4LB5A

Crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
60
structure length
57
Chain Sequence
EIEMRICDYLRRHGRSTVQDIFKELKLEKSTVNRHLYSLQASKQVFKTVKRPVWNLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for Z-DNA binding and stabilization by the zebrafish Z-DNA dependent protein kinase PKZ.
pubmed doi rcsb
source organism Danio rerio
molecule tags Transferase/dna
molecule keywords Protein kinase containing Z-DNA binding domains
total genus 20
structure length 57
sequence length 60
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4lb5A00
1U8RA 2H27A 3KLOA 1YIOA 2HYGD 5CVJA 2RNJA 2MH9A 3RPUA 4KIFA 3MWMA 3EETA 1JXSA 2PMHA 3I59A 3M7GA 1SAXA 5BOXA 1L3LA 4I09A 5LRSA 3C18A 3V7SA 3WG9A 5IT9Z 5E1WA 1IXRC 3BPXA 1Z1DA 4ZYDA 5E17F 1WWXA 1Z7UA 1G4DA 3KCCA 4KFCA 3JSOA 5JR3A 2XUBA 1RZ4A 1O3TA 4LFUA 2DK8A 4UHTA 3W6KB 1YO5C 1P4AA 4AIKA 4HX8A 4O5VA 3O3KA 6PAXA 3HSEA 1XCVA 1MDMA 2QQAA 2DAOA 4G6DA 3EQLF 2Y0MA 4IPAA 1BBYA 5BMZA 1FOKA 2FU4A 5D5VB 1BI0A 3GVAA 3I64A 4ESFA 2OQRA 1KU9A 3HYIA 4LG0B 3DF8A 1QQIA 4BNCA 3T1BA 1HSJA 5FB2A 1IRFA 3EDPA 3HTUA 3LQRA 3KETA 1O3SA 1ZG3A 1S6LA 1WRJA 4GYIA 1HBXG 3CO6C 2VBZA 3TDZC 4P9UA 2M8EA 3N97A 3B02A 3WTSC 2ISYA 4ZYHA 3WTWC 1BIAA 2RQPA 4KA4A 2VC0A 5HLHA 3HSFA 4IJAA 2LSOA 1LDKB 4I0AA 2ZJ2A 2UZKA 2LNBA 1LB2A 2X4HA 3MEXA 4XLNF 2K86A 4YFKF 5HDNA 3GFLA 3RJPA 5D5WB 3FHZA 3ROUA 2O6GE 1I27A 4MQ9F 1X3UA 4A6EA 4G7HF 3JTGA 1S8NA 4U0VA 1Q1HA 2L3DA 2NYXA 2ISZA 2Z33A 5HS7A 2K27A 2QBYA 3H92A 3ZN0A 1IXCA 1Z91A 3ABUA 3DFGA 4YIIA 3F21A 2XAQA 1HXDA 4EMSA 4M6YA 1P6RA 4BH9A 2DO7A 2DQLA 2TDXA 2O8XA 4KN7X 4L9TA 5CYVA 3I4PA 5DEQA 1MZBA 1B6AA 4P55A 1FSHA 4L0ZB 3JAMZ 4M6XA 1G3SA 3FM5A 1SD5A 3L00A 5DCMA 3RYRA 3GW2A 2A6HF 2ACJA 4L9VA 5ILSA 1BM9A 3P9KA 5F1RA 1IN8A 1TBXA 2K7LA 3RKXA 1HKSA 2XAHA 5K1YA 1YG2A 1V3FA 1ZGAA 2GAUA 3DQVC 3Q5FA 4Q5SF 1ZYRF 2M30A 2W84A 1UB9A 1IN4A 2KIMA 4HX7A 5KK1A 1HKTA 4I2OA 3JAMK 4CHUA 3R61A 4LG0A 4U88A 3RPQA 2ZFWA 5TJJA 3GFMA 2YX4A 3HRUA 3SFZA 1LEAA 3ZMUA 2STTA 4OU0A 2Z9OA 5A2QZ 1K78A 2D1HA 4P9FA 3BY6A 2FEZA 4O6JA 1XDSA 4XRFA 1GVJA 5D4RA 4CGZA 4GXOA 1BC8C 3KP4A 2L4MA 4KMFA 3BPVA 5EEHA 5KVRA 1E17A 3LA2A 1IN7A 2DQRA 4WXCA 1J0RA 2VC1A 2EA4A 1IW7F 3B73A 2QWWA 3I53A 3JSPA 3KP3A 4F7ZA 3ZP5A 2EFPA 2QYOA 3ML6A 5AONA 2P7CB 1QZYA 2FF4A 2EV5A 3ISPA 3K1PA 2HR3A 5FD5A 3SHFA 1T6SA 3COAC 3L7WA 4GYGA 4EM0B 5ERIA 2VT2A 3TGNA 5IT9K 1AWCA 2CWEA 3FXQA 2PBIA 4WF2A 2UWMA 2KJBA 2HYFA 3WTZA 3MAJA 3G73A 1J9IA 3WGIA 2P6SA 3L9FA 2NRAC 5HDKA 3IC7A 4BAYA 2L02A 2A61A 2CG4A 1TTYA 2FNPA 2KJCA 3SQNA 3FX3A 1MJAA 3KP2A 2A6EF 5D8LB 1RNLA 4P5OA 3E6BA 4AWXB 2PEXA 3REOA 5AIPA 3O6BB 2OZ6A 3LSTA 5CVUA 2Z99A 2O0YA 1W5TA 4RS8A 1R00A 2QZ8A 4WX9A 1O3RA 4AIJA 2DTRA 4IHTA 3GFIA 1U5TA 1OYWA 2HTJA 5J8CA 4WXDA 3NEUA 1L0OC 1SFXA 3WTUC 1IUYA 1UHMA 4HQEA 1B9NA 2FSWA 2HTSA 2FBHA 4LLLA 3V7RA 4G8XA 2V1DA 2Y48A 1JHHA 1S7AA 1S3JA 3N4MA 3CTAA 1UHWA 2MLKA 3OV8A 1PUEE 3HRTA 5AIQA 1P2FA 4HX4A 1WI9A 1Z6RA 1R1UA 4G94A 3U9GA 1FBSA 3F23A 3FF5A 1B9MA 1YYVA 3QP5A 4HZFA 2Y75A 2FBKA 3GX4X 2EA2A 1DP7P 4LD5A 1FLIA 2W25A 3R60A 3ELKA 3I71A 2MBFA 1QGPA 2Q2EA 3WU0A 2EJRA 2A68F 1I5ZA 1YFHA 2FE3A 5JVTA 4XSXF 5LEJA 5CLSA 2R3SA 5H6QA 4G9YA 5LLQA 4B09A 4S05A 2DK5A 3KZYA 4L0YB 1FZPB 2V79A 4M9SA 5DV5A 3GF2A 3TDUC 1PDNC 2DBBA 3U2RA 1TQMA 3TOBA 2M1BA 2ZKZA 3RIRA 1RUOA 4A2UA 2O61A 2RKHA 4CO8A 4CYDA 1V4RA 3KLNA 1RI7A 3VB2A 4DNCA 1G3WA 4ZYEA 1O7LA 1XB4A 3LFKA 4EM1A 1CF7B 1BIBA 4A12A 4RB2C 4S04A 4A0ZA 3T0YA 2L54A 3HSRA 2JTVA 4K2EA 2EK5A 2EFQA 1O57A 2JPCA 2E1NA 1GXPA 3F22A 2HS5A 2KIUA 4HYEA 3WGHA 1ZRDA 1J5YA 5E18F 5DYMA 1U78A 3DP7A 2EV0A 3GLXA 1GHCA 3RI4A 4OIQF 2C6YA 3KFWX 2DLLA 4U0WA 4IHSA 3BZ6A 2F5CA 1T2KA 5F6FA 5HLIA 3R4KA 4ESJA 3I54A 4HA8A 3DXJF 1SFEA 1S7OA 3ZQ7A 1TNTA 4LLGF 4WK8F 3WTTC 2L01A 1DUXC 2LF8A 4OMZA 1J2XA 4HQMA 3ZMDA 1B59A 3F8FA 3IRQA 4ZYGA 4EJWA 1E2XA 2ZNZA 2CFXA 1KA8A 3CUQA 3L09A 2OD5A 2IRFG 1MGTA 3VEPA 2HFHA 4ASNA 1SMYF 4H0EA 4AD9A 1Z9CA 3QU6A 1C0WA 2B0LA 2QENA 2GQQA 1O3QA 4FX4A 3V8LA 4LLNA 3C3WA 1R5GA 2PFBA 4KICA 2FA5A 5D6FA 3TO6A 3PFIA 4XSZF 4RB1A 2ESHA 1TW2A 3F8MA 2A69F 5F64A 1IXSB 2BYVE 3M8FA 4UUVA 2VT3A 2EFNA 4MEYF 2YR2A 4HDUA 1ULYA 5L3DA 1TQPA 2KKOA 2R7FA 3RKWA 4YG2F 2M5WA 4UNOA 4I02A 1HW2A 5JHUA 3DPTA 3FMRA 1T0FA 2W24A 1D8JA 5CJ9A 3F8BA 4HV6A 3GO5A 2PI0A 3DKWA 1U5TB 3IHUA 5ICGA 3NQOA 2VOPA 4PZJA 3K0LA 3KP6A 3V8KA 1BI2A 2OA4A 1D8KA 4A5MA 5LBQA 1JE8A 1SFUA 4ETSA 5L3BA 1R1TA 3E5QA 1OYYA 2IA0A 4GCVA 2DPDA 2V6CA 3QU3A 1KQ9A 4RGRA 3EYIA 1FYMA 5D6EA 2F2EA 4PGGA 3K1MA 2HZTA 3M1EA 1R22A 3BROA 1YW9A 1QO0D 4KUMA 1ZRFA 1QBJA 3HIFA 3FZVA 2YU3A 1RIOH 2RDPA 1LEBA 1ZGJA 2IJLA 2P5VA 2GXGA 1XSXA 3KEOA 1YS6A 3MZYA 2IVMA 1U3EM 1FBUA 2RC4A 1FNNA 2V9VA 1AOYA 1OYIA 1FSEA 2Z5UA 2XAJA 4Y15A 3J80Z 2XHKA 1K79A 2ZMEB 5DD4A 4L5JA 2P4WA 3D5LA 1XCBA 1OR7A 2XKOA 1NHAA 5HS8A 4R8HA 4RAYA 2YSRA 4IVNA 4P96A 2ADUA 3QP6A 1FWZA 4YFXF 2CO5A 2FXAA 1XSVA 3C1DA 1FP2A 5HOOA 1QZZA 2XAFA 2CW0F 1SD4A 1W7PD 4MNUA 2VONA 1CF7A 1MKMA 1T39A 3Q9VA 1G6NA 4HV5A 5D4SA 3LA3A 2D1VA 4L18B 1STZA 1JGSA 2G7HA 1A04A 1JHFA 2HDCA 3MQ0A 5DDGA 4MQVA 2XV4S 1VTNC 1BI3A 3BJAA 2G9WA 1USTA 4RB0A 3BWGA 3MCZA 2UXNA 2FRHA 3QOPA 5ICFA 3OOPA 1BI1A 1YLFA 1YW8A 2XAGA 1XGSA 3CO7C 5HLGA 2WWYA 3BJOA 2PN6A 2RV8A 2XVCA 4EV0A 4D0PA 3GUDA 4QLCU 4EJVA 2XRNA 3HHHA 2HKOA 5LHGA 3DPLC 3DV8A 2DU9A 2IT0A 2VBXA 2HQNA 3K9TA 4PGHA 1FX7A 3P9CA 4LJZF 3V4GA 3GXOA 2FNAA 2J5PA 2KIFA 2VBYA 3WTVC 2XGXA 2ELHA 2GA2A 4G7OF 2LDUA 4CICA 2NNYA 2RVCA 1KGSA 5DD8A 2ZCWA 3P7NA 4CXFA 2QM3A 4EGYA 2PLYA 2CYYA 3S2WA 5ILVA 2STWA 5IT3A 1ZH5A 1K78B 3R6SA 2QVOA 4I01A 5DCFA 2E1CA 1H0MA 2OZUA 1UFMA 3F8NA 4OINF 1BOAA 3ECHA 3G3ZA 4BQAA 3QRFF 5D5XB 1DPUA 1F4KA 4O3MA 2BEOA 1B1BA 5D8KB 5E8GA 5ED4A 5H6RA 5ICEA 1I1GA 3GFJA 2WTEA 3J81Z 2HGCA 1J59A 4EQQA 1FY7A 3TO9A 2OBPA 3FMQA 3E97A 2PMUA 4OOIA 4E70A 5JI6A 1W5SA 4YFNF 5FGMA 2V1UA 3IRRA 4HF1A 3KE2A 2RGVA 4AIHA 1ON2A 2W85A 3TKYA 2QQBA 5EEGA 1H9GA 1XGMA 3CDHA 2Q0OA 3E6DA 1MDMB 1GXQA 4IRIA 1B4AA 1Z05A 3FWEA 1BN5A 2OU2A 2BE5F 5DUKA 1FP1D 3CJNA 4N9IA 4WCGA 1U2WA 4OIRF 4ENKA 2H09A 4RB3C 1OMIA 1D3YA 3BJ6A 1KU3A 4N9HA 1O7FA 1W7PB 4NHJA 2VN2A 3WGGA 1Y0UA 2P6TA 1FBQA 1LVAA 1KU2A 4L9JA 5LGUA 1ZARA 4HLYA 4ZH4F 4Q47A 5ICCA 3WODF 5DUIA 3TOAA 4KN4X 1USSA 2GXBA 5H20A 1FYKA 3E5UA 4Y13A 3GYHX 3WE3A 3MZHA 4EJTA 5A2QK 2A07F 1HW1A 3J7AO 4A0YA 4WWCA 5LGTA 5BPIA 4JQFA 3J81K 1K7AA 3ZPLA 5TRDA 4HW0A 3ZMSA 2XROA 4BHCA 1R36A 2DPUA 4OIPF 3I58A 1HW5A 4ZZDA 2BBYA 1KYZA 5J6XA 2YPRA 3LAPA 2E7WA 2WC2A 2JZYA 5FFZA 4XLPF 3WU1B 1SD6A 3I5UA 2ETHA 2ZBKA 4EM2A 3KZZA 1ODDA 2F5FA 5CVIA 1TNSA 2OAZA 5ILUA 3M9AA 5DCMB 2WV0A 4R1HA 1U5TC 5L3CA 1R7JA 1OPCA 4M9XA 4BHPA 3LQQA 3WTYC 2CSOA 2A5YB 3QPTA 1ZLKA 3GZ6A 3PQJA 4AVPA 4Q4ZF 3Q9SA 3NRVA 1P92A 1HQCA 4G7ZF 1CGPA 4IXAA 1Z6TA 1DDNA 2F5DA 1HSTA 5LRRA 2QUFA 3J80K 1ZRCA 3TQNA 3BDDA 1WQ2A 2M87A 4YIFA 2FMLA 3HOTA 1F1ZA 2JPBA 3K2ZA 1MJBA 4HOBA 4UV8A 3HOSA 4M71A 3ULQB 1XDUA 5CVVA 3E6CC 4I0BA 4CZZA 3VOEA 2IP2A 1J7KA 3ABTA 2IA1A 4LGWA 4G6QA 1R58A 1MJ9A 1ONVA 3BP8A 5K5OA 4MTDA 4NQWA 5FLXZ 2LF7A 2NS0A 1W7PA 1G3TA 4DQ2A 3AAFA 2VOOA 2ESNA 1W4MA 1OKRA 3RTRA 1YTYA 4Q48A 3F3XA 2GZWA 4KIGA 4LB5A 4MGRA 5FO5A 2ZMEA 5J8FA 2VBWA 1XN7A 3SXYA 1IN5A 4U0YA 5K5QA 3IKTA 2L4AA 2K02A 1ZREA 2M45A 3KP7A 2HKXA 3T8RA 3DEUA 3GWZA 3BOQA 3D0SA 4KMUX 5JFRA 2PG4A 4U7DA 4M73A 1I1SA 1IZ1A 4LMYA 3JTHA 1T38A 2GIVA 1IN6A 4GGGA 1SMTA 3GEZA 5LHHA 4JBAA 3ZMTA 3TO7A 5BS6A 2D45A 2A3SA 2XKPA 2Z3YA 4LK1F 4MHGA 4UVAA 3HRMA 2EWNA 4I98B 4A0XA 1FC3A 3CLOA 4HAMA 2P5LC 4PDKA 5E20A 2NNNA 5L3FA 2DI3A 3V7CA 4RGUA 5HS9A 3LA7A 1IAWA 2F5EA 1LNWA 2ZO4A 1K6OA 4EVIA 1XMKA 2G7UA 2MLGA 2D2WA 2K4JA 1XMAA 1FT9A 1ZLJA 2EFWA 4L5IA 1J75A 4ZZLA 2HQRA 4Z2YA 5L3GA 1LDDA 3K69A 5E1XA 4FT8A 1WSUA 3E5XA 2CQKA 2EV6A 3K1NA 5LHIA 1KQ8A 2H94A 3I59B 4XBFA 4PCQA 3MFKA 3KEQA 2DW4A 3T8TA 5LGNA 1I6XA 2H6CA 5HDGA 2OQGA 4M72A 2FMYA 1TW3A 2O03A 1LDJA 2IA2A 2E7XA 3V8JA 1G3YA 4U7BA 3ZMZA 3CUOA 3I0TA 2GWRA 2JT1A 1FYLA 3QPHA 1QNTA 2XASA 1R23A 3VFZA 4HF0A 3ECOA 3GZ5A 2QQ9A 2GA1A 2FBIA 1P4WA 4BHBA 4KDPA 4JK1X 3C7JA 4LK0F 2BGCA 1TQIA 1PP7U 4L9NA 1BC7C 4UVBA 1P4XA 2V1XA 3PQKA 1KU7A 4ENNA 2FOKA 3FXUA 2NAZA 4I7HA 2IW5A 3IWFA 4TV7A 1YQAA 2UXXA 3E6MA 2K4BA 5CVRA 3HHGA 3H3ZA 4OIOF 2EB7A 1SD7A 2P7VB 4ENMA 5D5UB 3CUQB 5BPDA 4FX0A 2ZXJA 4NB5A 2Q8KA 3ZN1A 4EJOA 4ENJA 3FMSA 3U1DA 3FXRA 3WE2A 2H6BA 1R1VA 5FFXA 1PP8F 4M74A 5BQTA 3HRSA 2DFIA 4RGXA 3HUGA 1ZG1A 2P5KA 2MA3A 1EV7A 2HWVA 4BYYA 3H3UA 1EH6A 4A5NA 4MTEA 3CUQC 2CGPA 1ZG5A 4GO1A 1T98A 3R0AA 1ZN2A 1IF1A 2COMA 1MD0A 1KQ0A 4EGZA 3E3VA 5FD6A 1REPC 3ZMVA 4M9ZA 2MD5A 3KP5A 3VODA 1LJ9A 4KNYA 3IL2A 5FLXK 1XGOA 3P9IA 4IRHA 3F72A 4ON0A 2BV6A 4UV9A 3QAHA 5E1ZB 2PJPA 4HDVA 2J5OA 2HOEA 5LEKA 2PQ8A 1DPRA 2DT5A 4N0BA 1ZAOA 4KYWA 2X0LA 3F6VA 1F5TA 4HF2A 4A6DA 2HEOA 1F9NA 4Y17A 2KRFA 3JW4A 2YX7A 4FHTA 2VE9A 1U6GA 2LKPA 4HLXA 1HKQA 2W57A 1D5VA 4UXNA 3L2CA 1ON1A 2IPQX 2MC3A 2FQ3A 5HVQC 4ESBA 3T5XA 2VODA 1R5HA 2QBYB 3FM3A 1XD7A 3M8EA 4B8XA 3ERED 3IWZA 4HBLA 1YS7A 1EH7A 2JSCA 1XGNA 4WXHA 1BJAA 1ZHFA 3LAJA 4OMYA 4UVCA 4RAZA 1UCRA 3LWFA 2XIGA 4QWQA 1FPQA 3WTXC 3F6OA 2AS5F 2P8TA 3IKVA 2QLZA 3R0JA 4RGSA 1S29A 3RYPA 4R79A 3SZPA 5E8IA 4EJUA 1WKMA 2JRTA 2VE8A 3HTSB 3F8CA 2EFOA 1IRGA 2MH2A 2AXLA 1EH8A 1YW7A 1QPMA 3O2PE 1LQ1A 5K5RA 2ZNYA 5L3EA 2R7DA 4KT5C 3SZTA 2RN7A 2VXZA 4BXUA 4KIBA 1TLHB 4IF4A 4LB6B 3RDIA 4IRGA 3RKYA 3EUHA 1XSDA 1RUNA 1H9TA 4MEXF 2O3FA 4CDGA 1KYWA 3EYYA 3W6JB
chains in the Genus database with same CATH superfamily
3K2AA 1U8RA 4FE7A 2H27A 2LMDA 2R7UA 4Y4RA 3KLOA 1RKWA 1WH5A 1WH7A 1YIOA 2ID3A 4NQWB 2WY8Q 5E3NA 3S2DJ 2HYGD 3JRGA 5CVJA 2VJ4A 2RNJA 2MH9A 1QRYA 2BZTA 2GOXB 3RPUA 3ZR8X 5GPAA 1WHUA 4KIFA 3MWMA 4XORA 3EETA 1JXSA 2PMHA 3I59A 1FEXA 2FOWA 3M7GA 2VPRA 5B1AH 1SAXA 2OF7A 5BOXA 1L3LA 4I09A 5LRSA 3C18A 3V7SA 3WG9A 3KYLA 2QF7A 5IT9Z 3HGGA 4PSXA 5E1WA 2E1OA 4JP0A 5CQEA 4V2FA 3ERMA 1IXRC 3BPXA 3S1MJ 1Z1DA 2DA2A 3G1LA 2QQ8A 4ZYDA 2E36A 5E17F 1WWXA 1Z7UA 3H36A 4XN3A 5CPRB 1G4DA 4M3EA 1WJBA 2RAEA 3KCCA 4KFCA 3JSOA 5JR3A 2XUBA 4FASD 1RZ4A 5EG0A 1O3TA 4LFUA 2DK8A 1YRNA 4UHTA 3W6KB 1YO5C 4PSWA 1P4AA 4B3XA 1DGRM 2DOEA 2IBDA 4QPOA 3L2UA 1EA3A 4AIKA 4HX8A 3Q0VA 4O5VA 3O3KA 6PAXA 2R7SA 1TWAJ 1TWCJ 1HA8A 3S3MA 3HSEA 2KPMA 1XCVA 1MDMA 2QQAA 2DAOA 2EZLA 4G6DA 2Y9YA 3EQLF 2Y0MA 1JUSA 2NOJB 3RZDJ 4IPAA 3VDXA 1BBYA 2M3AA 5BMZA 1FOKA 1R4MB 2FU4A 2IGNA 5D5VB 5F08A 1BI0A 2DXIA 3GVAA 1FIPA 3I64A 1TWFJ 4ESFA 2OQRA 1KU9A 3HYIA 1ZQ3P 3DF8A 1QQIA 4LG0B 4BNCA 2HOSA 4IKFA 3T1BA 1HSJA 1R49A 3AG3H 2W00A 1WGXA 3DTEA 3FXJA 5FB2A 5LFAA 1IRFA 1D0YA 1V54H 1EKEA 3H35A 3EDPA 2HQ5A 4PUSA 4YELA 1ERDA 1XG1A 4DZJA 3HTUA 1IRXA 3LQRA 3KETA 1O3SA 4DIQA 3MZ8A 1ZG3A 1S6LA 1WRJA 2H1LA 4GYIA 1HBXG 1HF0A 1QU3A 3IV5A 3IH3A 2XGEA 3CO6C 2HXIA 2VBZA 3TDZC 4B44A 4CCOA 4P9UA 2M0MA 2M8EA 3D1NI 3N97A 3QPSA 3B02A 1X1PA 1I39A 3DU5A 3F9KA 2DMTA 2ISYA 1V5GA 4E7ZA 3WTSC 1D1BA 4ZYHA 3QYFA 2AHQA 4Z6YA 3WTWC 1BIAA 2RQPA 1HCRA 4KA4A 3ABMH 3BQZA 2BW3A 2VC0A 5C3EJ 2CJJA 5HLHA 1ETVA 2DYRH 2CH0A 4BKXA 1VFCA 1U0JA 3PUBA 2QKMB 4QSHA 3HSFA 1N78A 2OTJI 4IJAA 5EDNA 2LSOA 3JRAA 1LDKB 4I0AA 1X1DA 4XICA 3BZKA 2ZJ2A 4BGDA 1VQNI 4IOAF 1WJFA 2BY3A 2UZKA 1SAUA 2LNBA 1ETQA 3K4BA 5IPAA 2R4GA 2X4HA 1LB2A 2X48A 3MEXA 4XLNF 2K86A 2E34A 4BXFA 4YFKF 5J47A 5HDNA 4NC7A 2X1DA 3GFLA 3RJPA 5D5WB 3FHZA 2V9KA 5IP9J 5FJ8J 3ROUA 2O6GE 1I27A 2WB1A 4MQ9F 2F4OB 1X3UA 4A6EA 2M2EA 1JUMA 4G7HF 3JTGA 1S8NA 3NAUA 4F93B 4U0VA 1Q1HA 2L3DA 1Y8RB 4II2A 3VYTB 4GRIA 2NYXA 4HNVA 2ISZA 2Z33A 5HS7A 2K27A 2QBYA 2V6EA 3TW7A 3H92A 1IXCA 3ZN0A 1Z91A 3ABUA 3DFGA 1UG0A 4YIIA 2K9MA 2QKLB 3F21A 5DM7F 2XAQA 4XNFA 3OS1A 2KISA 4V2GA 1HXDA 4EMSA 3A4CA 4M6YA 1P6RA 4BH9A 2DO7A 2DQLA 3K6GA 3GTJJ 2TDXA 4A3GJ 3AG2H 1MSEC 3PM1A 2O8XA 4KN7X 4L9TA 5CYVA 5IYBJ 2LVSA 3I4PA 5DEQA 3HKZN 2Y30A 4NUBA 1XS9A 1MZBA 3FHNA 1B6AA 5JVGF 3BTJA 4P55A 1FSHA 4L0ZB 4XLHA 3DEWA 3JAMZ 4M6XA 1G3SA 1ENHA 3FM5A 3HZJA 1SD5A 3ZQQA 3L00A 5DCMA 1QHGA 3GW2A 3RYRA 1WJDA 1WI3A 5J4YA 2A6HF 4C3JJ 2COBA 2ACJA 2LR8A 2ID6A 4L9VA 5ILSA 1BM9A 9ANTA 5TISC 3P9KA 5F1RA 1JTYA 3DPUA 3QYEA 2MGQA 3HOZJ 1IN8A 1TBXA 2K7LA 2LREA 2EZKA 4CCKA 1OQYA 2F4MB 3RKXA 1HKSA 3K4JA 4LIUA 4BBRJ 2XAHA 5K1YA 2WV1A 2QA4I 1WFXA 1YG2A 1V3FA 1K83J 1ZGAA 3ZQIA 4XR6A 4EEFG 1VQMI 2GAUA 2R7QA 2DOAA 3DQVC 5GAHJ 4JYKA 1LE8A 3Q5FA 4Q5SF 3Q0UA 1ZYRF 2CQ7A 2M30A 2W84A 1UB9A 1IN4A 2KIMA 1FMWA 4HX7A 5KK1A 2WAFA 1HKTA 4I2OA 5IYCJ 1WZ2A 2LG4A 3JAMK 4CHUA 1T0FC 3R61A 4LG0A 4U88A 3RPQA 2ZFWA 1JUPA 5TJJA 3GFMA 2YX4A 3HRUA 3SFZA 4XRMA 2JN6A 2F6CA 4M3DA 1LEAA 5HNFA 4J01A 3ZMUA 2STTA 4OU0A 2Z9OA 4X6AJ 3S1RJ 4DW6A 5A2QZ 1ACIA 1K78A 2D1HA 1UJ8A 2VQGA 4H4KC 4P9FA 5GPCA 4UB6C 4UY8I 3BY6A 2FEZA 4BDZA 1EJ9A 1V5EA 4O6JA 5KHDA 2AXTC 1S9HA 1XDSA 3VYUB 4XRFA 1GVJA 1BW6A 5D4RA 4CGZA 2OJED 4GXOA 5FKNA 3JRBA 1BC8C 3KP4A 1K4SA 2L4MA 4KMFA 4IZZA 3BPVA 1E3OC 3G6EI 5EEHA 1I3AA 2DOFA 5J1YA 5KVRA 1E17A 3LA2A 2CMPA 3LSMA 1IN7A 2DQRA 3PL8A 4WXCA 3B73A 1J0RA 2VC1A 2X51A 2EA4A 1IW7F 2QWWA 3I53A 3JSPA 2WY7Q 3KP3A 4OAYA 1RESA 4F7ZA 3UR3C 3ZP5A 3PIOF 2EFPA 2E2IJ 2GOMA 2QYOA 3ML6A 5AONA 2P7CB 1QZYA 1DU6A 2FF4A 2EV5A 3BT9A 3ISPA 1SVOA 2QCOA 3KZIC 3K1PA 1B72B 4PFPA 1ZTRA 3D5SC 3BZCA 1I6HJ 2HR3A 5FD5A 2R5YA 3MKWB 3SHFA 4E7LA 1T6SA 4RM3A 5EEAA 3G1MA 3COAC 3L7WA 4GYGA 4EM0B 4HSTA 5ERIA 4A3DJ 2VT2A 3CJQB 4DYQA 3MMYB 3B6AA 3TGNA 5IT9K 1AWCA 2CWEA 3TEDA 3SEQA 2YU9J 3FXQA 2PBIA 5E3OA 3CF5F 3C2GA 4WF2A 2UWMA 2KJBA 1POGA 2HYFA 2XSJC 3H5NA 3WTZA 3MAJA 2F5VA 3G73A 1J9IA 3WGIA 2VPLA 2P6SA 1ETYA 3BR0A 4AIDA 3L9FA 4Y33A 1A36A 2E2HJ 2NRAC 3A2KA 5HDKA 3IC7A 1OCPA 4BAYA 1X19A 2JSPA 2L02A 2A61A 2XB5A 2CG4A 1TTYA 2FNPA 1HOMA 2KJCA 3CCYA 1D0XA 2DMPA 3SQNA 2HXOA 4CCMA 3OYAA 1VQPI 3FX3A 4A3MJ 3I4NJ 2CFOA 1MJAA 1XMXA 3PO2J 3KP2A 2A6EF 5D8LB 1W1WE 1LFBA 2EBIA 5IP7J 1N25A 1TC3C 1RNLA 4P5OA 3E6BA 2CUEA 1TP4A 4X1EA 4AWXB 2CQQA 4OWRB 5JHFA 2PEXA 1DGWY 5EZHA 3REOA 1U8BA 5AIPA 2P81A 3O6BB 2OZ6A 3OYMA 2KQRA 4E7JA 3LSTA 1HDPA 4RA2A 5CVUA 2Z99A 5IY5H 2O0YA 1W5TA 4RS8A 1R00A 1W0TA 3A02A 1SEUA 2QZ8A 4WX9A 1SFOJ 3H9JA 1JT0A 3UKGA 3CJTB 1O3RA 4AIJA 1BJZA 2DTRA 1BR1A 4LG3A 4BBSJ 4IHTA 2CW7A 3FKJA 3GFIA 4BU2A 2CUFA 1U5TA 2HVQA 1OYWA 3S14J 2HTJA 5J8CA 4WXDA 3NEUA 3GTKJ 1L0OC 1SFXA 3EUHC 3WTUC 1IUYA 1UHMA 3FXKA 1SVMA 1B9NA 2BW3B 4HNTA 3AKZA 2XPUA 4HQEA 2FSWA 2B63J 2HTSA 2FBHA 3HM5A 1W36D 2XGDA 3X2QH 4LLLA 3V7RA 3M3YJ 4G8XA 2V1DA 2Y48A 4AYBA 2L9NA 1X1BA 3S16J 2L7MP 1FMVA 1JHHA 1S7AA 5M5WJ 1S3JA 2AQEA 3N4MA 1A6IA 3CTAA 3H9QA 1IV6A 1UHWA 2MLKA 3OV8A 1PUEE 3HRTA 5E79C 2LFBA 5AIQA 1P2FA 3AL0B 4HX4A 1WI9A 1Z6RA 1R1UA 4G94A 3U9GA 3I55I 1YIJI 1FBSA 4NDLA 3F23A 1D5YA 3FF5A 2NS8A 1B9MA 1YYVA 1ETWA 2GBYA 2V1NA 2G0EA 3QP5A 2W82A 4HZFA 4DYCA 5CKTA 1M1EB 2Y75A 2IS1A 2FBKA 3P5JA 3GX4X 2EA2A 1DP7P 2R7VA 1R4NB 4LD5A 2IGMA 1FLIA 1VQ7I 2W25A 4I6ZA 1JKPC 3R60A 5FKOA 3DTKA 2CUZA 3ELKA 3WU2C 2A05A 3MD2A 3I71A 4DOZA 2JJ7A 2K40A 3FK7A 1BW5A 3N05A 2R5YB 1E3HA 4PJMA 3BTCA 2MBFA 1B72A 1QGPA 2EINH 2Q2EA 5IOZA 3AG4H 3WU0A 3TP0A 3FXLA 2EJRA 2A68F 1I5ZA 1R5ID 1A35A 1ZK8A 1YFHA 2FE3A 5JVTA 4XSXF 5LEJA 5CLSA 2R3SA 5H6QA 4F91B 3QPLA 4G9YA 2VXDA 1Z3XA 5LLQA 4B09A 4S05A 3ESWB 4J00A 2DK5A 3KZYA 3CC7I 4L0YB 1FZPB 1W0UA 4AYBN 2V79A 3ABLH 1X1AA 4M9SA 5DV5A 3QOEA 3GF2A 3TDUC 3K4KA 4ABZA 1PDNC 2DBBA 3U2RA 3DCFA 5K7FA 1TQMA 4BY7J 3TOBA 2DJIA 2E1MB 2M1BA 1XX5A 2ZKZA 3RIRA 1RUOA 2DT7B 2O7OA 4A2UA 4F3QA 4BE1A 2O61A 2RKHA 1CQTA 3QYBA 5FROA 3AL0C 2K85A 1AHDP 4CO8A 4CYDA 4D7NA 1V4RA 4XK4A 3KLNA 1RI7A 2FJ1A 3VB2A 3CCJI 1Y1VJ 4BJTA 4DNCA 1G3WA 2KFDA 3HDDA 5HLTA 4ZYEA 1R71A 1O7LA 1XB4A 2OCEA 2LOOA 3LFKA 4EM1A 3H0DA 1CF7B 1Y0NA 3E7LA 3K70C 1BIBA 2XB0X 4A12A 4RB2C 2L7FP 4S04A 2PJRB 1T95A 4A0ZA 3T0YA 2L54A 4A3KJ 3HSRA 4UUSA 3HC7A 4XKWA 1H88C 2JTVA 4K2EA 2EK5A 4MIMA 1X2MA 2EFQA 3J7AY 1O57A 2JPCA 2E1NA 1GXPA 2R7TA 3F22A 3DKXA 2HS5A 2KIUA 4HYEA 5HNHA 3WGHA 2HQAA 2VKEA 1ZRDA 1OLTA 1J5YA 3M1CA 2QEXI 1F36A 1Y6IA 3RPUD 5E18F 5DYMA 1U78A 3DP7A 4E4HA 2EV0A 3LMMA 3H9GA 3GMEA 1Y1WJ 3GLXA 1GHCA 3RI4A 2KHMA 2UUZA 3BQYA 1FOYA 4XQFA 3AFHA 3A03A 4OIQF 3VPRA 2C6YA 4IOCF 2XPWA 2LBFA 3KFWX 4C2UA 2DLLA 3A1YA 3PSFA 2XRLA 3ZRGA 4U0WA 4M3FA 1NG6A 4IHSA 3BZ6A 4XN0A 3PNYA 3SYTA 2F5CA 1T2KA 3LL7A 4B43A 4BJ5C 5F6FA 5HLIA 3R4KA 4CZCA 3ZGKA 4XONA 4ESJA 3I54A 4HA8A 3DXJF 2VIXA 3H1CA 2V7FA 1UAAA 1SFEA 1ZR2A 1S7OA 3ZQ7A 1TNTA 4LLGF 4WK8F 3DBLB 4KJZA 3WTTC 2L01A 1OR7C 1DUXC 3SEZA 2LF8A 4OMZA 3HGYA 3BR2A 1J2XA 4HQMA 2V26A 1K61A 3ZMDA 1B59A 2BXYA 5F0HA 4C3HJ 3MVPA 3F8FA 4HSRA 3BTLA 4BE2A 3IRQA 4ZYGA 2O5RA 1OCTC 4EJWA 1E2XA 1GVDA 2DYSH 1MNMC 1VF9A 1S7EA 2CFXA 2ZNZA 1KA8A 4D1QA 2JUGA 3CUQA 3L09A 2OD5A 2LC2A 3PIPF 3M07A 4A3EJ 2IRFG 4A3LJ 1ZR4A 1MGTA 3PNTA 3MKYB 2TCTA 3VEPA 2HFHA 2RNGA 4ASNA 1Z7LA 1SMYF 4H0EA 1GV5A 4AD9A 1MBKA 1XC5A 1Z9CA 1W5CC 3QU6A 1C0WA 2B0LA 2IS6A 2QENA 1MBFA 4NNJA 5FKKA 2GQQA 2R7WA 1O3QA 1MMSA 1E3PA 2CS3A 4BL0B 4FX4A 3V8LA 4LLNA 2DFHA 3C3WA 3OYHA 1R5GA 2PFBA 1P7IA 1Z0XA 3OYNA 3W2AA 1DQUA 4KICA 3JRDA 2FX0A 4FQGA 2FA5A 5D6FA 3TO6A 3PJRA 3PFIA 4XSZF 4ZTJA 4RB1A 2ESHA 2XSDC 2HPIA 1TW2A 3F8MA 2A69F 5F64A 2RREA 1IXSB 2BYVE 2DA3A 1VQ8I 2DMUA 3M8FA 1OCOH 4UUVA 2MFZA 2VT3A 3W2VA 2EFNA 2R7XA 4XLFA 2HI3A 3GTQJ 1WJCA 2YR2A 4MEYF 3PO3J 2E1MC 1ETXA 2BXZA 4HDUA 1ULYA 5L3DA 1TQPA 2KKOA 2R7FA 3RKWA 1UELB 4YG2F 2R7ZJ 3ZQLA 3LSKA 2DMQA 5GP9A 2HVSA 2VLAA 2M5WA 4B48A 3GTMJ 4XKCA 3GLLA 4UNOA 2L0KA 5EF6A 2R92J 4I02A 1HW2A 1VQLI 5JHUA 3DPTA 3FMRA 3RSNA 1T0FA 1OISA 2DMNA 2ZSIB 3CMEI 1U9NA 2W24A 4RAGA 1D8JA 5CJ9A 3HOWJ 3F8BA 3SZGA 4HV6A 2JA5J 3OYIA 3OR2C 3GO5A 2PI0A 2NVXJ 3DKWA 1FJLA 1U5TB 3WG7H 3IHUA 5ICGA 3NQOA 1GV2A 1JKQC 2W4SA 2VOPA 1LKXA 3HEFA 4PZJA 1MSFC 2Z2SB 3HUGB 3K0LA 3BG9A 2I8DA 3KP6A 1TL8A 3V8KA 1BI2A 2OA4A 1D8KA 2Y2ZA 4A5MA 3Q0WA 5LBQA 1JE8A 1YJ9I 3CCUI 5FKLA 1SFUA 4JX5A 1Z21A 4ETSA 5L3BA 1R1TA 3OR1C 3TW6A 3VYSB 3E5QA 1OYYA 2QSGX 2IA0A 4FTHA 2X6WA 2N8GA 2NVQJ 4CUGA 4GCVA 2DPDA 3QODA 1KZHA 3CESA 4E7SA 2MC4A 2V6CA 4N4OB 1BR2A 2FQ4A 4IEJA 4XM3A 4ZJZA 3QU3A 4RLFA 1U9OA 1KQ9A 4RGRA 2IGOA 2LK2A 3CMAI 3OYDA 3EYIA 1FYMA 5D6EA 1VQ5I 3GTLJ 2F2EA 4XKBA 4PGGA 2M7BA 4M3BA 3K1MA 4I76A 5DTDA 5IP6A 2HZTA 3M1EA 1R22A 1A6QA 3BROA 1YW9A 1QO0D 2QSFX 3FBIB 1S5LC 3GBGA 4XRSG 3ABKH 4KUMA 1MBHA 1ZRFA 3ZCOA 3NARA 4IQ4A 3HIFA 1QBJA 4A3JJ 3FZVA 2YU3A 2BVMA 1GLNA 1RIOH 2RDPA 1LEBA 4RAFA 2BY2A 3JREA 3DTIA 2LD5A 1FTZA 5CQGA 1ZGJA 1RKTA 4G6TB 2IJLA 2P5VA 3S3NA 2GXGA 5FLMJ 2W7NA 1XSXA 3GTOJ 3KEOA 1AKHA 2CU7A 1YS6A 4QPQA 5B5EC 3MZYA 3CC2I 1APLC 2IVMA 4CYCA 1U3EM 1GT0C 1FBUA 2RC4A 2R5ZB 1FOWA 1FNNA 2V9VA 1LE8B 1AOYA 1OYIA 3L2QA 1FSEA 4BEHA 2Z5UA 2XAJA 2LKXA 4Y15A 3OIOA 3J80Z 1MNEA 2XHKA 4XKVA 1RETA 1K79A 2ZMEB 5DD4A 2M0CA 3TMOA 4D5FA 4L5JA 2P4WA 3D5LA 5HODA 1QA6A 1XCBA 1R9TJ 3CZ6A 1OR7A 2XKOA 1NHAA 5HS8A 4R8HA 3CMYA 2MSYA 2ZXIA 4RAYA 2YSRA 4IVNA 4P96A 2ADUA 3TL4X 3OYGA 3QP6A 2VQCA 1FWZA 3BG7A 4YFXF 3HOYJ 1UHSA 2CO5A 3E0JB 3DBHB 1MNDA 2FXAA 3DLLF 1UG2A 1XSVA 3C1DA 3CCQI 5KCMA 1IDZA 1FP2A 5HOOA 2MG4A 3VYRB 1QZZA 2XAFA 2CW0F 1DP3A 1SD4A 2V4JC 1W7PD 1QPIA 4MNUA 3JR9A 4FETA 4CYCB 2VONA 4QIWN 5JLWA 1CF7A 2M4KA 1MKMA 2DT6A 4PFOA 3CCEI 4A3IJ 1T39A 3Q9VA 2ZMEC 4L5EA 1G6NA 4HV5A 1P9QC 5D4SA 5F0FA 3LSIA 1T56A 2L5QA 3LA3A 3SJMA 2D1VA 4DYRA 4L18B 3BCBA 2BY1A 1STZA 3G4SI 1BL0A 1JGSA 2G7HA 1A04A 3D5RC 2K9NA 1JHFA 2HDCA 2IAIA 3K10A 3MQ0A 2EZHA 1G8XA 3H0GJ 2UV1A 1KONA 3DKYA 4AC0A 3LNQA 4QTRA 2GLOA 4HPQA 5DDGA 4MQVA 1V5FA 3WHCA 4YEJA 4ZC3A 2F48A 4V19K 4PJNA 3PFYA 3VSKA 2FUG2 2XV4S 1VTNC 4XMYA 4II3A 1BI3A 3BJAA 3DLAA 2G9WA 1USTA 4RB0A 2OUMA 4HNUA 2AQFA 1IO2A 3BWGA 3MCZA 3S15J 5M5YJ 3ASNH 1OJLA 5EGOA 2E35A 3CP8A 2UXNA 2Y9ZA 4XL9A 3W2WA 2FRHA 3NWTA 3QOPA 5ICFA 3MN2A 4D7MA 3HJEA 2M34A 3H5RA 2XDVA 3OOPA 1BI1A 1YLFA 3IAM2 5M3FJ 1YW8A 2XAGA 1XGSA 2ZJQF 2QSHX 3CO7C 4BY1J 3ONQA 5HLGA 5KNLA 2WWYA 1ETOA 2X6OA 2OV7A 3IH4A 3OL3A 3BJOA 3E1SA 4BQNA 2PN6A 2RV8A 2HYJA 2XVCA 4EV0A 3S3OA 4D0PA 2DA6A 3GUDA 2WB1N 4QLCU 4EJVA 1MMAA 2XRNA 4DJAA 1VQ9I 3HHHA 2HKOA 5LHGA 3DPLC 3DV8A 2O8KA 2DU9A 1HC8A 2IT0A 2VBXA 2H1KA 2HQNA 3K9TA 4PGHA 1FX7A 3AG1H 3K4MA 3GTPJ 3P9CA 3HKZA 4LJZF 3O8GA 3V4GA 2PX9A 3GXOA 2FNAA 5B3SH 2J5PA 3HG9A 2KIFA 3Q3SA 1ITYA 2VBYA 4A3FJ 2KDZA 2L9VA 1YOVB 5H2FC 3HOVJ 4LIVA 4BQQA 3WTVC 3S32A 2XGXA 2ELHA 3CC4I 3QQAA 2GA2A 4F55A 4JX4A 4XLCA 4G7OF 2D5VA 2LDUA 2DCEA 4CICA 2NNYA 2RVCA 4UUSB 1MMGA 1ZELA 1JJ8C 1KGSA 5DD8A 4B47A 3VSLA 2ZCWA 3P7NA 5KAFC 5EJCA 4CXFA 2QM3A 2R5ZA 4NC8A 4EGYA 4C30A 2PLYA 3OYLA 3CCRI 2CYYA 3KEYA 3HBLA 1BR4A 3S2WA 3CD6I 5ILVA 1AKHB 2L7KA 2ME6A 4FCYA 2CQXA 2CV1A 2STWA 1F43A 2CW8A 5IT3A 4B3AA 1ZH5A 3DU6A 3PUFA 2VJIA 1K78B 3R6SA 3OOUA 2E60A 2QVOA 4I01A 1NG7A 3IUOA 5DCFA 2E1CA 3DEEA 2XF7A 2OZUA 1T8IA 1H0MA 1UFMA 3S17J 4HG2A 1BA5A 3F8NA 4OINF 5C4XJ 4F92B 4DBQA 1BOAA 3C2BA 3ECHA 3J7ZI 3G3ZA 4BQAA 3QRFF 3GZNB 3H3VK 5D5XB 3H5AA 1DPUA 1F4KA 2EZIA 3LSGA 1MH3A 4O3MA 2BEOA 3L2RA 1B1BA 5D8KB 3K4LA 1VQKI 4IHXA 2E5ZA 5E8GA 3ZOBA 5ED4A 2R7RA 5EG0B 4C3IJ 1AU7A 5H6RA 5ICEA 3ZXSA 3CF2A 1PVEA 3L2WA 1SVLA 2GIZA 2I10A 2B9SA 1I1GA 3OL4A 3GFJA 2Q2EB 2WTEA 2XAUA 1Y8QB 3S93A 3J81Z 2E2JJ 2HGCA 1K6YA 1J59A 2OCCH 4EQQA 1FY7A 3TO9A 1IV8A 4M6VA 5FLVA 4BUPA 2OBPA 3FMQA 3E97A 2PMUA 2H8WA 4OOIA 3NWSA 3MKLA 4E70A 5JI6A 4CA0A 1W5SA 3BR5A 4YFNF 5FGMA 3FXOA 2V1UA 3IRRA 4DBRA 2H8RA 4HF1A 4A3CJ 3ZQCA 2M8GX 4XLAA 3KE2A 4BACA 3OS2A 2IXSA 2PMZN 2RGVA 4AIHA 1MH4A 1ON2A 2W85A 2ELKA 3FKIJ 3TKYA 2L9RA 2ZB9A 2Z16A 2QQBA 4PK4A 4ZYAA 5EEGA 5M5XJ 1QHHD 1H9GA 1XGMA 2DFEA 3CDHA 2Q0OA 3PSIA 3E6DA 1MDMB 1GXQA 2V9PA 4BDYA 4IRIA 4B4CA 1B4AA 1Z05A 3M4OJ 4C2TA 2JK3A 5E3LA 3FWEA 1HLVA 1BN5A 1X58A 1O4XA 3ZQFA 2OU2A 1IRZA 2BE5F 1YRNB 4BQOA 4E7IA 2KLOA 5DUKA 1FP1D 3CJNA 4N9IA 3TP3A 4WCGA 1U2WA 4OIRF 2CQNA 1E0EA 3OMYA 4ENKA 5GAEJ 4XOPA 2H09A 3W3CA 3LSHA 1QVUA 1IGNA 2VQHA 2X9DA 4RB3C 1OMIA 1D3YA 3BJ6A 1KU3A 2R93J 4N9HA 3KX2A 1O7FA 1OCZH 2IS4A 1R6RA 1W7PB 2DA4A 4NHJA 2VN2A 1MW7A 3WGGA 2Z1DA 2HDWA 4Y52J 1Y0UA 2P6TA 2KIQA 2RQQA 2WA0A 1FBQA 2DFFA 3BR3A 1LVAA 1RR8C 3O8HA 1EF4A 1KU2A 4L9JA 5LGUA 1ZARA 3SDBA 2OPTA 4ZH4F 4HLYA 4Q47A 3I3LA 2DODA 3WODF 4F52A 3TOAA 5ICCA 5DUIA 4KN4X 2O9LA 1LPQA 1USSA 2GXBA 4AUXA 2BOLA 5H20A 2DTZA 1FYKA 3E5UA 4Y13A 2R7OA 4CCLA 3GYHX 3OYKA 3LFUA 4XRSA 1H89C 3WE3A 3V42A 3FBNB 3MZHA 4EJTA 5A2QK 2A07F 5J1RA 1HW1A 3G1OA 3J7AO 4A0YA 2K3PA 4WWCA 3OSFA 5LGTA 3OYCA 3WHBA 1RC9A 3I4MJ 1H8AC 5BPIA 4JQFA 3J81K 1K7AA 3ZPLA 5TRDA 4HW0A 2BVLA 3B6CA 2VJ5A 3ZMSA 2M4GA 2XROA 2M7AA 3SDGA 4M3GA 4IL6C 4BHCA 3C2HA 1R36A 2NVUB 4E7HA 2DPUA 4OIPF 3I58A 3RKQA 1HW5A 2EH3A 4AU7A 4ZZDA 2BBYA 1KYZA 2YPRA 5J6XA 3HB9A 2DN0A 3LAPA 1X1CA 2E7WA 2WC2A 3ZQHA 2JZYA 5FFZA 4XLPF 3WU1B 1PJRA 1SD6A 3HPHA 3I5UA 2ETHA 1YX3A 5GTIC 2ZBKA 1T08B 4EM2A 3OYFA 3KZZA 1ODDA 4ANJA 4MO7A 4XLEA 2F5FA 5CVIA 1TNSA 2OAZA 5ILUA 3M9AA 5DCMB 4DZPA 2WV0A 3OSGA 1YJNI 4R1HA 1U5TC 3DWLE 2KDOA 1LUJB 2WADA 5L3CA 1R7JA 4GFBA 1OPCA 2M9HA 2Q1ZB 2OTLI 1FOXA 4LOCA 1WJEA 4M9XA 4BHPA 3LQQA 3WTYC 2CSOA 3BG6A 2A5YB 1IDYA 3QPTA 5J40A 1V55H 3CCLI 1ZLKA 1VNDA 3PQJA 3GZ6A 2VUMJ 4AVPA 4ZDOA 1YE9A 4Q4ZF 3Q9SA 3NRVA 1P92A 3LOCA 2LYCA 1HQCA 2EIJH 4G7ZF 1CGPA 4IXAA 1Z6TA 4S0HB 5F27A 4C9YA 4D5CA 1DDNA 2F5DA 1HSTA 3OIPA 2QUFA 5LRRA 3J80K 1VQOI 3JRFA 1ZRCA 2JA2A 3TQNA 3BDDA 1WQ2A 2M87A 4YIFA 2FMLA 3EPZA 2VI6A 3HOTA 1F1ZA 2CV2A 2EIKH 3EUAA 2E5NA 4ZTFA 2JPBA 3K2ZA 3CLQA 2A6TA 1MJBA 4HOBA 2JVGA 2VKVA 4UV8A 3HOSA 4M71A 2HDDA 3BR1A 3ULQB 2XPVA 1XDUA 2IEKA 3FK6A 2HOTA 1A5JA 3S8PA 5CVVA 3E6CC 4I0BA 4CZZA 4IO9F 1SANA 2IP2A 3VOEA 2NVTJ 2W48A 3RQIA 1J7KA 1X3ZB 1AA7A 1LFPA 2IA1A 3ABTA 4LGWA 4RM2A 5C44J 3JRIA 2VKHA 4G6QA 1R58A 1MJ9A 1IG7A 1ONVA 1SC7A 3OYBA 3BP8A 2F4IA 5K5OA 2YS9A 4MTDA 4NQWA 5FLXZ 4N4NB 1NK2P 2LF7A 1GDTA 4NC6A 3W6VA 2LBFB 2LTPA 2NS0A 1W7PA 1G3TA 1ZGWA 4PJLA 4DQ2A 3AAFA 2VOOA 2ESNA 1WPKA 2HOAA 1BOBA 1W4MA 1OKRA 3RTRA 1XPXA 2NOGA 5F0CA 1JTXA 1YTYA 4Q48A 5LD2C 2K9QA 2A5WA 3LSPA 1VI0A 5C4JJ 1N75A 1UZCA 3OWTA 3F3XA 2GZWA 3LSRA 2NS7A 5K7ZA 4KIGA 4U87A 4LB5A 1IJWC 4MGRA 5FO5A 2ZMEA 5J8FA 2VBWA 3FDYA 1LVKA 1XN7A 3SXYA 1IN5A 4U0YA 2ZJPF 5K5QA 1PUFB 3S2HJ 3IKTA 2L4AA 2PMZA 2K02A 4ITVA 1ZREA 2M45A 3KP7A 3PNVA 2HKXA 4KITB 3T8RA 2MW8A 3U1KA 2ECBA 5BNGA 3BC8A 4G12A 5J3LA 2ZJRF 3BCAA 1B8IB 3DEUA 3GWZA 3LSJA 3BOQA 4CSWA 3D0SA 5B66C 3FIWA 4KMUX 3HXLA 4DGWB 5JFRA 2PG4A 4U7DA 4M73A 1I1SA 4FISA 1IZ1A 3OYEA 1JGGA 1TZLA 2EIMH 3EUKL 3JTHA 4LMYA 1T38A 2GIVA 1JKRC 1IN6A 2ZC2A 4GGGA 4NBQA 1NH3A 1SMTA 2KZVA 1IC8A 1PUFA 3GEZA 4AM3A 2QGUA 5LHHA 4JBAA 5DS9A 3ZMTA 3TO7A 3K70D 3CDLA 2JA7J 5BS6A 2D45A 3BLYA 2A3SA 1G2HA 2XKPA 2Z3YA 4IX7A 4LK1F 4MHGA 1I3QJ 2E19A 4UVAA 1A31A 3HRMA 2EWNA 4I98B 2XGCA 3MKZA 4A0XA 1FC3A 3CLOA 1QZEA 2W1OA 1MIJA 3FXMA 4HAMA 2P5LC 4PDKA 4CH7A 5E20A 2NNNA 1OFCX 5L3FA 2DI3A 3V7CA 5IYDJ 3HOXJ 4RGUA 5HS9A 3LA7A 3BTIA 1IAWA 1NTCA 1LNWA 1P7JA 2F5EA 2ZO4A 1K6OA 5F04A 1NK3P 5GTHC 4EVIA 5KAIC 1VZ0A 2X6XA 1XMKA 2CUJA 1T33A 2JQ7A 2G7UA 1DU0A 2MLGA 3S1QJ 2D2WA 2CV0A 2JRMA 4A3BJ 3K4NA 2K4JA 1XMAA 1FT9A 1ZLJA 2EFWA 2DDBA 4L5IA 1FTTA 5E3MA 1J75A 3OIQA 4ZZLA 2HQRA 4Z2YA 4YRVA 2NXNB 4BS9A 5L3GA 3F0CA 1LDDA 3K69A 5E1XA 4IQJA 4FT8A 1WSUA 3KYCB 1J09A 2LH9A 2ZXHA 3E5XA 2CQKA 1MBJA 2EV6A 3K1NA 5LHIA 1KQ8A 2H94A 2K9SA 1Q1VA 3I59B 4XBFA 1YHQI 4Y7NJ 1JJ6C 4BXXJ 2X6YA 4PCQA 3MFKA 3KEQA 2DW4A 3T8TA 2XF5A 5M3MJ 2Y0SA 5LGNA 1I6XA 4CCNA 2H6CA 4XIDA 5HDGA 2OQGA 3K4CA 4M72A 4BJ6C 1RRJA 2FMYA 1X4OA 1LFUP 3KYDB 4OAZA 2WBMA 1TW3A 3ASOH 2ME0A 3DBRB 2O03A 4KT6A 1LDJA 2IA2A 2E7XA 3V8JA 3A01B 1G3YA 2LY2A 4U7BA 2JMWA 3ZMZA 2LY9A 3CUOA 3A01A 2AO9A 3I0TA 4P1WA 2GWRA 2JT1A 1FYLA 2Y69H 1Y39A 4JOMA 3QPHA 5FKMA 2XC7A 1QNTA 2XASA 4BEHB 1N77A 4IHWA 2KT0A 1R23A 1D0ZA 3VFZA 3CCSI 4X0GA 1MBGA 3CCMI 4HF0A 4W1UA 1Z67A 1IUFA 3ECOA 3GZ5A 2QQ9A 1D1AA 1VQ6I 2FBIA 2GA1A 1P4WA 4BHBA 4KDPA 3OY9A 3L2VA 4JK1X 2JA6J 4BE0A 3C7JA 3CCVI 4LK0F 2BGCA 2E71A 1TQIA 2JUCA 2ZFUA 1PP7U 4L9NA 1BC7C 2BY0A 2YUSA 2VASA 3RCOA 2X1CA 4RMNA 1B8IA 4UVBA 4IHYA 2EILH 2Y0SN 2IGKA 1P4XA 2V1XA 3PQKA 3U21A 1KU7A 4ENNA 3GCMA 2FOKA 3GTGJ 4FE4A 3FXUA 2NAZA 3G71I 1Y56A 1MBEA 4I7HA 2IW5A 3HL2A 3IWFA 4TV7A 1ORKA 1YQAA 5GAGJ 4EATA 1I50J 2LLKA 5DM6F 1MMNA 2UXXA 3E6MA 1YI2I 2K4BA 5CVRA 3HHGA 2MD0A 1Z3YA 4ZDPA 3J7YJ 3H3ZA 4OIOF 2MYSA 1XTAA 2K5CA 5EGOB 2EB7A 2KRCA 5EYRA 1SD7A 2P7VB 4YIRX 2ZSHB 4ENMA 5B1BH 5D5UB 3CUQB 4I99C 1YITI 1JKOC 5BPDA 4MFEA 4GDFA 1ETKA 2LRDA 4FX0A 2ZXJA 4NB5A 2Q8KA 3ZN1A 4HEA2 4EJOA 2KL4A 4ENJA 3FISA 5FRNA 3FMSA 3U1DA 1RPWA 1TT5B 3I9V2 2PJRA 3FXRA 2K9LA 3WE2A 2H6BA 4J19A 1R1VA 1WVRA 5FFXA 3CMMA 4W97A 1PP8F 4M74A 4PJ0C 5BQTA 3HRSA 2I5UA 4MFDA 2DFIA 4RGXA 2IS2A 2HU9A 3HUGA 1ZG1A 2XF6A 2P5KA 2MA3A 1EV7A 2HWVA 4LITA 4E7KA 4BYYA 3H3UA 4RDUA 1EH6A 4A5NA 4MTEA 3IH2A 3CUQC 2CGPA 1ZG5A 3SFIA 3CP2A 3KPHA 2Y31A 4GO1A 3JCUC 1S72I 2GM4A 1T98A 4C2MJ 5J4VA 3R0AA 1ZN2A 1IF1A 1YJWI 1K4TA 2COMA 4MLOA 1MD0A 1KQ0A 4XOTA 2TRTA 4EGZA 4IHVA 3E3VA 5FD6A 1YX5A 1REPC 3K7AJ 3ZMVA 2L9SA 3BR6A 4A93J 4M9ZA 2MD5A 3KP5A 3VODA 2JA8J 2VJJA 2LKSA 1LJ9A 2KP6A 4KNYA 3IL2A 5FLXK 1XGOA 1HDDC 3P9IA 2LP0A 4IRHA 4A69C 3F72A 4AVZA 1RR7A 5TGTA 4ON0A 2BV6A 2ZXWH 4UV9A 1FIAA 3QAHA 5E1ZB 2PJPA 4HDVA 2J5OA 3M8JA 2HOEA 5LEKA 2PQ8A 2HZDA 3QWLA 1DPRA 3ZQGA 2DT5A 1ZKGA 3UNGC 2KMUA 4N0BA 1ZAOA 3RQ4A 4E6KG 4KYWA 2X0LA 1TT0A 2VQLA 3F6VA 2FD5A 4UB8C 2ELJA 1F5TA 1SFKA 1JI8A 2LY1A 4HF2A 3KIOA 2EPFA 3IP4B 2BHZA 2OC6A 4A6DA 2HEOA 1F9NA 3CQZJ 4Y17A 2KZGA 2KRFA 1JT6A 2JVHA 3JW4A 2BHYA 3A0HC 2HNHA 2YX7A 4CCJA 2K3FA 4FHTA 5F1JA 2VE9A 1W36C 1U6GA 3HOUJ 1MMDA 2CRGA 3BG5A 2LKPA 2WAQN 1VQ4I 4HLXA 1HKQA 4D9JA 4KISA 2W57A 1D5VA 1TWGJ 4UXNA 3L2CA 1ON1A 2IPQX 2MC3A 2FQ3A 2X1EA 2DA5A 2X85A 3OS0A 5HVQC 4ESBA 3T5XA 2VODA 1GUUA 1R5HA 1X4PA 2QBYB 2DA1A 2B7EA 1XD7A 2L2OA 3FM3A 3M8EA 3S1NJ 3VWBA 3CDIA 3A0BC 4B8XA 5FRMA 3ERED 4HRIA 1TWHJ 3IWZA 1OCCH 4HBLA 1YS7A 3CJRB 1EH7A 2JSCA 2KRHA 1XGNA 4WXHA 1BJAA 1D1CA 1ZHFA 3HPGA 3LAJA 2HPMA 4OMYA 3RZOJ 2EQRA 4RAZA 1UCRA 4UVCA 2DDAA 3LWFA 1PYVA 4Y3OA 2R0QC 3L1PA 2XIGA 2ECCA 5IOYA 4QWQA 2VL8A 1FPQA 3WTXC 3F6OA 2WAEA 2AS5F 1WJAA 5EZGA 2NVYJ 2P8TA 3IKVA 4PJJA 2QLZA 3TBIA 3R0JA 4RGSA 1S29A 1Z77A 3RYPA 4R79A 3SZPA 5E8IA 2VKDA 4EJUA 1WKMA 2JRTA 4RBOA 2ICWG 2VE8A 4ZDLA 3HTSB 3F8CA 2EFOA 2DJNA 1IRGA 2MH2A 2AXLA 2WAQA 5JLXA 2GXAA 1EH8A 1YW7A 1X3WB 4JX6A 5J1UA 1QPMA 1QVTA 3O2PE 1LQ1A 3JRCA 4B1RA 2L7ZA 5K5RA 3G2BA 5K7HA 2VB6A 2DA7A 2ZNYA 5L3EA 1WJ5A 2R7DA 3IAS2 4KT5C 3SZTA 4RLQA 2RN7A 2VXZA 3BG3A 4BXUA 4KIBA 1TLHB 4IF4A 3I56I 1G59A 4LB6B 3RDIA 2MABA 1OCRH 4IRGA 3RKYA 3OYJA 3EUHA 1XSDA 1RUNA 1UMQA 1H9TA 1WCMJ 2JWTA 2O3FA 4MEXF 4CDGA 1KYWA 2HVRA 4UUTA 3EYYA 1X2NA 2P0WA 3W6JB 5GADJ 3JRHA
chains in the Genus database with same CATH topology
1U8RA 2H27A 3KLOA 1YIOA 2HYGD 5CVJA 2RNJA 2MH9A 3RPUA 4KIFA 3MWMA 3EETA 1JXSA 2PMHA 3I59A 3M7GA 1SAXA 5BOXA 1L3LA 4I09A 5LRSA 3C18A 3V7SA 3WG9A 5IT9Z 5E1WA 1IXRC 3BPXA 1Z1DA 4ZYDA 5E17F 1WWXA 1Z7UA 1G4DA 3KCCA 4KFCA 3JSOA 5JR3A 2XUBA 1RZ4A 1O3TA 4LFUA 2DK8A 4UHTA 3W6KB 1YO5C 1P4AA 4AIKA 4HX8A 4O5VA 3O3KA 6PAXA 3HSEA 1XCVA 1MDMA 2QQAA 2DAOA 4G6DA 3EQLF 2Y0MA 4IPAA 1BBYA 5BMZA 1FOKA 2FU4A 5D5VB 1BI0A 3GVAA 3I64A 4ESFA 2OQRA 1KU9A 3HYIA 4LG0B 3DF8A 1QQIA 4BNCA 3T1BA 1HSJA 5FB2A 1IRFA 3EDPA 3HTUA 3LQRA 3KETA 1O3SA 1ZG3A 1S6LA 1WRJA 4GYIA 1HBXG 3CO6C 2VBZA 3TDZC 4P9UA 2M8EA 3N97A 3B02A 3WTSC 2ISYA 4ZYHA 3WTWC 1BIAA 2RQPA 4KA4A 2VC0A 5HLHA 3HSFA 4IJAA 2LSOA 1LDKB 4I0AA 2ZJ2A 2UZKA 2LNBA 1LB2A 2X4HA 3MEXA 4XLNF 2K86A 4YFKF 5HDNA 3GFLA 3RJPA 5D5WB 3FHZA 3ROUA 2O6GE 1I27A 4MQ9F 1X3UA 4A6EA 4G7HF 3JTGA 1S8NA 4U0VA 1Q1HA 2L3DA 2NYXA 2ISZA 2Z33A 5HS7A 2K27A 2QBYA 3H92A 3ZN0A 1IXCA 1Z91A 3ABUA 3DFGA 4YIIA 3F21A 2XAQA 1HXDA 4EMSA 4M6YA 1P6RA 4BH9A 2DO7A 2DQLA 2TDXA 2O8XA 4KN7X 4L9TA 5CYVA 3I4PA 5DEQA 1MZBA 1B6AA 4P55A 1FSHA 4L0ZB 3JAMZ 4M6XA 1G3SA 3FM5A 1SD5A 3L00A 5DCMA 3RYRA 3GW2A 2A6HF 2ACJA 4L9VA 5ILSA 1BM9A 3P9KA 5F1RA 1IN8A 1TBXA 2K7LA 3RKXA 1HKSA 2XAHA 5K1YA 1YG2A 1V3FA 1ZGAA 2GAUA 3DQVC 3Q5FA 4Q5SF 1ZYRF 2M30A 2W84A 1UB9A 1IN4A 2KIMA 4HX7A 5KK1A 1HKTA 4I2OA 3JAMK 4CHUA 3R61A 4LG0A 4U88A 3RPQA 2ZFWA 5TJJA 3GFMA 2YX4A 3HRUA 3SFZA 1LEAA 3ZMUA 2STTA 4OU0A 2Z9OA 5A2QZ 1K78A 2D1HA 4P9FA 3BY6A 2FEZA 4O6JA 1XDSA 4XRFA 1GVJA 5D4RA 4CGZA 4GXOA 1BC8C 3KP4A 2L4MA 4KMFA 3BPVA 5EEHA 5KVRA 1E17A 3LA2A 1IN7A 2DQRA 4WXCA 1J0RA 2VC1A 2EA4A 1IW7F 3B73A 2QWWA 3I53A 3JSPA 3KP3A 4F7ZA 3ZP5A 2EFPA 2QYOA 3ML6A 5AONA 2P7CB 1QZYA 2FF4A 2EV5A 3ISPA 3K1PA 2HR3A 5FD5A 3SHFA 1T6SA 3COAC 3L7WA 4GYGA 4EM0B 5ERIA 2VT2A 3TGNA 5IT9K 1AWCA 2CWEA 3FXQA 2PBIA 4WF2A 2UWMA 2KJBA 2HYFA 3WTZA 3MAJA 3G73A 1J9IA 3WGIA 2P6SA 3L9FA 2NRAC 5HDKA 3IC7A 4BAYA 2L02A 2A61A 2CG4A 1TTYA 2FNPA 2KJCA 3SQNA 3FX3A 1MJAA 3KP2A 2A6EF 5D8LB 1RNLA 4P5OA 3E6BA 4AWXB 2PEXA 3REOA 5AIPA 3O6BB 2OZ6A 3LSTA 5CVUA 2Z99A 2O0YA 1W5TA 4RS8A 1R00A 2QZ8A 4WX9A 1O3RA 4AIJA 2DTRA 4IHTA 3GFIA 1U5TA 1OYWA 2HTJA 5J8CA 4WXDA 3NEUA 1L0OC 1SFXA 3WTUC 1IUYA 1UHMA 4HQEA 1B9NA 2FSWA 2HTSA 2FBHA 4LLLA 3V7RA 4G8XA 2V1DA 2Y48A 1JHHA 1S7AA 1S3JA 3N4MA 3CTAA 1UHWA 2MLKA 3OV8A 1PUEE 3HRTA 5AIQA 1P2FA 4HX4A 1WI9A 1Z6RA 1R1UA 4G94A 3U9GA 1FBSA 3F23A 3FF5A 1B9MA 1YYVA 3QP5A 4HZFA 2Y75A 2FBKA 3GX4X 2EA2A 1DP7P 4LD5A 1FLIA 2W25A 3R60A 3ELKA 3I71A 2MBFA 1QGPA 2Q2EA 3WU0A 2EJRA 2A68F 1I5ZA 1YFHA 2FE3A 5JVTA 4XSXF 5LEJA 5CLSA 2R3SA 5H6QA 4G9YA 5LLQA 4B09A 4S05A 2DK5A 3KZYA 4L0YB 1FZPB 2V79A 4M9SA 5DV5A 3GF2A 3TDUC 1PDNC 2DBBA 3U2RA 1TQMA 3TOBA 2M1BA 2ZKZA 3RIRA 1RUOA 4A2UA 2O61A 2RKHA 4CO8A 4CYDA 1V4RA 3KLNA 1RI7A 3VB2A 4DNCA 1G3WA 4ZYEA 1O7LA 1XB4A 3LFKA 4EM1A 1CF7B 1BIBA 4A12A 4RB2C 4S04A 4A0ZA 3T0YA 2L54A 3HSRA 2JTVA 4K2EA 2EK5A 2EFQA 1O57A 2JPCA 2E1NA 1GXPA 3F22A 2HS5A 2KIUA 4HYEA 3WGHA 1ZRDA 1J5YA 5E18F 5DYMA 1U78A 3DP7A 2EV0A 3GLXA 1GHCA 3RI4A 4OIQF 2C6YA 3KFWX 2DLLA 4U0WA 4IHSA 3BZ6A 2F5CA 1T2KA 5F6FA 5HLIA 3R4KA 4ESJA 3I54A 4HA8A 3DXJF 1SFEA 1S7OA 3ZQ7A 1TNTA 4LLGF 4WK8F 3WTTC 2L01A 1DUXC 2LF8A 4OMZA 1J2XA 4HQMA 3ZMDA 1B59A 3F8FA 3IRQA 4ZYGA 4EJWA 1E2XA 2ZNZA 2CFXA 1KA8A 3CUQA 3L09A 2OD5A 2IRFG 1MGTA 3VEPA 2HFHA 4ASNA 1SMYF 4H0EA 4AD9A 1Z9CA 3QU6A 1C0WA 2B0LA 2QENA 2GQQA 1O3QA 4FX4A 3V8LA 4LLNA 3C3WA 1R5GA 2PFBA 4KICA 2FA5A 5D6FA 3TO6A 3PFIA 4XSZF 4RB1A 2ESHA 1TW2A 3F8MA 2A69F 5F64A 1IXSB 2BYVE 3M8FA 4UUVA 2VT3A 2EFNA 4MEYF 2YR2A 4HDUA 1ULYA 5L3DA 1TQPA 2KKOA 2R7FA 3RKWA 4YG2F 2M5WA 4UNOA 4I02A 1HW2A 5JHUA 3DPTA 3FMRA 1T0FA 2W24A 1D8JA 5CJ9A 3F8BA 4HV6A 3GO5A 2PI0A 3DKWA 1U5TB 3IHUA 5ICGA 3NQOA 2VOPA 4PZJA 3K0LA 3KP6A 3V8KA 1BI2A 2OA4A 1D8KA 4A5MA 5LBQA 1JE8A 1SFUA 4ETSA 5L3BA 1R1TA 3E5QA 1OYYA 2IA0A 4GCVA 2DPDA 2V6CA 3QU3A 1KQ9A 4RGRA 3EYIA 1FYMA 5D6EA 2F2EA 4PGGA 3K1MA 2HZTA 3M1EA 1R22A 3BROA 1YW9A 1QO0D 4KUMA 1ZRFA 1QBJA 3HIFA 3FZVA 2YU3A 1RIOH 2RDPA 1LEBA 1ZGJA 2IJLA 2P5VA 2GXGA 1XSXA 3KEOA 1YS6A 3MZYA 2IVMA 1U3EM 1FBUA 2RC4A 1FNNA 2V9VA 1AOYA 1OYIA 1FSEA 2Z5UA 2XAJA 4Y15A 3J80Z 2XHKA 1K79A 2ZMEB 5DD4A 4L5JA 2P4WA 3D5LA 1XCBA 1OR7A 2XKOA 1NHAA 5HS8A 4R8HA 4RAYA 2YSRA 4IVNA 4P96A 2ADUA 3QP6A 1FWZA 4YFXF 2CO5A 2FXAA 1XSVA 3C1DA 1FP2A 5HOOA 1QZZA 2XAFA 2CW0F 1SD4A 1W7PD 4MNUA 2VONA 1CF7A 1MKMA 1T39A 3Q9VA 1G6NA 4HV5A 5D4SA 3LA3A 2D1VA 4L18B 1STZA 1JGSA 2G7HA 1A04A 1JHFA 2HDCA 3MQ0A 5DDGA 4MQVA 2XV4S 1VTNC 1BI3A 3BJAA 2G9WA 1USTA 4RB0A 3BWGA 3MCZA 2UXNA 2FRHA 3QOPA 5ICFA 3OOPA 1BI1A 1YLFA 1YW8A 2XAGA 1XGSA 3CO7C 5HLGA 2WWYA 3BJOA 2PN6A 2RV8A 2XVCA 4EV0A 4D0PA 3GUDA 4QLCU 4EJVA 2XRNA 3HHHA 2HKOA 5LHGA 3DPLC 3DV8A 2DU9A 2IT0A 2VBXA 2HQNA 3K9TA 4PGHA 1FX7A 3P9CA 4LJZF 3V4GA 3GXOA 2FNAA 2J5PA 2KIFA 2VBYA 3WTVC 2XGXA 2ELHA 2GA2A 4G7OF 2LDUA 4CICA 2NNYA 2RVCA 1KGSA 5DD8A 2ZCWA 3P7NA 4CXFA 2QM3A 4EGYA 2PLYA 2CYYA 3S2WA 5ILVA 2STWA 5IT3A 1ZH5A 1K78B 3R6SA 2QVOA 4I01A 5DCFA 2E1CA 1H0MA 2OZUA 1UFMA 3F8NA 4OINF 1BOAA 3ECHA 3G3ZA 4BQAA 3QRFF 5D5XB 1DPUA 1F4KA 4O3MA 2BEOA 1B1BA 5D8KB 5E8GA 5ED4A 5H6RA 5ICEA 1I1GA 3GFJA 2WTEA 3J81Z 2HGCA 1J59A 4EQQA 1FY7A 3TO9A 2OBPA 3FMQA 3E97A 2PMUA 4OOIA 4E70A 5JI6A 1W5SA 4YFNF 5FGMA 2V1UA 3IRRA 4HF1A 3KE2A 2RGVA 4AIHA 1ON2A 2W85A 3TKYA 2QQBA 5EEGA 1H9GA 1XGMA 3CDHA 2Q0OA 3E6DA 1MDMB 1GXQA 4IRIA 1B4AA 1Z05A 3FWEA 1BN5A 2OU2A 2BE5F 5DUKA 1FP1D 3CJNA 4N9IA 4WCGA 1U2WA 4OIRF 4ENKA 2H09A 4RB3C 1OMIA 1D3YA 3BJ6A 1KU3A 4N9HA 1O7FA 1W7PB 4NHJA 2VN2A 3WGGA 1Y0UA 2P6TA 1FBQA 1LVAA 1KU2A 4L9JA 5LGUA 1ZARA 4HLYA 4ZH4F 4Q47A 5ICCA 3WODF 5DUIA 3TOAA 4KN4X 1USSA 2GXBA 5H20A 1FYKA 3E5UA 4Y13A 3GYHX 3WE3A 3MZHA 4EJTA 5A2QK 2A07F 1HW1A 3J7AO 4A0YA 4WWCA 5LGTA 5BPIA 4JQFA 3J81K 1K7AA 3ZPLA 5TRDA 4HW0A 3ZMSA 2XROA 4BHCA 1R36A 2DPUA 4OIPF 3I58A 1HW5A 4ZZDA 2BBYA 1KYZA 5J6XA 2YPRA 3LAPA 2E7WA 2WC2A 2JZYA 5FFZA 4XLPF 3WU1B 1SD6A 3I5UA 2ETHA 2ZBKA 4EM2A 3KZZA 1ODDA 2F5FA 5CVIA 1TNSA 2OAZA 5ILUA 3M9AA 5DCMB 2WV0A 4R1HA 1U5TC 5L3CA 1R7JA 1OPCA 4M9XA 4BHPA 3LQQA 3WTYC 2CSOA 2A5YB 3QPTA 1ZLKA 3GZ6A 3PQJA 4AVPA 4Q4ZF 3Q9SA 3NRVA 1P92A 1HQCA 4G7ZF 1CGPA 4IXAA 1Z6TA 1DDNA 2F5DA 1HSTA 5LRRA 2QUFA 3J80K 1ZRCA 3TQNA 3BDDA 1WQ2A 2M87A 4YIFA 2FMLA 3HOTA 1F1ZA 2JPBA 3K2ZA 1MJBA 4HOBA 4UV8A 3HOSA 4M71A 3ULQB 1XDUA 5CVVA 3E6CC 4I0BA 4CZZA 3VOEA 2IP2A 1J7KA 3ABTA 2IA1A 4LGWA 4G6QA 1R58A 1MJ9A 1ONVA 3BP8A 5K5OA 4MTDA 4NQWA 5FLXZ 2LF7A 2NS0A 1W7PA 1G3TA 4DQ2A 3AAFA 2VOOA 2ESNA 1W4MA 1OKRA 3RTRA 1YTYA 4Q48A 3F3XA 2GZWA 4KIGA 4LB5A 4MGRA 5FO5A 2ZMEA 5J8FA 2VBWA 1XN7A 3SXYA 1IN5A 4U0YA 5K5QA 3IKTA 2L4AA 2K02A 1ZREA 2M45A 3KP7A 2HKXA 3T8RA 3DEUA 3GWZA 3BOQA 3D0SA 4KMUX 5JFRA 2PG4A 4U7DA 4M73A 1I1SA 1IZ1A 4LMYA 3JTHA 1T38A 2GIVA 1IN6A 4GGGA 1SMTA 3GEZA 5LHHA 4JBAA 3ZMTA 3TO7A 5BS6A 2D45A 2A3SA 2XKPA 2Z3YA 4LK1F 4MHGA 4UVAA 3HRMA 2EWNA 4I98B 4A0XA 1FC3A 3CLOA 4HAMA 2P5LC 4PDKA 5E20A 2NNNA 5L3FA 2DI3A 3V7CA 4RGUA 5HS9A 3LA7A 1IAWA 2F5EA 1LNWA 2ZO4A 1K6OA 4EVIA 1XMKA 2G7UA 2MLGA 2D2WA 2K4JA 1XMAA 1FT9A 1ZLJA 2EFWA 4L5IA 1J75A 4ZZLA 2HQRA 4Z2YA 5L3GA 1LDDA 3K69A 5E1XA 4FT8A 1WSUA 3E5XA 2CQKA 2EV6A 3K1NA 5LHIA 1KQ8A 2H94A 3I59B 4XBFA 4PCQA 3MFKA 3KEQA 2DW4A 3T8TA 5LGNA 1I6XA 2H6CA 5HDGA 2OQGA 4M72A 2FMYA 1TW3A 2O03A 1LDJA 2IA2A 2E7XA 3V8JA 1G3YA 4U7BA 3ZMZA 3CUOA 3I0TA 2GWRA 2JT1A 1FYLA 3QPHA 1QNTA 2XASA 1R23A 3VFZA 4HF0A 3ECOA 3GZ5A 2QQ9A 2GA1A 2FBIA 1P4WA 4BHBA 4KDPA 4JK1X 3C7JA 4LK0F 2BGCA 1TQIA 1PP7U 4L9NA 1BC7C 4UVBA 1P4XA 2V1XA 3PQKA 1KU7A 4ENNA 2FOKA 3FXUA 2NAZA 4I7HA 2IW5A 3IWFA 4TV7A 1YQAA 2UXXA 3E6MA 2K4BA 5CVRA 3HHGA 3H3ZA 4OIOF 2EB7A 1SD7A 2P7VB 4ENMA 5D5UB 3CUQB 5BPDA 4FX0A 2ZXJA 4NB5A 2Q8KA 3ZN1A 4EJOA 4ENJA 3FMSA 3U1DA 3FXRA 3WE2A 2H6BA 1R1VA 5FFXA 1PP8F 4M74A 5BQTA 3HRSA 2DFIA 4RGXA 3HUGA 1ZG1A 2P5KA 2MA3A 1EV7A 2HWVA 4BYYA 3H3UA 1EH6A 4A5NA 4MTEA 3CUQC 2CGPA 1ZG5A 4GO1A 1T98A 3R0AA 1ZN2A 1IF1A 2COMA 1MD0A 1KQ0A 4EGZA 3E3VA 5FD6A 1REPC 3ZMVA 4M9ZA 2MD5A 3KP5A 3VODA 1LJ9A 4KNYA 3IL2A 5FLXK 1XGOA 3P9IA 4IRHA 3F72A 4ON0A 2BV6A 4UV9A 3QAHA 5E1ZB 2PJPA 4HDVA 2J5OA 2HOEA 5LEKA 2PQ8A 1DPRA 2DT5A 4N0BA 1ZAOA 4KYWA 2X0LA 3F6VA 1F5TA 4HF2A 4A6DA 2HEOA 1F9NA 4Y17A 2KRFA 3JW4A 2YX7A 4FHTA 2VE9A 1U6GA 2LKPA 4HLXA 1HKQA 2W57A 1D5VA 4UXNA 3L2CA 1ON1A 2IPQX 2MC3A 2FQ3A 5HVQC 4ESBA 3T5XA 2VODA 1R5HA 2QBYB 3FM3A 1XD7A 3M8EA 4B8XA 3ERED 3IWZA 4HBLA 1YS7A 1EH7A 2JSCA 1XGNA 4WXHA 1BJAA 1ZHFA 3LAJA 4OMYA 4UVCA 4RAZA 1UCRA 3LWFA 2XIGA 4QWQA 1FPQA 3WTXC 3F6OA 2AS5F 2P8TA 3IKVA 2QLZA 3R0JA 4RGSA 1S29A 3RYPA 4R79A 3SZPA 5E8IA 4EJUA 1WKMA 2JRTA 2VE8A 3HTSB 3F8CA 2EFOA 1IRGA 2MH2A 2AXLA 1EH8A 1YW7A 1QPMA 3O2PE 1LQ1A 5K5RA 2ZNYA 5L3EA 2R7DA 4KT5C 3SZTA 2RN7A 2VXZA 4BXUA 4KIBA 1TLHB 4IF4A 4LB6B 3RDIA 4IRGA 3RKYA 3EUHA 1XSDA 1RUNA 1H9TA 4MEXF 2O3FA 4CDGA 1KYWA 3EYYA 3W6JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U8R A;  2H27 A;  3KLO A;  1YIO A;  2HYG D;  5CVJ A;  2RNJ A;  2MH9 A;  3RPU A;  4KIF A;  3MWM A;  3EET A;  1JXS A;  2PMH A;  3I59 A;  3M7G A;  1SAX A;  5BOX A;  1L3L A;  4I09 A;  5LRS A;  3C18 A;  3V7S A;  3WG9 A;  5IT9 Z;  5E1W A;  1IXR C;  3BPX A;  1Z1D A;  4ZYD A;  5E17 F;  1WWX A;  1Z7U A;  1G4D A;  3KCC A;  4KFC A;  3JSO A;  5JR3 A;  2XUB A;  1RZ4 A;  1O3T A;  4LFU A;  2DK8 A;  4UHT A;  3W6K B;  1YO5 C;  1P4A A;  4AIK A;  4HX8 A;  4O5V A;  3O3K A;  6PAX A;  3HSE A;  1XCV A;  1MDM A;  2QQA A;  2DAO A;  4G6D A;  3EQL F;  2Y0M A;  4IPA A;  1BBY A;  5BMZ A;  1FOK A;  2FU4 A;  5D5V B;  1BI0 A;  3GVA A;  3I64 A;  4ESF A;  2OQR A;  1KU9 A;  3HYI A;  4LG0 B;  3DF8 A;  1QQI A;  4BNC A;  3T1B A;  1HSJ A;  5FB2 A;  1IRF A;  3EDP A;  3HTU A;  3LQR A;  3KET A;  1O3S A;  1ZG3 A;  1S6L A;  1WRJ A;  4GYI A;  1HBX G;  3CO6 C;  2VBZ A;  3TDZ C;  4P9U A;  2M8E A;  3N97 A;  3B02 A;  3WTS C;  2ISY A;  4ZYH A;  3WTW C;  1BIA A;  2RQP A;  4KA4 A;  2VC0 A;  5HLH A;  3HSF A;  4IJA A;  2LSO A;  1LDK B;  4I0A A;  2ZJ2 A;  2UZK A;  2LNB A;  1LB2 A;  2X4H A;  3MEX A;  4XLN F;  2K86 A;  4YFK F;  5HDN A;  3GFL A;  3RJP A;  5D5W B;  3FHZ A;  3ROU A;  2O6G E;  1I27 A;  4MQ9 F;  1X3U A;  4A6E A;  4G7H F;  3JTG A;  1S8N A;  4U0V A;  1Q1H A;  2L3D A;  2NYX A;  2ISZ A;  2Z33 A;  5HS7 A;  2K27 A;  2QBY A;  3H92 A;  3ZN0 A;  1IXC A;  1Z91 A;  3ABU A;  3DFG A;  4YII A;  3F21 A;  2XAQ A;  1HXD A;  4EMS A;  4M6Y A;  1P6R A;  4BH9 A;  2DO7 A;  2DQL A;  2TDX A;  2O8X A;  4KN7 X;  4L9T A;  5CYV A;  3I4P A;  5DEQ A;  1MZB A;  1B6A A;  4P55 A;  1FSH A;  4L0Z B;  3JAM Z;  4M6X A;  1G3S A;  3FM5 A;  1SD5 A;  3L00 A;  5DCM A;  3RYR A;  3GW2 A;  2A6H F;  2ACJ A;  4L9V A;  5ILS A;  1BM9 A;  3P9K A;  5F1R A;  1IN8 A;  1TBX A;  2K7L A;  3RKX A;  1HKS A;  2XAH A;  5K1Y A;  1YG2 A;  1V3F A;  1ZGA A;  2GAU A;  3DQV C;  3Q5F A;  4Q5S F;  1ZYR F;  2M30 A;  2W84 A;  1UB9 A;  1IN4 A;  2KIM A;  4HX7 A;  5KK1 A;  1HKT A;  4I2O A;  3JAM K;  4CHU A;  3R61 A;  4LG0 A;  4U88 A;  3RPQ A;  2ZFW A;  5TJJ A;  3GFM A;  2YX4 A;  3HRU A;  3SFZ A;  1LEA A;  3ZMU A;  2STT A;  4OU0 A;  2Z9O A;  5A2Q Z;  1K78 A;  2D1H A;  4P9F A;  3BY6 A;  2FEZ A;  4O6J A;  1XDS A;  4XRF A;  1GVJ A;  5D4R A;  4CGZ A;  4GXO A;  1BC8 C;  3KP4 A;  2L4M A;  4KMF A;  3BPV A;  5EEH A;  5KVR A;  1E17 A;  3LA2 A;  1IN7 A;  2DQR A;  4WXC A;  1J0R A;  2VC1 A;  2EA4 A;  1IW7 F;  3B73 A;  2QWW A;  3I53 A;  3JSP A;  3KP3 A;  4F7Z A;  3ZP5 A;  2EFP A;  2QYO A;  3ML6 A;  5AON A;  2P7C B;  1QZY A;  2FF4 A;  2EV5 A;  3ISP A;  3K1P A;  2HR3 A;  5FD5 A;  3SHF A;  1T6S A;  3COA C;  3L7W A;  4GYG A;  4EM0 B;  5ERI A;  2VT2 A;  3TGN A;  5IT9 K;  1AWC A;  2CWE A;  3FXQ A;  2PBI A;  4WF2 A;  2UWM A;  2KJB A;  2HYF A;  3WTZ A;  3MAJ A;  3G73 A;  1J9I A;  3WGI A;  2P6S A;  3L9F A;  2NRA C;  5HDK A;  3IC7 A;  4BAY A;  2L02 A;  2A61 A;  2CG4 A;  1TTY A;  2FNP A;  2KJC A;  3SQN A;  3FX3 A;  1MJA A;  3KP2 A;  2A6E F;  5D8L B;  1RNL A;  4P5O A;  3E6B A;  4AWX B;  2PEX A;  3REO A;  5AIP A;  3O6B B;  2OZ6 A;  3LST A;  5CVU A;  2Z99 A;  2O0Y A;  1W5T A;  4RS8 A;  1R00 A;  2QZ8 A;  4WX9 A;  1O3R A;  4AIJ A;  2DTR A;  4IHT A;  3GFI A;  1U5T A;  1OYW A;  2HTJ A;  5J8C A;  4WXD A;  3NEU A;  1L0O C;  1SFX A;  3WTU C;  1IUY A;  1UHM A;  4HQE A;  1B9N A;  2FSW A;  2HTS A;  2FBH A;  4LLL A;  3V7R A;  4G8X A;  2V1D A;  2Y48 A;  1JHH A;  1S7A A;  1S3J A;  3N4M A;  3CTA A;  1UHW A;  2MLK A;  3OV8 A;  1PUE E;  3HRT A;  5AIQ A;  1P2F A;  4HX4 A;  1WI9 A;  1Z6R A;  1R1U A;  4G94 A;  3U9G A;  1FBS A;  3F23 A;  3FF5 A;  1B9M A;  1YYV A;  3QP5 A;  4HZF A;  2Y75 A;  2FBK A;  3GX4 X;  2EA2 A;  1DP7 P;  4LD5 A;  1FLI A;  2W25 A;  3R60 A;  3ELK A;  3I71 A;  2MBF A;  1QGP A;  2Q2E A;  3WU0 A;  2EJR A;  2A68 F;  1I5Z A;  1YFH A;  2FE3 A;  5JVT A;  4XSX F;  5LEJ A;  5CLS A;  2R3S A;  5H6Q A;  4G9Y A;  5LLQ A;  4B09 A;  4S05 A;  2DK5 A;  3KZY A;  4L0Y B;  1FZP B;  2V79 A;  4M9S A;  5DV5 A;  3GF2 A;  3TDU C;  1PDN C;  2DBB A;  3U2R A;  1TQM A;  3TOB A;  2M1B A;  2ZKZ A;  3RIR A;  1RUO A;  4A2U A;  2O61 A;  2RKH A;  4CO8 A;  4CYD A;  1V4R A;  3KLN A;  1RI7 A;  3VB2 A;  4DNC A;  1G3W A;  4ZYE A;  1O7L A;  1XB4 A;  3LFK A;  4EM1 A;  1CF7 B;  1BIB A;  4A12 A;  4RB2 C;  4S04 A;  4A0Z A;  3T0Y A;  2L54 A;  3HSR A;  2JTV A;  4K2E A;  2EK5 A;  2EFQ A;  1O57 A;  2JPC A;  2E1N A;  1GXP A;  3F22 A;  2HS5 A;  2KIU A;  4HYE A;  3WGH A;  1ZRD A;  1J5Y A;  5E18 F;  5DYM A;  1U78 A;  3DP7 A;  2EV0 A;  3GLX A;  1GHC A;  3RI4 A;  4OIQ F;  2C6Y A;  3KFW X;  2DLL A;  4U0W A;  4IHS A;  3BZ6 A;  2F5C A;  1T2K A;  5F6F A;  5HLI A;  3R4K A;  4ESJ A;  3I54 A;  4HA8 A;  3DXJ F;  1SFE A;  1S7O A;  3ZQ7 A;  1TNT A;  4LLG F;  4WK8 F;  3WTT C;  2L01 A;  1DUX C;  2LF8 A;  4OMZ A;  1J2X A;  4HQM A;  3ZMD A;  1B59 A;  3F8F A;  3IRQ A;  4ZYG A;  4EJW A;  1E2X A;  2ZNZ A;  2CFX A;  1KA8 A;  3CUQ A;  3L09 A;  2OD5 A;  2IRF G;  1MGT A;  3VEP A;  2HFH A;  4ASN A;  1SMY F;  4H0E A;  4AD9 A;  1Z9C A;  3QU6 A;  1C0W A;  2B0L A;  2QEN A;  2GQQ A;  1O3Q A;  4FX4 A;  3V8L A;  4LLN A;  3C3W A;  1R5G A;  2PFB A;  4KIC A;  2FA5 A;  5D6F A;  3TO6 A;  3PFI A;  4XSZ F;  4RB1 A;  2ESH A;  1TW2 A;  3F8M A;  2A69 F;  5F64 A;  1IXS B;  2BYV E;  3M8F A;  4UUV A;  2VT3 A;  2EFN A;  4MEY F;  2YR2 A;  4HDU A;  1ULY A;  5L3D A;  1TQP A;  2KKO A;  2R7F A;  3RKW A;  4YG2 F;  2M5W A;  4UNO A;  4I02 A;  1HW2 A;  5JHU A;  3DPT A;  3FMR A;  1T0F A;  2W24 A;  1D8J A;  5CJ9 A;  3F8B A;  4HV6 A;  3GO5 A;  2PI0 A;  3DKW A;  1U5T B;  3IHU A;  5ICG A;  3NQO A;  2VOP A;  4PZJ A;  3K0L A;  3KP6 A;  3V8K A;  1BI2 A;  2OA4 A;  1D8K A;  4A5M A;  5LBQ A;  1JE8 A;  1SFU A;  4ETS A;  5L3B A;  1R1T A;  3E5Q A;  1OYY A;  2IA0 A;  4GCV A;  2DPD A;  2V6C A;  3QU3 A;  1KQ9 A;  4RGR A;  3EYI A;  1FYM A;  5D6E A;  2F2E A;  4PGG A;  3K1M A;  2HZT A;  3M1E A;  1R22 A;  3BRO A;  1YW9 A;  1QO0 D;  4KUM A;  1ZRF A;  1QBJ A;  3HIF A;  3FZV A;  2YU3 A;  1RIO H;  2RDP A;  1LEB A;  1ZGJ A;  2IJL A;  2P5V A;  2GXG A;  1XSX A;  3KEO A;  1YS6 A;  3MZY A;  2IVM A;  1U3E M;  1FBU A;  2RC4 A;  1FNN A;  2V9V A;  1AOY A;  1OYI A;  1FSE A;  2Z5U A;  2XAJ A;  4Y15 A;  3J80 Z;  2XHK A;  1K79 A;  2ZME B;  5DD4 A;  4L5J A;  2P4W A;  3D5L A;  1XCB A;  1OR7 A;  2XKO A;  1NHA A;  5HS8 A;  4R8H A;  4RAY A;  2YSR A;  4IVN A;  4P96 A;  2ADU A;  3QP6 A;  1FWZ A;  4YFX F;  2CO5 A;  2FXA A;  1XSV A;  3C1D A;  1FP2 A;  5HOO A;  1QZZ A;  2XAF A;  2CW0 F;  1SD4 A;  1W7P D;  4MNU A;  2VON A;  1CF7 A;  1MKM A;  1T39 A;  3Q9V A;  1G6N A;  4HV5 A;  5D4S A;  3LA3 A;  2D1V A;  4L18 B;  1STZ A;  1JGS A;  2G7H A;  1A04 A;  1JHF A;  2HDC A;  3MQ0 A;  5DDG A;  4MQV A;  2XV4 S;  1VTN C;  1BI3 A;  3BJA A;  2G9W A;  1UST A;  4RB0 A;  3BWG A;  3MCZ A;  2UXN A;  2FRH A;  3QOP A;  5ICF A;  3OOP A;  1BI1 A;  1YLF A;  1YW8 A;  2XAG A;  1XGS A;  3CO7 C;  5HLG A;  2WWY A;  3BJO A;  2PN6 A;  2RV8 A;  2XVC A;  4EV0 A;  4D0P A;  3GUD A;  4QLC U;  4EJV A;  2XRN A;  3HHH A;  2HKO A;  5LHG A;  3DPL C;  3DV8 A;  2DU9 A;  2IT0 A;  2VBX A;  2HQN A;  3K9T A;  4PGH A;  1FX7 A;  3P9C A;  4LJZ F;  3V4G A;  3GXO A;  2FNA A;  2J5P A;  2KIF A;  2VBY A;  3WTV C;  2XGX A;  2ELH A;  2GA2 A;  4G7O F;  2LDU A;  4CIC A;  2NNY A;  2RVC A;  1KGS A;  5DD8 A;  2ZCW A;  3P7N A;  4CXF A;  2QM3 A;  4EGY A;  2PLY A;  2CYY A;  3S2W A;  5ILV A;  2STW A;  5IT3 A;  1ZH5 A;  1K78 B;  3R6S A;  2QVO A;  4I01 A;  5DCF A;  2E1C A;  1H0M A;  2OZU A;  1UFM A;  3F8N A;  4OIN F;  1BOA A;  3ECH A;  3G3Z A;  4BQA A;  3QRF F;  5D5X B;  1DPU A;  1F4K A;  4O3M A;  2BEO A;  1B1B A;  5D8K B;  5E8G A;  5ED4 A;  5H6R A;  5ICE A;  1I1G A;  3GFJ A;  2WTE A;  3J81 Z;  2HGC A;  1J59 A;  4EQQ A;  1FY7 A;  3TO9 A;  2OBP A;  3FMQ A;  3E97 A;  2PMU A;  4OOI A;  4E70 A;  5JI6 A;  1W5S A;  4YFN F;  5FGM A;  2V1U A;  3IRR A;  4HF1 A;  3KE2 A;  2RGV A;  4AIH A;  1ON2 A;  2W85 A;  3TKY A;  2QQB A;  5EEG A;  1H9G A;  1XGM A;  3CDH A;  2Q0O A;  3E6D A;  1MDM B;  1GXQ A;  4IRI A;  1B4A A;  1Z05 A;  3FWE A;  1BN5 A;  2OU2 A;  2BE5 F;  5DUK A;  1FP1 D;  3CJN A;  4N9I A;  4WCG A;  1U2W A;  4OIR F;  4ENK A;  2H09 A;  4RB3 C;  1OMI A;  1D3Y A;  3BJ6 A;  1KU3 A;  4N9H A;  1O7F A;  1W7P B;  4NHJ A;  2VN2 A;  3WGG A;  1Y0U A;  2P6T A;  1FBQ A;  1LVA A;  1KU2 A;  4L9J A;  5LGU A;  1ZAR A;  4HLY A;  4ZH4 F;  4Q47 A;  5ICC A;  3WOD F;  5DUI A;  3TOA A;  4KN4 X;  1USS A;  2GXB A;  5H20 A;  1FYK A;  3E5U A;  4Y13 A;  3GYH X;  3WE3 A;  3MZH A;  4EJT A;  5A2Q K;  2A07 F;  1HW1 A;  3J7A O;  4A0Y A;  4WWC A;  5LGT A;  5BPI A;  4JQF A;  3J81 K;  1K7A A;  3ZPL A;  5TRD A;  4HW0 A;  3ZMS A;  2XRO A;  4BHC A;  1R36 A;  2DPU A;  4OIP F;  3I58 A;  1HW5 A;  4ZZD A;  2BBY A;  1KYZ A;  5J6X A;  2YPR A;  3LAP A;  2E7W A;  2WC2 A;  2JZY A;  5FFZ A;  4XLP F;  3WU1 B;  1SD6 A;  3I5U A;  2ETH A;  2ZBK A;  4EM2 A;  3KZZ A;  1ODD A;  2F5F A;  5CVI A;  1TNS A;  2OAZ A;  5ILU A;  3M9A A;  5DCM B;  2WV0 A;  4R1H A;  1U5T C;  5L3C A;  1R7J A;  1OPC A;  4M9X A;  4BHP A;  3LQQ A;  3WTY C;  2CSO A;  2A5Y B;  3QPT A;  1ZLK A;  3GZ6 A;  3PQJ A;  4AVP A;  4Q4Z F;  3Q9S A;  3NRV A;  1P92 A;  1HQC A;  4G7Z F;  1CGP A;  4IXA A;  1Z6T A;  1DDN A;  2F5D A;  1HST A;  5LRR A;  2QUF A;  3J80 K;  1ZRC A;  3TQN A;  3BDD A;  1WQ2 A;  2M87 A;  4YIF A;  2FML A;  3HOT A;  1F1Z A;  2JPB A;  3K2Z A;  1MJB A;  4HOB A;  4UV8 A;  3HOS A;  4M71 A;  3ULQ B;  1XDU A;  5CVV A;  3E6C C;  4I0B A;  4CZZ A;  3VOE A;  2IP2 A;  1J7K A;  3ABT A;  2IA1 A;  4LGW A;  4G6Q A;  1R58 A;  1MJ9 A;  1ONV A;  3BP8 A;  5K5O A;  4MTD A;  4NQW A;  5FLX Z;  2LF7 A;  2NS0 A;  1W7P A;  1G3T A;  4DQ2 A;  3AAF A;  2VOO A;  2ESN A;  1W4M A;  1OKR A;  3RTR A;  1YTY A;  4Q48 A;  3F3X A;  2GZW A;  4KIG A;  4LB5 A;  4MGR A;  5FO5 A;  2ZME A;  5J8F A;  2VBW A;  1XN7 A;  3SXY A;  1IN5 A;  4U0Y A;  5K5Q A;  3IKT A;  2L4A A;  2K02 A;  1ZRE A;  2M45 A;  3KP7 A;  2HKX A;  3T8R A;  3DEU A;  3GWZ A;  3BOQ A;  3D0S A;  4KMU X;  5JFR A;  2PG4 A;  4U7D A;  4M73 A;  1I1S A;  1IZ1 A;  4LMY A;  3JTH A;  1T38 A;  2GIV A;  1IN6 A;  4GGG A;  1SMT A;  3GEZ A;  5LHH A;  4JBA A;  3ZMT A;  3TO7 A;  5BS6 A;  2D45 A;  2A3S A;  2XKP A;  2Z3Y A;  4LK1 F;  4MHG A;  4UVA A;  3HRM A;  2EWN A;  4I98 B;  4A0X A;  1FC3 A;  3CLO A;  4HAM A;  2P5L C;  4PDK A;  5E20 A;  2NNN A;  5L3F A;  2DI3 A;  3V7C A;  4RGU A;  5HS9 A;  3LA7 A;  1IAW A;  2F5E A;  1LNW A;  2ZO4 A;  1K6O A;  4EVI A;  1XMK A;  2G7U A;  2MLG A;  2D2W A;  2K4J A;  1XMA A;  1FT9 A;  1ZLJ A;  2EFW A;  4L5I A;  1J75 A;  4ZZL A;  2HQR A;  4Z2Y A;  5L3G A;  1LDD A;  3K69 A;  5E1X A;  4FT8 A;  1WSU A;  3E5X A;  2CQK A;  2EV6 A;  3K1N A;  5LHI A;  1KQ8 A;  2H94 A;  3I59 B;  4XBF A;  4PCQ A;  3MFK A;  3KEQ A;  2DW4 A;  3T8T A;  5LGN A;  1I6X A;  2H6C A;  5HDG A;  2OQG A;  4M72 A;  2FMY A;  1TW3 A;  2O03 A;  1LDJ A;  2IA2 A;  2E7X A;  3V8J A;  1G3Y A;  4U7B A;  3ZMZ A;  3CUO A;  3I0T A;  2GWR A;  2JT1 A;  1FYL A;  3QPH A;  1QNT A;  2XAS A;  1R23 A;  3VFZ A;  4HF0 A;  3ECO A;  3GZ5 A;  2QQ9 A;  2GA1 A;  2FBI A;  1P4W A;  4BHB A;  4KDP A;  4JK1 X;  3C7J A;  4LK0 F;  2BGC A;  1TQI A;  1PP7 U;  4L9N A;  1BC7 C;  4UVB A;  1P4X A;  2V1X A;  3PQK A;  1KU7 A;  4ENN A;  2FOK A;  3FXU A;  2NAZ A;  4I7H A;  2IW5 A;  3IWF A;  4TV7 A;  1YQA A;  2UXX A;  3E6M A;  2K4B A;  5CVR A;  3HHG A;  3H3Z A;  4OIO F;  2EB7 A;  1SD7 A;  2P7V B;  4ENM A;  5D5U B;  3CUQ B;  5BPD A;  4FX0 A;  2ZXJ A;  4NB5 A;  2Q8K A;  3ZN1 A;  4EJO A;  4ENJ A;  3FMS A;  3U1D A;  3FXR A;  3WE2 A;  2H6B A;  1R1V A;  5FFX A;  1PP8 F;  4M74 A;  5BQT A;  3HRS A;  2DFI A;  4RGX A;  3HUG A;  1ZG1 A;  2P5K A;  2MA3 A;  1EV7 A;  2HWV A;  4BYY A;  3H3U A;  1EH6 A;  4A5N A;  4MTE A;  3CUQ C;  2CGP A;  1ZG5 A;  4GO1 A;  1T98 A;  3R0A A;  1ZN2 A;  1IF1 A;  2COM A;  1MD0 A;  1KQ0 A;  4EGZ A;  3E3V A;  5FD6 A;  1REP C;  3ZMV A;  4M9Z A;  2MD5 A;  3KP5 A;  3VOD A;  1LJ9 A;  4KNY A;  3IL2 A;  5FLX K;  1XGO A;  3P9I A;  4IRH A;  3F72 A;  4ON0 A;  2BV6 A;  4UV9 A;  3QAH A;  5E1Z B;  2PJP A;  4HDV A;  2J5O A;  2HOE A;  5LEK A;  2PQ8 A;  1DPR A;  2DT5 A;  4N0B A;  1ZAO A;  4KYW A;  2X0L A;  3F6V A;  1F5T A;  4HF2 A;  4A6D A;  2HEO A;  1F9N A;  4Y17 A;  2KRF A;  3JW4 A;  2YX7 A;  4FHT A;  2VE9 A;  1U6G A;  2LKP A;  4HLX A;  1HKQ A;  2W57 A;  1D5V A;  4UXN A;  3L2C A;  1ON1 A;  2IPQ X;  2MC3 A;  2FQ3 A;  5HVQ C;  4ESB A;  3T5X A;  2VOD A;  1R5H A;  2QBY B;  3FM3 A;  1XD7 A;  3M8E A;  4B8X A;  3ERE D;  3IWZ A;  4HBL A;  1YS7 A;  1EH7 A;  2JSC A;  1XGN A;  4WXH A;  1BJA A;  1ZHF A;  3LAJ A;  4OMY A;  4UVC A;  4RAZ A;  1UCR A;  3LWF A;  2XIG A;  4QWQ A;  1FPQ A;  3WTX C;  3F6O A;  2AS5 F;  2P8T A;  3IKV A;  2QLZ A;  3R0J A;  4RGS A;  1S29 A;  3RYP A;  4R79 A;  3SZP A;  5E8I A;  4EJU A;  1WKM A;  2JRT A;  2VE8 A;  3HTS B;  3F8C A;  2EFO A;  1IRG A;  2MH2 A;  2AXL A;  1EH8 A;  1YW7 A;  1QPM A;  3O2P E;  1LQ1 A;  5K5R A;  2ZNY A;  5L3E A;  2R7D A;  4KT5 C;  3SZT A;  2RN7 A;  2VXZ A;  4BXU A;  4KIB A;  1TLH B;  4IF4 A;  4LB6 B;  3RDI A;  4IRG A;  3RKY A;  3EUH A;  1XSD A;  1RUN A;  1H9T A;  4MEX F;  2O3F A;  4CDG A;  1KYW A;  3EYY A;  3W6J B; 
#chains in the Genus database with same CATH topology
 3K2A A;  1U8R A;  4FE7 A;  2H27 A;  2LMD A;  2R7U A;  4Y4R A;  3KLO A;  1RKW A;  1WH5 A;  1WH7 A;  1YIO A;  2ID3 A;  4NQW B;  2WY8 Q;  5E3N A;  3S2D J;  2HYG D;  3JRG A;  5CVJ A;  2VJ4 A;  2RNJ A;  2MH9 A;  1QRY A;  2BZT A;  2GOX B;  3RPU A;  3ZR8 X;  5GPA A;  1WHU A;  4KIF A;  3MWM A;  4XOR A;  3EET A;  1JXS A;  2PMH A;  3I59 A;  1FEX A;  2FOW A;  3M7G A;  2VPR A;  5B1A H;  1SAX A;  2OF7 A;  5BOX A;  1L3L A;  4I09 A;  5LRS A;  3C18 A;  3V7S A;  3WG9 A;  3KYL A;  2QF7 A;  5IT9 Z;  3HGG A;  4PSX A;  5E1W A;  2E1O A;  4JP0 A;  5CQE A;  4V2F A;  3ERM A;  1IXR C;  3BPX A;  3S1M J;  1Z1D A;  2DA2 A;  3G1L A;  2QQ8 A;  4ZYD A;  2E36 A;  5E17 F;  1WWX A;  1Z7U A;  3H36 A;  4XN3 A;  5CPR B;  1G4D A;  4M3E A;  1WJB A;  2RAE A;  3KCC A;  4KFC A;  3JSO A;  5JR3 A;  2XUB A;  4FAS D;  1RZ4 A;  5EG0 A;  1O3T A;  4LFU A;  2DK8 A;  1YRN A;  4UHT A;  3W6K B;  1YO5 C;  4PSW A;  1P4A A;  4B3X A;  1DGR M;  2DOE A;  2IBD A;  4QPO A;  3L2U A;  1EA3 A;  4AIK A;  4HX8 A;  3Q0V A;  4O5V A;  3O3K A;  6PAX A;  2R7S A;  1TWA J;  1TWC J;  1HA8 A;  3S3M A;  3HSE A;  2KPM A;  1XCV A;  1MDM A;  2QQA A;  2DAO A;  2EZL A;  4G6D A;  2Y9Y A;  3EQL F;  2Y0M A;  1JUS A;  2NOJ B;  3RZD J;  4IPA A;  3VDX A;  1BBY A;  2M3A A;  5BMZ A;  1FOK A;  1R4M B;  2FU4 A;  2IGN A;  5D5V B;  5F08 A;  1BI0 A;  2DXI A;  3GVA A;  1FIP A;  3I64 A;  1TWF J;  4ESF A;  2OQR A;  1KU9 A;  3HYI A;  1ZQ3 P;  3DF8 A;  1QQI A;  4LG0 B;  4BNC A;  2HOS A;  4IKF A;  3T1B A;  1HSJ A;  1R49 A;  3AG3 H;  2W00 A;  1WGX A;  3DTE A;  3FXJ A;  5FB2 A;  5LFA A;  1IRF A;  1D0Y A;  1V54 H;  1EKE A;  3H35 A;  3EDP A;  2HQ5 A;  4PUS A;  4YEL A;  1ERD A;  1XG1 A;  4DZJ A;  3HTU A;  1IRX A;  3LQR A;  3KET A;  1O3S A;  4DIQ A;  3MZ8 A;  1ZG3 A;  1S6L A;  1WRJ A;  2H1L A;  4GYI A;  1HBX G;  1HF0 A;  1QU3 A;  3IV5 A;  3IH3 A;  2XGE A;  3CO6 C;  2HXI A;  2VBZ A;  3TDZ C;  4B44 A;  4CCO A;  4P9U A;  2M0M A;  2M8E A;  3D1N I;  3N97 A;  3QPS A;  3B02 A;  1X1P A;  1I39 A;  3DU5 A;  3F9K A;  2DMT A;  2ISY A;  1V5G A;  4E7Z A;  3WTS C;  1D1B A;  4ZYH A;  3QYF A;  2AHQ A;  4Z6Y A;  3WTW C;  1BIA A;  2RQP A;  1HCR A;  4KA4 A;  3ABM H;  3BQZ A;  2BW3 A;  2VC0 A;  5C3E J;  2CJJ A;  5HLH A;  1ETV A;  2DYR H;  2CH0 A;  4BKX A;  1VFC A;  1U0J A;  3PUB A;  2QKM B;  4QSH A;  3HSF A;  1N78 A;  2OTJ I;  4IJA A;  5EDN A;  2LSO A;  3JRA A;  1LDK B;  4I0A A;  1X1D A;  4XIC A;  3BZK A;  2ZJ2 A;  4BGD A;  1VQN I;  4IOA F;  1WJF A;  2BY3 A;  2UZK A;  1SAU A;  2LNB A;  1ETQ A;  3K4B A;  5IPA A;  2R4G A;  2X4H A;  1LB2 A;  2X48 A;  3MEX A;  4XLN F;  2K86 A;  2E34 A;  4BXF A;  4YFK F;  5J47 A;  5HDN A;  4NC7 A;  2X1D A;  3GFL A;  3RJP A;  5D5W B;  3FHZ A;  2V9K A;  5IP9 J;  5FJ8 J;  3ROU A;  2O6G E;  1I27 A;  2WB1 A;  4MQ9 F;  2F4O B;  1X3U A;  4A6E A;  2M2E A;  1JUM A;  4G7H F;  3JTG A;  1S8N A;  3NAU A;  4F93 B;  4U0V A;  1Q1H A;  2L3D A;  1Y8R B;  4II2 A;  3VYT B;  4GRI A;  2NYX A;  4HNV A;  2ISZ A;  2Z33 A;  5HS7 A;  2K27 A;  2QBY A;  2V6E A;  3TW7 A;  3H92 A;  1IXC A;  3ZN0 A;  1Z91 A;  3ABU A;  3DFG A;  1UG0 A;  4YII A;  2K9M A;  2QKL B;  3F21 A;  5DM7 F;  2XAQ A;  4XNF A;  3OS1 A;  2KIS A;  4V2G A;  1HXD A;  4EMS A;  3A4C A;  4M6Y A;  1P6R A;  4BH9 A;  2DO7 A;  2DQL A;  3K6G A;  3GTJ J;  2TDX A;  4A3G J;  3AG2 H;  1MSE C;  3PM1 A;  2O8X A;  4KN7 X;  4L9T A;  5CYV A;  5IYB J;  2LVS A;  3I4P A;  5DEQ A;  3HKZ N;  2Y30 A;  4NUB A;  1XS9 A;  1MZB A;  3FHN A;  1B6A A;  5JVG F;  3BTJ A;  4P55 A;  1FSH A;  4L0Z B;  4XLH A;  3DEW A;  3JAM Z;  4M6X A;  1G3S A;  1ENH A;  3FM5 A;  3HZJ A;  1SD5 A;  3ZQQ A;  3L00 A;  5DCM A;  1QHG A;  3GW2 A;  3RYR A;  1WJD A;  1WI3 A;  5J4Y A;  2A6H F;  4C3J J;  2COB A;  2ACJ A;  2LR8 A;  2ID6 A;  4L9V A;  5ILS A;  1BM9 A;  9ANT A;  5TIS C;  3P9K A;  5F1R A;  1JTY A;  3DPU A;  3QYE A;  2MGQ A;  3HOZ J;  1IN8 A;  1TBX A;  2K7L A;  2LRE A;  2EZK A;  4CCK A;  1OQY A;  2F4M B;  3RKX A;  1HKS A;  3K4J A;  4LIU A;  4BBR J;  2XAH A;  5K1Y A;  2WV1 A;  2QA4 I;  1WFX A;  1YG2 A;  1V3F A;  1K83 J;  1ZGA A;  3ZQI A;  4XR6 A;  4EEF G;  1VQM I;  2GAU A;  2R7Q A;  2DOA A;  3DQV C;  5GAH J;  4JYK A;  1LE8 A;  3Q5F A;  4Q5S F;  3Q0U A;  1ZYR F;  2CQ7 A;  2M30 A;  2W84 A;  1UB9 A;  1IN4 A;  2KIM A;  1FMW A;  4HX7 A;  5KK1 A;  2WAF A;  1HKT A;  4I2O A;  5IYC J;  1WZ2 A;  2LG4 A;  3JAM K;  4CHU A;  1T0F C;  3R61 A;  4LG0 A;  4U88 A;  3RPQ A;  2ZFW A;  1JUP A;  5TJJ A;  3GFM A;  2YX4 A;  3HRU A;  3SFZ A;  4XRM A;  2JN6 A;  2F6C A;  4M3D A;  1LEA A;  5HNF A;  4J01 A;  3ZMU A;  2STT A;  4OU0 A;  2Z9O A;  4X6A J;  3S1R J;  4DW6 A;  5A2Q Z;  1ACI A;  1K78 A;  2D1H A;  1UJ8 A;  2VQG A;  4H4K C;  4P9F A;  5GPC A;  4UB6 C;  4UY8 I;  3BY6 A;  2FEZ A;  4BDZ A;  1EJ9 A;  1V5E A;  4O6J A;  5KHD A;  2AXT C;  1S9H A;  1XDS A;  3VYU B;  4XRF A;  1GVJ A;  1BW6 A;  5D4R A;  4CGZ A;  2OJE D;  4GXO A;  5FKN A;  3JRB A;  1BC8 C;  3KP4 A;  1K4S A;  2L4M A;  4KMF A;  4IZZ A;  3BPV A;  1E3O C;  3G6E I;  5EEH A;  1I3A A;  2DOF A;  5J1Y A;  5KVR A;  1E17 A;  3LA2 A;  2CMP A;  3LSM A;  1IN7 A;  2DQR A;  3PL8 A;  4WXC A;  3B73 A;  1J0R A;  2VC1 A;  2X51 A;  2EA4 A;  1IW7 F;  2QWW A;  3I53 A;  3JSP A;  2WY7 Q;  3KP3 A;  4OAY A;  1RES A;  4F7Z A;  3UR3 C;  3ZP5 A;  3PIO F;  2EFP A;  2E2I J;  2GOM A;  2QYO A;  3ML6 A;  5AON A;  2P7C B;  1QZY A;  1DU6 A;  2FF4 A;  2EV5 A;  3BT9 A;  3ISP A;  1SVO A;  2QCO A;  3KZI C;  3K1P A;  1B72 B;  4PFP A;  1ZTR A;  3D5S C;  3BZC A;  1I6H J;  2HR3 A;  5FD5 A;  2R5Y A;  3MKW B;  3SHF A;  4E7L A;  1T6S A;  4RM3 A;  5EEA A;  3G1M A;  3COA C;  3L7W A;  4GYG A;  4EM0 B;  4HST A;  5ERI A;  4A3D J;  2VT2 A;  3CJQ B;  4DYQ A;  3MMY B;  3B6A A;  3TGN A;  5IT9 K;  1AWC A;  2CWE A;  3TED A;  3SEQ A;  2YU9 J;  3FXQ A;  2PBI A;  5E3O A;  3CF5 F;  3C2G A;  4WF2 A;  2UWM A;  2KJB A;  1POG A;  2HYF A;  2XSJ C;  3H5N A;  3WTZ A;  3MAJ A;  2F5V A;  3G73 A;  1J9I A;  3WGI A;  2VPL A;  2P6S A;  1ETY A;  3BR0 A;  4AID A;  3L9F A;  4Y33 A;  1A36 A;  2E2H J;  2NRA C;  3A2K A;  5HDK A;  3IC7 A;  1OCP A;  4BAY A;  1X19 A;  2JSP A;  2L02 A;  2A61 A;  2XB5 A;  2CG4 A;  1TTY A;  2FNP A;  1HOM A;  2KJC A;  3CCY A;  1D0X A;  2DMP A;  3SQN A;  2HXO A;  4CCM A;  3OYA A;  1VQP I;  3FX3 A;  4A3M J;  3I4N J;  2CFO A;  1MJA A;  1XMX A;  3PO2 J;  3KP2 A;  2A6E F;  5D8L B;  1W1W E;  1LFB A;  2EBI A;  5IP7 J;  1N25 A;  1TC3 C;  1RNL A;  4P5O A;  3E6B A;  2CUE A;  1TP4 A;  4X1E A;  4AWX B;  2CQQ A;  4OWR B;  5JHF A;  2PEX A;  1DGW Y;  5EZH A;  3REO A;  1U8B A;  5AIP A;  2P81 A;  3O6B B;  2OZ6 A;  3OYM A;  2KQR A;  4E7J A;  3LST A;  1HDP A;  4RA2 A;  5CVU A;  2Z99 A;  5IY5 H;  2O0Y A;  1W5T A;  4RS8 A;  1R00 A;  1W0T A;  3A02 A;  1SEU A;  2QZ8 A;  4WX9 A;  1SFO J;  3H9J A;  1JT0 A;  3UKG A;  3CJT B;  1O3R A;  4AIJ A;  1BJZ A;  2DTR A;  1BR1 A;  4LG3 A;  4BBS J;  4IHT A;  2CW7 A;  3FKJ A;  3GFI A;  4BU2 A;  2CUF A;  1U5T A;  2HVQ A;  1OYW A;  3S14 J;  2HTJ A;  5J8C A;  4WXD A;  3NEU A;  3GTK J;  1L0O C;  1SFX A;  3EUH C;  3WTU C;  1IUY A;  1UHM A;  3FXK A;  1SVM A;  1B9N A;  2BW3 B;  4HNT A;  3AKZ A;  2XPU A;  4HQE A;  2FSW A;  2B63 J;  2HTS A;  2FBH A;  3HM5 A;  1W36 D;  2XGD A;  3X2Q H;  4LLL A;  3V7R A;  3M3Y J;  4G8X A;  2V1D A;  2Y48 A;  4AYB A;  2L9N A;  1X1B A;  3S16 J;  2L7M P;  1FMV A;  1JHH A;  1S7A A;  5M5W J;  1S3J A;  2AQE A;  3N4M A;  1A6I A;  3CTA A;  3H9Q A;  1IV6 A;  1UHW A;  2MLK A;  3OV8 A;  1PUE E;  3HRT A;  5E79 C;  2LFB A;  5AIQ A;  1P2F A;  3AL0 B;  4HX4 A;  1WI9 A;  1Z6R A;  1R1U A;  4G94 A;  3U9G A;  3I55 I;  1YIJ I;  1FBS A;  4NDL A;  3F23 A;  1D5Y A;  3FF5 A;  2NS8 A;  1B9M A;  1YYV A;  1ETW A;  2GBY A;  2V1N A;  2G0E A;  3QP5 A;  2W82 A;  4HZF A;  4DYC A;  5CKT A;  1M1E B;  2Y75 A;  2IS1 A;  2FBK A;  3P5J A;  3GX4 X;  2EA2 A;  1DP7 P;  2R7V A;  1R4N B;  4LD5 A;  2IGM A;  1FLI A;  1VQ7 I;  2W25 A;  4I6Z A;  1JKP C;  3R60 A;  5FKO A;  3DTK A;  2CUZ A;  3ELK A;  3WU2 C;  2A05 A;  3MD2 A;  3I71 A;  4DOZ A;  2JJ7 A;  2K40 A;  3FK7 A;  1BW5 A;  3N05 A;  2R5Y B;  1E3H A;  4PJM A;  3BTC A;  2MBF A;  1B72 A;  1QGP A;  2EIN H;  2Q2E A;  5IOZ A;  3AG4 H;  3WU0 A;  3TP0 A;  3FXL A;  2EJR A;  2A68 F;  1I5Z A;  1R5I D;  1A35 A;  1ZK8 A;  1YFH A;  2FE3 A;  5JVT A;  4XSX F;  5LEJ A;  5CLS A;  2R3S A;  5H6Q A;  4F91 B;  3QPL A;  4G9Y A;  2VXD A;  1Z3X A;  5LLQ A;  4B09 A;  4S05 A;  3ESW B;  4J00 A;  2DK5 A;  3KZY A;  3CC7 I;  4L0Y B;  1FZP B;  1W0U A;  4AYB N;  2V79 A;  3ABL H;  1X1A A;  4M9S A;  5DV5 A;  3QOE A;  3GF2 A;  3TDU C;  3K4K A;  4ABZ A;  1PDN C;  2DBB A;  3U2R A;  3DCF A;  5K7F A;  1TQM A;  4BY7 J;  3TOB A;  2DJI A;  2E1M B;  2M1B A;  1XX5 A;  2ZKZ A;  3RIR A;  1RUO A;  2DT7 B;  2O7O A;  4A2U A;  4F3Q A;  4BE1 A;  2O61 A;  2RKH A;  1CQT A;  3QYB A;  5FRO A;  3AL0 C;  2K85 A;  1AHD P;  4CO8 A;  4CYD A;  4D7N A;  1V4R A;  4XK4 A;  3KLN A;  1RI7 A;  2FJ1 A;  3VB2 A;  3CCJ I;  1Y1V J;  4BJT A;  4DNC A;  1G3W A;  2KFD A;  3HDD A;  5HLT A;  4ZYE A;  1R71 A;  1O7L A;  1XB4 A;  2OCE A;  2LOO A;  3LFK A;  4EM1 A;  3H0D A;  1CF7 B;  1Y0N A;  3E7L A;  3K70 C;  1BIB A;  2XB0 X;  4A12 A;  4RB2 C;  2L7F P;  4S04 A;  2PJR B;  1T95 A;  4A0Z A;  3T0Y A;  2L54 A;  4A3K J;  3HSR A;  4UUS A;  3HC7 A;  4XKW A;  1H88 C;  2JTV A;  4K2E A;  2EK5 A;  4MIM A;  1X2M A;  2EFQ A;  3J7A Y;  1O57 A;  2JPC A;  2E1N A;  1GXP A;  2R7T A;  3F22 A;  3DKX A;  2HS5 A;  2KIU A;  4HYE A;  5HNH A;  3WGH A;  2HQA A;  2VKE A;  1ZRD A;  1OLT A;  1J5Y A;  3M1C A;  2QEX I;  1F36 A;  1Y6I A;  3RPU D;  5E18 F;  5DYM A;  1U78 A;  3DP7 A;  4E4H A;  2EV0 A;  3LMM A;  3H9G A;  3GME A;  1Y1W J;  3GLX A;  1GHC A;  3RI4 A;  2KHM A;  2UUZ A;  3BQY A;  1FOY A;  4XQF A;  3AFH A;  3A03 A;  4OIQ F;  3VPR A;  2C6Y A;  4IOC F;  2XPW A;  2LBF A;  3KFW X;  4C2U A;  2DLL A;  3A1Y A;  3PSF A;  2XRL A;  3ZRG A;  4U0W A;  4M3F A;  1NG6 A;  4IHS A;  3BZ6 A;  4XN0 A;  3PNY A;  3SYT A;  2F5C A;  1T2K A;  3LL7 A;  4B43 A;  4BJ5 C;  5F6F A;  5HLI A;  3R4K A;  4CZC A;  3ZGK A;  4XON A;  4ESJ A;  3I54 A;  4HA8 A;  3DXJ F;  2VIX A;  3H1C A;  2V7F A;  1UAA A;  1SFE A;  1ZR2 A;  1S7O A;  3ZQ7 A;  1TNT A;  4LLG F;  4WK8 F;  3DBL B;  4KJZ A;  3WTT C;  2L01 A;  1OR7 C;  1DUX C;  3SEZ A;  2LF8 A;  4OMZ A;  3HGY A;  3BR2 A;  1J2X A;  4HQM A;  2V26 A;  1K61 A;  3ZMD A;  1B59 A;  2BXY A;  5F0H A;  4C3H J;  3MVP A;  3F8F A;  4HSR A;  3BTL A;  4BE2 A;  3IRQ A;  4ZYG A;  2O5R A;  1OCT C;  4EJW A;  1E2X A;  1GVD A;  2DYS H;  1MNM C;  1VF9 A;  1S7E A;  2CFX A;  2ZNZ A;  1KA8 A;  4D1Q A;  2JUG A;  3CUQ A;  3L09 A;  2OD5 A;  2LC2 A;  3PIP F;  3M07 A;  4A3E J;  2IRF G;  4A3L J;  1ZR4 A;  1MGT A;  3PNT A;  3MKY B;  2TCT A;  3VEP A;  2HFH A;  2RNG A;  4ASN A;  1Z7L A;  1SMY F;  4H0E A;  1GV5 A;  4AD9 A;  1MBK A;  1XC5 A;  1Z9C A;  1W5C C;  3QU6 A;  1C0W A;  2B0L A;  2IS6 A;  2QEN A;  1MBF A;  4NNJ A;  5FKK A;  2GQQ A;  2R7W A;  1O3Q A;  1MMS A;  1E3P A;  2CS3 A;  4BL0 B;  4FX4 A;  3V8L A;  4LLN A;  2DFH A;  3C3W A;  3OYH A;  1R5G A;  2PFB A;  1P7I A;  1Z0X A;  3OYN A;  3W2A A;  1DQU A;  4KIC A;  3JRD A;  2FX0 A;  4FQG A;  2FA5 A;  5D6F A;  3TO6 A;  3PJR A;  3PFI A;  4XSZ F;  4ZTJ A;  4RB1 A;  2ESH A;  2XSD C;  2HPI A;  1TW2 A;  3F8M A;  2A69 F;  5F64 A;  2RRE A;  1IXS B;  2BYV E;  2DA3 A;  1VQ8 I;  2DMU A;  3M8F A;  1OCO H;  4UUV A;  2MFZ A;  2VT3 A;  3W2V A;  2EFN A;  2R7X A;  4XLF A;  2HI3 A;  3GTQ J;  1WJC A;  2YR2 A;  4MEY F;  3PO3 J;  2E1M C;  1ETX A;  2BXZ A;  4HDU A;  1ULY A;  5L3D A;  1TQP A;  2KKO A;  2R7F A;  3RKW A;  1UEL B;  4YG2 F;  2R7Z J;  3ZQL A;  3LSK A;  2DMQ A;  5GP9 A;  2HVS A;  2VLA A;  2M5W A;  4B48 A;  3GTM J;  4XKC A;  3GLL A;  4UNO A;  2L0K A;  5EF6 A;  2R92 J;  4I02 A;  1HW2 A;  1VQL I;  5JHU A;  3DPT A;  3FMR A;  3RSN A;  1T0F A;  1OIS A;  2DMN A;  2ZSI B;  3CME I;  1U9N A;  2W24 A;  4RAG A;  1D8J A;  5CJ9 A;  3HOW J;  3F8B A;  3SZG A;  4HV6 A;  2JA5 J;  3OYI A;  3OR2 C;  3GO5 A;  2PI0 A;  2NVX J;  3DKW A;  1FJL A;  1U5T B;  3WG7 H;  3IHU A;  5ICG A;  3NQO A;  1GV2 A;  1JKQ C;  2W4S A;  2VOP A;  1LKX A;  3HEF A;  4PZJ A;  1MSF C;  2Z2S B;  3HUG B;  3K0L A;  3BG9 A;  2I8D A;  3KP6 A;  1TL8 A;  3V8K A;  1BI2 A;  2OA4 A;  1D8K A;  2Y2Z A;  4A5M A;  3Q0W A;  5LBQ A;  1JE8 A;  1YJ9 I;  3CCU I;  5FKL A;  1SFU A;  4JX5 A;  1Z21 A;  4ETS A;  5L3B A;  1R1T A;  3OR1 C;  3TW6 A;  3VYS B;  3E5Q A;  1OYY A;  2QSG X;  2IA0 A;  4FTH A;  2X6W A;  2N8G A;  2NVQ J;  4CUG A;  4GCV A;  2DPD A;  3QOD A;  1KZH A;  3CES A;  4E7S A;  2MC4 A;  2V6C A;  4N4O B;  1BR2 A;  2FQ4 A;  4IEJ A;  4XM3 A;  4ZJZ A;  3QU3 A;  4RLF A;  1U9O A;  1KQ9 A;  4RGR A;  2IGO A;  2LK2 A;  3CMA I;  3OYD A;  3EYI A;  1FYM A;  5D6E A;  1VQ5 I;  3GTL J;  2F2E A;  4XKB A;  4PGG A;  2M7B A;  4M3B A;  3K1M A;  4I76 A;  5DTD A;  5IP6 A;  2HZT A;  3M1E A;  1R22 A;  1A6Q A;  3BRO A;  1YW9 A;  1QO0 D;  2QSF X;  3FBI B;  1S5L C;  3GBG A;  4XRS G;  3ABK H;  4KUM A;  1MBH A;  1ZRF A;  3ZCO A;  3NAR A;  4IQ4 A;  3HIF A;  1QBJ A;  4A3J J;  3FZV A;  2YU3 A;  2BVM A;  1GLN A;  1RIO H;  2RDP A;  1LEB A;  4RAF A;  2BY2 A;  3JRE A;  3DTI A;  2LD5 A;  1FTZ A;  5CQG A;  1ZGJ A;  1RKT A;  4G6T B;  2IJL A;  2P5V A;  3S3N A;  2GXG A;  5FLM J;  2W7N A;  1XSX A;  3GTO J;  3KEO A;  1AKH A;  2CU7 A;  1YS6 A;  4QPQ A;  5B5E C;  3MZY A;  3CC2 I;  1APL C;  2IVM A;  4CYC A;  1U3E M;  1GT0 C;  1FBU A;  2RC4 A;  2R5Z B;  1FOW A;  1FNN A;  2V9V A;  1LE8 B;  1AOY A;  1OYI A;  3L2Q A;  1FSE A;  4BEH A;  2Z5U A;  2XAJ A;  2LKX A;  4Y15 A;  3OIO A;  3J80 Z;  1MNE A;  2XHK A;  4XKV A;  1RET A;  1K79 A;  2ZME B;  5DD4 A;  2M0C A;  3TMO A;  4D5F A;  4L5J A;  2P4W A;  3D5L A;  5HOD A;  1QA6 A;  1XCB A;  1R9T J;  3CZ6 A;  1OR7 A;  2XKO A;  1NHA A;  5HS8 A;  4R8H A;  3CMY A;  2MSY A;  2ZXI A;  4RAY A;  2YSR A;  4IVN A;  4P96 A;  2ADU A;  3TL4 X;  3OYG A;  3QP6 A;  2VQC A;  1FWZ A;  3BG7 A;  4YFX F;  3HOY J;  1UHS A;  2CO5 A;  3E0J B;  3DBH B;  1MND A;  2FXA A;  3DLL F;  1UG2 A;  1XSV A;  3C1D A;  3CCQ I;  5KCM A;  1IDZ A;  1FP2 A;  5HOO A;  2MG4 A;  3VYR B;  1QZZ A;  2XAF A;  2CW0 F;  1DP3 A;  1SD4 A;  2V4J C;  1W7P D;  1QPI A;  4MNU A;  3JR9 A;  4FET A;  4CYC B;  2VON A;  4QIW N;  5JLW A;  1CF7 A;  2M4K A;  1MKM A;  2DT6 A;  4PFO A;  3CCE I;  4A3I J;  1T39 A;  3Q9V A;  2ZME C;  4L5E A;  1G6N A;  4HV5 A;  1P9Q C;  5D4S A;  5F0F A;  3LSI A;  1T56 A;  2L5Q A;  3LA3 A;  3SJM A;  2D1V A;  4DYR A;  4L18 B;  3BCB A;  2BY1 A;  1STZ A;  3G4S I;  1BL0 A;  1JGS A;  2G7H A;  1A04 A;  3D5R C;  2K9N A;  1JHF A;  2HDC A;  2IAI A;  3K10 A;  3MQ0 A;  2EZH A;  1G8X A;  3H0G J;  2UV1 A;  1KON A;  3DKY A;  4AC0 A;  3LNQ A;  4QTR A;  2GLO A;  4HPQ A;  5DDG A;  4MQV A;  1V5F A;  3WHC A;  4YEJ A;  4ZC3 A;  2F48 A;  4V19 K;  4PJN A;  3PFY A;  3VSK A;  2FUG 2;  2XV4 S;  1VTN C;  4XMY A;  4II3 A;  1BI3 A;  3BJA A;  3DLA A;  2G9W A;  1UST A;  4RB0 A;  2OUM A;  4HNU A;  2AQF A;  1IO2 A;  3BWG A;  3MCZ A;  3S15 J;  5M5Y J;  3ASN H;  1OJL A;  5EGO A;  2E35 A;  3CP8 A;  2UXN A;  2Y9Z A;  4XL9 A;  3W2W A;  2FRH A;  3NWT A;  3QOP A;  5ICF A;  3MN2 A;  4D7M A;  3HJE A;  2M34 A;  3H5R A;  2XDV A;  3OOP A;  1BI1 A;  1YLF A;  3IAM 2;  5M3F J;  1YW8 A;  2XAG A;  1XGS A;  2ZJQ F;  2QSH X;  3CO7 C;  4BY1 J;  3ONQ A;  5HLG A;  5KNL A;  2WWY A;  1ETO A;  2X6O A;  2OV7 A;  3IH4 A;  3OL3 A;  3BJO A;  3E1S A;  4BQN A;  2PN6 A;  2RV8 A;  2HYJ A;  2XVC A;  4EV0 A;  3S3O A;  4D0P A;  2DA6 A;  3GUD A;  2WB1 N;  4QLC U;  4EJV A;  1MMA A;  2XRN A;  4DJA A;  1VQ9 I;  3HHH A;  2HKO A;  5LHG A;  3DPL C;  3DV8 A;  2O8K A;  2DU9 A;  1HC8 A;  2IT0 A;  2VBX A;  2H1K A;  2HQN A;  3K9T A;  4PGH A;  1FX7 A;  3AG1 H;  3K4M A;  3GTP J;  3P9C A;  3HKZ A;  4LJZ F;  3O8G A;  3V4G A;  2PX9 A;  3GXO A;  2FNA A;  5B3S H;  2J5P A;  3HG9 A;  2KIF A;  3Q3S A;  1ITY A;  2VBY A;  4A3F J;  2KDZ A;  2L9V A;  1YOV B;  5H2F C;  3HOV J;  4LIV A;  4BQQ A;  3WTV C;  3S32 A;  2XGX A;  2ELH A;  3CC4 I;  3QQA A;  2GA2 A;  4F55 A;  4JX4 A;  4XLC A;  4G7O F;  2D5V A;  2LDU A;  2DCE A;  4CIC A;  2NNY A;  2RVC A;  4UUS B;  1MMG A;  1ZEL A;  1JJ8 C;  1KGS A;  5DD8 A;  4B47 A;  3VSL A;  2ZCW A;  3P7N A;  5KAF C;  5EJC A;  4CXF A;  2QM3 A;  2R5Z A;  4NC8 A;  4EGY A;  4C30 A;  2PLY A;  3OYL A;  3CCR I;  2CYY A;  3KEY A;  3HBL A;  1BR4 A;  3S2W A;  3CD6 I;  5ILV A;  1AKH B;  2L7K A;  2ME6 A;  4FCY A;  2CQX A;  2CV1 A;  2STW A;  1F43 A;  2CW8 A;  5IT3 A;  4B3A A;  1ZH5 A;  3DU6 A;  3PUF A;  2VJI A;  1K78 B;  3R6S A;  3OOU A;  2E60 A;  2QVO A;  4I01 A;  1NG7 A;  3IUO A;  5DCF A;  2E1C A;  3DEE A;  2XF7 A;  2OZU A;  1T8I A;  1H0M A;  1UFM A;  3S17 J;  4HG2 A;  1BA5 A;  3F8N A;  4OIN F;  5C4X J;  4F92 B;  4DBQ A;  1BOA A;  3C2B A;  3ECH A;  3J7Z I;  3G3Z A;  4BQA A;  3QRF F;  3GZN B;  3H3V K;  5D5X B;  3H5A A;  1DPU A;  1F4K A;  2EZI A;  3LSG A;  1MH3 A;  4O3M A;  2BEO A;  3L2R A;  1B1B A;  5D8K B;  3K4L A;  1VQK I;  4IHX A;  2E5Z A;  5E8G A;  3ZOB A;  5ED4 A;  2R7R A;  5EG0 B;  4C3I J;  1AU7 A;  5H6R A;  5ICE A;  3ZXS A;  3CF2 A;  1PVE A;  3L2W A;  1SVL A;  2GIZ A;  2I10 A;  2B9S A;  1I1G A;  3OL4 A;  3GFJ A;  2Q2E B;  2WTE A;  2XAU A;  1Y8Q B;  3S93 A;  3J81 Z;  2E2J J;  2HGC A;  1K6Y A;  1J59 A;  2OCC H;  4EQQ A;  1FY7 A;  3TO9 A;  1IV8 A;  4M6V A;  5FLV A;  4BUP A;  2OBP A;  3FMQ A;  3E97 A;  2PMU A;  2H8W A;  4OOI A;  3NWS A;  3MKL A;  4E70 A;  5JI6 A;  4CA0 A;  1W5S A;  3BR5 A;  4YFN F;  5FGM A;  3FXO A;  2V1U A;  3IRR A;  4DBR A;  2H8R A;  4HF1 A;  4A3C J;  3ZQC A;  2M8G X;  4XLA A;  3KE2 A;  4BAC A;  3OS2 A;  2IXS A;  2PMZ N;  2RGV A;  4AIH A;  1MH4 A;  1ON2 A;  2W85 A;  2ELK A;  3FKI J;  3TKY A;  2L9R A;  2ZB9 A;  2Z16 A;  2QQB A;  4PK4 A;  4ZYA A;  5EEG A;  5M5X J;  1QHH D;  1H9G A;  1XGM A;  2DFE A;  3CDH A;  2Q0O A;  3PSI A;  3E6D A;  1MDM B;  1GXQ A;  2V9P A;  4BDY A;  4IRI A;  4B4C A;  1B4A A;  1Z05 A;  3M4O J;  4C2T A;  2JK3 A;  5E3L A;  3FWE A;  1HLV A;  1BN5 A;  1X58 A;  1O4X A;  3ZQF A;  2OU2 A;  1IRZ A;  2BE5 F;  1YRN B;  4BQO A;  4E7I A;  2KLO A;  5DUK A;  1FP1 D;  3CJN A;  4N9I A;  3TP3 A;  4WCG A;  1U2W A;  4OIR F;  2CQN A;  1E0E A;  3OMY A;  4ENK A;  5GAE J;  4XOP A;  2H09 A;  3W3C A;  3LSH A;  1QVU A;  1IGN A;  2VQH A;  2X9D A;  4RB3 C;  1OMI A;  1D3Y A;  3BJ6 A;  1KU3 A;  2R93 J;  4N9H A;  3KX2 A;  1O7F A;  1OCZ H;  2IS4 A;  1R6R A;  1W7P B;  2DA4 A;  4NHJ A;  2VN2 A;  1MW7 A;  3WGG A;  2Z1D A;  2HDW A;  4Y52 J;  1Y0U A;  2P6T A;  2KIQ A;  2RQQ A;  2WA0 A;  1FBQ A;  2DFF A;  3BR3 A;  1LVA A;  1RR8 C;  3O8H A;  1EF4 A;  1KU2 A;  4L9J A;  5LGU A;  1ZAR A;  3SDB A;  2OPT A;  4ZH4 F;  4HLY A;  4Q47 A;  3I3L A;  2DOD A;  3WOD F;  4F52 A;  3TOA A;  5ICC A;  5DUI A;  4KN4 X;  2O9L A;  1LPQ A;  1USS A;  2GXB A;  4AUX A;  2BOL A;  5H20 A;  2DTZ A;  1FYK A;  3E5U A;  4Y13 A;  2R7O A;  4CCL A;  3GYH X;  3OYK A;  3LFU A;  4XRS A;  1H89 C;  3WE3 A;  3V42 A;  3FBN B;  3MZH A;  4EJT A;  5A2Q K;  2A07 F;  5J1R A;  1HW1 A;  3G1O A;  3J7A O;  4A0Y A;  2K3P A;  4WWC A;  3OSF A;  5LGT A;  3OYC A;  3WHB A;  1RC9 A;  3I4M J;  1H8A C;  5BPI A;  4JQF A;  3J81 K;  1K7A A;  3ZPL A;  5TRD A;  4HW0 A;  2BVL A;  3B6C A;  2VJ5 A;  3ZMS A;  2M4G A;  2XRO A;  2M7A A;  3SDG A;  4M3G A;  4IL6 C;  4BHC A;  3C2H A;  1R36 A;  2NVU B;  4E7H A;  2DPU A;  4OIP F;  3I58 A;  3RKQ A;  1HW5 A;  2EH3 A;  4AU7 A;  4ZZD A;  2BBY A;  1KYZ A;  2YPR A;  5J6X A;  3HB9 A;  2DN0 A;  3LAP A;  1X1C A;  2E7W A;  2WC2 A;  3ZQH A;  2JZY A;  5FFZ A;  4XLP F;  3WU1 B;  1PJR A;  1SD6 A;  3HPH A;  3I5U A;  2ETH A;  1YX3 A;  5GTI C;  2ZBK A;  1T08 B;  4EM2 A;  3OYF A;  3KZZ A;  1ODD A;  4ANJ A;  4MO7 A;  4XLE A;  2F5F A;  5CVI A;  1TNS A;  2OAZ A;  5ILU A;  3M9A A;  5DCM B;  4DZP A;  2WV0 A;  3OSG A;  1YJN I;  4R1H A;  1U5T C;  3DWL E;  2KDO A;  1LUJ B;  2WAD A;  5L3C A;  1R7J A;  4GFB A;  1OPC A;  2M9H A;  2Q1Z B;  2OTL I;  1FOX A;  4LOC A;  1WJE A;  4M9X A;  4BHP A;  3LQQ A;  3WTY C;  2CSO A;  3BG6 A;  2A5Y B;  1IDY A;  3QPT A;  5J40 A;  1V55 H;  3CCL I;  1ZLK A;  1VND A;  3PQJ A;  3GZ6 A;  2VUM J;  4AVP A;  4ZDO A;  1YE9 A;  4Q4Z F;  3Q9S A;  3NRV A;  1P92 A;  3LOC A;  2LYC A;  1HQC A;  2EIJ H;  4G7Z F;  1CGP A;  4IXA A;  1Z6T A;  4S0H B;  5F27 A;  4C9Y A;  4D5C A;  1DDN A;  2F5D A;  1HST A;  3OIP A;  2QUF A;  5LRR A;  3J80 K;  1VQO I;  3JRF A;  1ZRC A;  2JA2 A;  3TQN A;  3BDD A;  1WQ2 A;  2M87 A;  4YIF A;  2FML A;  3EPZ A;  2VI6 A;  3HOT A;  1F1Z A;  2CV2 A;  2EIK H;  3EUA A;  2E5N A;  4ZTF A;  2JPB A;  3K2Z A;  3CLQ A;  2A6T A;  1MJB A;  4HOB A;  2JVG A;  2VKV A;  4UV8 A;  3HOS A;  4M71 A;  2HDD A;  3BR1 A;  3ULQ B;  2XPV A;  1XDU A;  2IEK A;  3FK6 A;  2HOT A;  1A5J A;  3S8P A;  5CVV A;  3E6C C;  4I0B A;  4CZZ A;  4IO9 F;  1SAN A;  2IP2 A;  3VOE A;  2NVT J;  2W48 A;  3RQI A;  1J7K A;  1X3Z B;  1AA7 A;  1LFP A;  2IA1 A;  3ABT A;  4LGW A;  4RM2 A;  5C44 J;  3JRI A;  2VKH A;  4G6Q A;  1R58 A;  1MJ9 A;  1IG7 A;  1ONV A;  1SC7 A;  3OYB A;  3BP8 A;  2F4I A;  5K5O A;  2YS9 A;  4MTD A;  4NQW A;  5FLX Z;  4N4N B;  1NK2 P;  2LF7 A;  1GDT A;  4NC6 A;  3W6V A;  2LBF B;  2LTP A;  2NS0 A;  1W7P A;  1G3T A;  1ZGW A;  4PJL A;  4DQ2 A;  3AAF A;  2VOO A;  2ESN A;  1WPK A;  2HOA A;  1BOB A;  1W4M A;  1OKR A;  3RTR A;  1XPX A;  2NOG A;  5F0C A;  1JTX A;  1YTY A;  4Q48 A;  5LD2 C;  2K9Q A;  2A5W A;  3LSP A;  1VI0 A;  5C4J J;  1N75 A;  1UZC A;  3OWT A;  3F3X A;  2GZW A;  3LSR A;  2NS7 A;  5K7Z A;  4KIG A;  4U87 A;  4LB5 A;  1IJW C;  4MGR A;  5FO5 A;  2ZME A;  5J8F A;  2VBW A;  3FDY A;  1LVK A;  1XN7 A;  3SXY A;  1IN5 A;  4U0Y A;  2ZJP F;  5K5Q A;  1PUF B;  3S2H J;  3IKT A;  2L4A A;  2PMZ A;  2K02 A;  4ITV A;  1ZRE A;  2M45 A;  3KP7 A;  3PNV A;  2HKX A;  4KIT B;  3T8R A;  2MW8 A;  3U1K A;  2ECB A;  5BNG A;  3BC8 A;  4G12 A;  5J3L A;  2ZJR F;  3BCA A;  1B8I B;  3DEU A;  3GWZ A;  3LSJ A;  3BOQ A;  4CSW A;  3D0S A;  5B66 C;  3FIW A;  4KMU X;  3HXL A;  4DGW B;  5JFR A;  2PG4 A;  4U7D A;  4M73 A;  1I1S A;  4FIS A;  1IZ1 A;  3OYE A;  1JGG A;  1TZL A;  2EIM H;  3EUK L;  3JTH A;  4LMY A;  1T38 A;  2GIV A;  1JKR C;  1IN6 A;  2ZC2 A;  4GGG A;  4NBQ A;  1NH3 A;  1SMT A;  2KZV A;  1IC8 A;  1PUF A;  3GEZ A;  4AM3 A;  2QGU A;  5LHH A;  4JBA A;  5DS9 A;  3ZMT A;  3TO7 A;  3K70 D;  3CDL A;  2JA7 J;  5BS6 A;  2D45 A;  3BLY A;  2A3S A;  1G2H A;  2XKP A;  2Z3Y A;  4IX7 A;  4LK1 F;  4MHG A;  1I3Q J;  2E19 A;  4UVA A;  1A31 A;  3HRM A;  2EWN A;  4I98 B;  2XGC A;  3MKZ A;  4A0X A;  1FC3 A;  3CLO A;  1QZE A;  2W1O A;  1MIJ A;  3FXM A;  4HAM A;  2P5L C;  4PDK A;  4CH7 A;  5E20 A;  2NNN A;  1OFC X;  5L3F A;  2DI3 A;  3V7C A;  5IYD J;  3HOX J;  4RGU A;  5HS9 A;  3LA7 A;  3BTI A;  1IAW A;  1NTC A;  1LNW A;  1P7J A;  2F5E A;  2ZO4 A;  1K6O A;  5F04 A;  1NK3 P;  5GTH C;  4EVI A;  5KAI C;  1VZ0 A;  2X6X A;  1XMK A;  2CUJ A;  1T33 A;  2JQ7 A;  2G7U A;  1DU0 A;  2MLG A;  3S1Q J;  2D2W A;  2CV0 A;  2JRM A;  4A3B J;  3K4N A;  2K4J A;  1XMA A;  1FT9 A;  1ZLJ A;  2EFW A;  2DDB A;  4L5I A;  1FTT A;  5E3M A;  1J75 A;  3OIQ A;  4ZZL A;  2HQR A;  4Z2Y A;  4YRV A;  2NXN B;  4BS9 A;  5L3G A;  3F0C A;  1LDD A;  3K69 A;  5E1X A;  4IQJ A;  4FT8 A;  1WSU A;  3KYC B;  1J09 A;  2LH9 A;  2ZXH A;  3E5X A;  2CQK A;  1MBJ A;  2EV6 A;  3K1N A;  5LHI A;  1KQ8 A;  2H94 A;  2K9S A;  1Q1V A;  3I59 B;  4XBF A;  1YHQ I;  4Y7N J;  1JJ6 C;  4BXX J;  2X6Y A;  4PCQ A;  3MFK A;  3KEQ A;  2DW4 A;  3T8T A;  2XF5 A;  5M3M J;  2Y0S A;  5LGN A;  1I6X A;  4CCN A;  2H6C A;  4XID A;  5HDG A;  2OQG A;  3K4C A;  4M72 A;  4BJ6 C;  1RRJ A;  2FMY A;  1X4O A;  1LFU P;  3KYD B;  4OAZ A;  2WBM A;  1TW3 A;  3ASO H;  2ME0 A;  3DBR B;  2O03 A;  4KT6 A;  1LDJ A;  2IA2 A;  2E7X A;  3V8J A;  3A01 B;  1G3Y A;  2LY2 A;  4U7B A;  2JMW A;  3ZMZ A;  2LY9 A;  3CUO A;  3A01 A;  2AO9 A;  3I0T A;  4P1W A;  2GWR A;  2JT1 A;  1FYL A;  2Y69 H;  1Y39 A;  4JOM A;  3QPH A;  5FKM A;  2XC7 A;  1QNT A;  2XAS A;  4BEH B;  1N77 A;  4IHW A;  2KT0 A;  1R23 A;  1D0Z A;  3VFZ A;  3CCS I;  4X0G A;  1MBG A;  3CCM I;  4HF0 A;  4W1U A;  1Z67 A;  1IUF A;  3ECO A;  3GZ5 A;  2QQ9 A;  1D1A A;  1VQ6 I;  2FBI A;  2GA1 A;  1P4W A;  4BHB A;  4KDP A;  3OY9 A;  3L2V A;  4JK1 X;  2JA6 J;  4BE0 A;  3C7J A;  3CCV I;  4LK0 F;  2BGC A;  2E71 A;  1TQI A;  2JUC A;  2ZFU A;  1PP7 U;  4L9N A;  1BC7 C;  2BY0 A;  2YUS A;  2VAS A;  3RCO A;  2X1C A;  4RMN A;  1B8I A;  4UVB A;  4IHY A;  2EIL H;  2Y0S N;  2IGK A;  1P4X A;  2V1X A;  3PQK A;  3U21 A;  1KU7 A;  4ENN A;  3GCM A;  2FOK A;  3GTG J;  4FE4 A;  3FXU A;  2NAZ A;  3G71 I;  1Y56 A;  1MBE A;  4I7H A;  2IW5 A;  3HL2 A;  3IWF A;  4TV7 A;  1ORK A;  1YQA A;  5GAG J;  4EAT A;  1I50 J;  2LLK A;  5DM6 F;  1MMN A;  2UXX A;  3E6M A;  1YI2 I;  2K4B A;  5CVR A;  3HHG A;  2MD0 A;  1Z3Y A;  4ZDP A;  3J7Y J;  3H3Z A;  4OIO F;  2MYS A;  1XTA A;  2K5C A;  5EGO B;  2EB7 A;  2KRC A;  5EYR A;  1SD7 A;  2P7V B;  4YIR X;  2ZSH B;  4ENM A;  5B1B H;  5D5U B;  3CUQ B;  4I99 C;  1YIT I;  1JKO C;  5BPD A;  4MFE A;  4GDF A;  1ETK A;  2LRD A;  4FX0 A;  2ZXJ A;  4NB5 A;  2Q8K A;  3ZN1 A;  4HEA 2;  4EJO A;  2KL4 A;  4ENJ A;  3FIS A;  5FRN A;  3FMS A;  3U1D A;  1RPW A;  1TT5 B;  3I9V 2;  2PJR A;  3FXR A;  2K9L A;  3WE2 A;  2H6B A;  4J19 A;  1R1V A;  1WVR A;  5FFX A;  3CMM A;  4W97 A;  1PP8 F;  4M74 A;  4PJ0 C;  5BQT A;  3HRS A;  2I5U A;  4MFD A;  2DFI A;  4RGX A;  2IS2 A;  2HU9 A;  3HUG A;  1ZG1 A;  2XF6 A;  2P5K A;  2MA3 A;  1EV7 A;  2HWV A;  4LIT A;  4E7K A;  4BYY A;  3H3U A;  4RDU A;  1EH6 A;  4A5N A;  4MTE A;  3IH2 A;  3CUQ C;  2CGP A;  1ZG5 A;  3SFI A;  3CP2 A;  3KPH A;  2Y31 A;  4GO1 A;  3JCU C;  1S72 I;  2GM4 A;  1T98 A;  4C2M J;  5J4V A;  3R0A A;  1ZN2 A;  1IF1 A;  1YJW I;  1K4T A;  2COM A;  4MLO A;  1MD0 A;  1KQ0 A;  4XOT A;  2TRT A;  4EGZ A;  4IHV A;  3E3V A;  5FD6 A;  1YX5 A;  1REP C;  3K7A J;  3ZMV A;  2L9S A;  3BR6 A;  4A93 J;  4M9Z A;  2MD5 A;  3KP5 A;  3VOD A;  2JA8 J;  2VJJ A;  2LKS A;  1LJ9 A;  2KP6 A;  4KNY A;  3IL2 A;  5FLX K;  1XGO A;  1HDD C;  3P9I A;  2LP0 A;  4IRH A;  4A69 C;  3F72 A;  4AVZ A;  1RR7 A;  5TGT A;  4ON0 A;  2BV6 A;  2ZXW H;  4UV9 A;  1FIA A;  3QAH A;  5E1Z B;  2PJP A;  4HDV A;  2J5O A;  3M8J A;  2HOE A;  5LEK A;  2PQ8 A;  2HZD A;  3QWL A;  1DPR A;  3ZQG A;  2DT5 A;  1ZKG A;  3UNG C;  2KMU A;  4N0B A;  1ZAO A;  3RQ4 A;  4E6K G;  4KYW A;  2X0L A;  1TT0 A;  2VQL A;  3F6V A;  2FD5 A;  4UB8 C;  2ELJ A;  1F5T A;  1SFK A;  1JI8 A;  2LY1 A;  4HF2 A;  3KIO A;  2EPF A;  3IP4 B;  2BHZ A;  2OC6 A;  4A6D A;  2HEO A;  1F9N A;  3CQZ J;  4Y17 A;  2KZG A;  2KRF A;  1JT6 A;  2JVH A;  3JW4 A;  2BHY A;  3A0H C;  2HNH A;  2YX7 A;  4CCJ A;  2K3F A;  4FHT A;  5F1J A;  2VE9 A;  1W36 C;  1U6G A;  3HOU J;  1MMD A;  2CRG A;  3BG5 A;  2LKP A;  2WAQ N;  1VQ4 I;  4HLX A;  1HKQ A;  4D9J A;  4KIS A;  2W57 A;  1D5V A;  1TWG J;  4UXN A;  3L2C A;  1ON1 A;  2IPQ X;  2MC3 A;  2FQ3 A;  2X1E A;  2DA5 A;  2X85 A;  3OS0 A;  5HVQ C;  4ESB A;  3T5X A;  2VOD A;  1GUU A;  1R5H A;  1X4P A;  2QBY B;  2DA1 A;  2B7E A;  1XD7 A;  2L2O A;  3FM3 A;  3M8E A;  3S1N J;  3VWB A;  3CDI A;  3A0B C;  4B8X A;  5FRM A;  3ERE D;  4HRI A;  1TWH J;  3IWZ A;  1OCC H;  4HBL A;  1YS7 A;  3CJR B;  1EH7 A;  2JSC A;  2KRH A;  1XGN A;  4WXH A;  1BJA A;  1D1C A;  1ZHF A;  3HPG A;  3LAJ A;  2HPM A;  4OMY A;  3RZO J;  2EQR A;  4RAZ A;  1UCR A;  4UVC A;  2DDA A;  3LWF A;  1PYV A;  4Y3O A;  2R0Q C;  3L1P A;  2XIG A;  2ECC A;  5IOY A;  4QWQ A;  2VL8 A;  1FPQ A;  3WTX C;  3F6O A;  2WAE A;  2AS5 F;  1WJA A;  5EZG A;  2NVY J;  2P8T A;  3IKV A;  4PJJ A;  2QLZ A;  3TBI A;  3R0J A;  4RGS A;  1S29 A;  1Z77 A;  3RYP A;  4R79 A;  3SZP A;  5E8I A;  2VKD A;  4EJU A;  1WKM A;  2JRT A;  4RBO A;  2ICW G;  2VE8 A;  4ZDL A;  3HTS B;  3F8C A;  2EFO A;  2DJN A;  1IRG A;  2MH2 A;  2AXL A;  2WAQ A;  5JLX A;  2GXA A;  1EH8 A;  1YW7 A;  1X3W B;  4JX6 A;  5J1U A;  1QPM A;  1QVT A;  3O2P E;  1LQ1 A;  3JRC A;  4B1R A;  2L7Z A;  5K5R A;  3G2B A;  5K7H A;  2VB6 A;  2DA7 A;  2ZNY A;  5L3E A;  1WJ5 A;  2R7D A;  3IAS 2;  4KT5 C;  3SZT A;  4RLQ A;  2RN7 A;  2VXZ A;  3BG3 A;  4BXU A;  4KIB A;  1TLH B;  4IF4 A;  3I56 I;  1G59 A;  4LB6 B;  3RDI A;  2MAB A;  1OCR H;  4IRG A;  3RKY A;  3OYJ A;  3EUH A;  1XSD A;  1RUN A;  1UMQ A;  1H9T A;  1WCM J;  2JWT A;  2O3F A;  4MEX F;  4CDG A;  1KYW A;  2HVR A;  4UUT A;  3EYY A;  1X2N A;  2P0W A;  3W6J B;  5GAD J;  3JRH A; 
#chains in the Genus database with same CATH homology
 1U8R A;  2H27 A;  3KLO A;  1YIO A;  2HYG D;  5CVJ A;  2RNJ A;  2MH9 A;  3RPU A;  4KIF A;  3MWM A;  3EET A;  1JXS A;  2PMH A;  3I59 A;  3M7G A;  1SAX A;  5BOX A;  1L3L A;  4I09 A;  5LRS A;  3C18 A;  3V7S A;  3WG9 A;  5IT9 Z;  5E1W A;  1IXR C;  3BPX A;  1Z1D A;  4ZYD A;  5E17 F;  1WWX A;  1Z7U A;  1G4D A;  3KCC A;  4KFC A;  3JSO A;  5JR3 A;  2XUB A;  1RZ4 A;  1O3T A;  4LFU A;  2DK8 A;  4UHT A;  3W6K B;  1YO5 C;  1P4A A;  4AIK A;  4HX8 A;  4O5V A;  3O3K A;  6PAX A;  3HSE A;  1XCV A;  1MDM A;  2QQA A;  2DAO A;  4G6D A;  3EQL F;  2Y0M A;  4IPA A;  1BBY A;  5BMZ A;  1FOK A;  2FU4 A;  5D5V B;  1BI0 A;  3GVA A;  3I64 A;  4ESF A;  2OQR A;  1KU9 A;  3HYI A;  4LG0 B;  3DF8 A;  1QQI A;  4BNC A;  3T1B A;  1HSJ A;  5FB2 A;  1IRF A;  3EDP A;  3HTU A;  3LQR A;  3KET A;  1O3S A;  1ZG3 A;  1S6L A;  1WRJ A;  4GYI A;  1HBX G;  3CO6 C;  2VBZ A;  3TDZ C;  4P9U A;  2M8E A;  3N97 A;  3B02 A;  3WTS C;  2ISY A;  4ZYH A;  3WTW C;  1BIA A;  2RQP A;  4KA4 A;  2VC0 A;  5HLH A;  3HSF A;  4IJA A;  2LSO A;  1LDK B;  4I0A A;  2ZJ2 A;  2UZK A;  2LNB A;  1LB2 A;  2X4H A;  3MEX A;  4XLN F;  2K86 A;  4YFK F;  5HDN A;  3GFL A;  3RJP A;  5D5W B;  3FHZ A;  3ROU A;  2O6G E;  1I27 A;  4MQ9 F;  1X3U A;  4A6E A;  4G7H F;  3JTG A;  1S8N A;  4U0V A;  1Q1H A;  2L3D A;  2NYX A;  2ISZ A;  2Z33 A;  5HS7 A;  2K27 A;  2QBY A;  3H92 A;  3ZN0 A;  1IXC A;  1Z91 A;  3ABU A;  3DFG A;  4YII A;  3F21 A;  2XAQ A;  1HXD A;  4EMS A;  4M6Y A;  1P6R A;  4BH9 A;  2DO7 A;  2DQL A;  2TDX A;  2O8X A;  4KN7 X;  4L9T A;  5CYV A;  3I4P A;  5DEQ A;  1MZB A;  1B6A A;  4P55 A;  1FSH A;  4L0Z B;  3JAM Z;  4M6X A;  1G3S A;  3FM5 A;  1SD5 A;  3L00 A;  5DCM A;  3RYR A;  3GW2 A;  2A6H F;  2ACJ A;  4L9V A;  5ILS A;  1BM9 A;  3P9K A;  5F1R A;  1IN8 A;  1TBX A;  2K7L A;  3RKX A;  1HKS A;  2XAH A;  5K1Y A;  1YG2 A;  1V3F A;  1ZGA A;  2GAU A;  3DQV C;  3Q5F A;  4Q5S F;  1ZYR F;  2M30 A;  2W84 A;  1UB9 A;  1IN4 A;  2KIM A;  4HX7 A;  5KK1 A;  1HKT A;  4I2O A;  3JAM K;  4CHU A;  3R61 A;  4LG0 A;  4U88 A;  3RPQ A;  2ZFW A;  5TJJ A;  3GFM A;  2YX4 A;  3HRU A;  3SFZ A;  1LEA A;  3ZMU A;  2STT A;  4OU0 A;  2Z9O A;  5A2Q Z;  1K78 A;  2D1H A;  4P9F A;  3BY6 A;  2FEZ A;  4O6J A;  1XDS A;  4XRF A;  1GVJ A;  5D4R A;  4CGZ A;  4GXO A;  1BC8 C;  3KP4 A;  2L4M A;  4KMF A;  3BPV A;  5EEH A;  5KVR A;  1E17 A;  3LA2 A;  1IN7 A;  2DQR A;  4WXC A;  1J0R A;  2VC1 A;  2EA4 A;  1IW7 F;  3B73 A;  2QWW A;  3I53 A;  3JSP A;  3KP3 A;  4F7Z A;  3ZP5 A;  2EFP A;  2QYO A;  3ML6 A;  5AON A;  2P7C B;  1QZY A;  2FF4 A;  2EV5 A;  3ISP A;  3K1P A;  2HR3 A;  5FD5 A;  3SHF A;  1T6S A;  3COA C;  3L7W A;  4GYG A;  4EM0 B;  5ERI A;  2VT2 A;  3TGN A;  5IT9 K;  1AWC A;  2CWE A;  3FXQ A;  2PBI A;  4WF2 A;  2UWM A;  2KJB A;  2HYF A;  3WTZ A;  3MAJ A;  3G73 A;  1J9I A;  3WGI A;  2P6S A;  3L9F A;  2NRA C;  5HDK A;  3IC7 A;  4BAY A;  2L02 A;  2A61 A;  2CG4 A;  1TTY A;  2FNP A;  2KJC A;  3SQN A;  3FX3 A;  1MJA A;  3KP2 A;  2A6E F;  5D8L B;  1RNL A;  4P5O A;  3E6B A;  4AWX B;  2PEX A;  3REO A;  5AIP A;  3O6B B;  2OZ6 A;  3LST A;  5CVU A;  2Z99 A;  2O0Y A;  1W5T A;  4RS8 A;  1R00 A;  2QZ8 A;  4WX9 A;  1O3R A;  4AIJ A;  2DTR A;  4IHT A;  3GFI A;  1U5T A;  1OYW A;  2HTJ A;  5J8C A;  4WXD A;  3NEU A;  1L0O C;  1SFX A;  3WTU C;  1IUY A;  1UHM A;  4HQE A;  1B9N A;  2FSW A;  2HTS A;  2FBH A;  4LLL A;  3V7R A;  4G8X A;  2V1D A;  2Y48 A;  1JHH A;  1S7A A;  1S3J A;  3N4M A;  3CTA A;  1UHW A;  2MLK A;  3OV8 A;  1PUE E;  3HRT A;  5AIQ A;  1P2F A;  4HX4 A;  1WI9 A;  1Z6R A;  1R1U A;  4G94 A;  3U9G A;  1FBS A;  3F23 A;  3FF5 A;  1B9M A;  1YYV A;  3QP5 A;  4HZF A;  2Y75 A;  2FBK A;  3GX4 X;  2EA2 A;  1DP7 P;  4LD5 A;  1FLI A;  2W25 A;  3R60 A;  3ELK A;  3I71 A;  2MBF A;  1QGP A;  2Q2E A;  3WU0 A;  2EJR A;  2A68 F;  1I5Z A;  1YFH A;  2FE3 A;  5JVT A;  4XSX F;  5LEJ A;  5CLS A;  2R3S A;  5H6Q A;  4G9Y A;  5LLQ A;  4B09 A;  4S05 A;  2DK5 A;  3KZY A;  4L0Y B;  1FZP B;  2V79 A;  4M9S A;  5DV5 A;  3GF2 A;  3TDU C;  1PDN C;  2DBB A;  3U2R A;  1TQM A;  3TOB A;  2M1B A;  2ZKZ A;  3RIR A;  1RUO A;  4A2U A;  2O61 A;  2RKH A;  4CO8 A;  4CYD A;  1V4R A;  3KLN A;  1RI7 A;  3VB2 A;  4DNC A;  1G3W A;  4ZYE A;  1O7L A;  1XB4 A;  3LFK A;  4EM1 A;  1CF7 B;  1BIB A;  4A12 A;  4RB2 C;  4S04 A;  4A0Z A;  3T0Y A;  2L54 A;  3HSR A;  2JTV A;  4K2E A;  2EK5 A;  2EFQ A;  1O57 A;  2JPC A;  2E1N A;  1GXP A;  3F22 A;  2HS5 A;  2KIU A;  4HYE A;  3WGH A;  1ZRD A;  1J5Y A;  5E18 F;  5DYM A;  1U78 A;  3DP7 A;  2EV0 A;  3GLX A;  1GHC A;  3RI4 A;  4OIQ F;  2C6Y A;  3KFW X;  2DLL A;  4U0W A;  4IHS A;  3BZ6 A;  2F5C A;  1T2K A;  5F6F A;  5HLI A;  3R4K A;  4ESJ A;  3I54 A;  4HA8 A;  3DXJ F;  1SFE A;  1S7O A;  3ZQ7 A;  1TNT A;  4LLG F;  4WK8 F;  3WTT C;  2L01 A;  1DUX C;  2LF8 A;  4OMZ A;  1J2X A;  4HQM A;  3ZMD A;  1B59 A;  3F8F A;  3IRQ A;  4ZYG A;  4EJW A;  1E2X A;  2ZNZ A;  2CFX A;  1KA8 A;  3CUQ A;  3L09 A;  2OD5 A;  2IRF G;  1MGT A;  3VEP A;  2HFH A;  4ASN A;  1SMY F;  4H0E A;  4AD9 A;  1Z9C A;  3QU6 A;  1C0W A;  2B0L A;  2QEN A;  2GQQ A;  1O3Q A;  4FX4 A;  3V8L A;  4LLN A;  3C3W A;  1R5G A;  2PFB A;  4KIC A;  2FA5 A;  5D6F A;  3TO6 A;  3PFI A;  4XSZ F;  4RB1 A;  2ESH A;  1TW2 A;  3F8M A;  2A69 F;  5F64 A;  1IXS B;  2BYV E;  3M8F A;  4UUV A;  2VT3 A;  2EFN A;  4MEY F;  2YR2 A;  4HDU A;  1ULY A;  5L3D A;  1TQP A;  2KKO A;  2R7F A;  3RKW A;  4YG2 F;  2M5W A;  4UNO A;  4I02 A;  1HW2 A;  5JHU A;  3DPT A;  3FMR A;  1T0F A;  2W24 A;  1D8J A;  5CJ9 A;  3F8B A;  4HV6 A;  3GO5 A;  2PI0 A;  3DKW A;  1U5T B;  3IHU A;  5ICG A;  3NQO A;  2VOP A;  4PZJ A;  3K0L A;  3KP6 A;  3V8K A;  1BI2 A;  2OA4 A;  1D8K A;  4A5M A;  5LBQ A;  1JE8 A;  1SFU A;  4ETS A;  5L3B A;  1R1T A;  3E5Q A;  1OYY A;  2IA0 A;  4GCV A;  2DPD A;  2V6C A;  3QU3 A;  1KQ9 A;  4RGR A;  3EYI A;  1FYM A;  5D6E A;  2F2E A;  4PGG A;  3K1M A;  2HZT A;  3M1E A;  1R22 A;  3BRO A;  1YW9 A;  1QO0 D;  4KUM A;  1ZRF A;  1QBJ A;  3HIF A;  3FZV A;  2YU3 A;  1RIO H;  2RDP A;  1LEB A;  1ZGJ A;  2IJL A;  2P5V A;  2GXG A;  1XSX A;  3KEO A;  1YS6 A;  3MZY A;  2IVM A;  1U3E M;  1FBU A;  2RC4 A;  1FNN A;  2V9V A;  1AOY A;  1OYI A;  1FSE A;  2Z5U A;  2XAJ A;  4Y15 A;  3J80 Z;  2XHK A;  1K79 A;  2ZME B;  5DD4 A;  4L5J A;  2P4W A;  3D5L A;  1XCB A;  1OR7 A;  2XKO A;  1NHA A;  5HS8 A;  4R8H A;  4RAY A;  2YSR A;  4IVN A;  4P96 A;  2ADU A;  3QP6 A;  1FWZ A;  4YFX F;  2CO5 A;  2FXA A;  1XSV A;  3C1D A;  1FP2 A;  5HOO A;  1QZZ A;  2XAF A;  2CW0 F;  1SD4 A;  1W7P D;  4MNU A;  2VON A;  1CF7 A;  1MKM A;  1T39 A;  3Q9V A;  1G6N A;  4HV5 A;  5D4S A;  3LA3 A;  2D1V A;  4L18 B;  1STZ A;  1JGS A;  2G7H A;  1A04 A;  1JHF A;  2HDC A;  3MQ0 A;  5DDG A;  4MQV A;  2XV4 S;  1VTN C;  1BI3 A;  3BJA A;  2G9W A;  1UST A;  4RB0 A;  3BWG A;  3MCZ A;  2UXN A;  2FRH A;  3QOP A;  5ICF A;  3OOP A;  1BI1 A;  1YLF A;  1YW8 A;  2XAG A;  1XGS A;  3CO7 C;  5HLG A;  2WWY A;  3BJO A;  2PN6 A;  2RV8 A;  2XVC A;  4EV0 A;  4D0P A;  3GUD A;  4QLC U;  4EJV A;  2XRN A;  3HHH A;  2HKO A;  5LHG A;  3DPL C;  3DV8 A;  2DU9 A;  2IT0 A;  2VBX A;  2HQN A;  3K9T A;  4PGH A;  1FX7 A;  3P9C A;  4LJZ F;  3V4G A;  3GXO A;  2FNA A;  2J5P A;  2KIF A;  2VBY A;  3WTV C;  2XGX A;  2ELH A;  2GA2 A;  4G7O F;  2LDU A;  4CIC A;  2NNY A;  2RVC A;  1KGS A;  5DD8 A;  2ZCW A;  3P7N A;  4CXF A;  2QM3 A;  4EGY A;  2PLY A;  2CYY A;  3S2W A;  5ILV A;  2STW A;  5IT3 A;  1ZH5 A;  1K78 B;  3R6S A;  2QVO A;  4I01 A;  5DCF A;  2E1C A;  1H0M A;  2OZU A;  1UFM A;  3F8N A;  4OIN F;  1BOA A;  3ECH A;  3G3Z A;  4BQA A;  3QRF F;  5D5X B;  1DPU A;  1F4K A;  4O3M A;  2BEO A;  1B1B A;  5D8K B;  5E8G A;  5ED4 A;  5H6R A;  5ICE A;  1I1G A;  3GFJ A;  2WTE A;  3J81 Z;  2HGC A;  1J59 A;  4EQQ A;  1FY7 A;  3TO9 A;  2OBP A;  3FMQ A;  3E97 A;  2PMU A;  4OOI A;  4E70 A;  5JI6 A;  1W5S A;  4YFN F;  5FGM A;  2V1U A;  3IRR A;  4HF1 A;  3KE2 A;  2RGV A;  4AIH A;  1ON2 A;  2W85 A;  3TKY A;  2QQB A;  5EEG A;  1H9G A;  1XGM A;  3CDH A;  2Q0O A;  3E6D A;  1MDM B;  1GXQ A;  4IRI A;  1B4A A;  1Z05 A;  3FWE A;  1BN5 A;  2OU2 A;  2BE5 F;  5DUK A;  1FP1 D;  3CJN A;  4N9I A;  4WCG A;  1U2W A;  4OIR F;  4ENK A;  2H09 A;  4RB3 C;  1OMI A;  1D3Y A;  3BJ6 A;  1KU3 A;  4N9H A;  1O7F A;  1W7P B;  4NHJ A;  2VN2 A;  3WGG A;  1Y0U A;  2P6T A;  1FBQ A;  1LVA A;  1KU2 A;  4L9J A;  5LGU A;  1ZAR A;  4HLY A;  4ZH4 F;  4Q47 A;  5ICC A;  3WOD F;  5DUI A;  3TOA A;  4KN4 X;  1USS A;  2GXB A;  5H20 A;  1FYK A;  3E5U A;  4Y13 A;  3GYH X;  3WE3 A;  3MZH A;  4EJT A;  5A2Q K;  2A07 F;  1HW1 A;  3J7A O;  4A0Y A;  4WWC A;  5LGT A;  5BPI A;  4JQF A;  3J81 K;  1K7A A;  3ZPL A;  5TRD A;  4HW0 A;  3ZMS A;  2XRO A;  4BHC A;  1R36 A;  2DPU A;  4OIP F;  3I58 A;  1HW5 A;  4ZZD A;  2BBY A;  1KYZ A;  5J6X A;  2YPR A;  3LAP A;  2E7W A;  2WC2 A;  2JZY A;  5FFZ A;  4XLP F;  3WU1 B;  1SD6 A;  3I5U A;  2ETH A;  2ZBK A;  4EM2 A;  3KZZ A;  1ODD A;  2F5F A;  5CVI A;  1TNS A;  2OAZ A;  5ILU A;  3M9A A;  5DCM B;  2WV0 A;  4R1H A;  1U5T C;  5L3C A;  1R7J A;  1OPC A;  4M9X A;  4BHP A;  3LQQ A;  3WTY C;  2CSO A;  2A5Y B;  3QPT A;  1ZLK A;  3GZ6 A;  3PQJ A;  4AVP A;  4Q4Z F;  3Q9S A;  3NRV A;  1P92 A;  1HQC A;  4G7Z F;  1CGP A;  4IXA A;  1Z6T A;  1DDN A;  2F5D A;  1HST A;  5LRR A;  2QUF A;  3J80 K;  1ZRC A;  3TQN A;  3BDD A;  1WQ2 A;  2M87 A;  4YIF A;  2FML A;  3HOT A;  1F1Z A;  2JPB A;  3K2Z A;  1MJB A;  4HOB A;  4UV8 A;  3HOS A;  4M71 A;  3ULQ B;  1XDU A;  5CVV A;  3E6C C;  4I0B A;  4CZZ A;  3VOE A;  2IP2 A;  1J7K A;  3ABT A;  2IA1 A;  4LGW A;  4G6Q A;  1R58 A;  1MJ9 A;  1ONV A;  3BP8 A;  5K5O A;  4MTD A;  4NQW A;  5FLX Z;  2LF7 A;  2NS0 A;  1W7P A;  1G3T A;  4DQ2 A;  3AAF A;  2VOO A;  2ESN A;  1W4M A;  1OKR A;  3RTR A;  1YTY A;  4Q48 A;  3F3X A;  2GZW A;  4KIG A;  4LB5 A;  4MGR A;  5FO5 A;  2ZME A;  5J8F A;  2VBW A;  1XN7 A;  3SXY A;  1IN5 A;  4U0Y A;  5K5Q A;  3IKT A;  2L4A A;  2K02 A;  1ZRE A;  2M45 A;  3KP7 A;  2HKX A;  3T8R A;  3DEU A;  3GWZ A;  3BOQ A;  3D0S A;  4KMU X;  5JFR A;  2PG4 A;  4U7D A;  4M73 A;  1I1S A;  1IZ1 A;  4LMY A;  3JTH A;  1T38 A;  2GIV A;  1IN6 A;  4GGG A;  1SMT A;  3GEZ A;  5LHH A;  4JBA A;  3ZMT A;  3TO7 A;  5BS6 A;  2D45 A;  2A3S A;  2XKP A;  2Z3Y A;  4LK1 F;  4MHG A;  4UVA A;  3HRM A;  2EWN A;  4I98 B;  4A0X A;  1FC3 A;  3CLO A;  4HAM A;  2P5L C;  4PDK A;  5E20 A;  2NNN A;  5L3F A;  2DI3 A;  3V7C A;  4RGU A;  5HS9 A;  3LA7 A;  1IAW A;  2F5E A;  1LNW A;  2ZO4 A;  1K6O A;  4EVI A;  1XMK A;  2G7U A;  2MLG A;  2D2W A;  2K4J A;  1XMA A;  1FT9 A;  1ZLJ A;  2EFW A;  4L5I A;  1J75 A;  4ZZL A;  2HQR A;  4Z2Y A;  5L3G A;  1LDD A;  3K69 A;  5E1X A;  4FT8 A;  1WSU A;  3E5X A;  2CQK A;  2EV6 A;  3K1N A;  5LHI A;  1KQ8 A;  2H94 A;  3I59 B;  4XBF A;  4PCQ A;  3MFK A;  3KEQ A;  2DW4 A;  3T8T A;  5LGN A;  1I6X A;  2H6C A;  5HDG A;  2OQG A;  4M72 A;  2FMY A;  1TW3 A;  2O03 A;  1LDJ A;  2IA2 A;  2E7X A;  3V8J A;  1G3Y A;  4U7B A;  3ZMZ A;  3CUO A;  3I0T A;  2GWR A;  2JT1 A;  1FYL A;  3QPH A;  1QNT A;  2XAS A;  1R23 A;  3VFZ A;  4HF0 A;  3ECO A;  3GZ5 A;  2QQ9 A;  2GA1 A;  2FBI A;  1P4W A;  4BHB A;  4KDP A;  4JK1 X;  3C7J A;  4LK0 F;  2BGC A;  1TQI A;  1PP7 U;  4L9N A;  1BC7 C;  4UVB A;  1P4X A;  2V1X A;  3PQK A;  1KU7 A;  4ENN A;  2FOK A;  3FXU A;  2NAZ A;  4I7H A;  2IW5 A;  3IWF A;  4TV7 A;  1YQA A;  2UXX A;  3E6M A;  2K4B A;  5CVR A;  3HHG A;  3H3Z A;  4OIO F;  2EB7 A;  1SD7 A;  2P7V B;  4ENM A;  5D5U B;  3CUQ B;  5BPD A;  4FX0 A;  2ZXJ A;  4NB5 A;  2Q8K A;  3ZN1 A;  4EJO A;  4ENJ A;  3FMS A;  3U1D A;  3FXR A;  3WE2 A;  2H6B A;  1R1V A;  5FFX A;  1PP8 F;  4M74 A;  5BQT A;  3HRS A;  2DFI A;  4RGX A;  3HUG A;  1ZG1 A;  2P5K A;  2MA3 A;  1EV7 A;  2HWV A;  4BYY A;  3H3U A;  1EH6 A;  4A5N A;  4MTE A;  3CUQ C;  2CGP A;  1ZG5 A;  4GO1 A;  1T98 A;  3R0A A;  1ZN2 A;  1IF1 A;  2COM A;  1MD0 A;  1KQ0 A;  4EGZ A;  3E3V A;  5FD6 A;  1REP C;  3ZMV A;  4M9Z A;  2MD5 A;  3KP5 A;  3VOD A;  1LJ9 A;  4KNY A;  3IL2 A;  5FLX K;  1XGO A;  3P9I A;  4IRH A;  3F72 A;  4ON0 A;  2BV6 A;  4UV9 A;  3QAH A;  5E1Z B;  2PJP A;  4HDV A;  2J5O A;  2HOE A;  5LEK A;  2PQ8 A;  1DPR A;  2DT5 A;  4N0B A;  1ZAO A;  4KYW A;  2X0L A;  3F6V A;  1F5T A;  4HF2 A;  4A6D A;  2HEO A;  1F9N A;  4Y17 A;  2KRF A;  3JW4 A;  2YX7 A;  4FHT A;  2VE9 A;  1U6G A;  2LKP A;  4HLX A;  1HKQ A;  2W57 A;  1D5V A;  4UXN A;  3L2C A;  1ON1 A;  2IPQ X;  2MC3 A;  2FQ3 A;  5HVQ C;  4ESB A;  3T5X A;  2VOD A;  1R5H A;  2QBY B;  3FM3 A;  1XD7 A;  3M8E A;  4B8X A;  3ERE D;  3IWZ A;  4HBL A;  1YS7 A;  1EH7 A;  2JSC A;  1XGN A;  4WXH A;  1BJA A;  1ZHF A;  3LAJ A;  4OMY A;  4UVC A;  4RAZ A;  1UCR A;  3LWF A;  2XIG A;  4QWQ A;  1FPQ A;  3WTX C;  3F6O A;  2AS5 F;  2P8T A;  3IKV A;  2QLZ A;  3R0J A;  4RGS A;  1S29 A;  3RYP A;  4R79 A;  3SZP A;  5E8I A;  4EJU A;  1WKM A;  2JRT A;  2VE8 A;  3HTS B;  3F8C A;  2EFO A;  1IRG A;  2MH2 A;  2AXL A;  1EH8 A;  1YW7 A;  1QPM A;  3O2P E;  1LQ1 A;  5K5R A;  2ZNY A;  5L3E A;  2R7D A;  4KT5 C;  3SZT A;  2RN7 A;  2VXZ A;  4BXU A;  4KIB A;  1TLH B;  4IF4 A;  4LB6 B;  3RDI A;  4IRG A;  3RKY A;  3EUH A;  1XSD A;  1RUN A;  1H9T A;  4MEX F;  2O3F A;  4CDG A;  1KYW A;  3EYY A;  3W6J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...