1U5TB

Structure of the escrt-ii endosomal trafficking complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
169
structure length
169
Chain Sequence
LDREKFLNKELFLDEIAREIYEFTLSEFKDLNSDTNYMIITLVDLYAMYNKSMRIGTGLISPMEMREACERFEHLGLNELKLVKVNKRILCVTSEKFDVVKEKLVDLIGDNPGSDLLRLTQILSSNNSKSNWTLGILMEVLQNCVDEGDLLIDKQLSGIYYYKNSYWPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords appears to be functionally related to SNF7; Snf8p
publication title Structure of ESCRT-II endosomal trafficking complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
total genus 43
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2004-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1u5tB01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1u5tB02
3ABTA 5D6FA 4A2UA 4HLXA 1Z1DA 4M74A 2XIGA 2HQNA 3S2WA 2IA2A 2QUFA 1YQAA 2G7HA 2EV6A 2HOEA 3E6MA 3KP6A 5LRRA 2MH2A 1OMIA 2VBZA 4OIOF 2RV8A 2X4HA 3L9FA 2QBYA 4WXHA 2J5PA 2FOKA 3KZYA 4RB3C 3K1MA 2ZMEB 1ZGAA 1ZG5A 5ILSA 3MEXA 3HRMA 5J8FA 4IRHA 3F6VA 3AAFA 1PUEE 2QENA 2UZKA 1ZG1A 2KIFA 4KMFA 3MQ0A 1HKQA 5LRSA 1BBYA 2H94A 1B59A 1R1TA 4UV9A 2ESHA 4UVAA 2LF7A 5E20A 2NRAC 4AIHA 1U5TA 3ZMDA 1FSHA 4KUMA 2F5CA 3Q5FA 1R36A 1KQ0A 1ZYRF 1GHCA 3HHHA 2PFBA 2MBFA 3MWMA 3HSRA 4KNYA 4KA4A 2QQ9A 4HAMA 1R00A 3W6JB 2A69F 5DD4A 1I5ZA 3P9CA 1KQ9A 3ZMTA 4L5IA 2QWWA 1ZREA 1R23A 2IJLA 4LK1F 2A6HF 2VN2A 3DP7A 1XD7A 2MD5A 5BPIA 5CYVA 2CQKA 1Q1HA 2KJCA 1FC3A 1FBSA 3D5LA 2BEOA 5IT3A 3TKYA 4ZZDA 3CJNA 1CGPA 1DDNA 3I5UA 3HYIA 3ISPA 2EFNA 2PN6A 4CZZA 3GWZA 5CVRA 5E1XA 1FLIA 3FXQA 4I0AA 1HKTA 2F5FA 4BHPA 5TRDA 3DEUA 3CUQB 3RPQA 3TDUC 1ZHFA 3QP6A 1SD6A 2EJRA 3CO6C 2DW4A 2VC0A 4LLGF 3JTGA 3RJPA 5AIQA 1U78A 2JZYA 2NNYA 1OYYA 3ZQ7A 2RVCA 1SD7A 1G3WA 3R61A 1D8JA 4WXCA 3T0YA 5FD6A 4NHJA 5HS8A 5BS6A 1V3FA 3GVAA 1E17A 2QLZA 1F5TA 2F2EA 3GX4X 3I4PA 2IA0A 4LG0B 1UB9A 4JBAA 2KRFA 4XSZF 1TQPA 4RB1A 1T2KA 3GFMA 2CFXA 4L5JA 5KK1A 3F3XA 4CYDA 4BHBA 2NS0A 1FNNA 2D1VA 2EK5A 1F9NA 4Y15A 5CVJA 3RDIA 1YIOA 2OA4A 2YX7A 1J0RA 4A6EA 2RN7A 2DK8A 5D5WB 4HX4A 1ZRDA 4RGSA 3F8CA 4EQQA 1KU2A 3HTSB 3MAJA 2H6CA 4G7OF 2JT1A 4U7DA 1U5TC 1DPUA 1K78A 4O5VA 2ESNA 2IW5A 2E1NA 2L4AA 1XGOA 3QU6A 3GYHX 4BYYA 1T38A 4AVPA 4HDVA 1P4XA 3Q9SA 1ZRFA 3HTUA 2EA4A 1R1VA 3VODA 5D8LB 3T1BA 5CJ9A 3KLOA 2ADUA 3JSOA 2G7UA 3I59A 4IPAA 3PQKA 3ZN1A 2DPUA 3M7GA 1XGNA 5E8GA 2FF4A 3KE2A 3MFKA 3GZ5A 4KN4X 2E7XA 3SZTA 1K6OA 2P6TA 5L3EA 3D0SA 2M87A 4JQFA 2DLLA 3ULQB 2YR2A 1IAWA 4ZZLA 2YX4A 1G3TA 1MJAA 5LLQA 5K5QA 4XLPF 3GO5A 2HGCA 4LMYA 1JXSA 1W4MA 2Y0MA 1B4AA 1QPMA 3LA7A 5FLXZ 3V7RA 1J5YA 3BROA 1S7OA 4RB0A 1MJ9A 1HW1A 1BIAA 4M9SA 1TNSA 3LAJA 3DXJF 2EV5A 3GFLA 4N9IA 2FBIA 2O8XA 2VBYA 3V8KA 1U6GA 2AS5F 1FP1D 3IL2A 4N9HA 2AXLA 3ZMUA 5E17F 3L2CA 1OPCA 1XDUA 2RQPA 2EFPA 6PAXA 1BJAA 3KEOA 2WWYA 2PG4A 5BPDA 4RS8A 1FYLA 2GIVA 2CG4A 1BI3A 4HX7A 1I1GA 2FMYA 3T8RA 2K7LA 2MC3A 4A5MA 1WSUA 1E2XA 2HR3A 2ISZA 5F1RA 4U88A 1PP7U 1XGSA 1UHMA 5LGTA 3HUGA 2FMLA 4O6JA 1FYKA 2Z3YA 3E5UA 4HYEA 2GXGA 3OOPA 3MZYA 3F8BA 5LHHA 1Z91A 2COMA 1BC8C 4ZYHA 5D4RA 3EYIA 4KIGA 3R4KA 1SAXA 2B0LA 2XASA 4UVCA 3GUDA 1I1SA 2WC2A 5LEJA 1USTA 2CO5A 3E6DA 2IA1A 4UHTA 2EV0A 3VB2A 2V9VA 3DKWA 4CHUA 4EJWA 4S05A 2UWMA 2BGCA 3RI4A 3M8EA 3E6BA 4ETSA 1KYWA 1H9TA 2BV6A 3FXRA 4CXFA 5ED4A 4L0ZB 3DQVC 4YIFA 3R0JA 2IPQX 4IF4A 5DEQA 4JK1X 3BY6A 3IC7A 2D1HA 2UXXA 2DT5A 2P4WA 1DP7P 3SXYA 2H6BA 2VT3A 3I71A 3CLOA 2VBWA 2L3DA 4Y17A 1GXQA 5BMZA 1I27A 1AOYA 2Z99A 2ELHA 4PGGA 5AONA 2KIMA 2ZNYA 3N97A 4PGHA 1GVJA 4OOIA 1HQCA 2RDPA 1QZYA 2A07F 2P5KA 5ILUA 3QRFF 2EA2A 3K1PA 4YFKF 1RUOA 3FX3A 3MZHA 2D2WA 3BJAA 5E8IA 1ZN2A 3LA3A 3ZP5A 1RIOH 1S8NA 4WX9A 4AIJA 3N4MA 1B9NA 3LWFA 2JPBA 1U8RA 3HRSA 2M1BA 2Q8KA 4BXUA 3QPHA 1ZGJA 5E1ZB 2FU4A 1T6SA 2NYXA 2QBYB 2ISYA 3L7WA 2F5DA 5FFZA 1IXSB 1QZZA 3VEPA 1QBJA 5H6QA 4BHCA 3COAC 2XKOA 2MLKA 1BM9A 1YW7A 1MKMA 1VTNC 1KU9A 1SD4A 3WU0A 3GW2A 2HWVA 2LDUA 2P7VB 3WTWC 1G6NA 4D0PA 1WWXA 5D8KB 4Y13A 3HOTA 1U5TB 2GQQA 3M1EA 3IHUA 2XUBA 1W5TA 2R7DA 3IRQA 4KT5C 3WE2A 1IXRC 3GFJA 2F5EA 1P2FA 2O6GE 3R6SA 4HV6A 1MJBA 4Q47A 2IT0A 5F6FA 2DBBA 5DUKA 4I98B 1STZA 1EH6A 4NQWA 3LFKA 1LDDA 2DO7A 5JI6A 2FA5A 2L4MA 1IN7A 4BAYA 2BYVE 3NEUA 1KYZA 3G3ZA 3ECHA 3R0AA 4M9XA 5LHGA 3IKTA 1RZ4A 4LLLA 3O6BB 1P92A 1QGPA 3WTTC 4KIBA 5DD8A 3SHFA 1H0MA 1UCRA 3F6OA 1XDSA 2IRFG 3P7NA 2P7CB 5E1WA 3I54A 1D5VA 3O3KA 4O3MA 3KZZA 2FEZA 2STTA 3VFZA 1ON1A 1REPC 4M6YA 5DCFA 4M71A 3I64A 1DPRA 3J81K 1WRJA 4A0ZA 3P9IA 1ZLKA 4UUVA 5L3BA 1WKMA 4BNCA 1RNLA 2CSOA 3H92A 1PDNC 4H0EA 5JVTA 2DPDA 3K69A 1R5HA 1J75A 2W84A 1XMAA 4R8HA 1EH8A 1CF7A 3F8NA 1IRFA 5HLGA 2J5OA 5EEGA 1S6LA 1A04A 5E18F 1WI9A 1BN5A 1XCVA 3C18A 4A0XA 3GZ6A 4L0YB 1Z05A 2QZ8A 4RGXA 2O61A 4A5NA 2K4JA 2V6CA 1MZBA 3DF8A 4QWQA 2CW0F 1R7JA 4LB5A 3VOEA 4HF2A 2Z33A 2PMUA 3K9TA 1YO5C 2VT2A 4OIRF 3TO6A 4EV0A 2DAOA 2P5VA 4N0BA 5DCMA 4P5OA 4ESFA 3QU3A 3ZMZA 3HRTA 4E70A 2FNAA 3GXOA 1KQ8A 1ZAOA 4HZFA 5FGMA 5ICCA 1O3SA 1U3EM 1TW2A 4EJUA 2PQ8A 5HS9A 4OIQF 1FT9A 3ML6A 1L3LA 4GYGA 2FNPA 3HOSA 2XAQA 3EETA 1QNTA 1K78B 5ILVA 4P9FA 5KVRA 4ENJA 2ZBKA 3L00A 4RGRA 1I6XA 3WTSC 4IHSA 1NHAA 2P8TA 5HOOA 4MGRA 2YPRA 2GA2A 4I0BA 1MDMA 2OZUA 4LK0F 1EV7A 1J7KA 2VC1A 4ENMA 3BJOA 1F1ZA 4XBFA 3W6KB 5IT9K 1P6RA 3JAMK 3WTYC 4ON0A 3DFGA 4K2EA 2RKHA 1P4AA 2GWRA 2M8EA 4LB6B 2YU3A 4M73A 5K5RA 4WF2A 1MD0A 2DTRA 4ENKA 1XSDA 1LEBA 1B9MA 1V4RA 1T39A 3KCCA 3V8LA 2FBHA 3LA2A 5LBQA 1R5GA 4LGWA 1UHWA 2XKPA 4EM2A 4ENNA 4WCGA 4QLCU 2STWA 2OD5A 1IN5A 2ZJ2A 1W7PA 2XAGA 1S29A 2JPCA 1SMTA 4WK8F 4A6DA 3J80Z 2QVOA 4KFCA 3FZVA 3REOA 1U2WA 4U0YA 2K4BA 1G4DA 1KU3A 3WE3A 4MEXF 4PCQA 1LQ1A 4HA8A 3IWZA 1OYIA 4ZYDA 1BC7C 4U0WA 5F64A 2KJBA 3TO9A 5A2QK 4EM0B 3BJ6A 1XSXA 1YW8A 2DI3A 3HIFA 5D5XB 2QQBA 4KICA 4P96A 3RYRA 4G6DA 5FB2A 5BOXA 2W57A 3QAHA 1J9IA 1O7LA 2M30A 4EJOA 2PLYA 2P6SA 4G9YA 3GFIA 2PBIA 2QQAA 1T98A 3EUHA 2GXBA 1FYMA 1TQMA 1QQIA 1SFUA 3HRUA 1FP2A 4UXNA 3MCZA 3BP8A 3V7SA 1JHFA 1YYVA 2UXNA 1IN8A 2XROA 3E5XA 4MNUA 5BQTA 1TW3A 2GZWA 2M45A 2Z9OA 2HEOA 2VXZA 2PJPA 2X0LA 3TDZC 3WG9A 2HYFA 2FSWA 2K86A 2V1UA 3JSPA 3CDHA 2VOPA 3FMSA 4YFNF 1D3YA 4HX8A 2LKPA 5L3GA 3WTXC 1JE8A 2MH9A 4GO1A 4DQ2A 3ZMSA 3FXUA 1UFMA 4MTDA 5D5VB 4HV5A 1W7PD 3JTHA 1H9GA 2R7FA 1KU7A 5D4SA 4P55A 2E7WA 4OMYA 2Z5UA 3PQJA 3KP4A 3DV8A 1FY7A 2K27A 2A68F 2EFWA 2FE3A 1TTYA 1TNTA 3TO7A 3M9AA 2HTSA 1HW2A 3BWGA 4AD9A 2DQLA 2D45A 1K79A 3I53A 4G94A 3F8FA 3GEZA 1ZH5A 5JFRA 3Q9VA 2LNBA 1S3JA 1HSTA 5CLSA 1BI2A 1R58A 2MLGA 1BOAA 3K0LA 3EYYA 3GLXA 1X3UA 3FF5A 5JHUA 3KP3A 3T5XA 2P5LC 2XGXA 1IUYA 2H09A 3EDPA 4M72A 2XAHA 1YS7A 2BBYA 5HVQC 3WTUC 3ROUA 2C6YA 3B02A 2OU2A 1LEAA 2JRTA 2W24A 2ZNZA 4B09A 5ICEA 3ZN0A 1XB4A 1T0FA 2XVCA 3RTRA 5FO5A 3SFZA 4ESJA 3KP2A 1O57A 2ZMEA 3O2PE 2HDCA 2RC4A 2EWNA 5K5OA 1IZ1A 3FM3A 2IVMA 3K1NA 2HZTA 1IW7F 5L3CA 3BPXA 3T8TA 2HKXA 1B6AA 4ZH4F 3RKYA 5DV5A 4GXOA 2LF8A 1SMYF 4LFUA 3GF2A 4HDUA 4KN7X 3BPVA 4P9UA 1HXDA 4FX0A 2EB7A 1O3TA 4XRFA 3F23A 3TOBA 2DQRA 3J7AO 1ZRCA 4I09A 1OR7A 1BIBA 1FSEA 3V4GA 3I0TA 5J6XA 1R1UA 4ZYGA 3BZ6A 5K1YA 3E97A 1YLFA 2EFQA 1HKSA 4KMUX 2XHKA 3H3UA 5DUIA 2VE9A 2E1CA 3ELKA 2L54A 2KIUA 4GCVA 1BI0A 4MTEA 1Z9CA 5D6EA 3C7JA 2CGPA 2PMHA 4L18B 3ECOA 2ETHA 1F4KA 3WGHA 1FOKA 4I01A 3DPTA 3NRVA 3FMQA 3FHZA 3BOQA 1G3SA 1Z6RA 1LJ9A 2HYGD 4MHGA 1ONVA 3K2ZA 4LD5A 3F72A 1S7AA 2FQ3A 1YS6A 3CTAA 1ZG3A 4G7ZF 1O7FA 4F7ZA 1FBQA 1HBXG 3FWEA 3ZMVA 4OMZA 4G6QA 1O3QA 4PDKA 1R22A 2RNJA 1IRGA 3CUQA 2OAZA 4UV8A 4G7HF 4EM1A 2L01A 2HQRA 1HSJA 2H27A 2FBKA 4A12A 4EVIA 2TDXA 4IXAA 3RPUA 3E5QA 1ODDA 3R60A 4IHTA 4IVNA 1P4WA 3WGGA 4EJVA 2V1DA 3KLNA 3SZPA 1FPQA 1FX7A 3WTVC 1EH7A 4FHTA 1TLHB 2HTJA 4LG0A 4Z2YA 5CVIA 1DUXC 3U2RA 5HDGA 4B8XA 1ZARA 1Y0UA 1LDKB 4L9TA 1Z6TA 3F22A 4HQMA 2V79A 1XGMA 2OBPA 2XAJA 4PZJA 4U7BA 2A6EF 1YFHA 4RGUA 2LSOA 1RUNA 4HLYA 2NAZA 1CF7B 5H20A 3WGIA 4EJTA 2V1XA 1TBXA 2WTEA 5LHIA 1YW9A 1JHHA 4UVBA 3LQQA 2L02A 3SQNA 4GGGA 4Q4ZF 2BE5F 3J81Z 2KKOA 4WXDA 4OINF 2Q0OA 5D5UB 3U9GA 2Y75A 3F8MA 2O03A 3IWFA 2FRHA 2ZFWA 3BDDA 2PI0A 2JTVA 5DCMB 3F21A 1K7AA 2MA3A 3QP5A 5FD5A 5FLXK 5HLIA 2CWEA 3C1DA 5FFXA 5HDNA 2VODA 2DK5A 4IJAA 2A61A 2K02A 2RGVA 4TV7A 1O3RA 4FX4A 4S04A 1L0OC 4MQVA 5LGUA 1IF1A 3RKWA 1XCBA 3I59B 1GXPA 2JSCA 2OQRA 1JGSA 3KP7A 2NNNA 3M8FA 1YG2A 4BQAA 1ZLJA 3FMRA 4RAZA 3KP5A 1IXCA 3WU1B 3J80K 2Q2EA 2ZKZA 2XAFA 3OV8A 1XMKA 4LJZF 3KETA 1MGTA 3KEQA 2DFIA 5ERIA 3HHGA 1D8KA 2W85A 3B73A 3HSFA 2O3FA 2HFHA 4G8XA 1MDMB 3ERED 4CICA 4L9NA 3CUQC 3C3WA 2QM3A 3FM5A 1LB2A 3TQNA 4KDPA 3PFIA 2VONA 1KA8A 4RAYA 1B1BA 4CGZA 4U0VA 1FWZA 5JR3A 4AWXB 4M9ZA 2ZO4A 5ICFA 1OYWA 1WQ2A 4R1HA 5J8CA 4Q48A 2G9WA 5CVUA 1TQIA 2ZCWA 3I58A 4YIIA 4A0YA 1OKRA 1QO0D 4DNCA 2ACJA 3IKVA 3TGNA 1W7PB 2WV0A 5IT9Z 4ASNA 4L9JA 3JAMZ 5LEKA 3CUOA 1HW5A 1KGSA 1G3YA 3DPLC 4BH9A 4IRGA 5CVVA 4YG2F 2A5YB 3RIRA 1SD5A 4MQ9F 4MEYF 1SFEA 4RB2C 1Z7UA 2VE8A 3RYPA 1ULYA 3V7CA 2XV4S 3G73A 4YFXF 3QOPA 5HS7A 3ZPLA 4GYIA 3EQLF 4CDGA 1XN7A 3E3VA 5L3FA 4Q5SF 3JW4A 3KFWX 1LVAA 2W25A 4CO8A 5AIPA 2VBXA 2IP2A 2YSRA 5L3DA 4HQEA 4OU0A 2GAUA 4OIPF 2HS5A 2Y48A 4XLNF 4LLNA 3ABUA 1LNWA 3U1DA 1XSVA 4FT8A 1J59A 3L09A 3WTZA 1IN4A 4HOBA 4I7HA 4EMSA 4HW0A 3LQRA 2HKOA 4L9VA 1IN6A 1J2XA 5A2QZ 2CYYA 4IRIA 4M6XA 2O0YA 2OQGA 4WWCA 3V8JA 2OZ6A 2M5WA 1ON2A 4HF1A 5HLHA 5TJJA 4HBLA 2R3SA 1BI1A 1AWCA 5ICGA 3P9KA 5DYMA 4I2OA 2GA1A 4EGZA 1W5SA 4XSXF 5EEHA 5HDKA 1PP8F 4ZYEA 3HSEA 4NB5A 1C0WA 3H3ZA 2A3SA 4I02A 1RI7A 3LSTA 3TOAA 4AIKA 3LAPA 2ZXJA 2DU9A 2FXAA 4KIFA 1FBUA 1FZPB 5LGNA 3RKXA 5DDGA 1YTYA 2EFOA 3QPTA 1USSA 4HF0A 3WODF 4EGYA 2VOOA 3IRRA 4R79A 3CO7C 4KYWA 1SFXA 5H6RA 4ESBA 2QYOA 3NQOA 3E6CC 2PEXA 2XRNA 1LDJA 4UNOA
chains in the Genus database with same CATH superfamily
2MSYA 3ABTA 5D6FA 2HXIA 4A2UA 4HRIA 1OISA 4HLXA 1Z1DA 4M74A 2QSFX 2XIGA 2HQNA 4M3FA 1JJ6C 3A4CA 2IA2A 3S2WA 1I50J 2QUFA 2R93J 5IOYA 2VJ4A 2IS2A 1YQAA 2G7HA 2P81A 2VJ5A 2XB0X 1XPXA 3G1LA 2E1MC 2EV6A 2HOEA 1D1AA 3E6MA 3KP6A 3N05A 3GTPJ 5LRRA 3OSFA 2MH2A 1OMIA 1CQTA 2VBZA 2X1EA 1MNEA 2Z1DA 3I3LA 4P1WA 4OIOF 2RV8A 3M1CA 2X4HA 4LOCA 2LLKA 2VPRA 3L9FA 3PNTA 3HB9A 3TMOA 2QBYA 5FRNA 5JLWA 4WXHA 2J5PA 2FOKA 2HQ5A 4FISA 3KZYA 1UJ8A 4XRSG 4RB3C 2ZJQF 3W2VA 2GLOA 3S2HJ 4BXFA 1VZ0A 3OR2C 1MBKA 3K1MA 2KFDA 2ZMEB 1ZGAA 1ZG5A 5ILSA 3MEXA 3HRMA 5J8FA 4IRHA 2ME6A 3F6VA 2I8DA 3AAFA 1PUEE 2QENA 2AQEA 4XLCA 2UZKA 3FIWA 3JRIA 1ZG1A 2KIFA 1OCRH 2KDOA 4KMFA 2V7FA 3B6CA 1DQUA 3MQ0A 3DTIA 3PFYA 2FX0A 1HKQA 5LRSA 1BBYA 2H94A 4F91B 1IRXA 4E7ZA 4DZPA 1AKHB 1B59A 1N77A 1R1TA 4UV9A 1TT0A 2ESHA 4UVAA 2LF7A 5E20A 3IP4B 2VKVA 4BKXA 4XRSA 2NRAC 4AIHA 1U5TA 2UUZA 4CA0A 3PIPF 3ZMDA 2R4GA 4F3QA 1AHDP 3HPGA 4G12A 1FSHA 2DMTA 3LMMA 3PNVA 2NS7A 4KUMA 1S9HA 1OCOH 2E5NA 2F5CA 3Q5FA 1JI8A 1R36A 1KQ0A 1ZYRF 1GHCA 3HHHA 2PFBA 2MBFA 3MWMA 3HSRA 4BUPA 4BJ5C 3HM5A 3ZQLA 4KNYA 4PFOA 2W7NA 1ORKA 4KA4A 1N75A 1GV5A 2QQ9A 3BTLA 4HAMA 2M4GA 4IZZA 5JLXA 4M3DA 1R00A 1WFXA 2A69F 3W6JB 5DD4A 1I5ZA 2H1LA 3P9CA 1KQ9A 3ZMTA 4L5IA 2QWWA 1ZREA 4CCMA 2JJ7A 3GCMA 2CQQA 1R23A 2L0KA 1OCCH 1GLNA 2IJLA 4LK1F 4XLAA 2A6HF 1YITI 2VN2A 3MKZA 1VQ4I 3DP7A 2HVRA 1XD7A 3AL0B 1F43A 2XF5A 2JVGA 2MD5A 5BPIA 5CYVA 4NUBA 2CQKA 3I56I 3ABKH 1Q1HA 2KJCA 2LMDA 1FC3A 1FBSA 2FD5A 4IQJA 4NQWB 5IP6A 3D5LA 4JYKA 3OS2A 2BEOA 1JT0A 3PJRA 2JVHA 1M1EB 3GLLA 3D1NI 3CJQB 3L2VA 5IT3A 3TKYA 4ZZDA 3CJNA 1GUUA 1ZR4A 3AG3H 4QSHA 1CGPA 4BU2A 1DDNA 2R7RA 3I5UA 3CZ6A 5GTIC 3HYIA 3S14J 2PX9A 3ISPA 4Y3OA 4XICA 1RPWA 2EFNA 2M7AA 2OCEA 4M3BA 2PN6A 5HLTA 4CZZA 3GWZA 5CVRA 5E1XA 1FLIA 3KZIC 1E3PA 3M4OJ 3FXQA 1EJ9A 5FRMA 1I3AA 3JRFA 3MKWB 4I0AA 1HKTA 1MSFC 2F5FA 2WV1A 5F1JA 4BEHA 4QTRA 2HPIA 4BHPA 5TRDA 3DEUA 3PNYA 1WJAA 1R49A 3IAM2 4HEA2 3CJTB 1TC3C 3CUQB 1V5FA 3RPQA 3TDUC 3K4BA 1HDDC 1ZHFA 3QP6A 1SD6A 1VQ7I 2EJRA 3CO6C 2DW4A 2VC0A 4LLGF 3JTGA 2PJRB 3RJPA 3WG7H 5AIQA 3A0HC 1U78A 2JZYA 2NNYA 1OYYA 3ZQ7A 2RVCA 1SD7A 1RETA 1G3WA 3R61A 1D8JA 3S3MA 3BG3A 4Y7NJ 4LIVA 1R4NB 4WXCA 2NS8A 4A3FJ 3T0YA 5FD6A 4NHJA 3HBLA 5BS6A 5HS8A 1V3FA 2Y0SA 3GVAA 1E17A 2LK2A 2QLZA 5FKMA 2XPWA 3GTKJ 1F5TA 3LSKA 3VYTB 4F55A 2F2EA 3GX4X 1OCTC 1MW7A 3JREA 5M3FJ 3I4PA 4MFEA 2IA0A 2E60A 3DEEA 3QPLA 5KNLA 1QA6A 4LG0B 1UB9A 2FUG2 4AUXA 4JBAA 2KRFA 4XSZF 3G6EI 4KISA 2OCCH 1TQPA 4RB1A 1BA5A 1T2KA 3GFMA 3LSIA 2X1DA 1MNMC 1YOVB 2CFXA 2EINH 4L5JA 5KK1A 2ZSHB 3F3XA 4CYDA 3ZXSA 4BHBA 4CYCB 2R7ZJ 2NS0A 4BE2A 1FNNA 1WJCA 3L2QA 2D5VA 2D1VA 2EK5A 3OOUA 1F9NA 4Y15A 1H88C 3RSNA 5CPRB 5CVJA 3RDIA 1B8IB 1YIOA 1Z0XA 1HCRA 2E35A 3A0BC 2OA4A 2YX7A 1AU7A 2XB5A 1J0RA 4A6EA 1MNDA 1OQYA 4FE7A 3BG5A 1FEXA 2DFFA 2RN7A 4BS9A 2DK8A 1JJ8C 4CUGA 5D5WB 4HX4A 1ZRDA 1QVUA 3UR3C 3PIOF 2L9VA 3F8CA 4RGSA 4EQQA 1KU2A 4IOAF 2DA3A 1AA7A 2ZSIB 2K9SA 3HTSB 1MH4A 1VQ5I 3MAJA 2X6OA 3OYFA 3CF5F 2H6CA 4G7OF 2JT1A 4U7DA 3H5AA 4YIRX 1H89C 2JA5J 1U5TC 1DPUA 1K78A 4O5VA 2ESNA 3LSMA 2IW5A 3TW6A 2E1NA 2L4AA 1XGOA 1GV2A 2DYSH 2QCOA 3DU5A 1HDPA 3QU6A 4XRMA 3GYHX 4RA2A 4BYYA 1T38A 1P9QC 4AVPA 4HDVA 2XGCA 1P4XA 3Q9SA 1ZRFA 3HTUA 2EA4A 1ETXA 1ZELA 1R1VA 3ABLH 3VODA 5D8LB 3BR5A 3EUAA 3T1BA 2CW7A 5CJ9A 5J1RA 3KLOA 3FXOA 2ADUA 4AC0A 5GPAA 3JSOA 3SFIA 1D0ZA 4BQNA 2G7UA 3I59A 4IPAA 1IRZA 3MVPA 2HDDA 2XGDA 3PQKA 1YJNI 3ZN1A 2DPUA 3M7GA 1Z77A 4DYRA 1XGNA 1NK2P 3DEWA 5E8GA 5JVGF 2M0MA 2CUFA 3H36A 1W36C 2FF4A 3L2UA 2AHQA 4ABZA 4FE4A 4XQFA 1XMXA 3KE2A 3MFKA 3CDLA 3GZ5A 4KN4X 1UELB 2MFZA 2BOLA 2E7XA 4HSRA 2CQXA 3SZTA 5C4XJ 1K6OA 2P6TA 4ZC3A 5L3EA 3CCLI 3D0SA 2G0EA 2M87A 4JQFA 2YU9J 2DLLA 3ULQB 3E1SA 2YR2A 1IAWA 4ZZLA 2YX4A 3OMYA 1G3TA 1MJAA 2F4OB 2JMWA 2W82A 5LLQA 3CLQA 5K5QA 4XLPF 1TWHJ 2HYJA 3GO5A 2HGCA 4LMYA 3OYJA 2ZJPF 1JXSA 1W4MA 2Y0MA 2Q2EB 1B4AA 1QPMA 3LA7A 5FLXZ 3CMAI 3V7RA 2QF7A 1WJEA 1J5YA 3BROA 1S7OA 4RB0A 1MJ9A 1HW1A 2DA5A 2QA4I 1BIAA 4JX5A 4NDLA 3DLLF 4M9SA 1TNSA 3LAJA 3DXJF 1XS9A 2EV5A 3GFLA 4N9IA 3LNQA 2FBIA 1B72B 2O8XA 2HVQA 2VBYA 3V8KA 1U6GA 4PK4A 2HI3A 1WHUA 5KAIC 2AS5F 1FP1D 1FTZA 1LFPA 4PJJA 3IL2A 4N9HA 1TWCJ 3S1MJ 4IHWA 3OL3A 1JTYA 2AXLA 2ECCA 1YX3A 3ZMUA 5E17F 2BW3A 2ELJA 3L2CA 2WAEA 3OIPA 4C2MJ 3HJEA 1OPCA 2KRHA 2WB1N 5EJCA 1XDUA 2RQPA 1RR7A 2EFPA 1BJAA 6PAXA 2GOXB 3KEOA 1YIJI 3W2AA 1IUFA 2WWYA 2F4MB 2PG4A 3ZQHA 4RS8A 5BPDA 1FYLA 2E1MB 2CG4A 2GIVA 2E5ZA 1BI3A 2DA7A 3M8JA 4HX7A 1K6YA 1I1GA 2FMYA 3T8RA 1J09A 3S1NJ 2E19A 1O4XA 4A3LJ 4FASD 5JHFA 2XPVA 1G8XA 1X19A 4D7NA 4XL9A 1TT5B 2K7LA 2EIKH 2MC3A 3RKQA 2ZXHA 1VQ6I 4A5MA 1WSUA 1E2XA 1ZTRA 5GTHC 2HR3A 2ISZA 5F1RA 3OS0A 1NTCA 3HDDA 3SEQA 2KIQA 4U88A 1PP7U 2LG4A 2EQRA 1XGSA 1UHMA 5J3LA 1UMQA 2M8GX 3SDBA 2IGOA 5LGTA 3MN2A 3HUGA 1BJZA 2FMLA 4C30A 4O6JA 1FYKA 3O8HA 3BR0A 2ZXIA 2Z3YA 3E5UA 4HYEA 1ETWA 1MMDA 2GXGA 2K5CA 1VQOI 1V55H 4DBRA 4BE1A 3OOPA 3L1PA 3MZYA 3F8BA 5LHHA 1Z91A 4CZCA 2COMA 2VUMJ 3OL4A 1BC8C 4ZYHA 4ZDPA 2DMUA 3QYEA 1FOWA 5D4RA 3EYIA 3OYAA 2ICWG 2Y30A 4KIGA 3HEFA 3VYUB 3R4KA 5IY5H 5EG0A 1SAXA 3A02A 1U9NA 2CUZA 1Y56A 2B0LA 2K9LA 2XASA 4CCKA 4UVCA 3OY9A 4AYBA 1ZK8A 3ZR8X 3GUDA 4B4CA 3E0JB 3KEYA 1I1SA 1YRNA 3KYDB 1WZ2A 2X6YA 2WC2A 4XOPA 2GXAA 4DYCA 1V5EA 5E3LA 2DMNA 2DT7B 4F52A 3ASOH 1NK3P 5LEJA 1R4MB 2CS3A 1USTA 2CO5A 3E6DA 4HNVA 2IA1A 4UHTA 5GPCA 2EV0A 3VB2A 4JOMA 2V9VA 1X2NA 3DKWA 3FXJA 1E3HA 4CHUA 3SEZA 1R71A 4EJWA 1VQ8I 2EILH 5HNHA 4S05A 1D0XA 2UWMA 2LBFB 2BGCA 2KRCA 3M8EA 3RI4A 2BXZA 3RQIA 2O7OA 2JUCA 3A03A 3E6BA 3OIOA 4ETSA 3Q3SA 1KYWA 1H9TA 2BV6A 3FXRA 1QHHD 4CXFA 1EKEA 1X2MA 5ED4A 4L0ZB 2EIJH 1LFBA 3FBIB 3QYBA 3TW7A 3DQVC 1LE8B 2V6EA 4YIFA 3KIOA 3W3CA 5K7HA 4IOCF 3R0JA 4E7KA 2IPQX 4IF4A 3QWLA 5DEQA 2Q1ZB 3K70D 4JK1X 2VASA 3BY6A 3IC7A 5CKTA 2D1HA 1IGNA 4B3XA 3BR6A 2UXXA 5EZGA 3CP2A 1KONA 2JSPA 2DT5A 2VLAA 1JKOC 2P4WA 1DP7P 3SXYA 2WY8Q 3AG1H 2H6BA 5CQGA 2VT3A 3I71A 3CLOA 2VBWA 3OS1A 1JTXA 2L3DA 1X1DA 2M3AA 4Y17A 1GXQA 4D5CA 2W48A 2KL4A 5BMZA 2CUEA 1I27A 1AOYA 2Z99A 2ELHA 3PL8A 5BNGA 4I6ZA 3H9JA 2K9MA 2F48A 4PGGA 4B48A 3S93A 5AONA 2IAIA 2KIMA 2ZNYA 5E79C 4LIUA 2OTJI 2ECBA 3N97A 4PGHA 1GVJA 5F0CA 1W5CC 4OOIA 3LOCA 3O8GA 1HQCA 2RDPA 4CCOA 2RQQA 1QZYA 2A07F 2P5KA 1IDZA 4W1UA 5ILUA 3QRFF 2EA2A 3K1PA 4YFKF 1MMSA 1RUOA 3FX3A 3CJRB 3K4LA 3MZHA 2D2WA 3BJAA 5E8IA 1ZN2A 3LA3A 2MGQA 3ZP5A 1RIOH 1S8NA 1P7JA 1X1PA 2DXIA 4WX9A 3HG9A 4XKBA 4BQQA 4AIJA 5M5YJ 2L9SA 3N4MA 3K70C 2VXDA 4BQOA 1B9NA 3LWFA 2KT0A 2JPBA 1U8RA 3HRSA 2M1BA 2Q8KA 4KITB 4BXUA 2Z16A 4DIQA 2GBYA 1S72I 3QPHA 1ZGJA 2EZHA 3S32A 4IHVA 2LY2A 5E1ZB 2FU4A 1T6SA 2DA4A 3B6AA 2NYXA 1NH3A 2V9PA 1SVLA 4YEJA 2QBYB 1HC8A 2IGNA 2ISYA 4AIDA 1X1CA 4N4NB 2KLOA 1T33A 3L7WA 3RCOA 3S1RJ 2F5DA 5FFZA 1IXSB 1QZZA 3VEPA 3OYIA 1G2HA 1E3OC 1QBJA 4KT6A 3CDIA 5GAGJ 3FK7A 1G59A 5H6QA 4GRIA 1VF9A 2WBMA 4BHCA 3COAC 3FISA 2XKOA 2MLKA 3BG9A 1R5ID 1BM9A 1YW7A 1MKMA 2B63J 1VTNC 5GADJ 4QPOA 5FLVA 3BG6A 1KU9A 3QOEA 1IDYA 2K40A 2PMZA 1SD4A 2X48A 3WU0A 4B1RA 3GW2A 2HWVA 3I55I 2LOOA 2RNGA 2LDUA 5E3MA 2P7VB 3WTWC 3A01A 3H0DA 2IS4A 1G6NA 4D0PA 1WWXA 5D8KB 2P0WA 4Y13A 3HOTA 2X6XA 1U5TB 3CD6I 2GQQA 3M1EA 3IHUA 2K9QA 2XUBA 3GBGA 1W5TA 2R7DA 5E3OA 4Y52J 3IRQA 4KT5C 3WE2A 3J7YJ 1IXRC 2CW8A 5C4JJ 3GFJA 2F5EA 1P2FA 2O6GE 3R6SA 4C3IJ 2ZJRF 2X51A 4HV6A 1MJBA 2HPMA 3HXLA 4Q47A 2IT0A 2Y0SN 3OYDA 3IV5A 1RESA 5F6FA 2DBBA 5DUKA 4I98B 1STZA 1EH6A 3CF2A 2KQRA 2M4KA 4NQWA 3OYCA 3LFKA 3BR3A 1LDDA 2DO7A 4OAZA 5JI6A 2FA5A 1MBGA 2L4MA 1IN7A 4BAYA 2BYVE 3EPZA 3NEUA 1KYZA 3OYNA 3BT9A 1LPQA 3G3ZA 3ECHA 3JRAA 4D1QA 3R0AA 4XKWA 3H35A 2O9LA 4M9XA 1X58A 5LHGA 3IKTA 1RZ4A 3DBHB 3O6BB 4LLLA 1P92A 1T8IA 2VJJA 3W6VA 1YJ9I 1QGPA 3BC8A 2VKHA 2LREA 3WTTC 1MBFA 4D9JA 2LVSA 1SVMA 2ZXWH 3FHNA 2EZLA 4XLFA 4KIBA 5DD8A 3SHFA 3VDXA 1H0MA 1UCRA 2QQ8A 4X1EA 2RREA 3F6OA 1XDSA 2IRFG 3S16J 3U21A 1H8AC 3Q0UA 2JA6J 3P7NA 2P7CB 5E1WA 3I54A 2FOWA 4FCYA 1D5VA 2BY3A 3O3KA 4O3MA 3KZZA 2FEZA 5LFAA 2STTA 3VFZA 2OUMA 2W4SA 1ON1A 4RAFA 1YE9A 4BEHB 1REPC 4M6YA 3K4KA 5DCFA 4M71A 3I64A 1DPRA 3J81K 4J19A 1WRJA 4A0ZA 3P9IA 1ZLKA 4UUVA 4IHXA 1UHSA 5L3BA 1WKMA 3K4MA 2XSDC 4BNCA 1RNLA 4S0HB 2FQ4A 2CSOA 3H92A 3RQ4A 1PDNC 4Y4RA 2OF7A 4H0EA 5JVTA 1IO2A 2DPDA 2F5VA 3K69A 1R5HA 1J75A 2W84A 4DGWB 1XMAA 4R8HA 4MIMA 1EH8A 2DOFA 1CF7A 1ETQA 3F8NA 4X0GA 1JGGA 3KYLA 1IRFA 5HLGA 2J5OA 2WY7Q 4RMNA 4UB6C 4A3EJ 2AQFA 2R7VA 5EEGA 1S6LA 3ZQCA 2DJIA 1LUJB 1A04A 2XAUA 5E18F 1WI9A 2QGUA 4A3GJ 1X4PA 1WPKA 5FLMJ 1BN5A 1XCVA 3C18A 4XONA 3CCEI 2E1OA 4A0XA 3GZ6A 3ABMH 3ZGKA 4L0YB 2COBA 1Z05A 2QZ8A 3H3VK 4BL0B 4RGXA 1Z3YA 1QRYA 2O61A 4A5NA 4IL6C 3X2QH 1W36D 3BCBA 2K4JA 2V6CA 1MZBA 3DF8A 4QWQA 2CW0F 1R7JA 1DGWY 4LB5A 3VOEA 1HOMA 5E3NA 4HF2A 2Z33A 4BDYA 2PMUA 3K9TA 2H8WA 3SDGA 2NVQJ 4QIWN 1YO5C 1FMWA 2VT2A 2LRDA 5HNFA 1D5YA 2VQGA 1SAUA 4OIRF 3TO6A 4EV0A 3ERMA 2DAOA 3CESA 2P5VA 4N0BA 1APLC 5DCMA 2ZB9A 4P5OA 4ESFA 3QU3A 3ZMZA 3ZQGA 1A36A 2HQAA 2QSHX 3HRTA 2LTPA 4E70A 2FNAA 3GXOA 1KQ8A 3J7ZI 1ZAOA 3FKJA 3S1QJ 4HZFA 1RKTA 3Q0WA 1Z3XA 4GDFA 1OJLA 2MABA 2R7UA 4BJTA 3K2AA 5FGMA 4NC8A 5ICCA 1O3SA 1U3EM 1TW2A 4EJUA 2LFBA 2PQ8A 5HS9A 4OIQF 4FTHA 4NBQA 1FT9A 2HZDA 3ML6A 1QPIA 1L3LA 4GYGA 2FNPA 4A3KJ 3HOSA 2XAQA 3EETA 1QNTA 1K78B 4XLEA 3F9KA 1Y8RB 5ILVA 3CCQI 4P9FA 5KVRA 4ENJA 4I99C 2IEKA 3AG4H 2E2IJ 2KHMA 3K4NA 3DWLE 3DPUA 4II3A 2ZBKA 2XSJC 3RZDJ 2XRLA 4ZYAA 2OC6A 3MMYB 4E7HA 5J1UA 2IGKA 3L00A 4RGRA 2VB6A 4A3BJ 1I6XA 3JRCA 3WTSC 4YRVA 1WJDA 4IHSA 3MKYB 1NHAA 3TP0A 2P8TA 1WGXA 5HOOA 2CUJA 1K61A 4MGRA 3ZQIA 2LR8A 3BLYA 4PJ0C 1R9TJ 2YPRA 1MSEC 2GA2A 5IP9J 3DLAA 3HKZA 4I0BA 2OZUA 1MDMA 4RLFA 4XLHA 1MBEA 4LK0F 1EV7A 2CV2A 1J7KA 2VC1A 2KZVA 2LY1A 4IQ4A 5F27A 4ENMA 3BJOA 1F1ZA 4XBFA 3W6KB 5IT9K 1P6RA 2DA1A 1V54H 3JAMK 3WTYC 2WADA 4ON0A 3DFGA 3AKZA 4BDZA 3LSJA 4K2EA 1LFUP 2RKHA 4A3CJ 2DDAA 3I9V2 3S17J 3CCSI 1P4AA 2K3FA 2QSGX 2XF6A 1X3WB 2GWRA 2M8EA 4LB6B 2YU3A 3E7LA 2NOJB 2ZC2A 4M73A 3HL2A 2R5ZA 3GMEA 3ONQA 5K5RA 2R5YA 4ANJA 4WF2A 1MD0A 1Z67A 1JKRC 1W0TA 2DTRA 4ENKA 2QKLB 1XSDA 1LEBA 1B9MA 2EZKA 1V4RA 1T39A 2QKMB 3KCCA 3V8LA 2FBHA 1PUFA 3LA2A 5LBQA 1R5GA 1X4OA 4LGWA 1UHWA 2XKPA 4EM2A 4ENNA 4WCGA 3W2WA 3TEDA 4NNJA 5FROA 4AYBN 4QLCU 1SC7A 2STWA 1RC9A 2OD5A 2YS9A 2VL8A 1ETOA 1IN5A 3CCUI 2ZJ2A 1W7PA 2XAGA 1SANA 2TCTA 1S29A 2JPCA 3BTIA 3OR1C 1QVTA 4BY1J 1SMTA 4Z6YA 3IH4A 4WK8F 4A6DA 3J80Z 2JA8J 2QVOA 2HNHA 2XGEA 4RAGA 3FZVA 4C9YA 4KFCA 3REOA 2DTZA 1U2WA 5KCMA 4U0YA 2K4BA 1G4DA 1KU3A 1Y0NA 4DBQA 3GTQJ 4PJMA 3NWSA 3WE3A 1MMAA 4MEXF 2M9HA 4PSXA 4PCQA 4OWRB 3LSRA 4PJLA 3GTOJ 1LQ1A 2L7ZA 4HA8A 3IWZA 4XN0A 1OYIA 4ZYDA 1BC7C 4U0WA 3SJMA 3OYKA 2K3PA 5F64A 5EGOA 1RKWA 2KJBA 3TO9A 3ZRGA 5A2QK 1IG7A 4EM0B 3QQAA 2L5QA 3BJ6A 1XSXA 1YW8A 2DI3A 3OYBA 3HIFA 5D5XB 2QQBA 1EF4A 2DODA 4KICA 4AM3A 3G4SI 4P96A 1X1AA 3RYRA 1TP4A 4G6DA 3VYSB 3WHBA 5FB2A 4UUSA 2W57A 5BOXA 3QAHA 1Z21A 1J9IA 3OYLA 3OYEA 1O7LA 2M30A 2KMUA 3FKIJ 4EJOA 2PLYA 4A93J 2P6SA 4G9YA 2N8GA 3GFIA 2PBIA 2XPUA 4DJAA 2R7XA 2IBDA 3BZCA 2QQAA 1T98A 3EUHA 3S15J 2GXBA 2WAFA 2V4JC 1FYMA 5IYDJ 1TQMA 1QQIA 1SFUA 3HRUA 1FP2A 2R7QA 4UXNA 5F04A 3MCZA 3HUGB 3PUBA 3BP8A 3V7SA 1JHFA 1YYVA 2UXNA 1IN8A 2XROA 3E5XA 4MNUA 5BQTA 4M3GA 1TW3A 3PSIA 1UZCA 2GZWA 2DJNA 2Y9ZA 2M45A 2Z9OA 3CP8A 3K10A 4A3JJ 2ID3A 2HEOA 2VXZA 2PJPA 4F93B 2X0LA 3H0GJ 3TDZC 3WG9A 2HYFA 2FSWA 3CC2I 2GIZA 1Q1VA 2K86A 2V1UA 5EG0B 4BY7J 3JSPA 3CDHA 5J4VA 2VOPA 3FMSA 4A69C 4YFNF 1D3YA 4HX8A 2LKPA 1YRNB 2LKSA 4RBOA 2DDBA 3BR2A 3TL4X 5L3GA 3WTXC 1JE8A 1V5GA 2MH9A 4V2GA 4GO1A 4CCLA 3IUOA 4DQ2A 2EIMH 3ZMSA 2M7BA 4JX6A 4F92B 3FXUA 1UFMA 4MTDA 3DBLB 5DS9A 1SEUA 4RDUA 5D5VB 3F0CA 1MIJA 2HVSA 1A6IA 4HV5A 1W7PD 2DMPA 2W1OA 1A6QA 3FXMA 3HGYA 1H9GA 2R7FA 3JTHA 4M3EA 4PUSA 3VSKA 3PM1A 1KU7A 5D4SA 5KAFC 4P55A 1MBJA 2E7WA 4OMYA 2Z5UA 2CH0A 2LH9A 3PQJA 3KP4A 3LFUA 2I10A 3DV8A 1FY7A 2E2HJ 2K27A 1R6RA 1U9OA 2A68F 2EFWA 2FE3A 1TTYA 1JT6A 1TNTA 2DOAA 3TO7A 1WJFA 3M9AA 2HTSA 1BR2A 4MFDA 1HW2A 3BWGA 1I39A 4AD9A 5IYCJ 2DQLA 2D45A 3JRBA 1K79A 3I53A 1S7EA 4G94A 5IPAA 5LD2C 2YUSA 3F8FA 1BW6A 3GEZA 1SFOJ 1ZH5A 3PO3J 5JFRA 1S5LC 3Q9VA 2LNBA 2NVUB 1VQ9I 3LL7A 1S3JA 1HSTA 3FK6A 5CLSA 5J4YA 1T56A 1BI2A 1R58A 2MLGA 1BOAA 2DT6A 3K0LA 1VFCA 1IV8A 2KPMA 2PMZN 3EYYA 3GLXA 2M0CA 2F6CA 4CH7A 1X3UA 3FF5A 5JHUA 1ZR2A 3KP3A 3T5XA 3GTJJ 2P5LC 2XGXA 4N4OB 5B1AH 1N78A 4IEJA 3DU6A 2X6WA 1IUYA 5F0FA 1FJLA 2H09A 3EDPA 2CV1A 4M72A 2XAHA 5J1YA 1YS7A 2BBYA 2X1CA 1OCZH 5HVQC 3WTUC 3CMMA 3ROUA 1GT0C 1DU6A 2C6YA 5M5WJ 3B02A 2OU2A 1LEAA 3HPHA 4JP0A 2JRTA 2W24A 2Y9YA 2ZNZA 2HOAA 4HG2A 1MMNA 1LKXA 3CQZJ 1UG2A 4B09A 5ICEA 1XB4A 3ZN0A 2E2JJ 1T0FA 2XVCA 4C2UA 3RTRA 5FO5A 3SFZA 1FOXA 1FTTA 4ESJA 3KP2A 2E36A 3HC7A 1O57A 4RM3A 3GTLJ 2ZMEA 3O2PE 2HDCA 4EEFG 2RC4A 3NWTA 3JRDA 1MBHA 2L2OA 2EWNA 1I3QJ 5K5OA 2EZIA 1XC5A 1IZ1A 2X85A 1OLTA 3FM3A 4V2FA 1WI3A 2IVMA 4I76A 3HOZJ 2IS1A 3K1NA 2HZTA 1U8BA 1IW7F 5L3CA 3BPXA 5C44J 1F36A 3T8TA 2CQ7A 2HKXA 1AKHA 4XKVA 1B6AA 3Q0VA 4ZH4F 3RKYA 5DV5A 4CCNA 4GXOA 1VQNI 2LF8A 1SMYF 4LFUA 2WAQA 3GF2A 4HDUA 4KN7X 3BPVA 4XR6A 3I4NJ 4P9UA 2V26A 3U1KA 1HXDA 4FX0A 2EB7A 3HOXJ 1O3TA 1BW5A 4XRFA 3F23A 1D0YA 1TL8A 3TOBA 4W97A 2DQRA 2VIXA 3J7AO 1ZRCA 4I09A 1OR7A 4ZTJA 1BIBA 1FSEA 5IP7J 3V4GA 2IS6A 1ZQ3P 4PFPA 4A3MJ 4BBSJ 3I0TA 5J6XA 1R1UA 4ZYGA 3BZ6A 3BR1A 4XM3A 3EUHC 3E97A 5K1YA 2JA7J 1YLFA 2JQ7A 2EFQA 3C2BA 1TWAJ 4U87A 1JUMA 4G6TB 1HKSA 4KMUX 2XHKA 3KPHA 3H3UA 5DUIA 2VE9A 4DYQA 3ELKA 1BR1A 2E1CA 4HNTA 4QPQA 2L54A 2KIUA 2IGMA 1XTAA 4GCVA 1BI0A 4MTEA 1Z9CA 4E7JA 3CMEI 1VI0A 5D6EA 4E7SA 4XNFA 3C7JA 3HOVJ 3M3YJ 3CCVI 3A01B 2CGPA 3BZKA 2PMHA 4L18B 4UY8I 3ECOA 2ETHA 4J00A 4E4HA 5H2FC 1F4KA 3WGHA 2TRTA 4CCJA 3K6GA 1BOBA 2KZGA 1FOKA 4I01A 3VYRB 3DPTA 3NRVA 3FMQA 2JA2A 4MLOA 4C3HJ 4ZJZA 3FHZA 3BOQA 1G3SA 1Z6RA 2OTLI 1LJ9A 2OPTA 2VQHA 2HYGD 4MHGA 1BL0A 1ONVA 4KJZA 1FMVA 2FJ1A 3K2ZA 5FKKA 1RR8C 3D5SC 4LD5A 3F72A 1BR4A 3ZCOA 1S7AA 2HOSA 2FQ3A 3C2HA 4PSWA 2B7EA 1YX5A 1YS6A 2BZTA 3CTAA 3H5NA 1ZG3A 3IH2A 2VQCA 4BE0A 2R7WA 4G7ZF 4BXXJ 3FXKA 1O7FA 1OCPA 4NC6A 4F7ZA 1FBQA 1HBXG 3JR9A 3FWEA 2E34A 4ZDOA 3SZGA 3DKXA 3ZMVA 4OMZA 4B43A 4G6QA 3CCRI 1O3QA 1VQKI 4PDKA 2DMQA 1R22A 2RNJA 2BXYA 1IRGA 3CUQA 2OAZA 5CQEA 4UV8A 4XN3A 4G7HF 4EM1A 2L01A 2HQRA 3H9GA 1HSJA 2H27A 2FBKA 4A12A 4EVIA 2PJRA 2TDXA 3JCUC 4IXAA 4D5FA 3G2BA 3RPUA 2H8RA 3MZ8A 3DTKA 4D7MA 3E5QA 1T08B 1ODDA 1YHQI 1Y8QB 3AFHA 3R60A 4IHTA 1ERDA 2DCEA 2BY0A 1SFKA 4IVNA 1P4WA 4RM2A 3WGGA 4EJVA 1K4SA 5EEAA 2DYRH 2V1DA 3KLNA 3SZPA 4E6KG 1FPQA 1FX7A 4UUTA 1A31A 3HOWJ 1Y39A 3VWBA 3PO2J 5J47A 1D1CA 3GTMJ 3WTVC 1EH7A 4FHTA 3GZNB 4IKFA 1KZHA 1TLHB 4XORA 2HTJA 2JUGA 1Z7LA 3AG2H 4LG0A 4Z2YA 4ZDLA 1EA3A 1FOYA 5CVIA 2LY9A 3PSFA 5IOZA 1DUXC 4IHYA 3U2RA 5HDGA 2EBIA 1OFCX 4B8XA 4B3AA 2L9NA 1ZARA 2E71A 1Y0UA 2R0QC 3EUKL 5TISC 1LDKB 4L9TA 5FKOA 1ACIA 4CYCA 1VQMI 1XX5A 1Z6TA 3F22A 4HQMA 1I6HJ 1P7IA 2V79A 1XGMA 2OBPA 4DOZA 1T0FC 2XAJA 3H1CA 4PZJA 4U7BA 2A6EF 1B8IA 2MW8A 2ZMEC 5B5EC 1YFHA 4RGUA 4A3IJ 3QPSA 2LSOA 4ITVA 3V42A 2CMPA 2M34A 1RUNA 4A3DJ 4B47A 2GOMA 2NAZA 4HLYA 2NVXJ 1JUSA 1CF7B 1T95A 5H20A 2R7SA 5GAEJ 3I4MJ 3WGIA 4EJTA 3GTGJ 2IXSA 3DTEA 2NVYJ 2V1XA 1TBXA 3HKZN 1HF0A 1GDTA 2WTEA 5LHIA 5F08A 5GP9A 5DM7F 1YW9A 3M07A 4FQGA 1JHHA 4UVBA 1Y6IA 3LQQA 1HA8A 2L02A 3SQNA 4GGGA 3S3OA 1ETYA 3DBRB 2M2EA 4EATA 5M5XJ 4Q4ZF 2BE5F 3J81Z 2VKEA 2KKOA 1N25A 3FBNB 4WXDA 4OINF 1MH3A 1PVEA 2K85A 2Q0OA 4LG3A 5B1BH 2NXNB 5D5UB 2UV1A 2JRMA 3MD2A 3U9GA 2VJIA 2Y75A 3F8MA 3BQZA 3VSLA 2O03A 3IWFA 2A05A 4NC7A 3CCYA 1OR7C 1FIPA 2FRHA 2W00A 5IYBJ 2ZFWA 3BDDA 2Y69H 3MKLA 2PI0A 2JTVA 5GAHJ 5DCMB 3F21A 3HOUJ 5FKLA 1K7AA 2MA3A 3QP5A 5FD5A 2Y31A 4B44A 5M3MJ 2NVTJ 2VKDA 5FLXK 1ETKA 2CWEA 5HLIA 3C1DA 5FFXA 3BCAA 2B9SA 5HDNA 2VODA 2Z2SB 2DK5A 4IJAA 4BGDA 2A61A 3FDYA 4XIDA 3OYHA 4OAYA 2K02A 3KYCB 2CQNA 2LC2A 1DP3A 2MYSA 3NAUA 2RGVA 3RPUD 3AL0C 2DA2A 4TV7A 2F4IA 2HXOA 5EZHA 2NOGA 2I5UA 3CCJI 1O3RA 4FX4A 4S04A 5TGTA 1X1BA 2CU7A 1DU0A 2HOTA 1L0OC 1UG0A 3OYGA 4MQVA 5LGUA 1IF1A 1ZKGA 3BG7A 3RKWA 1XCBA 3I59B 1VQPI 1QHGA 1GXPA 1YJWI 2JSCA 1PYVA 1JGSA 2A6TA 2OQRA 2CJJA 3KP7A 3ESWB 2AXTC 2NNNA 3M8FA 3IAS2 3CC7I 1YG2A 4BQAA 1ZLJA 3FMRA 5EYRA 4RAZA 3KP5A 5EF6A 1IXCA 5K7FA 3G71I 1WH7A 3WU1B 2LYCA 2CV0A 2A5WA 3J80K 4E7IA 4HNUA 1UAAA 2Q2EA 2ZKZA 1DGRM 2XAFA 3OV8A 2WA0A 1XMKA 2KP6A 4LJZF 1MGTA 3KEQA 4XOTA 3KETA 2DFIA 2EPFA 2H1KA 3IH3A 1WCMJ 5ERIA 4PJNA 3HHGA 3ZQFA 4M6VA 1D8KA 2W85A 4FETA 1TZLA 3B73A 3SYTA 3HSFA 3PUFA 1IJWC 2KDZA 2O3FA 4IO9F 2DOEA 1MMGA 2R92J 2HFHA 2LD5A 4G8XA 1B72A 1MDMB 3ERED 4CICA 2MC4A 4L9NA 5DM6F 3CUQC 1FIAA 3C3WA 2QM3A 3FM5A 4UB8C 1LB2A 1VNDA 2Y2ZA 3TQNA 2L9RA 4KDPA 1A35A 2AO9A 3HGGA 3PFIA 2VONA 1K83J 1KA8A 1NG7A 3LSGA 5FJ8J 2R7TA 4RAYA 1B1BA 3VPRA 4V19K 1TWFJ 2R5ZB 4CGZA 4U0VA 1FWZA 5JR3A 2R5YB 4AWXB 4M9ZA 2ZO4A 3A2KA 3HZJA 5ICFA 1Y1WJ 1OYWA 1WQ2A 4R1HA 5B3SH 4C3JJ 2L7MP 5J8CA 1PUFB 1QU3A 4Q48A 2G9WA 5CVUA 1TQIA 2ZCWA 3I58A 4YIIA 1SVOA 4A0YA 1D1BA 4LITA 4XMYA 4ZTFA 1OKRA 1QO0D 1ZGWA 4DNCA 2ACJA 3IKVA 3TGNA 1ITYA 3S2DJ 1W7PB 2BW3B 2WV0A 1HLVA 2ME0A 5B66C 4BACA 9ANTA 5IT9Z 4ASNA 4L9JA 3JAMZ 2O5RA 5LEKA 3WHCA 3CUOA 1HW5A 3FXLA 1KGSA 1A5JA 1G3YA 2BHYA 3DPLC 4BH9A 5HODA 4YELA 4IRGA 1WJ5A 3LSPA 5CVVA 2BY1A 3OWTA 4YG2F 1JKQC 2A5YB 3RIRA 2KISA 4II2A 1SD5A 1LVKA 4MQ9F 3BTCA 4MEYF 2QEXI 1SFEA 2DN0A 1K4TA 4RB2C 2HDWA 1Z7UA 2VI6A 5EGOB 4J01A 5K7ZA 2VE8A 1W1WE 3LSHA 3RYPA 1ULYA 3V7CA 3BQYA 2XV4S 3G73A 1W0UA 1QZEA 3OIQA 3QOPA 5HS7A 4YFXF 1YI2I 3WU2C 3ZPLA 3P5JA 3QODA 1NG6A 4GYIA 3G1OA 2EH3A 3EQLF 4CDGA 2XDVA 1XN7A 3L2WA 1ETVA 1XG1A 1U0JA 2DA6A 3E3VA 5L3FA 4Q5SF 2O8KA 3HOYJ 3JW4A 3KFWX 4UUSB 3UKGA 1LVAA 3S3NA 5J40A 2W25A 5AIPA 4CO8A 2VBXA 2IP2A 2YSRA 3H5RA 2LP0A 5L3DA 3UNGC 4HQEA 3DKYA 4OU0A 4Y33A 4XK4A 2GAUA 4OIPF 2HS5A 2Y48A 2CRGA 4XLNF 3ABUA 4DZJA 1LNWA 4LLNA 1XSVA 4FT8A 3U1DA 1WJBA 2MD0A 1PJRA 1J59A 3DCFA 3RZOJ 3L09A 3WTZA 1IN4A 4HOBA 4I7HA 2JN6A 5KHDA 4EMSA 4HW0A 2V1NA 3C2GA 4BJ6C 4IX7A 3LQRA 3J7AY 2LKXA 2HKOA 2LBFA 2JK3A 4DW6A 4L9VA 1IN6A 1JUPA 1J2XA 3TBIA 3QYFA 2MG4A 5A2QZ 2CYYA 2BHZA 3H9QA 2HU9A 3KX2A 2GM4A 1X3ZB 4M6XA 2WB1A 4IRIA 2O0YA 2OQGA 4JX4A 4WWCA 1WVRA 2RAEA 3V8JA 2OZ6A 2M5WA 2VQLA 1ON2A 2BY2A 3K4JA 3D5RC 2CFOA 5FKNA 1LE8A 4HF1A 2ELKA 4X6AJ 5HLHA 5TJJA 4HBLA 2BVMA 2R3SA 3K4CA 1BI1A 1GVDA 3ASNH 5ICGA 3P9KA 1AWCA 4AVZA 5C3EJ 5DYMA 3TP3A 2K9NA 2GA1A 4I2OA 3OSGA 4EGZA 3L2RA 1W5SA 2VPLA 4XSXF 2JWTA 5EEHA 4CSWA 3JRGA 5HDKA 2ZFUA 1PP8F 4ZYEA 3HSEA 4NB5A 5DTDA 1C0WA 3G1MA 3H3ZA 2A3SA 1E0EA 3ZOBA 4AU7A 2XC7A 4I02A 4L5EA 3BTJA 2OJED 3OYMA 5F0HA 1VQLI 2V9KA 1ENHA 1RI7A 3LSTA 3TOAA 2WAQN 3NARA 4AIKA 1POGA 3LAPA 2XF7A 2ZXJA 2DU9A 4HSTA 4XKCA 2L7FP 2FXAA 3S8PA 1TWGJ 4KIFA 1FBUA 1FZPB 2OV7A 5LGNA 3RKXA 5DDGA 1YTYA 2EFOA 3QPTA 1USSA 4HF0A 3WODF 4EGYA 1RRJA 3IRRA 2VOOA 2DFHA 4R79A 3CO7C 3A1YA 4C2TA 2L7KA 3CC4I 4KYWA 5EDNA 3CCMI 3CMYA 4E7LA 1IV6A 4GFBA 1SFXA 5H6RA 2BVLA 4RLQA 1IC8A 4HPQA 1WH5A 2ID6A 4ESBA 2QYOA 3NQOA 3E6CC 3ZQQA 2PEXA 1JKPC 2XRNA 4BBRJ 1Y1VJ 4MO7A 4H4KC 2R7OA 3JRHA 2X9DA 1LDJA 2DFEA 4UNOA 3K7AJ
chains in the Genus database with same CATH topology
3ABTA 5D6FA 4A2UA 4HLXA 1Z1DA 4M74A 2XIGA 2HQNA 3S2WA 2IA2A 2QUFA 1YQAA 2G7HA 2EV6A 2HOEA 3E6MA 3KP6A 5LRRA 2MH2A 1OMIA 2VBZA 4OIOF 2RV8A 2X4HA 3L9FA 2QBYA 4WXHA 2J5PA 2FOKA 3KZYA 4RB3C 3K1MA 2ZMEB 1ZGAA 1ZG5A 5ILSA 3MEXA 3HRMA 5J8FA 4IRHA 3F6VA 3AAFA 1PUEE 2QENA 2UZKA 1ZG1A 2KIFA 4KMFA 3MQ0A 1HKQA 5LRSA 1BBYA 2H94A 1B59A 1R1TA 4UV9A 2ESHA 4UVAA 2LF7A 5E20A 2NRAC 4AIHA 1U5TA 3ZMDA 1FSHA 4KUMA 2F5CA 3Q5FA 1R36A 1KQ0A 1ZYRF 1GHCA 3HHHA 2PFBA 2MBFA 3MWMA 3HSRA 4KNYA 4KA4A 2QQ9A 4HAMA 1R00A 3W6JB 2A69F 5DD4A 1I5ZA 3P9CA 1KQ9A 3ZMTA 4L5IA 2QWWA 1ZREA 1R23A 2IJLA 4LK1F 2A6HF 2VN2A 3DP7A 1XD7A 2MD5A 5BPIA 5CYVA 2CQKA 1Q1HA 2KJCA 1FC3A 1FBSA 3D5LA 2BEOA 5IT3A 3TKYA 4ZZDA 3CJNA 1CGPA 1DDNA 3I5UA 3HYIA 3ISPA 2EFNA 2PN6A 4CZZA 3GWZA 5CVRA 5E1XA 1FLIA 3FXQA 4I0AA 1HKTA 2F5FA 4BHPA 5TRDA 3DEUA 3CUQB 3RPQA 3TDUC 1ZHFA 3QP6A 1SD6A 2EJRA 3CO6C 2DW4A 2VC0A 4LLGF 3JTGA 3RJPA 5AIQA 1U78A 2JZYA 2NNYA 1OYYA 3ZQ7A 2RVCA 1SD7A 1G3WA 3R61A 1D8JA 4WXCA 3T0YA 5FD6A 4NHJA 5HS8A 5BS6A 1V3FA 3GVAA 1E17A 2QLZA 1F5TA 2F2EA 3GX4X 3I4PA 2IA0A 4LG0B 1UB9A 4JBAA 2KRFA 4XSZF 1TQPA 4RB1A 1T2KA 3GFMA 2CFXA 4L5JA 5KK1A 3F3XA 4CYDA 4BHBA 2NS0A 1FNNA 2D1VA 2EK5A 1F9NA 4Y15A 5CVJA 3RDIA 1YIOA 2OA4A 2YX7A 1J0RA 4A6EA 2RN7A 2DK8A 5D5WB 4HX4A 1ZRDA 4RGSA 3F8CA 4EQQA 1KU2A 3HTSB 3MAJA 2H6CA 4G7OF 2JT1A 4U7DA 1U5TC 1DPUA 1K78A 4O5VA 2ESNA 2IW5A 2E1NA 2L4AA 1XGOA 3QU6A 3GYHX 4BYYA 1T38A 4AVPA 4HDVA 1P4XA 3Q9SA 1ZRFA 3HTUA 2EA4A 1R1VA 3VODA 5D8LB 3T1BA 5CJ9A 3KLOA 2ADUA 3JSOA 2G7UA 3I59A 4IPAA 3PQKA 3ZN1A 2DPUA 3M7GA 1XGNA 5E8GA 2FF4A 3KE2A 3MFKA 3GZ5A 4KN4X 2E7XA 3SZTA 1K6OA 2P6TA 5L3EA 3D0SA 2M87A 4JQFA 2DLLA 3ULQB 2YR2A 1IAWA 4ZZLA 2YX4A 1G3TA 1MJAA 5LLQA 5K5QA 4XLPF 3GO5A 2HGCA 4LMYA 1JXSA 1W4MA 2Y0MA 1B4AA 1QPMA 3LA7A 5FLXZ 3V7RA 1J5YA 3BROA 1S7OA 4RB0A 1MJ9A 1HW1A 1BIAA 4M9SA 1TNSA 3LAJA 3DXJF 2EV5A 3GFLA 4N9IA 2FBIA 2O8XA 2VBYA 3V8KA 1U6GA 2AS5F 1FP1D 3IL2A 4N9HA 2AXLA 3ZMUA 5E17F 3L2CA 1OPCA 1XDUA 2RQPA 2EFPA 6PAXA 1BJAA 3KEOA 2WWYA 2PG4A 5BPDA 4RS8A 1FYLA 2GIVA 2CG4A 1BI3A 4HX7A 1I1GA 2FMYA 3T8RA 2K7LA 2MC3A 4A5MA 1WSUA 1E2XA 2HR3A 2ISZA 5F1RA 4U88A 1PP7U 1XGSA 1UHMA 5LGTA 3HUGA 2FMLA 4O6JA 1FYKA 2Z3YA 3E5UA 4HYEA 2GXGA 3OOPA 3MZYA 3F8BA 5LHHA 1Z91A 2COMA 1BC8C 4ZYHA 5D4RA 3EYIA 4KIGA 3R4KA 1SAXA 2B0LA 2XASA 4UVCA 3GUDA 1I1SA 2WC2A 5LEJA 1USTA 2CO5A 3E6DA 2IA1A 4UHTA 2EV0A 3VB2A 2V9VA 3DKWA 4CHUA 4EJWA 4S05A 2UWMA 2BGCA 3RI4A 3M8EA 3E6BA 4ETSA 1KYWA 1H9TA 2BV6A 3FXRA 4CXFA 5ED4A 4L0ZB 3DQVC 4YIFA 3R0JA 2IPQX 4IF4A 5DEQA 4JK1X 3BY6A 3IC7A 2D1HA 2UXXA 2DT5A 2P4WA 1DP7P 3SXYA 2H6BA 2VT3A 3I71A 3CLOA 2VBWA 2L3DA 4Y17A 1GXQA 5BMZA 1I27A 1AOYA 2Z99A 2ELHA 4PGGA 5AONA 2KIMA 2ZNYA 3N97A 4PGHA 1GVJA 4OOIA 1HQCA 2RDPA 1QZYA 2A07F 2P5KA 5ILUA 3QRFF 2EA2A 3K1PA 4YFKF 1RUOA 3FX3A 3MZHA 2D2WA 3BJAA 5E8IA 1ZN2A 3LA3A 3ZP5A 1RIOH 1S8NA 4WX9A 4AIJA 3N4MA 1B9NA 3LWFA 2JPBA 1U8RA 3HRSA 2M1BA 2Q8KA 4BXUA 3QPHA 1ZGJA 5E1ZB 2FU4A 1T6SA 2NYXA 2QBYB 2ISYA 3L7WA 2F5DA 5FFZA 1IXSB 1QZZA 3VEPA 1QBJA 5H6QA 4BHCA 3COAC 2XKOA 2MLKA 1BM9A 1YW7A 1MKMA 1VTNC 1KU9A 1SD4A 3WU0A 3GW2A 2HWVA 2LDUA 2P7VB 3WTWC 1G6NA 4D0PA 1WWXA 5D8KB 4Y13A 3HOTA 1U5TB 2GQQA 3M1EA 3IHUA 2XUBA 1W5TA 2R7DA 3IRQA 4KT5C 3WE2A 1IXRC 3GFJA 2F5EA 1P2FA 2O6GE 3R6SA 4HV6A 1MJBA 4Q47A 2IT0A 5F6FA 2DBBA 5DUKA 4I98B 1STZA 1EH6A 4NQWA 3LFKA 1LDDA 2DO7A 5JI6A 2FA5A 2L4MA 1IN7A 4BAYA 2BYVE 3NEUA 1KYZA 3G3ZA 3ECHA 3R0AA 4M9XA 5LHGA 3IKTA 1RZ4A 4LLLA 3O6BB 1P92A 1QGPA 3WTTC 4KIBA 5DD8A 3SHFA 1H0MA 1UCRA 3F6OA 1XDSA 2IRFG 3P7NA 2P7CB 5E1WA 3I54A 1D5VA 3O3KA 4O3MA 3KZZA 2FEZA 2STTA 3VFZA 1ON1A 1REPC 4M6YA 5DCFA 4M71A 3I64A 1DPRA 3J81K 1WRJA 4A0ZA 3P9IA 1ZLKA 4UUVA 5L3BA 1WKMA 4BNCA 1RNLA 2CSOA 3H92A 1PDNC 4H0EA 5JVTA 2DPDA 3K69A 1R5HA 1J75A 2W84A 1XMAA 4R8HA 1EH8A 1CF7A 3F8NA 1IRFA 5HLGA 2J5OA 5EEGA 1S6LA 1A04A 5E18F 1WI9A 1BN5A 1XCVA 3C18A 4A0XA 3GZ6A 4L0YB 1Z05A 2QZ8A 4RGXA 2O61A 4A5NA 2K4JA 2V6CA 1MZBA 3DF8A 4QWQA 2CW0F 1R7JA 4LB5A 3VOEA 4HF2A 2Z33A 2PMUA 3K9TA 1YO5C 2VT2A 4OIRF 3TO6A 4EV0A 2DAOA 2P5VA 4N0BA 5DCMA 4P5OA 4ESFA 3QU3A 3ZMZA 3HRTA 4E70A 2FNAA 3GXOA 1KQ8A 1ZAOA 4HZFA 5FGMA 5ICCA 1O3SA 1U3EM 1TW2A 4EJUA 2PQ8A 5HS9A 4OIQF 1FT9A 3ML6A 1L3LA 4GYGA 2FNPA 3HOSA 2XAQA 3EETA 1QNTA 1K78B 5ILVA 4P9FA 5KVRA 4ENJA 2ZBKA 3L00A 4RGRA 1I6XA 3WTSC 4IHSA 1NHAA 2P8TA 5HOOA 4MGRA 2YPRA 2GA2A 4I0BA 1MDMA 2OZUA 4LK0F 1EV7A 1J7KA 2VC1A 4ENMA 3BJOA 1F1ZA 4XBFA 3W6KB 5IT9K 1P6RA 3JAMK 3WTYC 4ON0A 3DFGA 4K2EA 2RKHA 1P4AA 2GWRA 2M8EA 4LB6B 2YU3A 4M73A 5K5RA 4WF2A 1MD0A 2DTRA 4ENKA 1XSDA 1LEBA 1B9MA 1V4RA 1T39A 3KCCA 3V8LA 2FBHA 3LA2A 5LBQA 1R5GA 4LGWA 1UHWA 2XKPA 4EM2A 4ENNA 4WCGA 4QLCU 2STWA 2OD5A 1IN5A 2ZJ2A 1W7PA 2XAGA 1S29A 2JPCA 1SMTA 4WK8F 4A6DA 3J80Z 2QVOA 4KFCA 3FZVA 3REOA 1U2WA 4U0YA 2K4BA 1G4DA 1KU3A 3WE3A 4MEXF 4PCQA 1LQ1A 4HA8A 3IWZA 1OYIA 4ZYDA 1BC7C 4U0WA 5F64A 2KJBA 3TO9A 5A2QK 4EM0B 3BJ6A 1XSXA 1YW8A 2DI3A 3HIFA 5D5XB 2QQBA 4KICA 4P96A 3RYRA 4G6DA 5FB2A 5BOXA 2W57A 3QAHA 1J9IA 1O7LA 2M30A 4EJOA 2PLYA 2P6SA 4G9YA 3GFIA 2PBIA 2QQAA 1T98A 3EUHA 2GXBA 1FYMA 1TQMA 1QQIA 1SFUA 3HRUA 1FP2A 4UXNA 3MCZA 3BP8A 3V7SA 1JHFA 1YYVA 2UXNA 1IN8A 2XROA 3E5XA 4MNUA 5BQTA 1TW3A 2GZWA 2M45A 2Z9OA 2HEOA 2VXZA 2PJPA 2X0LA 3TDZC 3WG9A 2HYFA 2FSWA 2K86A 2V1UA 3JSPA 3CDHA 2VOPA 3FMSA 4YFNF 1D3YA 4HX8A 2LKPA 5L3GA 3WTXC 1JE8A 2MH9A 4GO1A 4DQ2A 3ZMSA 3FXUA 1UFMA 4MTDA 5D5VB 4HV5A 1W7PD 3JTHA 1H9GA 2R7FA 1KU7A 5D4SA 4P55A 2E7WA 4OMYA 2Z5UA 3PQJA 3KP4A 3DV8A 1FY7A 2K27A 2A68F 2EFWA 2FE3A 1TTYA 1TNTA 3TO7A 3M9AA 2HTSA 1HW2A 3BWGA 4AD9A 2DQLA 2D45A 1K79A 3I53A 4G94A 3F8FA 3GEZA 1ZH5A 5JFRA 3Q9VA 2LNBA 1S3JA 1HSTA 5CLSA 1BI2A 1R58A 2MLGA 1BOAA 3K0LA 3EYYA 3GLXA 1X3UA 3FF5A 5JHUA 3KP3A 3T5XA 2P5LC 2XGXA 1IUYA 2H09A 3EDPA 4M72A 2XAHA 1YS7A 2BBYA 5HVQC 3WTUC 3ROUA 2C6YA 3B02A 2OU2A 1LEAA 2JRTA 2W24A 2ZNZA 4B09A 5ICEA 3ZN0A 1XB4A 1T0FA 2XVCA 3RTRA 5FO5A 3SFZA 4ESJA 3KP2A 1O57A 2ZMEA 3O2PE 2HDCA 2RC4A 2EWNA 5K5OA 1IZ1A 3FM3A 2IVMA 3K1NA 2HZTA 1IW7F 5L3CA 3BPXA 3T8TA 2HKXA 1B6AA 4ZH4F 3RKYA 5DV5A 4GXOA 2LF8A 1SMYF 4LFUA 3GF2A 4HDUA 4KN7X 3BPVA 4P9UA 1HXDA 4FX0A 2EB7A 1O3TA 4XRFA 3F23A 3TOBA 2DQRA 3J7AO 1ZRCA 4I09A 1OR7A 1BIBA 1FSEA 3V4GA 3I0TA 5J6XA 1R1UA 4ZYGA 3BZ6A 5K1YA 3E97A 1YLFA 2EFQA 1HKSA 4KMUX 2XHKA 3H3UA 5DUIA 2VE9A 2E1CA 3ELKA 2L54A 2KIUA 4GCVA 1BI0A 4MTEA 1Z9CA 5D6EA 3C7JA 2CGPA 2PMHA 4L18B 3ECOA 2ETHA 1F4KA 3WGHA 1FOKA 4I01A 3DPTA 3NRVA 3FMQA 3FHZA 3BOQA 1G3SA 1Z6RA 1LJ9A 2HYGD 4MHGA 1ONVA 3K2ZA 4LD5A 3F72A 1S7AA 2FQ3A 1YS6A 3CTAA 1ZG3A 4G7ZF 1O7FA 4F7ZA 1FBQA 1HBXG 3FWEA 3ZMVA 4OMZA 4G6QA 1O3QA 4PDKA 1R22A 2RNJA 1IRGA 3CUQA 2OAZA 4UV8A 4G7HF 4EM1A 2L01A 2HQRA 1HSJA 2H27A 2FBKA 4A12A 4EVIA 2TDXA 4IXAA 3RPUA 3E5QA 1ODDA 3R60A 4IHTA 4IVNA 1P4WA 3WGGA 4EJVA 2V1DA 3KLNA 3SZPA 1FPQA 1FX7A 3WTVC 1EH7A 4FHTA 1TLHB 2HTJA 4LG0A 4Z2YA 5CVIA 1DUXC 3U2RA 5HDGA 4B8XA 1ZARA 1Y0UA 1LDKB 4L9TA 1Z6TA 3F22A 4HQMA 2V79A 1XGMA 2OBPA 2XAJA 4PZJA 4U7BA 2A6EF 1YFHA 4RGUA 2LSOA 1RUNA 4HLYA 2NAZA 1CF7B 5H20A 3WGIA 4EJTA 2V1XA 1TBXA 2WTEA 5LHIA 1YW9A 1JHHA 4UVBA 3LQQA 2L02A 3SQNA 4GGGA 4Q4ZF 2BE5F 3J81Z 2KKOA 4WXDA 4OINF 2Q0OA 5D5UB 3U9GA 2Y75A 3F8MA 2O03A 3IWFA 2FRHA 2ZFWA 3BDDA 2PI0A 2JTVA 5DCMB 3F21A 1K7AA 2MA3A 3QP5A 5FD5A 5FLXK 5HLIA 2CWEA 3C1DA 5FFXA 5HDNA 2VODA 2DK5A 4IJAA 2A61A 2K02A 2RGVA 4TV7A 1O3RA 4FX4A 4S04A 1L0OC 4MQVA 5LGUA 1IF1A 3RKWA 1XCBA 3I59B 1GXPA 2JSCA 2OQRA 1JGSA 3KP7A 2NNNA 3M8FA 1YG2A 4BQAA 1ZLJA 3FMRA 4RAZA 3KP5A 1IXCA 3WU1B 3J80K 2Q2EA 2ZKZA 2XAFA 3OV8A 1XMKA 4LJZF 3KETA 1MGTA 3KEQA 2DFIA 5ERIA 3HHGA 1D8KA 2W85A 3B73A 3HSFA 2O3FA 2HFHA 4G8XA 1MDMB 3ERED 4CICA 4L9NA 3CUQC 3C3WA 2QM3A 3FM5A 1LB2A 3TQNA 4KDPA 3PFIA 2VONA 1KA8A 4RAYA 1B1BA 4CGZA 4U0VA 1FWZA 5JR3A 4AWXB 4M9ZA 2ZO4A 5ICFA 1OYWA 1WQ2A 4R1HA 5J8CA 4Q48A 2G9WA 5CVUA 1TQIA 2ZCWA 3I58A 4YIIA 4A0YA 1OKRA 1QO0D 4DNCA 2ACJA 3IKVA 3TGNA 1W7PB 2WV0A 5IT9Z 4ASNA 4L9JA 3JAMZ 5LEKA 3CUOA 1HW5A 1KGSA 1G3YA 3DPLC 4BH9A 4IRGA 5CVVA 4YG2F 2A5YB 3RIRA 1SD5A 4MQ9F 4MEYF 1SFEA 4RB2C 1Z7UA 2VE8A 3RYPA 1ULYA 3V7CA 2XV4S 3G73A 4YFXF 3QOPA 5HS7A 3ZPLA 4GYIA 3EQLF 4CDGA 1XN7A 3E3VA 5L3FA 4Q5SF 3JW4A 3KFWX 1LVAA 2W25A 4CO8A 5AIPA 2VBXA 2IP2A 2YSRA 5L3DA 4HQEA 4OU0A 2GAUA 4OIPF 2HS5A 2Y48A 4XLNF 4LLNA 3ABUA 1LNWA 3U1DA 1XSVA 4FT8A 1J59A 3L09A 3WTZA 1IN4A 4HOBA 4I7HA 4EMSA 4HW0A 3LQRA 2HKOA 4L9VA 1IN6A 1J2XA 5A2QZ 2CYYA 4IRIA 4M6XA 2O0YA 2OQGA 4WWCA 3V8JA 2OZ6A 2M5WA 1ON2A 4HF1A 5HLHA 5TJJA 4HBLA 2R3SA 1BI1A 1AWCA 5ICGA 3P9KA 5DYMA 4I2OA 2GA1A 4EGZA 1W5SA 4XSXF 5EEHA 5HDKA 1PP8F 4ZYEA 3HSEA 4NB5A 1C0WA 3H3ZA 2A3SA 4I02A 1RI7A 3LSTA 3TOAA 4AIKA 3LAPA 2ZXJA 2DU9A 2FXAA 4KIFA 1FBUA 1FZPB 5LGNA 3RKXA 5DDGA 1YTYA 2EFOA 3QPTA 1USSA 4HF0A 3WODF 4EGYA 2VOOA 3IRRA 4R79A 3CO7C 4KYWA 1SFXA 5H6RA 4ESBA 2QYOA 3NQOA 3E6CC 2PEXA 2XRNA 1LDJA 4UNOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ABT A;  5D6F A;  4A2U A;  4HLX A;  1Z1D A;  4M74 A;  2XIG A;  2HQN A;  3S2W A;  2IA2 A;  2QUF A;  1YQA A;  2G7H A;  2EV6 A;  2HOE A;  3E6M A;  3KP6 A;  5LRR A;  2MH2 A;  1OMI A;  2VBZ A;  4OIO F;  2RV8 A;  2X4H A;  3L9F A;  2QBY A;  4WXH A;  2J5P A;  2FOK A;  3KZY A;  4RB3 C;  3K1M A;  2ZME B;  1ZGA A;  1ZG5 A;  5ILS A;  3MEX A;  3HRM A;  5J8F A;  4IRH A;  3F6V A;  3AAF A;  1PUE E;  2QEN A;  2UZK A;  1ZG1 A;  2KIF A;  4KMF A;  3MQ0 A;  1HKQ A;  5LRS A;  1BBY A;  2H94 A;  1B59 A;  1R1T A;  4UV9 A;  2ESH A;  4UVA A;  2LF7 A;  5E20 A;  2NRA C;  4AIH A;  1U5T A;  3ZMD A;  1FSH A;  4KUM A;  2F5C A;  3Q5F A;  1R36 A;  1KQ0 A;  1ZYR F;  1GHC A;  3HHH A;  2PFB A;  2MBF A;  3MWM A;  3HSR A;  4KNY A;  4KA4 A;  2QQ9 A;  4HAM A;  1R00 A;  3W6J B;  2A69 F;  5DD4 A;  1I5Z A;  3P9C A;  1KQ9 A;  3ZMT A;  4L5I A;  2QWW A;  1ZRE A;  1R23 A;  2IJL A;  4LK1 F;  2A6H F;  2VN2 A;  3DP7 A;  1XD7 A;  2MD5 A;  5BPI A;  5CYV A;  2CQK A;  1Q1H A;  2KJC A;  1FC3 A;  1FBS A;  3D5L A;  2BEO A;  5IT3 A;  3TKY A;  4ZZD A;  3CJN A;  1CGP A;  1DDN A;  3I5U A;  3HYI A;  3ISP A;  2EFN A;  2PN6 A;  4CZZ A;  3GWZ A;  5CVR A;  5E1X A;  1FLI A;  3FXQ A;  4I0A A;  1HKT A;  2F5F A;  4BHP A;  5TRD A;  3DEU A;  3CUQ B;  3RPQ A;  3TDU C;  1ZHF A;  3QP6 A;  1SD6 A;  2EJR A;  3CO6 C;  2DW4 A;  2VC0 A;  4LLG F;  3JTG A;  3RJP A;  5AIQ A;  1U78 A;  2JZY A;  2NNY A;  1OYY A;  3ZQ7 A;  2RVC A;  1SD7 A;  1G3W A;  3R61 A;  1D8J A;  4WXC A;  3T0Y A;  5FD6 A;  4NHJ A;  5HS8 A;  5BS6 A;  1V3F A;  3GVA A;  1E17 A;  2QLZ A;  1F5T A;  2F2E A;  3GX4 X;  3I4P A;  2IA0 A;  4LG0 B;  1UB9 A;  4JBA A;  2KRF A;  4XSZ F;  1TQP A;  4RB1 A;  1T2K A;  3GFM A;  2CFX A;  4L5J A;  5KK1 A;  3F3X A;  4CYD A;  4BHB A;  2NS0 A;  1FNN A;  2D1V A;  2EK5 A;  1F9N A;  4Y15 A;  5CVJ A;  3RDI A;  1YIO A;  2OA4 A;  2YX7 A;  1J0R A;  4A6E A;  2RN7 A;  2DK8 A;  5D5W B;  4HX4 A;  1ZRD A;  4RGS A;  3F8C A;  4EQQ A;  1KU2 A;  3HTS B;  3MAJ A;  2H6C A;  4G7O F;  2JT1 A;  4U7D A;  1U5T C;  1DPU A;  1K78 A;  4O5V A;  2ESN A;  2IW5 A;  2E1N A;  2L4A A;  1XGO A;  3QU6 A;  3GYH X;  4BYY A;  1T38 A;  4AVP A;  4HDV A;  1P4X A;  3Q9S A;  1ZRF A;  3HTU A;  2EA4 A;  1R1V A;  3VOD A;  5D8L B;  3T1B A;  5CJ9 A;  3KLO A;  2ADU A;  3JSO A;  2G7U A;  3I59 A;  4IPA A;  3PQK A;  3ZN1 A;  2DPU A;  3M7G A;  1XGN A;  5E8G A;  2FF4 A;  3KE2 A;  3MFK A;  3GZ5 A;  4KN4 X;  2E7X A;  3SZT A;  1K6O A;  2P6T A;  5L3E A;  3D0S A;  2M87 A;  4JQF A;  2DLL A;  3ULQ B;  2YR2 A;  1IAW A;  4ZZL A;  2YX4 A;  1G3T A;  1MJA A;  5LLQ A;  5K5Q A;  4XLP F;  3GO5 A;  2HGC A;  4LMY A;  1JXS A;  1W4M A;  2Y0M A;  1B4A A;  1QPM A;  3LA7 A;  5FLX Z;  3V7R A;  1J5Y A;  3BRO A;  1S7O A;  4RB0 A;  1MJ9 A;  1HW1 A;  1BIA A;  4M9S A;  1TNS A;  3LAJ A;  3DXJ F;  2EV5 A;  3GFL A;  4N9I A;  2FBI A;  2O8X A;  2VBY A;  3V8K A;  1U6G A;  2AS5 F;  1FP1 D;  3IL2 A;  4N9H A;  2AXL A;  3ZMU A;  5E17 F;  3L2C A;  1OPC A;  1XDU A;  2RQP A;  2EFP A;  6PAX A;  1BJA A;  3KEO A;  2WWY A;  2PG4 A;  5BPD A;  4RS8 A;  1FYL A;  2GIV A;  2CG4 A;  1BI3 A;  4HX7 A;  1I1G A;  2FMY A;  3T8R A;  2K7L A;  2MC3 A;  4A5M A;  1WSU A;  1E2X A;  2HR3 A;  2ISZ A;  5F1R A;  4U88 A;  1PP7 U;  1XGS A;  1UHM A;  5LGT A;  3HUG A;  2FML A;  4O6J A;  1FYK A;  2Z3Y A;  3E5U A;  4HYE A;  2GXG A;  3OOP A;  3MZY A;  3F8B A;  5LHH A;  1Z91 A;  2COM A;  1BC8 C;  4ZYH A;  5D4R A;  3EYI A;  4KIG A;  3R4K A;  1SAX A;  2B0L A;  2XAS A;  4UVC A;  3GUD A;  1I1S A;  2WC2 A;  5LEJ A;  1UST A;  2CO5 A;  3E6D A;  2IA1 A;  4UHT A;  2EV0 A;  3VB2 A;  2V9V A;  3DKW A;  4CHU A;  4EJW A;  4S05 A;  2UWM A;  2BGC A;  3RI4 A;  3M8E A;  3E6B A;  4ETS A;  1KYW A;  1H9T A;  2BV6 A;  3FXR A;  4CXF A;  5ED4 A;  4L0Z B;  3DQV C;  4YIF A;  3R0J A;  2IPQ X;  4IF4 A;  5DEQ A;  4JK1 X;  3BY6 A;  3IC7 A;  2D1H A;  2UXX A;  2DT5 A;  2P4W A;  1DP7 P;  3SXY A;  2H6B A;  2VT3 A;  3I71 A;  3CLO A;  2VBW A;  2L3D A;  4Y17 A;  1GXQ A;  5BMZ A;  1I27 A;  1AOY A;  2Z99 A;  2ELH A;  4PGG A;  5AON A;  2KIM A;  2ZNY A;  3N97 A;  4PGH A;  1GVJ A;  4OOI A;  1HQC A;  2RDP A;  1QZY A;  2A07 F;  2P5K A;  5ILU A;  3QRF F;  2EA2 A;  3K1P A;  4YFK F;  1RUO A;  3FX3 A;  3MZH A;  2D2W A;  3BJA A;  5E8I A;  1ZN2 A;  3LA3 A;  3ZP5 A;  1RIO H;  1S8N A;  4WX9 A;  4AIJ A;  3N4M A;  1B9N A;  3LWF A;  2JPB A;  1U8R A;  3HRS A;  2M1B A;  2Q8K A;  4BXU A;  3QPH A;  1ZGJ A;  5E1Z B;  2FU4 A;  1T6S A;  2NYX A;  2QBY B;  2ISY A;  3L7W A;  2F5D A;  5FFZ A;  1IXS B;  1QZZ A;  3VEP A;  1QBJ A;  5H6Q A;  4BHC A;  3COA C;  2XKO A;  2MLK A;  1BM9 A;  1YW7 A;  1MKM A;  1VTN C;  1KU9 A;  1SD4 A;  3WU0 A;  3GW2 A;  2HWV A;  2LDU A;  2P7V B;  3WTW C;  1G6N A;  4D0P A;  1WWX A;  5D8K B;  4Y13 A;  3HOT A;  1U5T B;  2GQQ A;  3M1E A;  3IHU A;  2XUB A;  1W5T A;  2R7D A;  3IRQ A;  4KT5 C;  3WE2 A;  1IXR C;  3GFJ A;  2F5E A;  1P2F A;  2O6G E;  3R6S A;  4HV6 A;  1MJB A;  4Q47 A;  2IT0 A;  5F6F A;  2DBB A;  5DUK A;  4I98 B;  1STZ A;  1EH6 A;  4NQW A;  3LFK A;  1LDD A;  2DO7 A;  5JI6 A;  2FA5 A;  2L4M A;  1IN7 A;  4BAY A;  2BYV E;  3NEU A;  1KYZ A;  3G3Z A;  3ECH A;  3R0A A;  4M9X A;  5LHG A;  3IKT A;  1RZ4 A;  4LLL A;  3O6B B;  1P92 A;  1QGP A;  3WTT C;  4KIB A;  5DD8 A;  3SHF A;  1H0M A;  1UCR A;  3F6O A;  1XDS A;  2IRF G;  3P7N A;  2P7C B;  5E1W A;  3I54 A;  1D5V A;  3O3K A;  4O3M A;  3KZZ A;  2FEZ A;  2STT A;  3VFZ A;  1ON1 A;  1REP C;  4M6Y A;  5DCF A;  4M71 A;  3I64 A;  1DPR A;  3J81 K;  1WRJ A;  4A0Z A;  3P9I A;  1ZLK A;  4UUV A;  5L3B A;  1WKM A;  4BNC A;  1RNL A;  2CSO A;  3H92 A;  1PDN C;  4H0E A;  5JVT A;  2DPD A;  3K69 A;  1R5H A;  1J75 A;  2W84 A;  1XMA A;  4R8H A;  1EH8 A;  1CF7 A;  3F8N A;  1IRF A;  5HLG A;  2J5O A;  5EEG A;  1S6L A;  1A04 A;  5E18 F;  1WI9 A;  1BN5 A;  1XCV A;  3C18 A;  4A0X A;  3GZ6 A;  4L0Y B;  1Z05 A;  2QZ8 A;  4RGX A;  2O61 A;  4A5N A;  2K4J A;  2V6C A;  1MZB A;  3DF8 A;  4QWQ A;  2CW0 F;  1R7J A;  4LB5 A;  3VOE A;  4HF2 A;  2Z33 A;  2PMU A;  3K9T A;  1YO5 C;  2VT2 A;  4OIR F;  3TO6 A;  4EV0 A;  2DAO A;  2P5V A;  4N0B A;  5DCM A;  4P5O A;  4ESF A;  3QU3 A;  3ZMZ A;  3HRT A;  4E70 A;  2FNA A;  3GXO A;  1KQ8 A;  1ZAO A;  4HZF A;  5FGM A;  5ICC A;  1O3S A;  1U3E M;  1TW2 A;  4EJU A;  2PQ8 A;  5HS9 A;  4OIQ F;  1FT9 A;  3ML6 A;  1L3L A;  4GYG A;  2FNP A;  3HOS A;  2XAQ A;  3EET A;  1QNT A;  1K78 B;  5ILV A;  4P9F A;  5KVR A;  4ENJ A;  2ZBK A;  3L00 A;  4RGR A;  1I6X A;  3WTS C;  4IHS A;  1NHA A;  2P8T A;  5HOO A;  4MGR A;  2YPR A;  2GA2 A;  4I0B A;  1MDM A;  2OZU A;  4LK0 F;  1EV7 A;  1J7K A;  2VC1 A;  4ENM A;  3BJO A;  1F1Z A;  4XBF A;  3W6K B;  5IT9 K;  1P6R A;  3JAM K;  3WTY C;  4ON0 A;  3DFG A;  4K2E A;  2RKH A;  1P4A A;  2GWR A;  2M8E A;  4LB6 B;  2YU3 A;  4M73 A;  5K5R A;  4WF2 A;  1MD0 A;  2DTR A;  4ENK A;  1XSD A;  1LEB A;  1B9M A;  1V4R A;  1T39 A;  3KCC A;  3V8L A;  2FBH A;  3LA2 A;  5LBQ A;  1R5G A;  4LGW A;  1UHW A;  2XKP A;  4EM2 A;  4ENN A;  4WCG A;  4QLC U;  2STW A;  2OD5 A;  1IN5 A;  2ZJ2 A;  1W7P A;  2XAG A;  1S29 A;  2JPC A;  1SMT A;  4WK8 F;  4A6D A;  3J80 Z;  2QVO A;  4KFC A;  3FZV A;  3REO A;  1U2W A;  4U0Y A;  2K4B A;  1G4D A;  1KU3 A;  3WE3 A;  4MEX F;  4PCQ A;  1LQ1 A;  4HA8 A;  3IWZ A;  1OYI A;  4ZYD A;  1BC7 C;  4U0W A;  5F64 A;  2KJB A;  3TO9 A;  5A2Q K;  4EM0 B;  3BJ6 A;  1XSX A;  1YW8 A;  2DI3 A;  3HIF A;  5D5X B;  2QQB A;  4KIC A;  4P96 A;  3RYR A;  4G6D A;  5FB2 A;  5BOX A;  2W57 A;  3QAH A;  1J9I A;  1O7L A;  2M30 A;  4EJO A;  2PLY A;  2P6S A;  4G9Y A;  3GFI A;  2PBI A;  2QQA A;  1T98 A;  3EUH A;  2GXB A;  1FYM A;  1TQM A;  1QQI A;  1SFU A;  3HRU A;  1FP2 A;  4UXN A;  3MCZ A;  3BP8 A;  3V7S A;  1JHF A;  1YYV A;  2UXN A;  1IN8 A;  2XRO A;  3E5X A;  4MNU A;  5BQT A;  1TW3 A;  2GZW A;  2M45 A;  2Z9O A;  2HEO A;  2VXZ A;  2PJP A;  2X0L A;  3TDZ C;  3WG9 A;  2HYF A;  2FSW A;  2K86 A;  2V1U A;  3JSP A;  3CDH A;  2VOP A;  3FMS A;  4YFN F;  1D3Y A;  4HX8 A;  2LKP A;  5L3G A;  3WTX C;  1JE8 A;  2MH9 A;  4GO1 A;  4DQ2 A;  3ZMS A;  3FXU A;  1UFM A;  4MTD A;  5D5V B;  4HV5 A;  1W7P D;  3JTH A;  1H9G A;  2R7F A;  1KU7 A;  5D4S A;  4P55 A;  2E7W A;  4OMY A;  2Z5U A;  3PQJ A;  3KP4 A;  3DV8 A;  1FY7 A;  2K27 A;  2A68 F;  2EFW A;  2FE3 A;  1TTY A;  1TNT A;  3TO7 A;  3M9A A;  2HTS A;  1HW2 A;  3BWG A;  4AD9 A;  2DQL A;  2D45 A;  1K79 A;  3I53 A;  4G94 A;  3F8F A;  3GEZ A;  1ZH5 A;  5JFR A;  3Q9V A;  2LNB A;  1S3J A;  1HST A;  5CLS A;  1BI2 A;  1R58 A;  2MLG A;  1BOA A;  3K0L A;  3EYY A;  3GLX A;  1X3U A;  3FF5 A;  5JHU A;  3KP3 A;  3T5X A;  2P5L C;  2XGX A;  1IUY A;  2H09 A;  3EDP A;  4M72 A;  2XAH A;  1YS7 A;  2BBY A;  5HVQ C;  3WTU C;  3ROU A;  2C6Y A;  3B02 A;  2OU2 A;  1LEA A;  2JRT A;  2W24 A;  2ZNZ A;  4B09 A;  5ICE A;  3ZN0 A;  1XB4 A;  1T0F A;  2XVC A;  3RTR A;  5FO5 A;  3SFZ A;  4ESJ A;  3KP2 A;  1O57 A;  2ZME A;  3O2P E;  2HDC A;  2RC4 A;  2EWN A;  5K5O A;  1IZ1 A;  3FM3 A;  2IVM A;  3K1N A;  2HZT A;  1IW7 F;  5L3C A;  3BPX A;  3T8T A;  2HKX A;  1B6A A;  4ZH4 F;  3RKY A;  5DV5 A;  4GXO A;  2LF8 A;  1SMY F;  4LFU A;  3GF2 A;  4HDU A;  4KN7 X;  3BPV A;  4P9U A;  1HXD A;  4FX0 A;  2EB7 A;  1O3T A;  4XRF A;  3F23 A;  3TOB A;  2DQR A;  3J7A O;  1ZRC A;  4I09 A;  1OR7 A;  1BIB A;  1FSE A;  3V4G A;  3I0T A;  5J6X A;  1R1U A;  4ZYG A;  3BZ6 A;  5K1Y A;  3E97 A;  1YLF A;  2EFQ A;  1HKS A;  4KMU X;  2XHK A;  3H3U A;  5DUI A;  2VE9 A;  2E1C A;  3ELK A;  2L54 A;  2KIU A;  4GCV A;  1BI0 A;  4MTE A;  1Z9C A;  5D6E A;  3C7J A;  2CGP A;  2PMH A;  4L18 B;  3ECO A;  2ETH A;  1F4K A;  3WGH A;  1FOK A;  4I01 A;  3DPT A;  3NRV A;  3FMQ A;  3FHZ A;  3BOQ A;  1G3S A;  1Z6R A;  1LJ9 A;  2HYG D;  4MHG A;  1ONV A;  3K2Z A;  4LD5 A;  3F72 A;  1S7A A;  2FQ3 A;  1YS6 A;  3CTA A;  1ZG3 A;  4G7Z F;  1O7F A;  4F7Z A;  1FBQ A;  1HBX G;  3FWE A;  3ZMV A;  4OMZ A;  4G6Q A;  1O3Q A;  4PDK A;  1R22 A;  2RNJ A;  1IRG A;  3CUQ A;  2OAZ A;  4UV8 A;  4G7H F;  4EM1 A;  2L01 A;  2HQR A;  1HSJ A;  2H27 A;  2FBK A;  4A12 A;  4EVI A;  2TDX A;  4IXA A;  3RPU A;  3E5Q A;  1ODD A;  3R60 A;  4IHT A;  4IVN A;  1P4W A;  3WGG A;  4EJV A;  2V1D A;  3KLN A;  3SZP A;  1FPQ A;  1FX7 A;  3WTV C;  1EH7 A;  4FHT A;  1TLH B;  2HTJ A;  4LG0 A;  4Z2Y A;  5CVI A;  1DUX C;  3U2R A;  5HDG A;  4B8X A;  1ZAR A;  1Y0U A;  1LDK B;  4L9T A;  1Z6T A;  3F22 A;  4HQM A;  2V79 A;  1XGM A;  2OBP A;  2XAJ A;  4PZJ A;  4U7B A;  2A6E F;  1YFH A;  4RGU A;  2LSO A;  1RUN A;  4HLY A;  2NAZ A;  1CF7 B;  5H20 A;  3WGI A;  4EJT A;  2V1X A;  1TBX A;  2WTE A;  5LHI A;  1YW9 A;  1JHH A;  4UVB A;  3LQQ A;  2L02 A;  3SQN A;  4GGG A;  4Q4Z F;  2BE5 F;  3J81 Z;  2KKO A;  4WXD A;  4OIN F;  2Q0O A;  5D5U B;  3U9G A;  2Y75 A;  3F8M A;  2O03 A;  3IWF A;  2FRH A;  2ZFW A;  3BDD A;  2PI0 A;  2JTV A;  5DCM B;  3F21 A;  1K7A A;  2MA3 A;  3QP5 A;  5FD5 A;  5FLX K;  5HLI A;  2CWE A;  3C1D A;  5FFX A;  5HDN A;  2VOD A;  2DK5 A;  4IJA A;  2A61 A;  2K02 A;  2RGV A;  4TV7 A;  1O3R A;  4FX4 A;  4S04 A;  1L0O C;  4MQV A;  5LGU A;  1IF1 A;  3RKW A;  1XCB A;  3I59 B;  1GXP A;  2JSC A;  2OQR A;  1JGS A;  3KP7 A;  2NNN A;  3M8F A;  1YG2 A;  4BQA A;  1ZLJ A;  3FMR A;  4RAZ A;  3KP5 A;  1IXC A;  3WU1 B;  3J80 K;  2Q2E A;  2ZKZ A;  2XAF A;  3OV8 A;  1XMK A;  4LJZ F;  3KET A;  1MGT A;  3KEQ A;  2DFI A;  5ERI A;  3HHG A;  1D8K A;  2W85 A;  3B73 A;  3HSF A;  2O3F A;  2HFH A;  4G8X A;  1MDM B;  3ERE D;  4CIC A;  4L9N A;  3CUQ C;  3C3W A;  2QM3 A;  3FM5 A;  1LB2 A;  3TQN A;  4KDP A;  3PFI A;  2VON A;  1KA8 A;  4RAY A;  1B1B A;  4CGZ A;  4U0V A;  1FWZ A;  5JR3 A;  4AWX B;  4M9Z A;  2ZO4 A;  5ICF A;  1OYW A;  1WQ2 A;  4R1H A;  5J8C A;  4Q48 A;  2G9W A;  5CVU A;  1TQI A;  2ZCW A;  3I58 A;  4YII A;  4A0Y A;  1OKR A;  1QO0 D;  4DNC A;  2ACJ A;  3IKV A;  3TGN A;  1W7P B;  2WV0 A;  5IT9 Z;  4ASN A;  4L9J A;  3JAM Z;  5LEK A;  3CUO A;  1HW5 A;  1KGS A;  1G3Y A;  3DPL C;  4BH9 A;  4IRG A;  5CVV A;  4YG2 F;  2A5Y B;  3RIR A;  1SD5 A;  4MQ9 F;  4MEY F;  1SFE A;  4RB2 C;  1Z7U A;  2VE8 A;  3RYP A;  1ULY A;  3V7C A;  2XV4 S;  3G73 A;  4YFX F;  3QOP A;  5HS7 A;  3ZPL A;  4GYI A;  3EQL F;  4CDG A;  1XN7 A;  3E3V A;  5L3F A;  4Q5S F;  3JW4 A;  3KFW X;  1LVA A;  2W25 A;  4CO8 A;  5AIP A;  2VBX A;  2IP2 A;  2YSR A;  5L3D A;  4HQE A;  4OU0 A;  2GAU A;  4OIP F;  2HS5 A;  2Y48 A;  4XLN F;  4LLN A;  3ABU A;  1LNW A;  3U1D A;  1XSV A;  4FT8 A;  1J59 A;  3L09 A;  3WTZ A;  1IN4 A;  4HOB A;  4I7H A;  4EMS A;  4HW0 A;  3LQR A;  2HKO A;  4L9V A;  1IN6 A;  1J2X A;  5A2Q Z;  2CYY A;  4IRI A;  4M6X A;  2O0Y A;  2OQG A;  4WWC A;  3V8J A;  2OZ6 A;  2M5W A;  1ON2 A;  4HF1 A;  5HLH A;  5TJJ A;  4HBL A;  2R3S A;  1BI1 A;  1AWC A;  5ICG A;  3P9K A;  5DYM A;  4I2O A;  2GA1 A;  4EGZ A;  1W5S A;  4XSX F;  5EEH A;  5HDK A;  1PP8 F;  4ZYE A;  3HSE A;  4NB5 A;  1C0W A;  3H3Z A;  2A3S A;  4I02 A;  1RI7 A;  3LST A;  3TOA A;  4AIK A;  3LAP A;  2ZXJ A;  2DU9 A;  2FXA A;  4KIF A;  1FBU A;  1FZP B;  5LGN A;  3RKX A;  5DDG A;  1YTY A;  2EFO A;  3QPT A;  1USS A;  4HF0 A;  3WOD F;  4EGY A;  2VOO A;  3IRR A;  4R79 A;  3CO7 C;  4KYW A;  1SFX A;  5H6R A;  4ESB A;  2QYO A;  3NQO A;  3E6C C;  2PEX A;  2XRN A;  1LDJ A;  4UNO A; 
#chains in the Genus database with same CATH topology
 2MSY A;  3ABT A;  5D6F A;  2HXI A;  4A2U A;  4HRI A;  1OIS A;  4HLX A;  1Z1D A;  4M74 A;  2QSF X;  2XIG A;  2HQN A;  4M3F A;  1JJ6 C;  3A4C A;  2IA2 A;  3S2W A;  1I50 J;  2QUF A;  2R93 J;  5IOY A;  2VJ4 A;  2IS2 A;  1YQA A;  2G7H A;  2P81 A;  2VJ5 A;  2XB0 X;  1XPX A;  3G1L A;  2E1M C;  2EV6 A;  2HOE A;  1D1A A;  3E6M A;  3KP6 A;  3N05 A;  3GTP J;  5LRR A;  3OSF A;  2MH2 A;  1OMI A;  1CQT A;  2VBZ A;  2X1E A;  1MNE A;  2Z1D A;  3I3L A;  4P1W A;  4OIO F;  2RV8 A;  3M1C A;  2X4H A;  4LOC A;  2LLK A;  2VPR A;  3L9F A;  3PNT A;  3HB9 A;  3TMO A;  2QBY A;  5FRN A;  5JLW A;  4WXH A;  2J5P A;  2FOK A;  2HQ5 A;  4FIS A;  3KZY A;  1UJ8 A;  4XRS G;  4RB3 C;  2ZJQ F;  3W2V A;  2GLO A;  3S2H J;  4BXF A;  1VZ0 A;  3OR2 C;  1MBK A;  3K1M A;  2KFD A;  2ZME B;  1ZGA A;  1ZG5 A;  5ILS A;  3MEX A;  3HRM A;  5J8F A;  4IRH A;  2ME6 A;  3F6V A;  2I8D A;  3AAF A;  1PUE E;  2QEN A;  2AQE A;  4XLC A;  2UZK A;  3FIW A;  3JRI A;  1ZG1 A;  2KIF A;  1OCR H;  2KDO A;  4KMF A;  2V7F A;  3B6C A;  1DQU A;  3MQ0 A;  3DTI A;  3PFY A;  2FX0 A;  1HKQ A;  5LRS A;  1BBY A;  2H94 A;  4F91 B;  1IRX A;  4E7Z A;  4DZP A;  1AKH B;  1B59 A;  1N77 A;  1R1T A;  4UV9 A;  1TT0 A;  2ESH A;  4UVA A;  2LF7 A;  5E20 A;  3IP4 B;  2VKV A;  4BKX A;  4XRS A;  2NRA C;  4AIH A;  1U5T A;  2UUZ A;  4CA0 A;  3PIP F;  3ZMD A;  2R4G A;  4F3Q A;  1AHD P;  3HPG A;  4G12 A;  1FSH A;  2DMT A;  3LMM A;  3PNV A;  2NS7 A;  4KUM A;  1S9H A;  1OCO H;  2E5N A;  2F5C A;  3Q5F A;  1JI8 A;  1R36 A;  1KQ0 A;  1ZYR F;  1GHC A;  3HHH A;  2PFB A;  2MBF A;  3MWM A;  3HSR A;  4BUP A;  4BJ5 C;  3HM5 A;  3ZQL A;  4KNY A;  4PFO A;  2W7N A;  1ORK A;  4KA4 A;  1N75 A;  1GV5 A;  2QQ9 A;  3BTL A;  4HAM A;  2M4G A;  4IZZ A;  5JLX A;  4M3D A;  1R00 A;  1WFX A;  2A69 F;  3W6J B;  5DD4 A;  1I5Z A;  2H1L A;  3P9C A;  1KQ9 A;  3ZMT A;  4L5I A;  2QWW A;  1ZRE A;  4CCM A;  2JJ7 A;  3GCM A;  2CQQ A;  1R23 A;  2L0K A;  1OCC H;  1GLN A;  2IJL A;  4LK1 F;  4XLA A;  2A6H F;  1YIT I;  2VN2 A;  3MKZ A;  1VQ4 I;  3DP7 A;  2HVR A;  1XD7 A;  3AL0 B;  1F43 A;  2XF5 A;  2JVG A;  2MD5 A;  5BPI A;  5CYV A;  4NUB A;  2CQK A;  3I56 I;  3ABK H;  1Q1H A;  2KJC A;  2LMD A;  1FC3 A;  1FBS A;  2FD5 A;  4IQJ A;  4NQW B;  5IP6 A;  3D5L A;  4JYK A;  3OS2 A;  2BEO A;  1JT0 A;  3PJR A;  2JVH A;  1M1E B;  3GLL A;  3D1N I;  3CJQ B;  3L2V A;  5IT3 A;  3TKY A;  4ZZD A;  3CJN A;  1GUU A;  1ZR4 A;  3AG3 H;  4QSH A;  1CGP A;  4BU2 A;  1DDN A;  2R7R A;  3I5U A;  3CZ6 A;  5GTI C;  3HYI A;  3S14 J;  2PX9 A;  3ISP A;  4Y3O A;  4XIC A;  1RPW A;  2EFN A;  2M7A A;  2OCE A;  4M3B A;  2PN6 A;  5HLT A;  4CZZ A;  3GWZ A;  5CVR A;  5E1X A;  1FLI A;  3KZI C;  1E3P A;  3M4O J;  3FXQ A;  1EJ9 A;  5FRM A;  1I3A A;  3JRF A;  3MKW B;  4I0A A;  1HKT A;  1MSF C;  2F5F A;  2WV1 A;  5F1J A;  4BEH A;  4QTR A;  2HPI A;  4BHP A;  5TRD A;  3DEU A;  3PNY A;  1WJA A;  1R49 A;  3IAM 2;  4HEA 2;  3CJT B;  1TC3 C;  3CUQ B;  1V5F A;  3RPQ A;  3TDU C;  3K4B A;  1HDD C;  1ZHF A;  3QP6 A;  1SD6 A;  1VQ7 I;  2EJR A;  3CO6 C;  2DW4 A;  2VC0 A;  4LLG F;  3JTG A;  2PJR B;  3RJP A;  3WG7 H;  5AIQ A;  3A0H C;  1U78 A;  2JZY A;  2NNY A;  1OYY A;  3ZQ7 A;  2RVC A;  1SD7 A;  1RET A;  1G3W A;  3R61 A;  1D8J A;  3S3M A;  3BG3 A;  4Y7N J;  4LIV A;  1R4N B;  4WXC A;  2NS8 A;  4A3F J;  3T0Y A;  5FD6 A;  4NHJ A;  3HBL A;  5BS6 A;  5HS8 A;  1V3F A;  2Y0S A;  3GVA A;  1E17 A;  2LK2 A;  2QLZ A;  5FKM A;  2XPW A;  3GTK J;  1F5T A;  3LSK A;  3VYT B;  4F55 A;  2F2E A;  3GX4 X;  1OCT C;  1MW7 A;  3JRE A;  5M3F J;  3I4P A;  4MFE A;  2IA0 A;  2E60 A;  3DEE A;  3QPL A;  5KNL A;  1QA6 A;  4LG0 B;  1UB9 A;  2FUG 2;  4AUX A;  4JBA A;  2KRF A;  4XSZ F;  3G6E I;  4KIS A;  2OCC H;  1TQP A;  4RB1 A;  1BA5 A;  1T2K A;  3GFM A;  3LSI A;  2X1D A;  1MNM C;  1YOV B;  2CFX A;  2EIN H;  4L5J A;  5KK1 A;  2ZSH B;  3F3X A;  4CYD A;  3ZXS A;  4BHB A;  4CYC B;  2R7Z J;  2NS0 A;  4BE2 A;  1FNN A;  1WJC A;  3L2Q A;  2D5V A;  2D1V A;  2EK5 A;  3OOU A;  1F9N A;  4Y15 A;  1H88 C;  3RSN A;  5CPR B;  5CVJ A;  3RDI A;  1B8I B;  1YIO A;  1Z0X A;  1HCR A;  2E35 A;  3A0B C;  2OA4 A;  2YX7 A;  1AU7 A;  2XB5 A;  1J0R A;  4A6E A;  1MND A;  1OQY A;  4FE7 A;  3BG5 A;  1FEX A;  2DFF A;  2RN7 A;  4BS9 A;  2DK8 A;  1JJ8 C;  4CUG A;  5D5W B;  4HX4 A;  1ZRD A;  1QVU A;  3UR3 C;  3PIO F;  2L9V A;  3F8C A;  4RGS A;  4EQQ A;  1KU2 A;  4IOA F;  2DA3 A;  1AA7 A;  2ZSI B;  2K9S A;  3HTS B;  1MH4 A;  1VQ5 I;  3MAJ A;  2X6O A;  3OYF A;  3CF5 F;  2H6C A;  4G7O F;  2JT1 A;  4U7D A;  3H5A A;  4YIR X;  1H89 C;  2JA5 J;  1U5T C;  1DPU A;  1K78 A;  4O5V A;  2ESN A;  3LSM A;  2IW5 A;  3TW6 A;  2E1N A;  2L4A A;  1XGO A;  1GV2 A;  2DYS H;  2QCO A;  3DU5 A;  1HDP A;  3QU6 A;  4XRM A;  3GYH X;  4RA2 A;  4BYY A;  1T38 A;  1P9Q C;  4AVP A;  4HDV A;  2XGC A;  1P4X A;  3Q9S A;  1ZRF A;  3HTU A;  2EA4 A;  1ETX A;  1ZEL A;  1R1V A;  3ABL H;  3VOD A;  5D8L B;  3BR5 A;  3EUA A;  3T1B A;  2CW7 A;  5CJ9 A;  5J1R A;  3KLO A;  3FXO A;  2ADU A;  4AC0 A;  5GPA A;  3JSO A;  3SFI A;  1D0Z A;  4BQN A;  2G7U A;  3I59 A;  4IPA A;  1IRZ A;  3MVP A;  2HDD A;  2XGD A;  3PQK A;  1YJN I;  3ZN1 A;  2DPU A;  3M7G A;  1Z77 A;  4DYR A;  1XGN A;  1NK2 P;  3DEW A;  5E8G A;  5JVG F;  2M0M A;  2CUF A;  3H36 A;  1W36 C;  2FF4 A;  3L2U A;  2AHQ A;  4ABZ A;  4FE4 A;  4XQF A;  1XMX A;  3KE2 A;  3MFK A;  3CDL A;  3GZ5 A;  4KN4 X;  1UEL B;  2MFZ A;  2BOL A;  2E7X A;  4HSR A;  2CQX A;  3SZT A;  5C4X J;  1K6O A;  2P6T A;  4ZC3 A;  5L3E A;  3CCL I;  3D0S A;  2G0E A;  2M87 A;  4JQF A;  2YU9 J;  2DLL A;  3ULQ B;  3E1S A;  2YR2 A;  1IAW A;  4ZZL A;  2YX4 A;  3OMY A;  1G3T A;  1MJA A;  2F4O B;  2JMW A;  2W82 A;  5LLQ A;  3CLQ A;  5K5Q A;  4XLP F;  1TWH J;  2HYJ A;  3GO5 A;  2HGC A;  4LMY A;  3OYJ A;  2ZJP F;  1JXS A;  1W4M A;  2Y0M A;  2Q2E B;  1B4A A;  1QPM A;  3LA7 A;  5FLX Z;  3CMA I;  3V7R A;  2QF7 A;  1WJE A;  1J5Y A;  3BRO A;  1S7O A;  4RB0 A;  1MJ9 A;  1HW1 A;  2DA5 A;  2QA4 I;  1BIA A;  4JX5 A;  4NDL A;  3DLL F;  4M9S A;  1TNS A;  3LAJ A;  3DXJ F;  1XS9 A;  2EV5 A;  3GFL A;  4N9I A;  3LNQ A;  2FBI A;  1B72 B;  2O8X A;  2HVQ A;  2VBY A;  3V8K A;  1U6G A;  4PK4 A;  2HI3 A;  1WHU A;  5KAI C;  2AS5 F;  1FP1 D;  1FTZ A;  1LFP A;  4PJJ A;  3IL2 A;  4N9H A;  1TWC J;  3S1M J;  4IHW A;  3OL3 A;  1JTY A;  2AXL A;  2ECC A;  1YX3 A;  3ZMU A;  5E17 F;  2BW3 A;  2ELJ A;  3L2C A;  2WAE A;  3OIP A;  4C2M J;  3HJE A;  1OPC A;  2KRH A;  2WB1 N;  5EJC A;  1XDU A;  2RQP A;  1RR7 A;  2EFP A;  1BJA A;  6PAX A;  2GOX B;  3KEO A;  1YIJ I;  3W2A A;  1IUF A;  2WWY A;  2F4M B;  2PG4 A;  3ZQH A;  4RS8 A;  5BPD A;  1FYL A;  2E1M B;  2CG4 A;  2GIV A;  2E5Z A;  1BI3 A;  2DA7 A;  3M8J A;  4HX7 A;  1K6Y A;  1I1G A;  2FMY A;  3T8R A;  1J09 A;  3S1N J;  2E19 A;  1O4X A;  4A3L J;  4FAS D;  5JHF A;  2XPV A;  1G8X A;  1X19 A;  4D7N A;  4XL9 A;  1TT5 B;  2K7L A;  2EIK H;  2MC3 A;  3RKQ A;  2ZXH A;  1VQ6 I;  4A5M A;  1WSU A;  1E2X A;  1ZTR A;  5GTH C;  2HR3 A;  2ISZ A;  5F1R A;  3OS0 A;  1NTC A;  3HDD A;  3SEQ A;  2KIQ A;  4U88 A;  1PP7 U;  2LG4 A;  2EQR A;  1XGS A;  1UHM A;  5J3L A;  1UMQ A;  2M8G X;  3SDB A;  2IGO A;  5LGT A;  3MN2 A;  3HUG A;  1BJZ A;  2FML A;  4C30 A;  4O6J A;  1FYK A;  3O8H A;  3BR0 A;  2ZXI A;  2Z3Y A;  3E5U A;  4HYE A;  1ETW A;  1MMD A;  2GXG A;  2K5C A;  1VQO I;  1V55 H;  4DBR A;  4BE1 A;  3OOP A;  3L1P A;  3MZY A;  3F8B A;  5LHH A;  1Z91 A;  4CZC A;  2COM A;  2VUM J;  3OL4 A;  1BC8 C;  4ZYH A;  4ZDP A;  2DMU A;  3QYE A;  1FOW A;  5D4R A;  3EYI A;  3OYA A;  2ICW G;  2Y30 A;  4KIG A;  3HEF A;  3VYU B;  3R4K A;  5IY5 H;  5EG0 A;  1SAX A;  3A02 A;  1U9N A;  2CUZ A;  1Y56 A;  2B0L A;  2K9L A;  2XAS A;  4CCK A;  4UVC A;  3OY9 A;  4AYB A;  1ZK8 A;  3ZR8 X;  3GUD A;  4B4C A;  3E0J B;  3KEY A;  1I1S A;  1YRN A;  3KYD B;  1WZ2 A;  2X6Y A;  2WC2 A;  4XOP A;  2GXA A;  4DYC A;  1V5E A;  5E3L A;  2DMN A;  2DT7 B;  4F52 A;  3ASO H;  1NK3 P;  5LEJ A;  1R4M B;  2CS3 A;  1UST A;  2CO5 A;  3E6D A;  4HNV A;  2IA1 A;  4UHT A;  5GPC A;  2EV0 A;  3VB2 A;  4JOM A;  2V9V A;  1X2N A;  3DKW A;  3FXJ A;  1E3H A;  4CHU A;  3SEZ A;  1R71 A;  4EJW A;  1VQ8 I;  2EIL H;  5HNH A;  4S05 A;  1D0X A;  2UWM A;  2LBF B;  2BGC A;  2KRC A;  3M8E A;  3RI4 A;  2BXZ A;  3RQI A;  2O7O A;  2JUC A;  3A03 A;  3E6B A;  3OIO A;  4ETS A;  3Q3S A;  1KYW A;  1H9T A;  2BV6 A;  3FXR A;  1QHH D;  4CXF A;  1EKE A;  1X2M A;  5ED4 A;  4L0Z B;  2EIJ H;  1LFB A;  3FBI B;  3QYB A;  3TW7 A;  3DQV C;  1LE8 B;  2V6E A;  4YIF A;  3KIO A;  3W3C A;  5K7H A;  4IOC F;  3R0J A;  4E7K A;  2IPQ X;  4IF4 A;  3QWL A;  5DEQ A;  2Q1Z B;  3K70 D;  4JK1 X;  2VAS A;  3BY6 A;  3IC7 A;  5CKT A;  2D1H A;  1IGN A;  4B3X A;  3BR6 A;  2UXX A;  5EZG A;  3CP2 A;  1KON A;  2JSP A;  2DT5 A;  2VLA A;  1JKO C;  2P4W A;  1DP7 P;  3SXY A;  2WY8 Q;  3AG1 H;  2H6B A;  5CQG A;  2VT3 A;  3I71 A;  3CLO A;  2VBW A;  3OS1 A;  1JTX A;  2L3D A;  1X1D A;  2M3A A;  4Y17 A;  1GXQ A;  4D5C A;  2W48 A;  2KL4 A;  5BMZ A;  2CUE A;  1I27 A;  1AOY A;  2Z99 A;  2ELH A;  3PL8 A;  5BNG A;  4I6Z A;  3H9J A;  2K9M A;  2F48 A;  4PGG A;  4B48 A;  3S93 A;  5AON A;  2IAI A;  2KIM A;  2ZNY A;  5E79 C;  4LIU A;  2OTJ I;  2ECB A;  3N97 A;  4PGH A;  1GVJ A;  5F0C A;  1W5C C;  4OOI A;  3LOC A;  3O8G A;  1HQC A;  2RDP A;  4CCO A;  2RQQ A;  1QZY A;  2A07 F;  2P5K A;  1IDZ A;  4W1U A;  5ILU A;  3QRF F;  2EA2 A;  3K1P A;  4YFK F;  1MMS A;  1RUO A;  3FX3 A;  3CJR B;  3K4L A;  3MZH A;  2D2W A;  3BJA A;  5E8I A;  1ZN2 A;  3LA3 A;  2MGQ A;  3ZP5 A;  1RIO H;  1S8N A;  1P7J A;  1X1P A;  2DXI A;  4WX9 A;  3HG9 A;  4XKB A;  4BQQ A;  4AIJ A;  5M5Y J;  2L9S A;  3N4M A;  3K70 C;  2VXD A;  4BQO A;  1B9N A;  3LWF A;  2KT0 A;  2JPB A;  1U8R A;  3HRS A;  2M1B A;  2Q8K A;  4KIT B;  4BXU A;  2Z16 A;  4DIQ A;  2GBY A;  1S72 I;  3QPH A;  1ZGJ A;  2EZH A;  3S32 A;  4IHV A;  2LY2 A;  5E1Z B;  2FU4 A;  1T6S A;  2DA4 A;  3B6A A;  2NYX A;  1NH3 A;  2V9P A;  1SVL A;  4YEJ A;  2QBY B;  1HC8 A;  2IGN A;  2ISY A;  4AID A;  1X1C A;  4N4N B;  2KLO A;  1T33 A;  3L7W A;  3RCO A;  3S1R J;  2F5D A;  5FFZ A;  1IXS B;  1QZZ A;  3VEP A;  3OYI A;  1G2H A;  1E3O C;  1QBJ A;  4KT6 A;  3CDI A;  5GAG J;  3FK7 A;  1G59 A;  5H6Q A;  4GRI A;  1VF9 A;  2WBM A;  4BHC A;  3COA C;  3FIS A;  2XKO A;  2MLK A;  3BG9 A;  1R5I D;  1BM9 A;  1YW7 A;  1MKM A;  2B63 J;  1VTN C;  5GAD J;  4QPO A;  5FLV A;  3BG6 A;  1KU9 A;  3QOE A;  1IDY A;  2K40 A;  2PMZ A;  1SD4 A;  2X48 A;  3WU0 A;  4B1R A;  3GW2 A;  2HWV A;  3I55 I;  2LOO A;  2RNG A;  2LDU A;  5E3M A;  2P7V B;  3WTW C;  3A01 A;  3H0D A;  2IS4 A;  1G6N A;  4D0P A;  1WWX A;  5D8K B;  2P0W A;  4Y13 A;  3HOT A;  2X6X A;  1U5T B;  3CD6 I;  2GQQ A;  3M1E A;  3IHU A;  2K9Q A;  2XUB A;  3GBG A;  1W5T A;  2R7D A;  5E3O A;  4Y52 J;  3IRQ A;  4KT5 C;  3WE2 A;  3J7Y J;  1IXR C;  2CW8 A;  5C4J J;  3GFJ A;  2F5E A;  1P2F A;  2O6G E;  3R6S A;  4C3I J;  2ZJR F;  2X51 A;  4HV6 A;  1MJB A;  2HPM A;  3HXL A;  4Q47 A;  2IT0 A;  2Y0S N;  3OYD A;  3IV5 A;  1RES A;  5F6F A;  2DBB A;  5DUK A;  4I98 B;  1STZ A;  1EH6 A;  3CF2 A;  2KQR A;  2M4K A;  4NQW A;  3OYC A;  3LFK A;  3BR3 A;  1LDD A;  2DO7 A;  4OAZ A;  5JI6 A;  2FA5 A;  1MBG A;  2L4M A;  1IN7 A;  4BAY A;  2BYV E;  3EPZ A;  3NEU A;  1KYZ A;  3OYN A;  3BT9 A;  1LPQ A;  3G3Z A;  3ECH A;  3JRA A;  4D1Q A;  3R0A A;  4XKW A;  3H35 A;  2O9L A;  4M9X A;  1X58 A;  5LHG A;  3IKT A;  1RZ4 A;  3DBH B;  3O6B B;  4LLL A;  1P92 A;  1T8I A;  2VJJ A;  3W6V A;  1YJ9 I;  1QGP A;  3BC8 A;  2VKH A;  2LRE A;  3WTT C;  1MBF A;  4D9J A;  2LVS A;  1SVM A;  2ZXW H;  3FHN A;  2EZL A;  4XLF A;  4KIB A;  5DD8 A;  3SHF A;  3VDX A;  1H0M A;  1UCR A;  2QQ8 A;  4X1E A;  2RRE A;  3F6O A;  1XDS A;  2IRF G;  3S16 J;  3U21 A;  1H8A C;  3Q0U A;  2JA6 J;  3P7N A;  2P7C B;  5E1W A;  3I54 A;  2FOW A;  4FCY A;  1D5V A;  2BY3 A;  3O3K A;  4O3M A;  3KZZ A;  2FEZ A;  5LFA A;  2STT A;  3VFZ A;  2OUM A;  2W4S A;  1ON1 A;  4RAF A;  1YE9 A;  4BEH B;  1REP C;  4M6Y A;  3K4K A;  5DCF A;  4M71 A;  3I64 A;  1DPR A;  3J81 K;  4J19 A;  1WRJ A;  4A0Z A;  3P9I A;  1ZLK A;  4UUV A;  4IHX A;  1UHS A;  5L3B A;  1WKM A;  3K4M A;  2XSD C;  4BNC A;  1RNL A;  4S0H B;  2FQ4 A;  2CSO A;  3H92 A;  3RQ4 A;  1PDN C;  4Y4R A;  2OF7 A;  4H0E A;  5JVT A;  1IO2 A;  2DPD A;  2F5V A;  3K69 A;  1R5H A;  1J75 A;  2W84 A;  4DGW B;  1XMA A;  4R8H A;  4MIM A;  1EH8 A;  2DOF A;  1CF7 A;  1ETQ A;  3F8N A;  4X0G A;  1JGG A;  3KYL A;  1IRF A;  5HLG A;  2J5O A;  2WY7 Q;  4RMN A;  4UB6 C;  4A3E J;  2AQF A;  2R7V A;  5EEG A;  1S6L A;  3ZQC A;  2DJI A;  1LUJ B;  1A04 A;  2XAU A;  5E18 F;  1WI9 A;  2QGU A;  4A3G J;  1X4P A;  1WPK A;  5FLM J;  1BN5 A;  1XCV A;  3C18 A;  4XON A;  3CCE I;  2E1O A;  4A0X A;  3GZ6 A;  3ABM H;  3ZGK A;  4L0Y B;  2COB A;  1Z05 A;  2QZ8 A;  3H3V K;  4BL0 B;  4RGX A;  1Z3Y A;  1QRY A;  2O61 A;  4A5N A;  4IL6 C;  3X2Q H;  1W36 D;  3BCB A;  2K4J A;  2V6C A;  1MZB A;  3DF8 A;  4QWQ A;  2CW0 F;  1R7J A;  1DGW Y;  4LB5 A;  3VOE A;  1HOM A;  5E3N A;  4HF2 A;  2Z33 A;  4BDY A;  2PMU A;  3K9T A;  2H8W A;  3SDG A;  2NVQ J;  4QIW N;  1YO5 C;  1FMW A;  2VT2 A;  2LRD A;  5HNF A;  1D5Y A;  2VQG A;  1SAU A;  4OIR F;  3TO6 A;  4EV0 A;  3ERM A;  2DAO A;  3CES A;  2P5V A;  4N0B A;  1APL C;  5DCM A;  2ZB9 A;  4P5O A;  4ESF A;  3QU3 A;  3ZMZ A;  3ZQG A;  1A36 A;  2HQA A;  2QSH X;  3HRT A;  2LTP A;  4E70 A;  2FNA A;  3GXO A;  1KQ8 A;  3J7Z I;  1ZAO A;  3FKJ A;  3S1Q J;  4HZF A;  1RKT A;  3Q0W A;  1Z3X A;  4GDF A;  1OJL A;  2MAB A;  2R7U A;  4BJT A;  3K2A A;  5FGM A;  4NC8 A;  5ICC A;  1O3S A;  1U3E M;  1TW2 A;  4EJU A;  2LFB A;  2PQ8 A;  5HS9 A;  4OIQ F;  4FTH A;  4NBQ A;  1FT9 A;  2HZD A;  3ML6 A;  1QPI A;  1L3L A;  4GYG A;  2FNP A;  4A3K J;  3HOS A;  2XAQ A;  3EET A;  1QNT A;  1K78 B;  4XLE A;  3F9K A;  1Y8R B;  5ILV A;  3CCQ I;  4P9F A;  5KVR A;  4ENJ A;  4I99 C;  2IEK A;  3AG4 H;  2E2I J;  2KHM A;  3K4N A;  3DWL E;  3DPU A;  4II3 A;  2ZBK A;  2XSJ C;  3RZD J;  2XRL A;  4ZYA A;  2OC6 A;  3MMY B;  4E7H A;  5J1U A;  2IGK A;  3L00 A;  4RGR A;  2VB6 A;  4A3B J;  1I6X A;  3JRC A;  3WTS C;  4YRV A;  1WJD A;  4IHS A;  3MKY B;  1NHA A;  3TP0 A;  2P8T A;  1WGX A;  5HOO A;  2CUJ A;  1K61 A;  4MGR A;  3ZQI A;  2LR8 A;  3BLY A;  4PJ0 C;  1R9T J;  2YPR A;  1MSE C;  2GA2 A;  5IP9 J;  3DLA A;  3HKZ A;  4I0B A;  2OZU A;  1MDM A;  4RLF A;  4XLH A;  1MBE A;  4LK0 F;  1EV7 A;  2CV2 A;  1J7K A;  2VC1 A;  2KZV A;  2LY1 A;  4IQ4 A;  5F27 A;  4ENM A;  3BJO A;  1F1Z A;  4XBF A;  3W6K B;  5IT9 K;  1P6R A;  2DA1 A;  1V54 H;  3JAM K;  3WTY C;  2WAD A;  4ON0 A;  3DFG A;  3AKZ A;  4BDZ A;  3LSJ A;  4K2E A;  1LFU P;  2RKH A;  4A3C J;  2DDA A;  3I9V 2;  3S17 J;  3CCS I;  1P4A A;  2K3F A;  2QSG X;  2XF6 A;  1X3W B;  2GWR A;  2M8E A;  4LB6 B;  2YU3 A;  3E7L A;  2NOJ B;  2ZC2 A;  4M73 A;  3HL2 A;  2R5Z A;  3GME A;  3ONQ A;  5K5R A;  2R5Y A;  4ANJ A;  4WF2 A;  1MD0 A;  1Z67 A;  1JKR C;  1W0T A;  2DTR A;  4ENK A;  2QKL B;  1XSD A;  1LEB A;  1B9M A;  2EZK A;  1V4R A;  1T39 A;  2QKM B;  3KCC A;  3V8L A;  2FBH A;  1PUF A;  3LA2 A;  5LBQ A;  1R5G A;  1X4O A;  4LGW A;  1UHW A;  2XKP A;  4EM2 A;  4ENN A;  4WCG A;  3W2W A;  3TED A;  4NNJ A;  5FRO A;  4AYB N;  4QLC U;  1SC7 A;  2STW A;  1RC9 A;  2OD5 A;  2YS9 A;  2VL8 A;  1ETO A;  1IN5 A;  3CCU I;  2ZJ2 A;  1W7P A;  2XAG A;  1SAN A;  2TCT A;  1S29 A;  2JPC A;  3BTI A;  3OR1 C;  1QVT A;  4BY1 J;  1SMT A;  4Z6Y A;  3IH4 A;  4WK8 F;  4A6D A;  3J80 Z;  2JA8 J;  2QVO A;  2HNH A;  2XGE A;  4RAG A;  3FZV A;  4C9Y A;  4KFC A;  3REO A;  2DTZ A;  1U2W A;  5KCM A;  4U0Y A;  2K4B A;  1G4D A;  1KU3 A;  1Y0N A;  4DBQ A;  3GTQ J;  4PJM A;  3NWS A;  3WE3 A;  1MMA A;  4MEX F;  2M9H A;  4PSX A;  4PCQ A;  4OWR B;  3LSR A;  4PJL A;  3GTO J;  1LQ1 A;  2L7Z A;  4HA8 A;  3IWZ A;  4XN0 A;  1OYI A;  4ZYD A;  1BC7 C;  4U0W A;  3SJM A;  3OYK A;  2K3P A;  5F64 A;  5EGO A;  1RKW A;  2KJB A;  3TO9 A;  3ZRG A;  5A2Q K;  1IG7 A;  4EM0 B;  3QQA A;  2L5Q A;  3BJ6 A;  1XSX A;  1YW8 A;  2DI3 A;  3OYB A;  3HIF A;  5D5X B;  2QQB A;  1EF4 A;  2DOD A;  4KIC A;  4AM3 A;  3G4S I;  4P96 A;  1X1A A;  3RYR A;  1TP4 A;  4G6D A;  3VYS B;  3WHB A;  5FB2 A;  4UUS A;  2W57 A;  5BOX A;  3QAH A;  1Z21 A;  1J9I A;  3OYL A;  3OYE A;  1O7L A;  2M30 A;  2KMU A;  3FKI J;  4EJO A;  2PLY A;  4A93 J;  2P6S A;  4G9Y A;  2N8G A;  3GFI A;  2PBI A;  2XPU A;  4DJA A;  2R7X A;  2IBD A;  3BZC A;  2QQA A;  1T98 A;  3EUH A;  3S15 J;  2GXB A;  2WAF A;  2V4J C;  1FYM A;  5IYD J;  1TQM A;  1QQI A;  1SFU A;  3HRU A;  1FP2 A;  2R7Q A;  4UXN A;  5F04 A;  3MCZ A;  3HUG B;  3PUB A;  3BP8 A;  3V7S A;  1JHF A;  1YYV A;  2UXN A;  1IN8 A;  2XRO A;  3E5X A;  4MNU A;  5BQT A;  4M3G A;  1TW3 A;  3PSI A;  1UZC A;  2GZW A;  2DJN A;  2Y9Z A;  2M45 A;  2Z9O A;  3CP8 A;  3K10 A;  4A3J J;  2ID3 A;  2HEO A;  2VXZ A;  2PJP A;  4F93 B;  2X0L A;  3H0G J;  3TDZ C;  3WG9 A;  2HYF A;  2FSW A;  3CC2 I;  2GIZ A;  1Q1V A;  2K86 A;  2V1U A;  5EG0 B;  4BY7 J;  3JSP A;  3CDH A;  5J4V A;  2VOP A;  3FMS A;  4A69 C;  4YFN F;  1D3Y A;  4HX8 A;  2LKP A;  1YRN B;  2LKS A;  4RBO A;  2DDB A;  3BR2 A;  3TL4 X;  5L3G A;  3WTX C;  1JE8 A;  1V5G A;  2MH9 A;  4V2G A;  4GO1 A;  4CCL A;  3IUO A;  4DQ2 A;  2EIM H;  3ZMS A;  2M7B A;  4JX6 A;  4F92 B;  3FXU A;  1UFM A;  4MTD A;  3DBL B;  5DS9 A;  1SEU A;  4RDU A;  5D5V B;  3F0C A;  1MIJ A;  2HVS A;  1A6I A;  4HV5 A;  1W7P D;  2DMP A;  2W1O A;  1A6Q A;  3FXM A;  3HGY A;  1H9G A;  2R7F A;  3JTH A;  4M3E A;  4PUS A;  3VSK A;  3PM1 A;  1KU7 A;  5D4S A;  5KAF C;  4P55 A;  1MBJ A;  2E7W A;  4OMY A;  2Z5U A;  2CH0 A;  2LH9 A;  3PQJ A;  3KP4 A;  3LFU A;  2I10 A;  3DV8 A;  1FY7 A;  2E2H J;  2K27 A;  1R6R A;  1U9O A;  2A68 F;  2EFW A;  2FE3 A;  1TTY A;  1JT6 A;  1TNT A;  2DOA A;  3TO7 A;  1WJF A;  3M9A A;  2HTS A;  1BR2 A;  4MFD A;  1HW2 A;  3BWG A;  1I39 A;  4AD9 A;  5IYC J;  2DQL A;  2D45 A;  3JRB A;  1K79 A;  3I53 A;  1S7E A;  4G94 A;  5IPA A;  5LD2 C;  2YUS A;  3F8F A;  1BW6 A;  3GEZ A;  1SFO J;  1ZH5 A;  3PO3 J;  5JFR A;  1S5L C;  3Q9V A;  2LNB A;  2NVU B;  1VQ9 I;  3LL7 A;  1S3J A;  1HST A;  3FK6 A;  5CLS A;  5J4Y A;  1T56 A;  1BI2 A;  1R58 A;  2MLG A;  1BOA A;  2DT6 A;  3K0L A;  1VFC A;  1IV8 A;  2KPM A;  2PMZ N;  3EYY A;  3GLX A;  2M0C A;  2F6C A;  4CH7 A;  1X3U A;  3FF5 A;  5JHU A;  1ZR2 A;  3KP3 A;  3T5X A;  3GTJ J;  2P5L C;  2XGX A;  4N4O B;  5B1A H;  1N78 A;  4IEJ A;  3DU6 A;  2X6W A;  1IUY A;  5F0F A;  1FJL A;  2H09 A;  3EDP A;  2CV1 A;  4M72 A;  2XAH A;  5J1Y A;  1YS7 A;  2BBY A;  2X1C A;  1OCZ H;  5HVQ C;  3WTU C;  3CMM A;  3ROU A;  1GT0 C;  1DU6 A;  2C6Y A;  5M5W J;  3B02 A;  2OU2 A;  1LEA A;  3HPH A;  4JP0 A;  2JRT A;  2W24 A;  2Y9Y A;  2ZNZ A;  2HOA A;  4HG2 A;  1MMN A;  1LKX A;  3CQZ J;  1UG2 A;  4B09 A;  5ICE A;  1XB4 A;  3ZN0 A;  2E2J J;  1T0F A;  2XVC A;  4C2U A;  3RTR A;  5FO5 A;  3SFZ A;  1FOX A;  1FTT A;  4ESJ A;  3KP2 A;  2E36 A;  3HC7 A;  1O57 A;  4RM3 A;  3GTL J;  2ZME A;  3O2P E;  2HDC A;  4EEF G;  2RC4 A;  3NWT A;  3JRD A;  1MBH A;  2L2O A;  2EWN A;  1I3Q J;  5K5O A;  2EZI A;  1XC5 A;  1IZ1 A;  2X85 A;  1OLT A;  3FM3 A;  4V2F A;  1WI3 A;  2IVM A;  4I76 A;  3HOZ J;  2IS1 A;  3K1N A;  2HZT A;  1U8B A;  1IW7 F;  5L3C A;  3BPX A;  5C44 J;  1F36 A;  3T8T A;  2CQ7 A;  2HKX A;  1AKH A;  4XKV A;  1B6A A;  3Q0V A;  4ZH4 F;  3RKY A;  5DV5 A;  4CCN A;  4GXO A;  1VQN I;  2LF8 A;  1SMY F;  4LFU A;  2WAQ A;  3GF2 A;  4HDU A;  4KN7 X;  3BPV A;  4XR6 A;  3I4N J;  4P9U A;  2V26 A;  3U1K A;  1HXD A;  4FX0 A;  2EB7 A;  3HOX J;  1O3T A;  1BW5 A;  4XRF A;  3F23 A;  1D0Y A;  1TL8 A;  3TOB A;  4W97 A;  2DQR A;  2VIX A;  3J7A O;  1ZRC A;  4I09 A;  1OR7 A;  4ZTJ A;  1BIB A;  1FSE A;  5IP7 J;  3V4G A;  2IS6 A;  1ZQ3 P;  4PFP A;  4A3M J;  4BBS J;  3I0T A;  5J6X A;  1R1U A;  4ZYG A;  3BZ6 A;  3BR1 A;  4XM3 A;  3EUH C;  3E97 A;  5K1Y A;  2JA7 J;  1YLF A;  2JQ7 A;  2EFQ A;  3C2B A;  1TWA J;  4U87 A;  1JUM A;  4G6T B;  1HKS A;  4KMU X;  2XHK A;  3KPH A;  3H3U A;  5DUI A;  2VE9 A;  4DYQ A;  3ELK A;  1BR1 A;  2E1C A;  4HNT A;  4QPQ A;  2L54 A;  2KIU A;  2IGM A;  1XTA A;  4GCV A;  1BI0 A;  4MTE A;  1Z9C A;  4E7J A;  3CME I;  1VI0 A;  5D6E A;  4E7S A;  4XNF A;  3C7J A;  3HOV J;  3M3Y J;  3CCV I;  3A01 B;  2CGP A;  3BZK A;  2PMH A;  4L18 B;  4UY8 I;  3ECO A;  2ETH A;  4J00 A;  4E4H A;  5H2F C;  1F4K A;  3WGH A;  2TRT A;  4CCJ A;  3K6G A;  1BOB A;  2KZG A;  1FOK A;  4I01 A;  3VYR B;  3DPT A;  3NRV A;  3FMQ A;  2JA2 A;  4MLO A;  4C3H J;  4ZJZ A;  3FHZ A;  3BOQ A;  1G3S A;  1Z6R A;  2OTL I;  1LJ9 A;  2OPT A;  2VQH A;  2HYG D;  4MHG A;  1BL0 A;  1ONV A;  4KJZ A;  1FMV A;  2FJ1 A;  3K2Z A;  5FKK A;  1RR8 C;  3D5S C;  4LD5 A;  3F72 A;  1BR4 A;  3ZCO A;  1S7A A;  2HOS A;  2FQ3 A;  3C2H A;  4PSW A;  2B7E A;  1YX5 A;  1YS6 A;  2BZT A;  3CTA A;  3H5N A;  1ZG3 A;  3IH2 A;  2VQC A;  4BE0 A;  2R7W A;  4G7Z F;  4BXX J;  3FXK A;  1O7F A;  1OCP A;  4NC6 A;  4F7Z A;  1FBQ A;  1HBX G;  3JR9 A;  3FWE A;  2E34 A;  4ZDO A;  3SZG A;  3DKX A;  3ZMV A;  4OMZ A;  4B43 A;  4G6Q A;  3CCR I;  1O3Q A;  1VQK I;  4PDK A;  2DMQ A;  1R22 A;  2RNJ A;  2BXY A;  1IRG A;  3CUQ A;  2OAZ A;  5CQE A;  4UV8 A;  4XN3 A;  4G7H F;  4EM1 A;  2L01 A;  2HQR A;  3H9G A;  1HSJ A;  2H27 A;  2FBK A;  4A12 A;  4EVI A;  2PJR A;  2TDX A;  3JCU C;  4IXA A;  4D5F A;  3G2B A;  3RPU A;  2H8R A;  3MZ8 A;  3DTK A;  4D7M A;  3E5Q A;  1T08 B;  1ODD A;  1YHQ I;  1Y8Q B;  3AFH A;  3R60 A;  4IHT A;  1ERD A;  2DCE A;  2BY0 A;  1SFK A;  4IVN A;  1P4W A;  4RM2 A;  3WGG A;  4EJV A;  1K4S A;  5EEA A;  2DYR H;  2V1D A;  3KLN A;  3SZP A;  4E6K G;  1FPQ A;  1FX7 A;  4UUT A;  1A31 A;  3HOW J;  1Y39 A;  3VWB A;  3PO2 J;  5J47 A;  1D1C A;  3GTM J;  3WTV C;  1EH7 A;  4FHT A;  3GZN B;  4IKF A;  1KZH A;  1TLH B;  4XOR A;  2HTJ A;  2JUG A;  1Z7L A;  3AG2 H;  4LG0 A;  4Z2Y A;  4ZDL A;  1EA3 A;  1FOY A;  5CVI A;  2LY9 A;  3PSF A;  5IOZ A;  1DUX C;  4IHY A;  3U2R A;  5HDG A;  2EBI A;  1OFC X;  4B8X A;  4B3A A;  2L9N A;  1ZAR A;  2E71 A;  1Y0U A;  2R0Q C;  3EUK L;  5TIS C;  1LDK B;  4L9T A;  5FKO A;  1ACI A;  4CYC A;  1VQM I;  1XX5 A;  1Z6T A;  3F22 A;  4HQM A;  1I6H J;  1P7I A;  2V79 A;  1XGM A;  2OBP A;  4DOZ A;  1T0F C;  2XAJ A;  3H1C A;  4PZJ A;  4U7B A;  2A6E F;  1B8I A;  2MW8 A;  2ZME C;  5B5E C;  1YFH A;  4RGU A;  4A3I J;  3QPS A;  2LSO A;  4ITV A;  3V42 A;  2CMP A;  2M34 A;  1RUN A;  4A3D J;  4B47 A;  2GOM A;  2NAZ A;  4HLY A;  2NVX J;  1JUS A;  1CF7 B;  1T95 A;  5H20 A;  2R7S A;  5GAE J;  3I4M J;  3WGI A;  4EJT A;  3GTG J;  2IXS A;  3DTE A;  2NVY J;  2V1X A;  1TBX A;  3HKZ N;  1HF0 A;  1GDT A;  2WTE A;  5LHI A;  5F08 A;  5GP9 A;  5DM7 F;  1YW9 A;  3M07 A;  4FQG A;  1JHH A;  4UVB A;  1Y6I A;  3LQQ A;  1HA8 A;  2L02 A;  3SQN A;  4GGG A;  3S3O A;  1ETY A;  3DBR B;  2M2E A;  4EAT A;  5M5X J;  4Q4Z F;  2BE5 F;  3J81 Z;  2VKE A;  2KKO A;  1N25 A;  3FBN B;  4WXD A;  4OIN F;  1MH3 A;  1PVE A;  2K85 A;  2Q0O A;  4LG3 A;  5B1B H;  2NXN B;  5D5U B;  2UV1 A;  2JRM A;  3MD2 A;  3U9G A;  2VJI A;  2Y75 A;  3F8M A;  3BQZ A;  3VSL A;  2O03 A;  3IWF A;  2A05 A;  4NC7 A;  3CCY A;  1OR7 C;  1FIP A;  2FRH A;  2W00 A;  5IYB J;  2ZFW A;  3BDD A;  2Y69 H;  3MKL A;  2PI0 A;  2JTV A;  5GAH J;  5DCM B;  3F21 A;  3HOU J;  5FKL A;  1K7A A;  2MA3 A;  3QP5 A;  5FD5 A;  2Y31 A;  4B44 A;  5M3M J;  2NVT J;  2VKD A;  5FLX K;  1ETK A;  2CWE A;  5HLI A;  3C1D A;  5FFX A;  3BCA A;  2B9S A;  5HDN A;  2VOD A;  2Z2S B;  2DK5 A;  4IJA A;  4BGD A;  2A61 A;  3FDY A;  4XID A;  3OYH A;  4OAY A;  2K02 A;  3KYC B;  2CQN A;  2LC2 A;  1DP3 A;  2MYS A;  3NAU A;  2RGV A;  3RPU D;  3AL0 C;  2DA2 A;  4TV7 A;  2F4I A;  2HXO A;  5EZH A;  2NOG A;  2I5U A;  3CCJ I;  1O3R A;  4FX4 A;  4S04 A;  5TGT A;  1X1B A;  2CU7 A;  1DU0 A;  2HOT A;  1L0O C;  1UG0 A;  3OYG A;  4MQV A;  5LGU A;  1IF1 A;  1ZKG A;  3BG7 A;  3RKW A;  1XCB A;  3I59 B;  1VQP I;  1QHG A;  1GXP A;  1YJW I;  2JSC A;  1PYV A;  1JGS A;  2A6T A;  2OQR A;  2CJJ A;  3KP7 A;  3ESW B;  2AXT C;  2NNN A;  3M8F A;  3IAS 2;  3CC7 I;  1YG2 A;  4BQA A;  1ZLJ A;  3FMR A;  5EYR A;  4RAZ A;  3KP5 A;  5EF6 A;  1IXC A;  5K7F A;  3G71 I;  1WH7 A;  3WU1 B;  2LYC A;  2CV0 A;  2A5W A;  3J80 K;  4E7I A;  4HNU A;  1UAA A;  2Q2E A;  2ZKZ A;  1DGR M;  2XAF A;  3OV8 A;  2WA0 A;  1XMK A;  2KP6 A;  4LJZ F;  1MGT A;  3KEQ A;  4XOT A;  3KET A;  2DFI A;  2EPF A;  2H1K A;  3IH3 A;  1WCM J;  5ERI A;  4PJN A;  3HHG A;  3ZQF A;  4M6V A;  1D8K A;  2W85 A;  4FET A;  1TZL A;  3B73 A;  3SYT A;  3HSF A;  3PUF A;  1IJW C;  2KDZ A;  2O3F A;  4IO9 F;  2DOE A;  1MMG A;  2R92 J;  2HFH A;  2LD5 A;  4G8X A;  1B72 A;  1MDM B;  3ERE D;  4CIC A;  2MC4 A;  4L9N A;  5DM6 F;  3CUQ C;  1FIA A;  3C3W A;  2QM3 A;  3FM5 A;  4UB8 C;  1LB2 A;  1VND A;  2Y2Z A;  3TQN A;  2L9R A;  4KDP A;  1A35 A;  2AO9 A;  3HGG A;  3PFI A;  2VON A;  1K83 J;  1KA8 A;  1NG7 A;  3LSG A;  5FJ8 J;  2R7T A;  4RAY A;  1B1B A;  3VPR A;  4V19 K;  1TWF J;  2R5Z B;  4CGZ A;  4U0V A;  1FWZ A;  5JR3 A;  2R5Y B;  4AWX B;  4M9Z A;  2ZO4 A;  3A2K A;  3HZJ A;  5ICF A;  1Y1W J;  1OYW A;  1WQ2 A;  4R1H A;  5B3S H;  4C3J J;  2L7M P;  5J8C A;  1PUF B;  1QU3 A;  4Q48 A;  2G9W A;  5CVU A;  1TQI A;  2ZCW A;  3I58 A;  4YII A;  1SVO A;  4A0Y A;  1D1B A;  4LIT A;  4XMY A;  4ZTF A;  1OKR A;  1QO0 D;  1ZGW A;  4DNC A;  2ACJ A;  3IKV A;  3TGN A;  1ITY A;  3S2D J;  1W7P B;  2BW3 B;  2WV0 A;  1HLV A;  2ME0 A;  5B66 C;  4BAC A;  9ANT A;  5IT9 Z;  4ASN A;  4L9J A;  3JAM Z;  2O5R A;  5LEK A;  3WHC A;  3CUO A;  1HW5 A;  3FXL A;  1KGS A;  1A5J A;  1G3Y A;  2BHY A;  3DPL C;  4BH9 A;  5HOD A;  4YEL A;  4IRG A;  1WJ5 A;  3LSP A;  5CVV A;  2BY1 A;  3OWT A;  4YG2 F;  1JKQ C;  2A5Y B;  3RIR A;  2KIS A;  4II2 A;  1SD5 A;  1LVK A;  4MQ9 F;  3BTC A;  4MEY F;  2QEX I;  1SFE A;  2DN0 A;  1K4T A;  4RB2 C;  2HDW A;  1Z7U A;  2VI6 A;  5EGO B;  4J01 A;  5K7Z A;  2VE8 A;  1W1W E;  3LSH A;  3RYP A;  1ULY A;  3V7C A;  3BQY A;  2XV4 S;  3G73 A;  1W0U A;  1QZE A;  3OIQ A;  3QOP A;  5HS7 A;  4YFX F;  1YI2 I;  3WU2 C;  3ZPL A;  3P5J A;  3QOD A;  1NG6 A;  4GYI A;  3G1O A;  2EH3 A;  3EQL F;  4CDG A;  2XDV A;  1XN7 A;  3L2W A;  1ETV A;  1XG1 A;  1U0J A;  2DA6 A;  3E3V A;  5L3F A;  4Q5S F;  2O8K A;  3HOY J;  3JW4 A;  3KFW X;  4UUS B;  3UKG A;  1LVA A;  3S3N A;  5J40 A;  2W25 A;  5AIP A;  4CO8 A;  2VBX A;  2IP2 A;  2YSR A;  3H5R A;  2LP0 A;  5L3D A;  3UNG C;  4HQE A;  3DKY A;  4OU0 A;  4Y33 A;  4XK4 A;  2GAU A;  4OIP F;  2HS5 A;  2Y48 A;  2CRG A;  4XLN F;  3ABU A;  4DZJ A;  1LNW A;  4LLN A;  1XSV A;  4FT8 A;  3U1D A;  1WJB A;  2MD0 A;  1PJR A;  1J59 A;  3DCF A;  3RZO J;  3L09 A;  3WTZ A;  1IN4 A;  4HOB A;  4I7H A;  2JN6 A;  5KHD A;  4EMS A;  4HW0 A;  2V1N A;  3C2G A;  4BJ6 C;  4IX7 A;  3LQR A;  3J7A Y;  2LKX A;  2HKO A;  2LBF A;  2JK3 A;  4DW6 A;  4L9V A;  1IN6 A;  1JUP A;  1J2X A;  3TBI A;  3QYF A;  2MG4 A;  5A2Q Z;  2CYY A;  2BHZ A;  3H9Q A;  2HU9 A;  3KX2 A;  2GM4 A;  1X3Z B;  4M6X A;  2WB1 A;  4IRI A;  2O0Y A;  2OQG A;  4JX4 A;  4WWC A;  1WVR A;  2RAE A;  3V8J A;  2OZ6 A;  2M5W A;  2VQL A;  1ON2 A;  2BY2 A;  3K4J A;  3D5R C;  2CFO A;  5FKN A;  1LE8 A;  4HF1 A;  2ELK A;  4X6A J;  5HLH A;  5TJJ A;  4HBL A;  2BVM A;  2R3S A;  3K4C A;  1BI1 A;  1GVD A;  3ASN H;  5ICG A;  3P9K A;  1AWC A;  4AVZ A;  5C3E J;  5DYM A;  3TP3 A;  2K9N A;  2GA1 A;  4I2O A;  3OSG A;  4EGZ A;  3L2R A;  1W5S A;  2VPL A;  4XSX F;  2JWT A;  5EEH A;  4CSW A;  3JRG A;  5HDK A;  2ZFU A;  1PP8 F;  4ZYE A;  3HSE A;  4NB5 A;  5DTD A;  1C0W A;  3G1M A;  3H3Z A;  2A3S A;  1E0E A;  3ZOB A;  4AU7 A;  2XC7 A;  4I02 A;  4L5E A;  3BTJ A;  2OJE D;  3OYM A;  5F0H A;  1VQL I;  2V9K A;  1ENH A;  1RI7 A;  3LST A;  3TOA A;  2WAQ N;  3NAR A;  4AIK A;  1POG A;  3LAP A;  2XF7 A;  2ZXJ A;  2DU9 A;  4HST A;  4XKC A;  2L7F P;  2FXA A;  3S8P A;  1TWG J;  4KIF A;  1FBU A;  1FZP B;  2OV7 A;  5LGN A;  3RKX A;  5DDG A;  1YTY A;  2EFO A;  3QPT A;  1USS A;  4HF0 A;  3WOD F;  4EGY A;  1RRJ A;  3IRR A;  2VOO A;  2DFH A;  4R79 A;  3CO7 C;  3A1Y A;  4C2T A;  2L7K A;  3CC4 I;  4KYW A;  5EDN A;  3CCM I;  3CMY A;  4E7L A;  1IV6 A;  4GFB A;  1SFX A;  5H6R A;  2BVL A;  4RLQ A;  1IC8 A;  4HPQ A;  1WH5 A;  2ID6 A;  4ESB A;  2QYO A;  3NQO A;  3E6C C;  3ZQQ A;  2PEX A;  1JKP C;  2XRN A;  4BBR J;  1Y1V J;  4MO7 A;  4H4K C;  2R7O A;  3JRH A;  2X9D A;  1LDJ A;  2DFE A;  4UNO A;  3K7A J; 
#chains in the Genus database with same CATH homology
 3ABT A;  5D6F A;  4A2U A;  4HLX A;  1Z1D A;  4M74 A;  2XIG A;  2HQN A;  3S2W A;  2IA2 A;  2QUF A;  1YQA A;  2G7H A;  2EV6 A;  2HOE A;  3E6M A;  3KP6 A;  5LRR A;  2MH2 A;  1OMI A;  2VBZ A;  4OIO F;  2RV8 A;  2X4H A;  3L9F A;  2QBY A;  4WXH A;  2J5P A;  2FOK A;  3KZY A;  4RB3 C;  3K1M A;  2ZME B;  1ZGA A;  1ZG5 A;  5ILS A;  3MEX A;  3HRM A;  5J8F A;  4IRH A;  3F6V A;  3AAF A;  1PUE E;  2QEN A;  2UZK A;  1ZG1 A;  2KIF A;  4KMF A;  3MQ0 A;  1HKQ A;  5LRS A;  1BBY A;  2H94 A;  1B59 A;  1R1T A;  4UV9 A;  2ESH A;  4UVA A;  2LF7 A;  5E20 A;  2NRA C;  4AIH A;  1U5T A;  3ZMD A;  1FSH A;  4KUM A;  2F5C A;  3Q5F A;  1R36 A;  1KQ0 A;  1ZYR F;  1GHC A;  3HHH A;  2PFB A;  2MBF A;  3MWM A;  3HSR A;  4KNY A;  4KA4 A;  2QQ9 A;  4HAM A;  1R00 A;  3W6J B;  2A69 F;  5DD4 A;  1I5Z A;  3P9C A;  1KQ9 A;  3ZMT A;  4L5I A;  2QWW A;  1ZRE A;  1R23 A;  2IJL A;  4LK1 F;  2A6H F;  2VN2 A;  3DP7 A;  1XD7 A;  2MD5 A;  5BPI A;  5CYV A;  2CQK A;  1Q1H A;  2KJC A;  1FC3 A;  1FBS A;  3D5L A;  2BEO A;  5IT3 A;  3TKY A;  4ZZD A;  3CJN A;  1CGP A;  1DDN A;  3I5U A;  3HYI A;  3ISP A;  2EFN A;  2PN6 A;  4CZZ A;  3GWZ A;  5CVR A;  5E1X A;  1FLI A;  3FXQ A;  4I0A A;  1HKT A;  2F5F A;  4BHP A;  5TRD A;  3DEU A;  3CUQ B;  3RPQ A;  3TDU C;  1ZHF A;  3QP6 A;  1SD6 A;  2EJR A;  3CO6 C;  2DW4 A;  2VC0 A;  4LLG F;  3JTG A;  3RJP A;  5AIQ A;  1U78 A;  2JZY A;  2NNY A;  1OYY A;  3ZQ7 A;  2RVC A;  1SD7 A;  1G3W A;  3R61 A;  1D8J A;  4WXC A;  3T0Y A;  5FD6 A;  4NHJ A;  5HS8 A;  5BS6 A;  1V3F A;  3GVA A;  1E17 A;  2QLZ A;  1F5T A;  2F2E A;  3GX4 X;  3I4P A;  2IA0 A;  4LG0 B;  1UB9 A;  4JBA A;  2KRF A;  4XSZ F;  1TQP A;  4RB1 A;  1T2K A;  3GFM A;  2CFX A;  4L5J A;  5KK1 A;  3F3X A;  4CYD A;  4BHB A;  2NS0 A;  1FNN A;  2D1V A;  2EK5 A;  1F9N A;  4Y15 A;  5CVJ A;  3RDI A;  1YIO A;  2OA4 A;  2YX7 A;  1J0R A;  4A6E A;  2RN7 A;  2DK8 A;  5D5W B;  4HX4 A;  1ZRD A;  4RGS A;  3F8C A;  4EQQ A;  1KU2 A;  3HTS B;  3MAJ A;  2H6C A;  4G7O F;  2JT1 A;  4U7D A;  1U5T C;  1DPU A;  1K78 A;  4O5V A;  2ESN A;  2IW5 A;  2E1N A;  2L4A A;  1XGO A;  3QU6 A;  3GYH X;  4BYY A;  1T38 A;  4AVP A;  4HDV A;  1P4X A;  3Q9S A;  1ZRF A;  3HTU A;  2EA4 A;  1R1V A;  3VOD A;  5D8L B;  3T1B A;  5CJ9 A;  3KLO A;  2ADU A;  3JSO A;  2G7U A;  3I59 A;  4IPA A;  3PQK A;  3ZN1 A;  2DPU A;  3M7G A;  1XGN A;  5E8G A;  2FF4 A;  3KE2 A;  3MFK A;  3GZ5 A;  4KN4 X;  2E7X A;  3SZT A;  1K6O A;  2P6T A;  5L3E A;  3D0S A;  2M87 A;  4JQF A;  2DLL A;  3ULQ B;  2YR2 A;  1IAW A;  4ZZL A;  2YX4 A;  1G3T A;  1MJA A;  5LLQ A;  5K5Q A;  4XLP F;  3GO5 A;  2HGC A;  4LMY A;  1JXS A;  1W4M A;  2Y0M A;  1B4A A;  1QPM A;  3LA7 A;  5FLX Z;  3V7R A;  1J5Y A;  3BRO A;  1S7O A;  4RB0 A;  1MJ9 A;  1HW1 A;  1BIA A;  4M9S A;  1TNS A;  3LAJ A;  3DXJ F;  2EV5 A;  3GFL A;  4N9I A;  2FBI A;  2O8X A;  2VBY A;  3V8K A;  1U6G A;  2AS5 F;  1FP1 D;  3IL2 A;  4N9H A;  2AXL A;  3ZMU A;  5E17 F;  3L2C A;  1OPC A;  1XDU A;  2RQP A;  2EFP A;  6PAX A;  1BJA A;  3KEO A;  2WWY A;  2PG4 A;  5BPD A;  4RS8 A;  1FYL A;  2GIV A;  2CG4 A;  1BI3 A;  4HX7 A;  1I1G A;  2FMY A;  3T8R A;  2K7L A;  2MC3 A;  4A5M A;  1WSU A;  1E2X A;  2HR3 A;  2ISZ A;  5F1R A;  4U88 A;  1PP7 U;  1XGS A;  1UHM A;  5LGT A;  3HUG A;  2FML A;  4O6J A;  1FYK A;  2Z3Y A;  3E5U A;  4HYE A;  2GXG A;  3OOP A;  3MZY A;  3F8B A;  5LHH A;  1Z91 A;  2COM A;  1BC8 C;  4ZYH A;  5D4R A;  3EYI A;  4KIG A;  3R4K A;  1SAX A;  2B0L A;  2XAS A;  4UVC A;  3GUD A;  1I1S A;  2WC2 A;  5LEJ A;  1UST A;  2CO5 A;  3E6D A;  2IA1 A;  4UHT A;  2EV0 A;  3VB2 A;  2V9V A;  3DKW A;  4CHU A;  4EJW A;  4S05 A;  2UWM A;  2BGC A;  3RI4 A;  3M8E A;  3E6B A;  4ETS A;  1KYW A;  1H9T A;  2BV6 A;  3FXR A;  4CXF A;  5ED4 A;  4L0Z B;  3DQV C;  4YIF A;  3R0J A;  2IPQ X;  4IF4 A;  5DEQ A;  4JK1 X;  3BY6 A;  3IC7 A;  2D1H A;  2UXX A;  2DT5 A;  2P4W A;  1DP7 P;  3SXY A;  2H6B A;  2VT3 A;  3I71 A;  3CLO A;  2VBW A;  2L3D A;  4Y17 A;  1GXQ A;  5BMZ A;  1I27 A;  1AOY A;  2Z99 A;  2ELH A;  4PGG A;  5AON A;  2KIM A;  2ZNY A;  3N97 A;  4PGH A;  1GVJ A;  4OOI A;  1HQC A;  2RDP A;  1QZY A;  2A07 F;  2P5K A;  5ILU A;  3QRF F;  2EA2 A;  3K1P A;  4YFK F;  1RUO A;  3FX3 A;  3MZH A;  2D2W A;  3BJA A;  5E8I A;  1ZN2 A;  3LA3 A;  3ZP5 A;  1RIO H;  1S8N A;  4WX9 A;  4AIJ A;  3N4M A;  1B9N A;  3LWF A;  2JPB A;  1U8R A;  3HRS A;  2M1B A;  2Q8K A;  4BXU A;  3QPH A;  1ZGJ A;  5E1Z B;  2FU4 A;  1T6S A;  2NYX A;  2QBY B;  2ISY A;  3L7W A;  2F5D A;  5FFZ A;  1IXS B;  1QZZ A;  3VEP A;  1QBJ A;  5H6Q A;  4BHC A;  3COA C;  2XKO A;  2MLK A;  1BM9 A;  1YW7 A;  1MKM A;  1VTN C;  1KU9 A;  1SD4 A;  3WU0 A;  3GW2 A;  2HWV A;  2LDU A;  2P7V B;  3WTW C;  1G6N A;  4D0P A;  1WWX A;  5D8K B;  4Y13 A;  3HOT A;  1U5T B;  2GQQ A;  3M1E A;  3IHU A;  2XUB A;  1W5T A;  2R7D A;  3IRQ A;  4KT5 C;  3WE2 A;  1IXR C;  3GFJ A;  2F5E A;  1P2F A;  2O6G E;  3R6S A;  4HV6 A;  1MJB A;  4Q47 A;  2IT0 A;  5F6F A;  2DBB A;  5DUK A;  4I98 B;  1STZ A;  1EH6 A;  4NQW A;  3LFK A;  1LDD A;  2DO7 A;  5JI6 A;  2FA5 A;  2L4M A;  1IN7 A;  4BAY A;  2BYV E;  3NEU A;  1KYZ A;  3G3Z A;  3ECH A;  3R0A A;  4M9X A;  5LHG A;  3IKT A;  1RZ4 A;  4LLL A;  3O6B B;  1P92 A;  1QGP A;  3WTT C;  4KIB A;  5DD8 A;  3SHF A;  1H0M A;  1UCR A;  3F6O A;  1XDS A;  2IRF G;  3P7N A;  2P7C B;  5E1W A;  3I54 A;  1D5V A;  3O3K A;  4O3M A;  3KZZ A;  2FEZ A;  2STT A;  3VFZ A;  1ON1 A;  1REP C;  4M6Y A;  5DCF A;  4M71 A;  3I64 A;  1DPR A;  3J81 K;  1WRJ A;  4A0Z A;  3P9I A;  1ZLK A;  4UUV A;  5L3B A;  1WKM A;  4BNC A;  1RNL A;  2CSO A;  3H92 A;  1PDN C;  4H0E A;  5JVT A;  2DPD A;  3K69 A;  1R5H A;  1J75 A;  2W84 A;  1XMA A;  4R8H A;  1EH8 A;  1CF7 A;  3F8N A;  1IRF A;  5HLG A;  2J5O A;  5EEG A;  1S6L A;  1A04 A;  5E18 F;  1WI9 A;  1BN5 A;  1XCV A;  3C18 A;  4A0X A;  3GZ6 A;  4L0Y B;  1Z05 A;  2QZ8 A;  4RGX A;  2O61 A;  4A5N A;  2K4J A;  2V6C A;  1MZB A;  3DF8 A;  4QWQ A;  2CW0 F;  1R7J A;  4LB5 A;  3VOE A;  4HF2 A;  2Z33 A;  2PMU A;  3K9T A;  1YO5 C;  2VT2 A;  4OIR F;  3TO6 A;  4EV0 A;  2DAO A;  2P5V A;  4N0B A;  5DCM A;  4P5O A;  4ESF A;  3QU3 A;  3ZMZ A;  3HRT A;  4E70 A;  2FNA A;  3GXO A;  1KQ8 A;  1ZAO A;  4HZF A;  5FGM A;  5ICC A;  1O3S A;  1U3E M;  1TW2 A;  4EJU A;  2PQ8 A;  5HS9 A;  4OIQ F;  1FT9 A;  3ML6 A;  1L3L A;  4GYG A;  2FNP A;  3HOS A;  2XAQ A;  3EET A;  1QNT A;  1K78 B;  5ILV A;  4P9F A;  5KVR A;  4ENJ A;  2ZBK A;  3L00 A;  4RGR A;  1I6X A;  3WTS C;  4IHS A;  1NHA A;  2P8T A;  5HOO A;  4MGR A;  2YPR A;  2GA2 A;  4I0B A;  1MDM A;  2OZU A;  4LK0 F;  1EV7 A;  1J7K A;  2VC1 A;  4ENM A;  3BJO A;  1F1Z A;  4XBF A;  3W6K B;  5IT9 K;  1P6R A;  3JAM K;  3WTY C;  4ON0 A;  3DFG A;  4K2E A;  2RKH A;  1P4A A;  2GWR A;  2M8E A;  4LB6 B;  2YU3 A;  4M73 A;  5K5R A;  4WF2 A;  1MD0 A;  2DTR A;  4ENK A;  1XSD A;  1LEB A;  1B9M A;  1V4R A;  1T39 A;  3KCC A;  3V8L A;  2FBH A;  3LA2 A;  5LBQ A;  1R5G A;  4LGW A;  1UHW A;  2XKP A;  4EM2 A;  4ENN A;  4WCG A;  4QLC U;  2STW A;  2OD5 A;  1IN5 A;  2ZJ2 A;  1W7P A;  2XAG A;  1S29 A;  2JPC A;  1SMT A;  4WK8 F;  4A6D A;  3J80 Z;  2QVO A;  4KFC A;  3FZV A;  3REO A;  1U2W A;  4U0Y A;  2K4B A;  1G4D A;  1KU3 A;  3WE3 A;  4MEX F;  4PCQ A;  1LQ1 A;  4HA8 A;  3IWZ A;  1OYI A;  4ZYD A;  1BC7 C;  4U0W A;  5F64 A;  2KJB A;  3TO9 A;  5A2Q K;  4EM0 B;  3BJ6 A;  1XSX A;  1YW8 A;  2DI3 A;  3HIF A;  5D5X B;  2QQB A;  4KIC A;  4P96 A;  3RYR A;  4G6D A;  5FB2 A;  5BOX A;  2W57 A;  3QAH A;  1J9I A;  1O7L A;  2M30 A;  4EJO A;  2PLY A;  2P6S A;  4G9Y A;  3GFI A;  2PBI A;  2QQA A;  1T98 A;  3EUH A;  2GXB A;  1FYM A;  1TQM A;  1QQI A;  1SFU A;  3HRU A;  1FP2 A;  4UXN A;  3MCZ A;  3BP8 A;  3V7S A;  1JHF A;  1YYV A;  2UXN A;  1IN8 A;  2XRO A;  3E5X A;  4MNU A;  5BQT A;  1TW3 A;  2GZW A;  2M45 A;  2Z9O A;  2HEO A;  2VXZ A;  2PJP A;  2X0L A;  3TDZ C;  3WG9 A;  2HYF A;  2FSW A;  2K86 A;  2V1U A;  3JSP A;  3CDH A;  2VOP A;  3FMS A;  4YFN F;  1D3Y A;  4HX8 A;  2LKP A;  5L3G A;  3WTX C;  1JE8 A;  2MH9 A;  4GO1 A;  4DQ2 A;  3ZMS A;  3FXU A;  1UFM A;  4MTD A;  5D5V B;  4HV5 A;  1W7P D;  3JTH A;  1H9G A;  2R7F A;  1KU7 A;  5D4S A;  4P55 A;  2E7W A;  4OMY A;  2Z5U A;  3PQJ A;  3KP4 A;  3DV8 A;  1FY7 A;  2K27 A;  2A68 F;  2EFW A;  2FE3 A;  1TTY A;  1TNT A;  3TO7 A;  3M9A A;  2HTS A;  1HW2 A;  3BWG A;  4AD9 A;  2DQL A;  2D45 A;  1K79 A;  3I53 A;  4G94 A;  3F8F A;  3GEZ A;  1ZH5 A;  5JFR A;  3Q9V A;  2LNB A;  1S3J A;  1HST A;  5CLS A;  1BI2 A;  1R58 A;  2MLG A;  1BOA A;  3K0L A;  3EYY A;  3GLX A;  1X3U A;  3FF5 A;  5JHU A;  3KP3 A;  3T5X A;  2P5L C;  2XGX A;  1IUY A;  2H09 A;  3EDP A;  4M72 A;  2XAH A;  1YS7 A;  2BBY A;  5HVQ C;  3WTU C;  3ROU A;  2C6Y A;  3B02 A;  2OU2 A;  1LEA A;  2JRT A;  2W24 A;  2ZNZ A;  4B09 A;  5ICE A;  3ZN0 A;  1XB4 A;  1T0F A;  2XVC A;  3RTR A;  5FO5 A;  3SFZ A;  4ESJ A;  3KP2 A;  1O57 A;  2ZME A;  3O2P E;  2HDC A;  2RC4 A;  2EWN A;  5K5O A;  1IZ1 A;  3FM3 A;  2IVM A;  3K1N A;  2HZT A;  1IW7 F;  5L3C A;  3BPX A;  3T8T A;  2HKX A;  1B6A A;  4ZH4 F;  3RKY A;  5DV5 A;  4GXO A;  2LF8 A;  1SMY F;  4LFU A;  3GF2 A;  4HDU A;  4KN7 X;  3BPV A;  4P9U A;  1HXD A;  4FX0 A;  2EB7 A;  1O3T A;  4XRF A;  3F23 A;  3TOB A;  2DQR A;  3J7A O;  1ZRC A;  4I09 A;  1OR7 A;  1BIB A;  1FSE A;  3V4G A;  3I0T A;  5J6X A;  1R1U A;  4ZYG A;  3BZ6 A;  5K1Y A;  3E97 A;  1YLF A;  2EFQ A;  1HKS A;  4KMU X;  2XHK A;  3H3U A;  5DUI A;  2VE9 A;  2E1C A;  3ELK A;  2L54 A;  2KIU A;  4GCV A;  1BI0 A;  4MTE A;  1Z9C A;  5D6E A;  3C7J A;  2CGP A;  2PMH A;  4L18 B;  3ECO A;  2ETH A;  1F4K A;  3WGH A;  1FOK A;  4I01 A;  3DPT A;  3NRV A;  3FMQ A;  3FHZ A;  3BOQ A;  1G3S A;  1Z6R A;  1LJ9 A;  2HYG D;  4MHG A;  1ONV A;  3K2Z A;  4LD5 A;  3F72 A;  1S7A A;  2FQ3 A;  1YS6 A;  3CTA A;  1ZG3 A;  4G7Z F;  1O7F A;  4F7Z A;  1FBQ A;  1HBX G;  3FWE A;  3ZMV A;  4OMZ A;  4G6Q A;  1O3Q A;  4PDK A;  1R22 A;  2RNJ A;  1IRG A;  3CUQ A;  2OAZ A;  4UV8 A;  4G7H F;  4EM1 A;  2L01 A;  2HQR A;  1HSJ A;  2H27 A;  2FBK A;  4A12 A;  4EVI A;  2TDX A;  4IXA A;  3RPU A;  3E5Q A;  1ODD A;  3R60 A;  4IHT A;  4IVN A;  1P4W A;  3WGG A;  4EJV A;  2V1D A;  3KLN A;  3SZP A;  1FPQ A;  1FX7 A;  3WTV C;  1EH7 A;  4FHT A;  1TLH B;  2HTJ A;  4LG0 A;  4Z2Y A;  5CVI A;  1DUX C;  3U2R A;  5HDG A;  4B8X A;  1ZAR A;  1Y0U A;  1LDK B;  4L9T A;  1Z6T A;  3F22 A;  4HQM A;  2V79 A;  1XGM A;  2OBP A;  2XAJ A;  4PZJ A;  4U7B A;  2A6E F;  1YFH A;  4RGU A;  2LSO A;  1RUN A;  4HLY A;  2NAZ A;  1CF7 B;  5H20 A;  3WGI A;  4EJT A;  2V1X A;  1TBX A;  2WTE A;  5LHI A;  1YW9 A;  1JHH A;  4UVB A;  3LQQ A;  2L02 A;  3SQN A;  4GGG A;  4Q4Z F;  2BE5 F;  3J81 Z;  2KKO A;  4WXD A;  4OIN F;  2Q0O A;  5D5U B;  3U9G A;  2Y75 A;  3F8M A;  2O03 A;  3IWF A;  2FRH A;  2ZFW A;  3BDD A;  2PI0 A;  2JTV A;  5DCM B;  3F21 A;  1K7A A;  2MA3 A;  3QP5 A;  5FD5 A;  5FLX K;  5HLI A;  2CWE A;  3C1D A;  5FFX A;  5HDN A;  2VOD A;  2DK5 A;  4IJA A;  2A61 A;  2K02 A;  2RGV A;  4TV7 A;  1O3R A;  4FX4 A;  4S04 A;  1L0O C;  4MQV A;  5LGU A;  1IF1 A;  3RKW A;  1XCB A;  3I59 B;  1GXP A;  2JSC A;  2OQR A;  1JGS A;  3KP7 A;  2NNN A;  3M8F A;  1YG2 A;  4BQA A;  1ZLJ A;  3FMR A;  4RAZ A;  3KP5 A;  1IXC A;  3WU1 B;  3J80 K;  2Q2E A;  2ZKZ A;  2XAF A;  3OV8 A;  1XMK A;  4LJZ F;  3KET A;  1MGT A;  3KEQ A;  2DFI A;  5ERI A;  3HHG A;  1D8K A;  2W85 A;  3B73 A;  3HSF A;  2O3F A;  2HFH A;  4G8X A;  1MDM B;  3ERE D;  4CIC A;  4L9N A;  3CUQ C;  3C3W A;  2QM3 A;  3FM5 A;  1LB2 A;  3TQN A;  4KDP A;  3PFI A;  2VON A;  1KA8 A;  4RAY A;  1B1B A;  4CGZ A;  4U0V A;  1FWZ A;  5JR3 A;  4AWX B;  4M9Z A;  2ZO4 A;  5ICF A;  1OYW A;  1WQ2 A;  4R1H A;  5J8C A;  4Q48 A;  2G9W A;  5CVU A;  1TQI A;  2ZCW A;  3I58 A;  4YII A;  4A0Y A;  1OKR A;  1QO0 D;  4DNC A;  2ACJ A;  3IKV A;  3TGN A;  1W7P B;  2WV0 A;  5IT9 Z;  4ASN A;  4L9J A;  3JAM Z;  5LEK A;  3CUO A;  1HW5 A;  1KGS A;  1G3Y A;  3DPL C;  4BH9 A;  4IRG A;  5CVV A;  4YG2 F;  2A5Y B;  3RIR A;  1SD5 A;  4MQ9 F;  4MEY F;  1SFE A;  4RB2 C;  1Z7U A;  2VE8 A;  3RYP A;  1ULY A;  3V7C A;  2XV4 S;  3G73 A;  4YFX F;  3QOP A;  5HS7 A;  3ZPL A;  4GYI A;  3EQL F;  4CDG A;  1XN7 A;  3E3V A;  5L3F A;  4Q5S F;  3JW4 A;  3KFW X;  1LVA A;  2W25 A;  4CO8 A;  5AIP A;  2VBX A;  2IP2 A;  2YSR A;  5L3D A;  4HQE A;  4OU0 A;  2GAU A;  4OIP F;  2HS5 A;  2Y48 A;  4XLN F;  4LLN A;  3ABU A;  1LNW A;  3U1D A;  1XSV A;  4FT8 A;  1J59 A;  3L09 A;  3WTZ A;  1IN4 A;  4HOB A;  4I7H A;  4EMS A;  4HW0 A;  3LQR A;  2HKO A;  4L9V A;  1IN6 A;  1J2X A;  5A2Q Z;  2CYY A;  4IRI A;  4M6X A;  2O0Y A;  2OQG A;  4WWC A;  3V8J A;  2OZ6 A;  2M5W A;  1ON2 A;  4HF1 A;  5HLH A;  5TJJ A;  4HBL A;  2R3S A;  1BI1 A;  1AWC A;  5ICG A;  3P9K A;  5DYM A;  4I2O A;  2GA1 A;  4EGZ A;  1W5S A;  4XSX F;  5EEH A;  5HDK A;  1PP8 F;  4ZYE A;  3HSE A;  4NB5 A;  1C0W A;  3H3Z A;  2A3S A;  4I02 A;  1RI7 A;  3LST A;  3TOA A;  4AIK A;  3LAP A;  2ZXJ A;  2DU9 A;  2FXA A;  4KIF A;  1FBU A;  1FZP B;  5LGN A;  3RKX A;  5DDG A;  1YTY A;  2EFO A;  3QPT A;  1USS A;  4HF0 A;  3WOD F;  4EGY A;  2VOO A;  3IRR A;  4R79 A;  3CO7 C;  4KYW A;  1SFX A;  5H6R A;  4ESB A;  2QYO A;  3NQO A;  3E6C C;  2PEX A;  2XRN A;  1LDJ A;  4UNO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...