5IT9K

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
96
structure length
96
Chain Sequence
b'MLIPKEDRKKIYQHLFQEGVLVAKKDFNQPKHEEIDTKNLFVIKALQSLTSKGFVKTQFSWQYYYYTLTEEGVVYLREYLNLPEHIFPATYLAGQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein uS2
molecule tags Ribosome
source organism Cricket paralysis virus
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
total genus 21
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF03501 S10_plectin Plectin/S10 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5it9K00
4NHJA 3TGNA 1RNLA 3RIRA 4HZFA 1WRJA 1KU9A 2P7CB 3G73A 1RZ4A 3CDHA 1O3SA 2A6HF 5D5VB 3WGIA 4L0ZB 3RPUA 1BI1A 1HW1A 2KKOA 3RYPA 1LDJA 5LHGA 3PQJA 3K1PA 5IT3A 1TBXA 4HBLA 1G4DA 2P4WA 5ICGA 1EH6A 1LJ9A 2GXBA 3DXJF 5ICCA 3COAC 1BC7C 4YFKF 4Y17A 3ZPLA 1MDMA 2LDUA 3MCZA 3BY6A 1G3TA 2UXXA 3MQ0A 2V6CA 2QWWA 4NB5A 2KIUA 2P5KA 2VOOA 1TQMA 2A61A 3RPQA 3FX3A 2HYFA 1WWXA 2WV0A 3HRSA 3T8TA 3R6SA 4I2OA 1WSUA 1FP2A 3M1EA 4ETSA 3T5XA 3O6BB 5BS6A 4A0YA 5L3CA 4AVPA 2RC4A 2ISYA 2QBYB 3QPTA 4EV0A 3GUDA 1ZG3A 4R79A 1Z91A 3Q9SA 1XCBA 1EH8A 2ZJ2A 4WWCA 1KYWA 4N0BA 2Z3YA 3F8NA 5HS7A 1O7LA 2AS5F 1QQIA 3FXUA 2VBWA 4BAYA 3QP5A 2IRFG 3HTSB 5FGMA 2DK8A 3HUGA 4G94A 2NS0A 2VT2A 1MJ9A 3E97A 3F8BA 5ERIA 1U2WA 1XMKA 1HQCA 5D6FA 3R61A 3E5UA 4A2UA 4L9TA 1JE8A 1FBQA 4KFCA 1SD4A 3LA2A 1P4AA 2HQRA 1YW7A 1W4MA 2G7UA 2DBBA 4L9VA 2FQ3A 3ZN0A 2BV6A 4U0WA 1REPC 2P6TA 4A0XA 5JHUA 2NNYA 2MLGA 1LEAA 3N97A 4LG0A 3IRQA 3E3VA 3ECHA 4LD5A 2H6BA 3FWEA 1F1ZA 2CGPA 4HQMA 4WK8F 3DPTA 5CVIA 2PI0A 2XVCA 3WTYC 3GLXA 2O6GE 3MZYA 3P9IA 1T6SA 4A0ZA 4A6DA 3S2WA 3H3UA 5D5UB 4U7DA 1EH7A 4S04A 2EA2A 3QPHA 1RUOA 1FSEA 1K78B 4I0BA 3VOEA 4JK1X 1BM9A 2G9WA 5L3GA 2Z33A 4KN7X 4G7OF 1CGPA 3ZP5A 3M8FA 4CYDA 4UV9A 3TO9A 2J5PA 4L9NA 4KDPA 2H94A 2KJCA 4GYIA 4IJAA 3BJOA 4ESJA 3V4GA 3KETA 2CYYA 5ICEA 4L5IA 2FSWA 3F21A 2YU3A 3HSFA 3ULQB 4ESFA 3WTXC 4L18B 4I7HA 2DQRA 3FHZA 5L3EA 4AIKA 2F5DA 4KIBA 1SMTA 4PZJA 5D5XB 4MGRA 4HA8A 3P7NA 2ETHA 2AXLA 1OR7A 5D8LB 3J81Z 4RGSA 3GEZA 2M8EA 5FLXZ 1T38A 5E1ZB 5K1YA 2DT5A 1R5GA 2Y0MA 3R0AA 4KYWA 2XKOA 1R1VA 5H20A 2MD5A 3CLOA 1HW2A 4BYYA 2HGCA 3L09A 4HF1A 5D4SA 1IN8A 4OIPF 2FMLA 4PCQA 3NQOA 4MEXF 2E7XA 1E2XA 3WGGA 1Z6RA 4A5NA 2QBYA 3LA7A 5DV5A 1K79A 1XB4A 3B02A 1YS7A 2A07F 3GXOA 2K27A 4LGWA 1BIAA 2CG4A 3EUHA 2XRNA 2ZKZA 2LSOA 1BIBA 1TW3A 4UXNA 3WTVC 4L0YB 1ZRCA 1TNTA 3CUOA 2L02A 3WU1B 1FNNA 3JAMZ 1USTA 4IHTA 4FT8A 1ON1A 3ELKA 1I27A 5HLIA 5ILUA 1XSVA 2V79A 1P92A 1FBUA 3DEUA 2HDCA 1BI2A 4U7BA 4I0AA 3KP3A 4ZYDA 1U5TC 2L01A 5L3BA 3CUQB 5ED4A 2FNPA 1O3RA 1O3TA 3LSTA 4Y13A 4Y15A 4WX9A 4IVNA 1IXSB 4XBFA 4UUVA 5CVUA 3K0LA 3QU3A 5E17F 4U0YA 3Q5FA 3BJAA 4XSZF 2XAGA 3WE3A 1OMIA 1IN6A 2ZCWA 1XSXA 4EQQA 2IJLA 2XROA 2DLLA 1B1BA 4LK1F 2HTJA 1GVJA 4MHGA 4PGGA 4HX7A 1LNWA 2EFNA 1XDUA 3BZ6A 2K86A 5E8IA 1H9GA 3E6CC 3I71A 2M30A 3RDIA 3TOBA 2TDXA 4HQEA 5IT9K 2L4AA 5AIPA 3WE2A 5BOXA 3LFKA 2D1VA 1BOAA 1R23A 4XRFA 1ZN2A 1R1TA 1TTYA 2CFXA 3K1MA 4ZYGA 4U88A 1U78A 2P5VA 3HOTA 3B73A 4D0PA 4M72A 5A2QZ 3IKVA 2QYOA 2EFOA 3M8EA 1HXDA 3KP5A 3FXRA 5HLHA 2QZ8A 2OQGA 2CW0F 4RGXA 4GGGA 5ILVA 2F5FA 5FO5A 1IXRC 2W85A 5ICFA 3F22A 1PP7U 3P9KA 1YW8A 4FX0A 1CF7B 2F5CA 5KVRA 4BHBA 3RJPA 4PDKA 5FFXA 4ON0A 4LJZF 1LEBA 4KN4X 4WCGA 2X0LA 1S8NA 4G6DA 1IAWA 4LFUA 1MD0A 1YYVA 1JGSA 5L3FA 5K5OA 2A68F 2BGCA 1W7PA 2DPUA 1IN4A 4MQVA 3WG9A 3I54A 4RB0A 4LLGF 4BH9A 1V4RA 2FE3A 1LDKB 3ZMZA 1UCRA 3EETA 2NAZA 3F8MA 2FMYA 2K7LA 3O3KA 2NYXA 3DFGA 1ZRFA 4P96A 4YIIA 3CUQC 4HDVA 3V8KA 4MQ9F 4M6XA 2DTRA 3J80K 2R3SA 3RYRA 4A5MA 1XGSA 2ZBKA 4Q47A 4N9IA 1ZGAA 3MZHA 4OINF 4I01A 3C1DA 3GZ6A 1KA8A 1BI0A 2PBIA 2H27A 1F5TA 4RB2C 4CO8A 1ONVA 4NQWA 2E7WA 1GXPA 4HLXA 3I4PA 1IN7A 2QQ9A 5DD8A 4KMUX 2V1DA 4RAYA 2O0YA 1V3FA 2VOPA 1HKSA 1AWCA 2OU2A 1MZBA 3KP6A 4YG2F 2M5WA 5CVJA 2Z99A 3F3XA 4G7ZF 3SQNA 1FY7A 4BNCA 4KUMA 1U5TB 5JFRA 1R22A 3F8CA 3C7JA 2PJPA 4OIRF 2RV8A 2CO5A 1IW7F 2EV6A 1FYLA 2VBYA 3ZMVA 4EGYA 4M71A 3M7GA 2HFHA 3L7WA 4EVIA 1FLIA 2ZFWA 2MC3A 3TDUC 2L3DA 4B8XA 3ERED 2W25A 3L2CA 4AIHA 4ESBA 3SFZA 5DUKA 1F9NA 4KA4A 1R1UA 2OZUA 3RKWA 2XHKA 3E5QA 1UB9A 2V9VA 2FRHA 1B6AA 4ENMA 2Q0OA 1ZAOA 4F7ZA 1XGNA 3ROUA 1ZLJA 3HRTA 5LBQA 3ZMTA 1G3YA 3WU0A 4KMFA 1QPMA 1G3SA 4FX4A 3KCCA 4BQAA 5K5QA 2HEOA 4KNYA 2HWVA 2YPRA 1FP1D 2YSRA 3TKYA 1SMYF 3LWFA 2IA0A 3RKYA 3HHGA 4RGRA 3MWMA 3EYIA 1R00A 1QNTA 2DI3A 2IPQX 2ZO4A 5H6QA 4K2EA 2MLKA 1ODDA 1QBJA 1R7JA 3F72A 1ZG5A 3GFJA 3SXYA 4ENJA 4GYGA 1KQ8A 1J9IA 1PP8F 1ZHFA 4IPAA 4ENKA 1FSHA 2FXAA 4G8XA 5HS9A 3ISPA 3RKXA 4ZYHA 4RAZA 4ZZDA 5HDKA 2FF4A 4LG0B 4UNOA 2VXZA 4EMSA 3J80Z 2GWRA 2K02A 3W6KB 2BEOA 2JTVA 4G6QA 1O7FA 2OQRA 1FYMA 1SD7A 3HRUA 1OYYA 4HX4A 4I02A 4L9JA 2FBHA 2O03A 5FB2A 4EM1A 1FYKA 2M1BA 4P9UA 4HYEA 2A6EF 2EV0A 5E8GA 1BN5A 2M87A 1L0OC 1YS6A 3KP2A 1J0RA 3O2PE 1WKMA 3IL2A 4MNUA 2VONA 2O3FA 4BXUA 1U8RA 3IHUA 3VODA 3HIFA 4HV6A 4ENNA 4P55A 2A69F 2ZXJA 4CZZA 4G7HF 3GO5A 3RI4A 1A04A 1S7AA 2KJBA 2IA1A 2HYGD 1YQAA 1FX7A 3R0JA 1WI9A 2JRTA 4OMZA 4OIQF 5F1RA 3WTTC 2ACJA 5D6EA 4S05A 2MH9A 1OYWA 3LQRA 4M74A 4Q4ZF 4ZYEA 1J5YA 4HF2A 3MAJA 5JI6A 1RIOH 2IW5A 2ZMEA 1UHMA 4RB3C 3W6JB 5FFZA 5LRRA 3ML6A 3CO7C 2O8XA 1RI7A 2DAOA 2DK5A 1IXCA 1OPCA 1T0FA 2K4JA 1P2FA 2E1CA 3DPLC 3K2ZA 2UWMA 1STZA 4UV8A 5FD5A 3C18A 1MJAA 1S6LA 1GXQA 3I58A 1SD5A 2JSCA 4BHCA 2HZTA 5JR3A 4A6EA 2VE8A 3WTWC 5IT9Z 2JPBA 2VBXA 5BQTA 2Q2EA 2HR3A 3LA3A 1YW9A 1BC8C 5KK1A 2Z9OA 2W57A 2W24A 3HRMA 1IZ1A 2G7HA 1I6XA 3GYHX 3HTUA 1TW2A 2UZKA 1IUYA 4YFNF 4JBAA 3BPVA 5DCMB 3V7CA 5F6FA 2KIMA 2PFBA 2V1UA 2XASA 3FZVA 4GO1A 1MJBA 4YIFA 3KP4A 5LEKA 5L3DA 1FPQA 3DP7A 3KZZA 5BPIA 1IF1A 1KQ9A 1QO0D 1YIOA 4TV7A 4O3MA 5E18F 1S7OA 4DQ2A 3JW4A 3LQQA 2BYVE 3TO7A 5D8KB 3KEOA 1SAXA 2P6SA 4MTDA 1PUEE 1TQIA 3R60A 4R1HA 5J8FA 3ABUA 1HKTA 5J6XA 2EWNA 3RTRA 1HSJA 4LB6B 3WGHA 3PFIA 3SZTA 1OYIA 2ESHA 5AIQA 4AD9A 1EV7A 2A3SA 4OIOF 5EEHA 2HKXA 3R4KA 3GFIA 2XGXA 4EM2A 3T8RA 3WODF 1R36A 4XLPF 1H0MA 1H9TA 2GA2A 1D3YA 1XMAA 4O5VA 1C0WA 2KIFA 3JSPA 1U3EM 2COMA 2Y48A 5LGNA 4M6YA 4EM0B 2QQAA 1I1GA 3FM5A 1QGPA 1I1SA 3CUQA 1T39A 1R58A 1SFXA 4BHPA 2FOKA 3DKWA 3Q9VA 2V1XA 5HDGA 3KLNA 1BJAA 1DPUA 3D0SA 2QENA 3KFWX 3WTSC 3BDDA 3NRVA 3H92A 1HW5A 3I0TA 2ESNA 3LAPA 3BJ6A 1P4XA 2HS5A 3FMQA 3T1BA 2W84A 2OD5A 3WTZA 4ASNA 3G3ZA 1ZARA 2MH2A 3K69A 1XGOA 1B9NA 1FWZA 4AIJA 3QP6A 3KEQA 5H6RA 3ZN1A 1I5ZA 3GX4X 1K7AA 2LNBA 4UVBA 3K9TA 3SZPA 5TRDA 2IP2A 3J7AO 4KIGA 2EV5A 2DW4A 4LMYA 2JT1A 2HKOA 1P6RA 2PMHA 1IRFA 1D8JA 4EJOA 5F64A 3DV8A 2R7FA 5DUIA 2VODA 3FMRA 2Q8KA 1FC3A 1NHAA 1MKMA 2GXGA 1G3WA 2EFQA 1U6GA 1XGMA 1D8KA 4U0VA 4LB5A 3MFKA 2MA3A 4UVCA 3E5XA 2EJRA 5BPDA 5LHIA 5TJJA 3JTHA 2ADUA 1JXSA 4FHTA 3VB2A 4YFXF 4RGUA 1U5TA 1OKRA 5DD4A 1TQPA 1HKQA 3V7RA 3GVAA 1WQ2A 1HSTA 1KU2A 3QRFF 1G6NA 1J59A 5LEJA 1K6OA 2EB7A 5E1WA 4UHTA 4QLCU 2OA4A 5D4RA 3BWGA 4HF0A 4HX8A 2GAUA 3K1NA 1ULYA 1R5HA 1RUNA 2RN7A 1O57A 5LHHA 1MDMB 2PQ8A 4HDUA 2YX4A 1J7KA 1FT9A 1Z7UA 5D5WB 3E6MA 4DNCA 3PQKA 3KP7A 2IT0A 3BP8A 1Y0UA 4PGHA 5CJ9A 1XDSA 5DYMA 2BE5F 3TOAA 2FEZA 1T98A 4MEYF 3VFZA 4HAMA 3C3WA 4LLNA 4IRGA 3U9GA 4G9YA 3T0YA 4Q48A 3BPXA 2RNJA 1ZLKA 1AOYA 4EJTA 5DCFA 4A12A 2H09A 2YR2A 2VBZA 1ZYRF 3GFLA 1UFMA 1SFUA 4GXOA 3REOA 4ZH4F 1KYZA 3KLOA 2H6CA 1Q1HA 3HSEA 2FNAA 2L4MA 2FU4A 3D5LA 3GWZA 2GIVA 3ABTA 1L3LA 2O61A 3ZMUA 2HTSA 1YTYA 4OU0A 3L00A 2D45A 4ZZLA 4KT5C 3MEXA 2DU9A 1Z9CA 3QOPA 4EJWA 5E1XA 1KGSA 3L9FA 2LKPA 3GW2A 2CWEA 2J5OA 4I98B 2D1HA 4CHUA 2STWA 2NRAC 5ILSA 1UHWA 2XKPA 5BMZA 5FD6A 5A2QK 2A5YB 2GA1A 5DEQA 2M45A 2HQNA 2QVOA 5LGUA 1HBXG 5DDGA 1LB2A 3QU6A 4M9SA 4CXFA 4P5OA 3ZMSA 1KU7A 3JTGA 1DDNA 3JSOA 2Y75A 4HW0A 4CDGA 2XAJA 4L5JA 3ZQ7A 5AONA 2RDPA 5HLGA 3TQNA 2JPCA 4OMYA 3CJNA 1BBYA 3CO6C 1K78A 1JHHA 1F4KA 4IRIA 4HOBA 4H0EA 4O6JA 4E70A 1S29A 2UXNA 3ECOA 1XD7A 1ZRDA 4CGZA 5FLXK 5HVQC 3IRRA 2XAQA 3FMSA 2YX7A 4JQFA 3DF8A 3VEPA 4MTEA 2PG4A 3HOSA 5CVRA 3EDPA 3F23A 5CYVA 3M9AA 5CLSA 1E17A 3KE2A 4R8HA 3F6VA 4IRHA 1FOKA 1B59A 1KU3A 2ZNZA 2EFWA 1B4AA 2F5EA 1YFHA 1TLHB 4M73A 1IRGA 4KICA 4WXHA 4GCVA 2EA4A 1QZYA 2OBPA 1TNSA 3LAJA 2MBFA 3I59B 4IHSA 3FM3A 3JAMK 2WC2A 3HSRA 5LGTA 1YG2A 1LQ1A 2XIGA 2GZWA 4M9ZA 2R7DA 6PAXA 1XN7A 3IKTA 4AWXB 4M9XA 1DPRA 2STTA 3NEUA 1S3JA 1XCVA 5HDNA 5K5RA 4EJVA 5HS8A 1SD6A 4Z2YA 3I53A 2RVCA 4QWQA 4XSXF 1JHFA 1DUXC 2DO7A 5DCMA 2VC1A 4OOIA 3U1DA 2RQPA 1YO5C 4B09A 1USSA 2NNNA 1B9MA 1PDNC 4I09A 2VT3A 2IVMA 4WXDA 1Z05A 5HOOA 1QZZA 3OOPA 1DP7P 2FBKA 3CTAA 3FF5A 4UVAA 4WXCA 2C6YA 1W7PD 1W5TA 2QM3A 2ZMEB 1ZGJA 5LRSA 3KZYA 3U2RA 3P9CA 3J81K 4KIFA 1IN5A 2ZNYA 2PLYA 2VN2A 2X4HA 4N9HA 2OZ6A 2FBIA 3GZ5A 3TDZC 1XSDA 2EFPA 1LDDA 2BBYA 2CQKA 2QLZA 1CF7A 2OAZA 1P4WA 2QUFA 4RB1A 2WWYA 3IC7A 3QAHA 4EGZA 3ZMDA 5JVTA 1W5SA 3HHHA 4P9FA 2GQQA 2DQLA 1LVAA 2B0LA 2XAFA 4Q5SF 1J75A 3I59A 1FZPB 3BROA 4IXAA 4LK0F 2LF7A 1X3UA 3I64A 2CSOA 3GF2A 3FXQA 1D5VA 1SFEA 1Z1DA 1MGTA 4HV5A 2EK5A 3E6BA 2PN6A 3GFMA 1J2XA 2LF8A 1T2KA 3E6DA 2HOEA 2VC0A 2KRFA 2XV4S 2ELHA 3EYYA 3OV8A 3IWZA 1YLFA 1BI3A 2FA5A 4LLLA 3AAFA 2P8TA 3WTUC 3V8LA 3BOQA 2Z5UA 2WTEA 2RGVA 3F6OA 1ZREA 3V8JA 3N4MA 1ON2A 2P7VB 2E1NA 4RS8A 5EEGA 2ISZA 1W7PB 1GHCA 2IA2A 3IWFA 5CVVA 1KQ0A 1O3QA 2K4BA 1ZG1A 2F2EA 4IF4A 2PEXA 1ZH5A 2XAHA 2VE9A 3HYIA 3I5UA 2QQBA 2DFIA 2RKHA 2D2WA 5LLQA 3EQLF 3SHFA 3DQVC 4XLNF 2XUBA 1Z6TA 2P5LC 2L54A 5E20A 2PMUA 3V7SA 4EJUA 1FBSA 4WF2A 3TO6A 3F8FA 4CICA 2DPDA 3H3ZA 2JZYA 4HLYA 1VTNC 5J8CA
chains in the Genus database with same CATH superfamily
4NHJA 3TGNA 2EH3A 4CCLA 1W0TA 1RNLA 2AQEA 4HNTA 3RIRA 2R5ZA 1P9QC 2MABA 4HZFA 3BC8A 1MW7A 2LC2A 4XONA 1A31A 1WRJA 2CW7A 2ZJQF 1KU9A 2P7CB 4ZC3A 2EILH 3G73A 1RZ4A 2Y9YA 3CDHA 1O3SA 2A6HF 1BR1A 3CD6I 4CYCA 3S1QJ 5FJ8J 5D5VB 3OYGA 3WGIA 4L0ZB 4J00A 1LVKA 1Y56A 1BI1A 3RPUA 5B3SH 1TC3C 2E1MC 1HW1A 2KKOA 3F0CA 1FTZA 3RYPA 1LDJA 3CJRB 5LHGA 1T95A 3PQJA 4XRMA 3K1PA 4F92B 5IT3A 3JRIA 1TBXA 4HBLA 2QEXI 1G4DA 2MW8A 4XMYA 1MSFC 2P4WA 5ICGA 4RDUA 2ELKA 1EH6A 2HVQA 1LJ9A 2CW8A 5K7FA 3GTJJ 2GXBA 2M4KA 1A5JA 5KCMA 3DXJF 5ICCA 3COAC 1BC7C 5EEAA 1T08B 4YFKF 1SFOJ 3K4BA 4Y17A 3ZPLA 1U9NA 1MDMA 3HZJA 3LSGA 2LDUA 3MCZA 4II3A 3BY6A 5J1UA 1G3TA 1ITYA 2UXXA 3MQ0A 5GPAA 2V6CA 1YJWI 2ID3A 2QWWA 2QSHX 2JVHA 4NB5A 4BQNA 2KIUA 2P5KA 2JA8J 2VOOA 1TQMA 2A61A 3RPQA 3FX3A 4CSWA 4BE1A 2HYFA 1WWXA 2WV0A 1MMDA 3HRSA 2NVUB 3T8TA 2MSYA 3R6SA 4I2OA 5EYRA 1WSUA 1JTXA 1FP2A 3VYUB 3M1EA 4ETSA 3T5XA 3O6BB 2E5NA 2LRDA 2DJNA 5FLMJ 3TW6A 1T33A 5BS6A 4UUSA 1AHDP 4A0YA 5L3CA 2XC7A 4AVPA 2TRTA 2RC4A 3OIQA 2ISYA 2QBYB 2HDWA 1K4TA 3QPTA 4EV0A 3GUDA 1ZG3A 3GCMA 4R79A 1Z91A 3DPUA 1MNMC 3A03A 2QSGX 3Q9SA 3RQ4A 1XCBA 1EH8A 2NS8A 3HL2A 1Z67A 3B6CA 5CQEA 4OAZA 4XRSA 4FISA 2ZJ2A 4WWCA 1KYWA 1UZCA 4N0BA 2LYCA 2Z3YA 1ETXA 3F8NA 5HS7A 1O7LA 3RQIA 3GTGJ 2AS5F 1QQIA 2Z2SB 4NC7A 1XPXA 3FXUA 3QYFA 1OFCX 2L2OA 2VBWA 1LE8B 4BAYA 3QP5A 1H8AC 2G0EA 2IRFG 3MD2A 3HTSB 2AO9A 5FGMA 2KHMA 2DK8A 1YE9A 2DFEA 3HUGA 4GDFA 4G94A 1FJLA 3UR3C 3RZDJ 2EZHA 2NS0A 2CUEA 2VT2A 1MJ9A 3ASNH 3E97A 3F8BA 5J3LA 4YELA 1SANA 2DMUA 5LFAA 2F5VA 4A3BJ 3G71I 2LFBA 5ERIA 2CUZA 2NVYJ 1U2WA 1XMKA 1HQCA 3BG9A 2F4IA 2CV1A 4CCNA 5D6FA 3R61A 3E5UA 4A2UA 2KISA 3HPHA 4L9TA 4XKWA 1JE8A 3HGGA 1FBQA 4XKCA 3KIOA 4KFCA 1VQ4I 5DM7F 2BXZA 1SD4A 3LA2A 1P4AA 1SC7A 2HQRA 5IYCJ 1YW7A 2GIZA 1R4NB 1R4MB 1W4MA 3DTEA 3OYEA 2G7UA 2DBBA 2YUSA 3ZRGA 4L9VA 4XN3A 2FQ3A 3ONQA 3ZN0A 4IOAF 4QPOA 2BV6A 4U0WA 1REPC 4A3GJ 2P6TA 4HPQA 4A0XA 5JHUA 2NNYA 2MLGA 2VB6A 4LITA 3PUBA 5C4JJ 1LEAA 2Y30A 1Y0NA 3N97A 4LG0A 3E0JB 3IRQA 3E3VA 3ECHA 4A3FJ 2HOTA 4LD5A 3E1SA 3K4NA 2F6CA 2H6BA 3CF2A 4PJNA 2R7QA 4BXFA 2LTPA 1F1ZA 2BVLA 2XGCA 3FWEA 2A6TA 4HQMA 4WK8F 3OYLA 3DPTA 5CVIA 1D5YA 2CGPA 2PI0A 1DP3A 2XVCA 3OYCA 2XAUA 3WTYC 3JRFA 1RETA 3MKZA 2ZJRF 3UKGA 3GLXA 3A01B 3AL0B 3CZ6A 4CCOA 2O6GE 3MZYA 3P9IA 2L9VA 1T6SA 4A0ZA 3D5RC 3PO3J 4XRSG 1NG7A 3S2WA 4A6DA 1FTTA 3H3UA 4CA0A 4RLFA 5D5UB 4U7DA 1EH7A 4S04A 2EA2A 3CP8A 3QPHA 1RUOA 2X51A 2Z16A 1FSEA 1K78B 2L9RA 2R5YA 4I0BA 3VOEA 4JK1X 1BM9A 2G9WA 1A35A 1X4OA 3OYFA 5L3GA 2UUZA 2Z33A 3BTJA 4KN7X 4G7OF 1CGPA 3ZP5A 3M8FA 5FKLA 2VPRA 5E3OA 4CYDA 3CMYA 1Z0XA 2NVTJ 2VKDA 4UV9A 2J5PA 3TO9A 3HPGA 1JT0A 1UJ8A 4L9NA 5JLXA 3IV5A 1DU0A 4KDPA 1VQMI 2H94A 2KJCA 3IH3A 4GYIA 4IJAA 3BJOA 3FDYA 4BDYA 4ESJA 2PJRA 3I56I 3PIOF 3V4GA 3KETA 3AG2H 2CYYA 5ICEA 4L5IA 2FSWA 3F21A 1POGA 3OS2A 2YU3A 1K61A 3HSFA 3ULQB 4ESFA 2V7FA 2QSFX 3WTXC 4L18B 4I7HA 2DQRA 1ETQA 3GBGA 5EGOA 3FHZA 5L3EA 4AIKA 2F5DA 1H88C 4KIBA 5KHDA 3DU6A 1SMTA 3EUKL 4PZJA 5D5XB 2DN0A 4MGRA 2L9SA 4HA8A 3P7NA 2ETHA 1YX5A 2AXLA 1IGNA 1OR7A 2JWTA 3BG3A 1WJ5A 2IEKA 4RGSA 5D8LB 3J81Z 4Y52J 2HNHA 2L7KA 3GEZA 2DYSH 2M8EA 5J47A 3S3MA 1QRYA 5FLXZ 1PVEA 1T38A 4C2MJ 5E1ZB 5K1YA 5F04A 2DT5A 1KONA 3BR1A 1ZK8A 1R5GA 2Y0MA 3R0AA 1MMGA 4HG2A 4KYWA 1IDYA 1R1VA 2XKOA 5H20A 2MD5A 3CLOA 4LG3A 1BW6A 1IC8A 5BNGA 1HW2A 1VQ9I 5GAHJ 2MFZA 3OWTA 3JRGA 4D5FA 4BYYA 2HGCA 2XB5A 1ZKGA 5EJCA 3L09A 4IHWA 3GLLA 4U87A 3CDLA 4HF1A 4AYBN 2WV1A 5D4SA 2LVSA 2OV7A 1IN8A 4OIPF 3RZOJ 2FMLA 4PCQA 5E3MA 2W7NA 4AC0A 2ZXWH 2ZMEC 3NQOA 4HRIA 4MEXF 2R93J 1FOYA 2E7XA 3FXLA 4OAYA 1E2XA 1LKXA 3WGGA 3BTCA 3PL8A 1Z6RA 3AKZA 4A5NA 3JRHA 3D1NI 3LA7A 2QBYA 2YU9J 5DV5A 1R5ID 1K79A 2CUFA 1XB4A 3B02A 3FBIB 1YS7A 2HOAA 2LY9A 2A07F 4C2UA 4AYBA 3GXOA 1Y1VJ 2K27A 3HOUJ 3WHBA 4LGWA 1BIAA 2CG4A 3EUHA 2XRNA 2ZKZA 2A05A 2LSOA 1BIBA 4IL6C 2XRLA 2HPMA 1TW3A 1ETWA 2X1EA 1IO2A 5CKTA 3AG3H 4UXNA 3H9QA 3L1PA 4V2FA 3WTVC 4E7KA 2QF7A 4L0YB 1ZRCA 1TNTA 3CUOA 1OQYA 2L02A 3WU1B 2IXSA 1FNNA 3JAMZ 4XIDA 1USTA 4IHTA 4FT8A 1JKRC 1ON1A 3ELKA 1YITI 4G12A 3M1CA 1I27A 5HLIA 1GV5A 4BE2A 3IUOA 5ILUA 2ZXIA 1XSVA 2V79A 3HUGB 3H9JA 3J7ZI 1ETVA 1P92A 1FBUA 3DEUA 2HDCA 1BI2A 2ZB9A 4IQ4A 5CQGA 2EBIA 4U7BA 4I0AA 3KP3A 4ZYDA 1P7IA 1W0UA 3S8PA 1U5TC 3CCUI 2L01A 5L3BA 1IRXA 3CUQB 3DBRB 2R7XA 5ED4A 3CMMA 1E3HA 2JSPA 4IZZA 3DKYA 2RNGA 2FNPA 1O3RA 1O3TA 5EGOB 3LSTA 4Y13A 2AQFA 4Y15A 4WX9A 4RAFA 2R7RA 4IVNA 1IXSB 3L2RA 2QA4I 4XBFA 4UUVA 4DJAA 2CRGA 5CVUA 4XLFA 1X1BA 3K0LA 5FRNA 3H9GA 3QU3A 2CQQA 5E17F 2HPIA 2M7AA 3MN2A 4U0YA 3Q5FA 2OJED 3BJAA 4OWRB 1WCMJ 2F4OB 4XSZF 1VFCA 2L5QA 1S9HA 2XAGA 3WE3A 2M0CA 1D0ZA 1I50J 2M9HA 3IAM2 3OL3A 5KAIC 1OMIA 4A3MJ 5HLTA 4A93J 1IN6A 2BY2A 2ZCWA 3RSNA 2K9MA 1XSXA 4EQQA 1FOXA 2IJLA 2XROA 2DLLA 2E2HJ 1K83J 1B1BA 4LK1F 2KRHA 3CQZJ 2HTJA 1GVJA 5HNFA 4MHGA 4EEFG 1LFUP 4PGGA 2WA0A 4HX7A 4XKBA 3K10A 4YEJA 1LNWA 1A6QA 2EFNA 1XDUA 3BZ6A 2K86A 5E8IA 2KLOA 2WB1A 1Y6IA 2ZJPF 4PFPA 1H9GA 3E6CC 5M5WJ 4DYQA 3I71A 2M30A 3RDIA 3ZR8X 3KYLA 3CCMI 3VDXA 3TOBA 2LY1A 1E3OC 1D0YA 2O9LA 2TDXA 4HQEA 2V9KA 5IT9K 2L4AA 4CH7A 2GLOA 3DU5A 2JUCA 5AIPA 5GPCA 3ZCOA 3WE2A 2RQQA 5BOXA 5IOYA 3LFKA 5M3MJ 2XPVA 1QHGA 2D1VA 4XLHA 1BOAA 5GTHC 2IGKA 4F52A 3PIPF 1R23A 1I6HJ 3BG6A 4XRFA 5TISC 1ZN2A 1R1TA 1TTYA 2CFXA 3K1MA 4ZYGA 3LSIA 4U88A 4Y7NJ 5F1JA 1U78A 3A2KA 2P5VA 3HOTA 2JN6A 3B73A 4GRIA 4D0PA 4M72A 1YRNB 2VQGA 4B3XA 5A2QZ 4A3IJ 3IKVA 2QYOA 2EFOA 3M8EA 1HXDA 3KP5A 3FXRA 5HLHA 2QZ8A 3BTLA 2OQGA 2VXDA 5J1YA 2CQ7A 3A4CA 2CW0F 3ZQLA 4RGXA 4GGGA 2QKMB 5ILVA 3EPZA 2F5FA 5FO5A 1IXRC 2W85A 3HDDA 3GTPJ 5ICFA 2OF7A 3KZIC 2TCTA 3F22A 1PP7U 3P9KA 4LIUA 1YW8A 4FX0A 4PSXA 4PJJA 1CF7B 3S1MJ 2F5CA 1W36C 4XN0A 5KVRA 4BHBA 3RJPA 2X1DA 2HQAA 4PDKA 4FTHA 5FFXA 4ON0A 4LJZF 4ZDLA 3HOYJ 2YS9A 1VQLI 2E5ZA 4KN4X 2XGEA 4WCGA 1LEBA 2X0LA 1SVMA 1S8NA 4G6DA 4HNVA 2X6WA 1PUFB 1IAWA 3ZQIA 4N4NB 4LFUA 1MD0A 1YYVA 1R49A 2JA2A 3PJRA 1JGSA 5L3FA 3H36A 2X85A 5K5OA 1E3PA 2R7VA 3ZGKA 1LFBA 2A68F 2BGCA 1W7PA 2DPUA 1IN4A 4MQVA 3CCJI 3WG9A 3I54A 3I3LA 3LSKA 4RB0A 4LLGF 3ERMA 4JX6A 4BH9A 2IS4A 3PNVA 4II2A 1V4RA 1WI3A 3HKZA 3O8HA 2FE3A 2PX9A 1LDKB 1YJ9I 4ZDOA 3ZMZA 1IV6A 1UCRA 1ACIA 3EETA 2OPTA 5KAFC 3I4NJ 2BW3B 2E1MB 3DLAA 2NAZA 1BR2A 3F8MA 2FMYA 1OLTA 2K7LA 3PFYA 3O3KA 2NYXA 2HZDA 3DFGA 3G4SI 1ZRFA 1MBJA 2PMZA 4P96A 4W97A 2XGDA 3HJEA 4YIIA 2W1OA 4ZTFA 3HKZN 3CUQC 2WBMA 4HDVA 1B8IB 3PSIA 3V8KA 4RMNA 3VPRA 3CCRI 2BVMA 4MQ9F 3K4CA 3OIPA 4M6XA 4IKFA 4C9YA 2DTRA 2DXIA 2NOGA 3J80K 2R3SA 3RYRA 2R7WA 3S2HJ 4A5MA 2LBFA 1BR4A 2HXOA 1XGSA 3B6AA 4BGDA 2ZBKA 9ANTA 2OTLI 4AVZA 4Q47A 4N9IA 1XMXA 4BJ5C 1ZGAA 3MZHA 4OINF 4I01A 3C1DA 3Q0WA 2E35A 3GZ6A 2EPFA 1KA8A 1BI0A 2PBIA 2H27A 1SVOA 1F5TA 2GXAA 4RB2C 2R92J 4CO8A 1ONVA 4NQWA 4V19K 2E7WA 2CMPA 1GXPA 1N77A 4HLXA 3I4PA 1GDTA 1IN7A 1TWCJ 2QQ9A 5DD8A 4KMUX 1Z77A 2V1DA 4RAYA 4D9JA 1ZTRA 2O0YA 3I9V2 4B1RA 1V3FA 2VOPA 4BS9A 5DS9A 1TWAJ 1JJ8C 1HKSA 3ESWB 5M5XJ 1AWCA 2OU2A 1MZBA 3KP6A 4YG2F 4BEHA 2M5WA 2VQCA 5CVJA 2Z99A 3F3XA 4G7ZF 3SQNA 1T56A 2CJJA 4ZJZA 1FY7A 4YIRX 4KUMA 4BNCA 3CCLI 4E7LA 1U5TB 1ZELA 5JFRA 1I39A 2E2JJ 2M3AA 1R22A 3U1KA 5F0FA 3F8CA 4IHXA 4M3BA 2IBDA 3C7JA 5B1BH 4KISA 2VKEA 2PJPA 1TWGJ 4OIRF 3SDBA 2RV8A 5J4YA 2CO5A 1IW7F 2EV6A 2VQHA 3OYJA 1Y1WJ 1FYLA 2VBYA 2IGMA 1QU3A 5F0HA 3FIWA 2VJ4A 3ZMVA 4EGYA 4M71A 3M7GA 2HFHA 3TP3A 3JCUC 3L7WA 4DZJA 1LE8A 3FKJA 4EVIA 1FLIA 1MMAA 3V42A 1UHSA 3DBLB 2ZFWA 4RA2A 1RRJA 3OMYA 2MC3A 4DGWB 3TDUC 1YJNI 2L3DA 1MSEC 4B8XA 3ERED 3HM5A 3VYTB 4I6ZA 2W25A 3L2CA 4MLOA 5FRMA 4AIHA 4ESBA 1B72B 3NWTA 2HOSA 4HNUA 3SFZA 5DUKA 1F9NA 1TT5B 4KA4A 1BA5A 4BJ6C 1R1UA 3LSHA 5IYBJ 2OZUA 3RKWA 2XHKA 3E5QA 2R5YB 1ETKA 2F48A 1UB9A 2V9VA 3JR9A 5DM6F 2WAEA 2JA5J 1X3ZB 1N75A 2FRHA 2LKXA 3CCEI 1B6AA 4BACA 3CCSI 2KIQA 4ENMA 1VI0A 3LSPA 1MH3A 4ABZA 2Q0OA 1ZR4A 3CP2A 1ZAOA 4F7ZA 2IS1A 3A01A 1XGNA 3ROUA 1ZLJA 3HRTA 4RM3A 5IP7J 5LBQA 1WH5A 3ZMTA 1VQNI 1G3YA 1WGXA 3WU0A 4KMFA 1QPMA 1G3SA 1MBFA 4FX4A 4M3GA 2Y0SA 4XR6A 1FMWA 3KCCA 4XLCA 1GT0C 4A3DJ 4BQAA 4IX7A 4D7NA 5K5QA 4QIWN 2HEOA 1SVLA 2BY3A 2KL4A 4KNYA 3GTOJ 2HWVA 2YPRA 4JX5A 2K5CA 1FP1D 2FD5A 2YSRA 3TKYA 3CMEI 1SMYF 3LWFA 2IA0A 2BY1A 2L9NA 5GAGJ 2JK3A 3K4LA 3RKYA 3HHGA 4RGRA 1E0EA 2MGQA 5EDNA 1MMNA 3G1LA 3MWMA 3EYIA 1R00A 1QNTA 2DI3A 2IPQX 2ZO4A 5H6QA 1Q1VA 1OCOH 4K2EA 2MLKA 3BTIA 1ODDA 1QBJA 2LOOA 3VYSB 3K4JA 4J01A 1R7JA 3F72A 2XPWA 1ZG5A 3BR0A 1ZR2A 4IOCF 4CYCB 3GFJA 3SXYA 5DTDA 4GYGA 4ENJA 1KQ8A 2Q2EB 1J9IA 1PP8F 1ZHFA 4IPAA 2VJIA 4ENKA 1FSHA 2FXAA 1BW5A 4C30A 1WJAA 2M0MA 4G8XA 5HS9A 3ISPA 2VUMJ 2FOWA 3RKXA 2LKSA 4ZYHA 2EIJH 1MBHA 4RAZA 4ZZDA 5HDKA 2FF4A 3ASOH 3L2VA 4LG0B 4UNOA 2VPLA 5GADJ 1JTYA 2K85A 3NWSA 3OSGA 2K9QA 2L7ZA 3FISA 2VXZA 3QODA 2LBFB 3AFHA 1WJBA 1UAAA 4EMSA 3J80Z 4ZDPA 4HEA2 2GWRA 1P7JA 2K02A 3W6KB 2E34A 1MNDA 2JUGA 2BEOA 4BL0B 2JTVA 4G6QA 2KZGA 1FEXA 1IJWC 1O7FA 3F9KA 2OQRA 2OCEA 4BBRJ 1FYMA 1SD7A 3HRUA 4IEJA 2M34A 3MKLA 1KZHA 1OYYA 2KFDA 4HX4A 4I02A 4L9JA 2ICWG 1A36A 2FBHA 2O03A 3C2GA 5FB2A 4EM1A 1FYKA 1JKQC 4MFDA 2M1BA 4P9UA 1YIJI 4HYEA 2IAIA 3LMMA 2A6EF 2EV0A 4D1QA 5E8GA 3K6GA 3SFIA 1BN5A 2M87A 5GP9A 4ANJA 1L0OC 1ORKA 5GTIC 1N78A 4BQOA 1YS6A 3K4KA 3DWLE 2V1NA 3KP2A 1J0RA 3O2PE 1WKMA 4ZYAA 3IL2A 4MNUA 4LOCA 2VONA 2O3FA 4BXUA 2XF5A 1BJZA 2R7TA 3SEZA 2I5UA 1U8RA 1HCRA 3IHUA 1IG7A 3KEYA 1JUPA 4M3DA 2EZIA 3VODA 3HIFA 4HV6A 5J1RA 3MKYB 4ENNA 2FQ4A 4P55A 1OR7C 2A69F 2Z1DA 2ZXJA 3H0DA 4CZZA 4G7HF 5JLWA 1B72A 3VSLA 3TBIA 3GO5A 3RI4A 2B7EA 1A04A 3QYBA 4NDLA 1S7AA 2KJBA 2DA6A 3HXLA 2RAEA 5M3FJ 4NC8A 4XICA 3G2BA 2IA1A 4XOPA 1J09A 2HYGD 1YQAA 4MFEA 1FX7A 3R0JA 1WI9A 3CC7I 2JRTA 4OMZA 4OIQF 4BXXJ 5F1RA 3WTTC 2ACJA 5D6EA 3AG1H 4S05A 2MH9A 3BR2A 3DEWA 1ERDA 1OYWA 1I3AA 3LQRA 4M74A 4Q4ZF 1DU6A 4ZYEA 2VASA 1IV8A 1J5YA 4HF2A 1GVDA 2A5WA 3MAJA 5JI6A 5K7HA 4XQFA 1RIOH 3TP0A 2IW5A 2ZMEA 2IS6A 1UHMA 4RB3C 2DA7A 3W6JB 5FFZA 5LRRA 1Y8RB 2KT0A 3ML6A 2X6XA 3CO7C 2O8XA 4JP0A 3BG7A 1RI7A 2DAOA 2IS2A 2DK5A 3HGYA 4XNFA 4B43A 1IXCA 1OPCA 1JT6A 1T0FA 4BJTA 2K4JA 4MIMA 1P2FA 2R7OA 2E1CA 3DPLC 3K2ZA 1W36D 2UWMA 1N25A 1STZA 4UV8A 5FD5A 3C18A 3M4OJ 1FOWA 2AXTC 1MJAA 4M3FA 3TMOA 1R9TJ 3VWBA 1Y39A 3UNGC 1S6LA 1QHHD 5FROA 3NARA 1GXQA 3I58A 1SD5A 2JSCA 4BHCA 2HZTA 5JR3A 2L7MP 4E7HA 3CC4I 1U8BA 4A6EA 2VE8A 3WTWC 1NG6A 5IT9Z 2JPBA 2VBXA 4G6TB 5BQTA 2Q2EA 2HR3A 2JVGA 1YW9A 3LA3A 4XLAA 4M3EA 4RLQA 1BC8C 5KK1A 1UELB 2Z9OA 1ZQ3P 2W57A 1PJRA 2DYRH 3GTLJ 4S0HB 2W24A 3HRMA 1IZ1A 2G7HA 1I6XA 2BHZA 3GYHX 3HTUA 1M1EB 2Q1ZB 3Q3SA 1TW2A 3PO2J 2UZKA 2EQRA 5IY5H 1IUYA 3LOCA 4A69C 4YFNF 4JBAA 3BPVA 5B1AH 2Y31A 5J40A 4BEHB 5DCMB 3V7CA 5F6FA 2KIMA 2DFFA 2PFBA 4UB6C 3ABKH 4QTRA 5E3NA 1WJDA 1GV2A 3A0BC 2V1UA 2XASA 2KMUA 3FZVA 4GO1A 2R7ZJ 1Z3XA 2LY2A 1MJBA 4YIFA 3KP4A 5LEKA 3BZKA 1EA3A 5L3DA 1FPQA 3DP7A 3QPLA 3KZZA 3SEQA 3LL7A 5BPIA 1IF1A 1KQ9A 1QO0D 1X1DA 4A3JJ 1NH3A 5IPAA 1UG0A 1V5GA 1YIOA 1QVUA 2BHYA 3LNQA 1VQPI 4TV7A 1DQUA 4O3MA 1SEUA 5E18F 1S7OA 4E7IA 4DQ2A 2DOEA 3JW4A 3OYMA 1X2MA 3LQQA 2BYVE 3H5NA 1H89C 3TO7A 5D8KB 3KEOA 3W2WA 1UMQA 2BOLA 2OUMA 1SAXA 3WU2C 2P6SA 4MTDA 1G8XA 3CF5F 1TQIA 3R60A 1PUEE 3S1NJ 1X1AA 2LP0A 4R1HA 5J8FA 2VI6A 1TZLA 3ABUA 1HKTA 5J6XA 2EWNA 2X6YA 1HSJA 4LB6B 3RTRA 3WGHA 3PFIA 2XF7A 5IP6A 1HA8A 3DKXA 2IGNA 3SZTA 3QQAA 1OYIA 4DOZA 2ESHA 4A3CJ 2EIKH 4XLEA 5AIQA 4F91B 2DMQA 4AD9A 1OJLA 1EV7A 2DT6A 3FK6A 2A3SA 4UUSB 3OYHA 4OIOF 5EEHA 2HKXA 1I3QJ 1W1WE 4RAGA 3HOWJ 2CS3A 3IH4A 3BCAA 3R4KA 3GFIA 4XKVA 2XGXA 3CJTB 4EM2A 2R7SA 3T8RA 3WODF 2O5RA 1R36A 2ZFUA 4XLPF 1H0MA 4D5CA 1H9TA 1NK2P 3EUHC 2GA2A 4RBOA 2XSDC 2ZSIB 1D3YA 3TL4X 1XMAA 4O5VA 3N05A 3M8JA 1C0WA 3GTQJ 2NOJB 2KIFA 3A1YA 3JSPA 2LD5A 1T8IA 2COMA 1RR7A 1U3EM 1ETOA 3DTIA 4C3HJ 2V6EA 2EINH 3M3YJ 1PYVA 2Y48A 2E1OA 5LGNA 4M6YA 3OS0A 3BT9A 4EM0B 5HODA 2QQAA 1VQOI 1I1GA 3ABMH 3DTKA 1UG2A 3FM5A 4C2TA 1QGPA 4XOTA 1I1SA 3CJQB 3S14J 3L2UA 2H1LA 2X6OA 2HVSA 3KYDB 3CUQA 4BUPA 1T39A 3IP4B 1R58A 1SFXA 4BHPA 2HI3A 2FOKA 3PSFA 3DKWA 3Q9VA 5E79C 2V1XA 5HDGA 1TWHJ 2CUJA 3LSRA 1Z21A 2ME6A 1VZ0A 3DCFA 3KLNA 3PM1A 3FXJA 1X58A 4Y4RA 1BJAA 1OCTC 1DPUA 3H35A 1S5LC 3D0SA 2MD0A 2QENA 3KFWX 2W00A 3WTSC 5M5YJ 4Y33A 3BDDA 1V54H 3NRVA 5IOZA 3H92A 1HW5A 3I0TA 2ESNA 4PK4A 2QKLB 3LAPA 1X3WB 3BJ6A 1P4XA 2HS5A 3FMQA 4MO7A 2W84A 3T1BA 3JRDA 2LG4A 2R5ZB 3QPSA 3X2QH 2OD5A 4UB8C 3WTZA 3G3ZA 4ASNA 1ZARA 4FETA 2QGUA 2MH2A 3K69A 3AG4H 1Y8QB 3MZ8A 1G59A 1XGOA 1OCCH 3MVPA 1B9NA 5E3LA 1FWZA 4AIJA 3OYAA 1ZGWA 3QP6A 1SAUA 1VQKI 4KITB 3KEQA 5H6RA 3ZN1A 1I5ZA 3GX4X 2HU9A 1K7AA 2VKHA 3OYDA 2LNBA 2LMDA 4UVBA 4BU2A 2IGOA 3G1OA 5EG0B 2KQRA 3K9TA 3SZPA 3PNTA 5TRDA 2IP2A 3J7AO 4KIGA 3GTMJ 2EV5A 2DW4A 2E19A 4LMYA 2JT1A 2HKOA 1P6RA 1VQ6I 4NQWB 1V5EA 2PMHA 3OR1C 2JA7J 1IRFA 1D8JA 4EJOA 5F64A 3DV8A 2R7FA 5DUIA 2VODA 3FMRA 3M07A 2Q8KA 2VKVA 1FC3A 1NHAA 4BQQA 1MKMA 4NC6A 2HDDA 4XK4A 3L2QA 2AHQA 2GXGA 2ID6A 1G3WA 2EFQA 3S1RJ 1U6GA 2VJ5A 1XGMA 1D8KA 4ITVA 1YHQI 3W6VA 2DDAA 4U0VA 4LB5A 3MFKA 2MA3A 4UVCA 3E5XA 2EJRA 5BPDA 3VSKA 2ECCA 5LHIA 5TJJA 3JTHA 4AUXA 2ADUA 1JXSA 1VQ7I 1V5FA 2DT7B 2E71A 4EATA 4FHTA 2XF6A 1JI8A 3VB2A 4YFXF 4RGUA 1U5TA 1OKRA 5DD4A 3H5AA 3QWLA 2UV1A 1TQPA 2VJJA 2HVRA 1HKQA 3V7RA 3OY9A 3GVAA 1WQ2A 4M6VA 1S72I 4AIDA 3WG7H 1HSTA 1KU2A 3QRFF 3K70D 1G6NA 1J59A 5LEJA 1K6OA 3ZQHA 4B3AA 2EB7A 5E1WA 4CUGA 4UHTA 4CCKA 5K7ZA 2M2EA 1BOBA 4QLCU 4N4OB 4HSRA 4CCJA 3CCVI 2OA4A 3K2AA 3FXOA 3C2BA 5D4RA 3BWGA 2DOAA 2CV2A 4JX4A 1TL8A 4HF0A 4HX8A 2Y69H 2GAUA 3K1NA 3MKWB 1ULYA 1ENHA 1R5HA 1RUNA 2RN7A 1O57A 4FASD 2K3PA 1YRNA 3O8GA 5LHHA 1MDMB 2PQ8A 2EZLA 1YI2I 2K9SA 1CQTA 1O4XA 1B8IA 3KPHA 4HDUA 1FIPA 1X19A 1X4PA 2YX4A 3SZGA 5KNLA 3BQZA 1X2NA 2WAFA 1OISA 1J7KA 1FT9A 2LR8A 1Z7UA 2COBA 2W82A 5D5WB 3E6MA 4DNCA 3PQKA 5HNHA 3KP7A 2IT0A 2WAQN 3BP8A 3CLQA 1Y0UA 4PGHA 5CJ9A 5EZHA 1RC9A 2B9SA 1XDSA 4BY1J 5DYMA 5J4VA 2BE5F 1JKPC 1HDDC 2ME0A 2BW3A 3TOAA 2FEZA 1T98A 4MEYF 3VYRB 3VFZA 4HAMA 3C3WA 2EIMH 4LLNA 5LD2C 2PJRB 3BLYA 4IRGA 4Y3OA 3D5SC 4XM3A 4G9YA 3U9GA 2E2IJ 3T0YA 2KP6A 1RKWA 3CDIA 4QSHA 4Q48A 3OSFA 3BPXA 2RNJA 4BKXA 2KPMA 1ZLKA 1AOYA 2FX0A 4EJTA 1U0JA 5DCFA 2H09A 2YR2A 2VBZA 3GFLA 1ZYRF 4A12A 1IDZA 1UFMA 1SFUA 4JYKA 2BXYA 4X1EA 1JUMA 2XDVA 3QOEA 4XORA 4IO9F 3SYTA 4GXOA 1X1CA 3RCOA 2OC6A 3REOA 2OCCH 4ZH4F 1KYZA 2BY0A 2X9DA 2X1CA 2V4JC 3KLOA 4LIVA 2H6CA 1Q1HA 3HSEA 2FNAA 2L4MA 2FU4A 3D5LA 3GWZA 2GIVA 3ABTA 2DODA 3J7YJ 1L3LA 2O61A 3ZMUA 2HTSA 5GAEJ 5IP9J 1IUFA 1YTYA 3HEFA 4FE4A 1MBEA 4C3JJ 2JQ7A 1TWFJ 4HSTA 4OU0A 5H2FC 3L00A 1S7EA 2L7FP 4YRVA 2D45A 4ZZLA 1XG1A 1WPKA 4W1UA 2QQ8A 2DMTA 4KT5C 3MEXA 1WJCA 4AU7A 2DU9A 1Z9CA 2EZKA 3J7AY 3QOPA 4EJWA 5E1XA 1KGSA 3L9FA 4PJMA 1GUUA 2LKPA 1XS9A 3GW2A 2CWEA 1XC5A 2J5OA 4I98B 2ELJA 2FJ1A 4F55A 2D1HA 3FXMA 4CHUA 1OCZH 2STWA 1X1PA 4FE7A 3OYNA 1OCPA 3FBNB 2NRAC 5ILSA 4F3QA 3S93A 1UHWA 2XSJC 2XKPA 5BMZA 2DTZA 1D1CA 5FD6A 4JOMA 3K70C 5A2QK 2A5YB 2WADA 3P5JA 2GA1A 2DMPA 2PMZN 5DEQA 3K7AJ 4NUBA 1ETYA 5F27A 3OOUA 2M45A 1HOMA 2HQNA 3PUFA 1JGGA 4NBQA 2QVOA 3HOVJ 4X6AJ 5LGUA 3K4MA 5EF6A 1HBXG 5DDGA 1XX5A 1VNDA 1LB2A 3PNYA 3BG5A 1JKOC 1YX3A 3QU6A 1A6IA 2V26A 4M9SA 3G6EI 3ZQGA 1BL0A 4IQJA 4CXFA 4P5OA 3OR2C 3ZMSA 1KU7A 5B66C 3JTGA 2HQ5A 3ZQFA 1QVTA 1DDNA 1W5CC 2Y9ZA 3MMYB 3JSOA 1GLNA 2Y75A 4B4CA 4HW0A 4CDGA 1NTCA 1EF4A 2XAJA 4L5JA 3ZQ7A 2MG4A 2MC4A 3OYIA 5AONA 3TEDA 1WZ2A 2RDPA 3S2DJ 5HLGA 3TQNA 2JPCA 4OMYA 3CJNA 1BBYA 1WFXA 3CO6C 1VQ5I 1K78A 3S16J 1JHHA 1F4KA 1U9OA 2RREA 4IRIA 4HOBA 4E4HA 2CFOA 5EZGA 4H0EA 3AL0C 4O6JA 4E70A 1S29A 2UXNA 3H0GJ 3OL4A 3ECOA 2DA2A 4BY7J 1XD7A 1F36A 1ZRDA 4CGZA 5FLXK 5C44J 1OCRH 2P81A 3S3NA 5HVQC 2M8GX 3S3OA 3IRRA 2NVQJ 2XAQA 3FMSA 4E6KG 2YX7A 4JQFA 3H3VK 3DF8A 1NK3P 3VEPA 2CU7A 4MTEA 2LLKA 3H5RA 5IYDJ 2PG4A 3HOSA 3TW7A 2V9PA 3BCBA 5CVRA 3EDPA 1IRZA 3F23A 5CYVA 3M9AA 2H8RA 5CLSA 1D0XA 3GZNB 3KE2A 2CV0A 1E17A 4R8HA 3F6VA 2I10A 4IRHA 1FOKA 1B59A 1KU3A 2ZNZA 3Q0UA 1VF9A 4C3IJ 4CCMA 2EFWA 1B4AA 2F5EA 3DLLF 5FKMA 3Q0VA 1YFHA 2KDOA 1TLHB 4M73A 1IRGA 4KICA 4WXHA 2QCOA 4GCVA 1MIJA 2EA4A 1QZYA 2HXIA 1HDPA 2OBPA 3JREA 1TNSA 3LAJA 4DZPA 3LSJA 2MBFA 1MBKA 2VQLA 4DBRA 1D1AA 3JRCA 2JRMA 2NVXJ 3I59B 4IHSA 1FMVA 3HC7A 3FM3A 3H1CA 3JAMK 2WC2A 2H8WA 1F43A 2GBYA 3HOZJ 3HSRA 4J19A 3HBLA 1DGRM 5LGTA 2D5VA 2JA6J 2Y2ZA 4I76A 2K3FA 3QYEA 1YG2A 1LQ1A 2XIGA 2GZWA 3W3CA 3OYKA 4BDZA 2E36A 4M9ZA 2DFHA 2Y0SN 2R7DA 6PAXA 2K40A 3ABLH 3C2HA 1PUFA 1HF0A 4BBSJ 1MMSA 1DGWY 1XN7A 5B5EC 3IKTA 4AWXB 4M9XA 2K9NA 1VQ8I 1DPRA 2STTA 3NEUA 2ECBA 1S3JA 1XCVA 5HDNA 1LPQA 5K5RA 4EJVA 5HS8A 1QPIA 3RPUD 3ZQQA 1TT0A 4PUSA 1SD6A 2HYJA 4Z2YA 3I53A 2RVCA 5F08A 3I55I 4PJLA 4QWQA 4XSXF 1JHFA 1DUXC 2DO7A 3HOXJ 5DCMA 1TP4A 2VC1A 2M4GA 3CMAI 3E7LA 4OOIA 3U1DA 2LH9A 4I99C 2RQPA 2JJ7A 4B09A 1USSA 1YO5C 5FKKA 2NNNA 4V2GA 4H4KC 1B9MA 2R0QC 3S15J 1PDNC 4I09A 2R7UA 2VT3A 2IVMA 1MNEA 4WXDA 1Z05A 3BR5A 3CCQI 1R71A 5HOOA 2BZTA 2LK2A 5EG0A 1K6YA 1QZZA 3OOPA 1R6RA 4L5EA 1DP7P 5C4XJ 1JUSA 3FXKA 3L2WA 3W2VA 2R4GA 1RR8C 4UY8I 2FBKA 3CTAA 4A3LJ 3FF5A 4UVAA 3SDGA 2CQNA 4WXCA 2C6YA 2VL8A 4A3KJ 3A0HC 2MYSA 4B48A 5CPRB 1W7PD 3BR3A 2B63J 2WAQA 1W5TA 3OS1A 1QZEA 1SFKA 2QM3A 2ZMEB 1ZGJA 3JRBA 5LRSA 3KZYA 3U2RA 1XTAA 4GFBA 3EUAA 4KT6A 3NAUA 2KRCA 3P9CA 2KZVA 4NNJA 1K4SA 3J81K 2DA4A 4KIFA 1IN5A 2ZNYA 4Z6YA 2PLYA 2VN2A 4UUTA 1G2HA 2X4HA 2W48A 4N9HA 2OZ6A 3ZQCA 2FBIA 1AKHB 3GMEA 2ZSHB 4DW6A 3GZ5A 3TDZC 1XSDA 2E60A 1AKHA 2EFPA 2KDZA 3FKIJ 1EJ9A 3BQYA 1LDDA 2BBYA 2CQKA 2QLZA 1CF7A 3DBHB 2OAZA 1P4WA 2QUFA 4RB1A 2WWYA 3OYBA 4DYCA 2H1KA 3IC7A 2LREA 4DBQA 5C3EJ 3QAHA 4EGZA 1WVRA 4RM2A 5F0CA 3ZMDA 1FIAA 2CQXA 5JVTA 1W5SA 3HHHA 1LUJB 4P9FA 4ZTJA 2GQQA 2ZXHA 2DQLA 1LVAA 2WB1N 2B0LA 1D1BA 2XAFA 4CZCA 3SJMA 2L0KA 4Q5SF 1J75A 3I59A 1FZPB 2DA1A 3BROA 4IXAA 3S17J 2M7BA 4LK0F 3ZXSA 2O8KA 2LF7A 4B47A 1X3UA 3I64A 3DEEA 2CSOA 1APLC 3GF2A 3FXQA 2NS7A 2CH0A 1D5VA 1SFEA 3LFUA 3OIOA 1Z1DA 1JJ6C 1MGTA 3FHNA 4HV5A 2EK5A 3E6BA 2PN6A 2XPUA 2F4MB 1LFPA 3GFMA 1J2XA 5TGTA 4E7ZA 2LF8A 4IHYA 1T2KA 3E6DA 2HOEA 4D7MA 1WJFA 4B44A 1Z7LA 2VC0A 2KRFA 5JVGF 5FLVA 3BR6A 2XV4S 1HC8A 1YOVB 3HG9A 3I4MJ 2ELHA 3WHCA 3EYYA 4PFOA 3OV8A 4DYRA 3IWZA 1YLFA 1BI3A 3BZCA 4QPQA 3GTKJ 2FA5A 1Z3YA 4LLLA 3AAFA 2JMWA 2P8TA 3U21A 3FK7A 3WTUC 3V8LA 3BOQA 5FKOA 2GOXB 2O7OA 2Z5UA 2WTEA 2RGVA 2DA3A 3F6OA 1ZREA 4FCYA 2DOFA 1MBGA 3V8JA 2DCEA 4F93B 2GM4A 5JHFA 3CESA 3KYCB 3N4MA 1ON2A 3CCYA 2K9LA 2P7VB 2E1NA 2N8GA 4RS8A 4KJZA 5EEGA 2ISZA 1V55H 2I8DA 2P0WA 1W7PB 3IH2A 3CC2I 1QA6A 1GHCA 2DJIA 1WJEA 2IA2A 3IWFA 4PJ0C 1WHUA 5CVVA 2X48A 1KQ0A 1O3QA 2K4BA 4DIQA 1ZG1A 2F2EA 4IF4A 2PEXA 3W2AA 1ZH5A 3A02A 3G1MA 1RKTA 1WH7A 2XAHA 2VE9A 3LSMA 3HYIA 2DDBA 3I5UA 2NXNB 4E7JA 2GOMA 4E7SA 2QQBA 2FUG2 2DFIA 2RKHA 2D2WA 2WY8Q 5LLQA 3HB9A 3EQLF 4IHVA 2VLAA 3IAS2 4FQGA 4BE0A 1RESA 4X0GA 3SHFA 3DQVC 1RPWA 4XLNF 2XUBA 1Z6TA 1MH4A 2P5LC 1AA7A 2XB0X 2L54A 3S32A 5FKNA 1HLVA 1T0FC 1AU7A 4PSWA 5E20A 2PMUA 2VIXA 3V7SA 4EJUA 1FBSA 3RKQA 4A3EJ 4WF2A 3TO6A 3F8FA 2DMNA 4AM3A 1EKEA 2OTJI 4CICA 2DPDA 4P1WA 3H3ZA 3KX2A 2JZYA 4HLYA 4XL9A 2DA5A 1VTNC 3ZOBA 5J8CA 2W4SA 2WY7Q 2ZC2A 3JRAA
chains in the Genus database with same CATH topology
4NHJA 3TGNA 1RNLA 3RIRA 4HZFA 1WRJA 1KU9A 2P7CB 3G73A 1RZ4A 3CDHA 1O3SA 2A6HF 5D5VB 3WGIA 4L0ZB 3RPUA 1BI1A 1HW1A 2KKOA 3RYPA 1LDJA 5LHGA 3PQJA 3K1PA 5IT3A 1TBXA 4HBLA 1G4DA 2P4WA 5ICGA 1EH6A 1LJ9A 2GXBA 3DXJF 5ICCA 3COAC 1BC7C 4YFKF 4Y17A 3ZPLA 1MDMA 2LDUA 3MCZA 3BY6A 1G3TA 2UXXA 3MQ0A 2V6CA 2QWWA 4NB5A 2KIUA 2P5KA 2VOOA 1TQMA 2A61A 3RPQA 3FX3A 2HYFA 1WWXA 2WV0A 3HRSA 3T8TA 3R6SA 4I2OA 1WSUA 1FP2A 3M1EA 4ETSA 3T5XA 3O6BB 5BS6A 4A0YA 5L3CA 4AVPA 2RC4A 2ISYA 2QBYB 3QPTA 4EV0A 3GUDA 1ZG3A 4R79A 1Z91A 3Q9SA 1XCBA 1EH8A 2ZJ2A 4WWCA 1KYWA 4N0BA 2Z3YA 3F8NA 5HS7A 1O7LA 2AS5F 1QQIA 3FXUA 2VBWA 4BAYA 3QP5A 2IRFG 3HTSB 5FGMA 2DK8A 3HUGA 4G94A 2NS0A 2VT2A 1MJ9A 3E97A 3F8BA 5ERIA 1U2WA 1XMKA 1HQCA 5D6FA 3R61A 3E5UA 4A2UA 4L9TA 1JE8A 1FBQA 4KFCA 1SD4A 3LA2A 1P4AA 2HQRA 1YW7A 1W4MA 2G7UA 2DBBA 4L9VA 2FQ3A 3ZN0A 2BV6A 4U0WA 1REPC 2P6TA 4A0XA 5JHUA 2NNYA 2MLGA 1LEAA 3N97A 4LG0A 3IRQA 3E3VA 3ECHA 4LD5A 2H6BA 3FWEA 1F1ZA 2CGPA 4HQMA 4WK8F 3DPTA 5CVIA 2PI0A 2XVCA 3WTYC 3GLXA 2O6GE 3MZYA 3P9IA 1T6SA 4A0ZA 4A6DA 3S2WA 3H3UA 5D5UB 4U7DA 1EH7A 4S04A 2EA2A 3QPHA 1RUOA 1FSEA 1K78B 4I0BA 3VOEA 4JK1X 1BM9A 2G9WA 5L3GA 2Z33A 4KN7X 4G7OF 1CGPA 3ZP5A 3M8FA 4CYDA 4UV9A 3TO9A 2J5PA 4L9NA 4KDPA 2H94A 2KJCA 4GYIA 4IJAA 3BJOA 4ESJA 3V4GA 3KETA 2CYYA 5ICEA 4L5IA 2FSWA 3F21A 2YU3A 3HSFA 3ULQB 4ESFA 3WTXC 4L18B 4I7HA 2DQRA 3FHZA 5L3EA 4AIKA 2F5DA 4KIBA 1SMTA 4PZJA 5D5XB 4MGRA 4HA8A 3P7NA 2ETHA 2AXLA 1OR7A 5D8LB 3J81Z 4RGSA 3GEZA 2M8EA 5FLXZ 1T38A 5E1ZB 5K1YA 2DT5A 1R5GA 2Y0MA 3R0AA 4KYWA 2XKOA 1R1VA 5H20A 2MD5A 3CLOA 1HW2A 4BYYA 2HGCA 3L09A 4HF1A 5D4SA 1IN8A 4OIPF 2FMLA 4PCQA 3NQOA 4MEXF 2E7XA 1E2XA 3WGGA 1Z6RA 4A5NA 2QBYA 3LA7A 5DV5A 1K79A 1XB4A 3B02A 1YS7A 2A07F 3GXOA 2K27A 4LGWA 1BIAA 2CG4A 3EUHA 2XRNA 2ZKZA 2LSOA 1BIBA 1TW3A 4UXNA 3WTVC 4L0YB 1ZRCA 1TNTA 3CUOA 2L02A 3WU1B 1FNNA 3JAMZ 1USTA 4IHTA 4FT8A 1ON1A 3ELKA 1I27A 5HLIA 5ILUA 1XSVA 2V79A 1P92A 1FBUA 3DEUA 2HDCA 1BI2A 4U7BA 4I0AA 3KP3A 4ZYDA 1U5TC 2L01A 5L3BA 3CUQB 5ED4A 2FNPA 1O3RA 1O3TA 3LSTA 4Y13A 4Y15A 4WX9A 4IVNA 1IXSB 4XBFA 4UUVA 5CVUA 3K0LA 3QU3A 5E17F 4U0YA 3Q5FA 3BJAA 4XSZF 2XAGA 3WE3A 1OMIA 1IN6A 2ZCWA 1XSXA 4EQQA 2IJLA 2XROA 2DLLA 1B1BA 4LK1F 2HTJA 1GVJA 4MHGA 4PGGA 4HX7A 1LNWA 2EFNA 1XDUA 3BZ6A 2K86A 5E8IA 1H9GA 3E6CC 3I71A 2M30A 3RDIA 3TOBA 2TDXA 4HQEA 5IT9K 2L4AA 5AIPA 3WE2A 5BOXA 3LFKA 2D1VA 1BOAA 1R23A 4XRFA 1ZN2A 1R1TA 1TTYA 2CFXA 3K1MA 4ZYGA 4U88A 1U78A 2P5VA 3HOTA 3B73A 4D0PA 4M72A 5A2QZ 3IKVA 2QYOA 2EFOA 3M8EA 1HXDA 3KP5A 3FXRA 5HLHA 2QZ8A 2OQGA 2CW0F 4RGXA 4GGGA 5ILVA 2F5FA 5FO5A 1IXRC 2W85A 5ICFA 3F22A 1PP7U 3P9KA 1YW8A 4FX0A 1CF7B 2F5CA 5KVRA 4BHBA 3RJPA 4PDKA 5FFXA 4ON0A 4LJZF 1LEBA 4KN4X 4WCGA 2X0LA 1S8NA 4G6DA 1IAWA 4LFUA 1MD0A 1YYVA 1JGSA 5L3FA 5K5OA 2A68F 2BGCA 1W7PA 2DPUA 1IN4A 4MQVA 3WG9A 3I54A 4RB0A 4LLGF 4BH9A 1V4RA 2FE3A 1LDKB 3ZMZA 1UCRA 3EETA 2NAZA 3F8MA 2FMYA 2K7LA 3O3KA 2NYXA 3DFGA 1ZRFA 4P96A 4YIIA 3CUQC 4HDVA 3V8KA 4MQ9F 4M6XA 2DTRA 3J80K 2R3SA 3RYRA 4A5MA 1XGSA 2ZBKA 4Q47A 4N9IA 1ZGAA 3MZHA 4OINF 4I01A 3C1DA 3GZ6A 1KA8A 1BI0A 2PBIA 2H27A 1F5TA 4RB2C 4CO8A 1ONVA 4NQWA 2E7WA 1GXPA 4HLXA 3I4PA 1IN7A 2QQ9A 5DD8A 4KMUX 2V1DA 4RAYA 2O0YA 1V3FA 2VOPA 1HKSA 1AWCA 2OU2A 1MZBA 3KP6A 4YG2F 2M5WA 5CVJA 2Z99A 3F3XA 4G7ZF 3SQNA 1FY7A 4BNCA 4KUMA 1U5TB 5JFRA 1R22A 3F8CA 3C7JA 2PJPA 4OIRF 2RV8A 2CO5A 1IW7F 2EV6A 1FYLA 2VBYA 3ZMVA 4EGYA 4M71A 3M7GA 2HFHA 3L7WA 4EVIA 1FLIA 2ZFWA 2MC3A 3TDUC 2L3DA 4B8XA 3ERED 2W25A 3L2CA 4AIHA 4ESBA 3SFZA 5DUKA 1F9NA 4KA4A 1R1UA 2OZUA 3RKWA 2XHKA 3E5QA 1UB9A 2V9VA 2FRHA 1B6AA 4ENMA 2Q0OA 1ZAOA 4F7ZA 1XGNA 3ROUA 1ZLJA 3HRTA 5LBQA 3ZMTA 1G3YA 3WU0A 4KMFA 1QPMA 1G3SA 4FX4A 3KCCA 4BQAA 5K5QA 2HEOA 4KNYA 2HWVA 2YPRA 1FP1D 2YSRA 3TKYA 1SMYF 3LWFA 2IA0A 3RKYA 3HHGA 4RGRA 3MWMA 3EYIA 1R00A 1QNTA 2DI3A 2IPQX 2ZO4A 5H6QA 4K2EA 2MLKA 1ODDA 1QBJA 1R7JA 3F72A 1ZG5A 3GFJA 3SXYA 4ENJA 4GYGA 1KQ8A 1J9IA 1PP8F 1ZHFA 4IPAA 4ENKA 1FSHA 2FXAA 4G8XA 5HS9A 3ISPA 3RKXA 4ZYHA 4RAZA 4ZZDA 5HDKA 2FF4A 4LG0B 4UNOA 2VXZA 4EMSA 3J80Z 2GWRA 2K02A 3W6KB 2BEOA 2JTVA 4G6QA 1O7FA 2OQRA 1FYMA 1SD7A 3HRUA 1OYYA 4HX4A 4I02A 4L9JA 2FBHA 2O03A 5FB2A 4EM1A 1FYKA 2M1BA 4P9UA 4HYEA 2A6EF 2EV0A 5E8GA 1BN5A 2M87A 1L0OC 1YS6A 3KP2A 1J0RA 3O2PE 1WKMA 3IL2A 4MNUA 2VONA 2O3FA 4BXUA 1U8RA 3IHUA 3VODA 3HIFA 4HV6A 4ENNA 4P55A 2A69F 2ZXJA 4CZZA 4G7HF 3GO5A 3RI4A 1A04A 1S7AA 2KJBA 2IA1A 2HYGD 1YQAA 1FX7A 3R0JA 1WI9A 2JRTA 4OMZA 4OIQF 5F1RA 3WTTC 2ACJA 5D6EA 4S05A 2MH9A 1OYWA 3LQRA 4M74A 4Q4ZF 4ZYEA 1J5YA 4HF2A 3MAJA 5JI6A 1RIOH 2IW5A 2ZMEA 1UHMA 4RB3C 3W6JB 5FFZA 5LRRA 3ML6A 3CO7C 2O8XA 1RI7A 2DAOA 2DK5A 1IXCA 1OPCA 1T0FA 2K4JA 1P2FA 2E1CA 3DPLC 3K2ZA 2UWMA 1STZA 4UV8A 5FD5A 3C18A 1MJAA 1S6LA 1GXQA 3I58A 1SD5A 2JSCA 4BHCA 2HZTA 5JR3A 4A6EA 2VE8A 3WTWC 5IT9Z 2JPBA 2VBXA 5BQTA 2Q2EA 2HR3A 3LA3A 1YW9A 1BC8C 5KK1A 2Z9OA 2W57A 2W24A 3HRMA 1IZ1A 2G7HA 1I6XA 3GYHX 3HTUA 1TW2A 2UZKA 1IUYA 4YFNF 4JBAA 3BPVA 5DCMB 3V7CA 5F6FA 2KIMA 2PFBA 2V1UA 2XASA 3FZVA 4GO1A 1MJBA 4YIFA 3KP4A 5LEKA 5L3DA 1FPQA 3DP7A 3KZZA 5BPIA 1IF1A 1KQ9A 1QO0D 1YIOA 4TV7A 4O3MA 5E18F 1S7OA 4DQ2A 3JW4A 3LQQA 2BYVE 3TO7A 5D8KB 3KEOA 1SAXA 2P6SA 4MTDA 1PUEE 1TQIA 3R60A 4R1HA 5J8FA 3ABUA 1HKTA 5J6XA 2EWNA 3RTRA 1HSJA 4LB6B 3WGHA 3PFIA 3SZTA 1OYIA 2ESHA 5AIQA 4AD9A 1EV7A 2A3SA 4OIOF 5EEHA 2HKXA 3R4KA 3GFIA 2XGXA 4EM2A 3T8RA 3WODF 1R36A 4XLPF 1H0MA 1H9TA 2GA2A 1D3YA 1XMAA 4O5VA 1C0WA 2KIFA 3JSPA 1U3EM 2COMA 2Y48A 5LGNA 4M6YA 4EM0B 2QQAA 1I1GA 3FM5A 1QGPA 1I1SA 3CUQA 1T39A 1R58A 1SFXA 4BHPA 2FOKA 3DKWA 3Q9VA 2V1XA 5HDGA 3KLNA 1BJAA 1DPUA 3D0SA 2QENA 3KFWX 3WTSC 3BDDA 3NRVA 3H92A 1HW5A 3I0TA 2ESNA 3LAPA 3BJ6A 1P4XA 2HS5A 3FMQA 3T1BA 2W84A 2OD5A 3WTZA 4ASNA 3G3ZA 1ZARA 2MH2A 3K69A 1XGOA 1B9NA 1FWZA 4AIJA 3QP6A 3KEQA 5H6RA 3ZN1A 1I5ZA 3GX4X 1K7AA 2LNBA 4UVBA 3K9TA 3SZPA 5TRDA 2IP2A 3J7AO 4KIGA 2EV5A 2DW4A 4LMYA 2JT1A 2HKOA 1P6RA 2PMHA 1IRFA 1D8JA 4EJOA 5F64A 3DV8A 2R7FA 5DUIA 2VODA 3FMRA 2Q8KA 1FC3A 1NHAA 1MKMA 2GXGA 1G3WA 2EFQA 1U6GA 1XGMA 1D8KA 4U0VA 4LB5A 3MFKA 2MA3A 4UVCA 3E5XA 2EJRA 5BPDA 5LHIA 5TJJA 3JTHA 2ADUA 1JXSA 4FHTA 3VB2A 4YFXF 4RGUA 1U5TA 1OKRA 5DD4A 1TQPA 1HKQA 3V7RA 3GVAA 1WQ2A 1HSTA 1KU2A 3QRFF 1G6NA 1J59A 5LEJA 1K6OA 2EB7A 5E1WA 4UHTA 4QLCU 2OA4A 5D4RA 3BWGA 4HF0A 4HX8A 2GAUA 3K1NA 1ULYA 1R5HA 1RUNA 2RN7A 1O57A 5LHHA 1MDMB 2PQ8A 4HDUA 2YX4A 1J7KA 1FT9A 1Z7UA 5D5WB 3E6MA 4DNCA 3PQKA 3KP7A 2IT0A 3BP8A 1Y0UA 4PGHA 5CJ9A 1XDSA 5DYMA 2BE5F 3TOAA 2FEZA 1T98A 4MEYF 3VFZA 4HAMA 3C3WA 4LLNA 4IRGA 3U9GA 4G9YA 3T0YA 4Q48A 3BPXA 2RNJA 1ZLKA 1AOYA 4EJTA 5DCFA 4A12A 2H09A 2YR2A 2VBZA 1ZYRF 3GFLA 1UFMA 1SFUA 4GXOA 3REOA 4ZH4F 1KYZA 3KLOA 2H6CA 1Q1HA 3HSEA 2FNAA 2L4MA 2FU4A 3D5LA 3GWZA 2GIVA 3ABTA 1L3LA 2O61A 3ZMUA 2HTSA 1YTYA 4OU0A 3L00A 2D45A 4ZZLA 4KT5C 3MEXA 2DU9A 1Z9CA 3QOPA 4EJWA 5E1XA 1KGSA 3L9FA 2LKPA 3GW2A 2CWEA 2J5OA 4I98B 2D1HA 4CHUA 2STWA 2NRAC 5ILSA 1UHWA 2XKPA 5BMZA 5FD6A 5A2QK 2A5YB 2GA1A 5DEQA 2M45A 2HQNA 2QVOA 5LGUA 1HBXG 5DDGA 1LB2A 3QU6A 4M9SA 4CXFA 4P5OA 3ZMSA 1KU7A 3JTGA 1DDNA 3JSOA 2Y75A 4HW0A 4CDGA 2XAJA 4L5JA 3ZQ7A 5AONA 2RDPA 5HLGA 3TQNA 2JPCA 4OMYA 3CJNA 1BBYA 3CO6C 1K78A 1JHHA 1F4KA 4IRIA 4HOBA 4H0EA 4O6JA 4E70A 1S29A 2UXNA 3ECOA 1XD7A 1ZRDA 4CGZA 5FLXK 5HVQC 3IRRA 2XAQA 3FMSA 2YX7A 4JQFA 3DF8A 3VEPA 4MTEA 2PG4A 3HOSA 5CVRA 3EDPA 3F23A 5CYVA 3M9AA 5CLSA 1E17A 3KE2A 4R8HA 3F6VA 4IRHA 1FOKA 1B59A 1KU3A 2ZNZA 2EFWA 1B4AA 2F5EA 1YFHA 1TLHB 4M73A 1IRGA 4KICA 4WXHA 4GCVA 2EA4A 1QZYA 2OBPA 1TNSA 3LAJA 2MBFA 3I59B 4IHSA 3FM3A 3JAMK 2WC2A 3HSRA 5LGTA 1YG2A 1LQ1A 2XIGA 2GZWA 4M9ZA 2R7DA 6PAXA 1XN7A 3IKTA 4AWXB 4M9XA 1DPRA 2STTA 3NEUA 1S3JA 1XCVA 5HDNA 5K5RA 4EJVA 5HS8A 1SD6A 4Z2YA 3I53A 2RVCA 4QWQA 4XSXF 1JHFA 1DUXC 2DO7A 5DCMA 2VC1A 4OOIA 3U1DA 2RQPA 1YO5C 4B09A 1USSA 2NNNA 1B9MA 1PDNC 4I09A 2VT3A 2IVMA 4WXDA 1Z05A 5HOOA 1QZZA 3OOPA 1DP7P 2FBKA 3CTAA 3FF5A 4UVAA 4WXCA 2C6YA 1W7PD 1W5TA 2QM3A 2ZMEB 1ZGJA 5LRSA 3KZYA 3U2RA 3P9CA 3J81K 4KIFA 1IN5A 2ZNYA 2PLYA 2VN2A 2X4HA 4N9HA 2OZ6A 2FBIA 3GZ5A 3TDZC 1XSDA 2EFPA 1LDDA 2BBYA 2CQKA 2QLZA 1CF7A 2OAZA 1P4WA 2QUFA 4RB1A 2WWYA 3IC7A 3QAHA 4EGZA 3ZMDA 5JVTA 1W5SA 3HHHA 4P9FA 2GQQA 2DQLA 1LVAA 2B0LA 2XAFA 4Q5SF 1J75A 3I59A 1FZPB 3BROA 4IXAA 4LK0F 2LF7A 1X3UA 3I64A 2CSOA 3GF2A 3FXQA 1D5VA 1SFEA 1Z1DA 1MGTA 4HV5A 2EK5A 3E6BA 2PN6A 3GFMA 1J2XA 2LF8A 1T2KA 3E6DA 2HOEA 2VC0A 2KRFA 2XV4S 2ELHA 3EYYA 3OV8A 3IWZA 1YLFA 1BI3A 2FA5A 4LLLA 3AAFA 2P8TA 3WTUC 3V8LA 3BOQA 2Z5UA 2WTEA 2RGVA 3F6OA 1ZREA 3V8JA 3N4MA 1ON2A 2P7VB 2E1NA 4RS8A 5EEGA 2ISZA 1W7PB 1GHCA 2IA2A 3IWFA 5CVVA 1KQ0A 1O3QA 2K4BA 1ZG1A 2F2EA 4IF4A 2PEXA 1ZH5A 2XAHA 2VE9A 3HYIA 3I5UA 2QQBA 2DFIA 2RKHA 2D2WA 5LLQA 3EQLF 3SHFA 3DQVC 4XLNF 2XUBA 1Z6TA 2P5LC 2L54A 5E20A 2PMUA 3V7SA 4EJUA 1FBSA 4WF2A 3TO6A 3F8FA 4CICA 2DPDA 3H3ZA 2JZYA 4HLYA 1VTNC 5J8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NHJ A;  3TGN A;  1RNL A;  3RIR A;  4HZF A;  1WRJ A;  1KU9 A;  2P7C B;  3G73 A;  1RZ4 A;  3CDH A;  1O3S A;  2A6H F;  5D5V B;  3WGI A;  4L0Z B;  3RPU A;  1BI1 A;  1HW1 A;  2KKO A;  3RYP A;  1LDJ A;  5LHG A;  3PQJ A;  3K1P A;  5IT3 A;  1TBX A;  4HBL A;  1G4D A;  2P4W A;  5ICG A;  1EH6 A;  1LJ9 A;  2GXB A;  3DXJ F;  5ICC A;  3COA C;  1BC7 C;  4YFK F;  4Y17 A;  3ZPL A;  1MDM A;  2LDU A;  3MCZ A;  3BY6 A;  1G3T A;  2UXX A;  3MQ0 A;  2V6C A;  2QWW A;  4NB5 A;  2KIU A;  2P5K A;  2VOO A;  1TQM A;  2A61 A;  3RPQ A;  3FX3 A;  2HYF A;  1WWX A;  2WV0 A;  3HRS A;  3T8T A;  3R6S A;  4I2O A;  1WSU A;  1FP2 A;  3M1E A;  4ETS A;  3T5X A;  3O6B B;  5BS6 A;  4A0Y A;  5L3C A;  4AVP A;  2RC4 A;  2ISY A;  2QBY B;  3QPT A;  4EV0 A;  3GUD A;  1ZG3 A;  4R79 A;  1Z91 A;  3Q9S A;  1XCB A;  1EH8 A;  2ZJ2 A;  4WWC A;  1KYW A;  4N0B A;  2Z3Y A;  3F8N A;  5HS7 A;  1O7L A;  2AS5 F;  1QQI A;  3FXU A;  2VBW A;  4BAY A;  3QP5 A;  2IRF G;  3HTS B;  5FGM A;  2DK8 A;  3HUG A;  4G94 A;  2NS0 A;  2VT2 A;  1MJ9 A;  3E97 A;  3F8B A;  5ERI A;  1U2W A;  1XMK A;  1HQC A;  5D6F A;  3R61 A;  3E5U A;  4A2U A;  4L9T A;  1JE8 A;  1FBQ A;  4KFC A;  1SD4 A;  3LA2 A;  1P4A A;  2HQR A;  1YW7 A;  1W4M A;  2G7U A;  2DBB A;  4L9V A;  2FQ3 A;  3ZN0 A;  2BV6 A;  4U0W A;  1REP C;  2P6T A;  4A0X A;  5JHU A;  2NNY A;  2MLG A;  1LEA A;  3N97 A;  4LG0 A;  3IRQ A;  3E3V A;  3ECH A;  4LD5 A;  2H6B A;  3FWE A;  1F1Z A;  2CGP A;  4HQM A;  4WK8 F;  3DPT A;  5CVI A;  2PI0 A;  2XVC A;  3WTY C;  3GLX A;  2O6G E;  3MZY A;  3P9I A;  1T6S A;  4A0Z A;  4A6D A;  3S2W A;  3H3U A;  5D5U B;  4U7D A;  1EH7 A;  4S04 A;  2EA2 A;  3QPH A;  1RUO A;  1FSE A;  1K78 B;  4I0B A;  3VOE A;  4JK1 X;  1BM9 A;  2G9W A;  5L3G A;  2Z33 A;  4KN7 X;  4G7O F;  1CGP A;  3ZP5 A;  3M8F A;  4CYD A;  4UV9 A;  3TO9 A;  2J5P A;  4L9N A;  4KDP A;  2H94 A;  2KJC A;  4GYI A;  4IJA A;  3BJO A;  4ESJ A;  3V4G A;  3KET A;  2CYY A;  5ICE A;  4L5I A;  2FSW A;  3F21 A;  2YU3 A;  3HSF A;  3ULQ B;  4ESF A;  3WTX C;  4L18 B;  4I7H A;  2DQR A;  3FHZ A;  5L3E A;  4AIK A;  2F5D A;  4KIB A;  1SMT A;  4PZJ A;  5D5X B;  4MGR A;  4HA8 A;  3P7N A;  2ETH A;  2AXL A;  1OR7 A;  5D8L B;  3J81 Z;  4RGS A;  3GEZ A;  2M8E A;  5FLX Z;  1T38 A;  5E1Z B;  5K1Y A;  2DT5 A;  1R5G A;  2Y0M A;  3R0A A;  4KYW A;  2XKO A;  1R1V A;  5H20 A;  2MD5 A;  3CLO A;  1HW2 A;  4BYY A;  2HGC A;  3L09 A;  4HF1 A;  5D4S A;  1IN8 A;  4OIP F;  2FML A;  4PCQ A;  3NQO A;  4MEX F;  2E7X A;  1E2X A;  3WGG A;  1Z6R A;  4A5N A;  2QBY A;  3LA7 A;  5DV5 A;  1K79 A;  1XB4 A;  3B02 A;  1YS7 A;  2A07 F;  3GXO A;  2K27 A;  4LGW A;  1BIA A;  2CG4 A;  3EUH A;  2XRN A;  2ZKZ A;  2LSO A;  1BIB A;  1TW3 A;  4UXN A;  3WTV C;  4L0Y B;  1ZRC A;  1TNT A;  3CUO A;  2L02 A;  3WU1 B;  1FNN A;  3JAM Z;  1UST A;  4IHT A;  4FT8 A;  1ON1 A;  3ELK A;  1I27 A;  5HLI A;  5ILU A;  1XSV A;  2V79 A;  1P92 A;  1FBU A;  3DEU A;  2HDC A;  1BI2 A;  4U7B A;  4I0A A;  3KP3 A;  4ZYD A;  1U5T C;  2L01 A;  5L3B A;  3CUQ B;  5ED4 A;  2FNP A;  1O3R A;  1O3T A;  3LST A;  4Y13 A;  4Y15 A;  4WX9 A;  4IVN A;  1IXS B;  4XBF A;  4UUV A;  5CVU A;  3K0L A;  3QU3 A;  5E17 F;  4U0Y A;  3Q5F A;  3BJA A;  4XSZ F;  2XAG A;  3WE3 A;  1OMI A;  1IN6 A;  2ZCW A;  1XSX A;  4EQQ A;  2IJL A;  2XRO A;  2DLL A;  1B1B A;  4LK1 F;  2HTJ A;  1GVJ A;  4MHG A;  4PGG A;  4HX7 A;  1LNW A;  2EFN A;  1XDU A;  3BZ6 A;  2K86 A;  5E8I A;  1H9G A;  3E6C C;  3I71 A;  2M30 A;  3RDI A;  3TOB A;  2TDX A;  4HQE A;  5IT9 K;  2L4A A;  5AIP A;  3WE2 A;  5BOX A;  3LFK A;  2D1V A;  1BOA A;  1R23 A;  4XRF A;  1ZN2 A;  1R1T A;  1TTY A;  2CFX A;  3K1M A;  4ZYG A;  4U88 A;  1U78 A;  2P5V A;  3HOT A;  3B73 A;  4D0P A;  4M72 A;  5A2Q Z;  3IKV A;  2QYO A;  2EFO A;  3M8E A;  1HXD A;  3KP5 A;  3FXR A;  5HLH A;  2QZ8 A;  2OQG A;  2CW0 F;  4RGX A;  4GGG A;  5ILV A;  2F5F A;  5FO5 A;  1IXR C;  2W85 A;  5ICF A;  3F22 A;  1PP7 U;  3P9K A;  1YW8 A;  4FX0 A;  1CF7 B;  2F5C A;  5KVR A;  4BHB A;  3RJP A;  4PDK A;  5FFX A;  4ON0 A;  4LJZ F;  1LEB A;  4KN4 X;  4WCG A;  2X0L A;  1S8N A;  4G6D A;  1IAW A;  4LFU A;  1MD0 A;  1YYV A;  1JGS A;  5L3F A;  5K5O A;  2A68 F;  2BGC A;  1W7P A;  2DPU A;  1IN4 A;  4MQV A;  3WG9 A;  3I54 A;  4RB0 A;  4LLG F;  4BH9 A;  1V4R A;  2FE3 A;  1LDK B;  3ZMZ A;  1UCR A;  3EET A;  2NAZ A;  3F8M A;  2FMY A;  2K7L A;  3O3K A;  2NYX A;  3DFG A;  1ZRF A;  4P96 A;  4YII A;  3CUQ C;  4HDV A;  3V8K A;  4MQ9 F;  4M6X A;  2DTR A;  3J80 K;  2R3S A;  3RYR A;  4A5M A;  1XGS A;  2ZBK A;  4Q47 A;  4N9I A;  1ZGA A;  3MZH A;  4OIN F;  4I01 A;  3C1D A;  3GZ6 A;  1KA8 A;  1BI0 A;  2PBI A;  2H27 A;  1F5T A;  4RB2 C;  4CO8 A;  1ONV A;  4NQW A;  2E7W A;  1GXP A;  4HLX A;  3I4P A;  1IN7 A;  2QQ9 A;  5DD8 A;  4KMU X;  2V1D A;  4RAY A;  2O0Y A;  1V3F A;  2VOP A;  1HKS A;  1AWC A;  2OU2 A;  1MZB A;  3KP6 A;  4YG2 F;  2M5W A;  5CVJ A;  2Z99 A;  3F3X A;  4G7Z F;  3SQN A;  1FY7 A;  4BNC A;  4KUM A;  1U5T B;  5JFR A;  1R22 A;  3F8C A;  3C7J A;  2PJP A;  4OIR F;  2RV8 A;  2CO5 A;  1IW7 F;  2EV6 A;  1FYL A;  2VBY A;  3ZMV A;  4EGY A;  4M71 A;  3M7G A;  2HFH A;  3L7W A;  4EVI A;  1FLI A;  2ZFW A;  2MC3 A;  3TDU C;  2L3D A;  4B8X A;  3ERE D;  2W25 A;  3L2C A;  4AIH A;  4ESB A;  3SFZ A;  5DUK A;  1F9N A;  4KA4 A;  1R1U A;  2OZU A;  3RKW A;  2XHK A;  3E5Q A;  1UB9 A;  2V9V A;  2FRH A;  1B6A A;  4ENM A;  2Q0O A;  1ZAO A;  4F7Z A;  1XGN A;  3ROU A;  1ZLJ A;  3HRT A;  5LBQ A;  3ZMT A;  1G3Y A;  3WU0 A;  4KMF A;  1QPM A;  1G3S A;  4FX4 A;  3KCC A;  4BQA A;  5K5Q A;  2HEO A;  4KNY A;  2HWV A;  2YPR A;  1FP1 D;  2YSR A;  3TKY A;  1SMY F;  3LWF A;  2IA0 A;  3RKY A;  3HHG A;  4RGR A;  3MWM A;  3EYI A;  1R00 A;  1QNT A;  2DI3 A;  2IPQ X;  2ZO4 A;  5H6Q A;  4K2E A;  2MLK A;  1ODD A;  1QBJ A;  1R7J A;  3F72 A;  1ZG5 A;  3GFJ A;  3SXY A;  4ENJ A;  4GYG A;  1KQ8 A;  1J9I A;  1PP8 F;  1ZHF A;  4IPA A;  4ENK A;  1FSH A;  2FXA A;  4G8X A;  5HS9 A;  3ISP A;  3RKX A;  4ZYH A;  4RAZ A;  4ZZD A;  5HDK A;  2FF4 A;  4LG0 B;  4UNO A;  2VXZ A;  4EMS A;  3J80 Z;  2GWR A;  2K02 A;  3W6K B;  2BEO A;  2JTV A;  4G6Q A;  1O7F A;  2OQR A;  1FYM A;  1SD7 A;  3HRU A;  1OYY A;  4HX4 A;  4I02 A;  4L9J A;  2FBH A;  2O03 A;  5FB2 A;  4EM1 A;  1FYK A;  2M1B A;  4P9U A;  4HYE A;  2A6E F;  2EV0 A;  5E8G A;  1BN5 A;  2M87 A;  1L0O C;  1YS6 A;  3KP2 A;  1J0R A;  3O2P E;  1WKM A;  3IL2 A;  4MNU A;  2VON A;  2O3F A;  4BXU A;  1U8R A;  3IHU A;  3VOD A;  3HIF A;  4HV6 A;  4ENN A;  4P55 A;  2A69 F;  2ZXJ A;  4CZZ A;  4G7H F;  3GO5 A;  3RI4 A;  1A04 A;  1S7A A;  2KJB A;  2IA1 A;  2HYG D;  1YQA A;  1FX7 A;  3R0J A;  1WI9 A;  2JRT A;  4OMZ A;  4OIQ F;  5F1R A;  3WTT C;  2ACJ A;  5D6E A;  4S05 A;  2MH9 A;  1OYW A;  3LQR A;  4M74 A;  4Q4Z F;  4ZYE A;  1J5Y A;  4HF2 A;  3MAJ A;  5JI6 A;  1RIO H;  2IW5 A;  2ZME A;  1UHM A;  4RB3 C;  3W6J B;  5FFZ A;  5LRR A;  3ML6 A;  3CO7 C;  2O8X A;  1RI7 A;  2DAO A;  2DK5 A;  1IXC A;  1OPC A;  1T0F A;  2K4J A;  1P2F A;  2E1C A;  3DPL C;  3K2Z A;  2UWM A;  1STZ A;  4UV8 A;  5FD5 A;  3C18 A;  1MJA A;  1S6L A;  1GXQ A;  3I58 A;  1SD5 A;  2JSC A;  4BHC A;  2HZT A;  5JR3 A;  4A6E A;  2VE8 A;  3WTW C;  5IT9 Z;  2JPB A;  2VBX A;  5BQT A;  2Q2E A;  2HR3 A;  3LA3 A;  1YW9 A;  1BC8 C;  5KK1 A;  2Z9O A;  2W57 A;  2W24 A;  3HRM A;  1IZ1 A;  2G7H A;  1I6X A;  3GYH X;  3HTU A;  1TW2 A;  2UZK A;  1IUY A;  4YFN F;  4JBA A;  3BPV A;  5DCM B;  3V7C A;  5F6F A;  2KIM A;  2PFB A;  2V1U A;  2XAS A;  3FZV A;  4GO1 A;  1MJB A;  4YIF A;  3KP4 A;  5LEK A;  5L3D A;  1FPQ A;  3DP7 A;  3KZZ A;  5BPI A;  1IF1 A;  1KQ9 A;  1QO0 D;  1YIO A;  4TV7 A;  4O3M A;  5E18 F;  1S7O A;  4DQ2 A;  3JW4 A;  3LQQ A;  2BYV E;  3TO7 A;  5D8K B;  3KEO A;  1SAX A;  2P6S A;  4MTD A;  1PUE E;  1TQI A;  3R60 A;  4R1H A;  5J8F A;  3ABU A;  1HKT A;  5J6X A;  2EWN A;  3RTR A;  1HSJ A;  4LB6 B;  3WGH A;  3PFI A;  3SZT A;  1OYI A;  2ESH A;  5AIQ A;  4AD9 A;  1EV7 A;  2A3S A;  4OIO F;  5EEH A;  2HKX A;  3R4K A;  3GFI A;  2XGX A;  4EM2 A;  3T8R A;  3WOD F;  1R36 A;  4XLP F;  1H0M A;  1H9T A;  2GA2 A;  1D3Y A;  1XMA A;  4O5V A;  1C0W A;  2KIF A;  3JSP A;  1U3E M;  2COM A;  2Y48 A;  5LGN A;  4M6Y A;  4EM0 B;  2QQA A;  1I1G A;  3FM5 A;  1QGP A;  1I1S A;  3CUQ A;  1T39 A;  1R58 A;  1SFX A;  4BHP A;  2FOK A;  3DKW A;  3Q9V A;  2V1X A;  5HDG A;  3KLN A;  1BJA A;  1DPU A;  3D0S A;  2QEN A;  3KFW X;  3WTS C;  3BDD A;  3NRV A;  3H92 A;  1HW5 A;  3I0T A;  2ESN A;  3LAP A;  3BJ6 A;  1P4X A;  2HS5 A;  3FMQ A;  3T1B A;  2W84 A;  2OD5 A;  3WTZ A;  4ASN A;  3G3Z A;  1ZAR A;  2MH2 A;  3K69 A;  1XGO A;  1B9N A;  1FWZ A;  4AIJ A;  3QP6 A;  3KEQ A;  5H6R A;  3ZN1 A;  1I5Z A;  3GX4 X;  1K7A A;  2LNB A;  4UVB A;  3K9T A;  3SZP A;  5TRD A;  2IP2 A;  3J7A O;  4KIG A;  2EV5 A;  2DW4 A;  4LMY A;  2JT1 A;  2HKO A;  1P6R A;  2PMH A;  1IRF A;  1D8J A;  4EJO A;  5F64 A;  3DV8 A;  2R7F A;  5DUI A;  2VOD A;  3FMR A;  2Q8K A;  1FC3 A;  1NHA A;  1MKM A;  2GXG A;  1G3W A;  2EFQ A;  1U6G A;  1XGM A;  1D8K A;  4U0V A;  4LB5 A;  3MFK A;  2MA3 A;  4UVC A;  3E5X A;  2EJR A;  5BPD A;  5LHI A;  5TJJ A;  3JTH A;  2ADU A;  1JXS A;  4FHT A;  3VB2 A;  4YFX F;  4RGU A;  1U5T A;  1OKR A;  5DD4 A;  1TQP A;  1HKQ A;  3V7R A;  3GVA A;  1WQ2 A;  1HST A;  1KU2 A;  3QRF F;  1G6N A;  1J59 A;  5LEJ A;  1K6O A;  2EB7 A;  5E1W A;  4UHT A;  4QLC U;  2OA4 A;  5D4R A;  3BWG A;  4HF0 A;  4HX8 A;  2GAU A;  3K1N A;  1ULY A;  1R5H A;  1RUN A;  2RN7 A;  1O57 A;  5LHH A;  1MDM B;  2PQ8 A;  4HDU A;  2YX4 A;  1J7K A;  1FT9 A;  1Z7U A;  5D5W B;  3E6M A;  4DNC A;  3PQK A;  3KP7 A;  2IT0 A;  3BP8 A;  1Y0U A;  4PGH A;  5CJ9 A;  1XDS A;  5DYM A;  2BE5 F;  3TOA A;  2FEZ A;  1T98 A;  4MEY F;  3VFZ A;  4HAM A;  3C3W A;  4LLN A;  4IRG A;  3U9G A;  4G9Y A;  3T0Y A;  4Q48 A;  3BPX A;  2RNJ A;  1ZLK A;  1AOY A;  4EJT A;  5DCF A;  4A12 A;  2H09 A;  2YR2 A;  2VBZ A;  1ZYR F;  3GFL A;  1UFM A;  1SFU A;  4GXO A;  3REO A;  4ZH4 F;  1KYZ A;  3KLO A;  2H6C A;  1Q1H A;  3HSE A;  2FNA A;  2L4M A;  2FU4 A;  3D5L A;  3GWZ A;  2GIV A;  3ABT A;  1L3L A;  2O61 A;  3ZMU A;  2HTS A;  1YTY A;  4OU0 A;  3L00 A;  2D45 A;  4ZZL A;  4KT5 C;  3MEX A;  2DU9 A;  1Z9C A;  3QOP A;  4EJW A;  5E1X A;  1KGS A;  3L9F A;  2LKP A;  3GW2 A;  2CWE A;  2J5O A;  4I98 B;  2D1H A;  4CHU A;  2STW A;  2NRA C;  5ILS A;  1UHW A;  2XKP A;  5BMZ A;  5FD6 A;  5A2Q K;  2A5Y B;  2GA1 A;  5DEQ A;  2M45 A;  2HQN A;  2QVO A;  5LGU A;  1HBX G;  5DDG A;  1LB2 A;  3QU6 A;  4M9S A;  4CXF A;  4P5O A;  3ZMS A;  1KU7 A;  3JTG A;  1DDN A;  3JSO A;  2Y75 A;  4HW0 A;  4CDG A;  2XAJ A;  4L5J A;  3ZQ7 A;  5AON A;  2RDP A;  5HLG A;  3TQN A;  2JPC A;  4OMY A;  3CJN A;  1BBY A;  3CO6 C;  1K78 A;  1JHH A;  1F4K A;  4IRI A;  4HOB A;  4H0E A;  4O6J A;  4E70 A;  1S29 A;  2UXN A;  3ECO A;  1XD7 A;  1ZRD A;  4CGZ A;  5FLX K;  5HVQ C;  3IRR A;  2XAQ A;  3FMS A;  2YX7 A;  4JQF A;  3DF8 A;  3VEP A;  4MTE A;  2PG4 A;  3HOS A;  5CVR A;  3EDP A;  3F23 A;  5CYV A;  3M9A A;  5CLS A;  1E17 A;  3KE2 A;  4R8H A;  3F6V A;  4IRH A;  1FOK A;  1B59 A;  1KU3 A;  2ZNZ A;  2EFW A;  1B4A A;  2F5E A;  1YFH A;  1TLH B;  4M73 A;  1IRG A;  4KIC A;  4WXH A;  4GCV A;  2EA4 A;  1QZY A;  2OBP A;  1TNS A;  3LAJ A;  2MBF A;  3I59 B;  4IHS A;  3FM3 A;  3JAM K;  2WC2 A;  3HSR A;  5LGT A;  1YG2 A;  1LQ1 A;  2XIG A;  2GZW A;  4M9Z A;  2R7D A;  6PAX A;  1XN7 A;  3IKT A;  4AWX B;  4M9X A;  1DPR A;  2STT A;  3NEU A;  1S3J A;  1XCV A;  5HDN A;  5K5R A;  4EJV A;  5HS8 A;  1SD6 A;  4Z2Y A;  3I53 A;  2RVC A;  4QWQ A;  4XSX F;  1JHF A;  1DUX C;  2DO7 A;  5DCM A;  2VC1 A;  4OOI A;  3U1D A;  2RQP A;  1YO5 C;  4B09 A;  1USS A;  2NNN A;  1B9M A;  1PDN C;  4I09 A;  2VT3 A;  2IVM A;  4WXD A;  1Z05 A;  5HOO A;  1QZZ A;  3OOP A;  1DP7 P;  2FBK A;  3CTA A;  3FF5 A;  4UVA A;  4WXC A;  2C6Y A;  1W7P D;  1W5T A;  2QM3 A;  2ZME B;  1ZGJ A;  5LRS A;  3KZY A;  3U2R A;  3P9C A;  3J81 K;  4KIF A;  1IN5 A;  2ZNY A;  2PLY A;  2VN2 A;  2X4H A;  4N9H A;  2OZ6 A;  2FBI A;  3GZ5 A;  3TDZ C;  1XSD A;  2EFP A;  1LDD A;  2BBY A;  2CQK A;  2QLZ A;  1CF7 A;  2OAZ A;  1P4W A;  2QUF A;  4RB1 A;  2WWY A;  3IC7 A;  3QAH A;  4EGZ A;  3ZMD A;  5JVT A;  1W5S A;  3HHH A;  4P9F A;  2GQQ A;  2DQL A;  1LVA A;  2B0L A;  2XAF A;  4Q5S F;  1J75 A;  3I59 A;  1FZP B;  3BRO A;  4IXA A;  4LK0 F;  2LF7 A;  1X3U A;  3I64 A;  2CSO A;  3GF2 A;  3FXQ A;  1D5V A;  1SFE A;  1Z1D A;  1MGT A;  4HV5 A;  2EK5 A;  3E6B A;  2PN6 A;  3GFM A;  1J2X A;  2LF8 A;  1T2K A;  3E6D A;  2HOE A;  2VC0 A;  2KRF A;  2XV4 S;  2ELH A;  3EYY A;  3OV8 A;  3IWZ A;  1YLF A;  1BI3 A;  2FA5 A;  4LLL A;  3AAF A;  2P8T A;  3WTU C;  3V8L A;  3BOQ A;  2Z5U A;  2WTE A;  2RGV A;  3F6O A;  1ZRE A;  3V8J A;  3N4M A;  1ON2 A;  2P7V B;  2E1N A;  4RS8 A;  5EEG A;  2ISZ A;  1W7P B;  1GHC A;  2IA2 A;  3IWF A;  5CVV A;  1KQ0 A;  1O3Q A;  2K4B A;  1ZG1 A;  2F2E A;  4IF4 A;  2PEX A;  1ZH5 A;  2XAH A;  2VE9 A;  3HYI A;  3I5U A;  2QQB A;  2DFI A;  2RKH A;  2D2W A;  5LLQ A;  3EQL F;  3SHF A;  3DQV C;  4XLN F;  2XUB A;  1Z6T A;  2P5L C;  2L54 A;  5E20 A;  2PMU A;  3V7S A;  4EJU A;  1FBS A;  4WF2 A;  3TO6 A;  3F8F A;  4CIC A;  2DPD A;  3H3Z A;  2JZY A;  4HLY A;  1VTN C;  5J8C A; 
#chains in the Genus database with same CATH topology
 4NHJ A;  3TGN A;  2EH3 A;  4CCL A;  1W0T A;  1RNL A;  2AQE A;  4HNT A;  3RIR A;  2R5Z A;  1P9Q C;  2MAB A;  4HZF A;  3BC8 A;  1MW7 A;  2LC2 A;  4XON A;  1A31 A;  1WRJ A;  2CW7 A;  2ZJQ F;  1KU9 A;  2P7C B;  4ZC3 A;  2EIL H;  3G73 A;  1RZ4 A;  2Y9Y A;  3CDH A;  1O3S A;  2A6H F;  1BR1 A;  3CD6 I;  4CYC A;  3S1Q J;  5FJ8 J;  5D5V B;  3OYG A;  3WGI A;  4L0Z B;  4J00 A;  1LVK A;  1Y56 A;  1BI1 A;  3RPU A;  5B3S H;  1TC3 C;  2E1M C;  1HW1 A;  2KKO A;  3F0C A;  1FTZ A;  3RYP A;  1LDJ A;  3CJR B;  5LHG A;  1T95 A;  3PQJ A;  4XRM A;  3K1P A;  4F92 B;  5IT3 A;  3JRI A;  1TBX A;  4HBL A;  2QEX I;  1G4D A;  2MW8 A;  4XMY A;  1MSF C;  2P4W A;  5ICG A;  4RDU A;  2ELK A;  1EH6 A;  2HVQ A;  1LJ9 A;  2CW8 A;  5K7F A;  3GTJ J;  2GXB A;  2M4K A;  1A5J A;  5KCM A;  3DXJ F;  5ICC A;  3COA C;  1BC7 C;  5EEA A;  1T08 B;  4YFK F;  1SFO J;  3K4B A;  4Y17 A;  3ZPL A;  1U9N A;  1MDM A;  3HZJ A;  3LSG A;  2LDU A;  3MCZ A;  4II3 A;  3BY6 A;  5J1U A;  1G3T A;  1ITY A;  2UXX A;  3MQ0 A;  5GPA A;  2V6C A;  1YJW I;  2ID3 A;  2QWW A;  2QSH X;  2JVH A;  4NB5 A;  4BQN A;  2KIU A;  2P5K A;  2JA8 J;  2VOO A;  1TQM A;  2A61 A;  3RPQ A;  3FX3 A;  4CSW A;  4BE1 A;  2HYF A;  1WWX A;  2WV0 A;  1MMD A;  3HRS A;  2NVU B;  3T8T A;  2MSY A;  3R6S A;  4I2O A;  5EYR A;  1WSU A;  1JTX A;  1FP2 A;  3VYU B;  3M1E A;  4ETS A;  3T5X A;  3O6B B;  2E5N A;  2LRD A;  2DJN A;  5FLM J;  3TW6 A;  1T33 A;  5BS6 A;  4UUS A;  1AHD P;  4A0Y A;  5L3C A;  2XC7 A;  4AVP A;  2TRT A;  2RC4 A;  3OIQ A;  2ISY A;  2QBY B;  2HDW A;  1K4T A;  3QPT A;  4EV0 A;  3GUD A;  1ZG3 A;  3GCM A;  4R79 A;  1Z91 A;  3DPU A;  1MNM C;  3A03 A;  2QSG X;  3Q9S A;  3RQ4 A;  1XCB A;  1EH8 A;  2NS8 A;  3HL2 A;  1Z67 A;  3B6C A;  5CQE A;  4OAZ A;  4XRS A;  4FIS A;  2ZJ2 A;  4WWC A;  1KYW A;  1UZC A;  4N0B A;  2LYC A;  2Z3Y A;  1ETX A;  3F8N A;  5HS7 A;  1O7L A;  3RQI A;  3GTG J;  2AS5 F;  1QQI A;  2Z2S B;  4NC7 A;  1XPX A;  3FXU A;  3QYF A;  1OFC X;  2L2O A;  2VBW A;  1LE8 B;  4BAY A;  3QP5 A;  1H8A C;  2G0E A;  2IRF G;  3MD2 A;  3HTS B;  2AO9 A;  5FGM A;  2KHM A;  2DK8 A;  1YE9 A;  2DFE A;  3HUG A;  4GDF A;  4G94 A;  1FJL A;  3UR3 C;  3RZD J;  2EZH A;  2NS0 A;  2CUE A;  2VT2 A;  1MJ9 A;  3ASN H;  3E97 A;  3F8B A;  5J3L A;  4YEL A;  1SAN A;  2DMU A;  5LFA A;  2F5V A;  4A3B J;  3G71 I;  2LFB A;  5ERI A;  2CUZ A;  2NVY J;  1U2W A;  1XMK A;  1HQC A;  3BG9 A;  2F4I A;  2CV1 A;  4CCN A;  5D6F A;  3R61 A;  3E5U A;  4A2U A;  2KIS A;  3HPH A;  4L9T A;  4XKW A;  1JE8 A;  3HGG A;  1FBQ A;  4XKC A;  3KIO A;  4KFC A;  1VQ4 I;  5DM7 F;  2BXZ A;  1SD4 A;  3LA2 A;  1P4A A;  1SC7 A;  2HQR A;  5IYC J;  1YW7 A;  2GIZ A;  1R4N B;  1R4M B;  1W4M A;  3DTE A;  3OYE A;  2G7U A;  2DBB A;  2YUS A;  3ZRG A;  4L9V A;  4XN3 A;  2FQ3 A;  3ONQ A;  3ZN0 A;  4IOA F;  4QPO A;  2BV6 A;  4U0W A;  1REP C;  4A3G J;  2P6T A;  4HPQ A;  4A0X A;  5JHU A;  2NNY A;  2MLG A;  2VB6 A;  4LIT A;  3PUB A;  5C4J J;  1LEA A;  2Y30 A;  1Y0N A;  3N97 A;  4LG0 A;  3E0J B;  3IRQ A;  3E3V A;  3ECH A;  4A3F J;  2HOT A;  4LD5 A;  3E1S A;  3K4N A;  2F6C A;  2H6B A;  3CF2 A;  4PJN A;  2R7Q A;  4BXF A;  2LTP A;  1F1Z A;  2BVL A;  2XGC A;  3FWE A;  2A6T A;  4HQM A;  4WK8 F;  3OYL A;  3DPT A;  5CVI A;  1D5Y A;  2CGP A;  2PI0 A;  1DP3 A;  2XVC A;  3OYC A;  2XAU A;  3WTY C;  3JRF A;  1RET A;  3MKZ A;  2ZJR F;  3UKG A;  3GLX A;  3A01 B;  3AL0 B;  3CZ6 A;  4CCO A;  2O6G E;  3MZY A;  3P9I A;  2L9V A;  1T6S A;  4A0Z A;  3D5R C;  3PO3 J;  4XRS G;  1NG7 A;  3S2W A;  4A6D A;  1FTT A;  3H3U A;  4CA0 A;  4RLF A;  5D5U B;  4U7D A;  1EH7 A;  4S04 A;  2EA2 A;  3CP8 A;  3QPH A;  1RUO A;  2X51 A;  2Z16 A;  1FSE A;  1K78 B;  2L9R A;  2R5Y A;  4I0B A;  3VOE A;  4JK1 X;  1BM9 A;  2G9W A;  1A35 A;  1X4O A;  3OYF A;  5L3G A;  2UUZ A;  2Z33 A;  3BTJ A;  4KN7 X;  4G7O F;  1CGP A;  3ZP5 A;  3M8F A;  5FKL A;  2VPR A;  5E3O A;  4CYD A;  3CMY A;  1Z0X A;  2NVT J;  2VKD A;  4UV9 A;  2J5P A;  3TO9 A;  3HPG A;  1JT0 A;  1UJ8 A;  4L9N A;  5JLX A;  3IV5 A;  1DU0 A;  4KDP A;  1VQM I;  2H94 A;  2KJC A;  3IH3 A;  4GYI A;  4IJA A;  3BJO A;  3FDY A;  4BDY A;  4ESJ A;  2PJR A;  3I56 I;  3PIO F;  3V4G A;  3KET A;  3AG2 H;  2CYY A;  5ICE A;  4L5I A;  2FSW A;  3F21 A;  1POG A;  3OS2 A;  2YU3 A;  1K61 A;  3HSF A;  3ULQ B;  4ESF A;  2V7F A;  2QSF X;  3WTX C;  4L18 B;  4I7H A;  2DQR A;  1ETQ A;  3GBG A;  5EGO A;  3FHZ A;  5L3E A;  4AIK A;  2F5D A;  1H88 C;  4KIB A;  5KHD A;  3DU6 A;  1SMT A;  3EUK L;  4PZJ A;  5D5X B;  2DN0 A;  4MGR A;  2L9S A;  4HA8 A;  3P7N A;  2ETH A;  1YX5 A;  2AXL A;  1IGN A;  1OR7 A;  2JWT A;  3BG3 A;  1WJ5 A;  2IEK A;  4RGS A;  5D8L B;  3J81 Z;  4Y52 J;  2HNH A;  2L7K A;  3GEZ A;  2DYS H;  2M8E A;  5J47 A;  3S3M A;  1QRY A;  5FLX Z;  1PVE A;  1T38 A;  4C2M J;  5E1Z B;  5K1Y A;  5F04 A;  2DT5 A;  1KON A;  3BR1 A;  1ZK8 A;  1R5G A;  2Y0M A;  3R0A A;  1MMG A;  4HG2 A;  4KYW A;  1IDY A;  1R1V A;  2XKO A;  5H20 A;  2MD5 A;  3CLO A;  4LG3 A;  1BW6 A;  1IC8 A;  5BNG A;  1HW2 A;  1VQ9 I;  5GAH J;  2MFZ A;  3OWT A;  3JRG A;  4D5F A;  4BYY A;  2HGC A;  2XB5 A;  1ZKG A;  5EJC A;  3L09 A;  4IHW A;  3GLL A;  4U87 A;  3CDL A;  4HF1 A;  4AYB N;  2WV1 A;  5D4S A;  2LVS A;  2OV7 A;  1IN8 A;  4OIP F;  3RZO J;  2FML A;  4PCQ A;  5E3M A;  2W7N A;  4AC0 A;  2ZXW H;  2ZME C;  3NQO A;  4HRI A;  4MEX F;  2R93 J;  1FOY A;  2E7X A;  3FXL A;  4OAY A;  1E2X A;  1LKX A;  3WGG A;  3BTC A;  3PL8 A;  1Z6R A;  3AKZ A;  4A5N A;  3JRH A;  3D1N I;  3LA7 A;  2QBY A;  2YU9 J;  5DV5 A;  1R5I D;  1K79 A;  2CUF A;  1XB4 A;  3B02 A;  3FBI B;  1YS7 A;  2HOA A;  2LY9 A;  2A07 F;  4C2U A;  4AYB A;  3GXO A;  1Y1V J;  2K27 A;  3HOU J;  3WHB A;  4LGW A;  1BIA A;  2CG4 A;  3EUH A;  2XRN A;  2ZKZ A;  2A05 A;  2LSO A;  1BIB A;  4IL6 C;  2XRL A;  2HPM A;  1TW3 A;  1ETW A;  2X1E A;  1IO2 A;  5CKT A;  3AG3 H;  4UXN A;  3H9Q A;  3L1P A;  4V2F A;  3WTV C;  4E7K A;  2QF7 A;  4L0Y B;  1ZRC A;  1TNT A;  3CUO A;  1OQY A;  2L02 A;  3WU1 B;  2IXS A;  1FNN A;  3JAM Z;  4XID A;  1UST A;  4IHT A;  4FT8 A;  1JKR C;  1ON1 A;  3ELK A;  1YIT I;  4G12 A;  3M1C A;  1I27 A;  5HLI A;  1GV5 A;  4BE2 A;  3IUO A;  5ILU A;  2ZXI A;  1XSV A;  2V79 A;  3HUG B;  3H9J A;  3J7Z I;  1ETV A;  1P92 A;  1FBU A;  3DEU A;  2HDC A;  1BI2 A;  2ZB9 A;  4IQ4 A;  5CQG A;  2EBI A;  4U7B A;  4I0A A;  3KP3 A;  4ZYD A;  1P7I A;  1W0U A;  3S8P A;  1U5T C;  3CCU I;  2L01 A;  5L3B A;  1IRX A;  3CUQ B;  3DBR B;  2R7X A;  5ED4 A;  3CMM A;  1E3H A;  2JSP A;  4IZZ A;  3DKY A;  2RNG A;  2FNP A;  1O3R A;  1O3T A;  5EGO B;  3LST A;  4Y13 A;  2AQF A;  4Y15 A;  4WX9 A;  4RAF A;  2R7R A;  4IVN A;  1IXS B;  3L2R A;  2QA4 I;  4XBF A;  4UUV A;  4DJA A;  2CRG A;  5CVU A;  4XLF A;  1X1B A;  3K0L A;  5FRN A;  3H9G A;  3QU3 A;  2CQQ A;  5E17 F;  2HPI A;  2M7A A;  3MN2 A;  4U0Y A;  3Q5F A;  2OJE D;  3BJA A;  4OWR B;  1WCM J;  2F4O B;  4XSZ F;  1VFC A;  2L5Q A;  1S9H A;  2XAG A;  3WE3 A;  2M0C A;  1D0Z A;  1I50 J;  2M9H A;  3IAM 2;  3OL3 A;  5KAI C;  1OMI A;  4A3M J;  5HLT A;  4A93 J;  1IN6 A;  2BY2 A;  2ZCW A;  3RSN A;  2K9M A;  1XSX A;  4EQQ A;  1FOX A;  2IJL A;  2XRO A;  2DLL A;  2E2H J;  1K83 J;  1B1B A;  4LK1 F;  2KRH A;  3CQZ J;  2HTJ A;  1GVJ A;  5HNF A;  4MHG A;  4EEF G;  1LFU P;  4PGG A;  2WA0 A;  4HX7 A;  4XKB A;  3K10 A;  4YEJ A;  1LNW A;  1A6Q A;  2EFN A;  1XDU A;  3BZ6 A;  2K86 A;  5E8I A;  2KLO A;  2WB1 A;  1Y6I A;  2ZJP F;  4PFP A;  1H9G A;  3E6C C;  5M5W J;  4DYQ A;  3I71 A;  2M30 A;  3RDI A;  3ZR8 X;  3KYL A;  3CCM I;  3VDX A;  3TOB A;  2LY1 A;  1E3O C;  1D0Y A;  2O9L A;  2TDX A;  4HQE A;  2V9K A;  5IT9 K;  2L4A A;  4CH7 A;  2GLO A;  3DU5 A;  2JUC A;  5AIP A;  5GPC A;  3ZCO A;  3WE2 A;  2RQQ A;  5BOX A;  5IOY A;  3LFK A;  5M3M J;  2XPV A;  1QHG A;  2D1V A;  4XLH A;  1BOA A;  5GTH C;  2IGK A;  4F52 A;  3PIP F;  1R23 A;  1I6H J;  3BG6 A;  4XRF A;  5TIS C;  1ZN2 A;  1R1T A;  1TTY A;  2CFX A;  3K1M A;  4ZYG A;  3LSI A;  4U88 A;  4Y7N J;  5F1J A;  1U78 A;  3A2K A;  2P5V A;  3HOT A;  2JN6 A;  3B73 A;  4GRI A;  4D0P A;  4M72 A;  1YRN B;  2VQG A;  4B3X A;  5A2Q Z;  4A3I J;  3IKV A;  2QYO A;  2EFO A;  3M8E A;  1HXD A;  3KP5 A;  3FXR A;  5HLH A;  2QZ8 A;  3BTL A;  2OQG A;  2VXD A;  5J1Y A;  2CQ7 A;  3A4C A;  2CW0 F;  3ZQL A;  4RGX A;  4GGG A;  2QKM B;  5ILV A;  3EPZ A;  2F5F A;  5FO5 A;  1IXR C;  2W85 A;  3HDD A;  3GTP J;  5ICF A;  2OF7 A;  3KZI C;  2TCT A;  3F22 A;  1PP7 U;  3P9K A;  4LIU A;  1YW8 A;  4FX0 A;  4PSX A;  4PJJ A;  1CF7 B;  3S1M J;  2F5C A;  1W36 C;  4XN0 A;  5KVR A;  4BHB A;  3RJP A;  2X1D A;  2HQA A;  4PDK A;  4FTH A;  5FFX A;  4ON0 A;  4LJZ F;  4ZDL A;  3HOY J;  2YS9 A;  1VQL I;  2E5Z A;  4KN4 X;  2XGE A;  4WCG A;  1LEB A;  2X0L A;  1SVM A;  1S8N A;  4G6D A;  4HNV A;  2X6W A;  1PUF B;  1IAW A;  3ZQI A;  4N4N B;  4LFU A;  1MD0 A;  1YYV A;  1R49 A;  2JA2 A;  3PJR A;  1JGS A;  5L3F A;  3H36 A;  2X85 A;  5K5O A;  1E3P A;  2R7V A;  3ZGK A;  1LFB A;  2A68 F;  2BGC A;  1W7P A;  2DPU A;  1IN4 A;  4MQV A;  3CCJ I;  3WG9 A;  3I54 A;  3I3L A;  3LSK A;  4RB0 A;  4LLG F;  3ERM A;  4JX6 A;  4BH9 A;  2IS4 A;  3PNV A;  4II2 A;  1V4R A;  1WI3 A;  3HKZ A;  3O8H A;  2FE3 A;  2PX9 A;  1LDK B;  1YJ9 I;  4ZDO A;  3ZMZ A;  1IV6 A;  1UCR A;  1ACI A;  3EET A;  2OPT A;  5KAF C;  3I4N J;  2BW3 B;  2E1M B;  3DLA A;  2NAZ A;  1BR2 A;  3F8M A;  2FMY A;  1OLT A;  2K7L A;  3PFY A;  3O3K A;  2NYX A;  2HZD A;  3DFG A;  3G4S I;  1ZRF A;  1MBJ A;  2PMZ A;  4P96 A;  4W97 A;  2XGD A;  3HJE A;  4YII A;  2W1O A;  4ZTF A;  3HKZ N;  3CUQ C;  2WBM A;  4HDV A;  1B8I B;  3PSI A;  3V8K A;  4RMN A;  3VPR A;  3CCR I;  2BVM A;  4MQ9 F;  3K4C A;  3OIP A;  4M6X A;  4IKF A;  4C9Y A;  2DTR A;  2DXI A;  2NOG A;  3J80 K;  2R3S A;  3RYR A;  2R7W A;  3S2H J;  4A5M A;  2LBF A;  1BR4 A;  2HXO A;  1XGS A;  3B6A A;  4BGD A;  2ZBK A;  9ANT A;  2OTL I;  4AVZ A;  4Q47 A;  4N9I A;  1XMX A;  4BJ5 C;  1ZGA A;  3MZH A;  4OIN F;  4I01 A;  3C1D A;  3Q0W A;  2E35 A;  3GZ6 A;  2EPF A;  1KA8 A;  1BI0 A;  2PBI A;  2H27 A;  1SVO A;  1F5T A;  2GXA A;  4RB2 C;  2R92 J;  4CO8 A;  1ONV A;  4NQW A;  4V19 K;  2E7W A;  2CMP A;  1GXP A;  1N77 A;  4HLX A;  3I4P A;  1GDT A;  1IN7 A;  1TWC J;  2QQ9 A;  5DD8 A;  4KMU X;  1Z77 A;  2V1D A;  4RAY A;  4D9J A;  1ZTR A;  2O0Y A;  3I9V 2;  4B1R A;  1V3F A;  2VOP A;  4BS9 A;  5DS9 A;  1TWA J;  1JJ8 C;  1HKS A;  3ESW B;  5M5X J;  1AWC A;  2OU2 A;  1MZB A;  3KP6 A;  4YG2 F;  4BEH A;  2M5W A;  2VQC A;  5CVJ A;  2Z99 A;  3F3X A;  4G7Z F;  3SQN A;  1T56 A;  2CJJ A;  4ZJZ A;  1FY7 A;  4YIR X;  4KUM A;  4BNC A;  3CCL I;  4E7L A;  1U5T B;  1ZEL A;  5JFR A;  1I39 A;  2E2J J;  2M3A A;  1R22 A;  3U1K A;  5F0F A;  3F8C A;  4IHX A;  4M3B A;  2IBD A;  3C7J A;  5B1B H;  4KIS A;  2VKE A;  2PJP A;  1TWG J;  4OIR F;  3SDB A;  2RV8 A;  5J4Y A;  2CO5 A;  1IW7 F;  2EV6 A;  2VQH A;  3OYJ A;  1Y1W J;  1FYL A;  2VBY A;  2IGM A;  1QU3 A;  5F0H A;  3FIW A;  2VJ4 A;  3ZMV A;  4EGY A;  4M71 A;  3M7G A;  2HFH A;  3TP3 A;  3JCU C;  3L7W A;  4DZJ A;  1LE8 A;  3FKJ A;  4EVI A;  1FLI A;  1MMA A;  3V42 A;  1UHS A;  3DBL B;  2ZFW A;  4RA2 A;  1RRJ A;  3OMY A;  2MC3 A;  4DGW B;  3TDU C;  1YJN I;  2L3D A;  1MSE C;  4B8X A;  3ERE D;  3HM5 A;  3VYT B;  4I6Z A;  2W25 A;  3L2C A;  4MLO A;  5FRM A;  4AIH A;  4ESB A;  1B72 B;  3NWT A;  2HOS A;  4HNU A;  3SFZ A;  5DUK A;  1F9N A;  1TT5 B;  4KA4 A;  1BA5 A;  4BJ6 C;  1R1U A;  3LSH A;  5IYB J;  2OZU A;  3RKW A;  2XHK A;  3E5Q A;  2R5Y B;  1ETK A;  2F48 A;  1UB9 A;  2V9V A;  3JR9 A;  5DM6 F;  2WAE A;  2JA5 J;  1X3Z B;  1N75 A;  2FRH A;  2LKX A;  3CCE I;  1B6A A;  4BAC A;  3CCS I;  2KIQ A;  4ENM A;  1VI0 A;  3LSP A;  1MH3 A;  4ABZ A;  2Q0O A;  1ZR4 A;  3CP2 A;  1ZAO A;  4F7Z A;  2IS1 A;  3A01 A;  1XGN A;  3ROU A;  1ZLJ A;  3HRT A;  4RM3 A;  5IP7 J;  5LBQ A;  1WH5 A;  3ZMT A;  1VQN I;  1G3Y A;  1WGX A;  3WU0 A;  4KMF A;  1QPM A;  1G3S A;  1MBF A;  4FX4 A;  4M3G A;  2Y0S A;  4XR6 A;  1FMW A;  3KCC A;  4XLC A;  1GT0 C;  4A3D J;  4BQA A;  4IX7 A;  4D7N A;  5K5Q A;  4QIW N;  2HEO A;  1SVL A;  2BY3 A;  2KL4 A;  4KNY A;  3GTO J;  2HWV A;  2YPR A;  4JX5 A;  2K5C A;  1FP1 D;  2FD5 A;  2YSR A;  3TKY A;  3CME I;  1SMY F;  3LWF A;  2IA0 A;  2BY1 A;  2L9N A;  5GAG J;  2JK3 A;  3K4L A;  3RKY A;  3HHG A;  4RGR A;  1E0E A;  2MGQ A;  5EDN A;  1MMN A;  3G1L A;  3MWM A;  3EYI A;  1R00 A;  1QNT A;  2DI3 A;  2IPQ X;  2ZO4 A;  5H6Q A;  1Q1V A;  1OCO H;  4K2E A;  2MLK A;  3BTI A;  1ODD A;  1QBJ A;  2LOO A;  3VYS B;  3K4J A;  4J01 A;  1R7J A;  3F72 A;  2XPW A;  1ZG5 A;  3BR0 A;  1ZR2 A;  4IOC F;  4CYC B;  3GFJ A;  3SXY A;  5DTD A;  4GYG A;  4ENJ A;  1KQ8 A;  2Q2E B;  1J9I A;  1PP8 F;  1ZHF A;  4IPA A;  2VJI A;  4ENK A;  1FSH A;  2FXA A;  1BW5 A;  4C30 A;  1WJA A;  2M0M A;  4G8X A;  5HS9 A;  3ISP A;  2VUM J;  2FOW A;  3RKX A;  2LKS A;  4ZYH A;  2EIJ H;  1MBH A;  4RAZ A;  4ZZD A;  5HDK A;  2FF4 A;  3ASO H;  3L2V A;  4LG0 B;  4UNO A;  2VPL A;  5GAD J;  1JTY A;  2K85 A;  3NWS A;  3OSG A;  2K9Q A;  2L7Z A;  3FIS A;  2VXZ A;  3QOD A;  2LBF B;  3AFH A;  1WJB A;  1UAA A;  4EMS A;  3J80 Z;  4ZDP A;  4HEA 2;  2GWR A;  1P7J A;  2K02 A;  3W6K B;  2E34 A;  1MND A;  2JUG A;  2BEO A;  4BL0 B;  2JTV A;  4G6Q A;  2KZG A;  1FEX A;  1IJW C;  1O7F A;  3F9K A;  2OQR A;  2OCE A;  4BBR J;  1FYM A;  1SD7 A;  3HRU A;  4IEJ A;  2M34 A;  3MKL A;  1KZH A;  1OYY A;  2KFD A;  4HX4 A;  4I02 A;  4L9J A;  2ICW G;  1A36 A;  2FBH A;  2O03 A;  3C2G A;  5FB2 A;  4EM1 A;  1FYK A;  1JKQ C;  4MFD A;  2M1B A;  4P9U A;  1YIJ I;  4HYE A;  2IAI A;  3LMM A;  2A6E F;  2EV0 A;  4D1Q A;  5E8G A;  3K6G A;  3SFI A;  1BN5 A;  2M87 A;  5GP9 A;  4ANJ A;  1L0O C;  1ORK A;  5GTI C;  1N78 A;  4BQO A;  1YS6 A;  3K4K A;  3DWL E;  2V1N A;  3KP2 A;  1J0R A;  3O2P E;  1WKM A;  4ZYA A;  3IL2 A;  4MNU A;  4LOC A;  2VON A;  2O3F A;  4BXU A;  2XF5 A;  1BJZ A;  2R7T A;  3SEZ A;  2I5U A;  1U8R A;  1HCR A;  3IHU A;  1IG7 A;  3KEY A;  1JUP A;  4M3D A;  2EZI A;  3VOD A;  3HIF A;  4HV6 A;  5J1R A;  3MKY B;  4ENN A;  2FQ4 A;  4P55 A;  1OR7 C;  2A69 F;  2Z1D A;  2ZXJ A;  3H0D A;  4CZZ A;  4G7H F;  5JLW A;  1B72 A;  3VSL A;  3TBI A;  3GO5 A;  3RI4 A;  2B7E A;  1A04 A;  3QYB A;  4NDL A;  1S7A A;  2KJB A;  2DA6 A;  3HXL A;  2RAE A;  5M3F J;  4NC8 A;  4XIC A;  3G2B A;  2IA1 A;  4XOP A;  1J09 A;  2HYG D;  1YQA A;  4MFE A;  1FX7 A;  3R0J A;  1WI9 A;  3CC7 I;  2JRT A;  4OMZ A;  4OIQ F;  4BXX J;  5F1R A;  3WTT C;  2ACJ A;  5D6E A;  3AG1 H;  4S05 A;  2MH9 A;  3BR2 A;  3DEW A;  1ERD A;  1OYW A;  1I3A A;  3LQR A;  4M74 A;  4Q4Z F;  1DU6 A;  4ZYE A;  2VAS A;  1IV8 A;  1J5Y A;  4HF2 A;  1GVD A;  2A5W A;  3MAJ A;  5JI6 A;  5K7H A;  4XQF A;  1RIO H;  3TP0 A;  2IW5 A;  2ZME A;  2IS6 A;  1UHM A;  4RB3 C;  2DA7 A;  3W6J B;  5FFZ A;  5LRR A;  1Y8R B;  2KT0 A;  3ML6 A;  2X6X A;  3CO7 C;  2O8X A;  4JP0 A;  3BG7 A;  1RI7 A;  2DAO A;  2IS2 A;  2DK5 A;  3HGY A;  4XNF A;  4B43 A;  1IXC A;  1OPC A;  1JT6 A;  1T0F A;  4BJT A;  2K4J A;  4MIM A;  1P2F A;  2R7O A;  2E1C A;  3DPL C;  3K2Z A;  1W36 D;  2UWM A;  1N25 A;  1STZ A;  4UV8 A;  5FD5 A;  3C18 A;  3M4O J;  1FOW A;  2AXT C;  1MJA A;  4M3F A;  3TMO A;  1R9T J;  3VWB A;  1Y39 A;  3UNG C;  1S6L A;  1QHH D;  5FRO A;  3NAR A;  1GXQ A;  3I58 A;  1SD5 A;  2JSC A;  4BHC A;  2HZT A;  5JR3 A;  2L7M P;  4E7H A;  3CC4 I;  1U8B A;  4A6E A;  2VE8 A;  3WTW C;  1NG6 A;  5IT9 Z;  2JPB A;  2VBX A;  4G6T B;  5BQT A;  2Q2E A;  2HR3 A;  2JVG A;  1YW9 A;  3LA3 A;  4XLA A;  4M3E A;  4RLQ A;  1BC8 C;  5KK1 A;  1UEL B;  2Z9O A;  1ZQ3 P;  2W57 A;  1PJR A;  2DYR H;  3GTL J;  4S0H B;  2W24 A;  3HRM A;  1IZ1 A;  2G7H A;  1I6X A;  2BHZ A;  3GYH X;  3HTU A;  1M1E B;  2Q1Z B;  3Q3S A;  1TW2 A;  3PO2 J;  2UZK A;  2EQR A;  5IY5 H;  1IUY A;  3LOC A;  4A69 C;  4YFN F;  4JBA A;  3BPV A;  5B1A H;  2Y31 A;  5J40 A;  4BEH B;  5DCM B;  3V7C A;  5F6F A;  2KIM A;  2DFF A;  2PFB A;  4UB6 C;  3ABK H;  4QTR A;  5E3N A;  1WJD A;  1GV2 A;  3A0B C;  2V1U A;  2XAS A;  2KMU A;  3FZV A;  4GO1 A;  2R7Z J;  1Z3X A;  2LY2 A;  1MJB A;  4YIF A;  3KP4 A;  5LEK A;  3BZK A;  1EA3 A;  5L3D A;  1FPQ A;  3DP7 A;  3QPL A;  3KZZ A;  3SEQ A;  3LL7 A;  5BPI A;  1IF1 A;  1KQ9 A;  1QO0 D;  1X1D A;  4A3J J;  1NH3 A;  5IPA A;  1UG0 A;  1V5G A;  1YIO A;  1QVU A;  2BHY A;  3LNQ A;  1VQP I;  4TV7 A;  1DQU A;  4O3M A;  1SEU A;  5E18 F;  1S7O A;  4E7I A;  4DQ2 A;  2DOE A;  3JW4 A;  3OYM A;  1X2M A;  3LQQ A;  2BYV E;  3H5N A;  1H89 C;  3TO7 A;  5D8K B;  3KEO A;  3W2W A;  1UMQ A;  2BOL A;  2OUM A;  1SAX A;  3WU2 C;  2P6S A;  4MTD A;  1G8X A;  3CF5 F;  1TQI A;  3R60 A;  1PUE E;  3S1N J;  1X1A A;  2LP0 A;  4R1H A;  5J8F A;  2VI6 A;  1TZL A;  3ABU A;  1HKT A;  5J6X A;  2EWN A;  2X6Y A;  1HSJ A;  4LB6 B;  3RTR A;  3WGH A;  3PFI A;  2XF7 A;  5IP6 A;  1HA8 A;  3DKX A;  2IGN A;  3SZT A;  3QQA A;  1OYI A;  4DOZ A;  2ESH A;  4A3C J;  2EIK H;  4XLE A;  5AIQ A;  4F91 B;  2DMQ A;  4AD9 A;  1OJL A;  1EV7 A;  2DT6 A;  3FK6 A;  2A3S A;  4UUS B;  3OYH A;  4OIO F;  5EEH A;  2HKX A;  1I3Q J;  1W1W E;  4RAG A;  3HOW J;  2CS3 A;  3IH4 A;  3BCA A;  3R4K A;  3GFI A;  4XKV A;  2XGX A;  3CJT B;  4EM2 A;  2R7S A;  3T8R A;  3WOD F;  2O5R A;  1R36 A;  2ZFU A;  4XLP F;  1H0M A;  4D5C A;  1H9T A;  1NK2 P;  3EUH C;  2GA2 A;  4RBO A;  2XSD C;  2ZSI B;  1D3Y A;  3TL4 X;  1XMA A;  4O5V A;  3N05 A;  3M8J A;  1C0W A;  3GTQ J;  2NOJ B;  2KIF A;  3A1Y A;  3JSP A;  2LD5 A;  1T8I A;  2COM A;  1RR7 A;  1U3E M;  1ETO A;  3DTI A;  4C3H J;  2V6E A;  2EIN H;  3M3Y J;  1PYV A;  2Y48 A;  2E1O A;  5LGN A;  4M6Y A;  3OS0 A;  3BT9 A;  4EM0 B;  5HOD A;  2QQA A;  1VQO I;  1I1G A;  3ABM H;  3DTK A;  1UG2 A;  3FM5 A;  4C2T A;  1QGP A;  4XOT A;  1I1S A;  3CJQ B;  3S14 J;  3L2U A;  2H1L A;  2X6O A;  2HVS A;  3KYD B;  3CUQ A;  4BUP A;  1T39 A;  3IP4 B;  1R58 A;  1SFX A;  4BHP A;  2HI3 A;  2FOK A;  3PSF A;  3DKW A;  3Q9V A;  5E79 C;  2V1X A;  5HDG A;  1TWH J;  2CUJ A;  3LSR A;  1Z21 A;  2ME6 A;  1VZ0 A;  3DCF A;  3KLN A;  3PM1 A;  3FXJ A;  1X58 A;  4Y4R A;  1BJA A;  1OCT C;  1DPU A;  3H35 A;  1S5L C;  3D0S A;  2MD0 A;  2QEN A;  3KFW X;  2W00 A;  3WTS C;  5M5Y J;  4Y33 A;  3BDD A;  1V54 H;  3NRV A;  5IOZ A;  3H92 A;  1HW5 A;  3I0T A;  2ESN A;  4PK4 A;  2QKL B;  3LAP A;  1X3W B;  3BJ6 A;  1P4X A;  2HS5 A;  3FMQ A;  4MO7 A;  2W84 A;  3T1B A;  3JRD A;  2LG4 A;  2R5Z B;  3QPS A;  3X2Q H;  2OD5 A;  4UB8 C;  3WTZ A;  3G3Z A;  4ASN A;  1ZAR A;  4FET A;  2QGU A;  2MH2 A;  3K69 A;  3AG4 H;  1Y8Q B;  3MZ8 A;  1G59 A;  1XGO A;  1OCC H;  3MVP A;  1B9N A;  5E3L A;  1FWZ A;  4AIJ A;  3OYA A;  1ZGW A;  3QP6 A;  1SAU A;  1VQK I;  4KIT B;  3KEQ A;  5H6R A;  3ZN1 A;  1I5Z A;  3GX4 X;  2HU9 A;  1K7A A;  2VKH A;  3OYD A;  2LNB A;  2LMD A;  4UVB A;  4BU2 A;  2IGO A;  3G1O A;  5EG0 B;  2KQR A;  3K9T A;  3SZP A;  3PNT A;  5TRD A;  2IP2 A;  3J7A O;  4KIG A;  3GTM J;  2EV5 A;  2DW4 A;  2E19 A;  4LMY A;  2JT1 A;  2HKO A;  1P6R A;  1VQ6 I;  4NQW B;  1V5E A;  2PMH A;  3OR1 C;  2JA7 J;  1IRF A;  1D8J A;  4EJO A;  5F64 A;  3DV8 A;  2R7F A;  5DUI A;  2VOD A;  3FMR A;  3M07 A;  2Q8K A;  2VKV A;  1FC3 A;  1NHA A;  4BQQ A;  1MKM A;  4NC6 A;  2HDD A;  4XK4 A;  3L2Q A;  2AHQ A;  2GXG A;  2ID6 A;  1G3W A;  2EFQ A;  3S1R J;  1U6G A;  2VJ5 A;  1XGM A;  1D8K A;  4ITV A;  1YHQ I;  3W6V A;  2DDA A;  4U0V A;  4LB5 A;  3MFK A;  2MA3 A;  4UVC A;  3E5X A;  2EJR A;  5BPD A;  3VSK A;  2ECC A;  5LHI A;  5TJJ A;  3JTH A;  4AUX A;  2ADU A;  1JXS A;  1VQ7 I;  1V5F A;  2DT7 B;  2E71 A;  4EAT A;  4FHT A;  2XF6 A;  1JI8 A;  3VB2 A;  4YFX F;  4RGU A;  1U5T A;  1OKR A;  5DD4 A;  3H5A A;  3QWL A;  2UV1 A;  1TQP A;  2VJJ A;  2HVR A;  1HKQ A;  3V7R A;  3OY9 A;  3GVA A;  1WQ2 A;  4M6V A;  1S72 I;  4AID A;  3WG7 H;  1HST A;  1KU2 A;  3QRF F;  3K70 D;  1G6N A;  1J59 A;  5LEJ A;  1K6O A;  3ZQH A;  4B3A A;  2EB7 A;  5E1W A;  4CUG A;  4UHT A;  4CCK A;  5K7Z A;  2M2E A;  1BOB A;  4QLC U;  4N4O B;  4HSR A;  4CCJ A;  3CCV I;  2OA4 A;  3K2A A;  3FXO A;  3C2B A;  5D4R A;  3BWG A;  2DOA A;  2CV2 A;  4JX4 A;  1TL8 A;  4HF0 A;  4HX8 A;  2Y69 H;  2GAU A;  3K1N A;  3MKW B;  1ULY A;  1ENH A;  1R5H A;  1RUN A;  2RN7 A;  1O57 A;  4FAS D;  2K3P A;  1YRN A;  3O8G A;  5LHH A;  1MDM B;  2PQ8 A;  2EZL A;  1YI2 I;  2K9S A;  1CQT A;  1O4X A;  1B8I A;  3KPH A;  4HDU A;  1FIP A;  1X19 A;  1X4P A;  2YX4 A;  3SZG A;  5KNL A;  3BQZ A;  1X2N A;  2WAF A;  1OIS A;  1J7K A;  1FT9 A;  2LR8 A;  1Z7U A;  2COB A;  2W82 A;  5D5W B;  3E6M A;  4DNC A;  3PQK A;  5HNH A;  3KP7 A;  2IT0 A;  2WAQ N;  3BP8 A;  3CLQ A;  1Y0U A;  4PGH A;  5CJ9 A;  5EZH A;  1RC9 A;  2B9S A;  1XDS A;  4BY1 J;  5DYM A;  5J4V A;  2BE5 F;  1JKP C;  1HDD C;  2ME0 A;  2BW3 A;  3TOA A;  2FEZ A;  1T98 A;  4MEY F;  3VYR B;  3VFZ A;  4HAM A;  3C3W A;  2EIM H;  4LLN A;  5LD2 C;  2PJR B;  3BLY A;  4IRG A;  4Y3O A;  3D5S C;  4XM3 A;  4G9Y A;  3U9G A;  2E2I J;  3T0Y A;  2KP6 A;  1RKW A;  3CDI A;  4QSH A;  4Q48 A;  3OSF A;  3BPX A;  2RNJ A;  4BKX A;  2KPM A;  1ZLK A;  1AOY A;  2FX0 A;  4EJT A;  1U0J A;  5DCF A;  2H09 A;  2YR2 A;  2VBZ A;  3GFL A;  1ZYR F;  4A12 A;  1IDZ A;  1UFM A;  1SFU A;  4JYK A;  2BXY A;  4X1E A;  1JUM A;  2XDV A;  3QOE A;  4XOR A;  4IO9 F;  3SYT A;  4GXO A;  1X1C A;  3RCO A;  2OC6 A;  3REO A;  2OCC H;  4ZH4 F;  1KYZ A;  2BY0 A;  2X9D A;  2X1C A;  2V4J C;  3KLO A;  4LIV A;  2H6C A;  1Q1H A;  3HSE A;  2FNA A;  2L4M A;  2FU4 A;  3D5L A;  3GWZ A;  2GIV A;  3ABT A;  2DOD A;  3J7Y J;  1L3L A;  2O61 A;  3ZMU A;  2HTS A;  5GAE J;  5IP9 J;  1IUF A;  1YTY A;  3HEF A;  4FE4 A;  1MBE A;  4C3J J;  2JQ7 A;  1TWF J;  4HST A;  4OU0 A;  5H2F C;  3L00 A;  1S7E A;  2L7F P;  4YRV A;  2D45 A;  4ZZL A;  1XG1 A;  1WPK A;  4W1U A;  2QQ8 A;  2DMT A;  4KT5 C;  3MEX A;  1WJC A;  4AU7 A;  2DU9 A;  1Z9C A;  2EZK A;  3J7A Y;  3QOP A;  4EJW A;  5E1X A;  1KGS A;  3L9F A;  4PJM A;  1GUU A;  2LKP A;  1XS9 A;  3GW2 A;  2CWE A;  1XC5 A;  2J5O A;  4I98 B;  2ELJ A;  2FJ1 A;  4F55 A;  2D1H A;  3FXM A;  4CHU A;  1OCZ H;  2STW A;  1X1P A;  4FE7 A;  3OYN A;  1OCP A;  3FBN B;  2NRA C;  5ILS A;  4F3Q A;  3S93 A;  1UHW A;  2XSJ C;  2XKP A;  5BMZ A;  2DTZ A;  1D1C A;  5FD6 A;  4JOM A;  3K70 C;  5A2Q K;  2A5Y B;  2WAD A;  3P5J A;  2GA1 A;  2DMP A;  2PMZ N;  5DEQ A;  3K7A J;  4NUB A;  1ETY A;  5F27 A;  3OOU A;  2M45 A;  1HOM A;  2HQN A;  3PUF A;  1JGG A;  4NBQ A;  2QVO A;  3HOV J;  4X6A J;  5LGU A;  3K4M A;  5EF6 A;  1HBX G;  5DDG A;  1XX5 A;  1VND A;  1LB2 A;  3PNY A;  3BG5 A;  1JKO C;  1YX3 A;  3QU6 A;  1A6I A;  2V26 A;  4M9S A;  3G6E I;  3ZQG A;  1BL0 A;  4IQJ A;  4CXF A;  4P5O A;  3OR2 C;  3ZMS A;  1KU7 A;  5B66 C;  3JTG A;  2HQ5 A;  3ZQF A;  1QVT A;  1DDN A;  1W5C C;  2Y9Z A;  3MMY B;  3JSO A;  1GLN A;  2Y75 A;  4B4C A;  4HW0 A;  4CDG A;  1NTC A;  1EF4 A;  2XAJ A;  4L5J A;  3ZQ7 A;  2MG4 A;  2MC4 A;  3OYI A;  5AON A;  3TED A;  1WZ2 A;  2RDP A;  3S2D J;  5HLG A;  3TQN A;  2JPC A;  4OMY A;  3CJN A;  1BBY A;  1WFX A;  3CO6 C;  1VQ5 I;  1K78 A;  3S16 J;  1JHH A;  1F4K A;  1U9O A;  2RRE A;  4IRI A;  4HOB A;  4E4H A;  2CFO A;  5EZG A;  4H0E A;  3AL0 C;  4O6J A;  4E70 A;  1S29 A;  2UXN A;  3H0G J;  3OL4 A;  3ECO A;  2DA2 A;  4BY7 J;  1XD7 A;  1F36 A;  1ZRD A;  4CGZ A;  5FLX K;  5C44 J;  1OCR H;  2P81 A;  3S3N A;  5HVQ C;  2M8G X;  3S3O A;  3IRR A;  2NVQ J;  2XAQ A;  3FMS A;  4E6K G;  2YX7 A;  4JQF A;  3H3V K;  3DF8 A;  1NK3 P;  3VEP A;  2CU7 A;  4MTE A;  2LLK A;  3H5R A;  5IYD J;  2PG4 A;  3HOS A;  3TW7 A;  2V9P A;  3BCB A;  5CVR A;  3EDP A;  1IRZ A;  3F23 A;  5CYV A;  3M9A A;  2H8R A;  5CLS A;  1D0X A;  3GZN B;  3KE2 A;  2CV0 A;  1E17 A;  4R8H A;  3F6V A;  2I10 A;  4IRH A;  1FOK A;  1B59 A;  1KU3 A;  2ZNZ A;  3Q0U A;  1VF9 A;  4C3I J;  4CCM A;  2EFW A;  1B4A A;  2F5E A;  3DLL F;  5FKM A;  3Q0V A;  1YFH A;  2KDO A;  1TLH B;  4M73 A;  1IRG A;  4KIC A;  4WXH A;  2QCO A;  4GCV A;  1MIJ A;  2EA4 A;  1QZY A;  2HXI A;  1HDP A;  2OBP A;  3JRE A;  1TNS A;  3LAJ A;  4DZP A;  3LSJ A;  2MBF A;  1MBK A;  2VQL A;  4DBR A;  1D1A A;  3JRC A;  2JRM A;  2NVX J;  3I59 B;  4IHS A;  1FMV A;  3HC7 A;  3FM3 A;  3H1C A;  3JAM K;  2WC2 A;  2H8W A;  1F43 A;  2GBY A;  3HOZ J;  3HSR A;  4J19 A;  3HBL A;  1DGR M;  5LGT A;  2D5V A;  2JA6 J;  2Y2Z A;  4I76 A;  2K3F A;  3QYE A;  1YG2 A;  1LQ1 A;  2XIG A;  2GZW A;  3W3C A;  3OYK A;  4BDZ A;  2E36 A;  4M9Z A;  2DFH A;  2Y0S N;  2R7D A;  6PAX A;  2K40 A;  3ABL H;  3C2H A;  1PUF A;  1HF0 A;  4BBS J;  1MMS A;  1DGW Y;  1XN7 A;  5B5E C;  3IKT A;  4AWX B;  4M9X A;  2K9N A;  1VQ8 I;  1DPR A;  2STT A;  3NEU A;  2ECB A;  1S3J A;  1XCV A;  5HDN A;  1LPQ A;  5K5R A;  4EJV A;  5HS8 A;  1QPI A;  3RPU D;  3ZQQ A;  1TT0 A;  4PUS A;  1SD6 A;  2HYJ A;  4Z2Y A;  3I53 A;  2RVC A;  5F08 A;  3I55 I;  4PJL A;  4QWQ A;  4XSX F;  1JHF A;  1DUX C;  2DO7 A;  3HOX J;  5DCM A;  1TP4 A;  2VC1 A;  2M4G A;  3CMA I;  3E7L A;  4OOI A;  3U1D A;  2LH9 A;  4I99 C;  2RQP A;  2JJ7 A;  4B09 A;  1USS A;  1YO5 C;  5FKK A;  2NNN A;  4V2G A;  4H4K C;  1B9M A;  2R0Q C;  3S15 J;  1PDN C;  4I09 A;  2R7U A;  2VT3 A;  2IVM A;  1MNE A;  4WXD A;  1Z05 A;  3BR5 A;  3CCQ I;  1R71 A;  5HOO A;  2BZT A;  2LK2 A;  5EG0 A;  1K6Y A;  1QZZ A;  3OOP A;  1R6R A;  4L5E A;  1DP7 P;  5C4X J;  1JUS A;  3FXK A;  3L2W A;  3W2V A;  2R4G A;  1RR8 C;  4UY8 I;  2FBK A;  3CTA A;  4A3L J;  3FF5 A;  4UVA A;  3SDG A;  2CQN A;  4WXC A;  2C6Y A;  2VL8 A;  4A3K J;  3A0H C;  2MYS A;  4B48 A;  5CPR B;  1W7P D;  3BR3 A;  2B63 J;  2WAQ A;  1W5T A;  3OS1 A;  1QZE A;  1SFK A;  2QM3 A;  2ZME B;  1ZGJ A;  3JRB A;  5LRS A;  3KZY A;  3U2R A;  1XTA A;  4GFB A;  3EUA A;  4KT6 A;  3NAU A;  2KRC A;  3P9C A;  2KZV A;  4NNJ A;  1K4S A;  3J81 K;  2DA4 A;  4KIF A;  1IN5 A;  2ZNY A;  4Z6Y A;  2PLY A;  2VN2 A;  4UUT A;  1G2H A;  2X4H A;  2W48 A;  4N9H A;  2OZ6 A;  3ZQC A;  2FBI A;  1AKH B;  3GME A;  2ZSH B;  4DW6 A;  3GZ5 A;  3TDZ C;  1XSD A;  2E60 A;  1AKH A;  2EFP A;  2KDZ A;  3FKI J;  1EJ9 A;  3BQY A;  1LDD A;  2BBY A;  2CQK A;  2QLZ A;  1CF7 A;  3DBH B;  2OAZ A;  1P4W A;  2QUF A;  4RB1 A;  2WWY A;  3OYB A;  4DYC A;  2H1K A;  3IC7 A;  2LRE A;  4DBQ A;  5C3E J;  3QAH A;  4EGZ A;  1WVR A;  4RM2 A;  5F0C A;  3ZMD A;  1FIA A;  2CQX A;  5JVT A;  1W5S A;  3HHH A;  1LUJ B;  4P9F A;  4ZTJ A;  2GQQ A;  2ZXH A;  2DQL A;  1LVA A;  2WB1 N;  2B0L A;  1D1B A;  2XAF A;  4CZC A;  3SJM A;  2L0K A;  4Q5S F;  1J75 A;  3I59 A;  1FZP B;  2DA1 A;  3BRO A;  4IXA A;  3S17 J;  2M7B A;  4LK0 F;  3ZXS A;  2O8K A;  2LF7 A;  4B47 A;  1X3U A;  3I64 A;  3DEE A;  2CSO A;  1APL C;  3GF2 A;  3FXQ A;  2NS7 A;  2CH0 A;  1D5V A;  1SFE A;  3LFU A;  3OIO A;  1Z1D A;  1JJ6 C;  1MGT A;  3FHN A;  4HV5 A;  2EK5 A;  3E6B A;  2PN6 A;  2XPU A;  2F4M B;  1LFP A;  3GFM A;  1J2X A;  5TGT A;  4E7Z A;  2LF8 A;  4IHY A;  1T2K A;  3E6D A;  2HOE A;  4D7M A;  1WJF A;  4B44 A;  1Z7L A;  2VC0 A;  2KRF A;  5JVG F;  5FLV A;  3BR6 A;  2XV4 S;  1HC8 A;  1YOV B;  3HG9 A;  3I4M J;  2ELH A;  3WHC A;  3EYY A;  4PFO A;  3OV8 A;  4DYR A;  3IWZ A;  1YLF A;  1BI3 A;  3BZC A;  4QPQ A;  3GTK J;  2FA5 A;  1Z3Y A;  4LLL A;  3AAF A;  2JMW A;  2P8T A;  3U21 A;  3FK7 A;  3WTU C;  3V8L A;  3BOQ A;  5FKO A;  2GOX B;  2O7O A;  2Z5U A;  2WTE A;  2RGV A;  2DA3 A;  3F6O A;  1ZRE A;  4FCY A;  2DOF A;  1MBG A;  3V8J A;  2DCE A;  4F93 B;  2GM4 A;  5JHF A;  3CES A;  3KYC B;  3N4M A;  1ON2 A;  3CCY A;  2K9L A;  2P7V B;  2E1N A;  2N8G A;  4RS8 A;  4KJZ A;  5EEG A;  2ISZ A;  1V55 H;  2I8D A;  2P0W A;  1W7P B;  3IH2 A;  3CC2 I;  1QA6 A;  1GHC A;  2DJI A;  1WJE A;  2IA2 A;  3IWF A;  4PJ0 C;  1WHU A;  5CVV A;  2X48 A;  1KQ0 A;  1O3Q A;  2K4B A;  4DIQ A;  1ZG1 A;  2F2E A;  4IF4 A;  2PEX A;  3W2A A;  1ZH5 A;  3A02 A;  3G1M A;  1RKT A;  1WH7 A;  2XAH A;  2VE9 A;  3LSM A;  3HYI A;  2DDB A;  3I5U A;  2NXN B;  4E7J A;  2GOM A;  4E7S A;  2QQB A;  2FUG 2;  2DFI A;  2RKH A;  2D2W A;  2WY8 Q;  5LLQ A;  3HB9 A;  3EQL F;  4IHV A;  2VLA A;  3IAS 2;  4FQG A;  4BE0 A;  1RES A;  4X0G A;  3SHF A;  3DQV C;  1RPW A;  4XLN F;  2XUB A;  1Z6T A;  1MH4 A;  2P5L C;  1AA7 A;  2XB0 X;  2L54 A;  3S32 A;  5FKN A;  1HLV A;  1T0F C;  1AU7 A;  4PSW A;  5E20 A;  2PMU A;  2VIX A;  3V7S A;  4EJU A;  1FBS A;  3RKQ A;  4A3E J;  4WF2 A;  3TO6 A;  3F8F A;  2DMN A;  4AM3 A;  1EKE A;  2OTJ I;  4CIC A;  2DPD A;  4P1W A;  3H3Z A;  3KX2 A;  2JZY A;  4HLY A;  4XL9 A;  2DA5 A;  1VTN C;  3ZOB A;  5J8C A;  2W4S A;  2WY7 Q;  2ZC2 A;  3JRA A; 
#chains in the Genus database with same CATH homology
 4NHJ A;  3TGN A;  1RNL A;  3RIR A;  4HZF A;  1WRJ A;  1KU9 A;  2P7C B;  3G73 A;  1RZ4 A;  3CDH A;  1O3S A;  2A6H F;  5D5V B;  3WGI A;  4L0Z B;  3RPU A;  1BI1 A;  1HW1 A;  2KKO A;  3RYP A;  1LDJ A;  5LHG A;  3PQJ A;  3K1P A;  5IT3 A;  1TBX A;  4HBL A;  1G4D A;  2P4W A;  5ICG A;  1EH6 A;  1LJ9 A;  2GXB A;  3DXJ F;  5ICC A;  3COA C;  1BC7 C;  4YFK F;  4Y17 A;  3ZPL A;  1MDM A;  2LDU A;  3MCZ A;  3BY6 A;  1G3T A;  2UXX A;  3MQ0 A;  2V6C A;  2QWW A;  4NB5 A;  2KIU A;  2P5K A;  2VOO A;  1TQM A;  2A61 A;  3RPQ A;  3FX3 A;  2HYF A;  1WWX A;  2WV0 A;  3HRS A;  3T8T A;  3R6S A;  4I2O A;  1WSU A;  1FP2 A;  3M1E A;  4ETS A;  3T5X A;  3O6B B;  5BS6 A;  4A0Y A;  5L3C A;  4AVP A;  2RC4 A;  2ISY A;  2QBY B;  3QPT A;  4EV0 A;  3GUD A;  1ZG3 A;  4R79 A;  1Z91 A;  3Q9S A;  1XCB A;  1EH8 A;  2ZJ2 A;  4WWC A;  1KYW A;  4N0B A;  2Z3Y A;  3F8N A;  5HS7 A;  1O7L A;  2AS5 F;  1QQI A;  3FXU A;  2VBW A;  4BAY A;  3QP5 A;  2IRF G;  3HTS B;  5FGM A;  2DK8 A;  3HUG A;  4G94 A;  2NS0 A;  2VT2 A;  1MJ9 A;  3E97 A;  3F8B A;  5ERI A;  1U2W A;  1XMK A;  1HQC A;  5D6F A;  3R61 A;  3E5U A;  4A2U A;  4L9T A;  1JE8 A;  1FBQ A;  4KFC A;  1SD4 A;  3LA2 A;  1P4A A;  2HQR A;  1YW7 A;  1W4M A;  2G7U A;  2DBB A;  4L9V A;  2FQ3 A;  3ZN0 A;  2BV6 A;  4U0W A;  1REP C;  2P6T A;  4A0X A;  5JHU A;  2NNY A;  2MLG A;  1LEA A;  3N97 A;  4LG0 A;  3IRQ A;  3E3V A;  3ECH A;  4LD5 A;  2H6B A;  3FWE A;  1F1Z A;  2CGP A;  4HQM A;  4WK8 F;  3DPT A;  5CVI A;  2PI0 A;  2XVC A;  3WTY C;  3GLX A;  2O6G E;  3MZY A;  3P9I A;  1T6S A;  4A0Z A;  4A6D A;  3S2W A;  3H3U A;  5D5U B;  4U7D A;  1EH7 A;  4S04 A;  2EA2 A;  3QPH A;  1RUO A;  1FSE A;  1K78 B;  4I0B A;  3VOE A;  4JK1 X;  1BM9 A;  2G9W A;  5L3G A;  2Z33 A;  4KN7 X;  4G7O F;  1CGP A;  3ZP5 A;  3M8F A;  4CYD A;  4UV9 A;  3TO9 A;  2J5P A;  4L9N A;  4KDP A;  2H94 A;  2KJC A;  4GYI A;  4IJA A;  3BJO A;  4ESJ A;  3V4G A;  3KET A;  2CYY A;  5ICE A;  4L5I A;  2FSW A;  3F21 A;  2YU3 A;  3HSF A;  3ULQ B;  4ESF A;  3WTX C;  4L18 B;  4I7H A;  2DQR A;  3FHZ A;  5L3E A;  4AIK A;  2F5D A;  4KIB A;  1SMT A;  4PZJ A;  5D5X B;  4MGR A;  4HA8 A;  3P7N A;  2ETH A;  2AXL A;  1OR7 A;  5D8L B;  3J81 Z;  4RGS A;  3GEZ A;  2M8E A;  5FLX Z;  1T38 A;  5E1Z B;  5K1Y A;  2DT5 A;  1R5G A;  2Y0M A;  3R0A A;  4KYW A;  2XKO A;  1R1V A;  5H20 A;  2MD5 A;  3CLO A;  1HW2 A;  4BYY A;  2HGC A;  3L09 A;  4HF1 A;  5D4S A;  1IN8 A;  4OIP F;  2FML A;  4PCQ A;  3NQO A;  4MEX F;  2E7X A;  1E2X A;  3WGG A;  1Z6R A;  4A5N A;  2QBY A;  3LA7 A;  5DV5 A;  1K79 A;  1XB4 A;  3B02 A;  1YS7 A;  2A07 F;  3GXO A;  2K27 A;  4LGW A;  1BIA A;  2CG4 A;  3EUH A;  2XRN A;  2ZKZ A;  2LSO A;  1BIB A;  1TW3 A;  4UXN A;  3WTV C;  4L0Y B;  1ZRC A;  1TNT A;  3CUO A;  2L02 A;  3WU1 B;  1FNN A;  3JAM Z;  1UST A;  4IHT A;  4FT8 A;  1ON1 A;  3ELK A;  1I27 A;  5HLI A;  5ILU A;  1XSV A;  2V79 A;  1P92 A;  1FBU A;  3DEU A;  2HDC A;  1BI2 A;  4U7B A;  4I0A A;  3KP3 A;  4ZYD A;  1U5T C;  2L01 A;  5L3B A;  3CUQ B;  5ED4 A;  2FNP A;  1O3R A;  1O3T A;  3LST A;  4Y13 A;  4Y15 A;  4WX9 A;  4IVN A;  1IXS B;  4XBF A;  4UUV A;  5CVU A;  3K0L A;  3QU3 A;  5E17 F;  4U0Y A;  3Q5F A;  3BJA A;  4XSZ F;  2XAG A;  3WE3 A;  1OMI A;  1IN6 A;  2ZCW A;  1XSX A;  4EQQ A;  2IJL A;  2XRO A;  2DLL A;  1B1B A;  4LK1 F;  2HTJ A;  1GVJ A;  4MHG A;  4PGG A;  4HX7 A;  1LNW A;  2EFN A;  1XDU A;  3BZ6 A;  2K86 A;  5E8I A;  1H9G A;  3E6C C;  3I71 A;  2M30 A;  3RDI A;  3TOB A;  2TDX A;  4HQE A;  5IT9 K;  2L4A A;  5AIP A;  3WE2 A;  5BOX A;  3LFK A;  2D1V A;  1BOA A;  1R23 A;  4XRF A;  1ZN2 A;  1R1T A;  1TTY A;  2CFX A;  3K1M A;  4ZYG A;  4U88 A;  1U78 A;  2P5V A;  3HOT A;  3B73 A;  4D0P A;  4M72 A;  5A2Q Z;  3IKV A;  2QYO A;  2EFO A;  3M8E A;  1HXD A;  3KP5 A;  3FXR A;  5HLH A;  2QZ8 A;  2OQG A;  2CW0 F;  4RGX A;  4GGG A;  5ILV A;  2F5F A;  5FO5 A;  1IXR C;  2W85 A;  5ICF A;  3F22 A;  1PP7 U;  3P9K A;  1YW8 A;  4FX0 A;  1CF7 B;  2F5C A;  5KVR A;  4BHB A;  3RJP A;  4PDK A;  5FFX A;  4ON0 A;  4LJZ F;  1LEB A;  4KN4 X;  4WCG A;  2X0L A;  1S8N A;  4G6D A;  1IAW A;  4LFU A;  1MD0 A;  1YYV A;  1JGS A;  5L3F A;  5K5O A;  2A68 F;  2BGC A;  1W7P A;  2DPU A;  1IN4 A;  4MQV A;  3WG9 A;  3I54 A;  4RB0 A;  4LLG F;  4BH9 A;  1V4R A;  2FE3 A;  1LDK B;  3ZMZ A;  1UCR A;  3EET A;  2NAZ A;  3F8M A;  2FMY A;  2K7L A;  3O3K A;  2NYX A;  3DFG A;  1ZRF A;  4P96 A;  4YII A;  3CUQ C;  4HDV A;  3V8K A;  4MQ9 F;  4M6X A;  2DTR A;  3J80 K;  2R3S A;  3RYR A;  4A5M A;  1XGS A;  2ZBK A;  4Q47 A;  4N9I A;  1ZGA A;  3MZH A;  4OIN F;  4I01 A;  3C1D A;  3GZ6 A;  1KA8 A;  1BI0 A;  2PBI A;  2H27 A;  1F5T A;  4RB2 C;  4CO8 A;  1ONV A;  4NQW A;  2E7W A;  1GXP A;  4HLX A;  3I4P A;  1IN7 A;  2QQ9 A;  5DD8 A;  4KMU X;  2V1D A;  4RAY A;  2O0Y A;  1V3F A;  2VOP A;  1HKS A;  1AWC A;  2OU2 A;  1MZB A;  3KP6 A;  4YG2 F;  2M5W A;  5CVJ A;  2Z99 A;  3F3X A;  4G7Z F;  3SQN A;  1FY7 A;  4BNC A;  4KUM A;  1U5T B;  5JFR A;  1R22 A;  3F8C A;  3C7J A;  2PJP A;  4OIR F;  2RV8 A;  2CO5 A;  1IW7 F;  2EV6 A;  1FYL A;  2VBY A;  3ZMV A;  4EGY A;  4M71 A;  3M7G A;  2HFH A;  3L7W A;  4EVI A;  1FLI A;  2ZFW A;  2MC3 A;  3TDU C;  2L3D A;  4B8X A;  3ERE D;  2W25 A;  3L2C A;  4AIH A;  4ESB A;  3SFZ A;  5DUK A;  1F9N A;  4KA4 A;  1R1U A;  2OZU A;  3RKW A;  2XHK A;  3E5Q A;  1UB9 A;  2V9V A;  2FRH A;  1B6A A;  4ENM A;  2Q0O A;  1ZAO A;  4F7Z A;  1XGN A;  3ROU A;  1ZLJ A;  3HRT A;  5LBQ A;  3ZMT A;  1G3Y A;  3WU0 A;  4KMF A;  1QPM A;  1G3S A;  4FX4 A;  3KCC A;  4BQA A;  5K5Q A;  2HEO A;  4KNY A;  2HWV A;  2YPR A;  1FP1 D;  2YSR A;  3TKY A;  1SMY F;  3LWF A;  2IA0 A;  3RKY A;  3HHG A;  4RGR A;  3MWM A;  3EYI A;  1R00 A;  1QNT A;  2DI3 A;  2IPQ X;  2ZO4 A;  5H6Q A;  4K2E A;  2MLK A;  1ODD A;  1QBJ A;  1R7J A;  3F72 A;  1ZG5 A;  3GFJ A;  3SXY A;  4ENJ A;  4GYG A;  1KQ8 A;  1J9I A;  1PP8 F;  1ZHF A;  4IPA A;  4ENK A;  1FSH A;  2FXA A;  4G8X A;  5HS9 A;  3ISP A;  3RKX A;  4ZYH A;  4RAZ A;  4ZZD A;  5HDK A;  2FF4 A;  4LG0 B;  4UNO A;  2VXZ A;  4EMS A;  3J80 Z;  2GWR A;  2K02 A;  3W6K B;  2BEO A;  2JTV A;  4G6Q A;  1O7F A;  2OQR A;  1FYM A;  1SD7 A;  3HRU A;  1OYY A;  4HX4 A;  4I02 A;  4L9J A;  2FBH A;  2O03 A;  5FB2 A;  4EM1 A;  1FYK A;  2M1B A;  4P9U A;  4HYE A;  2A6E F;  2EV0 A;  5E8G A;  1BN5 A;  2M87 A;  1L0O C;  1YS6 A;  3KP2 A;  1J0R A;  3O2P E;  1WKM A;  3IL2 A;  4MNU A;  2VON A;  2O3F A;  4BXU A;  1U8R A;  3IHU A;  3VOD A;  3HIF A;  4HV6 A;  4ENN A;  4P55 A;  2A69 F;  2ZXJ A;  4CZZ A;  4G7H F;  3GO5 A;  3RI4 A;  1A04 A;  1S7A A;  2KJB A;  2IA1 A;  2HYG D;  1YQA A;  1FX7 A;  3R0J A;  1WI9 A;  2JRT A;  4OMZ A;  4OIQ F;  5F1R A;  3WTT C;  2ACJ A;  5D6E A;  4S05 A;  2MH9 A;  1OYW A;  3LQR A;  4M74 A;  4Q4Z F;  4ZYE A;  1J5Y A;  4HF2 A;  3MAJ A;  5JI6 A;  1RIO H;  2IW5 A;  2ZME A;  1UHM A;  4RB3 C;  3W6J B;  5FFZ A;  5LRR A;  3ML6 A;  3CO7 C;  2O8X A;  1RI7 A;  2DAO A;  2DK5 A;  1IXC A;  1OPC A;  1T0F A;  2K4J A;  1P2F A;  2E1C A;  3DPL C;  3K2Z A;  2UWM A;  1STZ A;  4UV8 A;  5FD5 A;  3C18 A;  1MJA A;  1S6L A;  1GXQ A;  3I58 A;  1SD5 A;  2JSC A;  4BHC A;  2HZT A;  5JR3 A;  4A6E A;  2VE8 A;  3WTW C;  5IT9 Z;  2JPB A;  2VBX A;  5BQT A;  2Q2E A;  2HR3 A;  3LA3 A;  1YW9 A;  1BC8 C;  5KK1 A;  2Z9O A;  2W57 A;  2W24 A;  3HRM A;  1IZ1 A;  2G7H A;  1I6X A;  3GYH X;  3HTU A;  1TW2 A;  2UZK A;  1IUY A;  4YFN F;  4JBA A;  3BPV A;  5DCM B;  3V7C A;  5F6F A;  2KIM A;  2PFB A;  2V1U A;  2XAS A;  3FZV A;  4GO1 A;  1MJB A;  4YIF A;  3KP4 A;  5LEK A;  5L3D A;  1FPQ A;  3DP7 A;  3KZZ A;  5BPI A;  1IF1 A;  1KQ9 A;  1QO0 D;  1YIO A;  4TV7 A;  4O3M A;  5E18 F;  1S7O A;  4DQ2 A;  3JW4 A;  3LQQ A;  2BYV E;  3TO7 A;  5D8K B;  3KEO A;  1SAX A;  2P6S A;  4MTD A;  1PUE E;  1TQI A;  3R60 A;  4R1H A;  5J8F A;  3ABU A;  1HKT A;  5J6X A;  2EWN A;  3RTR A;  1HSJ A;  4LB6 B;  3WGH A;  3PFI A;  3SZT A;  1OYI A;  2ESH A;  5AIQ A;  4AD9 A;  1EV7 A;  2A3S A;  4OIO F;  5EEH A;  2HKX A;  3R4K A;  3GFI A;  2XGX A;  4EM2 A;  3T8R A;  3WOD F;  1R36 A;  4XLP F;  1H0M A;  1H9T A;  2GA2 A;  1D3Y A;  1XMA A;  4O5V A;  1C0W A;  2KIF A;  3JSP A;  1U3E M;  2COM A;  2Y48 A;  5LGN A;  4M6Y A;  4EM0 B;  2QQA A;  1I1G A;  3FM5 A;  1QGP A;  1I1S A;  3CUQ A;  1T39 A;  1R58 A;  1SFX A;  4BHP A;  2FOK A;  3DKW A;  3Q9V A;  2V1X A;  5HDG A;  3KLN A;  1BJA A;  1DPU A;  3D0S A;  2QEN A;  3KFW X;  3WTS C;  3BDD A;  3NRV A;  3H92 A;  1HW5 A;  3I0T A;  2ESN A;  3LAP A;  3BJ6 A;  1P4X A;  2HS5 A;  3FMQ A;  3T1B A;  2W84 A;  2OD5 A;  3WTZ A;  4ASN A;  3G3Z A;  1ZAR A;  2MH2 A;  3K69 A;  1XGO A;  1B9N A;  1FWZ A;  4AIJ A;  3QP6 A;  3KEQ A;  5H6R A;  3ZN1 A;  1I5Z A;  3GX4 X;  1K7A A;  2LNB A;  4UVB A;  3K9T A;  3SZP A;  5TRD A;  2IP2 A;  3J7A O;  4KIG A;  2EV5 A;  2DW4 A;  4LMY A;  2JT1 A;  2HKO A;  1P6R A;  2PMH A;  1IRF A;  1D8J A;  4EJO A;  5F64 A;  3DV8 A;  2R7F A;  5DUI A;  2VOD A;  3FMR A;  2Q8K A;  1FC3 A;  1NHA A;  1MKM A;  2GXG A;  1G3W A;  2EFQ A;  1U6G A;  1XGM A;  1D8K A;  4U0V A;  4LB5 A;  3MFK A;  2MA3 A;  4UVC A;  3E5X A;  2EJR A;  5BPD A;  5LHI A;  5TJJ A;  3JTH A;  2ADU A;  1JXS A;  4FHT A;  3VB2 A;  4YFX F;  4RGU A;  1U5T A;  1OKR A;  5DD4 A;  1TQP A;  1HKQ A;  3V7R A;  3GVA A;  1WQ2 A;  1HST A;  1KU2 A;  3QRF F;  1G6N A;  1J59 A;  5LEJ A;  1K6O A;  2EB7 A;  5E1W A;  4UHT A;  4QLC U;  2OA4 A;  5D4R A;  3BWG A;  4HF0 A;  4HX8 A;  2GAU A;  3K1N A;  1ULY A;  1R5H A;  1RUN A;  2RN7 A;  1O57 A;  5LHH A;  1MDM B;  2PQ8 A;  4HDU A;  2YX4 A;  1J7K A;  1FT9 A;  1Z7U A;  5D5W B;  3E6M A;  4DNC A;  3PQK A;  3KP7 A;  2IT0 A;  3BP8 A;  1Y0U A;  4PGH A;  5CJ9 A;  1XDS A;  5DYM A;  2BE5 F;  3TOA A;  2FEZ A;  1T98 A;  4MEY F;  3VFZ A;  4HAM A;  3C3W A;  4LLN A;  4IRG A;  3U9G A;  4G9Y A;  3T0Y A;  4Q48 A;  3BPX A;  2RNJ A;  1ZLK A;  1AOY A;  4EJT A;  5DCF A;  4A12 A;  2H09 A;  2YR2 A;  2VBZ A;  1ZYR F;  3GFL A;  1UFM A;  1SFU A;  4GXO A;  3REO A;  4ZH4 F;  1KYZ A;  3KLO A;  2H6C A;  1Q1H A;  3HSE A;  2FNA A;  2L4M A;  2FU4 A;  3D5L A;  3GWZ A;  2GIV A;  3ABT A;  1L3L A;  2O61 A;  3ZMU A;  2HTS A;  1YTY A;  4OU0 A;  3L00 A;  2D45 A;  4ZZL A;  4KT5 C;  3MEX A;  2DU9 A;  1Z9C A;  3QOP A;  4EJW A;  5E1X A;  1KGS A;  3L9F A;  2LKP A;  3GW2 A;  2CWE A;  2J5O A;  4I98 B;  2D1H A;  4CHU A;  2STW A;  2NRA C;  5ILS A;  1UHW A;  2XKP A;  5BMZ A;  5FD6 A;  5A2Q K;  2A5Y B;  2GA1 A;  5DEQ A;  2M45 A;  2HQN A;  2QVO A;  5LGU A;  1HBX G;  5DDG A;  1LB2 A;  3QU6 A;  4M9S A;  4CXF A;  4P5O A;  3ZMS A;  1KU7 A;  3JTG A;  1DDN A;  3JSO A;  2Y75 A;  4HW0 A;  4CDG A;  2XAJ A;  4L5J A;  3ZQ7 A;  5AON A;  2RDP A;  5HLG A;  3TQN A;  2JPC A;  4OMY A;  3CJN A;  1BBY A;  3CO6 C;  1K78 A;  1JHH A;  1F4K A;  4IRI A;  4HOB A;  4H0E A;  4O6J A;  4E70 A;  1S29 A;  2UXN A;  3ECO A;  1XD7 A;  1ZRD A;  4CGZ A;  5FLX K;  5HVQ C;  3IRR A;  2XAQ A;  3FMS A;  2YX7 A;  4JQF A;  3DF8 A;  3VEP A;  4MTE A;  2PG4 A;  3HOS A;  5CVR A;  3EDP A;  3F23 A;  5CYV A;  3M9A A;  5CLS A;  1E17 A;  3KE2 A;  4R8H A;  3F6V A;  4IRH A;  1FOK A;  1B59 A;  1KU3 A;  2ZNZ A;  2EFW A;  1B4A A;  2F5E A;  1YFH A;  1TLH B;  4M73 A;  1IRG A;  4KIC A;  4WXH A;  4GCV A;  2EA4 A;  1QZY A;  2OBP A;  1TNS A;  3LAJ A;  2MBF A;  3I59 B;  4IHS A;  3FM3 A;  3JAM K;  2WC2 A;  3HSR A;  5LGT A;  1YG2 A;  1LQ1 A;  2XIG A;  2GZW A;  4M9Z A;  2R7D A;  6PAX A;  1XN7 A;  3IKT A;  4AWX B;  4M9X A;  1DPR A;  2STT A;  3NEU A;  1S3J A;  1XCV A;  5HDN A;  5K5R A;  4EJV A;  5HS8 A;  1SD6 A;  4Z2Y A;  3I53 A;  2RVC A;  4QWQ A;  4XSX F;  1JHF A;  1DUX C;  2DO7 A;  5DCM A;  2VC1 A;  4OOI A;  3U1D A;  2RQP A;  1YO5 C;  4B09 A;  1USS A;  2NNN A;  1B9M A;  1PDN C;  4I09 A;  2VT3 A;  2IVM A;  4WXD A;  1Z05 A;  5HOO A;  1QZZ A;  3OOP A;  1DP7 P;  2FBK A;  3CTA A;  3FF5 A;  4UVA A;  4WXC A;  2C6Y A;  1W7P D;  1W5T A;  2QM3 A;  2ZME B;  1ZGJ A;  5LRS A;  3KZY A;  3U2R A;  3P9C A;  3J81 K;  4KIF A;  1IN5 A;  2ZNY A;  2PLY A;  2VN2 A;  2X4H A;  4N9H A;  2OZ6 A;  2FBI A;  3GZ5 A;  3TDZ C;  1XSD A;  2EFP A;  1LDD A;  2BBY A;  2CQK A;  2QLZ A;  1CF7 A;  2OAZ A;  1P4W A;  2QUF A;  4RB1 A;  2WWY A;  3IC7 A;  3QAH A;  4EGZ A;  3ZMD A;  5JVT A;  1W5S A;  3HHH A;  4P9F A;  2GQQ A;  2DQL A;  1LVA A;  2B0L A;  2XAF A;  4Q5S F;  1J75 A;  3I59 A;  1FZP B;  3BRO A;  4IXA A;  4LK0 F;  2LF7 A;  1X3U A;  3I64 A;  2CSO A;  3GF2 A;  3FXQ A;  1D5V A;  1SFE A;  1Z1D A;  1MGT A;  4HV5 A;  2EK5 A;  3E6B A;  2PN6 A;  3GFM A;  1J2X A;  2LF8 A;  1T2K A;  3E6D A;  2HOE A;  2VC0 A;  2KRF A;  2XV4 S;  2ELH A;  3EYY A;  3OV8 A;  3IWZ A;  1YLF A;  1BI3 A;  2FA5 A;  4LLL A;  3AAF A;  2P8T A;  3WTU C;  3V8L A;  3BOQ A;  2Z5U A;  2WTE A;  2RGV A;  3F6O A;  1ZRE A;  3V8J A;  3N4M A;  1ON2 A;  2P7V B;  2E1N A;  4RS8 A;  5EEG A;  2ISZ A;  1W7P B;  1GHC A;  2IA2 A;  3IWF A;  5CVV A;  1KQ0 A;  1O3Q A;  2K4B A;  1ZG1 A;  2F2E A;  4IF4 A;  2PEX A;  1ZH5 A;  2XAH A;  2VE9 A;  3HYI A;  3I5U A;  2QQB A;  2DFI A;  2RKH A;  2D2W A;  5LLQ A;  3EQL F;  3SHF A;  3DQV C;  4XLN F;  2XUB A;  1Z6T A;  2P5L C;  2L54 A;  5E20 A;  2PMU A;  3V7S A;  4EJU A;  1FBS A;  4WF2 A;  3TO6 A;  3F8F A;  4CIC A;  2DPD A;  3H3Z A;  2JZY A;  4HLY A;  1VTN C;  5J8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...