1U5TB

Structure of the escrt-ii endosomal trafficking complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
169
structure length
169
Chain Sequence
LDREKFLNKELFLDEIAREIYEFTLSEFKDLNSDTNYMIITLVDLYAMYNKSMRIGTGLISPMEMREACERFEHLGLNELKLVKVNKRILCVTSEKFDVVKEKLVDLIGDNPGSDLLRLTQILSSNNSKSNWTLGILMEVLQNCVDEGDLLIDKQLSGIYYYKNSYWPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of ESCRT-II endosomal trafficking complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
molecule keywords appears to be functionally related to SNF7; Snf8p
total genus 43
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2004-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1u5tB01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1u5tB02
2H27A 4HLYA 1XGOA 4RAYA 3BDDA 2EV6A 4L0ZB 3O6BB 4RB2C 3R0JA 3IHUA 4RS8A 3R6SA 1W5TA 4KDPA 4ASNA 2RV8A 4MTEA 3NQOA 3RKWA 3WTZA 1USTA 4NQWA 2PEXA 1HKSA 2Y48A 5ED4A 2Q0OA 3L7WA 4UHTA 2VBYA 3HHHA 1XCVA 1FBSA 1F1ZA 5L3CA 1T0FA 5LLQA 1O3SA 1P4XA 4M72A 3V8LA 3T0YA 5DUKA 1UB9A 3O3KA 1YW8A 2HGCA 4G8XA 2YSRA 4XRFA 2P7VB 5DCFA 1PDNC 2P6TA 2PMHA 2XAQA 1V3FA 4EJWA 1DPRA 2XKPA 1YYVA 5ILVA 3F3XA 2CO5A 3NRVA 3ELKA 3LQQA 3WODF 1J75A 4FHTA 2OZUA 4HLXA 5FLXZ 1B9MA 2M5WA 3C1DA 3CUQC 3GZ6A 5AIPA 2C6YA 2ZMEA 5LGNA 2FMLA 4M74A 2VBWA 3D5LA 3KLOA 4N9IA 3B73A 5K1YA 4HF2A 3K0LA 2L4AA 4U7BA 1OYWA 3M8EA 1LVAA 1NHAA 1QZYA 4UV9A 1HSJA 4IRHA 2ZO4A 4U0YA 1EH6A 3GFMA 2OA4A 1UCRA 1IW7F 2FU4A 3BP8A 3T1BA 4JQFA 4PZJA 2V79A 4HV5A 3ULQB 4XLPF 4D0PA 2HKXA 2V1DA 5LHGA 3J80K 2OAZA 2ISZA 5IT3A 5F1RA 2UZKA 4WF2A 4LG0B 2F2EA 4FX4A 2M8EA 1OYYA 1LEAA 4HW0A 4WWCA 4WXHA 2YX4A 3KE2A 3G3ZA 1D5VA 1G4DA 1SMTA 3U9GA 4R1HA 4HX7A 3KP7A 3BY6A 1HSTA 3E6CC 4KT5C 2CSOA 4KFCA 3CDHA 2L02A 4LK1F 1W4MA 3E6DA 5AIQA 1KU7A 1IZ1A 1ZG3A 3GW2A 3TO7A 2KIUA 4EVIA 2QQAA 4EM0B 3RPQA 3KZZA 2ZXJA 2E1CA 2D1VA 3L00A 3REOA 4NHJA 1XD7A 3VFZA 1FYKA 1KA8A 5E1XA 1LDKB 2K27A 5HOOA 3GX4X 3K69A 2LNBA 3EUHA 5DCMA 4BHCA 2YX7A 1ON2A 2FF4A 5KVRA 1USSA 2XROA 2W57A 3RKXA 2VBZA 3TGNA 1T38A 3MQ0A 3U1DA 4IHSA 1T39A 1ZARA 2MH2A 5ILUA 3T8RA 2WC2A 2R7DA 1FP1D 1EH7A 2VODA 1W7PB 1FSHA 3IC7A 2HYGD 2Z99A 4XLNF 1S7AA 3V7RA 1O7LA 2FA5A 4L5JA 3E3VA 3R61A 2VE9A 2PG4A 4YFNF 1FYMA 2YPRA 2Z5UA 2ADUA 1A04A 4MTDA 4AWXB 3DP7A 1U2WA 4OIOF 2DQLA 2JT1A 2ZMEB 4KICA 3GZ5A 1E2XA 3WTUC 5D6EA 2HTSA 4EJTA 3MZHA 2JTVA 5IT9K 2P8TA 2EV5A 1ZREA 5K5RA 1IXSB 4PGGA 3HRUA 1J0RA 1G3TA 2P5LC 5HDGA 3QP5A 4KNYA 1E17A 3KP5A 5E1ZB 4QWQA 4MGRA 4H0EA 1I6XA 3AAFA 5D5VB 1IF1A 5HS7A 3ZMTA 4BHPA 3COAC 4PDKA 1IN4A 4IRGA 4A0XA 1FWZA 3WG9A 4UVCA 1O3TA 1PUEE 3GFIA 2GAUA 5DDGA 4M9XA 3FHZA 5A2QK 1CF7B 2JSCA 4MNUA 4BQAA 2STWA 4RGRA 2W24A 5ICCA 4GGGA 1XSXA 1SD6A 1UFMA 2G9WA 1K78A 2ZFWA 3ZPLA 1D8KA 4IJAA 5H6QA 3SQNA 4WXDA 4AIJA 2GXBA 2LF8A 1QPMA 2XGXA 1OPCA 2FRHA 4OINF 3QAHA 1RZ4A 1BBYA 3I59B 2FBIA 3GXOA 3KETA 3KEQA 4WXCA 2RNJA 2XAGA 1X3UA 3ZN0A 1G6NA 3FMRA 1XDUA 4I2OA 3QU6A 5E18F 3RDIA 5HDKA 4L9JA 3M9AA 1HW2A 5LHHA 1F9NA 3EYIA 4G7OF 1QNTA 3N4MA 2HYFA 5CJ9A 2W25A 2IW5A 5E8GA 3JSPA 1U5TA 2LSOA 2RDPA 5L3BA 3I54A 3KFWX 3HHGA 5D8KB 1PP8F 4EGYA 2OQGA 1LB2A 1R1UA 2FNPA 4A6EA 3Q9SA 4G9YA 2MLGA 3L09A 4EM1A 2VOOA 5E20A 4R8HA 2CW0F 2G7HA 1J7KA 2GA2A 2L3DA 2VOPA 2BGCA 1ZYRF 3LA7A 3F8MA 4BAYA 3GO5A 4LLNA 2L4MA 3EETA 4YFXF 5ICGA 1LNWA 3CUOA 6PAXA 3ROUA 5ICFA 3BOQA 1GVJA 1P2FA 3IWFA 1BI2A 1WI9A 5FD6A 3LAPA 3U2RA 4ZZDA 3M8FA 4HQEA 5JHUA 1K7AA 2PJPA 2FSWA 1WKMA 1I27A 4YFKF 1SD7A 2VONA 3K1MA 5LRSA 2AS5F 4ZYDA 4P9UA 2EJRA 2M1BA 1TW2A 3IRQA 4RB0A 1F5TA 1YTYA 3OV8A 3WTYC 3GWZA 1P92A 3QRFF 1RUNA 3F8BA 3I53A 1ZRFA 1BJAA 4N9HA 1HXDA 1TLHB 3HTSB 5EEHA 3OOPA 3FXRA 4BYYA 2HQNA 4WX9A 2M87A 4ZYEA 2MH9A 5CYVA 1GXPA 3FMSA 3TO9A 3HSEA 2D45A 1I5ZA 4GXOA 3QOPA 4G7ZF 4MHGA 3WGGA 1ZH5A 1S29A 4DNCA 2DO7A 2KKOA 2AXLA 3CUQB 3RYRA 5F6FA 1Z7UA 1IN5A 2QQBA 2EFOA 2RN7A 3BJ6A 1MZBA 1G3SA 4CXFA 4M6YA 3V7CA 4LK0F 3WGIA 2OU2A 2RVCA 5E8IA 3MZYA 1KU2A 1V4RA 3VB2A 1S6LA 2V1UA 2LKPA 4HDVA 1ZGJA 4U0WA 4A6DA 3EQLF 1YQAA 4TV7A 3K1NA 4LG0A 1J9IA 5LHIA 1JHFA 4BXUA 2MD5A 3RTRA 5ERIA 2K4BA 4A0YA 1TTYA 5LGUA 2PLYA 4KIFA 1UHMA 3IRRA 3E6BA 1P4WA 3VEPA 2VT2A 3WE3A 3WTWC 3MAJA 1BN5A 2DI3A 2DU9A 2NYXA 5FFXA 1C0WA 1WQ2A 1ULYA 3CTAA 1WRJA 1FY7A 4P9FA 1SFXA 4UV8A 4G6DA 4KN7X 2M45A 3HYIA 3JAMK 4ETSA 4GYGA 1OKRA 1I1GA 4UVAA 3TOBA 1KQ0A 4LLGF 1I1SA 2Q8KA 3QPHA 3FWEA 5JR3A 4S04A 2CYYA 4HDUA 3I58A 4KIGA 4Y17A 2F5FA 3ISPA 1CF7A 4Q47A 1FPQA 3SZPA 3Q5FA 1YIOA 2IA1A 5J8FA 2DTRA 3S2WA 1S3JA 3F6OA 3GF2A 3F72A 2EFNA 2O03A 5CVUA 1UHWA 3LSTA 2QZ8A 3HRMA 5D4SA 2QLZA 4OMZA 1FT9A 4L9VA 1BI3A 2H6CA 2D2WA 5D8LB 2OZ6A 3WU0A 2ESHA 2VC1A 1EH8A 4RGUA 3GEZA 4Y13A 1P4AA 1AWCA 1R5GA 4HAMA 2O3FA 5IT9Z 4Z2YA 1XGMA 5BQTA 2D1HA 4KYWA 5D6FA 3V8KA 3F22A 4CDGA 1HQCA 1H9TA 2FE3A 1U5TB 3IKTA 3GFLA 5DD4A 4XSXF 3KP6A 3E97A 5DD8A 3LA3A 1SFEA 3M7GA 2GQQA 4HF1A 2OBPA 4ON0A 3QPTA 2XASA 2E7WA 3F21A 3SHFA 2VBXA 5DUIA 3GFJA 2ZNYA 4G94A 1XSVA 1FBUA 1BIAA 3HRTA 3KCCA 4WK8F 2ISYA 2TDXA 1SD5A 1ZAOA 1R22A 2XV4S 2EFWA 2FQ3A 1R1VA 3C3WA 4GYIA 1FOKA 3F8CA 3H3UA 3O2PE 2EB7A 2LDUA 1XMKA 4RGXA 3J7AO 2IT0A 1ZGAA 4IF4A 1R5HA 2JPBA 5CVIA 2HOEA 4WCGA 1Z1DA 3WTSC 1YFHA 1B9NA 1BM9A 3R60A 3JTHA 1TQIA 2P7CB 2ZJ2A 4F7ZA 4L9NA 4EJVA 4OIQF 2KJCA 5DV5A 1FSEA 4KN4X 3HOSA 3W6KB 3WTTC 5JFRA 1QBJA 4MEXF 3TO6A 2E1NA 3I0TA 4K2EA 2PQ8A 3T5XA 1HKTA 1KGSA 2ELHA 1KYZA 3FM3A 3JSOA 1SAXA 2RC4A 1Z05A 3FXQA 1F4KA 1R23A 4CYDA 3F8NA 2K7LA 3I71A 3P7NA 4LB6B 1DUXC 5HLHA 4M9SA 2VXZA 4HBLA 4OIRF 3F8FA 1RUOA 4LGWA 4KA4A 4M9ZA 1BI1A 1HBXG 4EM2A 1O3RA 5LEKA 1XDSA 3I4PA 2B0LA 3WE2A 1IXRC 4B8XA 5FD5A 4I98B 4ZH4F 5J6XA 5E1WA 2DK8A 4E70A 2HDCA 2VC0A 2XHKA 4ZYHA 5BMZA 4UVBA 5CLSA 5KK1A 2BEOA 2PFBA 5JI6A 1Z6TA 1O57A 2STTA 1YS7A 2JZYA 3KP4A 2K86A 2PBIA 1ZG5A 5LEJA 2DT5A 3JTGA 4IXAA 4EJUA 1U3EM 2EV0A 2FNAA 1O3QA 3W6JB 4YIFA 5BPIA 2EWNA 3TKYA 2L01A 4ESFA 1T98A 4YIIA 1KU9A 2VT3A 3T8TA 1QZZA 3LFKA 4MQ9F 2E7XA 4GCVA 1S8NA 3N97A 3GYHX 2QBYA 5J8CA 2IJLA 2ZBKA 2UXNA 2NNYA 1J2XA 1JE8A 1KU3A 5K5QA 5ICEA 2KIMA 2ETHA 1VTNC 2QUFA 4IRIA 5BPDA 1DPUA 4OIPF 3F23A 4XSZF 2LF7A 4Y15A 3CO7C 1IAWA 2P4WA 1TW3A 1LJ9A 5FO5A 3P9KA 2EFPA 4I0AA 1MJBA 1S7OA 3E5QA 2XVCA 3ZMDA 4A5MA 2HR3A 1FC3A 3D0SA 4CO8A 3ABTA 2DPDA 5AONA 2CG4A 2GA1A 3J81K 5HVQC 1H9GA 3HSFA 1FX7A 1YO5C 4ENNA 5EEGA 5D4RA 3FX3A 2WWYA 2FEZA 1XGSA 3FZVA 4LFUA 3R4KA 1ZLJA 4ENJA 3FM5A 2RGVA 3VOEA 2CGPA 2A3SA 3KP3A 2XRNA 4OU0A 2VE8A 1G3WA 2V1XA 5D5XB 4RB3C 4P55A 1K78B 3TDUC 5LRRA 4EMSA 4O3MA 1RI7A 2DPUA 4UUVA 2FOKA 4LMYA 1IUYA 2DBBA 1QGPA 1IRGA 2O6GE 3HUGA 2GXGA 4HV6A 2ACJA 2CWEA 1Y0UA 2A61A 3DPLC 3P9IA 4AD9A 1B6AA 1IRFA 4EQQA 1YW7A 4ESBA 2Y75A 2Z33A 2IRFG 1AOYA 1D8JA 2BE5F 1U5TC 4U7DA 2OQRA 4RGSA 1D3YA 4LB5A 3V4GA 2K02A 1Z91A 3KEOA 4I02A 3WU1B 2A68F 1MDMA 1QQIA 2IA2A 3ZP5A 4HOBA 2EA4A 1ODDA 2FBHA 1MDMB 3WTVC 4KIBA 5HLGA 2FXAA 4HYEA 1TQPA 3IKVA 2COMA 3ZMZA 3ZQ7A 3HTUA 3MWMA 3JAMZ 1KYWA 1RNLA 4G7HF 2DQRA 2UXXA 1EV7A 3HSRA 3PQKA 1TBXA 1MKMA 1K79A 4M6XA 1H0MA 3ML6A 2HTJA 3HIFA 4KMUX 2BYVE 1DDNA 2M30A 4RAZA 4HX4A 1MGTA 4BH9A 1PP7U 1MJAA 1W7PD 3DF8A 4ENMA 4FX0A 2P6SA 1XMAA 3ECOA 4MQVA 2V9VA 1TNTA 4A2UA 2O0YA 2JPCA 3GVAA 4CZZA 3GLXA 3E5UA 2QM3A 3RI4A 5TJJA 3KP2A 5DYMA 2KJBA 3WGHA 3LWFA 3BJAA 1IN7A 2ZKZA 5DCMB 2G7UA 4BHBA 3DEUA 2DAOA 2HS5A 3FF5A 1R36A 5TRDA 1R1TA 1ZHFA 3HRSA 1JHHA 3MFKA 4P5OA 2HEOA 2PMUA 1YS6A 2A07F 3GUDA 3L2CA 1KQ8A 4LLLA 1LEBA 2F5EA 1OMIA 3MEXA 4EGZA 3ZMVA 1TNSA 4ZYGA 4A0ZA 2H6BA 1L0OC 2MC3A 2QVOA 1G3YA 1IN8A 5E17F 1FNNA 3DPTA 4L0YB 1ONVA 2EK5A 2O61A 3EYYA 4PGHA 1ZRDA 4I01A 5CVJA 1XGNA 4Q4ZF 2HFHA 3BJOA 3CJNA 3R0AA 1HW1A 1T6SA 3V7SA 4Q5SF 4A12A 3CUQA 4ZZLA 4EV0A 5FB2A 1Z9CA 3SXYA 3ECHA 2QBYB 5LBQA 5FLXK 1QO0D 4AIKA 2Z9OA 3ABUA 4G6QA 2HWVA 4HF0A 4OMYA 2NNNA 2DLLA 2K4JA 3ERED 3P9CA 1Z6RA 4L9TA 3IL2A 2UWMA 2BV6A 2GZWA 2QQ9A 4U0VA 5F64A 3RJPA 1BC8C 2YR2A 4LJZF 4BNCA 3TDZC 2VN2A 1GXQA 3I5UA 3TQNA 5A2QZ 2H09A 3EDPA 2PI0A 3LA2A 4NB5A 2J5PA 2XIGA 2X0LA 4CICA 1YW9A 2A6EF 2F5CA 3K9TA 3CLOA 1LDDA 1U8RA 4M73A 1L3LA 4QLCU 3ZMUA 2H94A 5CVVA 2XAHA 2R7FA 2YU3A 3H3ZA 3MCZA 2CFXA 4JK1X 5HS9A 5BS6A 3C18A 1XB4A 5CVRA 4UXNA 2GIVA 3HOTA 2L54A 2MBFA 2IA0A 3PFIA 5LGTA 2P5VA 1REPC 1KQ9A 3IWZA 4DQ2A 2ZCWA 4M71A 3BWGA 2NS0A 3LAJA 2GWRA 5BOXA 5D5WB 2A6HF 1O7FA 4PCQA 4FT8A 1SMYF 5JVTA 4OOIA 2R3SA 2XUBA 3M1EA 3I59A 4ENKA 1RIOH 1WWXA 1P6RA 2DW4A 3DQVC 3FXUA 5FGMA 1JGSA 2V6CA 1JXSA 4A5NA 3Q9VA 3J81Z 5H6RA 4IHTA 2P5KA 2WV0A 1LDJA 2A69F 1YLFA 2PN6A 3H92A 4O5VA 3DXJF 4B09A 1R7JA 1YG2A 3E6MA 1MD0A 4LD5A 3QP6A 5L3GA 3F6VA 3ZMSA 4JBAA 3BPXA 2WTEA 1W5SA 2X4HA 1BC7C 5K5OA 1SFUA 2QYOA 1R00A 3DKWA 1J5YA 3V8JA 2HKOA 3FMQA 4XBFA 3J80Z 5HDNA 3I64A 1T2KA 4U88A 1FLIA 3E5XA 2NAZA 1U6GA 4EJOA 3BZ6A 2QENA 1SD4A 4Q48A 2Z3YA 2CQKA 3B02A 2J5OA 4GO1A 3DV8A 2ZNZA 1XN7A 1B59A 1BI0A 2ESNA 2QWWA 4I0BA 2Q2EA 4YG2F 2EA2A 3K1PA 1BOAA 3PQJA 2OD5A 2IPQX 4KUMA 4HA8A 1K6OA 3L9FA 2DK5A 5ILSA 2MA3A 1J59A 4HZFA 4IVNA 3KZYA 2IVMA 2F5DA 1OYIA 5H20A 1MJ9A 4R79A 4N0BA 2KRFA 2FMYA 1STZA 2EFQA 1HKQA 2XAFA 3RYPA 3RIRA 3VODA 4P96A 4UNOA 3JW4A 3RPUA 4ESJA 2HZTA 4IPAA 2MLKA 1W7PA 2HQRA 2BBYA 1ON1A 1TQMA 5HLIA 1GHCA 4I09A 1ZN2A 3LQRA 2FBKA 4O6JA 2JRTA 5HS8A 4S05A 1XCBA 1XSDA 3RKYA 4CHUA 4RB1A 4L5IA 3G73A 3CO6C 2Y0MA 2DFIA 3SFZA 1LQ1A 1FZPB 1DP7P 1B1BA 3TOAA 2NRAC 1OR7A 2O8XA 3C7JA 4KMFA 1FP2A 1FYLA 1ZG1A 2RQPA 4CGZA 2IP2A 1ZLKA 2KIFA 5DEQA 4L18B 2RKHA 4AVPA 3K2ZA 4AIHA 1HW5A 2W85A 4HQMA 4I7HA 3KLNA 3BPVA 5FFZA 1Q1HA 3NEUA 2XAJA 1B4AA 5D5UB 4MEYF 2W84A 2XKOA 3DFGA 5L3DA 5L3FA 1CGPA 1BIBA 3WTXC 1WSUA 3BROA 1U78A 1FBQA 2A5YB 1IXCA 1IN6A 3QU3A 4HX8A 1ZRCA 1R58A 3SZTA 5L3EA 3ZN1A
chains in the Genus database with same CATH superfamily
3VYSB 3QQAA 2H27A 3M1CA 4D9JA 2FOWA 4UUSB 3ABLH 3K70D 4HLYA 1XGOA 4RAYA 1PYVA 3BDDA 2EIJH 2EV6A 4L0ZB 2DJIA 2W4SA 1S9HA 3FK6A 3O6BB 5GTHC 3R0JA 4RB2C 3W2AA 3U21A 4BJTA 3M3YJ 3IHUA 4RS8A 5KCMA 2CS3A 3R6SA 2R7OA 1MBKA 4NQWB 2R92J 1DGWY 1R5ID 3CZ6A 4JX5A 4YRVA 4RLQA 5EG0A 1W5TA 2KPMA 4KDPA 4ASNA 2RV8A 4XRSG 2E2IJ 4MTEA 2EINH 3QYFA 1WHUA 3OYEA 1VQ6I 3NQOA 3RKWA 3WTZA 3JRGA 1USTA 4NQWA 2PEXA 1HKSA 2Y48A 2HOSA 3BG9A 5ED4A 5GPCA 2ME0A 1K4TA 5EZHA 2Q0OA 3L7WA 1Z7LA 4UHTA 2VBYA 3WHCA 3HHHA 2R7RA 2W7NA 2XPWA 3TP3A 1XCVA 2HQAA 1FBSA 1JKPC 1F1ZA 1GUUA 3CC7I 4D5CA 4UUSA 2DT7B 1OCCH 3M07A 1RKWA 1T0FA 5L3CA 4Y7NJ 3GCMA 3MD2A 5LLQA 1O3SA 1P4XA 5IPAA 4M72A 3V8LA 3T0YA 5DUKA 1UB9A 2OTJI 3O3KA 1AKHA 3PO2J 1YW8A 1X1AA 2HGCA 4G8XA 2Y2ZA 2YSRA 2F4OB 4XRFA 4KJZA 2NS7A 2XC7A 4Y3OA 2QA4I 4X1EA 2KQRA 2P7VB 5DCFA 1PDNC 1MBEA 2P6TA 3L2QA 2PMHA 2GXAA 2XAQA 1V3FA 3AG4H 1WJDA 9ANTA 3SEQA 4EJWA 1DPRA 3HG9A 2XKPA 1YYVA 3CQZJ 3S3MA 5ILVA 5FRNA 3F3XA 1X1DA 2CO5A 3NRVA 3PJRA 1YE9A 3ELKA 3LQQA 3WODF 2EPFA 2E1MB 1YITI 4FHTA 1J75A 2R93J 2OZUA 4HLXA 4ZC3A 5FLXZ 1B9MA 2RNGA 4RAGA 2M5WA 2QCOA 3Q3SA 3C1DA 4PJ0C 1TWAJ 2QGUA 3CUQC 4BEHB 3GZ6A 5AIPA 2C6YA 3PUBA 2DFHA 4MFEA 2ZMEA 5LGNA 2FMLA 4M74A 2VBWA 3D5LA 3KLOA 4N9IA 3B73A 5K1YA 2BHYA 4HF2A 3K0LA 2L4AA 4U7BA 4C3JJ 3DKXA 1OYWA 3M8EA 2DOAA 1LVAA 4E7KA 1NHAA 3TBIA 1QZYA 4UV9A 1HSJA 4IRHA 3GTOJ 2F4MB 4I99C 2VKDA 3ZGKA 2KRCA 2ZO4A 4U0YA 1EH6A 3GFMA 2OA4A 1VNDA 1UCRA 2R7TA 4IOCF 1IW7F 4LITA 2FU4A 1UHSA 3BP8A 3T1BA 3DBLB 4JQFA 1T95A 5C44J 4KITB 4PZJA 2V79A 3CCJI 4HV5A 1VQ9I 1ZKGA 3ULQB 1ETVA 4XLPF 1UZCA 3GMEA 5TGTA 4D0PA 2TCTA 3CCEI 4E7SA 4PJMA 2HKXA 2VQLA 2V1DA 3HXLA 2Q1ZB 5LHGA 3J80K 1TT0A 2OAZA 2ISZA 2LY2A 3ZQGA 2ZMEC 5IT3A 5F1RA 4HRIA 2JMWA 4KT6A 4RBOA 2UZKA 4WF2A 5JLWA 4LG0B 2F2EA 4FX4A 2M8EA 1OYYA 4C9YA 1LEAA 4HW0A 2HVQA 2QSGX 4A3MJ 4WWCA 3EPZA 4WXHA 2YX4A 3FXOA 1TL8A 3KE2A 3ZQIA 3G3ZA 1YX5A 4DJAA 3MKZA 1G4DA 1D5VA 1SMTA 3U9GA 4AU7A 4R1HA 4HX7A 3KP7A 3QPSA 3D5SC 3BY6A 1FOWA 3I56I 1HSTA 3E6CC 1S5LC 2VL8A 4KT5C 3FKJA 1MBFA 2CSOA 4KFCA 2WAFA 3CDHA 2OC6A 3J7AY 2L02A 4LK1F 4UB6C 5K7ZA 1W4MA 2E1MC 3E6DA 2VIXA 5AIQA 4IO9F 1KU7A 1MIJA 2LTPA 1IZ1A 1ZG3A 3GW2A 3TO7A 1Y1VJ 2KIUA 4EVIA 1ETOA 2VLAA 2QQAA 4EM0B 3NARA 3RPQA 3KZZA 4BDZA 1B8IB 2LR8A 2ZXJA 3A4CA 4XIDA 1RPWA 4B3XA 3VSLA 3SFIA 1EKEA 4BXFA 2E1CA 2D1VA 3L00A 3REOA 4NHJA 1XD7A 5LD2C 3EUKL 3VFZA 4BJ6C 1Y8QB 1FYKA 1KA8A 5E1XA 2DYSH 4AM3A 2ECCA 1LDKB 2E60A 1FOYA 1AHDP 2K27A 2CMPA 2BVLA 5HOOA 3IUOA 4LIVA 3DLAA 3JRAA 4E7IA 2RAEA 2Y0SN 2W1OA 3GX4X 3K69A 2LNBA 2X6OA 3EUHA 2CUFA 2IS4A 1XC5A 2XPUA 3H5NA 5DCMA 4BHCA 2YX7A 1ON2A 2FF4A 5KVRA 1USSA 1TWCJ 2XROA 2W57A 3RKXA 2VBZA 3TGNA 5GP9A 3E7LA 1T38A 1SVOA 4JP0A 4EATA 3MQ0A 3U1DA 1QVUA 3VYUB 4IHSA 1T39A 2PX9A 1ZR2A 4IQJA 1ZARA 3RQ4A 3OS0A 2MH2A 5ILUA 2NVQJ 1EJ9A 3T8RA 3VYRB 3EUAA 2WC2A 2ZXIA 5BNGA 2IGKA 5HLTA 2R7DA 1FP1D 1FEXA 1JKQC 1EH7A 3M8JA 3TEDA 3JRHA 2VODA 1MMAA 2R7VA 4U87A 1W7PB 2M3AA 1FSHA 3IC7A 2HYGD 2KISA 1BR4A 2Z99A 2JWTA 4XLNF 1S7AA 3V7RA 1DU0A 2L2OA 1T56A 1WCMJ 1O7LA 1NTCA 3HGGA 4BS9A 2DOEA 2FA5A 4L5JA 2EZKA 3IV5A 3BR5A 1BJZA 3E3VA 3R61A 3BQZA 1I39A 2VE9A 4N4OB 2R5ZB 2PG4A 3RPUD 4YFNF 3B6AA 1FYMA 4RA2A 2YPRA 2Z5UA 3CP8A 2ADUA 1A04A 4MTDA 2JVHA 4AWXB 4D5FA 3DP7A 5IY5H 4DBQA 2LY1A 5J47A 2H1KA 1U2WA 2EIKH 4OIOF 3HEFA 3BTLA 2JA6J 2K9NA 2DA3A 2DQLA 1MMGA 2JT1A 2ZMEB 4KICA 4CUGA 4HNVA 3GZ5A 2F6CA 1E2XA 3QYEA 2NVYJ 1M1EB 3WTUC 4XLFA 3W2WA 5D6EA 2HTSA 1A6IA 4N4NB 2DDBA 4CCMA 2DODA 4EJTA 1MBGA 1K6YA 3I9V2 4PFOA 3MZHA 1FIAA 2JTVA 5IT9K 2P8TA 2QSFX 3AL0B 4W97A 2EV5A 2CW7A 1VF9A 2XSDC 4F55A 3AKZA 1ZREA 5EF6A 3CF2A 5K5RA 1IXSB 4PGGA 3HRUA 1J0RA 1G3TA 3U1KA 5HDGA 2P5LC 4E7HA 4IHVA 1HDPA 3QP5A 5DS9A 4KNYA 1E17A 3KP5A 5E1ZB 2EQRA 4XR6A 4S0HB 4QWQA 4MGRA 4H0EA 3CCRI 5DM7F 3JRIA 4J00A 3S93A 1I6XA 4RM2A 3OL4A 3ZRGA 5D5VB 3AAFA 1IF1A 3K4MA 5HS7A 3ZMTA 4BHPA 1YRNB 3COAC 4PDKA 3K4JA 1V55H 1IN4A 5E3LA 1IDYA 4IRGA 4A0XA 1FWZA 3WG9A 1RR7A 4UVCA 1O3TA 1PUEE 3GFIA 2GAUA 2EH3A 5J4YA 2HVRA 5DDGA 1MH3A 4LOCA 4M9XA 3FHZA 3ZXSA 5A2QK 1CF7B 3ZQCA 2JSCA 4MNUA 4BQAA 1D0ZA 2STWA 4F52A 4RGRA 2W24A 5ICCA 5E3OA 4GGGA 3OYHA 3M4OJ 1I50J 4AYBA 2OF7A 1JTXA 1XSXA 1SD6A 2ZXHA 1UFMA 2G9WA 1K78A 3LFUA 1YJ9I 2ZFWA 1YJWI 2GOXB 3ZPLA 1D8KA 1P7IA 3TMOA 3MKLA 1PVEA 4IJAA 5H6QA 3KYLA 3DEWA 3SQNA 4HNTA 4WXDA 2HYJA 4AIJA 2GXBA 3CLQA 2OPTA 2VKHA 2JVGA 5EG0B 4XN3A 2LF8A 3KIOA 4XONA 1QPMA 2XGXA 1OPCA 1H8AC 2FRHA 1I3AA 3AFHA 4PSWA 4OINF 1LKXA 3QAHA 3K4BA 4B44A 4II2A 2CW8A 1RZ4A 3H0GJ 1BBYA 2P81A 2HQ5A 4FQGA 2DMUA 3I59B 2FBIA 2VKVA 5GAHJ 3GXOA 4CCKA 2QSHX 2DA1A 3KETA 3KEQA 4WXCA 2RNJA 4I76A 2XAGA 2NOJB 2BXZA 1X3UA 3ZN0A 3CJRB 5IOZA 1JGGA 1X2NA 3LSGA 1JUSA 1G6NA 1IG7A 3FMRA 1XDUA 5B3SH 4I2OA 3DBHB 4IHWA 5IOYA 3QU6A 5E18F 2ME6A 2IS2A 5IP6A 3RDIA 5HDKA 4L9JA 4GDFA 3M9AA 2FJ1A 1SANA 1HW2A 2CQ7A 1F9NA 5LHHA 3EYIA 4DZPA 2O9LA 2LD5A 4G7OF 1QNTA 1ERDA 3N4MA 1OCPA 2HYFA 3H35A 5CJ9A 2W25A 5JLXA 5B1AH 2JA5J 3KYDB 3D5RC 2VXDA 2IW5A 3GTKJ 4YIRX 5E8GA 2XGEA 3JSPA 1U5TA 2LSOA 3JRFA 2RDPA 5L3BA 3I54A 3KFWX 3HHGA 3PNTA 1PJRA 5D8KB 1PP8F 4EGYA 3S2DJ 1FTZA 2OQGA 2FD5A 2MW8A 1LB2A 3S1QJ 3HJEA 4H4KC 4D1QA 2PMZA 1R1UA 2FNPA 4A6EA 3Q9SA 4MLOA 1AA7A 4G9YA 2M0MA 1BOBA 2MLGA 3L09A 4EM1A 2OCCH 2VOOA 5E20A 5J40A 4R8HA 4A3LJ 2CW0F 2A5WA 1MW7A 3JRCA 2G7HA 1J7KA 1WJEA 4E7ZA 2GA2A 2L3DA 3CCLI 3JCUC 3A01A 4M3FA 2ZJRF 2VOPA 2BGCA 1ZYRF 3KZIC 3LA7A 1IV8A 3F8MA 4BAYA 2DN0A 3GO5A 1GVDA 4LLNA 2L4MA 3K2AA 2HNHA 3EETA 4YFXF 5ICGA 1LNWA 3CUOA 6PAXA 4GFBA 4A3JJ 3ROUA 1SEUA 5ICFA 1VZ0A 3BOQA 1GVJA 5JHFA 1P2FA 3IWFA 1S7EA 1BI2A 1WI9A 1Y6IA 5GAEJ 2HI3A 3G1OA 5FD6A 4A3CJ 4A3EJ 3LAPA 4UUTA 2M4KA 4XN0A 1VQKI 3K4NA 1UJ8A 3U2RA 3I4MJ 1QRYA 3RQIA 4ZZDA 1GDTA 1GV5A 4QPOA 4E7JA 5F1JA 3M8FA 4HQEA 1Z0XA 2BY2A 1X1PA 5JHUA 4G6TB 5GPAA 1K7AA 1JJ6C 2PJPA 1ETYA 2FSWA 1WKMA 3OMYA 3RCOA 1I27A 4YFKF 2BY3A 3G1LA 1SD7A 3CDLA 2X6YA 2VONA 3K1MA 2F48A 5LRSA 2AS5F 4ZYDA 4P9UA 2CFOA 2EJRA 2M1BA 3TP0A 2DXIA 4IZZA 1TW2A 3IRQA 2COBA 4JYKA 4RB0A 1F5TA 3S1NJ 2LP0A 1YTYA 3OV8A 1IC8A 3WTYC 3VWBA 3GWZA 3TW7A 1P92A 2AQFA 3QRFF 2DMNA 1RUNA 2XPVA 3F8BA 2DA6A 3I53A 1ZRFA 1BJAA 2IBDA 4N9HA 1RKTA 1HXDA 1TLHB 1ACIA 3HTSB 2TRTA 5EEHA 2D5VA 3OOPA 3FXRA 4BYYA 1SFOJ 2HQNA 4WX9A 2L0KA 2M87A 4ZYEA 3CDIA 2MH9A 5CYVA 3BLYA 1GXPA 3FMSA 5EDNA 3TO9A 3HSEA 1DU6A 2D45A 3DBRB 1I5ZA 4ZDLA 4GXOA 3QOPA 2AHQA 4G7ZF 4MHGA 3WGGA 2Z2SB 1ZH5A 5FLMJ 3OR1C 2DDAA 1ZGWA 2AQEA 1S29A 4DNCA 2DO7A 2KKOA 2AXLA 3OYJA 3MKYB 1YOVB 3AG1H 3S8PA 3CUQB 4C2TA 3RYRA 5F6FA 1JTYA 2V26A 1Z7UA 3A01B 1IN5A 2QQBA 2K9MA 5FKLA 2EFOA 3UR3C 4C3HJ 2RN7A 1VI0A 1UG2A 2N8GA 1MZBA 1G3SA 3BJ6A 4M6YA 3V7CA 4LK0F 4CXFA 2KFDA 3WGIA 1ETXA 1WFXA 2OU2A 2OTLI 2RVCA 5E8IA 1SAUA 3MZYA 1SVMA 5FKKA 1KU2A 1V4RA 2K3FA 3VB2A 4XOTA 1A35A 5DM6F 1S6LA 4BXXJ 2V1UA 1OCZH 2Y69H 3DCFA 4UB8C 3DEEA 2LKPA 4HDVA 3DTIA 3K10A 1ZGJA 2DT6A 3IH4A 3OOUA 4U0WA 3PM1A 4A6DA 3EQLF 1WZ2A 1YQAA 4TV7A 3K1NA 4LG0A 1J9IA 5LHIA 1JHFA 4BXUA 3GTLJ 2MD5A 3RTRA 3OYKA 5ERIA 1VFCA 4XICA 2K4BA 5J3LA 4A0YA 3RZOJ 5LFAA 1TTYA 5LGUA 2PLYA 2VASA 5TISC 4KIFA 1UHMA 2K9QA 1N25A 2BY1A 4DYRA 3IRRA 3E6BA 1P4WA 3KPHA 3VEPA 2VT2A 3WE3A 2EZIA 3WTWC 3MAJA 1BN5A 2CQQA 1JUPA 2DI3A 4M3GA 2DU9A 2NYXA 5FFXA 1C0WA 2WBMA 3FK7A 1WQ2A 4C2UA 1ULYA 1EF4A 2VQGA 3CTAA 4PUSA 1WRJA 2L7KA 1FY7A 1PUFA 4P9FA 1SFXA 4UV8A 3HBLA 4G6DA 4KN7X 3BG3A 2M45A 3P5JA 3HYIA 3JAMK 4BGDA 5KAFC 4ETSA 4GYGA 3PNVA 1OKRA 1I1GA 4UVAA 3TOBA 5KHDA 1KQ0A 1QPIA 4LLGF 1I1SA 4AVZA 1SFKA 2Q8KA 1N77A 1F43A 2A05A 3QPHA 4XKWA 4BEHA 2IS6A 3FWEA 2HDWA 2M7AA 4C30A 1JKRC 5JR3A 2BY0A 4S04A 3SDBA 2OJED 2BOLA 2CYYA 3BTIA 3H9GA 1ITYA 3HC7A 4HDUA 3I58A 4KIGA 4Y17A 2BW3A 2F5FA 3ISPA 1CF7A 1B72B 4Q47A 1FPQA 1X3WB 3SZPA 3LSIA 3Q5FA 1YIOA 3WHBA 2IA1A 2V9PA 3L2UA 5J8FA 2LVSA 2DTRA 3S2WA 1S3JA 3J7YJ 2VPLA 2CUJA 3BR2A 1GV2A 3WG7H 2VJ5A 3F6OA 3F72A 3GF2A 4IEJA 1AKHB 2EFNA 2O03A 5CVUA 3CCYA 4CYCB 1JUMA 1UHWA 4M3DA 1RRJA 1V54H 3LSTA 2QZ8A 3HRMA 1VQ5I 2LK2A 5FKNA 2QLZA 5D4SA 3ZQQA 4OMZA 1FT9A 4L9VA 1BI3A 5EYRA 2H6CA 3K4CA 2Y0SA 2IS1A 1Y8RB 2KT0A 2D2WA 5D8LB 2OZ6A 1IJWC 3WU0A 2JN6A 4HPQA 3OYDA 2ESHA 3L2VA 1MNDA 2VJIA 2VC1A 1EH8A 3ZOBA 2X48A 2GLOA 4RGUA 3GEZA 4Y13A 2Y31A 3K6GA 1H89C 1P4AA 1AWCA 5FRMA 1D1CA 4OAZA 3DKYA 2WV1A 4XOPA 2XAUA 4L5EA 1R9TJ 1R5GA 4HAMA 2O3FA 5IT9Z 4Z2YA 1XGMA 2ZXWH 2UUZA 3OIPA 4HEA2 3K4KA 5BQTA 2GOMA 2D1HA 2M0CA 1V5EA 4MIMA 4KYWA 5D6FA 3V8KA 3F22A 4CDGA 1NK2P 1LFPA 1E3PA 3AG2H 1HQCA 3OWTA 1H9TA 2DA2A 2FE3A 3GTGJ 1U5TB 5J1RA 3OYGA 3IKTA 1WGXA 3W6VA 1WJFA 3GFLA 4NBQA 5DD4A 4XSXF 2K9LA 3KP6A 5GADJ 2RREA 3E97A 5DD8A 3LA3A 1SFEA 2CUEA 3M7GA 4NUBA 2GQQA 4DW6A 4HF1A 2OBPA 3JR9A 4ON0A 3QPTA 2XASA 2E7WA 3F21A 3SHFA 2XF6A 2VBXA 1BA5A 4F3QA 3L2RA 4NDLA 2DJNA 3PIOF 5DUIA 3GFJA 2ZNYA 4G94A 3QPLA 1HDDC 1XG1A 1XSVA 1FBUA 1BIAA 3G71I 2VQCA 1WH7A 3OYCA 3HRTA 3KCCA 4F91B 4WK8F 4ABZA 2ISYA 2TDXA 2GM4A 1SD5A 1ZAOA 3CMYA 3FHNA 1R22A 2XV4S 3ONQA 4LIUA 2JUCA 2HPIA 2MYSA 2EFWA 2FQ3A 1QHHD 1R1VA 3C3WA 4GYIA 2LMDA 1FOKA 3H3UA 3F8CA 1K83J 2JJ7A 3O2PE 3KYCB 2EB7A 2LDUA 1XMKA 2R7WA 4RGXA 3J7AO 3HZJA 1UMQA 1ZGAA 2IT0A 2KZVA 4IF4A 3CMEI 1R5HA 2JPBA 5CVIA 4UY8I 2HOEA 4WCGA 1Z1DA 1V5FA 2QQ8A 5IYCJ 3OYFA 4DZJA 3S1RJ 3WTSC 1YFHA 1NK3P 1MBJA 1B9NA 1BM9A 3R60A 3JTHA 1ENHA 1TQIA 2P7CB 2ZJ2A 4CH7A 5GAGJ 4F7ZA 4BU2A 2K40A 1MH4A 4L9NA 4A3DJ 3DTEA 4EJVA 4BQQA 4OIQF 2KJCA 5DV5A 2MFZA 1FSEA 2ZFUA 4KN4X 3HOSA 2DFEA 3W6KB 1D1BA 3PSIA 3WTTC 4QSHA 5JFRA 1QBJA 4MEXF 3TO6A 2E1NA 4BUPA 3I0TA 4FE4A 3LSHA 4K2EA 2PQ8A 3T5XA 4XMYA 1HKTA 2LBFB 1KGSA 2IEKA 3LSKA 5C3EJ 2ELHA 2L9SA 1KYZA 3FM3A 3CD6I 3JSOA 1SAXA 2B9SA 2RC4A 2HU9A 1D1AA 2KHMA 3LSJA 1Z77A 3HM5A 1X4PA 1Z05A 2CRGA 4NC8A 3FXQA 2NVXJ 2CJJA 1F4KA 4XLCA 1R23A 3Q0WA 4CYDA 3F8NA 1SVLA 2K7LA 1S72I 2L7MP 3I71A 3IAS2 3P7NA 4LB6B 1DUXC 5HLHA 4M9SA 4IX7A 3VYTB 4CCJA 2VXZA 3OSGA 4HBLA 2E71A 4DOZA 4C3IJ 2XRLA 4OIRF 2M8GX 1DQUA 3F8FA 1RUOA 4LGWA 3LNQA 4A69C 4M9ZA 4KA4A 1BI1A 1T33A 1U9NA 1HBXG 2KDOA 4EM2A 1YIJI 1X58A 1O3RA 5LEKA 1XDSA 3I4PA 2B0LA 3WE2A 1IXRC 4B8XA 5FD5A 5EGOA 4I98B 4ZH4F 5J6XA 2DMQA 3WU2C 2M7BA 3CC2I 1WJ5A 2VJJA 2HXIA 5E1WA 2LREA 4PJJA 1GT0C 2ICWG 2DK8A 3OYMA 4E70A 1OCOH 2HDCA 3DWLE 2R5YB 2VC0A 2XHKA 4ZYHA 5BMZA 1D5YA 2V7FA 2E35A 4UVBA 5CLSA 1POGA 3H9JA 5KK1A 4Y33A 1Z3YA 2BEOA 2PFBA 2Y9YA 3PNYA 5JI6A 3RZDJ 3MZ8A 1Z6TA 1D0YA 3AG3H 2IAIA 1BW6A 1O57A 2JK3A 2R5YA 3RKQA 1A31A 2STTA 1YS7A 2JZYA 3KP4A 3G6EI 2R7UA 1X1CA 5K7HA 2H8WA 2K86A 2OCEA 1Z21A 2WAQN 3BR6A 2JSPA 3AL0C 3OS1A 2PBIA 1ZG5A 5LEJA 3ZQHA 2DT5A 2R7XA 2WAEA 4X6AJ 3JTGA 4IXAA 4EJUA 1U9OA 2LFBA 1U3EM 1UG0A 3HB9A 5B1BH 2EV0A 3MMYB 1ZTRA 2FNAA 3OYBA 3FXJA 1O3QA 5IP9J 2R5ZA 4V19K 1OJLA 3W6JB 4YIFA 4NC7A 2MG4A 5BPIA 2WAQA 3D1NI 2EWNA 3OIQA 5E79C 3TKYA 4ZDPA 2L01A 1TZLA 3ABKH 2LY9A 2NS8A 4BE1A 4CCLA 1T98A 4ESFA 3FIWA 4YIIA 1NG6A 1KU9A 3JREA 2VT3A 3T8TA 1Y1WJ 1QZZA 2PMZN 3OL3A 2JQ7A 3LFKA 4MQ9F 2E7XA 4GCVA 1R6RA 2ECBA 2NVUB 1FMWA 4RLFA 4C2MJ 3LSPA 4IHYA 4HNUA 2MABA 2X1CA 1S8NA 2W48A 4XLHA 1GLNA 3A02A 3CCSI 5F0CA 2YUSA 3N97A 3A0BC 3GYHX 1FIPA 2QBYA 4NNJA 3B6CA 2GBYA 5J8CA 2IJLA 2ZBKA 1MMDA 2UXNA 3SYTA 2NNYA 2UV1A 3G2BA 1J2XA 2XB5A 3S17J 1JE8A 1G2HA 1KU3A 5K5QA 4ZTJA 3E0JB 2DFFA 5ICEA 2KIMA 1RR8C 3L2WA 2ETHA 1VTNC 2NVTJ 2DA7A 2QUFA 3PFYA 4IRIA 2JA7J 5BPDA 1B8IA 1DPUA 3ZQLA 1IDZA 4OIPF 4DGWB 3F23A 1WJCA 3KX2A 1D0XA 2XGCA 3S32A 2LKXA 3HOUJ 4NC6A 5M3MJ 4XSZF 2LF7A 1ETKA 3CMMA 4Y15A 2HZDA 2L5QA 5M5WJ 4J19A 3CO7C 1XPXA 1IAWA 2P4WA 2CUZA 3OYAA 1TW3A 1LJ9A 5FO5A 1KONA 2ZC2A 3P9KA 4AIDA 2BW3B 2EFPA 4I0AA 1MJBA 1S7OA 3E5QA 4XKCA 2Q2EB 2XVCA 3ZMDA 1BR2A 4A5MA 5K7FA 2HR3A 1FC3A 3D0SA 2XGDA 4XNFA 4CO8A 4MFDA 2DA4A 3RSNA 1A5JA 3ABTA 2DPDA 2R0QC 5AONA 3J7ZI 2HVSA 2CG4A 4XKVA 2GA1A 3J81K 2CU7A 5HVQC 2G0EA 1H9GA 2BHZA 3K4LA 3HSFA 1FX7A 1YO5C 4ENNA 5H2FC 5EEGA 5D4RA 1T0FC 3FX3A 1X3ZB 2WWYA 1XTAA 1MNMC 2QF7A 4A93J 3BR3A 2FEZA 1XGSA 3FZVA 3IP4B 2M34A 4LFUA 1DP3A 2XB0X 3R4KA 1ZLJA 1E0EA 4ENJA 1LUJB 3FM5A 2RGVA 3VOEA 2CGPA 3F0CA 3I55I 1QZEA 1Z3XA 2A3SA 3KP3A 2XRNA 4OU0A 5JVGF 2VE8A 1E3OC 1G3WA 5EJCA 2QKLB 2V1XA 5D5XB 4RB3C 4P55A 4JX6A 4BBRJ 3TDUC 1K78B 1WH5A 1I3QJ 5LRRA 4EMSA 4O3MA 1RI7A 3H1CA 3H3VK 2ZB9A 2DPUA 4XM3A 4UUVA 4A3KJ 2FOKA 4FISA 3DU6A 3CC4I 1R49A 4LMYA 1IUYA 1MSFC 4DBRA 5B66C 1SC7A 2DBBA 1QGPA 1IRGA 4E4HA 5F0HA 2O6GE 3HUGA 2GXGA 4HV6A 2ACJA 2CWEA 1Y0UA 2HOTA 2A61A 3DPLC 3P9IA 3OY9A 4AD9A 3OYLA 3PO3J 1B6AA 1IRFA 1MMNA 1JT6A 4EQQA 1YW7A 1OCRH 3BCBA 1ZELA 4ESBA 2Y75A 2P0WA 2Z33A 2IRFG 1T8IA 1AOYA 1D8JA 2OUMA 4IOAF 2BE5F 1MBHA 3BG5A 2E5NA 2V4JC 1U5TC 4U7DA 3ZCOA 5KAIC 2OQRA 4RGSA 1D3YA 4XRSA 3G4SI 4LB5A 3S2HJ 3V4GA 4RDUA 3CCUI 2K02A 1Z91A 2E19A 3KEOA 4I02A 3WU1B 2A68F 1MDMA 1QQIA 2I5UA 4YELA 4BE0A 2IA2A 3ZP5A 4HOBA 2EA4A 1ODDA 3CP2A 3HOXJ 1OCTC 1N75A 2FBHA 2CQNA 5FKMA 4D7NA 5EEAA 1MDMB 2M2EA 3WTVC 4KIBA 4PFPA 2FXAA 5HLGA 4HYEA 3HOVJ 4J01A 1TQPA 3IKVA 5IYBJ 2WY8Q 4BE2A 2DA5A 2VI6A 2LLKA 2WB1A 2COMA 3ZMZA 3ZQ7A 1VQLI 1HC8A 3HTUA 2EZLA 4DYCA 3MWMA 3KEYA 3JAMZ 3LSRA 1KYWA 1RNLA 1OFCX 2F4IA 3BC8A 4G7HF 2DQRA 3S3OA 2KIQA 3DU5A 2UXXA 1HOMA 2BVMA 2HPMA 1EV7A 4QPQA 4ZTFA 2E2HJ 5FLVA 3HSRA 4IKFA 3PQKA 1TBXA 1MKMA 1K79A 3C2GA 4M6XA 1H0MA 1KZHA 3CCVI 3ML6A 4PJNA 3S14J 3HUGB 2HTJA 3HIFA 4KMUX 4PK4A 3EUHC 5F08A 3H5AA 5IYDJ 2BYVE 1DDNA 2M30A 4RAZA 4HX4A 1MGTA 2LKSA 4BH9A 3H36A 4BJ5C 4E6KG 1PP7U 1MJAA 1R4MB 2JA8J 1W7PD 3DF8A 1HA8A 2QEXI 2AXTC 1WJBA 4ENMA 4FX0A 2P6SA 1XMAA 2KMUA 1W1WE 2X1DA 3ECOA 4MQVA 1U8BA 5DTDA 2X6XA 2V9VA 4XLAA 1TNTA 4A2UA 2BZTA 2O0YA 2JPCA 3GVAA 3C2HA 3FDYA 4CZZA 3GLXA 2Z16A 3E5UA 2QM3A 4CCOA 3RI4A 5TJJA 4ZJZA 2CV1A 4A3GJ 2EZHA 4RMNA 3KP2A 5DYMA 2KJBA 5KNLA 3WGHA 3LWFA 3MKWB 3F9KA 3BJAA 1IN7A 2ZKZA 1U0JA 2L7ZA 5DCMB 2G7UA 2EBIA 5IP7J 4BHBA 4XL9A 3BG6A 2DAOA 3DEUA 2HS5A 3FF5A 1R36A 4CZCA 2FUG2 1YX3A 5TRDA 4YEJA 1PUFB 1R1TA 3FKIJ 3NAUA 1ZHFA 3HL2A 2IGMA 3HRSA 1JHHA 4PSXA 3MFKA 4P5OA 2ID6A 2PMUA 2HEOA 3DPUA 1YS6A 3OR2C 2A07F 3GUDA 3L2CA 3FBNB 1KQ8A 1LVKA 4BQNA 2FX0A 4LLLA 1O4XA 2R7SA 1LEBA 2F5EA 1OMIA 1IRZA 1W0UA 3MEXA 3OIOA 5J1YA 1FJLA 3L1PA 2W00A 4EGZA 2VQHA 5CQEA 4CCNA 2LYCA 4AYBN 4A3IJ 3ZMVA 1TNSA 4ZYGA 1OISA 2YS9A 4A0ZA 3PL8A 3SZGA 3SDGA 1T08B 1BR1A 2H6BA 2KDZA 3CF5F 3S3NA 1H88C 1L0OC 3ASNH 4JOMA 4XLEA 1V5GA 5CKTA 2MC3A 5E3MA 2QVOA 1OLTA 1G3YA 3Q0VA 1IN8A 1NH3A 5E17F 3DPTA 1FNNA 2E34A 2W82A 1ONVA 3BT9A 3ZN1A 4L0YB 2EK5A 2O61A 2L7FP 3EYYA 3GLLA 4PGHA 3BR0A 4BDYA 4A3FJ 4I01A 1ZRDA 5M3FJ 3ABMH 5CVJA 1XGNA 4FETA 3GTPJ 1CQTA 4BBSJ 1Y39A 4Q4ZF 2HFHA 2L9RA 3BJOA 3CJNA 4ZYAA 3R0AA 2M4GA 1MMSA 1HW1A 4IQ4A 1T6SA 3V7SA 4Q5SF 4A12A 2EILH 4HSTA 4BY7J 3CUQA 3TL4X 2XDVA 4ZZLA 4EV0A 5FB2A 1VQNI 3S15J 1Z9CA 1WVRA 3SXYA 3ECHA 3VSKA 2QBYB 5FKOA 5LBQA 1VQ7I 1A36A 5FLXK 5M5YJ 1P9QC 1W36D 1QO0D 3HKZN 1HLVA 3SEZA 2MC4A 3X2QH 4AIKA 2K9SA 2Z9OA 4BQOA 3ABUA 2WADA 1RETA 4G6QA 2VUMJ 1JKOC 2HWVA 2DOFA 4HF0A 4OMYA 2NNNA 4A3BJ 2DLLA 2K4JA 3O8GA 1E3HA 3SJMA 3ERED 2FQ4A 3P9CA 4OWRB 1Z6RA 2EIMH 3H9QA 4L9TA 2V9KA 3IL2A 2H8RA 2UWMA 1MNEA 2BV6A 2GZWA 2QQ9A 4U0VA 2E1OA 4Y4RA 2HDDA 2LRDA 3QYBA 5F64A 3RJPA 4DIQA 1HF0A 1BC8C 4DYQA 2YR2A 4AC0A 4LJZF 3GTJJ 3H0DA 4BNCA 3TDZC 2VN2A 1APLC 1TC3C 4Z6YA 1GXQA 3I5UA 3TQNA 3PIPF 1B72A 5A2QZ 2LOOA 2H09A 3EDPA 2PI0A 3LA2A 3O8HA 4NB5A 2J5PA 2XIGA 2X0LA 1VQ8I 4CICA 1N78A 4FASD 3I4NJ 3K7AJ 1YW9A 2A6EF 2F5CA 3K9TA 2WY7Q 2NOGA 1LE8B 1A6QA 1X4OA 3CLOA 1LDDA 2PJRB 1U8RA 3ASOH 3BTJA 4M73A 2R4GA 1L3LA 4QLCU 4PJLA 3IAM2 3ZMUA 2H94A 5CVVA 2XAHA 2R7FA 1YHQI 2VPRA 2YU3A 3H3ZA 4BACA 2O5RA 3MCZA 2CFXA 4JK1X 5HS9A 5BS6A 3C18A 1XB4A 1LPQA 2ZJPF 4Y52J 1IRXA 2JA2A 5CVRA 4UXNA 2GIVA 3HOTA 2L54A 2X51A 2MBFA 4AUXA 1Z67A 3OYIA 2DMTA 2IA0A 3PFIA 4KISA 5LGTA 5M5XJ 3A1YA 3G1MA 2X85A 4CYCA 2Y30A 2P5VA 1AU7A 2XF7A 1REPC 1KQ9A 3IWZA 5B5EC 4DQ2A 2X1EA 3N05A 2KZGA 3QODA 2CV2A 3IH3A 3JRDA 2ZCWA 1XS9A 4M6VA 1ORKA 4M71A 3FXLA 3BWGA 2NS0A 3LAJA 3S1MJ 2GWRA 5BOXA 5D5WB 2A6HF 1O7FA 4PCQA 3E1SA 4XK4A 3VDXA 4FT8A 1SMYF 1W5CC 3HOZJ 3LL7A 5JVTA 2CH0A 4OOIA 4OAYA 3ZQFA 3MVPA 2R3SA 2XUBA 4W1UA 2I10A 3BR1A 5HODA 3HOYJ 3M1EA 3I59A 4ENKA 2E2JJ 1I6HJ 3I3LA 2LC2A 4XQFA 1RIOH 3FXUA 1P6RA 1WWXA 2DW4A 3DQVC 5FGMA 1JGSA 2V6CA 1JXSA 4A5NA 2IGNA 3Q9VA 3J81Z 5H6RA 3GBGA 4IHTA 2P5KA 3LSMA 2WV0A 4B3AA 1LDJA 2A69F 1YLFA 1JI8A 1UAAA 1IUFA 2PN6A 2K3PA 5C4JJ 3H92A 4O5VA 2RQQA 3DXJF 4B09A 1R7JA 3V42A 1G59A 1IGNA 3HOWJ 3S16J 1YG2A 3E6MA 4V2GA 1MD0A 4BY1J 4LD5A 3QP6A 1J09A 4II3A 2VB6A 2ZSHB 5L3GA 3F6VA 3BZCA 2LH9A 3ZMSA 4JBAA 1P7JA 4I6ZA 3CCMI 5FROA 3BPXA 3NWTA 3A2KA 4E7LA 2NXNB 5HNHA 2MD0A 2WTEA 3CJTB 2Z1DA 4GRIA 5J1UA 3CJQB 1TWGJ 1W5SA 2ID3A 2LG4A 2X4HA 4B43A 5K5OA 1SFUA 1BC7C 1VQ4I 2QYOA 1R00A 2QKMB 3DKWA 3BTCA 1J5YA 1FTTA 3V8JA 2HKOA 3FMQA 4XBFA 4BL0B 3JRBA 3DTKA 3HKZA 1YRNA 3J80Z 2E36A 5HDNA 4G12A 3HDDA 3I64A 3PUFA 1Y56A 3BZKA 4M3EA 4CA0A 3GZNB 3W3CA 1Y0NA 4F93B 3UKGA 1T2KA 1ETWA 5CQGA 1ZR4A 4U88A 1FLIA 1TWFJ 3E5XA 1X2MA 2MGQA 3A0HC 4EEFG 1VQOI 1WJAA 2NAZA 2O8KA 1U6GA 2AO9A 2ELKA 4EJOA 3BZ6A 1OQYA 5C4XJ 4XORA 2QENA 1ETQA 1X1BA 4ITVA 1SD4A 4Q48A 2Z3YA 2CQKA 3B02A 2J5OA 4GO1A 3DV8A 2ZNZA 2O7OA 1XN7A 1B59A 1BI0A 2ESNA 1JJ8C 2QWWA 4I0BA 2Q2EA 2X6WA 4B47A 4YG2F 2R7ZJ 1Q1VA 2ELJA 2EA2A 1QU3A 3K1PA 3OSFA 1BOAA 1FOXA 3HPGA 3PQJA 2KL4A 2K85A 4ANJA 1WI3A 4X0GA 2E5ZA 3A03A 2OD5A 2KRHA 2I8DA 3W2VA 3LOCA 2IPQX 2M9HA 4F92B 4KUMA 1LE8A 4HA8A 1TT5B 2HXOA 3L9FA 1K6OA 2DK5A 5ILSA 2MA3A 1J59A 2MSYA 2X9DA 4HZFA 4IVNA 3KZYA 2IVMA 2F5DA 1OYIA 5H20A 1W0TA 4HG2A 1MJ9A 3H5RA 4R79A 4QTRA 4N0BA 2Y9ZA 2H1LA 2KRFA 2ZJQF 2PJRA 4B48A 2FMYA 2KP6A 1STZA 2EFQA 1HKQA 5EGOB 2XAFA 3HGYA 3RYPA 3RIRA 3OYNA 4FCYA 3LMMA 2XF5A 2JRMA 3VODA 4P96A 2XSJC 4UNOA 3JW4A 3RPUA 4ESJA 1YJNI 2HZTA 3FBIB 4M3BA 4RM3A 4IPAA 3UNGC 1IV6A 2MLKA 2DCEA 1W7PA 3FXKA 2HQRA 2BBYA 1K61A 3VPRA 1ON1A 1TQMA 2KLOA 5HLIA 2B63J 3QOEA 1GHCA 4I09A 1ZQ3P 2WB1N 1ZN2A 3LQRA 3GTMJ 1JT0A 2FBKA 1YI2I 1QVTA 4O6JA 2B7EA 2JRTA 4FE7A 3TW6A 2L9NA 2WA0A 3IH2A 5HS8A 4S05A 1XCBA 1XSDA 1EA3A 1G8XA 3RKYA 2CV0A 4MO7A 4CHUA 2DTZA 5FJ8J 3MN2A 4LG3A 5E3NA 4RB1A 2VJ4A 1TWHJ 4L5IA 3G73A 4HSRA 3CO6C 2VKEA 2Y0MA 1W36C 4V2FA 1UELB 2DFIA 3SFZA 1LQ1A 1FZPB 3OS2A 4XRMA 3K70C 1RC9A 1FMVA 1DP7P 1B1BA 1QA6A 1QHGA 1X19A 3FISA 3TOAA 2NRAC 1LFUP 1LFBA 1OR7A 2O8XA 3C7JA 4KMFA 1FP2A 1FYLA 2BXYA 3BG7A 1BW5A 3DLLF 1ZG1A 2JUGA 4XKBA 2RQPA 4IL6C 4CGZA 2IP2A 1ZLKA 2V1NA 2KIFA 2R7QA 4ZDOA 5DEQA 4B4CA 5J4VA 4L18B 4QIWN 2RKHA 3Q0UA 4AVPA 3CMAI 5HNFA 2L9VA 1XX5A 4IHXA 2F5VA 3K2ZA 2HOAA 4AIHA 1HW5A 2W85A 3ESWB 1R71A 1VQPI 4HQMA 4I7HA 3KLNA 2YU9J 1MSEC 3BPVA 1BL0A 5FFZA 1Q1HA 3ERMA 3NWSA 3NEUA 2XAJA 1B4AA 2IGOA 4FTHA 2V6EA 1VQMI 5F0FA 5D5UB 4MEYF 1F36A 2W84A 1K4SA 4RAFA 2OV7A 2XKOA 3DFGA 2K5CA 5L3DA 5CPRB 3GTQJ 3C2BA 5L3FA 5GTIC 3FXMA 3QWLA 2CQXA 1CGPA 1BIBA 2A6TA 2IXSA 4B1RA 2DMPA 1ZK8A 2DYRH 1DGRM 1IO2A 4BKXA 1HCRA 3WTXC 1TP4A 1WPKA 4P1WA 1NG7A 1WSUA 5F04A 3BROA 3BCAA 5EZGA 5F27A 1U78A 1FBQA 4CSWA 1RESA 4D7MA 2A5YB 3ZR8X 3HPHA 1XMXA 1IXCA 3PSFA 1IN6A 1R4NB 3CESA 3QU3A 3CCQI 1OR7C 4HX8A 1R58A 4JX4A 1ZRCA 2LBFA 2ZSIB 3SZTA 3BQYA 5L3EA 2GIZA
chains in the Genus database with same CATH topology
2H27A 4HLYA 1XGOA 4RAYA 3BDDA 2EV6A 4L0ZB 3O6BB 4RB2C 3R0JA 3IHUA 4RS8A 3R6SA 1W5TA 4KDPA 4ASNA 2RV8A 4MTEA 3NQOA 3RKWA 3WTZA 1USTA 4NQWA 2PEXA 1HKSA 2Y48A 5ED4A 2Q0OA 3L7WA 4UHTA 2VBYA 3HHHA 1XCVA 1FBSA 1F1ZA 5L3CA 1T0FA 5LLQA 1O3SA 1P4XA 4M72A 3V8LA 3T0YA 5DUKA 1UB9A 3O3KA 1YW8A 2HGCA 4G8XA 2YSRA 4XRFA 2P7VB 5DCFA 1PDNC 2P6TA 2PMHA 2XAQA 1V3FA 4EJWA 1DPRA 2XKPA 1YYVA 5ILVA 3F3XA 2CO5A 3NRVA 3ELKA 3LQQA 3WODF 1J75A 4FHTA 2OZUA 4HLXA 5FLXZ 1B9MA 2M5WA 3C1DA 3CUQC 3GZ6A 5AIPA 2C6YA 2ZMEA 5LGNA 2FMLA 4M74A 2VBWA 3D5LA 3KLOA 4N9IA 3B73A 5K1YA 4HF2A 3K0LA 2L4AA 4U7BA 1OYWA 3M8EA 1LVAA 1NHAA 1QZYA 4UV9A 1HSJA 4IRHA 2ZO4A 4U0YA 1EH6A 3GFMA 2OA4A 1UCRA 1IW7F 2FU4A 3BP8A 3T1BA 4JQFA 4PZJA 2V79A 4HV5A 3ULQB 4XLPF 4D0PA 2HKXA 2V1DA 5LHGA 3J80K 2OAZA 2ISZA 5IT3A 5F1RA 2UZKA 4WF2A 4LG0B 2F2EA 4FX4A 2M8EA 1OYYA 1LEAA 4HW0A 4WWCA 4WXHA 2YX4A 3KE2A 3G3ZA 1D5VA 1G4DA 1SMTA 3U9GA 4R1HA 4HX7A 3KP7A 3BY6A 1HSTA 3E6CC 4KT5C 2CSOA 4KFCA 3CDHA 2L02A 4LK1F 1W4MA 3E6DA 5AIQA 1KU7A 1IZ1A 1ZG3A 3GW2A 3TO7A 2KIUA 4EVIA 2QQAA 4EM0B 3RPQA 3KZZA 2ZXJA 2E1CA 2D1VA 3L00A 3REOA 4NHJA 1XD7A 3VFZA 1FYKA 1KA8A 5E1XA 1LDKB 2K27A 5HOOA 3GX4X 3K69A 2LNBA 3EUHA 5DCMA 4BHCA 2YX7A 1ON2A 2FF4A 5KVRA 1USSA 2XROA 2W57A 3RKXA 2VBZA 3TGNA 1T38A 3MQ0A 3U1DA 4IHSA 1T39A 1ZARA 2MH2A 5ILUA 3T8RA 2WC2A 2R7DA 1FP1D 1EH7A 2VODA 1W7PB 1FSHA 3IC7A 2HYGD 2Z99A 4XLNF 1S7AA 3V7RA 1O7LA 2FA5A 4L5JA 3E3VA 3R61A 2VE9A 2PG4A 4YFNF 1FYMA 2YPRA 2Z5UA 2ADUA 1A04A 4MTDA 4AWXB 3DP7A 1U2WA 4OIOF 2DQLA 2JT1A 2ZMEB 4KICA 3GZ5A 1E2XA 3WTUC 5D6EA 2HTSA 4EJTA 3MZHA 2JTVA 5IT9K 2P8TA 2EV5A 1ZREA 5K5RA 1IXSB 4PGGA 3HRUA 1J0RA 1G3TA 2P5LC 5HDGA 3QP5A 4KNYA 1E17A 3KP5A 5E1ZB 4QWQA 4MGRA 4H0EA 1I6XA 3AAFA 5D5VB 1IF1A 5HS7A 3ZMTA 4BHPA 3COAC 4PDKA 1IN4A 4IRGA 4A0XA 1FWZA 3WG9A 4UVCA 1O3TA 1PUEE 3GFIA 2GAUA 5DDGA 4M9XA 3FHZA 5A2QK 1CF7B 2JSCA 4MNUA 4BQAA 2STWA 4RGRA 2W24A 5ICCA 4GGGA 1XSXA 1SD6A 1UFMA 2G9WA 1K78A 2ZFWA 3ZPLA 1D8KA 4IJAA 5H6QA 3SQNA 4WXDA 4AIJA 2GXBA 2LF8A 1QPMA 2XGXA 1OPCA 2FRHA 4OINF 3QAHA 1RZ4A 1BBYA 3I59B 2FBIA 3GXOA 3KETA 3KEQA 4WXCA 2RNJA 2XAGA 1X3UA 3ZN0A 1G6NA 3FMRA 1XDUA 4I2OA 3QU6A 5E18F 3RDIA 5HDKA 4L9JA 3M9AA 1HW2A 5LHHA 1F9NA 3EYIA 4G7OF 1QNTA 3N4MA 2HYFA 5CJ9A 2W25A 2IW5A 5E8GA 3JSPA 1U5TA 2LSOA 2RDPA 5L3BA 3I54A 3KFWX 3HHGA 5D8KB 1PP8F 4EGYA 2OQGA 1LB2A 1R1UA 2FNPA 4A6EA 3Q9SA 4G9YA 2MLGA 3L09A 4EM1A 2VOOA 5E20A 4R8HA 2CW0F 2G7HA 1J7KA 2GA2A 2L3DA 2VOPA 2BGCA 1ZYRF 3LA7A 3F8MA 4BAYA 3GO5A 4LLNA 2L4MA 3EETA 4YFXF 5ICGA 1LNWA 3CUOA 6PAXA 3ROUA 5ICFA 3BOQA 1GVJA 1P2FA 3IWFA 1BI2A 1WI9A 5FD6A 3LAPA 3U2RA 4ZZDA 3M8FA 4HQEA 5JHUA 1K7AA 2PJPA 2FSWA 1WKMA 1I27A 4YFKF 1SD7A 2VONA 3K1MA 5LRSA 2AS5F 4ZYDA 4P9UA 2EJRA 2M1BA 1TW2A 3IRQA 4RB0A 1F5TA 1YTYA 3OV8A 3WTYC 3GWZA 1P92A 3QRFF 1RUNA 3F8BA 3I53A 1ZRFA 1BJAA 4N9HA 1HXDA 1TLHB 3HTSB 5EEHA 3OOPA 3FXRA 4BYYA 2HQNA 4WX9A 2M87A 4ZYEA 2MH9A 5CYVA 1GXPA 3FMSA 3TO9A 3HSEA 2D45A 1I5ZA 4GXOA 3QOPA 4G7ZF 4MHGA 3WGGA 1ZH5A 1S29A 4DNCA 2DO7A 2KKOA 2AXLA 3CUQB 3RYRA 5F6FA 1Z7UA 1IN5A 2QQBA 2EFOA 2RN7A 3BJ6A 1MZBA 1G3SA 4CXFA 4M6YA 3V7CA 4LK0F 3WGIA 2OU2A 2RVCA 5E8IA 3MZYA 1KU2A 1V4RA 3VB2A 1S6LA 2V1UA 2LKPA 4HDVA 1ZGJA 4U0WA 4A6DA 3EQLF 1YQAA 4TV7A 3K1NA 4LG0A 1J9IA 5LHIA 1JHFA 4BXUA 2MD5A 3RTRA 5ERIA 2K4BA 4A0YA 1TTYA 5LGUA 2PLYA 4KIFA 1UHMA 3IRRA 3E6BA 1P4WA 3VEPA 2VT2A 3WE3A 3WTWC 3MAJA 1BN5A 2DI3A 2DU9A 2NYXA 5FFXA 1C0WA 1WQ2A 1ULYA 3CTAA 1WRJA 1FY7A 4P9FA 1SFXA 4UV8A 4G6DA 4KN7X 2M45A 3HYIA 3JAMK 4ETSA 4GYGA 1OKRA 1I1GA 4UVAA 3TOBA 1KQ0A 4LLGF 1I1SA 2Q8KA 3QPHA 3FWEA 5JR3A 4S04A 2CYYA 4HDUA 3I58A 4KIGA 4Y17A 2F5FA 3ISPA 1CF7A 4Q47A 1FPQA 3SZPA 3Q5FA 1YIOA 2IA1A 5J8FA 2DTRA 3S2WA 1S3JA 3F6OA 3GF2A 3F72A 2EFNA 2O03A 5CVUA 1UHWA 3LSTA 2QZ8A 3HRMA 5D4SA 2QLZA 4OMZA 1FT9A 4L9VA 1BI3A 2H6CA 2D2WA 5D8LB 2OZ6A 3WU0A 2ESHA 2VC1A 1EH8A 4RGUA 3GEZA 4Y13A 1P4AA 1AWCA 1R5GA 4HAMA 2O3FA 5IT9Z 4Z2YA 1XGMA 5BQTA 2D1HA 4KYWA 5D6FA 3V8KA 3F22A 4CDGA 1HQCA 1H9TA 2FE3A 1U5TB 3IKTA 3GFLA 5DD4A 4XSXF 3KP6A 3E97A 5DD8A 3LA3A 1SFEA 3M7GA 2GQQA 4HF1A 2OBPA 4ON0A 3QPTA 2XASA 2E7WA 3F21A 3SHFA 2VBXA 5DUIA 3GFJA 2ZNYA 4G94A 1XSVA 1FBUA 1BIAA 3HRTA 3KCCA 4WK8F 2ISYA 2TDXA 1SD5A 1ZAOA 1R22A 2XV4S 2EFWA 2FQ3A 1R1VA 3C3WA 4GYIA 1FOKA 3F8CA 3H3UA 3O2PE 2EB7A 2LDUA 1XMKA 4RGXA 3J7AO 2IT0A 1ZGAA 4IF4A 1R5HA 2JPBA 5CVIA 2HOEA 4WCGA 1Z1DA 3WTSC 1YFHA 1B9NA 1BM9A 3R60A 3JTHA 1TQIA 2P7CB 2ZJ2A 4F7ZA 4L9NA 4EJVA 4OIQF 2KJCA 5DV5A 1FSEA 4KN4X 3HOSA 3W6KB 3WTTC 5JFRA 1QBJA 4MEXF 3TO6A 2E1NA 3I0TA 4K2EA 2PQ8A 3T5XA 1HKTA 1KGSA 2ELHA 1KYZA 3FM3A 3JSOA 1SAXA 2RC4A 1Z05A 3FXQA 1F4KA 1R23A 4CYDA 3F8NA 2K7LA 3I71A 3P7NA 4LB6B 1DUXC 5HLHA 4M9SA 2VXZA 4HBLA 4OIRF 3F8FA 1RUOA 4LGWA 4KA4A 4M9ZA 1BI1A 1HBXG 4EM2A 1O3RA 5LEKA 1XDSA 3I4PA 2B0LA 3WE2A 1IXRC 4B8XA 5FD5A 4I98B 4ZH4F 5J6XA 5E1WA 2DK8A 4E70A 2HDCA 2VC0A 2XHKA 4ZYHA 5BMZA 4UVBA 5CLSA 5KK1A 2BEOA 2PFBA 5JI6A 1Z6TA 1O57A 2STTA 1YS7A 2JZYA 3KP4A 2K86A 2PBIA 1ZG5A 5LEJA 2DT5A 3JTGA 4IXAA 4EJUA 1U3EM 2EV0A 2FNAA 1O3QA 3W6JB 4YIFA 5BPIA 2EWNA 3TKYA 2L01A 4ESFA 1T98A 4YIIA 1KU9A 2VT3A 3T8TA 1QZZA 3LFKA 4MQ9F 2E7XA 4GCVA 1S8NA 3N97A 3GYHX 2QBYA 5J8CA 2IJLA 2ZBKA 2UXNA 2NNYA 1J2XA 1JE8A 1KU3A 5K5QA 5ICEA 2KIMA 2ETHA 1VTNC 2QUFA 4IRIA 5BPDA 1DPUA 4OIPF 3F23A 4XSZF 2LF7A 4Y15A 3CO7C 1IAWA 2P4WA 1TW3A 1LJ9A 5FO5A 3P9KA 2EFPA 4I0AA 1MJBA 1S7OA 3E5QA 2XVCA 3ZMDA 4A5MA 2HR3A 1FC3A 3D0SA 4CO8A 3ABTA 2DPDA 5AONA 2CG4A 2GA1A 3J81K 5HVQC 1H9GA 3HSFA 1FX7A 1YO5C 4ENNA 5EEGA 5D4RA 3FX3A 2WWYA 2FEZA 1XGSA 3FZVA 4LFUA 3R4KA 1ZLJA 4ENJA 3FM5A 2RGVA 3VOEA 2CGPA 2A3SA 3KP3A 2XRNA 4OU0A 2VE8A 1G3WA 2V1XA 5D5XB 4RB3C 4P55A 1K78B 3TDUC 5LRRA 4EMSA 4O3MA 1RI7A 2DPUA 4UUVA 2FOKA 4LMYA 1IUYA 2DBBA 1QGPA 1IRGA 2O6GE 3HUGA 2GXGA 4HV6A 2ACJA 2CWEA 1Y0UA 2A61A 3DPLC 3P9IA 4AD9A 1B6AA 1IRFA 4EQQA 1YW7A 4ESBA 2Y75A 2Z33A 2IRFG 1AOYA 1D8JA 2BE5F 1U5TC 4U7DA 2OQRA 4RGSA 1D3YA 4LB5A 3V4GA 2K02A 1Z91A 3KEOA 4I02A 3WU1B 2A68F 1MDMA 1QQIA 2IA2A 3ZP5A 4HOBA 2EA4A 1ODDA 2FBHA 1MDMB 3WTVC 4KIBA 5HLGA 2FXAA 4HYEA 1TQPA 3IKVA 2COMA 3ZMZA 3ZQ7A 3HTUA 3MWMA 3JAMZ 1KYWA 1RNLA 4G7HF 2DQRA 2UXXA 1EV7A 3HSRA 3PQKA 1TBXA 1MKMA 1K79A 4M6XA 1H0MA 3ML6A 2HTJA 3HIFA 4KMUX 2BYVE 1DDNA 2M30A 4RAZA 4HX4A 1MGTA 4BH9A 1PP7U 1MJAA 1W7PD 3DF8A 4ENMA 4FX0A 2P6SA 1XMAA 3ECOA 4MQVA 2V9VA 1TNTA 4A2UA 2O0YA 2JPCA 3GVAA 4CZZA 3GLXA 3E5UA 2QM3A 3RI4A 5TJJA 3KP2A 5DYMA 2KJBA 3WGHA 3LWFA 3BJAA 1IN7A 2ZKZA 5DCMB 2G7UA 4BHBA 3DEUA 2DAOA 2HS5A 3FF5A 1R36A 5TRDA 1R1TA 1ZHFA 3HRSA 1JHHA 3MFKA 4P5OA 2HEOA 2PMUA 1YS6A 2A07F 3GUDA 3L2CA 1KQ8A 4LLLA 1LEBA 2F5EA 1OMIA 3MEXA 4EGZA 3ZMVA 1TNSA 4ZYGA 4A0ZA 2H6BA 1L0OC 2MC3A 2QVOA 1G3YA 1IN8A 5E17F 1FNNA 3DPTA 4L0YB 1ONVA 2EK5A 2O61A 3EYYA 4PGHA 1ZRDA 4I01A 5CVJA 1XGNA 4Q4ZF 2HFHA 3BJOA 3CJNA 3R0AA 1HW1A 1T6SA 3V7SA 4Q5SF 4A12A 3CUQA 4ZZLA 4EV0A 5FB2A 1Z9CA 3SXYA 3ECHA 2QBYB 5LBQA 5FLXK 1QO0D 4AIKA 2Z9OA 3ABUA 4G6QA 2HWVA 4HF0A 4OMYA 2NNNA 2DLLA 2K4JA 3ERED 3P9CA 1Z6RA 4L9TA 3IL2A 2UWMA 2BV6A 2GZWA 2QQ9A 4U0VA 5F64A 3RJPA 1BC8C 2YR2A 4LJZF 4BNCA 3TDZC 2VN2A 1GXQA 3I5UA 3TQNA 5A2QZ 2H09A 3EDPA 2PI0A 3LA2A 4NB5A 2J5PA 2XIGA 2X0LA 4CICA 1YW9A 2A6EF 2F5CA 3K9TA 3CLOA 1LDDA 1U8RA 4M73A 1L3LA 4QLCU 3ZMUA 2H94A 5CVVA 2XAHA 2R7FA 2YU3A 3H3ZA 3MCZA 2CFXA 4JK1X 5HS9A 5BS6A 3C18A 1XB4A 5CVRA 4UXNA 2GIVA 3HOTA 2L54A 2MBFA 2IA0A 3PFIA 5LGTA 2P5VA 1REPC 1KQ9A 3IWZA 4DQ2A 2ZCWA 4M71A 3BWGA 2NS0A 3LAJA 2GWRA 5BOXA 5D5WB 2A6HF 1O7FA 4PCQA 4FT8A 1SMYF 5JVTA 4OOIA 2R3SA 2XUBA 3M1EA 3I59A 4ENKA 1RIOH 1WWXA 1P6RA 2DW4A 3DQVC 3FXUA 5FGMA 1JGSA 2V6CA 1JXSA 4A5NA 3Q9VA 3J81Z 5H6RA 4IHTA 2P5KA 2WV0A 1LDJA 2A69F 1YLFA 2PN6A 3H92A 4O5VA 3DXJF 4B09A 1R7JA 1YG2A 3E6MA 1MD0A 4LD5A 3QP6A 5L3GA 3F6VA 3ZMSA 4JBAA 3BPXA 2WTEA 1W5SA 2X4HA 1BC7C 5K5OA 1SFUA 2QYOA 1R00A 3DKWA 1J5YA 3V8JA 2HKOA 3FMQA 4XBFA 3J80Z 5HDNA 3I64A 1T2KA 4U88A 1FLIA 3E5XA 2NAZA 1U6GA 4EJOA 3BZ6A 2QENA 1SD4A 4Q48A 2Z3YA 2CQKA 3B02A 2J5OA 4GO1A 3DV8A 2ZNZA 1XN7A 1B59A 1BI0A 2ESNA 2QWWA 4I0BA 2Q2EA 4YG2F 2EA2A 3K1PA 1BOAA 3PQJA 2OD5A 2IPQX 4KUMA 4HA8A 1K6OA 3L9FA 2DK5A 5ILSA 2MA3A 1J59A 4HZFA 4IVNA 3KZYA 2IVMA 2F5DA 1OYIA 5H20A 1MJ9A 4R79A 4N0BA 2KRFA 2FMYA 1STZA 2EFQA 1HKQA 2XAFA 3RYPA 3RIRA 3VODA 4P96A 4UNOA 3JW4A 3RPUA 4ESJA 2HZTA 4IPAA 2MLKA 1W7PA 2HQRA 2BBYA 1ON1A 1TQMA 5HLIA 1GHCA 4I09A 1ZN2A 3LQRA 2FBKA 4O6JA 2JRTA 5HS8A 4S05A 1XCBA 1XSDA 3RKYA 4CHUA 4RB1A 4L5IA 3G73A 3CO6C 2Y0MA 2DFIA 3SFZA 1LQ1A 1FZPB 1DP7P 1B1BA 3TOAA 2NRAC 1OR7A 2O8XA 3C7JA 4KMFA 1FP2A 1FYLA 1ZG1A 2RQPA 4CGZA 2IP2A 1ZLKA 2KIFA 5DEQA 4L18B 2RKHA 4AVPA 3K2ZA 4AIHA 1HW5A 2W85A 4HQMA 4I7HA 3KLNA 3BPVA 5FFZA 1Q1HA 3NEUA 2XAJA 1B4AA 5D5UB 4MEYF 2W84A 2XKOA 3DFGA 5L3DA 5L3FA 1CGPA 1BIBA 3WTXC 1WSUA 3BROA 1U78A 1FBQA 2A5YB 1IXCA 1IN6A 3QU3A 4HX8A 1ZRCA 1R58A 3SZTA 5L3EA 3ZN1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H27 A;  4HLY A;  1XGO A;  4RAY A;  3BDD A;  2EV6 A;  4L0Z B;  3O6B B;  4RB2 C;  3R0J A;  3IHU A;  4RS8 A;  3R6S A;  1W5T A;  4KDP A;  4ASN A;  2RV8 A;  4MTE A;  3NQO A;  3RKW A;  3WTZ A;  1UST A;  4NQW A;  2PEX A;  1HKS A;  2Y48 A;  5ED4 A;  2Q0O A;  3L7W A;  4UHT A;  2VBY A;  3HHH A;  1XCV A;  1FBS A;  1F1Z A;  5L3C A;  1T0F A;  5LLQ A;  1O3S A;  1P4X A;  4M72 A;  3V8L A;  3T0Y A;  5DUK A;  1UB9 A;  3O3K A;  1YW8 A;  2HGC A;  4G8X A;  2YSR A;  4XRF A;  2P7V B;  5DCF A;  1PDN C;  2P6T A;  2PMH A;  2XAQ A;  1V3F A;  4EJW A;  1DPR A;  2XKP A;  1YYV A;  5ILV A;  3F3X A;  2CO5 A;  3NRV A;  3ELK A;  3LQQ A;  3WOD F;  1J75 A;  4FHT A;  2OZU A;  4HLX A;  5FLX Z;  1B9M A;  2M5W A;  3C1D A;  3CUQ C;  3GZ6 A;  5AIP A;  2C6Y A;  2ZME A;  5LGN A;  2FML A;  4M74 A;  2VBW A;  3D5L A;  3KLO A;  4N9I A;  3B73 A;  5K1Y A;  4HF2 A;  3K0L A;  2L4A A;  4U7B A;  1OYW A;  3M8E A;  1LVA A;  1NHA A;  1QZY A;  4UV9 A;  1HSJ A;  4IRH A;  2ZO4 A;  4U0Y A;  1EH6 A;  3GFM A;  2OA4 A;  1UCR A;  1IW7 F;  2FU4 A;  3BP8 A;  3T1B A;  4JQF A;  4PZJ A;  2V79 A;  4HV5 A;  3ULQ B;  4XLP F;  4D0P A;  2HKX A;  2V1D A;  5LHG A;  3J80 K;  2OAZ A;  2ISZ A;  5IT3 A;  5F1R A;  2UZK A;  4WF2 A;  4LG0 B;  2F2E A;  4FX4 A;  2M8E A;  1OYY A;  1LEA A;  4HW0 A;  4WWC A;  4WXH A;  2YX4 A;  3KE2 A;  3G3Z A;  1D5V A;  1G4D A;  1SMT A;  3U9G A;  4R1H A;  4HX7 A;  3KP7 A;  3BY6 A;  1HST A;  3E6C C;  4KT5 C;  2CSO A;  4KFC A;  3CDH A;  2L02 A;  4LK1 F;  1W4M A;  3E6D A;  5AIQ A;  1KU7 A;  1IZ1 A;  1ZG3 A;  3GW2 A;  3TO7 A;  2KIU A;  4EVI A;  2QQA A;  4EM0 B;  3RPQ A;  3KZZ A;  2ZXJ A;  2E1C A;  2D1V A;  3L00 A;  3REO A;  4NHJ A;  1XD7 A;  3VFZ A;  1FYK A;  1KA8 A;  5E1X A;  1LDK B;  2K27 A;  5HOO A;  3GX4 X;  3K69 A;  2LNB A;  3EUH A;  5DCM A;  4BHC A;  2YX7 A;  1ON2 A;  2FF4 A;  5KVR A;  1USS A;  2XRO A;  2W57 A;  3RKX A;  2VBZ A;  3TGN A;  1T38 A;  3MQ0 A;  3U1D A;  4IHS A;  1T39 A;  1ZAR A;  2MH2 A;  5ILU A;  3T8R A;  2WC2 A;  2R7D A;  1FP1 D;  1EH7 A;  2VOD A;  1W7P B;  1FSH A;  3IC7 A;  2HYG D;  2Z99 A;  4XLN F;  1S7A A;  3V7R A;  1O7L A;  2FA5 A;  4L5J A;  3E3V A;  3R61 A;  2VE9 A;  2PG4 A;  4YFN F;  1FYM A;  2YPR A;  2Z5U A;  2ADU A;  1A04 A;  4MTD A;  4AWX B;  3DP7 A;  1U2W A;  4OIO F;  2DQL A;  2JT1 A;  2ZME B;  4KIC A;  3GZ5 A;  1E2X A;  3WTU C;  5D6E A;  2HTS A;  4EJT A;  3MZH A;  2JTV A;  5IT9 K;  2P8T A;  2EV5 A;  1ZRE A;  5K5R A;  1IXS B;  4PGG A;  3HRU A;  1J0R A;  1G3T A;  2P5L C;  5HDG A;  3QP5 A;  4KNY A;  1E17 A;  3KP5 A;  5E1Z B;  4QWQ A;  4MGR A;  4H0E A;  1I6X A;  3AAF A;  5D5V B;  1IF1 A;  5HS7 A;  3ZMT A;  4BHP A;  3COA C;  4PDK A;  1IN4 A;  4IRG A;  4A0X A;  1FWZ A;  3WG9 A;  4UVC A;  1O3T A;  1PUE E;  3GFI A;  2GAU A;  5DDG A;  4M9X A;  3FHZ A;  5A2Q K;  1CF7 B;  2JSC A;  4MNU A;  4BQA A;  2STW A;  4RGR A;  2W24 A;  5ICC A;  4GGG A;  1XSX A;  1SD6 A;  1UFM A;  2G9W A;  1K78 A;  2ZFW A;  3ZPL A;  1D8K A;  4IJA A;  5H6Q A;  3SQN A;  4WXD A;  4AIJ A;  2GXB A;  2LF8 A;  1QPM A;  2XGX A;  1OPC A;  2FRH A;  4OIN F;  3QAH A;  1RZ4 A;  1BBY A;  3I59 B;  2FBI A;  3GXO A;  3KET A;  3KEQ A;  4WXC A;  2RNJ A;  2XAG A;  1X3U A;  3ZN0 A;  1G6N A;  3FMR A;  1XDU A;  4I2O A;  3QU6 A;  5E18 F;  3RDI A;  5HDK A;  4L9J A;  3M9A A;  1HW2 A;  5LHH A;  1F9N A;  3EYI A;  4G7O F;  1QNT A;  3N4M A;  2HYF A;  5CJ9 A;  2W25 A;  2IW5 A;  5E8G A;  3JSP A;  1U5T A;  2LSO A;  2RDP A;  5L3B A;  3I54 A;  3KFW X;  3HHG A;  5D8K B;  1PP8 F;  4EGY A;  2OQG A;  1LB2 A;  1R1U A;  2FNP A;  4A6E A;  3Q9S A;  4G9Y A;  2MLG A;  3L09 A;  4EM1 A;  2VOO A;  5E20 A;  4R8H A;  2CW0 F;  2G7H A;  1J7K A;  2GA2 A;  2L3D A;  2VOP A;  2BGC A;  1ZYR F;  3LA7 A;  3F8M A;  4BAY A;  3GO5 A;  4LLN A;  2L4M A;  3EET A;  4YFX F;  5ICG A;  1LNW A;  3CUO A;  6PAX A;  3ROU A;  5ICF A;  3BOQ A;  1GVJ A;  1P2F A;  3IWF A;  1BI2 A;  1WI9 A;  5FD6 A;  3LAP A;  3U2R A;  4ZZD A;  3M8F A;  4HQE A;  5JHU A;  1K7A A;  2PJP A;  2FSW A;  1WKM A;  1I27 A;  4YFK F;  1SD7 A;  2VON A;  3K1M A;  5LRS A;  2AS5 F;  4ZYD A;  4P9U A;  2EJR A;  2M1B A;  1TW2 A;  3IRQ A;  4RB0 A;  1F5T A;  1YTY A;  3OV8 A;  3WTY C;  3GWZ A;  1P92 A;  3QRF F;  1RUN A;  3F8B A;  3I53 A;  1ZRF A;  1BJA A;  4N9H A;  1HXD A;  1TLH B;  3HTS B;  5EEH A;  3OOP A;  3FXR A;  4BYY A;  2HQN A;  4WX9 A;  2M87 A;  4ZYE A;  2MH9 A;  5CYV A;  1GXP A;  3FMS A;  3TO9 A;  3HSE A;  2D45 A;  1I5Z A;  4GXO A;  3QOP A;  4G7Z F;  4MHG A;  3WGG A;  1ZH5 A;  1S29 A;  4DNC A;  2DO7 A;  2KKO A;  2AXL A;  3CUQ B;  3RYR A;  5F6F A;  1Z7U A;  1IN5 A;  2QQB A;  2EFO A;  2RN7 A;  3BJ6 A;  1MZB A;  1G3S A;  4CXF A;  4M6Y A;  3V7C A;  4LK0 F;  3WGI A;  2OU2 A;  2RVC A;  5E8I A;  3MZY A;  1KU2 A;  1V4R A;  3VB2 A;  1S6L A;  2V1U A;  2LKP A;  4HDV A;  1ZGJ A;  4U0W A;  4A6D A;  3EQL F;  1YQA A;  4TV7 A;  3K1N A;  4LG0 A;  1J9I A;  5LHI A;  1JHF A;  4BXU A;  2MD5 A;  3RTR A;  5ERI A;  2K4B A;  4A0Y A;  1TTY A;  5LGU A;  2PLY A;  4KIF A;  1UHM A;  3IRR A;  3E6B A;  1P4W A;  3VEP A;  2VT2 A;  3WE3 A;  3WTW C;  3MAJ A;  1BN5 A;  2DI3 A;  2DU9 A;  2NYX A;  5FFX A;  1C0W A;  1WQ2 A;  1ULY A;  3CTA A;  1WRJ A;  1FY7 A;  4P9F A;  1SFX A;  4UV8 A;  4G6D A;  4KN7 X;  2M45 A;  3HYI A;  3JAM K;  4ETS A;  4GYG A;  1OKR A;  1I1G A;  4UVA A;  3TOB A;  1KQ0 A;  4LLG F;  1I1S A;  2Q8K A;  3QPH A;  3FWE A;  5JR3 A;  4S04 A;  2CYY A;  4HDU A;  3I58 A;  4KIG A;  4Y17 A;  2F5F A;  3ISP A;  1CF7 A;  4Q47 A;  1FPQ A;  3SZP A;  3Q5F A;  1YIO A;  2IA1 A;  5J8F A;  2DTR A;  3S2W A;  1S3J A;  3F6O A;  3GF2 A;  3F72 A;  2EFN A;  2O03 A;  5CVU A;  1UHW A;  3LST A;  2QZ8 A;  3HRM A;  5D4S A;  2QLZ A;  4OMZ A;  1FT9 A;  4L9V A;  1BI3 A;  2H6C A;  2D2W A;  5D8L B;  2OZ6 A;  3WU0 A;  2ESH A;  2VC1 A;  1EH8 A;  4RGU A;  3GEZ A;  4Y13 A;  1P4A A;  1AWC A;  1R5G A;  4HAM A;  2O3F A;  5IT9 Z;  4Z2Y A;  1XGM A;  5BQT A;  2D1H A;  4KYW A;  5D6F A;  3V8K A;  3F22 A;  4CDG A;  1HQC A;  1H9T A;  2FE3 A;  1U5T B;  3IKT A;  3GFL A;  5DD4 A;  4XSX F;  3KP6 A;  3E97 A;  5DD8 A;  3LA3 A;  1SFE A;  3M7G A;  2GQQ A;  4HF1 A;  2OBP A;  4ON0 A;  3QPT A;  2XAS A;  2E7W A;  3F21 A;  3SHF A;  2VBX A;  5DUI A;  3GFJ A;  2ZNY A;  4G94 A;  1XSV A;  1FBU A;  1BIA A;  3HRT A;  3KCC A;  4WK8 F;  2ISY A;  2TDX A;  1SD5 A;  1ZAO A;  1R22 A;  2XV4 S;  2EFW A;  2FQ3 A;  1R1V A;  3C3W A;  4GYI A;  1FOK A;  3F8C A;  3H3U A;  3O2P E;  2EB7 A;  2LDU A;  1XMK A;  4RGX A;  3J7A O;  2IT0 A;  1ZGA A;  4IF4 A;  1R5H A;  2JPB A;  5CVI A;  2HOE A;  4WCG A;  1Z1D A;  3WTS C;  1YFH A;  1B9N A;  1BM9 A;  3R60 A;  3JTH A;  1TQI A;  2P7C B;  2ZJ2 A;  4F7Z A;  4L9N A;  4EJV A;  4OIQ F;  2KJC A;  5DV5 A;  1FSE A;  4KN4 X;  3HOS A;  3W6K B;  3WTT C;  5JFR A;  1QBJ A;  4MEX F;  3TO6 A;  2E1N A;  3I0T A;  4K2E A;  2PQ8 A;  3T5X A;  1HKT A;  1KGS A;  2ELH A;  1KYZ A;  3FM3 A;  3JSO A;  1SAX A;  2RC4 A;  1Z05 A;  3FXQ A;  1F4K A;  1R23 A;  4CYD A;  3F8N A;  2K7L A;  3I71 A;  3P7N A;  4LB6 B;  1DUX C;  5HLH A;  4M9S A;  2VXZ A;  4HBL A;  4OIR F;  3F8F A;  1RUO A;  4LGW A;  4KA4 A;  4M9Z A;  1BI1 A;  1HBX G;  4EM2 A;  1O3R A;  5LEK A;  1XDS A;  3I4P A;  2B0L A;  3WE2 A;  1IXR C;  4B8X A;  5FD5 A;  4I98 B;  4ZH4 F;  5J6X A;  5E1W A;  2DK8 A;  4E70 A;  2HDC A;  2VC0 A;  2XHK A;  4ZYH A;  5BMZ A;  4UVB A;  5CLS A;  5KK1 A;  2BEO A;  2PFB A;  5JI6 A;  1Z6T A;  1O57 A;  2STT A;  1YS7 A;  2JZY A;  3KP4 A;  2K86 A;  2PBI A;  1ZG5 A;  5LEJ A;  2DT5 A;  3JTG A;  4IXA A;  4EJU A;  1U3E M;  2EV0 A;  2FNA A;  1O3Q A;  3W6J B;  4YIF A;  5BPI A;  2EWN A;  3TKY A;  2L01 A;  4ESF A;  1T98 A;  4YII A;  1KU9 A;  2VT3 A;  3T8T A;  1QZZ A;  3LFK A;  4MQ9 F;  2E7X A;  4GCV A;  1S8N A;  3N97 A;  3GYH X;  2QBY A;  5J8C A;  2IJL A;  2ZBK A;  2UXN A;  2NNY A;  1J2X A;  1JE8 A;  1KU3 A;  5K5Q A;  5ICE A;  2KIM A;  2ETH A;  1VTN C;  2QUF A;  4IRI A;  5BPD A;  1DPU A;  4OIP F;  3F23 A;  4XSZ F;  2LF7 A;  4Y15 A;  3CO7 C;  1IAW A;  2P4W A;  1TW3 A;  1LJ9 A;  5FO5 A;  3P9K A;  2EFP A;  4I0A A;  1MJB A;  1S7O A;  3E5Q A;  2XVC A;  3ZMD A;  4A5M A;  2HR3 A;  1FC3 A;  3D0S A;  4CO8 A;  3ABT A;  2DPD A;  5AON A;  2CG4 A;  2GA1 A;  3J81 K;  5HVQ C;  1H9G A;  3HSF A;  1FX7 A;  1YO5 C;  4ENN A;  5EEG A;  5D4R A;  3FX3 A;  2WWY A;  2FEZ A;  1XGS A;  3FZV A;  4LFU A;  3R4K A;  1ZLJ A;  4ENJ A;  3FM5 A;  2RGV A;  3VOE A;  2CGP A;  2A3S A;  3KP3 A;  2XRN A;  4OU0 A;  2VE8 A;  1G3W A;  2V1X A;  5D5X B;  4RB3 C;  4P55 A;  1K78 B;  3TDU C;  5LRR A;  4EMS A;  4O3M A;  1RI7 A;  2DPU A;  4UUV A;  2FOK A;  4LMY A;  1IUY A;  2DBB A;  1QGP A;  1IRG A;  2O6G E;  3HUG A;  2GXG A;  4HV6 A;  2ACJ A;  2CWE A;  1Y0U A;  2A61 A;  3DPL C;  3P9I A;  4AD9 A;  1B6A A;  1IRF A;  4EQQ A;  1YW7 A;  4ESB A;  2Y75 A;  2Z33 A;  2IRF G;  1AOY A;  1D8J A;  2BE5 F;  1U5T C;  4U7D A;  2OQR A;  4RGS A;  1D3Y A;  4LB5 A;  3V4G A;  2K02 A;  1Z91 A;  3KEO A;  4I02 A;  3WU1 B;  2A68 F;  1MDM A;  1QQI A;  2IA2 A;  3ZP5 A;  4HOB A;  2EA4 A;  1ODD A;  2FBH A;  1MDM B;  3WTV C;  4KIB A;  5HLG A;  2FXA A;  4HYE A;  1TQP A;  3IKV A;  2COM A;  3ZMZ A;  3ZQ7 A;  3HTU A;  3MWM A;  3JAM Z;  1KYW A;  1RNL A;  4G7H F;  2DQR A;  2UXX A;  1EV7 A;  3HSR A;  3PQK A;  1TBX A;  1MKM A;  1K79 A;  4M6X A;  1H0M A;  3ML6 A;  2HTJ A;  3HIF A;  4KMU X;  2BYV E;  1DDN A;  2M30 A;  4RAZ A;  4HX4 A;  1MGT A;  4BH9 A;  1PP7 U;  1MJA A;  1W7P D;  3DF8 A;  4ENM A;  4FX0 A;  2P6S A;  1XMA A;  3ECO A;  4MQV A;  2V9V A;  1TNT A;  4A2U A;  2O0Y A;  2JPC A;  3GVA A;  4CZZ A;  3GLX A;  3E5U A;  2QM3 A;  3RI4 A;  5TJJ A;  3KP2 A;  5DYM A;  2KJB A;  3WGH A;  3LWF A;  3BJA A;  1IN7 A;  2ZKZ A;  5DCM B;  2G7U A;  4BHB A;  3DEU A;  2DAO A;  2HS5 A;  3FF5 A;  1R36 A;  5TRD A;  1R1T A;  1ZHF A;  3HRS A;  1JHH A;  3MFK A;  4P5O A;  2HEO A;  2PMU A;  1YS6 A;  2A07 F;  3GUD A;  3L2C A;  1KQ8 A;  4LLL A;  1LEB A;  2F5E A;  1OMI A;  3MEX A;  4EGZ A;  3ZMV A;  1TNS A;  4ZYG A;  4A0Z A;  2H6B A;  1L0O C;  2MC3 A;  2QVO A;  1G3Y A;  1IN8 A;  5E17 F;  1FNN A;  3DPT A;  4L0Y B;  1ONV A;  2EK5 A;  2O61 A;  3EYY A;  4PGH A;  1ZRD A;  4I01 A;  5CVJ A;  1XGN A;  4Q4Z F;  2HFH A;  3BJO A;  3CJN A;  3R0A A;  1HW1 A;  1T6S A;  3V7S A;  4Q5S F;  4A12 A;  3CUQ A;  4ZZL A;  4EV0 A;  5FB2 A;  1Z9C A;  3SXY A;  3ECH A;  2QBY B;  5LBQ A;  5FLX K;  1QO0 D;  4AIK A;  2Z9O A;  3ABU A;  4G6Q A;  2HWV A;  4HF0 A;  4OMY A;  2NNN A;  2DLL A;  2K4J A;  3ERE D;  3P9C A;  1Z6R A;  4L9T A;  3IL2 A;  2UWM A;  2BV6 A;  2GZW A;  2QQ9 A;  4U0V A;  5F64 A;  3RJP A;  1BC8 C;  2YR2 A;  4LJZ F;  4BNC A;  3TDZ C;  2VN2 A;  1GXQ A;  3I5U A;  3TQN A;  5A2Q Z;  2H09 A;  3EDP A;  2PI0 A;  3LA2 A;  4NB5 A;  2J5P A;  2XIG A;  2X0L A;  4CIC A;  1YW9 A;  2A6E F;  2F5C A;  3K9T A;  3CLO A;  1LDD A;  1U8R A;  4M73 A;  1L3L A;  4QLC U;  3ZMU A;  2H94 A;  5CVV A;  2XAH A;  2R7F A;  2YU3 A;  3H3Z A;  3MCZ A;  2CFX A;  4JK1 X;  5HS9 A;  5BS6 A;  3C18 A;  1XB4 A;  5CVR A;  4UXN A;  2GIV A;  3HOT A;  2L54 A;  2MBF A;  2IA0 A;  3PFI A;  5LGT A;  2P5V A;  1REP C;  1KQ9 A;  3IWZ A;  4DQ2 A;  2ZCW A;  4M71 A;  3BWG A;  2NS0 A;  3LAJ A;  2GWR A;  5BOX A;  5D5W B;  2A6H F;  1O7F A;  4PCQ A;  4FT8 A;  1SMY F;  5JVT A;  4OOI A;  2R3S A;  2XUB A;  3M1E A;  3I59 A;  4ENK A;  1RIO H;  1WWX A;  1P6R A;  2DW4 A;  3DQV C;  3FXU A;  5FGM A;  1JGS A;  2V6C A;  1JXS A;  4A5N A;  3Q9V A;  3J81 Z;  5H6R A;  4IHT A;  2P5K A;  2WV0 A;  1LDJ A;  2A69 F;  1YLF A;  2PN6 A;  3H92 A;  4O5V A;  3DXJ F;  4B09 A;  1R7J A;  1YG2 A;  3E6M A;  1MD0 A;  4LD5 A;  3QP6 A;  5L3G A;  3F6V A;  3ZMS A;  4JBA A;  3BPX A;  2WTE A;  1W5S A;  2X4H A;  1BC7 C;  5K5O A;  1SFU A;  2QYO A;  1R00 A;  3DKW A;  1J5Y A;  3V8J A;  2HKO A;  3FMQ A;  4XBF A;  3J80 Z;  5HDN A;  3I64 A;  1T2K A;  4U88 A;  1FLI A;  3E5X A;  2NAZ A;  1U6G A;  4EJO A;  3BZ6 A;  2QEN A;  1SD4 A;  4Q48 A;  2Z3Y A;  2CQK A;  3B02 A;  2J5O A;  4GO1 A;  3DV8 A;  2ZNZ A;  1XN7 A;  1B59 A;  1BI0 A;  2ESN A;  2QWW A;  4I0B A;  2Q2E A;  4YG2 F;  2EA2 A;  3K1P A;  1BOA A;  3PQJ A;  2OD5 A;  2IPQ X;  4KUM A;  4HA8 A;  1K6O A;  3L9F A;  2DK5 A;  5ILS A;  2MA3 A;  1J59 A;  4HZF A;  4IVN A;  3KZY A;  2IVM A;  2F5D A;  1OYI A;  5H20 A;  1MJ9 A;  4R79 A;  4N0B A;  2KRF A;  2FMY A;  1STZ A;  2EFQ A;  1HKQ A;  2XAF A;  3RYP A;  3RIR A;  3VOD A;  4P96 A;  4UNO A;  3JW4 A;  3RPU A;  4ESJ A;  2HZT A;  4IPA A;  2MLK A;  1W7P A;  2HQR A;  2BBY A;  1ON1 A;  1TQM A;  5HLI A;  1GHC A;  4I09 A;  1ZN2 A;  3LQR A;  2FBK A;  4O6J A;  2JRT A;  5HS8 A;  4S05 A;  1XCB A;  1XSD A;  3RKY A;  4CHU A;  4RB1 A;  4L5I A;  3G73 A;  3CO6 C;  2Y0M A;  2DFI A;  3SFZ A;  1LQ1 A;  1FZP B;  1DP7 P;  1B1B A;  3TOA A;  2NRA C;  1OR7 A;  2O8X A;  3C7J A;  4KMF A;  1FP2 A;  1FYL A;  1ZG1 A;  2RQP A;  4CGZ A;  2IP2 A;  1ZLK A;  2KIF A;  5DEQ A;  4L18 B;  2RKH A;  4AVP A;  3K2Z A;  4AIH A;  1HW5 A;  2W85 A;  4HQM A;  4I7H A;  3KLN A;  3BPV A;  5FFZ A;  1Q1H A;  3NEU A;  2XAJ A;  1B4A A;  5D5U B;  4MEY F;  2W84 A;  2XKO A;  3DFG A;  5L3D A;  5L3F A;  1CGP A;  1BIB A;  3WTX C;  1WSU A;  3BRO A;  1U78 A;  1FBQ A;  2A5Y B;  1IXC A;  1IN6 A;  3QU3 A;  4HX8 A;  1ZRC A;  1R58 A;  3SZT A;  5L3E A;  3ZN1 A; 
#chains in the Genus database with same CATH topology
 3VYS B;  3QQA A;  2H27 A;  3M1C A;  4D9J A;  2FOW A;  4UUS B;  3ABL H;  3K70 D;  4HLY A;  1XGO A;  4RAY A;  1PYV A;  3BDD A;  2EIJ H;  2EV6 A;  4L0Z B;  2DJI A;  2W4S A;  1S9H A;  3FK6 A;  3O6B B;  5GTH C;  3R0J A;  4RB2 C;  3W2A A;  3U21 A;  4BJT A;  3M3Y J;  3IHU A;  4RS8 A;  5KCM A;  2CS3 A;  3R6S A;  2R7O A;  1MBK A;  4NQW B;  2R92 J;  1DGW Y;  1R5I D;  3CZ6 A;  4JX5 A;  4YRV A;  4RLQ A;  5EG0 A;  1W5T A;  2KPM A;  4KDP A;  4ASN A;  2RV8 A;  4XRS G;  2E2I J;  4MTE A;  2EIN H;  3QYF A;  1WHU A;  3OYE A;  1VQ6 I;  3NQO A;  3RKW A;  3WTZ A;  3JRG A;  1UST A;  4NQW A;  2PEX A;  1HKS A;  2Y48 A;  2HOS A;  3BG9 A;  5ED4 A;  5GPC A;  2ME0 A;  1K4T A;  5EZH A;  2Q0O A;  3L7W A;  1Z7L A;  4UHT A;  2VBY A;  3WHC A;  3HHH A;  2R7R A;  2W7N A;  2XPW A;  3TP3 A;  1XCV A;  2HQA A;  1FBS A;  1JKP C;  1F1Z A;  1GUU A;  3CC7 I;  4D5C A;  4UUS A;  2DT7 B;  1OCC H;  3M07 A;  1RKW A;  1T0F A;  5L3C A;  4Y7N J;  3GCM A;  3MD2 A;  5LLQ A;  1O3S A;  1P4X A;  5IPA A;  4M72 A;  3V8L A;  3T0Y A;  5DUK A;  1UB9 A;  2OTJ I;  3O3K A;  1AKH A;  3PO2 J;  1YW8 A;  1X1A A;  2HGC A;  4G8X A;  2Y2Z A;  2YSR A;  2F4O B;  4XRF A;  4KJZ A;  2NS7 A;  2XC7 A;  4Y3O A;  2QA4 I;  4X1E A;  2KQR A;  2P7V B;  5DCF A;  1PDN C;  1MBE A;  2P6T A;  3L2Q A;  2PMH A;  2GXA A;  2XAQ A;  1V3F A;  3AG4 H;  1WJD A;  9ANT A;  3SEQ A;  4EJW A;  1DPR A;  3HG9 A;  2XKP A;  1YYV A;  3CQZ J;  3S3M A;  5ILV A;  5FRN A;  3F3X A;  1X1D A;  2CO5 A;  3NRV A;  3PJR A;  1YE9 A;  3ELK A;  3LQQ A;  3WOD F;  2EPF A;  2E1M B;  1YIT I;  4FHT A;  1J75 A;  2R93 J;  2OZU A;  4HLX A;  4ZC3 A;  5FLX Z;  1B9M A;  2RNG A;  4RAG A;  2M5W A;  2QCO A;  3Q3S A;  3C1D A;  4PJ0 C;  1TWA J;  2QGU A;  3CUQ C;  4BEH B;  3GZ6 A;  5AIP A;  2C6Y A;  3PUB A;  2DFH A;  4MFE A;  2ZME A;  5LGN A;  2FML A;  4M74 A;  2VBW A;  3D5L A;  3KLO A;  4N9I A;  3B73 A;  5K1Y A;  2BHY A;  4HF2 A;  3K0L A;  2L4A A;  4U7B A;  4C3J J;  3DKX A;  1OYW A;  3M8E A;  2DOA A;  1LVA A;  4E7K A;  1NHA A;  3TBI A;  1QZY A;  4UV9 A;  1HSJ A;  4IRH A;  3GTO J;  2F4M B;  4I99 C;  2VKD A;  3ZGK A;  2KRC A;  2ZO4 A;  4U0Y A;  1EH6 A;  3GFM A;  2OA4 A;  1VND A;  1UCR A;  2R7T A;  4IOC F;  1IW7 F;  4LIT A;  2FU4 A;  1UHS A;  3BP8 A;  3T1B A;  3DBL B;  4JQF A;  1T95 A;  5C44 J;  4KIT B;  4PZJ A;  2V79 A;  3CCJ I;  4HV5 A;  1VQ9 I;  1ZKG A;  3ULQ B;  1ETV A;  4XLP F;  1UZC A;  3GME A;  5TGT A;  4D0P A;  2TCT A;  3CCE I;  4E7S A;  4PJM A;  2HKX A;  2VQL A;  2V1D A;  3HXL A;  2Q1Z B;  5LHG A;  3J80 K;  1TT0 A;  2OAZ A;  2ISZ A;  2LY2 A;  3ZQG A;  2ZME C;  5IT3 A;  5F1R A;  4HRI A;  2JMW A;  4KT6 A;  4RBO A;  2UZK A;  4WF2 A;  5JLW A;  4LG0 B;  2F2E A;  4FX4 A;  2M8E A;  1OYY A;  4C9Y A;  1LEA A;  4HW0 A;  2HVQ A;  2QSG X;  4A3M J;  4WWC A;  3EPZ A;  4WXH A;  2YX4 A;  3FXO A;  1TL8 A;  3KE2 A;  3ZQI A;  3G3Z A;  1YX5 A;  4DJA A;  3MKZ A;  1G4D A;  1D5V A;  1SMT A;  3U9G A;  4AU7 A;  4R1H A;  4HX7 A;  3KP7 A;  3QPS A;  3D5S C;  3BY6 A;  1FOW A;  3I56 I;  1HST A;  3E6C C;  1S5L C;  2VL8 A;  4KT5 C;  3FKJ A;  1MBF A;  2CSO A;  4KFC A;  2WAF A;  3CDH A;  2OC6 A;  3J7A Y;  2L02 A;  4LK1 F;  4UB6 C;  5K7Z A;  1W4M A;  2E1M C;  3E6D A;  2VIX A;  5AIQ A;  4IO9 F;  1KU7 A;  1MIJ A;  2LTP A;  1IZ1 A;  1ZG3 A;  3GW2 A;  3TO7 A;  1Y1V J;  2KIU A;  4EVI A;  1ETO A;  2VLA A;  2QQA A;  4EM0 B;  3NAR A;  3RPQ A;  3KZZ A;  4BDZ A;  1B8I B;  2LR8 A;  2ZXJ A;  3A4C A;  4XID A;  1RPW A;  4B3X A;  3VSL A;  3SFI A;  1EKE A;  4BXF A;  2E1C A;  2D1V A;  3L00 A;  3REO A;  4NHJ A;  1XD7 A;  5LD2 C;  3EUK L;  3VFZ A;  4BJ6 C;  1Y8Q B;  1FYK A;  1KA8 A;  5E1X A;  2DYS H;  4AM3 A;  2ECC A;  1LDK B;  2E60 A;  1FOY A;  1AHD P;  2K27 A;  2CMP A;  2BVL A;  5HOO A;  3IUO A;  4LIV A;  3DLA A;  3JRA A;  4E7I A;  2RAE A;  2Y0S N;  2W1O A;  3GX4 X;  3K69 A;  2LNB A;  2X6O A;  3EUH A;  2CUF A;  2IS4 A;  1XC5 A;  2XPU A;  3H5N A;  5DCM A;  4BHC A;  2YX7 A;  1ON2 A;  2FF4 A;  5KVR A;  1USS A;  1TWC J;  2XRO A;  2W57 A;  3RKX A;  2VBZ A;  3TGN A;  5GP9 A;  3E7L A;  1T38 A;  1SVO A;  4JP0 A;  4EAT A;  3MQ0 A;  3U1D A;  1QVU A;  3VYU B;  4IHS A;  1T39 A;  2PX9 A;  1ZR2 A;  4IQJ A;  1ZAR A;  3RQ4 A;  3OS0 A;  2MH2 A;  5ILU A;  2NVQ J;  1EJ9 A;  3T8R A;  3VYR B;  3EUA A;  2WC2 A;  2ZXI A;  5BNG A;  2IGK A;  5HLT A;  2R7D A;  1FP1 D;  1FEX A;  1JKQ C;  1EH7 A;  3M8J A;  3TED A;  3JRH A;  2VOD A;  1MMA A;  2R7V A;  4U87 A;  1W7P B;  2M3A A;  1FSH A;  3IC7 A;  2HYG D;  2KIS A;  1BR4 A;  2Z99 A;  2JWT A;  4XLN F;  1S7A A;  3V7R A;  1DU0 A;  2L2O A;  1T56 A;  1WCM J;  1O7L A;  1NTC A;  3HGG A;  4BS9 A;  2DOE A;  2FA5 A;  4L5J A;  2EZK A;  3IV5 A;  3BR5 A;  1BJZ A;  3E3V A;  3R61 A;  3BQZ A;  1I39 A;  2VE9 A;  4N4O B;  2R5Z B;  2PG4 A;  3RPU D;  4YFN F;  3B6A A;  1FYM A;  4RA2 A;  2YPR A;  2Z5U A;  3CP8 A;  2ADU A;  1A04 A;  4MTD A;  2JVH A;  4AWX B;  4D5F A;  3DP7 A;  5IY5 H;  4DBQ A;  2LY1 A;  5J47 A;  2H1K A;  1U2W A;  2EIK H;  4OIO F;  3HEF A;  3BTL A;  2JA6 J;  2K9N A;  2DA3 A;  2DQL A;  1MMG A;  2JT1 A;  2ZME B;  4KIC A;  4CUG A;  4HNV A;  3GZ5 A;  2F6C A;  1E2X A;  3QYE A;  2NVY J;  1M1E B;  3WTU C;  4XLF A;  3W2W A;  5D6E A;  2HTS A;  1A6I A;  4N4N B;  2DDB A;  4CCM A;  2DOD A;  4EJT A;  1MBG A;  1K6Y A;  3I9V 2;  4PFO A;  3MZH A;  1FIA A;  2JTV A;  5IT9 K;  2P8T A;  2QSF X;  3AL0 B;  4W97 A;  2EV5 A;  2CW7 A;  1VF9 A;  2XSD C;  4F55 A;  3AKZ A;  1ZRE A;  5EF6 A;  3CF2 A;  5K5R A;  1IXS B;  4PGG A;  3HRU A;  1J0R A;  1G3T A;  3U1K A;  5HDG A;  2P5L C;  4E7H A;  4IHV A;  1HDP A;  3QP5 A;  5DS9 A;  4KNY A;  1E17 A;  3KP5 A;  5E1Z B;  2EQR A;  4XR6 A;  4S0H B;  4QWQ A;  4MGR A;  4H0E A;  3CCR I;  5DM7 F;  3JRI A;  4J00 A;  3S93 A;  1I6X A;  4RM2 A;  3OL4 A;  3ZRG A;  5D5V B;  3AAF A;  1IF1 A;  3K4M A;  5HS7 A;  3ZMT A;  4BHP A;  1YRN B;  3COA C;  4PDK A;  3K4J A;  1V55 H;  1IN4 A;  5E3L A;  1IDY A;  4IRG A;  4A0X A;  1FWZ A;  3WG9 A;  1RR7 A;  4UVC A;  1O3T A;  1PUE E;  3GFI A;  2GAU A;  2EH3 A;  5J4Y A;  2HVR A;  5DDG A;  1MH3 A;  4LOC A;  4M9X A;  3FHZ A;  3ZXS A;  5A2Q K;  1CF7 B;  3ZQC A;  2JSC A;  4MNU A;  4BQA A;  1D0Z A;  2STW A;  4F52 A;  4RGR A;  2W24 A;  5ICC A;  5E3O A;  4GGG A;  3OYH A;  3M4O J;  1I50 J;  4AYB A;  2OF7 A;  1JTX A;  1XSX A;  1SD6 A;  2ZXH A;  1UFM A;  2G9W A;  1K78 A;  3LFU A;  1YJ9 I;  2ZFW A;  1YJW I;  2GOX B;  3ZPL A;  1D8K A;  1P7I A;  3TMO A;  3MKL A;  1PVE A;  4IJA A;  5H6Q A;  3KYL A;  3DEW A;  3SQN A;  4HNT A;  4WXD A;  2HYJ A;  4AIJ A;  2GXB A;  3CLQ A;  2OPT A;  2VKH A;  2JVG A;  5EG0 B;  4XN3 A;  2LF8 A;  3KIO A;  4XON A;  1QPM A;  2XGX A;  1OPC A;  1H8A C;  2FRH A;  1I3A A;  3AFH A;  4PSW A;  4OIN F;  1LKX A;  3QAH A;  3K4B A;  4B44 A;  4II2 A;  2CW8 A;  1RZ4 A;  3H0G J;  1BBY A;  2P81 A;  2HQ5 A;  4FQG A;  2DMU A;  3I59 B;  2FBI A;  2VKV A;  5GAH J;  3GXO A;  4CCK A;  2QSH X;  2DA1 A;  3KET A;  3KEQ A;  4WXC A;  2RNJ A;  4I76 A;  2XAG A;  2NOJ B;  2BXZ A;  1X3U A;  3ZN0 A;  3CJR B;  5IOZ A;  1JGG A;  1X2N A;  3LSG A;  1JUS A;  1G6N A;  1IG7 A;  3FMR A;  1XDU A;  5B3S H;  4I2O A;  3DBH B;  4IHW A;  5IOY A;  3QU6 A;  5E18 F;  2ME6 A;  2IS2 A;  5IP6 A;  3RDI A;  5HDK A;  4L9J A;  4GDF A;  3M9A A;  2FJ1 A;  1SAN A;  1HW2 A;  2CQ7 A;  1F9N A;  5LHH A;  3EYI A;  4DZP A;  2O9L A;  2LD5 A;  4G7O F;  1QNT A;  1ERD A;  3N4M A;  1OCP A;  2HYF A;  3H35 A;  5CJ9 A;  2W25 A;  5JLX A;  5B1A H;  2JA5 J;  3KYD B;  3D5R C;  2VXD A;  2IW5 A;  3GTK J;  4YIR X;  5E8G A;  2XGE A;  3JSP A;  1U5T A;  2LSO A;  3JRF A;  2RDP A;  5L3B A;  3I54 A;  3KFW X;  3HHG A;  3PNT A;  1PJR A;  5D8K B;  1PP8 F;  4EGY A;  3S2D J;  1FTZ A;  2OQG A;  2FD5 A;  2MW8 A;  1LB2 A;  3S1Q J;  3HJE A;  4H4K C;  4D1Q A;  2PMZ A;  1R1U A;  2FNP A;  4A6E A;  3Q9S A;  4MLO A;  1AA7 A;  4G9Y A;  2M0M A;  1BOB A;  2MLG A;  3L09 A;  4EM1 A;  2OCC H;  2VOO A;  5E20 A;  5J40 A;  4R8H A;  4A3L J;  2CW0 F;  2A5W A;  1MW7 A;  3JRC A;  2G7H A;  1J7K A;  1WJE A;  4E7Z A;  2GA2 A;  2L3D A;  3CCL I;  3JCU C;  3A01 A;  4M3F A;  2ZJR F;  2VOP A;  2BGC A;  1ZYR F;  3KZI C;  3LA7 A;  1IV8 A;  3F8M A;  4BAY A;  2DN0 A;  3GO5 A;  1GVD A;  4LLN A;  2L4M A;  3K2A A;  2HNH A;  3EET A;  4YFX F;  5ICG A;  1LNW A;  3CUO A;  6PAX A;  4GFB A;  4A3J J;  3ROU A;  1SEU A;  5ICF A;  1VZ0 A;  3BOQ A;  1GVJ A;  5JHF A;  1P2F A;  3IWF A;  1S7E A;  1BI2 A;  1WI9 A;  1Y6I A;  5GAE J;  2HI3 A;  3G1O A;  5FD6 A;  4A3C J;  4A3E J;  3LAP A;  4UUT A;  2M4K A;  4XN0 A;  1VQK I;  3K4N A;  1UJ8 A;  3U2R A;  3I4M J;  1QRY A;  3RQI A;  4ZZD A;  1GDT A;  1GV5 A;  4QPO A;  4E7J A;  5F1J A;  3M8F A;  4HQE A;  1Z0X A;  2BY2 A;  1X1P A;  5JHU A;  4G6T B;  5GPA A;  1K7A A;  1JJ6 C;  2PJP A;  1ETY A;  2FSW A;  1WKM A;  3OMY A;  3RCO A;  1I27 A;  4YFK F;  2BY3 A;  3G1L A;  1SD7 A;  3CDL A;  2X6Y A;  2VON A;  3K1M A;  2F48 A;  5LRS A;  2AS5 F;  4ZYD A;  4P9U A;  2CFO A;  2EJR A;  2M1B A;  3TP0 A;  2DXI A;  4IZZ A;  1TW2 A;  3IRQ A;  2COB A;  4JYK A;  4RB0 A;  1F5T A;  3S1N J;  2LP0 A;  1YTY A;  3OV8 A;  1IC8 A;  3WTY C;  3VWB A;  3GWZ A;  3TW7 A;  1P92 A;  2AQF A;  3QRF F;  2DMN A;  1RUN A;  2XPV A;  3F8B A;  2DA6 A;  3I53 A;  1ZRF A;  1BJA A;  2IBD A;  4N9H A;  1RKT A;  1HXD A;  1TLH B;  1ACI A;  3HTS B;  2TRT A;  5EEH A;  2D5V A;  3OOP A;  3FXR A;  4BYY A;  1SFO J;  2HQN A;  4WX9 A;  2L0K A;  2M87 A;  4ZYE A;  3CDI A;  2MH9 A;  5CYV A;  3BLY A;  1GXP A;  3FMS A;  5EDN A;  3TO9 A;  3HSE A;  1DU6 A;  2D45 A;  3DBR B;  1I5Z A;  4ZDL A;  4GXO A;  3QOP A;  2AHQ A;  4G7Z F;  4MHG A;  3WGG A;  2Z2S B;  1ZH5 A;  5FLM J;  3OR1 C;  2DDA A;  1ZGW A;  2AQE A;  1S29 A;  4DNC A;  2DO7 A;  2KKO A;  2AXL A;  3OYJ A;  3MKY B;  1YOV B;  3AG1 H;  3S8P A;  3CUQ B;  4C2T A;  3RYR A;  5F6F A;  1JTY A;  2V26 A;  1Z7U A;  3A01 B;  1IN5 A;  2QQB A;  2K9M A;  5FKL A;  2EFO A;  3UR3 C;  4C3H J;  2RN7 A;  1VI0 A;  1UG2 A;  2N8G A;  1MZB A;  1G3S A;  3BJ6 A;  4M6Y A;  3V7C A;  4LK0 F;  4CXF A;  2KFD A;  3WGI A;  1ETX A;  1WFX A;  2OU2 A;  2OTL I;  2RVC A;  5E8I A;  1SAU A;  3MZY A;  1SVM A;  5FKK A;  1KU2 A;  1V4R A;  2K3F A;  3VB2 A;  4XOT A;  1A35 A;  5DM6 F;  1S6L A;  4BXX J;  2V1U A;  1OCZ H;  2Y69 H;  3DCF A;  4UB8 C;  3DEE A;  2LKP A;  4HDV A;  3DTI A;  3K10 A;  1ZGJ A;  2DT6 A;  3IH4 A;  3OOU A;  4U0W A;  3PM1 A;  4A6D A;  3EQL F;  1WZ2 A;  1YQA A;  4TV7 A;  3K1N A;  4LG0 A;  1J9I A;  5LHI A;  1JHF A;  4BXU A;  3GTL J;  2MD5 A;  3RTR A;  3OYK A;  5ERI A;  1VFC A;  4XIC A;  2K4B A;  5J3L A;  4A0Y A;  3RZO J;  5LFA A;  1TTY A;  5LGU A;  2PLY A;  2VAS A;  5TIS C;  4KIF A;  1UHM A;  2K9Q A;  1N25 A;  2BY1 A;  4DYR A;  3IRR A;  3E6B A;  1P4W A;  3KPH A;  3VEP A;  2VT2 A;  3WE3 A;  2EZI A;  3WTW C;  3MAJ A;  1BN5 A;  2CQQ A;  1JUP A;  2DI3 A;  4M3G A;  2DU9 A;  2NYX A;  5FFX A;  1C0W A;  2WBM A;  3FK7 A;  1WQ2 A;  4C2U A;  1ULY A;  1EF4 A;  2VQG A;  3CTA A;  4PUS A;  1WRJ A;  2L7K A;  1FY7 A;  1PUF A;  4P9F A;  1SFX A;  4UV8 A;  3HBL A;  4G6D A;  4KN7 X;  3BG3 A;  2M45 A;  3P5J A;  3HYI A;  3JAM K;  4BGD A;  5KAF C;  4ETS A;  4GYG A;  3PNV A;  1OKR A;  1I1G A;  4UVA A;  3TOB A;  5KHD A;  1KQ0 A;  1QPI A;  4LLG F;  1I1S A;  4AVZ A;  1SFK A;  2Q8K A;  1N77 A;  1F43 A;  2A05 A;  3QPH A;  4XKW A;  4BEH A;  2IS6 A;  3FWE A;  2HDW A;  2M7A A;  4C30 A;  1JKR C;  5JR3 A;  2BY0 A;  4S04 A;  3SDB A;  2OJE D;  2BOL A;  2CYY A;  3BTI A;  3H9G A;  1ITY A;  3HC7 A;  4HDU A;  3I58 A;  4KIG A;  4Y17 A;  2BW3 A;  2F5F A;  3ISP A;  1CF7 A;  1B72 B;  4Q47 A;  1FPQ A;  1X3W B;  3SZP A;  3LSI A;  3Q5F A;  1YIO A;  3WHB A;  2IA1 A;  2V9P A;  3L2U A;  5J8F A;  2LVS A;  2DTR A;  3S2W A;  1S3J A;  3J7Y J;  2VPL A;  2CUJ A;  3BR2 A;  1GV2 A;  3WG7 H;  2VJ5 A;  3F6O A;  3F72 A;  3GF2 A;  4IEJ A;  1AKH B;  2EFN A;  2O03 A;  5CVU A;  3CCY A;  4CYC B;  1JUM A;  1UHW A;  4M3D A;  1RRJ A;  1V54 H;  3LST A;  2QZ8 A;  3HRM A;  1VQ5 I;  2LK2 A;  5FKN A;  2QLZ A;  5D4S A;  3ZQQ A;  4OMZ A;  1FT9 A;  4L9V A;  1BI3 A;  5EYR A;  2H6C A;  3K4C A;  2Y0S A;  2IS1 A;  1Y8R B;  2KT0 A;  2D2W A;  5D8L B;  2OZ6 A;  1IJW C;  3WU0 A;  2JN6 A;  4HPQ A;  3OYD A;  2ESH A;  3L2V A;  1MND A;  2VJI A;  2VC1 A;  1EH8 A;  3ZOB A;  2X48 A;  2GLO A;  4RGU A;  3GEZ A;  4Y13 A;  2Y31 A;  3K6G A;  1H89 C;  1P4A A;  1AWC A;  5FRM A;  1D1C A;  4OAZ A;  3DKY A;  2WV1 A;  4XOP A;  2XAU A;  4L5E A;  1R9T J;  1R5G A;  4HAM A;  2O3F A;  5IT9 Z;  4Z2Y A;  1XGM A;  2ZXW H;  2UUZ A;  3OIP A;  4HEA 2;  3K4K A;  5BQT A;  2GOM A;  2D1H A;  2M0C A;  1V5E A;  4MIM A;  4KYW A;  5D6F A;  3V8K A;  3F22 A;  4CDG A;  1NK2 P;  1LFP A;  1E3P A;  3AG2 H;  1HQC A;  3OWT A;  1H9T A;  2DA2 A;  2FE3 A;  3GTG J;  1U5T B;  5J1R A;  3OYG A;  3IKT A;  1WGX A;  3W6V A;  1WJF A;  3GFL A;  4NBQ A;  5DD4 A;  4XSX F;  2K9L A;  3KP6 A;  5GAD J;  2RRE A;  3E97 A;  5DD8 A;  3LA3 A;  1SFE A;  2CUE A;  3M7G A;  4NUB A;  2GQQ A;  4DW6 A;  4HF1 A;  2OBP A;  3JR9 A;  4ON0 A;  3QPT A;  2XAS A;  2E7W A;  3F21 A;  3SHF A;  2XF6 A;  2VBX A;  1BA5 A;  4F3Q A;  3L2R A;  4NDL A;  2DJN A;  3PIO F;  5DUI A;  3GFJ A;  2ZNY A;  4G94 A;  3QPL A;  1HDD C;  1XG1 A;  1XSV A;  1FBU A;  1BIA A;  3G71 I;  2VQC A;  1WH7 A;  3OYC A;  3HRT A;  3KCC A;  4F91 B;  4WK8 F;  4ABZ A;  2ISY A;  2TDX A;  2GM4 A;  1SD5 A;  1ZAO A;  3CMY A;  3FHN A;  1R22 A;  2XV4 S;  3ONQ A;  4LIU A;  2JUC A;  2HPI A;  2MYS A;  2EFW A;  2FQ3 A;  1QHH D;  1R1V A;  3C3W A;  4GYI A;  2LMD A;  1FOK A;  3H3U A;  3F8C A;  1K83 J;  2JJ7 A;  3O2P E;  3KYC B;  2EB7 A;  2LDU A;  1XMK A;  2R7W A;  4RGX A;  3J7A O;  3HZJ A;  1UMQ A;  1ZGA A;  2IT0 A;  2KZV A;  4IF4 A;  3CME I;  1R5H A;  2JPB A;  5CVI A;  4UY8 I;  2HOE A;  4WCG A;  1Z1D A;  1V5F A;  2QQ8 A;  5IYC J;  3OYF A;  4DZJ A;  3S1R J;  3WTS C;  1YFH A;  1NK3 P;  1MBJ A;  1B9N A;  1BM9 A;  3R60 A;  3JTH A;  1ENH A;  1TQI A;  2P7C B;  2ZJ2 A;  4CH7 A;  5GAG J;  4F7Z A;  4BU2 A;  2K40 A;  1MH4 A;  4L9N A;  4A3D J;  3DTE A;  4EJV A;  4BQQ A;  4OIQ F;  2KJC A;  5DV5 A;  2MFZ A;  1FSE A;  2ZFU A;  4KN4 X;  3HOS A;  2DFE A;  3W6K B;  1D1B A;  3PSI A;  3WTT C;  4QSH A;  5JFR A;  1QBJ A;  4MEX F;  3TO6 A;  2E1N A;  4BUP A;  3I0T A;  4FE4 A;  3LSH A;  4K2E A;  2PQ8 A;  3T5X A;  4XMY A;  1HKT A;  2LBF B;  1KGS A;  2IEK A;  3LSK A;  5C3E J;  2ELH A;  2L9S A;  1KYZ A;  3FM3 A;  3CD6 I;  3JSO A;  1SAX A;  2B9S A;  2RC4 A;  2HU9 A;  1D1A A;  2KHM A;  3LSJ A;  1Z77 A;  3HM5 A;  1X4P A;  1Z05 A;  2CRG A;  4NC8 A;  3FXQ A;  2NVX J;  2CJJ A;  1F4K A;  4XLC A;  1R23 A;  3Q0W A;  4CYD A;  3F8N A;  1SVL A;  2K7L A;  1S72 I;  2L7M P;  3I71 A;  3IAS 2;  3P7N A;  4LB6 B;  1DUX C;  5HLH A;  4M9S A;  4IX7 A;  3VYT B;  4CCJ A;  2VXZ A;  3OSG A;  4HBL A;  2E71 A;  4DOZ A;  4C3I J;  2XRL A;  4OIR F;  2M8G X;  1DQU A;  3F8F A;  1RUO A;  4LGW A;  3LNQ A;  4A69 C;  4M9Z A;  4KA4 A;  1BI1 A;  1T33 A;  1U9N A;  1HBX G;  2KDO A;  4EM2 A;  1YIJ I;  1X58 A;  1O3R A;  5LEK A;  1XDS A;  3I4P A;  2B0L A;  3WE2 A;  1IXR C;  4B8X A;  5FD5 A;  5EGO A;  4I98 B;  4ZH4 F;  5J6X A;  2DMQ A;  3WU2 C;  2M7B A;  3CC2 I;  1WJ5 A;  2VJJ A;  2HXI A;  5E1W A;  2LRE A;  4PJJ A;  1GT0 C;  2ICW G;  2DK8 A;  3OYM A;  4E70 A;  1OCO H;  2HDC A;  3DWL E;  2R5Y B;  2VC0 A;  2XHK A;  4ZYH A;  5BMZ A;  1D5Y A;  2V7F A;  2E35 A;  4UVB A;  5CLS A;  1POG A;  3H9J A;  5KK1 A;  4Y33 A;  1Z3Y A;  2BEO A;  2PFB A;  2Y9Y A;  3PNY A;  5JI6 A;  3RZD J;  3MZ8 A;  1Z6T A;  1D0Y A;  3AG3 H;  2IAI A;  1BW6 A;  1O57 A;  2JK3 A;  2R5Y A;  3RKQ A;  1A31 A;  2STT A;  1YS7 A;  2JZY A;  3KP4 A;  3G6E I;  2R7U A;  1X1C A;  5K7H A;  2H8W A;  2K86 A;  2OCE A;  1Z21 A;  2WAQ N;  3BR6 A;  2JSP A;  3AL0 C;  3OS1 A;  2PBI A;  1ZG5 A;  5LEJ A;  3ZQH A;  2DT5 A;  2R7X A;  2WAE A;  4X6A J;  3JTG A;  4IXA A;  4EJU A;  1U9O A;  2LFB A;  1U3E M;  1UG0 A;  3HB9 A;  5B1B H;  2EV0 A;  3MMY B;  1ZTR A;  2FNA A;  3OYB A;  3FXJ A;  1O3Q A;  5IP9 J;  2R5Z A;  4V19 K;  1OJL A;  3W6J B;  4YIF A;  4NC7 A;  2MG4 A;  5BPI A;  2WAQ A;  3D1N I;  2EWN A;  3OIQ A;  5E79 C;  3TKY A;  4ZDP A;  2L01 A;  1TZL A;  3ABK H;  2LY9 A;  2NS8 A;  4BE1 A;  4CCL A;  1T98 A;  4ESF A;  3FIW A;  4YII A;  1NG6 A;  1KU9 A;  3JRE A;  2VT3 A;  3T8T A;  1Y1W J;  1QZZ A;  2PMZ N;  3OL3 A;  2JQ7 A;  3LFK A;  4MQ9 F;  2E7X A;  4GCV A;  1R6R A;  2ECB A;  2NVU B;  1FMW A;  4RLF A;  4C2M J;  3LSP A;  4IHY A;  4HNU A;  2MAB A;  2X1C A;  1S8N A;  2W48 A;  4XLH A;  1GLN A;  3A02 A;  3CCS I;  5F0C A;  2YUS A;  3N97 A;  3A0B C;  3GYH X;  1FIP A;  2QBY A;  4NNJ A;  3B6C A;  2GBY A;  5J8C A;  2IJL A;  2ZBK A;  1MMD A;  2UXN A;  3SYT A;  2NNY A;  2UV1 A;  3G2B A;  1J2X A;  2XB5 A;  3S17 J;  1JE8 A;  1G2H A;  1KU3 A;  5K5Q A;  4ZTJ A;  3E0J B;  2DFF A;  5ICE A;  2KIM A;  1RR8 C;  3L2W A;  2ETH A;  1VTN C;  2NVT J;  2DA7 A;  2QUF A;  3PFY A;  4IRI A;  2JA7 J;  5BPD A;  1B8I A;  1DPU A;  3ZQL A;  1IDZ A;  4OIP F;  4DGW B;  3F23 A;  1WJC A;  3KX2 A;  1D0X A;  2XGC A;  3S32 A;  2LKX A;  3HOU J;  4NC6 A;  5M3M J;  4XSZ F;  2LF7 A;  1ETK A;  3CMM A;  4Y15 A;  2HZD A;  2L5Q A;  5M5W J;  4J19 A;  3CO7 C;  1XPX A;  1IAW A;  2P4W A;  2CUZ A;  3OYA A;  1TW3 A;  1LJ9 A;  5FO5 A;  1KON A;  2ZC2 A;  3P9K A;  4AID A;  2BW3 B;  2EFP A;  4I0A A;  1MJB A;  1S7O A;  3E5Q A;  4XKC A;  2Q2E B;  2XVC A;  3ZMD A;  1BR2 A;  4A5M A;  5K7F A;  2HR3 A;  1FC3 A;  3D0S A;  2XGD A;  4XNF A;  4CO8 A;  4MFD A;  2DA4 A;  3RSN A;  1A5J A;  3ABT A;  2DPD A;  2R0Q C;  5AON A;  3J7Z I;  2HVS A;  2CG4 A;  4XKV A;  2GA1 A;  3J81 K;  2CU7 A;  5HVQ C;  2G0E A;  1H9G A;  2BHZ A;  3K4L A;  3HSF A;  1FX7 A;  1YO5 C;  4ENN A;  5H2F C;  5EEG A;  5D4R A;  1T0F C;  3FX3 A;  1X3Z B;  2WWY A;  1XTA A;  1MNM C;  2QF7 A;  4A93 J;  3BR3 A;  2FEZ A;  1XGS A;  3FZV A;  3IP4 B;  2M34 A;  4LFU A;  1DP3 A;  2XB0 X;  3R4K A;  1ZLJ A;  1E0E A;  4ENJ A;  1LUJ B;  3FM5 A;  2RGV A;  3VOE A;  2CGP A;  3F0C A;  3I55 I;  1QZE A;  1Z3X A;  2A3S A;  3KP3 A;  2XRN A;  4OU0 A;  5JVG F;  2VE8 A;  1E3O C;  1G3W A;  5EJC A;  2QKL B;  2V1X A;  5D5X B;  4RB3 C;  4P55 A;  4JX6 A;  4BBR J;  3TDU C;  1K78 B;  1WH5 A;  1I3Q J;  5LRR A;  4EMS A;  4O3M A;  1RI7 A;  3H1C A;  3H3V K;  2ZB9 A;  2DPU A;  4XM3 A;  4UUV A;  4A3K J;  2FOK A;  4FIS A;  3DU6 A;  3CC4 I;  1R49 A;  4LMY A;  1IUY A;  1MSF C;  4DBR A;  5B66 C;  1SC7 A;  2DBB A;  1QGP A;  1IRG A;  4E4H A;  5F0H A;  2O6G E;  3HUG A;  2GXG A;  4HV6 A;  2ACJ A;  2CWE A;  1Y0U A;  2HOT A;  2A61 A;  3DPL C;  3P9I A;  3OY9 A;  4AD9 A;  3OYL A;  3PO3 J;  1B6A A;  1IRF A;  1MMN A;  1JT6 A;  4EQQ A;  1YW7 A;  1OCR H;  3BCB A;  1ZEL A;  4ESB A;  2Y75 A;  2P0W A;  2Z33 A;  2IRF G;  1T8I A;  1AOY A;  1D8J A;  2OUM A;  4IOA F;  2BE5 F;  1MBH A;  3BG5 A;  2E5N A;  2V4J C;  1U5T C;  4U7D A;  3ZCO A;  5KAI C;  2OQR A;  4RGS A;  1D3Y A;  4XRS A;  3G4S I;  4LB5 A;  3S2H J;  3V4G A;  4RDU A;  3CCU I;  2K02 A;  1Z91 A;  2E19 A;  3KEO A;  4I02 A;  3WU1 B;  2A68 F;  1MDM A;  1QQI A;  2I5U A;  4YEL A;  4BE0 A;  2IA2 A;  3ZP5 A;  4HOB A;  2EA4 A;  1ODD A;  3CP2 A;  3HOX J;  1OCT C;  1N75 A;  2FBH A;  2CQN A;  5FKM A;  4D7N A;  5EEA A;  1MDM B;  2M2E A;  3WTV C;  4KIB A;  4PFP A;  2FXA A;  5HLG A;  4HYE A;  3HOV J;  4J01 A;  1TQP A;  3IKV A;  5IYB J;  2WY8 Q;  4BE2 A;  2DA5 A;  2VI6 A;  2LLK A;  2WB1 A;  2COM A;  3ZMZ A;  3ZQ7 A;  1VQL I;  1HC8 A;  3HTU A;  2EZL A;  4DYC A;  3MWM A;  3KEY A;  3JAM Z;  3LSR A;  1KYW A;  1RNL A;  1OFC X;  2F4I A;  3BC8 A;  4G7H F;  2DQR A;  3S3O A;  2KIQ A;  3DU5 A;  2UXX A;  1HOM A;  2BVM A;  2HPM A;  1EV7 A;  4QPQ A;  4ZTF A;  2E2H J;  5FLV A;  3HSR A;  4IKF A;  3PQK A;  1TBX A;  1MKM A;  1K79 A;  3C2G A;  4M6X A;  1H0M A;  1KZH A;  3CCV I;  3ML6 A;  4PJN A;  3S14 J;  3HUG B;  2HTJ A;  3HIF A;  4KMU X;  4PK4 A;  3EUH C;  5F08 A;  3H5A A;  5IYD J;  2BYV E;  1DDN A;  2M30 A;  4RAZ A;  4HX4 A;  1MGT A;  2LKS A;  4BH9 A;  3H36 A;  4BJ5 C;  4E6K G;  1PP7 U;  1MJA A;  1R4M B;  2JA8 J;  1W7P D;  3DF8 A;  1HA8 A;  2QEX I;  2AXT C;  1WJB A;  4ENM A;  4FX0 A;  2P6S A;  1XMA A;  2KMU A;  1W1W E;  2X1D A;  3ECO A;  4MQV A;  1U8B A;  5DTD A;  2X6X A;  2V9V A;  4XLA A;  1TNT A;  4A2U A;  2BZT A;  2O0Y A;  2JPC A;  3GVA A;  3C2H A;  3FDY A;  4CZZ A;  3GLX A;  2Z16 A;  3E5U A;  2QM3 A;  4CCO A;  3RI4 A;  5TJJ A;  4ZJZ A;  2CV1 A;  4A3G J;  2EZH A;  4RMN A;  3KP2 A;  5DYM A;  2KJB A;  5KNL A;  3WGH A;  3LWF A;  3MKW B;  3F9K A;  3BJA A;  1IN7 A;  2ZKZ A;  1U0J A;  2L7Z A;  5DCM B;  2G7U A;  2EBI A;  5IP7 J;  4BHB A;  4XL9 A;  3BG6 A;  2DAO A;  3DEU A;  2HS5 A;  3FF5 A;  1R36 A;  4CZC A;  2FUG 2;  1YX3 A;  5TRD A;  4YEJ A;  1PUF B;  1R1T A;  3FKI J;  3NAU A;  1ZHF A;  3HL2 A;  2IGM A;  3HRS A;  1JHH A;  4PSX A;  3MFK A;  4P5O A;  2ID6 A;  2PMU A;  2HEO A;  3DPU A;  1YS6 A;  3OR2 C;  2A07 F;  3GUD A;  3L2C A;  3FBN B;  1KQ8 A;  1LVK A;  4BQN A;  2FX0 A;  4LLL A;  1O4X A;  2R7S A;  1LEB A;  2F5E A;  1OMI A;  1IRZ A;  1W0U A;  3MEX A;  3OIO A;  5J1Y A;  1FJL A;  3L1P A;  2W00 A;  4EGZ A;  2VQH A;  5CQE A;  4CCN A;  2LYC A;  4AYB N;  4A3I J;  3ZMV A;  1TNS A;  4ZYG A;  1OIS A;  2YS9 A;  4A0Z A;  3PL8 A;  3SZG A;  3SDG A;  1T08 B;  1BR1 A;  2H6B A;  2KDZ A;  3CF5 F;  3S3N A;  1H88 C;  1L0O C;  3ASN H;  4JOM A;  4XLE A;  1V5G A;  5CKT A;  2MC3 A;  5E3M A;  2QVO A;  1OLT A;  1G3Y A;  3Q0V A;  1IN8 A;  1NH3 A;  5E17 F;  3DPT A;  1FNN A;  2E34 A;  2W82 A;  1ONV A;  3BT9 A;  3ZN1 A;  4L0Y B;  2EK5 A;  2O61 A;  2L7F P;  3EYY A;  3GLL A;  4PGH A;  3BR0 A;  4BDY A;  4A3F J;  4I01 A;  1ZRD A;  5M3F J;  3ABM H;  5CVJ A;  1XGN A;  4FET A;  3GTP J;  1CQT A;  4BBS J;  1Y39 A;  4Q4Z F;  2HFH A;  2L9R A;  3BJO A;  3CJN A;  4ZYA A;  3R0A A;  2M4G A;  1MMS A;  1HW1 A;  4IQ4 A;  1T6S A;  3V7S A;  4Q5S F;  4A12 A;  2EIL H;  4HST A;  4BY7 J;  3CUQ A;  3TL4 X;  2XDV A;  4ZZL A;  4EV0 A;  5FB2 A;  1VQN I;  3S15 J;  1Z9C A;  1WVR A;  3SXY A;  3ECH A;  3VSK A;  2QBY B;  5FKO A;  5LBQ A;  1VQ7 I;  1A36 A;  5FLX K;  5M5Y J;  1P9Q C;  1W36 D;  1QO0 D;  3HKZ N;  1HLV A;  3SEZ A;  2MC4 A;  3X2Q H;  4AIK A;  2K9S A;  2Z9O A;  4BQO A;  3ABU A;  2WAD A;  1RET A;  4G6Q A;  2VUM J;  1JKO C;  2HWV A;  2DOF A;  4HF0 A;  4OMY A;  2NNN A;  4A3B J;  2DLL A;  2K4J A;  3O8G A;  1E3H A;  3SJM A;  3ERE D;  2FQ4 A;  3P9C A;  4OWR B;  1Z6R A;  2EIM H;  3H9Q A;  4L9T A;  2V9K A;  3IL2 A;  2H8R A;  2UWM A;  1MNE A;  2BV6 A;  2GZW A;  2QQ9 A;  4U0V A;  2E1O A;  4Y4R A;  2HDD A;  2LRD A;  3QYB A;  5F64 A;  3RJP A;  4DIQ A;  1HF0 A;  1BC8 C;  4DYQ A;  2YR2 A;  4AC0 A;  4LJZ F;  3GTJ J;  3H0D A;  4BNC A;  3TDZ C;  2VN2 A;  1APL C;  1TC3 C;  4Z6Y A;  1GXQ A;  3I5U A;  3TQN A;  3PIP F;  1B72 A;  5A2Q Z;  2LOO A;  2H09 A;  3EDP A;  2PI0 A;  3LA2 A;  3O8H A;  4NB5 A;  2J5P A;  2XIG A;  2X0L A;  1VQ8 I;  4CIC A;  1N78 A;  4FAS D;  3I4N J;  3K7A J;  1YW9 A;  2A6E F;  2F5C A;  3K9T A;  2WY7 Q;  2NOG A;  1LE8 B;  1A6Q A;  1X4O A;  3CLO A;  1LDD A;  2PJR B;  1U8R A;  3ASO H;  3BTJ A;  4M73 A;  2R4G A;  1L3L A;  4QLC U;  4PJL A;  3IAM 2;  3ZMU A;  2H94 A;  5CVV A;  2XAH A;  2R7F A;  1YHQ I;  2VPR A;  2YU3 A;  3H3Z A;  4BAC A;  2O5R A;  3MCZ A;  2CFX A;  4JK1 X;  5HS9 A;  5BS6 A;  3C18 A;  1XB4 A;  1LPQ A;  2ZJP F;  4Y52 J;  1IRX A;  2JA2 A;  5CVR A;  4UXN A;  2GIV A;  3HOT A;  2L54 A;  2X51 A;  2MBF A;  4AUX A;  1Z67 A;  3OYI A;  2DMT A;  2IA0 A;  3PFI A;  4KIS A;  5LGT A;  5M5X J;  3A1Y A;  3G1M A;  2X85 A;  4CYC A;  2Y30 A;  2P5V A;  1AU7 A;  2XF7 A;  1REP C;  1KQ9 A;  3IWZ A;  5B5E C;  4DQ2 A;  2X1E A;  3N05 A;  2KZG A;  3QOD A;  2CV2 A;  3IH3 A;  3JRD A;  2ZCW A;  1XS9 A;  4M6V A;  1ORK A;  4M71 A;  3FXL A;  3BWG A;  2NS0 A;  3LAJ A;  3S1M J;  2GWR A;  5BOX A;  5D5W B;  2A6H F;  1O7F A;  4PCQ A;  3E1S A;  4XK4 A;  3VDX A;  4FT8 A;  1SMY F;  1W5C C;  3HOZ J;  3LL7 A;  5JVT A;  2CH0 A;  4OOI A;  4OAY A;  3ZQF A;  3MVP A;  2R3S A;  2XUB A;  4W1U A;  2I10 A;  3BR1 A;  5HOD A;  3HOY J;  3M1E A;  3I59 A;  4ENK A;  2E2J J;  1I6H J;  3I3L A;  2LC2 A;  4XQF A;  1RIO H;  3FXU A;  1P6R A;  1WWX A;  2DW4 A;  3DQV C;  5FGM A;  1JGS A;  2V6C A;  1JXS A;  4A5N A;  2IGN A;  3Q9V A;  3J81 Z;  5H6R A;  3GBG A;  4IHT A;  2P5K A;  3LSM A;  2WV0 A;  4B3A A;  1LDJ A;  2A69 F;  1YLF A;  1JI8 A;  1UAA A;  1IUF A;  2PN6 A;  2K3P A;  5C4J J;  3H92 A;  4O5V A;  2RQQ A;  3DXJ F;  4B09 A;  1R7J A;  3V42 A;  1G59 A;  1IGN A;  3HOW J;  3S16 J;  1YG2 A;  3E6M A;  4V2G A;  1MD0 A;  4BY1 J;  4LD5 A;  3QP6 A;  1J09 A;  4II3 A;  2VB6 A;  2ZSH B;  5L3G A;  3F6V A;  3BZC A;  2LH9 A;  3ZMS A;  4JBA A;  1P7J A;  4I6Z A;  3CCM I;  5FRO A;  3BPX A;  3NWT A;  3A2K A;  4E7L A;  2NXN B;  5HNH A;  2MD0 A;  2WTE A;  3CJT B;  2Z1D A;  4GRI A;  5J1U A;  3CJQ B;  1TWG J;  1W5S A;  2ID3 A;  2LG4 A;  2X4H A;  4B43 A;  5K5O A;  1SFU A;  1BC7 C;  1VQ4 I;  2QYO A;  1R00 A;  2QKM B;  3DKW A;  3BTC A;  1J5Y A;  1FTT A;  3V8J A;  2HKO A;  3FMQ A;  4XBF A;  4BL0 B;  3JRB A;  3DTK A;  3HKZ A;  1YRN A;  3J80 Z;  2E36 A;  5HDN A;  4G12 A;  3HDD A;  3I64 A;  3PUF A;  1Y56 A;  3BZK A;  4M3E A;  4CA0 A;  3GZN B;  3W3C A;  1Y0N A;  4F93 B;  3UKG A;  1T2K A;  1ETW A;  5CQG A;  1ZR4 A;  4U88 A;  1FLI A;  1TWF J;  3E5X A;  1X2M A;  2MGQ A;  3A0H C;  4EEF G;  1VQO I;  1WJA A;  2NAZ A;  2O8K A;  1U6G A;  2AO9 A;  2ELK A;  4EJO A;  3BZ6 A;  1OQY A;  5C4X J;  4XOR A;  2QEN A;  1ETQ A;  1X1B A;  4ITV A;  1SD4 A;  4Q48 A;  2Z3Y A;  2CQK A;  3B02 A;  2J5O A;  4GO1 A;  3DV8 A;  2ZNZ A;  2O7O A;  1XN7 A;  1B59 A;  1BI0 A;  2ESN A;  1JJ8 C;  2QWW A;  4I0B A;  2Q2E A;  2X6W A;  4B47 A;  4YG2 F;  2R7Z J;  1Q1V A;  2ELJ A;  2EA2 A;  1QU3 A;  3K1P A;  3OSF A;  1BOA A;  1FOX A;  3HPG A;  3PQJ A;  2KL4 A;  2K85 A;  4ANJ A;  1WI3 A;  4X0G A;  2E5Z A;  3A03 A;  2OD5 A;  2KRH A;  2I8D A;  3W2V A;  3LOC A;  2IPQ X;  2M9H A;  4F92 B;  4KUM A;  1LE8 A;  4HA8 A;  1TT5 B;  2HXO A;  3L9F A;  1K6O A;  2DK5 A;  5ILS A;  2MA3 A;  1J59 A;  2MSY A;  2X9D A;  4HZF A;  4IVN A;  3KZY A;  2IVM A;  2F5D A;  1OYI A;  5H20 A;  1W0T A;  4HG2 A;  1MJ9 A;  3H5R A;  4R79 A;  4QTR A;  4N0B A;  2Y9Z A;  2H1L A;  2KRF A;  2ZJQ F;  2PJR A;  4B48 A;  2FMY A;  2KP6 A;  1STZ A;  2EFQ A;  1HKQ A;  5EGO B;  2XAF A;  3HGY A;  3RYP A;  3RIR A;  3OYN A;  4FCY A;  3LMM A;  2XF5 A;  2JRM A;  3VOD A;  4P96 A;  2XSJ C;  4UNO A;  3JW4 A;  3RPU A;  4ESJ A;  1YJN I;  2HZT A;  3FBI B;  4M3B A;  4RM3 A;  4IPA A;  3UNG C;  1IV6 A;  2MLK A;  2DCE A;  1W7P A;  3FXK A;  2HQR A;  2BBY A;  1K61 A;  3VPR A;  1ON1 A;  1TQM A;  2KLO A;  5HLI A;  2B63 J;  3QOE A;  1GHC A;  4I09 A;  1ZQ3 P;  2WB1 N;  1ZN2 A;  3LQR A;  3GTM J;  1JT0 A;  2FBK A;  1YI2 I;  1QVT A;  4O6J A;  2B7E A;  2JRT A;  4FE7 A;  3TW6 A;  2L9N A;  2WA0 A;  3IH2 A;  5HS8 A;  4S05 A;  1XCB A;  1XSD A;  1EA3 A;  1G8X A;  3RKY A;  2CV0 A;  4MO7 A;  4CHU A;  2DTZ A;  5FJ8 J;  3MN2 A;  4LG3 A;  5E3N A;  4RB1 A;  2VJ4 A;  1TWH J;  4L5I A;  3G73 A;  4HSR A;  3CO6 C;  2VKE A;  2Y0M A;  1W36 C;  4V2F A;  1UEL B;  2DFI A;  3SFZ A;  1LQ1 A;  1FZP B;  3OS2 A;  4XRM A;  3K70 C;  1RC9 A;  1FMV A;  1DP7 P;  1B1B A;  1QA6 A;  1QHG A;  1X19 A;  3FIS A;  3TOA A;  2NRA C;  1LFU P;  1LFB A;  1OR7 A;  2O8X A;  3C7J A;  4KMF A;  1FP2 A;  1FYL A;  2BXY A;  3BG7 A;  1BW5 A;  3DLL F;  1ZG1 A;  2JUG A;  4XKB A;  2RQP A;  4IL6 C;  4CGZ A;  2IP2 A;  1ZLK A;  2V1N A;  2KIF A;  2R7Q A;  4ZDO A;  5DEQ A;  4B4C A;  5J4V A;  4L18 B;  4QIW N;  2RKH A;  3Q0U A;  4AVP A;  3CMA I;  5HNF A;  2L9V A;  1XX5 A;  4IHX A;  2F5V A;  3K2Z A;  2HOA A;  4AIH A;  1HW5 A;  2W85 A;  3ESW B;  1R71 A;  1VQP I;  4HQM A;  4I7H A;  3KLN A;  2YU9 J;  1MSE C;  3BPV A;  1BL0 A;  5FFZ A;  1Q1H A;  3ERM A;  3NWS A;  3NEU A;  2XAJ A;  1B4A A;  2IGO A;  4FTH A;  2V6E A;  1VQM I;  5F0F A;  5D5U B;  4MEY F;  1F36 A;  2W84 A;  1K4S A;  4RAF A;  2OV7 A;  2XKO A;  3DFG A;  2K5C A;  5L3D A;  5CPR B;  3GTQ J;  3C2B A;  5L3F A;  5GTI C;  3FXM A;  3QWL A;  2CQX A;  1CGP A;  1BIB A;  2A6T A;  2IXS A;  4B1R A;  2DMP A;  1ZK8 A;  2DYR H;  1DGR M;  1IO2 A;  4BKX A;  1HCR A;  3WTX C;  1TP4 A;  1WPK A;  4P1W A;  1NG7 A;  1WSU A;  5F04 A;  3BRO A;  3BCA A;  5EZG A;  5F27 A;  1U78 A;  1FBQ A;  4CSW A;  1RES A;  4D7M A;  2A5Y B;  3ZR8 X;  3HPH A;  1XMX A;  1IXC A;  3PSF A;  1IN6 A;  1R4N B;  3CES A;  3QU3 A;  3CCQ I;  1OR7 C;  4HX8 A;  1R58 A;  4JX4 A;  1ZRC A;  2LBF A;  2ZSI B;  3SZT A;  3BQY A;  5L3E A;  2GIZ A; 
#chains in the Genus database with same CATH homology
 2H27 A;  4HLY A;  1XGO A;  4RAY A;  3BDD A;  2EV6 A;  4L0Z B;  3O6B B;  4RB2 C;  3R0J A;  3IHU A;  4RS8 A;  3R6S A;  1W5T A;  4KDP A;  4ASN A;  2RV8 A;  4MTE A;  3NQO A;  3RKW A;  3WTZ A;  1UST A;  4NQW A;  2PEX A;  1HKS A;  2Y48 A;  5ED4 A;  2Q0O A;  3L7W A;  4UHT A;  2VBY A;  3HHH A;  1XCV A;  1FBS A;  1F1Z A;  5L3C A;  1T0F A;  5LLQ A;  1O3S A;  1P4X A;  4M72 A;  3V8L A;  3T0Y A;  5DUK A;  1UB9 A;  3O3K A;  1YW8 A;  2HGC A;  4G8X A;  2YSR A;  4XRF A;  2P7V B;  5DCF A;  1PDN C;  2P6T A;  2PMH A;  2XAQ A;  1V3F A;  4EJW A;  1DPR A;  2XKP A;  1YYV A;  5ILV A;  3F3X A;  2CO5 A;  3NRV A;  3ELK A;  3LQQ A;  3WOD F;  1J75 A;  4FHT A;  2OZU A;  4HLX A;  5FLX Z;  1B9M A;  2M5W A;  3C1D A;  3CUQ C;  3GZ6 A;  5AIP A;  2C6Y A;  2ZME A;  5LGN A;  2FML A;  4M74 A;  2VBW A;  3D5L A;  3KLO A;  4N9I A;  3B73 A;  5K1Y A;  4HF2 A;  3K0L A;  2L4A A;  4U7B A;  1OYW A;  3M8E A;  1LVA A;  1NHA A;  1QZY A;  4UV9 A;  1HSJ A;  4IRH A;  2ZO4 A;  4U0Y A;  1EH6 A;  3GFM A;  2OA4 A;  1UCR A;  1IW7 F;  2FU4 A;  3BP8 A;  3T1B A;  4JQF A;  4PZJ A;  2V79 A;  4HV5 A;  3ULQ B;  4XLP F;  4D0P A;  2HKX A;  2V1D A;  5LHG A;  3J80 K;  2OAZ A;  2ISZ A;  5IT3 A;  5F1R A;  2UZK A;  4WF2 A;  4LG0 B;  2F2E A;  4FX4 A;  2M8E A;  1OYY A;  1LEA A;  4HW0 A;  4WWC A;  4WXH A;  2YX4 A;  3KE2 A;  3G3Z A;  1D5V A;  1G4D A;  1SMT A;  3U9G A;  4R1H A;  4HX7 A;  3KP7 A;  3BY6 A;  1HST A;  3E6C C;  4KT5 C;  2CSO A;  4KFC A;  3CDH A;  2L02 A;  4LK1 F;  1W4M A;  3E6D A;  5AIQ A;  1KU7 A;  1IZ1 A;  1ZG3 A;  3GW2 A;  3TO7 A;  2KIU A;  4EVI A;  2QQA A;  4EM0 B;  3RPQ A;  3KZZ A;  2ZXJ A;  2E1C A;  2D1V A;  3L00 A;  3REO A;  4NHJ A;  1XD7 A;  3VFZ A;  1FYK A;  1KA8 A;  5E1X A;  1LDK B;  2K27 A;  5HOO A;  3GX4 X;  3K69 A;  2LNB A;  3EUH A;  5DCM A;  4BHC A;  2YX7 A;  1ON2 A;  2FF4 A;  5KVR A;  1USS A;  2XRO A;  2W57 A;  3RKX A;  2VBZ A;  3TGN A;  1T38 A;  3MQ0 A;  3U1D A;  4IHS A;  1T39 A;  1ZAR A;  2MH2 A;  5ILU A;  3T8R A;  2WC2 A;  2R7D A;  1FP1 D;  1EH7 A;  2VOD A;  1W7P B;  1FSH A;  3IC7 A;  2HYG D;  2Z99 A;  4XLN F;  1S7A A;  3V7R A;  1O7L A;  2FA5 A;  4L5J A;  3E3V A;  3R61 A;  2VE9 A;  2PG4 A;  4YFN F;  1FYM A;  2YPR A;  2Z5U A;  2ADU A;  1A04 A;  4MTD A;  4AWX B;  3DP7 A;  1U2W A;  4OIO F;  2DQL A;  2JT1 A;  2ZME B;  4KIC A;  3GZ5 A;  1E2X A;  3WTU C;  5D6E A;  2HTS A;  4EJT A;  3MZH A;  2JTV A;  5IT9 K;  2P8T A;  2EV5 A;  1ZRE A;  5K5R A;  1IXS B;  4PGG A;  3HRU A;  1J0R A;  1G3T A;  2P5L C;  5HDG A;  3QP5 A;  4KNY A;  1E17 A;  3KP5 A;  5E1Z B;  4QWQ A;  4MGR A;  4H0E A;  1I6X A;  3AAF A;  5D5V B;  1IF1 A;  5HS7 A;  3ZMT A;  4BHP A;  3COA C;  4PDK A;  1IN4 A;  4IRG A;  4A0X A;  1FWZ A;  3WG9 A;  4UVC A;  1O3T A;  1PUE E;  3GFI A;  2GAU A;  5DDG A;  4M9X A;  3FHZ A;  5A2Q K;  1CF7 B;  2JSC A;  4MNU A;  4BQA A;  2STW A;  4RGR A;  2W24 A;  5ICC A;  4GGG A;  1XSX A;  1SD6 A;  1UFM A;  2G9W A;  1K78 A;  2ZFW A;  3ZPL A;  1D8K A;  4IJA A;  5H6Q A;  3SQN A;  4WXD A;  4AIJ A;  2GXB A;  2LF8 A;  1QPM A;  2XGX A;  1OPC A;  2FRH A;  4OIN F;  3QAH A;  1RZ4 A;  1BBY A;  3I59 B;  2FBI A;  3GXO A;  3KET A;  3KEQ A;  4WXC A;  2RNJ A;  2XAG A;  1X3U A;  3ZN0 A;  1G6N A;  3FMR A;  1XDU A;  4I2O A;  3QU6 A;  5E18 F;  3RDI A;  5HDK A;  4L9J A;  3M9A A;  1HW2 A;  5LHH A;  1F9N A;  3EYI A;  4G7O F;  1QNT A;  3N4M A;  2HYF A;  5CJ9 A;  2W25 A;  2IW5 A;  5E8G A;  3JSP A;  1U5T A;  2LSO A;  2RDP A;  5L3B A;  3I54 A;  3KFW X;  3HHG A;  5D8K B;  1PP8 F;  4EGY A;  2OQG A;  1LB2 A;  1R1U A;  2FNP A;  4A6E A;  3Q9S A;  4G9Y A;  2MLG A;  3L09 A;  4EM1 A;  2VOO A;  5E20 A;  4R8H A;  2CW0 F;  2G7H A;  1J7K A;  2GA2 A;  2L3D A;  2VOP A;  2BGC A;  1ZYR F;  3LA7 A;  3F8M A;  4BAY A;  3GO5 A;  4LLN A;  2L4M A;  3EET A;  4YFX F;  5ICG A;  1LNW A;  3CUO A;  6PAX A;  3ROU A;  5ICF A;  3BOQ A;  1GVJ A;  1P2F A;  3IWF A;  1BI2 A;  1WI9 A;  5FD6 A;  3LAP A;  3U2R A;  4ZZD A;  3M8F A;  4HQE A;  5JHU A;  1K7A A;  2PJP A;  2FSW A;  1WKM A;  1I27 A;  4YFK F;  1SD7 A;  2VON A;  3K1M A;  5LRS A;  2AS5 F;  4ZYD A;  4P9U A;  2EJR A;  2M1B A;  1TW2 A;  3IRQ A;  4RB0 A;  1F5T A;  1YTY A;  3OV8 A;  3WTY C;  3GWZ A;  1P92 A;  3QRF F;  1RUN A;  3F8B A;  3I53 A;  1ZRF A;  1BJA A;  4N9H A;  1HXD A;  1TLH B;  3HTS B;  5EEH A;  3OOP A;  3FXR A;  4BYY A;  2HQN A;  4WX9 A;  2M87 A;  4ZYE A;  2MH9 A;  5CYV A;  1GXP A;  3FMS A;  3TO9 A;  3HSE A;  2D45 A;  1I5Z A;  4GXO A;  3QOP A;  4G7Z F;  4MHG A;  3WGG A;  1ZH5 A;  1S29 A;  4DNC A;  2DO7 A;  2KKO A;  2AXL A;  3CUQ B;  3RYR A;  5F6F A;  1Z7U A;  1IN5 A;  2QQB A;  2EFO A;  2RN7 A;  3BJ6 A;  1MZB A;  1G3S A;  4CXF A;  4M6Y A;  3V7C A;  4LK0 F;  3WGI A;  2OU2 A;  2RVC A;  5E8I A;  3MZY A;  1KU2 A;  1V4R A;  3VB2 A;  1S6L A;  2V1U A;  2LKP A;  4HDV A;  1ZGJ A;  4U0W A;  4A6D A;  3EQL F;  1YQA A;  4TV7 A;  3K1N A;  4LG0 A;  1J9I A;  5LHI A;  1JHF A;  4BXU A;  2MD5 A;  3RTR A;  5ERI A;  2K4B A;  4A0Y A;  1TTY A;  5LGU A;  2PLY A;  4KIF A;  1UHM A;  3IRR A;  3E6B A;  1P4W A;  3VEP A;  2VT2 A;  3WE3 A;  3WTW C;  3MAJ A;  1BN5 A;  2DI3 A;  2DU9 A;  2NYX A;  5FFX A;  1C0W A;  1WQ2 A;  1ULY A;  3CTA A;  1WRJ A;  1FY7 A;  4P9F A;  1SFX A;  4UV8 A;  4G6D A;  4KN7 X;  2M45 A;  3HYI A;  3JAM K;  4ETS A;  4GYG A;  1OKR A;  1I1G A;  4UVA A;  3TOB A;  1KQ0 A;  4LLG F;  1I1S A;  2Q8K A;  3QPH A;  3FWE A;  5JR3 A;  4S04 A;  2CYY A;  4HDU A;  3I58 A;  4KIG A;  4Y17 A;  2F5F A;  3ISP A;  1CF7 A;  4Q47 A;  1FPQ A;  3SZP A;  3Q5F A;  1YIO A;  2IA1 A;  5J8F A;  2DTR A;  3S2W A;  1S3J A;  3F6O A;  3GF2 A;  3F72 A;  2EFN A;  2O03 A;  5CVU A;  1UHW A;  3LST A;  2QZ8 A;  3HRM A;  5D4S A;  2QLZ A;  4OMZ A;  1FT9 A;  4L9V A;  1BI3 A;  2H6C A;  2D2W A;  5D8L B;  2OZ6 A;  3WU0 A;  2ESH A;  2VC1 A;  1EH8 A;  4RGU A;  3GEZ A;  4Y13 A;  1P4A A;  1AWC A;  1R5G A;  4HAM A;  2O3F A;  5IT9 Z;  4Z2Y A;  1XGM A;  5BQT A;  2D1H A;  4KYW A;  5D6F A;  3V8K A;  3F22 A;  4CDG A;  1HQC A;  1H9T A;  2FE3 A;  1U5T B;  3IKT A;  3GFL A;  5DD4 A;  4XSX F;  3KP6 A;  3E97 A;  5DD8 A;  3LA3 A;  1SFE A;  3M7G A;  2GQQ A;  4HF1 A;  2OBP A;  4ON0 A;  3QPT A;  2XAS A;  2E7W A;  3F21 A;  3SHF A;  2VBX A;  5DUI A;  3GFJ A;  2ZNY A;  4G94 A;  1XSV A;  1FBU A;  1BIA A;  3HRT A;  3KCC A;  4WK8 F;  2ISY A;  2TDX A;  1SD5 A;  1ZAO A;  1R22 A;  2XV4 S;  2EFW A;  2FQ3 A;  1R1V A;  3C3W A;  4GYI A;  1FOK A;  3F8C A;  3H3U A;  3O2P E;  2EB7 A;  2LDU A;  1XMK A;  4RGX A;  3J7A O;  2IT0 A;  1ZGA A;  4IF4 A;  1R5H A;  2JPB A;  5CVI A;  2HOE A;  4WCG A;  1Z1D A;  3WTS C;  1YFH A;  1B9N A;  1BM9 A;  3R60 A;  3JTH A;  1TQI A;  2P7C B;  2ZJ2 A;  4F7Z A;  4L9N A;  4EJV A;  4OIQ F;  2KJC A;  5DV5 A;  1FSE A;  4KN4 X;  3HOS A;  3W6K B;  3WTT C;  5JFR A;  1QBJ A;  4MEX F;  3TO6 A;  2E1N A;  3I0T A;  4K2E A;  2PQ8 A;  3T5X A;  1HKT A;  1KGS A;  2ELH A;  1KYZ A;  3FM3 A;  3JSO A;  1SAX A;  2RC4 A;  1Z05 A;  3FXQ A;  1F4K A;  1R23 A;  4CYD A;  3F8N A;  2K7L A;  3I71 A;  3P7N A;  4LB6 B;  1DUX C;  5HLH A;  4M9S A;  2VXZ A;  4HBL A;  4OIR F;  3F8F A;  1RUO A;  4LGW A;  4KA4 A;  4M9Z A;  1BI1 A;  1HBX G;  4EM2 A;  1O3R A;  5LEK A;  1XDS A;  3I4P A;  2B0L A;  3WE2 A;  1IXR C;  4B8X A;  5FD5 A;  4I98 B;  4ZH4 F;  5J6X A;  5E1W A;  2DK8 A;  4E70 A;  2HDC A;  2VC0 A;  2XHK A;  4ZYH A;  5BMZ A;  4UVB A;  5CLS A;  5KK1 A;  2BEO A;  2PFB A;  5JI6 A;  1Z6T A;  1O57 A;  2STT A;  1YS7 A;  2JZY A;  3KP4 A;  2K86 A;  2PBI A;  1ZG5 A;  5LEJ A;  2DT5 A;  3JTG A;  4IXA A;  4EJU A;  1U3E M;  2EV0 A;  2FNA A;  1O3Q A;  3W6J B;  4YIF A;  5BPI A;  2EWN A;  3TKY A;  2L01 A;  4ESF A;  1T98 A;  4YII A;  1KU9 A;  2VT3 A;  3T8T A;  1QZZ A;  3LFK A;  4MQ9 F;  2E7X A;  4GCV A;  1S8N A;  3N97 A;  3GYH X;  2QBY A;  5J8C A;  2IJL A;  2ZBK A;  2UXN A;  2NNY A;  1J2X A;  1JE8 A;  1KU3 A;  5K5Q A;  5ICE A;  2KIM A;  2ETH A;  1VTN C;  2QUF A;  4IRI A;  5BPD A;  1DPU A;  4OIP F;  3F23 A;  4XSZ F;  2LF7 A;  4Y15 A;  3CO7 C;  1IAW A;  2P4W A;  1TW3 A;  1LJ9 A;  5FO5 A;  3P9K A;  2EFP A;  4I0A A;  1MJB A;  1S7O A;  3E5Q A;  2XVC A;  3ZMD A;  4A5M A;  2HR3 A;  1FC3 A;  3D0S A;  4CO8 A;  3ABT A;  2DPD A;  5AON A;  2CG4 A;  2GA1 A;  3J81 K;  5HVQ C;  1H9G A;  3HSF A;  1FX7 A;  1YO5 C;  4ENN A;  5EEG A;  5D4R A;  3FX3 A;  2WWY A;  2FEZ A;  1XGS A;  3FZV A;  4LFU A;  3R4K A;  1ZLJ A;  4ENJ A;  3FM5 A;  2RGV A;  3VOE A;  2CGP A;  2A3S A;  3KP3 A;  2XRN A;  4OU0 A;  2VE8 A;  1G3W A;  2V1X A;  5D5X B;  4RB3 C;  4P55 A;  1K78 B;  3TDU C;  5LRR A;  4EMS A;  4O3M A;  1RI7 A;  2DPU A;  4UUV A;  2FOK A;  4LMY A;  1IUY A;  2DBB A;  1QGP A;  1IRG A;  2O6G E;  3HUG A;  2GXG A;  4HV6 A;  2ACJ A;  2CWE A;  1Y0U A;  2A61 A;  3DPL C;  3P9I A;  4AD9 A;  1B6A A;  1IRF A;  4EQQ A;  1YW7 A;  4ESB A;  2Y75 A;  2Z33 A;  2IRF G;  1AOY A;  1D8J A;  2BE5 F;  1U5T C;  4U7D A;  2OQR A;  4RGS A;  1D3Y A;  4LB5 A;  3V4G A;  2K02 A;  1Z91 A;  3KEO A;  4I02 A;  3WU1 B;  2A68 F;  1MDM A;  1QQI A;  2IA2 A;  3ZP5 A;  4HOB A;  2EA4 A;  1ODD A;  2FBH A;  1MDM B;  3WTV C;  4KIB A;  5HLG A;  2FXA A;  4HYE A;  1TQP A;  3IKV A;  2COM A;  3ZMZ A;  3ZQ7 A;  3HTU A;  3MWM A;  3JAM Z;  1KYW A;  1RNL A;  4G7H F;  2DQR A;  2UXX A;  1EV7 A;  3HSR A;  3PQK A;  1TBX A;  1MKM A;  1K79 A;  4M6X A;  1H0M A;  3ML6 A;  2HTJ A;  3HIF A;  4KMU X;  2BYV E;  1DDN A;  2M30 A;  4RAZ A;  4HX4 A;  1MGT A;  4BH9 A;  1PP7 U;  1MJA A;  1W7P D;  3DF8 A;  4ENM A;  4FX0 A;  2P6S A;  1XMA A;  3ECO A;  4MQV A;  2V9V A;  1TNT A;  4A2U A;  2O0Y A;  2JPC A;  3GVA A;  4CZZ A;  3GLX A;  3E5U A;  2QM3 A;  3RI4 A;  5TJJ A;  3KP2 A;  5DYM A;  2KJB A;  3WGH A;  3LWF A;  3BJA A;  1IN7 A;  2ZKZ A;  5DCM B;  2G7U A;  4BHB A;  3DEU A;  2DAO A;  2HS5 A;  3FF5 A;  1R36 A;  5TRD A;  1R1T A;  1ZHF A;  3HRS A;  1JHH A;  3MFK A;  4P5O A;  2HEO A;  2PMU A;  1YS6 A;  2A07 F;  3GUD A;  3L2C A;  1KQ8 A;  4LLL A;  1LEB A;  2F5E A;  1OMI A;  3MEX A;  4EGZ A;  3ZMV A;  1TNS A;  4ZYG A;  4A0Z A;  2H6B A;  1L0O C;  2MC3 A;  2QVO A;  1G3Y A;  1IN8 A;  5E17 F;  1FNN A;  3DPT A;  4L0Y B;  1ONV A;  2EK5 A;  2O61 A;  3EYY A;  4PGH A;  1ZRD A;  4I01 A;  5CVJ A;  1XGN A;  4Q4Z F;  2HFH A;  3BJO A;  3CJN A;  3R0A A;  1HW1 A;  1T6S A;  3V7S A;  4Q5S F;  4A12 A;  3CUQ A;  4ZZL A;  4EV0 A;  5FB2 A;  1Z9C A;  3SXY A;  3ECH A;  2QBY B;  5LBQ A;  5FLX K;  1QO0 D;  4AIK A;  2Z9O A;  3ABU A;  4G6Q A;  2HWV A;  4HF0 A;  4OMY A;  2NNN A;  2DLL A;  2K4J A;  3ERE D;  3P9C A;  1Z6R A;  4L9T A;  3IL2 A;  2UWM A;  2BV6 A;  2GZW A;  2QQ9 A;  4U0V A;  5F64 A;  3RJP A;  1BC8 C;  2YR2 A;  4LJZ F;  4BNC A;  3TDZ C;  2VN2 A;  1GXQ A;  3I5U A;  3TQN A;  5A2Q Z;  2H09 A;  3EDP A;  2PI0 A;  3LA2 A;  4NB5 A;  2J5P A;  2XIG A;  2X0L A;  4CIC A;  1YW9 A;  2A6E F;  2F5C A;  3K9T A;  3CLO A;  1LDD A;  1U8R A;  4M73 A;  1L3L A;  4QLC U;  3ZMU A;  2H94 A;  5CVV A;  2XAH A;  2R7F A;  2YU3 A;  3H3Z A;  3MCZ A;  2CFX A;  4JK1 X;  5HS9 A;  5BS6 A;  3C18 A;  1XB4 A;  5CVR A;  4UXN A;  2GIV A;  3HOT A;  2L54 A;  2MBF A;  2IA0 A;  3PFI A;  5LGT A;  2P5V A;  1REP C;  1KQ9 A;  3IWZ A;  4DQ2 A;  2ZCW A;  4M71 A;  3BWG A;  2NS0 A;  3LAJ A;  2GWR A;  5BOX A;  5D5W B;  2A6H F;  1O7F A;  4PCQ A;  4FT8 A;  1SMY F;  5JVT A;  4OOI A;  2R3S A;  2XUB A;  3M1E A;  3I59 A;  4ENK A;  1RIO H;  1WWX A;  1P6R A;  2DW4 A;  3DQV C;  3FXU A;  5FGM A;  1JGS A;  2V6C A;  1JXS A;  4A5N A;  3Q9V A;  3J81 Z;  5H6R A;  4IHT A;  2P5K A;  2WV0 A;  1LDJ A;  2A69 F;  1YLF A;  2PN6 A;  3H92 A;  4O5V A;  3DXJ F;  4B09 A;  1R7J A;  1YG2 A;  3E6M A;  1MD0 A;  4LD5 A;  3QP6 A;  5L3G A;  3F6V A;  3ZMS A;  4JBA A;  3BPX A;  2WTE A;  1W5S A;  2X4H A;  1BC7 C;  5K5O A;  1SFU A;  2QYO A;  1R00 A;  3DKW A;  1J5Y A;  3V8J A;  2HKO A;  3FMQ A;  4XBF A;  3J80 Z;  5HDN A;  3I64 A;  1T2K A;  4U88 A;  1FLI A;  3E5X A;  2NAZ A;  1U6G A;  4EJO A;  3BZ6 A;  2QEN A;  1SD4 A;  4Q48 A;  2Z3Y A;  2CQK A;  3B02 A;  2J5O A;  4GO1 A;  3DV8 A;  2ZNZ A;  1XN7 A;  1B59 A;  1BI0 A;  2ESN A;  2QWW A;  4I0B A;  2Q2E A;  4YG2 F;  2EA2 A;  3K1P A;  1BOA A;  3PQJ A;  2OD5 A;  2IPQ X;  4KUM A;  4HA8 A;  1K6O A;  3L9F A;  2DK5 A;  5ILS A;  2MA3 A;  1J59 A;  4HZF A;  4IVN A;  3KZY A;  2IVM A;  2F5D A;  1OYI A;  5H20 A;  1MJ9 A;  4R79 A;  4N0B A;  2KRF A;  2FMY A;  1STZ A;  2EFQ A;  1HKQ A;  2XAF A;  3RYP A;  3RIR A;  3VOD A;  4P96 A;  4UNO A;  3JW4 A;  3RPU A;  4ESJ A;  2HZT A;  4IPA A;  2MLK A;  1W7P A;  2HQR A;  2BBY A;  1ON1 A;  1TQM A;  5HLI A;  1GHC A;  4I09 A;  1ZN2 A;  3LQR A;  2FBK A;  4O6J A;  2JRT A;  5HS8 A;  4S05 A;  1XCB A;  1XSD A;  3RKY A;  4CHU A;  4RB1 A;  4L5I A;  3G73 A;  3CO6 C;  2Y0M A;  2DFI A;  3SFZ A;  1LQ1 A;  1FZP B;  1DP7 P;  1B1B A;  3TOA A;  2NRA C;  1OR7 A;  2O8X A;  3C7J A;  4KMF A;  1FP2 A;  1FYL A;  1ZG1 A;  2RQP A;  4CGZ A;  2IP2 A;  1ZLK A;  2KIF A;  5DEQ A;  4L18 B;  2RKH A;  4AVP A;  3K2Z A;  4AIH A;  1HW5 A;  2W85 A;  4HQM A;  4I7H A;  3KLN A;  3BPV A;  5FFZ A;  1Q1H A;  3NEU A;  2XAJ A;  1B4A A;  5D5U B;  4MEY F;  2W84 A;  2XKO A;  3DFG A;  5L3D A;  5L3F A;  1CGP A;  1BIB A;  3WTX C;  1WSU A;  3BRO A;  1U78 A;  1FBQ A;  2A5Y B;  1IXC A;  1IN6 A;  3QU3 A;  4HX8 A;  1ZRC A;  1R58 A;  3SZT A;  5L3E A;  3ZN1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...