4LB5A

Crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
60
structure length
57
Chain Sequence
EIEMRICDYLRRHGRSTVQDIFKELKLEKSTVNRHLYSLQASKQVFKTVKRPVWNLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein kinase containing Z-DNA binding domains
publication title Structural basis for Z-DNA binding and stabilization by the zebrafish Z-DNA dependent protein kinase PKZ.
pubmed doi rcsb
source organism Danio rerio
molecule tags Transferase/dna
total genus 20
structure length 57
sequence length 60
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4lb5A00
3WTTC 1JXSA 1YTYA 2NNNA 1OYWA 4XBFA 4GCVA 4P9UA 2P8TA 4OIQF 1B9MA 4EJUA 1K79A 2YR2A 4I02A 4KN4X 1O57A 5DUKA 1KQ9A 4Q47A 4IHSA 3FXRA 4ENMA 2W84A 2DQLA 3LSTA 3ROUA 4U7DA 4RAZA 4EJVA 2Q8KA 1K78B 1JE8A 3J7AO 1SFXA 5LRRA 5DEQA 3BOQA 2NRAC 1GHCA 1QPMA 2DK5A 1ONVA 1O3SA 3WGIA 4A6EA 2LNBA 5E8IA 4IRIA 1ZLKA 3Q5FA 3QU3A 2R7FA 3N97A 1ZRFA 2L3DA 3LAPA 1WRJA 2PQ8A 1X3UA 1ZGAA 2JPCA 3GVAA 4HLXA 2ETHA 3F6OA 3QAHA 4A2UA 3I59B 3REOA 2GQQA 3FWEA 1HSJA 2IRFG 1LVAA 1YO5C 1R00A 3RDIA 1I1GA 2WTEA 3MCZA 1K78A 4XSXF 1TW2A 2HYGD 3GZ5A 2FBHA 5DV5A 1UHWA 3WG9A 3I71A 1P4WA 2BV6A 1QZYA 1XB4A 1R5HA 1W5SA 2RDPA 3IWZA 3KEOA 4U0WA 2XROA 4MHGA 2EA4A 4RB1A 4CXFA 4GO1A 4LLLA 1I1SA 4G6DA 1F4KA 5JR3A 4UV8A 3BPXA 1BOAA 2PG4A 2HQRA 2OQGA 3I59A 1S7OA 4YIFA 1BIBA 1XSXA 2MA3A 3EETA 3IRQA 4P9FA 1D8KA 1FC3A 1F9NA 4M6YA 1DDNA 2ZBKA 3FX3A 4U88A 1G4DA 4ENJA 5JVTA 2FMYA 4IXAA 4YIIA 4L9NA 4I0AA 2IJLA 4LK1F 2FE3A 5H6RA 2VC1A 2STWA 3DF8A 3JTGA 2NS0A 4ETSA 4HAMA 4ENKA 1PUEE 3BJ6A 3DP7A 3GFMA 4PCQA 4DQ2A 5LBQA 5EEGA 2VOPA 2MC3A 5HDNA 3GYHX 1Z1DA 2RC4A 1KU9A 2E1CA 2XKPA 4GYIA 2UXNA 2FU4A 3LA3A 1MJBA 5J8FA 3ZQ7A 4XLPF 1JGSA 5ICCA 5DDGA 3P9KA 5LRSA 3VFZA 1I5ZA 5BQTA 4IRGA 1FLIA 2PBIA 1NHAA 4NB5A 2HWVA 1MKMA 5FD6A 2DO7A 1TQIA 1SFEA 3E5UA 5ERIA 1TTYA 2RQPA 1V4RA 3I0TA 1Q1HA 4WWCA 1FP1D 4Y15A 2X4HA 2Q0OA 1B1BA 2HZTA 5D5XB 2C6YA 2PFBA 1HBXG 2FA5A 2EFPA 1O7LA 3V8LA 2VE9A 1YW7A 4G8XA 4WXHA 2ZO4A 2O3FA 3V7RA 1BBYA 3J80K 1LDKB 5DUIA 5K5RA 1ZLJA 2MBFA 2OBPA 4LLNA 1EH6A 1ZYRF 1O3QA 4PZJA 1BJAA 4ZYEA 1Z05A 2QZ8A 2XAFA 3GFJA 1KYWA 2GXGA 3CJNA 3J80Z 4WF2A 2QQBA 4IPAA 5E20A 5KK1A 4ESBA 1FYKA 3EQLF 5FB2A 3MFKA 1FY7A 4RGXA 5L3GA 1A04A 1LJ9A 1R7JA 3WE3A 2GA1A 4YFNF 3BP8A 4IF4A 2MLKA 4GGGA 3RPUA 5L3CA 2O0YA 1BM9A 5ICEA 1P6RA 4YG2F 3R61A 3BROA 2VONA 3BDDA 2IA2A 1STZA 3CUQB 4OINF 4G9YA 1H9GA 3QPTA 2YPRA 5HDGA 2JSCA 3ISPA 3HTSB 1MD0A 4EJTA 5D4SA 2IPQX 1QZZA 5D4RA 3ECOA 2FBIA 1CF7B 2VT2A 5CLSA 3L00A 4I2OA 3DEUA 4M6XA 2XRNA 1TNSA 1YQAA 1SD7A 1KQ8A 2OU2A 1HW5A 2D45A 2M30A 4CDGA 4KDPA 2VT3A 3GWZA 2B0LA 1AOYA 1SMTA 4HZFA 2FQ3A 3MZHA 3I53A 3K2ZA 3FHZA 3CUQA 1BI1A 2FNPA 3HRUA 2EWNA 2M87A 3KFWX 3DPLC 3IC7A 2QYOA 3C7JA 4EQQA 2COMA 3HRSA 4MEXF 3NRVA 2WC2A 2IA1A 1CF7A 3TOBA 4LLGF 1FT9A 4HW0A 3IKVA 2ESHA 2YX7A 4AIHA 4UNOA 2XAHA 3CO6C 4RAYA 2RV8A 4KUMA 4CICA 1P2FA 2EA2A 3GZ6A 5JHUA 4OOIA 5AIPA 3W6JB 4ZZDA 1JHHA 1LEBA 5TJJA 2P5VA 4ZYDA 2XASA 5CVRA 4FX4A 2K7LA 2HTJA 1W7PD 3CTAA 1TQMA 2PEXA 2XAJA 2E1NA 1ZHFA 1J5YA 3HIFA 4N9IA 1RUOA 1U5TB 1LEAA 3DPTA 1BC8C 1IN4A 3GXOA 2ZMEA 5D6FA 4UHTA 3T8TA 2LF8A 2H09A 1HKSA 3F8BA 4Q5SF 4OIOF 1T6SA 5ICGA 4TV7A 2XUBA 3WTVC 4PDKA 4ZH4F 1RIOH 1I6XA 1QBJA 4M71A 3T5XA 3AAFA 4S05A 2P6SA 3L09A 4HQMA 5F1RA 2V1XA 1IZ1A 2ZFWA 4BYYA 1USTA 4N0BA 1FSEA 1PDNC 3WTZA 4XSZF 1Y0UA 3ELKA 2DT5A 2EFQA 3TKYA 3VEPA 4UV9A 1BN5A 1YLFA 2G7HA 3WTXC 4A0ZA 2PLYA 1J7KA 4CZZA 2PI0A 2BEOA 2IP2A 3QOPA 1S8NA 4KMFA 3D5LA 1S29A 2Y75A 4HOBA 4B09A 2DBBA 2HYFA 2L4AA 1W4MA 4ZZLA 2PMUA 4I0BA 2O8XA 4OMYA 1OPCA 4CGZA 2FOKA 1XDUA 3I64A 3TQNA 1HQCA 1FBUA 3FXQA 3D0SA 3R4KA 4UVBA 1IXRC 3RKXA 4F7ZA 3KLNA 2DI3A 4RS8A 1OYIA 3RYPA 4ON0A 3HHGA 1HXDA 1KA8A 3JTHA 3HTUA 1TW3A 2XV4S 2ADUA 2LF7A 1WSUA 3PQKA 2XAGA 4EVIA 2NAZA 1SMYF 1MDMB 4AVPA 5JFRA 2XHKA 1BI0A 4MNUA 4BNCA 1REPC 3JW4A 5FFXA 1FYMA 4S04A 1K6OA 2Y0MA 1DPUA 2E7WA 2OQRA 2CWEA 2KIFA 2YSRA 2XVCA 5LLQA 2V6CA 2AXLA 2HTSA 3PQJA 1XGOA 3DV8A 1ZG5A 2W57A 5FO5A 5E1ZB 3HSFA 4KIBA 3GEZA 2DK8A 2Z3YA 4KYWA 5FD5A 4HX4A 1ZN2A 4UUVA 1U6GA 1O3RA 1XSDA 4O3MA 1T0FA 2D1HA 3U2RA 3MQ0A 3O2PE 1MDMA 2UWMA 2HGCA 3E6MA 3WTWC 3HSEA 3P7NA 5DD4A 3M9AA 3O3KA 4I01A 5K5QA 3F8FA 4RGSA 4LMYA 3KCCA 2QBYA 3ZMDA 4UVCA 3EDPA 5L3BA 2ZXJA 2FEZA 2OZ6A 5LHHA 4MQ9F 4ESFA 1JHFA 4KFCA 4IRHA 2CG4A 5LEKA 3ZMVA 4A0YA 5F6FA 5FLXK 4QLCU 3GFLA 4U7BA 1P4AA 1XD7A 1PP7U 3LQRA 3E3VA 3R6SA 3ZMUA 1J59A 3P9IA 2P5KA 3K0LA 5FLXZ 5H6QA 3HYIA 3LWFA 1SFUA 1DUXC 5LGNA 1RUNA 3KE2A 1ZGJA 1R22A 4HQEA 1MZBA 3RKWA 3TDUC 1XGMA 1TNTA 2BBYA 2FRHA 1J75A 1XCVA 1FYLA 3ZMZA 4ASNA 1LDDA 2VN2A 5KVRA 1ZRDA 4WXDA 2RNJA 2XKOA 3I54A 3ML6A 1R1UA 1ON2A 3WU1B 2V9VA 4WK8F 5FGMA 2ZNYA 5E1WA 4G6QA 3T1BA 4M74A 3B02A 3KZZA 2K4BA 1PP8F 2M5WA 2VBYA 1ZREA 2ELHA 4BHBA 4HDVA 3V4GA 2A68F 3HRTA 3BY6A 5D6EA 3RTRA 3CLOA 4N9HA 4NHJA 1U78A 1O3TA 3K1MA 2VBXA 1Z6RA 3DKWA 1T38A 1L0OC 1XSVA 5DYMA 4HV5A 5L3FA 3ABTA 4KT5C 2F5DA 4OIPF 4L9JA 1EV7A 4H0EA 3SHFA 2QM3A 5BS6A 4HBLA 4L9VA 2HEOA 2EV0A 4KMUX 1LNWA 1FWZA 3TDZC 2HR3A 3IWFA 1KQ0A 4ZYHA 6PAXA 3C18A 5E1XA 4BAYA 2Z33A 1IN6A 2FMLA 3RJPA 2K02A 1G3WA 3LQQA 1XMKA 2EFOA 2J5OA 4M72A 2BGCA 5ED4A 2GZWA 3CDHA 4D0PA 2ISYA 3E5XA 4EM0B 4HF0A 4KIFA 3CO7C 3KEQA 4Y13A 3GO5A 4DNCA 4OU0A 5HS9A 3EYIA 1FP2A 3WGGA 3KP2A 1Z7UA 3NEUA 3ZMSA 1T98A 1HKTA 1VTNC 2DU9A 4IVNA 4MGRA 3H3UA 5CJ9A 2KJBA 4XLNF 3ZP5A 1B59A 4LFUA 3TO9A 4A12A 3U9GA 1IUYA 2RVCA 1IN7A 2XGXA 5HVQC 1L3LA 4JQFA 5ILVA 5J6XA 5JI6A 3RPQA 1R23A 4BHCA 4OMZA 5E8GA 3T0YA 4AWXB 4L9TA 1R1VA 2OZUA 3W6KB 3DQVC 4LK0F 1ZAOA 4UVAA 4EMSA 4KN7X 1J2XA 4RGUA 2ZMEB 2QWWA 4GXOA 4JBAA 3WTYC 4O5VA 1G3SA 4HV6A 3COAC 4EJOA 3QU6A 2WWYA 3QRFF 3WODF 1HW1A 2G7UA 1XDSA 1KGSA 3GX4X 1IW7F 1XMAA 4M73A 2PJPA 3EYYA 4BQAA 2TDXA 1IRFA 4Q48A 1S7AA 3IL2A 3K1NA 2MH9A 1IAWA 1RNLA 1WQ2A 1ZG1A 2L4MA 1LB2A 3QP5A 2FNAA 3F72A 1TQPA 2P5LC 3WTUC 3HRMA 1QO0D 5IT9K 4LGWA 3EUHA 1E2XA 2HKOA 1B9NA 2OAZA 2ZKZA 2H27A 2VC0A 2DTRA 2V1DA 4RB2C 4EGZA 3JSOA 2IT0A 3FF5A 1G3TA 4RGRA 4EGYA 5IT9Z 2VOOA 3GF2A 3HHHA 1LQ1A 2R3SA 3T8RA 5CVJA 1YW8A 2ACJA 1SD4A 4P55A 2O61A 3VOEA 4HF1A 5TRDA 2P7CB 4BHPA 1ULYA 3GW2A 2F2EA 2QQ9A 3SQNA 2WV0A 2KIMA 1O7FA 2JZYA 3SXYA 4HYEA 5LHGA 2M8EA 2M1BA 2Y48A 3HOSA 4EM1A 3MEXA 1IXCA 3R0JA 2DPUA 1FNNA 2HKXA 4E70A 3FMSA 1YFHA 5HDKA 4R79A 1R5GA 4A5NA 4RB3C 2OA4A 3CUOA 1E17A 3WE2A 3M7GA 2W25A 1SAXA 1S6LA 3Q9SA 5HLIA 2MLGA 4IJAA 4BXUA 1EH8A 1R36A 3TO7A 1H9TA 1OMIA 3K1PA 3GFIA 4LG0B 4Z2YA 3PFIA 1ODDA 4L5IA 3L2CA 2PN6A 4MTEA 4LD5A 4ENNA 3JSPA 3U1DA 1OYYA 1YS7A 3TGNA 5ILUA 5HLGA 2A61A 1IXSB 1ZH5A 2STTA 2QUFA 4JK1X 1KU2A 5E17F 1GXQA 1D3YA 2JT1A 2Z9OA 2L54A 3I4PA 3KZYA 1BI2A 3GUDA 1OKRA 3K69A 4EM2A 1UCRA 3ULQB 4Q4ZF 4ZYGA 2CSOA 2A07F 4EV0A 2VE8A 2HQNA 1T2KA 3L9FA 4KNYA 1GVJA 1FOKA 3ERED 1I27A 2KRFA 2QBYB 2NYXA 1FBQA 2EV6A 3SZPA 4AIKA 4HDUA 4HLYA 4LG0A 2EV5A 1U5TC 2ISZA 3P9CA 2W85A 3V8KA 2ZNZA 4FT8A 1G6NA 4G7OF 4R8HA 1D5VA 2R7DA 4LJZF 2RGVA 4L0ZB 2F5FA 5LGUA 1AWCA 4PGHA 1J0RA 5EEHA 4Y17A 3KP4A 4M9XA 3LAJA 3ZN0A 3E6CC 1UFMA 4LB6B 3G73A 2D2WA 4L0YB 1B4AA 5HS8A 4I09A 1YW9A 2EB7A 3H3ZA 3KP3A 3R60A 4QWQA 1QNTA 3HUGA 3M8FA 1XN7A 3RI4A 5HLHA 3HOTA 3FM3A 3IKTA 1Z91A 4O6JA 4HX8A 2DFIA 1BIAA 2GWRA 1XGSA 1R58A 2LDUA 1DP7P 1G3YA 3E5QA 1EH7A 2RN7A 2A69F 4PGGA 3MZYA 3V8JA 2QQAA 4KIGA 3LA7A 3ZPLA 3H92A 2Q2EA 2DQRA 2PMHA 1W7PB 1U3EM 3SFZA 1F5TA 1P92A 2XIGA 3GLXA 2DLLA 3KETA 3KP6A 4B8XA 2EFWA 5L3DA 2UZKA 5CVUA 2A6HF 3HSRA 4I7HA 4K2EA 4A0XA 2YX4A 3RKYA 4HF2A 3F8NA 4ESJA 4L18B 2A5YB 3FXUA 3FZVA 2A3SA 2F5CA 1WI9A 4KICA 3I5UA 1USSA 1UHMA 2E7XA 5HOOA 2MH2A 3F22A 4GYGA 5CVVA 3J81K 2QLZA 1MJ9A 3FMQA 4CHUA 4M9SA 3VB2A 4NQWA 4MEYF 2CFXA 5E18F 1C0WA 2DW4A 2LSOA 3SZTA 2ZJ2A 1J9IA 1U2WA 2A6EF 1W7PA 5D5WB 5A2QK 5HS7A 2O6GE 2IVMA 3J81Z 3JAMK 2H6CA 2CYYA 5F64A 2O03A 2QVOA 4MQVA 5L3EA 1YG2A 1KU3A 1HW2A 2CGPA 3F3XA 1FX7A 2HS5A 5A2QZ 3QPHA 5CVIA 1HKQA 1IN8A 3VODA 2ESNA 3JAMZ 3Q9VA 2P4WA 2GA2A 4IHTA 2K4JA 3WU0A 1ON1A 1LDJA 3F21A 2M45A 2MD5A 1CGPA 3N4MA 1XCBA 2ZCWA 2Z5UA 2HFHA 3F6VA 5K5OA 4U0VA 5D8LB 2FSWA 3O6BB 1FBSA 3TOAA 4AIJA 3M1EA 2CO5A 2L01A 4WXCA 1Z9CA 2P6TA 1V3FA 2UXXA 2EFNA 2H94A 4UXNA 1T39A 1YIOA 3QP6A 1SD5A 3BJAA 1TBXA 3BJOA 3IHUA 4LB5A 1RZ4A 1ZARA 2RKHA 4I98B 5J8CA 4XRFA 2XAQA 2V79A 3KP5A 4L5JA 3F23A 3ZMTA 1R1TA 2EK5A 1SD6A 1MJAA 3R0AA 2CQKA 1KU7A 3B73A 1RI7A 2GAUA 5ILSA 5BPIA 2W24A 1FSHA 2NNYA 5DCFA 3BPVA 3K9TA 1B6AA 3DFGA 2OD5A 5CYVA 4M9ZA 1MGTA 2VXZA 2X0LA 5BOXA 3E6BA 1ZRCA 5IT3A 1F1ZA 3RIRA 2JRTA 1QQIA 2DAOA 3L7WA 2FXAA 2KKOA 3BZ6A 4A6DA 4KA4A 3TO6A 2VBZA 2HDCA 5BMZA 2KIUA 5D8KB 3FM5A 1W5TA 3F8MA 3E6DA 4BH9A 4WCGA 3V7SA 1HSTA 5ICFA 5D5VB 2BE5F 2Z99A 4RB0A 2BYVE 5LGTA 5D5UB 3MAJA 2VBWA 3KLOA 1IRGA 1GXPA 2J5PA 4EJWA 1DPRA 2K86A 1FZPB 3OOPA 1H0MA 2FF4A 1OR7A 3DXJF 1Z6TA 3E97A 4G7HF 3WTSC 5H20A 4FHTA 5AIQA 2HOEA 2QENA 4AD9A 1QGPA 3C1DA 3BWGA 2GIVA 1BI3A 2GXBA 2FBKA 2LKPA 1U8RA 2IW5A 2K27A 4YFXF 4YFKF 3I58A 3F8CA 1K7AA 3LA2A 4FX0A 3ZN1A 5K1YA 4P96A 3G3ZA 2AS5F 3OV8A 3S2WA 5LEJA 4R1HA 3M8EA 2YU3A 4G7ZF 4WX9A 5BPDA 1YYVA 3ECHA 1IN5A 1KYZA 5DCMB 2D1VA 1P4XA 4CO8A 4CYDA 1WWXA 2IA0A 2EJRA 1UB9A 3C3WA 3ABUA 1YS6A 4OIRF 4U0YA 5FFZA 1BC7C 4HA8A 3WGHA 2V1UA 3NQOA 3CUQC 5AONA 3FMRA 3MWMA 1TLHB 2CW0F 3V7CA 2KJCA 1S3JA 2JPBA 2L02A 3LFKA 2F5EA 2P7VB 1D8JA 5LHIA 1U5TA 5DD8A 2VODA 4MTDA 2DPDA 4A5MA 1WKMA 1XGNA 2JTVA 2H6BA 3KP7A 4G94A 5DCMA 4P5OA 1IF1A 1FPQA 1ZG3A 3RYRA 3IRRA 4HX7A 2G9WA
chains in the Genus database with same CATH superfamily
3WTTC 1JXSA 4DOZA 3OMYA 2X1CA 1YTYA 4BXFA 4XQFA 2NNNA 1OYWA 1TWCJ 4XBFA 4D1QA 2WADA 4GCVA 1X3WB 4P9UA 2P8TA 5F0CA 4OIQF 1OCRH 1B9MA 1YX3A 1TWHJ 4EJUA 1FOYA 1K79A 2YR2A 4I02A 4KN4X 3ZR8X 3H1CA 3BCBA 4BU2A 1IG7A 1O57A 2NVUB 4A3BJ 5DUKA 1KQ9A 1OCTC 1MBHA 4Q47A 4IHSA 3GZNB 1XPXA 3FXRA 2W48A 2RREA 4ENMA 3I3LA 2W84A 1SVMA 2DQLA 3LSTA 4BE1A 2ZMEC 3AG3H 3ROUA 4U7DA 4RAZA 4EJVA 1FOWA 1K78B 2F4OB 3O8HA 1JE8A 3J7AO 1SFXA 5LRRA 5DEQA 3BOQA 1KONA 2CH0A 2NRAC 3CF2A 1GHCA 1QPMA 3BR3A 2DK5A 1TC3C 1R49A 5JLWA 4A3DJ 1MMNA 1ONVA 4J01A 1O3SA 1HOMA 3WGIA 4A6EA 2LNBA 5E8IA 4IRIA 3E0JB 1ZLKA 3Q5FA 3QU3A 2R7FA 2R7RA 2WB1N 3HL2A 3N97A 3TBIA 4A3IJ 1ZRFA 1YX5A 2UUZA 2L3DA 3IAM2 3LAPA 3HEFA 4S0HB 1WRJA 2PQ8A 1X3UA 2LTPA 1ZGAA 2JPCA 3GVAA 4HLXA 2ETHA 3F6OA 3IAS2 3QAHA 2P0WA 4A2UA 3I59B 3REOA 2GQQA 3BG9A 2ME0A 3FWEA 3CCEI 2R92J 2LVSA 1HSJA 1CQTA 1MBKA 2IRFG 1LVAA 4PJ0C 1YO5C 1R00A 3RDIA 3JRHA 1I1GA 5GAGJ 1PUFB 1YI2I 4M6VA 3RCOA 2WTEA 2WY8Q 2GLOA 5JLXA 2R7XA 5FLVA 3MCZA 3QYFA 1K78A 5F0HA 4XSXF 1TW2A 2HYGD 3X2QH 1VNDA 2Q2EB 2ID3A 1W1WE 4E6KG 2X1EA 2VPRA 3GZ5A 4M3GA 2FBHA 5DV5A 2BW3B 2LREA 4CA0A 1UHWA 2K9MA 3BTIA 3WG9A 3D5SC 2PJRB 3I71A 4HNTA 1P4WA 2BV6A 1QZYA 2CQNA 2HQAA 2PX9A 4HEA2 3PIOF 1XB4A 4Y3OA 1R5HA 4DZJA 3KYLA 4PFOA 1X4PA 5EDNA 1Y8RB 1WJCA 2RDPA 1W5SA 1XC5A 2L5QA 2RNGA 3IWZA 3SYTA 3KEOA 4U0WA 2XROA 2R7WA 2K3FA 1QU3A 2JA7J 4MHGA 2EA4A 4BY1J 3CD6I 2VQGA 2VJ5A 4RB1A 1E3PA 4CXFA 4GO1A 3OYIA 4LLLA 3H5RA 1I1SA 3M3YJ 4G6DA 3BG7A 1YRNB 2M4GA 1F4KA 1BR4A 5JR3A 4X6AJ 4UV8A 3BPXA 1BOAA 2PG4A 2HQRA 2E5ZA 3K6GA 2OQGA 3I59A 3LSRA 3BR2A 1S7OA 2BOLA 4YIFA 1K6YA 1BIBA 1XSXA 2MA3A 3EETA 3IRQA 4BE2A 2OF7A 4P9FA 3M07A 1O4XA 2TCTA 1PUFA 1D8KA 2E2JJ 3HOWJ 2JK3A 1K4SA 1FC3A 1F9NA 2X51A 4M6YA 1DDNA 3LL7A 2ZBKA 3FXOA 2K3PA 3FX3A 4U88A 1G4DA 4ENJA 2JUGA 3PUFA 3JRBA 5JVTA 4JX5A 1YJNI 2FMYA 4IXAA 4YIIA 4L9NA 2EQRA 2VASA 4I0AA 2IJLA 4LK1F 2QKMB 1ZR2A 4E7IA 3AG2H 2FE3A 5H6RA 2BW3A 2VC1A 2STWA 3DF8A 3JTGA 4NC8A 2PJRA 2DMQA 2NS0A 2WAQN 3H5AA 3Q0WA 4B47A 4ETSA 4HAMA 4ENKA 1PUEE 3BJ6A 3DP7A 3MMYB 3BT9A 3HPHA 2DOFA 3GFMA 4PCQA 4DQ2A 1WCMJ 1WJBA 2EIMH 4XMYA 5EEGA 5LBQA 1R6RA 2VOPA 1D0YA 2M0CA 3BG6A 3CCYA 1X58A 3TP0A 3G1MA 2MC3A 3QYEA 3KZIC 5HDNA 2Y69H 2ZXIA 5FLMJ 4BUPA 3GYHX 1Z1DA 2NVYJ 2RC4A 1OISA 2W00A 1KU9A 4CYCB 2E1CA 2XKPA 4GYIA 1W0TA 4OWRB 5GTIC 2UXNA 2NS7A 2FU4A 3LA3A 1MJBA 3OL4A 5J8FA 1X1CA 2KHMA 1Z21A 3ZQ7A 4XLPF 1JGSA 5ICCA 1V5FA 5DDGA 3P9KA 4QPQA 5LRSA 3CJTB 3VFZA 2DA4A 1I5ZA 3Q0UA 5IOZA 4FE4A 5BQTA 3DLLF 1LVKA 4IRGA 5CPRB 3VYUB 1FLIA 2PBIA 1NHAA 2EPFA 2KDZA 4NB5A 4AM3A 1UG0A 2HI3A 4MFDA 2HWVA 3JRIA 1X3ZB 1MKMA 5FD6A 2ECBA 2DO7A 4XLFA 1T0FC 1TQIA 1SFEA 3E5UA 2KIQA 5ERIA 4PFPA 3MKZA 1TTYA 2RQPA 1V4RA 3I0TA 4YRVA 3TEDA 1Q1HA 3ASOH 3DU5A 1DQUA 4WWCA 1FP1D 2VQCA 4Y15A 4IHYA 4A69C 2LG4A 2X4HA 2Q0OA 1B1BA 2DOAA 2CW7A 4JOMA 2HZTA 3HGGA 3CMYA 4IX7A 5D5XB 4CYCA 3JR9A 1T08B 2C6YA 1Y0NA 4MO7A 2PFBA 1I39A 1V54H 4XLHA 1HBXG 2XGEA 2FA5A 2EFPA 1O7LA 3V8LA 1AKHB 2I10A 3VPRA 1BR2A 2VE9A 2XPVA 2OC6A 3WHBA 3K4LA 3D5RC 1YW7A 4G8XA 4WXHA 2ZO4A 2O3FA 1NG6A 4JX4A 2XDVA 3V7RA 2L0KA 5KCMA 2EBIA 1BBYA 3J80K 5J4VA 1OCOH 1LDKB 3BG5A 3QWLA 4BJ6C 5DUIA 5K5RA 5HNFA 4RM3A 1ZLJA 2MBFA 2G0EA 3OYNA 2CUJA 3CCQI 2QGUA 2OBPA 3ZRGA 4LLNA 5FRNA 1EH6A 1ZYRF 1O3QA 5CKTA 4PZJA 2R7QA 3AG4H 1Y6IA 1BJAA 4ZYEA 1Z05A 4HSRA 3HOYJ 2QZ8A 2XAFA 2MSYA 1S5LC 1A6IA 3GFJA 2CQ7A 1MIJA 2IAIA 1KYWA 2GXGA 2KQRA 3CJNA 3J80Z 4WF2A 4BL0B 2QQBA 2DMNA 2M8GX 4IPAA 2MGQA 5E20A 5KK1A 4ESBA 4F92B 5CQEA 3DBRB 1FYKA 3SFIA 3EQLF 5FB2A 4CSWA 2LKXA 3MFKA 3CMEI 1FY7A 4RGXA 2F5VA 1A04A 1JTYA 4MLOA 5L3GA 1LJ9A 1R7JA 3TP3A 3WE3A 1V5GA 2GA1A 2Y9YA 4YFNF 5TISC 3OYJA 3BP8A 4IF4A 1ZR4A 2MLKA 4GGGA 3RPUA 5L3CA 5IYDJ 3HOXJ 2O0YA 1BM9A 5ICEA 1JT0A 1ETWA 1AKHA 1BL0A 1P6RA 4YG2F 3R61A 2IS1A 3BROA 2VONA 3BDDA 1YJWI 2IA2A 4I99C 4II3A 3S93A 1STZA 3CUQB 4EATA 4OINF 5J1YA 2Y0SA 1T95A 2X6YA 4G9YA 1H9GA 4IQ4A 3QPTA 3F0CA 2YPRA 4LOCA 2Y9ZA 3BG3A 5HDGA 2JUCA 1TWFJ 2JSCA 2OUMA 4BE0A 4XOTA 2XGDA 3ISPA 4ZDLA 3HTSB 1MD0A 4EJTA 5D4SA 2IPQX 1QZZA 1W5CC 4IZZA 5D4RA 2DFFA 3ECOA 2FBIA 1CF7B 2VT2A 3L2WA 5CLSA 3CMMA 3L00A 4I2OA 4UUSB 5HODA 1JUMA 2I8DA 3DEUA 5FRMA 1GUUA 4HPQA 4M6XA 2XRNA 5CQGA 1U9NA 3DU6A 3IH4A 2HVRA 1TNSA 1YQAA 2R7SA 1SD7A 1KQ8A 2OU2A 1HW5A 2D45A 4ZDPA 1W36D 1MH4A 2M30A 4CDGA 2HOTA 4KDPA 2VT3A 3GWZA 2B0LA 1XX5A 1AOYA 1SMTA 4HZFA 2D5VA 2L7MP 2FQ3A 3MZHA 3I53A 3K2ZA 2VKEA 5F04A 3FHZA 3CUQA 1BI1A 2FNPA 3HRUA 2LY2A 3KYDB 3ZQGA 2Z2SB 2EWNA 5FROA 2M87A 2B9SA 4XRSA 3KFWX 2OTLI 2NS8A 2HXIA 3DPLC 3IC7A 2YS9A 3LSPA 2QYOA 2X6OA 3C7JA 4EQQA 2COMA 3HRSA 4MEXF 1UAAA 4Y52J 3NRVA 2ECCA 4AYBA 4XICA 2WC2A 1W0UA 1ZQ3P 2XF5A 2IXSA 2IA1A 2NOGA 2KDOA 1CF7A 3EPZA 3TOBA 4CZCA 4LLGF 4PJMA 4UUTA 1FT9A 4HW0A 3CCRI 3IKVA 2ESHA 1PYVA 5HLTA 3OS1A 4UUSA 2YX7A 4AIHA 3H9GA 4UNOA 3LSMA 1VQ7I 4KT6A 2XAHA 5E3OA 3CO6C 4RAYA 5C44J 2RV8A 3L2UA 4EEFG 4KUMA 4CICA 1P2FA 4D7MA 3H0GJ 2EA2A 3DTIA 3GZ6A 1RC9A 5JHUA 3PL8A 4OOIA 5AIPA 3W6JB 4ZZDA 3I4NJ 3HDDA 4P1WA 1JHHA 4BDYA 1LEBA 3K2AA 3CC2I 5TJJA 2P5VA 4ZYDA 2XASA 5CVRA 4FX4A 1SVLA 2HTJA 2K7LA 2LY1A 4C9YA 1VI0A 2NVXJ 1W7PD 3CTAA 3LSIA 1JKRC 1TQMA 1Y39A 1TP4A 2PEXA 5K7ZA 3WG7H 2XAJA 2E1NA 1ZHFA 3B6AA 1J5YA 3HIFA 1WFXA 4NC7A 2B63J 1D1CA 3UR3C 4N9IA 1RUOA 1U5TB 1LEAA 3SDBA 1ZELA 3DPTA 4M3DA 4AYBN 1BC8C 1IN4A 1X19A 1A5JA 3GXOA 2ZMEA 4B1RA 3RKQA 1AA7A 5B3SH 5D6FA 2M34A 1MBJA 3PSFA 4UHTA 3T8TA 2LF8A 2H09A 3RSNA 1JGGA 1HKSA 2DA2A 3F8BA 4Q5SF 2EZLA 2JMWA 4OIOF 1T6SA 3A02A 5ICGA 4TV7A 5E3LA 1SEUA 3DBLB 4DIQA 2IGMA 2XUBA 3WTVC 4N4NB 4PDKA 4ZH4F 1RIOH 1I6XA 5KAFC 2OV7A 1QBJA 4M71A 3T5XA 3AAFA 4S05A 2P6SA 3L09A 4HQMA 3S3OA 2KRCA 3K10A 5F1RA 2V1XA 1IZ1A 2ZFWA 4BYYA 2F6CA 3DKYA 1USTA 4N0BA 4W97A 1FSEA 4XK4A 1PDNC 3S14J 3WTZA 4XSZF 3L2VA 1RR7A 1WJ5A 1Y0UA 1QPIA 3ELKA 3FKIJ 2DT5A 4F3QA 2EFQA 1ZKGA 3TKYA 1ENHA 4PJJA 1QA6A 3VEPA 3VSLA 4UV9A 2QSHX 4DYCA 1P7JA 1BN5A 4XIDA 1YLFA 2XPWA 1A6QA 2TRTA 2G7HA 3WTXC 4A0ZA 2PLYA 1J7KA 3OS2A 4CZZA 1EJ9A 2PI0A 2BEOA 2IP2A 3QOPA 1S8NA 4A3LJ 2M7BA 4KMFA 3D5LA 1SVOA 1S29A 2Y75A 4HOBA 4B09A 2DBBA 2HYFA 2L4AA 4NDLA 4F55A 2A6TA 5GADJ 3A0BC 2JJ7A 1W4MA 3FXMA 4XLEA 5DTDA 4ZZLA 3L2QA 2VJIA 1I50J 3W2WA 2PMUA 4MIMA 4I0BA 2ZSHB 2O8XA 2LBFB 4FE7A 1D1AA 2WB1A 3DPUA 3HG9A 2VLAA 4BDZA 2JQ7A 4OMYA 1M1EB 1OPCA 2MC4A 3HOVJ 4CGZA 2DJNA 1EKEA 3QQAA 1FMWA 3M4OJ 2FOKA 3FBIB 1XDUA 3I64A 1ERDA 3S2HJ 3TQNA 2E36A 5FKMA 1VQ5I 3W6VA 1HQCA 1IO2A 2L7KA 1FBUA 1X1BA 4DW6A 3FXQA 4A3GJ 3D0SA 3R4KA 4GDFA 2NVTJ 3ZCOA 1JT6A 2V6EA 1Y56A 3SZGA 4UVBA 5EGOB 3EUHC 2GOXB 3N05A 1PVEA 2XSDC 5K7HA 1IXRC 2E34A 3RKXA 3KLNA 2DI3A 4F7ZA 4OAZA 4RS8A 2BHYA 3OYGA 1OYIA 2LH9A 1ZK8A 2R5ZB 5JVGF 2KL4A 3RYPA 4ON0A 3BZCA 4A3MJ 1A36A 2EILH 1D0ZA 1I3AA 3HHGA 1VQLI 1HXDA 1KA8A 1WH5A 2EINH 2BY3A 3JTHA 1IV6A 2R7ZJ 1X1AA 3HTUA 1TW3A 1JTXA 2XV4S 1IDYA 3GLLA 1V5EA 1YE9A 2ADUA 4BQOA 2LF7A 2FD5A 1WSUA 3PQKA 2XAGA 1ITYA 4EVIA 2NAZA 1SMYF 1MDMB 2LBFA 4AVPA 5JFRA 2XHKA 1BI0A 4MNUA 2BVMA 4BNCA 1REPC 1QHGA 3JW4A 5FFXA 3JRAA 1MNMC 5DM7F 1FYMA 2K40A 4S04A 5BNGA 5F27A 1K6OA 1FIAA 3CCSI 3H36A 1GT0C 3RQ4A 2Y0MA 1DPUA 2E7WA 1LFBA 2OQRA 2KMUA 3IH2A 4RA2A 5GAHJ 2CWEA 2KIFA 2CQXA 2YSRA 2XVCA 2OTJI 5KHDA 5LLQA 2DA5A 2XSJC 2V6CA 4IOCF 2AXLA 5J4YA 2HTSA 1D0XA 2DN0A 3PQJA 5EGOA 1XGOA 3DV8A 3GBGA 1ZG5A 2M4KA 2W57A 5FO5A 4IL6C 5E1ZB 3HSFA 4KIBA 3GEZA 2DK8A 3BQZA 2O8KA 5FJ8J 2R5ZA 4KITB 2HPMA 2O5RA 2Z3YA 4PJLA 4KYWA 4BQNA 5FD5A 4AUXA 3PUBA 4E7HA 2ELJA 4HX4A 1K4TA 4C3IJ 3UNGC 1ZN2A 3RZDJ 4UUVA 4LIVA 2WAQA 1DU6A 2MABA 1U6GA 2OCEA 1O3RA 2YUSA 1XSDA 4O3MA 1OFCX 3LNQA 4DJAA 2HU9A 1T0FA 2D1HA 4C2UA 3U2RA 3MQ0A 3VSKA 3O2PE 1MDMA 2UWMA 2HGCA 3OIOA 2DA6A 3E6MA 4KJZA 3WTWC 3HSEA 3P7NA 5DD4A 4CCOA 3M9AA 2L7ZA 3O3KA 4ZDOA 2VJJA 3KPHA 4I01A 1WH7A 2CQQA 5LFAA 3W2AA 5K5QA 3F8FA 1RPWA 4RGSA 2IBDA 2XAUA 1OCPA 4LMYA 3JRFA 4IHWA 3KCCA 3FK7A 2QBYA 3ZMDA 4UVCA 3EDPA 5L3BA 2ZXJA 1MSEC 1UELB 3ZOBA 2FEZA 2LYCA 2OZ6A 1A35A 5IOYA 2VJ4A 1MSFC 5LHHA 3CJQB 2LOOA 3M8JA 4MQ9F 4BY7J 1JHFA 3S8PA 4ESFA 4KFCA 4IRHA 3S1RJ 2CG4A 5LEKA 2IS2A 3ZMVA 4A0YA 3CC7I 2E35A 5F6FA 2DTZA 5FLXK 2DFHA 4QLCU 4A3FJ 2QF7A 3GFLA 4BKXA 4U7BA 4ANJA 3CLQA 5DS9A 1P4AA 3DEEA 1G8XA 3G1OA 1XD7A 4HG2A 5EZGA 1PP7U 4DBRA 3LQRA 1DU0A 2P81A 4HRIA 3E3VA 1MMDA 5E79C 2BY2A 3L1PA 3R6SA 3ZMUA 1G59A 1F36A 3PNVA 3K7AJ 1J59A 2JN6A 3P9IA 2P5KA 1MW7A 1UHSA 2M7AA 3VDXA 3K0LA 4XKVA 5FLXZ 5H6QA 3HYIA 3LWFA 1SFUA 1DUXC 1LKXA 5LGNA 1RUNA 3KE2A 1ZGJA 2CU7A 2QSGX 1R22A 4HQEA 3GTQJ 1MZBA 2L7FP 2FOWA 4QPOA 5FKNA 3NWSA 3UKGA 2BVLA 3RKWA 2CS3A 4ZTFA 3TDUC 1XGMA 2CRGA 3CP2A 3K4JA 1MMSA 1TNTA 1Z7LA 2BBYA 2FRHA 1J75A 2MD0A 1XCVA 1FYLA 3ZMZA 1POGA 4ASNA 4LIUA 4BEHA 1LDDA 1JJ6C 2VN2A 2ZFUA 5KVRA 3CCLI 4XLCA 1ZRDA 2DODA 4WXDA 2RNJA 2AO9A 2XKOA 3HJEA 3I54A 3HZJA 4J00A 3ML6A 3ZQFA 1R1UA 1ON2A 3WU1B 3FIWA 2V9VA 4WK8F 1S9HA 4PJNA 5FGMA 1DP3A 2ZNYA 5E1WA 4G6QA 3SJMA 5M5WJ 1RR8C 2L9RA 2H1LA 2JA2A 4PSWA 3T1BA 3U1KA 3RZOJ 4ABZA 4M74A 4A3KJ 3B02A 2GBYA 2KFDA 1VF9A 2CFOA 3KZZA 2K4BA 4FISA 1OLTA 1PP8F 3I56I 2E5NA 4A3CJ 2M5WA 3W3CA 1U9OA 2EZKA 2VBYA 1QVTA 1MNEA 1ZREA 4OAYA 2ELHA 4BHBA 2IGOA 4HDVA 3MKWB 3V4GA 2IEKA 4BACA 2A68F 1VQ8I 3HRTA 3BY6A 4ZTJA 5D6EA 2XB0X 3RTRA 1IRZA 3CLOA 4N9HA 4NHJA 4I76A 1U78A 2ZJRF 2Z1DA 5KAIC 1JJ8C 1O3TA 5E3MA 3K1MA 5FKKA 2VBXA 2DDBA 1Z6RA 3DKWA 1T38A 1L0OC 2K9QA 3L2RA 3TMOA 1XSVA 4II2A 4IQJA 3OIQA 5DYMA 3MKYB 1UMQA 4HV5A 4HNUA 2X6WA 5L3FA 3ABTA 3G2BA 2HOSA 1W36C 4KT5C 2F5DA 2JA5J 4XR6A 2FJ1A 1X1PA 4OIPF 3A2KA 2R4GA 2HDWA 4FETA 4L9JA 1IC8A 2QSFX 1J09A 1Z77A 5C3EJ 4Y33A 1EV7A 4DZPA 1OQYA 2PMZN 4H0EA 3KYCB 3SHFA 2QM3A 2L2OA 1AU7A 2K9LA 5BS6A 2WA0A 4HBLA 1SC7A 3CC4I 4XN3A 2R7VA 4L9VA 2IS4A 3E1SA 3OY9A 2HEOA 2VKHA 2EV0A 4KMUX 1LNWA 1FWZA 1I6HJ 3TDZC 3OYCA 2HR3A 3IWFA 1KQ0A 3FK6A 4ZYHA 6PAXA 4Y4RA 3G71I 3C18A 5E1XA 4BAYA 3JRDA 2Z33A 2Q1ZB 5GAEJ 1IN6A 1ACIA 5M5XJ 2FMLA 3H35A 4D7NA 3AL0C 5J1UA 1IJWC 2LY9A 2VXDA 3QYBA 3RJPA 2K02A 1G3WA 3FXLA 3LQQA 1XMKA 2EFOA 4A3EJ 2HVQA 2J5OA 3FHNA 2V1NA 2ZSIB 5E3NA 4M72A 2BGCA 4C30A 5ED4A 2GZWA 3CDHA 4D0PA 3Q3SA 2ISYA 1D1BA 3E5XA 4EM0B 4HF0A 1JUSA 2CV0A 1DGRM 4KIFA 1Y1WJ 2JWTA 2LK2A 3CO7C 3KEQA 4YEJA 4UB8C 3OS0A 4IHVA 2HOAA 4Y13A 3GO5A 4DNCA 4RAGA 4OU0A 5HS9A 1SFOJ 2V4JC 3ABLH 3SDGA 3EYIA 1FP2A 2M2EA 3WGGA 3KP2A 3GTMJ 1Z7UA 4XKWA 3NEUA 3ZMSA 3LSKA 3DLAA 1MMAA 1T98A 1HKTA 4CCNA 1TWGJ 4FCYA 1VTNC 2DU9A 4IVNA 1SFKA 4Z6YA 2ZJQF 4MGRA 3LFUA 2FX0A 3H3UA 3I9V2 1GDTA 5CJ9A 4B48A 2KJBA 1N25A 1WGXA 4XLNF 3CZ6A 3BTJA 3FBNB 3ZP5A 4ZJZA 1B59A 4LFUA 4BBSJ 3CDIA 3BQYA 3TO9A 4A12A 5C4XJ 3U9GA 1IUYA 2RVCA 1IN7A 2XGXA 3FXJA 5HVQC 4JQFA 4DYRA 1L3LA 5ILVA 3S16J 5J6XA 1LE8B 5JI6A 3RPQA 1R23A 4BHCA 4OMZA 3GTOJ 4V2FA 5E8GA 3T0YA 4AWXB 4L9TA 2CUEA 1R1VA 2OZUA 3W6KB 1XS9A 3B6CA 3AKZA 3HPGA 3DQVC 1WVRA 4LK0F 1ZAOA 2CMPA 3BZKA 1G2HA 4UVAA 2OJED 1WHUA 4M3FA 4EMSA 4KN7X 1J2XA 4RGUA 2ZMEB 2QWWA 2MW8A 4GXOA 1ZTRA 3SEQA 3DWLE 3VYSB 4JBAA 1T8IA 1VQNI 4C2MJ 5HNHA 3WTYC 4O5VA 1VZ0A 2LP0A 3ESWB 2KPMA 3VWBA 3BLYA 1G3SA 4HV6A 3COAC 3BR5A 4EJOA 5J1RA 3LMMA 5IY5H 3QU6A 1IDZA 2WWYA 3QRFF 3JCUC 2DOEA 1HW1A 3WODF 3FDYA 2G7UA 1XDSA 1KGSA 1RESA 3GX4X 2H1KA 1QRYA 4D5CA 5IP9J 1IW7F 1XMAA 4M73A 3ZQHA 2PJPA 3EYYA 1UJ8A 3KEYA 4BQAA 3CDLA 4E7KA 2TDXA 5LD2C 3OYFA 2ELKA 1LE8A 2R93J 2BXZA 2UV1A 2EIJH 4V2GA 3A01B 3S3NA 2M3AA 4D9JA 1IRFA 4Q48A 4QTRA 2R0QC 5TGTA 1SANA 5JHFA 5M3FJ 2M9HA 1S7AA 3IL2A 2KZGA 1SAUA 4ITVA 3K1NA 4AU7A 3OYMA 2MH9A 1IAWA 3S1MJ 1RNLA 1WQ2A 1ZG1A 3FKJA 2L4MA 3PJRA 1LB2A 3QP5A 2FNAA 3F72A 1HLVA 1TQPA 2P5LC 3WTUC 3PM1A 5DM6F 2LR8A 1ORKA 3HRMA 1QO0D 2MG4A 4UY8I 5IT9K 2JSPA 1WJDA 2LC2A 4LGWA 3EUHA 4LG3A 1E2XA 4ZC3A 1FOXA 2HKOA 3G6EI 4UB6C 1MH3A 1B9NA 2OAZA 2ZKZA 3FISA 4XRSG 1S7EA 2XF7A 2VC0A 2H27A 2HNHA 2DTRA 2V1DA 4XL9A 4RB2C 5B1AH 3H9JA 4EGZA 3JSOA 2IT0A 3FF5A 2JVHA 3GTKJ 1G3TA 2V7FA 4RGRA 4EGYA 5IT9Z 1TT0A 2VOOA 2WY7Q 3GF2A 2EZIA 2VQHA 3D1NI 2MFZA 3HHHA 4L5EA 1RKTA 3TW6A 5B66C 1H89C 3A01A 2VKDA 1YIJI 3OWTA 2L9VA 4F91B 1S72I 5M3MJ 2KISA 3PO3J 4NC6A 2R3SA 1LQ1A 3T8RA 5CVJA 1YW8A 2ACJA 1SD4A 4P55A 2O61A 3LSHA 1MBEA 3VOEA 3C2BA 2K85A 1R4NB 5TRDA 4HF1A 2P7CB 4BHPA 1Q1VA 2DXIA 1ULYA 3V42A 2ZXWH 3GW2A 2F2EA 4E7ZA 3C2GA 1Z3XA 2QQ9A 1FTZA 2BZTA 4N4OB 5M5YJ 3SQNA 3S2DJ 2WV0A 3BR0A 3ONQA 5IP6A 2A05A 2KIMA 1O7FA 2JZYA 4X0GA 1OR7C 4X1EA 3SXYA 2ZC2A 2RQQA 1MNDA 4HYEA 5LHGA 2M8EA 3OYLA 2M1BA 2K9NA 2Y48A 2DDAA 3HOSA 1H8AC 1BR1A 3RPUD 1XG1A 4Y7NJ 5C4JJ 1ETKA 4EM1A 3MEXA 2DCEA 1IXCA 3R0JA 2GOMA 2DPUA 3H3VK 3LSGA 3CCVI 1FNNA 2HKXA 4V19K 4F52A 4E70A 3FMSA 4E7LA 1YFHA 4M3BA 4E7JA 5HDKA 4R79A 1MBFA 1R5GA 4A5NA 3GMEA 3E7LA 2DYRH 3BTLA 3OSFA 2KP6A 2OA4A 4RB3C 4NNJA 3ZQQA 2AXTC 3CUOA 1E17A 1MBGA 3WE2A 3M7GA 2H8WA 2W25A 1SAXA 1S6LA 3J7AY 3Q9SA 5HLIA 2MLGA 1IUFA 2Y2ZA 1EA3A 2WAEA 4IJAA 4BXUA 1EH8A 2VIXA 2CV1A 1RRJA 3QODA 1NG7A 3OYKA 2A5WA 1R36A 3TO7A 1H9TA 1OMIA 1BOBA 3S3MA 1D5YA 3K1PA 3GFIA 4LG0B 1N75A 2LRDA 4Z2YA 2HDDA 3HKZN 3PFIA 1ODDA 4L5IA 3L2CA 4BGDA 2PN6A 3MVPA 3PNTA 4MTEA 1X4OA 2IGKA 2Y30A 4LD5A 3NARA 4W1UA 2DT6A 2Z16A 3JSPA 4ENNA 3PO2J 3U1DA 1OYYA 2KRHA 1YS7A 2OCCH 3TGNA 5ILUA 1QZEA 3W2VA 5GPCA 5HLGA 3CP8A 2A61A 3OYBA 2GXAA 2DA7A 3HC7A 1IXSB 1ZH5A 3EUAA 1VQ4I 2STTA 3IV5A 2QUFA 4JK1X 1KU2A 5E17F 1GXQA 1D3YA 2JT1A 4XLAA 3HOZJ 2Z9OA 2L54A 1LFUP 1B8IA 3I4PA 5EG0B 3KZYA 1BI2A 3GUDA 1OKRA 2DMPA 3K69A 9ANTA 4EM2A 1WJFA 1UCRA 2X85A 3ULQB 4CCMA 4Q4ZF 4ZYGA 2CSOA 2A07F 3QPSA 4EV0A 2VE8A 2HQNA 2K9SA 3DKXA 1T2KA 4B3XA 1P9QC 3IRRA 3L9FA 4BS9A 1GVDA 2E19A 4KNYA 1GVJA 3PIPF 2R5YB 1FOKA 3S17J 3HXLA 3ERED 1OCZH 5J47A 1I27A 2KRFA 1OJLA 2QBYB 5F08A 2NYXA 4JX6A 2FUG2 1FBQA 2EV6A 1U0JA 3SZPA 4BXXJ 4AIKA 2E1MC 3HUGB 2NOJB 5EF6A 4HDUA 1Z67A 4HLYA 3GTPJ 4LG0A 2O7OA 2EV5A 4CCKA 1U5TC 2WBMA 2ISZA 3DBHB 3P9CA 4IEJA 2W85A 3MN2A 5IYBJ 4IOAF 1HDPA 3V8KA 3CCJI 5GPAA 3H5NA 2ZNZA 1RKWA 1F43A 4FT8A 3VYTB 1G6NA 4G7OF 4I6ZA 2ZB9A 4R8HA 3F9KA 1D5VA 5F0FA 2R7DA 4LJZF 2RGVA 4L0ZB 2F5FA 5LGUA 1AWCA 2VQLA 2DJIA 4PGHA 1J0RA 1DGWY 3Q0VA 1ETYA 1LFPA 5EEHA 3G1LA 3OYDA 1A31A 4Y17A 3KP4A 1JKPC 2QQ8A 5EG0A 1VQMI 4M9XA 2Y31A 3LAJA 3CCMI 3ZN0A 3E6CC 4BJTA 2XC7A 5EEAA 1UFMA 5F1JA 2ME6A 1JI8A 4LB6B 3G73A 4XRMA 2D2WA 1Y8QB 4L0YB 1X2NA 3IUOA 1B4AA 5HS8A 3PNYA 4I09A 2IGNA 3H0DA 2R5YA 2BY0A 1YW9A 3P5JA 2EB7A 4PSXA 1E3HA 1PJRA 3H3ZA 3KP3A 3OR2C 3R60A 4QWQA 2V26A 1QNTA 3MD2A 3DTEA 3HUGA 3M8FA 4BEHB 1XN7A 4DBQA 4PUSA 2E71A 2QA4I 3RI4A 5HLHA 3HOTA 3FM3A 3IKTA 1Z91A 3AL0B 4M3EA 4O6JA 4NUBA 5B1BH 4HX8A 2DFIA 1BIAA 2GWRA 1XGSA 1R58A 2LDUA 1DP7P 1G3YA 3E5QA 1EH7A 2RN7A 4PK4A 3HBLA 1ETVA 2NXNB 5B5EC 2A69F 4PGGA 4NQWB 3MZYA 3V8JA 1Z3YA 2HQ5A 2ICWG 2QQAA 4KIGA 4IHXA 3LA7A 3ZPLA 3H92A 1R71A 3OR1C 2Q2EA 2DQRA 2PMHA 4B44A 1W7PB 1OCCH 2QEXI 2X9DA 2K5CA 1U3EM 3SFZA 2XRLA 1F5TA 1P92A 2JVGA 3A1YA 2XIGA 1TL8A 3GLXA 4C3HJ 1U8BA 2DLLA 3TW7A 3KETA 2KLOA 3KP6A 5H2FC 4B8XA 3AFHA 4FQGA 2EFWA 5L3DA 5IP7J 3A4CA 2UZKA 1NH3A 5CVUA 1WPKA 2A6HF 4NBQA 4F93B 3HSRA 1IRXA 4I7HA 4K2EA 2R7UA 4A0XA 4D5FA 2YX4A 3RKYA 4HF2A 1WZ2A 3F8NA 4ESJA 4L18B 3M1CA 2A5YB 3FXUA 1YRNA 1ETOA 3FZVA 2A3SA 1BJZA 2F5CA 2EIKH 1WI9A 1YHQI 4KICA 3I5UA 1USSA 4B4CA 1UHMA 2E7XA 3DCFA 2F4MB 5HOOA 2MH2A 3F22A 4MFEA 4GYGA 5FKOA 3CMAI 1Z0XA 1X1DA 1UG2A 1R5ID 1ZGWA 3LOCA 5CVVA 2HYJA 3J81K 4YIRX 2QLZA 1MJ9A 3FMQA 4CHUA 4CH7A 4M9SA 3VB2A 2DA1A 4NQWA 4MEYF 2X48A 2CFXA 2PMZA 5E18F 1YITI 1FJLA 3HOUJ 1C0WA 3O8GA 2DW4A 4GRIA 1APLC 2LSOA 2DT7B 3SZTA 3DEWA 2HZDA 2V9PA 3ZXSA 2ZJ2A 1J9IA 1U2WA 2A6EF 2O9LA 1W7PA 1E0EA 2BY1A 5D5WB 4DYQA 5A2QK 5HS7A 2O6GE 4CUGA 2IVMA 3J81Z 5KNLA 3JAMK 3JRCA 2H6CA 2VL8A 2HVSA 2CYYA 5EZHA 5F64A 2MYSA 4KISA 4C3JJ 2O03A 2QVOA 4MQVA 5L3EA 3HB9A 2VUMJ 4IKFA 1YG2A 1KU3A 5IPAA 1HW2A 3AG1H 3CF5F 2CGPA 3F3XA 1FX7A 2HS5A 5A2QZ 3QPHA 2B7EA 1HKQA 5CVIA 1IN8A 4H4KC 3VODA 2HPIA 2QCOA 2ESNA 3JAMZ 3Q9VA 2P4WA 4RLFA 1FIPA 4AIDA 2GA2A 3OOUA 4XKCA 1T33A 4IHTA 2K4JA 3WU0A 1ON1A 1LDJA 2DMTA 1R4MB 3F21A 5GP9A 2M45A 1JKOC 2LD5A 2MD5A 3BCAA 3BR1A 3K4CA 1CGPA 4E4HA 1XMXA 3N4MA 1B72B 1FEXA 3IP4B 1XCBA 1WJEA 2ZCWA 2Z5UA 3CQZJ 4A3JJ 2HFHA 3F6VA 5K5OA 4U0VA 5D8LB 4RBOA 2JA8J 2FSWA 1AHDP 1HCRA 3K4NA 1FBSA 3O6BB 3TOAA 1QHHD 1GLNA 4AIJA 2F48A 3M1EA 3PSIA 2CO5A 2L01A 4QSHA 3C2HA 3ERMA 4WXCA 3NWTA 1Z9CA 4JYKA 1IV8A 5IYCJ 2P6TA 1WJAA 1V3FA 2UXXA 4CCLA 5EJCA 3S1NJ 2EFNA 2H94A 2KT0A 4RM2A 1N77A 3KX2A 2R7TA 4UXNA 4BBRJ 1T39A 1YIOA 2XPUA 2EH3A 1VQOI 3QP6A 1SD5A 2AQFA 3A0HC 1ETQA 3BJAA 1TBXA 4RLQA 3BJOA 2XGCA 2CV2A 3IHUA 4C2TA 1RZ4A 4LB5A 1ZARA 2RKHA 2CJJA 4I98B 5J8CA 4XRFA 3S15J 3QPLA 5J40A 1H88C 5J3LA 2XAQA 3EUKL 3MKLA 4YELA 2V79A 3KP5A 4L5JA 3F23A 5K7FA 3ZMTA 1R1TA 2X6XA 2DFEA 3K4BA 3S32A 2EK5A 1T56A 1SD6A 1MJAA 3R0AA 1JKQC 2CQKA 3K4MA 4AC0A 1KU7A 3B73A 1RI7A 2GAUA 3ABKH 1GV5A 1B72A 3PFYA 1K83J 5ILSA 4XONA 2XF6A 5BPIA 2LFBA 2W24A 3LSJA 2BXYA 2I5UA 3VYRB 2NNYA 1FSHA 3ASNH 1TWAJ 1BW6A 1V55H 5DCFA 3JRGA 3BPVA 1LPQA 1VQ6I 1VQPI 3K9TA 1B6AA 2QKLB 3DFGA 2RAEA 3G4SI 2OD5A 5CYVA 2CUZA 1E3OC 4M9ZA 1MGTA 2E1OA 2VXZA 2X0LA 2ZJPF 3E6BA 5BOXA 1ZRCA 3CCUI 5IT3A 1F1ZA 3RIRA 2JRTA 2ZXHA 3GCMA 3BR6A 1HF0A 4HSTA 3J7YJ 1YJ9I 3U21A 3H9QA 2AHQA 4LITA 4XM3A 1JUPA 3K70C 2JRMA 1QQIA 2LKSA 2DAOA 3FXKA 3L7WA 2FXAA 2KKOA 3BZ6A 1HA8A 4A6DA 2CW8A 4KA4A 3WHCA 3TO6A 2VBZA 1WI3A 2W1OA 3ZQIA 2HDCA 1HC8A 3I55I 3HGYA 5BMZA 2F4IA 2KIUA 1GV2A 5D8KB 3SEZA 3CJRB 3FM5A 1W5TA 3ZQCA 3F8MA 3E6DA 4BH9A 2DA3A 3OIPA 2VI6A 1VFCA 4WCGA 2V9KA 2W82A 4B43A 2Y0SN 3V7SA 1TT5B 2N8GA 1HSTA 5ICFA 5D5VB 3OYHA 2BE5F 2Z99A 4RB0A 3TL4X 1YOVB 2BYVE 5LGTA 5D5UB 3MAJA 3DTKA 2HXOA 2VBWA 2E2IJ 3KLOA 1IRGA 1GXPA 2J5PA 2E2HJ 4EJWA 1DPRA 2K86A 2L9SA 1FZPB 1NTCA 2W7NA 3OYEA 2LLKA 3OOPA 4BQQA 1H0MA 2FF4A 4XORA 1OR7A 2L9NA 3DXJF 1Z6TA 3E97A 4E7SA 2CUFA 4G7HF 1LUJB 3WTSC 2X1DA 5H20A 4FHTA 5AIQA 5GTHC 2HOEA 2QENA 4AD9A 3S1QJ 1QGPA 3C1DA 3BWGA 3HM5A 3ZQLA 2GIVA 4GFBA 1BA5A 1BI3A 1IGNA 2GXBA 2FBKA 2BHZA 3MZ8A 4IO9F 2LKPA 2GIZA 3RQIA 2IW5A 3A03A 1U8RA 2EZHA 2K27A 4YFXF 1TZLA 4A93J 4YFKF 2IS6A 3I58A 2COBA 3F8CA 1RETA 3LA2A 1K7AA 2NVQJ 4QIWN 4FX0A 3ZN1A 5K1YA 1EF4A 2LMDA 2AQEA 3BC8A 4P96A 2JA6J 3G3ZA 1NK2P 4XKBA 2AS5F 1NK3P 1K61A 3OV8A 3S2WA 2WV1A 1XTAA 5LEJA 1HDDC 2XB5A 4AVZA 4R1HA 3M8EA 1Y1VJ 1KZHA 2E1MB 2DYSH 2YU3A 4G7ZF 3ZGKA 3K70D 4WX9A 1FMVA 5BPDA 2M0MA 2R7OA 3ABMH 3WU2C 1ETXA 5EYRA 1N78A 2DMUA 3OL3A 1YYVA 3ECHA 1IN5A 3KIOA 1KYZA 5DCMB 2D1VA 4CCJA 4G6TB 2VB6A 1P4XA 4CO8A 3GTJJ 4CYDA 2H8RA 1WWXA 2ID6A 2FQ4A 3IH3A 2IA0A 2EJRA 1UB9A 3C3WA 4RDUA 3ABUA 1YS6A 4OIRF 2VKVA 4B3AA 4ZYAA 4U0YA 5FFZA 1BC7C 4HA8A 1MMGA 2VPLA 3WGHA 1P7IA 4U87A 2V1UA 3NQOA 3NAUA 3K4KA 3CUQC 5AONA 3OYAA 3GTGJ 3FMRA 3OSGA 5FKLA 3MWMA 4DGWB 1TLHB 4FTHA 2CW0F 3V7CA 2KZVA 3CESA 2GM4A 2KJCA 1S3JA 2JPBA 2L02A 3LFKA 3BTCA 3HKZA 3QOEA 4FASD 2F5EA 2YU9J 3GTLJ 2W4SA 1BW5A 4RMNA 2P7VB 1X2MA 4G12A 4RAFA 1R9TJ 1D8JA 1VQKI 5LHIA 1U5TA 1VQ9I 3I4MJ 5DD8A 4XOPA 2VODA 1UZCA 4XNFA 2WAFA 4MTDA 4JP0A 3JREA 4J19A 2DPDA 4A5MA 1FTTA 2E60A 4XN0A 4HNVA 1WKMA 1XGNA 1I3QJ 2H6BA 2JTVA 3KP7A 4G94A 2OPTA 4P5OA 1QVUA 5DCMA 4BJ5C 1IF1A 1FPQA 1ZG3A 1B8IB 3RYRA 3J7ZI 2Q8KA 4HX7A 2G9WA
chains in the Genus database with same CATH topology
3WTTC 1JXSA 1YTYA 2NNNA 1OYWA 4XBFA 4GCVA 4P9UA 2P8TA 4OIQF 1B9MA 4EJUA 1K79A 2YR2A 4I02A 4KN4X 1O57A 5DUKA 1KQ9A 4Q47A 4IHSA 3FXRA 4ENMA 2W84A 2DQLA 3LSTA 3ROUA 4U7DA 4RAZA 4EJVA 2Q8KA 1K78B 1JE8A 3J7AO 1SFXA 5LRRA 5DEQA 3BOQA 2NRAC 1GHCA 1QPMA 2DK5A 1ONVA 1O3SA 3WGIA 4A6EA 2LNBA 5E8IA 4IRIA 1ZLKA 3Q5FA 3QU3A 2R7FA 3N97A 1ZRFA 2L3DA 3LAPA 1WRJA 2PQ8A 1X3UA 1ZGAA 2JPCA 3GVAA 4HLXA 2ETHA 3F6OA 3QAHA 4A2UA 3I59B 3REOA 2GQQA 3FWEA 1HSJA 2IRFG 1LVAA 1YO5C 1R00A 3RDIA 1I1GA 2WTEA 3MCZA 1K78A 4XSXF 1TW2A 2HYGD 3GZ5A 2FBHA 5DV5A 1UHWA 3WG9A 3I71A 1P4WA 2BV6A 1QZYA 1XB4A 1R5HA 1W5SA 2RDPA 3IWZA 3KEOA 4U0WA 2XROA 4MHGA 2EA4A 4RB1A 4CXFA 4GO1A 4LLLA 1I1SA 4G6DA 1F4KA 5JR3A 4UV8A 3BPXA 1BOAA 2PG4A 2HQRA 2OQGA 3I59A 1S7OA 4YIFA 1BIBA 1XSXA 2MA3A 3EETA 3IRQA 4P9FA 1D8KA 1FC3A 1F9NA 4M6YA 1DDNA 2ZBKA 3FX3A 4U88A 1G4DA 4ENJA 5JVTA 2FMYA 4IXAA 4YIIA 4L9NA 4I0AA 2IJLA 4LK1F 2FE3A 5H6RA 2VC1A 2STWA 3DF8A 3JTGA 2NS0A 4ETSA 4HAMA 4ENKA 1PUEE 3BJ6A 3DP7A 3GFMA 4PCQA 4DQ2A 5LBQA 5EEGA 2VOPA 2MC3A 5HDNA 3GYHX 1Z1DA 2RC4A 1KU9A 2E1CA 2XKPA 4GYIA 2UXNA 2FU4A 3LA3A 1MJBA 5J8FA 3ZQ7A 4XLPF 1JGSA 5ICCA 5DDGA 3P9KA 5LRSA 3VFZA 1I5ZA 5BQTA 4IRGA 1FLIA 2PBIA 1NHAA 4NB5A 2HWVA 1MKMA 5FD6A 2DO7A 1TQIA 1SFEA 3E5UA 5ERIA 1TTYA 2RQPA 1V4RA 3I0TA 1Q1HA 4WWCA 1FP1D 4Y15A 2X4HA 2Q0OA 1B1BA 2HZTA 5D5XB 2C6YA 2PFBA 1HBXG 2FA5A 2EFPA 1O7LA 3V8LA 2VE9A 1YW7A 4G8XA 4WXHA 2ZO4A 2O3FA 3V7RA 1BBYA 3J80K 1LDKB 5DUIA 5K5RA 1ZLJA 2MBFA 2OBPA 4LLNA 1EH6A 1ZYRF 1O3QA 4PZJA 1BJAA 4ZYEA 1Z05A 2QZ8A 2XAFA 3GFJA 1KYWA 2GXGA 3CJNA 3J80Z 4WF2A 2QQBA 4IPAA 5E20A 5KK1A 4ESBA 1FYKA 3EQLF 5FB2A 3MFKA 1FY7A 4RGXA 5L3GA 1A04A 1LJ9A 1R7JA 3WE3A 2GA1A 4YFNF 3BP8A 4IF4A 2MLKA 4GGGA 3RPUA 5L3CA 2O0YA 1BM9A 5ICEA 1P6RA 4YG2F 3R61A 3BROA 2VONA 3BDDA 2IA2A 1STZA 3CUQB 4OINF 4G9YA 1H9GA 3QPTA 2YPRA 5HDGA 2JSCA 3ISPA 3HTSB 1MD0A 4EJTA 5D4SA 2IPQX 1QZZA 5D4RA 3ECOA 2FBIA 1CF7B 2VT2A 5CLSA 3L00A 4I2OA 3DEUA 4M6XA 2XRNA 1TNSA 1YQAA 1SD7A 1KQ8A 2OU2A 1HW5A 2D45A 2M30A 4CDGA 4KDPA 2VT3A 3GWZA 2B0LA 1AOYA 1SMTA 4HZFA 2FQ3A 3MZHA 3I53A 3K2ZA 3FHZA 3CUQA 1BI1A 2FNPA 3HRUA 2EWNA 2M87A 3KFWX 3DPLC 3IC7A 2QYOA 3C7JA 4EQQA 2COMA 3HRSA 4MEXF 3NRVA 2WC2A 2IA1A 1CF7A 3TOBA 4LLGF 1FT9A 4HW0A 3IKVA 2ESHA 2YX7A 4AIHA 4UNOA 2XAHA 3CO6C 4RAYA 2RV8A 4KUMA 4CICA 1P2FA 2EA2A 3GZ6A 5JHUA 4OOIA 5AIPA 3W6JB 4ZZDA 1JHHA 1LEBA 5TJJA 2P5VA 4ZYDA 2XASA 5CVRA 4FX4A 2K7LA 2HTJA 1W7PD 3CTAA 1TQMA 2PEXA 2XAJA 2E1NA 1ZHFA 1J5YA 3HIFA 4N9IA 1RUOA 1U5TB 1LEAA 3DPTA 1BC8C 1IN4A 3GXOA 2ZMEA 5D6FA 4UHTA 3T8TA 2LF8A 2H09A 1HKSA 3F8BA 4Q5SF 4OIOF 1T6SA 5ICGA 4TV7A 2XUBA 3WTVC 4PDKA 4ZH4F 1RIOH 1I6XA 1QBJA 4M71A 3T5XA 3AAFA 4S05A 2P6SA 3L09A 4HQMA 5F1RA 2V1XA 1IZ1A 2ZFWA 4BYYA 1USTA 4N0BA 1FSEA 1PDNC 3WTZA 4XSZF 1Y0UA 3ELKA 2DT5A 2EFQA 3TKYA 3VEPA 4UV9A 1BN5A 1YLFA 2G7HA 3WTXC 4A0ZA 2PLYA 1J7KA 4CZZA 2PI0A 2BEOA 2IP2A 3QOPA 1S8NA 4KMFA 3D5LA 1S29A 2Y75A 4HOBA 4B09A 2DBBA 2HYFA 2L4AA 1W4MA 4ZZLA 2PMUA 4I0BA 2O8XA 4OMYA 1OPCA 4CGZA 2FOKA 1XDUA 3I64A 3TQNA 1HQCA 1FBUA 3FXQA 3D0SA 3R4KA 4UVBA 1IXRC 3RKXA 4F7ZA 3KLNA 2DI3A 4RS8A 1OYIA 3RYPA 4ON0A 3HHGA 1HXDA 1KA8A 3JTHA 3HTUA 1TW3A 2XV4S 2ADUA 2LF7A 1WSUA 3PQKA 2XAGA 4EVIA 2NAZA 1SMYF 1MDMB 4AVPA 5JFRA 2XHKA 1BI0A 4MNUA 4BNCA 1REPC 3JW4A 5FFXA 1FYMA 4S04A 1K6OA 2Y0MA 1DPUA 2E7WA 2OQRA 2CWEA 2KIFA 2YSRA 2XVCA 5LLQA 2V6CA 2AXLA 2HTSA 3PQJA 1XGOA 3DV8A 1ZG5A 2W57A 5FO5A 5E1ZB 3HSFA 4KIBA 3GEZA 2DK8A 2Z3YA 4KYWA 5FD5A 4HX4A 1ZN2A 4UUVA 1U6GA 1O3RA 1XSDA 4O3MA 1T0FA 2D1HA 3U2RA 3MQ0A 3O2PE 1MDMA 2UWMA 2HGCA 3E6MA 3WTWC 3HSEA 3P7NA 5DD4A 3M9AA 3O3KA 4I01A 5K5QA 3F8FA 4RGSA 4LMYA 3KCCA 2QBYA 3ZMDA 4UVCA 3EDPA 5L3BA 2ZXJA 2FEZA 2OZ6A 5LHHA 4MQ9F 4ESFA 1JHFA 4KFCA 4IRHA 2CG4A 5LEKA 3ZMVA 4A0YA 5F6FA 5FLXK 4QLCU 3GFLA 4U7BA 1P4AA 1XD7A 1PP7U 3LQRA 3E3VA 3R6SA 3ZMUA 1J59A 3P9IA 2P5KA 3K0LA 5FLXZ 5H6QA 3HYIA 3LWFA 1SFUA 1DUXC 5LGNA 1RUNA 3KE2A 1ZGJA 1R22A 4HQEA 1MZBA 3RKWA 3TDUC 1XGMA 1TNTA 2BBYA 2FRHA 1J75A 1XCVA 1FYLA 3ZMZA 4ASNA 1LDDA 2VN2A 5KVRA 1ZRDA 4WXDA 2RNJA 2XKOA 3I54A 3ML6A 1R1UA 1ON2A 3WU1B 2V9VA 4WK8F 5FGMA 2ZNYA 5E1WA 4G6QA 3T1BA 4M74A 3B02A 3KZZA 2K4BA 1PP8F 2M5WA 2VBYA 1ZREA 2ELHA 4BHBA 4HDVA 3V4GA 2A68F 3HRTA 3BY6A 5D6EA 3RTRA 3CLOA 4N9HA 4NHJA 1U78A 1O3TA 3K1MA 2VBXA 1Z6RA 3DKWA 1T38A 1L0OC 1XSVA 5DYMA 4HV5A 5L3FA 3ABTA 4KT5C 2F5DA 4OIPF 4L9JA 1EV7A 4H0EA 3SHFA 2QM3A 5BS6A 4HBLA 4L9VA 2HEOA 2EV0A 4KMUX 1LNWA 1FWZA 3TDZC 2HR3A 3IWFA 1KQ0A 4ZYHA 6PAXA 3C18A 5E1XA 4BAYA 2Z33A 1IN6A 2FMLA 3RJPA 2K02A 1G3WA 3LQQA 1XMKA 2EFOA 2J5OA 4M72A 2BGCA 5ED4A 2GZWA 3CDHA 4D0PA 2ISYA 3E5XA 4EM0B 4HF0A 4KIFA 3CO7C 3KEQA 4Y13A 3GO5A 4DNCA 4OU0A 5HS9A 3EYIA 1FP2A 3WGGA 3KP2A 1Z7UA 3NEUA 3ZMSA 1T98A 1HKTA 1VTNC 2DU9A 4IVNA 4MGRA 3H3UA 5CJ9A 2KJBA 4XLNF 3ZP5A 1B59A 4LFUA 3TO9A 4A12A 3U9GA 1IUYA 2RVCA 1IN7A 2XGXA 5HVQC 1L3LA 4JQFA 5ILVA 5J6XA 5JI6A 3RPQA 1R23A 4BHCA 4OMZA 5E8GA 3T0YA 4AWXB 4L9TA 1R1VA 2OZUA 3W6KB 3DQVC 4LK0F 1ZAOA 4UVAA 4EMSA 4KN7X 1J2XA 4RGUA 2ZMEB 2QWWA 4GXOA 4JBAA 3WTYC 4O5VA 1G3SA 4HV6A 3COAC 4EJOA 3QU6A 2WWYA 3QRFF 3WODF 1HW1A 2G7UA 1XDSA 1KGSA 3GX4X 1IW7F 1XMAA 4M73A 2PJPA 3EYYA 4BQAA 2TDXA 1IRFA 4Q48A 1S7AA 3IL2A 3K1NA 2MH9A 1IAWA 1RNLA 1WQ2A 1ZG1A 2L4MA 1LB2A 3QP5A 2FNAA 3F72A 1TQPA 2P5LC 3WTUC 3HRMA 1QO0D 5IT9K 4LGWA 3EUHA 1E2XA 2HKOA 1B9NA 2OAZA 2ZKZA 2H27A 2VC0A 2DTRA 2V1DA 4RB2C 4EGZA 3JSOA 2IT0A 3FF5A 1G3TA 4RGRA 4EGYA 5IT9Z 2VOOA 3GF2A 3HHHA 1LQ1A 2R3SA 3T8RA 5CVJA 1YW8A 2ACJA 1SD4A 4P55A 2O61A 3VOEA 4HF1A 5TRDA 2P7CB 4BHPA 1ULYA 3GW2A 2F2EA 2QQ9A 3SQNA 2WV0A 2KIMA 1O7FA 2JZYA 3SXYA 4HYEA 5LHGA 2M8EA 2M1BA 2Y48A 3HOSA 4EM1A 3MEXA 1IXCA 3R0JA 2DPUA 1FNNA 2HKXA 4E70A 3FMSA 1YFHA 5HDKA 4R79A 1R5GA 4A5NA 4RB3C 2OA4A 3CUOA 1E17A 3WE2A 3M7GA 2W25A 1SAXA 1S6LA 3Q9SA 5HLIA 2MLGA 4IJAA 4BXUA 1EH8A 1R36A 3TO7A 1H9TA 1OMIA 3K1PA 3GFIA 4LG0B 4Z2YA 3PFIA 1ODDA 4L5IA 3L2CA 2PN6A 4MTEA 4LD5A 4ENNA 3JSPA 3U1DA 1OYYA 1YS7A 3TGNA 5ILUA 5HLGA 2A61A 1IXSB 1ZH5A 2STTA 2QUFA 4JK1X 1KU2A 5E17F 1GXQA 1D3YA 2JT1A 2Z9OA 2L54A 3I4PA 3KZYA 1BI2A 3GUDA 1OKRA 3K69A 4EM2A 1UCRA 3ULQB 4Q4ZF 4ZYGA 2CSOA 2A07F 4EV0A 2VE8A 2HQNA 1T2KA 3L9FA 4KNYA 1GVJA 1FOKA 3ERED 1I27A 2KRFA 2QBYB 2NYXA 1FBQA 2EV6A 3SZPA 4AIKA 4HDUA 4HLYA 4LG0A 2EV5A 1U5TC 2ISZA 3P9CA 2W85A 3V8KA 2ZNZA 4FT8A 1G6NA 4G7OF 4R8HA 1D5VA 2R7DA 4LJZF 2RGVA 4L0ZB 2F5FA 5LGUA 1AWCA 4PGHA 1J0RA 5EEHA 4Y17A 3KP4A 4M9XA 3LAJA 3ZN0A 3E6CC 1UFMA 4LB6B 3G73A 2D2WA 4L0YB 1B4AA 5HS8A 4I09A 1YW9A 2EB7A 3H3ZA 3KP3A 3R60A 4QWQA 1QNTA 3HUGA 3M8FA 1XN7A 3RI4A 5HLHA 3HOTA 3FM3A 3IKTA 1Z91A 4O6JA 4HX8A 2DFIA 1BIAA 2GWRA 1XGSA 1R58A 2LDUA 1DP7P 1G3YA 3E5QA 1EH7A 2RN7A 2A69F 4PGGA 3MZYA 3V8JA 2QQAA 4KIGA 3LA7A 3ZPLA 3H92A 2Q2EA 2DQRA 2PMHA 1W7PB 1U3EM 3SFZA 1F5TA 1P92A 2XIGA 3GLXA 2DLLA 3KETA 3KP6A 4B8XA 2EFWA 5L3DA 2UZKA 5CVUA 2A6HF 3HSRA 4I7HA 4K2EA 4A0XA 2YX4A 3RKYA 4HF2A 3F8NA 4ESJA 4L18B 2A5YB 3FXUA 3FZVA 2A3SA 2F5CA 1WI9A 4KICA 3I5UA 1USSA 1UHMA 2E7XA 5HOOA 2MH2A 3F22A 4GYGA 5CVVA 3J81K 2QLZA 1MJ9A 3FMQA 4CHUA 4M9SA 3VB2A 4NQWA 4MEYF 2CFXA 5E18F 1C0WA 2DW4A 2LSOA 3SZTA 2ZJ2A 1J9IA 1U2WA 2A6EF 1W7PA 5D5WB 5A2QK 5HS7A 2O6GE 2IVMA 3J81Z 3JAMK 2H6CA 2CYYA 5F64A 2O03A 2QVOA 4MQVA 5L3EA 1YG2A 1KU3A 1HW2A 2CGPA 3F3XA 1FX7A 2HS5A 5A2QZ 3QPHA 5CVIA 1HKQA 1IN8A 3VODA 2ESNA 3JAMZ 3Q9VA 2P4WA 2GA2A 4IHTA 2K4JA 3WU0A 1ON1A 1LDJA 3F21A 2M45A 2MD5A 1CGPA 3N4MA 1XCBA 2ZCWA 2Z5UA 2HFHA 3F6VA 5K5OA 4U0VA 5D8LB 2FSWA 3O6BB 1FBSA 3TOAA 4AIJA 3M1EA 2CO5A 2L01A 4WXCA 1Z9CA 2P6TA 1V3FA 2UXXA 2EFNA 2H94A 4UXNA 1T39A 1YIOA 3QP6A 1SD5A 3BJAA 1TBXA 3BJOA 3IHUA 4LB5A 1RZ4A 1ZARA 2RKHA 4I98B 5J8CA 4XRFA 2XAQA 2V79A 3KP5A 4L5JA 3F23A 3ZMTA 1R1TA 2EK5A 1SD6A 1MJAA 3R0AA 2CQKA 1KU7A 3B73A 1RI7A 2GAUA 5ILSA 5BPIA 2W24A 1FSHA 2NNYA 5DCFA 3BPVA 3K9TA 1B6AA 3DFGA 2OD5A 5CYVA 4M9ZA 1MGTA 2VXZA 2X0LA 5BOXA 3E6BA 1ZRCA 5IT3A 1F1ZA 3RIRA 2JRTA 1QQIA 2DAOA 3L7WA 2FXAA 2KKOA 3BZ6A 4A6DA 4KA4A 3TO6A 2VBZA 2HDCA 5BMZA 2KIUA 5D8KB 3FM5A 1W5TA 3F8MA 3E6DA 4BH9A 4WCGA 3V7SA 1HSTA 5ICFA 5D5VB 2BE5F 2Z99A 4RB0A 2BYVE 5LGTA 5D5UB 3MAJA 2VBWA 3KLOA 1IRGA 1GXPA 2J5PA 4EJWA 1DPRA 2K86A 1FZPB 3OOPA 1H0MA 2FF4A 1OR7A 3DXJF 1Z6TA 3E97A 4G7HF 3WTSC 5H20A 4FHTA 5AIQA 2HOEA 2QENA 4AD9A 1QGPA 3C1DA 3BWGA 2GIVA 1BI3A 2GXBA 2FBKA 2LKPA 1U8RA 2IW5A 2K27A 4YFXF 4YFKF 3I58A 3F8CA 1K7AA 3LA2A 4FX0A 3ZN1A 5K1YA 4P96A 3G3ZA 2AS5F 3OV8A 3S2WA 5LEJA 4R1HA 3M8EA 2YU3A 4G7ZF 4WX9A 5BPDA 1YYVA 3ECHA 1IN5A 1KYZA 5DCMB 2D1VA 1P4XA 4CO8A 4CYDA 1WWXA 2IA0A 2EJRA 1UB9A 3C3WA 3ABUA 1YS6A 4OIRF 4U0YA 5FFZA 1BC7C 4HA8A 3WGHA 2V1UA 3NQOA 3CUQC 5AONA 3FMRA 3MWMA 1TLHB 2CW0F 3V7CA 2KJCA 1S3JA 2JPBA 2L02A 3LFKA 2F5EA 2P7VB 1D8JA 5LHIA 1U5TA 5DD8A 2VODA 4MTDA 2DPDA 4A5MA 1WKMA 1XGNA 2JTVA 2H6BA 3KP7A 4G94A 5DCMA 4P5OA 1IF1A 1FPQA 1ZG3A 3RYRA 3IRRA 4HX7A 2G9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WTT C;  1JXS A;  1YTY A;  2NNN A;  1OYW A;  4XBF A;  4GCV A;  4P9U A;  2P8T A;  4OIQ F;  1B9M A;  4EJU A;  1K79 A;  2YR2 A;  4I02 A;  4KN4 X;  1O57 A;  5DUK A;  1KQ9 A;  4Q47 A;  4IHS A;  3FXR A;  4ENM A;  2W84 A;  2DQL A;  3LST A;  3ROU A;  4U7D A;  4RAZ A;  4EJV A;  2Q8K A;  1K78 B;  1JE8 A;  3J7A O;  1SFX A;  5LRR A;  5DEQ A;  3BOQ A;  2NRA C;  1GHC A;  1QPM A;  2DK5 A;  1ONV A;  1O3S A;  3WGI A;  4A6E A;  2LNB A;  5E8I A;  4IRI A;  1ZLK A;  3Q5F A;  3QU3 A;  2R7F A;  3N97 A;  1ZRF A;  2L3D A;  3LAP A;  1WRJ A;  2PQ8 A;  1X3U A;  1ZGA A;  2JPC A;  3GVA A;  4HLX A;  2ETH A;  3F6O A;  3QAH A;  4A2U A;  3I59 B;  3REO A;  2GQQ A;  3FWE A;  1HSJ A;  2IRF G;  1LVA A;  1YO5 C;  1R00 A;  3RDI A;  1I1G A;  2WTE A;  3MCZ A;  1K78 A;  4XSX F;  1TW2 A;  2HYG D;  3GZ5 A;  2FBH A;  5DV5 A;  1UHW A;  3WG9 A;  3I71 A;  1P4W A;  2BV6 A;  1QZY A;  1XB4 A;  1R5H A;  1W5S A;  2RDP A;  3IWZ A;  3KEO A;  4U0W A;  2XRO A;  4MHG A;  2EA4 A;  4RB1 A;  4CXF A;  4GO1 A;  4LLL A;  1I1S A;  4G6D A;  1F4K A;  5JR3 A;  4UV8 A;  3BPX A;  1BOA A;  2PG4 A;  2HQR A;  2OQG A;  3I59 A;  1S7O A;  4YIF A;  1BIB A;  1XSX A;  2MA3 A;  3EET A;  3IRQ A;  4P9F A;  1D8K A;  1FC3 A;  1F9N A;  4M6Y A;  1DDN A;  2ZBK A;  3FX3 A;  4U88 A;  1G4D A;  4ENJ A;  5JVT A;  2FMY A;  4IXA A;  4YII A;  4L9N A;  4I0A A;  2IJL A;  4LK1 F;  2FE3 A;  5H6R A;  2VC1 A;  2STW A;  3DF8 A;  3JTG A;  2NS0 A;  4ETS A;  4HAM A;  4ENK A;  1PUE E;  3BJ6 A;  3DP7 A;  3GFM A;  4PCQ A;  4DQ2 A;  5LBQ A;  5EEG A;  2VOP A;  2MC3 A;  5HDN A;  3GYH X;  1Z1D A;  2RC4 A;  1KU9 A;  2E1C A;  2XKP A;  4GYI A;  2UXN A;  2FU4 A;  3LA3 A;  1MJB A;  5J8F A;  3ZQ7 A;  4XLP F;  1JGS A;  5ICC A;  5DDG A;  3P9K A;  5LRS A;  3VFZ A;  1I5Z A;  5BQT A;  4IRG A;  1FLI A;  2PBI A;  1NHA A;  4NB5 A;  2HWV A;  1MKM A;  5FD6 A;  2DO7 A;  1TQI A;  1SFE A;  3E5U A;  5ERI A;  1TTY A;  2RQP A;  1V4R A;  3I0T A;  1Q1H A;  4WWC A;  1FP1 D;  4Y15 A;  2X4H A;  2Q0O A;  1B1B A;  2HZT A;  5D5X B;  2C6Y A;  2PFB A;  1HBX G;  2FA5 A;  2EFP A;  1O7L A;  3V8L A;  2VE9 A;  1YW7 A;  4G8X A;  4WXH A;  2ZO4 A;  2O3F A;  3V7R A;  1BBY A;  3J80 K;  1LDK B;  5DUI A;  5K5R A;  1ZLJ A;  2MBF A;  2OBP A;  4LLN A;  1EH6 A;  1ZYR F;  1O3Q A;  4PZJ A;  1BJA A;  4ZYE A;  1Z05 A;  2QZ8 A;  2XAF A;  3GFJ A;  1KYW A;  2GXG A;  3CJN A;  3J80 Z;  4WF2 A;  2QQB A;  4IPA A;  5E20 A;  5KK1 A;  4ESB A;  1FYK A;  3EQL F;  5FB2 A;  3MFK A;  1FY7 A;  4RGX A;  5L3G A;  1A04 A;  1LJ9 A;  1R7J A;  3WE3 A;  2GA1 A;  4YFN F;  3BP8 A;  4IF4 A;  2MLK A;  4GGG A;  3RPU A;  5L3C A;  2O0Y A;  1BM9 A;  5ICE A;  1P6R A;  4YG2 F;  3R61 A;  3BRO A;  2VON A;  3BDD A;  2IA2 A;  1STZ A;  3CUQ B;  4OIN F;  4G9Y A;  1H9G A;  3QPT A;  2YPR A;  5HDG A;  2JSC A;  3ISP A;  3HTS B;  1MD0 A;  4EJT A;  5D4S A;  2IPQ X;  1QZZ A;  5D4R A;  3ECO A;  2FBI A;  1CF7 B;  2VT2 A;  5CLS A;  3L00 A;  4I2O A;  3DEU A;  4M6X A;  2XRN A;  1TNS A;  1YQA A;  1SD7 A;  1KQ8 A;  2OU2 A;  1HW5 A;  2D45 A;  2M30 A;  4CDG A;  4KDP A;  2VT3 A;  3GWZ A;  2B0L A;  1AOY A;  1SMT A;  4HZF A;  2FQ3 A;  3MZH A;  3I53 A;  3K2Z A;  3FHZ A;  3CUQ A;  1BI1 A;  2FNP A;  3HRU A;  2EWN A;  2M87 A;  3KFW X;  3DPL C;  3IC7 A;  2QYO A;  3C7J A;  4EQQ A;  2COM A;  3HRS A;  4MEX F;  3NRV A;  2WC2 A;  2IA1 A;  1CF7 A;  3TOB A;  4LLG F;  1FT9 A;  4HW0 A;  3IKV A;  2ESH A;  2YX7 A;  4AIH A;  4UNO A;  2XAH A;  3CO6 C;  4RAY A;  2RV8 A;  4KUM A;  4CIC A;  1P2F A;  2EA2 A;  3GZ6 A;  5JHU A;  4OOI A;  5AIP A;  3W6J B;  4ZZD A;  1JHH A;  1LEB A;  5TJJ A;  2P5V A;  4ZYD A;  2XAS A;  5CVR A;  4FX4 A;  2K7L A;  2HTJ A;  1W7P D;  3CTA A;  1TQM A;  2PEX A;  2XAJ A;  2E1N A;  1ZHF A;  1J5Y A;  3HIF A;  4N9I A;  1RUO A;  1U5T B;  1LEA A;  3DPT A;  1BC8 C;  1IN4 A;  3GXO A;  2ZME A;  5D6F A;  4UHT A;  3T8T A;  2LF8 A;  2H09 A;  1HKS A;  3F8B A;  4Q5S F;  4OIO F;  1T6S A;  5ICG A;  4TV7 A;  2XUB A;  3WTV C;  4PDK A;  4ZH4 F;  1RIO H;  1I6X A;  1QBJ A;  4M71 A;  3T5X A;  3AAF A;  4S05 A;  2P6S A;  3L09 A;  4HQM A;  5F1R A;  2V1X A;  1IZ1 A;  2ZFW A;  4BYY A;  1UST A;  4N0B A;  1FSE A;  1PDN C;  3WTZ A;  4XSZ F;  1Y0U A;  3ELK A;  2DT5 A;  2EFQ A;  3TKY A;  3VEP A;  4UV9 A;  1BN5 A;  1YLF A;  2G7H A;  3WTX C;  4A0Z A;  2PLY A;  1J7K A;  4CZZ A;  2PI0 A;  2BEO A;  2IP2 A;  3QOP A;  1S8N A;  4KMF A;  3D5L A;  1S29 A;  2Y75 A;  4HOB A;  4B09 A;  2DBB A;  2HYF A;  2L4A A;  1W4M A;  4ZZL A;  2PMU A;  4I0B A;  2O8X A;  4OMY A;  1OPC A;  4CGZ A;  2FOK A;  1XDU A;  3I64 A;  3TQN A;  1HQC A;  1FBU A;  3FXQ A;  3D0S A;  3R4K A;  4UVB A;  1IXR C;  3RKX A;  4F7Z A;  3KLN A;  2DI3 A;  4RS8 A;  1OYI A;  3RYP A;  4ON0 A;  3HHG A;  1HXD A;  1KA8 A;  3JTH A;  3HTU A;  1TW3 A;  2XV4 S;  2ADU A;  2LF7 A;  1WSU A;  3PQK A;  2XAG A;  4EVI A;  2NAZ A;  1SMY F;  1MDM B;  4AVP A;  5JFR A;  2XHK A;  1BI0 A;  4MNU A;  4BNC A;  1REP C;  3JW4 A;  5FFX A;  1FYM A;  4S04 A;  1K6O A;  2Y0M A;  1DPU A;  2E7W A;  2OQR A;  2CWE A;  2KIF A;  2YSR A;  2XVC A;  5LLQ A;  2V6C A;  2AXL A;  2HTS A;  3PQJ A;  1XGO A;  3DV8 A;  1ZG5 A;  2W57 A;  5FO5 A;  5E1Z B;  3HSF A;  4KIB A;  3GEZ A;  2DK8 A;  2Z3Y A;  4KYW A;  5FD5 A;  4HX4 A;  1ZN2 A;  4UUV A;  1U6G A;  1O3R A;  1XSD A;  4O3M A;  1T0F A;  2D1H A;  3U2R A;  3MQ0 A;  3O2P E;  1MDM A;  2UWM A;  2HGC A;  3E6M A;  3WTW C;  3HSE A;  3P7N A;  5DD4 A;  3M9A A;  3O3K A;  4I01 A;  5K5Q A;  3F8F A;  4RGS A;  4LMY A;  3KCC A;  2QBY A;  3ZMD A;  4UVC A;  3EDP A;  5L3B A;  2ZXJ A;  2FEZ A;  2OZ6 A;  5LHH A;  4MQ9 F;  4ESF A;  1JHF A;  4KFC A;  4IRH A;  2CG4 A;  5LEK A;  3ZMV A;  4A0Y A;  5F6F A;  5FLX K;  4QLC U;  3GFL A;  4U7B A;  1P4A A;  1XD7 A;  1PP7 U;  3LQR A;  3E3V A;  3R6S A;  3ZMU A;  1J59 A;  3P9I A;  2P5K A;  3K0L A;  5FLX Z;  5H6Q A;  3HYI A;  3LWF A;  1SFU A;  1DUX C;  5LGN A;  1RUN A;  3KE2 A;  1ZGJ A;  1R22 A;  4HQE A;  1MZB A;  3RKW A;  3TDU C;  1XGM A;  1TNT A;  2BBY A;  2FRH A;  1J75 A;  1XCV A;  1FYL A;  3ZMZ A;  4ASN A;  1LDD A;  2VN2 A;  5KVR A;  1ZRD A;  4WXD A;  2RNJ A;  2XKO A;  3I54 A;  3ML6 A;  1R1U A;  1ON2 A;  3WU1 B;  2V9V A;  4WK8 F;  5FGM A;  2ZNY A;  5E1W A;  4G6Q A;  3T1B A;  4M74 A;  3B02 A;  3KZZ A;  2K4B A;  1PP8 F;  2M5W A;  2VBY A;  1ZRE A;  2ELH A;  4BHB A;  4HDV A;  3V4G A;  2A68 F;  3HRT A;  3BY6 A;  5D6E A;  3RTR A;  3CLO A;  4N9H A;  4NHJ A;  1U78 A;  1O3T A;  3K1M A;  2VBX A;  1Z6R A;  3DKW A;  1T38 A;  1L0O C;  1XSV A;  5DYM A;  4HV5 A;  5L3F A;  3ABT A;  4KT5 C;  2F5D A;  4OIP F;  4L9J A;  1EV7 A;  4H0E A;  3SHF A;  2QM3 A;  5BS6 A;  4HBL A;  4L9V A;  2HEO A;  2EV0 A;  4KMU X;  1LNW A;  1FWZ A;  3TDZ C;  2HR3 A;  3IWF A;  1KQ0 A;  4ZYH A;  6PAX A;  3C18 A;  5E1X A;  4BAY A;  2Z33 A;  1IN6 A;  2FML A;  3RJP A;  2K02 A;  1G3W A;  3LQQ A;  1XMK A;  2EFO A;  2J5O A;  4M72 A;  2BGC A;  5ED4 A;  2GZW A;  3CDH A;  4D0P A;  2ISY A;  3E5X A;  4EM0 B;  4HF0 A;  4KIF A;  3CO7 C;  3KEQ A;  4Y13 A;  3GO5 A;  4DNC A;  4OU0 A;  5HS9 A;  3EYI A;  1FP2 A;  3WGG A;  3KP2 A;  1Z7U A;  3NEU A;  3ZMS A;  1T98 A;  1HKT A;  1VTN C;  2DU9 A;  4IVN A;  4MGR A;  3H3U A;  5CJ9 A;  2KJB A;  4XLN F;  3ZP5 A;  1B59 A;  4LFU A;  3TO9 A;  4A12 A;  3U9G A;  1IUY A;  2RVC A;  1IN7 A;  2XGX A;  5HVQ C;  1L3L A;  4JQF A;  5ILV A;  5J6X A;  5JI6 A;  3RPQ A;  1R23 A;  4BHC A;  4OMZ A;  5E8G A;  3T0Y A;  4AWX B;  4L9T A;  1R1V A;  2OZU A;  3W6K B;  3DQV C;  4LK0 F;  1ZAO A;  4UVA A;  4EMS A;  4KN7 X;  1J2X A;  4RGU A;  2ZME B;  2QWW A;  4GXO A;  4JBA A;  3WTY C;  4O5V A;  1G3S A;  4HV6 A;  3COA C;  4EJO A;  3QU6 A;  2WWY A;  3QRF F;  3WOD F;  1HW1 A;  2G7U A;  1XDS A;  1KGS A;  3GX4 X;  1IW7 F;  1XMA A;  4M73 A;  2PJP A;  3EYY A;  4BQA A;  2TDX A;  1IRF A;  4Q48 A;  1S7A A;  3IL2 A;  3K1N A;  2MH9 A;  1IAW A;  1RNL A;  1WQ2 A;  1ZG1 A;  2L4M A;  1LB2 A;  3QP5 A;  2FNA A;  3F72 A;  1TQP A;  2P5L C;  3WTU C;  3HRM A;  1QO0 D;  5IT9 K;  4LGW A;  3EUH A;  1E2X A;  2HKO A;  1B9N A;  2OAZ A;  2ZKZ A;  2H27 A;  2VC0 A;  2DTR A;  2V1D A;  4RB2 C;  4EGZ A;  3JSO A;  2IT0 A;  3FF5 A;  1G3T A;  4RGR A;  4EGY A;  5IT9 Z;  2VOO A;  3GF2 A;  3HHH A;  1LQ1 A;  2R3S A;  3T8R A;  5CVJ A;  1YW8 A;  2ACJ A;  1SD4 A;  4P55 A;  2O61 A;  3VOE A;  4HF1 A;  5TRD A;  2P7C B;  4BHP A;  1ULY A;  3GW2 A;  2F2E A;  2QQ9 A;  3SQN A;  2WV0 A;  2KIM A;  1O7F A;  2JZY A;  3SXY A;  4HYE A;  5LHG A;  2M8E A;  2M1B A;  2Y48 A;  3HOS A;  4EM1 A;  3MEX A;  1IXC A;  3R0J A;  2DPU A;  1FNN A;  2HKX A;  4E70 A;  3FMS A;  1YFH A;  5HDK A;  4R79 A;  1R5G A;  4A5N A;  4RB3 C;  2OA4 A;  3CUO A;  1E17 A;  3WE2 A;  3M7G A;  2W25 A;  1SAX A;  1S6L A;  3Q9S A;  5HLI A;  2MLG A;  4IJA A;  4BXU A;  1EH8 A;  1R36 A;  3TO7 A;  1H9T A;  1OMI A;  3K1P A;  3GFI A;  4LG0 B;  4Z2Y A;  3PFI A;  1ODD A;  4L5I A;  3L2C A;  2PN6 A;  4MTE A;  4LD5 A;  4ENN A;  3JSP A;  3U1D A;  1OYY A;  1YS7 A;  3TGN A;  5ILU A;  5HLG A;  2A61 A;  1IXS B;  1ZH5 A;  2STT A;  2QUF A;  4JK1 X;  1KU2 A;  5E17 F;  1GXQ A;  1D3Y A;  2JT1 A;  2Z9O A;  2L54 A;  3I4P A;  3KZY A;  1BI2 A;  3GUD A;  1OKR A;  3K69 A;  4EM2 A;  1UCR A;  3ULQ B;  4Q4Z F;  4ZYG A;  2CSO A;  2A07 F;  4EV0 A;  2VE8 A;  2HQN A;  1T2K A;  3L9F A;  4KNY A;  1GVJ A;  1FOK A;  3ERE D;  1I27 A;  2KRF A;  2QBY B;  2NYX A;  1FBQ A;  2EV6 A;  3SZP A;  4AIK A;  4HDU A;  4HLY A;  4LG0 A;  2EV5 A;  1U5T C;  2ISZ A;  3P9C A;  2W85 A;  3V8K A;  2ZNZ A;  4FT8 A;  1G6N A;  4G7O F;  4R8H A;  1D5V A;  2R7D A;  4LJZ F;  2RGV A;  4L0Z B;  2F5F A;  5LGU A;  1AWC A;  4PGH A;  1J0R A;  5EEH A;  4Y17 A;  3KP4 A;  4M9X A;  3LAJ A;  3ZN0 A;  3E6C C;  1UFM A;  4LB6 B;  3G73 A;  2D2W A;  4L0Y B;  1B4A A;  5HS8 A;  4I09 A;  1YW9 A;  2EB7 A;  3H3Z A;  3KP3 A;  3R60 A;  4QWQ A;  1QNT A;  3HUG A;  3M8F A;  1XN7 A;  3RI4 A;  5HLH A;  3HOT A;  3FM3 A;  3IKT A;  1Z91 A;  4O6J A;  4HX8 A;  2DFI A;  1BIA A;  2GWR A;  1XGS A;  1R58 A;  2LDU A;  1DP7 P;  1G3Y A;  3E5Q A;  1EH7 A;  2RN7 A;  2A69 F;  4PGG A;  3MZY A;  3V8J A;  2QQA A;  4KIG A;  3LA7 A;  3ZPL A;  3H92 A;  2Q2E A;  2DQR A;  2PMH A;  1W7P B;  1U3E M;  3SFZ A;  1F5T A;  1P92 A;  2XIG A;  3GLX A;  2DLL A;  3KET A;  3KP6 A;  4B8X A;  2EFW A;  5L3D A;  2UZK A;  5CVU A;  2A6H F;  3HSR A;  4I7H A;  4K2E A;  4A0X A;  2YX4 A;  3RKY A;  4HF2 A;  3F8N A;  4ESJ A;  4L18 B;  2A5Y B;  3FXU A;  3FZV A;  2A3S A;  2F5C A;  1WI9 A;  4KIC A;  3I5U A;  1USS A;  1UHM A;  2E7X A;  5HOO A;  2MH2 A;  3F22 A;  4GYG A;  5CVV A;  3J81 K;  2QLZ A;  1MJ9 A;  3FMQ A;  4CHU A;  4M9S A;  3VB2 A;  4NQW A;  4MEY F;  2CFX A;  5E18 F;  1C0W A;  2DW4 A;  2LSO A;  3SZT A;  2ZJ2 A;  1J9I A;  1U2W A;  2A6E F;  1W7P A;  5D5W B;  5A2Q K;  5HS7 A;  2O6G E;  2IVM A;  3J81 Z;  3JAM K;  2H6C A;  2CYY A;  5F64 A;  2O03 A;  2QVO A;  4MQV A;  5L3E A;  1YG2 A;  1KU3 A;  1HW2 A;  2CGP A;  3F3X A;  1FX7 A;  2HS5 A;  5A2Q Z;  3QPH A;  5CVI A;  1HKQ A;  1IN8 A;  3VOD A;  2ESN A;  3JAM Z;  3Q9V A;  2P4W A;  2GA2 A;  4IHT A;  2K4J A;  3WU0 A;  1ON1 A;  1LDJ A;  3F21 A;  2M45 A;  2MD5 A;  1CGP A;  3N4M A;  1XCB A;  2ZCW A;  2Z5U A;  2HFH A;  3F6V A;  5K5O A;  4U0V A;  5D8L B;  2FSW A;  3O6B B;  1FBS A;  3TOA A;  4AIJ A;  3M1E A;  2CO5 A;  2L01 A;  4WXC A;  1Z9C A;  2P6T A;  1V3F A;  2UXX A;  2EFN A;  2H94 A;  4UXN A;  1T39 A;  1YIO A;  3QP6 A;  1SD5 A;  3BJA A;  1TBX A;  3BJO A;  3IHU A;  4LB5 A;  1RZ4 A;  1ZAR A;  2RKH A;  4I98 B;  5J8C A;  4XRF A;  2XAQ A;  2V79 A;  3KP5 A;  4L5J A;  3F23 A;  3ZMT A;  1R1T A;  2EK5 A;  1SD6 A;  1MJA A;  3R0A A;  2CQK A;  1KU7 A;  3B73 A;  1RI7 A;  2GAU A;  5ILS A;  5BPI A;  2W24 A;  1FSH A;  2NNY A;  5DCF A;  3BPV A;  3K9T A;  1B6A A;  3DFG A;  2OD5 A;  5CYV A;  4M9Z A;  1MGT A;  2VXZ A;  2X0L A;  5BOX A;  3E6B A;  1ZRC A;  5IT3 A;  1F1Z A;  3RIR A;  2JRT A;  1QQI A;  2DAO A;  3L7W A;  2FXA A;  2KKO A;  3BZ6 A;  4A6D A;  4KA4 A;  3TO6 A;  2VBZ A;  2HDC A;  5BMZ A;  2KIU A;  5D8K B;  3FM5 A;  1W5T A;  3F8M A;  3E6D A;  4BH9 A;  4WCG A;  3V7S A;  1HST A;  5ICF A;  5D5V B;  2BE5 F;  2Z99 A;  4RB0 A;  2BYV E;  5LGT A;  5D5U B;  3MAJ A;  2VBW A;  3KLO A;  1IRG A;  1GXP A;  2J5P A;  4EJW A;  1DPR A;  2K86 A;  1FZP B;  3OOP A;  1H0M A;  2FF4 A;  1OR7 A;  3DXJ F;  1Z6T A;  3E97 A;  4G7H F;  3WTS C;  5H20 A;  4FHT A;  5AIQ A;  2HOE A;  2QEN A;  4AD9 A;  1QGP A;  3C1D A;  3BWG A;  2GIV A;  1BI3 A;  2GXB A;  2FBK A;  2LKP A;  1U8R A;  2IW5 A;  2K27 A;  4YFX F;  4YFK F;  3I58 A;  3F8C A;  1K7A A;  3LA2 A;  4FX0 A;  3ZN1 A;  5K1Y A;  4P96 A;  3G3Z A;  2AS5 F;  3OV8 A;  3S2W A;  5LEJ A;  4R1H A;  3M8E A;  2YU3 A;  4G7Z F;  4WX9 A;  5BPD A;  1YYV A;  3ECH A;  1IN5 A;  1KYZ A;  5DCM B;  2D1V A;  1P4X A;  4CO8 A;  4CYD A;  1WWX A;  2IA0 A;  2EJR A;  1UB9 A;  3C3W A;  3ABU A;  1YS6 A;  4OIR F;  4U0Y A;  5FFZ A;  1BC7 C;  4HA8 A;  3WGH A;  2V1U A;  3NQO A;  3CUQ C;  5AON A;  3FMR A;  3MWM A;  1TLH B;  2CW0 F;  3V7C A;  2KJC A;  1S3J A;  2JPB A;  2L02 A;  3LFK A;  2F5E A;  2P7V B;  1D8J A;  5LHI A;  1U5T A;  5DD8 A;  2VOD A;  4MTD A;  2DPD A;  4A5M A;  1WKM A;  1XGN A;  2JTV A;  2H6B A;  3KP7 A;  4G94 A;  5DCM A;  4P5O A;  1IF1 A;  1FPQ A;  1ZG3 A;  3RYR A;  3IRR A;  4HX7 A;  2G9W A; 
#chains in the Genus database with same CATH topology
 3WTT C;  1JXS A;  4DOZ A;  3OMY A;  2X1C A;  1YTY A;  4BXF A;  4XQF A;  2NNN A;  1OYW A;  1TWC J;  4XBF A;  4D1Q A;  2WAD A;  4GCV A;  1X3W B;  4P9U A;  2P8T A;  5F0C A;  4OIQ F;  1OCR H;  1B9M A;  1YX3 A;  1TWH J;  4EJU A;  1FOY A;  1K79 A;  2YR2 A;  4I02 A;  4KN4 X;  3ZR8 X;  3H1C A;  3BCB A;  4BU2 A;  1IG7 A;  1O57 A;  2NVU B;  4A3B J;  5DUK A;  1KQ9 A;  1OCT C;  1MBH A;  4Q47 A;  4IHS A;  3GZN B;  1XPX A;  3FXR A;  2W48 A;  2RRE A;  4ENM A;  3I3L A;  2W84 A;  1SVM A;  2DQL A;  3LST A;  4BE1 A;  2ZME C;  3AG3 H;  3ROU A;  4U7D A;  4RAZ A;  4EJV A;  1FOW A;  1K78 B;  2F4O B;  3O8H A;  1JE8 A;  3J7A O;  1SFX A;  5LRR A;  5DEQ A;  3BOQ A;  1KON A;  2CH0 A;  2NRA C;  3CF2 A;  1GHC A;  1QPM A;  3BR3 A;  2DK5 A;  1TC3 C;  1R49 A;  5JLW A;  4A3D J;  1MMN A;  1ONV A;  4J01 A;  1O3S A;  1HOM A;  3WGI A;  4A6E A;  2LNB A;  5E8I A;  4IRI A;  3E0J B;  1ZLK A;  3Q5F A;  3QU3 A;  2R7F A;  2R7R A;  2WB1 N;  3HL2 A;  3N97 A;  3TBI A;  4A3I J;  1ZRF A;  1YX5 A;  2UUZ A;  2L3D A;  3IAM 2;  3LAP A;  3HEF A;  4S0H B;  1WRJ A;  2PQ8 A;  1X3U A;  2LTP A;  1ZGA A;  2JPC A;  3GVA A;  4HLX A;  2ETH A;  3F6O A;  3IAS 2;  3QAH A;  2P0W A;  4A2U A;  3I59 B;  3REO A;  2GQQ A;  3BG9 A;  2ME0 A;  3FWE A;  3CCE I;  2R92 J;  2LVS A;  1HSJ A;  1CQT A;  1MBK A;  2IRF G;  1LVA A;  4PJ0 C;  1YO5 C;  1R00 A;  3RDI A;  3JRH A;  1I1G A;  5GAG J;  1PUF B;  1YI2 I;  4M6V A;  3RCO A;  2WTE A;  2WY8 Q;  2GLO A;  5JLX A;  2R7X A;  5FLV A;  3MCZ A;  3QYF A;  1K78 A;  5F0H A;  4XSX F;  1TW2 A;  2HYG D;  3X2Q H;  1VND A;  2Q2E B;  2ID3 A;  1W1W E;  4E6K G;  2X1E A;  2VPR A;  3GZ5 A;  4M3G A;  2FBH A;  5DV5 A;  2BW3 B;  2LRE A;  4CA0 A;  1UHW A;  2K9M A;  3BTI A;  3WG9 A;  3D5S C;  2PJR B;  3I71 A;  4HNT A;  1P4W A;  2BV6 A;  1QZY A;  2CQN A;  2HQA A;  2PX9 A;  4HEA 2;  3PIO F;  1XB4 A;  4Y3O A;  1R5H A;  4DZJ A;  3KYL A;  4PFO A;  1X4P A;  5EDN A;  1Y8R B;  1WJC A;  2RDP A;  1W5S A;  1XC5 A;  2L5Q A;  2RNG A;  3IWZ A;  3SYT A;  3KEO A;  4U0W A;  2XRO A;  2R7W A;  2K3F A;  1QU3 A;  2JA7 J;  4MHG A;  2EA4 A;  4BY1 J;  3CD6 I;  2VQG A;  2VJ5 A;  4RB1 A;  1E3P A;  4CXF A;  4GO1 A;  3OYI A;  4LLL A;  3H5R A;  1I1S A;  3M3Y J;  4G6D A;  3BG7 A;  1YRN B;  2M4G A;  1F4K A;  1BR4 A;  5JR3 A;  4X6A J;  4UV8 A;  3BPX A;  1BOA A;  2PG4 A;  2HQR A;  2E5Z A;  3K6G A;  2OQG A;  3I59 A;  3LSR A;  3BR2 A;  1S7O A;  2BOL A;  4YIF A;  1K6Y A;  1BIB A;  1XSX A;  2MA3 A;  3EET A;  3IRQ A;  4BE2 A;  2OF7 A;  4P9F A;  3M07 A;  1O4X A;  2TCT A;  1PUF A;  1D8K A;  2E2J J;  3HOW J;  2JK3 A;  1K4S A;  1FC3 A;  1F9N A;  2X51 A;  4M6Y A;  1DDN A;  3LL7 A;  2ZBK A;  3FXO A;  2K3P A;  3FX3 A;  4U88 A;  1G4D A;  4ENJ A;  2JUG A;  3PUF A;  3JRB A;  5JVT A;  4JX5 A;  1YJN I;  2FMY A;  4IXA A;  4YII A;  4L9N A;  2EQR A;  2VAS A;  4I0A A;  2IJL A;  4LK1 F;  2QKM B;  1ZR2 A;  4E7I A;  3AG2 H;  2FE3 A;  5H6R A;  2BW3 A;  2VC1 A;  2STW A;  3DF8 A;  3JTG A;  4NC8 A;  2PJR A;  2DMQ A;  2NS0 A;  2WAQ N;  3H5A A;  3Q0W A;  4B47 A;  4ETS A;  4HAM A;  4ENK A;  1PUE E;  3BJ6 A;  3DP7 A;  3MMY B;  3BT9 A;  3HPH A;  2DOF A;  3GFM A;  4PCQ A;  4DQ2 A;  1WCM J;  1WJB A;  2EIM H;  4XMY A;  5EEG A;  5LBQ A;  1R6R A;  2VOP A;  1D0Y A;  2M0C A;  3BG6 A;  3CCY A;  1X58 A;  3TP0 A;  3G1M A;  2MC3 A;  3QYE A;  3KZI C;  5HDN A;  2Y69 H;  2ZXI A;  5FLM J;  4BUP A;  3GYH X;  1Z1D A;  2NVY J;  2RC4 A;  1OIS A;  2W00 A;  1KU9 A;  4CYC B;  2E1C A;  2XKP A;  4GYI A;  1W0T A;  4OWR B;  5GTI C;  2UXN A;  2NS7 A;  2FU4 A;  3LA3 A;  1MJB A;  3OL4 A;  5J8F A;  1X1C A;  2KHM A;  1Z21 A;  3ZQ7 A;  4XLP F;  1JGS A;  5ICC A;  1V5F A;  5DDG A;  3P9K A;  4QPQ A;  5LRS A;  3CJT B;  3VFZ A;  2DA4 A;  1I5Z A;  3Q0U A;  5IOZ A;  4FE4 A;  5BQT A;  3DLL F;  1LVK A;  4IRG A;  5CPR B;  3VYU B;  1FLI A;  2PBI A;  1NHA A;  2EPF A;  2KDZ A;  4NB5 A;  4AM3 A;  1UG0 A;  2HI3 A;  4MFD A;  2HWV A;  3JRI A;  1X3Z B;  1MKM A;  5FD6 A;  2ECB A;  2DO7 A;  4XLF A;  1T0F C;  1TQI A;  1SFE A;  3E5U A;  2KIQ A;  5ERI A;  4PFP A;  3MKZ A;  1TTY A;  2RQP A;  1V4R A;  3I0T A;  4YRV A;  3TED A;  1Q1H A;  3ASO H;  3DU5 A;  1DQU A;  4WWC A;  1FP1 D;  2VQC A;  4Y15 A;  4IHY A;  4A69 C;  2LG4 A;  2X4H A;  2Q0O A;  1B1B A;  2DOA A;  2CW7 A;  4JOM A;  2HZT A;  3HGG A;  3CMY A;  4IX7 A;  5D5X B;  4CYC A;  3JR9 A;  1T08 B;  2C6Y A;  1Y0N A;  4MO7 A;  2PFB A;  1I39 A;  1V54 H;  4XLH A;  1HBX G;  2XGE A;  2FA5 A;  2EFP A;  1O7L A;  3V8L A;  1AKH B;  2I10 A;  3VPR A;  1BR2 A;  2VE9 A;  2XPV A;  2OC6 A;  3WHB A;  3K4L A;  3D5R C;  1YW7 A;  4G8X A;  4WXH A;  2ZO4 A;  2O3F A;  1NG6 A;  4JX4 A;  2XDV A;  3V7R A;  2L0K A;  5KCM A;  2EBI A;  1BBY A;  3J80 K;  5J4V A;  1OCO H;  1LDK B;  3BG5 A;  3QWL A;  4BJ6 C;  5DUI A;  5K5R A;  5HNF A;  4RM3 A;  1ZLJ A;  2MBF A;  2G0E A;  3OYN A;  2CUJ A;  3CCQ I;  2QGU A;  2OBP A;  3ZRG A;  4LLN A;  5FRN A;  1EH6 A;  1ZYR F;  1O3Q A;  5CKT A;  4PZJ A;  2R7Q A;  3AG4 H;  1Y6I A;  1BJA A;  4ZYE A;  1Z05 A;  4HSR A;  3HOY J;  2QZ8 A;  2XAF A;  2MSY A;  1S5L C;  1A6I A;  3GFJ A;  2CQ7 A;  1MIJ A;  2IAI A;  1KYW A;  2GXG A;  2KQR A;  3CJN A;  3J80 Z;  4WF2 A;  4BL0 B;  2QQB A;  2DMN A;  2M8G X;  4IPA A;  2MGQ A;  5E20 A;  5KK1 A;  4ESB A;  4F92 B;  5CQE A;  3DBR B;  1FYK A;  3SFI A;  3EQL F;  5FB2 A;  4CSW A;  2LKX A;  3MFK A;  3CME I;  1FY7 A;  4RGX A;  2F5V A;  1A04 A;  1JTY A;  4MLO A;  5L3G A;  1LJ9 A;  1R7J A;  3TP3 A;  3WE3 A;  1V5G A;  2GA1 A;  2Y9Y A;  4YFN F;  5TIS C;  3OYJ A;  3BP8 A;  4IF4 A;  1ZR4 A;  2MLK A;  4GGG A;  3RPU A;  5L3C A;  5IYD J;  3HOX J;  2O0Y A;  1BM9 A;  5ICE A;  1JT0 A;  1ETW A;  1AKH A;  1BL0 A;  1P6R A;  4YG2 F;  3R61 A;  2IS1 A;  3BRO A;  2VON A;  3BDD A;  1YJW I;  2IA2 A;  4I99 C;  4II3 A;  3S93 A;  1STZ A;  3CUQ B;  4EAT A;  4OIN F;  5J1Y A;  2Y0S A;  1T95 A;  2X6Y A;  4G9Y A;  1H9G A;  4IQ4 A;  3QPT A;  3F0C A;  2YPR A;  4LOC A;  2Y9Z A;  3BG3 A;  5HDG A;  2JUC A;  1TWF J;  2JSC A;  2OUM A;  4BE0 A;  4XOT A;  2XGD A;  3ISP A;  4ZDL A;  3HTS B;  1MD0 A;  4EJT A;  5D4S A;  2IPQ X;  1QZZ A;  1W5C C;  4IZZ A;  5D4R A;  2DFF A;  3ECO A;  2FBI A;  1CF7 B;  2VT2 A;  3L2W A;  5CLS A;  3CMM A;  3L00 A;  4I2O A;  4UUS B;  5HOD A;  1JUM A;  2I8D A;  3DEU A;  5FRM A;  1GUU A;  4HPQ A;  4M6X A;  2XRN A;  5CQG A;  1U9N A;  3DU6 A;  3IH4 A;  2HVR A;  1TNS A;  1YQA A;  2R7S A;  1SD7 A;  1KQ8 A;  2OU2 A;  1HW5 A;  2D45 A;  4ZDP A;  1W36 D;  1MH4 A;  2M30 A;  4CDG A;  2HOT A;  4KDP A;  2VT3 A;  3GWZ A;  2B0L A;  1XX5 A;  1AOY A;  1SMT A;  4HZF A;  2D5V A;  2L7M P;  2FQ3 A;  3MZH A;  3I53 A;  3K2Z A;  2VKE A;  5F04 A;  3FHZ A;  3CUQ A;  1BI1 A;  2FNP A;  3HRU A;  2LY2 A;  3KYD B;  3ZQG A;  2Z2S B;  2EWN A;  5FRO A;  2M87 A;  2B9S A;  4XRS A;  3KFW X;  2OTL I;  2NS8 A;  2HXI A;  3DPL C;  3IC7 A;  2YS9 A;  3LSP A;  2QYO A;  2X6O A;  3C7J A;  4EQQ A;  2COM A;  3HRS A;  4MEX F;  1UAA A;  4Y52 J;  3NRV A;  2ECC A;  4AYB A;  4XIC A;  2WC2 A;  1W0U A;  1ZQ3 P;  2XF5 A;  2IXS A;  2IA1 A;  2NOG A;  2KDO A;  1CF7 A;  3EPZ A;  3TOB A;  4CZC A;  4LLG F;  4PJM A;  4UUT A;  1FT9 A;  4HW0 A;  3CCR I;  3IKV A;  2ESH A;  1PYV A;  5HLT A;  3OS1 A;  4UUS A;  2YX7 A;  4AIH A;  3H9G A;  4UNO A;  3LSM A;  1VQ7 I;  4KT6 A;  2XAH A;  5E3O A;  3CO6 C;  4RAY A;  5C44 J;  2RV8 A;  3L2U A;  4EEF G;  4KUM A;  4CIC A;  1P2F A;  4D7M A;  3H0G J;  2EA2 A;  3DTI A;  3GZ6 A;  1RC9 A;  5JHU A;  3PL8 A;  4OOI A;  5AIP A;  3W6J B;  4ZZD A;  3I4N J;  3HDD A;  4P1W A;  1JHH A;  4BDY A;  1LEB A;  3K2A A;  3CC2 I;  5TJJ A;  2P5V A;  4ZYD A;  2XAS A;  5CVR A;  4FX4 A;  1SVL A;  2HTJ A;  2K7L A;  2LY1 A;  4C9Y A;  1VI0 A;  2NVX J;  1W7P D;  3CTA A;  3LSI A;  1JKR C;  1TQM A;  1Y39 A;  1TP4 A;  2PEX A;  5K7Z A;  3WG7 H;  2XAJ A;  2E1N A;  1ZHF A;  3B6A A;  1J5Y A;  3HIF A;  1WFX A;  4NC7 A;  2B63 J;  1D1C A;  3UR3 C;  4N9I A;  1RUO A;  1U5T B;  1LEA A;  3SDB A;  1ZEL A;  3DPT A;  4M3D A;  4AYB N;  1BC8 C;  1IN4 A;  1X19 A;  1A5J A;  3GXO A;  2ZME A;  4B1R A;  3RKQ A;  1AA7 A;  5B3S H;  5D6F A;  2M34 A;  1MBJ A;  3PSF A;  4UHT A;  3T8T A;  2LF8 A;  2H09 A;  3RSN A;  1JGG A;  1HKS A;  2DA2 A;  3F8B A;  4Q5S F;  2EZL A;  2JMW A;  4OIO F;  1T6S A;  3A02 A;  5ICG A;  4TV7 A;  5E3L A;  1SEU A;  3DBL B;  4DIQ A;  2IGM A;  2XUB A;  3WTV C;  4N4N B;  4PDK A;  4ZH4 F;  1RIO H;  1I6X A;  5KAF C;  2OV7 A;  1QBJ A;  4M71 A;  3T5X A;  3AAF A;  4S05 A;  2P6S A;  3L09 A;  4HQM A;  3S3O A;  2KRC A;  3K10 A;  5F1R A;  2V1X A;  1IZ1 A;  2ZFW A;  4BYY A;  2F6C A;  3DKY A;  1UST A;  4N0B A;  4W97 A;  1FSE A;  4XK4 A;  1PDN C;  3S14 J;  3WTZ A;  4XSZ F;  3L2V A;  1RR7 A;  1WJ5 A;  1Y0U A;  1QPI A;  3ELK A;  3FKI J;  2DT5 A;  4F3Q A;  2EFQ A;  1ZKG A;  3TKY A;  1ENH A;  4PJJ A;  1QA6 A;  3VEP A;  3VSL A;  4UV9 A;  2QSH X;  4DYC A;  1P7J A;  1BN5 A;  4XID A;  1YLF A;  2XPW A;  1A6Q A;  2TRT A;  2G7H A;  3WTX C;  4A0Z A;  2PLY A;  1J7K A;  3OS2 A;  4CZZ A;  1EJ9 A;  2PI0 A;  2BEO A;  2IP2 A;  3QOP A;  1S8N A;  4A3L J;  2M7B A;  4KMF A;  3D5L A;  1SVO A;  1S29 A;  2Y75 A;  4HOB A;  4B09 A;  2DBB A;  2HYF A;  2L4A A;  4NDL A;  4F55 A;  2A6T A;  5GAD J;  3A0B C;  2JJ7 A;  1W4M A;  3FXM A;  4XLE A;  5DTD A;  4ZZL A;  3L2Q A;  2VJI A;  1I50 J;  3W2W A;  2PMU A;  4MIM A;  4I0B A;  2ZSH B;  2O8X A;  2LBF B;  4FE7 A;  1D1A A;  2WB1 A;  3DPU A;  3HG9 A;  2VLA A;  4BDZ A;  2JQ7 A;  4OMY A;  1M1E B;  1OPC A;  2MC4 A;  3HOV J;  4CGZ A;  2DJN A;  1EKE A;  3QQA A;  1FMW A;  3M4O J;  2FOK A;  3FBI B;  1XDU A;  3I64 A;  1ERD A;  3S2H J;  3TQN A;  2E36 A;  5FKM A;  1VQ5 I;  3W6V A;  1HQC A;  1IO2 A;  2L7K A;  1FBU A;  1X1B A;  4DW6 A;  3FXQ A;  4A3G J;  3D0S A;  3R4K A;  4GDF A;  2NVT J;  3ZCO A;  1JT6 A;  2V6E A;  1Y56 A;  3SZG A;  4UVB A;  5EGO B;  3EUH C;  2GOX B;  3N05 A;  1PVE A;  2XSD C;  5K7H A;  1IXR C;  2E34 A;  3RKX A;  3KLN A;  2DI3 A;  4F7Z A;  4OAZ A;  4RS8 A;  2BHY A;  3OYG A;  1OYI A;  2LH9 A;  1ZK8 A;  2R5Z B;  5JVG F;  2KL4 A;  3RYP A;  4ON0 A;  3BZC A;  4A3M J;  1A36 A;  2EIL H;  1D0Z A;  1I3A A;  3HHG A;  1VQL I;  1HXD A;  1KA8 A;  1WH5 A;  2EIN H;  2BY3 A;  3JTH A;  1IV6 A;  2R7Z J;  1X1A A;  3HTU A;  1TW3 A;  1JTX A;  2XV4 S;  1IDY A;  3GLL A;  1V5E A;  1YE9 A;  2ADU A;  4BQO A;  2LF7 A;  2FD5 A;  1WSU A;  3PQK A;  2XAG A;  1ITY A;  4EVI A;  2NAZ A;  1SMY F;  1MDM B;  2LBF A;  4AVP A;  5JFR A;  2XHK A;  1BI0 A;  4MNU A;  2BVM A;  4BNC A;  1REP C;  1QHG A;  3JW4 A;  5FFX A;  3JRA A;  1MNM C;  5DM7 F;  1FYM A;  2K40 A;  4S04 A;  5BNG A;  5F27 A;  1K6O A;  1FIA A;  3CCS I;  3H36 A;  1GT0 C;  3RQ4 A;  2Y0M A;  1DPU A;  2E7W A;  1LFB A;  2OQR A;  2KMU A;  3IH2 A;  4RA2 A;  5GAH J;  2CWE A;  2KIF A;  2CQX A;  2YSR A;  2XVC A;  2OTJ I;  5KHD A;  5LLQ A;  2DA5 A;  2XSJ C;  2V6C A;  4IOC F;  2AXL A;  5J4Y A;  2HTS A;  1D0X A;  2DN0 A;  3PQJ A;  5EGO A;  1XGO A;  3DV8 A;  3GBG A;  1ZG5 A;  2M4K A;  2W57 A;  5FO5 A;  4IL6 C;  5E1Z B;  3HSF A;  4KIB A;  3GEZ A;  2DK8 A;  3BQZ A;  2O8K A;  5FJ8 J;  2R5Z A;  4KIT B;  2HPM A;  2O5R A;  2Z3Y A;  4PJL A;  4KYW A;  4BQN A;  5FD5 A;  4AUX A;  3PUB A;  4E7H A;  2ELJ A;  4HX4 A;  1K4T A;  4C3I J;  3UNG C;  1ZN2 A;  3RZD J;  4UUV A;  4LIV A;  2WAQ A;  1DU6 A;  2MAB A;  1U6G A;  2OCE A;  1O3R A;  2YUS A;  1XSD A;  4O3M A;  1OFC X;  3LNQ A;  4DJA A;  2HU9 A;  1T0F A;  2D1H A;  4C2U A;  3U2R A;  3MQ0 A;  3VSK A;  3O2P E;  1MDM A;  2UWM A;  2HGC A;  3OIO A;  2DA6 A;  3E6M A;  4KJZ A;  3WTW C;  3HSE A;  3P7N A;  5DD4 A;  4CCO A;  3M9A A;  2L7Z A;  3O3K A;  4ZDO A;  2VJJ A;  3KPH A;  4I01 A;  1WH7 A;  2CQQ A;  5LFA A;  3W2A A;  5K5Q A;  3F8F A;  1RPW A;  4RGS A;  2IBD A;  2XAU A;  1OCP A;  4LMY A;  3JRF A;  4IHW A;  3KCC A;  3FK7 A;  2QBY A;  3ZMD A;  4UVC A;  3EDP A;  5L3B A;  2ZXJ A;  1MSE C;  1UEL B;  3ZOB A;  2FEZ A;  2LYC A;  2OZ6 A;  1A35 A;  5IOY A;  2VJ4 A;  1MSF C;  5LHH A;  3CJQ B;  2LOO A;  3M8J A;  4MQ9 F;  4BY7 J;  1JHF A;  3S8P A;  4ESF A;  4KFC A;  4IRH A;  3S1R J;  2CG4 A;  5LEK A;  2IS2 A;  3ZMV A;  4A0Y A;  3CC7 I;  2E35 A;  5F6F A;  2DTZ A;  5FLX K;  2DFH A;  4QLC U;  4A3F J;  2QF7 A;  3GFL A;  4BKX A;  4U7B A;  4ANJ A;  3CLQ A;  5DS9 A;  1P4A A;  3DEE A;  1G8X A;  3G1O A;  1XD7 A;  4HG2 A;  5EZG A;  1PP7 U;  4DBR A;  3LQR A;  1DU0 A;  2P81 A;  4HRI A;  3E3V A;  1MMD A;  5E79 C;  2BY2 A;  3L1P A;  3R6S A;  3ZMU A;  1G59 A;  1F36 A;  3PNV A;  3K7A J;  1J59 A;  2JN6 A;  3P9I A;  2P5K A;  1MW7 A;  1UHS A;  2M7A A;  3VDX A;  3K0L A;  4XKV A;  5FLX Z;  5H6Q A;  3HYI A;  3LWF A;  1SFU A;  1DUX C;  1LKX A;  5LGN A;  1RUN A;  3KE2 A;  1ZGJ A;  2CU7 A;  2QSG X;  1R22 A;  4HQE A;  3GTQ J;  1MZB A;  2L7F P;  2FOW A;  4QPO A;  5FKN A;  3NWS A;  3UKG A;  2BVL A;  3RKW A;  2CS3 A;  4ZTF A;  3TDU C;  1XGM A;  2CRG A;  3CP2 A;  3K4J A;  1MMS A;  1TNT A;  1Z7L A;  2BBY A;  2FRH A;  1J75 A;  2MD0 A;  1XCV A;  1FYL A;  3ZMZ A;  1POG A;  4ASN A;  4LIU A;  4BEH A;  1LDD A;  1JJ6 C;  2VN2 A;  2ZFU A;  5KVR A;  3CCL I;  4XLC A;  1ZRD A;  2DOD A;  4WXD A;  2RNJ A;  2AO9 A;  2XKO A;  3HJE A;  3I54 A;  3HZJ A;  4J00 A;  3ML6 A;  3ZQF A;  1R1U A;  1ON2 A;  3WU1 B;  3FIW A;  2V9V A;  4WK8 F;  1S9H A;  4PJN A;  5FGM A;  1DP3 A;  2ZNY A;  5E1W A;  4G6Q A;  3SJM A;  5M5W J;  1RR8 C;  2L9R A;  2H1L A;  2JA2 A;  4PSW A;  3T1B A;  3U1K A;  3RZO J;  4ABZ A;  4M74 A;  4A3K J;  3B02 A;  2GBY A;  2KFD A;  1VF9 A;  2CFO A;  3KZZ A;  2K4B A;  4FIS A;  1OLT A;  1PP8 F;  3I56 I;  2E5N A;  4A3C J;  2M5W A;  3W3C A;  1U9O A;  2EZK A;  2VBY A;  1QVT A;  1MNE A;  1ZRE A;  4OAY A;  2ELH A;  4BHB A;  2IGO A;  4HDV A;  3MKW B;  3V4G A;  2IEK A;  4BAC A;  2A68 F;  1VQ8 I;  3HRT A;  3BY6 A;  4ZTJ A;  5D6E A;  2XB0 X;  3RTR A;  1IRZ A;  3CLO A;  4N9H A;  4NHJ A;  4I76 A;  1U78 A;  2ZJR F;  2Z1D A;  5KAI C;  1JJ8 C;  1O3T A;  5E3M A;  3K1M A;  5FKK A;  2VBX A;  2DDB A;  1Z6R A;  3DKW A;  1T38 A;  1L0O C;  2K9Q A;  3L2R A;  3TMO A;  1XSV A;  4II2 A;  4IQJ A;  3OIQ A;  5DYM A;  3MKY B;  1UMQ A;  4HV5 A;  4HNU A;  2X6W A;  5L3F A;  3ABT A;  3G2B A;  2HOS A;  1W36 C;  4KT5 C;  2F5D A;  2JA5 J;  4XR6 A;  2FJ1 A;  1X1P A;  4OIP F;  3A2K A;  2R4G A;  2HDW A;  4FET A;  4L9J A;  1IC8 A;  2QSF X;  1J09 A;  1Z77 A;  5C3E J;  4Y33 A;  1EV7 A;  4DZP A;  1OQY A;  2PMZ N;  4H0E A;  3KYC B;  3SHF A;  2QM3 A;  2L2O A;  1AU7 A;  2K9L A;  5BS6 A;  2WA0 A;  4HBL A;  1SC7 A;  3CC4 I;  4XN3 A;  2R7V A;  4L9V A;  2IS4 A;  3E1S A;  3OY9 A;  2HEO A;  2VKH A;  2EV0 A;  4KMU X;  1LNW A;  1FWZ A;  1I6H J;  3TDZ C;  3OYC A;  2HR3 A;  3IWF A;  1KQ0 A;  3FK6 A;  4ZYH A;  6PAX A;  4Y4R A;  3G71 I;  3C18 A;  5E1X A;  4BAY A;  3JRD A;  2Z33 A;  2Q1Z B;  5GAE J;  1IN6 A;  1ACI A;  5M5X J;  2FML A;  3H35 A;  4D7N A;  3AL0 C;  5J1U A;  1IJW C;  2LY9 A;  2VXD A;  3QYB A;  3RJP A;  2K02 A;  1G3W A;  3FXL A;  3LQQ A;  1XMK A;  2EFO A;  4A3E J;  2HVQ A;  2J5O A;  3FHN A;  2V1N A;  2ZSI B;  5E3N A;  4M72 A;  2BGC A;  4C30 A;  5ED4 A;  2GZW A;  3CDH A;  4D0P A;  3Q3S A;  2ISY A;  1D1B A;  3E5X A;  4EM0 B;  4HF0 A;  1JUS A;  2CV0 A;  1DGR M;  4KIF A;  1Y1W J;  2JWT A;  2LK2 A;  3CO7 C;  3KEQ A;  4YEJ A;  4UB8 C;  3OS0 A;  4IHV A;  2HOA A;  4Y13 A;  3GO5 A;  4DNC A;  4RAG A;  4OU0 A;  5HS9 A;  1SFO J;  2V4J C;  3ABL H;  3SDG A;  3EYI A;  1FP2 A;  2M2E A;  3WGG A;  3KP2 A;  3GTM J;  1Z7U A;  4XKW A;  3NEU A;  3ZMS A;  3LSK A;  3DLA A;  1MMA A;  1T98 A;  1HKT A;  4CCN A;  1TWG J;  4FCY A;  1VTN C;  2DU9 A;  4IVN A;  1SFK A;  4Z6Y A;  2ZJQ F;  4MGR A;  3LFU A;  2FX0 A;  3H3U A;  3I9V 2;  1GDT A;  5CJ9 A;  4B48 A;  2KJB A;  1N25 A;  1WGX A;  4XLN F;  3CZ6 A;  3BTJ A;  3FBN B;  3ZP5 A;  4ZJZ A;  1B59 A;  4LFU A;  4BBS J;  3CDI A;  3BQY A;  3TO9 A;  4A12 A;  5C4X J;  3U9G A;  1IUY A;  2RVC A;  1IN7 A;  2XGX A;  3FXJ A;  5HVQ C;  4JQF A;  4DYR A;  1L3L A;  5ILV A;  3S16 J;  5J6X A;  1LE8 B;  5JI6 A;  3RPQ A;  1R23 A;  4BHC A;  4OMZ A;  3GTO J;  4V2F A;  5E8G A;  3T0Y A;  4AWX B;  4L9T A;  2CUE A;  1R1V A;  2OZU A;  3W6K B;  1XS9 A;  3B6C A;  3AKZ A;  3HPG A;  3DQV C;  1WVR A;  4LK0 F;  1ZAO A;  2CMP A;  3BZK A;  1G2H A;  4UVA A;  2OJE D;  1WHU A;  4M3F A;  4EMS A;  4KN7 X;  1J2X A;  4RGU A;  2ZME B;  2QWW A;  2MW8 A;  4GXO A;  1ZTR A;  3SEQ A;  3DWL E;  3VYS B;  4JBA A;  1T8I A;  1VQN I;  4C2M J;  5HNH A;  3WTY C;  4O5V A;  1VZ0 A;  2LP0 A;  3ESW B;  2KPM A;  3VWB A;  3BLY A;  1G3S A;  4HV6 A;  3COA C;  3BR5 A;  4EJO A;  5J1R A;  3LMM A;  5IY5 H;  3QU6 A;  1IDZ A;  2WWY A;  3QRF F;  3JCU C;  2DOE A;  1HW1 A;  3WOD F;  3FDY A;  2G7U A;  1XDS A;  1KGS A;  1RES A;  3GX4 X;  2H1K A;  1QRY A;  4D5C A;  5IP9 J;  1IW7 F;  1XMA A;  4M73 A;  3ZQH A;  2PJP A;  3EYY A;  1UJ8 A;  3KEY A;  4BQA A;  3CDL A;  4E7K A;  2TDX A;  5LD2 C;  3OYF A;  2ELK A;  1LE8 A;  2R93 J;  2BXZ A;  2UV1 A;  2EIJ H;  4V2G A;  3A01 B;  3S3N A;  2M3A A;  4D9J A;  1IRF A;  4Q48 A;  4QTR A;  2R0Q C;  5TGT A;  1SAN A;  5JHF A;  5M3F J;  2M9H A;  1S7A A;  3IL2 A;  2KZG A;  1SAU A;  4ITV A;  3K1N A;  4AU7 A;  3OYM A;  2MH9 A;  1IAW A;  3S1M J;  1RNL A;  1WQ2 A;  1ZG1 A;  3FKJ A;  2L4M A;  3PJR A;  1LB2 A;  3QP5 A;  2FNA A;  3F72 A;  1HLV A;  1TQP A;  2P5L C;  3WTU C;  3PM1 A;  5DM6 F;  2LR8 A;  1ORK A;  3HRM A;  1QO0 D;  2MG4 A;  4UY8 I;  5IT9 K;  2JSP A;  1WJD A;  2LC2 A;  4LGW A;  3EUH A;  4LG3 A;  1E2X A;  4ZC3 A;  1FOX A;  2HKO A;  3G6E I;  4UB6 C;  1MH3 A;  1B9N A;  2OAZ A;  2ZKZ A;  3FIS A;  4XRS G;  1S7E A;  2XF7 A;  2VC0 A;  2H27 A;  2HNH A;  2DTR A;  2V1D A;  4XL9 A;  4RB2 C;  5B1A H;  3H9J A;  4EGZ A;  3JSO A;  2IT0 A;  3FF5 A;  2JVH A;  3GTK J;  1G3T A;  2V7F A;  4RGR A;  4EGY A;  5IT9 Z;  1TT0 A;  2VOO A;  2WY7 Q;  3GF2 A;  2EZI A;  2VQH A;  3D1N I;  2MFZ A;  3HHH A;  4L5E A;  1RKT A;  3TW6 A;  5B66 C;  1H89 C;  3A01 A;  2VKD A;  1YIJ I;  3OWT A;  2L9V A;  4F91 B;  1S72 I;  5M3M J;  2KIS A;  3PO3 J;  4NC6 A;  2R3S A;  1LQ1 A;  3T8R A;  5CVJ A;  1YW8 A;  2ACJ A;  1SD4 A;  4P55 A;  2O61 A;  3LSH A;  1MBE A;  3VOE A;  3C2B A;  2K85 A;  1R4N B;  5TRD A;  4HF1 A;  2P7C B;  4BHP A;  1Q1V A;  2DXI A;  1ULY A;  3V42 A;  2ZXW H;  3GW2 A;  2F2E A;  4E7Z A;  3C2G A;  1Z3X A;  2QQ9 A;  1FTZ A;  2BZT A;  4N4O B;  5M5Y J;  3SQN A;  3S2D J;  2WV0 A;  3BR0 A;  3ONQ A;  5IP6 A;  2A05 A;  2KIM A;  1O7F A;  2JZY A;  4X0G A;  1OR7 C;  4X1E A;  3SXY A;  2ZC2 A;  2RQQ A;  1MND A;  4HYE A;  5LHG A;  2M8E A;  3OYL A;  2M1B A;  2K9N A;  2Y48 A;  2DDA A;  3HOS A;  1H8A C;  1BR1 A;  3RPU D;  1XG1 A;  4Y7N J;  5C4J J;  1ETK A;  4EM1 A;  3MEX A;  2DCE A;  1IXC A;  3R0J A;  2GOM A;  2DPU A;  3H3V K;  3LSG A;  3CCV I;  1FNN A;  2HKX A;  4V19 K;  4F52 A;  4E70 A;  3FMS A;  4E7L A;  1YFH A;  4M3B A;  4E7J A;  5HDK A;  4R79 A;  1MBF A;  1R5G A;  4A5N A;  3GME A;  3E7L A;  2DYR H;  3BTL A;  3OSF A;  2KP6 A;  2OA4 A;  4RB3 C;  4NNJ A;  3ZQQ A;  2AXT C;  3CUO A;  1E17 A;  1MBG A;  3WE2 A;  3M7G A;  2H8W A;  2W25 A;  1SAX A;  1S6L A;  3J7A Y;  3Q9S A;  5HLI A;  2MLG A;  1IUF A;  2Y2Z A;  1EA3 A;  2WAE A;  4IJA A;  4BXU A;  1EH8 A;  2VIX A;  2CV1 A;  1RRJ A;  3QOD A;  1NG7 A;  3OYK A;  2A5W A;  1R36 A;  3TO7 A;  1H9T A;  1OMI A;  1BOB A;  3S3M A;  1D5Y A;  3K1P A;  3GFI A;  4LG0 B;  1N75 A;  2LRD A;  4Z2Y A;  2HDD A;  3HKZ N;  3PFI A;  1ODD A;  4L5I A;  3L2C A;  4BGD A;  2PN6 A;  3MVP A;  3PNT A;  4MTE A;  1X4O A;  2IGK A;  2Y30 A;  4LD5 A;  3NAR A;  4W1U A;  2DT6 A;  2Z16 A;  3JSP A;  4ENN A;  3PO2 J;  3U1D A;  1OYY A;  2KRH A;  1YS7 A;  2OCC H;  3TGN A;  5ILU A;  1QZE A;  3W2V A;  5GPC A;  5HLG A;  3CP8 A;  2A61 A;  3OYB A;  2GXA A;  2DA7 A;  3HC7 A;  1IXS B;  1ZH5 A;  3EUA A;  1VQ4 I;  2STT A;  3IV5 A;  2QUF A;  4JK1 X;  1KU2 A;  5E17 F;  1GXQ A;  1D3Y A;  2JT1 A;  4XLA A;  3HOZ J;  2Z9O A;  2L54 A;  1LFU P;  1B8I A;  3I4P A;  5EG0 B;  3KZY A;  1BI2 A;  3GUD A;  1OKR A;  2DMP A;  3K69 A;  9ANT A;  4EM2 A;  1WJF A;  1UCR A;  2X85 A;  3ULQ B;  4CCM A;  4Q4Z F;  4ZYG A;  2CSO A;  2A07 F;  3QPS A;  4EV0 A;  2VE8 A;  2HQN A;  2K9S A;  3DKX A;  1T2K A;  4B3X A;  1P9Q C;  3IRR A;  3L9F A;  4BS9 A;  1GVD A;  2E19 A;  4KNY A;  1GVJ A;  3PIP F;  2R5Y B;  1FOK A;  3S17 J;  3HXL A;  3ERE D;  1OCZ H;  5J47 A;  1I27 A;  2KRF A;  1OJL A;  2QBY B;  5F08 A;  2NYX A;  4JX6 A;  2FUG 2;  1FBQ A;  2EV6 A;  1U0J A;  3SZP A;  4BXX J;  4AIK A;  2E1M C;  3HUG B;  2NOJ B;  5EF6 A;  4HDU A;  1Z67 A;  4HLY A;  3GTP J;  4LG0 A;  2O7O A;  2EV5 A;  4CCK A;  1U5T C;  2WBM A;  2ISZ A;  3DBH B;  3P9C A;  4IEJ A;  2W85 A;  3MN2 A;  5IYB J;  4IOA F;  1HDP A;  3V8K A;  3CCJ I;  5GPA A;  3H5N A;  2ZNZ A;  1RKW A;  1F43 A;  4FT8 A;  3VYT B;  1G6N A;  4G7O F;  4I6Z A;  2ZB9 A;  4R8H A;  3F9K A;  1D5V A;  5F0F A;  2R7D A;  4LJZ F;  2RGV A;  4L0Z B;  2F5F A;  5LGU A;  1AWC A;  2VQL A;  2DJI A;  4PGH A;  1J0R A;  1DGW Y;  3Q0V A;  1ETY A;  1LFP A;  5EEH A;  3G1L A;  3OYD A;  1A31 A;  4Y17 A;  3KP4 A;  1JKP C;  2QQ8 A;  5EG0 A;  1VQM I;  4M9X A;  2Y31 A;  3LAJ A;  3CCM I;  3ZN0 A;  3E6C C;  4BJT A;  2XC7 A;  5EEA A;  1UFM A;  5F1J A;  2ME6 A;  1JI8 A;  4LB6 B;  3G73 A;  4XRM A;  2D2W A;  1Y8Q B;  4L0Y B;  1X2N A;  3IUO A;  1B4A A;  5HS8 A;  3PNY A;  4I09 A;  2IGN A;  3H0D A;  2R5Y A;  2BY0 A;  1YW9 A;  3P5J A;  2EB7 A;  4PSX A;  1E3H A;  1PJR A;  3H3Z A;  3KP3 A;  3OR2 C;  3R60 A;  4QWQ A;  2V26 A;  1QNT A;  3MD2 A;  3DTE A;  3HUG A;  3M8F A;  4BEH B;  1XN7 A;  4DBQ A;  4PUS A;  2E71 A;  2QA4 I;  3RI4 A;  5HLH A;  3HOT A;  3FM3 A;  3IKT A;  1Z91 A;  3AL0 B;  4M3E A;  4O6J A;  4NUB A;  5B1B H;  4HX8 A;  2DFI A;  1BIA A;  2GWR A;  1XGS A;  1R58 A;  2LDU A;  1DP7 P;  1G3Y A;  3E5Q A;  1EH7 A;  2RN7 A;  4PK4 A;  3HBL A;  1ETV A;  2NXN B;  5B5E C;  2A69 F;  4PGG A;  4NQW B;  3MZY A;  3V8J A;  1Z3Y A;  2HQ5 A;  2ICW G;  2QQA A;  4KIG A;  4IHX A;  3LA7 A;  3ZPL A;  3H92 A;  1R71 A;  3OR1 C;  2Q2E A;  2DQR A;  2PMH A;  4B44 A;  1W7P B;  1OCC H;  2QEX I;  2X9D A;  2K5C A;  1U3E M;  3SFZ A;  2XRL A;  1F5T A;  1P92 A;  2JVG A;  3A1Y A;  2XIG A;  1TL8 A;  3GLX A;  4C3H J;  1U8B A;  2DLL A;  3TW7 A;  3KET A;  2KLO A;  3KP6 A;  5H2F C;  4B8X A;  3AFH A;  4FQG A;  2EFW A;  5L3D A;  5IP7 J;  3A4C A;  2UZK A;  1NH3 A;  5CVU A;  1WPK A;  2A6H F;  4NBQ A;  4F93 B;  3HSR A;  1IRX A;  4I7H A;  4K2E A;  2R7U A;  4A0X A;  4D5F A;  2YX4 A;  3RKY A;  4HF2 A;  1WZ2 A;  3F8N A;  4ESJ A;  4L18 B;  3M1C A;  2A5Y B;  3FXU A;  1YRN A;  1ETO A;  3FZV A;  2A3S A;  1BJZ A;  2F5C A;  2EIK H;  1WI9 A;  1YHQ I;  4KIC A;  3I5U A;  1USS A;  4B4C A;  1UHM A;  2E7X A;  3DCF A;  2F4M B;  5HOO A;  2MH2 A;  3F22 A;  4MFE A;  4GYG A;  5FKO A;  3CMA I;  1Z0X A;  1X1D A;  1UG2 A;  1R5I D;  1ZGW A;  3LOC A;  5CVV A;  2HYJ A;  3J81 K;  4YIR X;  2QLZ A;  1MJ9 A;  3FMQ A;  4CHU A;  4CH7 A;  4M9S A;  3VB2 A;  2DA1 A;  4NQW A;  4MEY F;  2X48 A;  2CFX A;  2PMZ A;  5E18 F;  1YIT I;  1FJL A;  3HOU J;  1C0W A;  3O8G A;  2DW4 A;  4GRI A;  1APL C;  2LSO A;  2DT7 B;  3SZT A;  3DEW A;  2HZD A;  2V9P A;  3ZXS A;  2ZJ2 A;  1J9I A;  1U2W A;  2A6E F;  2O9L A;  1W7P A;  1E0E A;  2BY1 A;  5D5W B;  4DYQ A;  5A2Q K;  5HS7 A;  2O6G E;  4CUG A;  2IVM A;  3J81 Z;  5KNL A;  3JAM K;  3JRC A;  2H6C A;  2VL8 A;  2HVS A;  2CYY A;  5EZH A;  5F64 A;  2MYS A;  4KIS A;  4C3J J;  2O03 A;  2QVO A;  4MQV A;  5L3E A;  3HB9 A;  2VUM J;  4IKF A;  1YG2 A;  1KU3 A;  5IPA A;  1HW2 A;  3AG1 H;  3CF5 F;  2CGP A;  3F3X A;  1FX7 A;  2HS5 A;  5A2Q Z;  3QPH A;  2B7E A;  1HKQ A;  5CVI A;  1IN8 A;  4H4K C;  3VOD A;  2HPI A;  2QCO A;  2ESN A;  3JAM Z;  3Q9V A;  2P4W A;  4RLF A;  1FIP A;  4AID A;  2GA2 A;  3OOU A;  4XKC A;  1T33 A;  4IHT A;  2K4J A;  3WU0 A;  1ON1 A;  1LDJ A;  2DMT A;  1R4M B;  3F21 A;  5GP9 A;  2M45 A;  1JKO C;  2LD5 A;  2MD5 A;  3BCA A;  3BR1 A;  3K4C A;  1CGP A;  4E4H A;  1XMX A;  3N4M A;  1B72 B;  1FEX A;  3IP4 B;  1XCB A;  1WJE A;  2ZCW A;  2Z5U A;  3CQZ J;  4A3J J;  2HFH A;  3F6V A;  5K5O A;  4U0V A;  5D8L B;  4RBO A;  2JA8 J;  2FSW A;  1AHD P;  1HCR A;  3K4N A;  1FBS A;  3O6B B;  3TOA A;  1QHH D;  1GLN A;  4AIJ A;  2F48 A;  3M1E A;  3PSI A;  2CO5 A;  2L01 A;  4QSH A;  3C2H A;  3ERM A;  4WXC A;  3NWT A;  1Z9C A;  4JYK A;  1IV8 A;  5IYC J;  2P6T A;  1WJA A;  1V3F A;  2UXX A;  4CCL A;  5EJC A;  3S1N J;  2EFN A;  2H94 A;  2KT0 A;  4RM2 A;  1N77 A;  3KX2 A;  2R7T A;  4UXN A;  4BBR J;  1T39 A;  1YIO A;  2XPU A;  2EH3 A;  1VQO I;  3QP6 A;  1SD5 A;  2AQF A;  3A0H C;  1ETQ A;  3BJA A;  1TBX A;  4RLQ A;  3BJO A;  2XGC A;  2CV2 A;  3IHU A;  4C2T A;  1RZ4 A;  4LB5 A;  1ZAR A;  2RKH A;  2CJJ A;  4I98 B;  5J8C A;  4XRF A;  3S15 J;  3QPL A;  5J40 A;  1H88 C;  5J3L A;  2XAQ A;  3EUK L;  3MKL A;  4YEL A;  2V79 A;  3KP5 A;  4L5J A;  3F23 A;  5K7F A;  3ZMT A;  1R1T A;  2X6X A;  2DFE A;  3K4B A;  3S32 A;  2EK5 A;  1T56 A;  1SD6 A;  1MJA A;  3R0A A;  1JKQ C;  2CQK A;  3K4M A;  4AC0 A;  1KU7 A;  3B73 A;  1RI7 A;  2GAU A;  3ABK H;  1GV5 A;  1B72 A;  3PFY A;  1K83 J;  5ILS A;  4XON A;  2XF6 A;  5BPI A;  2LFB A;  2W24 A;  3LSJ A;  2BXY A;  2I5U A;  3VYR B;  2NNY A;  1FSH A;  3ASN H;  1TWA J;  1BW6 A;  1V55 H;  5DCF A;  3JRG A;  3BPV A;  1LPQ A;  1VQ6 I;  1VQP I;  3K9T A;  1B6A A;  2QKL B;  3DFG A;  2RAE A;  3G4S I;  2OD5 A;  5CYV A;  2CUZ A;  1E3O C;  4M9Z A;  1MGT A;  2E1O A;  2VXZ A;  2X0L A;  2ZJP F;  3E6B A;  5BOX A;  1ZRC A;  3CCU I;  5IT3 A;  1F1Z A;  3RIR A;  2JRT A;  2ZXH A;  3GCM A;  3BR6 A;  1HF0 A;  4HST A;  3J7Y J;  1YJ9 I;  3U21 A;  3H9Q A;  2AHQ A;  4LIT A;  4XM3 A;  1JUP A;  3K70 C;  2JRM A;  1QQI A;  2LKS A;  2DAO A;  3FXK A;  3L7W A;  2FXA A;  2KKO A;  3BZ6 A;  1HA8 A;  4A6D A;  2CW8 A;  4KA4 A;  3WHC A;  3TO6 A;  2VBZ A;  1WI3 A;  2W1O A;  3ZQI A;  2HDC A;  1HC8 A;  3I55 I;  3HGY A;  5BMZ A;  2F4I A;  2KIU A;  1GV2 A;  5D8K B;  3SEZ A;  3CJR B;  3FM5 A;  1W5T A;  3ZQC A;  3F8M A;  3E6D A;  4BH9 A;  2DA3 A;  3OIP A;  2VI6 A;  1VFC A;  4WCG A;  2V9K A;  2W82 A;  4B43 A;  2Y0S N;  3V7S A;  1TT5 B;  2N8G A;  1HST A;  5ICF A;  5D5V B;  3OYH A;  2BE5 F;  2Z99 A;  4RB0 A;  3TL4 X;  1YOV B;  2BYV E;  5LGT A;  5D5U B;  3MAJ A;  3DTK A;  2HXO A;  2VBW A;  2E2I J;  3KLO A;  1IRG A;  1GXP A;  2J5P A;  2E2H J;  4EJW A;  1DPR A;  2K86 A;  2L9S A;  1FZP B;  1NTC A;  2W7N A;  3OYE A;  2LLK A;  3OOP A;  4BQQ A;  1H0M A;  2FF4 A;  4XOR A;  1OR7 A;  2L9N A;  3DXJ F;  1Z6T A;  3E97 A;  4E7S A;  2CUF A;  4G7H F;  1LUJ B;  3WTS C;  2X1D A;  5H20 A;  4FHT A;  5AIQ A;  5GTH C;  2HOE A;  2QEN A;  4AD9 A;  3S1Q J;  1QGP A;  3C1D A;  3BWG A;  3HM5 A;  3ZQL A;  2GIV A;  4GFB A;  1BA5 A;  1BI3 A;  1IGN A;  2GXB A;  2FBK A;  2BHZ A;  3MZ8 A;  4IO9 F;  2LKP A;  2GIZ A;  3RQI A;  2IW5 A;  3A03 A;  1U8R A;  2EZH A;  2K27 A;  4YFX F;  1TZL A;  4A93 J;  4YFK F;  2IS6 A;  3I58 A;  2COB A;  3F8C A;  1RET A;  3LA2 A;  1K7A A;  2NVQ J;  4QIW N;  4FX0 A;  3ZN1 A;  5K1Y A;  1EF4 A;  2LMD A;  2AQE A;  3BC8 A;  4P96 A;  2JA6 J;  3G3Z A;  1NK2 P;  4XKB A;  2AS5 F;  1NK3 P;  1K61 A;  3OV8 A;  3S2W A;  2WV1 A;  1XTA A;  5LEJ A;  1HDD C;  2XB5 A;  4AVZ A;  4R1H A;  3M8E A;  1Y1V J;  1KZH A;  2E1M B;  2DYS H;  2YU3 A;  4G7Z F;  3ZGK A;  3K70 D;  4WX9 A;  1FMV A;  5BPD A;  2M0M A;  2R7O A;  3ABM H;  3WU2 C;  1ETX A;  5EYR A;  1N78 A;  2DMU A;  3OL3 A;  1YYV A;  3ECH A;  1IN5 A;  3KIO A;  1KYZ A;  5DCM B;  2D1V A;  4CCJ A;  4G6T B;  2VB6 A;  1P4X A;  4CO8 A;  3GTJ J;  4CYD A;  2H8R A;  1WWX A;  2ID6 A;  2FQ4 A;  3IH3 A;  2IA0 A;  2EJR A;  1UB9 A;  3C3W A;  4RDU A;  3ABU A;  1YS6 A;  4OIR F;  2VKV A;  4B3A A;  4ZYA A;  4U0Y A;  5FFZ A;  1BC7 C;  4HA8 A;  1MMG A;  2VPL A;  3WGH A;  1P7I A;  4U87 A;  2V1U A;  3NQO A;  3NAU A;  3K4K A;  3CUQ C;  5AON A;  3OYA A;  3GTG J;  3FMR A;  3OSG A;  5FKL A;  3MWM A;  4DGW B;  1TLH B;  4FTH A;  2CW0 F;  3V7C A;  2KZV A;  3CES A;  2GM4 A;  2KJC A;  1S3J A;  2JPB A;  2L02 A;  3LFK A;  3BTC A;  3HKZ A;  3QOE A;  4FAS D;  2F5E A;  2YU9 J;  3GTL J;  2W4S A;  1BW5 A;  4RMN A;  2P7V B;  1X2M A;  4G12 A;  4RAF A;  1R9T J;  1D8J A;  1VQK I;  5LHI A;  1U5T A;  1VQ9 I;  3I4M J;  5DD8 A;  4XOP A;  2VOD A;  1UZC A;  4XNF A;  2WAF A;  4MTD A;  4JP0 A;  3JRE A;  4J19 A;  2DPD A;  4A5M A;  1FTT A;  2E60 A;  4XN0 A;  4HNV A;  1WKM A;  1XGN A;  1I3Q J;  2H6B A;  2JTV A;  3KP7 A;  4G94 A;  2OPT A;  4P5O A;  1QVU A;  5DCM A;  4BJ5 C;  1IF1 A;  1FPQ A;  1ZG3 A;  1B8I B;  3RYR A;  3J7Z I;  2Q8K A;  4HX7 A;  2G9W A; 
#chains in the Genus database with same CATH homology
 3WTT C;  1JXS A;  1YTY A;  2NNN A;  1OYW A;  4XBF A;  4GCV A;  4P9U A;  2P8T A;  4OIQ F;  1B9M A;  4EJU A;  1K79 A;  2YR2 A;  4I02 A;  4KN4 X;  1O57 A;  5DUK A;  1KQ9 A;  4Q47 A;  4IHS A;  3FXR A;  4ENM A;  2W84 A;  2DQL A;  3LST A;  3ROU A;  4U7D A;  4RAZ A;  4EJV A;  2Q8K A;  1K78 B;  1JE8 A;  3J7A O;  1SFX A;  5LRR A;  5DEQ A;  3BOQ A;  2NRA C;  1GHC A;  1QPM A;  2DK5 A;  1ONV A;  1O3S A;  3WGI A;  4A6E A;  2LNB A;  5E8I A;  4IRI A;  1ZLK A;  3Q5F A;  3QU3 A;  2R7F A;  3N97 A;  1ZRF A;  2L3D A;  3LAP A;  1WRJ A;  2PQ8 A;  1X3U A;  1ZGA A;  2JPC A;  3GVA A;  4HLX A;  2ETH A;  3F6O A;  3QAH A;  4A2U A;  3I59 B;  3REO A;  2GQQ A;  3FWE A;  1HSJ A;  2IRF G;  1LVA A;  1YO5 C;  1R00 A;  3RDI A;  1I1G A;  2WTE A;  3MCZ A;  1K78 A;  4XSX F;  1TW2 A;  2HYG D;  3GZ5 A;  2FBH A;  5DV5 A;  1UHW A;  3WG9 A;  3I71 A;  1P4W A;  2BV6 A;  1QZY A;  1XB4 A;  1R5H A;  1W5S A;  2RDP A;  3IWZ A;  3KEO A;  4U0W A;  2XRO A;  4MHG A;  2EA4 A;  4RB1 A;  4CXF A;  4GO1 A;  4LLL A;  1I1S A;  4G6D A;  1F4K A;  5JR3 A;  4UV8 A;  3BPX A;  1BOA A;  2PG4 A;  2HQR A;  2OQG A;  3I59 A;  1S7O A;  4YIF A;  1BIB A;  1XSX A;  2MA3 A;  3EET A;  3IRQ A;  4P9F A;  1D8K A;  1FC3 A;  1F9N A;  4M6Y A;  1DDN A;  2ZBK A;  3FX3 A;  4U88 A;  1G4D A;  4ENJ A;  5JVT A;  2FMY A;  4IXA A;  4YII A;  4L9N A;  4I0A A;  2IJL A;  4LK1 F;  2FE3 A;  5H6R A;  2VC1 A;  2STW A;  3DF8 A;  3JTG A;  2NS0 A;  4ETS A;  4HAM A;  4ENK A;  1PUE E;  3BJ6 A;  3DP7 A;  3GFM A;  4PCQ A;  4DQ2 A;  5LBQ A;  5EEG A;  2VOP A;  2MC3 A;  5HDN A;  3GYH X;  1Z1D A;  2RC4 A;  1KU9 A;  2E1C A;  2XKP A;  4GYI A;  2UXN A;  2FU4 A;  3LA3 A;  1MJB A;  5J8F A;  3ZQ7 A;  4XLP F;  1JGS A;  5ICC A;  5DDG A;  3P9K A;  5LRS A;  3VFZ A;  1I5Z A;  5BQT A;  4IRG A;  1FLI A;  2PBI A;  1NHA A;  4NB5 A;  2HWV A;  1MKM A;  5FD6 A;  2DO7 A;  1TQI A;  1SFE A;  3E5U A;  5ERI A;  1TTY A;  2RQP A;  1V4R A;  3I0T A;  1Q1H A;  4WWC A;  1FP1 D;  4Y15 A;  2X4H A;  2Q0O A;  1B1B A;  2HZT A;  5D5X B;  2C6Y A;  2PFB A;  1HBX G;  2FA5 A;  2EFP A;  1O7L A;  3V8L A;  2VE9 A;  1YW7 A;  4G8X A;  4WXH A;  2ZO4 A;  2O3F A;  3V7R A;  1BBY A;  3J80 K;  1LDK B;  5DUI A;  5K5R A;  1ZLJ A;  2MBF A;  2OBP A;  4LLN A;  1EH6 A;  1ZYR F;  1O3Q A;  4PZJ A;  1BJA A;  4ZYE A;  1Z05 A;  2QZ8 A;  2XAF A;  3GFJ A;  1KYW A;  2GXG A;  3CJN A;  3J80 Z;  4WF2 A;  2QQB A;  4IPA A;  5E20 A;  5KK1 A;  4ESB A;  1FYK A;  3EQL F;  5FB2 A;  3MFK A;  1FY7 A;  4RGX A;  5L3G A;  1A04 A;  1LJ9 A;  1R7J A;  3WE3 A;  2GA1 A;  4YFN F;  3BP8 A;  4IF4 A;  2MLK A;  4GGG A;  3RPU A;  5L3C A;  2O0Y A;  1BM9 A;  5ICE A;  1P6R A;  4YG2 F;  3R61 A;  3BRO A;  2VON A;  3BDD A;  2IA2 A;  1STZ A;  3CUQ B;  4OIN F;  4G9Y A;  1H9G A;  3QPT A;  2YPR A;  5HDG A;  2JSC A;  3ISP A;  3HTS B;  1MD0 A;  4EJT A;  5D4S A;  2IPQ X;  1QZZ A;  5D4R A;  3ECO A;  2FBI A;  1CF7 B;  2VT2 A;  5CLS A;  3L00 A;  4I2O A;  3DEU A;  4M6X A;  2XRN A;  1TNS A;  1YQA A;  1SD7 A;  1KQ8 A;  2OU2 A;  1HW5 A;  2D45 A;  2M30 A;  4CDG A;  4KDP A;  2VT3 A;  3GWZ A;  2B0L A;  1AOY A;  1SMT A;  4HZF A;  2FQ3 A;  3MZH A;  3I53 A;  3K2Z A;  3FHZ A;  3CUQ A;  1BI1 A;  2FNP A;  3HRU A;  2EWN A;  2M87 A;  3KFW X;  3DPL C;  3IC7 A;  2QYO A;  3C7J A;  4EQQ A;  2COM A;  3HRS A;  4MEX F;  3NRV A;  2WC2 A;  2IA1 A;  1CF7 A;  3TOB A;  4LLG F;  1FT9 A;  4HW0 A;  3IKV A;  2ESH A;  2YX7 A;  4AIH A;  4UNO A;  2XAH A;  3CO6 C;  4RAY A;  2RV8 A;  4KUM A;  4CIC A;  1P2F A;  2EA2 A;  3GZ6 A;  5JHU A;  4OOI A;  5AIP A;  3W6J B;  4ZZD A;  1JHH A;  1LEB A;  5TJJ A;  2P5V A;  4ZYD A;  2XAS A;  5CVR A;  4FX4 A;  2K7L A;  2HTJ A;  1W7P D;  3CTA A;  1TQM A;  2PEX A;  2XAJ A;  2E1N A;  1ZHF A;  1J5Y A;  3HIF A;  4N9I A;  1RUO A;  1U5T B;  1LEA A;  3DPT A;  1BC8 C;  1IN4 A;  3GXO A;  2ZME A;  5D6F A;  4UHT A;  3T8T A;  2LF8 A;  2H09 A;  1HKS A;  3F8B A;  4Q5S F;  4OIO F;  1T6S A;  5ICG A;  4TV7 A;  2XUB A;  3WTV C;  4PDK A;  4ZH4 F;  1RIO H;  1I6X A;  1QBJ A;  4M71 A;  3T5X A;  3AAF A;  4S05 A;  2P6S A;  3L09 A;  4HQM A;  5F1R A;  2V1X A;  1IZ1 A;  2ZFW A;  4BYY A;  1UST A;  4N0B A;  1FSE A;  1PDN C;  3WTZ A;  4XSZ F;  1Y0U A;  3ELK A;  2DT5 A;  2EFQ A;  3TKY A;  3VEP A;  4UV9 A;  1BN5 A;  1YLF A;  2G7H A;  3WTX C;  4A0Z A;  2PLY A;  1J7K A;  4CZZ A;  2PI0 A;  2BEO A;  2IP2 A;  3QOP A;  1S8N A;  4KMF A;  3D5L A;  1S29 A;  2Y75 A;  4HOB A;  4B09 A;  2DBB A;  2HYF A;  2L4A A;  1W4M A;  4ZZL A;  2PMU A;  4I0B A;  2O8X A;  4OMY A;  1OPC A;  4CGZ A;  2FOK A;  1XDU A;  3I64 A;  3TQN A;  1HQC A;  1FBU A;  3FXQ A;  3D0S A;  3R4K A;  4UVB A;  1IXR C;  3RKX A;  4F7Z A;  3KLN A;  2DI3 A;  4RS8 A;  1OYI A;  3RYP A;  4ON0 A;  3HHG A;  1HXD A;  1KA8 A;  3JTH A;  3HTU A;  1TW3 A;  2XV4 S;  2ADU A;  2LF7 A;  1WSU A;  3PQK A;  2XAG A;  4EVI A;  2NAZ A;  1SMY F;  1MDM B;  4AVP A;  5JFR A;  2XHK A;  1BI0 A;  4MNU A;  4BNC A;  1REP C;  3JW4 A;  5FFX A;  1FYM A;  4S04 A;  1K6O A;  2Y0M A;  1DPU A;  2E7W A;  2OQR A;  2CWE A;  2KIF A;  2YSR A;  2XVC A;  5LLQ A;  2V6C A;  2AXL A;  2HTS A;  3PQJ A;  1XGO A;  3DV8 A;  1ZG5 A;  2W57 A;  5FO5 A;  5E1Z B;  3HSF A;  4KIB A;  3GEZ A;  2DK8 A;  2Z3Y A;  4KYW A;  5FD5 A;  4HX4 A;  1ZN2 A;  4UUV A;  1U6G A;  1O3R A;  1XSD A;  4O3M A;  1T0F A;  2D1H A;  3U2R A;  3MQ0 A;  3O2P E;  1MDM A;  2UWM A;  2HGC A;  3E6M A;  3WTW C;  3HSE A;  3P7N A;  5DD4 A;  3M9A A;  3O3K A;  4I01 A;  5K5Q A;  3F8F A;  4RGS A;  4LMY A;  3KCC A;  2QBY A;  3ZMD A;  4UVC A;  3EDP A;  5L3B A;  2ZXJ A;  2FEZ A;  2OZ6 A;  5LHH A;  4MQ9 F;  4ESF A;  1JHF A;  4KFC A;  4IRH A;  2CG4 A;  5LEK A;  3ZMV A;  4A0Y A;  5F6F A;  5FLX K;  4QLC U;  3GFL A;  4U7B A;  1P4A A;  1XD7 A;  1PP7 U;  3LQR A;  3E3V A;  3R6S A;  3ZMU A;  1J59 A;  3P9I A;  2P5K A;  3K0L A;  5FLX Z;  5H6Q A;  3HYI A;  3LWF A;  1SFU A;  1DUX C;  5LGN A;  1RUN A;  3KE2 A;  1ZGJ A;  1R22 A;  4HQE A;  1MZB A;  3RKW A;  3TDU C;  1XGM A;  1TNT A;  2BBY A;  2FRH A;  1J75 A;  1XCV A;  1FYL A;  3ZMZ A;  4ASN A;  1LDD A;  2VN2 A;  5KVR A;  1ZRD A;  4WXD A;  2RNJ A;  2XKO A;  3I54 A;  3ML6 A;  1R1U A;  1ON2 A;  3WU1 B;  2V9V A;  4WK8 F;  5FGM A;  2ZNY A;  5E1W A;  4G6Q A;  3T1B A;  4M74 A;  3B02 A;  3KZZ A;  2K4B A;  1PP8 F;  2M5W A;  2VBY A;  1ZRE A;  2ELH A;  4BHB A;  4HDV A;  3V4G A;  2A68 F;  3HRT A;  3BY6 A;  5D6E A;  3RTR A;  3CLO A;  4N9H A;  4NHJ A;  1U78 A;  1O3T A;  3K1M A;  2VBX A;  1Z6R A;  3DKW A;  1T38 A;  1L0O C;  1XSV A;  5DYM A;  4HV5 A;  5L3F A;  3ABT A;  4KT5 C;  2F5D A;  4OIP F;  4L9J A;  1EV7 A;  4H0E A;  3SHF A;  2QM3 A;  5BS6 A;  4HBL A;  4L9V A;  2HEO A;  2EV0 A;  4KMU X;  1LNW A;  1FWZ A;  3TDZ C;  2HR3 A;  3IWF A;  1KQ0 A;  4ZYH A;  6PAX A;  3C18 A;  5E1X A;  4BAY A;  2Z33 A;  1IN6 A;  2FML A;  3RJP A;  2K02 A;  1G3W A;  3LQQ A;  1XMK A;  2EFO A;  2J5O A;  4M72 A;  2BGC A;  5ED4 A;  2GZW A;  3CDH A;  4D0P A;  2ISY A;  3E5X A;  4EM0 B;  4HF0 A;  4KIF A;  3CO7 C;  3KEQ A;  4Y13 A;  3GO5 A;  4DNC A;  4OU0 A;  5HS9 A;  3EYI A;  1FP2 A;  3WGG A;  3KP2 A;  1Z7U A;  3NEU A;  3ZMS A;  1T98 A;  1HKT A;  1VTN C;  2DU9 A;  4IVN A;  4MGR A;  3H3U A;  5CJ9 A;  2KJB A;  4XLN F;  3ZP5 A;  1B59 A;  4LFU A;  3TO9 A;  4A12 A;  3U9G A;  1IUY A;  2RVC A;  1IN7 A;  2XGX A;  5HVQ C;  1L3L A;  4JQF A;  5ILV A;  5J6X A;  5JI6 A;  3RPQ A;  1R23 A;  4BHC A;  4OMZ A;  5E8G A;  3T0Y A;  4AWX B;  4L9T A;  1R1V A;  2OZU A;  3W6K B;  3DQV C;  4LK0 F;  1ZAO A;  4UVA A;  4EMS A;  4KN7 X;  1J2X A;  4RGU A;  2ZME B;  2QWW A;  4GXO A;  4JBA A;  3WTY C;  4O5V A;  1G3S A;  4HV6 A;  3COA C;  4EJO A;  3QU6 A;  2WWY A;  3QRF F;  3WOD F;  1HW1 A;  2G7U A;  1XDS A;  1KGS A;  3GX4 X;  1IW7 F;  1XMA A;  4M73 A;  2PJP A;  3EYY A;  4BQA A;  2TDX A;  1IRF A;  4Q48 A;  1S7A A;  3IL2 A;  3K1N A;  2MH9 A;  1IAW A;  1RNL A;  1WQ2 A;  1ZG1 A;  2L4M A;  1LB2 A;  3QP5 A;  2FNA A;  3F72 A;  1TQP A;  2P5L C;  3WTU C;  3HRM A;  1QO0 D;  5IT9 K;  4LGW A;  3EUH A;  1E2X A;  2HKO A;  1B9N A;  2OAZ A;  2ZKZ A;  2H27 A;  2VC0 A;  2DTR A;  2V1D A;  4RB2 C;  4EGZ A;  3JSO A;  2IT0 A;  3FF5 A;  1G3T A;  4RGR A;  4EGY A;  5IT9 Z;  2VOO A;  3GF2 A;  3HHH A;  1LQ1 A;  2R3S A;  3T8R A;  5CVJ A;  1YW8 A;  2ACJ A;  1SD4 A;  4P55 A;  2O61 A;  3VOE A;  4HF1 A;  5TRD A;  2P7C B;  4BHP A;  1ULY A;  3GW2 A;  2F2E A;  2QQ9 A;  3SQN A;  2WV0 A;  2KIM A;  1O7F A;  2JZY A;  3SXY A;  4HYE A;  5LHG A;  2M8E A;  2M1B A;  2Y48 A;  3HOS A;  4EM1 A;  3MEX A;  1IXC A;  3R0J A;  2DPU A;  1FNN A;  2HKX A;  4E70 A;  3FMS A;  1YFH A;  5HDK A;  4R79 A;  1R5G A;  4A5N A;  4RB3 C;  2OA4 A;  3CUO A;  1E17 A;  3WE2 A;  3M7G A;  2W25 A;  1SAX A;  1S6L A;  3Q9S A;  5HLI A;  2MLG A;  4IJA A;  4BXU A;  1EH8 A;  1R36 A;  3TO7 A;  1H9T A;  1OMI A;  3K1P A;  3GFI A;  4LG0 B;  4Z2Y A;  3PFI A;  1ODD A;  4L5I A;  3L2C A;  2PN6 A;  4MTE A;  4LD5 A;  4ENN A;  3JSP A;  3U1D A;  1OYY A;  1YS7 A;  3TGN A;  5ILU A;  5HLG A;  2A61 A;  1IXS B;  1ZH5 A;  2STT A;  2QUF A;  4JK1 X;  1KU2 A;  5E17 F;  1GXQ A;  1D3Y A;  2JT1 A;  2Z9O A;  2L54 A;  3I4P A;  3KZY A;  1BI2 A;  3GUD A;  1OKR A;  3K69 A;  4EM2 A;  1UCR A;  3ULQ B;  4Q4Z F;  4ZYG A;  2CSO A;  2A07 F;  4EV0 A;  2VE8 A;  2HQN A;  1T2K A;  3L9F A;  4KNY A;  1GVJ A;  1FOK A;  3ERE D;  1I27 A;  2KRF A;  2QBY B;  2NYX A;  1FBQ A;  2EV6 A;  3SZP A;  4AIK A;  4HDU A;  4HLY A;  4LG0 A;  2EV5 A;  1U5T C;  2ISZ A;  3P9C A;  2W85 A;  3V8K A;  2ZNZ A;  4FT8 A;  1G6N A;  4G7O F;  4R8H A;  1D5V A;  2R7D A;  4LJZ F;  2RGV A;  4L0Z B;  2F5F A;  5LGU A;  1AWC A;  4PGH A;  1J0R A;  5EEH A;  4Y17 A;  3KP4 A;  4M9X A;  3LAJ A;  3ZN0 A;  3E6C C;  1UFM A;  4LB6 B;  3G73 A;  2D2W A;  4L0Y B;  1B4A A;  5HS8 A;  4I09 A;  1YW9 A;  2EB7 A;  3H3Z A;  3KP3 A;  3R60 A;  4QWQ A;  1QNT A;  3HUG A;  3M8F A;  1XN7 A;  3RI4 A;  5HLH A;  3HOT A;  3FM3 A;  3IKT A;  1Z91 A;  4O6J A;  4HX8 A;  2DFI A;  1BIA A;  2GWR A;  1XGS A;  1R58 A;  2LDU A;  1DP7 P;  1G3Y A;  3E5Q A;  1EH7 A;  2RN7 A;  2A69 F;  4PGG A;  3MZY A;  3V8J A;  2QQA A;  4KIG A;  3LA7 A;  3ZPL A;  3H92 A;  2Q2E A;  2DQR A;  2PMH A;  1W7P B;  1U3E M;  3SFZ A;  1F5T A;  1P92 A;  2XIG A;  3GLX A;  2DLL A;  3KET A;  3KP6 A;  4B8X A;  2EFW A;  5L3D A;  2UZK A;  5CVU A;  2A6H F;  3HSR A;  4I7H A;  4K2E A;  4A0X A;  2YX4 A;  3RKY A;  4HF2 A;  3F8N A;  4ESJ A;  4L18 B;  2A5Y B;  3FXU A;  3FZV A;  2A3S A;  2F5C A;  1WI9 A;  4KIC A;  3I5U A;  1USS A;  1UHM A;  2E7X A;  5HOO A;  2MH2 A;  3F22 A;  4GYG A;  5CVV A;  3J81 K;  2QLZ A;  1MJ9 A;  3FMQ A;  4CHU A;  4M9S A;  3VB2 A;  4NQW A;  4MEY F;  2CFX A;  5E18 F;  1C0W A;  2DW4 A;  2LSO A;  3SZT A;  2ZJ2 A;  1J9I A;  1U2W A;  2A6E F;  1W7P A;  5D5W B;  5A2Q K;  5HS7 A;  2O6G E;  2IVM A;  3J81 Z;  3JAM K;  2H6C A;  2CYY A;  5F64 A;  2O03 A;  2QVO A;  4MQV A;  5L3E A;  1YG2 A;  1KU3 A;  1HW2 A;  2CGP A;  3F3X A;  1FX7 A;  2HS5 A;  5A2Q Z;  3QPH A;  5CVI A;  1HKQ A;  1IN8 A;  3VOD A;  2ESN A;  3JAM Z;  3Q9V A;  2P4W A;  2GA2 A;  4IHT A;  2K4J A;  3WU0 A;  1ON1 A;  1LDJ A;  3F21 A;  2M45 A;  2MD5 A;  1CGP A;  3N4M A;  1XCB A;  2ZCW A;  2Z5U A;  2HFH A;  3F6V A;  5K5O A;  4U0V A;  5D8L B;  2FSW A;  3O6B B;  1FBS A;  3TOA A;  4AIJ A;  3M1E A;  2CO5 A;  2L01 A;  4WXC A;  1Z9C A;  2P6T A;  1V3F A;  2UXX A;  2EFN A;  2H94 A;  4UXN A;  1T39 A;  1YIO A;  3QP6 A;  1SD5 A;  3BJA A;  1TBX A;  3BJO A;  3IHU A;  4LB5 A;  1RZ4 A;  1ZAR A;  2RKH A;  4I98 B;  5J8C A;  4XRF A;  2XAQ A;  2V79 A;  3KP5 A;  4L5J A;  3F23 A;  3ZMT A;  1R1T A;  2EK5 A;  1SD6 A;  1MJA A;  3R0A A;  2CQK A;  1KU7 A;  3B73 A;  1RI7 A;  2GAU A;  5ILS A;  5BPI A;  2W24 A;  1FSH A;  2NNY A;  5DCF A;  3BPV A;  3K9T A;  1B6A A;  3DFG A;  2OD5 A;  5CYV A;  4M9Z A;  1MGT A;  2VXZ A;  2X0L A;  5BOX A;  3E6B A;  1ZRC A;  5IT3 A;  1F1Z A;  3RIR A;  2JRT A;  1QQI A;  2DAO A;  3L7W A;  2FXA A;  2KKO A;  3BZ6 A;  4A6D A;  4KA4 A;  3TO6 A;  2VBZ A;  2HDC A;  5BMZ A;  2KIU A;  5D8K B;  3FM5 A;  1W5T A;  3F8M A;  3E6D A;  4BH9 A;  4WCG A;  3V7S A;  1HST A;  5ICF A;  5D5V B;  2BE5 F;  2Z99 A;  4RB0 A;  2BYV E;  5LGT A;  5D5U B;  3MAJ A;  2VBW A;  3KLO A;  1IRG A;  1GXP A;  2J5P A;  4EJW A;  1DPR A;  2K86 A;  1FZP B;  3OOP A;  1H0M A;  2FF4 A;  1OR7 A;  3DXJ F;  1Z6T A;  3E97 A;  4G7H F;  3WTS C;  5H20 A;  4FHT A;  5AIQ A;  2HOE A;  2QEN A;  4AD9 A;  1QGP A;  3C1D A;  3BWG A;  2GIV A;  1BI3 A;  2GXB A;  2FBK A;  2LKP A;  1U8R A;  2IW5 A;  2K27 A;  4YFX F;  4YFK F;  3I58 A;  3F8C A;  1K7A A;  3LA2 A;  4FX0 A;  3ZN1 A;  5K1Y A;  4P96 A;  3G3Z A;  2AS5 F;  3OV8 A;  3S2W A;  5LEJ A;  4R1H A;  3M8E A;  2YU3 A;  4G7Z F;  4WX9 A;  5BPD A;  1YYV A;  3ECH A;  1IN5 A;  1KYZ A;  5DCM B;  2D1V A;  1P4X A;  4CO8 A;  4CYD A;  1WWX A;  2IA0 A;  2EJR A;  1UB9 A;  3C3W A;  3ABU A;  1YS6 A;  4OIR F;  4U0Y A;  5FFZ A;  1BC7 C;  4HA8 A;  3WGH A;  2V1U A;  3NQO A;  3CUQ C;  5AON A;  3FMR A;  3MWM A;  1TLH B;  2CW0 F;  3V7C A;  2KJC A;  1S3J A;  2JPB A;  2L02 A;  3LFK A;  2F5E A;  2P7V B;  1D8J A;  5LHI A;  1U5T A;  5DD8 A;  2VOD A;  4MTD A;  2DPD A;  4A5M A;  1WKM A;  1XGN A;  2JTV A;  2H6B A;  3KP7 A;  4G94 A;  5DCM A;  4P5O A;  1IF1 A;  1FPQ A;  1ZG3 A;  3RYR A;  3IRR A;  4HX7 A;  2G9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...