1ETKA

The crystal structure of e. coli fis mutant q68a
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
90
structure length
75
Chain Sequence
DVLTVKPLRDSVKQALKNYFAQLVNDLYELVLAEVEQPLLDMVMAYTRGNQTRAALMMGINRGTLRKKLKKYGMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACTOR FOR INVERSION STIMULATION
publication title Structural analysis of the transcriptional activation on Fis: crystal structures of six Fis mutants with different activation properties.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription activator
total genus 28
structure length 75
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1etkA00
2Y30A 2NS8A 1MBKA 3B6CA 3S1QJ 5C3EJ 2L7MP 1A6IA 2D5VA 3F0CA 3LOCA 2P81A 1JTXA 2DJNA 1U9OA 1JTYA 1JUSA 5E3OA 3GTMJ 3JRIA 5C4XJ 3IH2A 1HDPA 3BR3A 2XPVA 2L7FP 4AYBN 2CQQA 4A3JJ 2H8RA 2MGQA 3BR0A 5IOZA 2GLOA 2FD5A 2CUFA 2ME0A 3HOVJ 3TW6A 4JX5A 3HOYJ 1IUFA 2CQXA 5GPCA 3PO2J 4XRMA 2DA5A 2HXIA 2OF7A 4MIMA 3JRFA 1NK3P 5IYDJ 3BTIA 2K9SA 2E19A 2KDZA 2R93J 3I4NJ 1F36A 1Y1WJ 1JKRC 1MBJA 4FCYA 1NTCA 3S17J 2ME6A 3M4OJ 5IOYA 4A3DJ 1ETKA 2HOSA 3GTGJ 2DN0A 2Y9ZA 3G1OA 4JYKA 1WH5A 1MBFA 3OIOA 4XIDA 3ZQGA 1K61A 1OJLA 1ITYA 2NOGA 2JJ7A 2HOAA 1DU6A 5FKMA 4FE7A 3QPLA 3A01A 1AKHA 4BY7J 5M3MJ 3ZQHA 3CMYA 3GTJJ 4D7MA 3ZQIA 1X58A 1HF0A 3TW7A 1B8IA 4DZPA 2XSDC 5FLVA 5FKOA 2M8GX 1Y1VJ 3BTLA 3MN2A 5M5XJ 2VI6A 2K40A 4A3FJ 2HYJA 2DMQA 4AC0A 3IV5A 1ZKGA 1RESA 1BL0A 2XB0X 3GBGA 4DYQA 1GDTA 4JX4A 3GTPJ 2EZIA 1BW6A 4QSHA 2XGEA 3JREA 3RKQA 4BY1J 3BTCA 1AU7A 2XGDA 1AKHB 2B63J 5EZHA 1ORKA 4A3CJ 1IDYA 1O4XA 3WHBA 1JKOC 1NK2P 1OCTC 2WB1N 3ZOBA 4UUSB 3SFIA 2DMPA 3PM1A 3S2DJ 1ZK8A 4S0HB 1B8IB 2ECCA 3L1PA 5FKLA 4B1RA 4BXXJ 2Y31A 3BR5A 5E3NA 4D7NA 1MBGA 3C2BA 2NVYJ 4JX6A 3RZOJ 2I10A 2QF7A 3LSPA 4M3GA 4CYCA 3K2AA 2CUEA 2CRGA 2KT0A 2LD5A 2EQRA 2L9RA 4A69C 3HOWJ 5EDNA 1XG1A 5JLXA 1IJWC 3FK7A 3JRHA 2DA2A 2ID3A 2M34A 2DMNA 4QIWN 1T33A 4C3IJ 2X9DA 2R5ZA 1R9TJ 3RQIA 4ABZA 2M9HA 2VUMJ 3FK6A 3B6AA 1ETVA 4A3LJ 3BG3A 2L7ZA 5M5YJ 3QQAA 5FKKA 1MBEA 3S14J 1F43A 2IBDA 3O8GA 4I6ZA 1ETWA 3A03A 4CYCB 4M3FA 4BBRJ 2LFBA 2CJJA 2JN6A 2H1KA 5J1RA 3RZDJ 1RKWA 5F0FA 4BKXA 3S1RJ 3IH3A 4V2GA 3TP3A 4IEJA 3O8HA 1I6HJ 4I76A 4AUXA 2R5ZB 5FJ8J 1ENHA 1TWAJ 3QPSA 4LOCA 1POGA 1ZR2A 3HKZN 3Q0WA 4GFBA 2EH3A 3MVPA 5E3LA 1LFBA 4XK4A 5BNGA 4DYRA 3LSRA 1RR7A 2PMZN 2WV1A 2E2HJ 2ECBA 5DS9A 4G12A 4A93J 1JT0A 4A3KJ 2DA4A 1IC8A 4HNVA 4UUTA 2YU9J 3BQYA 3GTKJ 3JR9A 1W0TA 4DZJA 2NVQJ 5C44J 2NVXJ 1RKTA 3GTOJ 3BR1A 1I3QJ 3JRGA 1CQTA 3PO3J 5IPAA 5K7FA 1VI0A 1Z0XA 4MFDA 2VPRA 2LY9A 2FX0A 1QPIA 3K7AJ 1HLVA 4J19A 4DYCA 2HI3A 5K7HA 9ANTA 4V2FA 3H3VK 2GBYA 2DA1A 4UUSA 1JJ8C 1JUMA 1MBHA 5K7ZA 1I50J 1IGNA 2DA6A 2Y9YA 1APLC 1HDDC 4C3JJ 4D5CA 1SFOJ 2EBIA 1IRZA 1D5YA 3SDGA 2G0EA 5IP6A 3E7LA 1YRNA 4M3EA 3S16J 4A3IJ 4A3BJ 1TWFJ 1AHDP 3OSFA 2DTZA 3NAUA 1JT6A 3BT9A 1H8AC 1MH4A 1MSFC 2W48A 2X48A 1G2HA 3HB9A 1QVUA 2O8KA 1RPWA 5J3LA 3FIWA 2GM4A 5M5WJ 3HBLA 2XPWA 4Y7NJ 1GV2A 2JA7J 2K9NA 2JK3A 2TCTA 1WI3A 2ZB9A 3G1LA 3TEDA 1WCMJ 4XICA 2R92J 2LK2A 2TRTA 1B72B 4M3DA 1LE8A 2AHQA 1IG7A 5DTDA 4IHWA 2XGCA 3NARA 4D5FA 2OPTA 3G1MA 4A3GJ 2AO9A 2HQ5A 1ZTRA 4MLOA 2FJ1A 4A3EJ 1YRNB 1BA5A 1X2NA 1JGGA 4W1UA 5HODA 2E2JJ 2FQ4A 3M3YJ 1IV6A 1WH7A 1TC3C 3JRDA 2YUSA 3BR6A 3HOUJ 3HEFA 3S15J 4X6AJ 5EEAA 5EG0A 2LKXA 2RAEA 5GPAA 1U9NA 1GVDA 1E3OC 2EZLA 3JRCA 2DMTA 3S2HJ 1FIPA 1ZGWA 2LTPA 1LE8B 4BBSJ 3TP0A 5F27A 3CQZJ 1VFCA 2DA3A 3MKLA 4M6VA 3FKIJ 1Z77A 4L5EA 1FTZA 2JMWA 1MNMC 5C4JJ 4B3AA 5JLWA 3GTLJ 1JKPC 3DEWA 5F08A 4A3MJ 1PUFA 1MSEC 1JJ6C 2EZHA 1ETQA 5EG0B 2MG4A 2NVTJ 1FIAA 1ZR4A 3HGYA 2YS9A 2MW8A 3DCFA 2X6OA 3LNQA 1VF9A 5F04A 1S7EA 3OOUA 1ZQ3P 4FISA 5EZGA 2JA5J 3WHCA 1HCRA 1MH3A 3HM5A 1T56A 1WGXA 2L0KA 5IP9J 2QCOA 1BJZA 4XRSA 3BG5A 2O7OA 2ID6A 3SJMA 1UHSA 2M2EA 1ETYA 2DMUA 1WPKA 4X1EA 2DA7A 3IH4A 1PUFB 1A5JA 2CU7A 3I4MJ 1FJLA 5IP7J 3Q0VA 2VKVA 3HGGA 2HOTA 1HOMA 4QTRA 1TWHJ 1QVTA 4JP0A 3CCYA 1FTTA 3CDLA 1JUPA 1ETXA 4M3BA 1UG2A 1ETOA 1FEXA 2JA8J 2R0QC 3LSGA 4MO7A 2VKEA 1GUUA 2XRLA 3BTJA 4XRSG 2HDDA 2E1OA 1OFCX 1P7JA 1K83J 3S1NJ 3HDDA 1B72A 4IHXA 3FISA 1SANA 2M0CA 4IHVA 5J1UA 3BR2A 3HOXJ 3JRAA 2MSYA 5EYRA 2LR8A 2Y0SN 3ZQLA 3UKGA 1X2MA 2NS7A 2HXOA 2LVSA 2WAQN 3GTQJ 4FE4A 3Q3SA 4C2MJ 4MFEA 4W97A 3S1MJ 4DW6A 4RBOA 5EGOA 5E3MA 1U8BA 2ELKA 2JA6J 3BQZA 4EEFG 5IYBJ 5FLMJ 1U78A 4C3HJ 4B4CA 2LLKA 1W0UA 5IYCJ 5F0CA 5EF6A 5J1YA 1OCPA 2IEKA 4NDLA 1TWCJ 2R5YA 1XS9A 1LFUP 1Q1VA 3A01B 1EF4A 2N8GA 4IHYA 2K9QA 2E2IJ 1UMQA 1RETA 2COBA 3A02A 3VPRA 1JKQC 1TWGJ 1DU0A 2IAIA 3H0GJ 1GV5A 5EGOB 5GP9A 3BG9A 5F0HA 1QRYA 3HOZJ 1H89C 1XC5A 5M3FJ 1GT0C 2EZKA 2Y2ZA 3W6VA 2R7ZJ 1IDZA 5F1JA 3OSGA 1BW5A 1P7IA 2JWTA 2LP0A 4FTHA 3Q0UA 3ZQFA 3D1NI 2O9LA 2R5YB 3JRBA 2XPUA 4RDUA 1VNDA 2XB5A 3ZQCA 4Y52J 3LSJA 5FKNA 1H88C
chains in the Genus database with same CATH superfamily
4I0BA 3ABUA 2NS8A 3B6CA 4DGWB 3WG9A 4ESJA 3UNGC 3U2RA 3S1QJ 5C3EJ 2DCEA 2KZVA 2LDUA 2KHMA 3LOCA 2HZDA 5J6XA 5DCFA 3GEZA 1MJAA 3H0DA 1FBUA 3JRIA 2VKHA 3CC7I 4AYBN 2LSOA 1W5CC 3DXJF 2YR2A 5IOZA 1J75A 1KYWA 4CCNA 2WA0A 1R5GA 4XM3A 3JW4A 4PJ0C 2NNYA 1YW8A 1LEAA 1B6AA 1HQCA 3E6CC 1ZARA 2OUMA 1TLHB 1VQ5I 1IUFA 3HOYJ 1ZELA 4NBQA 4XRMA 2DA5A 1MMGA 4KIBA 2L5QA 4PJLA 5IYDJ 2DOEA 2M4GA 4FQGA 4MIMA 2VQLA 2K9SA 1Y8QB 5FROA 1I39A 1Y0UA 1Z6TA 2Y75A 3VFZA 3K4CA 2R93J 3DBHB 1B9NA 2BBYA 1E0EA 1F36A 3QU3A 3H5NA 1MJ9A 3Q9SA 2ME6A 3G73A 1QBJA 4HYEA 4O6JA 5TGTA 2HOSA 2DN0A 1IXSB 1BR2A 1N78A 1D3YA 1U6GA 2TDXA 1YTYA 1TNTA 1YO5C 4BHBA 2DK8A 1MBFA 2CG4A 3RIRA 5IT9K 4IPAA 1U8RA 1MD0A 4C9YA 4X0GA 4Z6YA 3M07A 3GXOA 2YX4A 2EA2A 3KFWX 1IRXA 5FKMA 1DU6A 1WZ2A 2WBMA 5BS6A 1FZPB 4IOAF 4P55A 4BY7J 1FYLA 3BZCA 2Y0MA 5M3MJ 3ZQHA 2K3FA 1CF7A 4ENNA 3GO5A 4D7MA 2BGCA 3CD6I 4EVIA 1X58A 2XSDC 4A6DA 5FLVA 1A04A 3BTLA 3KP2A 3LFUA 3RJPA 1E3PA 3SDBA 1WHUA 1GXQA 2GOXB 4AC0A 1ZKGA 3H3ZA 3FXMA 3DU5A 3JAMK 2XC7A 1TW2A 3GBGA 1GDTA 5E20A 4JX4A 3H3UA 2RKHA 3JTHA 4IKFA 1UG0A 4BXFA 2XGEA 2PG4A 4LG3A 5DCMA 5L3BA 1O3RA 1X19A 2EJRA 3ML6A 2EFNA 4A3CJ 3WHBA 2FOKA 2H6CA 4B48A 4EV0A 1JKOC 1CF7B 1NK2P 3ZOBA 5EJCA 2VC1A 1OISA 3DTIA 5B1AH 4U88A 1BIAA 5F6FA 2L9SA 4AWXB 1FOXA 2GWRA 5FKLA 4B1RA 4L9VA 2UWMA 3BR5A 3X2QH 4D7NA 1MBGA 2DPUA 4BQNA 3CJTB 2NVYJ 3FDYA 3LSPA 1SAXA 3GFMA 4M3GA 4KN7X 2VBYA 3ABLH 2CRGA 4A5NA 3FXKA 3MCZA 5DCMB 1YIJI 1WRJA 2ZO4A 2MC3A 2COMA 5EDNA 4F92B 3FXOA 4PFPA 5JLXA 2LOOA 4M9ZA 4PCQA 1IF1A 4EMSA 1BIBA 1T33A 1R9TJ 2X9DA 3GLLA 4CZCA 1BBYA 3K4NA 1TTYA 3DV8A 1XGNA 1XD7A 4DBRA 4LGWA 3PUFA 1QU3A 2VJJA 3HHGA 2KDOA 4NB5A 5FKKA 4ZJZA 5LRSA 3S14J 2JSCA 1DUXC 3O8GA 3E6MA 1ETWA 4CO8A 3A03A 1YFHA 3K4KA 4M3FA 2IS4A 1AOYA 2LFBA 2MD5A 2CJJA 2ZCWA 1JHFA 1ON1A 3RZDJ 3IAS2 3S1RJ 1DP3A 4ASNA 1Z7UA 4XMYA 4ZYDA 3QODA 2RV8A 3TP3A 3W6KB 4IEJA 4BYYA 4OIQF 1K79A 1I6HJ 3GFLA 4II3A 4I7HA 3QPSA 2IJLA 1YHQI 1POGA 1UHWA 3SQNA 2FOWA 1SD7A 3MVPA 2EFWA 4Y15A 3CCVI 5ILUA 1D5VA 1OCZH 2E2HJ 2ECBA 5FB2A 5DS9A 1SVMA 2XIGA 3QP5A 3R60A 1QZEA 4L9JA 3E1SA 3JR9A 1HXDA 4DZJA 3MEXA 5DYMA 1AA7A 3BWGA 4GYGA 1RKTA 4HDUA 3CO7C 1VQ4I 3BR1A 1I3QJ 3GTOJ 4CYDA 2K9LA 2MA3A 1EKEA 3QPHA 3E97A 4OIRF 1V5GA 1Z0XA 1WJCA 3ROUA 1QPIA 3R0AA 4XLAA 2PMHA 3LWFA 2M30A 2WY7Q 4M71A 3OYKA 4HG2A 1FMVA 2L2OA 3S8PA 1LDKB 3FBNB 2GXAA 2K7LA 2R7OA 2K27A 2L7KA 3U9GA 2GBYA 2X1DA 2DA1A 4RLQA 1MBHA 5AIQA 2W00A 1P4XA 3VYSB 2Y9YA 2LC2A 3QAHA 4C3JJ 4L0ZB 1W36C 2BW3A 2EBIA 1DPRA 4BEHA 1D5YA 2KQRA 2L9VA 3AG3H 3WTXC 1YG2A 4OMZA 3ZN1A 4BNCA 3I5UA 4LLLA 4RGRA 3RDIA 3ZGKA 2VT3A 1AHDP 4J01A 2STTA 2GQQA 2RREA 3ZCOA 1N75A 2B7EA 3NAUA 2EV6A 1H8AC 1MH4A 4Z2YA 3HOTA 1R7JA 1SD6A 3FIWA 2M45A 2XPWA 4QLCU 1FX7A 1GV2A 3D5LA 4Y7NJ 1WI3A 2L9NA 4II2A 2W84A 3A1YA 4XICA 2MYSA 1SAUA 2MH2A 4WWCA 3CC4I 2DK5A 1UJ8A 1R58A 3K0LA 2VPLA 1IG7A 2BW3B 3OR2C 4BEHB 1C0WA 2VXZA 4MLOA 3EUHC 1ACIA 2HQAA 2MH9A 4XKVA 5HODA 4IJAA 2E2JJ 3WE3A 5HNFA 3M3YJ 3TOBA 2JZYA 1WH7A 3F9KA 3V42A 3VYRB 5ED4A 3CCUI 1KA8A 3AG2H 5BPIA 2BV6A 3RYPA 3ZRGA 1EH7A 3I55I 5EG0A 1KGSA 2IGNA 2RAEA 3J81K 3M8FA 5B3SH 2MD0A 5GPAA 1Z05A 1GVDA 2EZLA 3DWLE 1OYWA 3ASNH 2WADA 3TP0A 3IKTA 2EIKH 4LLNA 1VFCA 4XN0A 2Z5UA 1ZLKA 2MLKA 4M6VA 2DFEA 3GUDA 5AIPA 3VSLA 3HHHA 2KKOA 3FKIJ 1UB9A 3K4MA 2OBPA 2JMWA 5CVRA 3QOPA 4BQQA 4HX8A 5ICFA 4B3AA 2QENA 1JKPC 2QQ9A 4XNFA 4MTEA 3PNVA 3L9FA 5F08A 1MSEC 4PFOA 2X4HA 2XF5A 3IL2A 2W82A 4FX4A 5EG0B 2R7WA 2CGPA 2NVTJ 2ZKZA 3DCFA 2FMLA 5HDGA 5EEHA 3E3VA 3LNQA 1VF9A 1TZLA 4IVNA 2KPMA 2A6HF 4UB8C 3RKWA 3WHCA 5D5VB 1LEBA 4IL6C 3HM5A 3PSIA 2F4OB 3M1EA 3MWMA 1D0YA 2E1CA 4L0YB 3LSKA 4ZC3A 1HSJA 3CP8A 3T0YA 4EGYA 3SJMA 1UCRA 5LHGA 4A0YA 5L3GA 4AYBA 3IH4A 1MZBA 2HVQA 2GA2A 1FJLA 3BY6A 4KFCA 1T6SA 3HGGA 2KFDA 4P1WA 1RI7A 1ZH5A 4RS8A 1V3FA 4QTRA 2ISYA 2F4MB 1QVTA 1FTTA 3CCYA 3HXLA 4O3MA 1ETXA 2LY1A 2JA8J 4BDYA 3FM5A 2LY2A 3LSGA 4MO7A 5DD4A 1GUUA 3V4GA 3BTJA 1W7PA 2E1OA 1P7JA 2Z1DA 1N77A 2IW5A 2FF4A 3OL4A 4NC8A 3GZ5A 3ZMSA 4EM2A 4HPQA 3FISA 1Y6IA 4IHVA 2L54A 5J1UA 2DYRH 2LG4A 4BJTA 3VOEA 4IRGA 4A12A 1ULYA 1DGRM 2MSYA 1XMXA 2DDBA 2X0LA 4A2UA 4V19K 1Y39A 1X2MA 2GA1A 1G3TA 3K70C 2P5VA 4XKBA 3MQ0A 5L3CA 3BP8A 3ONQA 2VOOA 2W85A 3F23A 1ONVA 4C2MJ 4XKCA 2A61A 2VL8A 3AL0B 3DTKA 2IRFG 2ELKA 3JSOA 1W7PB 1BC7C 5KK1A 5IYBJ 5FLMJ 2FRHA 2XUBA 2Y0SA 2JPCA 4B4CA 2PLYA 5IYCJ 2VONA 1X1DA 1P2FA 2ZJPF 2CW7A 3DPTA 3GCMA 5LGTA 4CHUA 2E2IJ 1UMQA 1EV7A 1RETA 2RNGA 5D4SA 3HRMA 1JHHA 1T08B 3VPRA 1JKQC 1TWGJ 3DBLB 1HA8A 4Y33A 1I6XA 5E18F 1FBQA 2RDPA 3WTWC 3J7AO 4XLFA 5GP9A 3PJRA 3RSNA 2V1DA 1XC5A 4MGRA 5M3FJ 2G7UA 1IDZA 2Q8KA 2JWTA 2K5CA 3KLOA 3E0JB 4FTHA 3CO6C 3JRBA 3P9IA 3KZIC 2XAHA 4ZZLA 4NC6A 4RDUA 1NG7A 4M6XA 5HLTA 2MBFA 3I58A 1R36A 1YQAA 3HSEA 1H88C 2Y30A 3BOQA 3CTAA 2AQEA 2QBYA 3EQLF 2QQ8A 4YIFA 2GXBA 1BI3A 1W1WE 2L7MP 3M8EA 1A6IA 1XDUA 2P81A 2BOLA 2Z33A 1U9OA 1JUSA 4EJUA 4NHJA 5C4XJ 3IH2A 2XPVA 3BJOA 2CQQA 1I1GA 3C7JA 2MGQA 4L5IA 2VJIA 1IXCA 3RPQA 2CSOA 3TOAA 1G4DA 4NQWB 5GTIC 3ERMA 5ILSA 4ENKA 3CDHA 3PO2J 5GPCA 2I5UA 4HBLA 4LK0F 3KP7A 3KYLA 3S3MA 2HXIA 3GWZA 3RPUD 2V4JC 2QSFX 1RC9A 3JRFA 2QBYB 2CFXA 2V26A 1WJ5A 3BTIA 2NRAC 4KISA 4AVZA 1FYKA 3SHFA 1VQ6I 2VBZA 2WWYA 3CCMI 3CLOA 1R6RA 1LNWA 4FCYA 1NTCA 5IOYA 1YW7A 1SVLA 3I59A 1YJNI 1E3HA 3DFGA 4Q4ZF 4BHCA 1UHMA 4OINF 3ZQ7A 1K78A 2JRMA 3L00A 1WH5A 4JYKA 4XOPA 1SMYF 3OIOA 2W7NA 3OIPA 1LQ1A 2P6TA 4HAMA 4YELA 1OYIA 4I2OA 1OJLA 2AXLA 2IGOA 3CCRI 1ITYA 5JHFA 2NOGA 2OTLI 2JJ7A 4F3QA 3K70D 3GVAA 3EUKL 2H27A 2R7QA 5LEJA 1FOYA 1MW7A 1DDNA 1ZLJA 5IY5H 3GTJJ 2IXSA 2A5YB 5JI6A 1HF0A 3TW7A 4IXAA 4YFKF 3MD2A 4A0ZA 5A2QZ 3MN2A 3OS0A 4CCMA 2A05A 2HYJA 1RNLA 2DMQA 3T1BA 1RESA 1GHCA 1K78B 1DP7P 2NS0A 2BZTA 3WODF 3R6SA 2O3FA 2FU4A 2RGVA 4UVBA 3JREA 2CV1A 3E5QA 4EJWA 4BY1J 2V79A 4PZJA 2VBXA 2W57A 2XGDA 2HDCA 4M72A 1QQIA 3IKVA 4Q48A 1QGPA 1IDYA 3I71A 4CA0A 3L2RA 4UUSB 2KJBA 3F8MA 2IGKA 4OOIA 3ABMH 4ZZDA 4BDZA 4XSXF 4BQOA 2ECCA 3K10A 1VQ8I 5H20A 2UUZA 3LQRA 4BXXJ 2Y31A 3G3ZA 3C2BA 1KONA 2DTRA 3C3WA 2CUZA 4JX6A 4CICA 2QF7A 3LMMA 4HQEA 1G6NA 2BY1A 1REPC 4GDFA 2KT0A 4EM1A 1FC3A 1MIJA 1V4RA 3H5AA 3HOWJ 1XG1A 3WU2C 1F9NA 2PFBA 3RKXA 5KNLA 1KU2A 2DMNA 2VE8A 2UZKA 2VOPA 3RQIA 4RAFA 4ABZA 2PJRB 2JT1A 3FHNA 4Y17A 3CUOA 1ETVA 3HJEA 3BG3A 2L7ZA 5E1XA 1OR7A 1ZG5A 3FX3A 5KVRA 2BEOA 1PYVA 4EJOA 5HNHA 1H9TA 2ZSIB 1Y8RB 4I6ZA 3VEPA 2XROA 5D6EA 4Y13A 2KRHA 1Z1DA 2HVSA 2XKOA 4CXFA 3HIFA 5ILVA 3DTEA 1G3WA 2DQLA 4L9TA 5F0FA 1R5ID 4BKXA 2LREA 4RGUA 1YS6A 4HLXA 3M8JA 1BI0A 5CVIA 3F8FA 4AUXA 5FJ8J 1BOBA 4TV7A 1ZR2A 3HKZN 1RUOA 2K4JA 2V7FA 5E3LA 1WWXA 4MEYF 5BNGA 4ZDPA 1D0XA 4FT8A 1YX3A 2WV1A 1H0MA 1G3YA 2STWA 2H09A 1JT0A 1BN5A 4A93J 2EV0A 2DA4A 3KEOA 1IUYA 4UUTA 3BQYA 3GTKJ 4L9NA 3OL3A 5LLQA 2NVQJ 3H9JA 2LH9A 4LIVA 3DKWA 1ZAOA 1CQTA 2C6YA 4WXDA 3LSTA 5IPAA 2QVOA 5K7FA 4MFDA 2VPRA 2XHKA 4KICA 3K7AJ 2VE9A 3BZKA 4DYCA 1YS7A 2F6CA 4ANJA 2JQ7A 2KIQA 2E60A 3LA3A 4V2FA 4NUBA 5DDGA 4AIJA 5FD5A 3SXYA 2AS5F 1GVJA 1SC7A 4GYIA 2BYVE 4ZDLA 4HV6A 3A4CA 3KYDB 1D8KA 1I50J 4YFXF 2DA6A 5HS8A 1APLC 1HDDC 2CW0F 3DF8A 4R8HA 1GXPA 4I01A 5D8LB 1K4TA 4IHSA 2HKXA 3SDGA 4WK8F 5IP6A 1PJRA 4A3BJ 1QZYA 2QWWA 3HTSB 3OSFA 2AXTC 3MKWB 2O8XA 2LKPA 4R79A 2Z2SB 3BROA 4I99C 3ZN0A 1MSFC 1J5YA 4ON0A 5B66C 2X48A 1G2HA 1FY7A 1QVUA 4K2EA 5J3LA 2PMUA 3HBLA 4XRFA 4LITA 2VASA 3G1LA 3TEDA 3ECHA 2J5OA 1B72B 1WJDA 2A5WA 2PN6A 2HQNA 3CJRB 1S5LC 5LBQA 3GFIA 2HEOA 2QSGX 3ESWB 2OPTA 3G1MA 3CUQA 2VJ5A 1OCCH 4UXNA 5E1ZB 2I8DA 2IGMA 4PSWA 2BHYA 4G7ZF 4W1UA 4MNUA 1F1ZA 1QNTA 2QKLB 2GIZA 1XSDA 3BR6A 3HOUJ 3RCOA 5E1WA 2FUG2 3S15J 3VB2A 5LHIA 2LRDA 2LKXA 3I53A 2RQPA 2XGXA 5K5RA 2LKSA 5D6FA 3P7NA 3Q9VA 1E3OC 5B5EC 5JVTA 4N9HA 3J7ZI 3CUQB 2FNAA 1V5FA 2K02A 2M3AA 5E8GA 2E7WA 1FTZA 1IN8A 4BACA 1MNMC 1X1CA 1YLFA 3BG7A 2HDWA 4M6YA 3W2VA 3G6EI 2QQAA 4BE1A 1J9IA 3DP7A 2D1VA 5J4VA 2HFHA 1PUFA 3HG9A 4A3MJ 2ETHA 3D5RC 1JJ6C 3U21A 3H1CA 1U5TA 3HGYA 2YS9A 2MW8A 5FLXZ 3GX4X 3TKYA 3QOEA 3TQNA 5CVUA 4CCOA 4C2TA 5F04A 1D8JA 4PJMA 5EZGA 2JA5J 1VQ9I 1MH3A 2MABA 1IV8A 1T56A 3LA2A 2FXAA 2YSRA 3GZ6A 5KAFC 4HLYA 1WGXA 2ZSHB 2CO5A 2NVUB 2ZFUA 2L0KA 4EQQA 2QLZA 5IP9J 3BG5A 2O7OA 1LDDA 2KLOA 3V8LA 4YRVA 3SZPA 1DPUA 1UHSA 2M2EA 3OS1A 3TMOA 2BE5F 3F8BA 1PUFB 1A5JA 5J8FA 1J59A 1MMSA 5JR3A 3OYDA 3I4MJ 5IP7J 4MEXF 3SEZA 3PNYA 1Y56A 3Q0VA 1MNEA 2HOTA 1U5TB 3SZGA 1B1BA 1HOMA 1EA3A 2YX7A 1QPMA 3CDLA 2ELJA 1XB4A 4M3BA 1UG2A 4N0BA 3MZYA 5D4RA 4HF1A 4UB6C 2R0QC 4F93B 4UVCA 2HNHA 3SFZA 4AIDA 5HS9A 4ENJA 2VKEA 3HSRA 1J09A 2H6BA 4DJAA 1K83J 4E7IA 2M0MA 3HDDA 4CCJA 4IHXA 1S72I 2M0CA 4RLFA 1A36A 3PSFA 3JRAA 2BVLA 2DYSH 2A68F 2IS6A 2OD5A 1O3QA 4OMYA 5CQEA 2K9MA 2R4GA 2NOJB 3UKGA 2LVSA 2WAQN 3OV8A 3AFHA 1J2XA 1BR1A 2P4WA 1HW1A 2K85A 4GRIA 4W97A 1YJ9I 2KISA 4RBOA 4U0YA 1R71A 1LDJA 2HGCA 1U8BA 3PQJA 2LBFA 3DU6A 1MJBA 4EEFG 2PJPA 2P5KA 1ON2A 1TQMA 5CLSA 1DQUA 4C3HJ 4LK1F 1W0UA 3AAFA 3DLLF 5EF6A 3S3NA 2IEKA 2ADUA 1XS9A 2KIMA 4BE0A 2CWEA 2X1EA 4HX7A 3A01B 1Z9CA 2EFPA 2N8GA 1LJ9A 2ZJRF 3S32A 2M7AA 1KU3A 4JQFA 1EH6A 3A02A 1T8IA 2KJCA 3V7SA 2XAQA 3W2WA 3PUBA 1J0RA 3BG9A 5F0HA 1VTNC 3HOZJ 2LBFB 2P7CB 3M1CA 4UHTA 5F1JA 1BW5A 3F22A 3DQVC 5FFXA 2LP0A 1R49A 2HOEA 2ISZA 4R1HA 1LPQA 3ZQFA 2P0WA 2HKOA 4FX0A 4GGGA 3CMEI 2DT5A 1R4MB 2G7HA 5D5UB 1FP1D 1FWZA 3AL0C 2XPUA 4KMUX 2E1MB 3K9TA 3TO7A 3CP2A 3LSJA 1KYZA 5BQTA 1K6YA 3CCJI 1FP2A 1XCVA 3CF2A 2D5VA 3F0CA 3I4PA 3BJAA 3C2GA 1S7OA 5E3OA 1JTYA 2DFHA 1MKMA 2NYXA 3LQQA 1HDPA 2IA1A 3OYHA 2H8RA 5HLGA 3FF5A 2EPFA 5A2QK 3BR0A 1XMAA 3ULQB 1T0FA 2W25A 5HS7A 5LRRA 3VYTB 2OZUA 4E7SA 3PIPF 2HTJA 1D1AA 4DBQA 2GLOA 4M73A 2FD5A 2CUFA 2X1CA 2GAUA 1TBXA 2CYYA 3TW6A 2BY2A 4JX5A 2CQXA 2VODA 2FQ3A 2KZGA 4YIIA 3TL4X 2O6GE 2HU9A 4D1QA 1T39A 2CQNA 1S7AA 3WTUC 1NK3P 2R7RA 1USSA 2LF8A 2OQGA 1IN4A 4G7HF 2ZFWA 2XSJC 2ZMEA 3JCUC 4PUSA 5LHHA 1Z3YA 3KEYA 3H36A 2JPBA 2FE3A 1KZHA 1MMAA 4XN3A 3F8NA 1JKRC 4CCLA 1T2KA 3KZYA 3HRTA 1S8NA 4N9IA 4A3DJ 1ETKA 4XLEA 4AVPA 4DOZA 1WJBA 3E6BA 3K1MA 3GTGJ 2HQRA 3IUOA 1W36D 4E7JA 5LD2C 2A69F 3G1OA 1IRGA 3B02A 4XIDA 2ZJQF 3I0TA 1I5ZA 2E5NA 3ZQGA 4FASD 4UV8A 5HDNA 2V9PA 1F5TA 2JVGA 5CYVA 5D8KB 2HOAA 1P4WA 3M7GA 3OIQA 4FE7A 3QPLA 4HX4A 3MFKA 2P5LC 3EPZA 1AKHA 1V54H 1XGSA 3ZXSA 2ZMEB 1ZRCA 2VQCA 2IPQX 3CMYA 1V5EA 3FBIB 2VXDA 5ICCA 1O57A 2ACJA 1X3UA 1R1VA 2BHZA 2M8GX 5HOOA 4YFNF 1G59A 2PQ8A 2K40A 2VI6A 4A3FJ 4H0EA 4U87A 2DXIA 3OYLA 1BL0A 3N05A 3GTPJ 5AONA 4I98B 1WI9A 2CW8A 3T8TA 3BDDA 1BW6A 4GO1A 1U0JA 3FMSA 2DOFA 2F5DA 3BTCA 4MQVA 1AKHB 2B63J 4N4OB 4RM2A 3ZR8X 5EZHA 1ORKA 2W24A 4AU7A 4ESBA 4G8XA 5LGUA 3R4KA 3LAPA 1OCTC 1OLTA 2WB1N 4LD5A 3SFIA 4CH7A 2DMPA 3L7WA 3PM1A 4KITB 2HTSA 1HW5A 2V9VA 2XAJA 4OU0A 4S05A 1B9MA 3I9V2 4HW0A 3L1PA 3QYFA 3CMMA 4AIHA 5L3EA 3ZP5A 2EILH 1ZREA 5J47A 1CGPA 4XL9A 2D2WA 5E3NA 1PDNC 2Q0OA 4CZZA 2CH0A 3H92A 3L2VA 3N4MA 2QUFA 2E7XA 5J40A 1ZG3A 3OS2A 1QO0D 2EQRA 3HRSA 4PJJA 2JUGA 4NQWA 3JSPA 2L9RA 3QYEA 3FK7A 3JRHA 5FGMA 4D9JA 3K4BA 4C3IJ 1ZG1A 2M9HA 3H9GA 3EYIA 4RB0A 3ABKH 1IN7A 4BGDA 2PBIA 1OMIA 3COAC 3HL2A 2EWNA 1X3WB 3GLXA 1MBEA 1N25A 2XV4S 1F43A 1IN6A 2IBDA 3ISPA 5CVVA 3BJ6A 3CJQB 3J7YJ 4FHTA 2KMUA 4BBRJ 2H1KA 3ZPLA 1NHAA 5JHUA 2P7VB 1HKQA 1RKWA 2Q2EA 3CF5F 3IH3A 4V2GA 4MHGA 1P4AA 1R23A 1HC8A 1PP7U 1RIOH 4I76A 3OMYA 1X1AA 3WTZA 4HNTA 3E5XA 3IRRA 3B73A 3ERED 1TWAJ 2OCCH 1BR4A 4IZZA 5FRNA 2E1NA 2M87A 2EH3A 3CCLI 3LSHA 3G71I 3LSRA 1RR7A 2PMZN 1IO2A 1FOWA 4HA8A 3FMRA 1R22A 4B43A 4HQMA 4A3KJ 2CV2A 4HZFA 4G6QA 4HNVA 2YU9J 3NEUA 1VQ7I 2R3SA 2ESHA 4DIQA 5C44J 2NVXJ 2Q2EB 3KLNA 2DDAA 4PGHA 4G6TB 3JRGA 1FSEA 3PO3J 1S6LA 1IXRC 3C1DA 4H4KC 2EINH 2LY9A 2VKDA 3CLQA 2VT2A 4RB1A 4LG0B 1NG6A 2HI3A 5K7HA 3HOSA 2JTVA 1JXSA 1YE9A 2WAFA 9ANTA 4ZYGA 2BXZA 1KQ0A 2CV0A 5BPDA 4UUSA 1JUMA 1FPQA 2V9KA 5K7ZA 1VQOI 3J7AY 3WTYC 5H6RA 4IRIA 3BC8A 3F6VA 4D5CA 1SFOJ 3M9AA 2X6XA 4WXCA 4EGZA 1VQKI 4IQJA 2G0EA 3E7LA 2XVCA 1YRNA 3QU6A 3CCEI 4HDVA 3VSKA 4A3IJ 3D5SC 2ZC2A 1TWFJ 2ZXIA 1WJFA 3BG6A 1OR7C 1TP4A 2JSPA 5F64A 2XRNA 2R7TA 1JT6A 3BT9A 4KJZA 2W48A 3LL7A 3L09A 2VB6A 1L0OC 3S3OA 3TDUC 1HSTA 3A2KA 1RPWA 4NC7A 2NNNA 4U0VA 2HYGD 3RQ4A 1YITI 3VDXA 1UAAA 2JA7J 2K9NA 4U7BA 3WTSC 2TCTA 2DOAA 4I09A 4DQ2A 2PJRA 1WCMJ 3R0JA 2UXXA 2LK2A 4OAYA 2TRTA 1P92A 4XLPF 4M3DA 1LE8A 2V1NA 2DJIA 4ZH4F 2XASA 3K1NA 1YYVA 2XGCA 3NARA 4D5FA 3ZMVA 5ICGA 4IX7A 2OTJI 2HQ5A 4L5JA 4B09A 2FJ1A 4A3EJ 1YRNB 1BA5A 1X2NA 1JGGA 3O6BB 5DUIA 2RNJA 2FQ4A 1BJAA 2FMYA 3BCBA 1F4KA 1TC3C 1I1SA 2XAUA 4RB3C 2R7XA 2OAZA 2DFFA 1UELB 2FBIA 1SEUA 4X6AJ 3MAJA 2F2EA 5EEAA 3HPHA 2HYFA 4BE2A 2ZNYA 2PI0A 1IZ1A 4YG2F 2XAFA 2XF6A 3JRCA 2DU9A 3S2HJ 1FIPA 5DEQA 1LE8B 4KT6A 3KCCA 3KP4A 4HRIA 1FYMA 3CZ6A 3CQZJ 2DA3A 5GADJ 2WTEA 4G7OF 3IC7A 4AD9A 3WTVC 2WC2A 2ELHA 3IWZA 2F5FA 5E79C 2W1OA 4L5EA 4B8XA 4B3XA 2FBHA 2DT7B 1Y0NA 2QM3A 3K4LA 1SFUA 5C4JJ 2IVMA 4PDKA 2V1XA 3JTGA 5TJJA 1P9QC 4P9UA 3KPHA 4XLCA 3KX2A 2HPMA 4UV9A 2F5EA 2K3PA 2MG4A 4QWQA 3SZTA 1FIAA 1TW3A 1BI2A 4PJNA 2ZNZA 2V6EA 4XKWA 3J80Z 1S7EA 1XGMA 1W5TA 2XAGA 2O61A 3OOUA 2F5VA 4FISA 1HCRA 2R7UA 4YIRX 2H8WA 1USTA 4RA2A 3SYTA 2BVMA 3AG4H 4S04A 2OU2A 1PVEA 4IOCF 1Z67A 1FLIA 4XRSA 2XKPA 5HLIA 2ID6A 4BJ5C 1ETYA 2L02A 4KT5C 4B44A 1EH8A 2DA7A 4IF4A 2BY3A 4HV5A 2R7DA 1SMTA 4Y3OA 5LEKA 4E7KA 1TWHJ 1X4OA 2L4MA 3CUQC 4JP0A 5D5WB 1M1EB 4RB2C 1V55H 1ETOA 2NAZA 4ESFA 2RN7A 2OZ6A 1T38A 2ZXJA 1Q1HA 5ICEA 2DI3A 2F5CA 2EFQA 3I54A 2HDDA 1OFCX 3AKZA 3BCAA 1B72A 1QHHD 5TRDA 1SANA 1KU9A 3L2CA 3HSFA 4JOMA 5CQGA 1HW2A 2GIVA 1K6OA 3VWBA 1TNSA 3T5XA 2LR8A 2Y0SN 2M4KA 1OQYA 4KN4X 2NS7A 4RAYA 3GTQJ 2CMPA 4RAGA 1U2WA 4MFEA 1XPXA 1FNNA 2B0LA 1W5SA 3OOPA 2EA4A 3DPLC 3O3KA 3FMQA 3DBRB 3Q5FA 2JA6J 3BQZA 2OCEA 3GW2A 2QA4I 4MQ9F 2A6TA 3HUGA 4P5OA 3EUAA 5DUKA 1QHGA 5TISC 2EB7A 2LLKA 1U5TC 5F0CA 4ZTJA 1OCPA 1TWCJ 4OIOF 2ZBKA 3K4JA 4CDGA 1LB2A 4GCVA 3PFYA 1EF4A 2X6YA 5DM7F 1XSVA 2K9QA 1TT0A 3MKYB 3N97A 3HC7A 5ERIA 1W4MA 2COBA 2JUCA 4LMYA 3SEQA 1DU0A 3V8JA 3PQKA 4E7HA 1I27A 4LFUA 4OWRB 3GFJA 3H0GJ 1XGOA 3KZZA 3W6JB 4MTDA 4KA4A 1H89C 2J5PA 4O5VA 5KAIC 5KCMA 5CVJA 1GT0C 1BI1A 2Y2ZA 2R7ZJ 3ZMTA 3OSGA 3HUGB 4JBAA 1P7IA 1OCRH 1XN7A 3FXJA 2M5WA 3D1NI 1SFEA 1OCOH 2WB1A 2O9LA 3FKJA 5FD6A 2YPRA 5IT3A 1IW7F 4E7ZA 4WCGA 2XDVA 2XB5A 3ZQCA 2DAOA 3LSMA 2VLAA 4Y52J 2E19A 1OYYA 1OPCA 1ZHFA 1MBKA 3MZHA 2FSWA 3MZ8A 3CDIA 4Q5SF 2A3SA 1XMKA 4PK4A 1EJ9A 3U1DA 2E34A 2XF7A 5FFZA 1I3AA 2IA2A 1XDSA 1JTXA 2DJNA 3GTMJ 3BR3A 3KEQA 2L7FP 4A3JJ 4J00A 3W2AA 2CFOA 1WKMA 2FEZA 3AG1H 4EATA 3NQOA 1LVKA 1MMNA 2P6SA 1WQ2A 5FRMA 1SFXA 2ME0A 3HOVJ 4GXOA 4HF2A 5K1YA 1D1BA 3WG7H 3K2ZA 3OYCA 3CCQI 2OF7A 4RGSA 1XSXA 2Y48A 3F3XA 2KDZA 2BY0A 2HVRA 3TO6A 3P5JA 5L3FA 4U7DA 2QEXI 2IS1A 2AQFA 3P9CA 3I4NJ 3CJNA 5HDKA 1Y1WJ 4B47A 1MBJA 3L2UA 4C2UA 2E1MC 2OC6A 3S17J 5E17F 3M4OJ 3K6GA 2B9SA 3RI4A 2Y9ZA 1RUNA 1SD4A 3E6DA 2DFIA 4G9YA 2VQGA 1G8XA 4F91B 2QZ8A 2LF7A 4ZYEA 2HWVA 1K61A 3F6OA 2GXGA 2PEXA 2PMZA 1K4SA 4L18B 5E8IA 2QSHX 4JK1X 2F4IA 3A01A 1O3TA 6PAXA 2Z99A 3KIOA 2HS5A 4RAZA 2E36A 4QPOA 5CPRB 2GOMA 1K7AA 1ZGAA 1VQNI 4XQFA 4ENMA 1RRJA 1DGWY 3ZQIA 4LJZF 4P96A 3D0SA 4DZPA 1B8IA 3DPUA 5FKOA 1Y1VJ 5M5XJ 1QA6A 1X1PA 1MDMA 3OR1C 3DLAA 2IS2A 3OY9A 3IV5A 1TQIA 4F52A 2XB0X 2EFOA 4BS9A 4DYQA 3ZMZA 2EZIA 3OYMA 1SFKA 2HPIA 4Q47A 4QSHA 3RKQA 2KP6A 1PP8F 3KYCB 1HBXG 2ZXWH 1YIOA 1AU7A 2RC4A 3VODA 1T0FC 4UUVA 2DT6A 4RM3A 1O4XA 3T8RA 1PUEE 5D5XB 4Y4RA 1ZK8A 4E6KG 3S2DJ 1E17A 4S0HB 2Y69H 3BPVA 1B8IB 4A5MA 3C2HA 5CJ9A 1ZRFA 1IAWA 1MDMB 4U0WA 4KDPA 3FWEA 1YJWI 4BAYA 2R7VA 3S2WA 2A6EF 5KHDA 4NNJA 3FHZA 3VYUB 2HZTA 3RZOJ 4BHPA 2I10A 1HKTA 4CYCA 2ZMEC 5IT9Z 5FO5A 3K2AA 2CUEA 4EM0B 1GLNA 4I02A 2LD5A 4M74A 3W3CA 2ZJ2A 4UNOA 1KU7A 1NH3A 2F48A 4CGZA 4A69C 4F7ZA 3GF2A 3C18A 4HF0A 1IJWC 2DA2A 2ID3A 2M34A 5LGNA 4QIWN 3V7RA 2R5ZA 4IRHA 2VUMJ 2E5ZA 1XTAA 2R7SA 4BH9A 3FK6A 2W4SA 5K5QA 3ASOH 3B6AA 2BXYA 1ZN2A 2NXNB 2KRFA 5HVQC 2DPDA 4A3LJ 3WGGA 5M5YJ 3NWTA 3QQAA 4PGGA 5J4YA 3JAMZ 1QZZA 1XX5A 3U1KA 4CYCB 3OYNA 3I3LA 4XLNF 2JN6A 3FM3A 4BJ6C 2DLLA 4AIKA 5J1RA 2X6WA 4DNCA 2WAEA 4HOBA 1WFXA 1Z21A 1BOAA 3O8HA 2OQRA 2R5ZB 1ENHA 1T95A 4LOCA 3EUHA 2QGUA 3Q0WA 4GFBA 1B59A 4IHTA 1LFBA 4XK4A 4OIPF 3OWTA 1LVAA 4DYRA 3OYIA 1ZYRF 4G12A 1TT5B 2M8EA 1IC8A 1HKSA 2H1LA 2OV7A 1W0TA 1YOVB 3DKXA 1XCBA 2QKMB 1UZCA 3S93A 1JGSA 3HKZA 1A35A 2VBWA 3BPXA 1VI0A 2V6CA 3A0HC 2FX0A 3TDZC 1HLVA 2DO7A 5K5OA 1ZGJA 3L2QA 4J19A 2DBBA 4XLHA 3HZJA 3REOA 1B4AA 4WXHA 2HR3A 2QQBA 1D1CA 4ETSA 1FBSA 3FXRA 3H3VK 1KQ8A 2E71A 3F8CA 4M9XA 3RKYA 1JJ8C 1E2XA 3QP6A 2DODA 2LMDA 2DW4A 2JVHA 2O5RA 3HPGA 2PX9A 1IGNA 4LLGF 5CKTA 4ZDOA 2KIFA 3PIOF 1IRZA 1WJAA 2EK5A 4CUGA 1IRFA 4M3EA 4P9FA 3S16J 2YU3A 2WY8Q 3BZ6A 4ITVA 2K86A 1ZRDA 3H5RA 3KP6A 1O7FA 3OYEA 1S3JA 2DTZA 4ZYHA 3QRFF 4XR6A 2VN2A 5B1BH 1YX5A 4E7LA 1IN5A 2MLGA 3HB9A 1VQLI 2O8KA 2H94A 3PFIA 1WVRA 2GM4A 2MC4A 5M5WJ 4KIGA 3UR3C 3EDPA 2Z9OA 3H35A 2JK3A 3J80K 2ZB9A 3TO9A 2Z16A 4E70A 2QYOA 1Z91A 3IWFA 2R92J 3F72A 3CC2I 2IT0A 4AM3A 4I0AA 2AHQA 4IHWA 5DTDA 5HLHA 3DEUA 3RPUA 3I56I 1LUJB 2AO9A 1SVOA 2M1BA 1ZTRA 2IP2A 4A3GJ 1MGTA 1MMDA 3R61A 1X4PA 1J7KA 4IQ4A 3ZMDA 2RVCA 1YW9A 4LB6B 4M9SA 1A31A 1IV6A 3WTTC 1G3SA 4BUPA 2ZXHA 4KUMA 4BXUA 1VZ0A 3OYAA 2YUSA 1A6QA 3JRDA 4IO9F 1W7PD 3HEFA 1WJEA 3EYYA 3IRQA 5LFAA 3WGIA 2X51A 4PSXA 3ZQQA 1TL8A 4EJVA 2VQHA 2DQRA 2L3DA 3CESA 2E35A 2KIUA 1R5HA 3IAM2 1FMWA 1U9NA 1FOKA 4RMNA 2DMTA 1ZGWA 4LB5A 2LTPA 4BBSJ 2MFZA 3O2PE 3WGHA 2V1UA 4A6EA 5F27A 1P6RA 3MKLA 4WF2A 1YI2I 1X3ZB 1Z77A 2JA2A 2CQKA 3HRUA 3WU0A 1UFMA 1TQPA 3GTLJ 5JLWA 4N4NB 3RTRA 3FXLA 1X1BA 3GYHX 2RQQA 3DEWA 2JRTA 2EZHA 3QYBA 1ETQA 1O3SA 4C30A 4KIFA 1ZR4A 2X85A 3H9QA 3G4SI 2P8TA 3TBIA 2X6OA 1VQPI 3DKYA 2ICWG 4LG0A 3NRVA 3OYBA 1LKXA 3E5UA 3KETA 1RR8C 5BMZA 1VQMI 1ZQ3P 1Z3XA 3DEEA 4XORA 5GAGJ 3WE2A 2O0YA 3WU1B 2OA4A 1STZA 2R7FA 4OAZA 2QCOA 1BJZA 5DV5A 5DM6F 3MKZA 4BQAA 2IA0A 3OYFA 1O7LA 1R00A 3ABTA 2DMUA 3ZMUA 1WPKA 3P9KA 1Z7LA 1SD5A 4X1EA 3BLYA 3QPTA 2CU7A 2K4BA 2VKVA 4ZTFA 2OJED 5EEGA 3I64A 3J81Z 4UVAA 3RYRA 2FA5A 1S9HA 1JUPA 1R4NB 1H9GA 2CS3A 4F55A 5L3DA 4FETA 3PL8A 4KNYA 1BC8C 1FEXA 4CSWA 3CCSI 1R1TA 1T98A 2XRLA 2G9WA 4XRSG 2D45A 4BU2A 3S1NJ 3F21A 3KP5A 5GAEJ 1WSUA 2EIJH 1JI8A 5DD8A 3BR2A 1FT9A 3HOXJ 4WX9A 2D1HA 2KL4A 3GZNB 4XBFA 4HSTA 4XONA 5EYRA 3TGNA 2FBKA 1JE8A 5GAHJ 3ZQLA 2LYCA 3IHUA 4D0PA 2HXOA 2KRCA 3V8KA 2EIMH 4FE4A 3LA7A 3Q3SA 5J8CA 5JFRA 5H6QA 1KQ9A 3S1MJ 2CQ7A 2VJ4A 2WV0A 4DW6A 2UXNA 5EGOA 1LFPA 5FLXK 1MNDA 2FNPA 2Q1ZB 3I59B 4HSRA 5F1RA 5E3MA 1D0ZA 2GZWA 4RGXA 1L3LA 2M7BA 3LFKA 4G94A 1U78A 3ECOA 1ERDA 3A0BC 4G6DA 2L01A 4XOTA 3EETA 3IP4B 1RZ4A 3FZVA 4E4HA 3FXQA 2WAQA 3G2BA 5J1YA 2A07F 4NDLA 4CCKA 2L4AA 3KE2A 4ZYAA 2ESNA 2R5YA 3HTUA 4UY8I 1LFUP 1Q1VA 2O03A 2UV1A 3FXUA 3K69A 3MMYB 4IHYA 1OKRA 1S29A 4A0XA 5GTHC 4EJTA 4HEA2 1BM9A 3OYGA 3GMEA 3QWLA 2IAIA 4KMFA 1GV5A 5EGOB 3KP3A 1QRYA 1ODDA 4QPQA 1FSHA 5JVGF 5BOXA 3LSIA 2LNBA 3OYJA 4KYWA 2EZKA 3ELKA 1U3EM 3W6VA 3NWSA 3L2WA 2CUJA 1AWCA 2Z3YA 3Q0UA 4XSZF 3V7CA 4LIUA 3LAJA 2R5YB 2EV5A 3HYIA 1Z6RA 3PNTA 5H2FC 3CMAI 2VIXA 4YEJA 4BL0B 4HNUA 1VNDA 3K1PA 2VC0A 1R1UA 5FKNA
chains in the Genus database with same CATH topology
2Y30A 2NS8A 1MBKA 3B6CA 3S1QJ 5C3EJ 2L7MP 1A6IA 2D5VA 3F0CA 3LOCA 2P81A 1JTXA 2DJNA 1U9OA 1JTYA 1JUSA 5E3OA 3GTMJ 3JRIA 5C4XJ 3IH2A 1HDPA 3BR3A 2XPVA 2L7FP 4AYBN 2CQQA 4A3JJ 2H8RA 2MGQA 3BR0A 5IOZA 2GLOA 2FD5A 2CUFA 2ME0A 3HOVJ 3TW6A 4JX5A 3HOYJ 1IUFA 2CQXA 5GPCA 3PO2J 4XRMA 2DA5A 2HXIA 2OF7A 4MIMA 3JRFA 1NK3P 5IYDJ 3BTIA 2K9SA 2E19A 2KDZA 2R93J 3I4NJ 1F36A 1Y1WJ 1JKRC 1MBJA 4FCYA 1NTCA 3S17J 2ME6A 3M4OJ 5IOYA 4A3DJ 1ETKA 2HOSA 3GTGJ 2DN0A 2Y9ZA 3G1OA 4JYKA 1WH5A 1MBFA 3OIOA 4XIDA 3ZQGA 1K61A 1OJLA 1ITYA 2NOGA 2JJ7A 2HOAA 1DU6A 5FKMA 4FE7A 3QPLA 3A01A 1AKHA 4BY7J 5M3MJ 3ZQHA 3CMYA 3GTJJ 4D7MA 3ZQIA 1X58A 1HF0A 3TW7A 1B8IA 4DZPA 2XSDC 5FLVA 5FKOA 2M8GX 1Y1VJ 3BTLA 3MN2A 5M5XJ 2VI6A 2K40A 4A3FJ 2HYJA 2DMQA 4AC0A 3IV5A 1ZKGA 1RESA 1BL0A 2XB0X 3GBGA 4DYQA 1GDTA 4JX4A 3GTPJ 2EZIA 1BW6A 4QSHA 2XGEA 3JREA 3RKQA 4BY1J 3BTCA 1AU7A 2XGDA 1AKHB 2B63J 5EZHA 1ORKA 4A3CJ 1IDYA 1O4XA 3WHBA 1JKOC 1NK2P 1OCTC 2WB1N 3ZOBA 4UUSB 3SFIA 2DMPA 3PM1A 3S2DJ 1ZK8A 4S0HB 1B8IB 2ECCA 3L1PA 5FKLA 4B1RA 4BXXJ 2Y31A 3BR5A 5E3NA 4D7NA 1MBGA 3C2BA 2NVYJ 4JX6A 3RZOJ 2I10A 2QF7A 3LSPA 4M3GA 4CYCA 3K2AA 2CUEA 2CRGA 2KT0A 2LD5A 2EQRA 2L9RA 4A69C 3HOWJ 5EDNA 1XG1A 5JLXA 1IJWC 3FK7A 3JRHA 2DA2A 2ID3A 2M34A 2DMNA 4QIWN 1T33A 4C3IJ 2X9DA 2R5ZA 1R9TJ 3RQIA 4ABZA 2M9HA 2VUMJ 3FK6A 3B6AA 1ETVA 4A3LJ 3BG3A 2L7ZA 5M5YJ 3QQAA 5FKKA 1MBEA 3S14J 1F43A 2IBDA 3O8GA 4I6ZA 1ETWA 3A03A 4CYCB 4M3FA 4BBRJ 2LFBA 2CJJA 2JN6A 2H1KA 5J1RA 3RZDJ 1RKWA 5F0FA 4BKXA 3S1RJ 3IH3A 4V2GA 3TP3A 4IEJA 3O8HA 1I6HJ 4I76A 4AUXA 2R5ZB 5FJ8J 1ENHA 1TWAJ 3QPSA 4LOCA 1POGA 1ZR2A 3HKZN 3Q0WA 4GFBA 2EH3A 3MVPA 5E3LA 1LFBA 4XK4A 5BNGA 4DYRA 3LSRA 1RR7A 2PMZN 2WV1A 2E2HJ 2ECBA 5DS9A 4G12A 4A93J 1JT0A 4A3KJ 2DA4A 1IC8A 4HNVA 4UUTA 2YU9J 3BQYA 3GTKJ 3JR9A 1W0TA 4DZJA 2NVQJ 5C44J 2NVXJ 1RKTA 3GTOJ 3BR1A 1I3QJ 3JRGA 1CQTA 3PO3J 5IPAA 5K7FA 1VI0A 1Z0XA 4MFDA 2VPRA 2LY9A 2FX0A 1QPIA 3K7AJ 1HLVA 4J19A 4DYCA 2HI3A 5K7HA 9ANTA 4V2FA 3H3VK 2GBYA 2DA1A 4UUSA 1JJ8C 1JUMA 1MBHA 5K7ZA 1I50J 1IGNA 2DA6A 2Y9YA 1APLC 1HDDC 4C3JJ 4D5CA 1SFOJ 2EBIA 1IRZA 1D5YA 3SDGA 2G0EA 5IP6A 3E7LA 1YRNA 4M3EA 3S16J 4A3IJ 4A3BJ 1TWFJ 1AHDP 3OSFA 2DTZA 3NAUA 1JT6A 3BT9A 1H8AC 1MH4A 1MSFC 2W48A 2X48A 1G2HA 3HB9A 1QVUA 2O8KA 1RPWA 5J3LA 3FIWA 2GM4A 5M5WJ 3HBLA 2XPWA 4Y7NJ 1GV2A 2JA7J 2K9NA 2JK3A 2TCTA 1WI3A 2ZB9A 3G1LA 3TEDA 1WCMJ 4XICA 2R92J 2LK2A 2TRTA 1B72B 4M3DA 1LE8A 2AHQA 1IG7A 5DTDA 4IHWA 2XGCA 3NARA 4D5FA 2OPTA 3G1MA 4A3GJ 2AO9A 2HQ5A 1ZTRA 4MLOA 2FJ1A 4A3EJ 1YRNB 1BA5A 1X2NA 1JGGA 4W1UA 5HODA 2E2JJ 2FQ4A 3M3YJ 1IV6A 1WH7A 1TC3C 3JRDA 2YUSA 3BR6A 3HOUJ 3HEFA 3S15J 4X6AJ 5EEAA 5EG0A 2LKXA 2RAEA 5GPAA 1U9NA 1GVDA 1E3OC 2EZLA 3JRCA 2DMTA 3S2HJ 1FIPA 1ZGWA 2LTPA 1LE8B 4BBSJ 3TP0A 5F27A 3CQZJ 1VFCA 2DA3A 3MKLA 4M6VA 3FKIJ 1Z77A 4L5EA 1FTZA 2JMWA 1MNMC 5C4JJ 4B3AA 5JLWA 3GTLJ 1JKPC 3DEWA 5F08A 4A3MJ 1PUFA 1MSEC 1JJ6C 2EZHA 1ETQA 5EG0B 2MG4A 2NVTJ 1FIAA 1ZR4A 3HGYA 2YS9A 2MW8A 3DCFA 2X6OA 3LNQA 1VF9A 5F04A 1S7EA 3OOUA 1ZQ3P 4FISA 5EZGA 2JA5J 3WHCA 1HCRA 1MH3A 3HM5A 1T56A 1WGXA 2L0KA 5IP9J 2QCOA 1BJZA 4XRSA 3BG5A 2O7OA 2ID6A 3SJMA 1UHSA 2M2EA 1ETYA 2DMUA 1WPKA 4X1EA 2DA7A 3IH4A 1PUFB 1A5JA 2CU7A 3I4MJ 1FJLA 5IP7J 3Q0VA 2VKVA 3HGGA 2HOTA 1HOMA 4QTRA 1TWHJ 1QVTA 4JP0A 3CCYA 1FTTA 3CDLA 1JUPA 1ETXA 4M3BA 1UG2A 1ETOA 1FEXA 2JA8J 2R0QC 3LSGA 4MO7A 2VKEA 1GUUA 2XRLA 3BTJA 4XRSG 2HDDA 2E1OA 1OFCX 1P7JA 1K83J 3S1NJ 3HDDA 1B72A 4IHXA 3FISA 1SANA 2M0CA 4IHVA 5J1UA 3BR2A 3HOXJ 3JRAA 2MSYA 5EYRA 2LR8A 2Y0SN 3ZQLA 3UKGA 1X2MA 2NS7A 2HXOA 2LVSA 2WAQN 3GTQJ 4FE4A 3Q3SA 4C2MJ 4MFEA 4W97A 3S1MJ 4DW6A 4RBOA 5EGOA 5E3MA 1U8BA 2ELKA 2JA6J 3BQZA 4EEFG 5IYBJ 5FLMJ 1U78A 4C3HJ 4B4CA 2LLKA 1W0UA 5IYCJ 5F0CA 5EF6A 5J1YA 1OCPA 2IEKA 4NDLA 1TWCJ 2R5YA 1XS9A 1LFUP 1Q1VA 3A01B 1EF4A 2N8GA 4IHYA 2K9QA 2E2IJ 1UMQA 1RETA 2COBA 3A02A 3VPRA 1JKQC 1TWGJ 1DU0A 2IAIA 3H0GJ 1GV5A 5EGOB 5GP9A 3BG9A 5F0HA 1QRYA 3HOZJ 1H89C 1XC5A 5M3FJ 1GT0C 2EZKA 2Y2ZA 3W6VA 2R7ZJ 1IDZA 5F1JA 3OSGA 1BW5A 1P7IA 2JWTA 2LP0A 4FTHA 3Q0UA 3ZQFA 3D1NI 2O9LA 2R5YB 3JRBA 2XPUA 4RDUA 1VNDA 2XB5A 3ZQCA 4Y52J 3LSJA 5FKNA 1H88C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y30 A;  2NS8 A;  1MBK A;  3B6C A;  3S1Q J;  5C3E J;  2L7M P;  1A6I A;  2D5V A;  3F0C A;  3LOC A;  2P81 A;  1JTX A;  2DJN A;  1U9O A;  1JTY A;  1JUS A;  5E3O A;  3GTM J;  3JRI A;  5C4X J;  3IH2 A;  1HDP A;  3BR3 A;  2XPV A;  2L7F P;  4AYB N;  2CQQ A;  4A3J J;  2H8R A;  2MGQ A;  3BR0 A;  5IOZ A;  2GLO A;  2FD5 A;  2CUF A;  2ME0 A;  3HOV J;  3TW6 A;  4JX5 A;  3HOY J;  1IUF A;  2CQX A;  5GPC A;  3PO2 J;  4XRM A;  2DA5 A;  2HXI A;  2OF7 A;  4MIM A;  3JRF A;  1NK3 P;  5IYD J;  3BTI A;  2K9S A;  2E19 A;  2KDZ A;  2R93 J;  3I4N J;  1F36 A;  1Y1W J;  1JKR C;  1MBJ A;  4FCY A;  1NTC A;  3S17 J;  2ME6 A;  3M4O J;  5IOY A;  4A3D J;  1ETK A;  2HOS A;  3GTG J;  2DN0 A;  2Y9Z A;  3G1O A;  4JYK A;  1WH5 A;  1MBF A;  3OIO A;  4XID A;  3ZQG A;  1K61 A;  1OJL A;  1ITY A;  2NOG A;  2JJ7 A;  2HOA A;  1DU6 A;  5FKM A;  4FE7 A;  3QPL A;  3A01 A;  1AKH A;  4BY7 J;  5M3M J;  3ZQH A;  3CMY A;  3GTJ J;  4D7M A;  3ZQI A;  1X58 A;  1HF0 A;  3TW7 A;  1B8I A;  4DZP A;  2XSD C;  5FLV A;  5FKO A;  2M8G X;  1Y1V J;  3BTL A;  3MN2 A;  5M5X J;  2VI6 A;  2K40 A;  4A3F J;  2HYJ A;  2DMQ A;  4AC0 A;  3IV5 A;  1ZKG A;  1RES A;  1BL0 A;  2XB0 X;  3GBG A;  4DYQ A;  1GDT A;  4JX4 A;  3GTP J;  2EZI A;  1BW6 A;  4QSH A;  2XGE A;  3JRE A;  3RKQ A;  4BY1 J;  3BTC A;  1AU7 A;  2XGD A;  1AKH B;  2B63 J;  5EZH A;  1ORK A;  4A3C J;  1IDY A;  1O4X A;  3WHB A;  1JKO C;  1NK2 P;  1OCT C;  2WB1 N;  3ZOB A;  4UUS B;  3SFI A;  2DMP A;  3PM1 A;  3S2D J;  1ZK8 A;  4S0H B;  1B8I B;  2ECC A;  3L1P A;  5FKL A;  4B1R A;  4BXX J;  2Y31 A;  3BR5 A;  5E3N A;  4D7N A;  1MBG A;  3C2B A;  2NVY J;  4JX6 A;  3RZO J;  2I10 A;  2QF7 A;  3LSP A;  4M3G A;  4CYC A;  3K2A A;  2CUE A;  2CRG A;  2KT0 A;  2LD5 A;  2EQR A;  2L9R A;  4A69 C;  3HOW J;  5EDN A;  1XG1 A;  5JLX A;  1IJW C;  3FK7 A;  3JRH A;  2DA2 A;  2ID3 A;  2M34 A;  2DMN A;  4QIW N;  1T33 A;  4C3I J;  2X9D A;  2R5Z A;  1R9T J;  3RQI A;  4ABZ A;  2M9H A;  2VUM J;  3FK6 A;  3B6A A;  1ETV A;  4A3L J;  3BG3 A;  2L7Z A;  5M5Y J;  3QQA A;  5FKK A;  1MBE A;  3S14 J;  1F43 A;  2IBD A;  3O8G A;  4I6Z A;  1ETW A;  3A03 A;  4CYC B;  4M3F A;  4BBR J;  2LFB A;  2CJJ A;  2JN6 A;  2H1K A;  5J1R A;  3RZD J;  1RKW A;  5F0F A;  4BKX A;  3S1R J;  3IH3 A;  4V2G A;  3TP3 A;  4IEJ A;  3O8H A;  1I6H J;  4I76 A;  4AUX A;  2R5Z B;  5FJ8 J;  1ENH A;  1TWA J;  3QPS A;  4LOC A;  1POG A;  1ZR2 A;  3HKZ N;  3Q0W A;  4GFB A;  2EH3 A;  3MVP A;  5E3L A;  1LFB A;  4XK4 A;  5BNG A;  4DYR A;  3LSR A;  1RR7 A;  2PMZ N;  2WV1 A;  2E2H J;  2ECB A;  5DS9 A;  4G12 A;  4A93 J;  1JT0 A;  4A3K J;  2DA4 A;  1IC8 A;  4HNV A;  4UUT A;  2YU9 J;  3BQY A;  3GTK J;  3JR9 A;  1W0T A;  4DZJ A;  2NVQ J;  5C44 J;  2NVX J;  1RKT A;  3GTO J;  3BR1 A;  1I3Q J;  3JRG A;  1CQT A;  3PO3 J;  5IPA A;  5K7F A;  1VI0 A;  1Z0X A;  4MFD A;  2VPR A;  2LY9 A;  2FX0 A;  1QPI A;  3K7A J;  1HLV A;  4J19 A;  4DYC A;  2HI3 A;  5K7H A;  9ANT A;  4V2F A;  3H3V K;  2GBY A;  2DA1 A;  4UUS A;  1JJ8 C;  1JUM A;  1MBH A;  5K7Z A;  1I50 J;  1IGN A;  2DA6 A;  2Y9Y A;  1APL C;  1HDD C;  4C3J J;  4D5C A;  1SFO J;  2EBI A;  1IRZ A;  1D5Y A;  3SDG A;  2G0E A;  5IP6 A;  3E7L A;  1YRN A;  4M3E A;  3S16 J;  4A3I J;  4A3B J;  1TWF J;  1AHD P;  3OSF A;  2DTZ A;  3NAU A;  1JT6 A;  3BT9 A;  1H8A C;  1MH4 A;  1MSF C;  2W48 A;  2X48 A;  1G2H A;  3HB9 A;  1QVU A;  2O8K A;  1RPW A;  5J3L A;  3FIW A;  2GM4 A;  5M5W J;  3HBL A;  2XPW A;  4Y7N J;  1GV2 A;  2JA7 J;  2K9N A;  2JK3 A;  2TCT A;  1WI3 A;  2ZB9 A;  3G1L A;  3TED A;  1WCM J;  4XIC A;  2R92 J;  2LK2 A;  2TRT A;  1B72 B;  4M3D A;  1LE8 A;  2AHQ A;  1IG7 A;  5DTD A;  4IHW A;  2XGC A;  3NAR A;  4D5F A;  2OPT A;  3G1M A;  4A3G J;  2AO9 A;  2HQ5 A;  1ZTR A;  4MLO A;  2FJ1 A;  4A3E J;  1YRN B;  1BA5 A;  1X2N A;  1JGG A;  4W1U A;  5HOD A;  2E2J J;  2FQ4 A;  3M3Y J;  1IV6 A;  1WH7 A;  1TC3 C;  3JRD A;  2YUS A;  3BR6 A;  3HOU J;  3HEF A;  3S15 J;  4X6A J;  5EEA A;  5EG0 A;  2LKX A;  2RAE A;  5GPA A;  1U9N A;  1GVD A;  1E3O C;  2EZL A;  3JRC A;  2DMT A;  3S2H J;  1FIP A;  1ZGW A;  2LTP A;  1LE8 B;  4BBS J;  3TP0 A;  5F27 A;  3CQZ J;  1VFC A;  2DA3 A;  3MKL A;  4M6V A;  3FKI J;  1Z77 A;  4L5E A;  1FTZ A;  2JMW A;  1MNM C;  5C4J J;  4B3A A;  5JLW A;  3GTL J;  1JKP C;  3DEW A;  5F08 A;  4A3M J;  1PUF A;  1MSE C;  1JJ6 C;  2EZH A;  1ETQ A;  5EG0 B;  2MG4 A;  2NVT J;  1FIA A;  1ZR4 A;  3HGY A;  2YS9 A;  2MW8 A;  3DCF A;  2X6O A;  3LNQ A;  1VF9 A;  5F04 A;  1S7E A;  3OOU A;  1ZQ3 P;  4FIS A;  5EZG A;  2JA5 J;  3WHC A;  1HCR A;  1MH3 A;  3HM5 A;  1T56 A;  1WGX A;  2L0K A;  5IP9 J;  2QCO A;  1BJZ A;  4XRS A;  3BG5 A;  2O7O A;  2ID6 A;  3SJM A;  1UHS A;  2M2E A;  1ETY A;  2DMU A;  1WPK A;  4X1E A;  2DA7 A;  3IH4 A;  1PUF B;  1A5J A;  2CU7 A;  3I4M J;  1FJL A;  5IP7 J;  3Q0V A;  2VKV A;  3HGG A;  2HOT A;  1HOM A;  4QTR A;  1TWH J;  1QVT A;  4JP0 A;  3CCY A;  1FTT A;  3CDL A;  1JUP A;  1ETX A;  4M3B A;  1UG2 A;  1ETO A;  1FEX A;  2JA8 J;  2R0Q C;  3LSG A;  4MO7 A;  2VKE A;  1GUU A;  2XRL A;  3BTJ A;  4XRS G;  2HDD A;  2E1O A;  1OFC X;  1P7J A;  1K83 J;  3S1N J;  3HDD A;  1B72 A;  4IHX A;  3FIS A;  1SAN A;  2M0C A;  4IHV A;  5J1U A;  3BR2 A;  3HOX J;  3JRA A;  2MSY A;  5EYR A;  2LR8 A;  2Y0S N;  3ZQL A;  3UKG A;  1X2M A;  2NS7 A;  2HXO A;  2LVS A;  2WAQ N;  3GTQ J;  4FE4 A;  3Q3S A;  4C2M J;  4MFE A;  4W97 A;  3S1M J;  4DW6 A;  4RBO A;  5EGO A;  5E3M A;  1U8B A;  2ELK A;  2JA6 J;  3BQZ A;  4EEF G;  5IYB J;  5FLM J;  1U78 A;  4C3H J;  4B4C A;  2LLK A;  1W0U A;  5IYC J;  5F0C A;  5EF6 A;  5J1Y A;  1OCP A;  2IEK A;  4NDL A;  1TWC J;  2R5Y A;  1XS9 A;  1LFU P;  1Q1V A;  3A01 B;  1EF4 A;  2N8G A;  4IHY A;  2K9Q A;  2E2I J;  1UMQ A;  1RET A;  2COB A;  3A02 A;  3VPR A;  1JKQ C;  1TWG J;  1DU0 A;  2IAI A;  3H0G J;  1GV5 A;  5EGO B;  5GP9 A;  3BG9 A;  5F0H A;  1QRY A;  3HOZ J;  1H89 C;  1XC5 A;  5M3F J;  1GT0 C;  2EZK A;  2Y2Z A;  3W6V A;  2R7Z J;  1IDZ A;  5F1J A;  3OSG A;  1BW5 A;  1P7I A;  2JWT A;  2LP0 A;  4FTH A;  3Q0U A;  3ZQF A;  3D1N I;  2O9L A;  2R5Y B;  3JRB A;  2XPU A;  4RDU A;  1VND A;  2XB5 A;  3ZQC A;  4Y52 J;  3LSJ A;  5FKN A;  1H88 C; 
#chains in the Genus database with same CATH topology
 4I0B A;  3ABU A;  2NS8 A;  3B6C A;  4DGW B;  3WG9 A;  4ESJ A;  3UNG C;  3U2R A;  3S1Q J;  5C3E J;  2DCE A;  2KZV A;  2LDU A;  2KHM A;  3LOC A;  2HZD A;  5J6X A;  5DCF A;  3GEZ A;  1MJA A;  3H0D A;  1FBU A;  3JRI A;  2VKH A;  3CC7 I;  4AYB N;  2LSO A;  1W5C C;  3DXJ F;  2YR2 A;  5IOZ A;  1J75 A;  1KYW A;  4CCN A;  2WA0 A;  1R5G A;  4XM3 A;  3JW4 A;  4PJ0 C;  2NNY A;  1YW8 A;  1LEA A;  1B6A A;  1HQC A;  3E6C C;  1ZAR A;  2OUM A;  1TLH B;  1VQ5 I;  1IUF A;  3HOY J;  1ZEL A;  4NBQ A;  4XRM A;  2DA5 A;  1MMG A;  4KIB A;  2L5Q A;  4PJL A;  5IYD J;  2DOE A;  2M4G A;  4FQG A;  4MIM A;  2VQL A;  2K9S A;  1Y8Q B;  5FRO A;  1I39 A;  1Y0U A;  1Z6T A;  2Y75 A;  3VFZ A;  3K4C A;  2R93 J;  3DBH B;  1B9N A;  2BBY A;  1E0E A;  1F36 A;  3QU3 A;  3H5N A;  1MJ9 A;  3Q9S A;  2ME6 A;  3G73 A;  1QBJ A;  4HYE A;  4O6J A;  5TGT A;  2HOS A;  2DN0 A;  1IXS B;  1BR2 A;  1N78 A;  1D3Y A;  1U6G A;  2TDX A;  1YTY A;  1TNT A;  1YO5 C;  4BHB A;  2DK8 A;  1MBF A;  2CG4 A;  3RIR A;  5IT9 K;  4IPA A;  1U8R A;  1MD0 A;  4C9Y A;  4X0G A;  4Z6Y A;  3M07 A;  3GXO A;  2YX4 A;  2EA2 A;  3KFW X;  1IRX A;  5FKM A;  1DU6 A;  1WZ2 A;  2WBM A;  5BS6 A;  1FZP B;  4IOA F;  4P55 A;  4BY7 J;  1FYL A;  3BZC A;  2Y0M A;  5M3M J;  3ZQH A;  2K3F A;  1CF7 A;  4ENN A;  3GO5 A;  4D7M A;  2BGC A;  3CD6 I;  4EVI A;  1X58 A;  2XSD C;  4A6D A;  5FLV A;  1A04 A;  3BTL A;  3KP2 A;  3LFU A;  3RJP A;  1E3P A;  3SDB A;  1WHU A;  1GXQ A;  2GOX B;  4AC0 A;  1ZKG A;  3H3Z A;  3FXM A;  3DU5 A;  3JAM K;  2XC7 A;  1TW2 A;  3GBG A;  1GDT A;  5E20 A;  4JX4 A;  3H3U A;  2RKH A;  3JTH A;  4IKF A;  1UG0 A;  4BXF A;  2XGE A;  2PG4 A;  4LG3 A;  5DCM A;  5L3B A;  1O3R A;  1X19 A;  2EJR A;  3ML6 A;  2EFN A;  4A3C J;  3WHB A;  2FOK A;  2H6C A;  4B48 A;  4EV0 A;  1JKO C;  1CF7 B;  1NK2 P;  3ZOB A;  5EJC A;  2VC1 A;  1OIS A;  3DTI A;  5B1A H;  4U88 A;  1BIA A;  5F6F A;  2L9S A;  4AWX B;  1FOX A;  2GWR A;  5FKL A;  4B1R A;  4L9V A;  2UWM A;  3BR5 A;  3X2Q H;  4D7N A;  1MBG A;  2DPU A;  4BQN A;  3CJT B;  2NVY J;  3FDY A;  3LSP A;  1SAX A;  3GFM A;  4M3G A;  4KN7 X;  2VBY A;  3ABL H;  2CRG A;  4A5N A;  3FXK A;  3MCZ A;  5DCM B;  1YIJ I;  1WRJ A;  2ZO4 A;  2MC3 A;  2COM A;  5EDN A;  4F92 B;  3FXO A;  4PFP A;  5JLX A;  2LOO A;  4M9Z A;  4PCQ A;  1IF1 A;  4EMS A;  1BIB A;  1T33 A;  1R9T J;  2X9D A;  3GLL A;  4CZC A;  1BBY A;  3K4N A;  1TTY A;  3DV8 A;  1XGN A;  1XD7 A;  4DBR A;  4LGW A;  3PUF A;  1QU3 A;  2VJJ A;  3HHG A;  2KDO A;  4NB5 A;  5FKK A;  4ZJZ A;  5LRS A;  3S14 J;  2JSC A;  1DUX C;  3O8G A;  3E6M A;  1ETW A;  4CO8 A;  3A03 A;  1YFH A;  3K4K A;  4M3F A;  2IS4 A;  1AOY A;  2LFB A;  2MD5 A;  2CJJ A;  2ZCW A;  1JHF A;  1ON1 A;  3RZD J;  3IAS 2;  3S1R J;  1DP3 A;  4ASN A;  1Z7U A;  4XMY A;  4ZYD A;  3QOD A;  2RV8 A;  3TP3 A;  3W6K B;  4IEJ A;  4BYY A;  4OIQ F;  1K79 A;  1I6H J;  3GFL A;  4II3 A;  4I7H A;  3QPS A;  2IJL A;  1YHQ I;  1POG A;  1UHW A;  3SQN A;  2FOW A;  1SD7 A;  3MVP A;  2EFW A;  4Y15 A;  3CCV I;  5ILU A;  1D5V A;  1OCZ H;  2E2H J;  2ECB A;  5FB2 A;  5DS9 A;  1SVM A;  2XIG A;  3QP5 A;  3R60 A;  1QZE A;  4L9J A;  3E1S A;  3JR9 A;  1HXD A;  4DZJ A;  3MEX A;  5DYM A;  1AA7 A;  3BWG A;  4GYG A;  1RKT A;  4HDU A;  3CO7 C;  1VQ4 I;  3BR1 A;  1I3Q J;  3GTO J;  4CYD A;  2K9L A;  2MA3 A;  1EKE A;  3QPH A;  3E97 A;  4OIR F;  1V5G A;  1Z0X A;  1WJC A;  3ROU A;  1QPI A;  3R0A A;  4XLA A;  2PMH A;  3LWF A;  2M30 A;  2WY7 Q;  4M71 A;  3OYK A;  4HG2 A;  1FMV A;  2L2O A;  3S8P A;  1LDK B;  3FBN B;  2GXA A;  2K7L A;  2R7O A;  2K27 A;  2L7K A;  3U9G A;  2GBY A;  2X1D A;  2DA1 A;  4RLQ A;  1MBH A;  5AIQ A;  2W00 A;  1P4X A;  3VYS B;  2Y9Y A;  2LC2 A;  3QAH A;  4C3J J;  4L0Z B;  1W36 C;  2BW3 A;  2EBI A;  1DPR A;  4BEH A;  1D5Y A;  2KQR A;  2L9V A;  3AG3 H;  3WTX C;  1YG2 A;  4OMZ A;  3ZN1 A;  4BNC A;  3I5U A;  4LLL A;  4RGR A;  3RDI A;  3ZGK A;  2VT3 A;  1AHD P;  4J01 A;  2STT A;  2GQQ A;  2RRE A;  3ZCO A;  1N75 A;  2B7E A;  3NAU A;  2EV6 A;  1H8A C;  1MH4 A;  4Z2Y A;  3HOT A;  1R7J A;  1SD6 A;  3FIW A;  2M45 A;  2XPW A;  4QLC U;  1FX7 A;  1GV2 A;  3D5L A;  4Y7N J;  1WI3 A;  2L9N A;  4II2 A;  2W84 A;  3A1Y A;  4XIC A;  2MYS A;  1SAU A;  2MH2 A;  4WWC A;  3CC4 I;  2DK5 A;  1UJ8 A;  1R58 A;  3K0L A;  2VPL A;  1IG7 A;  2BW3 B;  3OR2 C;  4BEH B;  1C0W A;  2VXZ A;  4MLO A;  3EUH C;  1ACI A;  2HQA A;  2MH9 A;  4XKV A;  5HOD A;  4IJA A;  2E2J J;  3WE3 A;  5HNF A;  3M3Y J;  3TOB A;  2JZY A;  1WH7 A;  3F9K A;  3V42 A;  3VYR B;  5ED4 A;  3CCU I;  1KA8 A;  3AG2 H;  5BPI A;  2BV6 A;  3RYP A;  3ZRG A;  1EH7 A;  3I55 I;  5EG0 A;  1KGS A;  2IGN A;  2RAE A;  3J81 K;  3M8F A;  5B3S H;  2MD0 A;  5GPA A;  1Z05 A;  1GVD A;  2EZL A;  3DWL E;  1OYW A;  3ASN H;  2WAD A;  3TP0 A;  3IKT A;  2EIK H;  4LLN A;  1VFC A;  4XN0 A;  2Z5U A;  1ZLK A;  2MLK A;  4M6V A;  2DFE A;  3GUD A;  5AIP A;  3VSL A;  3HHH A;  2KKO A;  3FKI J;  1UB9 A;  3K4M A;  2OBP A;  2JMW A;  5CVR A;  3QOP A;  4BQQ A;  4HX8 A;  5ICF A;  4B3A A;  2QEN A;  1JKP C;  2QQ9 A;  4XNF A;  4MTE A;  3PNV A;  3L9F A;  5F08 A;  1MSE C;  4PFO A;  2X4H A;  2XF5 A;  3IL2 A;  2W82 A;  4FX4 A;  5EG0 B;  2R7W A;  2CGP A;  2NVT J;  2ZKZ A;  3DCF A;  2FML A;  5HDG A;  5EEH A;  3E3V A;  3LNQ A;  1VF9 A;  1TZL A;  4IVN A;  2KPM A;  2A6H F;  4UB8 C;  3RKW A;  3WHC A;  5D5V B;  1LEB A;  4IL6 C;  3HM5 A;  3PSI A;  2F4O B;  3M1E A;  3MWM A;  1D0Y A;  2E1C A;  4L0Y B;  3LSK A;  4ZC3 A;  1HSJ A;  3CP8 A;  3T0Y A;  4EGY A;  3SJM A;  1UCR A;  5LHG A;  4A0Y A;  5L3G A;  4AYB A;  3IH4 A;  1MZB A;  2HVQ A;  2GA2 A;  1FJL A;  3BY6 A;  4KFC A;  1T6S A;  3HGG A;  2KFD A;  4P1W A;  1RI7 A;  1ZH5 A;  4RS8 A;  1V3F A;  4QTR A;  2ISY A;  2F4M B;  1QVT A;  1FTT A;  3CCY A;  3HXL A;  4O3M A;  1ETX A;  2LY1 A;  2JA8 J;  4BDY A;  3FM5 A;  2LY2 A;  3LSG A;  4MO7 A;  5DD4 A;  1GUU A;  3V4G A;  3BTJ A;  1W7P A;  2E1O A;  1P7J A;  2Z1D A;  1N77 A;  2IW5 A;  2FF4 A;  3OL4 A;  4NC8 A;  3GZ5 A;  3ZMS A;  4EM2 A;  4HPQ A;  3FIS A;  1Y6I A;  4IHV A;  2L54 A;  5J1U A;  2DYR H;  2LG4 A;  4BJT A;  3VOE A;  4IRG A;  4A12 A;  1ULY A;  1DGR M;  2MSY A;  1XMX A;  2DDB A;  2X0L A;  4A2U A;  4V19 K;  1Y39 A;  1X2M A;  2GA1 A;  1G3T A;  3K70 C;  2P5V A;  4XKB A;  3MQ0 A;  5L3C A;  3BP8 A;  3ONQ A;  2VOO A;  2W85 A;  3F23 A;  1ONV A;  4C2M J;  4XKC A;  2A61 A;  2VL8 A;  3AL0 B;  3DTK A;  2IRF G;  2ELK A;  3JSO A;  1W7P B;  1BC7 C;  5KK1 A;  5IYB J;  5FLM J;  2FRH A;  2XUB A;  2Y0S A;  2JPC A;  4B4C A;  2PLY A;  5IYC J;  2VON A;  1X1D A;  1P2F A;  2ZJP F;  2CW7 A;  3DPT A;  3GCM A;  5LGT A;  4CHU A;  2E2I J;  1UMQ A;  1EV7 A;  1RET A;  2RNG A;  5D4S A;  3HRM A;  1JHH A;  1T08 B;  3VPR A;  1JKQ C;  1TWG J;  3DBL B;  1HA8 A;  4Y33 A;  1I6X A;  5E18 F;  1FBQ A;  2RDP A;  3WTW C;  3J7A O;  4XLF A;  5GP9 A;  3PJR A;  3RSN A;  2V1D A;  1XC5 A;  4MGR A;  5M3F J;  2G7U A;  1IDZ A;  2Q8K A;  2JWT A;  2K5C A;  3KLO A;  3E0J B;  4FTH A;  3CO6 C;  3JRB A;  3P9I A;  3KZI C;  2XAH A;  4ZZL A;  4NC6 A;  4RDU A;  1NG7 A;  4M6X A;  5HLT A;  2MBF A;  3I58 A;  1R36 A;  1YQA A;  3HSE A;  1H88 C;  2Y30 A;  3BOQ A;  3CTA A;  2AQE A;  2QBY A;  3EQL F;  2QQ8 A;  4YIF A;  2GXB A;  1BI3 A;  1W1W E;  2L7M P;  3M8E A;  1A6I A;  1XDU A;  2P81 A;  2BOL A;  2Z33 A;  1U9O A;  1JUS A;  4EJU A;  4NHJ A;  5C4X J;  3IH2 A;  2XPV A;  3BJO A;  2CQQ A;  1I1G A;  3C7J A;  2MGQ A;  4L5I A;  2VJI A;  1IXC A;  3RPQ A;  2CSO A;  3TOA A;  1G4D A;  4NQW B;  5GTI C;  3ERM A;  5ILS A;  4ENK A;  3CDH A;  3PO2 J;  5GPC A;  2I5U A;  4HBL A;  4LK0 F;  3KP7 A;  3KYL A;  3S3M A;  2HXI A;  3GWZ A;  3RPU D;  2V4J C;  2QSF X;  1RC9 A;  3JRF A;  2QBY B;  2CFX A;  2V26 A;  1WJ5 A;  3BTI A;  2NRA C;  4KIS A;  4AVZ A;  1FYK A;  3SHF A;  1VQ6 I;  2VBZ A;  2WWY A;  3CCM I;  3CLO A;  1R6R A;  1LNW A;  4FCY A;  1NTC A;  5IOY A;  1YW7 A;  1SVL A;  3I59 A;  1YJN I;  1E3H A;  3DFG A;  4Q4Z F;  4BHC A;  1UHM A;  4OIN F;  3ZQ7 A;  1K78 A;  2JRM A;  3L00 A;  1WH5 A;  4JYK A;  4XOP A;  1SMY F;  3OIO A;  2W7N A;  3OIP A;  1LQ1 A;  2P6T A;  4HAM A;  4YEL A;  1OYI A;  4I2O A;  1OJL A;  2AXL A;  2IGO A;  3CCR I;  1ITY A;  5JHF A;  2NOG A;  2OTL I;  2JJ7 A;  4F3Q A;  3K70 D;  3GVA A;  3EUK L;  2H27 A;  2R7Q A;  5LEJ A;  1FOY A;  1MW7 A;  1DDN A;  1ZLJ A;  5IY5 H;  3GTJ J;  2IXS A;  2A5Y B;  5JI6 A;  1HF0 A;  3TW7 A;  4IXA A;  4YFK F;  3MD2 A;  4A0Z A;  5A2Q Z;  3MN2 A;  3OS0 A;  4CCM A;  2A05 A;  2HYJ A;  1RNL A;  2DMQ A;  3T1B A;  1RES A;  1GHC A;  1K78 B;  1DP7 P;  2NS0 A;  2BZT A;  3WOD F;  3R6S A;  2O3F A;  2FU4 A;  2RGV A;  4UVB A;  3JRE A;  2CV1 A;  3E5Q A;  4EJW A;  4BY1 J;  2V79 A;  4PZJ A;  2VBX A;  2W57 A;  2XGD A;  2HDC A;  4M72 A;  1QQI A;  3IKV A;  4Q48 A;  1QGP A;  1IDY A;  3I71 A;  4CA0 A;  3L2R A;  4UUS B;  2KJB A;  3F8M A;  2IGK A;  4OOI A;  3ABM H;  4ZZD A;  4BDZ A;  4XSX F;  4BQO A;  2ECC A;  3K10 A;  1VQ8 I;  5H20 A;  2UUZ A;  3LQR A;  4BXX J;  2Y31 A;  3G3Z A;  3C2B A;  1KON A;  2DTR A;  3C3W A;  2CUZ A;  4JX6 A;  4CIC A;  2QF7 A;  3LMM A;  4HQE A;  1G6N A;  2BY1 A;  1REP C;  4GDF A;  2KT0 A;  4EM1 A;  1FC3 A;  1MIJ A;  1V4R A;  3H5A A;  3HOW J;  1XG1 A;  3WU2 C;  1F9N A;  2PFB A;  3RKX A;  5KNL A;  1KU2 A;  2DMN A;  2VE8 A;  2UZK A;  2VOP A;  3RQI A;  4RAF A;  4ABZ A;  2PJR B;  2JT1 A;  3FHN A;  4Y17 A;  3CUO A;  1ETV A;  3HJE A;  3BG3 A;  2L7Z A;  5E1X A;  1OR7 A;  1ZG5 A;  3FX3 A;  5KVR A;  2BEO A;  1PYV A;  4EJO A;  5HNH A;  1H9T A;  2ZSI B;  1Y8R B;  4I6Z A;  3VEP A;  2XRO A;  5D6E A;  4Y13 A;  2KRH A;  1Z1D A;  2HVS A;  2XKO A;  4CXF A;  3HIF A;  5ILV A;  3DTE A;  1G3W A;  2DQL A;  4L9T A;  5F0F A;  1R5I D;  4BKX A;  2LRE A;  4RGU A;  1YS6 A;  4HLX A;  3M8J A;  1BI0 A;  5CVI A;  3F8F A;  4AUX A;  5FJ8 J;  1BOB A;  4TV7 A;  1ZR2 A;  3HKZ N;  1RUO A;  2K4J A;  2V7F A;  5E3L A;  1WWX A;  4MEY F;  5BNG A;  4ZDP A;  1D0X A;  4FT8 A;  1YX3 A;  2WV1 A;  1H0M A;  1G3Y A;  2STW A;  2H09 A;  1JT0 A;  1BN5 A;  4A93 J;  2EV0 A;  2DA4 A;  3KEO A;  1IUY A;  4UUT A;  3BQY A;  3GTK J;  4L9N A;  3OL3 A;  5LLQ A;  2NVQ J;  3H9J A;  2LH9 A;  4LIV A;  3DKW A;  1ZAO A;  1CQT A;  2C6Y A;  4WXD A;  3LST A;  5IPA A;  2QVO A;  5K7F A;  4MFD A;  2VPR A;  2XHK A;  4KIC A;  3K7A J;  2VE9 A;  3BZK A;  4DYC A;  1YS7 A;  2F6C A;  4ANJ A;  2JQ7 A;  2KIQ A;  2E60 A;  3LA3 A;  4V2F A;  4NUB A;  5DDG A;  4AIJ A;  5FD5 A;  3SXY A;  2AS5 F;  1GVJ A;  1SC7 A;  4GYI A;  2BYV E;  4ZDL A;  4HV6 A;  3A4C A;  3KYD B;  1D8K A;  1I50 J;  4YFX F;  2DA6 A;  5HS8 A;  1APL C;  1HDD C;  2CW0 F;  3DF8 A;  4R8H A;  1GXP A;  4I01 A;  5D8L B;  1K4T A;  4IHS A;  2HKX A;  3SDG A;  4WK8 F;  5IP6 A;  1PJR A;  4A3B J;  1QZY A;  2QWW A;  3HTS B;  3OSF A;  2AXT C;  3MKW B;  2O8X A;  2LKP A;  4R79 A;  2Z2S B;  3BRO A;  4I99 C;  3ZN0 A;  1MSF C;  1J5Y A;  4ON0 A;  5B66 C;  2X48 A;  1G2H A;  1FY7 A;  1QVU A;  4K2E A;  5J3L A;  2PMU A;  3HBL A;  4XRF A;  4LIT A;  2VAS A;  3G1L A;  3TED A;  3ECH A;  2J5O A;  1B72 B;  1WJD A;  2A5W A;  2PN6 A;  2HQN A;  3CJR B;  1S5L C;  5LBQ A;  3GFI A;  2HEO A;  2QSG X;  3ESW B;  2OPT A;  3G1M A;  3CUQ A;  2VJ5 A;  1OCC H;  4UXN A;  5E1Z B;  2I8D A;  2IGM A;  4PSW A;  2BHY A;  4G7Z F;  4W1U A;  4MNU A;  1F1Z A;  1QNT A;  2QKL B;  2GIZ A;  1XSD A;  3BR6 A;  3HOU J;  3RCO A;  5E1W A;  2FUG 2;  3S15 J;  3VB2 A;  5LHI A;  2LRD A;  2LKX A;  3I53 A;  2RQP A;  2XGX A;  5K5R A;  2LKS A;  5D6F A;  3P7N A;  3Q9V A;  1E3O C;  5B5E C;  5JVT A;  4N9H A;  3J7Z I;  3CUQ B;  2FNA A;  1V5F A;  2K02 A;  2M3A A;  5E8G A;  2E7W A;  1FTZ A;  1IN8 A;  4BAC A;  1MNM C;  1X1C A;  1YLF A;  3BG7 A;  2HDW A;  4M6Y A;  3W2V A;  3G6E I;  2QQA A;  4BE1 A;  1J9I A;  3DP7 A;  2D1V A;  5J4V A;  2HFH A;  1PUF A;  3HG9 A;  4A3M J;  2ETH A;  3D5R C;  1JJ6 C;  3U21 A;  3H1C A;  1U5T A;  3HGY A;  2YS9 A;  2MW8 A;  5FLX Z;  3GX4 X;  3TKY A;  3QOE A;  3TQN A;  5CVU A;  4CCO A;  4C2T A;  5F04 A;  1D8J A;  4PJM A;  5EZG A;  2JA5 J;  1VQ9 I;  1MH3 A;  2MAB A;  1IV8 A;  1T56 A;  3LA2 A;  2FXA A;  2YSR A;  3GZ6 A;  5KAF C;  4HLY A;  1WGX A;  2ZSH B;  2CO5 A;  2NVU B;  2ZFU A;  2L0K A;  4EQQ A;  2QLZ A;  5IP9 J;  3BG5 A;  2O7O A;  1LDD A;  2KLO A;  3V8L A;  4YRV A;  3SZP A;  1DPU A;  1UHS A;  2M2E A;  3OS1 A;  3TMO A;  2BE5 F;  3F8B A;  1PUF B;  1A5J A;  5J8F A;  1J59 A;  1MMS A;  5JR3 A;  3OYD A;  3I4M J;  5IP7 J;  4MEX F;  3SEZ A;  3PNY A;  1Y56 A;  3Q0V A;  1MNE A;  2HOT A;  1U5T B;  3SZG A;  1B1B A;  1HOM A;  1EA3 A;  2YX7 A;  1QPM A;  3CDL A;  2ELJ A;  1XB4 A;  4M3B A;  1UG2 A;  4N0B A;  3MZY A;  5D4R A;  4HF1 A;  4UB6 C;  2R0Q C;  4F93 B;  4UVC A;  2HNH A;  3SFZ A;  4AID A;  5HS9 A;  4ENJ A;  2VKE A;  3HSR A;  1J09 A;  2H6B A;  4DJA A;  1K83 J;  4E7I A;  2M0M A;  3HDD A;  4CCJ A;  4IHX A;  1S72 I;  2M0C A;  4RLF A;  1A36 A;  3PSF A;  3JRA A;  2BVL A;  2DYS H;  2A68 F;  2IS6 A;  2OD5 A;  1O3Q A;  4OMY A;  5CQE A;  2K9M A;  2R4G A;  2NOJ B;  3UKG A;  2LVS A;  2WAQ N;  3OV8 A;  3AFH A;  1J2X A;  1BR1 A;  2P4W A;  1HW1 A;  2K85 A;  4GRI A;  4W97 A;  1YJ9 I;  2KIS A;  4RBO A;  4U0Y A;  1R71 A;  1LDJ A;  2HGC A;  1U8B A;  3PQJ A;  2LBF A;  3DU6 A;  1MJB A;  4EEF G;  2PJP A;  2P5K A;  1ON2 A;  1TQM A;  5CLS A;  1DQU A;  4C3H J;  4LK1 F;  1W0U A;  3AAF A;  3DLL F;  5EF6 A;  3S3N A;  2IEK A;  2ADU A;  1XS9 A;  2KIM A;  4BE0 A;  2CWE A;  2X1E A;  4HX7 A;  3A01 B;  1Z9C A;  2EFP A;  2N8G A;  1LJ9 A;  2ZJR F;  3S32 A;  2M7A A;  1KU3 A;  4JQF A;  1EH6 A;  3A02 A;  1T8I A;  2KJC A;  3V7S A;  2XAQ A;  3W2W A;  3PUB A;  1J0R A;  3BG9 A;  5F0H A;  1VTN C;  3HOZ J;  2LBF B;  2P7C B;  3M1C A;  4UHT A;  5F1J A;  1BW5 A;  3F22 A;  3DQV C;  5FFX A;  2LP0 A;  1R49 A;  2HOE A;  2ISZ A;  4R1H A;  1LPQ A;  3ZQF A;  2P0W A;  2HKO A;  4FX0 A;  4GGG A;  3CME I;  2DT5 A;  1R4M B;  2G7H A;  5D5U B;  1FP1 D;  1FWZ A;  3AL0 C;  2XPU A;  4KMU X;  2E1M B;  3K9T A;  3TO7 A;  3CP2 A;  3LSJ A;  1KYZ A;  5BQT A;  1K6Y A;  3CCJ I;  1FP2 A;  1XCV A;  3CF2 A;  2D5V A;  3F0C A;  3I4P A;  3BJA A;  3C2G A;  1S7O A;  5E3O A;  1JTY A;  2DFH A;  1MKM A;  2NYX A;  3LQQ A;  1HDP A;  2IA1 A;  3OYH A;  2H8R A;  5HLG A;  3FF5 A;  2EPF A;  5A2Q K;  3BR0 A;  1XMA A;  3ULQ B;  1T0F A;  2W25 A;  5HS7 A;  5LRR A;  3VYT B;  2OZU A;  4E7S A;  3PIP F;  2HTJ A;  1D1A A;  4DBQ A;  2GLO A;  4M73 A;  2FD5 A;  2CUF A;  2X1C A;  2GAU A;  1TBX A;  2CYY A;  3TW6 A;  2BY2 A;  4JX5 A;  2CQX A;  2VOD A;  2FQ3 A;  2KZG A;  4YII A;  3TL4 X;  2O6G E;  2HU9 A;  4D1Q A;  1T39 A;  2CQN A;  1S7A A;  3WTU C;  1NK3 P;  2R7R A;  1USS A;  2LF8 A;  2OQG A;  1IN4 A;  4G7H F;  2ZFW A;  2XSJ C;  2ZME A;  3JCU C;  4PUS A;  5LHH A;  1Z3Y A;  3KEY A;  3H36 A;  2JPB A;  2FE3 A;  1KZH A;  1MMA A;  4XN3 A;  3F8N A;  1JKR C;  4CCL A;  1T2K A;  3KZY A;  3HRT A;  1S8N A;  4N9I A;  4A3D J;  1ETK A;  4XLE A;  4AVP A;  4DOZ A;  1WJB A;  3E6B A;  3K1M A;  3GTG J;  2HQR A;  3IUO A;  1W36 D;  4E7J A;  5LD2 C;  2A69 F;  3G1O A;  1IRG A;  3B02 A;  4XID A;  2ZJQ F;  3I0T A;  1I5Z A;  2E5N A;  3ZQG A;  4FAS D;  4UV8 A;  5HDN A;  2V9P A;  1F5T A;  2JVG A;  5CYV A;  5D8K B;  2HOA A;  1P4W A;  3M7G A;  3OIQ A;  4FE7 A;  3QPL A;  4HX4 A;  3MFK A;  2P5L C;  3EPZ A;  1AKH A;  1V54 H;  1XGS A;  3ZXS A;  2ZME B;  1ZRC A;  2VQC A;  2IPQ X;  3CMY A;  1V5E A;  3FBI B;  2VXD A;  5ICC A;  1O57 A;  2ACJ A;  1X3U A;  1R1V A;  2BHZ A;  2M8G X;  5HOO A;  4YFN F;  1G59 A;  2PQ8 A;  2K40 A;  2VI6 A;  4A3F J;  4H0E A;  4U87 A;  2DXI A;  3OYL A;  1BL0 A;  3N05 A;  3GTP J;  5AON A;  4I98 B;  1WI9 A;  2CW8 A;  3T8T A;  3BDD A;  1BW6 A;  4GO1 A;  1U0J A;  3FMS A;  2DOF A;  2F5D A;  3BTC A;  4MQV A;  1AKH B;  2B63 J;  4N4O B;  4RM2 A;  3ZR8 X;  5EZH A;  1ORK A;  2W24 A;  4AU7 A;  4ESB A;  4G8X A;  5LGU A;  3R4K A;  3LAP A;  1OCT C;  1OLT A;  2WB1 N;  4LD5 A;  3SFI A;  4CH7 A;  2DMP A;  3L7W A;  3PM1 A;  4KIT B;  2HTS A;  1HW5 A;  2V9V A;  2XAJ A;  4OU0 A;  4S05 A;  1B9M A;  3I9V 2;  4HW0 A;  3L1P A;  3QYF A;  3CMM A;  4AIH A;  5L3E A;  3ZP5 A;  2EIL H;  1ZRE A;  5J47 A;  1CGP A;  4XL9 A;  2D2W A;  5E3N A;  1PDN C;  2Q0O A;  4CZZ A;  2CH0 A;  3H92 A;  3L2V A;  3N4M A;  2QUF A;  2E7X A;  5J40 A;  1ZG3 A;  3OS2 A;  1QO0 D;  2EQR A;  3HRS A;  4PJJ A;  2JUG A;  4NQW A;  3JSP A;  2L9R A;  3QYE A;  3FK7 A;  3JRH A;  5FGM A;  4D9J A;  3K4B A;  4C3I J;  1ZG1 A;  2M9H A;  3H9G A;  3EYI A;  4RB0 A;  3ABK H;  1IN7 A;  4BGD A;  2PBI A;  1OMI A;  3COA C;  3HL2 A;  2EWN A;  1X3W B;  3GLX A;  1MBE A;  1N25 A;  2XV4 S;  1F43 A;  1IN6 A;  2IBD A;  3ISP A;  5CVV A;  3BJ6 A;  3CJQ B;  3J7Y J;  4FHT A;  2KMU A;  4BBR J;  2H1K A;  3ZPL A;  1NHA A;  5JHU A;  2P7V B;  1HKQ A;  1RKW A;  2Q2E A;  3CF5 F;  3IH3 A;  4V2G A;  4MHG A;  1P4A A;  1R23 A;  1HC8 A;  1PP7 U;  1RIO H;  4I76 A;  3OMY A;  1X1A A;  3WTZ A;  4HNT A;  3E5X A;  3IRR A;  3B73 A;  3ERE D;  1TWA J;  2OCC H;  1BR4 A;  4IZZ A;  5FRN A;  2E1N A;  2M87 A;  2EH3 A;  3CCL I;  3LSH A;  3G71 I;  3LSR A;  1RR7 A;  2PMZ N;  1IO2 A;  1FOW A;  4HA8 A;  3FMR A;  1R22 A;  4B43 A;  4HQM A;  4A3K J;  2CV2 A;  4HZF A;  4G6Q A;  4HNV A;  2YU9 J;  3NEU A;  1VQ7 I;  2R3S A;  2ESH A;  4DIQ A;  5C44 J;  2NVX J;  2Q2E B;  3KLN A;  2DDA A;  4PGH A;  4G6T B;  3JRG A;  1FSE A;  3PO3 J;  1S6L A;  1IXR C;  3C1D A;  4H4K C;  2EIN H;  2LY9 A;  2VKD A;  3CLQ A;  2VT2 A;  4RB1 A;  4LG0 B;  1NG6 A;  2HI3 A;  5K7H A;  3HOS A;  2JTV A;  1JXS A;  1YE9 A;  2WAF A;  9ANT A;  4ZYG A;  2BXZ A;  1KQ0 A;  2CV0 A;  5BPD A;  4UUS A;  1JUM A;  1FPQ A;  2V9K A;  5K7Z A;  1VQO I;  3J7A Y;  3WTY C;  5H6R A;  4IRI A;  3BC8 A;  3F6V A;  4D5C A;  1SFO J;  3M9A A;  2X6X A;  4WXC A;  4EGZ A;  1VQK I;  4IQJ A;  2G0E A;  3E7L A;  2XVC A;  1YRN A;  3QU6 A;  3CCE I;  4HDV A;  3VSK A;  4A3I J;  3D5S C;  2ZC2 A;  1TWF J;  2ZXI A;  1WJF A;  3BG6 A;  1OR7 C;  1TP4 A;  2JSP A;  5F64 A;  2XRN A;  2R7T A;  1JT6 A;  3BT9 A;  4KJZ A;  2W48 A;  3LL7 A;  3L09 A;  2VB6 A;  1L0O C;  3S3O A;  3TDU C;  1HST A;  3A2K A;  1RPW A;  4NC7 A;  2NNN A;  4U0V A;  2HYG D;  3RQ4 A;  1YIT I;  3VDX A;  1UAA A;  2JA7 J;  2K9N A;  4U7B A;  3WTS C;  2TCT A;  2DOA A;  4I09 A;  4DQ2 A;  2PJR A;  1WCM J;  3R0J A;  2UXX A;  2LK2 A;  4OAY A;  2TRT A;  1P92 A;  4XLP F;  4M3D A;  1LE8 A;  2V1N A;  2DJI A;  4ZH4 F;  2XAS A;  3K1N A;  1YYV A;  2XGC A;  3NAR A;  4D5F A;  3ZMV A;  5ICG A;  4IX7 A;  2OTJ I;  2HQ5 A;  4L5J A;  4B09 A;  2FJ1 A;  4A3E J;  1YRN B;  1BA5 A;  1X2N A;  1JGG A;  3O6B B;  5DUI A;  2RNJ A;  2FQ4 A;  1BJA A;  2FMY A;  3BCB A;  1F4K A;  1TC3 C;  1I1S A;  2XAU A;  4RB3 C;  2R7X A;  2OAZ A;  2DFF A;  1UEL B;  2FBI A;  1SEU A;  4X6A J;  3MAJ A;  2F2E A;  5EEA A;  3HPH A;  2HYF A;  4BE2 A;  2ZNY A;  2PI0 A;  1IZ1 A;  4YG2 F;  2XAF A;  2XF6 A;  3JRC A;  2DU9 A;  3S2H J;  1FIP A;  5DEQ A;  1LE8 B;  4KT6 A;  3KCC A;  3KP4 A;  4HRI A;  1FYM A;  3CZ6 A;  3CQZ J;  2DA3 A;  5GAD J;  2WTE A;  4G7O F;  3IC7 A;  4AD9 A;  3WTV C;  2WC2 A;  2ELH A;  3IWZ A;  2F5F A;  5E79 C;  2W1O A;  4L5E A;  4B8X A;  4B3X A;  2FBH A;  2DT7 B;  1Y0N A;  2QM3 A;  3K4L A;  1SFU A;  5C4J J;  2IVM A;  4PDK A;  2V1X A;  3JTG A;  5TJJ A;  1P9Q C;  4P9U A;  3KPH A;  4XLC A;  3KX2 A;  2HPM A;  4UV9 A;  2F5E A;  2K3P A;  2MG4 A;  4QWQ A;  3SZT A;  1FIA A;  1TW3 A;  1BI2 A;  4PJN A;  2ZNZ A;  2V6E A;  4XKW A;  3J80 Z;  1S7E A;  1XGM A;  1W5T A;  2XAG A;  2O61 A;  3OOU A;  2F5V A;  4FIS A;  1HCR A;  2R7U A;  4YIR X;  2H8W A;  1UST A;  4RA2 A;  3SYT A;  2BVM A;  3AG4 H;  4S04 A;  2OU2 A;  1PVE A;  4IOC F;  1Z67 A;  1FLI A;  4XRS A;  2XKP A;  5HLI A;  2ID6 A;  4BJ5 C;  1ETY A;  2L02 A;  4KT5 C;  4B44 A;  1EH8 A;  2DA7 A;  4IF4 A;  2BY3 A;  4HV5 A;  2R7D A;  1SMT A;  4Y3O A;  5LEK A;  4E7K A;  1TWH J;  1X4O A;  2L4M A;  3CUQ C;  4JP0 A;  5D5W B;  1M1E B;  4RB2 C;  1V55 H;  1ETO A;  2NAZ A;  4ESF A;  2RN7 A;  2OZ6 A;  1T38 A;  2ZXJ A;  1Q1H A;  5ICE A;  2DI3 A;  2F5C A;  2EFQ A;  3I54 A;  2HDD A;  1OFC X;  3AKZ A;  3BCA A;  1B72 A;  1QHH D;  5TRD A;  1SAN A;  1KU9 A;  3L2C A;  3HSF A;  4JOM A;  5CQG A;  1HW2 A;  2GIV A;  1K6O A;  3VWB A;  1TNS A;  3T5X A;  2LR8 A;  2Y0S N;  2M4K A;  1OQY A;  4KN4 X;  2NS7 A;  4RAY A;  3GTQ J;  2CMP A;  4RAG A;  1U2W A;  4MFE A;  1XPX A;  1FNN A;  2B0L A;  1W5S A;  3OOP A;  2EA4 A;  3DPL C;  3O3K A;  3FMQ A;  3DBR B;  3Q5F A;  2JA6 J;  3BQZ A;  2OCE A;  3GW2 A;  2QA4 I;  4MQ9 F;  2A6T A;  3HUG A;  4P5O A;  3EUA A;  5DUK A;  1QHG A;  5TIS C;  2EB7 A;  2LLK A;  1U5T C;  5F0C A;  4ZTJ A;  1OCP A;  1TWC J;  4OIO F;  2ZBK A;  3K4J A;  4CDG A;  1LB2 A;  4GCV A;  3PFY A;  1EF4 A;  2X6Y A;  5DM7 F;  1XSV A;  2K9Q A;  1TT0 A;  3MKY B;  3N97 A;  3HC7 A;  5ERI A;  1W4M A;  2COB A;  2JUC A;  4LMY A;  3SEQ A;  1DU0 A;  3V8J A;  3PQK A;  4E7H A;  1I27 A;  4LFU A;  4OWR B;  3GFJ A;  3H0G J;  1XGO A;  3KZZ A;  3W6J B;  4MTD A;  4KA4 A;  1H89 C;  2J5P A;  4O5V A;  5KAI C;  5KCM A;  5CVJ A;  1GT0 C;  1BI1 A;  2Y2Z A;  2R7Z J;  3ZMT A;  3OSG A;  3HUG B;  4JBA A;  1P7I A;  1OCR H;  1XN7 A;  3FXJ A;  2M5W A;  3D1N I;  1SFE A;  1OCO H;  2WB1 A;  2O9L A;  3FKJ A;  5FD6 A;  2YPR A;  5IT3 A;  1IW7 F;  4E7Z A;  4WCG A;  2XDV A;  2XB5 A;  3ZQC A;  2DAO A;  3LSM A;  2VLA A;  4Y52 J;  2E19 A;  1OYY A;  1OPC A;  1ZHF A;  1MBK A;  3MZH A;  2FSW A;  3MZ8 A;  3CDI A;  4Q5S F;  2A3S A;  1XMK A;  4PK4 A;  1EJ9 A;  3U1D A;  2E34 A;  2XF7 A;  5FFZ A;  1I3A A;  2IA2 A;  1XDS A;  1JTX A;  2DJN A;  3GTM J;  3BR3 A;  3KEQ A;  2L7F P;  4A3J J;  4J00 A;  3W2A A;  2CFO A;  1WKM A;  2FEZ A;  3AG1 H;  4EAT A;  3NQO A;  1LVK A;  1MMN A;  2P6S A;  1WQ2 A;  5FRM A;  1SFX A;  2ME0 A;  3HOV J;  4GXO A;  4HF2 A;  5K1Y A;  1D1B A;  3WG7 H;  3K2Z A;  3OYC A;  3CCQ I;  2OF7 A;  4RGS A;  1XSX A;  2Y48 A;  3F3X A;  2KDZ A;  2BY0 A;  2HVR A;  3TO6 A;  3P5J A;  5L3F A;  4U7D A;  2QEX I;  2IS1 A;  2AQF A;  3P9C A;  3I4N J;  3CJN A;  5HDK A;  1Y1W J;  4B47 A;  1MBJ A;  3L2U A;  4C2U A;  2E1M C;  2OC6 A;  3S17 J;  5E17 F;  3M4O J;  3K6G A;  2B9S A;  3RI4 A;  2Y9Z A;  1RUN A;  1SD4 A;  3E6D A;  2DFI A;  4G9Y A;  2VQG A;  1G8X A;  4F91 B;  2QZ8 A;  2LF7 A;  4ZYE A;  2HWV A;  1K61 A;  3F6O A;  2GXG A;  2PEX A;  2PMZ A;  1K4S A;  4L18 B;  5E8I A;  2QSH X;  4JK1 X;  2F4I A;  3A01 A;  1O3T A;  6PAX A;  2Z99 A;  3KIO A;  2HS5 A;  4RAZ A;  2E36 A;  4QPO A;  5CPR B;  2GOM A;  1K7A A;  1ZGA A;  1VQN I;  4XQF A;  4ENM A;  1RRJ A;  1DGW Y;  3ZQI A;  4LJZ F;  4P96 A;  3D0S A;  4DZP A;  1B8I A;  3DPU A;  5FKO A;  1Y1V J;  5M5X J;  1QA6 A;  1X1P A;  1MDM A;  3OR1 C;  3DLA A;  2IS2 A;  3OY9 A;  3IV5 A;  1TQI A;  4F52 A;  2XB0 X;  2EFO A;  4BS9 A;  4DYQ A;  3ZMZ A;  2EZI A;  3OYM A;  1SFK A;  2HPI A;  4Q47 A;  4QSH A;  3RKQ A;  2KP6 A;  1PP8 F;  3KYC B;  1HBX G;  2ZXW H;  1YIO A;  1AU7 A;  2RC4 A;  3VOD A;  1T0F C;  4UUV A;  2DT6 A;  4RM3 A;  1O4X A;  3T8R A;  1PUE E;  5D5X B;  4Y4R A;  1ZK8 A;  4E6K G;  3S2D J;  1E17 A;  4S0H B;  2Y69 H;  3BPV A;  1B8I B;  4A5M A;  3C2H A;  5CJ9 A;  1ZRF A;  1IAW A;  1MDM B;  4U0W A;  4KDP A;  3FWE A;  1YJW I;  4BAY A;  2R7V A;  3S2W A;  2A6E F;  5KHD A;  4NNJ A;  3FHZ A;  3VYU B;  2HZT A;  3RZO J;  4BHP A;  2I10 A;  1HKT A;  4CYC A;  2ZME C;  5IT9 Z;  5FO5 A;  3K2A A;  2CUE A;  4EM0 B;  1GLN A;  4I02 A;  2LD5 A;  4M74 A;  3W3C A;  2ZJ2 A;  4UNO A;  1KU7 A;  1NH3 A;  2F48 A;  4CGZ A;  4A69 C;  4F7Z A;  3GF2 A;  3C18 A;  4HF0 A;  1IJW C;  2DA2 A;  2ID3 A;  2M34 A;  5LGN A;  4QIW N;  3V7R A;  2R5Z A;  4IRH A;  2VUM J;  2E5Z A;  1XTA A;  2R7S A;  4BH9 A;  3FK6 A;  2W4S A;  5K5Q A;  3ASO H;  3B6A A;  2BXY A;  1ZN2 A;  2NXN B;  2KRF A;  5HVQ C;  2DPD A;  4A3L J;  3WGG A;  5M5Y J;  3NWT A;  3QQA A;  4PGG A;  5J4Y A;  3JAM Z;  1QZZ A;  1XX5 A;  3U1K A;  4CYC B;  3OYN A;  3I3L A;  4XLN F;  2JN6 A;  3FM3 A;  4BJ6 C;  2DLL A;  4AIK A;  5J1R A;  2X6W A;  4DNC A;  2WAE A;  4HOB A;  1WFX A;  1Z21 A;  1BOA A;  3O8H A;  2OQR A;  2R5Z B;  1ENH A;  1T95 A;  4LOC A;  3EUH A;  2QGU A;  3Q0W A;  4GFB A;  1B59 A;  4IHT A;  1LFB A;  4XK4 A;  4OIP F;  3OWT A;  1LVA A;  4DYR A;  3OYI A;  1ZYR F;  4G12 A;  1TT5 B;  2M8E A;  1IC8 A;  1HKS A;  2H1L A;  2OV7 A;  1W0T A;  1YOV B;  3DKX A;  1XCB A;  2QKM B;  1UZC A;  3S93 A;  1JGS A;  3HKZ A;  1A35 A;  2VBW A;  3BPX A;  1VI0 A;  2V6C A;  3A0H C;  2FX0 A;  3TDZ C;  1HLV A;  2DO7 A;  5K5O A;  1ZGJ A;  3L2Q A;  4J19 A;  2DBB A;  4XLH A;  3HZJ A;  3REO A;  1B4A A;  4WXH A;  2HR3 A;  2QQB A;  1D1C A;  4ETS A;  1FBS A;  3FXR A;  3H3V K;  1KQ8 A;  2E71 A;  3F8C A;  4M9X A;  3RKY A;  1JJ8 C;  1E2X A;  3QP6 A;  2DOD A;  2LMD A;  2DW4 A;  2JVH A;  2O5R A;  3HPG A;  2PX9 A;  1IGN A;  4LLG F;  5CKT A;  4ZDO A;  2KIF A;  3PIO F;  1IRZ A;  1WJA A;  2EK5 A;  4CUG A;  1IRF A;  4M3E A;  4P9F A;  3S16 J;  2YU3 A;  2WY8 Q;  3BZ6 A;  4ITV A;  2K86 A;  1ZRD A;  3H5R A;  3KP6 A;  1O7F A;  3OYE A;  1S3J A;  2DTZ A;  4ZYH A;  3QRF F;  4XR6 A;  2VN2 A;  5B1B H;  1YX5 A;  4E7L A;  1IN5 A;  2MLG A;  3HB9 A;  1VQL I;  2O8K A;  2H94 A;  3PFI A;  1WVR A;  2GM4 A;  2MC4 A;  5M5W J;  4KIG A;  3UR3 C;  3EDP A;  2Z9O A;  3H35 A;  2JK3 A;  3J80 K;  2ZB9 A;  3TO9 A;  2Z16 A;  4E70 A;  2QYO A;  1Z91 A;  3IWF A;  2R92 J;  3F72 A;  3CC2 I;  2IT0 A;  4AM3 A;  4I0A A;  2AHQ A;  4IHW A;  5DTD A;  5HLH A;  3DEU A;  3RPU A;  3I56 I;  1LUJ B;  2AO9 A;  1SVO A;  2M1B A;  1ZTR A;  2IP2 A;  4A3G J;  1MGT A;  1MMD A;  3R61 A;  1X4P A;  1J7K A;  4IQ4 A;  3ZMD A;  2RVC A;  1YW9 A;  4LB6 B;  4M9S A;  1A31 A;  1IV6 A;  3WTT C;  1G3S A;  4BUP A;  2ZXH A;  4KUM A;  4BXU A;  1VZ0 A;  3OYA A;  2YUS A;  1A6Q A;  3JRD A;  4IO9 F;  1W7P D;  3HEF A;  1WJE A;  3EYY A;  3IRQ A;  5LFA A;  3WGI A;  2X51 A;  4PSX A;  3ZQQ A;  1TL8 A;  4EJV A;  2VQH A;  2DQR A;  2L3D A;  3CES A;  2E35 A;  2KIU A;  1R5H A;  3IAM 2;  1FMW A;  1U9N A;  1FOK A;  4RMN A;  2DMT A;  1ZGW A;  4LB5 A;  2LTP A;  4BBS J;  2MFZ A;  3O2P E;  3WGH A;  2V1U A;  4A6E A;  5F27 A;  1P6R A;  3MKL A;  4WF2 A;  1YI2 I;  1X3Z B;  1Z77 A;  2JA2 A;  2CQK A;  3HRU A;  3WU0 A;  1UFM A;  1TQP A;  3GTL J;  5JLW A;  4N4N B;  3RTR A;  3FXL A;  1X1B A;  3GYH X;  2RQQ A;  3DEW A;  2JRT A;  2EZH A;  3QYB A;  1ETQ A;  1O3S A;  4C30 A;  4KIF A;  1ZR4 A;  2X85 A;  3H9Q A;  3G4S I;  2P8T A;  3TBI A;  2X6O A;  1VQP I;  3DKY A;  2ICW G;  4LG0 A;  3NRV A;  3OYB A;  1LKX A;  3E5U A;  3KET A;  1RR8 C;  5BMZ A;  1VQM I;  1ZQ3 P;  1Z3X A;  3DEE A;  4XOR A;  5GAG J;  3WE2 A;  2O0Y A;  3WU1 B;  2OA4 A;  1STZ A;  2R7F A;  4OAZ A;  2QCO A;  1BJZ A;  5DV5 A;  5DM6 F;  3MKZ A;  4BQA A;  2IA0 A;  3OYF A;  1O7L A;  1R00 A;  3ABT A;  2DMU A;  3ZMU A;  1WPK A;  3P9K A;  1Z7L A;  1SD5 A;  4X1E A;  3BLY A;  3QPT A;  2CU7 A;  2K4B A;  2VKV A;  4ZTF A;  2OJE D;  5EEG A;  3I64 A;  3J81 Z;  4UVA A;  3RYR A;  2FA5 A;  1S9H A;  1JUP A;  1R4N B;  1H9G A;  2CS3 A;  4F55 A;  5L3D A;  4FET A;  3PL8 A;  4KNY A;  1BC8 C;  1FEX A;  4CSW A;  3CCS I;  1R1T A;  1T98 A;  2XRL A;  2G9W A;  4XRS G;  2D45 A;  4BU2 A;  3S1N J;  3F21 A;  3KP5 A;  5GAE J;  1WSU A;  2EIJ H;  1JI8 A;  5DD8 A;  3BR2 A;  1FT9 A;  3HOX J;  4WX9 A;  2D1H A;  2KL4 A;  3GZN B;  4XBF A;  4HST A;  4XON A;  5EYR A;  3TGN A;  2FBK A;  1JE8 A;  5GAH J;  3ZQL A;  2LYC A;  3IHU A;  4D0P A;  2HXO A;  2KRC A;  3V8K A;  2EIM H;  4FE4 A;  3LA7 A;  3Q3S A;  5J8C A;  5JFR A;  5H6Q A;  1KQ9 A;  3S1M J;  2CQ7 A;  2VJ4 A;  2WV0 A;  4DW6 A;  2UXN A;  5EGO A;  1LFP A;  5FLX K;  1MND A;  2FNP A;  2Q1Z B;  3I59 B;  4HSR A;  5F1R A;  5E3M A;  1D0Z A;  2GZW A;  4RGX A;  1L3L A;  2M7B A;  3LFK A;  4G94 A;  1U78 A;  3ECO A;  1ERD A;  3A0B C;  4G6D A;  2L01 A;  4XOT A;  3EET A;  3IP4 B;  1RZ4 A;  3FZV A;  4E4H A;  3FXQ A;  2WAQ A;  3G2B A;  5J1Y A;  2A07 F;  4NDL A;  4CCK A;  2L4A A;  3KE2 A;  4ZYA A;  2ESN A;  2R5Y A;  3HTU A;  4UY8 I;  1LFU P;  1Q1V A;  2O03 A;  2UV1 A;  3FXU A;  3K69 A;  3MMY B;  4IHY A;  1OKR A;  1S29 A;  4A0X A;  5GTH C;  4EJT A;  4HEA 2;  1BM9 A;  3OYG A;  3GME A;  3QWL A;  2IAI A;  4KMF A;  1GV5 A;  5EGO B;  3KP3 A;  1QRY A;  1ODD A;  4QPQ A;  1FSH A;  5JVG F;  5BOX A;  3LSI A;  2LNB A;  3OYJ A;  4KYW A;  2EZK A;  3ELK A;  1U3E M;  3W6V A;  3NWS A;  3L2W A;  2CUJ A;  1AWC A;  2Z3Y A;  3Q0U A;  4XSZ F;  3V7C A;  4LIU A;  3LAJ A;  2R5Y B;  2EV5 A;  3HYI A;  1Z6R A;  3PNT A;  5H2F C;  3CMA I;  2VIX A;  4YEJ A;  4BL0 B;  4HNU A;  1VND A;  3K1P A;  2VC0 A;  1R1U A;  5FKN A; 
#chains in the Genus database with same CATH homology
 2Y30 A;  2NS8 A;  1MBK A;  3B6C A;  3S1Q J;  5C3E J;  2L7M P;  1A6I A;  2D5V A;  3F0C A;  3LOC A;  2P81 A;  1JTX A;  2DJN A;  1U9O A;  1JTY A;  1JUS A;  5E3O A;  3GTM J;  3JRI A;  5C4X J;  3IH2 A;  1HDP A;  3BR3 A;  2XPV A;  2L7F P;  4AYB N;  2CQQ A;  4A3J J;  2H8R A;  2MGQ A;  3BR0 A;  5IOZ A;  2GLO A;  2FD5 A;  2CUF A;  2ME0 A;  3HOV J;  3TW6 A;  4JX5 A;  3HOY J;  1IUF A;  2CQX A;  5GPC A;  3PO2 J;  4XRM A;  2DA5 A;  2HXI A;  2OF7 A;  4MIM A;  3JRF A;  1NK3 P;  5IYD J;  3BTI A;  2K9S A;  2E19 A;  2KDZ A;  2R93 J;  3I4N J;  1F36 A;  1Y1W J;  1JKR C;  1MBJ A;  4FCY A;  1NTC A;  3S17 J;  2ME6 A;  3M4O J;  5IOY A;  4A3D J;  1ETK A;  2HOS A;  3GTG J;  2DN0 A;  2Y9Z A;  3G1O A;  4JYK A;  1WH5 A;  1MBF A;  3OIO A;  4XID A;  3ZQG A;  1K61 A;  1OJL A;  1ITY A;  2NOG A;  2JJ7 A;  2HOA A;  1DU6 A;  5FKM A;  4FE7 A;  3QPL A;  3A01 A;  1AKH A;  4BY7 J;  5M3M J;  3ZQH A;  3CMY A;  3GTJ J;  4D7M A;  3ZQI A;  1X58 A;  1HF0 A;  3TW7 A;  1B8I A;  4DZP A;  2XSD C;  5FLV A;  5FKO A;  2M8G X;  1Y1V J;  3BTL A;  3MN2 A;  5M5X J;  2VI6 A;  2K40 A;  4A3F J;  2HYJ A;  2DMQ A;  4AC0 A;  3IV5 A;  1ZKG A;  1RES A;  1BL0 A;  2XB0 X;  3GBG A;  4DYQ A;  1GDT A;  4JX4 A;  3GTP J;  2EZI A;  1BW6 A;  4QSH A;  2XGE A;  3JRE A;  3RKQ A;  4BY1 J;  3BTC A;  1AU7 A;  2XGD A;  1AKH B;  2B63 J;  5EZH A;  1ORK A;  4A3C J;  1IDY A;  1O4X A;  3WHB A;  1JKO C;  1NK2 P;  1OCT C;  2WB1 N;  3ZOB A;  4UUS B;  3SFI A;  2DMP A;  3PM1 A;  3S2D J;  1ZK8 A;  4S0H B;  1B8I B;  2ECC A;  3L1P A;  5FKL A;  4B1R A;  4BXX J;  2Y31 A;  3BR5 A;  5E3N A;  4D7N A;  1MBG A;  3C2B A;  2NVY J;  4JX6 A;  3RZO J;  2I10 A;  2QF7 A;  3LSP A;  4M3G A;  4CYC A;  3K2A A;  2CUE A;  2CRG A;  2KT0 A;  2LD5 A;  2EQR A;  2L9R A;  4A69 C;  3HOW J;  5EDN A;  1XG1 A;  5JLX A;  1IJW C;  3FK7 A;  3JRH A;  2DA2 A;  2ID3 A;  2M34 A;  2DMN A;  4QIW N;  1T33 A;  4C3I J;  2X9D A;  2R5Z A;  1R9T J;  3RQI A;  4ABZ A;  2M9H A;  2VUM J;  3FK6 A;  3B6A A;  1ETV A;  4A3L J;  3BG3 A;  2L7Z A;  5M5Y J;  3QQA A;  5FKK A;  1MBE A;  3S14 J;  1F43 A;  2IBD A;  3O8G A;  4I6Z A;  1ETW A;  3A03 A;  4CYC B;  4M3F A;  4BBR J;  2LFB A;  2CJJ A;  2JN6 A;  2H1K A;  5J1R A;  3RZD J;  1RKW A;  5F0F A;  4BKX A;  3S1R J;  3IH3 A;  4V2G A;  3TP3 A;  4IEJ A;  3O8H A;  1I6H J;  4I76 A;  4AUX A;  2R5Z B;  5FJ8 J;  1ENH A;  1TWA J;  3QPS A;  4LOC A;  1POG A;  1ZR2 A;  3HKZ N;  3Q0W A;  4GFB A;  2EH3 A;  3MVP A;  5E3L A;  1LFB A;  4XK4 A;  5BNG A;  4DYR A;  3LSR A;  1RR7 A;  2PMZ N;  2WV1 A;  2E2H J;  2ECB A;  5DS9 A;  4G12 A;  4A93 J;  1JT0 A;  4A3K J;  2DA4 A;  1IC8 A;  4HNV A;  4UUT A;  2YU9 J;  3BQY A;  3GTK J;  3JR9 A;  1W0T A;  4DZJ A;  2NVQ J;  5C44 J;  2NVX J;  1RKT A;  3GTO J;  3BR1 A;  1I3Q J;  3JRG A;  1CQT A;  3PO3 J;  5IPA A;  5K7F A;  1VI0 A;  1Z0X A;  4MFD A;  2VPR A;  2LY9 A;  2FX0 A;  1QPI A;  3K7A J;  1HLV A;  4J19 A;  4DYC A;  2HI3 A;  5K7H A;  9ANT A;  4V2F A;  3H3V K;  2GBY A;  2DA1 A;  4UUS A;  1JJ8 C;  1JUM A;  1MBH A;  5K7Z A;  1I50 J;  1IGN A;  2DA6 A;  2Y9Y A;  1APL C;  1HDD C;  4C3J J;  4D5C A;  1SFO J;  2EBI A;  1IRZ A;  1D5Y A;  3SDG A;  2G0E A;  5IP6 A;  3E7L A;  1YRN A;  4M3E A;  3S16 J;  4A3I J;  4A3B J;  1TWF J;  1AHD P;  3OSF A;  2DTZ A;  3NAU A;  1JT6 A;  3BT9 A;  1H8A C;  1MH4 A;  1MSF C;  2W48 A;  2X48 A;  1G2H A;  3HB9 A;  1QVU A;  2O8K A;  1RPW A;  5J3L A;  3FIW A;  2GM4 A;  5M5W J;  3HBL A;  2XPW A;  4Y7N J;  1GV2 A;  2JA7 J;  2K9N A;  2JK3 A;  2TCT A;  1WI3 A;  2ZB9 A;  3G1L A;  3TED A;  1WCM J;  4XIC A;  2R92 J;  2LK2 A;  2TRT A;  1B72 B;  4M3D A;  1LE8 A;  2AHQ A;  1IG7 A;  5DTD A;  4IHW A;  2XGC A;  3NAR A;  4D5F A;  2OPT A;  3G1M A;  4A3G J;  2AO9 A;  2HQ5 A;  1ZTR A;  4MLO A;  2FJ1 A;  4A3E J;  1YRN B;  1BA5 A;  1X2N A;  1JGG A;  4W1U A;  5HOD A;  2E2J J;  2FQ4 A;  3M3Y J;  1IV6 A;  1WH7 A;  1TC3 C;  3JRD A;  2YUS A;  3BR6 A;  3HOU J;  3HEF A;  3S15 J;  4X6A J;  5EEA A;  5EG0 A;  2LKX A;  2RAE A;  5GPA A;  1U9N A;  1GVD A;  1E3O C;  2EZL A;  3JRC A;  2DMT A;  3S2H J;  1FIP A;  1ZGW A;  2LTP A;  1LE8 B;  4BBS J;  3TP0 A;  5F27 A;  3CQZ J;  1VFC A;  2DA3 A;  3MKL A;  4M6V A;  3FKI J;  1Z77 A;  4L5E A;  1FTZ A;  2JMW A;  1MNM C;  5C4J J;  4B3A A;  5JLW A;  3GTL J;  1JKP C;  3DEW A;  5F08 A;  4A3M J;  1PUF A;  1MSE C;  1JJ6 C;  2EZH A;  1ETQ A;  5EG0 B;  2MG4 A;  2NVT J;  1FIA A;  1ZR4 A;  3HGY A;  2YS9 A;  2MW8 A;  3DCF A;  2X6O A;  3LNQ A;  1VF9 A;  5F04 A;  1S7E A;  3OOU A;  1ZQ3 P;  4FIS A;  5EZG A;  2JA5 J;  3WHC A;  1HCR A;  1MH3 A;  3HM5 A;  1T56 A;  1WGX A;  2L0K A;  5IP9 J;  2QCO A;  1BJZ A;  4XRS A;  3BG5 A;  2O7O A;  2ID6 A;  3SJM A;  1UHS A;  2M2E A;  1ETY A;  2DMU A;  1WPK A;  4X1E A;  2DA7 A;  3IH4 A;  1PUF B;  1A5J A;  2CU7 A;  3I4M J;  1FJL A;  5IP7 J;  3Q0V A;  2VKV A;  3HGG A;  2HOT A;  1HOM A;  4QTR A;  1TWH J;  1QVT A;  4JP0 A;  3CCY A;  1FTT A;  3CDL A;  1JUP A;  1ETX A;  4M3B A;  1UG2 A;  1ETO A;  1FEX A;  2JA8 J;  2R0Q C;  3LSG A;  4MO7 A;  2VKE A;  1GUU A;  2XRL A;  3BTJ A;  4XRS G;  2HDD A;  2E1O A;  1OFC X;  1P7J A;  1K83 J;  3S1N J;  3HDD A;  1B72 A;  4IHX A;  3FIS A;  1SAN A;  2M0C A;  4IHV A;  5J1U A;  3BR2 A;  3HOX J;  3JRA A;  2MSY A;  5EYR A;  2LR8 A;  2Y0S N;  3ZQL A;  3UKG A;  1X2M A;  2NS7 A;  2HXO A;  2LVS A;  2WAQ N;  3GTQ J;  4FE4 A;  3Q3S A;  4C2M J;  4MFE A;  4W97 A;  3S1M J;  4DW6 A;  4RBO A;  5EGO A;  5E3M A;  1U8B A;  2ELK A;  2JA6 J;  3BQZ A;  4EEF G;  5IYB J;  5FLM J;  1U78 A;  4C3H J;  4B4C A;  2LLK A;  1W0U A;  5IYC J;  5F0C A;  5EF6 A;  5J1Y A;  1OCP A;  2IEK A;  4NDL A;  1TWC J;  2R5Y A;  1XS9 A;  1LFU P;  1Q1V A;  3A01 B;  1EF4 A;  2N8G A;  4IHY A;  2K9Q A;  2E2I J;  1UMQ A;  1RET A;  2COB A;  3A02 A;  3VPR A;  1JKQ C;  1TWG J;  1DU0 A;  2IAI A;  3H0G J;  1GV5 A;  5EGO B;  5GP9 A;  3BG9 A;  5F0H A;  1QRY A;  3HOZ J;  1H89 C;  1XC5 A;  5M3F J;  1GT0 C;  2EZK A;  2Y2Z A;  3W6V A;  2R7Z J;  1IDZ A;  5F1J A;  3OSG A;  1BW5 A;  1P7I A;  2JWT A;  2LP0 A;  4FTH A;  3Q0U A;  3ZQF A;  3D1N I;  2O9L A;  2R5Y B;  3JRB A;  2XPU A;  4RDU A;  1VND A;  2XB5 A;  3ZQC A;  4Y52 J;  3LSJ A;  5FKN A;  1H88 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...