5IT9K

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
96
structure length
96
Chain Sequence
MLIPKEDRKKIYQHLFQEGVLVAKKDFNQPKHEEIDTKNLFVIKALQSLTSKGFVKTQFSWQYYYYTLTEEGVVYLREYLNLPEHIFPATYLAGQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
molecule tags Ribosome
molecule keywords Ribosomal protein uS2
total genus 21
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF03501 S10_plectin Plectin/S10 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5it9K00
2MD5A 3JAMK 3MFKA 3IRQA 3L2CA 2NYXA 4UV8A 4Y15A 1IUYA 5E20A 1QO0D 1ZARA 2KIUA 2V1XA 3CO6C 2E7XA 4CO8A 3ZMZA 2W57A 2CYYA 3LA3A 3R0JA 2CG4A 1GXPA 1KQ0A 2X0LA 1Z05A 4CXFA 2TDXA 2H94A 3QP5A 5DCFA 3NQOA 4KYWA 1L3LA 3GFJA 3RPQA 1EV7A 4UVBA 3KZYA 1JXSA 2VE8A 1SFEA 3MCZA 3AAFA 4BQAA 4IHSA 2JRTA 3KLOA 4KICA 4IRGA 1R36A 1HW5A 5ERIA 2VBYA 5ICFA 3RKWA 3IWFA 4UXNA 1HW1A 4AD9A 4UHTA 2IRFG 5K5QA 1BIBA 4LK1F 1T2KA 4A0YA 3Q5FA 1U5TB 3JAMZ 3KCCA 1TQIA 3HRMA 4ZZDA 1MD0A 1KU3A 2GXGA 3K1NA 3R0AA 2F5EA 2G7HA 4G7HF 3FWEA 1W4MA 2OBPA 1TW3A 2DK5A 1WSUA 2CGPA 2P4WA 1YW7A 3I59B 1MDMB 1YFHA 4MEXF 3K0LA 5LGUA 3R60A 4P9UA 2A3SA 3MWMA 3IWZA 2HWVA 2VE9A 3QRFF 2ISYA 3SZTA 2UXXA 1K6OA 4A5MA 2KRFA 3M8FA 5D5XB 1E2XA 3I58A 2K4JA 2VBWA 1ON1A 4KMFA 4MTEA 2ADUA 3JTHA 5BS6A 2WWYA 5BMZA 3WODF 3KP6A 3WTWC 1IZ1A 5DD4A 3TOBA 4I09A 2QQBA 2XIGA 1UB9A 2MLGA 5DUKA 5D4SA 4HX7A 1T38A 4AWXB 5ICGA 1KQ9A 2PN6A 5HDGA 3HSFA 1LDJA 2XAJA 1LEBA 2PQ8A 1BBYA 1HQCA 3DXJF 4HF1A 1MGTA 2DO7A 1F4KA 3J7AO 1K7AA 1TTYA 3U9GA 2GA1A 2E1NA 4OIRF 5J6XA 5ICCA 1O57A 1YS7A 4I02A 1S7OA 1EH7A 3FZVA 4I2OA 1IN4A 2BGCA 2W84A 3DF8A 3RJPA 4KIFA 3D0SA 2KKOA 4HZFA 1G3YA 1IRGA 1FSHA 3TQNA 1R00A 4A12A 4FX4A 3E6BA 3O2PE 1XGOA 2EWNA 2QENA 2H09A 4CDGA 4O6JA 1ON2A 3CUOA 4KIGA 2A61A 3IKVA 5HLHA 2VOPA 1LJ9A 3RYRA 2CFXA 1XSDA 1QZYA 1P4XA 5HDNA 1XGSA 2NNNA 2ISZA 1I1SA 1TNSA 4WXDA 4HV5A 2YU3A 4HLXA 5D8KB 3EETA 1G3SA 4BXUA 4F7ZA 2O3FA 1BI2A 5FD5A 3TO6A 3LSTA 4P96A 4L5IA 3D5LA 4PGGA 2JSCA 1BM9A 1I27A 3LAPA 3IC7A 2ZBKA 1I5ZA 1FYMA 4LJZF 4RB2C 4PDKA 4M73A 1XCVA 1G6NA 3FM5A 3BWGA 2IA1A 5A2QZ 2ZMEB 2VONA 3ULQB 2PJPA 4Q4ZF 2D1VA 5H6QA 3V7SA 3LFKA 3GFLA 2D1HA 3O6BB 3GUDA 1Z9CA 2ETHA 3GWZA 3QU6A 4EJVA 5BPDA 5AIPA 5D5WB 4JK1X 1LDDA 3F6OA 4RAZA 2Z99A 4B8XA 1W5SA 4RGUA 4O3MA 5IT9K 3MAJA 2Z9OA 2ACJA 2J5OA 1HBXG 3WTTC 3ECOA 3E6DA 3HHHA 3FM3A 4M9XA 2VT3A 3M1EA 2EFOA 5F6FA 1B6AA 4OIQF 3V8LA 2D2WA 3QOPA 1ZH5A 1EH6A 1TLHB 1R7JA 3V7RA 3SXYA 5E1ZB 5DD8A 3IL2A 2DI3A 1FBQA 3F8NA 5E1XA 3E5UA 3F23A 5ICEA 3F8BA 4RGXA 2P5KA 3U2RA 4R1HA 1ZLJA 4P55A 3WE3A 2LSOA 5E17F 1ZAOA 1O7LA 4HW0A 4G7OF 1OR7A 2XAQA 3TO7A 4CZZA 3F8FA 3V4GA 3V8KA 1S8NA 2FMLA 2GAUA 1U78A 3H3ZA 4A5NA 4WCGA 4MHGA 2EFPA 4HBLA 2KIMA 3ZN1A 1T6SA 1YW8A 2LNBA 3KP4A 4EJWA 3B02A 5CVJA 3FMQA 4HYEA 1P6RA 3HRSA 5DEQA 3GW2A 1LQ1A 2M5WA 3W6JB 1R1TA 4BHPA 2W25A 2G7UA 4MEYF 5EEHA 2ZCWA 4L5JA 5D6FA 5DCMB 3FXUA 1MJBA 3JTGA 5L3BA 1GXQA 1IN7A 3I64A 1BIAA 2XAGA 2VOOA 2A6EF 4QLCU 1OMIA 4HF2A 3ECHA 4IRHA 1AOYA 2W24A 2QLZA 1TNTA 1HSTA 1U2WA 2EFWA 2RNJA 3WE2A 3S2WA 4Q48A 2NNYA 1I6XA 2L01A 3FX3A 3Q9SA 4OU0A 1W7PA 1SFXA 1RUOA 1PP7U 2LF8A 4U0WA 4BNCA 1K78B 4M9SA 4HQEA 1CGPA 1IN8A 3C3WA 1HW2A 3J80K 2HQNA 1J0RA 2OD5A 2XVCA 2NS0A 1RNLA 3RDIA 4OIOF 2ZKZA 3HOTA 3WTZA 2OU2A 2EA4A 2EK5A 1WKMA 2P8TA 1F5TA 3I53A 1E17A 2B0LA 4U88A 4P5OA 2CSOA 2GXBA 1RIOH 3ZN0A 4OINF 4PGHA 5CVVA 5HS7A 3GYHX 4BH9A 4HDUA 1OYIA 1O3SA 3M8EA 3GZ6A 2R7DA 5E8GA 5ED4A 4CGZA 1ZHFA 1U5TC 3TKYA 4ON0A 3CUQA 2G9WA 1VTNC 4HX4A 3G73A 3G3ZA 3REOA 3IRRA 4IXAA 1I1GA 4ASNA 4G6DA 4LMYA 4KN7X 4AIHA 1SMYF 4U0YA 1JHFA 3BPVA 1PDNC 3LAJA 2HYGD 1XGNA 3CLOA 4XBFA 4AIKA 4A6EA 3JW4A 1U5TA 3LA7A 3J80Z 3NRVA 4S05A 3F8CA 2VBXA 3B73A 3LQRA 1BI0A 1R1UA 4BHBA 3GZ5A 4KT5C 5LLQA 2WV0A 3KP3A 2QBYB 1IW7F 2FNPA 1JGSA 2IJLA 2IT0A 4FHTA 3COAC 2JPBA 3Q9VA 5CVIA 5H6RA 5HDKA 2EV0A 2MBFA 3DQVC 2VBZA 1R23A 3HIFA 2FBIA 3VEPA 1H9GA 5BQTA 3RYPA 5FD6A 4A2UA 1FNNA 3I71A 4JBAA 5JI6A 4GGGA 4GYGA 2HZTA 4LB5A 5HS8A 4ESBA 4ENKA 4D0PA 3I59A 1MDMA 3GLXA 3QU3A 1YYVA 2EFNA 3K69A 1D5VA 3T8RA 5LEKA 5K5OA 4Q47A 5HLIA 2XRNA 3K2ZA 4N9HA 3SZPA 4U7BA 1ONVA 4N9IA 4CICA 3VB2A 2DPUA 3W6KB 1P4AA 3DKWA 1EH8A 1BC7C 5DYMA 2O03A 2YPRA 5KK1A 2YX7A 1FYKA 1F1ZA 5CVRA 4JQFA 3CUQC 2VODA 3O3KA 2DBBA 2EA2A 4CYDA 5HS9A 2IW5A 1SMTA 4XLNF 3CDHA 4RB3C 3EYIA 4RAYA 1USSA 4OIPF 1ZGAA 1HXDA 2FXAA 3C7JA 5FB2A 1Y0UA 3MQ0A 3WGGA 1J5YA 3P7NA 3L09A 2CO5A 1B9MA 2HYFA 2ZNYA 4XRFA 3HSEA 3F6VA 2H6CA 1FSEA 3PFIA 2O61A 3E97A 2JZYA 2RKHA 3QPTA 5TJJA 3TGNA 4WK8F 4U7DA 2STTA 1QPMA 4HV6A 2FE3A 2V79A 5L3CA 3K1MA 3ZMDA 1XMAA 4AVPA 5IT9Z 4I01A 2PLYA 3KETA 3ABTA 2Y75A 3SFZA 3E6MA 3K1PA 3DP7A 1FLIA 4M74A 4NB5A 2K4BA 1J7KA 1DDNA 2EV6A 2MH2A 4YFKF 3KEQA 1YW9A 1IRFA 4KUMA 4MTDA 1XMKA 2FNAA 1YIOA 2L3DA 1R1VA 2D45A 3N97A 4KFCA 2GQQA 4M72A 2OAZA 4GO1A 3FMRA 2JPCA 4HF0A 3IHUA 3WGIA 5AONA 3J81Z 1S29A 4DNCA 2FRHA 2DFIA 3BROA 2AXLA 2F5DA 2O0YA 2XAHA 4MNUA 5F1RA 2DTRA 1W7PD 2LDUA 1G3TA 5H20A 2F2EA 5EEGA 3P9CA 2HS5A 1YS6A 3SHFA 5HOOA 1W5TA 4FT8A 1IXRC 3RKXA 4HOBA 4EMSA 4ZYHA 3V8JA 1RZ4A 5HVQC 3I5UA 4BHCA 3F8MA 1FPQA 1DPUA 1ZG1A 4IVNA 3FMSA 2Z5UA 4KDPA 3U1DA 1IXCA 1KYZA 1ZRFA 2CWEA 3ELKA 3KP2A 5LEJA 1Z6TA 5ILSA 4H0EA 5LGNA 1J9IA 3DFGA 2PBIA 1YTYA 4BAYA 2HR3A 4LGWA 4WX9A 3EQLF 2OQGA 4LLLA 4IF4A 3LQQA 2XROA 4A0ZA 4E70A 1TBXA 3T8TA 1CF7A 1FBUA 2DLLA 3K9TA 3T1BA 1SAXA 3ABUA 1QQIA 2ZFWA 2H6BA 2DQLA 2V9VA 4EJOA 5J8CA 2Q8KA 4ETSA 2KIFA 2YSRA 1XB4A 1D8KA 1B9NA 1G4DA 2ELHA 2JT1A 4N0BA 5CVUA 5CJ9A 2C6YA 4EM0B 2QVOA 3VODA 1KA8A 2P6SA 4MQVA 3BDDA 4HAMA 2RVCA 4HA8A 3M9AA 3ZMUA 4CHUA 1V4RA 5D5VB 1RI7A 3OV8A 4L9JA 2P5VA 2RV8A 3WTVC 4R8HA 1BI1A 4MGRA 4I98B 2XKPA 3R6SA 1NHAA 2XKOA 1P4WA 4G9YA 2IA0A 4HQMA 2K27A 1ZRCA 3WU1B 2OA4A 2EFQA 3GVAA 5JHUA 4WWCA 2Z33A 3RI4A 1Z7UA 2XASA 3FXQA 1ZREA 4EM2A 3WTXC 3ISPA 2QBYA 4RGRA 1ZLKA 2BYVE 5L3DA 3N4MA 2FA5A 1HKTA 2M30A 3CO7C 3HRTA 3L00A 2A69F 5KVRA 3V7CA 4L9NA 2PMHA 4L9TA 4M6YA 1ZG3A 1SD4A 1FBSA 1STZA 3L9FA 2ESNA 1K78A 3KP7A 4EGZA 3ZMVA 1IXSB 2VC1A 3F21A 3H92A 1BJAA 5L3FA 1LDKB 1FZPB 1TW2A 3ZPLA 3GXOA 3I54A 2EV5A 4M6XA 1HKSA 1GVJA 3MZHA 5E8IA 4OOIA 3FHZA 2L4MA 3TDZC 3GEZA 4M9ZA 3T0YA 2RN7A 1PP8F 3JSOA 1T0FA 2V1DA 3CJNA 2VC0A 1FOKA 2MA3A 4RS8A 4LFUA 2Y0MA 3R61A 1UHWA 3T5XA 3QAHA 5FLXZ 3CTAA 2Q2EA 2HKXA 1Z6RA 1KQ8A 3MZYA 5HLGA 1KGSA 3ZP5A 4I0AA 1OPCA 1BC8C 2QYOA 2RGVA 5LRSA 4ENJA 1SD6A 4KNYA 1WWXA 2YX4A 5AIQA 5JFRA 1B4AA 1J2XA 1U6GA 2DT5A 3RTRA 4WXCA 3HYIA 4IJAA 1O3TA 1LNWA 2DAOA 4XSXF 4KIBA 1Z1DA 1XSVA 1J75A 2QWWA 2Q0OA 1QNTA 3ERED 2ZMEA 4I7HA 2M8EA 2UXNA 5D5UB 4ENMA 1XDSA 3WTSC 4A6DA 5D6EA 2AS5F 2MLKA 2XHKA 2COMA 4KMUX 4RB0A 1R58A 1V3FA 1S7AA 5LHIA 5JR3A 4YFXF 4QWQA 1ULYA 2W85A 2P7CB 3I4PA 5D8LB 4YG2F 2X4HA 1WI9A 1FC3A 2HKOA 4IHTA 3WTUC 3GFMA 2QQ9A 1FX7A 4ZYGA 1U3EM 3KFWX 1USTA 3CUQB 4GXOA 2V6CA 3RPUA 4KN4X 4EM1A 4XLPF 5J8FA 5CLSA 1YO5C 1FP2A 1QBJA 3P9IA 1UFMA 2F5CA 4TV7A 1W7PB 5FFZA 4IRIA 3GFIA 3DPTA 3LWFA 1OYWA 2CW0F 3OOPA 4P9FA 2MC3A 2VXZA 2P5LC 2YR2A 1Q1HA 5LRRA 1KYWA 1O7FA 1FYLA 1FWZA 2BEOA 2R7FA 1YQAA 2A6HF 5BPIA 2XUBA 1DUXC 1FT9A 3KZZA 3MEXA 4A0XA 1S3JA 3KEOA 1XGMA 1UHMA 1QGPA 4L9VA 2RC4A 3C1DA 2BV6A 2IP2A 3E6CC 1O3RA 4LLNA 2J5PA 4ZZLA 2PFBA 3NEUA 4EGYA 2K86A 1RUNA 3WG9A 2MH9A 5FLXK 2KJBA 4GYIA 5JVTA 2ZNZA 2M87A 4EQQA 3E5QA 2HTJA 5DUIA 2DK8A 1MZBA 5E18F 3HUGA 1JHHA 3HRUA 4O5VA 1KU7A 4R79A 1UCRA 4LG0A 4B09A 1JE8A 3EUHA 3FXRA 3ZQ7A 1G3WA 3HTSB 3PQKA 2EJRA 1LVAA 3RKYA 2RDPA 3BJ6A 3VFZA 3C18A 1YG2A 1WQ2A 2GIVA 2FMYA 2A68F 1ZGJA 3DV8A 4GCVA 3J81K 2RQPA 2DPDA 1L0OC 2VT2A 3HOSA 3TOAA 1CF7B 4Z2YA 3P9KA 2GWRA 4ESJA 2ESHA 2BBYA 3BPXA 1XCBA 2CQKA 1O3QA 2XV4S 2M45A 5DCMA 4LG0B 3F72A 1XN7A 4HDVA 2GZWA 1KU2A 3DEUA 4UVAA 4YIFA 2STWA 1D8JA 1D3YA 3IKTA 5FO5A 5FGMA 3BJAA 1IAWA 4Y17A 5IT3A 4G7ZF 4I0BA 1IN5A 1GHCA 3DPLC 3GX4X 1IN6A 4UVCA 3EDPA 4UV9A 2A07F 2L02A 3LA2A 2JTVA 1FY7A 4U0VA 2KJCA 2NRAC 1AWCA 3ZMSA 3R4KA 4G8XA 4Y13A 3QP6A 4RB1A 4EJTA 1XDUA 2DW4A 4RGSA 2WC2A 3FF5A 2E7WA 2BE5F 4LD5A 2VN2A 5LGTA 4LB6B 2M1BA 3L7WA 3TO9A 2PG4A 1SD5A 4OMYA 4UUVA 2V1UA 2P6TA 2DU9A 5LHGA 3PQJA 3SQNA 4BYYA 6PAXA 4L18B 2O6GE 2FBHA 5E1WA 2FF4A 5F64A 1ZYRF 2FOKA 3WGHA 2XAFA 4ENNA 3BZ6A 3E3VA 2PMUA 1FP1D 2R3SA 1OKRA 1DPRA 2HGCA 4LK0F 2LKPA 3F3XA 2QUFA 2NAZA 1ZRDA 1BOAA 2FU4A 4AIJA 2OZ6A 4DQ2A 4PZJA 3ZMTA 1K79A 2LF7A 3BP8A 2IPQX 1HKQA 3KP5A 1P92A 1OYYA 5L3EA 4L0YB 1R5GA 4ZYDA 1QZZA 2Z3YA 1DP7P 2FQ3A 3F22A 3BOQA 2EB7A 3KE2A 2PI0A 2K7LA 1LB2A 1J59A 2QM3A 2HOEA 4S04A 2FEZA 2UWMA 1SD7A 4FX0A 1U8RA 3ML6A 1YLFA 3JSPA 4WXHA 1S6LA 1ZN2A 5DDGA 1XD7A 3ROUA 2HTSA 4L0ZB 2HFHA 2OQRA 1R22A 1P2FA 5A2QK 4PCQA 2Y48A 4UNOA 2QQAA 5ILUA 5D4RA 2XGXA 5CYVA 4YIIA 4EJUA 2FBKA 4YFNF 4G6QA 5L3GA 5ILVA 3H3UA 3WU0A 5LHHA 1H9TA 2GA2A 1F9NA 1SFUA 2UZKA 4WF2A 3HHGA 4HX8A 5TRDA 1R5HA 2DQRA 2A5YB 1MKMA 1IF1A 5K5RA 4MQ9F 2K02A 1Z91A 2ZJ2A 4OMZA 1B1BA 2HDCA 3TDUC 4ESFA 2O8XA 4EVIA 2P7VB 4EV0A 1MJ9A 3RIRA 4XSZF 3EYYA 3HTUA 2QZ8A 2HEOA 2L54A 4Q5SF 3I0TA 1T98A 1WRJA 5K1YA 1X3UA 1ODDA 2WTEA 1REPC 2E1CA 3BY6A 2IVMA 3E5XA 2HQRA 5BOXA 1BN5A 1KU9A 5LBQA 2F5FA 3KLNA 4KA4A 3M7GA 1XSXA 4M71A 1LEAA 2ZO4A 4K2EA 3VOEA 3HSRA 1BI3A 1H0MA 1A04A 4IPAA 3BJOA 3GF2A 1T39A 1MJAA 4ZYEA 5DV5A 1ZG5A 2IA2A 3WTYC 5FFXA 4NQWA 2PEXA 4ZH4F 4HLYA 1PUEE 2ZXJA 2FSWA 1HSJA 2L4AA 4LLGF 4NHJA 3GO5A 1C0WA 2OZUA 1TQPA 1B59A 1TQMA 2H27A 4G94A 3QPHA
chains in the Genus database with same CATH superfamily
4XOPA 2MD5A 3JAMK 3MFKA 2LKXA 5FKKA 4S0HB 3IRQA 3L2CA 1HC8A 3BG5A 4J00A 2MSYA 2NYXA 2DXIA 1YI2I 2CUEA 3OL3A 3OYLA 3H0DA 3CD6I 4I99C 4UV8A 4Y15A 3J7AY 4JP0A 1IUYA 5E20A 4E4HA 5M3FJ 1QO0D 1ZARA 3CF2A 2R7ZJ 4W97A 2KIUA 2MFZA 3NWTA 3SFIA 5KAFC 2CMPA 2V1XA 1R49A 4BL0B 3CO6C 4FASD 2K3PA 2E7XA 3CCVI 4CO8A 3ZMZA 2W57A 3UR3C 2CYYA 3QPSA 4DBRA 1EJ9A 2M7AA 3MN2A 5CQEA 3IAS2 1Y8QB 2PMZA 3LA3A 3R0JA 4LIVA 4Y52J 2CG4A 1GXPA 1KQ0A 5LD2C 2X0LA 4HSRA 1Z05A 2W00A 3IV5A 4M3DA 3TP3A 4CXFA 5GP9A 2VUMJ 2TDXA 3IP4B 2H94A 3QYBA 2X6YA 3QP5A 2JSPA 4F52A 2L9VA 5DCFA 5C44J 3NQOA 4CYCA 2R4GA 3HJEA 4KYWA 1L3LA 3GFJA 2M0CA 3RPQA 1EV7A 1TWHJ 1ZK8A 4UVBA 1Y8RB 1B72A 3KZYA 2CQQA 1JXSA 3OS2A 2VE8A 1SFEA 3MCZA 5TGTA 1IO2A 3AAFA 4BQAA 4IHSA 2JRTA 3H36A 2OUMA 4RM2A 3KLOA 3OYNA 1HA8A 4KICA 3ABLH 4FE4A 4IRGA 1R36A 2BY0A 1HW5A 5ERIA 2VBYA 3W6VA 1BW6A 1OISA 1MBJA 2FUG2 5ICFA 3RKWA 3IWFA 1MMDA 2ID6A 2PX9A 4UXNA 4KISA 1HW1A 4G12A 4AD9A 3LOCA 3CCJI 3FHNA 4UHTA 2IRFG 5IP6A 5K5QA 1TC3C 2EQRA 1BIBA 1D0ZA 4LK1F 5HNFA 1MIJA 1T2KA 2WADA 4A0YA 2V26A 1MNMC 1YITI 3Q5FA 3OYJA 3DTEA 1TT5B 2CRGA 1U5TB 3JAMZ 3KCCA 1X4OA 1TQIA 4QSHA 3HRMA 4ZZDA 1RESA 1Z67A 3BC8A 3NWSA 4YRVA 4A3MJ 2R7VA 2DFHA 3D1NI 1QVTA 1MD0A 1KU3A 1WJCA 1MBGA 2GXGA 3K1NA 3ZRGA 2M0MA 2HI3A 3R0AA 2F5EA 3U21A 2G7HA 3UNGC 2ID3A 1ETVA 2LR8A 4BGDA 4G7HF 3K70C 2RREA 3FWEA 1ITYA 1W4MA 2OBPA 4XKVA 1TW3A 2DK5A 1WSUA 3OIOA 1LKXA 2H8RA 2CGPA 2P4WA 1YW7A 4CCJA 3I59B 2HQ5A 1MDMB 1YFHA 4MEXF 3CQZJ 3K0LA 5LGUA 1MSEC 3R60A 4P9UA 2A3SA 5FKOA 3MWMA 4JOMA 4XLCA 1VQ9I 3IWZA 2K9NA 2HWVA 2VE9A 4J01A 3LSPA 3QRFF 2ISYA 1ETXA 5M3MJ 1NTCA 2CH0A 2LYCA 3SZTA 2UXXA 1K6OA 2M8GX 4A5MA 1IRXA 2KRFA 3M8FA 2RNGA 4B44A 2RAEA 1OCRH 4AU7A 2QKMB 5D5XB 1E2XA 3I58A 1I3AA 3CMEI 3OYFA 2K4JA 2XB5A 4NC6A 2Q1ZB 2VBWA 1ON1A 3PIPF 4KMFA 3S14J 2HZDA 4MTEA 3BCAA 2ADUA 3JTHA 5BS6A 4CUGA 2WWYA 2YS9A 3DU5A 4HNTA 4N4OB 2KQRA 1X1CA 1H89C 5BMZA 3WODF 3KP6A 3WTWC 1IZ1A 1TZLA 1ZELA 2R5YA 5DD4A 3E1SA 1GV2A 3TOBA 4A3EJ 1K6YA 2DODA 4I09A 2QQBA 3LMMA 1VQ8I 2EZLA 3ZQGA 2QQ8A 5F0HA 2XIGA 1UB9A 2MLGA 5DUKA 3FXKA 5D4SA 4HX7A 1T38A 4AWXB 2W82A 5ICGA 2N8GA 3VDXA 2IEKA 3VSKA 1KQ9A 1ETYA 2DMTA 2BXYA 2PN6A 3BTCA 3MKLA 3RKQA 3LFUA 5HDGA 2W7NA 3DBHB 4RLFA 3HSFA 1LDJA 2XAJA 5F08A 3S1QJ 1LEBA 4BXXJ 1AHDP 3J7YJ 1N77A 2PQ8A 1BBYA 1HQCA 5IY5H 3DXJF 1K61A 4HF1A 1MGTA 2DO7A 2LKSA 3FXJA 1DU6A 1F4KA 3J7AO 2BHYA 4UY8I 2IXSA 5FRNA 2FX0A 1UELB 2A05A 1K7AA 2LY2A 1TTYA 3U9GA 3AFHA 2BVLA 3RZOJ 2W48A 3S3OA 2GA1A 3M4OJ 2E1NA 2LBFB 3QYFA 4OIRF 4P1WA 5J6XA 5ICCA 1O57A 1YS7A 4I02A 2NVUB 3I56I 1S7OA 1F43A 1EH7A 3FZVA 3A01B 4I2OA 4AVZA 2ICWG 1IN4A 2BGCA 1NK3P 3DF8A 2W84A 2WY8Q 2JMWA 3RJPA 2DDBA 4MLOA 4F55A 4KIFA 1I39A 3D0SA 2COBA 2ZJPF 2KKOA 4HZFA 1DQUA 1G3YA 1IRGA 3FKJA 2KZVA 3TQNA 1R00A 4A12A 2DFEA 3M07A 4FX4A 3PO3J 3IAM2 1FSHA 3E6BA 3O2PE 2DOFA 4XKBA 1XGOA 2EWNA 1HF0A 2QENA 2LMDA 2L7KA 5J4VA 1X3ZB 2H09A 2M3AA 4CDGA 4O6JA 4XKWA 4Y4RA 1ON2A 3AG1H 3CUOA 4KIGA 3A01A 2A61A 5FLVA 4AYBA 3IKVA 2P81A 4IKFA 5HLHA 2VOPA 1LJ9A 1PJRA 3DPUA 1UZCA 3RYRA 3K70D 2CFXA 1XSDA 1QZYA 1P4XA 5HDNA 1XGSA 1Z3YA 2NNNA 5EJCA 4E7JA 2ISZA 1DP3A 1ZKGA 1I1SA 2NVYJ 5J3LA 3B6AA 1TNSA 3HL2A 4HEA2 4CH7A 5E3NA 4WXDA 4HV5A 5HODA 2YU3A 2V1NA 4HLXA 5D8KB 3EETA 1A6QA 2KIQA 1G3SA 2WAFA 2WAQN 4BXUA 3CZ6A 4F7ZA 3CCEI 1CQTA 2X51A 2O3FA 2V4JC 2ZJQF 2E36A 1BI2A 1LFPA 2XF5A 5FD5A 3F9KA 4PFPA 3TO6A 4B3XA 3LSTA 4E7SA 2QA4I 5E79C 4P96A 3CCYA 1QHGA 1TWAJ 1WH7A 1MW7A 4L5IA 3D5LA 4D9JA 4A3BJ 4PGGA 2JSCA 2CU7A 1KZHA 1BM9A 1I27A 5CQGA 2JVGA 2K5CA 5HNHA 4BBSJ 3LAPA 3IC7A 2KMUA 3K10A 2ZBKA 1I5ZA 1BR2A 4OAYA 3HBLA 3ZQLA 4XICA 2UUZA 2IGOA 1FYMA 4LJZF 4RB2C 4PDKA 3K6GA 2E1MB 2LY9A 4M73A 1XCVA 4UUSB 1G6NA 3FM5A 3L1PA 1WPKA 2IGMA 1TP4A 4Y3OA 3BWGA 2IA1A 1WJEA 5A2QZ 2ZMEB 4MFEA 1X1PA 2KDOA 2VONA 1Q1VA 3ULQB 1QVUA 2PJPA 2E5ZA 4Q4ZF 2D1VA 5H6QA 3HG9A 3V7SA 3LFKA 1D1BA 3ZQFA 3GFLA 2D1HA 1ETKA 3O6BB 4RDUA 3GUDA 1Z9CA 2ETHA 3GWZA 3Q0UA 3QU6A 4EJVA 4BQOA 4CSWA 5BPDA 5AIPA 3JRFA 5D5WB 4JK1X 2WA0A 4IOAF 2R92J 1LDDA 3F6OA 4CCOA 1HOMA 4RAZA 3E7LA 2Z99A 3CCMI 3CCRI 4B8XA 3H3VK 1W5SA 4RGUA 4O3MA 2CW7A 4B47A 5IT9K 3MAJA 4N4NB 5J1RA 4KJZA 2HOAA 5GTHC 4A93J 2Z9OA 2ACJA 2J5OA 1HBXG 3LSJA 3WTTC 3DKXA 1EF4A 3ECOA 3E6DA 3HHHA 2MG4A 2VQLA 3FM3A 4M9XA 2FQ4A 2H1LA 3LSHA 1E0EA 2VT3A 1WJ5A 3M1EA 2EFOA 2DMUA 1B6AA 2X48A 5F6FA 4OIQF 3V8LA 2D2WA 3QOPA 1ZH5A 1EH6A 1TLHB 1R7JA 3V7RA 3SXYA 1NG7A 2DJIA 5E1ZB 5DD8A 3ASNH 3IL2A 2DI3A 1FBQA 2ELKA 3LSMA 1OCCH 3F8NA 5E1XA 3E5UA 4HNUA 3F23A 1R6RA 5ICEA 3SJMA 2Y9ZA 3F8BA 4RGXA 1WJFA 2P5KA 3U2RA 3D5RC 4R1HA 1ZLJA 3DBLB 4Z6YA 4P55A 2K9SA 3WE3A 1OCOH 2LSOA 5E17F 1SEUA 5B1BH 1ZAOA 2PMZN 1O7LA 2LFBA 4HW0A 2NOGA 3VWBA 4G7OF 1OR7A 1V5GA 2XAQA 4B4CA 3ZGKA 3TO7A 4CZZA 1ZR2A 3GTMJ 3B6CA 3F8FA 3V4GA 1RR7A 3V8KA 1S8NA 2FMLA 4IHVA 2GAUA 3S15J 4A69C 3FIWA 1NK2P 4YEJA 1U78A 3H3ZA 4A5NA 2DA4A 3FKIJ 3S1NJ 4WCGA 4MHGA 2ECBA 2EFPA 4HBLA 3OIQA 2KIMA 4UB8C 9ANTA 3ZN1A 1W5CC 1T6SA 1YW8A 4DOZA 2LNBA 4FQGA 5H2FC 3KP4A 3B02A 4EJWA 5FKLA 2Y31A 4HG2A 2B9SA 2KT0A 1YX3A 1MBKA 5CVJA 3AL0C 4PJLA 3FMQA 2DA6A 4HYEA 2TRTA 1P6RA 4XN0A 3HRSA 5DEQA 2XSJC 3GW2A 3DEEA 3K4KA 3PFYA 1BA5A 2MD0A 3U1KA 2A6TA 4QTRA 1LQ1A 2M5WA 3W6JB 1R1TA 4BHPA 2W25A 2CQ7A 2G7UA 5HLTA 4MEYF 2BW3B 4RLQA 3VPRA 3O8HA 1Y39A 5EEHA 2R7UA 2ZCWA 3V42A 3VSLA 4L5JA 5D6FA 5DCMB 3FXUA 1JUPA 4RM3A 2X9DA 3FK7A 3H5NA 1MJBA 1KONA 3MKWB 3JTGA 5L3BA 1YJWI 1GXQA 3SEZA 4EEFG 1R4MB 1IN7A 3I64A 5IOYA 2VJJA 4XLEA 1XC5A 2QSFX 1BIAA 3H9JA 2XAGA 1VF9A 2VOOA 2A6EF 3VYTB 4QLCU 2XB0X 4C3JJ 4V2GA 3K4LA 4E7KA 1OMIA 4HF2A 3ECHA 4IRHA 3OS0A 4A3FJ 2IAIA 5GAGJ 5JHFA 1AOYA 2CW8A 2JUCA 3PIOF 2W24A 2JQ7A 2QLZA 3GTOJ 1B72B 1TNTA 1U9NA 2VASA 1HSTA 1U2WA 2R7XA 2CUFA 2EFWA 4C3IJ 1YRNB 2RNJA 2Y30A 4AM3A 3WE2A 3S2WA 2EH3A 3KYLA 1K4TA 4Q48A 1B8IB 4C2TA 3S16J 2NNYA 1I6XA 2GLOA 1Y6IA 2L01A 2CQNA 3IH2A 4PJMA 3FX3A 3Q9SA 5FKMA 2NVXJ 4OU0A 1W7PA 1SFXA 3DBRB 3S1RJ 1X3WB 4PJ0C 3E0JB 3H5RA 1RUOA 4Y7NJ 2GBYA 1PP7U 2LF8A 1W36C 4U0WA 2VB6A 2V9PA 4BNCA 2BHZA 1K78B 3QPLA 4M9SA 2K9LA 4DYCA 4HQEA 1CGPA 1IDYA 4D5FA 1IN8A 3C3WA 4D5CA 1HW2A 1G59A 4X0GA 1P7JA 3J80K 1IV6A 2HQNA 1J0RA 2HOTA 2OD5A 2XVCA 2NS0A 1MNEA 4RBOA 1T0FC 1MBFA 1RNLA 3RDIA 4PJJA 2ZKZA 3HOTA 4OIOF 1JKQC 2E1OA 3H5AA 2KHMA 3WTZA 1G2HA 2OU2A 5F0FA 3TBIA 2GXAA 2EA4A 4ANJA 2EK5A 1WKMA 2P8TA 1U8BA 1F5TA 3I53A 1E17A 2B0LA 4U88A 4QPOA 3QYEA 5EEAA 4P5OA 2CSOA 2GXBA 3C2GA 4X6AJ 4M3FA 3ZN0A 1RIOH 4OINF 4PGHA 5CVVA 5HS7A 3GYHX 5K7HA 4BH9A 2E35A 4HDUA 3HGGA 1Y1VJ 2FOWA 1OYIA 3WU2C 1BW5A 1O3SA 5F0CA 3M8EA 3GZ6A 2R7DA 2ZSIB 5E8GA 5ED4A 2WY7Q 4CGZA 4OWRB 1Y56A 1ZHFA 1U5TC 2HNHA 3FBIB 2O7OA 4ON0A 3TKYA 2BXZA 2R0QC 3CUQA 2DTZA 3BR1A 3OSFA 2G9WA 2BY3A 3GBGA 3Q0WA 1VTNC 4HX4A 3PJRA 5IP9J 3G73A 3SDGA 2W1OA 2DMPA 3G3ZA 2NS7A 1W0UA 3HZJA 3REOA 5B66C 3IRRA 4IXAA 4D7NA 1GVDA 1I1GA 4ASNA 5BNGA 2DMNA 4G6DA 4LMYA 4KN7X 4AIHA 1SMYF 2Y69H 2GOMA 3CMAI 1MMGA 4U0YA 1JHFA 3BPVA 2UV1A 3S32A 1PDNC 3LAJA 4LITA 1AKHA 2HYGD 4UB6C 5B5EC 4Y33A 1XGNA 3CLOA 4XBFA 4AIKA 3UKGA 4A6EA 3JW4A 1U5TA 1VNDA 1VQLI 3LSKA 1LVKA 3LA7A 2M2EA 3J80Z 3NRVA 4PSWA 4S05A 4IHXA 1I6HJ 3W2AA 1R71A 3RQIA 1BR1A 3F8CA 2VBXA 3B73A 3LQRA 3K7AJ 1BI0A 1HDDC 1R1UA 4BHBA 3GZ5A 4KT5C 5LLQA 3QQAA 2WV0A 1S7EA 2HVRA 3KP3A 5C4JJ 2QBYB 1IW7F 2FNPA 1RR8C 2JK3A 1JGSA 4PUSA 2IJLA 2A5WA 2IT0A 4FHTA 3COAC 2JPBA 3IH4A 3Q9VA 1PUFB 3F0CA 5CVIA 4IL6C 5H6RA 5HDKA 3KX2A 5LFAA 3HXLA 3RPUD 2EV0A 2CFOA 2MBFA 3DQVC 4A3LJ 1JTYA 2VBZA 1R23A 5EF6A 1O4XA 3HIFA 2BZTA 2VQCA 3DWLE 2FBIA 1SVOA 4XQFA 3VEPA 2F5VA 1H9GA 2AXTC 5BQTA 2K9MA 2KLOA 3RYPA 5FD6A 4A2UA 2EZIA 1FNNA 4YIRX 3I71A 2V6EA 3OYHA 4JBAA 4M3EA 5JI6A 4GGGA 4GYGA 2HZTA 2QSHX 4LB5A 5HS8A 4ESBA 4ENKA 3ZR8X 3BR0A 3OOUA 4BDZA 4JX6A 4D0PA 3I59A 5GPCA 1MDMA 1ZGWA 1A31A 4F92B 3GLXA 3QU3A 3OYCA 1YYVA 3TP0A 3L2QA 2EFNA 3K69A 2HVSA 1LUJB 3T8RA 5LEKA 1D5VA 1WJDA 4Q47A 5K5OA 5HLIA 2XRNA 3K2ZA 4XRMA 2DN0A 4N9HA 2DT7B 4IHYA 3SZPA 1PYVA 3ZQQA 4BQNA 1TWCJ 2F48A 1N75A 4U7BA 1FJLA 1ONVA 2DMQA 2L7ZA 4N9IA 4NC8A 3VB2A 4CICA 3W6KB 2DPUA 2JA5J 1JUSA 1D5YA 3PNTA 1P4AA 1MMAA 2P0WA 3DKWA 1EH8A 2KL4A 4BQQA 1VQ6I 1BC7C 4F93B 3MVPA 3H9QA 5DYMA 2O03A 3LNQA 2YPRA 4HRIA 5KK1A 2YX7A 1UMQA 1FYKA 3KZIC 3JR9A 1F1ZA 3CMMA 4PFOA 1Y1WJ 4QIWN 5CVRA 4JQFA 1YOVB 3CUQC 2VODA 3O3KA 2DBBA 2KPMA 2EA2A 3H35A 3MD2A 4CYDA 5HS9A 2IW5A 1EA3A 1SMTA 4PK4A 2R93J 4XLNF 3CDHA 4RB3C 3G6EI 2BW3A 2X6OA 3HGYA 1N25A 4CCMA 3EYIA 4RAYA 1USSA 2L5QA 4XNFA 4M3BA 1RKTA 4MO7A 4OIPF 1ZGAA 1U9OA 3OYIA 1XS9A 1JKOC 3TW7A 1HXDA 1N78A 5C3EJ 2FXAA 2V9KA 3C7JA 1Y0UA 3MQ0A 3WGGA 4BY7J 5FB2A 1J5YA 3CP8A 3P7NA 3L09A 2CO5A 1B9MA 2HYFA 3RCOA 2R7WA 1HLVA 2ZNYA 1OQYA 4XRFA 3A2KA 3HSEA 1P7IA 3F6VA 2H6CA 1D1AA 2BOLA 1D1CA 2MC4A 1FSEA 3PFIA 2LTPA 2HPMA 2O61A 1FTTA 3E97A 2JZYA 2RKHA 3CJTB 3DTKA 3QPTA 3OYDA 5TJJA 4II3A 4DW6A 1HDPA 3TGNA 4XN3A 3JREA 3AG3H 4WK8F 1RKWA 4U7DA 3EUAA 2STTA 4XRSG 1QPMA 4HV6A 2FE3A 2EILH 2V79A 5L3CA 3K1MA 3AKZA 3ZMDA 4A3KJ 1OLTA 1XMAA 1QU3A 4AVPA 2XAUA 1QPIA 4I01A 5IT9Z 1G8XA 1FOWA 2PLYA 3KETA 3H1CA 3ABTA 2Y75A 4CYCB 3SFZA 5FRMA 3KYDB 3K4CA 3E6MA 3CESA 3DP7A 3K1PA 2OTLI 1FLIA 4M74A 1VFCA 3BR3A 2JRMA 4U87A 1W36D 4NB5A 4DBQA 4F91B 2K4BA 2R5YB 1J7KA 1UJ8A 1VI0A 2JVHA 2NVTJ 3X2QH 2EV6A 4W1UA 1DDNA 3CCQI 1AA7A 1E3HA 4JX5A 1VQPI 1X1DA 2MH2A 4YFKF 2Y0SA 3KEQA 3L2WA 1YW9A 2VXDA 4B48A 1IRFA 4NDLA 2E60A 4KUMA 3CCSI 4MTDA 3CC4I 2VKDA 1XMKA 2FNAA 1YIOA 2L3DA 3HPGA 4D7MA 1R1VA 2D45A 3N97A 4KFCA 2GQQA 4M72A 2OAZA 4GO1A 3FMRA 1AKHB 2JPCA 2Y2ZA 4HF0A 4XLFA 1R5ID 4GRIA 3IHUA 3WGIA 3L2UA 5AONA 3J81Z 1S29A 4DNCA 1ZR4A 3JRGA 2FRHA 3AL0B 3OYAA 2JN6A 1OJLA 2DFIA 3BROA 4ZTJA 2AXLA 3J7ZI 2F5DA 2O0YA 2XAHA 4MNUA 3GTQJ 5F1RA 2DTRA 3GMEA 2CS3A 4BJ5C 1W7PD 2LDUA 2XRLA 2MW8A 5E3MA 2K85A 1G3TA 1UG0A 5H20A 2ZXIA 4LOCA 2F2EA 5EEGA 3O8GA 3P9CA 3Q0VA 3G71I 1ERDA 1U0JA 3OYMA 2HS5A 1YS6A 2WAEA 3SHFA 4FISA 3BTLA 3HEFA 5HOOA 1W5TA 4NC7A 3CJRB 4V2FA 4FT8A 3WG7H 1YE9A 1IXRC 1NG6A 3RKXA 4HOBA 3DTIA 4EMSA 2DA1A 3S1MJ 2V7FA 3PM1A 1E3PA 3PNYA 4ZYHA 5KHDA 1RRJA 1OCTC 3GTPJ 3V8JA 1RZ4A 5HVQC 3I5UA 3FBNB 2R7QA 5JLXA 3BG6A 1W0TA 2HDDA 3SYTA 1YHQI 4BHCA 3F8MA 1FPQA 3JRDA 1SANA 2LRDA 1P9QC 1JJ8C 1DPUA 5F27A 4BUPA 1ZG1A 3VYRB 4IVNA 3FMSA 5J1UA 2Z5UA 3BR5A 1M1EB 2MYSA 3DU6A 4KDPA 3U1DA 1IXCA 2F4MB 3CJQB 1KYZA 1ZRFA 2CWEA 3ELKA 3KP2A 5LEJA 1Z6TA 5ILSA 4H0EA 2JJ7A 5LGNA 3OMYA 4LG3A 1J9IA 3JCUC 3ZQCA 3DFGA 3CDIA 2Z2SB 2PBIA 3FDYA 1YTYA 3I3LA 3BCBA 4BAYA 2HR3A 4LGWA 4WX9A 2X85A 1UAAA 3SEQA 2OTJI 3EQLF 2OQGA 4LLLA 3K4JA 4IF4A 3LQQA 2IS4A 2XROA 4A0ZA 4E70A 2NOJB 1TBXA 3T8TA 3MMYB 3NAUA 1CF7A 1FBUA 2JA6J 2DLLA 4ZDPA 2KP6A 3K9TA 3T1BA 1SAXA 5J47A 3PUBA 3OS1A 3ABUA 2WV1A 1QQIA 2L9RA 2ZFWA 2H6BA 4RA2A 2DQLA 2DCEA 2V9VA 4EJOA 1LE8B 2F4IA 3BTIA 1R4NB 5EZGA 5J8CA 2Q8KA 1FIAA 2OC6A 4ETSA 4A3JJ 2KIFA 2YSRA 2HDWA 2RQQA 1XB4A 5GPAA 1D8KA 1B9NA 1G4DA 3BR6A 2ELHA 4NBQA 3CF5F 2JT1A 4N0BA 5CVUA 5CJ9A 3I4MJ 2C6YA 4EM0B 2QVOA 3VODA 1KA8A 2E1MC 2P6SA 3HOVJ 4MQVA 2L9SA 3BDDA 1WGXA 4HAMA 2RVCA 3N05A 3CCUI 2XGCA 4DZPA 3TL4X 4A3CJ 4HA8A 2NVQJ 3M9AA 3TEDA 3ZMUA 2WB1A 2H8WA 1BJZA 1V4RA 2HVQA 4CHUA 5D5VB 1RI7A 1X4PA 2CUZA 2DA7A 3OV8A 3QOEA 4L9JA 2M7BA 2P5VA 4DIQA 2RV8A 3WTVC 4R8HA 1BI1A 4MGRA 3PNVA 4I98B 2XKPA 2AHQA 4C3HJ 2E2IJ 3R6SA 1NHAA 1VQ4I 3BTJA 2XKOA 3ERMA 3S8PA 3LSIA 1P4WA 4GDFA 2OV7A 5EDNA 4G9YA 2IA0A 1FOYA 4HQMA 2K27A 1ZRCA 3WU1B 2OA4A 3WHCA 2EFQA 2VKEA 2NXNB 3MKYB 3GVAA 5JHUA 1ENHA 1IC8A 4WWCA 3D5SC 2Z33A 3RI4A 2WBMA 1Z7UA 2XASA 4G6TB 3FXQA 1ZREA 4EM2A 3WTXC 3ISPA 2QBYA 4RGRA 1WVRA 4JX4A 1ZLKA 1VZ0A 2BYVE 5L3DA 4E7ZA 2VJ5A 4FTHA 3PUFA 2M4GA 3ZQIA 3N4MA 1K83J 2FA5A 1HKTA 1T08B 2M30A 3CO7C 3HRTA 3L00A 1YRNA 2A69F 2QCOA 1DU0A 5KVRA 5FROA 1BL0A 1ETQA 3RZDJ 3V7CA 4L9NA 1S9HA 2PMHA 4L9TA 3PSFA 4M6YA 4M3GA 1ZG3A 1SD4A 2E2JJ 4XRSA 1FBSA 2X1EA 2M4KA 3A02A 1STZA 3L9FA 2ESNA 1K78A 3KP7A 5IYCJ 4EGZA 3ZMVA 1IXSB 2VC1A 3F21A 3H92A 1XX5A 1BJAA 3W3CA 5L3FA 1LDKB 2ME0A 1FZPB 3P5JA 1TW2A 1I50J 3ZPLA 4BBRJ 3GXOA 4CA0A 3I54A 4II2A 2EV5A 1APLC 1VQ7I 4M6XA 2KISA 1HKSA 1GVJA 2DYSH 3MZHA 5E8IA 4OOIA 3FHZA 2L4MA 3TDZC 3JRIA 3GEZA 3KPHA 4M9ZA 3T0YA 4BU2A 1PVEA 2RN7A 1PP8F 3G4SI 4IQ4A 3DCFA 4CCKA 3JSOA 1D0YA 1XMXA 1T0FA 2XPVA 2V1DA 3CJNA 4HNVA 2VC0A 1FOKA 5C4XJ 1UHSA 2MA3A 1JT6A 5FKNA 2DA3A 5EGOB 2KZGA 4RS8A 2K3FA 1Z77A 4LFUA 3OSGA 3OYEA 1GV5A 2Q2EB 5F1JA 2Y0MA 4IZZA 1WH5A 3R61A 4NNJA 3RQ4A 1UHWA 3ONQA 3QAHA 3T5XA 2KRHA 5FLXZ 1TL8A 3AG4H 3DEWA 1BOBA 4DZJA 1S72I 1EKEA 3CTAA 2Q2EA 5JLWA 2HKXA 1Z6RA 2XPWA 4AC0A 1A5JA 1RPWA 1KQ8A 3MZYA 3S2DJ 2LP0A 4XMYA 1F36A 2EIKH 5HLGA 1KGSA 3ZP5A 4I0AA 3GTJJ 1OPCA 1BC8C 2QYOA 3BG9A 3ABKH 2RGVA 4XK4A 5LRSA 5GAEJ 1VQ5I 4ENJA 5B3SH 5GTIC 1SD6A 4KNYA 1WWXA 2YX4A 1SFOJ 4BACA 2ME6A 5AIQA 5JFRA 3BZKA 1B4AA 2H1KA 1J2XA 1U6GA 2DT5A 3RTRA 1ZQ3P 3ZOBA 4WXCA 3HYIA 4IJAA 2O9LA 1LNWA 4XSXF 2DAOA 1O3TA 3S2HJ 2LREA 4KIBA 1LPQA 1Z1DA 1XSVA 1J75A 4BE2A 2JA8J 2G0EA 5KCMA 3OIPA 2QWWA 2Q0OA 1TWGJ 2IS6A 1QNTA 4DJAA 3ERED 1LFUP 2ZMEA 4I7HA 2M8EA 2UXNA 5EG0B 5D5UB 4ENMA 3TW6A 1XDSA 3WTSC 4A6DA 1E3OC 5D6EA 2AS5F 5GADJ 5DM6F 4PJNA 2MLKA 2XHKA 3BG7A 1ACIA 2I8DA 5J1YA 1IG7A 2COMA 4KMUX 4RB0A 1R58A 2W4SA 1V3FA 1S7AA 2XF6A 4XKCA 4AIDA 3M3YJ 5LHIA 4D1QA 5JR3A 2BY2A 3JRCA 3S3MA 1WJBA 3BQZA 4YFXF 4BE0A 4QWQA 1MMSA 1ULYA 2W85A 4OAZA 2P7CB 2DOEA 2X1DA 3I4PA 5D8LB 4YG2F 3K4BA 3LL7A 4JYKA 2X4HA 1X58A 4C9YA 3ABMH 4EATA 3HUGB 4I6ZA 1WI9A 3HM5A 1FC3A 3A03A 2XC7A 2HKOA 4IHTA 3VYUB 3WTUC 3GFMA 2QQ9A 2IS1A 1FX7A 4ZYGA 1U3EM 3KFWX 1VQNI 1JUMA 1USTA 1JI8A 3CUQB 3HDDA 1MNDA 4GXOA 3G1OA 2V6CA 2R7SA 4MIMA 1YJNI 5CKTA 3SZGA 3HC7A 4PSXA 1MSFC 1YIJI 3RPUA 2LC2A 2O5RA 4KN4X 3W2WA 4EM1A 2GM4A 3KYCB 4XLPF 1FOXA 2JA2A 5J8FA 5CLSA 2ECCA 1IJWC 1MH4A 3CLQA 1FP2A 1YO5C 1QBJA 5KNLA 4BY1J 2EZKA 2VPLA 4KITB 3P9IA 1X2MA 1UFMA 2F5CA 4TV7A 1W7PB 5FFZA 4B43A 2OCEA 3GFIA 4IRIA 3DPTA 4B3AA 2M9HA 2BY1A 2F4OB 3OY9A 3LWFA 1OYWA 2DFFA 3EUKL 1HCRA 2CW0F 3OOPA 4P9FA 5K7FA 2MC3A 2L9NA 2VXZA 2P5LC 2YR2A 1Q1HA 5LRRA 1KYWA 2R5ZB 4CZCA 1O7FA 1FYLA 3CCLI 1FWZA 2BEOA 2R7FA 1QA6A 1YQAA 2A6HF 5BPIA 2XUBA 3BT9A 1DUXC 1FT9A 2TCTA 1GDTA 1AU7A 3KZZA 3MEXA 4A0XA 1S3JA 3KEOA 5DM7F 2VI6A 2DJNA 5TISC 1XGMA 1UHMA 3CC2I 2OCCH 3A0BC 3S3NA 1QGPA 2Z1DA 3LSRA 4L9VA 2RC4A 2AQFA 4DGWB 4XL9A 4FE7A 3C1DA 4XLHA 2BV6A 2IP2A 3E6CC 1O3RA 4LLNA 4DYRA 2HXOA 2J5PA 4ZZLA 2PFBA 4AYBN 1MBEA 3NEUA 4XORA 4EGYA 2K86A 1RUNA 2HOSA 3WG9A 2MH9A 4BDYA 2CV1A 5FLXK 2KJBA 3HOZJ 4GYIA 5JVTA 2ZNZA 2K40A 2M87A 4EQQA 3E5QA 2HTJA 5DUIA 2DK8A 1MZBA 3TMOA 5EYRA 5E18F 1X1AA 1JHHA 3HUGA 3HRUA 4O5VA 1KU7A 4R79A 1UCRA 4BEHB 3HOUJ 4LG0A 4B09A 4I76A 1JE8A 1ZTRA 3EUHA 3FXRA 2ZMEC 4FETA 2AO9A 3ZQ7A 1G3WA 2FD5A 4XLAA 1NH3A 3HTSB 4C30A 3PQKA 2EJRA 2LBFA 4RAGA 2ZJRF 1LVAA 4E7IA 5JVGF 3RKYA 1FMWA 1X2NA 1VQMI 4NQWB 2RDPA 1VQKI 1FMVA 5IYDJ 3VYSB 2VKHA 3BJ6A 2PJRB 3VFZA 4ZYAA 3C2HA 3C18A 1LE8A 1YG2A 1WQ2A 2GIVA 1RETA 2DT6A 2FMYA 2A68F 3RSNA 4ABZA 5M5WJ 1ZGJA 3DV8A 4GCVA 3I4NJ 3J81K 4BEHA 2RQPA 1QHHD 5FJ8J 2DPDA 1L0OC 2VT2A 3HOSA 2EBIA 3TOAA 4IHWA 3KEYA 3BQYA 3DLAA 1CF7B 4A3GJ 4Z2YA 2XGDA 3P9KA 2VQGA 4BS9A 2DA5A 3IUOA 3JRAA 2GIZA 2GWRA 4UUSA 2WB1N 1A35A 4ESJA 2K9QA 3HOWJ 2ESHA 1D0XA 2BBYA 1WHUA 3NARA 3BPXA 1XCBA 2CQKA 4LIUA 4RAFA 3OR1C 1O3QA 2XV4S 2M45A 5DCMA 4LG0B 3F72A 1XN7A 5J40A 4HDVA 2GZWA 1KU2A 4XONA 2HYJA 3DEUA 2LH9A 4UVAA 4YIFA 2STWA 1D8JA 1D3YA 1JKRC 1IRZA 3IKTA 5FO5A 1S5LC 5FGMA 3BJAA 1IAWA 2HU9A 5J4YA 1IV8A 3KIOA 1R9TJ 2MABA 1T33A 1V54H 5CPRB 1A36A 4Y17A 4XOTA 4ZJZA 2Y0SN 5IT3A 2ZC2A 3WHBA 2PJRA 4G7ZF 4I0BA 1GUUA 2FJ1A 2EZHA 1IN5A 3EPZA 1GHCA 3PSIA 4CCNA 3DPLC 4ITVA 1LFBA 3MKZA 3GX4X 2R7OA 3L2RA 1IN6A 2IBDA 3FXOA 1SVMA 5EG0A 4ZDOA 1H8AC 3IH3A 4UVCA 1X19A 5DS9A 3A0HC 2KFDA 3EDPA 4UV9A 4YELA 2A07F 2L02A 4IEJA 3LA2A 3H9GA 2JTVA 5M5XJ 2X6XA 1FY7A 2YUSA 4U0VA 2KJCA 2NRAC 1AWCA 4HSTA 2I5UA 5IPAA 1FIPA 4ZDLA 2DA2A 2VLAA 3ZMSA 3R4KA 4G8XA 4Y13A 2CV0A 5GAHJ 3QP6A 2ZXHA 4RB1A 4EJTA 2NS8A 3ESWB 1OR7C 1XDUA 1PUFA 2VQHA 1X1BA 2DW4A 4RGSA 4RMNA 2WC2A 3FF5A 2E7WA 1UG2A 2BE5F 2KRCA 3EUHC 4LD5A 5K7ZA 4V19K 2VN2A 5LGTA 2L2OA 4LB6B 3I55I 1H88C 1WFXA 3QWLA 2M1BA 3L7WA 3OYGA 3TO9A 3W2VA 5EGOA 4ZTFA 2KDZA 2XF7A 2PG4A 1SD5A 4OMYA 4UUVA 1FTZA 3OWTA 2V1UA 2P6TA 2DU9A 5LHGA 2QKLB 1MH3A 4BE1A 3G1MA 3PQJA 3SQNA 4BYYA 6PAXA 4L18B 2XGEA 2XDVA 1JGGA 2O6GE 5M5YJ 4BJ6C 2FBHA 2O8KA 1IGNA 2E5NA 4IOCF 3HKZA 5E1WA 1ETOA 2FF4A 5F64A 1ZYRF 2FOKA 3WGHA 1V5FA 2E19A 2LY1A 2XAFA 2R7RA 1TT0A 4XR6A 3BZ6A 4ENNA 3E3VA 2PMUA 1FP1D 2XPUA 1Z0XA 1WI3A 3JRBA 1ORKA 2R3SA 1OKRA 1POGA 1DPRA 2HGCA 4LK0F 2QGUA 1T95A 1JTXA 2LKPA 3I9V2 1T8IA 3BG3A 4H4KC 5KAIC 4C2MJ 3F3XA 2QUFA 2NAZA 4A3IJ 3GTLJ 1ZRDA 2JUGA 1BOAA 2FU4A 2LVSA 1OCPA 4A3DJ 4AIJA 2OZ6A 1K4SA 3HOXJ 2JWTA 2GOXB 5FLMJ 4DQ2A 2BVMA 4PZJA 5E3LA 1WZ2A 3ZMTA 2VIXA 1K79A 1QRYA 3ZXSA 2LF7A 3BP8A 2B63J 2IPQX 1HKQA 2VKVA 4MFDA 4E7LA 3KP5A 3ZCOA 1P92A 3HKZN 3QPHA 1SFKA 3HPHA 2LLKA 1OYYA 3BLYA 1I3QJ 1RC9A 5L3EA 4L0YB 2Y9YA 1R5GA 1JKPC 3M1CA 1QZZA 4ZYDA 3PO2J 2Z3YA 1DP7P 1MBHA 3CMYA 2FQ3A 3F22A 3BOQA 4UUTA 4BKXA 3FXMA 2IS2A 2EB7A 3KE2A 2X6WA 2PI0A 3DLLF 2K7LA 3FISA 1LB2A 1J59A 2X1CA 5IP7J 1WJAA 1DGWY 2QM3A 2HOEA 4S04A 2FEZA 2UWMA 4CCLA 1SD7A 4HPQA 2EPFA 4FX0A 2Z16A 3S93A 2XSDC 1XTAA 2R7TA 1JT0A 1U8RA 3ML6A 5B1AH 2CUJA 5DTDA 2QF7A 1YLFA 3JSPA 4WXHA 5IYBJ 3BZCA 2MGQA 3ZQHA 4BXFA 1S6LA 1ZN2A 5DDGA 3FK6A 2VL8A 3GCMA 1XD7A 2L7MP 3ROUA 4QPQA 2HTSA 4L0ZB 2HFHA 2OQRA 1R22A 1MMNA 3K4MA 1P2FA 2E71A 2OPTA 5A2QK 2ZXWH 3GZNB 3DKYA 4PCQA 2Y48A 3Q3SA 3CC7I 4UNOA 2HXIA 2QQAA 5ILUA 4F3QA 5D4RA 2XGXA 5CYVA 4YIIA 4EJUA 2FBKA 4YFNF 3S17J 2CJJA 4G6QA 1Z7LA 5L3GA 3M8JA 5ILVA 3H3UA 3C2BA 1BR4A 2AQEA 2DDAA 4IQJA 2CQXA 3WU0A 3OR2C 5LHHA 2F6CA 3G1LA 3OYKA 1H9TA 2GA2A 2D5VA 1F9NA 2L7FP 1SFUA 3HOYJ 2UZKA 4WF2A 3HHGA 2ZFUA 4HX8A 5TRDA 2OF7A 1R5HA 2DQRA 2A5YB 4XIDA 1MKMA 1IF1A 2EINH 5K5RA 4X1EA 4MQ9F 2LD5A 2K02A 3OYBA 1VQOI 1Z91A 3AG2H 2IGNA 2ZJ2A 2CV2A 4OMZA 1B1BA 2HDCA 3TDUC 4ESFA 1V55H 3SDBA 1Z3XA 3GTKJ 2O8XA 2LK2A 2DOAA 4EVIA 2P7VB 3QODA 2VJIA 4EV0A 1XG1A 1MJ9A 2E34A 3RIRA 4XSZF 1XPXA 3EYYA 3HTUA 1ETWA 2QZ8A 5E3OA 2HEOA 3BR2A 1TWFJ 3A1YA 2L54A 2ZB9A 4Q5SF 1YJ9I 1OFCX 4E6KG 3JRHA 4C2UA 5F04A 3I0TA 1YX5A 1Y0NA 4ZC3A 2I10A 1WCMJ 4DYQA 1T98A 1WRJA 2EIJH 3CDLA 1QZEA 5K1YA 4IO9F 1X3UA 2WAQA 1J09A 1ODDA 2WTEA 2HPIA 1REPC 2B7EA 5EZHA 2E1CA 3BY6A 2IVMA 4FCYA 3E5XA 2HQRA 5BOXA 1BN5A 1KU9A 3K4NA 2IGKA 5LBQA 4B1RA 2F5FA 1OCZH 3KLNA 4KA4A 4L5EA 3GTGJ 3M7GA 1XSXA 1IUFA 4M71A 1Z21A 2VJ4A 1FEXA 2LOOA 2DYRH 2M34A 1LEAA 2ZO4A 2JA7J 2QSGX 4K2EA 4XM3A 3VOEA 3HSRA 2ELJA 3MZ8A 3GLLA 4IX7A 1GT0C 1BI3A 3OL4A 4E7HA 1H0MA 1A04A 4IPAA 2VPRA 1SVLA 3BJOA 3GF2A 1V5EA 1SAUA 3L2VA 1T39A 1MJAA 4ZYEA 5DV5A 1ZG5A 1IDZA 2IA2A 1SC7A 2ZSHB 3WTYC 5FFXA 4M6VA 4NQWA 2PEXA 1T56A 4ZH4F 4HLYA 2EIMH 4J19A 1PUEE 2ZXJA 4GFBA 3LSGA 5IOZA 2FSWA 1W1WE 1HSJA 2L4AA 4LLGF 3A4CA 4BJTA 2L0KA 1A6IA 1B8IA 3CP2A 4AUXA 2LG4A 3HB9A 4NUBA 2QEXI 2YU9J 4NHJA 4KT6A 2E2HJ 3GO5A 2R5ZA 2HQAA 1C0WA 1GLNA 2OZUA 1TQPA 3H0GJ 1B59A 3ASOH 3K2AA 1DGRM 1TQMA 3PL8A 1JJ6C 3FXLA 2H27A 4G94A 3G2BA 2OJED
chains in the Genus database with same CATH topology
2MD5A 3JAMK 3MFKA 3IRQA 3L2CA 2NYXA 4UV8A 4Y15A 1IUYA 5E20A 1QO0D 1ZARA 2KIUA 2V1XA 3CO6C 2E7XA 4CO8A 3ZMZA 2W57A 2CYYA 3LA3A 3R0JA 2CG4A 1GXPA 1KQ0A 2X0LA 1Z05A 4CXFA 2TDXA 2H94A 3QP5A 5DCFA 3NQOA 4KYWA 1L3LA 3GFJA 3RPQA 1EV7A 4UVBA 3KZYA 1JXSA 2VE8A 1SFEA 3MCZA 3AAFA 4BQAA 4IHSA 2JRTA 3KLOA 4KICA 4IRGA 1R36A 1HW5A 5ERIA 2VBYA 5ICFA 3RKWA 3IWFA 4UXNA 1HW1A 4AD9A 4UHTA 2IRFG 5K5QA 1BIBA 4LK1F 1T2KA 4A0YA 3Q5FA 1U5TB 3JAMZ 3KCCA 1TQIA 3HRMA 4ZZDA 1MD0A 1KU3A 2GXGA 3K1NA 3R0AA 2F5EA 2G7HA 4G7HF 3FWEA 1W4MA 2OBPA 1TW3A 2DK5A 1WSUA 2CGPA 2P4WA 1YW7A 3I59B 1MDMB 1YFHA 4MEXF 3K0LA 5LGUA 3R60A 4P9UA 2A3SA 3MWMA 3IWZA 2HWVA 2VE9A 3QRFF 2ISYA 3SZTA 2UXXA 1K6OA 4A5MA 2KRFA 3M8FA 5D5XB 1E2XA 3I58A 2K4JA 2VBWA 1ON1A 4KMFA 4MTEA 2ADUA 3JTHA 5BS6A 2WWYA 5BMZA 3WODF 3KP6A 3WTWC 1IZ1A 5DD4A 3TOBA 4I09A 2QQBA 2XIGA 1UB9A 2MLGA 5DUKA 5D4SA 4HX7A 1T38A 4AWXB 5ICGA 1KQ9A 2PN6A 5HDGA 3HSFA 1LDJA 2XAJA 1LEBA 2PQ8A 1BBYA 1HQCA 3DXJF 4HF1A 1MGTA 2DO7A 1F4KA 3J7AO 1K7AA 1TTYA 3U9GA 2GA1A 2E1NA 4OIRF 5J6XA 5ICCA 1O57A 1YS7A 4I02A 1S7OA 1EH7A 3FZVA 4I2OA 1IN4A 2BGCA 2W84A 3DF8A 3RJPA 4KIFA 3D0SA 2KKOA 4HZFA 1G3YA 1IRGA 1FSHA 3TQNA 1R00A 4A12A 4FX4A 3E6BA 3O2PE 1XGOA 2EWNA 2QENA 2H09A 4CDGA 4O6JA 1ON2A 3CUOA 4KIGA 2A61A 3IKVA 5HLHA 2VOPA 1LJ9A 3RYRA 2CFXA 1XSDA 1QZYA 1P4XA 5HDNA 1XGSA 2NNNA 2ISZA 1I1SA 1TNSA 4WXDA 4HV5A 2YU3A 4HLXA 5D8KB 3EETA 1G3SA 4BXUA 4F7ZA 2O3FA 1BI2A 5FD5A 3TO6A 3LSTA 4P96A 4L5IA 3D5LA 4PGGA 2JSCA 1BM9A 1I27A 3LAPA 3IC7A 2ZBKA 1I5ZA 1FYMA 4LJZF 4RB2C 4PDKA 4M73A 1XCVA 1G6NA 3FM5A 3BWGA 2IA1A 5A2QZ 2ZMEB 2VONA 3ULQB 2PJPA 4Q4ZF 2D1VA 5H6QA 3V7SA 3LFKA 3GFLA 2D1HA 3O6BB 3GUDA 1Z9CA 2ETHA 3GWZA 3QU6A 4EJVA 5BPDA 5AIPA 5D5WB 4JK1X 1LDDA 3F6OA 4RAZA 2Z99A 4B8XA 1W5SA 4RGUA 4O3MA 5IT9K 3MAJA 2Z9OA 2ACJA 2J5OA 1HBXG 3WTTC 3ECOA 3E6DA 3HHHA 3FM3A 4M9XA 2VT3A 3M1EA 2EFOA 5F6FA 1B6AA 4OIQF 3V8LA 2D2WA 3QOPA 1ZH5A 1EH6A 1TLHB 1R7JA 3V7RA 3SXYA 5E1ZB 5DD8A 3IL2A 2DI3A 1FBQA 3F8NA 5E1XA 3E5UA 3F23A 5ICEA 3F8BA 4RGXA 2P5KA 3U2RA 4R1HA 1ZLJA 4P55A 3WE3A 2LSOA 5E17F 1ZAOA 1O7LA 4HW0A 4G7OF 1OR7A 2XAQA 3TO7A 4CZZA 3F8FA 3V4GA 3V8KA 1S8NA 2FMLA 2GAUA 1U78A 3H3ZA 4A5NA 4WCGA 4MHGA 2EFPA 4HBLA 2KIMA 3ZN1A 1T6SA 1YW8A 2LNBA 3KP4A 4EJWA 3B02A 5CVJA 3FMQA 4HYEA 1P6RA 3HRSA 5DEQA 3GW2A 1LQ1A 2M5WA 3W6JB 1R1TA 4BHPA 2W25A 2G7UA 4MEYF 5EEHA 2ZCWA 4L5JA 5D6FA 5DCMB 3FXUA 1MJBA 3JTGA 5L3BA 1GXQA 1IN7A 3I64A 1BIAA 2XAGA 2VOOA 2A6EF 4QLCU 1OMIA 4HF2A 3ECHA 4IRHA 1AOYA 2W24A 2QLZA 1TNTA 1HSTA 1U2WA 2EFWA 2RNJA 3WE2A 3S2WA 4Q48A 2NNYA 1I6XA 2L01A 3FX3A 3Q9SA 4OU0A 1W7PA 1SFXA 1RUOA 1PP7U 2LF8A 4U0WA 4BNCA 1K78B 4M9SA 4HQEA 1CGPA 1IN8A 3C3WA 1HW2A 3J80K 2HQNA 1J0RA 2OD5A 2XVCA 2NS0A 1RNLA 3RDIA 4OIOF 2ZKZA 3HOTA 3WTZA 2OU2A 2EA4A 2EK5A 1WKMA 2P8TA 1F5TA 3I53A 1E17A 2B0LA 4U88A 4P5OA 2CSOA 2GXBA 1RIOH 3ZN0A 4OINF 4PGHA 5CVVA 5HS7A 3GYHX 4BH9A 4HDUA 1OYIA 1O3SA 3M8EA 3GZ6A 2R7DA 5E8GA 5ED4A 4CGZA 1ZHFA 1U5TC 3TKYA 4ON0A 3CUQA 2G9WA 1VTNC 4HX4A 3G73A 3G3ZA 3REOA 3IRRA 4IXAA 1I1GA 4ASNA 4G6DA 4LMYA 4KN7X 4AIHA 1SMYF 4U0YA 1JHFA 3BPVA 1PDNC 3LAJA 2HYGD 1XGNA 3CLOA 4XBFA 4AIKA 4A6EA 3JW4A 1U5TA 3LA7A 3J80Z 3NRVA 4S05A 3F8CA 2VBXA 3B73A 3LQRA 1BI0A 1R1UA 4BHBA 3GZ5A 4KT5C 5LLQA 2WV0A 3KP3A 2QBYB 1IW7F 2FNPA 1JGSA 2IJLA 2IT0A 4FHTA 3COAC 2JPBA 3Q9VA 5CVIA 5H6RA 5HDKA 2EV0A 2MBFA 3DQVC 2VBZA 1R23A 3HIFA 2FBIA 3VEPA 1H9GA 5BQTA 3RYPA 5FD6A 4A2UA 1FNNA 3I71A 4JBAA 5JI6A 4GGGA 4GYGA 2HZTA 4LB5A 5HS8A 4ESBA 4ENKA 4D0PA 3I59A 1MDMA 3GLXA 3QU3A 1YYVA 2EFNA 3K69A 1D5VA 3T8RA 5LEKA 5K5OA 4Q47A 5HLIA 2XRNA 3K2ZA 4N9HA 3SZPA 4U7BA 1ONVA 4N9IA 4CICA 3VB2A 2DPUA 3W6KB 1P4AA 3DKWA 1EH8A 1BC7C 5DYMA 2O03A 2YPRA 5KK1A 2YX7A 1FYKA 1F1ZA 5CVRA 4JQFA 3CUQC 2VODA 3O3KA 2DBBA 2EA2A 4CYDA 5HS9A 2IW5A 1SMTA 4XLNF 3CDHA 4RB3C 3EYIA 4RAYA 1USSA 4OIPF 1ZGAA 1HXDA 2FXAA 3C7JA 5FB2A 1Y0UA 3MQ0A 3WGGA 1J5YA 3P7NA 3L09A 2CO5A 1B9MA 2HYFA 2ZNYA 4XRFA 3HSEA 3F6VA 2H6CA 1FSEA 3PFIA 2O61A 3E97A 2JZYA 2RKHA 3QPTA 5TJJA 3TGNA 4WK8F 4U7DA 2STTA 1QPMA 4HV6A 2FE3A 2V79A 5L3CA 3K1MA 3ZMDA 1XMAA 4AVPA 5IT9Z 4I01A 2PLYA 3KETA 3ABTA 2Y75A 3SFZA 3E6MA 3K1PA 3DP7A 1FLIA 4M74A 4NB5A 2K4BA 1J7KA 1DDNA 2EV6A 2MH2A 4YFKF 3KEQA 1YW9A 1IRFA 4KUMA 4MTDA 1XMKA 2FNAA 1YIOA 2L3DA 1R1VA 2D45A 3N97A 4KFCA 2GQQA 4M72A 2OAZA 4GO1A 3FMRA 2JPCA 4HF0A 3IHUA 3WGIA 5AONA 3J81Z 1S29A 4DNCA 2FRHA 2DFIA 3BROA 2AXLA 2F5DA 2O0YA 2XAHA 4MNUA 5F1RA 2DTRA 1W7PD 2LDUA 1G3TA 5H20A 2F2EA 5EEGA 3P9CA 2HS5A 1YS6A 3SHFA 5HOOA 1W5TA 4FT8A 1IXRC 3RKXA 4HOBA 4EMSA 4ZYHA 3V8JA 1RZ4A 5HVQC 3I5UA 4BHCA 3F8MA 1FPQA 1DPUA 1ZG1A 4IVNA 3FMSA 2Z5UA 4KDPA 3U1DA 1IXCA 1KYZA 1ZRFA 2CWEA 3ELKA 3KP2A 5LEJA 1Z6TA 5ILSA 4H0EA 5LGNA 1J9IA 3DFGA 2PBIA 1YTYA 4BAYA 2HR3A 4LGWA 4WX9A 3EQLF 2OQGA 4LLLA 4IF4A 3LQQA 2XROA 4A0ZA 4E70A 1TBXA 3T8TA 1CF7A 1FBUA 2DLLA 3K9TA 3T1BA 1SAXA 3ABUA 1QQIA 2ZFWA 2H6BA 2DQLA 2V9VA 4EJOA 5J8CA 2Q8KA 4ETSA 2KIFA 2YSRA 1XB4A 1D8KA 1B9NA 1G4DA 2ELHA 2JT1A 4N0BA 5CVUA 5CJ9A 2C6YA 4EM0B 2QVOA 3VODA 1KA8A 2P6SA 4MQVA 3BDDA 4HAMA 2RVCA 4HA8A 3M9AA 3ZMUA 4CHUA 1V4RA 5D5VB 1RI7A 3OV8A 4L9JA 2P5VA 2RV8A 3WTVC 4R8HA 1BI1A 4MGRA 4I98B 2XKPA 3R6SA 1NHAA 2XKOA 1P4WA 4G9YA 2IA0A 4HQMA 2K27A 1ZRCA 3WU1B 2OA4A 2EFQA 3GVAA 5JHUA 4WWCA 2Z33A 3RI4A 1Z7UA 2XASA 3FXQA 1ZREA 4EM2A 3WTXC 3ISPA 2QBYA 4RGRA 1ZLKA 2BYVE 5L3DA 3N4MA 2FA5A 1HKTA 2M30A 3CO7C 3HRTA 3L00A 2A69F 5KVRA 3V7CA 4L9NA 2PMHA 4L9TA 4M6YA 1ZG3A 1SD4A 1FBSA 1STZA 3L9FA 2ESNA 1K78A 3KP7A 4EGZA 3ZMVA 1IXSB 2VC1A 3F21A 3H92A 1BJAA 5L3FA 1LDKB 1FZPB 1TW2A 3ZPLA 3GXOA 3I54A 2EV5A 4M6XA 1HKSA 1GVJA 3MZHA 5E8IA 4OOIA 3FHZA 2L4MA 3TDZC 3GEZA 4M9ZA 3T0YA 2RN7A 1PP8F 3JSOA 1T0FA 2V1DA 3CJNA 2VC0A 1FOKA 2MA3A 4RS8A 4LFUA 2Y0MA 3R61A 1UHWA 3T5XA 3QAHA 5FLXZ 3CTAA 2Q2EA 2HKXA 1Z6RA 1KQ8A 3MZYA 5HLGA 1KGSA 3ZP5A 4I0AA 1OPCA 1BC8C 2QYOA 2RGVA 5LRSA 4ENJA 1SD6A 4KNYA 1WWXA 2YX4A 5AIQA 5JFRA 1B4AA 1J2XA 1U6GA 2DT5A 3RTRA 4WXCA 3HYIA 4IJAA 1O3TA 1LNWA 2DAOA 4XSXF 4KIBA 1Z1DA 1XSVA 1J75A 2QWWA 2Q0OA 1QNTA 3ERED 2ZMEA 4I7HA 2M8EA 2UXNA 5D5UB 4ENMA 1XDSA 3WTSC 4A6DA 5D6EA 2AS5F 2MLKA 2XHKA 2COMA 4KMUX 4RB0A 1R58A 1V3FA 1S7AA 5LHIA 5JR3A 4YFXF 4QWQA 1ULYA 2W85A 2P7CB 3I4PA 5D8LB 4YG2F 2X4HA 1WI9A 1FC3A 2HKOA 4IHTA 3WTUC 3GFMA 2QQ9A 1FX7A 4ZYGA 1U3EM 3KFWX 1USTA 3CUQB 4GXOA 2V6CA 3RPUA 4KN4X 4EM1A 4XLPF 5J8FA 5CLSA 1YO5C 1FP2A 1QBJA 3P9IA 1UFMA 2F5CA 4TV7A 1W7PB 5FFZA 4IRIA 3GFIA 3DPTA 3LWFA 1OYWA 2CW0F 3OOPA 4P9FA 2MC3A 2VXZA 2P5LC 2YR2A 1Q1HA 5LRRA 1KYWA 1O7FA 1FYLA 1FWZA 2BEOA 2R7FA 1YQAA 2A6HF 5BPIA 2XUBA 1DUXC 1FT9A 3KZZA 3MEXA 4A0XA 1S3JA 3KEOA 1XGMA 1UHMA 1QGPA 4L9VA 2RC4A 3C1DA 2BV6A 2IP2A 3E6CC 1O3RA 4LLNA 2J5PA 4ZZLA 2PFBA 3NEUA 4EGYA 2K86A 1RUNA 3WG9A 2MH9A 5FLXK 2KJBA 4GYIA 5JVTA 2ZNZA 2M87A 4EQQA 3E5QA 2HTJA 5DUIA 2DK8A 1MZBA 5E18F 3HUGA 1JHHA 3HRUA 4O5VA 1KU7A 4R79A 1UCRA 4LG0A 4B09A 1JE8A 3EUHA 3FXRA 3ZQ7A 1G3WA 3HTSB 3PQKA 2EJRA 1LVAA 3RKYA 2RDPA 3BJ6A 3VFZA 3C18A 1YG2A 1WQ2A 2GIVA 2FMYA 2A68F 1ZGJA 3DV8A 4GCVA 3J81K 2RQPA 2DPDA 1L0OC 2VT2A 3HOSA 3TOAA 1CF7B 4Z2YA 3P9KA 2GWRA 4ESJA 2ESHA 2BBYA 3BPXA 1XCBA 2CQKA 1O3QA 2XV4S 2M45A 5DCMA 4LG0B 3F72A 1XN7A 4HDVA 2GZWA 1KU2A 3DEUA 4UVAA 4YIFA 2STWA 1D8JA 1D3YA 3IKTA 5FO5A 5FGMA 3BJAA 1IAWA 4Y17A 5IT3A 4G7ZF 4I0BA 1IN5A 1GHCA 3DPLC 3GX4X 1IN6A 4UVCA 3EDPA 4UV9A 2A07F 2L02A 3LA2A 2JTVA 1FY7A 4U0VA 2KJCA 2NRAC 1AWCA 3ZMSA 3R4KA 4G8XA 4Y13A 3QP6A 4RB1A 4EJTA 1XDUA 2DW4A 4RGSA 2WC2A 3FF5A 2E7WA 2BE5F 4LD5A 2VN2A 5LGTA 4LB6B 2M1BA 3L7WA 3TO9A 2PG4A 1SD5A 4OMYA 4UUVA 2V1UA 2P6TA 2DU9A 5LHGA 3PQJA 3SQNA 4BYYA 6PAXA 4L18B 2O6GE 2FBHA 5E1WA 2FF4A 5F64A 1ZYRF 2FOKA 3WGHA 2XAFA 4ENNA 3BZ6A 3E3VA 2PMUA 1FP1D 2R3SA 1OKRA 1DPRA 2HGCA 4LK0F 2LKPA 3F3XA 2QUFA 2NAZA 1ZRDA 1BOAA 2FU4A 4AIJA 2OZ6A 4DQ2A 4PZJA 3ZMTA 1K79A 2LF7A 3BP8A 2IPQX 1HKQA 3KP5A 1P92A 1OYYA 5L3EA 4L0YB 1R5GA 4ZYDA 1QZZA 2Z3YA 1DP7P 2FQ3A 3F22A 3BOQA 2EB7A 3KE2A 2PI0A 2K7LA 1LB2A 1J59A 2QM3A 2HOEA 4S04A 2FEZA 2UWMA 1SD7A 4FX0A 1U8RA 3ML6A 1YLFA 3JSPA 4WXHA 1S6LA 1ZN2A 5DDGA 1XD7A 3ROUA 2HTSA 4L0ZB 2HFHA 2OQRA 1R22A 1P2FA 5A2QK 4PCQA 2Y48A 4UNOA 2QQAA 5ILUA 5D4RA 2XGXA 5CYVA 4YIIA 4EJUA 2FBKA 4YFNF 4G6QA 5L3GA 5ILVA 3H3UA 3WU0A 5LHHA 1H9TA 2GA2A 1F9NA 1SFUA 2UZKA 4WF2A 3HHGA 4HX8A 5TRDA 1R5HA 2DQRA 2A5YB 1MKMA 1IF1A 5K5RA 4MQ9F 2K02A 1Z91A 2ZJ2A 4OMZA 1B1BA 2HDCA 3TDUC 4ESFA 2O8XA 4EVIA 2P7VB 4EV0A 1MJ9A 3RIRA 4XSZF 3EYYA 3HTUA 2QZ8A 2HEOA 2L54A 4Q5SF 3I0TA 1T98A 1WRJA 5K1YA 1X3UA 1ODDA 2WTEA 1REPC 2E1CA 3BY6A 2IVMA 3E5XA 2HQRA 5BOXA 1BN5A 1KU9A 5LBQA 2F5FA 3KLNA 4KA4A 3M7GA 1XSXA 4M71A 1LEAA 2ZO4A 4K2EA 3VOEA 3HSRA 1BI3A 1H0MA 1A04A 4IPAA 3BJOA 3GF2A 1T39A 1MJAA 4ZYEA 5DV5A 1ZG5A 2IA2A 3WTYC 5FFXA 4NQWA 2PEXA 4ZH4F 4HLYA 1PUEE 2ZXJA 2FSWA 1HSJA 2L4AA 4LLGF 4NHJA 3GO5A 1C0WA 2OZUA 1TQPA 1B59A 1TQMA 2H27A 4G94A 3QPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MD5 A;  3JAM K;  3MFK A;  3IRQ A;  3L2C A;  2NYX A;  4UV8 A;  4Y15 A;  1IUY A;  5E20 A;  1QO0 D;  1ZAR A;  2KIU A;  2V1X A;  3CO6 C;  2E7X A;  4CO8 A;  3ZMZ A;  2W57 A;  2CYY A;  3LA3 A;  3R0J A;  2CG4 A;  1GXP A;  1KQ0 A;  2X0L A;  1Z05 A;  4CXF A;  2TDX A;  2H94 A;  3QP5 A;  5DCF A;  3NQO A;  4KYW A;  1L3L A;  3GFJ A;  3RPQ A;  1EV7 A;  4UVB A;  3KZY A;  1JXS A;  2VE8 A;  1SFE A;  3MCZ A;  3AAF A;  4BQA A;  4IHS A;  2JRT A;  3KLO A;  4KIC A;  4IRG A;  1R36 A;  1HW5 A;  5ERI A;  2VBY A;  5ICF A;  3RKW A;  3IWF A;  4UXN A;  1HW1 A;  4AD9 A;  4UHT A;  2IRF G;  5K5Q A;  1BIB A;  4LK1 F;  1T2K A;  4A0Y A;  3Q5F A;  1U5T B;  3JAM Z;  3KCC A;  1TQI A;  3HRM A;  4ZZD A;  1MD0 A;  1KU3 A;  2GXG A;  3K1N A;  3R0A A;  2F5E A;  2G7H A;  4G7H F;  3FWE A;  1W4M A;  2OBP A;  1TW3 A;  2DK5 A;  1WSU A;  2CGP A;  2P4W A;  1YW7 A;  3I59 B;  1MDM B;  1YFH A;  4MEX F;  3K0L A;  5LGU A;  3R60 A;  4P9U A;  2A3S A;  3MWM A;  3IWZ A;  2HWV A;  2VE9 A;  3QRF F;  2ISY A;  3SZT A;  2UXX A;  1K6O A;  4A5M A;  2KRF A;  3M8F A;  5D5X B;  1E2X A;  3I58 A;  2K4J A;  2VBW A;  1ON1 A;  4KMF A;  4MTE A;  2ADU A;  3JTH A;  5BS6 A;  2WWY A;  5BMZ A;  3WOD F;  3KP6 A;  3WTW C;  1IZ1 A;  5DD4 A;  3TOB A;  4I09 A;  2QQB A;  2XIG A;  1UB9 A;  2MLG A;  5DUK A;  5D4S A;  4HX7 A;  1T38 A;  4AWX B;  5ICG A;  1KQ9 A;  2PN6 A;  5HDG A;  3HSF A;  1LDJ A;  2XAJ A;  1LEB A;  2PQ8 A;  1BBY A;  1HQC A;  3DXJ F;  4HF1 A;  1MGT A;  2DO7 A;  1F4K A;  3J7A O;  1K7A A;  1TTY A;  3U9G A;  2GA1 A;  2E1N A;  4OIR F;  5J6X A;  5ICC A;  1O57 A;  1YS7 A;  4I02 A;  1S7O A;  1EH7 A;  3FZV A;  4I2O A;  1IN4 A;  2BGC A;  2W84 A;  3DF8 A;  3RJP A;  4KIF A;  3D0S A;  2KKO A;  4HZF A;  1G3Y A;  1IRG A;  1FSH A;  3TQN A;  1R00 A;  4A12 A;  4FX4 A;  3E6B A;  3O2P E;  1XGO A;  2EWN A;  2QEN A;  2H09 A;  4CDG A;  4O6J A;  1ON2 A;  3CUO A;  4KIG A;  2A61 A;  3IKV A;  5HLH A;  2VOP A;  1LJ9 A;  3RYR A;  2CFX A;  1XSD A;  1QZY A;  1P4X A;  5HDN A;  1XGS A;  2NNN A;  2ISZ A;  1I1S A;  1TNS A;  4WXD A;  4HV5 A;  2YU3 A;  4HLX A;  5D8K B;  3EET A;  1G3S A;  4BXU A;  4F7Z A;  2O3F A;  1BI2 A;  5FD5 A;  3TO6 A;  3LST A;  4P96 A;  4L5I A;  3D5L A;  4PGG A;  2JSC A;  1BM9 A;  1I27 A;  3LAP A;  3IC7 A;  2ZBK A;  1I5Z A;  1FYM A;  4LJZ F;  4RB2 C;  4PDK A;  4M73 A;  1XCV A;  1G6N A;  3FM5 A;  3BWG A;  2IA1 A;  5A2Q Z;  2ZME B;  2VON A;  3ULQ B;  2PJP A;  4Q4Z F;  2D1V A;  5H6Q A;  3V7S A;  3LFK A;  3GFL A;  2D1H A;  3O6B B;  3GUD A;  1Z9C A;  2ETH A;  3GWZ A;  3QU6 A;  4EJV A;  5BPD A;  5AIP A;  5D5W B;  4JK1 X;  1LDD A;  3F6O A;  4RAZ A;  2Z99 A;  4B8X A;  1W5S A;  4RGU A;  4O3M A;  5IT9 K;  3MAJ A;  2Z9O A;  2ACJ A;  2J5O A;  1HBX G;  3WTT C;  3ECO A;  3E6D A;  3HHH A;  3FM3 A;  4M9X A;  2VT3 A;  3M1E A;  2EFO A;  5F6F A;  1B6A A;  4OIQ F;  3V8L A;  2D2W A;  3QOP A;  1ZH5 A;  1EH6 A;  1TLH B;  1R7J A;  3V7R A;  3SXY A;  5E1Z B;  5DD8 A;  3IL2 A;  2DI3 A;  1FBQ A;  3F8N A;  5E1X A;  3E5U A;  3F23 A;  5ICE A;  3F8B A;  4RGX A;  2P5K A;  3U2R A;  4R1H A;  1ZLJ A;  4P55 A;  3WE3 A;  2LSO A;  5E17 F;  1ZAO A;  1O7L A;  4HW0 A;  4G7O F;  1OR7 A;  2XAQ A;  3TO7 A;  4CZZ A;  3F8F A;  3V4G A;  3V8K A;  1S8N A;  2FML A;  2GAU A;  1U78 A;  3H3Z A;  4A5N A;  4WCG A;  4MHG A;  2EFP A;  4HBL A;  2KIM A;  3ZN1 A;  1T6S A;  1YW8 A;  2LNB A;  3KP4 A;  4EJW A;  3B02 A;  5CVJ A;  3FMQ A;  4HYE A;  1P6R A;  3HRS A;  5DEQ A;  3GW2 A;  1LQ1 A;  2M5W A;  3W6J B;  1R1T A;  4BHP A;  2W25 A;  2G7U A;  4MEY F;  5EEH A;  2ZCW A;  4L5J A;  5D6F A;  5DCM B;  3FXU A;  1MJB A;  3JTG A;  5L3B A;  1GXQ A;  1IN7 A;  3I64 A;  1BIA A;  2XAG A;  2VOO A;  2A6E F;  4QLC U;  1OMI A;  4HF2 A;  3ECH A;  4IRH A;  1AOY A;  2W24 A;  2QLZ A;  1TNT A;  1HST A;  1U2W A;  2EFW A;  2RNJ A;  3WE2 A;  3S2W A;  4Q48 A;  2NNY A;  1I6X A;  2L01 A;  3FX3 A;  3Q9S A;  4OU0 A;  1W7P A;  1SFX A;  1RUO A;  1PP7 U;  2LF8 A;  4U0W A;  4BNC A;  1K78 B;  4M9S A;  4HQE A;  1CGP A;  1IN8 A;  3C3W A;  1HW2 A;  3J80 K;  2HQN A;  1J0R A;  2OD5 A;  2XVC A;  2NS0 A;  1RNL A;  3RDI A;  4OIO F;  2ZKZ A;  3HOT A;  3WTZ A;  2OU2 A;  2EA4 A;  2EK5 A;  1WKM A;  2P8T A;  1F5T A;  3I53 A;  1E17 A;  2B0L A;  4U88 A;  4P5O A;  2CSO A;  2GXB A;  1RIO H;  3ZN0 A;  4OIN F;  4PGH A;  5CVV A;  5HS7 A;  3GYH X;  4BH9 A;  4HDU A;  1OYI A;  1O3S A;  3M8E A;  3GZ6 A;  2R7D A;  5E8G A;  5ED4 A;  4CGZ A;  1ZHF A;  1U5T C;  3TKY A;  4ON0 A;  3CUQ A;  2G9W A;  1VTN C;  4HX4 A;  3G73 A;  3G3Z A;  3REO A;  3IRR A;  4IXA A;  1I1G A;  4ASN A;  4G6D A;  4LMY A;  4KN7 X;  4AIH A;  1SMY F;  4U0Y A;  1JHF A;  3BPV A;  1PDN C;  3LAJ A;  2HYG D;  1XGN A;  3CLO A;  4XBF A;  4AIK A;  4A6E A;  3JW4 A;  1U5T A;  3LA7 A;  3J80 Z;  3NRV A;  4S05 A;  3F8C A;  2VBX A;  3B73 A;  3LQR A;  1BI0 A;  1R1U A;  4BHB A;  3GZ5 A;  4KT5 C;  5LLQ A;  2WV0 A;  3KP3 A;  2QBY B;  1IW7 F;  2FNP A;  1JGS A;  2IJL A;  2IT0 A;  4FHT A;  3COA C;  2JPB A;  3Q9V A;  5CVI A;  5H6R A;  5HDK A;  2EV0 A;  2MBF A;  3DQV C;  2VBZ A;  1R23 A;  3HIF A;  2FBI A;  3VEP A;  1H9G A;  5BQT A;  3RYP A;  5FD6 A;  4A2U A;  1FNN A;  3I71 A;  4JBA A;  5JI6 A;  4GGG A;  4GYG A;  2HZT A;  4LB5 A;  5HS8 A;  4ESB A;  4ENK A;  4D0P A;  3I59 A;  1MDM A;  3GLX A;  3QU3 A;  1YYV A;  2EFN A;  3K69 A;  1D5V A;  3T8R A;  5LEK A;  5K5O A;  4Q47 A;  5HLI A;  2XRN A;  3K2Z A;  4N9H A;  3SZP A;  4U7B A;  1ONV A;  4N9I A;  4CIC A;  3VB2 A;  2DPU A;  3W6K B;  1P4A A;  3DKW A;  1EH8 A;  1BC7 C;  5DYM A;  2O03 A;  2YPR A;  5KK1 A;  2YX7 A;  1FYK A;  1F1Z A;  5CVR A;  4JQF A;  3CUQ C;  2VOD A;  3O3K A;  2DBB A;  2EA2 A;  4CYD A;  5HS9 A;  2IW5 A;  1SMT A;  4XLN F;  3CDH A;  4RB3 C;  3EYI A;  4RAY A;  1USS A;  4OIP F;  1ZGA A;  1HXD A;  2FXA A;  3C7J A;  5FB2 A;  1Y0U A;  3MQ0 A;  3WGG A;  1J5Y A;  3P7N A;  3L09 A;  2CO5 A;  1B9M A;  2HYF A;  2ZNY A;  4XRF A;  3HSE A;  3F6V A;  2H6C A;  1FSE A;  3PFI A;  2O61 A;  3E97 A;  2JZY A;  2RKH A;  3QPT A;  5TJJ A;  3TGN A;  4WK8 F;  4U7D A;  2STT A;  1QPM A;  4HV6 A;  2FE3 A;  2V79 A;  5L3C A;  3K1M A;  3ZMD A;  1XMA A;  4AVP A;  5IT9 Z;  4I01 A;  2PLY A;  3KET A;  3ABT A;  2Y75 A;  3SFZ A;  3E6M A;  3K1P A;  3DP7 A;  1FLI A;  4M74 A;  4NB5 A;  2K4B A;  1J7K A;  1DDN A;  2EV6 A;  2MH2 A;  4YFK F;  3KEQ A;  1YW9 A;  1IRF A;  4KUM A;  4MTD A;  1XMK A;  2FNA A;  1YIO A;  2L3D A;  1R1V A;  2D45 A;  3N97 A;  4KFC A;  2GQQ A;  4M72 A;  2OAZ A;  4GO1 A;  3FMR A;  2JPC A;  4HF0 A;  3IHU A;  3WGI A;  5AON A;  3J81 Z;  1S29 A;  4DNC A;  2FRH A;  2DFI A;  3BRO A;  2AXL A;  2F5D A;  2O0Y A;  2XAH A;  4MNU A;  5F1R A;  2DTR A;  1W7P D;  2LDU A;  1G3T A;  5H20 A;  2F2E A;  5EEG A;  3P9C A;  2HS5 A;  1YS6 A;  3SHF A;  5HOO A;  1W5T A;  4FT8 A;  1IXR C;  3RKX A;  4HOB A;  4EMS A;  4ZYH A;  3V8J A;  1RZ4 A;  5HVQ C;  3I5U A;  4BHC A;  3F8M A;  1FPQ A;  1DPU A;  1ZG1 A;  4IVN A;  3FMS A;  2Z5U A;  4KDP A;  3U1D A;  1IXC A;  1KYZ A;  1ZRF A;  2CWE A;  3ELK A;  3KP2 A;  5LEJ A;  1Z6T A;  5ILS A;  4H0E A;  5LGN A;  1J9I A;  3DFG A;  2PBI A;  1YTY A;  4BAY A;  2HR3 A;  4LGW A;  4WX9 A;  3EQL F;  2OQG A;  4LLL A;  4IF4 A;  3LQQ A;  2XRO A;  4A0Z A;  4E70 A;  1TBX A;  3T8T A;  1CF7 A;  1FBU A;  2DLL A;  3K9T A;  3T1B A;  1SAX A;  3ABU A;  1QQI A;  2ZFW A;  2H6B A;  2DQL A;  2V9V A;  4EJO A;  5J8C A;  2Q8K A;  4ETS A;  2KIF A;  2YSR A;  1XB4 A;  1D8K A;  1B9N A;  1G4D A;  2ELH A;  2JT1 A;  4N0B A;  5CVU A;  5CJ9 A;  2C6Y A;  4EM0 B;  2QVO A;  3VOD A;  1KA8 A;  2P6S A;  4MQV A;  3BDD A;  4HAM A;  2RVC A;  4HA8 A;  3M9A A;  3ZMU A;  4CHU A;  1V4R A;  5D5V B;  1RI7 A;  3OV8 A;  4L9J A;  2P5V A;  2RV8 A;  3WTV C;  4R8H A;  1BI1 A;  4MGR A;  4I98 B;  2XKP A;  3R6S A;  1NHA A;  2XKO A;  1P4W A;  4G9Y A;  2IA0 A;  4HQM A;  2K27 A;  1ZRC A;  3WU1 B;  2OA4 A;  2EFQ A;  3GVA A;  5JHU A;  4WWC A;  2Z33 A;  3RI4 A;  1Z7U A;  2XAS A;  3FXQ A;  1ZRE A;  4EM2 A;  3WTX C;  3ISP A;  2QBY A;  4RGR A;  1ZLK A;  2BYV E;  5L3D A;  3N4M A;  2FA5 A;  1HKT A;  2M30 A;  3CO7 C;  3HRT A;  3L00 A;  2A69 F;  5KVR A;  3V7C A;  4L9N A;  2PMH A;  4L9T A;  4M6Y A;  1ZG3 A;  1SD4 A;  1FBS A;  1STZ A;  3L9F A;  2ESN A;  1K78 A;  3KP7 A;  4EGZ A;  3ZMV A;  1IXS B;  2VC1 A;  3F21 A;  3H92 A;  1BJA A;  5L3F A;  1LDK B;  1FZP B;  1TW2 A;  3ZPL A;  3GXO A;  3I54 A;  2EV5 A;  4M6X A;  1HKS A;  1GVJ A;  3MZH A;  5E8I A;  4OOI A;  3FHZ A;  2L4M A;  3TDZ C;  3GEZ A;  4M9Z A;  3T0Y A;  2RN7 A;  1PP8 F;  3JSO A;  1T0F A;  2V1D A;  3CJN A;  2VC0 A;  1FOK A;  2MA3 A;  4RS8 A;  4LFU A;  2Y0M A;  3R61 A;  1UHW A;  3T5X A;  3QAH A;  5FLX Z;  3CTA A;  2Q2E A;  2HKX A;  1Z6R A;  1KQ8 A;  3MZY A;  5HLG A;  1KGS A;  3ZP5 A;  4I0A A;  1OPC A;  1BC8 C;  2QYO A;  2RGV A;  5LRS A;  4ENJ A;  1SD6 A;  4KNY A;  1WWX A;  2YX4 A;  5AIQ A;  5JFR A;  1B4A A;  1J2X A;  1U6G A;  2DT5 A;  3RTR A;  4WXC A;  3HYI A;  4IJA A;  1O3T A;  1LNW A;  2DAO A;  4XSX F;  4KIB A;  1Z1D A;  1XSV A;  1J75 A;  2QWW A;  2Q0O A;  1QNT A;  3ERE D;  2ZME A;  4I7H A;  2M8E A;  2UXN A;  5D5U B;  4ENM A;  1XDS A;  3WTS C;  4A6D A;  5D6E A;  2AS5 F;  2MLK A;  2XHK A;  2COM A;  4KMU X;  4RB0 A;  1R58 A;  1V3F A;  1S7A A;  5LHI A;  5JR3 A;  4YFX F;  4QWQ A;  1ULY A;  2W85 A;  2P7C B;  3I4P A;  5D8L B;  4YG2 F;  2X4H A;  1WI9 A;  1FC3 A;  2HKO A;  4IHT A;  3WTU C;  3GFM A;  2QQ9 A;  1FX7 A;  4ZYG A;  1U3E M;  3KFW X;  1UST A;  3CUQ B;  4GXO A;  2V6C A;  3RPU A;  4KN4 X;  4EM1 A;  4XLP F;  5J8F A;  5CLS A;  1YO5 C;  1FP2 A;  1QBJ A;  3P9I A;  1UFM A;  2F5C A;  4TV7 A;  1W7P B;  5FFZ A;  4IRI A;  3GFI A;  3DPT A;  3LWF A;  1OYW A;  2CW0 F;  3OOP A;  4P9F A;  2MC3 A;  2VXZ A;  2P5L C;  2YR2 A;  1Q1H A;  5LRR A;  1KYW A;  1O7F A;  1FYL A;  1FWZ A;  2BEO A;  2R7F A;  1YQA A;  2A6H F;  5BPI A;  2XUB A;  1DUX C;  1FT9 A;  3KZZ A;  3MEX A;  4A0X A;  1S3J A;  3KEO A;  1XGM A;  1UHM A;  1QGP A;  4L9V A;  2RC4 A;  3C1D A;  2BV6 A;  2IP2 A;  3E6C C;  1O3R A;  4LLN A;  2J5P A;  4ZZL A;  2PFB A;  3NEU A;  4EGY A;  2K86 A;  1RUN A;  3WG9 A;  2MH9 A;  5FLX K;  2KJB A;  4GYI A;  5JVT A;  2ZNZ A;  2M87 A;  4EQQ A;  3E5Q A;  2HTJ A;  5DUI A;  2DK8 A;  1MZB A;  5E18 F;  3HUG A;  1JHH A;  3HRU A;  4O5V A;  1KU7 A;  4R79 A;  1UCR A;  4LG0 A;  4B09 A;  1JE8 A;  3EUH A;  3FXR A;  3ZQ7 A;  1G3W A;  3HTS B;  3PQK A;  2EJR A;  1LVA A;  3RKY A;  2RDP A;  3BJ6 A;  3VFZ A;  3C18 A;  1YG2 A;  1WQ2 A;  2GIV A;  2FMY A;  2A68 F;  1ZGJ A;  3DV8 A;  4GCV A;  3J81 K;  2RQP A;  2DPD A;  1L0O C;  2VT2 A;  3HOS A;  3TOA A;  1CF7 B;  4Z2Y A;  3P9K A;  2GWR A;  4ESJ A;  2ESH A;  2BBY A;  3BPX A;  1XCB A;  2CQK A;  1O3Q A;  2XV4 S;  2M45 A;  5DCM A;  4LG0 B;  3F72 A;  1XN7 A;  4HDV A;  2GZW A;  1KU2 A;  3DEU A;  4UVA A;  4YIF A;  2STW A;  1D8J A;  1D3Y A;  3IKT A;  5FO5 A;  5FGM A;  3BJA A;  1IAW A;  4Y17 A;  5IT3 A;  4G7Z F;  4I0B A;  1IN5 A;  1GHC A;  3DPL C;  3GX4 X;  1IN6 A;  4UVC A;  3EDP A;  4UV9 A;  2A07 F;  2L02 A;  3LA2 A;  2JTV A;  1FY7 A;  4U0V A;  2KJC A;  2NRA C;  1AWC A;  3ZMS A;  3R4K A;  4G8X A;  4Y13 A;  3QP6 A;  4RB1 A;  4EJT A;  1XDU A;  2DW4 A;  4RGS A;  2WC2 A;  3FF5 A;  2E7W A;  2BE5 F;  4LD5 A;  2VN2 A;  5LGT A;  4LB6 B;  2M1B A;  3L7W A;  3TO9 A;  2PG4 A;  1SD5 A;  4OMY A;  4UUV A;  2V1U A;  2P6T A;  2DU9 A;  5LHG A;  3PQJ A;  3SQN A;  4BYY A;  6PAX A;  4L18 B;  2O6G E;  2FBH A;  5E1W A;  2FF4 A;  5F64 A;  1ZYR F;  2FOK A;  3WGH A;  2XAF A;  4ENN A;  3BZ6 A;  3E3V A;  2PMU A;  1FP1 D;  2R3S A;  1OKR A;  1DPR A;  2HGC A;  4LK0 F;  2LKP A;  3F3X A;  2QUF A;  2NAZ A;  1ZRD A;  1BOA A;  2FU4 A;  4AIJ A;  2OZ6 A;  4DQ2 A;  4PZJ A;  3ZMT A;  1K79 A;  2LF7 A;  3BP8 A;  2IPQ X;  1HKQ A;  3KP5 A;  1P92 A;  1OYY A;  5L3E A;  4L0Y B;  1R5G A;  4ZYD A;  1QZZ A;  2Z3Y A;  1DP7 P;  2FQ3 A;  3F22 A;  3BOQ A;  2EB7 A;  3KE2 A;  2PI0 A;  2K7L A;  1LB2 A;  1J59 A;  2QM3 A;  2HOE A;  4S04 A;  2FEZ A;  2UWM A;  1SD7 A;  4FX0 A;  1U8R A;  3ML6 A;  1YLF A;  3JSP A;  4WXH A;  1S6L A;  1ZN2 A;  5DDG A;  1XD7 A;  3ROU A;  2HTS A;  4L0Z B;  2HFH A;  2OQR A;  1R22 A;  1P2F A;  5A2Q K;  4PCQ A;  2Y48 A;  4UNO A;  2QQA A;  5ILU A;  5D4R A;  2XGX A;  5CYV A;  4YII A;  4EJU A;  2FBK A;  4YFN F;  4G6Q A;  5L3G A;  5ILV A;  3H3U A;  3WU0 A;  5LHH A;  1H9T A;  2GA2 A;  1F9N A;  1SFU A;  2UZK A;  4WF2 A;  3HHG A;  4HX8 A;  5TRD A;  1R5H A;  2DQR A;  2A5Y B;  1MKM A;  1IF1 A;  5K5R A;  4MQ9 F;  2K02 A;  1Z91 A;  2ZJ2 A;  4OMZ A;  1B1B A;  2HDC A;  3TDU C;  4ESF A;  2O8X A;  4EVI A;  2P7V B;  4EV0 A;  1MJ9 A;  3RIR A;  4XSZ F;  3EYY A;  3HTU A;  2QZ8 A;  2HEO A;  2L54 A;  4Q5S F;  3I0T A;  1T98 A;  1WRJ A;  5K1Y A;  1X3U A;  1ODD A;  2WTE A;  1REP C;  2E1C A;  3BY6 A;  2IVM A;  3E5X A;  2HQR A;  5BOX A;  1BN5 A;  1KU9 A;  5LBQ A;  2F5F A;  3KLN A;  4KA4 A;  3M7G A;  1XSX A;  4M71 A;  1LEA A;  2ZO4 A;  4K2E A;  3VOE A;  3HSR A;  1BI3 A;  1H0M A;  1A04 A;  4IPA A;  3BJO A;  3GF2 A;  1T39 A;  1MJA A;  4ZYE A;  5DV5 A;  1ZG5 A;  2IA2 A;  3WTY C;  5FFX A;  4NQW A;  2PEX A;  4ZH4 F;  4HLY A;  1PUE E;  2ZXJ A;  2FSW A;  1HSJ A;  2L4A A;  4LLG F;  4NHJ A;  3GO5 A;  1C0W A;  2OZU A;  1TQP A;  1B59 A;  1TQM A;  2H27 A;  4G94 A;  3QPH A; 
#chains in the Genus database with same CATH topology
 4XOP A;  2MD5 A;  3JAM K;  3MFK A;  2LKX A;  5FKK A;  4S0H B;  3IRQ A;  3L2C A;  1HC8 A;  3BG5 A;  4J00 A;  2MSY A;  2NYX A;  2DXI A;  1YI2 I;  2CUE A;  3OL3 A;  3OYL A;  3H0D A;  3CD6 I;  4I99 C;  4UV8 A;  4Y15 A;  3J7A Y;  4JP0 A;  1IUY A;  5E20 A;  4E4H A;  5M3F J;  1QO0 D;  1ZAR A;  3CF2 A;  2R7Z J;  4W97 A;  2KIU A;  2MFZ A;  3NWT A;  3SFI A;  5KAF C;  2CMP A;  2V1X A;  1R49 A;  4BL0 B;  3CO6 C;  4FAS D;  2K3P A;  2E7X A;  3CCV I;  4CO8 A;  3ZMZ A;  2W57 A;  3UR3 C;  2CYY A;  3QPS A;  4DBR A;  1EJ9 A;  2M7A A;  3MN2 A;  5CQE A;  3IAS 2;  1Y8Q B;  2PMZ A;  3LA3 A;  3R0J A;  4LIV A;  4Y52 J;  2CG4 A;  1GXP A;  1KQ0 A;  5LD2 C;  2X0L A;  4HSR A;  1Z05 A;  2W00 A;  3IV5 A;  4M3D A;  3TP3 A;  4CXF A;  5GP9 A;  2VUM J;  2TDX A;  3IP4 B;  2H94 A;  3QYB A;  2X6Y A;  3QP5 A;  2JSP A;  4F52 A;  2L9V A;  5DCF A;  5C44 J;  3NQO A;  4CYC A;  2R4G A;  3HJE A;  4KYW A;  1L3L A;  3GFJ A;  2M0C A;  3RPQ A;  1EV7 A;  1TWH J;  1ZK8 A;  4UVB A;  1Y8R B;  1B72 A;  3KZY A;  2CQQ A;  1JXS A;  3OS2 A;  2VE8 A;  1SFE A;  3MCZ A;  5TGT A;  1IO2 A;  3AAF A;  4BQA A;  4IHS A;  2JRT A;  3H36 A;  2OUM A;  4RM2 A;  3KLO A;  3OYN A;  1HA8 A;  4KIC A;  3ABL H;  4FE4 A;  4IRG A;  1R36 A;  2BY0 A;  1HW5 A;  5ERI A;  2VBY A;  3W6V A;  1BW6 A;  1OIS A;  1MBJ A;  2FUG 2;  5ICF A;  3RKW A;  3IWF A;  1MMD A;  2ID6 A;  2PX9 A;  4UXN A;  4KIS A;  1HW1 A;  4G12 A;  4AD9 A;  3LOC A;  3CCJ I;  3FHN A;  4UHT A;  2IRF G;  5IP6 A;  5K5Q A;  1TC3 C;  2EQR A;  1BIB A;  1D0Z A;  4LK1 F;  5HNF A;  1MIJ A;  1T2K A;  2WAD A;  4A0Y A;  2V26 A;  1MNM C;  1YIT I;  3Q5F A;  3OYJ A;  3DTE A;  1TT5 B;  2CRG A;  1U5T B;  3JAM Z;  3KCC A;  1X4O A;  1TQI A;  4QSH A;  3HRM A;  4ZZD A;  1RES A;  1Z67 A;  3BC8 A;  3NWS A;  4YRV A;  4A3M J;  2R7V A;  2DFH A;  3D1N I;  1QVT A;  1MD0 A;  1KU3 A;  1WJC A;  1MBG A;  2GXG A;  3K1N A;  3ZRG A;  2M0M A;  2HI3 A;  3R0A A;  2F5E A;  3U21 A;  2G7H A;  3UNG C;  2ID3 A;  1ETV A;  2LR8 A;  4BGD A;  4G7H F;  3K70 C;  2RRE A;  3FWE A;  1ITY A;  1W4M A;  2OBP A;  4XKV A;  1TW3 A;  2DK5 A;  1WSU A;  3OIO A;  1LKX A;  2H8R A;  2CGP A;  2P4W A;  1YW7 A;  4CCJ A;  3I59 B;  2HQ5 A;  1MDM B;  1YFH A;  4MEX F;  3CQZ J;  3K0L A;  5LGU A;  1MSE C;  3R60 A;  4P9U A;  2A3S A;  5FKO A;  3MWM A;  4JOM A;  4XLC A;  1VQ9 I;  3IWZ A;  2K9N A;  2HWV A;  2VE9 A;  4J01 A;  3LSP A;  3QRF F;  2ISY A;  1ETX A;  5M3M J;  1NTC A;  2CH0 A;  2LYC A;  3SZT A;  2UXX A;  1K6O A;  2M8G X;  4A5M A;  1IRX A;  2KRF A;  3M8F A;  2RNG A;  4B44 A;  2RAE A;  1OCR H;  4AU7 A;  2QKM B;  5D5X B;  1E2X A;  3I58 A;  1I3A A;  3CME I;  3OYF A;  2K4J A;  2XB5 A;  4NC6 A;  2Q1Z B;  2VBW A;  1ON1 A;  3PIP F;  4KMF A;  3S14 J;  2HZD A;  4MTE A;  3BCA A;  2ADU A;  3JTH A;  5BS6 A;  4CUG A;  2WWY A;  2YS9 A;  3DU5 A;  4HNT A;  4N4O B;  2KQR A;  1X1C A;  1H89 C;  5BMZ A;  3WOD F;  3KP6 A;  3WTW C;  1IZ1 A;  1TZL A;  1ZEL A;  2R5Y A;  5DD4 A;  3E1S A;  1GV2 A;  3TOB A;  4A3E J;  1K6Y A;  2DOD A;  4I09 A;  2QQB A;  3LMM A;  1VQ8 I;  2EZL A;  3ZQG A;  2QQ8 A;  5F0H A;  2XIG A;  1UB9 A;  2MLG A;  5DUK A;  3FXK A;  5D4S A;  4HX7 A;  1T38 A;  4AWX B;  2W82 A;  5ICG A;  2N8G A;  3VDX A;  2IEK A;  3VSK A;  1KQ9 A;  1ETY A;  2DMT A;  2BXY A;  2PN6 A;  3BTC A;  3MKL A;  3RKQ A;  3LFU A;  5HDG A;  2W7N A;  3DBH B;  4RLF A;  3HSF A;  1LDJ A;  2XAJ A;  5F08 A;  3S1Q J;  1LEB A;  4BXX J;  1AHD P;  3J7Y J;  1N77 A;  2PQ8 A;  1BBY A;  1HQC A;  5IY5 H;  3DXJ F;  1K61 A;  4HF1 A;  1MGT A;  2DO7 A;  2LKS A;  3FXJ A;  1DU6 A;  1F4K A;  3J7A O;  2BHY A;  4UY8 I;  2IXS A;  5FRN A;  2FX0 A;  1UEL B;  2A05 A;  1K7A A;  2LY2 A;  1TTY A;  3U9G A;  3AFH A;  2BVL A;  3RZO J;  2W48 A;  3S3O A;  2GA1 A;  3M4O J;  2E1N A;  2LBF B;  3QYF A;  4OIR F;  4P1W A;  5J6X A;  5ICC A;  1O57 A;  1YS7 A;  4I02 A;  2NVU B;  3I56 I;  1S7O A;  1F43 A;  1EH7 A;  3FZV A;  3A01 B;  4I2O A;  4AVZ A;  2ICW G;  1IN4 A;  2BGC A;  1NK3 P;  3DF8 A;  2W84 A;  2WY8 Q;  2JMW A;  3RJP A;  2DDB A;  4MLO A;  4F55 A;  4KIF A;  1I39 A;  3D0S A;  2COB A;  2ZJP F;  2KKO A;  4HZF A;  1DQU A;  1G3Y A;  1IRG A;  3FKJ A;  2KZV A;  3TQN A;  1R00 A;  4A12 A;  2DFE A;  3M07 A;  4FX4 A;  3PO3 J;  3IAM 2;  1FSH A;  3E6B A;  3O2P E;  2DOF A;  4XKB A;  1XGO A;  2EWN A;  1HF0 A;  2QEN A;  2LMD A;  2L7K A;  5J4V A;  1X3Z B;  2H09 A;  2M3A A;  4CDG A;  4O6J A;  4XKW A;  4Y4R A;  1ON2 A;  3AG1 H;  3CUO A;  4KIG A;  3A01 A;  2A61 A;  5FLV A;  4AYB A;  3IKV A;  2P81 A;  4IKF A;  5HLH A;  2VOP A;  1LJ9 A;  1PJR A;  3DPU A;  1UZC A;  3RYR A;  3K70 D;  2CFX A;  1XSD A;  1QZY A;  1P4X A;  5HDN A;  1XGS A;  1Z3Y A;  2NNN A;  5EJC A;  4E7J A;  2ISZ A;  1DP3 A;  1ZKG A;  1I1S A;  2NVY J;  5J3L A;  3B6A A;  1TNS A;  3HL2 A;  4HEA 2;  4CH7 A;  5E3N A;  4WXD A;  4HV5 A;  5HOD A;  2YU3 A;  2V1N A;  4HLX A;  5D8K B;  3EET A;  1A6Q A;  2KIQ A;  1G3S A;  2WAF A;  2WAQ N;  4BXU A;  3CZ6 A;  4F7Z A;  3CCE I;  1CQT A;  2X51 A;  2O3F A;  2V4J C;  2ZJQ F;  2E36 A;  1BI2 A;  1LFP A;  2XF5 A;  5FD5 A;  3F9K A;  4PFP A;  3TO6 A;  4B3X A;  3LST A;  4E7S A;  2QA4 I;  5E79 C;  4P96 A;  3CCY A;  1QHG A;  1TWA J;  1WH7 A;  1MW7 A;  4L5I A;  3D5L A;  4D9J A;  4A3B J;  4PGG A;  2JSC A;  2CU7 A;  1KZH A;  1BM9 A;  1I27 A;  5CQG A;  2JVG A;  2K5C A;  5HNH A;  4BBS J;  3LAP A;  3IC7 A;  2KMU A;  3K10 A;  2ZBK A;  1I5Z A;  1BR2 A;  4OAY A;  3HBL A;  3ZQL A;  4XIC A;  2UUZ A;  2IGO A;  1FYM A;  4LJZ F;  4RB2 C;  4PDK A;  3K6G A;  2E1M B;  2LY9 A;  4M73 A;  1XCV A;  4UUS B;  1G6N A;  3FM5 A;  3L1P A;  1WPK A;  2IGM A;  1TP4 A;  4Y3O A;  3BWG A;  2IA1 A;  1WJE A;  5A2Q Z;  2ZME B;  4MFE A;  1X1P A;  2KDO A;  2VON A;  1Q1V A;  3ULQ B;  1QVU A;  2PJP A;  2E5Z A;  4Q4Z F;  2D1V A;  5H6Q A;  3HG9 A;  3V7S A;  3LFK A;  1D1B A;  3ZQF A;  3GFL A;  2D1H A;  1ETK A;  3O6B B;  4RDU A;  3GUD A;  1Z9C A;  2ETH A;  3GWZ A;  3Q0U A;  3QU6 A;  4EJV A;  4BQO A;  4CSW A;  5BPD A;  5AIP A;  3JRF A;  5D5W B;  4JK1 X;  2WA0 A;  4IOA F;  2R92 J;  1LDD A;  3F6O A;  4CCO A;  1HOM A;  4RAZ A;  3E7L A;  2Z99 A;  3CCM I;  3CCR I;  4B8X A;  3H3V K;  1W5S A;  4RGU A;  4O3M A;  2CW7 A;  4B47 A;  5IT9 K;  3MAJ A;  4N4N B;  5J1R A;  4KJZ A;  2HOA A;  5GTH C;  4A93 J;  2Z9O A;  2ACJ A;  2J5O A;  1HBX G;  3LSJ A;  3WTT C;  3DKX A;  1EF4 A;  3ECO A;  3E6D A;  3HHH A;  2MG4 A;  2VQL A;  3FM3 A;  4M9X A;  2FQ4 A;  2H1L A;  3LSH A;  1E0E A;  2VT3 A;  1WJ5 A;  3M1E A;  2EFO A;  2DMU A;  1B6A A;  2X48 A;  5F6F A;  4OIQ F;  3V8L A;  2D2W A;  3QOP A;  1ZH5 A;  1EH6 A;  1TLH B;  1R7J A;  3V7R A;  3SXY A;  1NG7 A;  2DJI A;  5E1Z B;  5DD8 A;  3ASN H;  3IL2 A;  2DI3 A;  1FBQ A;  2ELK A;  3LSM A;  1OCC H;  3F8N A;  5E1X A;  3E5U A;  4HNU A;  3F23 A;  1R6R A;  5ICE A;  3SJM A;  2Y9Z A;  3F8B A;  4RGX A;  1WJF A;  2P5K A;  3U2R A;  3D5R C;  4R1H A;  1ZLJ A;  3DBL B;  4Z6Y A;  4P55 A;  2K9S A;  3WE3 A;  1OCO H;  2LSO A;  5E17 F;  1SEU A;  5B1B H;  1ZAO A;  2PMZ N;  1O7L A;  2LFB A;  4HW0 A;  2NOG A;  3VWB A;  4G7O F;  1OR7 A;  1V5G A;  2XAQ A;  4B4C A;  3ZGK A;  3TO7 A;  4CZZ A;  1ZR2 A;  3GTM J;  3B6C A;  3F8F A;  3V4G A;  1RR7 A;  3V8K A;  1S8N A;  2FML A;  4IHV A;  2GAU A;  3S15 J;  4A69 C;  3FIW A;  1NK2 P;  4YEJ A;  1U78 A;  3H3Z A;  4A5N A;  2DA4 A;  3FKI J;  3S1N J;  4WCG A;  4MHG A;  2ECB A;  2EFP A;  4HBL A;  3OIQ A;  2KIM A;  4UB8 C;  9ANT A;  3ZN1 A;  1W5C C;  1T6S A;  1YW8 A;  4DOZ A;  2LNB A;  4FQG A;  5H2F C;  3KP4 A;  3B02 A;  4EJW A;  5FKL A;  2Y31 A;  4HG2 A;  2B9S A;  2KT0 A;  1YX3 A;  1MBK A;  5CVJ A;  3AL0 C;  4PJL A;  3FMQ A;  2DA6 A;  4HYE A;  2TRT A;  1P6R A;  4XN0 A;  3HRS A;  5DEQ A;  2XSJ C;  3GW2 A;  3DEE A;  3K4K A;  3PFY A;  1BA5 A;  2MD0 A;  3U1K A;  2A6T A;  4QTR A;  1LQ1 A;  2M5W A;  3W6J B;  1R1T A;  4BHP A;  2W25 A;  2CQ7 A;  2G7U A;  5HLT A;  4MEY F;  2BW3 B;  4RLQ A;  3VPR A;  3O8H A;  1Y39 A;  5EEH A;  2R7U A;  2ZCW A;  3V42 A;  3VSL A;  4L5J A;  5D6F A;  5DCM B;  3FXU A;  1JUP A;  4RM3 A;  2X9D A;  3FK7 A;  3H5N A;  1MJB A;  1KON A;  3MKW B;  3JTG A;  5L3B A;  1YJW I;  1GXQ A;  3SEZ A;  4EEF G;  1R4M B;  1IN7 A;  3I64 A;  5IOY A;  2VJJ A;  4XLE A;  1XC5 A;  2QSF X;  1BIA A;  3H9J A;  2XAG A;  1VF9 A;  2VOO A;  2A6E F;  3VYT B;  4QLC U;  2XB0 X;  4C3J J;  4V2G A;  3K4L A;  4E7K A;  1OMI A;  4HF2 A;  3ECH A;  4IRH A;  3OS0 A;  4A3F J;  2IAI A;  5GAG J;  5JHF A;  1AOY A;  2CW8 A;  2JUC A;  3PIO F;  2W24 A;  2JQ7 A;  2QLZ A;  3GTO J;  1B72 B;  1TNT A;  1U9N A;  2VAS A;  1HST A;  1U2W A;  2R7X A;  2CUF A;  2EFW A;  4C3I J;  1YRN B;  2RNJ A;  2Y30 A;  4AM3 A;  3WE2 A;  3S2W A;  2EH3 A;  3KYL A;  1K4T A;  4Q48 A;  1B8I B;  4C2T A;  3S16 J;  2NNY A;  1I6X A;  2GLO A;  1Y6I A;  2L01 A;  2CQN A;  3IH2 A;  4PJM A;  3FX3 A;  3Q9S A;  5FKM A;  2NVX J;  4OU0 A;  1W7P A;  1SFX A;  3DBR B;  3S1R J;  1X3W B;  4PJ0 C;  3E0J B;  3H5R A;  1RUO A;  4Y7N J;  2GBY A;  1PP7 U;  2LF8 A;  1W36 C;  4U0W A;  2VB6 A;  2V9P A;  4BNC A;  2BHZ A;  1K78 B;  3QPL A;  4M9S A;  2K9L A;  4DYC A;  4HQE A;  1CGP A;  1IDY A;  4D5F A;  1IN8 A;  3C3W A;  4D5C A;  1HW2 A;  1G59 A;  4X0G A;  1P7J A;  3J80 K;  1IV6 A;  2HQN A;  1J0R A;  2HOT A;  2OD5 A;  2XVC A;  2NS0 A;  1MNE A;  4RBO A;  1T0F C;  1MBF A;  1RNL A;  3RDI A;  4PJJ A;  2ZKZ A;  3HOT A;  4OIO F;  1JKQ C;  2E1O A;  3H5A A;  2KHM A;  3WTZ A;  1G2H A;  2OU2 A;  5F0F A;  3TBI A;  2GXA A;  2EA4 A;  4ANJ A;  2EK5 A;  1WKM A;  2P8T A;  1U8B A;  1F5T A;  3I53 A;  1E17 A;  2B0L A;  4U88 A;  4QPO A;  3QYE A;  5EEA A;  4P5O A;  2CSO A;  2GXB A;  3C2G A;  4X6A J;  4M3F A;  3ZN0 A;  1RIO H;  4OIN F;  4PGH A;  5CVV A;  5HS7 A;  3GYH X;  5K7H A;  4BH9 A;  2E35 A;  4HDU A;  3HGG A;  1Y1V J;  2FOW A;  1OYI A;  3WU2 C;  1BW5 A;  1O3S A;  5F0C A;  3M8E A;  3GZ6 A;  2R7D A;  2ZSI B;  5E8G A;  5ED4 A;  2WY7 Q;  4CGZ A;  4OWR B;  1Y56 A;  1ZHF A;  1U5T C;  2HNH A;  3FBI B;  2O7O A;  4ON0 A;  3TKY A;  2BXZ A;  2R0Q C;  3CUQ A;  2DTZ A;  3BR1 A;  3OSF A;  2G9W A;  2BY3 A;  3GBG A;  3Q0W A;  1VTN C;  4HX4 A;  3PJR A;  5IP9 J;  3G73 A;  3SDG A;  2W1O A;  2DMP A;  3G3Z A;  2NS7 A;  1W0U A;  3HZJ A;  3REO A;  5B66 C;  3IRR A;  4IXA A;  4D7N A;  1GVD A;  1I1G A;  4ASN A;  5BNG A;  2DMN A;  4G6D A;  4LMY A;  4KN7 X;  4AIH A;  1SMY F;  2Y69 H;  2GOM A;  3CMA I;  1MMG A;  4U0Y A;  1JHF A;  3BPV A;  2UV1 A;  3S32 A;  1PDN C;  3LAJ A;  4LIT A;  1AKH A;  2HYG D;  4UB6 C;  5B5E C;  4Y33 A;  1XGN A;  3CLO A;  4XBF A;  4AIK A;  3UKG A;  4A6E A;  3JW4 A;  1U5T A;  1VND A;  1VQL I;  3LSK A;  1LVK A;  3LA7 A;  2M2E A;  3J80 Z;  3NRV A;  4PSW A;  4S05 A;  4IHX A;  1I6H J;  3W2A A;  1R71 A;  3RQI A;  1BR1 A;  3F8C A;  2VBX A;  3B73 A;  3LQR A;  3K7A J;  1BI0 A;  1HDD C;  1R1U A;  4BHB A;  3GZ5 A;  4KT5 C;  5LLQ A;  3QQA A;  2WV0 A;  1S7E A;  2HVR A;  3KP3 A;  5C4J J;  2QBY B;  1IW7 F;  2FNP A;  1RR8 C;  2JK3 A;  1JGS A;  4PUS A;  2IJL A;  2A5W A;  2IT0 A;  4FHT A;  3COA C;  2JPB A;  3IH4 A;  3Q9V A;  1PUF B;  3F0C A;  5CVI A;  4IL6 C;  5H6R A;  5HDK A;  3KX2 A;  5LFA A;  3HXL A;  3RPU D;  2EV0 A;  2CFO A;  2MBF A;  3DQV C;  4A3L J;  1JTY A;  2VBZ A;  1R23 A;  5EF6 A;  1O4X A;  3HIF A;  2BZT A;  2VQC A;  3DWL E;  2FBI A;  1SVO A;  4XQF A;  3VEP A;  2F5V A;  1H9G A;  2AXT C;  5BQT A;  2K9M A;  2KLO A;  3RYP A;  5FD6 A;  4A2U A;  2EZI A;  1FNN A;  4YIR X;  3I71 A;  2V6E A;  3OYH A;  4JBA A;  4M3E A;  5JI6 A;  4GGG A;  4GYG A;  2HZT A;  2QSH X;  4LB5 A;  5HS8 A;  4ESB A;  4ENK A;  3ZR8 X;  3BR0 A;  3OOU A;  4BDZ A;  4JX6 A;  4D0P A;  3I59 A;  5GPC A;  1MDM A;  1ZGW A;  1A31 A;  4F92 B;  3GLX A;  3QU3 A;  3OYC A;  1YYV A;  3TP0 A;  3L2Q A;  2EFN A;  3K69 A;  2HVS A;  1LUJ B;  3T8R A;  5LEK A;  1D5V A;  1WJD A;  4Q47 A;  5K5O A;  5HLI A;  2XRN A;  3K2Z A;  4XRM A;  2DN0 A;  4N9H A;  2DT7 B;  4IHY A;  3SZP A;  1PYV A;  3ZQQ A;  4BQN A;  1TWC J;  2F48 A;  1N75 A;  4U7B A;  1FJL A;  1ONV A;  2DMQ A;  2L7Z A;  4N9I A;  4NC8 A;  3VB2 A;  4CIC A;  3W6K B;  2DPU A;  2JA5 J;  1JUS A;  1D5Y A;  3PNT A;  1P4A A;  1MMA A;  2P0W A;  3DKW A;  1EH8 A;  2KL4 A;  4BQQ A;  1VQ6 I;  1BC7 C;  4F93 B;  3MVP A;  3H9Q A;  5DYM A;  2O03 A;  3LNQ A;  2YPR A;  4HRI A;  5KK1 A;  2YX7 A;  1UMQ A;  1FYK A;  3KZI C;  3JR9 A;  1F1Z A;  3CMM A;  4PFO A;  1Y1W J;  4QIW N;  5CVR A;  4JQF A;  1YOV B;  3CUQ C;  2VOD A;  3O3K A;  2DBB A;  2KPM A;  2EA2 A;  3H35 A;  3MD2 A;  4CYD A;  5HS9 A;  2IW5 A;  1EA3 A;  1SMT A;  4PK4 A;  2R93 J;  4XLN F;  3CDH A;  4RB3 C;  3G6E I;  2BW3 A;  2X6O A;  3HGY A;  1N25 A;  4CCM A;  3EYI A;  4RAY A;  1USS A;  2L5Q A;  4XNF A;  4M3B A;  1RKT A;  4MO7 A;  4OIP F;  1ZGA A;  1U9O A;  3OYI A;  1XS9 A;  1JKO C;  3TW7 A;  1HXD A;  1N78 A;  5C3E J;  2FXA A;  2V9K A;  3C7J A;  1Y0U A;  3MQ0 A;  3WGG A;  4BY7 J;  5FB2 A;  1J5Y A;  3CP8 A;  3P7N A;  3L09 A;  2CO5 A;  1B9M A;  2HYF A;  3RCO A;  2R7W A;  1HLV A;  2ZNY A;  1OQY A;  4XRF A;  3A2K A;  3HSE A;  1P7I A;  3F6V A;  2H6C A;  1D1A A;  2BOL A;  1D1C A;  2MC4 A;  1FSE A;  3PFI A;  2LTP A;  2HPM A;  2O61 A;  1FTT A;  3E97 A;  2JZY A;  2RKH A;  3CJT B;  3DTK A;  3QPT A;  3OYD A;  5TJJ A;  4II3 A;  4DW6 A;  1HDP A;  3TGN A;  4XN3 A;  3JRE A;  3AG3 H;  4WK8 F;  1RKW A;  4U7D A;  3EUA A;  2STT A;  4XRS G;  1QPM A;  4HV6 A;  2FE3 A;  2EIL H;  2V79 A;  5L3C A;  3K1M A;  3AKZ A;  3ZMD A;  4A3K J;  1OLT A;  1XMA A;  1QU3 A;  4AVP A;  2XAU A;  1QPI A;  4I01 A;  5IT9 Z;  1G8X A;  1FOW A;  2PLY A;  3KET A;  3H1C A;  3ABT A;  2Y75 A;  4CYC B;  3SFZ A;  5FRM A;  3KYD B;  3K4C A;  3E6M A;  3CES A;  3DP7 A;  3K1P A;  2OTL I;  1FLI A;  4M74 A;  1VFC A;  3BR3 A;  2JRM A;  4U87 A;  1W36 D;  4NB5 A;  4DBQ A;  4F91 B;  2K4B A;  2R5Y B;  1J7K A;  1UJ8 A;  1VI0 A;  2JVH A;  2NVT J;  3X2Q H;  2EV6 A;  4W1U A;  1DDN A;  3CCQ I;  1AA7 A;  1E3H A;  4JX5 A;  1VQP I;  1X1D A;  2MH2 A;  4YFK F;  2Y0S A;  3KEQ A;  3L2W A;  1YW9 A;  2VXD A;  4B48 A;  1IRF A;  4NDL A;  2E60 A;  4KUM A;  3CCS I;  4MTD A;  3CC4 I;  2VKD A;  1XMK A;  2FNA A;  1YIO A;  2L3D A;  3HPG A;  4D7M A;  1R1V A;  2D45 A;  3N97 A;  4KFC A;  2GQQ A;  4M72 A;  2OAZ A;  4GO1 A;  3FMR A;  1AKH B;  2JPC A;  2Y2Z A;  4HF0 A;  4XLF A;  1R5I D;  4GRI A;  3IHU A;  3WGI A;  3L2U A;  5AON A;  3J81 Z;  1S29 A;  4DNC A;  1ZR4 A;  3JRG A;  2FRH A;  3AL0 B;  3OYA A;  2JN6 A;  1OJL A;  2DFI A;  3BRO A;  4ZTJ A;  2AXL A;  3J7Z I;  2F5D A;  2O0Y A;  2XAH A;  4MNU A;  3GTQ J;  5F1R A;  2DTR A;  3GME A;  2CS3 A;  4BJ5 C;  1W7P D;  2LDU A;  2XRL A;  2MW8 A;  5E3M A;  2K85 A;  1G3T A;  1UG0 A;  5H20 A;  2ZXI A;  4LOC A;  2F2E A;  5EEG A;  3O8G A;  3P9C A;  3Q0V A;  3G71 I;  1ERD A;  1U0J A;  3OYM A;  2HS5 A;  1YS6 A;  2WAE A;  3SHF A;  4FIS A;  3BTL A;  3HEF A;  5HOO A;  1W5T A;  4NC7 A;  3CJR B;  4V2F A;  4FT8 A;  3WG7 H;  1YE9 A;  1IXR C;  1NG6 A;  3RKX A;  4HOB A;  3DTI A;  4EMS A;  2DA1 A;  3S1M J;  2V7F A;  3PM1 A;  1E3P A;  3PNY A;  4ZYH A;  5KHD A;  1RRJ A;  1OCT C;  3GTP J;  3V8J A;  1RZ4 A;  5HVQ C;  3I5U A;  3FBN B;  2R7Q A;  5JLX A;  3BG6 A;  1W0T A;  2HDD A;  3SYT A;  1YHQ I;  4BHC A;  3F8M A;  1FPQ A;  3JRD A;  1SAN A;  2LRD A;  1P9Q C;  1JJ8 C;  1DPU A;  5F27 A;  4BUP A;  1ZG1 A;  3VYR B;  4IVN A;  3FMS A;  5J1U A;  2Z5U A;  3BR5 A;  1M1E B;  2MYS A;  3DU6 A;  4KDP A;  3U1D A;  1IXC A;  2F4M B;  3CJQ B;  1KYZ A;  1ZRF A;  2CWE A;  3ELK A;  3KP2 A;  5LEJ A;  1Z6T A;  5ILS A;  4H0E A;  2JJ7 A;  5LGN A;  3OMY A;  4LG3 A;  1J9I A;  3JCU C;  3ZQC A;  3DFG A;  3CDI A;  2Z2S B;  2PBI A;  3FDY A;  1YTY A;  3I3L A;  3BCB A;  4BAY A;  2HR3 A;  4LGW A;  4WX9 A;  2X85 A;  1UAA A;  3SEQ A;  2OTJ I;  3EQL F;  2OQG A;  4LLL A;  3K4J A;  4IF4 A;  3LQQ A;  2IS4 A;  2XRO A;  4A0Z A;  4E70 A;  2NOJ B;  1TBX A;  3T8T A;  3MMY B;  3NAU A;  1CF7 A;  1FBU A;  2JA6 J;  2DLL A;  4ZDP A;  2KP6 A;  3K9T A;  3T1B A;  1SAX A;  5J47 A;  3PUB A;  3OS1 A;  3ABU A;  2WV1 A;  1QQI A;  2L9R A;  2ZFW A;  2H6B A;  4RA2 A;  2DQL A;  2DCE A;  2V9V A;  4EJO A;  1LE8 B;  2F4I A;  3BTI A;  1R4N B;  5EZG A;  5J8C A;  2Q8K A;  1FIA A;  2OC6 A;  4ETS A;  4A3J J;  2KIF A;  2YSR A;  2HDW A;  2RQQ A;  1XB4 A;  5GPA A;  1D8K A;  1B9N A;  1G4D A;  3BR6 A;  2ELH A;  4NBQ A;  3CF5 F;  2JT1 A;  4N0B A;  5CVU A;  5CJ9 A;  3I4M J;  2C6Y A;  4EM0 B;  2QVO A;  3VOD A;  1KA8 A;  2E1M C;  2P6S A;  3HOV J;  4MQV A;  2L9S A;  3BDD A;  1WGX A;  4HAM A;  2RVC A;  3N05 A;  3CCU I;  2XGC A;  4DZP A;  3TL4 X;  4A3C J;  4HA8 A;  2NVQ J;  3M9A A;  3TED A;  3ZMU A;  2WB1 A;  2H8W A;  1BJZ A;  1V4R A;  2HVQ A;  4CHU A;  5D5V B;  1RI7 A;  1X4P A;  2CUZ A;  2DA7 A;  3OV8 A;  3QOE A;  4L9J A;  2M7B A;  2P5V A;  4DIQ A;  2RV8 A;  3WTV C;  4R8H A;  1BI1 A;  4MGR A;  3PNV A;  4I98 B;  2XKP A;  2AHQ A;  4C3H J;  2E2I J;  3R6S A;  1NHA A;  1VQ4 I;  3BTJ A;  2XKO A;  3ERM A;  3S8P A;  3LSI A;  1P4W A;  4GDF A;  2OV7 A;  5EDN A;  4G9Y A;  2IA0 A;  1FOY A;  4HQM A;  2K27 A;  1ZRC A;  3WU1 B;  2OA4 A;  3WHC A;  2EFQ A;  2VKE A;  2NXN B;  3MKY B;  3GVA A;  5JHU A;  1ENH A;  1IC8 A;  4WWC A;  3D5S C;  2Z33 A;  3RI4 A;  2WBM A;  1Z7U A;  2XAS A;  4G6T B;  3FXQ A;  1ZRE A;  4EM2 A;  3WTX C;  3ISP A;  2QBY A;  4RGR A;  1WVR A;  4JX4 A;  1ZLK A;  1VZ0 A;  2BYV E;  5L3D A;  4E7Z A;  2VJ5 A;  4FTH A;  3PUF A;  2M4G A;  3ZQI A;  3N4M A;  1K83 J;  2FA5 A;  1HKT A;  1T08 B;  2M30 A;  3CO7 C;  3HRT A;  3L00 A;  1YRN A;  2A69 F;  2QCO A;  1DU0 A;  5KVR A;  5FRO A;  1BL0 A;  1ETQ A;  3RZD J;  3V7C A;  4L9N A;  1S9H A;  2PMH A;  4L9T A;  3PSF A;  4M6Y A;  4M3G A;  1ZG3 A;  1SD4 A;  2E2J J;  4XRS A;  1FBS A;  2X1E A;  2M4K A;  3A02 A;  1STZ A;  3L9F A;  2ESN A;  1K78 A;  3KP7 A;  5IYC J;  4EGZ A;  3ZMV A;  1IXS B;  2VC1 A;  3F21 A;  3H92 A;  1XX5 A;  1BJA A;  3W3C A;  5L3F A;  1LDK B;  2ME0 A;  1FZP B;  3P5J A;  1TW2 A;  1I50 J;  3ZPL A;  4BBR J;  3GXO A;  4CA0 A;  3I54 A;  4II2 A;  2EV5 A;  1APL C;  1VQ7 I;  4M6X A;  2KIS A;  1HKS A;  1GVJ A;  2DYS H;  3MZH A;  5E8I A;  4OOI A;  3FHZ A;  2L4M A;  3TDZ C;  3JRI A;  3GEZ A;  3KPH A;  4M9Z A;  3T0Y A;  4BU2 A;  1PVE A;  2RN7 A;  1PP8 F;  3G4S I;  4IQ4 A;  3DCF A;  4CCK A;  3JSO A;  1D0Y A;  1XMX A;  1T0F A;  2XPV A;  2V1D A;  3CJN A;  4HNV A;  2VC0 A;  1FOK A;  5C4X J;  1UHS A;  2MA3 A;  1JT6 A;  5FKN A;  2DA3 A;  5EGO B;  2KZG A;  4RS8 A;  2K3F A;  1Z77 A;  4LFU A;  3OSG A;  3OYE A;  1GV5 A;  2Q2E B;  5F1J A;  2Y0M A;  4IZZ A;  1WH5 A;  3R61 A;  4NNJ A;  3RQ4 A;  1UHW A;  3ONQ A;  3QAH A;  3T5X A;  2KRH A;  5FLX Z;  1TL8 A;  3AG4 H;  3DEW A;  1BOB A;  4DZJ A;  1S72 I;  1EKE A;  3CTA A;  2Q2E A;  5JLW A;  2HKX A;  1Z6R A;  2XPW A;  4AC0 A;  1A5J A;  1RPW A;  1KQ8 A;  3MZY A;  3S2D J;  2LP0 A;  4XMY A;  1F36 A;  2EIK H;  5HLG A;  1KGS A;  3ZP5 A;  4I0A A;  3GTJ J;  1OPC A;  1BC8 C;  2QYO A;  3BG9 A;  3ABK H;  2RGV A;  4XK4 A;  5LRS A;  5GAE J;  1VQ5 I;  4ENJ A;  5B3S H;  5GTI C;  1SD6 A;  4KNY A;  1WWX A;  2YX4 A;  1SFO J;  4BAC A;  2ME6 A;  5AIQ A;  5JFR A;  3BZK A;  1B4A A;  2H1K A;  1J2X A;  1U6G A;  2DT5 A;  3RTR A;  1ZQ3 P;  3ZOB A;  4WXC A;  3HYI A;  4IJA A;  2O9L A;  1LNW A;  4XSX F;  2DAO A;  1O3T A;  3S2H J;  2LRE A;  4KIB A;  1LPQ A;  1Z1D A;  1XSV A;  1J75 A;  4BE2 A;  2JA8 J;  2G0E A;  5KCM A;  3OIP A;  2QWW A;  2Q0O A;  1TWG J;  2IS6 A;  1QNT A;  4DJA A;  3ERE D;  1LFU P;  2ZME A;  4I7H A;  2M8E A;  2UXN A;  5EG0 B;  5D5U B;  4ENM A;  3TW6 A;  1XDS A;  3WTS C;  4A6D A;  1E3O C;  5D6E A;  2AS5 F;  5GAD J;  5DM6 F;  4PJN A;  2MLK A;  2XHK A;  3BG7 A;  1ACI A;  2I8D A;  5J1Y A;  1IG7 A;  2COM A;  4KMU X;  4RB0 A;  1R58 A;  2W4S A;  1V3F A;  1S7A A;  2XF6 A;  4XKC A;  4AID A;  3M3Y J;  5LHI A;  4D1Q A;  5JR3 A;  2BY2 A;  3JRC A;  3S3M A;  1WJB A;  3BQZ A;  4YFX F;  4BE0 A;  4QWQ A;  1MMS A;  1ULY A;  2W85 A;  4OAZ A;  2P7C B;  2DOE A;  2X1D A;  3I4P A;  5D8L B;  4YG2 F;  3K4B A;  3LL7 A;  4JYK A;  2X4H A;  1X58 A;  4C9Y A;  3ABM H;  4EAT A;  3HUG B;  4I6Z A;  1WI9 A;  3HM5 A;  1FC3 A;  3A03 A;  2XC7 A;  2HKO A;  4IHT A;  3VYU B;  3WTU C;  3GFM A;  2QQ9 A;  2IS1 A;  1FX7 A;  4ZYG A;  1U3E M;  3KFW X;  1VQN I;  1JUM A;  1UST A;  1JI8 A;  3CUQ B;  3HDD A;  1MND A;  4GXO A;  3G1O A;  2V6C A;  2R7S A;  4MIM A;  1YJN I;  5CKT A;  3SZG A;  3HC7 A;  4PSX A;  1MSF C;  1YIJ I;  3RPU A;  2LC2 A;  2O5R A;  4KN4 X;  3W2W A;  4EM1 A;  2GM4 A;  3KYC B;  4XLP F;  1FOX A;  2JA2 A;  5J8F A;  5CLS A;  2ECC A;  1IJW C;  1MH4 A;  3CLQ A;  1FP2 A;  1YO5 C;  1QBJ A;  5KNL A;  4BY1 J;  2EZK A;  2VPL A;  4KIT B;  3P9I A;  1X2M A;  1UFM A;  2F5C A;  4TV7 A;  1W7P B;  5FFZ A;  4B43 A;  2OCE A;  3GFI A;  4IRI A;  3DPT A;  4B3A A;  2M9H A;  2BY1 A;  2F4O B;  3OY9 A;  3LWF A;  1OYW A;  2DFF A;  3EUK L;  1HCR A;  2CW0 F;  3OOP A;  4P9F A;  5K7F A;  2MC3 A;  2L9N A;  2VXZ A;  2P5L C;  2YR2 A;  1Q1H A;  5LRR A;  1KYW A;  2R5Z B;  4CZC A;  1O7F A;  1FYL A;  3CCL I;  1FWZ A;  2BEO A;  2R7F A;  1QA6 A;  1YQA A;  2A6H F;  5BPI A;  2XUB A;  3BT9 A;  1DUX C;  1FT9 A;  2TCT A;  1GDT A;  1AU7 A;  3KZZ A;  3MEX A;  4A0X A;  1S3J A;  3KEO A;  5DM7 F;  2VI6 A;  2DJN A;  5TIS C;  1XGM A;  1UHM A;  3CC2 I;  2OCC H;  3A0B C;  3S3N A;  1QGP A;  2Z1D A;  3LSR A;  4L9V A;  2RC4 A;  2AQF A;  4DGW B;  4XL9 A;  4FE7 A;  3C1D A;  4XLH A;  2BV6 A;  2IP2 A;  3E6C C;  1O3R A;  4LLN A;  4DYR A;  2HXO A;  2J5P A;  4ZZL A;  2PFB A;  4AYB N;  1MBE A;  3NEU A;  4XOR A;  4EGY A;  2K86 A;  1RUN A;  2HOS A;  3WG9 A;  2MH9 A;  4BDY A;  2CV1 A;  5FLX K;  2KJB A;  3HOZ J;  4GYI A;  5JVT A;  2ZNZ A;  2K40 A;  2M87 A;  4EQQ A;  3E5Q A;  2HTJ A;  5DUI A;  2DK8 A;  1MZB A;  3TMO A;  5EYR A;  5E18 F;  1X1A A;  1JHH A;  3HUG A;  3HRU A;  4O5V A;  1KU7 A;  4R79 A;  1UCR A;  4BEH B;  3HOU J;  4LG0 A;  4B09 A;  4I76 A;  1JE8 A;  1ZTR A;  3EUH A;  3FXR A;  2ZME C;  4FET A;  2AO9 A;  3ZQ7 A;  1G3W A;  2FD5 A;  4XLA A;  1NH3 A;  3HTS B;  4C30 A;  3PQK A;  2EJR A;  2LBF A;  4RAG A;  2ZJR F;  1LVA A;  4E7I A;  5JVG F;  3RKY A;  1FMW A;  1X2N A;  1VQM I;  4NQW B;  2RDP A;  1VQK I;  1FMV A;  5IYD J;  3VYS B;  2VKH A;  3BJ6 A;  2PJR B;  3VFZ A;  4ZYA A;  3C2H A;  3C18 A;  1LE8 A;  1YG2 A;  1WQ2 A;  2GIV A;  1RET A;  2DT6 A;  2FMY A;  2A68 F;  3RSN A;  4ABZ A;  5M5W J;  1ZGJ A;  3DV8 A;  4GCV A;  3I4N J;  3J81 K;  4BEH A;  2RQP A;  1QHH D;  5FJ8 J;  2DPD A;  1L0O C;  2VT2 A;  3HOS A;  2EBI A;  3TOA A;  4IHW A;  3KEY A;  3BQY A;  3DLA A;  1CF7 B;  4A3G J;  4Z2Y A;  2XGD A;  3P9K A;  2VQG A;  4BS9 A;  2DA5 A;  3IUO A;  3JRA A;  2GIZ A;  2GWR A;  4UUS A;  2WB1 N;  1A35 A;  4ESJ A;  2K9Q A;  3HOW J;  2ESH A;  1D0X A;  2BBY A;  1WHU A;  3NAR A;  3BPX A;  1XCB A;  2CQK A;  4LIU A;  4RAF A;  3OR1 C;  1O3Q A;  2XV4 S;  2M45 A;  5DCM A;  4LG0 B;  3F72 A;  1XN7 A;  5J40 A;  4HDV A;  2GZW A;  1KU2 A;  4XON A;  2HYJ A;  3DEU A;  2LH9 A;  4UVA A;  4YIF A;  2STW A;  1D8J A;  1D3Y A;  1JKR C;  1IRZ A;  3IKT A;  5FO5 A;  1S5L C;  5FGM A;  3BJA A;  1IAW A;  2HU9 A;  5J4Y A;  1IV8 A;  3KIO A;  1R9T J;  2MAB A;  1T33 A;  1V54 H;  5CPR B;  1A36 A;  4Y17 A;  4XOT A;  4ZJZ A;  2Y0S N;  5IT3 A;  2ZC2 A;  3WHB A;  2PJR A;  4G7Z F;  4I0B A;  1GUU A;  2FJ1 A;  2EZH A;  1IN5 A;  3EPZ A;  1GHC A;  3PSI A;  4CCN A;  3DPL C;  4ITV A;  1LFB A;  3MKZ A;  3GX4 X;  2R7O A;  3L2R A;  1IN6 A;  2IBD A;  3FXO A;  1SVM A;  5EG0 A;  4ZDO A;  1H8A C;  3IH3 A;  4UVC A;  1X19 A;  5DS9 A;  3A0H C;  2KFD A;  3EDP A;  4UV9 A;  4YEL A;  2A07 F;  2L02 A;  4IEJ A;  3LA2 A;  3H9G A;  2JTV A;  5M5X J;  2X6X A;  1FY7 A;  2YUS A;  4U0V A;  2KJC A;  2NRA C;  1AWC A;  4HST A;  2I5U A;  5IPA A;  1FIP A;  4ZDL A;  2DA2 A;  2VLA A;  3ZMS A;  3R4K A;  4G8X A;  4Y13 A;  2CV0 A;  5GAH J;  3QP6 A;  2ZXH A;  4RB1 A;  4EJT A;  2NS8 A;  3ESW B;  1OR7 C;  1XDU A;  1PUF A;  2VQH A;  1X1B A;  2DW4 A;  4RGS A;  4RMN A;  2WC2 A;  3FF5 A;  2E7W A;  1UG2 A;  2BE5 F;  2KRC A;  3EUH C;  4LD5 A;  5K7Z A;  4V19 K;  2VN2 A;  5LGT A;  2L2O A;  4LB6 B;  3I55 I;  1H88 C;  1WFX A;  3QWL A;  2M1B A;  3L7W A;  3OYG A;  3TO9 A;  3W2V A;  5EGO A;  4ZTF A;  2KDZ A;  2XF7 A;  2PG4 A;  1SD5 A;  4OMY A;  4UUV A;  1FTZ A;  3OWT A;  2V1U A;  2P6T A;  2DU9 A;  5LHG A;  2QKL B;  1MH3 A;  4BE1 A;  3G1M A;  3PQJ A;  3SQN A;  4BYY A;  6PAX A;  4L18 B;  2XGE A;  2XDV A;  1JGG A;  2O6G E;  5M5Y J;  4BJ6 C;  2FBH A;  2O8K A;  1IGN A;  2E5N A;  4IOC F;  3HKZ A;  5E1W A;  1ETO A;  2FF4 A;  5F64 A;  1ZYR F;  2FOK A;  3WGH A;  1V5F A;  2E19 A;  2LY1 A;  2XAF A;  2R7R A;  1TT0 A;  4XR6 A;  3BZ6 A;  4ENN A;  3E3V A;  2PMU A;  1FP1 D;  2XPU A;  1Z0X A;  1WI3 A;  3JRB A;  1ORK A;  2R3S A;  1OKR A;  1POG A;  1DPR A;  2HGC A;  4LK0 F;  2QGU A;  1T95 A;  1JTX A;  2LKP A;  3I9V 2;  1T8I A;  3BG3 A;  4H4K C;  5KAI C;  4C2M J;  3F3X A;  2QUF A;  2NAZ A;  4A3I J;  3GTL J;  1ZRD A;  2JUG A;  1BOA A;  2FU4 A;  2LVS A;  1OCP A;  4A3D J;  4AIJ A;  2OZ6 A;  1K4S A;  3HOX J;  2JWT A;  2GOX B;  5FLM J;  4DQ2 A;  2BVM A;  4PZJ A;  5E3L A;  1WZ2 A;  3ZMT A;  2VIX A;  1K79 A;  1QRY A;  3ZXS A;  2LF7 A;  3BP8 A;  2B63 J;  2IPQ X;  1HKQ A;  2VKV A;  4MFD A;  4E7L A;  3KP5 A;  3ZCO A;  1P92 A;  3HKZ N;  3QPH A;  1SFK A;  3HPH A;  2LLK A;  1OYY A;  3BLY A;  1I3Q J;  1RC9 A;  5L3E A;  4L0Y B;  2Y9Y A;  1R5G A;  1JKP C;  3M1C A;  1QZZ A;  4ZYD A;  3PO2 J;  2Z3Y A;  1DP7 P;  1MBH A;  3CMY A;  2FQ3 A;  3F22 A;  3BOQ A;  4UUT A;  4BKX A;  3FXM A;  2IS2 A;  2EB7 A;  3KE2 A;  2X6W A;  2PI0 A;  3DLL F;  2K7L A;  3FIS A;  1LB2 A;  1J59 A;  2X1C A;  5IP7 J;  1WJA A;  1DGW Y;  2QM3 A;  2HOE A;  4S04 A;  2FEZ A;  2UWM A;  4CCL A;  1SD7 A;  4HPQ A;  2EPF A;  4FX0 A;  2Z16 A;  3S93 A;  2XSD C;  1XTA A;  2R7T A;  1JT0 A;  1U8R A;  3ML6 A;  5B1A H;  2CUJ A;  5DTD A;  2QF7 A;  1YLF A;  3JSP A;  4WXH A;  5IYB J;  3BZC A;  2MGQ A;  3ZQH A;  4BXF A;  1S6L A;  1ZN2 A;  5DDG A;  3FK6 A;  2VL8 A;  3GCM A;  1XD7 A;  2L7M P;  3ROU A;  4QPQ A;  2HTS A;  4L0Z B;  2HFH A;  2OQR A;  1R22 A;  1MMN A;  3K4M A;  1P2F A;  2E71 A;  2OPT A;  5A2Q K;  2ZXW H;  3GZN B;  3DKY A;  4PCQ A;  2Y48 A;  3Q3S A;  3CC7 I;  4UNO A;  2HXI A;  2QQA A;  5ILU A;  4F3Q A;  5D4R A;  2XGX A;  5CYV A;  4YII A;  4EJU A;  2FBK A;  4YFN F;  3S17 J;  2CJJ A;  4G6Q A;  1Z7L A;  5L3G A;  3M8J A;  5ILV A;  3H3U A;  3C2B A;  1BR4 A;  2AQE A;  2DDA A;  4IQJ A;  2CQX A;  3WU0 A;  3OR2 C;  5LHH A;  2F6C A;  3G1L A;  3OYK A;  1H9T A;  2GA2 A;  2D5V A;  1F9N A;  2L7F P;  1SFU A;  3HOY J;  2UZK A;  4WF2 A;  3HHG A;  2ZFU A;  4HX8 A;  5TRD A;  2OF7 A;  1R5H A;  2DQR A;  2A5Y B;  4XID A;  1MKM A;  1IF1 A;  2EIN H;  5K5R A;  4X1E A;  4MQ9 F;  2LD5 A;  2K02 A;  3OYB A;  1VQO I;  1Z91 A;  3AG2 H;  2IGN A;  2ZJ2 A;  2CV2 A;  4OMZ A;  1B1B A;  2HDC A;  3TDU C;  4ESF A;  1V55 H;  3SDB A;  1Z3X A;  3GTK J;  2O8X A;  2LK2 A;  2DOA A;  4EVI A;  2P7V B;  3QOD A;  2VJI A;  4EV0 A;  1XG1 A;  1MJ9 A;  2E34 A;  3RIR A;  4XSZ F;  1XPX A;  3EYY A;  3HTU A;  1ETW A;  2QZ8 A;  5E3O A;  2HEO A;  3BR2 A;  1TWF J;  3A1Y A;  2L54 A;  2ZB9 A;  4Q5S F;  1YJ9 I;  1OFC X;  4E6K G;  3JRH A;  4C2U A;  5F04 A;  3I0T A;  1YX5 A;  1Y0N A;  4ZC3 A;  2I10 A;  1WCM J;  4DYQ A;  1T98 A;  1WRJ A;  2EIJ H;  3CDL A;  1QZE A;  5K1Y A;  4IO9 F;  1X3U A;  2WAQ A;  1J09 A;  1ODD A;  2WTE A;  2HPI A;  1REP C;  2B7E A;  5EZH A;  2E1C A;  3BY6 A;  2IVM A;  4FCY A;  3E5X A;  2HQR A;  5BOX A;  1BN5 A;  1KU9 A;  3K4N A;  2IGK A;  5LBQ A;  4B1R A;  2F5F A;  1OCZ H;  3KLN A;  4KA4 A;  4L5E A;  3GTG J;  3M7G A;  1XSX A;  1IUF A;  4M71 A;  1Z21 A;  2VJ4 A;  1FEX A;  2LOO A;  2DYR H;  2M34 A;  1LEA A;  2ZO4 A;  2JA7 J;  2QSG X;  4K2E A;  4XM3 A;  3VOE A;  3HSR A;  2ELJ A;  3MZ8 A;  3GLL A;  4IX7 A;  1GT0 C;  1BI3 A;  3OL4 A;  4E7H A;  1H0M A;  1A04 A;  4IPA A;  2VPR A;  1SVL A;  3BJO A;  3GF2 A;  1V5E A;  1SAU A;  3L2V A;  1T39 A;  1MJA A;  4ZYE A;  5DV5 A;  1ZG5 A;  1IDZ A;  2IA2 A;  1SC7 A;  2ZSH B;  3WTY C;  5FFX A;  4M6V A;  4NQW A;  2PEX A;  1T56 A;  4ZH4 F;  4HLY A;  2EIM H;  4J19 A;  1PUE E;  2ZXJ A;  4GFB A;  3LSG A;  5IOZ A;  2FSW A;  1W1W E;  1HSJ A;  2L4A A;  4LLG F;  3A4C A;  4BJT A;  2L0K A;  1A6I A;  1B8I A;  3CP2 A;  4AUX A;  2LG4 A;  3HB9 A;  4NUB A;  2QEX I;  2YU9 J;  4NHJ A;  4KT6 A;  2E2H J;  3GO5 A;  2R5Z A;  2HQA A;  1C0W A;  1GLN A;  2OZU A;  1TQP A;  3H0G J;  1B59 A;  3ASO H;  3K2A A;  1DGR M;  1TQM A;  3PL8 A;  1JJ6 C;  3FXL A;  2H27 A;  4G94 A;  3G2B A;  2OJE D; 
#chains in the Genus database with same CATH homology
 2MD5 A;  3JAM K;  3MFK A;  3IRQ A;  3L2C A;  2NYX A;  4UV8 A;  4Y15 A;  1IUY A;  5E20 A;  1QO0 D;  1ZAR A;  2KIU A;  2V1X A;  3CO6 C;  2E7X A;  4CO8 A;  3ZMZ A;  2W57 A;  2CYY A;  3LA3 A;  3R0J A;  2CG4 A;  1GXP A;  1KQ0 A;  2X0L A;  1Z05 A;  4CXF A;  2TDX A;  2H94 A;  3QP5 A;  5DCF A;  3NQO A;  4KYW A;  1L3L A;  3GFJ A;  3RPQ A;  1EV7 A;  4UVB A;  3KZY A;  1JXS A;  2VE8 A;  1SFE A;  3MCZ A;  3AAF A;  4BQA A;  4IHS A;  2JRT A;  3KLO A;  4KIC A;  4IRG A;  1R36 A;  1HW5 A;  5ERI A;  2VBY A;  5ICF A;  3RKW A;  3IWF A;  4UXN A;  1HW1 A;  4AD9 A;  4UHT A;  2IRF G;  5K5Q A;  1BIB A;  4LK1 F;  1T2K A;  4A0Y A;  3Q5F A;  1U5T B;  3JAM Z;  3KCC A;  1TQI A;  3HRM A;  4ZZD A;  1MD0 A;  1KU3 A;  2GXG A;  3K1N A;  3R0A A;  2F5E A;  2G7H A;  4G7H F;  3FWE A;  1W4M A;  2OBP A;  1TW3 A;  2DK5 A;  1WSU A;  2CGP A;  2P4W A;  1YW7 A;  3I59 B;  1MDM B;  1YFH A;  4MEX F;  3K0L A;  5LGU A;  3R60 A;  4P9U A;  2A3S A;  3MWM A;  3IWZ A;  2HWV A;  2VE9 A;  3QRF F;  2ISY A;  3SZT A;  2UXX A;  1K6O A;  4A5M A;  2KRF A;  3M8F A;  5D5X B;  1E2X A;  3I58 A;  2K4J A;  2VBW A;  1ON1 A;  4KMF A;  4MTE A;  2ADU A;  3JTH A;  5BS6 A;  2WWY A;  5BMZ A;  3WOD F;  3KP6 A;  3WTW C;  1IZ1 A;  5DD4 A;  3TOB A;  4I09 A;  2QQB A;  2XIG A;  1UB9 A;  2MLG A;  5DUK A;  5D4S A;  4HX7 A;  1T38 A;  4AWX B;  5ICG A;  1KQ9 A;  2PN6 A;  5HDG A;  3HSF A;  1LDJ A;  2XAJ A;  1LEB A;  2PQ8 A;  1BBY A;  1HQC A;  3DXJ F;  4HF1 A;  1MGT A;  2DO7 A;  1F4K A;  3J7A O;  1K7A A;  1TTY A;  3U9G A;  2GA1 A;  2E1N A;  4OIR F;  5J6X A;  5ICC A;  1O57 A;  1YS7 A;  4I02 A;  1S7O A;  1EH7 A;  3FZV A;  4I2O A;  1IN4 A;  2BGC A;  2W84 A;  3DF8 A;  3RJP A;  4KIF A;  3D0S A;  2KKO A;  4HZF A;  1G3Y A;  1IRG A;  1FSH A;  3TQN A;  1R00 A;  4A12 A;  4FX4 A;  3E6B A;  3O2P E;  1XGO A;  2EWN A;  2QEN A;  2H09 A;  4CDG A;  4O6J A;  1ON2 A;  3CUO A;  4KIG A;  2A61 A;  3IKV A;  5HLH A;  2VOP A;  1LJ9 A;  3RYR A;  2CFX A;  1XSD A;  1QZY A;  1P4X A;  5HDN A;  1XGS A;  2NNN A;  2ISZ A;  1I1S A;  1TNS A;  4WXD A;  4HV5 A;  2YU3 A;  4HLX A;  5D8K B;  3EET A;  1G3S A;  4BXU A;  4F7Z A;  2O3F A;  1BI2 A;  5FD5 A;  3TO6 A;  3LST A;  4P96 A;  4L5I A;  3D5L A;  4PGG A;  2JSC A;  1BM9 A;  1I27 A;  3LAP A;  3IC7 A;  2ZBK A;  1I5Z A;  1FYM A;  4LJZ F;  4RB2 C;  4PDK A;  4M73 A;  1XCV A;  1G6N A;  3FM5 A;  3BWG A;  2IA1 A;  5A2Q Z;  2ZME B;  2VON A;  3ULQ B;  2PJP A;  4Q4Z F;  2D1V A;  5H6Q A;  3V7S A;  3LFK A;  3GFL A;  2D1H A;  3O6B B;  3GUD A;  1Z9C A;  2ETH A;  3GWZ A;  3QU6 A;  4EJV A;  5BPD A;  5AIP A;  5D5W B;  4JK1 X;  1LDD A;  3F6O A;  4RAZ A;  2Z99 A;  4B8X A;  1W5S A;  4RGU A;  4O3M A;  5IT9 K;  3MAJ A;  2Z9O A;  2ACJ A;  2J5O A;  1HBX G;  3WTT C;  3ECO A;  3E6D A;  3HHH A;  3FM3 A;  4M9X A;  2VT3 A;  3M1E A;  2EFO A;  5F6F A;  1B6A A;  4OIQ F;  3V8L A;  2D2W A;  3QOP A;  1ZH5 A;  1EH6 A;  1TLH B;  1R7J A;  3V7R A;  3SXY A;  5E1Z B;  5DD8 A;  3IL2 A;  2DI3 A;  1FBQ A;  3F8N A;  5E1X A;  3E5U A;  3F23 A;  5ICE A;  3F8B A;  4RGX A;  2P5K A;  3U2R A;  4R1H A;  1ZLJ A;  4P55 A;  3WE3 A;  2LSO A;  5E17 F;  1ZAO A;  1O7L A;  4HW0 A;  4G7O F;  1OR7 A;  2XAQ A;  3TO7 A;  4CZZ A;  3F8F A;  3V4G A;  3V8K A;  1S8N A;  2FML A;  2GAU A;  1U78 A;  3H3Z A;  4A5N A;  4WCG A;  4MHG A;  2EFP A;  4HBL A;  2KIM A;  3ZN1 A;  1T6S A;  1YW8 A;  2LNB A;  3KP4 A;  4EJW A;  3B02 A;  5CVJ A;  3FMQ A;  4HYE A;  1P6R A;  3HRS A;  5DEQ A;  3GW2 A;  1LQ1 A;  2M5W A;  3W6J B;  1R1T A;  4BHP A;  2W25 A;  2G7U A;  4MEY F;  5EEH A;  2ZCW A;  4L5J A;  5D6F A;  5DCM B;  3FXU A;  1MJB A;  3JTG A;  5L3B A;  1GXQ A;  1IN7 A;  3I64 A;  1BIA A;  2XAG A;  2VOO A;  2A6E F;  4QLC U;  1OMI A;  4HF2 A;  3ECH A;  4IRH A;  1AOY A;  2W24 A;  2QLZ A;  1TNT A;  1HST A;  1U2W A;  2EFW A;  2RNJ A;  3WE2 A;  3S2W A;  4Q48 A;  2NNY A;  1I6X A;  2L01 A;  3FX3 A;  3Q9S A;  4OU0 A;  1W7P A;  1SFX A;  1RUO A;  1PP7 U;  2LF8 A;  4U0W A;  4BNC A;  1K78 B;  4M9S A;  4HQE A;  1CGP A;  1IN8 A;  3C3W A;  1HW2 A;  3J80 K;  2HQN A;  1J0R A;  2OD5 A;  2XVC A;  2NS0 A;  1RNL A;  3RDI A;  4OIO F;  2ZKZ A;  3HOT A;  3WTZ A;  2OU2 A;  2EA4 A;  2EK5 A;  1WKM A;  2P8T A;  1F5T A;  3I53 A;  1E17 A;  2B0L A;  4U88 A;  4P5O A;  2CSO A;  2GXB A;  1RIO H;  3ZN0 A;  4OIN F;  4PGH A;  5CVV A;  5HS7 A;  3GYH X;  4BH9 A;  4HDU A;  1OYI A;  1O3S A;  3M8E A;  3GZ6 A;  2R7D A;  5E8G A;  5ED4 A;  4CGZ A;  1ZHF A;  1U5T C;  3TKY A;  4ON0 A;  3CUQ A;  2G9W A;  1VTN C;  4HX4 A;  3G73 A;  3G3Z A;  3REO A;  3IRR A;  4IXA A;  1I1G A;  4ASN A;  4G6D A;  4LMY A;  4KN7 X;  4AIH A;  1SMY F;  4U0Y A;  1JHF A;  3BPV A;  1PDN C;  3LAJ A;  2HYG D;  1XGN A;  3CLO A;  4XBF A;  4AIK A;  4A6E A;  3JW4 A;  1U5T A;  3LA7 A;  3J80 Z;  3NRV A;  4S05 A;  3F8C A;  2VBX A;  3B73 A;  3LQR A;  1BI0 A;  1R1U A;  4BHB A;  3GZ5 A;  4KT5 C;  5LLQ A;  2WV0 A;  3KP3 A;  2QBY B;  1IW7 F;  2FNP A;  1JGS A;  2IJL A;  2IT0 A;  4FHT A;  3COA C;  2JPB A;  3Q9V A;  5CVI A;  5H6R A;  5HDK A;  2EV0 A;  2MBF A;  3DQV C;  2VBZ A;  1R23 A;  3HIF A;  2FBI A;  3VEP A;  1H9G A;  5BQT A;  3RYP A;  5FD6 A;  4A2U A;  1FNN A;  3I71 A;  4JBA A;  5JI6 A;  4GGG A;  4GYG A;  2HZT A;  4LB5 A;  5HS8 A;  4ESB A;  4ENK A;  4D0P A;  3I59 A;  1MDM A;  3GLX A;  3QU3 A;  1YYV A;  2EFN A;  3K69 A;  1D5V A;  3T8R A;  5LEK A;  5K5O A;  4Q47 A;  5HLI A;  2XRN A;  3K2Z A;  4N9H A;  3SZP A;  4U7B A;  1ONV A;  4N9I A;  4CIC A;  3VB2 A;  2DPU A;  3W6K B;  1P4A A;  3DKW A;  1EH8 A;  1BC7 C;  5DYM A;  2O03 A;  2YPR A;  5KK1 A;  2YX7 A;  1FYK A;  1F1Z A;  5CVR A;  4JQF A;  3CUQ C;  2VOD A;  3O3K A;  2DBB A;  2EA2 A;  4CYD A;  5HS9 A;  2IW5 A;  1SMT A;  4XLN F;  3CDH A;  4RB3 C;  3EYI A;  4RAY A;  1USS A;  4OIP F;  1ZGA A;  1HXD A;  2FXA A;  3C7J A;  5FB2 A;  1Y0U A;  3MQ0 A;  3WGG A;  1J5Y A;  3P7N A;  3L09 A;  2CO5 A;  1B9M A;  2HYF A;  2ZNY A;  4XRF A;  3HSE A;  3F6V A;  2H6C A;  1FSE A;  3PFI A;  2O61 A;  3E97 A;  2JZY A;  2RKH A;  3QPT A;  5TJJ A;  3TGN A;  4WK8 F;  4U7D A;  2STT A;  1QPM A;  4HV6 A;  2FE3 A;  2V79 A;  5L3C A;  3K1M A;  3ZMD A;  1XMA A;  4AVP A;  5IT9 Z;  4I01 A;  2PLY A;  3KET A;  3ABT A;  2Y75 A;  3SFZ A;  3E6M A;  3K1P A;  3DP7 A;  1FLI A;  4M74 A;  4NB5 A;  2K4B A;  1J7K A;  1DDN A;  2EV6 A;  2MH2 A;  4YFK F;  3KEQ A;  1YW9 A;  1IRF A;  4KUM A;  4MTD A;  1XMK A;  2FNA A;  1YIO A;  2L3D A;  1R1V A;  2D45 A;  3N97 A;  4KFC A;  2GQQ A;  4M72 A;  2OAZ A;  4GO1 A;  3FMR A;  2JPC A;  4HF0 A;  3IHU A;  3WGI A;  5AON A;  3J81 Z;  1S29 A;  4DNC A;  2FRH A;  2DFI A;  3BRO A;  2AXL A;  2F5D A;  2O0Y A;  2XAH A;  4MNU A;  5F1R A;  2DTR A;  1W7P D;  2LDU A;  1G3T A;  5H20 A;  2F2E A;  5EEG A;  3P9C A;  2HS5 A;  1YS6 A;  3SHF A;  5HOO A;  1W5T A;  4FT8 A;  1IXR C;  3RKX A;  4HOB A;  4EMS A;  4ZYH A;  3V8J A;  1RZ4 A;  5HVQ C;  3I5U A;  4BHC A;  3F8M A;  1FPQ A;  1DPU A;  1ZG1 A;  4IVN A;  3FMS A;  2Z5U A;  4KDP A;  3U1D A;  1IXC A;  1KYZ A;  1ZRF A;  2CWE A;  3ELK A;  3KP2 A;  5LEJ A;  1Z6T A;  5ILS A;  4H0E A;  5LGN A;  1J9I A;  3DFG A;  2PBI A;  1YTY A;  4BAY A;  2HR3 A;  4LGW A;  4WX9 A;  3EQL F;  2OQG A;  4LLL A;  4IF4 A;  3LQQ A;  2XRO A;  4A0Z A;  4E70 A;  1TBX A;  3T8T A;  1CF7 A;  1FBU A;  2DLL A;  3K9T A;  3T1B A;  1SAX A;  3ABU A;  1QQI A;  2ZFW A;  2H6B A;  2DQL A;  2V9V A;  4EJO A;  5J8C A;  2Q8K A;  4ETS A;  2KIF A;  2YSR A;  1XB4 A;  1D8K A;  1B9N A;  1G4D A;  2ELH A;  2JT1 A;  4N0B A;  5CVU A;  5CJ9 A;  2C6Y A;  4EM0 B;  2QVO A;  3VOD A;  1KA8 A;  2P6S A;  4MQV A;  3BDD A;  4HAM A;  2RVC A;  4HA8 A;  3M9A A;  3ZMU A;  4CHU A;  1V4R A;  5D5V B;  1RI7 A;  3OV8 A;  4L9J A;  2P5V A;  2RV8 A;  3WTV C;  4R8H A;  1BI1 A;  4MGR A;  4I98 B;  2XKP A;  3R6S A;  1NHA A;  2XKO A;  1P4W A;  4G9Y A;  2IA0 A;  4HQM A;  2K27 A;  1ZRC A;  3WU1 B;  2OA4 A;  2EFQ A;  3GVA A;  5JHU A;  4WWC A;  2Z33 A;  3RI4 A;  1Z7U A;  2XAS A;  3FXQ A;  1ZRE A;  4EM2 A;  3WTX C;  3ISP A;  2QBY A;  4RGR A;  1ZLK A;  2BYV E;  5L3D A;  3N4M A;  2FA5 A;  1HKT A;  2M30 A;  3CO7 C;  3HRT A;  3L00 A;  2A69 F;  5KVR A;  3V7C A;  4L9N A;  2PMH A;  4L9T A;  4M6Y A;  1ZG3 A;  1SD4 A;  1FBS A;  1STZ A;  3L9F A;  2ESN A;  1K78 A;  3KP7 A;  4EGZ A;  3ZMV A;  1IXS B;  2VC1 A;  3F21 A;  3H92 A;  1BJA A;  5L3F A;  1LDK B;  1FZP B;  1TW2 A;  3ZPL A;  3GXO A;  3I54 A;  2EV5 A;  4M6X A;  1HKS A;  1GVJ A;  3MZH A;  5E8I A;  4OOI A;  3FHZ A;  2L4M A;  3TDZ C;  3GEZ A;  4M9Z A;  3T0Y A;  2RN7 A;  1PP8 F;  3JSO A;  1T0F A;  2V1D A;  3CJN A;  2VC0 A;  1FOK A;  2MA3 A;  4RS8 A;  4LFU A;  2Y0M A;  3R61 A;  1UHW A;  3T5X A;  3QAH A;  5FLX Z;  3CTA A;  2Q2E A;  2HKX A;  1Z6R A;  1KQ8 A;  3MZY A;  5HLG A;  1KGS A;  3ZP5 A;  4I0A A;  1OPC A;  1BC8 C;  2QYO A;  2RGV A;  5LRS A;  4ENJ A;  1SD6 A;  4KNY A;  1WWX A;  2YX4 A;  5AIQ A;  5JFR A;  1B4A A;  1J2X A;  1U6G A;  2DT5 A;  3RTR A;  4WXC A;  3HYI A;  4IJA A;  1O3T A;  1LNW A;  2DAO A;  4XSX F;  4KIB A;  1Z1D A;  1XSV A;  1J75 A;  2QWW A;  2Q0O A;  1QNT A;  3ERE D;  2ZME A;  4I7H A;  2M8E A;  2UXN A;  5D5U B;  4ENM A;  1XDS A;  3WTS C;  4A6D A;  5D6E A;  2AS5 F;  2MLK A;  2XHK A;  2COM A;  4KMU X;  4RB0 A;  1R58 A;  1V3F A;  1S7A A;  5LHI A;  5JR3 A;  4YFX F;  4QWQ A;  1ULY A;  2W85 A;  2P7C B;  3I4P A;  5D8L B;  4YG2 F;  2X4H A;  1WI9 A;  1FC3 A;  2HKO A;  4IHT A;  3WTU C;  3GFM A;  2QQ9 A;  1FX7 A;  4ZYG A;  1U3E M;  3KFW X;  1UST A;  3CUQ B;  4GXO A;  2V6C A;  3RPU A;  4KN4 X;  4EM1 A;  4XLP F;  5J8F A;  5CLS A;  1YO5 C;  1FP2 A;  1QBJ A;  3P9I A;  1UFM A;  2F5C A;  4TV7 A;  1W7P B;  5FFZ A;  4IRI A;  3GFI A;  3DPT A;  3LWF A;  1OYW A;  2CW0 F;  3OOP A;  4P9F A;  2MC3 A;  2VXZ A;  2P5L C;  2YR2 A;  1Q1H A;  5LRR A;  1KYW A;  1O7F A;  1FYL A;  1FWZ A;  2BEO A;  2R7F A;  1YQA A;  2A6H F;  5BPI A;  2XUB A;  1DUX C;  1FT9 A;  3KZZ A;  3MEX A;  4A0X A;  1S3J A;  3KEO A;  1XGM A;  1UHM A;  1QGP A;  4L9V A;  2RC4 A;  3C1D A;  2BV6 A;  2IP2 A;  3E6C C;  1O3R A;  4LLN A;  2J5P A;  4ZZL A;  2PFB A;  3NEU A;  4EGY A;  2K86 A;  1RUN A;  3WG9 A;  2MH9 A;  5FLX K;  2KJB A;  4GYI A;  5JVT A;  2ZNZ A;  2M87 A;  4EQQ A;  3E5Q A;  2HTJ A;  5DUI A;  2DK8 A;  1MZB A;  5E18 F;  3HUG A;  1JHH A;  3HRU A;  4O5V A;  1KU7 A;  4R79 A;  1UCR A;  4LG0 A;  4B09 A;  1JE8 A;  3EUH A;  3FXR A;  3ZQ7 A;  1G3W A;  3HTS B;  3PQK A;  2EJR A;  1LVA A;  3RKY A;  2RDP A;  3BJ6 A;  3VFZ A;  3C18 A;  1YG2 A;  1WQ2 A;  2GIV A;  2FMY A;  2A68 F;  1ZGJ A;  3DV8 A;  4GCV A;  3J81 K;  2RQP A;  2DPD A;  1L0O C;  2VT2 A;  3HOS A;  3TOA A;  1CF7 B;  4Z2Y A;  3P9K A;  2GWR A;  4ESJ A;  2ESH A;  2BBY A;  3BPX A;  1XCB A;  2CQK A;  1O3Q A;  2XV4 S;  2M45 A;  5DCM A;  4LG0 B;  3F72 A;  1XN7 A;  4HDV A;  2GZW A;  1KU2 A;  3DEU A;  4UVA A;  4YIF A;  2STW A;  1D8J A;  1D3Y A;  3IKT A;  5FO5 A;  5FGM A;  3BJA A;  1IAW A;  4Y17 A;  5IT3 A;  4G7Z F;  4I0B A;  1IN5 A;  1GHC A;  3DPL C;  3GX4 X;  1IN6 A;  4UVC A;  3EDP A;  4UV9 A;  2A07 F;  2L02 A;  3LA2 A;  2JTV A;  1FY7 A;  4U0V A;  2KJC A;  2NRA C;  1AWC A;  3ZMS A;  3R4K A;  4G8X A;  4Y13 A;  3QP6 A;  4RB1 A;  4EJT A;  1XDU A;  2DW4 A;  4RGS A;  2WC2 A;  3FF5 A;  2E7W A;  2BE5 F;  4LD5 A;  2VN2 A;  5LGT A;  4LB6 B;  2M1B A;  3L7W A;  3TO9 A;  2PG4 A;  1SD5 A;  4OMY A;  4UUV A;  2V1U A;  2P6T A;  2DU9 A;  5LHG A;  3PQJ A;  3SQN A;  4BYY A;  6PAX A;  4L18 B;  2O6G E;  2FBH A;  5E1W A;  2FF4 A;  5F64 A;  1ZYR F;  2FOK A;  3WGH A;  2XAF A;  4ENN A;  3BZ6 A;  3E3V A;  2PMU A;  1FP1 D;  2R3S A;  1OKR A;  1DPR A;  2HGC A;  4LK0 F;  2LKP A;  3F3X A;  2QUF A;  2NAZ A;  1ZRD A;  1BOA A;  2FU4 A;  4AIJ A;  2OZ6 A;  4DQ2 A;  4PZJ A;  3ZMT A;  1K79 A;  2LF7 A;  3BP8 A;  2IPQ X;  1HKQ A;  3KP5 A;  1P92 A;  1OYY A;  5L3E A;  4L0Y B;  1R5G A;  4ZYD A;  1QZZ A;  2Z3Y A;  1DP7 P;  2FQ3 A;  3F22 A;  3BOQ A;  2EB7 A;  3KE2 A;  2PI0 A;  2K7L A;  1LB2 A;  1J59 A;  2QM3 A;  2HOE A;  4S04 A;  2FEZ A;  2UWM A;  1SD7 A;  4FX0 A;  1U8R A;  3ML6 A;  1YLF A;  3JSP A;  4WXH A;  1S6L A;  1ZN2 A;  5DDG A;  1XD7 A;  3ROU A;  2HTS A;  4L0Z B;  2HFH A;  2OQR A;  1R22 A;  1P2F A;  5A2Q K;  4PCQ A;  2Y48 A;  4UNO A;  2QQA A;  5ILU A;  5D4R A;  2XGX A;  5CYV A;  4YII A;  4EJU A;  2FBK A;  4YFN F;  4G6Q A;  5L3G A;  5ILV A;  3H3U A;  3WU0 A;  5LHH A;  1H9T A;  2GA2 A;  1F9N A;  1SFU A;  2UZK A;  4WF2 A;  3HHG A;  4HX8 A;  5TRD A;  1R5H A;  2DQR A;  2A5Y B;  1MKM A;  1IF1 A;  5K5R A;  4MQ9 F;  2K02 A;  1Z91 A;  2ZJ2 A;  4OMZ A;  1B1B A;  2HDC A;  3TDU C;  4ESF A;  2O8X A;  4EVI A;  2P7V B;  4EV0 A;  1MJ9 A;  3RIR A;  4XSZ F;  3EYY A;  3HTU A;  2QZ8 A;  2HEO A;  2L54 A;  4Q5S F;  3I0T A;  1T98 A;  1WRJ A;  5K1Y A;  1X3U A;  1ODD A;  2WTE A;  1REP C;  2E1C A;  3BY6 A;  2IVM A;  3E5X A;  2HQR A;  5BOX A;  1BN5 A;  1KU9 A;  5LBQ A;  2F5F A;  3KLN A;  4KA4 A;  3M7G A;  1XSX A;  4M71 A;  1LEA A;  2ZO4 A;  4K2E A;  3VOE A;  3HSR A;  1BI3 A;  1H0M A;  1A04 A;  4IPA A;  3BJO A;  3GF2 A;  1T39 A;  1MJA A;  4ZYE A;  5DV5 A;  1ZG5 A;  2IA2 A;  3WTY C;  5FFX A;  4NQW A;  2PEX A;  4ZH4 F;  4HLY A;  1PUE E;  2ZXJ A;  2FSW A;  1HSJ A;  2L4A A;  4LLG F;  4NHJ A;  3GO5 A;  1C0W A;  2OZU A;  1TQP A;  1B59 A;  1TQM A;  2H27 A;  4G94 A;  3QPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...