4LB5A

Crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
60
structure length
57
Chain Sequence
EIEMRICDYLRRHGRSTVQDIFKELKLEKSTVNRHLYSLQASKQVFKTVKRPVWNLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein kinase containing Z-DNA binding domains
publication title Structural basis for Z-DNA binding and stabilization by the zebrafish Z-DNA dependent protein kinase PKZ.
pubmed doi rcsb
source organism Danio rerio
molecule tags Transferase/dna
total genus 20
structure length 57
sequence length 60
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4lb5A00
2XAJA 2A3SA 4Q4ZF 4XSXF 1K78B 1TW2A 2V9VA 3KEOA 3RDIA 4KMFA 4YFNF 2COMA 5KVRA 2IA1A 1S29A 1XCVA 3F22A 3BPXA 1YIOA 2Y48A 4ZYEA 4G94A 5L3FA 4LLLA 1E2XA 4HLXA 4N9HA 2Y0MA 3NRVA 4EGZA 5H20A 2CWEA 4ESFA 3I4PA 3HHGA 3KLNA 3FMSA 5DUIA 2EFQA 1KQ0A 3I71A 4KYWA 3RPUA 4A0XA 3L2CA 2M45A 5LRRA 2V1UA 3GW2A 2PFBA 2W57A 4QWQA 2XHKA 3NEUA 4OINF 2QWWA 1K78A 4WF2A 1HKTA 3BWGA 4OMZA 4BYYA 1F9NA 2P5KA 1EH8A 3GFIA 3KETA 5CVUA 1JXSA 2BEOA 5LHHA 4KDPA 2FQ3A 4WXDA 2QM3A 1I1SA 1FSEA 4EJWA 4A5NA 5HS8A 2XAGA 1FBQA 4HZFA 2B0LA 3C3WA 4ZYGA 1YW7A 5J6XA 4NHJA 3M9AA 1J2XA 1IXRC 1KYWA 3QU6A 2MLKA 1O3TA 3Q5FA 2BE5F 4CZZA 1U3EM 2VE9A 3Q9SA 1RUOA 4WXCA 4OOIA 4RAZA 4IJAA 2X4HA 5BQTA 1BN5A 2BYVE 4OIRF 5E20A 3F6VA 3ZMUA 2XROA 1JHHA 2IPQX 2FMLA 2RNJA 5HLHA 1R5GA 4BQAA 1LDJA 5BOXA 1CF7B 3KP2A 1OYYA 3FXUA 2VXZA 4WWCA 5FD5A 2D1HA 5LRSA 3RKWA 2LDUA 4KIGA 2FNAA 1D5VA 1KQ9A 2JPBA 1OKRA 2KIMA 4ZYHA 3HUGA 3T8RA 3WE2A 5HLGA 1PP8F 4L9NA 5LHIA 4L9JA 1LNWA 1QBJA 2V1XA 4OU0A 1GVJA 1K7AA 1IW7F 2DBBA 2ADUA 4YIIA 2C6YA 5JFRA 2K86A 4MEYF 3FZVA 3K9TA 2MBFA 2J5PA 3PQKA 1A04A 1FZPB 1QNTA 2DQLA 1BIAA 1XMKA 2WTEA 3MEXA 4XLNF 1FX7A 3SQNA 1I27A 3LWFA 1XDSA 4D0PA 3C1DA 3WU1B 3CUQB 3R6SA 3WGIA 3I64A 3V4GA 3L00A 1IRGA 4AIJA 4HW0A 1FNNA 1FP2A 3TO7A 3F72A 4HDVA 4A2UA 3BROA 3IWFA 4U88A 2K4JA 2OAZA 4HV6A 5E1XA 5KK1A 3TGNA 1R23A 3BP8A 1TBXA 2RN7A 4G7HF 2ETHA 3J7AO 5HOOA 1Z9CA 2EB7A 4R8HA 4B8XA 5DCFA 3F6OA 5FO5A 4UVAA 2H27A 2IW5A 1U2WA 3V8JA 2YSRA 3QOPA 5ILUA 3JTHA 2FXAA 6PAXA 2MH9A 2A69F 3E5QA 2CQKA 2HKXA 1LEAA 3QPHA 3C18A 4TV7A 5L3CA 2OQGA 3EDPA 4IPAA 3GO5A 3S2WA 2NNYA 1USTA 4L0YB 3LFKA 1ZREA 1MJAA 1IN7A 4ETSA 5ICCA 2FBHA 4IVNA 5A2QZ 3JSPA 2IRFG 2DI3A 1P4WA 5EEGA 2JZYA 4HAMA 1FC3A 4I0AA 3VB2A 2IJLA 1S7AA 1U6GA 2D2WA 4M6YA 1XMAA 4RB3C 1O3QA 4WX9A 2Q8KA 5FLXZ 1WQ2A 2DU9A 4EM2A 2JT1A 3QRFF 2HZTA 3TKYA 5IT9Z 3HOTA 4ENJA 3GF2A 3ISPA 2H6BA 5F1RA 3GYHX 5E1ZB 3C7JA 1RIOH 4AIHA 4ON0A 2HYGD 1SMYF 4P55A 2H09A 1QO0D 2VT3A 1R58A 3IRRA 1OR7A 1TQPA 5JVTA 1WSUA 3N4MA 4PGGA 3HYIA 5HDKA 1W7PB 3BJ6A 2O8XA 2VBYA 3FX3A 5JR3A 2ESNA 1Z6RA 1ZRFA 2CFXA 3LAJA 1FBUA 5J8CA 1QZYA 3CJNA 5AIPA 1RNLA 4IHSA 5A2QK 1XD7A 4Y17A 2GA1A 1R36A 1R5HA 2A5YB 4YFKF 1MZBA 3MZYA 2W85A 4LMYA 4KIFA 3JTGA 1IZ1A 3PFIA 1ZAOA 2M8EA 5DD4A 4QLCU 4A12A 1UHWA 5BS6A 4PGHA 2YU3A 1EH6A 1ON2A 1V4RA 4KN4X 1B4AA 3V7CA 1W4MA 3ROUA 1W7PA 4IHTA 1HQCA 1FYKA 3JW4A 3QP5A 3VFZA 1YO5C 4EJOA 3KP7A 3R4KA 2CW0F 2EFWA 3QU3A 3ECHA 3RKYA 2FU4A 1V3FA 2JTVA 2GXGA 2VC1A 4FHTA 1PP7U 1LEBA 2L3DA 2GAUA 3E97A 4EJVA 3GUDA 4R1HA 3TO9A 1USSA 2XASA 4IRHA 2ELHA 4XBFA 2Z9OA 5K5OA 1W7PD 1S6LA 2RC4A 3VEPA 3ECOA 3FXQA 4U7BA 1L0OC 2UXXA 2FA5A 1IN5A 3KP5A 2HYFA 3QPTA 1IN8A 3F8MA 2FNPA 3W6KB 4K2EA 4Q47A 1XB4A 2ZFWA 2W25A 5ILSA 3I58A 2E7WA 1QQIA 1XSVA 3SXYA 3DF8A 5E8GA 4CGZA 2RKHA 1OPCA 4L18B 5DV5A 1FY7A 3RI4A 2QLZA 3J81K 4MQVA 1MGTA 5CVRA 3J80K 5D6FA 1G3YA 3F21A 1EH7A 4IXAA 3CUQC 3VODA 3REOA 3HIFA 2HKOA 4HX8A 3ZMTA 2IA0A 2HTJA 2P7CB 5CVVA 2PQ8A 3EUHA 2RV8A 1BC8C 5LGTA 1GXQA 3EQLF 4ESJA 2QZ8A 1S8NA 2VOOA 4FX0A 2KIUA 1SD5A 4UV8A 4U7DA 1P4AA 3KFWX 1BI1A 2P6TA 2CG4A 2RDPA 1IUYA 5L3DA 3ZPLA 4A0ZA 3K1MA 4UXNA 1Q1HA 4ENNA 1WRJA 2W24A 1YG2A 2DLLA 1SFEA 5J8FA 4S05A 5BMZA 1MJ9A 3MAJA 1UCRA 3FMQA 4I2OA 4MTEA 3V7SA 2XVCA 4IRGA 2H94A 3GFJA 1F1ZA 1FLIA 1GHCA 3N97A 2A68F 4KA4A 1PUEE 4PDKA 1YS7A 3M1EA 3H92A 1J5YA 3W6JB 1TQIA 1Z91A 4M6XA 5D8KB 4YFXF 3KP3A 3HHHA 2RQPA 3I5UA 2FOKA 2NYXA 1UFMA 1BJAA 1B1BA 5ICGA 4G7OF 2VN2A 3QP6A 3B73A 3FXRA 1XGOA 1XDUA 1T38A 3HRTA 5CVJA 5DCMB 4HX7A 3RKXA 3EYYA 3GFMA 1B9NA 4BXUA 2E1NA 5CJ9A 3GLXA 2OZ6A 1KYZA 1MDMB 3ZMDA 1FPQA 2PMUA 1KGSA 1FT9A 3RTRA 4AVPA 1XGMA 2F5DA 5LGUA 2DW4A 1BI3A 2P8TA 4M73A 4KFCA 1MKMA 2V79A 4ZZDA 4LB5A 4M9SA 2XRNA 3IRQA 1S7OA 1ZLJA 3I54A 4WXHA 5CVIA 4HF1A 2JRTA 5ERIA 5FD6A 4L9VA 3RJPA 5DCMA 1XSDA 1SAXA 4ZZLA 2F5CA 3F3XA 5HS9A 1TQMA 1DDNA 3K0LA 2O61A 1P2FA 2EJRA 1O57A 1HW2A 1IN4A 1K6OA 3DPLC 4HV5A 4ASNA 3ERED 2HFHA 1R1UA 1MDMA 1XGSA 3E3VA 2ZMEA 1T6SA 4NQWA 5E1WA 2KIFA 2NS0A 1TNTA 1O3SA 4OMYA 1EV7A 4UHTA 2H6CA 2L4AA 2IVMA 2JPCA 2CO5A 5D8LB 1BI0A 3ABUA 2LF7A 3IKVA 1IXCA 1JE8A 1SD6A 4N0BA 5ED4A 3LA7A 4CHUA 4RGXA 2F2EA 2BBYA 2IP2A 3HSFA 3JSOA 2WC2A 3JAMK 1OYIA 2A61A 2E1CA 2F5EA 4UV9A 1YQAA 2MLGA 3O3KA 1OMIA 5D5UB 4A0YA 2XAHA 3DV8A 1ZH5A 3K1PA 1KU2A 4P9FA 1WKMA 5D5WB 4MTDA 3G3ZA 3F8FA 4GGGA 2PBIA 2D45A 2K27A 1SFXA 5D4RA 2DAOA 4EVIA 1ZLKA 4Q5SF 3KZZA 1G3WA 5D4SA 4KICA 2ESHA 4CXFA 4EMSA 3ZN1A 3R60A 2EFNA 2P5VA 4CDGA 3FWEA 3RYPA 2NNNA 2A07F 4ZYDA 1LB2A 1R1TA 1ZYRF 4CYDA 1HBXG 5FGMA 3KP4A 3DQVC 1L3LA 2CYYA 5AONA 1ZG5A 4O3MA 4DNCA 3WTSC 3BJAA 1J59A 4LG0B 1R22A 1G3SA 1FSHA 4EJTA 1XCBA 4KN7X 1IXSB 1HXDA 1S3JA 1WI9A 2PLYA 3H3ZA 4HYEA 2P4WA 2O03A 4YIFA 5FFXA 3MZHA 1JGSA 3OV8A 1X3UA 2Z99A 5L3EA 1DP7P 3M8FA 1U5TB 2VBWA 2QVOA 3E6MA 1Z7UA 2BV6A 4M9XA 3QAHA 4I09A 4XRFA 4G9YA 2PI0A 1HW1A 3CO6C 3K2ZA 1G6NA 2KKOA 1UHMA 4LLNA 3I59B 1LJ9A 2QBYB 3MQ0A 2X0LA 1K79A 1SD7A 2EV5A 2K02A 4LG0A 1REPC 4ESBA 4HOBA 1R7JA 1PDNC 1J9IA 3LSTA 2FSWA 2J5OA 3ELKA 1I5ZA 3K69A 3R61A 4HQEA 1HKQA 3KLOA 4L0ZB 4JK1X 4KUMA 4RGRA 4GCVA 3IL2A 1U5TA 3DEUA 1KU3A 4L5IA 4BAYA 1Z05A 1ZRDA 2Z5UA 1J7KA 4I01A 3WODF 3GX4X 1ZG1A 2L54A 3CUOA 3P9CA 5DYMA 3I0TA 1HSTA 3LA3A 5DEQA 5F6FA 2BGCA 3I59A 2KJCA 2PG4A 3G73A 3BZ6A 5ILVA 3O6BB 5JHUA 2QBYA 1NHAA 4HX4A 4LGWA 2YX7A 3E6BA 2L01A 3J81Z 5E17F 5HLIA 2RVCA 3J80Z 5K5RA 1P4XA 3TO6A 3WGHA 2Z33A 2VONA 3CTAA 4EM0B 3DPTA 3FM3A 1XGNA 3HRUA 4WCGA 2D1VA 1C0WA 2XAFA 2VBXA 3F8BA 1MJBA 3WE3A 3MFKA 3WTXC 2Z3YA 4RB2C 2STTA 3COAC 3NQOA 2O0YA 2PMHA 5H6QA 3CDHA 2VODA 1IF1A 3MCZA 5L3BA 5TRDA 5LGNA 3V7RA 3ZQ7A 3GZ6A 3FHZA 4LK0F 4B09A 1H9GA 2GZWA 2ZXJA 2EFOA 5IT3A 3WG9A 1CGPA 2QQAA 1G4DA 2HWVA 4CICA 3H3UA 4HF0A 2OBPA 2YX4A 5DD8A 2DK5A 3E5XA 1ULYA 4EJUA 1BOAA 2OD5A 2UWMA 2DO7A 2HQNA 3HTSB 4LD5A 5LEJA 2EA4A 4BHBA 1J0RA 1BIBA 1H9TA 3ULQB 1ZARA 2VOPA 4U0VA 1YTYA 4MNUA 1HSJA 2M30A 4BNCA 3WU0A 3L09A 2ZKZA 3E5UA 4EQQA 3KE2A 3WTTC 1MD0A 4I98B 2EWNA 4KMUX 2LSOA 1B59A 4GO1A 3L7WA 2EA2A 1J75A 3IHUA 1ZRCA 2VT2A 2FEZA 3B02A 2OZUA 4G8XA 3I53A 3GXOA 2UZKA 3O2PE 2DT5A 4UNOA 4P5OA 2XGXA 3DP7A 2FF4A 3HOSA 5L3GA 4LFUA 1QPMA 2DPDA 1STZA 4LB6B 1YFHA 3AAFA 2EK5A 3LQQA 4FT8A 3U9GA 1KA8A 1T98A 1IRFA 5LEKA 2XIGA 2GWRA 2QQ9A 2ZNYA 4M71A 4A6EA 3HSEA 4LLGF 5F64A 1HKSA 1BM9A 1QZZA 5BPDA 1DPRA 4MEXF 3WTZA 1YW9A 4JQFA 2NAZA 2DFIA 1T0FA 5E18F 2QUFA 4EM1A 4AD9A 2MD5A 2ISZA 2M1BA 1YLFA 1IAWA 5D6EA 1I1GA 1ZGJA 5HDGA 3RPQA 1W5TA 5TJJA 3WTVC 2R7FA 4IF4A 3BJOA 2CGPA 1U5TC 3CO7C 1TLHB 3HRSA 2IT0A 4HF2A 2Q0OA 4RB0A 4UUVA 2O3FA 4RB1A 3KP6A 2DPUA 1R1VA 1T39A 2YPRA 1OYWA 5FB2A 3BY6A 3U2RA 4MGRA 4KT5C 1ZG3A 1KU9A 2MH2A 2XUBA 3BPVA 3WTUC 2WWYA 2VC0A 1XSXA 5CLSA 4RAYA 2E7XA 2PJPA 3P7NA 2ZBKA 3GFLA 3DFGA 1T2KA 2V6CA 5LHGA 4JBAA 2JSCA 1YS6A 1D8KA 4HA8A 4R79A 2ZMEB 1G3TA 3F8CA 2PEXA 3FF5A 2V1DA 4M72A 3JAMZ 3F23A 3ZMSA 4KNYA 1TW3A 1BBYA 2IA2A 1U8RA 3CLOA 2HGCA 4I0BA 1O3RA 2CSOA 3IWZA 2NRAC 2EV6A 5LLQA 4AIKA 1BI2A 2HR3A 1DPUA 1Z1DA 3GEZA 2VBZA 2XKOA 2HEOA 5E8IA 4G6DA 1FOKA 4Y13A 1RUNA 3KEQA 2GXBA 3L9FA 2AXLA 1SFUA 1Z6TA 4LJZF 4MQ9F 2Y75A 4ENMA 3FM5A 4RS8A 5DDGA 5K5QA 4NB5A 4DQ2A 3K1NA 2EFPA 2M87A 4EV0A 5FFZA 1F5TA 2G9WA 2R7DA 4O5VA 2AS5F 1CF7A 1ZN2A 1B6AA 3TDUC 1ZGAA 3MWMA 1O7FA 3ZMVA 1AOYA 2G7UA 4A5MA 4O6JA 1ODDA 1E17A 3BDDA 5HS7A 5H6RA 4EGYA 3V8KA 4CO8A 3WTYC 3RIRA 2ZNZA 1U78A 4KIBA 4WK8F 2XAQA 2XV4S 2MA3A 4P96A 3Q9VA 3TOBA 1YW8A 1O7LA 2GQQA 2HTSA 2M5WA 4S04A 3ZMZA 5EEHA 4BHCA 1AWCA 1RI7A 3F8NA 3FMRA 3R0AA 4I7HA 2UXNA 1FWZA 3BOQA 4HDUA 1LQ1A 1KU7A 2HQRA 3EETA 3SFZA 1XN7A 1ON1A 2FMYA 2HDCA 3ZP5A 1BC7C 3OOPA 3T0YA 4BHPA 3KZYA 4BH9A 2F5FA 4UVBA 2OU2A 2A6HF 4LK1F 4IRIA 3CUQA 3WGGA 3ABTA 2GIVA 1P6RA 2XKPA 1QGPA 2KJBA 1LDDA 2VE8A 1JHFA 3D5LA 1YYVA 4H0EA 2HOEA 4I02A 1HW5A 3IC7A 3T8TA 1B9MA 5BPIA 1F4KA 3TQNA 2QYOA 5D5XB 4HQMA 4P9UA 4AWXB 3HRMA 1R00A 1D8JA 3T1BA 1LVAA 2GA2A 2P5LC 3DXJF 3SZPA 1DUXC 4OIOF 3GVAA 4N9IA 4E70A 1D3YA 3IKTA 3HTUA 2K7LA 4GXOA 4GYGA 3KCCA 2ISYA 4XSZF 1Y0UA 4OIPF 1H0MA 3V8LA 4Y15A 2FBKA 3GWZA 5HDNA 2ACJA 1SMTA 3M7GA 2DTRA 4RGSA 5CYVA 1WWXA 3T5XA 1VTNC 1TTYA 4M74A 4YG2F 2P7VB 2WV0A 1UB9A 4XLPF 4FX4A 3M8EA 1IN6A 4PZJA 3VOEA 4ENKA 1SD4A 4RGUA 5HVQC 4HLYA 3SZTA 2QENA 4U0YA 3WTWC 3LA2A 3P9IA 2QQBA 2DQRA 2MC3A 4ZH4F 2R3SA 3U1DA 3E6CC 2PN6A 1RZ4A 4F7ZA 4M9ZA 2FBIA 2RGVA 4U0WA 3ZN0A 2KRFA 5DUKA 2Q2EA 4HBLA 4G6QA 5ICEA 4L5JA 1ZHFA 1FYMA 3RYRA 1I6XA 1FBSA 2LF8A 3EYIA 4PCQA 4A6DA 5FLXK 2FE3A 2A6EF 2TDXA 4MHGA 2G7HA 5IT9K 1ONVA 2STWA 5K1YA 2DK8A 3TDZC 3E6DA 3TOAA 3GZ5A 2EV0A 3R0JA 2W84A 3SHFA 4GYIA 1P92A 2YR2A 1FYLA 1GXPA 1FP1D 2K4BA 2LKPA 3D0SA 4OIQF 2L02A 4L9TA 2LNBA 4Z2YA 2FRHA 4Q48A 2HS5A 2ZJ2A 2ZCWA 1KQ8A 1W5SA 5JI6A 5AIQA 5D5VB 3LAPA 1LDKB 5LBQA 3P9KA 3ML6A 4UVCA 1TNSA 2L4MA 2O6GE 3DKWA 3LQRA 4G7ZF 2P6SA 3PQJA 2OQRA 3HSRA 2ZO4A 5ICFA 2OA4A
chains in the Genus database with same CATH superfamily
2ME0A 5FJ8J 2R92J 2XAJA 2A3SA 4Z6YA 4Q4ZF 4XSXF 3NWTA 1YJNI 1K78B 1X4OA 1TW2A 2V9VA 3K2AA 3KEOA 4IQJA 2X48A 1TT5B 3RDIA 3AKZA 3TP3A 4KMFA 1A5JA 4YFNF 2COMA 5KVRA 2IA1A 1S29A 1XCVA 4C3IJ 1BR1A 3F22A 1R6RA 3BPXA 1YIOA 3RQ4A 2M9HA 2Y48A 3CCQI 3AFHA 1FMWA 2BOLA 4ZYEA 5E3MA 3OYDA 4B48A 3F0CA 2W1OA 1Y6IA 3FXOA 4G94A 2R7ZJ 5L3FA 4LLLA 4I99C 1E2XA 2LOOA 4HLXA 3SEZA 3HGGA 5B3SH 4N9HA 2Y0MA 3NRVA 1MBHA 4OAYA 3TMOA 4EGZA 5H20A 2LY1A 2CWEA 1JUPA 4ESFA 2IXSA 3I4PA 2WAEA 3HHGA 3KLNA 5C44J 1VQ7I 3FMSA 4CCKA 4E7KA 2M34A 3MKYB 5DUIA 2EFQA 3RZDJ 1KQ0A 3RSNA 1TP4A 3I71A 4KYWA 1G8XA 3RPUA 4A0XA 3L2CA 3OYNA 2M45A 5LRRA 4D1QA 3CCUI 2V1UA 1V5FA 3GW2A 2PFBA 2W57A 4QWQA 2XHKA 1YOVB 3NEUA 1BL0A 4OINF 2QWWA 1K78A 4WF2A 4B47A 1HKTA 3BWGA 2JA5J 5FKMA 2ZXHA 4OMZA 4AIDA 1YE9A 4BYYA 1F9NA 2P5KA 1EH8A 3GFIA 1POGA 1XG1A 2W7NA 1APLC 3KETA 1R4NB 5CVUA 1JXSA 2BEOA 5LHHA 3E0JB 1A6QA 4KDPA 1ETKA 2FQ3A 2PMZA 3U1KA 2KRHA 3L1PA 4WXDA 4A93J 4DYCA 5C4JJ 2QM3A 4XONA 2JMWA 2H8WA 3BQZA 1XMXA 1I1SA 1FSEA 3RPUD 2K9SA 4A5NA 2GOXB 1U9NA 2Y0SA 4EJWA 2VB6A 4JP0A 4BE2A 5HS8A 2RREA 2XAGA 3S16J 1FBQA 4HZFA 1I39A 1AHDP 4BXFA 2B0LA 3C3WA 1Y1WJ 4ZYGA 4Y52J 5TGTA 1B8IB 3MKWB 1MNDA 3QOEA 2V6EA 2MG4A 2XPVA 1YW7A 5J6XA 4NHJA 3BG6A 3M9AA 2E2JJ 1J2XA 1IXRC 5GPCA 1VQOI 1KYWA 3QU6A 1X2MA 2MLKA 2KL4A 1O3TA 3Q5FA 2Y2ZA 4A3FJ 3LMMA 2BE5F 4CZZA 1U3EM 1GVDA 3Q9SA 2VE9A 3FK6A 5M5WJ 1RUOA 4WXCA 4OOIA 4RAZA 3HUGB 4IJAA 2X4HA 3PSIA 3IAM2 5BQTA 1QRYA 1BN5A 1QVTA 2BYVE 5CQEA 4OIRF 3ESWB 5E20A 2L5QA 3F6VA 3ZMUA 5HNHA 1JGGA 3CC4I 3PO2J 4MFDA 1Y0NA 1D1BA 2M0CA 3HOXJ 2XDVA 2CV1A 2O5RA 2XROA 1JHHA 2CJJA 2IPQX 2EZLA 3E1SA 2FMLA 2W00A 3GMEA 3FXLA 2RNJA 3CCYA 2HYJA 3F9KA 5HLHA 1R5GA 2DMQA 1NTCA 4HSRA 4BQAA 1ETVA 3GTJJ 1Z7LA 2L9RA 1LDJA 3W6VA 2GM4A 5BOXA 2UUZA 4UUTA 1ZR4A 5TISC 1CF7B 2L9SA 2K85A 1OYYA 2VJ4A 3H36A 3KP2A 2EBIA 1UAAA 3FXUA 4XKVA 2VXZA 2M7BA 4WWCA 2L9VA 1R49A 5FD5A 2GBYA 4AU7A 2D1HA 2VJJA 4RM2A 5LRSA 3HC7A 3L2UA 3RKWA 2LDUA 3DU5A 4KIGA 2FNAA 2IS6A 1D5VA 1KZHA 3FIWA 1KQ9A 2JPBA 4YEJA 1OKRA 5GTIC 1JI8A 2KIMA 4PFOA 4ZYHA 3HUGA 3T8RA 2FX0A 3WE2A 5HLGA 1PP8F 2CRGA 2CUZA 4L9NA 3FKJA 5LHIA 1JKQC 2CH0A 5LD2C 4L9JA 4E7JA 3SDBA 1LNWA 2BHZA 2ID3A 2V1XA 4XKWA 3W2VA 3BLYA 1QBJA 2XGDA 4OU0A 3U21A 4ANJA 1GVJA 3JRAA 1K7AA 1IW7F 5F0CA 2DBBA 3SDGA 1E0EA 3E7LA 2ADUA 4YIIA 2XPWA 2R7WA 3PNTA 2EPFA 3GTMJ 4ABZA 3OWTA 2C6YA 2VKEA 2KRCA 4XMYA 4DBRA 2K86A 5JFRA 4MEYF 1RPWA 3FZVA 3K9TA 2MBFA 2N8GA 2F48A 1MBGA 2BY0A 4BE1A 1LFUP 2J5PA 3PQKA 2WY8Q 4L5EA 3S1RJ 1A04A 3QYEA 4IEJA 1JUSA 2ZXWH 3BTCA 4BUPA 2TRTA 3LSHA 2COBA 3VSKA 3CCRI 2EIJH 1FZPB 1QNTA 5E3LA 4M6VA 4J00A 5GP9A 2DQLA 2DFEA 3OIPA 1BIAA 1T08B 1XMKA 5JLWA 2WTEA 3MEXA 4IOAF 9ANTA 4XLNF 1FX7A 4BQQA 2NOJB 3SQNA 1I27A 3LWFA 4DYRA 2M4KA 1XDSA 5IOZA 4BE0A 2CW7A 1F43A 4D0PA 4UB6C 3HGYA 3TL4X 3C1DA 3WU1B 4UY8I 2JA7J 3CUQB 4LIUA 3R6SA 2Y30A 3WGIA 3I64A 3V4GA 3L00A 1IRGA 4AIJA 4HW0A 1FNNA 5FLVA 2Y31A 1FP2A 2DOFA 2OC6A 3TO7A 3F72A 1Y56A 4HDVA 1X1AA 2BW3B 3G1MA 2NVXJ 4A2UA 3BROA 3NAUA 3IWFA 4II3A 4U88A 2NVYJ 2R7XA 1WVRA 2K4JA 2OAZA 4HV6A 5E1XA 5KK1A 3BC8A 3WG7H 3TGNA 1R23A 3BP8A 1TBXA 2RN7A 5DS9A 1XC5A 4G7HF 1MNEA 2ETHA 4DYQA 1VQ6I 4BEHB 3DBRB 3J7AO 3TP0A 3H3VK 5HOOA 1Z9CA 2EB7A 1IG7A 3JRCA 4F55A 3NARA 4R8HA 1VQ4I 2JN6A 4RAGA 4B8XA 1D1CA 2LR8A 5EYRA 5DCFA 3F6OA 4HNVA 3CP8A 3ABKH 5FO5A 1JKPC 4UVAA 2H27A 2IW5A 1U2WA 2NXNB 3V8JA 2YSRA 3QOPA 2F6CA 5ILUA 1ETOA 3JTHA 4XICA 4RBOA 2FXAA 1VQ5I 2R7TA 1T0FC 6PAXA 2JA8J 3TW7A 2MH9A 2A69F 2M8GX 4YRVA 3CF2A 2CUFA 2CQKA 2CMPA 2HKXA 3E5QA 4Y7NJ 2BHYA 2JK3A 1LEAA 2BW3A 3QPHA 2PMZN 3C18A 2X6YA 3S15J 3HZJA 3AG4H 4TV7A 1B72B 5L3CA 3SJMA 2OQGA 2RNGA 4BQOA 3EDPA 4IPAA 3GO5A 1CQTA 2BY2A 2LVSA 2Y0SN 3S2WA 2XB5A 2NNYA 1USTA 4L0YB 2HNHA 3LFKA 4FCYA 2DN0A 1EF4A 4DZPA 1ZREA 1MJAA 2HPMA 1IN7A 1LVKA 2EILH 2KQRA 4DGWB 1BR2A 1V5GA 4BEHA 3JRHA 1K4SA 1IC8A 4ETSA 2ZXIA 5ICCA 2CQNA 2PJRB 5F04A 2FBHA 4IVNA 4CZCA 5A2QZ 3JSPA 2OUMA 2IRFG 2DI3A 2LP0A 2YU9J 1P4WA 2K3FA 5EEGA 2JZYA 2ICWG 1FC3A 4HAMA 4PJLA 4I0AA 3JRGA 3VB2A 2IJLA 1S7AA 2B63J 3IP4B 3JR9A 1U6GA 2D2WA 4M6YA 1XMAA 3Q0WA 4RB3C 4E7HA 3FXKA 5F0HA 1O3QA 4WX9A 1PUFB 3ABMH 3CC2I 4IHXA 2Q8KA 5FLXZ 1WQ2A 1HA8A 2DU9A 3H5NA 4EM2A 2JT1A 3QRFF 2HZTA 3TKYA 5GAEJ 5IT9Z 3HOTA 1VQPI 5K7ZA 1K6YA 4ENJA 3GF2A 3ISPA 3PNYA 2LBFB 2DT7B 2H6BA 5F1RA 3GYHX 1DU0A 5E1ZB 3C7JA 3CMMA 3K6GA 1RIOH 1ZELA 2MYSA 3OYGA 3S3OA 1B72A 3L2QA 3H0DA 3H9JA 4AIHA 4ON0A 2HYGD 1ORKA 1SMYF 4P55A 5J47A 3HJEA 1N75A 4UB8C 2H09A 5EGOB 1MH4A 4FE7A 2JSPA 1QO0D 2VT3A 1R58A 4F92B 3IRRA 4XQFA 1OR7A 4HNTA 4B3XA 4D7NA 3HOUJ 1LFBA 3TBIA 1ENHA 1TQPA 5JVTA 1WSUA 4XK4A 3N4MA 2LG4A 4PGGA 3OYJA 4DW6A 3HYIA 1OCCH 5HDKA 3PSFA 1W7PB 3BJ6A 2O8XA 1GV2A 2VBYA 3FX3A 4CUGA 3Q0VA 3I9V2 5IP7J 5JR3A 1A31A 4A3DJ 4A3LJ 2DA7A 2ESNA 2V9KA 3PFYA 1Z6RA 1ZRFA 3CCVI 3CCJI 2CFXA 3LAJA 4DIQA 2VUMJ 3H9QA 4C3HJ 1A36A 1FBUA 5J8CA 1QZYA 3CJNA 4M3GA 1AKHA 2DYRH 2IGNA 5AIPA 1RNLA 4IHSA 5A2QK 1XD7A 4Y17A 2GA1A 3A0BC 2VL8A 3LSGA 1R36A 1R5HA 2A5YB 4YFKF 2LBFA 1Z3XA 2BVLA 1MZBA 1S9HA 5KAIC 3MZYA 1MMSA 2LY2A 2W85A 3OYCA 4LMYA 3B6AA 2XPUA 4IL6C 4KIFA 3JTGA 1IZ1A 3FDYA 3PFIA 1ZAOA 3OY9A 2M8EA 5DD4A 4QLCU 2LFBA 3FHNA 3FXJA 4A12A 1SEUA 1UHWA 5BS6A 4PGHA 2YU3A 1EH6A 1ON2A 5EG0B 1DGWY 3GTGJ 1V4RA 2AQEA 4KN4X 1E3HA 1B4AA 3P5JA 3V7CA 3S1QJ 4NC6A 1IRXA 3BTLA 1W4MA 3HBLA 3ROUA 3I3LA 2DA5A 2DA6A 1W7PA 2UV1A 4IHTA 1HQCA 3BT9A 1FYKA 3JW4A 3QP5A 2L7FP 3VFZA 4J01A 1X1BA 2ZJRF 1YO5C 4EJOA 3KP7A 3R4KA 2CW0F 2HXOA 3Q0UA 2ZJPF 2EFWA 3QU3A 2P81A 3ECHA 2P0WA 3GBGA 3RKYA 2FU4A 1V3FA 2JTVA 2GXGA 2VC1A 4FHTA 1PP7U 4ZC3A 3K4MA 1LEBA 2L3DA 5GTHC 2GAUA 3E97A 4EJVA 3GUDA 3ZQIA 4R1HA 1F36A 3KEYA 3TO9A 4E7ZA 1USSA 1T56A 2XASA 4IRHA 2JVGA 2ELHA 2VPLA 4XBFA 2Y69H 3LSKA 2Z9OA 5K5OA 1W7PD 5M3FJ 1S6LA 1H89C 2RC4A 2A6TA 3VEPA 3PJRA 3ECOA 3FXQA 4U7BA 1L0OC 2UXXA 2FA5A 1IN5A 2IS4A 4PJJA 3J7AY 3KP5A 2HYFA 2LKSA 3QPTA 1IN8A 1HCRA 3F8MA 2FNPA 3W6KB 2V1NA 5EG0A 3IH2A 5M5XJ 4K2EA 1X4PA 4Q47A 1XB4A 2ZFWA 2W25A 2OPTA 1IDZA 1D5YA 3BG7A 5ILSA 1X58A 3RKQA 3I58A 2E7WA 1QQIA 1XSVA 4QSHA 3DF8A 3SXYA 3OSGA 5E8GA 1UJ8A 4CGZA 2RKHA 3DEEA 1OPCA 4L18B 2DOAA 2LTPA 5DV5A 1FY7A 3K4LA 3RI4A 4RLQA 2QLZA 3J81K 4MQVA 1MGTA 1NG7A 5CVRA 3J7ZI 4ZTFA 3J80K 3ZGKA 5D6FA 3PM1A 2DMNA 1G3YA 3F21A 1EH7A 2YUSA 3ZQGA 1M1EB 5FRNA 4IXAA 3CUQC 3VODA 2KMUA 4A3BJ 3OIOA 4XLAA 3L2RA 3REOA 3HIFA 2HKOA 2Y9ZA 4HX8A 2DODA 3JREA 3ZMTA 2IA0A 3IV5A 3FKIJ 1S5LC 4BY7J 2HTJA 2P7CB 3LSMA 5CVVA 2PQ8A 3EUHA 2RV8A 1N25A 1BC8C 3GTPJ 5LGTA 1GXQA 3EQLF 4MO7A 2BY3A 4ESJA 2QZ8A 1S8NA 2I5UA 4Y33A 4PUSA 3PNVA 4A3IJ 1D0XA 2VOOA 1UELB 1LPQA 2VJIA 4X0GA 4A3GJ 1WFXA 4FX0A 2KIUA 1SD5A 3AG2H 3ASOH 2BZTA 4UV8A 4U7DA 1NK2P 2ECBA 4HRIA 5DTDA 2XRLA 1P4AA 1G2HA 3H0GJ 3KFWX 2A05A 1BI1A 2VKVA 2P6TA 2OF7A 2HZDA 2CG4A 2RDPA 5IYCJ 1VZ0A 1W5CC 4AYBN 5L3DA 1IUYA 3ZPLA 2W4SA 2VKDA 4NC7A 4BBSJ 4A0ZA 5BNGA 3K1MA 4UXNA 1Q1HA 3W2WA 4ENNA 4D5FA 3GZNB 3DBHB 1WRJA 2W24A 2W48A 2DA4A 2ECCA 4AUXA 1YG2A 1OCOH 4D5CA 2DLLA 1SFEA 5J8FA 4S05A 3VSLA 5BMZA 3TEDA 4M3FA 3LOCA 1MJ9A 3MAJA 1UCRA 3FMQA 4I2OA 4MTEA 3V7SA 2XVCA 1P9QC 4MIMA 1MMGA 1WJCA 4IRGA 2H94A 3GFJA 1F1ZA 5DM7F 5F1JA 1FLIA 1GHCA 1X2NA 3N97A 2KFDA 2K9QA 2A68F 2ME6A 4KA4A 5LFAA 1PUEE 4PDKA 1YS7A 3M3YJ 2EZIA 2F4MB 3H92A 3M1EA 4HG2A 1J5YA 4DZJA 3W6JB 1X1DA 2LREA 1J09A 1SVOA 3OL4A 5JHFA 1TQIA 2E1OA 1Z91A 3GTLJ 1ZKGA 1OR7C 5E3NA 1TL8A 4M6XA 5D8KB 4YFXF 2M7AA 2VQLA 3OYEA 1YHQI 3KP3A 4M3BA 1W0TA 2KDOA 3HHHA 3VDXA 2RQPA 3I5UA 2FOKA 2NYXA 1UFMA 1BJAA 3OOUA 1B1BA 5ICGA 4E6KG 1X1CA 4G7OF 1JT0A 3QYFA 3CQZJ 2QCOA 2QA4I 4QIWN 2AXTC 4YELA 4IHYA 3UKGA 2VN2A 1WH5A 3B73A 3QP6A 4D9JA 3FXRA 1XGOA 1TT0A 4OAZA 4CYCA 2E36A 1XDUA 1T38A 3HRTA 4AVZA 1MBFA 5CVJA 5CPRB 5DCMB 3DWLE 3S1NJ 2CUEA 4HX7A 1RR7A 3RKXA 2E5ZA 3EYYA 2X1EA 3GFMA 1B9NA 4BXUA 3A01A 2E1NA 1WCMJ 5CJ9A 2X1DA 3GLXA 2OZ6A 3KYLA 3RZOJ 1Z21A 4IQ4A 1EA3A 2O9LA 1KYZA 1MDMB 3DU6A 1FPQA 1Z0XA 2PMUA 1KGSA 3TW6A 1FT9A 3ZMDA 5FKKA 3G71I 3RTRA 3QWLA 4RA2A 3EUKL 1XGMA 4AVPA 2F5DA 5GADJ 5LGUA 4E7IA 3O8GA 4NQWB 1YIJI 3BG9A 2DW4A 2R7SA 5GAHJ 1BI3A 2P8TA 4M73A 3EUAA 1K83J 2KZGA 1FOXA 4KFCA 1MKMA 3BR6A 2V79A 1UG0A 4ZZDA 4LB5A 4M9SA 3ZQQA 2E35A 4BJ5C 2B9SA 2QSHX 1WH7A 2A5WA 1Z67A 4UUSB 3S3MA 2XRNA 3G1OA 3IRQA 3IH3A 3JRIA 1S7OA 1ZLJA 3I54A 3LNQA 2B7EA 2LK2A 4WXHA 5CVIA 4HF1A 1BOBA 4IZZA 3S2DJ 2JRTA 3A0HC 3ZOBA 5ERIA 3S1MJ 1K4TA 4XLFA 3KIOA 2VKHA 4AC0A 5FD6A 1PVEA 5FLMJ 4L9VA 3RJPA 5DCMA 1XSDA 2XF5A 2WADA 4ZZLA 1SAXA 2O8KA 2RAEA 2F5CA 3F3XA 5HS9A 1TQMA 1DDNA 2QKMB 3K0LA 2O61A 3DLAA 1P2FA 2IGKA 4CCMA 3S93A 2EJRA 1O57A 1HW2A 1IN4A 1K6OA 1UG2A 1JJ8C 4BACA 4XNFA 3IUOA 1W0UA 3WU2C 3CP2A 3PIPF 2M3AA 3DPLC 4HV5A 2Z2SB 4ASNA 3ERED 2HFHA 3CZ6A 1XPXA 5EEAA 2ZJQF 1R1UA 1MDMA 1XGSA 3E3VA 4FTHA 2ZMEA 4IHVA 2TCTA 1T6SA 3ZXSA 4NQWA 4GFBA 5E1WA 4EEFG 1AU7A 2KIFA 2NS0A 4XRSA 1TNTA 3SEQA 3HB9A 1O3SA 4OMYA 1FTTA 1EV7A 4UHTA 1QPIA 2H6CA 1MBJA 5IOYA 3D5RC 3K4CA 2L4AA 2IVMA 3MN2A 2JPCA 1ZTRA 2CO5A 3NWSA 5D8LB 3ZR8X 1BI0A 4UUSA 2VQCA 3HOVJ 4JYKA 3ABUA 3HOZJ 2LF7A 4E7SA 3IKVA 3DBLB 2V4JC 1IXCA 1JE8A 1SD6A 2XSJC 4N0BA 5ED4A 3V42A 3LA7A 3OYBA 4CHUA 1JTYA 3OMYA 4RGXA 2F2EA 2BBYA 1T95A 2LMDA 2IP2A 3HSFA 3DTIA 2NOGA 2L7KA 3JSOA 2WC2A 3JAMK 1OYIA 1TWAJ 2A61A 2E1CA 3MKZA 2F5EA 3SFIA 2WBMA 1QHHD 2DFHA 2VXDA 4UV9A 5E3OA 1YQAA 2MLGA 3ZQLA 1TC3C 3O3KA 2XGCA 1DGRM 2DFFA 1JJ6C 2XAUA 2KHMA 1ETXA 1TZLA 2K3PA 4FISA 3SYTA 2OTJI 1OMIA 1LFPA 3S17J 5D5UB 3ERMA 4A0YA 2KISA 2XAHA 2AO9A 3DV8A 1ZH5A 3K1PA 1KU2A 2LY9A 1WKMA 4P9FA 5F0FA 5D5WB 1GV5A 2YS9A 4MTDA 3G3ZA 5HNFA 3F8FA 3QPLA 2CUJA 4GGGA 4BBRJ 2PBIA 3IAS2 4DBQA 2D45A 3JRFA 2K27A 4Y3OA 4W1UA 1HDPA 4LOCA 1SFXA 2E71A 2LD5A 5D4RA 1XS9A 3LFUA 3WHBA 2R7QA 1SAUA 1HF0A 2DAOA 4EVIA 2DYSH 1ZLKA 4Q5SF 3KZZA 1G3WA 5D4SA 3I4MJ 4KICA 4V2FA 2ESHA 4PSWA 4CXFA 4EMSA 3ZN1A 3R60A 2GIZA 3PUFA 4LITA 2EFNA 2P5VA 4CDGA 3FWEA 4BJ6C 3RYPA 2NNNA 2JUGA 3BQYA 3RQIA 4I76A 2A07F 4ZYDA 1LB2A 1R1TA 1ZYRF 3OYHA 4KISA 4CYDA 1HBXG 1IRZA 5FGMA 2E60A 3KP4A 3DQVC 1L3LA 2EINH 3QODA 4II2A 3HG9A 4HNUA 2CYYA 4CSWA 5AONA 2IEKA 3CMYA 4ZYAA 1ZG5A 1OCTC 4O3MA 1MBKA 1WJDA 4DNCA 3WTSC 4GRIA 3BJAA 4NBQA 1J59A 4DOZA 4LG0B 4QPQA 1R22A 1D1AA 1G3SA 1FSHA 4EJTA 4J19A 1GT0C 1XCBA 4KN7X 2EZHA 3MMYB 1IXSB 3CESA 1HXDA 5EJCA 1S3JA 1WI9A 2PLYA 2D5VA 2HDDA 3H3ZA 4CCNA 3OSFA 3A2KA 4HYEA 2IGOA 2P4WA 2O03A 4PJ0C 4YIFA 5FFXA 3MZHA 3IH4A 1JGSA 3OV8A 1ITYA 1X3UA 2Z99A 5L3EA 4XKBA 4XRMA 3M8FA 1DP7P 1U5TB 2AHQA 2VBWA 1K61A 5JLXA 1I50J 2QVOA 2HDWA 2H1LA 3E6MA 4B4CA 2I8DA 5IPAA 1ZK8A 1Z7UA 2X9DA 5B1AH 2BV6A 4M9XA 3C2HA 3QAHA 2ZSIB 2VQHA 4I09A 4XRFA 4G9YA 2VI6A 2PI0A 3G2BA 3ZCOA 2R4GA 3I55I 1HW1A 3CO6C 3O8HA 5K7HA 2ZC2A 2WY7Q 3B6CA 3KYDB 3K2ZA 5M3MJ 1G6NA 2KKOA 1AKHB 2DA3A 1UHMA 3CCEI 3BTIA 2F5VA 1RKWA 4LLNA 3I59B 4X6AJ 5KAFC 2CS3A 1LJ9A 2QEXI 2L2OA 2QBYB 3MQ0A 1EKEA 2X0LA 4PK4A 1TWCJ 1K79A 1SD7A 4C3JJ 2NVUB 2L7MP 2EV5A 3OS1A 4XIDA 2CV2A 1VQNI 2K02A 2JA2A 4LG0A 4XLHA 1TWGJ 1REPC 1H8AC 4ESBA 1OCPA 4HOBA 4XL9A 4P1WA 1R7JA 2MSYA 1PDNC 1J9IA 3UNGC 1IJWC 3LSTA 2FSWA 2J5OA 3ELKA 1I5ZA 2LH9A 4D7MA 3K69A 2LRDA 3BR1A 3R61A 4HQEA 1HKQA 3KLOA 4IKFA 4L0ZB 3HOYJ 4ZTJA 1AA7A 5CQGA 5KNLA 2IAIA 3DPUA 4JK1X 4KUMA 1VF9A 4GCVA 4RGRA 1U5TA 3IL2A 3DEUA 1KU3A 4L5IA 1FMVA 4BAYA 4OWRB 1Z05A 4FE4A 1VQMI 4ZDPA 1ZRDA 1YI2I 2Z5UA 1J7KA 2BXYA 2DDBA 4I01A 2KLOA 3G6EI 3WODF 3GX4X 4C2TA 3OIQA 1ZG1A 2L54A 3HEFA 3BG3A 3CUOA 3BZKA 1ACIA 2FD5A 3P9CA 2VJ5A 5DYMA 2IS1A 2V26A 1OLTA 3FK7A 5J40A 4F93B 3I0TA 1HSTA 3LA3A 2KPMA 4F3QA 5DEQA 5F6FA 4YIRX 2DA1A 2BGCA 3I59A 2QGUA 2KJCA 2PG4A 4PSXA 3G73A 3BZ6A 5ILVA 3O6BB 5JHUA 2QBYA 1NHAA 4HX4A 4LGWA 3H35A 3FISA 1D0ZA 2YX7A 2L01A 3E6BA 4N4OB 3J81Z 4BDYA 5E17F 5HLIA 2RVCA 3J80Z 5H2FC 5K5RA 1P4XA 3TO6A 3WGHA 2Z33A 2VONA 3CTAA 4EM0B 2DA2A 3DPTA 1WJAA 3LSJA 3FM3A 2EIMH 1XGNA 3HRUA 2M0MA 4WCGA 2D1VA 1C0WA 4XOTA 1R5ID 2XAFA 2VBXA 2H8RA 3F8BA 1VQ8I 2WAQA 1MJBA 3JCUC 2LYCA 4EATA 3WE3A 3MFKA 1SFKA 5C3EJ 4AM3A 3WTXC 2Z3YA 4CA0A 4RB2C 1NK3P 2STTA 3COAC 3NQOA 2O0YA 2PMHA 5H6QA 1Y39A 1VNDA 3CDHA 1JTXA 1TWHJ 3HPHA 4FASD 1SANA 3OL3A 2VODA 2MC4A 1DU6A 1IF1A 3CD6I 2DJNA 3MCZA 5L3BA 5TRDA 1ZR2A 4BS9A 3V7RA 5LGNA 1MMDA 1E3PA 3VYTB 3ZQ7A 2WA0A 1WI3A 3GZ6A 2DOEA 4CCLA 3FHZA 4LK0F 1BW5A 4B09A 1OQYA 2ELKA 4FQGA 3VPRA 1V5EA 1H9GA 4ZJZA 3ZQCA 2GZWA 2ZXJA 2EFOA 5IT3A 2MW8A 2L9NA 2HQ5A 2GXAA 1I3AA 2VQGA 1LUJB 1W36D 2WAFA 1QU3A 3WG9A 2MGQA 1CGPA 2QQAA 1G4DA 2HWVA 3K7AJ 2FOWA 3K4KA 4CICA 3I56I 2EZKA 3H3UA 4HF0A 1QVUA 4B1RA 3K10A 2OBPA 2YX4A 4IOCF 5DD8A 2DK5A 2OV7A 2Z1DA 1R71A 3KZIC 4BU2A 3E5XA 1ULYA 4EJUA 1XTAA 1BOAA 2OD5A 2UWMA 2JJ7A 4A3MJ 2DO7A 2HQNA 3HTSB 1IDYA 1PJRA 3CCLI 4LD5A 5LEJA 2EA4A 4BHBA 2L7ZA 1J0RA 5KHDA 4V19K 4BXXJ 4N4NB 1BIBA 1H9TA 3ULQB 1ZARA 2HVRA 4CCOA 4U0VA 2VOPA 3CCMI 1IGNA 5FROA 1YTYA 4MNUA 4BY1J 3K4JA 1HSJA 2M30A 4BNCA 3WU0A 2XC7A 3L09A 4XM3A 2ZKZA 3E5UA 3QYBA 3ZQFA 4BJTA 4EQQA 3KE2A 2DJIA 3WTTC 1U8BA 1MD0A 4I98B 3M4OJ 2EWNA 3OR2C 4KMUX 3BR5A 2LSOA 1B59A 4GO1A 3L7WA 2EA2A 1J75A 3IHUA 3EPZA 1YRNB 1ZRCA 2GLOA 2VT2A 5F27A 2FEZA 1IUFA 4A3KJ 1O4XA 2E2IJ 3B02A 3KPHA 1RETA 1JUMA 2JRMA 2OZUA 4G8XA 3I53A 3FBIB 1OJLA 3H5RA 3GXOA 2LKXA 4XRSG 3A02A 2UZKA 2E1MB 3W2AA 3OYMA 1MSFC 5HODA 5J1RA 3AL0B 3O2PE 2DT5A 4S0HB 4UNOA 2DMTA 4P5OA 2HVSA 2X6WA 2MD0A 2QSGX 1SC7A 2K9MA 2XGXA 3DP7A 1HC8A 2FF4A 3HOSA 2R7OA 3BG5A 1ZGWA 5L3GA 1H88C 4LFUA 3DLLF 1QPMA 2DPDA 1TWFJ 2X1CA 1STZA 3H1CA 3K70D 4LB6B 4XLCA 1YFHA 1Y8RB 3BR3A 4NUBA 2V7FA 3AAFA 2EK5A 2IGMA 3LQQA 4IHWA 3A4CA 4IO9F 4FT8A 3U9GA 3CMAI 1KA8A 1NH3A 1T98A 4IX7A 2QKLB 2XSDC 1IRFA 2MFZA 1RR8C 2NS7A 5LEKA 3BTJA 2XIGA 4JX5A 2KZVA 2GWRA 1VFCA 5IYDJ 3DEWA 3M07A 2FJ1A 2QQ9A 2ZNYA 3MD2A 2H1KA 3JRDA 4M71A 4A6EA 1YRNA 4CYCB 3HSEA 2HQAA 5IP9J 4LLGF 1X19A 3C2BA 5B1BH 3N05A 5F64A 1HKSA 1BM9A 4MFEA 1QZZA 3G4SI 5BPDA 1DPRA 4MEXF 3WTZA 4QPOA 1YW9A 4JQFA 2NAZA 2DFIA 3A01B 3GTQJ 1T0FA 5E18F 1XX5A 2M2EA 2QUFA 2CQXA 3ABLH 4EM1A 2DCEA 4AD9A 2MD5A 1X3ZB 2ISZA 2M1BA 3C2GA 1YLFA 1IAWA 4LG3A 5D6EA 1I1GA 1OFCX 1Q1VA 1ZGJA 3LSIA 5HDGA 3RPQA 1W5TA 5J4VA 1VQLI 5TJJA 3WTVC 2R7FA 2LLKA 4A3EJ 4IF4A 1ETWA 3BJOA 1U5TC 5J1UA 2CGPA 3CO7C 1TLHB 3HRSA 2IT0A 2DMPA 3BCBA 1MBEA 4U87A 5CKTA 4HF2A 2DDAA 3S2HJ 1MW7A 2Q0OA 4RB0A 4UUVA 2O3FA 1DP3A 4RB1A 2O7OA 3A03A 3KP6A 2JA6J 2DPUA 3H5AA 2EH3A 1R1VA 1T39A 2YPRA 1OYWA 3MKLA 5FB2A 2VLAA 3BY6A 3U2RA 3ZQHA 4MGRA 3OYKA 1HDDC 4KT5C 2IS2A 1ZG3A 1KU9A 2MH2A 2XUBA 3BPVA 3M1CA 3WTUC 2WWYA 3HOWJ 2VC0A 1XSXA 5CLSA 4RAYA 2E7XA 5J1YA 1Y1VJ 3Q3SA 1LKXA 3ZRGA 2PJPA 5EF6A 3HDDA 3P7NA 2ZBKA 1OCZH 3GFLA 1V55H 3DFGA 1T2KA 3SZGA 3D1NI 2V6CA 5LHGA 4JBAA 2JSCA 3BZCA 2HPIA 2X51A 2E5NA 1YS6A 4E7LA 1D8KA 1ETYA 4HPQA 5IY5H 4HA8A 4R79A 2HVQA 1GDTA 2ZMEB 1G3TA 3AG1H 3F8CA 5DM6F 5K7FA 4G12A 2PEXA 1MH3A 2I10A 2CW8A 1RESA 3FF5A 2V1DA 4M72A 3JAMZ 3F23A 5GPAA 2X85A 2WAQN 3ZMSA 1BJZA 1FTZA 1W36C 3KYCB 3H9GA 4KNYA 1TW3A 1BBYA 3CJTB 2XF6A 2IA2A 2K9NA 2ZSHB 3CLOA 1U8RA 2R7VA 2HGCA 4I0BA 1B8IA 3K4NA 1O3RA 4HEA2 2CSOA 1YITI 3IWZA 2NRAC 1FIPA 5JVGF 2EV6A 5LLQA 1UHSA 2XB0X 4AIKA 1G59A 1BI2A 3OS2A 3QPSA 2HR3A 4XLEA 2R93J 1DPUA 1Z1DA 1Z3YA 3GEZA 2VBZA 2XKOA 2X6XA 2HEOA 5E8IA 4G6DA 1FOKA 4Y13A 1RUNA 3KEQA 2CU7A 2X6OA 2QF7A 3VWBA 2GXBA 2AQFA 1FIAA 3L9FA 4MLOA 2AXLA 2M4GA 4JX6A 1Y8QB 5F08A 1SFUA 3VYSB 1Z6TA 4LJZF 4MQ9F 2Y75A 4ENMA 3FM5A 4RS8A 5DDGA 4C2UA 4W97A 5K5QA 3LL7A 4NB5A 4FETA 2V9PA 4DQ2A 1MIJA 3K1NA 3AG3H 1BW6A 2CFOA 2EFPA 2M87A 3DKXA 4EV0A 5FFZA 1F5TA 2G9WA 2R7DA 4ITVA 4O5VA 2AS5F 1CF7A 1HLVA 1ZN2A 2WB1A 1B6AA 3TDUC 2VIXA 1ZGAA 2MABA 2R7RA 3VYUB 3MWMA 1WJ5A 1O7FA 1OISA 2Q1ZB 1YX3A 1R4MB 3ZMVA 3KX2A 2PX9A 1AOYA 2G7UA 4A5MA 4O6JA 4X1EA 4A69C 5EZHA 1ODDA 1E17A 3BDDA 4QTRA 5HLTA 2CQQA 5HS7A 5H6RA 4EGYA 4KJZA 2DT6A 3K70C 3V8KA 4CO8A 2Y9YA 3RIRA 5J4YA 2ZNZA 4RAFA 3WTYC 1U78A 2OJED 3VYRB 3L2VA 5C4XJ 1ERDA 4KIBA 2GOMA 1A6IA 4WK8F 4B44A 2XAQA 2XV4S 3EUHC 2MA3A 4P96A 3Q9VA 2E34A 1U9OA 4LIVA 3TOBA 2QQ8A 1YW8A 2R5YB 2ZFUA 1IV6A 1MMAA 1D0YA 1R9TJ 3I4NJ 3MZ8A 1O7LA 2GQQA 2R7UA 4RDUA 2HOSA 2HTSA 4ZDOA 2M5WA 2HU9A 4A3CJ 1E3OC 4S04A 1I3QJ 3DTKA 3ZMZA 4F91B 5EEHA 1WJEA 4BHCA 1AWCA 1MSEC 1RI7A 4DJAA 5EZGA 3F8NA 3FMRA 3R0AA 4I7HA 2UXNA 1I6HJ 3HKZA 1FWZA 1GLNA 3BOQA 2E2HJ 1T33A 4GDFA 3QQAA 4HDUA 3DCFA 1LQ1A 1VQKI 1EJ9A 1KU7A 2HQRA 3EETA 3SFZA 1XN7A 4M3DA 4CH7A 1ON1A 1RC9A 2Z16A 2FMYA 2HDCA 3W3CA 3S3NA 1UZCA 2OTLI 3ZP5A 1BC7C 3OOPA 3T0YA 4BHPA 3KZYA 2HOTA 3PL8A 5FKNA 4NC8A 3D5SC 2F5FA 4UVBA 4XN0A 4BH9A 3LSPA 2ZB9A 2OU2A 2A6HF 3BR0A 1RRJA 3CDIA 1T8IA 4LK1F 4IRIA 2L0KA 1ETQA 3CUQA 5GAGJ 4BQNA 1FJLA 3WGGA 4G6TB 2E1MC 4BL0B 3ABTA 2GIVA 4H4KC 1IO2A 1P6RA 2XKPA 3AL0C 2R5YA 1QGPA 2KJBA 2FQ4A 3OYIA 2NVQJ 1LDDA 2VE8A 1JHFA 4ZDLA 3D5LA 1YYVA 4C2MJ 3OYAA 4H0EA 2HOEA 4I02A 1HW5A 3IC7A 3T8TA 1B9MA 3G1LA 5BPIA 2VASA 3BR2A 1F4KA 3TQNA 1WZ2A 2QYOA 2NS8A 2JQ7A 5D5XB 4HQMA 2ELJA 4P9UA 2BY1A 1WJBA 4KITB 2IBDA 5M5YJ 3CJRB 4AWXB 3HRMA 1R00A 1D8JA 4PFPA 3HM5A 3T1BA 1LVAA 3RCOA 3S8PA 3HL2A 2BXZA 3J7YJ 3PIOF 4XKCA 1QZEA 2JVHA 4AYBA 2GA2A 5FKOA 1SVLA 2P5LC 1WJFA 3DXJF 1VI0A 3SZPA 1FEXA 1DUXC 2DMUA 4OIOF 1BR4A 3GVAA 1PYVA 4N9IA 4E70A 3JRBA 1SVMA 2VPRA 1D3YA 3IKTA 3OYLA 1ZQ3P 5B66C 1JKRC 3HTUA 1V54H 1FOYA 2K7LA 3PUBA 1RKTA 1UMQA 1YX5A 3OS0A 4GXOA 2LC2A 4GYGA 3KCCA 1DQUA 2ISYA 4XOPA 4XSZF 5KCMA 1Y0UA 4OIPF 3CLQA 3V8LA 4XN3A 4Y15A 2FBKA 1H0MA 3GWZA 2EIKH 5HDNA 2ACJA 1HOMA 2HOAA 1SMTA 3M7GA 2DTRA 4CCJA 4E4HA 4RGSA 2Q2EB 5CYVA 2CQ7A 1WWXA 3T5XA 1U0JA 1VTNC 4B43A 1TTYA 4C30A 4M74A 4YG2F 2P7VB 1IV8A 2WV0A 1UB9A 1S72I 1VQ9I 4XLPF 3M8EA 4FX4A 3ONQA 1Z77A 1IN6A 4PZJA 2K5CA 3VOEA 1JKOC 3OR1C 2K40A 2K9LA 4ENKA 1WGXA 1SD4A 1SFOJ 2PJRA 2QSFX 4RGUA 5HVQC 4HLYA 3SZTA 3HPGA 2QENA 4U0YA 4BKXA 3WTWC 2JWTA 3LA2A 1BA5A 1NG6A 2OCCH 1YJ9I 3BCAA 2DXIA 2KDZA 5IYBJ 3A1YA 3P9IA 3MVPA 3FXMA 2QQBA 5J3LA 2F4IA 3S14J 4M3EA 2DQRA 1PUFA 5EDNA 2MC3A 1GUUA 2FUG2 4JOMA 4ZH4F 2R3SA 5B5EC 3U1DA 3CC7I 4PJMA 4BDZA 2R5ZB 3E6CC 2PN6A 1RZ4A 4F7ZA 2F4OB 4M9ZA 3CMEI 2ZMEC 2FBIA 2RGVA 3HXLA 4U0WA 3ZN0A 4V2GA 2KRFA 5DUKA 2CV0A 2Q2EA 4HBLA 5IP6A 2XF7A 4I6ZA 1P7IA 4G6QA 2OCEA 5ICEA 4JX4A 3CDLA 4L5JA 3ASNH 1ZHFA 1FYMA 4NDLA 5E79C 3GTKJ 2KIQA 2HXIA 2G0EA 5EGOA 3RYRA 3FBNB 3CF5F 1YJWI 1I6XA 1FBSA 2LF8A 3EYIA 4PCQA 3GLLA 4A6DA 1LE8B 5FLXK 2FE3A 2A6EF 2TDXA 4MHGA 2G7HA 4F52A 3L2WA 2BVMA 2KT0A 4RM3A 2WB1N 3DKYA 4PJNA 5FKLA 5IT9K 1WPKA 1ONVA 2STWA 5K1YA 3PO3J 2DK8A 4KT6A 1KONA 3TDZC 3E6DA 3GCMA 4RMNA 3GZ5A 3TOAA 2EV0A 1S7EA 1QA6A 1X1PA 1MNMC 1A35A 3R0JA 4XR6A 2W84A 4NNJA 3SHFA 4GYIA 1P92A 2YR2A 3CCSI 2KP6A 1FYLA 2R5ZA 1GXPA 1FP1D 2K4BA 2NVTJ 2LKPA 3D0SA 4RLFA 4OIQF 2L02A 4L9TA 3GTOJ 2LNBA 1OCRH 4Z2YA 3X2QH 2FRHA 1MMNA 1WHUA 1N78A 4Q48A 4BGDA 2HS5A 2ZJ2A 2E19A 2WV1A 2ZCWA 1P7JA 4A3JJ 1KQ8A 1W5SA 1N77A 1JT6A 5JI6A 5AIQA 5D5VB 3LAPA 3CJQB 2W82A 1LDKB 2RQQA 5LBQA 3LSRA 4Y4RA 1LE8A 3P9KA 2DTZA 3ML6A 4UVCA 1TNSA 2L4MA 2EQRA 2R0QC 3HKZN 4XORA 1FOWA 3S32A 2O6GE 4C9YA 3DKWA 3LQRA 4G7ZF 2HI3A 3M8JA 2P6SA 2ID6A 2JUCA 3DTEA 3K4BA 1W1WE 3PQJA 4B3AA 4HSTA 2XGEA 2OQRA 1QHGA 3UR3C 5FRMA 3HSRA 3OYFA 2ZO4A 1X3WB 5ICFA 2OA4A 3WHCA
chains in the Genus database with same CATH topology
2XAJA 2A3SA 4Q4ZF 4XSXF 1K78B 1TW2A 2V9VA 3KEOA 3RDIA 4KMFA 4YFNF 2COMA 5KVRA 2IA1A 1S29A 1XCVA 3F22A 3BPXA 1YIOA 2Y48A 4ZYEA 4G94A 5L3FA 4LLLA 1E2XA 4HLXA 4N9HA 2Y0MA 3NRVA 4EGZA 5H20A 2CWEA 4ESFA 3I4PA 3HHGA 3KLNA 3FMSA 5DUIA 2EFQA 1KQ0A 3I71A 4KYWA 3RPUA 4A0XA 3L2CA 2M45A 5LRRA 2V1UA 3GW2A 2PFBA 2W57A 4QWQA 2XHKA 3NEUA 4OINF 2QWWA 1K78A 4WF2A 1HKTA 3BWGA 4OMZA 4BYYA 1F9NA 2P5KA 1EH8A 3GFIA 3KETA 5CVUA 1JXSA 2BEOA 5LHHA 4KDPA 2FQ3A 4WXDA 2QM3A 1I1SA 1FSEA 4EJWA 4A5NA 5HS8A 2XAGA 1FBQA 4HZFA 2B0LA 3C3WA 4ZYGA 1YW7A 5J6XA 4NHJA 3M9AA 1J2XA 1IXRC 1KYWA 3QU6A 2MLKA 1O3TA 3Q5FA 2BE5F 4CZZA 1U3EM 2VE9A 3Q9SA 1RUOA 4WXCA 4OOIA 4RAZA 4IJAA 2X4HA 5BQTA 1BN5A 2BYVE 4OIRF 5E20A 3F6VA 3ZMUA 2XROA 1JHHA 2IPQX 2FMLA 2RNJA 5HLHA 1R5GA 4BQAA 1LDJA 5BOXA 1CF7B 3KP2A 1OYYA 3FXUA 2VXZA 4WWCA 5FD5A 2D1HA 5LRSA 3RKWA 2LDUA 4KIGA 2FNAA 1D5VA 1KQ9A 2JPBA 1OKRA 2KIMA 4ZYHA 3HUGA 3T8RA 3WE2A 5HLGA 1PP8F 4L9NA 5LHIA 4L9JA 1LNWA 1QBJA 2V1XA 4OU0A 1GVJA 1K7AA 1IW7F 2DBBA 2ADUA 4YIIA 2C6YA 5JFRA 2K86A 4MEYF 3FZVA 3K9TA 2MBFA 2J5PA 3PQKA 1A04A 1FZPB 1QNTA 2DQLA 1BIAA 1XMKA 2WTEA 3MEXA 4XLNF 1FX7A 3SQNA 1I27A 3LWFA 1XDSA 4D0PA 3C1DA 3WU1B 3CUQB 3R6SA 3WGIA 3I64A 3V4GA 3L00A 1IRGA 4AIJA 4HW0A 1FNNA 1FP2A 3TO7A 3F72A 4HDVA 4A2UA 3BROA 3IWFA 4U88A 2K4JA 2OAZA 4HV6A 5E1XA 5KK1A 3TGNA 1R23A 3BP8A 1TBXA 2RN7A 4G7HF 2ETHA 3J7AO 5HOOA 1Z9CA 2EB7A 4R8HA 4B8XA 5DCFA 3F6OA 5FO5A 4UVAA 2H27A 2IW5A 1U2WA 3V8JA 2YSRA 3QOPA 5ILUA 3JTHA 2FXAA 6PAXA 2MH9A 2A69F 3E5QA 2CQKA 2HKXA 1LEAA 3QPHA 3C18A 4TV7A 5L3CA 2OQGA 3EDPA 4IPAA 3GO5A 3S2WA 2NNYA 1USTA 4L0YB 3LFKA 1ZREA 1MJAA 1IN7A 4ETSA 5ICCA 2FBHA 4IVNA 5A2QZ 3JSPA 2IRFG 2DI3A 1P4WA 5EEGA 2JZYA 4HAMA 1FC3A 4I0AA 3VB2A 2IJLA 1S7AA 1U6GA 2D2WA 4M6YA 1XMAA 4RB3C 1O3QA 4WX9A 2Q8KA 5FLXZ 1WQ2A 2DU9A 4EM2A 2JT1A 3QRFF 2HZTA 3TKYA 5IT9Z 3HOTA 4ENJA 3GF2A 3ISPA 2H6BA 5F1RA 3GYHX 5E1ZB 3C7JA 1RIOH 4AIHA 4ON0A 2HYGD 1SMYF 4P55A 2H09A 1QO0D 2VT3A 1R58A 3IRRA 1OR7A 1TQPA 5JVTA 1WSUA 3N4MA 4PGGA 3HYIA 5HDKA 1W7PB 3BJ6A 2O8XA 2VBYA 3FX3A 5JR3A 2ESNA 1Z6RA 1ZRFA 2CFXA 3LAJA 1FBUA 5J8CA 1QZYA 3CJNA 5AIPA 1RNLA 4IHSA 5A2QK 1XD7A 4Y17A 2GA1A 1R36A 1R5HA 2A5YB 4YFKF 1MZBA 3MZYA 2W85A 4LMYA 4KIFA 3JTGA 1IZ1A 3PFIA 1ZAOA 2M8EA 5DD4A 4QLCU 4A12A 1UHWA 5BS6A 4PGHA 2YU3A 1EH6A 1ON2A 1V4RA 4KN4X 1B4AA 3V7CA 1W4MA 3ROUA 1W7PA 4IHTA 1HQCA 1FYKA 3JW4A 3QP5A 3VFZA 1YO5C 4EJOA 3KP7A 3R4KA 2CW0F 2EFWA 3QU3A 3ECHA 3RKYA 2FU4A 1V3FA 2JTVA 2GXGA 2VC1A 4FHTA 1PP7U 1LEBA 2L3DA 2GAUA 3E97A 4EJVA 3GUDA 4R1HA 3TO9A 1USSA 2XASA 4IRHA 2ELHA 4XBFA 2Z9OA 5K5OA 1W7PD 1S6LA 2RC4A 3VEPA 3ECOA 3FXQA 4U7BA 1L0OC 2UXXA 2FA5A 1IN5A 3KP5A 2HYFA 3QPTA 1IN8A 3F8MA 2FNPA 3W6KB 4K2EA 4Q47A 1XB4A 2ZFWA 2W25A 5ILSA 3I58A 2E7WA 1QQIA 1XSVA 3SXYA 3DF8A 5E8GA 4CGZA 2RKHA 1OPCA 4L18B 5DV5A 1FY7A 3RI4A 2QLZA 3J81K 4MQVA 1MGTA 5CVRA 3J80K 5D6FA 1G3YA 3F21A 1EH7A 4IXAA 3CUQC 3VODA 3REOA 3HIFA 2HKOA 4HX8A 3ZMTA 2IA0A 2HTJA 2P7CB 5CVVA 2PQ8A 3EUHA 2RV8A 1BC8C 5LGTA 1GXQA 3EQLF 4ESJA 2QZ8A 1S8NA 2VOOA 4FX0A 2KIUA 1SD5A 4UV8A 4U7DA 1P4AA 3KFWX 1BI1A 2P6TA 2CG4A 2RDPA 1IUYA 5L3DA 3ZPLA 4A0ZA 3K1MA 4UXNA 1Q1HA 4ENNA 1WRJA 2W24A 1YG2A 2DLLA 1SFEA 5J8FA 4S05A 5BMZA 1MJ9A 3MAJA 1UCRA 3FMQA 4I2OA 4MTEA 3V7SA 2XVCA 4IRGA 2H94A 3GFJA 1F1ZA 1FLIA 1GHCA 3N97A 2A68F 4KA4A 1PUEE 4PDKA 1YS7A 3M1EA 3H92A 1J5YA 3W6JB 1TQIA 1Z91A 4M6XA 5D8KB 4YFXF 3KP3A 3HHHA 2RQPA 3I5UA 2FOKA 2NYXA 1UFMA 1BJAA 1B1BA 5ICGA 4G7OF 2VN2A 3QP6A 3B73A 3FXRA 1XGOA 1XDUA 1T38A 3HRTA 5CVJA 5DCMB 4HX7A 3RKXA 3EYYA 3GFMA 1B9NA 4BXUA 2E1NA 5CJ9A 3GLXA 2OZ6A 1KYZA 1MDMB 3ZMDA 1FPQA 2PMUA 1KGSA 1FT9A 3RTRA 4AVPA 1XGMA 2F5DA 5LGUA 2DW4A 1BI3A 2P8TA 4M73A 4KFCA 1MKMA 2V79A 4ZZDA 4LB5A 4M9SA 2XRNA 3IRQA 1S7OA 1ZLJA 3I54A 4WXHA 5CVIA 4HF1A 2JRTA 5ERIA 5FD6A 4L9VA 3RJPA 5DCMA 1XSDA 1SAXA 4ZZLA 2F5CA 3F3XA 5HS9A 1TQMA 1DDNA 3K0LA 2O61A 1P2FA 2EJRA 1O57A 1HW2A 1IN4A 1K6OA 3DPLC 4HV5A 4ASNA 3ERED 2HFHA 1R1UA 1MDMA 1XGSA 3E3VA 2ZMEA 1T6SA 4NQWA 5E1WA 2KIFA 2NS0A 1TNTA 1O3SA 4OMYA 1EV7A 4UHTA 2H6CA 2L4AA 2IVMA 2JPCA 2CO5A 5D8LB 1BI0A 3ABUA 2LF7A 3IKVA 1IXCA 1JE8A 1SD6A 4N0BA 5ED4A 3LA7A 4CHUA 4RGXA 2F2EA 2BBYA 2IP2A 3HSFA 3JSOA 2WC2A 3JAMK 1OYIA 2A61A 2E1CA 2F5EA 4UV9A 1YQAA 2MLGA 3O3KA 1OMIA 5D5UB 4A0YA 2XAHA 3DV8A 1ZH5A 3K1PA 1KU2A 4P9FA 1WKMA 5D5WB 4MTDA 3G3ZA 3F8FA 4GGGA 2PBIA 2D45A 2K27A 1SFXA 5D4RA 2DAOA 4EVIA 1ZLKA 4Q5SF 3KZZA 1G3WA 5D4SA 4KICA 2ESHA 4CXFA 4EMSA 3ZN1A 3R60A 2EFNA 2P5VA 4CDGA 3FWEA 3RYPA 2NNNA 2A07F 4ZYDA 1LB2A 1R1TA 1ZYRF 4CYDA 1HBXG 5FGMA 3KP4A 3DQVC 1L3LA 2CYYA 5AONA 1ZG5A 4O3MA 4DNCA 3WTSC 3BJAA 1J59A 4LG0B 1R22A 1G3SA 1FSHA 4EJTA 1XCBA 4KN7X 1IXSB 1HXDA 1S3JA 1WI9A 2PLYA 3H3ZA 4HYEA 2P4WA 2O03A 4YIFA 5FFXA 3MZHA 1JGSA 3OV8A 1X3UA 2Z99A 5L3EA 1DP7P 3M8FA 1U5TB 2VBWA 2QVOA 3E6MA 1Z7UA 2BV6A 4M9XA 3QAHA 4I09A 4XRFA 4G9YA 2PI0A 1HW1A 3CO6C 3K2ZA 1G6NA 2KKOA 1UHMA 4LLNA 3I59B 1LJ9A 2QBYB 3MQ0A 2X0LA 1K79A 1SD7A 2EV5A 2K02A 4LG0A 1REPC 4ESBA 4HOBA 1R7JA 1PDNC 1J9IA 3LSTA 2FSWA 2J5OA 3ELKA 1I5ZA 3K69A 3R61A 4HQEA 1HKQA 3KLOA 4L0ZB 4JK1X 4KUMA 4RGRA 4GCVA 3IL2A 1U5TA 3DEUA 1KU3A 4L5IA 4BAYA 1Z05A 1ZRDA 2Z5UA 1J7KA 4I01A 3WODF 3GX4X 1ZG1A 2L54A 3CUOA 3P9CA 5DYMA 3I0TA 1HSTA 3LA3A 5DEQA 5F6FA 2BGCA 3I59A 2KJCA 2PG4A 3G73A 3BZ6A 5ILVA 3O6BB 5JHUA 2QBYA 1NHAA 4HX4A 4LGWA 2YX7A 3E6BA 2L01A 3J81Z 5E17F 5HLIA 2RVCA 3J80Z 5K5RA 1P4XA 3TO6A 3WGHA 2Z33A 2VONA 3CTAA 4EM0B 3DPTA 3FM3A 1XGNA 3HRUA 4WCGA 2D1VA 1C0WA 2XAFA 2VBXA 3F8BA 1MJBA 3WE3A 3MFKA 3WTXC 2Z3YA 4RB2C 2STTA 3COAC 3NQOA 2O0YA 2PMHA 5H6QA 3CDHA 2VODA 1IF1A 3MCZA 5L3BA 5TRDA 5LGNA 3V7RA 3ZQ7A 3GZ6A 3FHZA 4LK0F 4B09A 1H9GA 2GZWA 2ZXJA 2EFOA 5IT3A 3WG9A 1CGPA 2QQAA 1G4DA 2HWVA 4CICA 3H3UA 4HF0A 2OBPA 2YX4A 5DD8A 2DK5A 3E5XA 1ULYA 4EJUA 1BOAA 2OD5A 2UWMA 2DO7A 2HQNA 3HTSB 4LD5A 5LEJA 2EA4A 4BHBA 1J0RA 1BIBA 1H9TA 3ULQB 1ZARA 2VOPA 4U0VA 1YTYA 4MNUA 1HSJA 2M30A 4BNCA 3WU0A 3L09A 2ZKZA 3E5UA 4EQQA 3KE2A 3WTTC 1MD0A 4I98B 2EWNA 4KMUX 2LSOA 1B59A 4GO1A 3L7WA 2EA2A 1J75A 3IHUA 1ZRCA 2VT2A 2FEZA 3B02A 2OZUA 4G8XA 3I53A 3GXOA 2UZKA 3O2PE 2DT5A 4UNOA 4P5OA 2XGXA 3DP7A 2FF4A 3HOSA 5L3GA 4LFUA 1QPMA 2DPDA 1STZA 4LB6B 1YFHA 3AAFA 2EK5A 3LQQA 4FT8A 3U9GA 1KA8A 1T98A 1IRFA 5LEKA 2XIGA 2GWRA 2QQ9A 2ZNYA 4M71A 4A6EA 3HSEA 4LLGF 5F64A 1HKSA 1BM9A 1QZZA 5BPDA 1DPRA 4MEXF 3WTZA 1YW9A 4JQFA 2NAZA 2DFIA 1T0FA 5E18F 2QUFA 4EM1A 4AD9A 2MD5A 2ISZA 2M1BA 1YLFA 1IAWA 5D6EA 1I1GA 1ZGJA 5HDGA 3RPQA 1W5TA 5TJJA 3WTVC 2R7FA 4IF4A 3BJOA 2CGPA 1U5TC 3CO7C 1TLHB 3HRSA 2IT0A 4HF2A 2Q0OA 4RB0A 4UUVA 2O3FA 4RB1A 3KP6A 2DPUA 1R1VA 1T39A 2YPRA 1OYWA 5FB2A 3BY6A 3U2RA 4MGRA 4KT5C 1ZG3A 1KU9A 2MH2A 2XUBA 3BPVA 3WTUC 2WWYA 2VC0A 1XSXA 5CLSA 4RAYA 2E7XA 2PJPA 3P7NA 2ZBKA 3GFLA 3DFGA 1T2KA 2V6CA 5LHGA 4JBAA 2JSCA 1YS6A 1D8KA 4HA8A 4R79A 2ZMEB 1G3TA 3F8CA 2PEXA 3FF5A 2V1DA 4M72A 3JAMZ 3F23A 3ZMSA 4KNYA 1TW3A 1BBYA 2IA2A 1U8RA 3CLOA 2HGCA 4I0BA 1O3RA 2CSOA 3IWZA 2NRAC 2EV6A 5LLQA 4AIKA 1BI2A 2HR3A 1DPUA 1Z1DA 3GEZA 2VBZA 2XKOA 2HEOA 5E8IA 4G6DA 1FOKA 4Y13A 1RUNA 3KEQA 2GXBA 3L9FA 2AXLA 1SFUA 1Z6TA 4LJZF 4MQ9F 2Y75A 4ENMA 3FM5A 4RS8A 5DDGA 5K5QA 4NB5A 4DQ2A 3K1NA 2EFPA 2M87A 4EV0A 5FFZA 1F5TA 2G9WA 2R7DA 4O5VA 2AS5F 1CF7A 1ZN2A 1B6AA 3TDUC 1ZGAA 3MWMA 1O7FA 3ZMVA 1AOYA 2G7UA 4A5MA 4O6JA 1ODDA 1E17A 3BDDA 5HS7A 5H6RA 4EGYA 3V8KA 4CO8A 3WTYC 3RIRA 2ZNZA 1U78A 4KIBA 4WK8F 2XAQA 2XV4S 2MA3A 4P96A 3Q9VA 3TOBA 1YW8A 1O7LA 2GQQA 2HTSA 2M5WA 4S04A 3ZMZA 5EEHA 4BHCA 1AWCA 1RI7A 3F8NA 3FMRA 3R0AA 4I7HA 2UXNA 1FWZA 3BOQA 4HDUA 1LQ1A 1KU7A 2HQRA 3EETA 3SFZA 1XN7A 1ON1A 2FMYA 2HDCA 3ZP5A 1BC7C 3OOPA 3T0YA 4BHPA 3KZYA 4BH9A 2F5FA 4UVBA 2OU2A 2A6HF 4LK1F 4IRIA 3CUQA 3WGGA 3ABTA 2GIVA 1P6RA 2XKPA 1QGPA 2KJBA 1LDDA 2VE8A 1JHFA 3D5LA 1YYVA 4H0EA 2HOEA 4I02A 1HW5A 3IC7A 3T8TA 1B9MA 5BPIA 1F4KA 3TQNA 2QYOA 5D5XB 4HQMA 4P9UA 4AWXB 3HRMA 1R00A 1D8JA 3T1BA 1LVAA 2GA2A 2P5LC 3DXJF 3SZPA 1DUXC 4OIOF 3GVAA 4N9IA 4E70A 1D3YA 3IKTA 3HTUA 2K7LA 4GXOA 4GYGA 3KCCA 2ISYA 4XSZF 1Y0UA 4OIPF 1H0MA 3V8LA 4Y15A 2FBKA 3GWZA 5HDNA 2ACJA 1SMTA 3M7GA 2DTRA 4RGSA 5CYVA 1WWXA 3T5XA 1VTNC 1TTYA 4M74A 4YG2F 2P7VB 2WV0A 1UB9A 4XLPF 4FX4A 3M8EA 1IN6A 4PZJA 3VOEA 4ENKA 1SD4A 4RGUA 5HVQC 4HLYA 3SZTA 2QENA 4U0YA 3WTWC 3LA2A 3P9IA 2QQBA 2DQRA 2MC3A 4ZH4F 2R3SA 3U1DA 3E6CC 2PN6A 1RZ4A 4F7ZA 4M9ZA 2FBIA 2RGVA 4U0WA 3ZN0A 2KRFA 5DUKA 2Q2EA 4HBLA 4G6QA 5ICEA 4L5JA 1ZHFA 1FYMA 3RYRA 1I6XA 1FBSA 2LF8A 3EYIA 4PCQA 4A6DA 5FLXK 2FE3A 2A6EF 2TDXA 4MHGA 2G7HA 5IT9K 1ONVA 2STWA 5K1YA 2DK8A 3TDZC 3E6DA 3TOAA 3GZ5A 2EV0A 3R0JA 2W84A 3SHFA 4GYIA 1P92A 2YR2A 1FYLA 1GXPA 1FP1D 2K4BA 2LKPA 3D0SA 4OIQF 2L02A 4L9TA 2LNBA 4Z2YA 2FRHA 4Q48A 2HS5A 2ZJ2A 2ZCWA 1KQ8A 1W5SA 5JI6A 5AIQA 5D5VB 3LAPA 1LDKB 5LBQA 3P9KA 3ML6A 4UVCA 1TNSA 2L4MA 2O6GE 3DKWA 3LQRA 4G7ZF 2P6SA 3PQJA 2OQRA 3HSRA 2ZO4A 5ICFA 2OA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XAJ A;  2A3S A;  4Q4Z F;  4XSX F;  1K78 B;  1TW2 A;  2V9V A;  3KEO A;  3RDI A;  4KMF A;  4YFN F;  2COM A;  5KVR A;  2IA1 A;  1S29 A;  1XCV A;  3F22 A;  3BPX A;  1YIO A;  2Y48 A;  4ZYE A;  4G94 A;  5L3F A;  4LLL A;  1E2X A;  4HLX A;  4N9H A;  2Y0M A;  3NRV A;  4EGZ A;  5H20 A;  2CWE A;  4ESF A;  3I4P A;  3HHG A;  3KLN A;  3FMS A;  5DUI A;  2EFQ A;  1KQ0 A;  3I71 A;  4KYW A;  3RPU A;  4A0X A;  3L2C A;  2M45 A;  5LRR A;  2V1U A;  3GW2 A;  2PFB A;  2W57 A;  4QWQ A;  2XHK A;  3NEU A;  4OIN F;  2QWW A;  1K78 A;  4WF2 A;  1HKT A;  3BWG A;  4OMZ A;  4BYY A;  1F9N A;  2P5K A;  1EH8 A;  3GFI A;  3KET A;  5CVU A;  1JXS A;  2BEO A;  5LHH A;  4KDP A;  2FQ3 A;  4WXD A;  2QM3 A;  1I1S A;  1FSE A;  4EJW A;  4A5N A;  5HS8 A;  2XAG A;  1FBQ A;  4HZF A;  2B0L A;  3C3W A;  4ZYG A;  1YW7 A;  5J6X A;  4NHJ A;  3M9A A;  1J2X A;  1IXR C;  1KYW A;  3QU6 A;  2MLK A;  1O3T A;  3Q5F A;  2BE5 F;  4CZZ A;  1U3E M;  2VE9 A;  3Q9S A;  1RUO A;  4WXC A;  4OOI A;  4RAZ A;  4IJA A;  2X4H A;  5BQT A;  1BN5 A;  2BYV E;  4OIR F;  5E20 A;  3F6V A;  3ZMU A;  2XRO A;  1JHH A;  2IPQ X;  2FML A;  2RNJ A;  5HLH A;  1R5G A;  4BQA A;  1LDJ A;  5BOX A;  1CF7 B;  3KP2 A;  1OYY A;  3FXU A;  2VXZ A;  4WWC A;  5FD5 A;  2D1H A;  5LRS A;  3RKW A;  2LDU A;  4KIG A;  2FNA A;  1D5V A;  1KQ9 A;  2JPB A;  1OKR A;  2KIM A;  4ZYH A;  3HUG A;  3T8R A;  3WE2 A;  5HLG A;  1PP8 F;  4L9N A;  5LHI A;  4L9J A;  1LNW A;  1QBJ A;  2V1X A;  4OU0 A;  1GVJ A;  1K7A A;  1IW7 F;  2DBB A;  2ADU A;  4YII A;  2C6Y A;  5JFR A;  2K86 A;  4MEY F;  3FZV A;  3K9T A;  2MBF A;  2J5P A;  3PQK A;  1A04 A;  1FZP B;  1QNT A;  2DQL A;  1BIA A;  1XMK A;  2WTE A;  3MEX A;  4XLN F;  1FX7 A;  3SQN A;  1I27 A;  3LWF A;  1XDS A;  4D0P A;  3C1D A;  3WU1 B;  3CUQ B;  3R6S A;  3WGI A;  3I64 A;  3V4G A;  3L00 A;  1IRG A;  4AIJ A;  4HW0 A;  1FNN A;  1FP2 A;  3TO7 A;  3F72 A;  4HDV A;  4A2U A;  3BRO A;  3IWF A;  4U88 A;  2K4J A;  2OAZ A;  4HV6 A;  5E1X A;  5KK1 A;  3TGN A;  1R23 A;  3BP8 A;  1TBX A;  2RN7 A;  4G7H F;  2ETH A;  3J7A O;  5HOO A;  1Z9C A;  2EB7 A;  4R8H A;  4B8X A;  5DCF A;  3F6O A;  5FO5 A;  4UVA A;  2H27 A;  2IW5 A;  1U2W A;  3V8J A;  2YSR A;  3QOP A;  5ILU A;  3JTH A;  2FXA A;  6PAX A;  2MH9 A;  2A69 F;  3E5Q A;  2CQK A;  2HKX A;  1LEA A;  3QPH A;  3C18 A;  4TV7 A;  5L3C A;  2OQG A;  3EDP A;  4IPA A;  3GO5 A;  3S2W A;  2NNY A;  1UST A;  4L0Y B;  3LFK A;  1ZRE A;  1MJA A;  1IN7 A;  4ETS A;  5ICC A;  2FBH A;  4IVN A;  5A2Q Z;  3JSP A;  2IRF G;  2DI3 A;  1P4W A;  5EEG A;  2JZY A;  4HAM A;  1FC3 A;  4I0A A;  3VB2 A;  2IJL A;  1S7A A;  1U6G A;  2D2W A;  4M6Y A;  1XMA A;  4RB3 C;  1O3Q A;  4WX9 A;  2Q8K A;  5FLX Z;  1WQ2 A;  2DU9 A;  4EM2 A;  2JT1 A;  3QRF F;  2HZT A;  3TKY A;  5IT9 Z;  3HOT A;  4ENJ A;  3GF2 A;  3ISP A;  2H6B A;  5F1R A;  3GYH X;  5E1Z B;  3C7J A;  1RIO H;  4AIH A;  4ON0 A;  2HYG D;  1SMY F;  4P55 A;  2H09 A;  1QO0 D;  2VT3 A;  1R58 A;  3IRR A;  1OR7 A;  1TQP A;  5JVT A;  1WSU A;  3N4M A;  4PGG A;  3HYI A;  5HDK A;  1W7P B;  3BJ6 A;  2O8X A;  2VBY A;  3FX3 A;  5JR3 A;  2ESN A;  1Z6R A;  1ZRF A;  2CFX A;  3LAJ A;  1FBU A;  5J8C A;  1QZY A;  3CJN A;  5AIP A;  1RNL A;  4IHS A;  5A2Q K;  1XD7 A;  4Y17 A;  2GA1 A;  1R36 A;  1R5H A;  2A5Y B;  4YFK F;  1MZB A;  3MZY A;  2W85 A;  4LMY A;  4KIF A;  3JTG A;  1IZ1 A;  3PFI A;  1ZAO A;  2M8E A;  5DD4 A;  4QLC U;  4A12 A;  1UHW A;  5BS6 A;  4PGH A;  2YU3 A;  1EH6 A;  1ON2 A;  1V4R A;  4KN4 X;  1B4A A;  3V7C A;  1W4M A;  3ROU A;  1W7P A;  4IHT A;  1HQC A;  1FYK A;  3JW4 A;  3QP5 A;  3VFZ A;  1YO5 C;  4EJO A;  3KP7 A;  3R4K A;  2CW0 F;  2EFW A;  3QU3 A;  3ECH A;  3RKY A;  2FU4 A;  1V3F A;  2JTV A;  2GXG A;  2VC1 A;  4FHT A;  1PP7 U;  1LEB A;  2L3D A;  2GAU A;  3E97 A;  4EJV A;  3GUD A;  4R1H A;  3TO9 A;  1USS A;  2XAS A;  4IRH A;  2ELH A;  4XBF A;  2Z9O A;  5K5O A;  1W7P D;  1S6L A;  2RC4 A;  3VEP A;  3ECO A;  3FXQ A;  4U7B A;  1L0O C;  2UXX A;  2FA5 A;  1IN5 A;  3KP5 A;  2HYF A;  3QPT A;  1IN8 A;  3F8M A;  2FNP A;  3W6K B;  4K2E A;  4Q47 A;  1XB4 A;  2ZFW A;  2W25 A;  5ILS A;  3I58 A;  2E7W A;  1QQI A;  1XSV A;  3SXY A;  3DF8 A;  5E8G A;  4CGZ A;  2RKH A;  1OPC A;  4L18 B;  5DV5 A;  1FY7 A;  3RI4 A;  2QLZ A;  3J81 K;  4MQV A;  1MGT A;  5CVR A;  3J80 K;  5D6F A;  1G3Y A;  3F21 A;  1EH7 A;  4IXA A;  3CUQ C;  3VOD A;  3REO A;  3HIF A;  2HKO A;  4HX8 A;  3ZMT A;  2IA0 A;  2HTJ A;  2P7C B;  5CVV A;  2PQ8 A;  3EUH A;  2RV8 A;  1BC8 C;  5LGT A;  1GXQ A;  3EQL F;  4ESJ A;  2QZ8 A;  1S8N A;  2VOO A;  4FX0 A;  2KIU A;  1SD5 A;  4UV8 A;  4U7D A;  1P4A A;  3KFW X;  1BI1 A;  2P6T A;  2CG4 A;  2RDP A;  1IUY A;  5L3D A;  3ZPL A;  4A0Z A;  3K1M A;  4UXN A;  1Q1H A;  4ENN A;  1WRJ A;  2W24 A;  1YG2 A;  2DLL A;  1SFE A;  5J8F A;  4S05 A;  5BMZ A;  1MJ9 A;  3MAJ A;  1UCR A;  3FMQ A;  4I2O A;  4MTE A;  3V7S A;  2XVC A;  4IRG A;  2H94 A;  3GFJ A;  1F1Z A;  1FLI A;  1GHC A;  3N97 A;  2A68 F;  4KA4 A;  1PUE E;  4PDK A;  1YS7 A;  3M1E A;  3H92 A;  1J5Y A;  3W6J B;  1TQI A;  1Z91 A;  4M6X A;  5D8K B;  4YFX F;  3KP3 A;  3HHH A;  2RQP A;  3I5U A;  2FOK A;  2NYX A;  1UFM A;  1BJA A;  1B1B A;  5ICG A;  4G7O F;  2VN2 A;  3QP6 A;  3B73 A;  3FXR A;  1XGO A;  1XDU A;  1T38 A;  3HRT A;  5CVJ A;  5DCM B;  4HX7 A;  3RKX A;  3EYY A;  3GFM A;  1B9N A;  4BXU A;  2E1N A;  5CJ9 A;  3GLX A;  2OZ6 A;  1KYZ A;  1MDM B;  3ZMD A;  1FPQ A;  2PMU A;  1KGS A;  1FT9 A;  3RTR A;  4AVP A;  1XGM A;  2F5D A;  5LGU A;  2DW4 A;  1BI3 A;  2P8T A;  4M73 A;  4KFC A;  1MKM A;  2V79 A;  4ZZD A;  4LB5 A;  4M9S A;  2XRN A;  3IRQ A;  1S7O A;  1ZLJ A;  3I54 A;  4WXH A;  5CVI A;  4HF1 A;  2JRT A;  5ERI A;  5FD6 A;  4L9V A;  3RJP A;  5DCM A;  1XSD A;  1SAX A;  4ZZL A;  2F5C A;  3F3X A;  5HS9 A;  1TQM A;  1DDN A;  3K0L A;  2O61 A;  1P2F A;  2EJR A;  1O57 A;  1HW2 A;  1IN4 A;  1K6O A;  3DPL C;  4HV5 A;  4ASN A;  3ERE D;  2HFH A;  1R1U A;  1MDM A;  1XGS A;  3E3V A;  2ZME A;  1T6S A;  4NQW A;  5E1W A;  2KIF A;  2NS0 A;  1TNT A;  1O3S A;  4OMY A;  1EV7 A;  4UHT A;  2H6C A;  2L4A A;  2IVM A;  2JPC A;  2CO5 A;  5D8L B;  1BI0 A;  3ABU A;  2LF7 A;  3IKV A;  1IXC A;  1JE8 A;  1SD6 A;  4N0B A;  5ED4 A;  3LA7 A;  4CHU A;  4RGX A;  2F2E A;  2BBY A;  2IP2 A;  3HSF A;  3JSO A;  2WC2 A;  3JAM K;  1OYI A;  2A61 A;  2E1C A;  2F5E A;  4UV9 A;  1YQA A;  2MLG A;  3O3K A;  1OMI A;  5D5U B;  4A0Y A;  2XAH A;  3DV8 A;  1ZH5 A;  3K1P A;  1KU2 A;  4P9F A;  1WKM A;  5D5W B;  4MTD A;  3G3Z A;  3F8F A;  4GGG A;  2PBI A;  2D45 A;  2K27 A;  1SFX A;  5D4R A;  2DAO A;  4EVI A;  1ZLK A;  4Q5S F;  3KZZ A;  1G3W A;  5D4S A;  4KIC A;  2ESH A;  4CXF A;  4EMS A;  3ZN1 A;  3R60 A;  2EFN A;  2P5V A;  4CDG A;  3FWE A;  3RYP A;  2NNN A;  2A07 F;  4ZYD A;  1LB2 A;  1R1T A;  1ZYR F;  4CYD A;  1HBX G;  5FGM A;  3KP4 A;  3DQV C;  1L3L A;  2CYY A;  5AON A;  1ZG5 A;  4O3M A;  4DNC A;  3WTS C;  3BJA A;  1J59 A;  4LG0 B;  1R22 A;  1G3S A;  1FSH A;  4EJT A;  1XCB A;  4KN7 X;  1IXS B;  1HXD A;  1S3J A;  1WI9 A;  2PLY A;  3H3Z A;  4HYE A;  2P4W A;  2O03 A;  4YIF A;  5FFX A;  3MZH A;  1JGS A;  3OV8 A;  1X3U A;  2Z99 A;  5L3E A;  1DP7 P;  3M8F A;  1U5T B;  2VBW A;  2QVO A;  3E6M A;  1Z7U A;  2BV6 A;  4M9X A;  3QAH A;  4I09 A;  4XRF A;  4G9Y A;  2PI0 A;  1HW1 A;  3CO6 C;  3K2Z A;  1G6N A;  2KKO A;  1UHM A;  4LLN A;  3I59 B;  1LJ9 A;  2QBY B;  3MQ0 A;  2X0L A;  1K79 A;  1SD7 A;  2EV5 A;  2K02 A;  4LG0 A;  1REP C;  4ESB A;  4HOB A;  1R7J A;  1PDN C;  1J9I A;  3LST A;  2FSW A;  2J5O A;  3ELK A;  1I5Z A;  3K69 A;  3R61 A;  4HQE A;  1HKQ A;  3KLO A;  4L0Z B;  4JK1 X;  4KUM A;  4RGR A;  4GCV A;  3IL2 A;  1U5T A;  3DEU A;  1KU3 A;  4L5I A;  4BAY A;  1Z05 A;  1ZRD A;  2Z5U A;  1J7K A;  4I01 A;  3WOD F;  3GX4 X;  1ZG1 A;  2L54 A;  3CUO A;  3P9C A;  5DYM A;  3I0T A;  1HST A;  3LA3 A;  5DEQ A;  5F6F A;  2BGC A;  3I59 A;  2KJC A;  2PG4 A;  3G73 A;  3BZ6 A;  5ILV A;  3O6B B;  5JHU A;  2QBY A;  1NHA A;  4HX4 A;  4LGW A;  2YX7 A;  3E6B A;  2L01 A;  3J81 Z;  5E17 F;  5HLI A;  2RVC A;  3J80 Z;  5K5R A;  1P4X A;  3TO6 A;  3WGH A;  2Z33 A;  2VON A;  3CTA A;  4EM0 B;  3DPT A;  3FM3 A;  1XGN A;  3HRU A;  4WCG A;  2D1V A;  1C0W A;  2XAF A;  2VBX A;  3F8B A;  1MJB A;  3WE3 A;  3MFK A;  3WTX C;  2Z3Y A;  4RB2 C;  2STT A;  3COA C;  3NQO A;  2O0Y A;  2PMH A;  5H6Q A;  3CDH A;  2VOD A;  1IF1 A;  3MCZ A;  5L3B A;  5TRD A;  5LGN A;  3V7R A;  3ZQ7 A;  3GZ6 A;  3FHZ A;  4LK0 F;  4B09 A;  1H9G A;  2GZW A;  2ZXJ A;  2EFO A;  5IT3 A;  3WG9 A;  1CGP A;  2QQA A;  1G4D A;  2HWV A;  4CIC A;  3H3U A;  4HF0 A;  2OBP A;  2YX4 A;  5DD8 A;  2DK5 A;  3E5X A;  1ULY A;  4EJU A;  1BOA A;  2OD5 A;  2UWM A;  2DO7 A;  2HQN A;  3HTS B;  4LD5 A;  5LEJ A;  2EA4 A;  4BHB A;  1J0R A;  1BIB A;  1H9T A;  3ULQ B;  1ZAR A;  2VOP A;  4U0V A;  1YTY A;  4MNU A;  1HSJ A;  2M30 A;  4BNC A;  3WU0 A;  3L09 A;  2ZKZ A;  3E5U A;  4EQQ A;  3KE2 A;  3WTT C;  1MD0 A;  4I98 B;  2EWN A;  4KMU X;  2LSO A;  1B59 A;  4GO1 A;  3L7W A;  2EA2 A;  1J75 A;  3IHU A;  1ZRC A;  2VT2 A;  2FEZ A;  3B02 A;  2OZU A;  4G8X A;  3I53 A;  3GXO A;  2UZK A;  3O2P E;  2DT5 A;  4UNO A;  4P5O A;  2XGX A;  3DP7 A;  2FF4 A;  3HOS A;  5L3G A;  4LFU A;  1QPM A;  2DPD A;  1STZ A;  4LB6 B;  1YFH A;  3AAF A;  2EK5 A;  3LQQ A;  4FT8 A;  3U9G A;  1KA8 A;  1T98 A;  1IRF A;  5LEK A;  2XIG A;  2GWR A;  2QQ9 A;  2ZNY A;  4M71 A;  4A6E A;  3HSE A;  4LLG F;  5F64 A;  1HKS A;  1BM9 A;  1QZZ A;  5BPD A;  1DPR A;  4MEX F;  3WTZ A;  1YW9 A;  4JQF A;  2NAZ A;  2DFI A;  1T0F A;  5E18 F;  2QUF A;  4EM1 A;  4AD9 A;  2MD5 A;  2ISZ A;  2M1B A;  1YLF A;  1IAW A;  5D6E A;  1I1G A;  1ZGJ A;  5HDG A;  3RPQ A;  1W5T A;  5TJJ A;  3WTV C;  2R7F A;  4IF4 A;  3BJO A;  2CGP A;  1U5T C;  3CO7 C;  1TLH B;  3HRS A;  2IT0 A;  4HF2 A;  2Q0O A;  4RB0 A;  4UUV A;  2O3F A;  4RB1 A;  3KP6 A;  2DPU A;  1R1V A;  1T39 A;  2YPR A;  1OYW A;  5FB2 A;  3BY6 A;  3U2R A;  4MGR A;  4KT5 C;  1ZG3 A;  1KU9 A;  2MH2 A;  2XUB A;  3BPV A;  3WTU C;  2WWY A;  2VC0 A;  1XSX A;  5CLS A;  4RAY A;  2E7X A;  2PJP A;  3P7N A;  2ZBK A;  3GFL A;  3DFG A;  1T2K A;  2V6C A;  5LHG A;  4JBA A;  2JSC A;  1YS6 A;  1D8K A;  4HA8 A;  4R79 A;  2ZME B;  1G3T A;  3F8C A;  2PEX A;  3FF5 A;  2V1D A;  4M72 A;  3JAM Z;  3F23 A;  3ZMS A;  4KNY A;  1TW3 A;  1BBY A;  2IA2 A;  1U8R A;  3CLO A;  2HGC A;  4I0B A;  1O3R A;  2CSO A;  3IWZ A;  2NRA C;  2EV6 A;  5LLQ A;  4AIK A;  1BI2 A;  2HR3 A;  1DPU A;  1Z1D A;  3GEZ A;  2VBZ A;  2XKO A;  2HEO A;  5E8I A;  4G6D A;  1FOK A;  4Y13 A;  1RUN A;  3KEQ A;  2GXB A;  3L9F A;  2AXL A;  1SFU A;  1Z6T A;  4LJZ F;  4MQ9 F;  2Y75 A;  4ENM A;  3FM5 A;  4RS8 A;  5DDG A;  5K5Q A;  4NB5 A;  4DQ2 A;  3K1N A;  2EFP A;  2M87 A;  4EV0 A;  5FFZ A;  1F5T A;  2G9W A;  2R7D A;  4O5V A;  2AS5 F;  1CF7 A;  1ZN2 A;  1B6A A;  3TDU C;  1ZGA A;  3MWM A;  1O7F A;  3ZMV A;  1AOY A;  2G7U A;  4A5M A;  4O6J A;  1ODD A;  1E17 A;  3BDD A;  5HS7 A;  5H6R A;  4EGY A;  3V8K A;  4CO8 A;  3WTY C;  3RIR A;  2ZNZ A;  1U78 A;  4KIB A;  4WK8 F;  2XAQ A;  2XV4 S;  2MA3 A;  4P96 A;  3Q9V A;  3TOB A;  1YW8 A;  1O7L A;  2GQQ A;  2HTS A;  2M5W A;  4S04 A;  3ZMZ A;  5EEH A;  4BHC A;  1AWC A;  1RI7 A;  3F8N A;  3FMR A;  3R0A A;  4I7H A;  2UXN A;  1FWZ A;  3BOQ A;  4HDU A;  1LQ1 A;  1KU7 A;  2HQR A;  3EET A;  3SFZ A;  1XN7 A;  1ON1 A;  2FMY A;  2HDC A;  3ZP5 A;  1BC7 C;  3OOP A;  3T0Y A;  4BHP A;  3KZY A;  4BH9 A;  2F5F A;  4UVB A;  2OU2 A;  2A6H F;  4LK1 F;  4IRI A;  3CUQ A;  3WGG A;  3ABT A;  2GIV A;  1P6R A;  2XKP A;  1QGP A;  2KJB A;  1LDD A;  2VE8 A;  1JHF A;  3D5L A;  1YYV A;  4H0E A;  2HOE A;  4I02 A;  1HW5 A;  3IC7 A;  3T8T A;  1B9M A;  5BPI A;  1F4K A;  3TQN A;  2QYO A;  5D5X B;  4HQM A;  4P9U A;  4AWX B;  3HRM A;  1R00 A;  1D8J A;  3T1B A;  1LVA A;  2GA2 A;  2P5L C;  3DXJ F;  3SZP A;  1DUX C;  4OIO F;  3GVA A;  4N9I A;  4E70 A;  1D3Y A;  3IKT A;  3HTU A;  2K7L A;  4GXO A;  4GYG A;  3KCC A;  2ISY A;  4XSZ F;  1Y0U A;  4OIP F;  1H0M A;  3V8L A;  4Y15 A;  2FBK A;  3GWZ A;  5HDN A;  2ACJ A;  1SMT A;  3M7G A;  2DTR A;  4RGS A;  5CYV A;  1WWX A;  3T5X A;  1VTN C;  1TTY A;  4M74 A;  4YG2 F;  2P7V B;  2WV0 A;  1UB9 A;  4XLP F;  4FX4 A;  3M8E A;  1IN6 A;  4PZJ A;  3VOE A;  4ENK A;  1SD4 A;  4RGU A;  5HVQ C;  4HLY A;  3SZT A;  2QEN A;  4U0Y A;  3WTW C;  3LA2 A;  3P9I A;  2QQB A;  2DQR A;  2MC3 A;  4ZH4 F;  2R3S A;  3U1D A;  3E6C C;  2PN6 A;  1RZ4 A;  4F7Z A;  4M9Z A;  2FBI A;  2RGV A;  4U0W A;  3ZN0 A;  2KRF A;  5DUK A;  2Q2E A;  4HBL A;  4G6Q A;  5ICE A;  4L5J A;  1ZHF A;  1FYM A;  3RYR A;  1I6X A;  1FBS A;  2LF8 A;  3EYI A;  4PCQ A;  4A6D A;  5FLX K;  2FE3 A;  2A6E F;  2TDX A;  4MHG A;  2G7H A;  5IT9 K;  1ONV A;  2STW A;  5K1Y A;  2DK8 A;  3TDZ C;  3E6D A;  3TOA A;  3GZ5 A;  2EV0 A;  3R0J A;  2W84 A;  3SHF A;  4GYI A;  1P92 A;  2YR2 A;  1FYL A;  1GXP A;  1FP1 D;  2K4B A;  2LKP A;  3D0S A;  4OIQ F;  2L02 A;  4L9T A;  2LNB A;  4Z2Y A;  2FRH A;  4Q48 A;  2HS5 A;  2ZJ2 A;  2ZCW A;  1KQ8 A;  1W5S A;  5JI6 A;  5AIQ A;  5D5V B;  3LAP A;  1LDK B;  5LBQ A;  3P9K A;  3ML6 A;  4UVC A;  1TNS A;  2L4M A;  2O6G E;  3DKW A;  3LQR A;  4G7Z F;  2P6S A;  3PQJ A;  2OQR A;  3HSR A;  2ZO4 A;  5ICF A;  2OA4 A; 
#chains in the Genus database with same CATH topology
 2ME0 A;  5FJ8 J;  2R92 J;  2XAJ A;  2A3S A;  4Z6Y A;  4Q4Z F;  4XSX F;  3NWT A;  1YJN I;  1K78 B;  1X4O A;  1TW2 A;  2V9V A;  3K2A A;  3KEO A;  4IQJ A;  2X48 A;  1TT5 B;  3RDI A;  3AKZ A;  3TP3 A;  4KMF A;  1A5J A;  4YFN F;  2COM A;  5KVR A;  2IA1 A;  1S29 A;  1XCV A;  4C3I J;  1BR1 A;  3F22 A;  1R6R A;  3BPX A;  1YIO A;  3RQ4 A;  2M9H A;  2Y48 A;  3CCQ I;  3AFH A;  1FMW A;  2BOL A;  4ZYE A;  5E3M A;  3OYD A;  4B48 A;  3F0C A;  2W1O A;  1Y6I A;  3FXO A;  4G94 A;  2R7Z J;  5L3F A;  4LLL A;  4I99 C;  1E2X A;  2LOO A;  4HLX A;  3SEZ A;  3HGG A;  5B3S H;  4N9H A;  2Y0M A;  3NRV A;  1MBH A;  4OAY A;  3TMO A;  4EGZ A;  5H20 A;  2LY1 A;  2CWE A;  1JUP A;  4ESF A;  2IXS A;  3I4P A;  2WAE A;  3HHG A;  3KLN A;  5C44 J;  1VQ7 I;  3FMS A;  4CCK A;  4E7K A;  2M34 A;  3MKY B;  5DUI A;  2EFQ A;  3RZD J;  1KQ0 A;  3RSN A;  1TP4 A;  3I71 A;  4KYW A;  1G8X A;  3RPU A;  4A0X A;  3L2C A;  3OYN A;  2M45 A;  5LRR A;  4D1Q A;  3CCU I;  2V1U A;  1V5F A;  3GW2 A;  2PFB A;  2W57 A;  4QWQ A;  2XHK A;  1YOV B;  3NEU A;  1BL0 A;  4OIN F;  2QWW A;  1K78 A;  4WF2 A;  4B47 A;  1HKT A;  3BWG A;  2JA5 J;  5FKM A;  2ZXH A;  4OMZ A;  4AID A;  1YE9 A;  4BYY A;  1F9N A;  2P5K A;  1EH8 A;  3GFI A;  1POG A;  1XG1 A;  2W7N A;  1APL C;  3KET A;  1R4N B;  5CVU A;  1JXS A;  2BEO A;  5LHH A;  3E0J B;  1A6Q A;  4KDP A;  1ETK A;  2FQ3 A;  2PMZ A;  3U1K A;  2KRH A;  3L1P A;  4WXD A;  4A93 J;  4DYC A;  5C4J J;  2QM3 A;  4XON A;  2JMW A;  2H8W A;  3BQZ A;  1XMX A;  1I1S A;  1FSE A;  3RPU D;  2K9S A;  4A5N A;  2GOX B;  1U9N A;  2Y0S A;  4EJW A;  2VB6 A;  4JP0 A;  4BE2 A;  5HS8 A;  2RRE A;  2XAG A;  3S16 J;  1FBQ A;  4HZF A;  1I39 A;  1AHD P;  4BXF A;  2B0L A;  3C3W A;  1Y1W J;  4ZYG A;  4Y52 J;  5TGT A;  1B8I B;  3MKW B;  1MND A;  3QOE A;  2V6E A;  2MG4 A;  2XPV A;  1YW7 A;  5J6X A;  4NHJ A;  3BG6 A;  3M9A A;  2E2J J;  1J2X A;  1IXR C;  5GPC A;  1VQO I;  1KYW A;  3QU6 A;  1X2M A;  2MLK A;  2KL4 A;  1O3T A;  3Q5F A;  2Y2Z A;  4A3F J;  3LMM A;  2BE5 F;  4CZZ A;  1U3E M;  1GVD A;  3Q9S A;  2VE9 A;  3FK6 A;  5M5W J;  1RUO A;  4WXC A;  4OOI A;  4RAZ A;  3HUG B;  4IJA A;  2X4H A;  3PSI A;  3IAM 2;  5BQT A;  1QRY A;  1BN5 A;  1QVT A;  2BYV E;  5CQE A;  4OIR F;  3ESW B;  5E20 A;  2L5Q A;  3F6V A;  3ZMU A;  5HNH A;  1JGG A;  3CC4 I;  3PO2 J;  4MFD A;  1Y0N A;  1D1B A;  2M0C A;  3HOX J;  2XDV A;  2CV1 A;  2O5R A;  2XRO A;  1JHH A;  2CJJ A;  2IPQ X;  2EZL A;  3E1S A;  2FML A;  2W00 A;  3GME A;  3FXL A;  2RNJ A;  3CCY A;  2HYJ A;  3F9K A;  5HLH A;  1R5G A;  2DMQ A;  1NTC A;  4HSR A;  4BQA A;  1ETV A;  3GTJ J;  1Z7L A;  2L9R A;  1LDJ A;  3W6V A;  2GM4 A;  5BOX A;  2UUZ A;  4UUT A;  1ZR4 A;  5TIS C;  1CF7 B;  2L9S A;  2K85 A;  1OYY A;  2VJ4 A;  3H36 A;  3KP2 A;  2EBI A;  1UAA A;  3FXU A;  4XKV A;  2VXZ A;  2M7B A;  4WWC A;  2L9V A;  1R49 A;  5FD5 A;  2GBY A;  4AU7 A;  2D1H A;  2VJJ A;  4RM2 A;  5LRS A;  3HC7 A;  3L2U A;  3RKW A;  2LDU A;  3DU5 A;  4KIG A;  2FNA A;  2IS6 A;  1D5V A;  1KZH A;  3FIW A;  1KQ9 A;  2JPB A;  4YEJ A;  1OKR A;  5GTI C;  1JI8 A;  2KIM A;  4PFO A;  4ZYH A;  3HUG A;  3T8R A;  2FX0 A;  3WE2 A;  5HLG A;  1PP8 F;  2CRG A;  2CUZ A;  4L9N A;  3FKJ A;  5LHI A;  1JKQ C;  2CH0 A;  5LD2 C;  4L9J A;  4E7J A;  3SDB A;  1LNW A;  2BHZ A;  2ID3 A;  2V1X A;  4XKW A;  3W2V A;  3BLY A;  1QBJ A;  2XGD A;  4OU0 A;  3U21 A;  4ANJ A;  1GVJ A;  3JRA A;  1K7A A;  1IW7 F;  5F0C A;  2DBB A;  3SDG A;  1E0E A;  3E7L A;  2ADU A;  4YII A;  2XPW A;  2R7W A;  3PNT A;  2EPF A;  3GTM J;  4ABZ A;  3OWT A;  2C6Y A;  2VKE A;  2KRC A;  4XMY A;  4DBR A;  2K86 A;  5JFR A;  4MEY F;  1RPW A;  3FZV A;  3K9T A;  2MBF A;  2N8G A;  2F48 A;  1MBG A;  2BY0 A;  4BE1 A;  1LFU P;  2J5P A;  3PQK A;  2WY8 Q;  4L5E A;  3S1R J;  1A04 A;  3QYE A;  4IEJ A;  1JUS A;  2ZXW H;  3BTC A;  4BUP A;  2TRT A;  3LSH A;  2COB A;  3VSK A;  3CCR I;  2EIJ H;  1FZP B;  1QNT A;  5E3L A;  4M6V A;  4J00 A;  5GP9 A;  2DQL A;  2DFE A;  3OIP A;  1BIA A;  1T08 B;  1XMK A;  5JLW A;  2WTE A;  3MEX A;  4IOA F;  9ANT A;  4XLN F;  1FX7 A;  4BQQ A;  2NOJ B;  3SQN A;  1I27 A;  3LWF A;  4DYR A;  2M4K A;  1XDS A;  5IOZ A;  4BE0 A;  2CW7 A;  1F43 A;  4D0P A;  4UB6 C;  3HGY A;  3TL4 X;  3C1D A;  3WU1 B;  4UY8 I;  2JA7 J;  3CUQ B;  4LIU A;  3R6S A;  2Y30 A;  3WGI A;  3I64 A;  3V4G A;  3L00 A;  1IRG A;  4AIJ A;  4HW0 A;  1FNN A;  5FLV A;  2Y31 A;  1FP2 A;  2DOF A;  2OC6 A;  3TO7 A;  3F72 A;  1Y56 A;  4HDV A;  1X1A A;  2BW3 B;  3G1M A;  2NVX J;  4A2U A;  3BRO A;  3NAU A;  3IWF A;  4II3 A;  4U88 A;  2NVY J;  2R7X A;  1WVR A;  2K4J A;  2OAZ A;  4HV6 A;  5E1X A;  5KK1 A;  3BC8 A;  3WG7 H;  3TGN A;  1R23 A;  3BP8 A;  1TBX A;  2RN7 A;  5DS9 A;  1XC5 A;  4G7H F;  1MNE A;  2ETH A;  4DYQ A;  1VQ6 I;  4BEH B;  3DBR B;  3J7A O;  3TP0 A;  3H3V K;  5HOO A;  1Z9C A;  2EB7 A;  1IG7 A;  3JRC A;  4F55 A;  3NAR A;  4R8H A;  1VQ4 I;  2JN6 A;  4RAG A;  4B8X A;  1D1C A;  2LR8 A;  5EYR A;  5DCF A;  3F6O A;  4HNV A;  3CP8 A;  3ABK H;  5FO5 A;  1JKP C;  4UVA A;  2H27 A;  2IW5 A;  1U2W A;  2NXN B;  3V8J A;  2YSR A;  3QOP A;  2F6C A;  5ILU A;  1ETO A;  3JTH A;  4XIC A;  4RBO A;  2FXA A;  1VQ5 I;  2R7T A;  1T0F C;  6PAX A;  2JA8 J;  3TW7 A;  2MH9 A;  2A69 F;  2M8G X;  4YRV A;  3CF2 A;  2CUF A;  2CQK A;  2CMP A;  2HKX A;  3E5Q A;  4Y7N J;  2BHY A;  2JK3 A;  1LEA A;  2BW3 A;  3QPH A;  2PMZ N;  3C18 A;  2X6Y A;  3S15 J;  3HZJ A;  3AG4 H;  4TV7 A;  1B72 B;  5L3C A;  3SJM A;  2OQG A;  2RNG A;  4BQO A;  3EDP A;  4IPA A;  3GO5 A;  1CQT A;  2BY2 A;  2LVS A;  2Y0S N;  3S2W A;  2XB5 A;  2NNY A;  1UST A;  4L0Y B;  2HNH A;  3LFK A;  4FCY A;  2DN0 A;  1EF4 A;  4DZP A;  1ZRE A;  1MJA A;  2HPM A;  1IN7 A;  1LVK A;  2EIL H;  2KQR A;  4DGW B;  1BR2 A;  1V5G A;  4BEH A;  3JRH A;  1K4S A;  1IC8 A;  4ETS A;  2ZXI A;  5ICC A;  2CQN A;  2PJR B;  5F04 A;  2FBH A;  4IVN A;  4CZC A;  5A2Q Z;  3JSP A;  2OUM A;  2IRF G;  2DI3 A;  2LP0 A;  2YU9 J;  1P4W A;  2K3F A;  5EEG A;  2JZY A;  2ICW G;  1FC3 A;  4HAM A;  4PJL A;  4I0A A;  3JRG A;  3VB2 A;  2IJL A;  1S7A A;  2B63 J;  3IP4 B;  3JR9 A;  1U6G A;  2D2W A;  4M6Y A;  1XMA A;  3Q0W A;  4RB3 C;  4E7H A;  3FXK A;  5F0H A;  1O3Q A;  4WX9 A;  1PUF B;  3ABM H;  3CC2 I;  4IHX A;  2Q8K A;  5FLX Z;  1WQ2 A;  1HA8 A;  2DU9 A;  3H5N A;  4EM2 A;  2JT1 A;  3QRF F;  2HZT A;  3TKY A;  5GAE J;  5IT9 Z;  3HOT A;  1VQP I;  5K7Z A;  1K6Y A;  4ENJ A;  3GF2 A;  3ISP A;  3PNY A;  2LBF B;  2DT7 B;  2H6B A;  5F1R A;  3GYH X;  1DU0 A;  5E1Z B;  3C7J A;  3CMM A;  3K6G A;  1RIO H;  1ZEL A;  2MYS A;  3OYG A;  3S3O A;  1B72 A;  3L2Q A;  3H0D A;  3H9J A;  4AIH A;  4ON0 A;  2HYG D;  1ORK A;  1SMY F;  4P55 A;  5J47 A;  3HJE A;  1N75 A;  4UB8 C;  2H09 A;  5EGO B;  1MH4 A;  4FE7 A;  2JSP A;  1QO0 D;  2VT3 A;  1R58 A;  4F92 B;  3IRR A;  4XQF A;  1OR7 A;  4HNT A;  4B3X A;  4D7N A;  3HOU J;  1LFB A;  3TBI A;  1ENH A;  1TQP A;  5JVT A;  1WSU A;  4XK4 A;  3N4M A;  2LG4 A;  4PGG A;  3OYJ A;  4DW6 A;  3HYI A;  1OCC H;  5HDK A;  3PSF A;  1W7P B;  3BJ6 A;  2O8X A;  1GV2 A;  2VBY A;  3FX3 A;  4CUG A;  3Q0V A;  3I9V 2;  5IP7 J;  5JR3 A;  1A31 A;  4A3D J;  4A3L J;  2DA7 A;  2ESN A;  2V9K A;  3PFY A;  1Z6R A;  1ZRF A;  3CCV I;  3CCJ I;  2CFX A;  3LAJ A;  4DIQ A;  2VUM J;  3H9Q A;  4C3H J;  1A36 A;  1FBU A;  5J8C A;  1QZY A;  3CJN A;  4M3G A;  1AKH A;  2DYR H;  2IGN A;  5AIP A;  1RNL A;  4IHS A;  5A2Q K;  1XD7 A;  4Y17 A;  2GA1 A;  3A0B C;  2VL8 A;  3LSG A;  1R36 A;  1R5H A;  2A5Y B;  4YFK F;  2LBF A;  1Z3X A;  2BVL A;  1MZB A;  1S9H A;  5KAI C;  3MZY A;  1MMS A;  2LY2 A;  2W85 A;  3OYC A;  4LMY A;  3B6A A;  2XPU A;  4IL6 C;  4KIF A;  3JTG A;  1IZ1 A;  3FDY A;  3PFI A;  1ZAO A;  3OY9 A;  2M8E A;  5DD4 A;  4QLC U;  2LFB A;  3FHN A;  3FXJ A;  4A12 A;  1SEU A;  1UHW A;  5BS6 A;  4PGH A;  2YU3 A;  1EH6 A;  1ON2 A;  5EG0 B;  1DGW Y;  3GTG J;  1V4R A;  2AQE A;  4KN4 X;  1E3H A;  1B4A A;  3P5J A;  3V7C A;  3S1Q J;  4NC6 A;  1IRX A;  3BTL A;  1W4M A;  3HBL A;  3ROU A;  3I3L A;  2DA5 A;  2DA6 A;  1W7P A;  2UV1 A;  4IHT A;  1HQC A;  3BT9 A;  1FYK A;  3JW4 A;  3QP5 A;  2L7F P;  3VFZ A;  4J01 A;  1X1B A;  2ZJR F;  1YO5 C;  4EJO A;  3KP7 A;  3R4K A;  2CW0 F;  2HXO A;  3Q0U A;  2ZJP F;  2EFW A;  3QU3 A;  2P81 A;  3ECH A;  2P0W A;  3GBG A;  3RKY A;  2FU4 A;  1V3F A;  2JTV A;  2GXG A;  2VC1 A;  4FHT A;  1PP7 U;  4ZC3 A;  3K4M A;  1LEB A;  2L3D A;  5GTH C;  2GAU A;  3E97 A;  4EJV A;  3GUD A;  3ZQI A;  4R1H A;  1F36 A;  3KEY A;  3TO9 A;  4E7Z A;  1USS A;  1T56 A;  2XAS A;  4IRH A;  2JVG A;  2ELH A;  2VPL A;  4XBF A;  2Y69 H;  3LSK A;  2Z9O A;  5K5O A;  1W7P D;  5M3F J;  1S6L A;  1H89 C;  2RC4 A;  2A6T A;  3VEP A;  3PJR A;  3ECO A;  3FXQ A;  4U7B A;  1L0O C;  2UXX A;  2FA5 A;  1IN5 A;  2IS4 A;  4PJJ A;  3J7A Y;  3KP5 A;  2HYF A;  2LKS A;  3QPT A;  1IN8 A;  1HCR A;  3F8M A;  2FNP A;  3W6K B;  2V1N A;  5EG0 A;  3IH2 A;  5M5X J;  4K2E A;  1X4P A;  4Q47 A;  1XB4 A;  2ZFW A;  2W25 A;  2OPT A;  1IDZ A;  1D5Y A;  3BG7 A;  5ILS A;  1X58 A;  3RKQ A;  3I58 A;  2E7W A;  1QQI A;  1XSV A;  4QSH A;  3DF8 A;  3SXY A;  3OSG A;  5E8G A;  1UJ8 A;  4CGZ A;  2RKH A;  3DEE A;  1OPC A;  4L18 B;  2DOA A;  2LTP A;  5DV5 A;  1FY7 A;  3K4L A;  3RI4 A;  4RLQ A;  2QLZ A;  3J81 K;  4MQV A;  1MGT A;  1NG7 A;  5CVR A;  3J7Z I;  4ZTF A;  3J80 K;  3ZGK A;  5D6F A;  3PM1 A;  2DMN A;  1G3Y A;  3F21 A;  1EH7 A;  2YUS A;  3ZQG A;  1M1E B;  5FRN A;  4IXA A;  3CUQ C;  3VOD A;  2KMU A;  4A3B J;  3OIO A;  4XLA A;  3L2R A;  3REO A;  3HIF A;  2HKO A;  2Y9Z A;  4HX8 A;  2DOD A;  3JRE A;  3ZMT A;  2IA0 A;  3IV5 A;  3FKI J;  1S5L C;  4BY7 J;  2HTJ A;  2P7C B;  3LSM A;  5CVV A;  2PQ8 A;  3EUH A;  2RV8 A;  1N25 A;  1BC8 C;  3GTP J;  5LGT A;  1GXQ A;  3EQL F;  4MO7 A;  2BY3 A;  4ESJ A;  2QZ8 A;  1S8N A;  2I5U A;  4Y33 A;  4PUS A;  3PNV A;  4A3I J;  1D0X A;  2VOO A;  1UEL B;  1LPQ A;  2VJI A;  4X0G A;  4A3G J;  1WFX A;  4FX0 A;  2KIU A;  1SD5 A;  3AG2 H;  3ASO H;  2BZT A;  4UV8 A;  4U7D A;  1NK2 P;  2ECB A;  4HRI A;  5DTD A;  2XRL A;  1P4A A;  1G2H A;  3H0G J;  3KFW X;  2A05 A;  1BI1 A;  2VKV A;  2P6T A;  2OF7 A;  2HZD A;  2CG4 A;  2RDP A;  5IYC J;  1VZ0 A;  1W5C C;  4AYB N;  5L3D A;  1IUY A;  3ZPL A;  2W4S A;  2VKD A;  4NC7 A;  4BBS J;  4A0Z A;  5BNG A;  3K1M A;  4UXN A;  1Q1H A;  3W2W A;  4ENN A;  4D5F A;  3GZN B;  3DBH B;  1WRJ A;  2W24 A;  2W48 A;  2DA4 A;  2ECC A;  4AUX A;  1YG2 A;  1OCO H;  4D5C A;  2DLL A;  1SFE A;  5J8F A;  4S05 A;  3VSL A;  5BMZ A;  3TED A;  4M3F A;  3LOC A;  1MJ9 A;  3MAJ A;  1UCR A;  3FMQ A;  4I2O A;  4MTE A;  3V7S A;  2XVC A;  1P9Q C;  4MIM A;  1MMG A;  1WJC A;  4IRG A;  2H94 A;  3GFJ A;  1F1Z A;  5DM7 F;  5F1J A;  1FLI A;  1GHC A;  1X2N A;  3N97 A;  2KFD A;  2K9Q A;  2A68 F;  2ME6 A;  4KA4 A;  5LFA A;  1PUE E;  4PDK A;  1YS7 A;  3M3Y J;  2EZI A;  2F4M B;  3H92 A;  3M1E A;  4HG2 A;  1J5Y A;  4DZJ A;  3W6J B;  1X1D A;  2LRE A;  1J09 A;  1SVO A;  3OL4 A;  5JHF A;  1TQI A;  2E1O A;  1Z91 A;  3GTL J;  1ZKG A;  1OR7 C;  5E3N A;  1TL8 A;  4M6X A;  5D8K B;  4YFX F;  2M7A A;  2VQL A;  3OYE A;  1YHQ I;  3KP3 A;  4M3B A;  1W0T A;  2KDO A;  3HHH A;  3VDX A;  2RQP A;  3I5U A;  2FOK A;  2NYX A;  1UFM A;  1BJA A;  3OOU A;  1B1B A;  5ICG A;  4E6K G;  1X1C A;  4G7O F;  1JT0 A;  3QYF A;  3CQZ J;  2QCO A;  2QA4 I;  4QIW N;  2AXT C;  4YEL A;  4IHY A;  3UKG A;  2VN2 A;  1WH5 A;  3B73 A;  3QP6 A;  4D9J A;  3FXR A;  1XGO A;  1TT0 A;  4OAZ A;  4CYC A;  2E36 A;  1XDU A;  1T38 A;  3HRT A;  4AVZ A;  1MBF A;  5CVJ A;  5CPR B;  5DCM B;  3DWL E;  3S1N J;  2CUE A;  4HX7 A;  1RR7 A;  3RKX A;  2E5Z A;  3EYY A;  2X1E A;  3GFM A;  1B9N A;  4BXU A;  3A01 A;  2E1N A;  1WCM J;  5CJ9 A;  2X1D A;  3GLX A;  2OZ6 A;  3KYL A;  3RZO J;  1Z21 A;  4IQ4 A;  1EA3 A;  2O9L A;  1KYZ A;  1MDM B;  3DU6 A;  1FPQ A;  1Z0X A;  2PMU A;  1KGS A;  3TW6 A;  1FT9 A;  3ZMD A;  5FKK A;  3G71 I;  3RTR A;  3QWL A;  4RA2 A;  3EUK L;  1XGM A;  4AVP A;  2F5D A;  5GAD J;  5LGU A;  4E7I A;  3O8G A;  4NQW B;  1YIJ I;  3BG9 A;  2DW4 A;  2R7S A;  5GAH J;  1BI3 A;  2P8T A;  4M73 A;  3EUA A;  1K83 J;  2KZG A;  1FOX A;  4KFC A;  1MKM A;  3BR6 A;  2V79 A;  1UG0 A;  4ZZD A;  4LB5 A;  4M9S A;  3ZQQ A;  2E35 A;  4BJ5 C;  2B9S A;  2QSH X;  1WH7 A;  2A5W A;  1Z67 A;  4UUS B;  3S3M A;  2XRN A;  3G1O A;  3IRQ A;  3IH3 A;  3JRI A;  1S7O A;  1ZLJ A;  3I54 A;  3LNQ A;  2B7E A;  2LK2 A;  4WXH A;  5CVI A;  4HF1 A;  1BOB A;  4IZZ A;  3S2D J;  2JRT A;  3A0H C;  3ZOB A;  5ERI A;  3S1M J;  1K4T A;  4XLF A;  3KIO A;  2VKH A;  4AC0 A;  5FD6 A;  1PVE A;  5FLM J;  4L9V A;  3RJP A;  5DCM A;  1XSD A;  2XF5 A;  2WAD A;  4ZZL A;  1SAX A;  2O8K A;  2RAE A;  2F5C A;  3F3X A;  5HS9 A;  1TQM A;  1DDN A;  2QKM B;  3K0L A;  2O61 A;  3DLA A;  1P2F A;  2IGK A;  4CCM A;  3S93 A;  2EJR A;  1O57 A;  1HW2 A;  1IN4 A;  1K6O A;  1UG2 A;  1JJ8 C;  4BAC A;  4XNF A;  3IUO A;  1W0U A;  3WU2 C;  3CP2 A;  3PIP F;  2M3A A;  3DPL C;  4HV5 A;  2Z2S B;  4ASN A;  3ERE D;  2HFH A;  3CZ6 A;  1XPX A;  5EEA A;  2ZJQ F;  1R1U A;  1MDM A;  1XGS A;  3E3V A;  4FTH A;  2ZME A;  4IHV A;  2TCT A;  1T6S A;  3ZXS A;  4NQW A;  4GFB A;  5E1W A;  4EEF G;  1AU7 A;  2KIF A;  2NS0 A;  4XRS A;  1TNT A;  3SEQ A;  3HB9 A;  1O3S A;  4OMY A;  1FTT A;  1EV7 A;  4UHT A;  1QPI A;  2H6C A;  1MBJ A;  5IOY A;  3D5R C;  3K4C A;  2L4A A;  2IVM A;  3MN2 A;  2JPC A;  1ZTR A;  2CO5 A;  3NWS A;  5D8L B;  3ZR8 X;  1BI0 A;  4UUS A;  2VQC A;  3HOV J;  4JYK A;  3ABU A;  3HOZ J;  2LF7 A;  4E7S A;  3IKV A;  3DBL B;  2V4J C;  1IXC A;  1JE8 A;  1SD6 A;  2XSJ C;  4N0B A;  5ED4 A;  3V42 A;  3LA7 A;  3OYB A;  4CHU A;  1JTY A;  3OMY A;  4RGX A;  2F2E A;  2BBY A;  1T95 A;  2LMD A;  2IP2 A;  3HSF A;  3DTI A;  2NOG A;  2L7K A;  3JSO A;  2WC2 A;  3JAM K;  1OYI A;  1TWA J;  2A61 A;  2E1C A;  3MKZ A;  2F5E A;  3SFI A;  2WBM A;  1QHH D;  2DFH A;  2VXD A;  4UV9 A;  5E3O A;  1YQA A;  2MLG A;  3ZQL A;  1TC3 C;  3O3K A;  2XGC A;  1DGR M;  2DFF A;  1JJ6 C;  2XAU A;  2KHM A;  1ETX A;  1TZL A;  2K3P A;  4FIS A;  3SYT A;  2OTJ I;  1OMI A;  1LFP A;  3S17 J;  5D5U B;  3ERM A;  4A0Y A;  2KIS A;  2XAH A;  2AO9 A;  3DV8 A;  1ZH5 A;  3K1P A;  1KU2 A;  2LY9 A;  1WKM A;  4P9F A;  5F0F A;  5D5W B;  1GV5 A;  2YS9 A;  4MTD A;  3G3Z A;  5HNF A;  3F8F A;  3QPL A;  2CUJ A;  4GGG A;  4BBR J;  2PBI A;  3IAS 2;  4DBQ A;  2D45 A;  3JRF A;  2K27 A;  4Y3O A;  4W1U A;  1HDP A;  4LOC A;  1SFX A;  2E71 A;  2LD5 A;  5D4R A;  1XS9 A;  3LFU A;  3WHB A;  2R7Q A;  1SAU A;  1HF0 A;  2DAO A;  4EVI A;  2DYS H;  1ZLK A;  4Q5S F;  3KZZ A;  1G3W A;  5D4S A;  3I4M J;  4KIC A;  4V2F A;  2ESH A;  4PSW A;  4CXF A;  4EMS A;  3ZN1 A;  3R60 A;  2GIZ A;  3PUF A;  4LIT A;  2EFN A;  2P5V A;  4CDG A;  3FWE A;  4BJ6 C;  3RYP A;  2NNN A;  2JUG A;  3BQY A;  3RQI A;  4I76 A;  2A07 F;  4ZYD A;  1LB2 A;  1R1T A;  1ZYR F;  3OYH A;  4KIS A;  4CYD A;  1HBX G;  1IRZ A;  5FGM A;  2E60 A;  3KP4 A;  3DQV C;  1L3L A;  2EIN H;  3QOD A;  4II2 A;  3HG9 A;  4HNU A;  2CYY A;  4CSW A;  5AON A;  2IEK A;  3CMY A;  4ZYA A;  1ZG5 A;  1OCT C;  4O3M A;  1MBK A;  1WJD A;  4DNC A;  3WTS C;  4GRI A;  3BJA A;  4NBQ A;  1J59 A;  4DOZ A;  4LG0 B;  4QPQ A;  1R22 A;  1D1A A;  1G3S A;  1FSH A;  4EJT A;  4J19 A;  1GT0 C;  1XCB A;  4KN7 X;  2EZH A;  3MMY B;  1IXS B;  3CES A;  1HXD A;  5EJC A;  1S3J A;  1WI9 A;  2PLY A;  2D5V A;  2HDD A;  3H3Z A;  4CCN A;  3OSF A;  3A2K A;  4HYE A;  2IGO A;  2P4W A;  2O03 A;  4PJ0 C;  4YIF A;  5FFX A;  3MZH A;  3IH4 A;  1JGS A;  3OV8 A;  1ITY A;  1X3U A;  2Z99 A;  5L3E A;  4XKB A;  4XRM A;  3M8F A;  1DP7 P;  1U5T B;  2AHQ A;  2VBW A;  1K61 A;  5JLX A;  1I50 J;  2QVO A;  2HDW A;  2H1L A;  3E6M A;  4B4C A;  2I8D A;  5IPA A;  1ZK8 A;  1Z7U A;  2X9D A;  5B1A H;  2BV6 A;  4M9X A;  3C2H A;  3QAH A;  2ZSI B;  2VQH A;  4I09 A;  4XRF A;  4G9Y A;  2VI6 A;  2PI0 A;  3G2B A;  3ZCO A;  2R4G A;  3I55 I;  1HW1 A;  3CO6 C;  3O8H A;  5K7H A;  2ZC2 A;  2WY7 Q;  3B6C A;  3KYD B;  3K2Z A;  5M3M J;  1G6N A;  2KKO A;  1AKH B;  2DA3 A;  1UHM A;  3CCE I;  3BTI A;  2F5V A;  1RKW A;  4LLN A;  3I59 B;  4X6A J;  5KAF C;  2CS3 A;  1LJ9 A;  2QEX I;  2L2O A;  2QBY B;  3MQ0 A;  1EKE A;  2X0L A;  4PK4 A;  1TWC J;  1K79 A;  1SD7 A;  4C3J J;  2NVU B;  2L7M P;  2EV5 A;  3OS1 A;  4XID A;  2CV2 A;  1VQN I;  2K02 A;  2JA2 A;  4LG0 A;  4XLH A;  1TWG J;  1REP C;  1H8A C;  4ESB A;  1OCP A;  4HOB A;  4XL9 A;  4P1W A;  1R7J A;  2MSY A;  1PDN C;  1J9I A;  3UNG C;  1IJW C;  3LST A;  2FSW A;  2J5O A;  3ELK A;  1I5Z A;  2LH9 A;  4D7M A;  3K69 A;  2LRD A;  3BR1 A;  3R61 A;  4HQE A;  1HKQ A;  3KLO A;  4IKF A;  4L0Z B;  3HOY J;  4ZTJ A;  1AA7 A;  5CQG A;  5KNL A;  2IAI A;  3DPU A;  4JK1 X;  4KUM A;  1VF9 A;  4GCV A;  4RGR A;  1U5T A;  3IL2 A;  3DEU A;  1KU3 A;  4L5I A;  1FMV A;  4BAY A;  4OWR B;  1Z05 A;  4FE4 A;  1VQM I;  4ZDP A;  1ZRD A;  1YI2 I;  2Z5U A;  1J7K A;  2BXY A;  2DDB A;  4I01 A;  2KLO A;  3G6E I;  3WOD F;  3GX4 X;  4C2T A;  3OIQ A;  1ZG1 A;  2L54 A;  3HEF A;  3BG3 A;  3CUO A;  3BZK A;  1ACI A;  2FD5 A;  3P9C A;  2VJ5 A;  5DYM A;  2IS1 A;  2V26 A;  1OLT A;  3FK7 A;  5J40 A;  4F93 B;  3I0T A;  1HST A;  3LA3 A;  2KPM A;  4F3Q A;  5DEQ A;  5F6F A;  4YIR X;  2DA1 A;  2BGC A;  3I59 A;  2QGU A;  2KJC A;  2PG4 A;  4PSX A;  3G73 A;  3BZ6 A;  5ILV A;  3O6B B;  5JHU A;  2QBY A;  1NHA A;  4HX4 A;  4LGW A;  3H35 A;  3FIS A;  1D0Z A;  2YX7 A;  2L01 A;  3E6B A;  4N4O B;  3J81 Z;  4BDY A;  5E17 F;  5HLI A;  2RVC A;  3J80 Z;  5H2F C;  5K5R A;  1P4X A;  3TO6 A;  3WGH A;  2Z33 A;  2VON A;  3CTA A;  4EM0 B;  2DA2 A;  3DPT A;  1WJA A;  3LSJ A;  3FM3 A;  2EIM H;  1XGN A;  3HRU A;  2M0M A;  4WCG A;  2D1V A;  1C0W A;  4XOT A;  1R5I D;  2XAF A;  2VBX A;  2H8R A;  3F8B A;  1VQ8 I;  2WAQ A;  1MJB A;  3JCU C;  2LYC A;  4EAT A;  3WE3 A;  3MFK A;  1SFK A;  5C3E J;  4AM3 A;  3WTX C;  2Z3Y A;  4CA0 A;  4RB2 C;  1NK3 P;  2STT A;  3COA C;  3NQO A;  2O0Y A;  2PMH A;  5H6Q A;  1Y39 A;  1VND A;  3CDH A;  1JTX A;  1TWH J;  3HPH A;  4FAS D;  1SAN A;  3OL3 A;  2VOD A;  2MC4 A;  1DU6 A;  1IF1 A;  3CD6 I;  2DJN A;  3MCZ A;  5L3B A;  5TRD A;  1ZR2 A;  4BS9 A;  3V7R A;  5LGN A;  1MMD A;  1E3P A;  3VYT B;  3ZQ7 A;  2WA0 A;  1WI3 A;  3GZ6 A;  2DOE A;  4CCL A;  3FHZ A;  4LK0 F;  1BW5 A;  4B09 A;  1OQY A;  2ELK A;  4FQG A;  3VPR A;  1V5E A;  1H9G A;  4ZJZ A;  3ZQC A;  2GZW A;  2ZXJ A;  2EFO A;  5IT3 A;  2MW8 A;  2L9N A;  2HQ5 A;  2GXA A;  1I3A A;  2VQG A;  1LUJ B;  1W36 D;  2WAF A;  1QU3 A;  3WG9 A;  2MGQ A;  1CGP A;  2QQA A;  1G4D A;  2HWV A;  3K7A J;  2FOW A;  3K4K A;  4CIC A;  3I56 I;  2EZK A;  3H3U A;  4HF0 A;  1QVU A;  4B1R A;  3K10 A;  2OBP A;  2YX4 A;  4IOC F;  5DD8 A;  2DK5 A;  2OV7 A;  2Z1D A;  1R71 A;  3KZI C;  4BU2 A;  3E5X A;  1ULY A;  4EJU A;  1XTA A;  1BOA A;  2OD5 A;  2UWM A;  2JJ7 A;  4A3M J;  2DO7 A;  2HQN A;  3HTS B;  1IDY A;  1PJR A;  3CCL I;  4LD5 A;  5LEJ A;  2EA4 A;  4BHB A;  2L7Z A;  1J0R A;  5KHD A;  4V19 K;  4BXX J;  4N4N B;  1BIB A;  1H9T A;  3ULQ B;  1ZAR A;  2HVR A;  4CCO A;  4U0V A;  2VOP A;  3CCM I;  1IGN A;  5FRO A;  1YTY A;  4MNU A;  4BY1 J;  3K4J A;  1HSJ A;  2M30 A;  4BNC A;  3WU0 A;  2XC7 A;  3L09 A;  4XM3 A;  2ZKZ A;  3E5U A;  3QYB A;  3ZQF A;  4BJT A;  4EQQ A;  3KE2 A;  2DJI A;  3WTT C;  1U8B A;  1MD0 A;  4I98 B;  3M4O J;  2EWN A;  3OR2 C;  4KMU X;  3BR5 A;  2LSO A;  1B59 A;  4GO1 A;  3L7W A;  2EA2 A;  1J75 A;  3IHU A;  3EPZ A;  1YRN B;  1ZRC A;  2GLO A;  2VT2 A;  5F27 A;  2FEZ A;  1IUF A;  4A3K J;  1O4X A;  2E2I J;  3B02 A;  3KPH A;  1RET A;  1JUM A;  2JRM A;  2OZU A;  4G8X A;  3I53 A;  3FBI B;  1OJL A;  3H5R A;  3GXO A;  2LKX A;  4XRS G;  3A02 A;  2UZK A;  2E1M B;  3W2A A;  3OYM A;  1MSF C;  5HOD A;  5J1R A;  3AL0 B;  3O2P E;  2DT5 A;  4S0H B;  4UNO A;  2DMT A;  4P5O A;  2HVS A;  2X6W A;  2MD0 A;  2QSG X;  1SC7 A;  2K9M A;  2XGX A;  3DP7 A;  1HC8 A;  2FF4 A;  3HOS A;  2R7O A;  3BG5 A;  1ZGW A;  5L3G A;  1H88 C;  4LFU A;  3DLL F;  1QPM A;  2DPD A;  1TWF J;  2X1C A;  1STZ A;  3H1C A;  3K70 D;  4LB6 B;  4XLC A;  1YFH A;  1Y8R B;  3BR3 A;  4NUB A;  2V7F A;  3AAF A;  2EK5 A;  2IGM A;  3LQQ A;  4IHW A;  3A4C A;  4IO9 F;  4FT8 A;  3U9G A;  3CMA I;  1KA8 A;  1NH3 A;  1T98 A;  4IX7 A;  2QKL B;  2XSD C;  1IRF A;  2MFZ A;  1RR8 C;  2NS7 A;  5LEK A;  3BTJ A;  2XIG A;  4JX5 A;  2KZV A;  2GWR A;  1VFC A;  5IYD J;  3DEW A;  3M07 A;  2FJ1 A;  2QQ9 A;  2ZNY A;  3MD2 A;  2H1K A;  3JRD A;  4M71 A;  4A6E A;  1YRN A;  4CYC B;  3HSE A;  2HQA A;  5IP9 J;  4LLG F;  1X19 A;  3C2B A;  5B1B H;  3N05 A;  5F64 A;  1HKS A;  1BM9 A;  4MFE A;  1QZZ A;  3G4S I;  5BPD A;  1DPR A;  4MEX F;  3WTZ A;  4QPO A;  1YW9 A;  4JQF A;  2NAZ A;  2DFI A;  3A01 B;  3GTQ J;  1T0F A;  5E18 F;  1XX5 A;  2M2E A;  2QUF A;  2CQX A;  3ABL H;  4EM1 A;  2DCE A;  4AD9 A;  2MD5 A;  1X3Z B;  2ISZ A;  2M1B A;  3C2G A;  1YLF A;  1IAW A;  4LG3 A;  5D6E A;  1I1G A;  1OFC X;  1Q1V A;  1ZGJ A;  3LSI A;  5HDG A;  3RPQ A;  1W5T A;  5J4V A;  1VQL I;  5TJJ A;  3WTV C;  2R7F A;  2LLK A;  4A3E J;  4IF4 A;  1ETW A;  3BJO A;  1U5T C;  5J1U A;  2CGP A;  3CO7 C;  1TLH B;  3HRS A;  2IT0 A;  2DMP A;  3BCB A;  1MBE A;  4U87 A;  5CKT A;  4HF2 A;  2DDA A;  3S2H J;  1MW7 A;  2Q0O A;  4RB0 A;  4UUV A;  2O3F A;  1DP3 A;  4RB1 A;  2O7O A;  3A03 A;  3KP6 A;  2JA6 J;  2DPU A;  3H5A A;  2EH3 A;  1R1V A;  1T39 A;  2YPR A;  1OYW A;  3MKL A;  5FB2 A;  2VLA A;  3BY6 A;  3U2R A;  3ZQH A;  4MGR A;  3OYK A;  1HDD C;  4KT5 C;  2IS2 A;  1ZG3 A;  1KU9 A;  2MH2 A;  2XUB A;  3BPV A;  3M1C A;  3WTU C;  2WWY A;  3HOW J;  2VC0 A;  1XSX A;  5CLS A;  4RAY A;  2E7X A;  5J1Y A;  1Y1V J;  3Q3S A;  1LKX A;  3ZRG A;  2PJP A;  5EF6 A;  3HDD A;  3P7N A;  2ZBK A;  1OCZ H;  3GFL A;  1V55 H;  3DFG A;  1T2K A;  3SZG A;  3D1N I;  2V6C A;  5LHG A;  4JBA A;  2JSC A;  3BZC A;  2HPI A;  2X51 A;  2E5N A;  1YS6 A;  4E7L A;  1D8K A;  1ETY A;  4HPQ A;  5IY5 H;  4HA8 A;  4R79 A;  2HVQ A;  1GDT A;  2ZME B;  1G3T A;  3AG1 H;  3F8C A;  5DM6 F;  5K7F A;  4G12 A;  2PEX A;  1MH3 A;  2I10 A;  2CW8 A;  1RES A;  3FF5 A;  2V1D A;  4M72 A;  3JAM Z;  3F23 A;  5GPA A;  2X85 A;  2WAQ N;  3ZMS A;  1BJZ A;  1FTZ A;  1W36 C;  3KYC B;  3H9G A;  4KNY A;  1TW3 A;  1BBY A;  3CJT B;  2XF6 A;  2IA2 A;  2K9N A;  2ZSH B;  3CLO A;  1U8R A;  2R7V A;  2HGC A;  4I0B A;  1B8I A;  3K4N A;  1O3R A;  4HEA 2;  2CSO A;  1YIT I;  3IWZ A;  2NRA C;  1FIP A;  5JVG F;  2EV6 A;  5LLQ A;  1UHS A;  2XB0 X;  4AIK A;  1G59 A;  1BI2 A;  3OS2 A;  3QPS A;  2HR3 A;  4XLE A;  2R93 J;  1DPU A;  1Z1D A;  1Z3Y A;  3GEZ A;  2VBZ A;  2XKO A;  2X6X A;  2HEO A;  5E8I A;  4G6D A;  1FOK A;  4Y13 A;  1RUN A;  3KEQ A;  2CU7 A;  2X6O A;  2QF7 A;  3VWB A;  2GXB A;  2AQF A;  1FIA A;  3L9F A;  4MLO A;  2AXL A;  2M4G A;  4JX6 A;  1Y8Q B;  5F08 A;  1SFU A;  3VYS B;  1Z6T A;  4LJZ F;  4MQ9 F;  2Y75 A;  4ENM A;  3FM5 A;  4RS8 A;  5DDG A;  4C2U A;  4W97 A;  5K5Q A;  3LL7 A;  4NB5 A;  4FET A;  2V9P A;  4DQ2 A;  1MIJ A;  3K1N A;  3AG3 H;  1BW6 A;  2CFO A;  2EFP A;  2M87 A;  3DKX A;  4EV0 A;  5FFZ A;  1F5T A;  2G9W A;  2R7D A;  4ITV A;  4O5V A;  2AS5 F;  1CF7 A;  1HLV A;  1ZN2 A;  2WB1 A;  1B6A A;  3TDU C;  2VIX A;  1ZGA A;  2MAB A;  2R7R A;  3VYU B;  3MWM A;  1WJ5 A;  1O7F A;  1OIS A;  2Q1Z B;  1YX3 A;  1R4M B;  3ZMV A;  3KX2 A;  2PX9 A;  1AOY A;  2G7U A;  4A5M A;  4O6J A;  4X1E A;  4A69 C;  5EZH A;  1ODD A;  1E17 A;  3BDD A;  4QTR A;  5HLT A;  2CQQ A;  5HS7 A;  5H6R A;  4EGY A;  4KJZ A;  2DT6 A;  3K70 C;  3V8K A;  4CO8 A;  2Y9Y A;  3RIR A;  5J4Y A;  2ZNZ A;  4RAF A;  3WTY C;  1U78 A;  2OJE D;  3VYR B;  3L2V A;  5C4X J;  1ERD A;  4KIB A;  2GOM A;  1A6I A;  4WK8 F;  4B44 A;  2XAQ A;  2XV4 S;  3EUH C;  2MA3 A;  4P96 A;  3Q9V A;  2E34 A;  1U9O A;  4LIV A;  3TOB A;  2QQ8 A;  1YW8 A;  2R5Y B;  2ZFU A;  1IV6 A;  1MMA A;  1D0Y A;  1R9T J;  3I4N J;  3MZ8 A;  1O7L A;  2GQQ A;  2R7U A;  4RDU A;  2HOS A;  2HTS A;  4ZDO A;  2M5W A;  2HU9 A;  4A3C J;  1E3O C;  4S04 A;  1I3Q J;  3DTK A;  3ZMZ A;  4F91 B;  5EEH A;  1WJE A;  4BHC A;  1AWC A;  1MSE C;  1RI7 A;  4DJA A;  5EZG A;  3F8N A;  3FMR A;  3R0A A;  4I7H A;  2UXN A;  1I6H J;  3HKZ A;  1FWZ A;  1GLN A;  3BOQ A;  2E2H J;  1T33 A;  4GDF A;  3QQA A;  4HDU A;  3DCF A;  1LQ1 A;  1VQK I;  1EJ9 A;  1KU7 A;  2HQR A;  3EET A;  3SFZ A;  1XN7 A;  4M3D A;  4CH7 A;  1ON1 A;  1RC9 A;  2Z16 A;  2FMY A;  2HDC A;  3W3C A;  3S3N A;  1UZC A;  2OTL I;  3ZP5 A;  1BC7 C;  3OOP A;  3T0Y A;  4BHP A;  3KZY A;  2HOT A;  3PL8 A;  5FKN A;  4NC8 A;  3D5S C;  2F5F A;  4UVB A;  4XN0 A;  4BH9 A;  3LSP A;  2ZB9 A;  2OU2 A;  2A6H F;  3BR0 A;  1RRJ A;  3CDI A;  1T8I A;  4LK1 F;  4IRI A;  2L0K A;  1ETQ A;  3CUQ A;  5GAG J;  4BQN A;  1FJL A;  3WGG A;  4G6T B;  2E1M C;  4BL0 B;  3ABT A;  2GIV A;  4H4K C;  1IO2 A;  1P6R A;  2XKP A;  3AL0 C;  2R5Y A;  1QGP A;  2KJB A;  2FQ4 A;  3OYI A;  2NVQ J;  1LDD A;  2VE8 A;  1JHF A;  4ZDL A;  3D5L A;  1YYV A;  4C2M J;  3OYA A;  4H0E A;  2HOE A;  4I02 A;  1HW5 A;  3IC7 A;  3T8T A;  1B9M A;  3G1L A;  5BPI A;  2VAS A;  3BR2 A;  1F4K A;  3TQN A;  1WZ2 A;  2QYO A;  2NS8 A;  2JQ7 A;  5D5X B;  4HQM A;  2ELJ A;  4P9U A;  2BY1 A;  1WJB A;  4KIT B;  2IBD A;  5M5Y J;  3CJR B;  4AWX B;  3HRM A;  1R00 A;  1D8J A;  4PFP A;  3HM5 A;  3T1B A;  1LVA A;  3RCO A;  3S8P A;  3HL2 A;  2BXZ A;  3J7Y J;  3PIO F;  4XKC A;  1QZE A;  2JVH A;  4AYB A;  2GA2 A;  5FKO A;  1SVL A;  2P5L C;  1WJF A;  3DXJ F;  1VI0 A;  3SZP A;  1FEX A;  1DUX C;  2DMU A;  4OIO F;  1BR4 A;  3GVA A;  1PYV A;  4N9I A;  4E70 A;  3JRB A;  1SVM A;  2VPR A;  1D3Y A;  3IKT A;  3OYL A;  1ZQ3 P;  5B66 C;  1JKR C;  3HTU A;  1V54 H;  1FOY A;  2K7L A;  3PUB A;  1RKT A;  1UMQ A;  1YX5 A;  3OS0 A;  4GXO A;  2LC2 A;  4GYG A;  3KCC A;  1DQU A;  2ISY A;  4XOP A;  4XSZ F;  5KCM A;  1Y0U A;  4OIP F;  3CLQ A;  3V8L A;  4XN3 A;  4Y15 A;  2FBK A;  1H0M A;  3GWZ A;  2EIK H;  5HDN A;  2ACJ A;  1HOM A;  2HOA A;  1SMT A;  3M7G A;  2DTR A;  4CCJ A;  4E4H A;  4RGS A;  2Q2E B;  5CYV A;  2CQ7 A;  1WWX A;  3T5X A;  1U0J A;  1VTN C;  4B43 A;  1TTY A;  4C30 A;  4M74 A;  4YG2 F;  2P7V B;  1IV8 A;  2WV0 A;  1UB9 A;  1S72 I;  1VQ9 I;  4XLP F;  3M8E A;  4FX4 A;  3ONQ A;  1Z77 A;  1IN6 A;  4PZJ A;  2K5C A;  3VOE A;  1JKO C;  3OR1 C;  2K40 A;  2K9L A;  4ENK A;  1WGX A;  1SD4 A;  1SFO J;  2PJR A;  2QSF X;  4RGU A;  5HVQ C;  4HLY A;  3SZT A;  3HPG A;  2QEN A;  4U0Y A;  4BKX A;  3WTW C;  2JWT A;  3LA2 A;  1BA5 A;  1NG6 A;  2OCC H;  1YJ9 I;  3BCA A;  2DXI A;  2KDZ A;  5IYB J;  3A1Y A;  3P9I A;  3MVP A;  3FXM A;  2QQB A;  5J3L A;  2F4I A;  3S14 J;  4M3E A;  2DQR A;  1PUF A;  5EDN A;  2MC3 A;  1GUU A;  2FUG 2;  4JOM A;  4ZH4 F;  2R3S A;  5B5E C;  3U1D A;  3CC7 I;  4PJM A;  4BDZ A;  2R5Z B;  3E6C C;  2PN6 A;  1RZ4 A;  4F7Z A;  2F4O B;  4M9Z A;  3CME I;  2ZME C;  2FBI A;  2RGV A;  3HXL A;  4U0W A;  3ZN0 A;  4V2G A;  2KRF A;  5DUK A;  2CV0 A;  2Q2E A;  4HBL A;  5IP6 A;  2XF7 A;  4I6Z A;  1P7I A;  4G6Q A;  2OCE A;  5ICE A;  4JX4 A;  3CDL A;  4L5J A;  3ASN H;  1ZHF A;  1FYM A;  4NDL A;  5E79 C;  3GTK J;  2KIQ A;  2HXI A;  2G0E A;  5EGO A;  3RYR A;  3FBN B;  3CF5 F;  1YJW I;  1I6X A;  1FBS A;  2LF8 A;  3EYI A;  4PCQ A;  3GLL A;  4A6D A;  1LE8 B;  5FLX K;  2FE3 A;  2A6E F;  2TDX A;  4MHG A;  2G7H A;  4F52 A;  3L2W A;  2BVM A;  2KT0 A;  4RM3 A;  2WB1 N;  3DKY A;  4PJN A;  5FKL A;  5IT9 K;  1WPK A;  1ONV A;  2STW A;  5K1Y A;  3PO3 J;  2DK8 A;  4KT6 A;  1KON A;  3TDZ C;  3E6D A;  3GCM A;  4RMN A;  3GZ5 A;  3TOA A;  2EV0 A;  1S7E A;  1QA6 A;  1X1P A;  1MNM C;  1A35 A;  3R0J A;  4XR6 A;  2W84 A;  4NNJ A;  3SHF A;  4GYI A;  1P92 A;  2YR2 A;  3CCS I;  2KP6 A;  1FYL A;  2R5Z A;  1GXP A;  1FP1 D;  2K4B A;  2NVT J;  2LKP A;  3D0S A;  4RLF A;  4OIQ F;  2L02 A;  4L9T A;  3GTO J;  2LNB A;  1OCR H;  4Z2Y A;  3X2Q H;  2FRH A;  1MMN A;  1WHU A;  1N78 A;  4Q48 A;  4BGD A;  2HS5 A;  2ZJ2 A;  2E19 A;  2WV1 A;  2ZCW A;  1P7J A;  4A3J J;  1KQ8 A;  1W5S A;  1N77 A;  1JT6 A;  5JI6 A;  5AIQ A;  5D5V B;  3LAP A;  3CJQ B;  2W82 A;  1LDK B;  2RQQ A;  5LBQ A;  3LSR A;  4Y4R A;  1LE8 A;  3P9K A;  2DTZ A;  3ML6 A;  4UVC A;  1TNS A;  2L4M A;  2EQR A;  2R0Q C;  3HKZ N;  4XOR A;  1FOW A;  3S32 A;  2O6G E;  4C9Y A;  3DKW A;  3LQR A;  4G7Z F;  2HI3 A;  3M8J A;  2P6S A;  2ID6 A;  2JUC A;  3DTE A;  3K4B A;  1W1W E;  3PQJ A;  4B3A A;  4HST A;  2XGE A;  2OQR A;  1QHG A;  3UR3 C;  5FRM A;  3HSR A;  3OYF A;  2ZO4 A;  1X3W B;  5ICF A;  2OA4 A;  3WHC A; 
#chains in the Genus database with same CATH homology
 2XAJ A;  2A3S A;  4Q4Z F;  4XSX F;  1K78 B;  1TW2 A;  2V9V A;  3KEO A;  3RDI A;  4KMF A;  4YFN F;  2COM A;  5KVR A;  2IA1 A;  1S29 A;  1XCV A;  3F22 A;  3BPX A;  1YIO A;  2Y48 A;  4ZYE A;  4G94 A;  5L3F A;  4LLL A;  1E2X A;  4HLX A;  4N9H A;  2Y0M A;  3NRV A;  4EGZ A;  5H20 A;  2CWE A;  4ESF A;  3I4P A;  3HHG A;  3KLN A;  3FMS A;  5DUI A;  2EFQ A;  1KQ0 A;  3I71 A;  4KYW A;  3RPU A;  4A0X A;  3L2C A;  2M45 A;  5LRR A;  2V1U A;  3GW2 A;  2PFB A;  2W57 A;  4QWQ A;  2XHK A;  3NEU A;  4OIN F;  2QWW A;  1K78 A;  4WF2 A;  1HKT A;  3BWG A;  4OMZ A;  4BYY A;  1F9N A;  2P5K A;  1EH8 A;  3GFI A;  3KET A;  5CVU A;  1JXS A;  2BEO A;  5LHH A;  4KDP A;  2FQ3 A;  4WXD A;  2QM3 A;  1I1S A;  1FSE A;  4EJW A;  4A5N A;  5HS8 A;  2XAG A;  1FBQ A;  4HZF A;  2B0L A;  3C3W A;  4ZYG A;  1YW7 A;  5J6X A;  4NHJ A;  3M9A A;  1J2X A;  1IXR C;  1KYW A;  3QU6 A;  2MLK A;  1O3T A;  3Q5F A;  2BE5 F;  4CZZ A;  1U3E M;  2VE9 A;  3Q9S A;  1RUO A;  4WXC A;  4OOI A;  4RAZ A;  4IJA A;  2X4H A;  5BQT A;  1BN5 A;  2BYV E;  4OIR F;  5E20 A;  3F6V A;  3ZMU A;  2XRO A;  1JHH A;  2IPQ X;  2FML A;  2RNJ A;  5HLH A;  1R5G A;  4BQA A;  1LDJ A;  5BOX A;  1CF7 B;  3KP2 A;  1OYY A;  3FXU A;  2VXZ A;  4WWC A;  5FD5 A;  2D1H A;  5LRS A;  3RKW A;  2LDU A;  4KIG A;  2FNA A;  1D5V A;  1KQ9 A;  2JPB A;  1OKR A;  2KIM A;  4ZYH A;  3HUG A;  3T8R A;  3WE2 A;  5HLG A;  1PP8 F;  4L9N A;  5LHI A;  4L9J A;  1LNW A;  1QBJ A;  2V1X A;  4OU0 A;  1GVJ A;  1K7A A;  1IW7 F;  2DBB A;  2ADU A;  4YII A;  2C6Y A;  5JFR A;  2K86 A;  4MEY F;  3FZV A;  3K9T A;  2MBF A;  2J5P A;  3PQK A;  1A04 A;  1FZP B;  1QNT A;  2DQL A;  1BIA A;  1XMK A;  2WTE A;  3MEX A;  4XLN F;  1FX7 A;  3SQN A;  1I27 A;  3LWF A;  1XDS A;  4D0P A;  3C1D A;  3WU1 B;  3CUQ B;  3R6S A;  3WGI A;  3I64 A;  3V4G A;  3L00 A;  1IRG A;  4AIJ A;  4HW0 A;  1FNN A;  1FP2 A;  3TO7 A;  3F72 A;  4HDV A;  4A2U A;  3BRO A;  3IWF A;  4U88 A;  2K4J A;  2OAZ A;  4HV6 A;  5E1X A;  5KK1 A;  3TGN A;  1R23 A;  3BP8 A;  1TBX A;  2RN7 A;  4G7H F;  2ETH A;  3J7A O;  5HOO A;  1Z9C A;  2EB7 A;  4R8H A;  4B8X A;  5DCF A;  3F6O A;  5FO5 A;  4UVA A;  2H27 A;  2IW5 A;  1U2W A;  3V8J A;  2YSR A;  3QOP A;  5ILU A;  3JTH A;  2FXA A;  6PAX A;  2MH9 A;  2A69 F;  3E5Q A;  2CQK A;  2HKX A;  1LEA A;  3QPH A;  3C18 A;  4TV7 A;  5L3C A;  2OQG A;  3EDP A;  4IPA A;  3GO5 A;  3S2W A;  2NNY A;  1UST A;  4L0Y B;  3LFK A;  1ZRE A;  1MJA A;  1IN7 A;  4ETS A;  5ICC A;  2FBH A;  4IVN A;  5A2Q Z;  3JSP A;  2IRF G;  2DI3 A;  1P4W A;  5EEG A;  2JZY A;  4HAM A;  1FC3 A;  4I0A A;  3VB2 A;  2IJL A;  1S7A A;  1U6G A;  2D2W A;  4M6Y A;  1XMA A;  4RB3 C;  1O3Q A;  4WX9 A;  2Q8K A;  5FLX Z;  1WQ2 A;  2DU9 A;  4EM2 A;  2JT1 A;  3QRF F;  2HZT A;  3TKY A;  5IT9 Z;  3HOT A;  4ENJ A;  3GF2 A;  3ISP A;  2H6B A;  5F1R A;  3GYH X;  5E1Z B;  3C7J A;  1RIO H;  4AIH A;  4ON0 A;  2HYG D;  1SMY F;  4P55 A;  2H09 A;  1QO0 D;  2VT3 A;  1R58 A;  3IRR A;  1OR7 A;  1TQP A;  5JVT A;  1WSU A;  3N4M A;  4PGG A;  3HYI A;  5HDK A;  1W7P B;  3BJ6 A;  2O8X A;  2VBY A;  3FX3 A;  5JR3 A;  2ESN A;  1Z6R A;  1ZRF A;  2CFX A;  3LAJ A;  1FBU A;  5J8C A;  1QZY A;  3CJN A;  5AIP A;  1RNL A;  4IHS A;  5A2Q K;  1XD7 A;  4Y17 A;  2GA1 A;  1R36 A;  1R5H A;  2A5Y B;  4YFK F;  1MZB A;  3MZY A;  2W85 A;  4LMY A;  4KIF A;  3JTG A;  1IZ1 A;  3PFI A;  1ZAO A;  2M8E A;  5DD4 A;  4QLC U;  4A12 A;  1UHW A;  5BS6 A;  4PGH A;  2YU3 A;  1EH6 A;  1ON2 A;  1V4R A;  4KN4 X;  1B4A A;  3V7C A;  1W4M A;  3ROU A;  1W7P A;  4IHT A;  1HQC A;  1FYK A;  3JW4 A;  3QP5 A;  3VFZ A;  1YO5 C;  4EJO A;  3KP7 A;  3R4K A;  2CW0 F;  2EFW A;  3QU3 A;  3ECH A;  3RKY A;  2FU4 A;  1V3F A;  2JTV A;  2GXG A;  2VC1 A;  4FHT A;  1PP7 U;  1LEB A;  2L3D A;  2GAU A;  3E97 A;  4EJV A;  3GUD A;  4R1H A;  3TO9 A;  1USS A;  2XAS A;  4IRH A;  2ELH A;  4XBF A;  2Z9O A;  5K5O A;  1W7P D;  1S6L A;  2RC4 A;  3VEP A;  3ECO A;  3FXQ A;  4U7B A;  1L0O C;  2UXX A;  2FA5 A;  1IN5 A;  3KP5 A;  2HYF A;  3QPT A;  1IN8 A;  3F8M A;  2FNP A;  3W6K B;  4K2E A;  4Q47 A;  1XB4 A;  2ZFW A;  2W25 A;  5ILS A;  3I58 A;  2E7W A;  1QQI A;  1XSV A;  3SXY A;  3DF8 A;  5E8G A;  4CGZ A;  2RKH A;  1OPC A;  4L18 B;  5DV5 A;  1FY7 A;  3RI4 A;  2QLZ A;  3J81 K;  4MQV A;  1MGT A;  5CVR A;  3J80 K;  5D6F A;  1G3Y A;  3F21 A;  1EH7 A;  4IXA A;  3CUQ C;  3VOD A;  3REO A;  3HIF A;  2HKO A;  4HX8 A;  3ZMT A;  2IA0 A;  2HTJ A;  2P7C B;  5CVV A;  2PQ8 A;  3EUH A;  2RV8 A;  1BC8 C;  5LGT A;  1GXQ A;  3EQL F;  4ESJ A;  2QZ8 A;  1S8N A;  2VOO A;  4FX0 A;  2KIU A;  1SD5 A;  4UV8 A;  4U7D A;  1P4A A;  3KFW X;  1BI1 A;  2P6T A;  2CG4 A;  2RDP A;  1IUY A;  5L3D A;  3ZPL A;  4A0Z A;  3K1M A;  4UXN A;  1Q1H A;  4ENN A;  1WRJ A;  2W24 A;  1YG2 A;  2DLL A;  1SFE A;  5J8F A;  4S05 A;  5BMZ A;  1MJ9 A;  3MAJ A;  1UCR A;  3FMQ A;  4I2O A;  4MTE A;  3V7S A;  2XVC A;  4IRG A;  2H94 A;  3GFJ A;  1F1Z A;  1FLI A;  1GHC A;  3N97 A;  2A68 F;  4KA4 A;  1PUE E;  4PDK A;  1YS7 A;  3M1E A;  3H92 A;  1J5Y A;  3W6J B;  1TQI A;  1Z91 A;  4M6X A;  5D8K B;  4YFX F;  3KP3 A;  3HHH A;  2RQP A;  3I5U A;  2FOK A;  2NYX A;  1UFM A;  1BJA A;  1B1B A;  5ICG A;  4G7O F;  2VN2 A;  3QP6 A;  3B73 A;  3FXR A;  1XGO A;  1XDU A;  1T38 A;  3HRT A;  5CVJ A;  5DCM B;  4HX7 A;  3RKX A;  3EYY A;  3GFM A;  1B9N A;  4BXU A;  2E1N A;  5CJ9 A;  3GLX A;  2OZ6 A;  1KYZ A;  1MDM B;  3ZMD A;  1FPQ A;  2PMU A;  1KGS A;  1FT9 A;  3RTR A;  4AVP A;  1XGM A;  2F5D A;  5LGU A;  2DW4 A;  1BI3 A;  2P8T A;  4M73 A;  4KFC A;  1MKM A;  2V79 A;  4ZZD A;  4LB5 A;  4M9S A;  2XRN A;  3IRQ A;  1S7O A;  1ZLJ A;  3I54 A;  4WXH A;  5CVI A;  4HF1 A;  2JRT A;  5ERI A;  5FD6 A;  4L9V A;  3RJP A;  5DCM A;  1XSD A;  1SAX A;  4ZZL A;  2F5C A;  3F3X A;  5HS9 A;  1TQM A;  1DDN A;  3K0L A;  2O61 A;  1P2F A;  2EJR A;  1O57 A;  1HW2 A;  1IN4 A;  1K6O A;  3DPL C;  4HV5 A;  4ASN A;  3ERE D;  2HFH A;  1R1U A;  1MDM A;  1XGS A;  3E3V A;  2ZME A;  1T6S A;  4NQW A;  5E1W A;  2KIF A;  2NS0 A;  1TNT A;  1O3S A;  4OMY A;  1EV7 A;  4UHT A;  2H6C A;  2L4A A;  2IVM A;  2JPC A;  2CO5 A;  5D8L B;  1BI0 A;  3ABU A;  2LF7 A;  3IKV A;  1IXC A;  1JE8 A;  1SD6 A;  4N0B A;  5ED4 A;  3LA7 A;  4CHU A;  4RGX A;  2F2E A;  2BBY A;  2IP2 A;  3HSF A;  3JSO A;  2WC2 A;  3JAM K;  1OYI A;  2A61 A;  2E1C A;  2F5E A;  4UV9 A;  1YQA A;  2MLG A;  3O3K A;  1OMI A;  5D5U B;  4A0Y A;  2XAH A;  3DV8 A;  1ZH5 A;  3K1P A;  1KU2 A;  4P9F A;  1WKM A;  5D5W B;  4MTD A;  3G3Z A;  3F8F A;  4GGG A;  2PBI A;  2D45 A;  2K27 A;  1SFX A;  5D4R A;  2DAO A;  4EVI A;  1ZLK A;  4Q5S F;  3KZZ A;  1G3W A;  5D4S A;  4KIC A;  2ESH A;  4CXF A;  4EMS A;  3ZN1 A;  3R60 A;  2EFN A;  2P5V A;  4CDG A;  3FWE A;  3RYP A;  2NNN A;  2A07 F;  4ZYD A;  1LB2 A;  1R1T A;  1ZYR F;  4CYD A;  1HBX G;  5FGM A;  3KP4 A;  3DQV C;  1L3L A;  2CYY A;  5AON A;  1ZG5 A;  4O3M A;  4DNC A;  3WTS C;  3BJA A;  1J59 A;  4LG0 B;  1R22 A;  1G3S A;  1FSH A;  4EJT A;  1XCB A;  4KN7 X;  1IXS B;  1HXD A;  1S3J A;  1WI9 A;  2PLY A;  3H3Z A;  4HYE A;  2P4W A;  2O03 A;  4YIF A;  5FFX A;  3MZH A;  1JGS A;  3OV8 A;  1X3U A;  2Z99 A;  5L3E A;  1DP7 P;  3M8F A;  1U5T B;  2VBW A;  2QVO A;  3E6M A;  1Z7U A;  2BV6 A;  4M9X A;  3QAH A;  4I09 A;  4XRF A;  4G9Y A;  2PI0 A;  1HW1 A;  3CO6 C;  3K2Z A;  1G6N A;  2KKO A;  1UHM A;  4LLN A;  3I59 B;  1LJ9 A;  2QBY B;  3MQ0 A;  2X0L A;  1K79 A;  1SD7 A;  2EV5 A;  2K02 A;  4LG0 A;  1REP C;  4ESB A;  4HOB A;  1R7J A;  1PDN C;  1J9I A;  3LST A;  2FSW A;  2J5O A;  3ELK A;  1I5Z A;  3K69 A;  3R61 A;  4HQE A;  1HKQ A;  3KLO A;  4L0Z B;  4JK1 X;  4KUM A;  4RGR A;  4GCV A;  3IL2 A;  1U5T A;  3DEU A;  1KU3 A;  4L5I A;  4BAY A;  1Z05 A;  1ZRD A;  2Z5U A;  1J7K A;  4I01 A;  3WOD F;  3GX4 X;  1ZG1 A;  2L54 A;  3CUO A;  3P9C A;  5DYM A;  3I0T A;  1HST A;  3LA3 A;  5DEQ A;  5F6F A;  2BGC A;  3I59 A;  2KJC A;  2PG4 A;  3G73 A;  3BZ6 A;  5ILV A;  3O6B B;  5JHU A;  2QBY A;  1NHA A;  4HX4 A;  4LGW A;  2YX7 A;  3E6B A;  2L01 A;  3J81 Z;  5E17 F;  5HLI A;  2RVC A;  3J80 Z;  5K5R A;  1P4X A;  3TO6 A;  3WGH A;  2Z33 A;  2VON A;  3CTA A;  4EM0 B;  3DPT A;  3FM3 A;  1XGN A;  3HRU A;  4WCG A;  2D1V A;  1C0W A;  2XAF A;  2VBX A;  3F8B A;  1MJB A;  3WE3 A;  3MFK A;  3WTX C;  2Z3Y A;  4RB2 C;  2STT A;  3COA C;  3NQO A;  2O0Y A;  2PMH A;  5H6Q A;  3CDH A;  2VOD A;  1IF1 A;  3MCZ A;  5L3B A;  5TRD A;  5LGN A;  3V7R A;  3ZQ7 A;  3GZ6 A;  3FHZ A;  4LK0 F;  4B09 A;  1H9G A;  2GZW A;  2ZXJ A;  2EFO A;  5IT3 A;  3WG9 A;  1CGP A;  2QQA A;  1G4D A;  2HWV A;  4CIC A;  3H3U A;  4HF0 A;  2OBP A;  2YX4 A;  5DD8 A;  2DK5 A;  3E5X A;  1ULY A;  4EJU A;  1BOA A;  2OD5 A;  2UWM A;  2DO7 A;  2HQN A;  3HTS B;  4LD5 A;  5LEJ A;  2EA4 A;  4BHB A;  1J0R A;  1BIB A;  1H9T A;  3ULQ B;  1ZAR A;  2VOP A;  4U0V A;  1YTY A;  4MNU A;  1HSJ A;  2M30 A;  4BNC A;  3WU0 A;  3L09 A;  2ZKZ A;  3E5U A;  4EQQ A;  3KE2 A;  3WTT C;  1MD0 A;  4I98 B;  2EWN A;  4KMU X;  2LSO A;  1B59 A;  4GO1 A;  3L7W A;  2EA2 A;  1J75 A;  3IHU A;  1ZRC A;  2VT2 A;  2FEZ A;  3B02 A;  2OZU A;  4G8X A;  3I53 A;  3GXO A;  2UZK A;  3O2P E;  2DT5 A;  4UNO A;  4P5O A;  2XGX A;  3DP7 A;  2FF4 A;  3HOS A;  5L3G A;  4LFU A;  1QPM A;  2DPD A;  1STZ A;  4LB6 B;  1YFH A;  3AAF A;  2EK5 A;  3LQQ A;  4FT8 A;  3U9G A;  1KA8 A;  1T98 A;  1IRF A;  5LEK A;  2XIG A;  2GWR A;  2QQ9 A;  2ZNY A;  4M71 A;  4A6E A;  3HSE A;  4LLG F;  5F64 A;  1HKS A;  1BM9 A;  1QZZ A;  5BPD A;  1DPR A;  4MEX F;  3WTZ A;  1YW9 A;  4JQF A;  2NAZ A;  2DFI A;  1T0F A;  5E18 F;  2QUF A;  4EM1 A;  4AD9 A;  2MD5 A;  2ISZ A;  2M1B A;  1YLF A;  1IAW A;  5D6E A;  1I1G A;  1ZGJ A;  5HDG A;  3RPQ A;  1W5T A;  5TJJ A;  3WTV C;  2R7F A;  4IF4 A;  3BJO A;  2CGP A;  1U5T C;  3CO7 C;  1TLH B;  3HRS A;  2IT0 A;  4HF2 A;  2Q0O A;  4RB0 A;  4UUV A;  2O3F A;  4RB1 A;  3KP6 A;  2DPU A;  1R1V A;  1T39 A;  2YPR A;  1OYW A;  5FB2 A;  3BY6 A;  3U2R A;  4MGR A;  4KT5 C;  1ZG3 A;  1KU9 A;  2MH2 A;  2XUB A;  3BPV A;  3WTU C;  2WWY A;  2VC0 A;  1XSX A;  5CLS A;  4RAY A;  2E7X A;  2PJP A;  3P7N A;  2ZBK A;  3GFL A;  3DFG A;  1T2K A;  2V6C A;  5LHG A;  4JBA A;  2JSC A;  1YS6 A;  1D8K A;  4HA8 A;  4R79 A;  2ZME B;  1G3T A;  3F8C A;  2PEX A;  3FF5 A;  2V1D A;  4M72 A;  3JAM Z;  3F23 A;  3ZMS A;  4KNY A;  1TW3 A;  1BBY A;  2IA2 A;  1U8R A;  3CLO A;  2HGC A;  4I0B A;  1O3R A;  2CSO A;  3IWZ A;  2NRA C;  2EV6 A;  5LLQ A;  4AIK A;  1BI2 A;  2HR3 A;  1DPU A;  1Z1D A;  3GEZ A;  2VBZ A;  2XKO A;  2HEO A;  5E8I A;  4G6D A;  1FOK A;  4Y13 A;  1RUN A;  3KEQ A;  2GXB A;  3L9F A;  2AXL A;  1SFU A;  1Z6T A;  4LJZ F;  4MQ9 F;  2Y75 A;  4ENM A;  3FM5 A;  4RS8 A;  5DDG A;  5K5Q A;  4NB5 A;  4DQ2 A;  3K1N A;  2EFP A;  2M87 A;  4EV0 A;  5FFZ A;  1F5T A;  2G9W A;  2R7D A;  4O5V A;  2AS5 F;  1CF7 A;  1ZN2 A;  1B6A A;  3TDU C;  1ZGA A;  3MWM A;  1O7F A;  3ZMV A;  1AOY A;  2G7U A;  4A5M A;  4O6J A;  1ODD A;  1E17 A;  3BDD A;  5HS7 A;  5H6R A;  4EGY A;  3V8K A;  4CO8 A;  3WTY C;  3RIR A;  2ZNZ A;  1U78 A;  4KIB A;  4WK8 F;  2XAQ A;  2XV4 S;  2MA3 A;  4P96 A;  3Q9V A;  3TOB A;  1YW8 A;  1O7L A;  2GQQ A;  2HTS A;  2M5W A;  4S04 A;  3ZMZ A;  5EEH A;  4BHC A;  1AWC A;  1RI7 A;  3F8N A;  3FMR A;  3R0A A;  4I7H A;  2UXN A;  1FWZ A;  3BOQ A;  4HDU A;  1LQ1 A;  1KU7 A;  2HQR A;  3EET A;  3SFZ A;  1XN7 A;  1ON1 A;  2FMY A;  2HDC A;  3ZP5 A;  1BC7 C;  3OOP A;  3T0Y A;  4BHP A;  3KZY A;  4BH9 A;  2F5F A;  4UVB A;  2OU2 A;  2A6H F;  4LK1 F;  4IRI A;  3CUQ A;  3WGG A;  3ABT A;  2GIV A;  1P6R A;  2XKP A;  1QGP A;  2KJB A;  1LDD A;  2VE8 A;  1JHF A;  3D5L A;  1YYV A;  4H0E A;  2HOE A;  4I02 A;  1HW5 A;  3IC7 A;  3T8T A;  1B9M A;  5BPI A;  1F4K A;  3TQN A;  2QYO A;  5D5X B;  4HQM A;  4P9U A;  4AWX B;  3HRM A;  1R00 A;  1D8J A;  3T1B A;  1LVA A;  2GA2 A;  2P5L C;  3DXJ F;  3SZP A;  1DUX C;  4OIO F;  3GVA A;  4N9I A;  4E70 A;  1D3Y A;  3IKT A;  3HTU A;  2K7L A;  4GXO A;  4GYG A;  3KCC A;  2ISY A;  4XSZ F;  1Y0U A;  4OIP F;  1H0M A;  3V8L A;  4Y15 A;  2FBK A;  3GWZ A;  5HDN A;  2ACJ A;  1SMT A;  3M7G A;  2DTR A;  4RGS A;  5CYV A;  1WWX A;  3T5X A;  1VTN C;  1TTY A;  4M74 A;  4YG2 F;  2P7V B;  2WV0 A;  1UB9 A;  4XLP F;  4FX4 A;  3M8E A;  1IN6 A;  4PZJ A;  3VOE A;  4ENK A;  1SD4 A;  4RGU A;  5HVQ C;  4HLY A;  3SZT A;  2QEN A;  4U0Y A;  3WTW C;  3LA2 A;  3P9I A;  2QQB A;  2DQR A;  2MC3 A;  4ZH4 F;  2R3S A;  3U1D A;  3E6C C;  2PN6 A;  1RZ4 A;  4F7Z A;  4M9Z A;  2FBI A;  2RGV A;  4U0W A;  3ZN0 A;  2KRF A;  5DUK A;  2Q2E A;  4HBL A;  4G6Q A;  5ICE A;  4L5J A;  1ZHF A;  1FYM A;  3RYR A;  1I6X A;  1FBS A;  2LF8 A;  3EYI A;  4PCQ A;  4A6D A;  5FLX K;  2FE3 A;  2A6E F;  2TDX A;  4MHG A;  2G7H A;  5IT9 K;  1ONV A;  2STW A;  5K1Y A;  2DK8 A;  3TDZ C;  3E6D A;  3TOA A;  3GZ5 A;  2EV0 A;  3R0J A;  2W84 A;  3SHF A;  4GYI A;  1P92 A;  2YR2 A;  1FYL A;  1GXP A;  1FP1 D;  2K4B A;  2LKP A;  3D0S A;  4OIQ F;  2L02 A;  4L9T A;  2LNB A;  4Z2Y A;  2FRH A;  4Q48 A;  2HS5 A;  2ZJ2 A;  2ZCW A;  1KQ8 A;  1W5S A;  5JI6 A;  5AIQ A;  5D5V B;  3LAP A;  1LDK B;  5LBQ A;  3P9K A;  3ML6 A;  4UVC A;  1TNS A;  2L4M A;  2O6G E;  3DKW A;  3LQR A;  4G7Z F;  2P6S A;  3PQJ A;  2OQR A;  3HSR A;  2ZO4 A;  5ICF A;  2OA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...