4HF2A

Crystal structure of e43a iscr mutant bound to its promoter
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
132
structure length
115
Chain Sequence
MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLAQLFSRLRKNGLVSSVRGPGGGYLLGKDASSIAVGEVISAVDESALTHALWRDLSDRLTGFLNNITLGELVNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords HTH-type transcriptional regulator IscR
publication title Studies of IscR reveal a unique mechanism for metal-dependent regulation of DNA binding specificity.
pubmed doi rcsb
source organism Escherichia coli
total genus 29
structure length 115
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02082 Rrf2 Transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hf2A00
1IF1A 3P7NA 5ICFA 2VOOA 2QBYA 3SQNA 3TGNA 4OIQF 2X4HA 1GHCA 1QGPA 1K6OA 3K2ZA 4EJVA 1XGSA 2FOKA 5E1ZB 2H27A 3KCCA 3HOTA 2RV8A 4UVCA 1Z6TA 2IW5A 2L4MA 3P9CA 3KE2A 2RKHA 5F1RA 5LBQA 4BHPA 3LA2A 3E6MA 3E5XA 2QLZA 2Z3YA 3ERED 1AOYA 1LEAA 4XLPF 2C6YA 4O6JA 1WI9A 1R1TA 4HW0A 3WTSC 1BI1A 2VC0A 5HDGA 3DPLC 5HDKA 2RN7A 3GO5A 1YS6A 3IC7A 2W25A 2HQNA 4KN7X 4A0ZA 2HOEA 3JAMZ 2VBXA 1J59A 1HSTA 3C7JA 4DNCA 2M30A 2F5FA 4MEYF 1FBQA 1XMAA 4M9SA 4MEXF 5K5RA 5F6FA 1TBXA 2RC4A 2H09A 4I01A 3F8BA 1BC7C 2P5LC 4L0ZB 4HV5A 3ABTA 3SZPA 4BQAA 3PFIA 2Z9OA 2NNNA 3NQOA 4Q4ZF 3HRTA 2XHKA 1HBXG 4HAMA 3IL2A 4N9HA 4R8HA 5HLIA 2A6EF 1ULYA 4HQEA 4RB2C 4ENJA 2NNYA 1O3SA 3WODF 3HRSA 3BROA 2VC1A 4BHBA 1U2WA 4KA4A 3QU6A 2E1CA 2FEZA 3E5QA 1SFEA 2QQAA 2LSOA 3F8MA 4AWXB 3I53A 2O3FA 4LJZF 1R5GA 1NHAA 1SD7A 4BXUA 2LF7A 3KLNA 1BM9A 1S7OA 1O7FA 3LQQA 5IT9Z 4UUVA 3K1PA 2PQ8A 5KVRA 1S6LA 4UHTA 4EGZA 4OIPF 3T5XA 4EQQA 3DQVC 3C18A 4KYWA 1R7JA 4EGYA 3BJOA 4IXAA 4QWQA 1IXSB 2DI3A 3T8TA 3G73A 5ICGA 5TJJA 3E3VA 2HS5A 1RIOH 1S3JA 5FD5A 4IF4A 4KIGA 4YFKF 1ZN2A 3DEUA 3DV8A 3E5UA 1EV7A 4PGHA 4RGSA 3E97A 1IRGA 1ZHFA 3E6BA 1KU2A 2XKPA 3C1DA 1FNNA 3CDHA 2V1UA 1J0RA 1Z05A 2D45A 3V7SA 4WCGA 4RGXA 3V8LA 1YFHA 4HLXA 2XKOA 3S2WA 4RB0A 5E8GA 5HVQC 2FRHA 4ESFA 3EYIA 2GA2A 4UXNA 1BIBA 5H6QA 4CYDA 1ZGJA 1D8JA 2P8TA 1T98A 3ZP5A 2G9WA 2K86A 4RGUA 4EJOA 1FPQA 1Q1HA 3F3XA 1TW2A 1YG2A 3HUGA 1YW7A 4BYYA 5L3CA 5ERIA 4B8XA 1MDMB 3REOA 1JHFA 2WC2A 5FFXA 3GZ5A 4ZYDA 2H6BA 5AIQA 5E1WA 5D8LB 1SD5A 3BZ6A 1LDKB 2TDXA 2CW0F 2E7XA 1PP7U 1P6RA 4IPAA 5IT3A 1XSDA 2MH2A 2BYVE 3F72A 1GXPA 1SFXA 1TQMA 3R60A 4KUMA 5HLGA 4Y15A 1HW2A 4L5JA 1OMIA 4KMUX 1FYLA 4OOIA 2EK5A 4OMYA 2WTEA 4A6EA 2BGCA 3BJ6A 4NB5A 2M8EA 1BBYA 1KYZA 5LGTA 3FWEA 1QQIA 2H6CA 4OIRF 1YW9A 5D8KB 3F8NA 4EV0A 1PUEE 3WTUC 1G3YA 4FX4A 3F8FA 4HYEA 5CVIA 1KGSA 1MDMA 1H9GA 2FA5A 1DP7P 1W7PD 2FBIA 3T8RA 2QUFA 3RYRA 1XCVA 3V4GA 1T2KA 1S8NA 1IAWA 2L4AA 2V79A 3I4PA 2ACJA 5L3DA 3NRVA 5HLHA 3TQNA 4L9NA 4XSZF 1FZPB 2M45A 5A2QK 1LJ9A 1HW5A 4HF0A 4KFCA 4LLGF 1BI3A 2VBZA 3GW2A 3HHHA 3K0LA 3K1NA 3RTRA 1WKMA 1R58A 1G3WA 2QQ9A 1FBSA 2KRFA 1U78A 5FGMA 2EJRA 2FU4A 1TQIA 5DDGA 3PQJA 1KQ0A 4MHGA 2AS5F 1LVAA 1OKRA 1K78B 4EJTA 3ROUA 1S29A 2E1NA 1J5YA 2STTA 1FYKA 3L00A 3B02A 5L3GA 3M9AA 4HDUA 2B0LA 1WSUA 2O8XA 1G6NA 1R36A 1O57A 5ED4A 2YSRA 5L3BA 3W6JB 3F8CA 4ZYEA 4MQVA 1UHMA 1O3TA 3E6DA 4I02A 5BMZA 1EH6A 2VE9A 5LLQA 1T0FA 4A0XA 4G7HF 3BP8A 2Z33A 1SMTA 2JRTA 2KIFA 1ZREA 3LAJA 2NAZA 1B4AA 2OBPA 4M9ZA 4CGZA 4LG0B 3MAJA 3QP6A 2A3SA 1L3LA 4YIFA 4Y17A 4OINF 3D5LA 1R1VA 2F5CA 1XDUA 1TW3A 1BI2A 1SD6A 1YTYA 1MJBA 2DU9A 2JPBA 2MH9A 2PFBA 2GZWA 2LNBA 4ZYHA 3I0TA 3M1EA 3U1DA 1KU3A 5LHHA 5CYVA 3FXUA 3M8FA 1TLHB 2R3SA 5E17F 1KQ8A 1YLFA 3RPUA 3MQ0A 4O3MA 2P5VA 3EYYA 1DDNA 5FB2A 3CLOA 2EWNA 2PJPA 2Y75A 4ZH4F 4A6DA 3RKYA 2A68F 1ZRCA 3T0YA 4G94A 1IZ1A 1HKTA 1BI0A 2MLKA 1MJ9A 1K7AA 3QPTA 3QP5A 3O2PE 1PP8F 2K4JA 2FF4A 5HS9A 3LAPA 2EA2A 4LB5A 2DPDA 1FSHA 1GXQA 3GFLA 3I5UA 4HV6A 1MZBA 3H92A 1SD4A 1DPUA 3QOPA 3JSOA 2EFNA 4XLNF 3R4KA 3CUQC 3FMSA 2DPUA 1JXSA 2ZBKA 1D3YA 5CLSA 4OU0A 5LRRA 4FT8A 3FM3A 4I98B 2HKXA 1RNLA 1LNWA 4QLCU 1J75A 1P4WA 1XCBA 2P6SA 3B73A 3DKWA 1FT9A 4XBFA 3V8KA 4A2UA 2CO5A 1KU9A 3WTVC 4MTDA 2HFHA 1KA8A 4L18B 2L54A 2Y48A 1T39A 3FXRA 2P4WA 1V3FA 4HOBA 3F23A 2R7FA 1P92A 5DUIA 4CZZA 4YG2F 5ILUA 3M8EA 1XDSA 4R1HA 5F64A 1Z6RA 2DK8A 4EMSA 5ICCA 4Q48A 4AIKA 2XAJA 3MZHA 4U88A 2L01A 2W57A 5DD8A 2VBYA 4LMYA 2XROA 1WWXA 1FYMA 2PLYA 1FWZA 2LDUA 3JW4A 2RGVA 3O6BB 3ZMVA 2XUBA 5J8CA 4IRHA 2KKOA 4I09A 4I7HA 5DCMB 3GZ6A 2Q0OA 3GFJA 1YW8A 5BPIA 4BH9A 3FHZA 3VB2A 3VODA 1JHHA 4LLNA 2ESHA 3GLXA 4YFXF 3J7AO 1IN4A 3HRMA 1UB9A 3WTTC 4OIOF 4B09A 1XSXA 2ISZA 3ECHA 2OQGA 4XSXF 3D0SA 2HR3A 1IXCA 3QAHA 1W5SA 2EFWA 3IHUA 5CJ9A 2G7HA 3GEZA 2P6TA 2BEOA 2DT5A 2GA1A 4EM1A 2EFOA 3RKWA 3O3KA 3CJNA 1DUXC 1Z7UA 2ZO4A 3K69A 3WU0A 2P7CB 2ISYA 2KJBA 2F5EA 5CVUA 1TTYA 5LGUA 1E2XA 4ETSA 2PI0A 5CVRA 5DCMA 4WXCA 1B6AA 3Q9SA 3VOEA 3GX4X 2MLGA 1BOAA 1ZG5A 1STZA 2PEXA 5FLXK 3JTHA 4S04A 1EH7A 1L0OC 2PG4A 3W6KB 5D4SA 3ELKA 5KK1A 3WTWC 3SZTA 4M6XA 5LHIA 1GVJA 2EFQA 3R0AA 6PAXA 5D5UB 1YQAA 2FQ3A 1YIOA 1XGNA 3L9FA 4I0AA 1R00A 4U0VA 5JHUA 5K5OA 1SMYF 2IVMA 4KICA 3KFWX 3ZMTA 5LGNA 2XAHA 2Q2EA 4HZFA 2RVCA 2HTSA 3IRQA 1W4MA 2ZCWA 2QVOA 4A12A 3EUHA 4AD9A 1K79A 4GXOA 1H0MA 5D4RA 5JFRA 2V1XA 1W5TA 4IHSA 3R6SA 2VE8A 4LLLA 2FBKA 3J80Z 2K4BA 4AVPA 5E1XA 2RDPA 5LEKA 3GUDA 1IN5A 1QZYA 2VBWA 1FP1D 3R61A 1O7LA 1Z9CA 3KP3A 3KLOA 4Y13A 4KMFA 3I54A 5DCFA 5K1YA 3LWFA 4EM2A 4UNOA 2JPCA 4U7BA 5CVVA 1LQ1A 1U8RA 2WWYA 4NQWA 4RAYA 2RQPA 4HA8A 1MD0A 2MA3A 1P2FA 4BNCA 3COAC 3ZMSA 1XB4A 5FO5A 4RB1A 4IJAA 3K1MA 2FNAA 4WX9A 4RAZA 3FX3A 3P9KA 2YX7A 4G9YA 5HS8A 4HLYA 3LQRA 4OMZA 5FFZA 5IT9K 1I27A 5D6FA 4EM0B 4LGWA 2EV6A 3WGHA 4RGRA 5L3EA 2IRFG 4R79A 3BY6A 3CUQB 3TO6A 4UV8A 2W85A 3RPQA 3SFZA 2G7UA 2ZJ2A 2GIVA 1KU7A 1IUYA 2QYOA 2DQRA 2Y0MA 2VT3A 2DK5A 1HXDA 3QU3A 3KP5A 1WRJA 1HQCA 4MQ9F 1B59A 1Z1DA 1UFMA 5AIPA 1FP2A 2GWRA 4P5OA 4Z2YA 4ENKA 1MKMA 4PZJA 3EDPA 4ENNA 4GO1A 2CWEA 3WG9A 1FBUA 5ILVA 1Z91A 4WK8F 2FE3A 5D5VB 3WTYC 1E17A 5J8FA 2ETHA 3J81K 3CUQA 3MWMA 1XN7A 2Q8KA 3GYHX 4JK1X 2ADUA 3I59B 2CSOA 3ML6A 4S05A 4JQFA 2FXAA 1HKSA 4Q5SF 1OR7A 3HIFA 1HW1A 1ZRFA 3TKYA 3DF8A 3WTZA 1MGTA 1P4AA 4PGGA 5D5WB 2PN6A 3ZMUA 2HQRA 3WGGA 3HTSB 2K7LA 1BJAA 3MFKA 3TOBA 1YS7A 5ICEA 3Q5FA 2PBIA 2CGPA 3KP6A 5BQTA 1XMKA 4G8XA 2BBYA 2IP2A 1SFUA 1OPCA 2OAZA 1USTA 2QM3A 1PDNC 2EB7A 2LKPA 5HOOA 1K78A 3LA7A 1D8KA 3RKXA 3ZN1A 2QBYB 1ON2A 2A5YB 4ESJA 2XASA 1J9IA 3HSFA 2CFXA 5J6XA 3LA3A 3CTAA 4IHTA 1I1GA 2DTRA 2GXBA 2GXGA 1DPRA 2XRNA 2RNJA 3K9TA 4ON0A 1RUOA 2HGCA 1XGMA 2L3DA 1VTNC 3ZQ7A 3DPTA 2VOPA 2CYYA 1I1SA 2ZKZA 4ASNA 4TV7A 1XD7A 4AIHA 1IN8A 1IW7F 3SHFA 1F5TA 1U3EM 2K27A 3RYPA 3N4MA 3RJPA 4EJWA 4ENMA 4FX0A 4YIIA 5EEHA 1KYWA 2OU2A 3FXQA 4LG0A 4CICA 2JSCA 2W84A 2DLLA 2HWVA 2M87A 1IXRC 2ZMEB 4HF1A 4BHCA 3KETA 4HF2A 1OYWA 3FM5A 2MC3A 1B9MA 4GCVA 4ESBA 5E8IA 3I64A 2HKOA 3ZPLA 3ULQB 3HSEA 2YR2A 2QWWA 2O03A 2PMHA 1EH8A 4L0YB 3C3WA 3ZMDA 3H3UA 3KP2A 1R23A 4L9TA 1ON1A 3PQKA 3TDUC 3VEPA 1ZG1A 2COMA 4PCQA 1TQPA 1ODDA 2E7WA 2WV0A 3ZMZA 4F7ZA 5FLXZ 5DD4A 4I2OA 1J2XA 4LK1F 4U0YA 2FSWA 4U7DA 4CHUA 4WXDA 4WF2A 3FF5A 2DFIA 1LDDA 2MD5A 1B1BA 4MTEA 4EJUA 2QENA 4ZZLA 5ILSA 3MEXA 1REPC 5EEGA 4FHTA 2YX4A 2ZMEA 3FMQA 3EETA 2M1BA 1KQ9A 1U5TC 4L9JA 2F2EA 5D5XB 4D0PA 2P7VB 3KZZA 4ZZDA 2DW4A 1ONVA 1F1ZA 4ZYGA 2O6GE 3GF2A 2DQLA 3FMRA 2HZTA 3KZYA 3CUOA 2ZXJA 1YYVA 2OQRA 1OYIA 2JT1A 2DAOA 3LFKA 4L5IA 1A04A 1QPMA 3IKVA 4I0BA 3HHGA 2ZFWA 2GQQA 3WE2A 2EA4A 3BJAA 2CQKA 2IA2A 1I6XA 5LRSA 3V7RA 2VXZA 3EQLF 2F5DA 3GFMA 4PDKA 1BC8C 3KEQA 3QRFF 2IPQX 1O3RA 3U9GA 3F6OA 1B9NA 5JVTA 4GYIA 1TNTA 2XAGA 4LD5A 3KP7A 3WE3A 5H6RA 2KIMA 5HDNA 2QZ8A 2W24A 1WQ2A 2VN2A 5FD6A 2JTVA 4DQ2A 3RI4A 4HBLA 1T38A 1V4RA 2EV0A 3IWFA 2XV4S 3HYIA 4GYGA 2QQBA 3KP4A 5DYMA 1HSJA 1F4KA 3VFZA 4IVNA 2IJLA 3L2CA 1OYYA 1RZ4A 2D1VA 4UVAA 3HOSA 4U0WA 1FLIA 1IN6A 1JE8A 4HDVA 4CO8A 2D1HA 1ZAOA 5E20A 3H3ZA 2YU3A 2A6HF 3HSRA 1I5ZA 3IRRA 1Y0UA 1P4XA 5HS7A 4HX7A 2A61A 2HEOA 1UHWA 1IRFA 3WGIA 1RI7A 1ZRDA 2A69F 4WXHA 2EFPA 3JAMK 1ZYRF 3OV8A 1QNTA 4K2EA 3NEUA 4N0BA 5A2QZ 3GWZA 4CXFA 2V9VA 3JTGA 1U6GA 3SXYA 1FSEA 2UZKA 5TRDA 3G3ZA 3F22A 4M9XA 4A5NA 3L7WA 2J5PA 1G3SA 4Q47A 3ECOA 2XAFA 4P9UA 1MJAA 1JGSA 1RUNA 3V7CA 3J81Z 1J7KA 3TO7A 4G6QA 1ZGAA 2UXNA 1BIAA 3V8JA 2XVCA 3HTUA 3T1BA 1ZH5A 1LB2A 3IKTA 2ZNYA 3Q9VA 2Z99A 3HRUA 1FX7A 1LEBA 4RB3C 2OZUA 4P96A 3QPHA 5CVJA 3GVAA 2OZ6A 5DEQA 3CO7C 4UV9A 5E18F 2V1DA 3CO6C 2O61A 1W7PB 4M71A 3U2RA 2AXLA 1ZARA 3BWGA 2NS0A 4KNYA 4WWCA 1ZLKA 2V6CA 3L09A 3RIRA 3F21A 5H20A 3R0JA 2HYFA 2L02A 3GFIA 1LDJA 3WU1B 1ZLJA 2DBBA 3ZN0A 5BS6A 4MNUA 5BPDA 5D6EA 4LK0F 4JBAA 2KIUA 4XRFA 5K5QA 4O5VA 4P9FA 3BOQA 2Z5UA 4AIJA 3F6VA 4KIBA 1G4DA 2R7DA 1FY7A 2PMUA 3BPXA 1C0WA 1CF7B 5LHGA 2OD5A 2XGXA 1YO5C 5BOXA 1QBJA 3TDZC 5AONA 3JSPA 2O0YA 2YPRA 3N97A 1ZG3A 1W7PA 4UVBA 1X3UA 2FBHA 2HDCA 1U5TB 2M5WA 2ZNZA 2UXXA 4NHJA 2IA1A 1SAXA 1FOKA 3WTXC 1R22A 3RDIA 2MBFA 1AWCA 3E6CC 1XSVA 5DV5A 1D5VA 1TNSA 4IRIA 2KJCA 4HX8A 2J5OA 1S7AA 2OA4A 2UWMA 1FC3A 2HYGD 4L9VA 4KDPA 4BAYA 4GGGA 3TO9A 3J80K 4RS8A 4CDGA 3DFGA 2FMLA 2LF8A 2NRAC 1CF7A 4LB6B 4IRGA 2FNPA 5LEJA 5JI6A 3P9IA 1HKQA 2FMYA 4G7ZF 5L3FA 4YFNF 2VONA 2CG4A 2K02A 2NYXA 4KN4X 2X0LA 2ESNA 2BE5F 1USSA 3I58A 1UCRA 3LSTA 3TOAA 4HQMA 4KIFA 3FZVA 3GXOA 2EV5A 4E70A 4A0YA 1U5TA 3ABUA 2JZYA 1G3TA 2XAQA 4M72A 3DP7A 2P5KA 2BV6A 3BPVA 3DXJF 2D2WA 1T6SA 4M6YA 4G6DA 2A07F 2H94A 3I59A 4KT5C 2STWA 4G7OF 1QO0D 3OOPA 2DO7A 1H9TA 1R5HA 1O3QA 2VODA 5JR3A 4P55A 2HTJA 4M73A 2GAUA 1BN5A 3ISPA 4M74A 3MZYA 4LFUA 3KEOA 1IN7A 2ELHA 1QZZA 2VT2A 4A5MA 3BDDA 3I71A 2IT0A 3MCZA 4EVIA 3IWZA 4MGRA 5DUKA 1XGOA 4H0EA 3M7GA 4HX4A 1F9NA 1CGPA 2XIGA 3AAFA 1R1UA 2IA0A 4N9IA
chains in the Genus database with same CATH superfamily
1BOBA 3MD2A 1IF1A 3L1PA 2VXDA 1QVUA 3P7NA 5ICFA 2OTLI 2VOOA 3OL3A 2QBYA 3SQNA 3TGNA 4OIQF 2X4HA 2IS1A 3H1CA 1GHCA 4C2MJ 1BR1A 3DKXA 1QGPA 2I5UA 1K6OA 4A3DJ 2BY0A 3WHBA 3K2ZA 2R7WA 2KPMA 4EJVA 1XGSA 3RQ4A 2H1LA 2FOKA 1T95A 5E1ZB 1OLTA 2HQAA 3HGYA 2LY1A 4OWRB 2H27A 3KCCA 3L2RA 4DW6A 3HOTA 2RV8A 3RQIA 4UVCA 3K4NA 2O9LA 2FD5A 4A3JJ 1Z6TA 2IW5A 5F0CA 2L4MA 5IP7J 3P9CA 3LSGA 3KE2A 3IUOA 3DBHB 2RKHA 1I6HJ 2X6XA 5F1RA 3ASNH 5TGTA 5LBQA 4BHPA 1D0ZA 3LA2A 4I6ZA 3E6MA 1S72I 3BG6A 5KAIC 1BA5A 3E5XA 2QLZA 2Z3YA 4E6KG 3ERED 1AOYA 4YIRX 1UG0A 1LEAA 1TWCJ 4QIWN 5DM7F 4XLPF 2F4MB 3DBRB 2C6YA 5EG0A 3GZNB 2DOFA 4O6JA 2ZJRF 3GTMJ 1WI9A 1HC8A 1R1TA 4HW0A 3WTSC 1BI1A 2VC0A 3H35A 4BQNA 5HDGA 1T0FC 2BHZA 3DPLC 1GT0C 5HDKA 2L5QA 2RN7A 3GO5A 3U1KA 1YS6A 3IC7A 3CC2I 2W25A 2HQNA 2AHQA 4KN7X 4A0ZA 2HOEA 4IZZA 2FUG2 3JAMZ 1LKXA 2VBXA 1J59A 1HSTA 3C7JA 2HDDA 4DNCA 2OC6A 1KONA 2VQGA 3DEEA 2M30A 5IOYA 4IHYA 2K9NA 2F5FA 4MEYF 1XPXA 5FRMA 2GM4A 1FBQA 1R49A 2WBMA 3ONQA 1XMAA 2LTPA 2IGKA 3C2BA 5FLVA 4A3MJ 4M9SA 4MEXF 5K5RA 5F6FA 1TBXA 2RC4A 2H09A 2EIKH 4I01A 3F8BA 2KDZA 2R7UA 1BC7C 1TWAJ 2P5LC 4L0ZB 2V9PA 3S1RJ 2X6WA 4HV5A 1IJWC 2H8WA 3E1SA 3ABTA 3SZPA 4BQAA 3EPZA 3PFIA 4BL0B 4X6AJ 3PO3J 3H36A 2Z9OA 3IP4B 2NNNA 3NQOA 4Q4ZF 3HRTA 2XHKA 1HBXG 4BQOA 4HAMA 3IL2A 4N9HA 4R8HA 4NBQA 5HLIA 2A6EF 4XOTA 2QKMB 4JX6A 2E34A 2K9LA 1ULYA 4HQEA 4CZCA 4RB2C 4DZPA 1NK3P 2OCEA 2CH0A 2BW3B 4ENJA 2NNYA 1JT0A 5E3MA 1O3SA 2QA4I 2LD5A 3SYTA 3WODF 5LD2C 2X1DA 3HRSA 1FOYA 3BROA 2VC1A 4BU2A 3G71I 3F9KA 1WGXA 2M9HA 4BHBA 1MMDA 2ELJA 2OV7A 1IDYA 3E7LA 3BTCA 4KISA 1U2WA 1NTCA 3ZCOA 4XLHA 3QU6A 4KA4A 2E1CA 1WJBA 2EILH 2FEZA 3E5QA 1A31A 1SFEA 3A0HC 1YITI 2QQAA 1ETQA 2LSOA 4B3XA 3F8MA 5E3OA 4AWXB 1RPWA 1S5LC 4FISA 2LLKA 3I53A 4KITB 2O3FA 2LR8A 4LJZF 1R5GA 1NHAA 1SD7A 4BXUA 2AQFA 2LF7A 1XTAA 3KLNA 1ERDA 1VQLI 1BM9A 2VJJA 3FBIB 1S7OA 1O7FA 5HODA 3LQQA 5IT9Z 4UUVA 1IRZA 3C2GA 3K1PA 1A35A 3QQAA 1WZ2A 2PQ8A 4J00A 4F92B 5KVRA 1S6LA 4BJ6C 4UHTA 2LMDA 4EGZA 4OIPF 3T5XA 1DGRM 4ZTFA 4EQQA 3DQVC 3TBIA 3C18A 4KYWA 1FMVA 2WY7Q 1R7JA 4EGYA 3BJOA 4IXAA 4QWQA 1TC3C 2VASA 2JK3A 2DMTA 3G1MA 1IXSB 2DI3A 3T8TA 1K61A 5B5EC 3G73A 3BG5A 1NG6A 2X9DA 1XC5A 5ICGA 5K7FA 5TJJA 2RQQA 3E3VA 2XB0X 3QYFA 4BUPA 1R4NB 2WAQA 3CMAI 3HUGB 5K7HA 2BY2A 2HS5A 1RIOH 1S3JA 2BW3A 5FD5A 3H9GA 3KX2A 4IF4A 3OYMA 4KIGA 4YFKF 2I8DA 1ZN2A 3DEUA 3DV8A 2W7NA 2HXIA 5M5YJ 3DTKA 3E5UA 1EV7A 3DTEA 1SVOA 4PGHA 1R9TJ 4RGSA 3E97A 1IRGA 1MNEA 3LSKA 5FROA 1ZHFA 1HA8A 3E6BA 1KU2A 2PMZN 2XKPA 2F4IA 3C1DA 1FNNA 3NARA 2DA2A 5J3LA 2Z1DA 4BE2A 3CDHA 2V1UA 1J0RA 1ITYA 1VF9A 4CUGA 1JTYA 1Z05A 2D45A 4NC8A 3V7SA 3OYKA 2VIXA 4AM3A 1XG1A 4WCGA 4RGXA 2Y2ZA 3V8LA 1YFHA 4HLXA 2XKOA 2CQ7A 3S2WA 4RB0A 5E8GA 4DZJA 5HVQC 2FRHA 1YHQI 4ESFA 1YE9A 3EYIA 2GA2A 2EZIA 4HSTA 4UXNA 2PX9A 4M3EA 2CUEA 1BIBA 5H6QA 4CYDA 1ZGJA 2WADA 5B1AH 3PIOF 4IKFA 1D8JA 2CFOA 4QPQA 2P8TA 3H9QA 1T98A 1UG2A 2V6EA 1DP3A 4CCLA 3ZP5A 2G9WA 2K86A 5IOZA 2JSPA 3CJTB 3G2BA 3HKZN 3OYCA 4RGUA 2HVQA 4EJOA 1FPQA 2HOAA 1TT5B 1IV6A 3JRHA 1YX3A 4ANJA 3S3MA 1Q1HA 3F3XA 4RBOA 4XLAA 3BG3A 2NOJB 1TW2A 4FTHA 1YG2A 3HUGA 3KEYA 1YW7A 4BYYA 1V5EA 5L3CA 3JR9A 1P7IA 5ERIA 3BG9A 4DYRA 3FKJA 4B8XA 4BEHB 4FCYA 1MDMB 2R5ZB 3DLAA 2EIJH 3REOA 1JHFA 2WC2A 5FFXA 3GZ5A 4ZYDA 2DMNA 2H6BA 5AIQA 5E1WA 5J40A 1SD5A 5D8LB 2L2OA 3BZ6A 4A3BJ 1LDKB 1GVDA 2TDXA 5GTIC 4A3CJ 3BR6A 3DPUA 2CW0F 2E7XA 1GUUA 4N9IA 2DJIA 3L2QA 1F43A 1Y0NA 1MMSA 1PP7U 1DQUA 1U0JA 3ABLH 2GXAA 1LE8B 1P6RA 4IPAA 5IT3A 2O7OA 3K4KA 3U21A 1XSDA 1Y8RB 2PJRB 1QHHD 2MH2A 2BYVE 4BBSJ 3F72A 1GXPA 1SFXA 4PJMA 2R7QA 1TQMA 1N75A 2NVUB 5F27A 2ECBA 3R60A 4KUMA 4IX7A 4PFOA 4BACA 4II2A 5FKLA 2K3FA 4Y15A 3SDGA 5HLGA 1HW2A 1E0EA 3HJEA 2EZKA 4L5JA 5B66C 3HC7A 1OMIA 2P0WA 3B6CA 4KMUX 1NG7A 2K9QA 4M3FA 3MVPA 1FYLA 4OOIA 1MBEA 2EK5A 4OMYA 2WTEA 4A6EA 2DYSH 2BGCA 2R7VA 4A3KJ 3DTIA 3BJ6A 1LVKA 1OJLA 1YOVB 2HNHA 4NB5A 2M8EA 4V2GA 5H2FC 1PVEA 2TRTA 1BBYA 1KYZA 3IH2A 5LGTA 3FWEA 1QQIA 2H6CA 4OIRF 3CZ6A 1YW9A 3CCYA 2B63J 3H3VK 5D8KB 2LY9A 3F8NA 2H1KA 5GP9A 4EV0A 3WTUC 1G3YA 3OYNA 4BE1A 1PUEE 3CCVI 4RMNA 4FX4A 2M7BA 3MZ8A 2IEKA 1ETVA 3F8FA 4HYEA 2LP0A 1KGSA 2QSFX 5CVIA 4RA2A 4BEHA 1MDMA 4A3GJ 1H9GA 2R5ZA 2FA5A 1DP7P 1W7PD 2FBIA 3T8RA 2QUFA 1IG7A 1VFCA 3AG1H 3PNYA 3NWSA 3RYRA 4D1QA 1XCVA 3V4GA 1T2KA 1S8NA 1XMXA 1IAWA 2XGEA 1VNDA 3BR2A 4BY7J 2L4AA 2V79A 3I4PA 5CPRB 2ACJA 4XORA 2B9SA 5L3DA 2DFHA 3NRVA 2WB1A 5HLHA 3TQNA 1K4SA 3FXKA 2DA3A 3KYLA 4L9NA 4XSZF 1FZPB 1I50J 2M45A 5A2QK 1LJ9A 1HW5A 2I10A 4HF0A 4KFCA 3PO2J 4LLGF 1BI3A 2VBZA 2WAEA 3GW2A 3HHHA 3K0LA 3K1NA 2ME6A 3RTRA 3OR1C 1WKMA 1T08B 1R58A 1G3WA 2M7AA 2ZJPF 2QQ9A 4E7SA 1FBSA 2KRFA 1U78A 5FGMA 1VI0A 2EJRA 2FU4A 1TQIA 1WFXA 2BVLA 4LOCA 5DDGA 2EINH 3PQJA 2EZHA 1KQ0A 3BQZA 4MHGA 1W0UA 1AU7A 3EUHC 2AS5F 1LVAA 1OKRA 1K78B 4EJTA 4F52A 3ROUA 1S29A 2E1NA 1K4TA 1JKRC 2DA5A 1J5YA 2STTA 2LYCA 4XLCA 3PUBA 3FXLA 1X1BA 1FYKA 3ZQCA 2Q1ZB 3K6GA 3OYGA 3L00A 3B02A 5L3GA 4B44A 2L7KA 3M9AA 4HDUA 2B0LA 1QPIA 3CJRB 1WSUA 2O8XA 1G6NA 1R36A 1O57A 5C4JJ 5ED4A 2YSRA 5L3BA 3W6JB 3F8CA 1TL8A 3OOUA 4RAGA 1HLVA 4ZYEA 5IYDJ 1QU3A 4MQVA 3BCAA 1UHMA 2HPIA 4JX5A 3E6DA 4I02A 1UHSA 5BMZA 1EH6A 2VE9A 5LLQA 1O3TA 1T0FA 4A0XA 3K70C 3S3OA 1I3AA 3OSGA 3M1CA 4G7HF 3BP8A 2Z33A 1DU0A 1SMTA 2JRTA 1V54H 3W2VA 4XK4A 2KIFA 1ZREA 3OYFA 3LAJA 1X19A 2NAZA 2XAUA 5TISC 2LOOA 1B4AA 2OBPA 4M9ZA 2KZGA 4CGZA 2CS3A 4LG0B 4G12A 1UMQA 1VQMI 1X4OA 2CV0A 3MAJA 3QP6A 2A3SA 2JUGA 4B1RA 1L3LA 3ZR8X 4YIFA 1W36C 4Y17A 4MLOA 4OINF 5CKTA 3FK7A 1Y6IA 1RKWA 3D5LA 1NK2P 1R1VA 2F5CA 3CQZJ 3HPGA 4IOAF 2HYJA 1XDUA 2W48A 2Y69H 1TW3A 1BI2A 4GRIA 4PSXA 2ME0A 1SD6A 1X3WB 1YTYA 1MJBA 2DU9A 2JPBA 3Q0UA 2NS8A 5E79C 3VYTB 2MH9A 2PFBA 1ACIA 2GZWA 1YJNI 4IQJA 2LNBA 3UR3C 1S9HA 4ZYHA 3I0TA 3RPUD 2K3PA 4BXXJ 4XICA 2MABA 3M1EA 3U1DA 2NS7A 5LFAA 5J1UA 4MO7A 1BR2A 1KU3A 2DOEA 1P9QC 2GIZA 5LHHA 2EIMH 1RRJA 3DEWA 5CYVA 1Z7LA 3FXUA 3M8FA 1TLHB 2R3SA 1POGA 1Z77A 5E17F 1KQ8A 3DLLF 1VQOI 4YRVA 1YLFA 1HCRA 5FRNA 3RPUA 3MQ0A 4AYBA 2XF5A 4O3MA 2P5VA 3EYYA 3GMEA 1DDNA 3J7AY 1MNDA 1X2MA 3JRDA 4MFDA 3CLOA 5FB2A 5E3LA 2E5NA 2EWNA 3GTKJ 4YELA 4XL9A 3S32A 2KHMA 2X1EA 4HNTA 2PJPA 2G0EA 1PYVA 2Y75A 4ZH4F 1U8BA 3RSNA 3N05A 1U9OA 4Y7NJ 1DU6A 2CU7A 4A6DA 1YX5A 3G1OA 2VJIA 2A68F 3RKYA 4PUSA 3SFIA 3I9V2 1ZRCA 4RM3A 3T0YA 4G94A 1IZ1A 1HKTA 2NVTJ 4JP0A 1BI0A 2MLKA 2Y9YA 3HB9A 5C44J 1MJ9A 3OY9A 3QPTA 1K7AA 3QP5A 3O2PE 1PP8F 2E2JJ 3OYHA 1JGGA 3HXLA 4J19A 3CJQB 3K7AJ 4IO9F 3LNQA 4A3EJ 4D7MA 2K4JA 2L7MP 3D5RC 2FF4A 2HZDA 5HS9A 2M8GX 4Y33A 5EYRA 3LAPA 1G2HA 1SFKA 2EA2A 4DGWB 4LB5A 2DPDA 3LSIA 1FSHA 1GXQA 1VQ7I 3GFLA 2NVYJ 3I5UA 1FMWA 3QPSA 4HV6A 1MZBA 1Y8QB 1DGWY 1VQNI 4E7ZA 2RNGA 3H92A 1SD4A 1IDZA 3OYJA 2CW8A 1DPUA 3QOPA 4BBRJ 3JSOA 4J01A 2EFNA 3LSMA 4FE4A 4XLNF 3R4KA 3CUQC 3FMSA 4RM2A 3MKZA 3JREA 2K9MA 3AL0C 2IS4A 3BT9A 2DPUA 1JXSA 5B1BH 4BJ5C 2ZBKA 1D3YA 5CLSA 5F0HA 4OU0A 5LRRA 4FT8A 3FM3A 4I98B 2HKXA 1RNLA 1LNWA 2V26A 4QLCU 1J75A 2DA1A 1OR7C 4AU7A 3ABKH 1P4WA 1XCBA 2P6SA 3B73A 4EATA 3DKWA 4CH7A 1FT9A 4XBFA 3V8KA 4A2UA 2CO5A 3HOWJ 4I76A 3S2HJ 1KU9A 2OUMA 3WTVC 5EJCA 3VYUB 2ELKA 4XKWA 3HZJA 4MTDA 2QEXI 2HFHA 2V1NA 4PK4A 1KA8A 4L18B 5GTHC 2L54A 2Y48A 3O8HA 1T39A 3CCRI 3FXRA 2P4WA 2LREA 1B8IB 1CQTA 1V3FA 1ZGWA 2W1OA 3SDBA 4HNUA 4HOBA 3F23A 3QOEA 3OMYA 2CUZA 1MBGA 2R7FA 4A3FJ 1P92A 5DUIA 2E1OA 2DYRH 3VDXA 4CZZA 4YG2F 5ILUA 3M8EA 1XDSA 4B48A 3WHCA 3I4NJ 4ZJZA 3EUAA 5DM6F 4R1HA 3Q3SA 5F64A 1Z6RA 2DT7B 4E7HA 2DK8A 4EMSA 5ICCA 4Q48A 1S7EA 5IYBJ 2XAJA 3AKZA 4AIKA 3MZHA 4U88A 2E1MB 2L01A 2W57A 3PSIA 2LKXA 5DD8A 2VBYA 4LMYA 2XROA 1WWXA 1SVLA 3OL4A 1FYMA 2PLYA 1FWZA 2LDUA 3TP0A 3JW4A 2RGVA 4CCNA 3O6BB 3ZMVA 2F5VA 2XUBA 5J8CA 4OAZA 2LKSA 3PNVA 4IRHA 4UY8I 1FTZA 2KKOA 4I09A 1OCOH 4I7HA 3H9JA 4XNFA 4Y3OA 5DCMB 3GZ6A 2M34A 2Q0OA 2VL8A 3GFJA 1YW8A 2KP6A 1UZCA 4XRMA 5BPIA 4BH9A 1JTXA 4XRSG 3FHZA 3VB2A 3W2WA 1OCPA 3VODA 2JA7J 1JHHA 3AG4H 3KYDB 4LLNA 2ESHA 3GLXA 4YFXF 3RZDJ 3CCQI 3ZQGA 2X51A 3J7AO 1IN4A 3GTOJ 3DU5A 3HRMA 1K6YA 2AQEA 1UB9A 2DFEA 3WTTC 4OIOF 4B09A 4OAYA 1B8IA 1XSXA 2ISZA 3ECHA 2OQGA 4XSXF 4CCOA 1YRNB 4JOMA 3D0SA 1EKEA 2HR3A 1IXCA 2BZTA 3FK6A 1D1BA 2JMWA 4IHVA 4IEJA 3QAHA 4HSRA 1W5SA 2EFWA 4ZYAA 3IHUA 5CJ9A 1MBFA 2G7HA 3PSFA 3OIQA 1MMAA 3GEZA 3ZQQA 2P6TA 1E3PA 2BEOA 2DT5A 1MH3A 2GA1A 4EM1A 1JJ8C 2XGDA 2VJ4A 2EFOA 3RKWA 1N25A 2Q2EB 3CJNA 3O3KA 2F4OB 1DUXC 3CESA 1Z7UA 2E19A 2ZO4A 1Z3XA 1A36A 3K69A 3WU0A 5J4VA 1OCZH 4CA0A 3G6EI 4UB6C 1YJWI 5B3SH 4X1EA 2P7CB 2ISYA 2KJBA 3K2AA 2F5EA 5CVUA 1TTYA 2DJNA 3ZRGA 5LGUA 2HU9A 1E2XA 1M1EB 2QGUA 2JA2A 1WJ5A 1MBHA 1EF4A 4ETSA 2PI0A 2BY3A 2E60A 5CVRA 1Y39A 5DCMA 3ABMH 4WXCA 4C2TA 3H0DA 1B6AA 3Q9SA 4QSHA 1OCRH 3VOEA 1H88C 4XMYA 3GX4X 1D0YA 2MLGA 3DWLE 1BOAA 1ZG5A 2LY2A 2XPVA 1STZA 3GTLJ 2PEXA 2O8KA 3M3YJ 5FLXK 1N77A 3JTHA 4DBRA 3S16J 4X0GA 3SJMA 2JN6A 2H8RA 2ECCA 4S04A 1EH7A 1L0OC 2PG4A 3FXJA 3W6KB 2JJ7A 5D4SA 3ELKA 2R93J 5KK1A 3RZOJ 3WTWC 1FOXA 3SZTA 4M6XA 4XKBA 1YRNA 1WJFA 5FKKA 5LHIA 1GVJA 2R7RA 2EFQA 2CMPA 3R0AA 6PAXA 5D5UB 1YQAA 2FQ3A 1YIOA 3A02A 4M3DA 1B72B 1XGNA 2K85A 4UUTA 4NQWB 3L9FA 1FIAA 1YIJI 4I0AA 2A6TA 3ZOBA 1ZELA 2W00A 4IL6C 4RLFA 3GTJJ 1R00A 4U0VA 5JHUA 2DA6A 5K5OA 2L9NA 3CCEI 1SMYF 2IVMA 4KICA 3KFWX 3ZMTA 5LGNA 1SEUA 2M3AA 1VQ6I 2E5ZA 1WVRA 2XAHA 2Q2EA 3OYDA 4HZFA 2ZMEC 3W6VA 4XLFA 2RVCA 2HTSA 4AC0A 3IRQA 1X1PA 1W4MA 2DCEA 2ZCWA 2UUZA 1X3ZB 2QVOA 4A12A 4M3BA 2VQCA 1E3OC 2WAFA 5EF6A 3KIOA 3EUHA 4AD9A 3S1MJ 4F91B 2HXOA 1K79A 4GXOA 1H0MA 5D4RA 5JFRA 2V1XA 4BDYA 2R7ZJ 3JRAA 2IS6A 1W5TA 4IHSA 3R6SA 2VE8A 2E35A 4LLLA 2FBKA 3J80Z 2K4BA 3OR2C 4AVPA 5E1XA 2RDPA 5LEKA 3G1LA 4AIDA 3GUDA 1SFOJ 1BJZA 2LVSA 2KRHA 3K70D 2GBYA 1IN5A 1QZYA 3H5AA 2VBWA 2Y31A 2DDAA 4XN0A 1FP1D 3R61A 1O7LA 5J4YA 1Z9CA 3KP3A 3KLOA 4Y13A 4KMFA 3I54A 3PNTA 2JVHA 5DTDA 5DCFA 5K1YA 3S2DJ 3LWFA 4EM2A 4UNOA 2JPCA 5EEAA 4U7BA 2R92J 2AXTC 5CVVA 1LQ1A 2GOXB 1B72A 1U8RA 2WWYA 4NQWA 3S17J 4RAYA 2RQPA 4HA8A 3CF2A 1W36D 2R7OA 4HNVA 2VJ5A 1MD0A 2KT0A 2MA3A 1P2FA 1Y1WJ 1N78A 2WV1A 3L2WA 1ETYA 2L9RA 4BNCA 3COAC 3ZMSA 1XB4A 5FO5A 2GLOA 4RB1A 4IJAA 3K1MA 2ID6A 1LUJB 1ZK8A 1RESA 2FNAA 4RAZA 4WX9A 5M5XJ 2RAEA 3TW7A 2Z2SB 3FX3A 3P9KA 2YX7A 2XC7A 2E1MC 3NWTA 4KJZA 4G9YA 1TWGJ 5F1JA 1WPKA 5HS8A 3JRCA 4HLYA 3MKWB 3LQRA 4D5CA 4OMZA 4PJLA 3IAM2 5FFZA 3BCBA 2BHYA 1UJ8A 4D9JA 5IT9K 1XS9A 1I27A 3VYRB 2YUSA 5D6FA 4EM0B 4LGWA 2EV6A 3WGHA 4RGRA 5L3EA 2IRFG 4R79A 3BY6A 1JKQC 1QRYA 2HDWA 3CUQB 1LFPA 5EGOB 3X2QH 3TO6A 3AL0B 3H0GJ 4LIVA 4UV8A 2LBFB 3CCMI 2W85A 3RPQA 3SFZA 2G7UA 2ZJ2A 2GIVA 4BKXA 1KU7A 1IUYA 2QYOA 1VQ4I 5IP9J 2MG4A 1TWHJ 2DQRA 4HPQA 1PJRA 2Y0MA 2VT3A 2DK5A 1HXDA 3QU3A 3VSKA 2IBDA 3KP5A 3RKQA 2QSGX 1WRJA 1WJDA 1HQCA 4MQ9F 1LE8A 3CC4I 1FTTA 2Y0SA 4ZDLA 1B59A 3AG3H 2PJRA 1Z1DA 3DBLB 1VQKI 1UFMA 3BC8A 2Y30A 5AIPA 1FP2A 2GWRA 4P5OA 4Z2YA 2KLOA 4ENKA 1MKMA 3S3NA 4CCKA 4PZJA 2WA0A 3EDPA 2LH9A 3BR0A 4ENNA 4GO1A 2CWEA 2KQRA 4U87A 1ORKA 1W0TA 4V2FA 3WG9A 1TP4A 4HRIA 1FBUA 1IO2A 2EQRA 3HG9A 2KISA 4LG3A 5ILVA 5HNFA 1D1AA 1Z21A 1VQ9I 1MIJA 1JJ6C 5FKMA 3KYCB 4B4CA 5GPAA 4ZDPA 1Z91A 3OWTA 4XQFA 4DOZA 2R7SA 4WK8F 2FE3A 3NAUA 2BOLA 1TZLA 5D5VB 3WTYC 1E17A 1AKHB 5J8FA 1ENHA 2ETHA 1V5GA 3J81K 3CUQA 2HI3A 3MWMA 4DBQA 5EGOA 1XN7A 2LBFA 2Q8KA 3GYHX 4JK1X 3S8PA 2ADUA 3I59B 3O8GA 2CSOA 3ML6A 3GTPJ 4S05A 2IAIA 4JQFA 4JX4A 2JUCA 3MKYB 1W5CC 4F3QA 2FXAA 1KZHA 1HKSA 2IGMA 4Q5SF 1OR7A 3HIFA 4UUSB 4ZDOA 4FQGA 1HW1A 5JLWA 1ZRFA 1WI3A 3TKYA 3DF8A 3WTZA 3H5NA 1MGTA 1P4AA 4PGGA 4NC7A 2XB5A 5JHFA 2CUJA 5KCMA 5D5WB 1GV5A 2X6YA 2PN6A 4EEFG 2IGOA 3ZMUA 2HQRA 3WGGA 3HTSB 2K7LA 3IV5A 1BJAA 1Y1VJ 4BE0A 3MFKA 3TOBA 1QZEA 3BR5A 3JRGA 1YS7A 2E2IJ 5ICEA 5M3MJ 3Q5FA 2PBIA 3A0BC 5C3EJ 2QF7A 4XOPA 2EBIA 2A5WA 3KP6A 5BQTA 2CGPA 1XMKA 3M07A 4G8XA 2BBYA 4DIQA 1MBKA 3MMYB 2IP2A 2OTJI 1PUFB 1SFUA 1OPCA 2COBA 2OAZA 4CCMA 3BQYA 4A3LJ 5HLTA 4ITVA 4II3A 1USTA 1Z0XA 2QM3A 1PDNC 2EB7A 1WJEA 2LKPA 3FIWA 5HOOA 5EZGA 2YU9J 1NH3A 3S15J 3BZKA 3JRBA 2MGQA 1K78A 1X58A 3FDYA 3LA7A 1D8KA 3RKXA 3JRIA 1X1DA 2HPMA 3ZN1A 1AKHA 2QBYB 1ON2A 2BY1A 2A5YB 4ESJA 2EH3A 2XASA 1J9IA 2WY8Q 2JA6J 4QPOA 4D5FA 2BVMA 3HSFA 2CFXA 3FKIJ 5J6XA 3LA3A 1IGNA 3OS1A 3CTAA 1R71A 4IHTA 1I1GA 2DTRA 2L0KA 1GDTA 2GXBA 2JA8J 2GXGA 1DPRA 2L9SA 2XRNA 2QQ8A 1MSEC 4UUSA 2RNJA 3QWLA 3K9TA 4ON0A 1RUOA 2X48A 4CYCB 2HGCA 1D5YA 1XGMA 2L3DA 2XSJC 4C3IJ 1A6QA 1VTNC 3BR3A 1HOMA 3ZQ7A 1MNMC 3DPTA 2VOPA 2CYYA 1I1SA 3GLLA 2W4SA 2ZKZA 2BXZA 2XRLA 4ASNA 4TV7A 1XD7A 4HG2A 4AIHA 3OYEA 1IN8A 2HQ5A 1IW7F 3HOYJ 3SHFA 1F5TA 1QA6A 1U3EM 2IXSA 2K27A 3UKGA 3RYPA 3K4CA 3N4MA 3RJPA 4C2UA 3A1YA 5EG0B 4EJWA 2CW7A 4ENMA 4FX0A 4YIIA 5IPAA 2VQHA 5EEHA 1KYWA 4BQQA 2LRDA 4XN3A 2OU2A 3FXQA 4LG0A 4CICA 2JSCA 4RAFA 2W84A 2L7ZA 2F48A 1PUFA 1VQPI 2DLLA 2HWVA 2M87A 1IXRC 2WB1N 1K83J 2KMUA 2B7EA 2OJED 2ZMEB 3ZQIA 1I3QJ 3HDDA 4BGDA 4HF1A 4BHCA 1OFCX 2DMUA 1X2NA 3KETA 4HF2A 1OYWA 1GLNA 2MC3A 3FM5A 2R7TA 1B9MA 3J7ZI 4GCVA 4ESBA 5E8IA 3I64A 2QSHX 3BTIA 2HKOA 3ZPLA 4XONA 3VSLA 3ULQB 4F55A 1TWFJ 2JWTA 3HSEA 4A93J 2YR2A 2P81A 2QWWA 2O03A 2PMHA 4RDUA 1EH8A 4L0YB 3C3WA 3FXMA 3ZMDA 3A4CA 3H3UA 3KP2A 1R23A 2ICWG 4L9TA 1ON1A 3PQKA 4CYCA 3TDUC 3VEPA 1ZG1A 1QHGA 4PFPA 2COMA 4PCQA 1TQPA 1ODDA 2N8GA 3HOVJ 2LFBA 2E7WA 4E7JA 1VQ8I 2WV0A 3ZMZA 4F7ZA 1OCTC 4W1UA 3A01B 2CUFA 5FLXZ 4PJJA 5DD4A 4I2OA 1J2XA 4LK1F 4BJTA 4IHWA 4U0YA 1ZKGA 2FSWA 2VKVA 4U7DA 2HVSA 2VKHA 5HNHA 1BL0A 4CHUA 4WXDA 4WF2A 3CMYA 2CQNA 4M3GA 3FF5A 2DFIA 2ID3A 2PMZA 2M2EA 5GADJ 1LDDA 4PJNA 1H8AC 2MD5A 1B1BA 4LITA 4B3AA 4MTEA 3HOXJ 2QCOA 4EJUA 3LL7A 2QENA 4ZZLA 5ILSA 3MEXA 1REPC 3A03A 5EEGA 1R4MB 3CP2A 4FHTA 1IV8A 2LK2A 2YX4A 2ZMEA 3FMQA 1V5FA 3EETA 2M1BA 2W82A 2DDBA 3CLQA 1KQ9A 2ZC2A 1U5TC 4L9JA 2F2EA 5D5XB 2MW8A 5K7ZA 2Z16A 1LFBA 5KHDA 3SEZA 4D0PA 2P7VB 3KZZA 4C9YA 4ZZDA 3HOUJ 2AO9A 2DW4A 2XPUA 1ONVA 1F1ZA 4ZYGA 2O6GE 3GF2A 5FKNA 2R0QC 2DQLA 3BTLA 1UELB 2XDVA 3FMRA 3QYBA 2KDOA 2HZTA 1JKPC 4CCJA 3I4MJ 3KZYA 3HKZA 3K4JA 3IH3A 3CUOA 2ZXJA 1SC7A 1YYVA 3IAS2 4B47A 2OQRA 1OYIA 3HBLA 2XGCA 3ERMA 4BDZA 2JT1A 2DAOA 3ZQHA 3LFKA 3SEQA 3JRFA 4L5IA 1ETWA 4XIDA 3PL8A 1A04A 1WJAA 1QPMA 3E0JB 3IKVA 3QODA 2GOMA 1Z67A 4I0BA 4FETA 3HHGA 2E36A 1SANA 2ZFWA 2GQQA 3WE2A 2EA4A 3S93A 3BJAA 2CQKA 2IA2A 4QTRA 1I6XA 3OS0A 2FX0A 3V7RA 3DKYA 2VXZA 4Y4RA 5LRSA 3A01A 3ZQLA 2VKEA 3EQLF 2F5DA 3GCMA 3GFMA 4PDKA 1RR7A 1BC8C 3KEQA 3QRFF 4V19K 2IPQX 3MN2A 1RETA 2L7FP 1O3RA 3QPLA 4B43A 3U9GA 3F6OA 1B9NA 5JVTA 4GYIA 4AYBN 1TNTA 4BY1J 2XAGA 1E3HA 3KP7A 4LD5A 1BW5A 2OF7A 2JRMA 1O4XA 3WE3A 5H6RA 1JUSA 2KIMA 1WJCA 3LOCA 3ZGKA 2R7XA 5HDNA 1X4PA 5GAEJ 1ETKA 4GFBA 4KT6A 2M4KA 2QZ8A 2W24A 1WQ2A 1Y56A 2VN2A 1FIPA 5FD6A 1J09A 2JTVA 2HOSA 4DQ2A 3A2KA 3RI4A 3BZCA 2CQXA 4HBLA 3WU2C 1T38A 1IUFA 1HDDC 4XRSA 4XKVA 1V4RA 2EV0A 2ZJQF 2MSYA 3IWFA 2XV4S 3S1NJ 3HYIA 4GYGA 2QQBA 3OSFA 1FJLA 3KP4A 2M0MA 2KIQA 5DYMA 1HSJA 3HM5A 1F4KA 3VFZA 4IVNA 2VUMJ 2IJLA 2F6CA 2K9SA 2OPTA 2VQLA 2XF7A 3AG2H 3L2CA 3KZIC 4HEA2 1OYYA 2KFDA 1RZ4A 2D1VA 2DFFA 4UVAA 3HOSA 2DODA 5IY5H 3B6AA 3ZQFA 2VPLA 3BTJA 5IP6A 4U0WA 3Q0WA 1FLIA 1IN6A 1JE8A 4HDVA 3TL4X 2KRCA 4CO8A 2JQ7A 2D1HA 1ZAOA 5E20A 3H3ZA 3OIOA 2X85A 2YU3A 2A6HF 3TEDA 3HSRA 3OYAA 1I5ZA 3I56I 3GBGA 3IRRA 1Y0UA 1P4XA 3CDLA 4HX7A 5HS7A 2A61A 3C2HA 2HEOA 4NNJA 1JUPA 3CCSI 3G4SI 1UHWA 4C3HJ 2X1CA 3TP3A 1FEXA 1IRFA 3WGIA 3I55I 2IGNA 2DXIA 1RI7A 4W97A 1ZRDA 3HGGA 2A69F 5GAGJ 3EUKL 1MSFC 4WXHA 2ZB9A 2A05A 2EFPA 3CP8A 3JAMK 5M5WJ 2V7FA 2OCCH 2HOTA 1ZYRF 4AUXA 3OV8A 1QNTA 4K2EA 4MFEA 3FBNB 3NEUA 2BXYA 4N0BA 1OCCH 5A2QZ 3GWZA 3LSHA 4PJ0C 4CXFA 2V9VA 4F93B 3JTGA 1V55H 1WH7A 1U6GA 3BG7A 1H89C 2Y9ZA 2XSDC 3SXYA 1FSEA 4N4NB 2UZKA 1HDPA 5TRDA 3G3ZA 3F22A 3FHNA 3H5RA 3PUFA 2DA4A 2XPWA 4M9XA 4A5NA 3L7WA 3M4OJ 1JI8A 1ETXA 1MMGA 4GDFA 2J5PA 1G3SA 4CSWA 4Q47A 3OYBA 3ECOA 2XAFA 3CCJI 1GV2A 5J1YA 4AVZA 3CMEI 4P9UA 4FASD 2K5CA 3CF5F 1MJAA 1IC8A 1JGSA 1RUNA 3V7CA 3JCUC 3J81Z 1J7KA 4ABZA 3TO7A 2CRGA 4G6QA 1ZGAA 1U9NA 4ZTJA 1UAAA 4E7IA 3PIPF 3LSPA 2UXNA 1BIAA 3OIPA 3CCUI 3V8JA 3I3LA 3CCLI 1ZR4A 2XVCA 3HTUA 3T1BA 5KNLA 4ZC3A 1ZH5A 1W1WE 1LB2A 3IKTA 2VLAA 1D1CA 3AFHA 2KZVA 2ZNYA 3Q9VA 4H4KC 2DA7A 4I99C 2Z99A 2FQ4A 3HRUA 5KAFC 3F0CA 1FX7A 1LEBA 1OISA 4RB3C 2OZUA 5CQGA 5EDNA 1FOWA 1YI2I 4N4OB 2R5YB 4P96A 1BR4A 3Q0VA 3QPHA 5CVJA 3GVAA 2ZXIA 2IS2A 1X1AA 4JYKA 2FOWA 2NOGA 2OZ6A 5DEQA 4DJAA 3CO7C 3K4BA 4UV9A 5E18F 2V1DA 2VPRA 3CO6C 2O61A 1W7PB 4NC6A 4M71A 4RLQA 4D7NA 3U2RA 1LPQA 2AXLA 4IHXA 4YEJA 1ZARA 3BWGA 2ZSIB 2NS0A 4KNYA 5FJ8J 2ZSHB 4BS9A 2DMQA 1JT6A 4WWCA 2DTZA 2K40A 1EJ9A 1ZLKA 1BW6A 2V6CA 3L09A 4BXFA 2MC4A 3RIRA 3F21A 5H20A 3VYSB 3R0JA 2DOAA 2HYFA 4A69C 2L02A 3GFIA 1LDJA 3K10A 1YJ9I 2DN0A 5F04A 3HL2A 3WU1B 1ZLJA 2DBBA 1RR8C 3ZN0A 3HPHA 5BS6A 4MNUA 4S0HB 2LC2A 3SZGA 5BPDA 5D6EA 4LK0F 5JVGF 4JBAA 1R5ID 2KIUA 4XRFA 4A3IJ 4XM3A 2M4GA 5K5QA 1APLC 4O5VA 3BLYA 4P9FA 3BOQA 2Z5UA 1MW7A 4AIJA 3F6VA 4KIBA 1G4DA 2R7DA 1FY7A 2PMUA 3BPXA 1C0WA 1Q1VA 1CF7B 3FXOA 2WAQN 5LHGA 3CC7I 5F08A 2YS9A 2OD5A 2XGXA 2V4JC 1YO5C 2RREA 5BOXA 2NVXJ 1T56A 1QBJA 4P1WA 3TDZC 1G8XA 2EZLA 3ASOH 5AONA 4G6TB 3JSPA 3D1NI 2R5YA 2O0YA 3L2UA 2YPRA 5FLMJ 1TT0A 4PSWA 3N97A 5J1RA 1ZG3A 1JUMA 2X6OA 3DCFA 1WCMJ 2ZFUA 5DS9A 4XLEA 2JA5J 1W7PA 1QVTA 4M6VA 4UVBA 1X3UA 3PM1A 2FBHA 1Z3YA 3BR1A 2HDCA 1SAUA 1U5TB 2M5WA 2E2HJ 2NXNB 2ZNZA 2LG4A 3W3CA 2UXXA 4NHJA 2IA1A 1SAXA 3GTGJ 5EZHA 1FOKA 2KL4A 3WTXC 1LFUP 1R22A 3RDIA 2MBFA 4IQ4A 1AWCA 1WH5A 3VPRA 3OYLA 2NVQJ 3E6CC 1XSVA 5DV5A 3HEFA 1MMNA 1D5VA 1TNSA 4IRIA 1F36A 1JKOC 3LSRA 5FKOA 2KJCA 4HX8A 2D5VA 1AA7A 1T8IA 2J5OA 1S7AA 2MYSA 1D0XA 2OA4A 2UWMA 4IOCF 1FC3A 3KPHA 3RCOA 2HYGD 3P5JA 4L9VA 5GAHJ 4KDPA 1ETOA 4BAYA 4GGGA 3TO9A 3J80K 4RS8A 3S14J 3V42A 4L5EA 2VB6A 4CDGA 1P7JA 2FJ1A 4DYQA 4Y52J 1SVMA 3TW6A 1OQYA 3CMMA 2VKDA 3DFGA 5E3NA 2FMLA 2LF8A 2ZXHA 5F0FA 1HF0A 2NRAC 1CF7A 3CDIA 1RC9A 4LB6B 4IRGA 2FNPA 3QYEA 2HVRA 5LEJA 2MFZA 3P9IA 2TCTA 5JI6A 1ZQ3P 2CJJA 3M8JA 2UV1A 1HKQA 2DT6A 2FMYA 5L3FA 4G7ZF 4YFNF 2VONA 1R6RA 3ESWB 2CG4A 4NDLA 3W2AA 3OS2A 2R4GA 2K02A 3FISA 5IYCJ 2NYXA 4KN4X 3PJRA 3LSJA 3L2VA 3PFYA 2CV2A 2X0LA 2ESNA 2BE5F 4FE7A 1USSA 5C4XJ 3I58A 1UCRA 3LSTA 3TOAA 4HQMA 5JLXA 4KIFA 1T33A 3J7YJ 3FZVA 1G59A 3S1QJ 3UNGC 3GXOA 1RKTA 2EV5A 4XR6A 4E70A 4A0YA 3DU6A 1WHUA 1U5TA 4E7LA 1VQ5I 3ABUA 2JZYA 1G3TA 1X1CA 2CV1A 2XAQA 4M72A 3LMMA 3DP7A 4C30A 1I39A 5J47A 2P5KA 3D5SC 1EA3A 2BV6A 3BPVA 3DXJF 4MIMA 2D2WA 1T6SA 4M6YA 4G6DA 4XKCA 2O5RA 2A07F 3GTQJ 2H94A 2QKLB 2E71A 2XF6A 3I59A 4E4HA 2M0CA 9ANTA 4E7KA 3OYIA 4KT5C 4LIUA 2STWA 4G7OF 1QO0D 3OOPA 5CQEA 2DO7A 3ZXSA 1H9TA 1R5HA 1O3QA 2VODA 5JR3A 4P55A 1MBJA 2HTJA 4M73A 2GAUA 1IRXA 1BN5A 5M3FJ 3ISPA 4M74A 3MZYA 1VZ0A 2MD0A 4DYCA 4Z6YA 3K4MA 1ZTRA 2DMPA 3KEOA 4LFUA 2V9KA 4NUBA 1IN7A 2ELHA 5GPCA 1ZR2A 3WG7H 3TMOA 3LFUA 1QZZA 3CD6I 2VT2A 4A5MA 5BNGA 2L9VA 1XX5A 3BDDA 3VWBA 3HOZJ 3I71A 1AHDP 1A5JA 2VI6A 2IT0A 1MH4A 3MCZA 4EVIA 3IWZA 2ZXWH 4C3JJ 2CQQA 2EPFA 4MGRA 5DUKA 1XGOA 3MKLA 3M7GA 4H0EA 4HX4A 1F9NA 1CGPA 2XIGA 2JVGA 2Y0SN 3AAFA 4UB8C 1A6IA 3K4LA 1R1UA 2IA0A 3IH4A
chains in the Genus database with same CATH topology
1IF1A 3P7NA 5ICFA 2VOOA 2QBYA 3SQNA 3TGNA 4OIQF 2X4HA 1GHCA 1QGPA 1K6OA 3K2ZA 4EJVA 1XGSA 2FOKA 5E1ZB 2H27A 3KCCA 3HOTA 2RV8A 4UVCA 1Z6TA 2IW5A 2L4MA 3P9CA 3KE2A 2RKHA 5F1RA 5LBQA 4BHPA 3LA2A 3E6MA 3E5XA 2QLZA 2Z3YA 3ERED 1AOYA 1LEAA 4XLPF 2C6YA 4O6JA 1WI9A 1R1TA 4HW0A 3WTSC 1BI1A 2VC0A 5HDGA 3DPLC 5HDKA 2RN7A 3GO5A 1YS6A 3IC7A 2W25A 2HQNA 4KN7X 4A0ZA 2HOEA 3JAMZ 2VBXA 1J59A 1HSTA 3C7JA 4DNCA 2M30A 2F5FA 4MEYF 1FBQA 1XMAA 4M9SA 4MEXF 5K5RA 5F6FA 1TBXA 2RC4A 2H09A 4I01A 3F8BA 1BC7C 2P5LC 4L0ZB 4HV5A 3ABTA 3SZPA 4BQAA 3PFIA 2Z9OA 2NNNA 3NQOA 4Q4ZF 3HRTA 2XHKA 1HBXG 4HAMA 3IL2A 4N9HA 4R8HA 5HLIA 2A6EF 1ULYA 4HQEA 4RB2C 4ENJA 2NNYA 1O3SA 3WODF 3HRSA 3BROA 2VC1A 4BHBA 1U2WA 4KA4A 3QU6A 2E1CA 2FEZA 3E5QA 1SFEA 2QQAA 2LSOA 3F8MA 4AWXB 3I53A 2O3FA 4LJZF 1R5GA 1NHAA 1SD7A 4BXUA 2LF7A 3KLNA 1BM9A 1S7OA 1O7FA 3LQQA 5IT9Z 4UUVA 3K1PA 2PQ8A 5KVRA 1S6LA 4UHTA 4EGZA 4OIPF 3T5XA 4EQQA 3DQVC 3C18A 4KYWA 1R7JA 4EGYA 3BJOA 4IXAA 4QWQA 1IXSB 2DI3A 3T8TA 3G73A 5ICGA 5TJJA 3E3VA 2HS5A 1RIOH 1S3JA 5FD5A 4IF4A 4KIGA 4YFKF 1ZN2A 3DEUA 3DV8A 3E5UA 1EV7A 4PGHA 4RGSA 3E97A 1IRGA 1ZHFA 3E6BA 1KU2A 2XKPA 3C1DA 1FNNA 3CDHA 2V1UA 1J0RA 1Z05A 2D45A 3V7SA 4WCGA 4RGXA 3V8LA 1YFHA 4HLXA 2XKOA 3S2WA 4RB0A 5E8GA 5HVQC 2FRHA 4ESFA 3EYIA 2GA2A 4UXNA 1BIBA 5H6QA 4CYDA 1ZGJA 1D8JA 2P8TA 1T98A 3ZP5A 2G9WA 2K86A 4RGUA 4EJOA 1FPQA 1Q1HA 3F3XA 1TW2A 1YG2A 3HUGA 1YW7A 4BYYA 5L3CA 5ERIA 4B8XA 1MDMB 3REOA 1JHFA 2WC2A 5FFXA 3GZ5A 4ZYDA 2H6BA 5AIQA 5E1WA 5D8LB 1SD5A 3BZ6A 1LDKB 2TDXA 2CW0F 2E7XA 1PP7U 1P6RA 4IPAA 5IT3A 1XSDA 2MH2A 2BYVE 3F72A 1GXPA 1SFXA 1TQMA 3R60A 4KUMA 5HLGA 4Y15A 1HW2A 4L5JA 1OMIA 4KMUX 1FYLA 4OOIA 2EK5A 4OMYA 2WTEA 4A6EA 2BGCA 3BJ6A 4NB5A 2M8EA 1BBYA 1KYZA 5LGTA 3FWEA 1QQIA 2H6CA 4OIRF 1YW9A 5D8KB 3F8NA 4EV0A 1PUEE 3WTUC 1G3YA 4FX4A 3F8FA 4HYEA 5CVIA 1KGSA 1MDMA 1H9GA 2FA5A 1DP7P 1W7PD 2FBIA 3T8RA 2QUFA 3RYRA 1XCVA 3V4GA 1T2KA 1S8NA 1IAWA 2L4AA 2V79A 3I4PA 2ACJA 5L3DA 3NRVA 5HLHA 3TQNA 4L9NA 4XSZF 1FZPB 2M45A 5A2QK 1LJ9A 1HW5A 4HF0A 4KFCA 4LLGF 1BI3A 2VBZA 3GW2A 3HHHA 3K0LA 3K1NA 3RTRA 1WKMA 1R58A 1G3WA 2QQ9A 1FBSA 2KRFA 1U78A 5FGMA 2EJRA 2FU4A 1TQIA 5DDGA 3PQJA 1KQ0A 4MHGA 2AS5F 1LVAA 1OKRA 1K78B 4EJTA 3ROUA 1S29A 2E1NA 1J5YA 2STTA 1FYKA 3L00A 3B02A 5L3GA 3M9AA 4HDUA 2B0LA 1WSUA 2O8XA 1G6NA 1R36A 1O57A 5ED4A 2YSRA 5L3BA 3W6JB 3F8CA 4ZYEA 4MQVA 1UHMA 1O3TA 3E6DA 4I02A 5BMZA 1EH6A 2VE9A 5LLQA 1T0FA 4A0XA 4G7HF 3BP8A 2Z33A 1SMTA 2JRTA 2KIFA 1ZREA 3LAJA 2NAZA 1B4AA 2OBPA 4M9ZA 4CGZA 4LG0B 3MAJA 3QP6A 2A3SA 1L3LA 4YIFA 4Y17A 4OINF 3D5LA 1R1VA 2F5CA 1XDUA 1TW3A 1BI2A 1SD6A 1YTYA 1MJBA 2DU9A 2JPBA 2MH9A 2PFBA 2GZWA 2LNBA 4ZYHA 3I0TA 3M1EA 3U1DA 1KU3A 5LHHA 5CYVA 3FXUA 3M8FA 1TLHB 2R3SA 5E17F 1KQ8A 1YLFA 3RPUA 3MQ0A 4O3MA 2P5VA 3EYYA 1DDNA 5FB2A 3CLOA 2EWNA 2PJPA 2Y75A 4ZH4F 4A6DA 3RKYA 2A68F 1ZRCA 3T0YA 4G94A 1IZ1A 1HKTA 1BI0A 2MLKA 1MJ9A 1K7AA 3QPTA 3QP5A 3O2PE 1PP8F 2K4JA 2FF4A 5HS9A 3LAPA 2EA2A 4LB5A 2DPDA 1FSHA 1GXQA 3GFLA 3I5UA 4HV6A 1MZBA 3H92A 1SD4A 1DPUA 3QOPA 3JSOA 2EFNA 4XLNF 3R4KA 3CUQC 3FMSA 2DPUA 1JXSA 2ZBKA 1D3YA 5CLSA 4OU0A 5LRRA 4FT8A 3FM3A 4I98B 2HKXA 1RNLA 1LNWA 4QLCU 1J75A 1P4WA 1XCBA 2P6SA 3B73A 3DKWA 1FT9A 4XBFA 3V8KA 4A2UA 2CO5A 1KU9A 3WTVC 4MTDA 2HFHA 1KA8A 4L18B 2L54A 2Y48A 1T39A 3FXRA 2P4WA 1V3FA 4HOBA 3F23A 2R7FA 1P92A 5DUIA 4CZZA 4YG2F 5ILUA 3M8EA 1XDSA 4R1HA 5F64A 1Z6RA 2DK8A 4EMSA 5ICCA 4Q48A 4AIKA 2XAJA 3MZHA 4U88A 2L01A 2W57A 5DD8A 2VBYA 4LMYA 2XROA 1WWXA 1FYMA 2PLYA 1FWZA 2LDUA 3JW4A 2RGVA 3O6BB 3ZMVA 2XUBA 5J8CA 4IRHA 2KKOA 4I09A 4I7HA 5DCMB 3GZ6A 2Q0OA 3GFJA 1YW8A 5BPIA 4BH9A 3FHZA 3VB2A 3VODA 1JHHA 4LLNA 2ESHA 3GLXA 4YFXF 3J7AO 1IN4A 3HRMA 1UB9A 3WTTC 4OIOF 4B09A 1XSXA 2ISZA 3ECHA 2OQGA 4XSXF 3D0SA 2HR3A 1IXCA 3QAHA 1W5SA 2EFWA 3IHUA 5CJ9A 2G7HA 3GEZA 2P6TA 2BEOA 2DT5A 2GA1A 4EM1A 2EFOA 3RKWA 3O3KA 3CJNA 1DUXC 1Z7UA 2ZO4A 3K69A 3WU0A 2P7CB 2ISYA 2KJBA 2F5EA 5CVUA 1TTYA 5LGUA 1E2XA 4ETSA 2PI0A 5CVRA 5DCMA 4WXCA 1B6AA 3Q9SA 3VOEA 3GX4X 2MLGA 1BOAA 1ZG5A 1STZA 2PEXA 5FLXK 3JTHA 4S04A 1EH7A 1L0OC 2PG4A 3W6KB 5D4SA 3ELKA 5KK1A 3WTWC 3SZTA 4M6XA 5LHIA 1GVJA 2EFQA 3R0AA 6PAXA 5D5UB 1YQAA 2FQ3A 1YIOA 1XGNA 3L9FA 4I0AA 1R00A 4U0VA 5JHUA 5K5OA 1SMYF 2IVMA 4KICA 3KFWX 3ZMTA 5LGNA 2XAHA 2Q2EA 4HZFA 2RVCA 2HTSA 3IRQA 1W4MA 2ZCWA 2QVOA 4A12A 3EUHA 4AD9A 1K79A 4GXOA 1H0MA 5D4RA 5JFRA 2V1XA 1W5TA 4IHSA 3R6SA 2VE8A 4LLLA 2FBKA 3J80Z 2K4BA 4AVPA 5E1XA 2RDPA 5LEKA 3GUDA 1IN5A 1QZYA 2VBWA 1FP1D 3R61A 1O7LA 1Z9CA 3KP3A 3KLOA 4Y13A 4KMFA 3I54A 5DCFA 5K1YA 3LWFA 4EM2A 4UNOA 2JPCA 4U7BA 5CVVA 1LQ1A 1U8RA 2WWYA 4NQWA 4RAYA 2RQPA 4HA8A 1MD0A 2MA3A 1P2FA 4BNCA 3COAC 3ZMSA 1XB4A 5FO5A 4RB1A 4IJAA 3K1MA 2FNAA 4WX9A 4RAZA 3FX3A 3P9KA 2YX7A 4G9YA 5HS8A 4HLYA 3LQRA 4OMZA 5FFZA 5IT9K 1I27A 5D6FA 4EM0B 4LGWA 2EV6A 3WGHA 4RGRA 5L3EA 2IRFG 4R79A 3BY6A 3CUQB 3TO6A 4UV8A 2W85A 3RPQA 3SFZA 2G7UA 2ZJ2A 2GIVA 1KU7A 1IUYA 2QYOA 2DQRA 2Y0MA 2VT3A 2DK5A 1HXDA 3QU3A 3KP5A 1WRJA 1HQCA 4MQ9F 1B59A 1Z1DA 1UFMA 5AIPA 1FP2A 2GWRA 4P5OA 4Z2YA 4ENKA 1MKMA 4PZJA 3EDPA 4ENNA 4GO1A 2CWEA 3WG9A 1FBUA 5ILVA 1Z91A 4WK8F 2FE3A 5D5VB 3WTYC 1E17A 5J8FA 2ETHA 3J81K 3CUQA 3MWMA 1XN7A 2Q8KA 3GYHX 4JK1X 2ADUA 3I59B 2CSOA 3ML6A 4S05A 4JQFA 2FXAA 1HKSA 4Q5SF 1OR7A 3HIFA 1HW1A 1ZRFA 3TKYA 3DF8A 3WTZA 1MGTA 1P4AA 4PGGA 5D5WB 2PN6A 3ZMUA 2HQRA 3WGGA 3HTSB 2K7LA 1BJAA 3MFKA 3TOBA 1YS7A 5ICEA 3Q5FA 2PBIA 2CGPA 3KP6A 5BQTA 1XMKA 4G8XA 2BBYA 2IP2A 1SFUA 1OPCA 2OAZA 1USTA 2QM3A 1PDNC 2EB7A 2LKPA 5HOOA 1K78A 3LA7A 1D8KA 3RKXA 3ZN1A 2QBYB 1ON2A 2A5YB 4ESJA 2XASA 1J9IA 3HSFA 2CFXA 5J6XA 3LA3A 3CTAA 4IHTA 1I1GA 2DTRA 2GXBA 2GXGA 1DPRA 2XRNA 2RNJA 3K9TA 4ON0A 1RUOA 2HGCA 1XGMA 2L3DA 1VTNC 3ZQ7A 3DPTA 2VOPA 2CYYA 1I1SA 2ZKZA 4ASNA 4TV7A 1XD7A 4AIHA 1IN8A 1IW7F 3SHFA 1F5TA 1U3EM 2K27A 3RYPA 3N4MA 3RJPA 4EJWA 4ENMA 4FX0A 4YIIA 5EEHA 1KYWA 2OU2A 3FXQA 4LG0A 4CICA 2JSCA 2W84A 2DLLA 2HWVA 2M87A 1IXRC 2ZMEB 4HF1A 4BHCA 3KETA 4HF2A 1OYWA 3FM5A 2MC3A 1B9MA 4GCVA 4ESBA 5E8IA 3I64A 2HKOA 3ZPLA 3ULQB 3HSEA 2YR2A 2QWWA 2O03A 2PMHA 1EH8A 4L0YB 3C3WA 3ZMDA 3H3UA 3KP2A 1R23A 4L9TA 1ON1A 3PQKA 3TDUC 3VEPA 1ZG1A 2COMA 4PCQA 1TQPA 1ODDA 2E7WA 2WV0A 3ZMZA 4F7ZA 5FLXZ 5DD4A 4I2OA 1J2XA 4LK1F 4U0YA 2FSWA 4U7DA 4CHUA 4WXDA 4WF2A 3FF5A 2DFIA 1LDDA 2MD5A 1B1BA 4MTEA 4EJUA 2QENA 4ZZLA 5ILSA 3MEXA 1REPC 5EEGA 4FHTA 2YX4A 2ZMEA 3FMQA 3EETA 2M1BA 1KQ9A 1U5TC 4L9JA 2F2EA 5D5XB 4D0PA 2P7VB 3KZZA 4ZZDA 2DW4A 1ONVA 1F1ZA 4ZYGA 2O6GE 3GF2A 2DQLA 3FMRA 2HZTA 3KZYA 3CUOA 2ZXJA 1YYVA 2OQRA 1OYIA 2JT1A 2DAOA 3LFKA 4L5IA 1A04A 1QPMA 3IKVA 4I0BA 3HHGA 2ZFWA 2GQQA 3WE2A 2EA4A 3BJAA 2CQKA 2IA2A 1I6XA 5LRSA 3V7RA 2VXZA 3EQLF 2F5DA 3GFMA 4PDKA 1BC8C 3KEQA 3QRFF 2IPQX 1O3RA 3U9GA 3F6OA 1B9NA 5JVTA 4GYIA 1TNTA 2XAGA 4LD5A 3KP7A 3WE3A 5H6RA 2KIMA 5HDNA 2QZ8A 2W24A 1WQ2A 2VN2A 5FD6A 2JTVA 4DQ2A 3RI4A 4HBLA 1T38A 1V4RA 2EV0A 3IWFA 2XV4S 3HYIA 4GYGA 2QQBA 3KP4A 5DYMA 1HSJA 1F4KA 3VFZA 4IVNA 2IJLA 3L2CA 1OYYA 1RZ4A 2D1VA 4UVAA 3HOSA 4U0WA 1FLIA 1IN6A 1JE8A 4HDVA 4CO8A 2D1HA 1ZAOA 5E20A 3H3ZA 2YU3A 2A6HF 3HSRA 1I5ZA 3IRRA 1Y0UA 1P4XA 5HS7A 4HX7A 2A61A 2HEOA 1UHWA 1IRFA 3WGIA 1RI7A 1ZRDA 2A69F 4WXHA 2EFPA 3JAMK 1ZYRF 3OV8A 1QNTA 4K2EA 3NEUA 4N0BA 5A2QZ 3GWZA 4CXFA 2V9VA 3JTGA 1U6GA 3SXYA 1FSEA 2UZKA 5TRDA 3G3ZA 3F22A 4M9XA 4A5NA 3L7WA 2J5PA 1G3SA 4Q47A 3ECOA 2XAFA 4P9UA 1MJAA 1JGSA 1RUNA 3V7CA 3J81Z 1J7KA 3TO7A 4G6QA 1ZGAA 2UXNA 1BIAA 3V8JA 2XVCA 3HTUA 3T1BA 1ZH5A 1LB2A 3IKTA 2ZNYA 3Q9VA 2Z99A 3HRUA 1FX7A 1LEBA 4RB3C 2OZUA 4P96A 3QPHA 5CVJA 3GVAA 2OZ6A 5DEQA 3CO7C 4UV9A 5E18F 2V1DA 3CO6C 2O61A 1W7PB 4M71A 3U2RA 2AXLA 1ZARA 3BWGA 2NS0A 4KNYA 4WWCA 1ZLKA 2V6CA 3L09A 3RIRA 3F21A 5H20A 3R0JA 2HYFA 2L02A 3GFIA 1LDJA 3WU1B 1ZLJA 2DBBA 3ZN0A 5BS6A 4MNUA 5BPDA 5D6EA 4LK0F 4JBAA 2KIUA 4XRFA 5K5QA 4O5VA 4P9FA 3BOQA 2Z5UA 4AIJA 3F6VA 4KIBA 1G4DA 2R7DA 1FY7A 2PMUA 3BPXA 1C0WA 1CF7B 5LHGA 2OD5A 2XGXA 1YO5C 5BOXA 1QBJA 3TDZC 5AONA 3JSPA 2O0YA 2YPRA 3N97A 1ZG3A 1W7PA 4UVBA 1X3UA 2FBHA 2HDCA 1U5TB 2M5WA 2ZNZA 2UXXA 4NHJA 2IA1A 1SAXA 1FOKA 3WTXC 1R22A 3RDIA 2MBFA 1AWCA 3E6CC 1XSVA 5DV5A 1D5VA 1TNSA 4IRIA 2KJCA 4HX8A 2J5OA 1S7AA 2OA4A 2UWMA 1FC3A 2HYGD 4L9VA 4KDPA 4BAYA 4GGGA 3TO9A 3J80K 4RS8A 4CDGA 3DFGA 2FMLA 2LF8A 2NRAC 1CF7A 4LB6B 4IRGA 2FNPA 5LEJA 5JI6A 3P9IA 1HKQA 2FMYA 4G7ZF 5L3FA 4YFNF 2VONA 2CG4A 2K02A 2NYXA 4KN4X 2X0LA 2ESNA 2BE5F 1USSA 3I58A 1UCRA 3LSTA 3TOAA 4HQMA 4KIFA 3FZVA 3GXOA 2EV5A 4E70A 4A0YA 1U5TA 3ABUA 2JZYA 1G3TA 2XAQA 4M72A 3DP7A 2P5KA 2BV6A 3BPVA 3DXJF 2D2WA 1T6SA 4M6YA 4G6DA 2A07F 2H94A 3I59A 4KT5C 2STWA 4G7OF 1QO0D 3OOPA 2DO7A 1H9TA 1R5HA 1O3QA 2VODA 5JR3A 4P55A 2HTJA 4M73A 2GAUA 1BN5A 3ISPA 4M74A 3MZYA 4LFUA 3KEOA 1IN7A 2ELHA 1QZZA 2VT2A 4A5MA 3BDDA 3I71A 2IT0A 3MCZA 4EVIA 3IWZA 4MGRA 5DUKA 1XGOA 4H0EA 3M7GA 4HX4A 1F9NA 1CGPA 2XIGA 3AAFA 1R1UA 2IA0A 4N9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IF1 A;  3P7N A;  5ICF A;  2VOO A;  2QBY A;  3SQN A;  3TGN A;  4OIQ F;  2X4H A;  1GHC A;  1QGP A;  1K6O A;  3K2Z A;  4EJV A;  1XGS A;  2FOK A;  5E1Z B;  2H27 A;  3KCC A;  3HOT A;  2RV8 A;  4UVC A;  1Z6T A;  2IW5 A;  2L4M A;  3P9C A;  3KE2 A;  2RKH A;  5F1R A;  5LBQ A;  4BHP A;  3LA2 A;  3E6M A;  3E5X A;  2QLZ A;  2Z3Y A;  3ERE D;  1AOY A;  1LEA A;  4XLP F;  2C6Y A;  4O6J A;  1WI9 A;  1R1T A;  4HW0 A;  3WTS C;  1BI1 A;  2VC0 A;  5HDG A;  3DPL C;  5HDK A;  2RN7 A;  3GO5 A;  1YS6 A;  3IC7 A;  2W25 A;  2HQN A;  4KN7 X;  4A0Z A;  2HOE A;  3JAM Z;  2VBX A;  1J59 A;  1HST A;  3C7J A;  4DNC A;  2M30 A;  2F5F A;  4MEY F;  1FBQ A;  1XMA A;  4M9S A;  4MEX F;  5K5R A;  5F6F A;  1TBX A;  2RC4 A;  2H09 A;  4I01 A;  3F8B A;  1BC7 C;  2P5L C;  4L0Z B;  4HV5 A;  3ABT A;  3SZP A;  4BQA A;  3PFI A;  2Z9O A;  2NNN A;  3NQO A;  4Q4Z F;  3HRT A;  2XHK A;  1HBX G;  4HAM A;  3IL2 A;  4N9H A;  4R8H A;  5HLI A;  2A6E F;  1ULY A;  4HQE A;  4RB2 C;  4ENJ A;  2NNY A;  1O3S A;  3WOD F;  3HRS A;  3BRO A;  2VC1 A;  4BHB A;  1U2W A;  4KA4 A;  3QU6 A;  2E1C A;  2FEZ A;  3E5Q A;  1SFE A;  2QQA A;  2LSO A;  3F8M A;  4AWX B;  3I53 A;  2O3F A;  4LJZ F;  1R5G A;  1NHA A;  1SD7 A;  4BXU A;  2LF7 A;  3KLN A;  1BM9 A;  1S7O A;  1O7F A;  3LQQ A;  5IT9 Z;  4UUV A;  3K1P A;  2PQ8 A;  5KVR A;  1S6L A;  4UHT A;  4EGZ A;  4OIP F;  3T5X A;  4EQQ A;  3DQV C;  3C18 A;  4KYW A;  1R7J A;  4EGY A;  3BJO A;  4IXA A;  4QWQ A;  1IXS B;  2DI3 A;  3T8T A;  3G73 A;  5ICG A;  5TJJ A;  3E3V A;  2HS5 A;  1RIO H;  1S3J A;  5FD5 A;  4IF4 A;  4KIG A;  4YFK F;  1ZN2 A;  3DEU A;  3DV8 A;  3E5U A;  1EV7 A;  4PGH A;  4RGS A;  3E97 A;  1IRG A;  1ZHF A;  3E6B A;  1KU2 A;  2XKP A;  3C1D A;  1FNN A;  3CDH A;  2V1U A;  1J0R A;  1Z05 A;  2D45 A;  3V7S A;  4WCG A;  4RGX A;  3V8L A;  1YFH A;  4HLX A;  2XKO A;  3S2W A;  4RB0 A;  5E8G A;  5HVQ C;  2FRH A;  4ESF A;  3EYI A;  2GA2 A;  4UXN A;  1BIB A;  5H6Q A;  4CYD A;  1ZGJ A;  1D8J A;  2P8T A;  1T98 A;  3ZP5 A;  2G9W A;  2K86 A;  4RGU A;  4EJO A;  1FPQ A;  1Q1H A;  3F3X A;  1TW2 A;  1YG2 A;  3HUG A;  1YW7 A;  4BYY A;  5L3C A;  5ERI A;  4B8X A;  1MDM B;  3REO A;  1JHF A;  2WC2 A;  5FFX A;  3GZ5 A;  4ZYD A;  2H6B A;  5AIQ A;  5E1W A;  5D8L B;  1SD5 A;  3BZ6 A;  1LDK B;  2TDX A;  2CW0 F;  2E7X A;  1PP7 U;  1P6R A;  4IPA A;  5IT3 A;  1XSD A;  2MH2 A;  2BYV E;  3F72 A;  1GXP A;  1SFX A;  1TQM A;  3R60 A;  4KUM A;  5HLG A;  4Y15 A;  1HW2 A;  4L5J A;  1OMI A;  4KMU X;  1FYL A;  4OOI A;  2EK5 A;  4OMY A;  2WTE A;  4A6E A;  2BGC A;  3BJ6 A;  4NB5 A;  2M8E A;  1BBY A;  1KYZ A;  5LGT A;  3FWE A;  1QQI A;  2H6C A;  4OIR F;  1YW9 A;  5D8K B;  3F8N A;  4EV0 A;  1PUE E;  3WTU C;  1G3Y A;  4FX4 A;  3F8F A;  4HYE A;  5CVI A;  1KGS A;  1MDM A;  1H9G A;  2FA5 A;  1DP7 P;  1W7P D;  2FBI A;  3T8R A;  2QUF A;  3RYR A;  1XCV A;  3V4G A;  1T2K A;  1S8N A;  1IAW A;  2L4A A;  2V79 A;  3I4P A;  2ACJ A;  5L3D A;  3NRV A;  5HLH A;  3TQN A;  4L9N A;  4XSZ F;  1FZP B;  2M45 A;  5A2Q K;  1LJ9 A;  1HW5 A;  4HF0 A;  4KFC A;  4LLG F;  1BI3 A;  2VBZ A;  3GW2 A;  3HHH A;  3K0L A;  3K1N A;  3RTR A;  1WKM A;  1R58 A;  1G3W A;  2QQ9 A;  1FBS A;  2KRF A;  1U78 A;  5FGM A;  2EJR A;  2FU4 A;  1TQI A;  5DDG A;  3PQJ A;  1KQ0 A;  4MHG A;  2AS5 F;  1LVA A;  1OKR A;  1K78 B;  4EJT A;  3ROU A;  1S29 A;  2E1N A;  1J5Y A;  2STT A;  1FYK A;  3L00 A;  3B02 A;  5L3G A;  3M9A A;  4HDU A;  2B0L A;  1WSU A;  2O8X A;  1G6N A;  1R36 A;  1O57 A;  5ED4 A;  2YSR A;  5L3B A;  3W6J B;  3F8C A;  4ZYE A;  4MQV A;  1UHM A;  1O3T A;  3E6D A;  4I02 A;  5BMZ A;  1EH6 A;  2VE9 A;  5LLQ A;  1T0F A;  4A0X A;  4G7H F;  3BP8 A;  2Z33 A;  1SMT A;  2JRT A;  2KIF A;  1ZRE A;  3LAJ A;  2NAZ A;  1B4A A;  2OBP A;  4M9Z A;  4CGZ A;  4LG0 B;  3MAJ A;  3QP6 A;  2A3S A;  1L3L A;  4YIF A;  4Y17 A;  4OIN F;  3D5L A;  1R1V A;  2F5C A;  1XDU A;  1TW3 A;  1BI2 A;  1SD6 A;  1YTY A;  1MJB A;  2DU9 A;  2JPB A;  2MH9 A;  2PFB A;  2GZW A;  2LNB A;  4ZYH A;  3I0T A;  3M1E A;  3U1D A;  1KU3 A;  5LHH A;  5CYV A;  3FXU A;  3M8F A;  1TLH B;  2R3S A;  5E17 F;  1KQ8 A;  1YLF A;  3RPU A;  3MQ0 A;  4O3M A;  2P5V A;  3EYY A;  1DDN A;  5FB2 A;  3CLO A;  2EWN A;  2PJP A;  2Y75 A;  4ZH4 F;  4A6D A;  3RKY A;  2A68 F;  1ZRC A;  3T0Y A;  4G94 A;  1IZ1 A;  1HKT A;  1BI0 A;  2MLK A;  1MJ9 A;  1K7A A;  3QPT A;  3QP5 A;  3O2P E;  1PP8 F;  2K4J A;  2FF4 A;  5HS9 A;  3LAP A;  2EA2 A;  4LB5 A;  2DPD A;  1FSH A;  1GXQ A;  3GFL A;  3I5U A;  4HV6 A;  1MZB A;  3H92 A;  1SD4 A;  1DPU A;  3QOP A;  3JSO A;  2EFN A;  4XLN F;  3R4K A;  3CUQ C;  3FMS A;  2DPU A;  1JXS A;  2ZBK A;  1D3Y A;  5CLS A;  4OU0 A;  5LRR A;  4FT8 A;  3FM3 A;  4I98 B;  2HKX A;  1RNL A;  1LNW A;  4QLC U;  1J75 A;  1P4W A;  1XCB A;  2P6S A;  3B73 A;  3DKW A;  1FT9 A;  4XBF A;  3V8K A;  4A2U A;  2CO5 A;  1KU9 A;  3WTV C;  4MTD A;  2HFH A;  1KA8 A;  4L18 B;  2L54 A;  2Y48 A;  1T39 A;  3FXR A;  2P4W A;  1V3F A;  4HOB A;  3F23 A;  2R7F A;  1P92 A;  5DUI A;  4CZZ A;  4YG2 F;  5ILU A;  3M8E A;  1XDS A;  4R1H A;  5F64 A;  1Z6R A;  2DK8 A;  4EMS A;  5ICC A;  4Q48 A;  4AIK A;  2XAJ A;  3MZH A;  4U88 A;  2L01 A;  2W57 A;  5DD8 A;  2VBY A;  4LMY A;  2XRO A;  1WWX A;  1FYM A;  2PLY A;  1FWZ A;  2LDU A;  3JW4 A;  2RGV A;  3O6B B;  3ZMV A;  2XUB A;  5J8C A;  4IRH A;  2KKO A;  4I09 A;  4I7H A;  5DCM B;  3GZ6 A;  2Q0O A;  3GFJ A;  1YW8 A;  5BPI A;  4BH9 A;  3FHZ A;  3VB2 A;  3VOD A;  1JHH A;  4LLN A;  2ESH A;  3GLX A;  4YFX F;  3J7A O;  1IN4 A;  3HRM A;  1UB9 A;  3WTT C;  4OIO F;  4B09 A;  1XSX A;  2ISZ A;  3ECH A;  2OQG A;  4XSX F;  3D0S A;  2HR3 A;  1IXC A;  3QAH A;  1W5S A;  2EFW A;  3IHU A;  5CJ9 A;  2G7H A;  3GEZ A;  2P6T A;  2BEO A;  2DT5 A;  2GA1 A;  4EM1 A;  2EFO A;  3RKW A;  3O3K A;  3CJN A;  1DUX C;  1Z7U A;  2ZO4 A;  3K69 A;  3WU0 A;  2P7C B;  2ISY A;  2KJB A;  2F5E A;  5CVU A;  1TTY A;  5LGU A;  1E2X A;  4ETS A;  2PI0 A;  5CVR A;  5DCM A;  4WXC A;  1B6A A;  3Q9S A;  3VOE A;  3GX4 X;  2MLG A;  1BOA A;  1ZG5 A;  1STZ A;  2PEX A;  5FLX K;  3JTH A;  4S04 A;  1EH7 A;  1L0O C;  2PG4 A;  3W6K B;  5D4S A;  3ELK A;  5KK1 A;  3WTW C;  3SZT A;  4M6X A;  5LHI A;  1GVJ A;  2EFQ A;  3R0A A;  6PAX A;  5D5U B;  1YQA A;  2FQ3 A;  1YIO A;  1XGN A;  3L9F A;  4I0A A;  1R00 A;  4U0V A;  5JHU A;  5K5O A;  1SMY F;  2IVM A;  4KIC A;  3KFW X;  3ZMT A;  5LGN A;  2XAH A;  2Q2E A;  4HZF A;  2RVC A;  2HTS A;  3IRQ A;  1W4M A;  2ZCW A;  2QVO A;  4A12 A;  3EUH A;  4AD9 A;  1K79 A;  4GXO A;  1H0M A;  5D4R A;  5JFR A;  2V1X A;  1W5T A;  4IHS A;  3R6S A;  2VE8 A;  4LLL A;  2FBK A;  3J80 Z;  2K4B A;  4AVP A;  5E1X A;  2RDP A;  5LEK A;  3GUD A;  1IN5 A;  1QZY A;  2VBW A;  1FP1 D;  3R61 A;  1O7L A;  1Z9C A;  3KP3 A;  3KLO A;  4Y13 A;  4KMF A;  3I54 A;  5DCF A;  5K1Y A;  3LWF A;  4EM2 A;  4UNO A;  2JPC A;  4U7B A;  5CVV A;  1LQ1 A;  1U8R A;  2WWY A;  4NQW A;  4RAY A;  2RQP A;  4HA8 A;  1MD0 A;  2MA3 A;  1P2F A;  4BNC A;  3COA C;  3ZMS A;  1XB4 A;  5FO5 A;  4RB1 A;  4IJA A;  3K1M A;  2FNA A;  4WX9 A;  4RAZ A;  3FX3 A;  3P9K A;  2YX7 A;  4G9Y A;  5HS8 A;  4HLY A;  3LQR A;  4OMZ A;  5FFZ A;  5IT9 K;  1I27 A;  5D6F A;  4EM0 B;  4LGW A;  2EV6 A;  3WGH A;  4RGR A;  5L3E A;  2IRF G;  4R79 A;  3BY6 A;  3CUQ B;  3TO6 A;  4UV8 A;  2W85 A;  3RPQ A;  3SFZ A;  2G7U A;  2ZJ2 A;  2GIV A;  1KU7 A;  1IUY A;  2QYO A;  2DQR A;  2Y0M A;  2VT3 A;  2DK5 A;  1HXD A;  3QU3 A;  3KP5 A;  1WRJ A;  1HQC A;  4MQ9 F;  1B59 A;  1Z1D A;  1UFM A;  5AIP A;  1FP2 A;  2GWR A;  4P5O A;  4Z2Y A;  4ENK A;  1MKM A;  4PZJ A;  3EDP A;  4ENN A;  4GO1 A;  2CWE A;  3WG9 A;  1FBU A;  5ILV A;  1Z91 A;  4WK8 F;  2FE3 A;  5D5V B;  3WTY C;  1E17 A;  5J8F A;  2ETH A;  3J81 K;  3CUQ A;  3MWM A;  1XN7 A;  2Q8K A;  3GYH X;  4JK1 X;  2ADU A;  3I59 B;  2CSO A;  3ML6 A;  4S05 A;  4JQF A;  2FXA A;  1HKS A;  4Q5S F;  1OR7 A;  3HIF A;  1HW1 A;  1ZRF A;  3TKY A;  3DF8 A;  3WTZ A;  1MGT A;  1P4A A;  4PGG A;  5D5W B;  2PN6 A;  3ZMU A;  2HQR A;  3WGG A;  3HTS B;  2K7L A;  1BJA A;  3MFK A;  3TOB A;  1YS7 A;  5ICE A;  3Q5F A;  2PBI A;  2CGP A;  3KP6 A;  5BQT A;  1XMK A;  4G8X A;  2BBY A;  2IP2 A;  1SFU A;  1OPC A;  2OAZ A;  1UST A;  2QM3 A;  1PDN C;  2EB7 A;  2LKP A;  5HOO A;  1K78 A;  3LA7 A;  1D8K A;  3RKX A;  3ZN1 A;  2QBY B;  1ON2 A;  2A5Y B;  4ESJ A;  2XAS A;  1J9I A;  3HSF A;  2CFX A;  5J6X A;  3LA3 A;  3CTA A;  4IHT A;  1I1G A;  2DTR A;  2GXB A;  2GXG A;  1DPR A;  2XRN A;  2RNJ A;  3K9T A;  4ON0 A;  1RUO A;  2HGC A;  1XGM A;  2L3D A;  1VTN C;  3ZQ7 A;  3DPT A;  2VOP A;  2CYY A;  1I1S A;  2ZKZ A;  4ASN A;  4TV7 A;  1XD7 A;  4AIH A;  1IN8 A;  1IW7 F;  3SHF A;  1F5T A;  1U3E M;  2K27 A;  3RYP A;  3N4M A;  3RJP A;  4EJW A;  4ENM A;  4FX0 A;  4YII A;  5EEH A;  1KYW A;  2OU2 A;  3FXQ A;  4LG0 A;  4CIC A;  2JSC A;  2W84 A;  2DLL A;  2HWV A;  2M87 A;  1IXR C;  2ZME B;  4HF1 A;  4BHC A;  3KET A;  4HF2 A;  1OYW A;  3FM5 A;  2MC3 A;  1B9M A;  4GCV A;  4ESB A;  5E8I A;  3I64 A;  2HKO A;  3ZPL A;  3ULQ B;  3HSE A;  2YR2 A;  2QWW A;  2O03 A;  2PMH A;  1EH8 A;  4L0Y B;  3C3W A;  3ZMD A;  3H3U A;  3KP2 A;  1R23 A;  4L9T A;  1ON1 A;  3PQK A;  3TDU C;  3VEP A;  1ZG1 A;  2COM A;  4PCQ A;  1TQP A;  1ODD A;  2E7W A;  2WV0 A;  3ZMZ A;  4F7Z A;  5FLX Z;  5DD4 A;  4I2O A;  1J2X A;  4LK1 F;  4U0Y A;  2FSW A;  4U7D A;  4CHU A;  4WXD A;  4WF2 A;  3FF5 A;  2DFI A;  1LDD A;  2MD5 A;  1B1B A;  4MTE A;  4EJU A;  2QEN A;  4ZZL A;  5ILS A;  3MEX A;  1REP C;  5EEG A;  4FHT A;  2YX4 A;  2ZME A;  3FMQ A;  3EET A;  2M1B A;  1KQ9 A;  1U5T C;  4L9J A;  2F2E A;  5D5X B;  4D0P A;  2P7V B;  3KZZ A;  4ZZD A;  2DW4 A;  1ONV A;  1F1Z A;  4ZYG A;  2O6G E;  3GF2 A;  2DQL A;  3FMR A;  2HZT A;  3KZY A;  3CUO A;  2ZXJ A;  1YYV A;  2OQR A;  1OYI A;  2JT1 A;  2DAO A;  3LFK A;  4L5I A;  1A04 A;  1QPM A;  3IKV A;  4I0B A;  3HHG A;  2ZFW A;  2GQQ A;  3WE2 A;  2EA4 A;  3BJA A;  2CQK A;  2IA2 A;  1I6X A;  5LRS A;  3V7R A;  2VXZ A;  3EQL F;  2F5D A;  3GFM A;  4PDK A;  1BC8 C;  3KEQ A;  3QRF F;  2IPQ X;  1O3R A;  3U9G A;  3F6O A;  1B9N A;  5JVT A;  4GYI A;  1TNT A;  2XAG A;  4LD5 A;  3KP7 A;  3WE3 A;  5H6R A;  2KIM A;  5HDN A;  2QZ8 A;  2W24 A;  1WQ2 A;  2VN2 A;  5FD6 A;  2JTV A;  4DQ2 A;  3RI4 A;  4HBL A;  1T38 A;  1V4R A;  2EV0 A;  3IWF A;  2XV4 S;  3HYI A;  4GYG A;  2QQB A;  3KP4 A;  5DYM A;  1HSJ A;  1F4K A;  3VFZ A;  4IVN A;  2IJL A;  3L2C A;  1OYY A;  1RZ4 A;  2D1V A;  4UVA A;  3HOS A;  4U0W A;  1FLI A;  1IN6 A;  1JE8 A;  4HDV A;  4CO8 A;  2D1H A;  1ZAO A;  5E20 A;  3H3Z A;  2YU3 A;  2A6H F;  3HSR A;  1I5Z A;  3IRR A;  1Y0U A;  1P4X A;  5HS7 A;  4HX7 A;  2A61 A;  2HEO A;  1UHW A;  1IRF A;  3WGI A;  1RI7 A;  1ZRD A;  2A69 F;  4WXH A;  2EFP A;  3JAM K;  1ZYR F;  3OV8 A;  1QNT A;  4K2E A;  3NEU A;  4N0B A;  5A2Q Z;  3GWZ A;  4CXF A;  2V9V A;  3JTG A;  1U6G A;  3SXY A;  1FSE A;  2UZK A;  5TRD A;  3G3Z A;  3F22 A;  4M9X A;  4A5N A;  3L7W A;  2J5P A;  1G3S A;  4Q47 A;  3ECO A;  2XAF A;  4P9U A;  1MJA A;  1JGS A;  1RUN A;  3V7C A;  3J81 Z;  1J7K A;  3TO7 A;  4G6Q A;  1ZGA A;  2UXN A;  1BIA A;  3V8J A;  2XVC A;  3HTU A;  3T1B A;  1ZH5 A;  1LB2 A;  3IKT A;  2ZNY A;  3Q9V A;  2Z99 A;  3HRU A;  1FX7 A;  1LEB A;  4RB3 C;  2OZU A;  4P96 A;  3QPH A;  5CVJ A;  3GVA A;  2OZ6 A;  5DEQ A;  3CO7 C;  4UV9 A;  5E18 F;  2V1D A;  3CO6 C;  2O61 A;  1W7P B;  4M71 A;  3U2R A;  2AXL A;  1ZAR A;  3BWG A;  2NS0 A;  4KNY A;  4WWC A;  1ZLK A;  2V6C A;  3L09 A;  3RIR A;  3F21 A;  5H20 A;  3R0J A;  2HYF A;  2L02 A;  3GFI A;  1LDJ A;  3WU1 B;  1ZLJ A;  2DBB A;  3ZN0 A;  5BS6 A;  4MNU A;  5BPD A;  5D6E A;  4LK0 F;  4JBA A;  2KIU A;  4XRF A;  5K5Q A;  4O5V A;  4P9F A;  3BOQ A;  2Z5U A;  4AIJ A;  3F6V A;  4KIB A;  1G4D A;  2R7D A;  1FY7 A;  2PMU A;  3BPX A;  1C0W A;  1CF7 B;  5LHG A;  2OD5 A;  2XGX A;  1YO5 C;  5BOX A;  1QBJ A;  3TDZ C;  5AON A;  3JSP A;  2O0Y A;  2YPR A;  3N97 A;  1ZG3 A;  1W7P A;  4UVB A;  1X3U A;  2FBH A;  2HDC A;  1U5T B;  2M5W A;  2ZNZ A;  2UXX A;  4NHJ A;  2IA1 A;  1SAX A;  1FOK A;  3WTX C;  1R22 A;  3RDI A;  2MBF A;  1AWC A;  3E6C C;  1XSV A;  5DV5 A;  1D5V A;  1TNS A;  4IRI A;  2KJC A;  4HX8 A;  2J5O A;  1S7A A;  2OA4 A;  2UWM A;  1FC3 A;  2HYG D;  4L9V A;  4KDP A;  4BAY A;  4GGG A;  3TO9 A;  3J80 K;  4RS8 A;  4CDG A;  3DFG A;  2FML A;  2LF8 A;  2NRA C;  1CF7 A;  4LB6 B;  4IRG A;  2FNP A;  5LEJ A;  5JI6 A;  3P9I A;  1HKQ A;  2FMY A;  4G7Z F;  5L3F A;  4YFN F;  2VON A;  2CG4 A;  2K02 A;  2NYX A;  4KN4 X;  2X0L A;  2ESN A;  2BE5 F;  1USS A;  3I58 A;  1UCR A;  3LST A;  3TOA A;  4HQM A;  4KIF A;  3FZV A;  3GXO A;  2EV5 A;  4E70 A;  4A0Y A;  1U5T A;  3ABU A;  2JZY A;  1G3T A;  2XAQ A;  4M72 A;  3DP7 A;  2P5K A;  2BV6 A;  3BPV A;  3DXJ F;  2D2W A;  1T6S A;  4M6Y A;  4G6D A;  2A07 F;  2H94 A;  3I59 A;  4KT5 C;  2STW A;  4G7O F;  1QO0 D;  3OOP A;  2DO7 A;  1H9T A;  1R5H A;  1O3Q A;  2VOD A;  5JR3 A;  4P55 A;  2HTJ A;  4M73 A;  2GAU A;  1BN5 A;  3ISP A;  4M74 A;  3MZY A;  4LFU A;  3KEO A;  1IN7 A;  2ELH A;  1QZZ A;  2VT2 A;  4A5M A;  3BDD A;  3I71 A;  2IT0 A;  3MCZ A;  4EVI A;  3IWZ A;  4MGR A;  5DUK A;  1XGO A;  4H0E A;  3M7G A;  4HX4 A;  1F9N A;  1CGP A;  2XIG A;  3AAF A;  1R1U A;  2IA0 A;  4N9I A; 
#chains in the Genus database with same CATH topology
 1BOB A;  3MD2 A;  1IF1 A;  3L1P A;  2VXD A;  1QVU A;  3P7N A;  5ICF A;  2OTL I;  2VOO A;  3OL3 A;  2QBY A;  3SQN A;  3TGN A;  4OIQ F;  2X4H A;  2IS1 A;  3H1C A;  1GHC A;  4C2M J;  1BR1 A;  3DKX A;  1QGP A;  2I5U A;  1K6O A;  4A3D J;  2BY0 A;  3WHB A;  3K2Z A;  2R7W A;  2KPM A;  4EJV A;  1XGS A;  3RQ4 A;  2H1L A;  2FOK A;  1T95 A;  5E1Z B;  1OLT A;  2HQA A;  3HGY A;  2LY1 A;  4OWR B;  2H27 A;  3KCC A;  3L2R A;  4DW6 A;  3HOT A;  2RV8 A;  3RQI A;  4UVC A;  3K4N A;  2O9L A;  2FD5 A;  4A3J J;  1Z6T A;  2IW5 A;  5F0C A;  2L4M A;  5IP7 J;  3P9C A;  3LSG A;  3KE2 A;  3IUO A;  3DBH B;  2RKH A;  1I6H J;  2X6X A;  5F1R A;  3ASN H;  5TGT A;  5LBQ A;  4BHP A;  1D0Z A;  3LA2 A;  4I6Z A;  3E6M A;  1S72 I;  3BG6 A;  5KAI C;  1BA5 A;  3E5X A;  2QLZ A;  2Z3Y A;  4E6K G;  3ERE D;  1AOY A;  4YIR X;  1UG0 A;  1LEA A;  1TWC J;  4QIW N;  5DM7 F;  4XLP F;  2F4M B;  3DBR B;  2C6Y A;  5EG0 A;  3GZN B;  2DOF A;  4O6J A;  2ZJR F;  3GTM J;  1WI9 A;  1HC8 A;  1R1T A;  4HW0 A;  3WTS C;  1BI1 A;  2VC0 A;  3H35 A;  4BQN A;  5HDG A;  1T0F C;  2BHZ A;  3DPL C;  1GT0 C;  5HDK A;  2L5Q A;  2RN7 A;  3GO5 A;  3U1K A;  1YS6 A;  3IC7 A;  3CC2 I;  2W25 A;  2HQN A;  2AHQ A;  4KN7 X;  4A0Z A;  2HOE A;  4IZZ A;  2FUG 2;  3JAM Z;  1LKX A;  2VBX A;  1J59 A;  1HST A;  3C7J A;  2HDD A;  4DNC A;  2OC6 A;  1KON A;  2VQG A;  3DEE A;  2M30 A;  5IOY A;  4IHY A;  2K9N A;  2F5F A;  4MEY F;  1XPX A;  5FRM A;  2GM4 A;  1FBQ A;  1R49 A;  2WBM A;  3ONQ A;  1XMA A;  2LTP A;  2IGK A;  3C2B A;  5FLV A;  4A3M J;  4M9S A;  4MEX F;  5K5R A;  5F6F A;  1TBX A;  2RC4 A;  2H09 A;  2EIK H;  4I01 A;  3F8B A;  2KDZ A;  2R7U A;  1BC7 C;  1TWA J;  2P5L C;  4L0Z B;  2V9P A;  3S1R J;  2X6W A;  4HV5 A;  1IJW C;  2H8W A;  3E1S A;  3ABT A;  3SZP A;  4BQA A;  3EPZ A;  3PFI A;  4BL0 B;  4X6A J;  3PO3 J;  3H36 A;  2Z9O A;  3IP4 B;  2NNN A;  3NQO A;  4Q4Z F;  3HRT A;  2XHK A;  1HBX G;  4BQO A;  4HAM A;  3IL2 A;  4N9H A;  4R8H A;  4NBQ A;  5HLI A;  2A6E F;  4XOT A;  2QKM B;  4JX6 A;  2E34 A;  2K9L A;  1ULY A;  4HQE A;  4CZC A;  4RB2 C;  4DZP A;  1NK3 P;  2OCE A;  2CH0 A;  2BW3 B;  4ENJ A;  2NNY A;  1JT0 A;  5E3M A;  1O3S A;  2QA4 I;  2LD5 A;  3SYT A;  3WOD F;  5LD2 C;  2X1D A;  3HRS A;  1FOY A;  3BRO A;  2VC1 A;  4BU2 A;  3G71 I;  3F9K A;  1WGX A;  2M9H A;  4BHB A;  1MMD A;  2ELJ A;  2OV7 A;  1IDY A;  3E7L A;  3BTC A;  4KIS A;  1U2W A;  1NTC A;  3ZCO A;  4XLH A;  3QU6 A;  4KA4 A;  2E1C A;  1WJB A;  2EIL H;  2FEZ A;  3E5Q A;  1A31 A;  1SFE A;  3A0H C;  1YIT I;  2QQA A;  1ETQ A;  2LSO A;  4B3X A;  3F8M A;  5E3O A;  4AWX B;  1RPW A;  1S5L C;  4FIS A;  2LLK A;  3I53 A;  4KIT B;  2O3F A;  2LR8 A;  4LJZ F;  1R5G A;  1NHA A;  1SD7 A;  4BXU A;  2AQF A;  2LF7 A;  1XTA A;  3KLN A;  1ERD A;  1VQL I;  1BM9 A;  2VJJ A;  3FBI B;  1S7O A;  1O7F A;  5HOD A;  3LQQ A;  5IT9 Z;  4UUV A;  1IRZ A;  3C2G A;  3K1P A;  1A35 A;  3QQA A;  1WZ2 A;  2PQ8 A;  4J00 A;  4F92 B;  5KVR A;  1S6L A;  4BJ6 C;  4UHT A;  2LMD A;  4EGZ A;  4OIP F;  3T5X A;  1DGR M;  4ZTF A;  4EQQ A;  3DQV C;  3TBI A;  3C18 A;  4KYW A;  1FMV A;  2WY7 Q;  1R7J A;  4EGY A;  3BJO A;  4IXA A;  4QWQ A;  1TC3 C;  2VAS A;  2JK3 A;  2DMT A;  3G1M A;  1IXS B;  2DI3 A;  3T8T A;  1K61 A;  5B5E C;  3G73 A;  3BG5 A;  1NG6 A;  2X9D A;  1XC5 A;  5ICG A;  5K7F A;  5TJJ A;  2RQQ A;  3E3V A;  2XB0 X;  3QYF A;  4BUP A;  1R4N B;  2WAQ A;  3CMA I;  3HUG B;  5K7H A;  2BY2 A;  2HS5 A;  1RIO H;  1S3J A;  2BW3 A;  5FD5 A;  3H9G A;  3KX2 A;  4IF4 A;  3OYM A;  4KIG A;  4YFK F;  2I8D A;  1ZN2 A;  3DEU A;  3DV8 A;  2W7N A;  2HXI A;  5M5Y J;  3DTK A;  3E5U A;  1EV7 A;  3DTE A;  1SVO A;  4PGH A;  1R9T J;  4RGS A;  3E97 A;  1IRG A;  1MNE A;  3LSK A;  5FRO A;  1ZHF A;  1HA8 A;  3E6B A;  1KU2 A;  2PMZ N;  2XKP A;  2F4I A;  3C1D A;  1FNN A;  3NAR A;  2DA2 A;  5J3L A;  2Z1D A;  4BE2 A;  3CDH A;  2V1U A;  1J0R A;  1ITY A;  1VF9 A;  4CUG A;  1JTY A;  1Z05 A;  2D45 A;  4NC8 A;  3V7S A;  3OYK A;  2VIX A;  4AM3 A;  1XG1 A;  4WCG A;  4RGX A;  2Y2Z A;  3V8L A;  1YFH A;  4HLX A;  2XKO A;  2CQ7 A;  3S2W A;  4RB0 A;  5E8G A;  4DZJ A;  5HVQ C;  2FRH A;  1YHQ I;  4ESF A;  1YE9 A;  3EYI A;  2GA2 A;  2EZI A;  4HST A;  4UXN A;  2PX9 A;  4M3E A;  2CUE A;  1BIB A;  5H6Q A;  4CYD A;  1ZGJ A;  2WAD A;  5B1A H;  3PIO F;  4IKF A;  1D8J A;  2CFO A;  4QPQ A;  2P8T A;  3H9Q A;  1T98 A;  1UG2 A;  2V6E A;  1DP3 A;  4CCL A;  3ZP5 A;  2G9W A;  2K86 A;  5IOZ A;  2JSP A;  3CJT B;  3G2B A;  3HKZ N;  3OYC A;  4RGU A;  2HVQ A;  4EJO A;  1FPQ A;  2HOA A;  1TT5 B;  1IV6 A;  3JRH A;  1YX3 A;  4ANJ A;  3S3M A;  1Q1H A;  3F3X A;  4RBO A;  4XLA A;  3BG3 A;  2NOJ B;  1TW2 A;  4FTH A;  1YG2 A;  3HUG A;  3KEY A;  1YW7 A;  4BYY A;  1V5E A;  5L3C A;  3JR9 A;  1P7I A;  5ERI A;  3BG9 A;  4DYR A;  3FKJ A;  4B8X A;  4BEH B;  4FCY A;  1MDM B;  2R5Z B;  3DLA A;  2EIJ H;  3REO A;  1JHF A;  2WC2 A;  5FFX A;  3GZ5 A;  4ZYD A;  2DMN A;  2H6B A;  5AIQ A;  5E1W A;  5J40 A;  1SD5 A;  5D8L B;  2L2O A;  3BZ6 A;  4A3B J;  1LDK B;  1GVD A;  2TDX A;  5GTI C;  4A3C J;  3BR6 A;  3DPU A;  2CW0 F;  2E7X A;  1GUU A;  4N9I A;  2DJI A;  3L2Q A;  1F43 A;  1Y0N A;  1MMS A;  1PP7 U;  1DQU A;  1U0J A;  3ABL H;  2GXA A;  1LE8 B;  1P6R A;  4IPA A;  5IT3 A;  2O7O A;  3K4K A;  3U21 A;  1XSD A;  1Y8R B;  2PJR B;  1QHH D;  2MH2 A;  2BYV E;  4BBS J;  3F72 A;  1GXP A;  1SFX A;  4PJM A;  2R7Q A;  1TQM A;  1N75 A;  2NVU B;  5F27 A;  2ECB A;  3R60 A;  4KUM A;  4IX7 A;  4PFO A;  4BAC A;  4II2 A;  5FKL A;  2K3F A;  4Y15 A;  3SDG A;  5HLG A;  1HW2 A;  1E0E A;  3HJE A;  2EZK A;  4L5J A;  5B66 C;  3HC7 A;  1OMI A;  2P0W A;  3B6C A;  4KMU X;  1NG7 A;  2K9Q A;  4M3F A;  3MVP A;  1FYL A;  4OOI A;  1MBE A;  2EK5 A;  4OMY A;  2WTE A;  4A6E A;  2DYS H;  2BGC A;  2R7V A;  4A3K J;  3DTI A;  3BJ6 A;  1LVK A;  1OJL A;  1YOV B;  2HNH A;  4NB5 A;  2M8E A;  4V2G A;  5H2F C;  1PVE A;  2TRT A;  1BBY A;  1KYZ A;  3IH2 A;  5LGT A;  3FWE A;  1QQI A;  2H6C A;  4OIR F;  3CZ6 A;  1YW9 A;  3CCY A;  2B63 J;  3H3V K;  5D8K B;  2LY9 A;  3F8N A;  2H1K A;  5GP9 A;  4EV0 A;  3WTU C;  1G3Y A;  3OYN A;  4BE1 A;  1PUE E;  3CCV I;  4RMN A;  4FX4 A;  2M7B A;  3MZ8 A;  2IEK A;  1ETV A;  3F8F A;  4HYE A;  2LP0 A;  1KGS A;  2QSF X;  5CVI A;  4RA2 A;  4BEH A;  1MDM A;  4A3G J;  1H9G A;  2R5Z A;  2FA5 A;  1DP7 P;  1W7P D;  2FBI A;  3T8R A;  2QUF A;  1IG7 A;  1VFC A;  3AG1 H;  3PNY A;  3NWS A;  3RYR A;  4D1Q A;  1XCV A;  3V4G A;  1T2K A;  1S8N A;  1XMX A;  1IAW A;  2XGE A;  1VND A;  3BR2 A;  4BY7 J;  2L4A A;  2V79 A;  3I4P A;  5CPR B;  2ACJ A;  4XOR A;  2B9S A;  5L3D A;  2DFH A;  3NRV A;  2WB1 A;  5HLH A;  3TQN A;  1K4S A;  3FXK A;  2DA3 A;  3KYL A;  4L9N A;  4XSZ F;  1FZP B;  1I50 J;  2M45 A;  5A2Q K;  1LJ9 A;  1HW5 A;  2I10 A;  4HF0 A;  4KFC A;  3PO2 J;  4LLG F;  1BI3 A;  2VBZ A;  2WAE A;  3GW2 A;  3HHH A;  3K0L A;  3K1N A;  2ME6 A;  3RTR A;  3OR1 C;  1WKM A;  1T08 B;  1R58 A;  1G3W A;  2M7A A;  2ZJP F;  2QQ9 A;  4E7S A;  1FBS A;  2KRF A;  1U78 A;  5FGM A;  1VI0 A;  2EJR A;  2FU4 A;  1TQI A;  1WFX A;  2BVL A;  4LOC A;  5DDG A;  2EIN H;  3PQJ A;  2EZH A;  1KQ0 A;  3BQZ A;  4MHG A;  1W0U A;  1AU7 A;  3EUH C;  2AS5 F;  1LVA A;  1OKR A;  1K78 B;  4EJT A;  4F52 A;  3ROU A;  1S29 A;  2E1N A;  1K4T A;  1JKR C;  2DA5 A;  1J5Y A;  2STT A;  2LYC A;  4XLC A;  3PUB A;  3FXL A;  1X1B A;  1FYK A;  3ZQC A;  2Q1Z B;  3K6G A;  3OYG A;  3L00 A;  3B02 A;  5L3G A;  4B44 A;  2L7K A;  3M9A A;  4HDU A;  2B0L A;  1QPI A;  3CJR B;  1WSU A;  2O8X A;  1G6N A;  1R36 A;  1O57 A;  5C4J J;  5ED4 A;  2YSR A;  5L3B A;  3W6J B;  3F8C A;  1TL8 A;  3OOU A;  4RAG A;  1HLV A;  4ZYE A;  5IYD J;  1QU3 A;  4MQV A;  3BCA A;  1UHM A;  2HPI A;  4JX5 A;  3E6D A;  4I02 A;  1UHS A;  5BMZ A;  1EH6 A;  2VE9 A;  5LLQ A;  1O3T A;  1T0F A;  4A0X A;  3K70 C;  3S3O A;  1I3A A;  3OSG A;  3M1C A;  4G7H F;  3BP8 A;  2Z33 A;  1DU0 A;  1SMT A;  2JRT A;  1V54 H;  3W2V A;  4XK4 A;  2KIF A;  1ZRE A;  3OYF A;  3LAJ A;  1X19 A;  2NAZ A;  2XAU A;  5TIS C;  2LOO A;  1B4A A;  2OBP A;  4M9Z A;  2KZG A;  4CGZ A;  2CS3 A;  4LG0 B;  4G12 A;  1UMQ A;  1VQM I;  1X4O A;  2CV0 A;  3MAJ A;  3QP6 A;  2A3S A;  2JUG A;  4B1R A;  1L3L A;  3ZR8 X;  4YIF A;  1W36 C;  4Y17 A;  4MLO A;  4OIN F;  5CKT A;  3FK7 A;  1Y6I A;  1RKW A;  3D5L A;  1NK2 P;  1R1V A;  2F5C A;  3CQZ J;  3HPG A;  4IOA F;  2HYJ A;  1XDU A;  2W48 A;  2Y69 H;  1TW3 A;  1BI2 A;  4GRI A;  4PSX A;  2ME0 A;  1SD6 A;  1X3W B;  1YTY A;  1MJB A;  2DU9 A;  2JPB A;  3Q0U A;  2NS8 A;  5E79 C;  3VYT B;  2MH9 A;  2PFB A;  1ACI A;  2GZW A;  1YJN I;  4IQJ A;  2LNB A;  3UR3 C;  1S9H A;  4ZYH A;  3I0T A;  3RPU D;  2K3P A;  4BXX J;  4XIC A;  2MAB A;  3M1E A;  3U1D A;  2NS7 A;  5LFA A;  5J1U A;  4MO7 A;  1BR2 A;  1KU3 A;  2DOE A;  1P9Q C;  2GIZ A;  5LHH A;  2EIM H;  1RRJ A;  3DEW A;  5CYV A;  1Z7L A;  3FXU A;  3M8F A;  1TLH B;  2R3S A;  1POG A;  1Z77 A;  5E17 F;  1KQ8 A;  3DLL F;  1VQO I;  4YRV A;  1YLF A;  1HCR A;  5FRN A;  3RPU A;  3MQ0 A;  4AYB A;  2XF5 A;  4O3M A;  2P5V A;  3EYY A;  3GME A;  1DDN A;  3J7A Y;  1MND A;  1X2M A;  3JRD A;  4MFD A;  3CLO A;  5FB2 A;  5E3L A;  2E5N A;  2EWN A;  3GTK J;  4YEL A;  4XL9 A;  3S32 A;  2KHM A;  2X1E A;  4HNT A;  2PJP A;  2G0E A;  1PYV A;  2Y75 A;  4ZH4 F;  1U8B A;  3RSN A;  3N05 A;  1U9O A;  4Y7N J;  1DU6 A;  2CU7 A;  4A6D A;  1YX5 A;  3G1O A;  2VJI A;  2A68 F;  3RKY A;  4PUS A;  3SFI A;  3I9V 2;  1ZRC A;  4RM3 A;  3T0Y A;  4G94 A;  1IZ1 A;  1HKT A;  2NVT J;  4JP0 A;  1BI0 A;  2MLK A;  2Y9Y A;  3HB9 A;  5C44 J;  1MJ9 A;  3OY9 A;  3QPT A;  1K7A A;  3QP5 A;  3O2P E;  1PP8 F;  2E2J J;  3OYH A;  1JGG A;  3HXL A;  4J19 A;  3CJQ B;  3K7A J;  4IO9 F;  3LNQ A;  4A3E J;  4D7M A;  2K4J A;  2L7M P;  3D5R C;  2FF4 A;  2HZD A;  5HS9 A;  2M8G X;  4Y33 A;  5EYR A;  3LAP A;  1G2H A;  1SFK A;  2EA2 A;  4DGW B;  4LB5 A;  2DPD A;  3LSI A;  1FSH A;  1GXQ A;  1VQ7 I;  3GFL A;  2NVY J;  3I5U A;  1FMW A;  3QPS A;  4HV6 A;  1MZB A;  1Y8Q B;  1DGW Y;  1VQN I;  4E7Z A;  2RNG A;  3H92 A;  1SD4 A;  1IDZ A;  3OYJ A;  2CW8 A;  1DPU A;  3QOP A;  4BBR J;  3JSO A;  4J01 A;  2EFN A;  3LSM A;  4FE4 A;  4XLN F;  3R4K A;  3CUQ C;  3FMS A;  4RM2 A;  3MKZ A;  3JRE A;  2K9M A;  3AL0 C;  2IS4 A;  3BT9 A;  2DPU A;  1JXS A;  5B1B H;  4BJ5 C;  2ZBK A;  1D3Y A;  5CLS A;  5F0H A;  4OU0 A;  5LRR A;  4FT8 A;  3FM3 A;  4I98 B;  2HKX A;  1RNL A;  1LNW A;  2V26 A;  4QLC U;  1J75 A;  2DA1 A;  1OR7 C;  4AU7 A;  3ABK H;  1P4W A;  1XCB A;  2P6S A;  3B73 A;  4EAT A;  3DKW A;  4CH7 A;  1FT9 A;  4XBF A;  3V8K A;  4A2U A;  2CO5 A;  3HOW J;  4I76 A;  3S2H J;  1KU9 A;  2OUM A;  3WTV C;  5EJC A;  3VYU B;  2ELK A;  4XKW A;  3HZJ A;  4MTD A;  2QEX I;  2HFH A;  2V1N A;  4PK4 A;  1KA8 A;  4L18 B;  5GTH C;  2L54 A;  2Y48 A;  3O8H A;  1T39 A;  3CCR I;  3FXR A;  2P4W A;  2LRE A;  1B8I B;  1CQT A;  1V3F A;  1ZGW A;  2W1O A;  3SDB A;  4HNU A;  4HOB A;  3F23 A;  3QOE A;  3OMY A;  2CUZ A;  1MBG A;  2R7F A;  4A3F J;  1P92 A;  5DUI A;  2E1O A;  2DYR H;  3VDX A;  4CZZ A;  4YG2 F;  5ILU A;  3M8E A;  1XDS A;  4B48 A;  3WHC A;  3I4N J;  4ZJZ A;  3EUA A;  5DM6 F;  4R1H A;  3Q3S A;  5F64 A;  1Z6R A;  2DT7 B;  4E7H A;  2DK8 A;  4EMS A;  5ICC A;  4Q48 A;  1S7E A;  5IYB J;  2XAJ A;  3AKZ A;  4AIK A;  3MZH A;  4U88 A;  2E1M B;  2L01 A;  2W57 A;  3PSI A;  2LKX A;  5DD8 A;  2VBY A;  4LMY A;  2XRO A;  1WWX A;  1SVL A;  3OL4 A;  1FYM A;  2PLY A;  1FWZ A;  2LDU A;  3TP0 A;  3JW4 A;  2RGV A;  4CCN A;  3O6B B;  3ZMV A;  2F5V A;  2XUB A;  5J8C A;  4OAZ A;  2LKS A;  3PNV A;  4IRH A;  4UY8 I;  1FTZ A;  2KKO A;  4I09 A;  1OCO H;  4I7H A;  3H9J A;  4XNF A;  4Y3O A;  5DCM B;  3GZ6 A;  2M34 A;  2Q0O A;  2VL8 A;  3GFJ A;  1YW8 A;  2KP6 A;  1UZC A;  4XRM A;  5BPI A;  4BH9 A;  1JTX A;  4XRS G;  3FHZ A;  3VB2 A;  3W2W A;  1OCP A;  3VOD A;  2JA7 J;  1JHH A;  3AG4 H;  3KYD B;  4LLN A;  2ESH A;  3GLX A;  4YFX F;  3RZD J;  3CCQ I;  3ZQG A;  2X51 A;  3J7A O;  1IN4 A;  3GTO J;  3DU5 A;  3HRM A;  1K6Y A;  2AQE A;  1UB9 A;  2DFE A;  3WTT C;  4OIO F;  4B09 A;  4OAY A;  1B8I A;  1XSX A;  2ISZ A;  3ECH A;  2OQG A;  4XSX F;  4CCO A;  1YRN B;  4JOM A;  3D0S A;  1EKE A;  2HR3 A;  1IXC A;  2BZT A;  3FK6 A;  1D1B A;  2JMW A;  4IHV A;  4IEJ A;  3QAH A;  4HSR A;  1W5S A;  2EFW A;  4ZYA A;  3IHU A;  5CJ9 A;  1MBF A;  2G7H A;  3PSF A;  3OIQ A;  1MMA A;  3GEZ A;  3ZQQ A;  2P6T A;  1E3P A;  2BEO A;  2DT5 A;  1MH3 A;  2GA1 A;  4EM1 A;  1JJ8 C;  2XGD A;  2VJ4 A;  2EFO A;  3RKW A;  1N25 A;  2Q2E B;  3CJN A;  3O3K A;  2F4O B;  1DUX C;  3CES A;  1Z7U A;  2E19 A;  2ZO4 A;  1Z3X A;  1A36 A;  3K69 A;  3WU0 A;  5J4V A;  1OCZ H;  4CA0 A;  3G6E I;  4UB6 C;  1YJW I;  5B3S H;  4X1E A;  2P7C B;  2ISY A;  2KJB A;  3K2A A;  2F5E A;  5CVU A;  1TTY A;  2DJN A;  3ZRG A;  5LGU A;  2HU9 A;  1E2X A;  1M1E B;  2QGU A;  2JA2 A;  1WJ5 A;  1MBH A;  1EF4 A;  4ETS A;  2PI0 A;  2BY3 A;  2E60 A;  5CVR A;  1Y39 A;  5DCM A;  3ABM H;  4WXC A;  4C2T A;  3H0D A;  1B6A A;  3Q9S A;  4QSH A;  1OCR H;  3VOE A;  1H88 C;  4XMY A;  3GX4 X;  1D0Y A;  2MLG A;  3DWL E;  1BOA A;  1ZG5 A;  2LY2 A;  2XPV A;  1STZ A;  3GTL J;  2PEX A;  2O8K A;  3M3Y J;  5FLX K;  1N77 A;  3JTH A;  4DBR A;  3S16 J;  4X0G A;  3SJM A;  2JN6 A;  2H8R A;  2ECC A;  4S04 A;  1EH7 A;  1L0O C;  2PG4 A;  3FXJ A;  3W6K B;  2JJ7 A;  5D4S A;  3ELK A;  2R93 J;  5KK1 A;  3RZO J;  3WTW C;  1FOX A;  3SZT A;  4M6X A;  4XKB A;  1YRN A;  1WJF A;  5FKK A;  5LHI A;  1GVJ A;  2R7R A;  2EFQ A;  2CMP A;  3R0A A;  6PAX A;  5D5U B;  1YQA A;  2FQ3 A;  1YIO A;  3A02 A;  4M3D A;  1B72 B;  1XGN A;  2K85 A;  4UUT A;  4NQW B;  3L9F A;  1FIA A;  1YIJ I;  4I0A A;  2A6T A;  3ZOB A;  1ZEL A;  2W00 A;  4IL6 C;  4RLF A;  3GTJ J;  1R00 A;  4U0V A;  5JHU A;  2DA6 A;  5K5O A;  2L9N A;  3CCE I;  1SMY F;  2IVM A;  4KIC A;  3KFW X;  3ZMT A;  5LGN A;  1SEU A;  2M3A A;  1VQ6 I;  2E5Z A;  1WVR A;  2XAH A;  2Q2E A;  3OYD A;  4HZF A;  2ZME C;  3W6V A;  4XLF A;  2RVC A;  2HTS A;  4AC0 A;  3IRQ A;  1X1P A;  1W4M A;  2DCE A;  2ZCW A;  2UUZ A;  1X3Z B;  2QVO A;  4A12 A;  4M3B A;  2VQC A;  1E3O C;  2WAF A;  5EF6 A;  3KIO A;  3EUH A;  4AD9 A;  3S1M J;  4F91 B;  2HXO A;  1K79 A;  4GXO A;  1H0M A;  5D4R A;  5JFR A;  2V1X A;  4BDY A;  2R7Z J;  3JRA A;  2IS6 A;  1W5T A;  4IHS A;  3R6S A;  2VE8 A;  2E35 A;  4LLL A;  2FBK A;  3J80 Z;  2K4B A;  3OR2 C;  4AVP A;  5E1X A;  2RDP A;  5LEK A;  3G1L A;  4AID A;  3GUD A;  1SFO J;  1BJZ A;  2LVS A;  2KRH A;  3K70 D;  2GBY A;  1IN5 A;  1QZY A;  3H5A A;  2VBW A;  2Y31 A;  2DDA A;  4XN0 A;  1FP1 D;  3R61 A;  1O7L A;  5J4Y A;  1Z9C A;  3KP3 A;  3KLO A;  4Y13 A;  4KMF A;  3I54 A;  3PNT A;  2JVH A;  5DTD A;  5DCF A;  5K1Y A;  3S2D J;  3LWF A;  4EM2 A;  4UNO A;  2JPC A;  5EEA A;  4U7B A;  2R92 J;  2AXT C;  5CVV A;  1LQ1 A;  2GOX B;  1B72 A;  1U8R A;  2WWY A;  4NQW A;  3S17 J;  4RAY A;  2RQP A;  4HA8 A;  3CF2 A;  1W36 D;  2R7O A;  4HNV A;  2VJ5 A;  1MD0 A;  2KT0 A;  2MA3 A;  1P2F A;  1Y1W J;  1N78 A;  2WV1 A;  3L2W A;  1ETY A;  2L9R A;  4BNC A;  3COA C;  3ZMS A;  1XB4 A;  5FO5 A;  2GLO A;  4RB1 A;  4IJA A;  3K1M A;  2ID6 A;  1LUJ B;  1ZK8 A;  1RES A;  2FNA A;  4RAZ A;  4WX9 A;  5M5X J;  2RAE A;  3TW7 A;  2Z2S B;  3FX3 A;  3P9K A;  2YX7 A;  2XC7 A;  2E1M C;  3NWT A;  4KJZ A;  4G9Y A;  1TWG J;  5F1J A;  1WPK A;  5HS8 A;  3JRC A;  4HLY A;  3MKW B;  3LQR A;  4D5C A;  4OMZ A;  4PJL A;  3IAM 2;  5FFZ A;  3BCB A;  2BHY A;  1UJ8 A;  4D9J A;  5IT9 K;  1XS9 A;  1I27 A;  3VYR B;  2YUS A;  5D6F A;  4EM0 B;  4LGW A;  2EV6 A;  3WGH A;  4RGR A;  5L3E A;  2IRF G;  4R79 A;  3BY6 A;  1JKQ C;  1QRY A;  2HDW A;  3CUQ B;  1LFP A;  5EGO B;  3X2Q H;  3TO6 A;  3AL0 B;  3H0G J;  4LIV A;  4UV8 A;  2LBF B;  3CCM I;  2W85 A;  3RPQ A;  3SFZ A;  2G7U A;  2ZJ2 A;  2GIV A;  4BKX A;  1KU7 A;  1IUY A;  2QYO A;  1VQ4 I;  5IP9 J;  2MG4 A;  1TWH J;  2DQR A;  4HPQ A;  1PJR A;  2Y0M A;  2VT3 A;  2DK5 A;  1HXD A;  3QU3 A;  3VSK A;  2IBD A;  3KP5 A;  3RKQ A;  2QSG X;  1WRJ A;  1WJD A;  1HQC A;  4MQ9 F;  1LE8 A;  3CC4 I;  1FTT A;  2Y0S A;  4ZDL A;  1B59 A;  3AG3 H;  2PJR A;  1Z1D A;  3DBL B;  1VQK I;  1UFM A;  3BC8 A;  2Y30 A;  5AIP A;  1FP2 A;  2GWR A;  4P5O A;  4Z2Y A;  2KLO A;  4ENK A;  1MKM A;  3S3N A;  4CCK A;  4PZJ A;  2WA0 A;  3EDP A;  2LH9 A;  3BR0 A;  4ENN A;  4GO1 A;  2CWE A;  2KQR A;  4U87 A;  1ORK A;  1W0T A;  4V2F A;  3WG9 A;  1TP4 A;  4HRI A;  1FBU A;  1IO2 A;  2EQR A;  3HG9 A;  2KIS A;  4LG3 A;  5ILV A;  5HNF A;  1D1A A;  1Z21 A;  1VQ9 I;  1MIJ A;  1JJ6 C;  5FKM A;  3KYC B;  4B4C A;  5GPA A;  4ZDP A;  1Z91 A;  3OWT A;  4XQF A;  4DOZ A;  2R7S A;  4WK8 F;  2FE3 A;  3NAU A;  2BOL A;  1TZL A;  5D5V B;  3WTY C;  1E17 A;  1AKH B;  5J8F A;  1ENH A;  2ETH A;  1V5G A;  3J81 K;  3CUQ A;  2HI3 A;  3MWM A;  4DBQ A;  5EGO A;  1XN7 A;  2LBF A;  2Q8K A;  3GYH X;  4JK1 X;  3S8P A;  2ADU A;  3I59 B;  3O8G A;  2CSO A;  3ML6 A;  3GTP J;  4S05 A;  2IAI A;  4JQF A;  4JX4 A;  2JUC A;  3MKY B;  1W5C C;  4F3Q A;  2FXA A;  1KZH A;  1HKS A;  2IGM A;  4Q5S F;  1OR7 A;  3HIF A;  4UUS B;  4ZDO A;  4FQG A;  1HW1 A;  5JLW A;  1ZRF A;  1WI3 A;  3TKY A;  3DF8 A;  3WTZ A;  3H5N A;  1MGT A;  1P4A A;  4PGG A;  4NC7 A;  2XB5 A;  5JHF A;  2CUJ A;  5KCM A;  5D5W B;  1GV5 A;  2X6Y A;  2PN6 A;  4EEF G;  2IGO A;  3ZMU A;  2HQR A;  3WGG A;  3HTS B;  2K7L A;  3IV5 A;  1BJA A;  1Y1V J;  4BE0 A;  3MFK A;  3TOB A;  1QZE A;  3BR5 A;  3JRG A;  1YS7 A;  2E2I J;  5ICE A;  5M3M J;  3Q5F A;  2PBI A;  3A0B C;  5C3E J;  2QF7 A;  4XOP A;  2EBI A;  2A5W A;  3KP6 A;  5BQT A;  2CGP A;  1XMK A;  3M07 A;  4G8X A;  2BBY A;  4DIQ A;  1MBK A;  3MMY B;  2IP2 A;  2OTJ I;  1PUF B;  1SFU A;  1OPC A;  2COB A;  2OAZ A;  4CCM A;  3BQY A;  4A3L J;  5HLT A;  4ITV A;  4II3 A;  1UST A;  1Z0X A;  2QM3 A;  1PDN C;  2EB7 A;  1WJE A;  2LKP A;  3FIW A;  5HOO A;  5EZG A;  2YU9 J;  1NH3 A;  3S15 J;  3BZK A;  3JRB A;  2MGQ A;  1K78 A;  1X58 A;  3FDY A;  3LA7 A;  1D8K A;  3RKX A;  3JRI A;  1X1D A;  2HPM A;  3ZN1 A;  1AKH A;  2QBY B;  1ON2 A;  2BY1 A;  2A5Y B;  4ESJ A;  2EH3 A;  2XAS A;  1J9I A;  2WY8 Q;  2JA6 J;  4QPO A;  4D5F A;  2BVM A;  3HSF A;  2CFX A;  3FKI J;  5J6X A;  3LA3 A;  1IGN A;  3OS1 A;  3CTA A;  1R71 A;  4IHT A;  1I1G A;  2DTR A;  2L0K A;  1GDT A;  2GXB A;  2JA8 J;  2GXG A;  1DPR A;  2L9S A;  2XRN A;  2QQ8 A;  1MSE C;  4UUS A;  2RNJ A;  3QWL A;  3K9T A;  4ON0 A;  1RUO A;  2X48 A;  4CYC B;  2HGC A;  1D5Y A;  1XGM A;  2L3D A;  2XSJ C;  4C3I J;  1A6Q A;  1VTN C;  3BR3 A;  1HOM A;  3ZQ7 A;  1MNM C;  3DPT A;  2VOP A;  2CYY A;  1I1S A;  3GLL A;  2W4S A;  2ZKZ A;  2BXZ A;  2XRL A;  4ASN A;  4TV7 A;  1XD7 A;  4HG2 A;  4AIH A;  3OYE A;  1IN8 A;  2HQ5 A;  1IW7 F;  3HOY J;  3SHF A;  1F5T A;  1QA6 A;  1U3E M;  2IXS A;  2K27 A;  3UKG A;  3RYP A;  3K4C A;  3N4M A;  3RJP A;  4C2U A;  3A1Y A;  5EG0 B;  4EJW A;  2CW7 A;  4ENM A;  4FX0 A;  4YII A;  5IPA A;  2VQH A;  5EEH A;  1KYW A;  4BQQ A;  2LRD A;  4XN3 A;  2OU2 A;  3FXQ A;  4LG0 A;  4CIC A;  2JSC A;  4RAF A;  2W84 A;  2L7Z A;  2F48 A;  1PUF A;  1VQP I;  2DLL A;  2HWV A;  2M87 A;  1IXR C;  2WB1 N;  1K83 J;  2KMU A;  2B7E A;  2OJE D;  2ZME B;  3ZQI A;  1I3Q J;  3HDD A;  4BGD A;  4HF1 A;  4BHC A;  1OFC X;  2DMU A;  1X2N A;  3KET A;  4HF2 A;  1OYW A;  1GLN A;  2MC3 A;  3FM5 A;  2R7T A;  1B9M A;  3J7Z I;  4GCV A;  4ESB A;  5E8I A;  3I64 A;  2QSH X;  3BTI A;  2HKO A;  3ZPL A;  4XON A;  3VSL A;  3ULQ B;  4F55 A;  1TWF J;  2JWT A;  3HSE A;  4A93 J;  2YR2 A;  2P81 A;  2QWW A;  2O03 A;  2PMH A;  4RDU A;  1EH8 A;  4L0Y B;  3C3W A;  3FXM A;  3ZMD A;  3A4C A;  3H3U A;  3KP2 A;  1R23 A;  2ICW G;  4L9T A;  1ON1 A;  3PQK A;  4CYC A;  3TDU C;  3VEP A;  1ZG1 A;  1QHG A;  4PFP A;  2COM A;  4PCQ A;  1TQP A;  1ODD A;  2N8G A;  3HOV J;  2LFB A;  2E7W A;  4E7J A;  1VQ8 I;  2WV0 A;  3ZMZ A;  4F7Z A;  1OCT C;  4W1U A;  3A01 B;  2CUF A;  5FLX Z;  4PJJ A;  5DD4 A;  4I2O A;  1J2X A;  4LK1 F;  4BJT A;  4IHW A;  4U0Y A;  1ZKG A;  2FSW A;  2VKV A;  4U7D A;  2HVS A;  2VKH A;  5HNH A;  1BL0 A;  4CHU A;  4WXD A;  4WF2 A;  3CMY A;  2CQN A;  4M3G A;  3FF5 A;  2DFI A;  2ID3 A;  2PMZ A;  2M2E A;  5GAD J;  1LDD A;  4PJN A;  1H8A C;  2MD5 A;  1B1B A;  4LIT A;  4B3A A;  4MTE A;  3HOX J;  2QCO A;  4EJU A;  3LL7 A;  2QEN A;  4ZZL A;  5ILS A;  3MEX A;  1REP C;  3A03 A;  5EEG A;  1R4M B;  3CP2 A;  4FHT A;  1IV8 A;  2LK2 A;  2YX4 A;  2ZME A;  3FMQ A;  1V5F A;  3EET A;  2M1B A;  2W82 A;  2DDB A;  3CLQ A;  1KQ9 A;  2ZC2 A;  1U5T C;  4L9J A;  2F2E A;  5D5X B;  2MW8 A;  5K7Z A;  2Z16 A;  1LFB A;  5KHD A;  3SEZ A;  4D0P A;  2P7V B;  3KZZ A;  4C9Y A;  4ZZD A;  3HOU J;  2AO9 A;  2DW4 A;  2XPU A;  1ONV A;  1F1Z A;  4ZYG A;  2O6G E;  3GF2 A;  5FKN A;  2R0Q C;  2DQL A;  3BTL A;  1UEL B;  2XDV A;  3FMR A;  3QYB A;  2KDO A;  2HZT A;  1JKP C;  4CCJ A;  3I4M J;  3KZY A;  3HKZ A;  3K4J A;  3IH3 A;  3CUO A;  2ZXJ A;  1SC7 A;  1YYV A;  3IAS 2;  4B47 A;  2OQR A;  1OYI A;  3HBL A;  2XGC A;  3ERM A;  4BDZ A;  2JT1 A;  2DAO A;  3ZQH A;  3LFK A;  3SEQ A;  3JRF A;  4L5I A;  1ETW A;  4XID A;  3PL8 A;  1A04 A;  1WJA A;  1QPM A;  3E0J B;  3IKV A;  3QOD A;  2GOM A;  1Z67 A;  4I0B A;  4FET A;  3HHG A;  2E36 A;  1SAN A;  2ZFW A;  2GQQ A;  3WE2 A;  2EA4 A;  3S93 A;  3BJA A;  2CQK A;  2IA2 A;  4QTR A;  1I6X A;  3OS0 A;  2FX0 A;  3V7R A;  3DKY A;  2VXZ A;  4Y4R A;  5LRS A;  3A01 A;  3ZQL A;  2VKE A;  3EQL F;  2F5D A;  3GCM A;  3GFM A;  4PDK A;  1RR7 A;  1BC8 C;  3KEQ A;  3QRF F;  4V19 K;  2IPQ X;  3MN2 A;  1RET A;  2L7F P;  1O3R A;  3QPL A;  4B43 A;  3U9G A;  3F6O A;  1B9N A;  5JVT A;  4GYI A;  4AYB N;  1TNT A;  4BY1 J;  2XAG A;  1E3H A;  3KP7 A;  4LD5 A;  1BW5 A;  2OF7 A;  2JRM A;  1O4X A;  3WE3 A;  5H6R A;  1JUS A;  2KIM A;  1WJC A;  3LOC A;  3ZGK A;  2R7X A;  5HDN A;  1X4P A;  5GAE J;  1ETK A;  4GFB A;  4KT6 A;  2M4K A;  2QZ8 A;  2W24 A;  1WQ2 A;  1Y56 A;  2VN2 A;  1FIP A;  5FD6 A;  1J09 A;  2JTV A;  2HOS A;  4DQ2 A;  3A2K A;  3RI4 A;  3BZC A;  2CQX A;  4HBL A;  3WU2 C;  1T38 A;  1IUF A;  1HDD C;  4XRS A;  4XKV A;  1V4R A;  2EV0 A;  2ZJQ F;  2MSY A;  3IWF A;  2XV4 S;  3S1N J;  3HYI A;  4GYG A;  2QQB A;  3OSF A;  1FJL A;  3KP4 A;  2M0M A;  2KIQ A;  5DYM A;  1HSJ A;  3HM5 A;  1F4K A;  3VFZ A;  4IVN A;  2VUM J;  2IJL A;  2F6C A;  2K9S A;  2OPT A;  2VQL A;  2XF7 A;  3AG2 H;  3L2C A;  3KZI C;  4HEA 2;  1OYY A;  2KFD A;  1RZ4 A;  2D1V A;  2DFF A;  4UVA A;  3HOS A;  2DOD A;  5IY5 H;  3B6A A;  3ZQF A;  2VPL A;  3BTJ A;  5IP6 A;  4U0W A;  3Q0W A;  1FLI A;  1IN6 A;  1JE8 A;  4HDV A;  3TL4 X;  2KRC A;  4CO8 A;  2JQ7 A;  2D1H A;  1ZAO A;  5E20 A;  3H3Z A;  3OIO A;  2X85 A;  2YU3 A;  2A6H F;  3TED A;  3HSR A;  3OYA A;  1I5Z A;  3I56 I;  3GBG A;  3IRR A;  1Y0U A;  1P4X A;  3CDL A;  4HX7 A;  5HS7 A;  2A61 A;  3C2H A;  2HEO A;  4NNJ A;  1JUP A;  3CCS I;  3G4S I;  1UHW A;  4C3H J;  2X1C A;  3TP3 A;  1FEX A;  1IRF A;  3WGI A;  3I55 I;  2IGN A;  2DXI A;  1RI7 A;  4W97 A;  1ZRD A;  3HGG A;  2A69 F;  5GAG J;  3EUK L;  1MSF C;  4WXH A;  2ZB9 A;  2A05 A;  2EFP A;  3CP8 A;  3JAM K;  5M5W J;  2V7F A;  2OCC H;  2HOT A;  1ZYR F;  4AUX A;  3OV8 A;  1QNT A;  4K2E A;  4MFE A;  3FBN B;  3NEU A;  2BXY A;  4N0B A;  1OCC H;  5A2Q Z;  3GWZ A;  3LSH A;  4PJ0 C;  4CXF A;  2V9V A;  4F93 B;  3JTG A;  1V55 H;  1WH7 A;  1U6G A;  3BG7 A;  1H89 C;  2Y9Z A;  2XSD C;  3SXY A;  1FSE A;  4N4N B;  2UZK A;  1HDP A;  5TRD A;  3G3Z A;  3F22 A;  3FHN A;  3H5R A;  3PUF A;  2DA4 A;  2XPW A;  4M9X A;  4A5N A;  3L7W A;  3M4O J;  1JI8 A;  1ETX A;  1MMG A;  4GDF A;  2J5P A;  1G3S A;  4CSW A;  4Q47 A;  3OYB A;  3ECO A;  2XAF A;  3CCJ I;  1GV2 A;  5J1Y A;  4AVZ A;  3CME I;  4P9U A;  4FAS D;  2K5C A;  3CF5 F;  1MJA A;  1IC8 A;  1JGS A;  1RUN A;  3V7C A;  3JCU C;  3J81 Z;  1J7K A;  4ABZ A;  3TO7 A;  2CRG A;  4G6Q A;  1ZGA A;  1U9N A;  4ZTJ A;  1UAA A;  4E7I A;  3PIP F;  3LSP A;  2UXN A;  1BIA A;  3OIP A;  3CCU I;  3V8J A;  3I3L A;  3CCL I;  1ZR4 A;  2XVC A;  3HTU A;  3T1B A;  5KNL A;  4ZC3 A;  1ZH5 A;  1W1W E;  1LB2 A;  3IKT A;  2VLA A;  1D1C A;  3AFH A;  2KZV A;  2ZNY A;  3Q9V A;  4H4K C;  2DA7 A;  4I99 C;  2Z99 A;  2FQ4 A;  3HRU A;  5KAF C;  3F0C A;  1FX7 A;  1LEB A;  1OIS A;  4RB3 C;  2OZU A;  5CQG A;  5EDN A;  1FOW A;  1YI2 I;  4N4O B;  2R5Y B;  4P96 A;  1BR4 A;  3Q0V A;  3QPH A;  5CVJ A;  3GVA A;  2ZXI A;  2IS2 A;  1X1A A;  4JYK A;  2FOW A;  2NOG A;  2OZ6 A;  5DEQ A;  4DJA A;  3CO7 C;  3K4B A;  4UV9 A;  5E18 F;  2V1D A;  2VPR A;  3CO6 C;  2O61 A;  1W7P B;  4NC6 A;  4M71 A;  4RLQ A;  4D7N A;  3U2R A;  1LPQ A;  2AXL A;  4IHX A;  4YEJ A;  1ZAR A;  3BWG A;  2ZSI B;  2NS0 A;  4KNY A;  5FJ8 J;  2ZSH B;  4BS9 A;  2DMQ A;  1JT6 A;  4WWC A;  2DTZ A;  2K40 A;  1EJ9 A;  1ZLK A;  1BW6 A;  2V6C A;  3L09 A;  4BXF A;  2MC4 A;  3RIR A;  3F21 A;  5H20 A;  3VYS B;  3R0J A;  2DOA A;  2HYF A;  4A69 C;  2L02 A;  3GFI A;  1LDJ A;  3K10 A;  1YJ9 I;  2DN0 A;  5F04 A;  3HL2 A;  3WU1 B;  1ZLJ A;  2DBB A;  1RR8 C;  3ZN0 A;  3HPH A;  5BS6 A;  4MNU A;  4S0H B;  2LC2 A;  3SZG A;  5BPD A;  5D6E A;  4LK0 F;  5JVG F;  4JBA A;  1R5I D;  2KIU A;  4XRF A;  4A3I J;  4XM3 A;  2M4G A;  5K5Q A;  1APL C;  4O5V A;  3BLY A;  4P9F A;  3BOQ A;  2Z5U A;  1MW7 A;  4AIJ A;  3F6V A;  4KIB A;  1G4D A;  2R7D A;  1FY7 A;  2PMU A;  3BPX A;  1C0W A;  1Q1V A;  1CF7 B;  3FXO A;  2WAQ N;  5LHG A;  3CC7 I;  5F08 A;  2YS9 A;  2OD5 A;  2XGX A;  2V4J C;  1YO5 C;  2RRE A;  5BOX A;  2NVX J;  1T56 A;  1QBJ A;  4P1W A;  3TDZ C;  1G8X A;  2EZL A;  3ASO H;  5AON A;  4G6T B;  3JSP A;  3D1N I;  2R5Y A;  2O0Y A;  3L2U A;  2YPR A;  5FLM J;  1TT0 A;  4PSW A;  3N97 A;  5J1R A;  1ZG3 A;  1JUM A;  2X6O A;  3DCF A;  1WCM J;  2ZFU A;  5DS9 A;  4XLE A;  2JA5 J;  1W7P A;  1QVT A;  4M6V A;  4UVB A;  1X3U A;  3PM1 A;  2FBH A;  1Z3Y A;  3BR1 A;  2HDC A;  1SAU A;  1U5T B;  2M5W A;  2E2H J;  2NXN B;  2ZNZ A;  2LG4 A;  3W3C A;  2UXX A;  4NHJ A;  2IA1 A;  1SAX A;  3GTG J;  5EZH A;  1FOK A;  2KL4 A;  3WTX C;  1LFU P;  1R22 A;  3RDI A;  2MBF A;  4IQ4 A;  1AWC A;  1WH5 A;  3VPR A;  3OYL A;  2NVQ J;  3E6C C;  1XSV A;  5DV5 A;  3HEF A;  1MMN A;  1D5V A;  1TNS A;  4IRI A;  1F36 A;  1JKO C;  3LSR A;  5FKO A;  2KJC A;  4HX8 A;  2D5V A;  1AA7 A;  1T8I A;  2J5O A;  1S7A A;  2MYS A;  1D0X A;  2OA4 A;  2UWM A;  4IOC F;  1FC3 A;  3KPH A;  3RCO A;  2HYG D;  3P5J A;  4L9V A;  5GAH J;  4KDP A;  1ETO A;  4BAY A;  4GGG A;  3TO9 A;  3J80 K;  4RS8 A;  3S14 J;  3V42 A;  4L5E A;  2VB6 A;  4CDG A;  1P7J A;  2FJ1 A;  4DYQ A;  4Y52 J;  1SVM A;  3TW6 A;  1OQY A;  3CMM A;  2VKD A;  3DFG A;  5E3N A;  2FML A;  2LF8 A;  2ZXH A;  5F0F A;  1HF0 A;  2NRA C;  1CF7 A;  3CDI A;  1RC9 A;  4LB6 B;  4IRG A;  2FNP A;  3QYE A;  2HVR A;  5LEJ A;  2MFZ A;  3P9I A;  2TCT A;  5JI6 A;  1ZQ3 P;  2CJJ A;  3M8J A;  2UV1 A;  1HKQ A;  2DT6 A;  2FMY A;  5L3F A;  4G7Z F;  4YFN F;  2VON A;  1R6R A;  3ESW B;  2CG4 A;  4NDL A;  3W2A A;  3OS2 A;  2R4G A;  2K02 A;  3FIS A;  5IYC J;  2NYX A;  4KN4 X;  3PJR A;  3LSJ A;  3L2V A;  3PFY A;  2CV2 A;  2X0L A;  2ESN A;  2BE5 F;  4FE7 A;  1USS A;  5C4X J;  3I58 A;  1UCR A;  3LST A;  3TOA A;  4HQM A;  5JLX A;  4KIF A;  1T33 A;  3J7Y J;  3FZV A;  1G59 A;  3S1Q J;  3UNG C;  3GXO A;  1RKT A;  2EV5 A;  4XR6 A;  4E70 A;  4A0Y A;  3DU6 A;  1WHU A;  1U5T A;  4E7L A;  1VQ5 I;  3ABU A;  2JZY A;  1G3T A;  1X1C A;  2CV1 A;  2XAQ A;  4M72 A;  3LMM A;  3DP7 A;  4C30 A;  1I39 A;  5J47 A;  2P5K A;  3D5S C;  1EA3 A;  2BV6 A;  3BPV A;  3DXJ F;  4MIM A;  2D2W A;  1T6S A;  4M6Y A;  4G6D A;  4XKC A;  2O5R A;  2A07 F;  3GTQ J;  2H94 A;  2QKL B;  2E71 A;  2XF6 A;  3I59 A;  4E4H A;  2M0C A;  9ANT A;  4E7K A;  3OYI A;  4KT5 C;  4LIU A;  2STW A;  4G7O F;  1QO0 D;  3OOP A;  5CQE A;  2DO7 A;  3ZXS A;  1H9T A;  1R5H A;  1O3Q A;  2VOD A;  5JR3 A;  4P55 A;  1MBJ A;  2HTJ A;  4M73 A;  2GAU A;  1IRX A;  1BN5 A;  5M3F J;  3ISP A;  4M74 A;  3MZY A;  1VZ0 A;  2MD0 A;  4DYC A;  4Z6Y A;  3K4M A;  1ZTR A;  2DMP A;  3KEO A;  4LFU A;  2V9K A;  4NUB A;  1IN7 A;  2ELH A;  5GPC A;  1ZR2 A;  3WG7 H;  3TMO A;  3LFU A;  1QZZ A;  3CD6 I;  2VT2 A;  4A5M A;  5BNG A;  2L9V A;  1XX5 A;  3BDD A;  3VWB A;  3HOZ J;  3I71 A;  1AHD P;  1A5J A;  2VI6 A;  2IT0 A;  1MH4 A;  3MCZ A;  4EVI A;  3IWZ A;  2ZXW H;  4C3J J;  2CQQ A;  2EPF A;  4MGR A;  5DUK A;  1XGO A;  3MKL A;  3M7G A;  4H0E A;  4HX4 A;  1F9N A;  1CGP A;  2XIG A;  2JVG A;  2Y0S N;  3AAF A;  4UB8 C;  1A6I A;  3K4L A;  1R1U A;  2IA0 A;  3IH4 A; 
#chains in the Genus database with same CATH homology
 1IF1 A;  3P7N A;  5ICF A;  2VOO A;  2QBY A;  3SQN A;  3TGN A;  4OIQ F;  2X4H A;  1GHC A;  1QGP A;  1K6O A;  3K2Z A;  4EJV A;  1XGS A;  2FOK A;  5E1Z B;  2H27 A;  3KCC A;  3HOT A;  2RV8 A;  4UVC A;  1Z6T A;  2IW5 A;  2L4M A;  3P9C A;  3KE2 A;  2RKH A;  5F1R A;  5LBQ A;  4BHP A;  3LA2 A;  3E6M A;  3E5X A;  2QLZ A;  2Z3Y A;  3ERE D;  1AOY A;  1LEA A;  4XLP F;  2C6Y A;  4O6J A;  1WI9 A;  1R1T A;  4HW0 A;  3WTS C;  1BI1 A;  2VC0 A;  5HDG A;  3DPL C;  5HDK A;  2RN7 A;  3GO5 A;  1YS6 A;  3IC7 A;  2W25 A;  2HQN A;  4KN7 X;  4A0Z A;  2HOE A;  3JAM Z;  2VBX A;  1J59 A;  1HST A;  3C7J A;  4DNC A;  2M30 A;  2F5F A;  4MEY F;  1FBQ A;  1XMA A;  4M9S A;  4MEX F;  5K5R A;  5F6F A;  1TBX A;  2RC4 A;  2H09 A;  4I01 A;  3F8B A;  1BC7 C;  2P5L C;  4L0Z B;  4HV5 A;  3ABT A;  3SZP A;  4BQA A;  3PFI A;  2Z9O A;  2NNN A;  3NQO A;  4Q4Z F;  3HRT A;  2XHK A;  1HBX G;  4HAM A;  3IL2 A;  4N9H A;  4R8H A;  5HLI A;  2A6E F;  1ULY A;  4HQE A;  4RB2 C;  4ENJ A;  2NNY A;  1O3S A;  3WOD F;  3HRS A;  3BRO A;  2VC1 A;  4BHB A;  1U2W A;  4KA4 A;  3QU6 A;  2E1C A;  2FEZ A;  3E5Q A;  1SFE A;  2QQA A;  2LSO A;  3F8M A;  4AWX B;  3I53 A;  2O3F A;  4LJZ F;  1R5G A;  1NHA A;  1SD7 A;  4BXU A;  2LF7 A;  3KLN A;  1BM9 A;  1S7O A;  1O7F A;  3LQQ A;  5IT9 Z;  4UUV A;  3K1P A;  2PQ8 A;  5KVR A;  1S6L A;  4UHT A;  4EGZ A;  4OIP F;  3T5X A;  4EQQ A;  3DQV C;  3C18 A;  4KYW A;  1R7J A;  4EGY A;  3BJO A;  4IXA A;  4QWQ A;  1IXS B;  2DI3 A;  3T8T A;  3G73 A;  5ICG A;  5TJJ A;  3E3V A;  2HS5 A;  1RIO H;  1S3J A;  5FD5 A;  4IF4 A;  4KIG A;  4YFK F;  1ZN2 A;  3DEU A;  3DV8 A;  3E5U A;  1EV7 A;  4PGH A;  4RGS A;  3E97 A;  1IRG A;  1ZHF A;  3E6B A;  1KU2 A;  2XKP A;  3C1D A;  1FNN A;  3CDH A;  2V1U A;  1J0R A;  1Z05 A;  2D45 A;  3V7S A;  4WCG A;  4RGX A;  3V8L A;  1YFH A;  4HLX A;  2XKO A;  3S2W A;  4RB0 A;  5E8G A;  5HVQ C;  2FRH A;  4ESF A;  3EYI A;  2GA2 A;  4UXN A;  1BIB A;  5H6Q A;  4CYD A;  1ZGJ A;  1D8J A;  2P8T A;  1T98 A;  3ZP5 A;  2G9W A;  2K86 A;  4RGU A;  4EJO A;  1FPQ A;  1Q1H A;  3F3X A;  1TW2 A;  1YG2 A;  3HUG A;  1YW7 A;  4BYY A;  5L3C A;  5ERI A;  4B8X A;  1MDM B;  3REO A;  1JHF A;  2WC2 A;  5FFX A;  3GZ5 A;  4ZYD A;  2H6B A;  5AIQ A;  5E1W A;  5D8L B;  1SD5 A;  3BZ6 A;  1LDK B;  2TDX A;  2CW0 F;  2E7X A;  1PP7 U;  1P6R A;  4IPA A;  5IT3 A;  1XSD A;  2MH2 A;  2BYV E;  3F72 A;  1GXP A;  1SFX A;  1TQM A;  3R60 A;  4KUM A;  5HLG A;  4Y15 A;  1HW2 A;  4L5J A;  1OMI A;  4KMU X;  1FYL A;  4OOI A;  2EK5 A;  4OMY A;  2WTE A;  4A6E A;  2BGC A;  3BJ6 A;  4NB5 A;  2M8E A;  1BBY A;  1KYZ A;  5LGT A;  3FWE A;  1QQI A;  2H6C A;  4OIR F;  1YW9 A;  5D8K B;  3F8N A;  4EV0 A;  1PUE E;  3WTU C;  1G3Y A;  4FX4 A;  3F8F A;  4HYE A;  5CVI A;  1KGS A;  1MDM A;  1H9G A;  2FA5 A;  1DP7 P;  1W7P D;  2FBI A;  3T8R A;  2QUF A;  3RYR A;  1XCV A;  3V4G A;  1T2K A;  1S8N A;  1IAW A;  2L4A A;  2V79 A;  3I4P A;  2ACJ A;  5L3D A;  3NRV A;  5HLH A;  3TQN A;  4L9N A;  4XSZ F;  1FZP B;  2M45 A;  5A2Q K;  1LJ9 A;  1HW5 A;  4HF0 A;  4KFC A;  4LLG F;  1BI3 A;  2VBZ A;  3GW2 A;  3HHH A;  3K0L A;  3K1N A;  3RTR A;  1WKM A;  1R58 A;  1G3W A;  2QQ9 A;  1FBS A;  2KRF A;  1U78 A;  5FGM A;  2EJR A;  2FU4 A;  1TQI A;  5DDG A;  3PQJ A;  1KQ0 A;  4MHG A;  2AS5 F;  1LVA A;  1OKR A;  1K78 B;  4EJT A;  3ROU A;  1S29 A;  2E1N A;  1J5Y A;  2STT A;  1FYK A;  3L00 A;  3B02 A;  5L3G A;  3M9A A;  4HDU A;  2B0L A;  1WSU A;  2O8X A;  1G6N A;  1R36 A;  1O57 A;  5ED4 A;  2YSR A;  5L3B A;  3W6J B;  3F8C A;  4ZYE A;  4MQV A;  1UHM A;  1O3T A;  3E6D A;  4I02 A;  5BMZ A;  1EH6 A;  2VE9 A;  5LLQ A;  1T0F A;  4A0X A;  4G7H F;  3BP8 A;  2Z33 A;  1SMT A;  2JRT A;  2KIF A;  1ZRE A;  3LAJ A;  2NAZ A;  1B4A A;  2OBP A;  4M9Z A;  4CGZ A;  4LG0 B;  3MAJ A;  3QP6 A;  2A3S A;  1L3L A;  4YIF A;  4Y17 A;  4OIN F;  3D5L A;  1R1V A;  2F5C A;  1XDU A;  1TW3 A;  1BI2 A;  1SD6 A;  1YTY A;  1MJB A;  2DU9 A;  2JPB A;  2MH9 A;  2PFB A;  2GZW A;  2LNB A;  4ZYH A;  3I0T A;  3M1E A;  3U1D A;  1KU3 A;  5LHH A;  5CYV A;  3FXU A;  3M8F A;  1TLH B;  2R3S A;  5E17 F;  1KQ8 A;  1YLF A;  3RPU A;  3MQ0 A;  4O3M A;  2P5V A;  3EYY A;  1DDN A;  5FB2 A;  3CLO A;  2EWN A;  2PJP A;  2Y75 A;  4ZH4 F;  4A6D A;  3RKY A;  2A68 F;  1ZRC A;  3T0Y A;  4G94 A;  1IZ1 A;  1HKT A;  1BI0 A;  2MLK A;  1MJ9 A;  1K7A A;  3QPT A;  3QP5 A;  3O2P E;  1PP8 F;  2K4J A;  2FF4 A;  5HS9 A;  3LAP A;  2EA2 A;  4LB5 A;  2DPD A;  1FSH A;  1GXQ A;  3GFL A;  3I5U A;  4HV6 A;  1MZB A;  3H92 A;  1SD4 A;  1DPU A;  3QOP A;  3JSO A;  2EFN A;  4XLN F;  3R4K A;  3CUQ C;  3FMS A;  2DPU A;  1JXS A;  2ZBK A;  1D3Y A;  5CLS A;  4OU0 A;  5LRR A;  4FT8 A;  3FM3 A;  4I98 B;  2HKX A;  1RNL A;  1LNW A;  4QLC U;  1J75 A;  1P4W A;  1XCB A;  2P6S A;  3B73 A;  3DKW A;  1FT9 A;  4XBF A;  3V8K A;  4A2U A;  2CO5 A;  1KU9 A;  3WTV C;  4MTD A;  2HFH A;  1KA8 A;  4L18 B;  2L54 A;  2Y48 A;  1T39 A;  3FXR A;  2P4W A;  1V3F A;  4HOB A;  3F23 A;  2R7F A;  1P92 A;  5DUI A;  4CZZ A;  4YG2 F;  5ILU A;  3M8E A;  1XDS A;  4R1H A;  5F64 A;  1Z6R A;  2DK8 A;  4EMS A;  5ICC A;  4Q48 A;  4AIK A;  2XAJ A;  3MZH A;  4U88 A;  2L01 A;  2W57 A;  5DD8 A;  2VBY A;  4LMY A;  2XRO A;  1WWX A;  1FYM A;  2PLY A;  1FWZ A;  2LDU A;  3JW4 A;  2RGV A;  3O6B B;  3ZMV A;  2XUB A;  5J8C A;  4IRH A;  2KKO A;  4I09 A;  4I7H A;  5DCM B;  3GZ6 A;  2Q0O A;  3GFJ A;  1YW8 A;  5BPI A;  4BH9 A;  3FHZ A;  3VB2 A;  3VOD A;  1JHH A;  4LLN A;  2ESH A;  3GLX A;  4YFX F;  3J7A O;  1IN4 A;  3HRM A;  1UB9 A;  3WTT C;  4OIO F;  4B09 A;  1XSX A;  2ISZ A;  3ECH A;  2OQG A;  4XSX F;  3D0S A;  2HR3 A;  1IXC A;  3QAH A;  1W5S A;  2EFW A;  3IHU A;  5CJ9 A;  2G7H A;  3GEZ A;  2P6T A;  2BEO A;  2DT5 A;  2GA1 A;  4EM1 A;  2EFO A;  3RKW A;  3O3K A;  3CJN A;  1DUX C;  1Z7U A;  2ZO4 A;  3K69 A;  3WU0 A;  2P7C B;  2ISY A;  2KJB A;  2F5E A;  5CVU A;  1TTY A;  5LGU A;  1E2X A;  4ETS A;  2PI0 A;  5CVR A;  5DCM A;  4WXC A;  1B6A A;  3Q9S A;  3VOE A;  3GX4 X;  2MLG A;  1BOA A;  1ZG5 A;  1STZ A;  2PEX A;  5FLX K;  3JTH A;  4S04 A;  1EH7 A;  1L0O C;  2PG4 A;  3W6K B;  5D4S A;  3ELK A;  5KK1 A;  3WTW C;  3SZT A;  4M6X A;  5LHI A;  1GVJ A;  2EFQ A;  3R0A A;  6PAX A;  5D5U B;  1YQA A;  2FQ3 A;  1YIO A;  1XGN A;  3L9F A;  4I0A A;  1R00 A;  4U0V A;  5JHU A;  5K5O A;  1SMY F;  2IVM A;  4KIC A;  3KFW X;  3ZMT A;  5LGN A;  2XAH A;  2Q2E A;  4HZF A;  2RVC A;  2HTS A;  3IRQ A;  1W4M A;  2ZCW A;  2QVO A;  4A12 A;  3EUH A;  4AD9 A;  1K79 A;  4GXO A;  1H0M A;  5D4R A;  5JFR A;  2V1X A;  1W5T A;  4IHS A;  3R6S A;  2VE8 A;  4LLL A;  2FBK A;  3J80 Z;  2K4B A;  4AVP A;  5E1X A;  2RDP A;  5LEK A;  3GUD A;  1IN5 A;  1QZY A;  2VBW A;  1FP1 D;  3R61 A;  1O7L A;  1Z9C A;  3KP3 A;  3KLO A;  4Y13 A;  4KMF A;  3I54 A;  5DCF A;  5K1Y A;  3LWF A;  4EM2 A;  4UNO A;  2JPC A;  4U7B A;  5CVV A;  1LQ1 A;  1U8R A;  2WWY A;  4NQW A;  4RAY A;  2RQP A;  4HA8 A;  1MD0 A;  2MA3 A;  1P2F A;  4BNC A;  3COA C;  3ZMS A;  1XB4 A;  5FO5 A;  4RB1 A;  4IJA A;  3K1M A;  2FNA A;  4WX9 A;  4RAZ A;  3FX3 A;  3P9K A;  2YX7 A;  4G9Y A;  5HS8 A;  4HLY A;  3LQR A;  4OMZ A;  5FFZ A;  5IT9 K;  1I27 A;  5D6F A;  4EM0 B;  4LGW A;  2EV6 A;  3WGH A;  4RGR A;  5L3E A;  2IRF G;  4R79 A;  3BY6 A;  3CUQ B;  3TO6 A;  4UV8 A;  2W85 A;  3RPQ A;  3SFZ A;  2G7U A;  2ZJ2 A;  2GIV A;  1KU7 A;  1IUY A;  2QYO A;  2DQR A;  2Y0M A;  2VT3 A;  2DK5 A;  1HXD A;  3QU3 A;  3KP5 A;  1WRJ A;  1HQC A;  4MQ9 F;  1B59 A;  1Z1D A;  1UFM A;  5AIP A;  1FP2 A;  2GWR A;  4P5O A;  4Z2Y A;  4ENK A;  1MKM A;  4PZJ A;  3EDP A;  4ENN A;  4GO1 A;  2CWE A;  3WG9 A;  1FBU A;  5ILV A;  1Z91 A;  4WK8 F;  2FE3 A;  5D5V B;  3WTY C;  1E17 A;  5J8F A;  2ETH A;  3J81 K;  3CUQ A;  3MWM A;  1XN7 A;  2Q8K A;  3GYH X;  4JK1 X;  2ADU A;  3I59 B;  2CSO A;  3ML6 A;  4S05 A;  4JQF A;  2FXA A;  1HKS A;  4Q5S F;  1OR7 A;  3HIF A;  1HW1 A;  1ZRF A;  3TKY A;  3DF8 A;  3WTZ A;  1MGT A;  1P4A A;  4PGG A;  5D5W B;  2PN6 A;  3ZMU A;  2HQR A;  3WGG A;  3HTS B;  2K7L A;  1BJA A;  3MFK A;  3TOB A;  1YS7 A;  5ICE A;  3Q5F A;  2PBI A;  2CGP A;  3KP6 A;  5BQT A;  1XMK A;  4G8X A;  2BBY A;  2IP2 A;  1SFU A;  1OPC A;  2OAZ A;  1UST A;  2QM3 A;  1PDN C;  2EB7 A;  2LKP A;  5HOO A;  1K78 A;  3LA7 A;  1D8K A;  3RKX A;  3ZN1 A;  2QBY B;  1ON2 A;  2A5Y B;  4ESJ A;  2XAS A;  1J9I A;  3HSF A;  2CFX A;  5J6X A;  3LA3 A;  3CTA A;  4IHT A;  1I1G A;  2DTR A;  2GXB A;  2GXG A;  1DPR A;  2XRN A;  2RNJ A;  3K9T A;  4ON0 A;  1RUO A;  2HGC A;  1XGM A;  2L3D A;  1VTN C;  3ZQ7 A;  3DPT A;  2VOP A;  2CYY A;  1I1S A;  2ZKZ A;  4ASN A;  4TV7 A;  1XD7 A;  4AIH A;  1IN8 A;  1IW7 F;  3SHF A;  1F5T A;  1U3E M;  2K27 A;  3RYP A;  3N4M A;  3RJP A;  4EJW A;  4ENM A;  4FX0 A;  4YII A;  5EEH A;  1KYW A;  2OU2 A;  3FXQ A;  4LG0 A;  4CIC A;  2JSC A;  2W84 A;  2DLL A;  2HWV A;  2M87 A;  1IXR C;  2ZME B;  4HF1 A;  4BHC A;  3KET A;  4HF2 A;  1OYW A;  3FM5 A;  2MC3 A;  1B9M A;  4GCV A;  4ESB A;  5E8I A;  3I64 A;  2HKO A;  3ZPL A;  3ULQ B;  3HSE A;  2YR2 A;  2QWW A;  2O03 A;  2PMH A;  1EH8 A;  4L0Y B;  3C3W A;  3ZMD A;  3H3U A;  3KP2 A;  1R23 A;  4L9T A;  1ON1 A;  3PQK A;  3TDU C;  3VEP A;  1ZG1 A;  2COM A;  4PCQ A;  1TQP A;  1ODD A;  2E7W A;  2WV0 A;  3ZMZ A;  4F7Z A;  5FLX Z;  5DD4 A;  4I2O A;  1J2X A;  4LK1 F;  4U0Y A;  2FSW A;  4U7D A;  4CHU A;  4WXD A;  4WF2 A;  3FF5 A;  2DFI A;  1LDD A;  2MD5 A;  1B1B A;  4MTE A;  4EJU A;  2QEN A;  4ZZL A;  5ILS A;  3MEX A;  1REP C;  5EEG A;  4FHT A;  2YX4 A;  2ZME A;  3FMQ A;  3EET A;  2M1B A;  1KQ9 A;  1U5T C;  4L9J A;  2F2E A;  5D5X B;  4D0P A;  2P7V B;  3KZZ A;  4ZZD A;  2DW4 A;  1ONV A;  1F1Z A;  4ZYG A;  2O6G E;  3GF2 A;  2DQL A;  3FMR A;  2HZT A;  3KZY A;  3CUO A;  2ZXJ A;  1YYV A;  2OQR A;  1OYI A;  2JT1 A;  2DAO A;  3LFK A;  4L5I A;  1A04 A;  1QPM A;  3IKV A;  4I0B A;  3HHG A;  2ZFW A;  2GQQ A;  3WE2 A;  2EA4 A;  3BJA A;  2CQK A;  2IA2 A;  1I6X A;  5LRS A;  3V7R A;  2VXZ A;  3EQL F;  2F5D A;  3GFM A;  4PDK A;  1BC8 C;  3KEQ A;  3QRF F;  2IPQ X;  1O3R A;  3U9G A;  3F6O A;  1B9N A;  5JVT A;  4GYI A;  1TNT A;  2XAG A;  4LD5 A;  3KP7 A;  3WE3 A;  5H6R A;  2KIM A;  5HDN A;  2QZ8 A;  2W24 A;  1WQ2 A;  2VN2 A;  5FD6 A;  2JTV A;  4DQ2 A;  3RI4 A;  4HBL A;  1T38 A;  1V4R A;  2EV0 A;  3IWF A;  2XV4 S;  3HYI A;  4GYG A;  2QQB A;  3KP4 A;  5DYM A;  1HSJ A;  1F4K A;  3VFZ A;  4IVN A;  2IJL A;  3L2C A;  1OYY A;  1RZ4 A;  2D1V A;  4UVA A;  3HOS A;  4U0W A;  1FLI A;  1IN6 A;  1JE8 A;  4HDV A;  4CO8 A;  2D1H A;  1ZAO A;  5E20 A;  3H3Z A;  2YU3 A;  2A6H F;  3HSR A;  1I5Z A;  3IRR A;  1Y0U A;  1P4X A;  5HS7 A;  4HX7 A;  2A61 A;  2HEO A;  1UHW A;  1IRF A;  3WGI A;  1RI7 A;  1ZRD A;  2A69 F;  4WXH A;  2EFP A;  3JAM K;  1ZYR F;  3OV8 A;  1QNT A;  4K2E A;  3NEU A;  4N0B A;  5A2Q Z;  3GWZ A;  4CXF A;  2V9V A;  3JTG A;  1U6G A;  3SXY A;  1FSE A;  2UZK A;  5TRD A;  3G3Z A;  3F22 A;  4M9X A;  4A5N A;  3L7W A;  2J5P A;  1G3S A;  4Q47 A;  3ECO A;  2XAF A;  4P9U A;  1MJA A;  1JGS A;  1RUN A;  3V7C A;  3J81 Z;  1J7K A;  3TO7 A;  4G6Q A;  1ZGA A;  2UXN A;  1BIA A;  3V8J A;  2XVC A;  3HTU A;  3T1B A;  1ZH5 A;  1LB2 A;  3IKT A;  2ZNY A;  3Q9V A;  2Z99 A;  3HRU A;  1FX7 A;  1LEB A;  4RB3 C;  2OZU A;  4P96 A;  3QPH A;  5CVJ A;  3GVA A;  2OZ6 A;  5DEQ A;  3CO7 C;  4UV9 A;  5E18 F;  2V1D A;  3CO6 C;  2O61 A;  1W7P B;  4M71 A;  3U2R A;  2AXL A;  1ZAR A;  3BWG A;  2NS0 A;  4KNY A;  4WWC A;  1ZLK A;  2V6C A;  3L09 A;  3RIR A;  3F21 A;  5H20 A;  3R0J A;  2HYF A;  2L02 A;  3GFI A;  1LDJ A;  3WU1 B;  1ZLJ A;  2DBB A;  3ZN0 A;  5BS6 A;  4MNU A;  5BPD A;  5D6E A;  4LK0 F;  4JBA A;  2KIU A;  4XRF A;  5K5Q A;  4O5V A;  4P9F A;  3BOQ A;  2Z5U A;  4AIJ A;  3F6V A;  4KIB A;  1G4D A;  2R7D A;  1FY7 A;  2PMU A;  3BPX A;  1C0W A;  1CF7 B;  5LHG A;  2OD5 A;  2XGX A;  1YO5 C;  5BOX A;  1QBJ A;  3TDZ C;  5AON A;  3JSP A;  2O0Y A;  2YPR A;  3N97 A;  1ZG3 A;  1W7P A;  4UVB A;  1X3U A;  2FBH A;  2HDC A;  1U5T B;  2M5W A;  2ZNZ A;  2UXX A;  4NHJ A;  2IA1 A;  1SAX A;  1FOK A;  3WTX C;  1R22 A;  3RDI A;  2MBF A;  1AWC A;  3E6C C;  1XSV A;  5DV5 A;  1D5V A;  1TNS A;  4IRI A;  2KJC A;  4HX8 A;  2J5O A;  1S7A A;  2OA4 A;  2UWM A;  1FC3 A;  2HYG D;  4L9V A;  4KDP A;  4BAY A;  4GGG A;  3TO9 A;  3J80 K;  4RS8 A;  4CDG A;  3DFG A;  2FML A;  2LF8 A;  2NRA C;  1CF7 A;  4LB6 B;  4IRG A;  2FNP A;  5LEJ A;  5JI6 A;  3P9I A;  1HKQ A;  2FMY A;  4G7Z F;  5L3F A;  4YFN F;  2VON A;  2CG4 A;  2K02 A;  2NYX A;  4KN4 X;  2X0L A;  2ESN A;  2BE5 F;  1USS A;  3I58 A;  1UCR A;  3LST A;  3TOA A;  4HQM A;  4KIF A;  3FZV A;  3GXO A;  2EV5 A;  4E70 A;  4A0Y A;  1U5T A;  3ABU A;  2JZY A;  1G3T A;  2XAQ A;  4M72 A;  3DP7 A;  2P5K A;  2BV6 A;  3BPV A;  3DXJ F;  2D2W A;  1T6S A;  4M6Y A;  4G6D A;  2A07 F;  2H94 A;  3I59 A;  4KT5 C;  2STW A;  4G7O F;  1QO0 D;  3OOP A;  2DO7 A;  1H9T A;  1R5H A;  1O3Q A;  2VOD A;  5JR3 A;  4P55 A;  2HTJ A;  4M73 A;  2GAU A;  1BN5 A;  3ISP A;  4M74 A;  3MZY A;  4LFU A;  3KEO A;  1IN7 A;  2ELH A;  1QZZ A;  2VT2 A;  4A5M A;  3BDD A;  3I71 A;  2IT0 A;  3MCZ A;  4EVI A;  3IWZ A;  4MGR A;  5DUK A;  1XGO A;  4H0E A;  3M7G A;  4HX4 A;  1F9N A;  1CGP A;  2XIG A;  3AAF A;  1R1U A;  2IA0 A;  4N9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...