3N97A

Rna polymerase alpha c-terminal domain (e. coli) and sigma region 4 (t. aq. mutant) bound to (up,-35 element) dna
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
53
structure length
53
Chain Sequence
SKLSEREAMVLKMRKGLIDGREHTLEEVGAYFGVTRERIRQIENKALRKLRHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA polymerase sigma factor
publication title Combined structural model for a transcription activation assembly
rcsb
source organism Thermus aquaticus
molecule tags Gene regulation/dna
total genus 19
structure length 53
sequence length 53
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3n97A00
2O8XA 4UHTA 5DUKA 2LSOA 1W4MA 1YQAA 1I1GA 6PAXA 2EFOA 3EYYA 4Y17A 2VBXA 2K4BA 3V4GA 3HIFA 2FMLA 4WCGA 2W84A 3HHHA 5LEKA 4FX4A 1ZRDA 2G9WA 3N97A 1TNTA 2H09A 2DLLA 4AIHA 2GA1A 3KZZA 2QQBA 2W57A 1D3YA 1RI7A 3ZMTA 3V8JA 1LDKB 2JRTA 1H0MA 1FP1D 1O7LA 4R1HA 3JSOA 3ECOA 3MFKA 1P6RA 1QBJA 2ZBKA 4UNOA 1X3UA 2QQ9A 1AWCA 1Z1DA 2L4AA 3U2RA 2FA5A 2MH9A 3GFMA 2RNJA 4AWXB 1K7AA 2PJPA 4OINF 2Z33A 2G7HA 2ACJA 4FT8A 2OQRA 3BJOA 5CJ9A 4ZH4F 2UZKA 4Q47A 1FWZA 4RGRA 4HQEA 1IUYA 3LQQA 2VXZA 3WGHA 4WK8F 3KZYA 1FZPB 1V3FA 3KEQA 2PQ8A 2KIMA 1B1BA 2K86A 4BNCA 1J75A 4HA8A 4JK1X 3KP5A 2UXXA 1ZARA 3F22A 3ZMZA 3NQOA 5ERIA 3E97A 2L01A 1G3SA 3WG9A 1J7KA 1IZ1A 2HGCA 5LHHA 3ECHA 2VC0A 4EQQA 4ZYHA 2O6GE 1S3JA 5EEHA 5DCMA 1R5GA 3TGNA 4A6DA 1JE8A 2DK5A 2ZFWA 2FXAA 1KQ0A 3GZ5A 1I6XA 3DV8A 5J6XA 3F8MA 2PMUA 3I58A 3SFZA 2HWVA 1F1ZA 3GXOA 2QUFA 2BV6A 1ULYA 2CW0F 1T39A 2P4WA 4YFXF 3MCZA 2H27A 3Q9VA 3SXYA 2ZKZA 5DUIA 5D6EA 3P7NA 2MH2A 4L5IA 5CVIA 1MD0A 4L9JA 1PP7U 4MGRA 2YU3A 1SMTA 2RKHA 4KFCA 1SD5A 1QPMA 5K5RA 4EJTA 4IHSA 4B8XA 4M9XA 4LG0A 5JI6A 2FRHA 1T6SA 2M45A 3ROUA 1FBUA 3VODA 5K5OA 3ML6A 2ZO4A 2DO7A 2PI0A 2V9VA 1Z6TA 3TO9A 4JBAA 1D8JA 1MJBA 3DPTA 5HDNA 1WQ2A 4EJOA 1UHWA 4KMUX 4KYWA 4RB0A 1ON1A 3ZP5A 3T8RA 1R58A 4MTEA 2ZMEA 3OOPA 3GWZA 1WSUA 2M30A 1XSDA 3E5XA 2PG4A 3QU6A 1CF7B 1GHCA 2YX4A 4G9YA 2GXBA 1KU7A 2HKXA 2RN7A 1FYLA 2O0YA 2A69F 2VOPA 4M72A 3KETA 2EWNA 4ON0A 3F3XA 4PGHA 3W6JB 1XSXA 2PN6A 3FXRA 1R5HA 4LK1F 2AXLA 4LK0F 1YW7A 4KMFA 1TLHB 4EGZA 2DBBA 3H3ZA 1RUOA 4L0ZB 4BHCA 2CSOA 4RAYA 3R0JA 1OYWA 4ENKA 3NRVA 1MKMA 4BXUA 3F21A 4M6XA 2VODA 3TOAA 2F5FA 4XRFA 3WTSC 3T8TA 4A6EA 4XBFA 1R7JA 2XAQA 2HZTA 2CO5A 2DU9A 1O7FA 3QP5A 1XSVA 5CYVA 2IRFG 5F64A 3TOBA 2P7VB 1E17A 4ETSA 2LKPA 2XIGA 4HF2A 4I09A 5HLHA 1G3YA 1FSEA 3I0TA 4DNCA 1GXQA 3CO7C 2MC3A 4U0VA 2QENA 3GO5A 5A2QZ 3COAC 4BQAA 1HXDA 2GQQA 3WTZA 5L3GA 5HVQC 1KU2A 3TDZC 3DXJF 1OR7A 2AS5F 4UVCA 1FYMA 3KP3A 3ZPLA 3GF2A 1T98A 2QYOA 4IRIA 4M6YA 1FP2A 2X4HA 3K2ZA 1MZBA 5FFZA 5EEGA 3BPVA 3T0YA 3EYIA 1TBXA 2EFPA 1ZH5A 4MEXF 2BYVE 1SFXA 3M8EA 3LAJA 2FU4A 3EETA 1XB4A 1MDMA 4LFUA 4JQFA 1HW2A 3DP7A 1YLFA 2GIVA 4KNYA 5E1ZB 3C7JA 3CUQB 3I64A 4WXHA 5A2QK 5ILSA 2ELHA 2FBHA 1IRGA 1IXCA 1U3EM 3BJ6A 4GXOA 5AIQA 3I54A 4OMZA 4G94A 3WU1B 4OOIA 4PDKA 3E6MA 4P5OA 3GYHX 2RGVA 4XLPF 2F5DA 4OMYA 5ICEA 4U0WA 3P9CA 1STZA 3VFZA 1UFMA 3TO6A 1T0FA 2DQRA 1KQ8A 2L3DA 3ZMDA 2DW4A 1U6GA 3C18A 3SZTA 2FE3A 1KU3A 3JTGA 2ZCWA 1ZLKA 5FB2A 3DF8A 5CVJA 1LDDA 5D5XB 3IKVA 5AONA 1O3SA 1P2FA 5LGNA 2VBZA 3E6BA 3REOA 3I53A 2YX7A 4Y13A 4EM1A 4L9VA 5ED4A 1USTA 1LNWA 3IKTA 1CGPA 3MZHA 1OYIA 3CUQC 1EH6A 5FD6A 2F5EA 1FYKA 2CGPA 4ZYEA 3FM5A 1G3WA 2ESNA 3M9AA 2ZJ2A 4MNUA 1DPRA 3MEXA 2A3SA 3K69A 3H3UA 3RKWA 1RZ4A 4Z2YA 3IHUA 1DP7P 2IPQX 2JZYA 3WE3A 2HS5A 3RKYA 3VB2A 4DQ2A 1I1SA 2GZWA 2KJCA 4AIJA 1TW2A 1CF7A 2XAFA 5D5UB 2CFXA 3H92A 4GO1A 3F8CA 2FF4A 1YG2A 5D5VB 4EJWA 2QBYA 2G7UA 4EJUA 3DQVC 1ON2A 5CVVA 3WGIA 2RC4A 5DD4A 1JHHA 2CWEA 1O57A 2V1DA 5HDGA 3WTYC 3RDIA 3HOTA 1F4KA 1G6NA 1B59A 3NEUA 3DFGA 4I01A 2P5LC 1IN7A 4IF4A 1FC3A 2KRFA 2XGXA 2MLKA 3S2WA 3PQKA 2NNYA 4GCVA 2FMYA 2ZXJA 4UVBA 2FNPA 2P6SA 3BOQA 1BIBA 4PZJA 4I2OA 2STWA 4OIQF 1D8KA 1TQPA 2O61A 3E5UA 1J0RA 2NS0A 5L3DA 4BAYA 3RIRA 1BI0A 2GA2A 2VN2A 5LBQA 1P4XA 1Y0UA 1FPQA 3LQRA 4EM0B 1W7PA 3VEPA 2XKPA 1YS6A 1IAWA 2DQLA 1XDSA 1BI3A 5DDGA 1T2KA 3HRSA 3L09A 3G73A 2VC1A 3HYIA 4CGZA 3F23A 3I71A 5BPIA 3V7RA 3D5LA 3F6OA 2JPCA 1ZN2A 2O03A 1HBXG 4L9TA 2F5CA 3WE2A 4U7BA 2OAZA 1ZREA 5BQTA 2Y48A 5E8GA 4LMYA 4M9SA 1HKTA 3RJPA 1S7AA 2DTRA 2HYGD 1MGTA 2Y0MA 4EVIA 4LLLA 4ENJA 1XDUA 4HDUA 4OIOF 4RGSA 4CZZA 3G3ZA 3SHFA 4E70A 1ZLJA 4XLNF 2E1CA 5DEQA 1ZYRF 3HHGA 1O3TA 1U5TA 4EV0A 4NB5A 4EJVA 2M8EA 4I0BA 2OQGA 4UUVA 4IRHA 1P4AA 2XAJA 1KU9A 2PBIA 3MQ0A 3TO7A 5LEJA 2K27A 4S05A 1EV7A 5D8LB 3I4PA 1HSJA 1KQ9A 1BJAA 1TTYA 2P5KA 1IN8A 2HOEA 4BYYA 3GZ6A 1YS7A 2FOKA 3ZN0A 3PFIA 4N9HA 1XGOA 2HQRA 1MJ9A 2DT5A 4H0EA 5DCFA 5ICCA 1UHMA 2WTEA 1R23A 4WF2A 2XV4S 1LB2A 2YSRA 4PCQA 5IT3A 1YYVA 3JSPA 5ILUA 3M7GA 3LA2A 1K78A 4I98B 4MHGA 3V7CA 4OIPF 4CDGA 4BHPA 2Z5UA 4YIFA 1HKQA 1XD7A 2XUBA 3GW2A 1SD4A 3L7WA 4HAMA 2EV5A 3K1MA 3TKYA 4CO8A 4B09A 5DD8A 4L5JA 4IXAA 1IN4A 3LA3A 3K1PA 1KA8A 2GWRA 2R3SA 4FHTA 4HLYA 2EK5A 2UWMA 2HQNA 4NHJA 4BHBA 3CJNA 5D6FA 2W85A 3L9FA 4ZYDA 2VOOA 5L3FA 2KIFA 4ENNA 5HOOA 3I59B 4G6QA 5F6FA 2DAOA 4CICA 2Z99A 2DPDA 3LFKA 1FOKA 2P6TA 4D0PA 3WTTC 2RVCA 2CQKA 4N9IA 3KLNA 1HQCA 2OZUA 4O5VA 1S8NA 4KN4X 4RB3C 3P9IA 2COMA 1Z9CA 3RTRA 2JPBA 4ESBA 3BWGA 1ODDA 2K02A 5L3CA 1S6LA 3WTWC 1S7OA 1A04A 3WU0A 1LQ1A 2TDXA 1K6OA 1R1TA 1GXPA 1HKSA 4M73A 3M1EA 5E17F 4TV7A 2WC2A 1TNSA 3RPQA 1H9GA 1ZAOA 1BC8C 1WKMA 3BY6A 5HLIA 2F2EA 2STTA 3GVAA 5BOXA 1SD7A 2UXNA 2ESHA 4OIRF 2ZNYA 4K2EA 2XHKA 4ESJA 3HSEA 1HW1A 3E5QA 3K9TA 5E8IA 4U7DA 4HZFA 3CTAA 1LVAA 2O3FA 1ZG3A 4I0AA 3BZ6A 2IVMA 1ONVA 2W24A 3RYRA 2DFIA 4ENMA 1LEAA 4UV9A 3GFLA 2E1NA 3B73A 1XCBA 3KP6A 2XRNA 2EV0A 3JAMZ 1B4AA 4AD9A 5AIPA 3FHZA 3M8FA 5HLGA 4LLNA 1W5TA 4RS8A 4WXDA 5FGMA 4GGGA 4M74A 4Y15A 1YW8A 3ABTA 1IW7F 2XAHA 5FFXA 4WWCA 2XKOA 3IWFA 1J59A 1LEBA 3SQNA 1WWXA 2C6YA 1WI9A 2IT0A 1BM9A 3FXQA 1FBQA 2Y75A 5BPDA 3F8BA 5E1WA 1YTYA 1SFUA 4HX7A 2IA0A 2KKOA 2GXGA 2HFHA 3IWZA 2JSCA 2VE8A 3LSTA 2FSWA 5DCMB 1XN7A 4FX0A 1BOAA 5LLQA 3JAMK 4LB6B 1XMAA 5E18F 1IXRC 5LHGA 1H9TA 4HDVA 2OBPA 2HEOA 1L0OC 3O6BB 1FNNA 5JFRA 1W7PD 1QQIA 4KA4A 4OU0A 3AAFA 4R8HA 2XASA 5TRDA 2KJBA 3KE2A 2RDPA 2PFBA 3I5UA 4HF0A 3ZN1A 2HDCA 1P92A 1TQMA 3ZMVA 4AVPA 3BJAA 3D0SA 1B9MA 1BI1A 2EA2A 3FXUA 3GUDA 1ZG5A 2MD5A 1TW3A 5ICGA 3HSRA 1U8RA 5L3EA 3ELKA 4U0YA 1VTNC 1F5TA 5ICFA 4HYEA 3O3KA 2A07F 4PGGA 3B02A 2BE5F 4HOBA 3QPHA 2MLGA 4LG0B 2J5OA 3DPLC 1PDNC 2LF8A 1XGNA 4G8XA 4A0ZA 1OYYA 5LGUA 3HSFA 2MBFA 3ZMSA 2OA4A 1OPCA 4HV6A 2A6HF 4UXNA 1TQIA 2YPRA 2P7CB 4L0YB 5DYMA 1JGSA 3HRMA 4BH9A 3J7AO 3PQJA 5KK1A 2Q2EA 3HOSA 1T38A 2QLZA 2ZMEB 3C3WA 1O3RA 3JTHA 3MWMA 1OMIA 4I7HA 4CXFA 4Q48A 2ISZA 5DV5A 3RI4A 2OD5A 1O3QA 4IHTA 1J2XA 1BN5A 4KDPA 4HF1A 3IL2A 5CVUA 1XMKA 3K0LA 1BI2A 1ZGJA 4HX8A 4A5NA 2V1XA 1QNTA 4HX4A 5E20A 2IA2A 2HR3A 2FQ3A 3ISPA 3EDPA 4KT5C 2YR2A 2K4JA 4F7ZA 2H6BA 2H6CA 3CUOA 2D1VA 1B6AA 1UCRA 1J9IA 1I27A 1ZRCA 2R7FA 4LLGF 2JT1A 1FBSA 2X0LA 4NQWA 1LDJA 4EGYA 1V4RA 1W5SA 2QZ8A 3C1DA 1FY7A 1SMYF 2FBKA 2HTJA 3O2PE 1D5VA 3HRUA 1JHFA 3F6VA 4U88A 3CO6C 2PMHA 3QPTA 4HV5A 4I02A 3L00A 3KLOA 1G3TA 2D1HA 3ABUA 5D5WB 2EV6A 4P96A 4R79A 2P8TA 3E6CC 1K79A 1HW5A 5JVTA 2HTSA 1E2XA 1GVJA 1G4DA 4MTDA 1DDNA 3QAHA 2FNAA 2Z3YA 1QGPA 5D4RA 2R7DA 3HTUA 1KYWA 1IRFA 4P9UA 3CUQA 2L54A 4P55A 1I5ZA 2RQPA 1EH8A 2HYFA 3KEOA 3E6DA 4WX9A 1L3LA 5CVRA 1QZZA 3U1DA 5J8CA 3F8NA 2NYXA 1MDMB 1USSA 1FX7A 1J5YA 1U2WA 4LJZF 4EM2A 4KICA 3T5XA 3EQLF 1EH7A 5JHUA 4Q4ZF 3N4MA 4A12A 1KGSA 1RNLA 3LAPA 4IRGA 4WXCA 2Q0OA 2RV8A 3V7SA 3R61A 2WWYA 2XROA 3FM3A 4MQVA 3TQNA 1ZGAA 4N0BA 1LJ9A 2QVOA 3P9KA 1ZHFA 3WTXC 2WV0A 1Z91A 3R6SA 4A0YA 1XGSA 3EUHA 2FBIA 3JW4A 2E7WA 3BDDA 3QOPA 3RKXA 1P4WA 4GYGA 3VOEA 3BP8A 2IW5A 5HS8A 2Z9OA 1DUXC 1IXSB 2B0LA 2EB7A 5KVRA 5D8KB 5ILVA 3LWFA 2M5WA 2D45A 2VT3A 4RGUA 1R00A 4RB1A 3BROA 3LA7A 4KIBA 2J5PA 4RAZA 2QM3A 1F9NA 2ETHA 2DPUA 4CYDA 5HDKA 4YFNF 4P9FA 1YW9A 4HQMA 5HS9A 4Q5SF 1WRJA 4EMSA 1BC7C 1Q1HA 3RYPA 4YG2F 2V6CA 3R60A 3U9GA 3HRTA 1Z6RA 3FMSA 1U78A 2BBYA 2ISYA 3DEUA 2L02A 3WTUC 1RUNA 5JR3A 1UB9A 1OKRA 1AOYA 2PEXA 1ZRFA 2L4MA 2M1BA 3HUGA 3KP7A 4O3MA 5H6RA 2QBYB 4G7OF 2EFWA 5BMZA 3Q5FA 3IRQA 3ERED 2EFNA 2IP2A 2D2WA 4ESFA 3GX4X 2ADUA 5FLXZ 4LD5A 4S04A 1FLIA 4MEYF 3KCCA 1QO0D 4ASNA 1R36A 2XVCA 2Q8KA 4A2UA 1R1UA 1YO5C 4ZYGA 4CHUA 2EA4A 2EJRA 3F72A 2PLYA 3ZMUA 5HS7A 2EFQA 2NAZA 2QQAA 2ZNZA 3WODF 4KIFA 2DI3A 2OZ6A 4UVAA 2W25A 3W6KB 2P5VA 2E7XA 1BIAA 5J8FA 1PP8F 2LDUA 1R1VA 3FMQA 2IA1A 3WTVC 2FEZA 4KUMA 4YIIA 4L9NA 4YFKF 1REPC 1C0WA 3HTSB 2VE9A 4AIKA 1W7PB 5FLXK 5F1RA 4G7ZF 3FWEA 1ZG1A 3V8KA 1YIOA 1NHAA 5H20A 3E3VA 3J80Z 3FF5A 1IN5A 3GFJA 1FSHA 2IJLA 3KFWX 4KIGA 2LF7A 1BBYA 5IT9Z 1QZYA 4HW0A 4ZZDA 5LGTA 3FX3A 3CLOA 2JTVA 3MZYA 1IN6A 2GAUA 3OV8A 1IF1A 1JXSA 4A0XA 1YFHA 3L2CA 5FO5A 3R0AA 5LHIA 2MA3A 3DKWA 2VONA 4GYIA 2V79A 3KP4A 2K7LA 3R4KA 3RPUA 1HSTA 4O6JA 4M9ZA 5E1XA 4RB2C 4HLXA 1U5TB 3IC7A 2H94A 1RIOH 1PUEE 4L18B 4XSZF 5H6QA 3J80K 2V1UA 4MQ9F 1SD6A 1XCVA 4QLCU 4A5MA 3GLXA 4ZZLA 2CG4A 3IRRA 1B9NA 5FD5A 3MAJA 3V8LA 5IT9K 2VBYA 2VT2A 3FZVA 4QWQA 3K1NA 2A5YB 2BGCA 3J81Z 1Z7UA 3SZPA 3QU3A 5TJJA 2DK8A 4M71A 2OU2A 5L3BA 3FMRA 4G6DA 4KN7X 1Z05A 3F8FA 1S29A 3GEZA 5BS6A 2VBWA 2XAGA 3ULQB 2QWWA 4IJAA 5CLSA 4XSXF 3KP2A 2A68F 1FT9A 4UV8A 3T1BA 1SFEA 1KYZA 1U5TC 1XGMA 3Q9SA 3QP6A 1K78B 5D4SA 5LRRA 2HKOA 4LB5A 1DPUA 3ZQ7A 5K5QA 1MJAA 3WGGA 2NRAC 3QRFF 1R22A 4IPAA 5K1YA 3I59A 2KIUA 2BEOA 2LNBA 2A61A 1SAXA 4HBLA 2CYYA 3J81K 3CDHA 4G7HF 4LGWA 3BPXA 2M87A 4IVNA 5LRSA 3TDUC 2NNNA 2A6EF 4RGXA 3GFIA
chains in the Genus database with same CATH superfamily
2O8XA 4UHTA 1YJWI 5DUKA 1E3HA 4A3LJ 2LSOA 4Y3OA 1W4MA 3OYAA 2F48A 1YQAA 3ZGKA 1I1GA 4KJZA 6PAXA 2EFOA 3K4JA 5DTDA 1FEXA 3EYYA 4Y17A 1PVEA 2VBXA 2O7OA 1X58A 2K4BA 3H36A 3K70C 4BE2A 3V4GA 3HIFA 2JUGA 4ZC3A 2VB6A 2FMLA 3BR1A 4WCGA 4MO7A 1BL0A 3HEFA 2W84A 3K70D 3HHHA 5LEKA 4FX4A 1ZRDA 3CDIA 4CYCA 1S72I 2G9WA 4B43A 3N97A 5C4XJ 1TNTA 2H09A 2DLLA 4AIHA 2GA1A 3KZZA 2QQBA 2W57A 4E7SA 1D3YA 1RI7A 3JREA 1JT0A 2JA2A 3ZMTA 3ZXSA 3K4KA 3V8JA 1Q1VA 1LDKB 2JRTA 1H0MA 1FP1D 2EIMH 4XRSG 1O7LA 4R1HA 3JSOA 2LRDA 3ZQQA 3ECOA 1VQ5I 4N4NB 1Z77A 3HJEA 5EG0A 4YIRX 5IPAA 1MBGA 2K9QA 3CDLA 3CCLI 1GVDA 4W97A 3M8JA 3MFKA 1P6RA 2DYSH 2ZBKA 1QBJA 3ZQLA 1OISA 1X3UA 5E3NA 4UNOA 2QQ9A 3DKYA 1AWCA 1Z1DA 2L4AA 3U2RA 2R5ZB 2FA5A 2MH9A 4XOPA 2VPRA 3DLAA 5K7HA 2EBIA 3GFMA 2RNJA 4AWXB 1K7AA 2PJPA 2DMNA 1AKHA 4BS9A 4OINF 3DTEA 2Z33A 2G7HA 4JX5A 3SYTA 3UR3C 2ACJA 3CESA 2OQRA 3BJOA 4FT8A 5CJ9A 4ZH4F 4Q47A 2UZKA 3CCRI 1E0EA 1FWZA 1G2HA 2A05A 2OF7A 3W2WA 1A6IA 4RGRA 4HQEA 3CJRB 1IUYA 2HVRA 2DOEA 2E19A 3LQQA 2VXZA 3WGHA 4XL9A 4XLCA 4OAZA 4WK8F 3I3LA 3KZYA 3CJTB 1FZPB 5M5YJ 3H5RA 4HG2A 2B7EA 2CFOA 1V3FA 4OAYA 1T33A 3GTJJ 1YX5A 4M3BA 3KEQA 1D0XA 2WY8Q 4ZDPA 1NK2P 2PQ8A 2KIMA 3G71I 4BACA 1B1BA 2K86A 5J1UA 4BNCA 2RNGA 3NWTA 4HA8A 1J75A 1EJ9A 4JK1X 2K9LA 3SFIA 2MW8A 3ZOBA 3KP5A 5IP9J 2UXXA 3ABLH 4CCNA 5HLTA 1MH3A 1ZARA 3CQZJ 3F22A 3HKZA 3ZMZA 3NQOA 3MZ8A 1JKRC 4B3XA 4XIDA 5ERIA 3FXLA 2QKMB 3E97A 2L01A 1Z0XA 3A0BC 1PUFB 1G3SA 2ID3A 4NDLA 2DA2A 3WG9A 1J7KA 3F9KA 2XF7A 1IZ1A 1MNDA 2HGCA 5LHHA 3ECHA 4UB8C 2VC0A 4EQQA 2R0QC 4ZYHA 2OJED 2O6GE 1S3JA 5EEHA 5DCMA 2NS7A 1R5GA 3ZQGA 2KDZA 3CCYA 3TGNA 4A6DA 1JE8A 2DK5A 2Y9YA 2ZFWA 2FXAA 2HOTA 1KQ0A 2QCOA 3GZ5A 1I6XA 3LNQA 3DV8A 1LFBA 3BLYA 4I76A 1Y39A 3H9JA 5J6XA 3F8MA 2PMUA 3I58A 3PUBA 1IRZA 3SFZA 2HWVA 1BJZA 1F1ZA 3GXOA 2QUFA 2BV6A 1ULYA 2CW0F 3TW6A 4J19A 1T39A 2P4WA 2CUEA 4YFXF 5CQGA 3MCZA 2H27A 3DLLF 3Q9VA 3PO2J 3SXYA 2ZKZA 1R6RA 3UNGC 5DUIA 2ZB9A 3QOEA 5D6EA 3P7NA 1ETXA 3D5RC 2MH2A 4L5IA 3K4CA 1JT6A 4BGDA 5CVIA 4XNFA 1X1CA 1MD0A 4IOAF 2PMZN 4L9JA 2DA3A 1PP7U 3H1CA 4MGRA 3HG9A 5EZHA 1WJCA 2YU3A 3LFUA 4A3BJ 2DA1A 3AG2H 2R7ZJ 4IEJA 1LVKA 1SMTA 1MBHA 2RKHA 2CQ7A 2BW3A 4KFCA 3W2AA 1SD5A 4NC8A 5KHDA 1QPMA 5K5RA 4EJTA 1Y8RB 4IHSA 4B8XA 1ETWA 4W1UA 4XN3A 1GV5A 2VKVA 5B66C 4M9XA 4HSTA 4LG0A 5JI6A 2FRHA 5JHFA 1T6SA 2M45A 4BY1J 1WH7A 3ROUA 4BEHA 1FBUA 3VODA 5K5OA 3HOXJ 2E2JJ 2GXAA 3ML6A 1POGA 2ZO4A 2DO7A 1GT0C 4BE1A 3CMMA 2V9VA 1Z6TA 3TO9A 2PI0A 4JBAA 1D8JA 1MJBA 4XOTA 4EEFG 2O5RA 3DPTA 2DYRH 1P7JA 5J47A 1IG7A 2KPMA 3TMOA 1LFPA 2L0KA 5HDNA 1WQ2A 1HOMA 3HXLA 4EJOA 2F5VA 1UHWA 4KMUX 4KYWA 4RB0A 3BR0A 3FK6A 1ON1A 4XRSA 1H89C 3ZP5A 1HCRA 3T8RA 4RM3A 1R58A 4MTEA 2ZMEA 5JLXA 3OOPA 3GWZA 3WHCA 5HODA 3TP0A 1UHSA 2WAEA 3RPUD 1WSUA 2M30A 2MYSA 1XSDA 4XLFA 4C2TA 1TWGJ 3MKWB 3E5XA 5CQEA 3QODA 2BY0A 2PG4A 5B5EC 3QU6A 2R7VA 1CF7B 1GHCA 2YX4A 4G9YA 1IUFA 3S93A 2GXBA 5HNFA 3OY9A 1KU7A 3VDXA 3BC8A 1OCOH 2HKXA 3LSJA 1TWAJ 3H5AA 3ZQIA 2RN7A 1FYLA 2WV1A 2O0YA 4A93J 1AHDP 2A69F 2VOPA 4JP0A 2KISA 2JRMA 4M72A 2KRCA 5GTHC 3VSKA 3MKYB 2VKHA 4ZTJA 2P81A 3KETA 2EWNA 1XMXA 4ON0A 2CJJA 2JQ7A 3ONQA 3F3XA 4PGHA 3FHNA 1XSXA 3W6JB 2PN6A 3FXRA 1VQ7I 1R5HA 4LK1F 2AXLA 4AYBN 5FKOA 4LK0F 1YW7A 2Y0SA 1TLHB 5JLWA 3W6VA 4KMFA 2OCCH 2BZTA 4EGZA 2DBBA 3H3ZA 3I9V2 2L7FP 1RUOA 4L0ZB 1X1PA 4BHCA 1T95A 2K5CA 4X0GA 2X48A 2CSOA 4RAYA 1JJ6C 3R0JA 1OYWA 3OYDA 4XKBA 4ENKA 4B1RA 1SEUA 3NRVA 1MKMA 3KIOA 4BXUA 3F21A 2M3AA 3S17J 9ANTA 4M6XA 2VODA 3TOAA 2F5FA 4XRFA 3WTSC 1X2NA 3T8TA 4A6EA 4ZDOA 4XBFA 1R7JA 2XAQA 2HZTA 2CS3A 2CO5A 2DU9A 1O7FA 3FDYA 4RDUA 2ME0A 3FKJA 2HXOA 3I56I 2R5ZA 4GRIA 1HA8A 3QP5A 2JA5J 1XSVA 3FIWA 3C2HA 1D1BA 5CYVA 2HDWA 5IOZA 1FIAA 2X6XA 3S1RJ 2IRFG 3KYCB 5F64A 3TOBA 2P7VB 3DU6A 2VUMJ 1E17A 2W4SA 4ETSA 2LKPA 2XIGA 4HF2A 4I09A 5HLHA 2LH9A 2JA7J 1G3YA 1FSEA 3FBNB 3I0TA 2YU9J 1N25A 4DNCA 3BZKA 2LKXA 1GXQA 5HNHA 1GDTA 3S1NJ 2UV1A 3CO7C 1U9OA 2MC3A 2H8WA 1SVMA 3DCFA 2EZHA 4U0VA 2QENA 3MVPA 3GO5A 5A2QZ 2XSDC 1G59A 3COAC 3OOUA 4BQAA 2V4JC 1HXDA 2GQQA 4NQWB 4AM3A 3WTZA 5L3GA 2ECBA 5HVQC 1KU2A 3TDZC 3DXJF 1OR7A 2AS5F 4UVCA 1FYMA 3KP3A 3ZPLA 3CP8A 3GTQJ 3GF2A 1T98A 2QYOA 4IRIA 3GCMA 4M6YA 4PFPA 1FP2A 1FOXA 2X4HA 3SEQA 3K2ZA 1MZBA 2HI3A 5FFZA 4D7NA 1D1AA 3JRAA 3OYEA 5EEGA 1Y56A 2R7QA 3BPVA 3PNYA 3T0YA 4CCKA 1VQ8I 3EYIA 1MMAA 1TBXA 1OQYA 2EFPA 4MEXF 1ZH5A 1MSFC 3RSNA 2BYVE 1SFXA 3M8EA 3LAJA 2FU4A 1RKTA 1PJRA 3EETA 3SDBA 3CCUI 4YELA 1P7IA 2R7WA 1XB4A 1MDMA 3ABMH 4LFUA 3UKGA 4JQFA 1HW2A 3DP7A 3GLLA 5EGOB 2LLKA 2NVUB 1FTTA 1YLFA 2GIVA 2OC6A 5LD2C 2BHZA 4IZZA 3LMMA 4KNYA 1DP3A 5E1ZB 3C7JA 2X9DA 3CUQB 3I64A 4WXHA 5A2QK 2DOAA 5ILSA 4RMNA 2ELHA 2FBHA 2HOAA 3QQAA 1IRGA 1SVOA 1IXCA 2CH0A 3JRBA 3BJ6A 1U3EM 4YRVA 3S14J 4GXOA 2VLAA 5AIQA 3I54A 4OMZA 1IV6A 2R4GA 4G94A 5E3OA 4HRIA 3WU1B 2CMPA 3LOCA 5F0FA 1V5EA 4OOIA 5DM7F 4PDKA 1X4PA 3E6MA 4P5OA 3GYHX 2RGVA 3AFHA 4XLPF 2F5DA 4OMYA 1YITI 5ICEA 4U0WA 4XN0A 3P9CA 1QHGA 1STZA 2L7KA 3VFZA 1UFMA 4QPQA 2DTZA 4XICA 1QVUA 3TO6A 1B8IA 1VQ9I 1T0FA 4XRMA 2DQRA 4UY8I 1KQ8A 1LE8A 2L3DA 3ZMDA 2DW4A 2KZVA 1U6GA 3BQZA 2LMDA 3C18A 3SZTA 1NG6A 2FE3A 1KU3A 5DM6F 3GTKJ 3JTGA 3GTPJ 2WB1A 2ZCWA 1ZLKA 5FB2A 3DF8A 5CVJA 1OCRH 1LDDA 2LVSA 2F4MB 5D5XB 3IKVA 4DGWB 1WJBA 4M3FA 5AONA 1P2FA 2IGOA 1O3SA 4C3IJ 2XB0X 3OMYA 4B4CA 2ZC2A 3CF5F 5LGNA 2XRLA 2VBZA 3E6BA 3REOA 2Y9ZA 3I53A 4IOCF 3O8GA 2KQRA 2YX7A 4Y13A 4EM1A 4L9VA 3OWTA 5KAFC 5ED4A 1USTA 3G1MA 3ZR8X 4EATA 5M5WJ 1LNWA 3IKTA 1CGPA 3MZHA 1OYIA 2DFHA 3CUQC 1EH6A 5FD6A 2HVSA 2BOLA 1VZ0A 2F5EA 1FYKA 2CGPA 4ZYEA 2VL8A 2R5YB 2XB5A 3FM5A 1ZGWA 1G3WA 4XQFA 3CC4I 3ASOH 2ESNA 3M9AA 2X1CA 2K3PA 2ZJ2A 4MNUA 1DPRA 3MEXA 1WJAA 2VPLA 5M5XJ 3JRGA 2A3SA 3K69A 2CQQA 5KNLA 4DZPA 2IGNA 3IP4B 2HPMA 1ZTRA 3H3UA 3RKWA 5J40A 2HYJA 4V2GA 2VKDA 1RZ4A 2L9SA 4C30A 4Z2YA 3BG9A 3IHUA 1DP7P 2IPQX 2DCEA 2JZYA 3WE3A 2HS5A 3RKYA 3VB2A 4DQ2A 2K9NA 1I1SA 2GZWA 2KJCA 4AIJA 1TW2A 1CF7A 2YS9A 2XAFA 4CCJA 2K9SA 5B1BH 5D5UB 2CFXA 3H92A 3M1CA 3CF2A 3U21A 4GO1A 2BY3A 2V26A 1EF4A 3OYHA 1IRXA 3HGGA 4B44A 3B6CA 1GV2A 2QSFX 2QSHX 3S2DJ 2JMWA 2JN6A 3F8CA 5GP9A 1WJ5A 4QIWN 2IS6A 2FF4A 1YG2A 3OYKA 4CCLA 5D5VB 4EJWA 2QBYA 2G7UA 1LFUP 2DFFA 2H1KA 1HC8A 4EJUA 3DQVC 2R92J 2JJ7A 1ON2A 4RLFA 3CZ6A 5CVVA 1ORKA 3WGIA 4XLAA 3MKLA 2LBFB 3EUHC 1TWHJ 2LYCA 2M0CA 3TW7A 2EZLA 2RC4A 5DD4A 1JHHA 2CWEA 1O57A 2V1DA 1VNDA 1VF9A 1U0JA 1XX5A 2GIZA 5HDGA 3WTYC 1TP4A 3RDIA 3OS1A 2OV7A 1BA5A 1P9QC 3HOTA 1F4KA 2W1OA 4RBOA 3HUGB 3MMYB 3S3NA 1MBEA 1VQ6I 4HEA2 1R4NB 4PJMA 1G6NA 1B59A 1Z67A 1DGRM 3NEUA 3DFGA 1LPQA 1R9TJ 4I01A 4RM2A 3N05A 3H0DA 2P5LC 3GZNB 2EILH 1IN7A 4IF4A 2VI6A 3S3MA 1FC3A 3HZJA 3DEWA 1TZLA 4PK4A 2KRFA 2D5VA 2XGXA 2MLKA 3S2WA 3PQKA 2NNYA 2CUFA 4GCVA 2FMYA 2ZXJA 4BUPA 4UVBA 1I39A 1WCMJ 1OLTA 2FNPA 4DYCA 3CCJI 2P6SA 3BOQA 3DTIA 1JKOC 1BIBA 4PZJA 4BL0B 2MGQA 3NWSA 4E7KA 1VQMI 4I2OA 2STWA 4OIQF 1D8KA 4FCYA 1TQPA 2ZMEC 2OTJI 2JA6J 2O61A 5E3LA 3E5UA 1J0RA 2NS0A 5L3DA 4BAYA 3RIRA 3M07A 2L2OA 1BI0A 2GA2A 2VN2A 3DBRB 5LBQA 1P4XA 3ZRGA 1Y0UA 2Y31A 1FPQA 3I4NJ 3LQRA 4EM0B 5EZGA 2XPWA 1W7PA 3FBIB 2XKPA 3VEPA 1YS6A 1IAWA 4Y33A 4I6ZA 2DQLA 4GFBA 1XDSA 1BI3A 3MN2A 5DDGA 1EA3A 1T2KA 3C2BA 2M0MA 2V7FA 3HRSA 3L09A 4A3IJ 4PUSA 2GM4A 2GLOA 3G73A 2VC1A 2BVLA 3TEDA 3HYIA 2DMQA 2M4GA 3OYBA 4CGZA 4Y7NJ 1X1DA 3BG3A 3F23A 4JYKA 3KYLA 1YX3A 2E1OA 3I71A 5BPIA 3QYFA 3V7RA 3D5LA 3F6OA 5CPRB 2JPCA 2BY1A 1ZN2A 3K4LA 4X6AJ 2NVXJ 2O03A 2GOXB 1HBXG 1JUSA 4L9TA 2K40A 2F5CA 1RETA 4GDFA 3WE2A 2HU9A 4AIDA 2OAZA 4U7BA 2DDBA 3FKIJ 1ZREA 5BQTA 2Y48A 5E8GA 4B47A 3VYSB 4LMYA 4M9SA 4BQOA 3RJPA 1HKTA 1S7AA 2DTRA 3S1MJ 3WHBA 2HYGD 1MGTA 2JWTA 2Y0MA 4EVIA 5KAIC 4LLLA 3KYDB 4ENJA 1XDUA 2QEXI 4HDUA 5F04A 4OIOF 3OYNA 1W0UA 4A3CJ 4RGSA 4CZZA 1HLVA 1XC5A 2NVTJ 3A4CA 2V1NA 3G3ZA 3SHFA 3KEYA 4S0HB 4E70A 2V9KA 1ZLJA 3MKZA 2W82A 4XLNF 3BR2A 4JX4A 3D1NI 1A6QA 3IAS2 1K83J 2E1CA 5DEQA 1Y6IA 1HDDC 2X6OA 1ZYRF 4FETA 3HHGA 1WJDA 1O3TA 1U5TA 1WFXA 1RKWA 4EV0A 2E5ZA 4NB5A 3F0CA 4EJVA 2M8EA 4I0BA 2OQGA 4UUVA 4IRHA 3BCAA 1P4AA 4CCOA 2XAJA 2E2IJ 4A3JJ 1UG2A 1KU9A 2PBIA 2M9HA 3MQ0A 3TO7A 2LP0A 2DA7A 3PM1A 5LEJA 2HXIA 2W48A 4HNVA 1ZK8A 2K27A 1FMVA 1R5ID 4S05A 1EV7A 4L5EA 3HOUJ 5D8LB 3I4PA 1X3ZB 2HVQA 2K85A 5J4YA 2JSPA 4QTRA 1HSJA 1N75A 4FE4A 4F93B 1KQ9A 3FXKA 1BJAA 1TTYA 2P5KA 3HOYJ 2VQCA 2L5QA 3P5JA 4BE0A 1IN8A 2Z16A 2HOEA 4KITB 3CCEI 1MW7A 3A2KA 1JUMA 4BJTA 2Y30A 4BYYA 3HB9A 2LC2A 3GZ6A 1YS7A 3BTCA 3CMYA 4RAGA 2M4KA 2FOKA 3ZN0A 3DBLB 5IYCJ 4CCMA 3S3OA 1M1EB 3OL4A 3PFIA 4A3MJ 1ZKGA 5GAHJ 1W5CC 4N9HA 1XGOA 2HQRA 1MJ9A 1ERDA 2DT5A 4G12A 4H0EA 4LIUA 5DCFA 5ICCA 1UHMA 2WTEA 1R23A 3AG4H 5J1YA 2KP6A 1U9NA 1WGXA 3K7AJ 2CV1A 1OCTC 1ENHA 5IP7J 4WF2A 4M3EA 4FASD 1QPIA 2XV4S 5DS9A 5EF6A 2YSRA 4PCQA 1LB2A 5IT3A 1YYVA 4CUGA 3JSPA 2DOFA 5ILUA 3CD6I 4Y52J 1ITYA 3HC7A 3E0JB 3M7GA 1S9HA 3LA2A 1OCZH 1K78A 4A3DJ 4I98B 1ETQA 4MHGA 3V7CA 4OIPF 4CDGA 1D0YA 1MMNA 1YRNB 4BHPA 2Z5UA 2B9SA 4YIFA 4F52A 1OCPA 2DXIA 1HKQA 1XD7A 2XUBA 3GW2A 4RAFA 2DT6A 1A5JA 1SD4A 3L7WA 4HAMA 3O8HA 1YJ9I 4D7MA 2EV5A 5FKNA 3BG6A 3K1MA 3TKYA 4CO8A 4DYRA 3OS0A 2FX0A 4B09A 2E5NA 5DD8A 2DODA 4L5JA 3ZMSA 4IXAA 1IN4A 3LA3A 3K1PA 1SANA 4BDYA 4D9JA 1ETYA 1KA8A 2GWRA 2F6CA 2R3SA 3PSIA 4FHTA 4HLYA 2EK5A 2UWMA 1B72B 3IUOA 2HQNA 4NHJA 4BHBA 1WVRA 3QPSA 3CJNA 2XGDA 4A3KJ 5D6FA 2W85A 3L9FA 3NAUA 4ZYDA 2ELJA 1WPKA 2VOOA 2OCEA 4XKWA 5L3FA 2KIFA 4ENNA 1FJLA 5HOOA 3I59B 2Q2EB 4H4KC 4G6QA 2ID6A 2X51A 2DAOA 3E7LA 5F6FA 2GBYA 3OYLA 4CICA 2Z99A 2E2HJ 2DPDA 1DU0A 5F1JA 3GTLJ 2OUMA 3LFKA 1FOKA 2P6TA 4D0PA 3WTTC 4IX7A 2HDDA 1T0FC 2RVCA 2CQKA 4N9IA 4M3DA 2WA0A 3KLNA 1HQCA 2UUZA 2OZUA 2JUCA 1ZELA 5FRNA 1Y8QB 2AQFA 3BQYA 1UELB 3H5NA 4FTHA 4O5VA 1S8NA 4KN4X 4RB3C 2DJIA 3P9IA 3H35A 2COMA 1Z9CA 3RTRA 2JPBA 4ESBA 4U87A 4J00A 3BWGA 1ODDA 2X1EA 4IL6C 3GMEA 1YI2I 3WODF 2K02A 4PJJA 2R93J 3ESWB 3Q0VA 2NVYJ 5L3CA 2EPFA 1S6LA 2TRTA 3A01B 3WTWC 2Q1ZB 2CW8A 4ZDLA 1MMGA 2WY7Q 2AHQA 3DWLE 1S7OA 1RC9A 2R7TA 1A04A 3WU0A 2KRHA 2JK3A 5EJCA 1LQ1A 1CQTA 1DGWY 4CA0A 2TDXA 1MBFA 1K6OA 1R1TA 1GXPA 1WJEA 1HKSA 3JR9A 4M73A 2K3FA 3G6EI 4CYCB 3CMAI 2EZKA 2H1LA 3M1EA 3PJRA 5E17F 4TV7A 3LSGA 2WC2A 2CUZA 1TNSA 3RPQA 1H9GA 3HOWJ 3OIQA 1ZAOA 1BC8C 2R7UA 1WKMA 3BY6A 5HLIA 2F4OB 2F2EA 2STTA 3G4SI 5FKLA 3GVAA 4BXFA 5BOXA 2IXSA 1SD7A 3PO3J 2UXNA 2I5UA 2ESHA 4OIRF 5FKKA 3PIOF 2ZNYA 4K2EA 5F27A 2XHKA 3FXMA 3AG1H 3HKZN 1HW1A 3E5QA 3HSEA 3K9TA 4ESJA 1TC3C 2VIXA 5JVGF 1X4OA 2A5WA 3K10A 5E8IA 4U7DA 2LG4A 4HZFA 2AO9A 1H88C 3CTAA 1LVAA 3LSHA 2O3FA 1ZG3A 4I0AA 5FKMA 3BZ6A 2IVMA 3OYFA 1TWFJ 5FLMJ 1ONVA 2W24A 3RYRA 4MLOA 3U1KA 2DFIA 4ENMA 1LEAA 1ETVA 4UV9A 3GFLA 1VQOI 4C2UA 2E1NA 3K2AA 3B73A 1XCBA 3PNTA 1FOYA 1AKHB 3KP6A 2XRNA 1DQUA 2EV0A 3JAMZ 1X1AA 1B4AA 5F08A 3PFYA 4AD9A 5AIPA 1IO2A 3FHZA 2BHYA 3M8FA 2BXZA 1OJLA 1AA7A 5HLGA 1W5TA 4LLNA 3CLQA 4RS8A 1PUFA 5IYBJ 4WXDA 5FGMA 3S8PA 4GGGA 2ZSHB 4IKFA 1G8XA 3DTKA 1MSEC 2R7XA 4M74A 4Y15A 1YW8A 3ABTA 1IW7F 2XAHA 2XPVA 5FFXA 4MFDA 2QA4I 4IO9F 4II2A 3AKZA 5M3MJ 4WWCA 2XKOA 2KDOA 3IWFA 2IBDA 1J59A 1LEBA 4E4HA 3SQNA 2VJIA 2GOMA 2ZJPF 1WWXA 2C6YA 3GTGJ 1WI9A 2IT0A 2DN0A 5EYRA 4PJ0C 1BM9A 2M7BA 2QQ8A 1UAAA 3FXQA 4NC6A 4E7HA 1FBQA 2Y75A 4PSXA 4UUSB 1XPXA 5BPDA 3F8BA 2WAFA 2ZJRF 5E1WA 1YTYA 1SFUA 4HX7A 3EPZA 2IA0A 2KKOA 1LKXA 2GXGA 2XF6A 1ACIA 1JJ8C 2HFHA 3IWZA 1KZHA 2JSCA 3MD2A 2VE8A 1HF0A 3LSTA 2FSWA 5DCMB 1XN7A 4FX0A 1I3AA 1BOAA 1JGGA 5LLQA 3TBIA 4XKVA 3JAMK 4LB6B 1XMAA 5E18F 2XPUA 1IXRC 3DU5A 3EUAA 5LHGA 1H9TA 4HDVA 2OBPA 3BR5A 2HEOA 1L0OC 4ANJA 3AL0C 1Y1WJ 2E34A 3O6BB 2ZXHA 3VYUB 4AU7A 1FNNA 1Y0NA 4LIVA 2MD0A 2WBMA 5JFRA 3LSMA 1W7PD 1QQIA 3PSFA 2E35A 2XDVA 3OYMA 4ABZA 3OL3A 4KA4A 4XK4A 2M34A 4OU0A 4D1QA 4C3JJ 5FJ8J 5EEAA 2DA5A 3AAFA 4R8HA 2R7SA 2XASA 3BTIA 2XAUA 2NOJB 5TRDA 2KJBA 3KE2A 2RDPA 2PFBA 3I5UA 4HF0A 3ZN1A 2HDCA 4HNUA 2IS2A 3BG5A 1P92A 1TQMA 3ZMVA 4AVPA 1X19A 3BJAA 3D0SA 2M7AA 4E7LA 1B9MA 4NUBA 3PUFA 1BI1A 2EA2A 3V42A 1ZR4A 3FXUA 3IV5A 3GUDA 1ZG5A 2MD5A 1YRNA 1TW3A 5ICGA 4B3AA 2VASA 1TT5B 3HSRA 3RQIA 1U8RA 1K61A 5J4VA 5L3EA 5C4JJ 3ELKA 4U0YA 4MIMA 4ZTFA 2BW3B 1GUUA 1VTNC 1IC8A 5ICFA 1F5TA 5H2FC 4HYEA 3O3KA 2A07F 2YUSA 4PGGA 3B02A 2BE5F 4HOBA 3QPHA 3NARA 2MLGA 4LG0B 3CCQI 2J5OA 5IYDJ 3DPLC 1E3OC 1PDNC 2QSGX 4BEHB 2LF8A 1ETOA 1XGNA 1W1WE 4G8XA 3PL8A 4A0ZA 1RPWA 1U8BA 2Y0SN 4PJNA 3PIPF 1OYYA 2MG4A 3RQ4A 5LGUA 3HPGA 3HSFA 1K6YA 1V55H 2MBFA 2OA4A 1OPCA 4M3GA 5BNGA 2LY2A 4HV6A 2A6HF 4UXNA 1TQIA 2FJ1A 3KPHA 2YPRA 2P7CB 4X1EA 4L0YB 5DYMA 1JGSA 3HRMA 4IHYA 4BH9A 5K7FA 3J7AO 3PQJA 5KK1A 2Q2EA 3HOSA 1TT0A 1N78A 1T38A 1VFCA 3K4BA 3DBHB 2QLZA 1BR4A 2XF5A 2ZMEB 2Z2SB 1UG0A 1V54H 3L2UA 3BZCA 2EINH 2WAQA 3GBGA 1YOVB 2O8KA 1IV8A 2VJ5A 3JRIA 3C3WA 3OYGA 3RZDJ 2E1MC 1O3RA 3JTHA 3MWMA 1OMIA 3CJQB 4I7HA 3TP3A 4CXFA 4Q48A 2ISZA 3CP2A 2F4IA 1Z7LA 5DV5A 3RI4A 3RCOA 2OD5A 3ZCOA 1O3QA 2WADA 4IHTA 1MBKA 1VQKI 1J2XA 2VJJA 1BN5A 3QWLA 4KDPA 4HF1A 2V9PA 3BR6A 3IL2A 3VYRB 3IH2A 3HM5A 5CVUA 2CUJA 3D5SC 3HGYA 4HPQA 3A01A 4D5FA 1XMKA 4BY7J 3K0LA 3L2QA 1BI2A 2V6EA 1IDZA 1ZGJA 2LY1A 4HX8A 4A5NA 3TL4X 1F43A 1ZR2A 2V1XA 1QNTA 1BR1A 3M3YJ 4FE7A 4HX4A 5E20A 1JUPA 2IA2A 2PX9A 2HR3A 3I55I 1VQNI 5TISC 3OS2A 1D1CA 1KONA 2FQ3A 3ISPA 3EDPA 4HSRA 4KT5C 4XM3A 5F0CA 2YR2A 2K4JA 3H3VK 3SZGA 1YHQI 4F7ZA 1JTYA 2E36A 4IHXA 2H6BA 2H6CA 1IJWC 3CUOA 4XORA 2D1VA 3FK7A 5B1AH 4DIQA 2XGCA 1MNMC 1B6AA 1R71A 3WG7H 1UCRA 1TL8A 1J9IA 5TGTA 4V2FA 2E60A 1I27A 1ZRCA 2R7OA 2R7FA 4LLGF 2W7NA 2JT1A 4BBSJ 1FBSA 2X0LA 4NQWA 4AYBA 1LDJA 2PJRB 4UUTA 4AUXA 5GAEJ 4EGYA 4IHWA 3PNVA 1H8AC 1W0TA 1V4RA 1W5SA 2QZ8A 4LITA 3C1DA 1FY7A 2VQLA 5FROA 1SMYF 2FBKA 2HTJA 3O2PE 1D5VA 1I3QJ 1MIJA 3HRUA 1DU6A 3GTMJ 3OSGA 1JHFA 4YEJA 3F6VA 4FISA 4U88A 3CO6C 2LOOA 2PMHA 3QPTA 4DZJA 3CCSI 5EDNA 4HV5A 4I02A 3L00A 1UZCA 3KLOA 1G3TA 2D1HA 3ABUA 5B3SH 5D5WB 2EV6A 4P96A 1V5FA 2IS1A 4R79A 2P8TA 2O9LA 2COBA 3E6CC 1EKEA 1K79A 1HW5A 4OWRB 5JVTA 4BDZA 3SEZA 2HZDA 2HTSA 2KMUA 3X2QH 1E2XA 1GVJA 4HNTA 1G4DA 1MMSA 2OTLI 2CW7A 2NOGA 4MTDA 1DDNA 3QAHA 2FNAA 2Z3YA 4BJ5C 3L2VA 1QGPA 5F0HA 5EGOA 2NXNB 5D4RA 3A02A 2R7DA 4XONA 3HTUA 1KYWA 3K4NA 1IRFA 4P9UA 3BCBA 4UUSA 4A3FJ 2LFBA 3S32A 3CUQA 2L54A 2RAEA 2ZFUA 4P55A 5FLVA 1I5ZA 2LD5A 2RQPA 1EH8A 1F36A 2L7ZA 2HYFA 4LG3A 2CQXA 2WB1N 2ELKA 2HNHA 3KEOA 3E6DA 1BR2A 4WX9A 1L3LA 5CVRA 2QF7A 1NK3P 1QZZA 3U1DA 1SVLA 5J8CA 3F8NA 3L2WA 1FIPA 2NYXA 4DYQA 2LTPA 2AXTC 1MDMB 4PFOA 3RKQA 1USSA 1FX7A 4NBQA 2XSJC 5KCMA 2M8GX 1J5YA 2KT0A 1U2WA 2JVHA 3ERMA 4LJZF 4EM2A 4KICA 4FQGA 1Y1VJ 1MMDA 2I10A 2LK2A 3T5XA 3H0GJ 3EQLF 3M4OJ 4F55A 1EH7A 4PJLA 5JHUA 4Q4ZF 3N4MA 4A12A 4BU2A 5K7ZA 3OYJA 2DMPA 4N4OB 1KGSA 1RNLA 3CC7I 3JCUC 2RQQA 3LAPA 4IRGA 2HOSA 4WXCA 2Q0OA 2RV8A 3LSPA 1I50J 3V7SA 3RZOJ 3R61A 1GLNA 1UMQA 2WWYA 2XROA 1OR7C 5LFAA 3Q3SA 1BW5A 3FM3A 2HQAA 4LOCA 2KZGA 4MQVA 4Z6YA 3TQNA 1ZGAA 4DOZA 2FUG2 1V5GA 1K4SA 2LREA 4N0BA 4NNJA 1LJ9A 3A0HC 2QVOA 1X2MA 3P9KA 1ZHFA 1MNEA 4II3A 2WV0A 1Z91A 3WTXC 3R6SA 4A0YA 1XGSA 2KLOA 3EUHA 2FBIA 1FMWA 3JW4A 1B8IB 2E7WA 2B63J 1LE8B 2VQGA 3BDDA 3QOPA 3RKXA 2R5YA 1P4WA 4GYGA 3VYTB 3VOEA 4A3EJ 3BP8A 2IW5A 1BW6A 4KISA 5HS8A 2KL4A 1D5YA 2Z9OA 3AG3H 1DUXC 1IXSB 2B0LA 2EB7A 5KVRA 2EQRA 1JI8A 1X3WB 3B6AA 4IHVA 3K4MA 5D8KB 2L9RA 2A6TA 5ILVA 2WAQN 3LWFA 1LUJB 2M5WA 2D45A 2VT3A 3K6GA 2BXYA 4RGUA 2LR8A 2EH3A 4MFEA 1WJFA 3FXJA 4QSHA 1A31A 2JA8J 4XR6A 2Z1DA 1NTCA 1R00A 4RB1A 2NS8A 3BROA 3LA7A 2K9MA 3Q0WA 3OYCA 4IQJA 2RREA 4DJAA 5C3EJ 4KIBA 4CSWA 2J5PA 2VJ4A 4RAZA 2QM3A 5C44J 3CMEI 1F9NA 3ABKH 2ETHA 2DPUA 4A3GJ 1Z3YA 2N8GA 4E7ZA 4CYDA 5HDKA 4E7IA 4YFNF 2MFZA 4P9FA 1YW9A 4ZJZA 4HQMA 5HS9A 4Q5SF 1WRJA 4EMSA 1RR7A 2EZIA 1BC7C 5J3LA 3JRHA 3LSKA 1Q1HA 3RYPA 4XKCA 4YG2F 2V6CA 4XMYA 2EIJH 3R60A 3U9GA 3HRTA 1Z6RA 3FMSA 1U78A 2LBFA 1QZEA 2BBYA 2ISYA 2QKLB 2L9NA 3DKXA 3DEUA 2L02A 3KX2A 1QRYA 3WTUC 1RUNA 3S15J 1FTZA 5GAGJ 5JR3A 1UB9A 2M2EA 1QA6A 1OKRA 3OSFA 1AOYA 2PEXA 2X1DA 1ZRFA 4AVZA 1Z3XA 2L4MA 2P0WA 3OIPA 2M1BA 2MC4A 3HUGA 3KP7A 4O3MA 5H6RA 2HPIA 2QBYB 4G7OF 2EFWA 4Y4RA 5BMZA 3BTJA 3Q5FA 5FRMA 3IRQA 3ERED 1I6HJ 1QHHD 2EFNA 2AQEA 2DMTA 2OPTA 2IP2A 2D2WA 3FXOA 4A69C 4ESFA 3GX4X 2ADUA 5FLXZ 4LD5A 3BR3A 5GTIC 4S04A 3L1PA 4E7JA 3QYBA 1FLIA 3S16J 2XGEA 4P1WA 4MEYF 2LY9A 1YE9A 4DBQA 1QVTA 4BQNA 4DW6A 3KCCA 5E79C 2ZXWH 1QO0D 4ASNA 1R36A 3E1SA 3JRFA 2XVCA 1VQPI 2Q8KA 3BG7A 1A35A 1MBJA 1J09A 3H9GA 2ME6A 1S5LC 1R1UA 4A2UA 1YO5C 3HDDA 4ZYGA 1NH3A 3HOZJ 4BQQA 1XS9A 1IDYA 3GTOJ 4AC0A 4C2MJ 3OR1C 4CHUA 2EA4A 3EUKL 2EJRA 5J1RA 1N77A 2ZXIA 3F72A 1WZ2A 2PLYA 1RESA 1OCCH 1T08B 2I8DA 5HS7A 3ZMUA 3I4MJ 2IAIA 1E3PA 2EFQA 2NAZA 2QQAA 2ZNZA 4G6TB 2CU7A 2DI3A 2X6YA 2OZ6A 2VQHA 4KIFA 3LL7A 4UVAA 5GPAA 2DMUA 2PJRA 2W25A 3W6KB 5EG0B 2P5VA 2LKSA 2E7XA 1BIAA 5J8FA 4RLQA 1NG7A 2FQ4A 2LDUA 3IH4A 1PP8F 2KFDA 3HOVJ 1R1VA 3FMQA 3J7YJ 2IGMA 2IGKA 2NVQJ 3J7AY 3H9QA 2ZJQF 2BVMA 2Y69H 3LSIA 2IA1A 3WTVC 1PYVA 2E71A 4J01A 3DPUA 1JKPC 2H8RA 2FEZA 4KUMA 5GADJ 4YIIA 3OR2C 4L9NA 1SFOJ 4YFKF 4XLHA 2ECCA 1REPC 3AL0B 1C0WA 2VKEA 3HTSB 2VE9A 4AIKA 1W7PB 3W3CA 2BY2A 5FLXK 5F1RA 3FWEA 4G7ZF 1ZQ3P 1ZG1A 3V8KA 1YIOA 1NHAA 5H20A 4IQ4A 3E3VA 3J80Z 2KHMA 3FF5A 3HPHA 1IN5A 1UJ8A 3GFJA 2DFEA 1FSHA 2G0EA 2IJLA 1JTXA 2ICWG 3KFWX 3VWBA 1WHUA 4KIGA 2LF7A 3C2GA 1BBYA 5IT9Z 1QZYA 1Z21A 3IH3A 4HW0A 4ZZDA 1VQ4I 3BT9A 2JVGA 1A36A 3S1QJ 2ZSIB 4BJ6C 1YJNI 2L7MP 5LGTA 3FX3A 3IAM2 4CH7A 3CLOA 3ZQFA 1MH4A 3W2VA 1T8IA 1APLC 2JTVA 3MZYA 2TCTA 1QU3A 1IN6A 2GAUA 3OV8A 3QYEA 1IF1A 1JXSA 1D0ZA 2X6WA 3OIOA 4A0XA 2W00A 4C9YA 3FISA 3L2CA 1YFHA 2CV0A 3VPRA 5FO5A 3R0AA 4B48A 2R7RA 5LHIA 2VXDA 4F3QA 2MA3A 3DKWA 1YIJI 2VONA 3HL2A 4GYIA 1ETKA 2V79A 3KP4A 2K7LA 4CZCA 3R4KA 3RPUA 1K4TA 3G1OA 1S7EA 4DBRA 1HSTA 1W36C 4O6JA 4M9ZA 2MSYA 2DA6A 3CC2I 3A1YA 5E1XA 3LSRA 2XC7A 4RB2C 4HLXA 1W36D 1U5TB 3IC7A 1SFKA 2H94A 1WH5A 1RIOH 1PUEE 4RA2A 4L18B 4XSZF 5H6QA 4XLEA 1SAUA 4JOMA 3J80K 3CCMI 3SJMA 2V1UA 4E6KG 4MQ9F 1XG1A 1SD6A 3CCVI 1XCVA 4QLCU 4A5MA 3GLXA 4ZZLA 1FOWA 2CG4A 3IRRA 1B9NA 4ZYAA 4F92B 5FD5A 3MAJA 3V8LA 5IT9K 1JKQC 1SC7A 1WI3A 1X1BA 2VBYA 2FD5A 2VT2A 4F91B 3BTLA 3FZVA 3ZQHA 4PSWA 4QWQA 5E3MA 4ITVA 3K1NA 2A5YB 3JRCA 4NC7A 2BGCA 2DA4A 1O4XA 4C3HJ 4BBRJ 3J81Z 2E1MB 4JX6A 1Z7UA 3ASNH 3SZPA 3QU3A 3HBLA 5TJJA 2DK8A 4M71A 2OU2A 3G1LA 5L3BA 3OYIA 2IEKA 4V19K 3FMRA 4G6DA 4KN7X 1XTAA 5M3FJ 1Z05A 3F8FA 1S29A 3GEZA 2QGUA 5BS6A 2VBWA 2XAGA 3ULQB 2QWWA 1R4MB 3JRDA 4IJAA 1IGNA 2HQ5A 5CLSA 3VSLA 2DDAA 4M6VA 2MABA 3Q0UA 1HDPA 4XSXF 3L2RA 3KP2A 3WU2C 3J7ZI 5IY5H 2A68F 5IP6A 1FT9A 2FOWA 4UV8A 3T1BA 2CV2A 1VI0A 1OFCX 4BKXA 1SFEA 1KYZA 2CQNA 2EIKH 3KZIC 4UB6C 1U5TC 1XGMA 3Q9SA 2PMZA 3QP6A 4KT6A 1K78B 1B72A 5D4SA 1AU7A 1T56A 5LRRA 2DT7B 2L9VA 1VQLI 2HKOA 4LB5A 1DPUA 4I99C 3SDGA 3ZQ7A 3A03A 5K5QA 1MJAA 3WGGA 5CKTA 1RR8C 2NRAC 1TWCJ 3QRFF 4QPOA 2KIQA 1R22A 1BOBA 3S2HJ 4IPAA 5K1YA 3I59A 2KIUA 3QPLA 2BEOA 2LNBA 3ZQCA 3DEEA 2A61A 5GPCA 2IS4A 1RRJA 1SAXA 4HBLA 2CYYA 2DJNA 3J81K 3CDHA 5IOYA 4G7HF 4LGWA 2Y2ZA 4BXXJ 2X85A 3BPXA 2CRGA 2M87A 4IVNA 5LRSA 4D5CA 3TDUC 2NNNA 2A6EF 3G2BA 4RGXA 3GFIA 1R49A
chains in the Genus database with same CATH topology
2O8XA 4UHTA 5DUKA 2LSOA 1W4MA 1YQAA 1I1GA 6PAXA 2EFOA 3EYYA 4Y17A 2VBXA 2K4BA 3V4GA 3HIFA 2FMLA 4WCGA 2W84A 3HHHA 5LEKA 4FX4A 1ZRDA 2G9WA 3N97A 1TNTA 2H09A 2DLLA 4AIHA 2GA1A 3KZZA 2QQBA 2W57A 1D3YA 1RI7A 3ZMTA 3V8JA 1LDKB 2JRTA 1H0MA 1FP1D 1O7LA 4R1HA 3JSOA 3ECOA 3MFKA 1P6RA 1QBJA 2ZBKA 4UNOA 1X3UA 2QQ9A 1AWCA 1Z1DA 2L4AA 3U2RA 2FA5A 2MH9A 3GFMA 2RNJA 4AWXB 1K7AA 2PJPA 4OINF 2Z33A 2G7HA 2ACJA 4FT8A 2OQRA 3BJOA 5CJ9A 4ZH4F 2UZKA 4Q47A 1FWZA 4RGRA 4HQEA 1IUYA 3LQQA 2VXZA 3WGHA 4WK8F 3KZYA 1FZPB 1V3FA 3KEQA 2PQ8A 2KIMA 1B1BA 2K86A 4BNCA 1J75A 4HA8A 4JK1X 3KP5A 2UXXA 1ZARA 3F22A 3ZMZA 3NQOA 5ERIA 3E97A 2L01A 1G3SA 3WG9A 1J7KA 1IZ1A 2HGCA 5LHHA 3ECHA 2VC0A 4EQQA 4ZYHA 2O6GE 1S3JA 5EEHA 5DCMA 1R5GA 3TGNA 4A6DA 1JE8A 2DK5A 2ZFWA 2FXAA 1KQ0A 3GZ5A 1I6XA 3DV8A 5J6XA 3F8MA 2PMUA 3I58A 3SFZA 2HWVA 1F1ZA 3GXOA 2QUFA 2BV6A 1ULYA 2CW0F 1T39A 2P4WA 4YFXF 3MCZA 2H27A 3Q9VA 3SXYA 2ZKZA 5DUIA 5D6EA 3P7NA 2MH2A 4L5IA 5CVIA 1MD0A 4L9JA 1PP7U 4MGRA 2YU3A 1SMTA 2RKHA 4KFCA 1SD5A 1QPMA 5K5RA 4EJTA 4IHSA 4B8XA 4M9XA 4LG0A 5JI6A 2FRHA 1T6SA 2M45A 3ROUA 1FBUA 3VODA 5K5OA 3ML6A 2ZO4A 2DO7A 2PI0A 2V9VA 1Z6TA 3TO9A 4JBAA 1D8JA 1MJBA 3DPTA 5HDNA 1WQ2A 4EJOA 1UHWA 4KMUX 4KYWA 4RB0A 1ON1A 3ZP5A 3T8RA 1R58A 4MTEA 2ZMEA 3OOPA 3GWZA 1WSUA 2M30A 1XSDA 3E5XA 2PG4A 3QU6A 1CF7B 1GHCA 2YX4A 4G9YA 2GXBA 1KU7A 2HKXA 2RN7A 1FYLA 2O0YA 2A69F 2VOPA 4M72A 3KETA 2EWNA 4ON0A 3F3XA 4PGHA 3W6JB 1XSXA 2PN6A 3FXRA 1R5HA 4LK1F 2AXLA 4LK0F 1YW7A 4KMFA 1TLHB 4EGZA 2DBBA 3H3ZA 1RUOA 4L0ZB 4BHCA 2CSOA 4RAYA 3R0JA 1OYWA 4ENKA 3NRVA 1MKMA 4BXUA 3F21A 4M6XA 2VODA 3TOAA 2F5FA 4XRFA 3WTSC 3T8TA 4A6EA 4XBFA 1R7JA 2XAQA 2HZTA 2CO5A 2DU9A 1O7FA 3QP5A 1XSVA 5CYVA 2IRFG 5F64A 3TOBA 2P7VB 1E17A 4ETSA 2LKPA 2XIGA 4HF2A 4I09A 5HLHA 1G3YA 1FSEA 3I0TA 4DNCA 1GXQA 3CO7C 2MC3A 4U0VA 2QENA 3GO5A 5A2QZ 3COAC 4BQAA 1HXDA 2GQQA 3WTZA 5L3GA 5HVQC 1KU2A 3TDZC 3DXJF 1OR7A 2AS5F 4UVCA 1FYMA 3KP3A 3ZPLA 3GF2A 1T98A 2QYOA 4IRIA 4M6YA 1FP2A 2X4HA 3K2ZA 1MZBA 5FFZA 5EEGA 3BPVA 3T0YA 3EYIA 1TBXA 2EFPA 1ZH5A 4MEXF 2BYVE 1SFXA 3M8EA 3LAJA 2FU4A 3EETA 1XB4A 1MDMA 4LFUA 4JQFA 1HW2A 3DP7A 1YLFA 2GIVA 4KNYA 5E1ZB 3C7JA 3CUQB 3I64A 4WXHA 5A2QK 5ILSA 2ELHA 2FBHA 1IRGA 1IXCA 1U3EM 3BJ6A 4GXOA 5AIQA 3I54A 4OMZA 4G94A 3WU1B 4OOIA 4PDKA 3E6MA 4P5OA 3GYHX 2RGVA 4XLPF 2F5DA 4OMYA 5ICEA 4U0WA 3P9CA 1STZA 3VFZA 1UFMA 3TO6A 1T0FA 2DQRA 1KQ8A 2L3DA 3ZMDA 2DW4A 1U6GA 3C18A 3SZTA 2FE3A 1KU3A 3JTGA 2ZCWA 1ZLKA 5FB2A 3DF8A 5CVJA 1LDDA 5D5XB 3IKVA 5AONA 1O3SA 1P2FA 5LGNA 2VBZA 3E6BA 3REOA 3I53A 2YX7A 4Y13A 4EM1A 4L9VA 5ED4A 1USTA 1LNWA 3IKTA 1CGPA 3MZHA 1OYIA 3CUQC 1EH6A 5FD6A 2F5EA 1FYKA 2CGPA 4ZYEA 3FM5A 1G3WA 2ESNA 3M9AA 2ZJ2A 4MNUA 1DPRA 3MEXA 2A3SA 3K69A 3H3UA 3RKWA 1RZ4A 4Z2YA 3IHUA 1DP7P 2IPQX 2JZYA 3WE3A 2HS5A 3RKYA 3VB2A 4DQ2A 1I1SA 2GZWA 2KJCA 4AIJA 1TW2A 1CF7A 2XAFA 5D5UB 2CFXA 3H92A 4GO1A 3F8CA 2FF4A 1YG2A 5D5VB 4EJWA 2QBYA 2G7UA 4EJUA 3DQVC 1ON2A 5CVVA 3WGIA 2RC4A 5DD4A 1JHHA 2CWEA 1O57A 2V1DA 5HDGA 3WTYC 3RDIA 3HOTA 1F4KA 1G6NA 1B59A 3NEUA 3DFGA 4I01A 2P5LC 1IN7A 4IF4A 1FC3A 2KRFA 2XGXA 2MLKA 3S2WA 3PQKA 2NNYA 4GCVA 2FMYA 2ZXJA 4UVBA 2FNPA 2P6SA 3BOQA 1BIBA 4PZJA 4I2OA 2STWA 4OIQF 1D8KA 1TQPA 2O61A 3E5UA 1J0RA 2NS0A 5L3DA 4BAYA 3RIRA 1BI0A 2GA2A 2VN2A 5LBQA 1P4XA 1Y0UA 1FPQA 3LQRA 4EM0B 1W7PA 3VEPA 2XKPA 1YS6A 1IAWA 2DQLA 1XDSA 1BI3A 5DDGA 1T2KA 3HRSA 3L09A 3G73A 2VC1A 3HYIA 4CGZA 3F23A 3I71A 5BPIA 3V7RA 3D5LA 3F6OA 2JPCA 1ZN2A 2O03A 1HBXG 4L9TA 2F5CA 3WE2A 4U7BA 2OAZA 1ZREA 5BQTA 2Y48A 5E8GA 4LMYA 4M9SA 1HKTA 3RJPA 1S7AA 2DTRA 2HYGD 1MGTA 2Y0MA 4EVIA 4LLLA 4ENJA 1XDUA 4HDUA 4OIOF 4RGSA 4CZZA 3G3ZA 3SHFA 4E70A 1ZLJA 4XLNF 2E1CA 5DEQA 1ZYRF 3HHGA 1O3TA 1U5TA 4EV0A 4NB5A 4EJVA 2M8EA 4I0BA 2OQGA 4UUVA 4IRHA 1P4AA 2XAJA 1KU9A 2PBIA 3MQ0A 3TO7A 5LEJA 2K27A 4S05A 1EV7A 5D8LB 3I4PA 1HSJA 1KQ9A 1BJAA 1TTYA 2P5KA 1IN8A 2HOEA 4BYYA 3GZ6A 1YS7A 2FOKA 3ZN0A 3PFIA 4N9HA 1XGOA 2HQRA 1MJ9A 2DT5A 4H0EA 5DCFA 5ICCA 1UHMA 2WTEA 1R23A 4WF2A 2XV4S 1LB2A 2YSRA 4PCQA 5IT3A 1YYVA 3JSPA 5ILUA 3M7GA 3LA2A 1K78A 4I98B 4MHGA 3V7CA 4OIPF 4CDGA 4BHPA 2Z5UA 4YIFA 1HKQA 1XD7A 2XUBA 3GW2A 1SD4A 3L7WA 4HAMA 2EV5A 3K1MA 3TKYA 4CO8A 4B09A 5DD8A 4L5JA 4IXAA 1IN4A 3LA3A 3K1PA 1KA8A 2GWRA 2R3SA 4FHTA 4HLYA 2EK5A 2UWMA 2HQNA 4NHJA 4BHBA 3CJNA 5D6FA 2W85A 3L9FA 4ZYDA 2VOOA 5L3FA 2KIFA 4ENNA 5HOOA 3I59B 4G6QA 5F6FA 2DAOA 4CICA 2Z99A 2DPDA 3LFKA 1FOKA 2P6TA 4D0PA 3WTTC 2RVCA 2CQKA 4N9IA 3KLNA 1HQCA 2OZUA 4O5VA 1S8NA 4KN4X 4RB3C 3P9IA 2COMA 1Z9CA 3RTRA 2JPBA 4ESBA 3BWGA 1ODDA 2K02A 5L3CA 1S6LA 3WTWC 1S7OA 1A04A 3WU0A 1LQ1A 2TDXA 1K6OA 1R1TA 1GXPA 1HKSA 4M73A 3M1EA 5E17F 4TV7A 2WC2A 1TNSA 3RPQA 1H9GA 1ZAOA 1BC8C 1WKMA 3BY6A 5HLIA 2F2EA 2STTA 3GVAA 5BOXA 1SD7A 2UXNA 2ESHA 4OIRF 2ZNYA 4K2EA 2XHKA 4ESJA 3HSEA 1HW1A 3E5QA 3K9TA 5E8IA 4U7DA 4HZFA 3CTAA 1LVAA 2O3FA 1ZG3A 4I0AA 3BZ6A 2IVMA 1ONVA 2W24A 3RYRA 2DFIA 4ENMA 1LEAA 4UV9A 3GFLA 2E1NA 3B73A 1XCBA 3KP6A 2XRNA 2EV0A 3JAMZ 1B4AA 4AD9A 5AIPA 3FHZA 3M8FA 5HLGA 4LLNA 1W5TA 4RS8A 4WXDA 5FGMA 4GGGA 4M74A 4Y15A 1YW8A 3ABTA 1IW7F 2XAHA 5FFXA 4WWCA 2XKOA 3IWFA 1J59A 1LEBA 3SQNA 1WWXA 2C6YA 1WI9A 2IT0A 1BM9A 3FXQA 1FBQA 2Y75A 5BPDA 3F8BA 5E1WA 1YTYA 1SFUA 4HX7A 2IA0A 2KKOA 2GXGA 2HFHA 3IWZA 2JSCA 2VE8A 3LSTA 2FSWA 5DCMB 1XN7A 4FX0A 1BOAA 5LLQA 3JAMK 4LB6B 1XMAA 5E18F 1IXRC 5LHGA 1H9TA 4HDVA 2OBPA 2HEOA 1L0OC 3O6BB 1FNNA 5JFRA 1W7PD 1QQIA 4KA4A 4OU0A 3AAFA 4R8HA 2XASA 5TRDA 2KJBA 3KE2A 2RDPA 2PFBA 3I5UA 4HF0A 3ZN1A 2HDCA 1P92A 1TQMA 3ZMVA 4AVPA 3BJAA 3D0SA 1B9MA 1BI1A 2EA2A 3FXUA 3GUDA 1ZG5A 2MD5A 1TW3A 5ICGA 3HSRA 1U8RA 5L3EA 3ELKA 4U0YA 1VTNC 1F5TA 5ICFA 4HYEA 3O3KA 2A07F 4PGGA 3B02A 2BE5F 4HOBA 3QPHA 2MLGA 4LG0B 2J5OA 3DPLC 1PDNC 2LF8A 1XGNA 4G8XA 4A0ZA 1OYYA 5LGUA 3HSFA 2MBFA 3ZMSA 2OA4A 1OPCA 4HV6A 2A6HF 4UXNA 1TQIA 2YPRA 2P7CB 4L0YB 5DYMA 1JGSA 3HRMA 4BH9A 3J7AO 3PQJA 5KK1A 2Q2EA 3HOSA 1T38A 2QLZA 2ZMEB 3C3WA 1O3RA 3JTHA 3MWMA 1OMIA 4I7HA 4CXFA 4Q48A 2ISZA 5DV5A 3RI4A 2OD5A 1O3QA 4IHTA 1J2XA 1BN5A 4KDPA 4HF1A 3IL2A 5CVUA 1XMKA 3K0LA 1BI2A 1ZGJA 4HX8A 4A5NA 2V1XA 1QNTA 4HX4A 5E20A 2IA2A 2HR3A 2FQ3A 3ISPA 3EDPA 4KT5C 2YR2A 2K4JA 4F7ZA 2H6BA 2H6CA 3CUOA 2D1VA 1B6AA 1UCRA 1J9IA 1I27A 1ZRCA 2R7FA 4LLGF 2JT1A 1FBSA 2X0LA 4NQWA 1LDJA 4EGYA 1V4RA 1W5SA 2QZ8A 3C1DA 1FY7A 1SMYF 2FBKA 2HTJA 3O2PE 1D5VA 3HRUA 1JHFA 3F6VA 4U88A 3CO6C 2PMHA 3QPTA 4HV5A 4I02A 3L00A 3KLOA 1G3TA 2D1HA 3ABUA 5D5WB 2EV6A 4P96A 4R79A 2P8TA 3E6CC 1K79A 1HW5A 5JVTA 2HTSA 1E2XA 1GVJA 1G4DA 4MTDA 1DDNA 3QAHA 2FNAA 2Z3YA 1QGPA 5D4RA 2R7DA 3HTUA 1KYWA 1IRFA 4P9UA 3CUQA 2L54A 4P55A 1I5ZA 2RQPA 1EH8A 2HYFA 3KEOA 3E6DA 4WX9A 1L3LA 5CVRA 1QZZA 3U1DA 5J8CA 3F8NA 2NYXA 1MDMB 1USSA 1FX7A 1J5YA 1U2WA 4LJZF 4EM2A 4KICA 3T5XA 3EQLF 1EH7A 5JHUA 4Q4ZF 3N4MA 4A12A 1KGSA 1RNLA 3LAPA 4IRGA 4WXCA 2Q0OA 2RV8A 3V7SA 3R61A 2WWYA 2XROA 3FM3A 4MQVA 3TQNA 1ZGAA 4N0BA 1LJ9A 2QVOA 3P9KA 1ZHFA 3WTXC 2WV0A 1Z91A 3R6SA 4A0YA 1XGSA 3EUHA 2FBIA 3JW4A 2E7WA 3BDDA 3QOPA 3RKXA 1P4WA 4GYGA 3VOEA 3BP8A 2IW5A 5HS8A 2Z9OA 1DUXC 1IXSB 2B0LA 2EB7A 5KVRA 5D8KB 5ILVA 3LWFA 2M5WA 2D45A 2VT3A 4RGUA 1R00A 4RB1A 3BROA 3LA7A 4KIBA 2J5PA 4RAZA 2QM3A 1F9NA 2ETHA 2DPUA 4CYDA 5HDKA 4YFNF 4P9FA 1YW9A 4HQMA 5HS9A 4Q5SF 1WRJA 4EMSA 1BC7C 1Q1HA 3RYPA 4YG2F 2V6CA 3R60A 3U9GA 3HRTA 1Z6RA 3FMSA 1U78A 2BBYA 2ISYA 3DEUA 2L02A 3WTUC 1RUNA 5JR3A 1UB9A 1OKRA 1AOYA 2PEXA 1ZRFA 2L4MA 2M1BA 3HUGA 3KP7A 4O3MA 5H6RA 2QBYB 4G7OF 2EFWA 5BMZA 3Q5FA 3IRQA 3ERED 2EFNA 2IP2A 2D2WA 4ESFA 3GX4X 2ADUA 5FLXZ 4LD5A 4S04A 1FLIA 4MEYF 3KCCA 1QO0D 4ASNA 1R36A 2XVCA 2Q8KA 4A2UA 1R1UA 1YO5C 4ZYGA 4CHUA 2EA4A 2EJRA 3F72A 2PLYA 3ZMUA 5HS7A 2EFQA 2NAZA 2QQAA 2ZNZA 3WODF 4KIFA 2DI3A 2OZ6A 4UVAA 2W25A 3W6KB 2P5VA 2E7XA 1BIAA 5J8FA 1PP8F 2LDUA 1R1VA 3FMQA 2IA1A 3WTVC 2FEZA 4KUMA 4YIIA 4L9NA 4YFKF 1REPC 1C0WA 3HTSB 2VE9A 4AIKA 1W7PB 5FLXK 5F1RA 4G7ZF 3FWEA 1ZG1A 3V8KA 1YIOA 1NHAA 5H20A 3E3VA 3J80Z 3FF5A 1IN5A 3GFJA 1FSHA 2IJLA 3KFWX 4KIGA 2LF7A 1BBYA 5IT9Z 1QZYA 4HW0A 4ZZDA 5LGTA 3FX3A 3CLOA 2JTVA 3MZYA 1IN6A 2GAUA 3OV8A 1IF1A 1JXSA 4A0XA 1YFHA 3L2CA 5FO5A 3R0AA 5LHIA 2MA3A 3DKWA 2VONA 4GYIA 2V79A 3KP4A 2K7LA 3R4KA 3RPUA 1HSTA 4O6JA 4M9ZA 5E1XA 4RB2C 4HLXA 1U5TB 3IC7A 2H94A 1RIOH 1PUEE 4L18B 4XSZF 5H6QA 3J80K 2V1UA 4MQ9F 1SD6A 1XCVA 4QLCU 4A5MA 3GLXA 4ZZLA 2CG4A 3IRRA 1B9NA 5FD5A 3MAJA 3V8LA 5IT9K 2VBYA 2VT2A 3FZVA 4QWQA 3K1NA 2A5YB 2BGCA 3J81Z 1Z7UA 3SZPA 3QU3A 5TJJA 2DK8A 4M71A 2OU2A 5L3BA 3FMRA 4G6DA 4KN7X 1Z05A 3F8FA 1S29A 3GEZA 5BS6A 2VBWA 2XAGA 3ULQB 2QWWA 4IJAA 5CLSA 4XSXF 3KP2A 2A68F 1FT9A 4UV8A 3T1BA 1SFEA 1KYZA 1U5TC 1XGMA 3Q9SA 3QP6A 1K78B 5D4SA 5LRRA 2HKOA 4LB5A 1DPUA 3ZQ7A 5K5QA 1MJAA 3WGGA 2NRAC 3QRFF 1R22A 4IPAA 5K1YA 3I59A 2KIUA 2BEOA 2LNBA 2A61A 1SAXA 4HBLA 2CYYA 3J81K 3CDHA 4G7HF 4LGWA 3BPXA 2M87A 4IVNA 5LRSA 3TDUC 2NNNA 2A6EF 4RGXA 3GFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O8X A;  4UHT A;  5DUK A;  2LSO A;  1W4M A;  1YQA A;  1I1G A;  6PAX A;  2EFO A;  3EYY A;  4Y17 A;  2VBX A;  2K4B A;  3V4G A;  3HIF A;  2FML A;  4WCG A;  2W84 A;  3HHH A;  5LEK A;  4FX4 A;  1ZRD A;  2G9W A;  3N97 A;  1TNT A;  2H09 A;  2DLL A;  4AIH A;  2GA1 A;  3KZZ A;  2QQB A;  2W57 A;  1D3Y A;  1RI7 A;  3ZMT A;  3V8J A;  1LDK B;  2JRT A;  1H0M A;  1FP1 D;  1O7L A;  4R1H A;  3JSO A;  3ECO A;  3MFK A;  1P6R A;  1QBJ A;  2ZBK A;  4UNO A;  1X3U A;  2QQ9 A;  1AWC A;  1Z1D A;  2L4A A;  3U2R A;  2FA5 A;  2MH9 A;  3GFM A;  2RNJ A;  4AWX B;  1K7A A;  2PJP A;  4OIN F;  2Z33 A;  2G7H A;  2ACJ A;  4FT8 A;  2OQR A;  3BJO A;  5CJ9 A;  4ZH4 F;  2UZK A;  4Q47 A;  1FWZ A;  4RGR A;  4HQE A;  1IUY A;  3LQQ A;  2VXZ A;  3WGH A;  4WK8 F;  3KZY A;  1FZP B;  1V3F A;  3KEQ A;  2PQ8 A;  2KIM A;  1B1B A;  2K86 A;  4BNC A;  1J75 A;  4HA8 A;  4JK1 X;  3KP5 A;  2UXX A;  1ZAR A;  3F22 A;  3ZMZ A;  3NQO A;  5ERI A;  3E97 A;  2L01 A;  1G3S A;  3WG9 A;  1J7K A;  1IZ1 A;  2HGC A;  5LHH A;  3ECH A;  2VC0 A;  4EQQ A;  4ZYH A;  2O6G E;  1S3J A;  5EEH A;  5DCM A;  1R5G A;  3TGN A;  4A6D A;  1JE8 A;  2DK5 A;  2ZFW A;  2FXA A;  1KQ0 A;  3GZ5 A;  1I6X A;  3DV8 A;  5J6X A;  3F8M A;  2PMU A;  3I58 A;  3SFZ A;  2HWV A;  1F1Z A;  3GXO A;  2QUF A;  2BV6 A;  1ULY A;  2CW0 F;  1T39 A;  2P4W A;  4YFX F;  3MCZ A;  2H27 A;  3Q9V A;  3SXY A;  2ZKZ A;  5DUI A;  5D6E A;  3P7N A;  2MH2 A;  4L5I A;  5CVI A;  1MD0 A;  4L9J A;  1PP7 U;  4MGR A;  2YU3 A;  1SMT A;  2RKH A;  4KFC A;  1SD5 A;  1QPM A;  5K5R A;  4EJT A;  4IHS A;  4B8X A;  4M9X A;  4LG0 A;  5JI6 A;  2FRH A;  1T6S A;  2M45 A;  3ROU A;  1FBU A;  3VOD A;  5K5O A;  3ML6 A;  2ZO4 A;  2DO7 A;  2PI0 A;  2V9V A;  1Z6T A;  3TO9 A;  4JBA A;  1D8J A;  1MJB A;  3DPT A;  5HDN A;  1WQ2 A;  4EJO A;  1UHW A;  4KMU X;  4KYW A;  4RB0 A;  1ON1 A;  3ZP5 A;  3T8R A;  1R58 A;  4MTE A;  2ZME A;  3OOP A;  3GWZ A;  1WSU A;  2M30 A;  1XSD A;  3E5X A;  2PG4 A;  3QU6 A;  1CF7 B;  1GHC A;  2YX4 A;  4G9Y A;  2GXB A;  1KU7 A;  2HKX A;  2RN7 A;  1FYL A;  2O0Y A;  2A69 F;  2VOP A;  4M72 A;  3KET A;  2EWN A;  4ON0 A;  3F3X A;  4PGH A;  3W6J B;  1XSX A;  2PN6 A;  3FXR A;  1R5H A;  4LK1 F;  2AXL A;  4LK0 F;  1YW7 A;  4KMF A;  1TLH B;  4EGZ A;  2DBB A;  3H3Z A;  1RUO A;  4L0Z B;  4BHC A;  2CSO A;  4RAY A;  3R0J A;  1OYW A;  4ENK A;  3NRV A;  1MKM A;  4BXU A;  3F21 A;  4M6X A;  2VOD A;  3TOA A;  2F5F A;  4XRF A;  3WTS C;  3T8T A;  4A6E A;  4XBF A;  1R7J A;  2XAQ A;  2HZT A;  2CO5 A;  2DU9 A;  1O7F A;  3QP5 A;  1XSV A;  5CYV A;  2IRF G;  5F64 A;  3TOB A;  2P7V B;  1E17 A;  4ETS A;  2LKP A;  2XIG A;  4HF2 A;  4I09 A;  5HLH A;  1G3Y A;  1FSE A;  3I0T A;  4DNC A;  1GXQ A;  3CO7 C;  2MC3 A;  4U0V A;  2QEN A;  3GO5 A;  5A2Q Z;  3COA C;  4BQA A;  1HXD A;  2GQQ A;  3WTZ A;  5L3G A;  5HVQ C;  1KU2 A;  3TDZ C;  3DXJ F;  1OR7 A;  2AS5 F;  4UVC A;  1FYM A;  3KP3 A;  3ZPL A;  3GF2 A;  1T98 A;  2QYO A;  4IRI A;  4M6Y A;  1FP2 A;  2X4H A;  3K2Z A;  1MZB A;  5FFZ A;  5EEG A;  3BPV A;  3T0Y A;  3EYI A;  1TBX A;  2EFP A;  1ZH5 A;  4MEX F;  2BYV E;  1SFX A;  3M8E A;  3LAJ A;  2FU4 A;  3EET A;  1XB4 A;  1MDM A;  4LFU A;  4JQF A;  1HW2 A;  3DP7 A;  1YLF A;  2GIV A;  4KNY A;  5E1Z B;  3C7J A;  3CUQ B;  3I64 A;  4WXH A;  5A2Q K;  5ILS A;  2ELH A;  2FBH A;  1IRG A;  1IXC A;  1U3E M;  3BJ6 A;  4GXO A;  5AIQ A;  3I54 A;  4OMZ A;  4G94 A;  3WU1 B;  4OOI A;  4PDK A;  3E6M A;  4P5O A;  3GYH X;  2RGV A;  4XLP F;  2F5D A;  4OMY A;  5ICE A;  4U0W A;  3P9C A;  1STZ A;  3VFZ A;  1UFM A;  3TO6 A;  1T0F A;  2DQR A;  1KQ8 A;  2L3D A;  3ZMD A;  2DW4 A;  1U6G A;  3C18 A;  3SZT A;  2FE3 A;  1KU3 A;  3JTG A;  2ZCW A;  1ZLK A;  5FB2 A;  3DF8 A;  5CVJ A;  1LDD A;  5D5X B;  3IKV A;  5AON A;  1O3S A;  1P2F A;  5LGN A;  2VBZ A;  3E6B A;  3REO A;  3I53 A;  2YX7 A;  4Y13 A;  4EM1 A;  4L9V A;  5ED4 A;  1UST A;  1LNW A;  3IKT A;  1CGP A;  3MZH A;  1OYI A;  3CUQ C;  1EH6 A;  5FD6 A;  2F5E A;  1FYK A;  2CGP A;  4ZYE A;  3FM5 A;  1G3W A;  2ESN A;  3M9A A;  2ZJ2 A;  4MNU A;  1DPR A;  3MEX A;  2A3S A;  3K69 A;  3H3U A;  3RKW A;  1RZ4 A;  4Z2Y A;  3IHU A;  1DP7 P;  2IPQ X;  2JZY A;  3WE3 A;  2HS5 A;  3RKY A;  3VB2 A;  4DQ2 A;  1I1S A;  2GZW A;  2KJC A;  4AIJ A;  1TW2 A;  1CF7 A;  2XAF A;  5D5U B;  2CFX A;  3H92 A;  4GO1 A;  3F8C A;  2FF4 A;  1YG2 A;  5D5V B;  4EJW A;  2QBY A;  2G7U A;  4EJU A;  3DQV C;  1ON2 A;  5CVV A;  3WGI A;  2RC4 A;  5DD4 A;  1JHH A;  2CWE A;  1O57 A;  2V1D A;  5HDG A;  3WTY C;  3RDI A;  3HOT A;  1F4K A;  1G6N A;  1B59 A;  3NEU A;  3DFG A;  4I01 A;  2P5L C;  1IN7 A;  4IF4 A;  1FC3 A;  2KRF A;  2XGX A;  2MLK A;  3S2W A;  3PQK A;  2NNY A;  4GCV A;  2FMY A;  2ZXJ A;  4UVB A;  2FNP A;  2P6S A;  3BOQ A;  1BIB A;  4PZJ A;  4I2O A;  2STW A;  4OIQ F;  1D8K A;  1TQP A;  2O61 A;  3E5U A;  1J0R A;  2NS0 A;  5L3D A;  4BAY A;  3RIR A;  1BI0 A;  2GA2 A;  2VN2 A;  5LBQ A;  1P4X A;  1Y0U A;  1FPQ A;  3LQR A;  4EM0 B;  1W7P A;  3VEP A;  2XKP A;  1YS6 A;  1IAW A;  2DQL A;  1XDS A;  1BI3 A;  5DDG A;  1T2K A;  3HRS A;  3L09 A;  3G73 A;  2VC1 A;  3HYI A;  4CGZ A;  3F23 A;  3I71 A;  5BPI A;  3V7R A;  3D5L A;  3F6O A;  2JPC A;  1ZN2 A;  2O03 A;  1HBX G;  4L9T A;  2F5C A;  3WE2 A;  4U7B A;  2OAZ A;  1ZRE A;  5BQT A;  2Y48 A;  5E8G A;  4LMY A;  4M9S A;  1HKT A;  3RJP A;  1S7A A;  2DTR A;  2HYG D;  1MGT A;  2Y0M A;  4EVI A;  4LLL A;  4ENJ A;  1XDU A;  4HDU A;  4OIO F;  4RGS A;  4CZZ A;  3G3Z A;  3SHF A;  4E70 A;  1ZLJ A;  4XLN F;  2E1C A;  5DEQ A;  1ZYR F;  3HHG A;  1O3T A;  1U5T A;  4EV0 A;  4NB5 A;  4EJV A;  2M8E A;  4I0B A;  2OQG A;  4UUV A;  4IRH A;  1P4A A;  2XAJ A;  1KU9 A;  2PBI A;  3MQ0 A;  3TO7 A;  5LEJ A;  2K27 A;  4S05 A;  1EV7 A;  5D8L B;  3I4P A;  1HSJ A;  1KQ9 A;  1BJA A;  1TTY A;  2P5K A;  1IN8 A;  2HOE A;  4BYY A;  3GZ6 A;  1YS7 A;  2FOK A;  3ZN0 A;  3PFI A;  4N9H A;  1XGO A;  2HQR A;  1MJ9 A;  2DT5 A;  4H0E A;  5DCF A;  5ICC A;  1UHM A;  2WTE A;  1R23 A;  4WF2 A;  2XV4 S;  1LB2 A;  2YSR A;  4PCQ A;  5IT3 A;  1YYV A;  3JSP A;  5ILU A;  3M7G A;  3LA2 A;  1K78 A;  4I98 B;  4MHG A;  3V7C A;  4OIP F;  4CDG A;  4BHP A;  2Z5U A;  4YIF A;  1HKQ A;  1XD7 A;  2XUB A;  3GW2 A;  1SD4 A;  3L7W A;  4HAM A;  2EV5 A;  3K1M A;  3TKY A;  4CO8 A;  4B09 A;  5DD8 A;  4L5J A;  4IXA A;  1IN4 A;  3LA3 A;  3K1P A;  1KA8 A;  2GWR A;  2R3S A;  4FHT A;  4HLY A;  2EK5 A;  2UWM A;  2HQN A;  4NHJ A;  4BHB A;  3CJN A;  5D6F A;  2W85 A;  3L9F A;  4ZYD A;  2VOO A;  5L3F A;  2KIF A;  4ENN A;  5HOO A;  3I59 B;  4G6Q A;  5F6F A;  2DAO A;  4CIC A;  2Z99 A;  2DPD A;  3LFK A;  1FOK A;  2P6T A;  4D0P A;  3WTT C;  2RVC A;  2CQK A;  4N9I A;  3KLN A;  1HQC A;  2OZU A;  4O5V A;  1S8N A;  4KN4 X;  4RB3 C;  3P9I A;  2COM A;  1Z9C A;  3RTR A;  2JPB A;  4ESB A;  3BWG A;  1ODD A;  2K02 A;  5L3C A;  1S6L A;  3WTW C;  1S7O A;  1A04 A;  3WU0 A;  1LQ1 A;  2TDX A;  1K6O A;  1R1T A;  1GXP A;  1HKS A;  4M73 A;  3M1E A;  5E17 F;  4TV7 A;  2WC2 A;  1TNS A;  3RPQ A;  1H9G A;  1ZAO A;  1BC8 C;  1WKM A;  3BY6 A;  5HLI A;  2F2E A;  2STT A;  3GVA A;  5BOX A;  1SD7 A;  2UXN A;  2ESH A;  4OIR F;  2ZNY A;  4K2E A;  2XHK A;  4ESJ A;  3HSE A;  1HW1 A;  3E5Q A;  3K9T A;  5E8I A;  4U7D A;  4HZF A;  3CTA A;  1LVA A;  2O3F A;  1ZG3 A;  4I0A A;  3BZ6 A;  2IVM A;  1ONV A;  2W24 A;  3RYR A;  2DFI A;  4ENM A;  1LEA A;  4UV9 A;  3GFL A;  2E1N A;  3B73 A;  1XCB A;  3KP6 A;  2XRN A;  2EV0 A;  3JAM Z;  1B4A A;  4AD9 A;  5AIP A;  3FHZ A;  3M8F A;  5HLG A;  4LLN A;  1W5T A;  4RS8 A;  4WXD A;  5FGM A;  4GGG A;  4M74 A;  4Y15 A;  1YW8 A;  3ABT A;  1IW7 F;  2XAH A;  5FFX A;  4WWC A;  2XKO A;  3IWF A;  1J59 A;  1LEB A;  3SQN A;  1WWX A;  2C6Y A;  1WI9 A;  2IT0 A;  1BM9 A;  3FXQ A;  1FBQ A;  2Y75 A;  5BPD A;  3F8B A;  5E1W A;  1YTY A;  1SFU A;  4HX7 A;  2IA0 A;  2KKO A;  2GXG A;  2HFH A;  3IWZ A;  2JSC A;  2VE8 A;  3LST A;  2FSW A;  5DCM B;  1XN7 A;  4FX0 A;  1BOA A;  5LLQ A;  3JAM K;  4LB6 B;  1XMA A;  5E18 F;  1IXR C;  5LHG A;  1H9T A;  4HDV A;  2OBP A;  2HEO A;  1L0O C;  3O6B B;  1FNN A;  5JFR A;  1W7P D;  1QQI A;  4KA4 A;  4OU0 A;  3AAF A;  4R8H A;  2XAS A;  5TRD A;  2KJB A;  3KE2 A;  2RDP A;  2PFB A;  3I5U A;  4HF0 A;  3ZN1 A;  2HDC A;  1P92 A;  1TQM A;  3ZMV A;  4AVP A;  3BJA A;  3D0S A;  1B9M A;  1BI1 A;  2EA2 A;  3FXU A;  3GUD A;  1ZG5 A;  2MD5 A;  1TW3 A;  5ICG A;  3HSR A;  1U8R A;  5L3E A;  3ELK A;  4U0Y A;  1VTN C;  1F5T A;  5ICF A;  4HYE A;  3O3K A;  2A07 F;  4PGG A;  3B02 A;  2BE5 F;  4HOB A;  3QPH A;  2MLG A;  4LG0 B;  2J5O A;  3DPL C;  1PDN C;  2LF8 A;  1XGN A;  4G8X A;  4A0Z A;  1OYY A;  5LGU A;  3HSF A;  2MBF A;  3ZMS A;  2OA4 A;  1OPC A;  4HV6 A;  2A6H F;  4UXN A;  1TQI A;  2YPR A;  2P7C B;  4L0Y B;  5DYM A;  1JGS A;  3HRM A;  4BH9 A;  3J7A O;  3PQJ A;  5KK1 A;  2Q2E A;  3HOS A;  1T38 A;  2QLZ A;  2ZME B;  3C3W A;  1O3R A;  3JTH A;  3MWM A;  1OMI A;  4I7H A;  4CXF A;  4Q48 A;  2ISZ A;  5DV5 A;  3RI4 A;  2OD5 A;  1O3Q A;  4IHT A;  1J2X A;  1BN5 A;  4KDP A;  4HF1 A;  3IL2 A;  5CVU A;  1XMK A;  3K0L A;  1BI2 A;  1ZGJ A;  4HX8 A;  4A5N A;  2V1X A;  1QNT A;  4HX4 A;  5E20 A;  2IA2 A;  2HR3 A;  2FQ3 A;  3ISP A;  3EDP A;  4KT5 C;  2YR2 A;  2K4J A;  4F7Z A;  2H6B A;  2H6C A;  3CUO A;  2D1V A;  1B6A A;  1UCR A;  1J9I A;  1I27 A;  1ZRC A;  2R7F A;  4LLG F;  2JT1 A;  1FBS A;  2X0L A;  4NQW A;  1LDJ A;  4EGY A;  1V4R A;  1W5S A;  2QZ8 A;  3C1D A;  1FY7 A;  1SMY F;  2FBK A;  2HTJ A;  3O2P E;  1D5V A;  3HRU A;  1JHF A;  3F6V A;  4U88 A;  3CO6 C;  2PMH A;  3QPT A;  4HV5 A;  4I02 A;  3L00 A;  3KLO A;  1G3T A;  2D1H A;  3ABU A;  5D5W B;  2EV6 A;  4P96 A;  4R79 A;  2P8T A;  3E6C C;  1K79 A;  1HW5 A;  5JVT A;  2HTS A;  1E2X A;  1GVJ A;  1G4D A;  4MTD A;  1DDN A;  3QAH A;  2FNA A;  2Z3Y A;  1QGP A;  5D4R A;  2R7D A;  3HTU A;  1KYW A;  1IRF A;  4P9U A;  3CUQ A;  2L54 A;  4P55 A;  1I5Z A;  2RQP A;  1EH8 A;  2HYF A;  3KEO A;  3E6D A;  4WX9 A;  1L3L A;  5CVR A;  1QZZ A;  3U1D A;  5J8C A;  3F8N A;  2NYX A;  1MDM B;  1USS A;  1FX7 A;  1J5Y A;  1U2W A;  4LJZ F;  4EM2 A;  4KIC A;  3T5X A;  3EQL F;  1EH7 A;  5JHU A;  4Q4Z F;  3N4M A;  4A12 A;  1KGS A;  1RNL A;  3LAP A;  4IRG A;  4WXC A;  2Q0O A;  2RV8 A;  3V7S A;  3R61 A;  2WWY A;  2XRO A;  3FM3 A;  4MQV A;  3TQN A;  1ZGA A;  4N0B A;  1LJ9 A;  2QVO A;  3P9K A;  1ZHF A;  3WTX C;  2WV0 A;  1Z91 A;  3R6S A;  4A0Y A;  1XGS A;  3EUH A;  2FBI A;  3JW4 A;  2E7W A;  3BDD A;  3QOP A;  3RKX A;  1P4W A;  4GYG A;  3VOE A;  3BP8 A;  2IW5 A;  5HS8 A;  2Z9O A;  1DUX C;  1IXS B;  2B0L A;  2EB7 A;  5KVR A;  5D8K B;  5ILV A;  3LWF A;  2M5W A;  2D45 A;  2VT3 A;  4RGU A;  1R00 A;  4RB1 A;  3BRO A;  3LA7 A;  4KIB A;  2J5P A;  4RAZ A;  2QM3 A;  1F9N A;  2ETH A;  2DPU A;  4CYD A;  5HDK A;  4YFN F;  4P9F A;  1YW9 A;  4HQM A;  5HS9 A;  4Q5S F;  1WRJ A;  4EMS A;  1BC7 C;  1Q1H A;  3RYP A;  4YG2 F;  2V6C A;  3R60 A;  3U9G A;  3HRT A;  1Z6R A;  3FMS A;  1U78 A;  2BBY A;  2ISY A;  3DEU A;  2L02 A;  3WTU C;  1RUN A;  5JR3 A;  1UB9 A;  1OKR A;  1AOY A;  2PEX A;  1ZRF A;  2L4M A;  2M1B A;  3HUG A;  3KP7 A;  4O3M A;  5H6R A;  2QBY B;  4G7O F;  2EFW A;  5BMZ A;  3Q5F A;  3IRQ A;  3ERE D;  2EFN A;  2IP2 A;  2D2W A;  4ESF A;  3GX4 X;  2ADU A;  5FLX Z;  4LD5 A;  4S04 A;  1FLI A;  4MEY F;  3KCC A;  1QO0 D;  4ASN A;  1R36 A;  2XVC A;  2Q8K A;  4A2U A;  1R1U A;  1YO5 C;  4ZYG A;  4CHU A;  2EA4 A;  2EJR A;  3F72 A;  2PLY A;  3ZMU A;  5HS7 A;  2EFQ A;  2NAZ A;  2QQA A;  2ZNZ A;  3WOD F;  4KIF A;  2DI3 A;  2OZ6 A;  4UVA A;  2W25 A;  3W6K B;  2P5V A;  2E7X A;  1BIA A;  5J8F A;  1PP8 F;  2LDU A;  1R1V A;  3FMQ A;  2IA1 A;  3WTV C;  2FEZ A;  4KUM A;  4YII A;  4L9N A;  4YFK F;  1REP C;  1C0W A;  3HTS B;  2VE9 A;  4AIK A;  1W7P B;  5FLX K;  5F1R A;  4G7Z F;  3FWE A;  1ZG1 A;  3V8K A;  1YIO A;  1NHA A;  5H20 A;  3E3V A;  3J80 Z;  3FF5 A;  1IN5 A;  3GFJ A;  1FSH A;  2IJL A;  3KFW X;  4KIG A;  2LF7 A;  1BBY A;  5IT9 Z;  1QZY A;  4HW0 A;  4ZZD A;  5LGT A;  3FX3 A;  3CLO A;  2JTV A;  3MZY A;  1IN6 A;  2GAU A;  3OV8 A;  1IF1 A;  1JXS A;  4A0X A;  1YFH A;  3L2C A;  5FO5 A;  3R0A A;  5LHI A;  2MA3 A;  3DKW A;  2VON A;  4GYI A;  2V79 A;  3KP4 A;  2K7L A;  3R4K A;  3RPU A;  1HST A;  4O6J A;  4M9Z A;  5E1X A;  4RB2 C;  4HLX A;  1U5T B;  3IC7 A;  2H94 A;  1RIO H;  1PUE E;  4L18 B;  4XSZ F;  5H6Q A;  3J80 K;  2V1U A;  4MQ9 F;  1SD6 A;  1XCV A;  4QLC U;  4A5M A;  3GLX A;  4ZZL A;  2CG4 A;  3IRR A;  1B9N A;  5FD5 A;  3MAJ A;  3V8L A;  5IT9 K;  2VBY A;  2VT2 A;  3FZV A;  4QWQ A;  3K1N A;  2A5Y B;  2BGC A;  3J81 Z;  1Z7U A;  3SZP A;  3QU3 A;  5TJJ A;  2DK8 A;  4M71 A;  2OU2 A;  5L3B A;  3FMR A;  4G6D A;  4KN7 X;  1Z05 A;  3F8F A;  1S29 A;  3GEZ A;  5BS6 A;  2VBW A;  2XAG A;  3ULQ B;  2QWW A;  4IJA A;  5CLS A;  4XSX F;  3KP2 A;  2A68 F;  1FT9 A;  4UV8 A;  3T1B A;  1SFE A;  1KYZ A;  1U5T C;  1XGM A;  3Q9S A;  3QP6 A;  1K78 B;  5D4S A;  5LRR A;  2HKO A;  4LB5 A;  1DPU A;  3ZQ7 A;  5K5Q A;  1MJA A;  3WGG A;  2NRA C;  3QRF F;  1R22 A;  4IPA A;  5K1Y A;  3I59 A;  2KIU A;  2BEO A;  2LNB A;  2A61 A;  1SAX A;  4HBL A;  2CYY A;  3J81 K;  3CDH A;  4G7H F;  4LGW A;  3BPX A;  2M87 A;  4IVN A;  5LRS A;  3TDU C;  2NNN A;  2A6E F;  4RGX A;  3GFI A; 
#chains in the Genus database with same CATH topology
 2O8X A;  4UHT A;  1YJW I;  5DUK A;  1E3H A;  4A3L J;  2LSO A;  4Y3O A;  1W4M A;  3OYA A;  2F48 A;  1YQA A;  3ZGK A;  1I1G A;  4KJZ A;  6PAX A;  2EFO A;  3K4J A;  5DTD A;  1FEX A;  3EYY A;  4Y17 A;  1PVE A;  2VBX A;  2O7O A;  1X58 A;  2K4B A;  3H36 A;  3K70 C;  4BE2 A;  3V4G A;  3HIF A;  2JUG A;  4ZC3 A;  2VB6 A;  2FML A;  3BR1 A;  4WCG A;  4MO7 A;  1BL0 A;  3HEF A;  2W84 A;  3K70 D;  3HHH A;  5LEK A;  4FX4 A;  1ZRD A;  3CDI A;  4CYC A;  1S72 I;  2G9W A;  4B43 A;  3N97 A;  5C4X J;  1TNT A;  2H09 A;  2DLL A;  4AIH A;  2GA1 A;  3KZZ A;  2QQB A;  2W57 A;  4E7S A;  1D3Y A;  1RI7 A;  3JRE A;  1JT0 A;  2JA2 A;  3ZMT A;  3ZXS A;  3K4K A;  3V8J A;  1Q1V A;  1LDK B;  2JRT A;  1H0M A;  1FP1 D;  2EIM H;  4XRS G;  1O7L A;  4R1H A;  3JSO A;  2LRD A;  3ZQQ A;  3ECO A;  1VQ5 I;  4N4N B;  1Z77 A;  3HJE A;  5EG0 A;  4YIR X;  5IPA A;  1MBG A;  2K9Q A;  3CDL A;  3CCL I;  1GVD A;  4W97 A;  3M8J A;  3MFK A;  1P6R A;  2DYS H;  2ZBK A;  1QBJ A;  3ZQL A;  1OIS A;  1X3U A;  5E3N A;  4UNO A;  2QQ9 A;  3DKY A;  1AWC A;  1Z1D A;  2L4A A;  3U2R A;  2R5Z B;  2FA5 A;  2MH9 A;  4XOP A;  2VPR A;  3DLA A;  5K7H A;  2EBI A;  3GFM A;  2RNJ A;  4AWX B;  1K7A A;  2PJP A;  2DMN A;  1AKH A;  4BS9 A;  4OIN F;  3DTE A;  2Z33 A;  2G7H A;  4JX5 A;  3SYT A;  3UR3 C;  2ACJ A;  3CES A;  2OQR A;  3BJO A;  4FT8 A;  5CJ9 A;  4ZH4 F;  4Q47 A;  2UZK A;  3CCR I;  1E0E A;  1FWZ A;  1G2H A;  2A05 A;  2OF7 A;  3W2W A;  1A6I A;  4RGR A;  4HQE A;  3CJR B;  1IUY A;  2HVR A;  2DOE A;  2E19 A;  3LQQ A;  2VXZ A;  3WGH A;  4XL9 A;  4XLC A;  4OAZ A;  4WK8 F;  3I3L A;  3KZY A;  3CJT B;  1FZP B;  5M5Y J;  3H5R A;  4HG2 A;  2B7E A;  2CFO A;  1V3F A;  4OAY A;  1T33 A;  3GTJ J;  1YX5 A;  4M3B A;  3KEQ A;  1D0X A;  2WY8 Q;  4ZDP A;  1NK2 P;  2PQ8 A;  2KIM A;  3G71 I;  4BAC A;  1B1B A;  2K86 A;  5J1U A;  4BNC A;  2RNG A;  3NWT A;  4HA8 A;  1J75 A;  1EJ9 A;  4JK1 X;  2K9L A;  3SFI A;  2MW8 A;  3ZOB A;  3KP5 A;  5IP9 J;  2UXX A;  3ABL H;  4CCN A;  5HLT A;  1MH3 A;  1ZAR A;  3CQZ J;  3F22 A;  3HKZ A;  3ZMZ A;  3NQO A;  3MZ8 A;  1JKR C;  4B3X A;  4XID A;  5ERI A;  3FXL A;  2QKM B;  3E97 A;  2L01 A;  1Z0X A;  3A0B C;  1PUF B;  1G3S A;  2ID3 A;  4NDL A;  2DA2 A;  3WG9 A;  1J7K A;  3F9K A;  2XF7 A;  1IZ1 A;  1MND A;  2HGC A;  5LHH A;  3ECH A;  4UB8 C;  2VC0 A;  4EQQ A;  2R0Q C;  4ZYH A;  2OJE D;  2O6G E;  1S3J A;  5EEH A;  5DCM A;  2NS7 A;  1R5G A;  3ZQG A;  2KDZ A;  3CCY A;  3TGN A;  4A6D A;  1JE8 A;  2DK5 A;  2Y9Y A;  2ZFW A;  2FXA A;  2HOT A;  1KQ0 A;  2QCO A;  3GZ5 A;  1I6X A;  3LNQ A;  3DV8 A;  1LFB A;  3BLY A;  4I76 A;  1Y39 A;  3H9J A;  5J6X A;  3F8M A;  2PMU A;  3I58 A;  3PUB A;  1IRZ A;  3SFZ A;  2HWV A;  1BJZ A;  1F1Z A;  3GXO A;  2QUF A;  2BV6 A;  1ULY A;  2CW0 F;  3TW6 A;  4J19 A;  1T39 A;  2P4W A;  2CUE A;  4YFX F;  5CQG A;  3MCZ A;  2H27 A;  3DLL F;  3Q9V A;  3PO2 J;  3SXY A;  2ZKZ A;  1R6R A;  3UNG C;  5DUI A;  2ZB9 A;  3QOE A;  5D6E A;  3P7N A;  1ETX A;  3D5R C;  2MH2 A;  4L5I A;  3K4C A;  1JT6 A;  4BGD A;  5CVI A;  4XNF A;  1X1C A;  1MD0 A;  4IOA F;  2PMZ N;  4L9J A;  2DA3 A;  1PP7 U;  3H1C A;  4MGR A;  3HG9 A;  5EZH A;  1WJC A;  2YU3 A;  3LFU A;  4A3B J;  2DA1 A;  3AG2 H;  2R7Z J;  4IEJ A;  1LVK A;  1SMT A;  1MBH A;  2RKH A;  2CQ7 A;  2BW3 A;  4KFC A;  3W2A A;  1SD5 A;  4NC8 A;  5KHD A;  1QPM A;  5K5R A;  4EJT A;  1Y8R B;  4IHS A;  4B8X A;  1ETW A;  4W1U A;  4XN3 A;  1GV5 A;  2VKV A;  5B66 C;  4M9X A;  4HST A;  4LG0 A;  5JI6 A;  2FRH A;  5JHF A;  1T6S A;  2M45 A;  4BY1 J;  1WH7 A;  3ROU A;  4BEH A;  1FBU A;  3VOD A;  5K5O A;  3HOX J;  2E2J J;  2GXA A;  3ML6 A;  1POG A;  2ZO4 A;  2DO7 A;  1GT0 C;  4BE1 A;  3CMM A;  2V9V A;  1Z6T A;  3TO9 A;  2PI0 A;  4JBA A;  1D8J A;  1MJB A;  4XOT A;  4EEF G;  2O5R A;  3DPT A;  2DYR H;  1P7J A;  5J47 A;  1IG7 A;  2KPM A;  3TMO A;  1LFP A;  2L0K A;  5HDN A;  1WQ2 A;  1HOM A;  3HXL A;  4EJO A;  2F5V A;  1UHW A;  4KMU X;  4KYW A;  4RB0 A;  3BR0 A;  3FK6 A;  1ON1 A;  4XRS A;  1H89 C;  3ZP5 A;  1HCR A;  3T8R A;  4RM3 A;  1R58 A;  4MTE A;  2ZME A;  5JLX A;  3OOP A;  3GWZ A;  3WHC A;  5HOD A;  3TP0 A;  1UHS A;  2WAE A;  3RPU D;  1WSU A;  2M30 A;  2MYS A;  1XSD A;  4XLF A;  4C2T A;  1TWG J;  3MKW B;  3E5X A;  5CQE A;  3QOD A;  2BY0 A;  2PG4 A;  5B5E C;  3QU6 A;  2R7V A;  1CF7 B;  1GHC A;  2YX4 A;  4G9Y A;  1IUF A;  3S93 A;  2GXB A;  5HNF A;  3OY9 A;  1KU7 A;  3VDX A;  3BC8 A;  1OCO H;  2HKX A;  3LSJ A;  1TWA J;  3H5A A;  3ZQI A;  2RN7 A;  1FYL A;  2WV1 A;  2O0Y A;  4A93 J;  1AHD P;  2A69 F;  2VOP A;  4JP0 A;  2KIS A;  2JRM A;  4M72 A;  2KRC A;  5GTH C;  3VSK A;  3MKY B;  2VKH A;  4ZTJ A;  2P81 A;  3KET A;  2EWN A;  1XMX A;  4ON0 A;  2CJJ A;  2JQ7 A;  3ONQ A;  3F3X A;  4PGH A;  3FHN A;  1XSX A;  3W6J B;  2PN6 A;  3FXR A;  1VQ7 I;  1R5H A;  4LK1 F;  2AXL A;  4AYB N;  5FKO A;  4LK0 F;  1YW7 A;  2Y0S A;  1TLH B;  5JLW A;  3W6V A;  4KMF A;  2OCC H;  2BZT A;  4EGZ A;  2DBB A;  3H3Z A;  3I9V 2;  2L7F P;  1RUO A;  4L0Z B;  1X1P A;  4BHC A;  1T95 A;  2K5C A;  4X0G A;  2X48 A;  2CSO A;  4RAY A;  1JJ6 C;  3R0J A;  1OYW A;  3OYD A;  4XKB A;  4ENK A;  4B1R A;  1SEU A;  3NRV A;  1MKM A;  3KIO A;  4BXU A;  3F21 A;  2M3A A;  3S17 J;  9ANT A;  4M6X A;  2VOD A;  3TOA A;  2F5F A;  4XRF A;  3WTS C;  1X2N A;  3T8T A;  4A6E A;  4ZDO A;  4XBF A;  1R7J A;  2XAQ A;  2HZT A;  2CS3 A;  2CO5 A;  2DU9 A;  1O7F A;  3FDY A;  4RDU A;  2ME0 A;  3FKJ A;  2HXO A;  3I56 I;  2R5Z A;  4GRI A;  1HA8 A;  3QP5 A;  2JA5 J;  1XSV A;  3FIW A;  3C2H A;  1D1B A;  5CYV A;  2HDW A;  5IOZ A;  1FIA A;  2X6X A;  3S1R J;  2IRF G;  3KYC B;  5F64 A;  3TOB A;  2P7V B;  3DU6 A;  2VUM J;  1E17 A;  2W4S A;  4ETS A;  2LKP A;  2XIG A;  4HF2 A;  4I09 A;  5HLH A;  2LH9 A;  2JA7 J;  1G3Y A;  1FSE A;  3FBN B;  3I0T A;  2YU9 J;  1N25 A;  4DNC A;  3BZK A;  2LKX A;  1GXQ A;  5HNH A;  1GDT A;  3S1N J;  2UV1 A;  3CO7 C;  1U9O A;  2MC3 A;  2H8W A;  1SVM A;  3DCF A;  2EZH A;  4U0V A;  2QEN A;  3MVP A;  3GO5 A;  5A2Q Z;  2XSD C;  1G59 A;  3COA C;  3OOU A;  4BQA A;  2V4J C;  1HXD A;  2GQQ A;  4NQW B;  4AM3 A;  3WTZ A;  5L3G A;  2ECB A;  5HVQ C;  1KU2 A;  3TDZ C;  3DXJ F;  1OR7 A;  2AS5 F;  4UVC A;  1FYM A;  3KP3 A;  3ZPL A;  3CP8 A;  3GTQ J;  3GF2 A;  1T98 A;  2QYO A;  4IRI A;  3GCM A;  4M6Y A;  4PFP A;  1FP2 A;  1FOX A;  2X4H A;  3SEQ A;  3K2Z A;  1MZB A;  2HI3 A;  5FFZ A;  4D7N A;  1D1A A;  3JRA A;  3OYE A;  5EEG A;  1Y56 A;  2R7Q A;  3BPV A;  3PNY A;  3T0Y A;  4CCK A;  1VQ8 I;  3EYI A;  1MMA A;  1TBX A;  1OQY A;  2EFP A;  4MEX F;  1ZH5 A;  1MSF C;  3RSN A;  2BYV E;  1SFX A;  3M8E A;  3LAJ A;  2FU4 A;  1RKT A;  1PJR A;  3EET A;  3SDB A;  3CCU I;  4YEL A;  1P7I A;  2R7W A;  1XB4 A;  1MDM A;  3ABM H;  4LFU A;  3UKG A;  4JQF A;  1HW2 A;  3DP7 A;  3GLL A;  5EGO B;  2LLK A;  2NVU B;  1FTT A;  1YLF A;  2GIV A;  2OC6 A;  5LD2 C;  2BHZ A;  4IZZ A;  3LMM A;  4KNY A;  1DP3 A;  5E1Z B;  3C7J A;  2X9D A;  3CUQ B;  3I64 A;  4WXH A;  5A2Q K;  2DOA A;  5ILS A;  4RMN A;  2ELH A;  2FBH A;  2HOA A;  3QQA A;  1IRG A;  1SVO A;  1IXC A;  2CH0 A;  3JRB A;  3BJ6 A;  1U3E M;  4YRV A;  3S14 J;  4GXO A;  2VLA A;  5AIQ A;  3I54 A;  4OMZ A;  1IV6 A;  2R4G A;  4G94 A;  5E3O A;  4HRI A;  3WU1 B;  2CMP A;  3LOC A;  5F0F A;  1V5E A;  4OOI A;  5DM7 F;  4PDK A;  1X4P A;  3E6M A;  4P5O A;  3GYH X;  2RGV A;  3AFH A;  4XLP F;  2F5D A;  4OMY A;  1YIT I;  5ICE A;  4U0W A;  4XN0 A;  3P9C A;  1QHG A;  1STZ A;  2L7K A;  3VFZ A;  1UFM A;  4QPQ A;  2DTZ A;  4XIC A;  1QVU A;  3TO6 A;  1B8I A;  1VQ9 I;  1T0F A;  4XRM A;  2DQR A;  4UY8 I;  1KQ8 A;  1LE8 A;  2L3D A;  3ZMD A;  2DW4 A;  2KZV A;  1U6G A;  3BQZ A;  2LMD A;  3C18 A;  3SZT A;  1NG6 A;  2FE3 A;  1KU3 A;  5DM6 F;  3GTK J;  3JTG A;  3GTP J;  2WB1 A;  2ZCW A;  1ZLK A;  5FB2 A;  3DF8 A;  5CVJ A;  1OCR H;  1LDD A;  2LVS A;  2F4M B;  5D5X B;  3IKV A;  4DGW B;  1WJB A;  4M3F A;  5AON A;  1P2F A;  2IGO A;  1O3S A;  4C3I J;  2XB0 X;  3OMY A;  4B4C A;  2ZC2 A;  3CF5 F;  5LGN A;  2XRL A;  2VBZ A;  3E6B A;  3REO A;  2Y9Z A;  3I53 A;  4IOC F;  3O8G A;  2KQR A;  2YX7 A;  4Y13 A;  4EM1 A;  4L9V A;  3OWT A;  5KAF C;  5ED4 A;  1UST A;  3G1M A;  3ZR8 X;  4EAT A;  5M5W J;  1LNW A;  3IKT A;  1CGP A;  3MZH A;  1OYI A;  2DFH A;  3CUQ C;  1EH6 A;  5FD6 A;  2HVS A;  2BOL A;  1VZ0 A;  2F5E A;  1FYK A;  2CGP A;  4ZYE A;  2VL8 A;  2R5Y B;  2XB5 A;  3FM5 A;  1ZGW A;  1G3W A;  4XQF A;  3CC4 I;  3ASO H;  2ESN A;  3M9A A;  2X1C A;  2K3P A;  2ZJ2 A;  4MNU A;  1DPR A;  3MEX A;  1WJA A;  2VPL A;  5M5X J;  3JRG A;  2A3S A;  3K69 A;  2CQQ A;  5KNL A;  4DZP A;  2IGN A;  3IP4 B;  2HPM A;  1ZTR A;  3H3U A;  3RKW A;  5J40 A;  2HYJ A;  4V2G A;  2VKD A;  1RZ4 A;  2L9S A;  4C30 A;  4Z2Y A;  3BG9 A;  3IHU A;  1DP7 P;  2IPQ X;  2DCE A;  2JZY A;  3WE3 A;  2HS5 A;  3RKY A;  3VB2 A;  4DQ2 A;  2K9N A;  1I1S A;  2GZW A;  2KJC A;  4AIJ A;  1TW2 A;  1CF7 A;  2YS9 A;  2XAF A;  4CCJ A;  2K9S A;  5B1B H;  5D5U B;  2CFX A;  3H92 A;  3M1C A;  3CF2 A;  3U21 A;  4GO1 A;  2BY3 A;  2V26 A;  1EF4 A;  3OYH A;  1IRX A;  3HGG A;  4B44 A;  3B6C A;  1GV2 A;  2QSF X;  2QSH X;  3S2D J;  2JMW A;  2JN6 A;  3F8C A;  5GP9 A;  1WJ5 A;  4QIW N;  2IS6 A;  2FF4 A;  1YG2 A;  3OYK A;  4CCL A;  5D5V B;  4EJW A;  2QBY A;  2G7U A;  1LFU P;  2DFF A;  2H1K A;  1HC8 A;  4EJU A;  3DQV C;  2R92 J;  2JJ7 A;  1ON2 A;  4RLF A;  3CZ6 A;  5CVV A;  1ORK A;  3WGI A;  4XLA A;  3MKL A;  2LBF B;  3EUH C;  1TWH J;  2LYC A;  2M0C A;  3TW7 A;  2EZL A;  2RC4 A;  5DD4 A;  1JHH A;  2CWE A;  1O57 A;  2V1D A;  1VND A;  1VF9 A;  1U0J A;  1XX5 A;  2GIZ A;  5HDG A;  3WTY C;  1TP4 A;  3RDI A;  3OS1 A;  2OV7 A;  1BA5 A;  1P9Q C;  3HOT A;  1F4K A;  2W1O A;  4RBO A;  3HUG B;  3MMY B;  3S3N A;  1MBE A;  1VQ6 I;  4HEA 2;  1R4N B;  4PJM A;  1G6N A;  1B59 A;  1Z67 A;  1DGR M;  3NEU A;  3DFG A;  1LPQ A;  1R9T J;  4I01 A;  4RM2 A;  3N05 A;  3H0D A;  2P5L C;  3GZN B;  2EIL H;  1IN7 A;  4IF4 A;  2VI6 A;  3S3M A;  1FC3 A;  3HZJ A;  3DEW A;  1TZL A;  4PK4 A;  2KRF A;  2D5V A;  2XGX A;  2MLK A;  3S2W A;  3PQK A;  2NNY A;  2CUF A;  4GCV A;  2FMY A;  2ZXJ A;  4BUP A;  4UVB A;  1I39 A;  1WCM J;  1OLT A;  2FNP A;  4DYC A;  3CCJ I;  2P6S A;  3BOQ A;  3DTI A;  1JKO C;  1BIB A;  4PZJ A;  4BL0 B;  2MGQ A;  3NWS A;  4E7K A;  1VQM I;  4I2O A;  2STW A;  4OIQ F;  1D8K A;  4FCY A;  1TQP A;  2ZME C;  2OTJ I;  2JA6 J;  2O61 A;  5E3L A;  3E5U A;  1J0R A;  2NS0 A;  5L3D A;  4BAY A;  3RIR A;  3M07 A;  2L2O A;  1BI0 A;  2GA2 A;  2VN2 A;  3DBR B;  5LBQ A;  1P4X A;  3ZRG A;  1Y0U A;  2Y31 A;  1FPQ A;  3I4N J;  3LQR A;  4EM0 B;  5EZG A;  2XPW A;  1W7P A;  3FBI B;  2XKP A;  3VEP A;  1YS6 A;  1IAW A;  4Y33 A;  4I6Z A;  2DQL A;  4GFB A;  1XDS A;  1BI3 A;  3MN2 A;  5DDG A;  1EA3 A;  1T2K A;  3C2B A;  2M0M A;  2V7F A;  3HRS A;  3L09 A;  4A3I J;  4PUS A;  2GM4 A;  2GLO A;  3G73 A;  2VC1 A;  2BVL A;  3TED A;  3HYI A;  2DMQ A;  2M4G A;  3OYB A;  4CGZ A;  4Y7N J;  1X1D A;  3BG3 A;  3F23 A;  4JYK A;  3KYL A;  1YX3 A;  2E1O A;  3I71 A;  5BPI A;  3QYF A;  3V7R A;  3D5L A;  3F6O A;  5CPR B;  2JPC A;  2BY1 A;  1ZN2 A;  3K4L A;  4X6A J;  2NVX J;  2O03 A;  2GOX B;  1HBX G;  1JUS A;  4L9T A;  2K40 A;  2F5C A;  1RET A;  4GDF A;  3WE2 A;  2HU9 A;  4AID A;  2OAZ A;  4U7B A;  2DDB A;  3FKI J;  1ZRE A;  5BQT A;  2Y48 A;  5E8G A;  4B47 A;  3VYS B;  4LMY A;  4M9S A;  4BQO A;  3RJP A;  1HKT A;  1S7A A;  2DTR A;  3S1M J;  3WHB A;  2HYG D;  1MGT A;  2JWT A;  2Y0M A;  4EVI A;  5KAI C;  4LLL A;  3KYD B;  4ENJ A;  1XDU A;  2QEX I;  4HDU A;  5F04 A;  4OIO F;  3OYN A;  1W0U A;  4A3C J;  4RGS A;  4CZZ A;  1HLV A;  1XC5 A;  2NVT J;  3A4C A;  2V1N A;  3G3Z A;  3SHF A;  3KEY A;  4S0H B;  4E70 A;  2V9K A;  1ZLJ A;  3MKZ A;  2W82 A;  4XLN F;  3BR2 A;  4JX4 A;  3D1N I;  1A6Q A;  3IAS 2;  1K83 J;  2E1C A;  5DEQ A;  1Y6I A;  1HDD C;  2X6O A;  1ZYR F;  4FET A;  3HHG A;  1WJD A;  1O3T A;  1U5T A;  1WFX A;  1RKW A;  4EV0 A;  2E5Z A;  4NB5 A;  3F0C A;  4EJV A;  2M8E A;  4I0B A;  2OQG A;  4UUV A;  4IRH A;  3BCA A;  1P4A A;  4CCO A;  2XAJ A;  2E2I J;  4A3J J;  1UG2 A;  1KU9 A;  2PBI A;  2M9H A;  3MQ0 A;  3TO7 A;  2LP0 A;  2DA7 A;  3PM1 A;  5LEJ A;  2HXI A;  2W48 A;  4HNV A;  1ZK8 A;  2K27 A;  1FMV A;  1R5I D;  4S05 A;  1EV7 A;  4L5E A;  3HOU J;  5D8L B;  3I4P A;  1X3Z B;  2HVQ A;  2K85 A;  5J4Y A;  2JSP A;  4QTR A;  1HSJ A;  1N75 A;  4FE4 A;  4F93 B;  1KQ9 A;  3FXK A;  1BJA A;  1TTY A;  2P5K A;  3HOY J;  2VQC A;  2L5Q A;  3P5J A;  4BE0 A;  1IN8 A;  2Z16 A;  2HOE A;  4KIT B;  3CCE I;  1MW7 A;  3A2K A;  1JUM A;  4BJT A;  2Y30 A;  4BYY A;  3HB9 A;  2LC2 A;  3GZ6 A;  1YS7 A;  3BTC A;  3CMY A;  4RAG A;  2M4K A;  2FOK A;  3ZN0 A;  3DBL B;  5IYC J;  4CCM A;  3S3O A;  1M1E B;  3OL4 A;  3PFI A;  4A3M J;  1ZKG A;  5GAH J;  1W5C C;  4N9H A;  1XGO A;  2HQR A;  1MJ9 A;  1ERD A;  2DT5 A;  4G12 A;  4H0E A;  4LIU A;  5DCF A;  5ICC A;  1UHM A;  2WTE A;  1R23 A;  3AG4 H;  5J1Y A;  2KP6 A;  1U9N A;  1WGX A;  3K7A J;  2CV1 A;  1OCT C;  1ENH A;  5IP7 J;  4WF2 A;  4M3E A;  4FAS D;  1QPI A;  2XV4 S;  5DS9 A;  5EF6 A;  2YSR A;  4PCQ A;  1LB2 A;  5IT3 A;  1YYV A;  4CUG A;  3JSP A;  2DOF A;  5ILU A;  3CD6 I;  4Y52 J;  1ITY A;  3HC7 A;  3E0J B;  3M7G A;  1S9H A;  3LA2 A;  1OCZ H;  1K78 A;  4A3D J;  4I98 B;  1ETQ A;  4MHG A;  3V7C A;  4OIP F;  4CDG A;  1D0Y A;  1MMN A;  1YRN B;  4BHP A;  2Z5U A;  2B9S A;  4YIF A;  4F52 A;  1OCP A;  2DXI A;  1HKQ A;  1XD7 A;  2XUB A;  3GW2 A;  4RAF A;  2DT6 A;  1A5J A;  1SD4 A;  3L7W A;  4HAM A;  3O8H A;  1YJ9 I;  4D7M A;  2EV5 A;  5FKN A;  3BG6 A;  3K1M A;  3TKY A;  4CO8 A;  4DYR A;  3OS0 A;  2FX0 A;  4B09 A;  2E5N A;  5DD8 A;  2DOD A;  4L5J A;  3ZMS A;  4IXA A;  1IN4 A;  3LA3 A;  3K1P A;  1SAN A;  4BDY A;  4D9J A;  1ETY A;  1KA8 A;  2GWR A;  2F6C A;  2R3S A;  3PSI A;  4FHT A;  4HLY A;  2EK5 A;  2UWM A;  1B72 B;  3IUO A;  2HQN A;  4NHJ A;  4BHB A;  1WVR A;  3QPS A;  3CJN A;  2XGD A;  4A3K J;  5D6F A;  2W85 A;  3L9F A;  3NAU A;  4ZYD A;  2ELJ A;  1WPK A;  2VOO A;  2OCE A;  4XKW A;  5L3F A;  2KIF A;  4ENN A;  1FJL A;  5HOO A;  3I59 B;  2Q2E B;  4H4K C;  4G6Q A;  2ID6 A;  2X51 A;  2DAO A;  3E7L A;  5F6F A;  2GBY A;  3OYL A;  4CIC A;  2Z99 A;  2E2H J;  2DPD A;  1DU0 A;  5F1J A;  3GTL J;  2OUM A;  3LFK A;  1FOK A;  2P6T A;  4D0P A;  3WTT C;  4IX7 A;  2HDD A;  1T0F C;  2RVC A;  2CQK A;  4N9I A;  4M3D A;  2WA0 A;  3KLN A;  1HQC A;  2UUZ A;  2OZU A;  2JUC A;  1ZEL A;  5FRN A;  1Y8Q B;  2AQF A;  3BQY A;  1UEL B;  3H5N A;  4FTH A;  4O5V A;  1S8N A;  4KN4 X;  4RB3 C;  2DJI A;  3P9I A;  3H35 A;  2COM A;  1Z9C A;  3RTR A;  2JPB A;  4ESB A;  4U87 A;  4J00 A;  3BWG A;  1ODD A;  2X1E A;  4IL6 C;  3GME A;  1YI2 I;  3WOD F;  2K02 A;  4PJJ A;  2R93 J;  3ESW B;  3Q0V A;  2NVY J;  5L3C A;  2EPF A;  1S6L A;  2TRT A;  3A01 B;  3WTW C;  2Q1Z B;  2CW8 A;  4ZDL A;  1MMG A;  2WY7 Q;  2AHQ A;  3DWL E;  1S7O A;  1RC9 A;  2R7T A;  1A04 A;  3WU0 A;  2KRH A;  2JK3 A;  5EJC A;  1LQ1 A;  1CQT A;  1DGW Y;  4CA0 A;  2TDX A;  1MBF A;  1K6O A;  1R1T A;  1GXP A;  1WJE A;  1HKS A;  3JR9 A;  4M73 A;  2K3F A;  3G6E I;  4CYC B;  3CMA I;  2EZK A;  2H1L A;  3M1E A;  3PJR A;  5E17 F;  4TV7 A;  3LSG A;  2WC2 A;  2CUZ A;  1TNS A;  3RPQ A;  1H9G A;  3HOW J;  3OIQ A;  1ZAO A;  1BC8 C;  2R7U A;  1WKM A;  3BY6 A;  5HLI A;  2F4O B;  2F2E A;  2STT A;  3G4S I;  5FKL A;  3GVA A;  4BXF A;  5BOX A;  2IXS A;  1SD7 A;  3PO3 J;  2UXN A;  2I5U A;  2ESH A;  4OIR F;  5FKK A;  3PIO F;  2ZNY A;  4K2E A;  5F27 A;  2XHK A;  3FXM A;  3AG1 H;  3HKZ N;  1HW1 A;  3E5Q A;  3HSE A;  3K9T A;  4ESJ A;  1TC3 C;  2VIX A;  5JVG F;  1X4O A;  2A5W A;  3K10 A;  5E8I A;  4U7D A;  2LG4 A;  4HZF A;  2AO9 A;  1H88 C;  3CTA A;  1LVA A;  3LSH A;  2O3F A;  1ZG3 A;  4I0A A;  5FKM A;  3BZ6 A;  2IVM A;  3OYF A;  1TWF J;  5FLM J;  1ONV A;  2W24 A;  3RYR A;  4MLO A;  3U1K A;  2DFI A;  4ENM A;  1LEA A;  1ETV A;  4UV9 A;  3GFL A;  1VQO I;  4C2U A;  2E1N A;  3K2A A;  3B73 A;  1XCB A;  3PNT A;  1FOY A;  1AKH B;  3KP6 A;  2XRN A;  1DQU A;  2EV0 A;  3JAM Z;  1X1A A;  1B4A A;  5F08 A;  3PFY A;  4AD9 A;  5AIP A;  1IO2 A;  3FHZ A;  2BHY A;  3M8F A;  2BXZ A;  1OJL A;  1AA7 A;  5HLG A;  1W5T A;  4LLN A;  3CLQ A;  4RS8 A;  1PUF A;  5IYB J;  4WXD A;  5FGM A;  3S8P A;  4GGG A;  2ZSH B;  4IKF A;  1G8X A;  3DTK A;  1MSE C;  2R7X A;  4M74 A;  4Y15 A;  1YW8 A;  3ABT A;  1IW7 F;  2XAH A;  2XPV A;  5FFX A;  4MFD A;  2QA4 I;  4IO9 F;  4II2 A;  3AKZ A;  5M3M J;  4WWC A;  2XKO A;  2KDO A;  3IWF A;  2IBD A;  1J59 A;  1LEB A;  4E4H A;  3SQN A;  2VJI A;  2GOM A;  2ZJP F;  1WWX A;  2C6Y A;  3GTG J;  1WI9 A;  2IT0 A;  2DN0 A;  5EYR A;  4PJ0 C;  1BM9 A;  2M7B A;  2QQ8 A;  1UAA A;  3FXQ A;  4NC6 A;  4E7H A;  1FBQ A;  2Y75 A;  4PSX A;  4UUS B;  1XPX A;  5BPD A;  3F8B A;  2WAF A;  2ZJR F;  5E1W A;  1YTY A;  1SFU A;  4HX7 A;  3EPZ A;  2IA0 A;  2KKO A;  1LKX A;  2GXG A;  2XF6 A;  1ACI A;  1JJ8 C;  2HFH A;  3IWZ A;  1KZH A;  2JSC A;  3MD2 A;  2VE8 A;  1HF0 A;  3LST A;  2FSW A;  5DCM B;  1XN7 A;  4FX0 A;  1I3A A;  1BOA A;  1JGG A;  5LLQ A;  3TBI A;  4XKV A;  3JAM K;  4LB6 B;  1XMA A;  5E18 F;  2XPU A;  1IXR C;  3DU5 A;  3EUA A;  5LHG A;  1H9T A;  4HDV A;  2OBP A;  3BR5 A;  2HEO A;  1L0O C;  4ANJ A;  3AL0 C;  1Y1W J;  2E34 A;  3O6B B;  2ZXH A;  3VYU B;  4AU7 A;  1FNN A;  1Y0N A;  4LIV A;  2MD0 A;  2WBM A;  5JFR A;  3LSM A;  1W7P D;  1QQI A;  3PSF A;  2E35 A;  2XDV A;  3OYM A;  4ABZ A;  3OL3 A;  4KA4 A;  4XK4 A;  2M34 A;  4OU0 A;  4D1Q A;  4C3J J;  5FJ8 J;  5EEA A;  2DA5 A;  3AAF A;  4R8H A;  2R7S A;  2XAS A;  3BTI A;  2XAU A;  2NOJ B;  5TRD A;  2KJB A;  3KE2 A;  2RDP A;  2PFB A;  3I5U A;  4HF0 A;  3ZN1 A;  2HDC A;  4HNU A;  2IS2 A;  3BG5 A;  1P92 A;  1TQM A;  3ZMV A;  4AVP A;  1X19 A;  3BJA A;  3D0S A;  2M7A A;  4E7L A;  1B9M A;  4NUB A;  3PUF A;  1BI1 A;  2EA2 A;  3V42 A;  1ZR4 A;  3FXU A;  3IV5 A;  3GUD A;  1ZG5 A;  2MD5 A;  1YRN A;  1TW3 A;  5ICG A;  4B3A A;  2VAS A;  1TT5 B;  3HSR A;  3RQI A;  1U8R A;  1K61 A;  5J4V A;  5L3E A;  5C4J J;  3ELK A;  4U0Y A;  4MIM A;  4ZTF A;  2BW3 B;  1GUU A;  1VTN C;  1IC8 A;  5ICF A;  1F5T A;  5H2F C;  4HYE A;  3O3K A;  2A07 F;  2YUS A;  4PGG A;  3B02 A;  2BE5 F;  4HOB A;  3QPH A;  3NAR A;  2MLG A;  4LG0 B;  3CCQ I;  2J5O A;  5IYD J;  3DPL C;  1E3O C;  1PDN C;  2QSG X;  4BEH B;  2LF8 A;  1ETO A;  1XGN A;  1W1W E;  4G8X A;  3PL8 A;  4A0Z A;  1RPW A;  1U8B A;  2Y0S N;  4PJN A;  3PIP F;  1OYY A;  2MG4 A;  3RQ4 A;  5LGU A;  3HPG A;  3HSF A;  1K6Y A;  1V55 H;  2MBF A;  2OA4 A;  1OPC A;  4M3G A;  5BNG A;  2LY2 A;  4HV6 A;  2A6H F;  4UXN A;  1TQI A;  2FJ1 A;  3KPH A;  2YPR A;  2P7C B;  4X1E A;  4L0Y B;  5DYM A;  1JGS A;  3HRM A;  4IHY A;  4BH9 A;  5K7F A;  3J7A O;  3PQJ A;  5KK1 A;  2Q2E A;  3HOS A;  1TT0 A;  1N78 A;  1T38 A;  1VFC A;  3K4B A;  3DBH B;  2QLZ A;  1BR4 A;  2XF5 A;  2ZME B;  2Z2S B;  1UG0 A;  1V54 H;  3L2U A;  3BZC A;  2EIN H;  2WAQ A;  3GBG A;  1YOV B;  2O8K A;  1IV8 A;  2VJ5 A;  3JRI A;  3C3W A;  3OYG A;  3RZD J;  2E1M C;  1O3R A;  3JTH A;  3MWM A;  1OMI A;  3CJQ B;  4I7H A;  3TP3 A;  4CXF A;  4Q48 A;  2ISZ A;  3CP2 A;  2F4I A;  1Z7L A;  5DV5 A;  3RI4 A;  3RCO A;  2OD5 A;  3ZCO A;  1O3Q A;  2WAD A;  4IHT A;  1MBK A;  1VQK I;  1J2X A;  2VJJ A;  1BN5 A;  3QWL A;  4KDP A;  4HF1 A;  2V9P A;  3BR6 A;  3IL2 A;  3VYR B;  3IH2 A;  3HM5 A;  5CVU A;  2CUJ A;  3D5S C;  3HGY A;  4HPQ A;  3A01 A;  4D5F A;  1XMK A;  4BY7 J;  3K0L A;  3L2Q A;  1BI2 A;  2V6E A;  1IDZ A;  1ZGJ A;  2LY1 A;  4HX8 A;  4A5N A;  3TL4 X;  1F43 A;  1ZR2 A;  2V1X A;  1QNT A;  1BR1 A;  3M3Y J;  4FE7 A;  4HX4 A;  5E20 A;  1JUP A;  2IA2 A;  2PX9 A;  2HR3 A;  3I55 I;  1VQN I;  5TIS C;  3OS2 A;  1D1C A;  1KON A;  2FQ3 A;  3ISP A;  3EDP A;  4HSR A;  4KT5 C;  4XM3 A;  5F0C A;  2YR2 A;  2K4J A;  3H3V K;  3SZG A;  1YHQ I;  4F7Z A;  1JTY A;  2E36 A;  4IHX A;  2H6B A;  2H6C A;  1IJW C;  3CUO A;  4XOR A;  2D1V A;  3FK7 A;  5B1A H;  4DIQ A;  2XGC A;  1MNM C;  1B6A A;  1R71 A;  3WG7 H;  1UCR A;  1TL8 A;  1J9I A;  5TGT A;  4V2F A;  2E60 A;  1I27 A;  1ZRC A;  2R7O A;  2R7F A;  4LLG F;  2W7N A;  2JT1 A;  4BBS J;  1FBS A;  2X0L A;  4NQW A;  4AYB A;  1LDJ A;  2PJR B;  4UUT A;  4AUX A;  5GAE J;  4EGY A;  4IHW A;  3PNV A;  1H8A C;  1W0T A;  1V4R A;  1W5S A;  2QZ8 A;  4LIT A;  3C1D A;  1FY7 A;  2VQL A;  5FRO A;  1SMY F;  2FBK A;  2HTJ A;  3O2P E;  1D5V A;  1I3Q J;  1MIJ A;  3HRU A;  1DU6 A;  3GTM J;  3OSG A;  1JHF A;  4YEJ A;  3F6V A;  4FIS A;  4U88 A;  3CO6 C;  2LOO A;  2PMH A;  3QPT A;  4DZJ A;  3CCS I;  5EDN A;  4HV5 A;  4I02 A;  3L00 A;  1UZC A;  3KLO A;  1G3T A;  2D1H A;  3ABU A;  5B3S H;  5D5W B;  2EV6 A;  4P96 A;  1V5F A;  2IS1 A;  4R79 A;  2P8T A;  2O9L A;  2COB A;  3E6C C;  1EKE A;  1K79 A;  1HW5 A;  4OWR B;  5JVT A;  4BDZ A;  3SEZ A;  2HZD A;  2HTS A;  2KMU A;  3X2Q H;  1E2X A;  1GVJ A;  4HNT A;  1G4D A;  1MMS A;  2OTL I;  2CW7 A;  2NOG A;  4MTD A;  1DDN A;  3QAH A;  2FNA A;  2Z3Y A;  4BJ5 C;  3L2V A;  1QGP A;  5F0H A;  5EGO A;  2NXN B;  5D4R A;  3A02 A;  2R7D A;  4XON A;  3HTU A;  1KYW A;  3K4N A;  1IRF A;  4P9U A;  3BCB A;  4UUS A;  4A3F J;  2LFB A;  3S32 A;  3CUQ A;  2L54 A;  2RAE A;  2ZFU A;  4P55 A;  5FLV A;  1I5Z A;  2LD5 A;  2RQP A;  1EH8 A;  1F36 A;  2L7Z A;  2HYF A;  4LG3 A;  2CQX A;  2WB1 N;  2ELK A;  2HNH A;  3KEO A;  3E6D A;  1BR2 A;  4WX9 A;  1L3L A;  5CVR A;  2QF7 A;  1NK3 P;  1QZZ A;  3U1D A;  1SVL A;  5J8C A;  3F8N A;  3L2W A;  1FIP A;  2NYX A;  4DYQ A;  2LTP A;  2AXT C;  1MDM B;  4PFO A;  3RKQ A;  1USS A;  1FX7 A;  4NBQ A;  2XSJ C;  5KCM A;  2M8G X;  1J5Y A;  2KT0 A;  1U2W A;  2JVH A;  3ERM A;  4LJZ F;  4EM2 A;  4KIC A;  4FQG A;  1Y1V J;  1MMD A;  2I10 A;  2LK2 A;  3T5X A;  3H0G J;  3EQL F;  3M4O J;  4F55 A;  1EH7 A;  4PJL A;  5JHU A;  4Q4Z F;  3N4M A;  4A12 A;  4BU2 A;  5K7Z A;  3OYJ A;  2DMP A;  4N4O B;  1KGS A;  1RNL A;  3CC7 I;  3JCU C;  2RQQ A;  3LAP A;  4IRG A;  2HOS A;  4WXC A;  2Q0O A;  2RV8 A;  3LSP A;  1I50 J;  3V7S A;  3RZO J;  3R61 A;  1GLN A;  1UMQ A;  2WWY A;  2XRO A;  1OR7 C;  5LFA A;  3Q3S A;  1BW5 A;  3FM3 A;  2HQA A;  4LOC A;  2KZG A;  4MQV A;  4Z6Y A;  3TQN A;  1ZGA A;  4DOZ A;  2FUG 2;  1V5G A;  1K4S A;  2LRE A;  4N0B A;  4NNJ A;  1LJ9 A;  3A0H C;  2QVO A;  1X2M A;  3P9K A;  1ZHF A;  1MNE A;  4II3 A;  2WV0 A;  1Z91 A;  3WTX C;  3R6S A;  4A0Y A;  1XGS A;  2KLO A;  3EUH A;  2FBI A;  1FMW A;  3JW4 A;  1B8I B;  2E7W A;  2B63 J;  1LE8 B;  2VQG A;  3BDD A;  3QOP A;  3RKX A;  2R5Y A;  1P4W A;  4GYG A;  3VYT B;  3VOE A;  4A3E J;  3BP8 A;  2IW5 A;  1BW6 A;  4KIS A;  5HS8 A;  2KL4 A;  1D5Y A;  2Z9O A;  3AG3 H;  1DUX C;  1IXS B;  2B0L A;  2EB7 A;  5KVR A;  2EQR A;  1JI8 A;  1X3W B;  3B6A A;  4IHV A;  3K4M A;  5D8K B;  2L9R A;  2A6T A;  5ILV A;  2WAQ N;  3LWF A;  1LUJ B;  2M5W A;  2D45 A;  2VT3 A;  3K6G A;  2BXY A;  4RGU A;  2LR8 A;  2EH3 A;  4MFE A;  1WJF A;  3FXJ A;  4QSH A;  1A31 A;  2JA8 J;  4XR6 A;  2Z1D A;  1NTC A;  1R00 A;  4RB1 A;  2NS8 A;  3BRO A;  3LA7 A;  2K9M A;  3Q0W A;  3OYC A;  4IQJ A;  2RRE A;  4DJA A;  5C3E J;  4KIB A;  4CSW A;  2J5P A;  2VJ4 A;  4RAZ A;  2QM3 A;  5C44 J;  3CME I;  1F9N A;  3ABK H;  2ETH A;  2DPU A;  4A3G J;  1Z3Y A;  2N8G A;  4E7Z A;  4CYD A;  5HDK A;  4E7I A;  4YFN F;  2MFZ A;  4P9F A;  1YW9 A;  4ZJZ A;  4HQM A;  5HS9 A;  4Q5S F;  1WRJ A;  4EMS A;  1RR7 A;  2EZI A;  1BC7 C;  5J3L A;  3JRH A;  3LSK A;  1Q1H A;  3RYP A;  4XKC A;  4YG2 F;  2V6C A;  4XMY A;  2EIJ H;  3R60 A;  3U9G A;  3HRT A;  1Z6R A;  3FMS A;  1U78 A;  2LBF A;  1QZE A;  2BBY A;  2ISY A;  2QKL B;  2L9N A;  3DKX A;  3DEU A;  2L02 A;  3KX2 A;  1QRY A;  3WTU C;  1RUN A;  3S15 J;  1FTZ A;  5GAG J;  5JR3 A;  1UB9 A;  2M2E A;  1QA6 A;  1OKR A;  3OSF A;  1AOY A;  2PEX A;  2X1D A;  1ZRF A;  4AVZ A;  1Z3X A;  2L4M A;  2P0W A;  3OIP A;  2M1B A;  2MC4 A;  3HUG A;  3KP7 A;  4O3M A;  5H6R A;  2HPI A;  2QBY B;  4G7O F;  2EFW A;  4Y4R A;  5BMZ A;  3BTJ A;  3Q5F A;  5FRM A;  3IRQ A;  3ERE D;  1I6H J;  1QHH D;  2EFN A;  2AQE A;  2DMT A;  2OPT A;  2IP2 A;  2D2W A;  3FXO A;  4A69 C;  4ESF A;  3GX4 X;  2ADU A;  5FLX Z;  4LD5 A;  3BR3 A;  5GTI C;  4S04 A;  3L1P A;  4E7J A;  3QYB A;  1FLI A;  3S16 J;  2XGE A;  4P1W A;  4MEY F;  2LY9 A;  1YE9 A;  4DBQ A;  1QVT A;  4BQN A;  4DW6 A;  3KCC A;  5E79 C;  2ZXW H;  1QO0 D;  4ASN A;  1R36 A;  3E1S A;  3JRF A;  2XVC A;  1VQP I;  2Q8K A;  3BG7 A;  1A35 A;  1MBJ A;  1J09 A;  3H9G A;  2ME6 A;  1S5L C;  1R1U A;  4A2U A;  1YO5 C;  3HDD A;  4ZYG A;  1NH3 A;  3HOZ J;  4BQQ A;  1XS9 A;  1IDY A;  3GTO J;  4AC0 A;  4C2M J;  3OR1 C;  4CHU A;  2EA4 A;  3EUK L;  2EJR A;  5J1R A;  1N77 A;  2ZXI A;  3F72 A;  1WZ2 A;  2PLY A;  1RES A;  1OCC H;  1T08 B;  2I8D A;  5HS7 A;  3ZMU A;  3I4M J;  2IAI A;  1E3P A;  2EFQ A;  2NAZ A;  2QQA A;  2ZNZ A;  4G6T B;  2CU7 A;  2DI3 A;  2X6Y A;  2OZ6 A;  2VQH A;  4KIF A;  3LL7 A;  4UVA A;  5GPA A;  2DMU A;  2PJR A;  2W25 A;  3W6K B;  5EG0 B;  2P5V A;  2LKS A;  2E7X A;  1BIA A;  5J8F A;  4RLQ A;  1NG7 A;  2FQ4 A;  2LDU A;  3IH4 A;  1PP8 F;  2KFD A;  3HOV J;  1R1V A;  3FMQ A;  3J7Y J;  2IGM A;  2IGK A;  2NVQ J;  3J7A Y;  3H9Q A;  2ZJQ F;  2BVM A;  2Y69 H;  3LSI A;  2IA1 A;  3WTV C;  1PYV A;  2E71 A;  4J01 A;  3DPU A;  1JKP C;  2H8R A;  2FEZ A;  4KUM A;  5GAD J;  4YII A;  3OR2 C;  4L9N A;  1SFO J;  4YFK F;  4XLH A;  2ECC A;  1REP C;  3AL0 B;  1C0W A;  2VKE A;  3HTS B;  2VE9 A;  4AIK A;  1W7P B;  3W3C A;  2BY2 A;  5FLX K;  5F1R A;  3FWE A;  4G7Z F;  1ZQ3 P;  1ZG1 A;  3V8K A;  1YIO A;  1NHA A;  5H20 A;  4IQ4 A;  3E3V A;  3J80 Z;  2KHM A;  3FF5 A;  3HPH A;  1IN5 A;  1UJ8 A;  3GFJ A;  2DFE A;  1FSH A;  2G0E A;  2IJL A;  1JTX A;  2ICW G;  3KFW X;  3VWB A;  1WHU A;  4KIG A;  2LF7 A;  3C2G A;  1BBY A;  5IT9 Z;  1QZY A;  1Z21 A;  3IH3 A;  4HW0 A;  4ZZD A;  1VQ4 I;  3BT9 A;  2JVG A;  1A36 A;  3S1Q J;  2ZSI B;  4BJ6 C;  1YJN I;  2L7M P;  5LGT A;  3FX3 A;  3IAM 2;  4CH7 A;  3CLO A;  3ZQF A;  1MH4 A;  3W2V A;  1T8I A;  1APL C;  2JTV A;  3MZY A;  2TCT A;  1QU3 A;  1IN6 A;  2GAU A;  3OV8 A;  3QYE A;  1IF1 A;  1JXS A;  1D0Z A;  2X6W A;  3OIO A;  4A0X A;  2W00 A;  4C9Y A;  3FIS A;  3L2C A;  1YFH A;  2CV0 A;  3VPR A;  5FO5 A;  3R0A A;  4B48 A;  2R7R A;  5LHI A;  2VXD A;  4F3Q A;  2MA3 A;  3DKW A;  1YIJ I;  2VON A;  3HL2 A;  4GYI A;  1ETK A;  2V79 A;  3KP4 A;  2K7L A;  4CZC A;  3R4K A;  3RPU A;  1K4T A;  3G1O A;  1S7E A;  4DBR A;  1HST A;  1W36 C;  4O6J A;  4M9Z A;  2MSY A;  2DA6 A;  3CC2 I;  3A1Y A;  5E1X A;  3LSR A;  2XC7 A;  4RB2 C;  4HLX A;  1W36 D;  1U5T B;  3IC7 A;  1SFK A;  2H94 A;  1WH5 A;  1RIO H;  1PUE E;  4RA2 A;  4L18 B;  4XSZ F;  5H6Q A;  4XLE A;  1SAU A;  4JOM A;  3J80 K;  3CCM I;  3SJM A;  2V1U A;  4E6K G;  4MQ9 F;  1XG1 A;  1SD6 A;  3CCV I;  1XCV A;  4QLC U;  4A5M A;  3GLX A;  4ZZL A;  1FOW A;  2CG4 A;  3IRR A;  1B9N A;  4ZYA A;  4F92 B;  5FD5 A;  3MAJ A;  3V8L A;  5IT9 K;  1JKQ C;  1SC7 A;  1WI3 A;  1X1B A;  2VBY A;  2FD5 A;  2VT2 A;  4F91 B;  3BTL A;  3FZV A;  3ZQH A;  4PSW A;  4QWQ A;  5E3M A;  4ITV A;  3K1N A;  2A5Y B;  3JRC A;  4NC7 A;  2BGC A;  2DA4 A;  1O4X A;  4C3H J;  4BBR J;  3J81 Z;  2E1M B;  4JX6 A;  1Z7U A;  3ASN H;  3SZP A;  3QU3 A;  3HBL A;  5TJJ A;  2DK8 A;  4M71 A;  2OU2 A;  3G1L A;  5L3B A;  3OYI A;  2IEK A;  4V19 K;  3FMR A;  4G6D A;  4KN7 X;  1XTA A;  5M3F J;  1Z05 A;  3F8F A;  1S29 A;  3GEZ A;  2QGU A;  5BS6 A;  2VBW A;  2XAG A;  3ULQ B;  2QWW A;  1R4M B;  3JRD A;  4IJA A;  1IGN A;  2HQ5 A;  5CLS A;  3VSL A;  2DDA A;  4M6V A;  2MAB A;  3Q0U A;  1HDP A;  4XSX F;  3L2R A;  3KP2 A;  3WU2 C;  3J7Z I;  5IY5 H;  2A68 F;  5IP6 A;  1FT9 A;  2FOW A;  4UV8 A;  3T1B A;  2CV2 A;  1VI0 A;  1OFC X;  4BKX A;  1SFE A;  1KYZ A;  2CQN A;  2EIK H;  3KZI C;  4UB6 C;  1U5T C;  1XGM A;  3Q9S A;  2PMZ A;  3QP6 A;  4KT6 A;  1K78 B;  1B72 A;  5D4S A;  1AU7 A;  1T56 A;  5LRR A;  2DT7 B;  2L9V A;  1VQL I;  2HKO A;  4LB5 A;  1DPU A;  4I99 C;  3SDG A;  3ZQ7 A;  3A03 A;  5K5Q A;  1MJA A;  3WGG A;  5CKT A;  1RR8 C;  2NRA C;  1TWC J;  3QRF F;  4QPO A;  2KIQ A;  1R22 A;  1BOB A;  3S2H J;  4IPA A;  5K1Y A;  3I59 A;  2KIU A;  3QPL A;  2BEO A;  2LNB A;  3ZQC A;  3DEE A;  2A61 A;  5GPC A;  2IS4 A;  1RRJ A;  1SAX A;  4HBL A;  2CYY A;  2DJN A;  3J81 K;  3CDH A;  5IOY A;  4G7H F;  4LGW A;  2Y2Z A;  4BXX J;  2X85 A;  3BPX A;  2CRG A;  2M87 A;  4IVN A;  5LRS A;  4D5C A;  3TDU C;  2NNN A;  2A6E F;  3G2B A;  4RGX A;  3GFI A;  1R49 A; 
#chains in the Genus database with same CATH homology
 2O8X A;  4UHT A;  5DUK A;  2LSO A;  1W4M A;  1YQA A;  1I1G A;  6PAX A;  2EFO A;  3EYY A;  4Y17 A;  2VBX A;  2K4B A;  3V4G A;  3HIF A;  2FML A;  4WCG A;  2W84 A;  3HHH A;  5LEK A;  4FX4 A;  1ZRD A;  2G9W A;  3N97 A;  1TNT A;  2H09 A;  2DLL A;  4AIH A;  2GA1 A;  3KZZ A;  2QQB A;  2W57 A;  1D3Y A;  1RI7 A;  3ZMT A;  3V8J A;  1LDK B;  2JRT A;  1H0M A;  1FP1 D;  1O7L A;  4R1H A;  3JSO A;  3ECO A;  3MFK A;  1P6R A;  1QBJ A;  2ZBK A;  4UNO A;  1X3U A;  2QQ9 A;  1AWC A;  1Z1D A;  2L4A A;  3U2R A;  2FA5 A;  2MH9 A;  3GFM A;  2RNJ A;  4AWX B;  1K7A A;  2PJP A;  4OIN F;  2Z33 A;  2G7H A;  2ACJ A;  4FT8 A;  2OQR A;  3BJO A;  5CJ9 A;  4ZH4 F;  2UZK A;  4Q47 A;  1FWZ A;  4RGR A;  4HQE A;  1IUY A;  3LQQ A;  2VXZ A;  3WGH A;  4WK8 F;  3KZY A;  1FZP B;  1V3F A;  3KEQ A;  2PQ8 A;  2KIM A;  1B1B A;  2K86 A;  4BNC A;  1J75 A;  4HA8 A;  4JK1 X;  3KP5 A;  2UXX A;  1ZAR A;  3F22 A;  3ZMZ A;  3NQO A;  5ERI A;  3E97 A;  2L01 A;  1G3S A;  3WG9 A;  1J7K A;  1IZ1 A;  2HGC A;  5LHH A;  3ECH A;  2VC0 A;  4EQQ A;  4ZYH A;  2O6G E;  1S3J A;  5EEH A;  5DCM A;  1R5G A;  3TGN A;  4A6D A;  1JE8 A;  2DK5 A;  2ZFW A;  2FXA A;  1KQ0 A;  3GZ5 A;  1I6X A;  3DV8 A;  5J6X A;  3F8M A;  2PMU A;  3I58 A;  3SFZ A;  2HWV A;  1F1Z A;  3GXO A;  2QUF A;  2BV6 A;  1ULY A;  2CW0 F;  1T39 A;  2P4W A;  4YFX F;  3MCZ A;  2H27 A;  3Q9V A;  3SXY A;  2ZKZ A;  5DUI A;  5D6E A;  3P7N A;  2MH2 A;  4L5I A;  5CVI A;  1MD0 A;  4L9J A;  1PP7 U;  4MGR A;  2YU3 A;  1SMT A;  2RKH A;  4KFC A;  1SD5 A;  1QPM A;  5K5R A;  4EJT A;  4IHS A;  4B8X A;  4M9X A;  4LG0 A;  5JI6 A;  2FRH A;  1T6S A;  2M45 A;  3ROU A;  1FBU A;  3VOD A;  5K5O A;  3ML6 A;  2ZO4 A;  2DO7 A;  2PI0 A;  2V9V A;  1Z6T A;  3TO9 A;  4JBA A;  1D8J A;  1MJB A;  3DPT A;  5HDN A;  1WQ2 A;  4EJO A;  1UHW A;  4KMU X;  4KYW A;  4RB0 A;  1ON1 A;  3ZP5 A;  3T8R A;  1R58 A;  4MTE A;  2ZME A;  3OOP A;  3GWZ A;  1WSU A;  2M30 A;  1XSD A;  3E5X A;  2PG4 A;  3QU6 A;  1CF7 B;  1GHC A;  2YX4 A;  4G9Y A;  2GXB A;  1KU7 A;  2HKX A;  2RN7 A;  1FYL A;  2O0Y A;  2A69 F;  2VOP A;  4M72 A;  3KET A;  2EWN A;  4ON0 A;  3F3X A;  4PGH A;  3W6J B;  1XSX A;  2PN6 A;  3FXR A;  1R5H A;  4LK1 F;  2AXL A;  4LK0 F;  1YW7 A;  4KMF A;  1TLH B;  4EGZ A;  2DBB A;  3H3Z A;  1RUO A;  4L0Z B;  4BHC A;  2CSO A;  4RAY A;  3R0J A;  1OYW A;  4ENK A;  3NRV A;  1MKM A;  4BXU A;  3F21 A;  4M6X A;  2VOD A;  3TOA A;  2F5F A;  4XRF A;  3WTS C;  3T8T A;  4A6E A;  4XBF A;  1R7J A;  2XAQ A;  2HZT A;  2CO5 A;  2DU9 A;  1O7F A;  3QP5 A;  1XSV A;  5CYV A;  2IRF G;  5F64 A;  3TOB A;  2P7V B;  1E17 A;  4ETS A;  2LKP A;  2XIG A;  4HF2 A;  4I09 A;  5HLH A;  1G3Y A;  1FSE A;  3I0T A;  4DNC A;  1GXQ A;  3CO7 C;  2MC3 A;  4U0V A;  2QEN A;  3GO5 A;  5A2Q Z;  3COA C;  4BQA A;  1HXD A;  2GQQ A;  3WTZ A;  5L3G A;  5HVQ C;  1KU2 A;  3TDZ C;  3DXJ F;  1OR7 A;  2AS5 F;  4UVC A;  1FYM A;  3KP3 A;  3ZPL A;  3GF2 A;  1T98 A;  2QYO A;  4IRI A;  4M6Y A;  1FP2 A;  2X4H A;  3K2Z A;  1MZB A;  5FFZ A;  5EEG A;  3BPV A;  3T0Y A;  3EYI A;  1TBX A;  2EFP A;  1ZH5 A;  4MEX F;  2BYV E;  1SFX A;  3M8E A;  3LAJ A;  2FU4 A;  3EET A;  1XB4 A;  1MDM A;  4LFU A;  4JQF A;  1HW2 A;  3DP7 A;  1YLF A;  2GIV A;  4KNY A;  5E1Z B;  3C7J A;  3CUQ B;  3I64 A;  4WXH A;  5A2Q K;  5ILS A;  2ELH A;  2FBH A;  1IRG A;  1IXC A;  1U3E M;  3BJ6 A;  4GXO A;  5AIQ A;  3I54 A;  4OMZ A;  4G94 A;  3WU1 B;  4OOI A;  4PDK A;  3E6M A;  4P5O A;  3GYH X;  2RGV A;  4XLP F;  2F5D A;  4OMY A;  5ICE A;  4U0W A;  3P9C A;  1STZ A;  3VFZ A;  1UFM A;  3TO6 A;  1T0F A;  2DQR A;  1KQ8 A;  2L3D A;  3ZMD A;  2DW4 A;  1U6G A;  3C18 A;  3SZT A;  2FE3 A;  1KU3 A;  3JTG A;  2ZCW A;  1ZLK A;  5FB2 A;  3DF8 A;  5CVJ A;  1LDD A;  5D5X B;  3IKV A;  5AON A;  1O3S A;  1P2F A;  5LGN A;  2VBZ A;  3E6B A;  3REO A;  3I53 A;  2YX7 A;  4Y13 A;  4EM1 A;  4L9V A;  5ED4 A;  1UST A;  1LNW A;  3IKT A;  1CGP A;  3MZH A;  1OYI A;  3CUQ C;  1EH6 A;  5FD6 A;  2F5E A;  1FYK A;  2CGP A;  4ZYE A;  3FM5 A;  1G3W A;  2ESN A;  3M9A A;  2ZJ2 A;  4MNU A;  1DPR A;  3MEX A;  2A3S A;  3K69 A;  3H3U A;  3RKW A;  1RZ4 A;  4Z2Y A;  3IHU A;  1DP7 P;  2IPQ X;  2JZY A;  3WE3 A;  2HS5 A;  3RKY A;  3VB2 A;  4DQ2 A;  1I1S A;  2GZW A;  2KJC A;  4AIJ A;  1TW2 A;  1CF7 A;  2XAF A;  5D5U B;  2CFX A;  3H92 A;  4GO1 A;  3F8C A;  2FF4 A;  1YG2 A;  5D5V B;  4EJW A;  2QBY A;  2G7U A;  4EJU A;  3DQV C;  1ON2 A;  5CVV A;  3WGI A;  2RC4 A;  5DD4 A;  1JHH A;  2CWE A;  1O57 A;  2V1D A;  5HDG A;  3WTY C;  3RDI A;  3HOT A;  1F4K A;  1G6N A;  1B59 A;  3NEU A;  3DFG A;  4I01 A;  2P5L C;  1IN7 A;  4IF4 A;  1FC3 A;  2KRF A;  2XGX A;  2MLK A;  3S2W A;  3PQK A;  2NNY A;  4GCV A;  2FMY A;  2ZXJ A;  4UVB A;  2FNP A;  2P6S A;  3BOQ A;  1BIB A;  4PZJ A;  4I2O A;  2STW A;  4OIQ F;  1D8K A;  1TQP A;  2O61 A;  3E5U A;  1J0R A;  2NS0 A;  5L3D A;  4BAY A;  3RIR A;  1BI0 A;  2GA2 A;  2VN2 A;  5LBQ A;  1P4X A;  1Y0U A;  1FPQ A;  3LQR A;  4EM0 B;  1W7P A;  3VEP A;  2XKP A;  1YS6 A;  1IAW A;  2DQL A;  1XDS A;  1BI3 A;  5DDG A;  1T2K A;  3HRS A;  3L09 A;  3G73 A;  2VC1 A;  3HYI A;  4CGZ A;  3F23 A;  3I71 A;  5BPI A;  3V7R A;  3D5L A;  3F6O A;  2JPC A;  1ZN2 A;  2O03 A;  1HBX G;  4L9T A;  2F5C A;  3WE2 A;  4U7B A;  2OAZ A;  1ZRE A;  5BQT A;  2Y48 A;  5E8G A;  4LMY A;  4M9S A;  1HKT A;  3RJP A;  1S7A A;  2DTR A;  2HYG D;  1MGT A;  2Y0M A;  4EVI A;  4LLL A;  4ENJ A;  1XDU A;  4HDU A;  4OIO F;  4RGS A;  4CZZ A;  3G3Z A;  3SHF A;  4E70 A;  1ZLJ A;  4XLN F;  2E1C A;  5DEQ A;  1ZYR F;  3HHG A;  1O3T A;  1U5T A;  4EV0 A;  4NB5 A;  4EJV A;  2M8E A;  4I0B A;  2OQG A;  4UUV A;  4IRH A;  1P4A A;  2XAJ A;  1KU9 A;  2PBI A;  3MQ0 A;  3TO7 A;  5LEJ A;  2K27 A;  4S05 A;  1EV7 A;  5D8L B;  3I4P A;  1HSJ A;  1KQ9 A;  1BJA A;  1TTY A;  2P5K A;  1IN8 A;  2HOE A;  4BYY A;  3GZ6 A;  1YS7 A;  2FOK A;  3ZN0 A;  3PFI A;  4N9H A;  1XGO A;  2HQR A;  1MJ9 A;  2DT5 A;  4H0E A;  5DCF A;  5ICC A;  1UHM A;  2WTE A;  1R23 A;  4WF2 A;  2XV4 S;  1LB2 A;  2YSR A;  4PCQ A;  5IT3 A;  1YYV A;  3JSP A;  5ILU A;  3M7G A;  3LA2 A;  1K78 A;  4I98 B;  4MHG A;  3V7C A;  4OIP F;  4CDG A;  4BHP A;  2Z5U A;  4YIF A;  1HKQ A;  1XD7 A;  2XUB A;  3GW2 A;  1SD4 A;  3L7W A;  4HAM A;  2EV5 A;  3K1M A;  3TKY A;  4CO8 A;  4B09 A;  5DD8 A;  4L5J A;  4IXA A;  1IN4 A;  3LA3 A;  3K1P A;  1KA8 A;  2GWR A;  2R3S A;  4FHT A;  4HLY A;  2EK5 A;  2UWM A;  2HQN A;  4NHJ A;  4BHB A;  3CJN A;  5D6F A;  2W85 A;  3L9F A;  4ZYD A;  2VOO A;  5L3F A;  2KIF A;  4ENN A;  5HOO A;  3I59 B;  4G6Q A;  5F6F A;  2DAO A;  4CIC A;  2Z99 A;  2DPD A;  3LFK A;  1FOK A;  2P6T A;  4D0P A;  3WTT C;  2RVC A;  2CQK A;  4N9I A;  3KLN A;  1HQC A;  2OZU A;  4O5V A;  1S8N A;  4KN4 X;  4RB3 C;  3P9I A;  2COM A;  1Z9C A;  3RTR A;  2JPB A;  4ESB A;  3BWG A;  1ODD A;  2K02 A;  5L3C A;  1S6L A;  3WTW C;  1S7O A;  1A04 A;  3WU0 A;  1LQ1 A;  2TDX A;  1K6O A;  1R1T A;  1GXP A;  1HKS A;  4M73 A;  3M1E A;  5E17 F;  4TV7 A;  2WC2 A;  1TNS A;  3RPQ A;  1H9G A;  1ZAO A;  1BC8 C;  1WKM A;  3BY6 A;  5HLI A;  2F2E A;  2STT A;  3GVA A;  5BOX A;  1SD7 A;  2UXN A;  2ESH A;  4OIR F;  2ZNY A;  4K2E A;  2XHK A;  4ESJ A;  3HSE A;  1HW1 A;  3E5Q A;  3K9T A;  5E8I A;  4U7D A;  4HZF A;  3CTA A;  1LVA A;  2O3F A;  1ZG3 A;  4I0A A;  3BZ6 A;  2IVM A;  1ONV A;  2W24 A;  3RYR A;  2DFI A;  4ENM A;  1LEA A;  4UV9 A;  3GFL A;  2E1N A;  3B73 A;  1XCB A;  3KP6 A;  2XRN A;  2EV0 A;  3JAM Z;  1B4A A;  4AD9 A;  5AIP A;  3FHZ A;  3M8F A;  5HLG A;  4LLN A;  1W5T A;  4RS8 A;  4WXD A;  5FGM A;  4GGG A;  4M74 A;  4Y15 A;  1YW8 A;  3ABT A;  1IW7 F;  2XAH A;  5FFX A;  4WWC A;  2XKO A;  3IWF A;  1J59 A;  1LEB A;  3SQN A;  1WWX A;  2C6Y A;  1WI9 A;  2IT0 A;  1BM9 A;  3FXQ A;  1FBQ A;  2Y75 A;  5BPD A;  3F8B A;  5E1W A;  1YTY A;  1SFU A;  4HX7 A;  2IA0 A;  2KKO A;  2GXG A;  2HFH A;  3IWZ A;  2JSC A;  2VE8 A;  3LST A;  2FSW A;  5DCM B;  1XN7 A;  4FX0 A;  1BOA A;  5LLQ A;  3JAM K;  4LB6 B;  1XMA A;  5E18 F;  1IXR C;  5LHG A;  1H9T A;  4HDV A;  2OBP A;  2HEO A;  1L0O C;  3O6B B;  1FNN A;  5JFR A;  1W7P D;  1QQI A;  4KA4 A;  4OU0 A;  3AAF A;  4R8H A;  2XAS A;  5TRD A;  2KJB A;  3KE2 A;  2RDP A;  2PFB A;  3I5U A;  4HF0 A;  3ZN1 A;  2HDC A;  1P92 A;  1TQM A;  3ZMV A;  4AVP A;  3BJA A;  3D0S A;  1B9M A;  1BI1 A;  2EA2 A;  3FXU A;  3GUD A;  1ZG5 A;  2MD5 A;  1TW3 A;  5ICG A;  3HSR A;  1U8R A;  5L3E A;  3ELK A;  4U0Y A;  1VTN C;  1F5T A;  5ICF A;  4HYE A;  3O3K A;  2A07 F;  4PGG A;  3B02 A;  2BE5 F;  4HOB A;  3QPH A;  2MLG A;  4LG0 B;  2J5O A;  3DPL C;  1PDN C;  2LF8 A;  1XGN A;  4G8X A;  4A0Z A;  1OYY A;  5LGU A;  3HSF A;  2MBF A;  3ZMS A;  2OA4 A;  1OPC A;  4HV6 A;  2A6H F;  4UXN A;  1TQI A;  2YPR A;  2P7C B;  4L0Y B;  5DYM A;  1JGS A;  3HRM A;  4BH9 A;  3J7A O;  3PQJ A;  5KK1 A;  2Q2E A;  3HOS A;  1T38 A;  2QLZ A;  2ZME B;  3C3W A;  1O3R A;  3JTH A;  3MWM A;  1OMI A;  4I7H A;  4CXF A;  4Q48 A;  2ISZ A;  5DV5 A;  3RI4 A;  2OD5 A;  1O3Q A;  4IHT A;  1J2X A;  1BN5 A;  4KDP A;  4HF1 A;  3IL2 A;  5CVU A;  1XMK A;  3K0L A;  1BI2 A;  1ZGJ A;  4HX8 A;  4A5N A;  2V1X A;  1QNT A;  4HX4 A;  5E20 A;  2IA2 A;  2HR3 A;  2FQ3 A;  3ISP A;  3EDP A;  4KT5 C;  2YR2 A;  2K4J A;  4F7Z A;  2H6B A;  2H6C A;  3CUO A;  2D1V A;  1B6A A;  1UCR A;  1J9I A;  1I27 A;  1ZRC A;  2R7F A;  4LLG F;  2JT1 A;  1FBS A;  2X0L A;  4NQW A;  1LDJ A;  4EGY A;  1V4R A;  1W5S A;  2QZ8 A;  3C1D A;  1FY7 A;  1SMY F;  2FBK A;  2HTJ A;  3O2P E;  1D5V A;  3HRU A;  1JHF A;  3F6V A;  4U88 A;  3CO6 C;  2PMH A;  3QPT A;  4HV5 A;  4I02 A;  3L00 A;  3KLO A;  1G3T A;  2D1H A;  3ABU A;  5D5W B;  2EV6 A;  4P96 A;  4R79 A;  2P8T A;  3E6C C;  1K79 A;  1HW5 A;  5JVT A;  2HTS A;  1E2X A;  1GVJ A;  1G4D A;  4MTD A;  1DDN A;  3QAH A;  2FNA A;  2Z3Y A;  1QGP A;  5D4R A;  2R7D A;  3HTU A;  1KYW A;  1IRF A;  4P9U A;  3CUQ A;  2L54 A;  4P55 A;  1I5Z A;  2RQP A;  1EH8 A;  2HYF A;  3KEO A;  3E6D A;  4WX9 A;  1L3L A;  5CVR A;  1QZZ A;  3U1D A;  5J8C A;  3F8N A;  2NYX A;  1MDM B;  1USS A;  1FX7 A;  1J5Y A;  1U2W A;  4LJZ F;  4EM2 A;  4KIC A;  3T5X A;  3EQL F;  1EH7 A;  5JHU A;  4Q4Z F;  3N4M A;  4A12 A;  1KGS A;  1RNL A;  3LAP A;  4IRG A;  4WXC A;  2Q0O A;  2RV8 A;  3V7S A;  3R61 A;  2WWY A;  2XRO A;  3FM3 A;  4MQV A;  3TQN A;  1ZGA A;  4N0B A;  1LJ9 A;  2QVO A;  3P9K A;  1ZHF A;  3WTX C;  2WV0 A;  1Z91 A;  3R6S A;  4A0Y A;  1XGS A;  3EUH A;  2FBI A;  3JW4 A;  2E7W A;  3BDD A;  3QOP A;  3RKX A;  1P4W A;  4GYG A;  3VOE A;  3BP8 A;  2IW5 A;  5HS8 A;  2Z9O A;  1DUX C;  1IXS B;  2B0L A;  2EB7 A;  5KVR A;  5D8K B;  5ILV A;  3LWF A;  2M5W A;  2D45 A;  2VT3 A;  4RGU A;  1R00 A;  4RB1 A;  3BRO A;  3LA7 A;  4KIB A;  2J5P A;  4RAZ A;  2QM3 A;  1F9N A;  2ETH A;  2DPU A;  4CYD A;  5HDK A;  4YFN F;  4P9F A;  1YW9 A;  4HQM A;  5HS9 A;  4Q5S F;  1WRJ A;  4EMS A;  1BC7 C;  1Q1H A;  3RYP A;  4YG2 F;  2V6C A;  3R60 A;  3U9G A;  3HRT A;  1Z6R A;  3FMS A;  1U78 A;  2BBY A;  2ISY A;  3DEU A;  2L02 A;  3WTU C;  1RUN A;  5JR3 A;  1UB9 A;  1OKR A;  1AOY A;  2PEX A;  1ZRF A;  2L4M A;  2M1B A;  3HUG A;  3KP7 A;  4O3M A;  5H6R A;  2QBY B;  4G7O F;  2EFW A;  5BMZ A;  3Q5F A;  3IRQ A;  3ERE D;  2EFN A;  2IP2 A;  2D2W A;  4ESF A;  3GX4 X;  2ADU A;  5FLX Z;  4LD5 A;  4S04 A;  1FLI A;  4MEY F;  3KCC A;  1QO0 D;  4ASN A;  1R36 A;  2XVC A;  2Q8K A;  4A2U A;  1R1U A;  1YO5 C;  4ZYG A;  4CHU A;  2EA4 A;  2EJR A;  3F72 A;  2PLY A;  3ZMU A;  5HS7 A;  2EFQ A;  2NAZ A;  2QQA A;  2ZNZ A;  3WOD F;  4KIF A;  2DI3 A;  2OZ6 A;  4UVA A;  2W25 A;  3W6K B;  2P5V A;  2E7X A;  1BIA A;  5J8F A;  1PP8 F;  2LDU A;  1R1V A;  3FMQ A;  2IA1 A;  3WTV C;  2FEZ A;  4KUM A;  4YII A;  4L9N A;  4YFK F;  1REP C;  1C0W A;  3HTS B;  2VE9 A;  4AIK A;  1W7P B;  5FLX K;  5F1R A;  4G7Z F;  3FWE A;  1ZG1 A;  3V8K A;  1YIO A;  1NHA A;  5H20 A;  3E3V A;  3J80 Z;  3FF5 A;  1IN5 A;  3GFJ A;  1FSH A;  2IJL A;  3KFW X;  4KIG A;  2LF7 A;  1BBY A;  5IT9 Z;  1QZY A;  4HW0 A;  4ZZD A;  5LGT A;  3FX3 A;  3CLO A;  2JTV A;  3MZY A;  1IN6 A;  2GAU A;  3OV8 A;  1IF1 A;  1JXS A;  4A0X A;  1YFH A;  3L2C A;  5FO5 A;  3R0A A;  5LHI A;  2MA3 A;  3DKW A;  2VON A;  4GYI A;  2V79 A;  3KP4 A;  2K7L A;  3R4K A;  3RPU A;  1HST A;  4O6J A;  4M9Z A;  5E1X A;  4RB2 C;  4HLX A;  1U5T B;  3IC7 A;  2H94 A;  1RIO H;  1PUE E;  4L18 B;  4XSZ F;  5H6Q A;  3J80 K;  2V1U A;  4MQ9 F;  1SD6 A;  1XCV A;  4QLC U;  4A5M A;  3GLX A;  4ZZL A;  2CG4 A;  3IRR A;  1B9N A;  5FD5 A;  3MAJ A;  3V8L A;  5IT9 K;  2VBY A;  2VT2 A;  3FZV A;  4QWQ A;  3K1N A;  2A5Y B;  2BGC A;  3J81 Z;  1Z7U A;  3SZP A;  3QU3 A;  5TJJ A;  2DK8 A;  4M71 A;  2OU2 A;  5L3B A;  3FMR A;  4G6D A;  4KN7 X;  1Z05 A;  3F8F A;  1S29 A;  3GEZ A;  5BS6 A;  2VBW A;  2XAG A;  3ULQ B;  2QWW A;  4IJA A;  5CLS A;  4XSX F;  3KP2 A;  2A68 F;  1FT9 A;  4UV8 A;  3T1B A;  1SFE A;  1KYZ A;  1U5T C;  1XGM A;  3Q9S A;  3QP6 A;  1K78 B;  5D4S A;  5LRR A;  2HKO A;  4LB5 A;  1DPU A;  3ZQ7 A;  5K5Q A;  1MJA A;  3WGG A;  2NRA C;  3QRF F;  1R22 A;  4IPA A;  5K1Y A;  3I59 A;  2KIU A;  2BEO A;  2LNB A;  2A61 A;  1SAX A;  4HBL A;  2CYY A;  3J81 K;  3CDH A;  4G7H F;  4LGW A;  3BPX A;  2M87 A;  4IVN A;  5LRS A;  3TDU C;  2NNN A;  2A6E F;  4RGX A;  3GFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...