5IT9K

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
96
structure length
96
Chain Sequence
MLIPKEDRKKIYQHLFQEGVLVAKKDFNQPKHEEIDTKNLFVIKALQSLTSKGFVKTQFSWQYYYYTLTEEGVVYLREYLNLPEHIFPATYLAGQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords Ribosomal protein uS2
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
total genus 21
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF03501 S10_plectin Plectin/S10 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5it9K00
5HS7A 1OR7A 3CUQB 1K6OA 1KGSA 2VC0A 2FBIA 3I53A 3ZMTA 2O03A 3CLOA 3D0SA 1FLIA 5JR3A 3F22A 1IN7A 3NQOA 2MLGA 3SQNA 3I0TA 3IC7A 3LAPA 2CQKA 4CGZA 2VODA 1XDSA 1FBSA 2D45A 2Z33A 5HS8A 2K4JA 4LB6B 1PUEE 3I64A 1J2XA 1G3YA 1IRGA 4ENNA 4N9HA 3EETA 1MDMB 2KJCA 4WCGA 1QZZA 3D5LA 3IHUA 1ZARA 3VEPA 2MH2A 3C18A 2IP2A 1GHCA 2XAHA 5LRRA 4UHTA 1BC7C 4A5MA 1J75A 3WTWC 3V7SA 2FXAA 2HGCA 3NRVA 5CYVA 1DPUA 5FLXK 4A6EA 3WG9A 4Q48A 1P4WA 3MWMA 2MC3A 3OOPA 4P5OA 1EH7A 2J5PA 3DXJF 4HF2A 3C3WA 1RNLA 4G7HF 5TRDA 5TJJA 4S05A 2E1CA 1R23A 3KLNA 3KCCA 1CGPA 1JXSA 4IXAA 4L9JA 3FMRA 3ECOA 2O8XA 3VB2A 3K0LA 2XROA 3LA3A 1FC3A 1VTNC 3I5UA 2FBKA 1W7PA 1R36A 5HS9A 2ZKZA 4ZYDA 2IT0A 3V7CA 2L3DA 2GQQA 1FYLA 4Y17A 4MQ9F 3HRSA 2F5CA 3GX4X 2QZ8A 1HXDA 5D5VB 1FP1D 5LEKA 3ABUA 4MHGA 2GIVA 1KQ9A 2HS5A 3T5XA 5FLXZ 2DI3A 3EUHA 3LA7A 1ZH5A 1D8JA 1SMYF 4F7ZA 4BHCA 2OU2A 5J8FA 2RDPA 2ZNZA 1T0FA 2CFXA 1W5SA 4U7DA 4IRHA 3HUGA 3K1NA 1USTA 1S7OA 3M8EA 3FF5A 2EFNA 3GXOA 2AXLA 3DPTA 2LF7A 2YSRA 2X4HA 2A5YB 3GFJA 1O7LA 3V7RA 1W4MA 3QU6A 2XKPA 4YG2F 2F5FA 1TQIA 3WU1B 2HYFA 1XB4A 3L2CA 4HLXA 3R0AA 3SHFA 1IN8A 4CICA 2DPDA 4OINF 3BOQA 5A2QK 4HF1A 1P4AA 3PFIA 2VOPA 5J6XA 3I59A 2QBYB 3R0JA 4KT5C 1FYMA 4IRIA 3DP7A 1OYYA 3ZP5A 4L0ZB 5DCMA 1STZA 5D5XB 2EFWA 2QQBA 2V1XA 1I27A 4FT8A 4L0YB 5E17F 3F8CA 4UVBA 1F1ZA 2PI0A 1FWZA 3GVAA 4A0ZA 1DDNA 3I58A 5FFZA 5J8CA 3F72A 2Y48A 1FSEA 1ZN2A 3R6SA 1YO5C 2F5EA 2EFPA 2Z99A 5F64A 2LSOA 1QGPA 3WGIA 5LHIA 5DD8A 2Z3YA 1R00A 1EH8A 1T38A 2W25A 1JHFA 1HKQA 2EWNA 5L3DA 4OIPF 3DF8A 2YX7A 2G7HA 2GAUA 5ILUA 4G9YA 5A2QZ 1IZ1A 4BH9A 1BI2A 2FMYA 2ESHA 2TDXA 1YG2A 3P9CA 5BOXA 4EM0B 2DO7A 1KYZA 4KYWA 3GFMA 3GWZA 2ETHA 1RIOH 4LG0A 1ON2A 3VOEA 4A2UA 3RKWA 2ZBKA 4A0XA 3LFKA 2YR2A 3T8TA 3QOPA 1S6LA 2VT3A 2VE8A 2J5OA 4RGSA 4AIKA 3R61A 1E17A 1EH6A 3HHGA 3KEQA 4MNUA 5K1YA 2M8EA 2HQNA 4LLNA 1P2FA 5LHHA 1A04A 1OMIA 3T8RA 5E20A 1T6SA 5FGMA 4M74A 3GO5A 2ZMEB 1JHHA 1BI1A 4LB5A 5IT9K 4I7HA 2OD5A 2D1HA 3EDPA 3TOAA 1RUOA 4EJTA 2JPBA 4M72A 1LB2A 3H3UA 2KIFA 3HRTA 5LLQA 1B4AA 2JSCA 2QENA 4G6QA 1ZLJA 4HAMA 2XKOA 4L9TA 1P6RA 4S04A 3SZPA 1U5TA 2H27A 2C6YA 2LF8A 1ONVA 3ISPA 3HYIA 4RGUA 3J81K 4MTEA 3F8MA 3K2ZA 4UVAA 1O3SA 4LD5A 4HYEA 2P5LC 1HSTA 4CO8A 2O3FA 5HVQC 2EB7A 4EMSA 5LEJA 1BI0A 3G3ZA 5L3GA 4WX9A 1XSVA 1XGMA 1ZG3A 1S3JA 2PLYA 2G9WA 2L4MA 1R5HA 2EV6A 3KETA 5CVJA 3QP6A 2JRTA 4RGXA 3RKXA 4U0YA 5E1XA 3H3ZA 4G94A 3ROUA 1PP7U 3EYIA 1BOAA 1WI9A 3TO6A 5CVRA 2EV0A 1LEAA 1SD4A 2VE9A 1J59A 1O3RA 3M7GA 3ERED 1AWCA 1R5GA 5LHGA 1FY7A 3T0YA 1FX7A 2DW4A 1ZHFA 5ICEA 5ED4A 4HDVA 1L3LA 1BI3A 3QPHA 2RV8A 3JAMK 4Q4ZF 1YS7A 3O3KA 4M9SA 3J81Z 2P5KA 2L4AA 4I2OA 5D5UB 1Y0UA 4M6XA 1R1UA 4MEYF 1YYVA 4Q5SF 4OIQF 3CDHA 3RTRA 5BPIA 3DFGA 1XSDA 1KU2A 5CVUA 2KKOA 1MGTA 1TQPA 2JPCA 5JI6A 2O61A 4UUVA 1KYWA 3BJAA 2XV4S 3JTHA 4HV6A 5DCFA 2PG4A 2K27A 2F5DA 4H0EA 1EV7A 4G7ZF 1ULYA 5IT3A 5F6FA 2PQ8A 3J80K 3U2RA 3FX3A 2WV0A 5DD4A 1I1SA 4WWCA 1CF7B 3COAC 4ENJA 4HX4A 4KIFA 1MKMA 4Q47A 3TO7A 5HDKA 3BP8A 4IRGA 3ZMVA 5D5WB 5BPDA 2EJRA 1ZG1A 4OIRF 2IA0A 3L00A 3JAMZ 2EA4A 3HTUA 2P6SA 3LAJA 1F4KA 3VFZA 4KN7X 2L01A 5L3EA 1XCBA 3E5XA 4KIBA 1IXRC 2IW5A 3R60A 3HIFA 2HQRA 2M1BA 5AIQA 1TTYA 3V8LA 4DQ2A 3RYPA 5HDGA 4PZJA 4Z2YA 2EK5A 2FRHA 2FBHA 1UHWA 4OIOF 1IXSB 1SD6A 2X0LA 2A3SA 3ECHA 4L5JA 3HHHA 1USSA 3TO9A 4I01A 3KP5A 2WTEA 2HTJA 1L0OC 3QAHA 4Y13A 3IL2A 3F6OA 2XIGA 2M30A 3DKWA 3RPQA 4EJUA 4BHPA 5D6FA 2KJBA 1HQCA 1G3SA 1ZRFA 1UB9A 1D5VA 3G73A 4L5IA 3ZMDA 2MBFA 3MCZA 1O57A 3E6CC 1XGNA 3ZMSA 3U1DA 1H9TA 4XBFA 2H94A 4M9ZA 4YFXF 2XGXA 1U6GA 2H09A 2EA2A 2XUBA 1Q1HA 1SFXA 2NYXA 3E3VA 1FZPB 4IJAA 4RB1A 3LSTA 2ZXJA 2KRFA 4HA8A 3CO7C 1XSXA 3RJPA 1R22A 2XASA 1UFMA 3BROA 2OQGA 3SFZA 5CVVA 1ODDA 5F1RA 1W7PD 1PDNC 4PCQA 4GYIA 1K78B 4HW0A 2B0LA 2Y0MA 4KIGA 4OU0A 1DUXC 3QU3A 2QQ9A 3E5QA 2H6CA 1FNNA 2KIUA 2OA4A 2RKHA 3FMSA 3ZQ7A 1RUNA 5AONA 4KA4A 2DFIA 2LKPA 1YW9A 4PDKA 5KK1A 3GZ5A 3FM5A 4I0BA 5DUIA 4BHBA 2OZ6A 1J0RA 4CYDA 3JW4A 4U0WA 1OKRA 3ZN1A 4AVPA 2QM3A 4RB3C 1K7AA 2A6HF 3BPVA 4UNOA 2HKXA 2Z5UA 1IN4A 1HSJA 3GUDA 5DYMA 4UV8A 5FO5A 4HF0A 4I02A 2PMUA 2XAGA 4B8XA 5CJ9A 2QLZA 5ILVA 1FBQA 1RI7A 5K5OA 5CVIA 3KP7A 3GFIA 5E8IA 2ZCWA 1DP7P 4GCVA 4LGWA 3TKYA 4WXDA 2W24A 4JK1X 4ENKA 3LQQA 3AAFA 4LJZF 4IHSA 4KN4X 2XHKA 1U78A 2CGPA 2DLLA 2PFBA 4HX8A 1X3UA 1KQ8A 4EVIA 3WTUC 2F2EA 1ZGAA 2FNAA 4I98B 1R1TA 3V8JA 5DUKA 3M9AA 2LNBA 3JTGA 3Q5FA 2DBBA 4AD9A 5CLSA 1Z6RA 4ZYEA 2M45A 2FU4A 3ULQB 2MD5A 1O3TA 1WSUA 3KZZA 2R3SA 2P5VA 1TNSA 1R1VA 4KICA 2HWVA 1FSHA 3RDIA 3QRFF 3KP2A 1BIAA 3MQ0A 1W7PB 5K5QA 2VT2A 3V4GA 5HLGA 1ZG5A 4EM1A 1YLFA 2JZYA 4HQEA 2UXNA 3ML6A 2OBPA 3RYRA 4UVCA 1I5ZA 1LNWA 4KFCA 3IKTA 5EEGA 2PN6A 3BPXA 3HTSB 1LDDA 5EEHA 3FXRA 2CO5A 3WE2A 1Z9CA 5LBQA 1G6NA 1QZYA 3IRRA 5DDGA 5D8LB 1D3YA 4YIFA 1SFEA 3JSPA 4IVNA 3LA2A 3M1EA 2K02A 2STWA 1J9IA 1LEBA 3GFLA 3FM3A 2DQLA 4M71A 2GA1A 2P8TA 2ZJ2A 3E6MA 1MD0A 5H6RA 2ISYA 1KA8A 2GXBA 5ICCA 1FT9A 2O6GE 1LVAA 3LQRA 4OOIA 2FA5A 2P4WA 4M73A 1GXPA 1B9NA 1TLHB 2BV6A 1OPCA 1I1GA 1B59A 2W57A 4EJOA 3F23A 2EFQA 3ABTA 4HQMA 1T98A 1SAXA 1HBXG 4BQAA 4EGYA 3HSEA 2IA1A 2FF4A 4UXNA 3KLOA 4RGRA 2OQRA 2BGCA 3WGHA 2M5WA 2NNYA 4L9VA 1QO0D 2P7CB 4EJWA 2QWWA 2STTA 2VC1A 1KU3A 4JQFA 5BMZA 1TW2A 1FBUA 4R1HA 1AOYA 2GZWA 3CUQA 1JGSA 5DCMB 2ZNYA 1F5TA 2E7XA 4U7BA 3CJNA 2Z9OA 1IN6A 1YQAA 4FX0A 5JHUA 4HOBA 1B6AA 1HW5A 4ON0A 5ILSA 4P55A 1J5YA 1SD7A 2JTVA 4XLNF 2MH9A 3E6BA 1XGSA 2Q2EA 4KMUX 3REOA 4AIJA 1HW1A 3B02A 1ZRDA 3CTAA 2GA2A 3T1BA 1BIBA 3MEXA 4BAYA 2RNJA 5IT9Z 3P9IA 5KVRA 1F9NA 2FOKA 1IN5A 2HFHA 2FMLA 2VN2A 1LDKB 1WKMA 4ZZDA 2A07F 1MDMA 2HZTA 4O3MA 3K1PA 4L9NA 1ON1A 1UHMA 1OYWA 2R7FA 3FMQA 4MTDA 2QQAA 2VBWA 4B09A 2BE5F 3FXUA 2UZKA 2CW0F 3HRUA 1XMKA 1WQ2A 1U5TC 2XAFA 2WWYA 2XRNA 4HV5A 4M9XA 2O0YA 1DPRA 1ZRCA 4I09A 2CG4A 2QUFA 3P9KA 4P96A 1WWXA 3E6DA 4LG0B 3C1DA 4ETSA 3PQJA 5DV5A 3KE2A 3J7AO 3BJ6A 3JSOA 4EV0A 2GXGA 2QYOA 3MAJA 1ZREA 3V8KA 2RC4A 3L09A 2V9VA 2W84A 3E5UA 3DQVC 2BBYA 3ELKA 2K7LA 1YTYA 1GVJA 5E1WA 4U88A 1K79A 5HLHA 4HZFA 4CXFA 4P9UA 1BC8C 2RN7A 3CUOA 4LLLA 4JBAA 2QVOA 3U9GA 3P7NA 3BY6A 2D1VA 1LDJA 1U5TB 2UXXA 4QLCU 2RGVA 5D4RA 2Q8KA 3I4PA 4R79A 4KMFA 3RKYA 3N97A 1H9GA 5AIPA 1XN7A 2VXZA 2HEOA 3BDDA 2COMA 4BNCA 3FZVA 4AIHA 2PMHA 3M8FA 3S2WA 2FNPA 4LMYA 3KP4A 3GF2A 1Z91A 2ESNA 5ICFA 3NEUA 1BN5A 1FYKA 1KQ0A 2KIMA 3SZTA 4ZZLA 3WE3A 3WGGA 3QPTA 3J80Z 1O3QA 4G8XA 1I6XA 2PBIA 2VBXA 1G3WA 2HKOA 3TDZC 4GO1A 2VBZA 4YFNF 6PAXA 2XAJA 4EGZA 2HDCA 3BWGA 4EQQA 2G7UA 1C0WA 2QBYA 3RPUA 4NHJA 2IPQX 3O6BB 2YX4A 4K2EA 1IUYA 4OMYA 1S8NA 3HSRA 5FB2A 2OAZA 5D8KB 1LJ9A 1J7KA 2HTSA 2DK5A 1SFUA 2DTRA 3IKVA 4D0PA 5E18F 4PGHA 2HYGD 1Z6TA 1QPMA 1XDUA 1UCRA 3DEUA 1YW8A 1XMAA 3MZYA 1P92A 1QNTA 4A12A 4XSXF 1XCVA 4CDGA 2DQRA 3F8FA 3I71A 1U2WA 2V6CA 3I54A 2NS0A 4P9FA 4YFKF 4IF4A 1IXCA 3FHZA 3WTSC 2R7DA 1YW7A 1Z7UA 2PEXA 2WC2A 1U3EM 1TW3A 4RS8A 4R8HA 3F3XA 4XSZF 1D8KA 2DT5A 3GYHX 1S7AA 4WF2A 4UV9A 3F6VA 4LK1F 3FXQA 2YU3A 1GXQA 3L7WA 2IVMA 2GWRA 4GXOA 4BXUA 3WTTC 3WODF 1QBJA 2EFOA 1O7FA 3KP3A 4KNYA 5JVTA 3BJOA 1IW7F 3HSFA 1IF1A 2V1DA 3EQLF 2A69F 2CYYA 2ZMEA 3E97A 1YIOA 2Q0OA 5FFXA 1T39A 3HOTA 4GGGA 3K69A 4A5NA 5BS6A 3VODA 3BZ6A 2K86A 2P6TA 2MLKA 2A68F 2ZFWA 3Q9VA 2XVCA 5L3BA 1Z1DA 4ZH4F 1XGOA 4NB5A 3QP5A 2FEZA 4YIIA 4Y15A 1Z05A 5D6EA 2K4BA 4NQWA 3TDUC 3MFKA 4XRFA 4OMZA 2DAOA 1HKSA 1ZGJA 1ZYRF 3F21A 1MJAA 4HLYA 3MZHA 5LRSA 3L9FA 2MA3A 4I0AA 3OV8A 3F8BA 2VBYA 1S29A 2RVCA 1B1BA 1U8RA 5LGNA 1OYIA 1YFHA 2V1UA 4LFUA 1WRJA 1MJ9A 4U0VA 3IWZA 2HR3A 5HLIA 4RAZA 3KZYA 5K5RA 5LGTA 1ZAOA 2EV5A 4ZYGA 3HOSA 1PP8F 2BEOA 2D2WA 2UWMA 5H20A 2ZO4A 2HOEA 3GW2A 4XLPF 1HKTA 2IRFG 3DPLC 4N9IA 3EYYA 3DV8A 3W6JB 4HBLA 4MGRA 4GYGA 3Q9SA 2FSWA 2AS5F 4RB0A 1TBXA 1FPQA 2DU9A 4FX4A 4IHTA 1KU9A 3KP6A 1FP2A 4MQVA 4DNCA 4E70A 3H92A 3K1MA 3WTZA 3SXYA 2M87A 4G6DA 3KFWX 5DEQA 3RI4A 2H6BA 3FWEA 2A6EF 3LWFA 2VOOA 2YPRA 3HRMA 5D4SA 3TQNA 1T2KA 1CF7A 2ISZA 4ZYHA 1ZLKA 3ZMZA 1E2XA 2ACJA 2DPUA 5HDNA 3ZN0A 4ESJA 1SD5A 1XD7A 3GLXA 3I59B 1TQMA 2NRAC 1MJBA 1IAWA 2L54A 3WTXC 4IPAA 3F8NA 2E7WA 2V79A 5FD6A 3W6KB 3IRQA 1V3FA 3ZMUA 1TNTA 2CSOA 4KUMA 1B9MA 4RB2C 2DK8A 1QQIA 1BM9A 2ELHA 3C7JA 5ERIA 4EJVA 2OZUA 3ZPLA 4MEXF 4G7OF 4O5VA 1KU7A 5ICGA 3N4MA 4BYYA 2RQPA 3O2PE 2Y75A 2E1NA 3IWFA 5L3CA 3TOBA 4L18B 4WXCA 3GEZA 1BBYA 4CHUA 1H0MA 4WXHA 1V4RA 5H6QA 1IRFA 2IJLA 3WU0A 2XAQA 4ENMA 1G3TA 2NAZA 4A6DA 4ESFA 4O6JA 5E8GA 4A0YA 4HX7A 1W5TA 2W85A 3KEOA 1JE8A 5L3FA 3WTVC 2CWEA 4FHTA 4M6YA 4LLGF 2LDUA 3B73A 5E1ZB 3WTYC 2L02A 4RAYA 2ADUA 1RZ4A 3CUQC 4ASNA 4CZZA 1FOKA 1R7JA 4AWXB 3CO6C 1NHAA 1P4XA 1YS6A 4TV7A 2FE3A 1R58A 1G4DA 2VONA 1BJAA 5BQTA 2P7VB 4WK8F 4KDPA 3PQKA 2NNNA 4HDUA 1SMTA 4EM2A 3RIRA 2BYVE 2FQ3A 2IA2A 1MZBA 1K78A 2JT1A 1HW2A 5JFRA 5LGUA 1REPC 3TGNA 5HOOA 2PJPA 2A61A 4PGGA 3K9TA 4LK0F 1LQ1A 4ESBA 5FD5A 4QWQA 3R4KA 3GZ6A 4N0BA
chains in the Genus database with same CATH superfamily
3W2WA 5HS7A 1OR7A 1ERDA 5JVGF 3CUQB 1T56A 3VSKA 4E7ZA 1K6OA 1KGSA 2VC0A 2CU7A 2FBIA 4B4CA 3RQ4A 3I53A 3ZMTA 1VQ9I 2BY1A 2L7ZA 2O03A 1X3WB 1SAUA 3CLOA 1ZKGA 3D0SA 3OMYA 2CV0A 1FOWA 1FLIA 5IY5H 4PK4A 4BS9A 4FASD 5JR3A 3F22A 1IN7A 3NQOA 2ICWG 3FXLA 2EZKA 2MLGA 3SQNA 2Q2EB 3I0TA 2DA2A 3N05A 4J01A 3IC7A 3W2VA 3LAPA 4ANJA 2CQKA 2EIMH 2MSYA 4CGZA 2VODA 1XDSA 1FBSA 3S32A 2D45A 2Z33A 4BL0B 3FK7A 5HS8A 2R7WA 2K4JA 4AUXA 4LB6B 4AVZA 2JVGA 2EINH 3ABKH 1JUPA 1PUEE 4DGWB 2K3PA 2FJ1A 3I64A 1RRJA 1J2XA 2X6OA 1G3YA 1IRGA 4ENNA 3VWBA 4N9HA 3EETA 2CW7A 3B6CA 3TMOA 3JRIA 1MDMB 2KJCA 4WCGA 1QZZA 3CP8A 3D5LA 2WY8Q 3IHUA 3RPUD 1ZARA 3VEPA 2R5ZB 2MH2A 1T8IA 3C18A 1WJDA 2IP2A 3M3YJ 1GHCA 3JCUC 2H1LA 4B44A 2XAHA 1HDDC 3H9QA 5LRRA 4UHTA 1BC7C 4A5MA 1J75A 3DBHB 3WTWC 2B7EA 3HB9A 3V7SA 3TW7A 4XICA 2LY2A 2FXAA 2HGCA 3NRVA 2V6EA 2DYRH 3F9KA 4M6VA 5CYVA 3I55I 1DPUA 5FLXK 4A6EA 3WG9A 1MBEA 4Q48A 1P4WA 3MWMA 2MC3A 1D5YA 4JX6A 4IHYA 3OOPA 2AHQA 2NOGA 4P5OA 2F48A 3Q3SA 1EH7A 2J5PA 3DXJF 4HF2A 3S1RJ 3C3WA 1U0JA 2QF7A 2R5YA 2WY7Q 3ASOH 1RNLA 4YELA 4G7HF 4H4KC 3OY9A 5TRDA 2E5NA 3ZQIA 5TJJA 4KT6A 5IPAA 4S05A 2E1CA 1R23A 2ELKA 3KLNA 3KCCA 1CGPA 1JXSA 4IXAA 4L9JA 3FISA 5IP6A 3FMRA 1JT6A 3ECOA 1A31A 3DLAA 2O8XA 3VB2A 3CCMI 3K0LA 3OL3A 3ZCOA 5EGOB 5C4JJ 2XROA 2LFBA 1PUFB 3GTMJ 3SDBA 2CRGA 2JVHA 3PUFA 3LA3A 2EZLA 1FC3A 1K83J 4GRIA 5GAGJ 1VTNC 2UUZA 2R7UA 3I5UA 2FBKA 2WAEA 1W7PA 1R36A 5HS9A 2QEXI 1KONA 2ZKZA 4ZYDA 3VPRA 3OS0A 1ACIA 4DZJA 4RDUA 2XDVA 4BY7J 2KMUA 3GMEA 2IT0A 5K7HA 4ZDOA 3V7CA 4ZJZA 2L3DA 3M4OJ 2K5CA 1X1DA 1S9HA 2GQQA 2WAQN 4EEFG 1FYLA 2BY3A 4Y17A 4MQ9F 4E7LA 3HRSA 2F5CA 3GX4X 2LY1A 1V5EA 2HU9A 3FBNB 3FKIJ 2QZ8A 1HXDA 5D5VB 2W00A 4UUTA 1FP1D 1MMAA 5LEKA 3ABUA 4MHGA 1VQKI 1MBHA 3BR0A 2GIVA 4KJZA 3H5NA 4D7MA 1Z7LA 1KQ9A 1Y1WJ 1H89C 2HS5A 2V9PA 3T5XA 5FLXZ 3ZR8X 2DI3A 3EUHA 3CMEI 3I4NJ 1MSEC 3LA7A 1ZH5A 1D8JA 1SMYF 4F7ZA 4BHCA 2OU2A 5M5XJ 3PIOF 2VPRA 3LL7A 5J8FA 1MSFC 2RDPA 2IGNA 2ZNZA 3CCYA 2XGDA 3CMMA 5F0CA 1JUMA 2UV1A 1T0FA 2CFXA 3HOUJ 1W5SA 2DN0A 4U7DA 3BG5A 4IRHA 3HUGA 5EZHA 1TC3C 3OS2A 2JMWA 3K1NA 1USTA 1S7OA 3M8EA 3D5SC 1I50J 2M7BA 3FF5A 3FXMA 2EFNA 3GXOA 2AXLA 3DPTA 1EKEA 2LF7A 2YSRA 3FIWA 4FCYA 2X4HA 2A5YB 5E3OA 3GFJA 1O7LA 3V7RA 1W4MA 2CV2A 3L2WA 3QU6A 2XKPA 1B72A 4YG2F 2F5FA 1TQIA 3WU1B 2HYFA 1XB4A 3S1QJ 5EG0A 1H8AC 3L2CA 4HLXA 3R0AA 5FKOA 3SHFA 1IN8A 4CICA 2DPDA 1VNDA 4A3LJ 4OINF 3PNYA 2DA1A 2W1OA 5K7ZA 4UY8I 1ENHA 4E7HA 3K70D 2M0CA 3BOQA 4D1QA 5B3SH 5A2QK 4HF1A 1P4AA 3PFIA 3K6GA 3OIOA 1D0ZA 3O8GA 1SVLA 3ZQHA 5HODA 1Z21A 2VOPA 1GV2A 2L9RA 5J6XA 1WJFA 3I59A 2QBYB 2X1CA 3R0JA 4KT5C 1R9TJ 1I3AA 1PJRA 5LD2C 2VQLA 1OCTC 2KLOA 1FYMA 4IRIA 3HOZJ 2MFZA 1MNDA 3DP7A 1T33A 1OYYA 4V2FA 3ZP5A 3PM1A 2MG4A 2HXIA 2NS8A 4L0ZB 5IYDJ 5FKMA 5DCMA 4XKBA 1STZA 2GXAA 3JRFA 1VI0A 2W7NA 5D5XB 2EFWA 2QQBA 2V1XA 4E4HA 2ZXIA 1I27A 3MKZA 4FT8A 4L0YB 2HOAA 4E7KA 5E17F 4BE0A 3F8CA 4UVBA 1F1ZA 2PI0A 1SVMA 1FWZA 3GVAA 4A0ZA 1DDNA 2IGOA 3I58A 1IO2A 5FFZA 5J8CA 3SFIA 2ZJQF 3JRCA 3A02A 3F72A 1DGRM 3KIOA 2Y48A 1FSEA 3ESWB 4ITVA 1ZN2A 3R6SA 1YO5C 3HOYJ 2F5EA 2EFPA 2Z99A 5F64A 2LSOA 1OCOH 1JKRC 1QGPA 5C44J 3MVPA 1A35A 3WGIA 3AG3H 1E3PA 3MN2A 5LHIA 4Y3OA 5DD8A 3CCQI 2Z3YA 1R00A 2Y2ZA 5GP9A 1ZR4A 1EH8A 3S17J 4XRSG 1LPQA 1T38A 2W25A 1JHFA 2Y31A 1HKQA 2ZXHA 2M4KA 2EWNA 3LSJA 1GLNA 4B3AA 1GV5A 1HLVA 5L3DA 4OIPF 2O5RA 1ZELA 3DF8A 4BQNA 4J00A 2YX7A 2G7HA 2GAUA 5ILUA 2V1NA 3QODA 3PNVA 3S93A 4G9YA 2M2EA 5IP9J 5A2QZ 3F0CA 1IZ1A 4BH9A 1BI2A 2FMYA 2ESHA 2TDXA 1T95A 1YG2A 3RZOJ 2KZVA 3P9CA 5BOXA 3K70C 4EM0B 2DO7A 4HSRA 2ZB9A 1FJLA 2OTLI 1KYZA 1YX3A 4KYWA 5M5WJ 3GFMA 3GWZA 2ETHA 1OCPA 3KEYA 1RIOH 3GCMA 4RA2A 4LG0A 1ON2A 3VOEA 4A2UA 3DEEA 3RKWA 2ZBKA 3LFKA 2YR2A 4A0XA 3A0HC 3DCFA 1Z67A 3T8TA 3QOPA 1S6LA 2EIKH 2VLAA 2ECBA 3OYEA 2VT3A 2VE8A 3EPZA 2J5OA 4RGSA 4AIKA 3R61A 1VF9A 1MNEA 4HNVA 1E17A 2R7ZJ 1EH6A 3HHGA 5GAHJ 3KEQA 4MNUA 5K1YA 2M8EA 1KZHA 5J4VA 2MGQA 2HQNA 3GBGA 4LLNA 1Y6IA 1P2FA 1VQOI 5LHHA 1LFUP 1A04A 2ID6A 1OMIA 3T8RA 5E20A 2DT7B 3BTIA 1T6SA 5HLTA 5FGMA 2I10A 4M74A 3GO5A 2ZMEB 1JHHA 1BI1A 4LB5A 5IT9K 1ZGWA 3P5JA 5M3MJ 4I7HA 3KX2A 3ZOBA 2OD5A 2D1HA 3EDPA 3TOAA 4CCMA 1RUOA 4EJTA 2JPBA 4IQJA 2K9SA 4MFDA 4M72A 1LB2A 3H3UA 2KIFA 3HRTA 3NWTA 1NH3A 1XG1A 5LLQA 4N4OB 1B4AA 2JSCA 2QENA 4G6QA 1MBFA 3S1MJ 1ZLJA 4HAMA 2W48A 3BCAA 2B63J 2XKOA 4L9TA 1D1AA 1TZLA 1P6RA 3ZQFA 4S04A 3SZPA 3BG7A 1U5TA 2H27A 2C6YA 2LF8A 1ONVA 3ISPA 3HYIA 4RGUA 5EDNA 2KDOA 3J81K 4XR6A 2VQHA 4MTEA 2OCCH 4NQWB 3F8MA 3K2ZA 1YOVB 2D5VA 3IH2A 4UVAA 1O3SA 4A69C 1K6YA 3IP4B 4E7IA 4XOTA 4LD5A 4V19K 3BG6A 2HVRA 4HYEA 2JWTA 2VB6A 2GOXB 3VYTB 2P5LC 1HSTA 4CO8A 2O3FA 3RZDJ 1JKQC 5HVQC 1X19A 2EB7A 4EMSA 4A3DJ 2LRDA 5LEJA 1BI0A 2LKXA 3K4JA 3G3ZA 5L3GA 4WX9A 2G0EA 1FTZA 1XSVA 1VQ7I 2HPMA 1XGMA 2L7KA 1ZG3A 1ZTRA 1S3JA 4XKCA 2PLYA 1QVTA 2G9WA 2L4MA 3OWTA 3DKXA 1R5HA 2EV6A 3KETA 2NXNB 1DP3A 2K9MA 2X6YA 5CVJA 3QP6A 1WJBA 2AQEA 2JRTA 5JLXA 1X4OA 4XM3A 4RGXA 2B9SA 3RKXA 5J4YA 4U0YA 1RETA 5E1XA 4A93J 3H3ZA 4G94A 3ROUA 1PP7U 3GTJJ 1MBGA 3EYIA 1BOAA 1WI9A 3TO6A 2PX9A 5CVRA 5FRMA 2EV0A 4G6TB 3PSFA 1OQYA 3PO3J 3BG3A 2X1DA 4BUPA 1LEAA 1SD4A 3I9V2 2VE9A 1J59A 1O3RA 4Y33A 3QYBA 3M7GA 5CQGA 3ERED 2LD5A 4CCKA 1R5GA 5LHGA 1AWCA 2OV7A 1FY7A 3T0YA 1LE8B 1FX7A 2BXYA 2DW4A 5IOYA 1ZHFA 5ICEA 3GTQJ 5C4XJ 2MYSA 5ED4A 4HDVA 2RQQA 4DYRA 1BI3A 3QPHA 1L3LA 2RV8A 3BT9A 4XIDA 3JAMK 4Q4ZF 1IV8A 1YS7A 3O3KA 1LKXA 4M9SA 4B3XA 2DJNA 2P5KA 3J81Z 4RBOA 3ZXSA 4QTRA 3BR5A 3FBIB 2L4AA 4I2OA 2CW8A 5D5UB 1TL8A 1Y0UA 2DODA 4M6XA 1K61A 1R1UA 4BJTA 1D1BA 4F93B 4MEYF 2HQ5A 1YYVA 1UG0A 4NUBA 4Q5SF 4OIQF 3CDHA 4IL6C 3CDIA 1GUUA 3RTRA 5BPIA 3HGYA 3DFGA 3H9GA 4C3JJ 1XSDA 2O8KA 1KU2A 3BC8A 5CVUA 2M34A 2KKOA 1MGTA 1TQPA 3C2GA 3OSGA 2CFOA 2JPCA 1W0TA 5JI6A 2O61A 4UUVA 4X1EA 1KYWA 4P1WA 3BTCA 3BJAA 2XV4S 3OYIA 2HPIA 3JTHA 2ECCA 4HV6A 4M3EA 4DZPA 1JTXA 5DCFA 2PG4A 2M4GA 2VKHA 2DMQA 1RKTA 4HPQA 4U87A 4IKFA 2K27A 2F5DA 1X2MA 4H0EA 2DMUA 1EV7A 4G7ZF 1ETKA 1ULYA 5IT3A 5F6FA 1QZEA 2PQ8A 4DYCA 2E5ZA 3FK6A 2W82A 3J80K 3U2RA 2QA4I 3FX3A 2JRMA 2WV0A 5DD4A 4XN3A 2VASA 2QCOA 1I1SA 4XONA 1UAAA 4WWCA 3L1PA 1CF7B 3COAC 4XNFA 2KZGA 5E3LA 4KITB 1AKHA 4ENJA 4HX4A 2A5WA 4XORA 1NTCA 4KIFA 2VQGA 1MKMA 4Q47A 4FQGA 2HDDA 3TO7A 4B43A 5HDKA 3BP8A 1GVDA 4IRGA 3ZMVA 5D5WB 6PAXA 2MC4A 2VPLA 5BPDA 1WH7A 1IJWC 2EJRA 1ZG1A 1XX5A 2W4SA 3K10A 4OIRF 3WG7H 2RNGA 2IA0A 3L00A 4CCJA 3CF2A 2DA3A 2EA4A 3HTUA 2JJ7A 3JAMZ 3OSFA 2IS2A 3W2AA 2ZSIB 1VQMI 3DPUA 2P6SA 2LMDA 2ELJA 4C30A 3LAJA 1F4KA 3OYDA 1ZQ3P 3VFZA 4KN7X 1U9OA 1D1CA 3BZCA 1LFPA 3JR9A 2DCEA 2E71A 2L01A 3OR1C 5L3EA 1XCBA 5CKTA 3E5XA 1OISA 2M3AA 4KIBA 1IXRC 2JA8J 2IW5A 2CUEA 3R60A 2YS9A 3HIFA 2HQRA 2M1BA 5AIQA 1TTYA 4BEHA 1EJ9A 3V8LA 3DBLB 1TWFJ 4DQ2A 3LFUA 3RYPA 5HDGA 3BZKA 4BXFA 4UUSA 4PZJA 1B8IB 4D5CA 4Z2YA 2EK5A 2FRHA 2FBHA 4J19A 3PSIA 1UHWA 5KHDA 4JX4A 4OIOF 1IXSB 3I3LA 1SD6A 2NVXJ 2X0LA 2EPFA 3LSIA 2A3SA 3ECHA 2COBA 2L2OA 4L5JA 3HHHA 1USSA 4LIUA 3TO9A 3OIPA 4I01A 4YEJA 3KP5A 2WTEA 4UB8C 1AA7A 2HTJA 1AHDP 2OTJI 1L0OC 1R5ID 2AQFA 3QAHA 2VJ4A 4Y13A 3IL2A 3F6OA 3HXLA 2XIGA 1JJ6C 2M30A 3DKWA 3RPQA 3ABMH 1GDTA 2QSGX 4EJUA 4GDFA 4BHPA 3I4MJ 1A36A 3CDLA 5D6FA 2V9KA 4PJMA 1ETVA 3ZQQA 1YITI 5J47A 4YIRX 4RMNA 2KJBA 1HQCA 2DMNA 4RAFA 3GZNB 1G3SA 1ZRFA 1UB9A 1D5VA 2ME0A 5GAEJ 3K4MA 3G73A 3EUAA 4L5IA 3ZMDA 2MBFA 3MCZA 1O57A 3E6CC 1XGNA 3ZMSA 3U1DA 2ME6A 1H9TA 3H5AA 2KDZA 1UG2A 3S3OA 4XBFA 2H94A 4M9ZA 4YFXF 2XGXA 1U6GA 2H09A 2BXZA 2EA2A 2XUBA 3Q0UA 1OR7C 1Q1HA 1SFXA 2NYXA 5J1YA 4XL9A 1YI2I 3I56I 1TWCJ 3E3VA 1DGWY 1FZPB 4IEJA 4IJAA 2R7RA 1TT0A 4RB1A 3OYBA 3CC2I 3LSTA 1FOYA 3A4CA 4OWRB 1VZ0A 5FLVA 1IDZA 3A2KA 1JJ8C 2L9NA 2O7OA 2ZXJA 1I3QJ 1OCZH 2EBIA 2KRFA 3L2RA 4HA8A 3CO7C 1XSXA 2R92J 3RJPA 3QPLA 1R22A 1X4PA 2XASA 4I76A 1UFMA 3UNGC 2E60A 2PJRA 3B6AA 3BROA 2OQGA 1N78A 1X1PA 4PUSA 1ODDA 5CVVA 2QKMB 3SFZA 5F1RA 1W5CC 1W7PD 3GTKJ 1PDNC 4PCQA 3V42A 4GYIA 2XGEA 1BL0A 3CF5F 1K78B 4HW0A 2B0LA 2V7FA 2Y0MA 1P7IA 2LK2A 4KIGA 2AXTC 4OU0A 1JGGA 1DUXC 3E0JB 2EZIA 1WI3A 3QU3A 4BE1A 2QQ9A 3E5QA 2H6CA 3NAUA 1FNNA 3OYJA 2KIUA 2BW3B 2OA4A 3HL2A 2RKHA 1MH3A 3FMSA 3M07A 3ZQ7A 1VQLI 2Y0SA 1BR2A 1RUNA 3E7LA 1R71A 2JK3A 5AONA 4KA4A 2DFIA 2LKPA 1E0EA 5GTHC 2DYSH 1YW9A 4PDKA 3GTPJ 5KK1A 3GZ5A 3FM5A 3ERMA 4I0BA 2K3FA 5DUIA 4HNTA 4BHBA 3SJMA 4XRMA 2OZ6A 1J0RA 2K85A 2LREA 4PSXA 4CYDA 3JW4A 4U0WA 2KISA 1OKRA 1VQ6I 3ZN1A 4XLAA 4E7SA 1FEXA 3O8HA 2E1OA 4AVPA 2QM3A 4RB3C 2VKVA 5FKNA 1K7AA 2K9QA 4Y52J 2M8GX 2A6HF 2NVQJ 3BPVA 3WU2C 4UNOA 4X6AJ 2QQ8A 2HKXA 4G12A 2Z5UA 1IN4A 1HSJA 3GUDA 5DYMA 4UV8A 5FO5A 2WADA 4HF0A 4I02A 1XS9A 1JTYA 2PMUA 2XAGA 4B8XA 1PVEA 4AYBA 5CJ9A 2QLZA 3PFYA 5E79C 1IDYA 5ILVA 1FBQA 2QKLB 1Y56A 1RI7A 2VL8A 2L9SA 4RM3A 5K5OA 5CVIA 4HEA2 3KP7A 3GFIA 5E8IA 1A5JA 4ZC3A 2ZCWA 3OL4A 5DM7F 1DP7P 4GCVA 4LGWA 3TKYA 1MMGA 2W24A 4WXDA 3KYLA 3CCLI 4JK1X 2H8RA 4ENKA 3LQQA 3PJRA 4FE4A 4V2GA 3AAFA 1W1WE 1NG6A 2DOAA 5FROA 1ZK8A 4LJZF 4IHSA 3QPSA 4KN4X 3ZQGA 5F1JA 2XHKA 1X1AA 3CZ6A 4I99C 1U78A 3RSNA 1YRNA 2NOJB 2CGPA 2EIJH 2DLLA 2AO9A 2KHMA 2PFBA 3D1NI 4JOMA 4HX8A 3S2HJ 2JQ7A 4NDLA 1X3UA 1KQ8A 2IAIA 4C3HJ 1MBJA 5FKLA 3OYGA 4EVIA 2FD5A 3WTUC 2F2EA 1ZGAA 1LVKA 2FNAA 4I98B 1R1TA 3V8JA 1P9QC 3HZJA 3M9AA 5DUKA 5H2FC 3JRBA 2LNBA 1X2NA 3JTGA 1WJEA 3Q5FA 2DBBA 4Y7NJ 3MKYB 3IH4A 4AD9A 4IHWA 3VYRB 5CLSA 4D5FA 1Y1VJ 1SEUA 2KP6A 1Z6RA 5IYBJ 4ZYEA 5E3NA 3OYLA 3AG1H 1YJWI 1RC9A 2FU4A 2M45A 3WHCA 3ULQB 2MD5A 3MZ8A 1Q1VA 3ZQCA 1T0FC 1DU6A 3HPHA 4D7NA 2R5YB 1I6HJ 5FRNA 5FKKA 1O3TA 4BQQA 1WSUA 1MH4A 1SANA 2CQXA 5DS9A 2P0WA 2XSDC 4LIVA 3EUKL 3KZZA 3SEQA 3S14J 2LC2A 2P5VA 1TNSA 2R3SA 2EILH 1R1VA 4KICA 2HWVA 2ZJRF 2ZMEC 3SDGA 1FSHA 2XPVA 3RDIA 1J09A 4QIWN 3KP2A 3QRFF 1BIAA 3DTIA 5GPAA 3MQ0A 2GBYA 3HKZN 2QSHX 4NC7A 3L2QA 2Y30A 1W7PB 3DU5A 5K5QA 2VT2A 3V4GA 5HLGA 1ZG5A 4EM1A 1YLFA 2JZYA 4HQEA 1VQ4I 2BVLA 3IAS2 2UXNA 3ML6A 3QYEA 4E7JA 2OBPA 2XB0X 5B1AH 4W1UA 3RYRA 4UVCA 1Z3XA 1I5ZA 5JHFA 1LNWA 3S3NA 4CH7A 1O4XA 4KFCA 3IKTA 1EA3A 5EEGA 2PN6A 3BPXA 3HTSB 1QHHD 1LDDA 1DQUA 5EEHA 3FXRA 2CO5A 2E1MC 3WE2A 1Z9CA 5LBQA 2E35A 3LNQA 3RKQA 1G6NA 1LFBA 4CCOA 2CQ7A 1ZR2A 2NVYJ 2ZFUA 4RLFA 1QZYA 3A01A 3IRRA 1MIJA 2LY9A 5DDGA 1U9NA 5D8LB 1D3YA 1YHQI 4KISA 4YIFA 1SFEA 2XF5A 5B1BH 3JSPA 4IVNA 2Z2SB 4QPQA 3LA2A 3M1EA 1EF4A 2K02A 2STWA 1J9IA 1LEBA 1R4NB 3GFLA 3HUGB 2FQ4A 3FM3A 4ZTFA 2DQLA 4M71A 3AFHA 2GA1A 2P8TA 1VQ5I 2ZJ2A 3E6MA 1S5LC 1VQNI 2R7SA 1MD0A 5H6RA 2ISYA 5DTDA 1KA8A 2KIQA 4JYKA 3OYKA 4HNUA 2GXBA 2HDWA 5ICCA 3CJRB 2LLKA 1FT9A 2O6GE 2IXSA 2VUMJ 2LBFA 1LVAA 2KQRA 3LQRA 4OOIA 2FA5A 1ETOA 3VYSB 1B72B 1IRZA 3BR6A 2P4WA 4M73A 1GXPA 1B9NA 1TLHB 2BV6A 1OPCA 1WHUA 1POGA 1I1GA 1B59A 4BU2A 1GT0C 1WPKA 5EG0B 2OPTA 4HG2A 2W57A 4EJOA 3F23A 2ZSHB 2EFQA 2KT0A 3ABTA 4HQMA 1T98A 1SAXA 1HBXG 4F91B 4BQAA 1OCCH 4F52A 4EGYA 4BBRJ 3K2AA 3CCJI 3HSEA 4XOPA 2IA1A 2DFEA 2XGCA 2FF4A 4UXNA 4CYCA 3KLOA 4RGRA 1N25A 1HF0A 2OQRA 2BGCA 2IS1A 3WGHA 2M5WA 5C3EJ 4LOCA 1VFCA 2NNYA 4L9VA 1QO0D 1FIAA 2P7CB 4EJWA 1OLTA 3CCEI 2QWWA 2STTA 2VC1A 1KU3A 1XTAA 4JQFA 5IYCJ 5BMZA 1TW2A 1FBUA 1MBKA 4R1HA 2E1MB 1AOYA 1BOBA 2GZWA 3CUQA 1X58A 1JGSA 5DCMB 1MMSA 1OFCX 1UHSA 2ZNYA 1F5TA 3PNTA 2E7XA 4U7BA 3AKZA 3CC7I 3CJNA 2Z9OA 1XPXA 1IN6A 1YQAA 4FX0A 5JHUA 1E3OC 5B5EC 4HOBA 1IC8A 1B6AA 1HW5A 2VQCA 4ON0A 5ILSA 4P55A 1J5YA 1SD7A 2JTVA 4XLNF 2L9VA 4C2TA 2DTZA 2Y0SN 2MH9A 3E6BA 1XGSA 3RCOA 2Q2EA 4KMUX 1S7EA 3REOA 5GADJ 2WB1A 3CMYA 4AIJA 1HW1A 3B02A 1ZRDA 3CTAA 1WJ5A 2GA2A 3LSKA 3T1BA 3L2UA 1BIBA 2BY2A 1BR1A 3MEXA 5EYRA 4BAYA 2RNJA 2X6WA 1RPWA 2JA2A 5IT9Z 4L5EA 3P9IA 3SYTA 5KVRA 1F9NA 2FOKA 1IN5A 2PMZN 2HFHA 4IZZA 1F36A 4CCNA 2FMLA 2YUSA 2VN2A 1LDKB 1WKMA 2KL4A 4ZZDA 3J7YJ 1F43A 2A07F 1MDMA 4PSWA 1P7JA 2HZTA 4O3MA 3K1PA 1K4SA 4L9NA 1ON1A 2KPMA 1UHMA 1OYWA 2R7FA 4BJ5C 2R5ZA 3FMQA 4F3QA 4MTDA 2A05A 2QQAA 3C2HA 2VBWA 2ZJPF 4B09A 2BE5F 3FXUA 2UZKA 3CCVI 3SEZA 3ZQLA 2CW0F 3HRUA 1XMKA 2HNHA 3OS1A 1OCRH 1WQ2A 1XC5A 1U5TC 2XAFA 2XRNA 4HV5A 2WWYA 1TWHJ 4AYBN 5HNHA 4RM2A 4M9XA 2M7AA 3K4KA 2O0YA 2CV1A 1DPRA 1ZRCA 4B48A 4I09A 2CG4A 2BOLA 2QUFA 3P9KA 4P96A 1WWXA 3RQIA 2M0MA 1M1EB 2CQQA 3E6DA 4LG0B 3C1DA 4ETSA 2R4GA 1BW6A 4FTHA 3S3MA 3OYAA 2CQNA 3PQJA 5DV5A 4XQFA 3KE2A 3J7AO 3K7AJ 3BJ6A 2IGKA 2XPUA 3JSOA 4EV0A 2CH0A 4HSTA 4XRSA 2GXGA 2QYOA 3MAJA 2H8WA 1ZREA 2L5QA 3V8KA 2RC4A 4M3BA 4C2MJ 4HRIA 2CJJA 3OOUA 1BW5A 2I8DA 3L09A 2DDBA 2V9VA 2W84A 4BXXJ 3CD6I 1V5FA 5EGOA 3E5UA 3G1OA 1PUFA 3DQVC 2I5UA 2BBYA 3IV5A 3ELKA 2F4MB 2K7LA 3Q0WA 2F5VA 3G6EI 3NARA 4CUGA 5J1RA 1QA6A 5F0HA 3FXJA 1YTYA 1GVJA 4AIDA 1T08B 5E1WA 4U88A 4F55A 1K79A 5HLHA 4HZFA 3H36A 4CXFA 3OYNA 3W6VA 1IG7A 4P9UA 4DJAA 1BC8C 4GFBA 2K9NA 2RN7A 3BR3A 3QQAA 3CUOA 3ABLH 4LLLA 2ID3A 3DLLF 4JBAA 2QVOA 3U9GA 3P7NA 3PUBA 3BY6A 2VJIA 2LTPA 2E2IJ 2D1VA 4IO9F 1RR7A 1VQ8I 4AM3A 1LDJA 1U5TB 2X6XA 2UXXA 4QLCU 2RGVA 5D4RA 2DFFA 1FMWA 2OF7A 2VI6A 2Q8KA 3I4PA 3KYDB 4R79A 5KCMA 4KMFA 3HKZA 3RKYA 3DKYA 3N97A 3HG9A 1XMXA 4Z6YA 2LR8A 4M3FA 1H9GA 5AIPA 2R7QA 2WA0A 1XN7A 2EQRA 3DWLE 1V5GA 1X1CA 3D5RC 5B66C 3AL0C 2VXZA 1RESA 1RKWA 2XC7A 2HEOA 4DBRA 3BDDA 2COMA 1N75A 3Q0VA 4BNCA 4PJNA 3FZVA 4AIHA 3GTLJ 3K4CA 2DDAA 4QPOA 3JRDA 2PMHA 1MNMC 4PFPA 3GTOJ 3M8FA 4BKXA 3S2WA 2FNPA 4LMYA 4AU7A 4A3BJ 3KP4A 3GF2A 1Z91A 1WGXA 2ESNA 4A3CJ 5ICFA 3WHBA 2MABA 3BQYA 3NEUA 1BN5A 1A6QA 1FYKA 2IS4A 1KQ0A 3FDYA 2KIMA 2FUG2 3SZTA 4ZZLA 9ANTA 3WE3A 3WGGA 3QPTA 3J80Z 1JT0A 2XSJC 2DA5A 4BJ6C 1BR4A 1MMNA 2FOWA 1O3QA 4G8XA 3C2BA 1X3ZB 1I6XA 2PBIA 2VBXA 1G3WA 2HKOA 5CQEA 3E1SA 5F0FA 4BACA 2CUJA 2VKDA 2RREA 2VBZA 4GO1A 2XAJA 3TDZC 3U1KA 4YFNF 3JREA 4EGZA 1BA5A 2HDCA 3HM5A 4IOCF 3CESA 3BWGA 2ZXWH 4OAYA 1ETQA 4EQQA 1D0XA 2G7UA 4A3FJ 1R6RA 4D9JA 5K7FA 1C0WA 2QBYA 3RPUA 3QYFA 3LSRA 1Y0NA 1YJNI 4NHJA 3JRHA 2IPQX 3O6BB 1WJCA 2YX4A 4K2EA 4ZDPA 1IUYA 3L2VA 4MIMA 3BG9A 5J40A 2BVMA 1IUFA 1SVOA 3G71I 4OMYA 1S8NA 3HSRA 4XKWA 5FB2A 2FX0A 2HQAA 2OAZA 3CP2A 5D8KB 1LJ9A 2NS7A 2OUMA 4A3EJ 1J7KA 2VJ5A 2HTSA 2HZDA 3LSHA 2E2JJ 2DK5A 1SFUA 4BDZA 2HOTA 2EZHA 2LG4A 2M9HA 2DTRA 3FHNA 3IKVA 3H5RA 2E2HJ 3OYFA 2NVUB 4II3A 4D0PA 1TT5B 5E18F 4PGHA 3AL0B 1MMDA 2HYGD 5GPCA 1Z6TA 1Y8RB 1QPMA 2IGMA 2L0KA 1XDUA 1UCRA 3DEUA 4B1RA 3MKWB 1YW8A 4A3JJ 4A3GJ 4IQ4A 3DEWA 2Z1DA 1XMAA 3MZYA 1P92A 3TP0A 4YRVA 1QNTA 1Y8QB 2E36A 4II2A 4A12A 1I39A 3TW6A 4XSXF 2OJED 1XCVA 3MD2A 4CDGA 2DQRA 2JN6A 2LVSA 3F8FA 2NVTJ 3H0DA 1Z77A 3I71A 4N4NB 1U2WA 4Y4RA 3VDXA 3S2DJ 3MMYB 2V6CA 3I54A 2NS0A 1QVUA 1HCRA 4P9FA 4YFKF 4IF4A 1AKHB 1IXCA 3FHZA 3WTSC 2N8GA 2R7DA 1YW7A 2K40A 2Z16A 1ORKA 1ITYA 1E3HA 1Z7UA 2PEXA 2WC2A 4MO7A 1U3EM 2ZC2A 3FXKA 5DM6F 4NBQA 2WB1N 4PJ0C 2GOMA 1TW3A 3AG4H 3LSGA 4RS8A 4NC6A 4R8HA 3F3XA 4XSZF 1D8KA 3G2BA 2X1EA 2DT5A 2JSPA 2PMZA 3GYHX 4XLHA 2R7OA 1YIJI 4B47A 1S7AA 4LITA 2XAUA 4WF2A 4UV9A 3F6VA 4FE7A 4LK1F 1NK3P 2LKSA 4ABZA 3FXQA 2YU3A 1GXQA 1LUJB 3L7WA 2IVMA 2Q1ZB 2GWRA 2WAFA 4GXOA 1QU3A 4BXUA 1MW7A 2BZTA 3CQZJ 3WTTC 3WODF 4BEHB 2EFOA 1QBJA 1O7FA 1OJLA 2RAEA 4XMYA 3KP3A 2HI3A 5EJCA 4KNYA 5JVTA 3G1LA 3BJOA 4ZTJA 4UUSB 1IW7F 3HSFA 1IF1A 2V1DA 3EQLF 2A69F 4BE2A 3KYCB 3J7AY 3OYMA 2CYYA 1QHGA 2ZMEA 3E97A 2DA4A 3HOXJ 1YIOA 2F4OB 2Q0OA 3UKGA 5FFXA 4IX7A 4QSHA 3U21A 3HBLA 3BCBA 1T39A 2BHZA 3HOTA 2R7VA 4GGGA 3K69A 4A5NA 1Y39A 5BS6A 3VODA 2CUFA 3BZ6A 3CCUI 2K86A 1D0YA 2P6TA 2V26A 3FKJA 2MLKA 2A68F 2ZFWA 3Q9VA 1JKOC 3TP3A 2XVCA 5L3BA 2GM4A 1Z1DA 4ZH4F 1BJZA 1XGOA 5JLWA 4DOZA 4NB5A 3QP5A 1W36D 2FEZA 3OIQA 1V55H 1FMVA 2L7MP 3S1NJ 4YIIA 5LFAA 4Y15A 1Z05A 5D6EA 1A6IA 2K4BA 3JRGA 4NQWA 3TDUC 3MFKA 3CJTB 2HVQA 4XRFA 4OMZA 2DAOA 5F27A 1HKSA 1ZGJA 3EUHC 3K4BA 2JA5J 4NC8A 1ZYRF 3F21A 1MJAA 4HLYA 3MZHA 5LRSA 2A6TA 3L9FA 2MA3A 4CA0A 4I0AA 1K4TA 3OV8A 1H88C 3F8BA 4JP0A 2VBYA 1S29A 3CC4I 2RVCA 1B1BA 3QWLA 5LGNA 1U8RA 5FJ8J 1OYIA 2JUCA 1Z3YA 1W0UA 3S8PA 3H35A 4A3KJ 1YFHA 4DIQA 2V1UA 2IEKA 4ZDLA 4LFUA 1U8BA 1G2HA 3H9JA 3M1CA 1IV6A 1WRJA 1MJ9A 4U0VA 3IWZA 5CPRB 2OCEA 2XB5A 3BLYA 3LMMA 2PJRB 2Y9YA 2HR3A 1WCMJ 4PFOA 1YE9A 4AC0A 5HLIA 1JUSA 4RAZA 3KZYA 5K5RA 2R0QC 2MD0A 3PIPF 5LGTA 1ZAOA 3HOVJ 2EV5A 4ZYGA 1SC7A 3TL4X 4CSWA 2DT6A 3HOSA 3H3VK 2DJIA 1PP8F 2VIXA 2BEOA 2D2WA 3G4SI 2IBDA 3HDDA 2UWMA 5H20A 4XLCA 1UJ8A 1LE8A 2ZO4A 2HOEA 4RAGA 4CZCA 2YU9J 2R7TA 1CQTA 3GW2A 3M8JA 4XLPF 5HNFA 2IRFG 1HKTA 3CJQB 1ETWA 4PJLA 3KPHA 1WH5A 1W36C 3DPLC 4IHVA 4N9IA 3EYYA 2VXDA 5J3LA 2BY0A 3DV8A 3A03A 3W6JB 1HDPA 1IRXA 2DMPA 4HBLA 2KRCA 4C3IJ 4MGRA 4E6KG 2WV1A 4XLEA 4GYGA 3Q9SA 2FSWA 3CLQA 4RB0A 2AS5F 2O9LA 1X1BA 1G8XA 1TBXA 1FPQA 2DU9A 3BQZA 2TRTA 1TP4A 3DBRB 4ZYAA 2DA7A 4FX4A 2HYJA 4IHTA 4NNJA 1KU9A 2OC6A 3KP6A 4A3MJ 1FP2A 3CMAI 3ONQA 3OYHA 3G1MA 4XN0A 4MQVA 4DNCA 4E70A 3H92A 3K1MA 3WTZA 1QPIA 3HOWJ 3SXYA 2M87A 4G6DA 3KFWX 5DEQA 1HOMA 1UELB 1YJ9I 4I6ZA 2DFHA 3RI4A 2H6BA 3FWEA 2A6EF 3LWFA 4IHXA 2VOOA 2IS6A 2BHYA 4OAZA 1NG7A 2YPRA 3ZGKA 3BR2A 3HRMA 3UR3C 5D4SA 3TQNA 2F4IA 1T2KA 1PYVA 2KRHA 1CF7A 5TGTA 5M5YJ 2ISZA 2QGUA 4ZYHA 1ZLKA 3ZMZA 1E2XA 2X51A 1RR8C 2ACJA 2DPUA 1JI8A 5HDNA 1IGNA 3J7ZI 1DU0A 5EF6A 3ZN0A 2R7XA 1YRNB 4ESJA 2CMPA 1SD5A 1XD7A 2L7FP 3DU6A 3GLXA 1HA8A 1UMQA 3I59B 2K9LA 2DXIA 1TQMA 2NRAC 1MJBA 3LSPA 2Y69H 1IAWA 2HOSA 3JRAA 3PO2J 2L54A 3HC7A 3WTXC 4IPAA 3F8NA 2E7WA 3BTLA 5F08A 2XF6A 3W3CA 2V79A 3AG2H 5FD6A 3W6KB 1NK2P 2EH3A 3MKLA 3IRQA 4IOAF 1SFKA 1V3FA 3ZMUA 5M3FJ 1TNTA 3A0BC 2CSOA 5IOZA 4KUMA 1B9MA 3H0GJ 4RB2C 4RLQA 2TCTA 4BQOA 2DOFA 4W97A 2F6CA 2LYCA 1WZ2A 1TWGJ 2DK8A 1QQIA 2XPWA 2Y9ZA 1BM9A 2DOEA 2ELHA 2WAQA 2H1KA 3C7JA 5ERIA 5E3MA 3TEDA 4EJVA 2DA6A 3LSMA 2OZUA 1B8IA 3ZPLA 1AU7A 2X85A 2LP0A 3IAM2 4MEXF 2HVSA 4G7OF 3IH3A 2P81A 4FISA 1FOXA 1Z0XA 4FETA 4O5VA 4EATA 1KU7A 3K4NA 5EZGA 5ICGA 3N4MA 2VKEA 4MLOA 2CS3A 4BYYA 2KFDA 2RQPA 3O2PE 5EEAA 2Y75A 4S0HB 3QOEA 5KAFC 2E1NA 3IWFA 5L3CA 4M3DA 3TOBA 4L18B 4WXCA 3GEZA 1BBYA 4CHUA 2LOOA 2R93J 1H0MA 3S15J 1UZCA 4WXHA 1V4RA 3PL8A 5H6QA 1IRFA 2IJLA 3OYCA 1V54H 3LOCA 3K4LA 3A1YA 3ZRGA 3WU0A 4DYQA 1WVRA 1APLC 3HEFA 1HC8A 1ETYA 2XAQA 4ENMA 1G3TA 2NAZA 2JUGA 4A6DA 5GTIC 4ESFA 4O6JA 5E8GA 4A0YA 4HX7A 1W5TA 2W85A 3HGGA 3KEOA 3SZGA 1VQPI 3DTEA 1JE8A 5L3FA 4A3IJ 5F04A 4C9YA 4CCLA 3WTVC 2GLOA 3ASNH 2XRLA 2CWEA 4FHTA 3GLLA 4M6YA 4BY1J 5KAIC 1ETXA 4LLGF 3VYUB 2LDUA 2DMTA 3B73A 2GIZA 5E1ZB 2X48A 3HJEA 2JA7J 3WTYC 2L02A 4RAYA 1S72I 2ADUA 1RZ4A 4UB6C 4XLFA 4C2UA 1JKPC 3CUQC 4ASNA 4CZZA 3X2QH 1FOKA 1R7JA 2VJJA 4DBQA 3OR2C 4AWXB 4X0GA 3CO6C 3A01B 4LG3A 1NHAA 1P4XA 1WJAA 3BR1A 4BGDA 1YS6A 4TV7A 2FE3A 5TISC 1R58A 1R4MB 5BNGA 1G4DA 5IP7J 2VONA 1BJAA 5BQTA 2XF7A 3BTJA 2P7VB 4WK8F 4KDPA 3PQKA 2NNNA 4HDUA 5J1UA 1SMTA 4EM2A 2CUZA 1WFXA 5FLMJ 3RIRA 2BYVE 1N77A 2FQ3A 2IA2A 1G59A 4PJJA 1MZBA 2E19A 2QSFX 1K78A 2JT1A 1TWAJ 1HW2A 2LBFB 3H1CA 5JFRA 2JA6J 4F92B 5LGUA 1YX5A 1REPC 3NWSA 2LH9A 3TGNA 5HOOA 2V4JC 2HXOA 2PJPA 2MW8A 1SFOJ 2BW3A 4XK4A 2A61A 4PGGA 4DW6A 4MFEA 3K9TA 4LK0F 3KZIC 1LQ1A 5KNLA 2X9DA 4BDYA 3S16J 1FIPA 3GTGJ 3CCSI 4M3GA 4ESBA 5FD5A 4CYCB 1FTTA 4QWQA 4XKVA 1R49A 3R4KA 3CCRI 3GZ6A 3VSLA 2WBMA 3DTKA 3TBIA 4N0BA 4JX5A 2E34A 4BBSJ 3HPGA 1QRYA 3FXOA 3IUOA
chains in the Genus database with same CATH topology
5HS7A 1OR7A 3CUQB 1K6OA 1KGSA 2VC0A 2FBIA 3I53A 3ZMTA 2O03A 3CLOA 3D0SA 1FLIA 5JR3A 3F22A 1IN7A 3NQOA 2MLGA 3SQNA 3I0TA 3IC7A 3LAPA 2CQKA 4CGZA 2VODA 1XDSA 1FBSA 2D45A 2Z33A 5HS8A 2K4JA 4LB6B 1PUEE 3I64A 1J2XA 1G3YA 1IRGA 4ENNA 4N9HA 3EETA 1MDMB 2KJCA 4WCGA 1QZZA 3D5LA 3IHUA 1ZARA 3VEPA 2MH2A 3C18A 2IP2A 1GHCA 2XAHA 5LRRA 4UHTA 1BC7C 4A5MA 1J75A 3WTWC 3V7SA 2FXAA 2HGCA 3NRVA 5CYVA 1DPUA 5FLXK 4A6EA 3WG9A 4Q48A 1P4WA 3MWMA 2MC3A 3OOPA 4P5OA 1EH7A 2J5PA 3DXJF 4HF2A 3C3WA 1RNLA 4G7HF 5TRDA 5TJJA 4S05A 2E1CA 1R23A 3KLNA 3KCCA 1CGPA 1JXSA 4IXAA 4L9JA 3FMRA 3ECOA 2O8XA 3VB2A 3K0LA 2XROA 3LA3A 1FC3A 1VTNC 3I5UA 2FBKA 1W7PA 1R36A 5HS9A 2ZKZA 4ZYDA 2IT0A 3V7CA 2L3DA 2GQQA 1FYLA 4Y17A 4MQ9F 3HRSA 2F5CA 3GX4X 2QZ8A 1HXDA 5D5VB 1FP1D 5LEKA 3ABUA 4MHGA 2GIVA 1KQ9A 2HS5A 3T5XA 5FLXZ 2DI3A 3EUHA 3LA7A 1ZH5A 1D8JA 1SMYF 4F7ZA 4BHCA 2OU2A 5J8FA 2RDPA 2ZNZA 1T0FA 2CFXA 1W5SA 4U7DA 4IRHA 3HUGA 3K1NA 1USTA 1S7OA 3M8EA 3FF5A 2EFNA 3GXOA 2AXLA 3DPTA 2LF7A 2YSRA 2X4HA 2A5YB 3GFJA 1O7LA 3V7RA 1W4MA 3QU6A 2XKPA 4YG2F 2F5FA 1TQIA 3WU1B 2HYFA 1XB4A 3L2CA 4HLXA 3R0AA 3SHFA 1IN8A 4CICA 2DPDA 4OINF 3BOQA 5A2QK 4HF1A 1P4AA 3PFIA 2VOPA 5J6XA 3I59A 2QBYB 3R0JA 4KT5C 1FYMA 4IRIA 3DP7A 1OYYA 3ZP5A 4L0ZB 5DCMA 1STZA 5D5XB 2EFWA 2QQBA 2V1XA 1I27A 4FT8A 4L0YB 5E17F 3F8CA 4UVBA 1F1ZA 2PI0A 1FWZA 3GVAA 4A0ZA 1DDNA 3I58A 5FFZA 5J8CA 3F72A 2Y48A 1FSEA 1ZN2A 3R6SA 1YO5C 2F5EA 2EFPA 2Z99A 5F64A 2LSOA 1QGPA 3WGIA 5LHIA 5DD8A 2Z3YA 1R00A 1EH8A 1T38A 2W25A 1JHFA 1HKQA 2EWNA 5L3DA 4OIPF 3DF8A 2YX7A 2G7HA 2GAUA 5ILUA 4G9YA 5A2QZ 1IZ1A 4BH9A 1BI2A 2FMYA 2ESHA 2TDXA 1YG2A 3P9CA 5BOXA 4EM0B 2DO7A 1KYZA 4KYWA 3GFMA 3GWZA 2ETHA 1RIOH 4LG0A 1ON2A 3VOEA 4A2UA 3RKWA 2ZBKA 4A0XA 3LFKA 2YR2A 3T8TA 3QOPA 1S6LA 2VT3A 2VE8A 2J5OA 4RGSA 4AIKA 3R61A 1E17A 1EH6A 3HHGA 3KEQA 4MNUA 5K1YA 2M8EA 2HQNA 4LLNA 1P2FA 5LHHA 1A04A 1OMIA 3T8RA 5E20A 1T6SA 5FGMA 4M74A 3GO5A 2ZMEB 1JHHA 1BI1A 4LB5A 5IT9K 4I7HA 2OD5A 2D1HA 3EDPA 3TOAA 1RUOA 4EJTA 2JPBA 4M72A 1LB2A 3H3UA 2KIFA 3HRTA 5LLQA 1B4AA 2JSCA 2QENA 4G6QA 1ZLJA 4HAMA 2XKOA 4L9TA 1P6RA 4S04A 3SZPA 1U5TA 2H27A 2C6YA 2LF8A 1ONVA 3ISPA 3HYIA 4RGUA 3J81K 4MTEA 3F8MA 3K2ZA 4UVAA 1O3SA 4LD5A 4HYEA 2P5LC 1HSTA 4CO8A 2O3FA 5HVQC 2EB7A 4EMSA 5LEJA 1BI0A 3G3ZA 5L3GA 4WX9A 1XSVA 1XGMA 1ZG3A 1S3JA 2PLYA 2G9WA 2L4MA 1R5HA 2EV6A 3KETA 5CVJA 3QP6A 2JRTA 4RGXA 3RKXA 4U0YA 5E1XA 3H3ZA 4G94A 3ROUA 1PP7U 3EYIA 1BOAA 1WI9A 3TO6A 5CVRA 2EV0A 1LEAA 1SD4A 2VE9A 1J59A 1O3RA 3M7GA 3ERED 1AWCA 1R5GA 5LHGA 1FY7A 3T0YA 1FX7A 2DW4A 1ZHFA 5ICEA 5ED4A 4HDVA 1L3LA 1BI3A 3QPHA 2RV8A 3JAMK 4Q4ZF 1YS7A 3O3KA 4M9SA 3J81Z 2P5KA 2L4AA 4I2OA 5D5UB 1Y0UA 4M6XA 1R1UA 4MEYF 1YYVA 4Q5SF 4OIQF 3CDHA 3RTRA 5BPIA 3DFGA 1XSDA 1KU2A 5CVUA 2KKOA 1MGTA 1TQPA 2JPCA 5JI6A 2O61A 4UUVA 1KYWA 3BJAA 2XV4S 3JTHA 4HV6A 5DCFA 2PG4A 2K27A 2F5DA 4H0EA 1EV7A 4G7ZF 1ULYA 5IT3A 5F6FA 2PQ8A 3J80K 3U2RA 3FX3A 2WV0A 5DD4A 1I1SA 4WWCA 1CF7B 3COAC 4ENJA 4HX4A 4KIFA 1MKMA 4Q47A 3TO7A 5HDKA 3BP8A 4IRGA 3ZMVA 5D5WB 5BPDA 2EJRA 1ZG1A 4OIRF 2IA0A 3L00A 3JAMZ 2EA4A 3HTUA 2P6SA 3LAJA 1F4KA 3VFZA 4KN7X 2L01A 5L3EA 1XCBA 3E5XA 4KIBA 1IXRC 2IW5A 3R60A 3HIFA 2HQRA 2M1BA 5AIQA 1TTYA 3V8LA 4DQ2A 3RYPA 5HDGA 4PZJA 4Z2YA 2EK5A 2FRHA 2FBHA 1UHWA 4OIOF 1IXSB 1SD6A 2X0LA 2A3SA 3ECHA 4L5JA 3HHHA 1USSA 3TO9A 4I01A 3KP5A 2WTEA 2HTJA 1L0OC 3QAHA 4Y13A 3IL2A 3F6OA 2XIGA 2M30A 3DKWA 3RPQA 4EJUA 4BHPA 5D6FA 2KJBA 1HQCA 1G3SA 1ZRFA 1UB9A 1D5VA 3G73A 4L5IA 3ZMDA 2MBFA 3MCZA 1O57A 3E6CC 1XGNA 3ZMSA 3U1DA 1H9TA 4XBFA 2H94A 4M9ZA 4YFXF 2XGXA 1U6GA 2H09A 2EA2A 2XUBA 1Q1HA 1SFXA 2NYXA 3E3VA 1FZPB 4IJAA 4RB1A 3LSTA 2ZXJA 2KRFA 4HA8A 3CO7C 1XSXA 3RJPA 1R22A 2XASA 1UFMA 3BROA 2OQGA 3SFZA 5CVVA 1ODDA 5F1RA 1W7PD 1PDNC 4PCQA 4GYIA 1K78B 4HW0A 2B0LA 2Y0MA 4KIGA 4OU0A 1DUXC 3QU3A 2QQ9A 3E5QA 2H6CA 1FNNA 2KIUA 2OA4A 2RKHA 3FMSA 3ZQ7A 1RUNA 5AONA 4KA4A 2DFIA 2LKPA 1YW9A 4PDKA 5KK1A 3GZ5A 3FM5A 4I0BA 5DUIA 4BHBA 2OZ6A 1J0RA 4CYDA 3JW4A 4U0WA 1OKRA 3ZN1A 4AVPA 2QM3A 4RB3C 1K7AA 2A6HF 3BPVA 4UNOA 2HKXA 2Z5UA 1IN4A 1HSJA 3GUDA 5DYMA 4UV8A 5FO5A 4HF0A 4I02A 2PMUA 2XAGA 4B8XA 5CJ9A 2QLZA 5ILVA 1FBQA 1RI7A 5K5OA 5CVIA 3KP7A 3GFIA 5E8IA 2ZCWA 1DP7P 4GCVA 4LGWA 3TKYA 4WXDA 2W24A 4JK1X 4ENKA 3LQQA 3AAFA 4LJZF 4IHSA 4KN4X 2XHKA 1U78A 2CGPA 2DLLA 2PFBA 4HX8A 1X3UA 1KQ8A 4EVIA 3WTUC 2F2EA 1ZGAA 2FNAA 4I98B 1R1TA 3V8JA 5DUKA 3M9AA 2LNBA 3JTGA 3Q5FA 2DBBA 4AD9A 5CLSA 1Z6RA 4ZYEA 2M45A 2FU4A 3ULQB 2MD5A 1O3TA 1WSUA 3KZZA 2R3SA 2P5VA 1TNSA 1R1VA 4KICA 2HWVA 1FSHA 3RDIA 3QRFF 3KP2A 1BIAA 3MQ0A 1W7PB 5K5QA 2VT2A 3V4GA 5HLGA 1ZG5A 4EM1A 1YLFA 2JZYA 4HQEA 2UXNA 3ML6A 2OBPA 3RYRA 4UVCA 1I5ZA 1LNWA 4KFCA 3IKTA 5EEGA 2PN6A 3BPXA 3HTSB 1LDDA 5EEHA 3FXRA 2CO5A 3WE2A 1Z9CA 5LBQA 1G6NA 1QZYA 3IRRA 5DDGA 5D8LB 1D3YA 4YIFA 1SFEA 3JSPA 4IVNA 3LA2A 3M1EA 2K02A 2STWA 1J9IA 1LEBA 3GFLA 3FM3A 2DQLA 4M71A 2GA1A 2P8TA 2ZJ2A 3E6MA 1MD0A 5H6RA 2ISYA 1KA8A 2GXBA 5ICCA 1FT9A 2O6GE 1LVAA 3LQRA 4OOIA 2FA5A 2P4WA 4M73A 1GXPA 1B9NA 1TLHB 2BV6A 1OPCA 1I1GA 1B59A 2W57A 4EJOA 3F23A 2EFQA 3ABTA 4HQMA 1T98A 1SAXA 1HBXG 4BQAA 4EGYA 3HSEA 2IA1A 2FF4A 4UXNA 3KLOA 4RGRA 2OQRA 2BGCA 3WGHA 2M5WA 2NNYA 4L9VA 1QO0D 2P7CB 4EJWA 2QWWA 2STTA 2VC1A 1KU3A 4JQFA 5BMZA 1TW2A 1FBUA 4R1HA 1AOYA 2GZWA 3CUQA 1JGSA 5DCMB 2ZNYA 1F5TA 2E7XA 4U7BA 3CJNA 2Z9OA 1IN6A 1YQAA 4FX0A 5JHUA 4HOBA 1B6AA 1HW5A 4ON0A 5ILSA 4P55A 1J5YA 1SD7A 2JTVA 4XLNF 2MH9A 3E6BA 1XGSA 2Q2EA 4KMUX 3REOA 4AIJA 1HW1A 3B02A 1ZRDA 3CTAA 2GA2A 3T1BA 1BIBA 3MEXA 4BAYA 2RNJA 5IT9Z 3P9IA 5KVRA 1F9NA 2FOKA 1IN5A 2HFHA 2FMLA 2VN2A 1LDKB 1WKMA 4ZZDA 2A07F 1MDMA 2HZTA 4O3MA 3K1PA 4L9NA 1ON1A 1UHMA 1OYWA 2R7FA 3FMQA 4MTDA 2QQAA 2VBWA 4B09A 2BE5F 3FXUA 2UZKA 2CW0F 3HRUA 1XMKA 1WQ2A 1U5TC 2XAFA 2WWYA 2XRNA 4HV5A 4M9XA 2O0YA 1DPRA 1ZRCA 4I09A 2CG4A 2QUFA 3P9KA 4P96A 1WWXA 3E6DA 4LG0B 3C1DA 4ETSA 3PQJA 5DV5A 3KE2A 3J7AO 3BJ6A 3JSOA 4EV0A 2GXGA 2QYOA 3MAJA 1ZREA 3V8KA 2RC4A 3L09A 2V9VA 2W84A 3E5UA 3DQVC 2BBYA 3ELKA 2K7LA 1YTYA 1GVJA 5E1WA 4U88A 1K79A 5HLHA 4HZFA 4CXFA 4P9UA 1BC8C 2RN7A 3CUOA 4LLLA 4JBAA 2QVOA 3U9GA 3P7NA 3BY6A 2D1VA 1LDJA 1U5TB 2UXXA 4QLCU 2RGVA 5D4RA 2Q8KA 3I4PA 4R79A 4KMFA 3RKYA 3N97A 1H9GA 5AIPA 1XN7A 2VXZA 2HEOA 3BDDA 2COMA 4BNCA 3FZVA 4AIHA 2PMHA 3M8FA 3S2WA 2FNPA 4LMYA 3KP4A 3GF2A 1Z91A 2ESNA 5ICFA 3NEUA 1BN5A 1FYKA 1KQ0A 2KIMA 3SZTA 4ZZLA 3WE3A 3WGGA 3QPTA 3J80Z 1O3QA 4G8XA 1I6XA 2PBIA 2VBXA 1G3WA 2HKOA 3TDZC 4GO1A 2VBZA 4YFNF 6PAXA 2XAJA 4EGZA 2HDCA 3BWGA 4EQQA 2G7UA 1C0WA 2QBYA 3RPUA 4NHJA 2IPQX 3O6BB 2YX4A 4K2EA 1IUYA 4OMYA 1S8NA 3HSRA 5FB2A 2OAZA 5D8KB 1LJ9A 1J7KA 2HTSA 2DK5A 1SFUA 2DTRA 3IKVA 4D0PA 5E18F 4PGHA 2HYGD 1Z6TA 1QPMA 1XDUA 1UCRA 3DEUA 1YW8A 1XMAA 3MZYA 1P92A 1QNTA 4A12A 4XSXF 1XCVA 4CDGA 2DQRA 3F8FA 3I71A 1U2WA 2V6CA 3I54A 2NS0A 4P9FA 4YFKF 4IF4A 1IXCA 3FHZA 3WTSC 2R7DA 1YW7A 1Z7UA 2PEXA 2WC2A 1U3EM 1TW3A 4RS8A 4R8HA 3F3XA 4XSZF 1D8KA 2DT5A 3GYHX 1S7AA 4WF2A 4UV9A 3F6VA 4LK1F 3FXQA 2YU3A 1GXQA 3L7WA 2IVMA 2GWRA 4GXOA 4BXUA 3WTTC 3WODF 1QBJA 2EFOA 1O7FA 3KP3A 4KNYA 5JVTA 3BJOA 1IW7F 3HSFA 1IF1A 2V1DA 3EQLF 2A69F 2CYYA 2ZMEA 3E97A 1YIOA 2Q0OA 5FFXA 1T39A 3HOTA 4GGGA 3K69A 4A5NA 5BS6A 3VODA 3BZ6A 2K86A 2P6TA 2MLKA 2A68F 2ZFWA 3Q9VA 2XVCA 5L3BA 1Z1DA 4ZH4F 1XGOA 4NB5A 3QP5A 2FEZA 4YIIA 4Y15A 1Z05A 5D6EA 2K4BA 4NQWA 3TDUC 3MFKA 4XRFA 4OMZA 2DAOA 1HKSA 1ZGJA 1ZYRF 3F21A 1MJAA 4HLYA 3MZHA 5LRSA 3L9FA 2MA3A 4I0AA 3OV8A 3F8BA 2VBYA 1S29A 2RVCA 1B1BA 1U8RA 5LGNA 1OYIA 1YFHA 2V1UA 4LFUA 1WRJA 1MJ9A 4U0VA 3IWZA 2HR3A 5HLIA 4RAZA 3KZYA 5K5RA 5LGTA 1ZAOA 2EV5A 4ZYGA 3HOSA 1PP8F 2BEOA 2D2WA 2UWMA 5H20A 2ZO4A 2HOEA 3GW2A 4XLPF 1HKTA 2IRFG 3DPLC 4N9IA 3EYYA 3DV8A 3W6JB 4HBLA 4MGRA 4GYGA 3Q9SA 2FSWA 2AS5F 4RB0A 1TBXA 1FPQA 2DU9A 4FX4A 4IHTA 1KU9A 3KP6A 1FP2A 4MQVA 4DNCA 4E70A 3H92A 3K1MA 3WTZA 3SXYA 2M87A 4G6DA 3KFWX 5DEQA 3RI4A 2H6BA 3FWEA 2A6EF 3LWFA 2VOOA 2YPRA 3HRMA 5D4SA 3TQNA 1T2KA 1CF7A 2ISZA 4ZYHA 1ZLKA 3ZMZA 1E2XA 2ACJA 2DPUA 5HDNA 3ZN0A 4ESJA 1SD5A 1XD7A 3GLXA 3I59B 1TQMA 2NRAC 1MJBA 1IAWA 2L54A 3WTXC 4IPAA 3F8NA 2E7WA 2V79A 5FD6A 3W6KB 3IRQA 1V3FA 3ZMUA 1TNTA 2CSOA 4KUMA 1B9MA 4RB2C 2DK8A 1QQIA 1BM9A 2ELHA 3C7JA 5ERIA 4EJVA 2OZUA 3ZPLA 4MEXF 4G7OF 4O5VA 1KU7A 5ICGA 3N4MA 4BYYA 2RQPA 3O2PE 2Y75A 2E1NA 3IWFA 5L3CA 3TOBA 4L18B 4WXCA 3GEZA 1BBYA 4CHUA 1H0MA 4WXHA 1V4RA 5H6QA 1IRFA 2IJLA 3WU0A 2XAQA 4ENMA 1G3TA 2NAZA 4A6DA 4ESFA 4O6JA 5E8GA 4A0YA 4HX7A 1W5TA 2W85A 3KEOA 1JE8A 5L3FA 3WTVC 2CWEA 4FHTA 4M6YA 4LLGF 2LDUA 3B73A 5E1ZB 3WTYC 2L02A 4RAYA 2ADUA 1RZ4A 3CUQC 4ASNA 4CZZA 1FOKA 1R7JA 4AWXB 3CO6C 1NHAA 1P4XA 1YS6A 4TV7A 2FE3A 1R58A 1G4DA 2VONA 1BJAA 5BQTA 2P7VB 4WK8F 4KDPA 3PQKA 2NNNA 4HDUA 1SMTA 4EM2A 3RIRA 2BYVE 2FQ3A 2IA2A 1MZBA 1K78A 2JT1A 1HW2A 5JFRA 5LGUA 1REPC 3TGNA 5HOOA 2PJPA 2A61A 4PGGA 3K9TA 4LK0F 1LQ1A 4ESBA 5FD5A 4QWQA 3R4KA 3GZ6A 4N0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HS7 A;  1OR7 A;  3CUQ B;  1K6O A;  1KGS A;  2VC0 A;  2FBI A;  3I53 A;  3ZMT A;  2O03 A;  3CLO A;  3D0S A;  1FLI A;  5JR3 A;  3F22 A;  1IN7 A;  3NQO A;  2MLG A;  3SQN A;  3I0T A;  3IC7 A;  3LAP A;  2CQK A;  4CGZ A;  2VOD A;  1XDS A;  1FBS A;  2D45 A;  2Z33 A;  5HS8 A;  2K4J A;  4LB6 B;  1PUE E;  3I64 A;  1J2X A;  1G3Y A;  1IRG A;  4ENN A;  4N9H A;  3EET A;  1MDM B;  2KJC A;  4WCG A;  1QZZ A;  3D5L A;  3IHU A;  1ZAR A;  3VEP A;  2MH2 A;  3C18 A;  2IP2 A;  1GHC A;  2XAH A;  5LRR A;  4UHT A;  1BC7 C;  4A5M A;  1J75 A;  3WTW C;  3V7S A;  2FXA A;  2HGC A;  3NRV A;  5CYV A;  1DPU A;  5FLX K;  4A6E A;  3WG9 A;  4Q48 A;  1P4W A;  3MWM A;  2MC3 A;  3OOP A;  4P5O A;  1EH7 A;  2J5P A;  3DXJ F;  4HF2 A;  3C3W A;  1RNL A;  4G7H F;  5TRD A;  5TJJ A;  4S05 A;  2E1C A;  1R23 A;  3KLN A;  3KCC A;  1CGP A;  1JXS A;  4IXA A;  4L9J A;  3FMR A;  3ECO A;  2O8X A;  3VB2 A;  3K0L A;  2XRO A;  3LA3 A;  1FC3 A;  1VTN C;  3I5U A;  2FBK A;  1W7P A;  1R36 A;  5HS9 A;  2ZKZ A;  4ZYD A;  2IT0 A;  3V7C A;  2L3D A;  2GQQ A;  1FYL A;  4Y17 A;  4MQ9 F;  3HRS A;  2F5C A;  3GX4 X;  2QZ8 A;  1HXD A;  5D5V B;  1FP1 D;  5LEK A;  3ABU A;  4MHG A;  2GIV A;  1KQ9 A;  2HS5 A;  3T5X A;  5FLX Z;  2DI3 A;  3EUH A;  3LA7 A;  1ZH5 A;  1D8J A;  1SMY F;  4F7Z A;  4BHC A;  2OU2 A;  5J8F A;  2RDP A;  2ZNZ A;  1T0F A;  2CFX A;  1W5S A;  4U7D A;  4IRH A;  3HUG A;  3K1N A;  1UST A;  1S7O A;  3M8E A;  3FF5 A;  2EFN A;  3GXO A;  2AXL A;  3DPT A;  2LF7 A;  2YSR A;  2X4H A;  2A5Y B;  3GFJ A;  1O7L A;  3V7R A;  1W4M A;  3QU6 A;  2XKP A;  4YG2 F;  2F5F A;  1TQI A;  3WU1 B;  2HYF A;  1XB4 A;  3L2C A;  4HLX A;  3R0A A;  3SHF A;  1IN8 A;  4CIC A;  2DPD A;  4OIN F;  3BOQ A;  5A2Q K;  4HF1 A;  1P4A A;  3PFI A;  2VOP A;  5J6X A;  3I59 A;  2QBY B;  3R0J A;  4KT5 C;  1FYM A;  4IRI A;  3DP7 A;  1OYY A;  3ZP5 A;  4L0Z B;  5DCM A;  1STZ A;  5D5X B;  2EFW A;  2QQB A;  2V1X A;  1I27 A;  4FT8 A;  4L0Y B;  5E17 F;  3F8C A;  4UVB A;  1F1Z A;  2PI0 A;  1FWZ A;  3GVA A;  4A0Z A;  1DDN A;  3I58 A;  5FFZ A;  5J8C A;  3F72 A;  2Y48 A;  1FSE A;  1ZN2 A;  3R6S A;  1YO5 C;  2F5E A;  2EFP A;  2Z99 A;  5F64 A;  2LSO A;  1QGP A;  3WGI A;  5LHI A;  5DD8 A;  2Z3Y A;  1R00 A;  1EH8 A;  1T38 A;  2W25 A;  1JHF A;  1HKQ A;  2EWN A;  5L3D A;  4OIP F;  3DF8 A;  2YX7 A;  2G7H A;  2GAU A;  5ILU A;  4G9Y A;  5A2Q Z;  1IZ1 A;  4BH9 A;  1BI2 A;  2FMY A;  2ESH A;  2TDX A;  1YG2 A;  3P9C A;  5BOX A;  4EM0 B;  2DO7 A;  1KYZ A;  4KYW A;  3GFM A;  3GWZ A;  2ETH A;  1RIO H;  4LG0 A;  1ON2 A;  3VOE A;  4A2U A;  3RKW A;  2ZBK A;  4A0X A;  3LFK A;  2YR2 A;  3T8T A;  3QOP A;  1S6L A;  2VT3 A;  2VE8 A;  2J5O A;  4RGS A;  4AIK A;  3R61 A;  1E17 A;  1EH6 A;  3HHG A;  3KEQ A;  4MNU A;  5K1Y A;  2M8E A;  2HQN A;  4LLN A;  1P2F A;  5LHH A;  1A04 A;  1OMI A;  3T8R A;  5E20 A;  1T6S A;  5FGM A;  4M74 A;  3GO5 A;  2ZME B;  1JHH A;  1BI1 A;  4LB5 A;  5IT9 K;  4I7H A;  2OD5 A;  2D1H A;  3EDP A;  3TOA A;  1RUO A;  4EJT A;  2JPB A;  4M72 A;  1LB2 A;  3H3U A;  2KIF A;  3HRT A;  5LLQ A;  1B4A A;  2JSC A;  2QEN A;  4G6Q A;  1ZLJ A;  4HAM A;  2XKO A;  4L9T A;  1P6R A;  4S04 A;  3SZP A;  1U5T A;  2H27 A;  2C6Y A;  2LF8 A;  1ONV A;  3ISP A;  3HYI A;  4RGU A;  3J81 K;  4MTE A;  3F8M A;  3K2Z A;  4UVA A;  1O3S A;  4LD5 A;  4HYE A;  2P5L C;  1HST A;  4CO8 A;  2O3F A;  5HVQ C;  2EB7 A;  4EMS A;  5LEJ A;  1BI0 A;  3G3Z A;  5L3G A;  4WX9 A;  1XSV A;  1XGM A;  1ZG3 A;  1S3J A;  2PLY A;  2G9W A;  2L4M A;  1R5H A;  2EV6 A;  3KET A;  5CVJ A;  3QP6 A;  2JRT A;  4RGX A;  3RKX A;  4U0Y A;  5E1X A;  3H3Z A;  4G94 A;  3ROU A;  1PP7 U;  3EYI A;  1BOA A;  1WI9 A;  3TO6 A;  5CVR A;  2EV0 A;  1LEA A;  1SD4 A;  2VE9 A;  1J59 A;  1O3R A;  3M7G A;  3ERE D;  1AWC A;  1R5G A;  5LHG A;  1FY7 A;  3T0Y A;  1FX7 A;  2DW4 A;  1ZHF A;  5ICE A;  5ED4 A;  4HDV A;  1L3L A;  1BI3 A;  3QPH A;  2RV8 A;  3JAM K;  4Q4Z F;  1YS7 A;  3O3K A;  4M9S A;  3J81 Z;  2P5K A;  2L4A A;  4I2O A;  5D5U B;  1Y0U A;  4M6X A;  1R1U A;  4MEY F;  1YYV A;  4Q5S F;  4OIQ F;  3CDH A;  3RTR A;  5BPI A;  3DFG A;  1XSD A;  1KU2 A;  5CVU A;  2KKO A;  1MGT A;  1TQP A;  2JPC A;  5JI6 A;  2O61 A;  4UUV A;  1KYW A;  3BJA A;  2XV4 S;  3JTH A;  4HV6 A;  5DCF A;  2PG4 A;  2K27 A;  2F5D A;  4H0E A;  1EV7 A;  4G7Z F;  1ULY A;  5IT3 A;  5F6F A;  2PQ8 A;  3J80 K;  3U2R A;  3FX3 A;  2WV0 A;  5DD4 A;  1I1S A;  4WWC A;  1CF7 B;  3COA C;  4ENJ A;  4HX4 A;  4KIF A;  1MKM A;  4Q47 A;  3TO7 A;  5HDK A;  3BP8 A;  4IRG A;  3ZMV A;  5D5W B;  5BPD A;  2EJR A;  1ZG1 A;  4OIR F;  2IA0 A;  3L00 A;  3JAM Z;  2EA4 A;  3HTU A;  2P6S A;  3LAJ A;  1F4K A;  3VFZ A;  4KN7 X;  2L01 A;  5L3E A;  1XCB A;  3E5X A;  4KIB A;  1IXR C;  2IW5 A;  3R60 A;  3HIF A;  2HQR A;  2M1B A;  5AIQ A;  1TTY A;  3V8L A;  4DQ2 A;  3RYP A;  5HDG A;  4PZJ A;  4Z2Y A;  2EK5 A;  2FRH A;  2FBH A;  1UHW A;  4OIO F;  1IXS B;  1SD6 A;  2X0L A;  2A3S A;  3ECH A;  4L5J A;  3HHH A;  1USS A;  3TO9 A;  4I01 A;  3KP5 A;  2WTE A;  2HTJ A;  1L0O C;  3QAH A;  4Y13 A;  3IL2 A;  3F6O A;  2XIG A;  2M30 A;  3DKW A;  3RPQ A;  4EJU A;  4BHP A;  5D6F A;  2KJB A;  1HQC A;  1G3S A;  1ZRF A;  1UB9 A;  1D5V A;  3G73 A;  4L5I A;  3ZMD A;  2MBF A;  3MCZ A;  1O57 A;  3E6C C;  1XGN A;  3ZMS A;  3U1D A;  1H9T A;  4XBF A;  2H94 A;  4M9Z A;  4YFX F;  2XGX A;  1U6G A;  2H09 A;  2EA2 A;  2XUB A;  1Q1H A;  1SFX A;  2NYX A;  3E3V A;  1FZP B;  4IJA A;  4RB1 A;  3LST A;  2ZXJ A;  2KRF A;  4HA8 A;  3CO7 C;  1XSX A;  3RJP A;  1R22 A;  2XAS A;  1UFM A;  3BRO A;  2OQG A;  3SFZ A;  5CVV A;  1ODD A;  5F1R A;  1W7P D;  1PDN C;  4PCQ A;  4GYI A;  1K78 B;  4HW0 A;  2B0L A;  2Y0M A;  4KIG A;  4OU0 A;  1DUX C;  3QU3 A;  2QQ9 A;  3E5Q A;  2H6C A;  1FNN A;  2KIU A;  2OA4 A;  2RKH A;  3FMS A;  3ZQ7 A;  1RUN A;  5AON A;  4KA4 A;  2DFI A;  2LKP A;  1YW9 A;  4PDK A;  5KK1 A;  3GZ5 A;  3FM5 A;  4I0B A;  5DUI A;  4BHB A;  2OZ6 A;  1J0R A;  4CYD A;  3JW4 A;  4U0W A;  1OKR A;  3ZN1 A;  4AVP A;  2QM3 A;  4RB3 C;  1K7A A;  2A6H F;  3BPV A;  4UNO A;  2HKX A;  2Z5U A;  1IN4 A;  1HSJ A;  3GUD A;  5DYM A;  4UV8 A;  5FO5 A;  4HF0 A;  4I02 A;  2PMU A;  2XAG A;  4B8X A;  5CJ9 A;  2QLZ A;  5ILV A;  1FBQ A;  1RI7 A;  5K5O A;  5CVI A;  3KP7 A;  3GFI A;  5E8I A;  2ZCW A;  1DP7 P;  4GCV A;  4LGW A;  3TKY A;  4WXD A;  2W24 A;  4JK1 X;  4ENK A;  3LQQ A;  3AAF A;  4LJZ F;  4IHS A;  4KN4 X;  2XHK A;  1U78 A;  2CGP A;  2DLL A;  2PFB A;  4HX8 A;  1X3U A;  1KQ8 A;  4EVI A;  3WTU C;  2F2E A;  1ZGA A;  2FNA A;  4I98 B;  1R1T A;  3V8J A;  5DUK A;  3M9A A;  2LNB A;  3JTG A;  3Q5F A;  2DBB A;  4AD9 A;  5CLS A;  1Z6R A;  4ZYE A;  2M45 A;  2FU4 A;  3ULQ B;  2MD5 A;  1O3T A;  1WSU A;  3KZZ A;  2R3S A;  2P5V A;  1TNS A;  1R1V A;  4KIC A;  2HWV A;  1FSH A;  3RDI A;  3QRF F;  3KP2 A;  1BIA A;  3MQ0 A;  1W7P B;  5K5Q A;  2VT2 A;  3V4G A;  5HLG A;  1ZG5 A;  4EM1 A;  1YLF A;  2JZY A;  4HQE A;  2UXN A;  3ML6 A;  2OBP A;  3RYR A;  4UVC A;  1I5Z A;  1LNW A;  4KFC A;  3IKT A;  5EEG A;  2PN6 A;  3BPX A;  3HTS B;  1LDD A;  5EEH A;  3FXR A;  2CO5 A;  3WE2 A;  1Z9C A;  5LBQ A;  1G6N A;  1QZY A;  3IRR A;  5DDG A;  5D8L B;  1D3Y A;  4YIF A;  1SFE A;  3JSP A;  4IVN A;  3LA2 A;  3M1E A;  2K02 A;  2STW A;  1J9I A;  1LEB A;  3GFL A;  3FM3 A;  2DQL A;  4M71 A;  2GA1 A;  2P8T A;  2ZJ2 A;  3E6M A;  1MD0 A;  5H6R A;  2ISY A;  1KA8 A;  2GXB A;  5ICC A;  1FT9 A;  2O6G E;  1LVA A;  3LQR A;  4OOI A;  2FA5 A;  2P4W A;  4M73 A;  1GXP A;  1B9N A;  1TLH B;  2BV6 A;  1OPC A;  1I1G A;  1B59 A;  2W57 A;  4EJO A;  3F23 A;  2EFQ A;  3ABT A;  4HQM A;  1T98 A;  1SAX A;  1HBX G;  4BQA A;  4EGY A;  3HSE A;  2IA1 A;  2FF4 A;  4UXN A;  3KLO A;  4RGR A;  2OQR A;  2BGC A;  3WGH A;  2M5W A;  2NNY A;  4L9V A;  1QO0 D;  2P7C B;  4EJW A;  2QWW A;  2STT A;  2VC1 A;  1KU3 A;  4JQF A;  5BMZ A;  1TW2 A;  1FBU A;  4R1H A;  1AOY A;  2GZW A;  3CUQ A;  1JGS A;  5DCM B;  2ZNY A;  1F5T A;  2E7X A;  4U7B A;  3CJN A;  2Z9O A;  1IN6 A;  1YQA A;  4FX0 A;  5JHU A;  4HOB A;  1B6A A;  1HW5 A;  4ON0 A;  5ILS A;  4P55 A;  1J5Y A;  1SD7 A;  2JTV A;  4XLN F;  2MH9 A;  3E6B A;  1XGS A;  2Q2E A;  4KMU X;  3REO A;  4AIJ A;  1HW1 A;  3B02 A;  1ZRD A;  3CTA A;  2GA2 A;  3T1B A;  1BIB A;  3MEX A;  4BAY A;  2RNJ A;  5IT9 Z;  3P9I A;  5KVR A;  1F9N A;  2FOK A;  1IN5 A;  2HFH A;  2FML A;  2VN2 A;  1LDK B;  1WKM A;  4ZZD A;  2A07 F;  1MDM A;  2HZT A;  4O3M A;  3K1P A;  4L9N A;  1ON1 A;  1UHM A;  1OYW A;  2R7F A;  3FMQ A;  4MTD A;  2QQA A;  2VBW A;  4B09 A;  2BE5 F;  3FXU A;  2UZK A;  2CW0 F;  3HRU A;  1XMK A;  1WQ2 A;  1U5T C;  2XAF A;  2WWY A;  2XRN A;  4HV5 A;  4M9X A;  2O0Y A;  1DPR A;  1ZRC A;  4I09 A;  2CG4 A;  2QUF A;  3P9K A;  4P96 A;  1WWX A;  3E6D A;  4LG0 B;  3C1D A;  4ETS A;  3PQJ A;  5DV5 A;  3KE2 A;  3J7A O;  3BJ6 A;  3JSO A;  4EV0 A;  2GXG A;  2QYO A;  3MAJ A;  1ZRE A;  3V8K A;  2RC4 A;  3L09 A;  2V9V A;  2W84 A;  3E5U A;  3DQV C;  2BBY A;  3ELK A;  2K7L A;  1YTY A;  1GVJ A;  5E1W A;  4U88 A;  1K79 A;  5HLH A;  4HZF A;  4CXF A;  4P9U A;  1BC8 C;  2RN7 A;  3CUO A;  4LLL A;  4JBA A;  2QVO A;  3U9G A;  3P7N A;  3BY6 A;  2D1V A;  1LDJ A;  1U5T B;  2UXX A;  4QLC U;  2RGV A;  5D4R A;  2Q8K A;  3I4P A;  4R79 A;  4KMF A;  3RKY A;  3N97 A;  1H9G A;  5AIP A;  1XN7 A;  2VXZ A;  2HEO A;  3BDD A;  2COM A;  4BNC A;  3FZV A;  4AIH A;  2PMH A;  3M8F A;  3S2W A;  2FNP A;  4LMY A;  3KP4 A;  3GF2 A;  1Z91 A;  2ESN A;  5ICF A;  3NEU A;  1BN5 A;  1FYK A;  1KQ0 A;  2KIM A;  3SZT A;  4ZZL A;  3WE3 A;  3WGG A;  3QPT A;  3J80 Z;  1O3Q A;  4G8X A;  1I6X A;  2PBI A;  2VBX A;  1G3W A;  2HKO A;  3TDZ C;  4GO1 A;  2VBZ A;  4YFN F;  6PAX A;  2XAJ A;  4EGZ A;  2HDC A;  3BWG A;  4EQQ A;  2G7U A;  1C0W A;  2QBY A;  3RPU A;  4NHJ A;  2IPQ X;  3O6B B;  2YX4 A;  4K2E A;  1IUY A;  4OMY A;  1S8N A;  3HSR A;  5FB2 A;  2OAZ A;  5D8K B;  1LJ9 A;  1J7K A;  2HTS A;  2DK5 A;  1SFU A;  2DTR A;  3IKV A;  4D0P A;  5E18 F;  4PGH A;  2HYG D;  1Z6T A;  1QPM A;  1XDU A;  1UCR A;  3DEU A;  1YW8 A;  1XMA A;  3MZY A;  1P92 A;  1QNT A;  4A12 A;  4XSX F;  1XCV A;  4CDG A;  2DQR A;  3F8F A;  3I71 A;  1U2W A;  2V6C A;  3I54 A;  2NS0 A;  4P9F A;  4YFK F;  4IF4 A;  1IXC A;  3FHZ A;  3WTS C;  2R7D A;  1YW7 A;  1Z7U A;  2PEX A;  2WC2 A;  1U3E M;  1TW3 A;  4RS8 A;  4R8H A;  3F3X A;  4XSZ F;  1D8K A;  2DT5 A;  3GYH X;  1S7A A;  4WF2 A;  4UV9 A;  3F6V A;  4LK1 F;  3FXQ A;  2YU3 A;  1GXQ A;  3L7W A;  2IVM A;  2GWR A;  4GXO A;  4BXU A;  3WTT C;  3WOD F;  1QBJ A;  2EFO A;  1O7F A;  3KP3 A;  4KNY A;  5JVT A;  3BJO A;  1IW7 F;  3HSF A;  1IF1 A;  2V1D A;  3EQL F;  2A69 F;  2CYY A;  2ZME A;  3E97 A;  1YIO A;  2Q0O A;  5FFX A;  1T39 A;  3HOT A;  4GGG A;  3K69 A;  4A5N A;  5BS6 A;  3VOD A;  3BZ6 A;  2K86 A;  2P6T A;  2MLK A;  2A68 F;  2ZFW A;  3Q9V A;  2XVC A;  5L3B A;  1Z1D A;  4ZH4 F;  1XGO A;  4NB5 A;  3QP5 A;  2FEZ A;  4YII A;  4Y15 A;  1Z05 A;  5D6E A;  2K4B A;  4NQW A;  3TDU C;  3MFK A;  4XRF A;  4OMZ A;  2DAO A;  1HKS A;  1ZGJ A;  1ZYR F;  3F21 A;  1MJA A;  4HLY A;  3MZH A;  5LRS A;  3L9F A;  2MA3 A;  4I0A A;  3OV8 A;  3F8B A;  2VBY A;  1S29 A;  2RVC A;  1B1B A;  1U8R A;  5LGN A;  1OYI A;  1YFH A;  2V1U A;  4LFU A;  1WRJ A;  1MJ9 A;  4U0V A;  3IWZ A;  2HR3 A;  5HLI A;  4RAZ A;  3KZY A;  5K5R A;  5LGT A;  1ZAO A;  2EV5 A;  4ZYG A;  3HOS A;  1PP8 F;  2BEO A;  2D2W A;  2UWM A;  5H20 A;  2ZO4 A;  2HOE A;  3GW2 A;  4XLP F;  1HKT A;  2IRF G;  3DPL C;  4N9I A;  3EYY A;  3DV8 A;  3W6J B;  4HBL A;  4MGR A;  4GYG A;  3Q9S A;  2FSW A;  2AS5 F;  4RB0 A;  1TBX A;  1FPQ A;  2DU9 A;  4FX4 A;  4IHT A;  1KU9 A;  3KP6 A;  1FP2 A;  4MQV A;  4DNC A;  4E70 A;  3H92 A;  3K1M A;  3WTZ A;  3SXY A;  2M87 A;  4G6D A;  3KFW X;  5DEQ A;  3RI4 A;  2H6B A;  3FWE A;  2A6E F;  3LWF A;  2VOO A;  2YPR A;  3HRM A;  5D4S A;  3TQN A;  1T2K A;  1CF7 A;  2ISZ A;  4ZYH A;  1ZLK A;  3ZMZ A;  1E2X A;  2ACJ A;  2DPU A;  5HDN A;  3ZN0 A;  4ESJ A;  1SD5 A;  1XD7 A;  3GLX A;  3I59 B;  1TQM A;  2NRA C;  1MJB A;  1IAW A;  2L54 A;  3WTX C;  4IPA A;  3F8N A;  2E7W A;  2V79 A;  5FD6 A;  3W6K B;  3IRQ A;  1V3F A;  3ZMU A;  1TNT A;  2CSO A;  4KUM A;  1B9M A;  4RB2 C;  2DK8 A;  1QQI A;  1BM9 A;  2ELH A;  3C7J A;  5ERI A;  4EJV A;  2OZU A;  3ZPL A;  4MEX F;  4G7O F;  4O5V A;  1KU7 A;  5ICG A;  3N4M A;  4BYY A;  2RQP A;  3O2P E;  2Y75 A;  2E1N A;  3IWF A;  5L3C A;  3TOB A;  4L18 B;  4WXC A;  3GEZ A;  1BBY A;  4CHU A;  1H0M A;  4WXH A;  1V4R A;  5H6Q A;  1IRF A;  2IJL A;  3WU0 A;  2XAQ A;  4ENM A;  1G3T A;  2NAZ A;  4A6D A;  4ESF A;  4O6J A;  5E8G A;  4A0Y A;  4HX7 A;  1W5T A;  2W85 A;  3KEO A;  1JE8 A;  5L3F A;  3WTV C;  2CWE A;  4FHT A;  4M6Y A;  4LLG F;  2LDU A;  3B73 A;  5E1Z B;  3WTY C;  2L02 A;  4RAY A;  2ADU A;  1RZ4 A;  3CUQ C;  4ASN A;  4CZZ A;  1FOK A;  1R7J A;  4AWX B;  3CO6 C;  1NHA A;  1P4X A;  1YS6 A;  4TV7 A;  2FE3 A;  1R58 A;  1G4D A;  2VON A;  1BJA A;  5BQT A;  2P7V B;  4WK8 F;  4KDP A;  3PQK A;  2NNN A;  4HDU A;  1SMT A;  4EM2 A;  3RIR A;  2BYV E;  2FQ3 A;  2IA2 A;  1MZB A;  1K78 A;  2JT1 A;  1HW2 A;  5JFR A;  5LGU A;  1REP C;  3TGN A;  5HOO A;  2PJP A;  2A61 A;  4PGG A;  3K9T A;  4LK0 F;  1LQ1 A;  4ESB A;  5FD5 A;  4QWQ A;  3R4K A;  3GZ6 A;  4N0B A; 
#chains in the Genus database with same CATH topology
 3W2W A;  5HS7 A;  1OR7 A;  1ERD A;  5JVG F;  3CUQ B;  1T56 A;  3VSK A;  4E7Z A;  1K6O A;  1KGS A;  2VC0 A;  2CU7 A;  2FBI A;  4B4C A;  3RQ4 A;  3I53 A;  3ZMT A;  1VQ9 I;  2BY1 A;  2L7Z A;  2O03 A;  1X3W B;  1SAU A;  3CLO A;  1ZKG A;  3D0S A;  3OMY A;  2CV0 A;  1FOW A;  1FLI A;  5IY5 H;  4PK4 A;  4BS9 A;  4FAS D;  5JR3 A;  3F22 A;  1IN7 A;  3NQO A;  2ICW G;  3FXL A;  2EZK A;  2MLG A;  3SQN A;  2Q2E B;  3I0T A;  2DA2 A;  3N05 A;  4J01 A;  3IC7 A;  3W2V A;  3LAP A;  4ANJ A;  2CQK A;  2EIM H;  2MSY A;  4CGZ A;  2VOD A;  1XDS A;  1FBS A;  3S32 A;  2D45 A;  2Z33 A;  4BL0 B;  3FK7 A;  5HS8 A;  2R7W A;  2K4J A;  4AUX A;  4LB6 B;  4AVZ A;  2JVG A;  2EIN H;  3ABK H;  1JUP A;  1PUE E;  4DGW B;  2K3P A;  2FJ1 A;  3I64 A;  1RRJ A;  1J2X A;  2X6O A;  1G3Y A;  1IRG A;  4ENN A;  3VWB A;  4N9H A;  3EET A;  2CW7 A;  3B6C A;  3TMO A;  3JRI A;  1MDM B;  2KJC A;  4WCG A;  1QZZ A;  3CP8 A;  3D5L A;  2WY8 Q;  3IHU A;  3RPU D;  1ZAR A;  3VEP A;  2R5Z B;  2MH2 A;  1T8I A;  3C18 A;  1WJD A;  2IP2 A;  3M3Y J;  1GHC A;  3JCU C;  2H1L A;  4B44 A;  2XAH A;  1HDD C;  3H9Q A;  5LRR A;  4UHT A;  1BC7 C;  4A5M A;  1J75 A;  3DBH B;  3WTW C;  2B7E A;  3HB9 A;  3V7S A;  3TW7 A;  4XIC A;  2LY2 A;  2FXA A;  2HGC A;  3NRV A;  2V6E A;  2DYR H;  3F9K A;  4M6V A;  5CYV A;  3I55 I;  1DPU A;  5FLX K;  4A6E A;  3WG9 A;  1MBE A;  4Q48 A;  1P4W A;  3MWM A;  2MC3 A;  1D5Y A;  4JX6 A;  4IHY A;  3OOP A;  2AHQ A;  2NOG A;  4P5O A;  2F48 A;  3Q3S A;  1EH7 A;  2J5P A;  3DXJ F;  4HF2 A;  3S1R J;  3C3W A;  1U0J A;  2QF7 A;  2R5Y A;  2WY7 Q;  3ASO H;  1RNL A;  4YEL A;  4G7H F;  4H4K C;  3OY9 A;  5TRD A;  2E5N A;  3ZQI A;  5TJJ A;  4KT6 A;  5IPA A;  4S05 A;  2E1C A;  1R23 A;  2ELK A;  3KLN A;  3KCC A;  1CGP A;  1JXS A;  4IXA A;  4L9J A;  3FIS A;  5IP6 A;  3FMR A;  1JT6 A;  3ECO A;  1A31 A;  3DLA A;  2O8X A;  3VB2 A;  3CCM I;  3K0L A;  3OL3 A;  3ZCO A;  5EGO B;  5C4J J;  2XRO A;  2LFB A;  1PUF B;  3GTM J;  3SDB A;  2CRG A;  2JVH A;  3PUF A;  3LA3 A;  2EZL A;  1FC3 A;  1K83 J;  4GRI A;  5GAG J;  1VTN C;  2UUZ A;  2R7U A;  3I5U A;  2FBK A;  2WAE A;  1W7P A;  1R36 A;  5HS9 A;  2QEX I;  1KON A;  2ZKZ A;  4ZYD A;  3VPR A;  3OS0 A;  1ACI A;  4DZJ A;  4RDU A;  2XDV A;  4BY7 J;  2KMU A;  3GME A;  2IT0 A;  5K7H A;  4ZDO A;  3V7C A;  4ZJZ A;  2L3D A;  3M4O J;  2K5C A;  1X1D A;  1S9H A;  2GQQ A;  2WAQ N;  4EEF G;  1FYL A;  2BY3 A;  4Y17 A;  4MQ9 F;  4E7L A;  3HRS A;  2F5C A;  3GX4 X;  2LY1 A;  1V5E A;  2HU9 A;  3FBN B;  3FKI J;  2QZ8 A;  1HXD A;  5D5V B;  2W00 A;  4UUT A;  1FP1 D;  1MMA A;  5LEK A;  3ABU A;  4MHG A;  1VQK I;  1MBH A;  3BR0 A;  2GIV A;  4KJZ A;  3H5N A;  4D7M A;  1Z7L A;  1KQ9 A;  1Y1W J;  1H89 C;  2HS5 A;  2V9P A;  3T5X A;  5FLX Z;  3ZR8 X;  2DI3 A;  3EUH A;  3CME I;  3I4N J;  1MSE C;  3LA7 A;  1ZH5 A;  1D8J A;  1SMY F;  4F7Z A;  4BHC A;  2OU2 A;  5M5X J;  3PIO F;  2VPR A;  3LL7 A;  5J8F A;  1MSF C;  2RDP A;  2IGN A;  2ZNZ A;  3CCY A;  2XGD A;  3CMM A;  5F0C A;  1JUM A;  2UV1 A;  1T0F A;  2CFX A;  3HOU J;  1W5S A;  2DN0 A;  4U7D A;  3BG5 A;  4IRH A;  3HUG A;  5EZH A;  1TC3 C;  3OS2 A;  2JMW A;  3K1N A;  1UST A;  1S7O A;  3M8E A;  3D5S C;  1I50 J;  2M7B A;  3FF5 A;  3FXM A;  2EFN A;  3GXO A;  2AXL A;  3DPT A;  1EKE A;  2LF7 A;  2YSR A;  3FIW A;  4FCY A;  2X4H A;  2A5Y B;  5E3O A;  3GFJ A;  1O7L A;  3V7R A;  1W4M A;  2CV2 A;  3L2W A;  3QU6 A;  2XKP A;  1B72 A;  4YG2 F;  2F5F A;  1TQI A;  3WU1 B;  2HYF A;  1XB4 A;  3S1Q J;  5EG0 A;  1H8A C;  3L2C A;  4HLX A;  3R0A A;  5FKO A;  3SHF A;  1IN8 A;  4CIC A;  2DPD A;  1VND A;  4A3L J;  4OIN F;  3PNY A;  2DA1 A;  2W1O A;  5K7Z A;  4UY8 I;  1ENH A;  4E7H A;  3K70 D;  2M0C A;  3BOQ A;  4D1Q A;  5B3S H;  5A2Q K;  4HF1 A;  1P4A A;  3PFI A;  3K6G A;  3OIO A;  1D0Z A;  3O8G A;  1SVL A;  3ZQH A;  5HOD A;  1Z21 A;  2VOP A;  1GV2 A;  2L9R A;  5J6X A;  1WJF A;  3I59 A;  2QBY B;  2X1C A;  3R0J A;  4KT5 C;  1R9T J;  1I3A A;  1PJR A;  5LD2 C;  2VQL A;  1OCT C;  2KLO A;  1FYM A;  4IRI A;  3HOZ J;  2MFZ A;  1MND A;  3DP7 A;  1T33 A;  1OYY A;  4V2F A;  3ZP5 A;  3PM1 A;  2MG4 A;  2HXI A;  2NS8 A;  4L0Z B;  5IYD J;  5FKM A;  5DCM A;  4XKB A;  1STZ A;  2GXA A;  3JRF A;  1VI0 A;  2W7N A;  5D5X B;  2EFW A;  2QQB A;  2V1X A;  4E4H A;  2ZXI A;  1I27 A;  3MKZ A;  4FT8 A;  4L0Y B;  2HOA A;  4E7K A;  5E17 F;  4BE0 A;  3F8C A;  4UVB A;  1F1Z A;  2PI0 A;  1SVM A;  1FWZ A;  3GVA A;  4A0Z A;  1DDN A;  2IGO A;  3I58 A;  1IO2 A;  5FFZ A;  5J8C A;  3SFI A;  2ZJQ F;  3JRC A;  3A02 A;  3F72 A;  1DGR M;  3KIO A;  2Y48 A;  1FSE A;  3ESW B;  4ITV A;  1ZN2 A;  3R6S A;  1YO5 C;  3HOY J;  2F5E A;  2EFP A;  2Z99 A;  5F64 A;  2LSO A;  1OCO H;  1JKR C;  1QGP A;  5C44 J;  3MVP A;  1A35 A;  3WGI A;  3AG3 H;  1E3P A;  3MN2 A;  5LHI A;  4Y3O A;  5DD8 A;  3CCQ I;  2Z3Y A;  1R00 A;  2Y2Z A;  5GP9 A;  1ZR4 A;  1EH8 A;  3S17 J;  4XRS G;  1LPQ A;  1T38 A;  2W25 A;  1JHF A;  2Y31 A;  1HKQ A;  2ZXH A;  2M4K A;  2EWN A;  3LSJ A;  1GLN A;  4B3A A;  1GV5 A;  1HLV A;  5L3D A;  4OIP F;  2O5R A;  1ZEL A;  3DF8 A;  4BQN A;  4J00 A;  2YX7 A;  2G7H A;  2GAU A;  5ILU A;  2V1N A;  3QOD A;  3PNV A;  3S93 A;  4G9Y A;  2M2E A;  5IP9 J;  5A2Q Z;  3F0C A;  1IZ1 A;  4BH9 A;  1BI2 A;  2FMY A;  2ESH A;  2TDX A;  1T95 A;  1YG2 A;  3RZO J;  2KZV A;  3P9C A;  5BOX A;  3K70 C;  4EM0 B;  2DO7 A;  4HSR A;  2ZB9 A;  1FJL A;  2OTL I;  1KYZ A;  1YX3 A;  4KYW A;  5M5W J;  3GFM A;  3GWZ A;  2ETH A;  1OCP A;  3KEY A;  1RIO H;  3GCM A;  4RA2 A;  4LG0 A;  1ON2 A;  3VOE A;  4A2U A;  3DEE A;  3RKW A;  2ZBK A;  3LFK A;  2YR2 A;  4A0X A;  3A0H C;  3DCF A;  1Z67 A;  3T8T A;  3QOP A;  1S6L A;  2EIK H;  2VLA A;  2ECB A;  3OYE A;  2VT3 A;  2VE8 A;  3EPZ A;  2J5O A;  4RGS A;  4AIK A;  3R61 A;  1VF9 A;  1MNE A;  4HNV A;  1E17 A;  2R7Z J;  1EH6 A;  3HHG A;  5GAH J;  3KEQ A;  4MNU A;  5K1Y A;  2M8E A;  1KZH A;  5J4V A;  2MGQ A;  2HQN A;  3GBG A;  4LLN A;  1Y6I A;  1P2F A;  1VQO I;  5LHH A;  1LFU P;  1A04 A;  2ID6 A;  1OMI A;  3T8R A;  5E20 A;  2DT7 B;  3BTI A;  1T6S A;  5HLT A;  5FGM A;  2I10 A;  4M74 A;  3GO5 A;  2ZME B;  1JHH A;  1BI1 A;  4LB5 A;  5IT9 K;  1ZGW A;  3P5J A;  5M3M J;  4I7H A;  3KX2 A;  3ZOB A;  2OD5 A;  2D1H A;  3EDP A;  3TOA A;  4CCM A;  1RUO A;  4EJT A;  2JPB A;  4IQJ A;  2K9S A;  4MFD A;  4M72 A;  1LB2 A;  3H3U A;  2KIF A;  3HRT A;  3NWT A;  1NH3 A;  1XG1 A;  5LLQ A;  4N4O B;  1B4A A;  2JSC A;  2QEN A;  4G6Q A;  1MBF A;  3S1M J;  1ZLJ A;  4HAM A;  2W48 A;  3BCA A;  2B63 J;  2XKO A;  4L9T A;  1D1A A;  1TZL A;  1P6R A;  3ZQF A;  4S04 A;  3SZP A;  3BG7 A;  1U5T A;  2H27 A;  2C6Y A;  2LF8 A;  1ONV A;  3ISP A;  3HYI A;  4RGU A;  5EDN A;  2KDO A;  3J81 K;  4XR6 A;  2VQH A;  4MTE A;  2OCC H;  4NQW B;  3F8M A;  3K2Z A;  1YOV B;  2D5V A;  3IH2 A;  4UVA A;  1O3S A;  4A69 C;  1K6Y A;  3IP4 B;  4E7I A;  4XOT A;  4LD5 A;  4V19 K;  3BG6 A;  2HVR A;  4HYE A;  2JWT A;  2VB6 A;  2GOX B;  3VYT B;  2P5L C;  1HST A;  4CO8 A;  2O3F A;  3RZD J;  1JKQ C;  5HVQ C;  1X19 A;  2EB7 A;  4EMS A;  4A3D J;  2LRD A;  5LEJ A;  1BI0 A;  2LKX A;  3K4J A;  3G3Z A;  5L3G A;  4WX9 A;  2G0E A;  1FTZ A;  1XSV A;  1VQ7 I;  2HPM A;  1XGM A;  2L7K A;  1ZG3 A;  1ZTR A;  1S3J A;  4XKC A;  2PLY A;  1QVT A;  2G9W A;  2L4M A;  3OWT A;  3DKX A;  1R5H A;  2EV6 A;  3KET A;  2NXN B;  1DP3 A;  2K9M A;  2X6Y A;  5CVJ A;  3QP6 A;  1WJB A;  2AQE A;  2JRT A;  5JLX A;  1X4O A;  4XM3 A;  4RGX A;  2B9S A;  3RKX A;  5J4Y A;  4U0Y A;  1RET A;  5E1X A;  4A93 J;  3H3Z A;  4G94 A;  3ROU A;  1PP7 U;  3GTJ J;  1MBG A;  3EYI A;  1BOA A;  1WI9 A;  3TO6 A;  2PX9 A;  5CVR A;  5FRM A;  2EV0 A;  4G6T B;  3PSF A;  1OQY A;  3PO3 J;  3BG3 A;  2X1D A;  4BUP A;  1LEA A;  1SD4 A;  3I9V 2;  2VE9 A;  1J59 A;  1O3R A;  4Y33 A;  3QYB A;  3M7G A;  5CQG A;  3ERE D;  2LD5 A;  4CCK A;  1R5G A;  5LHG A;  1AWC A;  2OV7 A;  1FY7 A;  3T0Y A;  1LE8 B;  1FX7 A;  2BXY A;  2DW4 A;  5IOY A;  1ZHF A;  5ICE A;  3GTQ J;  5C4X J;  2MYS A;  5ED4 A;  4HDV A;  2RQQ A;  4DYR A;  1BI3 A;  3QPH A;  1L3L A;  2RV8 A;  3BT9 A;  4XID A;  3JAM K;  4Q4Z F;  1IV8 A;  1YS7 A;  3O3K A;  1LKX A;  4M9S A;  4B3X A;  2DJN A;  2P5K A;  3J81 Z;  4RBO A;  3ZXS A;  4QTR A;  3BR5 A;  3FBI B;  2L4A A;  4I2O A;  2CW8 A;  5D5U B;  1TL8 A;  1Y0U A;  2DOD A;  4M6X A;  1K61 A;  1R1U A;  4BJT A;  1D1B A;  4F93 B;  4MEY F;  2HQ5 A;  1YYV A;  1UG0 A;  4NUB A;  4Q5S F;  4OIQ F;  3CDH A;  4IL6 C;  3CDI A;  1GUU A;  3RTR A;  5BPI A;  3HGY A;  3DFG A;  3H9G A;  4C3J J;  1XSD A;  2O8K A;  1KU2 A;  3BC8 A;  5CVU A;  2M34 A;  2KKO A;  1MGT A;  1TQP A;  3C2G A;  3OSG A;  2CFO A;  2JPC A;  1W0T A;  5JI6 A;  2O61 A;  4UUV A;  4X1E A;  1KYW A;  4P1W A;  3BTC A;  3BJA A;  2XV4 S;  3OYI A;  2HPI A;  3JTH A;  2ECC A;  4HV6 A;  4M3E A;  4DZP A;  1JTX A;  5DCF A;  2PG4 A;  2M4G A;  2VKH A;  2DMQ A;  1RKT A;  4HPQ A;  4U87 A;  4IKF A;  2K27 A;  2F5D A;  1X2M A;  4H0E A;  2DMU A;  1EV7 A;  4G7Z F;  1ETK A;  1ULY A;  5IT3 A;  5F6F A;  1QZE A;  2PQ8 A;  4DYC A;  2E5Z A;  3FK6 A;  2W82 A;  3J80 K;  3U2R A;  2QA4 I;  3FX3 A;  2JRM A;  2WV0 A;  5DD4 A;  4XN3 A;  2VAS A;  2QCO A;  1I1S A;  4XON A;  1UAA A;  4WWC A;  3L1P A;  1CF7 B;  3COA C;  4XNF A;  2KZG A;  5E3L A;  4KIT B;  1AKH A;  4ENJ A;  4HX4 A;  2A5W A;  4XOR A;  1NTC A;  4KIF A;  2VQG A;  1MKM A;  4Q47 A;  4FQG A;  2HDD A;  3TO7 A;  4B43 A;  5HDK A;  3BP8 A;  1GVD A;  4IRG A;  3ZMV A;  5D5W B;  6PAX A;  2MC4 A;  2VPL A;  5BPD A;  1WH7 A;  1IJW C;  2EJR A;  1ZG1 A;  1XX5 A;  2W4S A;  3K10 A;  4OIR F;  3WG7 H;  2RNG A;  2IA0 A;  3L00 A;  4CCJ A;  3CF2 A;  2DA3 A;  2EA4 A;  3HTU A;  2JJ7 A;  3JAM Z;  3OSF A;  2IS2 A;  3W2A A;  2ZSI B;  1VQM I;  3DPU A;  2P6S A;  2LMD A;  2ELJ A;  4C30 A;  3LAJ A;  1F4K A;  3OYD A;  1ZQ3 P;  3VFZ A;  4KN7 X;  1U9O A;  1D1C A;  3BZC A;  1LFP A;  3JR9 A;  2DCE A;  2E71 A;  2L01 A;  3OR1 C;  5L3E A;  1XCB A;  5CKT A;  3E5X A;  1OIS A;  2M3A A;  4KIB A;  1IXR C;  2JA8 J;  2IW5 A;  2CUE A;  3R60 A;  2YS9 A;  3HIF A;  2HQR A;  2M1B A;  5AIQ A;  1TTY A;  4BEH A;  1EJ9 A;  3V8L A;  3DBL B;  1TWF J;  4DQ2 A;  3LFU A;  3RYP A;  5HDG A;  3BZK A;  4BXF A;  4UUS A;  4PZJ A;  1B8I B;  4D5C A;  4Z2Y A;  2EK5 A;  2FRH A;  2FBH A;  4J19 A;  3PSI A;  1UHW A;  5KHD A;  4JX4 A;  4OIO F;  1IXS B;  3I3L A;  1SD6 A;  2NVX J;  2X0L A;  2EPF A;  3LSI A;  2A3S A;  3ECH A;  2COB A;  2L2O A;  4L5J A;  3HHH A;  1USS A;  4LIU A;  3TO9 A;  3OIP A;  4I01 A;  4YEJ A;  3KP5 A;  2WTE A;  4UB8 C;  1AA7 A;  2HTJ A;  1AHD P;  2OTJ I;  1L0O C;  1R5I D;  2AQF A;  3QAH A;  2VJ4 A;  4Y13 A;  3IL2 A;  3F6O A;  3HXL A;  2XIG A;  1JJ6 C;  2M30 A;  3DKW A;  3RPQ A;  3ABM H;  1GDT A;  2QSG X;  4EJU A;  4GDF A;  4BHP A;  3I4M J;  1A36 A;  3CDL A;  5D6F A;  2V9K A;  4PJM A;  1ETV A;  3ZQQ A;  1YIT I;  5J47 A;  4YIR X;  4RMN A;  2KJB A;  1HQC A;  2DMN A;  4RAF A;  3GZN B;  1G3S A;  1ZRF A;  1UB9 A;  1D5V A;  2ME0 A;  5GAE J;  3K4M A;  3G73 A;  3EUA A;  4L5I A;  3ZMD A;  2MBF A;  3MCZ A;  1O57 A;  3E6C C;  1XGN A;  3ZMS A;  3U1D A;  2ME6 A;  1H9T A;  3H5A A;  2KDZ A;  1UG2 A;  3S3O A;  4XBF A;  2H94 A;  4M9Z A;  4YFX F;  2XGX A;  1U6G A;  2H09 A;  2BXZ A;  2EA2 A;  2XUB A;  3Q0U A;  1OR7 C;  1Q1H A;  1SFX A;  2NYX A;  5J1Y A;  4XL9 A;  1YI2 I;  3I56 I;  1TWC J;  3E3V A;  1DGW Y;  1FZP B;  4IEJ A;  4IJA A;  2R7R A;  1TT0 A;  4RB1 A;  3OYB A;  3CC2 I;  3LST A;  1FOY A;  3A4C A;  4OWR B;  1VZ0 A;  5FLV A;  1IDZ A;  3A2K A;  1JJ8 C;  2L9N A;  2O7O A;  2ZXJ A;  1I3Q J;  1OCZ H;  2EBI A;  2KRF A;  3L2R A;  4HA8 A;  3CO7 C;  1XSX A;  2R92 J;  3RJP A;  3QPL A;  1R22 A;  1X4P A;  2XAS A;  4I76 A;  1UFM A;  3UNG C;  2E60 A;  2PJR A;  3B6A A;  3BRO A;  2OQG A;  1N78 A;  1X1P A;  4PUS A;  1ODD A;  5CVV A;  2QKM B;  3SFZ A;  5F1R A;  1W5C C;  1W7P D;  3GTK J;  1PDN C;  4PCQ A;  3V42 A;  4GYI A;  2XGE A;  1BL0 A;  3CF5 F;  1K78 B;  4HW0 A;  2B0L A;  2V7F A;  2Y0M A;  1P7I A;  2LK2 A;  4KIG A;  2AXT C;  4OU0 A;  1JGG A;  1DUX C;  3E0J B;  2EZI A;  1WI3 A;  3QU3 A;  4BE1 A;  2QQ9 A;  3E5Q A;  2H6C A;  3NAU A;  1FNN A;  3OYJ A;  2KIU A;  2BW3 B;  2OA4 A;  3HL2 A;  2RKH A;  1MH3 A;  3FMS A;  3M07 A;  3ZQ7 A;  1VQL I;  2Y0S A;  1BR2 A;  1RUN A;  3E7L A;  1R71 A;  2JK3 A;  5AON A;  4KA4 A;  2DFI A;  2LKP A;  1E0E A;  5GTH C;  2DYS H;  1YW9 A;  4PDK A;  3GTP J;  5KK1 A;  3GZ5 A;  3FM5 A;  3ERM A;  4I0B A;  2K3F A;  5DUI A;  4HNT A;  4BHB A;  3SJM A;  4XRM A;  2OZ6 A;  1J0R A;  2K85 A;  2LRE A;  4PSX A;  4CYD A;  3JW4 A;  4U0W A;  2KIS A;  1OKR A;  1VQ6 I;  3ZN1 A;  4XLA A;  4E7S A;  1FEX A;  3O8H A;  2E1O A;  4AVP A;  2QM3 A;  4RB3 C;  2VKV A;  5FKN A;  1K7A A;  2K9Q A;  4Y52 J;  2M8G X;  2A6H F;  2NVQ J;  3BPV A;  3WU2 C;  4UNO A;  4X6A J;  2QQ8 A;  2HKX A;  4G12 A;  2Z5U A;  1IN4 A;  1HSJ A;  3GUD A;  5DYM A;  4UV8 A;  5FO5 A;  2WAD A;  4HF0 A;  4I02 A;  1XS9 A;  1JTY A;  2PMU A;  2XAG A;  4B8X A;  1PVE A;  4AYB A;  5CJ9 A;  2QLZ A;  3PFY A;  5E79 C;  1IDY A;  5ILV A;  1FBQ A;  2QKL B;  1Y56 A;  1RI7 A;  2VL8 A;  2L9S A;  4RM3 A;  5K5O A;  5CVI A;  4HEA 2;  3KP7 A;  3GFI A;  5E8I A;  1A5J A;  4ZC3 A;  2ZCW A;  3OL4 A;  5DM7 F;  1DP7 P;  4GCV A;  4LGW A;  3TKY A;  1MMG A;  2W24 A;  4WXD A;  3KYL A;  3CCL I;  4JK1 X;  2H8R A;  4ENK A;  3LQQ A;  3PJR A;  4FE4 A;  4V2G A;  3AAF A;  1W1W E;  1NG6 A;  2DOA A;  5FRO A;  1ZK8 A;  4LJZ F;  4IHS A;  3QPS A;  4KN4 X;  3ZQG A;  5F1J A;  2XHK A;  1X1A A;  3CZ6 A;  4I99 C;  1U78 A;  3RSN A;  1YRN A;  2NOJ B;  2CGP A;  2EIJ H;  2DLL A;  2AO9 A;  2KHM A;  2PFB A;  3D1N I;  4JOM A;  4HX8 A;  3S2H J;  2JQ7 A;  4NDL A;  1X3U A;  1KQ8 A;  2IAI A;  4C3H J;  1MBJ A;  5FKL A;  3OYG A;  4EVI A;  2FD5 A;  3WTU C;  2F2E A;  1ZGA A;  1LVK A;  2FNA A;  4I98 B;  1R1T A;  3V8J A;  1P9Q C;  3HZJ A;  3M9A A;  5DUK A;  5H2F C;  3JRB A;  2LNB A;  1X2N A;  3JTG A;  1WJE A;  3Q5F A;  2DBB A;  4Y7N J;  3MKY B;  3IH4 A;  4AD9 A;  4IHW A;  3VYR B;  5CLS A;  4D5F A;  1Y1V J;  1SEU A;  2KP6 A;  1Z6R A;  5IYB J;  4ZYE A;  5E3N A;  3OYL A;  3AG1 H;  1YJW I;  1RC9 A;  2FU4 A;  2M45 A;  3WHC A;  3ULQ B;  2MD5 A;  3MZ8 A;  1Q1V A;  3ZQC A;  1T0F C;  1DU6 A;  3HPH A;  4D7N A;  2R5Y B;  1I6H J;  5FRN A;  5FKK A;  1O3T A;  4BQQ A;  1WSU A;  1MH4 A;  1SAN A;  2CQX A;  5DS9 A;  2P0W A;  2XSD C;  4LIV A;  3EUK L;  3KZZ A;  3SEQ A;  3S14 J;  2LC2 A;  2P5V A;  1TNS A;  2R3S A;  2EIL H;  1R1V A;  4KIC A;  2HWV A;  2ZJR F;  2ZME C;  3SDG A;  1FSH A;  2XPV A;  3RDI A;  1J09 A;  4QIW N;  3KP2 A;  3QRF F;  1BIA A;  3DTI A;  5GPA A;  3MQ0 A;  2GBY A;  3HKZ N;  2QSH X;  4NC7 A;  3L2Q A;  2Y30 A;  1W7P B;  3DU5 A;  5K5Q A;  2VT2 A;  3V4G A;  5HLG A;  1ZG5 A;  4EM1 A;  1YLF A;  2JZY A;  4HQE A;  1VQ4 I;  2BVL A;  3IAS 2;  2UXN A;  3ML6 A;  3QYE A;  4E7J A;  2OBP A;  2XB0 X;  5B1A H;  4W1U A;  3RYR A;  4UVC A;  1Z3X A;  1I5Z A;  5JHF A;  1LNW A;  3S3N A;  4CH7 A;  1O4X A;  4KFC A;  3IKT A;  1EA3 A;  5EEG A;  2PN6 A;  3BPX A;  3HTS B;  1QHH D;  1LDD A;  1DQU A;  5EEH A;  3FXR A;  2CO5 A;  2E1M C;  3WE2 A;  1Z9C A;  5LBQ A;  2E35 A;  3LNQ A;  3RKQ A;  1G6N A;  1LFB A;  4CCO A;  2CQ7 A;  1ZR2 A;  2NVY J;  2ZFU A;  4RLF A;  1QZY A;  3A01 A;  3IRR A;  1MIJ A;  2LY9 A;  5DDG A;  1U9N A;  5D8L B;  1D3Y A;  1YHQ I;  4KIS A;  4YIF A;  1SFE A;  2XF5 A;  5B1B H;  3JSP A;  4IVN A;  2Z2S B;  4QPQ A;  3LA2 A;  3M1E A;  1EF4 A;  2K02 A;  2STW A;  1J9I A;  1LEB A;  1R4N B;  3GFL A;  3HUG B;  2FQ4 A;  3FM3 A;  4ZTF A;  2DQL A;  4M71 A;  3AFH A;  2GA1 A;  2P8T A;  1VQ5 I;  2ZJ2 A;  3E6M A;  1S5L C;  1VQN I;  2R7S A;  1MD0 A;  5H6R A;  2ISY A;  5DTD A;  1KA8 A;  2KIQ A;  4JYK A;  3OYK A;  4HNU A;  2GXB A;  2HDW A;  5ICC A;  3CJR B;  2LLK A;  1FT9 A;  2O6G E;  2IXS A;  2VUM J;  2LBF A;  1LVA A;  2KQR A;  3LQR A;  4OOI A;  2FA5 A;  1ETO A;  3VYS B;  1B72 B;  1IRZ A;  3BR6 A;  2P4W A;  4M73 A;  1GXP A;  1B9N A;  1TLH B;  2BV6 A;  1OPC A;  1WHU A;  1POG A;  1I1G A;  1B59 A;  4BU2 A;  1GT0 C;  1WPK A;  5EG0 B;  2OPT A;  4HG2 A;  2W57 A;  4EJO A;  3F23 A;  2ZSH B;  2EFQ A;  2KT0 A;  3ABT A;  4HQM A;  1T98 A;  1SAX A;  1HBX G;  4F91 B;  4BQA A;  1OCC H;  4F52 A;  4EGY A;  4BBR J;  3K2A A;  3CCJ I;  3HSE A;  4XOP A;  2IA1 A;  2DFE A;  2XGC A;  2FF4 A;  4UXN A;  4CYC A;  3KLO A;  4RGR A;  1N25 A;  1HF0 A;  2OQR A;  2BGC A;  2IS1 A;  3WGH A;  2M5W A;  5C3E J;  4LOC A;  1VFC A;  2NNY A;  4L9V A;  1QO0 D;  1FIA A;  2P7C B;  4EJW A;  1OLT A;  3CCE I;  2QWW A;  2STT A;  2VC1 A;  1KU3 A;  1XTA A;  4JQF A;  5IYC J;  5BMZ A;  1TW2 A;  1FBU A;  1MBK A;  4R1H A;  2E1M B;  1AOY A;  1BOB A;  2GZW A;  3CUQ A;  1X58 A;  1JGS A;  5DCM B;  1MMS A;  1OFC X;  1UHS A;  2ZNY A;  1F5T A;  3PNT A;  2E7X A;  4U7B A;  3AKZ A;  3CC7 I;  3CJN A;  2Z9O A;  1XPX A;  1IN6 A;  1YQA A;  4FX0 A;  5JHU A;  1E3O C;  5B5E C;  4HOB A;  1IC8 A;  1B6A A;  1HW5 A;  2VQC A;  4ON0 A;  5ILS A;  4P55 A;  1J5Y A;  1SD7 A;  2JTV A;  4XLN F;  2L9V A;  4C2T A;  2DTZ A;  2Y0S N;  2MH9 A;  3E6B A;  1XGS A;  3RCO A;  2Q2E A;  4KMU X;  1S7E A;  3REO A;  5GAD J;  2WB1 A;  3CMY A;  4AIJ A;  1HW1 A;  3B02 A;  1ZRD A;  3CTA A;  1WJ5 A;  2GA2 A;  3LSK A;  3T1B A;  3L2U A;  1BIB A;  2BY2 A;  1BR1 A;  3MEX A;  5EYR A;  4BAY A;  2RNJ A;  2X6W A;  1RPW A;  2JA2 A;  5IT9 Z;  4L5E A;  3P9I A;  3SYT A;  5KVR A;  1F9N A;  2FOK A;  1IN5 A;  2PMZ N;  2HFH A;  4IZZ A;  1F36 A;  4CCN A;  2FML A;  2YUS A;  2VN2 A;  1LDK B;  1WKM A;  2KL4 A;  4ZZD A;  3J7Y J;  1F43 A;  2A07 F;  1MDM A;  4PSW A;  1P7J A;  2HZT A;  4O3M A;  3K1P A;  1K4S A;  4L9N A;  1ON1 A;  2KPM A;  1UHM A;  1OYW A;  2R7F A;  4BJ5 C;  2R5Z A;  3FMQ A;  4F3Q A;  4MTD A;  2A05 A;  2QQA A;  3C2H A;  2VBW A;  2ZJP F;  4B09 A;  2BE5 F;  3FXU A;  2UZK A;  3CCV I;  3SEZ A;  3ZQL A;  2CW0 F;  3HRU A;  1XMK A;  2HNH A;  3OS1 A;  1OCR H;  1WQ2 A;  1XC5 A;  1U5T C;  2XAF A;  2XRN A;  4HV5 A;  2WWY A;  1TWH J;  4AYB N;  5HNH A;  4RM2 A;  4M9X A;  2M7A A;  3K4K A;  2O0Y A;  2CV1 A;  1DPR A;  1ZRC A;  4B48 A;  4I09 A;  2CG4 A;  2BOL A;  2QUF A;  3P9K A;  4P96 A;  1WWX A;  3RQI A;  2M0M A;  1M1E B;  2CQQ A;  3E6D A;  4LG0 B;  3C1D A;  4ETS A;  2R4G A;  1BW6 A;  4FTH A;  3S3M A;  3OYA A;  2CQN A;  3PQJ A;  5DV5 A;  4XQF A;  3KE2 A;  3J7A O;  3K7A J;  3BJ6 A;  2IGK A;  2XPU A;  3JSO A;  4EV0 A;  2CH0 A;  4HST A;  4XRS A;  2GXG A;  2QYO A;  3MAJ A;  2H8W A;  1ZRE A;  2L5Q A;  3V8K A;  2RC4 A;  4M3B A;  4C2M J;  4HRI A;  2CJJ A;  3OOU A;  1BW5 A;  2I8D A;  3L09 A;  2DDB A;  2V9V A;  2W84 A;  4BXX J;  3CD6 I;  1V5F A;  5EGO A;  3E5U A;  3G1O A;  1PUF A;  3DQV C;  2I5U A;  2BBY A;  3IV5 A;  3ELK A;  2F4M B;  2K7L A;  3Q0W A;  2F5V A;  3G6E I;  3NAR A;  4CUG A;  5J1R A;  1QA6 A;  5F0H A;  3FXJ A;  1YTY A;  1GVJ A;  4AID A;  1T08 B;  5E1W A;  4U88 A;  4F55 A;  1K79 A;  5HLH A;  4HZF A;  3H36 A;  4CXF A;  3OYN A;  3W6V A;  1IG7 A;  4P9U A;  4DJA A;  1BC8 C;  4GFB A;  2K9N A;  2RN7 A;  3BR3 A;  3QQA A;  3CUO A;  3ABL H;  4LLL A;  2ID3 A;  3DLL F;  4JBA A;  2QVO A;  3U9G A;  3P7N A;  3PUB A;  3BY6 A;  2VJI A;  2LTP A;  2E2I J;  2D1V A;  4IO9 F;  1RR7 A;  1VQ8 I;  4AM3 A;  1LDJ A;  1U5T B;  2X6X A;  2UXX A;  4QLC U;  2RGV A;  5D4R A;  2DFF A;  1FMW A;  2OF7 A;  2VI6 A;  2Q8K A;  3I4P A;  3KYD B;  4R79 A;  5KCM A;  4KMF A;  3HKZ A;  3RKY A;  3DKY A;  3N97 A;  3HG9 A;  1XMX A;  4Z6Y A;  2LR8 A;  4M3F A;  1H9G A;  5AIP A;  2R7Q A;  2WA0 A;  1XN7 A;  2EQR A;  3DWL E;  1V5G A;  1X1C A;  3D5R C;  5B66 C;  3AL0 C;  2VXZ A;  1RES A;  1RKW A;  2XC7 A;  2HEO A;  4DBR A;  3BDD A;  2COM A;  1N75 A;  3Q0V A;  4BNC A;  4PJN A;  3FZV A;  4AIH A;  3GTL J;  3K4C A;  2DDA A;  4QPO A;  3JRD A;  2PMH A;  1MNM C;  4PFP A;  3GTO J;  3M8F A;  4BKX A;  3S2W A;  2FNP A;  4LMY A;  4AU7 A;  4A3B J;  3KP4 A;  3GF2 A;  1Z91 A;  1WGX A;  2ESN A;  4A3C J;  5ICF A;  3WHB A;  2MAB A;  3BQY A;  3NEU A;  1BN5 A;  1A6Q A;  1FYK A;  2IS4 A;  1KQ0 A;  3FDY A;  2KIM A;  2FUG 2;  3SZT A;  4ZZL A;  9ANT A;  3WE3 A;  3WGG A;  3QPT A;  3J80 Z;  1JT0 A;  2XSJ C;  2DA5 A;  4BJ6 C;  1BR4 A;  1MMN A;  2FOW A;  1O3Q A;  4G8X A;  3C2B A;  1X3Z B;  1I6X A;  2PBI A;  2VBX A;  1G3W A;  2HKO A;  5CQE A;  3E1S A;  5F0F A;  4BAC A;  2CUJ A;  2VKD A;  2RRE A;  2VBZ A;  4GO1 A;  2XAJ A;  3TDZ C;  3U1K A;  4YFN F;  3JRE A;  4EGZ A;  1BA5 A;  2HDC A;  3HM5 A;  4IOC F;  3CES A;  3BWG A;  2ZXW H;  4OAY A;  1ETQ A;  4EQQ A;  1D0X A;  2G7U A;  4A3F J;  1R6R A;  4D9J A;  5K7F A;  1C0W A;  2QBY A;  3RPU A;  3QYF A;  3LSR A;  1Y0N A;  1YJN I;  4NHJ A;  3JRH A;  2IPQ X;  3O6B B;  1WJC A;  2YX4 A;  4K2E A;  4ZDP A;  1IUY A;  3L2V A;  4MIM A;  3BG9 A;  5J40 A;  2BVM A;  1IUF A;  1SVO A;  3G71 I;  4OMY A;  1S8N A;  3HSR A;  4XKW A;  5FB2 A;  2FX0 A;  2HQA A;  2OAZ A;  3CP2 A;  5D8K B;  1LJ9 A;  2NS7 A;  2OUM A;  4A3E J;  1J7K A;  2VJ5 A;  2HTS A;  2HZD A;  3LSH A;  2E2J J;  2DK5 A;  1SFU A;  4BDZ A;  2HOT A;  2EZH A;  2LG4 A;  2M9H A;  2DTR A;  3FHN A;  3IKV A;  3H5R A;  2E2H J;  3OYF A;  2NVU B;  4II3 A;  4D0P A;  1TT5 B;  5E18 F;  4PGH A;  3AL0 B;  1MMD A;  2HYG D;  5GPC A;  1Z6T A;  1Y8R B;  1QPM A;  2IGM A;  2L0K A;  1XDU A;  1UCR A;  3DEU A;  4B1R A;  3MKW B;  1YW8 A;  4A3J J;  4A3G J;  4IQ4 A;  3DEW A;  2Z1D A;  1XMA A;  3MZY A;  1P92 A;  3TP0 A;  4YRV A;  1QNT A;  1Y8Q B;  2E36 A;  4II2 A;  4A12 A;  1I39 A;  3TW6 A;  4XSX F;  2OJE D;  1XCV A;  3MD2 A;  4CDG A;  2DQR A;  2JN6 A;  2LVS A;  3F8F A;  2NVT J;  3H0D A;  1Z77 A;  3I71 A;  4N4N B;  1U2W A;  4Y4R A;  3VDX A;  3S2D J;  3MMY B;  2V6C A;  3I54 A;  2NS0 A;  1QVU A;  1HCR A;  4P9F A;  4YFK F;  4IF4 A;  1AKH B;  1IXC A;  3FHZ A;  3WTS C;  2N8G A;  2R7D A;  1YW7 A;  2K40 A;  2Z16 A;  1ORK A;  1ITY A;  1E3H A;  1Z7U A;  2PEX A;  2WC2 A;  4MO7 A;  1U3E M;  2ZC2 A;  3FXK A;  5DM6 F;  4NBQ A;  2WB1 N;  4PJ0 C;  2GOM A;  1TW3 A;  3AG4 H;  3LSG A;  4RS8 A;  4NC6 A;  4R8H A;  3F3X A;  4XSZ F;  1D8K A;  3G2B A;  2X1E A;  2DT5 A;  2JSP A;  2PMZ A;  3GYH X;  4XLH A;  2R7O A;  1YIJ I;  4B47 A;  1S7A A;  4LIT A;  2XAU A;  4WF2 A;  4UV9 A;  3F6V A;  4FE7 A;  4LK1 F;  1NK3 P;  2LKS A;  4ABZ A;  3FXQ A;  2YU3 A;  1GXQ A;  1LUJ B;  3L7W A;  2IVM A;  2Q1Z B;  2GWR A;  2WAF A;  4GXO A;  1QU3 A;  4BXU A;  1MW7 A;  2BZT A;  3CQZ J;  3WTT C;  3WOD F;  4BEH B;  2EFO A;  1QBJ A;  1O7F A;  1OJL A;  2RAE A;  4XMY A;  3KP3 A;  2HI3 A;  5EJC A;  4KNY A;  5JVT A;  3G1L A;  3BJO A;  4ZTJ A;  4UUS B;  1IW7 F;  3HSF A;  1IF1 A;  2V1D A;  3EQL F;  2A69 F;  4BE2 A;  3KYC B;  3J7A Y;  3OYM A;  2CYY A;  1QHG A;  2ZME A;  3E97 A;  2DA4 A;  3HOX J;  1YIO A;  2F4O B;  2Q0O A;  3UKG A;  5FFX A;  4IX7 A;  4QSH A;  3U21 A;  3HBL A;  3BCB A;  1T39 A;  2BHZ A;  3HOT A;  2R7V A;  4GGG A;  3K69 A;  4A5N A;  1Y39 A;  5BS6 A;  3VOD A;  2CUF A;  3BZ6 A;  3CCU I;  2K86 A;  1D0Y A;  2P6T A;  2V26 A;  3FKJ A;  2MLK A;  2A68 F;  2ZFW A;  3Q9V A;  1JKO C;  3TP3 A;  2XVC A;  5L3B A;  2GM4 A;  1Z1D A;  4ZH4 F;  1BJZ A;  1XGO A;  5JLW A;  4DOZ A;  4NB5 A;  3QP5 A;  1W36 D;  2FEZ A;  3OIQ A;  1V55 H;  1FMV A;  2L7M P;  3S1N J;  4YII A;  5LFA A;  4Y15 A;  1Z05 A;  5D6E A;  1A6I A;  2K4B A;  3JRG A;  4NQW A;  3TDU C;  3MFK A;  3CJT B;  2HVQ A;  4XRF A;  4OMZ A;  2DAO A;  5F27 A;  1HKS A;  1ZGJ A;  3EUH C;  3K4B A;  2JA5 J;  4NC8 A;  1ZYR F;  3F21 A;  1MJA A;  4HLY A;  3MZH A;  5LRS A;  2A6T A;  3L9F A;  2MA3 A;  4CA0 A;  4I0A A;  1K4T A;  3OV8 A;  1H88 C;  3F8B A;  4JP0 A;  2VBY A;  1S29 A;  3CC4 I;  2RVC A;  1B1B A;  3QWL A;  5LGN A;  1U8R A;  5FJ8 J;  1OYI A;  2JUC A;  1Z3Y A;  1W0U A;  3S8P A;  3H35 A;  4A3K J;  1YFH A;  4DIQ A;  2V1U A;  2IEK A;  4ZDL A;  4LFU A;  1U8B A;  1G2H A;  3H9J A;  3M1C A;  1IV6 A;  1WRJ A;  1MJ9 A;  4U0V A;  3IWZ A;  5CPR B;  2OCE A;  2XB5 A;  3BLY A;  3LMM A;  2PJR B;  2Y9Y A;  2HR3 A;  1WCM J;  4PFO A;  1YE9 A;  4AC0 A;  5HLI A;  1JUS A;  4RAZ A;  3KZY A;  5K5R A;  2R0Q C;  2MD0 A;  3PIP F;  5LGT A;  1ZAO A;  3HOV J;  2EV5 A;  4ZYG A;  1SC7 A;  3TL4 X;  4CSW A;  2DT6 A;  3HOS A;  3H3V K;  2DJI A;  1PP8 F;  2VIX A;  2BEO A;  2D2W A;  3G4S I;  2IBD A;  3HDD A;  2UWM A;  5H20 A;  4XLC A;  1UJ8 A;  1LE8 A;  2ZO4 A;  2HOE A;  4RAG A;  4CZC A;  2YU9 J;  2R7T A;  1CQT A;  3GW2 A;  3M8J A;  4XLP F;  5HNF A;  2IRF G;  1HKT A;  3CJQ B;  1ETW A;  4PJL A;  3KPH A;  1WH5 A;  1W36 C;  3DPL C;  4IHV A;  4N9I A;  3EYY A;  2VXD A;  5J3L A;  2BY0 A;  3DV8 A;  3A03 A;  3W6J B;  1HDP A;  1IRX A;  2DMP A;  4HBL A;  2KRC A;  4C3I J;  4MGR A;  4E6K G;  2WV1 A;  4XLE A;  4GYG A;  3Q9S A;  2FSW A;  3CLQ A;  4RB0 A;  2AS5 F;  2O9L A;  1X1B A;  1G8X A;  1TBX A;  1FPQ A;  2DU9 A;  3BQZ A;  2TRT A;  1TP4 A;  3DBR B;  4ZYA A;  2DA7 A;  4FX4 A;  2HYJ A;  4IHT A;  4NNJ A;  1KU9 A;  2OC6 A;  3KP6 A;  4A3M J;  1FP2 A;  3CMA I;  3ONQ A;  3OYH A;  3G1M A;  4XN0 A;  4MQV A;  4DNC A;  4E70 A;  3H92 A;  3K1M A;  3WTZ A;  1QPI A;  3HOW J;  3SXY A;  2M87 A;  4G6D A;  3KFW X;  5DEQ A;  1HOM A;  1UEL B;  1YJ9 I;  4I6Z A;  2DFH A;  3RI4 A;  2H6B A;  3FWE A;  2A6E F;  3LWF A;  4IHX A;  2VOO A;  2IS6 A;  2BHY A;  4OAZ A;  1NG7 A;  2YPR A;  3ZGK A;  3BR2 A;  3HRM A;  3UR3 C;  5D4S A;  3TQN A;  2F4I A;  1T2K A;  1PYV A;  2KRH A;  1CF7 A;  5TGT A;  5M5Y J;  2ISZ A;  2QGU A;  4ZYH A;  1ZLK A;  3ZMZ A;  1E2X A;  2X51 A;  1RR8 C;  2ACJ A;  2DPU A;  1JI8 A;  5HDN A;  1IGN A;  3J7Z I;  1DU0 A;  5EF6 A;  3ZN0 A;  2R7X A;  1YRN B;  4ESJ A;  2CMP A;  1SD5 A;  1XD7 A;  2L7F P;  3DU6 A;  3GLX A;  1HA8 A;  1UMQ A;  3I59 B;  2K9L A;  2DXI A;  1TQM A;  2NRA C;  1MJB A;  3LSP A;  2Y69 H;  1IAW A;  2HOS A;  3JRA A;  3PO2 J;  2L54 A;  3HC7 A;  3WTX C;  4IPA A;  3F8N A;  2E7W A;  3BTL A;  5F08 A;  2XF6 A;  3W3C A;  2V79 A;  3AG2 H;  5FD6 A;  3W6K B;  1NK2 P;  2EH3 A;  3MKL A;  3IRQ A;  4IOA F;  1SFK A;  1V3F A;  3ZMU A;  5M3F J;  1TNT A;  3A0B C;  2CSO A;  5IOZ A;  4KUM A;  1B9M A;  3H0G J;  4RB2 C;  4RLQ A;  2TCT A;  4BQO A;  2DOF A;  4W97 A;  2F6C A;  2LYC A;  1WZ2 A;  1TWG J;  2DK8 A;  1QQI A;  2XPW A;  2Y9Z A;  1BM9 A;  2DOE A;  2ELH A;  2WAQ A;  2H1K A;  3C7J A;  5ERI A;  5E3M A;  3TED A;  4EJV A;  2DA6 A;  3LSM A;  2OZU A;  1B8I A;  3ZPL A;  1AU7 A;  2X85 A;  2LP0 A;  3IAM 2;  4MEX F;  2HVS A;  4G7O F;  3IH3 A;  2P81 A;  4FIS A;  1FOX A;  1Z0X A;  4FET A;  4O5V A;  4EAT A;  1KU7 A;  3K4N A;  5EZG A;  5ICG A;  3N4M A;  2VKE A;  4MLO A;  2CS3 A;  4BYY A;  2KFD A;  2RQP A;  3O2P E;  5EEA A;  2Y75 A;  4S0H B;  3QOE A;  5KAF C;  2E1N A;  3IWF A;  5L3C A;  4M3D A;  3TOB A;  4L18 B;  4WXC A;  3GEZ A;  1BBY A;  4CHU A;  2LOO A;  2R93 J;  1H0M A;  3S15 J;  1UZC A;  4WXH A;  1V4R A;  3PL8 A;  5H6Q A;  1IRF A;  2IJL A;  3OYC A;  1V54 H;  3LOC A;  3K4L A;  3A1Y A;  3ZRG A;  3WU0 A;  4DYQ A;  1WVR A;  1APL C;  3HEF A;  1HC8 A;  1ETY A;  2XAQ A;  4ENM A;  1G3T A;  2NAZ A;  2JUG A;  4A6D A;  5GTI C;  4ESF A;  4O6J A;  5E8G A;  4A0Y A;  4HX7 A;  1W5T A;  2W85 A;  3HGG A;  3KEO A;  3SZG A;  1VQP I;  3DTE A;  1JE8 A;  5L3F A;  4A3I J;  5F04 A;  4C9Y A;  4CCL A;  3WTV C;  2GLO A;  3ASN H;  2XRL A;  2CWE A;  4FHT A;  3GLL A;  4M6Y A;  4BY1 J;  5KAI C;  1ETX A;  4LLG F;  3VYU B;  2LDU A;  2DMT A;  3B73 A;  2GIZ A;  5E1Z B;  2X48 A;  3HJE A;  2JA7 J;  3WTY C;  2L02 A;  4RAY A;  1S72 I;  2ADU A;  1RZ4 A;  4UB6 C;  4XLF A;  4C2U A;  1JKP C;  3CUQ C;  4ASN A;  4CZZ A;  3X2Q H;  1FOK A;  1R7J A;  2VJJ A;  4DBQ A;  3OR2 C;  4AWX B;  4X0G A;  3CO6 C;  3A01 B;  4LG3 A;  1NHA A;  1P4X A;  1WJA A;  3BR1 A;  4BGD A;  1YS6 A;  4TV7 A;  2FE3 A;  5TIS C;  1R58 A;  1R4M B;  5BNG A;  1G4D A;  5IP7 J;  2VON A;  1BJA A;  5BQT A;  2XF7 A;  3BTJ A;  2P7V B;  4WK8 F;  4KDP A;  3PQK A;  2NNN A;  4HDU A;  5J1U A;  1SMT A;  4EM2 A;  2CUZ A;  1WFX A;  5FLM J;  3RIR A;  2BYV E;  1N77 A;  2FQ3 A;  2IA2 A;  1G59 A;  4PJJ A;  1MZB A;  2E19 A;  2QSF X;  1K78 A;  2JT1 A;  1TWA J;  1HW2 A;  2LBF B;  3H1C A;  5JFR A;  2JA6 J;  4F92 B;  5LGU A;  1YX5 A;  1REP C;  3NWS A;  2LH9 A;  3TGN A;  5HOO A;  2V4J C;  2HXO A;  2PJP A;  2MW8 A;  1SFO J;  2BW3 A;  4XK4 A;  2A61 A;  4PGG A;  4DW6 A;  4MFE A;  3K9T A;  4LK0 F;  3KZI C;  1LQ1 A;  5KNL A;  2X9D A;  4BDY A;  3S16 J;  1FIP A;  3GTG J;  3CCS I;  4M3G A;  4ESB A;  5FD5 A;  4CYC B;  1FTT A;  4QWQ A;  4XKV A;  1R49 A;  3R4K A;  3CCR I;  3GZ6 A;  3VSL A;  2WBM A;  3DTK A;  3TBI A;  4N0B A;  4JX5 A;  2E34 A;  4BBS J;  3HPG A;  1QRY A;  3FXO A;  3IUO A; 
#chains in the Genus database with same CATH homology
 5HS7 A;  1OR7 A;  3CUQ B;  1K6O A;  1KGS A;  2VC0 A;  2FBI A;  3I53 A;  3ZMT A;  2O03 A;  3CLO A;  3D0S A;  1FLI A;  5JR3 A;  3F22 A;  1IN7 A;  3NQO A;  2MLG A;  3SQN A;  3I0T A;  3IC7 A;  3LAP A;  2CQK A;  4CGZ A;  2VOD A;  1XDS A;  1FBS A;  2D45 A;  2Z33 A;  5HS8 A;  2K4J A;  4LB6 B;  1PUE E;  3I64 A;  1J2X A;  1G3Y A;  1IRG A;  4ENN A;  4N9H A;  3EET A;  1MDM B;  2KJC A;  4WCG A;  1QZZ A;  3D5L A;  3IHU A;  1ZAR A;  3VEP A;  2MH2 A;  3C18 A;  2IP2 A;  1GHC A;  2XAH A;  5LRR A;  4UHT A;  1BC7 C;  4A5M A;  1J75 A;  3WTW C;  3V7S A;  2FXA A;  2HGC A;  3NRV A;  5CYV A;  1DPU A;  5FLX K;  4A6E A;  3WG9 A;  4Q48 A;  1P4W A;  3MWM A;  2MC3 A;  3OOP A;  4P5O A;  1EH7 A;  2J5P A;  3DXJ F;  4HF2 A;  3C3W A;  1RNL A;  4G7H F;  5TRD A;  5TJJ A;  4S05 A;  2E1C A;  1R23 A;  3KLN A;  3KCC A;  1CGP A;  1JXS A;  4IXA A;  4L9J A;  3FMR A;  3ECO A;  2O8X A;  3VB2 A;  3K0L A;  2XRO A;  3LA3 A;  1FC3 A;  1VTN C;  3I5U A;  2FBK A;  1W7P A;  1R36 A;  5HS9 A;  2ZKZ A;  4ZYD A;  2IT0 A;  3V7C A;  2L3D A;  2GQQ A;  1FYL A;  4Y17 A;  4MQ9 F;  3HRS A;  2F5C A;  3GX4 X;  2QZ8 A;  1HXD A;  5D5V B;  1FP1 D;  5LEK A;  3ABU A;  4MHG A;  2GIV A;  1KQ9 A;  2HS5 A;  3T5X A;  5FLX Z;  2DI3 A;  3EUH A;  3LA7 A;  1ZH5 A;  1D8J A;  1SMY F;  4F7Z A;  4BHC A;  2OU2 A;  5J8F A;  2RDP A;  2ZNZ A;  1T0F A;  2CFX A;  1W5S A;  4U7D A;  4IRH A;  3HUG A;  3K1N A;  1UST A;  1S7O A;  3M8E A;  3FF5 A;  2EFN A;  3GXO A;  2AXL A;  3DPT A;  2LF7 A;  2YSR A;  2X4H A;  2A5Y B;  3GFJ A;  1O7L A;  3V7R A;  1W4M A;  3QU6 A;  2XKP A;  4YG2 F;  2F5F A;  1TQI A;  3WU1 B;  2HYF A;  1XB4 A;  3L2C A;  4HLX A;  3R0A A;  3SHF A;  1IN8 A;  4CIC A;  2DPD A;  4OIN F;  3BOQ A;  5A2Q K;  4HF1 A;  1P4A A;  3PFI A;  2VOP A;  5J6X A;  3I59 A;  2QBY B;  3R0J A;  4KT5 C;  1FYM A;  4IRI A;  3DP7 A;  1OYY A;  3ZP5 A;  4L0Z B;  5DCM A;  1STZ A;  5D5X B;  2EFW A;  2QQB A;  2V1X A;  1I27 A;  4FT8 A;  4L0Y B;  5E17 F;  3F8C A;  4UVB A;  1F1Z A;  2PI0 A;  1FWZ A;  3GVA A;  4A0Z A;  1DDN A;  3I58 A;  5FFZ A;  5J8C A;  3F72 A;  2Y48 A;  1FSE A;  1ZN2 A;  3R6S A;  1YO5 C;  2F5E A;  2EFP A;  2Z99 A;  5F64 A;  2LSO A;  1QGP A;  3WGI A;  5LHI A;  5DD8 A;  2Z3Y A;  1R00 A;  1EH8 A;  1T38 A;  2W25 A;  1JHF A;  1HKQ A;  2EWN A;  5L3D A;  4OIP F;  3DF8 A;  2YX7 A;  2G7H A;  2GAU A;  5ILU A;  4G9Y A;  5A2Q Z;  1IZ1 A;  4BH9 A;  1BI2 A;  2FMY A;  2ESH A;  2TDX A;  1YG2 A;  3P9C A;  5BOX A;  4EM0 B;  2DO7 A;  1KYZ A;  4KYW A;  3GFM A;  3GWZ A;  2ETH A;  1RIO H;  4LG0 A;  1ON2 A;  3VOE A;  4A2U A;  3RKW A;  2ZBK A;  4A0X A;  3LFK A;  2YR2 A;  3T8T A;  3QOP A;  1S6L A;  2VT3 A;  2VE8 A;  2J5O A;  4RGS A;  4AIK A;  3R61 A;  1E17 A;  1EH6 A;  3HHG A;  3KEQ A;  4MNU A;  5K1Y A;  2M8E A;  2HQN A;  4LLN A;  1P2F A;  5LHH A;  1A04 A;  1OMI A;  3T8R A;  5E20 A;  1T6S A;  5FGM A;  4M74 A;  3GO5 A;  2ZME B;  1JHH A;  1BI1 A;  4LB5 A;  5IT9 K;  4I7H A;  2OD5 A;  2D1H A;  3EDP A;  3TOA A;  1RUO A;  4EJT A;  2JPB A;  4M72 A;  1LB2 A;  3H3U A;  2KIF A;  3HRT A;  5LLQ A;  1B4A A;  2JSC A;  2QEN A;  4G6Q A;  1ZLJ A;  4HAM A;  2XKO A;  4L9T A;  1P6R A;  4S04 A;  3SZP A;  1U5T A;  2H27 A;  2C6Y A;  2LF8 A;  1ONV A;  3ISP A;  3HYI A;  4RGU A;  3J81 K;  4MTE A;  3F8M A;  3K2Z A;  4UVA A;  1O3S A;  4LD5 A;  4HYE A;  2P5L C;  1HST A;  4CO8 A;  2O3F A;  5HVQ C;  2EB7 A;  4EMS A;  5LEJ A;  1BI0 A;  3G3Z A;  5L3G A;  4WX9 A;  1XSV A;  1XGM A;  1ZG3 A;  1S3J A;  2PLY A;  2G9W A;  2L4M A;  1R5H A;  2EV6 A;  3KET A;  5CVJ A;  3QP6 A;  2JRT A;  4RGX A;  3RKX A;  4U0Y A;  5E1X A;  3H3Z A;  4G94 A;  3ROU A;  1PP7 U;  3EYI A;  1BOA A;  1WI9 A;  3TO6 A;  5CVR A;  2EV0 A;  1LEA A;  1SD4 A;  2VE9 A;  1J59 A;  1O3R A;  3M7G A;  3ERE D;  1AWC A;  1R5G A;  5LHG A;  1FY7 A;  3T0Y A;  1FX7 A;  2DW4 A;  1ZHF A;  5ICE A;  5ED4 A;  4HDV A;  1L3L A;  1BI3 A;  3QPH A;  2RV8 A;  3JAM K;  4Q4Z F;  1YS7 A;  3O3K A;  4M9S A;  3J81 Z;  2P5K A;  2L4A A;  4I2O A;  5D5U B;  1Y0U A;  4M6X A;  1R1U A;  4MEY F;  1YYV A;  4Q5S F;  4OIQ F;  3CDH A;  3RTR A;  5BPI A;  3DFG A;  1XSD A;  1KU2 A;  5CVU A;  2KKO A;  1MGT A;  1TQP A;  2JPC A;  5JI6 A;  2O61 A;  4UUV A;  1KYW A;  3BJA A;  2XV4 S;  3JTH A;  4HV6 A;  5DCF A;  2PG4 A;  2K27 A;  2F5D A;  4H0E A;  1EV7 A;  4G7Z F;  1ULY A;  5IT3 A;  5F6F A;  2PQ8 A;  3J80 K;  3U2R A;  3FX3 A;  2WV0 A;  5DD4 A;  1I1S A;  4WWC A;  1CF7 B;  3COA C;  4ENJ A;  4HX4 A;  4KIF A;  1MKM A;  4Q47 A;  3TO7 A;  5HDK A;  3BP8 A;  4IRG A;  3ZMV A;  5D5W B;  5BPD A;  2EJR A;  1ZG1 A;  4OIR F;  2IA0 A;  3L00 A;  3JAM Z;  2EA4 A;  3HTU A;  2P6S A;  3LAJ A;  1F4K A;  3VFZ A;  4KN7 X;  2L01 A;  5L3E A;  1XCB A;  3E5X A;  4KIB A;  1IXR C;  2IW5 A;  3R60 A;  3HIF A;  2HQR A;  2M1B A;  5AIQ A;  1TTY A;  3V8L A;  4DQ2 A;  3RYP A;  5HDG A;  4PZJ A;  4Z2Y A;  2EK5 A;  2FRH A;  2FBH A;  1UHW A;  4OIO F;  1IXS B;  1SD6 A;  2X0L A;  2A3S A;  3ECH A;  4L5J A;  3HHH A;  1USS A;  3TO9 A;  4I01 A;  3KP5 A;  2WTE A;  2HTJ A;  1L0O C;  3QAH A;  4Y13 A;  3IL2 A;  3F6O A;  2XIG A;  2M30 A;  3DKW A;  3RPQ A;  4EJU A;  4BHP A;  5D6F A;  2KJB A;  1HQC A;  1G3S A;  1ZRF A;  1UB9 A;  1D5V A;  3G73 A;  4L5I A;  3ZMD A;  2MBF A;  3MCZ A;  1O57 A;  3E6C C;  1XGN A;  3ZMS A;  3U1D A;  1H9T A;  4XBF A;  2H94 A;  4M9Z A;  4YFX F;  2XGX A;  1U6G A;  2H09 A;  2EA2 A;  2XUB A;  1Q1H A;  1SFX A;  2NYX A;  3E3V A;  1FZP B;  4IJA A;  4RB1 A;  3LST A;  2ZXJ A;  2KRF A;  4HA8 A;  3CO7 C;  1XSX A;  3RJP A;  1R22 A;  2XAS A;  1UFM A;  3BRO A;  2OQG A;  3SFZ A;  5CVV A;  1ODD A;  5F1R A;  1W7P D;  1PDN C;  4PCQ A;  4GYI A;  1K78 B;  4HW0 A;  2B0L A;  2Y0M A;  4KIG A;  4OU0 A;  1DUX C;  3QU3 A;  2QQ9 A;  3E5Q A;  2H6C A;  1FNN A;  2KIU A;  2OA4 A;  2RKH A;  3FMS A;  3ZQ7 A;  1RUN A;  5AON A;  4KA4 A;  2DFI A;  2LKP A;  1YW9 A;  4PDK A;  5KK1 A;  3GZ5 A;  3FM5 A;  4I0B A;  5DUI A;  4BHB A;  2OZ6 A;  1J0R A;  4CYD A;  3JW4 A;  4U0W A;  1OKR A;  3ZN1 A;  4AVP A;  2QM3 A;  4RB3 C;  1K7A A;  2A6H F;  3BPV A;  4UNO A;  2HKX A;  2Z5U A;  1IN4 A;  1HSJ A;  3GUD A;  5DYM A;  4UV8 A;  5FO5 A;  4HF0 A;  4I02 A;  2PMU A;  2XAG A;  4B8X A;  5CJ9 A;  2QLZ A;  5ILV A;  1FBQ A;  1RI7 A;  5K5O A;  5CVI A;  3KP7 A;  3GFI A;  5E8I A;  2ZCW A;  1DP7 P;  4GCV A;  4LGW A;  3TKY A;  4WXD A;  2W24 A;  4JK1 X;  4ENK A;  3LQQ A;  3AAF A;  4LJZ F;  4IHS A;  4KN4 X;  2XHK A;  1U78 A;  2CGP A;  2DLL A;  2PFB A;  4HX8 A;  1X3U A;  1KQ8 A;  4EVI A;  3WTU C;  2F2E A;  1ZGA A;  2FNA A;  4I98 B;  1R1T A;  3V8J A;  5DUK A;  3M9A A;  2LNB A;  3JTG A;  3Q5F A;  2DBB A;  4AD9 A;  5CLS A;  1Z6R A;  4ZYE A;  2M45 A;  2FU4 A;  3ULQ B;  2MD5 A;  1O3T A;  1WSU A;  3KZZ A;  2R3S A;  2P5V A;  1TNS A;  1R1V A;  4KIC A;  2HWV A;  1FSH A;  3RDI A;  3QRF F;  3KP2 A;  1BIA A;  3MQ0 A;  1W7P B;  5K5Q A;  2VT2 A;  3V4G A;  5HLG A;  1ZG5 A;  4EM1 A;  1YLF A;  2JZY A;  4HQE A;  2UXN A;  3ML6 A;  2OBP A;  3RYR A;  4UVC A;  1I5Z A;  1LNW A;  4KFC A;  3IKT A;  5EEG A;  2PN6 A;  3BPX A;  3HTS B;  1LDD A;  5EEH A;  3FXR A;  2CO5 A;  3WE2 A;  1Z9C A;  5LBQ A;  1G6N A;  1QZY A;  3IRR A;  5DDG A;  5D8L B;  1D3Y A;  4YIF A;  1SFE A;  3JSP A;  4IVN A;  3LA2 A;  3M1E A;  2K02 A;  2STW A;  1J9I A;  1LEB A;  3GFL A;  3FM3 A;  2DQL A;  4M71 A;  2GA1 A;  2P8T A;  2ZJ2 A;  3E6M A;  1MD0 A;  5H6R A;  2ISY A;  1KA8 A;  2GXB A;  5ICC A;  1FT9 A;  2O6G E;  1LVA A;  3LQR A;  4OOI A;  2FA5 A;  2P4W A;  4M73 A;  1GXP A;  1B9N A;  1TLH B;  2BV6 A;  1OPC A;  1I1G A;  1B59 A;  2W57 A;  4EJO A;  3F23 A;  2EFQ A;  3ABT A;  4HQM A;  1T98 A;  1SAX A;  1HBX G;  4BQA A;  4EGY A;  3HSE A;  2IA1 A;  2FF4 A;  4UXN A;  3KLO A;  4RGR A;  2OQR A;  2BGC A;  3WGH A;  2M5W A;  2NNY A;  4L9V A;  1QO0 D;  2P7C B;  4EJW A;  2QWW A;  2STT A;  2VC1 A;  1KU3 A;  4JQF A;  5BMZ A;  1TW2 A;  1FBU A;  4R1H A;  1AOY A;  2GZW A;  3CUQ A;  1JGS A;  5DCM B;  2ZNY A;  1F5T A;  2E7X A;  4U7B A;  3CJN A;  2Z9O A;  1IN6 A;  1YQA A;  4FX0 A;  5JHU A;  4HOB A;  1B6A A;  1HW5 A;  4ON0 A;  5ILS A;  4P55 A;  1J5Y A;  1SD7 A;  2JTV A;  4XLN F;  2MH9 A;  3E6B A;  1XGS A;  2Q2E A;  4KMU X;  3REO A;  4AIJ A;  1HW1 A;  3B02 A;  1ZRD A;  3CTA A;  2GA2 A;  3T1B A;  1BIB A;  3MEX A;  4BAY A;  2RNJ A;  5IT9 Z;  3P9I A;  5KVR A;  1F9N A;  2FOK A;  1IN5 A;  2HFH A;  2FML A;  2VN2 A;  1LDK B;  1WKM A;  4ZZD A;  2A07 F;  1MDM A;  2HZT A;  4O3M A;  3K1P A;  4L9N A;  1ON1 A;  1UHM A;  1OYW A;  2R7F A;  3FMQ A;  4MTD A;  2QQA A;  2VBW A;  4B09 A;  2BE5 F;  3FXU A;  2UZK A;  2CW0 F;  3HRU A;  1XMK A;  1WQ2 A;  1U5T C;  2XAF A;  2WWY A;  2XRN A;  4HV5 A;  4M9X A;  2O0Y A;  1DPR A;  1ZRC A;  4I09 A;  2CG4 A;  2QUF A;  3P9K A;  4P96 A;  1WWX A;  3E6D A;  4LG0 B;  3C1D A;  4ETS A;  3PQJ A;  5DV5 A;  3KE2 A;  3J7A O;  3BJ6 A;  3JSO A;  4EV0 A;  2GXG A;  2QYO A;  3MAJ A;  1ZRE A;  3V8K A;  2RC4 A;  3L09 A;  2V9V A;  2W84 A;  3E5U A;  3DQV C;  2BBY A;  3ELK A;  2K7L A;  1YTY A;  1GVJ A;  5E1W A;  4U88 A;  1K79 A;  5HLH A;  4HZF A;  4CXF A;  4P9U A;  1BC8 C;  2RN7 A;  3CUO A;  4LLL A;  4JBA A;  2QVO A;  3U9G A;  3P7N A;  3BY6 A;  2D1V A;  1LDJ A;  1U5T B;  2UXX A;  4QLC U;  2RGV A;  5D4R A;  2Q8K A;  3I4P A;  4R79 A;  4KMF A;  3RKY A;  3N97 A;  1H9G A;  5AIP A;  1XN7 A;  2VXZ A;  2HEO A;  3BDD A;  2COM A;  4BNC A;  3FZV A;  4AIH A;  2PMH A;  3M8F A;  3S2W A;  2FNP A;  4LMY A;  3KP4 A;  3GF2 A;  1Z91 A;  2ESN A;  5ICF A;  3NEU A;  1BN5 A;  1FYK A;  1KQ0 A;  2KIM A;  3SZT A;  4ZZL A;  3WE3 A;  3WGG A;  3QPT A;  3J80 Z;  1O3Q A;  4G8X A;  1I6X A;  2PBI A;  2VBX A;  1G3W A;  2HKO A;  3TDZ C;  4GO1 A;  2VBZ A;  4YFN F;  6PAX A;  2XAJ A;  4EGZ A;  2HDC A;  3BWG A;  4EQQ A;  2G7U A;  1C0W A;  2QBY A;  3RPU A;  4NHJ A;  2IPQ X;  3O6B B;  2YX4 A;  4K2E A;  1IUY A;  4OMY A;  1S8N A;  3HSR A;  5FB2 A;  2OAZ A;  5D8K B;  1LJ9 A;  1J7K A;  2HTS A;  2DK5 A;  1SFU A;  2DTR A;  3IKV A;  4D0P A;  5E18 F;  4PGH A;  2HYG D;  1Z6T A;  1QPM A;  1XDU A;  1UCR A;  3DEU A;  1YW8 A;  1XMA A;  3MZY A;  1P92 A;  1QNT A;  4A12 A;  4XSX F;  1XCV A;  4CDG A;  2DQR A;  3F8F A;  3I71 A;  1U2W A;  2V6C A;  3I54 A;  2NS0 A;  4P9F A;  4YFK F;  4IF4 A;  1IXC A;  3FHZ A;  3WTS C;  2R7D A;  1YW7 A;  1Z7U A;  2PEX A;  2WC2 A;  1U3E M;  1TW3 A;  4RS8 A;  4R8H A;  3F3X A;  4XSZ F;  1D8K A;  2DT5 A;  3GYH X;  1S7A A;  4WF2 A;  4UV9 A;  3F6V A;  4LK1 F;  3FXQ A;  2YU3 A;  1GXQ A;  3L7W A;  2IVM A;  2GWR A;  4GXO A;  4BXU A;  3WTT C;  3WOD F;  1QBJ A;  2EFO A;  1O7F A;  3KP3 A;  4KNY A;  5JVT A;  3BJO A;  1IW7 F;  3HSF A;  1IF1 A;  2V1D A;  3EQL F;  2A69 F;  2CYY A;  2ZME A;  3E97 A;  1YIO A;  2Q0O A;  5FFX A;  1T39 A;  3HOT A;  4GGG A;  3K69 A;  4A5N A;  5BS6 A;  3VOD A;  3BZ6 A;  2K86 A;  2P6T A;  2MLK A;  2A68 F;  2ZFW A;  3Q9V A;  2XVC A;  5L3B A;  1Z1D A;  4ZH4 F;  1XGO A;  4NB5 A;  3QP5 A;  2FEZ A;  4YII A;  4Y15 A;  1Z05 A;  5D6E A;  2K4B A;  4NQW A;  3TDU C;  3MFK A;  4XRF A;  4OMZ A;  2DAO A;  1HKS A;  1ZGJ A;  1ZYR F;  3F21 A;  1MJA A;  4HLY A;  3MZH A;  5LRS A;  3L9F A;  2MA3 A;  4I0A A;  3OV8 A;  3F8B A;  2VBY A;  1S29 A;  2RVC A;  1B1B A;  1U8R A;  5LGN A;  1OYI A;  1YFH A;  2V1U A;  4LFU A;  1WRJ A;  1MJ9 A;  4U0V A;  3IWZ A;  2HR3 A;  5HLI A;  4RAZ A;  3KZY A;  5K5R A;  5LGT A;  1ZAO A;  2EV5 A;  4ZYG A;  3HOS A;  1PP8 F;  2BEO A;  2D2W A;  2UWM A;  5H20 A;  2ZO4 A;  2HOE A;  3GW2 A;  4XLP F;  1HKT A;  2IRF G;  3DPL C;  4N9I A;  3EYY A;  3DV8 A;  3W6J B;  4HBL A;  4MGR A;  4GYG A;  3Q9S A;  2FSW A;  2AS5 F;  4RB0 A;  1TBX A;  1FPQ A;  2DU9 A;  4FX4 A;  4IHT A;  1KU9 A;  3KP6 A;  1FP2 A;  4MQV A;  4DNC A;  4E70 A;  3H92 A;  3K1M A;  3WTZ A;  3SXY A;  2M87 A;  4G6D A;  3KFW X;  5DEQ A;  3RI4 A;  2H6B A;  3FWE A;  2A6E F;  3LWF A;  2VOO A;  2YPR A;  3HRM A;  5D4S A;  3TQN A;  1T2K A;  1CF7 A;  2ISZ A;  4ZYH A;  1ZLK A;  3ZMZ A;  1E2X A;  2ACJ A;  2DPU A;  5HDN A;  3ZN0 A;  4ESJ A;  1SD5 A;  1XD7 A;  3GLX A;  3I59 B;  1TQM A;  2NRA C;  1MJB A;  1IAW A;  2L54 A;  3WTX C;  4IPA A;  3F8N A;  2E7W A;  2V79 A;  5FD6 A;  3W6K B;  3IRQ A;  1V3F A;  3ZMU A;  1TNT A;  2CSO A;  4KUM A;  1B9M A;  4RB2 C;  2DK8 A;  1QQI A;  1BM9 A;  2ELH A;  3C7J A;  5ERI A;  4EJV A;  2OZU A;  3ZPL A;  4MEX F;  4G7O F;  4O5V A;  1KU7 A;  5ICG A;  3N4M A;  4BYY A;  2RQP A;  3O2P E;  2Y75 A;  2E1N A;  3IWF A;  5L3C A;  3TOB A;  4L18 B;  4WXC A;  3GEZ A;  1BBY A;  4CHU A;  1H0M A;  4WXH A;  1V4R A;  5H6Q A;  1IRF A;  2IJL A;  3WU0 A;  2XAQ A;  4ENM A;  1G3T A;  2NAZ A;  4A6D A;  4ESF A;  4O6J A;  5E8G A;  4A0Y A;  4HX7 A;  1W5T A;  2W85 A;  3KEO A;  1JE8 A;  5L3F A;  3WTV C;  2CWE A;  4FHT A;  4M6Y A;  4LLG F;  2LDU A;  3B73 A;  5E1Z B;  3WTY C;  2L02 A;  4RAY A;  2ADU A;  1RZ4 A;  3CUQ C;  4ASN A;  4CZZ A;  1FOK A;  1R7J A;  4AWX B;  3CO6 C;  1NHA A;  1P4X A;  1YS6 A;  4TV7 A;  2FE3 A;  1R58 A;  1G4D A;  2VON A;  1BJA A;  5BQT A;  2P7V B;  4WK8 F;  4KDP A;  3PQK A;  2NNN A;  4HDU A;  1SMT A;  4EM2 A;  3RIR A;  2BYV E;  2FQ3 A;  2IA2 A;  1MZB A;  1K78 A;  2JT1 A;  1HW2 A;  5JFR A;  5LGU A;  1REP C;  3TGN A;  5HOO A;  2PJP A;  2A61 A;  4PGG A;  3K9T A;  4LK0 F;  1LQ1 A;  4ESB A;  5FD5 A;  4QWQ A;  3R4K A;  3GZ6 A;  4N0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...