2NXNB

T. thermophilus ribosomal protein l11 methyltransferase (prma) in complex with ribosomal protein l11
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
139
structure length
139
Chain Sequence
MKKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFVTKTPPASYLIRKAAGLEKGAHKPGREKVGRITWEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Ribosomal protein L11 methyltransferase
publication title Recognition of ribosomal protein L11 by the protein trimethyltransferase PrmA.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 20
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2006-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
B PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2nxnB02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 2nxnB01
3CCUI 3CCJI 3I56I 1VQKI 4IOCF 3CCLI 1WIBA 1VQ7I 3CC7I 2NXNB 3I55I 5GAEJ 3CF5F 3CCEI 1MMSA 3CMAI 3G71I 1YIJI 1HC8A 2K3FA 2OTJI 5JVGF 3G4SI 3J7YJ 3CCQI 3CJSB 3CJRB 3CMEI 1YJWI 3EGVB 5GAGJ 5GADJ 2E34A 1YJNI 1FOYA 2ZJQF 1VQ4I 2QA4I 2E35A 3G6EI 3CCMI 1VQPI 1S72I 5GAHJ 2JQ7A 3PIPF 3J7ZI 3CD6I 1YI2I 1FOXA 5DM7F 3PIOF 1VQ5I 1QA6A 5DM6F 1ACIA 3DLLF 1YITI 1VQMI 2E36A 3CCRI 1YJ9I 1VQ8I 4IOAF 3CCSI 1VQ9I 2H8WA 3CC2I 1VQ6I 3CJQB 1VQNI 1VQOI 1FOWA 3CCVI 2FOWA 1YHQI 4IO9F 1Y39A 3CC4I 4UY8I 3CJTB 2QEXI 2ZJRF 2OTLI 1VQLI 4V19K 2ZJPF
chains in the Genus database with same CATH superfamily
4DOZA 2XKOA 3VODA 4BY1J 1Z1DA 4U88A 1OR7A 3EETA 1G4DA 1U9NA 1I5ZA 2HDWA 5BQTA 2XAGA 3H36A 4LITA 4ZC3A 5L3EA 1G59A 2KQRA 2K3PA 2VJ5A 3BQYA 1H9GA 1OCRH 3T8RA 3M1CA 1B4AA 4DQ2A 4XLPF 3OYLA 3G71I 1HC8A 2Q8KA 2YS9A 3GFJA 1WSUA 1Z67A 2VB6A 3N05A 2HYGD 4BHPA 4E7LA 4OIOF 2HTSA 1TP4A 3WE3A 5HLTA 1K4TA 2EA2A 4EJTA 1IXRC 3CJSB 3IAM2 2K86A 2E1OA 3H9GA 1FNNA 2PMZA 2OU2A 1IRGA 3LFUA 4WXDA 5M5XJ 4Y3OA 4HDUA 2B9SA 2ZFWA 1FPQA 1KU3A 2ZNZA 2VLAA 4H0EA 2KZGA 4RGXA 5IP7J 1YJNI 3ULQB 1LUJB 2HU9A 2HVSA 1X19A 4YFXF 1O3TA 3OIPA 2JVHA 1N78A 1SFEA 2GBYA 1SVLA 3A4CA 3G6EI 4DNCA 4XOPA 1JKRC 3OMYA 2BHZA 1SAUA 2PN6A 3HOTA 5GTIC 2JQ7A 2EBIA 3GLXA 3ZMTA 1PUFA 4KJZA 2LRDA 3FX3A 5E3NA 2HQRA 2XDVA 3HL2A 2JN6A 2W85A 2A3SA 5EZHA 4LB5A 3BJOA 2UXXA 4BQOA 1W5CC 4J00A 1OCPA 3KZIC 4Q48A 5EJCA 3ZXSA 1UB9A 4I7HA 1Z77A 1YITI 1R1UA 3BQZA 2G9WA 3AL0B 2ESHA 2EFOA 1MKMA 5J8CA 1FZPB 4S0HB 4Q5SF 2VQHA 2HYJA 3CDHA 2XF6A 4PK4A 5L3CA 4OMYA 1Z0XA 2H1LA 2V4JC 3E6MA 4RLFA 2LOOA 2L2OA 1EA3A 3R60A 3RKXA 1QHHD 3NWTA 5H20A 5HS7A 3HOWJ 2MA3A 3D1NI 1I1SA 3Q9VA 2JA5J 2KISA 2UUZA 4S04A 4EVIA 1O3RA 1LVKA 4M74A 3L2RA 1SANA 4HDVA 2EWNA 3FBIB 3K4NA 4G12A 5KAIC 4D9JA 2OQRA 5CVJA 2QEXI 2HDCA 2ZBKA 2DDBA 1UCRA 2W25A 3KP2A 1BL0A 4A6EA 2P0WA 1FBUA 2VIXA 1T98A 3WTSC 4CYCA 4U87A 4KMUX 5K5RA 4U7DA 1UHWA 2DDAA 2CW7A 4FETA 3LSIA 2GAUA 2L01A 2ZSIB 4A5NA 4CO8A 5CYVA 2M30A 2RKHA 1A36A 3GBGA 1GV5A 2BE5F 1A5JA 3FZVA 4KIGA 4A3EJ 3VDXA 4D7MA 3FHZA 5LEKA 1Z91A 1YFHA 3V7SA 3L1PA 4RAZA 3CMMA 3JCUC 1VI0A 2HWVA 5GAGJ 1SEUA 1AA7A 1MMDA 1DPUA 3BZKA 1U8BA 1WFXA 3CP2A 3OS1A 2PFBA 1QGPA 2HOAA 2Y0SN 1IN4A 1UFMA 2F6CA 2QSFX 4B3XA 3WGIA 1W0UA 4ESBA 1KA8A 1Q1VA 4AIHA 3W2VA 4RB0A 5TJJA 3GLLA 2PX9A 4Q47A 2P5VA 2FX0A 4A5MA 2ZNYA 5EG0A 3TO7A 4G7OF 2IAIA 4G94A 5D4RA 2JK3A 1BW5A 3FMRA 2PJRB 1ETVA 2L7KA 5DM6F 5K7HA 2CRGA 4QSHA 4CCLA 5FFXA 4C2UA 1F4KA 3I5UA 5LGNA 3X2QH 1R6RA 2P8TA 1YJ9I 1R22A 1UHMA 2VE8A 2E1MB 3QYBA 2Y31A 3V4GA 2FXAA 5IYCJ 1FT9A 2WAQA 4LLNA 2NVQJ 4DYCA 3L2VA 4BDYA 1CGPA 3CJQB 4E4HA 1AOYA 2BYVE 3C1DA 4KYWA 4J19A 2H8RA 5EGOB 4AVZA 3BR0A 5F08A 1TT5B 3QYFA 5F1JA 1X4OA 4ANJA 1SVOA 4PGHA 3RZOJ 4KIFA 3OYAA 3IRRA 3BR1A 4BNCA 3VSKA 3H0DA 1IN8A 4JX6A 3ZQIA 2OTLI 1T08B 5H6QA 1MBFA 3SZGA 2NOJB 1SAXA 4XKCA 2WA0A 5L3FA 4IHYA 1KU2A 1S9HA 4NB5A 4ZYGA 2ECCA 4HSTA 4MNUA 4A6DA 5HVQC 1VQ7I 3I59B 2JA2A 2R92J 1GLNA 4KT6A 3OR2C 2E1CA 3LQQA 3HKZN 5CJ9A 3CCEI 1Y0NA 2VQGA 1HW5A 3KFWX 3LOCA 2DT5A 3BR5A 5CVVA 2CQNA 3ZQ7A 2O3FA 2FJ1A 3OWTA 4A3JJ 3Q0UA 1ZGWA 2KRHA 2ZJ2A 1BI1A 4XR6A 5DDGA 5JLWA 2IA0A 2XIGA 1H88C 2XAFA 4HBLA 3FXQA 3DF8A 1Z05A 4I76A 1FTZA 2L9RA 2A6TA 5B1BH 4JK1X 2OA4A 4RGUA 2RNJA 3IL2A 1XDUA 2FU4A 4XONA 1VQ4I 1QQIA 1ZYRF 1XGOA 4XN0A 4BQQA 1IRZA 3NWSA 2I8DA 3ZPLA 1QZEA 4OAYA 4Y33A 3SJMA 2O9LA 5JVTA 2E71A 2DPDA 2VOPA 2KT0A 3K1MA 1KQ8A 1YIOA 4MQVA 1XGSA 1O57A 3OOPA 3OL3A 3HIFA 4E6KG 3PIPF 2HQNA 3L9FA 2XAHA 2XV4S 4AYBA 5GP9A 1BC8C 2RDPA 1Z3YA 2VJIA 4LD5A 1UG0A 4KUMA 4F3QA 4L5IA 1FMWA 3R4KA 4L9TA 2H94A 3L2WA 4IXAA 3RTRA 2CG4A 4A3LJ 3OSGA 1ETOA 2DMTA 2Z16A 3MCZA 2JSPA 1F43A 5F27A 4PUSA 3CLQA 1U9OA 2L02A 3SFZA 5J47A 4HSRA 2AXLA 2W00A 1GT0C 2M0MA 2ACJA 1P4WA 3K4CA 4EM0B 4GO1A 5CVRA 1IRFA 3JR9A 1ZLJA 1WCMJ 1MBHA 2QQAA 4EGZA 2FBKA 2M4GA 2IGNA 3C7JA 3CMYA 1SFXA 4KN4X 1SVMA 4PDKA 4LIVA 4WK8F 3K0LA 3DEWA 3K4BA 4GYIA 3DEUA 2K4JA 1ZRCA 2GZWA 2L9NA 3S15J 3HGGA 1V55H 2HOTA 2F2EA 3CCJI 3PNVA 1FP2A 5IPAA 1P7JA 1XMKA 1TQPA 4DIQA 1E3OC 3WU2C 3TBIA 3TKYA 5D5XB 1W5TA 3B6AA 2K9SA 2LY1A 2XRLA 2XAQA 1HKQA 1WJEA 5IP9J 3KEQA 1MMSA 2VBYA 3GZ6A 5K5OA 3CDLA 3FBNB 4M9ZA 1GVJA 4EGYA 2MC4A 3S32A 2ZCWA 2XB5A 4AIDA 2NRAC 4I0BA 5F1RA 3KLOA 3FK6A 2KMUA 1X1AA 4XLAA 3BWGA 1OYIA 2X85A 3ZRGA 2IRFG 1IXCA 1IG7A 4FE4A 3PO3J 1RRJA 4A3KJ 1B1BA 5CVIA 5C4XJ 3RJPA 1QZZA 1P2FA 3F0CA 4HG2A 3MKWB 5J3LA 4EJUA 3JRBA 3ONQA 2VE9A 4IHTA 3O8GA 2PBIA 2QA4I 5JR3A 2FSWA 2HQ5A 1I39A 4E7KA 2E7XA 4W97A 5M5YJ 2NAZA 3CQZJ 1J9IA 3KETA 3GW2A 1VQPI 3S2WA 3WTYC 5CPRB 1YTYA 1T38A 4DZPA 5FFZA 4ZDOA 3GUDA 1PUFB 4GXOA 3WG9A 1A6QA 3HGYA 5FRNA 3E0JB 1QVTA 2KRCA 3IAS2 1EKEA 3CCYA 4Y17A 5BPIA 3HDDA 3ABKH 1B8IA 5F0HA 4UVBA 2Z99A 3DPLC 5EF6A 4IL6C 2LFBA 1GXPA 4PJNA 2V7FA 2ECBA 1Z7LA 3LAJA 3QOPA 2VKHA 5DS9A 3OYJA 2XPVA 3VYTB 4JX4A 3OS2A 2DAOA 2VBWA 1WZ2A 2CYYA 1SMTA 2R3SA 2RNGA 3CC2I 2ZB9A 1PJRA 3CDIA 1LDJA 1NHAA 3JTHA 2PMUA 3CLOA 1ON1A 2LNBA 4L5JA 2I10A 1TQIA 1U2WA 1R5ID 4IO9F 1G3TA 3CC4I 1BIAA 2EPFA 5FO5A 3DP7A 4EJWA 1HCRA 4BJTA 1EF4A 5D4SA 5FKLA 3M07A 5J1RA 4DGWB 3VSLA 1BI3A 5J40A 2CSOA 2EINH 2DA3A 1XGMA 3H9QA 2HPIA 4CYCB 3JRHA 1HF0A 2QSGX 3H3VK 3WTUC 4BXUA 4IOCF 4MIMA 2EQRA 1DUXC 1R4MB 3IH2A 3QPTA 3TO9A 1DP3A 3F8NA 1NH3A 1QBJA 4ASNA 2BXZA 2J5PA 1MD0A 2X4HA 3HBLA 4B44A 3NEUA 4XRMA 3K2AA 6PAXA 4R8HA 4A3IJ 1FP1D 1MGTA 3LL7A 1TNTA 1X1DA 1XD7A 2QZ8A 1W36D 1X3WB 1S7OA 2EV0A 2M9HA 5D5UB 3SEQA 3TL4X 2LY9A 5EYRA 5ERIA 2VXDA 4UUSB 3E1SA 3ZQHA 2A07F 2F5FA 5B1AH 3G1OA 5TISC 2ELKA 3F23A 1AKHA 2JMWA 1TWFJ 2BVMA 3MZ8A 4A2UA 5IP6A 5FLMJ 5D6EA 5HNHA 5IYDJ 3ZMZA 1MZBA 2BGCA 2M2EA 3AG1H 3OYHA 1NK2P 4QLCU 3PM1A 1YW7A 4HEA2 3JRAA 2F48A 2VC0A 3D5SC 2E35A 3F8BA 1R7JA 4KA4A 2IS6A 1O3QA 2MYSA 1R23A 2J5OA 4EM2A 3TDUC 2DLLA 5EG0B 2R5YA 4D5CA 2DJNA 3FK7A 3I0TA 5JFRA 3KE2A 2IGOA 2K9MA 1FOXA 5F0FA 1O7LA 4C30A 2FOKA 2OF7A 4IQ4A 2LKXA 1BR2A 1XTAA 2VKEA 3PQKA 4Y4RA 4G6QA 1GXQA 3PJRA 3ABTA 4HX7A 3DLLF 3KLNA 4KT5C 4I2OA 4G6TB 1V5GA 3K10A 4L9JA 2XUBA 3I3LA 3A2KA 2LDUA 4XRSG 1R5HA 1N25A 2A68F 2OZ6A 3T8TA 2GM4A 1VQ9I 4ZYDA 1NG6A 4AM3A 1Z6RA 2A6HF 3R6SA 1JHFA 5ILVA 1D0YA 3ABLH 4GYGA 3MKZA 2ZMEB 4LJZF 1TQMA 5D8KB 2DA2A 3QPLA 1KU9A 3OS0A 3E6DA 2EK5A 2DT6A 2XGDA 4P96A 2F4OB 2XVCA 3CUQC 2DU9A 2KZVA 3Q3SA 4ETSA 3K70D 5GPCA 1VQLI 2V79A 1HSTA 1REPC 4RM3A 5KK1A 1MMNA 1WI9A 1KU7A 3K9TA 4BGDA 2R7QA 3H5RA 2NVTJ 2K27A 2COMA 4AWXB 3S2HJ 4N9IA 2NXNB 2IJLA 4V2GA 5E1WA 5KCMA 5EZGA 3ECHA 1K79A 3LWFA 2CV1A 4ESJA 3K2ZA 2AO9A 3DWLE 3Q0VA 1WJ5A 4RB2C 3ZQGA 1YRNA 1V3FA 4HF2A 4KDPA 5BS6A 5DD8A 4FX0A 2NS0A 2OV7A 3FDYA 1ETQA 1JUPA 1TLHB 5IYBJ 3ZR8X 4HNUA 2GOXB 4ZZDA 2LK2A 4M3EA 4CCKA 1T56A 2Q2EA 4C3IJ 2BY2A 4UVCA 2ME0A 2VKVA 3OYEA 1X4PA 4LG3A 2P4WA 4BBSJ 3ZQQA 2ZXJA 2IBDA 1D1AA 3U1DA 1IDZA 3A01B 4PJLA 2RN7A 1MSFC 2DMNA 5FROA 1FOKA 3NQOA 4IRHA 2H27A 1T95A 2TCTA 1L0OC 4M3BA 2D5VA 2RQPA 5DCMB 2AQEA 2DT7B 5K5QA 2CV0A 2DK8A 2BVLA 2WWYA 3J7AO 5HLGA 3E5QA 1RPWA 2KPMA 2QQ9A 2LF8A 3LSGA 3P7NA 2YU3A 1K83J 3DXJF 1W7PB 3BPVA 1YG2A 1T2KA 2Z1DA 2HYFA 4IF4A 4MEYF 2GIVA 2KRFA 2MD5A 3LSHA 1RIOH 1ZR2A 2FNAA 5HS9A 5CVUA 1ZR4A 3FKIJ 2MLGA 1F36A 2GOMA 1VQ8I 1SD6A 3WE2A 5DEQA 2H09A 1T6SA 4IOAF 1MNEA 4U7BA 2IS1A 4M71A 2EV6A 5F64A 3WGHA 4RMNA 4WCGA 4P9FA 5FB2A 1RUOA 2AQFA 3ASOH 1UELB 2HVQA 1BN5A 1Y39A 1DQUA 4L0ZB 3B73A 1I27A 1R1TA 3KEYA 1C0WA 1I3AA 4U0YA 3WTTC 2X1CA 3S14J 3G2BA 1BW6A 5EEGA 3IH3A 3BT9A 3BTLA 2G0EA 2QUFA 3G3ZA 4ABZA 4KNYA 1YX5A 2K7LA 3LA7A 1FMVA 2CQXA 1EH7A 1LKXA 1OCOH 4FX4A 2QM3A 4D7NA 4FTHA 2R7XA 1JHHA 4EM1A 1FLIA 2GIZA 2BBYA 1POGA 5K7FA 3PSFA 3P9CA 5DV5A 3T1BA 5HNFA 5FLXZ 5DYMA 1Y8QB 3TO6A 1BJZA 3DKYA 4FE7A 2V6CA 4L9VA 1YIJI 4KFCA 3S8PA 1I3QJ 2K3FA 2GXGA 2ZFUA 4BEHB 3S1MJ 2V9KA 4A3GJ 3K69A 2IXSA 1OYWA 4ZDPA 4FCYA 2IPQX 3KZZA 2HDDA 3PFYA 5BNGA 3JRIA 1XSVA 2WC2A 4UHTA 1T33A 2DBBA 2ZO4A 2D45A 3EGVB 2OAZA 3L00A 2E2JJ 4XORA 4Y15A 4MGRA 2Y69H 1FSHA 1U5TB 2X0LA 2CMPA 1MDMA 2QKLB 2ZJQF 3PUBA 2RC4A 4I98B 1Y8RB 2EFQA 3HOZJ 4G8XA 1K61A 3T0YA 3OV8A 5DD4A 2EZHA 4M72A 4H4KC 1XG1A 1RZ4A 3K1PA 4MQ9F 3GFIA 2WB1A 3FXRA 4XOTA 1X1CA 1ETWA 1BM9A 2KIFA 1R00A 2OC6A 2QYOA 4EV0A 1IAWA 5LEJA 1RC9A 3MEXA 2ZKZA 4I0AA 1J75A 2EJRA 1OCCH 1PVEA 1B8IB 1BBYA 1JTYA 3AG2H 3VEPA 2VC1A 4F55A 3W2AA 3CUQA 2E36A 2V1NA 3E97A 1U6GA 1IN5A 2LYCA 2QKMB 4D0PA 3TW6A 3AL0C 2RVCA 1Z7UA 5KNLA 4PCQA 3ZQFA 4QIWN 1G6NA 3GFLA 3UR3C 4BHBA 1VQOI 4QPOA 4UUVA 4LLGF 1E3PA 2NNYA 1T39A 4IVNA 1JUSA 3HG9A 3LSKA 3OYKA 2FA5A 2M87A 4RB3C 1P7IA 4UUTA 1T8IA 1XX5A 4NC6A 2F5CA 1RESA 2ZXWH 4LG0A 4WWCA 3L2CA 4G7HF 1IC8A 1Y1VJ 1J0RA 2ADUA 4ENJA 3IV5A 5ILSA 1I1GA 1LNWA 4G6DA 3VYRB 5H6RA 2IA2A 4X0GA 2EIJH 4XRFA 3HUGA 4A3CJ 1FBQA 1IRXA 3DTEA 2KKOA 4DBQA 4XKWA 2Y2ZA 3P9KA 1O4XA 4PFPA 4D1QA 4CXFA 2LP0A 3ZP5A 3CCLI 2O8XA 1UG2A 4UVAA 4JBAA 2DCEA 1YLFA 2BZTA 3OYGA 4YIRX 3EQLF 1P6RA 1ZK8A 2LTPA 3E5XA 3CESA 3ZMUA 2E5NA 2L3DA 4WXHA 1ODDA 1ZAOA 3HXLA 4NC8A 5FD5A 3HRSA 2DXIA 2Y0MA 4XLEA 2L0KA 3HPHA 4BU2A 3G4SI 3GTMJ 2W1OA 2IVMA 5L3GA 3CCQI 1OCZH 4ZZLA 3TEDA 4HLYA 2JUGA 1AKHB 1FY7A 5KAFC 3BZ6A 3CMEI 2PI0A 3REOA 5C3EJ 4AVPA 1UZCA 1JI8A 4XLCA 2M45A 2E34A 3FHNA 3EUHC 2DA6A 2HNHA 3H1CA 1LVAA 1G3YA 5E8GA 5JI6A 3IC7A 4DW6A 1DDNA 3CCMI 2R5YB 1BR4A 2Y30A 3KP3A 2P81A 1DGRM 3GTJJ 1WWXA 2QWWA 2UWMA 2KIMA 3EYIA 2CQ7A 1BOAA 3ABUA 4BH9A 4HQEA 1XC5A 4E7IA 1ZGAA 3M8FA 2LH9A 1IXSB 5J1YA 3G73A 1UHSA 5DM7F 4NHJA 2M7AA 2F4IA 3WHBA 3ZQCA 1LPQA 2OPTA 2HR3A 3CCRI 3GFMA 3DTKA 4HQMA 2FBHA 4BJ5C 1MBJA 4N0BA 2A05A 1FJLA 4CA0A 4JYKA 1K4SA 3RDIA 1YYVA 1JGSA 2H6BA 4ENNA 1FWZA 4AIJA 4BL0B 2HOSA 1VQ6I 2E1MC 3U21A 1XMXA 3A0HC 3BG7A 2F5VA 3BG6A 4U0WA 4MEXF 3GEZA 3TP0A 4PJ0C 3CJNA 4LK1F 5KHDA 3KP5A 5IOYA 2PQ8A 2IEKA 4XQFA 2K9LA 3F72A 3F8MA 1YHQI 3BTCA 2XAJA 3DV8A 1LE8B 3QAHA 4XMYA 1W0TA 1FEXA 4HAMA 1TBXA 3OL4A 4OWRB 1DU0A 2WV1A 4EEFG 3CTAA 2ELHA 4JQFA 2PJPA 2W7NA 2X9DA 4XIDA 4LK0F 2XC7A 3VYUB 2E19A 2DMPA 1V54H 5HDGA 2QF7A 5LRRA 4QPQA 4UV8A 3M8JA 1TTYA 4DYQA 1OISA 1ZGJA 3AFHA 4RA2A 2L9VA 4TV7A 3TQNA 4E7SA 3I55I 1JKQC 4A0ZA 2AHQA 2JWTA 2X1DA 4RAGA 2HZDA 3H3UA 3ISPA 3SQNA 1W1WE 1MJBA 5FRMA 3V8JA 2X6WA 3VPRA 1YRNB 3CZ6A 2GA2A 4YRVA 5E3LA 2OQGA 1RR7A 4O3MA 1ETYA 5AIQA 1TWHJ 3DBRB 1WJFA 3RQ4A 1GUUA 2W24A 3DKXA 4Y7NJ 4M9SA 4HYEA 4L9NA 2KJCA 2Q2EB 3R0AA 2P7CB 2JZYA 4FT8A 4CCJA 1KGSA 4K2EA 5FLXK 2ISZA 1PP7U 4Y13A 2HOEA 3UKGA 4CSWA 4XRSA 1WJCA 3DKWA 3OYIA 3ZOBA 1FOYA 1IGNA 4BBRJ 2LC2A 1U78A 2QCOA 2FNPA 4BE1A 3JREA 1RKWA 2KLOA 2Q1ZB 1G8XA 2CFOA 2LREA 3LA3A 1RUNA 1WJBA 2HGCA 3CO7C 1S72I 5GAHJ 1IN7A 3HYIA 3I54A 1ERDA 3M9AA 5CQEA 1BJAA 3GO5A 3S16J 3GTOJ 3V7RA 3BY6A 4XLNF 2W82A 1U0JA 2E60A 2R5ZA 3OR1C 3QWLA 1QA6A 4UV9A 4MFEA 2F5DA 4LFUA 1K6OA 4GCVA 2HKXA 2KDOA 3HHGA 2ISYA 4A0XA 1B59A 1LDKB 2IGKA 3HC7A 3FIWA 3B6CA 3DLAA 3F21A 1WVRA 3ZN0A 1D5YA 4BAYA 2Z5UA 3HSEA 3CO6C 1VZ0A 4ZH4F 4BJ6C 1ZQ3P 4GGGA 2YX7A 4IPAA 1BOBA 3HRMA 1LFBA 2A6EF 4AD9A 4ZYHA 2V1UA 2D2WA 3IHUA 4OOIA 4M6YA 3ZGKA 5FJ8J 3RQIA 5K7ZA 3D5LA 1XPXA 2DMUA 3P9IA 2PLYA 3K4MA 1XSDA 1UJ8A 4RDUA 4F93B 2MGQA 4PSWA 3BR2A 5M5WJ 3FXOA 5LD2C 1D8KA 1L3LA 2O5RA 4YFKF 2VONA 4XICA 1R1VA 2JRMA 2MH9A 3FM5A 5L3BA 2HFHA 1YX3A 2R7OA 4BS9A 2L5QA 2QQBA 3ZN1A 3RPQA 2DI3A 3RPUD 1OR7C 2DFHA 4OIRF 4KISA 2M4KA 2MC3A 2VKDA 2R7VA 2D1VA 2VL8A 2HXIA 4BKXA 2EZIA 4M73A 4EJVA 2VOOA 2O8KA 2C6YA 2MABA 2XB0X 4ITVA 5E18F 2DFFA 2XSJC 1H8AC 2M8GX 2F4MB 2Z2SB 1SD5A 2R7RA 4M3FA 3O2PE 2WAQN 2F5EA 2QBYA 2OTJI 1SD4A 3C18A 3J7YJ 3H0GJ 3R61A 4O5VA 1LFPA 1STZA 2EH3A 4HF0A 4ZYEA 3GXOA 2XGCA 3D0SA 4KN7X 2JVGA 5F6FA 1Y1WJ 4LGWA 4O6JA 2I5UA 3WTVC 4CHUA 5F04A 2OCCH 5J4YA 1B72A 1TWAJ 4XM3A 3AKZA 4DYRA 3F8FA 2VT2A 2PJRA 5LHIA 2ZXIA 5B3SH 1R5GA 3FXMA 2DOEA 1SD7A 2FMLA 2EILH 1OFCX 4IRGA 3M1EA 3JRGA 3HOYJ 2P7VB 4F92B 1BIBA 3BLYA 5IY5H 3U2RA 2BV6A 2V9VA 4B48A 3IKTA 4IHVA 3J7ZI 3M3YJ 2DFIA 2ETHA 2ICWG 4IKFA 3WU1B 1RR8C 3K4LA 2MH2A 4L5EA 3JRFA 3OYNA 1BR1A 2O6GE 5IT3A 2R7WA 5JHUA 3Q5FA 5E1XA 2L54A 5EGOA 5B5EC 3J81Z 1LEAA 2R7UA 2LLKA 2M1BA 2R7FA 4I01A 2ME6A 3RPUA 2VBZA 3E6BA 1KYWA 2UZKA 1RETA 1HA8A 4FHTA 3G1LA 2X6OA 4EMSA 3IWFA 1IV8A 2DODA 4G9YA 4A3DJ 4JX5A 1ETXA 1OYYA 4BE0A 3ZMDA 4OIPF 2EFPA 2LSOA 2MG4A 2E2HJ 1SFUA 1HKTA 1MBGA 3IUOA 2JSCA 1OPCA 2BHYA 2CUFA 4FASD 1ON2A 3U1KA 1MIJA 3C2GA 2IT0A 2HS5A 3I59A 5LLQA 4XLFA 3MMYB 3OIQA 2STTA 3K6GA 3Q0WA 2BEOA 1USSA 3P5JA 1O3SA 2DPUA 4LG0B 3FXLA 1FSEA 2HQAA 2DW4A 2L4AA 4X1EA 3ML6A 2Y9ZA 1FX7A 1JTXA 2DN0A 1YOVB 4WXCA 3F22A 2DTZA 2Y0SA 2YSRA 3PSIA 2DK5A 2CFXA 1OQYA 1V5EA 2HPMA 3COAC 2RREA 1I6HJ 3RKWA 2L4MA 1HKSA 2X6YA 2STWA 2O7OA 1HQCA 2XAUA 3I56I 1FBSA 1VQKI 1BI0A 2V26A 3S3NA 3H35A 3KIOA 4C2MJ 3H5NA 3WTWC 1KONA 1QU3A 2UV1A 3S3OA 4YIIA 1ZHFA 4A3BJ 2QQ8A 4GRIA 3FXJA 1E0EA 1XCBA 1KZHA 1Y56A 3OY9A 1NG7A 4YEJA 3N4MA 1QPIA 1JGGA 3U9GA 5JVGF 4KICA 2ID6A 1U3EM 4AU7A 3V7CA 3ZMSA 2G7UA 4E7HA 1N77A 3K4KA 3A02A 1H89C 4NUBA 4E7JA 5D8LB 1UAAA 2K40A 2P5KA 3KYCB 2XSDC 1F9NA 1AU7A 3SHFA 3WODF 1Z6TA 3KEOA 1TWGJ 2E2IJ 1S7AA 4BQAA 1FYKA 3DEEA 3OYFA 4NDLA 4WX9A 4UNOA 3AG4H 1YO5C 2HXOA 2OD5A 2FQ4A 1TT0A 2VPRA 2W48A 4XSZF 3HOXJ 2IS4A 2CU7A 2IA1A 3MD2A 5LHHA 4DJAA 3QU3A 2BY3A 3TGNA 1WH7A 4I09A 1MNDA 1JKPC 3CD6I 4D5FA 3C2HA 5J8FA 3O6BB 1I50J 4A69C 1S3JA 5E20A 1VNDA 2EB7A 4I02A 1IW7F 5M3FJ 1PDNC 3ZCOA 2EA4A 1XMAA 5H2FC 2RV8A 3CUOA 4UB6C 3KZYA 5J6XA 3OIOA 2MD0A 4RGRA 5AONA 3RYRA 3FF5A 4B47A 1R4NB 2JPBA 4C9YA 1WJDA 3S1NJ 1JXSA 1ZRDA 3GF2A 3HKZA 1A04A 3BG5A 2BW3A 2Z9OA 5HDKA 4YIFA 2A5YB 3QYEA 4IQJA 3F8CA 4RGSA 4F7ZA 4NC7A 2JA8J 1FOWA 1Z3XA 3H5AA 2X1EA 4M6XA 5D5VB 1OMIA 1LFUP 2XPUA 4MTEA 2VT3A 1MNMC 3ABMH 1FC3A 2VPLA 1RKTA 3WHCA 2MW8A 2ZMEC 3MN2A 3PNYA 1RI7A 1FYMA 1F5TA 3CP8A 3HB9A 4B1RA 2HKOA 3KYLA 1Q1HA 1DU6A 5HODA 3ELKA 3DBHB 5ED4A 4RLQA 1S7EA 2KJBA 3CCUI 1MJ9A 1S29A 3VFZA 3CF2A 4BHCA 4PFOA 2CJJA 3BR3A 3RIRA 5LGUA 4ZTJA 4I99C 4XKBA 3KCCA 2R4GA 2A61A 5JHFA 1IUFA 3C3WA 4IZZA 3CF5F 3IKVA 1WI3A 1Y6IA 2QVOA 3BDDA 1MBKA 1OCTC 3W3CA 4ESFA 3JAMZ 3PQJA 3HM5A 1ZRFA 4CCOA 4BXXJ 2P6TA 5ICEA 3L09A 2Q0OA 5TRDA 4OU0A 1S8NA 3TW7A 1B9NA 3CJRB 4PGGA 3L2UA 4YELA 4IHWA 2W57A 1X58A 4OMZA 2R7TA 3PUFA 3V8LA 1ZG1A 2L9SA 1X3ZB 3KPHA 4KITB 1OKRA 4AC0A 1LJ9A 3QP5A 1M1EB 2DA1A 4BE2A 1BI2A 1W4MA 2IGMA 3F6VA 2GWRA 3S2DJ 4P1WA 2DA4A 1WGXA 1G3SA 5E1ZB 3S3MA 1VF9A 4IRIA 3QRFF 1ZLKA 2CV2A 4HNVA 4OIQF 3LQRA 2VQCA 3GYHX 2LBFA 4ON0A 3I4NJ 1S5LC 1ZH5A 1KQ9A 1MMAA 5HLHA 3H92A 3BG3A 3PNTA 3JRDA 4L18B 2QENA 2R5ZB 1SMYF 2XRNA 1VQ5I 1LQ1A 2CWEA 2LVSA 3RI4A 3ECOA 2GQQA 3WG7H 2MFZA 3S93A 1HOMA 4U0VA 1D3YA 3ESWB 3FWEA 1EH8A 4A3FJ 2ZC2A 2DTRA 2Y75A 3HRTA 5HDNA 3CCSI 3VB2A 3DCFA 3HJEA 3UNGC 4E7ZA 5K1YA 3DPTA 3LAPA 2GA1A 1D5VA 3TMOA 1X3UA 3KP6A 4PZJA 4P5OA 3QP6A 2WAEA 2MBFA 2AS5F 2OUMA 2CUJA 4XNFA 2W4SA 3J81K 5E3OA 2M8EA 3WGGA 1S6LA 1HDPA 1NK3P 2CW8A 1H9TA 2HI3A 2P5LC 4FISA 1ZTRA 3FXKA 3A1YA 5FKOA 1IZ1A 1P92A 3PFIA 4FQGA 2G7HA 4CGZA 3WTXC 2JTVA 1JT6A 2NVUB 2ZJRF 2Y9YA 1R71A 3I58A 1J5YA 3QU6A 2WTEA 2EZLA 3HRUA 4IX7A 4UUSA 4HW0A 5FKKA 3BC8A 3NARA 3NAUA 1IUYA 2LF7A 2XF7A 2JUCA 1LDDA 1ZN2A 2V1DA 1J2XA 4MO7A 1IF1A 1K78A 4UB8C 2YX4A 4NQWA 4ENMA 3RCOA 1R9TJ 3MKYB 3BTIA 3OYDA 4XK4A 2XASA 3BCAA 4MLOA 4N4NB 2NVXJ 2QBYB 2Y48A 3SYTA 3V42A 3M7GA 1HLVA 4JP0A 2IW5A 2YU9J 4XLHA 5E79C 2DO7A 4KIBA 4L0YB 3HOSA 5FKMA 3KYDB 2WY7Q 2XKPA 2DYSH 3K1NA 2XPWA 1G3WA 4RB1A 4ZYAA 3MFKA 1PYVA 2DYRH 1B72B 3QQAA 4KMFA 4EJOA 1YJWI 2DQRA 1CF7A 1MBEA 1QZYA 1IV6A 4HV6A 3BG9A 2VJJA 5ICFA 3GTQJ 3HSFA 5AIPA 9ANTA 3EUAA 1D0ZA 2XGXA 5CLSA 3SFIA 4B8XA 5FGMA 3JSPA 2M7BA 1QNTA 2EZKA 1TC3C 1WKMA 1JJ8C 1U5TC 4RM2A 2M5WA 3WU0A 1HXDA 4CZZA 3HOUJ 5ICGA 2YPRA 1TZLA 2K02A 4EATA 2HEOA 1XDSA 1JUMA 1T0FC 2LD5A 3AAFA 4PJMA 2RAEA 5IT9Z 1YI2I 3T5XA 1TW2A 3KX2A 4IEJA 1AWCA 3IH4A 1A6IA 2B7EA 3BJAA 4HF1A 4V2FA 3J80Z 3ASNH 2ZMEA 4A0YA 1MH3A 1J09A 1MMGA 5A2QZ 1NTCA 4LLLA 2LKPA 1ACIA 5TGTA 2DJIA 1R49A 2LY2A 1E2XA 3PO2J 2FF4A 3NRVA 3AG3H 4HX4A 4ENKA 5C4JJ 3K4JA 4CDGA 1GDTA 2NS8A 4M3DA 2H8WA 2LMDA 4B43A 1XN7A 1LB2A 1X1PA 1W7PD 4N4OB 3DBLB 3OYMA 3IRQA 4NBQA 1KYZA 2L7FP 4C3JJ 5EEAA 1D0XA 2WADA 3FMQA 5DTDA 2FOWA 5LHGA 3RZDJ 1IDYA 4B09A 3BCBA 3S17J 5LRSA 2ZSHB 3MWMA 2DFEA 3ZQLA 1XS9A 2DA7A 4UY8I 1IN6A 4RBOA 2EIMH 3EUKL 4B4CA 2RGVA 2JA6J 4PSXA 1QRYA 1N75A 2R0QC 1U8RA 2PMZN 1E17A 1VTNC 4V19K 3OYCA 1WRJA 5HLIA 2OCEA 3F3XA 4MFDA 3RKYA 4E70A 2DOAA 5D5WB 2NNNA 1LEBA 3F9KA 1WQ2A 2JRTA 3V8KA 1F1ZA 2BY1A 2CQQA 1MW7A 4II2A 2HZTA 3TOBA 4HPQA 1ORKA 1WHUA 1XSXA 4XN3A 3A01A 3MKLA 4XKVA 3W6KB 5LFAA 2KFDA 2WY8Q 3KP4A 2Z3YA 2NOGA 2FMYA 3BZCA 3W6VA 3DFGA 5DCMA 1UMQA 2N8GA 4BDZA 3I4PA 3BPXA 3M8EA 2QGUA 2JJ7A 5DCFA 3RYPA 3GTLJ 4RS8A 1Y0UA 4BXFA 2FRHA 4GFBA 1GHCA 3LA2A 1ULYA 1W7PA 5E17F 3SEZA 3D5RC 3ERMA 4XL9A 3BP8A 3JAMK 1FYLA 2WV0A 2K5CA 2CGPA 2X6XA 3IWZA 2BOLA 1YE9A 3WTZA 1ZREA 3BJ6A 4ZDLA 5J1UA 3HZJA 2R7SA 2L7MP 2XHKA 1ZG3A 3DQVC 4LB6B 1ZARA 2O0YA 3GZ5A 3GTKJ 4EQQA 3E7LA 5BMZA 4OAZA 3JRCA 2V6EA 2XROA 5EDNA 3A0BC 3I64A 3PIOF 1P4AA 2E7WA 3I53A 3GX4X 2VUMJ 1VQMI 3ZMVA 3GVAA 1GVDA 4N9HA 2BW3B 3DU5A 4GDFA 3EYYA 3OSFA 2ELJA 2EFNA 4MTDA 1WH5A 3A03A 2HTJA 3H9JA 3K7AJ 2MSYA 3I71A 5C44J 1ZELA 1ZKGA 2EFWA 3DPUA 1ONVA 1I6XA 1VQNI 1W5SA 1W36C 2E1NA 3C2BA 1ENHA 2BXYA 2NS7A 2O61A 4JOMA 2GXBA 4BY7J 2V9PA 3CCVI 3MZHA 1X2MA 5JLXA 3LFKA 3HSRA 2JPCA 2FE3A 3HEFA 4HX8A 1EJ9A 1HDDC 3QOEA 4G7ZF 3SDBA 4BUPA 2WB1N 2IP2A 3MVPA 2R7DA 3IP4B 1E3HA 2MLKA 4BEHA 3H3ZA 4HZFA 1TNSA 4HOBA 2KP6A 3CC7I 1B6AA 3MQ0A 5L3DA 1ITYA 4PJJA 2VXZA 4YG2F 1R58A 1U5TA 1A31A 1QPMA 3VWBA 2JA7J 2M3AA 1FIPA 3QPSA 2FD5A 2LG4A 1TL8A 2GLOA 3I4MJ 5F0CA 2R7ZJ 1T0FA 4IJAA 2VN2A 4M6VA 1Z9CA 2UXNA 2K9QA 4MHGA 4I6ZA 2FUG2 5CKTA 4Z6YA 1MJAA 2WBMA 4CUGA 2DA5A 2D1HA 2XGEA 3BR6A 4BQNA 3EUHA 1SFOJ 2H1KA 2LR8A 5GADJ 5E8IA 3PL8A 2ZXHA 1APLC 1QO0D 4YFNF 3GZNB 3O8HA 1K6YA 3LMMA 4M9XA 2PEXA 1FIAA 4AUXA 1B9MA 2E5ZA 4HRIA 2TDXA 2KIQA 2B0LA 2NYXA 5DUKA 1CQTA 4HNTA 2CUZA 1HBXG 2QSHX 1TW3A 2HVRA 4LIUA 3JTGA 3SZTA 4HV5A 3W2WA 4OINF 1RNLA 2O03A 2LBFB 4F52A 3LSTA 4A3MJ 4P9UA 2OBPA 4P55A 4W1UA 3TOAA 1DPRA 3E5UA 1K7AA 2CUEA 3W6JB 3K70C 3DU6A 4HLXA 3ERED 4RAYA 4WF2A 5FLVA 3LSPA 2JT1A 3RKQA 2OJED 4NNJA 2NVYJ 3EPZA 4Z2YA 1MDMB 4AIKA 1OLTA 3F6OA 1A35A 1D1BA 2CO5A 2P6SA 2ESNA 2QLZA 4R79A 3HPGA 2M0CA 4Q4ZF 1IO2A 5GPAA 4QWQA 4X6AJ 2BY0A 2LKSA 4C3HJ 2KL4A 4CCNA 4CCMA 4CICA 2DOFA 3G1MA 2CW0F 4F91B 1QHGA 5IT9K 3FM3A 3QPHA 2K85A 1PP8F 3GCMA 3I9V2 1HSJA 2FEZA 5BOXA 3J80K 3FMSA 3LSRA 4R1HA 3GMEA 4CYDA 5A2QK 4BACA 2VODA 3LSMA 1OJLA 4XBFA 4DZJA 2K4BA 3L2QA 4DBRA 3CUQB 1IJWC 1X2NA 1YW8A 1MSEC 2W84A 1USTA 2RQQA 1P4XA 2KDZA 3E6CC 4LOCA 1HW2A 4ZTFA 3CJTB 2XF5A 2A69F 1J59A 2PMHA 3E3VA 4CH7A 3JSOA 1WPKA 3GWZA 1WIBA 5J4VA 3HTSB 1FTTA 4ZJZA 2R93J 3L7WA 1PUEE 1JKOC 1TWCJ 5BPDA 5GAEJ 1K78B 3LNQA 4NQWB 2TRTA 3FXUA 3O3KA 1D8JA 1JT0A 2V1XA 3CMAI 3JW4A 2VASA 4S05A 2IS2A 1SC7A 5DUIA 3FKJA 3HUGB 3GTGJ 2DQLA 5E3MA 4AYBN 2EV5A 1GV2A 3S1QJ 4Y52J 2VQLA 1H0MA 1JJ6C 1ZG5A 5IOZA 2VI6A 1CF7B 3M4OJ 2M34A 2B63J 3HTUA 1G2HA 1AHDP 4B3AA 1R36A 3J7AY 2FQ3A 1V5FA 1YS7A 1BC7C 3R0JA 3SDGA 1DGWY 4A93J 2YR2A 4BYYA 5LGTA 1QVUA 5B66C 1EH6A 1XGNA 2YUSA 1BA5A 3RSNA 5M3MJ 3MZYA 2H6CA 1V4RA 1SFKA 3S1RJ 2A5WA 2K9NA 3ROUA 4UXNA 1ETKA 2FBIA 2ID3A 1XCVA 3HHHA 3TP3A 1KQ0A 3DTIA 4A12A 3MAJA 1VFCA 4QTRA 1X1BA 3N97A 2KIUA 4LMYA 1P9QC 4IHSA 4M3GA 1LE8A 1J7KA 5D6FA 2DMQA 2KHMA 3GTPJ 5ICCA 3Q9SA 3OOUA 3BROA 4IHXA 2L7ZA 3HOVJ 1WJAA 5EEHA 3SZPA 1HW1A 5CQGA 2CH0A 4C2TA 4CZCA 3VOEA 3SXYA 2Z33A 2COBA 1EV7A 2AXTC 3LSJA 1MH4A 2OZUA 2WAFA 2EIKH 5ILUA 4XSXF 3BOQA 2PG4A 1YS6A 2CS3A 3VYSB 1JE8A 1O7FA 3FISA 5HS8A 1Z21A 3TDZC 5GTHC 3OYBA 1YQAA 1XB4A 2X51A 5HOOA 3KP7A 5FD6A 2VBXA 2VJ4A 3EDPA 4J01A 2CQKA 1D1CA 3QODA 3BTJA 5FKNA 5KVRA 5LBQA 1DP7P 3B02A 2GXAA 4HA8A 4II3A 1YW9A 4RAFA 2X48A 2ZJPF
chains in the Genus database with same CATH topology
3CCUI 3CCJI 3I56I 1VQKI 4IOCF 3CCLI 1WIBA 1VQ7I 3CC7I 2NXNB 3I55I 5GAEJ 3CF5F 3CCEI 1MMSA 3CMAI 3G71I 1YIJI 1HC8A 2K3FA 2OTJI 5JVGF 3G4SI 3J7YJ 3CCQI 3CJSB 3CJRB 3CMEI 1YJWI 3EGVB 5GAGJ 5GADJ 2E34A 1YJNI 1FOYA 2ZJQF 1VQ4I 2QA4I 2E35A 3G6EI 3CCMI 1VQPI 1S72I 5GAHJ 2JQ7A 3PIPF 3J7ZI 3CD6I 1YI2I 1FOXA 5DM7F 3PIOF 1VQ5I 1QA6A 5DM6F 1ACIA 3DLLF 1YITI 1VQMI 2E36A 3CCRI 1YJ9I 1VQ8I 4IOAF 3CCSI 1VQ9I 2H8WA 3CC2I 1VQ6I 3CJQB 1VQNI 1VQOI 1FOWA 3CCVI 2FOWA 1YHQI 4IO9F 1Y39A 3CC4I 4UY8I 3CJTB 2QEXI 2ZJRF 2OTLI 1VQLI 4V19K 2ZJPF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCU I;  3CCJ I;  3I56 I;  1VQK I;  4IOC F;  3CCL I;  1WIB A;  1VQ7 I;  3CC7 I;  2NXN B;  3I55 I;  5GAE J;  3CF5 F;  3CCE I;  1MMS A;  3CMA I;  3G71 I;  1YIJ I;  1HC8 A;  2K3F A;  2OTJ I;  5JVG F;  3G4S I;  3J7Y J;  3CCQ I;  3CJS B;  3CJR B;  3CME I;  1YJW I;  3EGV B;  5GAG J;  5GAD J;  2E34 A;  1YJN I;  1FOY A;  2ZJQ F;  1VQ4 I;  2QA4 I;  2E35 A;  3G6E I;  3CCM I;  1VQP I;  1S72 I;  5GAH J;  2JQ7 A;  3PIP F;  3J7Z I;  3CD6 I;  1YI2 I;  1FOX A;  5DM7 F;  3PIO F;  1VQ5 I;  1QA6 A;  5DM6 F;  1ACI A;  3DLL F;  1YIT I;  1VQM I;  2E36 A;  3CCR I;  1YJ9 I;  1VQ8 I;  4IOA F;  3CCS I;  1VQ9 I;  2H8W A;  3CC2 I;  1VQ6 I;  3CJQ B;  1VQN I;  1VQO I;  1FOW A;  3CCV I;  2FOW A;  1YHQ I;  4IO9 F;  1Y39 A;  3CC4 I;  4UY8 I;  3CJT B;  2QEX I;  2ZJR F;  2OTL I;  1VQL I;  4V19 K;  2ZJP F; 
#chains in the Genus database with same CATH topology
 4DOZ A;  2XKO A;  3VOD A;  4BY1 J;  1Z1D A;  4U88 A;  1OR7 A;  3EET A;  1G4D A;  1U9N A;  1I5Z A;  2HDW A;  5BQT A;  2XAG A;  3H36 A;  4LIT A;  4ZC3 A;  5L3E A;  1G59 A;  2KQR A;  2K3P A;  2VJ5 A;  3BQY A;  1H9G A;  1OCR H;  3T8R A;  3M1C A;  1B4A A;  4DQ2 A;  4XLP F;  3OYL A;  3G71 I;  1HC8 A;  2Q8K A;  2YS9 A;  3GFJ A;  1WSU A;  1Z67 A;  2VB6 A;  3N05 A;  2HYG D;  4BHP A;  4E7L A;  4OIO F;  2HTS A;  1TP4 A;  3WE3 A;  5HLT A;  1K4T A;  2EA2 A;  4EJT A;  1IXR C;  3CJS B;  3IAM 2;  2K86 A;  2E1O A;  3H9G A;  1FNN A;  2PMZ A;  2OU2 A;  1IRG A;  3LFU A;  4WXD A;  5M5X J;  4Y3O A;  4HDU A;  2B9S A;  2ZFW A;  1FPQ A;  1KU3 A;  2ZNZ A;  2VLA A;  4H0E A;  2KZG A;  4RGX A;  5IP7 J;  1YJN I;  3ULQ B;  1LUJ B;  2HU9 A;  2HVS A;  1X19 A;  4YFX F;  1O3T A;  3OIP A;  2JVH A;  1N78 A;  1SFE A;  2GBY A;  1SVL A;  3A4C A;  3G6E I;  4DNC A;  4XOP A;  1JKR C;  3OMY A;  2BHZ A;  1SAU A;  2PN6 A;  3HOT A;  5GTI C;  2JQ7 A;  2EBI A;  3GLX A;  3ZMT A;  1PUF A;  4KJZ A;  2LRD A;  3FX3 A;  5E3N A;  2HQR A;  2XDV A;  3HL2 A;  2JN6 A;  2W85 A;  2A3S A;  5EZH A;  4LB5 A;  3BJO A;  2UXX A;  4BQO A;  1W5C C;  4J00 A;  1OCP A;  3KZI C;  4Q48 A;  5EJC A;  3ZXS A;  1UB9 A;  4I7H A;  1Z77 A;  1YIT I;  1R1U A;  3BQZ A;  2G9W A;  3AL0 B;  2ESH A;  2EFO A;  1MKM A;  5J8C A;  1FZP B;  4S0H B;  4Q5S F;  2VQH A;  2HYJ A;  3CDH A;  2XF6 A;  4PK4 A;  5L3C A;  4OMY A;  1Z0X A;  2H1L A;  2V4J C;  3E6M A;  4RLF A;  2LOO A;  2L2O A;  1EA3 A;  3R60 A;  3RKX A;  1QHH D;  3NWT A;  5H20 A;  5HS7 A;  3HOW J;  2MA3 A;  3D1N I;  1I1S A;  3Q9V A;  2JA5 J;  2KIS A;  2UUZ A;  4S04 A;  4EVI A;  1O3R A;  1LVK A;  4M74 A;  3L2R A;  1SAN A;  4HDV A;  2EWN A;  3FBI B;  3K4N A;  4G12 A;  5KAI C;  4D9J A;  2OQR A;  5CVJ A;  2QEX I;  2HDC A;  2ZBK A;  2DDB A;  1UCR A;  2W25 A;  3KP2 A;  1BL0 A;  4A6E A;  2P0W A;  1FBU A;  2VIX A;  1T98 A;  3WTS C;  4CYC A;  4U87 A;  4KMU X;  5K5R A;  4U7D A;  1UHW A;  2DDA A;  2CW7 A;  4FET A;  3LSI A;  2GAU A;  2L01 A;  2ZSI B;  4A5N A;  4CO8 A;  5CYV A;  2M30 A;  2RKH A;  1A36 A;  3GBG A;  1GV5 A;  2BE5 F;  1A5J A;  3FZV A;  4KIG A;  4A3E J;  3VDX A;  4D7M A;  3FHZ A;  5LEK A;  1Z91 A;  1YFH A;  3V7S A;  3L1P A;  4RAZ A;  3CMM A;  3JCU C;  1VI0 A;  2HWV A;  5GAG J;  1SEU A;  1AA7 A;  1MMD A;  1DPU A;  3BZK A;  1U8B A;  1WFX A;  3CP2 A;  3OS1 A;  2PFB A;  1QGP A;  2HOA A;  2Y0S N;  1IN4 A;  1UFM A;  2F6C A;  2QSF X;  4B3X A;  3WGI A;  1W0U A;  4ESB A;  1KA8 A;  1Q1V A;  4AIH A;  3W2V A;  4RB0 A;  5TJJ A;  3GLL A;  2PX9 A;  4Q47 A;  2P5V A;  2FX0 A;  4A5M A;  2ZNY A;  5EG0 A;  3TO7 A;  4G7O F;  2IAI A;  4G94 A;  5D4R A;  2JK3 A;  1BW5 A;  3FMR A;  2PJR B;  1ETV A;  2L7K A;  5DM6 F;  5K7H A;  2CRG A;  4QSH A;  4CCL A;  5FFX A;  4C2U A;  1F4K A;  3I5U A;  5LGN A;  3X2Q H;  1R6R A;  2P8T A;  1YJ9 I;  1R22 A;  1UHM A;  2VE8 A;  2E1M B;  3QYB A;  2Y31 A;  3V4G A;  2FXA A;  5IYC J;  1FT9 A;  2WAQ A;  4LLN A;  2NVQ J;  4DYC A;  3L2V A;  4BDY A;  1CGP A;  3CJQ B;  4E4H A;  1AOY A;  2BYV E;  3C1D A;  4KYW A;  4J19 A;  2H8R A;  5EGO B;  4AVZ A;  3BR0 A;  5F08 A;  1TT5 B;  3QYF A;  5F1J A;  1X4O A;  4ANJ A;  1SVO A;  4PGH A;  3RZO J;  4KIF A;  3OYA A;  3IRR A;  3BR1 A;  4BNC A;  3VSK A;  3H0D A;  1IN8 A;  4JX6 A;  3ZQI A;  2OTL I;  1T08 B;  5H6Q A;  1MBF A;  3SZG A;  2NOJ B;  1SAX A;  4XKC A;  2WA0 A;  5L3F A;  4IHY A;  1KU2 A;  1S9H A;  4NB5 A;  4ZYG A;  2ECC A;  4HST A;  4MNU A;  4A6D A;  5HVQ C;  1VQ7 I;  3I59 B;  2JA2 A;  2R92 J;  1GLN A;  4KT6 A;  3OR2 C;  2E1C A;  3LQQ A;  3HKZ N;  5CJ9 A;  3CCE I;  1Y0N A;  2VQG A;  1HW5 A;  3KFW X;  3LOC A;  2DT5 A;  3BR5 A;  5CVV A;  2CQN A;  3ZQ7 A;  2O3F A;  2FJ1 A;  3OWT A;  4A3J J;  3Q0U A;  1ZGW A;  2KRH A;  2ZJ2 A;  1BI1 A;  4XR6 A;  5DDG A;  5JLW A;  2IA0 A;  2XIG A;  1H88 C;  2XAF A;  4HBL A;  3FXQ A;  3DF8 A;  1Z05 A;  4I76 A;  1FTZ A;  2L9R A;  2A6T A;  5B1B H;  4JK1 X;  2OA4 A;  4RGU A;  2RNJ A;  3IL2 A;  1XDU A;  2FU4 A;  4XON A;  1VQ4 I;  1QQI A;  1ZYR F;  1XGO A;  4XN0 A;  4BQQ A;  1IRZ A;  3NWS A;  2I8D A;  3ZPL A;  1QZE A;  4OAY A;  4Y33 A;  3SJM A;  2O9L A;  5JVT A;  2E71 A;  2DPD A;  2VOP A;  2KT0 A;  3K1M A;  1KQ8 A;  1YIO A;  4MQV A;  1XGS A;  1O57 A;  3OOP A;  3OL3 A;  3HIF A;  4E6K G;  3PIP F;  2HQN A;  3L9F A;  2XAH A;  2XV4 S;  4AYB A;  5GP9 A;  1BC8 C;  2RDP A;  1Z3Y A;  2VJI A;  4LD5 A;  1UG0 A;  4KUM A;  4F3Q A;  4L5I A;  1FMW A;  3R4K A;  4L9T A;  2H94 A;  3L2W A;  4IXA A;  3RTR A;  2CG4 A;  4A3L J;  3OSG A;  1ETO A;  2DMT A;  2Z16 A;  3MCZ A;  2JSP A;  1F43 A;  5F27 A;  4PUS A;  3CLQ A;  1U9O A;  2L02 A;  3SFZ A;  5J47 A;  4HSR A;  2AXL A;  2W00 A;  1GT0 C;  2M0M A;  2ACJ A;  1P4W A;  3K4C A;  4EM0 B;  4GO1 A;  5CVR A;  1IRF A;  3JR9 A;  1ZLJ A;  1WCM J;  1MBH A;  2QQA A;  4EGZ A;  2FBK A;  2M4G A;  2IGN A;  3C7J A;  3CMY A;  1SFX A;  4KN4 X;  1SVM A;  4PDK A;  4LIV A;  4WK8 F;  3K0L A;  3DEW A;  3K4B A;  4GYI A;  3DEU A;  2K4J A;  1ZRC A;  2GZW A;  2L9N A;  3S15 J;  3HGG A;  1V55 H;  2HOT A;  2F2E A;  3CCJ I;  3PNV A;  1FP2 A;  5IPA A;  1P7J A;  1XMK A;  1TQP A;  4DIQ A;  1E3O C;  3WU2 C;  3TBI A;  3TKY A;  5D5X B;  1W5T A;  3B6A A;  2K9S A;  2LY1 A;  2XRL A;  2XAQ A;  1HKQ A;  1WJE A;  5IP9 J;  3KEQ A;  1MMS A;  2VBY A;  3GZ6 A;  5K5O A;  3CDL A;  3FBN B;  4M9Z A;  1GVJ A;  4EGY A;  2MC4 A;  3S32 A;  2ZCW A;  2XB5 A;  4AID A;  2NRA C;  4I0B A;  5F1R A;  3KLO A;  3FK6 A;  2KMU A;  1X1A A;  4XLA A;  3BWG A;  1OYI A;  2X85 A;  3ZRG A;  2IRF G;  1IXC A;  1IG7 A;  4FE4 A;  3PO3 J;  1RRJ A;  4A3K J;  1B1B A;  5CVI A;  5C4X J;  3RJP A;  1QZZ A;  1P2F A;  3F0C A;  4HG2 A;  3MKW B;  5J3L A;  4EJU A;  3JRB A;  3ONQ A;  2VE9 A;  4IHT A;  3O8G A;  2PBI A;  2QA4 I;  5JR3 A;  2FSW A;  2HQ5 A;  1I39 A;  4E7K A;  2E7X A;  4W97 A;  5M5Y J;  2NAZ A;  3CQZ J;  1J9I A;  3KET A;  3GW2 A;  1VQP I;  3S2W A;  3WTY C;  5CPR B;  1YTY A;  1T38 A;  4DZP A;  5FFZ A;  4ZDO A;  3GUD A;  1PUF B;  4GXO A;  3WG9 A;  1A6Q A;  3HGY A;  5FRN A;  3E0J B;  1QVT A;  2KRC A;  3IAS 2;  1EKE A;  3CCY A;  4Y17 A;  5BPI A;  3HDD A;  3ABK H;  1B8I A;  5F0H A;  4UVB A;  2Z99 A;  3DPL C;  5EF6 A;  4IL6 C;  2LFB A;  1GXP A;  4PJN A;  2V7F A;  2ECB A;  1Z7L A;  3LAJ A;  3QOP A;  2VKH A;  5DS9 A;  3OYJ A;  2XPV A;  3VYT B;  4JX4 A;  3OS2 A;  2DAO A;  2VBW A;  1WZ2 A;  2CYY A;  1SMT A;  2R3S A;  2RNG A;  3CC2 I;  2ZB9 A;  1PJR A;  3CDI A;  1LDJ A;  1NHA A;  3JTH A;  2PMU A;  3CLO A;  1ON1 A;  2LNB A;  4L5J A;  2I10 A;  1TQI A;  1U2W A;  1R5I D;  4IO9 F;  1G3T A;  3CC4 I;  1BIA A;  2EPF A;  5FO5 A;  3DP7 A;  4EJW A;  1HCR A;  4BJT A;  1EF4 A;  5D4S A;  5FKL A;  3M07 A;  5J1R A;  4DGW B;  3VSL A;  1BI3 A;  5J40 A;  2CSO A;  2EIN H;  2DA3 A;  1XGM A;  3H9Q A;  2HPI A;  4CYC B;  3JRH A;  1HF0 A;  2QSG X;  3H3V K;  3WTU C;  4BXU A;  4IOC F;  4MIM A;  2EQR A;  1DUX C;  1R4M B;  3IH2 A;  3QPT A;  3TO9 A;  1DP3 A;  3F8N A;  1NH3 A;  1QBJ A;  4ASN A;  2BXZ A;  2J5P A;  1MD0 A;  2X4H A;  3HBL A;  4B44 A;  3NEU A;  4XRM A;  3K2A A;  6PAX A;  4R8H A;  4A3I J;  1FP1 D;  1MGT A;  3LL7 A;  1TNT A;  1X1D A;  1XD7 A;  2QZ8 A;  1W36 D;  1X3W B;  1S7O A;  2EV0 A;  2M9H A;  5D5U B;  3SEQ A;  3TL4 X;  2LY9 A;  5EYR A;  5ERI A;  2VXD A;  4UUS B;  3E1S A;  3ZQH A;  2A07 F;  2F5F A;  5B1A H;  3G1O A;  5TIS C;  2ELK A;  3F23 A;  1AKH A;  2JMW A;  1TWF J;  2BVM A;  3MZ8 A;  4A2U A;  5IP6 A;  5FLM J;  5D6E A;  5HNH A;  5IYD J;  3ZMZ A;  1MZB A;  2BGC A;  2M2E A;  3AG1 H;  3OYH A;  1NK2 P;  4QLC U;  3PM1 A;  1YW7 A;  4HEA 2;  3JRA A;  2F48 A;  2VC0 A;  3D5S C;  2E35 A;  3F8B A;  1R7J A;  4KA4 A;  2IS6 A;  1O3Q A;  2MYS A;  1R23 A;  2J5O A;  4EM2 A;  3TDU C;  2DLL A;  5EG0 B;  2R5Y A;  4D5C A;  2DJN A;  3FK7 A;  3I0T A;  5JFR A;  3KE2 A;  2IGO A;  2K9M A;  1FOX A;  5F0F A;  1O7L A;  4C30 A;  2FOK A;  2OF7 A;  4IQ4 A;  2LKX A;  1BR2 A;  1XTA A;  2VKE A;  3PQK A;  4Y4R A;  4G6Q A;  1GXQ A;  3PJR A;  3ABT A;  4HX7 A;  3DLL F;  3KLN A;  4KT5 C;  4I2O A;  4G6T B;  1V5G A;  3K10 A;  4L9J A;  2XUB A;  3I3L A;  3A2K A;  2LDU A;  4XRS G;  1R5H A;  1N25 A;  2A68 F;  2OZ6 A;  3T8T A;  2GM4 A;  1VQ9 I;  4ZYD A;  1NG6 A;  4AM3 A;  1Z6R A;  2A6H F;  3R6S A;  1JHF A;  5ILV A;  1D0Y A;  3ABL H;  4GYG A;  3MKZ A;  2ZME B;  4LJZ F;  1TQM A;  5D8K B;  2DA2 A;  3QPL A;  1KU9 A;  3OS0 A;  3E6D A;  2EK5 A;  2DT6 A;  2XGD A;  4P96 A;  2F4O B;  2XVC A;  3CUQ C;  2DU9 A;  2KZV A;  3Q3S A;  4ETS A;  3K70 D;  5GPC A;  1VQL I;  2V79 A;  1HST A;  1REP C;  4RM3 A;  5KK1 A;  1MMN A;  1WI9 A;  1KU7 A;  3K9T A;  4BGD A;  2R7Q A;  3H5R A;  2NVT J;  2K27 A;  2COM A;  4AWX B;  3S2H J;  4N9I A;  2NXN B;  2IJL A;  4V2G A;  5E1W A;  5KCM A;  5EZG A;  3ECH A;  1K79 A;  3LWF A;  2CV1 A;  4ESJ A;  3K2Z A;  2AO9 A;  3DWL E;  3Q0V A;  1WJ5 A;  4RB2 C;  3ZQG A;  1YRN A;  1V3F A;  4HF2 A;  4KDP A;  5BS6 A;  5DD8 A;  4FX0 A;  2NS0 A;  2OV7 A;  3FDY A;  1ETQ A;  1JUP A;  1TLH B;  5IYB J;  3ZR8 X;  4HNU A;  2GOX B;  4ZZD A;  2LK2 A;  4M3E A;  4CCK A;  1T56 A;  2Q2E A;  4C3I J;  2BY2 A;  4UVC A;  2ME0 A;  2VKV A;  3OYE A;  1X4P A;  4LG3 A;  2P4W A;  4BBS J;  3ZQQ A;  2ZXJ A;  2IBD A;  1D1A A;  3U1D A;  1IDZ A;  3A01 B;  4PJL A;  2RN7 A;  1MSF C;  2DMN A;  5FRO A;  1FOK A;  3NQO A;  4IRH A;  2H27 A;  1T95 A;  2TCT A;  1L0O C;  4M3B A;  2D5V A;  2RQP A;  5DCM B;  2AQE A;  2DT7 B;  5K5Q A;  2CV0 A;  2DK8 A;  2BVL A;  2WWY A;  3J7A O;  5HLG A;  3E5Q A;  1RPW A;  2KPM A;  2QQ9 A;  2LF8 A;  3LSG A;  3P7N A;  2YU3 A;  1K83 J;  3DXJ F;  1W7P B;  3BPV A;  1YG2 A;  1T2K A;  2Z1D A;  2HYF A;  4IF4 A;  4MEY F;  2GIV A;  2KRF A;  2MD5 A;  3LSH A;  1RIO H;  1ZR2 A;  2FNA A;  5HS9 A;  5CVU A;  1ZR4 A;  3FKI J;  2MLG A;  1F36 A;  2GOM A;  1VQ8 I;  1SD6 A;  3WE2 A;  5DEQ A;  2H09 A;  1T6S A;  4IOA F;  1MNE A;  4U7B A;  2IS1 A;  4M71 A;  2EV6 A;  5F64 A;  3WGH A;  4RMN A;  4WCG A;  4P9F A;  5FB2 A;  1RUO A;  2AQF A;  3ASO H;  1UEL B;  2HVQ A;  1BN5 A;  1Y39 A;  1DQU A;  4L0Z B;  3B73 A;  1I27 A;  1R1T A;  3KEY A;  1C0W A;  1I3A A;  4U0Y A;  3WTT C;  2X1C A;  3S14 J;  3G2B A;  1BW6 A;  5EEG A;  3IH3 A;  3BT9 A;  3BTL A;  2G0E A;  2QUF A;  3G3Z A;  4ABZ A;  4KNY A;  1YX5 A;  2K7L A;  3LA7 A;  1FMV A;  2CQX A;  1EH7 A;  1LKX A;  1OCO H;  4FX4 A;  2QM3 A;  4D7N A;  4FTH A;  2R7X A;  1JHH A;  4EM1 A;  1FLI A;  2GIZ A;  2BBY A;  1POG A;  5K7F A;  3PSF A;  3P9C A;  5DV5 A;  3T1B A;  5HNF A;  5FLX Z;  5DYM A;  1Y8Q B;  3TO6 A;  1BJZ A;  3DKY A;  4FE7 A;  2V6C A;  4L9V A;  1YIJ I;  4KFC A;  3S8P A;  1I3Q J;  2K3F A;  2GXG A;  2ZFU A;  4BEH B;  3S1M J;  2V9K A;  4A3G J;  3K69 A;  2IXS A;  1OYW A;  4ZDP A;  4FCY A;  2IPQ X;  3KZZ A;  2HDD A;  3PFY A;  5BNG A;  3JRI A;  1XSV A;  2WC2 A;  4UHT A;  1T33 A;  2DBB A;  2ZO4 A;  2D45 A;  3EGV B;  2OAZ A;  3L00 A;  2E2J J;  4XOR A;  4Y15 A;  4MGR A;  2Y69 H;  1FSH A;  1U5T B;  2X0L A;  2CMP A;  1MDM A;  2QKL B;  2ZJQ F;  3PUB A;  2RC4 A;  4I98 B;  1Y8R B;  2EFQ A;  3HOZ J;  4G8X A;  1K61 A;  3T0Y A;  3OV8 A;  5DD4 A;  2EZH A;  4M72 A;  4H4K C;  1XG1 A;  1RZ4 A;  3K1P A;  4MQ9 F;  3GFI A;  2WB1 A;  3FXR A;  4XOT A;  1X1C A;  1ETW A;  1BM9 A;  2KIF A;  1R00 A;  2OC6 A;  2QYO A;  4EV0 A;  1IAW A;  5LEJ A;  1RC9 A;  3MEX A;  2ZKZ A;  4I0A A;  1J75 A;  2EJR A;  1OCC H;  1PVE A;  1B8I B;  1BBY A;  1JTY A;  3AG2 H;  3VEP A;  2VC1 A;  4F55 A;  3W2A A;  3CUQ A;  2E36 A;  2V1N A;  3E97 A;  1U6G A;  1IN5 A;  2LYC A;  2QKM B;  4D0P A;  3TW6 A;  3AL0 C;  2RVC A;  1Z7U A;  5KNL A;  4PCQ A;  3ZQF A;  4QIW N;  1G6N A;  3GFL A;  3UR3 C;  4BHB A;  1VQO I;  4QPO A;  4UUV A;  4LLG F;  1E3P A;  2NNY A;  1T39 A;  4IVN A;  1JUS A;  3HG9 A;  3LSK A;  3OYK A;  2FA5 A;  2M87 A;  4RB3 C;  1P7I A;  4UUT A;  1T8I A;  1XX5 A;  4NC6 A;  2F5C A;  1RES A;  2ZXW H;  4LG0 A;  4WWC A;  3L2C A;  4G7H F;  1IC8 A;  1Y1V J;  1J0R A;  2ADU A;  4ENJ A;  3IV5 A;  5ILS A;  1I1G A;  1LNW A;  4G6D A;  3VYR B;  5H6R A;  2IA2 A;  4X0G A;  2EIJ H;  4XRF A;  3HUG A;  4A3C J;  1FBQ A;  1IRX A;  3DTE A;  2KKO A;  4DBQ A;  4XKW A;  2Y2Z A;  3P9K A;  1O4X A;  4PFP A;  4D1Q A;  4CXF A;  2LP0 A;  3ZP5 A;  3CCL I;  2O8X A;  1UG2 A;  4UVA A;  4JBA A;  2DCE A;  1YLF A;  2BZT A;  3OYG A;  4YIR X;  3EQL F;  1P6R A;  1ZK8 A;  2LTP A;  3E5X A;  3CES A;  3ZMU A;  2E5N A;  2L3D A;  4WXH A;  1ODD A;  1ZAO A;  3HXL A;  4NC8 A;  5FD5 A;  3HRS A;  2DXI A;  2Y0M A;  4XLE A;  2L0K A;  3HPH A;  4BU2 A;  3G4S I;  3GTM J;  2W1O A;  2IVM A;  5L3G A;  3CCQ I;  1OCZ H;  4ZZL A;  3TED A;  4HLY A;  2JUG A;  1AKH B;  1FY7 A;  5KAF C;  3BZ6 A;  3CME I;  2PI0 A;  3REO A;  5C3E J;  4AVP A;  1UZC A;  1JI8 A;  4XLC A;  2M45 A;  2E34 A;  3FHN A;  3EUH C;  2DA6 A;  2HNH A;  3H1C A;  1LVA A;  1G3Y A;  5E8G A;  5JI6 A;  3IC7 A;  4DW6 A;  1DDN A;  3CCM I;  2R5Y B;  1BR4 A;  2Y30 A;  3KP3 A;  2P81 A;  1DGR M;  3GTJ J;  1WWX A;  2QWW A;  2UWM A;  2KIM A;  3EYI A;  2CQ7 A;  1BOA A;  3ABU A;  4BH9 A;  4HQE A;  1XC5 A;  4E7I A;  1ZGA A;  3M8F A;  2LH9 A;  1IXS B;  5J1Y A;  3G73 A;  1UHS A;  5DM7 F;  4NHJ A;  2M7A A;  2F4I A;  3WHB A;  3ZQC A;  1LPQ A;  2OPT A;  2HR3 A;  3CCR I;  3GFM A;  3DTK A;  4HQM A;  2FBH A;  4BJ5 C;  1MBJ A;  4N0B A;  2A05 A;  1FJL A;  4CA0 A;  4JYK A;  1K4S A;  3RDI A;  1YYV A;  1JGS A;  2H6B A;  4ENN A;  1FWZ A;  4AIJ A;  4BL0 B;  2HOS A;  1VQ6 I;  2E1M C;  3U21 A;  1XMX A;  3A0H C;  3BG7 A;  2F5V A;  3BG6 A;  4U0W A;  4MEX F;  3GEZ A;  3TP0 A;  4PJ0 C;  3CJN A;  4LK1 F;  5KHD A;  3KP5 A;  5IOY A;  2PQ8 A;  2IEK A;  4XQF A;  2K9L A;  3F72 A;  3F8M A;  1YHQ I;  3BTC A;  2XAJ A;  3DV8 A;  1LE8 B;  3QAH A;  4XMY A;  1W0T A;  1FEX A;  4HAM A;  1TBX A;  3OL4 A;  4OWR B;  1DU0 A;  2WV1 A;  4EEF G;  3CTA A;  2ELH A;  4JQF A;  2PJP A;  2W7N A;  2X9D A;  4XID A;  4LK0 F;  2XC7 A;  3VYU B;  2E19 A;  2DMP A;  1V54 H;  5HDG A;  2QF7 A;  5LRR A;  4QPQ A;  4UV8 A;  3M8J A;  1TTY A;  4DYQ A;  1OIS A;  1ZGJ A;  3AFH A;  4RA2 A;  2L9V A;  4TV7 A;  3TQN A;  4E7S A;  3I55 I;  1JKQ C;  4A0Z A;  2AHQ A;  2JWT A;  2X1D A;  4RAG A;  2HZD A;  3H3U A;  3ISP A;  3SQN A;  1W1W E;  1MJB A;  5FRM A;  3V8J A;  2X6W A;  3VPR A;  1YRN B;  3CZ6 A;  2GA2 A;  4YRV A;  5E3L A;  2OQG A;  1RR7 A;  4O3M A;  1ETY A;  5AIQ A;  1TWH J;  3DBR B;  1WJF A;  3RQ4 A;  1GUU A;  2W24 A;  3DKX A;  4Y7N J;  4M9S A;  4HYE A;  4L9N A;  2KJC A;  2Q2E B;  3R0A A;  2P7C B;  2JZY A;  4FT8 A;  4CCJ A;  1KGS A;  4K2E A;  5FLX K;  2ISZ A;  1PP7 U;  4Y13 A;  2HOE A;  3UKG A;  4CSW A;  4XRS A;  1WJC A;  3DKW A;  3OYI A;  3ZOB A;  1FOY A;  1IGN A;  4BBR J;  2LC2 A;  1U78 A;  2QCO A;  2FNP A;  4BE1 A;  3JRE A;  1RKW A;  2KLO A;  2Q1Z B;  1G8X A;  2CFO A;  2LRE A;  3LA3 A;  1RUN A;  1WJB A;  2HGC A;  3CO7 C;  1S72 I;  5GAH J;  1IN7 A;  3HYI A;  3I54 A;  1ERD A;  3M9A A;  5CQE A;  1BJA A;  3GO5 A;  3S16 J;  3GTO J;  3V7R A;  3BY6 A;  4XLN F;  2W82 A;  1U0J A;  2E60 A;  2R5Z A;  3OR1 C;  3QWL A;  1QA6 A;  4UV9 A;  4MFE A;  2F5D A;  4LFU A;  1K6O A;  4GCV A;  2HKX A;  2KDO A;  3HHG A;  2ISY A;  4A0X A;  1B59 A;  1LDK B;  2IGK A;  3HC7 A;  3FIW A;  3B6C A;  3DLA A;  3F21 A;  1WVR A;  3ZN0 A;  1D5Y A;  4BAY A;  2Z5U A;  3HSE A;  3CO6 C;  1VZ0 A;  4ZH4 F;  4BJ6 C;  1ZQ3 P;  4GGG A;  2YX7 A;  4IPA A;  1BOB A;  3HRM A;  1LFB A;  2A6E F;  4AD9 A;  4ZYH A;  2V1U A;  2D2W A;  3IHU A;  4OOI A;  4M6Y A;  3ZGK A;  5FJ8 J;  3RQI A;  5K7Z A;  3D5L A;  1XPX A;  2DMU A;  3P9I A;  2PLY A;  3K4M A;  1XSD A;  1UJ8 A;  4RDU A;  4F93 B;  2MGQ A;  4PSW A;  3BR2 A;  5M5W J;  3FXO A;  5LD2 C;  1D8K A;  1L3L A;  2O5R A;  4YFK F;  2VON A;  4XIC A;  1R1V A;  2JRM A;  2MH9 A;  3FM5 A;  5L3B A;  2HFH A;  1YX3 A;  2R7O A;  4BS9 A;  2L5Q A;  2QQB A;  3ZN1 A;  3RPQ A;  2DI3 A;  3RPU D;  1OR7 C;  2DFH A;  4OIR F;  4KIS A;  2M4K A;  2MC3 A;  2VKD A;  2R7V A;  2D1V A;  2VL8 A;  2HXI A;  4BKX A;  2EZI A;  4M73 A;  4EJV A;  2VOO A;  2O8K A;  2C6Y A;  2MAB A;  2XB0 X;  4ITV A;  5E18 F;  2DFF A;  2XSJ C;  1H8A C;  2M8G X;  2F4M B;  2Z2S B;  1SD5 A;  2R7R A;  4M3F A;  3O2P E;  2WAQ N;  2F5E A;  2QBY A;  2OTJ I;  1SD4 A;  3C18 A;  3J7Y J;  3H0G J;  3R61 A;  4O5V A;  1LFP A;  1STZ A;  2EH3 A;  4HF0 A;  4ZYE A;  3GXO A;  2XGC A;  3D0S A;  4KN7 X;  2JVG A;  5F6F A;  1Y1W J;  4LGW A;  4O6J A;  2I5U A;  3WTV C;  4CHU A;  5F04 A;  2OCC H;  5J4Y A;  1B72 A;  1TWA J;  4XM3 A;  3AKZ A;  4DYR A;  3F8F A;  2VT2 A;  2PJR A;  5LHI A;  2ZXI A;  5B3S H;  1R5G A;  3FXM A;  2DOE A;  1SD7 A;  2FML A;  2EIL H;  1OFC X;  4IRG A;  3M1E A;  3JRG A;  3HOY J;  2P7V B;  4F92 B;  1BIB A;  3BLY A;  5IY5 H;  3U2R A;  2BV6 A;  2V9V A;  4B48 A;  3IKT A;  4IHV A;  3J7Z I;  3M3Y J;  2DFI A;  2ETH A;  2ICW G;  4IKF A;  3WU1 B;  1RR8 C;  3K4L A;  2MH2 A;  4L5E A;  3JRF A;  3OYN A;  1BR1 A;  2O6G E;  5IT3 A;  2R7W A;  5JHU A;  3Q5F A;  5E1X A;  2L54 A;  5EGO A;  5B5E C;  3J81 Z;  1LEA A;  2R7U A;  2LLK A;  2M1B A;  2R7F A;  4I01 A;  2ME6 A;  3RPU A;  2VBZ A;  3E6B A;  1KYW A;  2UZK A;  1RET A;  1HA8 A;  4FHT A;  3G1L A;  2X6O A;  4EMS A;  3IWF A;  1IV8 A;  2DOD A;  4G9Y A;  4A3D J;  4JX5 A;  1ETX A;  1OYY A;  4BE0 A;  3ZMD A;  4OIP F;  2EFP A;  2LSO A;  2MG4 A;  2E2H J;  1SFU A;  1HKT A;  1MBG A;  3IUO A;  2JSC A;  1OPC A;  2BHY A;  2CUF A;  4FAS D;  1ON2 A;  3U1K A;  1MIJ A;  3C2G A;  2IT0 A;  2HS5 A;  3I59 A;  5LLQ A;  4XLF A;  3MMY B;  3OIQ A;  2STT A;  3K6G A;  3Q0W A;  2BEO A;  1USS A;  3P5J A;  1O3S A;  2DPU A;  4LG0 B;  3FXL A;  1FSE A;  2HQA A;  2DW4 A;  2L4A A;  4X1E A;  3ML6 A;  2Y9Z A;  1FX7 A;  1JTX A;  2DN0 A;  1YOV B;  4WXC A;  3F22 A;  2DTZ A;  2Y0S A;  2YSR A;  3PSI A;  2DK5 A;  2CFX A;  1OQY A;  1V5E A;  2HPM A;  3COA C;  2RRE A;  1I6H J;  3RKW A;  2L4M A;  1HKS A;  2X6Y A;  2STW A;  2O7O A;  1HQC A;  2XAU A;  3I56 I;  1FBS A;  1VQK I;  1BI0 A;  2V26 A;  3S3N A;  3H35 A;  3KIO A;  4C2M J;  3H5N A;  3WTW C;  1KON A;  1QU3 A;  2UV1 A;  3S3O A;  4YII A;  1ZHF A;  4A3B J;  2QQ8 A;  4GRI A;  3FXJ A;  1E0E A;  1XCB A;  1KZH A;  1Y56 A;  3OY9 A;  1NG7 A;  4YEJ A;  3N4M A;  1QPI A;  1JGG A;  3U9G A;  5JVG F;  4KIC A;  2ID6 A;  1U3E M;  4AU7 A;  3V7C A;  3ZMS A;  2G7U A;  4E7H A;  1N77 A;  3K4K A;  3A02 A;  1H89 C;  4NUB A;  4E7J A;  5D8L B;  1UAA A;  2K40 A;  2P5K A;  3KYC B;  2XSD C;  1F9N A;  1AU7 A;  3SHF A;  3WOD F;  1Z6T A;  3KEO A;  1TWG J;  2E2I J;  1S7A A;  4BQA A;  1FYK A;  3DEE A;  3OYF A;  4NDL A;  4WX9 A;  4UNO A;  3AG4 H;  1YO5 C;  2HXO A;  2OD5 A;  2FQ4 A;  1TT0 A;  2VPR A;  2W48 A;  4XSZ F;  3HOX J;  2IS4 A;  2CU7 A;  2IA1 A;  3MD2 A;  5LHH A;  4DJA A;  3QU3 A;  2BY3 A;  3TGN A;  1WH7 A;  4I09 A;  1MND A;  1JKP C;  3CD6 I;  4D5F A;  3C2H A;  5J8F A;  3O6B B;  1I50 J;  4A69 C;  1S3J A;  5E20 A;  1VND A;  2EB7 A;  4I02 A;  1IW7 F;  5M3F J;  1PDN C;  3ZCO A;  2EA4 A;  1XMA A;  5H2F C;  2RV8 A;  3CUO A;  4UB6 C;  3KZY A;  5J6X A;  3OIO A;  2MD0 A;  4RGR A;  5AON A;  3RYR A;  3FF5 A;  4B47 A;  1R4N B;  2JPB A;  4C9Y A;  1WJD A;  3S1N J;  1JXS A;  1ZRD A;  3GF2 A;  3HKZ A;  1A04 A;  3BG5 A;  2BW3 A;  2Z9O A;  5HDK A;  4YIF A;  2A5Y B;  3QYE A;  4IQJ A;  3F8C A;  4RGS A;  4F7Z A;  4NC7 A;  2JA8 J;  1FOW A;  1Z3X A;  3H5A A;  2X1E A;  4M6X A;  5D5V B;  1OMI A;  1LFU P;  2XPU A;  4MTE A;  2VT3 A;  1MNM C;  3ABM H;  1FC3 A;  2VPL A;  1RKT A;  3WHC A;  2MW8 A;  2ZME C;  3MN2 A;  3PNY A;  1RI7 A;  1FYM A;  1F5T A;  3CP8 A;  3HB9 A;  4B1R A;  2HKO A;  3KYL A;  1Q1H A;  1DU6 A;  5HOD A;  3ELK A;  3DBH B;  5ED4 A;  4RLQ A;  1S7E A;  2KJB A;  3CCU I;  1MJ9 A;  1S29 A;  3VFZ A;  3CF2 A;  4BHC A;  4PFO A;  2CJJ A;  3BR3 A;  3RIR A;  5LGU A;  4ZTJ A;  4I99 C;  4XKB A;  3KCC A;  2R4G A;  2A61 A;  5JHF A;  1IUF A;  3C3W A;  4IZZ A;  3CF5 F;  3IKV A;  1WI3 A;  1Y6I A;  2QVO A;  3BDD A;  1MBK A;  1OCT C;  3W3C A;  4ESF A;  3JAM Z;  3PQJ A;  3HM5 A;  1ZRF A;  4CCO A;  4BXX J;  2P6T A;  5ICE A;  3L09 A;  2Q0O A;  5TRD A;  4OU0 A;  1S8N A;  3TW7 A;  1B9N A;  3CJR B;  4PGG A;  3L2U A;  4YEL A;  4IHW A;  2W57 A;  1X58 A;  4OMZ A;  2R7T A;  3PUF A;  3V8L A;  1ZG1 A;  2L9S A;  1X3Z B;  3KPH A;  4KIT B;  1OKR A;  4AC0 A;  1LJ9 A;  3QP5 A;  1M1E B;  2DA1 A;  4BE2 A;  1BI2 A;  1W4M A;  2IGM A;  3F6V A;  2GWR A;  3S2D J;  4P1W A;  2DA4 A;  1WGX A;  1G3S A;  5E1Z B;  3S3M A;  1VF9 A;  4IRI A;  3QRF F;  1ZLK A;  2CV2 A;  4HNV A;  4OIQ F;  3LQR A;  2VQC A;  3GYH X;  2LBF A;  4ON0 A;  3I4N J;  1S5L C;  1ZH5 A;  1KQ9 A;  1MMA A;  5HLH A;  3H92 A;  3BG3 A;  3PNT A;  3JRD A;  4L18 B;  2QEN A;  2R5Z B;  1SMY F;  2XRN A;  1VQ5 I;  1LQ1 A;  2CWE A;  2LVS A;  3RI4 A;  3ECO A;  2GQQ A;  3WG7 H;  2MFZ A;  3S93 A;  1HOM A;  4U0V A;  1D3Y A;  3ESW B;  3FWE A;  1EH8 A;  4A3F J;  2ZC2 A;  2DTR A;  2Y75 A;  3HRT A;  5HDN A;  3CCS I;  3VB2 A;  3DCF A;  3HJE A;  3UNG C;  4E7Z A;  5K1Y A;  3DPT A;  3LAP A;  2GA1 A;  1D5V A;  3TMO A;  1X3U A;  3KP6 A;  4PZJ A;  4P5O A;  3QP6 A;  2WAE A;  2MBF A;  2AS5 F;  2OUM A;  2CUJ A;  4XNF A;  2W4S A;  3J81 K;  5E3O A;  2M8E A;  3WGG A;  1S6L A;  1HDP A;  1NK3 P;  2CW8 A;  1H9T A;  2HI3 A;  2P5L C;  4FIS A;  1ZTR A;  3FXK A;  3A1Y A;  5FKO A;  1IZ1 A;  1P92 A;  3PFI A;  4FQG A;  2G7H A;  4CGZ A;  3WTX C;  2JTV A;  1JT6 A;  2NVU B;  2ZJR F;  2Y9Y A;  1R71 A;  3I58 A;  1J5Y A;  3QU6 A;  2WTE A;  2EZL A;  3HRU A;  4IX7 A;  4UUS A;  4HW0 A;  5FKK A;  3BC8 A;  3NAR A;  3NAU A;  1IUY A;  2LF7 A;  2XF7 A;  2JUC A;  1LDD A;  1ZN2 A;  2V1D A;  1J2X A;  4MO7 A;  1IF1 A;  1K78 A;  4UB8 C;  2YX4 A;  4NQW A;  4ENM A;  3RCO A;  1R9T J;  3MKY B;  3BTI A;  3OYD A;  4XK4 A;  2XAS A;  3BCA A;  4MLO A;  4N4N B;  2NVX J;  2QBY B;  2Y48 A;  3SYT A;  3V42 A;  3M7G A;  1HLV A;  4JP0 A;  2IW5 A;  2YU9 J;  4XLH A;  5E79 C;  2DO7 A;  4KIB A;  4L0Y B;  3HOS A;  5FKM A;  3KYD B;  2WY7 Q;  2XKP A;  2DYS H;  3K1N A;  2XPW A;  1G3W A;  4RB1 A;  4ZYA A;  3MFK A;  1PYV A;  2DYR H;  1B72 B;  3QQA A;  4KMF A;  4EJO A;  1YJW I;  2DQR A;  1CF7 A;  1MBE A;  1QZY A;  1IV6 A;  4HV6 A;  3BG9 A;  2VJJ A;  5ICF A;  3GTQ J;  3HSF A;  5AIP A;  9ANT A;  3EUA A;  1D0Z A;  2XGX A;  5CLS A;  3SFI A;  4B8X A;  5FGM A;  3JSP A;  2M7B A;  1QNT A;  2EZK A;  1TC3 C;  1WKM A;  1JJ8 C;  1U5T C;  4RM2 A;  2M5W A;  3WU0 A;  1HXD A;  4CZZ A;  3HOU J;  5ICG A;  2YPR A;  1TZL A;  2K02 A;  4EAT A;  2HEO A;  1XDS A;  1JUM A;  1T0F C;  2LD5 A;  3AAF A;  4PJM A;  2RAE A;  5IT9 Z;  1YI2 I;  3T5X A;  1TW2 A;  3KX2 A;  4IEJ A;  1AWC A;  3IH4 A;  1A6I A;  2B7E A;  3BJA A;  4HF1 A;  4V2F A;  3J80 Z;  3ASN H;  2ZME A;  4A0Y A;  1MH3 A;  1J09 A;  1MMG A;  5A2Q Z;  1NTC A;  4LLL A;  2LKP A;  1ACI A;  5TGT A;  2DJI A;  1R49 A;  2LY2 A;  1E2X A;  3PO2 J;  2FF4 A;  3NRV A;  3AG3 H;  4HX4 A;  4ENK A;  5C4J J;  3K4J A;  4CDG A;  1GDT A;  2NS8 A;  4M3D A;  2H8W A;  2LMD A;  4B43 A;  1XN7 A;  1LB2 A;  1X1P A;  1W7P D;  4N4O B;  3DBL B;  3OYM A;  3IRQ A;  4NBQ A;  1KYZ A;  2L7F P;  4C3J J;  5EEA A;  1D0X A;  2WAD A;  3FMQ A;  5DTD A;  2FOW A;  5LHG A;  3RZD J;  1IDY A;  4B09 A;  3BCB A;  3S17 J;  5LRS A;  2ZSH B;  3MWM A;  2DFE A;  3ZQL A;  1XS9 A;  2DA7 A;  4UY8 I;  1IN6 A;  4RBO A;  2EIM H;  3EUK L;  4B4C A;  2RGV A;  2JA6 J;  4PSX A;  1QRY A;  1N75 A;  2R0Q C;  1U8R A;  2PMZ N;  1E17 A;  1VTN C;  4V19 K;  3OYC A;  1WRJ A;  5HLI A;  2OCE A;  3F3X A;  4MFD A;  3RKY A;  4E70 A;  2DOA A;  5D5W B;  2NNN A;  1LEB A;  3F9K A;  1WQ2 A;  2JRT A;  3V8K A;  1F1Z A;  2BY1 A;  2CQQ A;  1MW7 A;  4II2 A;  2HZT A;  3TOB A;  4HPQ A;  1ORK A;  1WHU A;  1XSX A;  4XN3 A;  3A01 A;  3MKL A;  4XKV A;  3W6K B;  5LFA A;  2KFD A;  2WY8 Q;  3KP4 A;  2Z3Y A;  2NOG A;  2FMY A;  3BZC A;  3W6V A;  3DFG A;  5DCM A;  1UMQ A;  2N8G A;  4BDZ A;  3I4P A;  3BPX A;  3M8E A;  2QGU A;  2JJ7 A;  5DCF A;  3RYP A;  3GTL J;  4RS8 A;  1Y0U A;  4BXF A;  2FRH A;  4GFB A;  1GHC A;  3LA2 A;  1ULY A;  1W7P A;  5E17 F;  3SEZ A;  3D5R C;  3ERM A;  4XL9 A;  3BP8 A;  3JAM K;  1FYL A;  2WV0 A;  2K5C A;  2CGP A;  2X6X A;  3IWZ A;  2BOL A;  1YE9 A;  3WTZ A;  1ZRE A;  3BJ6 A;  4ZDL A;  5J1U A;  3HZJ A;  2R7S A;  2L7M P;  2XHK A;  1ZG3 A;  3DQV C;  4LB6 B;  1ZAR A;  2O0Y A;  3GZ5 A;  3GTK J;  4EQQ A;  3E7L A;  5BMZ A;  4OAZ A;  3JRC A;  2V6E A;  2XRO A;  5EDN A;  3A0B C;  3I64 A;  3PIO F;  1P4A A;  2E7W A;  3I53 A;  3GX4 X;  2VUM J;  1VQM I;  3ZMV A;  3GVA A;  1GVD A;  4N9H A;  2BW3 B;  3DU5 A;  4GDF A;  3EYY A;  3OSF A;  2ELJ A;  2EFN A;  4MTD A;  1WH5 A;  3A03 A;  2HTJ A;  3H9J A;  3K7A J;  2MSY A;  3I71 A;  5C44 J;  1ZEL A;  1ZKG A;  2EFW A;  3DPU A;  1ONV A;  1I6X A;  1VQN I;  1W5S A;  1W36 C;  2E1N A;  3C2B A;  1ENH A;  2BXY A;  2NS7 A;  2O61 A;  4JOM A;  2GXB A;  4BY7 J;  2V9P A;  3CCV I;  3MZH A;  1X2M A;  5JLX A;  3LFK A;  3HSR A;  2JPC A;  2FE3 A;  3HEF A;  4HX8 A;  1EJ9 A;  1HDD C;  3QOE A;  4G7Z F;  3SDB A;  4BUP A;  2WB1 N;  2IP2 A;  3MVP A;  2R7D A;  3IP4 B;  1E3H A;  2MLK A;  4BEH A;  3H3Z A;  4HZF A;  1TNS A;  4HOB A;  2KP6 A;  3CC7 I;  1B6A A;  3MQ0 A;  5L3D A;  1ITY A;  4PJJ A;  2VXZ A;  4YG2 F;  1R58 A;  1U5T A;  1A31 A;  1QPM A;  3VWB A;  2JA7 J;  2M3A A;  1FIP A;  3QPS A;  2FD5 A;  2LG4 A;  1TL8 A;  2GLO A;  3I4M J;  5F0C A;  2R7Z J;  1T0F A;  4IJA A;  2VN2 A;  4M6V A;  1Z9C A;  2UXN A;  2K9Q A;  4MHG A;  4I6Z A;  2FUG 2;  5CKT A;  4Z6Y A;  1MJA A;  2WBM A;  4CUG A;  2DA5 A;  2D1H A;  2XGE A;  3BR6 A;  4BQN A;  3EUH A;  1SFO J;  2H1K A;  2LR8 A;  5GAD J;  5E8I A;  3PL8 A;  2ZXH A;  1APL C;  1QO0 D;  4YFN F;  3GZN B;  3O8H A;  1K6Y A;  3LMM A;  4M9X A;  2PEX A;  1FIA A;  4AUX A;  1B9M A;  2E5Z A;  4HRI A;  2TDX A;  2KIQ A;  2B0L A;  2NYX A;  5DUK A;  1CQT A;  4HNT A;  2CUZ A;  1HBX G;  2QSH X;  1TW3 A;  2HVR A;  4LIU A;  3JTG A;  3SZT A;  4HV5 A;  3W2W A;  4OIN F;  1RNL A;  2O03 A;  2LBF B;  4F52 A;  3LST A;  4A3M J;  4P9U A;  2OBP A;  4P55 A;  4W1U A;  3TOA A;  1DPR A;  3E5U A;  1K7A A;  2CUE A;  3W6J B;  3K70 C;  3DU6 A;  4HLX A;  3ERE D;  4RAY A;  4WF2 A;  5FLV A;  3LSP A;  2JT1 A;  3RKQ A;  2OJE D;  4NNJ A;  2NVY J;  3EPZ A;  4Z2Y A;  1MDM B;  4AIK A;  1OLT A;  3F6O A;  1A35 A;  1D1B A;  2CO5 A;  2P6S A;  2ESN A;  2QLZ A;  4R79 A;  3HPG A;  2M0C A;  4Q4Z F;  1IO2 A;  5GPA A;  4QWQ A;  4X6A J;  2BY0 A;  2LKS A;  4C3H J;  2KL4 A;  4CCN A;  4CCM A;  4CIC A;  2DOF A;  3G1M A;  2CW0 F;  4F91 B;  1QHG A;  5IT9 K;  3FM3 A;  3QPH A;  2K85 A;  1PP8 F;  3GCM A;  3I9V 2;  1HSJ A;  2FEZ A;  5BOX A;  3J80 K;  3FMS A;  3LSR A;  4R1H A;  3GME A;  4CYD A;  5A2Q K;  4BAC A;  2VOD A;  3LSM A;  1OJL A;  4XBF A;  4DZJ A;  2K4B A;  3L2Q A;  4DBR A;  3CUQ B;  1IJW C;  1X2N A;  1YW8 A;  1MSE C;  2W84 A;  1UST A;  2RQQ A;  1P4X A;  2KDZ A;  3E6C C;  4LOC A;  1HW2 A;  4ZTF A;  3CJT B;  2XF5 A;  2A69 F;  1J59 A;  2PMH A;  3E3V A;  4CH7 A;  3JSO A;  1WPK A;  3GWZ A;  1WIB A;  5J4V A;  3HTS B;  1FTT A;  4ZJZ A;  2R93 J;  3L7W A;  1PUE E;  1JKO C;  1TWC J;  5BPD A;  5GAE J;  1K78 B;  3LNQ A;  4NQW B;  2TRT A;  3FXU A;  3O3K A;  1D8J A;  1JT0 A;  2V1X A;  3CMA I;  3JW4 A;  2VAS A;  4S05 A;  2IS2 A;  1SC7 A;  5DUI A;  3FKJ A;  3HUG B;  3GTG J;  2DQL A;  5E3M A;  4AYB N;  2EV5 A;  1GV2 A;  3S1Q J;  4Y52 J;  2VQL A;  1H0M A;  1JJ6 C;  1ZG5 A;  5IOZ A;  2VI6 A;  1CF7 B;  3M4O J;  2M34 A;  2B63 J;  3HTU A;  1G2H A;  1AHD P;  4B3A A;  1R36 A;  3J7A Y;  2FQ3 A;  1V5F A;  1YS7 A;  1BC7 C;  3R0J A;  3SDG A;  1DGW Y;  4A93 J;  2YR2 A;  4BYY A;  5LGT A;  1QVU A;  5B66 C;  1EH6 A;  1XGN A;  2YUS A;  1BA5 A;  3RSN A;  5M3M J;  3MZY A;  2H6C A;  1V4R A;  1SFK A;  3S1R J;  2A5W A;  2K9N A;  3ROU A;  4UXN A;  1ETK A;  2FBI A;  2ID3 A;  1XCV A;  3HHH A;  3TP3 A;  1KQ0 A;  3DTI A;  4A12 A;  3MAJ A;  1VFC A;  4QTR A;  1X1B A;  3N97 A;  2KIU A;  4LMY A;  1P9Q C;  4IHS A;  4M3G A;  1LE8 A;  1J7K A;  5D6F A;  2DMQ A;  2KHM A;  3GTP J;  5ICC A;  3Q9S A;  3OOU A;  3BRO A;  4IHX A;  2L7Z A;  3HOV J;  1WJA A;  5EEH A;  3SZP A;  1HW1 A;  5CQG A;  2CH0 A;  4C2T A;  4CZC A;  3VOE A;  3SXY A;  2Z33 A;  2COB A;  1EV7 A;  2AXT C;  3LSJ A;  1MH4 A;  2OZU A;  2WAF A;  2EIK H;  5ILU A;  4XSX F;  3BOQ A;  2PG4 A;  1YS6 A;  2CS3 A;  3VYS B;  1JE8 A;  1O7F A;  3FIS A;  5HS8 A;  1Z21 A;  3TDZ C;  5GTH C;  3OYB A;  1YQA A;  1XB4 A;  2X51 A;  5HOO A;  3KP7 A;  5FD6 A;  2VBX A;  2VJ4 A;  3EDP A;  4J01 A;  2CQK A;  1D1C A;  3QOD A;  3BTJ A;  5FKN A;  5KVR A;  5LBQ A;  1DP7 P;  3B02 A;  2GXA A;  4HA8 A;  4II3 A;  1YW9 A;  4RAF A;  2X48 A;  2ZJP F; 
#chains in the Genus database with same CATH homology
 3CCU I;  3CCJ I;  3I56 I;  1VQK I;  4IOC F;  3CCL I;  1WIB A;  1VQ7 I;  3CC7 I;  2NXN B;  3I55 I;  5GAE J;  3CF5 F;  3CCE I;  1MMS A;  3CMA I;  3G71 I;  1YIJ I;  1HC8 A;  2K3F A;  2OTJ I;  5JVG F;  3G4S I;  3J7Y J;  3CCQ I;  3CJS B;  3CJR B;  3CME I;  1YJW I;  3EGV B;  5GAG J;  5GAD J;  2E34 A;  1YJN I;  1FOY A;  2ZJQ F;  1VQ4 I;  2QA4 I;  2E35 A;  3G6E I;  3CCM I;  1VQP I;  1S72 I;  5GAH J;  2JQ7 A;  3PIP F;  3J7Z I;  3CD6 I;  1YI2 I;  1FOX A;  5DM7 F;  3PIO F;  1VQ5 I;  1QA6 A;  5DM6 F;  1ACI A;  3DLL F;  1YIT I;  1VQM I;  2E36 A;  3CCR I;  1YJ9 I;  1VQ8 I;  4IOA F;  3CCS I;  1VQ9 I;  2H8W A;  3CC2 I;  1VQ6 I;  3CJQ B;  1VQN I;  1VQO I;  1FOW A;  3CCV I;  2FOW A;  1YHQ I;  4IO9 F;  1Y39 A;  3CC4 I;  4UY8 I;  3CJT B;  2QEX I;  2ZJR F;  2OTL I;  1VQL I;  4V19 K;  2ZJP F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...