1ETKA

The crystal structure of e. coli fis mutant q68a
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
90
structure length
75
Chain Sequence
DVLTVKPLRDSVKQALKNYFAQLVNDLYELVLAEVEQPLLDMVMAYTRGNQTRAALMMGINRGTLRKKLKKYGMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription activator
molecule keywords FACTOR FOR INVERSION STIMULATION
publication title Structural analysis of the transcriptional activation on Fis: crystal structures of six Fis mutants with different activation properties.
pubmed doi rcsb
source organism Escherichia coli
total genus 28
structure length 75
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1etkA00
3GTGJ 1ETWA 1DU0A 1WCMJ 2DMNA 1FEXA 1WPKA 2Y2ZA 5EZHA 1U78A 4UUSA 4D7NA 1ZKGA 3RZOJ 1TWFJ 2CQXA 1YRNA 1MH3A 2DA3A 5EGOA 4Y7NJ 4S0HB 2B63J 2JA6J 1RPWA 2AHQA 2CU7A 2AO9A 5F27A 4BBRJ 5C3EJ 4D7MA 2NS8A 4W97A 3A01B 2MG4A 1Z0XA 1OFCX 2DA5A 3Q3SA 5E3OA 4IHWA 1JUSA 5F08A 2DMTA 1HDDC 5FJ8J 2YUSA 3WHCA 5FKOA 1H8AC 1ZGWA 3LSJA 3FK6A 3ZQIA 3JRDA 1HCRA 1ETQA 2DTZA 4CYCB 3IH3A 2L9RA 1JKRC 2ME0A 1MH4A 5F0CA 3QQAA 2COBA 4M6VA 1T33A 4FE7A 4A3CJ 2EBIA 5GPAA 5K7FA 1P7IA 3A02A 1D5YA 4DYQA 3S14J 3BR3A 4C2MJ 1U9OA 4CYCA 2DA7A 1ETKA 4A3JJ 1MNMC 1MBHA 5C4JJ 3JR9A 2ECBA 3BG5A 1EF4A 5GPCA 1TWAJ 3LSPA 2M34A 3HOUJ 3GTLJ 5HODA 1JGGA 2LD5A 4M3GA 3SFIA 4FISA 4C3JJ 2E1OA 1X2MA 1RR7A 2LFBA 2X48A 4A3FJ 4X6AJ 3S1RJ 2LK2A 3IH2A 1S7EA 1BW6A 3HDDA 2L7FP 5EYRA 5GP9A 3BTLA 2E2HJ 1UHSA 5F04A 3O8GA 1H88C 1W0TA 1Z77A 4MO7A 1MSFC 2HOSA 2VPRA 3HOXJ 3GTPJ 4MIMA 3F0CA 5IOZA 1ZQ3P 3CDLA 2G0EA 4C3IJ 3M3YJ 1R9TJ 2LP0A 3PM1A 3RQIA 2EQRA 1APLC 2DJNA 5E3NA 1FIAA 4M3DA 3ZQGA 1FTZA 3HGGA 4FE4A 2JK3A 3BR0A 3JRCA 4FTHA 2Y9ZA 1AKHA 2GLOA 4IHYA 3S2HJ 2I10A 1ETXA 1RKTA 5IP9J 2M9HA 2EZKA 2L7ZA 3CQZJ 5FKKA 2L7MP 3QPLA 3HEFA 3NARA 2EH3A 3NAUA 2L0KA 1E3OC 4UUSB 5M5WJ 1YRNB 1HLVA 1HDPA 2DA4A 1QVTA 2O9LA 3K7AJ 5J1UA 5EGOB 2OF7A 3BR6A 4FCYA 3LSGA 2P81A 2FD5A 3DCFA 2VUMJ 1XG1A 2R93J 3GTKJ 2ME6A 1JKPC 3HBLA 3D1NI 1WGXA 3FIWA 4C3HJ 1B72A 4A3DJ 4A3BJ 1HOMA 2WB1N 4D5FA 3G1OA 1W0UA 3TW7A 1U9NA 5IOYA 1DU6A 4A3MJ 3O8HA 2M2EA 4JX4A 3LNQA 2NVTJ 1JTXA 5FLVA 3JRGA 1MBGA 2DMQA 2DN0A 3Q0UA 1MSEC 3G1LA 1GDTA 1WI3A 4GFBA 4BKXA 3FISA 2R5ZA 4ABZA 2CJJA 3SJMA 4BXXJ 3HOVJ 1IDZA 1OCTC 2ELKA 4M3EA 2Y0SN 4MFDA 3CMYA 2PMZN 1RESA 4BBSJ 4A3KJ 4IHVA 3S1NJ 1ZK8A 1JJ8C 3BT9A 1IDYA 5IP7J 1ETOA 2E19A 2KT0A 2M0CA 5FKMA 1FJLA 5IP6A 1ORKA 2LY9A 2K40A 3OIOA 2NVYJ 1LE8A 3S15J 2XB0X 2XGDA 4IHXA 4I76A 4A93J 3K2AA 5C4XJ 4IEJA 1JUMA 2HQ5A 1ZTRA 5DS9A 3ZQHA 5DTDA 3TW6A 5J3LA 2IAIA 5EG0A 2D5VA 4XRSG 1BJZA 3VPRA 2JA7J 1JKOC 3BG3A 4QSHA 1JT0A 1MBJA 1OJLA 4HNVA 4EEFG 3GTJJ 1B8IA 2IBDA 3H3VK 1K83J 3S17J 2K9NA 3BR5A 2HI3A 4XK4A 2XPUA 2XPVA 2GBYA 1AHDP 1TC3C 3B6CA 2XGEA 3OSFA 4AYBN 3PO2J 3W6VA 3ZQFA 2XB5A 3CCYA 3MN2A 4AC0A 4JX6A 2EZLA 1MBKA 1POGA 4XIDA 1NK2P 1GVDA 2DMUA 1ENHA 1TWHJ 1QPIA 2DA2A 1BA5A 1UG2A 3S1QJ 5M5XJ 2M8GX 2R5YA 2TCTA 3Q0VA 1AKHB 2MGQA 3BG9A 3H0GJ 4AUXA 2H8RA 5J1RA 3BTIA 1K61A 2MW8A 2VKEA 3HM5A 1SFOJ 1ITYA 5FLMJ 2JWTA 5FKLA 1IC8A 4W1UA 1VI0A 1OCPA 3SDGA 1JJ6C 2JA8J 5M5YJ 5EDNA 5M3MJ 5K7HA 4L5EA 1FTTA 3FKIJ 2WAQN 4XICA 2NVQJ 3BTCA 1LFUP 2GM4A 2YU9J 3MKLA 2EZIA 2LTPA 3L1PA 1B72B 2DMPA 3HKZN 2R92J 2JMWA 2RAEA 2HYJA 2XGCA 3BQYA 3BTJA 4DW6A 2JA5J 1GV2A 3ZQCA 1PUFA 3M4OJ 1Y1VJ 2TRTA 3LSRA 2R5ZB 3TEDA 2EZHA 2VI6A 1Q1VA 2IEKA 2YS9A 5IYCJ 4A3EJ 1F36A 1QRYA 2JN6A 2ID6A 1LFBA 5F1JA 1JT6A 3I4NJ 3C2BA 3GTMJ 2LKXA 2X6OA 4JP0A 5IYBJ 1VF9A 2DA1A 1LE8B 4A69C 1RKWA 4M3BA 2W48A 2HDDA 2QCOA 3DEWA 2VKVA 4B1RA 2DA6A 1XC5A 3ZOBA 5JLWA 3MVPA 3TP0A 5EG0B 2FQ4A 1IG7A 5IPAA 2LR8A 3JRAA 3HOYJ 3G1MA 3BR2A 4DYCA 3JREA 1T56A 1TWCJ 1IGNA 2NVXJ 3ZQLA 1F43A 2HOAA 1B8IB 2Y9YA 2Y31A 4RBOA 2LLKA 1IUFA 2XRLA 3S2DJ 2HXIA 5BNGA 3RKQA 1AU7A 2QF7A 4D5CA 1JTYA 2KDZA 1UMQA 4UUTA 2XSDC 1BL0A 4MLOA 4DZPA 3RZDJ 4DZJA 4X1EA 1A5JA 1IV6A 1NK3P 4A3IJ 3FK7A 4DYRA 1X58A 2CUFA 1IJWC 2X9DA 2WV1A 4JYKA 3HGYA 3A01A 1GV5A 3B6AA 3S1MJ 1G2HA 1H89C 2Y30A 2R5YB 2E2IJ 3IV5A 2ID3A 4XRMA 5J1YA 3GBGA 2OPTA 3OOUA 5F0HA 2CQQA 2H1KA 4MFEA 1U8BA 4V2FA 5EZGA 4Y52J 1RETA 5K7ZA 3HB9A 1IRZA 1JUPA 2R7ZJ 2ECCA 2LVSA 4BY7J 4B4CA 3BQZA 4QIWN 1FIPA 1GT0C 1I50J 1MBEA 3BR1A 9ANTA 1P7JA 5IYDJ 3GTQJ 5JLXA 5EF6A 4QTRA 1ZR4A 2CUEA 2R0QC 5E3MA 3HOZJ 2E2JJ 4A3LJ 1A6IA 4NDLA 1I6HJ 1Y1WJ 1VNDA 1X2NA 4G12A 2N8GA 1O4XA 3OSGA 5C44J 5M3FJ 1VFCA 1PUFB 4XRSA 4J19A 3PO3J 1QVUA 1TWGJ 2FX0A 2MSYA 3JRIA 4I6ZA 2NOGA 2ZB9A 1CQTA 2XPWA 1WH5A 3A03A 1ZR2A 3UKGA 1JKQC 4M3FA 2FJ1A 1I3QJ 2HXOA 3I4MJ 1ETYA 2HOTA 2K9SA 1XS9A 3S16J 1ETVA 1GUUA 3JRFA 1WH7A 3HOWJ 4LOCA 5F0FA 5FKNA 2K9QA 3IH4A 2NS7A 1NTCA 3TP3A 3WHBA 4B3AA 3Q0WA 1MBFA 3GTOJ 1BW5A 2O7OA 2O8KA 3LOCA 4BY1J 1HF0A 2JJ7A 5EEAA 1SANA 2CRGA 4JX5A 4A3GJ 3QPSA 4V2GA 3E7LA 4RDUA 3JRHA 5E3LA 3JRBA
chains in the Genus database with same CATH superfamily
2ZXHA 3GTGJ 1PP8F 1S5LC 1WCMJ 2E1MC 1IN6A 2FSWA 2D1HA 1WPKA 3JAMZ 2H6BA 1ZKGA 3RYRA 1LUJB 1ERDA 3FXUA 5LGUA 1HKQA 1TWFJ 3P9CA 3HPHA 4IHSA 2COMA 2CUZA 3L09A 2KMUA 1H9TA 3ZMDA 2WV0A 2PN6A 3I64A 2DQLA 3HXLA 3BZCA 3WU0A 4S0HB 2PEXA 4RM2A 3K9TA 1Y6IA 4NBQA 1ZLKA 2CU7A 1ZELA 3LAJA 4NC6A 3OYHA 3VB2A 5F27A 5BOXA 3IL2A 1I6XA 2NS8A 2V1UA 3N05A 2HDWA 1OFCX 2DA5A 3U9GA 2OUMA 5E3OA 3S3MA 1LQ1A 3KEQA 4IHWA 3EYYA 2BY0A 2V7FA 4F52A 3TO6A 1W7PB 1HDDC 1BOAA 3F22A 2YUSA 3WHCA 4KA4A 1H8AC 3LSJA 2HYFA 1OPCA 4AM3A 1O3TA 1W5CC 4MQ9F 3VDXA 5FFZA 1ETQA 2MD0A 3VYRB 2WAEA 4Y15A 3ISPA 2OD5A 2PX9A 2QGUA 2DDBA 5D5VB 5D6EA 3IH3A 2IGKA 5HDKA 4L5IA 4Q4ZF 1JKRC 1MH4A 4G94A 5ILSA 5J40A 1X1DA 2COBA 3DKXA 3KFWX 4M6VA 5FGMA 2H1LA 4B8XA 4A3CJ 5GPAA 5BQTA 3A02A 3FMRA 3ML6A 2EFWA 4DYQA 5E1XA 1SFKA 2QUFA 1U9OA 4C2MJ 3HL2A 1AWCA 4CYCA 4A0XA 4E4HA 4A3JJ 3DBLB 3GFLA 3ZN0A 1UFMA 2DPDA 3RKYA 1EF4A 4J01A 4HF0A 4RMNA 2Z9OA 2M34A 1R58A 1JGGA 5CVJA 2YU3A 5LRRA 3VYTB 2IVMA 3ZN1A 3IWZA 1MZBA 1NG6A 2LFBA 2JT1A 1BI0A 3S1RJ 2VQGA 5BMZA 2BBYA 1BW6A 1B4AA 3C7JA 5EYRA 3PFYA 5GP9A 5FB2A 2E2HJ 1QBJA 1SVOA 3WU1B 1A04A 3GYHX 5CPRB 2KQRA 5IT3A 1I39A 3ZPLA 1Z77A 2HOSA 3IAM2 1ZRDA 5CYVA 2VQLA 2F5CA 3CDLA 2VJIA 4C3IJ 2B9SA 3OIPA 3M3YJ 4A2UA 1XMAA 3SDBA 1T38A 1SC7A 2DJNA 1MD0A 1FIAA 3IRQA 2Z5UA 4FE4A 2CUJA 3JRCA 3DFGA 2Y9ZA 2L3DA 2GLOA 2I10A 2NNNA 3LA7A 1RKTA 1NG7A 3O3KA 3QWLA 5CVIA 1C0WA 2V1XA 4LB5A 5FKKA 4ZDPA 3QPLA 2E1MB 2LSOA 3HEFA 3RYPA 3NARA 1X3WB 3K1PA 3K1NA 4MHGA 3F8MA 3TMOA 1X1PA 1VQ9I 1YRNB 1PYVA 2DA4A 1HLVA 2O9LA 3HSRA 2X1CA 2OF7A 2CFOA 3LSGA 2P81A 3UR3C 1QHHD 2KL4A 2OA4A 1XSXA 2KRFA 3HRUA 2VUMJ 3PUFA 3CLOA 4N4NB 4BQAA 4ANJA 2AS5F 1OCCH 1DPUA 2AXTC 3FXMA 4C3HJ 4IQ4A 4A3DJ 4A3BJ 2WB1N 1MMSA 4XMYA 1UELB 5CJ9A 5JI6A 3E6BA 4IL6C 3OWTA 2ZO4A 1PP7U 2JPBA 4JX4A 3GFIA 4ZC3A 4S04A 2XAJA 1WHUA 5FLVA 3JRGA 5DM7F 4U0WA 2K9LA 3F6VA 1SD6A 1GDTA 1WI3A 1XN7A 2FUG2 2HQNA 1G3SA 3F9KA 3QPTA 4XORA 2R5ZA 4EM0B 3SJMA 1OCTC 2ELKA 2Y0SN 4A0ZA 3BDDA 2A07F 4E7SA 1G3WA 1OKRA 2K7LA 4PFPA 3CMAI 4N0BA 1GHCA 4PFOA 1MMDA 5EEHA 4PJNA 5L3DA 2ZJ2A 1WWXA 2MLGA 2M0CA 1X4PA 2J5PA 5FKMA 3U1KA 1XCVA 3OIOA 2K40A 1LE8A 2HZTA 4I76A 1F1ZA 3LA3A 4MQVA 2E7WA 1BIAA 1ZTRA 1KZHA 1WJCA 3ZQHA 3BPXA 4EJOA 5DTDA 2R7TA 1YW9A 5EG0A 2D5VA 2Q2EA 4G6QA 3PIPF 4BJTA 2JA7J 4IOAF 1HQCA 1JKOC 1WKMA 3IKTA 2RN7A 3Q9VA 1JT0A 1MBJA 4Q48A 3GTJJ 2EB7A 1K83J 1SEUA 4KISA 4L9TA 1LEBA 2QVOA 4BDZA 2GBYA 5E8IA 4P1WA 3IUOA 3C3WA 1N25A 2R7OA 2ZXJA 4I98B 4OAYA 4AYBN 2E36A 3W6VA 3RTRA 2K02A 4JX6A 3U21A 4U0VA 1POGA 1CF7B 2QBYB 3R6SA 1U5TC 1ENHA 5E79C 5J8FA 1QPIA 3J7YJ 2L02A 2DA2A 1KQ9A 1Z21A 1ON1A 3S93A 2BVMA 1LDKB 1OYWA 3K2ZA 3H5RA 2ACJA 4HPQA 2QZ8A 1P6RA 2FBIA 3H9JA 3H0GJ 3CJNA 1IZ1A 1D8KA 2VKEA 1K61A 3HRSA 2P5KA 4M74A 3ZP5A 5FKLA 3VEPA 2GQQA 2RC4A 3KIOA 4XLHA 4EJUA 1J9IA 2EK5A 5F64A 3OS0A 2IA1A 1R00A 3RSNA 2F5DA 2WAQN 3NQOA 2FMYA 2JZYA 4XICA 2NVQJ 4RGUA 2GM4A 2R4GA 5L3GA 2E1CA 2KJCA 3L1PA 3K4NA 3H3UA 3PNVA 2HDCA 2LNBA 1TLHB 4CCLA 3HKZN 2XIGA 2Z2SB 3K4JA 2PJPA 2RAEA 4IO9F 5K5OA 1TQIA 5DCFA 1T98A 1ONVA 2Z3YA 1R1VA 1OR7C 3IKVA 4CCJA 4E7JA 2CW7A 4U7DA 3M4OJ 3HTUA 1R1UA 4EMSA 2HVQA 3ZMUA 4MTEA 2IEKA 2YS9A 4OMYA 4PSWA 2XF7A 2M5WA 4CYDA 1F36A 1FP2A 1FLIA 2JN6A 1S8NA 5F1JA 1D1CA 3C2BA 2F6CA 3F8CA 3GTMJ 2LKXA 2Y69H 4M72A 2DLLA 1VF9A 3RIRA 3FM3A 2VBZA 4RB0A 3HSFA 3OYJA 3F8NA 3GX4X 2AXLA 3ZOBA 1XGMA 3MVPA 5IT9K 4UB8C 1YS6A 5IPAA 3JRAA 2VIXA 1K78B 1U6GA 2YX7A 1B6AA 2JRTA 2W24A 3BR2A 2VQCA 3CJQB 1SD7A 3KYCB 3K69A 1B8IB 4YFXF 5A2QZ 3CF5F 4BYYA 2R7XA 2LLKA 5EJCA 2XRLA 3MAJA 2HXIA 5J4YA 1AU7A 2MD5A 2QF7A 3T8TA 2FU4A 2Z1DA 5HLIA 3DBHB 1UMQA 2MA3A 2C6YA 4L0YB 3LA2A 5DCMB 4DZPA 4RS8A 2PMHA 4Y4RA 1NK3P 2BV6A 4A3IJ 1JGSA 1X58A 1SAUA 3HHGA 4KMFA 1V5FA 4NQWA 2IA2A 1SAXA 4BH9A 1U5TB 3SZPA 2GAUA 5CKTA 3A01A 3B6AA 4UVBA 1K4TA 4BHBA 2R5YB 4RA2A 2CV0A 1LDJA 3GBGA 1WSUA 5F0HA 1IW7F 4LLGF 1TTYA 4V2FA 1XGSA 2MC4A 2VODA 4CUGA 1J59A 2LYCA 3BQZA 4QIWN 3IHUA 2M7AA 1X19A 1IF1A 3AL0B 3L2VA 3AKZA 2VJ5A 3OYLA 5EF6A 3ZMVA 4UVAA 2L5QA 4DJAA 2R0QC 3ABUA 2JSPA 3GZNB 2E2JJ 1KA8A 3J7AY 3M9AA 5LHGA 3B73A 1Y1WJ 1VNDA 3BLYA 5HLHA 5LEKA 1X2NA 3L7WA 4H4KC 4G12A 3IP4B 1YW7A 3DKYA 4XLCA 4KIBA 3OSGA 5ICEA 3ZRGA 3EUHA 4J19A 3DEEA 3L2WA 1QVUA 4PZJA 5B3SH 5H6RA 1FY7A 2JQ7A 2F4IA 3LQQA 2FX0A 2BEOA 4QPOA 3J80Z 2HPIA 2NOGA 2ZJRF 1KYWA 2ZB9A 1OYIA 3S8PA 3HUGA 1IUYA 1JKQC 1ZRCA 2KHMA 3ELKA 2FJ1A 3I4MJ 1ETYA 5J47A 2UWMA 4NB5A 4B09A 3JAMK 1UB9A 2JPCA 2BY2A 4UVCA 1GUUA 4N9IA 3MZHA 1J2XA 4YFKF 4KIGA 1ZAOA 2QWWA 1YI2I 4MGRA 1T6SA 1VQ7I 1MBFA 5FLXK 3FXJA 1GVJA 3DU5A 4ZTFA 1N77A 4XLFA 1VQ6I 1O7LA 4PK4A 1W5TA 3QP6A 3VSLA 4PGGA 2NOJB 3V7CA 4JX5A 1T0FA 2UXNA 2XASA 3JRHA 5E3LA 2KIMA 4L5JA 2IT0A 3BOQA 1WJEA 2Z33A 5EZHA 4UUSA 2ISZA 3A0HC 1XTAA 3RZOJ 2VC0A 3REOA 2DFFA 1D5VA 2K9MA 2CQXA 2RDPA 2TDXA 2NAZA 5KNLA 1ZG3A 5EGOA 2VKDA 2B63J 1OISA 2AHQA 5ICGA 2EWNA 2LDUA 3DKWA 1S7OA 3PIOF 4BBRJ 1R23A 4BE2A 1XD7A 2CH0A 2MG4A 2XSJC 2O6GE 3CC4I 2M30A 2BY1A 2M0MA 3Q3SA 3L2CA 2R7UA 4OU0A 3WTZA 2PFBA 1EJ9A 4A5MA 4UY8I 2EILH 4XN3A 1O3SA 2UUZA 4AIHA 1EH8A 2WB1A 1J7KA 3ZQIA 1HCRA 2VC1A 3GF2A 2HU9A 3ZMSA 2EJRA 2DTZA 1S3JA 3W3CA 1EV7A 4CYCB 2HFHA 3KZIC 4HYEA 3CP2A 3I0TA 2L9RA 2DDAA 2JSCA 3DTIA 5F0CA 2E71A 2XC7A 1MDMB 3KYLA 3M8FA 5J4VA 2VONA 1P7IA 2W85A 2ZMEA 1E2XA 3GVAA 2KZVA 3MZYA 2RKHA 4O6JA 1SMTA 2YR2A 4P5OA 3S14J 2Y0SA 5LGNA 3JSPA 2LBFB 2V9KA 3SEQA 1ETKA 1FMVA 3GUDA 2M8EA 4EM1A 1U8RA 1XCBA 3OY9A 4Z6YA 5TGTA 1TWAJ 2DI3A 3GTLJ 2KIQA 2LD5A 5H2FC 1DP7P 2X51A 4LK1F 3FZVA 3BP8A 2O0YA 4HW0A 4Y33A 2OQRA 1RR7A 4BAYA 1QHGA 2F5EA 4A3FJ 2E1NA 4X6AJ 4HQEA 3IH2A 1F9NA 1S7EA 2VB6A 3MCZA 1QA6A 2BHYA 4ZYHA 2VQHA 3GCMA 3HDDA 4BHCA 2LKSA 3HOTA 1FYLA 3BTLA 4I02A 2ZSIB 3OL4A 5F04A 3O8GA 3HG9A 5CQGA 2QQBA 1YS7A 2VPRA 2DOEA 4HLYA 3KEOA 3AAFA 2ESNA 2HNHA 4IF4A 2FOKA 3HRTA 4Q5SF 5FRNA 2DT6A 4IRGA 2LP0A 3QOEA 3V7RA 5HLGA 5ILVA 2R7SA 3V7SA 4M3DA 3MKZA 3HGGA 1AOYA 4FTHA 1AKHA 1FT9A 4JBAA 2E7XA 1ETXA 3C1DA 2A6HF 2CG4A 4P9FA 3JSOA 3CQZJ 3HIFA 2ELJA 2L7MP 3CUQA 1KU7A 1D3YA 5KVRA 3VSKA 3NAUA 2EH3A 1BBYA 1E3OC 2WAFA 2W82A 2E5NA 1VTNC 1QO0D 2MH2A 5J1UA 3ROUA 3WG7H 2BXYA 3BR6A 4FCYA 2GIVA 2Q0OA 3T5XA 1XG1A 2QA4I 3D1NI 1B72A 2Q8KA 2O61A 1WJAA 3CCJI 4RAFA 4HQMA 3WTYC 2WAQA 3NWSA 2K4JA 3TW7A 3CCSI 1DU6A 2XUBA 1YITI 1WFXA 1SFUA 3KP3A 2M2EA 3LNQA 3V8KA 3RPUD 1B9NA 2X4HA 2DMQA 1ZARA 3FXOA 2XVCA 1W1WE 2CSOA 3IC7A 2VE8A 3FISA 1IDZA 1XSVA 4MFDA 2FEZA 1MNEA 1UJ8A 5LRSA 2PMZN 1P2FA 4RAGA 1RESA 1D0XA 2PJRB 2MFZA 2Q2EB 1LVAA 1QQIA 1ZK8A 4IHVA 3BT9A 5IP7J 1ETOA 1FBSA 2XAQA 1IXRC 3EUAA 2OZ6A 1R71A 4UV8A 4XLNF 2LY9A 2XGDA 2CV2A 1O57A 4IHXA 3K2AA 4A93J 5C4XJ 3WTTC 1XMXA 2HQ5A 3F6OA 4HSTA 5DS9A 1ZHFA 3EQLF 3MZ8A 2KLOA 3KLOA 5GAEJ 2YX4A 5J3LA 2R7DA 3Q9SA 3I55I 2P6TA 1IO2A 4F3QA 3RI4A 3TDZC 4HX8A 2JVHA 3KYDB 3H36A 2Y48A 4HNVA 2RREA 2A6EF 5B1BH 1IAWA 3BR5A 4YIRX 3S17J 1QPMA 5K1YA 1DQUA 5L3CA 2XPUA 2X6YA 1LVKA 4ON0A 1TC3C 3DPTA 3OV8A 1EKEA 5ICCA 4L0ZB 4PSXA 3PO2J 5E1ZB 3ZQFA 3P7NA 3CCYA 4GXOA 1E3PA 3WE3A 2F2EA 1HKTA 3H0DA 5E20A 3ZQ7A 3HRMA 1USTA 4JQFA 4EVIA 3IAS2 1S29A 2LMDA 1TWHJ 4HOBA 3TDUC 2WWYA 3K4MA 3M1CA 1BA5A 1UG2A 2Y0MA 1PVEA 2STWA 3Q0VA 3DPUA 4BUPA 4XOPA 5B1AH 3WTWC 1SVLA 3WTSC 5FLMJ 2LRDA 2M7BA 1IC8A 2WTEA 4W1UA 1JJ6C 5CQEA 2NRAC 3O6BB 5M3MJ 1T95A 5D5XB 5DM6F 2DFHA 3ZGKA 2LH9A 3E5UA 1MJAA 3IRRA 2H8WA 4ZH4F 1IN4A 5B5EC 2RV8A 1LEAA 3BTCA 1Z3YA 4CCMA 3B02A 4F55A 4UXNA 1KU2A 2LTPA 2V1NA 3F3XA 2QSFX 4M6XA 2EV6A 1VZ0A 2L4MA 2IS2A 3FMSA 2HYJA 4GYGA 5L3BA 4NNJA 2RGVA 4PJMA 2VLAA 3BQYA 3S3NA 1XGNA 3I59B 4DW6A 2ZNZA 3CC7I 1PUFA 1Z7UA 3HYIA 2R7QA 2XRNA 2LY2A 2ZFUA 1Y1VJ 2E5ZA 5HS7A 3PJRA 3I9V2 5DV5A 1O3QA 2JA2A 2VI6A 3BJ6A 4EQQA 3VOEA 3G4SI 4XKVA 2B7EA 3QYBA 3WTUC 2QSGX 5A2QK 5BPDA 2BXZA 2FOWA 1MMAA 4EATA 2ID6A 3CMEI 3BCAA 4KICA 3CLQA 4XLEA 2V79A 1B1BA 2LG4A 2X6OA 4JP0A 1RIOH 4G7ZF 5D8KB 1N75A 3COAC 3E5XA 2A5YB 3ABTA 2A69F 2QCOA 2ZKZA 1R6RA 2DYSH 2VKVA 4FX0A 3G6EI 3J81Z 3F8BA 4EGZA 2JVGA 4AIKA 2G9WA 3GWZA 2FBHA 4IXAA 2IA0A 4HG2A 4G6DA 2VXDA 4ESFA 5JHUA 3OYIA 1FZPB 4BEHA 1SFEA 1YQAA 1FPQA 4B43A 3MQ0A 2H94A 1TWCJ 2JRMA 2HOEA 3KZZA 5DD8A 4M9SA 2LREA 4WCGA 1R22A 3FF5A 4RGSA 1IN8A 1ZH5A 4HRIA 3WE2A 1RI7A 3OYFA 2IS4A 1IUFA 4PCQA 1TW3A 3RKQA 4LG0B 2V9VA 1KU9A 2EFQA 4ZYAA 4I0AA 4D5CA 4L9JA 2XSDC 3H1CA 3RZDJ 3BWGA 1VQMI 4B44A 1A5JA 2FXAA 1OCOH 2Q1ZB 3L2UA 1KYZA 4BHPA 2X9DA 3NEUA 4XRFA 1Q1HA 1ULYA 4JYKA 3S1MJ 4ZZLA 5FFXA 2EIKH 4O5VA 3DWLE 2E2IJ 2OCCH 4BJ5C 3MD2A 4CA0A 3ZR8X 3EUKL 3CO7C 5JVGF 3OOUA 1W7PA 4M9ZA 1G6NA 2ICWG 1E17A 2M4GA 5K7ZA 3HB9A 2KIUA 1IRZA 4UHTA 1D1AA 3SZTA 3DQVC 1PJRA 2R7ZJ 3OYDA 1P9QC 4BY7J 5E1WA 4BXFA 1OLTA 4L9VA 2P5LC 4Z2YA 4B4CA 1FIPA 3WODF 1GT0C 2B0LA 3BR1A 9ANTA 1YW8A 3J80K 3OL3A 3FMQA 2VASA 3AG3H 1UCRA 3OYGA 3GTQJ 4QTRA 2BW3B 1BC7C 2IS1A 4MNUA 2W7NA 3OYNA 2VBXA 2KDOA 2XGXA 2A05A 2G7UA 3BG6A 2DU9A 1VQNI 4HF2A 2EPFA 2VOOA 4R8HA 3K70D 1PUEE 2L01A 4RAYA 1QNTA 4CHUA 5M3FJ 3AL0C 2OAZA 4ZYGA 4XRSA 2HTSA 3SEZA 3PO3J 3RDIA 2L9NA 3KZYA 1HW5A 3EETA 3H5AA 4XOTA 2MSYA 2VN2A 3JRIA 1BR2A 1UG0A 3ASNH 4BXUA 1L3LA 1CQTA 2DCEA 3A03A 4HNTA 4QLCU 4OOIA 4ZTJA 3AG1H 2HS5A 4UNOA 2EIJH 3QYFA 3SFZA 4FETA 2CFXA 1XS9A 3ONQA 3S16J 4ZJZA 1SVMA 2ETHA 1B9MA 3JRFA 1IN7A 2QM3A 2UZKA 3HOWJ 1HW2A 1OYYA 1RRJA 1STZA 1CGPA 4MTDA 3TO7A 1AA7A 3TP3A 1SD4A 3MMYB 4B3AA 3Q0WA 1Y8QB 1IRGA 4DOZA 5EEAA 1UHWA 3DTKA 4PUSA 1HSTA 4A3GJ 3QPSA 3I71A 4V2GA 3DV8A 3E7LA 4RDUA 4C30A 2WY8Q 2WA0A 5HDNA 2QQ9A 3QODA 4BL0B 1DU0A 2DMNA 1FOWA 2Y2ZA 1Y8RB 4ZDLA 3T0YA 1U78A 2AQFA 4D7NA 3R0JA 3CO6C 4A0YA 3DLAA 2OJED 3IWFA 1YRNA 1Z6RA 1MH3A 2P0WA 3HSEA 2ADUA 1U0JA 2DA3A 5CVRA 1Z05A 1HSJA 1MJ9A 5D5WB 1RPWA 1P92A 3CCMI 2BOLA 3BCBA 4FX4A 2LKPA 2AO9A 3GFMA 1ZREA 4FT8A 2CW8A 4D7MA 4W97A 1Y56A 1BC8C 2I5UA 1Z0XA 4KMUX 1FOXA 3LSKA 5HVQC 4RLFA 3KPHA 5KK1A 2W57A 5JHFA 2K3FA 2DMTA 2P8TA 4CZCA 3H35A 5FKOA 1I27A 1IXSB 2DK8A 5GTIC 2D1VA 4CICA 4BDYA 1XSDA 4DGWB 5LHIA 5HS9A 4BQNA 2DW4A 2W1OA 2KP6A 5ICFA 1FBUA 3CF2A 2ME0A 3M8EA 1Y0NA 3QQAA 5FROA 3N97A 2EBIA 3TGNA 2RQQA 2NNYA 1D5YA 2IGNA 3DF8A 3QU6A 2KKOA 3JTHA 4KN4X 1S7AA 3BR3A 4HDUA 2K86A 2V9PA 4CZZA 3BPVA 2DTRA 3K70C 1LNWA 1MBHA 5C4JJ 3JR9A 1MNMC 2ECBA 3TQNA 3E0JB 2HZDA 3TOBA 5LBQA 3LSPA 5HODA 4WXDA 2BYVE 3S3OA 3SFIA 3X2QH 4FISA 4C3JJ 1VQLI 2XF6A 2FE3A 1X2MA 1YIJI 1K6YA 1Z9CA 4ENJA 1KQ0A 3BZKA 1BI3A 1QZYA 1OMIA 2OTJI 4E7ZA 4YIIA 2H27A 4M71A 4V19K 1HKSA 1UHSA 1M1EB 4UB6C 1H88C 1W0TA 4YFNF 2YSRA 2EFNA 4JOMA 1CF7A 4MIMA 3M8JA 2W25A 2VXZA 3Q5FA 2MYSA 1TP4A 1I5ZA 3CUQB 2G0EA 4Q47A 3O2PE 4CO8A 1ZLJA 5J8CA 3OYKA 1A35A 2EQRA 1APLC 5E3NA 3ZQGA 3BR0A 3L9FA 4CXFA 4YRVA 4IHYA 2GXBA 3CCQI 4II3A 2CQ7A 1DUXC 5IP9J 2M9HA 3PQKA 3HTSB 3OS1A 3FWEA 2GOMA 2EIMH 4LJZF 2L0KA 1QGPA 3LMMA 1K4SA 2OQGA 5EEGA 1J5YA 1E0EA 4L18B 5DEQA 3K7AJ 3D5RC 1W36D 4X0GA 2HGCA 2EA2A 4XKCA 1BIBA 4CCKA 3SXYA 1Z6TA 1YOVB 2F4OB 2M3AA 3DCFA 2DAOA 2FD5A 2K85A 4OWRB 1V55H 4RGRA 5CVUA 2ZXIA 1JKPC 4GO1A 4HAMA 1WGXA 3FIWA 2X1EA 1QU3A 3KP4A 3KP7A 4D5FA 3G1OA 5ILUA 3AG4H 4A6DA 4OINF 4C9YA 3WGGA 4EJWA 3N4MA 2L2OA 4P9UA 3OR1C 4G8XA 1U9NA 2F5FA 1IXCA 4XR6A 5F6FA 1SFXA 1FP1D 5LHHA 1MBGA 1OQYA 3GXOA 1F5TA 3Q0UA 1MSEC 1A6QA 3G1LA 1NH3A 3ERED 1L0OC 3QPHA 4BXXJ 3LSHA 2CJJA 4LD5A 1G4DA 1REPC 4BBSJ 3ZXSA 4A3KJ 4RGXA 3S1NJ 5DUIA 3OMYA 4WK8F 4AVZA 4IHTA 2E19A 3E6MA 3GZ5A 3CCVI 4OMZA 1ORKA 4OIRF 2A3SA 2XB0X 3WU2C 2MABA 2NYXA 4ETSA 2VJ4A 3K4LA 1RZ4A 4ENMA 3TW6A 2IAIA 3CUOA 4XRSG 1BJZA 3VPRA 1U3EM 4AVPA 4Y17A 1K78A 3NRVA 3U2RA 5HNHA 4HA8A 3V42A 1OJLA 5IT9Z 2RNGA 4EEFG 3WGIA 3VODA 2IBDA 1B8IA 3I3LA 1IRXA 1ZRFA 2YPRA 2GA1A 1F4KA 2HI3A 4GYIA 4G6TB 2JTVA 2KJBA 4KT6A 5HDGA 1AHDP 3B6CA 1JHHA 3OSFA 1U2WA 4BNCA 2FNPA 3KP5A 2XB5A 1ZG1A 3MN2A 2EZLA 3FKJA 4YIFA 1MBKA 5DCMA 2VT2A 4WXHA 1R5GA 4KIFA 1YJWI 1FX7A 1YG2A 2OV7A 1NK2P 5FO5A 2L54A 1U5TA 2VBWA 4MEYF 2MLKA 4CCOA 1BI1A 3S1QJ 1KGSA 2PLYA 1P4AA 3C2HA 2HEOA 4XQFA 2R5YA 2KRCA 2V6EA 5B66C 2FRHA 3BG9A 4AUXA 5J1RA 3BTIA 1Y0UA 2RQPA 2MW8A 3HM5A 1ITYA 1SFOJ 5H6QA 1DP3A 2DFIA 1WJ5A 3GLXA 2A5WA 3ERMA 1OCPA 2X6XA 4AYBA 5M5YJ 1W4MA 3KX2A 1W36C 4KDPA 4S05A 2ELHA 4IRHA 2DYRH 1TQMA 3JCUC 3OOPA 4BJ6C 3F8FA 5DDGA 3DPLC 3FKIJ 5FD6A 4HX4A 2CGPA 3HZJA 1XX5A 4BS9A 4N9HA 3G73A 3VWBA 1LFUP 4NUBA 3MKLA 3K0LA 1N78A 1MJBA 4LGWA 3K4KA 3I5UA 1OCRH 2DMPA 3OIQA 4DBQA 1O3RA 4PGHA 3CDHA 3DXJF 4HV5A 1TZLA 3DEUA 4WX9A 1VQPI 1HA8A 5LD2C 2X85A 3BTJA 3WGHA 4KJZA 1TNTA 2JA5J 1MMNA 3L2RA 1FOYA 1GV2A 1Y39A 1KQ8A 4BACA 1TT0A 1OR7A 2UXXA 4KN7X 4UV9A 4DBRA 3G3ZA 3GMEA 2TRTA 4XL9A 3LSRA 1TQPA 3W6JB 2R5ZB 1D0ZA 2EZHA 3ASOH 2EV0A 5IYCJ 2BHZA 2DT5A 5KCMA 3RJPA 3PUBA 4HEA2 3K10A 1JT6A 3QYEA 4OAZA 4WF2A 1LPQA 2P5VA 1DPRA 3HKZA 4MEXF 5FRMA 3FXRA 2GIZA 4EGYA 1ZN2A 2D2WA 3LSMA 4XM3A 3LAPA 3QRFF 2IXSA 1LE8B 4M9XA 3S32A 3MEXA 4A69C 1RKWA 4M3BA 2W48A 4RB3C 2HDDA 4D0PA 3DEWA 5L3EA 3ZMZA 4P55A 2AQEA 4KFCA 5EG0B 1YX3A 2DBBA 1WRJA 2FQ4A 4RM3A 1IG7A 4WXCA 5JR3A 1HW1A 3TKYA 3G1MA 4DYCA 3JREA 3DTEA 1IGNA 5FLXZ 4LIUA 2NVXJ 3ZQLA 4Y3OA 1F43A 2DFEA 5GTHC 2Y9YA 3G71I 3KEYA 4RBOA 3FXKA 3S2DJ 5BNGA 2IS6A 2PMUA 3HPGA 1WQ2A 3V4GA 3T1BA 2BVLA 1JTYA 5LGTA 2KDZA 1DDNA 1BL0A 1YTYA 4BE1A 1P4XA 4B3XA 4DZJA 1LDDA 1YIOA 1IV6A 4LITA 4E7HA 3FK7A 4QWQA 2CUFA 4DYRA 1IJWC 1PDNC 2H09A 1QZZA 2GA2A 1H9GA 2WV1A 2PQ8A 3HGYA 1V4RA 3JW4A 2Z16A 3K6GA 2Y30A 4GRIA 4K2EA 3IV5A 2R7VA 3CP8A 1YFHA 2HQAA 4ENKA 1X3UA 4LFUA 2CQQA 1Z91A 2H1KA 1R49A 2R7WA 1U8BA 2XF5A 4I2OA 3FHNA 2ESHA 4RLQA 2W00A 1G8XA 4M6YA 2ECCA 4I7HA 4HZFA 5F1RA 5D8LB 2D45A 3F72A 6PAXA 4BU2A 1MDMA 1MBEA 2FA5A 1FC3A 2NXNB 4QPQA 1P7JA 3ZCOA 1ZYRF 3KP2A 2XDVA 4G7HF 2K27A 5JLXA 3L2QA 2W84A 2ZC2A 1ZR4A 2VKHA 2CUEA 2IGMA 3CJTB 2LBFA 4G9YA 5H20A 1I6HJ 3A1YA 1XB4A 4EJTA 3LQRA 5K5QA 2QQAA 4NC7A 2HVRA 4OIQF 1SD5A 2E34A 1V5GA 3F23A 2XV4S 4XSZF 4RB2C 4HBLA 1VFCA 3EUHC 1WZ2A 3J7AO 3M7GA 4U87A 3CC2I 4RB1A 2CQNA 4CDGA 2HVSA 4D1QA 4U0YA 1JI8A 2ZJQF 4CSWA 1K7AA 4A5NA 2WY7Q 3SZGA 1UAAA 1ZR2A 1WH5A 3T8RA 1K79A 3ZQQA 4ZZDA 5BPIA 3W6KB 2HXOA 3TBIA 4NC8A 5TRDA 2HOTA 4XSXF 2VOPA 3BROA 1IN5A 1WH7A 2F5VA 4XLAA 3BC8A 4LOCA 5F0FA 5FKNA 2K9QA 2OC6A 2M4KA 2NS7A 3MKWB 1RUOA 4DQ2A 4O3MA 3GTOJ 4IPAA 2O7OA 1D1BA 3LOCA 3WG9A 5GAHJ 4BY1J 3L00A 4EJVA 3V8LA 1J09A 1WI9A 1SANA 5D6FA 1T0FC 4IX7A 3JRBA 3ABLH 1ETWA 3P9KA 1FEXA 4R79A 4IOCF 3FBIB 1Z3XA 3E5QA 2V4JC 4I99C 5HNFA 2BE5F 1TBXA 1VQ4I 2XKPA 4Y7NJ 2E35A 3PSIA 3F21A 1HC8A 2DOFA 3HHHA 2JA6J 3FXLA 4DIQA 4NQWB 2FMLA 2XAUA 5TISC 5C3EJ 3H5NA 3A01B 4CGZA 1MNDA 2IGOA 3H9GA 5HOOA 1EA3A 3OYEA 5BS6A 1G59A 2LF7A 1JUSA 5F08A 3VFZA 5FJ8J 4IRIA 2KRHA 1ZGWA 3FK6A 3JRDA 2LC2A 4LG3A 1RC9A 3E6CC 5DD4A 2M87A 2ZSHB 3TL4X 2OZUA 2M1BA 2GOXB 2K5CA 2IJLA 1T8IA 2CV1A 2EFOA 1LKXA 3GLLA 4DNCA 5LEJA 2PJRA 3AFHA 2RNJA 3G2BA 1X3ZB 4P96A 1T33A 4FE7A 1Z67A 3A4CA 2ZMEC 3LSIA 3RPQA 5K7FA 4ESJA 1R7JA 4GDFA 1BN5A 5TJJA 1X1BA 3D5SC 2XHKA 3EPZA 4HV6A 5LLQA 4NHJA 4OIOF 2DA7A 2P4WA 1IV8A 2NVUB 3BG5A 3C2GA 3ECHA 4BQOA 5GPCA 4PJ0C 3SYTA 1V5EA 2IPQX 3HOUJ 2QSHX 3H3ZA 2KISA 4M3GA 3CJRB 1YX5A 2E1OA 3QAHA 4HLXA 1XPXA 2X48A 1QZEA 4PJJA 2LK2A 4H0EA 3S2WA 1BR1A 3PL8A 2KPMA 2L7FP 1O7FA 2FBKA 3HUGB 2OTLI 3CMMA 3CD6I 4C2UA 1XMKA 4IJAA 3FHZA 2STTA 4ITVA 4MO7A 4B47A 1MSFC 3EYIA 3HOXJ 4ZYEA 3GTPJ 3F0CA 2JUGA 2LF8A 5IOZA 4F91B 2WADA 1ZQ3P 1YHQI 3V8JA 2ZJPF 2HKXA 2P6SA 1R9TJ 1R1TA 3PM1A 5AONA 3RQIA 4XLPF 4N4OB 1FTZA 3M07A 3LL7A 2JK3A 4ESBA 3S2HJ 5D5UB 4EM2A 5IY5H 4YEJA 3ABKH 2KIFA 4PDKA 2LY1A 3LWFA 3MKYB 2VL8A 2EZKA 2L7ZA 1YJ9I 1FSEA 4LB6B 1G3TA 3CUQC 4AIJA 1VQOI 3A2KA 2XROA 4HDVA 3OR2C 2XAGA 3RKWA 2QEXI 2HPMA 4UUSB 3JTGA 3ABMH 2L9VA 5M5WJ 3KP6A 4ZYDA 1A31A 1HDPA 2ZCWA 1QVTA 5E8GA 2L4AA 3CDIA 4F92B 1X4OA 2HWVA 5EGOB 2ZXWH 1MGTA 3BZ6A 5ED4A 2EA4A 2ZBKA 4XNFA 5CLSA 1YLFA 1Z7LA 3K4BA 3GTKJ 2R93J 1OCZH 3MWMA 4I01A 2ME6A 4R1HA 5LFAA 3OYMA 3HBLA 5FD5A 2F48A 3MFKA 1HOMA 2PI0A 3PNTA 1W0UA 3QOPA 3CCLI 3PNYA 2CQKA 4E7LA 2P7CB 1R4MB 3I59A 5IOYA 3FDYA 4A3MJ 3J7ZI 3O8HA 4HX7A 2NVTJ 1JTXA 2NS0A 3OS2A 4GCVA 2DN0A 5GADJ 1LJ9A 4GFBA 3KCCA 4BKXA 1W5SA 2LOOA 2F4MB 4F7ZA 4ABZA 4AU7A 3HOVJ 4M3EA 3ESWB 4AD9A 3CMYA 2P7VB 1FMWA 1XDSA 3R60A 4EV0A 1D8JA 1JJ8C 2V26A 1IDYA 2J5OA 1K6OA 1RUNA 2PBIA 2ZMEB 2HYGD 2KT0A 1JHFA 1TT5B 1FJLA 3LSTA 5IP6A 2NVYJ 3S15J 4A6EA 3PFIA 1YJNI 1BM9A 2L9SA 4IEJA 1JE8A 1JUMA 3I56I 5E17F 5JFRA 3D5LA 2WBMA 3W2AA 3D0SA 4KITB 2UV1A 1ACIA 3RKXA 1V3FA 3CCUI 3BG3A 4QSHA 4BQQA 3H3VK 1HXDA 1Z1DA 2BGCA 2M45A 2K9NA 2DPUA 2PMZA 1WVRA 1E3HA 3K4CA 2ISYA 2XPVA 4XK4A 5JVTA 2L7KA 2PG4A 4LG0A 2HKOA 3FXQA 2XGEA 3BJOA 1LB2A 1XDUA 1R4NB 4RAZA 4AC0A 4IQJA 2DODA 4FASD 2OBPA 1R5HA 4XIDA 2R7RA 1GVDA 2O8XA 2ZNYA 4J00A 2DMUA 2QLZA 3KLNA 3I54A 5GAGJ 1WJBA 4F93B 1ZGJA 3R0AA 4HSRA 1ON2A 5M5XJ 2M8GX 4UUVA 1MMGA 2TCTA 3GEZA 1AKHB 1NHAA 1UHMA 4HF1A 2MH9A 2XAHA 2MGQA 2H8RA 2MBFA 4WWCA 2QBYA 3DP7A 1DGRM 4IVNA 3VYSB 1GLNA 2DQRA 2FNAA 2JWTA 4I09A 1SMYF 1DGWY 1VI0A 1W7PD 4LIVA 3SDGA 3H9QA 2JA8J 5EDNA 3SQNA 5K7HA 2H6CA 4B48A 4G7OF 4XBFA 2VT3A 1S6LA 4L5EA 1FTTA 1TW2A 1MKMA 4Y13A 4D9JA 3KE2A 2EINH 3K1MA 1IRFA 2YU9J 2BW3A 3P5JA 2JUCA 4AWXB 1FYMA 2EZIA 5CVVA 1BR4A 2O03A 1B72B 2R92J 3WTXC 2JMWA 3A0BC 2XGCA 3BG7A 3RPUA 1GXPA 3LFKA 5DUKA 5K5RA 4YG2F 3ZQCA 1MIJA 3FBNB 1P4WA 1WJDA 2K3PA 3I4PA 2A68F 3CCEI 2R7FA 4XONA 2HQRA 3NWTA 2QKMB 3TEDA 1Q1VA 2Z99A 4L9NA 4KNYA 3UNGC 3HC7A 4E6KG 4ASNA 4A3EJ 1USSA 3DU6A 1LFPA 1QRYA 2DJIA 1LFBA 3W2VA 1BI2A 3I4NJ 1I3AA 3ZMTA 3SHFA 1D0YA 2A61A 1V54H 5IYBJ 2DA1A 1T08B 2K4BA 2EV5A 3M1EA 3E6DA 2IP2A 2GWRA 3ECOA 4B1RA 5JLWA 2DA6A 1XC5A 3GZ6A 3E97A 4FHTA 3TP0A 1GXQA 2CS3A 1VQ8I 2LR8A 3H92A 2QKLB 3HOYJ 3PSFA 4FQGA 1T56A 1T39A 1FOKA 2A6TA 1FSHA 2XAFA 2HOAA 4E7KA 1UZCA 3R4KA 4YELA 4CCNA 4U7BA 2KFDA 4XKBA 3P9IA 1I1SA 5AIQA 4U88A 2CW0F 2Y31A 2EFPA 3I58A 4I0BA 1ZGAA 3W2WA 4BGDA 1S72I 2MC3A 1EH6A 1XGOA 3ULQB 1JXSA 1X1CA 3CESA 3DBRB 1H0MA 2OU2A 2W4SA 4PJLA 1KONA 4ZDOA 4UUTA 2DO7A 2VJJA 2ZFWA 4MLOA 2BZTA 1A36A 2QQ8A 4X1EA 3FX3A 1TL8A 2DT7B 1R5ID 5HLTA 3DLLF 1ZG5A 2RVCA 3BJAA 4M73A 3U1DA 1GV5A 2CYYA 1G2HA 5KAFC 2CMPA 1H89C 2V1DA 1YO5C 4OIPF 2ID3A 2OCEA 4KUMA 5DYMA 4XRMA 3GO5A 3CZ6A 3PQJA 5J1YA 2OPTA 2HTJA 4XN0A 1TNSA 1YE9A 2VPLA 3FM5A 4MFEA 1FWZA 2Y75A 5EZGA 2DK5A 4Y52J 1R36A 1RR8C 1RETA 1HBXG 3I53A 3EDPA 1EH7A 3AG2H 1MW7A 1JUPA 1YYVA 2DOAA 3QP5A 4IZZA 2LVSA 5AIPA 1ODDA 1VQKI 2I8DA 1RNLA 1I50J 4HNUA 4KYWA 3CTAA 2IRFG 1BJAA 1FBQA 2V6CA 4IKFA 3QU3A 3OYBA 4E70A 1I1GA 5IYDJ 4AIDA 1B59A 2O3FA 4TV7A 3OYAA 5E3MA 3HOZJ 2X0LA 4A3LJ 1A6IA 5ERIA 2VBYA 4NDLA 3GFJA 4A12A 5D4SA 3TO9A 3HJEA 2O5RA 2R3SA 5HS8A 2N8GA 2HR3A 4JK1X 1O4XA 2GXGA 3E3VA 5C44J 3HOSA 2CWEA 3VYUB 1PUFB 2VE9A 1FYKA 5KAIC 2G7HA 1X1AA 3OYCA 1FNNA 4BE0A 3WTVC 1TWGJ 1J0RA 4XKWA 5E18F 3RQ4A 1WJFA 2KZGA 4I6ZA 2DXIA 2IW5A 3R61A 2X6WA 4KT5C 2XPWA 4LMYA 2X1DA 3UKGA 4LLLA 3BY6A 3GW2A 5KHDA 1VQ5I 4M3FA 1I3QJ 2K9SA 4II2A 3CCRI 3J81K 2FQ3A 1ETVA 1KU3A 3LFUA 3E1SA 2CO5A 2FF4A 3RCOA 4E7IA 3IH4A 5L3FA 1S9HA 1NTCA 5D4RA 4LK0F 3WHBA 5J6XA 1BW5A 2BY3A 2O8KA 3TOAA 2QYOA 1HF0A 2XKOA 2JJ7A 4ENNA 1BOBA 1G3YA 2GZWA 4GGGA 4LLNA 2WC2A 2E60A 4BEHB 1J75A 2CRGA 3C18A 2GXAA 2QENA 4CH7A 4C2TA 1T2KA 3KETA
chains in the Genus database with same CATH topology
3GTGJ 1ETWA 1DU0A 1WCMJ 2DMNA 1FEXA 1WPKA 2Y2ZA 5EZHA 1U78A 4UUSA 4D7NA 1ZKGA 3RZOJ 1TWFJ 2CQXA 1YRNA 1MH3A 2DA3A 5EGOA 4Y7NJ 4S0HB 2B63J 2JA6J 1RPWA 2AHQA 2CU7A 2AO9A 5F27A 4BBRJ 5C3EJ 4D7MA 2NS8A 4W97A 3A01B 2MG4A 1Z0XA 1OFCX 2DA5A 3Q3SA 5E3OA 4IHWA 1JUSA 5F08A 2DMTA 1HDDC 5FJ8J 2YUSA 3WHCA 5FKOA 1H8AC 1ZGWA 3LSJA 3FK6A 3ZQIA 3JRDA 1HCRA 1ETQA 2DTZA 4CYCB 3IH3A 2L9RA 1JKRC 2ME0A 1MH4A 5F0CA 3QQAA 2COBA 4M6VA 1T33A 4FE7A 4A3CJ 2EBIA 5GPAA 5K7FA 1P7IA 3A02A 1D5YA 4DYQA 3S14J 3BR3A 4C2MJ 1U9OA 4CYCA 2DA7A 1ETKA 4A3JJ 1MNMC 1MBHA 5C4JJ 3JR9A 2ECBA 3BG5A 1EF4A 5GPCA 1TWAJ 3LSPA 2M34A 3HOUJ 3GTLJ 5HODA 1JGGA 2LD5A 4M3GA 3SFIA 4FISA 4C3JJ 2E1OA 1X2MA 1RR7A 2LFBA 2X48A 4A3FJ 4X6AJ 3S1RJ 2LK2A 3IH2A 1S7EA 1BW6A 3HDDA 2L7FP 5EYRA 5GP9A 3BTLA 2E2HJ 1UHSA 5F04A 3O8GA 1H88C 1W0TA 1Z77A 4MO7A 1MSFC 2HOSA 2VPRA 3HOXJ 3GTPJ 4MIMA 3F0CA 5IOZA 1ZQ3P 3CDLA 2G0EA 4C3IJ 3M3YJ 1R9TJ 2LP0A 3PM1A 3RQIA 2EQRA 1APLC 2DJNA 5E3NA 1FIAA 4M3DA 3ZQGA 1FTZA 3HGGA 4FE4A 2JK3A 3BR0A 3JRCA 4FTHA 2Y9ZA 1AKHA 2GLOA 4IHYA 3S2HJ 2I10A 1ETXA 1RKTA 5IP9J 2M9HA 2EZKA 2L7ZA 3CQZJ 5FKKA 2L7MP 3QPLA 3HEFA 3NARA 2EH3A 3NAUA 2L0KA 1E3OC 4UUSB 5M5WJ 1YRNB 1HLVA 1HDPA 2DA4A 1QVTA 2O9LA 3K7AJ 5J1UA 5EGOB 2OF7A 3BR6A 4FCYA 3LSGA 2P81A 2FD5A 3DCFA 2VUMJ 1XG1A 2R93J 3GTKJ 2ME6A 1JKPC 3HBLA 3D1NI 1WGXA 3FIWA 4C3HJ 1B72A 4A3DJ 4A3BJ 1HOMA 2WB1N 4D5FA 3G1OA 1W0UA 3TW7A 1U9NA 5IOYA 1DU6A 4A3MJ 3O8HA 2M2EA 4JX4A 3LNQA 2NVTJ 1JTXA 5FLVA 3JRGA 1MBGA 2DMQA 2DN0A 3Q0UA 1MSEC 3G1LA 1GDTA 1WI3A 4GFBA 4BKXA 3FISA 2R5ZA 4ABZA 2CJJA 3SJMA 4BXXJ 3HOVJ 1IDZA 1OCTC 2ELKA 4M3EA 2Y0SN 4MFDA 3CMYA 2PMZN 1RESA 4BBSJ 4A3KJ 4IHVA 3S1NJ 1ZK8A 1JJ8C 3BT9A 1IDYA 5IP7J 1ETOA 2E19A 2KT0A 2M0CA 5FKMA 1FJLA 5IP6A 1ORKA 2LY9A 2K40A 3OIOA 2NVYJ 1LE8A 3S15J 2XB0X 2XGDA 4IHXA 4I76A 4A93J 3K2AA 5C4XJ 4IEJA 1JUMA 2HQ5A 1ZTRA 5DS9A 3ZQHA 5DTDA 3TW6A 5J3LA 2IAIA 5EG0A 2D5VA 4XRSG 1BJZA 3VPRA 2JA7J 1JKOC 3BG3A 4QSHA 1JT0A 1MBJA 1OJLA 4HNVA 4EEFG 3GTJJ 1B8IA 2IBDA 3H3VK 1K83J 3S17J 2K9NA 3BR5A 2HI3A 4XK4A 2XPUA 2XPVA 2GBYA 1AHDP 1TC3C 3B6CA 2XGEA 3OSFA 4AYBN 3PO2J 3W6VA 3ZQFA 2XB5A 3CCYA 3MN2A 4AC0A 4JX6A 2EZLA 1MBKA 1POGA 4XIDA 1NK2P 1GVDA 2DMUA 1ENHA 1TWHJ 1QPIA 2DA2A 1BA5A 1UG2A 3S1QJ 5M5XJ 2M8GX 2R5YA 2TCTA 3Q0VA 1AKHB 2MGQA 3BG9A 3H0GJ 4AUXA 2H8RA 5J1RA 3BTIA 1K61A 2MW8A 2VKEA 3HM5A 1SFOJ 1ITYA 5FLMJ 2JWTA 5FKLA 1IC8A 4W1UA 1VI0A 1OCPA 3SDGA 1JJ6C 2JA8J 5M5YJ 5EDNA 5M3MJ 5K7HA 4L5EA 1FTTA 3FKIJ 2WAQN 4XICA 2NVQJ 3BTCA 1LFUP 2GM4A 2YU9J 3MKLA 2EZIA 2LTPA 3L1PA 1B72B 2DMPA 3HKZN 2R92J 2JMWA 2RAEA 2HYJA 2XGCA 3BQYA 3BTJA 4DW6A 2JA5J 1GV2A 3ZQCA 1PUFA 3M4OJ 1Y1VJ 2TRTA 3LSRA 2R5ZB 3TEDA 2EZHA 2VI6A 1Q1VA 2IEKA 2YS9A 5IYCJ 4A3EJ 1F36A 1QRYA 2JN6A 2ID6A 1LFBA 5F1JA 1JT6A 3I4NJ 3C2BA 3GTMJ 2LKXA 2X6OA 4JP0A 5IYBJ 1VF9A 2DA1A 1LE8B 4A69C 1RKWA 4M3BA 2W48A 2HDDA 2QCOA 3DEWA 2VKVA 4B1RA 2DA6A 1XC5A 3ZOBA 5JLWA 3MVPA 3TP0A 5EG0B 2FQ4A 1IG7A 5IPAA 2LR8A 3JRAA 3HOYJ 3G1MA 3BR2A 4DYCA 3JREA 1T56A 1TWCJ 1IGNA 2NVXJ 3ZQLA 1F43A 2HOAA 1B8IB 2Y9YA 2Y31A 4RBOA 2LLKA 1IUFA 2XRLA 3S2DJ 2HXIA 5BNGA 3RKQA 1AU7A 2QF7A 4D5CA 1JTYA 2KDZA 1UMQA 4UUTA 2XSDC 1BL0A 4MLOA 4DZPA 3RZDJ 4DZJA 4X1EA 1A5JA 1IV6A 1NK3P 4A3IJ 3FK7A 4DYRA 1X58A 2CUFA 1IJWC 2X9DA 2WV1A 4JYKA 3HGYA 3A01A 1GV5A 3B6AA 3S1MJ 1G2HA 1H89C 2Y30A 2R5YB 2E2IJ 3IV5A 2ID3A 4XRMA 5J1YA 3GBGA 2OPTA 3OOUA 5F0HA 2CQQA 2H1KA 4MFEA 1U8BA 4V2FA 5EZGA 4Y52J 1RETA 5K7ZA 3HB9A 1IRZA 1JUPA 2R7ZJ 2ECCA 2LVSA 4BY7J 4B4CA 3BQZA 4QIWN 1FIPA 1GT0C 1I50J 1MBEA 3BR1A 9ANTA 1P7JA 5IYDJ 3GTQJ 5JLXA 5EF6A 4QTRA 1ZR4A 2CUEA 2R0QC 5E3MA 3HOZJ 2E2JJ 4A3LJ 1A6IA 4NDLA 1I6HJ 1Y1WJ 1VNDA 1X2NA 4G12A 2N8GA 1O4XA 3OSGA 5C44J 5M3FJ 1VFCA 1PUFB 4XRSA 4J19A 3PO3J 1QVUA 1TWGJ 2FX0A 2MSYA 3JRIA 4I6ZA 2NOGA 2ZB9A 1CQTA 2XPWA 1WH5A 3A03A 1ZR2A 3UKGA 1JKQC 4M3FA 2FJ1A 1I3QJ 2HXOA 3I4MJ 1ETYA 2HOTA 2K9SA 1XS9A 3S16J 1ETVA 1GUUA 3JRFA 1WH7A 3HOWJ 4LOCA 5F0FA 5FKNA 2K9QA 3IH4A 2NS7A 1NTCA 3TP3A 3WHBA 4B3AA 3Q0WA 1MBFA 3GTOJ 1BW5A 2O7OA 2O8KA 3LOCA 4BY1J 1HF0A 2JJ7A 5EEAA 1SANA 2CRGA 4JX5A 4A3GJ 3QPSA 4V2GA 3E7LA 4RDUA 3JRHA 5E3LA 3JRBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTG J;  1ETW A;  1DU0 A;  1WCM J;  2DMN A;  1FEX A;  1WPK A;  2Y2Z A;  5EZH A;  1U78 A;  4UUS A;  4D7N A;  1ZKG A;  3RZO J;  1TWF J;  2CQX A;  1YRN A;  1MH3 A;  2DA3 A;  5EGO A;  4Y7N J;  4S0H B;  2B63 J;  2JA6 J;  1RPW A;  2AHQ A;  2CU7 A;  2AO9 A;  5F27 A;  4BBR J;  5C3E J;  4D7M A;  2NS8 A;  4W97 A;  3A01 B;  2MG4 A;  1Z0X A;  1OFC X;  2DA5 A;  3Q3S A;  5E3O A;  4IHW A;  1JUS A;  5F08 A;  2DMT A;  1HDD C;  5FJ8 J;  2YUS A;  3WHC A;  5FKO A;  1H8A C;  1ZGW A;  3LSJ A;  3FK6 A;  3ZQI A;  3JRD A;  1HCR A;  1ETQ A;  2DTZ A;  4CYC B;  3IH3 A;  2L9R A;  1JKR C;  2ME0 A;  1MH4 A;  5F0C A;  3QQA A;  2COB A;  4M6V A;  1T33 A;  4FE7 A;  4A3C J;  2EBI A;  5GPA A;  5K7F A;  1P7I A;  3A02 A;  1D5Y A;  4DYQ A;  3S14 J;  3BR3 A;  4C2M J;  1U9O A;  4CYC A;  2DA7 A;  1ETK A;  4A3J J;  1MNM C;  1MBH A;  5C4J J;  3JR9 A;  2ECB A;  3BG5 A;  1EF4 A;  5GPC A;  1TWA J;  3LSP A;  2M34 A;  3HOU J;  3GTL J;  5HOD A;  1JGG A;  2LD5 A;  4M3G A;  3SFI A;  4FIS A;  4C3J J;  2E1O A;  1X2M A;  1RR7 A;  2LFB A;  2X48 A;  4A3F J;  4X6A J;  3S1R J;  2LK2 A;  3IH2 A;  1S7E A;  1BW6 A;  3HDD A;  2L7F P;  5EYR A;  5GP9 A;  3BTL A;  2E2H J;  1UHS A;  5F04 A;  3O8G A;  1H88 C;  1W0T A;  1Z77 A;  4MO7 A;  1MSF C;  2HOS A;  2VPR A;  3HOX J;  3GTP J;  4MIM A;  3F0C A;  5IOZ A;  1ZQ3 P;  3CDL A;  2G0E A;  4C3I J;  3M3Y J;  1R9T J;  2LP0 A;  3PM1 A;  3RQI A;  2EQR A;  1APL C;  2DJN A;  5E3N A;  1FIA A;  4M3D A;  3ZQG A;  1FTZ A;  3HGG A;  4FE4 A;  2JK3 A;  3BR0 A;  3JRC A;  4FTH A;  2Y9Z A;  1AKH A;  2GLO A;  4IHY A;  3S2H J;  2I10 A;  1ETX A;  1RKT A;  5IP9 J;  2M9H A;  2EZK A;  2L7Z A;  3CQZ J;  5FKK A;  2L7M P;  3QPL A;  3HEF A;  3NAR A;  2EH3 A;  3NAU A;  2L0K A;  1E3O C;  4UUS B;  5M5W J;  1YRN B;  1HLV A;  1HDP A;  2DA4 A;  1QVT A;  2O9L A;  3K7A J;  5J1U A;  5EGO B;  2OF7 A;  3BR6 A;  4FCY A;  3LSG A;  2P81 A;  2FD5 A;  3DCF A;  2VUM J;  1XG1 A;  2R93 J;  3GTK J;  2ME6 A;  1JKP C;  3HBL A;  3D1N I;  1WGX A;  3FIW A;  4C3H J;  1B72 A;  4A3D J;  4A3B J;  1HOM A;  2WB1 N;  4D5F A;  3G1O A;  1W0U A;  3TW7 A;  1U9N A;  5IOY A;  1DU6 A;  4A3M J;  3O8H A;  2M2E A;  4JX4 A;  3LNQ A;  2NVT J;  1JTX A;  5FLV A;  3JRG A;  1MBG A;  2DMQ A;  2DN0 A;  3Q0U A;  1MSE C;  3G1L A;  1GDT A;  1WI3 A;  4GFB A;  4BKX A;  3FIS A;  2R5Z A;  4ABZ A;  2CJJ A;  3SJM A;  4BXX J;  3HOV J;  1IDZ A;  1OCT C;  2ELK A;  4M3E A;  2Y0S N;  4MFD A;  3CMY A;  2PMZ N;  1RES A;  4BBS J;  4A3K J;  4IHV A;  3S1N J;  1ZK8 A;  1JJ8 C;  3BT9 A;  1IDY A;  5IP7 J;  1ETO A;  2E19 A;  2KT0 A;  2M0C A;  5FKM A;  1FJL A;  5IP6 A;  1ORK A;  2LY9 A;  2K40 A;  3OIO A;  2NVY J;  1LE8 A;  3S15 J;  2XB0 X;  2XGD A;  4IHX A;  4I76 A;  4A93 J;  3K2A A;  5C4X J;  4IEJ A;  1JUM A;  2HQ5 A;  1ZTR A;  5DS9 A;  3ZQH A;  5DTD A;  3TW6 A;  5J3L A;  2IAI A;  5EG0 A;  2D5V A;  4XRS G;  1BJZ A;  3VPR A;  2JA7 J;  1JKO C;  3BG3 A;  4QSH A;  1JT0 A;  1MBJ A;  1OJL A;  4HNV A;  4EEF G;  3GTJ J;  1B8I A;  2IBD A;  3H3V K;  1K83 J;  3S17 J;  2K9N A;  3BR5 A;  2HI3 A;  4XK4 A;  2XPU A;  2XPV A;  2GBY A;  1AHD P;  1TC3 C;  3B6C A;  2XGE A;  3OSF A;  4AYB N;  3PO2 J;  3W6V A;  3ZQF A;  2XB5 A;  3CCY A;  3MN2 A;  4AC0 A;  4JX6 A;  2EZL A;  1MBK A;  1POG A;  4XID A;  1NK2 P;  1GVD A;  2DMU A;  1ENH A;  1TWH J;  1QPI A;  2DA2 A;  1BA5 A;  1UG2 A;  3S1Q J;  5M5X J;  2M8G X;  2R5Y A;  2TCT A;  3Q0V A;  1AKH B;  2MGQ A;  3BG9 A;  3H0G J;  4AUX A;  2H8R A;  5J1R A;  3BTI A;  1K61 A;  2MW8 A;  2VKE A;  3HM5 A;  1SFO J;  1ITY A;  5FLM J;  2JWT A;  5FKL A;  1IC8 A;  4W1U A;  1VI0 A;  1OCP A;  3SDG A;  1JJ6 C;  2JA8 J;  5M5Y J;  5EDN A;  5M3M J;  5K7H A;  4L5E A;  1FTT A;  3FKI J;  2WAQ N;  4XIC A;  2NVQ J;  3BTC A;  1LFU P;  2GM4 A;  2YU9 J;  3MKL A;  2EZI A;  2LTP A;  3L1P A;  1B72 B;  2DMP A;  3HKZ N;  2R92 J;  2JMW A;  2RAE A;  2HYJ A;  2XGC A;  3BQY A;  3BTJ A;  4DW6 A;  2JA5 J;  1GV2 A;  3ZQC A;  1PUF A;  3M4O J;  1Y1V J;  2TRT A;  3LSR A;  2R5Z B;  3TED A;  2EZH A;  2VI6 A;  1Q1V A;  2IEK A;  2YS9 A;  5IYC J;  4A3E J;  1F36 A;  1QRY A;  2JN6 A;  2ID6 A;  1LFB A;  5F1J A;  1JT6 A;  3I4N J;  3C2B A;  3GTM J;  2LKX A;  2X6O A;  4JP0 A;  5IYB J;  1VF9 A;  2DA1 A;  1LE8 B;  4A69 C;  1RKW A;  4M3B A;  2W48 A;  2HDD A;  2QCO A;  3DEW A;  2VKV A;  4B1R A;  2DA6 A;  1XC5 A;  3ZOB A;  5JLW A;  3MVP A;  3TP0 A;  5EG0 B;  2FQ4 A;  1IG7 A;  5IPA A;  2LR8 A;  3JRA A;  3HOY J;  3G1M A;  3BR2 A;  4DYC A;  3JRE A;  1T56 A;  1TWC J;  1IGN A;  2NVX J;  3ZQL A;  1F43 A;  2HOA A;  1B8I B;  2Y9Y A;  2Y31 A;  4RBO A;  2LLK A;  1IUF A;  2XRL A;  3S2D J;  2HXI A;  5BNG A;  3RKQ A;  1AU7 A;  2QF7 A;  4D5C A;  1JTY A;  2KDZ A;  1UMQ A;  4UUT A;  2XSD C;  1BL0 A;  4MLO A;  4DZP A;  3RZD J;  4DZJ A;  4X1E A;  1A5J A;  1IV6 A;  1NK3 P;  4A3I J;  3FK7 A;  4DYR A;  1X58 A;  2CUF A;  1IJW C;  2X9D A;  2WV1 A;  4JYK A;  3HGY A;  3A01 A;  1GV5 A;  3B6A A;  3S1M J;  1G2H A;  1H89 C;  2Y30 A;  2R5Y B;  2E2I J;  3IV5 A;  2ID3 A;  4XRM A;  5J1Y A;  3GBG A;  2OPT A;  3OOU A;  5F0H A;  2CQQ A;  2H1K A;  4MFE A;  1U8B A;  4V2F A;  5EZG A;  4Y52 J;  1RET A;  5K7Z A;  3HB9 A;  1IRZ A;  1JUP A;  2R7Z J;  2ECC A;  2LVS A;  4BY7 J;  4B4C A;  3BQZ A;  4QIW N;  1FIP A;  1GT0 C;  1I50 J;  1MBE A;  3BR1 A;  9ANT A;  1P7J A;  5IYD J;  3GTQ J;  5JLX A;  5EF6 A;  4QTR A;  1ZR4 A;  2CUE A;  2R0Q C;  5E3M A;  3HOZ J;  2E2J J;  4A3L J;  1A6I A;  4NDL A;  1I6H J;  1Y1W J;  1VND A;  1X2N A;  4G12 A;  2N8G A;  1O4X A;  3OSG A;  5C44 J;  5M3F J;  1VFC A;  1PUF B;  4XRS A;  4J19 A;  3PO3 J;  1QVU A;  1TWG J;  2FX0 A;  2MSY A;  3JRI A;  4I6Z A;  2NOG A;  2ZB9 A;  1CQT A;  2XPW A;  1WH5 A;  3A03 A;  1ZR2 A;  3UKG A;  1JKQ C;  4M3F A;  2FJ1 A;  1I3Q J;  2HXO A;  3I4M J;  1ETY A;  2HOT A;  2K9S A;  1XS9 A;  3S16 J;  1ETV A;  1GUU A;  3JRF A;  1WH7 A;  3HOW J;  4LOC A;  5F0F A;  5FKN A;  2K9Q A;  3IH4 A;  2NS7 A;  1NTC A;  3TP3 A;  3WHB A;  4B3A A;  3Q0W A;  1MBF A;  3GTO J;  1BW5 A;  2O7O A;  2O8K A;  3LOC A;  4BY1 J;  1HF0 A;  2JJ7 A;  5EEA A;  1SAN A;  2CRG A;  4JX5 A;  4A3G J;  3QPS A;  4V2G A;  3E7L A;  4RDU A;  3JRH A;  5E3L A;  3JRB A; 
#chains in the Genus database with same CATH topology
 2ZXH A;  3GTG J;  1PP8 F;  1S5L C;  1WCM J;  2E1M C;  1IN6 A;  2FSW A;  2D1H A;  1WPK A;  3JAM Z;  2H6B A;  1ZKG A;  3RYR A;  1LUJ B;  1ERD A;  3FXU A;  5LGU A;  1HKQ A;  1TWF J;  3P9C A;  3HPH A;  4IHS A;  2COM A;  2CUZ A;  3L09 A;  2KMU A;  1H9T A;  3ZMD A;  2WV0 A;  2PN6 A;  3I64 A;  2DQL A;  3HXL A;  3BZC A;  3WU0 A;  4S0H B;  2PEX A;  4RM2 A;  3K9T A;  1Y6I A;  4NBQ A;  1ZLK A;  2CU7 A;  1ZEL A;  3LAJ A;  4NC6 A;  3OYH A;  3VB2 A;  5F27 A;  5BOX A;  3IL2 A;  1I6X A;  2NS8 A;  2V1U A;  3N05 A;  2HDW A;  1OFC X;  2DA5 A;  3U9G A;  2OUM A;  5E3O A;  3S3M A;  1LQ1 A;  3KEQ A;  4IHW A;  3EYY A;  2BY0 A;  2V7F A;  4F52 A;  3TO6 A;  1W7P B;  1HDD C;  1BOA A;  3F22 A;  2YUS A;  3WHC A;  4KA4 A;  1H8A C;  3LSJ A;  2HYF A;  1OPC A;  4AM3 A;  1O3T A;  1W5C C;  4MQ9 F;  3VDX A;  5FFZ A;  1ETQ A;  2MD0 A;  3VYR B;  2WAE A;  4Y15 A;  3ISP A;  2OD5 A;  2PX9 A;  2QGU A;  2DDB A;  5D5V B;  5D6E A;  3IH3 A;  2IGK A;  5HDK A;  4L5I A;  4Q4Z F;  1JKR C;  1MH4 A;  4G94 A;  5ILS A;  5J40 A;  1X1D A;  2COB A;  3DKX A;  3KFW X;  4M6V A;  5FGM A;  2H1L A;  4B8X A;  4A3C J;  5GPA A;  5BQT A;  3A02 A;  3FMR A;  3ML6 A;  2EFW A;  4DYQ A;  5E1X A;  1SFK A;  2QUF A;  1U9O A;  4C2M J;  3HL2 A;  1AWC A;  4CYC A;  4A0X A;  4E4H A;  4A3J J;  3DBL B;  3GFL A;  3ZN0 A;  1UFM A;  2DPD A;  3RKY A;  1EF4 A;  4J01 A;  4HF0 A;  4RMN A;  2Z9O A;  2M34 A;  1R58 A;  1JGG A;  5CVJ A;  2YU3 A;  5LRR A;  3VYT B;  2IVM A;  3ZN1 A;  3IWZ A;  1MZB A;  1NG6 A;  2LFB A;  2JT1 A;  1BI0 A;  3S1R J;  2VQG A;  5BMZ A;  2BBY A;  1BW6 A;  1B4A A;  3C7J A;  5EYR A;  3PFY A;  5GP9 A;  5FB2 A;  2E2H J;  1QBJ A;  1SVO A;  3WU1 B;  1A04 A;  3GYH X;  5CPR B;  2KQR A;  5IT3 A;  1I39 A;  3ZPL A;  1Z77 A;  2HOS A;  3IAM 2;  1ZRD A;  5CYV A;  2VQL A;  2F5C A;  3CDL A;  2VJI A;  4C3I J;  2B9S A;  3OIP A;  3M3Y J;  4A2U A;  1XMA A;  3SDB A;  1T38 A;  1SC7 A;  2DJN A;  1MD0 A;  1FIA A;  3IRQ A;  2Z5U A;  4FE4 A;  2CUJ A;  3JRC A;  3DFG A;  2Y9Z A;  2L3D A;  2GLO A;  2I10 A;  2NNN A;  3LA7 A;  1RKT A;  1NG7 A;  3O3K A;  3QWL A;  5CVI A;  1C0W A;  2V1X A;  4LB5 A;  5FKK A;  4ZDP A;  3QPL A;  2E1M B;  2LSO A;  3HEF A;  3RYP A;  3NAR A;  1X3W B;  3K1P A;  3K1N A;  4MHG A;  3F8M A;  3TMO A;  1X1P A;  1VQ9 I;  1YRN B;  1PYV A;  2DA4 A;  1HLV A;  2O9L A;  3HSR A;  2X1C A;  2OF7 A;  2CFO A;  3LSG A;  2P81 A;  3UR3 C;  1QHH D;  2KL4 A;  2OA4 A;  1XSX A;  2KRF A;  3HRU A;  2VUM J;  3PUF A;  3CLO A;  4N4N B;  4BQA A;  4ANJ A;  2AS5 F;  1OCC H;  1DPU A;  2AXT C;  3FXM A;  4C3H J;  4IQ4 A;  4A3D J;  4A3B J;  2WB1 N;  1MMS A;  4XMY A;  1UEL B;  5CJ9 A;  5JI6 A;  3E6B A;  4IL6 C;  3OWT A;  2ZO4 A;  1PP7 U;  2JPB A;  4JX4 A;  3GFI A;  4ZC3 A;  4S04 A;  2XAJ A;  1WHU A;  5FLV A;  3JRG A;  5DM7 F;  4U0W A;  2K9L A;  3F6V A;  1SD6 A;  1GDT A;  1WI3 A;  1XN7 A;  2FUG 2;  2HQN A;  1G3S A;  3F9K A;  3QPT A;  4XOR A;  2R5Z A;  4EM0 B;  3SJM A;  1OCT C;  2ELK A;  2Y0S N;  4A0Z A;  3BDD A;  2A07 F;  4E7S A;  1G3W A;  1OKR A;  2K7L A;  4PFP A;  3CMA I;  4N0B A;  1GHC A;  4PFO A;  1MMD A;  5EEH A;  4PJN A;  5L3D A;  2ZJ2 A;  1WWX A;  2MLG A;  2M0C A;  1X4P A;  2J5P A;  5FKM A;  3U1K A;  1XCV A;  3OIO A;  2K40 A;  1LE8 A;  2HZT A;  4I76 A;  1F1Z A;  3LA3 A;  4MQV A;  2E7W A;  1BIA A;  1ZTR A;  1KZH A;  1WJC A;  3ZQH A;  3BPX A;  4EJO A;  5DTD A;  2R7T A;  1YW9 A;  5EG0 A;  2D5V A;  2Q2E A;  4G6Q A;  3PIP F;  4BJT A;  2JA7 J;  4IOA F;  1HQC A;  1JKO C;  1WKM A;  3IKT A;  2RN7 A;  3Q9V A;  1JT0 A;  1MBJ A;  4Q48 A;  3GTJ J;  2EB7 A;  1K83 J;  1SEU A;  4KIS A;  4L9T A;  1LEB A;  2QVO A;  4BDZ A;  2GBY A;  5E8I A;  4P1W A;  3IUO A;  3C3W A;  1N25 A;  2R7O A;  2ZXJ A;  4I98 B;  4OAY A;  4AYB N;  2E36 A;  3W6V A;  3RTR A;  2K02 A;  4JX6 A;  3U21 A;  4U0V A;  1POG A;  1CF7 B;  2QBY B;  3R6S A;  1U5T C;  1ENH A;  5E79 C;  5J8F A;  1QPI A;  3J7Y J;  2L02 A;  2DA2 A;  1KQ9 A;  1Z21 A;  1ON1 A;  3S93 A;  2BVM A;  1LDK B;  1OYW A;  3K2Z A;  3H5R A;  2ACJ A;  4HPQ A;  2QZ8 A;  1P6R A;  2FBI A;  3H9J A;  3H0G J;  3CJN A;  1IZ1 A;  1D8K A;  2VKE A;  1K61 A;  3HRS A;  2P5K A;  4M74 A;  3ZP5 A;  5FKL A;  3VEP A;  2GQQ A;  2RC4 A;  3KIO A;  4XLH A;  4EJU A;  1J9I A;  2EK5 A;  5F64 A;  3OS0 A;  2IA1 A;  1R00 A;  3RSN A;  2F5D A;  2WAQ N;  3NQO A;  2FMY A;  2JZY A;  4XIC A;  2NVQ J;  4RGU A;  2GM4 A;  2R4G A;  5L3G A;  2E1C A;  2KJC A;  3L1P A;  3K4N A;  3H3U A;  3PNV A;  2HDC A;  2LNB A;  1TLH B;  4CCL A;  3HKZ N;  2XIG A;  2Z2S B;  3K4J A;  2PJP A;  2RAE A;  4IO9 F;  5K5O A;  1TQI A;  5DCF A;  1T98 A;  1ONV A;  2Z3Y A;  1R1V A;  1OR7 C;  3IKV A;  4CCJ A;  4E7J A;  2CW7 A;  4U7D A;  3M4O J;  3HTU A;  1R1U A;  4EMS A;  2HVQ A;  3ZMU A;  4MTE A;  2IEK A;  2YS9 A;  4OMY A;  4PSW A;  2XF7 A;  2M5W A;  4CYD A;  1F36 A;  1FP2 A;  1FLI A;  2JN6 A;  1S8N A;  5F1J A;  1D1C A;  3C2B A;  2F6C A;  3F8C A;  3GTM J;  2LKX A;  2Y69 H;  4M72 A;  2DLL A;  1VF9 A;  3RIR A;  3FM3 A;  2VBZ A;  4RB0 A;  3HSF A;  3OYJ A;  3F8N A;  3GX4 X;  2AXL A;  3ZOB A;  1XGM A;  3MVP A;  5IT9 K;  4UB8 C;  1YS6 A;  5IPA A;  3JRA A;  2VIX A;  1K78 B;  1U6G A;  2YX7 A;  1B6A A;  2JRT A;  2W24 A;  3BR2 A;  2VQC A;  3CJQ B;  1SD7 A;  3KYC B;  3K69 A;  1B8I B;  4YFX F;  5A2Q Z;  3CF5 F;  4BYY A;  2R7X A;  2LLK A;  5EJC A;  2XRL A;  3MAJ A;  2HXI A;  5J4Y A;  1AU7 A;  2MD5 A;  2QF7 A;  3T8T A;  2FU4 A;  2Z1D A;  5HLI A;  3DBH B;  1UMQ A;  2MA3 A;  2C6Y A;  4L0Y B;  3LA2 A;  5DCM B;  4DZP A;  4RS8 A;  2PMH A;  4Y4R A;  1NK3 P;  2BV6 A;  4A3I J;  1JGS A;  1X58 A;  1SAU A;  3HHG A;  4KMF A;  1V5F A;  4NQW A;  2IA2 A;  1SAX A;  4BH9 A;  1U5T B;  3SZP A;  2GAU A;  5CKT A;  3A01 A;  3B6A A;  4UVB A;  1K4T A;  4BHB A;  2R5Y B;  4RA2 A;  2CV0 A;  1LDJ A;  3GBG A;  1WSU A;  5F0H A;  1IW7 F;  4LLG F;  1TTY A;  4V2F A;  1XGS A;  2MC4 A;  2VOD A;  4CUG A;  1J59 A;  2LYC A;  3BQZ A;  4QIW N;  3IHU A;  2M7A A;  1X19 A;  1IF1 A;  3AL0 B;  3L2V A;  3AKZ A;  2VJ5 A;  3OYL A;  5EF6 A;  3ZMV A;  4UVA A;  2L5Q A;  4DJA A;  2R0Q C;  3ABU A;  2JSP A;  3GZN B;  2E2J J;  1KA8 A;  3J7A Y;  3M9A A;  5LHG A;  3B73 A;  1Y1W J;  1VND A;  3BLY A;  5HLH A;  5LEK A;  1X2N A;  3L7W A;  4H4K C;  4G12 A;  3IP4 B;  1YW7 A;  3DKY A;  4XLC A;  4KIB A;  3OSG A;  5ICE A;  3ZRG A;  3EUH A;  4J19 A;  3DEE A;  3L2W A;  1QVU A;  4PZJ A;  5B3S H;  5H6R A;  1FY7 A;  2JQ7 A;  2F4I A;  3LQQ A;  2FX0 A;  2BEO A;  4QPO A;  3J80 Z;  2HPI A;  2NOG A;  2ZJR F;  1KYW A;  2ZB9 A;  1OYI A;  3S8P A;  3HUG A;  1IUY A;  1JKQ C;  1ZRC A;  2KHM A;  3ELK A;  2FJ1 A;  3I4M J;  1ETY A;  5J47 A;  2UWM A;  4NB5 A;  4B09 A;  3JAM K;  1UB9 A;  2JPC A;  2BY2 A;  4UVC A;  1GUU A;  4N9I A;  3MZH A;  1J2X A;  4YFK F;  4KIG A;  1ZAO A;  2QWW A;  1YI2 I;  4MGR A;  1T6S A;  1VQ7 I;  1MBF A;  5FLX K;  3FXJ A;  1GVJ A;  3DU5 A;  4ZTF A;  1N77 A;  4XLF A;  1VQ6 I;  1O7L A;  4PK4 A;  1W5T A;  3QP6 A;  3VSL A;  4PGG A;  2NOJ B;  3V7C A;  4JX5 A;  1T0F A;  2UXN A;  2XAS A;  3JRH A;  5E3L A;  2KIM A;  4L5J A;  2IT0 A;  3BOQ A;  1WJE A;  2Z33 A;  5EZH A;  4UUS A;  2ISZ A;  3A0H C;  1XTA A;  3RZO J;  2VC0 A;  3REO A;  2DFF A;  1D5V A;  2K9M A;  2CQX A;  2RDP A;  2TDX A;  2NAZ A;  5KNL A;  1ZG3 A;  5EGO A;  2VKD A;  2B63 J;  1OIS A;  2AHQ A;  5ICG A;  2EWN A;  2LDU A;  3DKW A;  1S7O A;  3PIO F;  4BBR J;  1R23 A;  4BE2 A;  1XD7 A;  2CH0 A;  2MG4 A;  2XSJ C;  2O6G E;  3CC4 I;  2M30 A;  2BY1 A;  2M0M A;  3Q3S A;  3L2C A;  2R7U A;  4OU0 A;  3WTZ A;  2PFB A;  1EJ9 A;  4A5M A;  4UY8 I;  2EIL H;  4XN3 A;  1O3S A;  2UUZ A;  4AIH A;  1EH8 A;  2WB1 A;  1J7K A;  3ZQI A;  1HCR A;  2VC1 A;  3GF2 A;  2HU9 A;  3ZMS A;  2EJR A;  2DTZ A;  1S3J A;  3W3C A;  1EV7 A;  4CYC B;  2HFH A;  3KZI C;  4HYE A;  3CP2 A;  3I0T A;  2L9R A;  2DDA A;  2JSC A;  3DTI A;  5F0C A;  2E71 A;  2XC7 A;  1MDM B;  3KYL A;  3M8F A;  5J4V A;  2VON A;  1P7I A;  2W85 A;  2ZME A;  1E2X A;  3GVA A;  2KZV A;  3MZY A;  2RKH A;  4O6J A;  1SMT A;  2YR2 A;  4P5O A;  3S14 J;  2Y0S A;  5LGN A;  3JSP A;  2LBF B;  2V9K A;  3SEQ A;  1ETK A;  1FMV A;  3GUD A;  2M8E A;  4EM1 A;  1U8R A;  1XCB A;  3OY9 A;  4Z6Y A;  5TGT A;  1TWA J;  2DI3 A;  3GTL J;  2KIQ A;  2LD5 A;  5H2F C;  1DP7 P;  2X51 A;  4LK1 F;  3FZV A;  3BP8 A;  2O0Y A;  4HW0 A;  4Y33 A;  2OQR A;  1RR7 A;  4BAY A;  1QHG A;  2F5E A;  4A3F J;  2E1N A;  4X6A J;  4HQE A;  3IH2 A;  1F9N A;  1S7E A;  2VB6 A;  3MCZ A;  1QA6 A;  2BHY A;  4ZYH A;  2VQH A;  3GCM A;  3HDD A;  4BHC A;  2LKS A;  3HOT A;  1FYL A;  3BTL A;  4I02 A;  2ZSI B;  3OL4 A;  5F04 A;  3O8G A;  3HG9 A;  5CQG A;  2QQB A;  1YS7 A;  2VPR A;  2DOE A;  4HLY A;  3KEO A;  3AAF A;  2ESN A;  2HNH A;  4IF4 A;  2FOK A;  3HRT A;  4Q5S F;  5FRN A;  2DT6 A;  4IRG A;  2LP0 A;  3QOE A;  3V7R A;  5HLG A;  5ILV A;  2R7S A;  3V7S A;  4M3D A;  3MKZ A;  3HGG A;  1AOY A;  4FTH A;  1AKH A;  1FT9 A;  4JBA A;  2E7X A;  1ETX A;  3C1D A;  2A6H F;  2CG4 A;  4P9F A;  3JSO A;  3CQZ J;  3HIF A;  2ELJ A;  2L7M P;  3CUQ A;  1KU7 A;  1D3Y A;  5KVR A;  3VSK A;  3NAU A;  2EH3 A;  1BBY A;  1E3O C;  2WAF A;  2W82 A;  2E5N A;  1VTN C;  1QO0 D;  2MH2 A;  5J1U A;  3ROU A;  3WG7 H;  2BXY A;  3BR6 A;  4FCY A;  2GIV A;  2Q0O A;  3T5X A;  1XG1 A;  2QA4 I;  3D1N I;  1B72 A;  2Q8K A;  2O61 A;  1WJA A;  3CCJ I;  4RAF A;  4HQM A;  3WTY C;  2WAQ A;  3NWS A;  2K4J A;  3TW7 A;  3CCS I;  1DU6 A;  2XUB A;  1YIT I;  1WFX A;  1SFU A;  3KP3 A;  2M2E A;  3LNQ A;  3V8K A;  3RPU D;  1B9N A;  2X4H A;  2DMQ A;  1ZAR A;  3FXO A;  2XVC A;  1W1W E;  2CSO A;  3IC7 A;  2VE8 A;  3FIS A;  1IDZ A;  1XSV A;  4MFD A;  2FEZ A;  1MNE A;  1UJ8 A;  5LRS A;  2PMZ N;  1P2F A;  4RAG A;  1RES A;  1D0X A;  2PJR B;  2MFZ A;  2Q2E B;  1LVA A;  1QQI A;  1ZK8 A;  4IHV A;  3BT9 A;  5IP7 J;  1ETO A;  1FBS A;  2XAQ A;  1IXR C;  3EUA A;  2OZ6 A;  1R71 A;  4UV8 A;  4XLN F;  2LY9 A;  2XGD A;  2CV2 A;  1O57 A;  4IHX A;  3K2A A;  4A93 J;  5C4X J;  3WTT C;  1XMX A;  2HQ5 A;  3F6O A;  4HST A;  5DS9 A;  1ZHF A;  3EQL F;  3MZ8 A;  2KLO A;  3KLO A;  5GAE J;  2YX4 A;  5J3L A;  2R7D A;  3Q9S A;  3I55 I;  2P6T A;  1IO2 A;  4F3Q A;  3RI4 A;  3TDZ C;  4HX8 A;  2JVH A;  3KYD B;  3H36 A;  2Y48 A;  4HNV A;  2RRE A;  2A6E F;  5B1B H;  1IAW A;  3BR5 A;  4YIR X;  3S17 J;  1QPM A;  5K1Y A;  1DQU A;  5L3C A;  2XPU A;  2X6Y A;  1LVK A;  4ON0 A;  1TC3 C;  3DPT A;  3OV8 A;  1EKE A;  5ICC A;  4L0Z B;  4PSX A;  3PO2 J;  5E1Z B;  3ZQF A;  3P7N A;  3CCY A;  4GXO A;  1E3P A;  3WE3 A;  2F2E A;  1HKT A;  3H0D A;  5E20 A;  3ZQ7 A;  3HRM A;  1UST A;  4JQF A;  4EVI A;  3IAS 2;  1S29 A;  2LMD A;  1TWH J;  4HOB A;  3TDU C;  2WWY A;  3K4M A;  3M1C A;  1BA5 A;  1UG2 A;  2Y0M A;  1PVE A;  2STW A;  3Q0V A;  3DPU A;  4BUP A;  4XOP A;  5B1A H;  3WTW C;  1SVL A;  3WTS C;  5FLM J;  2LRD A;  2M7B A;  1IC8 A;  2WTE A;  4W1U A;  1JJ6 C;  5CQE A;  2NRA C;  3O6B B;  5M3M J;  1T95 A;  5D5X B;  5DM6 F;  2DFH A;  3ZGK A;  2LH9 A;  3E5U A;  1MJA A;  3IRR A;  2H8W A;  4ZH4 F;  1IN4 A;  5B5E C;  2RV8 A;  1LEA A;  3BTC A;  1Z3Y A;  4CCM A;  3B02 A;  4F55 A;  4UXN A;  1KU2 A;  2LTP A;  2V1N A;  3F3X A;  2QSF X;  4M6X A;  2EV6 A;  1VZ0 A;  2L4M A;  2IS2 A;  3FMS A;  2HYJ A;  4GYG A;  5L3B A;  4NNJ A;  2RGV A;  4PJM A;  2VLA A;  3BQY A;  3S3N A;  1XGN A;  3I59 B;  4DW6 A;  2ZNZ A;  3CC7 I;  1PUF A;  1Z7U A;  3HYI A;  2R7Q A;  2XRN A;  2LY2 A;  2ZFU A;  1Y1V J;  2E5Z A;  5HS7 A;  3PJR A;  3I9V 2;  5DV5 A;  1O3Q A;  2JA2 A;  2VI6 A;  3BJ6 A;  4EQQ A;  3VOE A;  3G4S I;  4XKV A;  2B7E A;  3QYB A;  3WTU C;  2QSG X;  5A2Q K;  5BPD A;  2BXZ A;  2FOW A;  1MMA A;  4EAT A;  2ID6 A;  3CME I;  3BCA A;  4KIC A;  3CLQ A;  4XLE A;  2V79 A;  1B1B A;  2LG4 A;  2X6O A;  4JP0 A;  1RIO H;  4G7Z F;  5D8K B;  1N75 A;  3COA C;  3E5X A;  2A5Y B;  3ABT A;  2A69 F;  2QCO A;  2ZKZ A;  1R6R A;  2DYS H;  2VKV A;  4FX0 A;  3G6E I;  3J81 Z;  3F8B A;  4EGZ A;  2JVG A;  4AIK A;  2G9W A;  3GWZ A;  2FBH A;  4IXA A;  2IA0 A;  4HG2 A;  4G6D A;  2VXD A;  4ESF A;  5JHU A;  3OYI A;  1FZP B;  4BEH A;  1SFE A;  1YQA A;  1FPQ A;  4B43 A;  3MQ0 A;  2H94 A;  1TWC J;  2JRM A;  2HOE A;  3KZZ A;  5DD8 A;  4M9S A;  2LRE A;  4WCG A;  1R22 A;  3FF5 A;  4RGS A;  1IN8 A;  1ZH5 A;  4HRI A;  3WE2 A;  1RI7 A;  3OYF A;  2IS4 A;  1IUF A;  4PCQ A;  1TW3 A;  3RKQ A;  4LG0 B;  2V9V A;  1KU9 A;  2EFQ A;  4ZYA A;  4I0A A;  4D5C A;  4L9J A;  2XSD C;  3H1C A;  3RZD J;  3BWG A;  1VQM I;  4B44 A;  1A5J A;  2FXA A;  1OCO H;  2Q1Z B;  3L2U A;  1KYZ A;  4BHP A;  2X9D A;  3NEU A;  4XRF A;  1Q1H A;  1ULY A;  4JYK A;  3S1M J;  4ZZL A;  5FFX A;  2EIK H;  4O5V A;  3DWL E;  2E2I J;  2OCC H;  4BJ5 C;  3MD2 A;  4CA0 A;  3ZR8 X;  3EUK L;  3CO7 C;  5JVG F;  3OOU A;  1W7P A;  4M9Z A;  1G6N A;  2ICW G;  1E17 A;  2M4G A;  5K7Z A;  3HB9 A;  2KIU A;  1IRZ A;  4UHT A;  1D1A A;  3SZT A;  3DQV C;  1PJR A;  2R7Z J;  3OYD A;  1P9Q C;  4BY7 J;  5E1W A;  4BXF A;  1OLT A;  4L9V A;  2P5L C;  4Z2Y A;  4B4C A;  1FIP A;  3WOD F;  1GT0 C;  2B0L A;  3BR1 A;  9ANT A;  1YW8 A;  3J80 K;  3OL3 A;  3FMQ A;  2VAS A;  3AG3 H;  1UCR A;  3OYG A;  3GTQ J;  4QTR A;  2BW3 B;  1BC7 C;  2IS1 A;  4MNU A;  2W7N A;  3OYN A;  2VBX A;  2KDO A;  2XGX A;  2A05 A;  2G7U A;  3BG6 A;  2DU9 A;  1VQN I;  4HF2 A;  2EPF A;  2VOO A;  4R8H A;  3K70 D;  1PUE E;  2L01 A;  4RAY A;  1QNT A;  4CHU A;  5M3F J;  3AL0 C;  2OAZ A;  4ZYG A;  4XRS A;  2HTS A;  3SEZ A;  3PO3 J;  3RDI A;  2L9N A;  3KZY A;  1HW5 A;  3EET A;  3H5A A;  4XOT A;  2MSY A;  2VN2 A;  3JRI A;  1BR2 A;  1UG0 A;  3ASN H;  4BXU A;  1L3L A;  1CQT A;  2DCE A;  3A03 A;  4HNT A;  4QLC U;  4OOI A;  4ZTJ A;  3AG1 H;  2HS5 A;  4UNO A;  2EIJ H;  3QYF A;  3SFZ A;  4FET A;  2CFX A;  1XS9 A;  3ONQ A;  3S16 J;  4ZJZ A;  1SVM A;  2ETH A;  1B9M A;  3JRF A;  1IN7 A;  2QM3 A;  2UZK A;  3HOW J;  1HW2 A;  1OYY A;  1RRJ A;  1STZ A;  1CGP A;  4MTD A;  3TO7 A;  1AA7 A;  3TP3 A;  1SD4 A;  3MMY B;  4B3A A;  3Q0W A;  1Y8Q B;  1IRG A;  4DOZ A;  5EEA A;  1UHW A;  3DTK A;  4PUS A;  1HST A;  4A3G J;  3QPS A;  3I71 A;  4V2G A;  3DV8 A;  3E7L A;  4RDU A;  4C30 A;  2WY8 Q;  2WA0 A;  5HDN A;  2QQ9 A;  3QOD A;  4BL0 B;  1DU0 A;  2DMN A;  1FOW A;  2Y2Z A;  1Y8R B;  4ZDL A;  3T0Y A;  1U78 A;  2AQF A;  4D7N A;  3R0J A;  3CO6 C;  4A0Y A;  3DLA A;  2OJE D;  3IWF A;  1YRN A;  1Z6R A;  1MH3 A;  2P0W A;  3HSE A;  2ADU A;  1U0J A;  2DA3 A;  5CVR A;  1Z05 A;  1HSJ A;  1MJ9 A;  5D5W B;  1RPW A;  1P92 A;  3CCM I;  2BOL A;  3BCB A;  4FX4 A;  2LKP A;  2AO9 A;  3GFM A;  1ZRE A;  4FT8 A;  2CW8 A;  4D7M A;  4W97 A;  1Y56 A;  1BC8 C;  2I5U A;  1Z0X A;  4KMU X;  1FOX A;  3LSK A;  5HVQ C;  4RLF A;  3KPH A;  5KK1 A;  2W57 A;  5JHF A;  2K3F A;  2DMT A;  2P8T A;  4CZC A;  3H35 A;  5FKO A;  1I27 A;  1IXS B;  2DK8 A;  5GTI C;  2D1V A;  4CIC A;  4BDY A;  1XSD A;  4DGW B;  5LHI A;  5HS9 A;  4BQN A;  2DW4 A;  2W1O A;  2KP6 A;  5ICF A;  1FBU A;  3CF2 A;  2ME0 A;  3M8E A;  1Y0N A;  3QQA A;  5FRO A;  3N97 A;  2EBI A;  3TGN A;  2RQQ A;  2NNY A;  1D5Y A;  2IGN A;  3DF8 A;  3QU6 A;  2KKO A;  3JTH A;  4KN4 X;  1S7A A;  3BR3 A;  4HDU A;  2K86 A;  2V9P A;  4CZZ A;  3BPV A;  2DTR A;  3K70 C;  1LNW A;  1MBH A;  5C4J J;  3JR9 A;  1MNM C;  2ECB A;  3TQN A;  3E0J B;  2HZD A;  3TOB A;  5LBQ A;  3LSP A;  5HOD A;  4WXD A;  2BYV E;  3S3O A;  3SFI A;  3X2Q H;  4FIS A;  4C3J J;  1VQL I;  2XF6 A;  2FE3 A;  1X2M A;  1YIJ I;  1K6Y A;  1Z9C A;  4ENJ A;  1KQ0 A;  3BZK A;  1BI3 A;  1QZY A;  1OMI A;  2OTJ I;  4E7Z A;  4YII A;  2H27 A;  4M71 A;  4V19 K;  1HKS A;  1UHS A;  1M1E B;  4UB6 C;  1H88 C;  1W0T A;  4YFN F;  2YSR A;  2EFN A;  4JOM A;  1CF7 A;  4MIM A;  3M8J A;  2W25 A;  2VXZ A;  3Q5F A;  2MYS A;  1TP4 A;  1I5Z A;  3CUQ B;  2G0E A;  4Q47 A;  3O2P E;  4CO8 A;  1ZLJ A;  5J8C A;  3OYK A;  1A35 A;  2EQR A;  1APL C;  5E3N A;  3ZQG A;  3BR0 A;  3L9F A;  4CXF A;  4YRV A;  4IHY A;  2GXB A;  3CCQ I;  4II3 A;  2CQ7 A;  1DUX C;  5IP9 J;  2M9H A;  3PQK A;  3HTS B;  3OS1 A;  3FWE A;  2GOM A;  2EIM H;  4LJZ F;  2L0K A;  1QGP A;  3LMM A;  1K4S A;  2OQG A;  5EEG A;  1J5Y A;  1E0E A;  4L18 B;  5DEQ A;  3K7A J;  3D5R C;  1W36 D;  4X0G A;  2HGC A;  2EA2 A;  4XKC A;  1BIB A;  4CCK A;  3SXY A;  1Z6T A;  1YOV B;  2F4O B;  2M3A A;  3DCF A;  2DAO A;  2FD5 A;  2K85 A;  4OWR B;  1V55 H;  4RGR A;  5CVU A;  2ZXI A;  1JKP C;  4GO1 A;  4HAM A;  1WGX A;  3FIW A;  2X1E A;  1QU3 A;  3KP4 A;  3KP7 A;  4D5F A;  3G1O A;  5ILU A;  3AG4 H;  4A6D A;  4OIN F;  4C9Y A;  3WGG A;  4EJW A;  3N4M A;  2L2O A;  4P9U A;  3OR1 C;  4G8X A;  1U9N A;  2F5F A;  1IXC A;  4XR6 A;  5F6F A;  1SFX A;  1FP1 D;  5LHH A;  1MBG A;  1OQY A;  3GXO A;  1F5T A;  3Q0U A;  1MSE C;  1A6Q A;  3G1L A;  1NH3 A;  3ERE D;  1L0O C;  3QPH A;  4BXX J;  3LSH A;  2CJJ A;  4LD5 A;  1G4D A;  1REP C;  4BBS J;  3ZXS A;  4A3K J;  4RGX A;  3S1N J;  5DUI A;  3OMY A;  4WK8 F;  4AVZ A;  4IHT A;  2E19 A;  3E6M A;  3GZ5 A;  3CCV I;  4OMZ A;  1ORK A;  4OIR F;  2A3S A;  2XB0 X;  3WU2 C;  2MAB A;  2NYX A;  4ETS A;  2VJ4 A;  3K4L A;  1RZ4 A;  4ENM A;  3TW6 A;  2IAI A;  3CUO A;  4XRS G;  1BJZ A;  3VPR A;  1U3E M;  4AVP A;  4Y17 A;  1K78 A;  3NRV A;  3U2R A;  5HNH A;  4HA8 A;  3V42 A;  1OJL A;  5IT9 Z;  2RNG A;  4EEF G;  3WGI A;  3VOD A;  2IBD A;  1B8I A;  3I3L A;  1IRX A;  1ZRF A;  2YPR A;  2GA1 A;  1F4K A;  2HI3 A;  4GYI A;  4G6T B;  2JTV A;  2KJB A;  4KT6 A;  5HDG A;  1AHD P;  3B6C A;  1JHH A;  3OSF A;  1U2W A;  4BNC A;  2FNP A;  3KP5 A;  2XB5 A;  1ZG1 A;  3MN2 A;  2EZL A;  3FKJ A;  4YIF A;  1MBK A;  5DCM A;  2VT2 A;  4WXH A;  1R5G A;  4KIF A;  1YJW I;  1FX7 A;  1YG2 A;  2OV7 A;  1NK2 P;  5FO5 A;  2L54 A;  1U5T A;  2VBW A;  4MEY F;  2MLK A;  4CCO A;  1BI1 A;  3S1Q J;  1KGS A;  2PLY A;  1P4A A;  3C2H A;  2HEO A;  4XQF A;  2R5Y A;  2KRC A;  2V6E A;  5B66 C;  2FRH A;  3BG9 A;  4AUX A;  5J1R A;  3BTI A;  1Y0U A;  2RQP A;  2MW8 A;  3HM5 A;  1ITY A;  1SFO J;  5H6Q A;  1DP3 A;  2DFI A;  1WJ5 A;  3GLX A;  2A5W A;  3ERM A;  1OCP A;  2X6X A;  4AYB A;  5M5Y J;  1W4M A;  3KX2 A;  1W36 C;  4KDP A;  4S05 A;  2ELH A;  4IRH A;  2DYR H;  1TQM A;  3JCU C;  3OOP A;  4BJ6 C;  3F8F A;  5DDG A;  3DPL C;  3FKI J;  5FD6 A;  4HX4 A;  2CGP A;  3HZJ A;  1XX5 A;  4BS9 A;  4N9H A;  3G73 A;  3VWB A;  1LFU P;  4NUB A;  3MKL A;  3K0L A;  1N78 A;  1MJB A;  4LGW A;  3K4K A;  3I5U A;  1OCR H;  2DMP A;  3OIQ A;  4DBQ A;  1O3R A;  4PGH A;  3CDH A;  3DXJ F;  4HV5 A;  1TZL A;  3DEU A;  4WX9 A;  1VQP I;  1HA8 A;  5LD2 C;  2X85 A;  3BTJ A;  3WGH A;  4KJZ A;  1TNT A;  2JA5 J;  1MMN A;  3L2R A;  1FOY A;  1GV2 A;  1Y39 A;  1KQ8 A;  4BAC A;  1TT0 A;  1OR7 A;  2UXX A;  4KN7 X;  4UV9 A;  4DBR A;  3G3Z A;  3GME A;  2TRT A;  4XL9 A;  3LSR A;  1TQP A;  3W6J B;  2R5Z B;  1D0Z A;  2EZH A;  3ASO H;  2EV0 A;  5IYC J;  2BHZ A;  2DT5 A;  5KCM A;  3RJP A;  3PUB A;  4HEA 2;  3K10 A;  1JT6 A;  3QYE A;  4OAZ A;  4WF2 A;  1LPQ A;  2P5V A;  1DPR A;  3HKZ A;  4MEX F;  5FRM A;  3FXR A;  2GIZ A;  4EGY A;  1ZN2 A;  2D2W A;  3LSM A;  4XM3 A;  3LAP A;  3QRF F;  2IXS A;  1LE8 B;  4M9X A;  3S32 A;  3MEX A;  4A69 C;  1RKW A;  4M3B A;  2W48 A;  4RB3 C;  2HDD A;  4D0P A;  3DEW A;  5L3E A;  3ZMZ A;  4P55 A;  2AQE A;  4KFC A;  5EG0 B;  1YX3 A;  2DBB A;  1WRJ A;  2FQ4 A;  4RM3 A;  1IG7 A;  4WXC A;  5JR3 A;  1HW1 A;  3TKY A;  3G1M A;  4DYC A;  3JRE A;  3DTE A;  1IGN A;  5FLX Z;  4LIU A;  2NVX J;  3ZQL A;  4Y3O A;  1F43 A;  2DFE A;  5GTH C;  2Y9Y A;  3G71 I;  3KEY A;  4RBO A;  3FXK A;  3S2D J;  5BNG A;  2IS6 A;  2PMU A;  3HPG A;  1WQ2 A;  3V4G A;  3T1B A;  2BVL A;  1JTY A;  5LGT A;  2KDZ A;  1DDN A;  1BL0 A;  1YTY A;  4BE1 A;  1P4X A;  4B3X A;  4DZJ A;  1LDD A;  1YIO A;  1IV6 A;  4LIT A;  4E7H A;  3FK7 A;  4QWQ A;  2CUF A;  4DYR A;  1IJW C;  1PDN C;  2H09 A;  1QZZ A;  2GA2 A;  1H9G A;  2WV1 A;  2PQ8 A;  3HGY A;  1V4R A;  3JW4 A;  2Z16 A;  3K6G A;  2Y30 A;  4GRI A;  4K2E A;  3IV5 A;  2R7V A;  3CP8 A;  1YFH A;  2HQA A;  4ENK A;  1X3U A;  4LFU A;  2CQQ A;  1Z91 A;  2H1K A;  1R49 A;  2R7W A;  1U8B A;  2XF5 A;  4I2O A;  3FHN A;  2ESH A;  4RLQ A;  2W00 A;  1G8X A;  4M6Y A;  2ECC A;  4I7H A;  4HZF A;  5F1R A;  5D8L B;  2D45 A;  3F72 A;  6PAX A;  4BU2 A;  1MDM A;  1MBE A;  2FA5 A;  1FC3 A;  2NXN B;  4QPQ A;  1P7J A;  3ZCO A;  1ZYR F;  3KP2 A;  2XDV A;  4G7H F;  2K27 A;  5JLX A;  3L2Q A;  2W84 A;  2ZC2 A;  1ZR4 A;  2VKH A;  2CUE A;  2IGM A;  3CJT B;  2LBF A;  4G9Y A;  5H20 A;  1I6H J;  3A1Y A;  1XB4 A;  4EJT A;  3LQR A;  5K5Q A;  2QQA A;  4NC7 A;  2HVR A;  4OIQ F;  1SD5 A;  2E34 A;  1V5G A;  3F23 A;  2XV4 S;  4XSZ F;  4RB2 C;  4HBL A;  1VFC A;  3EUH C;  1WZ2 A;  3J7A O;  3M7G A;  4U87 A;  3CC2 I;  4RB1 A;  2CQN A;  4CDG A;  2HVS A;  4D1Q A;  4U0Y A;  1JI8 A;  2ZJQ F;  4CSW A;  1K7A A;  4A5N A;  2WY7 Q;  3SZG A;  1UAA A;  1ZR2 A;  1WH5 A;  3T8R A;  1K79 A;  3ZQQ A;  4ZZD A;  5BPI A;  3W6K B;  2HXO A;  3TBI A;  4NC8 A;  5TRD A;  2HOT A;  4XSX F;  2VOP A;  3BRO A;  1IN5 A;  1WH7 A;  2F5V A;  4XLA A;  3BC8 A;  4LOC A;  5F0F A;  5FKN A;  2K9Q A;  2OC6 A;  2M4K A;  2NS7 A;  3MKW B;  1RUO A;  4DQ2 A;  4O3M A;  3GTO J;  4IPA A;  2O7O A;  1D1B A;  3LOC A;  3WG9 A;  5GAH J;  4BY1 J;  3L00 A;  4EJV A;  3V8L A;  1J09 A;  1WI9 A;  1SAN A;  5D6F A;  1T0F C;  4IX7 A;  3JRB A;  3ABL H;  1ETW A;  3P9K A;  1FEX A;  4R79 A;  4IOC F;  3FBI B;  1Z3X A;  3E5Q A;  2V4J C;  4I99 C;  5HNF A;  2BE5 F;  1TBX A;  1VQ4 I;  2XKP A;  4Y7N J;  2E35 A;  3PSI A;  3F21 A;  1HC8 A;  2DOF A;  3HHH A;  2JA6 J;  3FXL A;  4DIQ A;  4NQW B;  2FML A;  2XAU A;  5TIS C;  5C3E J;  3H5N A;  3A01 B;  4CGZ A;  1MND A;  2IGO A;  3H9G A;  5HOO A;  1EA3 A;  3OYE A;  5BS6 A;  1G59 A;  2LF7 A;  1JUS A;  5F08 A;  3VFZ A;  5FJ8 J;  4IRI A;  2KRH A;  1ZGW A;  3FK6 A;  3JRD A;  2LC2 A;  4LG3 A;  1RC9 A;  3E6C C;  5DD4 A;  2M87 A;  2ZSH B;  3TL4 X;  2OZU A;  2M1B A;  2GOX B;  2K5C A;  2IJL A;  1T8I A;  2CV1 A;  2EFO A;  1LKX A;  3GLL A;  4DNC A;  5LEJ A;  2PJR A;  3AFH A;  2RNJ A;  3G2B A;  1X3Z B;  4P96 A;  1T33 A;  4FE7 A;  1Z67 A;  3A4C A;  2ZME C;  3LSI A;  3RPQ A;  5K7F A;  4ESJ A;  1R7J A;  4GDF A;  1BN5 A;  5TJJ A;  1X1B A;  3D5S C;  2XHK A;  3EPZ A;  4HV6 A;  5LLQ A;  4NHJ A;  4OIO F;  2DA7 A;  2P4W A;  1IV8 A;  2NVU B;  3BG5 A;  3C2G A;  3ECH A;  4BQO A;  5GPC A;  4PJ0 C;  3SYT A;  1V5E A;  2IPQ X;  3HOU J;  2QSH X;  3H3Z A;  2KIS A;  4M3G A;  3CJR B;  1YX5 A;  2E1O A;  3QAH A;  4HLX A;  1XPX A;  2X48 A;  1QZE A;  4PJJ A;  2LK2 A;  4H0E A;  3S2W A;  1BR1 A;  3PL8 A;  2KPM A;  2L7F P;  1O7F A;  2FBK A;  3HUG B;  2OTL I;  3CMM A;  3CD6 I;  4C2U A;  1XMK A;  4IJA A;  3FHZ A;  2STT A;  4ITV A;  4MO7 A;  4B47 A;  1MSF C;  3EYI A;  3HOX J;  4ZYE A;  3GTP J;  3F0C A;  2JUG A;  2LF8 A;  5IOZ A;  4F91 B;  2WAD A;  1ZQ3 P;  1YHQ I;  3V8J A;  2ZJP F;  2HKX A;  2P6S A;  1R9T J;  1R1T A;  3PM1 A;  5AON A;  3RQI A;  4XLP F;  4N4O B;  1FTZ A;  3M07 A;  3LL7 A;  2JK3 A;  4ESB A;  3S2H J;  5D5U B;  4EM2 A;  5IY5 H;  4YEJ A;  3ABK H;  2KIF A;  4PDK A;  2LY1 A;  3LWF A;  3MKY B;  2VL8 A;  2EZK A;  2L7Z A;  1YJ9 I;  1FSE A;  4LB6 B;  1G3T A;  3CUQ C;  4AIJ A;  1VQO I;  3A2K A;  2XRO A;  4HDV A;  3OR2 C;  2XAG A;  3RKW A;  2QEX I;  2HPM A;  4UUS B;  3JTG A;  3ABM H;  2L9V A;  5M5W J;  3KP6 A;  4ZYD A;  1A31 A;  1HDP A;  2ZCW A;  1QVT A;  5E8G A;  2L4A A;  3CDI A;  4F92 B;  1X4O A;  2HWV A;  5EGO B;  2ZXW H;  1MGT A;  3BZ6 A;  5ED4 A;  2EA4 A;  2ZBK A;  4XNF A;  5CLS A;  1YLF A;  1Z7L A;  3K4B A;  3GTK J;  2R93 J;  1OCZ H;  3MWM A;  4I01 A;  2ME6 A;  4R1H A;  5LFA A;  3OYM A;  3HBL A;  5FD5 A;  2F48 A;  3MFK A;  1HOM A;  2PI0 A;  3PNT A;  1W0U A;  3QOP A;  3CCL I;  3PNY A;  2CQK A;  4E7L A;  2P7C B;  1R4M B;  3I59 A;  5IOY A;  3FDY A;  4A3M J;  3J7Z I;  3O8H A;  4HX7 A;  2NVT J;  1JTX A;  2NS0 A;  3OS2 A;  4GCV A;  2DN0 A;  5GAD J;  1LJ9 A;  4GFB A;  3KCC A;  4BKX A;  1W5S A;  2LOO A;  2F4M B;  4F7Z A;  4ABZ A;  4AU7 A;  3HOV J;  4M3E A;  3ESW B;  4AD9 A;  3CMY A;  2P7V B;  1FMW A;  1XDS A;  3R60 A;  4EV0 A;  1D8J A;  1JJ8 C;  2V26 A;  1IDY A;  2J5O A;  1K6O A;  1RUN A;  2PBI A;  2ZME B;  2HYG D;  2KT0 A;  1JHF A;  1TT5 B;  1FJL A;  3LST A;  5IP6 A;  2NVY J;  3S15 J;  4A6E A;  3PFI A;  1YJN I;  1BM9 A;  2L9S A;  4IEJ A;  1JE8 A;  1JUM A;  3I56 I;  5E17 F;  5JFR A;  3D5L A;  2WBM A;  3W2A A;  3D0S A;  4KIT B;  2UV1 A;  1ACI A;  3RKX A;  1V3F A;  3CCU I;  3BG3 A;  4QSH A;  4BQQ A;  3H3V K;  1HXD A;  1Z1D A;  2BGC A;  2M45 A;  2K9N A;  2DPU A;  2PMZ A;  1WVR A;  1E3H A;  3K4C A;  2ISY A;  2XPV A;  4XK4 A;  5JVT A;  2L7K A;  2PG4 A;  4LG0 A;  2HKO A;  3FXQ A;  2XGE A;  3BJO A;  1LB2 A;  1XDU A;  1R4N B;  4RAZ A;  4AC0 A;  4IQJ A;  2DOD A;  4FAS D;  2OBP A;  1R5H A;  4XID A;  2R7R A;  1GVD A;  2O8X A;  2ZNY A;  4J00 A;  2DMU A;  2QLZ A;  3KLN A;  3I54 A;  5GAG J;  1WJB A;  4F93 B;  1ZGJ A;  3R0A A;  4HSR A;  1ON2 A;  5M5X J;  2M8G X;  4UUV A;  1MMG A;  2TCT A;  3GEZ A;  1AKH B;  1NHA A;  1UHM A;  4HF1 A;  2MH9 A;  2XAH A;  2MGQ A;  2H8R A;  2MBF A;  4WWC A;  2QBY A;  3DP7 A;  1DGR M;  4IVN A;  3VYS B;  1GLN A;  2DQR A;  2FNA A;  2JWT A;  4I09 A;  1SMY F;  1DGW Y;  1VI0 A;  1W7P D;  4LIV A;  3SDG A;  3H9Q A;  2JA8 J;  5EDN A;  3SQN A;  5K7H A;  2H6C A;  4B48 A;  4G7O F;  4XBF A;  2VT3 A;  1S6L A;  4L5E A;  1FTT A;  1TW2 A;  1MKM A;  4Y13 A;  4D9J A;  3KE2 A;  2EIN H;  3K1M A;  1IRF A;  2YU9 J;  2BW3 A;  3P5J A;  2JUC A;  4AWX B;  1FYM A;  2EZI A;  5CVV A;  1BR4 A;  2O03 A;  1B72 B;  2R92 J;  3WTX C;  2JMW A;  3A0B C;  2XGC A;  3BG7 A;  3RPU A;  1GXP A;  3LFK A;  5DUK A;  5K5R A;  4YG2 F;  3ZQC A;  1MIJ A;  3FBN B;  1P4W A;  1WJD A;  2K3P A;  3I4P A;  2A68 F;  3CCE I;  2R7F A;  4XON A;  2HQR A;  3NWT A;  2QKM B;  3TED A;  1Q1V A;  2Z99 A;  4L9N A;  4KNY A;  3UNG C;  3HC7 A;  4E6K G;  4ASN A;  4A3E J;  1USS A;  3DU6 A;  1LFP A;  1QRY A;  2DJI A;  1LFB A;  3W2V A;  1BI2 A;  3I4N J;  1I3A A;  3ZMT A;  3SHF A;  1D0Y A;  2A61 A;  1V54 H;  5IYB J;  2DA1 A;  1T08 B;  2K4B A;  2EV5 A;  3M1E A;  3E6D A;  2IP2 A;  2GWR A;  3ECO A;  4B1R A;  5JLW A;  2DA6 A;  1XC5 A;  3GZ6 A;  3E97 A;  4FHT A;  3TP0 A;  1GXQ A;  2CS3 A;  1VQ8 I;  2LR8 A;  3H92 A;  2QKL B;  3HOY J;  3PSF A;  4FQG A;  1T56 A;  1T39 A;  1FOK A;  2A6T A;  1FSH A;  2XAF A;  2HOA A;  4E7K A;  1UZC A;  3R4K A;  4YEL A;  4CCN A;  4U7B A;  2KFD A;  4XKB A;  3P9I A;  1I1S A;  5AIQ A;  4U88 A;  2CW0 F;  2Y31 A;  2EFP A;  3I58 A;  4I0B A;  1ZGA A;  3W2W A;  4BGD A;  1S72 I;  2MC3 A;  1EH6 A;  1XGO A;  3ULQ B;  1JXS A;  1X1C A;  3CES A;  3DBR B;  1H0M A;  2OU2 A;  2W4S A;  4PJL A;  1KON A;  4ZDO A;  4UUT A;  2DO7 A;  2VJJ A;  2ZFW A;  4MLO A;  2BZT A;  1A36 A;  2QQ8 A;  4X1E A;  3FX3 A;  1TL8 A;  2DT7 B;  1R5I D;  5HLT A;  3DLL F;  1ZG5 A;  2RVC A;  3BJA A;  4M73 A;  3U1D A;  1GV5 A;  2CYY A;  1G2H A;  5KAF C;  2CMP A;  1H89 C;  2V1D A;  1YO5 C;  4OIP F;  2ID3 A;  2OCE A;  4KUM A;  5DYM A;  4XRM A;  3GO5 A;  3CZ6 A;  3PQJ A;  5J1Y A;  2OPT A;  2HTJ A;  4XN0 A;  1TNS A;  1YE9 A;  2VPL A;  3FM5 A;  4MFE A;  1FWZ A;  2Y75 A;  5EZG A;  2DK5 A;  4Y52 J;  1R36 A;  1RR8 C;  1RET A;  1HBX G;  3I53 A;  3EDP A;  1EH7 A;  3AG2 H;  1MW7 A;  1JUP A;  1YYV A;  2DOA A;  3QP5 A;  4IZZ A;  2LVS A;  5AIP A;  1ODD A;  1VQK I;  2I8D A;  1RNL A;  1I50 J;  4HNU A;  4KYW A;  3CTA A;  2IRF G;  1BJA A;  1FBQ A;  2V6C A;  4IKF A;  3QU3 A;  3OYB A;  4E70 A;  1I1G A;  5IYD J;  4AID A;  1B59 A;  2O3F A;  4TV7 A;  3OYA A;  5E3M A;  3HOZ J;  2X0L A;  4A3L J;  1A6I A;  5ERI A;  2VBY A;  4NDL A;  3GFJ A;  4A12 A;  5D4S A;  3TO9 A;  3HJE A;  2O5R A;  2R3S A;  5HS8 A;  2N8G A;  2HR3 A;  4JK1 X;  1O4X A;  2GXG A;  3E3V A;  5C44 J;  3HOS A;  2CWE A;  3VYU B;  1PUF B;  2VE9 A;  1FYK A;  5KAI C;  2G7H A;  1X1A A;  3OYC A;  1FNN A;  4BE0 A;  3WTV C;  1TWG J;  1J0R A;  4XKW A;  5E18 F;  3RQ4 A;  1WJF A;  2KZG A;  4I6Z A;  2DXI A;  2IW5 A;  3R61 A;  2X6W A;  4KT5 C;  2XPW A;  4LMY A;  2X1D A;  3UKG A;  4LLL A;  3BY6 A;  3GW2 A;  5KHD A;  1VQ5 I;  4M3F A;  1I3Q J;  2K9S A;  4II2 A;  3CCR I;  3J81 K;  2FQ3 A;  1ETV A;  1KU3 A;  3LFU A;  3E1S A;  2CO5 A;  2FF4 A;  3RCO A;  4E7I A;  3IH4 A;  5L3F A;  1S9H A;  1NTC A;  5D4R A;  4LK0 F;  3WHB A;  5J6X A;  1BW5 A;  2BY3 A;  2O8K A;  3TOA A;  2QYO A;  1HF0 A;  2XKO A;  2JJ7 A;  4ENN A;  1BOB A;  1G3Y A;  2GZW A;  4GGG A;  4LLN A;  2WC2 A;  2E60 A;  4BEH B;  1J75 A;  2CRG A;  3C18 A;  2GXA A;  2QEN A;  4CH7 A;  4C2T A;  1T2K A;  3KET A; 
#chains in the Genus database with same CATH homology
 3GTG J;  1ETW A;  1DU0 A;  1WCM J;  2DMN A;  1FEX A;  1WPK A;  2Y2Z A;  5EZH A;  1U78 A;  4UUS A;  4D7N A;  1ZKG A;  3RZO J;  1TWF J;  2CQX A;  1YRN A;  1MH3 A;  2DA3 A;  5EGO A;  4Y7N J;  4S0H B;  2B63 J;  2JA6 J;  1RPW A;  2AHQ A;  2CU7 A;  2AO9 A;  5F27 A;  4BBR J;  5C3E J;  4D7M A;  2NS8 A;  4W97 A;  3A01 B;  2MG4 A;  1Z0X A;  1OFC X;  2DA5 A;  3Q3S A;  5E3O A;  4IHW A;  1JUS A;  5F08 A;  2DMT A;  1HDD C;  5FJ8 J;  2YUS A;  3WHC A;  5FKO A;  1H8A C;  1ZGW A;  3LSJ A;  3FK6 A;  3ZQI A;  3JRD A;  1HCR A;  1ETQ A;  2DTZ A;  4CYC B;  3IH3 A;  2L9R A;  1JKR C;  2ME0 A;  1MH4 A;  5F0C A;  3QQA A;  2COB A;  4M6V A;  1T33 A;  4FE7 A;  4A3C J;  2EBI A;  5GPA A;  5K7F A;  1P7I A;  3A02 A;  1D5Y A;  4DYQ A;  3S14 J;  3BR3 A;  4C2M J;  1U9O A;  4CYC A;  2DA7 A;  1ETK A;  4A3J J;  1MNM C;  1MBH A;  5C4J J;  3JR9 A;  2ECB A;  3BG5 A;  1EF4 A;  5GPC A;  1TWA J;  3LSP A;  2M34 A;  3HOU J;  3GTL J;  5HOD A;  1JGG A;  2LD5 A;  4M3G A;  3SFI A;  4FIS A;  4C3J J;  2E1O A;  1X2M A;  1RR7 A;  2LFB A;  2X48 A;  4A3F J;  4X6A J;  3S1R J;  2LK2 A;  3IH2 A;  1S7E A;  1BW6 A;  3HDD A;  2L7F P;  5EYR A;  5GP9 A;  3BTL A;  2E2H J;  1UHS A;  5F04 A;  3O8G A;  1H88 C;  1W0T A;  1Z77 A;  4MO7 A;  1MSF C;  2HOS A;  2VPR A;  3HOX J;  3GTP J;  4MIM A;  3F0C A;  5IOZ A;  1ZQ3 P;  3CDL A;  2G0E A;  4C3I J;  3M3Y J;  1R9T J;  2LP0 A;  3PM1 A;  3RQI A;  2EQR A;  1APL C;  2DJN A;  5E3N A;  1FIA A;  4M3D A;  3ZQG A;  1FTZ A;  3HGG A;  4FE4 A;  2JK3 A;  3BR0 A;  3JRC A;  4FTH A;  2Y9Z A;  1AKH A;  2GLO A;  4IHY A;  3S2H J;  2I10 A;  1ETX A;  1RKT A;  5IP9 J;  2M9H A;  2EZK A;  2L7Z A;  3CQZ J;  5FKK A;  2L7M P;  3QPL A;  3HEF A;  3NAR A;  2EH3 A;  3NAU A;  2L0K A;  1E3O C;  4UUS B;  5M5W J;  1YRN B;  1HLV A;  1HDP A;  2DA4 A;  1QVT A;  2O9L A;  3K7A J;  5J1U A;  5EGO B;  2OF7 A;  3BR6 A;  4FCY A;  3LSG A;  2P81 A;  2FD5 A;  3DCF A;  2VUM J;  1XG1 A;  2R93 J;  3GTK J;  2ME6 A;  1JKP C;  3HBL A;  3D1N I;  1WGX A;  3FIW A;  4C3H J;  1B72 A;  4A3D J;  4A3B J;  1HOM A;  2WB1 N;  4D5F A;  3G1O A;  1W0U A;  3TW7 A;  1U9N A;  5IOY A;  1DU6 A;  4A3M J;  3O8H A;  2M2E A;  4JX4 A;  3LNQ A;  2NVT J;  1JTX A;  5FLV A;  3JRG A;  1MBG A;  2DMQ A;  2DN0 A;  3Q0U A;  1MSE C;  3G1L A;  1GDT A;  1WI3 A;  4GFB A;  4BKX A;  3FIS A;  2R5Z A;  4ABZ A;  2CJJ A;  3SJM A;  4BXX J;  3HOV J;  1IDZ A;  1OCT C;  2ELK A;  4M3E A;  2Y0S N;  4MFD A;  3CMY A;  2PMZ N;  1RES A;  4BBS J;  4A3K J;  4IHV A;  3S1N J;  1ZK8 A;  1JJ8 C;  3BT9 A;  1IDY A;  5IP7 J;  1ETO A;  2E19 A;  2KT0 A;  2M0C A;  5FKM A;  1FJL A;  5IP6 A;  1ORK A;  2LY9 A;  2K40 A;  3OIO A;  2NVY J;  1LE8 A;  3S15 J;  2XB0 X;  2XGD A;  4IHX A;  4I76 A;  4A93 J;  3K2A A;  5C4X J;  4IEJ A;  1JUM A;  2HQ5 A;  1ZTR A;  5DS9 A;  3ZQH A;  5DTD A;  3TW6 A;  5J3L A;  2IAI A;  5EG0 A;  2D5V A;  4XRS G;  1BJZ A;  3VPR A;  2JA7 J;  1JKO C;  3BG3 A;  4QSH A;  1JT0 A;  1MBJ A;  1OJL A;  4HNV A;  4EEF G;  3GTJ J;  1B8I A;  2IBD A;  3H3V K;  1K83 J;  3S17 J;  2K9N A;  3BR5 A;  2HI3 A;  4XK4 A;  2XPU A;  2XPV A;  2GBY A;  1AHD P;  1TC3 C;  3B6C A;  2XGE A;  3OSF A;  4AYB N;  3PO2 J;  3W6V A;  3ZQF A;  2XB5 A;  3CCY A;  3MN2 A;  4AC0 A;  4JX6 A;  2EZL A;  1MBK A;  1POG A;  4XID A;  1NK2 P;  1GVD A;  2DMU A;  1ENH A;  1TWH J;  1QPI A;  2DA2 A;  1BA5 A;  1UG2 A;  3S1Q J;  5M5X J;  2M8G X;  2R5Y A;  2TCT A;  3Q0V A;  1AKH B;  2MGQ A;  3BG9 A;  3H0G J;  4AUX A;  2H8R A;  5J1R A;  3BTI A;  1K61 A;  2MW8 A;  2VKE A;  3HM5 A;  1SFO J;  1ITY A;  5FLM J;  2JWT A;  5FKL A;  1IC8 A;  4W1U A;  1VI0 A;  1OCP A;  3SDG A;  1JJ6 C;  2JA8 J;  5M5Y J;  5EDN A;  5M3M J;  5K7H A;  4L5E A;  1FTT A;  3FKI J;  2WAQ N;  4XIC A;  2NVQ J;  3BTC A;  1LFU P;  2GM4 A;  2YU9 J;  3MKL A;  2EZI A;  2LTP A;  3L1P A;  1B72 B;  2DMP A;  3HKZ N;  2R92 J;  2JMW A;  2RAE A;  2HYJ A;  2XGC A;  3BQY A;  3BTJ A;  4DW6 A;  2JA5 J;  1GV2 A;  3ZQC A;  1PUF A;  3M4O J;  1Y1V J;  2TRT A;  3LSR A;  2R5Z B;  3TED A;  2EZH A;  2VI6 A;  1Q1V A;  2IEK A;  2YS9 A;  5IYC J;  4A3E J;  1F36 A;  1QRY A;  2JN6 A;  2ID6 A;  1LFB A;  5F1J A;  1JT6 A;  3I4N J;  3C2B A;  3GTM J;  2LKX A;  2X6O A;  4JP0 A;  5IYB J;  1VF9 A;  2DA1 A;  1LE8 B;  4A69 C;  1RKW A;  4M3B A;  2W48 A;  2HDD A;  2QCO A;  3DEW A;  2VKV A;  4B1R A;  2DA6 A;  1XC5 A;  3ZOB A;  5JLW A;  3MVP A;  3TP0 A;  5EG0 B;  2FQ4 A;  1IG7 A;  5IPA A;  2LR8 A;  3JRA A;  3HOY J;  3G1M A;  3BR2 A;  4DYC A;  3JRE A;  1T56 A;  1TWC J;  1IGN A;  2NVX J;  3ZQL A;  1F43 A;  2HOA A;  1B8I B;  2Y9Y A;  2Y31 A;  4RBO A;  2LLK A;  1IUF A;  2XRL A;  3S2D J;  2HXI A;  5BNG A;  3RKQ A;  1AU7 A;  2QF7 A;  4D5C A;  1JTY A;  2KDZ A;  1UMQ A;  4UUT A;  2XSD C;  1BL0 A;  4MLO A;  4DZP A;  3RZD J;  4DZJ A;  4X1E A;  1A5J A;  1IV6 A;  1NK3 P;  4A3I J;  3FK7 A;  4DYR A;  1X58 A;  2CUF A;  1IJW C;  2X9D A;  2WV1 A;  4JYK A;  3HGY A;  3A01 A;  1GV5 A;  3B6A A;  3S1M J;  1G2H A;  1H89 C;  2Y30 A;  2R5Y B;  2E2I J;  3IV5 A;  2ID3 A;  4XRM A;  5J1Y A;  3GBG A;  2OPT A;  3OOU A;  5F0H A;  2CQQ A;  2H1K A;  4MFE A;  1U8B A;  4V2F A;  5EZG A;  4Y52 J;  1RET A;  5K7Z A;  3HB9 A;  1IRZ A;  1JUP A;  2R7Z J;  2ECC A;  2LVS A;  4BY7 J;  4B4C A;  3BQZ A;  4QIW N;  1FIP A;  1GT0 C;  1I50 J;  1MBE A;  3BR1 A;  9ANT A;  1P7J A;  5IYD J;  3GTQ J;  5JLX A;  5EF6 A;  4QTR A;  1ZR4 A;  2CUE A;  2R0Q C;  5E3M A;  3HOZ J;  2E2J J;  4A3L J;  1A6I A;  4NDL A;  1I6H J;  1Y1W J;  1VND A;  1X2N A;  4G12 A;  2N8G A;  1O4X A;  3OSG A;  5C44 J;  5M3F J;  1VFC A;  1PUF B;  4XRS A;  4J19 A;  3PO3 J;  1QVU A;  1TWG J;  2FX0 A;  2MSY A;  3JRI A;  4I6Z A;  2NOG A;  2ZB9 A;  1CQT A;  2XPW A;  1WH5 A;  3A03 A;  1ZR2 A;  3UKG A;  1JKQ C;  4M3F A;  2FJ1 A;  1I3Q J;  2HXO A;  3I4M J;  1ETY A;  2HOT A;  2K9S A;  1XS9 A;  3S16 J;  1ETV A;  1GUU A;  3JRF A;  1WH7 A;  3HOW J;  4LOC A;  5F0F A;  5FKN A;  2K9Q A;  3IH4 A;  2NS7 A;  1NTC A;  3TP3 A;  3WHB A;  4B3A A;  3Q0W A;  1MBF A;  3GTO J;  1BW5 A;  2O7O A;  2O8K A;  3LOC A;  4BY1 J;  1HF0 A;  2JJ7 A;  5EEA A;  1SAN A;  2CRG A;  4JX5 A;  4A3G J;  3QPS A;  4V2G A;  3E7L A;  4RDU A;  3JRH A;  5E3L A;  3JRB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...