2NXNB

T. thermophilus ribosomal protein l11 methyltransferase (prma) in complex with ribosomal protein l11
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
139
structure length
139
Chain Sequence
MKKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFVTKTPPASYLIRKAAGLEKGAHKPGREKVGRITWEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein L11 methyltransferase
publication title Recognition of ribosomal protein L11 by the protein trimethyltransferase PrmA.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 20
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2006-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
B PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2nxnB02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 2nxnB01
1VQLI 3CCUI 5DM7F 2OTLI 3CJSB 2ZJPF 5GAGJ 2QEXI 1YHQI 3PIOF 1YJNI 2QA4I 1WIBA 3G6EI 5GAHJ 1FOYA 2FOWA 1VQ7I 3CF5F 3CJRB 1VQ4I 2E34A 3CD6I 1QA6A 3CCEI 3G71I 1VQ9I 1YJ9I 1HC8A 1VQ8I 3CCMI 3CCLI 1YJWI 3CC2I 1VQ5I 1VQNI 2H8WA 3CJTB 3DLLF 3CCSI 3CCQI 3CMEI 1FOXA 4IOAF 2OTJI 3J7YJ 1Y39A 4IOCF 1YIJI 1VQOI 2ZJRF 3CC4I 5GAEJ 1VQKI 2K3FA 1VQ6I 3CCRI 2E36A 3G4SI 2ZJQF 4IO9F 1MMSA 3J7ZI 3CC7I 3I56I 5JVGF 1VQPI 4UY8I 2JQ7A 3PIPF 1S72I 1YITI 3CCVI 1VQMI 2NXNB 3EGVB 1FOWA 2E35A 3CMAI 3CJQB 5DM6F 3CCJI 1YI2I 4V19K 1ACIA 3I55I 5GADJ
chains in the Genus database with same CATH superfamily
2R7OA 5HS9A 3GTPJ 1VQLI 4D0PA 5IYDJ 1FLIA 1ZRFA 1U8RA 3HRSA 2VC0A 1MBEA 3J81Z 1NK3P 4EEFG 3F3XA 2EFNA 3S2HJ 3VODA 3MKYB 2F4MB 5L3EA 4CXFA 2GXBA 2LD5A 2UWMA 2F5FA 4MNUA 2DA3A 1ZTRA 3EDPA 2XGEA 3S14J 3LQQA 1T98A 4YRVA 3F8MA 2VBZA 2K7LA 1ZH5A 1SAUA 2XGDA 2K86A 4CCLA 2YUSA 3JSPA 2M87A 4BYYA 4A3JJ 3ASNH 1HW1A 2CYYA 3RIRA 2HQNA 2IA1A 4CGZA 1ERDA 3L2CA 4P5OA 1FMWA 2VC1A 3CCLI 1Z77A 3W6JB 3S3OA 5J40A 2ZXWH 2R7SA 2DOAA 4BY1J 1KYWA 1AKHA 1GDTA 1STZA 3WTUC 2H6BA 4AU7A 5FLXK 2FF4A 3DLLF 5LGUA 1R5HA 2ZFWA 1T08B 4RAYA 2QCOA 3S16J 2ZKZA 3KPHA 2DU9A 4I0AA 2HNHA 1GT0C 4D9JA 1LJ9A 2NVUB 1IG7A 3HRTA 1TWGJ 1ON2A 2BW3B 1TT0A 1O7LA 4HOBA 3CUQB 1RKWA 5TISC 2DMNA 2L0KA 2GAUA 3HXLA 5FRNA 1RETA 2KHMA 5E3OA 2OU2A 1WKMA 1VQKI 2DA6A 4B43A 1ITYA 3G1MA 1TQPA 1ZRDA 2XRNA 4M73A 1BIAA 1TTYA 2HQRA 2DTRA 2V7FA 2L9SA 3FHNA 4BDYA 1VQPI 4IJAA 4G9YA 5GTIC 3LA3A 1NG7A 5KHDA 3ZPLA 2IS2A 2EV5A 2A05A 3QRFF 3VPRA 5LHHA 5C3EJ 2MGQA 1X1PA 4XM3A 2HYFA 4I98B 1ZLKA 1SANA 2V9VA 2VKHA 1ETQA 3DEEA 2RNJA 3RZOJ 3CO6C 5BOXA 3MAJA 3CLQA 4IF4A 2CG4A 2PMZA 1OISA 1MNEA 4K2EA 4AIKA 5GPAA 2A3SA 3P9IA 3GTJJ 3RTRA 2BY1A 2EZLA 1XSVA 4U87A 3CO7C 3G3ZA 2ZJPF 4FETA 4OIPF 3IH3A 2A5YB 2JRMA 3FMRA 3OS1A 1LFPA 4XONA 2W1OA 3AKZA 4Q4ZF 4GO1A 2X0LA 3SEQA 3WHCA 1MSEC 2RAEA 5FB2A 2ZXIA 1MBJA 1WQ2A 2LF8A 1WHUA 4L9VA 3RKYA 4WWCA 2KIFA 3BCAA 2IGOA 4NC6A 5GAHJ 5J8FA 2DT5A 2BVLA 1V5EA 2HDDA 4BAYA 2F4IA 4BHBA 2EK5A 5EG0B 2MD0A 4B47A 2CUEA 4O6JA 4F93B 2VOOA 5IT9Z 2PEXA 3CCEI 4OIQF 3IHUA 2GBYA 1OLTA 1X2MA 4W1UA 1BR2A 1LDKB 3NWTA 2R5ZA 2M4GA 2LKXA 4NQWB 2K4BA 5E1ZB 4IX7A 1XDUA 2DT7B 2HWVA 4JP0A 2R5YA 1L3LA 5DCMB 3IRRA 2Y0MA 1OJLA 3WTTC 1Y0NA 1FOKA 3K4NA 1T56A 4RM2A 2E1OA 2HZDA 1EF4A 3BZCA 1QPIA 3HHGA 2WAQN 3KYCB 2E19A 2MW8A 5JLXA 3KEOA 4QWQA 3ZCOA 5D6FA 4KIFA 4HNTA 3S2DJ 1GUUA 2LH9A 3VSKA 1ZLJA 1IDZA 3BPXA 1SMYF 3FXLA 4L0YB 2K9SA 5M5YJ 1BIBA 4LFUA 2QQAA 2ELJA 3OS0A 2DYSH 2X6OA 3IKTA 1WFXA 3AAFA 1RNLA 2DLLA 2YR2A 1QQIA 2VUMJ 3H3VK 3GFIA 3E6CC 3BTLA 4UY8I 2JQ7A 3HPGA 2WAEA 1V3FA 3FMQA 2FBKA 2VT3A 3TO9A 3U1DA 5CKTA 1X3ZB 2ESHA 2IA0A 3O6BB 3OV8A 3K10A 3TOBA 3HOUJ 3AL0B 2NYXA 3TEDA 2PJRB 2R7FA 3OL3A 1S3JA 5BS6A 1X3UA 2UV1A 4DJAA 4HQEA 4C30A 3M07A 2FU4A 1YW9A 3RDIA 1MJAA 4EGYA 1ACIA 3SFIA 3ZN1A 3O2PE 1POGA 5BPDA 5IP7J 4MO7A 3FIWA 2VL8A 3H5AA 3OWTA 1ZR4A 5E8GA 2OTLI 1IN4A 3DTKA 2FMLA 1ULYA 3CJSB 3R0JA 4E7SA 1JT6A 3K4JA 2K9MA 1T33A 2ELHA 4AIHA 4RB3C 2Q0OA 3F9KA 2KDZA 9ANTA 5B66C 4F7ZA 2H94A 1LE8B 4KNYA 5BQTA 4ON0A 1GV5A 1MH3A 1Z3XA 2HU9A 5TJJA 1H0MA 1WIBA 4A0YA 4TV7A 2IVMA 5LHIA 2L9RA 4YELA 5KVRA 2BXZA 4Y15A 1PDNC 3BG6A 2I10A 3IL2A 2E7XA 3H3UA 1MDMA 1JXSA 2EFWA 2NOJB 2CW8A 3ZQHA 3HRUA 2DQRA 3K2AA 4PJJA 2F4OB 3BJAA 3K69A 1VQ9I 3J81K 1IRGA 4GDFA 3QU6A 2L9VA 1W1WE 4BQQA 2OV7A 1MGTA 1QHGA 2EB7A 4OMYA 3SXYA 2LNBA 1XPXA 2XROA 2K4JA 2V1XA 3K70C 1DU6A 1X4OA 3DPLC 3CCQI 3E6BA 1ZG3A 1X1DA 1VI0A 2O61A 1ZGJA 2KJBA 1MMGA 3HGGA 4R79A 5DEQA 4A5MA 3WODF 4XKWA 4U7BA 3BG7A 1B72B 3LSTA 2MABA 2VBYA 3M1EA 4CYCA 3ZOBA 5D5WB 1H88C 2M7AA 3BCBA 3TQNA 3ERMA 2ZMEA 1RZ4A 2HR3A 1OPCA 1Z21A 3JRIA 2XAGA 1I27A 1SFXA 2VBXA 5HS7A 4BS9A 2ZSIB 2W7NA 2LKPA 4BGDA 5H6RA 1IF1A 1R1UA 4D7MA 4Q5SF 3LSHA 4AWXB 1QZYA 3I56I 2F5VA 1MBGA 3H5RA 4QIWN 1B8IB 1TWCJ 1Z7UA 4A6EA 1MSFC 3MD2A 2M1BA 3Q3SA 1S72I 5E20A 2BE5F 5ICEA 2KL4A 5DYMA 2TCTA 2GOXB 4A0ZA 3GUDA 2JA7J 2L4MA 1I6XA 2XF7A 4BEHB 3BZ6A 2L5QA 4YFNF 5K1YA 1S7OA 1MKMA 4HSTA 1R4NB 4M71A 3G1LA 3GTLJ 2YSRA 2LBFB 4ZDLA 5IYCJ 2VE9A 1IRZA 4BY7J 5DDGA 1YI2I 3BJOA 3S17J 4KIGA 3L00A 4MFDA 4RM3A 2XHKA 2DAOA 1TNSA 2FA5A 4ESJA 4GCVA 3TW6A 3CDIA 4HX4A 4MLOA 4R8HA 3GFMA 3PO2J 4DYRA 1JKRC 5JVTA 2F48A 2GXGA 3DEUA 3FXRA 2R92J 1F9NA 3L9FA 3SFZA 2KISA 3MKWB 1YOVB 4BJ5C 2RKHA 3F8CA 3BTJA 1N75A 2OUMA 4F52A 1D5YA 2CV1A 3ZMUA 2PLYA 4I0BA 4EM0B 3GTGJ 5J1UA 1K79A 3I59B 3E3VA 3KP2A 5B5EC 4U0YA 4EV0A 3HOXJ 1H89C 4C2UA 3CUOA 1T95A 4HA8A 5J6XA 2LK2A 2A6HF 3F22A 1VQ4I 2R93J 2R4GA 4BQNA 1OR7C 2KZGA 3B6AA 2MG4A 2R7VA 2ETHA 3W2AA 1JE8A 1BJAA 4B3AA 4YEJA 2EQRA 3DV8A 3CCMI 4HV5A 3F8NA 2RQQA 3HSRA 2XKPA 4EGZA 1GXPA 3M8FA 1SFOJ 5FLXZ 1RIOH 2JT1A 3MN2A 3PFYA 3RPQA 2CQKA 5CPRB 1T8IA 2NOGA 3QU3A 3BZKA 5BNGA 2VPRA 3TO6A 2PBIA 2E2JJ 2Y2ZA 2V9KA 1DDNA 3JRHA 4UV9A 4DYQA 4E70A 1A31A 1FTTA 5IT9K 2JPCA 1R5ID 2CRGA 2RQPA 3FDYA 2DYRH 2JSCA 4LK0F 2W24A 2A07F 3E97A 5H2FC 4A3EJ 5FLMJ 3H9JA 3FISA 5E3MA 3GLXA 3P7NA 2K5CA 4EJOA 3KP4A 3T8RA 4Y17A 2QSHX 3CZ6A 2VN2A 1FWZA 1QO0D 3ML6A 2QLZA 1GVDA 2DCEA 2BY2A 5FGMA 1JGGA 3GYHX 1QBJA 3RCOA 5IP9J 3JR9A 1Z6TA 1UJ8A 4D7NA 4CUGA 2BOLA 3VYRB 1Z67A 1A5JA 1K78B 1XTAA 2DT6A 4FX0A 2CUFA 1QZZA 4I01A 5CLSA 2TRTA 3KEQA 4NNJA 3HOZJ 3KE2A 4V19K 5J1RA 1XB4A 1EA3A 2H09A 3OR1C 4RA2A 4EQQA 2AXTC 4EJWA 5FKOA 4IHYA 5F04A 2LDUA 4RAFA 1FMVA 2DODA 5KCMA 5FROA 2DA1A 4C9YA 3PQJA 4ASNA 3B73A 3K70D 2MH2A 4I7HA 3IH4A 1O3SA 1IXRC 4I2OA 3ZXSA 3FX3A 3LMMA 5HNHA 5DS9A 5D8KB 2K9QA 5IYBJ 1L0OC 1W5CC 2EWNA 3GVAA 3ONQA 1HQCA 3I58A 1APLC 2P6TA 2CS3A 3CESA 1VFCA 4BDZA 4FQGA 4Z6YA 2NRAC 4MFEA 2O8KA 4ABZA 2FUG2 3QP6A 2ADUA 4L5EA 4CCOA 2FD5A 3CJRB 4F3QA 4CHUA 5BPIA 1BL0A 2P7VB 1BN5A 3OR2C 1JKOC 4O3MA 1F36A 3HOYJ 4BNCA 3K2ZA 2RN7A 1TBXA 4L9TA 4IHWA 1YS6A 1ZGWA 2DK8A 5D5XB 2XKOA 3PFIA 3H9GA 3E5UA 3ZMTA 1U2WA 4DW6A 3F21A 1F43A 2XDVA 3DKYA 2ZFUA 2CMPA 4FCYA 1IO2A 1VQNI 1ZHFA 3CJTB 2E1MC 4F92B 3RKWA 1ZN2A 3H1CA 1LFUP 3LSKA 2MLKA 4BBRJ 3DBRB 1O7FA 2VKVA 4IOAF 2W82A 4BQAA 2CQ7A 1U78A 3E1SA 3J7YJ 2UUZA 1JHHA 5LGNA 2YS9A 1E3HA 1R6RA 4RB0A 2HPMA 2MC3A 3DTIA 4WXCA 2GIVA 2V26A 2VQLA 1QNTA 3IAS2 3Q5FA 4BACA 2VONA 3K1PA 2KMUA 5F0CA 1FX7A 1IUYA 3LL7A 4M6XA 2VE8A 1MMDA 4A3IJ 5E8IA 1R49A 4IHTA 4HAMA 2K85A 1AKHB 1WJ5A 2WV1A 2L54A 4O5VA 1TT5B 1PYVA 1X58A 2HTSA 3NEUA 3FXUA 1P7JA 2NXNB 4NC7A 3L2VA 3V7SA 2GXAA 3JREA 2JUCA 1W36C 2JWTA 4IQJA 3F72A 3GFJA 3IWZA 5CQGA 1OMIA 2HOTA 3QYBA 4QPQA 1XSXA 1LVAA 4BXFA 5GTHC 3E6MA 5ILUA 5E3LA 4G6DA 3CTAA 3HPHA 2ID6A 1T39A 4XL9A 4AVPA 2EA2A 3RQIA 5KK1A 5J8CA 2OQRA 4E7JA 5EGOA 3VYTB 3L1PA 3ZQQA 1W5SA 3FMSA 3N4MA 4ZTFA 3MVPA 2V9PA 1Z0XA 1R23A 3JTGA 2P5VA 1IC8A 4ENNA 3S1RJ 3HOWJ 2C6YA 2OCCH 2IBDA 2DOEA 3F8FA 3WG7H 1SVOA 1HF0A 5E18F 2OBPA 3R61A 4ZDPA 2XAFA 4XRMA 2QUFA 5HDNA 3I71A 5FFZA 1Z6RA 1X1AA 4GFBA 4AVZA 4B8XA 1D8KA 4UHTA 3WGGA 1F5TA 4XN0A 1HCRA 2EFOA 2E60A 4EATA 3CD6I 1YRNB 2CSOA 1E0EA 1HKTA 2WWYA 2LREA 4GGGA 1LDJA 2K3PA 2O5RA 2Z16A 2AQEA 1XSDA 2LP0A 3MZ8A 5CQEA 2GLOA 3S15J 2BYVE 1KU3A 2XUBA 4A2UA 2IAIA 2PJPA 1X1CA 1Z3YA 3M4OJ 5EEHA 1O57A 4M72A 4P9UA 2VIXA 4M9SA 1XGSA 3VOEA 3PL8A 5EJCA 2CU7A 4IOCF 2OF7A 2Z3YA 5LRSA 1SD5A 1HDDC 4RGRA 3QP5A 4HSRA 4CSWA 4HG2A 3OYNA 3HYIA 5F27A 1K83J 2FQ4A 3AFHA 3N05A 4HDVA 3QYEA 3F6VA 3L2QA 2XAJA 2IP2A 3HSFA 2R5ZB 4G6TB 4JX5A 1S5LC 4ENMA 2R5YB 1YFHA 1S8NA 4MGRA 3IRQA 4M74A 1U9NA 1ETKA 2IGMA 4AD9A 4CZZA 2DJNA 3SHFA 4ZYEA 2VXZA 3HEFA 2D1HA 2QVOA 3OYDA 3TP0A 3WTYC 1LQ1A 3V7CA 1BBYA 1CGPA 1YQAA 3RYPA 4FTHA 3BG5A 4PJLA 4A3CJ 4XIDA 2KIQA 1K4TA 4MQ9F 1FJLA 5DV5A 4Y7NJ 1D0ZA 1RUNA 3E5XA 3COAC 3D5SC 2XF5A 4UB8C 2QGUA 3GMEA 4LB5A 5GADJ 3GCMA 1XGNA 1IXSB 1XGOA 4OAYA 2HEOA 4ZH4F 2XGXA 4LG0A 3TKYA 2XAQA 3HG9A 2V1UA 4OMZA 2P5KA 1W7PD 3PUFA 5DD8A 1ETXA 3D5RC 3DWLE 3SYTA 4PK4A 4G94A 4LITA 2IA2A 1A36A 4U88A 1DP3A 1B4AA 4G7OF 4XSXF 3OYKA 3OSFA 2EJRA 2BHZA 2L7FP 1X19A 3BQZA 4KMUX 5FD6A 3WTVC 2CQQA 4RLFA 4KDPA 2PFBA 1J59A 4KT5C 3K1MA 2V6EA 2WB1A 1OCCH 2LF7A 3T0YA 2O8XA 3UNGC 4BU2A 1IV6A 2CO5A 4PCQA 1VZ0A 1VQ8I 5J3LA 2DJIA 2QM3A 3GWZA 4XICA 2QQ9A 1GHCA 2H6CA 1W5TA 5KAFC 5LEJA 3I64A 3LSRA 1KA8A 2EPFA 4E7IA 2LSOA 2CGPA 2EZIA 4H0EA 1FZPB 4P9FA 2H27A 1RC9A 2LY2A 4G8XA 3FHZA 3ELKA 4KN4X 2ISZA 4FX4A 2HKOA 4HNUA 5LD2C 3WTZA 4L5IA 4Q47A 2ICWG 1W36D 2L7ZA 1V54H 2P8TA 1YO5C 1Y8QB 4XRSG 2D5VA 1U5TC 4KISA 1P2FA 4N0BA 2IS6A 3F0CA 5EEGA 2CUZA 1UMQA 1TP4A 4UUVA 1WZ2A 2W57A 4ZJZA 1R00A 1N25A 3VYSB 4BL0B 3W6VA 2EZHA 2X85A 3E7LA 4E7HA 3SZTA 1G4DA 4HYEA 3OYEA 2X48A 3IC7A 4DOZA 3MMYB 3PNVA 1ZELA 1BI0A 1S6LA 3HOTA 3G4SI 2JSPA 4A3FJ 2MSYA 3J7ZI 3I4PA 1ZREA 2ME6A 2HXOA 2VI6A 3GEZA 4DNCA 4N9IA 3HDDA 1Y6IA 2XRLA 3FM3A 4XLNF 2JA5J 3HOVJ 3ZR8X 2RGVA 2L7MP 2O03A 2DI3A 4ENKA 4FHTA 2M8GX 3PSFA 1GLNA 1T0FC 3Q9VA 4EMSA 4HX7A 4PGHA 4B3XA 5K5QA 4Y4RA 1G59A 1IN5A 3K4MA 2DDAA 2E1NA 2CW0F 1U0JA 4ESBA 2NVYJ 3I3LA 5J47A 3CJQB 3FXKA 3LSGA 4CYCB 1TL8A 3DF8A 3ZMDA 5DM6F 3T8TA 3T5XA 2ZMEB 3CDHA 4LLLA 2CWEA 1T6SA 2KZVA 4UB6C 2XPWA 3LOCA 3WGHA 1UHWA 4N4OB 3H36A 3QODA 5E1WA 5H6QA 2DOFA 1OR7A 3HTUA 2DA5A 2FNAA 1XX5A 3HHHA 4EJUA 3C2BA 1FC3A 2M3AA 2YPRA 4BE0A 2XGCA 5GAGJ 1J0RA 3FKIJ 2JVHA 3BR1A 1JJ8C 3J80K 1RESA 5ICFA 4JYKA 2AXLA 2Y9YA 2VT2A 3Q0WA 3LSIA 2EIMH 3W6KB 4A5NA 5M3MJ 5L3DA 3I4MJ 3L2WA 4Q48A 4NUBA 1YX5A 5FKKA 1H8AC 2UXXA 3H92A 4KIBA 4X1EA 4LB6B 2E34A 2ID3A 4BUPA 4IHXA 1AHDP 2LOOA 4M6YA 1N77A 4X0GA 1ETYA 3KZIC 1Q1HA 2G9WA 1YJ9I 1P9QC 2D1VA 4EM2A 3BY6A 3GTOJ 1Q1VA 2AS5F 1WJCA 3CP2A 3CCYA 4ZYHA 2BEOA 1UFMA 5F08A 1YX3A 4L18B 4OINF 4Y33A 1D8JA 1K6YA 3FXMA 5KNLA 5L3BA 1BI3A 5L3FA 2M9HA 2EINH 5CVJA 3I4NJ 4A12A 3CMEI 1HKQA 5DUIA 1LNWA 2KDOA 4P55A 3RPUD 2B0LA 1FOXA 1XC5A 2HQ5A 4KMFA 1JKQC 1ENHA 2QKLB 1V4RA 2IJLA 1DQUA 3MKZA 1OCZH 2XPUA 3ZGKA 1BR1A 3DP7A 1MBHA 2YU3A 2CUJA 3E0JB 2BV6A 1DPUA 3C2GA 1B9MA 2UZKA 4IXAA 1OQYA 5EEAA 1G6NA 4CA0A 1SD4A 5FKLA 2K3FA 1G3SA 4S0HB 2STWA 4UUTA 3CCRI 2KRHA 3AG3H 3GFLA 4CCNA 4XMYA 4HLYA 1ZARA 3IV5A 2HDWA 3BC8A 3JRGA 3OYMA 2A5WA 1W4MA 5C4JJ 2MD5A 2LR8A 2Q2EA 4Y3OA 2PN6A 1CF7A 1B59A 1SVLA 1FSHA 3WE2A 1VQMI 4LLNA 4ZZDA 3TGNA 1EH6A 2ESNA 2DMTA 3W2WA 3OIPA 2GA1A 2GA2A 1JUSA 3T1BA 2STTA 4LIUA 1XGMA 3C2HA 3RKQA 3LNQA 2WAQA 3AG2H 2XF6A 3I55I 2Z5UA 2V6CA 3WE3A 2G7UA 3IP4B 3OYLA 2Y0SN 3TL4X 1P6RA 3HIFA 2HFHA 2KKOA 3K4KA 4M3FA 3HKZN 3M7GA 3D1NI 3GTMJ 3IH2A 1D5VA 1J9IA 1SFEA 1OYYA 3A0BC 3M8JA 3ABKH 4MEYF 3ZQCA 2Y30A 3WHBA 1W7PA 3EUKL 3F6OA 3OOPA 1A04A 3BP8A 4ZYDA 4A0XA 5D8LB 3V4GA 1G3WA 2LY1A 3A02A 1ZGAA 1FOYA 4M3DA 2NS8A 4M3GA 4CCKA 1TWAJ 1HSJA 4XKBA 2R7TA 1AU7A 3I54A 4NBQA 1WWXA 1FBUA 3JRBA 4IKFA 5HLIA 2J5OA 1EH7A 3OYAA 1IJWC 3GX4X 2OPTA 1M1EB 4DYCA 2JA2A 1YJWI 3HL2A 4JK1X 1DU0A 2IS4A 2Z33A 4BXUA 1JI8A 4KFCA 3DKWA 1D1AA 2K40A 2VODA 5A2QZ 1W0TA 4WCGA 1IRXA 5HLGA 3DCFA 3WTWC 2L02A 3JRDA 1MD0A 2M45A 1X1BA 2UXNA 4FE4A 2HKXA 3CUQC 3D0SA 1SAXA 1R5GA 2E7WA 2HVRA 3A0HC 2E5ZA 1R1VA 2EV0A 1ZKGA 5F1JA 2FQ3A 4PJNA 4B09A 2M0MA 4J19A 1KU9A 5DTDA 2WV0A 2XSDC 1VQ6I 2I5UA 3QPTA 3KP6A 4ZYAA 2R3SA 1DGRM 4EM1A 2OAZA 3QPHA 1KU7A 3QPLA 2ACJA 2X9DA 5IT3A 1H9TA 3ECHA 1A6QA 5LGTA 2M7BA 4XLEA 5ICCA 2XAUA 4UUSB 5GP9A 1FTZA 5F0HA 3ZQLA 2GIZA 3A03A 4FE7A 4LJZF 5AIQA 2P0WA 1U3EM 3PNTA 4LD5A 3DU6A 1IAWA 2Y9ZA 1YLFA 1BA5A 2Y48A 2JUGA 2R7XA 4DBQA 4BJ6C 3E5QA 2RV8A 3CCUI 1I3AA 1PJRA 3EUHC 3KP5A 3J7AO 2JMWA 4C3JJ 2ZNYA 2WY8Q 1F4KA 2Z9OA 1XG1A 5JI6A 1FEXA 2HPIA 4KT6A 1DUXC 5IOYA 4PFPA 2PI0A 2A6EF 5J4YA 4XR6A 1QU3A 3TO7A 1BJZA 3K7AJ 2M8EA 1TLHB 3PNYA 4UVAA 2QA4I 2FMYA 3SQNA 4P1WA 3RI4A 3GZ5A 2KRCA 1O3QA 3HKZA 5JFRA 3U21A 3L2UA 5FD5A 4IPAA 2VJ4A 5HODA 4XNFA 3V8JA 1QA6A 2ZXJA 4HLXA 2LKSA 1HW2A 1FSEA 4I09A 4A3GJ 3HSEA 3EETA 2CJJA 1I1SA 5EGOB 1MJBA 1BOAA 5LHGA 1JT0A 3K6GA 1P4XA 2DBBA 4LGWA 5EDNA 3BOQA 1PVEA 2PX9A 2HDCA 2VOPA 2H8WA 2A68F 4PUSA 1RKTA 3CCSI 3V8LA 1TQIA 1FBQA 1XMAA 2OC6A 2OD5A 3U9GA 1Z1DA 5E17F 2QBYB 4U7DA 1K61A 3TOAA 3P9CA 1KQ0A 1JHFA 4JBAA 5CVIA 2EA4A 3Q9SA 4IZZA 1OYWA 1GV2A 1ODDA 4HEA2 1Z9CA 3KZYA 2XC7A 3ABUA 2DFHA 3CQZJ 4NDLA 2ZJRF 3RPUA 1KQ9A 4QSHA 2QENA 5B1AH 4A6DA 4G7ZF 5LFAA 1J7KA 4IRIA 3BR3A 1QGPA 4L9NA 2RNGA 2XSJC 2IT0A 1YW7A 4AIJA 2NS7A 4IO9F 2W48A 4RGUA 3FKJA 2KT0A 2ZSHB 4H4KC 3HOSA 2CV0A 3BR6A 1MZBA 2DDBA 3DQVC 3KLOA 3DBLB 3OYFA 3AL0C 3FXOA 2RREA 2XV4S 1WPKA 2L9NA 1FOWA 1ONVA 2DFIA 4ETSA 1B6AA 1WGXA 3S3MA 5CVUA 3L2RA 1YIOA 3C18A 3LA2A 3OYIA 2RDPA 4RGXA 4DQ2A 3KIOA 4I76A 2HYJA 4IHSA 5EYRA 3A4CA 3BT9A 4ESFA 2WA0A 2ZO4A 3MZYA 4L5JA 3PUBA 2ZCWA 3GTKJ 1LKXA 3FBIB 1G8XA 1R58A 5L3GA 1S9HA 1USSA 2HXIA 4LMYA 4S04A 3A01A 3TMOA 3MEXA 4YG2F 1XDSA 1X3WB 1OCRH 3H0DA 2DN0A 1FIPA 3OOUA 4OIOF 3J80Z 2IW5A 2QEXI 2IPQX 4OAZA 3TBIA 4XLAA 5B3SH 4FT8A 2FXAA 2JRTA 4J01A 4W97A 2PMHA 2Y31A 2ZBKA 3DPUA 3EQLF 2F5EA 1XCBA 1FP1D 2MFZA 2N8GA 1UZCA 4QTRA 1FT9A 1O3RA 3ECOA 3R60A 1ON1A 2JN6A 3ISPA 4MTDA 2PG4A 5ED4A 2CQXA 2D2WA 1U5TA 2LTPA 1FNNA 2L4AA 3S1QJ 4DZJA 2K9NA 4LG0B 1P4WA 1IGNA 4HQMA 3VEPA 2XVCA 3HZJA 4HV6A 5J4VA 1Y1VJ 4XKCA 1U8BA 1MNMC 1WJBA 3BTCA 4E7ZA 2ECCA 3WGIA 4DBRA 2R7QA 1NHAA 3KYDB 2I8DA 4BE1A 1X2NA 4PZJA 3LSJA 3TP3A 3IUOA 1SC7A 2QYOA 4BKXA 4E7LA 2DPUA 4G7HF 2VLAA 2M4KA 2ZJ2A 2E2HJ 1T0FA 2PMZN 1A6IA 1ZYRF 3U1KA 2EIKH 2MLGA 4OIRF 4P96A 4PSXA 1DGWY 1D1BA 4CICA 4A3LJ 1IDYA 3H5NA 3AG4H 3SDBA 4KICA 4MEXF 3PO3J 1D0XA 1TW3A 2E36A 1SFKA 1UAAA 4GXOA 4G6QA 3EPZA 2HOEA 5A2QK 4WXDA 5FKMA 3ASOH 3RQ4A 5HLHA 2IXSA 2IGNA 3M1CA 3PM1A 5LLQA 1JTYA 5IOZA 2NVQJ 1MJ9A 2R7DA 3HBLA 1ZR2A 2VKDA 3OL4A 4J00A 1RPWA 2DMPA 2E35A 4ANJA 3OYGA 2DA7A 3BDDA 2VQHA 2KLOA 3VDXA 3BQYA 3WU1B 4U0VA 1S7EA 1OCOH 3SJMA 2GM4A 4EJTA 1NTCA 3CCJI 2K27A 3OY9A 3ESWB 2WY7Q 1KYZA 4M3EA 2XPVA 2V79A 1QVTA 4BE2A 1FYKA 1KU2A 4HZFA 5DD4A 4Z2YA 3VB2A 4OWRB 2ZC2A 4UVCA 5ERIA 5DM7F 4LOCA 1REPC 2HZTA 1IN8A 3LFUA 4U0WA 3LFKA 2W25A 1G3TA 3S8PA 3UKGA 3GBGA 3ABTA 3F8BA 3KZZA 3PJRA 1IN6A 2DXIA 1YHQI 2X1EA 4LK1F 3V8KA 2M2EA 3OIQA 2DPDA 1KZHA 2HYGD 5H20A 4BJTA 3G6EI 3NWSA 5ICGA 1K4SA 3QAHA 3OYJA 1PUFA 1K6OA 3PQKA 5JHFA 3IWFA 4WF2A 3W2VA 4E4HA 1JTXA 1P92A 2FOWA 2OZ6A 2X1DA 3V7RA 4A3BJ 3ABMH 2HGCA 3KETA 4XLCA 4BQOA 3O3KA 4YIRX 2COMA 4FISA 3MFKA 2LY9A 5LRRA 2OZUA 5AONA 2R7WA 3G71I 3K9TA 5K7ZA 1Y8RB 4CO8A 5IPAA 1TWFJ 3FXJA 3BWGA 3K4BA 2CV2A 1R71A 3FXQA 1V5FA 3HUGA 4HF1A 4HPQA 3OSGA 5D6EA 2IGKA 3HM5A 4C3HJ 1YYVA 2HTJA 1XD7A 4M9XA 3H3ZA 1XCVA 1U6GA 2Y69H 1QVUA 4A3MJ 1BC7C 4HW0A 1D3YA 2OQGA 3VYUB 1PUEE 1I5ZA 1LEBA 3JW4A 4IHVA 2HOSA 4YFXF 4AM3A 4L0ZB 3QWLA 3OYCA 5EZHA 2HVSA 1R1TA 4XORA 4X6AJ 4XLFA 2J5PA 4GYGA 2QSGX 3FF5A 3BR0A 1FYLA 2P81A 3MQ0A 5FO5A 3UR3C 2FX0A 3EYIA 1GXQA 2MBFA 2H1LA 3I0TA 3C7JA 2FJ1A 1HDPA 4RDUA 3MWMA 4RS8A 1YRNA 3JRFA 1HA8A 3A1YA 2W4SA 2KIUA 3BLYA 3LWFA 2AHQA 2CQNA 2COBA 2F5CA 3P5JA 3R0AA 2FNPA 1OFCX 3K4CA 2QWWA 3I53A 3Q0UA 2WADA 3DU5A 3R4KA 2O7OA 4IL6C 4XRFA 3KP7A 3CCVI 4HF0A 2QF7A 3KEYA 3S1NJ 1V5GA 1WJFA 1MDMB 1DP7P 4HF2A 3EGVB 2IEKA 1R4MB 4KITB 2ELKA 3CMMA 4ZDOA 2VQGA 3CMAI 3B02A 2QQBA 1UHMA 3ERED 2QQ8A 1VF9A 2KJCA 3JSOA 3MKLA 2NNYA 4WX9A 2NNNA 2ME0A 1TZLA 1I6HJ 4V2GA 3CP8A 3J7AY 1PP8F 3LAJA 2L3DA 1HLVA 3FBNB 3NRVA 1MBFA 4XQFA 2E5NA 3GLLA 5CYVA 1GVJA 1WI9A 4KN7X 4ZZLA 1LVKA 2O6GE 1OYIA 3TDZC 5EF6A 2Q2EB 2HI3A 4XK4A 4CCJA 1CF7B 5F6FA 4XRSA 3QQAA 1Z05A 3BR5A 3IKVA 3PIOF 1USTA 2G0EA 2HVQA 5JHUA 4KJZA 1YG2A 2VJIA 2PQ8A 4YIFA 2VQCA 3ZN0A 1OCPA 4F91B 3QYFA 1YS7A 2BW3A 3D5LA 3O8HA 4D5FA 3CF5F 4QPOA 1WJAA 3ZMVA 3CUQA 4HDUA 3A2KA 3O8GA 1S7AA 2BY3A 1SEUA 2A61A 1E3PA 4JOMA 2W00A 2LG4A 4F55A 2NAZA 2ZXHA 4RMNA 3LSPA 3ZRGA 1EJ9A 1WH5A 2DK5A 1KONA 1ETVA 2OJED 3DBHB 2NVXJ 1XMKA 2L01A 3NQOA 1FPQA 3KFWX 1AOYA 1IXCA 1TNTA 5K5OA 1W7PB 4XKVA 4I99C 2Q1ZB 3BROA 2E1MB 5LBQA 1EKEA 1EH8A 4WXHA 3WTSC 2OA4A 5BMZA 3GZ6A 4LIVA 2P6SA 3KX2A 3EUAA 1UG2A 3H0GJ 1J75A 1AWCA 2VB6A 1R22A 1MW7A 2JPBA 1WJDA 2FRHA 4G12A 4GRIA 2M30A 5DCFA 1ETWA 1IUFA 4KYWA 3CDLA 4I6ZA 4XN3A 2EV6A 3JAMZ 3V42A 2LRDA 4PGGA 4PDKA 2F6CA 2QZ8A 1J09A 2KP6A 2BBYA 1FP2A 2H8RA 1MMSA 1BM9A 1HKSA 3JRAA 4L9JA 4AUXA 2ISYA 2LMDA 5FKNA 1R9TJ 3CC7I 4D1QA 2DTZA 1D0YA 4PFOA 3BTIA 1JGSA 2JZYA 3EUHA 3M9AA 2G7HA 1WRJA 2JA6J 2JA8J 2LVSA 1B1BA 3DLAA 4FASD 3ULQB 3JTHA 2DW4A 1HXDA 3QPSA 4HX8A 2VJJA 4I02A 2LC2A 2W85A 1UHSA 2JVGA 5AIPA 3QOEA 4GYIA 4NC8A 5EG0A 3RYRA 2RC4A 1BI1A 1TW2A 4ITVA 3X2QH 1QZEA 3K0LA 4D5CA 1NH3A 1J5YA 2EBIA 2V1NA 2WAFA 3AG1H 1ZG1A 3KCCA 4NQWA 1P4AA 3JRCA 1HOMA 3NARA 2XIGA 1MNDA 5DCMA 1C0WA 3GXOA 1FY7A 4MQVA 2Z2SB 1Y0UA 1ZRCA 1R36A 4XOPA 1B9NA 2XB5A 2BGCA 1E17A 1RR8C 3OS2A 4PJMA 3F23A 2WBMA 5ILSA 1K7AA 2X6YA 1DPRA 1HW5A 2MH9A 2IS1A 3P9KA 4IRHA 4RBOA 4IEJA 3S32A 3WU2C 1XN7A 1HC8A 2K9LA 6PAXA 3WG9A 3CF2A 1WCMJ 4PJ0C 4ZTJA 2D45A 2X51A 4OOIA 1Z7LA 2M0CA 1PP7U 2TDXA 1QHHD 4C2MJ 1VQ5I 2VKEA 5K7HA 3KLNA 4RB1A 1MMAA 5TGTA 1RUOA 2Y75A 5K5RA 4HBLA 5IY5H 2P5LC 1FIAA 3PSIA 4ENJA 1FYMA 4B44A 4E6KG 2O3FA 4JQFA 4EVIA 4NB5A 5L3CA 3JCUC 3REOA 2DMUA 3RKXA 3RSNA 1WH7A 1XS9A 4MIMA 2FE3A 5FLVA 3ZQGA 4B48A 4AC0A 3H9QA 2PJRA 1SD6A 3QOPA 2VJ5A 1XMXA 3CC4I 1A35A 1ZK8A 3ZQFA 1P7IA 1ETOA 3FK7A 2KPMA 1ZG5A 1JJ6C 4OU0A 3SDGA 2R7ZJ 1O4XA 4V2FA 5B1BH 2NVTJ 2DMQA 1RRJA 2L2OA 1LFBA 2KFDA 1IN7A 3K1NA 2ZB9A 2JJ7A 1YE9A 2V4JC 3MZHA 4B1RA 4S05A 3ZMZA 3W3CA 3HTSB 1YW8A 4LG3A 1ORKA 1S29A 1LE8A 2EH3A 2MC4A 1BC8C 1MBKA 2DA2A 3OMYA 1BI2A 3C3WA 2FBHA 2NS0A 5D5VB 1SMTA 1KQ8A 1IW7F 2DQLA 5FFXA 5HS8A 1SD7A 2WC2A 3DFGA 1BW6A 2EILH 2CH0A 4DIQA 3ABLH 3GW2A 1Z91A 4NHJA 2FEZA 3OYBA 3SZPA 2MYSA 5HNFA 1T2KA 1E3OC 4BXXJ 4Y52J 3ZQIA 5TRDA 4AYBN 1WJEA 3CJNA 3BR2A 4RAZA 3VFZA 2VXDA 5M3FJ 4MHGA 5FRMA 2EZKA 3VWBA 4CCMA 1KGSA 3SZGA 1BW5A 1MH4A 2CW7A 3ZMSA 1IRFA 3HJEA 3N97A 4XOTA 3TW7A 4CZCA 3DEWA 4XBFA 4IRGA 4ZC3A 1SFUA 2O9LA 1F1ZA 5M5XJ 4BBSJ 2HOAA 1B72A 1CQTA 2HQAA 2F5DA 5F64A 4A3KJ 3FM5A 5JLWA 5C44J 1X4PA 2BY0A 2A6TA 2VBWA 1RR7A 3LA7A 2CFOA 5HVQC 4II3A 2GQQA 3BG3A 1WI3A 1IZ1A 2DFEA 3HGYA 3A01B 2O0YA 2PMUA 2WTEA 2V1DA 1LUJB 3GZNB 4QLCU 5F1RA 3CC2I 4M9ZA 2AQFA 3L7WA 1J2XA 3WTXC 2FBIA 3FZVA 1TC3C 2Y0SA 1VNDA 1B8IA 3HB9A 4UXNA 1UB9A 1MIJA 2GWRA 1I1GA 3I9V2 5FJ8J 5M5WJ 4PSWA 2K02A 4IQ4A 1LEAA 2QSFX 1LPQA 1Y39A 2E2IJ 1QPMA 1MMNA 2DFFA 2P4WA 4BEHA 2YU9J 3E6DA 2X6WA 1FBSA 2XASA 1VQOI 2EFPA 3IAM2 1QRYA 1U5TB 2GZWA 2LBFA 2Q8KA 3S1MJ 5CJ9A 2R0QC 3RJPA 1H9GA 2AO9A 2JK3A 4CH7A 1Y56A 3HRMA 1AA7A 4II2A 5EZGA 1R7JA 5J1YA 5HLTA 3SEZA 2ZJQF 5IP6A 4ZYGA 1I39A 5ILVA 1N78A 3BG9A 4A93J 5JVGF 3GF2A 2B7EA 2OCEA 3LAPA 1NK2P 3U2RA 1YITI 2P7CB 1YTYA 3WU0A 2BHYA 1EV7A 4DZPA 3M8EA 3I59A 4JX4A 3KYLA 4UV8A 3VSLA 4CDGA 4KUMA 2A69F 2ZMEC 4E7KA 2B63J 4DGWB 4R1HA 4EJVA 3H35A 2E71A 2DA4A 2X4HA 2Z1DA 5E79C 1E2XA 2MA3A 2GOMA 4XSZF 3JAMK 2CFXA 5LEKA 2BXYA 3GO5A 5D4RA 4BH9A 3C1DA 4RLQA 2RVCA 2ECBA 2B9SA 4C3IJ 2FSWA 1WSUA 2X6XA 3FWEA 3ROUA 3B6CA 1O3TA 2X1CA 4Y13A 2IRFG 2R7UA 1JUMA 2W84A 4MTEA 3RZDJ 3FK6A 4AIDA 2R7RA 3ZQ7A 1RI7A 2Z99A 3K4LA 4AYBA 1YJNI 2LYCA 1V55H 2VASA 1NG6A 1ZQ3P 5HDGA 1BR4A 3S3NA 3DXJF 3G2BA 1HSTA 5GPCA 1Y1WJ 5D5UB 1VQ7I 2JTVA 1BOBA 1VTNC 4RGSA 2XAHA 2XB0X 4UUSA 2VPLA 5KAIC 1OKRA 3G1OA 4XLHA 4XLPF 4WK8F 5C4XJ 4UVBA 2LLKA 1G3YA 3OIOA 3CLOA 5E1XA 3BPVA 3LSMA 1HBXG 3M3YJ 2HS5A 3HC7A 1JUPA 2BZTA 2LFBA 2F2EA 1UG0A 5D4SA 3CMYA 3KP3A 5DUKA 3ZP5A 1UELB 5CVRA 3L09A 4CYDA 3OYHA 2OTJI 4A3DJ 5E3NA 2YX4A 2L7KA 4LLGF 5K7FA 4M6VA 1PUFB 4C2TA 4JX6A 4HNVA 2DO7A 1YIJI 1K78A 5HOOA 1D1CA 3G73A 1LB2A 4KA4A 2BVMA 2M5WA 1U9OA 3MCZA 4B4CA 2H1KA 1WVRA 5GAEJ 3I5UA 1UCRA 2M34A 1OCTC 3GTQJ 2KRFA 3DPTA 1T38A 3BJ6A 3HUGB 1I50J 4M3BA 4BHCA 2YX7A 1JKPC 3Q0VA 2KIMA 5F0FA 4RAGA 5HDKA 3R6SA 2KQRA 2QKMB 4N9HA 4HRIA 4IVNA 5CVVA 3S2WA 4BHPA 1LDDA 3PIPF 1SVMA 1I3QJ 1ZAOA 3DKXA 1TWHJ 4N4NB 4YFKF 1W0UA 2ZNZA 3S93A 3LQRA 4RB2C 3TDUC 2WB1N 5JR3A 4A69C 2E1CA 1TQMA 3EYYA 2QBYA 1G2HA 4UNOA 3DTEA 4YIIA 3NAUA 1IV8A 2FOKA 2EIJH 2EFQA
chains in the Genus database with same CATH topology
1VQLI 3CCUI 5DM7F 2OTLI 3CJSB 2ZJPF 5GAGJ 2QEXI 1YHQI 3PIOF 1YJNI 2QA4I 1WIBA 3G6EI 5GAHJ 1FOYA 2FOWA 1VQ7I 3CF5F 3CJRB 1VQ4I 2E34A 3CD6I 1QA6A 3CCEI 3G71I 1VQ9I 1YJ9I 1HC8A 1VQ8I 3CCMI 3CCLI 1YJWI 3CC2I 1VQ5I 1VQNI 2H8WA 3CJTB 3DLLF 3CCSI 3CCQI 3CMEI 1FOXA 4IOAF 2OTJI 3J7YJ 1Y39A 4IOCF 1YIJI 1VQOI 2ZJRF 3CC4I 5GAEJ 1VQKI 2K3FA 1VQ6I 3CCRI 2E36A 3G4SI 2ZJQF 4IO9F 1MMSA 3J7ZI 3CC7I 3I56I 5JVGF 1VQPI 4UY8I 2JQ7A 3PIPF 1S72I 1YITI 3CCVI 1VQMI 2NXNB 3EGVB 1FOWA 2E35A 3CMAI 3CJQB 5DM6F 3CCJI 1YI2I 4V19K 1ACIA 3I55I 5GADJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQL I;  3CCU I;  5DM7 F;  2OTL I;  3CJS B;  2ZJP F;  5GAG J;  2QEX I;  1YHQ I;  3PIO F;  1YJN I;  2QA4 I;  1WIB A;  3G6E I;  5GAH J;  1FOY A;  2FOW A;  1VQ7 I;  3CF5 F;  3CJR B;  1VQ4 I;  2E34 A;  3CD6 I;  1QA6 A;  3CCE I;  3G71 I;  1VQ9 I;  1YJ9 I;  1HC8 A;  1VQ8 I;  3CCM I;  3CCL I;  1YJW I;  3CC2 I;  1VQ5 I;  1VQN I;  2H8W A;  3CJT B;  3DLL F;  3CCS I;  3CCQ I;  3CME I;  1FOX A;  4IOA F;  2OTJ I;  3J7Y J;  1Y39 A;  4IOC F;  1YIJ I;  1VQO I;  2ZJR F;  3CC4 I;  5GAE J;  1VQK I;  2K3F A;  1VQ6 I;  3CCR I;  2E36 A;  3G4S I;  2ZJQ F;  4IO9 F;  1MMS A;  3J7Z I;  3CC7 I;  3I56 I;  5JVG F;  1VQP I;  4UY8 I;  2JQ7 A;  3PIP F;  1S72 I;  1YIT I;  3CCV I;  1VQM I;  2NXN B;  3EGV B;  1FOW A;  2E35 A;  3CMA I;  3CJQ B;  5DM6 F;  3CCJ I;  1YI2 I;  4V19 K;  1ACI A;  3I55 I;  5GAD J; 
#chains in the Genus database with same CATH topology
 2R7O A;  5HS9 A;  3GTP J;  1VQL I;  4D0P A;  5IYD J;  1FLI A;  1ZRF A;  1U8R A;  3HRS A;  2VC0 A;  1MBE A;  3J81 Z;  1NK3 P;  4EEF G;  3F3X A;  2EFN A;  3S2H J;  3VOD A;  3MKY B;  2F4M B;  5L3E A;  4CXF A;  2GXB A;  2LD5 A;  2UWM A;  2F5F A;  4MNU A;  2DA3 A;  1ZTR A;  3EDP A;  2XGE A;  3S14 J;  3LQQ A;  1T98 A;  4YRV A;  3F8M A;  2VBZ A;  2K7L A;  1ZH5 A;  1SAU A;  2XGD A;  2K86 A;  4CCL A;  2YUS A;  3JSP A;  2M87 A;  4BYY A;  4A3J J;  3ASN H;  1HW1 A;  2CYY A;  3RIR A;  2HQN A;  2IA1 A;  4CGZ A;  1ERD A;  3L2C A;  4P5O A;  1FMW A;  2VC1 A;  3CCL I;  1Z77 A;  3W6J B;  3S3O A;  5J40 A;  2ZXW H;  2R7S A;  2DOA A;  4BY1 J;  1KYW A;  1AKH A;  1GDT A;  1STZ A;  3WTU C;  2H6B A;  4AU7 A;  5FLX K;  2FF4 A;  3DLL F;  5LGU A;  1R5H A;  2ZFW A;  1T08 B;  4RAY A;  2QCO A;  3S16 J;  2ZKZ A;  3KPH A;  2DU9 A;  4I0A A;  2HNH A;  1GT0 C;  4D9J A;  1LJ9 A;  2NVU B;  1IG7 A;  3HRT A;  1TWG J;  1ON2 A;  2BW3 B;  1TT0 A;  1O7L A;  4HOB A;  3CUQ B;  1RKW A;  5TIS C;  2DMN A;  2L0K A;  2GAU A;  3HXL A;  5FRN A;  1RET A;  2KHM A;  5E3O A;  2OU2 A;  1WKM A;  1VQK I;  2DA6 A;  4B43 A;  1ITY A;  3G1M A;  1TQP A;  1ZRD A;  2XRN A;  4M73 A;  1BIA A;  1TTY A;  2HQR A;  2DTR A;  2V7F A;  2L9S A;  3FHN A;  4BDY A;  1VQP I;  4IJA A;  4G9Y A;  5GTI C;  3LA3 A;  1NG7 A;  5KHD A;  3ZPL A;  2IS2 A;  2EV5 A;  2A05 A;  3QRF F;  3VPR A;  5LHH A;  5C3E J;  2MGQ A;  1X1P A;  4XM3 A;  2HYF A;  4I98 B;  1ZLK A;  1SAN A;  2V9V A;  2VKH A;  1ETQ A;  3DEE A;  2RNJ A;  3RZO J;  3CO6 C;  5BOX A;  3MAJ A;  3CLQ A;  4IF4 A;  2CG4 A;  2PMZ A;  1OIS A;  1MNE A;  4K2E A;  4AIK A;  5GPA A;  2A3S A;  3P9I A;  3GTJ J;  3RTR A;  2BY1 A;  2EZL A;  1XSV A;  4U87 A;  3CO7 C;  3G3Z A;  2ZJP F;  4FET A;  4OIP F;  3IH3 A;  2A5Y B;  2JRM A;  3FMR A;  3OS1 A;  1LFP A;  4XON A;  2W1O A;  3AKZ A;  4Q4Z F;  4GO1 A;  2X0L A;  3SEQ A;  3WHC A;  1MSE C;  2RAE A;  5FB2 A;  2ZXI A;  1MBJ A;  1WQ2 A;  2LF8 A;  1WHU A;  4L9V A;  3RKY A;  4WWC A;  2KIF A;  3BCA A;  2IGO A;  4NC6 A;  5GAH J;  5J8F A;  2DT5 A;  2BVL A;  1V5E A;  2HDD A;  4BAY A;  2F4I A;  4BHB A;  2EK5 A;  5EG0 B;  2MD0 A;  4B47 A;  2CUE A;  4O6J A;  4F93 B;  2VOO A;  5IT9 Z;  2PEX A;  3CCE I;  4OIQ F;  3IHU A;  2GBY A;  1OLT A;  1X2M A;  4W1U A;  1BR2 A;  1LDK B;  3NWT A;  2R5Z A;  2M4G A;  2LKX A;  4NQW B;  2K4B A;  5E1Z B;  4IX7 A;  1XDU A;  2DT7 B;  2HWV A;  4JP0 A;  2R5Y A;  1L3L A;  5DCM B;  3IRR A;  2Y0M A;  1OJL A;  3WTT C;  1Y0N A;  1FOK A;  3K4N A;  1T56 A;  4RM2 A;  2E1O A;  2HZD A;  1EF4 A;  3BZC A;  1QPI A;  3HHG A;  2WAQ N;  3KYC B;  2E19 A;  2MW8 A;  5JLX A;  3KEO A;  4QWQ A;  3ZCO A;  5D6F A;  4KIF A;  4HNT A;  3S2D J;  1GUU A;  2LH9 A;  3VSK A;  1ZLJ A;  1IDZ A;  3BPX A;  1SMY F;  3FXL A;  4L0Y B;  2K9S A;  5M5Y J;  1BIB A;  4LFU A;  2QQA A;  2ELJ A;  3OS0 A;  2DYS H;  2X6O A;  3IKT A;  1WFX A;  3AAF A;  1RNL A;  2DLL A;  2YR2 A;  1QQI A;  2VUM J;  3H3V K;  3GFI A;  3E6C C;  3BTL A;  4UY8 I;  2JQ7 A;  3HPG A;  2WAE A;  1V3F A;  3FMQ A;  2FBK A;  2VT3 A;  3TO9 A;  3U1D A;  5CKT A;  1X3Z B;  2ESH A;  2IA0 A;  3O6B B;  3OV8 A;  3K10 A;  3TOB A;  3HOU J;  3AL0 B;  2NYX A;  3TED A;  2PJR B;  2R7F A;  3OL3 A;  1S3J A;  5BS6 A;  1X3U A;  2UV1 A;  4DJA A;  4HQE A;  4C30 A;  3M07 A;  2FU4 A;  1YW9 A;  3RDI A;  1MJA A;  4EGY A;  1ACI A;  3SFI A;  3ZN1 A;  3O2P E;  1POG A;  5BPD A;  5IP7 J;  4MO7 A;  3FIW A;  2VL8 A;  3H5A A;  3OWT A;  1ZR4 A;  5E8G A;  2OTL I;  1IN4 A;  3DTK A;  2FML A;  1ULY A;  3CJS B;  3R0J A;  4E7S A;  1JT6 A;  3K4J A;  2K9M A;  1T33 A;  2ELH A;  4AIH A;  4RB3 C;  2Q0O A;  3F9K A;  2KDZ A;  9ANT A;  5B66 C;  4F7Z A;  2H94 A;  1LE8 B;  4KNY A;  5BQT A;  4ON0 A;  1GV5 A;  1MH3 A;  1Z3X A;  2HU9 A;  5TJJ A;  1H0M A;  1WIB A;  4A0Y A;  4TV7 A;  2IVM A;  5LHI A;  2L9R A;  4YEL A;  5KVR A;  2BXZ A;  4Y15 A;  1PDN C;  3BG6 A;  2I10 A;  3IL2 A;  2E7X A;  3H3U A;  1MDM A;  1JXS A;  2EFW A;  2NOJ B;  2CW8 A;  3ZQH A;  3HRU A;  2DQR A;  3K2A A;  4PJJ A;  2F4O B;  3BJA A;  3K69 A;  1VQ9 I;  3J81 K;  1IRG A;  4GDF A;  3QU6 A;  2L9V A;  1W1W E;  4BQQ A;  2OV7 A;  1MGT A;  1QHG A;  2EB7 A;  4OMY A;  3SXY A;  2LNB A;  1XPX A;  2XRO A;  2K4J A;  2V1X A;  3K70 C;  1DU6 A;  1X4O A;  3DPL C;  3CCQ I;  3E6B A;  1ZG3 A;  1X1D A;  1VI0 A;  2O61 A;  1ZGJ A;  2KJB A;  1MMG A;  3HGG A;  4R79 A;  5DEQ A;  4A5M A;  3WOD F;  4XKW A;  4U7B A;  3BG7 A;  1B72 B;  3LST A;  2MAB A;  2VBY A;  3M1E A;  4CYC A;  3ZOB A;  5D5W B;  1H88 C;  2M7A A;  3BCB A;  3TQN A;  3ERM A;  2ZME A;  1RZ4 A;  2HR3 A;  1OPC A;  1Z21 A;  3JRI A;  2XAG A;  1I27 A;  1SFX A;  2VBX A;  5HS7 A;  4BS9 A;  2ZSI B;  2W7N A;  2LKP A;  4BGD A;  5H6R A;  1IF1 A;  1R1U A;  4D7M A;  4Q5S F;  3LSH A;  4AWX B;  1QZY A;  3I56 I;  2F5V A;  1MBG A;  3H5R A;  4QIW N;  1B8I B;  1TWC J;  1Z7U A;  4A6E A;  1MSF C;  3MD2 A;  2M1B A;  3Q3S A;  1S72 I;  5E20 A;  2BE5 F;  5ICE A;  2KL4 A;  5DYM A;  2TCT A;  2GOX B;  4A0Z A;  3GUD A;  2JA7 J;  2L4M A;  1I6X A;  2XF7 A;  4BEH B;  3BZ6 A;  2L5Q A;  4YFN F;  5K1Y A;  1S7O A;  1MKM A;  4HST A;  1R4N B;  4M71 A;  3G1L A;  3GTL J;  2YSR A;  2LBF B;  4ZDL A;  5IYC J;  2VE9 A;  1IRZ A;  4BY7 J;  5DDG A;  1YI2 I;  3BJO A;  3S17 J;  4KIG A;  3L00 A;  4MFD A;  4RM3 A;  2XHK A;  2DAO A;  1TNS A;  2FA5 A;  4ESJ A;  4GCV A;  3TW6 A;  3CDI A;  4HX4 A;  4MLO A;  4R8H A;  3GFM A;  3PO2 J;  4DYR A;  1JKR C;  5JVT A;  2F48 A;  2GXG A;  3DEU A;  3FXR A;  2R92 J;  1F9N A;  3L9F A;  3SFZ A;  2KIS A;  3MKW B;  1YOV B;  4BJ5 C;  2RKH A;  3F8C A;  3BTJ A;  1N75 A;  2OUM A;  4F52 A;  1D5Y A;  2CV1 A;  3ZMU A;  2PLY A;  4I0B A;  4EM0 B;  3GTG J;  5J1U A;  1K79 A;  3I59 B;  3E3V A;  3KP2 A;  5B5E C;  4U0Y A;  4EV0 A;  3HOX J;  1H89 C;  4C2U A;  3CUO A;  1T95 A;  4HA8 A;  5J6X A;  2LK2 A;  2A6H F;  3F22 A;  1VQ4 I;  2R93 J;  2R4G A;  4BQN A;  1OR7 C;  2KZG A;  3B6A A;  2MG4 A;  2R7V A;  2ETH A;  3W2A A;  1JE8 A;  1BJA A;  4B3A A;  4YEJ A;  2EQR A;  3DV8 A;  3CCM I;  4HV5 A;  3F8N A;  2RQQ A;  3HSR A;  2XKP A;  4EGZ A;  1GXP A;  3M8F A;  1SFO J;  5FLX Z;  1RIO H;  2JT1 A;  3MN2 A;  3PFY A;  3RPQ A;  2CQK A;  5CPR B;  1T8I A;  2NOG A;  3QU3 A;  3BZK A;  5BNG A;  2VPR A;  3TO6 A;  2PBI A;  2E2J J;  2Y2Z A;  2V9K A;  1DDN A;  3JRH A;  4UV9 A;  4DYQ A;  4E70 A;  1A31 A;  1FTT A;  5IT9 K;  2JPC A;  1R5I D;  2CRG A;  2RQP A;  3FDY A;  2DYR H;  2JSC A;  4LK0 F;  2W24 A;  2A07 F;  3E97 A;  5H2F C;  4A3E J;  5FLM J;  3H9J A;  3FIS A;  5E3M A;  3GLX A;  3P7N A;  2K5C A;  4EJO A;  3KP4 A;  3T8R A;  4Y17 A;  2QSH X;  3CZ6 A;  2VN2 A;  1FWZ A;  1QO0 D;  3ML6 A;  2QLZ A;  1GVD A;  2DCE A;  2BY2 A;  5FGM A;  1JGG A;  3GYH X;  1QBJ A;  3RCO A;  5IP9 J;  3JR9 A;  1Z6T A;  1UJ8 A;  4D7N A;  4CUG A;  2BOL A;  3VYR B;  1Z67 A;  1A5J A;  1K78 B;  1XTA A;  2DT6 A;  4FX0 A;  2CUF A;  1QZZ A;  4I01 A;  5CLS A;  2TRT A;  3KEQ A;  4NNJ A;  3HOZ J;  3KE2 A;  4V19 K;  5J1R A;  1XB4 A;  1EA3 A;  2H09 A;  3OR1 C;  4RA2 A;  4EQQ A;  2AXT C;  4EJW A;  5FKO A;  4IHY A;  5F04 A;  2LDU A;  4RAF A;  1FMV A;  2DOD A;  5KCM A;  5FRO A;  2DA1 A;  4C9Y A;  3PQJ A;  4ASN A;  3B73 A;  3K70 D;  2MH2 A;  4I7H A;  3IH4 A;  1O3S A;  1IXR C;  4I2O A;  3ZXS A;  3FX3 A;  3LMM A;  5HNH A;  5DS9 A;  5D8K B;  2K9Q A;  5IYB J;  1L0O C;  1W5C C;  2EWN A;  3GVA A;  3ONQ A;  1HQC A;  3I58 A;  1APL C;  2P6T A;  2CS3 A;  3CES A;  1VFC A;  4BDZ A;  4FQG A;  4Z6Y A;  2NRA C;  4MFE A;  2O8K A;  4ABZ A;  2FUG 2;  3QP6 A;  2ADU A;  4L5E A;  4CCO A;  2FD5 A;  3CJR B;  4F3Q A;  4CHU A;  5BPI A;  1BL0 A;  2P7V B;  1BN5 A;  3OR2 C;  1JKO C;  4O3M A;  1F36 A;  3HOY J;  4BNC A;  3K2Z A;  2RN7 A;  1TBX A;  4L9T A;  4IHW A;  1YS6 A;  1ZGW A;  2DK8 A;  5D5X B;  2XKO A;  3PFI A;  3H9G A;  3E5U A;  3ZMT A;  1U2W A;  4DW6 A;  3F21 A;  1F43 A;  2XDV A;  3DKY A;  2ZFU A;  2CMP A;  4FCY A;  1IO2 A;  1VQN I;  1ZHF A;  3CJT B;  2E1M C;  4F92 B;  3RKW A;  1ZN2 A;  3H1C A;  1LFU P;  3LSK A;  2MLK A;  4BBR J;  3DBR B;  1O7F A;  2VKV A;  4IOA F;  2W82 A;  4BQA A;  2CQ7 A;  1U78 A;  3E1S A;  3J7Y J;  2UUZ A;  1JHH A;  5LGN A;  2YS9 A;  1E3H A;  1R6R A;  4RB0 A;  2HPM A;  2MC3 A;  3DTI A;  4WXC A;  2GIV A;  2V26 A;  2VQL A;  1QNT A;  3IAS 2;  3Q5F A;  4BAC A;  2VON A;  3K1P A;  2KMU A;  5F0C A;  1FX7 A;  1IUY A;  3LL7 A;  4M6X A;  2VE8 A;  1MMD A;  4A3I J;  5E8I A;  1R49 A;  4IHT A;  4HAM A;  2K85 A;  1AKH B;  1WJ5 A;  2WV1 A;  2L54 A;  4O5V A;  1TT5 B;  1PYV A;  1X58 A;  2HTS A;  3NEU A;  3FXU A;  1P7J A;  2NXN B;  4NC7 A;  3L2V A;  3V7S A;  2GXA A;  3JRE A;  2JUC A;  1W36 C;  2JWT A;  4IQJ A;  3F72 A;  3GFJ A;  3IWZ A;  5CQG A;  1OMI A;  2HOT A;  3QYB A;  4QPQ A;  1XSX A;  1LVA A;  4BXF A;  5GTH C;  3E6M A;  5ILU A;  5E3L A;  4G6D A;  3CTA A;  3HPH A;  2ID6 A;  1T39 A;  4XL9 A;  4AVP A;  2EA2 A;  3RQI A;  5KK1 A;  5J8C A;  2OQR A;  4E7J A;  5EGO A;  3VYT B;  3L1P A;  3ZQQ A;  1W5S A;  3FMS A;  3N4M A;  4ZTF A;  3MVP A;  2V9P A;  1Z0X A;  1R23 A;  3JTG A;  2P5V A;  1IC8 A;  4ENN A;  3S1R J;  3HOW J;  2C6Y A;  2OCC H;  2IBD A;  2DOE A;  3F8F A;  3WG7 H;  1SVO A;  1HF0 A;  5E18 F;  2OBP A;  3R61 A;  4ZDP A;  2XAF A;  4XRM A;  2QUF A;  5HDN A;  3I71 A;  5FFZ A;  1Z6R A;  1X1A A;  4GFB A;  4AVZ A;  4B8X A;  1D8K A;  4UHT A;  3WGG A;  1F5T A;  4XN0 A;  1HCR A;  2EFO A;  2E60 A;  4EAT A;  3CD6 I;  1YRN B;  2CSO A;  1E0E A;  1HKT A;  2WWY A;  2LRE A;  4GGG A;  1LDJ A;  2K3P A;  2O5R A;  2Z16 A;  2AQE A;  1XSD A;  2LP0 A;  3MZ8 A;  5CQE A;  2GLO A;  3S15 J;  2BYV E;  1KU3 A;  2XUB A;  4A2U A;  2IAI A;  2PJP A;  1X1C A;  1Z3Y A;  3M4O J;  5EEH A;  1O57 A;  4M72 A;  4P9U A;  2VIX A;  4M9S A;  1XGS A;  3VOE A;  3PL8 A;  5EJC A;  2CU7 A;  4IOC F;  2OF7 A;  2Z3Y A;  5LRS A;  1SD5 A;  1HDD C;  4RGR A;  3QP5 A;  4HSR A;  4CSW A;  4HG2 A;  3OYN A;  3HYI A;  5F27 A;  1K83 J;  2FQ4 A;  3AFH A;  3N05 A;  4HDV A;  3QYE A;  3F6V A;  3L2Q A;  2XAJ A;  2IP2 A;  3HSF A;  2R5Z B;  4G6T B;  4JX5 A;  1S5L C;  4ENM A;  2R5Y B;  1YFH A;  1S8N A;  4MGR A;  3IRQ A;  4M74 A;  1U9N A;  1ETK A;  2IGM A;  4AD9 A;  4CZZ A;  2DJN A;  3SHF A;  4ZYE A;  2VXZ A;  3HEF A;  2D1H A;  2QVO A;  3OYD A;  3TP0 A;  3WTY C;  1LQ1 A;  3V7C A;  1BBY A;  1CGP A;  1YQA A;  3RYP A;  4FTH A;  3BG5 A;  4PJL A;  4A3C J;  4XID A;  2KIQ A;  1K4T A;  4MQ9 F;  1FJL A;  5DV5 A;  4Y7N J;  1D0Z A;  1RUN A;  3E5X A;  3COA C;  3D5S C;  2XF5 A;  4UB8 C;  2QGU A;  3GME A;  4LB5 A;  5GAD J;  3GCM A;  1XGN A;  1IXS B;  1XGO A;  4OAY A;  2HEO A;  4ZH4 F;  2XGX A;  4LG0 A;  3TKY A;  2XAQ A;  3HG9 A;  2V1U A;  4OMZ A;  2P5K A;  1W7P D;  3PUF A;  5DD8 A;  1ETX A;  3D5R C;  3DWL E;  3SYT A;  4PK4 A;  4G94 A;  4LIT A;  2IA2 A;  1A36 A;  4U88 A;  1DP3 A;  1B4A A;  4G7O F;  4XSX F;  3OYK A;  3OSF A;  2EJR A;  2BHZ A;  2L7F P;  1X19 A;  3BQZ A;  4KMU X;  5FD6 A;  3WTV C;  2CQQ A;  4RLF A;  4KDP A;  2PFB A;  1J59 A;  4KT5 C;  3K1M A;  2V6E A;  2WB1 A;  1OCC H;  2LF7 A;  3T0Y A;  2O8X A;  3UNG C;  4BU2 A;  1IV6 A;  2CO5 A;  4PCQ A;  1VZ0 A;  1VQ8 I;  5J3L A;  2DJI A;  2QM3 A;  3GWZ A;  4XIC A;  2QQ9 A;  1GHC A;  2H6C A;  1W5T A;  5KAF C;  5LEJ A;  3I64 A;  3LSR A;  1KA8 A;  2EPF A;  4E7I A;  2LSO A;  2CGP A;  2EZI A;  4H0E A;  1FZP B;  4P9F A;  2H27 A;  1RC9 A;  2LY2 A;  4G8X A;  3FHZ A;  3ELK A;  4KN4 X;  2ISZ A;  4FX4 A;  2HKO A;  4HNU A;  5LD2 C;  3WTZ A;  4L5I A;  4Q47 A;  2ICW G;  1W36 D;  2L7Z A;  1V54 H;  2P8T A;  1YO5 C;  1Y8Q B;  4XRS G;  2D5V A;  1U5T C;  4KIS A;  1P2F A;  4N0B A;  2IS6 A;  3F0C A;  5EEG A;  2CUZ A;  1UMQ A;  1TP4 A;  4UUV A;  1WZ2 A;  2W57 A;  4ZJZ A;  1R00 A;  1N25 A;  3VYS B;  4BL0 B;  3W6V A;  2EZH A;  2X85 A;  3E7L A;  4E7H A;  3SZT A;  1G4D A;  4HYE A;  3OYE A;  2X48 A;  3IC7 A;  4DOZ A;  3MMY B;  3PNV A;  1ZEL A;  1BI0 A;  1S6L A;  3HOT A;  3G4S I;  2JSP A;  4A3F J;  2MSY A;  3J7Z I;  3I4P A;  1ZRE A;  2ME6 A;  2HXO A;  2VI6 A;  3GEZ A;  4DNC A;  4N9I A;  3HDD A;  1Y6I A;  2XRL A;  3FM3 A;  4XLN F;  2JA5 J;  3HOV J;  3ZR8 X;  2RGV A;  2L7M P;  2O03 A;  2DI3 A;  4ENK A;  4FHT A;  2M8G X;  3PSF A;  1GLN A;  1T0F C;  3Q9V A;  4EMS A;  4HX7 A;  4PGH A;  4B3X A;  5K5Q A;  4Y4R A;  1G59 A;  1IN5 A;  3K4M A;  2DDA A;  2E1N A;  2CW0 F;  1U0J A;  4ESB A;  2NVY J;  3I3L A;  5J47 A;  3CJQ B;  3FXK A;  3LSG A;  4CYC B;  1TL8 A;  3DF8 A;  3ZMD A;  5DM6 F;  3T8T A;  3T5X A;  2ZME B;  3CDH A;  4LLL A;  2CWE A;  1T6S A;  2KZV A;  4UB6 C;  2XPW A;  3LOC A;  3WGH A;  1UHW A;  4N4O B;  3H36 A;  3QOD A;  5E1W A;  5H6Q A;  2DOF A;  1OR7 A;  3HTU A;  2DA5 A;  2FNA A;  1XX5 A;  3HHH A;  4EJU A;  3C2B A;  1FC3 A;  2M3A A;  2YPR A;  4BE0 A;  2XGC A;  5GAG J;  1J0R A;  3FKI J;  2JVH A;  3BR1 A;  1JJ8 C;  3J80 K;  1RES A;  5ICF A;  4JYK A;  2AXL A;  2Y9Y A;  2VT2 A;  3Q0W A;  3LSI A;  2EIM H;  3W6K B;  4A5N A;  5M3M J;  5L3D A;  3I4M J;  3L2W A;  4Q48 A;  4NUB A;  1YX5 A;  5FKK A;  1H8A C;  2UXX A;  3H92 A;  4KIB A;  4X1E A;  4LB6 B;  2E34 A;  2ID3 A;  4BUP A;  4IHX A;  1AHD P;  2LOO A;  4M6Y A;  1N77 A;  4X0G A;  1ETY A;  3KZI C;  1Q1H A;  2G9W A;  1YJ9 I;  1P9Q C;  2D1V A;  4EM2 A;  3BY6 A;  3GTO J;  1Q1V A;  2AS5 F;  1WJC A;  3CP2 A;  3CCY A;  4ZYH A;  2BEO A;  1UFM A;  5F08 A;  1YX3 A;  4L18 B;  4OIN F;  4Y33 A;  1D8J A;  1K6Y A;  3FXM A;  5KNL A;  5L3B A;  1BI3 A;  5L3F A;  2M9H A;  2EIN H;  5CVJ A;  3I4N J;  4A12 A;  3CME I;  1HKQ A;  5DUI A;  1LNW A;  2KDO A;  4P55 A;  3RPU D;  2B0L A;  1FOX A;  1XC5 A;  2HQ5 A;  4KMF A;  1JKQ C;  1ENH A;  2QKL B;  1V4R A;  2IJL A;  1DQU A;  3MKZ A;  1OCZ H;  2XPU A;  3ZGK A;  1BR1 A;  3DP7 A;  1MBH A;  2YU3 A;  2CUJ A;  3E0J B;  2BV6 A;  1DPU A;  3C2G A;  1B9M A;  2UZK A;  4IXA A;  1OQY A;  5EEA A;  1G6N A;  4CA0 A;  1SD4 A;  5FKL A;  2K3F A;  1G3S A;  4S0H B;  2STW A;  4UUT A;  3CCR I;  2KRH A;  3AG3 H;  3GFL A;  4CCN A;  4XMY A;  4HLY A;  1ZAR A;  3IV5 A;  2HDW A;  3BC8 A;  3JRG A;  3OYM A;  2A5W A;  1W4M A;  5C4J J;  2MD5 A;  2LR8 A;  2Q2E A;  4Y3O A;  2PN6 A;  1CF7 A;  1B59 A;  1SVL A;  1FSH A;  3WE2 A;  1VQM I;  4LLN A;  4ZZD A;  3TGN A;  1EH6 A;  2ESN A;  2DMT A;  3W2W A;  3OIP A;  2GA1 A;  2GA2 A;  1JUS A;  3T1B A;  2STT A;  4LIU A;  1XGM A;  3C2H A;  3RKQ A;  3LNQ A;  2WAQ A;  3AG2 H;  2XF6 A;  3I55 I;  2Z5U A;  2V6C A;  3WE3 A;  2G7U A;  3IP4 B;  3OYL A;  2Y0S N;  3TL4 X;  1P6R A;  3HIF A;  2HFH A;  2KKO A;  3K4K A;  4M3F A;  3HKZ N;  3M7G A;  3D1N I;  3GTM J;  3IH2 A;  1D5V A;  1J9I A;  1SFE A;  1OYY A;  3A0B C;  3M8J A;  3ABK H;  4MEY F;  3ZQC A;  2Y30 A;  3WHB A;  1W7P A;  3EUK L;  3F6O A;  3OOP A;  1A04 A;  3BP8 A;  4ZYD A;  4A0X A;  5D8L B;  3V4G A;  1G3W A;  2LY1 A;  3A02 A;  1ZGA A;  1FOY A;  4M3D A;  2NS8 A;  4M3G A;  4CCK A;  1TWA J;  1HSJ A;  4XKB A;  2R7T A;  1AU7 A;  3I54 A;  4NBQ A;  1WWX A;  1FBU A;  3JRB A;  4IKF A;  5HLI A;  2J5O A;  1EH7 A;  3OYA A;  1IJW C;  3GX4 X;  2OPT A;  1M1E B;  4DYC A;  2JA2 A;  1YJW I;  3HL2 A;  4JK1 X;  1DU0 A;  2IS4 A;  2Z33 A;  4BXU A;  1JI8 A;  4KFC A;  3DKW A;  1D1A A;  2K40 A;  2VOD A;  5A2Q Z;  1W0T A;  4WCG A;  1IRX A;  5HLG A;  3DCF A;  3WTW C;  2L02 A;  3JRD A;  1MD0 A;  2M45 A;  1X1B A;  2UXN A;  4FE4 A;  2HKX A;  3CUQ C;  3D0S A;  1SAX A;  1R5G A;  2E7W A;  2HVR A;  3A0H C;  2E5Z A;  1R1V A;  2EV0 A;  1ZKG A;  5F1J A;  2FQ3 A;  4PJN A;  4B09 A;  2M0M A;  4J19 A;  1KU9 A;  5DTD A;  2WV0 A;  2XSD C;  1VQ6 I;  2I5U A;  3QPT A;  3KP6 A;  4ZYA A;  2R3S A;  1DGR M;  4EM1 A;  2OAZ A;  3QPH A;  1KU7 A;  3QPL A;  2ACJ A;  2X9D A;  5IT3 A;  1H9T A;  3ECH A;  1A6Q A;  5LGT A;  2M7B A;  4XLE A;  5ICC A;  2XAU A;  4UUS B;  5GP9 A;  1FTZ A;  5F0H A;  3ZQL A;  2GIZ A;  3A03 A;  4FE7 A;  4LJZ F;  5AIQ A;  2P0W A;  1U3E M;  3PNT A;  4LD5 A;  3DU6 A;  1IAW A;  2Y9Z A;  1YLF A;  1BA5 A;  2Y48 A;  2JUG A;  2R7X A;  4DBQ A;  4BJ6 C;  3E5Q A;  2RV8 A;  3CCU I;  1I3A A;  1PJR A;  3EUH C;  3KP5 A;  3J7A O;  2JMW A;  4C3J J;  2ZNY A;  2WY8 Q;  1F4K A;  2Z9O A;  1XG1 A;  5JI6 A;  1FEX A;  2HPI A;  4KT6 A;  1DUX C;  5IOY A;  4PFP A;  2PI0 A;  2A6E F;  5J4Y A;  4XR6 A;  1QU3 A;  3TO7 A;  1BJZ A;  3K7A J;  2M8E A;  1TLH B;  3PNY A;  4UVA A;  2QA4 I;  2FMY A;  3SQN A;  4P1W A;  3RI4 A;  3GZ5 A;  2KRC A;  1O3Q A;  3HKZ A;  5JFR A;  3U21 A;  3L2U A;  5FD5 A;  4IPA A;  2VJ4 A;  5HOD A;  4XNF A;  3V8J A;  1QA6 A;  2ZXJ A;  4HLX A;  2LKS A;  1HW2 A;  1FSE A;  4I09 A;  4A3G J;  3HSE A;  3EET A;  2CJJ A;  1I1S A;  5EGO B;  1MJB A;  1BOA A;  5LHG A;  1JT0 A;  3K6G A;  1P4X A;  2DBB A;  4LGW A;  5EDN A;  3BOQ A;  1PVE A;  2PX9 A;  2HDC A;  2VOP A;  2H8W A;  2A68 F;  4PUS A;  1RKT A;  3CCS I;  3V8L A;  1TQI A;  1FBQ A;  1XMA A;  2OC6 A;  2OD5 A;  3U9G A;  1Z1D A;  5E17 F;  2QBY B;  4U7D A;  1K61 A;  3TOA A;  3P9C A;  1KQ0 A;  1JHF A;  4JBA A;  5CVI A;  2EA4 A;  3Q9S A;  4IZZ A;  1OYW A;  1GV2 A;  1ODD A;  4HEA 2;  1Z9C A;  3KZY A;  2XC7 A;  3ABU A;  2DFH A;  3CQZ J;  4NDL A;  2ZJR F;  3RPU A;  1KQ9 A;  4QSH A;  2QEN A;  5B1A H;  4A6D A;  4G7Z F;  5LFA A;  1J7K A;  4IRI A;  3BR3 A;  1QGP A;  4L9N A;  2RNG A;  2XSJ C;  2IT0 A;  1YW7 A;  4AIJ A;  2NS7 A;  4IO9 F;  2W48 A;  4RGU A;  3FKJ A;  2KT0 A;  2ZSH B;  4H4K C;  3HOS A;  2CV0 A;  3BR6 A;  1MZB A;  2DDB A;  3DQV C;  3KLO A;  3DBL B;  3OYF A;  3AL0 C;  3FXO A;  2RRE A;  2XV4 S;  1WPK A;  2L9N A;  1FOW A;  1ONV A;  2DFI A;  4ETS A;  1B6A A;  1WGX A;  3S3M A;  5CVU A;  3L2R A;  1YIO A;  3C18 A;  3LA2 A;  3OYI A;  2RDP A;  4RGX A;  4DQ2 A;  3KIO A;  4I76 A;  2HYJ A;  4IHS A;  5EYR A;  3A4C A;  3BT9 A;  4ESF A;  2WA0 A;  2ZO4 A;  3MZY A;  4L5J A;  3PUB A;  2ZCW A;  3GTK J;  1LKX A;  3FBI B;  1G8X A;  1R58 A;  5L3G A;  1S9H A;  1USS A;  2HXI A;  4LMY A;  4S04 A;  3A01 A;  3TMO A;  3MEX A;  4YG2 F;  1XDS A;  1X3W B;  1OCR H;  3H0D A;  2DN0 A;  1FIP A;  3OOU A;  4OIO F;  3J80 Z;  2IW5 A;  2QEX I;  2IPQ X;  4OAZ A;  3TBI A;  4XLA A;  5B3S H;  4FT8 A;  2FXA A;  2JRT A;  4J01 A;  4W97 A;  2PMH A;  2Y31 A;  2ZBK A;  3DPU A;  3EQL F;  2F5E A;  1XCB A;  1FP1 D;  2MFZ A;  2N8G A;  1UZC A;  4QTR A;  1FT9 A;  1O3R A;  3ECO A;  3R60 A;  1ON1 A;  2JN6 A;  3ISP A;  4MTD A;  2PG4 A;  5ED4 A;  2CQX A;  2D2W A;  1U5T A;  2LTP A;  1FNN A;  2L4A A;  3S1Q J;  4DZJ A;  2K9N A;  4LG0 B;  1P4W A;  1IGN A;  4HQM A;  3VEP A;  2XVC A;  3HZJ A;  4HV6 A;  5J4V A;  1Y1V J;  4XKC A;  1U8B A;  1MNM C;  1WJB A;  3BTC A;  4E7Z A;  2ECC A;  3WGI A;  4DBR A;  2R7Q A;  1NHA A;  3KYD B;  2I8D A;  4BE1 A;  1X2N A;  4PZJ A;  3LSJ A;  3TP3 A;  3IUO A;  1SC7 A;  2QYO A;  4BKX A;  4E7L A;  2DPU A;  4G7H F;  2VLA A;  2M4K A;  2ZJ2 A;  2E2H J;  1T0F A;  2PMZ N;  1A6I A;  1ZYR F;  3U1K A;  2EIK H;  2MLG A;  4OIR F;  4P96 A;  4PSX A;  1DGW Y;  1D1B A;  4CIC A;  4A3L J;  1IDY A;  3H5N A;  3AG4 H;  3SDB A;  4KIC A;  4MEX F;  3PO3 J;  1D0X A;  1TW3 A;  2E36 A;  1SFK A;  1UAA A;  4GXO A;  4G6Q A;  3EPZ A;  2HOE A;  5A2Q K;  4WXD A;  5FKM A;  3ASO H;  3RQ4 A;  5HLH A;  2IXS A;  2IGN A;  3M1C A;  3PM1 A;  5LLQ A;  1JTY A;  5IOZ A;  2NVQ J;  1MJ9 A;  2R7D A;  3HBL A;  1ZR2 A;  2VKD A;  3OL4 A;  4J00 A;  1RPW A;  2DMP A;  2E35 A;  4ANJ A;  3OYG A;  2DA7 A;  3BDD A;  2VQH A;  2KLO A;  3VDX A;  3BQY A;  3WU1 B;  4U0V A;  1S7E A;  1OCO H;  3SJM A;  2GM4 A;  4EJT A;  1NTC A;  3CCJ I;  2K27 A;  3OY9 A;  3ESW B;  2WY7 Q;  1KYZ A;  4M3E A;  2XPV A;  2V79 A;  1QVT A;  4BE2 A;  1FYK A;  1KU2 A;  4HZF A;  5DD4 A;  4Z2Y A;  3VB2 A;  4OWR B;  2ZC2 A;  4UVC A;  5ERI A;  5DM7 F;  4LOC A;  1REP C;  2HZT A;  1IN8 A;  3LFU A;  4U0W A;  3LFK A;  2W25 A;  1G3T A;  3S8P A;  3UKG A;  3GBG A;  3ABT A;  3F8B A;  3KZZ A;  3PJR A;  1IN6 A;  2DXI A;  1YHQ I;  2X1E A;  4LK1 F;  3V8K A;  2M2E A;  3OIQ A;  2DPD A;  1KZH A;  2HYG D;  5H20 A;  4BJT A;  3G6E I;  3NWS A;  5ICG A;  1K4S A;  3QAH A;  3OYJ A;  1PUF A;  1K6O A;  3PQK A;  5JHF A;  3IWF A;  4WF2 A;  3W2V A;  4E4H A;  1JTX A;  1P92 A;  2FOW A;  2OZ6 A;  2X1D A;  3V7R A;  4A3B J;  3ABM H;  2HGC A;  3KET A;  4XLC A;  4BQO A;  3O3K A;  4YIR X;  2COM A;  4FIS A;  3MFK A;  2LY9 A;  5LRR A;  2OZU A;  5AON A;  2R7W A;  3G71 I;  3K9T A;  5K7Z A;  1Y8R B;  4CO8 A;  5IPA A;  1TWF J;  3FXJ A;  3BWG A;  3K4B A;  2CV2 A;  1R71 A;  3FXQ A;  1V5F A;  3HUG A;  4HF1 A;  4HPQ A;  3OSG A;  5D6E A;  2IGK A;  3HM5 A;  4C3H J;  1YYV A;  2HTJ A;  1XD7 A;  4M9X A;  3H3Z A;  1XCV A;  1U6G A;  2Y69 H;  1QVU A;  4A3M J;  1BC7 C;  4HW0 A;  1D3Y A;  2OQG A;  3VYU B;  1PUE E;  1I5Z A;  1LEB A;  3JW4 A;  4IHV A;  2HOS A;  4YFX F;  4AM3 A;  4L0Z B;  3QWL A;  3OYC A;  5EZH A;  2HVS A;  1R1T A;  4XOR A;  4X6A J;  4XLF A;  2J5P A;  4GYG A;  2QSG X;  3FF5 A;  3BR0 A;  1FYL A;  2P81 A;  3MQ0 A;  5FO5 A;  3UR3 C;  2FX0 A;  3EYI A;  1GXQ A;  2MBF A;  2H1L A;  3I0T A;  3C7J A;  2FJ1 A;  1HDP A;  4RDU A;  3MWM A;  4RS8 A;  1YRN A;  3JRF A;  1HA8 A;  3A1Y A;  2W4S A;  2KIU A;  3BLY A;  3LWF A;  2AHQ A;  2CQN A;  2COB A;  2F5C A;  3P5J A;  3R0A A;  2FNP A;  1OFC X;  3K4C A;  2QWW A;  3I53 A;  3Q0U A;  2WAD A;  3DU5 A;  3R4K A;  2O7O A;  4IL6 C;  4XRF A;  3KP7 A;  3CCV I;  4HF0 A;  2QF7 A;  3KEY A;  3S1N J;  1V5G A;  1WJF A;  1MDM B;  1DP7 P;  4HF2 A;  3EGV B;  2IEK A;  1R4M B;  4KIT B;  2ELK A;  3CMM A;  4ZDO A;  2VQG A;  3CMA I;  3B02 A;  2QQB A;  1UHM A;  3ERE D;  2QQ8 A;  1VF9 A;  2KJC A;  3JSO A;  3MKL A;  2NNY A;  4WX9 A;  2NNN A;  2ME0 A;  1TZL A;  1I6H J;  4V2G A;  3CP8 A;  3J7A Y;  1PP8 F;  3LAJ A;  2L3D A;  1HLV A;  3FBN B;  3NRV A;  1MBF A;  4XQF A;  2E5N A;  3GLL A;  5CYV A;  1GVJ A;  1WI9 A;  4KN7 X;  4ZZL A;  1LVK A;  2O6G E;  1OYI A;  3TDZ C;  5EF6 A;  2Q2E B;  2HI3 A;  4XK4 A;  4CCJ A;  1CF7 B;  5F6F A;  4XRS A;  3QQA A;  1Z05 A;  3BR5 A;  3IKV A;  3PIO F;  1UST A;  2G0E A;  2HVQ A;  5JHU A;  4KJZ A;  1YG2 A;  2VJI A;  2PQ8 A;  4YIF A;  2VQC A;  3ZN0 A;  1OCP A;  4F91 B;  3QYF A;  1YS7 A;  2BW3 A;  3D5L A;  3O8H A;  4D5F A;  3CF5 F;  4QPO A;  1WJA A;  3ZMV A;  3CUQ A;  4HDU A;  3A2K A;  3O8G A;  1S7A A;  2BY3 A;  1SEU A;  2A61 A;  1E3P A;  4JOM A;  2W00 A;  2LG4 A;  4F55 A;  2NAZ A;  2ZXH A;  4RMN A;  3LSP A;  3ZRG A;  1EJ9 A;  1WH5 A;  2DK5 A;  1KON A;  1ETV A;  2OJE D;  3DBH B;  2NVX J;  1XMK A;  2L01 A;  3NQO A;  1FPQ A;  3KFW X;  1AOY A;  1IXC A;  1TNT A;  5K5O A;  1W7P B;  4XKV A;  4I99 C;  2Q1Z B;  3BRO A;  2E1M B;  5LBQ A;  1EKE A;  1EH8 A;  4WXH A;  3WTS C;  2OA4 A;  5BMZ A;  3GZ6 A;  4LIV A;  2P6S A;  3KX2 A;  3EUA A;  1UG2 A;  3H0G J;  1J75 A;  1AWC A;  2VB6 A;  1R22 A;  1MW7 A;  2JPB A;  1WJD A;  2FRH A;  4G12 A;  4GRI A;  2M30 A;  5DCF A;  1ETW A;  1IUF A;  4KYW A;  3CDL A;  4I6Z A;  4XN3 A;  2EV6 A;  3JAM Z;  3V42 A;  2LRD A;  4PGG A;  4PDK A;  2F6C A;  2QZ8 A;  1J09 A;  2KP6 A;  2BBY A;  1FP2 A;  2H8R A;  1MMS A;  1BM9 A;  1HKS A;  3JRA A;  4L9J A;  4AUX A;  2ISY A;  2LMD A;  5FKN A;  1R9T J;  3CC7 I;  4D1Q A;  2DTZ A;  1D0Y A;  4PFO A;  3BTI A;  1JGS A;  2JZY A;  3EUH A;  3M9A A;  2G7H A;  1WRJ A;  2JA6 J;  2JA8 J;  2LVS A;  1B1B A;  3DLA A;  4FAS D;  3ULQ B;  3JTH A;  2DW4 A;  1HXD A;  3QPS A;  4HX8 A;  2VJJ A;  4I02 A;  2LC2 A;  2W85 A;  1UHS A;  2JVG A;  5AIP A;  3QOE A;  4GYI A;  4NC8 A;  5EG0 A;  3RYR A;  2RC4 A;  1BI1 A;  1TW2 A;  4ITV A;  3X2Q H;  1QZE A;  3K0L A;  4D5C A;  1NH3 A;  1J5Y A;  2EBI A;  2V1N A;  2WAF A;  3AG1 H;  1ZG1 A;  3KCC A;  4NQW A;  1P4A A;  3JRC A;  1HOM A;  3NAR A;  2XIG A;  1MND A;  5DCM A;  1C0W A;  3GXO A;  1FY7 A;  4MQV A;  2Z2S B;  1Y0U A;  1ZRC A;  1R36 A;  4XOP A;  1B9N A;  2XB5 A;  2BGC A;  1E17 A;  1RR8 C;  3OS2 A;  4PJM A;  3F23 A;  2WBM A;  5ILS A;  1K7A A;  2X6Y A;  1DPR A;  1HW5 A;  2MH9 A;  2IS1 A;  3P9K A;  4IRH A;  4RBO A;  4IEJ A;  3S32 A;  3WU2 C;  1XN7 A;  1HC8 A;  2K9L A;  6PAX A;  3WG9 A;  3CF2 A;  1WCM J;  4PJ0 C;  4ZTJ A;  2D45 A;  2X51 A;  4OOI A;  1Z7L A;  2M0C A;  1PP7 U;  2TDX A;  1QHH D;  4C2M J;  1VQ5 I;  2VKE A;  5K7H A;  3KLN A;  4RB1 A;  1MMA A;  5TGT A;  1RUO A;  2Y75 A;  5K5R A;  4HBL A;  5IY5 H;  2P5L C;  1FIA A;  3PSI A;  4ENJ A;  1FYM A;  4B44 A;  4E6K G;  2O3F A;  4JQF A;  4EVI A;  4NB5 A;  5L3C A;  3JCU C;  3REO A;  2DMU A;  3RKX A;  3RSN A;  1WH7 A;  1XS9 A;  4MIM A;  2FE3 A;  5FLV A;  3ZQG A;  4B48 A;  4AC0 A;  3H9Q A;  2PJR A;  1SD6 A;  3QOP A;  2VJ5 A;  1XMX A;  3CC4 I;  1A35 A;  1ZK8 A;  3ZQF A;  1P7I A;  1ETO A;  3FK7 A;  2KPM A;  1ZG5 A;  1JJ6 C;  4OU0 A;  3SDG A;  2R7Z J;  1O4X A;  4V2F A;  5B1B H;  2NVT J;  2DMQ A;  1RRJ A;  2L2O A;  1LFB A;  2KFD A;  1IN7 A;  3K1N A;  2ZB9 A;  2JJ7 A;  1YE9 A;  2V4J C;  3MZH A;  4B1R A;  4S05 A;  3ZMZ A;  3W3C A;  3HTS B;  1YW8 A;  4LG3 A;  1ORK A;  1S29 A;  1LE8 A;  2EH3 A;  2MC4 A;  1BC8 C;  1MBK A;  2DA2 A;  3OMY A;  1BI2 A;  3C3W A;  2FBH A;  2NS0 A;  5D5V B;  1SMT A;  1KQ8 A;  1IW7 F;  2DQL A;  5FFX A;  5HS8 A;  1SD7 A;  2WC2 A;  3DFG A;  1BW6 A;  2EIL H;  2CH0 A;  4DIQ A;  3ABL H;  3GW2 A;  1Z91 A;  4NHJ A;  2FEZ A;  3OYB A;  3SZP A;  2MYS A;  5HNF A;  1T2K A;  1E3O C;  4BXX J;  4Y52 J;  3ZQI A;  5TRD A;  4AYB N;  1WJE A;  3CJN A;  3BR2 A;  4RAZ A;  3VFZ A;  2VXD A;  5M3F J;  4MHG A;  5FRM A;  2EZK A;  3VWB A;  4CCM A;  1KGS A;  3SZG A;  1BW5 A;  1MH4 A;  2CW7 A;  3ZMS A;  1IRF A;  3HJE A;  3N97 A;  4XOT A;  3TW7 A;  4CZC A;  3DEW A;  4XBF A;  4IRG A;  4ZC3 A;  1SFU A;  2O9L A;  1F1Z A;  5M5X J;  4BBS J;  2HOA A;  1B72 A;  1CQT A;  2HQA A;  2F5D A;  5F64 A;  4A3K J;  3FM5 A;  5JLW A;  5C44 J;  1X4P A;  2BY0 A;  2A6T A;  2VBW A;  1RR7 A;  3LA7 A;  2CFO A;  5HVQ C;  4II3 A;  2GQQ A;  3BG3 A;  1WI3 A;  1IZ1 A;  2DFE A;  3HGY A;  3A01 B;  2O0Y A;  2PMU A;  2WTE A;  2V1D A;  1LUJ B;  3GZN B;  4QLC U;  5F1R A;  3CC2 I;  4M9Z A;  2AQF A;  3L7W A;  1J2X A;  3WTX C;  2FBI A;  3FZV A;  1TC3 C;  2Y0S A;  1VND A;  1B8I A;  3HB9 A;  4UXN A;  1UB9 A;  1MIJ A;  2GWR A;  1I1G A;  3I9V 2;  5FJ8 J;  5M5W J;  4PSW A;  2K02 A;  4IQ4 A;  1LEA A;  2QSF X;  1LPQ A;  1Y39 A;  2E2I J;  1QPM A;  1MMN A;  2DFF A;  2P4W A;  4BEH A;  2YU9 J;  3E6D A;  2X6W A;  1FBS A;  2XAS A;  1VQO I;  2EFP A;  3IAM 2;  1QRY A;  1U5T B;  2GZW A;  2LBF A;  2Q8K A;  3S1M J;  5CJ9 A;  2R0Q C;  3RJP A;  1H9G A;  2AO9 A;  2JK3 A;  4CH7 A;  1Y56 A;  3HRM A;  1AA7 A;  4II2 A;  5EZG A;  1R7J A;  5J1Y A;  5HLT A;  3SEZ A;  2ZJQ F;  5IP6 A;  4ZYG A;  1I39 A;  5ILV A;  1N78 A;  3BG9 A;  4A93 J;  5JVG F;  3GF2 A;  2B7E A;  2OCE A;  3LAP A;  1NK2 P;  3U2R A;  1YIT I;  2P7C B;  1YTY A;  3WU0 A;  2BHY A;  1EV7 A;  4DZP A;  3M8E A;  3I59 A;  4JX4 A;  3KYL A;  4UV8 A;  3VSL A;  4CDG A;  4KUM A;  2A69 F;  2ZME C;  4E7K A;  2B63 J;  4DGW B;  4R1H A;  4EJV A;  3H35 A;  2E71 A;  2DA4 A;  2X4H A;  2Z1D A;  5E79 C;  1E2X A;  2MA3 A;  2GOM A;  4XSZ F;  3JAM K;  2CFX A;  5LEK A;  2BXY A;  3GO5 A;  5D4R A;  4BH9 A;  3C1D A;  4RLQ A;  2RVC A;  2ECB A;  2B9S A;  4C3I J;  2FSW A;  1WSU A;  2X6X A;  3FWE A;  3ROU A;  3B6C A;  1O3T A;  2X1C A;  4Y13 A;  2IRF G;  2R7U A;  1JUM A;  2W84 A;  4MTE A;  3RZD J;  3FK6 A;  4AID A;  2R7R A;  3ZQ7 A;  1RI7 A;  2Z99 A;  3K4L A;  4AYB A;  1YJN I;  2LYC A;  1V55 H;  2VAS A;  1NG6 A;  1ZQ3 P;  5HDG A;  1BR4 A;  3S3N A;  3DXJ F;  3G2B A;  1HST A;  5GPC A;  1Y1W J;  5D5U B;  1VQ7 I;  2JTV A;  1BOB A;  1VTN C;  4RGS A;  2XAH A;  2XB0 X;  4UUS A;  2VPL A;  5KAI C;  1OKR A;  3G1O A;  4XLH A;  4XLP F;  4WK8 F;  5C4X J;  4UVB A;  2LLK A;  1G3Y A;  3OIO A;  3CLO A;  5E1X A;  3BPV A;  3LSM A;  1HBX G;  3M3Y J;  2HS5 A;  3HC7 A;  1JUP A;  2BZT A;  2LFB A;  2F2E A;  1UG0 A;  5D4S A;  3CMY A;  3KP3 A;  5DUK A;  3ZP5 A;  1UEL B;  5CVR A;  3L09 A;  4CYD A;  3OYH A;  2OTJ I;  4A3D J;  5E3N A;  2YX4 A;  2L7K A;  4LLG F;  5K7F A;  4M6V A;  1PUF B;  4C2T A;  4JX6 A;  4HNV A;  2DO7 A;  1YIJ I;  1K78 A;  5HOO A;  1D1C A;  3G73 A;  1LB2 A;  4KA4 A;  2BVM A;  2M5W A;  1U9O A;  3MCZ A;  4B4C A;  2H1K A;  1WVR A;  5GAE J;  3I5U A;  1UCR A;  2M34 A;  1OCT C;  3GTQ J;  2KRF A;  3DPT A;  1T38 A;  3BJ6 A;  3HUG B;  1I50 J;  4M3B A;  4BHC A;  2YX7 A;  1JKP C;  3Q0V A;  2KIM A;  5F0F A;  4RAG A;  5HDK A;  3R6S A;  2KQR A;  2QKM B;  4N9H A;  4HRI A;  4IVN A;  5CVV A;  3S2W A;  4BHP A;  1LDD A;  3PIP F;  1SVM A;  1I3Q J;  1ZAO A;  3DKX A;  1TWH J;  4N4N B;  4YFK F;  1W0U A;  2ZNZ A;  3S93 A;  3LQR A;  4RB2 C;  3TDU C;  2WB1 N;  5JR3 A;  4A69 C;  2E1C A;  1TQM A;  3EYY A;  2QBY A;  1G2H A;  4UNO A;  3DTE A;  4YII A;  3NAU A;  1IV8 A;  2FOK A;  2EIJ H;  2EFQ A; 
#chains in the Genus database with same CATH homology
 1VQL I;  3CCU I;  5DM7 F;  2OTL I;  3CJS B;  2ZJP F;  5GAG J;  2QEX I;  1YHQ I;  3PIO F;  1YJN I;  2QA4 I;  1WIB A;  3G6E I;  5GAH J;  1FOY A;  2FOW A;  1VQ7 I;  3CF5 F;  3CJR B;  1VQ4 I;  2E34 A;  3CD6 I;  1QA6 A;  3CCE I;  3G71 I;  1VQ9 I;  1YJ9 I;  1HC8 A;  1VQ8 I;  3CCM I;  3CCL I;  1YJW I;  3CC2 I;  1VQ5 I;  1VQN I;  2H8W A;  3CJT B;  3DLL F;  3CCS I;  3CCQ I;  3CME I;  1FOX A;  4IOA F;  2OTJ I;  3J7Y J;  1Y39 A;  4IOC F;  1YIJ I;  1VQO I;  2ZJR F;  3CC4 I;  5GAE J;  1VQK I;  2K3F A;  1VQ6 I;  3CCR I;  2E36 A;  3G4S I;  2ZJQ F;  4IO9 F;  1MMS A;  3J7Z I;  3CC7 I;  3I56 I;  5JVG F;  1VQP I;  4UY8 I;  2JQ7 A;  3PIP F;  1S72 I;  1YIT I;  3CCV I;  1VQM I;  2NXN B;  3EGV B;  1FOW A;  2E35 A;  3CMA I;  3CJQ B;  5DM6 F;  3CCJ I;  1YI2 I;  4V19 K;  1ACI A;  3I55 I;  5GAD J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...