3N97A

Rna polymerase alpha c-terminal domain (e. coli) and sigma region 4 (t. aq. mutant) bound to (up,-35 element) dna
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
53
structure length
53
Chain Sequence
SKLSEREAMVLKMRKGLIDGREHTLEEVGAYFGVTRERIRQIENKALRKLRHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Combined structural model for a transcription activation assembly
rcsb
source organism Thermus aquaticus
molecule tags Gene regulation/dna
molecule keywords RNA polymerase sigma factor
total genus 19
structure length 53
sequence length 53
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3n97A00
1DUXC 2V1UA 2D1HA 1MDMB 1BC7C 5A2QZ 1XDSA 1OR7A 1ONVA 2IVMA 4WF2A 5FO5A 4I98B 2P7VB 1YW7A 2E7XA 1BIAA 5L3FA 2QBYB 3JAMK 1QGPA 1BM9A 2DU9A 4B8XA 3J7AO 5D5XB 3VB2A 1KYWA 1F9NA 2ZNZA 2K7LA 3J81K 1SMYF 1LEAA 3LA2A 2MLKA 2HTJA 1HKTA 2O6GE 4N9IA 3I58A 2JT1A 3BJAA 3WTUC 3HHGA 1R1VA 3KP5A 1SD6A 3BZ6A 2ZCWA 1ZGJA 3D5LA 3ZN0A 2O03A 3CUQB 5LHHA 1QO0D 3J81Z 2DI3A 5D6EA 3GZ5A 3I59A 2EFQA 2DQLA 5E1WA 3HUGA 3IHUA 4LB6B 1W7PD 3K1MA 4A5MA 3ZMZA 1GXPA 1I5ZA 3KETA 1LDJA 4IHSA 5FD6A 5CJ9A 2BYVE 3MAJA 2QENA 4KIFA 3WE2A 1L3LA 1O57A 1OKRA 2EV0A 3KLNA 3TDZC 2DPDA 4HF0A 2DFIA 4UVCA 3TOAA 5E1XA 3R61A 3S2WA 1J5YA 3V8JA 3F6OA 2Y0MA 4IJAA 4I09A 1W5TA 2XKPA 2XHKA 5DD4A 2LF7A 4MNUA 5DUIA 3HOTA 4RAZA 5A2QK 1XN7A 2P4WA 3K2ZA 3KP6A 2ESHA 2A6EF 3TO9A 3K0LA 2HQRA 3LSTA 2NNYA 2EJRA 2OQGA 2Q0OA 3E5XA 3I53A 3F8MA 3PQJA 2PLYA 3G3ZA 1BI1A 1ZLKA 2HR3A 1HBXG 1ON1A 5IT3A 1XSVA 2JTVA 3QRFF 3E6DA 2NYXA 3K9TA 4GXOA 1TBXA 4CGZA 2CW0F 1W7PA 2KKOA 2NNNA 4I02A 3RYRA 1XMKA 2X4HA 5D8KB 1TTYA 3WE3A 3HIFA 5D4RA 1QPMA 5DCFA 5CVRA 2M5WA 1TLHB 1S6LA 3SXYA 4QWQA 2F2EA 2FRHA 4WCGA 1MJ9A 2ZKZA 4UV9A 4L9NA 2F5DA 2QQAA 1YFHA 2HFHA 1UHMA 3J80Z 3DQVC 2FSWA 2VC1A 1H0MA 4YFNF 1FY7A 2VBZA 1USSA 4LLGF 3V8KA 2EFNA 4HV6A 3IRRA 4EV0A 1XB4A 4BHPA 4LLLA 2KRFA 2MH9A 1OYIA 3IRQA 1XGMA 1R7JA 1LJ9A 4O5VA 2A69F 5LRRA 1P4XA 1TQPA 1WWXA 5AIPA 1IW7F 3PFIA 2EFPA 1P6RA 1R58A 5D5UB 1IF1A 5FFZA 4EJVA 1DPRA 4GO1A 2M87A 5E1ZB 4I0BA 3CTAA 4LGWA 3I64A 1O3SA 4CO8A 2DT5A 3TO7A 5JFRA 2Z3YA 4I2OA 4OMZA 2QVOA 4AIJA 1MZBA 4CDGA 3CUOA 3ERED 1WSUA 4HBLA 1R5GA 4EM2A 4YFXF 5J8FA 1Z7UA 4WXHA 5ILUA 5ILSA 3ULQB 2PMUA 2CO5A 2BGCA 3P9CA 4XBFA 4PGGA 4Q5SF 1MJAA 4UHTA 1ZRDA 4A6EA 2ZMEB 4M9ZA 2X0LA 2LF8A 3IKTA 2V1DA 4RGRA 4P55A 3HRTA 3ISPA 2H6CA 2PEXA 1IN5A 1YS7A 2O8XA 3I54A 5LGNA 2EA2A 1K78B 2F5FA 3TOBA 1G3SA 3P9KA 4M72A 2C6YA 2RC4A 3HTSB 1HQCA 1J2XA 2A6HF 2D45A 3ZPLA 3PQKA 1S29A 2VT2A 3ZQ7A 3GFIA 5TJJA 4F7ZA 4BXUA 3RPQA 1I1SA 3U2RA 5LGTA 1CF7A 3KP4A 2YX4A 4PGHA 2DLLA 1W7PB 1FYLA 5LGUA 2V1XA 1FBSA 2VOPA 1RIOH 4A2UA 4L0YB 4XRFA 2P5LC 3KFWX 4K2EA 3GVAA 1JHHA 4G7ZF 1IN8A 3M9AA 4ZYEA 4Y13A 1FYMA 4N0BA 5E17F 3BDDA 5HLHA 1T6SA 3U1DA 2H09A 1J7KA 3V8LA 2HEOA 2HOEA 1ZAOA 2EB7A 3R0AA 4JQFA 3QU3A 4Q48A 5D8LB 1Z91A 1ZRCA 2L4MA 5ICGA 5E8IA 1R1UA 2MA3A 1H9GA 3TO6A 5EEGA 4EJWA 3L00A 1IN4A 5D5VB 2FEZA 1UB9A 2DBBA 4AIHA 3HHHA 4E70A 1JXSA 6PAXA 2E1CA 4S05A 2VBXA 4M9XA 5JI6A 4ZH4F 1LNWA 4LFUA 1XCBA 3GYHX 5FFXA 2H94A 4Y15A 1ULYA 2RQPA 1FZPB 4HQMA 4KMUX 4IF4A 4MTDA 4MHGA 4ZZDA 3AAFA 1RZ4A 2EFWA 2YPRA 1FT9A 2KIUA 4XLNF 2UWMA 4M74A 3ROUA 4JBAA 3HYIA 3FXQA 2FNPA 4ZYDA 5AONA 3ZMTA 2L01A 4ON0A 4KN4X 3HRMA 2FBKA 2R3SA 1B6AA 4AWXB 3KP2A 5L3EA 4RB3C 3ML6A 1HSJA 3R60A 3VEPA 2G7HA 3VODA 2DK5A 3ABUA 3FF5A 2IRFG 2OZUA 4LK0F 2CWEA 3IC7A 1S8NA 2GIVA 4HDVA 4ETSA 2GQQA 3RI4A 2IPQX 4EGYA 1LB2A 1S7AA 3GLXA 1YW8A 2MC3A 5D6FA 2QWWA 4FHTA 2OBPA 4U0VA 3F6VA 4LMYA 2OQRA 1UCRA 4A12A 1P4WA 4BH9A 4A0ZA 3M1EA 4BAYA 5ICCA 2P5VA 2GA2A 1U5TC 2M45A 1R00A 1MDMA 3GWZA 5BOXA 1XGNA 2Q8KA 5K5QA 2AS5F 3E6MA 2LDUA 4U0YA 4BYYA 4AVPA 2A61A 5ICEA 4P9UA 2MLGA 3LA3A 2VE9A 1FX7A 4H0EA 4D0PA 5FD5A 1YQAA 3WTSC 2FMYA 1MJBA 4R79A 2P6SA 2KIMA 1BI0A 4UVBA 4IRGA 2P7CB 5LHGA 3GFMA 2VT3A 3K1PA 2W57A 1AWCA 1V4RA 3WTZA 2FF4A 4HX4A 1BBYA 2KJBA 3P7NA 4EGZA 2M8EA 1Z6RA 4M73A 3ZMVA 3BROA 4L9JA 1G3YA 1U2WA 2QBYA 5L3GA 3H3ZA 2QYOA 3HSFA 4MQ9F 4KDPA 1Q1HA 3SFZA 2YX7A 3ECHA 4RB1A 3JW4A 2FOKA 5HS8A 3GXOA 2UZKA 5ICFA 2XV4S 4OOIA 4OU0A 3WTYC 3ZMDA 1VTNC 2M1BA 1KU7A 1PP8F 3T5XA 5AIQA 3EDPA 1F1ZA 1YIOA 3R6SA 2Z33A 4BNCA 3LQQA 2DK8A 1RUNA 4IHTA 2O0YA 1FC3A 2EA4A 3F8BA 3GEZA 5ERIA 4LK1F 3ZP5A 2EFOA 4XLPF 1DDNA 1Z05A 2IT0A 5J8CA 3FM3A 3HSRA 2NS0A 3TKYA 2RV8A 5DCMA 1HW2A 2ZJ2A 2PN6A 4M6YA 3VFZA 4HLXA 1B9NA 1KQ9A 3BWGA 1R36A 1W5SA 4EJOA 4OINF 3KEOA 3DFGA 2RVCA 1J59A 3WG9A 3V7RA 3RJPA 3N4MA 3MZHA 5HDKA 1RUOA 2XVCA 3TQNA 5IT9Z 4HLYA 3QPHA 3FHZA 2Z99A 1OPCA 3DXJF 1KA8A 5BS6A 1J75A 3TDUC 4RB2C 3W6JB 3F3XA 3E5QA 1F4KA 2IW5A 4B09A 2XKOA 2ZMEA 5H20A 1LDKB 4CZZA 1LEBA 1Z6TA 3CUQC 2V79A 5DV5A 2PBIA 3GX4X 2FU4A 4JK1X 1ZGAA 3RKYA 1ZG1A 1U5TB 3SQNA 3Q5FA 2JPCA 4OIQF 3F8FA 4RB0A 4NHJA 2A07F 4HW0A 1E17A 1KU2A 2JPBA 5D5WB 5CLSA 2VBWA 3I0TA 1R22A 2FMLA 3EETA 2MH2A 2HWVA 3FM5A 4BHBA 4I0AA 3WTVC 1P2FA 3KLOA 1MKMA 1QQIA 1ZG5A 5CVIA 5CVUA 1QZZA 1KQ8A 3T1BA 2FNAA 5FLXK 2STWA 1FPQA 1BOAA 1I1GA 4UUVA 2E7WA 3NQOA 1KYZA 1LQ1A 1T0FA 5LEJA 3SZPA 2VXZA 1ON2A 3V4GA 3JSPA 1SFXA 1TW2A 4KNYA 2HZTA 1A04A 2AXLA 4U88A 1ZH5A 1GHCA 4A6DA 2QM3A 2FBIA 4L18B 2GA1A 4DQ2A 5TRDA 1USTA 3O3KA 3EYIA 1IXRC 4LLNA 4ENJA 1OYWA 3U9GA 4LG0A 2PMHA 4BQAA 2E1NA 1P92A 3FX3A 3H3UA 2GAUA 4FX0A 5LHIA 2K27A 4RS8A 3LA7A 2Y48A 3WGIA 3WU1B 1R23A 3ABTA 3KP7A 1FSEA 3KEQA 3L09A 1H9TA 2MD5A 1ODDA 3WTXC 3B73A 1FBUA 3KCCA 3QOPA 4KIBA 2XIGA 4HQEA 4EMSA 4LB5A 4BHCA 1MD0A 4NQWA 4GCVA 4YG2F 1HXDA 4Y17A 4PCQA 1IRFA 4CICA 5JR3A 1O7LA 1I6XA 5JHUA 2BV6A 4L9TA 2CSOA 1U3EM 4M71A 2ELHA 3Q9SA 1L0OC 1AOYA 3ZMSA 2W84A 1QNTA 3QPTA 4KN7X 2ZXJA 2P5KA 5E20A 5FB2A 3RPUA 5DD8A 1YYVA 1IN7A 2ISYA 1YS6A 4G8XA 5F6FA 2L54A 4U0WA 3T8TA 3COAC 2PFBA 1ZLJA 4A0XA 3FMSA 5BPDA 2PQ8A 4M6XA 3C3WA 4KFCA 3GZ6A 1XD7A 4KIGA 2CQKA 4YIFA 5CVVA 3CUQA 2XAJA 5HVQC 4U7DA 4XSXF 3EYYA 3QP6A 4ZYGA 2XAGA 3RDIA 4O6JA 1FYKA 1BI3A 5DUKA 4O3MA 3O6BB 3ECOA 3MFKA 3G73A 1NHAA 3RYPA 2RKHA 1EV7A 4EJUA 1B4AA 2RNJA 2GXGA 4L5IA 5F1RA 1XSXA 2P6TA 4HZFA 1G3TA 3CDHA 2DPUA 4A5NA 1EH6A 2XRNA 3M8EA 4HYEA 5ILVA 3KZYA 4RGXA 5LEKA 4KA4A 5BQTA 5DDGA 1J9IA 4Q47A 5KVRA 2WV0A 3DP7A 2IP2A 4ASNA 2RGVA 1ZREA 1XMAA 1D8KA 1CF7B 3WODF 2DAOA 5JVTA 1K78A 2JZYA 3E5UA 5CVJA 5DEQA 2H27A 3BY6A 3WTTC 4XSZF 1TNTA 4KMFA 3T0YA 1RI7A 3L7WA 3IWZA 5IT9K 2ZNYA 5CYVA 3C18A 4MGRA 1W4MA 3KZZA 4L0ZB 3K69A 2J5PA 2BEOA 3C1DA 1B1BA 2YSRA 3SHFA 4HOBA 1C0WA 4S04A 1IUYA 2O61A 1XGSA 1BC8C 1D8JA 1FP1D 4NB5A 1OMIA 1F5TA 2QLZA 3ELKA 3GF2A 3W6KB 1I27A 2V9VA 2V6CA 4CHUA 2MBFA 4MQVA 1R1TA 2HKXA 3V7SA 1YW9A 4OMYA 3LAJA 3CJNA 5L3DA 4CXFA 1FBQA 3BJ6A 3MEXA 1BJAA 2Z9OA 4EVIA 4N9HA 4R8HA 3N97A 4L5JA 3CO6C 2ADUA 4AIKA 3HSEA 3C7JA 4ENMA 1ZYRF 1PP7U 2G9WA 4DNCA 4KT5C 1YLFA 2QQBA 1FP2A 1BI2A 3F8NA 2LNBA 3BPVA 1WKMA 2HQNA 1JE8A 2UXNA 1TQMA 4KICA 4G94A 3J80K 1OYYA 3DKWA 1SMTA 1FOKA 2NRAC 2QUFA 2EWNA 4WXDA 2ZBKA 3GO5A 2XAFA 2L3DA 4GYGA 3R4KA 4YFKF 4WX9A 2VODA 2Y75A 1FNNA 1BIBA 2QZ8A 4RGUA 2VE8A 3RKWA 3GW2A 1DPUA 3HRUA 4L9VA 3WTWC 1R5HA 4ESBA 3LWFA 4IRIA 5HLIA 2PG4A 2NAZA 4PZJA 1ZRFA 4U7BA 2XAQA 1K6OA 1HSTA 1EH8A 3Q9VA 5FGMA 1FLIA 1SD4A 4M9SA 1GVJA 2PI0A 1V3FA 1S7OA 2M30A 2G7UA 4EM1A 5LLQA 3JAMZ 1SFEA 4HF1A 2QQ9A 2D1VA 4ESFA 1IXCA 4MTEA 2A3SA 2CFXA 3KE2A 3WGHA 1G4DA 1REPC 3L2CA 3BP8A 3O2PE 1J0RA 5K5OA 1CGPA 2DW4A 3OOPA 5F64A 1O7FA 1ZN2A 1K79A 4GYIA 5BPIA 2HGCA 2HDCA 4FT8A 3P9IA 3L9FA 2ACJA 2W24A 3I5UA 1HW5A 2GZWA 2VONA 3MCZA 2OD5A 1XGOA 4G9YA 4G6DA 1KGSA 4ENNA 2CGPA 2DO7A 2K02A 2A68F 4GGGA 4CYDA 3RKXA 2YR2A 1HW1A 2HS5A 1TW3A 2XROA 4ESJA 2IJLA 2ZFWA 2JSCA 4OIRF 5L3BA 2ESNA 5HS7A 2OAZA 1YG2A 1T38A 3KP3A 1FWZA 2FA5A 2YU3A 1D3YA 2VC0A 3F21A 2WC2A 4AD9A 4Q4ZF 5DYMA 1IZ1A 3EUHA 5E18F 5H6QA 5HOOA 3BJOA 3QP5A 1Z1DA 1U5TA 2BE5F 4LG0B 3GFLA 3IL2A 2EV6A 2D2WA 4P96A 5FLXZ 4RAYA 2ZO4A 2IA2A 1U78A 4IRHA 2H6BA 1XDUA 1WI9A 5HS9A 3WU0A 3REOA 3V7CA 1JGSA 2STTA 2K4BA 3K1NA 2OZ6A 3IWFA 4WK8F 1B9MA 1SAXA 2RDPA 2LSOA 4KUMA 2VN2A 5J6XA 1K7AA 4HDUA 2W25A 3DEUA 4G7OF 2FE3A 5K5RA 2F5EA 2ISZA 2B0LA 3E3VA 5H6RA 3FWEA 4Z2YA 4ZYHA 4HX8A 3E97A 4I7HA 2J5OA 1B59A 2RN7A 3H92A 2P8TA 2HYFA 4HV5A 4I01A 3HTUA 1SD5A 5LBQA 1SFUA 1KU9A 1STZA 2LKPA 2BBYA 1KQ0A 3JSOA 3ZMUA 3MWMA 5DCMB 2R7DA 4OIOF 1SD7A 2Q2EA 1Z9CA 3JTGA 4A0YA 2KJCA 2VBYA 4PDKA 5D4SA 4WXCA 4UXNA 1S3JA 1QBJA 4P5OA 4ZZLA 2XAHA 4HAMA 2TDXA 1IAWA 3FZVA 4G6QA 1IXSB 4IPAA 3VOEA 3ZN1A 3GUDA 2HYGD 3LQRA 1QZYA 1E2XA 1BN5A 4LD5A 3NEUA 5EEHA 3DPTA 2EV5A 2COMA 1ZG3A 1T2KA 3T8RA 4HF2A 1O3RA 2O3FA 4KYWA 1O3QA 2K86A 1UHWA 4YIIA 3CO7C 1KU3A 3E6CC 2K4JA 4WWCA 3BPXA 3TGNA 4EQQA 5ED4A 2OA4A 2L02A 4QLCU 1LDDA 4OIPF 2CYYA 4LJZF 3BOQA 3RIRA 3FXUA 4HX7A 3R0JA 2JRTA 3DPLC 3LAPA 1T39A 3SZTA 2CG4A 1ZHFA 1IRGA 3HRSA 3EQLF 3OV8A 3D0SA 2WWYA 4TV7A 1UFMA 3MZYA 2HKOA 1X3UA 2XGXA 3JTHA 3B02A 1U6GA 1RNLA 5L3CA 1HKQA 3FMQA 3LFKA 4EM0B 1Y0UA 2F5CA 3GFJA 2DQRA 2UXXA 1G6NA 1JHFA 3WGGA 1XSDA 3I4PA 1PUEE 4MEYF 4UVAA 2W85A 2FQ3A 2GWRA 4MEXF 2WTEA 2ETHA 1WQ2A 1YO5C 4UV8A 1WRJA 3M7GA 2KIFA 5HLGA 3I59B 2GXBA 1YTYA 1P4AA 1XCVA 4HA8A 3CLOA 3MQ0A 1TNSA 2PJPA 2XUBA 1O3TA 1ZARA 3RTRA 3F23A 1PDNC 1HKSA 4FX4A 2L4AA 5LRSA 1IN6A 5E8GA 1LVAA 2Z5UA 1EH7A 3QAHA 1G3WA 3F22A 2DTRA 1MGTA 2FXAA 5K1YA 5HDNA 3I71A 4IXAA 4ENKA 2IA1A 4R1HA 3E6BA 3FMRA 1TQIA 3NRVA 2IA0A 3DF8A 1U8RA 2FBHA 4IVNA 2R7FA 3F8CA 2EK5A 1D5VA 2VOOA 2A5YB 2HTSA 1T98A 3HOSA 5KK1A 4UNOA 4G7HF 5BMZA 2XASA 1FSHA 2OU2A 3F72A 5HDGA 3M8FA 3QU6A 4P9FA 4RGSA 3DV8A 1GXQA 3IKVA 1DP7P 3FXRA 4EJTA
chains in the Genus database with same CATH superfamily
1DUXC 2V1UA 2D1HA 1OCTC 1MDMB 2HOTA 3BCBA 1BC7C 3HOVJ 3AG3H 5A2QZ 1XDSA 1OR7A 3JRCA 1MW7A 1ONVA 2IVMA 4WF2A 4L5EA 5FO5A 3OWTA 4I98B 2B7EA 3K7AJ 2P7VB 3K4JA 5J1RA 1YW7A 3AG2H 2XGDA 3KYCB 2K9QA 3HUGB 2E7XA 1BIAA 4PFPA 3I55I 5L3FA 3Q0UA 3JRDA 2QBYB 1FIPA 3H5NA 3JAMK 3DLLF 5DM6F 1QGPA 1BM9A 2LH9A 4J19A 2EIKH 2DU9A 4B8XA 5GAGJ 5F1JA 5D5XB 3J7AO 3VB2A 1KYWA 3S3NA 1F9NA 1RRJA 2ZNZA 2K7LA 3J81K 4BS9A 3S8PA 5M3MJ 2NVTJ 1IUFA 1X1BA 2E2JJ 3G1MA 1RESA 3K70C 1SMYF 2X6YA 3JRBA 1LEAA 4C3JJ 3LA2A 2HOSA 2EILH 1GVDA 3CCJI 3BR1A 2MLKA 2HTJA 1HKTA 2O6GE 4N9IA 4JOMA 2M7BA 4B44A 3W2AA 3I58A 2PMZA 2JT1A 3BJAA 5FKOA 3WTUC 2R7XA 3HHGA 3OIQA 1R1VA 3KP5A 1SD6A 3BZ6A 2AXTC 2ZCWA 1ZGJA 3GZNB 1FJLA 2DFEA 4DJAA 4XRSG 1OLTA 3D5RC 2JUCA 3HJEA 3D5LA 3ZOBA 3ZN0A 1SVLA 2O03A 2QA4I 4FE7A 4II3A 4HSTA 3CUQB 3KYDB 5LHHA 1QO0D 3C2HA 3LFUA 2X48A 3J81Z 2CV0A 2ECBA 1DU0A 2DI3A 5D6EA 3GZ5A 1VQMI 3I59A 4UB8C 3TP0A 3BTJA 4FQGA 4ITVA 1FIAA 2DT7B 4DBRA 2P0WA 5GPCA 3S3MA 2EFQA 2DQLA 5E1WA 3HUGA 3IHUA 1LFUP 4LB6B 1W7PD 3K1MA 4A5MA 1WJ5A 3ZMZA 5EEAA 1I5ZA 4B47A 1LDJA 5EG0B 3KETA 5FD6A 1GXPA 1VQ9I 3LSRA 5CJ9A 2YU9J 4IHSA 1IDYA 2VKEA 2BYVE 3MAJA 4JX6A 4E7IA 2QENA 4KIFA 3SFIA 3WE2A 1L3LA 1O57A 1OKRA 2EV0A 2IEKA 3KLNA 2K9SA 2DA2A 4BDZA 2HQAA 3TDZC 2X6OA 4XONA 3U1KA 1PUFA 1JKOC 2DPDA 3TBIA 1Y8RB 2DFIA 4HF0A 4N4NB 3BQZA 4UVCA 3TOAA 1MSFC 5E1XA 3R61A 3G6EI 5IP7J 3ZRGA 2LKSA 1WVRA 3S2WA 2BHYA 1J5YA 4BDYA 3V8JA 3F6OA 2LY1A 1I3QJ 2CS3A 2F4OB 2Y0MA 1MNEA 3DWLE 3NAUA 4I09A 4IJAA 2VKDA 1UMQA 1W5TA 2XKPA 3RQ4A 3CCEI 2WA0A 2XHKA 2FD5A 1IV6A 1R49A 5DD4A 1B8IB 3K4BA 2LF7A 4MNUA 5DUIA 3HOTA 1Y8QB 2DDBA 3L2WA 2DT6A 1XMXA 1XX5A 2L7MP 2K3FA 5DTDA 4RAZA 3HGGA 1JTYA 5A2QK 1HF0A 1XN7A 2P4WA 2R5ZB 3K2ZA 3KP6A 1P7IA 2ESHA 4AC0A 2A6EF 3TO9A 1IGNA 1LFBA 4XLAA 1UAAA 3K0LA 1HDPA 2HQRA 3LSTA 1ITYA 2NNYA 2UUZA 2R5ZA 2Y9ZA 3K2AA 2IGOA 2EJRA 2OQGA 2Q0OA 1R71A 3BLYA 3E5XA 5DM7F 2Z16A 3I53A 4KT6A 3F8MA 3PQJA 1VQ4I 1WJDA 2PLYA 3G3ZA 4A3IJ 1BI1A 2E2IJ 1ZLKA 1U9NA 2HR3A 2XF7A 1HBXG 2B9SA 2KP6A 1ON1A 5IT3A 2WY7Q 1XSVA 2JTVA 3QRFF 3E6DA 2NYXA 3OIPA 3K9TA 4HG2A 2CFOA 2DFFA 4GXOA 1TBXA 4CGZA 3PUFA 2CW0F 1W7PA 1JGGA 2BY1A 2H1LA 2KKOA 1WJAA 4IL6C 2NNNA 4I02A 3RYRA 1XMKA 4RLQA 2X4HA 2EH3A 2JA6J 3IAS2 5D8KB 1TTYA 3BTCA 5IYBJ 2WAQA 3GTGJ 3WE3A 3HIFA 5D4RA 1QPMA 5DCFA 5CVRA 2M5WA 1TLHB 1S6LA 3OL4A 3HOXJ 3SXYA 1X3WB 5TGTA 4QWQA 3BT9A 2F2EA 2BY2A 4B3XA 2FRHA 4WCGA 5KNLA 1MJ9A 2ZKZA 2LFBA 2R92J 4UV9A 2ZFUA 3WG7H 2DMUA 2LY9A 4L9NA 2F5DA 4F91B 3OYEA 1YJWI 3FKIJ 1A36A 3VPRA 2QQAA 2HVSA 3VWBA 2HXIA 1YFHA 2HFHA 2FJ1A 1UHMA 3J80Z 1TP4A 3DQVC 1LFPA 2FSWA 4XN0A 3VYRB 3E0JB 2DJIA 2QF7A 4XKCA 1TL8A 1VQKI 3K4CA 2L0KA 2VC1A 4V2GA 1H0MA 4YFNF 2LBFB 1FY7A 2VBZA 1USSA 2JA8J 4LLGF 3H0GJ 3V8KA 5JHFA 2L7KA 2EFNA 4HV6A 4NNJA 5FKLA 2WB1A 3IRRA 4RMNA 3NWTA 3NWSA 4EV0A 1XB4A 2YS9A 3BZKA 4BHPA 4LLLA 2KRFA 2XAUA 1Y56A 2MH9A 1OYIA 1W5CC 1LPQA 4MFDA 3IRQA 4G6TB 1XGMA 3H9JA 2HDWA 4BUPA 1R7JA 1LJ9A 4O5VA 2K5CA 2A69F 4JX4A 3OIOA 5LRRA 3HOYJ 1P4XA 1TQPA 1WWXA 1XS9A 1FEXA 5AIPA 2H1KA 1IW7F 3PFIA 4CZCA 3HZJA 2LD5A 2EFPA 1P6RA 1R58A 3IH4A 2NXNB 3PUBA 3WHBA 5D5UB 1IF1A 2XC7A 4AIDA 5FFZA 4BJTA 1K61A 4EJVA 1DPRA 4B43A 4GO1A 3I56I 2M87A 5E1ZB 4I0BA 5EYRA 3CTAA 1OCCH 1WCMJ 2G0EA 3GTQJ 2HYJA 3I64A 4LGWA 4BY1J 2VJ5A 1O3SA 4CO8A 2DT5A 2X51A 3TO7A 5JFRA 2Z3YA 3OYNA 3OSFA 4I2OA 4OMZA 1S5LC 2QVOA 3FDYA 2X85A 2HPMA 2JA7J 3CCUI 4XRMA 4AIJA 1MZBA 4CDGA 3CUOA 3ERED 5KCMA 3K4KA 1WSUA 4HBLA 1R5GA 4BBRJ 4EM2A 4YFXF 5H2FC 3SYTA 1YRNA 2XRLA 3UR3C 3ZGKA 5J8FA 1IRXA 1Z7UA 4DZPA 4WXHA 2O7OA 5ILUA 5F0HA 1Y0NA 3S1RJ 2MFZA 5ILSA 3ULQB 3JRGA 1OFCX 2PMUA 2CO5A 5IOYA 2BGCA 3P9CA 2PJRA 4XBFA 4PGGA 4Q5SF 3QOEA 2HI3A 5HLTA 1MJAA 4QPQA 2NOGA 3JREA 3K4LA 4E4HA 4UHTA 1ZRDA 3CCYA 4A6EA 4AYBA 4CA0A 3N05A 2ZMEB 4DW6A 4M9ZA 3GMEA 1POGA 2X0LA 2E34A 2LF8A 3IKTA 3BG6A 2V1DA 4RGRA 5K7HA 1BJZA 4P55A 3S3OA 3H5RA 4CUGA 4Z6YA 3HRTA 3ISPA 1YHQI 2H6CA 2PEXA 4W1UA 1IN5A 1YS7A 2O8XA 3CCMI 2HPIA 1T08B 3I54A 5LGNA 2EA2A 5M5YJ 1K78B 2F5FA 2H8WA 2DA6A 2VJJA 3BQYA 3TOBA 1G3SA 4DYQA 3P9KA 2R93J 2PX9A 4M72A 2C6YA 2RC4A 1HQCA 3HTSB 1J2XA 2A6HF 2LG4A 2D45A 4DYRA 3ZPLA 3PQKA 1S29A 3K10A 1OCRH 1RETA 2VT2A 3ZQ7A 3GFIA 2JQ7A 5TJJA 2E1MB 4BJ6C 4F7ZA 3S1MJ 4BXUA 3FK6A 1HA8A 3RPQA 2LTPA 1I1SA 3U2RA 5LGTA 1D1CA 3BG3A 3VSLA 1CF7A 2V7FA 3KP4A 1SEUA 2YX4A 5JVGF 4PGHA 2DLLA 1W7PB 1MMGA 1FYLA 2DMPA 2NS7A 5LGUA 2V1XA 1ZKGA 1FBSA 2VOPA 5K7FA 1RIOH 4A2UA 1AKHB 3ESWB 3DEWA 1GDTA 1DGRM 3S2DJ 2OJED 4L0YB 4KISA 3S16J 2MD0A 4XRFA 2P5LC 2IGNA 2AHQA 4Y52J 3KFWX 2K40A 4K2EA 3GVAA 1JHHA 2UV1A 1LE8A 3RPUD 4G7ZF 4J01A 2M4GA 2HDDA 4BGDA 4BKXA 3Q0VA 3IH3A 1IN8A 2XDVA 2ZXWH 3M9AA 2VJIA 4ZYEA 1K83J 3PNTA 4Y13A 1FYMA 4N0BA 3OOUA 5E17F 3ONQA 1A6QA 3KX2A 3BDDA 1W1WE 1SFKA 1D1BA 5HLHA 1T6SA 3U1DA 1J7KA 2H09A 3V8LA 3LNQA 2HEOA 2HOEA 2H8RA 1ZAOA 2EB7A 3R0AA 4JQFA 2R7UA 3QU3A 4IOCF 4Q48A 4YELA 2KDOA 5D8LB 1Z91A 1ZRCA 2L4MA 3LSGA 2RNGA 2VB6A 5ICGA 2KHMA 5E8IA 1R1UA 2MA3A 1H9GA 3TO6A 4FETA 5EEGA 3ZQLA 2Z1DA 4EJWA 4CYCB 3HKZA 1UG0A 3L00A 4UY8I 1IN4A 1ZR2A 5D5VB 2FEZA 2VQCA 1W0UA 1UB9A 1Z3YA 2DA1A 1TWFJ 1IV8A 3A4CA 4LITA 2DBBA 4AIHA 3HHHA 4E70A 1JXSA 6PAXA 2E1CA 4S05A 2W48A 2E60A 2VBXA 4M9XA 1NTCA 5JI6A 4ZH4F 1LNWA 4LFUA 1XCBA 2KRCA 3GYHX 5FFXA 2H94A 1WJCA 4Y15A 1MMSA 1ULYA 4JX5A 2RQPA 2IGKA 1FZPB 2I8DA 4HQMA 1S9HA 3FISA 5GTIC 2ZXIA 4DYCA 4YIRX 3MVPA 1SAUA 4KMUX 4BQQA 4IF4A 2DTZA 4ZYAA 4MTDA 4MHGA 2WB1N 4ZZDA 3AAFA 1RZ4A 2EFWA 2YPRA 1FT9A 2KIUA 4BE0A 4XLNF 3PNYA 2UWMA 4M74A 3ROUA 4JBAA 1R5ID 3HYIA 3BG5A 4B1RA 3FXQA 1FOWA 2FNPA 1Z77A 1V5GA 4ZYDA 5AONA 3ZMTA 2DYSH 1MIJA 2L01A 3CESA 4ON0A 2CUZA 2ZJQF 4KN4X 3HRMA 2FBKA 2R3SA 1B6AA 2RREA 3KP2A 4JYKA 4AWXB 2CJJA 2COBA 5L3EA 4RB3C 1MMNA 3ML6A 1Y1WJ 1HSJA 3R60A 4IHYA 3VEPA 3BR0A 2M4KA 2G7HA 3VODA 2DK5A 3ABUA 3FF5A 4BEHA 2IRFG 1GLNA 2OZUA 3G2BA 4LK0F 2CWEA 3IC7A 2K9LA 3K4NA 4MFEA 1S8NA 2GIVA 4HDVA 3FK7A 1SVMA 3H36A 2GQQA 4ETSA 5C44J 3RI4A 2IPQX 4LIVA 4A3BJ 4EGYA 1LB2A 3MD2A 1S7AA 3GLXA 1YW8A 2MC3A 5D6FA 2QWWA 4XLCA 4XMYA 3AG1H 4FHTA 3DTIA 2OBPA 4U0VA 3F6VA 1YIJI 2R7OA 4IOAF 1MBFA 4LMYA 1UG2A 1Y6IA 2OQRA 1UCRA 4A12A 1RR8C 1P4WA 2R7RA 1EJ9A 2JVGA 2ME6A 4BH9A 3ZQIA 2CMPA 4A0ZA 3M1EA 4PK4A 4BAYA 5ICCA 2P5VA 2GA2A 1U5TC 2M45A 1R00A 2NS8A 1MDMA 4C3HJ 3GWZA 5BOXA 1XGNA 4A3DJ 4E6KG 2Q8KA 5K5QA 2AS5F 3E6MA 1RKWA 2R5YA 3TW6A 2LDUA 2OCCH 1H89C 2BW3A 4U0YA 3OYKA 1B72B 4BYYA 1MBHA 1WGXA 4ZJZA 4AVPA 3CJTB 2FUG2 2ZXHA 3GTMJ 3D5SC 5EZHA 2A61A 1WJBA 5ICEA 1WFXA 5IY5H 4P9UA 2O5RA 2MLGA 3LA3A 2GLOA 1YOVB 2VE9A 4C2UA 1FX7A 3RSNA 2JA5J 4H0EA 3F9KA 4D0PA 3A0HC 5FD5A 3TEDA 1YQAA 2DMNA 3WTSC 2FMYA 1GT0C 1MJBA 4R79A 2P6SA 3S1NJ 2KIMA 1BI0A 3MMYB 5E3NA 2RQQA 4XK4A 1V5EA 2IS2A 2XB0X 4UVBA 4IRGA 2CUEA 3B6CA 3DTKA 2P7CB 2JRMA 3BC8A 2BHZA 5LHGA 3GFMA 5B1AH 2VT3A 3K1PA 3IH2A 2W57A 3F0CA 1V4RA 3CDIA 3WTZA 3L2RA 1AWCA 1H88C 2M0CA 2FF4A 3AFHA 2X6WA 5B1BH 4BL0B 4D1QA 1ETWA 3OYGA 2VXDA 2DA7A 4HX4A 2F6CA 1BBYA 1WH7A 2KJBA 3P7NA 3IP4B 3CMEI 4AM3A 4EGZA 2M8EA 1Z6RA 3FHNA 4M73A 1K4TA 3ZMVA 3ZQHA 1JT0A 3B6AA 4X0GA 3BROA 3EPZA 4L9JA 1G3YA 1U2WA 2QBYA 5L3GA 1ZK8A 3H3ZA 2QYOA 3JRAA 3HSFA 4MQ9F 4KDPA 2FX0A 2X1EA 2NVQJ 1OQYA 3HB9A 1Q1HA 3SFZA 2YX7A 2BW3B 3ECHA 4RB1A 1PVEA 3JW4A 1ETYA 2FOKA 1QVUA 5HS8A 3QWLA 5EJCA 1E3PA 3GXOA 2UZKA 5ICFA 2XV4S 4OOIA 4OU0A 3WTYC 3ZMDA 1VTNC 2O8KA 2GBYA 2M1BA 3BZCA 3CLQA 1KU7A 1PP8F 3T5XA 1D0YA 5AIQA 3EDPA 1D5YA 5E3LA 2V9PA 1F1ZA 1YIOA 3CDLA 3LL7A 3R6SA 2Z33A 4BNCA 5DS9A 3RQIA 3LQQA 2DK8A 3H9GA 4RAGA 1RUNA 4IHTA 2O0YA 1FC3A 2EA4A 3F8BA 4AVZA 3GEZA 1OR7C 1ETXA 5ERIA 4A3LJ 4LK1F 3ZP5A 2CV2A 3SDBA 4IHXA 2EFOA 4XLPF 1DDNA 1ZGWA 1Z05A 3DTEA 1JUPA 2IT0A 2BOLA 5J8CA 3FM3A 2V9KA 1A5JA 5IOZA 2QSHX 3HSRA 1VQ8I 4M3EA 2NS0A 5FROA 3TKYA 2RV8A 5DCMA 1HW2A 5EF6A 2ZJ2A 3OS2A 2PN6A 1D0ZA 3FXLA 4M6YA 3FXOA 1A35A 4KJZA 5GADJ 3VFZA 2FQ4A 4HLXA 1B9NA 2VL8A 1KQ9A 1ZELA 3BWGA 1R36A 1W5SA 4BQNA 1OISA 4EJOA 4OINF 3KEOA 4CSWA 1PUFB 4RDUA 3DFGA 2RVCA 1VQ5I 4FE4A 2DN0A 3CCLI 3H1CA 1J59A 3WG9A 1MH4A 3V7RA 2CH0A 3RJPA 3N4MA 3MZHA 5HDKA 1RUOA 2EIJH 3FIWA 2HVQA 2WBMA 2JSPA 2XVCA 3A0BC 3TQNA 3AL0B 5IT9Z 4HLYA 4D5CA 3QPHA 3FHZA 2Z99A 1OPCA 3DXJF 1KA8A 5BS6A 4A3KJ 1J75A 3TDUC 1TC3C 4RB2C 3W6JB 2X9DA 2L9RA 1J09A 3F3XA 4DZJA 3E5QA 1F4KA 1DU6A 1K6YA 2HOAA 1G2HA 2IW5A 2L9NA 4B09A 2LK2A 3CCRI 4FISA 3GTJJ 2XKOA 2ZMEA 2I10A 5H20A 2I5UA 1LDKB 4CZZA 1X3ZB 5HODA 1LEBA 1Z6TA 3CUQC 1M1EB 3P5JA 2V79A 2M3AA 4D7MA 2JK3A 2HQ5A 5DV5A 1A6IA 3A1YA 5C4XJ 3M8JA 2PBIA 3VYUB 3GX4X 2E1MC 4XN3A 2FU4A 4JK1X 5IYCJ 2X6XA 1T0FC 1ZGAA 3RKYA 1ZG1A 1U5TB 3CMAI 3SQNA 2ZSIB 3Q5FA 2JPCA 3LOCA 4HRIA 4OIQF 3F8FA 4RB0A 4NHJA 2A07F 1TT0A 1QRYA 4HW0A 1E17A 4IQ4A 1KU2A 2JPBA 5D5WB 2W00A 2VBWA 5CLSA 3I0TA 1R22A 5J1YA 2FMLA 3CZ6A 3EETA 2O9LA 1QA6A 4XOTA 3UNGC 2MH2A 1GUUA 3IUOA 4RA2A 2HWVA 3FM5A 4BHBA 4I0AA 3WTVC 3FXJA 2DA4A 4ZDLA 3KZIC 1P2FA 3KLOA 3EUKL 1MKMA 1QQIA 1ZG5A 3Q0WA 5CVUA 1QZZA 3DKXA 5CVIA 3VYSB 1PJRA 1A31A 1KQ8A 3T1BA 4D7NA 2FNAA 2K3PA 3I9V2 2MABA 5FLXK 1PYVA 1TT5B 2STWA 4XKBA 1FPQA 1BOAA 3KEYA 1I1GA 3LSPA 5IP9J 3I4MJ 2EZKA 2CQQA 1H8AC 1X1PA 4UUVA 2E7WA 4XORA 1R4MB 3NQOA 1KYZA 1LQ1A 1T0FA 3OYJA 3A01B 5LEJA 2PJRB 3SZPA 5TISC 2KFDA 3CC7I 4GRIA 2VXZA 1ON2A 3AG4H 3V4GA 3JSPA 1SFXA 2XB5A 4CCOA 1TW2A 1OCZH 4KNYA 4XNFA 1EF4A 4RAFA 1SVOA 2HZTA 3QYFA 1A04A 2AXLA 2N8GA 4U88A 2JJ7A 1ZH5A 4IHWA 1GHCA 4A6DA 2RAEA 1W36D 5IPAA 2QM3A 2FBIA 4IX7A 2LBFA 5FRMA 4A3JJ 2W7NA 2Q2EB 4L18B 2GA1A 2ID6A 3K6GA 3S32A 4DQ2A 1FTTA 3H3VK 5TRDA 1USTA 3O3KA 1R6RA 1RR7A 3WHCA 3W2WA 2VUMJ 1BW6A 3CMYA 3EYIA 4OAYA 1IXRC 1UELB 2VKHA 4M3BA 4ABZA 4LLNA 1FTZA 3CD6I 3SDGA 4CCLA 2L5QA 4ENJA 3W2VA 1OYWA 3SEQA 2R4GA 2ZC2A 3U9GA 4LG0A 4PJ0C 2PMHA 4BQAA 2E1NA 4A3GJ 1P92A 2MGQA 2M8GX 2GAUA 3FX3A 3H3UA 5M3FJ 4FX0A 5LHIA 4PJJA 2K27A 5JLXA 4RS8A 4W97A 3LA7A 2Y48A 3WGIA 3ABKH 3WU1B 3MKWB 2KZGA 5HNHA 1R23A 4XKVA 5GTHC 3CQZJ 2ELJA 3DBLB 3SZGA 5B66C 1K4SA 3ABTA 3KP7A 1ZQ3P 1FSEA 2K9MA 5CKTA 3KEQA 3L09A 5J40A 2F5VA 1H9TA 2MD5A 4PJLA 1ODDA 3WTXC 2E36A 3B73A 1JKPC 1FBUA 4E7LA 1YJNI 2LREA 1TWHJ 3KCCA 4RM2A 3BR3A 3L1PA 3QOPA 4KIBA 1G8XA 2OF7A 2XIGA 2VPRA 4HQEA 4EMSA 4LB5A 3DBRB 4BHCA 2Z2SB 2JWTA 2DA3A 1MD0A 1MBJA 4NQWA 1WPKA 4GCVA 1Z7LA 4YG2F 4NUBA 3KYLA 1HXDA 3HXLA 4Y17A 4NC6A 3OYHA 4PCQA 3ZQCA 1IRFA 2DOFA 3GBGA 2HU9A 4B4CA 4CICA 2R7TA 5JR3A 1O7LA 1I6XA 3IV5A 3K70D 5JHUA 4PSXA 2BV6A 4L9TA 2CSOA 2LYCA 2CQXA 4C9YA 5E79C 2TRTA 1U3EM 1IO2A 4M71A 3OYBA 2ELHA 4BACA 3Q9SA 2JVHA 1L0OC 1AOYA 2KIQA 3L2VA 2B63J 2DOAA 2ID3A 2XF6A 3ZMSA 2BXYA 2W84A 1QNTA 1WH5A 3QPTA 4KN7X 1YJ9I 2GOMA 4DBQA 2ZXJA 2OCEA 2P5KA 5E20A 2X1CA 4MO7A 4QIWN 5FB2A 3RPUA 5DD8A 1YYVA 1IN7A 3W6VA 2ISYA 2KT0A 2XGCA 3HG9A 1YS6A 4G8XA 4BU2A 4N4OB 5CPRB 5F0CA 5LD2C 3DKYA 5F6FA 4A93J 1V5FA 2L54A 2VASA 3A03A 4U0WA 3T8TA 2KRHA 3COAC 2PFBA 1ZLJA 4A0XA 3E1SA 3FMSA 3OYCA 2MC4A 5BPDA 2PQ8A 3LSIA 4M6XA 3C3WA 4KFCA 5F27A 3GZ6A 1XD7A 4KIGA 2TCTA 1HLVA 3HBLA 2CQKA 4YIFA 2XPVA 3QYBA 5CVVA 3L2UA 3CUQA 1WJEA 2BY3A 2KISA 2XAJA 1VQ6I 5HVQC 4U7DA 2OPTA 1BR1A 2WAQN 3LMMA 3LSHA 3DEEA 4XSXF 4CYCA 2LLKA 2A6TA 3CJRB 3DU6A 1WJFA 3EYYA 3KPHA 4KITB 1NH3A 5BNGA 2CU7A 2ZB9A 3QP6A 3WU2C 3ZQFA 2DYRH 4ZYGA 4NQWB 1S72I 2XAGA 1TZLA 3RDIA 2CW7A 3BG7A 4O6JA 1FYKA 3HM5A 1BI3A 3EUAA 5CQEA 1KZHA 3E7LA 5DUKA 1NK2P 3HOZJ 4O3MA 3O6BB 1ERDA 3JRHA 3HPGA 3ECOA 3MFKA 3G73A 1NHAA 4CCMA 2OUMA 2RKHA 3RYPA 5EDNA 1EV7A 3QQAA 2BZTA 4EJUA 4LOCA 1B4AA 2NOJB 2RNJA 2GXGA 4L5IA 3ZQGA 2LRDA 5F1RA 1IDZA 1XSXA 2P6TA 4HZFA 1G3TA 3I3LA 1MNDA 4IKFA 3CDHA 2E5NA 1TWAJ 2DJNA 4AUXA 2DPUA 2HXOA 2Y0SA 2LY2A 1NK3P 2VQHA 4A5NA 1EH6A 5HNFA 2DDAA 4PSWA 3OYAA 2XRNA 4BY7J 3DCFA 2EZHA 1D0XA 3M8EA 2JA2A 1D1AA 5FRNA 1QZEA 4HYEA 5ILVA 2IGMA 3KZYA 4RGXA 5LEKA 3OS0A 5IP6A 2LMDA 4KA4A 5BQTA 5DDGA 4Y33A 5FJ8J 1J9IA 2ICWG 3OYFA 1VF9A 4Q47A 5KVRA 1QHGA 1N75A 2WV0A 2X1DA 3DP7A 2VIXA 1GV2A 2E71A 2XGEA 2IP2A 5KAIC 4ASNA 2RGVA 1ZREA 4E7ZA 3BTIA 1XMAA 1JT6A 1U8BA 1HCRA 1D8KA 1ETQA 1I3AA 1CF7B 3WODF 3PSIA 2CQ7A 1LVKA 4F52A 1R4NB 4BXXJ 2DAOA 2DFHA 5JVTA 1DP3A 4IEJA 2M34A 1K78A 2JZYA 4XR6A 2L2OA 2M7AA 3CP2A 3E5UA 1VQ7I 5CVJA 2M2EA 3BY6A 5DEQA 3WTTC 5M5WJ 2H27A 4XSZF 1TNTA 2QEXI 4A3MJ 2HNHA 3GTPJ 2OV7A 4KMFA 1S7EA 3K4MA 2DODA 3T0YA 3J7YJ 2XF5A 1RI7A 3L7WA 3IWZA 1MSEC 3GTOJ 5IT9K 2ZNYA 4PFOA 2VI6A 5CYVA 3C18A 3EUHC 4MGRA 1W4MA 3KZZA 3G71I 2R7WA 1XG1A 2MG4A 3K69A 4L0ZB 2J5PA 2IS1A 3A02A 3CCQI 2BEOA 3C2BA 1N25A 3C1DA 3HEFA 3G1LA 1MMDA 1B1BA 2YSRA 3SHFA 1BW5A 4HOBA 1C0WA 4S04A 1IUYA 3MKZA 1VQLI 4BEHB 4RBOA 3M4OJ 4Y7NJ 4IZZA 2O61A 3S17J 1EKEA 1AA7A 4PJMA 1XGSA 1BC8C 2JN6A 1D8JA 4ANJA 1FP1D 4NB5A 1RC9A 1OMIA 4PJNA 1F5TA 9ANTA 2QLZA 3ELKA 3GF2A 3W6KB 1I27A 2V9VA 2V6CA 3OY9A 4CHUA 2D5VA 2WAFA 2MBFA 2HZDA 2EIMH 4MQVA 1R1TA 2HKXA 3V7SA 3M3YJ 1MH3A 1YW9A 3HL2A 3A2KA 3CCSI 4OMYA 4E7JA 2CRGA 3CJNA 3LAJA 5L3DA 4CXFA 1FBQA 3BJ6A 3MEXA 4BE2A 2ZSHB 1BJAA 4UUTA 4ZTFA 1Z67A 5C3EJ 2LOOA 4A3FJ 1BOBA 1QHHD 1X1DA 1VFCA 1X1CA 1MMAA 1WI3A 3CJQB 4D5FA 4MIMA 2Z9OA 2DMTA 4EVIA 3G4SI 1F36A 4N9HA 4R8HA 4V2FA 1P7JA 4FTHA 3UKGA 3N97A 4L5JA 3CO6C 1ETOA 3U21A 3PIOF 3H0DA 2ADUA 5KHDA 4AIKA 3HSEA 3C7JA 3QYEA 4ENMA 5F08A 1F43A 2NVYJ 3ASOH 3CCVI 1ZYRF 3TL4X 1PP7U 2G9WA 1QPIA 3PFYA 4DNCA 4KT5C 1U0JA 1YLFA 2QSGX 3PL8A 2QQBA 1SFOJ 1FP2A 2VKVA 2KPMA 1BI2A 3S14J 3F8NA 4B3AA 2LNBA 3BPVA 1WKMA 2HQNA 1JE8A 1YE9A 2UXNA 1TQMA 4KICA 4G94A 3J80K 1OYYA 3DKWA 1SMTA 4NBQA 1FOKA 3PO2J 1Q1VA 2PMZN 2NRAC 2QUFA 4F55A 2EWNA 3PM1A 4WXDA 2KL4A 4M3DA 2ZBKA 3BCAA 3H9QA 1WHUA 3GO5A 3S1QJ 3RCOA 2XAFA 2L3DA 4GYGA 3R4KA 3M1CA 4YFKF 4WX9A 3H35A 4QPOA 2VODA 4RM3A 2Y75A 2JUGA 1FNNA 1BIBA 4ZDOA 2QZ8A 1UZCA 1APLC 4QSHA 4II2A 2NVUB 4RGUA 2VE8A 3RKWA 3GW2A 3FXMA 4BJ5C 1DPUA 3HRUA 3IAM2 5EGOA 4L9VA 2EZLA 2JMWA 1R5HA 3WTWC 4C2TA 4ESBA 3LWFA 4IRIA 5HLIA 3OSGA 2PG4A 2ME0A 2NAZA 4PZJA 1ZRFA 4U7BA 2XAQA 3J7AY 4OWRB 1K6OA 1JKQC 1HSTA 1EH8A 2YUSA 4BE1A 3AKZA 3DU5A 3Q9VA 3SJMA 4IO9F 4XLHA 4J00A 4HEA2 5FGMA 1FLIA 1SD4A 2R5YB 4M9SA 4A3CJ 2KLOA 2EZIA 1GVJA 2PI0A 1V3FA 2AO9A 1S7OA 1B72A 2M30A 2VQLA 5E3OA 2G7UA 4EM1A 5LLQA 3JAMZ 1SFEA 5FKNA 1AHDP 4HF1A 3X2QH 2VPLA 2QQ9A 4FASD 2D1VA 1NG7A 4ESFA 1IXCA 3OYMA 4MTEA 2A3SA 2CFXA 3BR6A 4CCJA 3KE2A 2W4SA 3WGHA 1G4DA 1REPC 3L2CA 3BP8A 1HC8A 3O2PE 4I76A 5E3MA 1J0RA 1T33A 1Z21A 3LSKA 3OYLA 5K5OA 2BVLA 1CGPA 2DW4A 3OOPA 5F64A 1O7FA 1LKXA 1ZN2A 1K79A 2R7SA 2M9HA 2V4JC 4GYIA 5BPIA 2HGCA 5IYDJ 2DOEA 1YI2I 2HDCA 4FT8A 2Y69H 3P9IA 1WZ2A 3L9FA 5GPAA 2ACJA 2W24A 4EATA 3I5UA 1VQNI 1HW5A 2GZWA 4XOPA 2VONA 3MCZA 4XICA 4CCNA 2OD5A 1XGOA 2BXZA 4G6DA 4G9YA 1KGSA 4S0HB 4ENNA 2CGPA 2EBIA 2DO7A 2K02A 4LIUA 2CUJA 2V26A 1DQUA 1YX5A 2A68F 2AQFA 4P1WA 4GGGA 4CYDA 3J7ZI 1ZR4A 4I99C 1Y39A 3RKXA 4NC8A 2QKMB 2E2HJ 2YR2A 1HW1A 2HS5A 3HKZN 5JLWA 3W3CA 1TW3A 2XROA 2P81A 2Y2ZA 4ESJA 1U9OA 2CQNA 3O8GA 2IJLA 4XRSA 3JRIA 2VQGA 2ZFWA 1X58A 4UB6C 1TWGJ 2JSCA 4OIRF 5L3BA 3PIPF 2F48A 4U87A 2ESNA 3S93A 3HGYA 2A5WA 5HS7A 2DXIA 1FMWA 2FOWA 2OAZA 1YG2A 1T38A 2GM4A 3KP3A 1FWZA 1X4OA 2FA5A 2Y30A 1BL0A 2V6EA 2YU3A 1D3YA 2LC2A 2QCOA 1X4PA 1R9TJ 3CMMA 5LFAA 2VC0A 3F21A 1GV5A 4HNTA 1OCOH 2WC2A 1UHSA 4AD9A 4Q4ZF 5DYMA 1KONA 1IZ1A 3EUHA 3HPHA 2ECCA 5H6QA 5E18F 1X2NA 3CC2I 3VSKA 1XTAA 5HOOA 3ABLH 3BJOA 1O4XA 3QP5A 1Z1DA 1U5TA 4C2MJ 5EZGA 1JUSA 2BE5F 1W0TA 4LG0B 2CUFA 3BG9A 3CF2A 3GFLA 3IL2A 3RKQA 2EV6A 2D2WA 3PJRA 4P96A 5FLXZ 3ZXSA 4RAYA 4E7KA 3SEZA 2ZJPF 2ZO4A 3BR5A 4C30A 3DBHB 5C4JJ 2IA2A 1U78A 5J1UA 3HDDA 3G1OA 4IRHA 2H6BA 1XDUA 4EEFG 1WI9A 2L9VA 4NDLA 5HS9A 3WU0A 3REOA 3V7CA 2LKXA 2IBDA 1JGSA 2XSDC 1FOYA 2STTA 2K4BA 3K1NA 4JP0A 4F92B 2OZ6A 3IWFA 3MN2A 1UJ8A 3VDXA 2Y9YA 4XM3A 3TP3A 2KMUA 1VI0A 1B9MA 4WK8F 2R7VA 4HNVA 2WADA 1SAXA 2R0QC 2RDPA 2LSOA 4KUMA 2VN2A 1BR2A 4UUSB 5J6XA 5K7ZA 3LSJA 1K7AA 4HDUA 2W25A 3DEUA 2V1NA 1YRNB 4G7OF 3OYIA 2FE3A 3ERMA 3H5AA 1N78A 2F4MB 5K5RA 3PSFA 2F5EA 3A01A 2ISZA 4GDFA 2B0LA 3ZCOA 2E5ZA 3CF5F 2KDZA 3E3VA 5H6RA 1X1AA 3FWEA 1FMVA 1RKTA 4Z2YA 4ZYHA 3HOWJ 3S15J 4HX8A 3VYTB 1LE8B 1JI8A 2WAEA 5J4VA 1X19A 1T8IA 2EINH 3E97A 1ZTRA 4I7HA 2GXAA 3GLLA 2J5OA 1Y1VJ 3FKJA 4PUSA 3GCMA 3JCUC 1B59A 2RN7A 3H92A 2P8TA 4IHVA 2HYFA 2BVMA 1I6HJ 4HV5A 4I01A 3HTUA 3I4NJ 1SD5A 5LBQA 4ZTJA 1SFUA 2OTLI 1KU9A 4XIDA 1STZA 2LKPA 2BBYA 2LR8A 1E3HA 4A69C 5CQGA 1KQ0A 1E3OC 3JSOA 1MNMC 2M0MA 3HC7A 4X6AJ 2ZJRF 3ZMUA 3MWMA 5GAEJ 3FBIB 3ABMH 1HDDC 5DCMB 1JUMA 1MBEA 2R7DA 3NARA 4OIOF 1I50J 1SD7A 1P9QC 2Q2EA 1Z9CA 3JTGA 4M3FA 2DCEA 4AYBN 4A0YA 4QTRA 1IG7A 2KJCA 1T95A 2VBYA 3C2GA 4PDKA 5D4SA 4WXCA 4FCYA 2IXSA 4UXNA 1S3JA 3PNVA 2EPFA 2MW8A 1XC5A 2LP0A 1B8IA 1QBJA 2R7ZJ 1VNDA 5M5XJ 3HOUJ 4OAZA 4D9JA 4ZC3A 3RZOJ 2KZVA 4P5OA 4ZZLA 2R7QA 4CH7A 2XAHA 1VQPI 2IS4A 1ETVA 4HAMA 2TDXA 1IAWA 3FZVA 4G6QA 3ZQQA 1IXSB 4ZDPA 5FKMA 4IPAA 1T56A 3TMOA 3VOEA 3ZN1A 3GUDA 2HYGD 5B5EC 2MYSA 3LQRA 4F93B 3LSMA 4DOZA 1QZYA 1E2XA 4M3GA 1BN5A 2MSYA 3M07A 1IC8A 4LD5A 3NEUA 5EEHA 1BR4A 3DPTA 2EV5A 2L7ZA 2COMA 1ZG3A 1T2KA 3T8RA 4G12A 4HF2A 1O3RA 2O3FA 3CP8A 1O3QA 5EG0A 4XL9A 2K86A 4KYWA 1UHWA 4YIIA 3CO7C 1KU3A 3E6CC 2K4JA 4WWCA 1Z0XA 4Y4RA 3BPXA 3TGNA 3V42A 4EQQA 3MZ8A 2GIZA 2CW8A 5ED4A 2WV1A 2OA4A 2L02A 4QLCU 3BR2A 4AU7A 1LDDA 2VJ4A 1TWCJ 2K9NA 5F0FA 2CYYA 4LJZF 1XPXA 3BOQA 4OIPF 3RIRA 1SC7A 3FXUA 1ORKA 2W82A 4HX7A 3R0JA 4HPQA 2JRTA 3DPLC 3LAPA 1T39A 1MBKA 1YX3A 3DLAA 1LUJB 2CG4A 3SZTA 4Y3OA 5J4YA 4E7HA 2IS6A 1ZHFA 1IRGA 3HRSA 3EQLF 3OV8A 2CV1A 3D0SA 2LVSA 2WWYA 4TV7A 3OL3A 1UFMA 3GTKJ 3MZYA 1I39A 2XSJC 2HKOA 2XPUA 4F3QA 3CC4I 1X3UA 2XGXA 4XLEA 3JTHA 2IAIA 4XKWA 5GAHJ 3B02A 1JTXA 1U6GA 4GFBA 1E0EA 1MBGA 1RNLA 4YEJA 5L3CA 2E35A 1HKQA 4MLOA 3FMQA 3ASNH 2XPWA 3LFKA 1NG6A 4EM0B 3BTLA 2F4IA 1AU7A 3S2HJ 1ACIA 4HNUA 1Y0UA 2F5CA 3GFJA 2DQRA 2UXXA 1FOXA 5B3SH 2Q1ZB 1G6NA 5GP9A 1JHFA 3WGGA 1XSDA 4M6VA 5J3LA 3I4PA 2OC6A 4BQOA 1PUEE 4MEYF 4UVAA 2W85A 2E19A 4X1EA 2FQ3A 2HVRA 2GWRA 4E7SA 2DA5A 1V55H 2L7FP 3OR1C 2WTEA 4MEXF 2ETHA 3OR2C 2DMQA 3TW7A 4DIQA 1WQ2A 4XQFA 1QU3A 1YO5C 3OYDA 4UV8A 1WRJA 5FKKA 1OCPA 3M7GA 4DGWB 2KIFA 5HLGA 3I59B 2GXBA 5EGOB 1YTYA 1JKRC 4YRVA 2OTJI 1P4AA 1XCVA 2Y31A 2QQ8A 1DGWY 2Y0SN 2KQRA 3D1NI 4RLFA 3Q3SA 4HA8A 3CLOA 1N77A 3MQ0A 2BY0A 2AQEA 1TNSA 1W36C 2PJPA 5FLMJ 2XUBA 1EA3A 3KIOA 1ZARA 3RTRA 1RPWA 3F23A 1O3TA 1PDNC 1HKSA 4UUSA 3L2QA 2E1OA 4NC7A 3O8HA 1AKHA 4V19K 2ELKA 2EQRA 4B48A 3FBNB 4FX4A 4C3IJ 4BBSJ 2L4AA 5LRSA 3JR9A 1IN6A 3ZR8X 5E8GA 1LVAA 3PO3J 2Z5UA 3FXKA 2A05A 1HOMA 2W1OA 3JRFA 3OMYA 1EH7A 3QAHA 1G3WA 1IRZA 1ETKA 5FLVA 3F22A 1OJLA 2DTRA 1MGTA 4XLFA 2FXAA 1BA5A 1JJ6C 5K1YA 5HDNA 3I71A 1ENHA 4IXAA 5J47A 2IA1A 4ENKA 3GTLJ 3MKYB 4R1HA 1VQOI 3E6BA 1Z3XA 3FMRA 1TQIA 2QSFX 3NRVA 2IA0A 4A3EJ 4BXFA 2ZMEC 3DF8A 3QPLA 1U8RA 2FBHA 2GOXB 4H4KC 4IVNA 2R7FA 3F8CA 2EK5A 3QODA 3QPSA 1D5VA 2QGUA 4I6ZA 1X2MA 2VOOA 2A5YB 2K85A 1V54H 2HTSA 1T98A 2L9SA 3HOSA 4HSRA 5KK1A 4UNOA 4G7HF 5BMZA 4CCKA 1YITI 2XASA 2VLAA 1G59A 1JJ8C 3AL0C 1FSHA 2OU2A 1CQTA 3F72A 3MKLA 5HDGA 3M8FA 3QU6A 1QVTA 3RZDJ 4P9FA 2QKLB 1SANA 4RGSA 3DV8A 2NVXJ 1GXQA 3IKVA 4IQJA 1DP7P 5F04A 3FXRA 3DPUA 2WY8Q 4LG3A 4EJTA 1IJWC 1VZ0A 3OS1A 5KAFC
chains in the Genus database with same CATH topology
1DUXC 2V1UA 2D1HA 1MDMB 1BC7C 5A2QZ 1XDSA 1OR7A 1ONVA 2IVMA 4WF2A 5FO5A 4I98B 2P7VB 1YW7A 2E7XA 1BIAA 5L3FA 2QBYB 3JAMK 1QGPA 1BM9A 2DU9A 4B8XA 3J7AO 5D5XB 3VB2A 1KYWA 1F9NA 2ZNZA 2K7LA 3J81K 1SMYF 1LEAA 3LA2A 2MLKA 2HTJA 1HKTA 2O6GE 4N9IA 3I58A 2JT1A 3BJAA 3WTUC 3HHGA 1R1VA 3KP5A 1SD6A 3BZ6A 2ZCWA 1ZGJA 3D5LA 3ZN0A 2O03A 3CUQB 5LHHA 1QO0D 3J81Z 2DI3A 5D6EA 3GZ5A 3I59A 2EFQA 2DQLA 5E1WA 3HUGA 3IHUA 4LB6B 1W7PD 3K1MA 4A5MA 3ZMZA 1GXPA 1I5ZA 3KETA 1LDJA 4IHSA 5FD6A 5CJ9A 2BYVE 3MAJA 2QENA 4KIFA 3WE2A 1L3LA 1O57A 1OKRA 2EV0A 3KLNA 3TDZC 2DPDA 4HF0A 2DFIA 4UVCA 3TOAA 5E1XA 3R61A 3S2WA 1J5YA 3V8JA 3F6OA 2Y0MA 4IJAA 4I09A 1W5TA 2XKPA 2XHKA 5DD4A 2LF7A 4MNUA 5DUIA 3HOTA 4RAZA 5A2QK 1XN7A 2P4WA 3K2ZA 3KP6A 2ESHA 2A6EF 3TO9A 3K0LA 2HQRA 3LSTA 2NNYA 2EJRA 2OQGA 2Q0OA 3E5XA 3I53A 3F8MA 3PQJA 2PLYA 3G3ZA 1BI1A 1ZLKA 2HR3A 1HBXG 1ON1A 5IT3A 1XSVA 2JTVA 3QRFF 3E6DA 2NYXA 3K9TA 4GXOA 1TBXA 4CGZA 2CW0F 1W7PA 2KKOA 2NNNA 4I02A 3RYRA 1XMKA 2X4HA 5D8KB 1TTYA 3WE3A 3HIFA 5D4RA 1QPMA 5DCFA 5CVRA 2M5WA 1TLHB 1S6LA 3SXYA 4QWQA 2F2EA 2FRHA 4WCGA 1MJ9A 2ZKZA 4UV9A 4L9NA 2F5DA 2QQAA 1YFHA 2HFHA 1UHMA 3J80Z 3DQVC 2FSWA 2VC1A 1H0MA 4YFNF 1FY7A 2VBZA 1USSA 4LLGF 3V8KA 2EFNA 4HV6A 3IRRA 4EV0A 1XB4A 4BHPA 4LLLA 2KRFA 2MH9A 1OYIA 3IRQA 1XGMA 1R7JA 1LJ9A 4O5VA 2A69F 5LRRA 1P4XA 1TQPA 1WWXA 5AIPA 1IW7F 3PFIA 2EFPA 1P6RA 1R58A 5D5UB 1IF1A 5FFZA 4EJVA 1DPRA 4GO1A 2M87A 5E1ZB 4I0BA 3CTAA 4LGWA 3I64A 1O3SA 4CO8A 2DT5A 3TO7A 5JFRA 2Z3YA 4I2OA 4OMZA 2QVOA 4AIJA 1MZBA 4CDGA 3CUOA 3ERED 1WSUA 4HBLA 1R5GA 4EM2A 4YFXF 5J8FA 1Z7UA 4WXHA 5ILUA 5ILSA 3ULQB 2PMUA 2CO5A 2BGCA 3P9CA 4XBFA 4PGGA 4Q5SF 1MJAA 4UHTA 1ZRDA 4A6EA 2ZMEB 4M9ZA 2X0LA 2LF8A 3IKTA 2V1DA 4RGRA 4P55A 3HRTA 3ISPA 2H6CA 2PEXA 1IN5A 1YS7A 2O8XA 3I54A 5LGNA 2EA2A 1K78B 2F5FA 3TOBA 1G3SA 3P9KA 4M72A 2C6YA 2RC4A 3HTSB 1HQCA 1J2XA 2A6HF 2D45A 3ZPLA 3PQKA 1S29A 2VT2A 3ZQ7A 3GFIA 5TJJA 4F7ZA 4BXUA 3RPQA 1I1SA 3U2RA 5LGTA 1CF7A 3KP4A 2YX4A 4PGHA 2DLLA 1W7PB 1FYLA 5LGUA 2V1XA 1FBSA 2VOPA 1RIOH 4A2UA 4L0YB 4XRFA 2P5LC 3KFWX 4K2EA 3GVAA 1JHHA 4G7ZF 1IN8A 3M9AA 4ZYEA 4Y13A 1FYMA 4N0BA 5E17F 3BDDA 5HLHA 1T6SA 3U1DA 2H09A 1J7KA 3V8LA 2HEOA 2HOEA 1ZAOA 2EB7A 3R0AA 4JQFA 3QU3A 4Q48A 5D8LB 1Z91A 1ZRCA 2L4MA 5ICGA 5E8IA 1R1UA 2MA3A 1H9GA 3TO6A 5EEGA 4EJWA 3L00A 1IN4A 5D5VB 2FEZA 1UB9A 2DBBA 4AIHA 3HHHA 4E70A 1JXSA 6PAXA 2E1CA 4S05A 2VBXA 4M9XA 5JI6A 4ZH4F 1LNWA 4LFUA 1XCBA 3GYHX 5FFXA 2H94A 4Y15A 1ULYA 2RQPA 1FZPB 4HQMA 4KMUX 4IF4A 4MTDA 4MHGA 4ZZDA 3AAFA 1RZ4A 2EFWA 2YPRA 1FT9A 2KIUA 4XLNF 2UWMA 4M74A 3ROUA 4JBAA 3HYIA 3FXQA 2FNPA 4ZYDA 5AONA 3ZMTA 2L01A 4ON0A 4KN4X 3HRMA 2FBKA 2R3SA 1B6AA 4AWXB 3KP2A 5L3EA 4RB3C 3ML6A 1HSJA 3R60A 3VEPA 2G7HA 3VODA 2DK5A 3ABUA 3FF5A 2IRFG 2OZUA 4LK0F 2CWEA 3IC7A 1S8NA 2GIVA 4HDVA 4ETSA 2GQQA 3RI4A 2IPQX 4EGYA 1LB2A 1S7AA 3GLXA 1YW8A 2MC3A 5D6FA 2QWWA 4FHTA 2OBPA 4U0VA 3F6VA 4LMYA 2OQRA 1UCRA 4A12A 1P4WA 4BH9A 4A0ZA 3M1EA 4BAYA 5ICCA 2P5VA 2GA2A 1U5TC 2M45A 1R00A 1MDMA 3GWZA 5BOXA 1XGNA 2Q8KA 5K5QA 2AS5F 3E6MA 2LDUA 4U0YA 4BYYA 4AVPA 2A61A 5ICEA 4P9UA 2MLGA 3LA3A 2VE9A 1FX7A 4H0EA 4D0PA 5FD5A 1YQAA 3WTSC 2FMYA 1MJBA 4R79A 2P6SA 2KIMA 1BI0A 4UVBA 4IRGA 2P7CB 5LHGA 3GFMA 2VT3A 3K1PA 2W57A 1AWCA 1V4RA 3WTZA 2FF4A 4HX4A 1BBYA 2KJBA 3P7NA 4EGZA 2M8EA 1Z6RA 4M73A 3ZMVA 3BROA 4L9JA 1G3YA 1U2WA 2QBYA 5L3GA 3H3ZA 2QYOA 3HSFA 4MQ9F 4KDPA 1Q1HA 3SFZA 2YX7A 3ECHA 4RB1A 3JW4A 2FOKA 5HS8A 3GXOA 2UZKA 5ICFA 2XV4S 4OOIA 4OU0A 3WTYC 3ZMDA 1VTNC 2M1BA 1KU7A 1PP8F 3T5XA 5AIQA 3EDPA 1F1ZA 1YIOA 3R6SA 2Z33A 4BNCA 3LQQA 2DK8A 1RUNA 4IHTA 2O0YA 1FC3A 2EA4A 3F8BA 3GEZA 5ERIA 4LK1F 3ZP5A 2EFOA 4XLPF 1DDNA 1Z05A 2IT0A 5J8CA 3FM3A 3HSRA 2NS0A 3TKYA 2RV8A 5DCMA 1HW2A 2ZJ2A 2PN6A 4M6YA 3VFZA 4HLXA 1B9NA 1KQ9A 3BWGA 1R36A 1W5SA 4EJOA 4OINF 3KEOA 3DFGA 2RVCA 1J59A 3WG9A 3V7RA 3RJPA 3N4MA 3MZHA 5HDKA 1RUOA 2XVCA 3TQNA 5IT9Z 4HLYA 3QPHA 3FHZA 2Z99A 1OPCA 3DXJF 1KA8A 5BS6A 1J75A 3TDUC 4RB2C 3W6JB 3F3XA 3E5QA 1F4KA 2IW5A 4B09A 2XKOA 2ZMEA 5H20A 1LDKB 4CZZA 1LEBA 1Z6TA 3CUQC 2V79A 5DV5A 2PBIA 3GX4X 2FU4A 4JK1X 1ZGAA 3RKYA 1ZG1A 1U5TB 3SQNA 3Q5FA 2JPCA 4OIQF 3F8FA 4RB0A 4NHJA 2A07F 4HW0A 1E17A 1KU2A 2JPBA 5D5WB 5CLSA 2VBWA 3I0TA 1R22A 2FMLA 3EETA 2MH2A 2HWVA 3FM5A 4BHBA 4I0AA 3WTVC 1P2FA 3KLOA 1MKMA 1QQIA 1ZG5A 5CVIA 5CVUA 1QZZA 1KQ8A 3T1BA 2FNAA 5FLXK 2STWA 1FPQA 1BOAA 1I1GA 4UUVA 2E7WA 3NQOA 1KYZA 1LQ1A 1T0FA 5LEJA 3SZPA 2VXZA 1ON2A 3V4GA 3JSPA 1SFXA 1TW2A 4KNYA 2HZTA 1A04A 2AXLA 4U88A 1ZH5A 1GHCA 4A6DA 2QM3A 2FBIA 4L18B 2GA1A 4DQ2A 5TRDA 1USTA 3O3KA 3EYIA 1IXRC 4LLNA 4ENJA 1OYWA 3U9GA 4LG0A 2PMHA 4BQAA 2E1NA 1P92A 3FX3A 3H3UA 2GAUA 4FX0A 5LHIA 2K27A 4RS8A 3LA7A 2Y48A 3WGIA 3WU1B 1R23A 3ABTA 3KP7A 1FSEA 3KEQA 3L09A 1H9TA 2MD5A 1ODDA 3WTXC 3B73A 1FBUA 3KCCA 3QOPA 4KIBA 2XIGA 4HQEA 4EMSA 4LB5A 4BHCA 1MD0A 4NQWA 4GCVA 4YG2F 1HXDA 4Y17A 4PCQA 1IRFA 4CICA 5JR3A 1O7LA 1I6XA 5JHUA 2BV6A 4L9TA 2CSOA 1U3EM 4M71A 2ELHA 3Q9SA 1L0OC 1AOYA 3ZMSA 2W84A 1QNTA 3QPTA 4KN7X 2ZXJA 2P5KA 5E20A 5FB2A 3RPUA 5DD8A 1YYVA 1IN7A 2ISYA 1YS6A 4G8XA 5F6FA 2L54A 4U0WA 3T8TA 3COAC 2PFBA 1ZLJA 4A0XA 3FMSA 5BPDA 2PQ8A 4M6XA 3C3WA 4KFCA 3GZ6A 1XD7A 4KIGA 2CQKA 4YIFA 5CVVA 3CUQA 2XAJA 5HVQC 4U7DA 4XSXF 3EYYA 3QP6A 4ZYGA 2XAGA 3RDIA 4O6JA 1FYKA 1BI3A 5DUKA 4O3MA 3O6BB 3ECOA 3MFKA 3G73A 1NHAA 3RYPA 2RKHA 1EV7A 4EJUA 1B4AA 2RNJA 2GXGA 4L5IA 5F1RA 1XSXA 2P6TA 4HZFA 1G3TA 3CDHA 2DPUA 4A5NA 1EH6A 2XRNA 3M8EA 4HYEA 5ILVA 3KZYA 4RGXA 5LEKA 4KA4A 5BQTA 5DDGA 1J9IA 4Q47A 5KVRA 2WV0A 3DP7A 2IP2A 4ASNA 2RGVA 1ZREA 1XMAA 1D8KA 1CF7B 3WODF 2DAOA 5JVTA 1K78A 2JZYA 3E5UA 5CVJA 5DEQA 2H27A 3BY6A 3WTTC 4XSZF 1TNTA 4KMFA 3T0YA 1RI7A 3L7WA 3IWZA 5IT9K 2ZNYA 5CYVA 3C18A 4MGRA 1W4MA 3KZZA 4L0ZB 3K69A 2J5PA 2BEOA 3C1DA 1B1BA 2YSRA 3SHFA 4HOBA 1C0WA 4S04A 1IUYA 2O61A 1XGSA 1BC8C 1D8JA 1FP1D 4NB5A 1OMIA 1F5TA 2QLZA 3ELKA 3GF2A 3W6KB 1I27A 2V9VA 2V6CA 4CHUA 2MBFA 4MQVA 1R1TA 2HKXA 3V7SA 1YW9A 4OMYA 3LAJA 3CJNA 5L3DA 4CXFA 1FBQA 3BJ6A 3MEXA 1BJAA 2Z9OA 4EVIA 4N9HA 4R8HA 3N97A 4L5JA 3CO6C 2ADUA 4AIKA 3HSEA 3C7JA 4ENMA 1ZYRF 1PP7U 2G9WA 4DNCA 4KT5C 1YLFA 2QQBA 1FP2A 1BI2A 3F8NA 2LNBA 3BPVA 1WKMA 2HQNA 1JE8A 2UXNA 1TQMA 4KICA 4G94A 3J80K 1OYYA 3DKWA 1SMTA 1FOKA 2NRAC 2QUFA 2EWNA 4WXDA 2ZBKA 3GO5A 2XAFA 2L3DA 4GYGA 3R4KA 4YFKF 4WX9A 2VODA 2Y75A 1FNNA 1BIBA 2QZ8A 4RGUA 2VE8A 3RKWA 3GW2A 1DPUA 3HRUA 4L9VA 3WTWC 1R5HA 4ESBA 3LWFA 4IRIA 5HLIA 2PG4A 2NAZA 4PZJA 1ZRFA 4U7BA 2XAQA 1K6OA 1HSTA 1EH8A 3Q9VA 5FGMA 1FLIA 1SD4A 4M9SA 1GVJA 2PI0A 1V3FA 1S7OA 2M30A 2G7UA 4EM1A 5LLQA 3JAMZ 1SFEA 4HF1A 2QQ9A 2D1VA 4ESFA 1IXCA 4MTEA 2A3SA 2CFXA 3KE2A 3WGHA 1G4DA 1REPC 3L2CA 3BP8A 3O2PE 1J0RA 5K5OA 1CGPA 2DW4A 3OOPA 5F64A 1O7FA 1ZN2A 1K79A 4GYIA 5BPIA 2HGCA 2HDCA 4FT8A 3P9IA 3L9FA 2ACJA 2W24A 3I5UA 1HW5A 2GZWA 2VONA 3MCZA 2OD5A 1XGOA 4G9YA 4G6DA 1KGSA 4ENNA 2CGPA 2DO7A 2K02A 2A68F 4GGGA 4CYDA 3RKXA 2YR2A 1HW1A 2HS5A 1TW3A 2XROA 4ESJA 2IJLA 2ZFWA 2JSCA 4OIRF 5L3BA 2ESNA 5HS7A 2OAZA 1YG2A 1T38A 3KP3A 1FWZA 2FA5A 2YU3A 1D3YA 2VC0A 3F21A 2WC2A 4AD9A 4Q4ZF 5DYMA 1IZ1A 3EUHA 5E18F 5H6QA 5HOOA 3BJOA 3QP5A 1Z1DA 1U5TA 2BE5F 4LG0B 3GFLA 3IL2A 2EV6A 2D2WA 4P96A 5FLXZ 4RAYA 2ZO4A 2IA2A 1U78A 4IRHA 2H6BA 1XDUA 1WI9A 5HS9A 3WU0A 3REOA 3V7CA 1JGSA 2STTA 2K4BA 3K1NA 2OZ6A 3IWFA 4WK8F 1B9MA 1SAXA 2RDPA 2LSOA 4KUMA 2VN2A 5J6XA 1K7AA 4HDUA 2W25A 3DEUA 4G7OF 2FE3A 5K5RA 2F5EA 2ISZA 2B0LA 3E3VA 5H6RA 3FWEA 4Z2YA 4ZYHA 4HX8A 3E97A 4I7HA 2J5OA 1B59A 2RN7A 3H92A 2P8TA 2HYFA 4HV5A 4I01A 3HTUA 1SD5A 5LBQA 1SFUA 1KU9A 1STZA 2LKPA 2BBYA 1KQ0A 3JSOA 3ZMUA 3MWMA 5DCMB 2R7DA 4OIOF 1SD7A 2Q2EA 1Z9CA 3JTGA 4A0YA 2KJCA 2VBYA 4PDKA 5D4SA 4WXCA 4UXNA 1S3JA 1QBJA 4P5OA 4ZZLA 2XAHA 4HAMA 2TDXA 1IAWA 3FZVA 4G6QA 1IXSB 4IPAA 3VOEA 3ZN1A 3GUDA 2HYGD 3LQRA 1QZYA 1E2XA 1BN5A 4LD5A 3NEUA 5EEHA 3DPTA 2EV5A 2COMA 1ZG3A 1T2KA 3T8RA 4HF2A 1O3RA 2O3FA 4KYWA 1O3QA 2K86A 1UHWA 4YIIA 3CO7C 1KU3A 3E6CC 2K4JA 4WWCA 3BPXA 3TGNA 4EQQA 5ED4A 2OA4A 2L02A 4QLCU 1LDDA 4OIPF 2CYYA 4LJZF 3BOQA 3RIRA 3FXUA 4HX7A 3R0JA 2JRTA 3DPLC 3LAPA 1T39A 3SZTA 2CG4A 1ZHFA 1IRGA 3HRSA 3EQLF 3OV8A 3D0SA 2WWYA 4TV7A 1UFMA 3MZYA 2HKOA 1X3UA 2XGXA 3JTHA 3B02A 1U6GA 1RNLA 5L3CA 1HKQA 3FMQA 3LFKA 4EM0B 1Y0UA 2F5CA 3GFJA 2DQRA 2UXXA 1G6NA 1JHFA 3WGGA 1XSDA 3I4PA 1PUEE 4MEYF 4UVAA 2W85A 2FQ3A 2GWRA 4MEXF 2WTEA 2ETHA 1WQ2A 1YO5C 4UV8A 1WRJA 3M7GA 2KIFA 5HLGA 3I59B 2GXBA 1YTYA 1P4AA 1XCVA 4HA8A 3CLOA 3MQ0A 1TNSA 2PJPA 2XUBA 1O3TA 1ZARA 3RTRA 3F23A 1PDNC 1HKSA 4FX4A 2L4AA 5LRSA 1IN6A 5E8GA 1LVAA 2Z5UA 1EH7A 3QAHA 1G3WA 3F22A 2DTRA 1MGTA 2FXAA 5K1YA 5HDNA 3I71A 4IXAA 4ENKA 2IA1A 4R1HA 3E6BA 3FMRA 1TQIA 3NRVA 2IA0A 3DF8A 1U8RA 2FBHA 4IVNA 2R7FA 3F8CA 2EK5A 1D5VA 2VOOA 2A5YB 2HTSA 1T98A 3HOSA 5KK1A 4UNOA 4G7HF 5BMZA 2XASA 1FSHA 2OU2A 3F72A 5HDGA 3M8FA 3QU6A 4P9FA 4RGSA 3DV8A 1GXQA 3IKVA 1DP7P 3FXRA 4EJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DUX C;  2V1U A;  2D1H A;  1MDM B;  1BC7 C;  5A2Q Z;  1XDS A;  1OR7 A;  1ONV A;  2IVM A;  4WF2 A;  5FO5 A;  4I98 B;  2P7V B;  1YW7 A;  2E7X A;  1BIA A;  5L3F A;  2QBY B;  3JAM K;  1QGP A;  1BM9 A;  2DU9 A;  4B8X A;  3J7A O;  5D5X B;  3VB2 A;  1KYW A;  1F9N A;  2ZNZ A;  2K7L A;  3J81 K;  1SMY F;  1LEA A;  3LA2 A;  2MLK A;  2HTJ A;  1HKT A;  2O6G E;  4N9I A;  3I58 A;  2JT1 A;  3BJA A;  3WTU C;  3HHG A;  1R1V A;  3KP5 A;  1SD6 A;  3BZ6 A;  2ZCW A;  1ZGJ A;  3D5L A;  3ZN0 A;  2O03 A;  3CUQ B;  5LHH A;  1QO0 D;  3J81 Z;  2DI3 A;  5D6E A;  3GZ5 A;  3I59 A;  2EFQ A;  2DQL A;  5E1W A;  3HUG A;  3IHU A;  4LB6 B;  1W7P D;  3K1M A;  4A5M A;  3ZMZ A;  1GXP A;  1I5Z A;  3KET A;  1LDJ A;  4IHS A;  5FD6 A;  5CJ9 A;  2BYV E;  3MAJ A;  2QEN A;  4KIF A;  3WE2 A;  1L3L A;  1O57 A;  1OKR A;  2EV0 A;  3KLN A;  3TDZ C;  2DPD A;  4HF0 A;  2DFI A;  4UVC A;  3TOA A;  5E1X A;  3R61 A;  3S2W A;  1J5Y A;  3V8J A;  3F6O A;  2Y0M A;  4IJA A;  4I09 A;  1W5T A;  2XKP A;  2XHK A;  5DD4 A;  2LF7 A;  4MNU A;  5DUI A;  3HOT A;  4RAZ A;  5A2Q K;  1XN7 A;  2P4W A;  3K2Z A;  3KP6 A;  2ESH A;  2A6E F;  3TO9 A;  3K0L A;  2HQR A;  3LST A;  2NNY A;  2EJR A;  2OQG A;  2Q0O A;  3E5X A;  3I53 A;  3F8M A;  3PQJ A;  2PLY A;  3G3Z A;  1BI1 A;  1ZLK A;  2HR3 A;  1HBX G;  1ON1 A;  5IT3 A;  1XSV A;  2JTV A;  3QRF F;  3E6D A;  2NYX A;  3K9T A;  4GXO A;  1TBX A;  4CGZ A;  2CW0 F;  1W7P A;  2KKO A;  2NNN A;  4I02 A;  3RYR A;  1XMK A;  2X4H A;  5D8K B;  1TTY A;  3WE3 A;  3HIF A;  5D4R A;  1QPM A;  5DCF A;  5CVR A;  2M5W A;  1TLH B;  1S6L A;  3SXY A;  4QWQ A;  2F2E A;  2FRH A;  4WCG A;  1MJ9 A;  2ZKZ A;  4UV9 A;  4L9N A;  2F5D A;  2QQA A;  1YFH A;  2HFH A;  1UHM A;  3J80 Z;  3DQV C;  2FSW A;  2VC1 A;  1H0M A;  4YFN F;  1FY7 A;  2VBZ A;  1USS A;  4LLG F;  3V8K A;  2EFN A;  4HV6 A;  3IRR A;  4EV0 A;  1XB4 A;  4BHP A;  4LLL A;  2KRF A;  2MH9 A;  1OYI A;  3IRQ A;  1XGM A;  1R7J A;  1LJ9 A;  4O5V A;  2A69 F;  5LRR A;  1P4X A;  1TQP A;  1WWX A;  5AIP A;  1IW7 F;  3PFI A;  2EFP A;  1P6R A;  1R58 A;  5D5U B;  1IF1 A;  5FFZ A;  4EJV A;  1DPR A;  4GO1 A;  2M87 A;  5E1Z B;  4I0B A;  3CTA A;  4LGW A;  3I64 A;  1O3S A;  4CO8 A;  2DT5 A;  3TO7 A;  5JFR A;  2Z3Y A;  4I2O A;  4OMZ A;  2QVO A;  4AIJ A;  1MZB A;  4CDG A;  3CUO A;  3ERE D;  1WSU A;  4HBL A;  1R5G A;  4EM2 A;  4YFX F;  5J8F A;  1Z7U A;  4WXH A;  5ILU A;  5ILS A;  3ULQ B;  2PMU A;  2CO5 A;  2BGC A;  3P9C A;  4XBF A;  4PGG A;  4Q5S F;  1MJA A;  4UHT A;  1ZRD A;  4A6E A;  2ZME B;  4M9Z A;  2X0L A;  2LF8 A;  3IKT A;  2V1D A;  4RGR A;  4P55 A;  3HRT A;  3ISP A;  2H6C A;  2PEX A;  1IN5 A;  1YS7 A;  2O8X A;  3I54 A;  5LGN A;  2EA2 A;  1K78 B;  2F5F A;  3TOB A;  1G3S A;  3P9K A;  4M72 A;  2C6Y A;  2RC4 A;  3HTS B;  1HQC A;  1J2X A;  2A6H F;  2D45 A;  3ZPL A;  3PQK A;  1S29 A;  2VT2 A;  3ZQ7 A;  3GFI A;  5TJJ A;  4F7Z A;  4BXU A;  3RPQ A;  1I1S A;  3U2R A;  5LGT A;  1CF7 A;  3KP4 A;  2YX4 A;  4PGH A;  2DLL A;  1W7P B;  1FYL A;  5LGU A;  2V1X A;  1FBS A;  2VOP A;  1RIO H;  4A2U A;  4L0Y B;  4XRF A;  2P5L C;  3KFW X;  4K2E A;  3GVA A;  1JHH A;  4G7Z F;  1IN8 A;  3M9A A;  4ZYE A;  4Y13 A;  1FYM A;  4N0B A;  5E17 F;  3BDD A;  5HLH A;  1T6S A;  3U1D A;  2H09 A;  1J7K A;  3V8L A;  2HEO A;  2HOE A;  1ZAO A;  2EB7 A;  3R0A A;  4JQF A;  3QU3 A;  4Q48 A;  5D8L B;  1Z91 A;  1ZRC A;  2L4M A;  5ICG A;  5E8I A;  1R1U A;  2MA3 A;  1H9G A;  3TO6 A;  5EEG A;  4EJW A;  3L00 A;  1IN4 A;  5D5V B;  2FEZ A;  1UB9 A;  2DBB A;  4AIH A;  3HHH A;  4E70 A;  1JXS A;  6PAX A;  2E1C A;  4S05 A;  2VBX A;  4M9X A;  5JI6 A;  4ZH4 F;  1LNW A;  4LFU A;  1XCB A;  3GYH X;  5FFX A;  2H94 A;  4Y15 A;  1ULY A;  2RQP A;  1FZP B;  4HQM A;  4KMU X;  4IF4 A;  4MTD A;  4MHG A;  4ZZD A;  3AAF A;  1RZ4 A;  2EFW A;  2YPR A;  1FT9 A;  2KIU A;  4XLN F;  2UWM A;  4M74 A;  3ROU A;  4JBA A;  3HYI A;  3FXQ A;  2FNP A;  4ZYD A;  5AON A;  3ZMT A;  2L01 A;  4ON0 A;  4KN4 X;  3HRM A;  2FBK A;  2R3S A;  1B6A A;  4AWX B;  3KP2 A;  5L3E A;  4RB3 C;  3ML6 A;  1HSJ A;  3R60 A;  3VEP A;  2G7H A;  3VOD A;  2DK5 A;  3ABU A;  3FF5 A;  2IRF G;  2OZU A;  4LK0 F;  2CWE A;  3IC7 A;  1S8N A;  2GIV A;  4HDV A;  4ETS A;  2GQQ A;  3RI4 A;  2IPQ X;  4EGY A;  1LB2 A;  1S7A A;  3GLX A;  1YW8 A;  2MC3 A;  5D6F A;  2QWW A;  4FHT A;  2OBP A;  4U0V A;  3F6V A;  4LMY A;  2OQR A;  1UCR A;  4A12 A;  1P4W A;  4BH9 A;  4A0Z A;  3M1E A;  4BAY A;  5ICC A;  2P5V A;  2GA2 A;  1U5T C;  2M45 A;  1R00 A;  1MDM A;  3GWZ A;  5BOX A;  1XGN A;  2Q8K A;  5K5Q A;  2AS5 F;  3E6M A;  2LDU A;  4U0Y A;  4BYY A;  4AVP A;  2A61 A;  5ICE A;  4P9U A;  2MLG A;  3LA3 A;  2VE9 A;  1FX7 A;  4H0E A;  4D0P A;  5FD5 A;  1YQA A;  3WTS C;  2FMY A;  1MJB A;  4R79 A;  2P6S A;  2KIM A;  1BI0 A;  4UVB A;  4IRG A;  2P7C B;  5LHG A;  3GFM A;  2VT3 A;  3K1P A;  2W57 A;  1AWC A;  1V4R A;  3WTZ A;  2FF4 A;  4HX4 A;  1BBY A;  2KJB A;  3P7N A;  4EGZ A;  2M8E A;  1Z6R A;  4M73 A;  3ZMV A;  3BRO A;  4L9J A;  1G3Y A;  1U2W A;  2QBY A;  5L3G A;  3H3Z A;  2QYO A;  3HSF A;  4MQ9 F;  4KDP A;  1Q1H A;  3SFZ A;  2YX7 A;  3ECH A;  4RB1 A;  3JW4 A;  2FOK A;  5HS8 A;  3GXO A;  2UZK A;  5ICF A;  2XV4 S;  4OOI A;  4OU0 A;  3WTY C;  3ZMD A;  1VTN C;  2M1B A;  1KU7 A;  1PP8 F;  3T5X A;  5AIQ A;  3EDP A;  1F1Z A;  1YIO A;  3R6S A;  2Z33 A;  4BNC A;  3LQQ A;  2DK8 A;  1RUN A;  4IHT A;  2O0Y A;  1FC3 A;  2EA4 A;  3F8B A;  3GEZ A;  5ERI A;  4LK1 F;  3ZP5 A;  2EFO A;  4XLP F;  1DDN A;  1Z05 A;  2IT0 A;  5J8C A;  3FM3 A;  3HSR A;  2NS0 A;  3TKY A;  2RV8 A;  5DCM A;  1HW2 A;  2ZJ2 A;  2PN6 A;  4M6Y A;  3VFZ A;  4HLX A;  1B9N A;  1KQ9 A;  3BWG A;  1R36 A;  1W5S A;  4EJO A;  4OIN F;  3KEO A;  3DFG A;  2RVC A;  1J59 A;  3WG9 A;  3V7R A;  3RJP A;  3N4M A;  3MZH A;  5HDK A;  1RUO A;  2XVC A;  3TQN A;  5IT9 Z;  4HLY A;  3QPH A;  3FHZ A;  2Z99 A;  1OPC A;  3DXJ F;  1KA8 A;  5BS6 A;  1J75 A;  3TDU C;  4RB2 C;  3W6J B;  3F3X A;  3E5Q A;  1F4K A;  2IW5 A;  4B09 A;  2XKO A;  2ZME A;  5H20 A;  1LDK B;  4CZZ A;  1LEB A;  1Z6T A;  3CUQ C;  2V79 A;  5DV5 A;  2PBI A;  3GX4 X;  2FU4 A;  4JK1 X;  1ZGA A;  3RKY A;  1ZG1 A;  1U5T B;  3SQN A;  3Q5F A;  2JPC A;  4OIQ F;  3F8F A;  4RB0 A;  4NHJ A;  2A07 F;  4HW0 A;  1E17 A;  1KU2 A;  2JPB A;  5D5W B;  5CLS A;  2VBW A;  3I0T A;  1R22 A;  2FML A;  3EET A;  2MH2 A;  2HWV A;  3FM5 A;  4BHB A;  4I0A A;  3WTV C;  1P2F A;  3KLO A;  1MKM A;  1QQI A;  1ZG5 A;  5CVI A;  5CVU A;  1QZZ A;  1KQ8 A;  3T1B A;  2FNA A;  5FLX K;  2STW A;  1FPQ A;  1BOA A;  1I1G A;  4UUV A;  2E7W A;  3NQO A;  1KYZ A;  1LQ1 A;  1T0F A;  5LEJ A;  3SZP A;  2VXZ A;  1ON2 A;  3V4G A;  3JSP A;  1SFX A;  1TW2 A;  4KNY A;  2HZT A;  1A04 A;  2AXL A;  4U88 A;  1ZH5 A;  1GHC A;  4A6D A;  2QM3 A;  2FBI A;  4L18 B;  2GA1 A;  4DQ2 A;  5TRD A;  1UST A;  3O3K A;  3EYI A;  1IXR C;  4LLN A;  4ENJ A;  1OYW A;  3U9G A;  4LG0 A;  2PMH A;  4BQA A;  2E1N A;  1P92 A;  3FX3 A;  3H3U A;  2GAU A;  4FX0 A;  5LHI A;  2K27 A;  4RS8 A;  3LA7 A;  2Y48 A;  3WGI A;  3WU1 B;  1R23 A;  3ABT A;  3KP7 A;  1FSE A;  3KEQ A;  3L09 A;  1H9T A;  2MD5 A;  1ODD A;  3WTX C;  3B73 A;  1FBU A;  3KCC A;  3QOP A;  4KIB A;  2XIG A;  4HQE A;  4EMS A;  4LB5 A;  4BHC A;  1MD0 A;  4NQW A;  4GCV A;  4YG2 F;  1HXD A;  4Y17 A;  4PCQ A;  1IRF A;  4CIC A;  5JR3 A;  1O7L A;  1I6X A;  5JHU A;  2BV6 A;  4L9T A;  2CSO A;  1U3E M;  4M71 A;  2ELH A;  3Q9S A;  1L0O C;  1AOY A;  3ZMS A;  2W84 A;  1QNT A;  3QPT A;  4KN7 X;  2ZXJ A;  2P5K A;  5E20 A;  5FB2 A;  3RPU A;  5DD8 A;  1YYV A;  1IN7 A;  2ISY A;  1YS6 A;  4G8X A;  5F6F A;  2L54 A;  4U0W A;  3T8T A;  3COA C;  2PFB A;  1ZLJ A;  4A0X A;  3FMS A;  5BPD A;  2PQ8 A;  4M6X A;  3C3W A;  4KFC A;  3GZ6 A;  1XD7 A;  4KIG A;  2CQK A;  4YIF A;  5CVV A;  3CUQ A;  2XAJ A;  5HVQ C;  4U7D A;  4XSX F;  3EYY A;  3QP6 A;  4ZYG A;  2XAG A;  3RDI A;  4O6J A;  1FYK A;  1BI3 A;  5DUK A;  4O3M A;  3O6B B;  3ECO A;  3MFK A;  3G73 A;  1NHA A;  3RYP A;  2RKH A;  1EV7 A;  4EJU A;  1B4A A;  2RNJ A;  2GXG A;  4L5I A;  5F1R A;  1XSX A;  2P6T A;  4HZF A;  1G3T A;  3CDH A;  2DPU A;  4A5N A;  1EH6 A;  2XRN A;  3M8E A;  4HYE A;  5ILV A;  3KZY A;  4RGX A;  5LEK A;  4KA4 A;  5BQT A;  5DDG A;  1J9I A;  4Q47 A;  5KVR A;  2WV0 A;  3DP7 A;  2IP2 A;  4ASN A;  2RGV A;  1ZRE A;  1XMA A;  1D8K A;  1CF7 B;  3WOD F;  2DAO A;  5JVT A;  1K78 A;  2JZY A;  3E5U A;  5CVJ A;  5DEQ A;  2H27 A;  3BY6 A;  3WTT C;  4XSZ F;  1TNT A;  4KMF A;  3T0Y A;  1RI7 A;  3L7W A;  3IWZ A;  5IT9 K;  2ZNY A;  5CYV A;  3C18 A;  4MGR A;  1W4M A;  3KZZ A;  4L0Z B;  3K69 A;  2J5P A;  2BEO A;  3C1D A;  1B1B A;  2YSR A;  3SHF A;  4HOB A;  1C0W A;  4S04 A;  1IUY A;  2O61 A;  1XGS A;  1BC8 C;  1D8J A;  1FP1 D;  4NB5 A;  1OMI A;  1F5T A;  2QLZ A;  3ELK A;  3GF2 A;  3W6K B;  1I27 A;  2V9V A;  2V6C A;  4CHU A;  2MBF A;  4MQV A;  1R1T A;  2HKX A;  3V7S A;  1YW9 A;  4OMY A;  3LAJ A;  3CJN A;  5L3D A;  4CXF A;  1FBQ A;  3BJ6 A;  3MEX A;  1BJA A;  2Z9O A;  4EVI A;  4N9H A;  4R8H A;  3N97 A;  4L5J A;  3CO6 C;  2ADU A;  4AIK A;  3HSE A;  3C7J A;  4ENM A;  1ZYR F;  1PP7 U;  2G9W A;  4DNC A;  4KT5 C;  1YLF A;  2QQB A;  1FP2 A;  1BI2 A;  3F8N A;  2LNB A;  3BPV A;  1WKM A;  2HQN A;  1JE8 A;  2UXN A;  1TQM A;  4KIC A;  4G94 A;  3J80 K;  1OYY A;  3DKW A;  1SMT A;  1FOK A;  2NRA C;  2QUF A;  2EWN A;  4WXD A;  2ZBK A;  3GO5 A;  2XAF A;  2L3D A;  4GYG A;  3R4K A;  4YFK F;  4WX9 A;  2VOD A;  2Y75 A;  1FNN A;  1BIB A;  2QZ8 A;  4RGU A;  2VE8 A;  3RKW A;  3GW2 A;  1DPU A;  3HRU A;  4L9V A;  3WTW C;  1R5H A;  4ESB A;  3LWF A;  4IRI A;  5HLI A;  2PG4 A;  2NAZ A;  4PZJ A;  1ZRF A;  4U7B A;  2XAQ A;  1K6O A;  1HST A;  1EH8 A;  3Q9V A;  5FGM A;  1FLI A;  1SD4 A;  4M9S A;  1GVJ A;  2PI0 A;  1V3F A;  1S7O A;  2M30 A;  2G7U A;  4EM1 A;  5LLQ A;  3JAM Z;  1SFE A;  4HF1 A;  2QQ9 A;  2D1V A;  4ESF A;  1IXC A;  4MTE A;  2A3S A;  2CFX A;  3KE2 A;  3WGH A;  1G4D A;  1REP C;  3L2C A;  3BP8 A;  3O2P E;  1J0R A;  5K5O A;  1CGP A;  2DW4 A;  3OOP A;  5F64 A;  1O7F A;  1ZN2 A;  1K79 A;  4GYI A;  5BPI A;  2HGC A;  2HDC A;  4FT8 A;  3P9I A;  3L9F A;  2ACJ A;  2W24 A;  3I5U A;  1HW5 A;  2GZW A;  2VON A;  3MCZ A;  2OD5 A;  1XGO A;  4G9Y A;  4G6D A;  1KGS A;  4ENN A;  2CGP A;  2DO7 A;  2K02 A;  2A68 F;  4GGG A;  4CYD A;  3RKX A;  2YR2 A;  1HW1 A;  2HS5 A;  1TW3 A;  2XRO A;  4ESJ A;  2IJL A;  2ZFW A;  2JSC A;  4OIR F;  5L3B A;  2ESN A;  5HS7 A;  2OAZ A;  1YG2 A;  1T38 A;  3KP3 A;  1FWZ A;  2FA5 A;  2YU3 A;  1D3Y A;  2VC0 A;  3F21 A;  2WC2 A;  4AD9 A;  4Q4Z F;  5DYM A;  1IZ1 A;  3EUH A;  5E18 F;  5H6Q A;  5HOO A;  3BJO A;  3QP5 A;  1Z1D A;  1U5T A;  2BE5 F;  4LG0 B;  3GFL A;  3IL2 A;  2EV6 A;  2D2W A;  4P96 A;  5FLX Z;  4RAY A;  2ZO4 A;  2IA2 A;  1U78 A;  4IRH A;  2H6B A;  1XDU A;  1WI9 A;  5HS9 A;  3WU0 A;  3REO A;  3V7C A;  1JGS A;  2STT A;  2K4B A;  3K1N A;  2OZ6 A;  3IWF A;  4WK8 F;  1B9M A;  1SAX A;  2RDP A;  2LSO A;  4KUM A;  2VN2 A;  5J6X A;  1K7A A;  4HDU A;  2W25 A;  3DEU A;  4G7O F;  2FE3 A;  5K5R A;  2F5E A;  2ISZ A;  2B0L A;  3E3V A;  5H6R A;  3FWE A;  4Z2Y A;  4ZYH A;  4HX8 A;  3E97 A;  4I7H A;  2J5O A;  1B59 A;  2RN7 A;  3H92 A;  2P8T A;  2HYF A;  4HV5 A;  4I01 A;  3HTU A;  1SD5 A;  5LBQ A;  1SFU A;  1KU9 A;  1STZ A;  2LKP A;  2BBY A;  1KQ0 A;  3JSO A;  3ZMU A;  3MWM A;  5DCM B;  2R7D A;  4OIO F;  1SD7 A;  2Q2E A;  1Z9C A;  3JTG A;  4A0Y A;  2KJC A;  2VBY A;  4PDK A;  5D4S A;  4WXC A;  4UXN A;  1S3J A;  1QBJ A;  4P5O A;  4ZZL A;  2XAH A;  4HAM A;  2TDX A;  1IAW A;  3FZV A;  4G6Q A;  1IXS B;  4IPA A;  3VOE A;  3ZN1 A;  3GUD A;  2HYG D;  3LQR A;  1QZY A;  1E2X A;  1BN5 A;  4LD5 A;  3NEU A;  5EEH A;  3DPT A;  2EV5 A;  2COM A;  1ZG3 A;  1T2K A;  3T8R A;  4HF2 A;  1O3R A;  2O3F A;  4KYW A;  1O3Q A;  2K86 A;  1UHW A;  4YII A;  3CO7 C;  1KU3 A;  3E6C C;  2K4J A;  4WWC A;  3BPX A;  3TGN A;  4EQQ A;  5ED4 A;  2OA4 A;  2L02 A;  4QLC U;  1LDD A;  4OIP F;  2CYY A;  4LJZ F;  3BOQ A;  3RIR A;  3FXU A;  4HX7 A;  3R0J A;  2JRT A;  3DPL C;  3LAP A;  1T39 A;  3SZT A;  2CG4 A;  1ZHF A;  1IRG A;  3HRS A;  3EQL F;  3OV8 A;  3D0S A;  2WWY A;  4TV7 A;  1UFM A;  3MZY A;  2HKO A;  1X3U A;  2XGX A;  3JTH A;  3B02 A;  1U6G A;  1RNL A;  5L3C A;  1HKQ A;  3FMQ A;  3LFK A;  4EM0 B;  1Y0U A;  2F5C A;  3GFJ A;  2DQR A;  2UXX A;  1G6N A;  1JHF A;  3WGG A;  1XSD A;  3I4P A;  1PUE E;  4MEY F;  4UVA A;  2W85 A;  2FQ3 A;  2GWR A;  4MEX F;  2WTE A;  2ETH A;  1WQ2 A;  1YO5 C;  4UV8 A;  1WRJ A;  3M7G A;  2KIF A;  5HLG A;  3I59 B;  2GXB A;  1YTY A;  1P4A A;  1XCV A;  4HA8 A;  3CLO A;  3MQ0 A;  1TNS A;  2PJP A;  2XUB A;  1O3T A;  1ZAR A;  3RTR A;  3F23 A;  1PDN C;  1HKS A;  4FX4 A;  2L4A A;  5LRS A;  1IN6 A;  5E8G A;  1LVA A;  2Z5U A;  1EH7 A;  3QAH A;  1G3W A;  3F22 A;  2DTR A;  1MGT A;  2FXA A;  5K1Y A;  5HDN A;  3I71 A;  4IXA A;  4ENK A;  2IA1 A;  4R1H A;  3E6B A;  3FMR A;  1TQI A;  3NRV A;  2IA0 A;  3DF8 A;  1U8R A;  2FBH A;  4IVN A;  2R7F A;  3F8C A;  2EK5 A;  1D5V A;  2VOO A;  2A5Y B;  2HTS A;  1T98 A;  3HOS A;  5KK1 A;  4UNO A;  4G7H F;  5BMZ A;  2XAS A;  1FSH A;  2OU2 A;  3F72 A;  5HDG A;  3M8F A;  3QU6 A;  4P9F A;  4RGS A;  3DV8 A;  1GXQ A;  3IKV A;  1DP7 P;  3FXR A;  4EJT A; 
#chains in the Genus database with same CATH topology
 1DUX C;  2V1U A;  2D1H A;  1OCT C;  1MDM B;  2HOT A;  3BCB A;  1BC7 C;  3HOV J;  3AG3 H;  5A2Q Z;  1XDS A;  1OR7 A;  3JRC A;  1MW7 A;  1ONV A;  2IVM A;  4WF2 A;  4L5E A;  5FO5 A;  3OWT A;  4I98 B;  2B7E A;  3K7A J;  2P7V B;  3K4J A;  5J1R A;  1YW7 A;  3AG2 H;  2XGD A;  3KYC B;  2K9Q A;  3HUG B;  2E7X A;  1BIA A;  4PFP A;  3I55 I;  5L3F A;  3Q0U A;  3JRD A;  2QBY B;  1FIP A;  3H5N A;  3JAM K;  3DLL F;  5DM6 F;  1QGP A;  1BM9 A;  2LH9 A;  4J19 A;  2EIK H;  2DU9 A;  4B8X A;  5GAG J;  5F1J A;  5D5X B;  3J7A O;  3VB2 A;  1KYW A;  3S3N A;  1F9N A;  1RRJ A;  2ZNZ A;  2K7L A;  3J81 K;  4BS9 A;  3S8P A;  5M3M J;  2NVT J;  1IUF A;  1X1B A;  2E2J J;  3G1M A;  1RES A;  3K70 C;  1SMY F;  2X6Y A;  3JRB A;  1LEA A;  4C3J J;  3LA2 A;  2HOS A;  2EIL H;  1GVD A;  3CCJ I;  3BR1 A;  2MLK A;  2HTJ A;  1HKT A;  2O6G E;  4N9I A;  4JOM A;  2M7B A;  4B44 A;  3W2A A;  3I58 A;  2PMZ A;  2JT1 A;  3BJA A;  5FKO A;  3WTU C;  2R7X A;  3HHG A;  3OIQ A;  1R1V A;  3KP5 A;  1SD6 A;  3BZ6 A;  2AXT C;  2ZCW A;  1ZGJ A;  3GZN B;  1FJL A;  2DFE A;  4DJA A;  4XRS G;  1OLT A;  3D5R C;  2JUC A;  3HJE A;  3D5L A;  3ZOB A;  3ZN0 A;  1SVL A;  2O03 A;  2QA4 I;  4FE7 A;  4II3 A;  4HST A;  3CUQ B;  3KYD B;  5LHH A;  1QO0 D;  3C2H A;  3LFU A;  2X48 A;  3J81 Z;  2CV0 A;  2ECB A;  1DU0 A;  2DI3 A;  5D6E A;  3GZ5 A;  1VQM I;  3I59 A;  4UB8 C;  3TP0 A;  3BTJ A;  4FQG A;  4ITV A;  1FIA A;  2DT7 B;  4DBR A;  2P0W A;  5GPC A;  3S3M A;  2EFQ A;  2DQL A;  5E1W A;  3HUG A;  3IHU A;  1LFU P;  4LB6 B;  1W7P D;  3K1M A;  4A5M A;  1WJ5 A;  3ZMZ A;  5EEA A;  1I5Z A;  4B47 A;  1LDJ A;  5EG0 B;  3KET A;  5FD6 A;  1GXP A;  1VQ9 I;  3LSR A;  5CJ9 A;  2YU9 J;  4IHS A;  1IDY A;  2VKE A;  2BYV E;  3MAJ A;  4JX6 A;  4E7I A;  2QEN A;  4KIF A;  3SFI A;  3WE2 A;  1L3L A;  1O57 A;  1OKR A;  2EV0 A;  2IEK A;  3KLN A;  2K9S A;  2DA2 A;  4BDZ A;  2HQA A;  3TDZ C;  2X6O A;  4XON A;  3U1K A;  1PUF A;  1JKO C;  2DPD A;  3TBI A;  1Y8R B;  2DFI A;  4HF0 A;  4N4N B;  3BQZ A;  4UVC A;  3TOA A;  1MSF C;  5E1X A;  3R61 A;  3G6E I;  5IP7 J;  3ZRG A;  2LKS A;  1WVR A;  3S2W A;  2BHY A;  1J5Y A;  4BDY A;  3V8J A;  3F6O A;  2LY1 A;  1I3Q J;  2CS3 A;  2F4O B;  2Y0M A;  1MNE A;  3DWL E;  3NAU A;  4I09 A;  4IJA A;  2VKD A;  1UMQ A;  1W5T A;  2XKP A;  3RQ4 A;  3CCE I;  2WA0 A;  2XHK A;  2FD5 A;  1IV6 A;  1R49 A;  5DD4 A;  1B8I B;  3K4B A;  2LF7 A;  4MNU A;  5DUI A;  3HOT A;  1Y8Q B;  2DDB A;  3L2W A;  2DT6 A;  1XMX A;  1XX5 A;  2L7M P;  2K3F A;  5DTD A;  4RAZ A;  3HGG A;  1JTY A;  5A2Q K;  1HF0 A;  1XN7 A;  2P4W A;  2R5Z B;  3K2Z A;  3KP6 A;  1P7I A;  2ESH A;  4AC0 A;  2A6E F;  3TO9 A;  1IGN A;  1LFB A;  4XLA A;  1UAA A;  3K0L A;  1HDP A;  2HQR A;  3LST A;  1ITY A;  2NNY A;  2UUZ A;  2R5Z A;  2Y9Z A;  3K2A A;  2IGO A;  2EJR A;  2OQG A;  2Q0O A;  1R71 A;  3BLY A;  3E5X A;  5DM7 F;  2Z16 A;  3I53 A;  4KT6 A;  3F8M A;  3PQJ A;  1VQ4 I;  1WJD A;  2PLY A;  3G3Z A;  4A3I J;  1BI1 A;  2E2I J;  1ZLK A;  1U9N A;  2HR3 A;  2XF7 A;  1HBX G;  2B9S A;  2KP6 A;  1ON1 A;  5IT3 A;  2WY7 Q;  1XSV A;  2JTV A;  3QRF F;  3E6D A;  2NYX A;  3OIP A;  3K9T A;  4HG2 A;  2CFO A;  2DFF A;  4GXO A;  1TBX A;  4CGZ A;  3PUF A;  2CW0 F;  1W7P A;  1JGG A;  2BY1 A;  2H1L A;  2KKO A;  1WJA A;  4IL6 C;  2NNN A;  4I02 A;  3RYR A;  1XMK A;  4RLQ A;  2X4H A;  2EH3 A;  2JA6 J;  3IAS 2;  5D8K B;  1TTY A;  3BTC A;  5IYB J;  2WAQ A;  3GTG J;  3WE3 A;  3HIF A;  5D4R A;  1QPM A;  5DCF A;  5CVR A;  2M5W A;  1TLH B;  1S6L A;  3OL4 A;  3HOX J;  3SXY A;  1X3W B;  5TGT A;  4QWQ A;  3BT9 A;  2F2E A;  2BY2 A;  4B3X A;  2FRH A;  4WCG A;  5KNL A;  1MJ9 A;  2ZKZ A;  2LFB A;  2R92 J;  4UV9 A;  2ZFU A;  3WG7 H;  2DMU A;  2LY9 A;  4L9N A;  2F5D A;  4F91 B;  3OYE A;  1YJW I;  3FKI J;  1A36 A;  3VPR A;  2QQA A;  2HVS A;  3VWB A;  2HXI A;  1YFH A;  2HFH A;  2FJ1 A;  1UHM A;  3J80 Z;  1TP4 A;  3DQV C;  1LFP A;  2FSW A;  4XN0 A;  3VYR B;  3E0J B;  2DJI A;  2QF7 A;  4XKC A;  1TL8 A;  1VQK I;  3K4C A;  2L0K A;  2VC1 A;  4V2G A;  1H0M A;  4YFN F;  2LBF B;  1FY7 A;  2VBZ A;  1USS A;  2JA8 J;  4LLG F;  3H0G J;  3V8K A;  5JHF A;  2L7K A;  2EFN A;  4HV6 A;  4NNJ A;  5FKL A;  2WB1 A;  3IRR A;  4RMN A;  3NWT A;  3NWS A;  4EV0 A;  1XB4 A;  2YS9 A;  3BZK A;  4BHP A;  4LLL A;  2KRF A;  2XAU A;  1Y56 A;  2MH9 A;  1OYI A;  1W5C C;  1LPQ A;  4MFD A;  3IRQ A;  4G6T B;  1XGM A;  3H9J A;  2HDW A;  4BUP A;  1R7J A;  1LJ9 A;  4O5V A;  2K5C A;  2A69 F;  4JX4 A;  3OIO A;  5LRR A;  3HOY J;  1P4X A;  1TQP A;  1WWX A;  1XS9 A;  1FEX A;  5AIP A;  2H1K A;  1IW7 F;  3PFI A;  4CZC A;  3HZJ A;  2LD5 A;  2EFP A;  1P6R A;  1R58 A;  3IH4 A;  2NXN B;  3PUB A;  3WHB A;  5D5U B;  1IF1 A;  2XC7 A;  4AID A;  5FFZ A;  4BJT A;  1K61 A;  4EJV A;  1DPR A;  4B43 A;  4GO1 A;  3I56 I;  2M87 A;  5E1Z B;  4I0B A;  5EYR A;  3CTA A;  1OCC H;  1WCM J;  2G0E A;  3GTQ J;  2HYJ A;  3I64 A;  4LGW A;  4BY1 J;  2VJ5 A;  1O3S A;  4CO8 A;  2DT5 A;  2X51 A;  3TO7 A;  5JFR A;  2Z3Y A;  3OYN A;  3OSF A;  4I2O A;  4OMZ A;  1S5L C;  2QVO A;  3FDY A;  2X85 A;  2HPM A;  2JA7 J;  3CCU I;  4XRM A;  4AIJ A;  1MZB A;  4CDG A;  3CUO A;  3ERE D;  5KCM A;  3K4K A;  1WSU A;  4HBL A;  1R5G A;  4BBR J;  4EM2 A;  4YFX F;  5H2F C;  3SYT A;  1YRN A;  2XRL A;  3UR3 C;  3ZGK A;  5J8F A;  1IRX A;  1Z7U A;  4DZP A;  4WXH A;  2O7O A;  5ILU A;  5F0H A;  1Y0N A;  3S1R J;  2MFZ A;  5ILS A;  3ULQ B;  3JRG A;  1OFC X;  2PMU A;  2CO5 A;  5IOY A;  2BGC A;  3P9C A;  2PJR A;  4XBF A;  4PGG A;  4Q5S F;  3QOE A;  2HI3 A;  5HLT A;  1MJA A;  4QPQ A;  2NOG A;  3JRE A;  3K4L A;  4E4H A;  4UHT A;  1ZRD A;  3CCY A;  4A6E A;  4AYB A;  4CA0 A;  3N05 A;  2ZME B;  4DW6 A;  4M9Z A;  3GME A;  1POG A;  2X0L A;  2E34 A;  2LF8 A;  3IKT A;  3BG6 A;  2V1D A;  4RGR A;  5K7H A;  1BJZ A;  4P55 A;  3S3O A;  3H5R A;  4CUG A;  4Z6Y A;  3HRT A;  3ISP A;  1YHQ I;  2H6C A;  2PEX A;  4W1U A;  1IN5 A;  1YS7 A;  2O8X A;  3CCM I;  2HPI A;  1T08 B;  3I54 A;  5LGN A;  2EA2 A;  5M5Y J;  1K78 B;  2F5F A;  2H8W A;  2DA6 A;  2VJJ A;  3BQY A;  3TOB A;  1G3S A;  4DYQ A;  3P9K A;  2R93 J;  2PX9 A;  4M72 A;  2C6Y A;  2RC4 A;  1HQC A;  3HTS B;  1J2X A;  2A6H F;  2LG4 A;  2D45 A;  4DYR A;  3ZPL A;  3PQK A;  1S29 A;  3K10 A;  1OCR H;  1RET A;  2VT2 A;  3ZQ7 A;  3GFI A;  2JQ7 A;  5TJJ A;  2E1M B;  4BJ6 C;  4F7Z A;  3S1M J;  4BXU A;  3FK6 A;  1HA8 A;  3RPQ A;  2LTP A;  1I1S A;  3U2R A;  5LGT A;  1D1C A;  3BG3 A;  3VSL A;  1CF7 A;  2V7F A;  3KP4 A;  1SEU A;  2YX4 A;  5JVG F;  4PGH A;  2DLL A;  1W7P B;  1MMG A;  1FYL A;  2DMP A;  2NS7 A;  5LGU A;  2V1X A;  1ZKG A;  1FBS A;  2VOP A;  5K7F A;  1RIO H;  4A2U A;  1AKH B;  3ESW B;  3DEW A;  1GDT A;  1DGR M;  3S2D J;  2OJE D;  4L0Y B;  4KIS A;  3S16 J;  2MD0 A;  4XRF A;  2P5L C;  2IGN A;  2AHQ A;  4Y52 J;  3KFW X;  2K40 A;  4K2E A;  3GVA A;  1JHH A;  2UV1 A;  1LE8 A;  3RPU D;  4G7Z F;  4J01 A;  2M4G A;  2HDD A;  4BGD A;  4BKX A;  3Q0V A;  3IH3 A;  1IN8 A;  2XDV A;  2ZXW H;  3M9A A;  2VJI A;  4ZYE A;  1K83 J;  3PNT A;  4Y13 A;  1FYM A;  4N0B A;  3OOU A;  5E17 F;  3ONQ A;  1A6Q A;  3KX2 A;  3BDD A;  1W1W E;  1SFK A;  1D1B A;  5HLH A;  1T6S A;  3U1D A;  1J7K A;  2H09 A;  3V8L A;  3LNQ A;  2HEO A;  2HOE A;  2H8R A;  1ZAO A;  2EB7 A;  3R0A A;  4JQF A;  2R7U A;  3QU3 A;  4IOC F;  4Q48 A;  4YEL A;  2KDO A;  5D8L B;  1Z91 A;  1ZRC A;  2L4M A;  3LSG A;  2RNG A;  2VB6 A;  5ICG A;  2KHM A;  5E8I A;  1R1U A;  2MA3 A;  1H9G A;  3TO6 A;  4FET A;  5EEG A;  3ZQL A;  2Z1D A;  4EJW A;  4CYC B;  3HKZ A;  1UG0 A;  3L00 A;  4UY8 I;  1IN4 A;  1ZR2 A;  5D5V B;  2FEZ A;  2VQC A;  1W0U A;  1UB9 A;  1Z3Y A;  2DA1 A;  1TWF J;  1IV8 A;  3A4C A;  4LIT A;  2DBB A;  4AIH A;  3HHH A;  4E70 A;  1JXS A;  6PAX A;  2E1C A;  4S05 A;  2W48 A;  2E60 A;  2VBX A;  4M9X A;  1NTC A;  5JI6 A;  4ZH4 F;  1LNW A;  4LFU A;  1XCB A;  2KRC A;  3GYH X;  5FFX A;  2H94 A;  1WJC A;  4Y15 A;  1MMS A;  1ULY A;  4JX5 A;  2RQP A;  2IGK A;  1FZP B;  2I8D A;  4HQM A;  1S9H A;  3FIS A;  5GTI C;  2ZXI A;  4DYC A;  4YIR X;  3MVP A;  1SAU A;  4KMU X;  4BQQ A;  4IF4 A;  2DTZ A;  4ZYA A;  4MTD A;  4MHG A;  2WB1 N;  4ZZD A;  3AAF A;  1RZ4 A;  2EFW A;  2YPR A;  1FT9 A;  2KIU A;  4BE0 A;  4XLN F;  3PNY A;  2UWM A;  4M74 A;  3ROU A;  4JBA A;  1R5I D;  3HYI A;  3BG5 A;  4B1R A;  3FXQ A;  1FOW A;  2FNP A;  1Z77 A;  1V5G A;  4ZYD A;  5AON A;  3ZMT A;  2DYS H;  1MIJ A;  2L01 A;  3CES A;  4ON0 A;  2CUZ A;  2ZJQ F;  4KN4 X;  3HRM A;  2FBK A;  2R3S A;  1B6A A;  2RRE A;  3KP2 A;  4JYK A;  4AWX B;  2CJJ A;  2COB A;  5L3E A;  4RB3 C;  1MMN A;  3ML6 A;  1Y1W J;  1HSJ A;  3R60 A;  4IHY A;  3VEP A;  3BR0 A;  2M4K A;  2G7H A;  3VOD A;  2DK5 A;  3ABU A;  3FF5 A;  4BEH A;  2IRF G;  1GLN A;  2OZU A;  3G2B A;  4LK0 F;  2CWE A;  3IC7 A;  2K9L A;  3K4N A;  4MFE A;  1S8N A;  2GIV A;  4HDV A;  3FK7 A;  1SVM A;  3H36 A;  2GQQ A;  4ETS A;  5C44 J;  3RI4 A;  2IPQ X;  4LIV A;  4A3B J;  4EGY A;  1LB2 A;  3MD2 A;  1S7A A;  3GLX A;  1YW8 A;  2MC3 A;  5D6F A;  2QWW A;  4XLC A;  4XMY A;  3AG1 H;  4FHT A;  3DTI A;  2OBP A;  4U0V A;  3F6V A;  1YIJ I;  2R7O A;  4IOA F;  1MBF A;  4LMY A;  1UG2 A;  1Y6I A;  2OQR A;  1UCR A;  4A12 A;  1RR8 C;  1P4W A;  2R7R A;  1EJ9 A;  2JVG A;  2ME6 A;  4BH9 A;  3ZQI A;  2CMP A;  4A0Z A;  3M1E A;  4PK4 A;  4BAY A;  5ICC A;  2P5V A;  2GA2 A;  1U5T C;  2M45 A;  1R00 A;  2NS8 A;  1MDM A;  4C3H J;  3GWZ A;  5BOX A;  1XGN A;  4A3D J;  4E6K G;  2Q8K A;  5K5Q A;  2AS5 F;  3E6M A;  1RKW A;  2R5Y A;  3TW6 A;  2LDU A;  2OCC H;  1H89 C;  2BW3 A;  4U0Y A;  3OYK A;  1B72 B;  4BYY A;  1MBH A;  1WGX A;  4ZJZ A;  4AVP A;  3CJT B;  2FUG 2;  2ZXH A;  3GTM J;  3D5S C;  5EZH A;  2A61 A;  1WJB A;  5ICE A;  1WFX A;  5IY5 H;  4P9U A;  2O5R A;  2MLG A;  3LA3 A;  2GLO A;  1YOV B;  2VE9 A;  4C2U A;  1FX7 A;  3RSN A;  2JA5 J;  4H0E A;  3F9K A;  4D0P A;  3A0H C;  5FD5 A;  3TED A;  1YQA A;  2DMN A;  3WTS C;  2FMY A;  1GT0 C;  1MJB A;  4R79 A;  2P6S A;  3S1N J;  2KIM A;  1BI0 A;  3MMY B;  5E3N A;  2RQQ A;  4XK4 A;  1V5E A;  2IS2 A;  2XB0 X;  4UVB A;  4IRG A;  2CUE A;  3B6C A;  3DTK A;  2P7C B;  2JRM A;  3BC8 A;  2BHZ A;  5LHG A;  3GFM A;  5B1A H;  2VT3 A;  3K1P A;  3IH2 A;  2W57 A;  3F0C A;  1V4R A;  3CDI A;  3WTZ A;  3L2R A;  1AWC A;  1H88 C;  2M0C A;  2FF4 A;  3AFH A;  2X6W A;  5B1B H;  4BL0 B;  4D1Q A;  1ETW A;  3OYG A;  2VXD A;  2DA7 A;  4HX4 A;  2F6C A;  1BBY A;  1WH7 A;  2KJB A;  3P7N A;  3IP4 B;  3CME I;  4AM3 A;  4EGZ A;  2M8E A;  1Z6R A;  3FHN A;  4M73 A;  1K4T A;  3ZMV A;  3ZQH A;  1JT0 A;  3B6A A;  4X0G A;  3BRO A;  3EPZ A;  4L9J A;  1G3Y A;  1U2W A;  2QBY A;  5L3G A;  1ZK8 A;  3H3Z A;  2QYO A;  3JRA A;  3HSF A;  4MQ9 F;  4KDP A;  2FX0 A;  2X1E A;  2NVQ J;  1OQY A;  3HB9 A;  1Q1H A;  3SFZ A;  2YX7 A;  2BW3 B;  3ECH A;  4RB1 A;  1PVE A;  3JW4 A;  1ETY A;  2FOK A;  1QVU A;  5HS8 A;  3QWL A;  5EJC A;  1E3P A;  3GXO A;  2UZK A;  5ICF A;  2XV4 S;  4OOI A;  4OU0 A;  3WTY C;  3ZMD A;  1VTN C;  2O8K A;  2GBY A;  2M1B A;  3BZC A;  3CLQ A;  1KU7 A;  1PP8 F;  3T5X A;  1D0Y A;  5AIQ A;  3EDP A;  1D5Y A;  5E3L A;  2V9P A;  1F1Z A;  1YIO A;  3CDL A;  3LL7 A;  3R6S A;  2Z33 A;  4BNC A;  5DS9 A;  3RQI A;  3LQQ A;  2DK8 A;  3H9G A;  4RAG A;  1RUN A;  4IHT A;  2O0Y A;  1FC3 A;  2EA4 A;  3F8B A;  4AVZ A;  3GEZ A;  1OR7 C;  1ETX A;  5ERI A;  4A3L J;  4LK1 F;  3ZP5 A;  2CV2 A;  3SDB A;  4IHX A;  2EFO A;  4XLP F;  1DDN A;  1ZGW A;  1Z05 A;  3DTE A;  1JUP A;  2IT0 A;  2BOL A;  5J8C A;  3FM3 A;  2V9K A;  1A5J A;  5IOZ A;  2QSH X;  3HSR A;  1VQ8 I;  4M3E A;  2NS0 A;  5FRO A;  3TKY A;  2RV8 A;  5DCM A;  1HW2 A;  5EF6 A;  2ZJ2 A;  3OS2 A;  2PN6 A;  1D0Z A;  3FXL A;  4M6Y A;  3FXO A;  1A35 A;  4KJZ A;  5GAD J;  3VFZ A;  2FQ4 A;  4HLX A;  1B9N A;  2VL8 A;  1KQ9 A;  1ZEL A;  3BWG A;  1R36 A;  1W5S A;  4BQN A;  1OIS A;  4EJO A;  4OIN F;  3KEO A;  4CSW A;  1PUF B;  4RDU A;  3DFG A;  2RVC A;  1VQ5 I;  4FE4 A;  2DN0 A;  3CCL I;  3H1C A;  1J59 A;  3WG9 A;  1MH4 A;  3V7R A;  2CH0 A;  3RJP A;  3N4M A;  3MZH A;  5HDK A;  1RUO A;  2EIJ H;  3FIW A;  2HVQ A;  2WBM A;  2JSP A;  2XVC A;  3A0B C;  3TQN A;  3AL0 B;  5IT9 Z;  4HLY A;  4D5C A;  3QPH A;  3FHZ A;  2Z99 A;  1OPC A;  3DXJ F;  1KA8 A;  5BS6 A;  4A3K J;  1J75 A;  3TDU C;  1TC3 C;  4RB2 C;  3W6J B;  2X9D A;  2L9R A;  1J09 A;  3F3X A;  4DZJ A;  3E5Q A;  1F4K A;  1DU6 A;  1K6Y A;  2HOA A;  1G2H A;  2IW5 A;  2L9N A;  4B09 A;  2LK2 A;  3CCR I;  4FIS A;  3GTJ J;  2XKO A;  2ZME A;  2I10 A;  5H20 A;  2I5U A;  1LDK B;  4CZZ A;  1X3Z B;  5HOD A;  1LEB A;  1Z6T A;  3CUQ C;  1M1E B;  3P5J A;  2V79 A;  2M3A A;  4D7M A;  2JK3 A;  2HQ5 A;  5DV5 A;  1A6I A;  3A1Y A;  5C4X J;  3M8J A;  2PBI A;  3VYU B;  3GX4 X;  2E1M C;  4XN3 A;  2FU4 A;  4JK1 X;  5IYC J;  2X6X A;  1T0F C;  1ZGA A;  3RKY A;  1ZG1 A;  1U5T B;  3CMA I;  3SQN A;  2ZSI B;  3Q5F A;  2JPC A;  3LOC A;  4HRI A;  4OIQ F;  3F8F A;  4RB0 A;  4NHJ A;  2A07 F;  1TT0 A;  1QRY A;  4HW0 A;  1E17 A;  4IQ4 A;  1KU2 A;  2JPB A;  5D5W B;  2W00 A;  2VBW A;  5CLS A;  3I0T A;  1R22 A;  5J1Y A;  2FML A;  3CZ6 A;  3EET A;  2O9L A;  1QA6 A;  4XOT A;  3UNG C;  2MH2 A;  1GUU A;  3IUO A;  4RA2 A;  2HWV A;  3FM5 A;  4BHB A;  4I0A A;  3WTV C;  3FXJ A;  2DA4 A;  4ZDL A;  3KZI C;  1P2F A;  3KLO A;  3EUK L;  1MKM A;  1QQI A;  1ZG5 A;  3Q0W A;  5CVU A;  1QZZ A;  3DKX A;  5CVI A;  3VYS B;  1PJR A;  1A31 A;  1KQ8 A;  3T1B A;  4D7N A;  2FNA A;  2K3P A;  3I9V 2;  2MAB A;  5FLX K;  1PYV A;  1TT5 B;  2STW A;  4XKB A;  1FPQ A;  1BOA A;  3KEY A;  1I1G A;  3LSP A;  5IP9 J;  3I4M J;  2EZK A;  2CQQ A;  1H8A C;  1X1P A;  4UUV A;  2E7W A;  4XOR A;  1R4M B;  3NQO A;  1KYZ A;  1LQ1 A;  1T0F A;  3OYJ A;  3A01 B;  5LEJ A;  2PJR B;  3SZP A;  5TIS C;  2KFD A;  3CC7 I;  4GRI A;  2VXZ A;  1ON2 A;  3AG4 H;  3V4G A;  3JSP A;  1SFX A;  2XB5 A;  4CCO A;  1TW2 A;  1OCZ H;  4KNY A;  4XNF A;  1EF4 A;  4RAF A;  1SVO A;  2HZT A;  3QYF A;  1A04 A;  2AXL A;  2N8G A;  4U88 A;  2JJ7 A;  1ZH5 A;  4IHW A;  1GHC A;  4A6D A;  2RAE A;  1W36 D;  5IPA A;  2QM3 A;  2FBI A;  4IX7 A;  2LBF A;  5FRM A;  4A3J J;  2W7N A;  2Q2E B;  4L18 B;  2GA1 A;  2ID6 A;  3K6G A;  3S32 A;  4DQ2 A;  1FTT A;  3H3V K;  5TRD A;  1UST A;  3O3K A;  1R6R A;  1RR7 A;  3WHC A;  3W2W A;  2VUM J;  1BW6 A;  3CMY A;  3EYI A;  4OAY A;  1IXR C;  1UEL B;  2VKH A;  4M3B A;  4ABZ A;  4LLN A;  1FTZ A;  3CD6 I;  3SDG A;  4CCL A;  2L5Q A;  4ENJ A;  3W2V A;  1OYW A;  3SEQ A;  2R4G A;  2ZC2 A;  3U9G A;  4LG0 A;  4PJ0 C;  2PMH A;  4BQA A;  2E1N A;  4A3G J;  1P92 A;  2MGQ A;  2M8G X;  2GAU A;  3FX3 A;  3H3U A;  5M3F J;  4FX0 A;  5LHI A;  4PJJ A;  2K27 A;  5JLX A;  4RS8 A;  4W97 A;  3LA7 A;  2Y48 A;  3WGI A;  3ABK H;  3WU1 B;  3MKW B;  2KZG A;  5HNH A;  1R23 A;  4XKV A;  5GTH C;  3CQZ J;  2ELJ A;  3DBL B;  3SZG A;  5B66 C;  1K4S A;  3ABT A;  3KP7 A;  1ZQ3 P;  1FSE A;  2K9M A;  5CKT A;  3KEQ A;  3L09 A;  5J40 A;  2F5V A;  1H9T A;  2MD5 A;  4PJL A;  1ODD A;  3WTX C;  2E36 A;  3B73 A;  1JKP C;  1FBU A;  4E7L A;  1YJN I;  2LRE A;  1TWH J;  3KCC A;  4RM2 A;  3BR3 A;  3L1P A;  3QOP A;  4KIB A;  1G8X A;  2OF7 A;  2XIG A;  2VPR A;  4HQE A;  4EMS A;  4LB5 A;  3DBR B;  4BHC A;  2Z2S B;  2JWT A;  2DA3 A;  1MD0 A;  1MBJ A;  4NQW A;  1WPK A;  4GCV A;  1Z7L A;  4YG2 F;  4NUB A;  3KYL A;  1HXD A;  3HXL A;  4Y17 A;  4NC6 A;  3OYH A;  4PCQ A;  3ZQC A;  1IRF A;  2DOF A;  3GBG A;  2HU9 A;  4B4C A;  4CIC A;  2R7T A;  5JR3 A;  1O7L A;  1I6X A;  3IV5 A;  3K70 D;  5JHU A;  4PSX A;  2BV6 A;  4L9T A;  2CSO A;  2LYC A;  2CQX A;  4C9Y A;  5E79 C;  2TRT A;  1U3E M;  1IO2 A;  4M71 A;  3OYB A;  2ELH A;  4BAC A;  3Q9S A;  2JVH A;  1L0O C;  1AOY A;  2KIQ A;  3L2V A;  2B63 J;  2DOA A;  2ID3 A;  2XF6 A;  3ZMS A;  2BXY A;  2W84 A;  1QNT A;  1WH5 A;  3QPT A;  4KN7 X;  1YJ9 I;  2GOM A;  4DBQ A;  2ZXJ A;  2OCE A;  2P5K A;  5E20 A;  2X1C A;  4MO7 A;  4QIW N;  5FB2 A;  3RPU A;  5DD8 A;  1YYV A;  1IN7 A;  3W6V A;  2ISY A;  2KT0 A;  2XGC A;  3HG9 A;  1YS6 A;  4G8X A;  4BU2 A;  4N4O B;  5CPR B;  5F0C A;  5LD2 C;  3DKY A;  5F6F A;  4A93 J;  1V5F A;  2L54 A;  2VAS A;  3A03 A;  4U0W A;  3T8T A;  2KRH A;  3COA C;  2PFB A;  1ZLJ A;  4A0X A;  3E1S A;  3FMS A;  3OYC A;  2MC4 A;  5BPD A;  2PQ8 A;  3LSI A;  4M6X A;  3C3W A;  4KFC A;  5F27 A;  3GZ6 A;  1XD7 A;  4KIG A;  2TCT A;  1HLV A;  3HBL A;  2CQK A;  4YIF A;  2XPV A;  3QYB A;  5CVV A;  3L2U A;  3CUQ A;  1WJE A;  2BY3 A;  2KIS A;  2XAJ A;  1VQ6 I;  5HVQ C;  4U7D A;  2OPT A;  1BR1 A;  2WAQ N;  3LMM A;  3LSH A;  3DEE A;  4XSX F;  4CYC A;  2LLK A;  2A6T A;  3CJR B;  3DU6 A;  1WJF A;  3EYY A;  3KPH A;  4KIT B;  1NH3 A;  5BNG A;  2CU7 A;  2ZB9 A;  3QP6 A;  3WU2 C;  3ZQF A;  2DYR H;  4ZYG A;  4NQW B;  1S72 I;  2XAG A;  1TZL A;  3RDI A;  2CW7 A;  3BG7 A;  4O6J A;  1FYK A;  3HM5 A;  1BI3 A;  3EUA A;  5CQE A;  1KZH A;  3E7L A;  5DUK A;  1NK2 P;  3HOZ J;  4O3M A;  3O6B B;  1ERD A;  3JRH A;  3HPG A;  3ECO A;  3MFK A;  3G73 A;  1NHA A;  4CCM A;  2OUM A;  2RKH A;  3RYP A;  5EDN A;  1EV7 A;  3QQA A;  2BZT A;  4EJU A;  4LOC A;  1B4A A;  2NOJ B;  2RNJ A;  2GXG A;  4L5I A;  3ZQG A;  2LRD A;  5F1R A;  1IDZ A;  1XSX A;  2P6T A;  4HZF A;  1G3T A;  3I3L A;  1MND A;  4IKF A;  3CDH A;  2E5N A;  1TWA J;  2DJN A;  4AUX A;  2DPU A;  2HXO A;  2Y0S A;  2LY2 A;  1NK3 P;  2VQH A;  4A5N A;  1EH6 A;  5HNF A;  2DDA A;  4PSW A;  3OYA A;  2XRN A;  4BY7 J;  3DCF A;  2EZH A;  1D0X A;  3M8E A;  2JA2 A;  1D1A A;  5FRN A;  1QZE A;  4HYE A;  5ILV A;  2IGM A;  3KZY A;  4RGX A;  5LEK A;  3OS0 A;  5IP6 A;  2LMD A;  4KA4 A;  5BQT A;  5DDG A;  4Y33 A;  5FJ8 J;  1J9I A;  2ICW G;  3OYF A;  1VF9 A;  4Q47 A;  5KVR A;  1QHG A;  1N75 A;  2WV0 A;  2X1D A;  3DP7 A;  2VIX A;  1GV2 A;  2E71 A;  2XGE A;  2IP2 A;  5KAI C;  4ASN A;  2RGV A;  1ZRE A;  4E7Z A;  3BTI A;  1XMA A;  1JT6 A;  1U8B A;  1HCR A;  1D8K A;  1ETQ A;  1I3A A;  1CF7 B;  3WOD F;  3PSI A;  2CQ7 A;  1LVK A;  4F52 A;  1R4N B;  4BXX J;  2DAO A;  2DFH A;  5JVT A;  1DP3 A;  4IEJ A;  2M34 A;  1K78 A;  2JZY A;  4XR6 A;  2L2O A;  2M7A A;  3CP2 A;  3E5U A;  1VQ7 I;  5CVJ A;  2M2E A;  3BY6 A;  5DEQ A;  3WTT C;  5M5W J;  2H27 A;  4XSZ F;  1TNT A;  2QEX I;  4A3M J;  2HNH A;  3GTP J;  2OV7 A;  4KMF A;  1S7E A;  3K4M A;  2DOD A;  3T0Y A;  3J7Y J;  2XF5 A;  1RI7 A;  3L7W A;  3IWZ A;  1MSE C;  3GTO J;  5IT9 K;  2ZNY A;  4PFO A;  2VI6 A;  5CYV A;  3C18 A;  3EUH C;  4MGR A;  1W4M A;  3KZZ A;  3G71 I;  2R7W A;  1XG1 A;  2MG4 A;  3K69 A;  4L0Z B;  2J5P A;  2IS1 A;  3A02 A;  3CCQ I;  2BEO A;  3C2B A;  1N25 A;  3C1D A;  3HEF A;  3G1L A;  1MMD A;  1B1B A;  2YSR A;  3SHF A;  1BW5 A;  4HOB A;  1C0W A;  4S04 A;  1IUY A;  3MKZ A;  1VQL I;  4BEH B;  4RBO A;  3M4O J;  4Y7N J;  4IZZ A;  2O61 A;  3S17 J;  1EKE A;  1AA7 A;  4PJM A;  1XGS A;  1BC8 C;  2JN6 A;  1D8J A;  4ANJ A;  1FP1 D;  4NB5 A;  1RC9 A;  1OMI A;  4PJN A;  1F5T A;  9ANT A;  2QLZ A;  3ELK A;  3GF2 A;  3W6K B;  1I27 A;  2V9V A;  2V6C A;  3OY9 A;  4CHU A;  2D5V A;  2WAF A;  2MBF A;  2HZD A;  2EIM H;  4MQV A;  1R1T A;  2HKX A;  3V7S A;  3M3Y J;  1MH3 A;  1YW9 A;  3HL2 A;  3A2K A;  3CCS I;  4OMY A;  4E7J A;  2CRG A;  3CJN A;  3LAJ A;  5L3D A;  4CXF A;  1FBQ A;  3BJ6 A;  3MEX A;  4BE2 A;  2ZSH B;  1BJA A;  4UUT A;  4ZTF A;  1Z67 A;  5C3E J;  2LOO A;  4A3F J;  1BOB A;  1QHH D;  1X1D A;  1VFC A;  1X1C A;  1MMA A;  1WI3 A;  3CJQ B;  4D5F A;  4MIM A;  2Z9O A;  2DMT A;  4EVI A;  3G4S I;  1F36 A;  4N9H A;  4R8H A;  4V2F A;  1P7J A;  4FTH A;  3UKG A;  3N97 A;  4L5J A;  3CO6 C;  1ETO A;  3U21 A;  3PIO F;  3H0D A;  2ADU A;  5KHD A;  4AIK A;  3HSE A;  3C7J A;  3QYE A;  4ENM A;  5F08 A;  1F43 A;  2NVY J;  3ASO H;  3CCV I;  1ZYR F;  3TL4 X;  1PP7 U;  2G9W A;  1QPI A;  3PFY A;  4DNC A;  4KT5 C;  1U0J A;  1YLF A;  2QSG X;  3PL8 A;  2QQB A;  1SFO J;  1FP2 A;  2VKV A;  2KPM A;  1BI2 A;  3S14 J;  3F8N A;  4B3A A;  2LNB A;  3BPV A;  1WKM A;  2HQN A;  1JE8 A;  1YE9 A;  2UXN A;  1TQM A;  4KIC A;  4G94 A;  3J80 K;  1OYY A;  3DKW A;  1SMT A;  4NBQ A;  1FOK A;  3PO2 J;  1Q1V A;  2PMZ N;  2NRA C;  2QUF A;  4F55 A;  2EWN A;  3PM1 A;  4WXD A;  2KL4 A;  4M3D A;  2ZBK A;  3BCA A;  3H9Q A;  1WHU A;  3GO5 A;  3S1Q J;  3RCO A;  2XAF A;  2L3D A;  4GYG A;  3R4K A;  3M1C A;  4YFK F;  4WX9 A;  3H35 A;  4QPO A;  2VOD A;  4RM3 A;  2Y75 A;  2JUG A;  1FNN A;  1BIB A;  4ZDO A;  2QZ8 A;  1UZC A;  1APL C;  4QSH A;  4II2 A;  2NVU B;  4RGU A;  2VE8 A;  3RKW A;  3GW2 A;  3FXM A;  4BJ5 C;  1DPU A;  3HRU A;  3IAM 2;  5EGO A;  4L9V A;  2EZL A;  2JMW A;  1R5H A;  3WTW C;  4C2T A;  4ESB A;  3LWF A;  4IRI A;  5HLI A;  3OSG A;  2PG4 A;  2ME0 A;  2NAZ A;  4PZJ A;  1ZRF A;  4U7B A;  2XAQ A;  3J7A Y;  4OWR B;  1K6O A;  1JKQ C;  1HST A;  1EH8 A;  2YUS A;  4BE1 A;  3AKZ A;  3DU5 A;  3Q9V A;  3SJM A;  4IO9 F;  4XLH A;  4J00 A;  4HEA 2;  5FGM A;  1FLI A;  1SD4 A;  2R5Y B;  4M9S A;  4A3C J;  2KLO A;  2EZI A;  1GVJ A;  2PI0 A;  1V3F A;  2AO9 A;  1S7O A;  1B72 A;  2M30 A;  2VQL A;  5E3O A;  2G7U A;  4EM1 A;  5LLQ A;  3JAM Z;  1SFE A;  5FKN A;  1AHD P;  4HF1 A;  3X2Q H;  2VPL A;  2QQ9 A;  4FAS D;  2D1V A;  1NG7 A;  4ESF A;  1IXC A;  3OYM A;  4MTE A;  2A3S A;  2CFX A;  3BR6 A;  4CCJ A;  3KE2 A;  2W4S A;  3WGH A;  1G4D A;  1REP C;  3L2C A;  3BP8 A;  1HC8 A;  3O2P E;  4I76 A;  5E3M A;  1J0R A;  1T33 A;  1Z21 A;  3LSK A;  3OYL A;  5K5O A;  2BVL A;  1CGP A;  2DW4 A;  3OOP A;  5F64 A;  1O7F A;  1LKX A;  1ZN2 A;  1K79 A;  2R7S A;  2M9H A;  2V4J C;  4GYI A;  5BPI A;  2HGC A;  5IYD J;  2DOE A;  1YI2 I;  2HDC A;  4FT8 A;  2Y69 H;  3P9I A;  1WZ2 A;  3L9F A;  5GPA A;  2ACJ A;  2W24 A;  4EAT A;  3I5U A;  1VQN I;  1HW5 A;  2GZW A;  4XOP A;  2VON A;  3MCZ A;  4XIC A;  4CCN A;  2OD5 A;  1XGO A;  2BXZ A;  4G6D A;  4G9Y A;  1KGS A;  4S0H B;  4ENN A;  2CGP A;  2EBI A;  2DO7 A;  2K02 A;  4LIU A;  2CUJ A;  2V26 A;  1DQU A;  1YX5 A;  2A68 F;  2AQF A;  4P1W A;  4GGG A;  4CYD A;  3J7Z I;  1ZR4 A;  4I99 C;  1Y39 A;  3RKX A;  4NC8 A;  2QKM B;  2E2H J;  2YR2 A;  1HW1 A;  2HS5 A;  3HKZ N;  5JLW A;  3W3C A;  1TW3 A;  2XRO A;  2P81 A;  2Y2Z A;  4ESJ A;  1U9O A;  2CQN A;  3O8G A;  2IJL A;  4XRS A;  3JRI A;  2VQG A;  2ZFW A;  1X58 A;  4UB6 C;  1TWG J;  2JSC A;  4OIR F;  5L3B A;  3PIP F;  2F48 A;  4U87 A;  2ESN A;  3S93 A;  3HGY A;  2A5W A;  5HS7 A;  2DXI A;  1FMW A;  2FOW A;  2OAZ A;  1YG2 A;  1T38 A;  2GM4 A;  3KP3 A;  1FWZ A;  1X4O A;  2FA5 A;  2Y30 A;  1BL0 A;  2V6E A;  2YU3 A;  1D3Y A;  2LC2 A;  2QCO A;  1X4P A;  1R9T J;  3CMM A;  5LFA A;  2VC0 A;  3F21 A;  1GV5 A;  4HNT A;  1OCO H;  2WC2 A;  1UHS A;  4AD9 A;  4Q4Z F;  5DYM A;  1KON A;  1IZ1 A;  3EUH A;  3HPH A;  2ECC A;  5H6Q A;  5E18 F;  1X2N A;  3CC2 I;  3VSK A;  1XTA A;  5HOO A;  3ABL H;  3BJO A;  1O4X A;  3QP5 A;  1Z1D A;  1U5T A;  4C2M J;  5EZG A;  1JUS A;  2BE5 F;  1W0T A;  4LG0 B;  2CUF A;  3BG9 A;  3CF2 A;  3GFL A;  3IL2 A;  3RKQ A;  2EV6 A;  2D2W A;  3PJR A;  4P96 A;  5FLX Z;  3ZXS A;  4RAY A;  4E7K A;  3SEZ A;  2ZJP F;  2ZO4 A;  3BR5 A;  4C30 A;  3DBH B;  5C4J J;  2IA2 A;  1U78 A;  5J1U A;  3HDD A;  3G1O A;  4IRH A;  2H6B A;  1XDU A;  4EEF G;  1WI9 A;  2L9V A;  4NDL A;  5HS9 A;  3WU0 A;  3REO A;  3V7C A;  2LKX A;  2IBD A;  1JGS A;  2XSD C;  1FOY A;  2STT A;  2K4B A;  3K1N A;  4JP0 A;  4F92 B;  2OZ6 A;  3IWF A;  3MN2 A;  1UJ8 A;  3VDX A;  2Y9Y A;  4XM3 A;  3TP3 A;  2KMU A;  1VI0 A;  1B9M A;  4WK8 F;  2R7V A;  4HNV A;  2WAD A;  1SAX A;  2R0Q C;  2RDP A;  2LSO A;  4KUM A;  2VN2 A;  1BR2 A;  4UUS B;  5J6X A;  5K7Z A;  3LSJ A;  1K7A A;  4HDU A;  2W25 A;  3DEU A;  2V1N A;  1YRN B;  4G7O F;  3OYI A;  2FE3 A;  3ERM A;  3H5A A;  1N78 A;  2F4M B;  5K5R A;  3PSF A;  2F5E A;  3A01 A;  2ISZ A;  4GDF A;  2B0L A;  3ZCO A;  2E5Z A;  3CF5 F;  2KDZ A;  3E3V A;  5H6R A;  1X1A A;  3FWE A;  1FMV A;  1RKT A;  4Z2Y A;  4ZYH A;  3HOW J;  3S15 J;  4HX8 A;  3VYT B;  1LE8 B;  1JI8 A;  2WAE A;  5J4V A;  1X19 A;  1T8I A;  2EIN H;  3E97 A;  1ZTR A;  4I7H A;  2GXA A;  3GLL A;  2J5O A;  1Y1V J;  3FKJ A;  4PUS A;  3GCM A;  3JCU C;  1B59 A;  2RN7 A;  3H92 A;  2P8T A;  4IHV A;  2HYF A;  2BVM A;  1I6H J;  4HV5 A;  4I01 A;  3HTU A;  3I4N J;  1SD5 A;  5LBQ A;  4ZTJ A;  1SFU A;  2OTL I;  1KU9 A;  4XID A;  1STZ A;  2LKP A;  2BBY A;  2LR8 A;  1E3H A;  4A69 C;  5CQG A;  1KQ0 A;  1E3O C;  3JSO A;  1MNM C;  2M0M A;  3HC7 A;  4X6A J;  2ZJR F;  3ZMU A;  3MWM A;  5GAE J;  3FBI B;  3ABM H;  1HDD C;  5DCM B;  1JUM A;  1MBE A;  2R7D A;  3NAR A;  4OIO F;  1I50 J;  1SD7 A;  1P9Q C;  2Q2E A;  1Z9C A;  3JTG A;  4M3F A;  2DCE A;  4AYB N;  4A0Y A;  4QTR A;  1IG7 A;  2KJC A;  1T95 A;  2VBY A;  3C2G A;  4PDK A;  5D4S A;  4WXC A;  4FCY A;  2IXS A;  4UXN A;  1S3J A;  3PNV A;  2EPF A;  2MW8 A;  1XC5 A;  2LP0 A;  1B8I A;  1QBJ A;  2R7Z J;  1VND A;  5M5X J;  3HOU J;  4OAZ A;  4D9J A;  4ZC3 A;  3RZO J;  2KZV A;  4P5O A;  4ZZL A;  2R7Q A;  4CH7 A;  2XAH A;  1VQP I;  2IS4 A;  1ETV A;  4HAM A;  2TDX A;  1IAW A;  3FZV A;  4G6Q A;  3ZQQ A;  1IXS B;  4ZDP A;  5FKM A;  4IPA A;  1T56 A;  3TMO A;  3VOE A;  3ZN1 A;  3GUD A;  2HYG D;  5B5E C;  2MYS A;  3LQR A;  4F93 B;  3LSM A;  4DOZ A;  1QZY A;  1E2X A;  4M3G A;  1BN5 A;  2MSY A;  3M07 A;  1IC8 A;  4LD5 A;  3NEU A;  5EEH A;  1BR4 A;  3DPT A;  2EV5 A;  2L7Z A;  2COM A;  1ZG3 A;  1T2K A;  3T8R A;  4G12 A;  4HF2 A;  1O3R A;  2O3F A;  3CP8 A;  1O3Q A;  5EG0 A;  4XL9 A;  2K86 A;  4KYW A;  1UHW A;  4YII A;  3CO7 C;  1KU3 A;  3E6C C;  2K4J A;  4WWC A;  1Z0X A;  4Y4R A;  3BPX A;  3TGN A;  3V42 A;  4EQQ A;  3MZ8 A;  2GIZ A;  2CW8 A;  5ED4 A;  2WV1 A;  2OA4 A;  2L02 A;  4QLC U;  3BR2 A;  4AU7 A;  1LDD A;  2VJ4 A;  1TWC J;  2K9N A;  5F0F A;  2CYY A;  4LJZ F;  1XPX A;  3BOQ A;  4OIP F;  3RIR A;  1SC7 A;  3FXU A;  1ORK A;  2W82 A;  4HX7 A;  3R0J A;  4HPQ A;  2JRT A;  3DPL C;  3LAP A;  1T39 A;  1MBK A;  1YX3 A;  3DLA A;  1LUJ B;  2CG4 A;  3SZT A;  4Y3O A;  5J4Y A;  4E7H A;  2IS6 A;  1ZHF A;  1IRG A;  3HRS A;  3EQL F;  3OV8 A;  2CV1 A;  3D0S A;  2LVS A;  2WWY A;  4TV7 A;  3OL3 A;  1UFM A;  3GTK J;  3MZY A;  1I39 A;  2XSJ C;  2HKO A;  2XPU A;  4F3Q A;  3CC4 I;  1X3U A;  2XGX A;  4XLE A;  3JTH A;  2IAI A;  4XKW A;  5GAH J;  3B02 A;  1JTX A;  1U6G A;  4GFB A;  1E0E A;  1MBG A;  1RNL A;  4YEJ A;  5L3C A;  2E35 A;  1HKQ A;  4MLO A;  3FMQ A;  3ASN H;  2XPW A;  3LFK A;  1NG6 A;  4EM0 B;  3BTL A;  2F4I A;  1AU7 A;  3S2H J;  1ACI A;  4HNU A;  1Y0U A;  2F5C A;  3GFJ A;  2DQR A;  2UXX A;  1FOX A;  5B3S H;  2Q1Z B;  1G6N A;  5GP9 A;  1JHF A;  3WGG A;  1XSD A;  4M6V A;  5J3L A;  3I4P A;  2OC6 A;  4BQO A;  1PUE E;  4MEY F;  4UVA A;  2W85 A;  2E19 A;  4X1E A;  2FQ3 A;  2HVR A;  2GWR A;  4E7S A;  2DA5 A;  1V55 H;  2L7F P;  3OR1 C;  2WTE A;  4MEX F;  2ETH A;  3OR2 C;  2DMQ A;  3TW7 A;  4DIQ A;  1WQ2 A;  4XQF A;  1QU3 A;  1YO5 C;  3OYD A;  4UV8 A;  1WRJ A;  5FKK A;  1OCP A;  3M7G A;  4DGW B;  2KIF A;  5HLG A;  3I59 B;  2GXB A;  5EGO B;  1YTY A;  1JKR C;  4YRV A;  2OTJ I;  1P4A A;  1XCV A;  2Y31 A;  2QQ8 A;  1DGW Y;  2Y0S N;  2KQR A;  3D1N I;  4RLF A;  3Q3S A;  4HA8 A;  3CLO A;  1N77 A;  3MQ0 A;  2BY0 A;  2AQE A;  1TNS A;  1W36 C;  2PJP A;  5FLM J;  2XUB A;  1EA3 A;  3KIO A;  1ZAR A;  3RTR A;  1RPW A;  3F23 A;  1O3T A;  1PDN C;  1HKS A;  4UUS A;  3L2Q A;  2E1O A;  4NC7 A;  3O8H A;  1AKH A;  4V19 K;  2ELK A;  2EQR A;  4B48 A;  3FBN B;  4FX4 A;  4C3I J;  4BBS J;  2L4A A;  5LRS A;  3JR9 A;  1IN6 A;  3ZR8 X;  5E8G A;  1LVA A;  3PO3 J;  2Z5U A;  3FXK A;  2A05 A;  1HOM A;  2W1O A;  3JRF A;  3OMY A;  1EH7 A;  3QAH A;  1G3W A;  1IRZ A;  1ETK A;  5FLV A;  3F22 A;  1OJL A;  2DTR A;  1MGT A;  4XLF A;  2FXA A;  1BA5 A;  1JJ6 C;  5K1Y A;  5HDN A;  3I71 A;  1ENH A;  4IXA A;  5J47 A;  2IA1 A;  4ENK A;  3GTL J;  3MKY B;  4R1H A;  1VQO I;  3E6B A;  1Z3X A;  3FMR A;  1TQI A;  2QSF X;  3NRV A;  2IA0 A;  4A3E J;  4BXF A;  2ZME C;  3DF8 A;  3QPL A;  1U8R A;  2FBH A;  2GOX B;  4H4K C;  4IVN A;  2R7F A;  3F8C A;  2EK5 A;  3QOD A;  3QPS A;  1D5V A;  2QGU A;  4I6Z A;  1X2M A;  2VOO A;  2A5Y B;  2K85 A;  1V54 H;  2HTS A;  1T98 A;  2L9S A;  3HOS A;  4HSR A;  5KK1 A;  4UNO A;  4G7H F;  5BMZ A;  4CCK A;  1YIT I;  2XAS A;  2VLA A;  1G59 A;  1JJ8 C;  3AL0 C;  1FSH A;  2OU2 A;  1CQT A;  3F72 A;  3MKL A;  5HDG A;  3M8F A;  3QU6 A;  1QVT A;  3RZD J;  4P9F A;  2QKL B;  1SAN A;  4RGS A;  3DV8 A;  2NVX J;  1GXQ A;  3IKV A;  4IQJ A;  1DP7 P;  5F04 A;  3FXR A;  3DPU A;  2WY8 Q;  4LG3 A;  4EJT A;  1IJW C;  1VZ0 A;  3OS1 A;  5KAF C; 
#chains in the Genus database with same CATH homology
 1DUX C;  2V1U A;  2D1H A;  1MDM B;  1BC7 C;  5A2Q Z;  1XDS A;  1OR7 A;  1ONV A;  2IVM A;  4WF2 A;  5FO5 A;  4I98 B;  2P7V B;  1YW7 A;  2E7X A;  1BIA A;  5L3F A;  2QBY B;  3JAM K;  1QGP A;  1BM9 A;  2DU9 A;  4B8X A;  3J7A O;  5D5X B;  3VB2 A;  1KYW A;  1F9N A;  2ZNZ A;  2K7L A;  3J81 K;  1SMY F;  1LEA A;  3LA2 A;  2MLK A;  2HTJ A;  1HKT A;  2O6G E;  4N9I A;  3I58 A;  2JT1 A;  3BJA A;  3WTU C;  3HHG A;  1R1V A;  3KP5 A;  1SD6 A;  3BZ6 A;  2ZCW A;  1ZGJ A;  3D5L A;  3ZN0 A;  2O03 A;  3CUQ B;  5LHH A;  1QO0 D;  3J81 Z;  2DI3 A;  5D6E A;  3GZ5 A;  3I59 A;  2EFQ A;  2DQL A;  5E1W A;  3HUG A;  3IHU A;  4LB6 B;  1W7P D;  3K1M A;  4A5M A;  3ZMZ A;  1GXP A;  1I5Z A;  3KET A;  1LDJ A;  4IHS A;  5FD6 A;  5CJ9 A;  2BYV E;  3MAJ A;  2QEN A;  4KIF A;  3WE2 A;  1L3L A;  1O57 A;  1OKR A;  2EV0 A;  3KLN A;  3TDZ C;  2DPD A;  4HF0 A;  2DFI A;  4UVC A;  3TOA A;  5E1X A;  3R61 A;  3S2W A;  1J5Y A;  3V8J A;  3F6O A;  2Y0M A;  4IJA A;  4I09 A;  1W5T A;  2XKP A;  2XHK A;  5DD4 A;  2LF7 A;  4MNU A;  5DUI A;  3HOT A;  4RAZ A;  5A2Q K;  1XN7 A;  2P4W A;  3K2Z A;  3KP6 A;  2ESH A;  2A6E F;  3TO9 A;  3K0L A;  2HQR A;  3LST A;  2NNY A;  2EJR A;  2OQG A;  2Q0O A;  3E5X A;  3I53 A;  3F8M A;  3PQJ A;  2PLY A;  3G3Z A;  1BI1 A;  1ZLK A;  2HR3 A;  1HBX G;  1ON1 A;  5IT3 A;  1XSV A;  2JTV A;  3QRF F;  3E6D A;  2NYX A;  3K9T A;  4GXO A;  1TBX A;  4CGZ A;  2CW0 F;  1W7P A;  2KKO A;  2NNN A;  4I02 A;  3RYR A;  1XMK A;  2X4H A;  5D8K B;  1TTY A;  3WE3 A;  3HIF A;  5D4R A;  1QPM A;  5DCF A;  5CVR A;  2M5W A;  1TLH B;  1S6L A;  3SXY A;  4QWQ A;  2F2E A;  2FRH A;  4WCG A;  1MJ9 A;  2ZKZ A;  4UV9 A;  4L9N A;  2F5D A;  2QQA A;  1YFH A;  2HFH A;  1UHM A;  3J80 Z;  3DQV C;  2FSW A;  2VC1 A;  1H0M A;  4YFN F;  1FY7 A;  2VBZ A;  1USS A;  4LLG F;  3V8K A;  2EFN A;  4HV6 A;  3IRR A;  4EV0 A;  1XB4 A;  4BHP A;  4LLL A;  2KRF A;  2MH9 A;  1OYI A;  3IRQ A;  1XGM A;  1R7J A;  1LJ9 A;  4O5V A;  2A69 F;  5LRR A;  1P4X A;  1TQP A;  1WWX A;  5AIP A;  1IW7 F;  3PFI A;  2EFP A;  1P6R A;  1R58 A;  5D5U B;  1IF1 A;  5FFZ A;  4EJV A;  1DPR A;  4GO1 A;  2M87 A;  5E1Z B;  4I0B A;  3CTA A;  4LGW A;  3I64 A;  1O3S A;  4CO8 A;  2DT5 A;  3TO7 A;  5JFR A;  2Z3Y A;  4I2O A;  4OMZ A;  2QVO A;  4AIJ A;  1MZB A;  4CDG A;  3CUO A;  3ERE D;  1WSU A;  4HBL A;  1R5G A;  4EM2 A;  4YFX F;  5J8F A;  1Z7U A;  4WXH A;  5ILU A;  5ILS A;  3ULQ B;  2PMU A;  2CO5 A;  2BGC A;  3P9C A;  4XBF A;  4PGG A;  4Q5S F;  1MJA A;  4UHT A;  1ZRD A;  4A6E A;  2ZME B;  4M9Z A;  2X0L A;  2LF8 A;  3IKT A;  2V1D A;  4RGR A;  4P55 A;  3HRT A;  3ISP A;  2H6C A;  2PEX A;  1IN5 A;  1YS7 A;  2O8X A;  3I54 A;  5LGN A;  2EA2 A;  1K78 B;  2F5F A;  3TOB A;  1G3S A;  3P9K A;  4M72 A;  2C6Y A;  2RC4 A;  3HTS B;  1HQC A;  1J2X A;  2A6H F;  2D45 A;  3ZPL A;  3PQK A;  1S29 A;  2VT2 A;  3ZQ7 A;  3GFI A;  5TJJ A;  4F7Z A;  4BXU A;  3RPQ A;  1I1S A;  3U2R A;  5LGT A;  1CF7 A;  3KP4 A;  2YX4 A;  4PGH A;  2DLL A;  1W7P B;  1FYL A;  5LGU A;  2V1X A;  1FBS A;  2VOP A;  1RIO H;  4A2U A;  4L0Y B;  4XRF A;  2P5L C;  3KFW X;  4K2E A;  3GVA A;  1JHH A;  4G7Z F;  1IN8 A;  3M9A A;  4ZYE A;  4Y13 A;  1FYM A;  4N0B A;  5E17 F;  3BDD A;  5HLH A;  1T6S A;  3U1D A;  2H09 A;  1J7K A;  3V8L A;  2HEO A;  2HOE A;  1ZAO A;  2EB7 A;  3R0A A;  4JQF A;  3QU3 A;  4Q48 A;  5D8L B;  1Z91 A;  1ZRC A;  2L4M A;  5ICG A;  5E8I A;  1R1U A;  2MA3 A;  1H9G A;  3TO6 A;  5EEG A;  4EJW A;  3L00 A;  1IN4 A;  5D5V B;  2FEZ A;  1UB9 A;  2DBB A;  4AIH A;  3HHH A;  4E70 A;  1JXS A;  6PAX A;  2E1C A;  4S05 A;  2VBX A;  4M9X A;  5JI6 A;  4ZH4 F;  1LNW A;  4LFU A;  1XCB A;  3GYH X;  5FFX A;  2H94 A;  4Y15 A;  1ULY A;  2RQP A;  1FZP B;  4HQM A;  4KMU X;  4IF4 A;  4MTD A;  4MHG A;  4ZZD A;  3AAF A;  1RZ4 A;  2EFW A;  2YPR A;  1FT9 A;  2KIU A;  4XLN F;  2UWM A;  4M74 A;  3ROU A;  4JBA A;  3HYI A;  3FXQ A;  2FNP A;  4ZYD A;  5AON A;  3ZMT A;  2L01 A;  4ON0 A;  4KN4 X;  3HRM A;  2FBK A;  2R3S A;  1B6A A;  4AWX B;  3KP2 A;  5L3E A;  4RB3 C;  3ML6 A;  1HSJ A;  3R60 A;  3VEP A;  2G7H A;  3VOD A;  2DK5 A;  3ABU A;  3FF5 A;  2IRF G;  2OZU A;  4LK0 F;  2CWE A;  3IC7 A;  1S8N A;  2GIV A;  4HDV A;  4ETS A;  2GQQ A;  3RI4 A;  2IPQ X;  4EGY A;  1LB2 A;  1S7A A;  3GLX A;  1YW8 A;  2MC3 A;  5D6F A;  2QWW A;  4FHT A;  2OBP A;  4U0V A;  3F6V A;  4LMY A;  2OQR A;  1UCR A;  4A12 A;  1P4W A;  4BH9 A;  4A0Z A;  3M1E A;  4BAY A;  5ICC A;  2P5V A;  2GA2 A;  1U5T C;  2M45 A;  1R00 A;  1MDM A;  3GWZ A;  5BOX A;  1XGN A;  2Q8K A;  5K5Q A;  2AS5 F;  3E6M A;  2LDU A;  4U0Y A;  4BYY A;  4AVP A;  2A61 A;  5ICE A;  4P9U A;  2MLG A;  3LA3 A;  2VE9 A;  1FX7 A;  4H0E A;  4D0P A;  5FD5 A;  1YQA A;  3WTS C;  2FMY A;  1MJB A;  4R79 A;  2P6S A;  2KIM A;  1BI0 A;  4UVB A;  4IRG A;  2P7C B;  5LHG A;  3GFM A;  2VT3 A;  3K1P A;  2W57 A;  1AWC A;  1V4R A;  3WTZ A;  2FF4 A;  4HX4 A;  1BBY A;  2KJB A;  3P7N A;  4EGZ A;  2M8E A;  1Z6R A;  4M73 A;  3ZMV A;  3BRO A;  4L9J A;  1G3Y A;  1U2W A;  2QBY A;  5L3G A;  3H3Z A;  2QYO A;  3HSF A;  4MQ9 F;  4KDP A;  1Q1H A;  3SFZ A;  2YX7 A;  3ECH A;  4RB1 A;  3JW4 A;  2FOK A;  5HS8 A;  3GXO A;  2UZK A;  5ICF A;  2XV4 S;  4OOI A;  4OU0 A;  3WTY C;  3ZMD A;  1VTN C;  2M1B A;  1KU7 A;  1PP8 F;  3T5X A;  5AIQ A;  3EDP A;  1F1Z A;  1YIO A;  3R6S A;  2Z33 A;  4BNC A;  3LQQ A;  2DK8 A;  1RUN A;  4IHT A;  2O0Y A;  1FC3 A;  2EA4 A;  3F8B A;  3GEZ A;  5ERI A;  4LK1 F;  3ZP5 A;  2EFO A;  4XLP F;  1DDN A;  1Z05 A;  2IT0 A;  5J8C A;  3FM3 A;  3HSR A;  2NS0 A;  3TKY A;  2RV8 A;  5DCM A;  1HW2 A;  2ZJ2 A;  2PN6 A;  4M6Y A;  3VFZ A;  4HLX A;  1B9N A;  1KQ9 A;  3BWG A;  1R36 A;  1W5S A;  4EJO A;  4OIN F;  3KEO A;  3DFG A;  2RVC A;  1J59 A;  3WG9 A;  3V7R A;  3RJP A;  3N4M A;  3MZH A;  5HDK A;  1RUO A;  2XVC A;  3TQN A;  5IT9 Z;  4HLY A;  3QPH A;  3FHZ A;  2Z99 A;  1OPC A;  3DXJ F;  1KA8 A;  5BS6 A;  1J75 A;  3TDU C;  4RB2 C;  3W6J B;  3F3X A;  3E5Q A;  1F4K A;  2IW5 A;  4B09 A;  2XKO A;  2ZME A;  5H20 A;  1LDK B;  4CZZ A;  1LEB A;  1Z6T A;  3CUQ C;  2V79 A;  5DV5 A;  2PBI A;  3GX4 X;  2FU4 A;  4JK1 X;  1ZGA A;  3RKY A;  1ZG1 A;  1U5T B;  3SQN A;  3Q5F A;  2JPC A;  4OIQ F;  3F8F A;  4RB0 A;  4NHJ A;  2A07 F;  4HW0 A;  1E17 A;  1KU2 A;  2JPB A;  5D5W B;  5CLS A;  2VBW A;  3I0T A;  1R22 A;  2FML A;  3EET A;  2MH2 A;  2HWV A;  3FM5 A;  4BHB A;  4I0A A;  3WTV C;  1P2F A;  3KLO A;  1MKM A;  1QQI A;  1ZG5 A;  5CVI A;  5CVU A;  1QZZ A;  1KQ8 A;  3T1B A;  2FNA A;  5FLX K;  2STW A;  1FPQ A;  1BOA A;  1I1G A;  4UUV A;  2E7W A;  3NQO A;  1KYZ A;  1LQ1 A;  1T0F A;  5LEJ A;  3SZP A;  2VXZ A;  1ON2 A;  3V4G A;  3JSP A;  1SFX A;  1TW2 A;  4KNY A;  2HZT A;  1A04 A;  2AXL A;  4U88 A;  1ZH5 A;  1GHC A;  4A6D A;  2QM3 A;  2FBI A;  4L18 B;  2GA1 A;  4DQ2 A;  5TRD A;  1UST A;  3O3K A;  3EYI A;  1IXR C;  4LLN A;  4ENJ A;  1OYW A;  3U9G A;  4LG0 A;  2PMH A;  4BQA A;  2E1N A;  1P92 A;  3FX3 A;  3H3U A;  2GAU A;  4FX0 A;  5LHI A;  2K27 A;  4RS8 A;  3LA7 A;  2Y48 A;  3WGI A;  3WU1 B;  1R23 A;  3ABT A;  3KP7 A;  1FSE A;  3KEQ A;  3L09 A;  1H9T A;  2MD5 A;  1ODD A;  3WTX C;  3B73 A;  1FBU A;  3KCC A;  3QOP A;  4KIB A;  2XIG A;  4HQE A;  4EMS A;  4LB5 A;  4BHC A;  1MD0 A;  4NQW A;  4GCV A;  4YG2 F;  1HXD A;  4Y17 A;  4PCQ A;  1IRF A;  4CIC A;  5JR3 A;  1O7L A;  1I6X A;  5JHU A;  2BV6 A;  4L9T A;  2CSO A;  1U3E M;  4M71 A;  2ELH A;  3Q9S A;  1L0O C;  1AOY A;  3ZMS A;  2W84 A;  1QNT A;  3QPT A;  4KN7 X;  2ZXJ A;  2P5K A;  5E20 A;  5FB2 A;  3RPU A;  5DD8 A;  1YYV A;  1IN7 A;  2ISY A;  1YS6 A;  4G8X A;  5F6F A;  2L54 A;  4U0W A;  3T8T A;  3COA C;  2PFB A;  1ZLJ A;  4A0X A;  3FMS A;  5BPD A;  2PQ8 A;  4M6X A;  3C3W A;  4KFC A;  3GZ6 A;  1XD7 A;  4KIG A;  2CQK A;  4YIF A;  5CVV A;  3CUQ A;  2XAJ A;  5HVQ C;  4U7D A;  4XSX F;  3EYY A;  3QP6 A;  4ZYG A;  2XAG A;  3RDI A;  4O6J A;  1FYK A;  1BI3 A;  5DUK A;  4O3M A;  3O6B B;  3ECO A;  3MFK A;  3G73 A;  1NHA A;  3RYP A;  2RKH A;  1EV7 A;  4EJU A;  1B4A A;  2RNJ A;  2GXG A;  4L5I A;  5F1R A;  1XSX A;  2P6T A;  4HZF A;  1G3T A;  3CDH A;  2DPU A;  4A5N A;  1EH6 A;  2XRN A;  3M8E A;  4HYE A;  5ILV A;  3KZY A;  4RGX A;  5LEK A;  4KA4 A;  5BQT A;  5DDG A;  1J9I A;  4Q47 A;  5KVR A;  2WV0 A;  3DP7 A;  2IP2 A;  4ASN A;  2RGV A;  1ZRE A;  1XMA A;  1D8K A;  1CF7 B;  3WOD F;  2DAO A;  5JVT A;  1K78 A;  2JZY A;  3E5U A;  5CVJ A;  5DEQ A;  2H27 A;  3BY6 A;  3WTT C;  4XSZ F;  1TNT A;  4KMF A;  3T0Y A;  1RI7 A;  3L7W A;  3IWZ A;  5IT9 K;  2ZNY A;  5CYV A;  3C18 A;  4MGR A;  1W4M A;  3KZZ A;  4L0Z B;  3K69 A;  2J5P A;  2BEO A;  3C1D A;  1B1B A;  2YSR A;  3SHF A;  4HOB A;  1C0W A;  4S04 A;  1IUY A;  2O61 A;  1XGS A;  1BC8 C;  1D8J A;  1FP1 D;  4NB5 A;  1OMI A;  1F5T A;  2QLZ A;  3ELK A;  3GF2 A;  3W6K B;  1I27 A;  2V9V A;  2V6C A;  4CHU A;  2MBF A;  4MQV A;  1R1T A;  2HKX A;  3V7S A;  1YW9 A;  4OMY A;  3LAJ A;  3CJN A;  5L3D A;  4CXF A;  1FBQ A;  3BJ6 A;  3MEX A;  1BJA A;  2Z9O A;  4EVI A;  4N9H A;  4R8H A;  3N97 A;  4L5J A;  3CO6 C;  2ADU A;  4AIK A;  3HSE A;  3C7J A;  4ENM A;  1ZYR F;  1PP7 U;  2G9W A;  4DNC A;  4KT5 C;  1YLF A;  2QQB A;  1FP2 A;  1BI2 A;  3F8N A;  2LNB A;  3BPV A;  1WKM A;  2HQN A;  1JE8 A;  2UXN A;  1TQM A;  4KIC A;  4G94 A;  3J80 K;  1OYY A;  3DKW A;  1SMT A;  1FOK A;  2NRA C;  2QUF A;  2EWN A;  4WXD A;  2ZBK A;  3GO5 A;  2XAF A;  2L3D A;  4GYG A;  3R4K A;  4YFK F;  4WX9 A;  2VOD A;  2Y75 A;  1FNN A;  1BIB A;  2QZ8 A;  4RGU A;  2VE8 A;  3RKW A;  3GW2 A;  1DPU A;  3HRU A;  4L9V A;  3WTW C;  1R5H A;  4ESB A;  3LWF A;  4IRI A;  5HLI A;  2PG4 A;  2NAZ A;  4PZJ A;  1ZRF A;  4U7B A;  2XAQ A;  1K6O A;  1HST A;  1EH8 A;  3Q9V A;  5FGM A;  1FLI A;  1SD4 A;  4M9S A;  1GVJ A;  2PI0 A;  1V3F A;  1S7O A;  2M30 A;  2G7U A;  4EM1 A;  5LLQ A;  3JAM Z;  1SFE A;  4HF1 A;  2QQ9 A;  2D1V A;  4ESF A;  1IXC A;  4MTE A;  2A3S A;  2CFX A;  3KE2 A;  3WGH A;  1G4D A;  1REP C;  3L2C A;  3BP8 A;  3O2P E;  1J0R A;  5K5O A;  1CGP A;  2DW4 A;  3OOP A;  5F64 A;  1O7F A;  1ZN2 A;  1K79 A;  4GYI A;  5BPI A;  2HGC A;  2HDC A;  4FT8 A;  3P9I A;  3L9F A;  2ACJ A;  2W24 A;  3I5U A;  1HW5 A;  2GZW A;  2VON A;  3MCZ A;  2OD5 A;  1XGO A;  4G9Y A;  4G6D A;  1KGS A;  4ENN A;  2CGP A;  2DO7 A;  2K02 A;  2A68 F;  4GGG A;  4CYD A;  3RKX A;  2YR2 A;  1HW1 A;  2HS5 A;  1TW3 A;  2XRO A;  4ESJ A;  2IJL A;  2ZFW A;  2JSC A;  4OIR F;  5L3B A;  2ESN A;  5HS7 A;  2OAZ A;  1YG2 A;  1T38 A;  3KP3 A;  1FWZ A;  2FA5 A;  2YU3 A;  1D3Y A;  2VC0 A;  3F21 A;  2WC2 A;  4AD9 A;  4Q4Z F;  5DYM A;  1IZ1 A;  3EUH A;  5E18 F;  5H6Q A;  5HOO A;  3BJO A;  3QP5 A;  1Z1D A;  1U5T A;  2BE5 F;  4LG0 B;  3GFL A;  3IL2 A;  2EV6 A;  2D2W A;  4P96 A;  5FLX Z;  4RAY A;  2ZO4 A;  2IA2 A;  1U78 A;  4IRH A;  2H6B A;  1XDU A;  1WI9 A;  5HS9 A;  3WU0 A;  3REO A;  3V7C A;  1JGS A;  2STT A;  2K4B A;  3K1N A;  2OZ6 A;  3IWF A;  4WK8 F;  1B9M A;  1SAX A;  2RDP A;  2LSO A;  4KUM A;  2VN2 A;  5J6X A;  1K7A A;  4HDU A;  2W25 A;  3DEU A;  4G7O F;  2FE3 A;  5K5R A;  2F5E A;  2ISZ A;  2B0L A;  3E3V A;  5H6R A;  3FWE A;  4Z2Y A;  4ZYH A;  4HX8 A;  3E97 A;  4I7H A;  2J5O A;  1B59 A;  2RN7 A;  3H92 A;  2P8T A;  2HYF A;  4HV5 A;  4I01 A;  3HTU A;  1SD5 A;  5LBQ A;  1SFU A;  1KU9 A;  1STZ A;  2LKP A;  2BBY A;  1KQ0 A;  3JSO A;  3ZMU A;  3MWM A;  5DCM B;  2R7D A;  4OIO F;  1SD7 A;  2Q2E A;  1Z9C A;  3JTG A;  4A0Y A;  2KJC A;  2VBY A;  4PDK A;  5D4S A;  4WXC A;  4UXN A;  1S3J A;  1QBJ A;  4P5O A;  4ZZL A;  2XAH A;  4HAM A;  2TDX A;  1IAW A;  3FZV A;  4G6Q A;  1IXS B;  4IPA A;  3VOE A;  3ZN1 A;  3GUD A;  2HYG D;  3LQR A;  1QZY A;  1E2X A;  1BN5 A;  4LD5 A;  3NEU A;  5EEH A;  3DPT A;  2EV5 A;  2COM A;  1ZG3 A;  1T2K A;  3T8R A;  4HF2 A;  1O3R A;  2O3F A;  4KYW A;  1O3Q A;  2K86 A;  1UHW A;  4YII A;  3CO7 C;  1KU3 A;  3E6C C;  2K4J A;  4WWC A;  3BPX A;  3TGN A;  4EQQ A;  5ED4 A;  2OA4 A;  2L02 A;  4QLC U;  1LDD A;  4OIP F;  2CYY A;  4LJZ F;  3BOQ A;  3RIR A;  3FXU A;  4HX7 A;  3R0J A;  2JRT A;  3DPL C;  3LAP A;  1T39 A;  3SZT A;  2CG4 A;  1ZHF A;  1IRG A;  3HRS A;  3EQL F;  3OV8 A;  3D0S A;  2WWY A;  4TV7 A;  1UFM A;  3MZY A;  2HKO A;  1X3U A;  2XGX A;  3JTH A;  3B02 A;  1U6G A;  1RNL A;  5L3C A;  1HKQ A;  3FMQ A;  3LFK A;  4EM0 B;  1Y0U A;  2F5C A;  3GFJ A;  2DQR A;  2UXX A;  1G6N A;  1JHF A;  3WGG A;  1XSD A;  3I4P A;  1PUE E;  4MEY F;  4UVA A;  2W85 A;  2FQ3 A;  2GWR A;  4MEX F;  2WTE A;  2ETH A;  1WQ2 A;  1YO5 C;  4UV8 A;  1WRJ A;  3M7G A;  2KIF A;  5HLG A;  3I59 B;  2GXB A;  1YTY A;  1P4A A;  1XCV A;  4HA8 A;  3CLO A;  3MQ0 A;  1TNS A;  2PJP A;  2XUB A;  1O3T A;  1ZAR A;  3RTR A;  3F23 A;  1PDN C;  1HKS A;  4FX4 A;  2L4A A;  5LRS A;  1IN6 A;  5E8G A;  1LVA A;  2Z5U A;  1EH7 A;  3QAH A;  1G3W A;  3F22 A;  2DTR A;  1MGT A;  2FXA A;  5K1Y A;  5HDN A;  3I71 A;  4IXA A;  4ENK A;  2IA1 A;  4R1H A;  3E6B A;  3FMR A;  1TQI A;  3NRV A;  2IA0 A;  3DF8 A;  1U8R A;  2FBH A;  4IVN A;  2R7F A;  3F8C A;  2EK5 A;  1D5V A;  2VOO A;  2A5Y B;  2HTS A;  1T98 A;  3HOS A;  5KK1 A;  4UNO A;  4G7H F;  5BMZ A;  2XAS A;  1FSH A;  2OU2 A;  3F72 A;  5HDG A;  3M8F A;  3QU6 A;  4P9F A;  4RGS A;  3DV8 A;  1GXQ A;  3IKV A;  1DP7 P;  3FXR A;  4EJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...