4LB5A

Crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
60
structure length
57
Chain Sequence
EIEMRICDYLRRHGRSTVQDIFKELKLEKSTVNRHLYSLQASKQVFKTVKRPVWNLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords Protein kinase containing Z-DNA binding domains
publication title Structural basis for Z-DNA binding and stabilization by the zebrafish Z-DNA dependent protein kinase PKZ.
pubmed doi rcsb
source organism Danio rerio
total genus 20
structure length 57
sequence length 60
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4lb5A00
2OZUA 4ETSA 3E5XA 1HW2A 2KRFA 2GIVA 2GZWA 4JQFA 2MBFA 1KA8A 2QUFA 5LEKA 2NS0A 3EETA 3HTUA 2CW0F 2IVMA 1FBQA 2JZYA 4ENKA 4MEXF 3N4MA 3HRSA 2Q8KA 4RB0A 2DU9A 5J8CA 3LA7A 2ISZA 3ZMVA 3QAHA 3LSTA 2ZJ2A 2GXBA 5CVVA 1O3SA 1Q1HA 1W7PA 4AIJA 3V7RA 5BS6A 1ZGJA 3FWEA 1AOYA 3C7JA 3LA3A 3N97A 4EV0A 5DDGA 3V7CA 3V7SA 1B59A 1ODDA 5A2QZ 1IN5A 4MGRA 6PAXA 4WXCA 5BOXA 5AIPA 1I1GA 5D8LB 2O6GE 2GA1A 2XIGA 3Q9SA 2EFOA 3GFLA 2BV6A 4PGHA 5DUKA 3R6SA 3DF8A 5LLQA 3EQLF 3FF5A 2HS5A 1GHCA 1OMIA 2XGXA 4GGGA 3WTYC 3CJNA 2EJRA 4HW0A 4EGZA 3AAFA 3J80Z 1J59A 1H9GA 2QBYA 2HKOA 1OYYA 5LHHA 4KIFA 4FHTA 3FX3A 2XAJA 3HSRA 4R79A 4RGUA 1LJ9A 3KP7A 1G3SA 1LNWA 1XGNA 2KJBA 3QU3A 1Z05A 1B6AA 3WTTC 4G7ZF 1KU7A 5F1RA 3OOPA 3L9FA 3HSFA 4CYDA 1J9IA 2HZTA 1ZHFA 3KCCA 3REOA 4N9IA 3GLXA 3NQOA 4LG0A 3CTAA 4UV8A 5KVRA 3FMRA 1R00A 4QWQA 5LRSA 3O6BB 1L0OC 1EH8A 2EV0A 4KMUX 2ZCWA 2O8XA 4CO8A 4AVPA 1FWZA 4Q4ZF 4XLPF 4PCQA 3FXRA 3E5UA 3GF2A 3QPHA 5J8FA 4Y13A 2HWVA 1I27A 2OBPA 1K79A 2ADUA 3WTZA 5HDKA 2XROA 1EH6A 3ROUA 2TDXA 2P5KA 2IA1A 4ESFA 2J5PA 4IRHA 1P92A 4B09A 4E70A 3K2ZA 2A68F 2PMUA 2OQGA 4EM1A 1XGOA 4BHBA 2M87A 2P4WA 4HV5A 1RUNA 3M8EA 4HLXA 2ZMEA 1V4RA 1G3WA 3F21A 2RNJA 1JGSA 4HOBA 3TOBA 4BQAA 3J81K 4BAYA 5D5XB 2HKXA 4L0YB 2VXZA 1CGPA 3S2WA 1ZN2A 3EYYA 5HLHA 1ZLJA 1JXSA 2VONA 1JE8A 4BH9A 2IA0A 2STWA 1FP1D 2YX4A 4XBFA 4YG2F 3LAPA 2WWYA 4KYWA 4HF2A 1YW8A 2QLZA 1YYVA 4I0AA 1FZPB 5LRRA 2QM3A 5E20A 2Y0MA 2HDCA 3WU0A 4M74A 2XV4S 5HVQC 5TRDA 3K0LA 4S05A 2ZFWA 4OOIA 4RB1A 5ERIA 2STTA 2JT1A 3RPUA 4A5NA 4IJAA 2D1VA 1ZYRF 4XRFA 2M5WA 1NHAA 2PLYA 2E7WA 4KT5C 1FYLA 2PG4A 2M30A 1YLFA 4CICA 2M45A 1DUXC 2IT0A 3ISPA 2KKOA 5D4RA 4RGRA 4GYIA 3I59A 2FOKA 4KN4X 1USTA 4HX4A 3U9GA 3MZHA 4BNCA 3E6DA 1O57A 4GXOA 3JSPA 2A61A 4EJTA 5EEHA 2FQ3A 1D5VA 3V4GA 3W6JB 2VBYA 1T0FA 1ZARA 3RIRA 1OR7A 4G7OF 3JSOA 5E1WA 1Y0UA 1UHWA 3O2PE 2XUBA 2ESNA 2XAFA 2Z9OA 1V3FA 2VC0A 3BPVA 1SD7A 3BZ6A 4BHPA 2K86A 3HSEA 1A04A 1UHMA 2GWRA 4K2EA 2Y75A 4WK8F 5AIQA 2V1UA 3F8CA 1T98A 1P4WA 4G9YA 4S04A 3DQVC 2F2EA 1MJBA 1ONVA 1RI7A 3I4PA 3B02A 1MJ9A 3GEZA 4AWXB 4KIGA 2RGVA 4OINF 2DK8A 1QZZA 4O5VA 4AIHA 1SD4A 1YW9A 3TO7A 4HF0A 2QQBA 1GXPA 3WE2A 2A07F 1FY7A 2UXNA 2XAHA 5DCMA 4WXHA 5FFZA 1XMAA 5TJJA 1W5TA 2WTEA 1QZYA 1BI1A 2ZXJA 2FNPA 3I71A 1ZREA 1MDMB 2HYGD 3LAJA 3J81Z 1YIOA 2H94A 4L5IA 4U0WA 1IW7F 2WV0A 3M1EA 4HDUA 4A0YA 5D8KB 2E1CA 3JTGA 1BJAA 5HDNA 1O7FA 3LFKA 2FE3A 4M73A 1X3UA 2A6EF 5DEQA 2DW4A 2HOEA 4EM0B 1J75A 1FBUA 3KZZA 4LGWA 3WTSC 5D6EA 3HYIA 1DDNA 5IT9K 3BY6A 5DCFA 2GAUA 3MEXA 3F8MA 1SFEA 3WTUC 3DPLC 3RYPA 4Q48A 3CUQA 1ZH5A 3RYRA 3GXOA 4L0ZB 2XAQA 4EVIA 1JHHA 1IXSB 4HX8A 4P5OA 3OV8A 3ZMDA 1O3QA 4EGYA 1YFHA 4RAZA 4KICA 2FSWA 2O3FA 3WU1B 2EA4A 3ZMUA 1TNSA 3G73A 1XGMA 1K6OA 2FEZA 4L9TA 4P9UA 4M71A 1ZGAA 3ZP5A 3IRQA 1AWCA 3BJ6A 3BPXA 1R23A 2VBZA 1EV7A 1SFXA 4UNOA 5LBQA 2HEOA 1WRJA 4GCVA 2X0LA 2AS5F 2KJCA 2NNYA 3KP4A 2A6HF 3RTRA 4QLCU 1IN6A 1QQIA 3E6BA 1RIOH 3SHFA 3IRRA 4OMYA 4PZJA 2PJPA 1LDKB 3D5LA 3T1BA 1TQIA 2RKHA 4ZZDA 3MZYA 1S6LA 2A5YB 3EDPA 2XRNA 5K5QA 2R3SA 3PQKA 4DQ2A 4IRGA 4LLGF 4EJUA 5IT3A 4KA4A 4RGSA 2YSRA 1TLHB 4EJOA 2K27A 5BQTA 2J5OA 4HZFA 2X4HA 3ZMTA 3C18A 2HQRA 3R0AA 1KQ8A 5EEGA 3G3ZA 5DD4A 2K4JA 3IKTA 3TKYA 2ETHA 3K69A 2XASA 1TBXA 2V79A 1U5TB 5LEJA 2L3DA 4HYEA 3T0YA 5JR3A 1D3YA 1BC8C 1ZRCA 3ZQ7A 3TDZC 3E3VA 4CGZA 2VN2A 5ILUA 1I1SA 2O0YA 2JTVA 5IT9Z 4IF4A 4PGGA 4Q5SF 5CVJA 2G7UA 3CLOA 4RB2C 2YR2A 3BJOA 4KFCA 4M72A 3IKVA 1YQAA 2D2WA 5JFRA 1R5HA 1BIBA 2PMHA 4I09A 2XKPA 3F8FA 3BWGA 3IC7A 2YU3A 2EB7A 5DD8A 2DPDA 4M9SA 2F5EA 4YFNF 5L3FA 1WKMA 1STZA 1SAXA 3F3XA 5FLXK 3CUOA 2YPRA 1ZAOA 4FT8A 2HFHA 2E1NA 4JK1X 2P6TA 1P4XA 3F6VA 5FB2A 1DP7P 1G3YA 2P5LC 4L9NA 2H6BA 3MCZA 4AD9A 1SMYF 2V1DA 4ZYDA 1OKRA 2DAOA 3L7WA 4M6XA 2FNAA 2FF4A 1SMTA 2W24A 5BPIA 1HBXG 3ZMSA 2RVCA 4XSZF 3C1DA 2QBYB 3RPQA 4ENJA 4MHGA 4G6QA 3TDUC 2IJLA 4OIPF 3P9KA 1GVJA 4LB6B 4XLNF 5E8IA 5LGTA 4GO1A 4IHTA 2FA5A 2ZNZA 2A3SA 4I0BA 3GX4X 2RQPA 3KP2A 1RZ4A 2Y48A 2UWMA 4LJZF 3HIFA 2IP2A 1KQ0A 3M7GA 3T5XA 3QPTA 3GFMA 4YFXF 3IHUA 2LDUA 3EUHA 4O6JA 3VEPA 3KP6A 4WWCA 3F22A 3GZ5A 3BOQA 1QBJA 1VTNC 2ISYA 3GYHX 1EH7A 4IVNA 5L3BA 4L9VA 2ESHA 3I0TA 4HA8A 1UB9A 5CJ9A 2GXGA 3QP5A 4P9FA 4N0BA 2DFIA 2EWNA 4Q47A 3ABUA 3C3WA 3PQJA 3V8LA 5CLSA 4ENNA 3M8FA 2PI0A 2JRTA 1D8KA 5HLGA 3GVAA 5BPDA 3Q5FA 1RNLA 2KIUA 4ON0A 4UXNA 4F7ZA 1ZG1A 2ZKZA 2FBKA 3BJAA 1FOKA 1S3JA 4ENMA 4MEYF 3TO6A 1LEBA 1HXDA 3FM5A 3F6OA 3CO6C 2QVOA 2HQNA 4BYYA 3DP7A 3FXQA 2QQ9A 2W85A 2F5DA 3QP6A 3HRTA 3RKYA 4UVAA 2C6YA 1BC7C 1TQMA 3GWZA 2V1XA 2IW5A 3JAMK 4I7HA 3KLNA 3I54A 3F72A 4UUVA 5D5UB 2QYOA 1E17A 1MKMA 4A0ZA 1H9TA 3TO9A 2ELHA 3DV8A 4G7HF 2HGCA 5ILVA 3TOAA 3WGGA 2RV8A 1Z1DA 3IL2A 3HTSB 4A12A 1CF7B 2XKOA 1HSTA 3K9TA 1Z6TA 1R1UA 1W4MA 1FC3A 1G3TA 1LDJA 4HQEA 4HBLA 1T38A 1ZG3A 2XVCA 3WG9A 1B4AA 2FMYA 4D0PA 1ZG5A 3FM3A 3L00A 1MJAA 2XAGA 3I59B 1FNNA 5HDGA 3KFWX 3MAJA 3WODF 1IXRC 1TW3A 4G6DA 3V8KA 4Z2YA 3FMQA 3VB2A 1F9NA 2CFXA 2VT3A 1ZLKA 1XCVA 2Z99A 2JPCA 4NQWA 1BM9A 5HS8A 1IN4A 2DI3A 2EV6A 5DV5A 5H6QA 2W25A 1IXCA 2PQ8A 2FMLA 3VFZA 5J6XA 1F1ZA 5L3GA 2CWEA 2MH9A 4PDKA 2BBYA 2M1BA 1YTYA 2HYFA 1XGSA 1HKTA 3DPTA 2QWWA 2FBHA 4G94A 1PP8F 3QOPA 2LNBA 3SZTA 5FO5A 5HS7A 5FD6A 2JSCA 4KDPA 3HRMA 2O61A 3RJPA 3CDHA 1XDUA 2VOOA 3SQNA 2JPBA 3NRVA 5CVRA 3JW4A 1FYKA 3TQNA 2F5FA 2EA2A 3ABTA 2YX7A 4WCGA 3FXUA 3SZPA 3JTHA 2OQRA 5FD5A 1XCBA 3J80K 3GFJA 2M8EA 1JHFA 3E6CC 3SFZA 1R1TA 4RB3C 1WWXA 1SD5A 1R58A 4NB5A 2DPUA 1XN7A 1QO0D 2VT2A 1Z6RA 1U8RA 2NAZA 4IHSA 3P9CA 4I02A 2L02A 1KU9A 1ZRDA 1YG2A 5KK1A 2RC4A 5LGUA 1XDSA 3KEQA 5ICEA 1TTYA 1IF1A 4FX4A 1HW5A 3H3ZA 4YFKF 4I01A 2L01A 2XHKA 5E8GA 3JAMZ 1YW7A 5ILSA 2NNNA 3P7NA 1P4AA 1QGPA 1BI2A 1TQPA 2H6CA 1J5YA 2V9VA 1K78B 4HV6A 3GW2A 2H27A 1KQ9A 1U78A 3E97A 3K1MA 1U5TA 2K7LA 4TV7A 5H6RA 3L09A 1KYZA 4U0VA 4EJVA 3WGHA 3T8TA 1W7PD 1LB2A 4U0YA 1Z9CA 1L3LA 1B9NA 2V6CA 4ZYHA 2OD5A 4RAYA 2RN7A 1B9MA 4MQVA 3F23A 2VBXA 2MH2A 4KMFA 2VODA 1QPMA 2P7CB 1S7AA 3H3UA 1R36A 2KIMA 4BHCA 2EFWA 2CG4A 1KU3A 3DXJF 1HW1A 3FZVA 2CQKA 3ECHA 5K5RA 2K02A 2P6SA 1FBSA 2Q2EA 3VODA 1KGSA 3R61A 1BI3A 2ZBKA 2CO5A 3I64A 5JI6A 4MTEA 3SXYA 4KNYA 1R1VA 1PUEE 2EFQA 2E7XA 1ON1A 2WC2A 1XSXA 3ZPLA 2FU4A 4R8HA 4ESJA 1ZRFA 2CSOA 1Z7UA 2D1HA 1BOAA 4M6YA 4AIKA 3I58A 1PDNC 2DBBA 2D45A 2IRFG 4NHJA 3R4KA 1GXQA 5ICCA 5L3EA 5JVTA 3HRUA 2G9WA 2P8TA 3K1NA 1FPQA 1F4KA 1U3EM 1IAWA 2LSOA 1OYWA 4WF2A 4BXUA 2RDPA 1ON2A 2UXXA 3F8NA 1P6RA 2QZ8A 4LK1F 4MNUA 1HSJA 5D6FA 5HS9A 1W7PB 3HOTA 4MQ9F 4ZYEA 4JBAA 3CUQC 2EV5A 2MLKA 2PBIA 1USSA 3WTXC 1BI0A 3W6KB 4YIFA 2PFBA 1LEAA 3R60A 4CDGA 4I2OA 2IA2A 3RKWA 4IPAA 3GFIA 4IXAA 2G7HA 5HOOA 5LHIA 4HX7A 3DKWA 4HQMA 2EFNA 4P55A 1TNTA 2Q0OA 5K1YA 2R7FA 3LA2A 1H0MA 1FT9A 1S8NA 1MGTA 3BROA 1FYMA 2VC1A 4CXFA 1IRFA 1DPUA 1FX7A 4OMZA 2AXLA 4Y17A 5FGMA 2BEOA 3ZMZA 4WXDA 2DQRA 1YS7A 2BE5F 1O3TA 2BYVE 2DTRA 3BDDA 4UVCA 3GO5A 1HKSA 1FLIA 5F6FA 4A6DA 3COAC 1TW2A 2DO7A 5H20A 5FFXA 1U5TC 4WX9A 3IWFA 1FP2A 3U2RA 4LLLA 4H0EA 3I53A 5JHUA 3ZN1A 2PEXA 5HLIA 1HKQA 3J7AO 3KEOA 4M9ZA 3RI4A 1WI9A 3TGNA 4FX0A 2H09A 5ED4A 1SD6A 3M9AA 2W57A 3HOSA 4LG0B 1SFUA 1S7OA 3WTWC 3U1DA 4A6EA 1T39A 2Z33A 4DNCA 3B73A 3LQQA 5DYMA 4UHTA 3ELKA 3T8RA 4EJWA 4OIRF 3KZYA 5D4SA 2IPQX 3WGIA 1R5GA 3FMSA 1XSDA 4LFUA 3V8JA 1E2XA 2QQAA 3H92A 2DT5A 1D8JA 1IN8A 1T6SA 2FRHA 3KETA 1IRGA 4L18B 4ZZLA 3Q9VA 2OZ6A 3ERED 1OPCA 4LB5A 2Z5UA 2LF7A 3KP3A 5K5OA 5DUIA 2CGPA 1XD7A 3VOEA 3K1PA 5BMZA 2ZO4A 2L4AA 2OAZA 5FLXZ 1CF7A 2ZMEB 2LKPA 4A2UA 4OU0A 3ECOA 1G6NA 4EQQA 2Z3YA 3KP5A 3KLOA 3E5QA 5ICGA 3HUGA 3E6MA 1F5TA 5D5VB 1XB4A 3LQRA 2HTJA 4CZZA 4ASNA 1R7JA 2ACJA 4RS8A 2HTSA 4XSXF 4HDVA 3RDIA 3FHZA 2P5VA 4O3MA 3KE2A 2GQQA 1OYIA 4EMSA 2KIFA 2MA3A 2K4BA 2L4MA 4M9XA 3MFKA 2OA4A 4P96A 4OIOF 1T2KA 1RUOA 1MDMA 4EM2A 3HHHA 1W5SA 2NRAC 2VBWA 2MD5A 1XSVA 1I6XA 1KYWA 4ZYGA 1LQ1A 4RGXA 1YO5C 3PFIA 4IRIA 5CVIA 1B1BA 2EK5A 2VE9A 5E1ZB 1KU2A 2A69F 2DK5A 5E1XA 1O3RA 1U6GA 2F5CA 1WQ2A 1XMKA 1ULYA 2MLGA 1BBYA 2PN6A 1IUYA 3EYIA 1YS6A 4MTDA 1DPRA 3D0SA 4N9HA 2DQLA 5F64A 1J7KA 3DEUA 3IWZA 3HHGA 1FSHA 3ZN0A 1FSEA 1MD0A 4YIIA 4U88A 2DLLA 1S29A 1IN7A 2R7DA 1PP7U 3NEUA 3MWMA 1R22A 5E18F 3CO7C 2ZNYA 5LGNA 4HF1A 4A5MA 1K7AA 4Y15A 4A0XA 3BP8A 1QNTA 4I98B 4B8XA 1G4DA 1IZ1A 4KIBA 3RKXA 2FBIA 5L3CA 1LVAA 3LWFA 3QRFF 2VE8A 1BN5A 5A2QK 5CYVA 3P9IA 4ESBA 1J2XA 2B0LA 1MZBA 5CVUA 1J0RA 1LDDA 2UZKA 4CHUA 2LF8A 2NYXA 1UFMA 2FXAA 2VOPA 3DFGA 3O3KA 1HQCA 5D5WB 1O7LA 4LMYA 4G8XA 4KUMA 1K78A 5ICFA 4OIQF 1P2FA 2L54A 4L9JA 2W84A 3MQ0A 2O03A 4U7DA 5DCMB 5L3DA 3QU6A 4ZH4F 2GA2A 2HR3A 3GUDA 4KN7X 4U7BA 3F8BA 4HAMA 1Z91A 1U2WA 2BGCA 3ULQB 1I5ZA 1BIAA 2P7VB 4LD5A 3WTVC 1REPC 2MC3A 2CYYA 4LK0F 5E17F 4LLNA 4UVBA 2OU2A 3GZ6A 3I5UA 2QENA 5AONA 3R0JA 1C0WA 4GYGA 2EFPA 4L5JA 2COMA 3ML6A 4HLYA 5LHGA 1UCRA 3CUQB 3WE3A 1WSUA 4R1HA 3L2CA 4UV9A
chains in the Genus database with same CATH superfamily
2XB0X 5E79C 2OZUA 4ETSA 3E5XA 1IJWC 2WA0A 1HW2A 2KRFA 2R0QC 2EZLA 2GIVA 2GZWA 4JQFA 1Y1WJ 4UB6C 2MBFA 2EZIA 3M07A 1QVUA 2PMZN 1KA8A 1TP4A 2QUFA 3K4LA 3QOEA 3VYRB 5LEKA 3CCLI 2NS0A 3EETA 3HTUA 3IH3A 2CW0F 2IVMA 3DKYA 3H0DA 1FBQA 2BXZA 3OYDA 2JZYA 4ENKA 4MEXF 3N4MA 5KAFC 1D1CA 2EIMH 3HRSA 2Q8KA 1JT6A 1MBKA 2ID3A 2HNHA 4RB0A 2DU9A 2V26A 3LSJA 5J8CA 3CJTB 3LA7A 2ISZA 2LYCA 3ZMVA 4E7SA 1PUFB 2R5YA 3QAHA 3MKYB 3LSTA 2E2HJ 2ZJ2A 2GXBA 2X1CA 2AHQA 2DA1A 5M3MJ 2LBFA 2TCTA 5CVVA 5GP9A 4I99C 2CQXA 2Y30A 5JLWA 1FEXA 2V9KA 1O3SA 1Q1HA 4C2MJ 1W7PA 1JTXA 2BOLA 4AIJA 3HPHA 3FXKA 3V7RA 4II3A 5BS6A 3ASNH 1ZGJA 3GTPJ 3FWEA 1AOYA 3C7JA 3LA3A 2DODA 3N97A 4EV0A 1TWAJ 5C3EJ 4PFPA 5DDGA 3V7CA 2BW3A 3NWTA 3V7SA 1B59A 3OS0A 3JRHA 1T95A 4ZC3A 1ODDA 5A2QZ 1IN5A 4MGRA 6PAXA 4WXCA 1UG2A 3CQZJ 5FKNA 5BOXA 5AIPA 1I1GA 2DMPA 1OCPA 5D8LB 2EZKA 2O6GE 3K4JA 2XSJC 2GA1A 2Y0SN 1M1EB 1JGGA 3HOWJ 4A3EJ 2XIGA 3Q9SA 2EFOA 3OYBA 3ZQFA 2OPTA 1X2MA 4CSWA 1Q1VA 3GFLA 2BV6A 4PGHA 5DUKA 2KDZA 4JX5A 3ZQQA 3R6SA 2KFDA 3SDBA 4DYCA 3DF8A 4FETA 5LLQA 5HNHA 3EQLF 3FF5A 1RR7A 4UY8I 2HS5A 1GHCA 1V5FA 3OS1A 1MMAA 1OMIA 2XGXA 4GGGA 3WTYC 3CJNA 2EJRA 3FKIJ 2Z1DA 4HW0A 5E3NA 3CMYA 3AAFA 4EGZA 4ZTFA 3J80Z 4HNUA 3KPHA 2GOMA 1H9GA 1J59A 2QBYA 1J09A 2LLKA 3CC7I 2HKOA 1OYYA 5LHHA 4KIFA 4FHTA 2DFFA 2NXNB 3FX3A 2XAJA 2COBA 1NG7A 1WH7A 3HSRA 1W36D 4R79A 4RGUA 1LJ9A 3A0BC 3BR2A 3KP7A 3E1SA 1BJZA 2X6WA 1G3SA 1LNWA 1XPXA 2CV2A 1XGNA 4DYRA 5JLXA 2KJBA 3DLLF 2DA5A 4DZJA 4YEJA 4IX7A 3QU3A 1WJBA 4RM2A 1Z05A 1JKQC 1B6AA 2L7ZA 3WTTC 4G7ZF 1KU7A 5F1RA 4CYCB 3OOPA 2LRDA 1MIJA 3L9FA 3HSFA 4CYDA 2CMPA 4E7LA 4C2TA 2TRTA 2E1MC 1J9IA 4RDUA 2JN6A 2HZTA 1ZHFA 3H5RA 3A01B 2G0EA 3KCCA 1BR1A 1JJ8C 3REOA 4N9IA 3GLXA 4B43A 4XRSG 1GUUA 1U8BA 3NQOA 4LG0A 3OL4A 4CCMA 3EUKL 2JRMA 3CTAA 4UV8A 2HDWA 5KVRA 3FMRA 1R00A 3LSIA 4QWQA 2EBIA 5LRSA 4Y52J 3O6BB 3AG2H 1L0OC 1EH8A 4F3QA 2UUZA 2WY8Q 2PJRB 2EV0A 4KMUX 3BTJA 2LD5A 2ZCWA 5IPAA 1A5JA 4E7JA 3FXMA 2V6EA 2O8XA 4CO8A 4AU7A 5J40A 4AVPA 4PJNA 1FWZA 4Q4ZF 2F4OB 4XLPF 5E3LA 4E7KA 4PCQA 4Y7NJ 1S72I 2X9DA 4XLCA 3JRDA 2Y69H 3K4CA 3FXRA 2JA7J 1ETVA 3E5UA 3GF2A 2VJIA 3QPHA 5J8FA 4Y13A 2HWVA 1I27A 4A3LJ 2IGOA 2QSFX 4B3XA 1X19A 3VYTB 2OBPA 4XICA 1K79A 1LVKA 1FIPA 1X3ZB 2MD0A 1AKHA 1T08B 4CCJA 2ADUA 1NH3A 3WTZA 5HDKA 2XROA 1EH6A 2HXIA 2H1KA 3ROUA 3OYKA 3H5NA 2TDXA 3ABLH 2L2OA 2P5KA 2O5RA 2ZXIA 1I39A 5LFAA 2OTJI 2IA1A 4C3IJ 4ESFA 2KRCA 2J5PA 3AG4H 5HLTA 2KRHA 4IRHA 4BDZA 1P92A 3LFUA 4B09A 2M9HA 4E70A 3K2ZA 2DJIA 2A68F 2PMUA 2OQGA 5FLMJ 2KP6A 4EM1A 1XGOA 3ABKH 4BHBA 2B7EA 2M87A 1RPWA 3QPSA 2P4WA 4HV5A 1Y56A 3HXLA 1RUNA 3M8EA 3S1NJ 1IV6A 4HLXA 2ZMEA 3V42A 2NS8A 2JVGA 1NG6A 2WB1N 1V4RA 1G3WA 3JCUC 3F21A 3Q0UA 3KYDB 3ZQLA 2RNJA 1JGSA 2F5VA 4HOBA 3TOBA 4BQAA 3IH4A 4BAYA 3PSIA 3J81K 5D5XB 2LP0A 2HKXA 2LC2A 4L0YB 2VXZA 1CGPA 3S2WA 3PO3J 1ZN2A 3G1LA 1CQTA 3EYYA 5HLHA 1ZLJA 1HOMA 1JXSA 1P9QC 2VONA 2P81A 1JE8A 4XKVA 3FXOA 4V2GA 4BH9A 2IA0A 4BDYA 1FP1D 2STWA 2YX4A 4XBFA 2CUJA 3OL3A 4YG2F 3LAPA 2WBMA 2WWYA 4KYWA 1ZTRA 2L0KA 3HL2A 4HF2A 1YW8A 4BKXA 1LUJB 2VPLA 2QLZA 5E3MA 1YYVA 4I0AA 1RRJA 1FZPB 5LRRA 2QM3A 5E20A 1PVEA 1ZGWA 2HPMA 5DM7F 3JRFA 3DBHB 2Y0MA 2IXSA 2R7ZJ 5M5YJ 3BLYA 1VFCA 3WU0A 5EEAA 2HDCA 2W4SA 4M74A 2XV4S 5HVQC 5TRDA 3K0LA 4S05A 2ZFWA 4OOIA 1UG0A 4RB1A 1Y6IA 5ERIA 2STTA 3M8JA 4LG3A 2JT1A 3RPUA 4A5NA 4IJAA 2D1VA 2JK3A 1ZYRF 3KX2A 4XRFA 2M5WA 4AYBN 1NHAA 2V7FA 2KPMA 4JX4A 3MKLA 2DOEA 1MBGA 3SDGA 2ZC2A 2DA3A 4XM3A 1O4XA 1WH5A 3IV5A 2PLYA 2E7WA 4KT5C 4A3DJ 1FYLA 3QWLA 2MC4A 2PG4A 2M30A 1GDTA 1VQNI 1YLFA 2FQ4A 3PUFA 4CICA 2M45A 2V9PA 1P7JA 1DUXC 2IT0A 4BEHB 2K40A 3ISPA 2KKOA 5D4RA 4RGRA 2JUCA 4GYIA 1MW7A 3I59A 3SEZA 2PX9A 2W48A 2DFHA 2FOKA 3CF2A 4KN4X 1USTA 4QSHA 1QRYA 4HX4A 5KNLA 3U9GA 3MZHA 1X1PA 4BNCA 3E6DA 1O57A 3PSFA 4GXOA 3JSPA 3WHCA 5B3SH 2A61A 3IP4B 4JYKA 4XR6A 4EJTA 5EEHA 2FQ3A 1D5VA 3V4GA 3W6JB 2VBYA 2WAFA 1T0FA 3OYMA 1ZARA 3RIRA 2V1NA 1OR7A 4G7OF 3JSOA 2CUFA 5E1WA 1JJ6C 1Y0UA 1UHWA 1UJ8A 2EINH 4XOPA 3MVPA 3BQYA 3O2PE 3BG7A 2R7XA 2ZB9A 2K9SA 2XUBA 2ESNA 2XAFA 2Z9OA 1V3FA 2VC0A 3BPVA 4RMNA 2CQNA 1SD7A 3BZ6A 1UZCA 4BHPA 4PJMA 2K86A 3HSEA 4XN0A 1A04A 1UHMA 2GWRA 4K2EA 2Y75A 4WK8F 5AIQA 2V1UA 3S15J 3F8CA 1T98A 5GTIC 1P4WA 4G9YA 3HEFA 4S04A 3DQVC 3IUOA 2F2EA 2LTPA 1MJBA 1ONVA 1RI7A 4HPQA 1E3PA 3CCJI 3I4PA 3B02A 1XC5A 5BNGA 2VJ5A 1MJ9A 2M3AA 4Y3OA 3GEZA 1TT0A 2HU9A 4AWXB 1DP3A 5KAIC 4KIGA 5B5EC 2LR8A 2RGVA 1VQKI 4OINF 3HZJA 4G12A 4PSWA 4D5CA 2DK8A 1GVDA 2GLOA 1QZZA 4O5VA 3S3NA 4AIHA 2E5NA 4BBRJ 3GTOJ 3I56I 1K4SA 1SD4A 1YW9A 4N4NB 3AKZA 2YUSA 4HF0A 2QQBA 3TO7A 1GXPA 3WE2A 1WZ2A 4IQ4A 3AL0C 3CCVI 2L9SA 4A3CJ 2A07F 1FY7A 2XAHA 2UXNA 2E36A 4L5EA 1N78A 5DCMA 4WXHA 5FFZA 4N4OB 3DU5A 2W00A 5TGTA 1XMAA 5TJJA 2EIKH 3CP8A 1W5TA 2WTEA 1QZYA 1BI1A 2ZXJA 2FNPA 1ETXA 4HEA2 3I71A 1ZREA 1MDMB 2CS3A 2HYGD 3IAS2 5IOYA 4BE1A 3LAJA 3J81Z 1YIOA 2H94A 3BR6A 5F0CA 3BR1A 4L5IA 4U0WA 3OSFA 2KDOA 1IW7F 2WV0A 3M1EA 4HDUA 1R49A 4A0YA 2CH0A 5D8KB 4A69C 3S3MA 2E1CA 3ESWB 3JRGA 3JTGA 1BJAA 3OYNA 1K61A 3HKZN 5HDNA 5IP9J 2XPUA 4RBOA 1Y1VJ 2W1OA 4PJ0C 1VQ4I 1O7FA 5GADJ 3LFKA 2FE3A 2ZMEC 4M73A 1X3UA 2A6EF 4E7IA 5DTDA 4Y33A 5DEQA 3SEQA 3HC7A 1VQ9I 4BY7J 2DW4A 2HOEA 2GM4A 3KYCB 4EM0B 1J75A 3ZQHA 1FBUA 3KZZA 4LGWA 1A31A 3WTSC 4KT6A 3DTKA 5D6EA 1K4TA 3HYIA 1DDNA 2BY3A 5IT9K 3BY6A 2K85A 4M3GA 4DIQA 4YELA 2IGMA 3G6EI 3OYAA 5E3OA 5DCFA 2GAUA 3MEXA 4BACA 3LSKA 3G1OA 2KZGA 3F8MA 1LE8B 1SFEA 1W5CC 2PMZA 3WTUC 2DN0A 4CH7A 4NQWB 3DPLC 3RYPA 4Q48A 1S7EA 2K5CA 3Q0WA 2FD5A 1EA3A 3CUQA 3KIOA 1ZH5A 1XX5A 3RYRA 3GXOA 1XS9A 3OR1C 4L0ZB 2H8WA 4BUPA 2XAQA 2KZVA 4JOMA 4EVIA 2Y31A 1JHHA 1IXSB 1A6IA 4HX8A 4P5OA 3OV8A 3A0HC 3ZMDA 4XLEA 1O3QA 4EGYA 1ETQA 1YFHA 3TP3A 4RAZA 2LH9A 4KICA 2FSWA 2O3FA 3G71I 3WU1B 2EA4A 3ZMUA 1TNSA 3G73A 2XF6A 4IHYA 3S1QJ 1XGMA 1K6OA 2OCEA 2FEZA 3CLQA 4L9TA 4CCNA 2ZXHA 4XL9A 5CPRB 4MIMA 1GV2A 2LY9A 4P9UA 4M71A 1ZGAA 3ZP5A 2DMUA 4ZDPA 3IRQA 3I9V2 1AWCA 2WADA 1WJ5A 2K9NA 2XDVA 3BJ6A 3BPXA 4XKBA 1R23A 2VBZA 1EV7A 1PUFA 1EJ9A 1SFXA 4UNOA 5LBQA 2HEOA 1XG1A 1JKOC 2LMDA 1WRJA 4GCVA 2X0LA 2AS5F 4XLAA 2Y0SA 2KJCA 2NNYA 3S8PA 3KP4A 1TWGJ 2A6HF 4HSTA 3RTRA 4QLCU 1IN6A 2ELJA 1MMDA 1QQIA 4ZDLA 3CCUI 1HDPA 2Z16A 4J00A 1OR7C 4DW6A 3DKXA 3E6BA 2E2IJ 4BU2A 1RIOH 4JX6A 2BHYA 3SHFA 4OWRB 4AVZA 1AHDP 3IRRA 4OMYA 2KHMA 4PZJA 2PJPA 1LDKB 2VASA 1MH3A 1ACIA 3RQIA 4CCOA 5C44J 2VIXA 2VKDA 3D5LA 3T1BA 1IDYA 3G4SI 1TQIA 2RKHA 1YX5A 3OYEA 3EPZA 3JRBA 3MZYA 4ZZDA 1S6LA 1Z3YA 3F9KA 2A5YB 1MSEC 3EDPA 2F6CA 2XRNA 2E1MB 5K5QA 2R3SA 4BE2A 4E7ZA 1H8AC 4MO7A 3PQKA 2RREA 4IRGA 4DQ2A 4LLGF 4CUGA 4EJUA 3C2HA 2DYSH 3AG1H 3VSLA 1JKRC 5IT3A 1Y0NA 2BY1A 2VPRA 3DEWA 4KA4A 4RLFA 2YS9A 4RGSA 2YSRA 2R5ZB 2M2EA 1MNMC 1TLHB 4EJOA 2K9MA 5K7HA 2W7NA 2K27A 4M3FA 3TP0A 4AM3A 5BQTA 2KISA 2LFBA 5HODA 2J5OA 5EZHA 4HZFA 2X4HA 3ZMTA 3C18A 2HQRA 3R0AA 1KQ8A 5EEGA 2M0CA 3G3ZA 3PNVA 5DD4A 3CP2A 2V4JC 3S1MJ 2K4JA 4BBSJ 3IKTA 1LFBA 4PUSA 3TKYA 2ETHA 2CW7A 3K69A 2E71A 3CC4I 3H1CA 2XASA 1TBXA 3A4CA 4V2FA 2V79A 1U5TB 5LEJA 2L3DA 2GBYA 3ABMH 4HYEA 3C2GA 5FLVA 3T0YA 1B8IB 1IDZA 3L2UA 4RAFA 5JR3A 1OCOH 4X1EA 1D3YA 1ZK8A 3CJRB 1BC8C 1ZRCA 3NARA 1BW5A 4UB8C 3LSRA 3ZQ7A 1IRXA 3TDZC 3E3VA 3G1MA 2VN2A 3GBGA 5ILUA 4CGZA 5K7ZA 4CYCA 2Q1ZB 1I1SA 5B1BH 3GTKJ 1WCMJ 4KJZA 1VQPI 3TW7A 3CC2I 3OYIA 2O0YA 2JTVA 1VI0A 5IT9Z 3A01A 3OSGA 4IF4A 4PGGA 2L7MP 4OAZA 4B3AA 4ABZA 1D1AA 4Q5SF 3BCAA 5CVJA 2G7UA 3RSNA 3CLOA 3K7AJ 4RB2C 2YR2A 3BJOA 4KFCA 4M72A 3IKVA 1YQAA 3OYCA 2D2WA 5JFRA 1R5HA 1BIBA 2PMHA 2JJ7A 2NOGA 1N25A 2XKPA 4I09A 3F8FA 3BWGA 2BVMA 5EZGA 3IC7A 2YU3A 2MABA 2DA4A 2EB7A 2VKHA 4XKCA 5EG0B 2PJRA 5DD8A 4BJ6C 3H5AA 4M3BA 4BGDA 2DPDA 4M9SA 3OIQA 1SVMA 1A6QA 1YE9A 2F5EA 4YFNF 3ZQGA 5L3FA 3CCRI 1WKMA 2Q2EB 3LSPA 1YJNI 1PYVA 1STZA 1MH4A 3H9QA 1SAXA 1VF9A 3OWTA 3F3XA 3HB9A 5FLXK 1Z67A 1YHQI 4FASD 2E1OA 3CUOA 3ZRGA 2VXDA 2X6XA 4XK4A 5FKLA 5EGOB 3RQ4A 1OCCH 1ZAOA 2YPRA 4FT8A 3BTIA 2HFHA 3FDYA 1OISA 5M3FJ 2E1NA 4JK1X 4IHVA 1E0EA 1LFUP 1MBFA 2P6TA 2OF7A 1P4XA 1R4MB 2NVUB 2DMNA 2LVSA 2CV1A 2DOFA 3TEDA 3F6VA 3AG3H 2JWTA 4M3DA 4D5FA 1N77A 1QZEA 2F48A 5FB2A 1QHHD 4ZJZA 1G8XA 1DP7P 2IS1A 2R92J 5F0HA 1G3YA 2P5LC 4L9NA 1OLTA 1NK2P 2H6BA 3MCZA 4AD9A 4X6AJ 5M5XJ 2YU9J 1SMYF 2V1DA 2E60A 2GXAA 1F43A 4ZYDA 4IL6C 1RC9A 1OKRA 3S2DJ 1JT0A 2DAOA 3L7WA 3SZGA 4M6XA 2FNAA 3S1RJ 2FF4A 1SMTA 1UAAA 2W24A 5BPIA 1HBXG 2BZTA 3ZMSA 1BW6A 4LITA 2RVCA 1FMWA 1YX3A 4XSZF 3F0CA 2ID6A 3C1DA 1EF4A 4AYBA 1SFOJ 2MGQA 2QBYB 3CCYA 3RPQA 4ENJA 1BL0A 2O9LA 4MHGA 1RR8C 4F93B 4G6QA 3TDUC 3MKZA 1FTZA 3B6AA 3HOXJ 1ORKA 2IJLA 1EKEA 4OIPF 2L9RA 1APLC 3LOCA 4HRIA 3BC8A 1ENHA 3H35A 4XKWA 3P9KA 4XMYA 1GVJA 3MZ8A 4LB6B 3O8HA 4XLNF 4GFBA 5E8IA 1B72B 5GPAA 1JKPC 4NDLA 5LGTA 4GO1A 2M4KA 4IHTA 3M1CA 2R7RA 2FA5A 2JVHA 2ZNZA 3GTJJ 1YITI 2A3SA 2E34A 4I0BA 3GX4X 2RQPA 3KP2A 5IP7J 1RZ4A 2Y48A 1ETOA 3DBRB 2UWMA 3BZKA 4LJZF 3HIFA 1AA7A 2IP2A 1KQ0A 1WI3A 2MG4A 3M7GA 1FTTA 3T5XA 3QPTA 3GFMA 4YFXF 3HPGA 3ERMA 3GMEA 3IHUA 2LDUA 3CCQI 3EUHA 2AO9A 4O6JA 1DGWY 3VEPA 3CMMA 1Y8QB 3KP6A 4BEHA 4WWCA 3D5RC 3F22A 1Y39A 4BJ5C 3GZ5A 3BOQA 1QBJA 1VTNC 1DGRM 4IOAF 3PFYA 3L2QA 2DA7A 2ISYA 5KCMA 2DCEA 4IQJA 1OCRH 3GYHX 1EH7A 4IVNA 5L3BA 3I4NJ 4KITB 4L9VA 2JQ7A 2ESHA 3K4KA 3I0TA 4HA8A 1UB9A 5CJ9A 3SFIA 4IKFA 2GXGA 3QP5A 4P9FA 4N0BA 5CQEA 1DU6A 4J19A 2DFIA 2EWNA 4S0HB 4QPOA 4Q47A 2EIJH 3AL0B 3ABUA 3DLAA 3C3WA 4XRSA 1HA8A 1LFPA 3PQJA 4HNTA 3FBIB 3V8LA 5CLSA 5GPCA 1MBHA 2N8GA 2X1DA 3M8FA 4ENNA 4GDFA 2PI0A 1Z7LA 2JRTA 1D8KA 5HLGA 3GVAA 2KLOA 5BPDA 3HOUJ 3Q5FA 3OMYA 1OQYA 1D1BA 3GZNB 1RNLA 3FKJA 2KIUA 3HOVJ 4ON0A 4UXNA 4F7ZA 1WJDA 5F08A 1ZG1A 4F92B 2QQ8A 2ZKZA 3HM5A 2FBKA 3CCSI 3BJAA 4BY1J 1FOKA 3K6GA 2R7UA 1S3JA 4ENMA 4MEYF 1SVOA 3TO6A 1LEBA 1HXDA 3FM5A 2QGUA 3F6OA 2JUGA 2BVLA 3CO6C 1TWHJ 2QVOA 2HQNA 4BYYA 1A35A 1YJWI 3BQZA 2VQCA 2XSDC 1R6RA 3DP7A 3FXQA 4B47A 3M3YJ 1FOWA 1MNEA 2CU7A 2QQ9A 2W85A 2F5DA 3QP6A 3HRTA 3RKYA 1DU0A 1WGXA 4BE0A 1U9OA 4UVAA 2C6YA 1BC7C 3HKZA 3LMMA 1TQMA 3GWZA 2V1XA 1ITYA 1S5LC 2DFEA 4UUTA 2HVRA 1GV5A 3IH2A 2HPIA 2IW5A 1Z3XA 1DQUA 1WJEA 1Z0XA 5CKTA 3JAMK 2P0WA 1YRNB 3FBNB 5GAGJ 4I7HA 3KLNA 3I54A 3F72A 1QPIA 4UUVA 5D5UB 2QYOA 2M4GA 1MKMA 1E17A 2QSHX 3RZOJ 3BTLA 4A0ZA 3D1NI 1H9TA 3G2BA 3TO9A 3N05A 2ELHA 2H8RA 4I76A 3DV8A 5IP6A 4G7HF 2HGCA 3LSHA 3PM1A 5ILVA 3TOAA 3WGGA 2RV8A 4H4KC 2FOWA 1Z1DA 3IL2A 2F4IA 3HTSB 3QPLA 4DYQA 4A12A 1CF7B 2XKOA 1BR4A 1HSTA 2X48A 3K9TA 1Z6TA 5IYDJ 3U21A 2RQQA 2R7TA 1R1UA 1W4MA 1FC3A 1G3TA 2BY2A 2VI6A 5F0FA 3DTIA 1LDJA 3HUGB 4HQEA 2OC6A 1W36C 3MKWB 2E5ZA 4HBLA 4MFEA 1ZG3A 2XVCA 1T38A 3WG9A 3BZCA 1B4AA 2FMYA 5F1JA 2XGCA 4UUSB 1RKTA 4D0PA 2KMUA 1ZG5A 2ZJQF 3FM3A 3L00A 1SFKA 2WAEA 4XRMA 1MJAA 2XAGA 3ZQIA 3I59B 1FNNA 3DCFA 5HDGA 3KFWX 2IGNA 3SYTA 1G2HA 3W6VA 3MAJA 3WODF 1LPQA 1IXRC 1TW3A 2FX0A 4G6TB 4ZYAA 4F52A 4QTRA 4G6DA 4NC8A 3V8KA 4Z2YA 2XF7A 2DYRH 2K3FA 3FMQA 3VB2A 3W2WA 4A3FJ 1LE8A 1F9NA 2CFXA 2VT3A 1ZLKA 5J4VA 2IS2A 1XCVA 2Z99A 2JPCA 4NQWA 1BM9A 5HS8A 1IN4A 5DM6F 4A93J 2DI3A 2M7BA 1WHUA 1V55H 2EV6A 5DV5A 3E0JB 5H6QA 3I55I 1U9NA 2R4GA 4RA2A 1TWCJ 3OYLA 2W25A 2IS4A 1IXCA 2PQ8A 2FMLA 3VFZA 5J6XA 2K9LA 1F1ZA 5L3GA 2LKXA 4P1WA 2NS7A 3PO2J 2X6YA 2CWEA 2MH9A 4W97A 4PDKA 2BBYA 2M1BA 1YTYA 2HYFA 1XGSA 2VUMJ 1HKTA 3DPTA 2QWWA 2FBHA 2ECBA 4G94A 2HVQA 1VQMI 2CQ7A 1PP8F 3QOPA 2LNBA 3SZTA 5FO5A 5HS7A 5FD6A 2JSCA 2ECCA 1FJLA 4KDPA 4CCKA 3HRMA 5J1UA 4PJJA 1P7IA 2O61A 3RJPA 3DEEA 3L2RA 3CDHA 1X4PA 1XDUA 3VWBA 3OIPA 4NC7A 4C30A 2VOOA 2HOTA 1FMVA 1X2NA 4D9JA 3SQNA 4F55A 2JPBA 2O7OA 2LG4A 3NRVA 3DPUA 5CVRA 2M8GX 5FJ8J 2XRLA 3JW4A 3TL4X 1FYKA 2NVQJ 2QKMB 1AU7A 2DMQA 2LKSA 3TQNA 2F5FA 1X1DA 2IAIA 5EDNA 2LK2A 3KZIC 2EA2A 4A3MJ 3ABTA 2YX7A 4WCGA 3HJEA 3FXUA 3I3LA 2OV7A 3SZPA 2MW8A 3JTHA 3KEYA 1KONA 2OQRA 3PIOF 2ZSHB 5FD5A 5GAHJ 1XCBA 3J80K 3GFJA 2M8EA 1JHFA 4D1QA 1H89C 3E6CC 3SFZA 1R1TA 4RB3C 3W3CA 3S32A 1WWXA 2IEKA 1QA6A 5IYBJ 1SD5A 3X2QH 1I3QJ 3QYBA 3VPRA 3S16J 1R58A 4NB5A 2DPUA 1XN7A 4BJTA 1QO0D 2VT2A 1Z6RA 2QEXI 2FJ1A 1U8RA 2NAZA 1KZHA 4IHSA 3P9CA 4I02A 4DJAA 2L02A 1KU9A 1ZRDA 3QQAA 1YG2A 3RCOA 5KK1A 2RC4A 5LGUA 2AQFA 5JVGF 4IHWA 1XDSA 3KEQA 2R5ZA 1Z21A 1TTYA 2KT0A 5ICEA 1IF1A 5FRMA 4FX4A 1HW5A 3H3ZA 4YFKF 4I01A 2L01A 3CF5F 2XHKA 3CZ6A 5E8GA 3JAMZ 1YW7A 1E3OC 5ILSA 2NNNA 4DBRA 3P7NA 1P4AA 1QGPA 1BI2A 3B6CA 2QCOA 3TBIA 1TQPA 2H6CA 1J5YA 2V9VA 3K10A 5J47A 4BS9A 1K78B 4HV6A 1T0FC 3PNYA 4NBQA 1HCRA 3GW2A 2EZHA 1V5GA 2H27A 3K2AA 2KIQA 4XLFA 1KQ9A 1U78A 3PUBA 3E97A 3K1MA 1U5TA 2K7LA 3UNGC 2X6OA 1TWFJ 4TV7A 2ELKA 2OJED 5H6RA 3QODA 4EEFG 3L09A 1KYZA 4U0VA 2X51A 4EJVA 1B8IA 3WGHA 3T8TA 1W7PD 4BXFA 1LB2A 1X1AA 1TT5B 4U0YA 1Z9CA 1WPKA 1L3LA 2WV1A 1B9NA 1T33A 2V6CA 4ZYHA 2OD5A 2QF7A 4RAYA 5FRNA 2RN7A 3L2VA 2VB6A 1B9MA 4MQVA 3F23A 2VBXA 3NWSA 1I50J 2MH2A 2HI3A 4HSRA 3A1YA 4KMFA 2VODA 1JTYA 3S14J 1QPMA 2P7CB 4CZCA 1S7AA 3H3UA 1R36A 1QU3A 5F27A 2M7AA 2IS6A 1MSFC 3KYLA 1ETKA 2KIMA 3H3VK 2DA6A 5C4XJ 4BHCA 2L9VA 2EFWA 2CG4A 2ZJPF 2DDAA 2X85A 1KU3A 3DXJF 1HW1A 2CFOA 5DS9A 5EG0A 3FZVA 1VQ8I 4RLQA 2M0MA 2CQKA 5FKMA 3ECHA 3JREA 2DDBA 1I3AA 3GTQJ 4A3GJ 5K5RA 1SANA 2K02A 2P6SA 3FISA 1IC8A 1FBSA 4PK4A 4E7HA 2WAQN 3ZOBA 4XONA 4NUBA 2Q2EA 1X1BA 1X3WB 3VODA 3OYGA 1KGSA 3R61A 1HC8A 1BI3A 2ZBKA 2CO5A 3I64A 5JI6A 2H1LA 5EGOA 4MTEA 3VYSB 3SXYA 4KNYA 4B48A 1R1VA 1PUEE 2EFQA 2E7XA 1ON1A 2WC2A 1RKWA 1XSXA 4RM3A 1WVRA 2FU4A 1IUFA 3ZPLA 2HDDA 4R8HA 1W1WE 4ESJA 3CMAI 1ZRFA 4W1UA 2CSOA 1Z7UA 2VJ4A 2D1HA 4DZPA 1BOAA 1VNDA 4D7NA 2VLAA 4M6YA 1GLNA 3I58A 3WHBA 4AIKA 1PDNC 2ICWG 1ZQ3P 5J3LA 2DBBA 2D45A 2IRFG 2AQEA 1QHGA 4NHJA 3E7LA 3R4KA 1GXQA 5ICCA 5L3EA 1WJFA 3K4BA 5JVTA 3PJRA 4RAGA 3HRUA 3GLLA 2KQRA 3JRAA 1GT0C 2G9WA 3LSMA 2XAUA 2P8TA 3K1NA 1FPQA 3IAM2 4IO9F 1F4KA 1VZ0A 1U3EM 3OYHA 1IAWA 2LSOA 4FTHA 2UV1A 2R5YB 1OYWA 4WF2A 1JI8A 4BXUA 2RDPA 1ON2A 2UXXA 3F8NA 1P6RA 2LBFB 2QZ8A 4LK1F 3OYJA 4MNUA 1HSJA 2E35A 5D6FA 5HS9A 5EYRA 4C3JJ 3LNQA 1W7PB 3HOTA 4MQ9F 4ZYEA 4JBAA 3CUQC 2EV5A 2CUEA 2FUG2 2MLKA 2DJNA 2PBIA 4ANJA 1USSA 3WTXC 1BI0A 2XGEA 2VQLA 2WB1A 3W6KB 1K83J 2R7QA 3GTGJ 2VKEA 1V5EA 1XMXA 4DBQA 2BW3B 1MMNA 2A6TA 2L5QA 1TZLA 2GOXB 4YIFA 2PFBA 1LEAA 3R60A 4CDGA 4I2OA 2IA2A 1MMGA 3FHNA 4YIRX 3RKWA 1B72A 4IPAA 3GFIA 3LL7A 2DMTA 4IXAA 2G7HA 5HOOA 3BG3A 5LHIA 4HX7A 3DKWA 4HQMA 2EFNA 3GTLJ 4P55A 1TNTA 2Q0OA 2CJJA 5K1YA 2R7FA 4CCLA 1WJCA 4B1RA 1D5YA 3LA2A 3CCMI 5HNFA 5J1RA 1H0MA 1FT9A 1S8NA 2AXTC 1MGTA 2CV0A 1V54H 3Q3SA 4B44A 3HG9A 3BROA 1FYMA 1VQ6I 2VC1A 4CXFA 1IRFA 1DPUA 1FX7A 4C9YA 4BXXJ 3TMOA 3JR9A 3OY9A 4OMZA 2AXLA 3Q0VA 2BXYA 1R9TJ 1FOYA 4Y17A 1OJLA 2BEOA 2F4MB 5FGMA 3ZMZA 4WXDA 2DQRA 2K9QA 2HXOA 1YS7A 2BE5F 1X1CA 3ZR8X 3K4MA 2BYVE 3ZQCA 1O3TA 1RESA 2DTRA 3BDDA 1YOVB 1ZKGA 4UVCA 3GO5A 4GRIA 2QA4I 1ERDA 1HKSA 4IZZA 1FLIA 3HOZJ 5F6FA 5IOZA 5EJCA 2Z2SB 1VQLI 4A6DA 2CRGA 3COAC 1TW2A 2DO7A 2L7KA 5H20A 1D0ZA 4ZTJA 4FQGA 3MMYB 5FFXA 1U5TC 1R71A 2XB5A 3WG7H 4BQOA 2JA5J 4BL0B 4WX9A 3IWFA 1FP2A 3U2RA 5B66C 3OYFA 1F36A 4LLLA 4H0EA 1UHSA 3H9GA 3I53A 5JHUA 3ZN1A 2PEXA 5HLIA 5B1AH 1HKQA 4NC6A 3LSGA 3C2BA 3BG5A 3J7AO 5CQGA 4ZDOA 3KEOA 4M9ZA 2OTLI 3UKGA 3RI4A 3HOYJ 3CJQB 1WI9A 3TGNA 3RPUD 3HDDA 4FX0A 2H09A 1W0UA 5FROA 2MSYA 5ED4A 1SD6A 3M9AA 2W57A 2DA2A 5K7FA 3HOSA 4LG0B 3PIPF 2JSPA 1TL8A 1SFUA 1S7OA 1HF0A 3WTWC 3JRIA 3U1DA 1TC3C 2O8KA 4A6EA 1T39A 2Z33A 3ZGKA 4DNCA 3B73A 3K70C 3LQQA 5DYMA 4UHTA 1ZR4A 3ELKA 2LY1A 2Y9ZA 3T8RA 1JUSA 2ZSIB 2ZJRF 4EJWA 3JRCA 4OIRF 2Y2ZA 3P5JA 3KZYA 5D4SA 2NVTJ 4M6VA 2IPQX 5FKOA 1IRZA 4IHXA 5EF6A 3WGIA 1R5GA 2L9NA 2VQHA 1OCZH 3FMSA 3SJMA 2HZDA 1XSDA 2LY2A 4LFUA 2DT7B 2EPFA 5J4YA 2EILH 3FXLA 1QVTA 3V8JA 1E2XA 1AKHB 4XOTA 2QQAA 3FK7A 3H92A 2MFZA 2DT5A 1YRNA 5IY5H 1D8JA 1IN8A 2R7SA 1T6SA 2FRHA 2JMWA 5IYCJ 4FE4A 3KETA 4F91B 1MMSA 1IGNA 4XIDA 1IRGA 1A36A 2NVYJ 4L18B 4ZZLA 1BOBA 3GCMA 3Q9VA 4U87A 2OZ6A 4PSXA 3ERED 3CD6I 4D7MA 1IG7A 1OPCA 4QIWN 5JHFA 4LB5A 1VQ5I 2JA8J 2Z5UA 2LF7A 3KP3A 5K5OA 3FXJA 5DUIA 2CGPA 1XD7A 2BY0A 3K1PA 3VOEA 4E4HA 1NK3P 5BMZA 2ZO4A 2L4AA 4V19K 5H2FC 2OAZA 3MN2A 5FLXZ 1CF7A 3CDIA 1RETA 2ZMEB 2LKPA 4A2UA 2DOAA 4OU0A 3ECOA 2DTZA 1G6NA 3ONQA 4EQQA 2Z3YA 1FOXA 2K3PA 2CW8A 3DWLE 3KLOA 3E5QA 3KP5A 5ICGA 1HLVA 9ANTA 1FIAA 2B9SA 1SVLA 2CUZA 3HUGA 3E6MA 4AUXA 1MNDA 1PJRA 3RKQA 3VSKA 1F5TA 1D0YA 5D5VB 3BG6A 1XB4A 3LQRA 2HTJA 4CZZA 4ASNA 1R7JA 1I6HJ 2A5WA 4UUSA 2ACJA 4RS8A 1H88C 2HTSA 4XSXF 2HVSA 5LD2C 4HDVA 2B63J 3RDIA 4B4CA 3FHZA 2P5VA 4C2UA 4Y4RA 4O3MA 3KE2A 2GQQA 5TISC 1ZELA 1OYIA 4EMSA 3W2AA 3FIWA 3OOUA 3CDLA 1UMQA 1OFCX 2KIFA 2MA3A 2QSGX 2E19A 2K4BA 1IV8A 2L4MA 4M9XA 3MFKA 3O8GA 4EATA 2OA4A 4P96A 4OIOF 1T2KA 1RUOA 3J7ZI 1MDMA 4EM2A 1R5ID 4A3JJ 3HHHA 3HBLA 1W5SA 4DOZA 5GTHC 1YIJI 3VDXA 3U1KA 3S3OA 4HG2A 1ZR2A 4IEJA 3L2WA 2M34A 2NRAC 2JA2A 2VBWA 4M3EA 4II2A 2MD5A 4PFOA 1XSVA 2VL8A 1I6XA 1LKXA 1KYWA 4ZYGA 3HGYA 1LQ1A 3OIOA 4RGXA 2XGDA 3PFIA 3PNTA 1ETYA 3DU6A 1YO5C 2VJJA 4IRIA 2ZXWH 4AC0A 1ETWA 2HOAA 3M4OJ 3ZCOA 4FCYA 5CVIA 1B1BA 2EK5A 3DBLB 2VE9A 3CMEI 2JA6J 5E1ZB 1KU2A 2A69F 2DK5A 1W0TA 5E1XA 2GIZA 1O3RA 1U6GA 2KL4A 2HYJA 2F5CA 1WQ2A 3PL8A 1XMKA 3NAUA 4A3BJ 5J1YA 2R7OA 2IGKA 1ULYA 2MLGA 1BBYA 2PN6A 3H36A 2HOSA 4OAYA 1IUYA 3EYIA 1YS6A 4MTDA 1WFXA 1DPRA 3H9JA 3D0SA 3J7YJ 4N9HA 1SAUA 2DQLA 3W2VA 5F64A 3BTCA 1SC7A 1J7KA 3DEUA 2VQGA 3BR5A 3BT9A 3IWZA 3HHGA 2VKVA 1FSHA 1XTAA 3ZN0A 1D0XA 1FSEA 1MD0A 4YIIA 3A2KA 4U88A 2DLLA 1S29A 1IN7A 2EH3A 2R7DA 1PP7U 3NEUA 3A03A 2HQAA 4ITVA 3BCBA 3MWMA 3OS2A 1R22A 5E18F 3CO7C 1IO2A 3QYEA 2ZNYA 3ASOH 5LGNA 4HF1A 4A5MA 1K7AA 3I4MJ 4Y15A 4FISA 4A0XA 3BP8A 1MBEA 2I8DA 2QKLB 3DTEA 1QNTA 3UR3C 4I98B 3GTMJ 2W82A 1Z77A 4B8XA 1Y8RB 1G4DA 1IZ1A 4AIDA 2RAEA 3H0GJ 3S93A 2XC7A 1R4NB 4KIBA 4A3KJ 3EUHC 3RKXA 2FBIA 5L3CA 1LVAA 3LWFA 2CQQA 1G59A 2L7FP 4X0GA 3QRFF 4J01A 2VE8A 1BN5A 4Z6YA 5A2QK 5CYVA 3P9IA 1SEUA 5KHDA 3VYUB 3A02A 4ESBA 1J2XA 1MBJA 2B0LA 1MZBA 5CVUA 1J0RA 1LDDA 2UZKA 4CHUA 2LF8A 2OCCH 4JP0A 1WJAA 2NYXA 1UFMA 2FXAA 2VOPA 2I10A 3DFGA 3O3KA 2MYSA 3J7AY 3S2HJ 1HQCA 5D5WB 1O7LA 4LMYA 4XN3A 1VQOI 4G8XA 4KUMA 1K78A 3AFHA 3CCEI 5ICFA 4KISA 3BG9A 4OIQF 1P2FA 2L54A 3TW6A 4L9JA 2W84A 3MQ0A 1VQ7I 2O03A 4U7DA 4XNFA 2Y9YA 5DCMB 4DGWB 5L3DA 4XLHA 3RZDJ 3D5SC 4PJLA 3QU6A 2E2JJ 2D5VA 3S17J 4ZH4F 2WY7Q 2GA2A 4C3HJ 2LREA 2HR3A 3GUDA 4KN7X 1X4OA 4LIVA 5F04A 4U7BA 3OR2C 4LIUA 2EQRA 3F8BA 1N75A 2DT6A 4HAMA 4BQNA 2RNGA 1YI2I 3MD2A 2I5UA 2OUMA 1Z91A 1U2WA 1T56A 2BGCA 3ULQB 1I5ZA 1BIAA 1U0JA 3HGGA 3FK6A 2P7VB 2WAQA 1HDDC 4LD5A 1JUMA 2XPWA 3WTVC 4XORA 1OCTC 2X1EA 1BA5A 1S9HA 4I6ZA 1REPC 2BHZA 2LOOA 1NTCA 2MC3A 2NOJB 3BR0A 1T8IA 4FE7A 1POGA 4BQQA 1BR2A 2NVXJ 2CYYA 3K4NA 4QPQA 4LK0F 2ME6A 2XF5A 4LLNA 5E17F 4UVBA 5C4JJ 2OU2A 4XQFA 2ME0A 3EUAA 5FKKA 4HNVA 3GZ6A 4LOCA 2HQ5A 2R7VA 3I5UA 2QENA 3QYFA 5AONA 3R0JA 3L1PA 4A3IJ 1C0WA 4MFDA 1X58A 3CESA 4GYGA 4MLOA 2EFPA 1E3HA 2XPVA 4L5JA 2COMA 3ZXSA 5M5WJ 2DXIA 3BR3A 3K70D 4IOCF 3ML6A 4HLYA 4NNJA 2ZFUA 2R93J 4YRVA 1JUPA 5LHGA 2IBDA 1UCRA 2R7WA 3CUQB 3WE3A 1YJ9I 5GAEJ 2A05A 4CA0A 1WSUA 1K6YA 4R1HA 1UELB 4E6KG 3L2CA 3WU2C 4UV9A
chains in the Genus database with same CATH topology
2OZUA 4ETSA 3E5XA 1HW2A 2KRFA 2GIVA 2GZWA 4JQFA 2MBFA 1KA8A 2QUFA 5LEKA 2NS0A 3EETA 3HTUA 2CW0F 2IVMA 1FBQA 2JZYA 4ENKA 4MEXF 3N4MA 3HRSA 2Q8KA 4RB0A 2DU9A 5J8CA 3LA7A 2ISZA 3ZMVA 3QAHA 3LSTA 2ZJ2A 2GXBA 5CVVA 1O3SA 1Q1HA 1W7PA 4AIJA 3V7RA 5BS6A 1ZGJA 3FWEA 1AOYA 3C7JA 3LA3A 3N97A 4EV0A 5DDGA 3V7CA 3V7SA 1B59A 1ODDA 5A2QZ 1IN5A 4MGRA 6PAXA 4WXCA 5BOXA 5AIPA 1I1GA 5D8LB 2O6GE 2GA1A 2XIGA 3Q9SA 2EFOA 3GFLA 2BV6A 4PGHA 5DUKA 3R6SA 3DF8A 5LLQA 3EQLF 3FF5A 2HS5A 1GHCA 1OMIA 2XGXA 4GGGA 3WTYC 3CJNA 2EJRA 4HW0A 4EGZA 3AAFA 3J80Z 1J59A 1H9GA 2QBYA 2HKOA 1OYYA 5LHHA 4KIFA 4FHTA 3FX3A 2XAJA 3HSRA 4R79A 4RGUA 1LJ9A 3KP7A 1G3SA 1LNWA 1XGNA 2KJBA 3QU3A 1Z05A 1B6AA 3WTTC 4G7ZF 1KU7A 5F1RA 3OOPA 3L9FA 3HSFA 4CYDA 1J9IA 2HZTA 1ZHFA 3KCCA 3REOA 4N9IA 3GLXA 3NQOA 4LG0A 3CTAA 4UV8A 5KVRA 3FMRA 1R00A 4QWQA 5LRSA 3O6BB 1L0OC 1EH8A 2EV0A 4KMUX 2ZCWA 2O8XA 4CO8A 4AVPA 1FWZA 4Q4ZF 4XLPF 4PCQA 3FXRA 3E5UA 3GF2A 3QPHA 5J8FA 4Y13A 2HWVA 1I27A 2OBPA 1K79A 2ADUA 3WTZA 5HDKA 2XROA 1EH6A 3ROUA 2TDXA 2P5KA 2IA1A 4ESFA 2J5PA 4IRHA 1P92A 4B09A 4E70A 3K2ZA 2A68F 2PMUA 2OQGA 4EM1A 1XGOA 4BHBA 2M87A 2P4WA 4HV5A 1RUNA 3M8EA 4HLXA 2ZMEA 1V4RA 1G3WA 3F21A 2RNJA 1JGSA 4HOBA 3TOBA 4BQAA 3J81K 4BAYA 5D5XB 2HKXA 4L0YB 2VXZA 1CGPA 3S2WA 1ZN2A 3EYYA 5HLHA 1ZLJA 1JXSA 2VONA 1JE8A 4BH9A 2IA0A 2STWA 1FP1D 2YX4A 4XBFA 4YG2F 3LAPA 2WWYA 4KYWA 4HF2A 1YW8A 2QLZA 1YYVA 4I0AA 1FZPB 5LRRA 2QM3A 5E20A 2Y0MA 2HDCA 3WU0A 4M74A 2XV4S 5HVQC 5TRDA 3K0LA 4S05A 2ZFWA 4OOIA 4RB1A 5ERIA 2STTA 2JT1A 3RPUA 4A5NA 4IJAA 2D1VA 1ZYRF 4XRFA 2M5WA 1NHAA 2PLYA 2E7WA 4KT5C 1FYLA 2PG4A 2M30A 1YLFA 4CICA 2M45A 1DUXC 2IT0A 3ISPA 2KKOA 5D4RA 4RGRA 4GYIA 3I59A 2FOKA 4KN4X 1USTA 4HX4A 3U9GA 3MZHA 4BNCA 3E6DA 1O57A 4GXOA 3JSPA 2A61A 4EJTA 5EEHA 2FQ3A 1D5VA 3V4GA 3W6JB 2VBYA 1T0FA 1ZARA 3RIRA 1OR7A 4G7OF 3JSOA 5E1WA 1Y0UA 1UHWA 3O2PE 2XUBA 2ESNA 2XAFA 2Z9OA 1V3FA 2VC0A 3BPVA 1SD7A 3BZ6A 4BHPA 2K86A 3HSEA 1A04A 1UHMA 2GWRA 4K2EA 2Y75A 4WK8F 5AIQA 2V1UA 3F8CA 1T98A 1P4WA 4G9YA 4S04A 3DQVC 2F2EA 1MJBA 1ONVA 1RI7A 3I4PA 3B02A 1MJ9A 3GEZA 4AWXB 4KIGA 2RGVA 4OINF 2DK8A 1QZZA 4O5VA 4AIHA 1SD4A 1YW9A 3TO7A 4HF0A 2QQBA 1GXPA 3WE2A 2A07F 1FY7A 2UXNA 2XAHA 5DCMA 4WXHA 5FFZA 1XMAA 5TJJA 1W5TA 2WTEA 1QZYA 1BI1A 2ZXJA 2FNPA 3I71A 1ZREA 1MDMB 2HYGD 3LAJA 3J81Z 1YIOA 2H94A 4L5IA 4U0WA 1IW7F 2WV0A 3M1EA 4HDUA 4A0YA 5D8KB 2E1CA 3JTGA 1BJAA 5HDNA 1O7FA 3LFKA 2FE3A 4M73A 1X3UA 2A6EF 5DEQA 2DW4A 2HOEA 4EM0B 1J75A 1FBUA 3KZZA 4LGWA 3WTSC 5D6EA 3HYIA 1DDNA 5IT9K 3BY6A 5DCFA 2GAUA 3MEXA 3F8MA 1SFEA 3WTUC 3DPLC 3RYPA 4Q48A 3CUQA 1ZH5A 3RYRA 3GXOA 4L0ZB 2XAQA 4EVIA 1JHHA 1IXSB 4HX8A 4P5OA 3OV8A 3ZMDA 1O3QA 4EGYA 1YFHA 4RAZA 4KICA 2FSWA 2O3FA 3WU1B 2EA4A 3ZMUA 1TNSA 3G73A 1XGMA 1K6OA 2FEZA 4L9TA 4P9UA 4M71A 1ZGAA 3ZP5A 3IRQA 1AWCA 3BJ6A 3BPXA 1R23A 2VBZA 1EV7A 1SFXA 4UNOA 5LBQA 2HEOA 1WRJA 4GCVA 2X0LA 2AS5F 2KJCA 2NNYA 3KP4A 2A6HF 3RTRA 4QLCU 1IN6A 1QQIA 3E6BA 1RIOH 3SHFA 3IRRA 4OMYA 4PZJA 2PJPA 1LDKB 3D5LA 3T1BA 1TQIA 2RKHA 4ZZDA 3MZYA 1S6LA 2A5YB 3EDPA 2XRNA 5K5QA 2R3SA 3PQKA 4DQ2A 4IRGA 4LLGF 4EJUA 5IT3A 4KA4A 4RGSA 2YSRA 1TLHB 4EJOA 2K27A 5BQTA 2J5OA 4HZFA 2X4HA 3ZMTA 3C18A 2HQRA 3R0AA 1KQ8A 5EEGA 3G3ZA 5DD4A 2K4JA 3IKTA 3TKYA 2ETHA 3K69A 2XASA 1TBXA 2V79A 1U5TB 5LEJA 2L3DA 4HYEA 3T0YA 5JR3A 1D3YA 1BC8C 1ZRCA 3ZQ7A 3TDZC 3E3VA 4CGZA 2VN2A 5ILUA 1I1SA 2O0YA 2JTVA 5IT9Z 4IF4A 4PGGA 4Q5SF 5CVJA 2G7UA 3CLOA 4RB2C 2YR2A 3BJOA 4KFCA 4M72A 3IKVA 1YQAA 2D2WA 5JFRA 1R5HA 1BIBA 2PMHA 4I09A 2XKPA 3F8FA 3BWGA 3IC7A 2YU3A 2EB7A 5DD8A 2DPDA 4M9SA 2F5EA 4YFNF 5L3FA 1WKMA 1STZA 1SAXA 3F3XA 5FLXK 3CUOA 2YPRA 1ZAOA 4FT8A 2HFHA 2E1NA 4JK1X 2P6TA 1P4XA 3F6VA 5FB2A 1DP7P 1G3YA 2P5LC 4L9NA 2H6BA 3MCZA 4AD9A 1SMYF 2V1DA 4ZYDA 1OKRA 2DAOA 3L7WA 4M6XA 2FNAA 2FF4A 1SMTA 2W24A 5BPIA 1HBXG 3ZMSA 2RVCA 4XSZF 3C1DA 2QBYB 3RPQA 4ENJA 4MHGA 4G6QA 3TDUC 2IJLA 4OIPF 3P9KA 1GVJA 4LB6B 4XLNF 5E8IA 5LGTA 4GO1A 4IHTA 2FA5A 2ZNZA 2A3SA 4I0BA 3GX4X 2RQPA 3KP2A 1RZ4A 2Y48A 2UWMA 4LJZF 3HIFA 2IP2A 1KQ0A 3M7GA 3T5XA 3QPTA 3GFMA 4YFXF 3IHUA 2LDUA 3EUHA 4O6JA 3VEPA 3KP6A 4WWCA 3F22A 3GZ5A 3BOQA 1QBJA 1VTNC 2ISYA 3GYHX 1EH7A 4IVNA 5L3BA 4L9VA 2ESHA 3I0TA 4HA8A 1UB9A 5CJ9A 2GXGA 3QP5A 4P9FA 4N0BA 2DFIA 2EWNA 4Q47A 3ABUA 3C3WA 3PQJA 3V8LA 5CLSA 4ENNA 3M8FA 2PI0A 2JRTA 1D8KA 5HLGA 3GVAA 5BPDA 3Q5FA 1RNLA 2KIUA 4ON0A 4UXNA 4F7ZA 1ZG1A 2ZKZA 2FBKA 3BJAA 1FOKA 1S3JA 4ENMA 4MEYF 3TO6A 1LEBA 1HXDA 3FM5A 3F6OA 3CO6C 2QVOA 2HQNA 4BYYA 3DP7A 3FXQA 2QQ9A 2W85A 2F5DA 3QP6A 3HRTA 3RKYA 4UVAA 2C6YA 1BC7C 1TQMA 3GWZA 2V1XA 2IW5A 3JAMK 4I7HA 3KLNA 3I54A 3F72A 4UUVA 5D5UB 2QYOA 1E17A 1MKMA 4A0ZA 1H9TA 3TO9A 2ELHA 3DV8A 4G7HF 2HGCA 5ILVA 3TOAA 3WGGA 2RV8A 1Z1DA 3IL2A 3HTSB 4A12A 1CF7B 2XKOA 1HSTA 3K9TA 1Z6TA 1R1UA 1W4MA 1FC3A 1G3TA 1LDJA 4HQEA 4HBLA 1T38A 1ZG3A 2XVCA 3WG9A 1B4AA 2FMYA 4D0PA 1ZG5A 3FM3A 3L00A 1MJAA 2XAGA 3I59B 1FNNA 5HDGA 3KFWX 3MAJA 3WODF 1IXRC 1TW3A 4G6DA 3V8KA 4Z2YA 3FMQA 3VB2A 1F9NA 2CFXA 2VT3A 1ZLKA 1XCVA 2Z99A 2JPCA 4NQWA 1BM9A 5HS8A 1IN4A 2DI3A 2EV6A 5DV5A 5H6QA 2W25A 1IXCA 2PQ8A 2FMLA 3VFZA 5J6XA 1F1ZA 5L3GA 2CWEA 2MH9A 4PDKA 2BBYA 2M1BA 1YTYA 2HYFA 1XGSA 1HKTA 3DPTA 2QWWA 2FBHA 4G94A 1PP8F 3QOPA 2LNBA 3SZTA 5FO5A 5HS7A 5FD6A 2JSCA 4KDPA 3HRMA 2O61A 3RJPA 3CDHA 1XDUA 2VOOA 3SQNA 2JPBA 3NRVA 5CVRA 3JW4A 1FYKA 3TQNA 2F5FA 2EA2A 3ABTA 2YX7A 4WCGA 3FXUA 3SZPA 3JTHA 2OQRA 5FD5A 1XCBA 3J80K 3GFJA 2M8EA 1JHFA 3E6CC 3SFZA 1R1TA 4RB3C 1WWXA 1SD5A 1R58A 4NB5A 2DPUA 1XN7A 1QO0D 2VT2A 1Z6RA 1U8RA 2NAZA 4IHSA 3P9CA 4I02A 2L02A 1KU9A 1ZRDA 1YG2A 5KK1A 2RC4A 5LGUA 1XDSA 3KEQA 5ICEA 1TTYA 1IF1A 4FX4A 1HW5A 3H3ZA 4YFKF 4I01A 2L01A 2XHKA 5E8GA 3JAMZ 1YW7A 5ILSA 2NNNA 3P7NA 1P4AA 1QGPA 1BI2A 1TQPA 2H6CA 1J5YA 2V9VA 1K78B 4HV6A 3GW2A 2H27A 1KQ9A 1U78A 3E97A 3K1MA 1U5TA 2K7LA 4TV7A 5H6RA 3L09A 1KYZA 4U0VA 4EJVA 3WGHA 3T8TA 1W7PD 1LB2A 4U0YA 1Z9CA 1L3LA 1B9NA 2V6CA 4ZYHA 2OD5A 4RAYA 2RN7A 1B9MA 4MQVA 3F23A 2VBXA 2MH2A 4KMFA 2VODA 1QPMA 2P7CB 1S7AA 3H3UA 1R36A 2KIMA 4BHCA 2EFWA 2CG4A 1KU3A 3DXJF 1HW1A 3FZVA 2CQKA 3ECHA 5K5RA 2K02A 2P6SA 1FBSA 2Q2EA 3VODA 1KGSA 3R61A 1BI3A 2ZBKA 2CO5A 3I64A 5JI6A 4MTEA 3SXYA 4KNYA 1R1VA 1PUEE 2EFQA 2E7XA 1ON1A 2WC2A 1XSXA 3ZPLA 2FU4A 4R8HA 4ESJA 1ZRFA 2CSOA 1Z7UA 2D1HA 1BOAA 4M6YA 4AIKA 3I58A 1PDNC 2DBBA 2D45A 2IRFG 4NHJA 3R4KA 1GXQA 5ICCA 5L3EA 5JVTA 3HRUA 2G9WA 2P8TA 3K1NA 1FPQA 1F4KA 1U3EM 1IAWA 2LSOA 1OYWA 4WF2A 4BXUA 2RDPA 1ON2A 2UXXA 3F8NA 1P6RA 2QZ8A 4LK1F 4MNUA 1HSJA 5D6FA 5HS9A 1W7PB 3HOTA 4MQ9F 4ZYEA 4JBAA 3CUQC 2EV5A 2MLKA 2PBIA 1USSA 3WTXC 1BI0A 3W6KB 4YIFA 2PFBA 1LEAA 3R60A 4CDGA 4I2OA 2IA2A 3RKWA 4IPAA 3GFIA 4IXAA 2G7HA 5HOOA 5LHIA 4HX7A 3DKWA 4HQMA 2EFNA 4P55A 1TNTA 2Q0OA 5K1YA 2R7FA 3LA2A 1H0MA 1FT9A 1S8NA 1MGTA 3BROA 1FYMA 2VC1A 4CXFA 1IRFA 1DPUA 1FX7A 4OMZA 2AXLA 4Y17A 5FGMA 2BEOA 3ZMZA 4WXDA 2DQRA 1YS7A 2BE5F 1O3TA 2BYVE 2DTRA 3BDDA 4UVCA 3GO5A 1HKSA 1FLIA 5F6FA 4A6DA 3COAC 1TW2A 2DO7A 5H20A 5FFXA 1U5TC 4WX9A 3IWFA 1FP2A 3U2RA 4LLLA 4H0EA 3I53A 5JHUA 3ZN1A 2PEXA 5HLIA 1HKQA 3J7AO 3KEOA 4M9ZA 3RI4A 1WI9A 3TGNA 4FX0A 2H09A 5ED4A 1SD6A 3M9AA 2W57A 3HOSA 4LG0B 1SFUA 1S7OA 3WTWC 3U1DA 4A6EA 1T39A 2Z33A 4DNCA 3B73A 3LQQA 5DYMA 4UHTA 3ELKA 3T8RA 4EJWA 4OIRF 3KZYA 5D4SA 2IPQX 3WGIA 1R5GA 3FMSA 1XSDA 4LFUA 3V8JA 1E2XA 2QQAA 3H92A 2DT5A 1D8JA 1IN8A 1T6SA 2FRHA 3KETA 1IRGA 4L18B 4ZZLA 3Q9VA 2OZ6A 3ERED 1OPCA 4LB5A 2Z5UA 2LF7A 3KP3A 5K5OA 5DUIA 2CGPA 1XD7A 3VOEA 3K1PA 5BMZA 2ZO4A 2L4AA 2OAZA 5FLXZ 1CF7A 2ZMEB 2LKPA 4A2UA 4OU0A 3ECOA 1G6NA 4EQQA 2Z3YA 3KP5A 3KLOA 3E5QA 5ICGA 3HUGA 3E6MA 1F5TA 5D5VB 1XB4A 3LQRA 2HTJA 4CZZA 4ASNA 1R7JA 2ACJA 4RS8A 2HTSA 4XSXF 4HDVA 3RDIA 3FHZA 2P5VA 4O3MA 3KE2A 2GQQA 1OYIA 4EMSA 2KIFA 2MA3A 2K4BA 2L4MA 4M9XA 3MFKA 2OA4A 4P96A 4OIOF 1T2KA 1RUOA 1MDMA 4EM2A 3HHHA 1W5SA 2NRAC 2VBWA 2MD5A 1XSVA 1I6XA 1KYWA 4ZYGA 1LQ1A 4RGXA 1YO5C 3PFIA 4IRIA 5CVIA 1B1BA 2EK5A 2VE9A 5E1ZB 1KU2A 2A69F 2DK5A 5E1XA 1O3RA 1U6GA 2F5CA 1WQ2A 1XMKA 1ULYA 2MLGA 1BBYA 2PN6A 1IUYA 3EYIA 1YS6A 4MTDA 1DPRA 3D0SA 4N9HA 2DQLA 5F64A 1J7KA 3DEUA 3IWZA 3HHGA 1FSHA 3ZN0A 1FSEA 1MD0A 4YIIA 4U88A 2DLLA 1S29A 1IN7A 2R7DA 1PP7U 3NEUA 3MWMA 1R22A 5E18F 3CO7C 2ZNYA 5LGNA 4HF1A 4A5MA 1K7AA 4Y15A 4A0XA 3BP8A 1QNTA 4I98B 4B8XA 1G4DA 1IZ1A 4KIBA 3RKXA 2FBIA 5L3CA 1LVAA 3LWFA 3QRFF 2VE8A 1BN5A 5A2QK 5CYVA 3P9IA 4ESBA 1J2XA 2B0LA 1MZBA 5CVUA 1J0RA 1LDDA 2UZKA 4CHUA 2LF8A 2NYXA 1UFMA 2FXAA 2VOPA 3DFGA 3O3KA 1HQCA 5D5WB 1O7LA 4LMYA 4G8XA 4KUMA 1K78A 5ICFA 4OIQF 1P2FA 2L54A 4L9JA 2W84A 3MQ0A 2O03A 4U7DA 5DCMB 5L3DA 3QU6A 4ZH4F 2GA2A 2HR3A 3GUDA 4KN7X 4U7BA 3F8BA 4HAMA 1Z91A 1U2WA 2BGCA 3ULQB 1I5ZA 1BIAA 2P7VB 4LD5A 3WTVC 1REPC 2MC3A 2CYYA 4LK0F 5E17F 4LLNA 4UVBA 2OU2A 3GZ6A 3I5UA 2QENA 5AONA 3R0JA 1C0WA 4GYGA 2EFPA 4L5JA 2COMA 3ML6A 4HLYA 5LHGA 1UCRA 3CUQB 3WE3A 1WSUA 4R1HA 3L2CA 4UV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OZU A;  4ETS A;  3E5X A;  1HW2 A;  2KRF A;  2GIV A;  2GZW A;  4JQF A;  2MBF A;  1KA8 A;  2QUF A;  5LEK A;  2NS0 A;  3EET A;  3HTU A;  2CW0 F;  2IVM A;  1FBQ A;  2JZY A;  4ENK A;  4MEX F;  3N4M A;  3HRS A;  2Q8K A;  4RB0 A;  2DU9 A;  5J8C A;  3LA7 A;  2ISZ A;  3ZMV A;  3QAH A;  3LST A;  2ZJ2 A;  2GXB A;  5CVV A;  1O3S A;  1Q1H A;  1W7P A;  4AIJ A;  3V7R A;  5BS6 A;  1ZGJ A;  3FWE A;  1AOY A;  3C7J A;  3LA3 A;  3N97 A;  4EV0 A;  5DDG A;  3V7C A;  3V7S A;  1B59 A;  1ODD A;  5A2Q Z;  1IN5 A;  4MGR A;  6PAX A;  4WXC A;  5BOX A;  5AIP A;  1I1G A;  5D8L B;  2O6G E;  2GA1 A;  2XIG A;  3Q9S A;  2EFO A;  3GFL A;  2BV6 A;  4PGH A;  5DUK A;  3R6S A;  3DF8 A;  5LLQ A;  3EQL F;  3FF5 A;  2HS5 A;  1GHC A;  1OMI A;  2XGX A;  4GGG A;  3WTY C;  3CJN A;  2EJR A;  4HW0 A;  4EGZ A;  3AAF A;  3J80 Z;  1J59 A;  1H9G A;  2QBY A;  2HKO A;  1OYY A;  5LHH A;  4KIF A;  4FHT A;  3FX3 A;  2XAJ A;  3HSR A;  4R79 A;  4RGU A;  1LJ9 A;  3KP7 A;  1G3S A;  1LNW A;  1XGN A;  2KJB A;  3QU3 A;  1Z05 A;  1B6A A;  3WTT C;  4G7Z F;  1KU7 A;  5F1R A;  3OOP A;  3L9F A;  3HSF A;  4CYD A;  1J9I A;  2HZT A;  1ZHF A;  3KCC A;  3REO A;  4N9I A;  3GLX A;  3NQO A;  4LG0 A;  3CTA A;  4UV8 A;  5KVR A;  3FMR A;  1R00 A;  4QWQ A;  5LRS A;  3O6B B;  1L0O C;  1EH8 A;  2EV0 A;  4KMU X;  2ZCW A;  2O8X A;  4CO8 A;  4AVP A;  1FWZ A;  4Q4Z F;  4XLP F;  4PCQ A;  3FXR A;  3E5U A;  3GF2 A;  3QPH A;  5J8F A;  4Y13 A;  2HWV A;  1I27 A;  2OBP A;  1K79 A;  2ADU A;  3WTZ A;  5HDK A;  2XRO A;  1EH6 A;  3ROU A;  2TDX A;  2P5K A;  2IA1 A;  4ESF A;  2J5P A;  4IRH A;  1P92 A;  4B09 A;  4E70 A;  3K2Z A;  2A68 F;  2PMU A;  2OQG A;  4EM1 A;  1XGO A;  4BHB A;  2M87 A;  2P4W A;  4HV5 A;  1RUN A;  3M8E A;  4HLX A;  2ZME A;  1V4R A;  1G3W A;  3F21 A;  2RNJ A;  1JGS A;  4HOB A;  3TOB A;  4BQA A;  3J81 K;  4BAY A;  5D5X B;  2HKX A;  4L0Y B;  2VXZ A;  1CGP A;  3S2W A;  1ZN2 A;  3EYY A;  5HLH A;  1ZLJ A;  1JXS A;  2VON A;  1JE8 A;  4BH9 A;  2IA0 A;  2STW A;  1FP1 D;  2YX4 A;  4XBF A;  4YG2 F;  3LAP A;  2WWY A;  4KYW A;  4HF2 A;  1YW8 A;  2QLZ A;  1YYV A;  4I0A A;  1FZP B;  5LRR A;  2QM3 A;  5E20 A;  2Y0M A;  2HDC A;  3WU0 A;  4M74 A;  2XV4 S;  5HVQ C;  5TRD A;  3K0L A;  4S05 A;  2ZFW A;  4OOI A;  4RB1 A;  5ERI A;  2STT A;  2JT1 A;  3RPU A;  4A5N A;  4IJA A;  2D1V A;  1ZYR F;  4XRF A;  2M5W A;  1NHA A;  2PLY A;  2E7W A;  4KT5 C;  1FYL A;  2PG4 A;  2M30 A;  1YLF A;  4CIC A;  2M45 A;  1DUX C;  2IT0 A;  3ISP A;  2KKO A;  5D4R A;  4RGR A;  4GYI A;  3I59 A;  2FOK A;  4KN4 X;  1UST A;  4HX4 A;  3U9G A;  3MZH A;  4BNC A;  3E6D A;  1O57 A;  4GXO A;  3JSP A;  2A61 A;  4EJT A;  5EEH A;  2FQ3 A;  1D5V A;  3V4G A;  3W6J B;  2VBY A;  1T0F A;  1ZAR A;  3RIR A;  1OR7 A;  4G7O F;  3JSO A;  5E1W A;  1Y0U A;  1UHW A;  3O2P E;  2XUB A;  2ESN A;  2XAF A;  2Z9O A;  1V3F A;  2VC0 A;  3BPV A;  1SD7 A;  3BZ6 A;  4BHP A;  2K86 A;  3HSE A;  1A04 A;  1UHM A;  2GWR A;  4K2E A;  2Y75 A;  4WK8 F;  5AIQ A;  2V1U A;  3F8C A;  1T98 A;  1P4W A;  4G9Y A;  4S04 A;  3DQV C;  2F2E A;  1MJB A;  1ONV A;  1RI7 A;  3I4P A;  3B02 A;  1MJ9 A;  3GEZ A;  4AWX B;  4KIG A;  2RGV A;  4OIN F;  2DK8 A;  1QZZ A;  4O5V A;  4AIH A;  1SD4 A;  1YW9 A;  3TO7 A;  4HF0 A;  2QQB A;  1GXP A;  3WE2 A;  2A07 F;  1FY7 A;  2UXN A;  2XAH A;  5DCM A;  4WXH A;  5FFZ A;  1XMA A;  5TJJ A;  1W5T A;  2WTE A;  1QZY A;  1BI1 A;  2ZXJ A;  2FNP A;  3I71 A;  1ZRE A;  1MDM B;  2HYG D;  3LAJ A;  3J81 Z;  1YIO A;  2H94 A;  4L5I A;  4U0W A;  1IW7 F;  2WV0 A;  3M1E A;  4HDU A;  4A0Y A;  5D8K B;  2E1C A;  3JTG A;  1BJA A;  5HDN A;  1O7F A;  3LFK A;  2FE3 A;  4M73 A;  1X3U A;  2A6E F;  5DEQ A;  2DW4 A;  2HOE A;  4EM0 B;  1J75 A;  1FBU A;  3KZZ A;  4LGW A;  3WTS C;  5D6E A;  3HYI A;  1DDN A;  5IT9 K;  3BY6 A;  5DCF A;  2GAU A;  3MEX A;  3F8M A;  1SFE A;  3WTU C;  3DPL C;  3RYP A;  4Q48 A;  3CUQ A;  1ZH5 A;  3RYR A;  3GXO A;  4L0Z B;  2XAQ A;  4EVI A;  1JHH A;  1IXS B;  4HX8 A;  4P5O A;  3OV8 A;  3ZMD A;  1O3Q A;  4EGY A;  1YFH A;  4RAZ A;  4KIC A;  2FSW A;  2O3F A;  3WU1 B;  2EA4 A;  3ZMU A;  1TNS A;  3G73 A;  1XGM A;  1K6O A;  2FEZ A;  4L9T A;  4P9U A;  4M71 A;  1ZGA A;  3ZP5 A;  3IRQ A;  1AWC A;  3BJ6 A;  3BPX A;  1R23 A;  2VBZ A;  1EV7 A;  1SFX A;  4UNO A;  5LBQ A;  2HEO A;  1WRJ A;  4GCV A;  2X0L A;  2AS5 F;  2KJC A;  2NNY A;  3KP4 A;  2A6H F;  3RTR A;  4QLC U;  1IN6 A;  1QQI A;  3E6B A;  1RIO H;  3SHF A;  3IRR A;  4OMY A;  4PZJ A;  2PJP A;  1LDK B;  3D5L A;  3T1B A;  1TQI A;  2RKH A;  4ZZD A;  3MZY A;  1S6L A;  2A5Y B;  3EDP A;  2XRN A;  5K5Q A;  2R3S A;  3PQK A;  4DQ2 A;  4IRG A;  4LLG F;  4EJU A;  5IT3 A;  4KA4 A;  4RGS A;  2YSR A;  1TLH B;  4EJO A;  2K27 A;  5BQT A;  2J5O A;  4HZF A;  2X4H A;  3ZMT A;  3C18 A;  2HQR A;  3R0A A;  1KQ8 A;  5EEG A;  3G3Z A;  5DD4 A;  2K4J A;  3IKT A;  3TKY A;  2ETH A;  3K69 A;  2XAS A;  1TBX A;  2V79 A;  1U5T B;  5LEJ A;  2L3D A;  4HYE A;  3T0Y A;  5JR3 A;  1D3Y A;  1BC8 C;  1ZRC A;  3ZQ7 A;  3TDZ C;  3E3V A;  4CGZ A;  2VN2 A;  5ILU A;  1I1S A;  2O0Y A;  2JTV A;  5IT9 Z;  4IF4 A;  4PGG A;  4Q5S F;  5CVJ A;  2G7U A;  3CLO A;  4RB2 C;  2YR2 A;  3BJO A;  4KFC A;  4M72 A;  3IKV A;  1YQA A;  2D2W A;  5JFR A;  1R5H A;  1BIB A;  2PMH A;  4I09 A;  2XKP A;  3F8F A;  3BWG A;  3IC7 A;  2YU3 A;  2EB7 A;  5DD8 A;  2DPD A;  4M9S A;  2F5E A;  4YFN F;  5L3F A;  1WKM A;  1STZ A;  1SAX A;  3F3X A;  5FLX K;  3CUO A;  2YPR A;  1ZAO A;  4FT8 A;  2HFH A;  2E1N A;  4JK1 X;  2P6T A;  1P4X A;  3F6V A;  5FB2 A;  1DP7 P;  1G3Y A;  2P5L C;  4L9N A;  2H6B A;  3MCZ A;  4AD9 A;  1SMY F;  2V1D A;  4ZYD A;  1OKR A;  2DAO A;  3L7W A;  4M6X A;  2FNA A;  2FF4 A;  1SMT A;  2W24 A;  5BPI A;  1HBX G;  3ZMS A;  2RVC A;  4XSZ F;  3C1D A;  2QBY B;  3RPQ A;  4ENJ A;  4MHG A;  4G6Q A;  3TDU C;  2IJL A;  4OIP F;  3P9K A;  1GVJ A;  4LB6 B;  4XLN F;  5E8I A;  5LGT A;  4GO1 A;  4IHT A;  2FA5 A;  2ZNZ A;  2A3S A;  4I0B A;  3GX4 X;  2RQP A;  3KP2 A;  1RZ4 A;  2Y48 A;  2UWM A;  4LJZ F;  3HIF A;  2IP2 A;  1KQ0 A;  3M7G A;  3T5X A;  3QPT A;  3GFM A;  4YFX F;  3IHU A;  2LDU A;  3EUH A;  4O6J A;  3VEP A;  3KP6 A;  4WWC A;  3F22 A;  3GZ5 A;  3BOQ A;  1QBJ A;  1VTN C;  2ISY A;  3GYH X;  1EH7 A;  4IVN A;  5L3B A;  4L9V A;  2ESH A;  3I0T A;  4HA8 A;  1UB9 A;  5CJ9 A;  2GXG A;  3QP5 A;  4P9F A;  4N0B A;  2DFI A;  2EWN A;  4Q47 A;  3ABU A;  3C3W A;  3PQJ A;  3V8L A;  5CLS A;  4ENN A;  3M8F A;  2PI0 A;  2JRT A;  1D8K A;  5HLG A;  3GVA A;  5BPD A;  3Q5F A;  1RNL A;  2KIU A;  4ON0 A;  4UXN A;  4F7Z A;  1ZG1 A;  2ZKZ A;  2FBK A;  3BJA A;  1FOK A;  1S3J A;  4ENM A;  4MEY F;  3TO6 A;  1LEB A;  1HXD A;  3FM5 A;  3F6O A;  3CO6 C;  2QVO A;  2HQN A;  4BYY A;  3DP7 A;  3FXQ A;  2QQ9 A;  2W85 A;  2F5D A;  3QP6 A;  3HRT A;  3RKY A;  4UVA A;  2C6Y A;  1BC7 C;  1TQM A;  3GWZ A;  2V1X A;  2IW5 A;  3JAM K;  4I7H A;  3KLN A;  3I54 A;  3F72 A;  4UUV A;  5D5U B;  2QYO A;  1E17 A;  1MKM A;  4A0Z A;  1H9T A;  3TO9 A;  2ELH A;  3DV8 A;  4G7H F;  2HGC A;  5ILV A;  3TOA A;  3WGG A;  2RV8 A;  1Z1D A;  3IL2 A;  3HTS B;  4A12 A;  1CF7 B;  2XKO A;  1HST A;  3K9T A;  1Z6T A;  1R1U A;  1W4M A;  1FC3 A;  1G3T A;  1LDJ A;  4HQE A;  4HBL A;  1T38 A;  1ZG3 A;  2XVC A;  3WG9 A;  1B4A A;  2FMY A;  4D0P A;  1ZG5 A;  3FM3 A;  3L00 A;  1MJA A;  2XAG A;  3I59 B;  1FNN A;  5HDG A;  3KFW X;  3MAJ A;  3WOD F;  1IXR C;  1TW3 A;  4G6D A;  3V8K A;  4Z2Y A;  3FMQ A;  3VB2 A;  1F9N A;  2CFX A;  2VT3 A;  1ZLK A;  1XCV A;  2Z99 A;  2JPC A;  4NQW A;  1BM9 A;  5HS8 A;  1IN4 A;  2DI3 A;  2EV6 A;  5DV5 A;  5H6Q A;  2W25 A;  1IXC A;  2PQ8 A;  2FML A;  3VFZ A;  5J6X A;  1F1Z A;  5L3G A;  2CWE A;  2MH9 A;  4PDK A;  2BBY A;  2M1B A;  1YTY A;  2HYF A;  1XGS A;  1HKT A;  3DPT A;  2QWW A;  2FBH A;  4G94 A;  1PP8 F;  3QOP A;  2LNB A;  3SZT A;  5FO5 A;  5HS7 A;  5FD6 A;  2JSC A;  4KDP A;  3HRM A;  2O61 A;  3RJP A;  3CDH A;  1XDU A;  2VOO A;  3SQN A;  2JPB A;  3NRV A;  5CVR A;  3JW4 A;  1FYK A;  3TQN A;  2F5F A;  2EA2 A;  3ABT A;  2YX7 A;  4WCG A;  3FXU A;  3SZP A;  3JTH A;  2OQR A;  5FD5 A;  1XCB A;  3J80 K;  3GFJ A;  2M8E A;  1JHF A;  3E6C C;  3SFZ A;  1R1T A;  4RB3 C;  1WWX A;  1SD5 A;  1R58 A;  4NB5 A;  2DPU A;  1XN7 A;  1QO0 D;  2VT2 A;  1Z6R A;  1U8R A;  2NAZ A;  4IHS A;  3P9C A;  4I02 A;  2L02 A;  1KU9 A;  1ZRD A;  1YG2 A;  5KK1 A;  2RC4 A;  5LGU A;  1XDS A;  3KEQ A;  5ICE A;  1TTY A;  1IF1 A;  4FX4 A;  1HW5 A;  3H3Z A;  4YFK F;  4I01 A;  2L01 A;  2XHK A;  5E8G A;  3JAM Z;  1YW7 A;  5ILS A;  2NNN A;  3P7N A;  1P4A A;  1QGP A;  1BI2 A;  1TQP A;  2H6C A;  1J5Y A;  2V9V A;  1K78 B;  4HV6 A;  3GW2 A;  2H27 A;  1KQ9 A;  1U78 A;  3E97 A;  3K1M A;  1U5T A;  2K7L A;  4TV7 A;  5H6R A;  3L09 A;  1KYZ A;  4U0V A;  4EJV A;  3WGH A;  3T8T A;  1W7P D;  1LB2 A;  4U0Y A;  1Z9C A;  1L3L A;  1B9N A;  2V6C A;  4ZYH A;  2OD5 A;  4RAY A;  2RN7 A;  1B9M A;  4MQV A;  3F23 A;  2VBX A;  2MH2 A;  4KMF A;  2VOD A;  1QPM A;  2P7C B;  1S7A A;  3H3U A;  1R36 A;  2KIM A;  4BHC A;  2EFW A;  2CG4 A;  1KU3 A;  3DXJ F;  1HW1 A;  3FZV A;  2CQK A;  3ECH A;  5K5R A;  2K02 A;  2P6S A;  1FBS A;  2Q2E A;  3VOD A;  1KGS A;  3R61 A;  1BI3 A;  2ZBK A;  2CO5 A;  3I64 A;  5JI6 A;  4MTE A;  3SXY A;  4KNY A;  1R1V A;  1PUE E;  2EFQ A;  2E7X A;  1ON1 A;  2WC2 A;  1XSX A;  3ZPL A;  2FU4 A;  4R8H A;  4ESJ A;  1ZRF A;  2CSO A;  1Z7U A;  2D1H A;  1BOA A;  4M6Y A;  4AIK A;  3I58 A;  1PDN C;  2DBB A;  2D45 A;  2IRF G;  4NHJ A;  3R4K A;  1GXQ A;  5ICC A;  5L3E A;  5JVT A;  3HRU A;  2G9W A;  2P8T A;  3K1N A;  1FPQ A;  1F4K A;  1U3E M;  1IAW A;  2LSO A;  1OYW A;  4WF2 A;  4BXU A;  2RDP A;  1ON2 A;  2UXX A;  3F8N A;  1P6R A;  2QZ8 A;  4LK1 F;  4MNU A;  1HSJ A;  5D6F A;  5HS9 A;  1W7P B;  3HOT A;  4MQ9 F;  4ZYE A;  4JBA A;  3CUQ C;  2EV5 A;  2MLK A;  2PBI A;  1USS A;  3WTX C;  1BI0 A;  3W6K B;  4YIF A;  2PFB A;  1LEA A;  3R60 A;  4CDG A;  4I2O A;  2IA2 A;  3RKW A;  4IPA A;  3GFI A;  4IXA A;  2G7H A;  5HOO A;  5LHI A;  4HX7 A;  3DKW A;  4HQM A;  2EFN A;  4P55 A;  1TNT A;  2Q0O A;  5K1Y A;  2R7F A;  3LA2 A;  1H0M A;  1FT9 A;  1S8N A;  1MGT A;  3BRO A;  1FYM A;  2VC1 A;  4CXF A;  1IRF A;  1DPU A;  1FX7 A;  4OMZ A;  2AXL A;  4Y17 A;  5FGM A;  2BEO A;  3ZMZ A;  4WXD A;  2DQR A;  1YS7 A;  2BE5 F;  1O3T A;  2BYV E;  2DTR A;  3BDD A;  4UVC A;  3GO5 A;  1HKS A;  1FLI A;  5F6F A;  4A6D A;  3COA C;  1TW2 A;  2DO7 A;  5H20 A;  5FFX A;  1U5T C;  4WX9 A;  3IWF A;  1FP2 A;  3U2R A;  4LLL A;  4H0E A;  3I53 A;  5JHU A;  3ZN1 A;  2PEX A;  5HLI A;  1HKQ A;  3J7A O;  3KEO A;  4M9Z A;  3RI4 A;  1WI9 A;  3TGN A;  4FX0 A;  2H09 A;  5ED4 A;  1SD6 A;  3M9A A;  2W57 A;  3HOS A;  4LG0 B;  1SFU A;  1S7O A;  3WTW C;  3U1D A;  4A6E A;  1T39 A;  2Z33 A;  4DNC A;  3B73 A;  3LQQ A;  5DYM A;  4UHT A;  3ELK A;  3T8R A;  4EJW A;  4OIR F;  3KZY A;  5D4S A;  2IPQ X;  3WGI A;  1R5G A;  3FMS A;  1XSD A;  4LFU A;  3V8J A;  1E2X A;  2QQA A;  3H92 A;  2DT5 A;  1D8J A;  1IN8 A;  1T6S A;  2FRH A;  3KET A;  1IRG A;  4L18 B;  4ZZL A;  3Q9V A;  2OZ6 A;  3ERE D;  1OPC A;  4LB5 A;  2Z5U A;  2LF7 A;  3KP3 A;  5K5O A;  5DUI A;  2CGP A;  1XD7 A;  3VOE A;  3K1P A;  5BMZ A;  2ZO4 A;  2L4A A;  2OAZ A;  5FLX Z;  1CF7 A;  2ZME B;  2LKP A;  4A2U A;  4OU0 A;  3ECO A;  1G6N A;  4EQQ A;  2Z3Y A;  3KP5 A;  3KLO A;  3E5Q A;  5ICG A;  3HUG A;  3E6M A;  1F5T A;  5D5V B;  1XB4 A;  3LQR A;  2HTJ A;  4CZZ A;  4ASN A;  1R7J A;  2ACJ A;  4RS8 A;  2HTS A;  4XSX F;  4HDV A;  3RDI A;  3FHZ A;  2P5V A;  4O3M A;  3KE2 A;  2GQQ A;  1OYI A;  4EMS A;  2KIF A;  2MA3 A;  2K4B A;  2L4M A;  4M9X A;  3MFK A;  2OA4 A;  4P96 A;  4OIO F;  1T2K A;  1RUO A;  1MDM A;  4EM2 A;  3HHH A;  1W5S A;  2NRA C;  2VBW A;  2MD5 A;  1XSV A;  1I6X A;  1KYW A;  4ZYG A;  1LQ1 A;  4RGX A;  1YO5 C;  3PFI A;  4IRI A;  5CVI A;  1B1B A;  2EK5 A;  2VE9 A;  5E1Z B;  1KU2 A;  2A69 F;  2DK5 A;  5E1X A;  1O3R A;  1U6G A;  2F5C A;  1WQ2 A;  1XMK A;  1ULY A;  2MLG A;  1BBY A;  2PN6 A;  1IUY A;  3EYI A;  1YS6 A;  4MTD A;  1DPR A;  3D0S A;  4N9H A;  2DQL A;  5F64 A;  1J7K A;  3DEU A;  3IWZ A;  3HHG A;  1FSH A;  3ZN0 A;  1FSE A;  1MD0 A;  4YII A;  4U88 A;  2DLL A;  1S29 A;  1IN7 A;  2R7D A;  1PP7 U;  3NEU A;  3MWM A;  1R22 A;  5E18 F;  3CO7 C;  2ZNY A;  5LGN A;  4HF1 A;  4A5M A;  1K7A A;  4Y15 A;  4A0X A;  3BP8 A;  1QNT A;  4I98 B;  4B8X A;  1G4D A;  1IZ1 A;  4KIB A;  3RKX A;  2FBI A;  5L3C A;  1LVA A;  3LWF A;  3QRF F;  2VE8 A;  1BN5 A;  5A2Q K;  5CYV A;  3P9I A;  4ESB A;  1J2X A;  2B0L A;  1MZB A;  5CVU A;  1J0R A;  1LDD A;  2UZK A;  4CHU A;  2LF8 A;  2NYX A;  1UFM A;  2FXA A;  2VOP A;  3DFG A;  3O3K A;  1HQC A;  5D5W B;  1O7L A;  4LMY A;  4G8X A;  4KUM A;  1K78 A;  5ICF A;  4OIQ F;  1P2F A;  2L54 A;  4L9J A;  2W84 A;  3MQ0 A;  2O03 A;  4U7D A;  5DCM B;  5L3D A;  3QU6 A;  4ZH4 F;  2GA2 A;  2HR3 A;  3GUD A;  4KN7 X;  4U7B A;  3F8B A;  4HAM A;  1Z91 A;  1U2W A;  2BGC A;  3ULQ B;  1I5Z A;  1BIA A;  2P7V B;  4LD5 A;  3WTV C;  1REP C;  2MC3 A;  2CYY A;  4LK0 F;  5E17 F;  4LLN A;  4UVB A;  2OU2 A;  3GZ6 A;  3I5U A;  2QEN A;  5AON A;  3R0J A;  1C0W A;  4GYG A;  2EFP A;  4L5J A;  2COM A;  3ML6 A;  4HLY A;  5LHG A;  1UCR A;  3CUQ B;  3WE3 A;  1WSU A;  4R1H A;  3L2C A;  4UV9 A; 
#chains in the Genus database with same CATH topology
 2XB0 X;  5E79 C;  2OZU A;  4ETS A;  3E5X A;  1IJW C;  2WA0 A;  1HW2 A;  2KRF A;  2R0Q C;  2EZL A;  2GIV A;  2GZW A;  4JQF A;  1Y1W J;  4UB6 C;  2MBF A;  2EZI A;  3M07 A;  1QVU A;  2PMZ N;  1KA8 A;  1TP4 A;  2QUF A;  3K4L A;  3QOE A;  3VYR B;  5LEK A;  3CCL I;  2NS0 A;  3EET A;  3HTU A;  3IH3 A;  2CW0 F;  2IVM A;  3DKY A;  3H0D A;  1FBQ A;  2BXZ A;  3OYD A;  2JZY A;  4ENK A;  4MEX F;  3N4M A;  5KAF C;  1D1C A;  2EIM H;  3HRS A;  2Q8K A;  1JT6 A;  1MBK A;  2ID3 A;  2HNH A;  4RB0 A;  2DU9 A;  2V26 A;  3LSJ A;  5J8C A;  3CJT B;  3LA7 A;  2ISZ A;  2LYC A;  3ZMV A;  4E7S A;  1PUF B;  2R5Y A;  3QAH A;  3MKY B;  3LST A;  2E2H J;  2ZJ2 A;  2GXB A;  2X1C A;  2AHQ A;  2DA1 A;  5M3M J;  2LBF A;  2TCT A;  5CVV A;  5GP9 A;  4I99 C;  2CQX A;  2Y30 A;  5JLW A;  1FEX A;  2V9K A;  1O3S A;  1Q1H A;  4C2M J;  1W7P A;  1JTX A;  2BOL A;  4AIJ A;  3HPH A;  3FXK A;  3V7R A;  4II3 A;  5BS6 A;  3ASN H;  1ZGJ A;  3GTP J;  3FWE A;  1AOY A;  3C7J A;  3LA3 A;  2DOD A;  3N97 A;  4EV0 A;  1TWA J;  5C3E J;  4PFP A;  5DDG A;  3V7C A;  2BW3 A;  3NWT A;  3V7S A;  1B59 A;  3OS0 A;  3JRH A;  1T95 A;  4ZC3 A;  1ODD A;  5A2Q Z;  1IN5 A;  4MGR A;  6PAX A;  4WXC A;  1UG2 A;  3CQZ J;  5FKN A;  5BOX A;  5AIP A;  1I1G A;  2DMP A;  1OCP A;  5D8L B;  2EZK A;  2O6G E;  3K4J A;  2XSJ C;  2GA1 A;  2Y0S N;  1M1E B;  1JGG A;  3HOW J;  4A3E J;  2XIG A;  3Q9S A;  2EFO A;  3OYB A;  3ZQF A;  2OPT A;  1X2M A;  4CSW A;  1Q1V A;  3GFL A;  2BV6 A;  4PGH A;  5DUK A;  2KDZ A;  4JX5 A;  3ZQQ A;  3R6S A;  2KFD A;  3SDB A;  4DYC A;  3DF8 A;  4FET A;  5LLQ A;  5HNH A;  3EQL F;  3FF5 A;  1RR7 A;  4UY8 I;  2HS5 A;  1GHC A;  1V5F A;  3OS1 A;  1MMA A;  1OMI A;  2XGX A;  4GGG A;  3WTY C;  3CJN A;  2EJR A;  3FKI J;  2Z1D A;  4HW0 A;  5E3N A;  3CMY A;  3AAF A;  4EGZ A;  4ZTF A;  3J80 Z;  4HNU A;  3KPH A;  2GOM A;  1H9G A;  1J59 A;  2QBY A;  1J09 A;  2LLK A;  3CC7 I;  2HKO A;  1OYY A;  5LHH A;  4KIF A;  4FHT A;  2DFF A;  2NXN B;  3FX3 A;  2XAJ A;  2COB A;  1NG7 A;  1WH7 A;  3HSR A;  1W36 D;  4R79 A;  4RGU A;  1LJ9 A;  3A0B C;  3BR2 A;  3KP7 A;  3E1S A;  1BJZ A;  2X6W A;  1G3S A;  1LNW A;  1XPX A;  2CV2 A;  1XGN A;  4DYR A;  5JLX A;  2KJB A;  3DLL F;  2DA5 A;  4DZJ A;  4YEJ A;  4IX7 A;  3QU3 A;  1WJB A;  4RM2 A;  1Z05 A;  1JKQ C;  1B6A A;  2L7Z A;  3WTT C;  4G7Z F;  1KU7 A;  5F1R A;  4CYC B;  3OOP A;  2LRD A;  1MIJ A;  3L9F A;  3HSF A;  4CYD A;  2CMP A;  4E7L A;  4C2T A;  2TRT A;  2E1M C;  1J9I A;  4RDU A;  2JN6 A;  2HZT A;  1ZHF A;  3H5R A;  3A01 B;  2G0E A;  3KCC A;  1BR1 A;  1JJ8 C;  3REO A;  4N9I A;  3GLX A;  4B43 A;  4XRS G;  1GUU A;  1U8B A;  3NQO A;  4LG0 A;  3OL4 A;  4CCM A;  3EUK L;  2JRM A;  3CTA A;  4UV8 A;  2HDW A;  5KVR A;  3FMR A;  1R00 A;  3LSI A;  4QWQ A;  2EBI A;  5LRS A;  4Y52 J;  3O6B B;  3AG2 H;  1L0O C;  1EH8 A;  4F3Q A;  2UUZ A;  2WY8 Q;  2PJR B;  2EV0 A;  4KMU X;  3BTJ A;  2LD5 A;  2ZCW A;  5IPA A;  1A5J A;  4E7J A;  3FXM A;  2V6E A;  2O8X A;  4CO8 A;  4AU7 A;  5J40 A;  4AVP A;  4PJN A;  1FWZ A;  4Q4Z F;  2F4O B;  4XLP F;  5E3L A;  4E7K A;  4PCQ A;  4Y7N J;  1S72 I;  2X9D A;  4XLC A;  3JRD A;  2Y69 H;  3K4C A;  3FXR A;  2JA7 J;  1ETV A;  3E5U A;  3GF2 A;  2VJI A;  3QPH A;  5J8F A;  4Y13 A;  2HWV A;  1I27 A;  4A3L J;  2IGO A;  2QSF X;  4B3X A;  1X19 A;  3VYT B;  2OBP A;  4XIC A;  1K79 A;  1LVK A;  1FIP A;  1X3Z B;  2MD0 A;  1AKH A;  1T08 B;  4CCJ A;  2ADU A;  1NH3 A;  3WTZ A;  5HDK A;  2XRO A;  1EH6 A;  2HXI A;  2H1K A;  3ROU A;  3OYK A;  3H5N A;  2TDX A;  3ABL H;  2L2O A;  2P5K A;  2O5R A;  2ZXI A;  1I39 A;  5LFA A;  2OTJ I;  2IA1 A;  4C3I J;  4ESF A;  2KRC A;  2J5P A;  3AG4 H;  5HLT A;  2KRH A;  4IRH A;  4BDZ A;  1P92 A;  3LFU A;  4B09 A;  2M9H A;  4E70 A;  3K2Z A;  2DJI A;  2A68 F;  2PMU A;  2OQG A;  5FLM J;  2KP6 A;  4EM1 A;  1XGO A;  3ABK H;  4BHB A;  2B7E A;  2M87 A;  1RPW A;  3QPS A;  2P4W A;  4HV5 A;  1Y56 A;  3HXL A;  1RUN A;  3M8E A;  3S1N J;  1IV6 A;  4HLX A;  2ZME A;  3V42 A;  2NS8 A;  2JVG A;  1NG6 A;  2WB1 N;  1V4R A;  1G3W A;  3JCU C;  3F21 A;  3Q0U A;  3KYD B;  3ZQL A;  2RNJ A;  1JGS A;  2F5V A;  4HOB A;  3TOB A;  4BQA A;  3IH4 A;  4BAY A;  3PSI A;  3J81 K;  5D5X B;  2LP0 A;  2HKX A;  2LC2 A;  4L0Y B;  2VXZ A;  1CGP A;  3S2W A;  3PO3 J;  1ZN2 A;  3G1L A;  1CQT A;  3EYY A;  5HLH A;  1ZLJ A;  1HOM A;  1JXS A;  1P9Q C;  2VON A;  2P81 A;  1JE8 A;  4XKV A;  3FXO A;  4V2G A;  4BH9 A;  2IA0 A;  4BDY A;  1FP1 D;  2STW A;  2YX4 A;  4XBF A;  2CUJ A;  3OL3 A;  4YG2 F;  3LAP A;  2WBM A;  2WWY A;  4KYW A;  1ZTR A;  2L0K A;  3HL2 A;  4HF2 A;  1YW8 A;  4BKX A;  1LUJ B;  2VPL A;  2QLZ A;  5E3M A;  1YYV A;  4I0A A;  1RRJ A;  1FZP B;  5LRR A;  2QM3 A;  5E20 A;  1PVE A;  1ZGW A;  2HPM A;  5DM7 F;  3JRF A;  3DBH B;  2Y0M A;  2IXS A;  2R7Z J;  5M5Y J;  3BLY A;  1VFC A;  3WU0 A;  5EEA A;  2HDC A;  2W4S A;  4M74 A;  2XV4 S;  5HVQ C;  5TRD A;  3K0L A;  4S05 A;  2ZFW A;  4OOI A;  1UG0 A;  4RB1 A;  1Y6I A;  5ERI A;  2STT A;  3M8J A;  4LG3 A;  2JT1 A;  3RPU A;  4A5N A;  4IJA A;  2D1V A;  2JK3 A;  1ZYR F;  3KX2 A;  4XRF A;  2M5W A;  4AYB N;  1NHA A;  2V7F A;  2KPM A;  4JX4 A;  3MKL A;  2DOE A;  1MBG A;  3SDG A;  2ZC2 A;  2DA3 A;  4XM3 A;  1O4X A;  1WH5 A;  3IV5 A;  2PLY A;  2E7W A;  4KT5 C;  4A3D J;  1FYL A;  3QWL A;  2MC4 A;  2PG4 A;  2M30 A;  1GDT A;  1VQN I;  1YLF A;  2FQ4 A;  3PUF A;  4CIC A;  2M45 A;  2V9P A;  1P7J A;  1DUX C;  2IT0 A;  4BEH B;  2K40 A;  3ISP A;  2KKO A;  5D4R A;  4RGR A;  2JUC A;  4GYI A;  1MW7 A;  3I59 A;  3SEZ A;  2PX9 A;  2W48 A;  2DFH A;  2FOK A;  3CF2 A;  4KN4 X;  1UST A;  4QSH A;  1QRY A;  4HX4 A;  5KNL A;  3U9G A;  3MZH A;  1X1P A;  4BNC A;  3E6D A;  1O57 A;  3PSF A;  4GXO A;  3JSP A;  3WHC A;  5B3S H;  2A61 A;  3IP4 B;  4JYK A;  4XR6 A;  4EJT A;  5EEH A;  2FQ3 A;  1D5V A;  3V4G A;  3W6J B;  2VBY A;  2WAF A;  1T0F A;  3OYM A;  1ZAR A;  3RIR A;  2V1N A;  1OR7 A;  4G7O F;  3JSO A;  2CUF A;  5E1W A;  1JJ6 C;  1Y0U A;  1UHW A;  1UJ8 A;  2EIN H;  4XOP A;  3MVP A;  3BQY A;  3O2P E;  3BG7 A;  2R7X A;  2ZB9 A;  2K9S A;  2XUB A;  2ESN A;  2XAF A;  2Z9O A;  1V3F A;  2VC0 A;  3BPV A;  4RMN A;  2CQN A;  1SD7 A;  3BZ6 A;  1UZC A;  4BHP A;  4PJM A;  2K86 A;  3HSE A;  4XN0 A;  1A04 A;  1UHM A;  2GWR A;  4K2E A;  2Y75 A;  4WK8 F;  5AIQ A;  2V1U A;  3S15 J;  3F8C A;  1T98 A;  5GTI C;  1P4W A;  4G9Y A;  3HEF A;  4S04 A;  3DQV C;  3IUO A;  2F2E A;  2LTP A;  1MJB A;  1ONV A;  1RI7 A;  4HPQ A;  1E3P A;  3CCJ I;  3I4P A;  3B02 A;  1XC5 A;  5BNG A;  2VJ5 A;  1MJ9 A;  2M3A A;  4Y3O A;  3GEZ A;  1TT0 A;  2HU9 A;  4AWX B;  1DP3 A;  5KAI C;  4KIG A;  5B5E C;  2LR8 A;  2RGV A;  1VQK I;  4OIN F;  3HZJ A;  4G12 A;  4PSW A;  4D5C A;  2DK8 A;  1GVD A;  2GLO A;  1QZZ A;  4O5V A;  3S3N A;  4AIH A;  2E5N A;  4BBR J;  3GTO J;  3I56 I;  1K4S A;  1SD4 A;  1YW9 A;  4N4N B;  3AKZ A;  2YUS A;  4HF0 A;  2QQB A;  3TO7 A;  1GXP A;  3WE2 A;  1WZ2 A;  4IQ4 A;  3AL0 C;  3CCV I;  2L9S A;  4A3C J;  2A07 F;  1FY7 A;  2XAH A;  2UXN A;  2E36 A;  4L5E A;  1N78 A;  5DCM A;  4WXH A;  5FFZ A;  4N4O B;  3DU5 A;  2W00 A;  5TGT A;  1XMA A;  5TJJ A;  2EIK H;  3CP8 A;  1W5T A;  2WTE A;  1QZY A;  1BI1 A;  2ZXJ A;  2FNP A;  1ETX A;  4HEA 2;  3I71 A;  1ZRE A;  1MDM B;  2CS3 A;  2HYG D;  3IAS 2;  5IOY A;  4BE1 A;  3LAJ A;  3J81 Z;  1YIO A;  2H94 A;  3BR6 A;  5F0C A;  3BR1 A;  4L5I A;  4U0W A;  3OSF A;  2KDO A;  1IW7 F;  2WV0 A;  3M1E A;  4HDU A;  1R49 A;  4A0Y A;  2CH0 A;  5D8K B;  4A69 C;  3S3M A;  2E1C A;  3ESW B;  3JRG A;  3JTG A;  1BJA A;  3OYN A;  1K61 A;  3HKZ N;  5HDN A;  5IP9 J;  2XPU A;  4RBO A;  1Y1V J;  2W1O A;  4PJ0 C;  1VQ4 I;  1O7F A;  5GAD J;  3LFK A;  2FE3 A;  2ZME C;  4M73 A;  1X3U A;  2A6E F;  4E7I A;  5DTD A;  4Y33 A;  5DEQ A;  3SEQ A;  3HC7 A;  1VQ9 I;  4BY7 J;  2DW4 A;  2HOE A;  2GM4 A;  3KYC B;  4EM0 B;  1J75 A;  3ZQH A;  1FBU A;  3KZZ A;  4LGW A;  1A31 A;  3WTS C;  4KT6 A;  3DTK A;  5D6E A;  1K4T A;  3HYI A;  1DDN A;  2BY3 A;  5IT9 K;  3BY6 A;  2K85 A;  4M3G A;  4DIQ A;  4YEL A;  2IGM A;  3G6E I;  3OYA A;  5E3O A;  5DCF A;  2GAU A;  3MEX A;  4BAC A;  3LSK A;  3G1O A;  2KZG A;  3F8M A;  1LE8 B;  1SFE A;  1W5C C;  2PMZ A;  3WTU C;  2DN0 A;  4CH7 A;  4NQW B;  3DPL C;  3RYP A;  4Q48 A;  1S7E A;  2K5C A;  3Q0W A;  2FD5 A;  1EA3 A;  3CUQ A;  3KIO A;  1ZH5 A;  1XX5 A;  3RYR A;  3GXO A;  1XS9 A;  3OR1 C;  4L0Z B;  2H8W A;  4BUP A;  2XAQ A;  2KZV A;  4JOM A;  4EVI A;  2Y31 A;  1JHH A;  1IXS B;  1A6I A;  4HX8 A;  4P5O A;  3OV8 A;  3A0H C;  3ZMD A;  4XLE A;  1O3Q A;  4EGY A;  1ETQ A;  1YFH A;  3TP3 A;  4RAZ A;  2LH9 A;  4KIC A;  2FSW A;  2O3F A;  3G71 I;  3WU1 B;  2EA4 A;  3ZMU A;  1TNS A;  3G73 A;  2XF6 A;  4IHY A;  3S1Q J;  1XGM A;  1K6O A;  2OCE A;  2FEZ A;  3CLQ A;  4L9T A;  4CCN A;  2ZXH A;  4XL9 A;  5CPR B;  4MIM A;  1GV2 A;  2LY9 A;  4P9U A;  4M71 A;  1ZGA A;  3ZP5 A;  2DMU A;  4ZDP A;  3IRQ A;  3I9V 2;  1AWC A;  2WAD A;  1WJ5 A;  2K9N A;  2XDV A;  3BJ6 A;  3BPX A;  4XKB A;  1R23 A;  2VBZ A;  1EV7 A;  1PUF A;  1EJ9 A;  1SFX A;  4UNO A;  5LBQ A;  2HEO A;  1XG1 A;  1JKO C;  2LMD A;  1WRJ A;  4GCV A;  2X0L A;  2AS5 F;  4XLA A;  2Y0S A;  2KJC A;  2NNY A;  3S8P A;  3KP4 A;  1TWG J;  2A6H F;  4HST A;  3RTR A;  4QLC U;  1IN6 A;  2ELJ A;  1MMD A;  1QQI A;  4ZDL A;  3CCU I;  1HDP A;  2Z16 A;  4J00 A;  1OR7 C;  4DW6 A;  3DKX A;  3E6B A;  2E2I J;  4BU2 A;  1RIO H;  4JX6 A;  2BHY A;  3SHF A;  4OWR B;  4AVZ A;  1AHD P;  3IRR A;  4OMY A;  2KHM A;  4PZJ A;  2PJP A;  1LDK B;  2VAS A;  1MH3 A;  1ACI A;  3RQI A;  4CCO A;  5C44 J;  2VIX A;  2VKD A;  3D5L A;  3T1B A;  1IDY A;  3G4S I;  1TQI A;  2RKH A;  1YX5 A;  3OYE A;  3EPZ A;  3JRB A;  3MZY A;  4ZZD A;  1S6L A;  1Z3Y A;  3F9K A;  2A5Y B;  1MSE C;  3EDP A;  2F6C A;  2XRN A;  2E1M B;  5K5Q A;  2R3S A;  4BE2 A;  4E7Z A;  1H8A C;  4MO7 A;  3PQK A;  2RRE A;  4IRG A;  4DQ2 A;  4LLG F;  4CUG A;  4EJU A;  3C2H A;  2DYS H;  3AG1 H;  3VSL A;  1JKR C;  5IT3 A;  1Y0N A;  2BY1 A;  2VPR A;  3DEW A;  4KA4 A;  4RLF A;  2YS9 A;  4RGS A;  2YSR A;  2R5Z B;  2M2E A;  1MNM C;  1TLH B;  4EJO A;  2K9M A;  5K7H A;  2W7N A;  2K27 A;  4M3F A;  3TP0 A;  4AM3 A;  5BQT A;  2KIS A;  2LFB A;  5HOD A;  2J5O A;  5EZH A;  4HZF A;  2X4H A;  3ZMT A;  3C18 A;  2HQR A;  3R0A A;  1KQ8 A;  5EEG A;  2M0C A;  3G3Z A;  3PNV A;  5DD4 A;  3CP2 A;  2V4J C;  3S1M J;  2K4J A;  4BBS J;  3IKT A;  1LFB A;  4PUS A;  3TKY A;  2ETH A;  2CW7 A;  3K69 A;  2E71 A;  3CC4 I;  3H1C A;  2XAS A;  1TBX A;  3A4C A;  4V2F A;  2V79 A;  1U5T B;  5LEJ A;  2L3D A;  2GBY A;  3ABM H;  4HYE A;  3C2G A;  5FLV A;  3T0Y A;  1B8I B;  1IDZ A;  3L2U A;  4RAF A;  5JR3 A;  1OCO H;  4X1E A;  1D3Y A;  1ZK8 A;  3CJR B;  1BC8 C;  1ZRC A;  3NAR A;  1BW5 A;  4UB8 C;  3LSR A;  3ZQ7 A;  1IRX A;  3TDZ C;  3E3V A;  3G1M A;  2VN2 A;  3GBG A;  5ILU A;  4CGZ A;  5K7Z A;  4CYC A;  2Q1Z B;  1I1S A;  5B1B H;  3GTK J;  1WCM J;  4KJZ A;  1VQP I;  3TW7 A;  3CC2 I;  3OYI A;  2O0Y A;  2JTV A;  1VI0 A;  5IT9 Z;  3A01 A;  3OSG A;  4IF4 A;  4PGG A;  2L7M P;  4OAZ A;  4B3A A;  4ABZ A;  1D1A A;  4Q5S F;  3BCA A;  5CVJ A;  2G7U A;  3RSN A;  3CLO A;  3K7A J;  4RB2 C;  2YR2 A;  3BJO A;  4KFC A;  4M72 A;  3IKV A;  1YQA A;  3OYC A;  2D2W A;  5JFR A;  1R5H A;  1BIB A;  2PMH A;  2JJ7 A;  2NOG A;  1N25 A;  2XKP A;  4I09 A;  3F8F A;  3BWG A;  2BVM A;  5EZG A;  3IC7 A;  2YU3 A;  2MAB A;  2DA4 A;  2EB7 A;  2VKH A;  4XKC A;  5EG0 B;  2PJR A;  5DD8 A;  4BJ6 C;  3H5A A;  4M3B A;  4BGD A;  2DPD A;  4M9S A;  3OIQ A;  1SVM A;  1A6Q A;  1YE9 A;  2F5E A;  4YFN F;  3ZQG A;  5L3F A;  3CCR I;  1WKM A;  2Q2E B;  3LSP A;  1YJN I;  1PYV A;  1STZ A;  1MH4 A;  3H9Q A;  1SAX A;  1VF9 A;  3OWT A;  3F3X A;  3HB9 A;  5FLX K;  1Z67 A;  1YHQ I;  4FAS D;  2E1O A;  3CUO A;  3ZRG A;  2VXD A;  2X6X A;  4XK4 A;  5FKL A;  5EGO B;  3RQ4 A;  1OCC H;  1ZAO A;  2YPR A;  4FT8 A;  3BTI A;  2HFH A;  3FDY A;  1OIS A;  5M3F J;  2E1N A;  4JK1 X;  4IHV A;  1E0E A;  1LFU P;  1MBF A;  2P6T A;  2OF7 A;  1P4X A;  1R4M B;  2NVU B;  2DMN A;  2LVS A;  2CV1 A;  2DOF A;  3TED A;  3F6V A;  3AG3 H;  2JWT A;  4M3D A;  4D5F A;  1N77 A;  1QZE A;  2F48 A;  5FB2 A;  1QHH D;  4ZJZ A;  1G8X A;  1DP7 P;  2IS1 A;  2R92 J;  5F0H A;  1G3Y A;  2P5L C;  4L9N A;  1OLT A;  1NK2 P;  2H6B A;  3MCZ A;  4AD9 A;  4X6A J;  5M5X J;  2YU9 J;  1SMY F;  2V1D A;  2E60 A;  2GXA A;  1F43 A;  4ZYD A;  4IL6 C;  1RC9 A;  1OKR A;  3S2D J;  1JT0 A;  2DAO A;  3L7W A;  3SZG A;  4M6X A;  2FNA A;  3S1R J;  2FF4 A;  1SMT A;  1UAA A;  2W24 A;  5BPI A;  1HBX G;  2BZT A;  3ZMS A;  1BW6 A;  4LIT A;  2RVC A;  1FMW A;  1YX3 A;  4XSZ F;  3F0C A;  2ID6 A;  3C1D A;  1EF4 A;  4AYB A;  1SFO J;  2MGQ A;  2QBY B;  3CCY A;  3RPQ A;  4ENJ A;  1BL0 A;  2O9L A;  4MHG A;  1RR8 C;  4F93 B;  4G6Q A;  3TDU C;  3MKZ A;  1FTZ A;  3B6A A;  3HOX J;  1ORK A;  2IJL A;  1EKE A;  4OIP F;  2L9R A;  1APL C;  3LOC A;  4HRI A;  3BC8 A;  1ENH A;  3H35 A;  4XKW A;  3P9K A;  4XMY A;  1GVJ A;  3MZ8 A;  4LB6 B;  3O8H A;  4XLN F;  4GFB A;  5E8I A;  1B72 B;  5GPA A;  1JKP C;  4NDL A;  5LGT A;  4GO1 A;  2M4K A;  4IHT A;  3M1C A;  2R7R A;  2FA5 A;  2JVH A;  2ZNZ A;  3GTJ J;  1YIT I;  2A3S A;  2E34 A;  4I0B A;  3GX4 X;  2RQP A;  3KP2 A;  5IP7 J;  1RZ4 A;  2Y48 A;  1ETO A;  3DBR B;  2UWM A;  3BZK A;  4LJZ F;  3HIF A;  1AA7 A;  2IP2 A;  1KQ0 A;  1WI3 A;  2MG4 A;  3M7G A;  1FTT A;  3T5X A;  3QPT A;  3GFM A;  4YFX F;  3HPG A;  3ERM A;  3GME A;  3IHU A;  2LDU A;  3CCQ I;  3EUH A;  2AO9 A;  4O6J A;  1DGW Y;  3VEP A;  3CMM A;  1Y8Q B;  3KP6 A;  4BEH A;  4WWC A;  3D5R C;  3F22 A;  1Y39 A;  4BJ5 C;  3GZ5 A;  3BOQ A;  1QBJ A;  1VTN C;  1DGR M;  4IOA F;  3PFY A;  3L2Q A;  2DA7 A;  2ISY A;  5KCM A;  2DCE A;  4IQJ A;  1OCR H;  3GYH X;  1EH7 A;  4IVN A;  5L3B A;  3I4N J;  4KIT B;  4L9V A;  2JQ7 A;  2ESH A;  3K4K A;  3I0T A;  4HA8 A;  1UB9 A;  5CJ9 A;  3SFI A;  4IKF A;  2GXG A;  3QP5 A;  4P9F A;  4N0B A;  5CQE A;  1DU6 A;  4J19 A;  2DFI A;  2EWN A;  4S0H B;  4QPO A;  4Q47 A;  2EIJ H;  3AL0 B;  3ABU A;  3DLA A;  3C3W A;  4XRS A;  1HA8 A;  1LFP A;  3PQJ A;  4HNT A;  3FBI B;  3V8L A;  5CLS A;  5GPC A;  1MBH A;  2N8G A;  2X1D A;  3M8F A;  4ENN A;  4GDF A;  2PI0 A;  1Z7L A;  2JRT A;  1D8K A;  5HLG A;  3GVA A;  2KLO A;  5BPD A;  3HOU J;  3Q5F A;  3OMY A;  1OQY A;  1D1B A;  3GZN B;  1RNL A;  3FKJ A;  2KIU A;  3HOV J;  4ON0 A;  4UXN A;  4F7Z A;  1WJD A;  5F08 A;  1ZG1 A;  4F92 B;  2QQ8 A;  2ZKZ A;  3HM5 A;  2FBK A;  3CCS I;  3BJA A;  4BY1 J;  1FOK A;  3K6G A;  2R7U A;  1S3J A;  4ENM A;  4MEY F;  1SVO A;  3TO6 A;  1LEB A;  1HXD A;  3FM5 A;  2QGU A;  3F6O A;  2JUG A;  2BVL A;  3CO6 C;  1TWH J;  2QVO A;  2HQN A;  4BYY A;  1A35 A;  1YJW I;  3BQZ A;  2VQC A;  2XSD C;  1R6R A;  3DP7 A;  3FXQ A;  4B47 A;  3M3Y J;  1FOW A;  1MNE A;  2CU7 A;  2QQ9 A;  2W85 A;  2F5D A;  3QP6 A;  3HRT A;  3RKY A;  1DU0 A;  1WGX A;  4BE0 A;  1U9O A;  4UVA A;  2C6Y A;  1BC7 C;  3HKZ A;  3LMM A;  1TQM A;  3GWZ A;  2V1X A;  1ITY A;  1S5L C;  2DFE A;  4UUT A;  2HVR A;  1GV5 A;  3IH2 A;  2HPI A;  2IW5 A;  1Z3X A;  1DQU A;  1WJE A;  1Z0X A;  5CKT A;  3JAM K;  2P0W A;  1YRN B;  3FBN B;  5GAG J;  4I7H A;  3KLN A;  3I54 A;  3F72 A;  1QPI A;  4UUV A;  5D5U B;  2QYO A;  2M4G A;  1MKM A;  1E17 A;  2QSH X;  3RZO J;  3BTL A;  4A0Z A;  3D1N I;  1H9T A;  3G2B A;  3TO9 A;  3N05 A;  2ELH A;  2H8R A;  4I76 A;  3DV8 A;  5IP6 A;  4G7H F;  2HGC A;  3LSH A;  3PM1 A;  5ILV A;  3TOA A;  3WGG A;  2RV8 A;  4H4K C;  2FOW A;  1Z1D A;  3IL2 A;  2F4I A;  3HTS B;  3QPL A;  4DYQ A;  4A12 A;  1CF7 B;  2XKO A;  1BR4 A;  1HST A;  2X48 A;  3K9T A;  1Z6T A;  5IYD J;  3U21 A;  2RQQ A;  2R7T A;  1R1U A;  1W4M A;  1FC3 A;  1G3T A;  2BY2 A;  2VI6 A;  5F0F A;  3DTI A;  1LDJ A;  3HUG B;  4HQE A;  2OC6 A;  1W36 C;  3MKW B;  2E5Z A;  4HBL A;  4MFE A;  1ZG3 A;  2XVC A;  1T38 A;  3WG9 A;  3BZC A;  1B4A A;  2FMY A;  5F1J A;  2XGC A;  4UUS B;  1RKT A;  4D0P A;  2KMU A;  1ZG5 A;  2ZJQ F;  3FM3 A;  3L00 A;  1SFK A;  2WAE A;  4XRM A;  1MJA A;  2XAG A;  3ZQI A;  3I59 B;  1FNN A;  3DCF A;  5HDG A;  3KFW X;  2IGN A;  3SYT A;  1G2H A;  3W6V A;  3MAJ A;  3WOD F;  1LPQ A;  1IXR C;  1TW3 A;  2FX0 A;  4G6T B;  4ZYA A;  4F52 A;  4QTR A;  4G6D A;  4NC8 A;  3V8K A;  4Z2Y A;  2XF7 A;  2DYR H;  2K3F A;  3FMQ A;  3VB2 A;  3W2W A;  4A3F J;  1LE8 A;  1F9N A;  2CFX A;  2VT3 A;  1ZLK A;  5J4V A;  2IS2 A;  1XCV A;  2Z99 A;  2JPC A;  4NQW A;  1BM9 A;  5HS8 A;  1IN4 A;  5DM6 F;  4A93 J;  2DI3 A;  2M7B A;  1WHU A;  1V55 H;  2EV6 A;  5DV5 A;  3E0J B;  5H6Q A;  3I55 I;  1U9N A;  2R4G A;  4RA2 A;  1TWC J;  3OYL A;  2W25 A;  2IS4 A;  1IXC A;  2PQ8 A;  2FML A;  3VFZ A;  5J6X A;  2K9L A;  1F1Z A;  5L3G A;  2LKX A;  4P1W A;  2NS7 A;  3PO2 J;  2X6Y A;  2CWE A;  2MH9 A;  4W97 A;  4PDK A;  2BBY A;  2M1B A;  1YTY A;  2HYF A;  1XGS A;  2VUM J;  1HKT A;  3DPT A;  2QWW A;  2FBH A;  2ECB A;  4G94 A;  2HVQ A;  1VQM I;  2CQ7 A;  1PP8 F;  3QOP A;  2LNB A;  3SZT A;  5FO5 A;  5HS7 A;  5FD6 A;  2JSC A;  2ECC A;  1FJL A;  4KDP A;  4CCK A;  3HRM A;  5J1U A;  4PJJ A;  1P7I A;  2O61 A;  3RJP A;  3DEE A;  3L2R A;  3CDH A;  1X4P A;  1XDU A;  3VWB A;  3OIP A;  4NC7 A;  4C30 A;  2VOO A;  2HOT A;  1FMV A;  1X2N A;  4D9J A;  3SQN A;  4F55 A;  2JPB A;  2O7O A;  2LG4 A;  3NRV A;  3DPU A;  5CVR A;  2M8G X;  5FJ8 J;  2XRL A;  3JW4 A;  3TL4 X;  1FYK A;  2NVQ J;  2QKM B;  1AU7 A;  2DMQ A;  2LKS A;  3TQN A;  2F5F A;  1X1D A;  2IAI A;  5EDN A;  2LK2 A;  3KZI C;  2EA2 A;  4A3M J;  3ABT A;  2YX7 A;  4WCG A;  3HJE A;  3FXU A;  3I3L A;  2OV7 A;  3SZP A;  2MW8 A;  3JTH A;  3KEY A;  1KON A;  2OQR A;  3PIO F;  2ZSH B;  5FD5 A;  5GAH J;  1XCB A;  3J80 K;  3GFJ A;  2M8E A;  1JHF A;  4D1Q A;  1H89 C;  3E6C C;  3SFZ A;  1R1T A;  4RB3 C;  3W3C A;  3S32 A;  1WWX A;  2IEK A;  1QA6 A;  5IYB J;  1SD5 A;  3X2Q H;  1I3Q J;  3QYB A;  3VPR A;  3S16 J;  1R58 A;  4NB5 A;  2DPU A;  1XN7 A;  4BJT A;  1QO0 D;  2VT2 A;  1Z6R A;  2QEX I;  2FJ1 A;  1U8R A;  2NAZ A;  1KZH A;  4IHS A;  3P9C A;  4I02 A;  4DJA A;  2L02 A;  1KU9 A;  1ZRD A;  3QQA A;  1YG2 A;  3RCO A;  5KK1 A;  2RC4 A;  5LGU A;  2AQF A;  5JVG F;  4IHW A;  1XDS A;  3KEQ A;  2R5Z A;  1Z21 A;  1TTY A;  2KT0 A;  5ICE A;  1IF1 A;  5FRM A;  4FX4 A;  1HW5 A;  3H3Z A;  4YFK F;  4I01 A;  2L01 A;  3CF5 F;  2XHK A;  3CZ6 A;  5E8G A;  3JAM Z;  1YW7 A;  1E3O C;  5ILS A;  2NNN A;  4DBR A;  3P7N A;  1P4A A;  1QGP A;  1BI2 A;  3B6C A;  2QCO A;  3TBI A;  1TQP A;  2H6C A;  1J5Y A;  2V9V A;  3K10 A;  5J47 A;  4BS9 A;  1K78 B;  4HV6 A;  1T0F C;  3PNY A;  4NBQ A;  1HCR A;  3GW2 A;  2EZH A;  1V5G A;  2H27 A;  3K2A A;  2KIQ A;  4XLF A;  1KQ9 A;  1U78 A;  3PUB A;  3E97 A;  3K1M A;  1U5T A;  2K7L A;  3UNG C;  2X6O A;  1TWF J;  4TV7 A;  2ELK A;  2OJE D;  5H6R A;  3QOD A;  4EEF G;  3L09 A;  1KYZ A;  4U0V A;  2X51 A;  4EJV A;  1B8I A;  3WGH A;  3T8T A;  1W7P D;  4BXF A;  1LB2 A;  1X1A A;  1TT5 B;  4U0Y A;  1Z9C A;  1WPK A;  1L3L A;  2WV1 A;  1B9N A;  1T33 A;  2V6C A;  4ZYH A;  2OD5 A;  2QF7 A;  4RAY A;  5FRN A;  2RN7 A;  3L2V A;  2VB6 A;  1B9M A;  4MQV A;  3F23 A;  2VBX A;  3NWS A;  1I50 J;  2MH2 A;  2HI3 A;  4HSR A;  3A1Y A;  4KMF A;  2VOD A;  1JTY A;  3S14 J;  1QPM A;  2P7C B;  4CZC A;  1S7A A;  3H3U A;  1R36 A;  1QU3 A;  5F27 A;  2M7A A;  2IS6 A;  1MSF C;  3KYL A;  1ETK A;  2KIM A;  3H3V K;  2DA6 A;  5C4X J;  4BHC A;  2L9V A;  2EFW A;  2CG4 A;  2ZJP F;  2DDA A;  2X85 A;  1KU3 A;  3DXJ F;  1HW1 A;  2CFO A;  5DS9 A;  5EG0 A;  3FZV A;  1VQ8 I;  4RLQ A;  2M0M A;  2CQK A;  5FKM A;  3ECH A;  3JRE A;  2DDB A;  1I3A A;  3GTQ J;  4A3G J;  5K5R A;  1SAN A;  2K02 A;  2P6S A;  3FIS A;  1IC8 A;  1FBS A;  4PK4 A;  4E7H A;  2WAQ N;  3ZOB A;  4XON A;  4NUB A;  2Q2E A;  1X1B A;  1X3W B;  3VOD A;  3OYG A;  1KGS A;  3R61 A;  1HC8 A;  1BI3 A;  2ZBK A;  2CO5 A;  3I64 A;  5JI6 A;  2H1L A;  5EGO A;  4MTE A;  3VYS B;  3SXY A;  4KNY A;  4B48 A;  1R1V A;  1PUE E;  2EFQ A;  2E7X A;  1ON1 A;  2WC2 A;  1RKW A;  1XSX A;  4RM3 A;  1WVR A;  2FU4 A;  1IUF A;  3ZPL A;  2HDD A;  4R8H A;  1W1W E;  4ESJ A;  3CMA I;  1ZRF A;  4W1U A;  2CSO A;  1Z7U A;  2VJ4 A;  2D1H A;  4DZP A;  1BOA A;  1VND A;  4D7N A;  2VLA A;  4M6Y A;  1GLN A;  3I58 A;  3WHB A;  4AIK A;  1PDN C;  2ICW G;  1ZQ3 P;  5J3L A;  2DBB A;  2D45 A;  2IRF G;  2AQE A;  1QHG A;  4NHJ A;  3E7L A;  3R4K A;  1GXQ A;  5ICC A;  5L3E A;  1WJF A;  3K4B A;  5JVT A;  3PJR A;  4RAG A;  3HRU A;  3GLL A;  2KQR A;  3JRA A;  1GT0 C;  2G9W A;  3LSM A;  2XAU A;  2P8T A;  3K1N A;  1FPQ A;  3IAM 2;  4IO9 F;  1F4K A;  1VZ0 A;  1U3E M;  3OYH A;  1IAW A;  2LSO A;  4FTH A;  2UV1 A;  2R5Y B;  1OYW A;  4WF2 A;  1JI8 A;  4BXU A;  2RDP A;  1ON2 A;  2UXX A;  3F8N A;  1P6R A;  2LBF B;  2QZ8 A;  4LK1 F;  3OYJ A;  4MNU A;  1HSJ A;  2E35 A;  5D6F A;  5HS9 A;  5EYR A;  4C3J J;  3LNQ A;  1W7P B;  3HOT A;  4MQ9 F;  4ZYE A;  4JBA A;  3CUQ C;  2EV5 A;  2CUE A;  2FUG 2;  2MLK A;  2DJN A;  2PBI A;  4ANJ A;  1USS A;  3WTX C;  1BI0 A;  2XGE A;  2VQL A;  2WB1 A;  3W6K B;  1K83 J;  2R7Q A;  3GTG J;  2VKE A;  1V5E A;  1XMX A;  4DBQ A;  2BW3 B;  1MMN A;  2A6T A;  2L5Q A;  1TZL A;  2GOX B;  4YIF A;  2PFB A;  1LEA A;  3R60 A;  4CDG A;  4I2O A;  2IA2 A;  1MMG A;  3FHN A;  4YIR X;  3RKW A;  1B72 A;  4IPA A;  3GFI A;  3LL7 A;  2DMT A;  4IXA A;  2G7H A;  5HOO A;  3BG3 A;  5LHI A;  4HX7 A;  3DKW A;  4HQM A;  2EFN A;  3GTL J;  4P55 A;  1TNT A;  2Q0O A;  2CJJ A;  5K1Y A;  2R7F A;  4CCL A;  1WJC A;  4B1R A;  1D5Y A;  3LA2 A;  3CCM I;  5HNF A;  5J1R A;  1H0M A;  1FT9 A;  1S8N A;  2AXT C;  1MGT A;  2CV0 A;  1V54 H;  3Q3S A;  4B44 A;  3HG9 A;  3BRO A;  1FYM A;  1VQ6 I;  2VC1 A;  4CXF A;  1IRF A;  1DPU A;  1FX7 A;  4C9Y A;  4BXX J;  3TMO A;  3JR9 A;  3OY9 A;  4OMZ A;  2AXL A;  3Q0V A;  2BXY A;  1R9T J;  1FOY A;  4Y17 A;  1OJL A;  2BEO A;  2F4M B;  5FGM A;  3ZMZ A;  4WXD A;  2DQR A;  2K9Q A;  2HXO A;  1YS7 A;  2BE5 F;  1X1C A;  3ZR8 X;  3K4M A;  2BYV E;  3ZQC A;  1O3T A;  1RES A;  2DTR A;  3BDD A;  1YOV B;  1ZKG A;  4UVC A;  3GO5 A;  4GRI A;  2QA4 I;  1ERD A;  1HKS A;  4IZZ A;  1FLI A;  3HOZ J;  5F6F A;  5IOZ A;  5EJC A;  2Z2S B;  1VQL I;  4A6D A;  2CRG A;  3COA C;  1TW2 A;  2DO7 A;  2L7K A;  5H20 A;  1D0Z A;  4ZTJ A;  4FQG A;  3MMY B;  5FFX A;  1U5T C;  1R71 A;  2XB5 A;  3WG7 H;  4BQO A;  2JA5 J;  4BL0 B;  4WX9 A;  3IWF A;  1FP2 A;  3U2R A;  5B66 C;  3OYF A;  1F36 A;  4LLL A;  4H0E A;  1UHS A;  3H9G A;  3I53 A;  5JHU A;  3ZN1 A;  2PEX A;  5HLI A;  5B1A H;  1HKQ A;  4NC6 A;  3LSG A;  3C2B A;  3BG5 A;  3J7A O;  5CQG A;  4ZDO A;  3KEO A;  4M9Z A;  2OTL I;  3UKG A;  3RI4 A;  3HOY J;  3CJQ B;  1WI9 A;  3TGN A;  3RPU D;  3HDD A;  4FX0 A;  2H09 A;  1W0U A;  5FRO A;  2MSY A;  5ED4 A;  1SD6 A;  3M9A A;  2W57 A;  2DA2 A;  5K7F A;  3HOS A;  4LG0 B;  3PIP F;  2JSP A;  1TL8 A;  1SFU A;  1S7O A;  1HF0 A;  3WTW C;  3JRI A;  3U1D A;  1TC3 C;  2O8K A;  4A6E A;  1T39 A;  2Z33 A;  3ZGK A;  4DNC A;  3B73 A;  3K70 C;  3LQQ A;  5DYM A;  4UHT A;  1ZR4 A;  3ELK A;  2LY1 A;  2Y9Z A;  3T8R A;  1JUS A;  2ZSI B;  2ZJR F;  4EJW A;  3JRC A;  4OIR F;  2Y2Z A;  3P5J A;  3KZY A;  5D4S A;  2NVT J;  4M6V A;  2IPQ X;  5FKO A;  1IRZ A;  4IHX A;  5EF6 A;  3WGI A;  1R5G A;  2L9N A;  2VQH A;  1OCZ H;  3FMS A;  3SJM A;  2HZD A;  1XSD A;  2LY2 A;  4LFU A;  2DT7 B;  2EPF A;  5J4Y A;  2EIL H;  3FXL A;  1QVT A;  3V8J A;  1E2X A;  1AKH B;  4XOT A;  2QQA A;  3FK7 A;  3H92 A;  2MFZ A;  2DT5 A;  1YRN A;  5IY5 H;  1D8J A;  1IN8 A;  2R7S A;  1T6S A;  2FRH A;  2JMW A;  5IYC J;  4FE4 A;  3KET A;  4F91 B;  1MMS A;  1IGN A;  4XID A;  1IRG A;  1A36 A;  2NVY J;  4L18 B;  4ZZL A;  1BOB A;  3GCM A;  3Q9V A;  4U87 A;  2OZ6 A;  4PSX A;  3ERE D;  3CD6 I;  4D7M A;  1IG7 A;  1OPC A;  4QIW N;  5JHF A;  4LB5 A;  1VQ5 I;  2JA8 J;  2Z5U A;  2LF7 A;  3KP3 A;  5K5O A;  3FXJ A;  5DUI A;  2CGP A;  1XD7 A;  2BY0 A;  3K1P A;  3VOE A;  4E4H A;  1NK3 P;  5BMZ A;  2ZO4 A;  2L4A A;  4V19 K;  5H2F C;  2OAZ A;  3MN2 A;  5FLX Z;  1CF7 A;  3CDI A;  1RET A;  2ZME B;  2LKP A;  4A2U A;  2DOA A;  4OU0 A;  3ECO A;  2DTZ A;  1G6N A;  3ONQ A;  4EQQ A;  2Z3Y A;  1FOX A;  2K3P A;  2CW8 A;  3DWL E;  3KLO A;  3E5Q A;  3KP5 A;  5ICG A;  1HLV A;  9ANT A;  1FIA A;  2B9S A;  1SVL A;  2CUZ A;  3HUG A;  3E6M A;  4AUX A;  1MND A;  1PJR A;  3RKQ A;  3VSK A;  1F5T A;  1D0Y A;  5D5V B;  3BG6 A;  1XB4 A;  3LQR A;  2HTJ A;  4CZZ A;  4ASN A;  1R7J A;  1I6H J;  2A5W A;  4UUS A;  2ACJ A;  4RS8 A;  1H88 C;  2HTS A;  4XSX F;  2HVS A;  5LD2 C;  4HDV A;  2B63 J;  3RDI A;  4B4C A;  3FHZ A;  2P5V A;  4C2U A;  4Y4R A;  4O3M A;  3KE2 A;  2GQQ A;  5TIS C;  1ZEL A;  1OYI A;  4EMS A;  3W2A A;  3FIW A;  3OOU A;  3CDL A;  1UMQ A;  1OFC X;  2KIF A;  2MA3 A;  2QSG X;  2E19 A;  2K4B A;  1IV8 A;  2L4M A;  4M9X A;  3MFK A;  3O8G A;  4EAT A;  2OA4 A;  4P96 A;  4OIO F;  1T2K A;  1RUO A;  3J7Z I;  1MDM A;  4EM2 A;  1R5I D;  4A3J J;  3HHH A;  3HBL A;  1W5S A;  4DOZ A;  5GTH C;  1YIJ I;  3VDX A;  3U1K A;  3S3O A;  4HG2 A;  1ZR2 A;  4IEJ A;  3L2W A;  2M34 A;  2NRA C;  2JA2 A;  2VBW A;  4M3E A;  4II2 A;  2MD5 A;  4PFO A;  1XSV A;  2VL8 A;  1I6X A;  1LKX A;  1KYW A;  4ZYG A;  3HGY A;  1LQ1 A;  3OIO A;  4RGX A;  2XGD A;  3PFI A;  3PNT A;  1ETY A;  3DU6 A;  1YO5 C;  2VJJ A;  4IRI A;  2ZXW H;  4AC0 A;  1ETW A;  2HOA A;  3M4O J;  3ZCO A;  4FCY A;  5CVI A;  1B1B A;  2EK5 A;  3DBL B;  2VE9 A;  3CME I;  2JA6 J;  5E1Z B;  1KU2 A;  2A69 F;  2DK5 A;  1W0T A;  5E1X A;  2GIZ A;  1O3R A;  1U6G A;  2KL4 A;  2HYJ A;  2F5C A;  1WQ2 A;  3PL8 A;  1XMK A;  3NAU A;  4A3B J;  5J1Y A;  2R7O A;  2IGK A;  1ULY A;  2MLG A;  1BBY A;  2PN6 A;  3H36 A;  2HOS A;  4OAY A;  1IUY A;  3EYI A;  1YS6 A;  4MTD A;  1WFX A;  1DPR A;  3H9J A;  3D0S A;  3J7Y J;  4N9H A;  1SAU A;  2DQL A;  3W2V A;  5F64 A;  3BTC A;  1SC7 A;  1J7K A;  3DEU A;  2VQG A;  3BR5 A;  3BT9 A;  3IWZ A;  3HHG A;  2VKV A;  1FSH A;  1XTA A;  3ZN0 A;  1D0X A;  1FSE A;  1MD0 A;  4YII A;  3A2K A;  4U88 A;  2DLL A;  1S29 A;  1IN7 A;  2EH3 A;  2R7D A;  1PP7 U;  3NEU A;  3A03 A;  2HQA A;  4ITV A;  3BCB A;  3MWM A;  3OS2 A;  1R22 A;  5E18 F;  3CO7 C;  1IO2 A;  3QYE A;  2ZNY A;  3ASO H;  5LGN A;  4HF1 A;  4A5M A;  1K7A A;  3I4M J;  4Y15 A;  4FIS A;  4A0X A;  3BP8 A;  1MBE A;  2I8D A;  2QKL B;  3DTE A;  1QNT A;  3UR3 C;  4I98 B;  3GTM J;  2W82 A;  1Z77 A;  4B8X A;  1Y8R B;  1G4D A;  1IZ1 A;  4AID A;  2RAE A;  3H0G J;  3S93 A;  2XC7 A;  1R4N B;  4KIB A;  4A3K J;  3EUH C;  3RKX A;  2FBI A;  5L3C A;  1LVA A;  3LWF A;  2CQQ A;  1G59 A;  2L7F P;  4X0G A;  3QRF F;  4J01 A;  2VE8 A;  1BN5 A;  4Z6Y A;  5A2Q K;  5CYV A;  3P9I A;  1SEU A;  5KHD A;  3VYU B;  3A02 A;  4ESB A;  1J2X A;  1MBJ A;  2B0L A;  1MZB A;  5CVU A;  1J0R A;  1LDD A;  2UZK A;  4CHU A;  2LF8 A;  2OCC H;  4JP0 A;  1WJA A;  2NYX A;  1UFM A;  2FXA A;  2VOP A;  2I10 A;  3DFG A;  3O3K A;  2MYS A;  3J7A Y;  3S2H J;  1HQC A;  5D5W B;  1O7L A;  4LMY A;  4XN3 A;  1VQO I;  4G8X A;  4KUM A;  1K78 A;  3AFH A;  3CCE I;  5ICF A;  4KIS A;  3BG9 A;  4OIQ F;  1P2F A;  2L54 A;  3TW6 A;  4L9J A;  2W84 A;  3MQ0 A;  1VQ7 I;  2O03 A;  4U7D A;  4XNF A;  2Y9Y A;  5DCM B;  4DGW B;  5L3D A;  4XLH A;  3RZD J;  3D5S C;  4PJL A;  3QU6 A;  2E2J J;  2D5V A;  3S17 J;  4ZH4 F;  2WY7 Q;  2GA2 A;  4C3H J;  2LRE A;  2HR3 A;  3GUD A;  4KN7 X;  1X4O A;  4LIV A;  5F04 A;  4U7B A;  3OR2 C;  4LIU A;  2EQR A;  3F8B A;  1N75 A;  2DT6 A;  4HAM A;  4BQN A;  2RNG A;  1YI2 I;  3MD2 A;  2I5U A;  2OUM A;  1Z91 A;  1U2W A;  1T56 A;  2BGC A;  3ULQ B;  1I5Z A;  1BIA A;  1U0J A;  3HGG A;  3FK6 A;  2P7V B;  2WAQ A;  1HDD C;  4LD5 A;  1JUM A;  2XPW A;  3WTV C;  4XOR A;  1OCT C;  2X1E A;  1BA5 A;  1S9H A;  4I6Z A;  1REP C;  2BHZ A;  2LOO A;  1NTC A;  2MC3 A;  2NOJ B;  3BR0 A;  1T8I A;  4FE7 A;  1POG A;  4BQQ A;  1BR2 A;  2NVX J;  2CYY A;  3K4N A;  4QPQ A;  4LK0 F;  2ME6 A;  2XF5 A;  4LLN A;  5E17 F;  4UVB A;  5C4J J;  2OU2 A;  4XQF A;  2ME0 A;  3EUA A;  5FKK A;  4HNV A;  3GZ6 A;  4LOC A;  2HQ5 A;  2R7V A;  3I5U A;  2QEN A;  3QYF A;  5AON A;  3R0J A;  3L1P A;  4A3I J;  1C0W A;  4MFD A;  1X58 A;  3CES A;  4GYG A;  4MLO A;  2EFP A;  1E3H A;  2XPV A;  4L5J A;  2COM A;  3ZXS A;  5M5W J;  2DXI A;  3BR3 A;  3K70 D;  4IOC F;  3ML6 A;  4HLY A;  4NNJ A;  2ZFU A;  2R93 J;  4YRV A;  1JUP A;  5LHG A;  2IBD A;  1UCR A;  2R7W A;  3CUQ B;  3WE3 A;  1YJ9 I;  5GAE J;  2A05 A;  4CA0 A;  1WSU A;  1K6Y A;  4R1H A;  1UEL B;  4E6K G;  3L2C A;  3WU2 C;  4UV9 A; 
#chains in the Genus database with same CATH homology
 2OZU A;  4ETS A;  3E5X A;  1HW2 A;  2KRF A;  2GIV A;  2GZW A;  4JQF A;  2MBF A;  1KA8 A;  2QUF A;  5LEK A;  2NS0 A;  3EET A;  3HTU A;  2CW0 F;  2IVM A;  1FBQ A;  2JZY A;  4ENK A;  4MEX F;  3N4M A;  3HRS A;  2Q8K A;  4RB0 A;  2DU9 A;  5J8C A;  3LA7 A;  2ISZ A;  3ZMV A;  3QAH A;  3LST A;  2ZJ2 A;  2GXB A;  5CVV A;  1O3S A;  1Q1H A;  1W7P A;  4AIJ A;  3V7R A;  5BS6 A;  1ZGJ A;  3FWE A;  1AOY A;  3C7J A;  3LA3 A;  3N97 A;  4EV0 A;  5DDG A;  3V7C A;  3V7S A;  1B59 A;  1ODD A;  5A2Q Z;  1IN5 A;  4MGR A;  6PAX A;  4WXC A;  5BOX A;  5AIP A;  1I1G A;  5D8L B;  2O6G E;  2GA1 A;  2XIG A;  3Q9S A;  2EFO A;  3GFL A;  2BV6 A;  4PGH A;  5DUK A;  3R6S A;  3DF8 A;  5LLQ A;  3EQL F;  3FF5 A;  2HS5 A;  1GHC A;  1OMI A;  2XGX A;  4GGG A;  3WTY C;  3CJN A;  2EJR A;  4HW0 A;  4EGZ A;  3AAF A;  3J80 Z;  1J59 A;  1H9G A;  2QBY A;  2HKO A;  1OYY A;  5LHH A;  4KIF A;  4FHT A;  3FX3 A;  2XAJ A;  3HSR A;  4R79 A;  4RGU A;  1LJ9 A;  3KP7 A;  1G3S A;  1LNW A;  1XGN A;  2KJB A;  3QU3 A;  1Z05 A;  1B6A A;  3WTT C;  4G7Z F;  1KU7 A;  5F1R A;  3OOP A;  3L9F A;  3HSF A;  4CYD A;  1J9I A;  2HZT A;  1ZHF A;  3KCC A;  3REO A;  4N9I A;  3GLX A;  3NQO A;  4LG0 A;  3CTA A;  4UV8 A;  5KVR A;  3FMR A;  1R00 A;  4QWQ A;  5LRS A;  3O6B B;  1L0O C;  1EH8 A;  2EV0 A;  4KMU X;  2ZCW A;  2O8X A;  4CO8 A;  4AVP A;  1FWZ A;  4Q4Z F;  4XLP F;  4PCQ A;  3FXR A;  3E5U A;  3GF2 A;  3QPH A;  5J8F A;  4Y13 A;  2HWV A;  1I27 A;  2OBP A;  1K79 A;  2ADU A;  3WTZ A;  5HDK A;  2XRO A;  1EH6 A;  3ROU A;  2TDX A;  2P5K A;  2IA1 A;  4ESF A;  2J5P A;  4IRH A;  1P92 A;  4B09 A;  4E70 A;  3K2Z A;  2A68 F;  2PMU A;  2OQG A;  4EM1 A;  1XGO A;  4BHB A;  2M87 A;  2P4W A;  4HV5 A;  1RUN A;  3M8E A;  4HLX A;  2ZME A;  1V4R A;  1G3W A;  3F21 A;  2RNJ A;  1JGS A;  4HOB A;  3TOB A;  4BQA A;  3J81 K;  4BAY A;  5D5X B;  2HKX A;  4L0Y B;  2VXZ A;  1CGP A;  3S2W A;  1ZN2 A;  3EYY A;  5HLH A;  1ZLJ A;  1JXS A;  2VON A;  1JE8 A;  4BH9 A;  2IA0 A;  2STW A;  1FP1 D;  2YX4 A;  4XBF A;  4YG2 F;  3LAP A;  2WWY A;  4KYW A;  4HF2 A;  1YW8 A;  2QLZ A;  1YYV A;  4I0A A;  1FZP B;  5LRR A;  2QM3 A;  5E20 A;  2Y0M A;  2HDC A;  3WU0 A;  4M74 A;  2XV4 S;  5HVQ C;  5TRD A;  3K0L A;  4S05 A;  2ZFW A;  4OOI A;  4RB1 A;  5ERI A;  2STT A;  2JT1 A;  3RPU A;  4A5N A;  4IJA A;  2D1V A;  1ZYR F;  4XRF A;  2M5W A;  1NHA A;  2PLY A;  2E7W A;  4KT5 C;  1FYL A;  2PG4 A;  2M30 A;  1YLF A;  4CIC A;  2M45 A;  1DUX C;  2IT0 A;  3ISP A;  2KKO A;  5D4R A;  4RGR A;  4GYI A;  3I59 A;  2FOK A;  4KN4 X;  1UST A;  4HX4 A;  3U9G A;  3MZH A;  4BNC A;  3E6D A;  1O57 A;  4GXO A;  3JSP A;  2A61 A;  4EJT A;  5EEH A;  2FQ3 A;  1D5V A;  3V4G A;  3W6J B;  2VBY A;  1T0F A;  1ZAR A;  3RIR A;  1OR7 A;  4G7O F;  3JSO A;  5E1W A;  1Y0U A;  1UHW A;  3O2P E;  2XUB A;  2ESN A;  2XAF A;  2Z9O A;  1V3F A;  2VC0 A;  3BPV A;  1SD7 A;  3BZ6 A;  4BHP A;  2K86 A;  3HSE A;  1A04 A;  1UHM A;  2GWR A;  4K2E A;  2Y75 A;  4WK8 F;  5AIQ A;  2V1U A;  3F8C A;  1T98 A;  1P4W A;  4G9Y A;  4S04 A;  3DQV C;  2F2E A;  1MJB A;  1ONV A;  1RI7 A;  3I4P A;  3B02 A;  1MJ9 A;  3GEZ A;  4AWX B;  4KIG A;  2RGV A;  4OIN F;  2DK8 A;  1QZZ A;  4O5V A;  4AIH A;  1SD4 A;  1YW9 A;  3TO7 A;  4HF0 A;  2QQB A;  1GXP A;  3WE2 A;  2A07 F;  1FY7 A;  2UXN A;  2XAH A;  5DCM A;  4WXH A;  5FFZ A;  1XMA A;  5TJJ A;  1W5T A;  2WTE A;  1QZY A;  1BI1 A;  2ZXJ A;  2FNP A;  3I71 A;  1ZRE A;  1MDM B;  2HYG D;  3LAJ A;  3J81 Z;  1YIO A;  2H94 A;  4L5I A;  4U0W A;  1IW7 F;  2WV0 A;  3M1E A;  4HDU A;  4A0Y A;  5D8K B;  2E1C A;  3JTG A;  1BJA A;  5HDN A;  1O7F A;  3LFK A;  2FE3 A;  4M73 A;  1X3U A;  2A6E F;  5DEQ A;  2DW4 A;  2HOE A;  4EM0 B;  1J75 A;  1FBU A;  3KZZ A;  4LGW A;  3WTS C;  5D6E A;  3HYI A;  1DDN A;  5IT9 K;  3BY6 A;  5DCF A;  2GAU A;  3MEX A;  3F8M A;  1SFE A;  3WTU C;  3DPL C;  3RYP A;  4Q48 A;  3CUQ A;  1ZH5 A;  3RYR A;  3GXO A;  4L0Z B;  2XAQ A;  4EVI A;  1JHH A;  1IXS B;  4HX8 A;  4P5O A;  3OV8 A;  3ZMD A;  1O3Q A;  4EGY A;  1YFH A;  4RAZ A;  4KIC A;  2FSW A;  2O3F A;  3WU1 B;  2EA4 A;  3ZMU A;  1TNS A;  3G73 A;  1XGM A;  1K6O A;  2FEZ A;  4L9T A;  4P9U A;  4M71 A;  1ZGA A;  3ZP5 A;  3IRQ A;  1AWC A;  3BJ6 A;  3BPX A;  1R23 A;  2VBZ A;  1EV7 A;  1SFX A;  4UNO A;  5LBQ A;  2HEO A;  1WRJ A;  4GCV A;  2X0L A;  2AS5 F;  2KJC A;  2NNY A;  3KP4 A;  2A6H F;  3RTR A;  4QLC U;  1IN6 A;  1QQI A;  3E6B A;  1RIO H;  3SHF A;  3IRR A;  4OMY A;  4PZJ A;  2PJP A;  1LDK B;  3D5L A;  3T1B A;  1TQI A;  2RKH A;  4ZZD A;  3MZY A;  1S6L A;  2A5Y B;  3EDP A;  2XRN A;  5K5Q A;  2R3S A;  3PQK A;  4DQ2 A;  4IRG A;  4LLG F;  4EJU A;  5IT3 A;  4KA4 A;  4RGS A;  2YSR A;  1TLH B;  4EJO A;  2K27 A;  5BQT A;  2J5O A;  4HZF A;  2X4H A;  3ZMT A;  3C18 A;  2HQR A;  3R0A A;  1KQ8 A;  5EEG A;  3G3Z A;  5DD4 A;  2K4J A;  3IKT A;  3TKY A;  2ETH A;  3K69 A;  2XAS A;  1TBX A;  2V79 A;  1U5T B;  5LEJ A;  2L3D A;  4HYE A;  3T0Y A;  5JR3 A;  1D3Y A;  1BC8 C;  1ZRC A;  3ZQ7 A;  3TDZ C;  3E3V A;  4CGZ A;  2VN2 A;  5ILU A;  1I1S A;  2O0Y A;  2JTV A;  5IT9 Z;  4IF4 A;  4PGG A;  4Q5S F;  5CVJ A;  2G7U A;  3CLO A;  4RB2 C;  2YR2 A;  3BJO A;  4KFC A;  4M72 A;  3IKV A;  1YQA A;  2D2W A;  5JFR A;  1R5H A;  1BIB A;  2PMH A;  4I09 A;  2XKP A;  3F8F A;  3BWG A;  3IC7 A;  2YU3 A;  2EB7 A;  5DD8 A;  2DPD A;  4M9S A;  2F5E A;  4YFN F;  5L3F A;  1WKM A;  1STZ A;  1SAX A;  3F3X A;  5FLX K;  3CUO A;  2YPR A;  1ZAO A;  4FT8 A;  2HFH A;  2E1N A;  4JK1 X;  2P6T A;  1P4X A;  3F6V A;  5FB2 A;  1DP7 P;  1G3Y A;  2P5L C;  4L9N A;  2H6B A;  3MCZ A;  4AD9 A;  1SMY F;  2V1D A;  4ZYD A;  1OKR A;  2DAO A;  3L7W A;  4M6X A;  2FNA A;  2FF4 A;  1SMT A;  2W24 A;  5BPI A;  1HBX G;  3ZMS A;  2RVC A;  4XSZ F;  3C1D A;  2QBY B;  3RPQ A;  4ENJ A;  4MHG A;  4G6Q A;  3TDU C;  2IJL A;  4OIP F;  3P9K A;  1GVJ A;  4LB6 B;  4XLN F;  5E8I A;  5LGT A;  4GO1 A;  4IHT A;  2FA5 A;  2ZNZ A;  2A3S A;  4I0B A;  3GX4 X;  2RQP A;  3KP2 A;  1RZ4 A;  2Y48 A;  2UWM A;  4LJZ F;  3HIF A;  2IP2 A;  1KQ0 A;  3M7G A;  3T5X A;  3QPT A;  3GFM A;  4YFX F;  3IHU A;  2LDU A;  3EUH A;  4O6J A;  3VEP A;  3KP6 A;  4WWC A;  3F22 A;  3GZ5 A;  3BOQ A;  1QBJ A;  1VTN C;  2ISY A;  3GYH X;  1EH7 A;  4IVN A;  5L3B A;  4L9V A;  2ESH A;  3I0T A;  4HA8 A;  1UB9 A;  5CJ9 A;  2GXG A;  3QP5 A;  4P9F A;  4N0B A;  2DFI A;  2EWN A;  4Q47 A;  3ABU A;  3C3W A;  3PQJ A;  3V8L A;  5CLS A;  4ENN A;  3M8F A;  2PI0 A;  2JRT A;  1D8K A;  5HLG A;  3GVA A;  5BPD A;  3Q5F A;  1RNL A;  2KIU A;  4ON0 A;  4UXN A;  4F7Z A;  1ZG1 A;  2ZKZ A;  2FBK A;  3BJA A;  1FOK A;  1S3J A;  4ENM A;  4MEY F;  3TO6 A;  1LEB A;  1HXD A;  3FM5 A;  3F6O A;  3CO6 C;  2QVO A;  2HQN A;  4BYY A;  3DP7 A;  3FXQ A;  2QQ9 A;  2W85 A;  2F5D A;  3QP6 A;  3HRT A;  3RKY A;  4UVA A;  2C6Y A;  1BC7 C;  1TQM A;  3GWZ A;  2V1X A;  2IW5 A;  3JAM K;  4I7H A;  3KLN A;  3I54 A;  3F72 A;  4UUV A;  5D5U B;  2QYO A;  1E17 A;  1MKM A;  4A0Z A;  1H9T A;  3TO9 A;  2ELH A;  3DV8 A;  4G7H F;  2HGC A;  5ILV A;  3TOA A;  3WGG A;  2RV8 A;  1Z1D A;  3IL2 A;  3HTS B;  4A12 A;  1CF7 B;  2XKO A;  1HST A;  3K9T A;  1Z6T A;  1R1U A;  1W4M A;  1FC3 A;  1G3T A;  1LDJ A;  4HQE A;  4HBL A;  1T38 A;  1ZG3 A;  2XVC A;  3WG9 A;  1B4A A;  2FMY A;  4D0P A;  1ZG5 A;  3FM3 A;  3L00 A;  1MJA A;  2XAG A;  3I59 B;  1FNN A;  5HDG A;  3KFW X;  3MAJ A;  3WOD F;  1IXR C;  1TW3 A;  4G6D A;  3V8K A;  4Z2Y A;  3FMQ A;  3VB2 A;  1F9N A;  2CFX A;  2VT3 A;  1ZLK A;  1XCV A;  2Z99 A;  2JPC A;  4NQW A;  1BM9 A;  5HS8 A;  1IN4 A;  2DI3 A;  2EV6 A;  5DV5 A;  5H6Q A;  2W25 A;  1IXC A;  2PQ8 A;  2FML A;  3VFZ A;  5J6X A;  1F1Z A;  5L3G A;  2CWE A;  2MH9 A;  4PDK A;  2BBY A;  2M1B A;  1YTY A;  2HYF A;  1XGS A;  1HKT A;  3DPT A;  2QWW A;  2FBH A;  4G94 A;  1PP8 F;  3QOP A;  2LNB A;  3SZT A;  5FO5 A;  5HS7 A;  5FD6 A;  2JSC A;  4KDP A;  3HRM A;  2O61 A;  3RJP A;  3CDH A;  1XDU A;  2VOO A;  3SQN A;  2JPB A;  3NRV A;  5CVR A;  3JW4 A;  1FYK A;  3TQN A;  2F5F A;  2EA2 A;  3ABT A;  2YX7 A;  4WCG A;  3FXU A;  3SZP A;  3JTH A;  2OQR A;  5FD5 A;  1XCB A;  3J80 K;  3GFJ A;  2M8E A;  1JHF A;  3E6C C;  3SFZ A;  1R1T A;  4RB3 C;  1WWX A;  1SD5 A;  1R58 A;  4NB5 A;  2DPU A;  1XN7 A;  1QO0 D;  2VT2 A;  1Z6R A;  1U8R A;  2NAZ A;  4IHS A;  3P9C A;  4I02 A;  2L02 A;  1KU9 A;  1ZRD A;  1YG2 A;  5KK1 A;  2RC4 A;  5LGU A;  1XDS A;  3KEQ A;  5ICE A;  1TTY A;  1IF1 A;  4FX4 A;  1HW5 A;  3H3Z A;  4YFK F;  4I01 A;  2L01 A;  2XHK A;  5E8G A;  3JAM Z;  1YW7 A;  5ILS A;  2NNN A;  3P7N A;  1P4A A;  1QGP A;  1BI2 A;  1TQP A;  2H6C A;  1J5Y A;  2V9V A;  1K78 B;  4HV6 A;  3GW2 A;  2H27 A;  1KQ9 A;  1U78 A;  3E97 A;  3K1M A;  1U5T A;  2K7L A;  4TV7 A;  5H6R A;  3L09 A;  1KYZ A;  4U0V A;  4EJV A;  3WGH A;  3T8T A;  1W7P D;  1LB2 A;  4U0Y A;  1Z9C A;  1L3L A;  1B9N A;  2V6C A;  4ZYH A;  2OD5 A;  4RAY A;  2RN7 A;  1B9M A;  4MQV A;  3F23 A;  2VBX A;  2MH2 A;  4KMF A;  2VOD A;  1QPM A;  2P7C B;  1S7A A;  3H3U A;  1R36 A;  2KIM A;  4BHC A;  2EFW A;  2CG4 A;  1KU3 A;  3DXJ F;  1HW1 A;  3FZV A;  2CQK A;  3ECH A;  5K5R A;  2K02 A;  2P6S A;  1FBS A;  2Q2E A;  3VOD A;  1KGS A;  3R61 A;  1BI3 A;  2ZBK A;  2CO5 A;  3I64 A;  5JI6 A;  4MTE A;  3SXY A;  4KNY A;  1R1V A;  1PUE E;  2EFQ A;  2E7X A;  1ON1 A;  2WC2 A;  1XSX A;  3ZPL A;  2FU4 A;  4R8H A;  4ESJ A;  1ZRF A;  2CSO A;  1Z7U A;  2D1H A;  1BOA A;  4M6Y A;  4AIK A;  3I58 A;  1PDN C;  2DBB A;  2D45 A;  2IRF G;  4NHJ A;  3R4K A;  1GXQ A;  5ICC A;  5L3E A;  5JVT A;  3HRU A;  2G9W A;  2P8T A;  3K1N A;  1FPQ A;  1F4K A;  1U3E M;  1IAW A;  2LSO A;  1OYW A;  4WF2 A;  4BXU A;  2RDP A;  1ON2 A;  2UXX A;  3F8N A;  1P6R A;  2QZ8 A;  4LK1 F;  4MNU A;  1HSJ A;  5D6F A;  5HS9 A;  1W7P B;  3HOT A;  4MQ9 F;  4ZYE A;  4JBA A;  3CUQ C;  2EV5 A;  2MLK A;  2PBI A;  1USS A;  3WTX C;  1BI0 A;  3W6K B;  4YIF A;  2PFB A;  1LEA A;  3R60 A;  4CDG A;  4I2O A;  2IA2 A;  3RKW A;  4IPA A;  3GFI A;  4IXA A;  2G7H A;  5HOO A;  5LHI A;  4HX7 A;  3DKW A;  4HQM A;  2EFN A;  4P55 A;  1TNT A;  2Q0O A;  5K1Y A;  2R7F A;  3LA2 A;  1H0M A;  1FT9 A;  1S8N A;  1MGT A;  3BRO A;  1FYM A;  2VC1 A;  4CXF A;  1IRF A;  1DPU A;  1FX7 A;  4OMZ A;  2AXL A;  4Y17 A;  5FGM A;  2BEO A;  3ZMZ A;  4WXD A;  2DQR A;  1YS7 A;  2BE5 F;  1O3T A;  2BYV E;  2DTR A;  3BDD A;  4UVC A;  3GO5 A;  1HKS A;  1FLI A;  5F6F A;  4A6D A;  3COA C;  1TW2 A;  2DO7 A;  5H20 A;  5FFX A;  1U5T C;  4WX9 A;  3IWF A;  1FP2 A;  3U2R A;  4LLL A;  4H0E A;  3I53 A;  5JHU A;  3ZN1 A;  2PEX A;  5HLI A;  1HKQ A;  3J7A O;  3KEO A;  4M9Z A;  3RI4 A;  1WI9 A;  3TGN A;  4FX0 A;  2H09 A;  5ED4 A;  1SD6 A;  3M9A A;  2W57 A;  3HOS A;  4LG0 B;  1SFU A;  1S7O A;  3WTW C;  3U1D A;  4A6E A;  1T39 A;  2Z33 A;  4DNC A;  3B73 A;  3LQQ A;  5DYM A;  4UHT A;  3ELK A;  3T8R A;  4EJW A;  4OIR F;  3KZY A;  5D4S A;  2IPQ X;  3WGI A;  1R5G A;  3FMS A;  1XSD A;  4LFU A;  3V8J A;  1E2X A;  2QQA A;  3H92 A;  2DT5 A;  1D8J A;  1IN8 A;  1T6S A;  2FRH A;  3KET A;  1IRG A;  4L18 B;  4ZZL A;  3Q9V A;  2OZ6 A;  3ERE D;  1OPC A;  4LB5 A;  2Z5U A;  2LF7 A;  3KP3 A;  5K5O A;  5DUI A;  2CGP A;  1XD7 A;  3VOE A;  3K1P A;  5BMZ A;  2ZO4 A;  2L4A A;  2OAZ A;  5FLX Z;  1CF7 A;  2ZME B;  2LKP A;  4A2U A;  4OU0 A;  3ECO A;  1G6N A;  4EQQ A;  2Z3Y A;  3KP5 A;  3KLO A;  3E5Q A;  5ICG A;  3HUG A;  3E6M A;  1F5T A;  5D5V B;  1XB4 A;  3LQR A;  2HTJ A;  4CZZ A;  4ASN A;  1R7J A;  2ACJ A;  4RS8 A;  2HTS A;  4XSX F;  4HDV A;  3RDI A;  3FHZ A;  2P5V A;  4O3M A;  3KE2 A;  2GQQ A;  1OYI A;  4EMS A;  2KIF A;  2MA3 A;  2K4B A;  2L4M A;  4M9X A;  3MFK A;  2OA4 A;  4P96 A;  4OIO F;  1T2K A;  1RUO A;  1MDM A;  4EM2 A;  3HHH A;  1W5S A;  2NRA C;  2VBW A;  2MD5 A;  1XSV A;  1I6X A;  1KYW A;  4ZYG A;  1LQ1 A;  4RGX A;  1YO5 C;  3PFI A;  4IRI A;  5CVI A;  1B1B A;  2EK5 A;  2VE9 A;  5E1Z B;  1KU2 A;  2A69 F;  2DK5 A;  5E1X A;  1O3R A;  1U6G A;  2F5C A;  1WQ2 A;  1XMK A;  1ULY A;  2MLG A;  1BBY A;  2PN6 A;  1IUY A;  3EYI A;  1YS6 A;  4MTD A;  1DPR A;  3D0S A;  4N9H A;  2DQL A;  5F64 A;  1J7K A;  3DEU A;  3IWZ A;  3HHG A;  1FSH A;  3ZN0 A;  1FSE A;  1MD0 A;  4YII A;  4U88 A;  2DLL A;  1S29 A;  1IN7 A;  2R7D A;  1PP7 U;  3NEU A;  3MWM A;  1R22 A;  5E18 F;  3CO7 C;  2ZNY A;  5LGN A;  4HF1 A;  4A5M A;  1K7A A;  4Y15 A;  4A0X A;  3BP8 A;  1QNT A;  4I98 B;  4B8X A;  1G4D A;  1IZ1 A;  4KIB A;  3RKX A;  2FBI A;  5L3C A;  1LVA A;  3LWF A;  3QRF F;  2VE8 A;  1BN5 A;  5A2Q K;  5CYV A;  3P9I A;  4ESB A;  1J2X A;  2B0L A;  1MZB A;  5CVU A;  1J0R A;  1LDD A;  2UZK A;  4CHU A;  2LF8 A;  2NYX A;  1UFM A;  2FXA A;  2VOP A;  3DFG A;  3O3K A;  1HQC A;  5D5W B;  1O7L A;  4LMY A;  4G8X A;  4KUM A;  1K78 A;  5ICF A;  4OIQ F;  1P2F A;  2L54 A;  4L9J A;  2W84 A;  3MQ0 A;  2O03 A;  4U7D A;  5DCM B;  5L3D A;  3QU6 A;  4ZH4 F;  2GA2 A;  2HR3 A;  3GUD A;  4KN7 X;  4U7B A;  3F8B A;  4HAM A;  1Z91 A;  1U2W A;  2BGC A;  3ULQ B;  1I5Z A;  1BIA A;  2P7V B;  4LD5 A;  3WTV C;  1REP C;  2MC3 A;  2CYY A;  4LK0 F;  5E17 F;  4LLN A;  4UVB A;  2OU2 A;  3GZ6 A;  3I5U A;  2QEN A;  5AON A;  3R0J A;  1C0W A;  4GYG A;  2EFP A;  4L5J A;  2COM A;  3ML6 A;  4HLY A;  5LHG A;  1UCR A;  3CUQ B;  3WE3 A;  1WSU A;  4R1H A;  3L2C A;  4UV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...