2NXNB

T. thermophilus ribosomal protein l11 methyltransferase (prma) in complex with ribosomal protein l11
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
139
structure length
139
Chain Sequence
MKKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFVTKTPPASYLIRKAAGLEKGAHKPGREKVGRITWEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein L11 methyltransferase
publication title Recognition of ribosomal protein L11 by the protein trimethyltransferase PrmA.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 20
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2006-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
B PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2nxnB02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 2nxnB01
1ACIA 3CJTB 3CCSI 1FOWA 2K3FA 1YHQI 3CD6I 3CC2I 3CC4I 3J7YJ 3CMEI 1VQ7I 1FOYA 1QA6A 1VQ6I 2E34A 3I56I 3CCJI 1YJNI 3EGVB 3CCVI 1FOXA 2E35A 5DM7F 4UY8I 1VQOI 4IO9F 1YITI 1VQ8I 2JQ7A 3PIOF 2OTLI 2ZJPF 1VQLI 2FOWA 2NXNB 1MMSA 3G4SI 3G71I 3CJRB 1VQKI 3PIPF 3CCEI 2E36A 3DLLF 3CCLI 2QA4I 3CCUI 3CF5F 1Y39A 5GAHJ 2H8WA 1YI2I 4IOCF 2QEXI 3CCMI 5GAGJ 3CCQI 1VQ4I 1S72I 5GAEJ 2ZJRF 5JVGF 1YJWI 2ZJQF 1VQ5I 4IOAF 1YJ9I 1VQNI 2OTJI 3CJQB 1HC8A 4V19K 5DM6F 3I55I 1YIJI 3CC7I 3CCRI 1WIBA 3CMAI 3J7ZI 5GADJ 1VQ9I 3CJSB 1VQMI 3G6EI 1VQPI
chains in the Genus database with same CATH superfamily
3Q9SA 4TV7A 5J8CA 1R36A 2XAQA 3ZQIA 3A0BC 3WGHA 3E97A 5DD8A 3LSRA 1X1PA 2DTRA 3K69A 2VBYA 4LB6B 2W25A 4KIGA 4Q47A 4XMYA 3IKTA 1SFUA 4BY7J 5BPIA 2E34A 2P6TA 3F9KA 4IHYA 4MQ9F 2NVQJ 4A3CJ 3DTEA 3PUBA 1ZGWA 2KIMA 5IOYA 2GA2A 2HKOA 1D1AA 1Y0UA 3NWTA 2L4MA 4EM0B 1VQOI 3MVPA 4B47A 2FF4A 1ZTRA 4Y3OA 1FSEA 1LDKB 2FE3A 4PGGA 1YO5C 3S2HJ 4PJMA 1YITI 1BIAA 4PK4A 4XLCA 2KDOA 1GVJA 3LNQA 2RDPA 3M1EA 3OS1A 5CVIA 3KX2A 2OA4A 3KYLA 2K9MA 3DWLE 2AO9A 3W6KB 2WV1A 2DFEA 2XAJA 4Y17A 2DA5A 4KA4A 1DGWY 3HG9A 3Q0VA 5CPRB 3DTIA 1UG0A 4BEHA 3J80K 3CO6C 2MLKA 4P96A 1FBUA 5CQEA 3F22A 1V55H 4ANJA 4CH7A 5FJ8J 3J80Z 2NRAC 2PMZN 5F04A 1BJZA 1MJAA 2A69F 1O3SA 2I5UA 4AYBN 1MNDA 4S04A 2DN0A 2VE9A 3Q9VA 4RM2A 2GWRA 4ZYEA 3F8NA 2M7BA 3VSLA 1H0MA 4E70A 3OSGA 3WGGA 2UZKA 2V79A 1XMXA 3J81K 1DP3A 1P9QC 1HW1A 2W1OA 2LR8A 4IPAA 4CO8A 1WJFA 2LLKA 3H5RA 2LBFB 4BQAA 1A04A 3J81Z 3OMYA 3IL2A 3ELKA 1LDJA 1MBEA 1FP2A 4EM2A 2Z33A 2EA2A 3SFIA 4BQOA 3G2BA 5CVUA 3ZQGA 2L7ZA 4BUPA 1KQ9A 3WGIA 3P9KA 2XF7A 3WTZA 2HWVA 3K9TA 3EQLF 2FJ1A 4YEJA 4XOPA 2ZO4A 3CF2A 1FBQA 3JRBA 1IRGA 2EK5A 3M9AA 3WHBA 2A3SA 3HPGA 2M1BA 1ONVA 4ENJA 1YYVA 2QWWA 1D0YA 3BY6A 3CDIA 3LSHA 2FX0A 4YELA 1EH6A 2K3FA 5EDNA 1ZREA 1USTA 2MGQA 3GTPJ 4ZZLA 1I6HJ 1W36D 1B6AA 3F8BA 4GCVA 2R7VA 1ENHA 5H20A 1VZ0A 4R1HA 5J47A 2XASA 1P7JA 1XDUA 5D6EA 1B4AA 1K7AA 5IT9K 1WJDA 1SD5A 2O61A 1R5ID 1EV7A 2VQGA 4HZFA 5IT9Z 2PLYA 2FQ3A 1MBHA 4I09A 3RCOA 3K4CA 3M07A 2OZ6A 4U0YA 4AIDA 3PM1A 4ESFA 4MHGA 3K2ZA 1QRYA 1EF4A 1BR1A 1G4DA 5B3SH 4J19A 3PNYA 1OCPA 5J1YA 4J01A 2PMHA 2YX4A 5FKKA 2L9VA 1T0FA 2JSPA 3IH2A 2OQGA 5DYMA 3BG6A 4PFPA 1VFCA 1VQLI 2QUFA 1V3FA 3KYDB 3TGNA 1S5LC 2VUMJ 5LHHA 1SD4A 3KLOA 2P7VB 5K7ZA 1LPQA 4BKXA 2UWMA 2YU3A 4BXXJ 1S8NA 1DUXC 4DNCA 2XC7A 1P7IA 3L7WA 1AOYA 3JREA 3HUGA 4JX6A 1LE8A 4AVZA 2QSHX 3K70C 1Y8RB 1X4OA 4EJVA 3BQYA 4EQQA 2QCOA 4QTRA 4JP0A 2WAFA 5J1RA 4U88A 3REOA 2R7SA 3ZQLA 4PJ0C 4XSZF 3P9CA 3SYTA 1RESA 3OOPA 1Z6TA 3BG5A 1T6SA 3IC7A 3V7RA 1U3EM 4RBOA 1GDTA 4NQWB 2YU9J 3D5RC 4HYEA 3TMOA 2GQQA 2YR2A 3ASNH 3PNTA 1K78B 2WC2A 4R8HA 2LFBA 3JRGA 1SAUA 1GXPA 4A0ZA 4IF4A 1Z21A 2CH0A 1HKQA 4ZDLA 1CF7B 2STTA 2IS1A 2BVMA 2VASA 3A2KA 5IP6A 2JA8J 1MBKA 2F48A 4MNUA 4O5VA 3RPQA 1S29A 5E8GA 1U78A 4HA8A 2EIMH 1C0WA 1KYZA 3MEXA 3I71A 1JT6A 5F64A 4HG2A 3ZMUA 2IPQX 3GWZA 3KEQA 2DLLA 2VKDA 3KZYA 4I01A 4FASD 4DZPA 1MH4A 4N9IA 4B3AA 3BR1A 3G3ZA 2CU7A 1OYWA 2VONA 3CTAA 4EJTA 2X51A 4IHSA 3F6OA 2G7HA 2K9QA 1KU9A 1BW6A 3F0CA 3HJEA 2F5EA 2BOLA 1SC7A 2M8EA 1KU3A 2UUZA 2DW4A 3HKZA 5FKNA 3I56I 1YRNB 4MFDA 4ZYGA 1SMYF 2ZXWH 4KN4X 1ZRDA 5EEGA 1U5TA 1ZRFA 1U2WA 4HSTA 4I0BA 2Q2EA 3OIPA 5IYCJ 2XROA 1W0TA 1LB2A 1HA8A 5E79C 2VJ4A 2LH9A 2X6YA 1D3YA 2DA7A 4MO7A 2RQQA 2QQBA 1VQ8I 2JQ7A 4C30A 4E7SA 1MJBA 1BA5A 3FBNB 1JGGA 4C2TA 2ZMEB 3KZIC 4JYKA 2IGNA 2W24A 2XPUA 3B73A 3AG4H 3NRVA 2ZFUA 2BW3B 3RIRA 1WFXA 2L2OA 2HZTA 4BHCA 4A3KJ 1JUPA 4L0ZB 1QZZA 2XB5A 1OJLA 1FOKA 2ICWG 2VXZA 2KLOA 5JR3A 5DV5A 1E17A 2DDBA 2QVOA 3QU3A 2HI3A 2KIUA 3FXQA 4M3GA 2A6HF 1A6IA 5FROA 2CV1A 1USSA 3HB9A 2X6OA 3SQNA 4I99C 2QEXI 2ESNA 2X6XA 3WTUC 3OYCA 2B7EA 5FFXA 4ZTJA 1IDYA 1OISA 4IJAA 2GXBA 2E1MC 1WJCA 2CQXA 1LVAA 5LD2C 2LKSA 1E0EA 3BJOA 2MSYA 2P6SA 2XKOA 4OIOF 5LBQA 2EB7A 2RV8A 4LFUA 4FETA 3RI4A 3QYEA 4A0XA 1X3UA 1O7FA 1G2HA 5LEJA 4NC6A 2ZNZA 1W5TA 1WI9A 5JLXA 1RKWA 5JHUA 1CGPA 2E1NA 1R7JA 3FXJA 3ECOA 3BP8A 3HTUA 1IF1A 1KONA 4M6YA 4HX4A 1I1SA 3QAHA 1H8AC 1XTAA 4G7ZF 3RPUA 2F2EA 1OKRA 3S1MJ 2M4GA 2W85A 3WU2C 2DI3A 3BZCA 3CC7I 4MEYF 3V8LA 1IN4A 1HW5A 1JKPC 2A07F 2EFOA 4NDLA 1OMIA 4HV6A 1VQMI 4YRVA 5FD6A 2BZTA 2PEXA 4HX7A 1YHQI 3DKXA 2WAQN 3HYIA 2KJCA 3TO9A 4NUBA 1WH7A 1E3HA 2PG4A 3BR3A 1SVOA 2E2JJ 2BE5F 4A3IJ 2FBHA 3QPHA 2M0MA 3BPVA 1NK3P 3FXUA 1G3SA 4A0YA 1Y8QB 2XF6A 3BTCA 3FKIJ 1GT0C 1HDDC 3HGGA 1U8RA 2YSRA 3OYLA 1YQAA 1Z6RA 3QU6A 4CSWA 1N77A 1DQUA 4EMSA 2ZXIA 1J9IA 3PO3J 2VKEA 3I4NJ 2EFPA 4UVAA 3S3MA 3VB2A 1EKEA 3FX3A 5KHDA 3GFLA 3PQKA 3ZR8X 3I4MJ 3HOUJ 4FQGA 1Z3YA 3GEZA 3KEYA 2DPDA 5HVQC 1IN6A 1TWGJ 5J6XA 2R7QA 4A3BJ 1R4MB 1XN7A 3G4SI 4BEHB 1YLFA 3L2QA 4X1EA 3ABMH 5F27A 2ZC2A 2PQ8A 2QYOA 1X1BA 4HNUA 1R71A 1G3YA 5FKMA 2IS6A 1XX5A 1GUUA 3W6VA 4IVNA 2Y31A 2E71A 2WV0A 4IKFA 1MKMA 2KRFA 4NHJA 1JUMA 2CW7A 4QWQA 3DEUA 5LHGA 5CKTA 5HS8A 1XGSA 4IOCF 1E2XA 2WY7Q 3GLLA 3T8RA 4FT8A 1B9NA 1X2NA 2W00A 3WODF 2V1UA 1RC9A 4XLHA 4L5EA 2MD5A 3AL0C 5CQGA 5GAEJ 3E6BA 2GIZA 2ZJQF 4FX4A 3RKYA 4NC7A 1T08B 4UXNA 2NVTJ 2DBBA 3IRQA 1H89C 4PCQA 2VT2A 5FRMA 4ENMA 4D1QA 2R7ZJ 2D2WA 3ERED 2H1KA 3K6GA 3LQRA 4B1RA 2OZUA 1WKMA 3EUHC 3IH4A 1FSHA 3I58A 1FIAA 5E3NA 3CCRI 1ETXA 3LSMA 1XPXA 1STZA 3CMAI 1WJ5A 1D0XA 1W7PB 1SAXA 1FEXA 1HF0A 4QPOA 2GOMA 4CZCA 4JBAA 2O03A 4NNJA 3GBGA 4LMYA 1U9OA 2CW8A 2FXAA 3ZMVA 4XOTA 4JK1X 2NOGA 5F1JA 4L9JA 3CCSI 4H4KC 2QQAA 5JI6A 2VBXA 3AG2H 4UVBA 3JR9A 2KRCA 4D5CA 4R79A 1B1BA 3VEPA 2QBYA 2VL8A 2HYGD 1UHWA 5EGOA 1R4NB 3FXOA 1QA6A 1YTYA 1MMDA 2F4OB 2G7UA 3GMEA 3T8TA 1T39A 3AAFA 3I0TA 1ZN2A 4WK8F 2JSCA 4B4CA 1YFHA 2V1DA 5H6QA 2ZXHA 5FD5A 3SXYA 3R61A 2ETHA 1OCCH 1BC7C 3MKLA 5HLTA 3F23A 1MH3A 3EPZA 3GYHX 4KFCA 3ZMSA 4D5FA 2V1XA 4OINF 4KMUX 5ERIA 3DU6A 1S7EA 1T38A 2XAHA 3RYRA 1LFPA 4E7HA 1ZH5A 4YFKF 2K7LA 5H6RA 3OS2A 3DV8A 4EATA 1JTYA 1ZRCA 3ZN0A 2Y30A 1F1ZA 3G71I 2ZXJA 2IS2A 1PUFA 3HUGB 3L9FA 1LE8B 2DOAA 1J75A 1ULYA 3V8KA 2IW5A 2ELKA 2LOOA 1I3QJ 4E7LA 5K5RA 3WTWC 1TW3A 3BG7A 3GVAA 1Q1VA 4C3IJ 3HHHA 5GAHJ 3H0GJ 3FISA 1OYIA 1WJBA 3BTLA 3HPHA 4DJAA 4S0HB 2A6EF 2A05A 1PDNC 4QIWN 2OQRA 2CFXA 2LNBA 4Y13A 1IN5A 2DT5A 2YX7A 2UXNA 2QSFX 1T33A 5LGNA 1LFUP 3SEZA 3BROA 1V5EA 4YG2F 3HOWJ 3X2QH 1HCRA 4OU0A 3V7CA 3IAM2 1ZLKA 2G0EA 3PFYA 1FYKA 1KYWA 1KU7A 3CLOA 2I10A 4BHPA 2H09A 3LSKA 1S7OA 1UFMA 2JA7J 2KJBA 1YG2A 4ASNA 3LFUA 4RM3A 4FTHA 4I76A 4OMZA 1YW8A 4XNFA 3IHUA 2CFOA 1LNWA 2NVXJ 3B6AA 2ELJA 2ELHA 4XN3A 5IP7J 1WIBA 1X19A 4K2EA 4OWRB 3BTJA 4WXCA 2CMPA 2LG4A 4II3A 3GLXA 3I54A 5CVJA 2QSGX 2QKMB 3SJMA 1RIOH 2JJ7A 3ASOH 2W82A 3D5LA 3A0HC 3S1NJ 3VFZA 2P4WA 2VBWA 4N4OB 2L3DA 3DBHB 3BPXA 3KFWX 4RB3C 3HRMA 4M3FA 2ME6A 5LLQA 2OJED 3S15J 1W1WE 4HW0A 2V9KA 5KNLA 3KP6A 3HSRA 1U5TB 2O0YA 3FXLA 4AWXB 2CQ7A 4M3DA 4IX7A 1X1DA 3ABUA 3T1BA 2IXSA 3ZQQA 2XF5A 3OOUA 1BC8C 2X1DA 1MJ9A 3HL2A 2H8RA 3KLNA 1KU2A 3R0AA 3CP2A 2VQHA 2E35A 4N0BA 4KT5C 4OMYA 2P7CB 2EPFA 4X6AJ 2XAFA 2X4HA 4P5OA 2VLAA 2A68F 4UB6C 2WAEA 5J3LA 4YIIA 1BOBA 3TO7A 4ZTFA 4RAYA 1RNLA 4GYGA 3DCFA 4LGWA 3WE2A 5E3OA 4X0GA 4WF2A 3Q5FA 2JRMA 2R5YA 4N4NB 2FMLA 5TGTA 5GTIC 3R4KA 3CCEI 3LQQA 4FX0A 2HOSA 3IWZA 3QOEA 4IEJA 1RKTA 1I27A 2HVRA 3GX4X 3CCUI 2DMNA 2XGXA 3DQVC 3OL3A 1QHGA 1Z0XA 2VKHA 4A3FJ 5HDNA 3PJRA 3BR0A 4A3DJ 2IS4A 2R7TA 1OPCA 5TRDA 3M3YJ 3OYJA 5D8LB 4Y33A 5ILUA 3HRSA 3NQOA 2GA1A 4AIJA 4CGZA 2DA2A 4UUSA 1WJEA 3GZNB 4HAMA 2W48A 2ZJ2A 1MW7A 5HLHA 1QBJA 4CZZA 2L4AA 4P9UA 3BTIA 1WPKA 3W2WA 1Z7LA 1X4PA 3OYEA 1Y0NA 3ECHA 2F5FA 3FM3A 1EJ9A 9ANTA 2HKXA 4A3LJ 3N05A 1P4XA 2DAOA 2L9SA 1TP4A 2ZNYA 3KPHA 4ZH4F 4RGSA 5GPAA 2HS5A 1P6RA 2PJPA 3SZTA 1A31A 2OTJI 3JSOA 4A3MJ 3DPLC 3QWLA 3GTGJ 2Y0SA 4OAYA 3FHZA 2V6CA 2IGOA 5FKLA 2JA5J 5HOOA 2NS8A 3I55I 1YIJI 2Z99A 3EYIA 4GDFA 1POGA 1R49A 2GXGA 2EFQA 5BMZA 2C6YA 3SHFA 1UCRA 2XGCA 3K4MA 3OIOA 4EJWA 3SDGA 1ON2A 3L00A 1SFXA 5GADJ 4CCJA 1WCMJ 2CWEA 3LSIA 2PX9A 1ZR4A 3C3WA 4E7JA 2F4IA 2HOTA 3ABLH 5J4VA 5K7HA 1FYMA 1R5GA 2E5ZA 5ICEA 3CMEI 2A61A 2P5KA 5L3GA 1IRXA 2EH3A 3HOSA 1FIPA 1U9NA 3CCJI 1YJNI 3FXKA 2V1NA 2FA5A 5LGUA 4G94A 3OYMA 4YIFA 3CUQC 4KDPA 4CCKA 5M3MJ 3H9GA 1VF9A 1ZYRF 4CYDA 1F5TA 1WSUA 4HLXA 4BHBA 3S14J 1REPC 2KL4A 1IV6A 2VQLA 3MAJA 3GFMA 2CGPA 2MG4A 1TWHJ 1D1CA 2KISA 2LP0A 1TL8A 5HLIA 3SEQA 5E17F 3JRIA 2DTZA 1FC3A 5L3BA 1R00A 5J40A 4B09A 2E36A 3LSTA 3IRRA 3OYNA 4B48A 2K4BA 2EJRA 2VN2A 1VTNC 1Q1HA 2HTJA 1WHUA 1G3TA 4HV5A 2Y0MA 2JK3A 1N78A 2GOXB 2HOEA 3B02A 2BBYA 3GTOJ 2DYSH 2DMPA 1BI1A 2E2HJ 4HF1A 1S72I 5IP9J 4HSRA 4WWCA 2NVYJ 2L7MP 5BS6A 1QHHD 3L2VA 2CV2A 1YJWI 4CICA 2OPTA 4IQJA 4EGYA 1XCVA 2R5ZA 3FIWA 1QVTA 4ZYHA 1JJ8C 3IP4B 1MMAA 1OR7C 3MWMA 2EIJH 3CO7C 3I59A 4BE1A 3AFHA 4O3MA 2O8KA 4HQMA 2HDWA 4XLEA 3TBIA 4W97A 4GGGA 1H9GA 2LY2A 1AWCA 2W84A 2VC0A 3U21A 2XAUA 5DM6F 2L02A 2VIXA 3ABKH 1X1AA 2M34A 2VQCA 3J7AO 2K5CA 4DIQA 5FO5A 4UNOA 4I02A 4GO1A 1JXSA 3FK6A 4RB2C 3A02A 1UZCA 2JPBA 3G1LA 1QZEA 4RS8A 1JKQC 2NS0A 5H2FC 1FJLA 4HPQA 1QGPA 4FCYA 1ACIA 4KMFA 2QBYB 2IJLA 1FOWA 2IA1A 2JTVA 4IHVA 3H92A 5EGOB 3V42A 5ICFA 4MTDA 1WI3A 4YIRX 3RKQA 4BJTA 3M1CA 1O3TA 3CC4I 1S3JA 3K7AJ 4DQ2A 3LSJA 3Q3SA 3ZCOA 4BU2A 1TWCJ 1D8JA 3O8GA 3OR1C 3BLYA 2EBIA 2QQ8A 1XB4A 5CLSA 1JTXA 4FE7A 2LF7A 1MZBA 2AXTC 3EGVB 1MIJA 2UV1A 2DJNA 4B43A 3UKGA 3TW7A 3WTVC 2IRFG 1SD7A 1FOXA 1TT0A 2B0LA 1RRJA 3BR5A 1HLVA 5CJ9A 3LAJA 3IUOA 4UY8I 3L2CA 2VOPA 3UR3C 3K70D 5L3EA 4IO9F 1PYVA 2VKVA 4RLQA 3ONQA 1SMTA 1Y1VJ 1AKHA 1HSTA 1PUFB 3GZ5A 3H1CA 2V26A 2XVCA 3O6BB 5IYDJ 1GHCA 3K1PA 3U9GA 4B44A 2VJJA 1Y6IA 3QODA 3GW2A 4Z6YA 3CJRB 1HBXG 2CUZA 2Y48A 3U1KA 4O6JA 4PDKA 1R5HA 4CCOA 1XS9A 1N75A 3A01A 4QSHA 2P8TA 3FXMA 4RGUA 2BEOA 5JVTA 5FLXK 3OV8A 1IZ1A 2Z3YA 4AIKA 3GTLJ 2IP2A 1FPQA 5E8IA 2IAIA 5FLXZ 4P1WA 1MSEC 2K9LA 2KFDA 3RJPA 2QKLB 4E7IA 1AA7A 2DFHA 2IEKA 5HLGA 3CCMI 2BHZA 5GAGJ 2O5RA 1J59A 1BL0A 1RI7A 4LIUA 3VYTB 4PSWA 2LKPA 2XUBA 4CYCA 5A2QK 1JHHA 4XRFA 4NB5A 2VT3A 4P9FA 1QO0D 5A2QZ 1Z05A 2XPWA 4IOAF 3HZJA 4ESJA 3BC8A 5L3DA 4IRGA 2XSDC 1VQNI 5IPAA 1XD7A 4ZYAA 1IJWC 2OU2A 3DEWA 4RAZA 3MZ8A 2CRGA 4E6KG 4F92B 5E1ZB 1HSJA 3K2AA 4N9HA 3S3NA 3E5XA 3M7GA 3RSNA 2HPIA 4G8XA 5KAIC 4RMNA 1BW5A 5FLVA 4CXFA 4BY1J 4PFOA 3LSGA 2A6TA 4Y15A 1JKRC 2XHKA 4XONA 2HNHA 2ZBKA 4OIPF 4BAYA 3JRCA 4L9TA 1TLHB 2A5YB 4M74A 4BQQA 1IRZA 3SZGA 5DCMA 3LWFA 3JTHA 3OWTA 3VSKA 3HOTA 5JFRA 2MBFA 1IUYA 1ZAOA 2QM3A 3MKYB 2R92J 1PVEA 4BH9A 3I9V2 2HVQA 3KIOA 1B8IA 3EUHA 4AUXA 1KA8A 3VDXA 2Z16A 2KP6A 1R6RA 3WTSC 1FNNA 1F36A 2Y75A 1MDMA 1VNDA 1ETKA 2PJRA 3V4GA 3BZKA 2MA3A 3L2UA 3JRHA 3BR2A 1UAAA 2TRTA 3TKYA 2CQQA 4XLFA 1BI3A 2VB6A 4PJJA 4IXAA 2EILH 2LREA 3VYSB 4BXUA 3E6DA 2XKPA 3LFKA 1K61A 2E1CA 2V6EA 1HDPA 1VQKI 2XRLA 3ERMA 4HF0A 4E7ZA 1EH7A 2RAEA 3DXJF 3MZYA 2Y69H 3QP5A 4DBRA 3HOZJ 2WTEA 4MEXF 2JVGA 2OC6A 1A5JA 1D8KA 2QA4I 3VODA 4BDYA 2HFHA 3CF5F 5ED4A 3F8FA 3KCCA 4UUSB 3S1QJ 2K02A 3OR2C 4S05A 3ZN1A 2RN7A 1B72A 1DU6A 1DGRM 2IGKA 3S2WA 3ZQFA 5B1AH 5EJCA 1SVMA 5K5OA 2LDUA 1GV2A 4PSXA 4Z2YA 3FHNA 3JAMK 2EFNA 3E1SA 2E1OA 2P5VA 2HQNA 3JAMZ 3F21A 4U7BA 3FM5A 1DPRA 1OFCX 2P5LC 2HZDA 3G73A 1XSVA 2QF7A 3FBIB 4HDUA 2VPRA 5EZHA 4ETSA 2IA2A 2BY0A 1OCZH 2OCEA 4GFBA 3DLAA 2E5NA 2X85A 1YI2I 4LK1F 5K1YA 3OIQA 4Y4RA 2XSJC 5D5XB 1SFEA 1W0UA 3J7ZI 2DQRA 2LY1A 2DODA 2XRNA 3K4BA 5CYVA 3BCAA 3K1NA 3I64A 3KYCB 3RKXA 3KP7A 4GYIA 1FMVA 3JRFA 5F0HA 1K4TA 3PSIA 3AKZA 1X2MA 4I98B 1V54H 2L5QA 4FHTA 4KUMA 1BN5A 3I3LA 3OYGA 3CDLA 2X1EA 1G6NA 3U1DA 1TZLA 1WGXA 5M5XJ 2L9RA 3ISPA 4JQFA 4C3JJ 1MMGA 2Z2SB 3CZ6A 4DYRA 3OYIA 3QPLA 3OL4A 1J5YA 2RNJA 2K4JA 4HDVA 2LF8A 2YUSA 1RUNA 3K0LA 4E7KA 1ZG1A 2RNGA 3HSFA 4BL0B 3CCVI 2R4GA 2GBYA 4II2A 2DFFA 4UB8C 2LMDA 1ETQA 2QGUA 3HDDA 2HVSA 1YX3A 4KN7X 2L01A 2L7FP 5CVVA 3BJAA 2ZSIB 3ULQB 4BBRJ 3PIOF 2CW0F 4FE4A 4KISA 2FOWA 1MBFA 2NXNB 2WB1N 3FZVA 1FBSA 2MW8A 2EZHA 4G9YA 1E3OC 2GZWA 2KZGA 3GTMJ 2AXLA 2CO5A 3B6CA 3A1YA 4XORA 5DD4A 2X0LA 3BCBA 2XPVA 4ENKA 2VC1A 3S8PA 1FLIA 3CCLI 2DA6A 4CA0A 3BQZA 2FBKA 3QP6A 5F0CA 4B8XA 4LG3A 2F4MB 4HRIA 5EZGA 4RDUA 2O9LA 2L54A 3HGYA 3H5NA 1SANA 1T95A 1XSXA 2PMZA 4RA2A 4XM3A 4NC8A 3JCUC 3MZHA 2F5VA 2FSWA 4JX4A 5EEAA 2DA3A 3C18A 4U87A 5FGMA 3HEFA 4AYBA 4G6QA 1BR2A 4OOIA 1Z91A 3GXOA 1CF7A 2R5ZB 4Q5SF 3RKWA 1XSDA 4IQ4A 2ISYA 5E1XA 2ADUA 2HOAA 4I7HA 2GIVA 1TBXA 2WBMA 3M8FA 3I59B 4D7MA 2QZ8A 1GV5A 2RREA 4A69C 3DPTA 1TWFJ 3WU1B 4HX8A 1OCTC 4M3BA 4C2MJ 1YJ9I 2HXIA 4IHXA 2TCTA 3N97A 3HTSB 2R7OA 4BBSJ 3TEDA 2JA6J 4ON0A 2V7FA 2FEZA 3M8JA 4G12A 4QPQA 2CJJA 2E1MB 3RQ4A 5DTDA 4EEFG 4LIVA 2R93J 3LAPA 3CP8A 3K4LA 3TQNA 2JMWA 1YOVB 2QENA 1P2FA 3G6EI 4ENNA 1YRNA 4HBLA 2M7AA 2X9DA 3Q0WA 1IUFA 1IV8A 4G6DA 5J1UA 4CCNA 3HOVJ 3PQJA 3DPUA 3W2AA 3CD6I 2DT7B 2HGCA 1R58A 2BY2A 4LLGF 4WX9A 2H94A 2RQPA 3J7YJ 1U8BA 4OAZA 3VWBA 3K4JA 3FDYA 1FOYA 2JVHA 4KIFA 2QQ9A 4LG0B 2CV0A 2Z1DA 3EUAA 3F8CA 3F6VA 2F5CA 3MMYB 2LK2A 4ESBA 2VBZA 2VJIA 5D5UB 1D5YA 1TQPA 1Z1DA 5EF6A 3V7SA 5DM7F 1AKHB 3S16J 3N4MA 4Q48A 1MNMC 2X48A 1QU3A 5D6FA 5DUIA 3JW4A 3K4NA 4J00A 3OSFA 2OUMA 2JT1A 3L2RA 2MC4A 4IL6C 1P4AA 4BXFA 3A01B 1KQ0A 3LSPA 3GFIA 1J7KA 2O7OA 1UB9A 1FT9A 3FXRA 5D4RA 1OYYA 2EQRA 4RAFA 3S32A 4BACA 2Q2EB 4U7DA 4XRSA 2LSOA 3KE2A 4A12A 1IN7A 3GZ6A 2HQAA 2ECBA 2NOJB 2G9WA 3CMYA 3S2DJ 1MNEA 4HOBA 2E7XA 4QLCU 4LG0A 2MH9A 3CUQA 1WVRA 2KIFA 2BY1A 1I3AA 4BNCA 4M71A 1XCBA 1XGNA 3D5SC 4CYCB 2PMUA 2L0KA 2ID6A 2JPCA 3LL7A 2X1CA 3CUOA 4IHWA 4Y52J 3DKWA 5F08A 3MCZA 4U0VA 4UVCA 2AHQA 2KIQA 3CQZJ 2XDVA 2JZYA 2DO7A 3FWEA 2ZJRF 5JVGF 5D4SA 4BJ6C 2O3FA 1T8IA 2EV0A 1X3WB 1ON1A 2Q0OA 3MFKA 3H3ZA 2I8DA 2NNYA 3T0YA 2H27A 1MSFC 5ILSA 4DGWB 1K83J 4ZC3A 2VJ5A 5M5YJ 5EG0A 1BIBA 1R1VA 3K4KA 1RZ4A 3ZMDA 2R7UA 3GCMA 2GAUA 1NTCA 1ZGJA 2IVMA 4CUGA 1YS6A 2M5WA 4PJNA 3AL0B 2EZLA 4I0AA 3WTXC 4UUVA 1U6GA 2BGCA 2DXIA 2FRHA 4EVIA 2M8GX 4M9ZA 4EJUA 4MTEA 1RR7A 1LJ9A 3C7JA 2K9SA 1J09A 4WXHA 3I5UA 1VQPI 3DFGA 1F43A 2AQFA 4E4HA 4L5JA 3VOEA 1ZR2A 3BJ6A 4M72A 5DCMB 1ERDA 1H88C 5AONA 5KCMA 1IRFA 5D8KB 2BY3A 1TQIA 2JRTA 4BYYA 1A35A 4XRSG 1JI8A 2IBDA 3BWGA 2DA4A 1OR7A 3CLQA 1OLTA 4XRMA 5ICCA 4XSXF 1D1BA 1IN8A 4M6XA 3TDZC 3A03A 1B8IB 4DOZA 2HR3A 4WXDA 2ZMEC 2KPMA 1VQ6I 1WJAA 4XK4A 1MDMB 2CYYA 2COBA 1I1GA 1NK2P 2PJRB 2BVLA 3QQAA 2LRDA 4DYCA 1UMQA 3DF8A 2XIGA 1NH3A 2DMQA 2N8GA 3E3VA 1LUJB 2ID3A 2K3PA 4A3GJ 4DZJA 2ME0A 5DCFA 2YS9A 4F91B 3BDDA 2R3SA 4M9XA 1ZARA 2ZSHB 3G1MA 4BE2A 3S17J 5E1WA 1EH8A 3E6MA 1W36C 4F52A 3H36A 2YPRA 2FU4A 1G3WA 2FOKA 2FBIA 2VPLA 3TOBA 2FNAA 3MKZA 1ZELA 1Z67A 5LRSA 1YE9A 1T98A 5KAFC 2M0CA 4KIBA 2MABA 3HM5A 3JSPA 3C2GA 2ZKZA 1LVKA 1B72B 2LVSA 5L3CA 5B66C 1TC3C 1XGMA 2O8XA 2F6CA 4IRIA 3ZQHA 4MIMA 4UV8A 4XR6A 2L9NA 4B3XA 3P7NA 5FKOA 4MFEA 1IAWA 1MGTA 2PI0A 4BJ5C 3KP4A 4V2GA 2DOEA 2M45A 3HRTA 1I39A 2RKHA 3K1MA 4M9SA 3W6JB 2D45A 5C4JJ 1S9HA 1XG1A 1FZPB 4LLLA 1W7PA 2D5VA 3BOQA 1BR4A 2IGMA 1UJ8A 2JUGA 2E7WA 4UHTA 4H0EA 3P5JA 1IC8A 4ABZA 1DPUA 3CESA 2WADA 3LA7A 3QOPA 4CDGA 4A3EJ 2OBPA 5EYRA 2H1LA 3F72A 1P4WA 1D0ZA 3QRFF 2JWTA 3MD2A 3JRAA 1HQCA 1W5CC 2XB0X 4F7ZA 1FX7A 3VPRA 5C4XJ 1I6XA 2JA2A 1MBGA 2R7RA 4KICA 2QLZA 1B9MA 1Z9CA 5LEKA 5FRNA 5C3EJ 1U0JA 2H6BA 2OF7A 3P9IA 1HW2A 3NAUA 2FMYA 3ZOBA 3OYKA 5AIPA 1K79A 2VODA 1W5SA 1AHDP 1PJRA 2RGVA 2WAQA 2HYJA 3S3OA 3DP7A 4A3JJ 4HNVA 1ORKA 2ACJA 4PGHA 1ODDA 1APLC 3O2PE 3PFIA 1IGNA 3HHGA 2PN6A 3J7AY 2EA4A 1YS7A 5D5WB 2DDAA 4UV9A 1PUEE 4XLPF 4I6ZA 1CQTA 5M3FJ 2LKXA 4U0WA 3RZOJ 2M2EA 1ZKGA 2AS5F 5K5QA 3LA2A 1AU7A 2WA0A 1R23A 2VE8A 1R9TJ 3KETA 2B63J 1A6QA 4L18B 4DBQA 3OYBA 3SZPA 4ZZDA 2AQEA 5DDGA 2EINH 2DA1A 1A36A 3TOAA 5JLWA 4XN0A 5JHFA 3A4CA 2P0WA 3E0JB 2ZJPF 1SFOJ 1FTTA 4RB1A 4HNTA 2HQRA 3AG1H 5F0FA 1Y1WJ 5BQTA 4F3QA 2BXZA 4L0YB 1ZK8A 1GLNA 4V2FA 3PIPF 2COMA 3ZMTA 3IH3A 1O3RA 4EGZA 2DYRH 4ITVA 1XDSA 2E60A 3DLLF 2LYCA 5K7FA 1W4MA 3ZGKA 3LOCA 2MC3A 1Y39A 1FP1D 2BV6A 1J2XA 2DPUA 4RGXA 2CUFA 1LEAA 4AU7A 3ZQCA 3CCQI 3KZZA 4KITB 1YW7A 1IXSB 3EDPA 2EWNA 2R7WA 3ESWB 3ROUA 5DEQA 2X6WA 4BQNA 2V9PA 4LOCA 1MD0A 4EJOA 5KK1A 4EV0A 2VXDA 1WZ2A 4IRHA 4W1UA 3FMRA 2Y0SN 4EM1A 3KEOA 2NYXA 1WRJA 3ZXSA 3CJQB 4XIDA 1Y56A 1O4XA 2CG4A 2R7XA 2NNNA 3IV5A 5IY5H 5GPCA 2WY8Q 1BOAA 3L2WA 3W3CA 4IZZA 4A93J 2ZFWA 1ZLJA 5HS7A 3EYYA 3VYRB 3WTYC 5M5WJ 3CJSB 1S6LA 4I2OA 3CJTB 3JTGA 1IW7F 5J4YA 1BI2A 2HDDA 3W2VA 4MQVA 3BR6A 2K27A 2KDZA 2HEOA 1T0FC 1RUOA 2OAZA 5LHIA 1SEUA 1LDDA 2E2IJ 4XLNF 4YFXF 1DP7P 2V9VA 5FFZA 1F4KA 2WB1A 2J5OA 1FMWA 2KKOA 1XC5A 3KP3A 3QPSA 1W7PD 1PP7U 3M4OJ 3WG7H 1O3QA 2OD5A 5F1RA 2CS3A 2K40A 1IDZA 2LY9A 3TDUC 1SVLA 2M4KA 2P81A 2V4JC 1KGSA 2MH2A 4BGDA 3CJNA 3CDHA 3QYFA 1T2KA 3C2HA 4LITA 3H3VK 2DMTA 2FUG2 4XBFA 1BM9A 4MGRA 2OTLI 3HSEA 3ZMZA 1X58A 1PP8F 4LD5A 4KNYA 5DS9A 1V4RA 3H3UA 4D9JA 2R7DA 4C2UA 1HXDA 2XAGA 1HKSA 1TNSA 1G8XA 1UHMA 3CUQB 1YW9A 2HTSA 3PL8A 4HF2A 4GXOA 3GTQJ 4MLOA 1DDNA 3RYPA 3I53A 2R7FA 2D1HA 5C44J 1ETVA 4AVPA 5D5VB 3MQ0A 1OCOH 1TQMA 2DOFA 3BZ6A 4CCLA 5GP9A 4C9YA 3HXLA 2H8WA 1JE8A 2L7KA 2B9SA 5TISC 1P92A 3T5XA 2E19A 2PFBA 5HNHA 3TP0A 1LEBA 2BXYA 4DW6A 4F93B 2OCCH 2ZB9A 2R5YB 2GXAA 1SFKA 3S93A 4L9NA 5BOXA 1IXCA 3GUDA 2DK5A 2M3AA 5KVRA 2MLGA 3S1RJ 1HKTA 2XGEA 4A2UA 2HDCA 1NG7A 4M3EA 5EG0B 3H9QA 3K10A 3H5AA 2CSOA 4F55A 1ETOA 1UG2A 2M87A 1Z77A 2K86A 3ML6A 2Z9OA 2LBFA 2KQRA 3V8JA 1R22A 4CHUA 4IHTA 3DEEA 2DJIA 3FMSA 2EZKA 5HDKA 1FY7A 1U5TC 3C1DA 4PUSA 1K4SA 5EEHA 5CVRA 1Z7UA 3GF2A 4AM3A 1X1CA 4ZYDA 1VQ9I 4P55A 3RQIA 4ZJZA 4M6VA 2DMUA 4JOMA 5LGTA 2CQNA 1TWAJ 1E3PA 3CCYA 2KMUA 1ZG3A 1J0RA 3AG3H 3OYFA 3CC2I 3TW6A 1YX5A 1S7AA 4L5IA 3D0SA 5IYBJ 2LTPA 4JX5A 3OS0A 3O8HA 4AD9A 2DQLA 4M73A 5FB2A 1ZGAA 2W7NA 2BHYA 2EIKH 2Q1ZB 3SFZA 2PBIA 3R0JA 3PUFA 5AIQA 1ETWA 2M9HA 1IXRC 3R60A 2DT6A 2JN6A 4G7HF 5BPDA 3FF5A 2EZIA 1X3ZB 4UUTA 4A6EA 4BS9A 2KHMA 2CUJA 3L1PA 4KT6A 1FTZA 3HRUA 2MYSA 2DU9A 2IT0A 3DU5A 1DU0A 5E3LA 3H0DA 3IAS2 3UNGC 1UELB 3BG9A 1WWXA 1D5VA 1L3LA 3HKZN 2Y9YA 5IOZA 3ZQ7A 3G1OA 2NVUB 4GRIA 3PO2J 3I4PA 3NEUA 2GM4A 2J5PA 3COAC 1T56A 5B1BH 3HOXJ 2D1VA 3H9JA 3WE3A 2CUEA 1K6YA 2EV5A 1JGSA 2W57A 5E3MA 4HEA2 4YFNF 4L9VA 4Q4ZF 3DBLB 5FLMJ 3U2RA 1ZG5A 4NBQA 2KRHA 3TO6A 2ISZA 2ESHA 3EETA 1QNTA 2DK8A 2HU9A 3QPTA 3GTKJ 1ZHFA 1K6OA 1L0OC 4RB0A 4XKBA 4A6DA 1VQ4I 1HOMA 3NWSA 1MBJA 1ITYA 4Y7NJ 5TJJA 1LKXA 3GO5A 3FMQA 3HC7A 1G59A 3WU0A 5J8FA 1Z3XA 4RAGA 3RTRA 1VQ5I 4A5NA 2OV7A 4HQEA 1WH5A 2EV6A 2Y2ZA 2W4SA 3FK7A 1IG7A 3F3XA 5ILVA 3D1NI 3WG9A 1BBYA 4NQWA 4D0PA 1JJ6C 4PJLA 1ETYA 2K85A 1K78A 4FISA 3OYHA 5LRRA 2JUCA 2HXOA 1O57A 1XGOA 3KP5A 3IWFA 1JUSA 4KJZA 3PSFA 5L3FA 3OY9A 5IT3A 2NAZA 3E5UA 2Y9ZA 1QPIA 2NS7A 4DYQA 6PAXA 3F8MA 3GTJJ 2K9NA 1XMAA 2MD0A 1YIOA 3RPUD 3BG3A 2HQ5A 4BDZA 3OYDA 3RDIA 5DUKA 1EA3A 1RR8C 3WTTC 4AC0A 1LQ1A 5HS9A 4XL9A 3EUKL 1VQ7I 1TW2A 2KZVA 3PNVA 2WWYA 2MFZA 2VOOA 2XV4S 5E20A 1TNTA 2F5DA 3IKVA 3ZP5A 4G7OF 3VYUB 3ZRGA 1RPWA 1UHSA 4CCMA 4G6TB 2KT0A 3DKYA 1TTYA 5ICGA 1KQ8A 2RC4A 3HOYJ 2FNPA 1JHFA 1MMNA 3R6SA 2DFIA 3DTKA 5HODA 4ZDOA 3KP2A 3SDBA 3CMMA 1FYLA 2BYVE 2DCEA 4OIRF 2VI6A 1I5ZA 4KYWA 1QPMA 1R1TA 4LK0F 5BNGA 3HBLA 1MMSA 3BT9A 3Q0UA 3RZDJ 3WHCA 4LB5A 1H9TA 1IO2A 4D7NA 2ZMEA 3L09A 1KZHA 1ZQ3P 2A5WA 3DBRB 2HYFA 2BW3A 4LLNA 1TT5B 2O6GE 3ABTA 1R1UA 3TP3A 2HPMA 3NARA 1OCRH 4ZDPA 3HIFA 2ZCWA 4RGRA 2FQ4A 1O7LA 4LJZF 2RVCA 5HNFA 4BE0A 2EFWA 2ECCA 4WCGA 1B59A 2CQKA 1I50J 2IA0A 3OYAA 5LFAA 1NHAA 3H35A 2Q8KA 2LD5A 3LMMA 5B5EC 1BJAA 2XGDA 5HDGA 1SD6A 2Z5UA 1BI0A 2TDXA 1VI0A 3GFJA 3FKJA 5F6FA 3TL4X 4HLYA 1WQ2A 3M8EA 1GXQA 1M1EB 4OIQF 2GLOA 1NG6A 4XKCA 1RETA 2H6CA 1N25A 1QZYA 2UXXA 4XKWA 1JKOC 4C3HJ 2M30A 3E7LA 2LC2A 2R0QC 1JT0A 4XKVA 3QYBA 4A5MA 1LFBA 2FD5A 1HC8A 4XLAA 4V19K 3E6CC 1GVDA 1OQYA 3O3KA 3C2BA 1QVUA 5GTHC 4XICA 1V5GA 3MN2A 4XQFA 2STWA 1F9NA 1V5FA 4AIHA 1XMKA 1QQIA 4PZJA 3MKWB 3LA3A 5E18F 1FWZA 4RLFA 3JRDA 3E5QA 3ZPLA
chains in the Genus database with same CATH topology
1ACIA 3CJTB 3CCSI 1FOWA 2K3FA 1YHQI 3CD6I 3CC2I 3CC4I 3J7YJ 3CMEI 1VQ7I 1FOYA 1QA6A 1VQ6I 2E34A 3I56I 3CCJI 1YJNI 3EGVB 3CCVI 1FOXA 2E35A 5DM7F 4UY8I 1VQOI 4IO9F 1YITI 1VQ8I 2JQ7A 3PIOF 2OTLI 2ZJPF 1VQLI 2FOWA 2NXNB 1MMSA 3G4SI 3G71I 3CJRB 1VQKI 3PIPF 3CCEI 2E36A 3DLLF 3CCLI 2QA4I 3CCUI 3CF5F 1Y39A 5GAHJ 2H8WA 1YI2I 4IOCF 2QEXI 3CCMI 5GAGJ 3CCQI 1VQ4I 1S72I 5GAEJ 2ZJRF 5JVGF 1YJWI 2ZJQF 1VQ5I 4IOAF 1YJ9I 1VQNI 2OTJI 3CJQB 1HC8A 4V19K 5DM6F 3I55I 1YIJI 3CC7I 3CCRI 1WIBA 3CMAI 3J7ZI 5GADJ 1VQ9I 3CJSB 1VQMI 3G6EI 1VQPI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ACI A;  3CJT B;  3CCS I;  1FOW A;  2K3F A;  1YHQ I;  3CD6 I;  3CC2 I;  3CC4 I;  3J7Y J;  3CME I;  1VQ7 I;  1FOY A;  1QA6 A;  1VQ6 I;  2E34 A;  3I56 I;  3CCJ I;  1YJN I;  3EGV B;  3CCV I;  1FOX A;  2E35 A;  5DM7 F;  4UY8 I;  1VQO I;  4IO9 F;  1YIT I;  1VQ8 I;  2JQ7 A;  3PIO F;  2OTL I;  2ZJP F;  1VQL I;  2FOW A;  2NXN B;  1MMS A;  3G4S I;  3G71 I;  3CJR B;  1VQK I;  3PIP F;  3CCE I;  2E36 A;  3DLL F;  3CCL I;  2QA4 I;  3CCU I;  3CF5 F;  1Y39 A;  5GAH J;  2H8W A;  1YI2 I;  4IOC F;  2QEX I;  3CCM I;  5GAG J;  3CCQ I;  1VQ4 I;  1S72 I;  5GAE J;  2ZJR F;  5JVG F;  1YJW I;  2ZJQ F;  1VQ5 I;  4IOA F;  1YJ9 I;  1VQN I;  2OTJ I;  3CJQ B;  1HC8 A;  4V19 K;  5DM6 F;  3I55 I;  1YIJ I;  3CC7 I;  3CCR I;  1WIB A;  3CMA I;  3J7Z I;  5GAD J;  1VQ9 I;  3CJS B;  1VQM I;  3G6E I;  1VQP I; 
#chains in the Genus database with same CATH topology
 3Q9S A;  4TV7 A;  5J8C A;  1R36 A;  2XAQ A;  3ZQI A;  3A0B C;  3WGH A;  3E97 A;  5DD8 A;  3LSR A;  1X1P A;  2DTR A;  3K69 A;  2VBY A;  4LB6 B;  2W25 A;  4KIG A;  4Q47 A;  4XMY A;  3IKT A;  1SFU A;  4BY7 J;  5BPI A;  2E34 A;  2P6T A;  3F9K A;  4IHY A;  4MQ9 F;  2NVQ J;  4A3C J;  3DTE A;  3PUB A;  1ZGW A;  2KIM A;  5IOY A;  2GA2 A;  2HKO A;  1D1A A;  1Y0U A;  3NWT A;  2L4M A;  4EM0 B;  1VQO I;  3MVP A;  4B47 A;  2FF4 A;  1ZTR A;  4Y3O A;  1FSE A;  1LDK B;  2FE3 A;  4PGG A;  1YO5 C;  3S2H J;  4PJM A;  1YIT I;  1BIA A;  4PK4 A;  4XLC A;  2KDO A;  1GVJ A;  3LNQ A;  2RDP A;  3M1E A;  3OS1 A;  5CVI A;  3KX2 A;  2OA4 A;  3KYL A;  2K9M A;  3DWL E;  2AO9 A;  3W6K B;  2WV1 A;  2DFE A;  2XAJ A;  4Y17 A;  2DA5 A;  4KA4 A;  1DGW Y;  3HG9 A;  3Q0V A;  5CPR B;  3DTI A;  1UG0 A;  4BEH A;  3J80 K;  3CO6 C;  2MLK A;  4P96 A;  1FBU A;  5CQE A;  3F22 A;  1V55 H;  4ANJ A;  4CH7 A;  5FJ8 J;  3J80 Z;  2NRA C;  2PMZ N;  5F04 A;  1BJZ A;  1MJA A;  2A69 F;  1O3S A;  2I5U A;  4AYB N;  1MND A;  4S04 A;  2DN0 A;  2VE9 A;  3Q9V A;  4RM2 A;  2GWR A;  4ZYE A;  3F8N A;  2M7B A;  3VSL A;  1H0M A;  4E70 A;  3OSG A;  3WGG A;  2UZK A;  2V79 A;  1XMX A;  3J81 K;  1DP3 A;  1P9Q C;  1HW1 A;  2W1O A;  2LR8 A;  4IPA A;  4CO8 A;  1WJF A;  2LLK A;  3H5R A;  2LBF B;  4BQA A;  1A04 A;  3J81 Z;  3OMY A;  3IL2 A;  3ELK A;  1LDJ A;  1MBE A;  1FP2 A;  4EM2 A;  2Z33 A;  2EA2 A;  3SFI A;  4BQO A;  3G2B A;  5CVU A;  3ZQG A;  2L7Z A;  4BUP A;  1KQ9 A;  3WGI A;  3P9K A;  2XF7 A;  3WTZ A;  2HWV A;  3K9T A;  3EQL F;  2FJ1 A;  4YEJ A;  4XOP A;  2ZO4 A;  3CF2 A;  1FBQ A;  3JRB A;  1IRG A;  2EK5 A;  3M9A A;  3WHB A;  2A3S A;  3HPG A;  2M1B A;  1ONV A;  4ENJ A;  1YYV A;  2QWW A;  1D0Y A;  3BY6 A;  3CDI A;  3LSH A;  2FX0 A;  4YEL A;  1EH6 A;  2K3F A;  5EDN A;  1ZRE A;  1UST A;  2MGQ A;  3GTP J;  4ZZL A;  1I6H J;  1W36 D;  1B6A A;  3F8B A;  4GCV A;  2R7V A;  1ENH A;  5H20 A;  1VZ0 A;  4R1H A;  5J47 A;  2XAS A;  1P7J A;  1XDU A;  5D6E A;  1B4A A;  1K7A A;  5IT9 K;  1WJD A;  1SD5 A;  2O61 A;  1R5I D;  1EV7 A;  2VQG A;  4HZF A;  5IT9 Z;  2PLY A;  2FQ3 A;  1MBH A;  4I09 A;  3RCO A;  3K4C A;  3M07 A;  2OZ6 A;  4U0Y A;  4AID A;  3PM1 A;  4ESF A;  4MHG A;  3K2Z A;  1QRY A;  1EF4 A;  1BR1 A;  1G4D A;  5B3S H;  4J19 A;  3PNY A;  1OCP A;  5J1Y A;  4J01 A;  2PMH A;  2YX4 A;  5FKK A;  2L9V A;  1T0F A;  2JSP A;  3IH2 A;  2OQG A;  5DYM A;  3BG6 A;  4PFP A;  1VFC A;  1VQL I;  2QUF A;  1V3F A;  3KYD B;  3TGN A;  1S5L C;  2VUM J;  5LHH A;  1SD4 A;  3KLO A;  2P7V B;  5K7Z A;  1LPQ A;  4BKX A;  2UWM A;  2YU3 A;  4BXX J;  1S8N A;  1DUX C;  4DNC A;  2XC7 A;  1P7I A;  3L7W A;  1AOY A;  3JRE A;  3HUG A;  4JX6 A;  1LE8 A;  4AVZ A;  2QSH X;  3K70 C;  1Y8R B;  1X4O A;  4EJV A;  3BQY A;  4EQQ A;  2QCO A;  4QTR A;  4JP0 A;  2WAF A;  5J1R A;  4U88 A;  3REO A;  2R7S A;  3ZQL A;  4PJ0 C;  4XSZ F;  3P9C A;  3SYT A;  1RES A;  3OOP A;  1Z6T A;  3BG5 A;  1T6S A;  3IC7 A;  3V7R A;  1U3E M;  4RBO A;  1GDT A;  4NQW B;  2YU9 J;  3D5R C;  4HYE A;  3TMO A;  2GQQ A;  2YR2 A;  3ASN H;  3PNT A;  1K78 B;  2WC2 A;  4R8H A;  2LFB A;  3JRG A;  1SAU A;  1GXP A;  4A0Z A;  4IF4 A;  1Z21 A;  2CH0 A;  1HKQ A;  4ZDL A;  1CF7 B;  2STT A;  2IS1 A;  2BVM A;  2VAS A;  3A2K A;  5IP6 A;  2JA8 J;  1MBK A;  2F48 A;  4MNU A;  4O5V A;  3RPQ A;  1S29 A;  5E8G A;  1U78 A;  4HA8 A;  2EIM H;  1C0W A;  1KYZ A;  3MEX A;  3I71 A;  1JT6 A;  5F64 A;  4HG2 A;  3ZMU A;  2IPQ X;  3GWZ A;  3KEQ A;  2DLL A;  2VKD A;  3KZY A;  4I01 A;  4FAS D;  4DZP A;  1MH4 A;  4N9I A;  4B3A A;  3BR1 A;  3G3Z A;  2CU7 A;  1OYW A;  2VON A;  3CTA A;  4EJT A;  2X51 A;  4IHS A;  3F6O A;  2G7H A;  2K9Q A;  1KU9 A;  1BW6 A;  3F0C A;  3HJE A;  2F5E A;  2BOL A;  1SC7 A;  2M8E A;  1KU3 A;  2UUZ A;  2DW4 A;  3HKZ A;  5FKN A;  3I56 I;  1YRN B;  4MFD A;  4ZYG A;  1SMY F;  2ZXW H;  4KN4 X;  1ZRD A;  5EEG A;  1U5T A;  1ZRF A;  1U2W A;  4HST A;  4I0B A;  2Q2E A;  3OIP A;  5IYC J;  2XRO A;  1W0T A;  1LB2 A;  1HA8 A;  5E79 C;  2VJ4 A;  2LH9 A;  2X6Y A;  1D3Y A;  2DA7 A;  4MO7 A;  2RQQ A;  2QQB A;  1VQ8 I;  2JQ7 A;  4C30 A;  4E7S A;  1MJB A;  1BA5 A;  3FBN B;  1JGG A;  4C2T A;  2ZME B;  3KZI C;  4JYK A;  2IGN A;  2W24 A;  2XPU A;  3B73 A;  3AG4 H;  3NRV A;  2ZFU A;  2BW3 B;  3RIR A;  1WFX A;  2L2O A;  2HZT A;  4BHC A;  4A3K J;  1JUP A;  4L0Z B;  1QZZ A;  2XB5 A;  1OJL A;  1FOK A;  2ICW G;  2VXZ A;  2KLO A;  5JR3 A;  5DV5 A;  1E17 A;  2DDB A;  2QVO A;  3QU3 A;  2HI3 A;  2KIU A;  3FXQ A;  4M3G A;  2A6H F;  1A6I A;  5FRO A;  2CV1 A;  1USS A;  3HB9 A;  2X6O A;  3SQN A;  4I99 C;  2QEX I;  2ESN A;  2X6X A;  3WTU C;  3OYC A;  2B7E A;  5FFX A;  4ZTJ A;  1IDY A;  1OIS A;  4IJA A;  2GXB A;  2E1M C;  1WJC A;  2CQX A;  1LVA A;  5LD2 C;  2LKS A;  1E0E A;  3BJO A;  2MSY A;  2P6S A;  2XKO A;  4OIO F;  5LBQ A;  2EB7 A;  2RV8 A;  4LFU A;  4FET A;  3RI4 A;  3QYE A;  4A0X A;  1X3U A;  1O7F A;  1G2H A;  5LEJ A;  4NC6 A;  2ZNZ A;  1W5T A;  1WI9 A;  5JLX A;  1RKW A;  5JHU A;  1CGP A;  2E1N A;  1R7J A;  3FXJ A;  3ECO A;  3BP8 A;  3HTU A;  1IF1 A;  1KON A;  4M6Y A;  4HX4 A;  1I1S A;  3QAH A;  1H8A C;  1XTA A;  4G7Z F;  3RPU A;  2F2E A;  1OKR A;  3S1M J;  2M4G A;  2W85 A;  3WU2 C;  2DI3 A;  3BZC A;  3CC7 I;  4MEY F;  3V8L A;  1IN4 A;  1HW5 A;  1JKP C;  2A07 F;  2EFO A;  4NDL A;  1OMI A;  4HV6 A;  1VQM I;  4YRV A;  5FD6 A;  2BZT A;  2PEX A;  4HX7 A;  1YHQ I;  3DKX A;  2WAQ N;  3HYI A;  2KJC A;  3TO9 A;  4NUB A;  1WH7 A;  1E3H A;  2PG4 A;  3BR3 A;  1SVO A;  2E2J J;  2BE5 F;  4A3I J;  2FBH A;  3QPH A;  2M0M A;  3BPV A;  1NK3 P;  3FXU A;  1G3S A;  4A0Y A;  1Y8Q B;  2XF6 A;  3BTC A;  3FKI J;  1GT0 C;  1HDD C;  3HGG A;  1U8R A;  2YSR A;  3OYL A;  1YQA A;  1Z6R A;  3QU6 A;  4CSW A;  1N77 A;  1DQU A;  4EMS A;  2ZXI A;  1J9I A;  3PO3 J;  2VKE A;  3I4N J;  2EFP A;  4UVA A;  3S3M A;  3VB2 A;  1EKE A;  3FX3 A;  5KHD A;  3GFL A;  3PQK A;  3ZR8 X;  3I4M J;  3HOU J;  4FQG A;  1Z3Y A;  3GEZ A;  3KEY A;  2DPD A;  5HVQ C;  1IN6 A;  1TWG J;  5J6X A;  2R7Q A;  4A3B J;  1R4M B;  1XN7 A;  3G4S I;  4BEH B;  1YLF A;  3L2Q A;  4X1E A;  3ABM H;  5F27 A;  2ZC2 A;  2PQ8 A;  2QYO A;  1X1B A;  4HNU A;  1R71 A;  1G3Y A;  5FKM A;  2IS6 A;  1XX5 A;  1GUU A;  3W6V A;  4IVN A;  2Y31 A;  2E71 A;  2WV0 A;  4IKF A;  1MKM A;  2KRF A;  4NHJ A;  1JUM A;  2CW7 A;  4QWQ A;  3DEU A;  5LHG A;  5CKT A;  5HS8 A;  1XGS A;  4IOC F;  1E2X A;  2WY7 Q;  3GLL A;  3T8R A;  4FT8 A;  1B9N A;  1X2N A;  2W00 A;  3WOD F;  2V1U A;  1RC9 A;  4XLH A;  4L5E A;  2MD5 A;  3AL0 C;  5CQG A;  5GAE J;  3E6B A;  2GIZ A;  2ZJQ F;  4FX4 A;  3RKY A;  4NC7 A;  1T08 B;  4UXN A;  2NVT J;  2DBB A;  3IRQ A;  1H89 C;  4PCQ A;  2VT2 A;  5FRM A;  4ENM A;  4D1Q A;  2R7Z J;  2D2W A;  3ERE D;  2H1K A;  3K6G A;  3LQR A;  4B1R A;  2OZU A;  1WKM A;  3EUH C;  3IH4 A;  1FSH A;  3I58 A;  1FIA A;  5E3N A;  3CCR I;  1ETX A;  3LSM A;  1XPX A;  1STZ A;  3CMA I;  1WJ5 A;  1D0X A;  1W7P B;  1SAX A;  1FEX A;  1HF0 A;  4QPO A;  2GOM A;  4CZC A;  4JBA A;  2O03 A;  4NNJ A;  3GBG A;  4LMY A;  1U9O A;  2CW8 A;  2FXA A;  3ZMV A;  4XOT A;  4JK1 X;  2NOG A;  5F1J A;  4L9J A;  3CCS I;  4H4K C;  2QQA A;  5JI6 A;  2VBX A;  3AG2 H;  4UVB A;  3JR9 A;  2KRC A;  4D5C A;  4R79 A;  1B1B A;  3VEP A;  2QBY A;  2VL8 A;  2HYG D;  1UHW A;  5EGO A;  1R4N B;  3FXO A;  1QA6 A;  1YTY A;  1MMD A;  2F4O B;  2G7U A;  3GME A;  3T8T A;  1T39 A;  3AAF A;  3I0T A;  1ZN2 A;  4WK8 F;  2JSC A;  4B4C A;  1YFH A;  2V1D A;  5H6Q A;  2ZXH A;  5FD5 A;  3SXY A;  3R61 A;  2ETH A;  1OCC H;  1BC7 C;  3MKL A;  5HLT A;  3F23 A;  1MH3 A;  3EPZ A;  3GYH X;  4KFC A;  3ZMS A;  4D5F A;  2V1X A;  4OIN F;  4KMU X;  5ERI A;  3DU6 A;  1S7E A;  1T38 A;  2XAH A;  3RYR A;  1LFP A;  4E7H A;  1ZH5 A;  4YFK F;  2K7L A;  5H6R A;  3OS2 A;  3DV8 A;  4EAT A;  1JTY A;  1ZRC A;  3ZN0 A;  2Y30 A;  1F1Z A;  3G71 I;  2ZXJ A;  2IS2 A;  1PUF A;  3HUG B;  3L9F A;  1LE8 B;  2DOA A;  1J75 A;  1ULY A;  3V8K A;  2IW5 A;  2ELK A;  2LOO A;  1I3Q J;  4E7L A;  5K5R A;  3WTW C;  1TW3 A;  3BG7 A;  3GVA A;  1Q1V A;  4C3I J;  3HHH A;  5GAH J;  3H0G J;  3FIS A;  1OYI A;  1WJB A;  3BTL A;  3HPH A;  4DJA A;  4S0H B;  2A6E F;  2A05 A;  1PDN C;  4QIW N;  2OQR A;  2CFX A;  2LNB A;  4Y13 A;  1IN5 A;  2DT5 A;  2YX7 A;  2UXN A;  2QSF X;  1T33 A;  5LGN A;  1LFU P;  3SEZ A;  3BRO A;  1V5E A;  4YG2 F;  3HOW J;  3X2Q H;  1HCR A;  4OU0 A;  3V7C A;  3IAM 2;  1ZLK A;  2G0E A;  3PFY A;  1FYK A;  1KYW A;  1KU7 A;  3CLO A;  2I10 A;  4BHP A;  2H09 A;  3LSK A;  1S7O A;  1UFM A;  2JA7 J;  2KJB A;  1YG2 A;  4ASN A;  3LFU A;  4RM3 A;  4FTH A;  4I76 A;  4OMZ A;  1YW8 A;  4XNF A;  3IHU A;  2CFO A;  1LNW A;  2NVX J;  3B6A A;  2ELJ A;  2ELH A;  4XN3 A;  5IP7 J;  1WIB A;  1X19 A;  4K2E A;  4OWR B;  3BTJ A;  4WXC A;  2CMP A;  2LG4 A;  4II3 A;  3GLX A;  3I54 A;  5CVJ A;  2QSG X;  2QKM B;  3SJM A;  1RIO H;  2JJ7 A;  3ASO H;  2W82 A;  3D5L A;  3A0H C;  3S1N J;  3VFZ A;  2P4W A;  2VBW A;  4N4O B;  2L3D A;  3DBH B;  3BPX A;  3KFW X;  4RB3 C;  3HRM A;  4M3F A;  2ME6 A;  5LLQ A;  2OJE D;  3S15 J;  1W1W E;  4HW0 A;  2V9K A;  5KNL A;  3KP6 A;  3HSR A;  1U5T B;  2O0Y A;  3FXL A;  4AWX B;  2CQ7 A;  4M3D A;  4IX7 A;  1X1D A;  3ABU A;  3T1B A;  2IXS A;  3ZQQ A;  2XF5 A;  3OOU A;  1BC8 C;  2X1D A;  1MJ9 A;  3HL2 A;  2H8R A;  3KLN A;  1KU2 A;  3R0A A;  3CP2 A;  2VQH A;  2E35 A;  4N0B A;  4KT5 C;  4OMY A;  2P7C B;  2EPF A;  4X6A J;  2XAF A;  2X4H A;  4P5O A;  2VLA A;  2A68 F;  4UB6 C;  2WAE A;  5J3L A;  4YII A;  1BOB A;  3TO7 A;  4ZTF A;  4RAY A;  1RNL A;  4GYG A;  3DCF A;  4LGW A;  3WE2 A;  5E3O A;  4X0G A;  4WF2 A;  3Q5F A;  2JRM A;  2R5Y A;  4N4N B;  2FML A;  5TGT A;  5GTI C;  3R4K A;  3CCE I;  3LQQ A;  4FX0 A;  2HOS A;  3IWZ A;  3QOE A;  4IEJ A;  1RKT A;  1I27 A;  2HVR A;  3GX4 X;  3CCU I;  2DMN A;  2XGX A;  3DQV C;  3OL3 A;  1QHG A;  1Z0X A;  2VKH A;  4A3F J;  5HDN A;  3PJR A;  3BR0 A;  4A3D J;  2IS4 A;  2R7T A;  1OPC A;  5TRD A;  3M3Y J;  3OYJ A;  5D8L B;  4Y33 A;  5ILU A;  3HRS A;  3NQO A;  2GA1 A;  4AIJ A;  4CGZ A;  2DA2 A;  4UUS A;  1WJE A;  3GZN B;  4HAM A;  2W48 A;  2ZJ2 A;  1MW7 A;  5HLH A;  1QBJ A;  4CZZ A;  2L4A A;  4P9U A;  3BTI A;  1WPK A;  3W2W A;  1Z7L A;  1X4P A;  3OYE A;  1Y0N A;  3ECH A;  2F5F A;  3FM3 A;  1EJ9 A;  9ANT A;  2HKX A;  4A3L J;  3N05 A;  1P4X A;  2DAO A;  2L9S A;  1TP4 A;  2ZNY A;  3KPH A;  4ZH4 F;  4RGS A;  5GPA A;  2HS5 A;  1P6R A;  2PJP A;  3SZT A;  1A31 A;  2OTJ I;  3JSO A;  4A3M J;  3DPL C;  3QWL A;  3GTG J;  2Y0S A;  4OAY A;  3FHZ A;  2V6C A;  2IGO A;  5FKL A;  2JA5 J;  5HOO A;  2NS8 A;  3I55 I;  1YIJ I;  2Z99 A;  3EYI A;  4GDF A;  1POG A;  1R49 A;  2GXG A;  2EFQ A;  5BMZ A;  2C6Y A;  3SHF A;  1UCR A;  2XGC A;  3K4M A;  3OIO A;  4EJW A;  3SDG A;  1ON2 A;  3L00 A;  1SFX A;  5GAD J;  4CCJ A;  1WCM J;  2CWE A;  3LSI A;  2PX9 A;  1ZR4 A;  3C3W A;  4E7J A;  2F4I A;  2HOT A;  3ABL H;  5J4V A;  5K7H A;  1FYM A;  1R5G A;  2E5Z A;  5ICE A;  3CME I;  2A61 A;  2P5K A;  5L3G A;  1IRX A;  2EH3 A;  3HOS A;  1FIP A;  1U9N A;  3CCJ I;  1YJN I;  3FXK A;  2V1N A;  2FA5 A;  5LGU A;  4G94 A;  3OYM A;  4YIF A;  3CUQ C;  4KDP A;  4CCK A;  5M3M J;  3H9G A;  1VF9 A;  1ZYR F;  4CYD A;  1F5T A;  1WSU A;  4HLX A;  4BHB A;  3S14 J;  1REP C;  2KL4 A;  1IV6 A;  2VQL A;  3MAJ A;  3GFM A;  2CGP A;  2MG4 A;  1TWH J;  1D1C A;  2KIS A;  2LP0 A;  1TL8 A;  5HLI A;  3SEQ A;  5E17 F;  3JRI A;  2DTZ A;  1FC3 A;  5L3B A;  1R00 A;  5J40 A;  4B09 A;  2E36 A;  3LST A;  3IRR A;  3OYN A;  4B48 A;  2K4B A;  2EJR A;  2VN2 A;  1VTN C;  1Q1H A;  2HTJ A;  1WHU A;  1G3T A;  4HV5 A;  2Y0M A;  2JK3 A;  1N78 A;  2GOX B;  2HOE A;  3B02 A;  2BBY A;  3GTO J;  2DYS H;  2DMP A;  1BI1 A;  2E2H J;  4HF1 A;  1S72 I;  5IP9 J;  4HSR A;  4WWC A;  2NVY J;  2L7M P;  5BS6 A;  1QHH D;  3L2V A;  2CV2 A;  1YJW I;  4CIC A;  2OPT A;  4IQJ A;  4EGY A;  1XCV A;  2R5Z A;  3FIW A;  1QVT A;  4ZYH A;  1JJ8 C;  3IP4 B;  1MMA A;  1OR7 C;  3MWM A;  2EIJ H;  3CO7 C;  3I59 A;  4BE1 A;  3AFH A;  4O3M A;  2O8K A;  4HQM A;  2HDW A;  4XLE A;  3TBI A;  4W97 A;  4GGG A;  1H9G A;  2LY2 A;  1AWC A;  2W84 A;  2VC0 A;  3U21 A;  2XAU A;  5DM6 F;  2L02 A;  2VIX A;  3ABK H;  1X1A A;  2M34 A;  2VQC A;  3J7A O;  2K5C A;  4DIQ A;  5FO5 A;  4UNO A;  4I02 A;  4GO1 A;  1JXS A;  3FK6 A;  4RB2 C;  3A02 A;  1UZC A;  2JPB A;  3G1L A;  1QZE A;  4RS8 A;  1JKQ C;  2NS0 A;  5H2F C;  1FJL A;  4HPQ A;  1QGP A;  4FCY A;  1ACI A;  4KMF A;  2QBY B;  2IJL A;  1FOW A;  2IA1 A;  2JTV A;  4IHV A;  3H92 A;  5EGO B;  3V42 A;  5ICF A;  4MTD A;  1WI3 A;  4YIR X;  3RKQ A;  4BJT A;  3M1C A;  1O3T A;  3CC4 I;  1S3J A;  3K7A J;  4DQ2 A;  3LSJ A;  3Q3S A;  3ZCO A;  4BU2 A;  1TWC J;  1D8J A;  3O8G A;  3OR1 C;  3BLY A;  2EBI A;  2QQ8 A;  1XB4 A;  5CLS A;  1JTX A;  4FE7 A;  2LF7 A;  1MZB A;  2AXT C;  3EGV B;  1MIJ A;  2UV1 A;  2DJN A;  4B43 A;  3UKG A;  3TW7 A;  3WTV C;  2IRF G;  1SD7 A;  1FOX A;  1TT0 A;  2B0L A;  1RRJ A;  3BR5 A;  1HLV A;  5CJ9 A;  3LAJ A;  3IUO A;  4UY8 I;  3L2C A;  2VOP A;  3UR3 C;  3K70 D;  5L3E A;  4IO9 F;  1PYV A;  2VKV A;  4RLQ A;  3ONQ A;  1SMT A;  1Y1V J;  1AKH A;  1HST A;  1PUF B;  3GZ5 A;  3H1C A;  2V26 A;  2XVC A;  3O6B B;  5IYD J;  1GHC A;  3K1P A;  3U9G A;  4B44 A;  2VJJ A;  1Y6I A;  3QOD A;  3GW2 A;  4Z6Y A;  3CJR B;  1HBX G;  2CUZ A;  2Y48 A;  3U1K A;  4O6J A;  4PDK A;  1R5H A;  4CCO A;  1XS9 A;  1N75 A;  3A01 A;  4QSH A;  2P8T A;  3FXM A;  4RGU A;  2BEO A;  5JVT A;  5FLX K;  3OV8 A;  1IZ1 A;  2Z3Y A;  4AIK A;  3GTL J;  2IP2 A;  1FPQ A;  5E8I A;  2IAI A;  5FLX Z;  4P1W A;  1MSE C;  2K9L A;  2KFD A;  3RJP A;  2QKL B;  4E7I A;  1AA7 A;  2DFH A;  2IEK A;  5HLG A;  3CCM I;  2BHZ A;  5GAG J;  2O5R A;  1J59 A;  1BL0 A;  1RI7 A;  4LIU A;  3VYT B;  4PSW A;  2LKP A;  2XUB A;  4CYC A;  5A2Q K;  1JHH A;  4XRF A;  4NB5 A;  2VT3 A;  4P9F A;  1QO0 D;  5A2Q Z;  1Z05 A;  2XPW A;  4IOA F;  3HZJ A;  4ESJ A;  3BC8 A;  5L3D A;  4IRG A;  2XSD C;  1VQN I;  5IPA A;  1XD7 A;  4ZYA A;  1IJW C;  2OU2 A;  3DEW A;  4RAZ A;  3MZ8 A;  2CRG A;  4E6K G;  4F92 B;  5E1Z B;  1HSJ A;  3K2A A;  4N9H A;  3S3N A;  3E5X A;  3M7G A;  3RSN A;  2HPI A;  4G8X A;  5KAI C;  4RMN A;  1BW5 A;  5FLV A;  4CXF A;  4BY1 J;  4PFO A;  3LSG A;  2A6T A;  4Y15 A;  1JKR C;  2XHK A;  4XON A;  2HNH A;  2ZBK A;  4OIP F;  4BAY A;  3JRC A;  4L9T A;  1TLH B;  2A5Y B;  4M74 A;  4BQQ A;  1IRZ A;  3SZG A;  5DCM A;  3LWF A;  3JTH A;  3OWT A;  3VSK A;  3HOT A;  5JFR A;  2MBF A;  1IUY A;  1ZAO A;  2QM3 A;  3MKY B;  2R92 J;  1PVE A;  4BH9 A;  3I9V 2;  2HVQ A;  3KIO A;  1B8I A;  3EUH A;  4AUX A;  1KA8 A;  3VDX A;  2Z16 A;  2KP6 A;  1R6R A;  3WTS C;  1FNN A;  1F36 A;  2Y75 A;  1MDM A;  1VND A;  1ETK A;  2PJR A;  3V4G A;  3BZK A;  2MA3 A;  3L2U A;  3JRH A;  3BR2 A;  1UAA A;  2TRT A;  3TKY A;  2CQQ A;  4XLF A;  1BI3 A;  2VB6 A;  4PJJ A;  4IXA A;  2EIL H;  2LRE A;  3VYS B;  4BXU A;  3E6D A;  2XKP A;  3LFK A;  1K61 A;  2E1C A;  2V6E A;  1HDP A;  1VQK I;  2XRL A;  3ERM A;  4HF0 A;  4E7Z A;  1EH7 A;  2RAE A;  3DXJ F;  3MZY A;  2Y69 H;  3QP5 A;  4DBR A;  3HOZ J;  2WTE A;  4MEX F;  2JVG A;  2OC6 A;  1A5J A;  1D8K A;  2QA4 I;  3VOD A;  4BDY A;  2HFH A;  3CF5 F;  5ED4 A;  3F8F A;  3KCC A;  4UUS B;  3S1Q J;  2K02 A;  3OR2 C;  4S05 A;  3ZN1 A;  2RN7 A;  1B72 A;  1DU6 A;  1DGR M;  2IGK A;  3S2W A;  3ZQF A;  5B1A H;  5EJC A;  1SVM A;  5K5O A;  2LDU A;  1GV2 A;  4PSX A;  4Z2Y A;  3FHN A;  3JAM K;  2EFN A;  3E1S A;  2E1O A;  2P5V A;  2HQN A;  3JAM Z;  3F21 A;  4U7B A;  3FM5 A;  1DPR A;  1OFC X;  2P5L C;  2HZD A;  3G73 A;  1XSV A;  2QF7 A;  3FBI B;  4HDU A;  2VPR A;  5EZH A;  4ETS A;  2IA2 A;  2BY0 A;  1OCZ H;  2OCE A;  4GFB A;  3DLA A;  2E5N A;  2X85 A;  1YI2 I;  4LK1 F;  5K1Y A;  3OIQ A;  4Y4R A;  2XSJ C;  5D5X B;  1SFE A;  1W0U A;  3J7Z I;  2DQR A;  2LY1 A;  2DOD A;  2XRN A;  3K4B A;  5CYV A;  3BCA A;  3K1N A;  3I64 A;  3KYC B;  3RKX A;  3KP7 A;  4GYI A;  1FMV A;  3JRF A;  5F0H A;  1K4T A;  3PSI A;  3AKZ A;  1X2M A;  4I98 B;  1V54 H;  2L5Q A;  4FHT A;  4KUM A;  1BN5 A;  3I3L A;  3OYG A;  3CDL A;  2X1E A;  1G6N A;  3U1D A;  1TZL A;  1WGX A;  5M5X J;  2L9R A;  3ISP A;  4JQF A;  4C3J J;  1MMG A;  2Z2S B;  3CZ6 A;  4DYR A;  3OYI A;  3QPL A;  3OL4 A;  1J5Y A;  2RNJ A;  2K4J A;  4HDV A;  2LF8 A;  2YUS A;  1RUN A;  3K0L A;  4E7K A;  1ZG1 A;  2RNG A;  3HSF A;  4BL0 B;  3CCV I;  2R4G A;  2GBY A;  4II2 A;  2DFF A;  4UB8 C;  2LMD A;  1ETQ A;  2QGU A;  3HDD A;  2HVS A;  1YX3 A;  4KN7 X;  2L01 A;  2L7F P;  5CVV A;  3BJA A;  2ZSI B;  3ULQ B;  4BBR J;  3PIO F;  2CW0 F;  4FE4 A;  4KIS A;  2FOW A;  1MBF A;  2NXN B;  2WB1 N;  3FZV A;  1FBS A;  2MW8 A;  2EZH A;  4G9Y A;  1E3O C;  2GZW A;  2KZG A;  3GTM J;  2AXL A;  2CO5 A;  3B6C A;  3A1Y A;  4XOR A;  5DD4 A;  2X0L A;  3BCB A;  2XPV A;  4ENK A;  2VC1 A;  3S8P A;  1FLI A;  3CCL I;  2DA6 A;  4CA0 A;  3BQZ A;  2FBK A;  3QP6 A;  5F0C A;  4B8X A;  4LG3 A;  2F4M B;  4HRI A;  5EZG A;  4RDU A;  2O9L A;  2L54 A;  3HGY A;  3H5N A;  1SAN A;  1T95 A;  1XSX A;  2PMZ A;  4RA2 A;  4XM3 A;  4NC8 A;  3JCU C;  3MZH A;  2F5V A;  2FSW A;  4JX4 A;  5EEA A;  2DA3 A;  3C18 A;  4U87 A;  5FGM A;  3HEF A;  4AYB A;  4G6Q A;  1BR2 A;  4OOI A;  1Z91 A;  3GXO A;  1CF7 A;  2R5Z B;  4Q5S F;  3RKW A;  1XSD A;  4IQ4 A;  2ISY A;  5E1X A;  2ADU A;  2HOA A;  4I7H A;  2GIV A;  1TBX A;  2WBM A;  3M8F A;  3I59 B;  4D7M A;  2QZ8 A;  1GV5 A;  2RRE A;  4A69 C;  3DPT A;  1TWF J;  3WU1 B;  4HX8 A;  1OCT C;  4M3B A;  4C2M J;  1YJ9 I;  2HXI A;  4IHX A;  2TCT A;  3N97 A;  3HTS B;  2R7O A;  4BBS J;  3TED A;  2JA6 J;  4ON0 A;  2V7F A;  2FEZ A;  3M8J A;  4G12 A;  4QPQ A;  2CJJ A;  2E1M B;  3RQ4 A;  5DTD A;  4EEF G;  4LIV A;  2R93 J;  3LAP A;  3CP8 A;  3K4L A;  3TQN A;  2JMW A;  1YOV B;  2QEN A;  1P2F A;  3G6E I;  4ENN A;  1YRN A;  4HBL A;  2M7A A;  2X9D A;  3Q0W A;  1IUF A;  1IV8 A;  4G6D A;  5J1U A;  4CCN A;  3HOV J;  3PQJ A;  3DPU A;  3W2A A;  3CD6 I;  2DT7 B;  2HGC A;  1R58 A;  2BY2 A;  4LLG F;  4WX9 A;  2H94 A;  2RQP A;  3J7Y J;  1U8B A;  4OAZ A;  3VWB A;  3K4J A;  3FDY A;  1FOY A;  2JVH A;  4KIF A;  2QQ9 A;  4LG0 B;  2CV0 A;  2Z1D A;  3EUA A;  3F8C A;  3F6V A;  2F5C A;  3MMY B;  2LK2 A;  4ESB A;  2VBZ A;  2VJI A;  5D5U B;  1D5Y A;  1TQP A;  1Z1D A;  5EF6 A;  3V7S A;  5DM7 F;  1AKH B;  3S16 J;  3N4M A;  4Q48 A;  1MNM C;  2X48 A;  1QU3 A;  5D6F A;  5DUI A;  3JW4 A;  3K4N A;  4J00 A;  3OSF A;  2OUM A;  2JT1 A;  3L2R A;  2MC4 A;  4IL6 C;  1P4A A;  4BXF A;  3A01 B;  1KQ0 A;  3LSP A;  3GFI A;  1J7K A;  2O7O A;  1UB9 A;  1FT9 A;  3FXR A;  5D4R A;  1OYY A;  2EQR A;  4RAF A;  3S32 A;  4BAC A;  2Q2E B;  4U7D A;  4XRS A;  2LSO A;  3KE2 A;  4A12 A;  1IN7 A;  3GZ6 A;  2HQA A;  2ECB A;  2NOJ B;  2G9W A;  3CMY A;  3S2D J;  1MNE A;  4HOB A;  2E7X A;  4QLC U;  4LG0 A;  2MH9 A;  3CUQ A;  1WVR A;  2KIF A;  2BY1 A;  1I3A A;  4BNC A;  4M71 A;  1XCB A;  1XGN A;  3D5S C;  4CYC B;  2PMU A;  2L0K A;  2ID6 A;  2JPC A;  3LL7 A;  2X1C A;  3CUO A;  4IHW A;  4Y52 J;  3DKW A;  5F08 A;  3MCZ A;  4U0V A;  4UVC A;  2AHQ A;  2KIQ A;  3CQZ J;  2XDV A;  2JZY A;  2DO7 A;  3FWE A;  2ZJR F;  5JVG F;  5D4S A;  4BJ6 C;  2O3F A;  1T8I A;  2EV0 A;  1X3W B;  1ON1 A;  2Q0O A;  3MFK A;  3H3Z A;  2I8D A;  2NNY A;  3T0Y A;  2H27 A;  1MSF C;  5ILS A;  4DGW B;  1K83 J;  4ZC3 A;  2VJ5 A;  5M5Y J;  5EG0 A;  1BIB A;  1R1V A;  3K4K A;  1RZ4 A;  3ZMD A;  2R7U A;  3GCM A;  2GAU A;  1NTC A;  1ZGJ A;  2IVM A;  4CUG A;  1YS6 A;  2M5W A;  4PJN A;  3AL0 B;  2EZL A;  4I0A A;  3WTX C;  4UUV A;  1U6G A;  2BGC A;  2DXI A;  2FRH A;  4EVI A;  2M8G X;  4M9Z A;  4EJU A;  4MTE A;  1RR7 A;  1LJ9 A;  3C7J A;  2K9S A;  1J09 A;  4WXH A;  3I5U A;  1VQP I;  3DFG A;  1F43 A;  2AQF A;  4E4H A;  4L5J A;  3VOE A;  1ZR2 A;  3BJ6 A;  4M72 A;  5DCM B;  1ERD A;  1H88 C;  5AON A;  5KCM A;  1IRF A;  5D8K B;  2BY3 A;  1TQI A;  2JRT A;  4BYY A;  1A35 A;  4XRS G;  1JI8 A;  2IBD A;  3BWG A;  2DA4 A;  1OR7 A;  3CLQ A;  1OLT A;  4XRM A;  5ICC A;  4XSX F;  1D1B A;  1IN8 A;  4M6X A;  3TDZ C;  3A03 A;  1B8I B;  4DOZ A;  2HR3 A;  4WXD A;  2ZME C;  2KPM A;  1VQ6 I;  1WJA A;  4XK4 A;  1MDM B;  2CYY A;  2COB A;  1I1G A;  1NK2 P;  2PJR B;  2BVL A;  3QQA A;  2LRD A;  4DYC A;  1UMQ A;  3DF8 A;  2XIG A;  1NH3 A;  2DMQ A;  2N8G A;  3E3V A;  1LUJ B;  2ID3 A;  2K3P A;  4A3G J;  4DZJ A;  2ME0 A;  5DCF A;  2YS9 A;  4F91 B;  3BDD A;  2R3S A;  4M9X A;  1ZAR A;  2ZSH B;  3G1M A;  4BE2 A;  3S17 J;  5E1W A;  1EH8 A;  3E6M A;  1W36 C;  4F52 A;  3H36 A;  2YPR A;  2FU4 A;  1G3W A;  2FOK A;  2FBI A;  2VPL A;  3TOB A;  2FNA A;  3MKZ A;  1ZEL A;  1Z67 A;  5LRS A;  1YE9 A;  1T98 A;  5KAF C;  2M0C A;  4KIB A;  2MAB A;  3HM5 A;  3JSP A;  3C2G A;  2ZKZ A;  1LVK A;  1B72 B;  2LVS A;  5L3C A;  5B66 C;  1TC3 C;  1XGM A;  2O8X A;  2F6C A;  4IRI A;  3ZQH A;  4MIM A;  4UV8 A;  4XR6 A;  2L9N A;  4B3X A;  3P7N A;  5FKO A;  4MFE A;  1IAW A;  1MGT A;  2PI0 A;  4BJ5 C;  3KP4 A;  4V2G A;  2DOE A;  2M45 A;  3HRT A;  1I39 A;  2RKH A;  3K1M A;  4M9S A;  3W6J B;  2D45 A;  5C4J J;  1S9H A;  1XG1 A;  1FZP B;  4LLL A;  1W7P A;  2D5V A;  3BOQ A;  1BR4 A;  2IGM A;  1UJ8 A;  2JUG A;  2E7W A;  4UHT A;  4H0E A;  3P5J A;  1IC8 A;  4ABZ A;  1DPU A;  3CES A;  2WAD A;  3LA7 A;  3QOP A;  4CDG A;  4A3E J;  2OBP A;  5EYR A;  2H1L A;  3F72 A;  1P4W A;  1D0Z A;  3QRF F;  2JWT A;  3MD2 A;  3JRA A;  1HQC A;  1W5C C;  2XB0 X;  4F7Z A;  1FX7 A;  3VPR A;  5C4X J;  1I6X A;  2JA2 A;  1MBG A;  2R7R A;  4KIC A;  2QLZ A;  1B9M A;  1Z9C A;  5LEK A;  5FRN A;  5C3E J;  1U0J A;  2H6B A;  2OF7 A;  3P9I A;  1HW2 A;  3NAU A;  2FMY A;  3ZOB A;  3OYK A;  5AIP A;  1K79 A;  2VOD A;  1W5S A;  1AHD P;  1PJR A;  2RGV A;  2WAQ A;  2HYJ A;  3S3O A;  3DP7 A;  4A3J J;  4HNV A;  1ORK A;  2ACJ A;  4PGH A;  1ODD A;  1APL C;  3O2P E;  3PFI A;  1IGN A;  3HHG A;  2PN6 A;  3J7A Y;  2EA4 A;  1YS7 A;  5D5W B;  2DDA A;  4UV9 A;  1PUE E;  4XLP F;  4I6Z A;  1CQT A;  5M3F J;  2LKX A;  4U0W A;  3RZO J;  2M2E A;  1ZKG A;  2AS5 F;  5K5Q A;  3LA2 A;  1AU7 A;  2WA0 A;  1R23 A;  2VE8 A;  1R9T J;  3KET A;  2B63 J;  1A6Q A;  4L18 B;  4DBQ A;  3OYB A;  3SZP A;  4ZZD A;  2AQE A;  5DDG A;  2EIN H;  2DA1 A;  1A36 A;  3TOA A;  5JLW A;  4XN0 A;  5JHF A;  3A4C A;  2P0W A;  3E0J B;  2ZJP F;  1SFO J;  1FTT A;  4RB1 A;  4HNT A;  2HQR A;  3AG1 H;  5F0F A;  1Y1W J;  5BQT A;  4F3Q A;  2BXZ A;  4L0Y B;  1ZK8 A;  1GLN A;  4V2F A;  3PIP F;  2COM A;  3ZMT A;  3IH3 A;  1O3R A;  4EGZ A;  2DYR H;  4ITV A;  1XDS A;  2E60 A;  3DLL F;  2LYC A;  5K7F A;  1W4M A;  3ZGK A;  3LOC A;  2MC3 A;  1Y39 A;  1FP1 D;  2BV6 A;  1J2X A;  2DPU A;  4RGX A;  2CUF A;  1LEA A;  4AU7 A;  3ZQC A;  3CCQ I;  3KZZ A;  4KIT B;  1YW7 A;  1IXS B;  3EDP A;  2EWN A;  2R7W A;  3ESW B;  3ROU A;  5DEQ A;  2X6W A;  4BQN A;  2V9P A;  4LOC A;  1MD0 A;  4EJO A;  5KK1 A;  4EV0 A;  2VXD A;  1WZ2 A;  4IRH A;  4W1U A;  3FMR A;  2Y0S N;  4EM1 A;  3KEO A;  2NYX A;  1WRJ A;  3ZXS A;  3CJQ B;  4XID A;  1Y56 A;  1O4X A;  2CG4 A;  2R7X A;  2NNN A;  3IV5 A;  5IY5 H;  5GPC A;  2WY8 Q;  1BOA A;  3L2W A;  3W3C A;  4IZZ A;  4A93 J;  2ZFW A;  1ZLJ A;  5HS7 A;  3EYY A;  3VYR B;  3WTY C;  5M5W J;  3CJS B;  1S6L A;  4I2O A;  3CJT B;  3JTG A;  1IW7 F;  5J4Y A;  1BI2 A;  2HDD A;  3W2V A;  4MQV A;  3BR6 A;  2K27 A;  2KDZ A;  2HEO A;  1T0F C;  1RUO A;  2OAZ A;  5LHI A;  1SEU A;  1LDD A;  2E2I J;  4XLN F;  4YFX F;  1DP7 P;  2V9V A;  5FFZ A;  1F4K A;  2WB1 A;  2J5O A;  1FMW A;  2KKO A;  1XC5 A;  3KP3 A;  3QPS A;  1W7P D;  1PP7 U;  3M4O J;  3WG7 H;  1O3Q A;  2OD5 A;  5F1R A;  2CS3 A;  2K40 A;  1IDZ A;  2LY9 A;  3TDU C;  1SVL A;  2M4K A;  2P81 A;  2V4J C;  1KGS A;  2MH2 A;  4BGD A;  3CJN A;  3CDH A;  3QYF A;  1T2K A;  3C2H A;  4LIT A;  3H3V K;  2DMT A;  2FUG 2;  4XBF A;  1BM9 A;  4MGR A;  2OTL I;  3HSE A;  3ZMZ A;  1X58 A;  1PP8 F;  4LD5 A;  4KNY A;  5DS9 A;  1V4R A;  3H3U A;  4D9J A;  2R7D A;  4C2U A;  1HXD A;  2XAG A;  1HKS A;  1TNS A;  1G8X A;  1UHM A;  3CUQ B;  1YW9 A;  2HTS A;  3PL8 A;  4HF2 A;  4GXO A;  3GTQ J;  4MLO A;  1DDN A;  3RYP A;  3I53 A;  2R7F A;  2D1H A;  5C44 J;  1ETV A;  4AVP A;  5D5V B;  3MQ0 A;  1OCO H;  1TQM A;  2DOF A;  3BZ6 A;  4CCL A;  5GP9 A;  4C9Y A;  3HXL A;  2H8W A;  1JE8 A;  2L7K A;  2B9S A;  5TIS C;  1P92 A;  3T5X A;  2E19 A;  2PFB A;  5HNH A;  3TP0 A;  1LEB A;  2BXY A;  4DW6 A;  4F93 B;  2OCC H;  2ZB9 A;  2R5Y B;  2GXA A;  1SFK A;  3S93 A;  4L9N A;  5BOX A;  1IXC A;  3GUD A;  2DK5 A;  2M3A A;  5KVR A;  2MLG A;  3S1R J;  1HKT A;  2XGE A;  4A2U A;  2HDC A;  1NG7 A;  4M3E A;  5EG0 B;  3H9Q A;  3K10 A;  3H5A A;  2CSO A;  4F55 A;  1ETO A;  1UG2 A;  2M87 A;  1Z77 A;  2K86 A;  3ML6 A;  2Z9O A;  2LBF A;  2KQR A;  3V8J A;  1R22 A;  4CHU A;  4IHT A;  3DEE A;  2DJI A;  3FMS A;  2EZK A;  5HDK A;  1FY7 A;  1U5T C;  3C1D A;  4PUS A;  1K4S A;  5EEH A;  5CVR A;  1Z7U A;  3GF2 A;  4AM3 A;  1X1C A;  4ZYD A;  1VQ9 I;  4P55 A;  3RQI A;  4ZJZ A;  4M6V A;  2DMU A;  4JOM A;  5LGT A;  2CQN A;  1TWA J;  1E3P A;  3CCY A;  2KMU A;  1ZG3 A;  1J0R A;  3AG3 H;  3OYF A;  3CC2 I;  3TW6 A;  1YX5 A;  1S7A A;  4L5I A;  3D0S A;  5IYB J;  2LTP A;  4JX5 A;  3OS0 A;  3O8H A;  4AD9 A;  2DQL A;  4M73 A;  5FB2 A;  1ZGA A;  2W7N A;  2BHY A;  2EIK H;  2Q1Z B;  3SFZ A;  2PBI A;  3R0J A;  3PUF A;  5AIQ A;  1ETW A;  2M9H A;  1IXR C;  3R60 A;  2DT6 A;  2JN6 A;  4G7H F;  5BPD A;  3FF5 A;  2EZI A;  1X3Z B;  4UUT A;  4A6E A;  4BS9 A;  2KHM A;  2CUJ A;  3L1P A;  4KT6 A;  1FTZ A;  3HRU A;  2MYS A;  2DU9 A;  2IT0 A;  3DU5 A;  1DU0 A;  5E3L A;  3H0D A;  3IAS 2;  3UNG C;  1UEL B;  3BG9 A;  1WWX A;  1D5V A;  1L3L A;  3HKZ N;  2Y9Y A;  5IOZ A;  3ZQ7 A;  3G1O A;  2NVU B;  4GRI A;  3PO2 J;  3I4P A;  3NEU A;  2GM4 A;  2J5P A;  3COA C;  1T56 A;  5B1B H;  3HOX J;  2D1V A;  3H9J A;  3WE3 A;  2CUE A;  1K6Y A;  2EV5 A;  1JGS A;  2W57 A;  5E3M A;  4HEA 2;  4YFN F;  4L9V A;  4Q4Z F;  3DBL B;  5FLM J;  3U2R A;  1ZG5 A;  4NBQ A;  2KRH A;  3TO6 A;  2ISZ A;  2ESH A;  3EET A;  1QNT A;  2DK8 A;  2HU9 A;  3QPT A;  3GTK J;  1ZHF A;  1K6O A;  1L0O C;  4RB0 A;  4XKB A;  4A6D A;  1VQ4 I;  1HOM A;  3NWS A;  1MBJ A;  1ITY A;  4Y7N J;  5TJJ A;  1LKX A;  3GO5 A;  3FMQ A;  3HC7 A;  1G59 A;  3WU0 A;  5J8F A;  1Z3X A;  4RAG A;  3RTR A;  1VQ5 I;  4A5N A;  2OV7 A;  4HQE A;  1WH5 A;  2EV6 A;  2Y2Z A;  2W4S A;  3FK7 A;  1IG7 A;  3F3X A;  5ILV A;  3D1N I;  3WG9 A;  1BBY A;  4NQW A;  4D0P A;  1JJ6 C;  4PJL A;  1ETY A;  2K85 A;  1K78 A;  4FIS A;  3OYH A;  5LRR A;  2JUC A;  2HXO A;  1O57 A;  1XGO A;  3KP5 A;  3IWF A;  1JUS A;  4KJZ A;  3PSF A;  5L3F A;  3OY9 A;  5IT3 A;  2NAZ A;  3E5U A;  2Y9Z A;  1QPI A;  2NS7 A;  4DYQ A;  6PAX A;  3F8M A;  3GTJ J;  2K9N A;  1XMA A;  2MD0 A;  1YIO A;  3RPU D;  3BG3 A;  2HQ5 A;  4BDZ A;  3OYD A;  3RDI A;  5DUK A;  1EA3 A;  1RR8 C;  3WTT C;  4AC0 A;  1LQ1 A;  5HS9 A;  4XL9 A;  3EUK L;  1VQ7 I;  1TW2 A;  2KZV A;  3PNV A;  2WWY A;  2MFZ A;  2VOO A;  2XV4 S;  5E20 A;  1TNT A;  2F5D A;  3IKV A;  3ZP5 A;  4G7O F;  3VYU B;  3ZRG A;  1RPW A;  1UHS A;  4CCM A;  4G6T B;  2KT0 A;  3DKY A;  1TTY A;  5ICG A;  1KQ8 A;  2RC4 A;  3HOY J;  2FNP A;  1JHF A;  1MMN A;  3R6S A;  2DFI A;  3DTK A;  5HOD A;  4ZDO A;  3KP2 A;  3SDB A;  3CMM A;  1FYL A;  2BYV E;  2DCE A;  4OIR F;  2VI6 A;  1I5Z A;  4KYW A;  1QPM A;  1R1T A;  4LK0 F;  5BNG A;  3HBL A;  1MMS A;  3BT9 A;  3Q0U A;  3RZD J;  3WHC A;  4LB5 A;  1H9T A;  1IO2 A;  4D7N A;  2ZME A;  3L09 A;  1KZH A;  1ZQ3 P;  2A5W A;  3DBR B;  2HYF A;  2BW3 A;  4LLN A;  1TT5 B;  2O6G E;  3ABT A;  1R1U A;  3TP3 A;  2HPM A;  3NAR A;  1OCR H;  4ZDP A;  3HIF A;  2ZCW A;  4RGR A;  2FQ4 A;  1O7L A;  4LJZ F;  2RVC A;  5HNF A;  4BE0 A;  2EFW A;  2ECC A;  4WCG A;  1B59 A;  2CQK A;  1I50 J;  2IA0 A;  3OYA A;  5LFA A;  1NHA A;  3H35 A;  2Q8K A;  2LD5 A;  3LMM A;  5B5E C;  1BJA A;  2XGD A;  5HDG A;  1SD6 A;  2Z5U A;  1BI0 A;  2TDX A;  1VI0 A;  3GFJ A;  3FKJ A;  5F6F A;  3TL4 X;  4HLY A;  1WQ2 A;  3M8E A;  1GXQ A;  1M1E B;  4OIQ F;  2GLO A;  1NG6 A;  4XKC A;  1RET A;  2H6C A;  1N25 A;  1QZY A;  2UXX A;  4XKW A;  1JKO C;  4C3H J;  2M30 A;  3E7L A;  2LC2 A;  2R0Q C;  1JT0 A;  4XKV A;  3QYB A;  4A5M A;  1LFB A;  2FD5 A;  1HC8 A;  4XLA A;  4V19 K;  3E6C C;  1GVD A;  1OQY A;  3O3K A;  3C2B A;  1QVU A;  5GTH C;  4XIC A;  1V5G A;  3MN2 A;  4XQF A;  2STW A;  1F9N A;  1V5F A;  4AIH A;  1XMK A;  1QQI A;  4PZJ A;  3MKW B;  3LA3 A;  5E18 F;  1FWZ A;  4RLF A;  3JRD A;  3E5Q A;  3ZPL A; 
#chains in the Genus database with same CATH homology
 1ACI A;  3CJT B;  3CCS I;  1FOW A;  2K3F A;  1YHQ I;  3CD6 I;  3CC2 I;  3CC4 I;  3J7Y J;  3CME I;  1VQ7 I;  1FOY A;  1QA6 A;  1VQ6 I;  2E34 A;  3I56 I;  3CCJ I;  1YJN I;  3EGV B;  3CCV I;  1FOX A;  2E35 A;  5DM7 F;  4UY8 I;  1VQO I;  4IO9 F;  1YIT I;  1VQ8 I;  2JQ7 A;  3PIO F;  2OTL I;  2ZJP F;  1VQL I;  2FOW A;  2NXN B;  1MMS A;  3G4S I;  3G71 I;  3CJR B;  1VQK I;  3PIP F;  3CCE I;  2E36 A;  3DLL F;  3CCL I;  2QA4 I;  3CCU I;  3CF5 F;  1Y39 A;  5GAH J;  2H8W A;  1YI2 I;  4IOC F;  2QEX I;  3CCM I;  5GAG J;  3CCQ I;  1VQ4 I;  1S72 I;  5GAE J;  2ZJR F;  5JVG F;  1YJW I;  2ZJQ F;  1VQ5 I;  4IOA F;  1YJ9 I;  1VQN I;  2OTJ I;  3CJQ B;  1HC8 A;  4V19 K;  5DM6 F;  3I55 I;  1YIJ I;  3CC7 I;  3CCR I;  1WIB A;  3CMA I;  3J7Z I;  5GAD J;  1VQ9 I;  3CJS B;  1VQM I;  3G6E I;  1VQP I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...