4HF2A

Crystal structure of e43a iscr mutant bound to its promoter
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
132
structure length
115
Chain Sequence
MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLAQLFSRLRKNGLVSSVRGPGGGYLLGKDASSIAVGEVISAVDESALTHALWRDLSDRLTGFLNNITLGELVNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Studies of IscR reveal a unique mechanism for metal-dependent regulation of DNA binding specificity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
molecule keywords HTH-type transcriptional regulator IscR
total genus 29
structure length 115
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02082 Rrf2 Transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hf2A00
3BDDA 4PCQA 1H9TA 5LGTA 2OD5A 3IRQA 4M9SA 3DP7A 4P9FA 2QENA 5D4SA 2YX4A 3QRFF 2E1NA 4L0ZB 1MGTA 4EMSA 4HX8A 5CLSA 4MEXF 4M73A 3WTTC 3FWEA 2HQRA 3L9FA 5JI6A 2F5EA 4LLNA 4A2UA 4HW0A 1BOAA 2W25A 3Q5FA 2K27A 1FWZA 3KP3A 2JSCA 5LGNA 3CUQC 4O5VA 5AONA 4ZYGA 4ZYEA 3P7NA 2ZMEA 4Q4ZF 4HAMA 3MZHA 4G7HF 5F64A 2ELHA 1W4MA 5HOOA 1V3FA 3W6JB 4QLCU 1KQ8A 4ESBA 1H9GA 5BS6A 3V4GA 3DPTA 2FOKA 1W7PA 1KGSA 2GA1A 1DPUA 2O6GE 1U3EM 1QZZA 2LDUA 3FXRA 3GVAA 1QO0D 2XVCA 2VT2A 3VB2A 4FHTA 2OA4A 2LKPA 2VE9A 4PZJA 4AIKA 2FBIA 2WWYA 2HFHA 1R1VA 1FYLA 1MDMA 3OV8A 1MJAA 1FNNA 3K1PA 2O0YA 5JR3A 1LNWA 3F21A 3IWFA 3V7SA 5LHGA 2KRFA 1UB9A 1KYWA 4MGRA 2V79A 3BOQA 4OIQF 2RC4A 1P4WA 2EA4A 2DQRA 3F72A 1ZG3A 2W57A 2LF8A 3EYYA 4OU0A 4P55A 3TO7A 2DPDA 1IN8A 2V1DA 2K86A 3SZPA 1YO5C 3F8CA 5FO5A 1IF1A 4KIGA 4KMUX 3K69A 2KKOA 1TQMA 5D8LB 2QWWA 4L9NA 5HLIA 2VBWA 4G6QA 1OMIA 4H0EA 2HWVA 4N0BA 5KVRA 5E1WA 1U78A 4HA8A 5DUIA 3M1EA 2QZ8A 2UXXA 2P5KA 1ZARA 1GHCA 2ZJ2A 3GFMA 4Q47A 3CUQB 1ODDA 4OMYA 2E1CA 1BJAA 2IA1A 1G3YA 3GXOA 1B4AA 1NHAA 3ZMVA 3HSFA 2NS0A 1BN5A 2HR3A 1LEBA 4OINF 2QUFA 3WGGA 2EJRA 2ZO4A 3GO5A 4BHBA 3BWGA 3FM3A 3N97A 1BI1A 1FY7A 1ZYRF 3E5QA 5J8CA 3KP5A 4IXAA 1BC8C 2P6TA 5FD5A 1TBXA 5HLGA 2W84A 1YTYA 4EJVA 5A2QZ 1F1ZA 2JPBA 1KU7A 3BJAA 2PBIA 2GQQA 4GGGA 2A3SA 1FPQA 3FHZA 1O7FA 1S7OA 3HTSB 2DT5A 3W6KB 1T98A 2VBXA 3I53A 2ZNZA 4A12A 2CGPA 4CYDA 3SZTA 5KK1A 2GIVA 2ADUA 3DXJF 4LG0B 3VEPA 2X4HA 2XIGA 2FA5A 3TDUC 1D8JA 1USSA 4IPAA 4G8XA 5HDNA 1IUYA 4HF0A 3G73A 3IHUA 5CYVA 1ZGJA 4PGHA 2Y75A 1XSVA 4WK8F 2M30A 2V9VA 1J2XA 1P6RA 2ZFWA 4IHTA 1I1SA 2P4WA 1Z1DA 4S04A 2ISZA 4M6YA 1ZG1A 1MJBA 1TNTA 1R1UA 3SHFA 5LLQA 1BIAA 4M74A 3N4MA 5ED4A 2OAZA 3GX4X 3JAMK 1XCVA 1U2WA 2VN2A 2Q0OA 3BPXA 3P9IA 4B8XA 5F1RA 1ON2A 4EJWA 3BJ6A 2V1XA 3I5UA 3RYRA 2EB7A 1T39A 2CO5A 2RDPA 1XGMA 3QPHA 2A6HF 3V7RA 4YFNF 3NQOA 4U7BA 5DD4A 4L9TA 4A5MA 3LAJA 1O3RA 2Z3YA 4U0WA 4HQEA 1MZBA 3VOEA 1XGOA 3E5UA 1B9NA 3IKVA 2O3FA 4HQMA 1YW9A 2EFQA 3RDIA 3R6SA 2NYXA 3L2CA 2NNNA 4KICA 1P92A 2XASA 3TO6A 5L3FA 5HLHA 3CUQA 3KCCA 2DK5A 3ZMTA 1U5TB 3R0AA 3RPQA 1YFHA 5D8KB 2TDXA 1FLIA 1R00A 1FSEA 5ERIA 1FOKA 3E3VA 4U0YA 2Z5UA 1IXRC 2PG4A 2EV0A 3KFWX 5LGUA 1IAWA 2EA2A 2FRHA 1GVJA 3T5XA 4IF4A 1YQAA 2QLZA 5DYMA 3HHHA 3L09A 4DNCA 3QP5A 5D6FA 1ZH5A 2B0LA 2IA2A 2HTSA 4KMFA 5ILVA 3MAJA 1J5YA 1EH7A 1KA8A 1E2XA 3V8KA 1R5HA 5BOXA 2QVOA 1OPCA 3I54A 2AS5F 1Z05A 2A07F 3FMSA 3M8EA 5JVTA 2W24A 3AAFA 2DBBA 5L3BA 1Z6RA 2G9WA 1RNLA 3K1NA 3WGHA 3JSOA 5D5VB 3K0LA 1KU3A 5CVJA 1C0WA 4ETSA 3DQVC 2EK5A 1G3WA 4ENJA 2EV5A 4Q48A 3DF8A 2WV0A 1ZRDA 2DQLA 5HVQC 2QQAA 2OZ6A 1T2KA 3I4PA 3CLOA 3HRTA 4KYWA 2DW4A 2HYGD 3GEZA 2XKOA 4RB0A 1U5TA 2IA0A 5ICFA 1G3TA 2UWMA 2HZTA 4LLLA 5HS7A 2ISYA 1K79A 5DCMA 2VBZA 3O2PE 1FP1D 3O3KA 5HS8A 3GFJA 3EDPA 4WXHA 3ZMDA 4RAYA 5BQTA 3HOTA 1XDSA 3WTUC 1GXPA 4CDGA 3BP8A 3V8LA 5HDGA 4RGXA 3EQLF 1ZRFA 1XN7A 3MQ0A 4CXFA 3ZP5A 2BBYA 4KNYA 1G6NA 2R7DA 3M7GA 1ZHFA 1L3LA 3SQNA 4HF1A 4MTEA 1LB2A 4A6EA 2D45A 2BV6A 5ILSA 4BXUA 4Z2YA 3F6VA 1JGSA 2ZXJA 1TQPA 4ZZLA 3FM5A 3CUOA 4ASNA 5L3EA 1SFUA 4HBLA 5HS9A 4EGZA 5DCMB 1YS7A 4I98B 3ABTA 1U6GA 1S7AA 1YG2A 3VODA 3WU0A 2J5PA 1YS6A 4HV6A 3SFZA 4BNCA 5EEGA 5FLXZ 1ZLKA 4KDPA 1I27A 4LJZF 1LVAA 2FEZA 1FX7A 3CO6C 4TV7A 4M71A 3E6DA 4HOBA 2HQNA 1XSDA 3ZMZA 5E17F 1UFMA 3LQQA 3CJNA 3VFZA 1RZ4A 1OR7A 3HRSA 3MCZA 5E8GA 2CQKA 2FE3A 2PJPA 3ML6A 4RB2C 2BGCA 4L5IA 3I59B 3ZPLA 1XSXA 3K2ZA 2L4AA 2ESNA 3R61A 3WE2A 1CGPA 1RUNA 2IW5A 4FX4A 4I09A 3LAPA 2EFPA 2L4MA 4K2EA 4UV9A 2FXAA 4UVBA 1J0RA 1PDNC 3IC7A 3LQRA 2ETHA 4N9IA 3KZYA 5CVRA 5JHUA 1HW2A 1L0OC 1K7AA 2P7VB 3I59A 2K4BA 4JQFA 6PAXA 2Q8KA 5K5QA 3ZN1A 2PQ8A 4CHUA 3ULQB 4AIJA 2VBYA 3F6OA 2UZKA 1YIOA 1EH6A 4PDKA 2HTJA 3TO9A 4KIFA 2P6SA 3RKXA 5ICCA 1AWCA 2XV4S 2KIMA 1DDNA 1WSUA 2RVCA 2Q2EA 3T8RA 4WCGA 4EQQA 1OYIA 3J81Z 2KIUA 3RJPA 3CO7C 1F5TA 4ENNA 2JPCA 3F23A 3JTGA 3TQNA 3TDZC 1R36A 4LG0A 5AIPA 1XGSA 4HF2A 2VC0A 4GYIA 1K78B 2A6EF 3FMQA 2DO7A 4OMZA 2M5WA 2C6YA 2J5OA 2XHKA 5DDGA 3F8BA 4UV8A 4IJAA 4OIPF 4HYEA 3DPLC 4HLYA 2FNAA 2VODA 2GA2A 3I71A 4U0VA 1XCBA 2M45A 2PFBA 5BMZA 1TNSA 3COAC 2JT1A 1LEAA 1TTYA 3IWZA 2FBKA 3Q9SA 2O61A 4UVCA 4WXDA 5IT3A 2HGCA 1RUOA 4D0PA 2Z99A 4XSXF 4HZFA 3H3ZA 2PLYA 2EWNA 1I6XA 3FF5A 3FZVA 3ZQ7A 3QU6A 1BC7C 3MZYA 3E97A 2X0LA 5FGMA 2WC2A 1ZN2A 3WGIA 1YW8A 4P5OA 2NNYA 1JXSA 5D6EA 5DD8A 5FFZA 1FP2A 4RB1A 3IKTA 3TKYA 4EM0B 2KJCA 1FSHA 5FB2A 1A04A 5ICEA 1CF7A 4EJUA 3DEUA 2PN6A 1EH8A 3KEQA 1S6LA 3G3ZA 1TW3A 3QP6A 1KYZA 2GZWA 3RKYA 2NAZA 4RAZA 2XAGA 2DPUA 4N9HA 2VT3A 1R58A 1TQIA 2ZMEB 4F7ZA 1IRFA 4UVAA 3B02A 3FMRA 3I58A 2EFWA 5IT9Z 4EVIA 1FBSA 3F8NA 4LMYA 2PI0A 1HBXG 2R7FA 4ZZDA 3HRUA 3KLOA 1K78A 2ZBKA 3QU3A 1PP8F 1S8NA 3E5XA 2OQGA 3CDHA 1G3SA 3P9CA 2Z33A 2H6BA 2K4JA 4M9XA 3ZMUA 3GLXA 4EJOA 3WG9A 2CW0F 4ON0A 3BJOA 1XDUA 1WWXA 3F8MA 4G7ZF 2AXLA 4YFXF 3GF2A 2Y48A 5BPDA 1R23A 2F2EA 1BI3A 1UHMA 2W85A 2FSWA 1FZPB 3WTZA 5LBQA 1PUEE 1P4XA 2O8XA 3MEXA 1FYMA 3BZ6A 4OIOF 2CG4A 3RYPA 4XLPF 2HDCA 2FQ3A 5JFRA 4EM2A 4A6DA 2XRNA 5K5OA 3J80Z 1IRGA 3C18A 1D8KA 1HQCA 2K7LA 1REPC 3E6BA 2P7CB 1Z6TA 1I5ZA 1O7LA 1FBQA 4BQAA 4Q5SF 2MBFA 3LFKA 4UNOA 4GCVA 3HIFA 1LDJA 3KP6A 2BYVE 3RTRA 3BPVA 1MD0A 3L00A 3U9GA 3OOPA 4HDVA 1QGPA 3BROA 2DK8A 4UUVA 5E8IA 3Q9VA 4LK1F 1B1BA 5ILUA 2A69F 1EV7A 4IHSA 1ZLJA 2HKXA 5L3DA 2WTEA 4XBFA 4NB5A 3ERED 3HSRA 3GFIA 3KEOA 1G4DA 1O3TA 3JTHA 5FFXA 2G7HA 2DFIA 2EV6A 4EGYA 3J7AO 2YPRA 2OZUA 3RIRA 5J6XA 1ZG5A 4MHGA 1USTA 4KN7X 3F22A 4M9ZA 4BHPA 1IW7F 2QQBA 1FT9A 2PEXA 3IL2A 4CO8A 2FNPA 4ENMA 2OBPA 1W7PB 2QBYB 1Q1HA 1T0FA 2XROA 5D4RA 3HHGA 2HS5A 5L3GA 5LRRA 2EFOA 4KN4X 1WI9A 1FC3A 4LFUA 1WRJA 4I2OA 4L5JA 1D5VA 3I64A 2DTRA 4I0AA 4A0ZA 4XLNF 3ISPA 3NEUA 4M6XA 2XAJA 1SFXA 2KIFA 2XUBA 3PFIA 5TJJA 1XB4A 5DEQA 4EV0A 2KJBA 2FMLA 2MD5A 1BM9A 4A0YA 3QOPA 2QYOA 3RI4A 4DQ2A 2H6CA 1O3SA 1Z91A 3EUHA 2DU9A 1O57A 3RPUA 4CGZA 2VC1A 2M8EA 3M8FA 2A5YB 1I1GA 5ICGA 2DAOA 3KE2A 3TGNA 4AWXB 2COMA 4AD9A 2UXNA 1MJ9A 2MA3A 1J7KA 2STTA 4AVPA 1V4RA 3O6BB 3T1BA 3FXQA 2IJLA 3WTSC 3KZZA 1D3YA 4RS8A 4RGRA 3LSTA 2IPQX 1UCRA 1XMKA 4JBAA 3WODF 3GZ6A 1W7PD 4L18B 1XMAA 3CTAA 3H92A 1ZGAA 3C1DA 2FU4A 4R8HA 4KUMA 4WF2A 2H09A 4LB6B 3I0TA 2GWRA 2BEOA 5H6RA 3H3UA 1SD4A 2P5VA 2JRTA 2O03A 2PMUA 2OQRA 3GWZA 4YIFA 1X3UA 4UXNA 2IRFG 2RN7A 1QBJA 4OIRF 4JK1X 4HDUA 4E70A 1JHHA 2G7UA 2CFXA 1ON1A 2R3SA 1PP7U 2ACJA 2LSOA 1S3JA 3DKWA 4IRIA 1QZYA 4O3MA 1TW2A 2GXGA 2RV8A 3K1MA 1IN5A 3KETA 4IRHA 5LEKA 4KT5C 5FLXK 3ECOA 3KP4A 4ENKA 2FBHA 3QAHA 3IRRA 1KU9A 2HEOA 3J81K 1HW1A 4YG2F 4MEYF 2L02A 4CICA 5H20A 3ZMSA 2HKOA 3REOA 1XGNA 4ZH4F 3V8JA 4FT8A 3U1DA 3ABUA 4P9UA 4B09A 2XGXA 2JTVA 1K6OA 4LGWA 4RGUA 1P4AA 4IVNA 5L3CA 1LJ9A 3LA3A 1KQ9A 3TOBA 3WE3A 3KP2A 3E6MA 4BAYA 2K02A 3HUGA 5F6FA 4BYYA 5CVIA 4EM1A 1ZAOA 1HKQA 4YIIA 3KP7A 1ULYA 1R5GA 1J75A 2H27A 4A0XA 3WTVC 1YYVA 2YR2A 3HYIA 1RI7A 1ZRCA 4G94A 4UHTA 2QBYA 4I02A 1T38A 3NRVA 5D5XB 1T6SA 1LDKB 2ZKZA 5CVVA 3JSPA 1R1TA 2A68F 3C7JA 3S2WA 4ESFA 3K9TA 4IRGA 2L01A 1MDMB 2VONA 1Z9CA 3PQKA 3ELKA 4U88A 1W5TA 1ONVA 4ZYDA 2PMHA 5LHHA 5HDKA 1O3QA 4RB3C 2VOOA 2VE8A 4MQ9F 2QM3A 4P96A 1U8RA 1IXCA 3LA2A 1BI0A 4XRFA 4S05A 4MQVA 2E7XA 4U7DA 2EFNA 5A2QK 1YLFA 1IZ1A 3WTYC 2V6CA 1MKMA 3R0JA 4L9VA 1J9IA 3GUDA 5H6QA 2NRAC 3WTWC 1HKTA 1ZREA 4KA4A 3R60A 2GXBA 3HOSA 5J8FA 2M1BA 2VXZA 5TRDA 4HLXA 4LK0F 4I7HA 2RQPA 2DLLA 4PGGA 4KFCA 4NHJA 1U5TC 3HRMA 3GFLA 5FD6A 1QNTA 3EETA 4FX0A 5DCFA 3DV8A 1GXQA 5E1XA 3T8TA 2F5FA 1BIBA 3ECHA 2QQ9A 5D5UB 4I0BA 2ESHA 3FXUA 2STWA 2XAQA 5LRSA 4MTDA 4BHCA 2D1VA 5CJ9A 4L9JA 2BE5F 5DV5A 5IT9K 2HYFA 1CF7B 4GXOA 3M9AA 2XAHA 1R7JA 2FF4A 1SD6A 3T0YA 1STZA 3JW4A 4WX9A 1E17A 2MH9A 3ZN0A 1Y0UA 3JAMZ 3F3XA 1FBUA 1HKSA 4GYGA 2P5LC 3C3WA 1F4KA 4WWCA 3HTUA 3WU1B 1Z7UA 3L7WA 4R79A 3GW2A 1F9NA 1KQ0A 2CWEA 4Y17A 3R4KA 1LDDA 1IN6A 3TOAA 2OU2A 1FYKA 4CZZA 1OKRA 4O6JA 2CSOA 2HOEA 4G9YA 1WKMA 4GO1A 4LLGF 1J59A 5DUKA 1OYWA 2P8TA 4LD5A 1LQ1A 2RNJA 3D0SA 4ESJA 2GAUA 1XD7A 1W5SA 1SMTA 4EJTA 3B73A 1H0MA 1BI2A 4Y13A 2F5CA 3MWMA 4G7OF 4KIBA 2FMYA 3D5LA 4G6DA 3HSEA 3QPTA 2RGVA 1R22A 3V7CA 1VTNC 4A5NA 1KU2A 1YW7A 2MC3A 5LHIA 1S29A 1IN7A 4YFKF 2Z9OA 1B9MA 4XSZF 2RKHA 3SXYA 4BH9A 2YSRA 3GZ5A 3DFGA 2L3DA 1SD5A 1HSJA 1WQ2A 1QPMA 2ZCWA 5K5RA 5E18F 2E7WA 3GYHX 3LA7A 5E1ZB 1TLHB 1DUXC 3J80K 1DPRA 1B6AA 3EYIA 2IT0A 2JZYA 5K1YA 4QWQA 2ZNYA 2LNBA 5LEJA 1SD7A 2YU3A 4NQWA 3FX3A 4HX7A 1IN4A 1QQIA 1HXDA 2H94A 1OYYA 2MH2A 2XAFA 3BY6A 1JE8A 3KLNA 2XKPA 5E20A 4MNUA 3E6CC 2CYYA 1RIOH 3MFKA 4AIHA 1JHFA 5CVUA 2D1HA 4ZYHA 5BPIA 2M87A 1SAXA 1HW5A 2L54A 2F5DA 4RGSA 3U2RA 4HX4A 5D5WB 2MLKA 4L0YB 1IXSB 5EEHA 1B59A 1BBYA 2A61A 2VOPA 1SMYF 4I01A 4LB5A 3RKWA 4Y15A 4WXCA 2Y0MA 3LWFA 4M72A 3WTXC 2IP2A 3PQJA 2DI3A 5AIQA 2V1UA 3ROUA 4R1HA 1SFEA 2IVMA 1AOYA 4OOIA 4HV5A 2D2WA 1P2FA 1DP7P 3F8FA 2LF7A 1HSTA 1UHWA 2MLGA 3P9KA 2YX7A
chains in the Genus database with same CATH superfamily
3BR3A 3BDDA 4PCQA 1NH3A 1H9TA 1FEXA 4HRIA 2I8DA 5LGTA 3ERMA 2JVHA 2OD5A 3IRQA 1XX5A 4M9SA 1WCMJ 3DP7A 4P9FA 2QENA 5D4SA 3Q0VA 2YX4A 2ZSIB 3TW6A 3QRFF 2E1NA 3PM1A 4L0ZB 1OCTC 1YOVB 2ECCA 1BW5A 2I10A 1MGTA 4EMSA 4HX8A 5CLSA 4MEXF 1ENHA 4DYCA 4M73A 2JUCA 3WTTC 3FWEA 1W0TA 4H4KC 2GXAA 2XF5A 2M4GA 3S3OA 2HQRA 1RR8C 1MMDA 2XF7A 4XL9A 3L9FA 5JI6A 2F5EA 4LLNA 4A2UA 3GZNB 4UUSB 4HW0A 1BOAA 2W25A 3Q5FA 2K27A 1FWZA 2CH0A 3KP3A 2VLAA 2JSCA 2NXNB 4BACA 3NARA 2QSHX 5LGNA 4YEJA 3CUQC 1LE8A 4O5VA 5AONA 1R71A 4ZYGA 4ZYEA 2CW7A 2ZMEA 3P7NA 4Q4ZF 4HAMA 3MZHA 4G7HF 3HB9A 5F64A 4AIDA 2ELHA 1W4MA 3OYBA 5HOOA 4J01A 1V3FA 3W6JB 1VFCA 4QLCU 3BC8A 1KQ8A 4ESBA 1H9GA 4N4NB 4ZDOA 5BS6A 3V4GA 1T56A 3DPTA 2FOKA 3TMOA 1W7PA 2X1EA 3ASOH 1KGSA 3QYBA 2GA1A 1DPUA 1Y1VJ 2O6GE 1U3EM 2Z2SB 1QZZA 3GMEA 4GDFA 1ZKGA 2LDUA 3FXRA 3GVAA 1FOYA 1QO0D 1ZTRA 2XVCA 3OY9A 2VT2A 3VB2A 4C2MJ 1X1BA 1YI2I 1UJ8A 4FHTA 4MO7A 2OA4A 2LKPA 2A5WA 1YE9A 2DMPA 2VE9A 2IS1A 4RAFA 4PZJA 4AIKA 4XKCA 2FBIA 2WWYA 2HFHA 3FXMA 1VQ6I 1R1VA 2DMNA 4XR6A 4YELA 1X1PA 4B43A 1HF0A 1FYLA 1MDMA 4DZPA 3OV8A 1OFCX 4B1RA 1MJAA 1FNNA 3K1PA 2O0YA 2VIXA 3I4MJ 5EGOA 5JR3A 4PJ0C 1LNWA 5CPRB 4A3DJ 3I4NJ 3F21A 3GTMJ 3IWFA 3V7SA 5LHGA 3ABMH 1X2MA 2FD5A 2DN0A 2KRFA 2DDBA 1UB9A 1KYWA 2QQ8A 3RQ4A 1Z67A 5BNGA 2HXIA 2K3FA 2QEXI 2R7VA 2E71A 4MGRA 2V79A 3W2WA 1TT5B 1ZGWA 3BOQA 1AU7A 3OYCA 4D5FA 3OYIA 4OIQF 3AKZA 2V6EA 2RC4A 1P4WA 1X3WB 2EA4A 2WA0A 2DQRA 3F72A 5FRMA 1ZG3A 2HNHA 2W57A 2LF8A 1XS9A 4BGDA 3EYYA 4OU0A 4P55A 4XIDA 3EUKL 2P0WA 3TO7A 3JRBA 2DPDA 1IN8A 2V1DA 3CC7I 1R49A 3IV5A 3FXOA 4LIUA 2X6YA 2K86A 5HLTA 1MSFC 3ZXSA 3SZPA 4ZDLA 1YO5C 3F8CA 5TGTA 5FO5A 1IF1A 4KIGA 1BA5A 3H5RA 4KMUX 2G0EA 2WY7Q 3K69A 3LSHA 2F5VA 2KKOA 4A3IJ 1FMVA 2NS8A 3B6CA 1DU6A 3N05A 3SEZA 1TQMA 4B4CA 2K9NA 3FXKA 3OYMA 1Y0NA 5D8LB 1JUMA 1R6RA 2QWWA 4L9NA 5HLIA 2VBWA 3M8JA 4G6QA 3SDGA 1OMIA 4H0EA 2NVQJ 3FHNA 2HWVA 4N0BA 5KVRA 2WAQA 5E1WA 1U78A 1IRZA 4HA8A 2NOGA 5DUIA 4XKWA 1QHHD 2ZB9A 2CS3A 2EINH 1MNDA 2R7OA 3M1EA 5KAIC 1SVMA 3CMYA 2QZ8A 2L2OA 1AKHA 2BVMA 2UXXA 4QPOA 2P5KA 2KLOA 1BR2A 1ZARA 1GHCA 2M7AA 2B63J 2ZJ2A 1S5LC 4Y33A 2M0CA 4JX5A 3VYTB 3GFMA 4F92B 2LP0A 2CV2A 2JJ7A 4Q47A 3CUQB 1ODDA 4OMYA 2E1CA 4PFOA 1BJAA 2IA1A 4PJNA 2R7WA 1G3YA 3BTIA 3GXOA 1B4AA 1NHAA 3EPZA 3ZMVA 3HSFA 4Y52J 2NS0A 1BN5A 2HR3A 2OF7A 3CF5F 3ZCOA 1LEBA 4OINF 2JVGA 2QUFA 3WGGA 1P7IA 1OCZH 3MMYB 2EJRA 5KNLA 2ZO4A 3GO5A 2DYRH 5F08A 1VZ0A 4BHBA 3BWGA 3FM3A 2RQQA 3K70D 2CQQA 2R4GA 3N97A 3HGGA 1BI1A 1FY7A 3PJRA 1ZQ3P 1ZYRF 3E5QA 2QSGX 2ZXHA 5J8CA 2E5ZA 3KP5A 4IXAA 1BC8C 2KDOA 2P6TA 1MBGA 5FD5A 4A3JJ 1TBXA 4AYBN 2OJED 5HLGA 2W84A 1YTYA 4IHXA 4EJVA 5FKNA 3KX2A 3S1QJ 5A2QZ 9ANTA 1F1ZA 2JPBA 4PSXA 1LPQA 1KU7A 3DU6A 3BJAA 4IOCF 2PBIA 4HNVA 2GQQA 4GGGA 3ZQQA 2V9PA 4C3HJ 1K4SA 1A35A 2E5NA 3IP4B 2A3SA 3A02A 1FPQA 3FHZA 1VQ4I 2HOAA 1U8BA 1O7FA 1S7OA 3CMEI 2LMDA 4BQNA 3HTSB 2DT5A 3W6KB 3HUGB 1T98A 2XF6A 1MIJA 2VBXA 3I53A 2ZNZA 4A12A 2CGPA 3I3LA 4CYDA 3SZTA 4HSTA 5KK1A 1EA3A 2KQRA 3CC2I 4IKFA 2B9SA 4NQWB 1RRJA 2GIVA 2H1LA 1Z0XA 2ADUA 3DXJF 3VEPA 4LG0B 4IHYA 5IYCJ 2X4HA 3PO2J 2XGDA 2XIGA 1T08B 2FA5A 4XONA 3TDUC 1D8JA 3OWTA 1E3OC 1USSA 4IPAA 4G8XA 5HDNA 3JRAA 1IUYA 3M1CA 3G1MA 4HF0A 3G73A 3IHUA 5IP7J 3RKQA 5CYVA 1SC7A 1ZGJA 2VQLA 2R93J 2DA2A 4PGHA 1TWCJ 2Y75A 4XN0A 3MKWB 5FKKA 5JHFA 3VWBA 1XSVA 1YIJI 3E1SA 1HLVA 4WK8F 3JRHA 3Q3SA 2H1KA 2M30A 2Z1DA 2Y0SN 4UB8C 5KHDA 2V9VA 3U1KA 1J2XA 4XRSA 1P6RA 5IYDJ 1VQ5I 2ZFWA 4C2TA 2KPMA 5E79C 4IHTA 1I1SA 4XN3A 2WV1A 2P4WA 1Z1DA 4S04A 2ISZA 4M6YA 5M5WJ 5E3OA 2R5ZA 1ZG1A 1MJBA 1TNTA 1R1UA 3BR5A 3SHFA 5LLQA 1BIAA 1XPXA 1OCPA 3IH4A 3GTLJ 4M74A 2W7NA 3N4MA 5ED4A 1E3HA 2OAZA 4HG2A 4RDUA 3GX4X 1JT0A 4IHWA 4MLOA 3JAMK 4X1EA 2CMPA 1XCVA 1U2WA 1WFXA 2E2JJ 2VN2A 4PJMA 3H1CA 3JRDA 2KT0A 4CZCA 1W5CC 2Q0OA 3BPXA 2Y31A 4FTHA 3CCLI 3K2AA 4Z6YA 3P9IA 4B8XA 2OCCH 5F1RA 1ON2A 3E0JB 4EJWA 3BJ6A 3FBNB 1MNMC 2V1XA 3I5UA 3RYRA 4EEFG 2EB7A 1T39A 3KZIC 1WHUA 4DOZA 4DZJA 2CO5A 3BTCA 2RDPA 1XGMA 2LVSA 2A6HF 3DPUA 3QPHA 2MD0A 3V7RA 2VKDA 4YFNF 3NQOA 1PUFA 4U7BA 3J7YJ 2VB6A 5DD4A 5F04A 5GTHC 4L9TA 1D5YA 4XOTA 1JGGA 4A5MA 3LAJA 1O3RA 2Z3YA 4U0WA 5IYBJ 2EIKH 4HQEA 2R5ZB 1MZBA 1D0YA 3VOEA 1XGOA 4B3XA 4ZDPA 3E5UA 1B9NA 3IKVA 3CCRI 3CP2A 2O3FA 4HQMA 1YW9A 1ACIA 1PYVA 5EF6A 1YJWI 2EFQA 3RDIA 2HU9A 3R6SA 1IC8A 3HOVJ 3OMYA 2NYXA 3L2CA 2NNNA 3QODA 1SEUA 3IH3A 4KICA 2KZGA 1ZK8A 1P92A 2XASA 3TO6A 5L3FA 3K4NA 5HLHA 3CUQA 3KCCA 2DK5A 3BG7A 4V2GA 3ZMTA 3CQZJ 1E0EA 5M3FJ 1U5TB 2AQEA 1OISA 3R0AA 3RPQA 2CUZA 3LSIA 1YFHA 5D8KB 3H36A 2TDXA 1FLIA 1R00A 1FSEA 5ERIA 5GAGJ 1FOKA 3E3VA 1PJRA 1FTTA 1A31A 2LBFA 2Z5UA 4U0YA 1Y6IA 1IXRC 2PG4A 2EV0A 3KFWX 4XLFA 5LGUA 1IAWA 2EA2A 1X4OA 3JRFA 2IGNA 2FRHA 1GVJA 3T5XA 2GOMA 4IF4A 1YQAA 1LKXA 2LG4A 3VYUB 2QLZA 1GVDA 5DYMA 3HHHA 1Y39A 3TP0A 3L09A 2QF7A 1LUJB 4DNCA 3QP5A 2DT7B 3A0HC 3OL4A 4F3QA 1MMAA 4XKVA 5FJ8J 3HPGA 5D6FA 1ZH5A 2B0LA 2IA2A 2HTSA 4KMFA 2DA5A 3MAJA 5ILVA 1J5YA 1EH7A 1KA8A 2F4MB 1E2XA 3TP3A 3PO3J 3V8KA 1R5HA 2WADA 4XRSG 4BQOA 5BOXA 3LOCA 1LFBA 2QVOA 1OPCA 5EJCA 3I54A 1P9QC 2AS5F 1Z05A 2A07F 2LFBA 5IP6A 3FMSA 3M8EA 4IEJA 1FOXA 5JVTA 2CUJA 2W24A 3AAFA 2DBBA 5L3BA 1JTXA 1Z6RA 2JA5J 1EKEA 2G9WA 1GDTA 1RNLA 1F36A 2JRMA 1ETXA 3K1NA 3WGHA 3JSOA 5D5VB 3K0LA 1MSEC 1KU3A 5CVJA 1C0WA 2A6TA 4ETSA 3DQVC 3QYEA 1IDYA 2EK5A 1G3WA 2BY1A 2EV5A 4Q48A 4ENJA 1YITI 5B3SH 3CZ6A 3DF8A 2WV0A 4QPQA 2DQLA 2QCOA 1HCRA 1ZRDA 2CV1A 5HVQC 2QQAA 2OZ6A 2WB1N 1T2KA 3I4PA 3CLOA 3HRTA 5M5XJ 2DW4A 4KYWA 4RBOA 5IP9J 2HYGD 1AHDP 3GEZA 1G8XA 2XKOA 1LVKA 2A05A 2LD5A 2HZDA 2GM4A 4B47A 4RA2A 4RB0A 3IAS2 1U5TA 1ETQA 2IA0A 2L7KA 5ICFA 1G3TA 4DYRA 2DOFA 2UWMA 3CCSI 4BE2A 2HZTA 2OUMA 1D1AA 4BDZA 3PSFA 5HS7A 4LLLA 3VPRA 2PX9A 1WH7A 2VKVA 2ISYA 2OTJI 3KYLA 1FOWA 2JA2A 4S0HB 1K79A 5DCMA 4PUSA 1TL8A 2VBZA 4RMNA 4CH7A 3NAUA 1WVRA 3O2PE 1FP1D 3O3KA 5HS8A 3GFJA 3EDPA 2ECBA 4WXHA 2BOLA 3ZMDA 3HL2A 2DTZA 4RAYA 1NK3P 3LSMA 5BQTA 3OYFA 3G1OA 3HOTA 5B5EC 1XDSA 3WTUC 1GXPA 3L2WA 4CDGA 3FBIB 1MMGA 1X4PA 2KRCA 3BP8A 5J47A 1TWGJ 2L7MP 3V8LA 4BY7J 2VPRA 3CJQB 5HDGA 4RGXA 3EQLF 1ZRFA 1XN7A 3CCYA 3MQ0A 4CXFA 3BG9A 3ZP5A 4ITVA 2R7ZJ 1S9HA 2BBYA 4KNYA 1G6NA 2FX0A 1UAAA 5C44J 2R7DA 2XGCA 3GBGA 1Z3XA 2X6WA 4I99C 3M7GA 1ZHFA 1L3LA 3SQNA 4HF1A 3MVPA 2XSJC 4MTEA 3S16J 1O4XA 2ZSHB 2LC2A 1LB2A 3AG1H 4A6EA 2BZTA 3CESA 2L9SA 2VASA 2D45A 5B1BH 3DKXA 3SEQA 2BV6A 2GBYA 3PUBA 5ILSA 4BXUA 4Z2YA 3BTLA 1JGSA 2RAEA 2ZXJA 1MBEA 3F6VA 1BR4A 4MFEA 1TQPA 1XTAA 3DKYA 4ZZLA 3FM5A 3CUOA 2KDZA 2H8RA 4ASNA 1A5JA 1SFKA 3BCAA 1W36C 1SANA 5L3EA 5EDNA 2O5RA 1SFUA 2Y2ZA 4HBLA 1X1DA 5GAEJ 3PL8A 4AVZA 3S3MA 5HS9A 3KEYA 4EGZA 3Q0UA 5DCMB 1YS7A 5IOYA 2VJIA 2IBDA 1Z7LA 4I98B 3ABTA 1I39A 1S7AA 1U6GA 1YG2A 1KONA 1WI3A 3VODA 3GTJJ 3WU0A 2J5PA 1YS6A 4HV6A 3SFZA 3WHCA 2X9DA 3CCMI 3W2AA 3HM5A 3G6EI 3H5NA 2NVTJ 1N25A 4BNCA 2AQFA 5EEGA 4QTRA 5FLXZ 1ZLKA 1FIAA 3PNVA 3AL0B 4KDPA 2F4IA 1I27A 3DBHB 4LJZF 5JVGF 1N78A 1R4NB 1LVAA 2KISA 2FEZA 4MIMA 1N77A 1FX7A 3CO6C 1RESA 4M71A 4TV7A 3A03A 3E6DA 4D9JA 5E3NA 3K70C 4HOBA 4A3CJ 2HQNA 1XSDA 3ZMZA 5E17F 3I55I 1UFMA 2AO9A 3A1YA 3LQQA 5GP9A 3CJNA 3VFZA 1RZ4A 1OR7A 1WJCA 3CF2A 3HRSA 3MCZA 5E8GA 1X19A 2CQKA 2FE3A 2PJPA 3ML6A 4RB2C 3JRGA 3OYEA 1OCRH 2BGCA 1VQ8I 2NS7A 4L5IA 4V2FA 4A3KJ 3I59B 3ZPLA 3ASNH 4YRVA 3JCUC 1XSXA 3K2ZA 2KIQA 2L4AA 3DLAA 2ESNA 3FXLA 2V4JC 4BL0B 3R61A 3WE2A 1CGPA 1RUNA 2IW5A 4FX4A 4IOAF 4I09A 3LAPA 3ZR8X 2NVXJ 4A3FJ 2CW8A 2EFPA 4D5CA 2L4MA 1V5FA 4K2EA 1TWAJ 2MGQA 4JYKA 4UV9A 3DBRB 2XAUA 2FXAA 4UVBA 1J0RA 1PDNC 2V26A 3IC7A 3ZQGA 3OSFA 3LQRA 2ETHA 4NBQA 4N9IA 1DU0A 3DEEA 2L9VA 2CQNA 5M3MJ 2H8WA 2X1DA 3KZYA 5CVRA 5JHUA 4Y7NJ 2M2EA 4KJZA 1HW2A 1L0OC 3H9JA 4NNJA 1K7AA 2JWTA 2P7VB 2CV0A 1V55H 3I59A 2K4BA 4JQFA 6PAXA 2Q8KA 5HNHA 2DJNA 5K5QA 1TWFJ 2EZHA 2XB5A 1ZELA 4F55A 3ZN1A 2PQ8A 2LTPA 3IUOA 4CHUA 1MH3A 3HOXJ 3ULQB 2HOSA 2VBYA 3F6OA 2UZKA 4AIJA 1YIOA 1EH6A 4PDKA 1FIPA 2HTJA 3TO9A 4KIFA 3GTOJ 3DBLB 2P6SA 3RKXA 3F9KA 5ICCA 1AWCA 2NVYJ 1APLC 1GT0C 2M0MA 2I5UA 1NTCA 5EGOB 3OIPA 2XV4S 2LKXA 2Q2EB 2KIMA 4BJTA 3GLLA 4CCMA 1DDNA 1WSUA 1ORKA 2RVCA 2Q2EA 3T8RA 4WCGA 1WH5A 4EQQA 3AFHA 1OYIA 3J81Z 2KIUA 3RJPA 3CO7C 1WJDA 2GLOA 3K7AJ 3OYJA 1F5TA 4ENNA 1SAUA 2K5CA 5J4VA 2ZJRF 4BBSJ 2JPCA 3F23A 3W6VA 3JTGA 2L7ZA 3TQNA 1XG1A 4OAZA 3TDZC 5FROA 2W4SA 1R36A 4LG0A 5AIPA 1XGSA 2JUGA 3D5RC 4HF2A 5DM6F 4CUGA 2VC0A 3CDLA 4GYIA 1K78B 2A6EF 2EIJH 1YJNI 2YS9A 3FMQA 2DO7A 4OMZA 4CCKA 2M5WA 2VJ4A 4XRMA 4HPQA 2C6YA 2VKEA 2Y69H 2IAIA 2J5OA 2HDWA 1TC3C 2XHKA 1AA7A 4CCJA 1PUFB 3OIOA 4F91B 2R7RA 5DDGA 3F8BA 1IG7A 4UV8A 4IJAA 2DA1A 4HYEA 4OIPF 2DFHA 3AL0C 5F27A 3DPLC 4HLYA 3BT9A 2FNAA 2VODA 2GA2A 1ITYA 3I71A 4U0VA 3GTQJ 3L2RA 1XCBA 3RCOA 2E2HJ 2HPMA 2M45A 2PFBA 5DTDA 5BMZA 1TNSA 1K4TA 2E1MC 2KRHA 3COAC 2JT1A 4UUTA 2E1OA 3CD6I 2HQ5A 1LEAA 1UHSA 2ID3A 2D5VA 1TTYA 3DWLE 3IWZA 2FBKA 3Q9SA 2O61A 3M07A 4UVCA 4WXDA 3TBIA 5IT3A 2R5YB 2HGCA 3NWTA 1RUOA 4D0PA 3LMMA 3HC7A 3OR1C 2Z99A 4XSXF 1OCCH 1UG0A 2UV1A 1A6IA 4B48A 2NVUB 3MKZA 2GIZA 3H3ZA 4HZFA 2PLYA 3G71I 4RM2A 4OAYA 2EWNA 1I6XA 1UG2A 3FF5A 3RZOJ 2FQ4A 1RR7A 3FZVA 3GTKJ 5M5YJ 3ZQ7A 1WGXA 3QU6A 4II2A 1ETYA 5E3LA 2XB0X 3OS2A 2R0QC 1BC7C 3MZYA 4LG3A 3E97A 5EZHA 2R92J 5KAFC 2X0LA 5FGMA 2WC2A 3Q0WA 2EQRA 1ZN2A 3SFIA 5GADJ 1ETKA 5F0HA 3WGIA 1T0FC 1YW8A 4P5OA 1VQPI 3DTKA 2NNYA 1JXSA 2CRGA 5D6EA 5DD8A 2DXIA 5FFZA 1FP2A 1VQOI 2ZXIA 3QWLA 1UELB 2UUZA 1EF4A 4RB1A 3CCQI 3IKTA 3TKYA 4EM0B 2KJCA 3LNQA 1FSHA 5FB2A 1IUFA 1A04A 5ICEA 1CF7A 2Y9ZA 4EJUA 3DEUA 4DYQA 2PN6A 1EH8A 3KEQA 3S14J 4G6TB 1S6LA 3G3ZA 3PNTA 1TW3A 1MH4A 2V1NA 2ZFUA 3QP6A 1G59A 1WJAA 1H89C 5EG0A 5FRNA 1KYZA 2GZWA 2KHMA 3RKYA 4BJ6C 1Z3YA 2NAZA 4BQQA 1HA8A 4RAZA 2XAGA 2DPUA 2XDVA 2VT3A 4N9HA 1R58A 1IDZA 3A4CA 2KZVA 3MZ8A 2BHYA 4BKXA 1TQIA 2ZMEB 3RPUD 2K9MA 4F7ZA 2QA4I 5JLXA 2QKMB 1TP4A 1IRFA 2TRTA 2BY0A 3EUHC 1POGA 4AC0A 4UVAA 4RAGA 3B02A 3GTGJ 3PNYA 3FMRA 3I58A 5HNFA 4CCLA 2OC6A 2EFWA 2E2IJ 5IT9Z 4EVIA 3CMAI 3A2KA 3S32A 4XMYA 3S15J 3L1PA 5CQEA 4F93B 1FBSA 2BY3A 4A3LJ 2K3PA 3F8NA 4LMYA 2BVLA 4W97A 2PI0A 2HVQA 1HBXG 2R7FA 4ZZDA 4CSWA 3HRUA 3KLOA 1K78A 2LH9A 4X0GA 2ZBKA 3DU5A 3QU3A 1PP8F 4FQGA 1S8NA 3HGYA 3E5XA 1YHQI 4C9YA 2OQGA 2DODA 2ID6A 3CDHA 2LBFB 1G3SA 4BXXJ 4XK4A 3P9CA 3OYGA 4XLAA 3PFYA 2Z33A 2IGOA 1X58A 2H6BA 2K4JA 3TEDA 4M9XA 3ZMUA 4LITA 5J40A 3GLXA 2XPUA 2DA7A 3BQYA 4EJOA 4DBRA 2BHZA 3WG9A 2CW0F 4ON0A 3BJOA 1XDUA 1WWXA 3FK6A 3BZKA 3IAM2 3F8MA 4G7ZF 4HSRA 5C4JJ 2AXLA 1E3PA 5J3LA 1XMXA 3GF2A 4YFXF 2PMZA 2Y48A 2O8KA 2BY2A 5BPDA 1R23A 2F2EA 1BI3A 1UHMA 2W85A 2FSWA 3KIOA 3PUFA 1FZPB 3WTZA 5LBQA 2FOWA 1PUEE 3AG2H 1P4XA 2O8XA 3ZQCA 3MEXA 4RM3A 1FYMA 3BZ6A 4EATA 3D5SC 4OIOF 2CG4A 2ELKA 3RYPA 4XLPF 4ZTFA 2HDCA 2FQ3A 2NOJB 4EM2A 5JFRA 4F52A 2DMUA 1I6HJ 4A6DA 4PJJA 3LSGA 2XRNA 3C2BA 1RPWA 5K5OA 3F0CA 3J80Z 2O9LA 3C18A 5KCMA 3W3CA 1IRGA 4E7KA 1D8KA 1R9TJ 1HQCA 2K7LA 4CCOA 3BCBA 2IS6A 1REPC 2PJRB 2HXOA 3ABKH 3E6BA 4J19A 2W48A 2P7CB 2B7EA 3FKIJ 1MBKA 1Z6TA 2YUSA 3BZCA 3OIQA 1I5ZA 1O7LA 5TISC 2DCEA 1FBQA 2FUG2 4BQAA 2W82A 4II3A 4XNFA 4Q5SF 2MBFA 1IV6A 3LFKA 4UNOA 1X3ZB 2VXDA 4GCVA 1B8IA 1QHGA 3HIFA 1LDJA 3KP6A 5K7HA 5K7ZA 3ABLH 2BYVE 1QRYA 3RTRA 3BPVA 1MD0A 3L00A 2L9NA 3U9GA 3PIPF 3UKGA 2EH3A 2JMWA 3FDYA 3OOPA 1HOMA 4IX7A 4HDVA 3CCJI 5DS9A 1QGPA 4XORA 1QZEA 4BDYA 3BROA 1FJLA 2DK8A 4UUVA 5E8IA 1GV5A 3Q9VA 2F6CA 2X6XA 4LK1F 1H8AC 1B1BA 5ILUA 3FK7A 2A69F 1PVEA 1EV7A 4IHSA 4BXFA 1ZLJA 1VQNI 2HKXA 5L3DA 2WTEA 1VNDA 4XBFA 4I76A 4NB5A 2QSFX 3ERED 3ONQA 3S1MJ 2L7FP 3HSRA 3KEOA 3GFIA 2DFEA 1G4DA 4AUXA 1O3TA 4DW6A 2MFZA 3H9QA 3JTHA 1X1CA 3ZOBA 5FFXA 2Z16A 2G7HA 3VSKA 3HBLA 2DFIA 4V19K 4JP0A 2EV6A 4EGYA 3J7AO 2E1MB 2YPRA 1QVUA 5FKLA 2OZUA 1VF9A 2EZKA 3RIRA 1IGNA 2DJIA 3RSNA 2R7TA 5J6XA 1VQKI 1WJEA 5IPAA 1ZG5A 1OR7C 2Q1ZB 4MHGA 3HXLA 2YU9J 5J1UA 5EZGA 2R7QA 2XC7A 1USTA 4BU2A 4KN7X 3F22A 2IEKA 3OS1A 4M9ZA 4BHPA 3OYDA 3I56I 4XICA 1IW7F 2QQBA 1FT9A 3MN2A 2PEXA 3IL2A 4CO8A 2FNPA 2KP6A 2V9KA 3VYSB 3OYHA 4ENMA 2IS2A 2LY9A 2OBPA 1W36D 4I6ZA 2X51A 3H0DA 4ABZA 3CCEI 1W7PB 3HZJA 2QBYB 4IO9F 3OOUA 2N8GA 2ME0A 4HEA2 3H9GA 3P5JA 1Q1HA 1T0FA 2XROA 3S1RJ 3TL4X 5D4RA 3HHGA 3K4CA 2HS5A 3EUAA 3BG3A 1BL0A 5L3GA 5LRRA 2EFOA 3JREA 4KN4X 1JKRC 1DQUA 1FC3A 1WI9A 4BEHA 2V7FA 1UZCA 4LFUA 1WRJA 4I2OA 4L5JA 1D5VA 1LE8B 1U9NA 3I64A 2DTRA 1A36A 2IS4A 1Y8RB 4I0AA 4A3EJ 2K40A 2ELJA 4A0ZA 1BW6A 4XLNF 3ISPA 2OPTA 1B8IB 2ZC2A 3NEUA 5DM7F 4M6XA 3CCVI 3DCFA 2PMZN 2M34A 1JUSA 3S1NJ 3KYCB 2QKLB 2XAJA 3FISA 3ZRGA 1D1CA 1SFXA 2KIFA 2XUBA 3PFIA 5TJJA 1K6YA 2K9QA 2VKHA 3HEFA 1GV2A 1XB4A 2KFDA 5DEQA 2LLKA 4EV0A 2MABA 2OCEA 2KJBA 3M3YJ 2FMLA 2MD5A 2L9RA 4M3DA 1VQLI 1BM9A 4A0YA 4D1QA 5FKOA 3W2VA 3QOPA 2QYOA 3RI4A 3A0BC 4DQ2A 2Y0SA 3HG9A 2H6CA 2JSPA 1O3SA 1Z91A 3EUHA 2DU9A 3K4BA 1O57A 3GCMA 1R4MB 3RPUA 1GUUA 1B72B 4CGZA 2VC1A 3HPHA 4M6VA 2CU7A 2M8EA 3M8FA 1MBFA 4IZZA 3JR9A 3S3NA 2A5YB 4FCYA 4IQ4A 1I1GA 5ICGA 2DAOA 3KE2A 1ERDA 3TGNA 4AWXB 3RZDJ 2COMA 4AD9A 2UXNA 1MJ9A 2MA3A 4IHVA 1J7KA 1G2HA 4C3IJ 2STTA 4AVPA 3LSPA 1V4RA 1WZ2A 3O6BB 1JI8A 3T1BA 3FXQA 3MD2A 3MKLA 1SVOA 2IJLA 2VJ5A 5F0CA 2JN6A 3WTSC 1V54H 3KZZA 1D3YA 2CFOA 4RGRA 3C2GA 2IXSA 4RS8A 3LSTA 2IPQX 1UCRA 1XMKA 4A3GJ 4JBAA 2MC4A 3WODF 3CDIA 1VQ9I 3BR0A 3GZ6A 1H88C 3H3VK 1W7PD 4L18B 1XMAA 5C4XJ 3CTAA 3H92A 3MKYB 4XLCA 3FXJA 1D0ZA 1ZGAA 1K61A 3C1DA 2FU4A 3BR1A 4DBQA 1V5EA 2LY1A 4R8HA 2ZJPF 1OCOH 4KUMA 4WF2A 2H09A 2JA6J 4LB6B 2LREA 4FE7A 5CQGA 4E7ZA 3I0TA 2GWRA 2BEOA 2RREA 5H6RA 3H3UA 4FASD 1WJ5A 1SD4A 2P5VA 4PFPA 5C3EJ 1I3AA 2DYSH 3VYRB 2JRTA 1DP3A 4M3FA 2O03A 2PMUA 2OQRA 3GWZA 3OYAA 4Y3OA 3TW7A 4YIFA 1JKQC 1S72I 1JUPA 1NG7A 1X3UA 2Y30A 4UXNA 2WAEA 2RN7A 1QBJA 2IRFG 4OIRF 4JK1X 4HDUA 2IGKA 4E70A 3OYNA 1JHHA 4IL6C 2G7UA 4JX6A 2CFXA 4D7MA 1ON1A 3S2DJ 4U87A 3ZQHA 3K4LA 3K4JA 2R3SA 2LRDA 4KITB 1PP7U 2ACJA 3SDBA 2LSOA 3V42A 1S3JA 2M7BA 3DKWA 4OWRB 1I3QJ 2MYSA 4IRIA 2KMUA 3BLYA 1QZYA 4O3MA 1TW2A 1F43A 1YRNB 2GXGA 5J1RA 2EIMH 3I9V2 2RV8A 3K1MA 1IN5A 3ZQIA 3KETA 4IRHA 5LEKA 1HDDC 1IRXA 2E19A 2X6OA 4KT5C 3X2QH 5FLXK 3ECOA 3KP4A 4ENKA 1RETA 4A69C 2CQ7A 2FBHA 3QAHA 2HQAA 3IRRA 1KU9A 1IO2A 3PSIA 3J81K 2HEOA 5E3MA 4L5EA 1HW1A 4YG2F 4MEYF 2L02A 3OR2C 1AKHB 4CICA 5H20A 3ZMSA 3QQAA 4JX4A 2DA3A 4E7LA 2HKOA 1BOBA 3REOA 1RC9A 1XGNA 2FJ1A 3DTIA 4ZH4F 3V8JA 4FT8A 2ME6A 3U1DA 3ABUA 3G4SI 4P9UA 3J7AY 4B09A 2WAFA 2XGXA 3B6AA 2JTVA 2M3AA 4XOPA 4E7SA 2L0KA 1MBHA 3BG6A 1K6OA 3H0GJ 4LGWA 4RGUA 1P4AA 4IVNA 5L3CA 1JTYA 4C2UA 1LJ9A 3LA3A 1KQ9A 4E4HA 3TOBA 4LOCA 3WE3A 3KP2A 2LOOA 3E6MA 4BAYA 4J00A 1Z77A 2K02A 1NG6A 3HUGA 5LD2C 5F6FA 4G12A 4RLFA 1WPKA 2VI6A 5CVIA 4BYYA 1ZAOA 2W00A 4EM1A 2XPVA 1HKQA 4YIIA 2R7SA 1VQMI 3KP7A 1ULYA 1R5GA 2VQHA 4ZC3A 1MMSA 4KISA 2XSDC 4W1UA 1J75A 2H27A 4A0XA 3WTVC 1BR1A 1YYVA 2YR2A 3DLLF 3HYIA 1RI7A 1ZRCA 4G94A 4UHTA 1QA6A 2M8GX 2QBYA 1D0XA 2WAQN 5J4YA 4I02A 5CKTA 1T38A 3NRVA 5D5XB 1T6SA 3QOEA 2CUFA 2AXTC 2EBIA 5JLWA 1LDKB 2ZKZA 5CVVA 3JSPA 1ZR2A 1LFUP 1R1TA 2DMTA 2A68F 3C7JA 3S2WA 4ESFA 1MNEA 1Y56A 2DA4A 3K9TA 1MBJA 4IRGA 2L01A 3BR2A 1T8IA 1MDMB 2VONA 1Z9CA 1R5ID 2EPFA 3PQKA 2HYJA 2E36A 2LK2A 1W5TA 3ELKA 4U88A 1ONVA 3OSGA 3O8GA 2HDDA 5FLVA 2OTLI 4ZYDA 5GPAA 2PMHA 5EYRA 5HDKA 5LHHA 1YJ9I 1O3QA 4RB3C 1NK2P 2VOOA 4NC7A 1YX5A 2VE8A 4MQ9F 2QM3A 4P96A 1Z21A 4BS9A 1U9OA 1U8RA 1IXCA 3LA2A 1BI0A 2BXZA 3ZGKA 3CC4I 5GTIC 4XRFA 4RLQA 4S05A 2LR8A 4MQVA 4AYBA 2E7XA 3L2VA 4U7DA 1WJFA 2EFNA 5A2QK 1YLFA 2JA7J 2KL4A 1IZ1A 1MMNA 1OQYA 1IV8A 2CUEA 3UR3C 3WTYC 3QPSA 2E60A 4A93J 2V6CA 1MKMA 3R0JA 4L9VA 2BW3B 1J9IA 3S8PA 3GUDA 4A3BJ 5H6QA 2NRAC 4FETA 2JA8J 3WTWC 4XLHA 1HKTA 1ZREA 5F0FA 2MW8A 3AG4H 1YX3A 2XRLA 2DT6A 4KA4A 2ZXWH 3R60A 3S93A 3LSKA 3OL3A 2GXBA 3HOSA 2COBA 3GTPJ 5J8FA 2M1BA 2VXZA 5LFAA 5IY5H 4UB6C 5TRDA 4HLXA 4PK4A 4KT6A 4LK0F 4I7HA 2RQPA 3LSRA 2DLLA 1ETWA 4AU7A 4PGGA 3HDDA 4KFCA 4NHJA 1VQ7I 1U5TC 3HRMA 3HOUJ 3RQIA 3CCUI 2VPLA 1SFOJ 3HKZN 3GFLA 5FD6A 5HODA 1QNTA 3EETA 2HI3A 1UMQA 1WJBA 4A3MJ 1W1WE 4XKBA 4FX0A 5GPCA 3DEWA 5DCFA 3WG7H 4DJAA 3DV8A 1GXQA 5E1XA 4E7HA 3T8TA 2F5FA 1BIBA 2F48A 3ECHA 4BBRJ 2QQ9A 4D7NA 2BXYA 5D5UB 4I0BA 3PIOF 2F4OB 3L2UA 1Y1WJ 2ICWG 2ESHA 3FXUA 2K85A 1FMWA 1T33A 2STWA 3BQZA 4BE0A 1LFPA 4GFBA 3L2QA 3J7ZI 3VSLA 4E6KG 2XAQA 1EJ9A 2XGEA 5LRSA 4MTDA 3DTEA 4BHCA 2D1VA 5CJ9A 4CA0A 4L9JA 2BE5F 5DV5A 5H2FC 5IT9K 4M3BA 2HYFA 1CF7B 3CMMA 4GXOA 3M9AA 2DA6A 2XAHA 1R7JA 2FF4A 1SD6A 3T0YA 3K10A 1STZA 1XC5A 1DGRM 1QVTA 3JW4A 2X48A 4WX9A 1V5GA 3D1NI 1E17A 2MH9A 3ZN0A 5B66C 1Y0UA 3JAMZ 3F3XA 1QU3A 1FBUA 1HKSA 1K83J 2K9LA 4GYGA 4PSWA 2P5LC 2O7OA 4E7IA 3C3WA 4JOMA 3WHBA 1RKTA 4PJLA 1T95A 1F4KA 1VI0A 2VQGA 1B72A 2EZIA 4WWCA 3JRIA 4XM3A 3HTUA 3VDXA 3WU1B 1Z7UA 3LSJA 2DDAA 3L7WA 5FLMJ 1GLNA 4R79A 3GW2A 2K9SA 3U21A 1F9NA 3OS0A 1Y8QB 1KQ0A 5FKMA 2CWEA 4C3JJ 3OYLA 4BJ5C 4Y17A 3R4KA 3M4OJ 2GOXB 1LDDA 4XQFA 1IN6A 3TOAA 1TWHJ 3C2HA 1ETOA 2OU2A 1FYKA 2M4KA 4XLEA 1N75A 2MSYA 2P81A 3FIWA 1KZHA 4CZZA 1OKRA 4O6JA 2HVRA 2M9HA 4UY8I 2CSOA 2HOEA 4G9YA 4GRIA 1WKMA 1TZLA 4GO1A 4BE1A 3QYFA 4LLGF 1J59A 5DUKA 1JKPC 3QPLA 1OYWA 2P8TA 5GAHJ 4LD5A 1LQ1A 1RKWA 2DOAA 2RNJA 3D0SA 4ESJA 1HC8A 2GAUA 1XD7A 1W5SA 4B3AA 1SMTA 4EJTA 3B73A 3K6GA 3OYKA 1H0MA 4BY1J 4ZJZA 1J09A 2X1CA 4E7JA 2E34A 1BI2A 4Y13A 1SVLA 2CQXA 2F5CA 3KPHA 3MWMA 2EILH 4G7OF 4KIBA 1U0JA 2RNGA 1W0UA 2FMYA 1QPIA 3D5LA 2LKSA 4G6DA 4BEHB 3HSEA 3QPTA 5EG0B 3JRCA 4ANJA 1I50J 1Q1VA 2RGVA 1R22A 3V7CA 4YIRX 1VTNC 2DMQA 2CJJA 2WB1A 4A5NA 3SZGA 1KU2A 1YW7A 3K4KA 2MC3A 5LHIA 4DGWB 1S29A 1IN7A 2VQCA 4YFKF 2Z9OA 3CJRB 1B9MA 4XSZF 1ETVA 2RKHA 3WU2C 1BJZA 5B1AH 2VJJA 2MG4A 3SXYA 2XPWA 3HOYJ 4BH9A 1OJLA 2YSRA 4NUBA 1X2NA 3A01A 3GZ5A 2VL8A 3DFGA 2L3DA 1SD5A 1HSJA 4FE4A 1WQ2A 2OV7A 2EZLA 1HDPA 1QPMA 2ZCWA 3CP8A 5K5RA 3UNGC 3O8HA 5E18F 3H5AA 2E7WA 3GYHX 4C30A 3FKJA 3S17J 4N4OB 3LA7A 1YRNA 2HVSA 4X6AJ 5E1ZB 1TLHB 2VUMJ 1DUXC 3J80K 1DPRA 1B6AA 1M1EB 3EYIA 1TT0A 2IT0A 5J1YA 3BG5A 2JZYA 3AG3H 4FISA 4HNTA 4CYCB 5K1YA 2X85A 4QWQA 2ZNYA 4M3GA 2LNBA 5LEJA 1DGWY 1SD7A 2YU3A 3K4MA 1FTZA 2LYCA 4NQWA 3FX3A 3BR6A 2R5YA 3CLQA 4HX7A 1IN4A 4BUPA 1JJ8C 1QQIA 2L5QA 1X1AA 2ZMEC 1OLTA 4AM3A 1HXDA 4ZTJA 2H94A 3LFUA 1CQTA 4CCNA 2HPIA 1OYYA 2MH2A 2XAFA 3BY6A 3IH2A 4MFDA 3E7LA 1JE8A 3HOZJ 3KLNA 4Y4RA 2XKPA 5F1JA 4UUSA 2R7UA 5E20A 4MNUA 3E6CC 2CYYA 1P7JA 1RIOH 3MFKA 4AIHA 1A6QA 1JHFA 2JK3A 2R7XA 1JJ6C 3NWSA 2LY2A 5CVUA 2HOTA 2D1HA 3ZQFA 1D1BA 4ZYHA 1IJWC 5BPIA 3LL7A 1ZR4A 2M87A 4ZYAA 2E35A 4B44A 1SAXA 1HW5A 2Y9YA 4NDLA 2L54A 2IGMA 2F5DA 3SJMA 1S7EA 3HJEA 4RGSA 3U2RA 4NC6A 4HX4A 5D5WB 3ZQLA 2MLKA 2JQ7A 4L0YB 2BW3A 1IXSB 2W1OA 3S2HJ 5EEHA 2PJRA 1B59A 1BBYA 2A61A 2VOPA 4NC8A 1JT6A 3HOWJ 1SMYF 4I01A 4LB5A 4P1WA 3RKWA 2WBMA 4Y15A 4WXCA 4CYCA 5IOZA 5K7FA 2Y0MA 3LWFA 4M72A 3WTXC 4QSHA 4M3EA 2IP2A 3PQJA 2QGUA 2DI3A 5AIQA 1MW7A 5EEAA 4QIWN 2ZJQF 2AHQA 3HKZA 3ESWB 3SYTA 3BTJA 3G1LA 3G2BA 2V1UA 3ROUA 2TCTA 1SFEA 2IVMA 4R1HA 3H35A 2DOEA 1AOYA 4OOIA 1JKOC 4HV5A 2D2WA 1P2FA 4DIQA 3CJTB 1DP7P 3F8FA 2LF7A 1HSTA 4IQJA 4LIVA 3A01B 2DFFA 1UHWA 2MLGA 3P9KA 3KYDB 4HNUA 2WY8Q 2YX7A
chains in the Genus database with same CATH topology
3BDDA 4PCQA 1H9TA 5LGTA 2OD5A 3IRQA 4M9SA 3DP7A 4P9FA 2QENA 5D4SA 2YX4A 3QRFF 2E1NA 4L0ZB 1MGTA 4EMSA 4HX8A 5CLSA 4MEXF 4M73A 3WTTC 3FWEA 2HQRA 3L9FA 5JI6A 2F5EA 4LLNA 4A2UA 4HW0A 1BOAA 2W25A 3Q5FA 2K27A 1FWZA 3KP3A 2JSCA 5LGNA 3CUQC 4O5VA 5AONA 4ZYGA 4ZYEA 3P7NA 2ZMEA 4Q4ZF 4HAMA 3MZHA 4G7HF 5F64A 2ELHA 1W4MA 5HOOA 1V3FA 3W6JB 4QLCU 1KQ8A 4ESBA 1H9GA 5BS6A 3V4GA 3DPTA 2FOKA 1W7PA 1KGSA 2GA1A 1DPUA 2O6GE 1U3EM 1QZZA 2LDUA 3FXRA 3GVAA 1QO0D 2XVCA 2VT2A 3VB2A 4FHTA 2OA4A 2LKPA 2VE9A 4PZJA 4AIKA 2FBIA 2WWYA 2HFHA 1R1VA 1FYLA 1MDMA 3OV8A 1MJAA 1FNNA 3K1PA 2O0YA 5JR3A 1LNWA 3F21A 3IWFA 3V7SA 5LHGA 2KRFA 1UB9A 1KYWA 4MGRA 2V79A 3BOQA 4OIQF 2RC4A 1P4WA 2EA4A 2DQRA 3F72A 1ZG3A 2W57A 2LF8A 3EYYA 4OU0A 4P55A 3TO7A 2DPDA 1IN8A 2V1DA 2K86A 3SZPA 1YO5C 3F8CA 5FO5A 1IF1A 4KIGA 4KMUX 3K69A 2KKOA 1TQMA 5D8LB 2QWWA 4L9NA 5HLIA 2VBWA 4G6QA 1OMIA 4H0EA 2HWVA 4N0BA 5KVRA 5E1WA 1U78A 4HA8A 5DUIA 3M1EA 2QZ8A 2UXXA 2P5KA 1ZARA 1GHCA 2ZJ2A 3GFMA 4Q47A 3CUQB 1ODDA 4OMYA 2E1CA 1BJAA 2IA1A 1G3YA 3GXOA 1B4AA 1NHAA 3ZMVA 3HSFA 2NS0A 1BN5A 2HR3A 1LEBA 4OINF 2QUFA 3WGGA 2EJRA 2ZO4A 3GO5A 4BHBA 3BWGA 3FM3A 3N97A 1BI1A 1FY7A 1ZYRF 3E5QA 5J8CA 3KP5A 4IXAA 1BC8C 2P6TA 5FD5A 1TBXA 5HLGA 2W84A 1YTYA 4EJVA 5A2QZ 1F1ZA 2JPBA 1KU7A 3BJAA 2PBIA 2GQQA 4GGGA 2A3SA 1FPQA 3FHZA 1O7FA 1S7OA 3HTSB 2DT5A 3W6KB 1T98A 2VBXA 3I53A 2ZNZA 4A12A 2CGPA 4CYDA 3SZTA 5KK1A 2GIVA 2ADUA 3DXJF 4LG0B 3VEPA 2X4HA 2XIGA 2FA5A 3TDUC 1D8JA 1USSA 4IPAA 4G8XA 5HDNA 1IUYA 4HF0A 3G73A 3IHUA 5CYVA 1ZGJA 4PGHA 2Y75A 1XSVA 4WK8F 2M30A 2V9VA 1J2XA 1P6RA 2ZFWA 4IHTA 1I1SA 2P4WA 1Z1DA 4S04A 2ISZA 4M6YA 1ZG1A 1MJBA 1TNTA 1R1UA 3SHFA 5LLQA 1BIAA 4M74A 3N4MA 5ED4A 2OAZA 3GX4X 3JAMK 1XCVA 1U2WA 2VN2A 2Q0OA 3BPXA 3P9IA 4B8XA 5F1RA 1ON2A 4EJWA 3BJ6A 2V1XA 3I5UA 3RYRA 2EB7A 1T39A 2CO5A 2RDPA 1XGMA 3QPHA 2A6HF 3V7RA 4YFNF 3NQOA 4U7BA 5DD4A 4L9TA 4A5MA 3LAJA 1O3RA 2Z3YA 4U0WA 4HQEA 1MZBA 3VOEA 1XGOA 3E5UA 1B9NA 3IKVA 2O3FA 4HQMA 1YW9A 2EFQA 3RDIA 3R6SA 2NYXA 3L2CA 2NNNA 4KICA 1P92A 2XASA 3TO6A 5L3FA 5HLHA 3CUQA 3KCCA 2DK5A 3ZMTA 1U5TB 3R0AA 3RPQA 1YFHA 5D8KB 2TDXA 1FLIA 1R00A 1FSEA 5ERIA 1FOKA 3E3VA 4U0YA 2Z5UA 1IXRC 2PG4A 2EV0A 3KFWX 5LGUA 1IAWA 2EA2A 2FRHA 1GVJA 3T5XA 4IF4A 1YQAA 2QLZA 5DYMA 3HHHA 3L09A 4DNCA 3QP5A 5D6FA 1ZH5A 2B0LA 2IA2A 2HTSA 4KMFA 5ILVA 3MAJA 1J5YA 1EH7A 1KA8A 1E2XA 3V8KA 1R5HA 5BOXA 2QVOA 1OPCA 3I54A 2AS5F 1Z05A 2A07F 3FMSA 3M8EA 5JVTA 2W24A 3AAFA 2DBBA 5L3BA 1Z6RA 2G9WA 1RNLA 3K1NA 3WGHA 3JSOA 5D5VB 3K0LA 1KU3A 5CVJA 1C0WA 4ETSA 3DQVC 2EK5A 1G3WA 4ENJA 2EV5A 4Q48A 3DF8A 2WV0A 1ZRDA 2DQLA 5HVQC 2QQAA 2OZ6A 1T2KA 3I4PA 3CLOA 3HRTA 4KYWA 2DW4A 2HYGD 3GEZA 2XKOA 4RB0A 1U5TA 2IA0A 5ICFA 1G3TA 2UWMA 2HZTA 4LLLA 5HS7A 2ISYA 1K79A 5DCMA 2VBZA 3O2PE 1FP1D 3O3KA 5HS8A 3GFJA 3EDPA 4WXHA 3ZMDA 4RAYA 5BQTA 3HOTA 1XDSA 3WTUC 1GXPA 4CDGA 3BP8A 3V8LA 5HDGA 4RGXA 3EQLF 1ZRFA 1XN7A 3MQ0A 4CXFA 3ZP5A 2BBYA 4KNYA 1G6NA 2R7DA 3M7GA 1ZHFA 1L3LA 3SQNA 4HF1A 4MTEA 1LB2A 4A6EA 2D45A 2BV6A 5ILSA 4BXUA 4Z2YA 3F6VA 1JGSA 2ZXJA 1TQPA 4ZZLA 3FM5A 3CUOA 4ASNA 5L3EA 1SFUA 4HBLA 5HS9A 4EGZA 5DCMB 1YS7A 4I98B 3ABTA 1U6GA 1S7AA 1YG2A 3VODA 3WU0A 2J5PA 1YS6A 4HV6A 3SFZA 4BNCA 5EEGA 5FLXZ 1ZLKA 4KDPA 1I27A 4LJZF 1LVAA 2FEZA 1FX7A 3CO6C 4TV7A 4M71A 3E6DA 4HOBA 2HQNA 1XSDA 3ZMZA 5E17F 1UFMA 3LQQA 3CJNA 3VFZA 1RZ4A 1OR7A 3HRSA 3MCZA 5E8GA 2CQKA 2FE3A 2PJPA 3ML6A 4RB2C 2BGCA 4L5IA 3I59B 3ZPLA 1XSXA 3K2ZA 2L4AA 2ESNA 3R61A 3WE2A 1CGPA 1RUNA 2IW5A 4FX4A 4I09A 3LAPA 2EFPA 2L4MA 4K2EA 4UV9A 2FXAA 4UVBA 1J0RA 1PDNC 3IC7A 3LQRA 2ETHA 4N9IA 3KZYA 5CVRA 5JHUA 1HW2A 1L0OC 1K7AA 2P7VB 3I59A 2K4BA 4JQFA 6PAXA 2Q8KA 5K5QA 3ZN1A 2PQ8A 4CHUA 3ULQB 4AIJA 2VBYA 3F6OA 2UZKA 1YIOA 1EH6A 4PDKA 2HTJA 3TO9A 4KIFA 2P6SA 3RKXA 5ICCA 1AWCA 2XV4S 2KIMA 1DDNA 1WSUA 2RVCA 2Q2EA 3T8RA 4WCGA 4EQQA 1OYIA 3J81Z 2KIUA 3RJPA 3CO7C 1F5TA 4ENNA 2JPCA 3F23A 3JTGA 3TQNA 3TDZC 1R36A 4LG0A 5AIPA 1XGSA 4HF2A 2VC0A 4GYIA 1K78B 2A6EF 3FMQA 2DO7A 4OMZA 2M5WA 2C6YA 2J5OA 2XHKA 5DDGA 3F8BA 4UV8A 4IJAA 4OIPF 4HYEA 3DPLC 4HLYA 2FNAA 2VODA 2GA2A 3I71A 4U0VA 1XCBA 2M45A 2PFBA 5BMZA 1TNSA 3COAC 2JT1A 1LEAA 1TTYA 3IWZA 2FBKA 3Q9SA 2O61A 4UVCA 4WXDA 5IT3A 2HGCA 1RUOA 4D0PA 2Z99A 4XSXF 4HZFA 3H3ZA 2PLYA 2EWNA 1I6XA 3FF5A 3FZVA 3ZQ7A 3QU6A 1BC7C 3MZYA 3E97A 2X0LA 5FGMA 2WC2A 1ZN2A 3WGIA 1YW8A 4P5OA 2NNYA 1JXSA 5D6EA 5DD8A 5FFZA 1FP2A 4RB1A 3IKTA 3TKYA 4EM0B 2KJCA 1FSHA 5FB2A 1A04A 5ICEA 1CF7A 4EJUA 3DEUA 2PN6A 1EH8A 3KEQA 1S6LA 3G3ZA 1TW3A 3QP6A 1KYZA 2GZWA 3RKYA 2NAZA 4RAZA 2XAGA 2DPUA 4N9HA 2VT3A 1R58A 1TQIA 2ZMEB 4F7ZA 1IRFA 4UVAA 3B02A 3FMRA 3I58A 2EFWA 5IT9Z 4EVIA 1FBSA 3F8NA 4LMYA 2PI0A 1HBXG 2R7FA 4ZZDA 3HRUA 3KLOA 1K78A 2ZBKA 3QU3A 1PP8F 1S8NA 3E5XA 2OQGA 3CDHA 1G3SA 3P9CA 2Z33A 2H6BA 2K4JA 4M9XA 3ZMUA 3GLXA 4EJOA 3WG9A 2CW0F 4ON0A 3BJOA 1XDUA 1WWXA 3F8MA 4G7ZF 2AXLA 4YFXF 3GF2A 2Y48A 5BPDA 1R23A 2F2EA 1BI3A 1UHMA 2W85A 2FSWA 1FZPB 3WTZA 5LBQA 1PUEE 1P4XA 2O8XA 3MEXA 1FYMA 3BZ6A 4OIOF 2CG4A 3RYPA 4XLPF 2HDCA 2FQ3A 5JFRA 4EM2A 4A6DA 2XRNA 5K5OA 3J80Z 1IRGA 3C18A 1D8KA 1HQCA 2K7LA 1REPC 3E6BA 2P7CB 1Z6TA 1I5ZA 1O7LA 1FBQA 4BQAA 4Q5SF 2MBFA 3LFKA 4UNOA 4GCVA 3HIFA 1LDJA 3KP6A 2BYVE 3RTRA 3BPVA 1MD0A 3L00A 3U9GA 3OOPA 4HDVA 1QGPA 3BROA 2DK8A 4UUVA 5E8IA 3Q9VA 4LK1F 1B1BA 5ILUA 2A69F 1EV7A 4IHSA 1ZLJA 2HKXA 5L3DA 2WTEA 4XBFA 4NB5A 3ERED 3HSRA 3GFIA 3KEOA 1G4DA 1O3TA 3JTHA 5FFXA 2G7HA 2DFIA 2EV6A 4EGYA 3J7AO 2YPRA 2OZUA 3RIRA 5J6XA 1ZG5A 4MHGA 1USTA 4KN7X 3F22A 4M9ZA 4BHPA 1IW7F 2QQBA 1FT9A 2PEXA 3IL2A 4CO8A 2FNPA 4ENMA 2OBPA 1W7PB 2QBYB 1Q1HA 1T0FA 2XROA 5D4RA 3HHGA 2HS5A 5L3GA 5LRRA 2EFOA 4KN4X 1WI9A 1FC3A 4LFUA 1WRJA 4I2OA 4L5JA 1D5VA 3I64A 2DTRA 4I0AA 4A0ZA 4XLNF 3ISPA 3NEUA 4M6XA 2XAJA 1SFXA 2KIFA 2XUBA 3PFIA 5TJJA 1XB4A 5DEQA 4EV0A 2KJBA 2FMLA 2MD5A 1BM9A 4A0YA 3QOPA 2QYOA 3RI4A 4DQ2A 2H6CA 1O3SA 1Z91A 3EUHA 2DU9A 1O57A 3RPUA 4CGZA 2VC1A 2M8EA 3M8FA 2A5YB 1I1GA 5ICGA 2DAOA 3KE2A 3TGNA 4AWXB 2COMA 4AD9A 2UXNA 1MJ9A 2MA3A 1J7KA 2STTA 4AVPA 1V4RA 3O6BB 3T1BA 3FXQA 2IJLA 3WTSC 3KZZA 1D3YA 4RS8A 4RGRA 3LSTA 2IPQX 1UCRA 1XMKA 4JBAA 3WODF 3GZ6A 1W7PD 4L18B 1XMAA 3CTAA 3H92A 1ZGAA 3C1DA 2FU4A 4R8HA 4KUMA 4WF2A 2H09A 4LB6B 3I0TA 2GWRA 2BEOA 5H6RA 3H3UA 1SD4A 2P5VA 2JRTA 2O03A 2PMUA 2OQRA 3GWZA 4YIFA 1X3UA 4UXNA 2IRFG 2RN7A 1QBJA 4OIRF 4JK1X 4HDUA 4E70A 1JHHA 2G7UA 2CFXA 1ON1A 2R3SA 1PP7U 2ACJA 2LSOA 1S3JA 3DKWA 4IRIA 1QZYA 4O3MA 1TW2A 2GXGA 2RV8A 3K1MA 1IN5A 3KETA 4IRHA 5LEKA 4KT5C 5FLXK 3ECOA 3KP4A 4ENKA 2FBHA 3QAHA 3IRRA 1KU9A 2HEOA 3J81K 1HW1A 4YG2F 4MEYF 2L02A 4CICA 5H20A 3ZMSA 2HKOA 3REOA 1XGNA 4ZH4F 3V8JA 4FT8A 3U1DA 3ABUA 4P9UA 4B09A 2XGXA 2JTVA 1K6OA 4LGWA 4RGUA 1P4AA 4IVNA 5L3CA 1LJ9A 3LA3A 1KQ9A 3TOBA 3WE3A 3KP2A 3E6MA 4BAYA 2K02A 3HUGA 5F6FA 4BYYA 5CVIA 4EM1A 1ZAOA 1HKQA 4YIIA 3KP7A 1ULYA 1R5GA 1J75A 2H27A 4A0XA 3WTVC 1YYVA 2YR2A 3HYIA 1RI7A 1ZRCA 4G94A 4UHTA 2QBYA 4I02A 1T38A 3NRVA 5D5XB 1T6SA 1LDKB 2ZKZA 5CVVA 3JSPA 1R1TA 2A68F 3C7JA 3S2WA 4ESFA 3K9TA 4IRGA 2L01A 1MDMB 2VONA 1Z9CA 3PQKA 3ELKA 4U88A 1W5TA 1ONVA 4ZYDA 2PMHA 5LHHA 5HDKA 1O3QA 4RB3C 2VOOA 2VE8A 4MQ9F 2QM3A 4P96A 1U8RA 1IXCA 3LA2A 1BI0A 4XRFA 4S05A 4MQVA 2E7XA 4U7DA 2EFNA 5A2QK 1YLFA 1IZ1A 3WTYC 2V6CA 1MKMA 3R0JA 4L9VA 1J9IA 3GUDA 5H6QA 2NRAC 3WTWC 1HKTA 1ZREA 4KA4A 3R60A 2GXBA 3HOSA 5J8FA 2M1BA 2VXZA 5TRDA 4HLXA 4LK0F 4I7HA 2RQPA 2DLLA 4PGGA 4KFCA 4NHJA 1U5TC 3HRMA 3GFLA 5FD6A 1QNTA 3EETA 4FX0A 5DCFA 3DV8A 1GXQA 5E1XA 3T8TA 2F5FA 1BIBA 3ECHA 2QQ9A 5D5UB 4I0BA 2ESHA 3FXUA 2STWA 2XAQA 5LRSA 4MTDA 4BHCA 2D1VA 5CJ9A 4L9JA 2BE5F 5DV5A 5IT9K 2HYFA 1CF7B 4GXOA 3M9AA 2XAHA 1R7JA 2FF4A 1SD6A 3T0YA 1STZA 3JW4A 4WX9A 1E17A 2MH9A 3ZN0A 1Y0UA 3JAMZ 3F3XA 1FBUA 1HKSA 4GYGA 2P5LC 3C3WA 1F4KA 4WWCA 3HTUA 3WU1B 1Z7UA 3L7WA 4R79A 3GW2A 1F9NA 1KQ0A 2CWEA 4Y17A 3R4KA 1LDDA 1IN6A 3TOAA 2OU2A 1FYKA 4CZZA 1OKRA 4O6JA 2CSOA 2HOEA 4G9YA 1WKMA 4GO1A 4LLGF 1J59A 5DUKA 1OYWA 2P8TA 4LD5A 1LQ1A 2RNJA 3D0SA 4ESJA 2GAUA 1XD7A 1W5SA 1SMTA 4EJTA 3B73A 1H0MA 1BI2A 4Y13A 2F5CA 3MWMA 4G7OF 4KIBA 2FMYA 3D5LA 4G6DA 3HSEA 3QPTA 2RGVA 1R22A 3V7CA 1VTNC 4A5NA 1KU2A 1YW7A 2MC3A 5LHIA 1S29A 1IN7A 4YFKF 2Z9OA 1B9MA 4XSZF 2RKHA 3SXYA 4BH9A 2YSRA 3GZ5A 3DFGA 2L3DA 1SD5A 1HSJA 1WQ2A 1QPMA 2ZCWA 5K5RA 5E18F 2E7WA 3GYHX 3LA7A 5E1ZB 1TLHB 1DUXC 3J80K 1DPRA 1B6AA 3EYIA 2IT0A 2JZYA 5K1YA 4QWQA 2ZNYA 2LNBA 5LEJA 1SD7A 2YU3A 4NQWA 3FX3A 4HX7A 1IN4A 1QQIA 1HXDA 2H94A 1OYYA 2MH2A 2XAFA 3BY6A 1JE8A 3KLNA 2XKPA 5E20A 4MNUA 3E6CC 2CYYA 1RIOH 3MFKA 4AIHA 1JHFA 5CVUA 2D1HA 4ZYHA 5BPIA 2M87A 1SAXA 1HW5A 2L54A 2F5DA 4RGSA 3U2RA 4HX4A 5D5WB 2MLKA 4L0YB 1IXSB 5EEHA 1B59A 1BBYA 2A61A 2VOPA 1SMYF 4I01A 4LB5A 3RKWA 4Y15A 4WXCA 2Y0MA 3LWFA 4M72A 3WTXC 2IP2A 3PQJA 2DI3A 5AIQA 2V1UA 3ROUA 4R1HA 1SFEA 2IVMA 1AOYA 4OOIA 4HV5A 2D2WA 1P2FA 1DP7P 3F8FA 2LF7A 1HSTA 1UHWA 2MLGA 3P9KA 2YX7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BDD A;  4PCQ A;  1H9T A;  5LGT A;  2OD5 A;  3IRQ A;  4M9S A;  3DP7 A;  4P9F A;  2QEN A;  5D4S A;  2YX4 A;  3QRF F;  2E1N A;  4L0Z B;  1MGT A;  4EMS A;  4HX8 A;  5CLS A;  4MEX F;  4M73 A;  3WTT C;  3FWE A;  2HQR A;  3L9F A;  5JI6 A;  2F5E A;  4LLN A;  4A2U A;  4HW0 A;  1BOA A;  2W25 A;  3Q5F A;  2K27 A;  1FWZ A;  3KP3 A;  2JSC A;  5LGN A;  3CUQ C;  4O5V A;  5AON A;  4ZYG A;  4ZYE A;  3P7N A;  2ZME A;  4Q4Z F;  4HAM A;  3MZH A;  4G7H F;  5F64 A;  2ELH A;  1W4M A;  5HOO A;  1V3F A;  3W6J B;  4QLC U;  1KQ8 A;  4ESB A;  1H9G A;  5BS6 A;  3V4G A;  3DPT A;  2FOK A;  1W7P A;  1KGS A;  2GA1 A;  1DPU A;  2O6G E;  1U3E M;  1QZZ A;  2LDU A;  3FXR A;  3GVA A;  1QO0 D;  2XVC A;  2VT2 A;  3VB2 A;  4FHT A;  2OA4 A;  2LKP A;  2VE9 A;  4PZJ A;  4AIK A;  2FBI A;  2WWY A;  2HFH A;  1R1V A;  1FYL A;  1MDM A;  3OV8 A;  1MJA A;  1FNN A;  3K1P A;  2O0Y A;  5JR3 A;  1LNW A;  3F21 A;  3IWF A;  3V7S A;  5LHG A;  2KRF A;  1UB9 A;  1KYW A;  4MGR A;  2V79 A;  3BOQ A;  4OIQ F;  2RC4 A;  1P4W A;  2EA4 A;  2DQR A;  3F72 A;  1ZG3 A;  2W57 A;  2LF8 A;  3EYY A;  4OU0 A;  4P55 A;  3TO7 A;  2DPD A;  1IN8 A;  2V1D A;  2K86 A;  3SZP A;  1YO5 C;  3F8C A;  5FO5 A;  1IF1 A;  4KIG A;  4KMU X;  3K69 A;  2KKO A;  1TQM A;  5D8L B;  2QWW A;  4L9N A;  5HLI A;  2VBW A;  4G6Q A;  1OMI A;  4H0E A;  2HWV A;  4N0B A;  5KVR A;  5E1W A;  1U78 A;  4HA8 A;  5DUI A;  3M1E A;  2QZ8 A;  2UXX A;  2P5K A;  1ZAR A;  1GHC A;  2ZJ2 A;  3GFM A;  4Q47 A;  3CUQ B;  1ODD A;  4OMY A;  2E1C A;  1BJA A;  2IA1 A;  1G3Y A;  3GXO A;  1B4A A;  1NHA A;  3ZMV A;  3HSF A;  2NS0 A;  1BN5 A;  2HR3 A;  1LEB A;  4OIN F;  2QUF A;  3WGG A;  2EJR A;  2ZO4 A;  3GO5 A;  4BHB A;  3BWG A;  3FM3 A;  3N97 A;  1BI1 A;  1FY7 A;  1ZYR F;  3E5Q A;  5J8C A;  3KP5 A;  4IXA A;  1BC8 C;  2P6T A;  5FD5 A;  1TBX A;  5HLG A;  2W84 A;  1YTY A;  4EJV A;  5A2Q Z;  1F1Z A;  2JPB A;  1KU7 A;  3BJA A;  2PBI A;  2GQQ A;  4GGG A;  2A3S A;  1FPQ A;  3FHZ A;  1O7F A;  1S7O A;  3HTS B;  2DT5 A;  3W6K B;  1T98 A;  2VBX A;  3I53 A;  2ZNZ A;  4A12 A;  2CGP A;  4CYD A;  3SZT A;  5KK1 A;  2GIV A;  2ADU A;  3DXJ F;  4LG0 B;  3VEP A;  2X4H A;  2XIG A;  2FA5 A;  3TDU C;  1D8J A;  1USS A;  4IPA A;  4G8X A;  5HDN A;  1IUY A;  4HF0 A;  3G73 A;  3IHU A;  5CYV A;  1ZGJ A;  4PGH A;  2Y75 A;  1XSV A;  4WK8 F;  2M30 A;  2V9V A;  1J2X A;  1P6R A;  2ZFW A;  4IHT A;  1I1S A;  2P4W A;  1Z1D A;  4S04 A;  2ISZ A;  4M6Y A;  1ZG1 A;  1MJB A;  1TNT A;  1R1U A;  3SHF A;  5LLQ A;  1BIA A;  4M74 A;  3N4M A;  5ED4 A;  2OAZ A;  3GX4 X;  3JAM K;  1XCV A;  1U2W A;  2VN2 A;  2Q0O A;  3BPX A;  3P9I A;  4B8X A;  5F1R A;  1ON2 A;  4EJW A;  3BJ6 A;  2V1X A;  3I5U A;  3RYR A;  2EB7 A;  1T39 A;  2CO5 A;  2RDP A;  1XGM A;  3QPH A;  2A6H F;  3V7R A;  4YFN F;  3NQO A;  4U7B A;  5DD4 A;  4L9T A;  4A5M A;  3LAJ A;  1O3R A;  2Z3Y A;  4U0W A;  4HQE A;  1MZB A;  3VOE A;  1XGO A;  3E5U A;  1B9N A;  3IKV A;  2O3F A;  4HQM A;  1YW9 A;  2EFQ A;  3RDI A;  3R6S A;  2NYX A;  3L2C A;  2NNN A;  4KIC A;  1P92 A;  2XAS A;  3TO6 A;  5L3F A;  5HLH A;  3CUQ A;  3KCC A;  2DK5 A;  3ZMT A;  1U5T B;  3R0A A;  3RPQ A;  1YFH A;  5D8K B;  2TDX A;  1FLI A;  1R00 A;  1FSE A;  5ERI A;  1FOK A;  3E3V A;  4U0Y A;  2Z5U A;  1IXR C;  2PG4 A;  2EV0 A;  3KFW X;  5LGU A;  1IAW A;  2EA2 A;  2FRH A;  1GVJ A;  3T5X A;  4IF4 A;  1YQA A;  2QLZ A;  5DYM A;  3HHH A;  3L09 A;  4DNC A;  3QP5 A;  5D6F A;  1ZH5 A;  2B0L A;  2IA2 A;  2HTS A;  4KMF A;  5ILV A;  3MAJ A;  1J5Y A;  1EH7 A;  1KA8 A;  1E2X A;  3V8K A;  1R5H A;  5BOX A;  2QVO A;  1OPC A;  3I54 A;  2AS5 F;  1Z05 A;  2A07 F;  3FMS A;  3M8E A;  5JVT A;  2W24 A;  3AAF A;  2DBB A;  5L3B A;  1Z6R A;  2G9W A;  1RNL A;  3K1N A;  3WGH A;  3JSO A;  5D5V B;  3K0L A;  1KU3 A;  5CVJ A;  1C0W A;  4ETS A;  3DQV C;  2EK5 A;  1G3W A;  4ENJ A;  2EV5 A;  4Q48 A;  3DF8 A;  2WV0 A;  1ZRD A;  2DQL A;  5HVQ C;  2QQA A;  2OZ6 A;  1T2K A;  3I4P A;  3CLO A;  3HRT A;  4KYW A;  2DW4 A;  2HYG D;  3GEZ A;  2XKO A;  4RB0 A;  1U5T A;  2IA0 A;  5ICF A;  1G3T A;  2UWM A;  2HZT A;  4LLL A;  5HS7 A;  2ISY A;  1K79 A;  5DCM A;  2VBZ A;  3O2P E;  1FP1 D;  3O3K A;  5HS8 A;  3GFJ A;  3EDP A;  4WXH A;  3ZMD A;  4RAY A;  5BQT A;  3HOT A;  1XDS A;  3WTU C;  1GXP A;  4CDG A;  3BP8 A;  3V8L A;  5HDG A;  4RGX A;  3EQL F;  1ZRF A;  1XN7 A;  3MQ0 A;  4CXF A;  3ZP5 A;  2BBY A;  4KNY A;  1G6N A;  2R7D A;  3M7G A;  1ZHF A;  1L3L A;  3SQN A;  4HF1 A;  4MTE A;  1LB2 A;  4A6E A;  2D45 A;  2BV6 A;  5ILS A;  4BXU A;  4Z2Y A;  3F6V A;  1JGS A;  2ZXJ A;  1TQP A;  4ZZL A;  3FM5 A;  3CUO A;  4ASN A;  5L3E A;  1SFU A;  4HBL A;  5HS9 A;  4EGZ A;  5DCM B;  1YS7 A;  4I98 B;  3ABT A;  1U6G A;  1S7A A;  1YG2 A;  3VOD A;  3WU0 A;  2J5P A;  1YS6 A;  4HV6 A;  3SFZ A;  4BNC A;  5EEG A;  5FLX Z;  1ZLK A;  4KDP A;  1I27 A;  4LJZ F;  1LVA A;  2FEZ A;  1FX7 A;  3CO6 C;  4TV7 A;  4M71 A;  3E6D A;  4HOB A;  2HQN A;  1XSD A;  3ZMZ A;  5E17 F;  1UFM A;  3LQQ A;  3CJN A;  3VFZ A;  1RZ4 A;  1OR7 A;  3HRS A;  3MCZ A;  5E8G A;  2CQK A;  2FE3 A;  2PJP A;  3ML6 A;  4RB2 C;  2BGC A;  4L5I A;  3I59 B;  3ZPL A;  1XSX A;  3K2Z A;  2L4A A;  2ESN A;  3R61 A;  3WE2 A;  1CGP A;  1RUN A;  2IW5 A;  4FX4 A;  4I09 A;  3LAP A;  2EFP A;  2L4M A;  4K2E A;  4UV9 A;  2FXA A;  4UVB A;  1J0R A;  1PDN C;  3IC7 A;  3LQR A;  2ETH A;  4N9I A;  3KZY A;  5CVR A;  5JHU A;  1HW2 A;  1L0O C;  1K7A A;  2P7V B;  3I59 A;  2K4B A;  4JQF A;  6PAX A;  2Q8K A;  5K5Q A;  3ZN1 A;  2PQ8 A;  4CHU A;  3ULQ B;  4AIJ A;  2VBY A;  3F6O A;  2UZK A;  1YIO A;  1EH6 A;  4PDK A;  2HTJ A;  3TO9 A;  4KIF A;  2P6S A;  3RKX A;  5ICC A;  1AWC A;  2XV4 S;  2KIM A;  1DDN A;  1WSU A;  2RVC A;  2Q2E A;  3T8R A;  4WCG A;  4EQQ A;  1OYI A;  3J81 Z;  2KIU A;  3RJP A;  3CO7 C;  1F5T A;  4ENN A;  2JPC A;  3F23 A;  3JTG A;  3TQN A;  3TDZ C;  1R36 A;  4LG0 A;  5AIP A;  1XGS A;  4HF2 A;  2VC0 A;  4GYI A;  1K78 B;  2A6E F;  3FMQ A;  2DO7 A;  4OMZ A;  2M5W A;  2C6Y A;  2J5O A;  2XHK A;  5DDG A;  3F8B A;  4UV8 A;  4IJA A;  4OIP F;  4HYE A;  3DPL C;  4HLY A;  2FNA A;  2VOD A;  2GA2 A;  3I71 A;  4U0V A;  1XCB A;  2M45 A;  2PFB A;  5BMZ A;  1TNS A;  3COA C;  2JT1 A;  1LEA A;  1TTY A;  3IWZ A;  2FBK A;  3Q9S A;  2O61 A;  4UVC A;  4WXD A;  5IT3 A;  2HGC A;  1RUO A;  4D0P A;  2Z99 A;  4XSX F;  4HZF A;  3H3Z A;  2PLY A;  2EWN A;  1I6X A;  3FF5 A;  3FZV A;  3ZQ7 A;  3QU6 A;  1BC7 C;  3MZY A;  3E97 A;  2X0L A;  5FGM A;  2WC2 A;  1ZN2 A;  3WGI A;  1YW8 A;  4P5O A;  2NNY A;  1JXS A;  5D6E A;  5DD8 A;  5FFZ A;  1FP2 A;  4RB1 A;  3IKT A;  3TKY A;  4EM0 B;  2KJC A;  1FSH A;  5FB2 A;  1A04 A;  5ICE A;  1CF7 A;  4EJU A;  3DEU A;  2PN6 A;  1EH8 A;  3KEQ A;  1S6L A;  3G3Z A;  1TW3 A;  3QP6 A;  1KYZ A;  2GZW A;  3RKY A;  2NAZ A;  4RAZ A;  2XAG A;  2DPU A;  4N9H A;  2VT3 A;  1R58 A;  1TQI A;  2ZME B;  4F7Z A;  1IRF A;  4UVA A;  3B02 A;  3FMR A;  3I58 A;  2EFW A;  5IT9 Z;  4EVI A;  1FBS A;  3F8N A;  4LMY A;  2PI0 A;  1HBX G;  2R7F A;  4ZZD A;  3HRU A;  3KLO A;  1K78 A;  2ZBK A;  3QU3 A;  1PP8 F;  1S8N A;  3E5X A;  2OQG A;  3CDH A;  1G3S A;  3P9C A;  2Z33 A;  2H6B A;  2K4J A;  4M9X A;  3ZMU A;  3GLX A;  4EJO A;  3WG9 A;  2CW0 F;  4ON0 A;  3BJO A;  1XDU A;  1WWX A;  3F8M A;  4G7Z F;  2AXL A;  4YFX F;  3GF2 A;  2Y48 A;  5BPD A;  1R23 A;  2F2E A;  1BI3 A;  1UHM A;  2W85 A;  2FSW A;  1FZP B;  3WTZ A;  5LBQ A;  1PUE E;  1P4X A;  2O8X A;  3MEX A;  1FYM A;  3BZ6 A;  4OIO F;  2CG4 A;  3RYP A;  4XLP F;  2HDC A;  2FQ3 A;  5JFR A;  4EM2 A;  4A6D A;  2XRN A;  5K5O A;  3J80 Z;  1IRG A;  3C18 A;  1D8K A;  1HQC A;  2K7L A;  1REP C;  3E6B A;  2P7C B;  1Z6T A;  1I5Z A;  1O7L A;  1FBQ A;  4BQA A;  4Q5S F;  2MBF A;  3LFK A;  4UNO A;  4GCV A;  3HIF A;  1LDJ A;  3KP6 A;  2BYV E;  3RTR A;  3BPV A;  1MD0 A;  3L00 A;  3U9G A;  3OOP A;  4HDV A;  1QGP A;  3BRO A;  2DK8 A;  4UUV A;  5E8I A;  3Q9V A;  4LK1 F;  1B1B A;  5ILU A;  2A69 F;  1EV7 A;  4IHS A;  1ZLJ A;  2HKX A;  5L3D A;  2WTE A;  4XBF A;  4NB5 A;  3ERE D;  3HSR A;  3GFI A;  3KEO A;  1G4D A;  1O3T A;  3JTH A;  5FFX A;  2G7H A;  2DFI A;  2EV6 A;  4EGY A;  3J7A O;  2YPR A;  2OZU A;  3RIR A;  5J6X A;  1ZG5 A;  4MHG A;  1UST A;  4KN7 X;  3F22 A;  4M9Z A;  4BHP A;  1IW7 F;  2QQB A;  1FT9 A;  2PEX A;  3IL2 A;  4CO8 A;  2FNP A;  4ENM A;  2OBP A;  1W7P B;  2QBY B;  1Q1H A;  1T0F A;  2XRO A;  5D4R A;  3HHG A;  2HS5 A;  5L3G A;  5LRR A;  2EFO A;  4KN4 X;  1WI9 A;  1FC3 A;  4LFU A;  1WRJ A;  4I2O A;  4L5J A;  1D5V A;  3I64 A;  2DTR A;  4I0A A;  4A0Z A;  4XLN F;  3ISP A;  3NEU A;  4M6X A;  2XAJ A;  1SFX A;  2KIF A;  2XUB A;  3PFI A;  5TJJ A;  1XB4 A;  5DEQ A;  4EV0 A;  2KJB A;  2FML A;  2MD5 A;  1BM9 A;  4A0Y A;  3QOP A;  2QYO A;  3RI4 A;  4DQ2 A;  2H6C A;  1O3S A;  1Z91 A;  3EUH A;  2DU9 A;  1O57 A;  3RPU A;  4CGZ A;  2VC1 A;  2M8E A;  3M8F A;  2A5Y B;  1I1G A;  5ICG A;  2DAO A;  3KE2 A;  3TGN A;  4AWX B;  2COM A;  4AD9 A;  2UXN A;  1MJ9 A;  2MA3 A;  1J7K A;  2STT A;  4AVP A;  1V4R A;  3O6B B;  3T1B A;  3FXQ A;  2IJL A;  3WTS C;  3KZZ A;  1D3Y A;  4RS8 A;  4RGR A;  3LST A;  2IPQ X;  1UCR A;  1XMK A;  4JBA A;  3WOD F;  3GZ6 A;  1W7P D;  4L18 B;  1XMA A;  3CTA A;  3H92 A;  1ZGA A;  3C1D A;  2FU4 A;  4R8H A;  4KUM A;  4WF2 A;  2H09 A;  4LB6 B;  3I0T A;  2GWR A;  2BEO A;  5H6R A;  3H3U A;  1SD4 A;  2P5V A;  2JRT A;  2O03 A;  2PMU A;  2OQR A;  3GWZ A;  4YIF A;  1X3U A;  4UXN A;  2IRF G;  2RN7 A;  1QBJ A;  4OIR F;  4JK1 X;  4HDU A;  4E70 A;  1JHH A;  2G7U A;  2CFX A;  1ON1 A;  2R3S A;  1PP7 U;  2ACJ A;  2LSO A;  1S3J A;  3DKW A;  4IRI A;  1QZY A;  4O3M A;  1TW2 A;  2GXG A;  2RV8 A;  3K1M A;  1IN5 A;  3KET A;  4IRH A;  5LEK A;  4KT5 C;  5FLX K;  3ECO A;  3KP4 A;  4ENK A;  2FBH A;  3QAH A;  3IRR A;  1KU9 A;  2HEO A;  3J81 K;  1HW1 A;  4YG2 F;  4MEY F;  2L02 A;  4CIC A;  5H20 A;  3ZMS A;  2HKO A;  3REO A;  1XGN A;  4ZH4 F;  3V8J A;  4FT8 A;  3U1D A;  3ABU A;  4P9U A;  4B09 A;  2XGX A;  2JTV A;  1K6O A;  4LGW A;  4RGU A;  1P4A A;  4IVN A;  5L3C A;  1LJ9 A;  3LA3 A;  1KQ9 A;  3TOB A;  3WE3 A;  3KP2 A;  3E6M A;  4BAY A;  2K02 A;  3HUG A;  5F6F A;  4BYY A;  5CVI A;  4EM1 A;  1ZAO A;  1HKQ A;  4YII A;  3KP7 A;  1ULY A;  1R5G A;  1J75 A;  2H27 A;  4A0X A;  3WTV C;  1YYV A;  2YR2 A;  3HYI A;  1RI7 A;  1ZRC A;  4G94 A;  4UHT A;  2QBY A;  4I02 A;  1T38 A;  3NRV A;  5D5X B;  1T6S A;  1LDK B;  2ZKZ A;  5CVV A;  3JSP A;  1R1T A;  2A68 F;  3C7J A;  3S2W A;  4ESF A;  3K9T A;  4IRG A;  2L01 A;  1MDM B;  2VON A;  1Z9C A;  3PQK A;  3ELK A;  4U88 A;  1W5T A;  1ONV A;  4ZYD A;  2PMH A;  5LHH A;  5HDK A;  1O3Q A;  4RB3 C;  2VOO A;  2VE8 A;  4MQ9 F;  2QM3 A;  4P96 A;  1U8R A;  1IXC A;  3LA2 A;  1BI0 A;  4XRF A;  4S05 A;  4MQV A;  2E7X A;  4U7D A;  2EFN A;  5A2Q K;  1YLF A;  1IZ1 A;  3WTY C;  2V6C A;  1MKM A;  3R0J A;  4L9V A;  1J9I A;  3GUD A;  5H6Q A;  2NRA C;  3WTW C;  1HKT A;  1ZRE A;  4KA4 A;  3R60 A;  2GXB A;  3HOS A;  5J8F A;  2M1B A;  2VXZ A;  5TRD A;  4HLX A;  4LK0 F;  4I7H A;  2RQP A;  2DLL A;  4PGG A;  4KFC A;  4NHJ A;  1U5T C;  3HRM A;  3GFL A;  5FD6 A;  1QNT A;  3EET A;  4FX0 A;  5DCF A;  3DV8 A;  1GXQ A;  5E1X A;  3T8T A;  2F5F A;  1BIB A;  3ECH A;  2QQ9 A;  5D5U B;  4I0B A;  2ESH A;  3FXU A;  2STW A;  2XAQ A;  5LRS A;  4MTD A;  4BHC A;  2D1V A;  5CJ9 A;  4L9J A;  2BE5 F;  5DV5 A;  5IT9 K;  2HYF A;  1CF7 B;  4GXO A;  3M9A A;  2XAH A;  1R7J A;  2FF4 A;  1SD6 A;  3T0Y A;  1STZ A;  3JW4 A;  4WX9 A;  1E17 A;  2MH9 A;  3ZN0 A;  1Y0U A;  3JAM Z;  3F3X A;  1FBU A;  1HKS A;  4GYG A;  2P5L C;  3C3W A;  1F4K A;  4WWC A;  3HTU A;  3WU1 B;  1Z7U A;  3L7W A;  4R79 A;  3GW2 A;  1F9N A;  1KQ0 A;  2CWE A;  4Y17 A;  3R4K A;  1LDD A;  1IN6 A;  3TOA A;  2OU2 A;  1FYK A;  4CZZ A;  1OKR A;  4O6J A;  2CSO A;  2HOE A;  4G9Y A;  1WKM A;  4GO1 A;  4LLG F;  1J59 A;  5DUK A;  1OYW A;  2P8T A;  4LD5 A;  1LQ1 A;  2RNJ A;  3D0S A;  4ESJ A;  2GAU A;  1XD7 A;  1W5S A;  1SMT A;  4EJT A;  3B73 A;  1H0M A;  1BI2 A;  4Y13 A;  2F5C A;  3MWM A;  4G7O F;  4KIB A;  2FMY A;  3D5L A;  4G6D A;  3HSE A;  3QPT A;  2RGV A;  1R22 A;  3V7C A;  1VTN C;  4A5N A;  1KU2 A;  1YW7 A;  2MC3 A;  5LHI A;  1S29 A;  1IN7 A;  4YFK F;  2Z9O A;  1B9M A;  4XSZ F;  2RKH A;  3SXY A;  4BH9 A;  2YSR A;  3GZ5 A;  3DFG A;  2L3D A;  1SD5 A;  1HSJ A;  1WQ2 A;  1QPM A;  2ZCW A;  5K5R A;  5E18 F;  2E7W A;  3GYH X;  3LA7 A;  5E1Z B;  1TLH B;  1DUX C;  3J80 K;  1DPR A;  1B6A A;  3EYI A;  2IT0 A;  2JZY A;  5K1Y A;  4QWQ A;  2ZNY A;  2LNB A;  5LEJ A;  1SD7 A;  2YU3 A;  4NQW A;  3FX3 A;  4HX7 A;  1IN4 A;  1QQI A;  1HXD A;  2H94 A;  1OYY A;  2MH2 A;  2XAF A;  3BY6 A;  1JE8 A;  3KLN A;  2XKP A;  5E20 A;  4MNU A;  3E6C C;  2CYY A;  1RIO H;  3MFK A;  4AIH A;  1JHF A;  5CVU A;  2D1H A;  4ZYH A;  5BPI A;  2M87 A;  1SAX A;  1HW5 A;  2L54 A;  2F5D A;  4RGS A;  3U2R A;  4HX4 A;  5D5W B;  2MLK A;  4L0Y B;  1IXS B;  5EEH A;  1B59 A;  1BBY A;  2A61 A;  2VOP A;  1SMY F;  4I01 A;  4LB5 A;  3RKW A;  4Y15 A;  4WXC A;  2Y0M A;  3LWF A;  4M72 A;  3WTX C;  2IP2 A;  3PQJ A;  2DI3 A;  5AIQ A;  2V1U A;  3ROU A;  4R1H A;  1SFE A;  2IVM A;  1AOY A;  4OOI A;  4HV5 A;  2D2W A;  1P2F A;  1DP7 P;  3F8F A;  2LF7 A;  1HST A;  1UHW A;  2MLG A;  3P9K A;  2YX7 A; 
#chains in the Genus database with same CATH topology
 3BR3 A;  3BDD A;  4PCQ A;  1NH3 A;  1H9T A;  1FEX A;  4HRI A;  2I8D A;  5LGT A;  3ERM A;  2JVH A;  2OD5 A;  3IRQ A;  1XX5 A;  4M9S A;  1WCM J;  3DP7 A;  4P9F A;  2QEN A;  5D4S A;  3Q0V A;  2YX4 A;  2ZSI B;  3TW6 A;  3QRF F;  2E1N A;  3PM1 A;  4L0Z B;  1OCT C;  1YOV B;  2ECC A;  1BW5 A;  2I10 A;  1MGT A;  4EMS A;  4HX8 A;  5CLS A;  4MEX F;  1ENH A;  4DYC A;  4M73 A;  2JUC A;  3WTT C;  3FWE A;  1W0T A;  4H4K C;  2GXA A;  2XF5 A;  2M4G A;  3S3O A;  2HQR A;  1RR8 C;  1MMD A;  2XF7 A;  4XL9 A;  3L9F A;  5JI6 A;  2F5E A;  4LLN A;  4A2U A;  3GZN B;  4UUS B;  4HW0 A;  1BOA A;  2W25 A;  3Q5F A;  2K27 A;  1FWZ A;  2CH0 A;  3KP3 A;  2VLA A;  2JSC A;  2NXN B;  4BAC A;  3NAR A;  2QSH X;  5LGN A;  4YEJ A;  3CUQ C;  1LE8 A;  4O5V A;  5AON A;  1R71 A;  4ZYG A;  4ZYE A;  2CW7 A;  2ZME A;  3P7N A;  4Q4Z F;  4HAM A;  3MZH A;  4G7H F;  3HB9 A;  5F64 A;  4AID A;  2ELH A;  1W4M A;  3OYB A;  5HOO A;  4J01 A;  1V3F A;  3W6J B;  1VFC A;  4QLC U;  3BC8 A;  1KQ8 A;  4ESB A;  1H9G A;  4N4N B;  4ZDO A;  5BS6 A;  3V4G A;  1T56 A;  3DPT A;  2FOK A;  3TMO A;  1W7P A;  2X1E A;  3ASO H;  1KGS A;  3QYB A;  2GA1 A;  1DPU A;  1Y1V J;  2O6G E;  1U3E M;  2Z2S B;  1QZZ A;  3GME A;  4GDF A;  1ZKG A;  2LDU A;  3FXR A;  3GVA A;  1FOY A;  1QO0 D;  1ZTR A;  2XVC A;  3OY9 A;  2VT2 A;  3VB2 A;  4C2M J;  1X1B A;  1YI2 I;  1UJ8 A;  4FHT A;  4MO7 A;  2OA4 A;  2LKP A;  2A5W A;  1YE9 A;  2DMP A;  2VE9 A;  2IS1 A;  4RAF A;  4PZJ A;  4AIK A;  4XKC A;  2FBI A;  2WWY A;  2HFH A;  3FXM A;  1VQ6 I;  1R1V A;  2DMN A;  4XR6 A;  4YEL A;  1X1P A;  4B43 A;  1HF0 A;  1FYL A;  1MDM A;  4DZP A;  3OV8 A;  1OFC X;  4B1R A;  1MJA A;  1FNN A;  3K1P A;  2O0Y A;  2VIX A;  3I4M J;  5EGO A;  5JR3 A;  4PJ0 C;  1LNW A;  5CPR B;  4A3D J;  3I4N J;  3F21 A;  3GTM J;  3IWF A;  3V7S A;  5LHG A;  3ABM H;  1X2M A;  2FD5 A;  2DN0 A;  2KRF A;  2DDB A;  1UB9 A;  1KYW A;  2QQ8 A;  3RQ4 A;  1Z67 A;  5BNG A;  2HXI A;  2K3F A;  2QEX I;  2R7V A;  2E71 A;  4MGR A;  2V79 A;  3W2W A;  1TT5 B;  1ZGW A;  3BOQ A;  1AU7 A;  3OYC A;  4D5F A;  3OYI A;  4OIQ F;  3AKZ A;  2V6E A;  2RC4 A;  1P4W A;  1X3W B;  2EA4 A;  2WA0 A;  2DQR A;  3F72 A;  5FRM A;  1ZG3 A;  2HNH A;  2W57 A;  2LF8 A;  1XS9 A;  4BGD A;  3EYY A;  4OU0 A;  4P55 A;  4XID A;  3EUK L;  2P0W A;  3TO7 A;  3JRB A;  2DPD A;  1IN8 A;  2V1D A;  3CC7 I;  1R49 A;  3IV5 A;  3FXO A;  4LIU A;  2X6Y A;  2K86 A;  5HLT A;  1MSF C;  3ZXS A;  3SZP A;  4ZDL A;  1YO5 C;  3F8C A;  5TGT A;  5FO5 A;  1IF1 A;  4KIG A;  1BA5 A;  3H5R A;  4KMU X;  2G0E A;  2WY7 Q;  3K69 A;  3LSH A;  2F5V A;  2KKO A;  4A3I J;  1FMV A;  2NS8 A;  3B6C A;  1DU6 A;  3N05 A;  3SEZ A;  1TQM A;  4B4C A;  2K9N A;  3FXK A;  3OYM A;  1Y0N A;  5D8L B;  1JUM A;  1R6R A;  2QWW A;  4L9N A;  5HLI A;  2VBW A;  3M8J A;  4G6Q A;  3SDG A;  1OMI A;  4H0E A;  2NVQ J;  3FHN A;  2HWV A;  4N0B A;  5KVR A;  2WAQ A;  5E1W A;  1U78 A;  1IRZ A;  4HA8 A;  2NOG A;  5DUI A;  4XKW A;  1QHH D;  2ZB9 A;  2CS3 A;  2EIN H;  1MND A;  2R7O A;  3M1E A;  5KAI C;  1SVM A;  3CMY A;  2QZ8 A;  2L2O A;  1AKH A;  2BVM A;  2UXX A;  4QPO A;  2P5K A;  2KLO A;  1BR2 A;  1ZAR A;  1GHC A;  2M7A A;  2B63 J;  2ZJ2 A;  1S5L C;  4Y33 A;  2M0C A;  4JX5 A;  3VYT B;  3GFM A;  4F92 B;  2LP0 A;  2CV2 A;  2JJ7 A;  4Q47 A;  3CUQ B;  1ODD A;  4OMY A;  2E1C A;  4PFO A;  1BJA A;  2IA1 A;  4PJN A;  2R7W A;  1G3Y A;  3BTI A;  3GXO A;  1B4A A;  1NHA A;  3EPZ A;  3ZMV A;  3HSF A;  4Y52 J;  2NS0 A;  1BN5 A;  2HR3 A;  2OF7 A;  3CF5 F;  3ZCO A;  1LEB A;  4OIN F;  2JVG A;  2QUF A;  3WGG A;  1P7I A;  1OCZ H;  3MMY B;  2EJR A;  5KNL A;  2ZO4 A;  3GO5 A;  2DYR H;  5F08 A;  1VZ0 A;  4BHB A;  3BWG A;  3FM3 A;  2RQQ A;  3K70 D;  2CQQ A;  2R4G A;  3N97 A;  3HGG A;  1BI1 A;  1FY7 A;  3PJR A;  1ZQ3 P;  1ZYR F;  3E5Q A;  2QSG X;  2ZXH A;  5J8C A;  2E5Z A;  3KP5 A;  4IXA A;  1BC8 C;  2KDO A;  2P6T A;  1MBG A;  5FD5 A;  4A3J J;  1TBX A;  4AYB N;  2OJE D;  5HLG A;  2W84 A;  1YTY A;  4IHX A;  4EJV A;  5FKN A;  3KX2 A;  3S1Q J;  5A2Q Z;  9ANT A;  1F1Z A;  2JPB A;  4PSX A;  1LPQ A;  1KU7 A;  3DU6 A;  3BJA A;  4IOC F;  2PBI A;  4HNV A;  2GQQ A;  4GGG A;  3ZQQ A;  2V9P A;  4C3H J;  1K4S A;  1A35 A;  2E5N A;  3IP4 B;  2A3S A;  3A02 A;  1FPQ A;  3FHZ A;  1VQ4 I;  2HOA A;  1U8B A;  1O7F A;  1S7O A;  3CME I;  2LMD A;  4BQN A;  3HTS B;  2DT5 A;  3W6K B;  3HUG B;  1T98 A;  2XF6 A;  1MIJ A;  2VBX A;  3I53 A;  2ZNZ A;  4A12 A;  2CGP A;  3I3L A;  4CYD A;  3SZT A;  4HST A;  5KK1 A;  1EA3 A;  2KQR A;  3CC2 I;  4IKF A;  2B9S A;  4NQW B;  1RRJ A;  2GIV A;  2H1L A;  1Z0X A;  2ADU A;  3DXJ F;  3VEP A;  4LG0 B;  4IHY A;  5IYC J;  2X4H A;  3PO2 J;  2XGD A;  2XIG A;  1T08 B;  2FA5 A;  4XON A;  3TDU C;  1D8J A;  3OWT A;  1E3O C;  1USS A;  4IPA A;  4G8X A;  5HDN A;  3JRA A;  1IUY A;  3M1C A;  3G1M A;  4HF0 A;  3G73 A;  3IHU A;  5IP7 J;  3RKQ A;  5CYV A;  1SC7 A;  1ZGJ A;  2VQL A;  2R93 J;  2DA2 A;  4PGH A;  1TWC J;  2Y75 A;  4XN0 A;  3MKW B;  5FKK A;  5JHF A;  3VWB A;  1XSV A;  1YIJ I;  3E1S A;  1HLV A;  4WK8 F;  3JRH A;  3Q3S A;  2H1K A;  2M30 A;  2Z1D A;  2Y0S N;  4UB8 C;  5KHD A;  2V9V A;  3U1K A;  1J2X A;  4XRS A;  1P6R A;  5IYD J;  1VQ5 I;  2ZFW A;  4C2T A;  2KPM A;  5E79 C;  4IHT A;  1I1S A;  4XN3 A;  2WV1 A;  2P4W A;  1Z1D A;  4S04 A;  2ISZ A;  4M6Y A;  5M5W J;  5E3O A;  2R5Z A;  1ZG1 A;  1MJB A;  1TNT A;  1R1U A;  3BR5 A;  3SHF A;  5LLQ A;  1BIA A;  1XPX A;  1OCP A;  3IH4 A;  3GTL J;  4M74 A;  2W7N A;  3N4M A;  5ED4 A;  1E3H A;  2OAZ A;  4HG2 A;  4RDU A;  3GX4 X;  1JT0 A;  4IHW A;  4MLO A;  3JAM K;  4X1E A;  2CMP A;  1XCV A;  1U2W A;  1WFX A;  2E2J J;  2VN2 A;  4PJM A;  3H1C A;  3JRD A;  2KT0 A;  4CZC A;  1W5C C;  2Q0O A;  3BPX A;  2Y31 A;  4FTH A;  3CCL I;  3K2A A;  4Z6Y A;  3P9I A;  4B8X A;  2OCC H;  5F1R A;  1ON2 A;  3E0J B;  4EJW A;  3BJ6 A;  3FBN B;  1MNM C;  2V1X A;  3I5U A;  3RYR A;  4EEF G;  2EB7 A;  1T39 A;  3KZI C;  1WHU A;  4DOZ A;  4DZJ A;  2CO5 A;  3BTC A;  2RDP A;  1XGM A;  2LVS A;  2A6H F;  3DPU A;  3QPH A;  2MD0 A;  3V7R A;  2VKD A;  4YFN F;  3NQO A;  1PUF A;  4U7B A;  3J7Y J;  2VB6 A;  5DD4 A;  5F04 A;  5GTH C;  4L9T A;  1D5Y A;  4XOT A;  1JGG A;  4A5M A;  3LAJ A;  1O3R A;  2Z3Y A;  4U0W A;  5IYB J;  2EIK H;  4HQE A;  2R5Z B;  1MZB A;  1D0Y A;  3VOE A;  1XGO A;  4B3X A;  4ZDP A;  3E5U A;  1B9N A;  3IKV A;  3CCR I;  3CP2 A;  2O3F A;  4HQM A;  1YW9 A;  1ACI A;  1PYV A;  5EF6 A;  1YJW I;  2EFQ A;  3RDI A;  2HU9 A;  3R6S A;  1IC8 A;  3HOV J;  3OMY A;  2NYX A;  3L2C A;  2NNN A;  3QOD A;  1SEU A;  3IH3 A;  4KIC A;  2KZG A;  1ZK8 A;  1P92 A;  2XAS A;  3TO6 A;  5L3F A;  3K4N A;  5HLH A;  3CUQ A;  3KCC A;  2DK5 A;  3BG7 A;  4V2G A;  3ZMT A;  3CQZ J;  1E0E A;  5M3F J;  1U5T B;  2AQE A;  1OIS A;  3R0A A;  3RPQ A;  2CUZ A;  3LSI A;  1YFH A;  5D8K B;  3H36 A;  2TDX A;  1FLI A;  1R00 A;  1FSE A;  5ERI A;  5GAG J;  1FOK A;  3E3V A;  1PJR A;  1FTT A;  1A31 A;  2LBF A;  2Z5U A;  4U0Y A;  1Y6I A;  1IXR C;  2PG4 A;  2EV0 A;  3KFW X;  4XLF A;  5LGU A;  1IAW A;  2EA2 A;  1X4O A;  3JRF A;  2IGN A;  2FRH A;  1GVJ A;  3T5X A;  2GOM A;  4IF4 A;  1YQA A;  1LKX A;  2LG4 A;  3VYU B;  2QLZ A;  1GVD A;  5DYM A;  3HHH A;  1Y39 A;  3TP0 A;  3L09 A;  2QF7 A;  1LUJ B;  4DNC A;  3QP5 A;  2DT7 B;  3A0H C;  3OL4 A;  4F3Q A;  1MMA A;  4XKV A;  5FJ8 J;  3HPG A;  5D6F A;  1ZH5 A;  2B0L A;  2IA2 A;  2HTS A;  4KMF A;  2DA5 A;  3MAJ A;  5ILV A;  1J5Y A;  1EH7 A;  1KA8 A;  2F4M B;  1E2X A;  3TP3 A;  3PO3 J;  3V8K A;  1R5H A;  2WAD A;  4XRS G;  4BQO A;  5BOX A;  3LOC A;  1LFB A;  2QVO A;  1OPC A;  5EJC A;  3I54 A;  1P9Q C;  2AS5 F;  1Z05 A;  2A07 F;  2LFB A;  5IP6 A;  3FMS A;  3M8E A;  4IEJ A;  1FOX A;  5JVT A;  2CUJ A;  2W24 A;  3AAF A;  2DBB A;  5L3B A;  1JTX A;  1Z6R A;  2JA5 J;  1EKE A;  2G9W A;  1GDT A;  1RNL A;  1F36 A;  2JRM A;  1ETX A;  3K1N A;  3WGH A;  3JSO A;  5D5V B;  3K0L A;  1MSE C;  1KU3 A;  5CVJ A;  1C0W A;  2A6T A;  4ETS A;  3DQV C;  3QYE A;  1IDY A;  2EK5 A;  1G3W A;  2BY1 A;  2EV5 A;  4Q48 A;  4ENJ A;  1YIT I;  5B3S H;  3CZ6 A;  3DF8 A;  2WV0 A;  4QPQ A;  2DQL A;  2QCO A;  1HCR A;  1ZRD A;  2CV1 A;  5HVQ C;  2QQA A;  2OZ6 A;  2WB1 N;  1T2K A;  3I4P A;  3CLO A;  3HRT A;  5M5X J;  2DW4 A;  4KYW A;  4RBO A;  5IP9 J;  2HYG D;  1AHD P;  3GEZ A;  1G8X A;  2XKO A;  1LVK A;  2A05 A;  2LD5 A;  2HZD A;  2GM4 A;  4B47 A;  4RA2 A;  4RB0 A;  3IAS 2;  1U5T A;  1ETQ A;  2IA0 A;  2L7K A;  5ICF A;  1G3T A;  4DYR A;  2DOF A;  2UWM A;  3CCS I;  4BE2 A;  2HZT A;  2OUM A;  1D1A A;  4BDZ A;  3PSF A;  5HS7 A;  4LLL A;  3VPR A;  2PX9 A;  1WH7 A;  2VKV A;  2ISY A;  2OTJ I;  3KYL A;  1FOW A;  2JA2 A;  4S0H B;  1K79 A;  5DCM A;  4PUS A;  1TL8 A;  2VBZ A;  4RMN A;  4CH7 A;  3NAU A;  1WVR A;  3O2P E;  1FP1 D;  3O3K A;  5HS8 A;  3GFJ A;  3EDP A;  2ECB A;  4WXH A;  2BOL A;  3ZMD A;  3HL2 A;  2DTZ A;  4RAY A;  1NK3 P;  3LSM A;  5BQT A;  3OYF A;  3G1O A;  3HOT A;  5B5E C;  1XDS A;  3WTU C;  1GXP A;  3L2W A;  4CDG A;  3FBI B;  1MMG A;  1X4P A;  2KRC A;  3BP8 A;  5J47 A;  1TWG J;  2L7M P;  3V8L A;  4BY7 J;  2VPR A;  3CJQ B;  5HDG A;  4RGX A;  3EQL F;  1ZRF A;  1XN7 A;  3CCY A;  3MQ0 A;  4CXF A;  3BG9 A;  3ZP5 A;  4ITV A;  2R7Z J;  1S9H A;  2BBY A;  4KNY A;  1G6N A;  2FX0 A;  1UAA A;  5C44 J;  2R7D A;  2XGC A;  3GBG A;  1Z3X A;  2X6W A;  4I99 C;  3M7G A;  1ZHF A;  1L3L A;  3SQN A;  4HF1 A;  3MVP A;  2XSJ C;  4MTE A;  3S16 J;  1O4X A;  2ZSH B;  2LC2 A;  1LB2 A;  3AG1 H;  4A6E A;  2BZT A;  3CES A;  2L9S A;  2VAS A;  2D45 A;  5B1B H;  3DKX A;  3SEQ A;  2BV6 A;  2GBY A;  3PUB A;  5ILS A;  4BXU A;  4Z2Y A;  3BTL A;  1JGS A;  2RAE A;  2ZXJ A;  1MBE A;  3F6V A;  1BR4 A;  4MFE A;  1TQP A;  1XTA A;  3DKY A;  4ZZL A;  3FM5 A;  3CUO A;  2KDZ A;  2H8R A;  4ASN A;  1A5J A;  1SFK A;  3BCA A;  1W36 C;  1SAN A;  5L3E A;  5EDN A;  2O5R A;  1SFU A;  2Y2Z A;  4HBL A;  1X1D A;  5GAE J;  3PL8 A;  4AVZ A;  3S3M A;  5HS9 A;  3KEY A;  4EGZ A;  3Q0U A;  5DCM B;  1YS7 A;  5IOY A;  2VJI A;  2IBD A;  1Z7L A;  4I98 B;  3ABT A;  1I39 A;  1S7A A;  1U6G A;  1YG2 A;  1KON A;  1WI3 A;  3VOD A;  3GTJ J;  3WU0 A;  2J5P A;  1YS6 A;  4HV6 A;  3SFZ A;  3WHC A;  2X9D A;  3CCM I;  3W2A A;  3HM5 A;  3G6E I;  3H5N A;  2NVT J;  1N25 A;  4BNC A;  2AQF A;  5EEG A;  4QTR A;  5FLX Z;  1ZLK A;  1FIA A;  3PNV A;  3AL0 B;  4KDP A;  2F4I A;  1I27 A;  3DBH B;  4LJZ F;  5JVG F;  1N78 A;  1R4N B;  1LVA A;  2KIS A;  2FEZ A;  4MIM A;  1N77 A;  1FX7 A;  3CO6 C;  1RES A;  4M71 A;  4TV7 A;  3A03 A;  3E6D A;  4D9J A;  5E3N A;  3K70 C;  4HOB A;  4A3C J;  2HQN A;  1XSD A;  3ZMZ A;  5E17 F;  3I55 I;  1UFM A;  2AO9 A;  3A1Y A;  3LQQ A;  5GP9 A;  3CJN A;  3VFZ A;  1RZ4 A;  1OR7 A;  1WJC A;  3CF2 A;  3HRS A;  3MCZ A;  5E8G A;  1X19 A;  2CQK A;  2FE3 A;  2PJP A;  3ML6 A;  4RB2 C;  3JRG A;  3OYE A;  1OCR H;  2BGC A;  1VQ8 I;  2NS7 A;  4L5I A;  4V2F A;  4A3K J;  3I59 B;  3ZPL A;  3ASN H;  4YRV A;  3JCU C;  1XSX A;  3K2Z A;  2KIQ A;  2L4A A;  3DLA A;  2ESN A;  3FXL A;  2V4J C;  4BL0 B;  3R61 A;  3WE2 A;  1CGP A;  1RUN A;  2IW5 A;  4FX4 A;  4IOA F;  4I09 A;  3LAP A;  3ZR8 X;  2NVX J;  4A3F J;  2CW8 A;  2EFP A;  4D5C A;  2L4M A;  1V5F A;  4K2E A;  1TWA J;  2MGQ A;  4JYK A;  4UV9 A;  3DBR B;  2XAU A;  2FXA A;  4UVB A;  1J0R A;  1PDN C;  2V26 A;  3IC7 A;  3ZQG A;  3OSF A;  3LQR A;  2ETH A;  4NBQ A;  4N9I A;  1DU0 A;  3DEE A;  2L9V A;  2CQN A;  5M3M J;  2H8W A;  2X1D A;  3KZY A;  5CVR A;  5JHU A;  4Y7N J;  2M2E A;  4KJZ A;  1HW2 A;  1L0O C;  3H9J A;  4NNJ A;  1K7A A;  2JWT A;  2P7V B;  2CV0 A;  1V55 H;  3I59 A;  2K4B A;  4JQF A;  6PAX A;  2Q8K A;  5HNH A;  2DJN A;  5K5Q A;  1TWF J;  2EZH A;  2XB5 A;  1ZEL A;  4F55 A;  3ZN1 A;  2PQ8 A;  2LTP A;  3IUO A;  4CHU A;  1MH3 A;  3HOX J;  3ULQ B;  2HOS A;  2VBY A;  3F6O A;  2UZK A;  4AIJ A;  1YIO A;  1EH6 A;  4PDK A;  1FIP A;  2HTJ A;  3TO9 A;  4KIF A;  3GTO J;  3DBL B;  2P6S A;  3RKX A;  3F9K A;  5ICC A;  1AWC A;  2NVY J;  1APL C;  1GT0 C;  2M0M A;  2I5U A;  1NTC A;  5EGO B;  3OIP A;  2XV4 S;  2LKX A;  2Q2E B;  2KIM A;  4BJT A;  3GLL A;  4CCM A;  1DDN A;  1WSU A;  1ORK A;  2RVC A;  2Q2E A;  3T8R A;  4WCG A;  1WH5 A;  4EQQ A;  3AFH A;  1OYI A;  3J81 Z;  2KIU A;  3RJP A;  3CO7 C;  1WJD A;  2GLO A;  3K7A J;  3OYJ A;  1F5T A;  4ENN A;  1SAU A;  2K5C A;  5J4V A;  2ZJR F;  4BBS J;  2JPC A;  3F23 A;  3W6V A;  3JTG A;  2L7Z A;  3TQN A;  1XG1 A;  4OAZ A;  3TDZ C;  5FRO A;  2W4S A;  1R36 A;  4LG0 A;  5AIP A;  1XGS A;  2JUG A;  3D5R C;  4HF2 A;  5DM6 F;  4CUG A;  2VC0 A;  3CDL A;  4GYI A;  1K78 B;  2A6E F;  2EIJ H;  1YJN I;  2YS9 A;  3FMQ A;  2DO7 A;  4OMZ A;  4CCK A;  2M5W A;  2VJ4 A;  4XRM A;  4HPQ A;  2C6Y A;  2VKE A;  2Y69 H;  2IAI A;  2J5O A;  2HDW A;  1TC3 C;  2XHK A;  1AA7 A;  4CCJ A;  1PUF B;  3OIO A;  4F91 B;  2R7R A;  5DDG A;  3F8B A;  1IG7 A;  4UV8 A;  4IJA A;  2DA1 A;  4HYE A;  4OIP F;  2DFH A;  3AL0 C;  5F27 A;  3DPL C;  4HLY A;  3BT9 A;  2FNA A;  2VOD A;  2GA2 A;  1ITY A;  3I71 A;  4U0V A;  3GTQ J;  3L2R A;  1XCB A;  3RCO A;  2E2H J;  2HPM A;  2M45 A;  2PFB A;  5DTD A;  5BMZ A;  1TNS A;  1K4T A;  2E1M C;  2KRH A;  3COA C;  2JT1 A;  4UUT A;  2E1O A;  3CD6 I;  2HQ5 A;  1LEA A;  1UHS A;  2ID3 A;  2D5V A;  1TTY A;  3DWL E;  3IWZ A;  2FBK A;  3Q9S A;  2O61 A;  3M07 A;  4UVC A;  4WXD A;  3TBI A;  5IT3 A;  2R5Y B;  2HGC A;  3NWT A;  1RUO A;  4D0P A;  3LMM A;  3HC7 A;  3OR1 C;  2Z99 A;  4XSX F;  1OCC H;  1UG0 A;  2UV1 A;  1A6I A;  4B48 A;  2NVU B;  3MKZ A;  2GIZ A;  3H3Z A;  4HZF A;  2PLY A;  3G71 I;  4RM2 A;  4OAY A;  2EWN A;  1I6X A;  1UG2 A;  3FF5 A;  3RZO J;  2FQ4 A;  1RR7 A;  3FZV A;  3GTK J;  5M5Y J;  3ZQ7 A;  1WGX A;  3QU6 A;  4II2 A;  1ETY A;  5E3L A;  2XB0 X;  3OS2 A;  2R0Q C;  1BC7 C;  3MZY A;  4LG3 A;  3E97 A;  5EZH A;  2R92 J;  5KAF C;  2X0L A;  5FGM A;  2WC2 A;  3Q0W A;  2EQR A;  1ZN2 A;  3SFI A;  5GAD J;  1ETK A;  5F0H A;  3WGI A;  1T0F C;  1YW8 A;  4P5O A;  1VQP I;  3DTK A;  2NNY A;  1JXS A;  2CRG A;  5D6E A;  5DD8 A;  2DXI A;  5FFZ A;  1FP2 A;  1VQO I;  2ZXI A;  3QWL A;  1UEL B;  2UUZ A;  1EF4 A;  4RB1 A;  3CCQ I;  3IKT A;  3TKY A;  4EM0 B;  2KJC A;  3LNQ A;  1FSH A;  5FB2 A;  1IUF A;  1A04 A;  5ICE A;  1CF7 A;  2Y9Z A;  4EJU A;  3DEU A;  4DYQ A;  2PN6 A;  1EH8 A;  3KEQ A;  3S14 J;  4G6T B;  1S6L A;  3G3Z A;  3PNT A;  1TW3 A;  1MH4 A;  2V1N A;  2ZFU A;  3QP6 A;  1G59 A;  1WJA A;  1H89 C;  5EG0 A;  5FRN A;  1KYZ A;  2GZW A;  2KHM A;  3RKY A;  4BJ6 C;  1Z3Y A;  2NAZ A;  4BQQ A;  1HA8 A;  4RAZ A;  2XAG A;  2DPU A;  2XDV A;  2VT3 A;  4N9H A;  1R58 A;  1IDZ A;  3A4C A;  2KZV A;  3MZ8 A;  2BHY A;  4BKX A;  1TQI A;  2ZME B;  3RPU D;  2K9M A;  4F7Z A;  2QA4 I;  5JLX A;  2QKM B;  1TP4 A;  1IRF A;  2TRT A;  2BY0 A;  3EUH C;  1POG A;  4AC0 A;  4UVA A;  4RAG A;  3B02 A;  3GTG J;  3PNY A;  3FMR A;  3I58 A;  5HNF A;  4CCL A;  2OC6 A;  2EFW A;  2E2I J;  5IT9 Z;  4EVI A;  3CMA I;  3A2K A;  3S32 A;  4XMY A;  3S15 J;  3L1P A;  5CQE A;  4F93 B;  1FBS A;  2BY3 A;  4A3L J;  2K3P A;  3F8N A;  4LMY A;  2BVL A;  4W97 A;  2PI0 A;  2HVQ A;  1HBX G;  2R7F A;  4ZZD A;  4CSW A;  3HRU A;  3KLO A;  1K78 A;  2LH9 A;  4X0G A;  2ZBK A;  3DU5 A;  3QU3 A;  1PP8 F;  4FQG A;  1S8N A;  3HGY A;  3E5X A;  1YHQ I;  4C9Y A;  2OQG A;  2DOD A;  2ID6 A;  3CDH A;  2LBF B;  1G3S A;  4BXX J;  4XK4 A;  3P9C A;  3OYG A;  4XLA A;  3PFY A;  2Z33 A;  2IGO A;  1X58 A;  2H6B A;  2K4J A;  3TED A;  4M9X A;  3ZMU A;  4LIT A;  5J40 A;  3GLX A;  2XPU A;  2DA7 A;  3BQY A;  4EJO A;  4DBR A;  2BHZ A;  3WG9 A;  2CW0 F;  4ON0 A;  3BJO A;  1XDU A;  1WWX A;  3FK6 A;  3BZK A;  3IAM 2;  3F8M A;  4G7Z F;  4HSR A;  5C4J J;  2AXL A;  1E3P A;  5J3L A;  1XMX A;  3GF2 A;  4YFX F;  2PMZ A;  2Y48 A;  2O8K A;  2BY2 A;  5BPD A;  1R23 A;  2F2E A;  1BI3 A;  1UHM A;  2W85 A;  2FSW A;  3KIO A;  3PUF A;  1FZP B;  3WTZ A;  5LBQ A;  2FOW A;  1PUE E;  3AG2 H;  1P4X A;  2O8X A;  3ZQC A;  3MEX A;  4RM3 A;  1FYM A;  3BZ6 A;  4EAT A;  3D5S C;  4OIO F;  2CG4 A;  2ELK A;  3RYP A;  4XLP F;  4ZTF A;  2HDC A;  2FQ3 A;  2NOJ B;  4EM2 A;  5JFR A;  4F52 A;  2DMU A;  1I6H J;  4A6D A;  4PJJ A;  3LSG A;  2XRN A;  3C2B A;  1RPW A;  5K5O A;  3F0C A;  3J80 Z;  2O9L A;  3C18 A;  5KCM A;  3W3C A;  1IRG A;  4E7K A;  1D8K A;  1R9T J;  1HQC A;  2K7L A;  4CCO A;  3BCB A;  2IS6 A;  1REP C;  2PJR B;  2HXO A;  3ABK H;  3E6B A;  4J19 A;  2W48 A;  2P7C B;  2B7E A;  3FKI J;  1MBK A;  1Z6T A;  2YUS A;  3BZC A;  3OIQ A;  1I5Z A;  1O7L A;  5TIS C;  2DCE A;  1FBQ A;  2FUG 2;  4BQA A;  2W82 A;  4II3 A;  4XNF A;  4Q5S F;  2MBF A;  1IV6 A;  3LFK A;  4UNO A;  1X3Z B;  2VXD A;  4GCV A;  1B8I A;  1QHG A;  3HIF A;  1LDJ A;  3KP6 A;  5K7H A;  5K7Z A;  3ABL H;  2BYV E;  1QRY A;  3RTR A;  3BPV A;  1MD0 A;  3L00 A;  2L9N A;  3U9G A;  3PIP F;  3UKG A;  2EH3 A;  2JMW A;  3FDY A;  3OOP A;  1HOM A;  4IX7 A;  4HDV A;  3CCJ I;  5DS9 A;  1QGP A;  4XOR A;  1QZE A;  4BDY A;  3BRO A;  1FJL A;  2DK8 A;  4UUV A;  5E8I A;  1GV5 A;  3Q9V A;  2F6C A;  2X6X A;  4LK1 F;  1H8A C;  1B1B A;  5ILU A;  3FK7 A;  2A69 F;  1PVE A;  1EV7 A;  4IHS A;  4BXF A;  1ZLJ A;  1VQN I;  2HKX A;  5L3D A;  2WTE A;  1VND A;  4XBF A;  4I76 A;  4NB5 A;  2QSF X;  3ERE D;  3ONQ A;  3S1M J;  2L7F P;  3HSR A;  3KEO A;  3GFI A;  2DFE A;  1G4D A;  4AUX A;  1O3T A;  4DW6 A;  2MFZ A;  3H9Q A;  3JTH A;  1X1C A;  3ZOB A;  5FFX A;  2Z16 A;  2G7H A;  3VSK A;  3HBL A;  2DFI A;  4V19 K;  4JP0 A;  2EV6 A;  4EGY A;  3J7A O;  2E1M B;  2YPR A;  1QVU A;  5FKL A;  2OZU A;  1VF9 A;  2EZK A;  3RIR A;  1IGN A;  2DJI A;  3RSN A;  2R7T A;  5J6X A;  1VQK I;  1WJE A;  5IPA A;  1ZG5 A;  1OR7 C;  2Q1Z B;  4MHG A;  3HXL A;  2YU9 J;  5J1U A;  5EZG A;  2R7Q A;  2XC7 A;  1UST A;  4BU2 A;  4KN7 X;  3F22 A;  2IEK A;  3OS1 A;  4M9Z A;  4BHP A;  3OYD A;  3I56 I;  4XIC A;  1IW7 F;  2QQB A;  1FT9 A;  3MN2 A;  2PEX A;  3IL2 A;  4CO8 A;  2FNP A;  2KP6 A;  2V9K A;  3VYS B;  3OYH A;  4ENM A;  2IS2 A;  2LY9 A;  2OBP A;  1W36 D;  4I6Z A;  2X51 A;  3H0D A;  4ABZ A;  3CCE I;  1W7P B;  3HZJ A;  2QBY B;  4IO9 F;  3OOU A;  2N8G A;  2ME0 A;  4HEA 2;  3H9G A;  3P5J A;  1Q1H A;  1T0F A;  2XRO A;  3S1R J;  3TL4 X;  5D4R A;  3HHG A;  3K4C A;  2HS5 A;  3EUA A;  3BG3 A;  1BL0 A;  5L3G A;  5LRR A;  2EFO A;  3JRE A;  4KN4 X;  1JKR C;  1DQU A;  1FC3 A;  1WI9 A;  4BEH A;  2V7F A;  1UZC A;  4LFU A;  1WRJ A;  4I2O A;  4L5J A;  1D5V A;  1LE8 B;  1U9N A;  3I64 A;  2DTR A;  1A36 A;  2IS4 A;  1Y8R B;  4I0A A;  4A3E J;  2K40 A;  2ELJ A;  4A0Z A;  1BW6 A;  4XLN F;  3ISP A;  2OPT A;  1B8I B;  2ZC2 A;  3NEU A;  5DM7 F;  4M6X A;  3CCV I;  3DCF A;  2PMZ N;  2M34 A;  1JUS A;  3S1N J;  3KYC B;  2QKL B;  2XAJ A;  3FIS A;  3ZRG A;  1D1C A;  1SFX A;  2KIF A;  2XUB A;  3PFI A;  5TJJ A;  1K6Y A;  2K9Q A;  2VKH A;  3HEF A;  1GV2 A;  1XB4 A;  2KFD A;  5DEQ A;  2LLK A;  4EV0 A;  2MAB A;  2OCE A;  2KJB A;  3M3Y J;  2FML A;  2MD5 A;  2L9R A;  4M3D A;  1VQL I;  1BM9 A;  4A0Y A;  4D1Q A;  5FKO A;  3W2V A;  3QOP A;  2QYO A;  3RI4 A;  3A0B C;  4DQ2 A;  2Y0S A;  3HG9 A;  2H6C A;  2JSP A;  1O3S A;  1Z91 A;  3EUH A;  2DU9 A;  3K4B A;  1O57 A;  3GCM A;  1R4M B;  3RPU A;  1GUU A;  1B72 B;  4CGZ A;  2VC1 A;  3HPH A;  4M6V A;  2CU7 A;  2M8E A;  3M8F A;  1MBF A;  4IZZ A;  3JR9 A;  3S3N A;  2A5Y B;  4FCY A;  4IQ4 A;  1I1G A;  5ICG A;  2DAO A;  3KE2 A;  1ERD A;  3TGN A;  4AWX B;  3RZD J;  2COM A;  4AD9 A;  2UXN A;  1MJ9 A;  2MA3 A;  4IHV A;  1J7K A;  1G2H A;  4C3I J;  2STT A;  4AVP A;  3LSP A;  1V4R A;  1WZ2 A;  3O6B B;  1JI8 A;  3T1B A;  3FXQ A;  3MD2 A;  3MKL A;  1SVO A;  2IJL A;  2VJ5 A;  5F0C A;  2JN6 A;  3WTS C;  1V54 H;  3KZZ A;  1D3Y A;  2CFO A;  4RGR A;  3C2G A;  2IXS A;  4RS8 A;  3LST A;  2IPQ X;  1UCR A;  1XMK A;  4A3G J;  4JBA A;  2MC4 A;  3WOD F;  3CDI A;  1VQ9 I;  3BR0 A;  3GZ6 A;  1H88 C;  3H3V K;  1W7P D;  4L18 B;  1XMA A;  5C4X J;  3CTA A;  3H92 A;  3MKY B;  4XLC A;  3FXJ A;  1D0Z A;  1ZGA A;  1K61 A;  3C1D A;  2FU4 A;  3BR1 A;  4DBQ A;  1V5E A;  2LY1 A;  4R8H A;  2ZJP F;  1OCO H;  4KUM A;  4WF2 A;  2H09 A;  2JA6 J;  4LB6 B;  2LRE A;  4FE7 A;  5CQG A;  4E7Z A;  3I0T A;  2GWR A;  2BEO A;  2RRE A;  5H6R A;  3H3U A;  4FAS D;  1WJ5 A;  1SD4 A;  2P5V A;  4PFP A;  5C3E J;  1I3A A;  2DYS H;  3VYR B;  2JRT A;  1DP3 A;  4M3F A;  2O03 A;  2PMU A;  2OQR A;  3GWZ A;  3OYA A;  4Y3O A;  3TW7 A;  4YIF A;  1JKQ C;  1S72 I;  1JUP A;  1NG7 A;  1X3U A;  2Y30 A;  4UXN A;  2WAE A;  2RN7 A;  1QBJ A;  2IRF G;  4OIR F;  4JK1 X;  4HDU A;  2IGK A;  4E70 A;  3OYN A;  1JHH A;  4IL6 C;  2G7U A;  4JX6 A;  2CFX A;  4D7M A;  1ON1 A;  3S2D J;  4U87 A;  3ZQH A;  3K4L A;  3K4J A;  2R3S A;  2LRD A;  4KIT B;  1PP7 U;  2ACJ A;  3SDB A;  2LSO A;  3V42 A;  1S3J A;  2M7B A;  3DKW A;  4OWR B;  1I3Q J;  2MYS A;  4IRI A;  2KMU A;  3BLY A;  1QZY A;  4O3M A;  1TW2 A;  1F43 A;  1YRN B;  2GXG A;  5J1R A;  2EIM H;  3I9V 2;  2RV8 A;  3K1M A;  1IN5 A;  3ZQI A;  3KET A;  4IRH A;  5LEK A;  1HDD C;  1IRX A;  2E19 A;  2X6O A;  4KT5 C;  3X2Q H;  5FLX K;  3ECO A;  3KP4 A;  4ENK A;  1RET A;  4A69 C;  2CQ7 A;  2FBH A;  3QAH A;  2HQA A;  3IRR A;  1KU9 A;  1IO2 A;  3PSI A;  3J81 K;  2HEO A;  5E3M A;  4L5E A;  1HW1 A;  4YG2 F;  4MEY F;  2L02 A;  3OR2 C;  1AKH B;  4CIC A;  5H20 A;  3ZMS A;  3QQA A;  4JX4 A;  2DA3 A;  4E7L A;  2HKO A;  1BOB A;  3REO A;  1RC9 A;  1XGN A;  2FJ1 A;  3DTI A;  4ZH4 F;  3V8J A;  4FT8 A;  2ME6 A;  3U1D A;  3ABU A;  3G4S I;  4P9U A;  3J7A Y;  4B09 A;  2WAF A;  2XGX A;  3B6A A;  2JTV A;  2M3A A;  4XOP A;  4E7S A;  2L0K A;  1MBH A;  3BG6 A;  1K6O A;  3H0G J;  4LGW A;  4RGU A;  1P4A A;  4IVN A;  5L3C A;  1JTY A;  4C2U A;  1LJ9 A;  3LA3 A;  1KQ9 A;  4E4H A;  3TOB A;  4LOC A;  3WE3 A;  3KP2 A;  2LOO A;  3E6M A;  4BAY A;  4J00 A;  1Z77 A;  2K02 A;  1NG6 A;  3HUG A;  5LD2 C;  5F6F A;  4G12 A;  4RLF A;  1WPK A;  2VI6 A;  5CVI A;  4BYY A;  1ZAO A;  2W00 A;  4EM1 A;  2XPV A;  1HKQ A;  4YII A;  2R7S A;  1VQM I;  3KP7 A;  1ULY A;  1R5G A;  2VQH A;  4ZC3 A;  1MMS A;  4KIS A;  2XSD C;  4W1U A;  1J75 A;  2H27 A;  4A0X A;  3WTV C;  1BR1 A;  1YYV A;  2YR2 A;  3DLL F;  3HYI A;  1RI7 A;  1ZRC A;  4G94 A;  4UHT A;  1QA6 A;  2M8G X;  2QBY A;  1D0X A;  2WAQ N;  5J4Y A;  4I02 A;  5CKT A;  1T38 A;  3NRV A;  5D5X B;  1T6S A;  3QOE A;  2CUF A;  2AXT C;  2EBI A;  5JLW A;  1LDK B;  2ZKZ A;  5CVV A;  3JSP A;  1ZR2 A;  1LFU P;  1R1T A;  2DMT A;  2A68 F;  3C7J A;  3S2W A;  4ESF A;  1MNE A;  1Y56 A;  2DA4 A;  3K9T A;  1MBJ A;  4IRG A;  2L01 A;  3BR2 A;  1T8I A;  1MDM B;  2VON A;  1Z9C A;  1R5I D;  2EPF A;  3PQK A;  2HYJ A;  2E36 A;  2LK2 A;  1W5T A;  3ELK A;  4U88 A;  1ONV A;  3OSG A;  3O8G A;  2HDD A;  5FLV A;  2OTL I;  4ZYD A;  5GPA A;  2PMH A;  5EYR A;  5HDK A;  5LHH A;  1YJ9 I;  1O3Q A;  4RB3 C;  1NK2 P;  2VOO A;  4NC7 A;  1YX5 A;  2VE8 A;  4MQ9 F;  2QM3 A;  4P96 A;  1Z21 A;  4BS9 A;  1U9O A;  1U8R A;  1IXC A;  3LA2 A;  1BI0 A;  2BXZ A;  3ZGK A;  3CC4 I;  5GTI C;  4XRF A;  4RLQ A;  4S05 A;  2LR8 A;  4MQV A;  4AYB A;  2E7X A;  3L2V A;  4U7D A;  1WJF A;  2EFN A;  5A2Q K;  1YLF A;  2JA7 J;  2KL4 A;  1IZ1 A;  1MMN A;  1OQY A;  1IV8 A;  2CUE A;  3UR3 C;  3WTY C;  3QPS A;  2E60 A;  4A93 J;  2V6C A;  1MKM A;  3R0J A;  4L9V A;  2BW3 B;  1J9I A;  3S8P A;  3GUD A;  4A3B J;  5H6Q A;  2NRA C;  4FET A;  2JA8 J;  3WTW C;  4XLH A;  1HKT A;  1ZRE A;  5F0F A;  2MW8 A;  3AG4 H;  1YX3 A;  2XRL A;  2DT6 A;  4KA4 A;  2ZXW H;  3R60 A;  3S93 A;  3LSK A;  3OL3 A;  2GXB A;  3HOS A;  2COB A;  3GTP J;  5J8F A;  2M1B A;  2VXZ A;  5LFA A;  5IY5 H;  4UB6 C;  5TRD A;  4HLX A;  4PK4 A;  4KT6 A;  4LK0 F;  4I7H A;  2RQP A;  3LSR A;  2DLL A;  1ETW A;  4AU7 A;  4PGG A;  3HDD A;  4KFC A;  4NHJ A;  1VQ7 I;  1U5T C;  3HRM A;  3HOU J;  3RQI A;  3CCU I;  2VPL A;  1SFO J;  3HKZ N;  3GFL A;  5FD6 A;  5HOD A;  1QNT A;  3EET A;  2HI3 A;  1UMQ A;  1WJB A;  4A3M J;  1W1W E;  4XKB A;  4FX0 A;  5GPC A;  3DEW A;  5DCF A;  3WG7 H;  4DJA A;  3DV8 A;  1GXQ A;  5E1X A;  4E7H A;  3T8T A;  2F5F A;  1BIB A;  2F48 A;  3ECH A;  4BBR J;  2QQ9 A;  4D7N A;  2BXY A;  5D5U B;  4I0B A;  3PIO F;  2F4O B;  3L2U A;  1Y1W J;  2ICW G;  2ESH A;  3FXU A;  2K85 A;  1FMW A;  1T33 A;  2STW A;  3BQZ A;  4BE0 A;  1LFP A;  4GFB A;  3L2Q A;  3J7Z I;  3VSL A;  4E6K G;  2XAQ A;  1EJ9 A;  2XGE A;  5LRS A;  4MTD A;  3DTE A;  4BHC A;  2D1V A;  5CJ9 A;  4CA0 A;  4L9J A;  2BE5 F;  5DV5 A;  5H2F C;  5IT9 K;  4M3B A;  2HYF A;  1CF7 B;  3CMM A;  4GXO A;  3M9A A;  2DA6 A;  2XAH A;  1R7J A;  2FF4 A;  1SD6 A;  3T0Y A;  3K10 A;  1STZ A;  1XC5 A;  1DGR M;  1QVT A;  3JW4 A;  2X48 A;  4WX9 A;  1V5G A;  3D1N I;  1E17 A;  2MH9 A;  3ZN0 A;  5B66 C;  1Y0U A;  3JAM Z;  3F3X A;  1QU3 A;  1FBU A;  1HKS A;  1K83 J;  2K9L A;  4GYG A;  4PSW A;  2P5L C;  2O7O A;  4E7I A;  3C3W A;  4JOM A;  3WHB A;  1RKT A;  4PJL A;  1T95 A;  1F4K A;  1VI0 A;  2VQG A;  1B72 A;  2EZI A;  4WWC A;  3JRI A;  4XM3 A;  3HTU A;  3VDX A;  3WU1 B;  1Z7U A;  3LSJ A;  2DDA A;  3L7W A;  5FLM J;  1GLN A;  4R79 A;  3GW2 A;  2K9S A;  3U21 A;  1F9N A;  3OS0 A;  1Y8Q B;  1KQ0 A;  5FKM A;  2CWE A;  4C3J J;  3OYL A;  4BJ5 C;  4Y17 A;  3R4K A;  3M4O J;  2GOX B;  1LDD A;  4XQF A;  1IN6 A;  3TOA A;  1TWH J;  3C2H A;  1ETO A;  2OU2 A;  1FYK A;  2M4K A;  4XLE A;  1N75 A;  2MSY A;  2P81 A;  3FIW A;  1KZH A;  4CZZ A;  1OKR A;  4O6J A;  2HVR A;  2M9H A;  4UY8 I;  2CSO A;  2HOE A;  4G9Y A;  4GRI A;  1WKM A;  1TZL A;  4GO1 A;  4BE1 A;  3QYF A;  4LLG F;  1J59 A;  5DUK A;  1JKP C;  3QPL A;  1OYW A;  2P8T A;  5GAH J;  4LD5 A;  1LQ1 A;  1RKW A;  2DOA A;  2RNJ A;  3D0S A;  4ESJ A;  1HC8 A;  2GAU A;  1XD7 A;  1W5S A;  4B3A A;  1SMT A;  4EJT A;  3B73 A;  3K6G A;  3OYK A;  1H0M A;  4BY1 J;  4ZJZ A;  1J09 A;  2X1C A;  4E7J A;  2E34 A;  1BI2 A;  4Y13 A;  1SVL A;  2CQX A;  2F5C A;  3KPH A;  3MWM A;  2EIL H;  4G7O F;  4KIB A;  1U0J A;  2RNG A;  1W0U A;  2FMY A;  1QPI A;  3D5L A;  2LKS A;  4G6D A;  4BEH B;  3HSE A;  3QPT A;  5EG0 B;  3JRC A;  4ANJ A;  1I50 J;  1Q1V A;  2RGV A;  1R22 A;  3V7C A;  4YIR X;  1VTN C;  2DMQ A;  2CJJ A;  2WB1 A;  4A5N A;  3SZG A;  1KU2 A;  1YW7 A;  3K4K A;  2MC3 A;  5LHI A;  4DGW B;  1S29 A;  1IN7 A;  2VQC A;  4YFK F;  2Z9O A;  3CJR B;  1B9M A;  4XSZ F;  1ETV A;  2RKH A;  3WU2 C;  1BJZ A;  5B1A H;  2VJJ A;  2MG4 A;  3SXY A;  2XPW A;  3HOY J;  4BH9 A;  1OJL A;  2YSR A;  4NUB A;  1X2N A;  3A01 A;  3GZ5 A;  2VL8 A;  3DFG A;  2L3D A;  1SD5 A;  1HSJ A;  4FE4 A;  1WQ2 A;  2OV7 A;  2EZL A;  1HDP A;  1QPM A;  2ZCW A;  3CP8 A;  5K5R A;  3UNG C;  3O8H A;  5E18 F;  3H5A A;  2E7W A;  3GYH X;  4C30 A;  3FKJ A;  3S17 J;  4N4O B;  3LA7 A;  1YRN A;  2HVS A;  4X6A J;  5E1Z B;  1TLH B;  2VUM J;  1DUX C;  3J80 K;  1DPR A;  1B6A A;  1M1E B;  3EYI A;  1TT0 A;  2IT0 A;  5J1Y A;  3BG5 A;  2JZY A;  3AG3 H;  4FIS A;  4HNT A;  4CYC B;  5K1Y A;  2X85 A;  4QWQ A;  2ZNY A;  4M3G A;  2LNB A;  5LEJ A;  1DGW Y;  1SD7 A;  2YU3 A;  3K4M A;  1FTZ A;  2LYC A;  4NQW A;  3FX3 A;  3BR6 A;  2R5Y A;  3CLQ A;  4HX7 A;  1IN4 A;  4BUP A;  1JJ8 C;  1QQI A;  2L5Q A;  1X1A A;  2ZME C;  1OLT A;  4AM3 A;  1HXD A;  4ZTJ A;  2H94 A;  3LFU A;  1CQT A;  4CCN A;  2HPI A;  1OYY A;  2MH2 A;  2XAF A;  3BY6 A;  3IH2 A;  4MFD A;  3E7L A;  1JE8 A;  3HOZ J;  3KLN A;  4Y4R A;  2XKP A;  5F1J A;  4UUS A;  2R7U A;  5E20 A;  4MNU A;  3E6C C;  2CYY A;  1P7J A;  1RIO H;  3MFK A;  4AIH A;  1A6Q A;  1JHF A;  2JK3 A;  2R7X A;  1JJ6 C;  3NWS A;  2LY2 A;  5CVU A;  2HOT A;  2D1H A;  3ZQF A;  1D1B A;  4ZYH A;  1IJW C;  5BPI A;  3LL7 A;  1ZR4 A;  2M87 A;  4ZYA A;  2E35 A;  4B44 A;  1SAX A;  1HW5 A;  2Y9Y A;  4NDL A;  2L54 A;  2IGM A;  2F5D A;  3SJM A;  1S7E A;  3HJE A;  4RGS A;  3U2R A;  4NC6 A;  4HX4 A;  5D5W B;  3ZQL A;  2MLK A;  2JQ7 A;  4L0Y B;  2BW3 A;  1IXS B;  2W1O A;  3S2H J;  5EEH A;  2PJR A;  1B59 A;  1BBY A;  2A61 A;  2VOP A;  4NC8 A;  1JT6 A;  3HOW J;  1SMY F;  4I01 A;  4LB5 A;  4P1W A;  3RKW A;  2WBM A;  4Y15 A;  4WXC A;  4CYC A;  5IOZ A;  5K7F A;  2Y0M A;  3LWF A;  4M72 A;  3WTX C;  4QSH A;  4M3E A;  2IP2 A;  3PQJ A;  2QGU A;  2DI3 A;  5AIQ A;  1MW7 A;  5EEA A;  4QIW N;  2ZJQ F;  2AHQ A;  3HKZ A;  3ESW B;  3SYT A;  3BTJ A;  3G1L A;  3G2B A;  2V1U A;  3ROU A;  2TCT A;  1SFE A;  2IVM A;  4R1H A;  3H35 A;  2DOE A;  1AOY A;  4OOI A;  1JKO C;  4HV5 A;  2D2W A;  1P2F A;  4DIQ A;  3CJT B;  1DP7 P;  3F8F A;  2LF7 A;  1HST A;  4IQJ A;  4LIV A;  3A01 B;  2DFF A;  1UHW A;  2MLG A;  3P9K A;  3KYD B;  4HNU A;  2WY8 Q;  2YX7 A; 
#chains in the Genus database with same CATH homology
 3BDD A;  4PCQ A;  1H9T A;  5LGT A;  2OD5 A;  3IRQ A;  4M9S A;  3DP7 A;  4P9F A;  2QEN A;  5D4S A;  2YX4 A;  3QRF F;  2E1N A;  4L0Z B;  1MGT A;  4EMS A;  4HX8 A;  5CLS A;  4MEX F;  4M73 A;  3WTT C;  3FWE A;  2HQR A;  3L9F A;  5JI6 A;  2F5E A;  4LLN A;  4A2U A;  4HW0 A;  1BOA A;  2W25 A;  3Q5F A;  2K27 A;  1FWZ A;  3KP3 A;  2JSC A;  5LGN A;  3CUQ C;  4O5V A;  5AON A;  4ZYG A;  4ZYE A;  3P7N A;  2ZME A;  4Q4Z F;  4HAM A;  3MZH A;  4G7H F;  5F64 A;  2ELH A;  1W4M A;  5HOO A;  1V3F A;  3W6J B;  4QLC U;  1KQ8 A;  4ESB A;  1H9G A;  5BS6 A;  3V4G A;  3DPT A;  2FOK A;  1W7P A;  1KGS A;  2GA1 A;  1DPU A;  2O6G E;  1U3E M;  1QZZ A;  2LDU A;  3FXR A;  3GVA A;  1QO0 D;  2XVC A;  2VT2 A;  3VB2 A;  4FHT A;  2OA4 A;  2LKP A;  2VE9 A;  4PZJ A;  4AIK A;  2FBI A;  2WWY A;  2HFH A;  1R1V A;  1FYL A;  1MDM A;  3OV8 A;  1MJA A;  1FNN A;  3K1P A;  2O0Y A;  5JR3 A;  1LNW A;  3F21 A;  3IWF A;  3V7S A;  5LHG A;  2KRF A;  1UB9 A;  1KYW A;  4MGR A;  2V79 A;  3BOQ A;  4OIQ F;  2RC4 A;  1P4W A;  2EA4 A;  2DQR A;  3F72 A;  1ZG3 A;  2W57 A;  2LF8 A;  3EYY A;  4OU0 A;  4P55 A;  3TO7 A;  2DPD A;  1IN8 A;  2V1D A;  2K86 A;  3SZP A;  1YO5 C;  3F8C A;  5FO5 A;  1IF1 A;  4KIG A;  4KMU X;  3K69 A;  2KKO A;  1TQM A;  5D8L B;  2QWW A;  4L9N A;  5HLI A;  2VBW A;  4G6Q A;  1OMI A;  4H0E A;  2HWV A;  4N0B A;  5KVR A;  5E1W A;  1U78 A;  4HA8 A;  5DUI A;  3M1E A;  2QZ8 A;  2UXX A;  2P5K A;  1ZAR A;  1GHC A;  2ZJ2 A;  3GFM A;  4Q47 A;  3CUQ B;  1ODD A;  4OMY A;  2E1C A;  1BJA A;  2IA1 A;  1G3Y A;  3GXO A;  1B4A A;  1NHA A;  3ZMV A;  3HSF A;  2NS0 A;  1BN5 A;  2HR3 A;  1LEB A;  4OIN F;  2QUF A;  3WGG A;  2EJR A;  2ZO4 A;  3GO5 A;  4BHB A;  3BWG A;  3FM3 A;  3N97 A;  1BI1 A;  1FY7 A;  1ZYR F;  3E5Q A;  5J8C A;  3KP5 A;  4IXA A;  1BC8 C;  2P6T A;  5FD5 A;  1TBX A;  5HLG A;  2W84 A;  1YTY A;  4EJV A;  5A2Q Z;  1F1Z A;  2JPB A;  1KU7 A;  3BJA A;  2PBI A;  2GQQ A;  4GGG A;  2A3S A;  1FPQ A;  3FHZ A;  1O7F A;  1S7O A;  3HTS B;  2DT5 A;  3W6K B;  1T98 A;  2VBX A;  3I53 A;  2ZNZ A;  4A12 A;  2CGP A;  4CYD A;  3SZT A;  5KK1 A;  2GIV A;  2ADU A;  3DXJ F;  4LG0 B;  3VEP A;  2X4H A;  2XIG A;  2FA5 A;  3TDU C;  1D8J A;  1USS A;  4IPA A;  4G8X A;  5HDN A;  1IUY A;  4HF0 A;  3G73 A;  3IHU A;  5CYV A;  1ZGJ A;  4PGH A;  2Y75 A;  1XSV A;  4WK8 F;  2M30 A;  2V9V A;  1J2X A;  1P6R A;  2ZFW A;  4IHT A;  1I1S A;  2P4W A;  1Z1D A;  4S04 A;  2ISZ A;  4M6Y A;  1ZG1 A;  1MJB A;  1TNT A;  1R1U A;  3SHF A;  5LLQ A;  1BIA A;  4M74 A;  3N4M A;  5ED4 A;  2OAZ A;  3GX4 X;  3JAM K;  1XCV A;  1U2W A;  2VN2 A;  2Q0O A;  3BPX A;  3P9I A;  4B8X A;  5F1R A;  1ON2 A;  4EJW A;  3BJ6 A;  2V1X A;  3I5U A;  3RYR A;  2EB7 A;  1T39 A;  2CO5 A;  2RDP A;  1XGM A;  3QPH A;  2A6H F;  3V7R A;  4YFN F;  3NQO A;  4U7B A;  5DD4 A;  4L9T A;  4A5M A;  3LAJ A;  1O3R A;  2Z3Y A;  4U0W A;  4HQE A;  1MZB A;  3VOE A;  1XGO A;  3E5U A;  1B9N A;  3IKV A;  2O3F A;  4HQM A;  1YW9 A;  2EFQ A;  3RDI A;  3R6S A;  2NYX A;  3L2C A;  2NNN A;  4KIC A;  1P92 A;  2XAS A;  3TO6 A;  5L3F A;  5HLH A;  3CUQ A;  3KCC A;  2DK5 A;  3ZMT A;  1U5T B;  3R0A A;  3RPQ A;  1YFH A;  5D8K B;  2TDX A;  1FLI A;  1R00 A;  1FSE A;  5ERI A;  1FOK A;  3E3V A;  4U0Y A;  2Z5U A;  1IXR C;  2PG4 A;  2EV0 A;  3KFW X;  5LGU A;  1IAW A;  2EA2 A;  2FRH A;  1GVJ A;  3T5X A;  4IF4 A;  1YQA A;  2QLZ A;  5DYM A;  3HHH A;  3L09 A;  4DNC A;  3QP5 A;  5D6F A;  1ZH5 A;  2B0L A;  2IA2 A;  2HTS A;  4KMF A;  5ILV A;  3MAJ A;  1J5Y A;  1EH7 A;  1KA8 A;  1E2X A;  3V8K A;  1R5H A;  5BOX A;  2QVO A;  1OPC A;  3I54 A;  2AS5 F;  1Z05 A;  2A07 F;  3FMS A;  3M8E A;  5JVT A;  2W24 A;  3AAF A;  2DBB A;  5L3B A;  1Z6R A;  2G9W A;  1RNL A;  3K1N A;  3WGH A;  3JSO A;  5D5V B;  3K0L A;  1KU3 A;  5CVJ A;  1C0W A;  4ETS A;  3DQV C;  2EK5 A;  1G3W A;  4ENJ A;  2EV5 A;  4Q48 A;  3DF8 A;  2WV0 A;  1ZRD A;  2DQL A;  5HVQ C;  2QQA A;  2OZ6 A;  1T2K A;  3I4P A;  3CLO A;  3HRT A;  4KYW A;  2DW4 A;  2HYG D;  3GEZ A;  2XKO A;  4RB0 A;  1U5T A;  2IA0 A;  5ICF A;  1G3T A;  2UWM A;  2HZT A;  4LLL A;  5HS7 A;  2ISY A;  1K79 A;  5DCM A;  2VBZ A;  3O2P E;  1FP1 D;  3O3K A;  5HS8 A;  3GFJ A;  3EDP A;  4WXH A;  3ZMD A;  4RAY A;  5BQT A;  3HOT A;  1XDS A;  3WTU C;  1GXP A;  4CDG A;  3BP8 A;  3V8L A;  5HDG A;  4RGX A;  3EQL F;  1ZRF A;  1XN7 A;  3MQ0 A;  4CXF A;  3ZP5 A;  2BBY A;  4KNY A;  1G6N A;  2R7D A;  3M7G A;  1ZHF A;  1L3L A;  3SQN A;  4HF1 A;  4MTE A;  1LB2 A;  4A6E A;  2D45 A;  2BV6 A;  5ILS A;  4BXU A;  4Z2Y A;  3F6V A;  1JGS A;  2ZXJ A;  1TQP A;  4ZZL A;  3FM5 A;  3CUO A;  4ASN A;  5L3E A;  1SFU A;  4HBL A;  5HS9 A;  4EGZ A;  5DCM B;  1YS7 A;  4I98 B;  3ABT A;  1U6G A;  1S7A A;  1YG2 A;  3VOD A;  3WU0 A;  2J5P A;  1YS6 A;  4HV6 A;  3SFZ A;  4BNC A;  5EEG A;  5FLX Z;  1ZLK A;  4KDP A;  1I27 A;  4LJZ F;  1LVA A;  2FEZ A;  1FX7 A;  3CO6 C;  4TV7 A;  4M71 A;  3E6D A;  4HOB A;  2HQN A;  1XSD A;  3ZMZ A;  5E17 F;  1UFM A;  3LQQ A;  3CJN A;  3VFZ A;  1RZ4 A;  1OR7 A;  3HRS A;  3MCZ A;  5E8G A;  2CQK A;  2FE3 A;  2PJP A;  3ML6 A;  4RB2 C;  2BGC A;  4L5I A;  3I59 B;  3ZPL A;  1XSX A;  3K2Z A;  2L4A A;  2ESN A;  3R61 A;  3WE2 A;  1CGP A;  1RUN A;  2IW5 A;  4FX4 A;  4I09 A;  3LAP A;  2EFP A;  2L4M A;  4K2E A;  4UV9 A;  2FXA A;  4UVB A;  1J0R A;  1PDN C;  3IC7 A;  3LQR A;  2ETH A;  4N9I A;  3KZY A;  5CVR A;  5JHU A;  1HW2 A;  1L0O C;  1K7A A;  2P7V B;  3I59 A;  2K4B A;  4JQF A;  6PAX A;  2Q8K A;  5K5Q A;  3ZN1 A;  2PQ8 A;  4CHU A;  3ULQ B;  4AIJ A;  2VBY A;  3F6O A;  2UZK A;  1YIO A;  1EH6 A;  4PDK A;  2HTJ A;  3TO9 A;  4KIF A;  2P6S A;  3RKX A;  5ICC A;  1AWC A;  2XV4 S;  2KIM A;  1DDN A;  1WSU A;  2RVC A;  2Q2E A;  3T8R A;  4WCG A;  4EQQ A;  1OYI A;  3J81 Z;  2KIU A;  3RJP A;  3CO7 C;  1F5T A;  4ENN A;  2JPC A;  3F23 A;  3JTG A;  3TQN A;  3TDZ C;  1R36 A;  4LG0 A;  5AIP A;  1XGS A;  4HF2 A;  2VC0 A;  4GYI A;  1K78 B;  2A6E F;  3FMQ A;  2DO7 A;  4OMZ A;  2M5W A;  2C6Y A;  2J5O A;  2XHK A;  5DDG A;  3F8B A;  4UV8 A;  4IJA A;  4OIP F;  4HYE A;  3DPL C;  4HLY A;  2FNA A;  2VOD A;  2GA2 A;  3I71 A;  4U0V A;  1XCB A;  2M45 A;  2PFB A;  5BMZ A;  1TNS A;  3COA C;  2JT1 A;  1LEA A;  1TTY A;  3IWZ A;  2FBK A;  3Q9S A;  2O61 A;  4UVC A;  4WXD A;  5IT3 A;  2HGC A;  1RUO A;  4D0P A;  2Z99 A;  4XSX F;  4HZF A;  3H3Z A;  2PLY A;  2EWN A;  1I6X A;  3FF5 A;  3FZV A;  3ZQ7 A;  3QU6 A;  1BC7 C;  3MZY A;  3E97 A;  2X0L A;  5FGM A;  2WC2 A;  1ZN2 A;  3WGI A;  1YW8 A;  4P5O A;  2NNY A;  1JXS A;  5D6E A;  5DD8 A;  5FFZ A;  1FP2 A;  4RB1 A;  3IKT A;  3TKY A;  4EM0 B;  2KJC A;  1FSH A;  5FB2 A;  1A04 A;  5ICE A;  1CF7 A;  4EJU A;  3DEU A;  2PN6 A;  1EH8 A;  3KEQ A;  1S6L A;  3G3Z A;  1TW3 A;  3QP6 A;  1KYZ A;  2GZW A;  3RKY A;  2NAZ A;  4RAZ A;  2XAG A;  2DPU A;  4N9H A;  2VT3 A;  1R58 A;  1TQI A;  2ZME B;  4F7Z A;  1IRF A;  4UVA A;  3B02 A;  3FMR A;  3I58 A;  2EFW A;  5IT9 Z;  4EVI A;  1FBS A;  3F8N A;  4LMY A;  2PI0 A;  1HBX G;  2R7F A;  4ZZD A;  3HRU A;  3KLO A;  1K78 A;  2ZBK A;  3QU3 A;  1PP8 F;  1S8N A;  3E5X A;  2OQG A;  3CDH A;  1G3S A;  3P9C A;  2Z33 A;  2H6B A;  2K4J A;  4M9X A;  3ZMU A;  3GLX A;  4EJO A;  3WG9 A;  2CW0 F;  4ON0 A;  3BJO A;  1XDU A;  1WWX A;  3F8M A;  4G7Z F;  2AXL A;  4YFX F;  3GF2 A;  2Y48 A;  5BPD A;  1R23 A;  2F2E A;  1BI3 A;  1UHM A;  2W85 A;  2FSW A;  1FZP B;  3WTZ A;  5LBQ A;  1PUE E;  1P4X A;  2O8X A;  3MEX A;  1FYM A;  3BZ6 A;  4OIO F;  2CG4 A;  3RYP A;  4XLP F;  2HDC A;  2FQ3 A;  5JFR A;  4EM2 A;  4A6D A;  2XRN A;  5K5O A;  3J80 Z;  1IRG A;  3C18 A;  1D8K A;  1HQC A;  2K7L A;  1REP C;  3E6B A;  2P7C B;  1Z6T A;  1I5Z A;  1O7L A;  1FBQ A;  4BQA A;  4Q5S F;  2MBF A;  3LFK A;  4UNO A;  4GCV A;  3HIF A;  1LDJ A;  3KP6 A;  2BYV E;  3RTR A;  3BPV A;  1MD0 A;  3L00 A;  3U9G A;  3OOP A;  4HDV A;  1QGP A;  3BRO A;  2DK8 A;  4UUV A;  5E8I A;  3Q9V A;  4LK1 F;  1B1B A;  5ILU A;  2A69 F;  1EV7 A;  4IHS A;  1ZLJ A;  2HKX A;  5L3D A;  2WTE A;  4XBF A;  4NB5 A;  3ERE D;  3HSR A;  3GFI A;  3KEO A;  1G4D A;  1O3T A;  3JTH A;  5FFX A;  2G7H A;  2DFI A;  2EV6 A;  4EGY A;  3J7A O;  2YPR A;  2OZU A;  3RIR A;  5J6X A;  1ZG5 A;  4MHG A;  1UST A;  4KN7 X;  3F22 A;  4M9Z A;  4BHP A;  1IW7 F;  2QQB A;  1FT9 A;  2PEX A;  3IL2 A;  4CO8 A;  2FNP A;  4ENM A;  2OBP A;  1W7P B;  2QBY B;  1Q1H A;  1T0F A;  2XRO A;  5D4R A;  3HHG A;  2HS5 A;  5L3G A;  5LRR A;  2EFO A;  4KN4 X;  1WI9 A;  1FC3 A;  4LFU A;  1WRJ A;  4I2O A;  4L5J A;  1D5V A;  3I64 A;  2DTR A;  4I0A A;  4A0Z A;  4XLN F;  3ISP A;  3NEU A;  4M6X A;  2XAJ A;  1SFX A;  2KIF A;  2XUB A;  3PFI A;  5TJJ A;  1XB4 A;  5DEQ A;  4EV0 A;  2KJB A;  2FML A;  2MD5 A;  1BM9 A;  4A0Y A;  3QOP A;  2QYO A;  3RI4 A;  4DQ2 A;  2H6C A;  1O3S A;  1Z91 A;  3EUH A;  2DU9 A;  1O57 A;  3RPU A;  4CGZ A;  2VC1 A;  2M8E A;  3M8F A;  2A5Y B;  1I1G A;  5ICG A;  2DAO A;  3KE2 A;  3TGN A;  4AWX B;  2COM A;  4AD9 A;  2UXN A;  1MJ9 A;  2MA3 A;  1J7K A;  2STT A;  4AVP A;  1V4R A;  3O6B B;  3T1B A;  3FXQ A;  2IJL A;  3WTS C;  3KZZ A;  1D3Y A;  4RS8 A;  4RGR A;  3LST A;  2IPQ X;  1UCR A;  1XMK A;  4JBA A;  3WOD F;  3GZ6 A;  1W7P D;  4L18 B;  1XMA A;  3CTA A;  3H92 A;  1ZGA A;  3C1D A;  2FU4 A;  4R8H A;  4KUM A;  4WF2 A;  2H09 A;  4LB6 B;  3I0T A;  2GWR A;  2BEO A;  5H6R A;  3H3U A;  1SD4 A;  2P5V A;  2JRT A;  2O03 A;  2PMU A;  2OQR A;  3GWZ A;  4YIF A;  1X3U A;  4UXN A;  2IRF G;  2RN7 A;  1QBJ A;  4OIR F;  4JK1 X;  4HDU A;  4E70 A;  1JHH A;  2G7U A;  2CFX A;  1ON1 A;  2R3S A;  1PP7 U;  2ACJ A;  2LSO A;  1S3J A;  3DKW A;  4IRI A;  1QZY A;  4O3M A;  1TW2 A;  2GXG A;  2RV8 A;  3K1M A;  1IN5 A;  3KET A;  4IRH A;  5LEK A;  4KT5 C;  5FLX K;  3ECO A;  3KP4 A;  4ENK A;  2FBH A;  3QAH A;  3IRR A;  1KU9 A;  2HEO A;  3J81 K;  1HW1 A;  4YG2 F;  4MEY F;  2L02 A;  4CIC A;  5H20 A;  3ZMS A;  2HKO A;  3REO A;  1XGN A;  4ZH4 F;  3V8J A;  4FT8 A;  3U1D A;  3ABU A;  4P9U A;  4B09 A;  2XGX A;  2JTV A;  1K6O A;  4LGW A;  4RGU A;  1P4A A;  4IVN A;  5L3C A;  1LJ9 A;  3LA3 A;  1KQ9 A;  3TOB A;  3WE3 A;  3KP2 A;  3E6M A;  4BAY A;  2K02 A;  3HUG A;  5F6F A;  4BYY A;  5CVI A;  4EM1 A;  1ZAO A;  1HKQ A;  4YII A;  3KP7 A;  1ULY A;  1R5G A;  1J75 A;  2H27 A;  4A0X A;  3WTV C;  1YYV A;  2YR2 A;  3HYI A;  1RI7 A;  1ZRC A;  4G94 A;  4UHT A;  2QBY A;  4I02 A;  1T38 A;  3NRV A;  5D5X B;  1T6S A;  1LDK B;  2ZKZ A;  5CVV A;  3JSP A;  1R1T A;  2A68 F;  3C7J A;  3S2W A;  4ESF A;  3K9T A;  4IRG A;  2L01 A;  1MDM B;  2VON A;  1Z9C A;  3PQK A;  3ELK A;  4U88 A;  1W5T A;  1ONV A;  4ZYD A;  2PMH A;  5LHH A;  5HDK A;  1O3Q A;  4RB3 C;  2VOO A;  2VE8 A;  4MQ9 F;  2QM3 A;  4P96 A;  1U8R A;  1IXC A;  3LA2 A;  1BI0 A;  4XRF A;  4S05 A;  4MQV A;  2E7X A;  4U7D A;  2EFN A;  5A2Q K;  1YLF A;  1IZ1 A;  3WTY C;  2V6C A;  1MKM A;  3R0J A;  4L9V A;  1J9I A;  3GUD A;  5H6Q A;  2NRA C;  3WTW C;  1HKT A;  1ZRE A;  4KA4 A;  3R60 A;  2GXB A;  3HOS A;  5J8F A;  2M1B A;  2VXZ A;  5TRD A;  4HLX A;  4LK0 F;  4I7H A;  2RQP A;  2DLL A;  4PGG A;  4KFC A;  4NHJ A;  1U5T C;  3HRM A;  3GFL A;  5FD6 A;  1QNT A;  3EET A;  4FX0 A;  5DCF A;  3DV8 A;  1GXQ A;  5E1X A;  3T8T A;  2F5F A;  1BIB A;  3ECH A;  2QQ9 A;  5D5U B;  4I0B A;  2ESH A;  3FXU A;  2STW A;  2XAQ A;  5LRS A;  4MTD A;  4BHC A;  2D1V A;  5CJ9 A;  4L9J A;  2BE5 F;  5DV5 A;  5IT9 K;  2HYF A;  1CF7 B;  4GXO A;  3M9A A;  2XAH A;  1R7J A;  2FF4 A;  1SD6 A;  3T0Y A;  1STZ A;  3JW4 A;  4WX9 A;  1E17 A;  2MH9 A;  3ZN0 A;  1Y0U A;  3JAM Z;  3F3X A;  1FBU A;  1HKS A;  4GYG A;  2P5L C;  3C3W A;  1F4K A;  4WWC A;  3HTU A;  3WU1 B;  1Z7U A;  3L7W A;  4R79 A;  3GW2 A;  1F9N A;  1KQ0 A;  2CWE A;  4Y17 A;  3R4K A;  1LDD A;  1IN6 A;  3TOA A;  2OU2 A;  1FYK A;  4CZZ A;  1OKR A;  4O6J A;  2CSO A;  2HOE A;  4G9Y A;  1WKM A;  4GO1 A;  4LLG F;  1J59 A;  5DUK A;  1OYW A;  2P8T A;  4LD5 A;  1LQ1 A;  2RNJ A;  3D0S A;  4ESJ A;  2GAU A;  1XD7 A;  1W5S A;  1SMT A;  4EJT A;  3B73 A;  1H0M A;  1BI2 A;  4Y13 A;  2F5C A;  3MWM A;  4G7O F;  4KIB A;  2FMY A;  3D5L A;  4G6D A;  3HSE A;  3QPT A;  2RGV A;  1R22 A;  3V7C A;  1VTN C;  4A5N A;  1KU2 A;  1YW7 A;  2MC3 A;  5LHI A;  1S29 A;  1IN7 A;  4YFK F;  2Z9O A;  1B9M A;  4XSZ F;  2RKH A;  3SXY A;  4BH9 A;  2YSR A;  3GZ5 A;  3DFG A;  2L3D A;  1SD5 A;  1HSJ A;  1WQ2 A;  1QPM A;  2ZCW A;  5K5R A;  5E18 F;  2E7W A;  3GYH X;  3LA7 A;  5E1Z B;  1TLH B;  1DUX C;  3J80 K;  1DPR A;  1B6A A;  3EYI A;  2IT0 A;  2JZY A;  5K1Y A;  4QWQ A;  2ZNY A;  2LNB A;  5LEJ A;  1SD7 A;  2YU3 A;  4NQW A;  3FX3 A;  4HX7 A;  1IN4 A;  1QQI A;  1HXD A;  2H94 A;  1OYY A;  2MH2 A;  2XAF A;  3BY6 A;  1JE8 A;  3KLN A;  2XKP A;  5E20 A;  4MNU A;  3E6C C;  2CYY A;  1RIO H;  3MFK A;  4AIH A;  1JHF A;  5CVU A;  2D1H A;  4ZYH A;  5BPI A;  2M87 A;  1SAX A;  1HW5 A;  2L54 A;  2F5D A;  4RGS A;  3U2R A;  4HX4 A;  5D5W B;  2MLK A;  4L0Y B;  1IXS B;  5EEH A;  1B59 A;  1BBY A;  2A61 A;  2VOP A;  1SMY F;  4I01 A;  4LB5 A;  3RKW A;  4Y15 A;  4WXC A;  2Y0M A;  3LWF A;  4M72 A;  3WTX C;  2IP2 A;  3PQJ A;  2DI3 A;  5AIQ A;  2V1U A;  3ROU A;  4R1H A;  1SFE A;  2IVM A;  1AOY A;  4OOI A;  4HV5 A;  2D2W A;  1P2F A;  1DP7 P;  3F8F A;  2LF7 A;  1HST A;  1UHW A;  2MLG A;  3P9K A;  2YX7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...