2NXNB

T. thermophilus ribosomal protein l11 methyltransferase (prma) in complex with ribosomal protein l11
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
139
structure length
139
Chain Sequence
b'MKKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFVTKTPPASYLIRKAAGLEKGAHKPGREKVGRITWEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein L11 methyltransferase
publication title Recognition of ribosomal protein L11 by the protein trimethyltransferase PrmA.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 20
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2006-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
B PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2nxnB02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 2nxnB01
3CJTB 3CC7I 1YITI 3G4SI 3I56I 1VQ6I 1VQ9I 1YHQI 1FOWA 1S72I 2ZJRF 2OTLI 1ACIA 4IO9F 1MMSA 1VQ8I 3PIPF 5GAEJ 2FOWA 2ZJPF 3CCEI 2ZJQF 1VQ5I 3DLLF 1HC8A 3EGVB 2E35A 3CCSI 3CJSB 1VQNI 3CCJI 3CC2I 5GAGJ 3CCUI 1Y39A 4UY8I 1YJNI 3CD6I 1VQLI 4IOAF 5GAHJ 1YJ9I 2E36A 3CCVI 1VQPI 3CMAI 3CC4I 1VQMI 3CCMI 3J7YJ 3G71I 1VQOI 1YI2I 3CCLI 3CCRI 3CMEI 1VQKI 2K3FA 1FOXA 5JVGF 1QA6A 2H8WA 3CJRB 1WIBA 2QA4I 1YJWI 1VQ4I 3CCQI 3G6EI 4V19K 3PIOF 5DM7F 1YIJI 5DM6F 2OTJI 3J7ZI 2NXNB 3CF5F 1FOYA 2E34A 5GADJ 3I55I 1VQ7I 4IOCF 3CJQB 2JQ7A 2QEXI
chains in the Genus database with same CATH superfamily
3W3CA 3MFKA 4U7DA 2GIZA 2V6EA 2EFWA 2CV0A 4AD9A 3K9TA 4O3MA 5C44J 2GA2A 2J5OA 3LWFA 4IRGA 1MNEA 5FO5A 1KONA 1Z67A 1XDUA 1SC7A 1D1AA 2QZ8A 4RAFA 3IH3A 2DFIA 1SVLA 2CH0A 1YHQI 3RPUA 2EFQA 3HSFA 4M9XA 1JHFA 4A0XA 2BOLA 4LGWA 2A6TA 2HGCA 3TDUC 1Z6RA 2HS5A 4JX5A 1QRYA 1OMIA 2Z3YA 4G6DA 1RESA 3ZN0A 4ESFA 1WGXA 5J47A 3T8TA 4L5IA 1FYKA 2DFEA 3P5JA 3CUOA 2ZCWA 3E97A 5F08A 5GAEJ 2GOXB 4XRFA 3OYKA 1JUSA 2MH2A 5A2QK 3GBGA 2CWEA 5FLXZ 1RZ4A 1QVTA 2FNPA 4MQ9F 3ASOH 4DQ2A 3JRBA 4CCMA 4I6ZA 4FISA 1TWGJ 2PLYA 2LRDA 4AVZA 4ZJZA 2DT6A 4CCKA 2E1CA 2PEXA 4EEFG 3MZ8A 3GO5A 3MCZA 3WTSC 2O61A 2VBZA 1A35A 2CS3A 1U8BA 1T56A 3IWFA 4FE7A 4YELA 1ZKGA 1ZK8A 2D2WA 4OAYA 4XRSG 1FSEA 1LFPA 1YRNB 3O8GA 2LNBA 3V7SA 3M4OJ 4XKWA 2X6OA 2XV4S 2RC4A 2ZNZA 2CW0F 2IT0A 2RQQA 2EK5A 4B3XA 2Z33A 4XOPA 4HF2A 3I4NJ 1WJBA 2GIVA 3CO7C 3FXMA 4UVAA 3JAMZ 3LA2A 2JSPA 4MTDA 4A3GJ 1U5TB 2AHQA 3BR1A 2XHKA 4XOTA 3WGIA 2HYGD 1U5TC 4ENMA 3BZCA 3CC4I 3CCMI 2WBMA 5K7FA 3H3VK 2CO5A 4CZZA 2LH9A 1BIBA 2GLOA 3CMEI 2DLLA 1M1EB 3GWZA 3WU0A 1D3YA 1U78A 3W6KB 3D5LA 4N0BA 1YFHA 1ZLKA 2L02A 1BI3A 2EINH 3DQVC 1XCVA 1R4MB 2FEZA 1BM9A 3PL8A 3TBIA 4BACA 3FHNA 4P1WA 3HUGB 2CUJA 2JA5J 4KN7X 3S3MA 2IP2A 1JJ6C 3AFHA 4XBFA 2LK2A 4A5NA 1HQCA 2LY2A 4KFCA 5DCFA 4EJOA 2Z5UA 3ECOA 3R4KA 1G6NA 3M7GA 4BY7J 1L3LA 2XGEA 1N75A 1USTA 1JKRC 4BJ6C 4EM2A 2P8TA 1X4OA 3KYDB 1WH7A 1REPC 1A31A 5DEQA 1SFXA 3QU3A 1MD0A 2IA2A 3X2QH 1BW5A 2WV1A 5LHHA 5IY5H 1QVUA 1MBGA 1X2NA 3OYLA 4BE0A 5IP9J 2OQRA 3WGHA 4I01A 2DI3A 4BE2A 1MMAA 3E5UA 5D8LB 2H6CA 4NDLA 1QZZA 3JCUC 1X19A 4XMYA 2XAFA 3SJMA 2VQCA 1IRZA 2OBPA 1ITYA 1GLNA 1ON1A 4MQVA 5HNFA 3SZGA 1LEAA 2Y30A 3HSEA 1X1DA 1ZGJA 2CQXA 2FMYA 2VJJA 3A03A 1XSXA 3K69A 4YIFA 5D5WB 2L7ZA 3U1DA 3WHCA 3CCEI 1F1ZA 3OSFA 3F23A 1R4NB 1PP8F 2WA0A 2RVCA 3C2GA 1V5EA 3G2BA 1F4KA 1YRNA 3EGVB 1T6SA 4XONA 2NOJB 2C6YA 5E1XA 4XSXF 1XN7A 4U7BA 3OY9A 1W36D 4HSTA 2PMUA 3HOTA 1D8KA 4EMSA 3H5AA 1R5HA 2I8DA 1WSUA 2HI3A 3G1MA 4NNJA 2VE8A 5IP7J 1K7AA 3K4CA 1U5TA 1TWAJ 3FX3A 2PMZA 3H92A 2F5CA 4JYKA 3QWLA 2FA5A 1FPQA 4LLLA 2E36A 4I09A 1WJEA 2EH3A 5A2QZ 1T95A 2BHZA 1T98A 2DMUA 3WTYC 3HBLA 2IVMA 1S3JA 4ZTFA 3GTJJ 1TQMA 4LLNA 4ZZDA 3HOWJ 3GUDA 3ZP5A 1VZ0A 3BTJA 4ESBA 3BT9A 4AYBA 1FOXA 3K70C 5JVGF 3U21A 2BBYA 3DTEA 3A2KA 4CYCA 3HUGA 3R0AA 3LAJA 2XF5A 5JHUA 1POGA 4EGYA 4A12A 3L2QA 4ASNA 5CVJA 3IHUA 5EYRA 2XB0X 1LFBA 3WG7H 4BQQA 1A5JA 3RDIA 4LG0B 2VONA 2ZXIA 1P4AA 1TZLA 4N9HA 4XR6A 5FFXA 2I5UA 2YS9A 3GFMA 3KYCB 3S93A 3PFYA 5ICCA 3HKZN 3S16J 3PM1A 4HF0A 3HGYA 3D1NI 1AKHB 2DA7A 3L2VA 2VIXA 3FWEA 3KZIC 2HXIA 3ULQB 4KDPA 2AS5F 4CUGA 3OSGA 2O5RA 1HSTA 1YOVB 2KRFA 3EUKL 2RNGA 3BG7A 1WI9A 1XD7A 4BEHB 3ERMA 2E5ZA 4OIQF 2L3DA 2JVGA 5D8KB 3J80K 1QPMA 3K4MA 1R9TJ 1X4PA 2JTVA 1R5GA 3SHFA 1S9HA 1HKQA 3CP8A 1A6QA 3ABMH 3RZOJ 3OYNA 2DMPA 1QPIA 3KP5A 2FBHA 3C2HA 2UV1A 1GT0C 4CXFA 1YW7A 1N25A 1RPWA 2KL4A 3CCSI 2R7RA 3SYTA 4XRSA 1PVEA 1A36A 3GFJA 5GAGJ 4IHWA 2M0CA 4C30A 3ELKA 1PP7U 1EKEA 2OZUA 2RDPA 1E17A 4LOCA 2R92J 1G2HA 4YFXF 2MA3A 5IYDJ 4GXOA 3QP5A 1Z3YA 2Z2SB 1HF0A 2IA1A 3LQRA 2LF8A 4IRIA 2DT7B 3PO2J 3ZOBA 3F22A 4IL6C 3JRCA 4HF1A 3S15J 3T5XA 1TNTA 2HKXA 1W7PB 3E0JB 4FE4A 2KISA 2IRFG 5J4VA 4QSHA 4M6XA 2H8RA 1A6IA 3CF2A 4HNTA 4CCOA 1LVAA 2RN7A 2Y0MA 4TV7A 1MMDA 4LG0A 2L9SA 3G6EI 2E7XA 4XNFA 3ONQA 3P9CA 1H89C 1SFUA 1NG6A 5L3FA 1Y8RB 1X1CA 3I59B 4MNUA 4P55A 1XGSA 4J01A 3RCOA 4M3DA 2DA4A 1MGTA 2LY9A 2A61A 4RM3A 4LD5A 1T33A 2ME0A 1TNSA 1FOYA 1YYVA 3FMQA 1K6OA 2STWA 1MMGA 4BGDA 3WHBA 1O3SA 2Y75A 1T38A 3IWZA 4II3A 1AKHA 3KFWX 2VOPA 3KP3A 2VJ5A 5GP9A 5JLXA 3VEPA 2KJCA 4BQOA 2VBWA 4UXNA 4E7LA 2EA2A 5CLSA 3V7RA 2VPRA 3FBIB 3JREA 2X6WA 4BEHA 3PNYA 5ILUA 3ZN1A 4HDVA 2BEOA 5BQTA 4A3IJ 1JKPC 4NC6A 1BIAA 2F4OB 3I71A 4KA4A 3RKWA 1TTYA 2QYOA 4PSWA 3PSFA 2HEOA 2FMLA 3GLLA 2XRLA 2B63J 2ELKA 1OCRH 1MBKA 2CQKA 3F72A 5E3MA 3GZ5A 2ID6A 2O03A 2VC1A 4A3BJ 1W4MA 3Q5FA 5M5XJ 1U0JA 1SD5A 2BY2A 4L18B 3A01B 2HQRA 4UUTA 4ZC3A 2MD5A 3I58A 3IH2A 2CW7A 1FOKA 3MWMA 2DFFA 2GOMA 3BR2A 2FOKA 1U8RA 1NH3A 1H9GA 2KDOA 2NNYA 2EB7A 2F5VA 2K5CA 2PMZN 1TT0A 3OYEA 2KP6A 2MC4A 4HX8A 4BE1A 2CV2A 1IRXA 2R7TA 1G3YA 3HXLA 3W2WA 3HTSB 1BR2A 3ZQCA 4QLCU 1CQTA 1SFKA 4HV6A 3JR9A 3KP2A 2E5NA 5HOOA 5E3OA 3RI4A 2Y0SA 3VPRA 3J80Z 3WTWC 1BJZA 3MD2A 4IOAF 2GWRA 5GAHJ 4BY1J 2HTJA 4CO8A 5F0FA 5HLTA 1YJ9I 2L9NA 4AYBN 4BYYA 3CO6C 2NS0A 2WAQA 1W1WE 1FTTA 2NS7A 3TO9A 3S14J 1IN7A 1FWZA 3L2CA 4P9FA 2DJIA 2F5EA 3G71I 4AIJA 2M87A 3MAJA 1A04A 2LOOA 5LGTA 3FK7A 4R1HA 2BYVE 1YG2A 2ZMEB 4BUPA 1Z1DA 2ZMEC 2ACJA 1K78A 1FLIA 5E8IA 2EA4A 3I59A 3HRUA 1SANA 4HZFA 4Q4ZF 3H0DA 3BDDA 2LKXA 1LDJA 2PI0A 2CQNA 4RGSA 3M1CA 2V1XA 1D5YA 2M3AA 4XLCA 1QHGA 4PJLA 3GCMA 4P5OA 5GPAA 2IGKA 4OAZA 5LEJA 2AO9A 2L4AA 2DK8A 3CJQB 3VSLA 3PO3J 2DPDA 3TOAA 1KQ8A 5KNLA 2QM3A 3DEWA 3C3WA 2QQ9A 4JBAA 1RKWA 3IP4B 2P7CB 3CC7I 3KETA 2NVXJ 5CPRB 2HQAA 3PSIA 4RLQA 3VYTB 2M5WA 3Q0UA 3OIOA 3VODA 5L3EA 3C18A 4PSXA 4MO7A 2PQ8A 4UV9A 4RB2C 4M73A 4YFNF 1BW6A 4IJAA 1Z7LA 1G59A 2P5LC 4D7NA 2HQNA 2XDVA 1DP7P 3BR3A 3JRGA 3OYAA 3A01A 1FBUA 4OINF 2J5PA 2CGPA 1HCRA 4C3IJ 3D5SC 5FRNA 3FKIJ 2DW4A 2AXLA 1BC7C 4DBRA 1VQ5I 3BTIA 2KMUA 1UFMA 3CUQB 4XKCA 4MFEA 5ICFA 2EFPA 2ZXWH 4AUXA 2ID3A 3CUQC 4HNVA 3AKZA 2NVYJ 4LIUA 2BE5F 4HQEA 4A3LJ 1QZYA 2E35A 4D9JA 4YFKF 3GW2A 2ECCA 2DTRA 2HKOA 2IGNA 1IC8A 2N8GA 3S1QJ 2YR2A 1MIJA 2PBIA 1SFEA 2V9PA 1W5SA 5E8GA 3IC7A 3GTQJ 3IRQA 3BPVA 3W6JB 3H5NA 4F93B 2CUZA 3CCVI 2H94A 4FETA 1IN6A 5M5WJ 3LSGA 3QU6A 2ZMEA 2HDWA 2P6SA 3ABKH 4UVBA 3QPHA 1VQOI 1AA7A 3S1MJ 4Y13A 2DODA 1B9MA 1VQKI 4MGRA 5EEAA 2O9LA 2VPLA 1BOBA 2L7FP 2EFOA 2JPCA 3JSPA 4EJTA 5D4RA 4M72A 1I39A 2A3SA 1JKOC 1V4RA 3OYIA 1RRJA 2IPQX 2OZ6A 2ZB9A 2ZXHA 3N05A 1JTYA 1DGWY 3FXUA 3GVAA 5DDGA 1UHWA 5F64A 1E3PA 3A4CA 3LSIA 4KIGA 4WXDA 2VQHA 1G8XA 3DTIA 3F0CA 1MBHA 3DEUA 3FIWA 5HLIA 3KEQA 3L2RA 1Z05A 1TWFJ 2M8GX 2LTPA 3PUFA 5F1RA 5E1ZB 2ECBA 2MGQA 4C2TA 1JTXA 3K0LA 1WH5A 1B8IA 1J75A 3CLOA 5L3DA 3PJRA 3RYRA 2E1NA 1NTCA 1RI7A 1HW5A 3WE2A 3QP6A 1HA8A 4ZDOA 2EJRA 2K7LA 3HHHA 4XLFA 2WY7Q 3FXQA 4F92B 4P9UA 2IW5A 5AIPA 3MKYB 2G7UA 3MN2A 2FBIA 1PUFB 2P0WA 5IP6A 1E2XA 3KYLA 2MYSA 3QOEA 3ZR8X 2M4GA 2ZSIB 1D1CA 3SZTA 5EEGA 5JI6A 2CG4A 2OD5A 3I54A 4JQFA 4IQ4A 5LLQA 4BL0B 2GXAA 1ZH5A 4CCLA 4G8XA 1TP4A 2V6CA 5L3GA 3H9GA 3TO7A 1PUEE 5M5YJ 4EM0B 3DEEA 1ZQ3P 4GFBA 4ABZA 2ELJA 2W1OA 2X1CA 4BQAA 3CUQA 2TRTA 4A3KJ 1VQ8I 1I6HJ 2HVSA 1J5YA 3MQ0A 5HDGA 2W24A 2R5ZA 1SAUA 2ZJQF 1MJ9A 3PUBA 2O6GE 2DOFA 5GPCA 5IYCJ 4S05A 1S7OA 1ZR2A 2LDUA 4HLYA 1ETWA 3ISPA 2F5DA 1YS7A 4LLGF 3DV8A 3VYRB 4EM1A 2V1UA 1R7JA 2Y0SN 3S32A 1O7LA 2ZFWA 1Z7UA 3HOVJ 2RKHA 1H9TA 1BJAA 3K1PA 3FKJA 1X58A 3CD6I 2WAQN 2K86A 1XGNA 3OOPA 2LLKA 1GHCA 1D0ZA 2CYYA 4OIRF 4ENKA 2LBFA 3E6CC 2R5YB 1O7FA 2ZC2A 4LK0F 1WQ2A 3H36A 3CMAI 3LSHA 2R7WA 1XTAA 3BC8A 4N4OB 3GTLJ 4B47A 4H0EA 5JFRA 4G6QA 3C2BA 1RR7A 5ICGA 1LDDA 2M9HA 2QKMB 2QCOA 1I5ZA 3LSPA 4KN4X 2XIGA 1J09A 2CQQA 1U3EM 1S7EA 4UUSA 4BBRJ 2V4JC 5F0HA 3W2VA 2R7FA 3F21A 2ZBKA 3VFZA 4IX7A 5DTDA 1E3HA 1JUMA 4V19K 5BMZA 5J6XA 2QWWA 2ZO4A 1IO2A 5DM7F 2V1DA 4OMZA 1B6AA 3KZZA 3H1CA 3TW7A 2KRCA 2W84A 1R58A 3ECHA 3CCYA 2DOAA 3AG1H 3JSOA 2EILH 1XCBA 2Y2ZA 4RGUA 2L9VA 1KGSA 4BHBA 2ELHA 2W4SA 3ZMDA 1TQIA 2UZKA 1I3QJ 5AONA 2FD5A 5DUIA 1PUFA 5FKOA 1SVOA 2LF7A 5D4SA 4II2A 4D0PA 2CRGA 3OYFA 1HW2A 4AM3A 5AIQA 1HOMA 3GX4X 2QSHX 2DA5A 4EGZA 1ZLJA 1U6GA 2DA2A 2O8KA 2EV0A 3WTUC 4HPQA 2IGMA 3NWTA 4AIHA 3E6MA 1SAXA 1MBFA 1MKMA 1ON2A 3O2PE 5FB2A 5EGOA 2IGOA 1IN4A 3L1PA 3BG6A 4M9ZA 2XAHA 4BKXA 1NK3P 3FMRA 1Z91A 2LSOA 1MMSA 2CUEA 4FQGA 3OYGA 1D5VA 2PFBA 2NVTJ 1BN5A 3BZKA 3O6BB 2Y9ZA 4IZZA 1OISA 4OIOF 4P96A 2WY8Q 4LMYA 3RKYA 1P7IA 2HFHA 3OOUA 3HOXJ 4IHSA 3DLLF 2MBFA 3H0GJ 2VJIA 1B72B 1JXSA 2OUMA 1G4DA 5HDKA 3F8CA 2QQBA 2W82A 2CV1A 5DUKA 1IN5A 1YX5A 4XLAA 4UV8A 3JRIA 3K70D 3ABLH 4FASD 2Y48A 4QPQA 1HKSA 4PFPA 2DK5A 4WX9A 4B09A 2HDCA 1P92A 2Z16A 4BS9A 1WPKA 3HSRA 1LPQA 3DKXA 2COBA 1BL0A 5HS9A 1B59A 2EZIA 2IJLA 4LG3A 4YEJA 2VBXA 3IV5A 3LSJA 3KLOA 3CMMA 1HW1A 3IAM2 2QBYB 4CZCA 5B5EC 3A0BC 1X1BA 5H6QA 5CVRA 2K3FA 5JLWA 2DOEA 1Z77A 4PJJA 1FSHA 2EIMH 5ICEA 3ZMUA 1EV7A 3VSKA 1T0FC 4J00A 3GTPJ 1MJBA 2VKHA 4M74A 4A0YA 4PCQA 1IDYA 2OA4A 5HNHA 3R6SA 2DDAA 5DM6F 1Y0NA 4U87A 2KQRA 3SXYA 3HHGA 3HOYJ 4ON0A 1WKMA 2V9KA 3BJAA 1KZHA 1IXSB 1J59A 5DD8A 3DLAA 3B02A 2ZJ2A 3BWGA 5FROA 2HVRA 3FXOA 2VOOA 3BOQA 1WJFA 5F6FA 5H20A 1FEXA 4IF4A 2MH9A 2M7BA 3PQJA 2M4KA 5HLGA 3D5RC 2EIKH 1MNDA 2QLZA 5BS6A 9ANTA 3U1KA 5K7ZA 2E1OA 4KMUX 3CQZJ 4OWRB 3GZNB 3RSNA 2A07F 3ESWB 4ANJA 4KMFA 1UHMA 3ZQGA 4C3HJ 2JK3A 4YRVA 4ITVA 4F55A 2NOGA 4PGHA 2WAFA 4HV5A 1UG2A 2FNAA 2WV0A 1LDKB 4I2OA 3BLYA 1IGNA 4Y3OA 4F52A 3W6VA 2HYJA 1FP2A 5LRSA 2IXSA 3R0JA 4FCYA 1ZGAA 2QKLB 3KP6A 4B48A 2Q2EB 1IRGA 3QYBA 4OMYA 1OKRA 4IPAA 3NQOA 1OYYA 1JHHA 4X0GA 3ZCOA 2DXIA 4XN3A 3OYBA 1IUFA 3PNTA 2BW3B 1Y1WJ 3N97A 1SD4A 1X1AA 1W7PD 3B73A 3K4LA 3CCJI 3BG3A 1DU6A 3SQNA 1K61A 2X51A 4UY8I 1OCPA 4R79A 2BXZA 2OCEA 2Q0OA 4DW6A 3I5UA 4HEA2 4G7ZF 1QZEA 2MLKA 3S2DJ 3EUHC 4PZJA 2NVUB 2GXBA 2A6HF 1FY7A 2NNNA 4RM2A 3I9V2 1YX3A 2EWNA 1B1BA 5IOZA 4EJWA 1WJCA 4RB0A 4KUMA 4JOMA 3S3OA 4NUBA 2EBIA 2K27A 3G73A 3BG5A 4U88A 4H4KC 1KU7A 5FJ8J 1TWHJ 5H6RA 2WAEA 2MABA 4B1RA 1EJ9A 1QO0D 3Q9VA 1OYWA 2XGXA 2E2JJ 3ZXSA 5J1RA 1YJWI 2VUMJ 2MG4A 1TW3A 3TOBA 1YQAA 4DBQA 2CFXA 3OS1A 4A6EA 2L01A 2BXYA 1GXQA 1YIOA 4HOBA 4HX4A 1RETA 4PJMA 4BQNA 3HOZJ 1FIPA 3J7ZI 3AG2H 3TQNA 4L5JA 2L54A 5IT3A 2Q1ZB 3F9KA 2JA7J 3BP8A 2VJ4A 5CVIA 1K6YA 4IOCF 3K4NA 2R0QC 2B0LA 4L5EA 3BQZA 2CUFA 3ASNH 5HS7A 4MHGA 4UVCA 1JGGA 2FXAA 1J7KA 1KYWA 4I0BA 3HM5A 3OYHA 2FUG2 2LREA 2V1NA 4F3QA 2W48A 1TLHB 3GEZA 4HQMA 5E18F 3Q0VA 4HSRA 2OCCH 3S17J 3SFZA 5GTIC 3H3ZA 4X6AJ 3IL2A 2IA0A 1AOYA 4FHTA 3S1NJ 1XG1A 2XB5A 3F8BA 3DU6A 2KZGA 1ACIA 4I7HA 3OV8A 4ZYDA 4WK8F 5FKLA 3HIFA 3L9FA 2XAQA 2A05A 1BA5A 1BOAA 3RKXA 2RAEA 2FX0A 3V42A 1STZA 3T1BA 1I1GA 1S5LC 3J81K 4KJZA 4PDKA 1P9QC 3P7NA 1Z21A 5EG0B 3ABUA 1V5GA 3NAUA 3UKGA 2X4HA 1EA3A 1IV6A 2VXZA 4HYEA 5K1YA 1VQNI 4GCVA 5C4JJ 2O8XA 1T08B 4HG2A 1LQ1A 3EUHA 4V2GA 1GVJA 4F91B 2YU3A 2XUBA 2XF6A 2IS2A 4Z6YA 2XASA 4C3JJ 2X6XA 1TT5B 3G1OA 2QSFX 2K9QA 1PDNC 3K4BA 3K1NA 2WTEA 3K10A 4MEXF 4Y15A 4B3AA 1OFCX 3IRRA 4IRHA 3DU5A 3F8MA 5CJ9A 4ZYGA 5FFZA 4CGZA 3NEUA 4M71A 2DJNA 3J7AO 3CCLI 1KQ9A 2LKPA 3V4GA 5IOYA 1D8JA 4A3JJ 3A02A 4KT5C 3DF8A 5TGTA 4KIFA 4A2UA 2XSDC 5CKTA 5TJJA 1QU3A 2QA4I 4NC7A 3KEYA 1XSVA 2BZTA 1VQ4I 2BY3A 4LITA 5F1JA 1FBQA 2Z1DA 3BTLA 3PIOF 3OYMA 4UUVA 1UJ8A 5HDNA 1ZR4A 1W7PA 2YSRA 2Z99A 2M34A 4WWCA 2K02A 2ISYA 4LFUA 3D0SA 5TISC 1MSEC 3CF5F 2K85A 2HPMA 4HNUA 2QQAA 1UG0A 4XLHA 1JT6A 1VQ7I 3FXJA 1FNNA 1Y1VJ 5C3EJ 2QSGX 1MJAA 2VKVA 1FTZA 2XC7A 3BR5A 2QF7A 3TEDA 3O8HA 3GTGJ 5FKNA 2W85A 3KCCA 1UMQA 1R22A 4PJ0C 5JVTA 4I99C 3MZYA 2STTA 3V8JA 3U2RA 1ERDA 5BOXA 5F04A 1VQ6I 1I6XA 3E5XA 3OIPA 1ZG1A 3PFIA 2PJPA 2K3PA 2DA1A 1EF4A 3F6OA 3HEFA 5C4XJ 4JK1X 3HZJA 4RB1A 1QGPA 3WODF 4RGXA 1TL8A 2LD5A 2DA3A 2RREA 3JTHA 3Q9SA 3E6DA 3DXJF 2VASA 2EZKA 3KPHA 4GGGA 5EG0A 2JUGA 4EV0A 2B7EA 1OCCH 1ZRFA 4E7KA 3S2WA 4Z2YA 1IXRC 3HGGA 1SFOJ 2CMPA 2OF7A 3FM5A 1SD6A 2K9NA 1IN8A 2KZVA 2UWMA 5CVUA 3QOPA 3HG9A 1BI0A 2CQ7A 1DDNA 1QBJA 4QIWN 3LMMA 5LHIA 4BXFA 5E1WA 3DCFA 5DYMA 1G3WA 2KDZA 3DBHB 1YJNI 1BC8C 2CSOA 3FF5A 3BR6A 1O4XA 2BY0A 5ERIA 1B9NA 3WTTC 4MIMA 3S2HJ 3IKVA 4O5VA 1GUUA 3B6CA 2A5WA 3MMYB 4KITB 2FU4A 1ETOA 1K79A 5FKKA 2P6TA 1IW7F 2K9MA 1LE8B 2IS1A 1WWXA 3EQLF 5K7HA 2E2IJ 2D1HA 2H6BA 2KIMA 3DKWA 2ESNA 5FD6A 1S6LA 1DP3A 1F36A 4CYDA 3CZ6A 5IYBJ 3J81Z 3FXRA 1X3ZB 3AL0B 3BROA 1VFCA 2WWYA 3AL0C 3ZMZA 1F43A 2E2HJ 4UNOA 2NS8A 1ZAOA 2H8WA 5DD4A 3VB2A 3ZQIA 2AXTC 2HVQA 1ODDA 4NC8A 1XPXA 5FLXK 1UZCA 2X48A 3GXOA 5KVRA 2UXNA 2YUSA 1DPUA 4WF2A 1AWCA 2YX7A 5ED4A 2XAUA 5J3LA 1KA8A 2OQGA 3IKTA 3RTRA 3GFLA 2LFBA 4U0YA 3HRTA 5FLMJ 1X2MA 2PN6A 2OC6A 2EFNA 1V5FA 2M30A 4M3EA 4BXUA 1O3TA 3LA3A 2M1BA 3M8JA 1U9OA 2R7OA 2JQ7A 3QRFF 1FT9A 2ZXJA 2H1LA 1LB2A 4Q5SF 5ILVA 1LJ9A 1BR1A 3Q0WA 5B1AH 1WCMJ 4E6KG 4A3MJ 3QAHA 2V7FA 1YLFA 3T0YA 2V26A 2GBYA 4U0VA 1YW9A 1DQUA 2R3SA 2BY1A 2VT2A 1P4XA 3C7JA 2BHYA 3TMOA 3TP3A 4G94A 1KU2A 2X1DA 2D1VA 4A93J 3PQKA 3ZMSA 3DWLE 4W1UA 2XF7A 1WRJA 3LSTA 2LVSA 3JTGA 2JPBA 2H27A 2E1MB 4GYIA 2E1MC 4XKVA 3GYHX 1X1PA 5DV5A 5GTHC 4A0ZA 3KE2A 4L9NA 2HXOA 2KIFA 3F3XA 4XIDA 4G12A 3FHZA 2KJBA 3DFGA 2HOSA 3BJ6A 5CYVA 1R5ID 2A69F 3M9AA 2DTZA 1FJLA 1P6RA 2F2EA 3QQAA 4CCJA 2ZJPF 1LFUP 3EYIA 2KRHA 2FF4A 2VB6A 3L09A 4Y7NJ 4KNYA 2DO7A 1T8IA 3FZVA 4PFOA 3HPGA 3L2WA 3CJSB 2YX4A 4C9YA 3RJPA 3MZHA 3GTKJ 1Z6TA 2R93J 2DCEA 3VDXA 3K1MA 4UB8C 1VQLI 1LE8A 1TC3C 2DA6A 4BDYA 1HSJA 3JRAA 1ZREA 1RKTA 1WI3A 5LFAA 4G7HF 5KCMA 1YW8A 1I50J 2EV5A 3LA7A 1R6RA 3QYEA 2XROA 3HTUA 1MDMB 4A3FJ 3CDLA 4RB3C 1LKXA 4Q48A 4E7HA 2R7VA 1XDSA 1LUJB 4BH9A 1ENHA 4B43A 4CCNA 4EJUA 3BPXA 4AIDA 2VE9A 1JGSA 3HRSA 1R36A 4A6DA 4DNCA 1H0MA 3LSRA 5HODA 1KU9A 1N77A 2JT1A 1X3WB 2VL8A 4QPOA 4IHXA 1KQ0A 3ZQHA 3WTVC 4ENNA 2LG4A 2ICWG 3BCBA 4BJ5C 3JW4A 2L7MP 2DMTA 4A3CJ 1R71A 1I3AA 3RQIA 3S1RJ 5DCMB 1JT0A 1VNDA 3HKZA 3GLXA 2Y69H 4IEJA 3MKWB 3OWTA 5GADJ 1PYVA 5K5RA 3LL7A 2HOAA 1LVKA 3KP4A 3HB9A 5J1YA 3V7CA 1WFXA 1IUYA 2QGUA 4WCGA 4OU0A 2NVQJ 3ABTA 3CJTB 3E7LA 4D7MA 4E4HA 4UB6C 2NAZA 2HU9A 2HZTA 1F9NA 3CDHA 1K4TA 2F48A 2TDXA 4HBLA 2V79A 4JP0A 4HX7A 3CTAA 5H2FC 2KHMA 2X85A 3KEOA 3QPSA 5LD2C 3WTXC 4BXXJ 1RUNA 4BNCA 1KYZA 2KIUA 4S0HB 4AU7A 1DU0A 2JWTA 4NHJA 3KLNA 4MLOA 4XLPF 2XKOA 1V3FA 2DT5A 2VODA 1G3TA 2XPUA 4ETSA 1Y56A 3DP7A 3OR1C 4RAZA 1IV8A 5B1BH 1MW7A 2RNJA 1FX7A 3B6AA 5ILSA 3HDDA 1NG7A 1N78A 4XKBA 2F4IA 5FKMA 3TL4X 4D5FA 1ZRCA 3OR2C 3TW6A 1TQPA 2NYXA 2FRHA 4BDZA 2LR8A 3CJNA 3RPQA 4E7ZA 3V8KA 4AC0A 3ML6A 4DZPA 2D5VA 2E71A 1MDMA 2L2OA 2XRNA 2IBDA 2Z9OA 3ROUA 2QUFA 4HDUA 1TW2A 1AHDP 1EH6A 4CYCB 1UELB 1LNWA 3MVPA 5EJCA 1U2WA 3OYJA 4DZJA 1ZELA 3L7WA 2PMHA 1YI2I 3E3VA 3CCRI 1Z0XA 4DGWB 2O7OA 3CMYA 1ZGWA 1U9NA 3HOUJ 2P4WA 4PUSA 1ZN2A 5F27A 1QA6A 3TGNA 3I53A 4M9SA 1J9IA 5HLHA 4FX4A 2O3FA 2R5YA 1WJ5A 3W2AA 3SZPA 5DCMA 1AU7A 1MNMC 3CLQA 2P7VB 1MBJA 1G3SA 3ZGKA 1P2FA 3DPTA 3WE3A 1DPRA 4R8HA 4IXAA 4S04A 1B4AA 1XS9A 4XRMA 4G6TB 2D45A 4E7JA 4XLNF 3H5RA 3HOSA 2LMDA 2OTJI 2BGCA 5D5XB 1YO5C 5EDNA 2OJED 3DPLC 2G7HA 2F6CA 4NBQA 4B44A 4PJNA 3WGGA 1SEUA 5IT9K 4AWXB 4RMNA 3VYSB 3JRFA 4KICA 2Y9YA 2OV7A 2QVOA 2VQLA 4M6VA 2HOTA 4XORA 2GZWA 4W97A 2H09A 4L9TA 1R49A 4YG2F 3G4SI 1WVRA 3UNGC 5M3MJ 2YU9J 2M45A 4ZTJA 1RNLA 3P9KA 1Z3XA 4QWQA 5D5VB 5E20A 2GA1A 3R61A 2FJ1A 3ZPLA 3ZRGA 5EF6A 2RV8A 3LSMA 4CICA 5CQEA 3M07A 1S72I 2OTLI 1C0WA 3A0HC 3WTZA 2DMQA 2VKEA 4MEYF 4D1QA 1EH7A 3ZQFA 2K4JA 2R7ZJ 6PAXA 2CW8A 4LJZF 4DOZA 1CF7B 2JRTA 1JI8A 1R1TA 3OYDA 1ZRDA 1EH8A 1FC3A 1XGMA 5D6FA 2DBBA 2WC2A 4XM3A 1QQIA 3GTOJ 2IS4A 1LEBA 1DGRM 3O3KA 1D0YA 3S8PA 5E3NA 2G9WA 1BR4A 3KX2A 3TDZC 2XGDA 2B9SA 3CC2I 5B66C 4KYWA 5L3BA 2M0MA 3E6BA 4A69C 1Y39A 3SDBA 2CU7A 3NRVA 4X1EA 3HYIA 4BHPA 1MZBA 5J8FA 4GO1A 3TKYA 2JRMA 5KHDA 2L9RA 2OAZA 1J0RA 4O6JA 1ZG3A 4ZYEA 1B72A 3SEZA 1MSFC 2MD0A 3PNVA 1HKTA 3T8RA 1FP1D 2GXGA 1OCTC 3J7YJ 2DU9A 1RUOA 2KT0A 2ESHA 4XQFA 3MEXA 2GM4A 4MTEA 1W36C 2VT3A 2IEKA 2ZNYA 2JUCA 3NWSA 4MFDA 3DBLB 3LSKA 4IQJA 4IKFA 2VC0A 4CSWA 4N4NB 4Y52J 3L2UA 2W57A 3WU1B 3REOA 1IJWC 3LFKA 4E7SA 1IZ1A 2EZHA 3FK6A 4EJVA 2ADUA 5FLVA 1O57A 4A3DJ 4ZYAA 1YIJI 2IS6A 3E5QA 3QPTA 2DYSH 1ETKA 2QBYA 1XMXA 2PG4A 4UHTA 3G1LA 2NXNB 2LC2A 4I76A 3FISA 1GXPA 1ZHFA 3IH4A 1T0FA 3I55I 1H8AC 3OYCA 2EIJH 2JA6J 4E7IA 3SEQA 5E17F 2CFOA 2FBKA 4LB6B 1BI2A 1WZ2A 2VKDA 1V55H 1OYIA 2OU2A 3FBNB 4ZZLA 4A5MA 4ESJA 1BI1A 4YIRX 3OS0A 4RBOA 1FMVA 3EETA 3LOCA 1I1SA 2M2EA 2VI6A 1QHHD 2JA8J 1IAWA 4I0AA 2ME6A 2A6EF 1S29A 3UR3C 3EDPA 4G7OF 5D5UB 2VXDA 2R7XA 1VQ9I 3BR0A 3K6GA 4LB5A 1IF1A 2DYRH 3HJEA 2ZJRF 1CF7A 3CESA 2COMA 2F5FA 5DS9A 4HLXA 1YE9A 4KISA 1FBSA 5CVVA 2MFZA 2VN2A 4M3FA 5IPAA 2R7DA 3EPZA 4GRIA 5HVQC 3AAFA 5IT9Z 3AG4H 4BU2A 2FOWA 2HZDA 1HBXG 5KK1A 2X9DA 3L00A 1FYMA 3EYYA 3MKZA 1SD7A 3RQ4A 2JZYA 1JUPA 1RR8C 1UHSA 4ZDLA 5LEKA 5EEHA 3RIRA 4CH7A 4YIIA 2Q8KA 1XSDA 1IG7A 1KU3A 3OIQA 4C2UA 3CCUI 3LQQA 2CJJA 2P5KA 4WXCA 5BNGA 4HW0A 2Q2EA 5L3CA 1UCRA 1ONVA 1Q1HA 2W25A 4XSZF 3BJOA 4ZDPA 3K2AA 1K78B 1W0TA 3HPHA 5LBQA 2PJRB 3FXLA 2L5QA 2BW3A 2KLOA 2W00A 3FXKA 2A5YB 4JX6A 3LFUA 2LKSA 2RGVA 1MBEA 1OR7C 2X6YA 4NQWB 4CDGA 1XGOA 5M3FJ 5F0CA 1I27A 3VYUB 2WADA 3MKLA 2JMWA 2GQQA 5FRMA 3H35A 4GDFA 1GV5A 3OMYA 3RYPA 1MH4A 1XMKA 3NARA 3GTMJ 2HR3A 4N9IA 1S7AA 4RDUA 4RS8A 1WIBA 1NK2P 3ZQLA 3P9IA 4AIKA 5BPIA 5FD5A 3DKYA 4IHVA 3SFIA 3ZQQA 1WJAA 4XLEA 3VOEA 2DDBA 1JJ8C 2KIQA 1HLVA 2F4MB 1ULYA 4QTRA 2R7QA 1TWCJ 1K83J 4DYRA 2PX9A 5J4YA 2XAGA 5J40A 1S8NA 2XPVA 1OJLA 2I10A 2O0YA 1R00A 5KAFC 4V2FA 4KT6A 2Y31A 5E3LA 1Q1VA 2R7UA 1RC9A 3BQYA 4EVIA 2HPIA 2ISZA 2OPTA 1PJRA 1NHAA 3FDYA 2X0LA 1YS6A 2UXXA 3CDIA 3ZQ7A 5LGNA 2RQPA 3BG9A 2EPFA 4RLFA 5D6EA 1MH3A 1ZYRF 3IUOA 3M1EA 2XSJC 2WB1A 4XK4A 3I3LA 3CP2A 1YITI 3DTKA 1QNTA 1VF9A 2KPMA 3EUAA 4LIVA 3I56I 1L0OC 1ZTRA 1O3RA 3QPLA 4M3GA 2HWVA 1BBYA 1FOWA 4K2EA 5J1UA 1XB4A 1TBXA 1YTYA 4M3BA 4JX4A 5K5OA 4RGRA 1SMTA 3BZ6A 1K4SA 1ETQA 2ZKZA 2GAUA 1OCZH 2R4GA 2L0KA 1HXDA 5LRRA 2HTSA 4DYCA 3KP7A 3I64A 1OLTA 2DFHA 4XL9A 1R23A 2M8EA 2LP0A 2M7AA 4Q47A 3U9GA 3BY6A 2K9LA 4Y17A 2MSYA 2YPRA 4C2MJ 3S3NA 1HC8A 4Y4RA 3K4JA 1CGPA 4CHUA 3BCAA 4RAYA 4L0YB 2FQ3A 3LAPA 1R1UA 3TO6A 2PJRA 2FE3A 4ZYHA 4IHYA 4LK1F 3IAS2 1X3UA 3M8EA 4FX0A 3G3ZA 1OR7A 4NQWA 4EATA 4HA8A 2DN0A 4ZH4F 2HQ5A 2G0EA 1F5TA 5LGUA 1WJDA 3COAC 3KZYA 1ZG5A 1ETYA 4PGGA 4B8XA 4BBSJ 2V9VA 4G9YA 4XICA 2DPUA 2VBYA 2XPWA 4HAMA 1FZPB 3OL3A 1IXCA 3GF2A 1ORKA 3OL4A 2X1EA 3M3YJ 5JR3A 1FMWA 4L0ZB 1V54H 3VWBA 2XAJA 5EZHA 5LHGA 3H9JA 1ETXA 1OQYA 3CJRB 1T2KA 3HC7A 1T39A 3RPUD 4IVNA 3RKQA 2MC3A 3CCQI 1B8IB 2VLAA 4B4CA 3I4PA 5TRDA 2QQ8A 4M6YA 2KFDA 2A68F 1D0XA 2HOEA 1FYLA 2EV6A 5KAIC 3K7AJ 1GDTA 4RAGA 3H3UA 2EQRA 4I98B 4U0WA 3HRMA 3K4KA 2XGCA 4EQQA 1E0EA 2K9SA 3DPUA 4L9VA 4BHCA 1USSA 3OS2A 3BTCA 2XKPA 3AG3H 3F8FA 2JN6A 4NB5A 3I0TA 4FT8A 3K2ZA 1W5CC 2ZFUA 3FM3A 1VI0A 2HNHA 2LY1A 1JKQC 1W5TA 2QENA 3FMSA 4RA2A 4DJAA 1RIOH 5FGMA 4GYGA 2AQFA 1UB9A 2R5ZB 2HDDA 5JHFA 1OCOH 1Y6IA 1ETVA 3RZDJ 1DUXC 1ZARA 4F7ZA 3WU2C 5J8CA 1IRFA 2LYCA 2JVHA 2MW8A 4E70A 2L7KA 4IO9F 3GFIA 1Y0UA 2BV6A 4AVPA 3PIPF 3JAMK 1HDDC 3A1YA 3SDGA 2TCTA 4HRIA 1MMNA 2W7NA 2MLGA 3JRHA 4KIBA 3Q3SA 3M8FA 2IAIA 2UUZA 3N4MA 5HS8A 3TP0A 2LBFB 1APLC 4BJTA 2E7WA 4DYQA 2BVMA 2E60A 3KIOA 2K40A 5CQGA 2FQ4A 1UAAA 3QYFA 3R60A 1D1BA 3F6VA 4CA0A 1OPCA 4UUSB 3QODA 1GV2A 1VQPI 2JSCA 4WXHA 5BPDA 1Y8QB 1R1VA 4BAYA 1VQMI 2L4MA 4DIQA 1SMYF 4A3EJ 2K4BA 2ZSHB 1P7JA 1JE8A 1XMAA 3DBRB 1Z9CA 2JA2A 2DMNA 1IDZA 4OIPF 4I02A 2E19A 2FSWA 2DQRA 3E1SA 1WHUA 2VQGA 1FIAA 4FTHA 2R7SA 3V8LA 5E79C 2JJ7A 3ZMVA 2KKOA 3ERED 2HYFA 3HL2A 1E3OC 3J7AY 3H9QA 1XC5A 2EZLA 2P5VA 3WG9A 4XN0A 3GZ6A 1P4WA 1O3QA 4Y33A 3JRDA 4L9JA 5EZGA 5K5QA 4ENJA 1H88C 2H1KA 4IHTA 3I4MJ 4D5CA 2NRAC 2E34A 2BVLA 3ZMTA 2AQEA 2XVCA 2DAOA 5B3SH 1W0UA 2WB1N 1HDPA 4OOIA 1GVDA 3GMEA 2QEXI 3LNQA 2ETHA 2DQLA 2P81A 3F8NA 4PK4A 5EGOB 1SVMA 4J19A 1XX5A 3C1DA 1J2XA 1VTNC
chains in the Genus database with same CATH topology
3CJTB 3CC7I 1YITI 3G4SI 3I56I 1VQ6I 1VQ9I 1YHQI 1FOWA 1S72I 2ZJRF 2OTLI 1ACIA 4IO9F 1MMSA 1VQ8I 3PIPF 5GAEJ 2FOWA 2ZJPF 3CCEI 2ZJQF 1VQ5I 3DLLF 1HC8A 3EGVB 2E35A 3CCSI 3CJSB 1VQNI 3CCJI 3CC2I 5GAGJ 3CCUI 1Y39A 4UY8I 1YJNI 3CD6I 1VQLI 4IOAF 5GAHJ 1YJ9I 2E36A 3CCVI 1VQPI 3CMAI 3CC4I 1VQMI 3CCMI 3J7YJ 3G71I 1VQOI 1YI2I 3CCLI 3CCRI 3CMEI 1VQKI 2K3FA 1FOXA 5JVGF 1QA6A 2H8WA 3CJRB 1WIBA 2QA4I 1YJWI 1VQ4I 3CCQI 3G6EI 4V19K 3PIOF 5DM7F 1YIJI 5DM6F 2OTJI 3J7ZI 2NXNB 3CF5F 1FOYA 2E34A 5GADJ 3I55I 1VQ7I 4IOCF 3CJQB 2JQ7A 2QEXI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CJT B;  3CC7 I;  1YIT I;  3G4S I;  3I56 I;  1VQ6 I;  1VQ9 I;  1YHQ I;  1FOW A;  1S72 I;  2ZJR F;  2OTL I;  1ACI A;  4IO9 F;  1MMS A;  1VQ8 I;  3PIP F;  5GAE J;  2FOW A;  2ZJP F;  3CCE I;  2ZJQ F;  1VQ5 I;  3DLL F;  1HC8 A;  3EGV B;  2E35 A;  3CCS I;  3CJS B;  1VQN I;  3CCJ I;  3CC2 I;  5GAG J;  3CCU I;  1Y39 A;  4UY8 I;  1YJN I;  3CD6 I;  1VQL I;  4IOA F;  5GAH J;  1YJ9 I;  2E36 A;  3CCV I;  1VQP I;  3CMA I;  3CC4 I;  1VQM I;  3CCM I;  3J7Y J;  3G71 I;  1VQO I;  1YI2 I;  3CCL I;  3CCR I;  3CME I;  1VQK I;  2K3F A;  1FOX A;  5JVG F;  1QA6 A;  2H8W A;  3CJR B;  1WIB A;  2QA4 I;  1YJW I;  1VQ4 I;  3CCQ I;  3G6E I;  4V19 K;  3PIO F;  5DM7 F;  1YIJ I;  5DM6 F;  2OTJ I;  3J7Z I;  2NXN B;  3CF5 F;  1FOY A;  2E34 A;  5GAD J;  3I55 I;  1VQ7 I;  4IOC F;  3CJQ B;  2JQ7 A;  2QEX I; 
#chains in the Genus database with same CATH topology
 3W3C A;  3MFK A;  4U7D A;  2GIZ A;  2V6E A;  2EFW A;  2CV0 A;  4AD9 A;  3K9T A;  4O3M A;  5C44 J;  2GA2 A;  2J5O A;  3LWF A;  4IRG A;  1MNE A;  5FO5 A;  1KON A;  1Z67 A;  1XDU A;  1SC7 A;  1D1A A;  2QZ8 A;  4RAF A;  3IH3 A;  2DFI A;  1SVL A;  2CH0 A;  1YHQ I;  3RPU A;  2EFQ A;  3HSF A;  4M9X A;  1JHF A;  4A0X A;  2BOL A;  4LGW A;  2A6T A;  2HGC A;  3TDU C;  1Z6R A;  2HS5 A;  4JX5 A;  1QRY A;  1OMI A;  2Z3Y A;  4G6D A;  1RES A;  3ZN0 A;  4ESF A;  1WGX A;  5J47 A;  3T8T A;  4L5I A;  1FYK A;  2DFE A;  3P5J A;  3CUO A;  2ZCW A;  3E97 A;  5F08 A;  5GAE J;  2GOX B;  4XRF A;  3OYK A;  1JUS A;  2MH2 A;  5A2Q K;  3GBG A;  2CWE A;  5FLX Z;  1RZ4 A;  1QVT A;  2FNP A;  4MQ9 F;  3ASO H;  4DQ2 A;  3JRB A;  4CCM A;  4I6Z A;  4FIS A;  1TWG J;  2PLY A;  2LRD A;  4AVZ A;  4ZJZ A;  2DT6 A;  4CCK A;  2E1C A;  2PEX A;  4EEF G;  3MZ8 A;  3GO5 A;  3MCZ A;  3WTS C;  2O61 A;  2VBZ A;  1A35 A;  2CS3 A;  1U8B A;  1T56 A;  3IWF A;  4FE7 A;  4YEL A;  1ZKG A;  1ZK8 A;  2D2W A;  4OAY A;  4XRS G;  1FSE A;  1LFP A;  1YRN B;  3O8G A;  2LNB A;  3V7S A;  3M4O J;  4XKW A;  2X6O A;  2XV4 S;  2RC4 A;  2ZNZ A;  2CW0 F;  2IT0 A;  2RQQ A;  2EK5 A;  4B3X A;  2Z33 A;  4XOP A;  4HF2 A;  3I4N J;  1WJB A;  2GIV A;  3CO7 C;  3FXM A;  4UVA A;  3JAM Z;  3LA2 A;  2JSP A;  4MTD A;  4A3G J;  1U5T B;  2AHQ A;  3BR1 A;  2XHK A;  4XOT A;  3WGI A;  2HYG D;  1U5T C;  4ENM A;  3BZC A;  3CC4 I;  3CCM I;  2WBM A;  5K7F A;  3H3V K;  2CO5 A;  4CZZ A;  2LH9 A;  1BIB A;  2GLO A;  3CME I;  2DLL A;  1M1E B;  3GWZ A;  3WU0 A;  1D3Y A;  1U78 A;  3W6K B;  3D5L A;  4N0B A;  1YFH A;  1ZLK A;  2L02 A;  1BI3 A;  2EIN H;  3DQV C;  1XCV A;  1R4M B;  2FEZ A;  1BM9 A;  3PL8 A;  3TBI A;  4BAC A;  3FHN A;  4P1W A;  3HUG B;  2CUJ A;  2JA5 J;  4KN7 X;  3S3M A;  2IP2 A;  1JJ6 C;  3AFH A;  4XBF A;  2LK2 A;  4A5N A;  1HQC A;  2LY2 A;  4KFC A;  5DCF A;  4EJO A;  2Z5U A;  3ECO A;  3R4K A;  1G6N A;  3M7G A;  4BY7 J;  1L3L A;  2XGE A;  1N75 A;  1UST A;  1JKR C;  4BJ6 C;  4EM2 A;  2P8T A;  1X4O A;  3KYD B;  1WH7 A;  1REP C;  1A31 A;  5DEQ A;  1SFX A;  3QU3 A;  1MD0 A;  2IA2 A;  3X2Q H;  1BW5 A;  2WV1 A;  5LHH A;  5IY5 H;  1QVU A;  1MBG A;  1X2N A;  3OYL A;  4BE0 A;  5IP9 J;  2OQR A;  3WGH A;  4I01 A;  2DI3 A;  4BE2 A;  1MMA A;  3E5U A;  5D8L B;  2H6C A;  4NDL A;  1QZZ A;  3JCU C;  1X19 A;  4XMY A;  2XAF A;  3SJM A;  2VQC A;  1IRZ A;  2OBP A;  1ITY A;  1GLN A;  1ON1 A;  4MQV A;  5HNF A;  3SZG A;  1LEA A;  2Y30 A;  3HSE A;  1X1D A;  1ZGJ A;  2CQX A;  2FMY A;  2VJJ A;  3A03 A;  1XSX A;  3K69 A;  4YIF A;  5D5W B;  2L7Z A;  3U1D A;  3WHC A;  3CCE I;  1F1Z A;  3OSF A;  3F23 A;  1R4N B;  1PP8 F;  2WA0 A;  2RVC A;  3C2G A;  1V5E A;  3G2B A;  1F4K A;  1YRN A;  3EGV B;  1T6S A;  4XON A;  2NOJ B;  2C6Y A;  5E1X A;  4XSX F;  1XN7 A;  4U7B A;  3OY9 A;  1W36 D;  4HST A;  2PMU A;  3HOT A;  1D8K A;  4EMS A;  3H5A A;  1R5H A;  2I8D A;  1WSU A;  2HI3 A;  3G1M A;  4NNJ A;  2VE8 A;  5IP7 J;  1K7A A;  3K4C A;  1U5T A;  1TWA J;  3FX3 A;  2PMZ A;  3H92 A;  2F5C A;  4JYK A;  3QWL A;  2FA5 A;  1FPQ A;  4LLL A;  2E36 A;  4I09 A;  1WJE A;  2EH3 A;  5A2Q Z;  1T95 A;  2BHZ A;  1T98 A;  2DMU A;  3WTY C;  3HBL A;  2IVM A;  1S3J A;  4ZTF A;  3GTJ J;  1TQM A;  4LLN A;  4ZZD A;  3HOW J;  3GUD A;  3ZP5 A;  1VZ0 A;  3BTJ A;  4ESB A;  3BT9 A;  4AYB A;  1FOX A;  3K70 C;  5JVG F;  3U21 A;  2BBY A;  3DTE A;  3A2K A;  4CYC A;  3HUG A;  3R0A A;  3LAJ A;  2XF5 A;  5JHU A;  1POG A;  4EGY A;  4A12 A;  3L2Q A;  4ASN A;  5CVJ A;  3IHU A;  5EYR A;  2XB0 X;  1LFB A;  3WG7 H;  4BQQ A;  1A5J A;  3RDI A;  4LG0 B;  2VON A;  2ZXI A;  1P4A A;  1TZL A;  4N9H A;  4XR6 A;  5FFX A;  2I5U A;  2YS9 A;  3GFM A;  3KYC B;  3S93 A;  3PFY A;  5ICC A;  3HKZ N;  3S16 J;  3PM1 A;  4HF0 A;  3HGY A;  3D1N I;  1AKH B;  2DA7 A;  3L2V A;  2VIX A;  3FWE A;  3KZI C;  2HXI A;  3ULQ B;  4KDP A;  2AS5 F;  4CUG A;  3OSG A;  2O5R A;  1HST A;  1YOV B;  2KRF A;  3EUK L;  2RNG A;  3BG7 A;  1WI9 A;  1XD7 A;  4BEH B;  3ERM A;  2E5Z A;  4OIQ F;  2L3D A;  2JVG A;  5D8K B;  3J80 K;  1QPM A;  3K4M A;  1R9T J;  1X4P A;  2JTV A;  1R5G A;  3SHF A;  1S9H A;  1HKQ A;  3CP8 A;  1A6Q A;  3ABM H;  3RZO J;  3OYN A;  2DMP A;  1QPI A;  3KP5 A;  2FBH A;  3C2H A;  2UV1 A;  1GT0 C;  4CXF A;  1YW7 A;  1N25 A;  1RPW A;  2KL4 A;  3CCS I;  2R7R A;  3SYT A;  4XRS A;  1PVE A;  1A36 A;  3GFJ A;  5GAG J;  4IHW A;  2M0C A;  4C30 A;  3ELK A;  1PP7 U;  1EKE A;  2OZU A;  2RDP A;  1E17 A;  4LOC A;  2R92 J;  1G2H A;  4YFX F;  2MA3 A;  5IYD J;  4GXO A;  3QP5 A;  1Z3Y A;  2Z2S B;  1HF0 A;  2IA1 A;  3LQR A;  2LF8 A;  4IRI A;  2DT7 B;  3PO2 J;  3ZOB A;  3F22 A;  4IL6 C;  3JRC A;  4HF1 A;  3S15 J;  3T5X A;  1TNT A;  2HKX A;  1W7P B;  3E0J B;  4FE4 A;  2KIS A;  2IRF G;  5J4V A;  4QSH A;  4M6X A;  2H8R A;  1A6I A;  3CF2 A;  4HNT A;  4CCO A;  1LVA A;  2RN7 A;  2Y0M A;  4TV7 A;  1MMD A;  4LG0 A;  2L9S A;  3G6E I;  2E7X A;  4XNF A;  3ONQ A;  3P9C A;  1H89 C;  1SFU A;  1NG6 A;  5L3F A;  1Y8R B;  1X1C A;  3I59 B;  4MNU A;  4P55 A;  1XGS A;  4J01 A;  3RCO A;  4M3D A;  2DA4 A;  1MGT A;  2LY9 A;  2A61 A;  4RM3 A;  4LD5 A;  1T33 A;  2ME0 A;  1TNS A;  1FOY A;  1YYV A;  3FMQ A;  1K6O A;  2STW A;  1MMG A;  4BGD A;  3WHB A;  1O3S A;  2Y75 A;  1T38 A;  3IWZ A;  4II3 A;  1AKH A;  3KFW X;  2VOP A;  3KP3 A;  2VJ5 A;  5GP9 A;  5JLX A;  3VEP A;  2KJC A;  4BQO A;  2VBW A;  4UXN A;  4E7L A;  2EA2 A;  5CLS A;  3V7R A;  2VPR A;  3FBI B;  3JRE A;  2X6W A;  4BEH A;  3PNY A;  5ILU A;  3ZN1 A;  4HDV A;  2BEO A;  5BQT A;  4A3I J;  1JKP C;  4NC6 A;  1BIA A;  2F4O B;  3I71 A;  4KA4 A;  3RKW A;  1TTY A;  2QYO A;  4PSW A;  3PSF A;  2HEO A;  2FML A;  3GLL A;  2XRL A;  2B63 J;  2ELK A;  1OCR H;  1MBK A;  2CQK A;  3F72 A;  5E3M A;  3GZ5 A;  2ID6 A;  2O03 A;  2VC1 A;  4A3B J;  1W4M A;  3Q5F A;  5M5X J;  1U0J A;  1SD5 A;  2BY2 A;  4L18 B;  3A01 B;  2HQR A;  4UUT A;  4ZC3 A;  2MD5 A;  3I58 A;  3IH2 A;  2CW7 A;  1FOK A;  3MWM A;  2DFF A;  2GOM A;  3BR2 A;  2FOK A;  1U8R A;  1NH3 A;  1H9G A;  2KDO A;  2NNY A;  2EB7 A;  2F5V A;  2K5C A;  2PMZ N;  1TT0 A;  3OYE A;  2KP6 A;  2MC4 A;  4HX8 A;  4BE1 A;  2CV2 A;  1IRX A;  2R7T A;  1G3Y A;  3HXL A;  3W2W A;  3HTS B;  1BR2 A;  3ZQC A;  4QLC U;  1CQT A;  1SFK A;  4HV6 A;  3JR9 A;  3KP2 A;  2E5N A;  5HOO A;  5E3O A;  3RI4 A;  2Y0S A;  3VPR A;  3J80 Z;  3WTW C;  1BJZ A;  3MD2 A;  4IOA F;  2GWR A;  5GAH J;  4BY1 J;  2HTJ A;  4CO8 A;  5F0F A;  5HLT A;  1YJ9 I;  2L9N A;  4AYB N;  4BYY A;  3CO6 C;  2NS0 A;  2WAQ A;  1W1W E;  1FTT A;  2NS7 A;  3TO9 A;  3S14 J;  1IN7 A;  1FWZ A;  3L2C A;  4P9F A;  2DJI A;  2F5E A;  3G71 I;  4AIJ A;  2M87 A;  3MAJ A;  1A04 A;  2LOO A;  5LGT A;  3FK7 A;  4R1H A;  2BYV E;  1YG2 A;  2ZME B;  4BUP A;  1Z1D A;  2ZME C;  2ACJ A;  1K78 A;  1FLI A;  5E8I A;  2EA4 A;  3I59 A;  3HRU A;  1SAN A;  4HZF A;  4Q4Z F;  3H0D A;  3BDD A;  2LKX A;  1LDJ A;  2PI0 A;  2CQN A;  4RGS A;  3M1C A;  2V1X A;  1D5Y A;  2M3A A;  4XLC A;  1QHG A;  4PJL A;  3GCM A;  4P5O A;  5GPA A;  2IGK A;  4OAZ A;  5LEJ A;  2AO9 A;  2L4A A;  2DK8 A;  3CJQ B;  3VSL A;  3PO3 J;  2DPD A;  3TOA A;  1KQ8 A;  5KNL A;  2QM3 A;  3DEW A;  3C3W A;  2QQ9 A;  4JBA A;  1RKW A;  3IP4 B;  2P7C B;  3CC7 I;  3KET A;  2NVX J;  5CPR B;  2HQA A;  3PSI A;  4RLQ A;  3VYT B;  2M5W A;  3Q0U A;  3OIO A;  3VOD A;  5L3E A;  3C18 A;  4PSX A;  4MO7 A;  2PQ8 A;  4UV9 A;  4RB2 C;  4M73 A;  4YFN F;  1BW6 A;  4IJA A;  1Z7L A;  1G59 A;  2P5L C;  4D7N A;  2HQN A;  2XDV A;  1DP7 P;  3BR3 A;  3JRG A;  3OYA A;  3A01 A;  1FBU A;  4OIN F;  2J5P A;  2CGP A;  1HCR A;  4C3I J;  3D5S C;  5FRN A;  3FKI J;  2DW4 A;  2AXL A;  1BC7 C;  4DBR A;  1VQ5 I;  3BTI A;  2KMU A;  1UFM A;  3CUQ B;  4XKC A;  4MFE A;  5ICF A;  2EFP A;  2ZXW H;  4AUX A;  2ID3 A;  3CUQ C;  4HNV A;  3AKZ A;  2NVY J;  4LIU A;  2BE5 F;  4HQE A;  4A3L J;  1QZY A;  2E35 A;  4D9J A;  4YFK F;  3GW2 A;  2ECC A;  2DTR A;  2HKO A;  2IGN A;  1IC8 A;  2N8G A;  3S1Q J;  2YR2 A;  1MIJ A;  2PBI A;  1SFE A;  2V9P A;  1W5S A;  5E8G A;  3IC7 A;  3GTQ J;  3IRQ A;  3BPV A;  3W6J B;  3H5N A;  4F93 B;  2CUZ A;  3CCV I;  2H94 A;  4FET A;  1IN6 A;  5M5W J;  3LSG A;  3QU6 A;  2ZME A;  2HDW A;  2P6S A;  3ABK H;  4UVB A;  3QPH A;  1VQO I;  1AA7 A;  3S1M J;  4Y13 A;  2DOD A;  1B9M A;  1VQK I;  4MGR A;  5EEA A;  2O9L A;  2VPL A;  1BOB A;  2L7F P;  2EFO A;  2JPC A;  3JSP A;  4EJT A;  5D4R A;  4M72 A;  1I39 A;  2A3S A;  1JKO C;  1V4R A;  3OYI A;  1RRJ A;  2IPQ X;  2OZ6 A;  2ZB9 A;  2ZXH A;  3N05 A;  1JTY A;  1DGW Y;  3FXU A;  3GVA A;  5DDG A;  1UHW A;  5F64 A;  1E3P A;  3A4C A;  3LSI A;  4KIG A;  4WXD A;  2VQH A;  1G8X A;  3DTI A;  3F0C A;  1MBH A;  3DEU A;  3FIW A;  5HLI A;  3KEQ A;  3L2R A;  1Z05 A;  1TWF J;  2M8G X;  2LTP A;  3PUF A;  5F1R A;  5E1Z B;  2ECB A;  2MGQ A;  4C2T A;  1JTX A;  3K0L A;  1WH5 A;  1B8I A;  1J75 A;  3CLO A;  5L3D A;  3PJR A;  3RYR A;  2E1N A;  1NTC A;  1RI7 A;  1HW5 A;  3WE2 A;  3QP6 A;  1HA8 A;  4ZDO A;  2EJR A;  2K7L A;  3HHH A;  4XLF A;  2WY7 Q;  3FXQ A;  4F92 B;  4P9U A;  2IW5 A;  5AIP A;  3MKY B;  2G7U A;  3MN2 A;  2FBI A;  1PUF B;  2P0W A;  5IP6 A;  1E2X A;  3KYL A;  2MYS A;  3QOE A;  3ZR8 X;  2M4G A;  2ZSI B;  1D1C A;  3SZT A;  5EEG A;  5JI6 A;  2CG4 A;  2OD5 A;  3I54 A;  4JQF A;  4IQ4 A;  5LLQ A;  4BL0 B;  2GXA A;  1ZH5 A;  4CCL A;  4G8X A;  1TP4 A;  2V6C A;  5L3G A;  3H9G A;  3TO7 A;  1PUE E;  5M5Y J;  4EM0 B;  3DEE A;  1ZQ3 P;  4GFB A;  4ABZ A;  2ELJ A;  2W1O A;  2X1C A;  4BQA A;  3CUQ A;  2TRT A;  4A3K J;  1VQ8 I;  1I6H J;  2HVS A;  1J5Y A;  3MQ0 A;  5HDG A;  2W24 A;  2R5Z A;  1SAU A;  2ZJQ F;  1MJ9 A;  3PUB A;  2O6G E;  2DOF A;  5GPC A;  5IYC J;  4S05 A;  1S7O A;  1ZR2 A;  2LDU A;  4HLY A;  1ETW A;  3ISP A;  2F5D A;  1YS7 A;  4LLG F;  3DV8 A;  3VYR B;  4EM1 A;  2V1U A;  1R7J A;  2Y0S N;  3S32 A;  1O7L A;  2ZFW A;  1Z7U A;  3HOV J;  2RKH A;  1H9T A;  1BJA A;  3K1P A;  3FKJ A;  1X58 A;  3CD6 I;  2WAQ N;  2K86 A;  1XGN A;  3OOP A;  2LLK A;  1GHC A;  1D0Z A;  2CYY A;  4OIR F;  4ENK A;  2LBF A;  3E6C C;  2R5Y B;  1O7F A;  2ZC2 A;  4LK0 F;  1WQ2 A;  3H36 A;  3CMA I;  3LSH A;  2R7W A;  1XTA A;  3BC8 A;  4N4O B;  3GTL J;  4B47 A;  4H0E A;  5JFR A;  4G6Q A;  3C2B A;  1RR7 A;  5ICG A;  1LDD A;  2M9H A;  2QKM B;  2QCO A;  1I5Z A;  3LSP A;  4KN4 X;  2XIG A;  1J09 A;  2CQQ A;  1U3E M;  1S7E A;  4UUS A;  4BBR J;  2V4J C;  5F0H A;  3W2V A;  2R7F A;  3F21 A;  2ZBK A;  3VFZ A;  4IX7 A;  5DTD A;  1E3H A;  1JUM A;  4V19 K;  5BMZ A;  5J6X A;  2QWW A;  2ZO4 A;  1IO2 A;  5DM7 F;  2V1D A;  4OMZ A;  1B6A A;  3KZZ A;  3H1C A;  3TW7 A;  2KRC A;  2W84 A;  1R58 A;  3ECH A;  3CCY A;  2DOA A;  3AG1 H;  3JSO A;  2EIL H;  1XCB A;  2Y2Z A;  4RGU A;  2L9V A;  1KGS A;  4BHB A;  2ELH A;  2W4S A;  3ZMD A;  1TQI A;  2UZK A;  1I3Q J;  5AON A;  2FD5 A;  5DUI A;  1PUF A;  5FKO A;  1SVO A;  2LF7 A;  5D4S A;  4II2 A;  4D0P A;  2CRG A;  3OYF A;  1HW2 A;  4AM3 A;  5AIQ A;  1HOM A;  3GX4 X;  2QSH X;  2DA5 A;  4EGZ A;  1ZLJ A;  1U6G A;  2DA2 A;  2O8K A;  2EV0 A;  3WTU C;  4HPQ A;  2IGM A;  3NWT A;  4AIH A;  3E6M A;  1SAX A;  1MBF A;  1MKM A;  1ON2 A;  3O2P E;  5FB2 A;  5EGO A;  2IGO A;  1IN4 A;  3L1P A;  3BG6 A;  4M9Z A;  2XAH A;  4BKX A;  1NK3 P;  3FMR A;  1Z91 A;  2LSO A;  1MMS A;  2CUE A;  4FQG A;  3OYG A;  1D5V A;  2PFB A;  2NVT J;  1BN5 A;  3BZK A;  3O6B B;  2Y9Z A;  4IZZ A;  1OIS A;  4OIO F;  4P96 A;  2WY8 Q;  4LMY A;  3RKY A;  1P7I A;  2HFH A;  3OOU A;  3HOX J;  4IHS A;  3DLL F;  2MBF A;  3H0G J;  2VJI A;  1B72 B;  1JXS A;  2OUM A;  1G4D A;  5HDK A;  3F8C A;  2QQB A;  2W82 A;  2CV1 A;  5DUK A;  1IN5 A;  1YX5 A;  4XLA A;  4UV8 A;  3JRI A;  3K70 D;  3ABL H;  4FAS D;  2Y48 A;  4QPQ A;  1HKS A;  4PFP A;  2DK5 A;  4WX9 A;  4B09 A;  2HDC A;  1P92 A;  2Z16 A;  4BS9 A;  1WPK A;  3HSR A;  1LPQ A;  3DKX A;  2COB A;  1BL0 A;  5HS9 A;  1B59 A;  2EZI A;  2IJL A;  4LG3 A;  4YEJ A;  2VBX A;  3IV5 A;  3LSJ A;  3KLO A;  3CMM A;  1HW1 A;  3IAM 2;  2QBY B;  4CZC A;  5B5E C;  3A0B C;  1X1B A;  5H6Q A;  5CVR A;  2K3F A;  5JLW A;  2DOE A;  1Z77 A;  4PJJ A;  1FSH A;  2EIM H;  5ICE A;  3ZMU A;  1EV7 A;  3VSK A;  1T0F C;  4J00 A;  3GTP J;  1MJB A;  2VKH A;  4M74 A;  4A0Y A;  4PCQ A;  1IDY A;  2OA4 A;  5HNH A;  3R6S A;  2DDA A;  5DM6 F;  1Y0N A;  4U87 A;  2KQR A;  3SXY A;  3HHG A;  3HOY J;  4ON0 A;  1WKM A;  2V9K A;  3BJA A;  1KZH A;  1IXS B;  1J59 A;  5DD8 A;  3DLA A;  3B02 A;  2ZJ2 A;  3BWG A;  5FRO A;  2HVR A;  3FXO A;  2VOO A;  3BOQ A;  1WJF A;  5F6F A;  5H20 A;  1FEX A;  4IF4 A;  2MH9 A;  2M7B A;  3PQJ A;  2M4K A;  5HLG A;  3D5R C;  2EIK H;  1MND A;  2QLZ A;  5BS6 A;  9ANT A;  3U1K A;  5K7Z A;  2E1O A;  4KMU X;  3CQZ J;  4OWR B;  3GZN B;  3RSN A;  2A07 F;  3ESW B;  4ANJ A;  4KMF A;  1UHM A;  3ZQG A;  4C3H J;  2JK3 A;  4YRV A;  4ITV A;  4F55 A;  2NOG A;  4PGH A;  2WAF A;  4HV5 A;  1UG2 A;  2FNA A;  2WV0 A;  1LDK B;  4I2O A;  3BLY A;  1IGN A;  4Y3O A;  4F52 A;  3W6V A;  2HYJ A;  1FP2 A;  5LRS A;  2IXS A;  3R0J A;  4FCY A;  1ZGA A;  2QKL B;  3KP6 A;  4B48 A;  2Q2E B;  1IRG A;  3QYB A;  4OMY A;  1OKR A;  4IPA A;  3NQO A;  1OYY A;  1JHH A;  4X0G A;  3ZCO A;  2DXI A;  4XN3 A;  3OYB A;  1IUF A;  3PNT A;  2BW3 B;  1Y1W J;  3N97 A;  1SD4 A;  1X1A A;  1W7P D;  3B73 A;  3K4L A;  3CCJ I;  3BG3 A;  1DU6 A;  3SQN A;  1K61 A;  2X51 A;  4UY8 I;  1OCP A;  4R79 A;  2BXZ A;  2OCE A;  2Q0O A;  4DW6 A;  3I5U A;  4HEA 2;  4G7Z F;  1QZE A;  2MLK A;  3S2D J;  3EUH C;  4PZJ A;  2NVU B;  2GXB A;  2A6H F;  1FY7 A;  2NNN A;  4RM2 A;  3I9V 2;  1YX3 A;  2EWN A;  1B1B A;  5IOZ A;  4EJW A;  1WJC A;  4RB0 A;  4KUM A;  4JOM A;  3S3O A;  4NUB A;  2EBI A;  2K27 A;  3G73 A;  3BG5 A;  4U88 A;  4H4K C;  1KU7 A;  5FJ8 J;  1TWH J;  5H6R A;  2WAE A;  2MAB A;  4B1R A;  1EJ9 A;  1QO0 D;  3Q9V A;  1OYW A;  2XGX A;  2E2J J;  3ZXS A;  5J1R A;  1YJW I;  2VUM J;  2MG4 A;  1TW3 A;  3TOB A;  1YQA A;  4DBQ A;  2CFX A;  3OS1 A;  4A6E A;  2L01 A;  2BXY A;  1GXQ A;  1YIO A;  4HOB A;  4HX4 A;  1RET A;  4PJM A;  4BQN A;  3HOZ J;  1FIP A;  3J7Z I;  3AG2 H;  3TQN A;  4L5J A;  2L54 A;  5IT3 A;  2Q1Z B;  3F9K A;  2JA7 J;  3BP8 A;  2VJ4 A;  5CVI A;  1K6Y A;  4IOC F;  3K4N A;  2R0Q C;  2B0L A;  4L5E A;  3BQZ A;  2CUF A;  3ASN H;  5HS7 A;  4MHG A;  4UVC A;  1JGG A;  2FXA A;  1J7K A;  1KYW A;  4I0B A;  3HM5 A;  3OYH A;  2FUG 2;  2LRE A;  2V1N A;  4F3Q A;  2W48 A;  1TLH B;  3GEZ A;  4HQM A;  5E18 F;  3Q0V A;  4HSR A;  2OCC H;  3S17 J;  3SFZ A;  5GTI C;  3H3Z A;  4X6A J;  3IL2 A;  2IA0 A;  1AOY A;  4FHT A;  3S1N J;  1XG1 A;  2XB5 A;  3F8B A;  3DU6 A;  2KZG A;  1ACI A;  4I7H A;  3OV8 A;  4ZYD A;  4WK8 F;  5FKL A;  3HIF A;  3L9F A;  2XAQ A;  2A05 A;  1BA5 A;  1BOA A;  3RKX A;  2RAE A;  2FX0 A;  3V42 A;  1STZ A;  3T1B A;  1I1G A;  1S5L C;  3J81 K;  4KJZ A;  4PDK A;  1P9Q C;  3P7N A;  1Z21 A;  5EG0 B;  3ABU A;  1V5G A;  3NAU A;  3UKG A;  2X4H A;  1EA3 A;  1IV6 A;  2VXZ A;  4HYE A;  5K1Y A;  1VQN I;  4GCV A;  5C4J J;  2O8X A;  1T08 B;  4HG2 A;  1LQ1 A;  3EUH A;  4V2G A;  1GVJ A;  4F91 B;  2YU3 A;  2XUB A;  2XF6 A;  2IS2 A;  4Z6Y A;  2XAS A;  4C3J J;  2X6X A;  1TT5 B;  3G1O A;  2QSF X;  2K9Q A;  1PDN C;  3K4B A;  3K1N A;  2WTE A;  3K10 A;  4MEX F;  4Y15 A;  4B3A A;  1OFC X;  3IRR A;  4IRH A;  3DU5 A;  3F8M A;  5CJ9 A;  4ZYG A;  5FFZ A;  4CGZ A;  3NEU A;  4M71 A;  2DJN A;  3J7A O;  3CCL I;  1KQ9 A;  2LKP A;  3V4G A;  5IOY A;  1D8J A;  4A3J J;  3A02 A;  4KT5 C;  3DF8 A;  5TGT A;  4KIF A;  4A2U A;  2XSD C;  5CKT A;  5TJJ A;  1QU3 A;  2QA4 I;  4NC7 A;  3KEY A;  1XSV A;  2BZT A;  1VQ4 I;  2BY3 A;  4LIT A;  5F1J A;  1FBQ A;  2Z1D A;  3BTL A;  3PIO F;  3OYM A;  4UUV A;  1UJ8 A;  5HDN A;  1ZR4 A;  1W7P A;  2YSR A;  2Z99 A;  2M34 A;  4WWC A;  2K02 A;  2ISY A;  4LFU A;  3D0S A;  5TIS C;  1MSE C;  3CF5 F;  2K85 A;  2HPM A;  4HNU A;  2QQA A;  1UG0 A;  4XLH A;  1JT6 A;  1VQ7 I;  3FXJ A;  1FNN A;  1Y1V J;  5C3E J;  2QSG X;  1MJA A;  2VKV A;  1FTZ A;  2XC7 A;  3BR5 A;  2QF7 A;  3TED A;  3O8H A;  3GTG J;  5FKN A;  2W85 A;  3KCC A;  1UMQ A;  1R22 A;  4PJ0 C;  5JVT A;  4I99 C;  3MZY A;  2STT A;  3V8J A;  3U2R A;  1ERD A;  5BOX A;  5F04 A;  1VQ6 I;  1I6X A;  3E5X A;  3OIP A;  1ZG1 A;  3PFI A;  2PJP A;  2K3P A;  2DA1 A;  1EF4 A;  3F6O A;  3HEF A;  5C4X J;  4JK1 X;  3HZJ A;  4RB1 A;  1QGP A;  3WOD F;  4RGX A;  1TL8 A;  2LD5 A;  2DA3 A;  2RRE A;  3JTH A;  3Q9S A;  3E6D A;  3DXJ F;  2VAS A;  2EZK A;  3KPH A;  4GGG A;  5EG0 A;  2JUG A;  4EV0 A;  2B7E A;  1OCC H;  1ZRF A;  4E7K A;  3S2W A;  4Z2Y A;  1IXR C;  3HGG A;  1SFO J;  2CMP A;  2OF7 A;  3FM5 A;  1SD6 A;  2K9N A;  1IN8 A;  2KZV A;  2UWM A;  5CVU A;  3QOP A;  3HG9 A;  1BI0 A;  2CQ7 A;  1DDN A;  1QBJ A;  4QIW N;  3LMM A;  5LHI A;  4BXF A;  5E1W A;  3DCF A;  5DYM A;  1G3W A;  2KDZ A;  3DBH B;  1YJN I;  1BC8 C;  2CSO A;  3FF5 A;  3BR6 A;  1O4X A;  2BY0 A;  5ERI A;  1B9N A;  3WTT C;  4MIM A;  3S2H J;  3IKV A;  4O5V A;  1GUU A;  3B6C A;  2A5W A;  3MMY B;  4KIT B;  2FU4 A;  1ETO A;  1K79 A;  5FKK A;  2P6T A;  1IW7 F;  2K9M A;  1LE8 B;  2IS1 A;  1WWX A;  3EQL F;  5K7H A;  2E2I J;  2D1H A;  2H6B A;  2KIM A;  3DKW A;  2ESN A;  5FD6 A;  1S6L A;  1DP3 A;  1F36 A;  4CYD A;  3CZ6 A;  5IYB J;  3J81 Z;  3FXR A;  1X3Z B;  3AL0 B;  3BRO A;  1VFC A;  2WWY A;  3AL0 C;  3ZMZ A;  1F43 A;  2E2H J;  4UNO A;  2NS8 A;  1ZAO A;  2H8W A;  5DD4 A;  3VB2 A;  3ZQI A;  2AXT C;  2HVQ A;  1ODD A;  4NC8 A;  1XPX A;  5FLX K;  1UZC A;  2X48 A;  3GXO A;  5KVR A;  2UXN A;  2YUS A;  1DPU A;  4WF2 A;  1AWC A;  2YX7 A;  5ED4 A;  2XAU A;  5J3L A;  1KA8 A;  2OQG A;  3IKT A;  3RTR A;  3GFL A;  2LFB A;  4U0Y A;  3HRT A;  5FLM J;  1X2M A;  2PN6 A;  2OC6 A;  2EFN A;  1V5F A;  2M30 A;  4M3E A;  4BXU A;  1O3T A;  3LA3 A;  2M1B A;  3M8J A;  1U9O A;  2R7O A;  2JQ7 A;  3QRF F;  1FT9 A;  2ZXJ A;  2H1L A;  1LB2 A;  4Q5S F;  5ILV A;  1LJ9 A;  1BR1 A;  3Q0W A;  5B1A H;  1WCM J;  4E6K G;  4A3M J;  3QAH A;  2V7F A;  1YLF A;  3T0Y A;  2V26 A;  2GBY A;  4U0V A;  1YW9 A;  1DQU A;  2R3S A;  2BY1 A;  2VT2 A;  1P4X A;  3C7J A;  2BHY A;  3TMO A;  3TP3 A;  4G94 A;  1KU2 A;  2X1D A;  2D1V A;  4A93 J;  3PQK A;  3ZMS A;  3DWL E;  4W1U A;  2XF7 A;  1WRJ A;  3LST A;  2LVS A;  3JTG A;  2JPB A;  2H27 A;  2E1M B;  4GYI A;  2E1M C;  4XKV A;  3GYH X;  1X1P A;  5DV5 A;  5GTH C;  4A0Z A;  3KE2 A;  4L9N A;  2HXO A;  2KIF A;  3F3X A;  4XID A;  4G12 A;  3FHZ A;  2KJB A;  3DFG A;  2HOS A;  3BJ6 A;  5CYV A;  1R5I D;  2A69 F;  3M9A A;  2DTZ A;  1FJL A;  1P6R A;  2F2E A;  3QQA A;  4CCJ A;  2ZJP F;  1LFU P;  3EYI A;  2KRH A;  2FF4 A;  2VB6 A;  3L09 A;  4Y7N J;  4KNY A;  2DO7 A;  1T8I A;  3FZV A;  4PFO A;  3HPG A;  3L2W A;  3CJS B;  2YX4 A;  4C9Y A;  3RJP A;  3MZH A;  3GTK J;  1Z6T A;  2R93 J;  2DCE A;  3VDX A;  3K1M A;  4UB8 C;  1VQL I;  1LE8 A;  1TC3 C;  2DA6 A;  4BDY A;  1HSJ A;  3JRA A;  1ZRE A;  1RKT A;  1WI3 A;  5LFA A;  4G7H F;  5KCM A;  1YW8 A;  1I50 J;  2EV5 A;  3LA7 A;  1R6R A;  3QYE A;  2XRO A;  3HTU A;  1MDM B;  4A3F J;  3CDL A;  4RB3 C;  1LKX A;  4Q48 A;  4E7H A;  2R7V A;  1XDS A;  1LUJ B;  4BH9 A;  1ENH A;  4B43 A;  4CCN A;  4EJU A;  3BPX A;  4AID A;  2VE9 A;  1JGS A;  3HRS A;  1R36 A;  4A6D A;  4DNC A;  1H0M A;  3LSR A;  5HOD A;  1KU9 A;  1N77 A;  2JT1 A;  1X3W B;  2VL8 A;  4QPO A;  4IHX A;  1KQ0 A;  3ZQH A;  3WTV C;  4ENN A;  2LG4 A;  2ICW G;  3BCB A;  4BJ5 C;  3JW4 A;  2L7M P;  2DMT A;  4A3C J;  1R71 A;  1I3A A;  3RQI A;  3S1R J;  5DCM B;  1JT0 A;  1VND A;  3HKZ A;  3GLX A;  2Y69 H;  4IEJ A;  3MKW B;  3OWT A;  5GAD J;  1PYV A;  5K5R A;  3LL7 A;  2HOA A;  1LVK A;  3KP4 A;  3HB9 A;  5J1Y A;  3V7C A;  1WFX A;  1IUY A;  2QGU A;  4WCG A;  4OU0 A;  2NVQ J;  3ABT A;  3CJT B;  3E7L A;  4D7M A;  4E4H A;  4UB6 C;  2NAZ A;  2HU9 A;  2HZT A;  1F9N A;  3CDH A;  1K4T A;  2F48 A;  2TDX A;  4HBL A;  2V79 A;  4JP0 A;  4HX7 A;  3CTA A;  5H2F C;  2KHM A;  2X85 A;  3KEO A;  3QPS A;  5LD2 C;  3WTX C;  4BXX J;  1RUN A;  4BNC A;  1KYZ A;  2KIU A;  4S0H B;  4AU7 A;  1DU0 A;  2JWT A;  4NHJ A;  3KLN A;  4MLO A;  4XLP F;  2XKO A;  1V3F A;  2DT5 A;  2VOD A;  1G3T A;  2XPU A;  4ETS A;  1Y56 A;  3DP7 A;  3OR1 C;  4RAZ A;  1IV8 A;  5B1B H;  1MW7 A;  2RNJ A;  1FX7 A;  3B6A A;  5ILS A;  3HDD A;  1NG7 A;  1N78 A;  4XKB A;  2F4I A;  5FKM A;  3TL4 X;  4D5F A;  1ZRC A;  3OR2 C;  3TW6 A;  1TQP A;  2NYX A;  2FRH A;  4BDZ A;  2LR8 A;  3CJN A;  3RPQ A;  4E7Z A;  3V8K A;  4AC0 A;  3ML6 A;  4DZP A;  2D5V A;  2E71 A;  1MDM A;  2L2O A;  2XRN A;  2IBD A;  2Z9O A;  3ROU A;  2QUF A;  4HDU A;  1TW2 A;  1AHD P;  1EH6 A;  4CYC B;  1UEL B;  1LNW A;  3MVP A;  5EJC A;  1U2W A;  3OYJ A;  4DZJ A;  1ZEL A;  3L7W A;  2PMH A;  1YI2 I;  3E3V A;  3CCR I;  1Z0X A;  4DGW B;  2O7O A;  3CMY A;  1ZGW A;  1U9N A;  3HOU J;  2P4W A;  4PUS A;  1ZN2 A;  5F27 A;  1QA6 A;  3TGN A;  3I53 A;  4M9S A;  1J9I A;  5HLH A;  4FX4 A;  2O3F A;  2R5Y A;  1WJ5 A;  3W2A A;  3SZP A;  5DCM A;  1AU7 A;  1MNM C;  3CLQ A;  2P7V B;  1MBJ A;  1G3S A;  3ZGK A;  1P2F A;  3DPT A;  3WE3 A;  1DPR A;  4R8H A;  4IXA A;  4S04 A;  1B4A A;  1XS9 A;  4XRM A;  4G6T B;  2D45 A;  4E7J A;  4XLN F;  3H5R A;  3HOS A;  2LMD A;  2OTJ I;  2BGC A;  5D5X B;  1YO5 C;  5EDN A;  2OJE D;  3DPL C;  2G7H A;  2F6C A;  4NBQ A;  4B44 A;  4PJN A;  3WGG A;  1SEU A;  5IT9 K;  4AWX B;  4RMN A;  3VYS B;  3JRF A;  4KIC A;  2Y9Y A;  2OV7 A;  2QVO A;  2VQL A;  4M6V A;  2HOT A;  4XOR A;  2GZW A;  4W97 A;  2H09 A;  4L9T A;  1R49 A;  4YG2 F;  3G4S I;  1WVR A;  3UNG C;  5M3M J;  2YU9 J;  2M45 A;  4ZTJ A;  1RNL A;  3P9K A;  1Z3X A;  4QWQ A;  5D5V B;  5E20 A;  2GA1 A;  3R61 A;  2FJ1 A;  3ZPL A;  3ZRG A;  5EF6 A;  2RV8 A;  3LSM A;  4CIC A;  5CQE A;  3M07 A;  1S72 I;  2OTL I;  1C0W A;  3A0H C;  3WTZ A;  2DMQ A;  2VKE A;  4MEY F;  4D1Q A;  1EH7 A;  3ZQF A;  2K4J A;  2R7Z J;  6PAX A;  2CW8 A;  4LJZ F;  4DOZ A;  1CF7 B;  2JRT A;  1JI8 A;  1R1T A;  3OYD A;  1ZRD A;  1EH8 A;  1FC3 A;  1XGM A;  5D6F A;  2DBB A;  2WC2 A;  4XM3 A;  1QQI A;  3GTO J;  2IS4 A;  1LEB A;  1DGR M;  3O3K A;  1D0Y A;  3S8P A;  5E3N A;  2G9W A;  1BR4 A;  3KX2 A;  3TDZ C;  2XGD A;  2B9S A;  3CC2 I;  5B66 C;  4KYW A;  5L3B A;  2M0M A;  3E6B A;  4A69 C;  1Y39 A;  3SDB A;  2CU7 A;  3NRV A;  4X1E A;  3HYI A;  4BHP A;  1MZB A;  5J8F A;  4GO1 A;  3TKY A;  2JRM A;  5KHD A;  2L9R A;  2OAZ A;  1J0R A;  4O6J A;  1ZG3 A;  4ZYE A;  1B72 A;  3SEZ A;  1MSF C;  2MD0 A;  3PNV A;  1HKT A;  3T8R A;  1FP1 D;  2GXG A;  1OCT C;  3J7Y J;  2DU9 A;  1RUO A;  2KT0 A;  2ESH A;  4XQF A;  3MEX A;  2GM4 A;  4MTE A;  1W36 C;  2VT3 A;  2IEK A;  2ZNY A;  2JUC A;  3NWS A;  4MFD A;  3DBL B;  3LSK A;  4IQJ A;  4IKF A;  2VC0 A;  4CSW A;  4N4N B;  4Y52 J;  3L2U A;  2W57 A;  3WU1 B;  3REO A;  1IJW C;  3LFK A;  4E7S A;  1IZ1 A;  2EZH A;  3FK6 A;  4EJV A;  2ADU A;  5FLV A;  1O57 A;  4A3D J;  4ZYA A;  1YIJ I;  2IS6 A;  3E5Q A;  3QPT A;  2DYS H;  1ETK A;  2QBY A;  1XMX A;  2PG4 A;  4UHT A;  3G1L A;  2NXN B;  2LC2 A;  4I76 A;  3FIS A;  1GXP A;  1ZHF A;  3IH4 A;  1T0F A;  3I55 I;  1H8A C;  3OYC A;  2EIJ H;  2JA6 J;  4E7I A;  3SEQ A;  5E17 F;  2CFO A;  2FBK A;  4LB6 B;  1BI2 A;  1WZ2 A;  2VKD A;  1V55 H;  1OYI A;  2OU2 A;  3FBN B;  4ZZL A;  4A5M A;  4ESJ A;  1BI1 A;  4YIR X;  3OS0 A;  4RBO A;  1FMV A;  3EET A;  3LOC A;  1I1S A;  2M2E A;  2VI6 A;  1QHH D;  2JA8 J;  1IAW A;  4I0A A;  2ME6 A;  2A6E F;  1S29 A;  3UR3 C;  3EDP A;  4G7O F;  5D5U B;  2VXD A;  2R7X A;  1VQ9 I;  3BR0 A;  3K6G A;  4LB5 A;  1IF1 A;  2DYR H;  3HJE A;  2ZJR F;  1CF7 A;  3CES A;  2COM A;  2F5F A;  5DS9 A;  4HLX A;  1YE9 A;  4KIS A;  1FBS A;  5CVV A;  2MFZ A;  2VN2 A;  4M3F A;  5IPA A;  2R7D A;  3EPZ A;  4GRI A;  5HVQ C;  3AAF A;  5IT9 Z;  3AG4 H;  4BU2 A;  2FOW A;  2HZD A;  1HBX G;  5KK1 A;  2X9D A;  3L00 A;  1FYM A;  3EYY A;  3MKZ A;  1SD7 A;  3RQ4 A;  2JZY A;  1JUP A;  1RR8 C;  1UHS A;  4ZDL A;  5LEK A;  5EEH A;  3RIR A;  4CH7 A;  4YII A;  2Q8K A;  1XSD A;  1IG7 A;  1KU3 A;  3OIQ A;  4C2U A;  3CCU I;  3LQQ A;  2CJJ A;  2P5K A;  4WXC A;  5BNG A;  4HW0 A;  2Q2E A;  5L3C A;  1UCR A;  1ONV A;  1Q1H A;  2W25 A;  4XSZ F;  3BJO A;  4ZDP A;  3K2A A;  1K78 B;  1W0T A;  3HPH A;  5LBQ A;  2PJR B;  3FXL A;  2L5Q A;  2BW3 A;  2KLO A;  2W00 A;  3FXK A;  2A5Y B;  4JX6 A;  3LFU A;  2LKS A;  2RGV A;  1MBE A;  1OR7 C;  2X6Y A;  4NQW B;  4CDG A;  1XGO A;  5M3F J;  5F0C A;  1I27 A;  3VYU B;  2WAD A;  3MKL A;  2JMW A;  2GQQ A;  5FRM A;  3H35 A;  4GDF A;  1GV5 A;  3OMY A;  3RYP A;  1MH4 A;  1XMK A;  3NAR A;  3GTM J;  2HR3 A;  4N9I A;  1S7A A;  4RDU A;  4RS8 A;  1WIB A;  1NK2 P;  3ZQL A;  3P9I A;  4AIK A;  5BPI A;  5FD5 A;  3DKY A;  4IHV A;  3SFI A;  3ZQQ A;  1WJA A;  4XLE A;  3VOE A;  2DDB A;  1JJ8 C;  2KIQ A;  1HLV A;  2F4M B;  1ULY A;  4QTR A;  2R7Q A;  1TWC J;  1K83 J;  4DYR A;  2PX9 A;  5J4Y A;  2XAG A;  5J40 A;  1S8N A;  2XPV A;  1OJL A;  2I10 A;  2O0Y A;  1R00 A;  5KAF C;  4V2F A;  4KT6 A;  2Y31 A;  5E3L A;  1Q1V A;  2R7U A;  1RC9 A;  3BQY A;  4EVI A;  2HPI A;  2ISZ A;  2OPT A;  1PJR A;  1NHA A;  3FDY A;  2X0L A;  1YS6 A;  2UXX A;  3CDI A;  3ZQ7 A;  5LGN A;  2RQP A;  3BG9 A;  2EPF A;  4RLF A;  5D6E A;  1MH3 A;  1ZYR F;  3IUO A;  3M1E A;  2XSJ C;  2WB1 A;  4XK4 A;  3I3L A;  3CP2 A;  1YIT I;  3DTK A;  1QNT A;  1VF9 A;  2KPM A;  3EUA A;  4LIV A;  3I56 I;  1L0O C;  1ZTR A;  1O3R A;  3QPL A;  4M3G A;  2HWV A;  1BBY A;  1FOW A;  4K2E A;  5J1U A;  1XB4 A;  1TBX A;  1YTY A;  4M3B A;  4JX4 A;  5K5O A;  4RGR A;  1SMT A;  3BZ6 A;  1K4S A;  1ETQ A;  2ZKZ A;  2GAU A;  1OCZ H;  2R4G A;  2L0K A;  1HXD A;  5LRR A;  2HTS A;  4DYC A;  3KP7 A;  3I64 A;  1OLT A;  2DFH A;  4XL9 A;  1R23 A;  2M8E A;  2LP0 A;  2M7A A;  4Q47 A;  3U9G A;  3BY6 A;  2K9L A;  4Y17 A;  2MSY A;  2YPR A;  4C2M J;  3S3N A;  1HC8 A;  4Y4R A;  3K4J A;  1CGP A;  4CHU A;  3BCA A;  4RAY A;  4L0Y B;  2FQ3 A;  3LAP A;  1R1U A;  3TO6 A;  2PJR A;  2FE3 A;  4ZYH A;  4IHY A;  4LK1 F;  3IAS 2;  1X3U A;  3M8E A;  4FX0 A;  3G3Z A;  1OR7 A;  4NQW A;  4EAT A;  4HA8 A;  2DN0 A;  4ZH4 F;  2HQ5 A;  2G0E A;  1F5T A;  5LGU A;  1WJD A;  3COA C;  3KZY A;  1ZG5 A;  1ETY A;  4PGG A;  4B8X A;  4BBS J;  2V9V A;  4G9Y A;  4XIC A;  2DPU A;  2VBY A;  2XPW A;  4HAM A;  1FZP B;  3OL3 A;  1IXC A;  3GF2 A;  1ORK A;  3OL4 A;  2X1E A;  3M3Y J;  5JR3 A;  1FMW A;  4L0Z B;  1V54 H;  3VWB A;  2XAJ A;  5EZH A;  5LHG A;  3H9J A;  1ETX A;  1OQY A;  3CJR B;  1T2K A;  3HC7 A;  1T39 A;  3RPU D;  4IVN A;  3RKQ A;  2MC3 A;  3CCQ I;  1B8I B;  2VLA A;  4B4C A;  3I4P A;  5TRD A;  2QQ8 A;  4M6Y A;  2KFD A;  2A68 F;  1D0X A;  2HOE A;  1FYL A;  2EV6 A;  5KAI C;  3K7A J;  1GDT A;  4RAG A;  3H3U A;  2EQR A;  4I98 B;  4U0W A;  3HRM A;  3K4K A;  2XGC A;  4EQQ A;  1E0E A;  2K9S A;  3DPU A;  4L9V A;  4BHC A;  1USS A;  3OS2 A;  3BTC A;  2XKP A;  3AG3 H;  3F8F A;  2JN6 A;  4NB5 A;  3I0T A;  4FT8 A;  3K2Z A;  1W5C C;  2ZFU A;  3FM3 A;  1VI0 A;  2HNH A;  2LY1 A;  1JKQ C;  1W5T A;  2QEN A;  3FMS A;  4RA2 A;  4DJA A;  1RIO H;  5FGM A;  4GYG A;  2AQF A;  1UB9 A;  2R5Z B;  2HDD A;  5JHF A;  1OCO H;  1Y6I A;  1ETV A;  3RZD J;  1DUX C;  1ZAR A;  4F7Z A;  3WU2 C;  5J8C A;  1IRF A;  2LYC A;  2JVH A;  2MW8 A;  4E70 A;  2L7K A;  4IO9 F;  3GFI A;  1Y0U A;  2BV6 A;  4AVP A;  3PIP F;  3JAM K;  1HDD C;  3A1Y A;  3SDG A;  2TCT A;  4HRI A;  1MMN A;  2W7N A;  2MLG A;  3JRH A;  4KIB A;  3Q3S A;  3M8F A;  2IAI A;  2UUZ A;  3N4M A;  5HS8 A;  3TP0 A;  2LBF B;  1APL C;  4BJT A;  2E7W A;  4DYQ A;  2BVM A;  2E60 A;  3KIO A;  2K40 A;  5CQG A;  2FQ4 A;  1UAA A;  3QYF A;  3R60 A;  1D1B A;  3F6V A;  4CA0 A;  1OPC A;  4UUS B;  3QOD A;  1GV2 A;  1VQP I;  2JSC A;  4WXH A;  5BPD A;  1Y8Q B;  1R1V A;  4BAY A;  1VQM I;  2L4M A;  4DIQ A;  1SMY F;  4A3E J;  2K4B A;  2ZSH B;  1P7J A;  1JE8 A;  1XMA A;  3DBR B;  1Z9C A;  2JA2 A;  2DMN A;  1IDZ A;  4OIP F;  4I02 A;  2E19 A;  2FSW A;  2DQR A;  3E1S A;  1WHU A;  2VQG A;  1FIA A;  4FTH A;  2R7S A;  3V8L A;  5E79 C;  2JJ7 A;  3ZMV A;  2KKO A;  3ERE D;  2HYF A;  3HL2 A;  1E3O C;  3J7A Y;  3H9Q A;  1XC5 A;  2EZL A;  2P5V A;  3WG9 A;  4XN0 A;  3GZ6 A;  1P4W A;  1O3Q A;  4Y33 A;  3JRD A;  4L9J A;  5EZG A;  5K5Q A;  4ENJ A;  1H88 C;  2H1K A;  4IHT A;  3I4M J;  4D5C A;  2NRA C;  2E34 A;  2BVL A;  3ZMT A;  2AQE A;  2XVC A;  2DAO A;  5B3S H;  1W0U A;  2WB1 N;  1HDP A;  4OOI A;  1GVD A;  3GME A;  2QEX I;  3LNQ A;  2ETH A;  2DQL A;  2P81 A;  3F8N A;  4PK4 A;  5EGO B;  1SVM A;  4J19 A;  1XX5 A;  3C1D A;  1J2X A;  1VTN C; 
#chains in the Genus database with same CATH homology
 3CJT B;  3CC7 I;  1YIT I;  3G4S I;  3I56 I;  1VQ6 I;  1VQ9 I;  1YHQ I;  1FOW A;  1S72 I;  2ZJR F;  2OTL I;  1ACI A;  4IO9 F;  1MMS A;  1VQ8 I;  3PIP F;  5GAE J;  2FOW A;  2ZJP F;  3CCE I;  2ZJQ F;  1VQ5 I;  3DLL F;  1HC8 A;  3EGV B;  2E35 A;  3CCS I;  3CJS B;  1VQN I;  3CCJ I;  3CC2 I;  5GAG J;  3CCU I;  1Y39 A;  4UY8 I;  1YJN I;  3CD6 I;  1VQL I;  4IOA F;  5GAH J;  1YJ9 I;  2E36 A;  3CCV I;  1VQP I;  3CMA I;  3CC4 I;  1VQM I;  3CCM I;  3J7Y J;  3G71 I;  1VQO I;  1YI2 I;  3CCL I;  3CCR I;  3CME I;  1VQK I;  2K3F A;  1FOX A;  5JVG F;  1QA6 A;  2H8W A;  3CJR B;  1WIB A;  2QA4 I;  1YJW I;  1VQ4 I;  3CCQ I;  3G6E I;  4V19 K;  3PIO F;  5DM7 F;  1YIJ I;  5DM6 F;  2OTJ I;  3J7Z I;  2NXN B;  3CF5 F;  1FOY A;  2E34 A;  5GAD J;  3I55 I;  1VQ7 I;  4IOC F;  3CJQ B;  2JQ7 A;  2QEX I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...