1U5TB

Structure of the escrt-ii endosomal trafficking complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
169
structure length
169
Chain Sequence
LDREKFLNKELFLDEIAREIYEFTLSEFKDLNSDTNYMIITLVDLYAMYNKSMRIGTGLISPMEMREACERFEHLGLNELKLVKVNKRILCVTSEKFDVVKEKLVDLIGDNPGSDLLRLTQILSSNNSKSNWTLGILMEVLQNCVDEGDLLIDKQLSGIYYYKNSYWPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords appears to be functionally related to SNF7; Snf8p
publication title Structure of ESCRT-II endosomal trafficking complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 43
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2004-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1u5tB01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1u5tB02
3WTYC 2EA2A 1BI2A 2V9VA 2ETHA 2CGPA 4UV8A 3F23A 2VONA 3MFKA 5LHHA 4N9HA 5D4RA 3BOQA 2L4AA 1KU9A 4HYEA 3I54A 4ENJA 5L3DA 3I58A 3DEUA 4L9JA 1LVAA 4ZYHA 2HR3A 2XVCA 4R8HA 3BZ6A 3E6DA 3HOSA 4Y17A 3F8NA 2WWYA 2RDPA 2XUBA 4NB5A 3KZZA 5HDKA 1MD0A 1ON1A 1HXDA 1W7PA 2HS5A 2LSOA 1R22A 5F64A 3FM5A 3I59B 5FLXK 5HS9A 5JFRA 3O6BB 2ZFWA 3K1MA 3WU0A 2VOOA 2JRTA 3WTWC 1T98A 2Z9OA 4MTDA 4U88A 4WK8F 1WKMA 1YS7A 4CDGA 2HEOA 3I4PA 4JK1X 2A6EF 1CGPA 3I71A 4LMYA 4IJAA 1AOYA 1W7PB 3F8BA 4RGSA 4OU0A 5CVRA 1U2WA 2O0YA 2BYVE 4M6XA 1NHAA 3FXRA 4XBFA 4LJZF 2Z33A 2MA3A 4IVNA 4AIHA 2QUFA 2VODA 4ZH4F 1MJAA 2A6HF 3M9AA 2XIGA 5EEGA 3H3UA 2RKHA 3RDIA 3V7RA 1YQAA 3KP5A 5JR3A 5LRSA 2UXNA 2COMA 3RKWA 2V1UA 2XAJA 4IPAA 2ZCWA 1ZREA 1Z6TA 3DPTA 2HOEA 5K1YA 1DP7P 2FSWA 5KVRA 5DUIA 1FBSA 2HKXA 4ESBA 1STZA 4WF2A 1QZZA 1LQ1A 3HRMA 3HUGA 2Y75A 3DFGA 4G94A 3BJ6A 2IW5A 1FT9A 5DV5A 2K02A 1JHHA 4P5OA 4CXFA 2IPQX 2L3DA 1F4KA 4UHTA 2HYFA 2JSCA 3GZ5A 3FX3A 3TDUC 3F3XA 4KUMA 2H09A 4KT5C 4M72A 2O6GE 1BC8C 2F2EA 2L02A 1R00A 5D4SA 2ACJA 2X4HA 1KQ9A 3IC7A 1SFEA 2P7VB 4OIPF 2DQLA 1ZRDA 1SAXA 2TDXA 3RTRA 1XSVA 3ISPA 3OV8A 1XDSA 1D8JA 3EYYA 3C7JA 2WV0A 1USTA 2NRAC 2KJCA 5LEJA 3HHGA 1ZRCA 1FOKA 2EFQA 4EJUA 5J8FA 3RJPA 1T6SA 3CTAA 1FP1D 3SQNA 3BDDA 1PP7U 2CYYA 3NQOA 4OOIA 1FX7A 4A5NA 2GWRA 4MEYF 3ZN1A 3GYHX 2O8XA 4XLPF 4PCQA 2Z3YA 2VT3A 1O7LA 4EGYA 1HQCA 3KEOA 3DF8A 3I64A 4EGZA 2VOPA 4G7HF 2EFWA 3T0YA 3CUQA 3QPTA 3F6VA 4UXNA 2ISYA 3WTTC 3CO7C 4HDVA 4HX4A 3GFLA 1U78A 2Z99A 5LHIA 2HQRA 1AWCA 5CVIA 4HBLA 2DI3A 2ADUA 3AAFA 1S8NA 1YW7A 4HW0A 4MEXF 2RGVA 5H20A 1O3TA 5L3EA 2ISZA 1ZYRF 2LNBA 1J7KA 3ERED 3R0AA 4H0EA 2K4BA 3ZMVA 2MLGA 3GVAA 1LEAA 4GYGA 2EK5A 2O3FA 2CSOA 2ZMEA 3GX4X 2DU9A 2EB7A 1BOAA 1R1UA 2RC4A 2A5YB 2GA2A 4RAYA 2KIFA 4KNYA 3K0LA 4WXDA 1LNWA 4RB0A 2FBHA 2Y48A 2ZNYA 3QPHA 3RKXA 2CG4A 3E5QA 1HSJA 3WTVC 1ZARA 3HIFA 3PFIA 3IKTA 3J80Z 3KEQA 3C18A 3HRUA 1SFUA 4RS8A 3DKWA 3FM3A 2KRFA 1KYWA 4OIOF 4LLNA 3ML6A 1TNSA 4HX7A 4WCGA 4I01A 5LBQA 4TV7A 1BJAA 4HF1A 1BIAA 4L0ZB 2H94A 4UVAA 3GF2A 2KIMA 4M9SA 1E17A 3ECOA 3GWZA 2VBWA 3L7WA 4RGUA 2CFXA 4WXCA 1SD4A 5HDGA 4RGXA 2W84A 2P5KA 2K4JA 2WC2A 3QAHA 5DUKA 3BPVA 3FWEA 4R1HA 3QOPA 2HKOA 4DQ2A 1XGSA 3E3VA 5F6FA 2VE9A 2PI0A 3F22A 4EJOA 1XCVA 4S04A 1SMTA 2FEZA 2YSRA 3WE3A 1KU3A 5KK1A 4Q4ZF 4M73A 3CUOA 3JSPA 4I7HA 2E7XA 2VT2A 2GXBA 5A2QK 5H6QA 4IHTA 3CUQC 4L9NA 2HTJA 2IT0A 2DQRA 5LRRA 4JQFA 4LGWA 3HOTA 1KU7A 3F8CA 4ASNA 5D5UB 4KN4X 5HVQC 3IWZA 5FFXA 2L4MA 4I0BA 1YYVA 1F5TA 2P6SA 5J6XA 1XMAA 2FMLA 2XAGA 3V4GA 5D8KB 1R58A 2AS5F 3G3ZA 2LF7A 3E6CC 1P6RA 1P4AA 2VBYA 3L9FA 4IXAA 4MHGA 1S3JA 3KZYA 5TJJA 2F5EA 2OD5A 4YIIA 3U2RA 2PMUA 1I1GA 2JZYA 5CVJA 1EH6A 1GXQA 2QZ8A 3L00A 1SFXA 1TLHB 1T0FA 1U5TA 1EH8A 1DDNA 2R7FA 3B73A 4LFUA 4CO8A 4ZZLA 1DPRA 1B6AA 4MQ9F 2HDCA 4I98B 4KMFA 1S29A 3HSRA 5K5RA 5LGTA 4KYWA 4MQVA 2YPRA 2L01A 1ON2A 5E20A 1YFHA 1KQ0A 4EJTA 3F21A 3CLOA 1TNTA 1UB9A 1YG2A 1U8RA 2GA1A 5F1RA 4KMUX 2LDUA 3FHZA 4EMSA 2MD5A 2A68F 1YS6A 1OYWA 4A6DA 1U5TB 1MJBA 1KA8A 4G6DA 1CF7A 5E8IA 1YTYA 2XAQA 2JT1A 3EETA 1R7JA 3TOBA 1ZG1A 4GO1A 1FBUA 2H6CA 2O03A 2XROA 3PQJA 4HLXA 2Y0MA 4U7BA 2OZUA 3DXJF 4GYIA 4LLGF 1I6XA 1K78A 1I1SA 4I2OA 5D6FA 1D5VA 5DCFA 1G4DA 2K86A 4HDUA 3SZTA 1T38A 1RZ4A 1FZPB 3ULQB 3K69A 2STWA 3P7NA 1CF7B 1FYMA 1Z7UA 5DEQA 3ZQ7A 1ZAOA 3IHUA 2GZWA 5BMZA 1BN5A 3GEZA 4A2UA 2R7DA 4RB1A 5ILVA 2DLLA 3WU1B 4BNCA 3U9GA 1K78B 4CGZA 3BWGA 5LHGA 3FXQA 2QM3A 5IT3A 2PMHA 4BHPA 1XGOA 4IRHA 1W7PD 2QYOA 4UUVA 4ON0A 1O3QA 3FMSA 5DD8A 1O3SA 1FYKA 2NYXA 1GVJA 2XAHA 4L5JA 3WTSC 3LSTA 3HRTA 4GXOA 3R61A 2CO5A 5ICGA 1TQIA 3M8EA 2RQPA 4Y15A 2F5FA 5HS7A 1LDJA 4GCVA 5ERIA 4G7ZF 3QU3A 3GO5A 4LB5A 2Q8KA 1OR7A 4M9ZA 1RNLA 1QQIA 4AIKA 2IA1A 2XRNA 5LGNA 1KYZA 5CVUA 2OA4A 3CDHA 1MZBA 2P5VA 4KA4A 2EFPA 1R5HA 3WTUC 4HV6A 1YW8A 1OYIA 2DT5A 3P9IA 1OYYA 1Y0UA 4EJVA 1U5TC 2ESHA 5IT9Z 3RKYA 1T2KA 1IRFA 2KIUA 4A12A 4HQMA 3ROUA 2DPUA 5ED4A 1Q1HA 3D0SA 2YX4A 5HLHA 5ICEA 5JHUA 2DAOA 4DNCA 1O57A 2J5OA 1IXRC 1XGMA 5DDGA 2QVOA 1WWXA 3W6KB 1KQ8A 1QGPA 3PQKA 3U1DA 3FZVA 2P7CB 1DPUA 3K1PA 4JBAA 1ZHFA 2ZBKA 3KLOA 3LWFA 2IJLA 5BOXA 1HW5A 3L09A 2MC3A 4O5VA 2MBFA 3VEPA 1Z6RA 3LAJA 4A0YA 5HOOA 2BBYA 1YIOA 3CO6C 4L0YB 1F9NA 4BXUA 1TQPA 2ELHA 5JI6A 2ESNA 2BEOA 1V4RA 3OOPA 3WTZA 4G6QA 3VFZA 2J5PA 3ZMZA 2JTVA 4KICA 3F8FA 3H3ZA 1LEBA 2V79A 4A0XA 1KU2A 2A3SA 1SD5A 2QQAA 4KN7X 3N97A 3LQRA 5DYMA 2E1CA 1ZLJA 4HX8A 1J0RA 1DUXC 4CYDA 2EWNA 5CLSA 2HWVA 2FNAA 4EM0B 1W4MA 1FC3A 4IHSA 2D2WA 5CYVA 5D8LB 2IVMA 3FMQA 3J80K 4M74A 1OMIA 3BY6A 2V1XA 1VTNC 1IAWA 2M8EA 1A04A 3KFWX 1B4AA 3K2ZA 2M5WA 2YU3A 4A0ZA 3MZYA 3I53A 4IRGA 4HLYA 3KP6A 5ICCA 2P8TA 3IWFA 3CUQB 4N0BA 4XRFA 1IW7F 1IUYA 5D5VB 3BP8A 4CHUA 4GGGA 4BHCA 2VN2A 3FXUA 1XGNA 2QQBA 5HS8A 4WX9A 3DPLC 4NQWA 4CZZA 3HHHA 4K2EA 3K1NA 3JTHA 4MTEA 2GQQA 4Q48A 2JPCA 4L9TA 3NRVA 3RYRA 2IA0A 2AXLA 3HTUA 1MDMA 2FQ3A 2K7LA 1C0WA 2QBYA 2IP2A 1BIBA 2W57A 3EUHA 4OIRF 1S7OA 4OIQF 1QO0D 2G7UA 2ZMEB 3S2WA 1JGSA 4RB2C 5L3BA 3V7SA 1LJ9A 2NNYA 2PBIA 3ECHA 1FY7A 4YFKF 1IRGA 1EH7A 4M6YA 1HKTA 1XCBA 2XV4S 5E1XA 1PUEE 4F7ZA 5ICFA 3RYPA 3W6JB 2EFOA 3R0JA 2QWWA 1R36A 1HKQA 4ESJA 3ABUA 1R1TA 2QBYB 2ZXJA 1P2FA 1HW1A 1ZH5A 1ZGJA 2CW0F 1W5TA 2VC1A 1TW3A 3KP7A 1FNNA 3QP6A 3KP2A 1TTYA 3MQ0A 4U0WA 1ODDA 5LLQA 3Q9VA 2XHKA 3M7GA 4KDPA 4KFCA 5H6RA 4LD5A 1W5SA 2P4WA 2HYGD 5FD5A 2P5LC 2L54A 3TO6A 1K7AA 1ZGAA 2NAZA 2HTSA 3GFJA 3N4MA 4M71A 4NHJA 2KJBA 1Z91A 3GUDA 3P9CA 1TW2A 3BPXA 2GIVA 1R23A 3T8TA 3BJOA 3GLXA 3GW2A 1IN7A 1IXCA 2RVCA 2EV6A 4HAMA 2A69F 1FWZA 1XSDA 3F72A 2NNNA 2FRHA 3CJNA 1YW9A 4FX4A 1ULYA 1D3YA 1GHCA 4O6JA 3C3WA 2GAUA 2YR2A 1S7AA 1LDKB 2BE5F 1V3FA 1FBQA 1Z05A 3T8RA 3FMRA 2VXZA 2HGCA 3F6OA 4XLNF 3B02A 5ILSA 4S05A 4UV9A 4HA8A 4A6EA 5FB2A 2VC0A 2HQNA 2P6TA 4L5IA 1ZG3A 1J5YA 5AIQA 3SZPA 4PZJA 2F5CA 3KE2A 3E97A 3LFKA 2FNPA 2DBBA 2EV5A 4MGRA 5FGMA 1H9TA 2G7HA 4I02A 4ENNA 1J9IA 3REOA 2OZ6A 3R6SA 3BROA 4ESFA 1BI1A 3HTSB 2PLYA 3ZN0A 4EQQA 3WGGA 3O2PE 3ZMTA 1F1ZA 4N9IA 1U6GA 5FD6A 1FYLA 2MH2A 3ABTA 2YX7A 1IZ1A 2HZTA 5EEHA 4AIJA 4BHBA 2FXAA 1YO5C 4PGGA 2V1DA 1JHFA 1S6LA 1XB4A 1P4WA 4UVCA 2D1HA 3G73A 3GFMA 4YFXF 4UNOA 2PJPA 1G3WA 3I59A 4P55A 3IKVA 4YG2F 4ENMA 3V8KA 4U0VA 2UXXA 1G6NA 1FLIA 2CQKA 2EJRA 3M8FA 2PG4A 2XGXA 1SMYF 1XMKA 2G9WA 3LA7A 3O3KA 4I09A 2OBPA 4BYYA 3JAMK 1J59A 3SXYA 3VB2A 5ILUA 1Z9CA 1KGSA 2JPBA 3TOAA 3EQLF 5HLIA 4XSZF 4EJWA 3C1DA 4AVPA 3V8JA 1QNTA 1YLFA 1UHMA 1XN7A 1H9GA 2LKPA 4LG0A 2NS0A 5FO5A 1FP2A 5L3GA 2A61A 2W85A 3TDZC 1USSA 4PGHA 3E6BA 1K6OA 5DCMA 4HF2A 2DO7A 1ZN2A 2DPDA 5IT9K 2HFHA 2MH9A 1WI9A 2BGCA 3I5UA 3R4KA 4OINF 3K9TA 5LGUA 4M9XA 3KETA 1B9MA 4QWQA 1MJ9A 2GXGA 2OQRA 2A07F 3WG9A 3JAMZ 2DK5A 4LG0B 3TO9A 2DTRA 2PEXA 1HW2A 2MLKA 1G3TA 4I0AA 5DCMB 1BBYA 1I5ZA 5AONA 3KP4A 4HV5A 4BAYA 2XASA 2PQ8A 5FLXZ 2X0LA 1FPQA 1QZYA 4AD9A 1I27A 3FF5A 4Q5SF 4HQEA 5E8GA 3Q9SA 4ZZDA 5K5OA 1PDNC 3QU6A 2STTA 2E7WA 4LLLA 1IF1A 4EV0A 2FF4A 3DQVC 1R1VA 5E17F 5L3FA 2LF8A 3ZP5A 4O3MA 1RI7A 2Z5UA 3P9KA 4RGRA 1JE8A 1BC7C 4G8XA 1LDDA 1H0MA 5TRDA 4IF4A 2ZNZA 3T5XA 4YIFA 1Z1DA 2XAFA 2FOKA 5JVTA 2E1NA 4EM2A 4B09A 2QENA 1FSEA 2DW4A 5FFZA 4R79A 4G9YA 5D6EA 2QQ9A 1IN4A 2VBXA 1QPMA 1RUOA 4LK1F 5AIPA 4YFNF 5J8CA 3IL2A 2VE8A 1RIOH 3KLNA 3RPUA 4L9VA 3NEUA 1UFMA 3TKYA 2FBKA 3ZMDA 4LK0F 3TQNA 3M1EA 1XDUA 1HBXG 4U0YA 3WGHA 5BPDA 1P92A 2FE3A 1BI0A 3GZ6A 4BQAA 1MKMA 3BJAA 3ELKA 4FX0A 4CICA 2H27A 3SFZA 3WGIA 4OMZA 4EVIA 1GXPA 4XSXF 2PFBA 4A5MA 1WRJA 3Q5FA 3RI4A 2FMYA 2W24A 1L0OC 3MZHA 2M87A 2D45A 1O7FA 4FT8A 1TQMA 5HLGA 3LAPA 2XKOA 3E6MA 4ZYDA 5D5WB 2R3SA 1BM9A 2Q0OA 6PAXA 4B8XA 2M45A 4P96A 2EV0A 4WXHA 2RV8A 3T1BA 3JSOA 3J7AO 4MNUA 2D1VA 1IN5A 2DFIA 2B0LA 5HDNA 1WQ2A 5DD4A 3HSFA 4RAZA 4OMYA 3LQQA 3GXOA 1U3EM 4QLCU 1B9NA 5CVVA 1ZLKA 4KIFA 5CJ9A 1OKRA 2UZKA 2FBIA 4PDKA 5E1ZB 1ZG5A 1X3UA 3IRQA 1ONVA 1P4XA 1SD7A 1T39A 2OU2A 3D5LA 3IRRA 3VOEA 5BQTA 4HOBA 1PP8F 3JW4A 4HZFA 5LEKA 2Q2EA 1MDMB 3WTXC 2KKOA 4D0PA 4ENKA 3WODF 2ZKZA 4G7OF 2UWMA 3EDPA 4FHTA 4KIGA 1G3SA 2OQGA 4IRIA 3LA2A 2XKPA 4L18B 3H92A 3HSEA 4AWXB 3E5XA 4HF0A 1IN6A 2V6CA 1JXSA 3ZMSA 5BPIA 3ZMUA 4ETSA 3E5UA 1IN8A 4ZYGA 1HSTA 2RN7A 2CWEA 3WE2A 4P9FA 3F8MA 3KP3A 3GFIA 2W25A 2OAZA 2M1BA 4WWCA 4Q47A 1REPC 3MCZA 1MGTA 4U7DA 1B1BA 2BV6A 3HRSA 2WTEA 1J75A 1OPCA 1R5GA 1UCRA 5E1WA 1B59A 2C6YA 1K79A 3ZPLA 1FSHA 1ZRFA 3V7CA 1LB2A 3L2CA 3MEXA 1E2XA 1J2XA 3LA3A 3MWMA 4KIBA 3J81K 4LB6B 4BH9A 2ZO4A 1XSXA 2M30A 3QRFF 3RIRA 3VODA 1D8KA 3R60A 3KCCA 4UVBA 1BI3A 3MAJA 3COAC 1L3LA 1EV7A 3DV8A 1QBJA 4Y13A 2O61A 5E18F 1O3RA 2QLZA 1IXSB 1UHWA 1RUNA 1WSUA 4P9UA 2FU4A 2IA2A 2PN6A 3DP7A 3EYIA 3V8LA 4ZYEA 1SD6A 2IRFG 3HYIA 2H6BA 1XD7A 1G3YA 2EFNA 5L3CA 2F5DA 4RB3C 4Z2YA 2K27A 1HKSA 5BS6A 4E70A 5K5QA 2ZJ2A 2RNJA 4EM1A 5A2QZ 3QP5A 3J81Z 3RPQA 3JTGA 2EA4A 5D5XB 2DK8A 2VBZA 3TO7A 3I0TA 2FA5A 3SHFA 1TBXA 3TGNA
chains in the Genus database with same CATH superfamily
1HLVA 4B4CA 3WTYC 2EA2A 4IOAF 1UJ8A 1BI2A 1GUUA 2V9VA 3RKQA 2ETHA 2CGPA 4UV8A 3F23A 1PUFA 4XNFA 2VONA 3GMEA 3MFKA 2LBFB 5LHHA 2LK2A 4N9HA 4CA0A 1Z77A 1MH4A 4XRSA 2P81A 2Y0SA 3TMOA 4AYBN 5D4RA 3BOQA 2L4AA 1KU9A 1MNMC 5IP6A 4HYEA 1N25A 3I54A 4HSTA 4ENJA 3FHNA 5L3DA 3I58A 2DTZA 3DEUA 2EBIA 1LVAA 4L9JA 4ZYHA 1ERDA 1IC8A 4M3DA 2HR3A 2XVCA 4R8HA 3BZ6A 3E6DA 3HOSA 3OR1C 2ZSIB 1JJ8C 4Y17A 3F8NA 1OCTC 2WWYA 2RDPA 2XUBA 4NB5A 3KZZA 3MKLA 5HDKA 1MD0A 3JRHA 1E3HA 3S1MJ 1ON1A 3Q0WA 1HXDA 1W7PA 2DA4A 3S2DJ 2HS5A 2MYSA 1A36A 4DBRA 3BR0A 2LSOA 3HM5A 1WHUA 1R22A 4DOZA 2O8KA 5F64A 2XSJC 3FM5A 3I59B 5DM6F 4F3QA 3OYKA 3G71I 2VLAA 5FLXK 5HS9A 5JFRA 3O6BB 4C3HJ 2NVUB 2ZFWA 1OISA 3K1MA 3I9V2 3LFUA 5EYRA 3WU0A 3LL7A 2KLOA 1H88C 2VOOA 2JRTA 3WTWC 1T98A 2Z9OA 1BR1A 4MTDA 4U88A 4WK8F 1WKMA 1ORKA 3FK7A 3HOXJ 4AM3A 1YS7A 4CDGA 5GADJ 2HEOA 4Y52J 1MIJA 3SYTA 3I4PA 2OUMA 4JK1X 3JREA 1X1BA 2A6EF 3I71A 4JOMA 1CGPA 4KJZA 4OAYA 3BR6A 3DCFA 4CCOA 4LMYA 3OY9A 2TRTA 4IJAA 1AOYA 1W7PB 3CZ6A 3F8BA 4RGSA 4OU0A 5CVRA 4MIMA 5K7HA 1U2WA 2O0YA 1T8IA 2BYVE 4M6XA 2X1CA 1NHAA 1MSEC 2NS8A 1Z67A 3FXRA 3EUKL 3ESWB 3H5RA 2CH0A 4XBFA 2HZDA 4LJZF 2Z33A 3N05A 1T33A 2MA3A 2M0MA 4IVNA 5FRMA 4AIHA 2QUFA 2VODA 3QODA 4AIDA 3HKZA 4ZH4F 4ZTJA 3FKIJ 1MJAA 2A6HF 5F1JA 4IKFA 3M9AA 2DMTA 3AFHA 1WI3A 2XIGA 5JLWA 5EEGA 3H3UA 2RKHA 3K4JA 3HPHA 3RDIA 1EKEA 1VQ7I 3V7RA 3CCVI 2R7SA 1YQAA 2LTPA 3KP5A 3HOZJ 5JR3A 1RR7A 2VQCA 2E2HJ 4FQGA 5LRSA 4J00A 3ABMH 2UXNA 2VUMJ 5CPRB 4C2UA 2ECCA 3A0HC 4CCKA 4M3FA 2COMA 3RKWA 2V1UA 2XAJA 1SANA 4IPAA 3BG9A 4JX6A 2ZCWA 2CUEA 3TL4X 1ZREA 2R7TA 1Z6TA 3S1QJ 3K70D 1ETVA 3DPTA 3FKJA 3H0GJ 2HOEA 2GBYA 3VYTB 5K1YA 2H1LA 1DP7P 2FSWA 2LP0A 5KVRA 1FBSA 5DUIA 2HKXA 4ESBA 1STZA 4WF2A 1QZZA 3H5NA 1LQ1A 3HRMA 3HUGA 2Y75A 2HOSA 2DFHA 2MGQA 1W36C 4AVZA 2VJ4A 2D5VA 3DFGA 3PNYA 2F4OB 3CCMI 1FOXA 3BR5A 4G94A 3BJ6A 2MSYA 2IW5A 3S1RJ 4PJMA 1FT9A 5DV5A 2K02A 2KRCA 2VQGA 1JHHA 2OTLI 4P5OA 4D9JA 2IPQX 2L3DA 2F4MB 4CXFA 1F4KA 3OOUA 4UHTA 2HYFA 2JSCA 2HDDA 3GZ5A 2BW3B 3QWLA 3CJQB 3FX3A 2XGDA 3TDUC 3IV5A 1DQUA 1TC3C 2B9SA 1T56A 1RKWA 3C2HA 4D7NA 3F3XA 4KUMA 2NVTJ 2H09A 1X4OA 2I8DA 4KT5C 2HU9A 4M72A 1JJ6C 2O6GE 1BC8C 1PVEA 2F2EA 3IAS2 2L02A 3HUGB 4G12A 4C3JJ 2Y9ZA 1R00A 5D4SA 4PFOA 2ACJA 4ABZA 2DA7A 2X4HA 1EA3A 3IH3A 1KQ9A 3IC7A 5F27A 1FOYA 1SFEA 2P7VB 4OIPF 2DQLA 1ZRDA 1SAXA 4IX7A 3TP3A 4IOCF 2CQQA 2TDXA 2O7OA 2L5QA 3VYSB 2DT6A 3RTRA 5EEAA 5KCMA 5F04A 3CCQI 2BY1A 3S15J 1YITI 1XSVA 3ISPA 3OV8A 2Y30A 3GTQJ 1XDSA 4BY7J 1D8JA 4NDLA 3EYYA 3C7JA 2ZB9A 2WV0A 3OSFA 1USTA 2E34A 2NRAC 2RREA 5FLMJ 2KJCA 4E7JA 4I6ZA 4XLEA 5LEJA 3HHGA 4Y4RA 1ZRCA 1FOKA 1V55H 3MD2A 1YE9A 2BXZA 3NAUA 2EFQA 4YRVA 3I55I 1RKTA 4EJUA 4BY1J 1NK3P 4LIVA 5J8FA 3RJPA 1T6SA 3CTAA 1FP1D 2H8WA 4XLCA 2R7UA 2L7MP 3SQNA 4P1WA 2WY7Q 3BDDA 1PP7U 2CYYA 3NQOA 4OOIA 4CSWA 1FX7A 1RETA 1FTZA 2V6EA 4A5NA 2GWRA 2K9SA 1XTAA 2F48A 4MEYF 2K9NA 2DJNA 1AA7A 3ZN1A 2VPLA 3TBIA 1O4XA 3GYHX 2O8XA 2CQNA 1X19A 3FXMA 4XLPF 3A2KA 4PCQA 4CCMA 4E7IA 3IAM2 1K4SA 1FEXA 2Z3YA 4Y3OA 4A3JJ 5KAFC 5F0HA 1V5EA 2VT3A 2AO9A 1O7LA 2GOMA 2RAEA 2IGOA 4EGYA 1HDDC 2WAFA 1HQCA 3KEOA 3DF8A 3I64A 4EGZA 3H9GA 2VOPA 2BXYA 1E3OC 2W4SA 4PJNA 5EG0B 4G7HF 2EFWA 3T0YA 1WJDA 1OCZH 2CMPA 4CYCA 3CUQA 3E0JB 3QPTA 4IZZA 3GTKJ 2V7FA 5HODA 3RQIA 3F6VA 4UXNA 2ISYA 3WTTC 5LD2C 2V4JC 3CO7C 4HDVA 4HX4A 3GFLA 1U78A 2Z99A 5LHIA 2HQRA 3HJEA 1AWCA 5CVIA 4HBLA 3OYAA 2E2IJ 2JA6J 2DI3A 1ACIA 2QKLB 2HDWA 3LSIA 2ADUA 1Z21A 1VNDA 3AAFA 3DKXA 3BG7A 2EZKA 1S8NA 3LMMA 3KIOA 3HGYA 1ETYA 1YW7A 2B63J 1BOBA 4HW0A 4MEXF 2XRLA 2F5VA 2RGVA 5H20A 1O3TA 5L3EA 2ISZA 1ZYRF 2LNBA 1J7KA 3ERED 3DWLE 3R0AA 4H0EA 2K4BA 3FXOA 1QPIA 3ZMVA 2EZHA 2MLGA 3GVAA 4NC8A 1LEAA 2E36A 4GYGA 4CYCB 2X6XA 2EK5A 2O3FA 2CSOA 2ZMEA 2HQ5A 4IQJA 2BHZA 3GX4X 1Z7LA 2DU9A 2QEXI 2LVSA 2EB7A 1BOAA 3K4KA 1R1UA 2RC4A 2A5YB 2PMZA 5FRNA 2GA2A 4GRIA 3BT9A 3RZOJ 2BVLA 4RAYA 5JLXA 2KIFA 3TEDA 3ZQHA 1VQMI 4KNYA 2IS2A 3K0LA 4WXDA 1LNWA 4CCJA 4RB0A 2FBHA 2Y48A 3FBNB 2EIMH 3OS2A 2ZNYA 1A6IA 3QPHA 4JX4A 2M0CA 2LC2A 5JVGF 3MMYB 3RKXA 3SDBA 2CG4A 2EINH 3E5QA 1HSJA 1S5LC 3HZJA 3WTVC 3F9KA 4DGWB 1ZARA 3AG2H 3HIFA 3PFIA 4CCNA 4B43A 3IKTA 3J80Z 1NG7A 3KEQA 3JRDA 3OMYA 3C18A 3ZCOA 5E3LA 4C30A 2LG4A 2Y0SN 1X3WB 3HRUA 2MD0A 1SFUA 4RS8A 5EF6A 2KL4A 1Y8QB 3BZCA 3DKWA 2LY1A 1P7JA 5B5EC 1TWFJ 3FM3A 4PFPA 2KRFA 5KAIC 1JUPA 1D0YA 1VQOI 1KYWA 1S72I 4OIOF 4DIQA 2E1MB 4LLNA 3ML6A 1OCOH 1TNSA 4HX7A 4WCGA 1I6HJ 2DMPA 2A6TA 5GAGJ 4PUSA 2ME6A 4I01A 2VQLA 5LBQA 4TV7A 1BJAA 1FJLA 1MBFA 1B72A 4HF1A 1BIAA 4L0ZB 2H94A 3S1NJ 4W1UA 4UVAA 3GF2A 2YUSA 1GT0C 3S93A 2KIMA 1W5CC 4M9SA 2X1DA 1E17A 3S32A 3ECOA 3JRAA 3GWZA 1HCRA 2VBWA 1WJ5A 3L7WA 4RGUA 2CFXA 2HYJA 4WXCA 1SD4A 5HDGA 2X6WA 1R4MB 1VFCA 1P9QC 4RGXA 3ABLH 3L2WA 3A1YA 2W84A 2P5KA 2K4JA 2WC2A 3UR3C 3HGGA 3QAHA 4DW6A 2XB0X 2M3AA 1SVMA 3TP0A 5DUKA 5M5WJ 3BPVA 3FWEA 1YX5A 2IAIA 3QOPA 4R1HA 2HKOA 4DQ2A 1XGSA 1ETQA 4X0GA 1EF4A 3E3VA 4RM2A 1SC7A 2R7XA 5F6FA 3L2QA 2X6YA 2MABA 2ELKA 1OFCX 4RM3A 2VE9A 1TT5B 3QOEA 2PI0A 1FMWA 1ITYA 3EUAA 4GDFA 3F22A 4EJOA 2JUCA 2H1KA 1XCVA 4S04A 1X4PA 4MO7A 1BL0A 1SMTA 1WJCA 3LSGA 1SEUA 3OYFA 2FEZA 2YSRA 2VJJA 1R71A 3HC7A 3WE3A 5GPAA 1KU3A 3C2GA 2DDBA 2CV0A 5KK1A 3BTLA 4Q4ZF 4M73A 3CUOA 3JSPA 4I7HA 1YJWI 5CKTA 2E7XA 3HOYJ 1JKRC 3I3LA 4XKBA 4XL9A 3HKZN 2VT2A 2GXBA 5A2QK 4UUSA 2V9KA 5H6QA 4FE7A 4II2A 3SZGA 1QRYA 4IHTA 3CUQC 4L9NA 2HTJA 2IT0A 2DYSH 2DQRA 3LNQA 3HB9A 1OLTA 5LRRA 4JQFA 4LGWA 3HOTA 3KZIC 1KU7A 1JGGA 3F8CA 4ASNA 2X9DA 5D5UB 3F0CA 3ZR8X 4KN4X 4BEHA 5HVQC 3IWZA 5FFXA 2L4MA 4I0BA 5GAHJ 1TP4A 1IGNA 1YYVA 4PJJA 4N4NB 2XF6A 1F5TA 2P6SA 5J6XA 1MBEA 1XMAA 2FOWA 3OYHA 4A3CJ 4UUTA 5C4XJ 2FMLA 2XAGA 2KQRA 4RAGA 4XLFA 3V4GA 5D8KB 1VQ4I 4OAZA 3IH2A 1R58A 3OIPA 3LSPA 2IS4A 2AS5F 3FIWA 2LD5A 4U87A 2VI6A 3G3ZA 2WA0A 2LF7A 3E6CC 3H5AA 4UUSB 1IDZA 1P6RA 5E3NA 1P4AA 2E2JJ 4B3XA 2VBYA 1IO2A 3L9FA 4IXAA 4MHGA 1S3JA 3KZYA 2MC4A 3S3NA 5TJJA 2F5EA 2OD5A 4YIIA 3AG4H 3PM1A 4HEA2 2ZMEC 4A93J 1WJFA 3U2RA 1Q1VA 2PMUA 4BEHB 3ZQGA 1RRJA 2ZJPF 5FKNA 1QA6A 3CC7I 1VQPI 3WG7H 1I1GA 5EGOB 4AU7A 2E1MC 2KZGA 2JZYA 3ONQA 3PUBA 5CVJA 4F52A 1EH6A 1GXQA 2QZ8A 3L00A 1SFXA 2EILH 1TLHB 2FJ1A 1T0FA 3A01A 1U5TA 1MMDA 3OS0A 1EH8A 4RBOA 1DDNA 2R92J 2R7FA 3B73A 3U1KA 4LFUA 2MW8A 1R49A 4CO8A 4FE4A 4M3EA 1WVRA 4ZZLA 1DPRA 3H9JA 2KISA 1B6AA 3EUHC 2DDAA 2EIJH 3CDIA 4MQ9F 2HDCA 4I98B 4KMFA 1S29A 2CQXA 3HSRA 5K5RA 5LGTA 4XN3A 4XONA 4KYWA 2JA7J 2Y31A 4MQVA 3VPRA 2YPRA 2L01A 1ON2A 1YIJI 5E20A 1YFHA 1KQ0A 1MMNA 1XG1A 4EJTA 3F21A 3IH4A 1VI0A 2FQ4A 4FISA 4KITB 2E5NA 2IGNA 3I4NJ 3CLOA 3ZQIA 4PSWA 1TNTA 1UB9A 1YG2A 1U8RA 2GA1A 1MBJA 3ZGKA 4KMUX 5F1RA 2LDUA 3FHZA 1UAAA 3GBGA 1YHQI 4EMSA 2MD5A 2A68F 1YS6A 1OYWA 4A6DA 4NUBA 1U5TB 3OL4A 1MJBA 1OJLA 5LFAA 4BKXA 3G1OA 3E7LA 1KA8A 1IV8A 4G6DA 1CF7A 5E8IA 2XDVA 2K85A 1YTYA 2XAQA 4XICA 2JT1A 2WAEA 3EETA 1R7JA 3TOBA 1ZG1A 3GLLA 4GO1A 1FBUA 2H6CA 2LREA 2O03A 3PQJA 2XROA 3S14J 4HLXA 1ZGWA 2Y0MA 4U7BA 3CESA 3DEWA 2OZUA 3DXJF 3BR1A 3QYBA 5FROA 4GYIA 3G4SI 4LLGF 1I6XA 3E1SA 4RA2A 1K78A 1I1SA 2IBDA 4DZPA 1HOMA 4I2OA 4CZCA 5D6FA 2HXIA 3S16J 1IDYA 1PUFB 3S8PA 1D5VA 1D0ZA 1JI8A 5DCFA 3QPSA 2COBA 2ZXWH 1G4DA 2K86A 4DYQA 4HDUA 3SZTA 1T38A 3A03A 1RZ4A 2DMQA 1FZPB 3ULQB 3K69A 1N75A 2WY8Q 3CMMA 2STWA 3VWBA 3AG3H 3P7NA 1CF7B 3S2HJ 1FYMA 1Z7UA 5DEQA 3ZQ7A 1ZAOA 3IHUA 2GZWA 2XB5A 5BMZA 1BN5A 3GEZA 3CC4I 4A2UA 2NVQJ 2R7DA 3MVPA 4PJLA 5M5YJ 4RB1A 5ILVA 4AUXA 2DLLA 3M4OJ 3WU1B 1YX3A 4BNCA 3UNGC 3BTCA 3U9GA 4KT6A 1K78B 1LFUP 3BWGA 3U21A 5LHGA 4CGZA 4QIWN 3FXQA 2QM3A 5IT3A 1QU3A 3ZQCA 2PMHA 4BHPA 1XGOA 4IRHA 3OYNA 3CMAI 1W7PD 2GXAA 4BJ6C 2VJ5A 1K4TA 1WH7A 2QYOA 4UUVA 4ON0A 4OWRB 1O3QA 3FMSA 4ITVA 5DD8A 1O3SA 3O8GA 1FYKA 2XAHA 2NYXA 1GVJA 1WJBA 1X1DA 1Y1VJ 2QSFX 3LSTA 4L5JA 3WTSC 3HRTA 5FKLA 3W2WA 2DJIA 4MLOA 4E7KA 4GXOA 3K4MA 3R61A 2CO5A 1V5FA 5ICGA 1TQIA 3M8EA 2A5WA 2RQPA 4Y15A 2F5FA 5HS7A 3L2RA 1LDJA 4GCVA 5ERIA 2XAUA 2QCOA 2DFEA 3PL8A 3CD6I 1QHHD 4G7ZF 3QU3A 3DLAA 1JTXA 2VPRA 3GO5A 4LB5A 2Q8KA 1MH3A 1OR7A 3S3MA 4M9ZA 1E3PA 1IRXA 1RNLA 1QQIA 4AIKA 2IA1A 2XRNA 5LGNA 3OYBA 2CU7A 4ZJZA 1D5YA 1KYZA 2PMZN 5CVUA 1LKXA 1WGXA 2OA4A 1VF9A 3CDHA 4XR6A 4IL6C 3FXKA 1MZBA 2P5VA 4KA4A 5IP7J 2EFPA 3J7AY 2WB1A 4PSXA 4A3IJ 1R5HA 3LSMA 3NARA 3WTUC 4HV6A 1BJZA 5J1RA 1YW8A 1OYIA 2Q1ZB 2DT5A 1JTYA 2VXDA 1OYYA 3P9IA 1Y0UA 3K4LA 4DYRA 1K61A 4EJVA 2BZTA 3CQZJ 1T0FC 1SAUA 1U5TC 2KHMA 2ESHA 2DOAA 3G1MA 4G6TB 3AKZA 1Y39A 5IT9Z 4BUPA 3RKYA 1LUJB 3LSHA 2ECBA 1T2KA 1D1BA 2E60A 3D5SC 1LFBA 3D1NI 1MMSA 2K40A 1IRFA 2KIUA 4E7LA 4A12A 5J1YA 1V54H 4HQMA 3ROUA 1SFOJ 2DA5A 3RZDJ 3VYRB 4QSHA 5E3OA 2DPUA 5ED4A 1Q1HA 2Y69H 3D0SA 4F55A 2YX4A 4V2GA 5HLHA 1POGA 5CQEA 1FTTA 1R9TJ 5ICEA 3CCEI 5JHUA 2DAOA 4DNCA 3DBLB 1O57A 1TWCJ 1OCPA 2J5OA 1IXRC 1XGMA 2QVOA 5DDGA 1WWXA 3W6KB 1KQ8A 1TWAJ 1QGPA 2X1EA 3PQKA 1U0JA 3U1DA 2X51A 3HEFA 3VDXA 2LYCA 2L9SA 3FZVA 2P7CB 1DPUA 3K1PA 4XLHA 2DOFA 4JBAA 2ZC2A 2M4KA 1ZHFA 2ZBKA 1U9NA 3KLOA 3LWFA 2IJLA 5BOXA 1B8IA 2QKMB 1HW5A 2W82A 3L09A 2MC3A 4O5VA 4DYCA 2MBFA 2L0KA 3VEPA 1Z6RA 1N77A 3LAJA 4A0YA 2ZXIA 2JA8J 2LKSA 5HOOA 2BBYA 4KISA 2BY3A 4BBRJ 1YIOA 5K7FA 3CO6C 4AYBA 1R5ID 3CP8A 4L0YB 1F9NA 4BXUA 1TQPA 2ELHA 5JI6A 2ESNA 2BEOA 1V4RA 3BG5A 1HDPA 3H35A 3OOPA 4IO9F 3WTZA 1IRZA 3OYMA 3H9QA 4G6QA 4RDUA 2AHQA 3CCJI 3WHCA 3VFZA 2ZJQF 2J5PA 1Y56A 3ZMZA 3BG6A 1PYVA 3TW7A 1RESA 1BR4A 2JTVA 4EEFG 4KICA 1E0EA 1CQTA 3F8FA 3H3ZA 1VQLI 1ETKA 2JUGA 1LEBA 2V79A 3DU5A 4A0XA 1EJ9A 2LY2A 5F0CA 2JA5J 1FIPA 1KU2A 2A3SA 5IPAA 3NWSA 1SD5A 2KP6A 2QQAA 2KPMA 5FJ8J 4A3BJ 4KN7X 3N97A 5IYDJ 5EZGA 3LQRA 3GZNB 5DYMA 4A3EJ 3OIQA 1LFPA 4CUGA 2E1CA 1ZLJA 3G1LA 4HX8A 4XRSG 1J0RA 4RLQA 1DUXC 3K4NA 4CYDA 2HNHA 3CMYA 2CW7A 3RPUD 2EWNA 1W0UA 5IP9J 4DZJA 1JKQC 2HWVA 5CLSA 2YU9J 1LPQA 2DA1A 2FNAA 4BE0A 4EM0B 1W4MA 3PNTA 1FC3A 2LMDA 4XQFA 4IHSA 2D2WA 2FUG2 1JUMA 5CYVA 5D8LB 2IVMA 3FMQA 3J80K 3PSFA 4M74A 3K70C 1OMIA 3M1CA 1A31A 3BY6A 3O8HA 2V1XA 1VTNC 2EH3A 1A35A 1IAWA 4BXFA 3C2BA 2M8EA 2KFDA 3FDYA 1A04A 3DBHB 3KFWX 1B4AA 3K2ZA 1DP3A 2IGKA 2M5WA 2YU3A 4A0ZA 1OR7C 3MZYA 3I53A 2IEKA 4IRGA 2DCEA 3HBLA 3KP6A 4HLYA 1Y8RB 2DMNA 5ICCA 4ZDOA 3B6CA 2P8TA 3IWFA 1MW7A 3CUQB 4N0BA 2XSDC 4F91B 2AQFA 2LFBA 4XRFA 4NC6A 2ELJA 4YEJA 1IW7F 3JRGA 1VQ8I 2XGEA 1IUYA 1NG6A 5D5VB 3BP8A 4CHUA 2KDOA 4GGGA 4BHCA 2VN2A 3FXUA 1XGNA 4XORA 2QQBA 5B66C 1IG7A 5HS8A 3MKZA 1NH3A 4WX9A 1I3AA 3DPLC 4NQWA 3K4BA 4CZZA 3HHHA 4K2EA 1WPKA 3K1NA 2OPTA 3JTHA 4MTEA 2GQQA 2R7WA 2R93J 2ZFUA 4Q48A 3SJMA 2JPCA 4UY8I 4L9TA 3NRVA 2M9HA 3RYRA 2IA0A 2AXLA 4BGDA 3HTUA 5EJCA 1MDMA 2FQ3A 1X3ZB 2K7LA 4RLFA 1C0WA 2ID3A 2QBYA 2L9VA 5J1UA 2IP2A 1BIBA 2W57A 1XX5A 5KNLA 2W1OA 1LE8A 3EUHA 4RAFA 4OIRF 1S7OA 2NS7A 4OIQF 4QPQA 2OV7A 1MBGA 1QO0D 2G7UA 3Q3SA 3SDGA 3DTIA 5HNHA 2ZMEB 4BQNA 3S2WA 4CH7A 1JGSA 1VQNI 4IHYA 2EZLA 4RB2C 3V42A 5L3BA 3V7SA 1LJ9A 2VKHA 2NNYA 1MBHA 2PBIA 3ECHA 1FMVA 1FY7A 4NQWB 4YFKF 2XPVA 1IRGA 1EH7A 5IYBJ 4M6YA 1HKTA 1XCBA 2XV4S 5E1XA 1PUEE 4F7ZA 3CC2I 5ICFA 3RYPA 3W6JB 2EFOA 3R0JA 4BDZA 2QWWA 2BVMA 2PX9A 2BOLA 2K9MA 1R36A 1U8BA 1HKQA 4ESJA 4A3MJ 1X1CA 1SVLA 3ABUA 3HXLA 1RPWA 1R1TA 2QBYB 2ZXJA 1P2FA 1HW1A 3UKGA 3OYDA 1ZH5A 3PFYA 1LE8B 2P0WA 1ZGJA 2L9RA 2VQHA 4C2TA 4XLAA 2CW0F 3GTLJ 1W5TA 2VC1A 1TW3A 1JUSA 1FNNA 3KP7A 3QP6A 2M2EA 3NWTA 5GP9A 3KP2A 2WAQA 4B48A 1TTYA 4GFBA 2WADA 3S17J 3MQ0A 3K6GA 3ZQFA 4U0WA 1ODDA 3W2AA 1OQYA 1D1AA 1XS9A 3W6VA 3VSKA 3PUFA 2HOAA 5LLQA 1JKOC 3Q9VA 2XHKA 3M7GA 1ETWA 4KDPA 1J09A 5H6RA 4KFCA 2KRHA 2CQ7A 3BTJA 3B6AA 2M34A 1W5SA 4LD5A 1X2NA 2P4WA 3CDLA 1VZ0A 3M3YJ 2HYGD 5FD5A 1B72B 3QYEA 2F4IA 3LSRA 1W0TA 2CFOA 3QYFA 5J47A 5FKMA 3OWTA 2P5LC 4N4OB 1DU0A 2L54A 3AL0B 3TO6A 1TWGJ 1WH5A 3BCAA 1VQ6I 2Y2ZA 1K7AA 1ZGAA 2NAZA 2HTSA 3GFJA 3PNVA 5C44J 3N4MA 2DA2A 4M71A 4NHJA 3DBRB 3HOWJ 2KJBA 3RSNA 1Z91A 3ZXSA 5IY5H 1Y1WJ 3S3OA 2UUZA 2LOOA 4LITA 2R5ZA 1YJNI 3GUDA 2IS6A 2L7KA 2BHYA 3P9CA 1TW2A 2L7ZA 4C2MJ 3BPXA 1ZK8A 2GIVA 1R23A 3T8TA 1Z3YA 2Z1DA 2EPFA 5B1BH 3BJOA 1MBKA 4BJ5C 2OJED 1HC8A 3GLXA 1WCMJ 1A5JA 4DJAA 3GW2A 1ZR2A 1IN7A 1IXCA 3Q0VA 2RVCA 2EV6A 4HAMA 2A69F 1FWZA 5M3FJ 3HDDA 1XSDA 1I50J 2DOEA 4QTRA 2HPMA 2LY9A 3BZKA 3F72A 4QPOA 2NNNA 2F6CA 4YELA 1ZR4A 4A3DJ 2FRHA 2DT7B 3P5JA 3BCBA 4Z6YA 3CJNA 2E71A 1T08B 2DYRH 1YW9A 4FX4A 1ULYA 2CV1A 1D3YA 3SEZA 3OYEA 3HPGA 1GHCA 4O6JA 4IHWA 3C3WA 5GTHC 2VL8A 3J7YJ 1QHGA 2GAUA 2YR2A 3BTIA 1S7AA 2WB1N 2A05A 1LDKB 2BE5F 5TGTA 3PIPF 1V3FA 1FBQA 1Z05A 2UV1A 3KPHA 2LR8A 1WFXA 5IOYA 3T8RA 3FMRA 2VXZA 3GTPJ 2HGCA 3F6OA 4XLNF 3B02A 5ILSA 4S05A 4UV9A 4HA8A 2QGUA 2XC7A 3BR2A 4A6EA 4BS9A 1BW5A 1KZHA 2L2OA 5FB2A 2VC0A 2HQNA 4M6VA 2P6TA 3OR2C 3DU6A 3QPLA 4BQOA 3KEYA 1FIAA 2JA2A 4L5IA 1ZG3A 4PK4A 4XKVA 1J5YA 5AIQA 3SZPA 4PZJA 4FETA 1APLC 2F5CA 1RR8C 1N78A 3KE2A 3E97A 2WV1A 1AHDP 3LFKA 2FNPA 1BW6A 2DBBA 3LOCA 2EV5A 4MGRA 5FGMA 1H9TA 1A6QA 2G7HA 1DU6A 2R0QC 4ZYAA 1QVTA 1WJAA 4I02A 1X2MA 4ENNA 1M1EB 1J9IA 3REOA 4BQQA 2OZ6A 3R6SA 2O9LA 3BROA 3DTEA 4ESFA 4FTHA 1BI1A 3HTSB 3HOVJ 1F36A 2PLYA 3ZN0A 4EQQA 3WGGA 2BY0A 1W36D 4V19K 1PJRA 3O2PE 3ZMTA 1F1ZA 2CUZA 4N9IA 4I99C 1U6GA 5FD6A 1FYLA 1Y0NA 2MH2A 3ABTA 4NBQA 2YX7A 1IZ1A 3RCOA 3OYIA 4B44A 2HZTA 2JJ7A 2V1NA 5EEHA 5J4YA 4AIJA 3W2VA 4BHBA 2FXAA 3A01B 1FOWA 1YO5C 4PGGA 4LOCA 2V1DA 1I3QJ 1SFKA 1JHFA 4M3BA 1S6LA 4UB6C 1XB4A 3DTKA 1P4WA 3ZOBA 4UVCA 1BR2A 2D1HA 3AL0C 3CCYA 3LSJA 2JN6A 3G73A 3GFMA 4XN0A 3ASOH 4YFXF 4UNOA 2PJPA 1G3WA 4XOPA 3I59A 4P55A 3IKVA 4YG2F 3KX2A 4ENMA 3V8KA 2I5UA 4U0VA 1TZLA 2UXXA 1G6NA 2AXTC 2CQKA 1FLIA 2EJRA 2K9LA 3M8FA 3OYJA 5GTIC 2PG4A 2XGXA 1SMYF 1YJ9I 1XMKA 3DKYA 2G9WA 3PO2J 2X48A 1ZKGA 3LA7A 3O3KA 1Z3XA 4I09A 4EATA 2OBPA 4BYYA 3JAMK 1XC5A 2R7QA 1J59A 4JP0A 2DN0A 3SXYA 3VB2A 5ILUA 1AKHA 1Z9CA 1KGSA 2JPBA 3TOAA 3EQLF 5HLIA 5B3SH 9ANTA 2EIKH 1MMGA 4XSZF 4EJWA 3KYCB 4HSRA 2R5YA 4ZTFA 3IUOA 5HLTA 2PJRA 3C1DA 4AVPA 1XMXA 3V8JA 1QNTA 1YLFA 2ICWG 1UHMA 1XN7A 4ZDLA 4BE2A 1H9GA 2E1OA 2LKPA 4LG0A 2EZIA 2NS0A 2XGCA 1FP2A 4MFDA 5FO5A 3MZ8A 5BNGA 5GAEJ 3L2VA 4E6KG 5L3GA 2A61A 2R4GA 2W85A 2E5ZA 3TDZC 1USSA 4PGHA 4BXXJ 3E6BA 4ZC3A 1K6OA 2TCTA 5DCMA 4HF2A 2DA6A 5TISC 1U9OA 2DO7A 1ZN2A 5JHFA 2DPDA 1ETOA 4D5CA 5IT9K 2HFHA 4H4KC 1AKHB 4D7MA 2V9PA 2QQ8A 2MH9A 5F0FA 1WI9A 3K2AA 4E7HA 2BGCA 3I5UA 3R4KA 2OCEA 4OINF 3K9TA 2MG4A 3SEQA 4M9XA 5LGUA 2R5YB 2PJRB 2CS3A 3GTGJ 3KETA 1B9MA 3G6EI 4QWQA 1MJ9A 2GXGA 2OQRA 4IHVA 2FX0A 2A07F 3WG9A 4JX5A 2ID6A 1QZEA 3VYUB 3CF5F 3JAMZ 2DK5A 2VKVA 4LG0B 1P7IA 1ENHA 3TO9A 2LH9A 2QA4I 2DTRA 5M5XJ 2QSHX 2PEXA 2K3FA 3H36A 1HW2A 3OL3A 2MLKA 1G3TA 4I0AA 5DCMB 1BBYA 1I5ZA 5AONA 3KP4A 2I10A 1VQ5I 4HV5A 1S9HA 3PSIA 4BAYA 3JCUC 2XASA 5FKKA 2PQ8A 2DXIA 2OTJI 1RC9A 5FLXZ 2BW3A 2X0LA 2M7BA 2KZVA 2NVYJ 2M7AA 3BQYA 3Q0UA 1FPQA 1QZYA 2Y9YA 4HRIA 3K4CA 4AD9A 1VQKI 1I27A 3FF5A 4XOTA 4Q5SF 2XPWA 2GIZA 2W00A 4HQEA 2YS9A 5E8GA 3Q9SA 4E7SA 5GPCA 3K7AJ 1YOVB 4IQ4A 2LKXA 5H2FC 4ZZDA 5K5OA 1WJEA 1PDNC 3QU6A 2K9QA 2KDZA 2VKDA 2RQQA 2STTA 3CP2A 2E7WA 4LLLA 3L2UA 4HG2A 1IF1A 4EV0A 3DPUA 3AG1H 2FF4A 3DQVC 1V5GA 1R1VA 3HOUJ 5E17F 3SFIA 1NK2P 1GV2A 2NOJB 5L3FA 2QSGX 2LF8A 3ZP5A 4AC0A 4O3MA 4A3FJ 1RI7A 2Z5UA 3CMEI 3P9KA 4RGRA 1JE8A 3BLYA 1BC7C 4G8XA 1XPXA 2VJIA 4RMNA 1LDDA 1H0MA 5K7ZA 1NTCA 2N8GA 5TRDA 4IF4A 1JT0A 1X1PA 2JRMA 2WAQN 2ZNZA 3T5XA 3DEEA 4YIFA 2MFZA 1Z1DA 4Y33A 2XAFA 3ABKH 2FOKA 5JVTA 4XMYA 1UHSA 2Z2SB 3ASNH 2E1NA 4EM2A 4B09A 4JYKA 2QENA 1FSEA 3KYDB 2DW4A 5FFZA 4R79A 3DLLF 3X2QH 4G9YA 1IUFA 4V2FA 1K83J 5D6EA 2QQ9A 4A3KJ 1IN4A 5J3LA 2VBXA 1ZQ3P 2DA3A 2O5RA 2E19A 1QPMA 3OIOA 5J40A 2DODA 1RUOA 5M3MJ 4LK1F 2AQEA 2WBMA 2HVQA 1TWHJ 1YRNA 5AIPA 4YFNF 5J8CA 3IL2A 2VE8A 4ANJA 1RIOH 3GTOJ 3WHBA 4FCYA 3KLNA 3IP4B 1MMAA 3RPUA 5EG0A 1S7EA 4L9VA 3NEUA 1UFMA 3TKYA 2FBKA 3ZMDA 1B8IB 4LK0F 4IHXA 4Y7NJ 3TQNA 3M1EA 1XDUA 1HBXG 2JVHA 5HNFA 4U0YA 2W48A 3WGHA 5BPDA 1GDTA 1P92A 3OYCA 2FE3A 2CRGA 3M8JA 2NVXJ 1BI0A 1F43A 3WU2C 4YIRX 1UG2A 3GZ6A 1I39A 4F92B 4B47A 4C3IJ 2IGMA 5B1AH 5EDNA 4BQAA 4ZDPA 2VKEA 1MSFC 1MKMA 3OYGA 3BJAA 3ELKA 4FX0A 4CICA 1YRNB 1LVKA 2JMWA 3OYLA 2H27A 2CV2A 1JT6A 1D0XA 1JKPC 3SFZA 3WGIA 4B1RA 4OMZA 1VQ9I 2HOTA 4BU2A 4NC7A 4EVIA 1GXPA 3JRIA 4II3A 2JVGA 2VB6A 4XSXF 1H8AC 2CUFA 2PFBA 4A5MA 1WRJA 4D1QA 1DGRM 3CLQA 3Q5FA 3RI4A 2FMYA 2W24A 2HQAA 1L0OC 2JK3A 3MZHA 3BR3A 2M87A 2D45A 1O7FA 2JSPA 4FT8A 1TQMA 3FXJA 5HLGA 2W7NA 2OC6A 3GTJJ 3LAPA 2XKOA 2R7RA 3E6MA 4ZYDA 3H1CA 5D5WB 2R3SA 1BM9A 2X85A 2X6OA 3ZQLA 2VASA 3J7ZI 4CCLA 5DTDA 2Q0OA 3L1PA 5F08A 1X58A 5E79C 2B7EA 1TT0A 6PAXA 3ZRGA 2HPIA 4B8XA 2M45A 4P96A 4E4HA 4A3LJ 2EV0A 1DGWY 4WXHA 3A0BC 2RV8A 3T1BA 2FD5A 2IXSA 2HXOA 1UG0A 3JRFA 1SVOA 3JSOA 2CJJA 3J7AO 4MNUA 2R7OA 2D1VA 3FK6A 1IN5A 2DFIA 2B0LA 5HDNA 1WQ2A 4D5FA 3G2BA 5DD4A 1ETXA 3HSFA 4RAZA 2E35A 2GLOA 4OMYA 3A02A 3K10A 4MFEA 3FBIB 1UMQA 3LQQA 3GXOA 1U3EM 4QLCU 1QVUA 1B9NA 2QF7A 5CVVA 2H8RA 3HG9A 1ZLKA 2HI3A 4KIFA 4HNVA 3H3VK 5CJ9A 1OKRA 2UZKA 2R7VA 2FBIA 4PDKA 1KONA 5DM7F 5E1ZB 4B3AA 3OS1A 2DMUA 1ZG5A 1X3UA 4BACA 3IRQA 1ONVA 4XRMA 1P4XA 1SD7A 3MKYB 1T39A 2HVRA 3PO3J 2V26A 2K5CA 2Z16A 2OU2A 3D5LA 3IRRA 3VOEA 5BQTA 4HOBA 1PP8F 1UZCA 3JW4A 4HZFA 2EQRA 2ZXHA 5IOZA 5LEKA 1UELB 2BY2A 2Q2EA 3CF2A 1MDMB 1H89C 3EPZA 3WTXC 2KKOA 4X1EA 4A3GJ 2NXNB 3H0DA 4D0PA 2OCCH 3JRCA 1IV6A 1ZTRA 4ENKA 3WODF 2RNGA 2ZKZA 4G7OF 5DS9A 4PJ0C 2UWMA 2OF7A 3EDPA 4FHTA 4KIGA 1G3SA 4HPQA 1YI2I 2OQGA 4J01A 2HVSA 3A4CA 2GOXB 1G2HA 4F93B 4IRIA 3MN2A 3LA2A 5J4VA 2XKPA 3RQ4A 3CJRB 4L18B 3KYLA 3H92A 3HSEA 4AWXB 4BDYA 2CW8A 3E5XA 3CCLI 4HF0A 1IN6A 4L5EA 4FASD 4BL0B 4E7ZA 2LRDA 2V6CA 1JXSA 3ZMSA 1MNEA 3TW6A 5BPIA 3ZMUA 2JWTA 1WZ2A 2Q2EB 4ETSA 3E5UA 1AU7A 1IN8A 1IJWC 4XKWA 3QQAA 4ZYGA 1HSTA 2RN7A 2R7ZJ 2CWEA 3WE2A 2VIXA 1R6RA 4J19A 4P9FA 3F8MA 3KP3A 1T95A 3GFIA 2W25A 2XF7A 1W1WE 2OAZA 3D5RC 2M1BA 3BG3A 4I76A 3HL2A 4WWCA 4Q47A 3LSKA 5C4JJ 2M4GA 1REPC 3MCZA 2DFFA 1MGTA 5IYCJ 2ZJRF 2CUJA 4S0HB 3BC8A 4W97A 4U7DA 1G59A 1B1BA 3MKWB 2BV6A 4XKCA 3HRSA 2WTEA 1GLNA 1J75A 3CCUI 1OPCA 1R5GA 3W3CA 1UCRA 5E1WA 3GTMJ 1B59A 3FISA 2C6YA 1K79A 3ZPLA 1FSHA 1ZRFA 4XK4A 4UB8C 4BE1A 3V7CA 3CCSI 3ERMA 1LB2A 3L2CA 1K6YA 3MEXA 1E2XA 4HNTA 1J2XA 2ZSHB 3LA3A 3MWMA 1Z0XA 4KIBA 1OCRH 4LB6B 4BH9A 2ZO4A 4XIDA 3J81K 1XSXA 1TL8A 2M30A 1GVDA 1HA8A 3QRFF 3CJTB 5EZHA 3RIRA 3VODA 1D8KA 3R60A 3KCCA 4UVBA 2R5ZB 2ME0A 1BI3A 2NOGA 3MAJA 5CQGA 3COAC 3ZQQA 5EGOA 1L3LA 2JQ7A 1EV7A 1X1AA 2XPUA 3DV8A 1QBJA 1MNDA 4Y13A 2O61A 4BBSJ 1G8XA 3OSGA 5KHDA 5E18F 1O3RA 2QLZA 4DBQA 1IXSB 1UHWA 1RUNA 2LLKA 1WSUA 4A69C 3I4MJ 4P9UA 2FU4A 3PJRA 2IA2A 2PN6A 1R4NB 3DP7A 3V8LA 5C3EJ 3EYIA 4C9YA 3JR9A 1HF0A 5FLVA 4ZYEA 1SD6A 4LG3A 4NNJA 2IRFG 5E3MA 4IEJA 4LIUA 2GM4A 1Y6IA 2M8GX 3HYIA 2H6BA 1ZELA 1XD7A 2K3PA 3PIOF 1G3YA 2EFNA 5L3CA 3FXLA 2G0EA 2F5DA 2XF5A 4Z2YA 4RB3C 2K27A 2LBFA 1HKSA 4XM3A 5BS6A 4E70A 5K5QA 5FKOA 2ZJ2A 2RNJA 4X6AJ 4EM1A 1D1CA 5A2QZ 3QP5A 4M3GA 4BJTA 3J81Z 3VSLA 3RPQA 2L9NA 4HNUA 3JTGA 2EA4A 5D5XB 2DK8A 3M07A 2VBZA 3GCMA 2IS1A 3TO7A 3BQZA 3I0TA 1GV5A 1OCCH 3CCRI 1BA5A 2FA5A 2L7FP 2KIQA 2KT0A 3SHFA 3I56I 1TBXA 2KMUA 3JRBA 3TGNA
chains in the Genus database with same CATH topology
3WTYC 2EA2A 1BI2A 2V9VA 2ETHA 2CGPA 4UV8A 3F23A 2VONA 3MFKA 5LHHA 4N9HA 5D4RA 3BOQA 2L4AA 1KU9A 4HYEA 3I54A 4ENJA 5L3DA 3I58A 3DEUA 4L9JA 1LVAA 4ZYHA 2HR3A 2XVCA 4R8HA 3BZ6A 3E6DA 3HOSA 4Y17A 3F8NA 2WWYA 2RDPA 2XUBA 4NB5A 3KZZA 5HDKA 1MD0A 1ON1A 1HXDA 1W7PA 2HS5A 2LSOA 1R22A 5F64A 3FM5A 3I59B 5FLXK 5HS9A 5JFRA 3O6BB 2ZFWA 3K1MA 3WU0A 2VOOA 2JRTA 3WTWC 1T98A 2Z9OA 4MTDA 4U88A 4WK8F 1WKMA 1YS7A 4CDGA 2HEOA 3I4PA 4JK1X 2A6EF 1CGPA 3I71A 4LMYA 4IJAA 1AOYA 1W7PB 3F8BA 4RGSA 4OU0A 5CVRA 1U2WA 2O0YA 2BYVE 4M6XA 1NHAA 3FXRA 4XBFA 4LJZF 2Z33A 2MA3A 4IVNA 4AIHA 2QUFA 2VODA 4ZH4F 1MJAA 2A6HF 3M9AA 2XIGA 5EEGA 3H3UA 2RKHA 3RDIA 3V7RA 1YQAA 3KP5A 5JR3A 5LRSA 2UXNA 2COMA 3RKWA 2V1UA 2XAJA 4IPAA 2ZCWA 1ZREA 1Z6TA 3DPTA 2HOEA 5K1YA 1DP7P 2FSWA 5KVRA 5DUIA 1FBSA 2HKXA 4ESBA 1STZA 4WF2A 1QZZA 1LQ1A 3HRMA 3HUGA 2Y75A 3DFGA 4G94A 3BJ6A 2IW5A 1FT9A 5DV5A 2K02A 1JHHA 4P5OA 4CXFA 2IPQX 2L3DA 1F4KA 4UHTA 2HYFA 2JSCA 3GZ5A 3FX3A 3TDUC 3F3XA 4KUMA 2H09A 4KT5C 4M72A 2O6GE 1BC8C 2F2EA 2L02A 1R00A 5D4SA 2ACJA 2X4HA 1KQ9A 3IC7A 1SFEA 2P7VB 4OIPF 2DQLA 1ZRDA 1SAXA 2TDXA 3RTRA 1XSVA 3ISPA 3OV8A 1XDSA 1D8JA 3EYYA 3C7JA 2WV0A 1USTA 2NRAC 2KJCA 5LEJA 3HHGA 1ZRCA 1FOKA 2EFQA 4EJUA 5J8FA 3RJPA 1T6SA 3CTAA 1FP1D 3SQNA 3BDDA 1PP7U 2CYYA 3NQOA 4OOIA 1FX7A 4A5NA 2GWRA 4MEYF 3ZN1A 3GYHX 2O8XA 4XLPF 4PCQA 2Z3YA 2VT3A 1O7LA 4EGYA 1HQCA 3KEOA 3DF8A 3I64A 4EGZA 2VOPA 4G7HF 2EFWA 3T0YA 3CUQA 3QPTA 3F6VA 4UXNA 2ISYA 3WTTC 3CO7C 4HDVA 4HX4A 3GFLA 1U78A 2Z99A 5LHIA 2HQRA 1AWCA 5CVIA 4HBLA 2DI3A 2ADUA 3AAFA 1S8NA 1YW7A 4HW0A 4MEXF 2RGVA 5H20A 1O3TA 5L3EA 2ISZA 1ZYRF 2LNBA 1J7KA 3ERED 3R0AA 4H0EA 2K4BA 3ZMVA 2MLGA 3GVAA 1LEAA 4GYGA 2EK5A 2O3FA 2CSOA 2ZMEA 3GX4X 2DU9A 2EB7A 1BOAA 1R1UA 2RC4A 2A5YB 2GA2A 4RAYA 2KIFA 4KNYA 3K0LA 4WXDA 1LNWA 4RB0A 2FBHA 2Y48A 2ZNYA 3QPHA 3RKXA 2CG4A 3E5QA 1HSJA 3WTVC 1ZARA 3HIFA 3PFIA 3IKTA 3J80Z 3KEQA 3C18A 3HRUA 1SFUA 4RS8A 3DKWA 3FM3A 2KRFA 1KYWA 4OIOF 4LLNA 3ML6A 1TNSA 4HX7A 4WCGA 4I01A 5LBQA 4TV7A 1BJAA 4HF1A 1BIAA 4L0ZB 2H94A 4UVAA 3GF2A 2KIMA 4M9SA 1E17A 3ECOA 3GWZA 2VBWA 3L7WA 4RGUA 2CFXA 4WXCA 1SD4A 5HDGA 4RGXA 2W84A 2P5KA 2K4JA 2WC2A 3QAHA 5DUKA 3BPVA 3FWEA 4R1HA 3QOPA 2HKOA 4DQ2A 1XGSA 3E3VA 5F6FA 2VE9A 2PI0A 3F22A 4EJOA 1XCVA 4S04A 1SMTA 2FEZA 2YSRA 3WE3A 1KU3A 5KK1A 4Q4ZF 4M73A 3CUOA 3JSPA 4I7HA 2E7XA 2VT2A 2GXBA 5A2QK 5H6QA 4IHTA 3CUQC 4L9NA 2HTJA 2IT0A 2DQRA 5LRRA 4JQFA 4LGWA 3HOTA 1KU7A 3F8CA 4ASNA 5D5UB 4KN4X 5HVQC 3IWZA 5FFXA 2L4MA 4I0BA 1YYVA 1F5TA 2P6SA 5J6XA 1XMAA 2FMLA 2XAGA 3V4GA 5D8KB 1R58A 2AS5F 3G3ZA 2LF7A 3E6CC 1P6RA 1P4AA 2VBYA 3L9FA 4IXAA 4MHGA 1S3JA 3KZYA 5TJJA 2F5EA 2OD5A 4YIIA 3U2RA 2PMUA 1I1GA 2JZYA 5CVJA 1EH6A 1GXQA 2QZ8A 3L00A 1SFXA 1TLHB 1T0FA 1U5TA 1EH8A 1DDNA 2R7FA 3B73A 4LFUA 4CO8A 4ZZLA 1DPRA 1B6AA 4MQ9F 2HDCA 4I98B 4KMFA 1S29A 3HSRA 5K5RA 5LGTA 4KYWA 4MQVA 2YPRA 2L01A 1ON2A 5E20A 1YFHA 1KQ0A 4EJTA 3F21A 3CLOA 1TNTA 1UB9A 1YG2A 1U8RA 2GA1A 5F1RA 4KMUX 2LDUA 3FHZA 4EMSA 2MD5A 2A68F 1YS6A 1OYWA 4A6DA 1U5TB 1MJBA 1KA8A 4G6DA 1CF7A 5E8IA 1YTYA 2XAQA 2JT1A 3EETA 1R7JA 3TOBA 1ZG1A 4GO1A 1FBUA 2H6CA 2O03A 2XROA 3PQJA 4HLXA 2Y0MA 4U7BA 2OZUA 3DXJF 4GYIA 4LLGF 1I6XA 1K78A 1I1SA 4I2OA 5D6FA 1D5VA 5DCFA 1G4DA 2K86A 4HDUA 3SZTA 1T38A 1RZ4A 1FZPB 3ULQB 3K69A 2STWA 3P7NA 1CF7B 1FYMA 1Z7UA 5DEQA 3ZQ7A 1ZAOA 3IHUA 2GZWA 5BMZA 1BN5A 3GEZA 4A2UA 2R7DA 4RB1A 5ILVA 2DLLA 3WU1B 4BNCA 3U9GA 1K78B 4CGZA 3BWGA 5LHGA 3FXQA 2QM3A 5IT3A 2PMHA 4BHPA 1XGOA 4IRHA 1W7PD 2QYOA 4UUVA 4ON0A 1O3QA 3FMSA 5DD8A 1O3SA 1FYKA 2NYXA 1GVJA 2XAHA 4L5JA 3WTSC 3LSTA 3HRTA 4GXOA 3R61A 2CO5A 5ICGA 1TQIA 3M8EA 2RQPA 4Y15A 2F5FA 5HS7A 1LDJA 4GCVA 5ERIA 4G7ZF 3QU3A 3GO5A 4LB5A 2Q8KA 1OR7A 4M9ZA 1RNLA 1QQIA 4AIKA 2IA1A 2XRNA 5LGNA 1KYZA 5CVUA 2OA4A 3CDHA 1MZBA 2P5VA 4KA4A 2EFPA 1R5HA 3WTUC 4HV6A 1YW8A 1OYIA 2DT5A 3P9IA 1OYYA 1Y0UA 4EJVA 1U5TC 2ESHA 5IT9Z 3RKYA 1T2KA 1IRFA 2KIUA 4A12A 4HQMA 3ROUA 2DPUA 5ED4A 1Q1HA 3D0SA 2YX4A 5HLHA 5ICEA 5JHUA 2DAOA 4DNCA 1O57A 2J5OA 1IXRC 1XGMA 5DDGA 2QVOA 1WWXA 3W6KB 1KQ8A 1QGPA 3PQKA 3U1DA 3FZVA 2P7CB 1DPUA 3K1PA 4JBAA 1ZHFA 2ZBKA 3KLOA 3LWFA 2IJLA 5BOXA 1HW5A 3L09A 2MC3A 4O5VA 2MBFA 3VEPA 1Z6RA 3LAJA 4A0YA 5HOOA 2BBYA 1YIOA 3CO6C 4L0YB 1F9NA 4BXUA 1TQPA 2ELHA 5JI6A 2ESNA 2BEOA 1V4RA 3OOPA 3WTZA 4G6QA 3VFZA 2J5PA 3ZMZA 2JTVA 4KICA 3F8FA 3H3ZA 1LEBA 2V79A 4A0XA 1KU2A 2A3SA 1SD5A 2QQAA 4KN7X 3N97A 3LQRA 5DYMA 2E1CA 1ZLJA 4HX8A 1J0RA 1DUXC 4CYDA 2EWNA 5CLSA 2HWVA 2FNAA 4EM0B 1W4MA 1FC3A 4IHSA 2D2WA 5CYVA 5D8LB 2IVMA 3FMQA 3J80K 4M74A 1OMIA 3BY6A 2V1XA 1VTNC 1IAWA 2M8EA 1A04A 3KFWX 1B4AA 3K2ZA 2M5WA 2YU3A 4A0ZA 3MZYA 3I53A 4IRGA 4HLYA 3KP6A 5ICCA 2P8TA 3IWFA 3CUQB 4N0BA 4XRFA 1IW7F 1IUYA 5D5VB 3BP8A 4CHUA 4GGGA 4BHCA 2VN2A 3FXUA 1XGNA 2QQBA 5HS8A 4WX9A 3DPLC 4NQWA 4CZZA 3HHHA 4K2EA 3K1NA 3JTHA 4MTEA 2GQQA 4Q48A 2JPCA 4L9TA 3NRVA 3RYRA 2IA0A 2AXLA 3HTUA 1MDMA 2FQ3A 2K7LA 1C0WA 2QBYA 2IP2A 1BIBA 2W57A 3EUHA 4OIRF 1S7OA 4OIQF 1QO0D 2G7UA 2ZMEB 3S2WA 1JGSA 4RB2C 5L3BA 3V7SA 1LJ9A 2NNYA 2PBIA 3ECHA 1FY7A 4YFKF 1IRGA 1EH7A 4M6YA 1HKTA 1XCBA 2XV4S 5E1XA 1PUEE 4F7ZA 5ICFA 3RYPA 3W6JB 2EFOA 3R0JA 2QWWA 1R36A 1HKQA 4ESJA 3ABUA 1R1TA 2QBYB 2ZXJA 1P2FA 1HW1A 1ZH5A 1ZGJA 2CW0F 1W5TA 2VC1A 1TW3A 3KP7A 1FNNA 3QP6A 3KP2A 1TTYA 3MQ0A 4U0WA 1ODDA 5LLQA 3Q9VA 2XHKA 3M7GA 4KDPA 4KFCA 5H6RA 4LD5A 1W5SA 2P4WA 2HYGD 5FD5A 2P5LC 2L54A 3TO6A 1K7AA 1ZGAA 2NAZA 2HTSA 3GFJA 3N4MA 4M71A 4NHJA 2KJBA 1Z91A 3GUDA 3P9CA 1TW2A 3BPXA 2GIVA 1R23A 3T8TA 3BJOA 3GLXA 3GW2A 1IN7A 1IXCA 2RVCA 2EV6A 4HAMA 2A69F 1FWZA 1XSDA 3F72A 2NNNA 2FRHA 3CJNA 1YW9A 4FX4A 1ULYA 1D3YA 1GHCA 4O6JA 3C3WA 2GAUA 2YR2A 1S7AA 1LDKB 2BE5F 1V3FA 1FBQA 1Z05A 3T8RA 3FMRA 2VXZA 2HGCA 3F6OA 4XLNF 3B02A 5ILSA 4S05A 4UV9A 4HA8A 4A6EA 5FB2A 2VC0A 2HQNA 2P6TA 4L5IA 1ZG3A 1J5YA 5AIQA 3SZPA 4PZJA 2F5CA 3KE2A 3E97A 3LFKA 2FNPA 2DBBA 2EV5A 4MGRA 5FGMA 1H9TA 2G7HA 4I02A 4ENNA 1J9IA 3REOA 2OZ6A 3R6SA 3BROA 4ESFA 1BI1A 3HTSB 2PLYA 3ZN0A 4EQQA 3WGGA 3O2PE 3ZMTA 1F1ZA 4N9IA 1U6GA 5FD6A 1FYLA 2MH2A 3ABTA 2YX7A 1IZ1A 2HZTA 5EEHA 4AIJA 4BHBA 2FXAA 1YO5C 4PGGA 2V1DA 1JHFA 1S6LA 1XB4A 1P4WA 4UVCA 2D1HA 3G73A 3GFMA 4YFXF 4UNOA 2PJPA 1G3WA 3I59A 4P55A 3IKVA 4YG2F 4ENMA 3V8KA 4U0VA 2UXXA 1G6NA 1FLIA 2CQKA 2EJRA 3M8FA 2PG4A 2XGXA 1SMYF 1XMKA 2G9WA 3LA7A 3O3KA 4I09A 2OBPA 4BYYA 3JAMK 1J59A 3SXYA 3VB2A 5ILUA 1Z9CA 1KGSA 2JPBA 3TOAA 3EQLF 5HLIA 4XSZF 4EJWA 3C1DA 4AVPA 3V8JA 1QNTA 1YLFA 1UHMA 1XN7A 1H9GA 2LKPA 4LG0A 2NS0A 5FO5A 1FP2A 5L3GA 2A61A 2W85A 3TDZC 1USSA 4PGHA 3E6BA 1K6OA 5DCMA 4HF2A 2DO7A 1ZN2A 2DPDA 5IT9K 2HFHA 2MH9A 1WI9A 2BGCA 3I5UA 3R4KA 4OINF 3K9TA 5LGUA 4M9XA 3KETA 1B9MA 4QWQA 1MJ9A 2GXGA 2OQRA 2A07F 3WG9A 3JAMZ 2DK5A 4LG0B 3TO9A 2DTRA 2PEXA 1HW2A 2MLKA 1G3TA 4I0AA 5DCMB 1BBYA 1I5ZA 5AONA 3KP4A 4HV5A 4BAYA 2XASA 2PQ8A 5FLXZ 2X0LA 1FPQA 1QZYA 4AD9A 1I27A 3FF5A 4Q5SF 4HQEA 5E8GA 3Q9SA 4ZZDA 5K5OA 1PDNC 3QU6A 2STTA 2E7WA 4LLLA 1IF1A 4EV0A 2FF4A 3DQVC 1R1VA 5E17F 5L3FA 2LF8A 3ZP5A 4O3MA 1RI7A 2Z5UA 3P9KA 4RGRA 1JE8A 1BC7C 4G8XA 1LDDA 1H0MA 5TRDA 4IF4A 2ZNZA 3T5XA 4YIFA 1Z1DA 2XAFA 2FOKA 5JVTA 2E1NA 4EM2A 4B09A 2QENA 1FSEA 2DW4A 5FFZA 4R79A 4G9YA 5D6EA 2QQ9A 1IN4A 2VBXA 1QPMA 1RUOA 4LK1F 5AIPA 4YFNF 5J8CA 3IL2A 2VE8A 1RIOH 3KLNA 3RPUA 4L9VA 3NEUA 1UFMA 3TKYA 2FBKA 3ZMDA 4LK0F 3TQNA 3M1EA 1XDUA 1HBXG 4U0YA 3WGHA 5BPDA 1P92A 2FE3A 1BI0A 3GZ6A 4BQAA 1MKMA 3BJAA 3ELKA 4FX0A 4CICA 2H27A 3SFZA 3WGIA 4OMZA 4EVIA 1GXPA 4XSXF 2PFBA 4A5MA 1WRJA 3Q5FA 3RI4A 2FMYA 2W24A 1L0OC 3MZHA 2M87A 2D45A 1O7FA 4FT8A 1TQMA 5HLGA 3LAPA 2XKOA 3E6MA 4ZYDA 5D5WB 2R3SA 1BM9A 2Q0OA 6PAXA 4B8XA 2M45A 4P96A 2EV0A 4WXHA 2RV8A 3T1BA 3JSOA 3J7AO 4MNUA 2D1VA 1IN5A 2DFIA 2B0LA 5HDNA 1WQ2A 5DD4A 3HSFA 4RAZA 4OMYA 3LQQA 3GXOA 1U3EM 4QLCU 1B9NA 5CVVA 1ZLKA 4KIFA 5CJ9A 1OKRA 2UZKA 2FBIA 4PDKA 5E1ZB 1ZG5A 1X3UA 3IRQA 1ONVA 1P4XA 1SD7A 1T39A 2OU2A 3D5LA 3IRRA 3VOEA 5BQTA 4HOBA 1PP8F 3JW4A 4HZFA 5LEKA 2Q2EA 1MDMB 3WTXC 2KKOA 4D0PA 4ENKA 3WODF 2ZKZA 4G7OF 2UWMA 3EDPA 4FHTA 4KIGA 1G3SA 2OQGA 4IRIA 3LA2A 2XKPA 4L18B 3H92A 3HSEA 4AWXB 3E5XA 4HF0A 1IN6A 2V6CA 1JXSA 3ZMSA 5BPIA 3ZMUA 4ETSA 3E5UA 1IN8A 4ZYGA 1HSTA 2RN7A 2CWEA 3WE2A 4P9FA 3F8MA 3KP3A 3GFIA 2W25A 2OAZA 2M1BA 4WWCA 4Q47A 1REPC 3MCZA 1MGTA 4U7DA 1B1BA 2BV6A 3HRSA 2WTEA 1J75A 1OPCA 1R5GA 1UCRA 5E1WA 1B59A 2C6YA 1K79A 3ZPLA 1FSHA 1ZRFA 3V7CA 1LB2A 3L2CA 3MEXA 1E2XA 1J2XA 3LA3A 3MWMA 4KIBA 3J81K 4LB6B 4BH9A 2ZO4A 1XSXA 2M30A 3QRFF 3RIRA 3VODA 1D8KA 3R60A 3KCCA 4UVBA 1BI3A 3MAJA 3COAC 1L3LA 1EV7A 3DV8A 1QBJA 4Y13A 2O61A 5E18F 1O3RA 2QLZA 1IXSB 1UHWA 1RUNA 1WSUA 4P9UA 2FU4A 2IA2A 2PN6A 3DP7A 3EYIA 3V8LA 4ZYEA 1SD6A 2IRFG 3HYIA 2H6BA 1XD7A 1G3YA 2EFNA 5L3CA 2F5DA 4RB3C 4Z2YA 2K27A 1HKSA 5BS6A 4E70A 5K5QA 2ZJ2A 2RNJA 4EM1A 5A2QZ 3QP5A 3J81Z 3RPQA 3JTGA 2EA4A 5D5XB 2DK8A 2VBZA 3TO7A 3I0TA 2FA5A 3SHFA 1TBXA 3TGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WTY C;  2EA2 A;  1BI2 A;  2V9V A;  2ETH A;  2CGP A;  4UV8 A;  3F23 A;  2VON A;  3MFK A;  5LHH A;  4N9H A;  5D4R A;  3BOQ A;  2L4A A;  1KU9 A;  4HYE A;  3I54 A;  4ENJ A;  5L3D A;  3I58 A;  3DEU A;  4L9J A;  1LVA A;  4ZYH A;  2HR3 A;  2XVC A;  4R8H A;  3BZ6 A;  3E6D A;  3HOS A;  4Y17 A;  3F8N A;  2WWY A;  2RDP A;  2XUB A;  4NB5 A;  3KZZ A;  5HDK A;  1MD0 A;  1ON1 A;  1HXD A;  1W7P A;  2HS5 A;  2LSO A;  1R22 A;  5F64 A;  3FM5 A;  3I59 B;  5FLX K;  5HS9 A;  5JFR A;  3O6B B;  2ZFW A;  3K1M A;  3WU0 A;  2VOO A;  2JRT A;  3WTW C;  1T98 A;  2Z9O A;  4MTD A;  4U88 A;  4WK8 F;  1WKM A;  1YS7 A;  4CDG A;  2HEO A;  3I4P A;  4JK1 X;  2A6E F;  1CGP A;  3I71 A;  4LMY A;  4IJA A;  1AOY A;  1W7P B;  3F8B A;  4RGS A;  4OU0 A;  5CVR A;  1U2W A;  2O0Y A;  2BYV E;  4M6X A;  1NHA A;  3FXR A;  4XBF A;  4LJZ F;  2Z33 A;  2MA3 A;  4IVN A;  4AIH A;  2QUF A;  2VOD A;  4ZH4 F;  1MJA A;  2A6H F;  3M9A A;  2XIG A;  5EEG A;  3H3U A;  2RKH A;  3RDI A;  3V7R A;  1YQA A;  3KP5 A;  5JR3 A;  5LRS A;  2UXN A;  2COM A;  3RKW A;  2V1U A;  2XAJ A;  4IPA A;  2ZCW A;  1ZRE A;  1Z6T A;  3DPT A;  2HOE A;  5K1Y A;  1DP7 P;  2FSW A;  5KVR A;  5DUI A;  1FBS A;  2HKX A;  4ESB A;  1STZ A;  4WF2 A;  1QZZ A;  1LQ1 A;  3HRM A;  3HUG A;  2Y75 A;  3DFG A;  4G94 A;  3BJ6 A;  2IW5 A;  1FT9 A;  5DV5 A;  2K02 A;  1JHH A;  4P5O A;  4CXF A;  2IPQ X;  2L3D A;  1F4K A;  4UHT A;  2HYF A;  2JSC A;  3GZ5 A;  3FX3 A;  3TDU C;  3F3X A;  4KUM A;  2H09 A;  4KT5 C;  4M72 A;  2O6G E;  1BC8 C;  2F2E A;  2L02 A;  1R00 A;  5D4S A;  2ACJ A;  2X4H A;  1KQ9 A;  3IC7 A;  1SFE A;  2P7V B;  4OIP F;  2DQL A;  1ZRD A;  1SAX A;  2TDX A;  3RTR A;  1XSV A;  3ISP A;  3OV8 A;  1XDS A;  1D8J A;  3EYY A;  3C7J A;  2WV0 A;  1UST A;  2NRA C;  2KJC A;  5LEJ A;  3HHG A;  1ZRC A;  1FOK A;  2EFQ A;  4EJU A;  5J8F A;  3RJP A;  1T6S A;  3CTA A;  1FP1 D;  3SQN A;  3BDD A;  1PP7 U;  2CYY A;  3NQO A;  4OOI A;  1FX7 A;  4A5N A;  2GWR A;  4MEY F;  3ZN1 A;  3GYH X;  2O8X A;  4XLP F;  4PCQ A;  2Z3Y A;  2VT3 A;  1O7L A;  4EGY A;  1HQC A;  3KEO A;  3DF8 A;  3I64 A;  4EGZ A;  2VOP A;  4G7H F;  2EFW A;  3T0Y A;  3CUQ A;  3QPT A;  3F6V A;  4UXN A;  2ISY A;  3WTT C;  3CO7 C;  4HDV A;  4HX4 A;  3GFL A;  1U78 A;  2Z99 A;  5LHI A;  2HQR A;  1AWC A;  5CVI A;  4HBL A;  2DI3 A;  2ADU A;  3AAF A;  1S8N A;  1YW7 A;  4HW0 A;  4MEX F;  2RGV A;  5H20 A;  1O3T A;  5L3E A;  2ISZ A;  1ZYR F;  2LNB A;  1J7K A;  3ERE D;  3R0A A;  4H0E A;  2K4B A;  3ZMV A;  2MLG A;  3GVA A;  1LEA A;  4GYG A;  2EK5 A;  2O3F A;  2CSO A;  2ZME A;  3GX4 X;  2DU9 A;  2EB7 A;  1BOA A;  1R1U A;  2RC4 A;  2A5Y B;  2GA2 A;  4RAY A;  2KIF A;  4KNY A;  3K0L A;  4WXD A;  1LNW A;  4RB0 A;  2FBH A;  2Y48 A;  2ZNY A;  3QPH A;  3RKX A;  2CG4 A;  3E5Q A;  1HSJ A;  3WTV C;  1ZAR A;  3HIF A;  3PFI A;  3IKT A;  3J80 Z;  3KEQ A;  3C18 A;  3HRU A;  1SFU A;  4RS8 A;  3DKW A;  3FM3 A;  2KRF A;  1KYW A;  4OIO F;  4LLN A;  3ML6 A;  1TNS A;  4HX7 A;  4WCG A;  4I01 A;  5LBQ A;  4TV7 A;  1BJA A;  4HF1 A;  1BIA A;  4L0Z B;  2H94 A;  4UVA A;  3GF2 A;  2KIM A;  4M9S A;  1E17 A;  3ECO A;  3GWZ A;  2VBW A;  3L7W A;  4RGU A;  2CFX A;  4WXC A;  1SD4 A;  5HDG A;  4RGX A;  2W84 A;  2P5K A;  2K4J A;  2WC2 A;  3QAH A;  5DUK A;  3BPV A;  3FWE A;  4R1H A;  3QOP A;  2HKO A;  4DQ2 A;  1XGS A;  3E3V A;  5F6F A;  2VE9 A;  2PI0 A;  3F22 A;  4EJO A;  1XCV A;  4S04 A;  1SMT A;  2FEZ A;  2YSR A;  3WE3 A;  1KU3 A;  5KK1 A;  4Q4Z F;  4M73 A;  3CUO A;  3JSP A;  4I7H A;  2E7X A;  2VT2 A;  2GXB A;  5A2Q K;  5H6Q A;  4IHT A;  3CUQ C;  4L9N A;  2HTJ A;  2IT0 A;  2DQR A;  5LRR A;  4JQF A;  4LGW A;  3HOT A;  1KU7 A;  3F8C A;  4ASN A;  5D5U B;  4KN4 X;  5HVQ C;  3IWZ A;  5FFX A;  2L4M A;  4I0B A;  1YYV A;  1F5T A;  2P6S A;  5J6X A;  1XMA A;  2FML A;  2XAG A;  3V4G A;  5D8K B;  1R58 A;  2AS5 F;  3G3Z A;  2LF7 A;  3E6C C;  1P6R A;  1P4A A;  2VBY A;  3L9F A;  4IXA A;  4MHG A;  1S3J A;  3KZY A;  5TJJ A;  2F5E A;  2OD5 A;  4YII A;  3U2R A;  2PMU A;  1I1G A;  2JZY A;  5CVJ A;  1EH6 A;  1GXQ A;  2QZ8 A;  3L00 A;  1SFX A;  1TLH B;  1T0F A;  1U5T A;  1EH8 A;  1DDN A;  2R7F A;  3B73 A;  4LFU A;  4CO8 A;  4ZZL A;  1DPR A;  1B6A A;  4MQ9 F;  2HDC A;  4I98 B;  4KMF A;  1S29 A;  3HSR A;  5K5R A;  5LGT A;  4KYW A;  4MQV A;  2YPR A;  2L01 A;  1ON2 A;  5E20 A;  1YFH A;  1KQ0 A;  4EJT A;  3F21 A;  3CLO A;  1TNT A;  1UB9 A;  1YG2 A;  1U8R A;  2GA1 A;  5F1R A;  4KMU X;  2LDU A;  3FHZ A;  4EMS A;  2MD5 A;  2A68 F;  1YS6 A;  1OYW A;  4A6D A;  1U5T B;  1MJB A;  1KA8 A;  4G6D A;  1CF7 A;  5E8I A;  1YTY A;  2XAQ A;  2JT1 A;  3EET A;  1R7J A;  3TOB A;  1ZG1 A;  4GO1 A;  1FBU A;  2H6C A;  2O03 A;  2XRO A;  3PQJ A;  4HLX A;  2Y0M A;  4U7B A;  2OZU A;  3DXJ F;  4GYI A;  4LLG F;  1I6X A;  1K78 A;  1I1S A;  4I2O A;  5D6F A;  1D5V A;  5DCF A;  1G4D A;  2K86 A;  4HDU A;  3SZT A;  1T38 A;  1RZ4 A;  1FZP B;  3ULQ B;  3K69 A;  2STW A;  3P7N A;  1CF7 B;  1FYM A;  1Z7U A;  5DEQ A;  3ZQ7 A;  1ZAO A;  3IHU A;  2GZW A;  5BMZ A;  1BN5 A;  3GEZ A;  4A2U A;  2R7D A;  4RB1 A;  5ILV A;  2DLL A;  3WU1 B;  4BNC A;  3U9G A;  1K78 B;  4CGZ A;  3BWG A;  5LHG A;  3FXQ A;  2QM3 A;  5IT3 A;  2PMH A;  4BHP A;  1XGO A;  4IRH A;  1W7P D;  2QYO A;  4UUV A;  4ON0 A;  1O3Q A;  3FMS A;  5DD8 A;  1O3S A;  1FYK A;  2NYX A;  1GVJ A;  2XAH A;  4L5J A;  3WTS C;  3LST A;  3HRT A;  4GXO A;  3R61 A;  2CO5 A;  5ICG A;  1TQI A;  3M8E A;  2RQP A;  4Y15 A;  2F5F A;  5HS7 A;  1LDJ A;  4GCV A;  5ERI A;  4G7Z F;  3QU3 A;  3GO5 A;  4LB5 A;  2Q8K A;  1OR7 A;  4M9Z A;  1RNL A;  1QQI A;  4AIK A;  2IA1 A;  2XRN A;  5LGN A;  1KYZ A;  5CVU A;  2OA4 A;  3CDH A;  1MZB A;  2P5V A;  4KA4 A;  2EFP A;  1R5H A;  3WTU C;  4HV6 A;  1YW8 A;  1OYI A;  2DT5 A;  3P9I A;  1OYY A;  1Y0U A;  4EJV A;  1U5T C;  2ESH A;  5IT9 Z;  3RKY A;  1T2K A;  1IRF A;  2KIU A;  4A12 A;  4HQM A;  3ROU A;  2DPU A;  5ED4 A;  1Q1H A;  3D0S A;  2YX4 A;  5HLH A;  5ICE A;  5JHU A;  2DAO A;  4DNC A;  1O57 A;  2J5O A;  1IXR C;  1XGM A;  5DDG A;  2QVO A;  1WWX A;  3W6K B;  1KQ8 A;  1QGP A;  3PQK A;  3U1D A;  3FZV A;  2P7C B;  1DPU A;  3K1P A;  4JBA A;  1ZHF A;  2ZBK A;  3KLO A;  3LWF A;  2IJL A;  5BOX A;  1HW5 A;  3L09 A;  2MC3 A;  4O5V A;  2MBF A;  3VEP A;  1Z6R A;  3LAJ A;  4A0Y A;  5HOO A;  2BBY A;  1YIO A;  3CO6 C;  4L0Y B;  1F9N A;  4BXU A;  1TQP A;  2ELH A;  5JI6 A;  2ESN A;  2BEO A;  1V4R A;  3OOP A;  3WTZ A;  4G6Q A;  3VFZ A;  2J5P A;  3ZMZ A;  2JTV A;  4KIC A;  3F8F A;  3H3Z A;  1LEB A;  2V79 A;  4A0X A;  1KU2 A;  2A3S A;  1SD5 A;  2QQA A;  4KN7 X;  3N97 A;  3LQR A;  5DYM A;  2E1C A;  1ZLJ A;  4HX8 A;  1J0R A;  1DUX C;  4CYD A;  2EWN A;  5CLS A;  2HWV A;  2FNA A;  4EM0 B;  1W4M A;  1FC3 A;  4IHS A;  2D2W A;  5CYV A;  5D8L B;  2IVM A;  3FMQ A;  3J80 K;  4M74 A;  1OMI A;  3BY6 A;  2V1X A;  1VTN C;  1IAW A;  2M8E A;  1A04 A;  3KFW X;  1B4A A;  3K2Z A;  2M5W A;  2YU3 A;  4A0Z A;  3MZY A;  3I53 A;  4IRG A;  4HLY A;  3KP6 A;  5ICC A;  2P8T A;  3IWF A;  3CUQ B;  4N0B A;  4XRF A;  1IW7 F;  1IUY A;  5D5V B;  3BP8 A;  4CHU A;  4GGG A;  4BHC A;  2VN2 A;  3FXU A;  1XGN A;  2QQB A;  5HS8 A;  4WX9 A;  3DPL C;  4NQW A;  4CZZ A;  3HHH A;  4K2E A;  3K1N A;  3JTH A;  4MTE A;  2GQQ A;  4Q48 A;  2JPC A;  4L9T A;  3NRV A;  3RYR A;  2IA0 A;  2AXL A;  3HTU A;  1MDM A;  2FQ3 A;  2K7L A;  1C0W A;  2QBY A;  2IP2 A;  1BIB A;  2W57 A;  3EUH A;  4OIR F;  1S7O A;  4OIQ F;  1QO0 D;  2G7U A;  2ZME B;  3S2W A;  1JGS A;  4RB2 C;  5L3B A;  3V7S A;  1LJ9 A;  2NNY A;  2PBI A;  3ECH A;  1FY7 A;  4YFK F;  1IRG A;  1EH7 A;  4M6Y A;  1HKT A;  1XCB A;  2XV4 S;  5E1X A;  1PUE E;  4F7Z A;  5ICF A;  3RYP A;  3W6J B;  2EFO A;  3R0J A;  2QWW A;  1R36 A;  1HKQ A;  4ESJ A;  3ABU A;  1R1T A;  2QBY B;  2ZXJ A;  1P2F A;  1HW1 A;  1ZH5 A;  1ZGJ A;  2CW0 F;  1W5T A;  2VC1 A;  1TW3 A;  3KP7 A;  1FNN A;  3QP6 A;  3KP2 A;  1TTY A;  3MQ0 A;  4U0W A;  1ODD A;  5LLQ A;  3Q9V A;  2XHK A;  3M7G A;  4KDP A;  4KFC A;  5H6R A;  4LD5 A;  1W5S A;  2P4W A;  2HYG D;  5FD5 A;  2P5L C;  2L54 A;  3TO6 A;  1K7A A;  1ZGA A;  2NAZ A;  2HTS A;  3GFJ A;  3N4M A;  4M71 A;  4NHJ A;  2KJB A;  1Z91 A;  3GUD A;  3P9C A;  1TW2 A;  3BPX A;  2GIV A;  1R23 A;  3T8T A;  3BJO A;  3GLX A;  3GW2 A;  1IN7 A;  1IXC A;  2RVC A;  2EV6 A;  4HAM A;  2A69 F;  1FWZ A;  1XSD A;  3F72 A;  2NNN A;  2FRH A;  3CJN A;  1YW9 A;  4FX4 A;  1ULY A;  1D3Y A;  1GHC A;  4O6J A;  3C3W A;  2GAU A;  2YR2 A;  1S7A A;  1LDK B;  2BE5 F;  1V3F A;  1FBQ A;  1Z05 A;  3T8R A;  3FMR A;  2VXZ A;  2HGC A;  3F6O A;  4XLN F;  3B02 A;  5ILS A;  4S05 A;  4UV9 A;  4HA8 A;  4A6E A;  5FB2 A;  2VC0 A;  2HQN A;  2P6T A;  4L5I A;  1ZG3 A;  1J5Y A;  5AIQ A;  3SZP A;  4PZJ A;  2F5C A;  3KE2 A;  3E97 A;  3LFK A;  2FNP A;  2DBB A;  2EV5 A;  4MGR A;  5FGM A;  1H9T A;  2G7H A;  4I02 A;  4ENN A;  1J9I A;  3REO A;  2OZ6 A;  3R6S A;  3BRO A;  4ESF A;  1BI1 A;  3HTS B;  2PLY A;  3ZN0 A;  4EQQ A;  3WGG A;  3O2P E;  3ZMT A;  1F1Z A;  4N9I A;  1U6G A;  5FD6 A;  1FYL A;  2MH2 A;  3ABT A;  2YX7 A;  1IZ1 A;  2HZT A;  5EEH A;  4AIJ A;  4BHB A;  2FXA A;  1YO5 C;  4PGG A;  2V1D A;  1JHF A;  1S6L A;  1XB4 A;  1P4W A;  4UVC A;  2D1H A;  3G73 A;  3GFM A;  4YFX F;  4UNO A;  2PJP A;  1G3W A;  3I59 A;  4P55 A;  3IKV A;  4YG2 F;  4ENM A;  3V8K A;  4U0V A;  2UXX A;  1G6N A;  1FLI A;  2CQK A;  2EJR A;  3M8F A;  2PG4 A;  2XGX A;  1SMY F;  1XMK A;  2G9W A;  3LA7 A;  3O3K A;  4I09 A;  2OBP A;  4BYY A;  3JAM K;  1J59 A;  3SXY A;  3VB2 A;  5ILU A;  1Z9C A;  1KGS A;  2JPB A;  3TOA A;  3EQL F;  5HLI A;  4XSZ F;  4EJW A;  3C1D A;  4AVP A;  3V8J A;  1QNT A;  1YLF A;  1UHM A;  1XN7 A;  1H9G A;  2LKP A;  4LG0 A;  2NS0 A;  5FO5 A;  1FP2 A;  5L3G A;  2A61 A;  2W85 A;  3TDZ C;  1USS A;  4PGH A;  3E6B A;  1K6O A;  5DCM A;  4HF2 A;  2DO7 A;  1ZN2 A;  2DPD A;  5IT9 K;  2HFH A;  2MH9 A;  1WI9 A;  2BGC A;  3I5U A;  3R4K A;  4OIN F;  3K9T A;  5LGU A;  4M9X A;  3KET A;  1B9M A;  4QWQ A;  1MJ9 A;  2GXG A;  2OQR A;  2A07 F;  3WG9 A;  3JAM Z;  2DK5 A;  4LG0 B;  3TO9 A;  2DTR A;  2PEX A;  1HW2 A;  2MLK A;  1G3T A;  4I0A A;  5DCM B;  1BBY A;  1I5Z A;  5AON A;  3KP4 A;  4HV5 A;  4BAY A;  2XAS A;  2PQ8 A;  5FLX Z;  2X0L A;  1FPQ A;  1QZY A;  4AD9 A;  1I27 A;  3FF5 A;  4Q5S F;  4HQE A;  5E8G A;  3Q9S A;  4ZZD A;  5K5O A;  1PDN C;  3QU6 A;  2STT A;  2E7W A;  4LLL A;  1IF1 A;  4EV0 A;  2FF4 A;  3DQV C;  1R1V A;  5E17 F;  5L3F A;  2LF8 A;  3ZP5 A;  4O3M A;  1RI7 A;  2Z5U A;  3P9K A;  4RGR A;  1JE8 A;  1BC7 C;  4G8X A;  1LDD A;  1H0M A;  5TRD A;  4IF4 A;  2ZNZ A;  3T5X A;  4YIF A;  1Z1D A;  2XAF A;  2FOK A;  5JVT A;  2E1N A;  4EM2 A;  4B09 A;  2QEN A;  1FSE A;  2DW4 A;  5FFZ A;  4R79 A;  4G9Y A;  5D6E A;  2QQ9 A;  1IN4 A;  2VBX A;  1QPM A;  1RUO A;  4LK1 F;  5AIP A;  4YFN F;  5J8C A;  3IL2 A;  2VE8 A;  1RIO H;  3KLN A;  3RPU A;  4L9V A;  3NEU A;  1UFM A;  3TKY A;  2FBK A;  3ZMD A;  4LK0 F;  3TQN A;  3M1E A;  1XDU A;  1HBX G;  4U0Y A;  3WGH A;  5BPD A;  1P92 A;  2FE3 A;  1BI0 A;  3GZ6 A;  4BQA A;  1MKM A;  3BJA A;  3ELK A;  4FX0 A;  4CIC A;  2H27 A;  3SFZ A;  3WGI A;  4OMZ A;  4EVI A;  1GXP A;  4XSX F;  2PFB A;  4A5M A;  1WRJ A;  3Q5F A;  3RI4 A;  2FMY A;  2W24 A;  1L0O C;  3MZH A;  2M87 A;  2D45 A;  1O7F A;  4FT8 A;  1TQM A;  5HLG A;  3LAP A;  2XKO A;  3E6M A;  4ZYD A;  5D5W B;  2R3S A;  1BM9 A;  2Q0O A;  6PAX A;  4B8X A;  2M45 A;  4P96 A;  2EV0 A;  4WXH A;  2RV8 A;  3T1B A;  3JSO A;  3J7A O;  4MNU A;  2D1V A;  1IN5 A;  2DFI A;  2B0L A;  5HDN A;  1WQ2 A;  5DD4 A;  3HSF A;  4RAZ A;  4OMY A;  3LQQ A;  3GXO A;  1U3E M;  4QLC U;  1B9N A;  5CVV A;  1ZLK A;  4KIF A;  5CJ9 A;  1OKR A;  2UZK A;  2FBI A;  4PDK A;  5E1Z B;  1ZG5 A;  1X3U A;  3IRQ A;  1ONV A;  1P4X A;  1SD7 A;  1T39 A;  2OU2 A;  3D5L A;  3IRR A;  3VOE A;  5BQT A;  4HOB A;  1PP8 F;  3JW4 A;  4HZF A;  5LEK A;  2Q2E A;  1MDM B;  3WTX C;  2KKO A;  4D0P A;  4ENK A;  3WOD F;  2ZKZ A;  4G7O F;  2UWM A;  3EDP A;  4FHT A;  4KIG A;  1G3S A;  2OQG A;  4IRI A;  3LA2 A;  2XKP A;  4L18 B;  3H92 A;  3HSE A;  4AWX B;  3E5X A;  4HF0 A;  1IN6 A;  2V6C A;  1JXS A;  3ZMS A;  5BPI A;  3ZMU A;  4ETS A;  3E5U A;  1IN8 A;  4ZYG A;  1HST A;  2RN7 A;  2CWE A;  3WE2 A;  4P9F A;  3F8M A;  3KP3 A;  3GFI A;  2W25 A;  2OAZ A;  2M1B A;  4WWC A;  4Q47 A;  1REP C;  3MCZ A;  1MGT A;  4U7D A;  1B1B A;  2BV6 A;  3HRS A;  2WTE A;  1J75 A;  1OPC A;  1R5G A;  1UCR A;  5E1W A;  1B59 A;  2C6Y A;  1K79 A;  3ZPL A;  1FSH A;  1ZRF A;  3V7C A;  1LB2 A;  3L2C A;  3MEX A;  1E2X A;  1J2X A;  3LA3 A;  3MWM A;  4KIB A;  3J81 K;  4LB6 B;  4BH9 A;  2ZO4 A;  1XSX A;  2M30 A;  3QRF F;  3RIR A;  3VOD A;  1D8K A;  3R60 A;  3KCC A;  4UVB A;  1BI3 A;  3MAJ A;  3COA C;  1L3L A;  1EV7 A;  3DV8 A;  1QBJ A;  4Y13 A;  2O61 A;  5E18 F;  1O3R A;  2QLZ A;  1IXS B;  1UHW A;  1RUN A;  1WSU A;  4P9U A;  2FU4 A;  2IA2 A;  2PN6 A;  3DP7 A;  3EYI A;  3V8L A;  4ZYE A;  1SD6 A;  2IRF G;  3HYI A;  2H6B A;  1XD7 A;  1G3Y A;  2EFN A;  5L3C A;  2F5D A;  4RB3 C;  4Z2Y A;  2K27 A;  1HKS A;  5BS6 A;  4E70 A;  5K5Q A;  2ZJ2 A;  2RNJ A;  4EM1 A;  5A2Q Z;  3QP5 A;  3J81 Z;  3RPQ A;  3JTG A;  2EA4 A;  5D5X B;  2DK8 A;  2VBZ A;  3TO7 A;  3I0T A;  2FA5 A;  3SHF A;  1TBX A;  3TGN A; 
#chains in the Genus database with same CATH topology
 1HLV A;  4B4C A;  3WTY C;  2EA2 A;  4IOA F;  1UJ8 A;  1BI2 A;  1GUU A;  2V9V A;  3RKQ A;  2ETH A;  2CGP A;  4UV8 A;  3F23 A;  1PUF A;  4XNF A;  2VON A;  3GME A;  3MFK A;  2LBF B;  5LHH A;  2LK2 A;  4N9H A;  4CA0 A;  1Z77 A;  1MH4 A;  4XRS A;  2P81 A;  2Y0S A;  3TMO A;  4AYB N;  5D4R A;  3BOQ A;  2L4A A;  1KU9 A;  1MNM C;  5IP6 A;  4HYE A;  1N25 A;  3I54 A;  4HST A;  4ENJ A;  3FHN A;  5L3D A;  3I58 A;  2DTZ A;  3DEU A;  2EBI A;  1LVA A;  4L9J A;  4ZYH A;  1ERD A;  1IC8 A;  4M3D A;  2HR3 A;  2XVC A;  4R8H A;  3BZ6 A;  3E6D A;  3HOS A;  3OR1 C;  2ZSI B;  1JJ8 C;  4Y17 A;  3F8N A;  1OCT C;  2WWY A;  2RDP A;  2XUB A;  4NB5 A;  3KZZ A;  3MKL A;  5HDK A;  1MD0 A;  3JRH A;  1E3H A;  3S1M J;  1ON1 A;  3Q0W A;  1HXD A;  1W7P A;  2DA4 A;  3S2D J;  2HS5 A;  2MYS A;  1A36 A;  4DBR A;  3BR0 A;  2LSO A;  3HM5 A;  1WHU A;  1R22 A;  4DOZ A;  2O8K A;  5F64 A;  2XSJ C;  3FM5 A;  3I59 B;  5DM6 F;  4F3Q A;  3OYK A;  3G71 I;  2VLA A;  5FLX K;  5HS9 A;  5JFR A;  3O6B B;  4C3H J;  2NVU B;  2ZFW A;  1OIS A;  3K1M A;  3I9V 2;  3LFU A;  5EYR A;  3WU0 A;  3LL7 A;  2KLO A;  1H88 C;  2VOO A;  2JRT A;  3WTW C;  1T98 A;  2Z9O A;  1BR1 A;  4MTD A;  4U88 A;  4WK8 F;  1WKM A;  1ORK A;  3FK7 A;  3HOX J;  4AM3 A;  1YS7 A;  4CDG A;  5GAD J;  2HEO A;  4Y52 J;  1MIJ A;  3SYT A;  3I4P A;  2OUM A;  4JK1 X;  3JRE A;  1X1B A;  2A6E F;  3I71 A;  4JOM A;  1CGP A;  4KJZ A;  4OAY A;  3BR6 A;  3DCF A;  4CCO A;  4LMY A;  3OY9 A;  2TRT A;  4IJA A;  1AOY A;  1W7P B;  3CZ6 A;  3F8B A;  4RGS A;  4OU0 A;  5CVR A;  4MIM A;  5K7H A;  1U2W A;  2O0Y A;  1T8I A;  2BYV E;  4M6X A;  2X1C A;  1NHA A;  1MSE C;  2NS8 A;  1Z67 A;  3FXR A;  3EUK L;  3ESW B;  3H5R A;  2CH0 A;  4XBF A;  2HZD A;  4LJZ F;  2Z33 A;  3N05 A;  1T33 A;  2MA3 A;  2M0M A;  4IVN A;  5FRM A;  4AIH A;  2QUF A;  2VOD A;  3QOD A;  4AID A;  3HKZ A;  4ZH4 F;  4ZTJ A;  3FKI J;  1MJA A;  2A6H F;  5F1J A;  4IKF A;  3M9A A;  2DMT A;  3AFH A;  1WI3 A;  2XIG A;  5JLW A;  5EEG A;  3H3U A;  2RKH A;  3K4J A;  3HPH A;  3RDI A;  1EKE A;  1VQ7 I;  3V7R A;  3CCV I;  2R7S A;  1YQA A;  2LTP A;  3KP5 A;  3HOZ J;  5JR3 A;  1RR7 A;  2VQC A;  2E2H J;  4FQG A;  5LRS A;  4J00 A;  3ABM H;  2UXN A;  2VUM J;  5CPR B;  4C2U A;  2ECC A;  3A0H C;  4CCK A;  4M3F A;  2COM A;  3RKW A;  2V1U A;  2XAJ A;  1SAN A;  4IPA A;  3BG9 A;  4JX6 A;  2ZCW A;  2CUE A;  3TL4 X;  1ZRE A;  2R7T A;  1Z6T A;  3S1Q J;  3K70 D;  1ETV A;  3DPT A;  3FKJ A;  3H0G J;  2HOE A;  2GBY A;  3VYT B;  5K1Y A;  2H1L A;  1DP7 P;  2FSW A;  2LP0 A;  5KVR A;  1FBS A;  5DUI A;  2HKX A;  4ESB A;  1STZ A;  4WF2 A;  1QZZ A;  3H5N A;  1LQ1 A;  3HRM A;  3HUG A;  2Y75 A;  2HOS A;  2DFH A;  2MGQ A;  1W36 C;  4AVZ A;  2VJ4 A;  2D5V A;  3DFG A;  3PNY A;  2F4O B;  3CCM I;  1FOX A;  3BR5 A;  4G94 A;  3BJ6 A;  2MSY A;  2IW5 A;  3S1R J;  4PJM A;  1FT9 A;  5DV5 A;  2K02 A;  2KRC A;  2VQG A;  1JHH A;  2OTL I;  4P5O A;  4D9J A;  2IPQ X;  2L3D A;  2F4M B;  4CXF A;  1F4K A;  3OOU A;  4UHT A;  2HYF A;  2JSC A;  2HDD A;  3GZ5 A;  2BW3 B;  3QWL A;  3CJQ B;  3FX3 A;  2XGD A;  3TDU C;  3IV5 A;  1DQU A;  1TC3 C;  2B9S A;  1T56 A;  1RKW A;  3C2H A;  4D7N A;  3F3X A;  4KUM A;  2NVT J;  2H09 A;  1X4O A;  2I8D A;  4KT5 C;  2HU9 A;  4M72 A;  1JJ6 C;  2O6G E;  1BC8 C;  1PVE A;  2F2E A;  3IAS 2;  2L02 A;  3HUG B;  4G12 A;  4C3J J;  2Y9Z A;  1R00 A;  5D4S A;  4PFO A;  2ACJ A;  4ABZ A;  2DA7 A;  2X4H A;  1EA3 A;  3IH3 A;  1KQ9 A;  3IC7 A;  5F27 A;  1FOY A;  1SFE A;  2P7V B;  4OIP F;  2DQL A;  1ZRD A;  1SAX A;  4IX7 A;  3TP3 A;  4IOC F;  2CQQ A;  2TDX A;  2O7O A;  2L5Q A;  3VYS B;  2DT6 A;  3RTR A;  5EEA A;  5KCM A;  5F04 A;  3CCQ I;  2BY1 A;  3S15 J;  1YIT I;  1XSV A;  3ISP A;  3OV8 A;  2Y30 A;  3GTQ J;  1XDS A;  4BY7 J;  1D8J A;  4NDL A;  3EYY A;  3C7J A;  2ZB9 A;  2WV0 A;  3OSF A;  1UST A;  2E34 A;  2NRA C;  2RRE A;  5FLM J;  2KJC A;  4E7J A;  4I6Z A;  4XLE A;  5LEJ A;  3HHG A;  4Y4R A;  1ZRC A;  1FOK A;  1V55 H;  3MD2 A;  1YE9 A;  2BXZ A;  3NAU A;  2EFQ A;  4YRV A;  3I55 I;  1RKT A;  4EJU A;  4BY1 J;  1NK3 P;  4LIV A;  5J8F A;  3RJP A;  1T6S A;  3CTA A;  1FP1 D;  2H8W A;  4XLC A;  2R7U A;  2L7M P;  3SQN A;  4P1W A;  2WY7 Q;  3BDD A;  1PP7 U;  2CYY A;  3NQO A;  4OOI A;  4CSW A;  1FX7 A;  1RET A;  1FTZ A;  2V6E A;  4A5N A;  2GWR A;  2K9S A;  1XTA A;  2F48 A;  4MEY F;  2K9N A;  2DJN A;  1AA7 A;  3ZN1 A;  2VPL A;  3TBI A;  1O4X A;  3GYH X;  2O8X A;  2CQN A;  1X19 A;  3FXM A;  4XLP F;  3A2K A;  4PCQ A;  4CCM A;  4E7I A;  3IAM 2;  1K4S A;  1FEX A;  2Z3Y A;  4Y3O A;  4A3J J;  5KAF C;  5F0H A;  1V5E A;  2VT3 A;  2AO9 A;  1O7L A;  2GOM A;  2RAE A;  2IGO A;  4EGY A;  1HDD C;  2WAF A;  1HQC A;  3KEO A;  3DF8 A;  3I64 A;  4EGZ A;  3H9G A;  2VOP A;  2BXY A;  1E3O C;  2W4S A;  4PJN A;  5EG0 B;  4G7H F;  2EFW A;  3T0Y A;  1WJD A;  1OCZ H;  2CMP A;  4CYC A;  3CUQ A;  3E0J B;  3QPT A;  4IZZ A;  3GTK J;  2V7F A;  5HOD A;  3RQI A;  3F6V A;  4UXN A;  2ISY A;  3WTT C;  5LD2 C;  2V4J C;  3CO7 C;  4HDV A;  4HX4 A;  3GFL A;  1U78 A;  2Z99 A;  5LHI A;  2HQR A;  3HJE A;  1AWC A;  5CVI A;  4HBL A;  3OYA A;  2E2I J;  2JA6 J;  2DI3 A;  1ACI A;  2QKL B;  2HDW A;  3LSI A;  2ADU A;  1Z21 A;  1VND A;  3AAF A;  3DKX A;  3BG7 A;  2EZK A;  1S8N A;  3LMM A;  3KIO A;  3HGY A;  1ETY A;  1YW7 A;  2B63 J;  1BOB A;  4HW0 A;  4MEX F;  2XRL A;  2F5V A;  2RGV A;  5H20 A;  1O3T A;  5L3E A;  2ISZ A;  1ZYR F;  2LNB A;  1J7K A;  3ERE D;  3DWL E;  3R0A A;  4H0E A;  2K4B A;  3FXO A;  1QPI A;  3ZMV A;  2EZH A;  2MLG A;  3GVA A;  4NC8 A;  1LEA A;  2E36 A;  4GYG A;  4CYC B;  2X6X A;  2EK5 A;  2O3F A;  2CSO A;  2ZME A;  2HQ5 A;  4IQJ A;  2BHZ A;  3GX4 X;  1Z7L A;  2DU9 A;  2QEX I;  2LVS A;  2EB7 A;  1BOA A;  3K4K A;  1R1U A;  2RC4 A;  2A5Y B;  2PMZ A;  5FRN A;  2GA2 A;  4GRI A;  3BT9 A;  3RZO J;  2BVL A;  4RAY A;  5JLX A;  2KIF A;  3TED A;  3ZQH A;  1VQM I;  4KNY A;  2IS2 A;  3K0L A;  4WXD A;  1LNW A;  4CCJ A;  4RB0 A;  2FBH A;  2Y48 A;  3FBN B;  2EIM H;  3OS2 A;  2ZNY A;  1A6I A;  3QPH A;  4JX4 A;  2M0C A;  2LC2 A;  5JVG F;  3MMY B;  3RKX A;  3SDB A;  2CG4 A;  2EIN H;  3E5Q A;  1HSJ A;  1S5L C;  3HZJ A;  3WTV C;  3F9K A;  4DGW B;  1ZAR A;  3AG2 H;  3HIF A;  3PFI A;  4CCN A;  4B43 A;  3IKT A;  3J80 Z;  1NG7 A;  3KEQ A;  3JRD A;  3OMY A;  3C18 A;  3ZCO A;  5E3L A;  4C30 A;  2LG4 A;  2Y0S N;  1X3W B;  3HRU A;  2MD0 A;  1SFU A;  4RS8 A;  5EF6 A;  2KL4 A;  1Y8Q B;  3BZC A;  3DKW A;  2LY1 A;  1P7J A;  5B5E C;  1TWF J;  3FM3 A;  4PFP A;  2KRF A;  5KAI C;  1JUP A;  1D0Y A;  1VQO I;  1KYW A;  1S72 I;  4OIO F;  4DIQ A;  2E1M B;  4LLN A;  3ML6 A;  1OCO H;  1TNS A;  4HX7 A;  4WCG A;  1I6H J;  2DMP A;  2A6T A;  5GAG J;  4PUS A;  2ME6 A;  4I01 A;  2VQL A;  5LBQ A;  4TV7 A;  1BJA A;  1FJL A;  1MBF A;  1B72 A;  4HF1 A;  1BIA A;  4L0Z B;  2H94 A;  3S1N J;  4W1U A;  4UVA A;  3GF2 A;  2YUS A;  1GT0 C;  3S93 A;  2KIM A;  1W5C C;  4M9S A;  2X1D A;  1E17 A;  3S32 A;  3ECO A;  3JRA A;  3GWZ A;  1HCR A;  2VBW A;  1WJ5 A;  3L7W A;  4RGU A;  2CFX A;  2HYJ A;  4WXC A;  1SD4 A;  5HDG A;  2X6W A;  1R4M B;  1VFC A;  1P9Q C;  4RGX A;  3ABL H;  3L2W A;  3A1Y A;  2W84 A;  2P5K A;  2K4J A;  2WC2 A;  3UR3 C;  3HGG A;  3QAH A;  4DW6 A;  2XB0 X;  2M3A A;  1SVM A;  3TP0 A;  5DUK A;  5M5W J;  3BPV A;  3FWE A;  1YX5 A;  2IAI A;  3QOP A;  4R1H A;  2HKO A;  4DQ2 A;  1XGS A;  1ETQ A;  4X0G A;  1EF4 A;  3E3V A;  4RM2 A;  1SC7 A;  2R7X A;  5F6F A;  3L2Q A;  2X6Y A;  2MAB A;  2ELK A;  1OFC X;  4RM3 A;  2VE9 A;  1TT5 B;  3QOE A;  2PI0 A;  1FMW A;  1ITY A;  3EUA A;  4GDF A;  3F22 A;  4EJO A;  2JUC A;  2H1K A;  1XCV A;  4S04 A;  1X4P A;  4MO7 A;  1BL0 A;  1SMT A;  1WJC A;  3LSG A;  1SEU A;  3OYF A;  2FEZ A;  2YSR A;  2VJJ A;  1R71 A;  3HC7 A;  3WE3 A;  5GPA A;  1KU3 A;  3C2G A;  2DDB A;  2CV0 A;  5KK1 A;  3BTL A;  4Q4Z F;  4M73 A;  3CUO A;  3JSP A;  4I7H A;  1YJW I;  5CKT A;  2E7X A;  3HOY J;  1JKR C;  3I3L A;  4XKB A;  4XL9 A;  3HKZ N;  2VT2 A;  2GXB A;  5A2Q K;  4UUS A;  2V9K A;  5H6Q A;  4FE7 A;  4II2 A;  3SZG A;  1QRY A;  4IHT A;  3CUQ C;  4L9N A;  2HTJ A;  2IT0 A;  2DYS H;  2DQR A;  3LNQ A;  3HB9 A;  1OLT A;  5LRR A;  4JQF A;  4LGW A;  3HOT A;  3KZI C;  1KU7 A;  1JGG A;  3F8C A;  4ASN A;  2X9D A;  5D5U B;  3F0C A;  3ZR8 X;  4KN4 X;  4BEH A;  5HVQ C;  3IWZ A;  5FFX A;  2L4M A;  4I0B A;  5GAH J;  1TP4 A;  1IGN A;  1YYV A;  4PJJ A;  4N4N B;  2XF6 A;  1F5T A;  2P6S A;  5J6X A;  1MBE A;  1XMA A;  2FOW A;  3OYH A;  4A3C J;  4UUT A;  5C4X J;  2FML A;  2XAG A;  2KQR A;  4RAG A;  4XLF A;  3V4G A;  5D8K B;  1VQ4 I;  4OAZ A;  3IH2 A;  1R58 A;  3OIP A;  3LSP A;  2IS4 A;  2AS5 F;  3FIW A;  2LD5 A;  4U87 A;  2VI6 A;  3G3Z A;  2WA0 A;  2LF7 A;  3E6C C;  3H5A A;  4UUS B;  1IDZ A;  1P6R A;  5E3N A;  1P4A A;  2E2J J;  4B3X A;  2VBY A;  1IO2 A;  3L9F A;  4IXA A;  4MHG A;  1S3J A;  3KZY A;  2MC4 A;  3S3N A;  5TJJ A;  2F5E A;  2OD5 A;  4YII A;  3AG4 H;  3PM1 A;  4HEA 2;  2ZME C;  4A93 J;  1WJF A;  3U2R A;  1Q1V A;  2PMU A;  4BEH B;  3ZQG A;  1RRJ A;  2ZJP F;  5FKN A;  1QA6 A;  3CC7 I;  1VQP I;  3WG7 H;  1I1G A;  5EGO B;  4AU7 A;  2E1M C;  2KZG A;  2JZY A;  3ONQ A;  3PUB A;  5CVJ A;  4F52 A;  1EH6 A;  1GXQ A;  2QZ8 A;  3L00 A;  1SFX A;  2EIL H;  1TLH B;  2FJ1 A;  1T0F A;  3A01 A;  1U5T A;  1MMD A;  3OS0 A;  1EH8 A;  4RBO A;  1DDN A;  2R92 J;  2R7F A;  3B73 A;  3U1K A;  4LFU A;  2MW8 A;  1R49 A;  4CO8 A;  4FE4 A;  4M3E A;  1WVR A;  4ZZL A;  1DPR A;  3H9J A;  2KIS A;  1B6A A;  3EUH C;  2DDA A;  2EIJ H;  3CDI A;  4MQ9 F;  2HDC A;  4I98 B;  4KMF A;  1S29 A;  2CQX A;  3HSR A;  5K5R A;  5LGT A;  4XN3 A;  4XON A;  4KYW A;  2JA7 J;  2Y31 A;  4MQV A;  3VPR A;  2YPR A;  2L01 A;  1ON2 A;  1YIJ I;  5E20 A;  1YFH A;  1KQ0 A;  1MMN A;  1XG1 A;  4EJT A;  3F21 A;  3IH4 A;  1VI0 A;  2FQ4 A;  4FIS A;  4KIT B;  2E5N A;  2IGN A;  3I4N J;  3CLO A;  3ZQI A;  4PSW A;  1TNT A;  1UB9 A;  1YG2 A;  1U8R A;  2GA1 A;  1MBJ A;  3ZGK A;  4KMU X;  5F1R A;  2LDU A;  3FHZ A;  1UAA A;  3GBG A;  1YHQ I;  4EMS A;  2MD5 A;  2A68 F;  1YS6 A;  1OYW A;  4A6D A;  4NUB A;  1U5T B;  3OL4 A;  1MJB A;  1OJL A;  5LFA A;  4BKX A;  3G1O A;  3E7L A;  1KA8 A;  1IV8 A;  4G6D A;  1CF7 A;  5E8I A;  2XDV A;  2K85 A;  1YTY A;  2XAQ A;  4XIC A;  2JT1 A;  2WAE A;  3EET A;  1R7J A;  3TOB A;  1ZG1 A;  3GLL A;  4GO1 A;  1FBU A;  2H6C A;  2LRE A;  2O03 A;  3PQJ A;  2XRO A;  3S14 J;  4HLX A;  1ZGW A;  2Y0M A;  4U7B A;  3CES A;  3DEW A;  2OZU A;  3DXJ F;  3BR1 A;  3QYB A;  5FRO A;  4GYI A;  3G4S I;  4LLG F;  1I6X A;  3E1S A;  4RA2 A;  1K78 A;  1I1S A;  2IBD A;  4DZP A;  1HOM A;  4I2O A;  4CZC A;  5D6F A;  2HXI A;  3S16 J;  1IDY A;  1PUF B;  3S8P A;  1D5V A;  1D0Z A;  1JI8 A;  5DCF A;  3QPS A;  2COB A;  2ZXW H;  1G4D A;  2K86 A;  4DYQ A;  4HDU A;  3SZT A;  1T38 A;  3A03 A;  1RZ4 A;  2DMQ A;  1FZP B;  3ULQ B;  3K69 A;  1N75 A;  2WY8 Q;  3CMM A;  2STW A;  3VWB A;  3AG3 H;  3P7N A;  1CF7 B;  3S2H J;  1FYM A;  1Z7U A;  5DEQ A;  3ZQ7 A;  1ZAO A;  3IHU A;  2GZW A;  2XB5 A;  5BMZ A;  1BN5 A;  3GEZ A;  3CC4 I;  4A2U A;  2NVQ J;  2R7D A;  3MVP A;  4PJL A;  5M5Y J;  4RB1 A;  5ILV A;  4AUX A;  2DLL A;  3M4O J;  3WU1 B;  1YX3 A;  4BNC A;  3UNG C;  3BTC A;  3U9G A;  4KT6 A;  1K78 B;  1LFU P;  3BWG A;  3U21 A;  5LHG A;  4CGZ A;  4QIW N;  3FXQ A;  2QM3 A;  5IT3 A;  1QU3 A;  3ZQC A;  2PMH A;  4BHP A;  1XGO A;  4IRH A;  3OYN A;  3CMA I;  1W7P D;  2GXA A;  4BJ6 C;  2VJ5 A;  1K4T A;  1WH7 A;  2QYO A;  4UUV A;  4ON0 A;  4OWR B;  1O3Q A;  3FMS A;  4ITV A;  5DD8 A;  1O3S A;  3O8G A;  1FYK A;  2XAH A;  2NYX A;  1GVJ A;  1WJB A;  1X1D A;  1Y1V J;  2QSF X;  3LST A;  4L5J A;  3WTS C;  3HRT A;  5FKL A;  3W2W A;  2DJI A;  4MLO A;  4E7K A;  4GXO A;  3K4M A;  3R61 A;  2CO5 A;  1V5F A;  5ICG A;  1TQI A;  3M8E A;  2A5W A;  2RQP A;  4Y15 A;  2F5F A;  5HS7 A;  3L2R A;  1LDJ A;  4GCV A;  5ERI A;  2XAU A;  2QCO A;  2DFE A;  3PL8 A;  3CD6 I;  1QHH D;  4G7Z F;  3QU3 A;  3DLA A;  1JTX A;  2VPR A;  3GO5 A;  4LB5 A;  2Q8K A;  1MH3 A;  1OR7 A;  3S3M A;  4M9Z A;  1E3P A;  1IRX A;  1RNL A;  1QQI A;  4AIK A;  2IA1 A;  2XRN A;  5LGN A;  3OYB A;  2CU7 A;  4ZJZ A;  1D5Y A;  1KYZ A;  2PMZ N;  5CVU A;  1LKX A;  1WGX A;  2OA4 A;  1VF9 A;  3CDH A;  4XR6 A;  4IL6 C;  3FXK A;  1MZB A;  2P5V A;  4KA4 A;  5IP7 J;  2EFP A;  3J7A Y;  2WB1 A;  4PSX A;  4A3I J;  1R5H A;  3LSM A;  3NAR A;  3WTU C;  4HV6 A;  1BJZ A;  5J1R A;  1YW8 A;  1OYI A;  2Q1Z B;  2DT5 A;  1JTY A;  2VXD A;  1OYY A;  3P9I A;  1Y0U A;  3K4L A;  4DYR A;  1K61 A;  4EJV A;  2BZT A;  3CQZ J;  1T0F C;  1SAU A;  1U5T C;  2KHM A;  2ESH A;  2DOA A;  3G1M A;  4G6T B;  3AKZ A;  1Y39 A;  5IT9 Z;  4BUP A;  3RKY A;  1LUJ B;  3LSH A;  2ECB A;  1T2K A;  1D1B A;  2E60 A;  3D5S C;  1LFB A;  3D1N I;  1MMS A;  2K40 A;  1IRF A;  2KIU A;  4E7L A;  4A12 A;  5J1Y A;  1V54 H;  4HQM A;  3ROU A;  1SFO J;  2DA5 A;  3RZD J;  3VYR B;  4QSH A;  5E3O A;  2DPU A;  5ED4 A;  1Q1H A;  2Y69 H;  3D0S A;  4F55 A;  2YX4 A;  4V2G A;  5HLH A;  1POG A;  5CQE A;  1FTT A;  1R9T J;  5ICE A;  3CCE I;  5JHU A;  2DAO A;  4DNC A;  3DBL B;  1O57 A;  1TWC J;  1OCP A;  2J5O A;  1IXR C;  1XGM A;  2QVO A;  5DDG A;  1WWX A;  3W6K B;  1KQ8 A;  1TWA J;  1QGP A;  2X1E A;  3PQK A;  1U0J A;  3U1D A;  2X51 A;  3HEF A;  3VDX A;  2LYC A;  2L9S A;  3FZV A;  2P7C B;  1DPU A;  3K1P A;  4XLH A;  2DOF A;  4JBA A;  2ZC2 A;  2M4K A;  1ZHF A;  2ZBK A;  1U9N A;  3KLO A;  3LWF A;  2IJL A;  5BOX A;  1B8I A;  2QKM B;  1HW5 A;  2W82 A;  3L09 A;  2MC3 A;  4O5V A;  4DYC A;  2MBF A;  2L0K A;  3VEP A;  1Z6R A;  1N77 A;  3LAJ A;  4A0Y A;  2ZXI A;  2JA8 J;  2LKS A;  5HOO A;  2BBY A;  4KIS A;  2BY3 A;  4BBR J;  1YIO A;  5K7F A;  3CO6 C;  4AYB A;  1R5I D;  3CP8 A;  4L0Y B;  1F9N A;  4BXU A;  1TQP A;  2ELH A;  5JI6 A;  2ESN A;  2BEO A;  1V4R A;  3BG5 A;  1HDP A;  3H35 A;  3OOP A;  4IO9 F;  3WTZ A;  1IRZ A;  3OYM A;  3H9Q A;  4G6Q A;  4RDU A;  2AHQ A;  3CCJ I;  3WHC A;  3VFZ A;  2ZJQ F;  2J5P A;  1Y56 A;  3ZMZ A;  3BG6 A;  1PYV A;  3TW7 A;  1RES A;  1BR4 A;  2JTV A;  4EEF G;  4KIC A;  1E0E A;  1CQT A;  3F8F A;  3H3Z A;  1VQL I;  1ETK A;  2JUG A;  1LEB A;  2V79 A;  3DU5 A;  4A0X A;  1EJ9 A;  2LY2 A;  5F0C A;  2JA5 J;  1FIP A;  1KU2 A;  2A3S A;  5IPA A;  3NWS A;  1SD5 A;  2KP6 A;  2QQA A;  2KPM A;  5FJ8 J;  4A3B J;  4KN7 X;  3N97 A;  5IYD J;  5EZG A;  3LQR A;  3GZN B;  5DYM A;  4A3E J;  3OIQ A;  1LFP A;  4CUG A;  2E1C A;  1ZLJ A;  3G1L A;  4HX8 A;  4XRS G;  1J0R A;  4RLQ A;  1DUX C;  3K4N A;  4CYD A;  2HNH A;  3CMY A;  2CW7 A;  3RPU D;  2EWN A;  1W0U A;  5IP9 J;  4DZJ A;  1JKQ C;  2HWV A;  5CLS A;  2YU9 J;  1LPQ A;  2DA1 A;  2FNA A;  4BE0 A;  4EM0 B;  1W4M A;  3PNT A;  1FC3 A;  2LMD A;  4XQF A;  4IHS A;  2D2W A;  2FUG 2;  1JUM A;  5CYV A;  5D8L B;  2IVM A;  3FMQ A;  3J80 K;  3PSF A;  4M74 A;  3K70 C;  1OMI A;  3M1C A;  1A31 A;  3BY6 A;  3O8H A;  2V1X A;  1VTN C;  2EH3 A;  1A35 A;  1IAW A;  4BXF A;  3C2B A;  2M8E A;  2KFD A;  3FDY A;  1A04 A;  3DBH B;  3KFW X;  1B4A A;  3K2Z A;  1DP3 A;  2IGK A;  2M5W A;  2YU3 A;  4A0Z A;  1OR7 C;  3MZY A;  3I53 A;  2IEK A;  4IRG A;  2DCE A;  3HBL A;  3KP6 A;  4HLY A;  1Y8R B;  2DMN A;  5ICC A;  4ZDO A;  3B6C A;  2P8T A;  3IWF A;  1MW7 A;  3CUQ B;  4N0B A;  2XSD C;  4F91 B;  2AQF A;  2LFB A;  4XRF A;  4NC6 A;  2ELJ A;  4YEJ A;  1IW7 F;  3JRG A;  1VQ8 I;  2XGE A;  1IUY A;  1NG6 A;  5D5V B;  3BP8 A;  4CHU A;  2KDO A;  4GGG A;  4BHC A;  2VN2 A;  3FXU A;  1XGN A;  4XOR A;  2QQB A;  5B66 C;  1IG7 A;  5HS8 A;  3MKZ A;  1NH3 A;  4WX9 A;  1I3A A;  3DPL C;  4NQW A;  3K4B A;  4CZZ A;  3HHH A;  4K2E A;  1WPK A;  3K1N A;  2OPT A;  3JTH A;  4MTE A;  2GQQ A;  2R7W A;  2R93 J;  2ZFU A;  4Q48 A;  3SJM A;  2JPC A;  4UY8 I;  4L9T A;  3NRV A;  2M9H A;  3RYR A;  2IA0 A;  2AXL A;  4BGD A;  3HTU A;  5EJC A;  1MDM A;  2FQ3 A;  1X3Z B;  2K7L A;  4RLF A;  1C0W A;  2ID3 A;  2QBY A;  2L9V A;  5J1U A;  2IP2 A;  1BIB A;  2W57 A;  1XX5 A;  5KNL A;  2W1O A;  1LE8 A;  3EUH A;  4RAF A;  4OIR F;  1S7O A;  2NS7 A;  4OIQ F;  4QPQ A;  2OV7 A;  1MBG A;  1QO0 D;  2G7U A;  3Q3S A;  3SDG A;  3DTI A;  5HNH A;  2ZME B;  4BQN A;  3S2W A;  4CH7 A;  1JGS A;  1VQN I;  4IHY A;  2EZL A;  4RB2 C;  3V42 A;  5L3B A;  3V7S A;  1LJ9 A;  2VKH A;  2NNY A;  1MBH A;  2PBI A;  3ECH A;  1FMV A;  1FY7 A;  4NQW B;  4YFK F;  2XPV A;  1IRG A;  1EH7 A;  5IYB J;  4M6Y A;  1HKT A;  1XCB A;  2XV4 S;  5E1X A;  1PUE E;  4F7Z A;  3CC2 I;  5ICF A;  3RYP A;  3W6J B;  2EFO A;  3R0J A;  4BDZ A;  2QWW A;  2BVM A;  2PX9 A;  2BOL A;  2K9M A;  1R36 A;  1U8B A;  1HKQ A;  4ESJ A;  4A3M J;  1X1C A;  1SVL A;  3ABU A;  3HXL A;  1RPW A;  1R1T A;  2QBY B;  2ZXJ A;  1P2F A;  1HW1 A;  3UKG A;  3OYD A;  1ZH5 A;  3PFY A;  1LE8 B;  2P0W A;  1ZGJ A;  2L9R A;  2VQH A;  4C2T A;  4XLA A;  2CW0 F;  3GTL J;  1W5T A;  2VC1 A;  1TW3 A;  1JUS A;  1FNN A;  3KP7 A;  3QP6 A;  2M2E A;  3NWT A;  5GP9 A;  3KP2 A;  2WAQ A;  4B48 A;  1TTY A;  4GFB A;  2WAD A;  3S17 J;  3MQ0 A;  3K6G A;  3ZQF A;  4U0W A;  1ODD A;  3W2A A;  1OQY A;  1D1A A;  1XS9 A;  3W6V A;  3VSK A;  3PUF A;  2HOA A;  5LLQ A;  1JKO C;  3Q9V A;  2XHK A;  3M7G A;  1ETW A;  4KDP A;  1J09 A;  5H6R A;  4KFC A;  2KRH A;  2CQ7 A;  3BTJ A;  3B6A A;  2M34 A;  1W5S A;  4LD5 A;  1X2N A;  2P4W A;  3CDL A;  1VZ0 A;  3M3Y J;  2HYG D;  5FD5 A;  1B72 B;  3QYE A;  2F4I A;  3LSR A;  1W0T A;  2CFO A;  3QYF A;  5J47 A;  5FKM A;  3OWT A;  2P5L C;  4N4O B;  1DU0 A;  2L54 A;  3AL0 B;  3TO6 A;  1TWG J;  1WH5 A;  3BCA A;  1VQ6 I;  2Y2Z A;  1K7A A;  1ZGA A;  2NAZ A;  2HTS A;  3GFJ A;  3PNV A;  5C44 J;  3N4M A;  2DA2 A;  4M71 A;  4NHJ A;  3DBR B;  3HOW J;  2KJB A;  3RSN A;  1Z91 A;  3ZXS A;  5IY5 H;  1Y1W J;  3S3O A;  2UUZ A;  2LOO A;  4LIT A;  2R5Z A;  1YJN I;  3GUD A;  2IS6 A;  2L7K A;  2BHY A;  3P9C A;  1TW2 A;  2L7Z A;  4C2M J;  3BPX A;  1ZK8 A;  2GIV A;  1R23 A;  3T8T A;  1Z3Y A;  2Z1D A;  2EPF A;  5B1B H;  3BJO A;  1MBK A;  4BJ5 C;  2OJE D;  1HC8 A;  3GLX A;  1WCM J;  1A5J A;  4DJA A;  3GW2 A;  1ZR2 A;  1IN7 A;  1IXC A;  3Q0V A;  2RVC A;  2EV6 A;  4HAM A;  2A69 F;  1FWZ A;  5M3F J;  3HDD A;  1XSD A;  1I50 J;  2DOE A;  4QTR A;  2HPM A;  2LY9 A;  3BZK A;  3F72 A;  4QPO A;  2NNN A;  2F6C A;  4YEL A;  1ZR4 A;  4A3D J;  2FRH A;  2DT7 B;  3P5J A;  3BCB A;  4Z6Y A;  3CJN A;  2E71 A;  1T08 B;  2DYR H;  1YW9 A;  4FX4 A;  1ULY A;  2CV1 A;  1D3Y A;  3SEZ A;  3OYE A;  3HPG A;  1GHC A;  4O6J A;  4IHW A;  3C3W A;  5GTH C;  2VL8 A;  3J7Y J;  1QHG A;  2GAU A;  2YR2 A;  3BTI A;  1S7A A;  2WB1 N;  2A05 A;  1LDK B;  2BE5 F;  5TGT A;  3PIP F;  1V3F A;  1FBQ A;  1Z05 A;  2UV1 A;  3KPH A;  2LR8 A;  1WFX A;  5IOY A;  3T8R A;  3FMR A;  2VXZ A;  3GTP J;  2HGC A;  3F6O A;  4XLN F;  3B02 A;  5ILS A;  4S05 A;  4UV9 A;  4HA8 A;  2QGU A;  2XC7 A;  3BR2 A;  4A6E A;  4BS9 A;  1BW5 A;  1KZH A;  2L2O A;  5FB2 A;  2VC0 A;  2HQN A;  4M6V A;  2P6T A;  3OR2 C;  3DU6 A;  3QPL A;  4BQO A;  3KEY A;  1FIA A;  2JA2 A;  4L5I A;  1ZG3 A;  4PK4 A;  4XKV A;  1J5Y A;  5AIQ A;  3SZP A;  4PZJ A;  4FET A;  1APL C;  2F5C A;  1RR8 C;  1N78 A;  3KE2 A;  3E97 A;  2WV1 A;  1AHD P;  3LFK A;  2FNP A;  1BW6 A;  2DBB A;  3LOC A;  2EV5 A;  4MGR A;  5FGM A;  1H9T A;  1A6Q A;  2G7H A;  1DU6 A;  2R0Q C;  4ZYA A;  1QVT A;  1WJA A;  4I02 A;  1X2M A;  4ENN A;  1M1E B;  1J9I A;  3REO A;  4BQQ A;  2OZ6 A;  3R6S A;  2O9L A;  3BRO A;  3DTE A;  4ESF A;  4FTH A;  1BI1 A;  3HTS B;  3HOV J;  1F36 A;  2PLY A;  3ZN0 A;  4EQQ A;  3WGG A;  2BY0 A;  1W36 D;  4V19 K;  1PJR A;  3O2P E;  3ZMT A;  1F1Z A;  2CUZ A;  4N9I A;  4I99 C;  1U6G A;  5FD6 A;  1FYL A;  1Y0N A;  2MH2 A;  3ABT A;  4NBQ A;  2YX7 A;  1IZ1 A;  3RCO A;  3OYI A;  4B44 A;  2HZT A;  2JJ7 A;  2V1N A;  5EEH A;  5J4Y A;  4AIJ A;  3W2V A;  4BHB A;  2FXA A;  3A01 B;  1FOW A;  1YO5 C;  4PGG A;  4LOC A;  2V1D A;  1I3Q J;  1SFK A;  1JHF A;  4M3B A;  1S6L A;  4UB6 C;  1XB4 A;  3DTK A;  1P4W A;  3ZOB A;  4UVC A;  1BR2 A;  2D1H A;  3AL0 C;  3CCY A;  3LSJ A;  2JN6 A;  3G73 A;  3GFM A;  4XN0 A;  3ASO H;  4YFX F;  4UNO A;  2PJP A;  1G3W A;  4XOP A;  3I59 A;  4P55 A;  3IKV A;  4YG2 F;  3KX2 A;  4ENM A;  3V8K A;  2I5U A;  4U0V A;  1TZL A;  2UXX A;  1G6N A;  2AXT C;  2CQK A;  1FLI A;  2EJR A;  2K9L A;  3M8F A;  3OYJ A;  5GTI C;  2PG4 A;  2XGX A;  1SMY F;  1YJ9 I;  1XMK A;  3DKY A;  2G9W A;  3PO2 J;  2X48 A;  1ZKG A;  3LA7 A;  3O3K A;  1Z3X A;  4I09 A;  4EAT A;  2OBP A;  4BYY A;  3JAM K;  1XC5 A;  2R7Q A;  1J59 A;  4JP0 A;  2DN0 A;  3SXY A;  3VB2 A;  5ILU A;  1AKH A;  1Z9C A;  1KGS A;  2JPB A;  3TOA A;  3EQL F;  5HLI A;  5B3S H;  9ANT A;  2EIK H;  1MMG A;  4XSZ F;  4EJW A;  3KYC B;  4HSR A;  2R5Y A;  4ZTF A;  3IUO A;  5HLT A;  2PJR A;  3C1D A;  4AVP A;  1XMX A;  3V8J A;  1QNT A;  1YLF A;  2ICW G;  1UHM A;  1XN7 A;  4ZDL A;  4BE2 A;  1H9G A;  2E1O A;  2LKP A;  4LG0 A;  2EZI A;  2NS0 A;  2XGC A;  1FP2 A;  4MFD A;  5FO5 A;  3MZ8 A;  5BNG A;  5GAE J;  3L2V A;  4E6K G;  5L3G A;  2A61 A;  2R4G A;  2W85 A;  2E5Z A;  3TDZ C;  1USS A;  4PGH A;  4BXX J;  3E6B A;  4ZC3 A;  1K6O A;  2TCT A;  5DCM A;  4HF2 A;  2DA6 A;  5TIS C;  1U9O A;  2DO7 A;  1ZN2 A;  5JHF A;  2DPD A;  1ETO A;  4D5C A;  5IT9 K;  2HFH A;  4H4K C;  1AKH B;  4D7M A;  2V9P A;  2QQ8 A;  2MH9 A;  5F0F A;  1WI9 A;  3K2A A;  4E7H A;  2BGC A;  3I5U A;  3R4K A;  2OCE A;  4OIN F;  3K9T A;  2MG4 A;  3SEQ A;  4M9X A;  5LGU A;  2R5Y B;  2PJR B;  2CS3 A;  3GTG J;  3KET A;  1B9M A;  3G6E I;  4QWQ A;  1MJ9 A;  2GXG A;  2OQR A;  4IHV A;  2FX0 A;  2A07 F;  3WG9 A;  4JX5 A;  2ID6 A;  1QZE A;  3VYU B;  3CF5 F;  3JAM Z;  2DK5 A;  2VKV A;  4LG0 B;  1P7I A;  1ENH A;  3TO9 A;  2LH9 A;  2QA4 I;  2DTR A;  5M5X J;  2QSH X;  2PEX A;  2K3F A;  3H36 A;  1HW2 A;  3OL3 A;  2MLK A;  1G3T A;  4I0A A;  5DCM B;  1BBY A;  1I5Z A;  5AON A;  3KP4 A;  2I10 A;  1VQ5 I;  4HV5 A;  1S9H A;  3PSI A;  4BAY A;  3JCU C;  2XAS A;  5FKK A;  2PQ8 A;  2DXI A;  2OTJ I;  1RC9 A;  5FLX Z;  2BW3 A;  2X0L A;  2M7B A;  2KZV A;  2NVY J;  2M7A A;  3BQY A;  3Q0U A;  1FPQ A;  1QZY A;  2Y9Y A;  4HRI A;  3K4C A;  4AD9 A;  1VQK I;  1I27 A;  3FF5 A;  4XOT A;  4Q5S F;  2XPW A;  2GIZ A;  2W00 A;  4HQE A;  2YS9 A;  5E8G A;  3Q9S A;  4E7S A;  5GPC A;  3K7A J;  1YOV B;  4IQ4 A;  2LKX A;  5H2F C;  4ZZD A;  5K5O A;  1WJE A;  1PDN C;  3QU6 A;  2K9Q A;  2KDZ A;  2VKD A;  2RQQ A;  2STT A;  3CP2 A;  2E7W A;  4LLL A;  3L2U A;  4HG2 A;  1IF1 A;  4EV0 A;  3DPU A;  3AG1 H;  2FF4 A;  3DQV C;  1V5G A;  1R1V A;  3HOU J;  5E17 F;  3SFI A;  1NK2 P;  1GV2 A;  2NOJ B;  5L3F A;  2QSG X;  2LF8 A;  3ZP5 A;  4AC0 A;  4O3M A;  4A3F J;  1RI7 A;  2Z5U A;  3CME I;  3P9K A;  4RGR A;  1JE8 A;  3BLY A;  1BC7 C;  4G8X A;  1XPX A;  2VJI A;  4RMN A;  1LDD A;  1H0M A;  5K7Z A;  1NTC A;  2N8G A;  5TRD A;  4IF4 A;  1JT0 A;  1X1P A;  2JRM A;  2WAQ N;  2ZNZ A;  3T5X A;  3DEE A;  4YIF A;  2MFZ A;  1Z1D A;  4Y33 A;  2XAF A;  3ABK H;  2FOK A;  5JVT A;  4XMY A;  1UHS A;  2Z2S B;  3ASN H;  2E1N A;  4EM2 A;  4B09 A;  4JYK A;  2QEN A;  1FSE A;  3KYD B;  2DW4 A;  5FFZ A;  4R79 A;  3DLL F;  3X2Q H;  4G9Y A;  1IUF A;  4V2F A;  1K83 J;  5D6E A;  2QQ9 A;  4A3K J;  1IN4 A;  5J3L A;  2VBX A;  1ZQ3 P;  2DA3 A;  2O5R A;  2E19 A;  1QPM A;  3OIO A;  5J40 A;  2DOD A;  1RUO A;  5M3M J;  4LK1 F;  2AQE A;  2WBM A;  2HVQ A;  1TWH J;  1YRN A;  5AIP A;  4YFN F;  5J8C A;  3IL2 A;  2VE8 A;  4ANJ A;  1RIO H;  3GTO J;  3WHB A;  4FCY A;  3KLN A;  3IP4 B;  1MMA A;  3RPU A;  5EG0 A;  1S7E A;  4L9V A;  3NEU A;  1UFM A;  3TKY A;  2FBK A;  3ZMD A;  1B8I B;  4LK0 F;  4IHX A;  4Y7N J;  3TQN A;  3M1E A;  1XDU A;  1HBX G;  2JVH A;  5HNF A;  4U0Y A;  2W48 A;  3WGH A;  5BPD A;  1GDT A;  1P92 A;  3OYC A;  2FE3 A;  2CRG A;  3M8J A;  2NVX J;  1BI0 A;  1F43 A;  3WU2 C;  4YIR X;  1UG2 A;  3GZ6 A;  1I39 A;  4F92 B;  4B47 A;  4C3I J;  2IGM A;  5B1A H;  5EDN A;  4BQA A;  4ZDP A;  2VKE A;  1MSF C;  1MKM A;  3OYG A;  3BJA A;  3ELK A;  4FX0 A;  4CIC A;  1YRN B;  1LVK A;  2JMW A;  3OYL A;  2H27 A;  2CV2 A;  1JT6 A;  1D0X A;  1JKP C;  3SFZ A;  3WGI A;  4B1R A;  4OMZ A;  1VQ9 I;  2HOT A;  4BU2 A;  4NC7 A;  4EVI A;  1GXP A;  3JRI A;  4II3 A;  2JVG A;  2VB6 A;  4XSX F;  1H8A C;  2CUF A;  2PFB A;  4A5M A;  1WRJ A;  4D1Q A;  1DGR M;  3CLQ A;  3Q5F A;  3RI4 A;  2FMY A;  2W24 A;  2HQA A;  1L0O C;  2JK3 A;  3MZH A;  3BR3 A;  2M87 A;  2D45 A;  1O7F A;  2JSP A;  4FT8 A;  1TQM A;  3FXJ A;  5HLG A;  2W7N A;  2OC6 A;  3GTJ J;  3LAP A;  2XKO A;  2R7R A;  3E6M A;  4ZYD A;  3H1C A;  5D5W B;  2R3S A;  1BM9 A;  2X85 A;  2X6O A;  3ZQL A;  2VAS A;  3J7Z I;  4CCL A;  5DTD A;  2Q0O A;  3L1P A;  5F08 A;  1X58 A;  5E79 C;  2B7E A;  1TT0 A;  6PAX A;  3ZRG A;  2HPI A;  4B8X A;  2M45 A;  4P96 A;  4E4H A;  4A3L J;  2EV0 A;  1DGW Y;  4WXH A;  3A0B C;  2RV8 A;  3T1B A;  2FD5 A;  2IXS A;  2HXO A;  1UG0 A;  3JRF A;  1SVO A;  3JSO A;  2CJJ A;  3J7A O;  4MNU A;  2R7O A;  2D1V A;  3FK6 A;  1IN5 A;  2DFI A;  2B0L A;  5HDN A;  1WQ2 A;  4D5F A;  3G2B A;  5DD4 A;  1ETX A;  3HSF A;  4RAZ A;  2E35 A;  2GLO A;  4OMY A;  3A02 A;  3K10 A;  4MFE A;  3FBI B;  1UMQ A;  3LQQ A;  3GXO A;  1U3E M;  4QLC U;  1QVU A;  1B9N A;  2QF7 A;  5CVV A;  2H8R A;  3HG9 A;  1ZLK A;  2HI3 A;  4KIF A;  4HNV A;  3H3V K;  5CJ9 A;  1OKR A;  2UZK A;  2R7V A;  2FBI A;  4PDK A;  1KON A;  5DM7 F;  5E1Z B;  4B3A A;  3OS1 A;  2DMU A;  1ZG5 A;  1X3U A;  4BAC A;  3IRQ A;  1ONV A;  4XRM A;  1P4X A;  1SD7 A;  3MKY B;  1T39 A;  2HVR A;  3PO3 J;  2V26 A;  2K5C A;  2Z16 A;  2OU2 A;  3D5L A;  3IRR A;  3VOE A;  5BQT A;  4HOB A;  1PP8 F;  1UZC A;  3JW4 A;  4HZF A;  2EQR A;  2ZXH A;  5IOZ A;  5LEK A;  1UEL B;  2BY2 A;  2Q2E A;  3CF2 A;  1MDM B;  1H89 C;  3EPZ A;  3WTX C;  2KKO A;  4X1E A;  4A3G J;  2NXN B;  3H0D A;  4D0P A;  2OCC H;  3JRC A;  1IV6 A;  1ZTR A;  4ENK A;  3WOD F;  2RNG A;  2ZKZ A;  4G7O F;  5DS9 A;  4PJ0 C;  2UWM A;  2OF7 A;  3EDP A;  4FHT A;  4KIG A;  1G3S A;  4HPQ A;  1YI2 I;  2OQG A;  4J01 A;  2HVS A;  3A4C A;  2GOX B;  1G2H A;  4F93 B;  4IRI A;  3MN2 A;  3LA2 A;  5J4V A;  2XKP A;  3RQ4 A;  3CJR B;  4L18 B;  3KYL A;  3H92 A;  3HSE A;  4AWX B;  4BDY A;  2CW8 A;  3E5X A;  3CCL I;  4HF0 A;  1IN6 A;  4L5E A;  4FAS D;  4BL0 B;  4E7Z A;  2LRD A;  2V6C A;  1JXS A;  3ZMS A;  1MNE A;  3TW6 A;  5BPI A;  3ZMU A;  2JWT A;  1WZ2 A;  2Q2E B;  4ETS A;  3E5U A;  1AU7 A;  1IN8 A;  1IJW C;  4XKW A;  3QQA A;  4ZYG A;  1HST A;  2RN7 A;  2R7Z J;  2CWE A;  3WE2 A;  2VIX A;  1R6R A;  4J19 A;  4P9F A;  3F8M A;  3KP3 A;  1T95 A;  3GFI A;  2W25 A;  2XF7 A;  1W1W E;  2OAZ A;  3D5R C;  2M1B A;  3BG3 A;  4I76 A;  3HL2 A;  4WWC A;  4Q47 A;  3LSK A;  5C4J J;  2M4G A;  1REP C;  3MCZ A;  2DFF A;  1MGT A;  5IYC J;  2ZJR F;  2CUJ A;  4S0H B;  3BC8 A;  4W97 A;  4U7D A;  1G59 A;  1B1B A;  3MKW B;  2BV6 A;  4XKC A;  3HRS A;  2WTE A;  1GLN A;  1J75 A;  3CCU I;  1OPC A;  1R5G A;  3W3C A;  1UCR A;  5E1W A;  3GTM J;  1B59 A;  3FIS A;  2C6Y A;  1K79 A;  3ZPL A;  1FSH A;  1ZRF A;  4XK4 A;  4UB8 C;  4BE1 A;  3V7C A;  3CCS I;  3ERM A;  1LB2 A;  3L2C A;  1K6Y A;  3MEX A;  1E2X A;  4HNT A;  1J2X A;  2ZSH B;  3LA3 A;  3MWM A;  1Z0X A;  4KIB A;  1OCR H;  4LB6 B;  4BH9 A;  2ZO4 A;  4XID A;  3J81 K;  1XSX A;  1TL8 A;  2M30 A;  1GVD A;  1HA8 A;  3QRF F;  3CJT B;  5EZH A;  3RIR A;  3VOD A;  1D8K A;  3R60 A;  3KCC A;  4UVB A;  2R5Z B;  2ME0 A;  1BI3 A;  2NOG A;  3MAJ A;  5CQG A;  3COA C;  3ZQQ A;  5EGO A;  1L3L A;  2JQ7 A;  1EV7 A;  1X1A A;  2XPU A;  3DV8 A;  1QBJ A;  1MND A;  4Y13 A;  2O61 A;  4BBS J;  1G8X A;  3OSG A;  5KHD A;  5E18 F;  1O3R A;  2QLZ A;  4DBQ A;  1IXS B;  1UHW A;  1RUN A;  2LLK A;  1WSU A;  4A69 C;  3I4M J;  4P9U A;  2FU4 A;  3PJR A;  2IA2 A;  2PN6 A;  1R4N B;  3DP7 A;  3V8L A;  5C3E J;  3EYI A;  4C9Y A;  3JR9 A;  1HF0 A;  5FLV A;  4ZYE A;  1SD6 A;  4LG3 A;  4NNJ A;  2IRF G;  5E3M A;  4IEJ A;  4LIU A;  2GM4 A;  1Y6I A;  2M8G X;  3HYI A;  2H6B A;  1ZEL A;  1XD7 A;  2K3P A;  3PIO F;  1G3Y A;  2EFN A;  5L3C A;  3FXL A;  2G0E A;  2F5D A;  2XF5 A;  4Z2Y A;  4RB3 C;  2K27 A;  2LBF A;  1HKS A;  4XM3 A;  5BS6 A;  4E70 A;  5K5Q A;  5FKO A;  2ZJ2 A;  2RNJ A;  4X6A J;  4EM1 A;  1D1C A;  5A2Q Z;  3QP5 A;  4M3G A;  4BJT A;  3J81 Z;  3VSL A;  3RPQ A;  2L9N A;  4HNU A;  3JTG A;  2EA4 A;  5D5X B;  2DK8 A;  3M07 A;  2VBZ A;  3GCM A;  2IS1 A;  3TO7 A;  3BQZ A;  3I0T A;  1GV5 A;  1OCC H;  3CCR I;  1BA5 A;  2FA5 A;  2L7F P;  2KIQ A;  2KT0 A;  3SHF A;  3I56 I;  1TBX A;  2KMU A;  3JRB A;  3TGN A; 
#chains in the Genus database with same CATH homology
 3WTY C;  2EA2 A;  1BI2 A;  2V9V A;  2ETH A;  2CGP A;  4UV8 A;  3F23 A;  2VON A;  3MFK A;  5LHH A;  4N9H A;  5D4R A;  3BOQ A;  2L4A A;  1KU9 A;  4HYE A;  3I54 A;  4ENJ A;  5L3D A;  3I58 A;  3DEU A;  4L9J A;  1LVA A;  4ZYH A;  2HR3 A;  2XVC A;  4R8H A;  3BZ6 A;  3E6D A;  3HOS A;  4Y17 A;  3F8N A;  2WWY A;  2RDP A;  2XUB A;  4NB5 A;  3KZZ A;  5HDK A;  1MD0 A;  1ON1 A;  1HXD A;  1W7P A;  2HS5 A;  2LSO A;  1R22 A;  5F64 A;  3FM5 A;  3I59 B;  5FLX K;  5HS9 A;  5JFR A;  3O6B B;  2ZFW A;  3K1M A;  3WU0 A;  2VOO A;  2JRT A;  3WTW C;  1T98 A;  2Z9O A;  4MTD A;  4U88 A;  4WK8 F;  1WKM A;  1YS7 A;  4CDG A;  2HEO A;  3I4P A;  4JK1 X;  2A6E F;  1CGP A;  3I71 A;  4LMY A;  4IJA A;  1AOY A;  1W7P B;  3F8B A;  4RGS A;  4OU0 A;  5CVR A;  1U2W A;  2O0Y A;  2BYV E;  4M6X A;  1NHA A;  3FXR A;  4XBF A;  4LJZ F;  2Z33 A;  2MA3 A;  4IVN A;  4AIH A;  2QUF A;  2VOD A;  4ZH4 F;  1MJA A;  2A6H F;  3M9A A;  2XIG A;  5EEG A;  3H3U A;  2RKH A;  3RDI A;  3V7R A;  1YQA A;  3KP5 A;  5JR3 A;  5LRS A;  2UXN A;  2COM A;  3RKW A;  2V1U A;  2XAJ A;  4IPA A;  2ZCW A;  1ZRE A;  1Z6T A;  3DPT A;  2HOE A;  5K1Y A;  1DP7 P;  2FSW A;  5KVR A;  5DUI A;  1FBS A;  2HKX A;  4ESB A;  1STZ A;  4WF2 A;  1QZZ A;  1LQ1 A;  3HRM A;  3HUG A;  2Y75 A;  3DFG A;  4G94 A;  3BJ6 A;  2IW5 A;  1FT9 A;  5DV5 A;  2K02 A;  1JHH A;  4P5O A;  4CXF A;  2IPQ X;  2L3D A;  1F4K A;  4UHT A;  2HYF A;  2JSC A;  3GZ5 A;  3FX3 A;  3TDU C;  3F3X A;  4KUM A;  2H09 A;  4KT5 C;  4M72 A;  2O6G E;  1BC8 C;  2F2E A;  2L02 A;  1R00 A;  5D4S A;  2ACJ A;  2X4H A;  1KQ9 A;  3IC7 A;  1SFE A;  2P7V B;  4OIP F;  2DQL A;  1ZRD A;  1SAX A;  2TDX A;  3RTR A;  1XSV A;  3ISP A;  3OV8 A;  1XDS A;  1D8J A;  3EYY A;  3C7J A;  2WV0 A;  1UST A;  2NRA C;  2KJC A;  5LEJ A;  3HHG A;  1ZRC A;  1FOK A;  2EFQ A;  4EJU A;  5J8F A;  3RJP A;  1T6S A;  3CTA A;  1FP1 D;  3SQN A;  3BDD A;  1PP7 U;  2CYY A;  3NQO A;  4OOI A;  1FX7 A;  4A5N A;  2GWR A;  4MEY F;  3ZN1 A;  3GYH X;  2O8X A;  4XLP F;  4PCQ A;  2Z3Y A;  2VT3 A;  1O7L A;  4EGY A;  1HQC A;  3KEO A;  3DF8 A;  3I64 A;  4EGZ A;  2VOP A;  4G7H F;  2EFW A;  3T0Y A;  3CUQ A;  3QPT A;  3F6V A;  4UXN A;  2ISY A;  3WTT C;  3CO7 C;  4HDV A;  4HX4 A;  3GFL A;  1U78 A;  2Z99 A;  5LHI A;  2HQR A;  1AWC A;  5CVI A;  4HBL A;  2DI3 A;  2ADU A;  3AAF A;  1S8N A;  1YW7 A;  4HW0 A;  4MEX F;  2RGV A;  5H20 A;  1O3T A;  5L3E A;  2ISZ A;  1ZYR F;  2LNB A;  1J7K A;  3ERE D;  3R0A A;  4H0E A;  2K4B A;  3ZMV A;  2MLG A;  3GVA A;  1LEA A;  4GYG A;  2EK5 A;  2O3F A;  2CSO A;  2ZME A;  3GX4 X;  2DU9 A;  2EB7 A;  1BOA A;  1R1U A;  2RC4 A;  2A5Y B;  2GA2 A;  4RAY A;  2KIF A;  4KNY A;  3K0L A;  4WXD A;  1LNW A;  4RB0 A;  2FBH A;  2Y48 A;  2ZNY A;  3QPH A;  3RKX A;  2CG4 A;  3E5Q A;  1HSJ A;  3WTV C;  1ZAR A;  3HIF A;  3PFI A;  3IKT A;  3J80 Z;  3KEQ A;  3C18 A;  3HRU A;  1SFU A;  4RS8 A;  3DKW A;  3FM3 A;  2KRF A;  1KYW A;  4OIO F;  4LLN A;  3ML6 A;  1TNS A;  4HX7 A;  4WCG A;  4I01 A;  5LBQ A;  4TV7 A;  1BJA A;  4HF1 A;  1BIA A;  4L0Z B;  2H94 A;  4UVA A;  3GF2 A;  2KIM A;  4M9S A;  1E17 A;  3ECO A;  3GWZ A;  2VBW A;  3L7W A;  4RGU A;  2CFX A;  4WXC A;  1SD4 A;  5HDG A;  4RGX A;  2W84 A;  2P5K A;  2K4J A;  2WC2 A;  3QAH A;  5DUK A;  3BPV A;  3FWE A;  4R1H A;  3QOP A;  2HKO A;  4DQ2 A;  1XGS A;  3E3V A;  5F6F A;  2VE9 A;  2PI0 A;  3F22 A;  4EJO A;  1XCV A;  4S04 A;  1SMT A;  2FEZ A;  2YSR A;  3WE3 A;  1KU3 A;  5KK1 A;  4Q4Z F;  4M73 A;  3CUO A;  3JSP A;  4I7H A;  2E7X A;  2VT2 A;  2GXB A;  5A2Q K;  5H6Q A;  4IHT A;  3CUQ C;  4L9N A;  2HTJ A;  2IT0 A;  2DQR A;  5LRR A;  4JQF A;  4LGW A;  3HOT A;  1KU7 A;  3F8C A;  4ASN A;  5D5U B;  4KN4 X;  5HVQ C;  3IWZ A;  5FFX A;  2L4M A;  4I0B A;  1YYV A;  1F5T A;  2P6S A;  5J6X A;  1XMA A;  2FML A;  2XAG A;  3V4G A;  5D8K B;  1R58 A;  2AS5 F;  3G3Z A;  2LF7 A;  3E6C C;  1P6R A;  1P4A A;  2VBY A;  3L9F A;  4IXA A;  4MHG A;  1S3J A;  3KZY A;  5TJJ A;  2F5E A;  2OD5 A;  4YII A;  3U2R A;  2PMU A;  1I1G A;  2JZY A;  5CVJ A;  1EH6 A;  1GXQ A;  2QZ8 A;  3L00 A;  1SFX A;  1TLH B;  1T0F A;  1U5T A;  1EH8 A;  1DDN A;  2R7F A;  3B73 A;  4LFU A;  4CO8 A;  4ZZL A;  1DPR A;  1B6A A;  4MQ9 F;  2HDC A;  4I98 B;  4KMF A;  1S29 A;  3HSR A;  5K5R A;  5LGT A;  4KYW A;  4MQV A;  2YPR A;  2L01 A;  1ON2 A;  5E20 A;  1YFH A;  1KQ0 A;  4EJT A;  3F21 A;  3CLO A;  1TNT A;  1UB9 A;  1YG2 A;  1U8R A;  2GA1 A;  5F1R A;  4KMU X;  2LDU A;  3FHZ A;  4EMS A;  2MD5 A;  2A68 F;  1YS6 A;  1OYW A;  4A6D A;  1U5T B;  1MJB A;  1KA8 A;  4G6D A;  1CF7 A;  5E8I A;  1YTY A;  2XAQ A;  2JT1 A;  3EET A;  1R7J A;  3TOB A;  1ZG1 A;  4GO1 A;  1FBU A;  2H6C A;  2O03 A;  2XRO A;  3PQJ A;  4HLX A;  2Y0M A;  4U7B A;  2OZU A;  3DXJ F;  4GYI A;  4LLG F;  1I6X A;  1K78 A;  1I1S A;  4I2O A;  5D6F A;  1D5V A;  5DCF A;  1G4D A;  2K86 A;  4HDU A;  3SZT A;  1T38 A;  1RZ4 A;  1FZP B;  3ULQ B;  3K69 A;  2STW A;  3P7N A;  1CF7 B;  1FYM A;  1Z7U A;  5DEQ A;  3ZQ7 A;  1ZAO A;  3IHU A;  2GZW A;  5BMZ A;  1BN5 A;  3GEZ A;  4A2U A;  2R7D A;  4RB1 A;  5ILV A;  2DLL A;  3WU1 B;  4BNC A;  3U9G A;  1K78 B;  4CGZ A;  3BWG A;  5LHG A;  3FXQ A;  2QM3 A;  5IT3 A;  2PMH A;  4BHP A;  1XGO A;  4IRH A;  1W7P D;  2QYO A;  4UUV A;  4ON0 A;  1O3Q A;  3FMS A;  5DD8 A;  1O3S A;  1FYK A;  2NYX A;  1GVJ A;  2XAH A;  4L5J A;  3WTS C;  3LST A;  3HRT A;  4GXO A;  3R61 A;  2CO5 A;  5ICG A;  1TQI A;  3M8E A;  2RQP A;  4Y15 A;  2F5F A;  5HS7 A;  1LDJ A;  4GCV A;  5ERI A;  4G7Z F;  3QU3 A;  3GO5 A;  4LB5 A;  2Q8K A;  1OR7 A;  4M9Z A;  1RNL A;  1QQI A;  4AIK A;  2IA1 A;  2XRN A;  5LGN A;  1KYZ A;  5CVU A;  2OA4 A;  3CDH A;  1MZB A;  2P5V A;  4KA4 A;  2EFP A;  1R5H A;  3WTU C;  4HV6 A;  1YW8 A;  1OYI A;  2DT5 A;  3P9I A;  1OYY A;  1Y0U A;  4EJV A;  1U5T C;  2ESH A;  5IT9 Z;  3RKY A;  1T2K A;  1IRF A;  2KIU A;  4A12 A;  4HQM A;  3ROU A;  2DPU A;  5ED4 A;  1Q1H A;  3D0S A;  2YX4 A;  5HLH A;  5ICE A;  5JHU A;  2DAO A;  4DNC A;  1O57 A;  2J5O A;  1IXR C;  1XGM A;  5DDG A;  2QVO A;  1WWX A;  3W6K B;  1KQ8 A;  1QGP A;  3PQK A;  3U1D A;  3FZV A;  2P7C B;  1DPU A;  3K1P A;  4JBA A;  1ZHF A;  2ZBK A;  3KLO A;  3LWF A;  2IJL A;  5BOX A;  1HW5 A;  3L09 A;  2MC3 A;  4O5V A;  2MBF A;  3VEP A;  1Z6R A;  3LAJ A;  4A0Y A;  5HOO A;  2BBY A;  1YIO A;  3CO6 C;  4L0Y B;  1F9N A;  4BXU A;  1TQP A;  2ELH A;  5JI6 A;  2ESN A;  2BEO A;  1V4R A;  3OOP A;  3WTZ A;  4G6Q A;  3VFZ A;  2J5P A;  3ZMZ A;  2JTV A;  4KIC A;  3F8F A;  3H3Z A;  1LEB A;  2V79 A;  4A0X A;  1KU2 A;  2A3S A;  1SD5 A;  2QQA A;  4KN7 X;  3N97 A;  3LQR A;  5DYM A;  2E1C A;  1ZLJ A;  4HX8 A;  1J0R A;  1DUX C;  4CYD A;  2EWN A;  5CLS A;  2HWV A;  2FNA A;  4EM0 B;  1W4M A;  1FC3 A;  4IHS A;  2D2W A;  5CYV A;  5D8L B;  2IVM A;  3FMQ A;  3J80 K;  4M74 A;  1OMI A;  3BY6 A;  2V1X A;  1VTN C;  1IAW A;  2M8E A;  1A04 A;  3KFW X;  1B4A A;  3K2Z A;  2M5W A;  2YU3 A;  4A0Z A;  3MZY A;  3I53 A;  4IRG A;  4HLY A;  3KP6 A;  5ICC A;  2P8T A;  3IWF A;  3CUQ B;  4N0B A;  4XRF A;  1IW7 F;  1IUY A;  5D5V B;  3BP8 A;  4CHU A;  4GGG A;  4BHC A;  2VN2 A;  3FXU A;  1XGN A;  2QQB A;  5HS8 A;  4WX9 A;  3DPL C;  4NQW A;  4CZZ A;  3HHH A;  4K2E A;  3K1N A;  3JTH A;  4MTE A;  2GQQ A;  4Q48 A;  2JPC A;  4L9T A;  3NRV A;  3RYR A;  2IA0 A;  2AXL A;  3HTU A;  1MDM A;  2FQ3 A;  2K7L A;  1C0W A;  2QBY A;  2IP2 A;  1BIB A;  2W57 A;  3EUH A;  4OIR F;  1S7O A;  4OIQ F;  1QO0 D;  2G7U A;  2ZME B;  3S2W A;  1JGS A;  4RB2 C;  5L3B A;  3V7S A;  1LJ9 A;  2NNY A;  2PBI A;  3ECH A;  1FY7 A;  4YFK F;  1IRG A;  1EH7 A;  4M6Y A;  1HKT A;  1XCB A;  2XV4 S;  5E1X A;  1PUE E;  4F7Z A;  5ICF A;  3RYP A;  3W6J B;  2EFO A;  3R0J A;  2QWW A;  1R36 A;  1HKQ A;  4ESJ A;  3ABU A;  1R1T A;  2QBY B;  2ZXJ A;  1P2F A;  1HW1 A;  1ZH5 A;  1ZGJ A;  2CW0 F;  1W5T A;  2VC1 A;  1TW3 A;  3KP7 A;  1FNN A;  3QP6 A;  3KP2 A;  1TTY A;  3MQ0 A;  4U0W A;  1ODD A;  5LLQ A;  3Q9V A;  2XHK A;  3M7G A;  4KDP A;  4KFC A;  5H6R A;  4LD5 A;  1W5S A;  2P4W A;  2HYG D;  5FD5 A;  2P5L C;  2L54 A;  3TO6 A;  1K7A A;  1ZGA A;  2NAZ A;  2HTS A;  3GFJ A;  3N4M A;  4M71 A;  4NHJ A;  2KJB A;  1Z91 A;  3GUD A;  3P9C A;  1TW2 A;  3BPX A;  2GIV A;  1R23 A;  3T8T A;  3BJO A;  3GLX A;  3GW2 A;  1IN7 A;  1IXC A;  2RVC A;  2EV6 A;  4HAM A;  2A69 F;  1FWZ A;  1XSD A;  3F72 A;  2NNN A;  2FRH A;  3CJN A;  1YW9 A;  4FX4 A;  1ULY A;  1D3Y A;  1GHC A;  4O6J A;  3C3W A;  2GAU A;  2YR2 A;  1S7A A;  1LDK B;  2BE5 F;  1V3F A;  1FBQ A;  1Z05 A;  3T8R A;  3FMR A;  2VXZ A;  2HGC A;  3F6O A;  4XLN F;  3B02 A;  5ILS A;  4S05 A;  4UV9 A;  4HA8 A;  4A6E A;  5FB2 A;  2VC0 A;  2HQN A;  2P6T A;  4L5I A;  1ZG3 A;  1J5Y A;  5AIQ A;  3SZP A;  4PZJ A;  2F5C A;  3KE2 A;  3E97 A;  3LFK A;  2FNP A;  2DBB A;  2EV5 A;  4MGR A;  5FGM A;  1H9T A;  2G7H A;  4I02 A;  4ENN A;  1J9I A;  3REO A;  2OZ6 A;  3R6S A;  3BRO A;  4ESF A;  1BI1 A;  3HTS B;  2PLY A;  3ZN0 A;  4EQQ A;  3WGG A;  3O2P E;  3ZMT A;  1F1Z A;  4N9I A;  1U6G A;  5FD6 A;  1FYL A;  2MH2 A;  3ABT A;  2YX7 A;  1IZ1 A;  2HZT A;  5EEH A;  4AIJ A;  4BHB A;  2FXA A;  1YO5 C;  4PGG A;  2V1D A;  1JHF A;  1S6L A;  1XB4 A;  1P4W A;  4UVC A;  2D1H A;  3G73 A;  3GFM A;  4YFX F;  4UNO A;  2PJP A;  1G3W A;  3I59 A;  4P55 A;  3IKV A;  4YG2 F;  4ENM A;  3V8K A;  4U0V A;  2UXX A;  1G6N A;  1FLI A;  2CQK A;  2EJR A;  3M8F A;  2PG4 A;  2XGX A;  1SMY F;  1XMK A;  2G9W A;  3LA7 A;  3O3K A;  4I09 A;  2OBP A;  4BYY A;  3JAM K;  1J59 A;  3SXY A;  3VB2 A;  5ILU A;  1Z9C A;  1KGS A;  2JPB A;  3TOA A;  3EQL F;  5HLI A;  4XSZ F;  4EJW A;  3C1D A;  4AVP A;  3V8J A;  1QNT A;  1YLF A;  1UHM A;  1XN7 A;  1H9G A;  2LKP A;  4LG0 A;  2NS0 A;  5FO5 A;  1FP2 A;  5L3G A;  2A61 A;  2W85 A;  3TDZ C;  1USS A;  4PGH A;  3E6B A;  1K6O A;  5DCM A;  4HF2 A;  2DO7 A;  1ZN2 A;  2DPD A;  5IT9 K;  2HFH A;  2MH9 A;  1WI9 A;  2BGC A;  3I5U A;  3R4K A;  4OIN F;  3K9T A;  5LGU A;  4M9X A;  3KET A;  1B9M A;  4QWQ A;  1MJ9 A;  2GXG A;  2OQR A;  2A07 F;  3WG9 A;  3JAM Z;  2DK5 A;  4LG0 B;  3TO9 A;  2DTR A;  2PEX A;  1HW2 A;  2MLK A;  1G3T A;  4I0A A;  5DCM B;  1BBY A;  1I5Z A;  5AON A;  3KP4 A;  4HV5 A;  4BAY A;  2XAS A;  2PQ8 A;  5FLX Z;  2X0L A;  1FPQ A;  1QZY A;  4AD9 A;  1I27 A;  3FF5 A;  4Q5S F;  4HQE A;  5E8G A;  3Q9S A;  4ZZD A;  5K5O A;  1PDN C;  3QU6 A;  2STT A;  2E7W A;  4LLL A;  1IF1 A;  4EV0 A;  2FF4 A;  3DQV C;  1R1V A;  5E17 F;  5L3F A;  2LF8 A;  3ZP5 A;  4O3M A;  1RI7 A;  2Z5U A;  3P9K A;  4RGR A;  1JE8 A;  1BC7 C;  4G8X A;  1LDD A;  1H0M A;  5TRD A;  4IF4 A;  2ZNZ A;  3T5X A;  4YIF A;  1Z1D A;  2XAF A;  2FOK A;  5JVT A;  2E1N A;  4EM2 A;  4B09 A;  2QEN A;  1FSE A;  2DW4 A;  5FFZ A;  4R79 A;  4G9Y A;  5D6E A;  2QQ9 A;  1IN4 A;  2VBX A;  1QPM A;  1RUO A;  4LK1 F;  5AIP A;  4YFN F;  5J8C A;  3IL2 A;  2VE8 A;  1RIO H;  3KLN A;  3RPU A;  4L9V A;  3NEU A;  1UFM A;  3TKY A;  2FBK A;  3ZMD A;  4LK0 F;  3TQN A;  3M1E A;  1XDU A;  1HBX G;  4U0Y A;  3WGH A;  5BPD A;  1P92 A;  2FE3 A;  1BI0 A;  3GZ6 A;  4BQA A;  1MKM A;  3BJA A;  3ELK A;  4FX0 A;  4CIC A;  2H27 A;  3SFZ A;  3WGI A;  4OMZ A;  4EVI A;  1GXP A;  4XSX F;  2PFB A;  4A5M A;  1WRJ A;  3Q5F A;  3RI4 A;  2FMY A;  2W24 A;  1L0O C;  3MZH A;  2M87 A;  2D45 A;  1O7F A;  4FT8 A;  1TQM A;  5HLG A;  3LAP A;  2XKO A;  3E6M A;  4ZYD A;  5D5W B;  2R3S A;  1BM9 A;  2Q0O A;  6PAX A;  4B8X A;  2M45 A;  4P96 A;  2EV0 A;  4WXH A;  2RV8 A;  3T1B A;  3JSO A;  3J7A O;  4MNU A;  2D1V A;  1IN5 A;  2DFI A;  2B0L A;  5HDN A;  1WQ2 A;  5DD4 A;  3HSF A;  4RAZ A;  4OMY A;  3LQQ A;  3GXO A;  1U3E M;  4QLC U;  1B9N A;  5CVV A;  1ZLK A;  4KIF A;  5CJ9 A;  1OKR A;  2UZK A;  2FBI A;  4PDK A;  5E1Z B;  1ZG5 A;  1X3U A;  3IRQ A;  1ONV A;  1P4X A;  1SD7 A;  1T39 A;  2OU2 A;  3D5L A;  3IRR A;  3VOE A;  5BQT A;  4HOB A;  1PP8 F;  3JW4 A;  4HZF A;  5LEK A;  2Q2E A;  1MDM B;  3WTX C;  2KKO A;  4D0P A;  4ENK A;  3WOD F;  2ZKZ A;  4G7O F;  2UWM A;  3EDP A;  4FHT A;  4KIG A;  1G3S A;  2OQG A;  4IRI A;  3LA2 A;  2XKP A;  4L18 B;  3H92 A;  3HSE A;  4AWX B;  3E5X A;  4HF0 A;  1IN6 A;  2V6C A;  1JXS A;  3ZMS A;  5BPI A;  3ZMU A;  4ETS A;  3E5U A;  1IN8 A;  4ZYG A;  1HST A;  2RN7 A;  2CWE A;  3WE2 A;  4P9F A;  3F8M A;  3KP3 A;  3GFI A;  2W25 A;  2OAZ A;  2M1B A;  4WWC A;  4Q47 A;  1REP C;  3MCZ A;  1MGT A;  4U7D A;  1B1B A;  2BV6 A;  3HRS A;  2WTE A;  1J75 A;  1OPC A;  1R5G A;  1UCR A;  5E1W A;  1B59 A;  2C6Y A;  1K79 A;  3ZPL A;  1FSH A;  1ZRF A;  3V7C A;  1LB2 A;  3L2C A;  3MEX A;  1E2X A;  1J2X A;  3LA3 A;  3MWM A;  4KIB A;  3J81 K;  4LB6 B;  4BH9 A;  2ZO4 A;  1XSX A;  2M30 A;  3QRF F;  3RIR A;  3VOD A;  1D8K A;  3R60 A;  3KCC A;  4UVB A;  1BI3 A;  3MAJ A;  3COA C;  1L3L A;  1EV7 A;  3DV8 A;  1QBJ A;  4Y13 A;  2O61 A;  5E18 F;  1O3R A;  2QLZ A;  1IXS B;  1UHW A;  1RUN A;  1WSU A;  4P9U A;  2FU4 A;  2IA2 A;  2PN6 A;  3DP7 A;  3EYI A;  3V8L A;  4ZYE A;  1SD6 A;  2IRF G;  3HYI A;  2H6B A;  1XD7 A;  1G3Y A;  2EFN A;  5L3C A;  2F5D A;  4RB3 C;  4Z2Y A;  2K27 A;  1HKS A;  5BS6 A;  4E70 A;  5K5Q A;  2ZJ2 A;  2RNJ A;  4EM1 A;  5A2Q Z;  3QP5 A;  3J81 Z;  3RPQ A;  3JTG A;  2EA4 A;  5D5X B;  2DK8 A;  2VBZ A;  3TO7 A;  3I0T A;  2FA5 A;  3SHF A;  1TBX A;  3TGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...