3N97A

Rna polymerase alpha c-terminal domain (e. coli) and sigma region 4 (t. aq. mutant) bound to (up,-35 element) dna
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
53
structure length
53
Chain Sequence
b'SKLSEREAMVLKMRKGLIDGREHTLEEVGAYFGVTRERIRQIENKALRKLRHP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA polymerase sigma factor
publication title Combined structural model for a transcription activation assembly
rcsb
source organism Thermus aquaticus
molecule tags Gene regulation/dna
total genus 19
structure length 53
sequence length 53
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3n97A00
2IJLA 2QBYB 2IP2A 4A0XA 5A2QZ 5LRSA 3ZMSA 1ZLKA 1XD7A 5BPDA 2W57A 2QM3A 1B59A 2EK5A 3RYRA 3CUOA 1LDKB 1O7FA 5J8CA 4BXUA 3GX4X 1RUNA 3BROA 1TNTA 1LEAA 2EFNA 3QP6A 4CHUA 1YYVA 4AD9A 2WV0A 3E6BA 3F22A 2PFBA 1Z7UA 2MLKA 3M8EA 1OYIA 3ABUA 1I6XA 3H3ZA 4PGHA 3FMSA 4RS8A 4KDPA 3M8FA 2XROA 4N9IA 4IF4A 4MEXF 2XAFA 3BWGA 2QYOA 4KA4A 3T8TA 5J8FA 3WE3A 2LSOA 4Q47A 4KICA 1LEBA 1IN5A 5BOXA 2M8EA 1Z05A 1AOYA 1IN4A 3KCCA 1D8KA 3JAMK 1ZYRF 2G7UA 1YS7A 3HTUA 3ZMVA 5IT3A 3TO9A 4M6XA 4UV9A 1Z6RA 3GUDA 3ZN1A 3HRSA 1H0MA 1ZG5A 3E5XA 2W84A 4OOIA 1OR7A 4BHCA 1FBQA 1T39A 2Y0MA 3QAHA 3ZQ7A 1DPUA 3CUQB 1FX7A 3LAJA 2IA2A 1FP1D 5K5OA 2FMLA 1EH7A 2LKPA 2HQNA 2XAJA 1HKQA 1KU7A 3V8JA 1B9MA 4CDGA 4JBAA 2HFHA 3TOAA 3KEOA 3ML6A 3I0TA 3C3WA 3JTGA 3GFIA 4P55A 2OA4A 3I53A 4BNCA 1IAWA 2FE3A 3HSEA 2NRAC 1REPC 4M6YA 4OU0A 1MDMA 1IF1A 2LNBA 5ED4A 3N97A 1SD7A 3I58A 2LF7A 1QQIA 4G9YA 1CF7A 2O61A 1UHWA 4U7DA 3K1NA 5LHIA 1F1ZA 2GWRA 4ZYGA 1J7KA 3C7JA 2EFWA 4HBLA 1F9NA 1YQAA 2V9VA 4A5MA 5D5UB 2OBPA 3VODA 3F8CA 2P5VA 1SFXA 3ECOA 4CGZA 3FMRA 4HF0A 1S7AA 1W4MA 4RGXA 1Z91A 5F6FA 5E17F 4GXOA 2YX4A 3RDIA 2QZ8A 2RNJA 2AS5F 1FY7A 4E70A 1IXRC 1MKMA 1HKSA 2BEOA 1YS6A 4I02A 4L5IA 1G3YA 2CWEA 4ESFA 2FBIA 3LQQA 2OQGA 4LGWA 2BE5F 3J7AO 1FYKA 2W25A 2L02A 1JHHA 3DEUA 1ZLJA 2JPCA 3KFWX 1LJ9A 2FA5A 2FRHA 3GZ6A 2CQKA 1PP7U 4IRIA 4EGZA 1IZ1A 5L3BA 1IRGA 4EJUA 2M30A 3W6KB 4U7BA 2PJPA 3HHHA 4LLLA 2DBBA 2TDXA 4G7HF 4DNCA 4WXHA 3QU3A 2K86A 4L9NA 1LNWA 1QZZA 2RQPA 3FMQA 1LVAA 4MNUA 5F1RA 2GXBA 4EVIA 3F72A 5ICEA 3JSOA 4LG0B 1ULYA 3EQLF 4RAYA 3BZ6A 2VOOA 2O8XA 1R22A 2OZUA 3J80K 4G6QA 5DCFA 4KYWA 4BQAA 4TV7A 2HKOA 2V1DA 1K79A 2ZBKA 3LA2A 1WSUA 1IXSB 3WTVC 1OYWA 4IJAA 4OINF 2HDCA 1H9GA 1USTA 2FNPA 2ZJ2A 1B4AA 2MLGA 4BHBA 3Q5FA 3CTAA 3CO7C 2A61A 4GGGA 2OQRA 2ZMEB 2RKHA 4JK1X 4RGRA 4R79A 1D8JA 4HV5A 1K78A 4YIFA 2VE8A 3GZ5A 1ZRCA 1KQ8A 5CLSA 2XVCA 1OKRA 2XV4S 1Z1DA 1PUEE 4YG2F 4O3MA 4AVPA 5JHUA 5D8KB 2IA0A 5CJ9A 4EM0B 3I5UA 3VOEA 1BC8C 2A07F 2VC0A 1GHCA 1FC3A 1J0RA 2ISZA 1ZGJA 3WGHA 3QOPA 3F23A 1I27A 2FQ3A 1DP7P 3BPVA 4WWCA 2ESHA 1JGSA 2KJBA 4IXAA 1UCRA 5BS6A 2ZO4A 2FSWA 1IUYA 2D1VA 5E1WA 4FX0A 1R1TA 2VC1A 3IHUA 4LD5A 2R3SA 4MTDA 4G94A 2GA2A 3OV8A 1MJ9A 1YW9A 4NB5A 3EYYA 1WQ2A 3PQJA 1KU9A 5FO5A 3LAPA 3GO5A 1RI7A 3V8LA 2A69F 2IA1A 1ZREA 3COAC 2CO5A 5LHHA 2EWNA 3PFIA 1HKTA 1NHAA 2Z3YA 3U1DA 1TNSA 4M9ZA 2MBFA 1O57A 5D5XB 2FBKA 4WXCA 3K9TA 2XIGA 2Q0OA 2GQQA 5L3GA 5LEJA 3EDPA 3F8NA 2Y48A 3HSRA 1B1BA 1PP8F 3BJAA 2V1XA 4EM2A 3WTWC 3TKYA 4UNOA 1K7AA 3BOQA 3HTSB 1O3SA 3W6JB 2F5DA 5LEKA 5DCMB 3K0LA 1FWZA 5ILUA 1QPMA 2RDPA 1XDUA 4OMZA 2ZXJA 3QP5A 3KP5A 5HDNA 3PQKA 5ERIA 1HBXG 1P4WA 1VTNC 1ONVA 1R5GA 4HX4A 2EA4A 3F6OA 3QPTA 4P9UA 2DK8A 3BDDA 1FYMA 3E6DA 2PG4A 3KP2A 3IRQA 4LB6B 2Y75A 1QZYA 4HLYA 3WTXC 1EH8A 3J81K 3R0AA 2DAOA 2JSCA 1KYZA 4HZFA 4AWXB 1W5SA 4RB2C 1SMTA 1XSXA 1SD5A 2EV5A 2ISYA 5LRRA 4MQVA 5FLXZ 2DU9A 3KP3A 2R7DA 3SFZA 2JPBA 4CYDA 3O6BB 1J9IA 5FFZA 3SQNA 2CW0F 3I59B 2WWYA 4ZYHA 1R23A 1R36A 4LLNA 3BY6A 4KIBA 4IHSA 4BHPA 3HOTA 2IPQX 2QENA 4LLGF 1S7OA 3DV8A 4A5NA 3CJNA 5E8GA 1SMYF 3ZMTA 2RN7A 3U9GA 2O03A 6PAXA 2DLLA 2L54A 1DPRA 4QLCU 2HTJA 4RAZA 3KP4A 4WX9A 2QQAA 4EM1A 3FX3A 4ESJA 4U0WA 2UWMA 4IPAA 1JE8A 2D1HA 4LK1F 4I09A 3GW2A 4IRGA 4IVNA 2X0LA 1ZG1A 1HW1A 1UFMA 2ETHA 2Z9OA 3MEXA 3ZPLA 2KIMA 4L9TA 2XUBA 4S04A 3TGNA 2QWWA 2HTSA 4G7OF 3U2RA 1WKMA 4A0ZA 2OU2A 1P92A 3GF2A 2H94A 1PDNC 3KP7A 3WTZA 3AAFA 1DDNA 1ZH5A 1YFHA 5JR3A 4L9VA 2GZWA 1XB4A 3ABTA 3GVAA 5DV5A 5JFRA 3ZN0A 1O7LA 1QNTA 4ASNA 3ERED 3JAMZ 2H09A 5HLIA 3I71A 1SD6A 5DD8A 4JQFA 3LA7A 2E7WA 1KQ9A 1BI1A 3Q9VA 1BIAA 1BM9A 3FXUA 4O5VA 1J5YA 1S29A 1FPQA 3ISPA 5ILVA 5HDGA 4EJVA 1WI9A 3IL2A 2R7FA 4A6DA 4DQ2A 1WRJA 2NAZA 1IXCA 1MJBA 3V7SA 5L3EA 5HLHA 1YTYA 1U78A 3M9AA 2XAHA 4KNYA 5LGNA 4YIIA 2VN2A 4ESBA 3O3KA 3VFZA 2HYGD 3ZP5A 3WTYC 3WU1B 4ENKA 2DI3A 4I01A 4CZZA 1FSEA 1QO0D 4P9FA 4AIKA 3B02A 4Y17A 3G73A 1R7JA 4KT5C 5FD5A 2DPDA 2QQ9A 1E2XA 4GCVA 1K6OA 5E1XA 3F21A 5HS7A 3LQRA 2FF4A 5HDKA 3MAJA 2EFQA 1U5TA 4UXNA 2M45A 3ROUA 2XRNA 1FLIA 1MD0A 1EV7A 1ON2A 5JVTA 2J5PA 4S05A 5LGTA 4H0EA 2PLYA 4QWQA 2DFIA 3ECHA 1JHFA 2VODA 3O2PE 5L3FA 3R60A 4A2UA 1IRFA 3FM5A 1XGNA 3VEPA 1MDMB 3WTSC 4YFXF 3F8BA 4OMYA 3H92A 1CF7B 3ULQB 2RC4A 4ETSA 1Y0UA 5H6QA 5EEGA 5E8IA 2KJCA 1HQCA 2PBIA 3KZYA 4I7HA 1KYWA 1RUOA 3E3VA 3CO6C 4EJTA 4OIQF 3HRTA 3GFLA 5ILSA 1IN7A 3RYPA 4I2OA 1FZPB 2M1BA 2D45A 4ZH4F 2RVCA 3GXOA 3SXYA 2HOEA 1W7PA 3GYHX 2IRFG 4EV0A 1YG2A 2GIVA 4L0YB 2VOPA 4HX8A 2W85A 4PCQA 2OD5A 5DEQA 3I64A 1XN7A 2H27A 5FFXA 1KQ0A 3MWMA 5K5RA 5BMZA 1SFUA 4L5JA 2XAGA 4ZZDA 2DTRA 2Z99A 3E6MA 2M87A 1HSJA 5D4SA 4RGSA 1XDSA 2V1UA 3GFJA 2JTVA 4UVBA 5KK1A 2MH2A 5D5WB 5CVRA 4KFCA 2HEOA 3GFMA 3NRVA 1R58A 2EA2A 3IKVA 5H6RA 3RKXA 2UXNA 1RIOH 1HW2A 5BQTA 3I54A 3LWFA 2L4MA 2P6TA 3V7RA 1BI3A 1HSTA 4XRFA 3DQVC 5CYVA 4M71A 4ENMA 2JRTA 1STZA 5DUKA 5DD4A 2P7CB 1I5ZA 2A3SA 3QU6A 1F5TA 4OIPF 4GYGA 3L09A 3L2CA 3HYIA 4KIFA 2FU4A 3IWFA 3FXQA 4BH9A 3SHFA 2Q2EA 1ZRDA 1P6RA 4LFUA 4G6DA 2P5LC 3N4MA 1XGMA 4N0BA 1EH6A 5L3CA 4CXFA 1K78B 1T38A 3KLOA 1YW8A 5HOOA 4KUMA 3H3UA 4UHTA 5DUIA 3E6CC 2K7LA 3E5QA 1J75A 3CDHA 1S3JA 1D3YA 4RB3C 1SAXA 2LDUA 4RB0A 4IHTA 2V79A 5EEHA 4MHGA 2O0YA 4NHJA 2RGVA 4ZYDA 3BJOA 5D5VB 5D8LB 4A12A 1KU3A 5DDGA 1G3TA 3CUQC 2XASA 3TOBA 1IN6A 2XKPA 2ZKZA 2H6CA 1IW7F 2PEXA 3EUHA 4PDKA 5D6EA 3V8KA 3VB2A 1LDJA 2BYVE 1ODDA 4MEYF 4HQEA 3DKWA 3WTTC 4D0PA 1ON1A 4L0ZB 1KU2A 1RNLA 4PZJA 3FXRA 4XBFA 2IT0A 2HS5A 1V4RA 4HW0A 1OMIA 2W24A 2Z33A 5BPIA 4Y15A 4M74A 2MA3A 2QVOA 4A6EA 1FYLA 1B6AA 4AIHA 1A04A 1ZAOA 2A68F 2ACJA 3FM3A 1TBXA 3BJ6A 1ZARA 3GEZA 2GA1A 3RIRA 3DP7A 5HLGA 1AWCA 1QGPA 1T0FA 2JT1A 1FBSA 2K27A 2BV6A 1U6GA 1TLHB 1TTYA 2QBYA 1BI2A 4ON0A 2HKXA 5FGMA 2ZFWA 1Z6TA 1O3RA 5ICGA 3WTUC 2DQLA 3F6VA 3JTHA 2UZKA 3RKYA 1R1UA 4R8HA 3T1BA 1TQMA 3WODF 4G7ZF 1D5VA 1UHMA 3J81Z 2V6CA 2IW5A 2A6HF 4EGYA 1U5TC 3KETA 3S2WA 1KGSA 4Y13A 3T8RA 5F64A 4M9XA 5A2QK 1G4DA 2L01A 4WK8F 4Z2YA 2L4AA 5IT9Z 2MC3A 2MH9A 1TW3A 4I0BA 5KVRA 3HIFA 2A5YB 3M1EA 4KMUX 4RB1A 3L7WA 1B9NA 3BP8A 3RJPA 5K1YA 3IC7A 4XSZF 5H20A 3T5XA 1T6SA 5LLQA 1I1GA 4N9HA 5AONA 1LQ1A 3TO6A 2E1CA 3TO7A 2LF8A 1XMAA 2NS0A 2XAQA 1MZBA 2DQRA 3P7NA 1ZGAA 1RZ4A 1R1VA 2CG4A 2EFPA 2UXXA 3MZHA 5CVVA 5E20A 3K2ZA 4UVCA 3NQOA 2PMHA 3KP6A 5HVQC 2KRFA 4EQQA 3P9CA 1BC7C 3CUQA 3EETA 1SD4A 2ELHA 2JZYA 2Q8KA 3TQNA 2J5OA 1ZRFA 3FHZA 2O6GE 2NNNA 4UUVA 3ELKA 2FXAA 3MFKA 2EV0A 3OOPA 1FSHA 3L00A 2M5WA 1USSA 3NEUA 2FMYA 4WCGA 3FF5A 2A6EF 2QQBA 1BOAA 1L0OC 2X4HA 2CFXA 1ZHFA 1TQIA 3M7GA 3K1MA 1MGTA 1W7PD 1U3EM 4F7ZA 5K5QA 2BBYA 3ZMZA 2DPUA 4BYYA 3WGGA 3JW4A 4HAMA 3DPLC 4MTEA 4EMSA 1YLFA 5ICFA 3F8FA 4HQMA 1G6NA 2B0LA 2F5CA 2GAUA 2YR2A 3TDUC 3D5LA 1GXPA 1OPCA 4YFNF 4FT8A 3JSPA 2WC2A 2P4WA 4P96A 4ENJA 2VBZA 4CICA 1G3SA 4M9SA 5HS9A 1YIOA 2KKOA 4EJWA 1BN5A 3HRUA 3KZZA 3V7CA 5AIPA 4PGGA 2QLZA 4CO8A 1LB2A 5JI6A 3R61A 2F5EA 3CLOA 2FBHA 3P9IA 3BPXA 2STTA 4HYEA 3GWZA 1TW2A 3ZMUA 4Q48A 2STWA 1BJAA 2DT5A 1BI0A 1FOKA 3DXJF 5CVIA 1XCBA 4M73A 3MCZA 1F4KA 4HF1A 3K1PA 2K4JA 1BIBA 1IN8A 4GYIA 1J2XA 2KIFA 4RGUA 1BBYA 4XSXF 1MJAA 2ADUA 2DK5A 3IWZA 3QRFF 1U2WA 2L3DA 3DPTA 1I1SA 1P4XA 3IRRA 5FB2A 1O3TA 1Q1HA 1UB9A 2F5FA 4HDUA 4LG0A 3SZPA 1WWXA 4B8XA 3HHGA 2GXGA 2YX7A 2O3FA 1FT9A 1U5TB 4YFKF 3REOA 2XHKA 4K2EA 3DFGA 4ENNA 3C1DA 1P4AA 3RTRA 4OIRF 5LGUA 4A0YA 1XGSA 5AIQA 1XMKA 4ZYEA 2CYYA 2P8TA 2EJRA 2ZCWA 4KMFA 2ZNYA 4HDVA 4U0YA 1V3FA 3K69A 1H9TA 4O6JA 5TJJA 5DYMA 2ZMEA 1FBUA 3TDZC 5LBQA 2OZ6A 1YW7A 3G3ZA 4Q4ZF 2XGXA 1Z9CA 1ZG3A 5E1ZB 3RPQA 2EV6A 1R00A 5HS8A 1C0WA 2FOKA 4R1HA 4IRHA 2NNYA 1HXDA 2COMA 3LA3A 4L18B 1HW5A 3QPHA 4MQ9F 3J80Z 1L3LA 4HV6A 2HGCA 2D2WA 2HQRA 1GVJA 2HYFA 5TRDA 4HX7A 3R6SA 1G3WA 3LSTA 2HR3A 3MQ0A 3FZVA 1W7PB 1ZN2A 2DO7A 4B09A 2CGPA 4U0VA 3RI4A 5J6XA 3F3XA 4UVAA 1O3QA 1X3UA 2F2EA 3WE2A 2OAZA 2G9WA 2YU3A 3HOSA 3T0YA 4OIOF 2PQ8A 4P5OA 4L9JA 2Z5UA 4AIJA 3HSFA 3Q9SA 3LFKA 4HOBA 2KIUA 4KN4X 4G8XA 3RKWA 2P5KA 5ICCA 4NQWA 2P6SA 2AXLA 2VONA 1YO5C 2YPRA 5D6FA 2VBYA 3B73A 5DCMA 4WF2A 2FEZA 2NYXA 2RV8A 3P9KA 3MZYA 3GLXA 2E7XA 2YSRA 2EB7A 2VE9A 2BGCA 3WGIA 4FX4A 3I4PA 3C18A 3E5UA 4XLNF 3WU0A 1GXQA 4MGRA 4LK0F 2ESNA 3HRMA 2C6YA 4I0AA 2EFOA 5FD6A 5E18F 2HZTA 3KLNA 2WTEA 2PMUA 2VBXA 5CVUA 4Q5SF 1LDDA 3ZMDA 2QUFA 2VT3A 3IKTA 4WXDA 4KIGA 4EJOA 4HA8A 4LJZF 2PN6A 4XLPF 2E1NA 4KN7X 3D0SA 4HF2A 3KE2A 1R5HA 3F8MA 3KEQA 3WG9A 5LHGA 1FP2A 2DW4A 1CGPA 4LB5A 2G7HA 4ZZLA 5L3DA 2HWVA 4GO1A 3I59A 4LMYA 1U8RA 2K4BA 1XGOA 1P2FA 1JXSA 3FWEA 3EYIA 3R0JA 3L9FA 3R4KA 5D4RA 3DF8A 1T2KA 3V4GA 4HLXA 1S6LA 4I98B 1XSVA 2K02A 2ZNZA 1TQPA 1DUXC 5FLXK 2FNAA 2H6BA 1E17A 2IVMA 1XCVA 3HUGA 2VBWA 1W5TA 2CSOA 5CVJA 2PI0A 4U88A 1QBJA 1SFEA 4BAYA 5IT9K 2P7VB 2MD5A 2XKOA 1J59A 2VXZA 1S8NA 1KA8A 1OYYA 4FHTA 3RPUA 4UV8A 3SZTA 1FNNA 3E97A 1XSDA 2VT2A 1T98A 4M72A
chains in the Genus database with same CATH superfamily
2ZXHA 2IJLA 2QBYB 3TBIA 2CW7A 2IP2A 4A0XA 5A2QZ 1DGWY 3LMMA 5LRSA 2JK3A 5GPCA 3ZMSA 3EUAA 1ZLKA 2K3FA 3KYDB 4BE2A 2R7ZJ 2E2JJ 1XD7A 3VYSB 5BPDA 2W57A 2QM3A 3IH4A 3K4LA 4FTHA 4AM3A 3F0CA 1B59A 2EK5A 3RYRA 3CUOA 1JTYA 1LDKB 1O7FA 5J8CA 1P7IA 4BXUA 3GX4X 2EQRA 1RUNA 3BROA 1TNTA 1LEAA 3GTMJ 2Y0SA 2EFNA 3QP6A 4CHUA 4HNTA 4IEJA 1YYVA 4KJZA 4M3GA 1ZGWA 2M7BA 4AD9A 3CJTB 3BR3A 2WV0A 4J00A 2KHMA 1G8XA 3E6BA 3F22A 2ZJRF 2PFBA 3VSKA 1YX5A 1Z7UA 4IHVA 5FJ8J 2MLKA 4GDFA 4A93J 3M8EA 1OYIA 4AUXA 4A3KJ 4E4HA 1OCZH 3W2WA 3ABUA 1RRJA 1JUMA 5JHFA 5IYCJ 1I6XA 5J40A 1UJ8A 4XLEA 4E7JA 2R4GA 2L9RA 3H3ZA 3S3NA 1MBGA 4PGHA 2DA2A 3FMSA 4RS8A 1BA5A 4KDPA 3M8FA 2XROA 1HF0A 4N9IA 4M3FA 5J4YA 2L5QA 4IF4A 2BY3A 3DTEA 3L2VA 4MEXF 2XAFA 3BWGA 2QYOA 1H89C 3B6AA 3T8TA 4KA4A 5J8FA 3WE3A 2LSOA 4Q47A 1S72I 4KICA 1Y0NA 1LEBA 2QSHX 3VPRA 1OQYA 3A0BC 1IN5A 3KYLA 4CCLA 2M8EA 4EEFG 5BOXA 1Z05A 3ZQLA 1AOYA 4B3AA 1IN4A 2NVTJ 3KCCA 5FRMA 3OYMA 1R5ID 1D8KA 2B63J 3JAMK 2LMDA 3RZOJ 2V6EA 1ZYRF 2G7UA 1YS7A 1R71A 4ANJA 3HTUA 1SVMA 3ZMVA 2NVUB 5IT3A 3TO9A 4M6XA 2CV1A 4LG3A 2QF7A 3DPUA 3PUFA 3BT9A 4UV9A 1Z6RA 1X1BA 2Y30A 2O8KA 3GUDA 3WHCA 3ZN1A 2K9SA 1NK2P 4CH7A 2K9LA 3HRSA 3OYAA 3I4MJ 3A01B 3CCSI 1H0MA 1ZG5A 3E5XA 3NWSA 2W84A 5EF6A 4I76A 4OOIA 4A3CJ 3UKGA 1OR7A 4BHCA 1FBQA 1T39A 2Y0MA 1FMWA 3LNQA 5F1JA 3QAHA 3W2AA 1WJEA 3ZQ7A 2VKDA 1DPUA 4S0HB 2LREA 2ECCA 2PJRA 1AA7A 3HB9A 2OPTA 3CUQB 1FX7A 1QZEA 3LAJA 2IA2A 1FP1D 5K5OA 5GTIC 2FMLA 2YUSA 1EH7A 3BR6A 2L7KA 2LKPA 2H8RA 2HQNA 3W3CA 2XAJA 1K4TA 2EBIA 2EPFA 1ETOA 3ZOBA 1HKQA 1Z67A 1KU7A 3V8JA 1B9MA 4CDGA 1BW5A 3AG2H 4JBAA 3S1QJ 5JLWA 1YX3A 2BW3B 2HFHA 2VI6A 1T8IA 3TOAA 3KYCB 3KEOA 3ML6A 4XORA 3I0TA 2GM4A 1LE8B 1YHQI 3C3WA 3JTGA 4RAGA 3SDGA 3GFIA 4HSRA 4P55A 2OA4A 3I53A 3SDBA 4BNCA 1IAWA 2IGNA 4J19A 3I4NJ 3HOUJ 2FE3A 3HSEA 1EA3A 1BOBA 3HOWJ 2IGMA 2NRAC 1REPC 4M6YA 4OU0A 1MDMA 1IF1A 2LNBA 3BQYA 5ED4A 3N97A 1SD7A 3I58A 2ZSHB 2LF7A 5CQEA 1QQIA 3CMAI 3HGGA 1FOWA 4G9YA 4CSWA 1CF7A 2O61A 1UHWA 4F91B 4U7DA 3CC7I 3SFIA 3K1NA 1ERDA 3GMEA 3CCEI 3J7YJ 5LHIA 1F1ZA 3MKYB 2OTJI 3VYTB 2GWRA 2DOAA 1GVDA 3FXLA 2CW8A 1VQ6I 4ZYGA 1BR2A 2Y9YA 2QKMB 1J7KA 3C7JA 2EFWA 2CQ7A 4HBLA 1F9NA 1YQAA 2V9VA 4A5MA 5D5UB 4M3BA 2NOGA 5F0FA 2HOTA 5FLVA 1DU6A 2OBPA 2JRMA 4PUSA 3RKQA 3VODA 3U21A 1FOYA 1OISA 3F8CA 2FQ4A 1A31A 1N78A 2FD5A 1SFXA 2P5VA 3ECOA 3K4CA 3CZ6A 4CGZA 3FMRA 4D1QA 4HF0A 4CUGA 1S7AA 2RREA 3DBLB 1W4MA 2LC2A 4RGXA 3MZ8A 4GRIA 2LK2A 3IAM2 1HC8A 1Z91A 5F6FA 4XL9A 3H0DA 5E17F 4GXOA 2YX4A 3RDIA 2QZ8A 3BG3A 1I50J 2KQRA 3FXMA 3K6GA 2RNJA 2AS5F 1FY7A 4E70A 1IXRC 1MKMA 2W7NA 1HKSA 1G59A 5C44J 2BEOA 1YS6A 3OL3A 4I02A 4L5IA 1JTXA 1VZ0A 4B3XA 1G3YA 2CWEA 4X0GA 2JVHA 4ESFA 2V4JC 2FBIA 3LQQA 2OQGA 4LGWA 2BE5F 3J7AO 1FYKA 4F52A 1QHHD 2W25A 2L02A 3B6CA 1U9OA 1JHHA 3DEUA 5DTDA 1ZLJA 1B72B 3OYCA 2JPCA 3KFWX 1LJ9A 2FA5A 4JX4A 2LKXA 3HDDA 4QPOA 2FRHA 2XB0X 3GZ6A 2CQKA 2AO9A 2R5YB 1PP7U 4IRIA 4EGZA 1IZ1A 5L3BA 1IRGA 1OCPA 4EJUA 2M30A 3W6KB 3G2BA 4U7BA 2PJPA 3HHHA 2DA3A 4LLLA 2DBBA 2TDXA 4G7HF 1R4MB 4DNCA 3L2WA 4Y33A 2LVSA 3N05A 1Y56A 4WXHA 1FMVA 3QU3A 2LD5A 2K86A 4GFBA 1Y8QB 1LNWA 1QZZA 2RQPA 3BG6A 4L9NA 3OS2A 3FMQA 1LVAA 1ZKGA 4MNUA 3LSPA 2MD0A 5F1RA 2ZFUA 2GXBA 3JRIA 4EVIA 2BOLA 1LPQA 4CCOA 3F72A 5ICEA 1T33A 3JSOA 3CCVI 1JT0A 2NS8A 1E3HA 2M8GX 4LG0B 1ULYA 2E34A 3EQLF 1WHUA 4RAYA 3BZ6A 3GZNB 2VOOA 2O8XA 3BCBA 3OS0A 5IYDJ 1R22A 2KZGA 2OZUA 3J80K 4G6QA 5DCFA 4B48A 4KYWA 4BQAA 4TV7A 2HKOA 2V1DA 3C2HA 3FXKA 3LSMA 1W1WE 1D1BA 3BTJA 1K79A 2ZBKA 2IGKA 1X1AA 4C2UA 2HQ5A 1PJRA 3LA2A 4HSTA 3OYJA 1WSUA 1IXSB 2QA4I 3VSLA 3WTVC 1OYWA 4IJAA 3HKZA 1JJ6C 4C30A 4OINF 1RKTA 2WAQA 2HDCA 1Y39A 1H9GA 1USTA 1ETQA 2FNPA 3MKZA 2ZJ2A 1B4AA 1HLVA 4NDLA 2MLGA 4BHBA 3Q5FA 3CTAA 4PFPA 3S8PA 3CO7C 2A61A 4GGGA 2WV1A 2OQRA 2ZMEB 2RKHA 4IQ4A 4JK1X 4RGRA 2PMZA 4R79A 4UUTA 3H3VK 1D8JA 4HV5A 3IV5A 2FUG2 3HJEA 5GP9A 2NVXJ 4HEA2 1K78A 4YIFA 3AFHA 1K4SA 2VE8A 3GZ5A 1VFCA 3ASOH 1ZRCA 1KQ8A 5CLSA 2XVCA 1OKRA 4X6AJ 2XV4S 5FROA 3FK7A 1Z1DA 1PUEE 4YG2F 2KL4A 4V19K 4O3MA 4AVPA 5JHUA 5D8KB 2IA0A 5CJ9A 2Z2SB 4EM0B 2DA7A 3I5UA 3VOEA 2DOEA 4IL6C 4XN0A 5FKLA 1BC8C 1QPIA 2A07F 2VC0A 1GHCA 1WJAA 1FC3A 1J0RA 3FISA 2ISZA 1ZGJA 3JRAA 3RPUD 5FKNA 3WGHA 3QOPA 3CDIA 1I27A 3PSFA 3F23A 2FQ3A 3JRHA 1DP7P 3CESA 1RETA 3BPVA 2BVMA 4WWCA 2ESHA 1JGSA 4RLQA 2KJBA 5GPAA 4IXAA 1UCRA 5BS6A 4A3GJ 2M4GA 2ZO4A 2FSWA 3P5JA 1IUYA 2D1VA 1GUUA 5E1WA 4RBOA 4FX0A 4IKFA 1R1TA 3QYEA 5F27A 2DA1A 2VC1A 3IHUA 5LFAA 2L7ZA 4LD5A 4FE7A 1OCTC 3ERMA 1B8IA 2R3SA 4MTDA 2KDZA 5HODA 3BR5A 4G94A 1DGRM 2GA2A 4ZYAA 3OV8A 1MJ9A 3BCAA 1YW9A 1T95A 4BY1J 4NB5A 3EYYA 3SZGA 1WQ2A 2OUMA 3PQJA 1KU9A 5FO5A 3GTJJ 3LAPA 4BXFA 5H2FC 2DFFA 3GO5A 2HI3A 2WB1A 1RI7A 3V8LA 2A69F 2IA1A 3UR3C 4BXXJ 4IQJA 1ZREA 3COAC 2CO5A 5LHHA 2EWNA 3PFIA 1HKTA 1NHAA 2Z3YA 3PSIA 3U1DA 4BE0A 3HEFA 1TNSA 4M9ZA 3ZQCA 4XNFA 4DBRA 2MBFA 1O57A 5D5XB 2EZIA 2FBKA 3EPZA 4WXCA 5GAEJ 2B9SA 4NQWB 3K9TA 2XIGA 2Q0OA 3ZQQA 2GQQA 3CF2A 5L3GA 5LEJA 3EDPA 3F8NA 2Y48A 3HSRA 4HNVA 1B1BA 1PP8F 3BJAA 2V1XA 4EM2A 3WTWC 4CA0A 1X3WB 2KIQA 3TKYA 4UNOA 4C3HJ 1K7AA 3BOQA 3JREA 3HTSB 1O3SA 2X1CA 4OWRB 1IV8A 3W6JB 3C2GA 2XAUA 2F5DA 5LEKA 4RM2A 5DS9A 5DCMB 4A3BJ 3K0LA 3O8HA 1RKWA 2CQNA 1FWZA 5ILUA 1QPMA 2RDPA 1XDUA 2LFBA 4XICA 4XM3A 4OMZA 2ZXJA 3QP5A 5FKOA 4F93B 1YRNA 3KP5A 5HDNA 3PQKA 5ERIA 3H9JA 5J47A 1ZR4A 1HBXG 2W4SA 3H5NA 1IJWC 1GV2A 1P4WA 1VTNC 2ZJQF 1ONVA 4BEHB 3JRDA 3K10A 5GAGJ 3CF5F 2F4OB 1MBEA 1R5GA 1R6RA 3S2DJ 2VIXA 2AQFA 2EA4A 3BQZA 4HX4A 3F6OA 2WAQN 3QPTA 4P9UA 2DK8A 1F43A 1Z77A 3BDDA 1FTZA 1FYMA 4BBSJ 3E6DA 2PG4A 3KP2A 3J7ZI 3IRQA 2EZHA 4XOTA 4LB6B 4CYCA 2Y75A 2LBFB 2PMZN 1MNMC 1QZYA 3FBNB 4HLYA 3WTXC 4F55A 1EH8A 1LVKA 1E0EA 2LP0A 3U1KA 3S15J 3JRGA 3BR1A 3TW6A 3J81K 5B1BH 3R0AA 2XDVA 4D9JA 2DAOA 1X58A 5CPRB 2JSCA 3PO3J 1U9NA 1KYZA 4HZFA 4AWXB 5M5WJ 1W5SA 4RB2C 1SMTA 4RM3A 1XSXA 1SD5A 2EV5A 2K9NA 4DIQA 3CCQI 4KISA 5C4XJ 2L9NA 2BZTA 2ISYA 2GBYA 2W82A 3LSHA 2DU9A 3KP3A 4MQVA 2R7DA 5LRRA 3SFZA 5FLXZ 5EZGA 2JPBA 2FOWA 5EG0A 4CYDA 2DDBA 3O6BB 1J9IA 2LY1A 5FFZA 3SQNA 2CW0F 1QA6A 3I59B 2M34A 2WWYA 1V5EA 4ZYHA 1R23A 1R36A 3CP8A 4LLNA 3GBGA 5DM7F 1MMAA 3BY6A 2R7RA 4KIBA 4IHSA 4BHPA 3HOTA 2IPQX 2QENA 4LLGF 3BR0A 1S7OA 3DV8A 1Z3XA 4A5NA 2P0WA 3CJNA 3QWLA 2L0KA 5E8GA 2JA7J 1HOMA 4XQFA 5B66C 1SMYF 5IOYA 4DYRA 1PYVA 3ZMTA 2RN7A 1K61A 3U9GA 2O03A 2QEXI 1FOXA 3E1SA 3HUGB 1MW7A 1PUFA 2KRCA 3BG5A 1I6HJ 6PAXA 2DLLA 1A36A 2L54A 1DPRA 4QLCU 2HTJA 2VQGA 4RAZA 3BR2A 5EYRA 3KP4A 4WX9A 1OFCX 4UUSB 1RC9A 2QQAA 2DMNA 1J09A 4EM1A 3FX3A 3E7LA 4ESJA 4U0WA 2X6YA 3OL4A 2WB1N 3BC8A 4XRSA 2UWMA 1EF4A 2K5CA 3AG3H 3AL0C 4IPAA 2H8WA 5CQGA 1BR4A 2DYRH 4JX6A 1JE8A 2D1HA 4PJJA 4LK1F 5HNHA 3OS1A 4I09A 3GW2A 2ECBA 2X6OA 4IRGA 5EZHA 4IVNA 2X0LA 1ZG1A 5K7FA 1HW1A 1UFMA 3TW7A 1IGNA 2ETHA 5B1AH 1UELB 1HDDC 1VQOI 2OTLI 2Z9OA 4AYBN 3MEXA 3OYHA 3ZPLA 2KIMA 2E71A 2JA5J 4L9TA 2XUBA 4XKBA 4S04A 3TGNA 2QWWA 2QSGX 2VL8A 2R7UA 2HTSA 4BY7J 2IS2A 4G7OF 3U2RA 1MMSA 3KIOA 4C3IJ 5KHDA 1WKMA 2R7WA 4A0ZA 2F5VA 2OU2A 1IC8A 1P92A 3GF2A 3M1CA 1ETKA 3BZKA 2H94A 3HM5A 4M3EA 3OYDA 2DMQA 2TRTA 4BBRJ 1IO2A 5E3LA 1PDNC 3KP7A 3Q0VA 3RCOA 2N8GA 5FRNA 2R7TA 3WTZA 5GADJ 3K4MA 4M3DA 2QGUA 3AAFA 1DDNA 3FKIJ 1ZH5A 1JKRC 2VPLA 4NNJA 1YFHA 1WJ5A 3DCFA 5JR3A 1V54H 4L9VA 2GZWA 1XB4A 3NWTA 3S2HJ 3ABTA 3PNVA 3GVAA 4IOAF 3V42A 3H5AA 5DV5A 3A03A 5JFRA 2MG4A 2EILH 3ZN0A 4A3IJ 1O7LA 4PK4A 4F92B 1QNTA 4ASNA 1X2NA 3ERED 4QPQA 4BJ6C 1QVTA 3JAMZ 2H09A 5HLIA 3I71A 1SD6A 3OR1C 5DD8A 2L7FP 4JQFA 3LA7A 2E7WA 2HVRA 3A1YA 1KQ9A 1BW6A 4LOCA 3PNTA 3I55I 1BI1A 3DU5A 3Q9VA 1BIAA 1BM9A 3A0HC 2KT0A 3C2BA 3FXUA 4B47A 1IDYA 5GTHC 4O5VA 1J5YA 2DODA 2OCEA 2L2OA 3OYNA 1S29A 1FPQA 3ISPA 5ILVA 1MBKA 5M3MJ 5HDGA 5M5XJ 4EJVA 1A5JA 1WI9A 3IL2A 2ME0A 1XPXA 2R7FA 3OIOA 3CC4I 1APLC 4A6DA 4DQ2A 1WRJA 2VASA 2LLKA 2NAZA 1ZK8A 1IXCA 3K2AA 1MJBA 2R7VA 3V7SA 4A3MJ 1WI3A 4YEJA 3KPHA 2IAIA 5L3EA 3K4KA 5HLHA 2IS6A 3DTIA 3OYBA 1YTYA 3QQAA 1U78A 4JP0A 1DU0A 3M9AA 3VWBA 3PJRA 2XAHA 4B44A 4KNYA 5LGNA 4YIIA 2VN2A 2HVQA 4ESBA 3SEZA 2OJED 3O3KA 3VFZA 1Z0XA 2HYGD 1W5CC 3JR9A 2R5ZA 3AG1H 3ZP5A 2HPIA 4II2A 3WTYC 3DTKA 3WU1B 4LIUA 2ME6A 1HCRA 1FTTA 4ENKA 1V5GA 2DI3A 2IBDA 4I01A 2E1MB 4CZZA 1FSEA 1QO0D 2VQHA 4P9FA 4AIKA 4YIRX 3B02A 4IZZA 5TISC 4Y17A 3KX2A 2QCOA 2K85A 3G73A 1SFOJ 1QU3A 1R7JA 4KT5C 5FD5A 4DOZA 2LG4A 4BUPA 3FXOA 2DPDA 1FIPA 1SAUA 2QQ9A 3CJRB 5IPAA 1E2XA 4GCVA 1K6OA 5E1XA 5E3NA 2PJRB 3F21A 2CRGA 3DLAA 5HS7A 1OCRH 3K7AJ 4B1RA 2Y0SN 3LQRA 5EGOA 2FF4A 4XIDA 5HDKA 3MAJA 2ELJA 2EFQA 1U5TA 2XRLA 5CKTA 4UXNA 2M45A 2CV0A 3ROUA 5K7ZA 2XRNA 1FLIA 1MD0A 1EV7A 2CV2A 2P81A 1ON2A 3HXLA 1YE9A 5JVTA 2J5PA 2QQ8A 2CQQA 3M07A 4S05A 5LGTA 2R7SA 4H0EA 2PLYA 3MN2A 4QWQA 2DFIA 2DXIA 4FASD 3I56I 3ECHA 5E79C 1JHFA 2VODA 3DEWA 3O2PE 1R9TJ 2GOMA 5IP6A 5L3FA 4BS9A 1D1AA 3FIWA 1YJWI 3R60A 4A2UA 4QTRA 2E1OA 1IRFA 1NH3A 3IH3A 2Z16A 1XGNA 3FM5A 3VEPA 1MDMB 3WTSC 3Q3SA 1WJCA 4YFXF 3F8BA 1GLNA 4OMYA 1CQTA 3H92A 3WHBA 3EUHC 3CQZJ 1R4NB 2TCTA 3ULQB 1CF7B 1NK3P 5J3LA 2RC4A 4ETSA 1T08B 1RR8C 5FKKA 1Y0UA 1UMQA 4ZTJA 5H6QA 5EEGA 3GLLA 1D1CA 3HG9A 5E8IA 2JUGA 2KJCA 1HQCA 2PBIA 3KZYA 4FISA 4I7HA 1KYWA 2X1DA 5DM6F 1RUOA 1W0UA 3E3VA 2WAEA 2VKVA 3CO6C 4EJTA 9ANTA 3L1PA 4OIQF 3HRTA 3GFLA 5IYBJ 3HOYJ 5ILSA 1IN7A 2HPMA 2OF7A 4BQOA 3W6VA 2CUEA 3RYPA 4MLOA 4I2OA 4XKWA 5TGTA 1VF9A 1FZPB 2HDDA 3S1MJ 4A69C 5JVGF 2M1BA 2D45A 4ZH4F 2QSFX 2RVCA 4QSHA 1WFXA 4DBQA 3GXOA 1P7JA 1XMXA 3CCLI 3SXYA 2HOEA 1W7PA 3L2RA 1TWAJ 3E0JB 3QODA 4BU2A 3OYEA 1ETXA 1YG2A 2GIVA 3FDYA 4OAZA 4EV0A 4L0YB 2VOPA 4HX8A 2W85A 4PCQA 2OD5A 5DEQA 1X1CA 3I64A 1XN7A 2H27A 1ETWA 5FFXA 2NVYJ 1KQ0A 2HDWA 3MWMA 2ZJPF 1MIJA 3S16J 5K5RA 3L2UA 5BMZA 1SFUA 4V2GA 1EJ9A 1T0FC 5F0CA 1R49A 4L5JA 2XAGA 4DW6A 4ZZDA 2DTRA 3OYLA 1IUFA 2Z99A 3E6MA 2E35A 2HVSA 3ZRGA 1V5FA 3OSGA 1ZR2A 1Y1WJ 2M87A 5HNFA 1Q1VA 1ENHA 2ICWG 1HSJA 3JRCA 5D4SA 4RGSA 5KAIC 1XDSA 2V1UA 2X9DA 3GFJA 1TWHJ 2JTVA 4UVBA 5KK1A 2MH2A 2F4IA 2HQAA 5CVRA 5D5WB 4KFCA 4C2TA 2HEOA 2EZKA 5KAFC 3GFMA 3LSKA 3NRVA 1R58A 4CCNA 1WH5A 3OSFA 2EA2A 1IRZA 3IKVA 5H6RA 3RKXA 4HRIA 2UXNA 5FKMA 1RIOH 1HW2A 3HPHA 3CCJI 1JI8A 5BQTA 3I54A 3LWFA 3GTKJ 2VKEA 1LFBA 2L4MA 4D7MA 2P6TA 3V7RA 3PUBA 3K70C 1BI3A 1HSTA 3IH2A 4XRFA 4CCJA 2JUCA 2IXSA 3DQVC 5GAHJ 2MW8A 5CYVA 2YU9J 4M71A 5FLMJ 1W0TA 4ZC3A 1YJ9I 1WJBA 2XSJC 4ENMA 2JRTA 1STZA 1I39A 5DUKA 4II3A 4DZJA 3BZCA 5DD4A 1Z3YA 2L7MP 2P7CB 2WADA 1I5ZA 3EUKL 2A3SA 3QU6A 3I3LA 1F5TA 4OIPF 2V7FA 3CCUI 4GYGA 3DBHB 4IOCF 3OYGA 3L09A 1FEXA 3CMYA 2I10A 3L2CA 3HYIA 1ITYA 3G1OA 4KIFA 3ZQIA 1K83J 2FU4A 3IWFA 2JA8J 3FXQA 2XPVA 4BH9A 1JT6A 3SHFA 2Q2EA 4IO9F 1ZRDA 4DYCA 1P6RA 2MFZA 3K70D 4LFUA 4G6DA 4RAFA 2COBA 1H8AC 2P5LC 2JVGA 2WA0A 3PIPF 2AXTC 2HOSA 1ETYA 1VQNI 4RLFA 3N4MA 1XGMA 4N0BA 1EH6A 2BVLA 5IOZA 5L3CA 4NC8A 4BDZA 1HA8A 1VQ9I 2OCCH 4XR6A 2CH0A 4CXFA 1K78B 1T38A 3KLOA 1YW8A 3H9QA 4KUMA 5HOOA 2DOFA 2V26A 3BTIA 3H3UA 4UHTA 5DUIA 3TL4X 3E6CC 2K7LA 4C2MJ 3E5QA 4CCKA 1J75A 3CDHA 3ZR8X 3MD2A 1S3JA 1D3YA 1Y8RB 4RB3C 1SAXA 2LDUA 4RB0A 1Z7LA 4IHTA 2V79A 2X51A 3OIQA 5EEHA 4MHGA 1MSEC 2M4KA 2K40A 1AHDP 3HOZJ 2O0YA 3HGYA 4PJNA 1AKHA 1LKXA 1K6YA 2GXAA 2D5VA 2RGVA 4NHJA 4ZYDA 1WH7A 2FJ1A 3BJOA 5J1UA 2KZVA 5D8LB 5D5VB 1KU3A 5DDGA 4XRMA 3KZIC 3OYIA 4A12A 1G3TA 4A3JJ 2CFOA 3CUQC 2XASA 3DKYA 5IP9J 3TOBA 3GTQJ 2XF5A 3TMOA 1VQ5I 4A3LJ 1IN6A 3RZDJ 1RR7A 2XKPA 4IX7A 2ZKZA 1MSFC 5KCMA 2O7OA 4MO7A 2H6CA 1IW7F 2PEXA 3EUHA 4PDKA 5D6EA 3V8KA 3LSRA 1Y1VJ 3QYBA 3VB2A 4W1UA 1LDJA 4E6KG 1GDTA 2BYVE 2DT6A 2HYJA 3TEDA 1ODDA 4MEYF 4HQEA 1XG1A 2CUJA 3DKWA 3HZJA 1B8IB 3ZQGA 4C3JJ 3WTTC 4ZTFA 4D0PA 1ON1A 2IRFG 4Y52J 4L0ZB 1KU2A 1RNLA 4XLAA 4PZJA 3FXRA 1JKPC 1ACIA 5K7HA 4XBFA 2IT0A 2HS5A 1V4RA 4HW0A 1OMIA 2W24A 4N4OB 2BXZA 2Z33A 3MKWB 5BPIA 1P9QC 4Y15A 4IHXA 1A6IA 1BL0A 3HKZN 4M74A 2MA3A 2QVOA 2NOJB 4A6EA 2LY2A 2OV7A 1FYLA 1MBHA 1B6AA 1BJZA 4I99C 4AIHA 2XB5A 4Y3OA 1A04A 4XOPA 1ZAOA 2A68F 3CP2A 2ACJA 3FM3A 1TBXA 2G0EA 1ZQ3P 3BJ6A 2K9QA 1ZARA 4PSWA 3GEZA 2GA1A 3RIRA 3DP7A 5HLGA 1AWCA 2Y31A 2V9PA 2X85A 3PNYA 2HOAA 1QGPA 1T0FA 2LOOA 2JT1A 2JA2A 4OAYA 3PO2J 1FBSA 4RMNA 2K27A 3DEEA 2BV6A 1U6GA 1TLHB 1TTYA 3QYFA 2QBYA 3AKZA 5JLXA 1BI2A 4ON0A 1X4PA 2HKXA 5FGMA 2ZFWA 1Z21A 1Z6TA 1O3RA 5ICGA 3HC7A 3WTUC 2DQLA 2RQQA 3F6VA 3JTHA 2M2EA 2UZKA 2VJJA 1JUSA 1R1UA 3RKYA 4R8HA 2OC6A 3T1BA 5LD2C 1YRNB 1TQMA 3WODF 4BGDA 4BDYA 4G7ZF 1M1EB 1D5VA 4D7NA 1UHMA 3J81Z 4BQNA 2V6CA 2DDAA 2IW5A 2A6HF 3QPSA 3VYUB 4EGYA 1U5TC 3KETA 3S2WA 2DT7B 1KGSA 2UUZA 1QVUA 2W1OA 4Y13A 3T8RA 5F64A 4M9XA 5A2QK 1G4DA 3SEQA 2MYSA 4E7IA 2L01A 4WK8F 4Z2YA 2L4AA 5IT9Z 4CYCB 2MC3A 2EZLA 2MH9A 3ZGKA 1UZCA 1TW3A 1TT0A 2JQ7A 2I8DA 4I0BA 3OIPA 5KVRA 2WAFA 3HIFA 2A5YB 4M6VA 3M1EA 2X48A 4A3EJ 4KMUX 4RB1A 4AC0A 3L7WA 1B9NA 3BP8A 3RJPA 2E2HJ 4JOMA 5IP7J 2BY1A 5K1YA 3IC7A 2GIZA 4XN3A 4XSZF 2ZXWH 1VQPI 2LTPA 5H20A 3T5XA 2X1EA 3H1CA 1SFKA 1S9HA 1T6SA 3F9KA 3JRBA 1V55H 4ZDLA 1GT0C 3DLLF 2KDOA 3GCMA 5B3SH 2VJ5A 5LLQA 5EG0B 4UB8C 1YJNI 4X1EA 1I1GA 4N9HA 1TT5B 5AONA 2KLOA 1LQ1A 2JWTA 3TO6A 3QOEA 4D5CA 2E1CA 3TO7A 3OY9A 2LF8A 1XMAA 2JSPA 4QIWN 3L2QA 1VQKI 3D5RC 1WZ2A 2X6WA 4U87A 2M7AA 2NS0A 2XAQA 3PIOF 1MZBA 2DQRA 4E7HA 3P7NA 1POGA 1ZGAA 1RZ4A 4CZCA 1R1VA 2CG4A 2EFPA 3A01A 2UXXA 4G6TB 3MZHA 5CVVA 3S14J 5E20A 3O8GA 2EINH 3UNGC 4RA2A 3M3YJ 1PUFB 4PFOA 1QHGA 3K2ZA 4UVCA 4N4NB 3NQOA 2PMHA 4I6ZA 1NG7A 2IGOA 3KP6A 5HVQC 1MNDA 1MMDA 2KRFA 4EQQA 4BKXA 2ZMEC 2VXDA 5J1RA 1WJFA 3P9CA 1BC7C 3CUQA 3EETA 1SD4A 1G2HA 3M8JA 2BY2A 2ELHA 2JZYA 2LYCA 2Q8KA 3TQNA 2J5OA 1ZRFA 4Z6YA 2Y9ZA 3G1LA 2IS1A 3FHZA 1UG2A 2BHYA 2O6GE 2XSDC 2NNNA 4UUVA 3ELKA 2FXAA 3MFKA 2EV0A 3FBIB 3OOPA 2NS7A 4HPQA 1KONA 1FSHA 4XK4A 3L00A 1VQ7I 1X1PA 2BW3A 2M5WA 4EATA 1USSA 2KMUA 3NEUA 2FMYA 4WCGA 4AU7A 4JX5A 1LE8A 2XGCA 3FF5A 2A6EF 2QQBA 1BOAA 1VQLI 1L0OC 4W97A 2X4HA 2CFXA 1ZHFA 1TQIA 3M7GA 2FX0A 3M4OJ 1T56A 3K1MA 1MGTA 1W7PD 4XRSG 4YRVA 1U3EM 1SANA 4F7ZA 5K5QA 2BBYA 3ZMZA 1BR1A 2WY7Q 2DN0A 5M3FJ 2DPUA 4BYYA 3WGGA 3JW4A 4B4CA 4HAMA 3DPLC 4MTEA 2ZSIB 4EMSA 1YLFA 5ICFA 3F8FA 4HQMA 1G6NA 4NC6A 2B0LA 2F5CA 2GAUA 3IAS2 5EEAA 3TP0A 2RNGA 2CU7A 2YR2A 2EIMH 4MFDA 3TDUC 3D5LA 1GXPA 1OPCA 3RSNA 4YFNF 2WC2A 4FT8A 3JSPA 3NAUA 1MNEA 2DTZA 2MSYA 3K4NA 2P4WA 4P96A 3S3OA 4KT6A 3CCRI 3BG9A 4ENJA 2VQCA 2VBZA 2K9MA 4CICA 1G3SA 1OJLA 4PJMA 4M9SA 4JYKA 1S5LC 1E3PA 5HS9A 3CCMI 1TZLA 4FETA 4J01A 1YIOA 2KKOA 4EJWA 1BN5A 3HRUA 3KZZA 3V7CA 5AIPA 4PGGA 1VQ4I 2QLZA 4CO8A 3HL2A 1LB2A 5J1YA 5JI6A 3R61A 2VUMJ 1N25A 2F5EA 2R0QC 1IG7A 3CLOA 2FBHA 3P9IA 4IHYA 2ZC2A 3RQIA 3MKLA 3BPXA 1TL8A 1OCCH 1D0XA 2STTA 4HYEA 3GWZA 5B5EC 1TW2A 4DZPA 2IS4A 3ZMUA 3S1NJ 3OYFA 3GTLJ 2JJ7A 4Q48A 4UB6C 2STWA 1WJDA 2ID3A 2DA5A 1BJAA 2DT5A 4PJLA 1BI0A 1FOKA 3LL7A 4E7KA 3DXJF 1ETVA 2PX9A 5CVIA 1XCBA 4B43A 3GTOJ 4M73A 3MCZA 1F4KA 4HF1A 3K1PA 3ASNH 2K4JA 1LFPA 1YI2I 1BIBA 1IN8A 4GYIA 1B72A 4ZDOA 4C9YA 1MH3A 1J2XA 1X2MA 2E5ZA 2VLAA 2R5YA 2KIFA 5EJCA 3SJMA 4RGUA 4E7ZA 2R5ZB 2E2IJ 1BBYA 5E3OA 2DA4A 4E7LA 2GOXB 4XSXF 1MJAA 3D5SC 2F48A 2ADUA 3K4BA 1WPKA 2DK5A 3ONQA 3IWZA 3QRFF 3H9GA 1WVRA 3PL8A 2O9LA 5HLTA 3MMYB 3H0GJ 4BQQA 1U2WA 2L3DA 3DPTA 4PJ0C 1I1SA 1P4XA 3IRRA 4ITVA 5FB2A 1O3TA 1Q1HA 3VDXA 1NG6A 1UB9A 1MBJA 2F5FA 5J4VA 1ZELA 4HDUA 2MC4A 2X6XA 2A6TA 1D0ZA 2YS9A 3G1MA 3OWTA 4LG0A 3SZPA 1WWXA 4B8XA 2LY9A 2BXYA 1RPWA 1D0YA 3HHGA 2VJIA 4DYQA 2DA6A 2GXGA 2RAEA 1OCOH 2YX7A 2O3FA 1XC5A 3G71I 2MGQA 5EGOB 3AG4H 2EIJH 1A6QA 1FT9A 2AHQA 1U5TB 3Q0UA 4YFKF 3DBRB 4H4KC 1JKOC 3REOA 2HZDA 2XHKA 1HDPA 4F3QA 4BL0B 2CQXA 4K2EA 3DFGA 2DJIA 4ENNA 2HU9A 3C1DA 3WU2C 1I3AA 1P4AA 3I9V2 2DFEA 2DMTA 3RTRA 1X1DA 4OIRF 5LGUA 4LIVA 1XGSA 4A0YA 3JRFA 5AIQA 1XMKA 5F0HA 1IRXA 4ZYEA 2CMPA 1MMGA 1OLTA 2LR8A 3H36A 2CYYA 2P8TA 2EJRA 2ZCWA 4XLCA 4KMFA 2Q1ZB 3ABMH 1VQ8I 2ZNYA 1E3OC 2E60A 3CC2I 3GTGJ 4BJ5C 4HDVA 4U0YA 1V3FA 3MVPA 3K69A 1H9TA 4O6JA 4LITA 5TJJA 4XONA 5DYMA 2ZMEA 1FBUA 2LRDA 3TDZC 2GLOA 3A02A 2R93J 4P1WA 4XMYA 5LBQA 2OZ6A 1YW7A 1UHSA 4V2FA 3G3ZA 1LFUP 3JCUC 2ID6A 3AL0B 4Q4ZF 2UV1A 2XGXA 3A4CA 2F6CA 1YOVB 4AVZA 1Z9CA 1ZG3A 3S3MA 5E1ZB 2W00A 3RPQA 2DMUA 1R00A 2ELKA 2EV6A 1PVEA 2CJJA 2FOKA 4R1HA 5HS8A 1C0WA 4IRHA 3OOUA 1ORKA 2VB6A 2R7QA 3CCYA 3WG7H 2NNYA 3D1NI 5C4JJ 5F08A 2VPRA 4DGWB 1HXDA 2COMA 3FK6A 3LA3A 4L18B 1N75A 1DQUA 1HW5A 4AIDA 3QPHA 4MQ9F 3J80Z 2NVQJ 1L3LA 1IV6A 4HV6A 3G6EI 2HGCA 2E19A 2D2WA 2HQRA 1GVJA 2HYFA 5TRDA 4HX7A 3GYHX 3R6SA 1G3WA 3SYTA 3LSTA 4ZDPA 2HR3A 2AQEA 3MQ0A 2XGEA 3FZVA 4IHWA 1W7PB 1JUPA 2Y2ZA 1YIJI 3HBLA 1A35A 5F04A 5M5YJ 1ZN2A 3PM1A 2DO7A 4B09A 2CGPA 2K3PA 4U0VA 2VQLA 2IEKA 5C3EJ 3RI4A 5J6XA 3F3XA 4UVAA 4A3FJ 1X3UA 1O3QA 3FXJA 4NUBA 4NC7A 2F2EA 3WE2A 3W2VA 2OAZA 3S32A 3BLYA 5BNGA 4HNUA 2JA6J 3H5RA 4CCMA 2G9WA 2YU3A 2M3AA 3HOSA 1RESA 3DWLE 3T0YA 4OIOF 4FQGA 2PQ8A 4P5OA 5KNLA 4L9JA 2Z5UA 4AIJA 3HSFA 3Q9SA 3LFKA 2M0CA 3Q0WA 4HOBA 3GTPJ 2KIUA 2V1NA 2LH9A 4KN4X 4G8XA 3RKWA 2P5KA 3ZCOA 1N77A 3ZQHA 5ICCA 2JMWA 3NARA 4NQWA 2NXNB 2P6SA 4HG2A 2AXLA 2DCEA 2VONA 4ABZA 1YITI 1YO5C 2YPRA 1MH4A 1AU7A 2CUZA 1ZTRA 5D6FA 1X3ZB 1I3QJ 1QRYA 2O5RA 1X4OA 3DKXA 2L9SA 2VBYA 3B73A 2E36A 4L5EA 3CLQA 5DCMA 2DJNA 4WF2A 2R7XA 2KISA 2FEZA 2NYXA 2XF7A 4MIMA 3HOXJ 2RV8A 3HPGA 3P9KA 3MZYA 3CD6I 3GLXA 1MBFA 2E7XA 2YSRA 4FCYA 2HXOA 2EB7A 2VE9A 4E7SA 1EKEA 2BGCA 2A05A 2HNHA 3WGIA 4FX4A 3I4PA 1SVOA 3C18A 2M9HA 3E5UA 4XLNF 3WU0A 1GXQA 4MGRA 4LK0F 2ESNA 3HRMA 2C6YA 1JKQC 3G4SI 4I0AA 1UG0A 2EFOA 2Y69H 4KITB 2KRHA 5FD6A 5E18F 2DFHA 1FIAA 2HZTA 3KLNA 2WTEA 2Q2EB 1TWFJ 4BEHA 4PSXA 4RDUA 2PMUA 4ZJZA 1TWCJ 2VBXA 5CVUA 1Y6IA 2W48A 4BJTA 2XPWA 4Q5SF 1KZHA 1F36A 3CMMA 1LDDA 2H1KA 3QPLA 3ZMDA 4Y7NJ 4A3DJ 1SEUA 2L9VA 2QUFA 3S1RJ 2VT3A 3IKTA 3ZQFA 4D5FA 3ABKH 2LBFA 4WXDA 4YELA 3CDLA 4KIGA 4EJOA 4HA8A 2ZB9A 4AYBA 4Y4RA 2R92J 1VNDA 4LJZF 3S93A 2BY0A 2PN6A 4XLPF 3ABLH 2E1NA 1W36C 1SC7A 4KN7X 1O4XA 2E1MC 1U8BA 3PFYA 3D0SA 2VJ4A 3FKJA 3KEYA 3OR2C 2DYSH 4XLHA 3FHNA 4HF2A 3OYKA 3KE2A 1R5HA 3F8MA 2HXIA 3KEQA 3WG9A 4UY8I 1OR7C 1XX5A 3K4JA 5EDNA 5LHGA 2XC7A 1FP2A 2DW4A 3S17J 2E5NA 1CGPA 2LKSA 2XPUA 1AKHB 4LB5A 2G7HA 3BTLA 2EIKH 1NTCA 4ZZLA 1UAAA 2JN6A 5L3DA 4BACA 2HWVA 2EH3A 1GV5A 1WCMJ 3IUOA 1TC3C 3LSIA 4NBQA 2KPMA 4GO1A 2WBMA 3I59A 5E3MA 3HOVJ 4LMYA 1U8RA 1JGGA 2K4BA 1XGOA 2KP6A 1P2FA 2QKLB 1XS9A 2M0MA 4FE4A 1JXSA 1MMNA 3FWEA 3EYIA 3IP4B 3R0JA 3L9FA 3R4KA 3RQ4A 5D4RA 1VQMI 2V9KA 3LSGA 1XTAA 3DF8A 1T2KA 4G12A 2XGDA 3OMYA 1LUJB 4MFEA 2CUFA 3V4GA 2BHZA 2VKHA 2XF6A 3LSJA 4HLXA 1S6LA 1WGXA 2WY8Q 4I98B 3A2KA 4XKCA 1W36D 3VYRB 5IY5H 1XSVA 2K02A 2ZNZA 1TQPA 1DUXC 5FLXK 1FJLA 4XLFA 2FNAA 2H6BA 1E17A 2IVMA 1XCVA 2R7OA 3J7AY 1S7EA 3DU6A 3CJQB 3HUGA 4BE1A 3ZXSA 3BTCA 3ESWB 3H35A 2VBWA 1SVLA 2F4MB 1W5TA 2CSOA 5CVJA 3LOCA 4UUSA 3CMEI 3BG7A 2KFDA 1H88C 3TP3A 2PI0A 4U88A 1U0JA 1QBJA 1SFEA 1JJ8C 4BAYA 2I5UA 2B7EA 4XKVA 5IT9K 2P7VB 2MD5A 2CS3A 2XKOA 1J59A 2VXZA 1VI0A 1TP4A 1S8NA 1KA8A 1OYYA 4FHTA 1TWGJ 1D5YA 1IDZA 2DMPA 2H1LA 3RPUA 3LFUA 4UV8A 3SZTA 1FNNA 3E97A 2Z1DA 1XSDA 2A5WA 1X19A 2VT2A 1T98A 3X2QH 2ZXIA 4DJAA 1DP3A 4M72A 2MABA
chains in the Genus database with same CATH topology
2IJLA 2QBYB 2IP2A 4A0XA 5A2QZ 5LRSA 3ZMSA 1ZLKA 1XD7A 5BPDA 2W57A 2QM3A 1B59A 2EK5A 3RYRA 3CUOA 1LDKB 1O7FA 5J8CA 4BXUA 3GX4X 1RUNA 3BROA 1TNTA 1LEAA 2EFNA 3QP6A 4CHUA 1YYVA 4AD9A 2WV0A 3E6BA 3F22A 2PFBA 1Z7UA 2MLKA 3M8EA 1OYIA 3ABUA 1I6XA 3H3ZA 4PGHA 3FMSA 4RS8A 4KDPA 3M8FA 2XROA 4N9IA 4IF4A 4MEXF 2XAFA 3BWGA 2QYOA 4KA4A 3T8TA 5J8FA 3WE3A 2LSOA 4Q47A 4KICA 1LEBA 1IN5A 5BOXA 2M8EA 1Z05A 1AOYA 1IN4A 3KCCA 1D8KA 3JAMK 1ZYRF 2G7UA 1YS7A 3HTUA 3ZMVA 5IT3A 3TO9A 4M6XA 4UV9A 1Z6RA 3GUDA 3ZN1A 3HRSA 1H0MA 1ZG5A 3E5XA 2W84A 4OOIA 1OR7A 4BHCA 1FBQA 1T39A 2Y0MA 3QAHA 3ZQ7A 1DPUA 3CUQB 1FX7A 3LAJA 2IA2A 1FP1D 5K5OA 2FMLA 1EH7A 2LKPA 2HQNA 2XAJA 1HKQA 1KU7A 3V8JA 1B9MA 4CDGA 4JBAA 2HFHA 3TOAA 3KEOA 3ML6A 3I0TA 3C3WA 3JTGA 3GFIA 4P55A 2OA4A 3I53A 4BNCA 1IAWA 2FE3A 3HSEA 2NRAC 1REPC 4M6YA 4OU0A 1MDMA 1IF1A 2LNBA 5ED4A 3N97A 1SD7A 3I58A 2LF7A 1QQIA 4G9YA 1CF7A 2O61A 1UHWA 4U7DA 3K1NA 5LHIA 1F1ZA 2GWRA 4ZYGA 1J7KA 3C7JA 2EFWA 4HBLA 1F9NA 1YQAA 2V9VA 4A5MA 5D5UB 2OBPA 3VODA 3F8CA 2P5VA 1SFXA 3ECOA 4CGZA 3FMRA 4HF0A 1S7AA 1W4MA 4RGXA 1Z91A 5F6FA 5E17F 4GXOA 2YX4A 3RDIA 2QZ8A 2RNJA 2AS5F 1FY7A 4E70A 1IXRC 1MKMA 1HKSA 2BEOA 1YS6A 4I02A 4L5IA 1G3YA 2CWEA 4ESFA 2FBIA 3LQQA 2OQGA 4LGWA 2BE5F 3J7AO 1FYKA 2W25A 2L02A 1JHHA 3DEUA 1ZLJA 2JPCA 3KFWX 1LJ9A 2FA5A 2FRHA 3GZ6A 2CQKA 1PP7U 4IRIA 4EGZA 1IZ1A 5L3BA 1IRGA 4EJUA 2M30A 3W6KB 4U7BA 2PJPA 3HHHA 4LLLA 2DBBA 2TDXA 4G7HF 4DNCA 4WXHA 3QU3A 2K86A 4L9NA 1LNWA 1QZZA 2RQPA 3FMQA 1LVAA 4MNUA 5F1RA 2GXBA 4EVIA 3F72A 5ICEA 3JSOA 4LG0B 1ULYA 3EQLF 4RAYA 3BZ6A 2VOOA 2O8XA 1R22A 2OZUA 3J80K 4G6QA 5DCFA 4KYWA 4BQAA 4TV7A 2HKOA 2V1DA 1K79A 2ZBKA 3LA2A 1WSUA 1IXSB 3WTVC 1OYWA 4IJAA 4OINF 2HDCA 1H9GA 1USTA 2FNPA 2ZJ2A 1B4AA 2MLGA 4BHBA 3Q5FA 3CTAA 3CO7C 2A61A 4GGGA 2OQRA 2ZMEB 2RKHA 4JK1X 4RGRA 4R79A 1D8JA 4HV5A 1K78A 4YIFA 2VE8A 3GZ5A 1ZRCA 1KQ8A 5CLSA 2XVCA 1OKRA 2XV4S 1Z1DA 1PUEE 4YG2F 4O3MA 4AVPA 5JHUA 5D8KB 2IA0A 5CJ9A 4EM0B 3I5UA 3VOEA 1BC8C 2A07F 2VC0A 1GHCA 1FC3A 1J0RA 2ISZA 1ZGJA 3WGHA 3QOPA 3F23A 1I27A 2FQ3A 1DP7P 3BPVA 4WWCA 2ESHA 1JGSA 2KJBA 4IXAA 1UCRA 5BS6A 2ZO4A 2FSWA 1IUYA 2D1VA 5E1WA 4FX0A 1R1TA 2VC1A 3IHUA 4LD5A 2R3SA 4MTDA 4G94A 2GA2A 3OV8A 1MJ9A 1YW9A 4NB5A 3EYYA 1WQ2A 3PQJA 1KU9A 5FO5A 3LAPA 3GO5A 1RI7A 3V8LA 2A69F 2IA1A 1ZREA 3COAC 2CO5A 5LHHA 2EWNA 3PFIA 1HKTA 1NHAA 2Z3YA 3U1DA 1TNSA 4M9ZA 2MBFA 1O57A 5D5XB 2FBKA 4WXCA 3K9TA 2XIGA 2Q0OA 2GQQA 5L3GA 5LEJA 3EDPA 3F8NA 2Y48A 3HSRA 1B1BA 1PP8F 3BJAA 2V1XA 4EM2A 3WTWC 3TKYA 4UNOA 1K7AA 3BOQA 3HTSB 1O3SA 3W6JB 2F5DA 5LEKA 5DCMB 3K0LA 1FWZA 5ILUA 1QPMA 2RDPA 1XDUA 4OMZA 2ZXJA 3QP5A 3KP5A 5HDNA 3PQKA 5ERIA 1HBXG 1P4WA 1VTNC 1ONVA 1R5GA 4HX4A 2EA4A 3F6OA 3QPTA 4P9UA 2DK8A 3BDDA 1FYMA 3E6DA 2PG4A 3KP2A 3IRQA 4LB6B 2Y75A 1QZYA 4HLYA 3WTXC 1EH8A 3J81K 3R0AA 2DAOA 2JSCA 1KYZA 4HZFA 4AWXB 1W5SA 4RB2C 1SMTA 1XSXA 1SD5A 2EV5A 2ISYA 5LRRA 4MQVA 5FLXZ 2DU9A 3KP3A 2R7DA 3SFZA 2JPBA 4CYDA 3O6BB 1J9IA 5FFZA 3SQNA 2CW0F 3I59B 2WWYA 4ZYHA 1R23A 1R36A 4LLNA 3BY6A 4KIBA 4IHSA 4BHPA 3HOTA 2IPQX 2QENA 4LLGF 1S7OA 3DV8A 4A5NA 3CJNA 5E8GA 1SMYF 3ZMTA 2RN7A 3U9GA 2O03A 6PAXA 2DLLA 2L54A 1DPRA 4QLCU 2HTJA 4RAZA 3KP4A 4WX9A 2QQAA 4EM1A 3FX3A 4ESJA 4U0WA 2UWMA 4IPAA 1JE8A 2D1HA 4LK1F 4I09A 3GW2A 4IRGA 4IVNA 2X0LA 1ZG1A 1HW1A 1UFMA 2ETHA 2Z9OA 3MEXA 3ZPLA 2KIMA 4L9TA 2XUBA 4S04A 3TGNA 2QWWA 2HTSA 4G7OF 3U2RA 1WKMA 4A0ZA 2OU2A 1P92A 3GF2A 2H94A 1PDNC 3KP7A 3WTZA 3AAFA 1DDNA 1ZH5A 1YFHA 5JR3A 4L9VA 2GZWA 1XB4A 3ABTA 3GVAA 5DV5A 5JFRA 3ZN0A 1O7LA 1QNTA 4ASNA 3ERED 3JAMZ 2H09A 5HLIA 3I71A 1SD6A 5DD8A 4JQFA 3LA7A 2E7WA 1KQ9A 1BI1A 3Q9VA 1BIAA 1BM9A 3FXUA 4O5VA 1J5YA 1S29A 1FPQA 3ISPA 5ILVA 5HDGA 4EJVA 1WI9A 3IL2A 2R7FA 4A6DA 4DQ2A 1WRJA 2NAZA 1IXCA 1MJBA 3V7SA 5L3EA 5HLHA 1YTYA 1U78A 3M9AA 2XAHA 4KNYA 5LGNA 4YIIA 2VN2A 4ESBA 3O3KA 3VFZA 2HYGD 3ZP5A 3WTYC 3WU1B 4ENKA 2DI3A 4I01A 4CZZA 1FSEA 1QO0D 4P9FA 4AIKA 3B02A 4Y17A 3G73A 1R7JA 4KT5C 5FD5A 2DPDA 2QQ9A 1E2XA 4GCVA 1K6OA 5E1XA 3F21A 5HS7A 3LQRA 2FF4A 5HDKA 3MAJA 2EFQA 1U5TA 4UXNA 2M45A 3ROUA 2XRNA 1FLIA 1MD0A 1EV7A 1ON2A 5JVTA 2J5PA 4S05A 5LGTA 4H0EA 2PLYA 4QWQA 2DFIA 3ECHA 1JHFA 2VODA 3O2PE 5L3FA 3R60A 4A2UA 1IRFA 3FM5A 1XGNA 3VEPA 1MDMB 3WTSC 4YFXF 3F8BA 4OMYA 3H92A 1CF7B 3ULQB 2RC4A 4ETSA 1Y0UA 5H6QA 5EEGA 5E8IA 2KJCA 1HQCA 2PBIA 3KZYA 4I7HA 1KYWA 1RUOA 3E3VA 3CO6C 4EJTA 4OIQF 3HRTA 3GFLA 5ILSA 1IN7A 3RYPA 4I2OA 1FZPB 2M1BA 2D45A 4ZH4F 2RVCA 3GXOA 3SXYA 2HOEA 1W7PA 3GYHX 2IRFG 4EV0A 1YG2A 2GIVA 4L0YB 2VOPA 4HX8A 2W85A 4PCQA 2OD5A 5DEQA 3I64A 1XN7A 2H27A 5FFXA 1KQ0A 3MWMA 5K5RA 5BMZA 1SFUA 4L5JA 2XAGA 4ZZDA 2DTRA 2Z99A 3E6MA 2M87A 1HSJA 5D4SA 4RGSA 1XDSA 2V1UA 3GFJA 2JTVA 4UVBA 5KK1A 2MH2A 5D5WB 5CVRA 4KFCA 2HEOA 3GFMA 3NRVA 1R58A 2EA2A 3IKVA 5H6RA 3RKXA 2UXNA 1RIOH 1HW2A 5BQTA 3I54A 3LWFA 2L4MA 2P6TA 3V7RA 1BI3A 1HSTA 4XRFA 3DQVC 5CYVA 4M71A 4ENMA 2JRTA 1STZA 5DUKA 5DD4A 2P7CB 1I5ZA 2A3SA 3QU6A 1F5TA 4OIPF 4GYGA 3L09A 3L2CA 3HYIA 4KIFA 2FU4A 3IWFA 3FXQA 4BH9A 3SHFA 2Q2EA 1ZRDA 1P6RA 4LFUA 4G6DA 2P5LC 3N4MA 1XGMA 4N0BA 1EH6A 5L3CA 4CXFA 1K78B 1T38A 3KLOA 1YW8A 5HOOA 4KUMA 3H3UA 4UHTA 5DUIA 3E6CC 2K7LA 3E5QA 1J75A 3CDHA 1S3JA 1D3YA 4RB3C 1SAXA 2LDUA 4RB0A 4IHTA 2V79A 5EEHA 4MHGA 2O0YA 4NHJA 2RGVA 4ZYDA 3BJOA 5D5VB 5D8LB 4A12A 1KU3A 5DDGA 1G3TA 3CUQC 2XASA 3TOBA 1IN6A 2XKPA 2ZKZA 2H6CA 1IW7F 2PEXA 3EUHA 4PDKA 5D6EA 3V8KA 3VB2A 1LDJA 2BYVE 1ODDA 4MEYF 4HQEA 3DKWA 3WTTC 4D0PA 1ON1A 4L0ZB 1KU2A 1RNLA 4PZJA 3FXRA 4XBFA 2IT0A 2HS5A 1V4RA 4HW0A 1OMIA 2W24A 2Z33A 5BPIA 4Y15A 4M74A 2MA3A 2QVOA 4A6EA 1FYLA 1B6AA 4AIHA 1A04A 1ZAOA 2A68F 2ACJA 3FM3A 1TBXA 3BJ6A 1ZARA 3GEZA 2GA1A 3RIRA 3DP7A 5HLGA 1AWCA 1QGPA 1T0FA 2JT1A 1FBSA 2K27A 2BV6A 1U6GA 1TLHB 1TTYA 2QBYA 1BI2A 4ON0A 2HKXA 5FGMA 2ZFWA 1Z6TA 1O3RA 5ICGA 3WTUC 2DQLA 3F6VA 3JTHA 2UZKA 3RKYA 1R1UA 4R8HA 3T1BA 1TQMA 3WODF 4G7ZF 1D5VA 1UHMA 3J81Z 2V6CA 2IW5A 2A6HF 4EGYA 1U5TC 3KETA 3S2WA 1KGSA 4Y13A 3T8RA 5F64A 4M9XA 5A2QK 1G4DA 2L01A 4WK8F 4Z2YA 2L4AA 5IT9Z 2MC3A 2MH9A 1TW3A 4I0BA 5KVRA 3HIFA 2A5YB 3M1EA 4KMUX 4RB1A 3L7WA 1B9NA 3BP8A 3RJPA 5K1YA 3IC7A 4XSZF 5H20A 3T5XA 1T6SA 5LLQA 1I1GA 4N9HA 5AONA 1LQ1A 3TO6A 2E1CA 3TO7A 2LF8A 1XMAA 2NS0A 2XAQA 1MZBA 2DQRA 3P7NA 1ZGAA 1RZ4A 1R1VA 2CG4A 2EFPA 2UXXA 3MZHA 5CVVA 5E20A 3K2ZA 4UVCA 3NQOA 2PMHA 3KP6A 5HVQC 2KRFA 4EQQA 3P9CA 1BC7C 3CUQA 3EETA 1SD4A 2ELHA 2JZYA 2Q8KA 3TQNA 2J5OA 1ZRFA 3FHZA 2O6GE 2NNNA 4UUVA 3ELKA 2FXAA 3MFKA 2EV0A 3OOPA 1FSHA 3L00A 2M5WA 1USSA 3NEUA 2FMYA 4WCGA 3FF5A 2A6EF 2QQBA 1BOAA 1L0OC 2X4HA 2CFXA 1ZHFA 1TQIA 3M7GA 3K1MA 1MGTA 1W7PD 1U3EM 4F7ZA 5K5QA 2BBYA 3ZMZA 2DPUA 4BYYA 3WGGA 3JW4A 4HAMA 3DPLC 4MTEA 4EMSA 1YLFA 5ICFA 3F8FA 4HQMA 1G6NA 2B0LA 2F5CA 2GAUA 2YR2A 3TDUC 3D5LA 1GXPA 1OPCA 4YFNF 4FT8A 3JSPA 2WC2A 2P4WA 4P96A 4ENJA 2VBZA 4CICA 1G3SA 4M9SA 5HS9A 1YIOA 2KKOA 4EJWA 1BN5A 3HRUA 3KZZA 3V7CA 5AIPA 4PGGA 2QLZA 4CO8A 1LB2A 5JI6A 3R61A 2F5EA 3CLOA 2FBHA 3P9IA 3BPXA 2STTA 4HYEA 3GWZA 1TW2A 3ZMUA 4Q48A 2STWA 1BJAA 2DT5A 1BI0A 1FOKA 3DXJF 5CVIA 1XCBA 4M73A 3MCZA 1F4KA 4HF1A 3K1PA 2K4JA 1BIBA 1IN8A 4GYIA 1J2XA 2KIFA 4RGUA 1BBYA 4XSXF 1MJAA 2ADUA 2DK5A 3IWZA 3QRFF 1U2WA 2L3DA 3DPTA 1I1SA 1P4XA 3IRRA 5FB2A 1O3TA 1Q1HA 1UB9A 2F5FA 4HDUA 4LG0A 3SZPA 1WWXA 4B8XA 3HHGA 2GXGA 2YX7A 2O3FA 1FT9A 1U5TB 4YFKF 3REOA 2XHKA 4K2EA 3DFGA 4ENNA 3C1DA 1P4AA 3RTRA 4OIRF 5LGUA 4A0YA 1XGSA 5AIQA 1XMKA 4ZYEA 2CYYA 2P8TA 2EJRA 2ZCWA 4KMFA 2ZNYA 4HDVA 4U0YA 1V3FA 3K69A 1H9TA 4O6JA 5TJJA 5DYMA 2ZMEA 1FBUA 3TDZC 5LBQA 2OZ6A 1YW7A 3G3ZA 4Q4ZF 2XGXA 1Z9CA 1ZG3A 5E1ZB 3RPQA 2EV6A 1R00A 5HS8A 1C0WA 2FOKA 4R1HA 4IRHA 2NNYA 1HXDA 2COMA 3LA3A 4L18B 1HW5A 3QPHA 4MQ9F 3J80Z 1L3LA 4HV6A 2HGCA 2D2WA 2HQRA 1GVJA 2HYFA 5TRDA 4HX7A 3R6SA 1G3WA 3LSTA 2HR3A 3MQ0A 3FZVA 1W7PB 1ZN2A 2DO7A 4B09A 2CGPA 4U0VA 3RI4A 5J6XA 3F3XA 4UVAA 1O3QA 1X3UA 2F2EA 3WE2A 2OAZA 2G9WA 2YU3A 3HOSA 3T0YA 4OIOF 2PQ8A 4P5OA 4L9JA 2Z5UA 4AIJA 3HSFA 3Q9SA 3LFKA 4HOBA 2KIUA 4KN4X 4G8XA 3RKWA 2P5KA 5ICCA 4NQWA 2P6SA 2AXLA 2VONA 1YO5C 2YPRA 5D6FA 2VBYA 3B73A 5DCMA 4WF2A 2FEZA 2NYXA 2RV8A 3P9KA 3MZYA 3GLXA 2E7XA 2YSRA 2EB7A 2VE9A 2BGCA 3WGIA 4FX4A 3I4PA 3C18A 3E5UA 4XLNF 3WU0A 1GXQA 4MGRA 4LK0F 2ESNA 3HRMA 2C6YA 4I0AA 2EFOA 5FD6A 5E18F 2HZTA 3KLNA 2WTEA 2PMUA 2VBXA 5CVUA 4Q5SF 1LDDA 3ZMDA 2QUFA 2VT3A 3IKTA 4WXDA 4KIGA 4EJOA 4HA8A 4LJZF 2PN6A 4XLPF 2E1NA 4KN7X 3D0SA 4HF2A 3KE2A 1R5HA 3F8MA 3KEQA 3WG9A 5LHGA 1FP2A 2DW4A 1CGPA 4LB5A 2G7HA 4ZZLA 5L3DA 2HWVA 4GO1A 3I59A 4LMYA 1U8RA 2K4BA 1XGOA 1P2FA 1JXSA 3FWEA 3EYIA 3R0JA 3L9FA 3R4KA 5D4RA 3DF8A 1T2KA 3V4GA 4HLXA 1S6LA 4I98B 1XSVA 2K02A 2ZNZA 1TQPA 1DUXC 5FLXK 2FNAA 2H6BA 1E17A 2IVMA 1XCVA 3HUGA 2VBWA 1W5TA 2CSOA 5CVJA 2PI0A 4U88A 1QBJA 1SFEA 4BAYA 5IT9K 2P7VB 2MD5A 2XKOA 1J59A 2VXZA 1S8NA 1KA8A 1OYYA 4FHTA 3RPUA 4UV8A 3SZTA 1FNNA 3E97A 1XSDA 2VT2A 1T98A 4M72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IJL A;  2QBY B;  2IP2 A;  4A0X A;  5A2Q Z;  5LRS A;  3ZMS A;  1ZLK A;  1XD7 A;  5BPD A;  2W57 A;  2QM3 A;  1B59 A;  2EK5 A;  3RYR A;  3CUO A;  1LDK B;  1O7F A;  5J8C A;  4BXU A;  3GX4 X;  1RUN A;  3BRO A;  1TNT A;  1LEA A;  2EFN A;  3QP6 A;  4CHU A;  1YYV A;  4AD9 A;  2WV0 A;  3E6B A;  3F22 A;  2PFB A;  1Z7U A;  2MLK A;  3M8E A;  1OYI A;  3ABU A;  1I6X A;  3H3Z A;  4PGH A;  3FMS A;  4RS8 A;  4KDP A;  3M8F A;  2XRO A;  4N9I A;  4IF4 A;  4MEX F;  2XAF A;  3BWG A;  2QYO A;  4KA4 A;  3T8T A;  5J8F A;  3WE3 A;  2LSO A;  4Q47 A;  4KIC A;  1LEB A;  1IN5 A;  5BOX A;  2M8E A;  1Z05 A;  1AOY A;  1IN4 A;  3KCC A;  1D8K A;  3JAM K;  1ZYR F;  2G7U A;  1YS7 A;  3HTU A;  3ZMV A;  5IT3 A;  3TO9 A;  4M6X A;  4UV9 A;  1Z6R A;  3GUD A;  3ZN1 A;  3HRS A;  1H0M A;  1ZG5 A;  3E5X A;  2W84 A;  4OOI A;  1OR7 A;  4BHC A;  1FBQ A;  1T39 A;  2Y0M A;  3QAH A;  3ZQ7 A;  1DPU A;  3CUQ B;  1FX7 A;  3LAJ A;  2IA2 A;  1FP1 D;  5K5O A;  2FML A;  1EH7 A;  2LKP A;  2HQN A;  2XAJ A;  1HKQ A;  1KU7 A;  3V8J A;  1B9M A;  4CDG A;  4JBA A;  2HFH A;  3TOA A;  3KEO A;  3ML6 A;  3I0T A;  3C3W A;  3JTG A;  3GFI A;  4P55 A;  2OA4 A;  3I53 A;  4BNC A;  1IAW A;  2FE3 A;  3HSE A;  2NRA C;  1REP C;  4M6Y A;  4OU0 A;  1MDM A;  1IF1 A;  2LNB A;  5ED4 A;  3N97 A;  1SD7 A;  3I58 A;  2LF7 A;  1QQI A;  4G9Y A;  1CF7 A;  2O61 A;  1UHW A;  4U7D A;  3K1N A;  5LHI A;  1F1Z A;  2GWR A;  4ZYG A;  1J7K A;  3C7J A;  2EFW A;  4HBL A;  1F9N A;  1YQA A;  2V9V A;  4A5M A;  5D5U B;  2OBP A;  3VOD A;  3F8C A;  2P5V A;  1SFX A;  3ECO A;  4CGZ A;  3FMR A;  4HF0 A;  1S7A A;  1W4M A;  4RGX A;  1Z91 A;  5F6F A;  5E17 F;  4GXO A;  2YX4 A;  3RDI A;  2QZ8 A;  2RNJ A;  2AS5 F;  1FY7 A;  4E70 A;  1IXR C;  1MKM A;  1HKS A;  2BEO A;  1YS6 A;  4I02 A;  4L5I A;  1G3Y A;  2CWE A;  4ESF A;  2FBI A;  3LQQ A;  2OQG A;  4LGW A;  2BE5 F;  3J7A O;  1FYK A;  2W25 A;  2L02 A;  1JHH A;  3DEU A;  1ZLJ A;  2JPC A;  3KFW X;  1LJ9 A;  2FA5 A;  2FRH A;  3GZ6 A;  2CQK A;  1PP7 U;  4IRI A;  4EGZ A;  1IZ1 A;  5L3B A;  1IRG A;  4EJU A;  2M30 A;  3W6K B;  4U7B A;  2PJP A;  3HHH A;  4LLL A;  2DBB A;  2TDX A;  4G7H F;  4DNC A;  4WXH A;  3QU3 A;  2K86 A;  4L9N A;  1LNW A;  1QZZ A;  2RQP A;  3FMQ A;  1LVA A;  4MNU A;  5F1R A;  2GXB A;  4EVI A;  3F72 A;  5ICE A;  3JSO A;  4LG0 B;  1ULY A;  3EQL F;  4RAY A;  3BZ6 A;  2VOO A;  2O8X A;  1R22 A;  2OZU A;  3J80 K;  4G6Q A;  5DCF A;  4KYW A;  4BQA A;  4TV7 A;  2HKO A;  2V1D A;  1K79 A;  2ZBK A;  3LA2 A;  1WSU A;  1IXS B;  3WTV C;  1OYW A;  4IJA A;  4OIN F;  2HDC A;  1H9G A;  1UST A;  2FNP A;  2ZJ2 A;  1B4A A;  2MLG A;  4BHB A;  3Q5F A;  3CTA A;  3CO7 C;  2A61 A;  4GGG A;  2OQR A;  2ZME B;  2RKH A;  4JK1 X;  4RGR A;  4R79 A;  1D8J A;  4HV5 A;  1K78 A;  4YIF A;  2VE8 A;  3GZ5 A;  1ZRC A;  1KQ8 A;  5CLS A;  2XVC A;  1OKR A;  2XV4 S;  1Z1D A;  1PUE E;  4YG2 F;  4O3M A;  4AVP A;  5JHU A;  5D8K B;  2IA0 A;  5CJ9 A;  4EM0 B;  3I5U A;  3VOE A;  1BC8 C;  2A07 F;  2VC0 A;  1GHC A;  1FC3 A;  1J0R A;  2ISZ A;  1ZGJ A;  3WGH A;  3QOP A;  3F23 A;  1I27 A;  2FQ3 A;  1DP7 P;  3BPV A;  4WWC A;  2ESH A;  1JGS A;  2KJB A;  4IXA A;  1UCR A;  5BS6 A;  2ZO4 A;  2FSW A;  1IUY A;  2D1V A;  5E1W A;  4FX0 A;  1R1T A;  2VC1 A;  3IHU A;  4LD5 A;  2R3S A;  4MTD A;  4G94 A;  2GA2 A;  3OV8 A;  1MJ9 A;  1YW9 A;  4NB5 A;  3EYY A;  1WQ2 A;  3PQJ A;  1KU9 A;  5FO5 A;  3LAP A;  3GO5 A;  1RI7 A;  3V8L A;  2A69 F;  2IA1 A;  1ZRE A;  3COA C;  2CO5 A;  5LHH A;  2EWN A;  3PFI A;  1HKT A;  1NHA A;  2Z3Y A;  3U1D A;  1TNS A;  4M9Z A;  2MBF A;  1O57 A;  5D5X B;  2FBK A;  4WXC A;  3K9T A;  2XIG A;  2Q0O A;  2GQQ A;  5L3G A;  5LEJ A;  3EDP A;  3F8N A;  2Y48 A;  3HSR A;  1B1B A;  1PP8 F;  3BJA A;  2V1X A;  4EM2 A;  3WTW C;  3TKY A;  4UNO A;  1K7A A;  3BOQ A;  3HTS B;  1O3S A;  3W6J B;  2F5D A;  5LEK A;  5DCM B;  3K0L A;  1FWZ A;  5ILU A;  1QPM A;  2RDP A;  1XDU A;  4OMZ A;  2ZXJ A;  3QP5 A;  3KP5 A;  5HDN A;  3PQK A;  5ERI A;  1HBX G;  1P4W A;  1VTN C;  1ONV A;  1R5G A;  4HX4 A;  2EA4 A;  3F6O A;  3QPT A;  4P9U A;  2DK8 A;  3BDD A;  1FYM A;  3E6D A;  2PG4 A;  3KP2 A;  3IRQ A;  4LB6 B;  2Y75 A;  1QZY A;  4HLY A;  3WTX C;  1EH8 A;  3J81 K;  3R0A A;  2DAO A;  2JSC A;  1KYZ A;  4HZF A;  4AWX B;  1W5S A;  4RB2 C;  1SMT A;  1XSX A;  1SD5 A;  2EV5 A;  2ISY A;  5LRR A;  4MQV A;  5FLX Z;  2DU9 A;  3KP3 A;  2R7D A;  3SFZ A;  2JPB A;  4CYD A;  3O6B B;  1J9I A;  5FFZ A;  3SQN A;  2CW0 F;  3I59 B;  2WWY A;  4ZYH A;  1R23 A;  1R36 A;  4LLN A;  3BY6 A;  4KIB A;  4IHS A;  4BHP A;  3HOT A;  2IPQ X;  2QEN A;  4LLG F;  1S7O A;  3DV8 A;  4A5N A;  3CJN A;  5E8G A;  1SMY F;  3ZMT A;  2RN7 A;  3U9G A;  2O03 A;  6PAX A;  2DLL A;  2L54 A;  1DPR A;  4QLC U;  2HTJ A;  4RAZ A;  3KP4 A;  4WX9 A;  2QQA A;  4EM1 A;  3FX3 A;  4ESJ A;  4U0W A;  2UWM A;  4IPA A;  1JE8 A;  2D1H A;  4LK1 F;  4I09 A;  3GW2 A;  4IRG A;  4IVN A;  2X0L A;  1ZG1 A;  1HW1 A;  1UFM A;  2ETH A;  2Z9O A;  3MEX A;  3ZPL A;  2KIM A;  4L9T A;  2XUB A;  4S04 A;  3TGN A;  2QWW A;  2HTS A;  4G7O F;  3U2R A;  1WKM A;  4A0Z A;  2OU2 A;  1P92 A;  3GF2 A;  2H94 A;  1PDN C;  3KP7 A;  3WTZ A;  3AAF A;  1DDN A;  1ZH5 A;  1YFH A;  5JR3 A;  4L9V A;  2GZW A;  1XB4 A;  3ABT A;  3GVA A;  5DV5 A;  5JFR A;  3ZN0 A;  1O7L A;  1QNT A;  4ASN A;  3ERE D;  3JAM Z;  2H09 A;  5HLI A;  3I71 A;  1SD6 A;  5DD8 A;  4JQF A;  3LA7 A;  2E7W A;  1KQ9 A;  1BI1 A;  3Q9V A;  1BIA A;  1BM9 A;  3FXU A;  4O5V A;  1J5Y A;  1S29 A;  1FPQ A;  3ISP A;  5ILV A;  5HDG A;  4EJV A;  1WI9 A;  3IL2 A;  2R7F A;  4A6D A;  4DQ2 A;  1WRJ A;  2NAZ A;  1IXC A;  1MJB A;  3V7S A;  5L3E A;  5HLH A;  1YTY A;  1U78 A;  3M9A A;  2XAH A;  4KNY A;  5LGN A;  4YII A;  2VN2 A;  4ESB A;  3O3K A;  3VFZ A;  2HYG D;  3ZP5 A;  3WTY C;  3WU1 B;  4ENK A;  2DI3 A;  4I01 A;  4CZZ A;  1FSE A;  1QO0 D;  4P9F A;  4AIK A;  3B02 A;  4Y17 A;  3G73 A;  1R7J A;  4KT5 C;  5FD5 A;  2DPD A;  2QQ9 A;  1E2X A;  4GCV A;  1K6O A;  5E1X A;  3F21 A;  5HS7 A;  3LQR A;  2FF4 A;  5HDK A;  3MAJ A;  2EFQ A;  1U5T A;  4UXN A;  2M45 A;  3ROU A;  2XRN A;  1FLI A;  1MD0 A;  1EV7 A;  1ON2 A;  5JVT A;  2J5P A;  4S05 A;  5LGT A;  4H0E A;  2PLY A;  4QWQ A;  2DFI A;  3ECH A;  1JHF A;  2VOD A;  3O2P E;  5L3F A;  3R60 A;  4A2U A;  1IRF A;  3FM5 A;  1XGN A;  3VEP A;  1MDM B;  3WTS C;  4YFX F;  3F8B A;  4OMY A;  3H92 A;  1CF7 B;  3ULQ B;  2RC4 A;  4ETS A;  1Y0U A;  5H6Q A;  5EEG A;  5E8I A;  2KJC A;  1HQC A;  2PBI A;  3KZY A;  4I7H A;  1KYW A;  1RUO A;  3E3V A;  3CO6 C;  4EJT A;  4OIQ F;  3HRT A;  3GFL A;  5ILS A;  1IN7 A;  3RYP A;  4I2O A;  1FZP B;  2M1B A;  2D45 A;  4ZH4 F;  2RVC A;  3GXO A;  3SXY A;  2HOE A;  1W7P A;  3GYH X;  2IRF G;  4EV0 A;  1YG2 A;  2GIV A;  4L0Y B;  2VOP A;  4HX8 A;  2W85 A;  4PCQ A;  2OD5 A;  5DEQ A;  3I64 A;  1XN7 A;  2H27 A;  5FFX A;  1KQ0 A;  3MWM A;  5K5R A;  5BMZ A;  1SFU A;  4L5J A;  2XAG A;  4ZZD A;  2DTR A;  2Z99 A;  3E6M A;  2M87 A;  1HSJ A;  5D4S A;  4RGS A;  1XDS A;  2V1U A;  3GFJ A;  2JTV A;  4UVB A;  5KK1 A;  2MH2 A;  5D5W B;  5CVR A;  4KFC A;  2HEO A;  3GFM A;  3NRV A;  1R58 A;  2EA2 A;  3IKV A;  5H6R A;  3RKX A;  2UXN A;  1RIO H;  1HW2 A;  5BQT A;  3I54 A;  3LWF A;  2L4M A;  2P6T A;  3V7R A;  1BI3 A;  1HST A;  4XRF A;  3DQV C;  5CYV A;  4M71 A;  4ENM A;  2JRT A;  1STZ A;  5DUK A;  5DD4 A;  2P7C B;  1I5Z A;  2A3S A;  3QU6 A;  1F5T A;  4OIP F;  4GYG A;  3L09 A;  3L2C A;  3HYI A;  4KIF A;  2FU4 A;  3IWF A;  3FXQ A;  4BH9 A;  3SHF A;  2Q2E A;  1ZRD A;  1P6R A;  4LFU A;  4G6D A;  2P5L C;  3N4M A;  1XGM A;  4N0B A;  1EH6 A;  5L3C A;  4CXF A;  1K78 B;  1T38 A;  3KLO A;  1YW8 A;  5HOO A;  4KUM A;  3H3U A;  4UHT A;  5DUI A;  3E6C C;  2K7L A;  3E5Q A;  1J75 A;  3CDH A;  1S3J A;  1D3Y A;  4RB3 C;  1SAX A;  2LDU A;  4RB0 A;  4IHT A;  2V79 A;  5EEH A;  4MHG A;  2O0Y A;  4NHJ A;  2RGV A;  4ZYD A;  3BJO A;  5D5V B;  5D8L B;  4A12 A;  1KU3 A;  5DDG A;  1G3T A;  3CUQ C;  2XAS A;  3TOB A;  1IN6 A;  2XKP A;  2ZKZ A;  2H6C A;  1IW7 F;  2PEX A;  3EUH A;  4PDK A;  5D6E A;  3V8K A;  3VB2 A;  1LDJ A;  2BYV E;  1ODD A;  4MEY F;  4HQE A;  3DKW A;  3WTT C;  4D0P A;  1ON1 A;  4L0Z B;  1KU2 A;  1RNL A;  4PZJ A;  3FXR A;  4XBF A;  2IT0 A;  2HS5 A;  1V4R A;  4HW0 A;  1OMI A;  2W24 A;  2Z33 A;  5BPI A;  4Y15 A;  4M74 A;  2MA3 A;  2QVO A;  4A6E A;  1FYL A;  1B6A A;  4AIH A;  1A04 A;  1ZAO A;  2A68 F;  2ACJ A;  3FM3 A;  1TBX A;  3BJ6 A;  1ZAR A;  3GEZ A;  2GA1 A;  3RIR A;  3DP7 A;  5HLG A;  1AWC A;  1QGP A;  1T0F A;  2JT1 A;  1FBS A;  2K27 A;  2BV6 A;  1U6G A;  1TLH B;  1TTY A;  2QBY A;  1BI2 A;  4ON0 A;  2HKX A;  5FGM A;  2ZFW A;  1Z6T A;  1O3R A;  5ICG A;  3WTU C;  2DQL A;  3F6V A;  3JTH A;  2UZK A;  3RKY A;  1R1U A;  4R8H A;  3T1B A;  1TQM A;  3WOD F;  4G7Z F;  1D5V A;  1UHM A;  3J81 Z;  2V6C A;  2IW5 A;  2A6H F;  4EGY A;  1U5T C;  3KET A;  3S2W A;  1KGS A;  4Y13 A;  3T8R A;  5F64 A;  4M9X A;  5A2Q K;  1G4D A;  2L01 A;  4WK8 F;  4Z2Y A;  2L4A A;  5IT9 Z;  2MC3 A;  2MH9 A;  1TW3 A;  4I0B A;  5KVR A;  3HIF A;  2A5Y B;  3M1E A;  4KMU X;  4RB1 A;  3L7W A;  1B9N A;  3BP8 A;  3RJP A;  5K1Y A;  3IC7 A;  4XSZ F;  5H20 A;  3T5X A;  1T6S A;  5LLQ A;  1I1G A;  4N9H A;  5AON A;  1LQ1 A;  3TO6 A;  2E1C A;  3TO7 A;  2LF8 A;  1XMA A;  2NS0 A;  2XAQ A;  1MZB A;  2DQR A;  3P7N A;  1ZGA A;  1RZ4 A;  1R1V A;  2CG4 A;  2EFP A;  2UXX A;  3MZH A;  5CVV A;  5E20 A;  3K2Z A;  4UVC A;  3NQO A;  2PMH A;  3KP6 A;  5HVQ C;  2KRF A;  4EQQ A;  3P9C A;  1BC7 C;  3CUQ A;  3EET A;  1SD4 A;  2ELH A;  2JZY A;  2Q8K A;  3TQN A;  2J5O A;  1ZRF A;  3FHZ A;  2O6G E;  2NNN A;  4UUV A;  3ELK A;  2FXA A;  3MFK A;  2EV0 A;  3OOP A;  1FSH A;  3L00 A;  2M5W A;  1USS A;  3NEU A;  2FMY A;  4WCG A;  3FF5 A;  2A6E F;  2QQB A;  1BOA A;  1L0O C;  2X4H A;  2CFX A;  1ZHF A;  1TQI A;  3M7G A;  3K1M A;  1MGT A;  1W7P D;  1U3E M;  4F7Z A;  5K5Q A;  2BBY A;  3ZMZ A;  2DPU A;  4BYY A;  3WGG A;  3JW4 A;  4HAM A;  3DPL C;  4MTE A;  4EMS A;  1YLF A;  5ICF A;  3F8F A;  4HQM A;  1G6N A;  2B0L A;  2F5C A;  2GAU A;  2YR2 A;  3TDU C;  3D5L A;  1GXP A;  1OPC A;  4YFN F;  4FT8 A;  3JSP A;  2WC2 A;  2P4W A;  4P96 A;  4ENJ A;  2VBZ A;  4CIC A;  1G3S A;  4M9S A;  5HS9 A;  1YIO A;  2KKO A;  4EJW A;  1BN5 A;  3HRU A;  3KZZ A;  3V7C A;  5AIP A;  4PGG A;  2QLZ A;  4CO8 A;  1LB2 A;  5JI6 A;  3R61 A;  2F5E A;  3CLO A;  2FBH A;  3P9I A;  3BPX A;  2STT A;  4HYE A;  3GWZ A;  1TW2 A;  3ZMU A;  4Q48 A;  2STW A;  1BJA A;  2DT5 A;  1BI0 A;  1FOK A;  3DXJ F;  5CVI A;  1XCB A;  4M73 A;  3MCZ A;  1F4K A;  4HF1 A;  3K1P A;  2K4J A;  1BIB A;  1IN8 A;  4GYI A;  1J2X A;  2KIF A;  4RGU A;  1BBY A;  4XSX F;  1MJA A;  2ADU A;  2DK5 A;  3IWZ A;  3QRF F;  1U2W A;  2L3D A;  3DPT A;  1I1S A;  1P4X A;  3IRR A;  5FB2 A;  1O3T A;  1Q1H A;  1UB9 A;  2F5F A;  4HDU A;  4LG0 A;  3SZP A;  1WWX A;  4B8X A;  3HHG A;  2GXG A;  2YX7 A;  2O3F A;  1FT9 A;  1U5T B;  4YFK F;  3REO A;  2XHK A;  4K2E A;  3DFG A;  4ENN A;  3C1D A;  1P4A A;  3RTR A;  4OIR F;  5LGU A;  4A0Y A;  1XGS A;  5AIQ A;  1XMK A;  4ZYE A;  2CYY A;  2P8T A;  2EJR A;  2ZCW A;  4KMF A;  2ZNY A;  4HDV A;  4U0Y A;  1V3F A;  3K69 A;  1H9T A;  4O6J A;  5TJJ A;  5DYM A;  2ZME A;  1FBU A;  3TDZ C;  5LBQ A;  2OZ6 A;  1YW7 A;  3G3Z A;  4Q4Z F;  2XGX A;  1Z9C A;  1ZG3 A;  5E1Z B;  3RPQ A;  2EV6 A;  1R00 A;  5HS8 A;  1C0W A;  2FOK A;  4R1H A;  4IRH A;  2NNY A;  1HXD A;  2COM A;  3LA3 A;  4L18 B;  1HW5 A;  3QPH A;  4MQ9 F;  3J80 Z;  1L3L A;  4HV6 A;  2HGC A;  2D2W A;  2HQR A;  1GVJ A;  2HYF A;  5TRD A;  4HX7 A;  3R6S A;  1G3W A;  3LST A;  2HR3 A;  3MQ0 A;  3FZV A;  1W7P B;  1ZN2 A;  2DO7 A;  4B09 A;  2CGP A;  4U0V A;  3RI4 A;  5J6X A;  3F3X A;  4UVA A;  1O3Q A;  1X3U A;  2F2E A;  3WE2 A;  2OAZ A;  2G9W A;  2YU3 A;  3HOS A;  3T0Y A;  4OIO F;  2PQ8 A;  4P5O A;  4L9J A;  2Z5U A;  4AIJ A;  3HSF A;  3Q9S A;  3LFK A;  4HOB A;  2KIU A;  4KN4 X;  4G8X A;  3RKW A;  2P5K A;  5ICC A;  4NQW A;  2P6S A;  2AXL A;  2VON A;  1YO5 C;  2YPR A;  5D6F A;  2VBY A;  3B73 A;  5DCM A;  4WF2 A;  2FEZ A;  2NYX A;  2RV8 A;  3P9K A;  3MZY A;  3GLX A;  2E7X A;  2YSR A;  2EB7 A;  2VE9 A;  2BGC A;  3WGI A;  4FX4 A;  3I4P A;  3C18 A;  3E5U A;  4XLN F;  3WU0 A;  1GXQ A;  4MGR A;  4LK0 F;  2ESN A;  3HRM A;  2C6Y A;  4I0A A;  2EFO A;  5FD6 A;  5E18 F;  2HZT A;  3KLN A;  2WTE A;  2PMU A;  2VBX A;  5CVU A;  4Q5S F;  1LDD A;  3ZMD A;  2QUF A;  2VT3 A;  3IKT A;  4WXD A;  4KIG A;  4EJO A;  4HA8 A;  4LJZ F;  2PN6 A;  4XLP F;  2E1N A;  4KN7 X;  3D0S A;  4HF2 A;  3KE2 A;  1R5H A;  3F8M A;  3KEQ A;  3WG9 A;  5LHG A;  1FP2 A;  2DW4 A;  1CGP A;  4LB5 A;  2G7H A;  4ZZL A;  5L3D A;  2HWV A;  4GO1 A;  3I59 A;  4LMY A;  1U8R A;  2K4B A;  1XGO A;  1P2F A;  1JXS A;  3FWE A;  3EYI A;  3R0J A;  3L9F A;  3R4K A;  5D4R A;  3DF8 A;  1T2K A;  3V4G A;  4HLX A;  1S6L A;  4I98 B;  1XSV A;  2K02 A;  2ZNZ A;  1TQP A;  1DUX C;  5FLX K;  2FNA A;  2H6B A;  1E17 A;  2IVM A;  1XCV A;  3HUG A;  2VBW A;  1W5T A;  2CSO A;  5CVJ A;  2PI0 A;  4U88 A;  1QBJ A;  1SFE A;  4BAY A;  5IT9 K;  2P7V B;  2MD5 A;  2XKO A;  1J59 A;  2VXZ A;  1S8N A;  1KA8 A;  1OYY A;  4FHT A;  3RPU A;  4UV8 A;  3SZT A;  1FNN A;  3E97 A;  1XSD A;  2VT2 A;  1T98 A;  4M72 A; 
#chains in the Genus database with same CATH topology
 2ZXH A;  2IJL A;  2QBY B;  3TBI A;  2CW7 A;  2IP2 A;  4A0X A;  5A2Q Z;  1DGW Y;  3LMM A;  5LRS A;  2JK3 A;  5GPC A;  3ZMS A;  3EUA A;  1ZLK A;  2K3F A;  3KYD B;  4BE2 A;  2R7Z J;  2E2J J;  1XD7 A;  3VYS B;  5BPD A;  2W57 A;  2QM3 A;  3IH4 A;  3K4L A;  4FTH A;  4AM3 A;  3F0C A;  1B59 A;  2EK5 A;  3RYR A;  3CUO A;  1JTY A;  1LDK B;  1O7F A;  5J8C A;  1P7I A;  4BXU A;  3GX4 X;  2EQR A;  1RUN A;  3BRO A;  1TNT A;  1LEA A;  3GTM J;  2Y0S A;  2EFN A;  3QP6 A;  4CHU A;  4HNT A;  4IEJ A;  1YYV A;  4KJZ A;  4M3G A;  1ZGW A;  2M7B A;  4AD9 A;  3CJT B;  3BR3 A;  2WV0 A;  4J00 A;  2KHM A;  1G8X A;  3E6B A;  3F22 A;  2ZJR F;  2PFB A;  3VSK A;  1YX5 A;  1Z7U A;  4IHV A;  5FJ8 J;  2MLK A;  4GDF A;  4A93 J;  3M8E A;  1OYI A;  4AUX A;  4A3K J;  4E4H A;  1OCZ H;  3W2W A;  3ABU A;  1RRJ A;  1JUM A;  5JHF A;  5IYC J;  1I6X A;  5J40 A;  1UJ8 A;  4XLE A;  4E7J A;  2R4G A;  2L9R A;  3H3Z A;  3S3N A;  1MBG A;  4PGH A;  2DA2 A;  3FMS A;  4RS8 A;  1BA5 A;  4KDP A;  3M8F A;  2XRO A;  1HF0 A;  4N9I A;  4M3F A;  5J4Y A;  2L5Q A;  4IF4 A;  2BY3 A;  3DTE A;  3L2V A;  4MEX F;  2XAF A;  3BWG A;  2QYO A;  1H89 C;  3B6A A;  3T8T A;  4KA4 A;  5J8F A;  3WE3 A;  2LSO A;  4Q47 A;  1S72 I;  4KIC A;  1Y0N A;  1LEB A;  2QSH X;  3VPR A;  1OQY A;  3A0B C;  1IN5 A;  3KYL A;  4CCL A;  2M8E A;  4EEF G;  5BOX A;  1Z05 A;  3ZQL A;  1AOY A;  4B3A A;  1IN4 A;  2NVT J;  3KCC A;  5FRM A;  3OYM A;  1R5I D;  1D8K A;  2B63 J;  3JAM K;  2LMD A;  3RZO J;  2V6E A;  1ZYR F;  2G7U A;  1YS7 A;  1R71 A;  4ANJ A;  3HTU A;  1SVM A;  3ZMV A;  2NVU B;  5IT3 A;  3TO9 A;  4M6X A;  2CV1 A;  4LG3 A;  2QF7 A;  3DPU A;  3PUF A;  3BT9 A;  4UV9 A;  1Z6R A;  1X1B A;  2Y30 A;  2O8K A;  3GUD A;  3WHC A;  3ZN1 A;  2K9S A;  1NK2 P;  4CH7 A;  2K9L A;  3HRS A;  3OYA A;  3I4M J;  3A01 B;  3CCS I;  1H0M A;  1ZG5 A;  3E5X A;  3NWS A;  2W84 A;  5EF6 A;  4I76 A;  4OOI A;  4A3C J;  3UKG A;  1OR7 A;  4BHC A;  1FBQ A;  1T39 A;  2Y0M A;  1FMW A;  3LNQ A;  5F1J A;  3QAH A;  3W2A A;  1WJE A;  3ZQ7 A;  2VKD A;  1DPU A;  4S0H B;  2LRE A;  2ECC A;  2PJR A;  1AA7 A;  3HB9 A;  2OPT A;  3CUQ B;  1FX7 A;  1QZE A;  3LAJ A;  2IA2 A;  1FP1 D;  5K5O A;  5GTI C;  2FML A;  2YUS A;  1EH7 A;  3BR6 A;  2L7K A;  2LKP A;  2H8R A;  2HQN A;  3W3C A;  2XAJ A;  1K4T A;  2EBI A;  2EPF A;  1ETO A;  3ZOB A;  1HKQ A;  1Z67 A;  1KU7 A;  3V8J A;  1B9M A;  4CDG A;  1BW5 A;  3AG2 H;  4JBA A;  3S1Q J;  5JLW A;  1YX3 A;  2BW3 B;  2HFH A;  2VI6 A;  1T8I A;  3TOA A;  3KYC B;  3KEO A;  3ML6 A;  4XOR A;  3I0T A;  2GM4 A;  1LE8 B;  1YHQ I;  3C3W A;  3JTG A;  4RAG A;  3SDG A;  3GFI A;  4HSR A;  4P55 A;  2OA4 A;  3I53 A;  3SDB A;  4BNC A;  1IAW A;  2IGN A;  4J19 A;  3I4N J;  3HOU J;  2FE3 A;  3HSE A;  1EA3 A;  1BOB A;  3HOW J;  2IGM A;  2NRA C;  1REP C;  4M6Y A;  4OU0 A;  1MDM A;  1IF1 A;  2LNB A;  3BQY A;  5ED4 A;  3N97 A;  1SD7 A;  3I58 A;  2ZSH B;  2LF7 A;  5CQE A;  1QQI A;  3CMA I;  3HGG A;  1FOW A;  4G9Y A;  4CSW A;  1CF7 A;  2O61 A;  1UHW A;  4F91 B;  4U7D A;  3CC7 I;  3SFI A;  3K1N A;  1ERD A;  3GME A;  3CCE I;  3J7Y J;  5LHI A;  1F1Z A;  3MKY B;  2OTJ I;  3VYT B;  2GWR A;  2DOA A;  1GVD A;  3FXL A;  2CW8 A;  1VQ6 I;  4ZYG A;  1BR2 A;  2Y9Y A;  2QKM B;  1J7K A;  3C7J A;  2EFW A;  2CQ7 A;  4HBL A;  1F9N A;  1YQA A;  2V9V A;  4A5M A;  5D5U B;  4M3B A;  2NOG A;  5F0F A;  2HOT A;  5FLV A;  1DU6 A;  2OBP A;  2JRM A;  4PUS A;  3RKQ A;  3VOD A;  3U21 A;  1FOY A;  1OIS A;  3F8C A;  2FQ4 A;  1A31 A;  1N78 A;  2FD5 A;  1SFX A;  2P5V A;  3ECO A;  3K4C A;  3CZ6 A;  4CGZ A;  3FMR A;  4D1Q A;  4HF0 A;  4CUG A;  1S7A A;  2RRE A;  3DBL B;  1W4M A;  2LC2 A;  4RGX A;  3MZ8 A;  4GRI A;  2LK2 A;  3IAM 2;  1HC8 A;  1Z91 A;  5F6F A;  4XL9 A;  3H0D A;  5E17 F;  4GXO A;  2YX4 A;  3RDI A;  2QZ8 A;  3BG3 A;  1I50 J;  2KQR A;  3FXM A;  3K6G A;  2RNJ A;  2AS5 F;  1FY7 A;  4E70 A;  1IXR C;  1MKM A;  2W7N A;  1HKS A;  1G59 A;  5C44 J;  2BEO A;  1YS6 A;  3OL3 A;  4I02 A;  4L5I A;  1JTX A;  1VZ0 A;  4B3X A;  1G3Y A;  2CWE A;  4X0G A;  2JVH A;  4ESF A;  2V4J C;  2FBI A;  3LQQ A;  2OQG A;  4LGW A;  2BE5 F;  3J7A O;  1FYK A;  4F52 A;  1QHH D;  2W25 A;  2L02 A;  3B6C A;  1U9O A;  1JHH A;  3DEU A;  5DTD A;  1ZLJ A;  1B72 B;  3OYC A;  2JPC A;  3KFW X;  1LJ9 A;  2FA5 A;  4JX4 A;  2LKX A;  3HDD A;  4QPO A;  2FRH A;  2XB0 X;  3GZ6 A;  2CQK A;  2AO9 A;  2R5Y B;  1PP7 U;  4IRI A;  4EGZ A;  1IZ1 A;  5L3B A;  1IRG A;  1OCP A;  4EJU A;  2M30 A;  3W6K B;  3G2B A;  4U7B A;  2PJP A;  3HHH A;  2DA3 A;  4LLL A;  2DBB A;  2TDX A;  4G7H F;  1R4M B;  4DNC A;  3L2W A;  4Y33 A;  2LVS A;  3N05 A;  1Y56 A;  4WXH A;  1FMV A;  3QU3 A;  2LD5 A;  2K86 A;  4GFB A;  1Y8Q B;  1LNW A;  1QZZ A;  2RQP A;  3BG6 A;  4L9N A;  3OS2 A;  3FMQ A;  1LVA A;  1ZKG A;  4MNU A;  3LSP A;  2MD0 A;  5F1R A;  2ZFU A;  2GXB A;  3JRI A;  4EVI A;  2BOL A;  1LPQ A;  4CCO A;  3F72 A;  5ICE A;  1T33 A;  3JSO A;  3CCV I;  1JT0 A;  2NS8 A;  1E3H A;  2M8G X;  4LG0 B;  1ULY A;  2E34 A;  3EQL F;  1WHU A;  4RAY A;  3BZ6 A;  3GZN B;  2VOO A;  2O8X A;  3BCB A;  3OS0 A;  5IYD J;  1R22 A;  2KZG A;  2OZU A;  3J80 K;  4G6Q A;  5DCF A;  4B48 A;  4KYW A;  4BQA A;  4TV7 A;  2HKO A;  2V1D A;  3C2H A;  3FXK A;  3LSM A;  1W1W E;  1D1B A;  3BTJ A;  1K79 A;  2ZBK A;  2IGK A;  1X1A A;  4C2U A;  2HQ5 A;  1PJR A;  3LA2 A;  4HST A;  3OYJ A;  1WSU A;  1IXS B;  2QA4 I;  3VSL A;  3WTV C;  1OYW A;  4IJA A;  3HKZ A;  1JJ6 C;  4C30 A;  4OIN F;  1RKT A;  2WAQ A;  2HDC A;  1Y39 A;  1H9G A;  1UST A;  1ETQ A;  2FNP A;  3MKZ A;  2ZJ2 A;  1B4A A;  1HLV A;  4NDL A;  2MLG A;  4BHB A;  3Q5F A;  3CTA A;  4PFP A;  3S8P A;  3CO7 C;  2A61 A;  4GGG A;  2WV1 A;  2OQR A;  2ZME B;  2RKH A;  4IQ4 A;  4JK1 X;  4RGR A;  2PMZ A;  4R79 A;  4UUT A;  3H3V K;  1D8J A;  4HV5 A;  3IV5 A;  2FUG 2;  3HJE A;  5GP9 A;  2NVX J;  4HEA 2;  1K78 A;  4YIF A;  3AFH A;  1K4S A;  2VE8 A;  3GZ5 A;  1VFC A;  3ASO H;  1ZRC A;  1KQ8 A;  5CLS A;  2XVC A;  1OKR A;  4X6A J;  2XV4 S;  5FRO A;  3FK7 A;  1Z1D A;  1PUE E;  4YG2 F;  2KL4 A;  4V19 K;  4O3M A;  4AVP A;  5JHU A;  5D8K B;  2IA0 A;  5CJ9 A;  2Z2S B;  4EM0 B;  2DA7 A;  3I5U A;  3VOE A;  2DOE A;  4IL6 C;  4XN0 A;  5FKL A;  1BC8 C;  1QPI A;  2A07 F;  2VC0 A;  1GHC A;  1WJA A;  1FC3 A;  1J0R A;  3FIS A;  2ISZ A;  1ZGJ A;  3JRA A;  3RPU D;  5FKN A;  3WGH A;  3QOP A;  3CDI A;  1I27 A;  3PSF A;  3F23 A;  2FQ3 A;  3JRH A;  1DP7 P;  3CES A;  1RET A;  3BPV A;  2BVM A;  4WWC A;  2ESH A;  1JGS A;  4RLQ A;  2KJB A;  5GPA A;  4IXA A;  1UCR A;  5BS6 A;  4A3G J;  2M4G A;  2ZO4 A;  2FSW A;  3P5J A;  1IUY A;  2D1V A;  1GUU A;  5E1W A;  4RBO A;  4FX0 A;  4IKF A;  1R1T A;  3QYE A;  5F27 A;  2DA1 A;  2VC1 A;  3IHU A;  5LFA A;  2L7Z A;  4LD5 A;  4FE7 A;  1OCT C;  3ERM A;  1B8I A;  2R3S A;  4MTD A;  2KDZ A;  5HOD A;  3BR5 A;  4G94 A;  1DGR M;  2GA2 A;  4ZYA A;  3OV8 A;  1MJ9 A;  3BCA A;  1YW9 A;  1T95 A;  4BY1 J;  4NB5 A;  3EYY A;  3SZG A;  1WQ2 A;  2OUM A;  3PQJ A;  1KU9 A;  5FO5 A;  3GTJ J;  3LAP A;  4BXF A;  5H2F C;  2DFF A;  3GO5 A;  2HI3 A;  2WB1 A;  1RI7 A;  3V8L A;  2A69 F;  2IA1 A;  3UR3 C;  4BXX J;  4IQJ A;  1ZRE A;  3COA C;  2CO5 A;  5LHH A;  2EWN A;  3PFI A;  1HKT A;  1NHA A;  2Z3Y A;  3PSI A;  3U1D A;  4BE0 A;  3HEF A;  1TNS A;  4M9Z A;  3ZQC A;  4XNF A;  4DBR A;  2MBF A;  1O57 A;  5D5X B;  2EZI A;  2FBK A;  3EPZ A;  4WXC A;  5GAE J;  2B9S A;  4NQW B;  3K9T A;  2XIG A;  2Q0O A;  3ZQQ A;  2GQQ A;  3CF2 A;  5L3G A;  5LEJ A;  3EDP A;  3F8N A;  2Y48 A;  3HSR A;  4HNV A;  1B1B A;  1PP8 F;  3BJA A;  2V1X A;  4EM2 A;  3WTW C;  4CA0 A;  1X3W B;  2KIQ A;  3TKY A;  4UNO A;  4C3H J;  1K7A A;  3BOQ A;  3JRE A;  3HTS B;  1O3S A;  2X1C A;  4OWR B;  1IV8 A;  3W6J B;  3C2G A;  2XAU A;  2F5D A;  5LEK A;  4RM2 A;  5DS9 A;  5DCM B;  4A3B J;  3K0L A;  3O8H A;  1RKW A;  2CQN A;  1FWZ A;  5ILU A;  1QPM A;  2RDP A;  1XDU A;  2LFB A;  4XIC A;  4XM3 A;  4OMZ A;  2ZXJ A;  3QP5 A;  5FKO A;  4F93 B;  1YRN A;  3KP5 A;  5HDN A;  3PQK A;  5ERI A;  3H9J A;  5J47 A;  1ZR4 A;  1HBX G;  2W4S A;  3H5N A;  1IJW C;  1GV2 A;  1P4W A;  1VTN C;  2ZJQ F;  1ONV A;  4BEH B;  3JRD A;  3K10 A;  5GAG J;  3CF5 F;  2F4O B;  1MBE A;  1R5G A;  1R6R A;  3S2D J;  2VIX A;  2AQF A;  2EA4 A;  3BQZ A;  4HX4 A;  3F6O A;  2WAQ N;  3QPT A;  4P9U A;  2DK8 A;  1F43 A;  1Z77 A;  3BDD A;  1FTZ A;  1FYM A;  4BBS J;  3E6D A;  2PG4 A;  3KP2 A;  3J7Z I;  3IRQ A;  2EZH A;  4XOT A;  4LB6 B;  4CYC A;  2Y75 A;  2LBF B;  2PMZ N;  1MNM C;  1QZY A;  3FBN B;  4HLY A;  3WTX C;  4F55 A;  1EH8 A;  1LVK A;  1E0E A;  2LP0 A;  3U1K A;  3S15 J;  3JRG A;  3BR1 A;  3TW6 A;  3J81 K;  5B1B H;  3R0A A;  2XDV A;  4D9J A;  2DAO A;  1X58 A;  5CPR B;  2JSC A;  3PO3 J;  1U9N A;  1KYZ A;  4HZF A;  4AWX B;  5M5W J;  1W5S A;  4RB2 C;  1SMT A;  4RM3 A;  1XSX A;  1SD5 A;  2EV5 A;  2K9N A;  4DIQ A;  3CCQ I;  4KIS A;  5C4X J;  2L9N A;  2BZT A;  2ISY A;  2GBY A;  2W82 A;  3LSH A;  2DU9 A;  3KP3 A;  4MQV A;  2R7D A;  5LRR A;  3SFZ A;  5FLX Z;  5EZG A;  2JPB A;  2FOW A;  5EG0 A;  4CYD A;  2DDB A;  3O6B B;  1J9I A;  2LY1 A;  5FFZ A;  3SQN A;  2CW0 F;  1QA6 A;  3I59 B;  2M34 A;  2WWY A;  1V5E A;  4ZYH A;  1R23 A;  1R36 A;  3CP8 A;  4LLN A;  3GBG A;  5DM7 F;  1MMA A;  3BY6 A;  2R7R A;  4KIB A;  4IHS A;  4BHP A;  3HOT A;  2IPQ X;  2QEN A;  4LLG F;  3BR0 A;  1S7O A;  3DV8 A;  1Z3X A;  4A5N A;  2P0W A;  3CJN A;  3QWL A;  2L0K A;  5E8G A;  2JA7 J;  1HOM A;  4XQF A;  5B66 C;  1SMY F;  5IOY A;  4DYR A;  1PYV A;  3ZMT A;  2RN7 A;  1K61 A;  3U9G A;  2O03 A;  2QEX I;  1FOX A;  3E1S A;  3HUG B;  1MW7 A;  1PUF A;  2KRC A;  3BG5 A;  1I6H J;  6PAX A;  2DLL A;  1A36 A;  2L54 A;  1DPR A;  4QLC U;  2HTJ A;  2VQG A;  4RAZ A;  3BR2 A;  5EYR A;  3KP4 A;  4WX9 A;  1OFC X;  4UUS B;  1RC9 A;  2QQA A;  2DMN A;  1J09 A;  4EM1 A;  3FX3 A;  3E7L A;  4ESJ A;  4U0W A;  2X6Y A;  3OL4 A;  2WB1 N;  3BC8 A;  4XRS A;  2UWM A;  1EF4 A;  2K5C A;  3AG3 H;  3AL0 C;  4IPA A;  2H8W A;  5CQG A;  1BR4 A;  2DYR H;  4JX6 A;  1JE8 A;  2D1H A;  4PJJ A;  4LK1 F;  5HNH A;  3OS1 A;  4I09 A;  3GW2 A;  2ECB A;  2X6O A;  4IRG A;  5EZH A;  4IVN A;  2X0L A;  1ZG1 A;  5K7F A;  1HW1 A;  1UFM A;  3TW7 A;  1IGN A;  2ETH A;  5B1A H;  1UEL B;  1HDD C;  1VQO I;  2OTL I;  2Z9O A;  4AYB N;  3MEX A;  3OYH A;  3ZPL A;  2KIM A;  2E71 A;  2JA5 J;  4L9T A;  2XUB A;  4XKB A;  4S04 A;  3TGN A;  2QWW A;  2QSG X;  2VL8 A;  2R7U A;  2HTS A;  4BY7 J;  2IS2 A;  4G7O F;  3U2R A;  1MMS A;  3KIO A;  4C3I J;  5KHD A;  1WKM A;  2R7W A;  4A0Z A;  2F5V A;  2OU2 A;  1IC8 A;  1P92 A;  3GF2 A;  3M1C A;  1ETK A;  3BZK A;  2H94 A;  3HM5 A;  4M3E A;  3OYD A;  2DMQ A;  2TRT A;  4BBR J;  1IO2 A;  5E3L A;  1PDN C;  3KP7 A;  3Q0V A;  3RCO A;  2N8G A;  5FRN A;  2R7T A;  3WTZ A;  5GAD J;  3K4M A;  4M3D A;  2QGU A;  3AAF A;  1DDN A;  3FKI J;  1ZH5 A;  1JKR C;  2VPL A;  4NNJ A;  1YFH A;  1WJ5 A;  3DCF A;  5JR3 A;  1V54 H;  4L9V A;  2GZW A;  1XB4 A;  3NWT A;  3S2H J;  3ABT A;  3PNV A;  3GVA A;  4IOA F;  3V42 A;  3H5A A;  5DV5 A;  3A03 A;  5JFR A;  2MG4 A;  2EIL H;  3ZN0 A;  4A3I J;  1O7L A;  4PK4 A;  4F92 B;  1QNT A;  4ASN A;  1X2N A;  3ERE D;  4QPQ A;  4BJ6 C;  1QVT A;  3JAM Z;  2H09 A;  5HLI A;  3I71 A;  1SD6 A;  3OR1 C;  5DD8 A;  2L7F P;  4JQF A;  3LA7 A;  2E7W A;  2HVR A;  3A1Y A;  1KQ9 A;  1BW6 A;  4LOC A;  3PNT A;  3I55 I;  1BI1 A;  3DU5 A;  3Q9V A;  1BIA A;  1BM9 A;  3A0H C;  2KT0 A;  3C2B A;  3FXU A;  4B47 A;  1IDY A;  5GTH C;  4O5V A;  1J5Y A;  2DOD A;  2OCE A;  2L2O A;  3OYN A;  1S29 A;  1FPQ A;  3ISP A;  5ILV A;  1MBK A;  5M3M J;  5HDG A;  5M5X J;  4EJV A;  1A5J A;  1WI9 A;  3IL2 A;  2ME0 A;  1XPX A;  2R7F A;  3OIO A;  3CC4 I;  1APL C;  4A6D A;  4DQ2 A;  1WRJ A;  2VAS A;  2LLK A;  2NAZ A;  1ZK8 A;  1IXC A;  3K2A A;  1MJB A;  2R7V A;  3V7S A;  4A3M J;  1WI3 A;  4YEJ A;  3KPH A;  2IAI A;  5L3E A;  3K4K A;  5HLH A;  2IS6 A;  3DTI A;  3OYB A;  1YTY A;  3QQA A;  1U78 A;  4JP0 A;  1DU0 A;  3M9A A;  3VWB A;  3PJR A;  2XAH A;  4B44 A;  4KNY A;  5LGN A;  4YII A;  2VN2 A;  2HVQ A;  4ESB A;  3SEZ A;  2OJE D;  3O3K A;  3VFZ A;  1Z0X A;  2HYG D;  1W5C C;  3JR9 A;  2R5Z A;  3AG1 H;  3ZP5 A;  2HPI A;  4II2 A;  3WTY C;  3DTK A;  3WU1 B;  4LIU A;  2ME6 A;  1HCR A;  1FTT A;  4ENK A;  1V5G A;  2DI3 A;  2IBD A;  4I01 A;  2E1M B;  4CZZ A;  1FSE A;  1QO0 D;  2VQH A;  4P9F A;  4AIK A;  4YIR X;  3B02 A;  4IZZ A;  5TIS C;  4Y17 A;  3KX2 A;  2QCO A;  2K85 A;  3G73 A;  1SFO J;  1QU3 A;  1R7J A;  4KT5 C;  5FD5 A;  4DOZ A;  2LG4 A;  4BUP A;  3FXO A;  2DPD A;  1FIP A;  1SAU A;  2QQ9 A;  3CJR B;  5IPA A;  1E2X A;  4GCV A;  1K6O A;  5E1X A;  5E3N A;  2PJR B;  3F21 A;  2CRG A;  3DLA A;  5HS7 A;  1OCR H;  3K7A J;  4B1R A;  2Y0S N;  3LQR A;  5EGO A;  2FF4 A;  4XID A;  5HDK A;  3MAJ A;  2ELJ A;  2EFQ A;  1U5T A;  2XRL A;  5CKT A;  4UXN A;  2M45 A;  2CV0 A;  3ROU A;  5K7Z A;  2XRN A;  1FLI A;  1MD0 A;  1EV7 A;  2CV2 A;  2P81 A;  1ON2 A;  3HXL A;  1YE9 A;  5JVT A;  2J5P A;  2QQ8 A;  2CQQ A;  3M07 A;  4S05 A;  5LGT A;  2R7S A;  4H0E A;  2PLY A;  3MN2 A;  4QWQ A;  2DFI A;  2DXI A;  4FAS D;  3I56 I;  3ECH A;  5E79 C;  1JHF A;  2VOD A;  3DEW A;  3O2P E;  1R9T J;  2GOM A;  5IP6 A;  5L3F A;  4BS9 A;  1D1A A;  3FIW A;  1YJW I;  3R60 A;  4A2U A;  4QTR A;  2E1O A;  1IRF A;  1NH3 A;  3IH3 A;  2Z16 A;  1XGN A;  3FM5 A;  3VEP A;  1MDM B;  3WTS C;  3Q3S A;  1WJC A;  4YFX F;  3F8B A;  1GLN A;  4OMY A;  1CQT A;  3H92 A;  3WHB A;  3EUH C;  3CQZ J;  1R4N B;  2TCT A;  3ULQ B;  1CF7 B;  1NK3 P;  5J3L A;  2RC4 A;  4ETS A;  1T08 B;  1RR8 C;  5FKK A;  1Y0U A;  1UMQ A;  4ZTJ A;  5H6Q A;  5EEG A;  3GLL A;  1D1C A;  3HG9 A;  5E8I A;  2JUG A;  2KJC A;  1HQC A;  2PBI A;  3KZY A;  4FIS A;  4I7H A;  1KYW A;  2X1D A;  5DM6 F;  1RUO A;  1W0U A;  3E3V A;  2WAE A;  2VKV A;  3CO6 C;  4EJT A;  9ANT A;  3L1P A;  4OIQ F;  3HRT A;  3GFL A;  5IYB J;  3HOY J;  5ILS A;  1IN7 A;  2HPM A;  2OF7 A;  4BQO A;  3W6V A;  2CUE A;  3RYP A;  4MLO A;  4I2O A;  4XKW A;  5TGT A;  1VF9 A;  1FZP B;  2HDD A;  3S1M J;  4A69 C;  5JVG F;  2M1B A;  2D45 A;  4ZH4 F;  2QSF X;  2RVC A;  4QSH A;  1WFX A;  4DBQ A;  3GXO A;  1P7J A;  1XMX A;  3CCL I;  3SXY A;  2HOE A;  1W7P A;  3L2R A;  1TWA J;  3E0J B;  3QOD A;  4BU2 A;  3OYE A;  1ETX A;  1YG2 A;  2GIV A;  3FDY A;  4OAZ A;  4EV0 A;  4L0Y B;  2VOP A;  4HX8 A;  2W85 A;  4PCQ A;  2OD5 A;  5DEQ A;  1X1C A;  3I64 A;  1XN7 A;  2H27 A;  1ETW A;  5FFX A;  2NVY J;  1KQ0 A;  2HDW A;  3MWM A;  2ZJP F;  1MIJ A;  3S16 J;  5K5R A;  3L2U A;  5BMZ A;  1SFU A;  4V2G A;  1EJ9 A;  1T0F C;  5F0C A;  1R49 A;  4L5J A;  2XAG A;  4DW6 A;  4ZZD A;  2DTR A;  3OYL A;  1IUF A;  2Z99 A;  3E6M A;  2E35 A;  2HVS A;  3ZRG A;  1V5F A;  3OSG A;  1ZR2 A;  1Y1W J;  2M87 A;  5HNF A;  1Q1V A;  1ENH A;  2ICW G;  1HSJ A;  3JRC A;  5D4S A;  4RGS A;  5KAI C;  1XDS A;  2V1U A;  2X9D A;  3GFJ A;  1TWH J;  2JTV A;  4UVB A;  5KK1 A;  2MH2 A;  2F4I A;  2HQA A;  5CVR A;  5D5W B;  4KFC A;  4C2T A;  2HEO A;  2EZK A;  5KAF C;  3GFM A;  3LSK A;  3NRV A;  1R58 A;  4CCN A;  1WH5 A;  3OSF A;  2EA2 A;  1IRZ A;  3IKV A;  5H6R A;  3RKX A;  4HRI A;  2UXN A;  5FKM A;  1RIO H;  1HW2 A;  3HPH A;  3CCJ I;  1JI8 A;  5BQT A;  3I54 A;  3LWF A;  3GTK J;  2VKE A;  1LFB A;  2L4M A;  4D7M A;  2P6T A;  3V7R A;  3PUB A;  3K70 C;  1BI3 A;  1HST A;  3IH2 A;  4XRF A;  4CCJ A;  2JUC A;  2IXS A;  3DQV C;  5GAH J;  2MW8 A;  5CYV A;  2YU9 J;  4M71 A;  5FLM J;  1W0T A;  4ZC3 A;  1YJ9 I;  1WJB A;  2XSJ C;  4ENM A;  2JRT A;  1STZ A;  1I39 A;  5DUK A;  4II3 A;  4DZJ A;  3BZC A;  5DD4 A;  1Z3Y A;  2L7M P;  2P7C B;  2WAD A;  1I5Z A;  3EUK L;  2A3S A;  3QU6 A;  3I3L A;  1F5T A;  4OIP F;  2V7F A;  3CCU I;  4GYG A;  3DBH B;  4IOC F;  3OYG A;  3L09 A;  1FEX A;  3CMY A;  2I10 A;  3L2C A;  3HYI A;  1ITY A;  3G1O A;  4KIF A;  3ZQI A;  1K83 J;  2FU4 A;  3IWF A;  2JA8 J;  3FXQ A;  2XPV A;  4BH9 A;  1JT6 A;  3SHF A;  2Q2E A;  4IO9 F;  1ZRD A;  4DYC A;  1P6R A;  2MFZ A;  3K70 D;  4LFU A;  4G6D A;  4RAF A;  2COB A;  1H8A C;  2P5L C;  2JVG A;  2WA0 A;  3PIP F;  2AXT C;  2HOS A;  1ETY A;  1VQN I;  4RLF A;  3N4M A;  1XGM A;  4N0B A;  1EH6 A;  2BVL A;  5IOZ A;  5L3C A;  4NC8 A;  4BDZ A;  1HA8 A;  1VQ9 I;  2OCC H;  4XR6 A;  2CH0 A;  4CXF A;  1K78 B;  1T38 A;  3KLO A;  1YW8 A;  3H9Q A;  4KUM A;  5HOO A;  2DOF A;  2V26 A;  3BTI A;  3H3U A;  4UHT A;  5DUI A;  3TL4 X;  3E6C C;  2K7L A;  4C2M J;  3E5Q A;  4CCK A;  1J75 A;  3CDH A;  3ZR8 X;  3MD2 A;  1S3J A;  1D3Y A;  1Y8R B;  4RB3 C;  1SAX A;  2LDU A;  4RB0 A;  1Z7L A;  4IHT A;  2V79 A;  2X51 A;  3OIQ A;  5EEH A;  4MHG A;  1MSE C;  2M4K A;  2K40 A;  1AHD P;  3HOZ J;  2O0Y A;  3HGY A;  4PJN A;  1AKH A;  1LKX A;  1K6Y A;  2GXA A;  2D5V A;  2RGV A;  4NHJ A;  4ZYD A;  1WH7 A;  2FJ1 A;  3BJO A;  5J1U A;  2KZV A;  5D8L B;  5D5V B;  1KU3 A;  5DDG A;  4XRM A;  3KZI C;  3OYI A;  4A12 A;  1G3T A;  4A3J J;  2CFO A;  3CUQ C;  2XAS A;  3DKY A;  5IP9 J;  3TOB A;  3GTQ J;  2XF5 A;  3TMO A;  1VQ5 I;  4A3L J;  1IN6 A;  3RZD J;  1RR7 A;  2XKP A;  4IX7 A;  2ZKZ A;  1MSF C;  5KCM A;  2O7O A;  4MO7 A;  2H6C A;  1IW7 F;  2PEX A;  3EUH A;  4PDK A;  5D6E A;  3V8K A;  3LSR A;  1Y1V J;  3QYB A;  3VB2 A;  4W1U A;  1LDJ A;  4E6K G;  1GDT A;  2BYV E;  2DT6 A;  2HYJ A;  3TED A;  1ODD A;  4MEY F;  4HQE A;  1XG1 A;  2CUJ A;  3DKW A;  3HZJ A;  1B8I B;  3ZQG A;  4C3J J;  3WTT C;  4ZTF A;  4D0P A;  1ON1 A;  2IRF G;  4Y52 J;  4L0Z B;  1KU2 A;  1RNL A;  4XLA A;  4PZJ A;  3FXR A;  1JKP C;  1ACI A;  5K7H A;  4XBF A;  2IT0 A;  2HS5 A;  1V4R A;  4HW0 A;  1OMI A;  2W24 A;  4N4O B;  2BXZ A;  2Z33 A;  3MKW B;  5BPI A;  1P9Q C;  4Y15 A;  4IHX A;  1A6I A;  1BL0 A;  3HKZ N;  4M74 A;  2MA3 A;  2QVO A;  2NOJ B;  4A6E A;  2LY2 A;  2OV7 A;  1FYL A;  1MBH A;  1B6A A;  1BJZ A;  4I99 C;  4AIH A;  2XB5 A;  4Y3O A;  1A04 A;  4XOP A;  1ZAO A;  2A68 F;  3CP2 A;  2ACJ A;  3FM3 A;  1TBX A;  2G0E A;  1ZQ3 P;  3BJ6 A;  2K9Q A;  1ZAR A;  4PSW A;  3GEZ A;  2GA1 A;  3RIR A;  3DP7 A;  5HLG A;  1AWC A;  2Y31 A;  2V9P A;  2X85 A;  3PNY A;  2HOA A;  1QGP A;  1T0F A;  2LOO A;  2JT1 A;  2JA2 A;  4OAY A;  3PO2 J;  1FBS A;  4RMN A;  2K27 A;  3DEE A;  2BV6 A;  1U6G A;  1TLH B;  1TTY A;  3QYF A;  2QBY A;  3AKZ A;  5JLX A;  1BI2 A;  4ON0 A;  1X4P A;  2HKX A;  5FGM A;  2ZFW A;  1Z21 A;  1Z6T A;  1O3R A;  5ICG A;  3HC7 A;  3WTU C;  2DQL A;  2RQQ A;  3F6V A;  3JTH A;  2M2E A;  2UZK A;  2VJJ A;  1JUS A;  1R1U A;  3RKY A;  4R8H A;  2OC6 A;  3T1B A;  5LD2 C;  1YRN B;  1TQM A;  3WOD F;  4BGD A;  4BDY A;  4G7Z F;  1M1E B;  1D5V A;  4D7N A;  1UHM A;  3J81 Z;  4BQN A;  2V6C A;  2DDA A;  2IW5 A;  2A6H F;  3QPS A;  3VYU B;  4EGY A;  1U5T C;  3KET A;  3S2W A;  2DT7 B;  1KGS A;  2UUZ A;  1QVU A;  2W1O A;  4Y13 A;  3T8R A;  5F64 A;  4M9X A;  5A2Q K;  1G4D A;  3SEQ A;  2MYS A;  4E7I A;  2L01 A;  4WK8 F;  4Z2Y A;  2L4A A;  5IT9 Z;  4CYC B;  2MC3 A;  2EZL A;  2MH9 A;  3ZGK A;  1UZC A;  1TW3 A;  1TT0 A;  2JQ7 A;  2I8D A;  4I0B A;  3OIP A;  5KVR A;  2WAF A;  3HIF A;  2A5Y B;  4M6V A;  3M1E A;  2X48 A;  4A3E J;  4KMU X;  4RB1 A;  4AC0 A;  3L7W A;  1B9N A;  3BP8 A;  3RJP A;  2E2H J;  4JOM A;  5IP7 J;  2BY1 A;  5K1Y A;  3IC7 A;  2GIZ A;  4XN3 A;  4XSZ F;  2ZXW H;  1VQP I;  2LTP A;  5H20 A;  3T5X A;  2X1E A;  3H1C A;  1SFK A;  1S9H A;  1T6S A;  3F9K A;  3JRB A;  1V55 H;  4ZDL A;  1GT0 C;  3DLL F;  2KDO A;  3GCM A;  5B3S H;  2VJ5 A;  5LLQ A;  5EG0 B;  4UB8 C;  1YJN I;  4X1E A;  1I1G A;  4N9H A;  1TT5 B;  5AON A;  2KLO A;  1LQ1 A;  2JWT A;  3TO6 A;  3QOE A;  4D5C A;  2E1C A;  3TO7 A;  3OY9 A;  2LF8 A;  1XMA A;  2JSP A;  4QIW N;  3L2Q A;  1VQK I;  3D5R C;  1WZ2 A;  2X6W A;  4U87 A;  2M7A A;  2NS0 A;  2XAQ A;  3PIO F;  1MZB A;  2DQR A;  4E7H A;  3P7N A;  1POG A;  1ZGA A;  1RZ4 A;  4CZC A;  1R1V A;  2CG4 A;  2EFP A;  3A01 A;  2UXX A;  4G6T B;  3MZH A;  5CVV A;  3S14 J;  5E20 A;  3O8G A;  2EIN H;  3UNG C;  4RA2 A;  3M3Y J;  1PUF B;  4PFO A;  1QHG A;  3K2Z A;  4UVC A;  4N4N B;  3NQO A;  2PMH A;  4I6Z A;  1NG7 A;  2IGO A;  3KP6 A;  5HVQ C;  1MND A;  1MMD A;  2KRF A;  4EQQ A;  4BKX A;  2ZME C;  2VXD A;  5J1R A;  1WJF A;  3P9C A;  1BC7 C;  3CUQ A;  3EET A;  1SD4 A;  1G2H A;  3M8J A;  2BY2 A;  2ELH A;  2JZY A;  2LYC A;  2Q8K A;  3TQN A;  2J5O A;  1ZRF A;  4Z6Y A;  2Y9Z A;  3G1L A;  2IS1 A;  3FHZ A;  1UG2 A;  2BHY A;  2O6G E;  2XSD C;  2NNN A;  4UUV A;  3ELK A;  2FXA A;  3MFK A;  2EV0 A;  3FBI B;  3OOP A;  2NS7 A;  4HPQ A;  1KON A;  1FSH A;  4XK4 A;  3L00 A;  1VQ7 I;  1X1P A;  2BW3 A;  2M5W A;  4EAT A;  1USS A;  2KMU A;  3NEU A;  2FMY A;  4WCG A;  4AU7 A;  4JX5 A;  1LE8 A;  2XGC A;  3FF5 A;  2A6E F;  2QQB A;  1BOA A;  1VQL I;  1L0O C;  4W97 A;  2X4H A;  2CFX A;  1ZHF A;  1TQI A;  3M7G A;  2FX0 A;  3M4O J;  1T56 A;  3K1M A;  1MGT A;  1W7P D;  4XRS G;  4YRV A;  1U3E M;  1SAN A;  4F7Z A;  5K5Q A;  2BBY A;  3ZMZ A;  1BR1 A;  2WY7 Q;  2DN0 A;  5M3F J;  2DPU A;  4BYY A;  3WGG A;  3JW4 A;  4B4C A;  4HAM A;  3DPL C;  4MTE A;  2ZSI B;  4EMS A;  1YLF A;  5ICF A;  3F8F A;  4HQM A;  1G6N A;  4NC6 A;  2B0L A;  2F5C A;  2GAU A;  3IAS 2;  5EEA A;  3TP0 A;  2RNG A;  2CU7 A;  2YR2 A;  2EIM H;  4MFD A;  3TDU C;  3D5L A;  1GXP A;  1OPC A;  3RSN A;  4YFN F;  2WC2 A;  4FT8 A;  3JSP A;  3NAU A;  1MNE A;  2DTZ A;  2MSY A;  3K4N A;  2P4W A;  4P96 A;  3S3O A;  4KT6 A;  3CCR I;  3BG9 A;  4ENJ A;  2VQC A;  2VBZ A;  2K9M A;  4CIC A;  1G3S A;  1OJL A;  4PJM A;  4M9S A;  4JYK A;  1S5L C;  1E3P A;  5HS9 A;  3CCM I;  1TZL A;  4FET A;  4J01 A;  1YIO A;  2KKO A;  4EJW A;  1BN5 A;  3HRU A;  3KZZ A;  3V7C A;  5AIP A;  4PGG A;  1VQ4 I;  2QLZ A;  4CO8 A;  3HL2 A;  1LB2 A;  5J1Y A;  5JI6 A;  3R61 A;  2VUM J;  1N25 A;  2F5E A;  2R0Q C;  1IG7 A;  3CLO A;  2FBH A;  3P9I A;  4IHY A;  2ZC2 A;  3RQI A;  3MKL A;  3BPX A;  1TL8 A;  1OCC H;  1D0X A;  2STT A;  4HYE A;  3GWZ A;  5B5E C;  1TW2 A;  4DZP A;  2IS4 A;  3ZMU A;  3S1N J;  3OYF A;  3GTL J;  2JJ7 A;  4Q48 A;  4UB6 C;  2STW A;  1WJD A;  2ID3 A;  2DA5 A;  1BJA A;  2DT5 A;  4PJL A;  1BI0 A;  1FOK A;  3LL7 A;  4E7K A;  3DXJ F;  1ETV A;  2PX9 A;  5CVI A;  1XCB A;  4B43 A;  3GTO J;  4M73 A;  3MCZ A;  1F4K A;  4HF1 A;  3K1P A;  3ASN H;  2K4J A;  1LFP A;  1YI2 I;  1BIB A;  1IN8 A;  4GYI A;  1B72 A;  4ZDO A;  4C9Y A;  1MH3 A;  1J2X A;  1X2M A;  2E5Z A;  2VLA A;  2R5Y A;  2KIF A;  5EJC A;  3SJM A;  4RGU A;  4E7Z A;  2R5Z B;  2E2I J;  1BBY A;  5E3O A;  2DA4 A;  4E7L A;  2GOX B;  4XSX F;  1MJA A;  3D5S C;  2F48 A;  2ADU A;  3K4B A;  1WPK A;  2DK5 A;  3ONQ A;  3IWZ A;  3QRF F;  3H9G A;  1WVR A;  3PL8 A;  2O9L A;  5HLT A;  3MMY B;  3H0G J;  4BQQ A;  1U2W A;  2L3D A;  3DPT A;  4PJ0 C;  1I1S A;  1P4X A;  3IRR A;  4ITV A;  5FB2 A;  1O3T A;  1Q1H A;  3VDX A;  1NG6 A;  1UB9 A;  1MBJ A;  2F5F A;  5J4V A;  1ZEL A;  4HDU A;  2MC4 A;  2X6X A;  2A6T A;  1D0Z A;  2YS9 A;  3G1M A;  3OWT A;  4LG0 A;  3SZP A;  1WWX A;  4B8X A;  2LY9 A;  2BXY A;  1RPW A;  1D0Y A;  3HHG A;  2VJI A;  4DYQ A;  2DA6 A;  2GXG A;  2RAE A;  1OCO H;  2YX7 A;  2O3F A;  1XC5 A;  3G71 I;  2MGQ A;  5EGO B;  3AG4 H;  2EIJ H;  1A6Q A;  1FT9 A;  2AHQ A;  1U5T B;  3Q0U A;  4YFK F;  3DBR B;  4H4K C;  1JKO C;  3REO A;  2HZD A;  2XHK A;  1HDP A;  4F3Q A;  4BL0 B;  2CQX A;  4K2E A;  3DFG A;  2DJI A;  4ENN A;  2HU9 A;  3C1D A;  3WU2 C;  1I3A A;  1P4A A;  3I9V 2;  2DFE A;  2DMT A;  3RTR A;  1X1D A;  4OIR F;  5LGU A;  4LIV A;  1XGS A;  4A0Y A;  3JRF A;  5AIQ A;  1XMK A;  5F0H A;  1IRX A;  4ZYE A;  2CMP A;  1MMG A;  1OLT A;  2LR8 A;  3H36 A;  2CYY A;  2P8T A;  2EJR A;  2ZCW A;  4XLC A;  4KMF A;  2Q1Z B;  3ABM H;  1VQ8 I;  2ZNY A;  1E3O C;  2E60 A;  3CC2 I;  3GTG J;  4BJ5 C;  4HDV A;  4U0Y A;  1V3F A;  3MVP A;  3K69 A;  1H9T A;  4O6J A;  4LIT A;  5TJJ A;  4XON A;  5DYM A;  2ZME A;  1FBU A;  2LRD A;  3TDZ C;  2GLO A;  3A02 A;  2R93 J;  4P1W A;  4XMY A;  5LBQ A;  2OZ6 A;  1YW7 A;  1UHS A;  4V2F A;  3G3Z A;  1LFU P;  3JCU C;  2ID6 A;  3AL0 B;  4Q4Z F;  2UV1 A;  2XGX A;  3A4C A;  2F6C A;  1YOV B;  4AVZ A;  1Z9C A;  1ZG3 A;  3S3M A;  5E1Z B;  2W00 A;  3RPQ A;  2DMU A;  1R00 A;  2ELK A;  2EV6 A;  1PVE A;  2CJJ A;  2FOK A;  4R1H A;  5HS8 A;  1C0W A;  4IRH A;  3OOU A;  1ORK A;  2VB6 A;  2R7Q A;  3CCY A;  3WG7 H;  2NNY A;  3D1N I;  5C4J J;  5F08 A;  2VPR A;  4DGW B;  1HXD A;  2COM A;  3FK6 A;  3LA3 A;  4L18 B;  1N75 A;  1DQU A;  1HW5 A;  4AID A;  3QPH A;  4MQ9 F;  3J80 Z;  2NVQ J;  1L3L A;  1IV6 A;  4HV6 A;  3G6E I;  2HGC A;  2E19 A;  2D2W A;  2HQR A;  1GVJ A;  2HYF A;  5TRD A;  4HX7 A;  3GYH X;  3R6S A;  1G3W A;  3SYT A;  3LST A;  4ZDP A;  2HR3 A;  2AQE A;  3MQ0 A;  2XGE A;  3FZV A;  4IHW A;  1W7P B;  1JUP A;  2Y2Z A;  1YIJ I;  3HBL A;  1A35 A;  5F04 A;  5M5Y J;  1ZN2 A;  3PM1 A;  2DO7 A;  4B09 A;  2CGP A;  2K3P A;  4U0V A;  2VQL A;  2IEK A;  5C3E J;  3RI4 A;  5J6X A;  3F3X A;  4UVA A;  4A3F J;  1X3U A;  1O3Q A;  3FXJ A;  4NUB A;  4NC7 A;  2F2E A;  3WE2 A;  3W2V A;  2OAZ A;  3S32 A;  3BLY A;  5BNG A;  4HNU A;  2JA6 J;  3H5R A;  4CCM A;  2G9W A;  2YU3 A;  2M3A A;  3HOS A;  1RES A;  3DWL E;  3T0Y A;  4OIO F;  4FQG A;  2PQ8 A;  4P5O A;  5KNL A;  4L9J A;  2Z5U A;  4AIJ A;  3HSF A;  3Q9S A;  3LFK A;  2M0C A;  3Q0W A;  4HOB A;  3GTP J;  2KIU A;  2V1N A;  2LH9 A;  4KN4 X;  4G8X A;  3RKW A;  2P5K A;  3ZCO A;  1N77 A;  3ZQH A;  5ICC A;  2JMW A;  3NAR A;  4NQW A;  2NXN B;  2P6S A;  4HG2 A;  2AXL A;  2DCE A;  2VON A;  4ABZ A;  1YIT I;  1YO5 C;  2YPR A;  1MH4 A;  1AU7 A;  2CUZ A;  1ZTR A;  5D6F A;  1X3Z B;  1I3Q J;  1QRY A;  2O5R A;  1X4O A;  3DKX A;  2L9S A;  2VBY A;  3B73 A;  2E36 A;  4L5E A;  3CLQ A;  5DCM A;  2DJN A;  4WF2 A;  2R7X A;  2KIS A;  2FEZ A;  2NYX A;  2XF7 A;  4MIM A;  3HOX J;  2RV8 A;  3HPG A;  3P9K A;  3MZY A;  3CD6 I;  3GLX A;  1MBF A;  2E7X A;  2YSR A;  4FCY A;  2HXO A;  2EB7 A;  2VE9 A;  4E7S A;  1EKE A;  2BGC A;  2A05 A;  2HNH A;  3WGI A;  4FX4 A;  3I4P A;  1SVO A;  3C18 A;  2M9H A;  3E5U A;  4XLN F;  3WU0 A;  1GXQ A;  4MGR A;  4LK0 F;  2ESN A;  3HRM A;  2C6Y A;  1JKQ C;  3G4S I;  4I0A A;  1UG0 A;  2EFO A;  2Y69 H;  4KIT B;  2KRH A;  5FD6 A;  5E18 F;  2DFH A;  1FIA A;  2HZT A;  3KLN A;  2WTE A;  2Q2E B;  1TWF J;  4BEH A;  4PSX A;  4RDU A;  2PMU A;  4ZJZ A;  1TWC J;  2VBX A;  5CVU A;  1Y6I A;  2W48 A;  4BJT A;  2XPW A;  4Q5S F;  1KZH A;  1F36 A;  3CMM A;  1LDD A;  2H1K A;  3QPL A;  3ZMD A;  4Y7N J;  4A3D J;  1SEU A;  2L9V A;  2QUF A;  3S1R J;  2VT3 A;  3IKT A;  3ZQF A;  4D5F A;  3ABK H;  2LBF A;  4WXD A;  4YEL A;  3CDL A;  4KIG A;  4EJO A;  4HA8 A;  2ZB9 A;  4AYB A;  4Y4R A;  2R92 J;  1VND A;  4LJZ F;  3S93 A;  2BY0 A;  2PN6 A;  4XLP F;  3ABL H;  2E1N A;  1W36 C;  1SC7 A;  4KN7 X;  1O4X A;  2E1M C;  1U8B A;  3PFY A;  3D0S A;  2VJ4 A;  3FKJ A;  3KEY A;  3OR2 C;  2DYS H;  4XLH A;  3FHN A;  4HF2 A;  3OYK A;  3KE2 A;  1R5H A;  3F8M A;  2HXI A;  3KEQ A;  3WG9 A;  4UY8 I;  1OR7 C;  1XX5 A;  3K4J A;  5EDN A;  5LHG A;  2XC7 A;  1FP2 A;  2DW4 A;  3S17 J;  2E5N A;  1CGP A;  2LKS A;  2XPU A;  1AKH B;  4LB5 A;  2G7H A;  3BTL A;  2EIK H;  1NTC A;  4ZZL A;  1UAA A;  2JN6 A;  5L3D A;  4BAC A;  2HWV A;  2EH3 A;  1GV5 A;  1WCM J;  3IUO A;  1TC3 C;  3LSI A;  4NBQ A;  2KPM A;  4GO1 A;  2WBM A;  3I59 A;  5E3M A;  3HOV J;  4LMY A;  1U8R A;  1JGG A;  2K4B A;  1XGO A;  2KP6 A;  1P2F A;  2QKL B;  1XS9 A;  2M0M A;  4FE4 A;  1JXS A;  1MMN A;  3FWE A;  3EYI A;  3IP4 B;  3R0J A;  3L9F A;  3R4K A;  3RQ4 A;  5D4R A;  1VQM I;  2V9K A;  3LSG A;  1XTA A;  3DF8 A;  1T2K A;  4G12 A;  2XGD A;  3OMY A;  1LUJ B;  4MFE A;  2CUF A;  3V4G A;  2BHZ A;  2VKH A;  2XF6 A;  3LSJ A;  4HLX A;  1S6L A;  1WGX A;  2WY8 Q;  4I98 B;  3A2K A;  4XKC A;  1W36 D;  3VYR B;  5IY5 H;  1XSV A;  2K02 A;  2ZNZ A;  1TQP A;  1DUX C;  5FLX K;  1FJL A;  4XLF A;  2FNA A;  2H6B A;  1E17 A;  2IVM A;  1XCV A;  2R7O A;  3J7A Y;  1S7E A;  3DU6 A;  3CJQ B;  3HUG A;  4BE1 A;  3ZXS A;  3BTC A;  3ESW B;  3H35 A;  2VBW A;  1SVL A;  2F4M B;  1W5T A;  2CSO A;  5CVJ A;  3LOC A;  4UUS A;  3CME I;  3BG7 A;  2KFD A;  1H88 C;  3TP3 A;  2PI0 A;  4U88 A;  1U0J A;  1QBJ A;  1SFE A;  1JJ8 C;  4BAY A;  2I5U A;  2B7E A;  4XKV A;  5IT9 K;  2P7V B;  2MD5 A;  2CS3 A;  2XKO A;  1J59 A;  2VXZ A;  1VI0 A;  1TP4 A;  1S8N A;  1KA8 A;  1OYY A;  4FHT A;  1TWG J;  1D5Y A;  1IDZ A;  2DMP A;  2H1L A;  3RPU A;  3LFU A;  4UV8 A;  3SZT A;  1FNN A;  3E97 A;  2Z1D A;  1XSD A;  2A5W A;  1X19 A;  2VT2 A;  1T98 A;  3X2Q H;  2ZXI A;  4DJA A;  1DP3 A;  4M72 A;  2MAB A; 
#chains in the Genus database with same CATH homology
 2IJL A;  2QBY B;  2IP2 A;  4A0X A;  5A2Q Z;  5LRS A;  3ZMS A;  1ZLK A;  1XD7 A;  5BPD A;  2W57 A;  2QM3 A;  1B59 A;  2EK5 A;  3RYR A;  3CUO A;  1LDK B;  1O7F A;  5J8C A;  4BXU A;  3GX4 X;  1RUN A;  3BRO A;  1TNT A;  1LEA A;  2EFN A;  3QP6 A;  4CHU A;  1YYV A;  4AD9 A;  2WV0 A;  3E6B A;  3F22 A;  2PFB A;  1Z7U A;  2MLK A;  3M8E A;  1OYI A;  3ABU A;  1I6X A;  3H3Z A;  4PGH A;  3FMS A;  4RS8 A;  4KDP A;  3M8F A;  2XRO A;  4N9I A;  4IF4 A;  4MEX F;  2XAF A;  3BWG A;  2QYO A;  4KA4 A;  3T8T A;  5J8F A;  3WE3 A;  2LSO A;  4Q47 A;  4KIC A;  1LEB A;  1IN5 A;  5BOX A;  2M8E A;  1Z05 A;  1AOY A;  1IN4 A;  3KCC A;  1D8K A;  3JAM K;  1ZYR F;  2G7U A;  1YS7 A;  3HTU A;  3ZMV A;  5IT3 A;  3TO9 A;  4M6X A;  4UV9 A;  1Z6R A;  3GUD A;  3ZN1 A;  3HRS A;  1H0M A;  1ZG5 A;  3E5X A;  2W84 A;  4OOI A;  1OR7 A;  4BHC A;  1FBQ A;  1T39 A;  2Y0M A;  3QAH A;  3ZQ7 A;  1DPU A;  3CUQ B;  1FX7 A;  3LAJ A;  2IA2 A;  1FP1 D;  5K5O A;  2FML A;  1EH7 A;  2LKP A;  2HQN A;  2XAJ A;  1HKQ A;  1KU7 A;  3V8J A;  1B9M A;  4CDG A;  4JBA A;  2HFH A;  3TOA A;  3KEO A;  3ML6 A;  3I0T A;  3C3W A;  3JTG A;  3GFI A;  4P55 A;  2OA4 A;  3I53 A;  4BNC A;  1IAW A;  2FE3 A;  3HSE A;  2NRA C;  1REP C;  4M6Y A;  4OU0 A;  1MDM A;  1IF1 A;  2LNB A;  5ED4 A;  3N97 A;  1SD7 A;  3I58 A;  2LF7 A;  1QQI A;  4G9Y A;  1CF7 A;  2O61 A;  1UHW A;  4U7D A;  3K1N A;  5LHI A;  1F1Z A;  2GWR A;  4ZYG A;  1J7K A;  3C7J A;  2EFW A;  4HBL A;  1F9N A;  1YQA A;  2V9V A;  4A5M A;  5D5U B;  2OBP A;  3VOD A;  3F8C A;  2P5V A;  1SFX A;  3ECO A;  4CGZ A;  3FMR A;  4HF0 A;  1S7A A;  1W4M A;  4RGX A;  1Z91 A;  5F6F A;  5E17 F;  4GXO A;  2YX4 A;  3RDI A;  2QZ8 A;  2RNJ A;  2AS5 F;  1FY7 A;  4E70 A;  1IXR C;  1MKM A;  1HKS A;  2BEO A;  1YS6 A;  4I02 A;  4L5I A;  1G3Y A;  2CWE A;  4ESF A;  2FBI A;  3LQQ A;  2OQG A;  4LGW A;  2BE5 F;  3J7A O;  1FYK A;  2W25 A;  2L02 A;  1JHH A;  3DEU A;  1ZLJ A;  2JPC A;  3KFW X;  1LJ9 A;  2FA5 A;  2FRH A;  3GZ6 A;  2CQK A;  1PP7 U;  4IRI A;  4EGZ A;  1IZ1 A;  5L3B A;  1IRG A;  4EJU A;  2M30 A;  3W6K B;  4U7B A;  2PJP A;  3HHH A;  4LLL A;  2DBB A;  2TDX A;  4G7H F;  4DNC A;  4WXH A;  3QU3 A;  2K86 A;  4L9N A;  1LNW A;  1QZZ A;  2RQP A;  3FMQ A;  1LVA A;  4MNU A;  5F1R A;  2GXB A;  4EVI A;  3F72 A;  5ICE A;  3JSO A;  4LG0 B;  1ULY A;  3EQL F;  4RAY A;  3BZ6 A;  2VOO A;  2O8X A;  1R22 A;  2OZU A;  3J80 K;  4G6Q A;  5DCF A;  4KYW A;  4BQA A;  4TV7 A;  2HKO A;  2V1D A;  1K79 A;  2ZBK A;  3LA2 A;  1WSU A;  1IXS B;  3WTV C;  1OYW A;  4IJA A;  4OIN F;  2HDC A;  1H9G A;  1UST A;  2FNP A;  2ZJ2 A;  1B4A A;  2MLG A;  4BHB A;  3Q5F A;  3CTA A;  3CO7 C;  2A61 A;  4GGG A;  2OQR A;  2ZME B;  2RKH A;  4JK1 X;  4RGR A;  4R79 A;  1D8J A;  4HV5 A;  1K78 A;  4YIF A;  2VE8 A;  3GZ5 A;  1ZRC A;  1KQ8 A;  5CLS A;  2XVC A;  1OKR A;  2XV4 S;  1Z1D A;  1PUE E;  4YG2 F;  4O3M A;  4AVP A;  5JHU A;  5D8K B;  2IA0 A;  5CJ9 A;  4EM0 B;  3I5U A;  3VOE A;  1BC8 C;  2A07 F;  2VC0 A;  1GHC A;  1FC3 A;  1J0R A;  2ISZ A;  1ZGJ A;  3WGH A;  3QOP A;  3F23 A;  1I27 A;  2FQ3 A;  1DP7 P;  3BPV A;  4WWC A;  2ESH A;  1JGS A;  2KJB A;  4IXA A;  1UCR A;  5BS6 A;  2ZO4 A;  2FSW A;  1IUY A;  2D1V A;  5E1W A;  4FX0 A;  1R1T A;  2VC1 A;  3IHU A;  4LD5 A;  2R3S A;  4MTD A;  4G94 A;  2GA2 A;  3OV8 A;  1MJ9 A;  1YW9 A;  4NB5 A;  3EYY A;  1WQ2 A;  3PQJ A;  1KU9 A;  5FO5 A;  3LAP A;  3GO5 A;  1RI7 A;  3V8L A;  2A69 F;  2IA1 A;  1ZRE A;  3COA C;  2CO5 A;  5LHH A;  2EWN A;  3PFI A;  1HKT A;  1NHA A;  2Z3Y A;  3U1D A;  1TNS A;  4M9Z A;  2MBF A;  1O57 A;  5D5X B;  2FBK A;  4WXC A;  3K9T A;  2XIG A;  2Q0O A;  2GQQ A;  5L3G A;  5LEJ A;  3EDP A;  3F8N A;  2Y48 A;  3HSR A;  1B1B A;  1PP8 F;  3BJA A;  2V1X A;  4EM2 A;  3WTW C;  3TKY A;  4UNO A;  1K7A A;  3BOQ A;  3HTS B;  1O3S A;  3W6J B;  2F5D A;  5LEK A;  5DCM B;  3K0L A;  1FWZ A;  5ILU A;  1QPM A;  2RDP A;  1XDU A;  4OMZ A;  2ZXJ A;  3QP5 A;  3KP5 A;  5HDN A;  3PQK A;  5ERI A;  1HBX G;  1P4W A;  1VTN C;  1ONV A;  1R5G A;  4HX4 A;  2EA4 A;  3F6O A;  3QPT A;  4P9U A;  2DK8 A;  3BDD A;  1FYM A;  3E6D A;  2PG4 A;  3KP2 A;  3IRQ A;  4LB6 B;  2Y75 A;  1QZY A;  4HLY A;  3WTX C;  1EH8 A;  3J81 K;  3R0A A;  2DAO A;  2JSC A;  1KYZ A;  4HZF A;  4AWX B;  1W5S A;  4RB2 C;  1SMT A;  1XSX A;  1SD5 A;  2EV5 A;  2ISY A;  5LRR A;  4MQV A;  5FLX Z;  2DU9 A;  3KP3 A;  2R7D A;  3SFZ A;  2JPB A;  4CYD A;  3O6B B;  1J9I A;  5FFZ A;  3SQN A;  2CW0 F;  3I59 B;  2WWY A;  4ZYH A;  1R23 A;  1R36 A;  4LLN A;  3BY6 A;  4KIB A;  4IHS A;  4BHP A;  3HOT A;  2IPQ X;  2QEN A;  4LLG F;  1S7O A;  3DV8 A;  4A5N A;  3CJN A;  5E8G A;  1SMY F;  3ZMT A;  2RN7 A;  3U9G A;  2O03 A;  6PAX A;  2DLL A;  2L54 A;  1DPR A;  4QLC U;  2HTJ A;  4RAZ A;  3KP4 A;  4WX9 A;  2QQA A;  4EM1 A;  3FX3 A;  4ESJ A;  4U0W A;  2UWM A;  4IPA A;  1JE8 A;  2D1H A;  4LK1 F;  4I09 A;  3GW2 A;  4IRG A;  4IVN A;  2X0L A;  1ZG1 A;  1HW1 A;  1UFM A;  2ETH A;  2Z9O A;  3MEX A;  3ZPL A;  2KIM A;  4L9T A;  2XUB A;  4S04 A;  3TGN A;  2QWW A;  2HTS A;  4G7O F;  3U2R A;  1WKM A;  4A0Z A;  2OU2 A;  1P92 A;  3GF2 A;  2H94 A;  1PDN C;  3KP7 A;  3WTZ A;  3AAF A;  1DDN A;  1ZH5 A;  1YFH A;  5JR3 A;  4L9V A;  2GZW A;  1XB4 A;  3ABT A;  3GVA A;  5DV5 A;  5JFR A;  3ZN0 A;  1O7L A;  1QNT A;  4ASN A;  3ERE D;  3JAM Z;  2H09 A;  5HLI A;  3I71 A;  1SD6 A;  5DD8 A;  4JQF A;  3LA7 A;  2E7W A;  1KQ9 A;  1BI1 A;  3Q9V A;  1BIA A;  1BM9 A;  3FXU A;  4O5V A;  1J5Y A;  1S29 A;  1FPQ A;  3ISP A;  5ILV A;  5HDG A;  4EJV A;  1WI9 A;  3IL2 A;  2R7F A;  4A6D A;  4DQ2 A;  1WRJ A;  2NAZ A;  1IXC A;  1MJB A;  3V7S A;  5L3E A;  5HLH A;  1YTY A;  1U78 A;  3M9A A;  2XAH A;  4KNY A;  5LGN A;  4YII A;  2VN2 A;  4ESB A;  3O3K A;  3VFZ A;  2HYG D;  3ZP5 A;  3WTY C;  3WU1 B;  4ENK A;  2DI3 A;  4I01 A;  4CZZ A;  1FSE A;  1QO0 D;  4P9F A;  4AIK A;  3B02 A;  4Y17 A;  3G73 A;  1R7J A;  4KT5 C;  5FD5 A;  2DPD A;  2QQ9 A;  1E2X A;  4GCV A;  1K6O A;  5E1X A;  3F21 A;  5HS7 A;  3LQR A;  2FF4 A;  5HDK A;  3MAJ A;  2EFQ A;  1U5T A;  4UXN A;  2M45 A;  3ROU A;  2XRN A;  1FLI A;  1MD0 A;  1EV7 A;  1ON2 A;  5JVT A;  2J5P A;  4S05 A;  5LGT A;  4H0E A;  2PLY A;  4QWQ A;  2DFI A;  3ECH A;  1JHF A;  2VOD A;  3O2P E;  5L3F A;  3R60 A;  4A2U A;  1IRF A;  3FM5 A;  1XGN A;  3VEP A;  1MDM B;  3WTS C;  4YFX F;  3F8B A;  4OMY A;  3H92 A;  1CF7 B;  3ULQ B;  2RC4 A;  4ETS A;  1Y0U A;  5H6Q A;  5EEG A;  5E8I A;  2KJC A;  1HQC A;  2PBI A;  3KZY A;  4I7H A;  1KYW A;  1RUO A;  3E3V A;  3CO6 C;  4EJT A;  4OIQ F;  3HRT A;  3GFL A;  5ILS A;  1IN7 A;  3RYP A;  4I2O A;  1FZP B;  2M1B A;  2D45 A;  4ZH4 F;  2RVC A;  3GXO A;  3SXY A;  2HOE A;  1W7P A;  3GYH X;  2IRF G;  4EV0 A;  1YG2 A;  2GIV A;  4L0Y B;  2VOP A;  4HX8 A;  2W85 A;  4PCQ A;  2OD5 A;  5DEQ A;  3I64 A;  1XN7 A;  2H27 A;  5FFX A;  1KQ0 A;  3MWM A;  5K5R A;  5BMZ A;  1SFU A;  4L5J A;  2XAG A;  4ZZD A;  2DTR A;  2Z99 A;  3E6M A;  2M87 A;  1HSJ A;  5D4S A;  4RGS A;  1XDS A;  2V1U A;  3GFJ A;  2JTV A;  4UVB A;  5KK1 A;  2MH2 A;  5D5W B;  5CVR A;  4KFC A;  2HEO A;  3GFM A;  3NRV A;  1R58 A;  2EA2 A;  3IKV A;  5H6R A;  3RKX A;  2UXN A;  1RIO H;  1HW2 A;  5BQT A;  3I54 A;  3LWF A;  2L4M A;  2P6T A;  3V7R A;  1BI3 A;  1HST A;  4XRF A;  3DQV C;  5CYV A;  4M71 A;  4ENM A;  2JRT A;  1STZ A;  5DUK A;  5DD4 A;  2P7C B;  1I5Z A;  2A3S A;  3QU6 A;  1F5T A;  4OIP F;  4GYG A;  3L09 A;  3L2C A;  3HYI A;  4KIF A;  2FU4 A;  3IWF A;  3FXQ A;  4BH9 A;  3SHF A;  2Q2E A;  1ZRD A;  1P6R A;  4LFU A;  4G6D A;  2P5L C;  3N4M A;  1XGM A;  4N0B A;  1EH6 A;  5L3C A;  4CXF A;  1K78 B;  1T38 A;  3KLO A;  1YW8 A;  5HOO A;  4KUM A;  3H3U A;  4UHT A;  5DUI A;  3E6C C;  2K7L A;  3E5Q A;  1J75 A;  3CDH A;  1S3J A;  1D3Y A;  4RB3 C;  1SAX A;  2LDU A;  4RB0 A;  4IHT A;  2V79 A;  5EEH A;  4MHG A;  2O0Y A;  4NHJ A;  2RGV A;  4ZYD A;  3BJO A;  5D5V B;  5D8L B;  4A12 A;  1KU3 A;  5DDG A;  1G3T A;  3CUQ C;  2XAS A;  3TOB A;  1IN6 A;  2XKP A;  2ZKZ A;  2H6C A;  1IW7 F;  2PEX A;  3EUH A;  4PDK A;  5D6E A;  3V8K A;  3VB2 A;  1LDJ A;  2BYV E;  1ODD A;  4MEY F;  4HQE A;  3DKW A;  3WTT C;  4D0P A;  1ON1 A;  4L0Z B;  1KU2 A;  1RNL A;  4PZJ A;  3FXR A;  4XBF A;  2IT0 A;  2HS5 A;  1V4R A;  4HW0 A;  1OMI A;  2W24 A;  2Z33 A;  5BPI A;  4Y15 A;  4M74 A;  2MA3 A;  2QVO A;  4A6E A;  1FYL A;  1B6A A;  4AIH A;  1A04 A;  1ZAO A;  2A68 F;  2ACJ A;  3FM3 A;  1TBX A;  3BJ6 A;  1ZAR A;  3GEZ A;  2GA1 A;  3RIR A;  3DP7 A;  5HLG A;  1AWC A;  1QGP A;  1T0F A;  2JT1 A;  1FBS A;  2K27 A;  2BV6 A;  1U6G A;  1TLH B;  1TTY A;  2QBY A;  1BI2 A;  4ON0 A;  2HKX A;  5FGM A;  2ZFW A;  1Z6T A;  1O3R A;  5ICG A;  3WTU C;  2DQL A;  3F6V A;  3JTH A;  2UZK A;  3RKY A;  1R1U A;  4R8H A;  3T1B A;  1TQM A;  3WOD F;  4G7Z F;  1D5V A;  1UHM A;  3J81 Z;  2V6C A;  2IW5 A;  2A6H F;  4EGY A;  1U5T C;  3KET A;  3S2W A;  1KGS A;  4Y13 A;  3T8R A;  5F64 A;  4M9X A;  5A2Q K;  1G4D A;  2L01 A;  4WK8 F;  4Z2Y A;  2L4A A;  5IT9 Z;  2MC3 A;  2MH9 A;  1TW3 A;  4I0B A;  5KVR A;  3HIF A;  2A5Y B;  3M1E A;  4KMU X;  4RB1 A;  3L7W A;  1B9N A;  3BP8 A;  3RJP A;  5K1Y A;  3IC7 A;  4XSZ F;  5H20 A;  3T5X A;  1T6S A;  5LLQ A;  1I1G A;  4N9H A;  5AON A;  1LQ1 A;  3TO6 A;  2E1C A;  3TO7 A;  2LF8 A;  1XMA A;  2NS0 A;  2XAQ A;  1MZB A;  2DQR A;  3P7N A;  1ZGA A;  1RZ4 A;  1R1V A;  2CG4 A;  2EFP A;  2UXX A;  3MZH A;  5CVV A;  5E20 A;  3K2Z A;  4UVC A;  3NQO A;  2PMH A;  3KP6 A;  5HVQ C;  2KRF A;  4EQQ A;  3P9C A;  1BC7 C;  3CUQ A;  3EET A;  1SD4 A;  2ELH A;  2JZY A;  2Q8K A;  3TQN A;  2J5O A;  1ZRF A;  3FHZ A;  2O6G E;  2NNN A;  4UUV A;  3ELK A;  2FXA A;  3MFK A;  2EV0 A;  3OOP A;  1FSH A;  3L00 A;  2M5W A;  1USS A;  3NEU A;  2FMY A;  4WCG A;  3FF5 A;  2A6E F;  2QQB A;  1BOA A;  1L0O C;  2X4H A;  2CFX A;  1ZHF A;  1TQI A;  3M7G A;  3K1M A;  1MGT A;  1W7P D;  1U3E M;  4F7Z A;  5K5Q A;  2BBY A;  3ZMZ A;  2DPU A;  4BYY A;  3WGG A;  3JW4 A;  4HAM A;  3DPL C;  4MTE A;  4EMS A;  1YLF A;  5ICF A;  3F8F A;  4HQM A;  1G6N A;  2B0L A;  2F5C A;  2GAU A;  2YR2 A;  3TDU C;  3D5L A;  1GXP A;  1OPC A;  4YFN F;  4FT8 A;  3JSP A;  2WC2 A;  2P4W A;  4P96 A;  4ENJ A;  2VBZ A;  4CIC A;  1G3S A;  4M9S A;  5HS9 A;  1YIO A;  2KKO A;  4EJW A;  1BN5 A;  3HRU A;  3KZZ A;  3V7C A;  5AIP A;  4PGG A;  2QLZ A;  4CO8 A;  1LB2 A;  5JI6 A;  3R61 A;  2F5E A;  3CLO A;  2FBH A;  3P9I A;  3BPX A;  2STT A;  4HYE A;  3GWZ A;  1TW2 A;  3ZMU A;  4Q48 A;  2STW A;  1BJA A;  2DT5 A;  1BI0 A;  1FOK A;  3DXJ F;  5CVI A;  1XCB A;  4M73 A;  3MCZ A;  1F4K A;  4HF1 A;  3K1P A;  2K4J A;  1BIB A;  1IN8 A;  4GYI A;  1J2X A;  2KIF A;  4RGU A;  1BBY A;  4XSX F;  1MJA A;  2ADU A;  2DK5 A;  3IWZ A;  3QRF F;  1U2W A;  2L3D A;  3DPT A;  1I1S A;  1P4X A;  3IRR A;  5FB2 A;  1O3T A;  1Q1H A;  1UB9 A;  2F5F A;  4HDU A;  4LG0 A;  3SZP A;  1WWX A;  4B8X A;  3HHG A;  2GXG A;  2YX7 A;  2O3F A;  1FT9 A;  1U5T B;  4YFK F;  3REO A;  2XHK A;  4K2E A;  3DFG A;  4ENN A;  3C1D A;  1P4A A;  3RTR A;  4OIR F;  5LGU A;  4A0Y A;  1XGS A;  5AIQ A;  1XMK A;  4ZYE A;  2CYY A;  2P8T A;  2EJR A;  2ZCW A;  4KMF A;  2ZNY A;  4HDV A;  4U0Y A;  1V3F A;  3K69 A;  1H9T A;  4O6J A;  5TJJ A;  5DYM A;  2ZME A;  1FBU A;  3TDZ C;  5LBQ A;  2OZ6 A;  1YW7 A;  3G3Z A;  4Q4Z F;  2XGX A;  1Z9C A;  1ZG3 A;  5E1Z B;  3RPQ A;  2EV6 A;  1R00 A;  5HS8 A;  1C0W A;  2FOK A;  4R1H A;  4IRH A;  2NNY A;  1HXD A;  2COM A;  3LA3 A;  4L18 B;  1HW5 A;  3QPH A;  4MQ9 F;  3J80 Z;  1L3L A;  4HV6 A;  2HGC A;  2D2W A;  2HQR A;  1GVJ A;  2HYF A;  5TRD A;  4HX7 A;  3R6S A;  1G3W A;  3LST A;  2HR3 A;  3MQ0 A;  3FZV A;  1W7P B;  1ZN2 A;  2DO7 A;  4B09 A;  2CGP A;  4U0V A;  3RI4 A;  5J6X A;  3F3X A;  4UVA A;  1O3Q A;  1X3U A;  2F2E A;  3WE2 A;  2OAZ A;  2G9W A;  2YU3 A;  3HOS A;  3T0Y A;  4OIO F;  2PQ8 A;  4P5O A;  4L9J A;  2Z5U A;  4AIJ A;  3HSF A;  3Q9S A;  3LFK A;  4HOB A;  2KIU A;  4KN4 X;  4G8X A;  3RKW A;  2P5K A;  5ICC A;  4NQW A;  2P6S A;  2AXL A;  2VON A;  1YO5 C;  2YPR A;  5D6F A;  2VBY A;  3B73 A;  5DCM A;  4WF2 A;  2FEZ A;  2NYX A;  2RV8 A;  3P9K A;  3MZY A;  3GLX A;  2E7X A;  2YSR A;  2EB7 A;  2VE9 A;  2BGC A;  3WGI A;  4FX4 A;  3I4P A;  3C18 A;  3E5U A;  4XLN F;  3WU0 A;  1GXQ A;  4MGR A;  4LK0 F;  2ESN A;  3HRM A;  2C6Y A;  4I0A A;  2EFO A;  5FD6 A;  5E18 F;  2HZT A;  3KLN A;  2WTE A;  2PMU A;  2VBX A;  5CVU A;  4Q5S F;  1LDD A;  3ZMD A;  2QUF A;  2VT3 A;  3IKT A;  4WXD A;  4KIG A;  4EJO A;  4HA8 A;  4LJZ F;  2PN6 A;  4XLP F;  2E1N A;  4KN7 X;  3D0S A;  4HF2 A;  3KE2 A;  1R5H A;  3F8M A;  3KEQ A;  3WG9 A;  5LHG A;  1FP2 A;  2DW4 A;  1CGP A;  4LB5 A;  2G7H A;  4ZZL A;  5L3D A;  2HWV A;  4GO1 A;  3I59 A;  4LMY A;  1U8R A;  2K4B A;  1XGO A;  1P2F A;  1JXS A;  3FWE A;  3EYI A;  3R0J A;  3L9F A;  3R4K A;  5D4R A;  3DF8 A;  1T2K A;  3V4G A;  4HLX A;  1S6L A;  4I98 B;  1XSV A;  2K02 A;  2ZNZ A;  1TQP A;  1DUX C;  5FLX K;  2FNA A;  2H6B A;  1E17 A;  2IVM A;  1XCV A;  3HUG A;  2VBW A;  1W5T A;  2CSO A;  5CVJ A;  2PI0 A;  4U88 A;  1QBJ A;  1SFE A;  4BAY A;  5IT9 K;  2P7V B;  2MD5 A;  2XKO A;  1J59 A;  2VXZ A;  1S8N A;  1KA8 A;  1OYY A;  4FHT A;  3RPU A;  4UV8 A;  3SZT A;  1FNN A;  3E97 A;  1XSD A;  2VT2 A;  1T98 A;  4M72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...