3N97A

Rna polymerase alpha c-terminal domain (e. coli) and sigma region 4 (t. aq. mutant) bound to (up,-35 element) dna
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
53
structure length
53
Chain Sequence
SKLSEREAMVLKMRKGLIDGREHTLEEVGAYFGVTRERIRQIENKALRKLRHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Gene regulation/dna
molecule keywords RNA polymerase sigma factor
publication title Combined structural model for a transcription activation assembly
rcsb
source organism Thermus aquaticus
total genus 19
structure length 53
sequence length 53
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3n97A00
2KKOA 2RNJA 5ICEA 5E20A 4A5MA 2R3SA 3WGGA 4EM2A 4Y17A 2QUFA 3HTUA 3ZMDA 3H3UA 4CYDA 2JPCA 2STWA 2FBIA 3TO9A 1SAXA 2RQPA 3JW4A 4FX0A 3WODF 4WWCA 1D8JA 3L9FA 1E2XA 1R00A 1CF7A 1G4DA 1ON2A 5E8IA 2LKPA 5K5RA 1FYKA 4IJAA 3MAJA 3GVAA 3KLOA 3MWMA 1HW1A 1WI9A 2ZFWA 1R22A 3WTVC 1O7LA 3DFGA 1V3FA 2QBYA 2VC0A 4AWXB 1UFMA 2V1UA 4A12A 5H6RA 3FWEA 3ABTA 4L9TA 5KVRA 3FHZA 2QM3A 4I02A 1U8RA 4A5NA 1IN6A 3E97A 3QRFF 1JGSA 4UUVA 3LFKA 3LA7A 1T38A 2LDUA 4LD5A 2ZKZA 2W85A 1AOYA 1U5TB 4MQVA 1WKMA 4OIRF 1XGSA 4OMYA 5IT9K 2Z33A 4KMFA 2WWYA 6PAXA 4B09A 4HF2A 2XAJA 2M87A 1ZG1A 2NYXA 1LEBA 4U88A 3I58A 1I5ZA 3F72A 2YX7A 3SHFA 4HX4A 1WRJA 3BWGA 1CF7B 1OR7A 4TV7A 1YFHA 4L9VA 5AIPA 1OKRA 1IF1A 4N9HA 4IHSA 4UVBA 2DW4A 2HKXA 2K86A 3RIRA 1KA8A 4D0PA 2BYVE 4MEYF 4HV6A 2VBZA 1U6GA 1DP7P 4ZH4F 3Q5FA 2ISYA 2IA1A 5HVQC 3S2WA 3TKYA 3G3ZA 3WTYC 2EB7A 1G3YA 2K7LA 1YW8A 4G7ZF 1JHFA 4I2OA 2L4MA 2UWMA 2KRFA 2W24A 3K1MA 1TNSA 2VXZA 3J7AO 1Z6TA 3I64A 2MLKA 3C1DA 2G9WA 4RB3C 1KQ9A 2FNAA 2F5FA 2P7VB 4DNCA 2BEOA 1HW2A 3DEUA 4WXCA 1FLIA 1B59A 3VODA 1LB2A 3JAMK 2VOOA 3HOSA 1W5SA 4ZZDA 2CSOA 3KP6A 3CTAA 5JI6A 4HYEA 1O3SA 3P9KA 1YYVA 4I0AA 1FSEA 2O3FA 2MD5A 3VB2A 1LNWA 4RGUA 1XDSA 2F5DA 1Z7UA 4PGGA 3WTUC 5LLQA 3SFZA 4DQ2A 5DCMA 4HF1A 3ERED 4MNUA 4KMUX 3MQ0A 5LEKA 1J75A 1FSHA 2DLLA 1JXSA 4XSZF 1VTNC 1W7PA 4R79A 4RGXA 3NRVA 2Q8KA 4MQ9F 2FXAA 4MEXF 5J6XA 1OYIA 4Y15A 1O3TA 2FEZA 3CUQC 4HQMA 1XGNA 1WQ2A 3GWZA 2KJCA 4IVNA 1TQMA 1MKMA 5ICFA 3NEUA 3KEQA 4WF2A 4U7DA 3IC7A 2OAZA 3E6CC 1P92A 1I1SA 3ZP5A 4HDVA 2XAFA 3EDPA 3TQNA 3M1EA 1TBXA 2GAUA 3GZ5A 4GYGA 3WE3A 1ZG3A 3EETA 1STZA 2A68F 4BQAA 1O3RA 2MBFA 4G6DA 3BPXA 4AIJA 3IWZA 3SZTA 2VONA 4RAZA 3O2PE 1SD7A 2JTVA 4M71A 4IRGA 4UXNA 5HDGA 4Z2YA 4P9FA 1TQIA 1P4XA 1U3EM 2L01A 2IW5A 4JK1X 5HDKA 4ESBA 3HRSA 5D4RA 1FX7A 3CUQA 1HSJA 2L3DA 3JSPA 3E6DA 2ZO4A 2QQBA 3GZ6A 2RC4A 1S8NA 2YPRA 3R4KA 1OPCA 4M73A 4I98B 2ZCWA 1X3UA 2A3SA 4YFNF 4EGZA 1TW2A 2EFOA 1TLHB 4KYWA 3J80K 2IP2A 4HF0A 4B8XA 5DDGA 3IKTA 3RPQA 4LG0B 2YU3A 1B4AA 4LLGF 3VOEA 2STTA 2A69F 5EEHA 4BHBA 2GWRA 3K2ZA 1YIOA 4ZZLA 5BQTA 4ENKA 4WK8F 3BP8A 1Z05A 2ELHA 5DV5A 3C7JA 2V1DA 1KQ8A 1BN5A 5F1RA 4ENMA 4HV5A 1XD7A 3GEZA 4UHTA 3EQLF 3LQQA 2KIFA 3WE2A 2HTSA 2FSWA 3DXJF 2UXXA 3L2CA 2DPUA 2JSCA 2L02A 4BXUA 4IHTA 5IT3A 1R1TA 3RJPA 1FP1D 4OIPF 2LSOA 1XDUA 3LA3A 1WWXA 1SFXA 2ZXJA 1IN8A 4KN4X 3REOA 1S7AA 4YFKF 2K4BA 3AAFA 1Z1DA 2BBYA 3ECHA 4ZYGA 3F21A 2KIMA 1MD0A 1FNNA 3FM3A 3I53A 3WU1B 3WG9A 3ISPA 1UHMA 3LAJA 3N4MA 1BI0A 4LK1F 4IXAA 1K78B 2PMHA 4R1HA 2Q0OA 3OV8A 2K4JA 3KCCA 5JVTA 2A07F 1BI2A 2DU9A 1K79A 3ZMSA 2PEXA 3E5XA 2WC2A 5D5XB 4IRIA 4L5JA 2EA2A 3IL2A 2XRNA 3RKYA 4QWQA 1QPMA 2CO5A 4EVIA 3GFMA 1EH7A 3BDDA 2DPDA 3KETA 5ILUA 1B9MA 2P5VA 3O6BB 3HYIA 2E1NA 2E7XA 3E6BA 2VODA 5J8CA 3P9CA 3J80Z 2P5LC 3HSFA 1XCVA 5K5QA 4UVAA 4M72A 2P4WA 4AIHA 2JT1A 2PFBA 2P7CB 5JHUA 3KFWX 2GZWA 3WGHA 2M5WA 3SXYA 3R0JA 1BM9A 2OU2A 4G7HF 1FWZA 2XVCA 1KU7A 2A6HF 4WXHA 2X0LA 1F1ZA 1ZGAA 2HOEA 1FBSA 3HTSB 1XMKA 3DPTA 2NNYA 1DDNA 1IAWA 2ACJA 1LVAA 4G6QA 1Z9CA 1ONVA 1O3QA 1IZ1A 5D8LB 3VEPA 2HZTA 2K02A 5DUKA 4YIIA 5K1YA 3F8BA 2FBHA 3RDIA 4UV9A 5FGMA 2OZ6A 2IRFG 3F6OA 3WTSC 1MJBA 2K27A 4A0XA 5HLIA 3PFIA 1SD5A 2OD5A 2ZMEB 5TRDA 2FA5A 2HFHA 3Q9SA 3IRRA 3WGIA 3F23A 1FYMA 3KP5A 1AWCA 1J9IA 3G73A 4ZYEA 5JR3A 1HKSA 4IF4A 1L3LA 5E8GA 5LRSA 1ZLKA 1LDJA 1EH8A 3LAPA 5ICCA 5BPIA 1QQIA 3F6VA 4UV8A 1FPQA 2XAQA 1RZ4A 2DTRA 1GXQA 3BOQA 1U78A 4ASNA 2XHKA 4O5VA 3L7WA 2XKOA 2MH9A 4LGWA 1BIAA 4YG2F 1TQPA 5HLGA 4NQWA 1IXSB 1I6XA 2V6CA 3IKVA 4KN7X 4NB5A 4EJUA 2DQRA 4HOBA 2QBYB 4JQFA 1FC3A 3DKWA 3EYYA 5JFRA 5HS9A 3V7RA 2VT2A 3U9GA 1MZBA 2G7HA 1XN7A 5FFZA 5D6FA 5HS7A 1IW7F 4M6XA 1QO0D 2J5PA 3IHUA 3LQRA 2FQ3A 3P9IA 4KNYA 3TO6A 3VFZA 2EV6A 4NHJA 5DD4A 2HYGD 3I5UA 3ZMVA 2O8XA 1B1BA 3GW2A 1D3YA 2F5CA 4RB0A 5BMZA 3E5UA 2VBXA 2O03A 5HDNA 1T0FA 2L4AA 4PGHA 1IN7A 2WV0A 3W6JB 3F8MA 3KZZA 3D0SA 4OIQF 3MFKA 4S05A 1RNLA 1YW9A 2E7WA 2V1XA 1KGSA 1XGOA 2OQRA 4BH9A 1S29A 1Z91A 1OMIA 3L00A 3FXRA 2BGCA 2EFQA 2OA4A 1R7JA 1EV7A 3R6SA 4LFUA 2EJRA 5D6EA 2O0YA 3T8RA 2JRTA 5BPDA 3HOTA 3QPHA 4I0BA 4LLLA 2DO7A 2YSRA 2V79A 5E17F 1HKTA 1IN4A 2GA2A 2ESNA 3GXOA 2FMYA 1ZAOA 3F22A 4PDKA 3OOPA 2W25A 5ED4A 4EQQA 1I27A 4YFXF 3KLNA 1RUOA 2PG4A 1J0RA 5IT9Z 2VE9A 5ICGA 3R61A 4MHGA 3ULQB 4M74A 3BY6A 4AIKA 1UB9A 4KFCA 4HX8A 2X4HA 3TGNA 1G3SA 3M7GA 4Y13A 4LB5A 4CXFA 4ZYDA 2HTJA 4JBAA 1LQ1A 1XB4A 2LF7A 1R1UA 4A6EA 2GIVA 3GUDA 5ILSA 4KIGA 2MC3A 4RB1A 3DPLC 2F2EA 2V9VA 2CG4A 3F8CA 5DCMB 2W57A 2VOPA 2H27A 1QGPA 1DPRA 2DFIA 2FMLA 3T8TA 1HKQA 2FU4A 2XUBA 1ZHFA 5LHIA 2RDPA 3GYHX 5ILVA 3QP6A 5CVIA 1W7PB 1F5TA 3SQNA 4ESJA 1TTYA 2R7FA 2PN6A 3WTWC 2PLYA 4KIFA 3F3XA 1BI1A 1EH6A 2H6BA 3K69A 3E5QA 3LWFA 3I59A 4RB2C 3ABUA 3HIFA 2HDCA 2W84A 2M30A 1SD4A 4G8XA 1J59A 4HW0A 3JAMZ 3KP2A 3H3ZA 3GF2A 4EJWA 2PBIA 4EV0A 4S04A 1SMYF 3E3VA 2D2WA 4RAYA 4F7ZA 2CYYA 3FZVA 2IT0A 4KUMA 2HS5A 3L09A 1SFEA 1L0OC 3QPTA 4HQEA 2QZ8A 2IJLA 1C0WA 1ZGJA 2QWWA 3BPVA 5L3FA 1S7OA 3K1NA 5CYVA 2Y75A 2B0LA 1S6LA 3M9AA 4M6YA 1BC7C 2CQKA 4Q4ZF 4AVPA 2XAGA 1CGPA 3CDHA 3CUQB 3TDZC 2QQ9A 4R8HA 3I4PA 3V4GA 3GFIA 1BBYA 5F6FA 1PP7U 1P6RA 4L5IA 5CJ9A 1REPC 4ESFA 2M8EA 1PUEE 3FF5A 1JE8A 1KQ0A 2YX4A 2DBBA 3MCZA 3HSRA 2EV0A 1ULYA 1FZPB 5L3EA 3EYIA 2JZYA 5KK1A 3V8JA 5H6QA 3LSTA 3CLOA 2BV6A 1GHCA 5D5VB 2NS0A 4RGRA 3FXUA 1D5VA 2HQRA 2VBWA 1LJ9A 2KJBA 5AONA 2HWVA 2MLGA 1ZG5A 3I71A 1H9TA 3IRQA 1R23A 1UHWA 1H0MA 4RS8A 1TNTA 1YS6A 4L0ZB 4I01A 4L9JA 5DEQA 3O3KA 1R5GA 5CVRA 3ML6A 2VN2A 1RIOH 2HKOA 2PI0A 4GCVA 1BOAA 1MDMA 4CICA 3C18A 5CLSA 3RTRA 3I54A 3GO5A 2YR2A 5EEGA 3F8NA 3GLXA 5L3BA 1P4AA 3WTXC 1J5YA 1SFUA 2J5OA 4AD9A 2HGCA 4ENNA 3DP7A 1LDKB 3V7SA 2RVCA 3M8FA 2JPBA 2Z9OA 2HEOA 5F64A 1KYWA 1Z6RA 4M9SA 2AXLA 2H09A 3GFLA 3RI4A 3T5XA 5FO5A 2CGPA 1XSXA 3HUGA 5ERIA 1SD6A 2FRHA 2OBPA 2IA2A 3TOBA 4WXDA 3D5LA 5HLHA 1TW3A 2RKHA 3HRUA 4H0EA 1ZREA 2FBKA 4Q47A 3DF8A 4GYIA 3WTTC 2ESHA 5BS6A 2CW0F 2WTEA 2ISZA 3BJAA 3GX4X 1F4KA 1I1GA 5K5OA 1KU9A 3MZHA 1GXPA 2O61A 4L9NA 3RKWA 3LA2A 2D45A 4N9IA 5LGNA 2RGVA 2ZNZA 5DD8A 1ZRFA 3PQKA 3WU0A 1NHAA 3V7CA 1R36A 1LEAA 1V4RA 1IXRC 1B9NA 4I7HA 2NRAC 3ZN0A 3ZMUA 1MDMB 1ODDA 1P4WA 4O6JA 4KDPA 3V8LA 4EM0B 4EMSA 4A6DA 4OINF 2IA0A 4N0BA 3IWFA 3ZQ7A 4XRFA 3QP5A 3DQVC 1OYYA 4QLCU 1FP2A 1XSVA 2DK8A 3KZYA 3I0TA 1WSUA 4HBLA 5HOOA 2LNBA 1R5HA 1MGTA 3BZ6A 1XGMA 4CZZA 1QZYA 2Z3YA 4I09A 3GFJA 2IPQX 2HR3A 4HDUA 2QLZA 2P5KA 2EFNA 3ROUA 3T1BA 1IRFA 2MH2A 3ELKA 1YQAA 4UVCA 5FD6A 1BIBA 2VBYA 5AIQA 2EWNA 2P6TA 1K7AA 1BI3A 4GGGA 3COAC 3TOAA 2PMUA 2RN7A 5A2QK 2XROA 1ZLJA 2OQGA 4ZYHA 1LDDA 1DPUA 2E1CA 3HSEA 1XMAA 1YG2A 1QZZA 2ADUA 4U7BA 2BE5F 4IPAA 1HBXG 4G94A 5CVJA 4LMYA 1G6NA 2H94A 1T6SA 2DI3A 4EJOA 2GQQA 2XASA 1UCRA 1YTYA 2Y48A 1U2WA 1GVJA 1E17A 4LB6B 1R58A 1T39A 1HW5A 1FYLA 2R7DA 4P55A 4BHCA 3J81K 5L3GA 3F8FA 3HRTA 2GXGA 2O6GE 2CFXA 1ZN2A 1F9NA 3CO7C 5FD5A 2QENA 1QBJA 2ZJ2A 2XGXA 3CJNA 1Q1HA 3BROA 2VT3A 3KP4A 4PZJA 2H6CA 3ZMTA 4GO1A 3BJ6A 4Q5SF 2FE3A 2D1HA 1ON1A 4G9YA 1K6OA 3DV8A 2NNNA 3SZPA 2D1VA 4ETSA 3CUOA 3KP3A 1YLFA 5TJJA 3T0YA 2QQAA 4BAYA 4XBFA 2GA1A 1O7FA 4HAMA 3JTGA 4P96A 4A0YA 1YO5C 4RGSA 3FXQA 3QU3A 2HYFA 1S3JA 3V8KA 3K1PA 3JTHA 2GXBA 5FFXA 1A04A 1PDNC 1IN5A 1P2FA 4HZFA 1FT9A 2EFPA 4HX7A 4EGYA 2VC1A 4KA4A 5E1WA 3P7NA 2L54A 4U0WA 2PQ8A 1H9GA 2Z99A 4WX9A 1JHHA 1ZRDA 4G7OF 4P9UA 4ENJA 2PJPA 1BJAA 4M9XA 3KEOA 4ON0A 1KU2A 4L18B 4FHTA 2XIGA 4XLNF 3QOPA 1ZYRF 5LEJA 1W5TA 5A2QZ 2ZBKA 4BNCA 4LG0A 1FBUA 3QU6A 5LGTA 5LHHA 4EJTA 2MA3A 3RYPA 4KICA 4IRHA 5DCFA 1ZRCA 1ZARA 1G3WA 3HHGA 2Z5UA 2A5YB 4A0ZA 2QYOA 3U1DA 1USTA 4O3MA 3HRMA 1BC8C 3JSOA 3RYRA 4CGZA 2Q2EA 4OMZA 3J81Z 2XV4S 5FLXK 2LF8A 5L3DA 2DT5A 2XAHA 5LRRA 4MTDA 1FBQA 4E70A 2UZKA 1D8KA 2XKPA 2DAOA 3KP7A 3ZMZA 5D5WB 3HHHA 5E18F 5CVVA 2QVOA 4HLXA 1R1VA 2FOKA 2FNPA 1B6AA 1RI7A 5L3CA 4Q48A 4U0YA 2CWEA 1Y0UA 2EK5A 5LGUA 3RPUA 2M45A 3FM5A 5FB2A 1FY7A 1T98A 1MJ9A 3FMSA 1IXCA 1USSA 2RV8A 4OU0A 2TDXA 4EJVA 2NAZA 1K78A 4UNOA 4A2UA 5HS8A 4LLNA 4HA8A 2FF4A 3WTZA 1J7KA 3FMQA 3H92A 4MTEA 1SMTA 1ZH5A 3KE2A 3TO7A 2KIUA 3I59B 4KIBA 1RUNA 1HXDA 2ZNYA 5D4SA 2IVMA 4FT8A 3K0LA 5DUIA 3MEXA 4CO8A 2OZUA 4LJZF 3TDUC 4CHUA 4FX4A 5J8FA 3K9TA 3ZPLA 2COMA 5CVUA 1OYWA 3FX3A 2C6YA 1XCBA 1KU3A 3M8EA 3C3WA 3R0AA 3W6KB 3ECOA 4EM1A 1G3TA 1PP8F 3MZYA 3EUHA 2EFWA 2F5EA 1HQCA 4P5OA 1U5TC 4CDGA 2DQLA 1O57A 5D8KB 4U0VA 3Q9VA 1QNTA 2EA4A 4BYYA 5LBQA 2UXNA 2Y0MA 4L0YB 2ETHA 4YIFA 4XSXF 4HLYA 2AS5F 2G7UA 5E1ZB 4WCGA 3CO6C 5D5UB 1W7PD 3B02A 3B73A 4GXOA 4LK0F 1YS7A 2M1BA 3QAHA 3R60A 2DK5A 4BHPA 4K2EA 1YW7A 1W4MA 2P8TA 4MGRA 1IUYA 3RKXA 3N97A 1IRGA 5H20A 4OOIA 5LHGA 4PCQA 1KYZA 4M9ZA 1DUXC 2P6SA 4OIOF 4XLPF 3BJOA 5DYMA 5FLXZ 1J2XA 3NQOA 1T2KA 1FOKA 2EV5A 1XSDA 2VE8A 2ZMEA 3ZN1A 3E6MA 2A61A 5E1XA 3FMRA 1HSTA 4KT5C 1U5TA 2A6EF 2HQNA 3PQJA 3U2RA 5BOXA 1MJAA
chains in the Genus database with same CATH superfamily
3HOXJ 2KKOA 2RNJA 5ICEA 5E20A 4A5MA 2R3SA 3WGGA 2KISA 4EM2A 2CUEA 4Y17A 5IYBJ 2E35A 1DU6A 1PVEA 2QUFA 3HTUA 1N75A 2ECBA 3ZMDA 3H3UA 1N78A 4CYDA 3CJRB 1FIAA 2JPCA 3H9QA 2STWA 2FBIA 3TO9A 3J7YJ 5J40A 1SAXA 2RQPA 3JW4A 4FX0A 3WODF 1BR1A 1K83J 4A3FJ 2CQQA 2K5CA 4WWCA 3KYCB 4D9JA 2DOAA 3VYUB 1D8JA 2B63J 3L9FA 1E2XA 3BR6A 1R00A 1X2NA 3LNQA 3CCJI 1MMSA 2KT0A 2IGNA 1CF7A 3PNVA 1ON2A 1G4DA 4BACA 5E8IA 2LKPA 5K5RA 2VPRA 1FYKA 4G12A 1V54H 4IJAA 5DS9A 3OYGA 3MAJA 3GVAA 1OR7C 4U87A 3KLOA 3MWMA 1HW1A 1WI9A 2ZFWA 1RKWA 2QCOA 1XMXA 1R22A 1NH3A 3WTVC 1O7LA 3DFGA 1V3FA 2L9VA 2QBYA 1Y8RB 2VC0A 2M7BA 4AWXB 1TT0A 1UFMA 4A3EJ 2V1UA 4A12A 5H6RA 3FWEA 3ABTA 4L9TA 5KVRA 5KCMA 1PUFB 3FHZA 2GM4A 4DBRA 5FRMA 1Z77A 2QM3A 4I02A 2QKMB 1U8RA 4A5NA 1IN6A 1RC9A 3E97A 3M1CA 4F92B 1QA6A 2KQRA 2LC2A 3OYJA 3QRFF 1IV6A 1JGSA 3ABKH 2E2IJ 4UUVA 3LFKA 3LA7A 4PJMA 2L7KA 1T38A 2LDUA 4F52A 3HUGB 1XTAA 3CCRI 4LD5A 5F0HA 4XKCA 2ZKZA 4BXFA 2W85A 1AOYA 4A3MJ 1B72B 1U5TB 3D5SC 4MQVA 4XRMA 1WKMA 4OIRF 2OUMA 1XGSA 2DTZA 4OMYA 5IT9K 2Z33A 2IS1A 4KMFA 2WWYA 3SYTA 3MVPA 6PAXA 1VF9A 4BS9A 4B09A 1R4NB 2M4GA 4HF2A 2NOJB 2XAJA 4PFPA 2M87A 3A4CA 3ZGKA 5B66C 1D1CA 1ZG1A 2NYXA 1LEBA 4U88A 2VUMJ 3PO2J 2BXZA 2BVMA 3I58A 3CCMI 1I5ZA 3F72A 2YX7A 4C3IJ 2ELKA 4UUTA 3SHFA 4HX4A 1WRJA 3BWGA 1CF7B 1OR7A 1TWCJ 4TV7A 1YFHA 3DTEA 4BE1A 3BR0A 3KIOA 2N8GA 4L9VA 3QYBA 2F6CA 4XOPA 5AIPA 1OKRA 1IF1A 4N9HA 4IHSA 3TEDA 4NDLA 4UVBA 2DW4A 2HKXA 2K86A 3RIRA 1KA8A 1ZKGA 4D0PA 3G6EI 2BYVE 2Y31A 4AU7A 4MEYF 3OYBA 4HV6A 2VBZA 1U6GA 2OCEA 1VZ0A 1YX5A 4ZH4F 2QA4I 1DP7P 3Q5FA 3FXJA 2ISYA 2IA1A 4M6VA 2JA2A 3ZR8X 2VJ5A 2HDWA 5HVQC 3S2WA 3OS1A 1VFCA 1IC8A 2CV0A 3TKYA 3G3ZA 1MMGA 5HNHA 3WTYC 2EB7A 1G3YA 3GTQJ 1SANA 2K7LA 1YW8A 4G7ZF 4BBSJ 1JHFA 4I2OA 2L4MA 1QPIA 2UWMA 1IO2A 2KRFA 4DW6A 2W24A 5JLWA 3K1MA 1OLTA 3IH3A 3BZCA 3OYAA 1MSEC 1TNSA 2VXZA 3J7AO 1Z6TA 3I64A 2R7SA 2MLKA 3IUOA 2CV2A 2XC7A 4HSRA 3C1DA 2G9WA 4RB3C 1KQ9A 1V55H 2FNAA 2HZDA 2R5YA 2F5FA 2P7VB 1HLVA 3J7AY 1NG6A 4DNCA 2BEOA 5F04A 1HW2A 3DEUA 3CCSI 2HXOA 2MABA 4M3FA 4WXCA 1FLIA 2I10A 3H0DA 3KX2A 3WU2C 2M0CA 1RKTA 1B59A 1G2HA 3VODA 1LB2A 3JAMK 2VOOA 3HOSA 2FX0A 1W5SA 2DA5A 3FXOA 4ZZDA 2CSOA 3KP6A 1YOVB 3CTAA 1R6RA 5JI6A 2WB1N 5EZHA 3S16J 3OR1C 4HYEA 4DIQA 1O3SA 3P9KA 4D7NA 1YYVA 4I0AA 1AA7A 3HXLA 2R7XA 3GTGJ 2DMTA 3UKGA 3TMOA 4ITVA 4BXXJ 1FSEA 2E36A 2O3FA 3ZQHA 5K7FA 2MD5A 3VB2A 1LNWA 4RGUA 4DGWB 1QU3A 3LMMA 1UZCA 3ZQGA 1XC5A 3JRAA 4ZDOA 1XDSA 3GLLA 2F5DA 1Z7UA 4UY8I 4PGGA 3WTUC 3BG9A 3GTLJ 4PSXA 5LLQA 2H1KA 1JTXA 3SFZA 4DQ2A 1T56A 1JKRC 5DCMA 2K9LA 5KHDA 2LTPA 1LPQA 4ABZA 4HF1A 3B6CA 3ERED 4MNUA 4KMUX 1QHHD 3MQ0A 1BW5A 1QHGA 5LEKA 4BL0B 1J75A 1FSHA 1Y1VJ 2JQ7A 2DLLA 1JXSA 4XSZF 1VTNC 1ENHA 3K4JA 1W7PA 2X6XA 4R79A 1IV8A 3BR1A 2NXNB 4RGXA 1B8IB 2Y0SA 1ETVA 1ETWA 2DN0A 1U9NA 3NRVA 2M4KA 2Q8KA 4MQ9F 3S1MJ 2FXAA 2DOEA 2WAQA 2AQFA 4GRIA 3M8JA 1BA5A 4MEXF 3BG6A 1YX3A 2E1MB 3SDBA 1ERDA 5J6XA 1OYIA 4Y15A 3TBIA 4M3DA 5M3FJ 1O3TA 4GDFA 2FEZA 1POGA 4BQNA 3CUQC 4DYRA 4HQMA 1XGNA 2L0KA 1WQ2A 3GWZA 2KJCA 3K7AJ 2HOAA 3VDXA 1HDPA 4IVNA 1VQ4I 1TQMA 1MKMA 2R5YB 1U9OA 3DEEA 5ICFA 3NEUA 3KEQA 4WF2A 3S1QJ 2M7AA 4U7DA 5B5EC 3ABLH 3IC7A 2OAZA 3E6CC 1P92A 1I1SA 3ZP5A 5GPAA 4HDVA 5K7ZA 2JRMA 2XAFA 1OJLA 3GTKJ 1TWAJ 3EDPA 3TQNA 3M1EA 1TBXA 2GAUA 1JUMA 3GZ5A 4P1WA 2EZLA 4GYGA 3ZQIA 2K9QA 3WE3A 1ZG3A 2RQQA 5GPCA 3EETA 1STZA 4PK4A 4D1QA 4Y33A 2A68F 1WI3A 2E60A 4BQAA 1O3RA 2MBFA 4G6DA 3BPXA 4AIJA 3IWZA 3SZTA 2VONA 4RAZA 2F4IA 2HPIA 3O2PE 1SD7A 4PJNA 2JTVA 5C44J 4M71A 4IRGA 4UXNA 5HDGA 4Z2YA 4P9FA 1TQIA 3K4BA 1J09A 1P4XA 4EEFG 1U3EM 5EG0A 2L01A 2IW5A 4PJ0C 3OMYA 3LOCA 2PJRA 2EIJH 4JK1X 5C4JJ 4M3BA 1G59A 3CJQB 5GAHJ 5HDKA 4ESBA 3HRSA 5D4RA 2CFOA 2DODA 4XOTA 4XMYA 1FX7A 3CUQA 1N25A 1HSJA 1FMVA 3SEQA 2L3DA 3JSPA 3E6DA 2ZO4A 1VQNI 4LITA 4PSWA 2E5NA 2ZJPF 2QQBA 3GZ6A 2COBA 2RC4A 1S8NA 2YPRA 3AG1H 3R4KA 3JR9A 1OPCA 1YI2I 4M73A 4I98B 2ZCWA 3ZRGA 4BQOA 1X3UA 2A3SA 3IP4B 5M5XJ 1ETYA 4YFNF 4EGZA 1TW2A 3L2WA 4MLOA 3DKXA 1T8IA 4XKVA 3CC4I 5IY5H 1X19A 1TLHB 2EFOA 4XLCA 4KYWA 5IP6A 3J80K 2IP2A 4HF0A 1IRXA 5EDNA 1H89C 3S17J 2HYJA 4B8XA 5DDGA 3JRBA 3CMYA 3IKTA 1Y0NA 1YITI 3RPQA 4LG0B 2YU3A 1B4AA 1WJDA 4LLGF 2MG4A 3VOEA 2LOOA 2K3PA 2STTA 1A6IA 2A69F 3AG3H 5EEHA 4BHBA 2B9SA 4IHWA 2GWRA 5KAFC 3K2ZA 1YIOA 4ZZLA 1NG7A 3QOEA 5BQTA 4ENKA 4B47A 2K9MA 4WK8F 3BP8A 1Z05A 2GBYA 4RM2A 2ELHA 5DV5A 4F3QA 3C7JA 2V1DA 4V2FA 4J01A 1KQ8A 3F9KA 3FXMA 1BN5A 2JMWA 5F1RA 4ENMA 4HV5A 2HI3A 3BR5A 3TL4X 2AHQA 2DA2A 1AKHB 5EG0B 3OS2A 1XD7A 3GEZA 4E7ZA 4UHTA 3PUFA 1RETA 4RAFA 3EQLF 3LQQA 4UB8C 2KIFA 4JX6A 3WE2A 1T95A 2QKLB 2HTSA 2H8RA 2FSWA 2Q2EB 1A6QA 1OFCX 3DXJF 4CCJA 1E3PA 2UXXA 3L2CA 5J4VA 2DPUA 3GMEA 2JSCA 1Q1VA 2HNHA 2CRGA 2L02A 3RCOA 4D5FA 4BXUA 3G4SI 1MIJA 4IHTA 1YE9A 2Y2ZA 5IT3A 3W6VA 1T08B 1R1TA 2L9RA 3RJPA 1FP1D 3PL8A 2YS9A 5GP9A 5EGOA 2WADA 1R5ID 5J4YA 2JA5J 2R7VA 3NARA 4OIPF 1PJRA 2DMPA 3CCUI 4CCKA 2LSOA 3A01B 4B43A 1XDUA 2HOSA 3LA3A 1WWXA 2X1DA 1SFXA 4N4NB 2MSYA 1VI0A 1IN8A 2ZXJA 4KN4X 3REOA 3JRFA 1W5CC 2BW3A 1S7AA 1UHSA 4YFKF 4X6AJ 2K4BA 3DLAA 4RDUA 3AAFA 1Z1DA 2BBYA 3ECHA 4BEHA 4ZYAA 4NUBA 4ZYGA 3F21A 2R93J 3FK6A 3FDYA 2EH3A 2KIMA 1MD0A 5B3SH 4W1UA 5FKKA 1FNNA 3PM1A 5JLXA 3FM3A 3I53A 2ECCA 3WU1B 4C2UA 3WG9A 3ISPA 1UMQA 1UHMA 3LAJA 4B3XA 1WH5A 1EF4A 4IL6C 3JRHA 1MSFC 3DBLB 3N4MA 1BI0A 1Z0XA 4IXAA 4LK1F 2E1OA 4XIDA 2DJNA 2LP0A 3CQZJ 3QODA 1K78B 2PMHA 1MMAA 2R7WA 4R1HA 2Q0OA 5EEAA 4D5CA 3OV8A 2K4JA 3KCCA 1MMNA 2CW8A 4B3AA 5JVTA 2A07F 1BI2A 3GCMA 2V6EA 2DU9A 1K79A 3ZMSA 2L7ZA 3CDLA 1VNDA 2PEXA 2ZXHA 3E5XA 2WC2A 5D5XB 4IRIA 4L5JA 1SVLA 1BR4A 2EA2A 3IL2A 3LSGA 1A5JA 4XN3A 3OSGA 2XRNA 3RKYA 4QWQA 2BHYA 1QPMA 2CO5A 3D5RC 2CQ7A 1XPXA 4EVIA 1E0EA 3GFMA 2EBIA 1EH7A 3BDDA 2DPDA 1QZEA 2LFBA 1MH3A 3KETA 3ZQCA 1Z3XA 3EPZA 3Q0UA 5ILUA 1DGWY 3VYTB 2KRHA 2W82A 4RLQA 1B9MA 2P5VA 1QRYA 2XGDA 1I6HJ 1AU7A 4X0GA 2PMZA 3O6BB 4E7HA 3HYIA 3OWTA 2E1NA 2E7XA 2E19A 2R7TA 2EZHA 5K7HA 3K4LA 3E6BA 2L7MP 1X1AA 5J8CA 2VODA 1Y8QB 4LIUA 3I4NJ 1ETKA 3P9CA 2WA0A 3J80Z 2P5LC 2WAFA 4A3GJ 3HSFA 1XCVA 1JKQC 4XLAA 5K5QA 3VSKA 4N4OB 4UVAA 1IGNA 4BEHB 4M72A 2P4WA 4AIHA 4BJ5C 2JT1A 3KYDB 2PFBA 3BTJA 2P7CB 1IUFA 2I5UA 4II3A 5JHUA 3KFWX 2ME0A 1I3QJ 2O5RA 2VI6A 5JHFA 2GZWA 3JRGA 3WGHA 2M5WA 2R0QC 3H5RA 3OSFA 1XS9A 3SXYA 3R0JA 1BM9A 2OU2A 4G7HF 2XF6A 4XONA 1FWZA 2XVCA 1KU7A 3PNTA 1OCCH 2KIQA 2A6HF 4WXHA 2X0LA 1F1ZA 1ZGAA 5IP7J 2HOEA 4KISA 2GXAA 3HOUJ 1HA8A 1FBSA 1ZTRA 3HTSB 1XMKA 4DYCA 3DPTA 2KFDA 2NNYA 1DDNA 4BGDA 2FUG2 1IAWA 5DM6F 1NK3P 2ACJA 1LVAA 3FXLA 3FISA 4G6QA 2LBFB 1ONVA 1Z9CA 1JUSA 4C2TA 1O3QA 1BL0A 1IZ1A 1SVMA 5D8LB 4E7SA 3N05A 3VEPA 3G2BA 1WPKA 2ZXIA 1VQKI 2HZTA 3FK7A 2JVGA 2K02A 1SFKA 1QVUA 2VXDA 3AFHA 4JOMA 3Q3SA 1LE8A 3A2KA 5DUKA 4A3KJ 3W3CA 2IEKA 4YIIA 3S3MA 5GAEJ 5K1YA 3F8BA 3LSJA 3M3YJ 2FBHA 3RDIA 2R7QA 3OYFA 1JJ6C 4UV9A 5FGMA 3K70D 2OZ6A 2IRFG 2QSFX 3WG7H 3F6OA 5FKOA 3RSNA 3WTSC 2WBMA 4MFDA 1MJBA 3DWLE 2K27A 4A0XA 3G71I 1GLNA 2XSDC 1APLC 5HLIA 3PFIA 1SD5A 4HSTA 3DBRB 3K2AA 4RBOA 2OD5A 2VLAA 2ZMEB 5TRDA 2M8GX 2FA5A 2HFHA 3EUAA 3Q9SA 3WGIA 3IRRA 2V1NA 3KP5A 3F23A 1FYMA 1AWCA 1J9IA 3G73A 4ZYEA 5JR3A 3MKYB 1HKSA 4IF4A 2IS2A 2LKXA 3FIWA 5JVGF 1L3LA 2IGMA 3MN2A 5E8GA 5LRSA 2BZTA 1ZLKA 2LKSA 2V9KA 1LDJA 1EH8A 3LAPA 4KITB 4LOCA 5EYRA 3MZ8A 5ICCA 5BPIA 1QQIA 1OCZH 4CYCA 2QSGX 1NTCA 3F6VA 2HXIA 4UV8A 5F0CA 1XX5A 1FPQA 3ZCOA 2HU9A 3MD2A 2XAQA 1RZ4A 3BG5A 2DTRA 1X2MA 2DMNA 1GXQA 1T0FC 1S5LC 3BOQA 1U78A 2LY2A 4ASNA 2XHKA 2R7RA 3OYNA 4O5VA 3RPUD 2R7ZJ 3SEZA 3CMEI 2XF5A 1OQYA 3L7WA 1YJWI 2XKOA 4HEA2 1A35A 4ZDPA 4I76A 3GZNB 2F4OB 2MH9A 4LGWA 1BIAA 2Q1ZB 4YG2F 4UUSA 1TQPA 1QVTA 3JRIA 5HLGA 4NQWA 5LD2C 2FJ1A 3NAUA 1IXSB 1I6XA 4XLEA 3L1PA 2V6CA 3IKVA 4KN7X 4NB5A 3MMYB 3PNYA 4EJUA 2DQRA 4HOBA 2QBYB 2CW7A 4JQFA 1FC3A 1ZR2A 4IOCF 2E34A 2EIKH 3DKWA 1JUPA 2XRLA 3EYYA 3TW7A 2LMDA 3DKYA 5F27A 5JFRA 2X6WA 2VKDA 2KDOA 5HS9A 3V7RA 2VT2A 3U9GA 1MZBA 2G7HA 1XN7A 2CH0A 5FFZA 5D6FA 5HS7A 1WVRA 4DYQA 2K9SA 3IV5A 1IW7F 2DT7B 4M6XA 1QO0D 2J5PA 1W36C 3GTPJ 3IHUA 3LQRA 3ZQFA 1I3AA 1VQ7I 3E0JB 3H9JA 2FQ3A 3P9IA 4KNYA 3Q0WA 3ZXSA 5KNLA 3TO6A 3VFZA 2EV6A 3L2VA 2AO9A 4NHJA 5DD4A 2HYGD 2DA3A 3I5UA 3ZMVA 5E3OA 2O8XA 1B1BA 3GW2A 1BOBA 2WB1A 3A0BC 1JKOC 1D3YA 5J47A 2F5CA 4RB0A 1NK2P 2EINH 5BMZA 3E5UA 2VBXA 2O03A 2QSHX 2LVSA 5HDNA 3GBGA 1T0FA 2L4AA 4XLHA 4AYBA 4PGHA 2MW8A 1IN7A 2FD5A 2WV0A 3W6JB 1G8XA 3F8MA 2EZIA 3KZZA 3D0SA 2LRDA 4A3LJ 3CCQI 1D5YA 4OIQF 4RLFA 4Y52J 3MFKA 4MFEA 4S05A 5FKLA 1RNLA 1YW9A 2E7WA 4J19A 2V1XA 2F4MB 1KGSA 3AL0C 2JUGA 4UUSB 2ZSIB 1XGOA 2OQRA 4BH9A 1S29A 1Z91A 3GTOJ 1OMIA 3L00A 4BY1J 1X1BA 3NWSA 3HKZA 3I55I 3FXRA 2BGCA 2EFQA 2NS7A 3B6AA 2OA4A 1WFXA 2VJIA 1H8AC 3OYMA 1R7JA 3LSMA 1F36A 2NVYJ 1EV7A 1WJCA 4C30A 1D1BA 3R6SA 3RKQA 3AKZA 2BY0A 4LFUA 1W1WE 2EJRA 5D6EA 5CPRB 2O0YA 2JK3A 3T8RA 1K6YA 2JRTA 4AC0A 5BPDA 2E2HJ 3HOTA 2F5VA 3HBLA 3QPHA 4I0BA 4LLLA 4LG3A 4NC7A 3RQIA 2DO7A 3DEWA 2YSRA 2V79A 5E17F 3DU6A 1HKTA 1IN4A 4HNTA 2GA2A 3OYEA 3CMAI 3LSPA 2ESNA 2XPWA 2FMYA 3GXOA 4A69C 1ZAOA 1WJBA 3A03A 4PDKA 4CZCA 3F22A 2DXIA 3OOPA 2W25A 1S9HA 2R5ZA 3HDDA 5ED4A 5IYCJ 4EQQA 2DA6A 4PUSA 2V4JC 2DA1A 3JRCA 1I27A 4IHYA 4YFXF 3KLNA 1RUOA 2AXTC 2JA6J 2PG4A 1J0RA 5IT9Z 4A3DJ 2CMPA 2VE9A 4MHGA 3R61A 3ULQB 5ICGA 1IRZA 1JI8A 2VIXA 4M74A 3BY6A 4AIKA 1UB9A 3HPHA 4NC8A 1Y6IA 2LYCA 2BY2A 4KFCA 3H0GJ 4HX8A 1GUUA 4RA2A 5EF6A 4IO9F 2X4HA 2DMUA 3WHCA 1HCRA 3TGNA 1G3SA 3BTLA 3LSRA 4HNVA 3M7GA 4Y4RA 4Y13A 5F1JA 4LB5A 4CXFA 4ZYDA 2LY9A 2V7FA 3CCEI 2HTJA 4JBAA 5GAGJ 1LQ1A 1XB4A 2LF7A 1R1UA 4A6EA 2GIVA 3GUDA 5ILSA 4KIGA 2MC3A 4E7LA 4RB1A 2DJIA 1V5EA 3DPLC 2F2EA 4J00A 2V9VA 2CG4A 3F8CA 2Y69H 3S93A 4RMNA 5DCMB 1FTZA 2W57A 2VOPA 1X3WB 2H27A 2DA7A 1QGPA 1DPRA 3HZJA 2DFIA 3IH4A 2FMLA 4FETA 3T8TA 1HKQA 2FU4A 2XUBA 4FE7A 4AM3A 1ZHFA 2V26A 4NNJA 5LHIA 2EILH 2RDPA 3HEFA 2NVUB 5ILVA 3GYHX 3QP6A 5CVIA 1IJWC 4LIVA 4BQQA 2VJJA 4C3HJ 3SFIA 1W7PB 1F5TA 4XM3A 3SQNA 4ESJA 3S15J 2XGCA 2EQRA 4BJ6C 1TTYA 2F48A 2R7FA 5M5WJ 1ZK8A 2R7OA 2PN6A 2KL4A 3BR2A 1S72I 2KMUA 1JKPC 3H1CA 3WTWC 2PLYA 2CQXA 4HRIA 2M0MA 3HOZJ 4KIFA 2E5ZA 1I50J 1RR8C 5HLTA 1WJ5A 3F3XA 3V42A 1BI1A 1HDDC 1EH6A 1JJ8C 2JSPA 2H6BA 2W48A 2W1OA 1OCRH 3K69A 3E5QA 3M07A 3HL2A 2R5ZB 4B4CA 3LWFA 3I59A 4RB2C 3ABUA 3CF5F 3HIFA 2HDCA 2Z16A 3SDGA 2X1CA 5IOYA 4C2MJ 4CCLA 2W84A 2M30A 1SD4A 4AIDA 3IAS2 3HB9A 4G8XA 1J59A 4HW0A 4QPQA 3H35A 2X6YA 3OR2C 4E6KG 4ZTFA 1BR2A 2KP6A 3JAMZ 1LVKA 1MBGA 3KP2A 4ZC3A 3H3ZA 1U8BA 3IAM2 3GF2A 4FCYA 2IXSA 3O8GA 2GOMA 1MBHA 5IPAA 1WHUA 4EJWA 4HG2A 2PBIA 1TWFJ 3S14J 4EV0A 4S04A 1X58A 1FOWA 3TW6A 2HOTA 3S1NJ 1SMYF 3E3VA 3OYCA 2D2WA 4RAYA 4F7ZA 2CYYA 3FZVA 2IT0A 4KUMA 1EA3A 1TP4A 2NVXJ 3SZGA 3W2VA 2HS5A 3L09A 5EJCA 1SFEA 1L0OC 3QPTA 4HQEA 2QZ8A 2IJLA 3K4CA 4XRSA 1TL8A 3OY9A 1C0WA 2UUZA 1ZGJA 1EKEA 2QWWA 3L2QA 2IS4A 3BPVA 5L3FA 2LREA 2CV1A 3VWBA 2M34A 2XDVA 4BJTA 2NVTJ 1S7OA 1VQ9I 3K1NA 2OTLI 4M3EA 4W97A 5CYVA 1K4SA 2PJRB 2Y75A 5J1UA 4PFOA 2B0LA 4L5EA 1S6LA 3M9AA 3FKIJ 4C3JJ 4XN0A 4HPQA 4M6YA 1W0UA 1BC7C 2V9PA 2CQKA 4Q4ZF 4AVPA 1LFUP 2XAGA 2HVRA 1CGPA 3CDHA 3CUQB 3TDZC 2QQ9A 4R8HA 3I4PA 4OWRB 2WV1A 3V4GA 3FKJA 3GFIA 1BBYA 5F6FA 1PP7U 1P6RA 4L5IA 5CJ9A 1REPC 4ESFA 1VQ5I 1FTTA 2M8EA 3S3NA 1PUEE 2Z1DA 1SAUA 3FF5A 3OL4A 4IQ4A 1JE8A 1KQ0A 2YX4A 5M5YJ 2DBBA 2TRTA 4YEJA 5LFAA 2X9DA 4XR6A 3MCZA 4ZJZA 3HSRA 2NOGA 2EV0A 2I8DA 1ULYA 1FZPB 5L3EA 3EYIA 2AQEA 2JZYA 4Y7NJ 4Y3OA 5KK1A 3V8JA 5H6QA 2JA7J 4XQFA 3LSTA 1D0ZA 3CLOA 2BV6A 3CD6I 1GHCA 5D5VB 2NS0A 1MMDA 4IHXA 2G0EA 4RGRA 3VSLA 3FXUA 3KYLA 3I4MJ 2DOFA 4H4KC 2XPUA 3DPUA 4BE0A 1D5VA 1ETOA 2L9NA 1VQOI 3I56I 2HQRA 1JTYA 2VBWA 1SC7A 1LJ9A 2KJBA 3K4NA 5AONA 4PJLA 3DU5A 5FLVA 4YELA 3LSKA 2HWVA 2MLGA 3DTIA 1YIJI 1FEXA 1ZG5A 2IBDA 3CLQA 3H5NA 2VKHA 3I71A 3IRQA 1H9TA 1R23A 3I3LA 3OIQA 2HPMA 2E2JJ 4XKWA 1UHWA 4DZJA 1H0MA 4RS8A 2BY1A 3TP3A 1TNTA 3RZOJ 3BG3A 1YS6A 4L0ZB 1OCPA 4I01A 4L9JA 3CESA 5DEQA 3O3KA 4Z6YA 1UELB 3BT9A 1TWHJ 4NC6A 2MFZA 3E1SA 1R5GA 5CVRA 3ML6A 2QF7A 2VQHA 4RM3A 2VN2A 3DLLF 4A3CJ 1RIOH 2HKOA 2PI0A 3C2GA 5CKTA 4GCVA 1BOAA 4JYKA 1MDMA 4CICA 3C18A 3E7LA 1D0XA 5CLSA 3RTRA 3I54A 3GO5A 2YR2A 1ETXA 5EEGA 3CF2A 3F0CA 3F8NA 3PSIA 2XAUA 3GLXA 5L3BA 4F93B 1P4AA 2BXYA 3WTXC 1J5YA 1SFUA 5EGOB 3MKLA 1GDTA 4A3BJ 3OIOA 3WHBA 2J5OA 4AD9A 2X1EA 1SVOA 2ME6A 2HGCA 1V5FA 3LFUA 2DYSH 3DP7A 3ZOBA 4ENNA 1PUFA 1LDKB 1AHDP 3V7SA 2RVCA 3M8FA 2JPBA 3MKZA 2Z9OA 2HEOA 4BY7J 5F64A 5J1RA 1KYWA 1Z6RA 2BW3B 3OOUA 1LFPA 4M9SA 2AXLA 3KEYA 2H09A 3CCVI 1OCTC 2KZVA 1ZGWA 3GFLA 3RI4A 3HM5A 4JP0A 1KONA 3T5XA 5FO5A 1GV2A 2CGPA 1XSXA 5H2FC 3U21A 3HUGA 5ERIA 1SD6A 1DQUA 2FRHA 2OBPA 1P7JA 1Y56A 2A05A 1ETQA 2LLKA 2IA2A 3TOBA 5HODA 5DM7F 2ICWG 4WXDA 1B72A 3D5LA 5HLHA 1TW3A 2RKHA 1Z21A 3LL7A 2MC4A 5FJ8J 3HRUA 4H0EA 4JX5A 1ZREA 2FBKA 2RNGA 4Q47A 3HG9A 1YJ9I 3DF8A 4GYIA 1OCOH 2ESHA 2VQCA 3QWLA 5TISC 2CW0F 5BS6A 3WTTC 3CC7I 1HF0A 2WY7Q 2WTEA 2ISZA 3BJAA 3PIOF 3SJMA 3GX4X 1F4KA 2DDAA 4HNUA 1I1GA 5K5OA 1KU9A 3MZHA 1GXPA 2O61A 3VYSB 2D5VA 4L9NA 4CCOA 3RKWA 3W2AA 2RREA 3LA2A 3K6GA 2D45A 4N9IA 5LGNA 2RGVA 5CQEA 5E3NA 1FOYA 2L2OA 2ZNZA 2DFEA 1MBEA 1DU0A 5DD8A 3CCYA 3UNGC 2ZJRF 1ZRFA 3PQKA 2ZFUA 2O9LA 3WU0A 3HOYJ 1NHAA 5GTIC 3GTMJ 3V7CA 2GOXB 1R36A 1LEAA 2H8WA 1V4RA 1IXRC 1B9NA 4I7HA 2NRAC 3ZN0A 3ZMUA 1MDMB 1GT0C 3G1MA 1ODDA 1P4WA 3CP2A 3OIPA 4O6JA 3UR3C 4KDPA 2ZB9A 2L9SA 3V8LA 2O7OA 1D1AA 4I99C 4EM0B 1E3OC 1ZR4A 1YRNA 2VPLA 2DT6A 4EMSA 1RPWA 2LK2A 4MO7A 4A6DA 4OINF 2IA0A 1GV5A 4RAGA 4IHVA 3BR3A 4N0BA 1XG1A 3IWFA 3ZQ7A 4XRFA 3QP5A 3DQVC 1OYYA 4QLCU 1FP2A 4XRSG 4I6ZA 4BU2A 2GLOA 1XSVA 4BBRJ 2L7FP 4X1EA 1WZ2A 2DK8A 3KZYA 2OC6A 2HDDA 3I0TA 4FE4A 1WSUA 2JN6A 4HBLA 5HOOA 2LNBA 3KZIC 1R5HA 4FASD 5EZGA 1MGTA 3BZ6A 1XGMA 2OCCH 3VYRB 4CZZA 3HGGA 3EUKL 3FBNB 5FKMA 1QZYA 2Z3YA 1MBKA 3CC2I 3KPHA 1UG0A 2E1MC 4I09A 3GFJA 2IPQX 4IZZA 2HR3A 4HDUA 5E79C 2QLZA 2R4GA 4XKBA 2K9NA 3HGYA 2A6TA 2P5KA 1X1PA 2EFNA 2BHZA 3ROUA 3T1BA 1IRFA 4BE2A 2CUZA 2MH2A 3BQZA 3ONQA 4AVZA 3ELKA 2K40A 1YQAA 4UVCA 4CCMA 2TCTA 1BIBA 2VJ4A 5FD6A 2A5WA 3OYIA 1FJLA 2VBYA 5AIQA 2EWNA 2P6TA 1K7AA 2NVQJ 1BI3A 2EPFA 4GGGA 3COAC 3TOAA 2PMUA 3BLYA 2RN7A 5A2QK 1X1CA 2XROA 1ZLJA 3P5JA 5HNFA 2OQGA 4ZYHA 2K3FA 1LDDA 1DPUA 2E1CA 3HSEA 1XMAA 3QPLA 1YG2A 1QZZA 2ELJA 1VQMI 2ADUA 4U7BA 1Y1WJ 1LE8B 4II2A 3CDIA 3JREA 2BE5F 4IPAA 1LKXA 1HBXG 2QGUA 4FISA 4XORA 2Y9ZA 4UB6C 4CUGA 4G94A 3A0HC 2LH9A 5CVJA 1A36A 3CCLI 2FQ4A 4LMYA 4AUXA 5F08A 1YRNB 2M3AA 1G6NA 2PX9A 2H94A 3PJRA 1T6SA 2DI3A 4EJOA 2GQQA 2XASA 2DMQA 2XF7A 1UCRA 4V2GA 1YTYA 5BNGA 2X51A 2Y48A 1U2WA 2CUJA 1GVJA 3BC8A 1T33A 4LB6B 1E17A 1DP3A 4DOZA 1R58A 1T39A 1B8IA 1HW5A 1FYLA 2R7DA 4P55A 1SEUA 4BHCA 2W7NA 1YJNI 3J81K 5L3GA 3F8FA 2YU9J 3HRTA 3QPSA 1FMWA 2GXGA 4E7JA 4QIWN 1LFBA 4D7MA 2O6GE 2CFXA 1ZN2A 3PO3J 1F9NA 1MBJA 3CO7C 4CYCB 4XL9A 3ZQQA 2WY8Q 4XICA 2VKVA 5FD5A 2MD0A 1IG7A 2QENA 2K85A 1QBJA 2ZJ2A 1ACIA 2FOWA 3BZKA 2XGXA 3CJNA 3DTKA 1Q1HA 1WJAA 3BROA 1MW7A 2VT3A 4BKXA 3KP4A 2M2EA 2LD5A 4PZJA 1E3HA 2H6CA 3HPGA 4QSHA 3ZMTA 4GO1A 3BJ6A 2OTJI 1FOXA 4Q5SF 2CS3A 2FE3A 2D1HA 3LSHA 1ON1A 4NQWB 1UAAA 2Y9YA 4G9YA 1K6OA 5IYDJ 4IX7A 3DV8A 2NNNA 2ZJQF 3VPRA 4AYBN 3SZPA 2DCEA 1W0TA 2XGEA 3DBHB 2D1VA 2X6OA 1EJ9A 4ETSA 3CUOA 1K61A 1HC8A 9ANTA 3KP3A 3GTJJ 3L2UA 1YLFA 5TJJA 3BG7A 3T0YA 2JWTA 2QQAA 3RQ4A 3S3OA 2CUFA 4BAYA 1WJEA 4XBFA 1Z7LA 5B1BH 2GA1A 3OYHA 1O7FA 2OV7A 4HAMA 3JTGA 4P96A 4A0YA 1O4XA 1YO5C 4RGSA 3X2QH 3FXQA 3QU3A 4V19K 2X85A 3HKZN 2HYFA 2ID6A 1Z67A 1S3JA 2OJED 3V8KA 1WGXA 3K1PA 2NS8A 3JTHA 5DTDA 4M3GA 2GXBA 2KPMA 1LUJB 5FFXA 1A04A 2EZKA 1PDNC 1IN5A 1P2FA 4HZFA 1FT9A 2EFPA 4HX7A 2P0WA 2IGKA 2XSJC 4B48A 1DGRM 4EGYA 3HOWJ 3BCBA 2VC1A 4KA4A 1TC3C 2DYRH 4FQGA 4QPOA 5E1WA 3P7NA 2Y0SN 3K70C 2L54A 4U0WA 2PQ8A 1H9GA 2Z99A 3HC7A 4WX9A 1JHHA 2WAQN 2H1LA 1ZRDA 1PYVA 2MGQA 2CQNA 4G7OF 1X3ZB 2UV1A 4P9UA 4ENJA 4E7IA 4E7KA 2PJPA 1BJAA 5M3MJ 4M9XA 3FBIB 3KEOA 2KDZA 4ON0A 4B1RA 3A02A 1KU2A 5E3LA 4XLFA 1R9TJ 4L18B 4FHTA 3AG2H 4OAZA 4B44A 2XIGA 4XLNF 2JUCA 4XK4A 2XB0X 3QOPA 1ZYRF 3G1LA 5LEJA 5FLMJ 4DBQA 1R71A 1W5TA 5A2QZ 2ZBKA 3ABMH 3CMMA 2Z2SB 4BNCA 4LG0A 4A3JJ 1FBUA 4E4HA 3QU6A 3K10A 5LGTA 5LHHA 4IOAF 4A3IJ 3BCAA 2IS6A 4EJTA 3G1OA 2MA3A 2KZGA 3RYPA 4KICA 1S7EA 4IRHA 1R4MB 2MYSA 2LG4A 5DCFA 2BVLA 1ZRCA 3LSIA 5FKNA 2JA8J 2LY1A 1ZARA 1G3WA 3K4KA 1ITYA 3ERMA 1ZELA 2VQLA 1MH4A 3HHGA 2Z5UA 3I9V2 4CA0A 1I39A 3S8PA 2W4SA 3RZDJ 2A5YB 1AKHA 1P7IA 4A0ZA 3BTCA 3PFYA 4F91B 3C2BA 2QYOA 3U1DA 1USTA 1MNDA 2ID3A 2GIZA 2ZC2A 4O3MA 3ZQLA 3HRMA 1BC8C 3JSOA 3FHNA 3RYRA 2HQAA 2O8KA 4CGZA 3S32A 2Q2EA 4OMZA 3J81Z 1N77A 4OAYA 3PUBA 3K4MA 2OPTA 3M4OJ 2XV4S 5CQGA 1X4OA 1TZLA 2WAEA 1M1EB 3QYFA 5FLXK 1U0JA 3CP8A 2LF8A 5L3DA 3OL3A 4C9YA 2DT5A 2XAHA 5LRRA 4MTDA 1FBQA 4QTRA 2B7EA 4G6TB 3NWTA 3MKWB 4E70A 3AL0B 5E3MA 2UZKA 3D1NI 1RR7A 1D8KA 3A01A 2XKPA 2DAOA 5J3LA 3KP7A 3DCFA 3ZMZA 5D5WB 3HHHA 3JCUC 5E18F 4CH7A 3O8HA 5GTHC 5FRNA 5CVVA 1Z3YA 2QVOA 4HLXA 1R1VA 2FOKA 1UJ8A 3EUHC 2FNPA 1B6AA 4BUPA 1MNMC 1RI7A 5L3CA 4Q48A 4U0YA 2CWEA 1Y0UA 4PJJA 3H3VK 2EK5A 5LGUA 3RPUA 2E71A 3C2HA 2M45A 3FM5A 1P9QC 3S1RJ 2VL8A 4CCNA 1MBFA 5FB2A 1FY7A 1T98A 3H9GA 1K4TA 1MJ9A 3FMSA 1CQTA 1IXCA 1USSA 2RV8A 4OU0A 2TDXA 3CJTB 4A93J 1Y39A 4EJVA 2BY3A 2NAZA 1K78A 4UNOA 2ZXWH 4A2UA 5HS8A 4LLNA 1UG2A 4HA8A 2FF4A 3WTZA 1J7KA 4JX4A 2P81A 3Q0VA 3FMQA 2VASA 3H92A 4MTEA 1SMTA 3FXKA 1ZH5A 2Y30A 3KE2A 3TO7A 2IAIA 2KIUA 3I59B 4KIBA 1RUNA 1HXDA 4IEJA 1VQPI 2VQGA 2ZNYA 5D4SA 3QQAA 4NBQA 5GADJ 2DDBA 2IVMA 4FT8A 3ASNH 3K0LA 5DUIA 3MEXA 3ASOH 2M9HA 4CO8A 5IOZA 2DFHA 2OZUA 2LR8A 4LJZF 3BQYA 1RRJA 3TDUC 1MNEA 4CHUA 2L5QA 4FX4A 5J8FA 2DFFA 3K9TA 1ZQ3P 3ZPLA 2COMA 2HQ5A 5CVUA 5C3EJ 1X1DA 2KRCA 1OYWA 3FX3A 2C6YA 1KU3A 1XCBA 3M8EA 3QYEA 1KZHA 2JJ7A 1A31A 3S2DJ 3C3WA 2QQ8A 3R0AA 3W6KB 3W2WA 2ZMEC 3ECOA 4BDZA 4EM1A 2JVHA 5C4XJ 1G3TA 1PP8F 3MZYA 3EUHA 2EFWA 3CZ6A 3OYKA 2ZSHB 2F5EA 2BOLA 1HQCA 3HJEA 4P5OA 1U5TC 4CDGA 2DQLA 1YHQI 1O57A 3AG4H 4U0VA 5D8KB 2X48A 3Q9VA 1QNTA 1RESA 2EA4A 4BYYA 5LBQA 3PIPF 3L2RA 2RAEA 2VKEA 1JT0A 2UXNA 2Y0MA 4L0YB 3H5AA 3OYDA 3PSFA 1BW6A 2ETHA 4YRVA 4EATA 4YIFA 4XSXF 1SFOJ 4YIRX 1VQ6I 3S2HJ 2KLOA 4HLYA 4FTHA 3ESWB 2AS5F 2G7UA 4F55A 2HVSA 2DA4A 5KAIC 5E1ZB 5B1AH 4WCGA 3JRDA 5IP9J 1FIPA 3CO6C 2VB6A 3IH2A 1OISA 1HOMA 3H36A 5D5UB 1W7PD 3B02A 3OS0A 3B73A 4GXOA 1WH7A 4LK0F 2HVQA 3TP0A 1JGGA 5FROA 4BDYA 1YS7A 2LBFA 2M1BA 3QAHA 3R60A 1WJFA 2DK5A 4K2EA 4BHPA 1W36D 2R92J 1YW7A 3OYLA 1W4MA 3J7ZI 2P8TA 4IQJA 1H88C 5TGTA 4ZTJA 4DJAA 4MGRA 1WCMJ 1IUYA 4DZPA 3RKXA 1IDYA 3N97A 1IRGA 2W00A 5H20A 4OOIA 5LHGA 1BJZA 4KJZA 4PCQA 2R7UA 1KYZA 2OF7A 4KT6A 5J1YA 4IKFA 1VQLI 4XNFA 4M9ZA 1DUXC 2P6SA 4OIOF 3A1YA 4MIMA 4XLPF 3BJOA 5DYMA 5FLXZ 1J2XA 1JT6A 4GFBA 2IGOA 3NQOA 5F0FA 1V5GA 1T2KA 3HOVJ 1IDZA 1FOKA 2EV5A 1XSDA 2XB5A 1ORKA 2VE8A 1TT5B 2ZMEA 2XPVA 3ZN1A 2CU7A 4ANJA 3E6MA 2A61A 1R49A 1F43A 5E1XA 3FMRA 1D0YA 1HSTA 4KT5C 4S0HB 1VQ8I 1U5TA 2EIMH 2A6EF 4CSWA 1TWGJ 2CJJA 3U1KA 2HQNA 3BTIA 2QEXI 3PQJA 1GVDA 2PMZN 3U2RA 2KHMA 2YUSA 4ZDLA 1X4PA 5BOXA 1MJAA
chains in the Genus database with same CATH topology
2KKOA 2RNJA 5ICEA 5E20A 4A5MA 2R3SA 3WGGA 4EM2A 4Y17A 2QUFA 3HTUA 3ZMDA 3H3UA 4CYDA 2JPCA 2STWA 2FBIA 3TO9A 1SAXA 2RQPA 3JW4A 4FX0A 3WODF 4WWCA 1D8JA 3L9FA 1E2XA 1R00A 1CF7A 1G4DA 1ON2A 5E8IA 2LKPA 5K5RA 1FYKA 4IJAA 3MAJA 3GVAA 3KLOA 3MWMA 1HW1A 1WI9A 2ZFWA 1R22A 3WTVC 1O7LA 3DFGA 1V3FA 2QBYA 2VC0A 4AWXB 1UFMA 2V1UA 4A12A 5H6RA 3FWEA 3ABTA 4L9TA 5KVRA 3FHZA 2QM3A 4I02A 1U8RA 4A5NA 1IN6A 3E97A 3QRFF 1JGSA 4UUVA 3LFKA 3LA7A 1T38A 2LDUA 4LD5A 2ZKZA 2W85A 1AOYA 1U5TB 4MQVA 1WKMA 4OIRF 1XGSA 4OMYA 5IT9K 2Z33A 4KMFA 2WWYA 6PAXA 4B09A 4HF2A 2XAJA 2M87A 1ZG1A 2NYXA 1LEBA 4U88A 3I58A 1I5ZA 3F72A 2YX7A 3SHFA 4HX4A 1WRJA 3BWGA 1CF7B 1OR7A 4TV7A 1YFHA 4L9VA 5AIPA 1OKRA 1IF1A 4N9HA 4IHSA 4UVBA 2DW4A 2HKXA 2K86A 3RIRA 1KA8A 4D0PA 2BYVE 4MEYF 4HV6A 2VBZA 1U6GA 1DP7P 4ZH4F 3Q5FA 2ISYA 2IA1A 5HVQC 3S2WA 3TKYA 3G3ZA 3WTYC 2EB7A 1G3YA 2K7LA 1YW8A 4G7ZF 1JHFA 4I2OA 2L4MA 2UWMA 2KRFA 2W24A 3K1MA 1TNSA 2VXZA 3J7AO 1Z6TA 3I64A 2MLKA 3C1DA 2G9WA 4RB3C 1KQ9A 2FNAA 2F5FA 2P7VB 4DNCA 2BEOA 1HW2A 3DEUA 4WXCA 1FLIA 1B59A 3VODA 1LB2A 3JAMK 2VOOA 3HOSA 1W5SA 4ZZDA 2CSOA 3KP6A 3CTAA 5JI6A 4HYEA 1O3SA 3P9KA 1YYVA 4I0AA 1FSEA 2O3FA 2MD5A 3VB2A 1LNWA 4RGUA 1XDSA 2F5DA 1Z7UA 4PGGA 3WTUC 5LLQA 3SFZA 4DQ2A 5DCMA 4HF1A 3ERED 4MNUA 4KMUX 3MQ0A 5LEKA 1J75A 1FSHA 2DLLA 1JXSA 4XSZF 1VTNC 1W7PA 4R79A 4RGXA 3NRVA 2Q8KA 4MQ9F 2FXAA 4MEXF 5J6XA 1OYIA 4Y15A 1O3TA 2FEZA 3CUQC 4HQMA 1XGNA 1WQ2A 3GWZA 2KJCA 4IVNA 1TQMA 1MKMA 5ICFA 3NEUA 3KEQA 4WF2A 4U7DA 3IC7A 2OAZA 3E6CC 1P92A 1I1SA 3ZP5A 4HDVA 2XAFA 3EDPA 3TQNA 3M1EA 1TBXA 2GAUA 3GZ5A 4GYGA 3WE3A 1ZG3A 3EETA 1STZA 2A68F 4BQAA 1O3RA 2MBFA 4G6DA 3BPXA 4AIJA 3IWZA 3SZTA 2VONA 4RAZA 3O2PE 1SD7A 2JTVA 4M71A 4IRGA 4UXNA 5HDGA 4Z2YA 4P9FA 1TQIA 1P4XA 1U3EM 2L01A 2IW5A 4JK1X 5HDKA 4ESBA 3HRSA 5D4RA 1FX7A 3CUQA 1HSJA 2L3DA 3JSPA 3E6DA 2ZO4A 2QQBA 3GZ6A 2RC4A 1S8NA 2YPRA 3R4KA 1OPCA 4M73A 4I98B 2ZCWA 1X3UA 2A3SA 4YFNF 4EGZA 1TW2A 2EFOA 1TLHB 4KYWA 3J80K 2IP2A 4HF0A 4B8XA 5DDGA 3IKTA 3RPQA 4LG0B 2YU3A 1B4AA 4LLGF 3VOEA 2STTA 2A69F 5EEHA 4BHBA 2GWRA 3K2ZA 1YIOA 4ZZLA 5BQTA 4ENKA 4WK8F 3BP8A 1Z05A 2ELHA 5DV5A 3C7JA 2V1DA 1KQ8A 1BN5A 5F1RA 4ENMA 4HV5A 1XD7A 3GEZA 4UHTA 3EQLF 3LQQA 2KIFA 3WE2A 2HTSA 2FSWA 3DXJF 2UXXA 3L2CA 2DPUA 2JSCA 2L02A 4BXUA 4IHTA 5IT3A 1R1TA 3RJPA 1FP1D 4OIPF 2LSOA 1XDUA 3LA3A 1WWXA 1SFXA 2ZXJA 1IN8A 4KN4X 3REOA 1S7AA 4YFKF 2K4BA 3AAFA 1Z1DA 2BBYA 3ECHA 4ZYGA 3F21A 2KIMA 1MD0A 1FNNA 3FM3A 3I53A 3WU1B 3WG9A 3ISPA 1UHMA 3LAJA 3N4MA 1BI0A 4LK1F 4IXAA 1K78B 2PMHA 4R1HA 2Q0OA 3OV8A 2K4JA 3KCCA 5JVTA 2A07F 1BI2A 2DU9A 1K79A 3ZMSA 2PEXA 3E5XA 2WC2A 5D5XB 4IRIA 4L5JA 2EA2A 3IL2A 2XRNA 3RKYA 4QWQA 1QPMA 2CO5A 4EVIA 3GFMA 1EH7A 3BDDA 2DPDA 3KETA 5ILUA 1B9MA 2P5VA 3O6BB 3HYIA 2E1NA 2E7XA 3E6BA 2VODA 5J8CA 3P9CA 3J80Z 2P5LC 3HSFA 1XCVA 5K5QA 4UVAA 4M72A 2P4WA 4AIHA 2JT1A 2PFBA 2P7CB 5JHUA 3KFWX 2GZWA 3WGHA 2M5WA 3SXYA 3R0JA 1BM9A 2OU2A 4G7HF 1FWZA 2XVCA 1KU7A 2A6HF 4WXHA 2X0LA 1F1ZA 1ZGAA 2HOEA 1FBSA 3HTSB 1XMKA 3DPTA 2NNYA 1DDNA 1IAWA 2ACJA 1LVAA 4G6QA 1Z9CA 1ONVA 1O3QA 1IZ1A 5D8LB 3VEPA 2HZTA 2K02A 5DUKA 4YIIA 5K1YA 3F8BA 2FBHA 3RDIA 4UV9A 5FGMA 2OZ6A 2IRFG 3F6OA 3WTSC 1MJBA 2K27A 4A0XA 5HLIA 3PFIA 1SD5A 2OD5A 2ZMEB 5TRDA 2FA5A 2HFHA 3Q9SA 3IRRA 3WGIA 3F23A 1FYMA 3KP5A 1AWCA 1J9IA 3G73A 4ZYEA 5JR3A 1HKSA 4IF4A 1L3LA 5E8GA 5LRSA 1ZLKA 1LDJA 1EH8A 3LAPA 5ICCA 5BPIA 1QQIA 3F6VA 4UV8A 1FPQA 2XAQA 1RZ4A 2DTRA 1GXQA 3BOQA 1U78A 4ASNA 2XHKA 4O5VA 3L7WA 2XKOA 2MH9A 4LGWA 1BIAA 4YG2F 1TQPA 5HLGA 4NQWA 1IXSB 1I6XA 2V6CA 3IKVA 4KN7X 4NB5A 4EJUA 2DQRA 4HOBA 2QBYB 4JQFA 1FC3A 3DKWA 3EYYA 5JFRA 5HS9A 3V7RA 2VT2A 3U9GA 1MZBA 2G7HA 1XN7A 5FFZA 5D6FA 5HS7A 1IW7F 4M6XA 1QO0D 2J5PA 3IHUA 3LQRA 2FQ3A 3P9IA 4KNYA 3TO6A 3VFZA 2EV6A 4NHJA 5DD4A 2HYGD 3I5UA 3ZMVA 2O8XA 1B1BA 3GW2A 1D3YA 2F5CA 4RB0A 5BMZA 3E5UA 2VBXA 2O03A 5HDNA 1T0FA 2L4AA 4PGHA 1IN7A 2WV0A 3W6JB 3F8MA 3KZZA 3D0SA 4OIQF 3MFKA 4S05A 1RNLA 1YW9A 2E7WA 2V1XA 1KGSA 1XGOA 2OQRA 4BH9A 1S29A 1Z91A 1OMIA 3L00A 3FXRA 2BGCA 2EFQA 2OA4A 1R7JA 1EV7A 3R6SA 4LFUA 2EJRA 5D6EA 2O0YA 3T8RA 2JRTA 5BPDA 3HOTA 3QPHA 4I0BA 4LLLA 2DO7A 2YSRA 2V79A 5E17F 1HKTA 1IN4A 2GA2A 2ESNA 3GXOA 2FMYA 1ZAOA 3F22A 4PDKA 3OOPA 2W25A 5ED4A 4EQQA 1I27A 4YFXF 3KLNA 1RUOA 2PG4A 1J0RA 5IT9Z 2VE9A 5ICGA 3R61A 4MHGA 3ULQB 4M74A 3BY6A 4AIKA 1UB9A 4KFCA 4HX8A 2X4HA 3TGNA 1G3SA 3M7GA 4Y13A 4LB5A 4CXFA 4ZYDA 2HTJA 4JBAA 1LQ1A 1XB4A 2LF7A 1R1UA 4A6EA 2GIVA 3GUDA 5ILSA 4KIGA 2MC3A 4RB1A 3DPLC 2F2EA 2V9VA 2CG4A 3F8CA 5DCMB 2W57A 2VOPA 2H27A 1QGPA 1DPRA 2DFIA 2FMLA 3T8TA 1HKQA 2FU4A 2XUBA 1ZHFA 5LHIA 2RDPA 3GYHX 5ILVA 3QP6A 5CVIA 1W7PB 1F5TA 3SQNA 4ESJA 1TTYA 2R7FA 2PN6A 3WTWC 2PLYA 4KIFA 3F3XA 1BI1A 1EH6A 2H6BA 3K69A 3E5QA 3LWFA 3I59A 4RB2C 3ABUA 3HIFA 2HDCA 2W84A 2M30A 1SD4A 4G8XA 1J59A 4HW0A 3JAMZ 3KP2A 3H3ZA 3GF2A 4EJWA 2PBIA 4EV0A 4S04A 1SMYF 3E3VA 2D2WA 4RAYA 4F7ZA 2CYYA 3FZVA 2IT0A 4KUMA 2HS5A 3L09A 1SFEA 1L0OC 3QPTA 4HQEA 2QZ8A 2IJLA 1C0WA 1ZGJA 2QWWA 3BPVA 5L3FA 1S7OA 3K1NA 5CYVA 2Y75A 2B0LA 1S6LA 3M9AA 4M6YA 1BC7C 2CQKA 4Q4ZF 4AVPA 2XAGA 1CGPA 3CDHA 3CUQB 3TDZC 2QQ9A 4R8HA 3I4PA 3V4GA 3GFIA 1BBYA 5F6FA 1PP7U 1P6RA 4L5IA 5CJ9A 1REPC 4ESFA 2M8EA 1PUEE 3FF5A 1JE8A 1KQ0A 2YX4A 2DBBA 3MCZA 3HSRA 2EV0A 1ULYA 1FZPB 5L3EA 3EYIA 2JZYA 5KK1A 3V8JA 5H6QA 3LSTA 3CLOA 2BV6A 1GHCA 5D5VB 2NS0A 4RGRA 3FXUA 1D5VA 2HQRA 2VBWA 1LJ9A 2KJBA 5AONA 2HWVA 2MLGA 1ZG5A 3I71A 1H9TA 3IRQA 1R23A 1UHWA 1H0MA 4RS8A 1TNTA 1YS6A 4L0ZB 4I01A 4L9JA 5DEQA 3O3KA 1R5GA 5CVRA 3ML6A 2VN2A 1RIOH 2HKOA 2PI0A 4GCVA 1BOAA 1MDMA 4CICA 3C18A 5CLSA 3RTRA 3I54A 3GO5A 2YR2A 5EEGA 3F8NA 3GLXA 5L3BA 1P4AA 3WTXC 1J5YA 1SFUA 2J5OA 4AD9A 2HGCA 4ENNA 3DP7A 1LDKB 3V7SA 2RVCA 3M8FA 2JPBA 2Z9OA 2HEOA 5F64A 1KYWA 1Z6RA 4M9SA 2AXLA 2H09A 3GFLA 3RI4A 3T5XA 5FO5A 2CGPA 1XSXA 3HUGA 5ERIA 1SD6A 2FRHA 2OBPA 2IA2A 3TOBA 4WXDA 3D5LA 5HLHA 1TW3A 2RKHA 3HRUA 4H0EA 1ZREA 2FBKA 4Q47A 3DF8A 4GYIA 3WTTC 2ESHA 5BS6A 2CW0F 2WTEA 2ISZA 3BJAA 3GX4X 1F4KA 1I1GA 5K5OA 1KU9A 3MZHA 1GXPA 2O61A 4L9NA 3RKWA 3LA2A 2D45A 4N9IA 5LGNA 2RGVA 2ZNZA 5DD8A 1ZRFA 3PQKA 3WU0A 1NHAA 3V7CA 1R36A 1LEAA 1V4RA 1IXRC 1B9NA 4I7HA 2NRAC 3ZN0A 3ZMUA 1MDMB 1ODDA 1P4WA 4O6JA 4KDPA 3V8LA 4EM0B 4EMSA 4A6DA 4OINF 2IA0A 4N0BA 3IWFA 3ZQ7A 4XRFA 3QP5A 3DQVC 1OYYA 4QLCU 1FP2A 1XSVA 2DK8A 3KZYA 3I0TA 1WSUA 4HBLA 5HOOA 2LNBA 1R5HA 1MGTA 3BZ6A 1XGMA 4CZZA 1QZYA 2Z3YA 4I09A 3GFJA 2IPQX 2HR3A 4HDUA 2QLZA 2P5KA 2EFNA 3ROUA 3T1BA 1IRFA 2MH2A 3ELKA 1YQAA 4UVCA 5FD6A 1BIBA 2VBYA 5AIQA 2EWNA 2P6TA 1K7AA 1BI3A 4GGGA 3COAC 3TOAA 2PMUA 2RN7A 5A2QK 2XROA 1ZLJA 2OQGA 4ZYHA 1LDDA 1DPUA 2E1CA 3HSEA 1XMAA 1YG2A 1QZZA 2ADUA 4U7BA 2BE5F 4IPAA 1HBXG 4G94A 5CVJA 4LMYA 1G6NA 2H94A 1T6SA 2DI3A 4EJOA 2GQQA 2XASA 1UCRA 1YTYA 2Y48A 1U2WA 1GVJA 1E17A 4LB6B 1R58A 1T39A 1HW5A 1FYLA 2R7DA 4P55A 4BHCA 3J81K 5L3GA 3F8FA 3HRTA 2GXGA 2O6GE 2CFXA 1ZN2A 1F9NA 3CO7C 5FD5A 2QENA 1QBJA 2ZJ2A 2XGXA 3CJNA 1Q1HA 3BROA 2VT3A 3KP4A 4PZJA 2H6CA 3ZMTA 4GO1A 3BJ6A 4Q5SF 2FE3A 2D1HA 1ON1A 4G9YA 1K6OA 3DV8A 2NNNA 3SZPA 2D1VA 4ETSA 3CUOA 3KP3A 1YLFA 5TJJA 3T0YA 2QQAA 4BAYA 4XBFA 2GA1A 1O7FA 4HAMA 3JTGA 4P96A 4A0YA 1YO5C 4RGSA 3FXQA 3QU3A 2HYFA 1S3JA 3V8KA 3K1PA 3JTHA 2GXBA 5FFXA 1A04A 1PDNC 1IN5A 1P2FA 4HZFA 1FT9A 2EFPA 4HX7A 4EGYA 2VC1A 4KA4A 5E1WA 3P7NA 2L54A 4U0WA 2PQ8A 1H9GA 2Z99A 4WX9A 1JHHA 1ZRDA 4G7OF 4P9UA 4ENJA 2PJPA 1BJAA 4M9XA 3KEOA 4ON0A 1KU2A 4L18B 4FHTA 2XIGA 4XLNF 3QOPA 1ZYRF 5LEJA 1W5TA 5A2QZ 2ZBKA 4BNCA 4LG0A 1FBUA 3QU6A 5LGTA 5LHHA 4EJTA 2MA3A 3RYPA 4KICA 4IRHA 5DCFA 1ZRCA 1ZARA 1G3WA 3HHGA 2Z5UA 2A5YB 4A0ZA 2QYOA 3U1DA 1USTA 4O3MA 3HRMA 1BC8C 3JSOA 3RYRA 4CGZA 2Q2EA 4OMZA 3J81Z 2XV4S 5FLXK 2LF8A 5L3DA 2DT5A 2XAHA 5LRRA 4MTDA 1FBQA 4E70A 2UZKA 1D8KA 2XKPA 2DAOA 3KP7A 3ZMZA 5D5WB 3HHHA 5E18F 5CVVA 2QVOA 4HLXA 1R1VA 2FOKA 2FNPA 1B6AA 1RI7A 5L3CA 4Q48A 4U0YA 2CWEA 1Y0UA 2EK5A 5LGUA 3RPUA 2M45A 3FM5A 5FB2A 1FY7A 1T98A 1MJ9A 3FMSA 1IXCA 1USSA 2RV8A 4OU0A 2TDXA 4EJVA 2NAZA 1K78A 4UNOA 4A2UA 5HS8A 4LLNA 4HA8A 2FF4A 3WTZA 1J7KA 3FMQA 3H92A 4MTEA 1SMTA 1ZH5A 3KE2A 3TO7A 2KIUA 3I59B 4KIBA 1RUNA 1HXDA 2ZNYA 5D4SA 2IVMA 4FT8A 3K0LA 5DUIA 3MEXA 4CO8A 2OZUA 4LJZF 3TDUC 4CHUA 4FX4A 5J8FA 3K9TA 3ZPLA 2COMA 5CVUA 1OYWA 3FX3A 2C6YA 1XCBA 1KU3A 3M8EA 3C3WA 3R0AA 3W6KB 3ECOA 4EM1A 1G3TA 1PP8F 3MZYA 3EUHA 2EFWA 2F5EA 1HQCA 4P5OA 1U5TC 4CDGA 2DQLA 1O57A 5D8KB 4U0VA 3Q9VA 1QNTA 2EA4A 4BYYA 5LBQA 2UXNA 2Y0MA 4L0YB 2ETHA 4YIFA 4XSXF 4HLYA 2AS5F 2G7UA 5E1ZB 4WCGA 3CO6C 5D5UB 1W7PD 3B02A 3B73A 4GXOA 4LK0F 1YS7A 2M1BA 3QAHA 3R60A 2DK5A 4BHPA 4K2EA 1YW7A 1W4MA 2P8TA 4MGRA 1IUYA 3RKXA 3N97A 1IRGA 5H20A 4OOIA 5LHGA 4PCQA 1KYZA 4M9ZA 1DUXC 2P6SA 4OIOF 4XLPF 3BJOA 5DYMA 5FLXZ 1J2XA 3NQOA 1T2KA 1FOKA 2EV5A 1XSDA 2VE8A 2ZMEA 3ZN1A 3E6MA 2A61A 5E1XA 3FMRA 1HSTA 4KT5C 1U5TA 2A6EF 2HQNA 3PQJA 3U2RA 5BOXA 1MJAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KKO A;  2RNJ A;  5ICE A;  5E20 A;  4A5M A;  2R3S A;  3WGG A;  4EM2 A;  4Y17 A;  2QUF A;  3HTU A;  3ZMD A;  3H3U A;  4CYD A;  2JPC A;  2STW A;  2FBI A;  3TO9 A;  1SAX A;  2RQP A;  3JW4 A;  4FX0 A;  3WOD F;  4WWC A;  1D8J A;  3L9F A;  1E2X A;  1R00 A;  1CF7 A;  1G4D A;  1ON2 A;  5E8I A;  2LKP A;  5K5R A;  1FYK A;  4IJA A;  3MAJ A;  3GVA A;  3KLO A;  3MWM A;  1HW1 A;  1WI9 A;  2ZFW A;  1R22 A;  3WTV C;  1O7L A;  3DFG A;  1V3F A;  2QBY A;  2VC0 A;  4AWX B;  1UFM A;  2V1U A;  4A12 A;  5H6R A;  3FWE A;  3ABT A;  4L9T A;  5KVR A;  3FHZ A;  2QM3 A;  4I02 A;  1U8R A;  4A5N A;  1IN6 A;  3E97 A;  3QRF F;  1JGS A;  4UUV A;  3LFK A;  3LA7 A;  1T38 A;  2LDU A;  4LD5 A;  2ZKZ A;  2W85 A;  1AOY A;  1U5T B;  4MQV A;  1WKM A;  4OIR F;  1XGS A;  4OMY A;  5IT9 K;  2Z33 A;  4KMF A;  2WWY A;  6PAX A;  4B09 A;  4HF2 A;  2XAJ A;  2M87 A;  1ZG1 A;  2NYX A;  1LEB A;  4U88 A;  3I58 A;  1I5Z A;  3F72 A;  2YX7 A;  3SHF A;  4HX4 A;  1WRJ A;  3BWG A;  1CF7 B;  1OR7 A;  4TV7 A;  1YFH A;  4L9V A;  5AIP A;  1OKR A;  1IF1 A;  4N9H A;  4IHS A;  4UVB A;  2DW4 A;  2HKX A;  2K86 A;  3RIR A;  1KA8 A;  4D0P A;  2BYV E;  4MEY F;  4HV6 A;  2VBZ A;  1U6G A;  1DP7 P;  4ZH4 F;  3Q5F A;  2ISY A;  2IA1 A;  5HVQ C;  3S2W A;  3TKY A;  3G3Z A;  3WTY C;  2EB7 A;  1G3Y A;  2K7L A;  1YW8 A;  4G7Z F;  1JHF A;  4I2O A;  2L4M A;  2UWM A;  2KRF A;  2W24 A;  3K1M A;  1TNS A;  2VXZ A;  3J7A O;  1Z6T A;  3I64 A;  2MLK A;  3C1D A;  2G9W A;  4RB3 C;  1KQ9 A;  2FNA A;  2F5F A;  2P7V B;  4DNC A;  2BEO A;  1HW2 A;  3DEU A;  4WXC A;  1FLI A;  1B59 A;  3VOD A;  1LB2 A;  3JAM K;  2VOO A;  3HOS A;  1W5S A;  4ZZD A;  2CSO A;  3KP6 A;  3CTA A;  5JI6 A;  4HYE A;  1O3S A;  3P9K A;  1YYV A;  4I0A A;  1FSE A;  2O3F A;  2MD5 A;  3VB2 A;  1LNW A;  4RGU A;  1XDS A;  2F5D A;  1Z7U A;  4PGG A;  3WTU C;  5LLQ A;  3SFZ A;  4DQ2 A;  5DCM A;  4HF1 A;  3ERE D;  4MNU A;  4KMU X;  3MQ0 A;  5LEK A;  1J75 A;  1FSH A;  2DLL A;  1JXS A;  4XSZ F;  1VTN C;  1W7P A;  4R79 A;  4RGX A;  3NRV A;  2Q8K A;  4MQ9 F;  2FXA A;  4MEX F;  5J6X A;  1OYI A;  4Y15 A;  1O3T A;  2FEZ A;  3CUQ C;  4HQM A;  1XGN A;  1WQ2 A;  3GWZ A;  2KJC A;  4IVN A;  1TQM A;  1MKM A;  5ICF A;  3NEU A;  3KEQ A;  4WF2 A;  4U7D A;  3IC7 A;  2OAZ A;  3E6C C;  1P92 A;  1I1S A;  3ZP5 A;  4HDV A;  2XAF A;  3EDP A;  3TQN A;  3M1E A;  1TBX A;  2GAU A;  3GZ5 A;  4GYG A;  3WE3 A;  1ZG3 A;  3EET A;  1STZ A;  2A68 F;  4BQA A;  1O3R A;  2MBF A;  4G6D A;  3BPX A;  4AIJ A;  3IWZ A;  3SZT A;  2VON A;  4RAZ A;  3O2P E;  1SD7 A;  2JTV A;  4M71 A;  4IRG A;  4UXN A;  5HDG A;  4Z2Y A;  4P9F A;  1TQI A;  1P4X A;  1U3E M;  2L01 A;  2IW5 A;  4JK1 X;  5HDK A;  4ESB A;  3HRS A;  5D4R A;  1FX7 A;  3CUQ A;  1HSJ A;  2L3D A;  3JSP A;  3E6D A;  2ZO4 A;  2QQB A;  3GZ6 A;  2RC4 A;  1S8N A;  2YPR A;  3R4K A;  1OPC A;  4M73 A;  4I98 B;  2ZCW A;  1X3U A;  2A3S A;  4YFN F;  4EGZ A;  1TW2 A;  2EFO A;  1TLH B;  4KYW A;  3J80 K;  2IP2 A;  4HF0 A;  4B8X A;  5DDG A;  3IKT A;  3RPQ A;  4LG0 B;  2YU3 A;  1B4A A;  4LLG F;  3VOE A;  2STT A;  2A69 F;  5EEH A;  4BHB A;  2GWR A;  3K2Z A;  1YIO A;  4ZZL A;  5BQT A;  4ENK A;  4WK8 F;  3BP8 A;  1Z05 A;  2ELH A;  5DV5 A;  3C7J A;  2V1D A;  1KQ8 A;  1BN5 A;  5F1R A;  4ENM A;  4HV5 A;  1XD7 A;  3GEZ A;  4UHT A;  3EQL F;  3LQQ A;  2KIF A;  3WE2 A;  2HTS A;  2FSW A;  3DXJ F;  2UXX A;  3L2C A;  2DPU A;  2JSC A;  2L02 A;  4BXU A;  4IHT A;  5IT3 A;  1R1T A;  3RJP A;  1FP1 D;  4OIP F;  2LSO A;  1XDU A;  3LA3 A;  1WWX A;  1SFX A;  2ZXJ A;  1IN8 A;  4KN4 X;  3REO A;  1S7A A;  4YFK F;  2K4B A;  3AAF A;  1Z1D A;  2BBY A;  3ECH A;  4ZYG A;  3F21 A;  2KIM A;  1MD0 A;  1FNN A;  3FM3 A;  3I53 A;  3WU1 B;  3WG9 A;  3ISP A;  1UHM A;  3LAJ A;  3N4M A;  1BI0 A;  4LK1 F;  4IXA A;  1K78 B;  2PMH A;  4R1H A;  2Q0O A;  3OV8 A;  2K4J A;  3KCC A;  5JVT A;  2A07 F;  1BI2 A;  2DU9 A;  1K79 A;  3ZMS A;  2PEX A;  3E5X A;  2WC2 A;  5D5X B;  4IRI A;  4L5J A;  2EA2 A;  3IL2 A;  2XRN A;  3RKY A;  4QWQ A;  1QPM A;  2CO5 A;  4EVI A;  3GFM A;  1EH7 A;  3BDD A;  2DPD A;  3KET A;  5ILU A;  1B9M A;  2P5V A;  3O6B B;  3HYI A;  2E1N A;  2E7X A;  3E6B A;  2VOD A;  5J8C A;  3P9C A;  3J80 Z;  2P5L C;  3HSF A;  1XCV A;  5K5Q A;  4UVA A;  4M72 A;  2P4W A;  4AIH A;  2JT1 A;  2PFB A;  2P7C B;  5JHU A;  3KFW X;  2GZW A;  3WGH A;  2M5W A;  3SXY A;  3R0J A;  1BM9 A;  2OU2 A;  4G7H F;  1FWZ A;  2XVC A;  1KU7 A;  2A6H F;  4WXH A;  2X0L A;  1F1Z A;  1ZGA A;  2HOE A;  1FBS A;  3HTS B;  1XMK A;  3DPT A;  2NNY A;  1DDN A;  1IAW A;  2ACJ A;  1LVA A;  4G6Q A;  1Z9C A;  1ONV A;  1O3Q A;  1IZ1 A;  5D8L B;  3VEP A;  2HZT A;  2K02 A;  5DUK A;  4YII A;  5K1Y A;  3F8B A;  2FBH A;  3RDI A;  4UV9 A;  5FGM A;  2OZ6 A;  2IRF G;  3F6O A;  3WTS C;  1MJB A;  2K27 A;  4A0X A;  5HLI A;  3PFI A;  1SD5 A;  2OD5 A;  2ZME B;  5TRD A;  2FA5 A;  2HFH A;  3Q9S A;  3IRR A;  3WGI A;  3F23 A;  1FYM A;  3KP5 A;  1AWC A;  1J9I A;  3G73 A;  4ZYE A;  5JR3 A;  1HKS A;  4IF4 A;  1L3L A;  5E8G A;  5LRS A;  1ZLK A;  1LDJ A;  1EH8 A;  3LAP A;  5ICC A;  5BPI A;  1QQI A;  3F6V A;  4UV8 A;  1FPQ A;  2XAQ A;  1RZ4 A;  2DTR A;  1GXQ A;  3BOQ A;  1U78 A;  4ASN A;  2XHK A;  4O5V A;  3L7W A;  2XKO A;  2MH9 A;  4LGW A;  1BIA A;  4YG2 F;  1TQP A;  5HLG A;  4NQW A;  1IXS B;  1I6X A;  2V6C A;  3IKV A;  4KN7 X;  4NB5 A;  4EJU A;  2DQR A;  4HOB A;  2QBY B;  4JQF A;  1FC3 A;  3DKW A;  3EYY A;  5JFR A;  5HS9 A;  3V7R A;  2VT2 A;  3U9G A;  1MZB A;  2G7H A;  1XN7 A;  5FFZ A;  5D6F A;  5HS7 A;  1IW7 F;  4M6X A;  1QO0 D;  2J5P A;  3IHU A;  3LQR A;  2FQ3 A;  3P9I A;  4KNY A;  3TO6 A;  3VFZ A;  2EV6 A;  4NHJ A;  5DD4 A;  2HYG D;  3I5U A;  3ZMV A;  2O8X A;  1B1B A;  3GW2 A;  1D3Y A;  2F5C A;  4RB0 A;  5BMZ A;  3E5U A;  2VBX A;  2O03 A;  5HDN A;  1T0F A;  2L4A A;  4PGH A;  1IN7 A;  2WV0 A;  3W6J B;  3F8M A;  3KZZ A;  3D0S A;  4OIQ F;  3MFK A;  4S05 A;  1RNL A;  1YW9 A;  2E7W A;  2V1X A;  1KGS A;  1XGO A;  2OQR A;  4BH9 A;  1S29 A;  1Z91 A;  1OMI A;  3L00 A;  3FXR A;  2BGC A;  2EFQ A;  2OA4 A;  1R7J A;  1EV7 A;  3R6S A;  4LFU A;  2EJR A;  5D6E A;  2O0Y A;  3T8R A;  2JRT A;  5BPD A;  3HOT A;  3QPH A;  4I0B A;  4LLL A;  2DO7 A;  2YSR A;  2V79 A;  5E17 F;  1HKT A;  1IN4 A;  2GA2 A;  2ESN A;  3GXO A;  2FMY A;  1ZAO A;  3F22 A;  4PDK A;  3OOP A;  2W25 A;  5ED4 A;  4EQQ A;  1I27 A;  4YFX F;  3KLN A;  1RUO A;  2PG4 A;  1J0R A;  5IT9 Z;  2VE9 A;  5ICG A;  3R61 A;  4MHG A;  3ULQ B;  4M74 A;  3BY6 A;  4AIK A;  1UB9 A;  4KFC A;  4HX8 A;  2X4H A;  3TGN A;  1G3S A;  3M7G A;  4Y13 A;  4LB5 A;  4CXF A;  4ZYD A;  2HTJ A;  4JBA A;  1LQ1 A;  1XB4 A;  2LF7 A;  1R1U A;  4A6E A;  2GIV A;  3GUD A;  5ILS A;  4KIG A;  2MC3 A;  4RB1 A;  3DPL C;  2F2E A;  2V9V A;  2CG4 A;  3F8C A;  5DCM B;  2W57 A;  2VOP A;  2H27 A;  1QGP A;  1DPR A;  2DFI A;  2FML A;  3T8T A;  1HKQ A;  2FU4 A;  2XUB A;  1ZHF A;  5LHI A;  2RDP A;  3GYH X;  5ILV A;  3QP6 A;  5CVI A;  1W7P B;  1F5T A;  3SQN A;  4ESJ A;  1TTY A;  2R7F A;  2PN6 A;  3WTW C;  2PLY A;  4KIF A;  3F3X A;  1BI1 A;  1EH6 A;  2H6B A;  3K69 A;  3E5Q A;  3LWF A;  3I59 A;  4RB2 C;  3ABU A;  3HIF A;  2HDC A;  2W84 A;  2M30 A;  1SD4 A;  4G8X A;  1J59 A;  4HW0 A;  3JAM Z;  3KP2 A;  3H3Z A;  3GF2 A;  4EJW A;  2PBI A;  4EV0 A;  4S04 A;  1SMY F;  3E3V A;  2D2W A;  4RAY A;  4F7Z A;  2CYY A;  3FZV A;  2IT0 A;  4KUM A;  2HS5 A;  3L09 A;  1SFE A;  1L0O C;  3QPT A;  4HQE A;  2QZ8 A;  2IJL A;  1C0W A;  1ZGJ A;  2QWW A;  3BPV A;  5L3F A;  1S7O A;  3K1N A;  5CYV A;  2Y75 A;  2B0L A;  1S6L A;  3M9A A;  4M6Y A;  1BC7 C;  2CQK A;  4Q4Z F;  4AVP A;  2XAG A;  1CGP A;  3CDH A;  3CUQ B;  3TDZ C;  2QQ9 A;  4R8H A;  3I4P A;  3V4G A;  3GFI A;  1BBY A;  5F6F A;  1PP7 U;  1P6R A;  4L5I A;  5CJ9 A;  1REP C;  4ESF A;  2M8E A;  1PUE E;  3FF5 A;  1JE8 A;  1KQ0 A;  2YX4 A;  2DBB A;  3MCZ A;  3HSR A;  2EV0 A;  1ULY A;  1FZP B;  5L3E A;  3EYI A;  2JZY A;  5KK1 A;  3V8J A;  5H6Q A;  3LST A;  3CLO A;  2BV6 A;  1GHC A;  5D5V B;  2NS0 A;  4RGR A;  3FXU A;  1D5V A;  2HQR A;  2VBW A;  1LJ9 A;  2KJB A;  5AON A;  2HWV A;  2MLG A;  1ZG5 A;  3I71 A;  1H9T A;  3IRQ A;  1R23 A;  1UHW A;  1H0M A;  4RS8 A;  1TNT A;  1YS6 A;  4L0Z B;  4I01 A;  4L9J A;  5DEQ A;  3O3K A;  1R5G A;  5CVR A;  3ML6 A;  2VN2 A;  1RIO H;  2HKO A;  2PI0 A;  4GCV A;  1BOA A;  1MDM A;  4CIC A;  3C18 A;  5CLS A;  3RTR A;  3I54 A;  3GO5 A;  2YR2 A;  5EEG A;  3F8N A;  3GLX A;  5L3B A;  1P4A A;  3WTX C;  1J5Y A;  1SFU A;  2J5O A;  4AD9 A;  2HGC A;  4ENN A;  3DP7 A;  1LDK B;  3V7S A;  2RVC A;  3M8F A;  2JPB A;  2Z9O A;  2HEO A;  5F64 A;  1KYW A;  1Z6R A;  4M9S A;  2AXL A;  2H09 A;  3GFL A;  3RI4 A;  3T5X A;  5FO5 A;  2CGP A;  1XSX A;  3HUG A;  5ERI A;  1SD6 A;  2FRH A;  2OBP A;  2IA2 A;  3TOB A;  4WXD A;  3D5L A;  5HLH A;  1TW3 A;  2RKH A;  3HRU A;  4H0E A;  1ZRE A;  2FBK A;  4Q47 A;  3DF8 A;  4GYI A;  3WTT C;  2ESH A;  5BS6 A;  2CW0 F;  2WTE A;  2ISZ A;  3BJA A;  3GX4 X;  1F4K A;  1I1G A;  5K5O A;  1KU9 A;  3MZH A;  1GXP A;  2O61 A;  4L9N A;  3RKW A;  3LA2 A;  2D45 A;  4N9I A;  5LGN A;  2RGV A;  2ZNZ A;  5DD8 A;  1ZRF A;  3PQK A;  3WU0 A;  1NHA A;  3V7C A;  1R36 A;  1LEA A;  1V4R A;  1IXR C;  1B9N A;  4I7H A;  2NRA C;  3ZN0 A;  3ZMU A;  1MDM B;  1ODD A;  1P4W A;  4O6J A;  4KDP A;  3V8L A;  4EM0 B;  4EMS A;  4A6D A;  4OIN F;  2IA0 A;  4N0B A;  3IWF A;  3ZQ7 A;  4XRF A;  3QP5 A;  3DQV C;  1OYY A;  4QLC U;  1FP2 A;  1XSV A;  2DK8 A;  3KZY A;  3I0T A;  1WSU A;  4HBL A;  5HOO A;  2LNB A;  1R5H A;  1MGT A;  3BZ6 A;  1XGM A;  4CZZ A;  1QZY A;  2Z3Y A;  4I09 A;  3GFJ A;  2IPQ X;  2HR3 A;  4HDU A;  2QLZ A;  2P5K A;  2EFN A;  3ROU A;  3T1B A;  1IRF A;  2MH2 A;  3ELK A;  1YQA A;  4UVC A;  5FD6 A;  1BIB A;  2VBY A;  5AIQ A;  2EWN A;  2P6T A;  1K7A A;  1BI3 A;  4GGG A;  3COA C;  3TOA A;  2PMU A;  2RN7 A;  5A2Q K;  2XRO A;  1ZLJ A;  2OQG A;  4ZYH A;  1LDD A;  1DPU A;  2E1C A;  3HSE A;  1XMA A;  1YG2 A;  1QZZ A;  2ADU A;  4U7B A;  2BE5 F;  4IPA A;  1HBX G;  4G94 A;  5CVJ A;  4LMY A;  1G6N A;  2H94 A;  1T6S A;  2DI3 A;  4EJO A;  2GQQ A;  2XAS A;  1UCR A;  1YTY A;  2Y48 A;  1U2W A;  1GVJ A;  1E17 A;  4LB6 B;  1R58 A;  1T39 A;  1HW5 A;  1FYL A;  2R7D A;  4P55 A;  4BHC A;  3J81 K;  5L3G A;  3F8F A;  3HRT A;  2GXG A;  2O6G E;  2CFX A;  1ZN2 A;  1F9N A;  3CO7 C;  5FD5 A;  2QEN A;  1QBJ A;  2ZJ2 A;  2XGX A;  3CJN A;  1Q1H A;  3BRO A;  2VT3 A;  3KP4 A;  4PZJ A;  2H6C A;  3ZMT A;  4GO1 A;  3BJ6 A;  4Q5S F;  2FE3 A;  2D1H A;  1ON1 A;  4G9Y A;  1K6O A;  3DV8 A;  2NNN A;  3SZP A;  2D1V A;  4ETS A;  3CUO A;  3KP3 A;  1YLF A;  5TJJ A;  3T0Y A;  2QQA A;  4BAY A;  4XBF A;  2GA1 A;  1O7F A;  4HAM A;  3JTG A;  4P96 A;  4A0Y A;  1YO5 C;  4RGS A;  3FXQ A;  3QU3 A;  2HYF A;  1S3J A;  3V8K A;  3K1P A;  3JTH A;  2GXB A;  5FFX A;  1A04 A;  1PDN C;  1IN5 A;  1P2F A;  4HZF A;  1FT9 A;  2EFP A;  4HX7 A;  4EGY A;  2VC1 A;  4KA4 A;  5E1W A;  3P7N A;  2L54 A;  4U0W A;  2PQ8 A;  1H9G A;  2Z99 A;  4WX9 A;  1JHH A;  1ZRD A;  4G7O F;  4P9U A;  4ENJ A;  2PJP A;  1BJA A;  4M9X A;  3KEO A;  4ON0 A;  1KU2 A;  4L18 B;  4FHT A;  2XIG A;  4XLN F;  3QOP A;  1ZYR F;  5LEJ A;  1W5T A;  5A2Q Z;  2ZBK A;  4BNC A;  4LG0 A;  1FBU A;  3QU6 A;  5LGT A;  5LHH A;  4EJT A;  2MA3 A;  3RYP A;  4KIC A;  4IRH A;  5DCF A;  1ZRC A;  1ZAR A;  1G3W A;  3HHG A;  2Z5U A;  2A5Y B;  4A0Z A;  2QYO A;  3U1D A;  1UST A;  4O3M A;  3HRM A;  1BC8 C;  3JSO A;  3RYR A;  4CGZ A;  2Q2E A;  4OMZ A;  3J81 Z;  2XV4 S;  5FLX K;  2LF8 A;  5L3D A;  2DT5 A;  2XAH A;  5LRR A;  4MTD A;  1FBQ A;  4E70 A;  2UZK A;  1D8K A;  2XKP A;  2DAO A;  3KP7 A;  3ZMZ A;  5D5W B;  3HHH A;  5E18 F;  5CVV A;  2QVO A;  4HLX A;  1R1V A;  2FOK A;  2FNP A;  1B6A A;  1RI7 A;  5L3C A;  4Q48 A;  4U0Y A;  2CWE A;  1Y0U A;  2EK5 A;  5LGU A;  3RPU A;  2M45 A;  3FM5 A;  5FB2 A;  1FY7 A;  1T98 A;  1MJ9 A;  3FMS A;  1IXC A;  1USS A;  2RV8 A;  4OU0 A;  2TDX A;  4EJV A;  2NAZ A;  1K78 A;  4UNO A;  4A2U A;  5HS8 A;  4LLN A;  4HA8 A;  2FF4 A;  3WTZ A;  1J7K A;  3FMQ A;  3H92 A;  4MTE A;  1SMT A;  1ZH5 A;  3KE2 A;  3TO7 A;  2KIU A;  3I59 B;  4KIB A;  1RUN A;  1HXD A;  2ZNY A;  5D4S A;  2IVM A;  4FT8 A;  3K0L A;  5DUI A;  3MEX A;  4CO8 A;  2OZU A;  4LJZ F;  3TDU C;  4CHU A;  4FX4 A;  5J8F A;  3K9T A;  3ZPL A;  2COM A;  5CVU A;  1OYW A;  3FX3 A;  2C6Y A;  1XCB A;  1KU3 A;  3M8E A;  3C3W A;  3R0A A;  3W6K B;  3ECO A;  4EM1 A;  1G3T A;  1PP8 F;  3MZY A;  3EUH A;  2EFW A;  2F5E A;  1HQC A;  4P5O A;  1U5T C;  4CDG A;  2DQL A;  1O57 A;  5D8K B;  4U0V A;  3Q9V A;  1QNT A;  2EA4 A;  4BYY A;  5LBQ A;  2UXN A;  2Y0M A;  4L0Y B;  2ETH A;  4YIF A;  4XSX F;  4HLY A;  2AS5 F;  2G7U A;  5E1Z B;  4WCG A;  3CO6 C;  5D5U B;  1W7P D;  3B02 A;  3B73 A;  4GXO A;  4LK0 F;  1YS7 A;  2M1B A;  3QAH A;  3R60 A;  2DK5 A;  4BHP A;  4K2E A;  1YW7 A;  1W4M A;  2P8T A;  4MGR A;  1IUY A;  3RKX A;  3N97 A;  1IRG A;  5H20 A;  4OOI A;  5LHG A;  4PCQ A;  1KYZ A;  4M9Z A;  1DUX C;  2P6S A;  4OIO F;  4XLP F;  3BJO A;  5DYM A;  5FLX Z;  1J2X A;  3NQO A;  1T2K A;  1FOK A;  2EV5 A;  1XSD A;  2VE8 A;  2ZME A;  3ZN1 A;  3E6M A;  2A61 A;  5E1X A;  3FMR A;  1HST A;  4KT5 C;  1U5T A;  2A6E F;  2HQN A;  3PQJ A;  3U2R A;  5BOX A;  1MJA A; 
#chains in the Genus database with same CATH topology
 3HOX J;  2KKO A;  2RNJ A;  5ICE A;  5E20 A;  4A5M A;  2R3S A;  3WGG A;  2KIS A;  4EM2 A;  2CUE A;  4Y17 A;  5IYB J;  2E35 A;  1DU6 A;  1PVE A;  2QUF A;  3HTU A;  1N75 A;  2ECB A;  3ZMD A;  3H3U A;  1N78 A;  4CYD A;  3CJR B;  1FIA A;  2JPC A;  3H9Q A;  2STW A;  2FBI A;  3TO9 A;  3J7Y J;  5J40 A;  1SAX A;  2RQP A;  3JW4 A;  4FX0 A;  3WOD F;  1BR1 A;  1K83 J;  4A3F J;  2CQQ A;  2K5C A;  4WWC A;  3KYC B;  4D9J A;  2DOA A;  3VYU B;  1D8J A;  2B63 J;  3L9F A;  1E2X A;  3BR6 A;  1R00 A;  1X2N A;  3LNQ A;  3CCJ I;  1MMS A;  2KT0 A;  2IGN A;  1CF7 A;  3PNV A;  1ON2 A;  1G4D A;  4BAC A;  5E8I A;  2LKP A;  5K5R A;  2VPR A;  1FYK A;  4G12 A;  1V54 H;  4IJA A;  5DS9 A;  3OYG A;  3MAJ A;  3GVA A;  1OR7 C;  4U87 A;  3KLO A;  3MWM A;  1HW1 A;  1WI9 A;  2ZFW A;  1RKW A;  2QCO A;  1XMX A;  1R22 A;  1NH3 A;  3WTV C;  1O7L A;  3DFG A;  1V3F A;  2L9V A;  2QBY A;  1Y8R B;  2VC0 A;  2M7B A;  4AWX B;  1TT0 A;  1UFM A;  4A3E J;  2V1U A;  4A12 A;  5H6R A;  3FWE A;  3ABT A;  4L9T A;  5KVR A;  5KCM A;  1PUF B;  3FHZ A;  2GM4 A;  4DBR A;  5FRM A;  1Z77 A;  2QM3 A;  4I02 A;  2QKM B;  1U8R A;  4A5N A;  1IN6 A;  1RC9 A;  3E97 A;  3M1C A;  4F92 B;  1QA6 A;  2KQR A;  2LC2 A;  3OYJ A;  3QRF F;  1IV6 A;  1JGS A;  3ABK H;  2E2I J;  4UUV A;  3LFK A;  3LA7 A;  4PJM A;  2L7K A;  1T38 A;  2LDU A;  4F52 A;  3HUG B;  1XTA A;  3CCR I;  4LD5 A;  5F0H A;  4XKC A;  2ZKZ A;  4BXF A;  2W85 A;  1AOY A;  4A3M J;  1B72 B;  1U5T B;  3D5S C;  4MQV A;  4XRM A;  1WKM A;  4OIR F;  2OUM A;  1XGS A;  2DTZ A;  4OMY A;  5IT9 K;  2Z33 A;  2IS1 A;  4KMF A;  2WWY A;  3SYT A;  3MVP A;  6PAX A;  1VF9 A;  4BS9 A;  4B09 A;  1R4N B;  2M4G A;  4HF2 A;  2NOJ B;  2XAJ A;  4PFP A;  2M87 A;  3A4C A;  3ZGK A;  5B66 C;  1D1C A;  1ZG1 A;  2NYX A;  1LEB A;  4U88 A;  2VUM J;  3PO2 J;  2BXZ A;  2BVM A;  3I58 A;  3CCM I;  1I5Z A;  3F72 A;  2YX7 A;  4C3I J;  2ELK A;  4UUT A;  3SHF A;  4HX4 A;  1WRJ A;  3BWG A;  1CF7 B;  1OR7 A;  1TWC J;  4TV7 A;  1YFH A;  3DTE A;  4BE1 A;  3BR0 A;  3KIO A;  2N8G A;  4L9V A;  3QYB A;  2F6C A;  4XOP A;  5AIP A;  1OKR A;  1IF1 A;  4N9H A;  4IHS A;  3TED A;  4NDL A;  4UVB A;  2DW4 A;  2HKX A;  2K86 A;  3RIR A;  1KA8 A;  1ZKG A;  4D0P A;  3G6E I;  2BYV E;  2Y31 A;  4AU7 A;  4MEY F;  3OYB A;  4HV6 A;  2VBZ A;  1U6G A;  2OCE A;  1VZ0 A;  1YX5 A;  4ZH4 F;  2QA4 I;  1DP7 P;  3Q5F A;  3FXJ A;  2ISY A;  2IA1 A;  4M6V A;  2JA2 A;  3ZR8 X;  2VJ5 A;  2HDW A;  5HVQ C;  3S2W A;  3OS1 A;  1VFC A;  1IC8 A;  2CV0 A;  3TKY A;  3G3Z A;  1MMG A;  5HNH A;  3WTY C;  2EB7 A;  1G3Y A;  3GTQ J;  1SAN A;  2K7L A;  1YW8 A;  4G7Z F;  4BBS J;  1JHF A;  4I2O A;  2L4M A;  1QPI A;  2UWM A;  1IO2 A;  2KRF A;  4DW6 A;  2W24 A;  5JLW A;  3K1M A;  1OLT A;  3IH3 A;  3BZC A;  3OYA A;  1MSE C;  1TNS A;  2VXZ A;  3J7A O;  1Z6T A;  3I64 A;  2R7S A;  2MLK A;  3IUO A;  2CV2 A;  2XC7 A;  4HSR A;  3C1D A;  2G9W A;  4RB3 C;  1KQ9 A;  1V55 H;  2FNA A;  2HZD A;  2R5Y A;  2F5F A;  2P7V B;  1HLV A;  3J7A Y;  1NG6 A;  4DNC A;  2BEO A;  5F04 A;  1HW2 A;  3DEU A;  3CCS I;  2HXO A;  2MAB A;  4M3F A;  4WXC A;  1FLI A;  2I10 A;  3H0D A;  3KX2 A;  3WU2 C;  2M0C A;  1RKT A;  1B59 A;  1G2H A;  3VOD A;  1LB2 A;  3JAM K;  2VOO A;  3HOS A;  2FX0 A;  1W5S A;  2DA5 A;  3FXO A;  4ZZD A;  2CSO A;  3KP6 A;  1YOV B;  3CTA A;  1R6R A;  5JI6 A;  2WB1 N;  5EZH A;  3S16 J;  3OR1 C;  4HYE A;  4DIQ A;  1O3S A;  3P9K A;  4D7N A;  1YYV A;  4I0A A;  1AA7 A;  3HXL A;  2R7X A;  3GTG J;  2DMT A;  3UKG A;  3TMO A;  4ITV A;  4BXX J;  1FSE A;  2E36 A;  2O3F A;  3ZQH A;  5K7F A;  2MD5 A;  3VB2 A;  1LNW A;  4RGU A;  4DGW B;  1QU3 A;  3LMM A;  1UZC A;  3ZQG A;  1XC5 A;  3JRA A;  4ZDO A;  1XDS A;  3GLL A;  2F5D A;  1Z7U A;  4UY8 I;  4PGG A;  3WTU C;  3BG9 A;  3GTL J;  4PSX A;  5LLQ A;  2H1K A;  1JTX A;  3SFZ A;  4DQ2 A;  1T56 A;  1JKR C;  5DCM A;  2K9L A;  5KHD A;  2LTP A;  1LPQ A;  4ABZ A;  4HF1 A;  3B6C A;  3ERE D;  4MNU A;  4KMU X;  1QHH D;  3MQ0 A;  1BW5 A;  1QHG A;  5LEK A;  4BL0 B;  1J75 A;  1FSH A;  1Y1V J;  2JQ7 A;  2DLL A;  1JXS A;  4XSZ F;  1VTN C;  1ENH A;  3K4J A;  1W7P A;  2X6X A;  4R79 A;  1IV8 A;  3BR1 A;  2NXN B;  4RGX A;  1B8I B;  2Y0S A;  1ETV A;  1ETW A;  2DN0 A;  1U9N A;  3NRV A;  2M4K A;  2Q8K A;  4MQ9 F;  3S1M J;  2FXA A;  2DOE A;  2WAQ A;  2AQF A;  4GRI A;  3M8J A;  1BA5 A;  4MEX F;  3BG6 A;  1YX3 A;  2E1M B;  3SDB A;  1ERD A;  5J6X A;  1OYI A;  4Y15 A;  3TBI A;  4M3D A;  5M3F J;  1O3T A;  4GDF A;  2FEZ A;  1POG A;  4BQN A;  3CUQ C;  4DYR A;  4HQM A;  1XGN A;  2L0K A;  1WQ2 A;  3GWZ A;  2KJC A;  3K7A J;  2HOA A;  3VDX A;  1HDP A;  4IVN A;  1VQ4 I;  1TQM A;  1MKM A;  2R5Y B;  1U9O A;  3DEE A;  5ICF A;  3NEU A;  3KEQ A;  4WF2 A;  3S1Q J;  2M7A A;  4U7D A;  5B5E C;  3ABL H;  3IC7 A;  2OAZ A;  3E6C C;  1P92 A;  1I1S A;  3ZP5 A;  5GPA A;  4HDV A;  5K7Z A;  2JRM A;  2XAF A;  1OJL A;  3GTK J;  1TWA J;  3EDP A;  3TQN A;  3M1E A;  1TBX A;  2GAU A;  1JUM A;  3GZ5 A;  4P1W A;  2EZL A;  4GYG A;  3ZQI A;  2K9Q A;  3WE3 A;  1ZG3 A;  2RQQ A;  5GPC A;  3EET A;  1STZ A;  4PK4 A;  4D1Q A;  4Y33 A;  2A68 F;  1WI3 A;  2E60 A;  4BQA A;  1O3R A;  2MBF A;  4G6D A;  3BPX A;  4AIJ A;  3IWZ A;  3SZT A;  2VON A;  4RAZ A;  2F4I A;  2HPI A;  3O2P E;  1SD7 A;  4PJN A;  2JTV A;  5C44 J;  4M71 A;  4IRG A;  4UXN A;  5HDG A;  4Z2Y A;  4P9F A;  1TQI A;  3K4B A;  1J09 A;  1P4X A;  4EEF G;  1U3E M;  5EG0 A;  2L01 A;  2IW5 A;  4PJ0 C;  3OMY A;  3LOC A;  2PJR A;  2EIJ H;  4JK1 X;  5C4J J;  4M3B A;  1G59 A;  3CJQ B;  5GAH J;  5HDK A;  4ESB A;  3HRS A;  5D4R A;  2CFO A;  2DOD A;  4XOT A;  4XMY A;  1FX7 A;  3CUQ A;  1N25 A;  1HSJ A;  1FMV A;  3SEQ A;  2L3D A;  3JSP A;  3E6D A;  2ZO4 A;  1VQN I;  4LIT A;  4PSW A;  2E5N A;  2ZJP F;  2QQB A;  3GZ6 A;  2COB A;  2RC4 A;  1S8N A;  2YPR A;  3AG1 H;  3R4K A;  3JR9 A;  1OPC A;  1YI2 I;  4M73 A;  4I98 B;  2ZCW A;  3ZRG A;  4BQO A;  1X3U A;  2A3S A;  3IP4 B;  5M5X J;  1ETY A;  4YFN F;  4EGZ A;  1TW2 A;  3L2W A;  4MLO A;  3DKX A;  1T8I A;  4XKV A;  3CC4 I;  5IY5 H;  1X19 A;  1TLH B;  2EFO A;  4XLC A;  4KYW A;  5IP6 A;  3J80 K;  2IP2 A;  4HF0 A;  1IRX A;  5EDN A;  1H89 C;  3S17 J;  2HYJ A;  4B8X A;  5DDG A;  3JRB A;  3CMY A;  3IKT A;  1Y0N A;  1YIT I;  3RPQ A;  4LG0 B;  2YU3 A;  1B4A A;  1WJD A;  4LLG F;  2MG4 A;  3VOE A;  2LOO A;  2K3P A;  2STT A;  1A6I A;  2A69 F;  3AG3 H;  5EEH A;  4BHB A;  2B9S A;  4IHW A;  2GWR A;  5KAF C;  3K2Z A;  1YIO A;  4ZZL A;  1NG7 A;  3QOE A;  5BQT A;  4ENK A;  4B47 A;  2K9M A;  4WK8 F;  3BP8 A;  1Z05 A;  2GBY A;  4RM2 A;  2ELH A;  5DV5 A;  4F3Q A;  3C7J A;  2V1D A;  4V2F A;  4J01 A;  1KQ8 A;  3F9K A;  3FXM A;  1BN5 A;  2JMW A;  5F1R A;  4ENM A;  4HV5 A;  2HI3 A;  3BR5 A;  3TL4 X;  2AHQ A;  2DA2 A;  1AKH B;  5EG0 B;  3OS2 A;  1XD7 A;  3GEZ A;  4E7Z A;  4UHT A;  3PUF A;  1RET A;  4RAF A;  3EQL F;  3LQQ A;  4UB8 C;  2KIF A;  4JX6 A;  3WE2 A;  1T95 A;  2QKL B;  2HTS A;  2H8R A;  2FSW A;  2Q2E B;  1A6Q A;  1OFC X;  3DXJ F;  4CCJ A;  1E3P A;  2UXX A;  3L2C A;  5J4V A;  2DPU A;  3GME A;  2JSC A;  1Q1V A;  2HNH A;  2CRG A;  2L02 A;  3RCO A;  4D5F A;  4BXU A;  3G4S I;  1MIJ A;  4IHT A;  1YE9 A;  2Y2Z A;  5IT3 A;  3W6V A;  1T08 B;  1R1T A;  2L9R A;  3RJP A;  1FP1 D;  3PL8 A;  2YS9 A;  5GP9 A;  5EGO A;  2WAD A;  1R5I D;  5J4Y A;  2JA5 J;  2R7V A;  3NAR A;  4OIP F;  1PJR A;  2DMP A;  3CCU I;  4CCK A;  2LSO A;  3A01 B;  4B43 A;  1XDU A;  2HOS A;  3LA3 A;  1WWX A;  2X1D A;  1SFX A;  4N4N B;  2MSY A;  1VI0 A;  1IN8 A;  2ZXJ A;  4KN4 X;  3REO A;  3JRF A;  1W5C C;  2BW3 A;  1S7A A;  1UHS A;  4YFK F;  4X6A J;  2K4B A;  3DLA A;  4RDU A;  3AAF A;  1Z1D A;  2BBY A;  3ECH A;  4BEH A;  4ZYA A;  4NUB A;  4ZYG A;  3F21 A;  2R93 J;  3FK6 A;  3FDY A;  2EH3 A;  2KIM A;  1MD0 A;  5B3S H;  4W1U A;  5FKK A;  1FNN A;  3PM1 A;  5JLX A;  3FM3 A;  3I53 A;  2ECC A;  3WU1 B;  4C2U A;  3WG9 A;  3ISP A;  1UMQ A;  1UHM A;  3LAJ A;  4B3X A;  1WH5 A;  1EF4 A;  4IL6 C;  3JRH A;  1MSF C;  3DBL B;  3N4M A;  1BI0 A;  1Z0X A;  4IXA A;  4LK1 F;  2E1O A;  4XID A;  2DJN A;  2LP0 A;  3CQZ J;  3QOD A;  1K78 B;  2PMH A;  1MMA A;  2R7W A;  4R1H A;  2Q0O A;  5EEA A;  4D5C A;  3OV8 A;  2K4J A;  3KCC A;  1MMN A;  2CW8 A;  4B3A A;  5JVT A;  2A07 F;  1BI2 A;  3GCM A;  2V6E A;  2DU9 A;  1K79 A;  3ZMS A;  2L7Z A;  3CDL A;  1VND A;  2PEX A;  2ZXH A;  3E5X A;  2WC2 A;  5D5X B;  4IRI A;  4L5J A;  1SVL A;  1BR4 A;  2EA2 A;  3IL2 A;  3LSG A;  1A5J A;  4XN3 A;  3OSG A;  2XRN A;  3RKY A;  4QWQ A;  2BHY A;  1QPM A;  2CO5 A;  3D5R C;  2CQ7 A;  1XPX A;  4EVI A;  1E0E A;  3GFM A;  2EBI A;  1EH7 A;  3BDD A;  2DPD A;  1QZE A;  2LFB A;  1MH3 A;  3KET A;  3ZQC A;  1Z3X A;  3EPZ A;  3Q0U A;  5ILU A;  1DGW Y;  3VYT B;  2KRH A;  2W82 A;  4RLQ A;  1B9M A;  2P5V A;  1QRY A;  2XGD A;  1I6H J;  1AU7 A;  4X0G A;  2PMZ A;  3O6B B;  4E7H A;  3HYI A;  3OWT A;  2E1N A;  2E7X A;  2E19 A;  2R7T A;  2EZH A;  5K7H A;  3K4L A;  3E6B A;  2L7M P;  1X1A A;  5J8C A;  2VOD A;  1Y8Q B;  4LIU A;  3I4N J;  1ETK A;  3P9C A;  2WA0 A;  3J80 Z;  2P5L C;  2WAF A;  4A3G J;  3HSF A;  1XCV A;  1JKQ C;  4XLA A;  5K5Q A;  3VSK A;  4N4O B;  4UVA A;  1IGN A;  4BEH B;  4M72 A;  2P4W A;  4AIH A;  4BJ5 C;  2JT1 A;  3KYD B;  2PFB A;  3BTJ A;  2P7C B;  1IUF A;  2I5U A;  4II3 A;  5JHU A;  3KFW X;  2ME0 A;  1I3Q J;  2O5R A;  2VI6 A;  5JHF A;  2GZW A;  3JRG A;  3WGH A;  2M5W A;  2R0Q C;  3H5R A;  3OSF A;  1XS9 A;  3SXY A;  3R0J A;  1BM9 A;  2OU2 A;  4G7H F;  2XF6 A;  4XON A;  1FWZ A;  2XVC A;  1KU7 A;  3PNT A;  1OCC H;  2KIQ A;  2A6H F;  4WXH A;  2X0L A;  1F1Z A;  1ZGA A;  5IP7 J;  2HOE A;  4KIS A;  2GXA A;  3HOU J;  1HA8 A;  1FBS A;  1ZTR A;  3HTS B;  1XMK A;  4DYC A;  3DPT A;  2KFD A;  2NNY A;  1DDN A;  4BGD A;  2FUG 2;  1IAW A;  5DM6 F;  1NK3 P;  2ACJ A;  1LVA A;  3FXL A;  3FIS A;  4G6Q A;  2LBF B;  1ONV A;  1Z9C A;  1JUS A;  4C2T A;  1O3Q A;  1BL0 A;  1IZ1 A;  1SVM A;  5D8L B;  4E7S A;  3N05 A;  3VEP A;  3G2B A;  1WPK A;  2ZXI A;  1VQK I;  2HZT A;  3FK7 A;  2JVG A;  2K02 A;  1SFK A;  1QVU A;  2VXD A;  3AFH A;  4JOM A;  3Q3S A;  1LE8 A;  3A2K A;  5DUK A;  4A3K J;  3W3C A;  2IEK A;  4YII A;  3S3M A;  5GAE J;  5K1Y A;  3F8B A;  3LSJ A;  3M3Y J;  2FBH A;  3RDI A;  2R7Q A;  3OYF A;  1JJ6 C;  4UV9 A;  5FGM A;  3K70 D;  2OZ6 A;  2IRF G;  2QSF X;  3WG7 H;  3F6O A;  5FKO A;  3RSN A;  3WTS C;  2WBM A;  4MFD A;  1MJB A;  3DWL E;  2K27 A;  4A0X A;  3G71 I;  1GLN A;  2XSD C;  1APL C;  5HLI A;  3PFI A;  1SD5 A;  4HST A;  3DBR B;  3K2A A;  4RBO A;  2OD5 A;  2VLA A;  2ZME B;  5TRD A;  2M8G X;  2FA5 A;  2HFH A;  3EUA A;  3Q9S A;  3WGI A;  3IRR A;  2V1N A;  3KP5 A;  3F23 A;  1FYM A;  1AWC A;  1J9I A;  3G73 A;  4ZYE A;  5JR3 A;  3MKY B;  1HKS A;  4IF4 A;  2IS2 A;  2LKX A;  3FIW A;  5JVG F;  1L3L A;  2IGM A;  3MN2 A;  5E8G A;  5LRS A;  2BZT A;  1ZLK A;  2LKS A;  2V9K A;  1LDJ A;  1EH8 A;  3LAP A;  4KIT B;  4LOC A;  5EYR A;  3MZ8 A;  5ICC A;  5BPI A;  1QQI A;  1OCZ H;  4CYC A;  2QSG X;  1NTC A;  3F6V A;  2HXI A;  4UV8 A;  5F0C A;  1XX5 A;  1FPQ A;  3ZCO A;  2HU9 A;  3MD2 A;  2XAQ A;  1RZ4 A;  3BG5 A;  2DTR A;  1X2M A;  2DMN A;  1GXQ A;  1T0F C;  1S5L C;  3BOQ A;  1U78 A;  2LY2 A;  4ASN A;  2XHK A;  2R7R A;  3OYN A;  4O5V A;  3RPU D;  2R7Z J;  3SEZ A;  3CME I;  2XF5 A;  1OQY A;  3L7W A;  1YJW I;  2XKO A;  4HEA 2;  1A35 A;  4ZDP A;  4I76 A;  3GZN B;  2F4O B;  2MH9 A;  4LGW A;  1BIA A;  2Q1Z B;  4YG2 F;  4UUS A;  1TQP A;  1QVT A;  3JRI A;  5HLG A;  4NQW A;  5LD2 C;  2FJ1 A;  3NAU A;  1IXS B;  1I6X A;  4XLE A;  3L1P A;  2V6C A;  3IKV A;  4KN7 X;  4NB5 A;  3MMY B;  3PNY A;  4EJU A;  2DQR A;  4HOB A;  2QBY B;  2CW7 A;  4JQF A;  1FC3 A;  1ZR2 A;  4IOC F;  2E34 A;  2EIK H;  3DKW A;  1JUP A;  2XRL A;  3EYY A;  3TW7 A;  2LMD A;  3DKY A;  5F27 A;  5JFR A;  2X6W A;  2VKD A;  2KDO A;  5HS9 A;  3V7R A;  2VT2 A;  3U9G A;  1MZB A;  2G7H A;  1XN7 A;  2CH0 A;  5FFZ A;  5D6F A;  5HS7 A;  1WVR A;  4DYQ A;  2K9S A;  3IV5 A;  1IW7 F;  2DT7 B;  4M6X A;  1QO0 D;  2J5P A;  1W36 C;  3GTP J;  3IHU A;  3LQR A;  3ZQF A;  1I3A A;  1VQ7 I;  3E0J B;  3H9J A;  2FQ3 A;  3P9I A;  4KNY A;  3Q0W A;  3ZXS A;  5KNL A;  3TO6 A;  3VFZ A;  2EV6 A;  3L2V A;  2AO9 A;  4NHJ A;  5DD4 A;  2HYG D;  2DA3 A;  3I5U A;  3ZMV A;  5E3O A;  2O8X A;  1B1B A;  3GW2 A;  1BOB A;  2WB1 A;  3A0B C;  1JKO C;  1D3Y A;  5J47 A;  2F5C A;  4RB0 A;  1NK2 P;  2EIN H;  5BMZ A;  3E5U A;  2VBX A;  2O03 A;  2QSH X;  2LVS A;  5HDN A;  3GBG A;  1T0F A;  2L4A A;  4XLH A;  4AYB A;  4PGH A;  2MW8 A;  1IN7 A;  2FD5 A;  2WV0 A;  3W6J B;  1G8X A;  3F8M A;  2EZI A;  3KZZ A;  3D0S A;  2LRD A;  4A3L J;  3CCQ I;  1D5Y A;  4OIQ F;  4RLF A;  4Y52 J;  3MFK A;  4MFE A;  4S05 A;  5FKL A;  1RNL A;  1YW9 A;  2E7W A;  4J19 A;  2V1X A;  2F4M B;  1KGS A;  3AL0 C;  2JUG A;  4UUS B;  2ZSI B;  1XGO A;  2OQR A;  4BH9 A;  1S29 A;  1Z91 A;  3GTO J;  1OMI A;  3L00 A;  4BY1 J;  1X1B A;  3NWS A;  3HKZ A;  3I55 I;  3FXR A;  2BGC A;  2EFQ A;  2NS7 A;  3B6A A;  2OA4 A;  1WFX A;  2VJI A;  1H8A C;  3OYM A;  1R7J A;  3LSM A;  1F36 A;  2NVY J;  1EV7 A;  1WJC A;  4C30 A;  1D1B A;  3R6S A;  3RKQ A;  3AKZ A;  2BY0 A;  4LFU A;  1W1W E;  2EJR A;  5D6E A;  5CPR B;  2O0Y A;  2JK3 A;  3T8R A;  1K6Y A;  2JRT A;  4AC0 A;  5BPD A;  2E2H J;  3HOT A;  2F5V A;  3HBL A;  3QPH A;  4I0B A;  4LLL A;  4LG3 A;  4NC7 A;  3RQI A;  2DO7 A;  3DEW A;  2YSR A;  2V79 A;  5E17 F;  3DU6 A;  1HKT A;  1IN4 A;  4HNT A;  2GA2 A;  3OYE A;  3CMA I;  3LSP A;  2ESN A;  2XPW A;  2FMY A;  3GXO A;  4A69 C;  1ZAO A;  1WJB A;  3A03 A;  4PDK A;  4CZC A;  3F22 A;  2DXI A;  3OOP A;  2W25 A;  1S9H A;  2R5Z A;  3HDD A;  5ED4 A;  5IYC J;  4EQQ A;  2DA6 A;  4PUS A;  2V4J C;  2DA1 A;  3JRC A;  1I27 A;  4IHY A;  4YFX F;  3KLN A;  1RUO A;  2AXT C;  2JA6 J;  2PG4 A;  1J0R A;  5IT9 Z;  4A3D J;  2CMP A;  2VE9 A;  4MHG A;  3R61 A;  3ULQ B;  5ICG A;  1IRZ A;  1JI8 A;  2VIX A;  4M74 A;  3BY6 A;  4AIK A;  1UB9 A;  3HPH A;  4NC8 A;  1Y6I A;  2LYC A;  2BY2 A;  4KFC A;  3H0G J;  4HX8 A;  1GUU A;  4RA2 A;  5EF6 A;  4IO9 F;  2X4H A;  2DMU A;  3WHC A;  1HCR A;  3TGN A;  1G3S A;  3BTL A;  3LSR A;  4HNV A;  3M7G A;  4Y4R A;  4Y13 A;  5F1J A;  4LB5 A;  4CXF A;  4ZYD A;  2LY9 A;  2V7F A;  3CCE I;  2HTJ A;  4JBA A;  5GAG J;  1LQ1 A;  1XB4 A;  2LF7 A;  1R1U A;  4A6E A;  2GIV A;  3GUD A;  5ILS A;  4KIG A;  2MC3 A;  4E7L A;  4RB1 A;  2DJI A;  1V5E A;  3DPL C;  2F2E A;  4J00 A;  2V9V A;  2CG4 A;  3F8C A;  2Y69 H;  3S93 A;  4RMN A;  5DCM B;  1FTZ A;  2W57 A;  2VOP A;  1X3W B;  2H27 A;  2DA7 A;  1QGP A;  1DPR A;  3HZJ A;  2DFI A;  3IH4 A;  2FML A;  4FET A;  3T8T A;  1HKQ A;  2FU4 A;  2XUB A;  4FE7 A;  4AM3 A;  1ZHF A;  2V26 A;  4NNJ A;  5LHI A;  2EIL H;  2RDP A;  3HEF A;  2NVU B;  5ILV A;  3GYH X;  3QP6 A;  5CVI A;  1IJW C;  4LIV A;  4BQQ A;  2VJJ A;  4C3H J;  3SFI A;  1W7P B;  1F5T A;  4XM3 A;  3SQN A;  4ESJ A;  3S15 J;  2XGC A;  2EQR A;  4BJ6 C;  1TTY A;  2F48 A;  2R7F A;  5M5W J;  1ZK8 A;  2R7O A;  2PN6 A;  2KL4 A;  3BR2 A;  1S72 I;  2KMU A;  1JKP C;  3H1C A;  3WTW C;  2PLY A;  2CQX A;  4HRI A;  2M0M A;  3HOZ J;  4KIF A;  2E5Z A;  1I50 J;  1RR8 C;  5HLT A;  1WJ5 A;  3F3X A;  3V42 A;  1BI1 A;  1HDD C;  1EH6 A;  1JJ8 C;  2JSP A;  2H6B A;  2W48 A;  2W1O A;  1OCR H;  3K69 A;  3E5Q A;  3M07 A;  3HL2 A;  2R5Z B;  4B4C A;  3LWF A;  3I59 A;  4RB2 C;  3ABU A;  3CF5 F;  3HIF A;  2HDC A;  2Z16 A;  3SDG A;  2X1C A;  5IOY A;  4C2M J;  4CCL A;  2W84 A;  2M30 A;  1SD4 A;  4AID A;  3IAS 2;  3HB9 A;  4G8X A;  1J59 A;  4HW0 A;  4QPQ A;  3H35 A;  2X6Y A;  3OR2 C;  4E6K G;  4ZTF A;  1BR2 A;  2KP6 A;  3JAM Z;  1LVK A;  1MBG A;  3KP2 A;  4ZC3 A;  3H3Z A;  1U8B A;  3IAM 2;  3GF2 A;  4FCY A;  2IXS A;  3O8G A;  2GOM A;  1MBH A;  5IPA A;  1WHU A;  4EJW A;  4HG2 A;  2PBI A;  1TWF J;  3S14 J;  4EV0 A;  4S04 A;  1X58 A;  1FOW A;  3TW6 A;  2HOT A;  3S1N J;  1SMY F;  3E3V A;  3OYC A;  2D2W A;  4RAY A;  4F7Z A;  2CYY A;  3FZV A;  2IT0 A;  4KUM A;  1EA3 A;  1TP4 A;  2NVX J;  3SZG A;  3W2V A;  2HS5 A;  3L09 A;  5EJC A;  1SFE A;  1L0O C;  3QPT A;  4HQE A;  2QZ8 A;  2IJL A;  3K4C A;  4XRS A;  1TL8 A;  3OY9 A;  1C0W A;  2UUZ A;  1ZGJ A;  1EKE A;  2QWW A;  3L2Q A;  2IS4 A;  3BPV A;  5L3F A;  2LRE A;  2CV1 A;  3VWB A;  2M34 A;  2XDV A;  4BJT A;  2NVT J;  1S7O A;  1VQ9 I;  3K1N A;  2OTL I;  4M3E A;  4W97 A;  5CYV A;  1K4S A;  2PJR B;  2Y75 A;  5J1U A;  4PFO A;  2B0L A;  4L5E A;  1S6L A;  3M9A A;  3FKI J;  4C3J J;  4XN0 A;  4HPQ A;  4M6Y A;  1W0U A;  1BC7 C;  2V9P A;  2CQK A;  4Q4Z F;  4AVP A;  1LFU P;  2XAG A;  2HVR A;  1CGP A;  3CDH A;  3CUQ B;  3TDZ C;  2QQ9 A;  4R8H A;  3I4P A;  4OWR B;  2WV1 A;  3V4G A;  3FKJ A;  3GFI A;  1BBY A;  5F6F A;  1PP7 U;  1P6R A;  4L5I A;  5CJ9 A;  1REP C;  4ESF A;  1VQ5 I;  1FTT A;  2M8E A;  3S3N A;  1PUE E;  2Z1D A;  1SAU A;  3FF5 A;  3OL4 A;  4IQ4 A;  1JE8 A;  1KQ0 A;  2YX4 A;  5M5Y J;  2DBB A;  2TRT A;  4YEJ A;  5LFA A;  2X9D A;  4XR6 A;  3MCZ A;  4ZJZ A;  3HSR A;  2NOG A;  2EV0 A;  2I8D A;  1ULY A;  1FZP B;  5L3E A;  3EYI A;  2AQE A;  2JZY A;  4Y7N J;  4Y3O A;  5KK1 A;  3V8J A;  5H6Q A;  2JA7 J;  4XQF A;  3LST A;  1D0Z A;  3CLO A;  2BV6 A;  3CD6 I;  1GHC A;  5D5V B;  2NS0 A;  1MMD A;  4IHX A;  2G0E A;  4RGR A;  3VSL A;  3FXU A;  3KYL A;  3I4M J;  2DOF A;  4H4K C;  2XPU A;  3DPU A;  4BE0 A;  1D5V A;  1ETO A;  2L9N A;  1VQO I;  3I56 I;  2HQR A;  1JTY A;  2VBW A;  1SC7 A;  1LJ9 A;  2KJB A;  3K4N A;  5AON A;  4PJL A;  3DU5 A;  5FLV A;  4YEL A;  3LSK A;  2HWV A;  2MLG A;  3DTI A;  1YIJ I;  1FEX A;  1ZG5 A;  2IBD A;  3CLQ A;  3H5N A;  2VKH A;  3I71 A;  3IRQ A;  1H9T A;  1R23 A;  3I3L A;  3OIQ A;  2HPM A;  2E2J J;  4XKW A;  1UHW A;  4DZJ A;  1H0M A;  4RS8 A;  2BY1 A;  3TP3 A;  1TNT A;  3RZO J;  3BG3 A;  1YS6 A;  4L0Z B;  1OCP A;  4I01 A;  4L9J A;  3CES A;  5DEQ A;  3O3K A;  4Z6Y A;  1UEL B;  3BT9 A;  1TWH J;  4NC6 A;  2MFZ A;  3E1S A;  1R5G A;  5CVR A;  3ML6 A;  2QF7 A;  2VQH A;  4RM3 A;  2VN2 A;  3DLL F;  4A3C J;  1RIO H;  2HKO A;  2PI0 A;  3C2G A;  5CKT A;  4GCV A;  1BOA A;  4JYK A;  1MDM A;  4CIC A;  3C18 A;  3E7L A;  1D0X A;  5CLS A;  3RTR A;  3I54 A;  3GO5 A;  2YR2 A;  1ETX A;  5EEG A;  3CF2 A;  3F0C A;  3F8N A;  3PSI A;  2XAU A;  3GLX A;  5L3B A;  4F93 B;  1P4A A;  2BXY A;  3WTX C;  1J5Y A;  1SFU A;  5EGO B;  3MKL A;  1GDT A;  4A3B J;  3OIO A;  3WHB A;  2J5O A;  4AD9 A;  2X1E A;  1SVO A;  2ME6 A;  2HGC A;  1V5F A;  3LFU A;  2DYS H;  3DP7 A;  3ZOB A;  4ENN A;  1PUF A;  1LDK B;  1AHD P;  3V7S A;  2RVC A;  3M8F A;  2JPB A;  3MKZ A;  2Z9O A;  2HEO A;  4BY7 J;  5F64 A;  5J1R A;  1KYW A;  1Z6R A;  2BW3 B;  3OOU A;  1LFP A;  4M9S A;  2AXL A;  3KEY A;  2H09 A;  3CCV I;  1OCT C;  2KZV A;  1ZGW A;  3GFL A;  3RI4 A;  3HM5 A;  4JP0 A;  1KON A;  3T5X A;  5FO5 A;  1GV2 A;  2CGP A;  1XSX A;  5H2F C;  3U21 A;  3HUG A;  5ERI A;  1SD6 A;  1DQU A;  2FRH A;  2OBP A;  1P7J A;  1Y56 A;  2A05 A;  1ETQ A;  2LLK A;  2IA2 A;  3TOB A;  5HOD A;  5DM7 F;  2ICW G;  4WXD A;  1B72 A;  3D5L A;  5HLH A;  1TW3 A;  2RKH A;  1Z21 A;  3LL7 A;  2MC4 A;  5FJ8 J;  3HRU A;  4H0E A;  4JX5 A;  1ZRE A;  2FBK A;  2RNG A;  4Q47 A;  3HG9 A;  1YJ9 I;  3DF8 A;  4GYI A;  1OCO H;  2ESH A;  2VQC A;  3QWL A;  5TIS C;  2CW0 F;  5BS6 A;  3WTT C;  3CC7 I;  1HF0 A;  2WY7 Q;  2WTE A;  2ISZ A;  3BJA A;  3PIO F;  3SJM A;  3GX4 X;  1F4K A;  2DDA A;  4HNU A;  1I1G A;  5K5O A;  1KU9 A;  3MZH A;  1GXP A;  2O61 A;  3VYS B;  2D5V A;  4L9N A;  4CCO A;  3RKW A;  3W2A A;  2RRE A;  3LA2 A;  3K6G A;  2D45 A;  4N9I A;  5LGN A;  2RGV A;  5CQE A;  5E3N A;  1FOY A;  2L2O A;  2ZNZ A;  2DFE A;  1MBE A;  1DU0 A;  5DD8 A;  3CCY A;  3UNG C;  2ZJR F;  1ZRF A;  3PQK A;  2ZFU A;  2O9L A;  3WU0 A;  3HOY J;  1NHA A;  5GTI C;  3GTM J;  3V7C A;  2GOX B;  1R36 A;  1LEA A;  2H8W A;  1V4R A;  1IXR C;  1B9N A;  4I7H A;  2NRA C;  3ZN0 A;  3ZMU A;  1MDM B;  1GT0 C;  3G1M A;  1ODD A;  1P4W A;  3CP2 A;  3OIP A;  4O6J A;  3UR3 C;  4KDP A;  2ZB9 A;  2L9S A;  3V8L A;  2O7O A;  1D1A A;  4I99 C;  4EM0 B;  1E3O C;  1ZR4 A;  1YRN A;  2VPL A;  2DT6 A;  4EMS A;  1RPW A;  2LK2 A;  4MO7 A;  4A6D A;  4OIN F;  2IA0 A;  1GV5 A;  4RAG A;  4IHV A;  3BR3 A;  4N0B A;  1XG1 A;  3IWF A;  3ZQ7 A;  4XRF A;  3QP5 A;  3DQV C;  1OYY A;  4QLC U;  1FP2 A;  4XRS G;  4I6Z A;  4BU2 A;  2GLO A;  1XSV A;  4BBR J;  2L7F P;  4X1E A;  1WZ2 A;  2DK8 A;  3KZY A;  2OC6 A;  2HDD A;  3I0T A;  4FE4 A;  1WSU A;  2JN6 A;  4HBL A;  5HOO A;  2LNB A;  3KZI C;  1R5H A;  4FAS D;  5EZG A;  1MGT A;  3BZ6 A;  1XGM A;  2OCC H;  3VYR B;  4CZZ A;  3HGG A;  3EUK L;  3FBN B;  5FKM A;  1QZY A;  2Z3Y A;  1MBK A;  3CC2 I;  3KPH A;  1UG0 A;  2E1M C;  4I09 A;  3GFJ A;  2IPQ X;  4IZZ A;  2HR3 A;  4HDU A;  5E79 C;  2QLZ A;  2R4G A;  4XKB A;  2K9N A;  3HGY A;  2A6T A;  2P5K A;  1X1P A;  2EFN A;  2BHZ A;  3ROU A;  3T1B A;  1IRF A;  4BE2 A;  2CUZ A;  2MH2 A;  3BQZ A;  3ONQ A;  4AVZ A;  3ELK A;  2K40 A;  1YQA A;  4UVC A;  4CCM A;  2TCT A;  1BIB A;  2VJ4 A;  5FD6 A;  2A5W A;  3OYI A;  1FJL A;  2VBY A;  5AIQ A;  2EWN A;  2P6T A;  1K7A A;  2NVQ J;  1BI3 A;  2EPF A;  4GGG A;  3COA C;  3TOA A;  2PMU A;  3BLY A;  2RN7 A;  5A2Q K;  1X1C A;  2XRO A;  1ZLJ A;  3P5J A;  5HNF A;  2OQG A;  4ZYH A;  2K3F A;  1LDD A;  1DPU A;  2E1C A;  3HSE A;  1XMA A;  3QPL A;  1YG2 A;  1QZZ A;  2ELJ A;  1VQM I;  2ADU A;  4U7B A;  1Y1W J;  1LE8 B;  4II2 A;  3CDI A;  3JRE A;  2BE5 F;  4IPA A;  1LKX A;  1HBX G;  2QGU A;  4FIS A;  4XOR A;  2Y9Z A;  4UB6 C;  4CUG A;  4G94 A;  3A0H C;  2LH9 A;  5CVJ A;  1A36 A;  3CCL I;  2FQ4 A;  4LMY A;  4AUX A;  5F08 A;  1YRN B;  2M3A A;  1G6N A;  2PX9 A;  2H94 A;  3PJR A;  1T6S A;  2DI3 A;  4EJO A;  2GQQ A;  2XAS A;  2DMQ A;  2XF7 A;  1UCR A;  4V2G A;  1YTY A;  5BNG A;  2X51 A;  2Y48 A;  1U2W A;  2CUJ A;  1GVJ A;  3BC8 A;  1T33 A;  4LB6 B;  1E17 A;  1DP3 A;  4DOZ A;  1R58 A;  1T39 A;  1B8I A;  1HW5 A;  1FYL A;  2R7D A;  4P55 A;  1SEU A;  4BHC A;  2W7N A;  1YJN I;  3J81 K;  5L3G A;  3F8F A;  2YU9 J;  3HRT A;  3QPS A;  1FMW A;  2GXG A;  4E7J A;  4QIW N;  1LFB A;  4D7M A;  2O6G E;  2CFX A;  1ZN2 A;  3PO3 J;  1F9N A;  1MBJ A;  3CO7 C;  4CYC B;  4XL9 A;  3ZQQ A;  2WY8 Q;  4XIC A;  2VKV A;  5FD5 A;  2MD0 A;  1IG7 A;  2QEN A;  2K85 A;  1QBJ A;  2ZJ2 A;  1ACI A;  2FOW A;  3BZK A;  2XGX A;  3CJN A;  3DTK A;  1Q1H A;  1WJA A;  3BRO A;  1MW7 A;  2VT3 A;  4BKX A;  3KP4 A;  2M2E A;  2LD5 A;  4PZJ A;  1E3H A;  2H6C A;  3HPG A;  4QSH A;  3ZMT A;  4GO1 A;  3BJ6 A;  2OTJ I;  1FOX A;  4Q5S F;  2CS3 A;  2FE3 A;  2D1H A;  3LSH A;  1ON1 A;  4NQW B;  1UAA A;  2Y9Y A;  4G9Y A;  1K6O A;  5IYD J;  4IX7 A;  3DV8 A;  2NNN A;  2ZJQ F;  3VPR A;  4AYB N;  3SZP A;  2DCE A;  1W0T A;  2XGE A;  3DBH B;  2D1V A;  2X6O A;  1EJ9 A;  4ETS A;  3CUO A;  1K61 A;  1HC8 A;  9ANT A;  3KP3 A;  3GTJ J;  3L2U A;  1YLF A;  5TJJ A;  3BG7 A;  3T0Y A;  2JWT A;  2QQA A;  3RQ4 A;  3S3O A;  2CUF A;  4BAY A;  1WJE A;  4XBF A;  1Z7L A;  5B1B H;  2GA1 A;  3OYH A;  1O7F A;  2OV7 A;  4HAM A;  3JTG A;  4P96 A;  4A0Y A;  1O4X A;  1YO5 C;  4RGS A;  3X2Q H;  3FXQ A;  3QU3 A;  4V19 K;  2X85 A;  3HKZ N;  2HYF A;  2ID6 A;  1Z67 A;  1S3J A;  2OJE D;  3V8K A;  1WGX A;  3K1P A;  2NS8 A;  3JTH A;  5DTD A;  4M3G A;  2GXB A;  2KPM A;  1LUJ B;  5FFX A;  1A04 A;  2EZK A;  1PDN C;  1IN5 A;  1P2F A;  4HZF A;  1FT9 A;  2EFP A;  4HX7 A;  2P0W A;  2IGK A;  2XSJ C;  4B48 A;  1DGR M;  4EGY A;  3HOW J;  3BCB A;  2VC1 A;  4KA4 A;  1TC3 C;  2DYR H;  4FQG A;  4QPO A;  5E1W A;  3P7N A;  2Y0S N;  3K70 C;  2L54 A;  4U0W A;  2PQ8 A;  1H9G A;  2Z99 A;  3HC7 A;  4WX9 A;  1JHH A;  2WAQ N;  2H1L A;  1ZRD A;  1PYV A;  2MGQ A;  2CQN A;  4G7O F;  1X3Z B;  2UV1 A;  4P9U A;  4ENJ A;  4E7I A;  4E7K A;  2PJP A;  1BJA A;  5M3M J;  4M9X A;  3FBI B;  3KEO A;  2KDZ A;  4ON0 A;  4B1R A;  3A02 A;  1KU2 A;  5E3L A;  4XLF A;  1R9T J;  4L18 B;  4FHT A;  3AG2 H;  4OAZ A;  4B44 A;  2XIG A;  4XLN F;  2JUC A;  4XK4 A;  2XB0 X;  3QOP A;  1ZYR F;  3G1L A;  5LEJ A;  5FLM J;  4DBQ A;  1R71 A;  1W5T A;  5A2Q Z;  2ZBK A;  3ABM H;  3CMM A;  2Z2S B;  4BNC A;  4LG0 A;  4A3J J;  1FBU A;  4E4H A;  3QU6 A;  3K10 A;  5LGT A;  5LHH A;  4IOA F;  4A3I J;  3BCA A;  2IS6 A;  4EJT A;  3G1O A;  2MA3 A;  2KZG A;  3RYP A;  4KIC A;  1S7E A;  4IRH A;  1R4M B;  2MYS A;  2LG4 A;  5DCF A;  2BVL A;  1ZRC A;  3LSI A;  5FKN A;  2JA8 J;  2LY1 A;  1ZAR A;  1G3W A;  3K4K A;  1ITY A;  3ERM A;  1ZEL A;  2VQL A;  1MH4 A;  3HHG A;  2Z5U A;  3I9V 2;  4CA0 A;  1I39 A;  3S8P A;  2W4S A;  3RZD J;  2A5Y B;  1AKH A;  1P7I A;  4A0Z A;  3BTC A;  3PFY A;  4F91 B;  3C2B A;  2QYO A;  3U1D A;  1UST A;  1MND A;  2ID3 A;  2GIZ A;  2ZC2 A;  4O3M A;  3ZQL A;  3HRM A;  1BC8 C;  3JSO A;  3FHN A;  3RYR A;  2HQA A;  2O8K A;  4CGZ A;  3S32 A;  2Q2E A;  4OMZ A;  3J81 Z;  1N77 A;  4OAY A;  3PUB A;  3K4M A;  2OPT A;  3M4O J;  2XV4 S;  5CQG A;  1X4O A;  1TZL A;  2WAE A;  1M1E B;  3QYF A;  5FLX K;  1U0J A;  3CP8 A;  2LF8 A;  5L3D A;  3OL3 A;  4C9Y A;  2DT5 A;  2XAH A;  5LRR A;  4MTD A;  1FBQ A;  4QTR A;  2B7E A;  4G6T B;  3NWT A;  3MKW B;  4E70 A;  3AL0 B;  5E3M A;  2UZK A;  3D1N I;  1RR7 A;  1D8K A;  3A01 A;  2XKP A;  2DAO A;  5J3L A;  3KP7 A;  3DCF A;  3ZMZ A;  5D5W B;  3HHH A;  3JCU C;  5E18 F;  4CH7 A;  3O8H A;  5GTH C;  5FRN A;  5CVV A;  1Z3Y A;  2QVO A;  4HLX A;  1R1V A;  2FOK A;  1UJ8 A;  3EUH C;  2FNP A;  1B6A A;  4BUP A;  1MNM C;  1RI7 A;  5L3C A;  4Q48 A;  4U0Y A;  2CWE A;  1Y0U A;  4PJJ A;  3H3V K;  2EK5 A;  5LGU A;  3RPU A;  2E71 A;  3C2H A;  2M45 A;  3FM5 A;  1P9Q C;  3S1R J;  2VL8 A;  4CCN A;  1MBF A;  5FB2 A;  1FY7 A;  1T98 A;  3H9G A;  1K4T A;  1MJ9 A;  3FMS A;  1CQT A;  1IXC A;  1USS A;  2RV8 A;  4OU0 A;  2TDX A;  3CJT B;  4A93 J;  1Y39 A;  4EJV A;  2BY3 A;  2NAZ A;  1K78 A;  4UNO A;  2ZXW H;  4A2U A;  5HS8 A;  4LLN A;  1UG2 A;  4HA8 A;  2FF4 A;  3WTZ A;  1J7K A;  4JX4 A;  2P81 A;  3Q0V A;  3FMQ A;  2VAS A;  3H92 A;  4MTE A;  1SMT A;  3FXK A;  1ZH5 A;  2Y30 A;  3KE2 A;  3TO7 A;  2IAI A;  2KIU A;  3I59 B;  4KIB A;  1RUN A;  1HXD A;  4IEJ A;  1VQP I;  2VQG A;  2ZNY A;  5D4S A;  3QQA A;  4NBQ A;  5GAD J;  2DDB A;  2IVM A;  4FT8 A;  3ASN H;  3K0L A;  5DUI A;  3MEX A;  3ASO H;  2M9H A;  4CO8 A;  5IOZ A;  2DFH A;  2OZU A;  2LR8 A;  4LJZ F;  3BQY A;  1RRJ A;  3TDU C;  1MNE A;  4CHU A;  2L5Q A;  4FX4 A;  5J8F A;  2DFF A;  3K9T A;  1ZQ3 P;  3ZPL A;  2COM A;  2HQ5 A;  5CVU A;  5C3E J;  1X1D A;  2KRC A;  1OYW A;  3FX3 A;  2C6Y A;  1KU3 A;  1XCB A;  3M8E A;  3QYE A;  1KZH A;  2JJ7 A;  1A31 A;  3S2D J;  3C3W A;  2QQ8 A;  3R0A A;  3W6K B;  3W2W A;  2ZME C;  3ECO A;  4BDZ A;  4EM1 A;  2JVH A;  5C4X J;  1G3T A;  1PP8 F;  3MZY A;  3EUH A;  2EFW A;  3CZ6 A;  3OYK A;  2ZSH B;  2F5E A;  2BOL A;  1HQC A;  3HJE A;  4P5O A;  1U5T C;  4CDG A;  2DQL A;  1YHQ I;  1O57 A;  3AG4 H;  4U0V A;  5D8K B;  2X48 A;  3Q9V A;  1QNT A;  1RES A;  2EA4 A;  4BYY A;  5LBQ A;  3PIP F;  3L2R A;  2RAE A;  2VKE A;  1JT0 A;  2UXN A;  2Y0M A;  4L0Y B;  3H5A A;  3OYD A;  3PSF A;  1BW6 A;  2ETH A;  4YRV A;  4EAT A;  4YIF A;  4XSX F;  1SFO J;  4YIR X;  1VQ6 I;  3S2H J;  2KLO A;  4HLY A;  4FTH A;  3ESW B;  2AS5 F;  2G7U A;  4F55 A;  2HVS A;  2DA4 A;  5KAI C;  5E1Z B;  5B1A H;  4WCG A;  3JRD A;  5IP9 J;  1FIP A;  3CO6 C;  2VB6 A;  3IH2 A;  1OIS A;  1HOM A;  3H36 A;  5D5U B;  1W7P D;  3B02 A;  3OS0 A;  3B73 A;  4GXO A;  1WH7 A;  4LK0 F;  2HVQ A;  3TP0 A;  1JGG A;  5FRO A;  4BDY A;  1YS7 A;  2LBF A;  2M1B A;  3QAH A;  3R60 A;  1WJF A;  2DK5 A;  4K2E A;  4BHP A;  1W36 D;  2R92 J;  1YW7 A;  3OYL A;  1W4M A;  3J7Z I;  2P8T A;  4IQJ A;  1H88 C;  5TGT A;  4ZTJ A;  4DJA A;  4MGR A;  1WCM J;  1IUY A;  4DZP A;  3RKX A;  1IDY A;  3N97 A;  1IRG A;  2W00 A;  5H20 A;  4OOI A;  5LHG A;  1BJZ A;  4KJZ A;  4PCQ A;  2R7U A;  1KYZ A;  2OF7 A;  4KT6 A;  5J1Y A;  4IKF A;  1VQL I;  4XNF A;  4M9Z A;  1DUX C;  2P6S A;  4OIO F;  3A1Y A;  4MIM A;  4XLP F;  3BJO A;  5DYM A;  5FLX Z;  1J2X A;  1JT6 A;  4GFB A;  2IGO A;  3NQO A;  5F0F A;  1V5G A;  1T2K A;  3HOV J;  1IDZ A;  1FOK A;  2EV5 A;  1XSD A;  2XB5 A;  1ORK A;  2VE8 A;  1TT5 B;  2ZME A;  2XPV A;  3ZN1 A;  2CU7 A;  4ANJ A;  3E6M A;  2A61 A;  1R49 A;  1F43 A;  5E1X A;  3FMR A;  1D0Y A;  1HST A;  4KT5 C;  4S0H B;  1VQ8 I;  1U5T A;  2EIM H;  2A6E F;  4CSW A;  1TWG J;  2CJJ A;  3U1K A;  2HQN A;  3BTI A;  2QEX I;  3PQJ A;  1GVD A;  2PMZ N;  3U2R A;  2KHM A;  2YUS A;  4ZDL A;  1X4P A;  5BOX A;  1MJA A; 
#chains in the Genus database with same CATH homology
 2KKO A;  2RNJ A;  5ICE A;  5E20 A;  4A5M A;  2R3S A;  3WGG A;  4EM2 A;  4Y17 A;  2QUF A;  3HTU A;  3ZMD A;  3H3U A;  4CYD A;  2JPC A;  2STW A;  2FBI A;  3TO9 A;  1SAX A;  2RQP A;  3JW4 A;  4FX0 A;  3WOD F;  4WWC A;  1D8J A;  3L9F A;  1E2X A;  1R00 A;  1CF7 A;  1G4D A;  1ON2 A;  5E8I A;  2LKP A;  5K5R A;  1FYK A;  4IJA A;  3MAJ A;  3GVA A;  3KLO A;  3MWM A;  1HW1 A;  1WI9 A;  2ZFW A;  1R22 A;  3WTV C;  1O7L A;  3DFG A;  1V3F A;  2QBY A;  2VC0 A;  4AWX B;  1UFM A;  2V1U A;  4A12 A;  5H6R A;  3FWE A;  3ABT A;  4L9T A;  5KVR A;  3FHZ A;  2QM3 A;  4I02 A;  1U8R A;  4A5N A;  1IN6 A;  3E97 A;  3QRF F;  1JGS A;  4UUV A;  3LFK A;  3LA7 A;  1T38 A;  2LDU A;  4LD5 A;  2ZKZ A;  2W85 A;  1AOY A;  1U5T B;  4MQV A;  1WKM A;  4OIR F;  1XGS A;  4OMY A;  5IT9 K;  2Z33 A;  4KMF A;  2WWY A;  6PAX A;  4B09 A;  4HF2 A;  2XAJ A;  2M87 A;  1ZG1 A;  2NYX A;  1LEB A;  4U88 A;  3I58 A;  1I5Z A;  3F72 A;  2YX7 A;  3SHF A;  4HX4 A;  1WRJ A;  3BWG A;  1CF7 B;  1OR7 A;  4TV7 A;  1YFH A;  4L9V A;  5AIP A;  1OKR A;  1IF1 A;  4N9H A;  4IHS A;  4UVB A;  2DW4 A;  2HKX A;  2K86 A;  3RIR A;  1KA8 A;  4D0P A;  2BYV E;  4MEY F;  4HV6 A;  2VBZ A;  1U6G A;  1DP7 P;  4ZH4 F;  3Q5F A;  2ISY A;  2IA1 A;  5HVQ C;  3S2W A;  3TKY A;  3G3Z A;  3WTY C;  2EB7 A;  1G3Y A;  2K7L A;  1YW8 A;  4G7Z F;  1JHF A;  4I2O A;  2L4M A;  2UWM A;  2KRF A;  2W24 A;  3K1M A;  1TNS A;  2VXZ A;  3J7A O;  1Z6T A;  3I64 A;  2MLK A;  3C1D A;  2G9W A;  4RB3 C;  1KQ9 A;  2FNA A;  2F5F A;  2P7V B;  4DNC A;  2BEO A;  1HW2 A;  3DEU A;  4WXC A;  1FLI A;  1B59 A;  3VOD A;  1LB2 A;  3JAM K;  2VOO A;  3HOS A;  1W5S A;  4ZZD A;  2CSO A;  3KP6 A;  3CTA A;  5JI6 A;  4HYE A;  1O3S A;  3P9K A;  1YYV A;  4I0A A;  1FSE A;  2O3F A;  2MD5 A;  3VB2 A;  1LNW A;  4RGU A;  1XDS A;  2F5D A;  1Z7U A;  4PGG A;  3WTU C;  5LLQ A;  3SFZ A;  4DQ2 A;  5DCM A;  4HF1 A;  3ERE D;  4MNU A;  4KMU X;  3MQ0 A;  5LEK A;  1J75 A;  1FSH A;  2DLL A;  1JXS A;  4XSZ F;  1VTN C;  1W7P A;  4R79 A;  4RGX A;  3NRV A;  2Q8K A;  4MQ9 F;  2FXA A;  4MEX F;  5J6X A;  1OYI A;  4Y15 A;  1O3T A;  2FEZ A;  3CUQ C;  4HQM A;  1XGN A;  1WQ2 A;  3GWZ A;  2KJC A;  4IVN A;  1TQM A;  1MKM A;  5ICF A;  3NEU A;  3KEQ A;  4WF2 A;  4U7D A;  3IC7 A;  2OAZ A;  3E6C C;  1P92 A;  1I1S A;  3ZP5 A;  4HDV A;  2XAF A;  3EDP A;  3TQN A;  3M1E A;  1TBX A;  2GAU A;  3GZ5 A;  4GYG A;  3WE3 A;  1ZG3 A;  3EET A;  1STZ A;  2A68 F;  4BQA A;  1O3R A;  2MBF A;  4G6D A;  3BPX A;  4AIJ A;  3IWZ A;  3SZT A;  2VON A;  4RAZ A;  3O2P E;  1SD7 A;  2JTV A;  4M71 A;  4IRG A;  4UXN A;  5HDG A;  4Z2Y A;  4P9F A;  1TQI A;  1P4X A;  1U3E M;  2L01 A;  2IW5 A;  4JK1 X;  5HDK A;  4ESB A;  3HRS A;  5D4R A;  1FX7 A;  3CUQ A;  1HSJ A;  2L3D A;  3JSP A;  3E6D A;  2ZO4 A;  2QQB A;  3GZ6 A;  2RC4 A;  1S8N A;  2YPR A;  3R4K A;  1OPC A;  4M73 A;  4I98 B;  2ZCW A;  1X3U A;  2A3S A;  4YFN F;  4EGZ A;  1TW2 A;  2EFO A;  1TLH B;  4KYW A;  3J80 K;  2IP2 A;  4HF0 A;  4B8X A;  5DDG A;  3IKT A;  3RPQ A;  4LG0 B;  2YU3 A;  1B4A A;  4LLG F;  3VOE A;  2STT A;  2A69 F;  5EEH A;  4BHB A;  2GWR A;  3K2Z A;  1YIO A;  4ZZL A;  5BQT A;  4ENK A;  4WK8 F;  3BP8 A;  1Z05 A;  2ELH A;  5DV5 A;  3C7J A;  2V1D A;  1KQ8 A;  1BN5 A;  5F1R A;  4ENM A;  4HV5 A;  1XD7 A;  3GEZ A;  4UHT A;  3EQL F;  3LQQ A;  2KIF A;  3WE2 A;  2HTS A;  2FSW A;  3DXJ F;  2UXX A;  3L2C A;  2DPU A;  2JSC A;  2L02 A;  4BXU A;  4IHT A;  5IT3 A;  1R1T A;  3RJP A;  1FP1 D;  4OIP F;  2LSO A;  1XDU A;  3LA3 A;  1WWX A;  1SFX A;  2ZXJ A;  1IN8 A;  4KN4 X;  3REO A;  1S7A A;  4YFK F;  2K4B A;  3AAF A;  1Z1D A;  2BBY A;  3ECH A;  4ZYG A;  3F21 A;  2KIM A;  1MD0 A;  1FNN A;  3FM3 A;  3I53 A;  3WU1 B;  3WG9 A;  3ISP A;  1UHM A;  3LAJ A;  3N4M A;  1BI0 A;  4LK1 F;  4IXA A;  1K78 B;  2PMH A;  4R1H A;  2Q0O A;  3OV8 A;  2K4J A;  3KCC A;  5JVT A;  2A07 F;  1BI2 A;  2DU9 A;  1K79 A;  3ZMS A;  2PEX A;  3E5X A;  2WC2 A;  5D5X B;  4IRI A;  4L5J A;  2EA2 A;  3IL2 A;  2XRN A;  3RKY A;  4QWQ A;  1QPM A;  2CO5 A;  4EVI A;  3GFM A;  1EH7 A;  3BDD A;  2DPD A;  3KET A;  5ILU A;  1B9M A;  2P5V A;  3O6B B;  3HYI A;  2E1N A;  2E7X A;  3E6B A;  2VOD A;  5J8C A;  3P9C A;  3J80 Z;  2P5L C;  3HSF A;  1XCV A;  5K5Q A;  4UVA A;  4M72 A;  2P4W A;  4AIH A;  2JT1 A;  2PFB A;  2P7C B;  5JHU A;  3KFW X;  2GZW A;  3WGH A;  2M5W A;  3SXY A;  3R0J A;  1BM9 A;  2OU2 A;  4G7H F;  1FWZ A;  2XVC A;  1KU7 A;  2A6H F;  4WXH A;  2X0L A;  1F1Z A;  1ZGA A;  2HOE A;  1FBS A;  3HTS B;  1XMK A;  3DPT A;  2NNY A;  1DDN A;  1IAW A;  2ACJ A;  1LVA A;  4G6Q A;  1Z9C A;  1ONV A;  1O3Q A;  1IZ1 A;  5D8L B;  3VEP A;  2HZT A;  2K02 A;  5DUK A;  4YII A;  5K1Y A;  3F8B A;  2FBH A;  3RDI A;  4UV9 A;  5FGM A;  2OZ6 A;  2IRF G;  3F6O A;  3WTS C;  1MJB A;  2K27 A;  4A0X A;  5HLI A;  3PFI A;  1SD5 A;  2OD5 A;  2ZME B;  5TRD A;  2FA5 A;  2HFH A;  3Q9S A;  3IRR A;  3WGI A;  3F23 A;  1FYM A;  3KP5 A;  1AWC A;  1J9I A;  3G73 A;  4ZYE A;  5JR3 A;  1HKS A;  4IF4 A;  1L3L A;  5E8G A;  5LRS A;  1ZLK A;  1LDJ A;  1EH8 A;  3LAP A;  5ICC A;  5BPI A;  1QQI A;  3F6V A;  4UV8 A;  1FPQ A;  2XAQ A;  1RZ4 A;  2DTR A;  1GXQ A;  3BOQ A;  1U78 A;  4ASN A;  2XHK A;  4O5V A;  3L7W A;  2XKO A;  2MH9 A;  4LGW A;  1BIA A;  4YG2 F;  1TQP A;  5HLG A;  4NQW A;  1IXS B;  1I6X A;  2V6C A;  3IKV A;  4KN7 X;  4NB5 A;  4EJU A;  2DQR A;  4HOB A;  2QBY B;  4JQF A;  1FC3 A;  3DKW A;  3EYY A;  5JFR A;  5HS9 A;  3V7R A;  2VT2 A;  3U9G A;  1MZB A;  2G7H A;  1XN7 A;  5FFZ A;  5D6F A;  5HS7 A;  1IW7 F;  4M6X A;  1QO0 D;  2J5P A;  3IHU A;  3LQR A;  2FQ3 A;  3P9I A;  4KNY A;  3TO6 A;  3VFZ A;  2EV6 A;  4NHJ A;  5DD4 A;  2HYG D;  3I5U A;  3ZMV A;  2O8X A;  1B1B A;  3GW2 A;  1D3Y A;  2F5C A;  4RB0 A;  5BMZ A;  3E5U A;  2VBX A;  2O03 A;  5HDN A;  1T0F A;  2L4A A;  4PGH A;  1IN7 A;  2WV0 A;  3W6J B;  3F8M A;  3KZZ A;  3D0S A;  4OIQ F;  3MFK A;  4S05 A;  1RNL A;  1YW9 A;  2E7W A;  2V1X A;  1KGS A;  1XGO A;  2OQR A;  4BH9 A;  1S29 A;  1Z91 A;  1OMI A;  3L00 A;  3FXR A;  2BGC A;  2EFQ A;  2OA4 A;  1R7J A;  1EV7 A;  3R6S A;  4LFU A;  2EJR A;  5D6E A;  2O0Y A;  3T8R A;  2JRT A;  5BPD A;  3HOT A;  3QPH A;  4I0B A;  4LLL A;  2DO7 A;  2YSR A;  2V79 A;  5E17 F;  1HKT A;  1IN4 A;  2GA2 A;  2ESN A;  3GXO A;  2FMY A;  1ZAO A;  3F22 A;  4PDK A;  3OOP A;  2W25 A;  5ED4 A;  4EQQ A;  1I27 A;  4YFX F;  3KLN A;  1RUO A;  2PG4 A;  1J0R A;  5IT9 Z;  2VE9 A;  5ICG A;  3R61 A;  4MHG A;  3ULQ B;  4M74 A;  3BY6 A;  4AIK A;  1UB9 A;  4KFC A;  4HX8 A;  2X4H A;  3TGN A;  1G3S A;  3M7G A;  4Y13 A;  4LB5 A;  4CXF A;  4ZYD A;  2HTJ A;  4JBA A;  1LQ1 A;  1XB4 A;  2LF7 A;  1R1U A;  4A6E A;  2GIV A;  3GUD A;  5ILS A;  4KIG A;  2MC3 A;  4RB1 A;  3DPL C;  2F2E A;  2V9V A;  2CG4 A;  3F8C A;  5DCM B;  2W57 A;  2VOP A;  2H27 A;  1QGP A;  1DPR A;  2DFI A;  2FML A;  3T8T A;  1HKQ A;  2FU4 A;  2XUB A;  1ZHF A;  5LHI A;  2RDP A;  3GYH X;  5ILV A;  3QP6 A;  5CVI A;  1W7P B;  1F5T A;  3SQN A;  4ESJ A;  1TTY A;  2R7F A;  2PN6 A;  3WTW C;  2PLY A;  4KIF A;  3F3X A;  1BI1 A;  1EH6 A;  2H6B A;  3K69 A;  3E5Q A;  3LWF A;  3I59 A;  4RB2 C;  3ABU A;  3HIF A;  2HDC A;  2W84 A;  2M30 A;  1SD4 A;  4G8X A;  1J59 A;  4HW0 A;  3JAM Z;  3KP2 A;  3H3Z A;  3GF2 A;  4EJW A;  2PBI A;  4EV0 A;  4S04 A;  1SMY F;  3E3V A;  2D2W A;  4RAY A;  4F7Z A;  2CYY A;  3FZV A;  2IT0 A;  4KUM A;  2HS5 A;  3L09 A;  1SFE A;  1L0O C;  3QPT A;  4HQE A;  2QZ8 A;  2IJL A;  1C0W A;  1ZGJ A;  2QWW A;  3BPV A;  5L3F A;  1S7O A;  3K1N A;  5CYV A;  2Y75 A;  2B0L A;  1S6L A;  3M9A A;  4M6Y A;  1BC7 C;  2CQK A;  4Q4Z F;  4AVP A;  2XAG A;  1CGP A;  3CDH A;  3CUQ B;  3TDZ C;  2QQ9 A;  4R8H A;  3I4P A;  3V4G A;  3GFI A;  1BBY A;  5F6F A;  1PP7 U;  1P6R A;  4L5I A;  5CJ9 A;  1REP C;  4ESF A;  2M8E A;  1PUE E;  3FF5 A;  1JE8 A;  1KQ0 A;  2YX4 A;  2DBB A;  3MCZ A;  3HSR A;  2EV0 A;  1ULY A;  1FZP B;  5L3E A;  3EYI A;  2JZY A;  5KK1 A;  3V8J A;  5H6Q A;  3LST A;  3CLO A;  2BV6 A;  1GHC A;  5D5V B;  2NS0 A;  4RGR A;  3FXU A;  1D5V A;  2HQR A;  2VBW A;  1LJ9 A;  2KJB A;  5AON A;  2HWV A;  2MLG A;  1ZG5 A;  3I71 A;  1H9T A;  3IRQ A;  1R23 A;  1UHW A;  1H0M A;  4RS8 A;  1TNT A;  1YS6 A;  4L0Z B;  4I01 A;  4L9J A;  5DEQ A;  3O3K A;  1R5G A;  5CVR A;  3ML6 A;  2VN2 A;  1RIO H;  2HKO A;  2PI0 A;  4GCV A;  1BOA A;  1MDM A;  4CIC A;  3C18 A;  5CLS A;  3RTR A;  3I54 A;  3GO5 A;  2YR2 A;  5EEG A;  3F8N A;  3GLX A;  5L3B A;  1P4A A;  3WTX C;  1J5Y A;  1SFU A;  2J5O A;  4AD9 A;  2HGC A;  4ENN A;  3DP7 A;  1LDK B;  3V7S A;  2RVC A;  3M8F A;  2JPB A;  2Z9O A;  2HEO A;  5F64 A;  1KYW A;  1Z6R A;  4M9S A;  2AXL A;  2H09 A;  3GFL A;  3RI4 A;  3T5X A;  5FO5 A;  2CGP A;  1XSX A;  3HUG A;  5ERI A;  1SD6 A;  2FRH A;  2OBP A;  2IA2 A;  3TOB A;  4WXD A;  3D5L A;  5HLH A;  1TW3 A;  2RKH A;  3HRU A;  4H0E A;  1ZRE A;  2FBK A;  4Q47 A;  3DF8 A;  4GYI A;  3WTT C;  2ESH A;  5BS6 A;  2CW0 F;  2WTE A;  2ISZ A;  3BJA A;  3GX4 X;  1F4K A;  1I1G A;  5K5O A;  1KU9 A;  3MZH A;  1GXP A;  2O61 A;  4L9N A;  3RKW A;  3LA2 A;  2D45 A;  4N9I A;  5LGN A;  2RGV A;  2ZNZ A;  5DD8 A;  1ZRF A;  3PQK A;  3WU0 A;  1NHA A;  3V7C A;  1R36 A;  1LEA A;  1V4R A;  1IXR C;  1B9N A;  4I7H A;  2NRA C;  3ZN0 A;  3ZMU A;  1MDM B;  1ODD A;  1P4W A;  4O6J A;  4KDP A;  3V8L A;  4EM0 B;  4EMS A;  4A6D A;  4OIN F;  2IA0 A;  4N0B A;  3IWF A;  3ZQ7 A;  4XRF A;  3QP5 A;  3DQV C;  1OYY A;  4QLC U;  1FP2 A;  1XSV A;  2DK8 A;  3KZY A;  3I0T A;  1WSU A;  4HBL A;  5HOO A;  2LNB A;  1R5H A;  1MGT A;  3BZ6 A;  1XGM A;  4CZZ A;  1QZY A;  2Z3Y A;  4I09 A;  3GFJ A;  2IPQ X;  2HR3 A;  4HDU A;  2QLZ A;  2P5K A;  2EFN A;  3ROU A;  3T1B A;  1IRF A;  2MH2 A;  3ELK A;  1YQA A;  4UVC A;  5FD6 A;  1BIB A;  2VBY A;  5AIQ A;  2EWN A;  2P6T A;  1K7A A;  1BI3 A;  4GGG A;  3COA C;  3TOA A;  2PMU A;  2RN7 A;  5A2Q K;  2XRO A;  1ZLJ A;  2OQG A;  4ZYH A;  1LDD A;  1DPU A;  2E1C A;  3HSE A;  1XMA A;  1YG2 A;  1QZZ A;  2ADU A;  4U7B A;  2BE5 F;  4IPA A;  1HBX G;  4G94 A;  5CVJ A;  4LMY A;  1G6N A;  2H94 A;  1T6S A;  2DI3 A;  4EJO A;  2GQQ A;  2XAS A;  1UCR A;  1YTY A;  2Y48 A;  1U2W A;  1GVJ A;  1E17 A;  4LB6 B;  1R58 A;  1T39 A;  1HW5 A;  1FYL A;  2R7D A;  4P55 A;  4BHC A;  3J81 K;  5L3G A;  3F8F A;  3HRT A;  2GXG A;  2O6G E;  2CFX A;  1ZN2 A;  1F9N A;  3CO7 C;  5FD5 A;  2QEN A;  1QBJ A;  2ZJ2 A;  2XGX A;  3CJN A;  1Q1H A;  3BRO A;  2VT3 A;  3KP4 A;  4PZJ A;  2H6C A;  3ZMT A;  4GO1 A;  3BJ6 A;  4Q5S F;  2FE3 A;  2D1H A;  1ON1 A;  4G9Y A;  1K6O A;  3DV8 A;  2NNN A;  3SZP A;  2D1V A;  4ETS A;  3CUO A;  3KP3 A;  1YLF A;  5TJJ A;  3T0Y A;  2QQA A;  4BAY A;  4XBF A;  2GA1 A;  1O7F A;  4HAM A;  3JTG A;  4P96 A;  4A0Y A;  1YO5 C;  4RGS A;  3FXQ A;  3QU3 A;  2HYF A;  1S3J A;  3V8K A;  3K1P A;  3JTH A;  2GXB A;  5FFX A;  1A04 A;  1PDN C;  1IN5 A;  1P2F A;  4HZF A;  1FT9 A;  2EFP A;  4HX7 A;  4EGY A;  2VC1 A;  4KA4 A;  5E1W A;  3P7N A;  2L54 A;  4U0W A;  2PQ8 A;  1H9G A;  2Z99 A;  4WX9 A;  1JHH A;  1ZRD A;  4G7O F;  4P9U A;  4ENJ A;  2PJP A;  1BJA A;  4M9X A;  3KEO A;  4ON0 A;  1KU2 A;  4L18 B;  4FHT A;  2XIG A;  4XLN F;  3QOP A;  1ZYR F;  5LEJ A;  1W5T A;  5A2Q Z;  2ZBK A;  4BNC A;  4LG0 A;  1FBU A;  3QU6 A;  5LGT A;  5LHH A;  4EJT A;  2MA3 A;  3RYP A;  4KIC A;  4IRH A;  5DCF A;  1ZRC A;  1ZAR A;  1G3W A;  3HHG A;  2Z5U A;  2A5Y B;  4A0Z A;  2QYO A;  3U1D A;  1UST A;  4O3M A;  3HRM A;  1BC8 C;  3JSO A;  3RYR A;  4CGZ A;  2Q2E A;  4OMZ A;  3J81 Z;  2XV4 S;  5FLX K;  2LF8 A;  5L3D A;  2DT5 A;  2XAH A;  5LRR A;  4MTD A;  1FBQ A;  4E70 A;  2UZK A;  1D8K A;  2XKP A;  2DAO A;  3KP7 A;  3ZMZ A;  5D5W B;  3HHH A;  5E18 F;  5CVV A;  2QVO A;  4HLX A;  1R1V A;  2FOK A;  2FNP A;  1B6A A;  1RI7 A;  5L3C A;  4Q48 A;  4U0Y A;  2CWE A;  1Y0U A;  2EK5 A;  5LGU A;  3RPU A;  2M45 A;  3FM5 A;  5FB2 A;  1FY7 A;  1T98 A;  1MJ9 A;  3FMS A;  1IXC A;  1USS A;  2RV8 A;  4OU0 A;  2TDX A;  4EJV A;  2NAZ A;  1K78 A;  4UNO A;  4A2U A;  5HS8 A;  4LLN A;  4HA8 A;  2FF4 A;  3WTZ A;  1J7K A;  3FMQ A;  3H92 A;  4MTE A;  1SMT A;  1ZH5 A;  3KE2 A;  3TO7 A;  2KIU A;  3I59 B;  4KIB A;  1RUN A;  1HXD A;  2ZNY A;  5D4S A;  2IVM A;  4FT8 A;  3K0L A;  5DUI A;  3MEX A;  4CO8 A;  2OZU A;  4LJZ F;  3TDU C;  4CHU A;  4FX4 A;  5J8F A;  3K9T A;  3ZPL A;  2COM A;  5CVU A;  1OYW A;  3FX3 A;  2C6Y A;  1XCB A;  1KU3 A;  3M8E A;  3C3W A;  3R0A A;  3W6K B;  3ECO A;  4EM1 A;  1G3T A;  1PP8 F;  3MZY A;  3EUH A;  2EFW A;  2F5E A;  1HQC A;  4P5O A;  1U5T C;  4CDG A;  2DQL A;  1O57 A;  5D8K B;  4U0V A;  3Q9V A;  1QNT A;  2EA4 A;  4BYY A;  5LBQ A;  2UXN A;  2Y0M A;  4L0Y B;  2ETH A;  4YIF A;  4XSX F;  4HLY A;  2AS5 F;  2G7U A;  5E1Z B;  4WCG A;  3CO6 C;  5D5U B;  1W7P D;  3B02 A;  3B73 A;  4GXO A;  4LK0 F;  1YS7 A;  2M1B A;  3QAH A;  3R60 A;  2DK5 A;  4BHP A;  4K2E A;  1YW7 A;  1W4M A;  2P8T A;  4MGR A;  1IUY A;  3RKX A;  3N97 A;  1IRG A;  5H20 A;  4OOI A;  5LHG A;  4PCQ A;  1KYZ A;  4M9Z A;  1DUX C;  2P6S A;  4OIO F;  4XLP F;  3BJO A;  5DYM A;  5FLX Z;  1J2X A;  3NQO A;  1T2K A;  1FOK A;  2EV5 A;  1XSD A;  2VE8 A;  2ZME A;  3ZN1 A;  3E6M A;  2A61 A;  5E1X A;  3FMR A;  1HST A;  4KT5 C;  1U5T A;  2A6E F;  2HQN A;  3PQJ A;  3U2R A;  5BOX A;  1MJA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...