5IT9K

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
96
structure length
96
Chain Sequence
b'MLIPKEDRKKIYQHLFQEGVLVAKKDFNQPKHEEIDTKNLFVIKALQSLTSKGFVKTQFSWQYYYYTLTEEGVVYLREYLNLPEHIFPATYLAGQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein uS2
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
molecule tags Ribosome
total genus 21
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF03501 S10_plectin Plectin/S10 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5it9K00
3QAHA 2OQRA 3E3VA 1SMTA 1NHAA 1QBJA 2M5WA 5FGMA 2YR2A 3WTXC 2P6SA 2EB7A 2LDUA 2QM3A 2HFHA 3VOEA 2YU3A 5L3FA 4WK8F 1F4KA 2LF7A 3BPVA 1J7KA 5J8CA 3F22A 3SFZA 5DCMB 1LDDA 1S7OA 2O03A 4HX8A 3EETA 5IT9K 4A6DA 3WTYC 3ZMDA 3FXQA 2NS0A 4ENJA 3ECHA 2W24A 4ON0A 4A0XA 4IRHA 1HKSA 3GUDA 1KQ0A 3U9GA 5F1RA 1R1TA 4HDVA 4BHBA 2OAZA 4MTDA 1FNNA 3HTSB 5D4SA 1UFMA 2PBIA 2XKPA 4IHTA 4CDGA 2FXAA 2A61A 5BOXA 1WRJA 3JAMZ 4WF2A 4RB2C 3J81K 2CGPA 2BV6A 4GGGA 2R7DA 2YX4A 1W5TA 2ACJA 1OYWA 4A5NA 2VE9A 4EV0A 3ERED 2L4MA 3QP6A 5CLSA 2EFWA 1B9NA 1S7AA 3IKTA 3E5UA 4XLPF 1BIBA 3H92A 3EDPA 4Y15A 3LSTA 5D5VB 1S3JA 4KICA 2RN7A 2W25A 4WXHA 2COMA 1K78B 3C3WA 5D6EA 1OMIA 4MTEA 4N9HA 4A0YA 4M6YA 1OR7A 2VT3A 5FFZA 2J5PA 3VFZA 4WXCA 1C0WA 4ZYEA 2FRHA 2AS5F 2VBXA 3K69A 2Q8KA 4MQ9F 1JGSA 2F5CA 3LAJA 2L02A 2DTRA 3ZN1A 1MGTA 4QLCU 1U5TB 4EM2A 4AIJA 4L18B 2JZYA 2V1DA 2FBKA 3LAPA 4EM1A 1TNTA 3J7AO 3DFGA 1FYMA 4HYEA 3D5LA 3SZTA 4AWXB 4PDKA 4LMYA 3HSEA 2G7HA 4YG2F 3HRMA 3MCZA 4O3MA 2EFQA 3M1EA 3MFKA 3GWZA 2EV0A 2K4BA 2P7VB 1IAWA 2KRFA 3FWEA 1PP8F 1K78A 3GZ5A 3F8FA 3VEPA 1KQ9A 4NHJA 1ZARA 2JT1A 1YTYA 2MH9A 4KFCA 2ZXJA 2V1UA 1WKMA 1ZLJA 4KN4X 3V4GA 5LHHA 3IRRA 2E7XA 4L5JA 4HV6A 2XHKA 1J9IA 5E8GA 2A07F 1ON2A 1IXRC 2VONA 1YYVA 2WC2A 4YFKF 1DDNA 1UHWA 5K5RA 1WWXA 2DW4A 3F23A 3DPLC 3TDUC 4EGZA 2QLZA 1FWZA 1P4XA 1P4WA 3BROA 3TO9A 1Z05A 4ESJA 3MWMA 1RIOH 2ZMEB 1FY7A 2HTJA 4HOBA 4KT5C 4HF0A 2EA2A 1YQAA 1LB2A 1XCBA 3L2CA 2ISZA 1F9NA 2NNNA 3F6VA 2L54A 1FP1D 1VTNC 1GHCA 2OQGA 4ZZDA 4EJWA 1QZYA 2DPUA 1AOYA 1H9GA 4IHSA 1LDJA 2YX7A 3E6MA 2KIMA 1YW9A 2MBFA 2E1CA 1SD7A 5DV5A 5CVVA 1TQPA 3H3ZA 3O2PE 2FNPA 5HDGA 1D3YA 4ENMA 2Y0MA 2IA0A 1W7PD 1B6AA 4OIOF 2FA5A 2K86A 2P4WA 3DP7A 4N9IA 1KA8A 2W85A 3ABUA 1UB9A 1XCVA 1XB4A 1QGPA 5L3CA 1RZ4A 2RGVA 5KK1A 3N4MA 5F64A 2PEXA 4AIKA 5AIQA 5AONA 2ESNA 1I6XA 2Q0OA 4S04A 3R0AA 4D0PA 2GXGA 2TDXA 1STZA 4LFUA 3M9AA 1EH8A 3IWFA 2DLLA 5LEJA 4MQVA 2ZKZA 3M8FA 4RGSA 1O7FA 1XGNA 3WGHA 3WTVC 4BYYA 2KIFA 3GZ6A 2DK8A 4L9NA 3GF2A 4U0WA 2STWA 1KU2A 3RYPA 1S6LA 1XN7A 1G3WA 5H6RA 2MLGA 5ILVA 1BI0A 3DEUA 2XASA 2HKOA 2EK5A 1XSDA 3T8TA 4A5MA 4WX9A 4LLNA 1TQIA 5A2QK 1R36A 3HSFA 4AD9A 3HRTA 2FMLA 2CFXA 3CUQC 4HA8A 1W4MA 4A2UA 3RJPA 2CWEA 5HDNA 1USSA 5E20A 5ICGA 1J0RA 2QUFA 3I58A 1UHMA 3S2WA 2IPQX 5D6FA 1E17A 5D4RA 1ON1A 4I98B 1F1ZA 2F5EA 1QZZA 2HOEA 4CHUA 1ZLKA 4KIGA 2VOPA 2RVCA 1P6RA 2JPBA 4HLYA 4NB5A 2BYVE 1ZG5A 4RGUA 3PFIA 4HDUA 1MDMA 3J80K 4ETSA 4YFNF 2XAFA 2GWRA 2QQ9A 5ILUA 1YS7A 1IF1A 3F3XA 4PCQA 1L3LA 3GW2A 3F8CA 3KP2A 2MD5A 2DBBA 1EH7A 4RGRA 4GYIA 2M45A 4Q48A 2KJCA 2YPRA 3KLOA 4ZYHA 3R61A 1B4AA 4UXNA 2HZTA 4R79A 3ROUA 2QZ8A 3V7RA 3E97A 2EFNA 2EFOA 4IRIA 1QQIA 2MA3A 1K7AA 5IT9Z 3E6CC 2XGXA 2VXZA 2CSOA 3QU6A 3I5UA 1P2FA 2IT0A 1WI9A 4IVNA 4O6JA 2HDCA 3FHZA 3Q5FA 3TOAA 1H0MA 2IW5A 3GFLA 2H94A 1U3EM 3JW4A 3KP4A 1FZPB 3U1DA 5E1ZB 3R60A 3KLNA 1RI7A 4PGHA 4BHPA 1FX7A 3J81Z 2ZBKA 5LRRA 2M87A 2ZO4A 1B59A 2X0LA 5H6QA 1O3SA 5K1YA 3AAFA 2PFBA 4KYWA 3GFJA 5LBQA 2F2EA 1BJAA 2FNAA 1TTYA 1I5ZA 1IRFA 5E18F 5E8IA 2XAGA 4M9ZA 2O6GE 4R1HA 3ELKA 5K5OA 4F7ZA 5CJ9A 3CJNA 1ZRCA 5TRDA 5J6XA 4RB3C 3KP5A 1DPRA 2ZNZA 1WSUA 3CUQA 3LQRA 1TNSA 1O3RA 1IN8A 1I1SA 4U7BA 1LEAA 4CZZA 2PN6A 3ECOA 1TQMA 1U5TC 1X3UA 4Q4ZF 4XSZF 4MEXF 4HLXA 3DF8A 3VB2A 1V3FA 4OIRF 1BI2A 3GXOA 1HSJA 4UHTA 3I71A 1R58A 1W7PA 2D1VA 3CO7C 3TGNA 2PMHA 5HS7A 4TV7A 4L5IA 5HS8A 2B0LA 2NAZA 4IJAA 1Y0UA 2VODA 4ZH4F 1BIAA 2C6YA 1KQ8A 3DV8A 3QOPA 3I54A 3WTSC 1OKRA 1HBXG 2R3SA 2EV6A 2MLKA 1U2WA 2JSCA 3WODF 5DCMA 5BPIA 2FSWA 2QWWA 3QP5A 5FFXA 2UXXA 3RKXA 1GVJA 4G8XA 4YFXF 1YW8A 5DUIA 4ESFA 3DPTA 2XIGA 4KN7X 2O8XA 2XVCA 3ZP5A 3B02A 5E1XA 4JQFA 4XSXF 2WTEA 4JK1X 5JHUA 3M7GA 4KIBA 3SQNA 4WCGA 3IKVA 1XMKA 4HQEA 4KDPA 2HEOA 3LA3A 3LA2A 5D8LB 4OIPF 4BQAA 2HGCA 1ZHFA 2OBPA 3FF5A 3EYIA 4I2OA 1UCRA 5H20A 3F8MA 3KZYA 2XV4S 1J2XA 2H09A 3EUHA 3COAC 3QPHA 3FXRA 1T0FA 1QPMA 4HBLA 3HSRA 4BAYA 4G94A 4XLNF 5LHGA 4LLLA 3U2RA 2QVOA 3FMRA 3W6JB 1FLIA 2ELHA 2VBWA 5L3BA 3BZ6A 2Y75A 2OZUA 3G73A 2H27A 4KIFA 3FMSA 4M74A 1MZBA 1XGMA 2D45A 3C1DA 1W5SA 3NRVA 3ULQB 2FOKA 4LG0B 4CXFA 1ZRDA 4A6EA 2D1HA 1TBXA 2K7LA 1IRGA 1DUXC 3JSOA 1YW7A 1SD6A 5D5XB 2FU4A 2Z9OA 2FQ3A 2RQPA 2PI0A 1U5TA 1T6SA 3HHHA 3WU1B 3FZVA 4HZFA 1K79A 1BI3A 4UVCA 3L09A 3MQ0A 5FLXK 4MNUA 1Z6TA 4AVPA 2MC3A 5CVJA 4UV8A 2R7FA 1ZN2A 4WXDA 1JHHA 2VBZA 1HKQA 3TDZC 3VODA 2V6CA 3K9TA 1IXSB 4LK1F 5A2QZ 1YO5C 3PQJA 2ISYA 1IN6A 4B8XA 3BJ6A 5D5UB 5HLGA 3GVAA 4M72A 3G3ZA 3GFMA 2P5KA 3ZQ7A 2PG4A 4U7DA 4RB1A 4NQWA 5F6FA 3CTAA 2L3DA 2LSOA 3FXUA 1ZRFA 3J80Z 1Q1HA 4DNCA 3W6KB 1LJ9A 1FSHA 3ZMZA 4OOIA 3T8RA 2RNJA 2PJPA 4UVBA 2FBIA 2K27A 3NEUA 2ZMEA 2RV8A 3HOSA 1O3QA 5DD4A 3WG9A 1DP7P 4HF1A 2HYGD 3P9IA 4LLGF 4Q47A 2LNBA 4I7HA 1TLHB 5D5WB 1J5YA 4L0ZB 1XSVA 2DPDA 2CYYA 5E17F 3V8KA 5DDGA 4IF4A 3TOBA 1P92A 4HX7A 4U88A 2QYOA 4O5VA 3IC7A 1YS6A 2CW0F 4L9TA 1CGPA 3GLXA 4EJUA 1HQCA 2VT2A 1CF7B 2GIVA 5LLQA 3ZMVA 1JXSA 1FSEA 2L01A 4JBAA 1G6NA 2OU2A 4OINF 5L3GA 3DXJF 2HTSA 5D8KB 2DT5A 2M1BA 4P9FA 4DQ2A 3F6OA 2IRFG 3OOPA 1A04A 2DU9A 5JI6A 4U0YA 3KEQA 3N97A 4UV9A 5FD6A 1P4AA 3HHGA 1BC7C 2XUBA 3RPQA 4M6XA 4IXAA 2FMYA 2UWMA 1SFUA 2UZKA 3R6SA 1MKMA 2UXNA 2YSRA 1IN7A 1IW7F 1R23A 2NYXA 1G4DA 4GYGA 3T1BA 4M73A 2EV5A 3HYIA 4P5OA 3RIRA 3F21A 1J59A 5HDKA 1CF7A 5TJJA 3EQLF 4LD5A 2DK5A 4M71A 4RB0A 3HUGA 6PAXA 2NRAC 3BJAA 1O7LA 1XDSA 2XAJA 5LRSA 4RAYA 2FE3A 3OV8A 2V1XA 2IP2A 3I59B 4MHGA 4KMUX 3P9KA 2ZJ2A 4P9UA 4L0YB 1MJ9A 4HV5A 3IWZA 2E1NA 5L3DA 3P9CA 1G3YA 5JVTA 2QBYB 4U0VA 5FB2A 2V79A 2O3FA 1R7JA 3C18A 4P55A 3WE3A 4FT8A 2ZFWA 2GAUA 2HQRA 1KU9A 1T98A 3ZPLA 4R8HA 2P6TA 3HIFA 1BBYA 1ZG1A 4OMYA 2CQKA 3FX3A 4YIIA 2OD5A 3WGGA 4Q5SF 1OPCA 1KU3A 3HRSA 1S29A 3I4PA 3WTTC 1QO0D 2FEZA 2NNYA 2RDPA 1LEBA 2M30A 3H3UA 2DQLA 1FC3A 2QENA 5FD5A 1HW1A 4GXOA 3ZMUA 2DI3A 3KETA 2VC1A 3KFWX 4IRGA 5CVRA 1IN4A 4E70A 4EJOA 1R5HA 1GXQA 3CLOA 5CVUA 1FP2A 4L9JA 1YG2A 3NQOA 1Z1DA 2BBYA 2CG4A 3BOQA 1U78A 2P7CB 2P5LC 1R5GA 2F5DA 2HR3A 4UNOA 2FF4A 1D8JA 3BY6A 3LA7A 4I02A 3KP7A 1XMAA 3L7WA 3FMQA 1LDKB 2DFIA 5JFRA 4GO1A 5ILSA 3JSPA 4YIFA 1J75A 4RAZA 1O3TA 5HLHA 2JTVA 4FX0A 4CGZA 1XD7A 2A6EF 1YLFA 1XGOA 3GFIA 3E5QA 3IL2A 2O61A 1HXDA 2GQQA 2DQRA 3F8NA 2XRNA 5L3EA 2K4JA 4EJVA 4KUMA 4OIQF 3GEZA 5DD8A 2Z33A 1QNTA 1R22A 4UUVA 2OA4A 4G6DA 1Z91A 4A0ZA 1REPC 2H6CA 5LHIA 2OZ6A 1R1VA 5KVRA 5HOOA 4EM0B 3RTRA 1ODDA 3ML6A 4GCVA 2L4AA 1RUNA 4M9XA 3KZZA 1FBQA 1T39A 4LB5A 1OYYA 1E2XA 2IJLA 2GA2A 3BJOA 2KKOA 5EEGA 5FLXZ 2HS5A 1YFHA 5BPDA 2ADUA 5ICEA 1ZREA 1I27A 1GXPA 3EYYA 4EVIA 1U6GA 5FO5A 2V9VA 5HS9A 2STTA 5DUKA 2Z99A 3GX4X 5BS6A 2D2WA 2JRTA 1I1GA 1TW3A 2Y48A 3TKYA 3BPXA 1IZ1A 2P8TA 4G6QA 2W57A 2BE5F 4IPAA 1FBSA 4G9YA 4CICA 4HQMA 4I01A 4EJTA 4CO8A 3LFKA 5BQTA 4WWCA 1ZGAA 1MJBA 3L9FA 4FHTA 4BXUA 2GXBA 2G7UA 2O0YA 5IT3A 4KMFA 1HW5A 1H9TA 2H6BA 2P5VA 2A3SA 2GZWA 3E5XA 1K6OA 2CO5A 2VC0A 2DAOA 3JAMK 1BI1A 2Z5UA 2HQNA 3WGIA 4HW0A 3I53A 2KIUA 3ZMTA 2ESHA 1R00A 2Z3YA 3WE2A 1KYZA 3KP6A 4BHCA 3IRQA 2A69F 4A12A 2G9WA 3JTGA 2FBHA 4B09A 2J5OA 3HTUA 3WU0A 3ABTA 2ETHA 3RYRA 4ZYGA 1FYLA 3QRFF 3V7CA 5HLIA 3RKYA 1T38A 3QU3A 1ZYRF 3IHUA 4RS8A 3B73A 4Y13A 5CVIA 1R1UA 1ZAOA 3HOTA 4XBFA 1L0OC 1IXCA 3TO6A 2K02A 3LQQA 1LVAA 3DQVC 1XDUA 4HX4A 4L9VA 5JR3A 1USTA 3C7JA 4LB6B 1ZG3A 3E6BA 2W84A 3PQKA 4I0BA 2A6HF 1ONVA 2M8EA 1BOAA 1JE8A 4QWQA 3FM5A 3KCCA 4H0EA 1B9MA 4LG0A 5J8FA 4G7OF 3SZPA 1MD0A 1FYKA 2A5YB 3MAJA 1RUOA 4I09A 2PQ8A 3K0LA 3ISPA 3SXYA 1ULYA 3BP8A 1IUYA 3F8BA 2BGCA 3JTHA 1HSTA 2JPCA 4P96A 3ZMSA 2AXLA 5CYVA 1LQ1A 2EWNA 1U8RA 2VBYA 5EEHA 3R4KA 4CYDA 3FM3A 4BNCA 3Q9SA 1PP7U 1SFXA 1S8NA 1XGSA 1JHFA 1ZGJA 2XAHA 3TQNA 2A68F 1G3TA 1PDNC 1LNWA 1WQ2A 1FT9A 1RNLA 4ESBA 4ZZLA 2QQAA 5DEQA 3KP3A 5BMZA 5E1WA 1BM9A 3WTWC 3MZHA 3CO6C 5LGNA 4KNYA 2DO7A 2IVMA 5ED4A 4Y17A 5LEKA 2VN2A 4UVAA 3DKWA 4S05A 4ENNA 3CUOA 1MDMB 2LKPA 4Z2YA 3LWFA 4MEYF 3REOA 1PUEE 3KEOA 3RI4A 3O3KA 2XAQA 1SFEA 1KU7A 1HW2A 2HWVA 1BN5A 3O6BB 5HVQC 5LGUA 1D5VA 3QPTA 3SHFA 3D0SA 1Z7UA 3KE2A 2ZCWA 4KA4A 4HAMA 2WV0A 2XKOA 3WTZA 5LGTA 2MH2A 3HRUA 2ZNYA 4FX4A 1FOKA 2F5FA 2HYFA 1Z9CA 2X4HA 4ENKA 1Z6RA 3MEXA 3RKWA 4ZYDA 2KJBA 1V4RA 1T2KA 1F5TA 4LGWA 3V8LA 1HKTA 1SAXA 2HKXA 2EA4A 1SMYF 3M8EA 3F72A 3GO5A 3I0TA 1IN5A 4MGRA 1TW2A 3E6DA 3Q9VA 1KGSA 4RGXA 2E7WA 2LF8A 5ICCA 4EMSA 2PLYA 4BH9A 3MZYA 5ICFA 2VOOA 4LJZF 5DYMA 1KYWA 1ZH5A 5DCFA 4M9SA 2Q2EA 4ASNA 2XROA 3K1PA 3L00A 2PMUA 3BWGA 4XRFA 1EV7A 2RC4A 1FBUA 4HF2A 1BC8C 4EGYA 2IA1A 1EH6A 2EFPA 2GA1A 1FPQA 4OU0A 1SD5A 4I0AA 4K2EA 1DPUA 3R0JA 4PGGA 2QQBA 3ZN0A 3RDIA 1B1BA 4G7HF 3WTUC 2EJRA 3T0YA 1G3SA 3K1NA 2RKHA 3K2ZA 3CUQB 3TO7A 4N0BA 1SD4A 3I59A 3CDHA 1OYIA 5AIPA 4PZJA 5K5QA 1YIOA 1D8KA 3T5XA 4AIHA 4G7ZF 3BDDA 3I64A 1AWCA 2QBYA 3RPUA 5ERIA 2IA2A 4LK0F 2WWYA 1W7PB 1O57A 3P7NA 4EQQA 1MJAA 3GYHX 2BEOA 4OMZA 1XSXA 3V8JA 2VE8A 3V7SA 3K1MA
chains in the Genus database with same CATH superfamily
3QAHA 2IGNA 1K6YA 2OQRA 3E3VA 1SMTA 2VUMJ 2MFZA 3G2BA 1NHAA 1QBJA 1T08B 3GTMJ 2M5WA 3OYCA 3CLQA 4C30A 3W2AA 1V5EA 2FX0A 5FGMA 2YR2A 4CUGA 2W48A 2P6SA 3WTXC 2EB7A 2LDUA 4IHYA 1IV6A 1Z0XA 5B1BH 1VNDA 2QM3A 3LSMA 2HFHA 2L9RA 3VOEA 2YU3A 5L3FA 3VDXA 4ZDOA 1X2MA 2OUMA 4WK8F 1F4KA 2LF7A 3BPVA 5CKTA 1J7KA 5J8CA 3F22A 3SFZA 1QA6A 5DCMB 1LDDA 1S7OA 2O03A 4HX8A 4BEHB 3EETA 2CW7A 4C3JJ 5IT9K 4A6DA 3WTYC 3ZMDA 3FXQA 2NS0A 1R9TJ 2QF7A 4YRVA 3CP2A 4D7MA 1W36C 1JT6A 4ENJA 3ECHA 2OC6A 4AVZA 2W24A 2VKVA 4ON0A 4A0XA 4IRHA 1HKSA 4II2A 3L2QA 3AKZA 3FXOA 4E7JA 3GUDA 1KQ0A 3U9GA 3SEQA 2ECCA 5F1RA 1R1TA 4G12A 4HDVA 1E3HA 4BHBA 2M0MA 4BACA 2OAZA 1KZHA 3S1NJ 3FISA 2IAIA 5J4YA 2B9SA 3G1LA 3A1YA 2LR8A 3K4KA 4MTDA 3HOZJ 1FNNA 3OYGA 3HTSB 3K4BA 5D4SA 1UFMA 2OCEA 2PBIA 3H0GJ 2XKPA 4IHTA 1P9QC 3S17J 3I55I 2KP6A 4CDGA 2VQLA 3FDYA 2FXAA 2A61A 5BOXA 1WRJA 3JAMZ 3ERMA 4WF2A 3JRIA 3H3VK 4RB2C 3J81K 4PFOA 3ONQA 2CGPA 2BV6A 2A5WA 4GGGA 1YITI 2R7DA 2YX4A 5IOYA 1W5TA 1BJZA 2VKHA 2ACJA 4B43A 1OYWA 4A5NA 1I3QJ 3CF2A 2BY3A 2VE9A 1JTXA 4A3MJ 4EV0A 3ERED 2MW8A 2KL4A 3HJEA 1T8IA 2L4MA 4NBQA 3QP6A 5J1UA 5CLSA 2EFWA 1B9NA 1S7AA 3PUBA 3V42A 3IKTA 3E5UA 3A03A 4XLPF 1FMVA 4XIDA 3KYDB 3OYHA 3FBIB 1BIBA 4E7IA 1H89C 2EZKA 2R0QC 4M3DA 3KYCB 5C4XJ 3RSNA 3H92A 3EDPA 3SDGA 1I39A 4Y15A 3LSTA 1FOYA 3CDIA 5J1RA 5D5VB 1YX3A 1S3JA 4KICA 2QKLB 4I76A 2RN7A 1MIJA 2KIQA 1N77A 3ZOBA 2DDAA 2W25A 4JYKA 4WXHA 1VFCA 2EH3A 2VQCA 2COMA 1K78B 4F52A 3C3WA 5D6EA 1OMIA 4MTEA 4XRSG 4N9HA 4A0YA 3LMMA 4M6YA 3FKJA 2DCEA 1OR7A 1A6QA 2VT3A 4F55A 5FFZA 1X3WB 1VQ8I 4M6VA 2J5PA 2ID6A 4WXCA 3VFZA 3SDBA 1C0WA 4ZYEA 2FRHA 2AS5F 2VBXA 3K69A 2Q8KA 5CPRB 5GADJ 1QVTA 4ZC3A 4MQ9F 2YU9J 3DKYA 1JGSA 2F5CA 3LAJA 3GBGA 4G6TB 4CCNA 2L02A 1B8IA 2DTRA 3TBIA 3ZN1A 1ORKA 1MGTA 4XORA 4YEJA 3S8PA 4QLCU 1SVOA 5FLMJ 2CUEA 1U5TB 2X6WA 3BC8A 2B7EA 4EM2A 1MH4A 4BUPA 3LSHA 4AIJA 3GZNB 3PFYA 4L18B 2JZYA 2V1DA 2FBKA 1VQ6I 2MSYA 3LAPA 4EM1A 1TNTA 2XGCA 3J7AO 2RNGA 3DFGA 1FYMA 4HYEA 3D5LA 5F04A 3SZTA 3VYRB 4L5EA 4AWXB 4PDKA 4DZPA 4LMYA 5FJ8J 1MMGA 3HSEA 3LSPA 2G7HA 4YG2F 3HRMA 3MCZA 4O3MA 2EFQA 3ZXSA 3DTEA 3M1EA 3GWZA 3MFKA 2EV0A 2K4BA 2WBMA 4C3HJ 2P7VB 4CH7A 2KRFA 1IAWA 4NC6A 2HXOA 3FWEA 1PP8F 3S2HJ 4RM2A 3QPSA 3OY9A 2DFFA 1K78A 1OCCH 2CH0A 1EJ9A 2M34A 3GZ5A 3F8FA 3HXLA 5FRMA 2JUCA 3HOYJ 4ZDPA 3VEPA 1KQ9A 4NHJA 1ZARA 2JT1A 3OL3A 3TP3A 2F48A 1X1DA 2MH9A 3BT9A 1YTYA 1O4XA 4KFCA 2ZXJA 2KQRA 1U8BA 2V1UA 1WKMA 1ZLJA 4KN4X 3V4GA 5LHHA 3IRRA 2DMTA 4IQ4A 5F08A 2E1MB 2E7XA 2XDVA 3TW6A 1VQ4I 1MH3A 1Y56A 2HPIA 4L5JA 4HV6A 2CUZA 1A6IA 4Y4RA 2XHKA 4XICA 1J9IA 2BVLA 2ZXHA 3JCUC 5E8GA 2E2JJ 2A07F 1ON2A 3BQYA 1IXRC 2HDWA 2VONA 1YYVA 3K70C 2WC2A 2XAUA 4YFKF 5IY5H 5M3FJ 4NQWB 1DDNA 5GAEJ 4XK4A 1ERDA 3OIQA 5DTDA 1SFKA 5GTIC 1OISA 1UHWA 5LFAA 3W3CA 5K5RA 2OF7A 1WWXA 2DW4A 5JVGF 3F23A 3DPLC 3TDUC 4EGZA 2K3PA 3PNYA 2QLZA 5B3SH 2L9SA 4HRIA 4QPOA 1FWZA 1P4XA 5K7FA 2V1NA 3LOCA 3I9V2 1P4WA 3BROA 3QPLA 3FK7A 2M7BA 3TO9A 1Z05A 4ESJA 3MWMA 1RIOH 1MSFC 2ZMEB 1FY7A 2HTJA 2G0EA 4HOBA 4KT5C 2VI6A 4HF0A 4Y52J 4RLQA 2EA2A 4B47A 1YQAA 1LB2A 1DP3A 1VQ9I 4XLFA 1XCBA 3EUAA 3ZQGA 1NK2P 5EZGA 3L2CA 2ISZA 2GOXB 1JKRC 4ZTFA 4IHVA 1F9NA 4IHWA 2JVHA 2NNNA 3F6VA 2L54A 2EIMH 1FP1D 1VTNC 1GHCA 2OQGA 2LLKA 4ZZDA 4EJWA 4RMNA 1QZYA 2DPUA 4EEFG 1AOYA 3S3MA 4RAGA 1NK3P 1H9GA 2HPMA 2CJJA 3FHNA 4P1WA 3G1MA 4IHSA 1LDJA 2LC2A 1Y8RB 2YX7A 3E6MA 3G71I 1Y8QB 2OCCH 3DEWA 2KIMA 1YW9A 3PO2J 2MBFA 2DT6A 2E1CA 4JX5A 1SD7A 2ZJPF 1ZQ3P 5DV5A 1SANA 2ZFUA 5CVVA 1JGGA 1TQPA 3H3ZA 3LSKA 3O2PE 3J7AY 2FNPA 5HDGA 2LBFB 5EF6A 1D3YA 4X6AJ 2X48A 4BQQA 4ENMA 2Y0MA 2IS4A 4XNFA 2IA0A 1W7PD 1B6AA 4OIOF 2FA5A 2K86A 2P4WA 1D0ZA 3DP7A 4N9IA 1KA8A 2W85A 4LOCA 4NC8A 3ABUA 1UB9A 1XCVA 3ZQHA 3BR0A 1XB4A 2CQQA 1QGPA 5L3CA 1RZ4A 2RGVA 5KK1A 3H0DA 3N4MA 4RDUA 3H35A 5F64A 2L7FP 2PEXA 4AIKA 5AIQA 5AONA 2WAQA 2ZXWH 3RKQA 2ESNA 1I6XA 2NVTJ 4IOAF 2PX9A 2Q0OA 4HNUA 4S04A 3R0AA 4D0PA 2GXGA 2TDXA 1IJWC 2KMUA 1STZA 4CA0A 4LFUA 3M9AA 3TEDA 1EH8A 1WH5A 3IWFA 2DLLA 5LEJA 4MQVA 2ZKZA 3W2VA 3DBHB 3M8FA 2H1KA 4RGSA 3OYAA 5IOZA 2IXSA 3BR6A 1O7FA 1XGNA 2LK2A 3WGHA 2AXTC 3WTVC 2MD0A 3F9KA 1X2NA 2DA3A 2KIFA 4BYYA 1K4TA 3GZ6A 2DK8A 2R7WA 4DGWB 4L9NA 3K4NA 2Z16A 3GF2A 2BZTA 4U0WA 3HEFA 4A3JJ 2STWA 1KU2A 2R92J 3RYPA 2LD5A 3HL2A 1VQLI 3LSGA 1S6LA 2E2IJ 2BXYA 1IRZA 1XN7A 4DYCA 4E7SA 1G3WA 3FBNB 5H6RA 3IV5A 2MLGA 1OCTC 2XC7A 4XLCA 5ILVA 1T95A 1BI0A 3DEUA 2XASA 2HKOA 2EK5A 1XSDA 1MSEC 3GTGJ 3T8TA 4A5MA 4WX9A 4LLNA 1TQIA 5A2QK 4CZCA 1R36A 3HSFA 1QPIA 3O8HA 3HRTA 4AD9A 1I50J 2FMLA 2CFXA 3CUQC 4HA8A 1W4MA 4A2UA 4J01A 3RJPA 2CWEA 5HDNA 1USSA 3MD2A 3BTCA 3PSIA 5E20A 1J0RA 3I58A 2QUFA 1S5LC 5ICGA 1UHMA 3S2WA 2IPQX 5D6FA 5HNFA 1E17A 1TZLA 5D4RA 1ON1A 2WV1A 1ACIA 4M3FA 3IAS2 2L9VA 4I98B 1F1ZA 2F5EA 1QZZA 2HOEA 3CESA 4CHUA 4BBSJ 1X1CA 1ZLKA 4KIGA 2FD5A 2VOPA 3JRFA 2RVCA 4AIDA 1P6RA 3QODA 1WFXA 2JPBA 4HLYA 4NB5A 2W4SA 2BYVE 2NOGA 1ZG5A 4RGUA 3PFIA 4HDUA 2R7OA 4J00A 1MDMA 4XLAA 2CRGA 3J80K 4ETSA 4YFNF 2XAFA 2GWRA 4IQJA 3HDDA 2QQ9A 2ZJRF 5ILUA 2W82A 1YS7A 3A4CA 3JREA 1IF1A 1YHQI 4RLFA 1RPWA 3F3XA 1QU3A 4PCQA 2CV1A 1LFPA 4IZZA 1L3LA 4X1EA 3GTPJ 1PUFA 3GW2A 1JJ6C 3F8CA 4QTRA 3E7LA 3KP2A 2MD5A 1UAAA 2DBBA 1EH7A 4RGRA 1OCRH 4GYIA 1YIJI 2M45A 4Q48A 2KJCA 2OPTA 1UMQA 2YPRA 3KLOA 4ZYHA 3A01B 2PMZA 3S93A 2CUJA 1RR8C 2P81A 3R61A 4E6KG 1B4AA 1RC9A 2DA2A 2HZTA 3DLAA 4UXNA 4R79A 5FKOA 2YS9A 3ROUA 2QZ8A 3SZGA 1D1AA 1S7EA 1XC5A 3V7RA 2EILH 3OR1C 3E97A 2EFNA 2EFOA 4IRIA 1QQIA 2MA3A 1K7AA 1HC8A 3GTOJ 4UUSA 5IT9Z 3E6CC 2MGQA 1N78A 2R93J 2XGXA 1UJ8A 2VXZA 2CSOA 2MABA 3AG2H 3OWTA 3QU6A 3CP8A 3I5UA 2WAEA 1P2FA 1LFBA 5C3EJ 1U9OA 2IT0A 1WI9A 4UB8C 4IVNA 3PIOF 2F5VA 4O6JA 2HDCA 3FHZA 2DA7A 3HZJA 3TOAA 5J1YA 3Q5FA 1H0MA 1VI0A 4DBQA 2IW5A 3E1SA 3GFLA 2CW8A 2H94A 4HNVA 3JW4A 1U3EM 1B72B 3KP4A 1Z67A 2HVSA 1FZPB 1OR7C 2HI3A 3U1DA 1NG7A 2AQEA 5HNHA 1ENHA 5E1ZB 3R60A 3KLNA 1H88C 1RI7A 4PGHA 3OMYA 4HPQA 2NOJB 4DYRA 5TISC 3S15J 4BHPA 1FX7A 3J81Z 2ZBKA 2R7VA 3RZDJ 1E0EA 2I8DA 5LRRA 2ME6A 2R5YB 3G4SI 2M87A 4B48A 2X9DA 1B59A 2ZO4A 4Y33A 2ID3A 3HKZN 1AKHB 4B3XA 2X0LA 4C2TA 2F4MB 5H6QA 1O3SA 3CF5F 2VLAA 5K1YA 1Y0NA 2DODA 5K7HA 3AAFA 2PFBA 3OOUA 3EUHC 1FMWA 3GFJA 4KYWA 1T0FC 1RESA 1A35A 3H9QA 5LBQA 2BY0A 2F2EA 1V5GA 1A36A 2X6XA 2DTZA 3DWLE 4BJ6C 2VJ5A 2DMNA 4CCKA 1BJAA 3KYLA 2FNAA 3P5JA 2DOFA 5E79C 1LPQA 2VKDA 5CQGA 1YRNB 1RR7A 1MBKA 1TTYA 2Y2ZA 1IDYA 4V2GA 3UNGC 1I5ZA 1OJLA 1IRFA 3OS0A 1ETKA 5E18F 4PK4A 2ZB9A 5E8IA 2XAGA 3BQZA 4M9ZA 2O6GE 1FOWA 1NG6A 4R1HA 3ELKA 5K5OA 4DBRA 1WJFA 4F7ZA 3CD6I 5CJ9A 3CJNA 1ZRCA 1JUMA 5J6XA 5TRDA 4RB3C 1AHDP 2JQ7A 3QWLA 3KP5A 5IYBJ 1UELB 1DPRA 4FQGA 2ZNZA 1V55H 3IUOA 1WSUA 3OYIA 2HYJA 3CUQA 3LQRA 3PM1A 1TNSA 1O3RA 3HOVJ 3OYFA 1LE8B 1IN8A 2E5NA 1I1SA 4U7BA 4E7HA 1LEAA 4CZZA 3HPGA 4IHXA 2PN6A 4IKFA 3AFHA 1GV2A 3ECOA 4BJTA 1TQMA 1U5TC 1X3UA 4KITB 1AKHA 1N25A 4Q4ZF 4XSZF 4MEXF 4HLXA 3DF8A 3BG9A 3HM5A 3VB2A 1V3FA 4OIRF 1G59A 1BI2A 2VL8A 3M3YJ 2VJJA 3GXOA 4XN3A 1HSJA 3I71A 4UHTA 3VYTB 1R58A 1W7PA 3HOXJ 2D1VA 3CO7C 1KONA 3TGNA 3MMYB 2PMHA 2BOLA 5HS7A 4BJ5C 4TV7A 4L5IA 5HS8A 2B0LA 2NAZA 4IJAA 1Y0UA 2VODA 4ZH4F 5KNLA 1ETYA 1YRNA 3H36A 4X0GA 1BIAA 2C6YA 1KQ8A 3DV8A 3QOPA 4IEJA 3NARA 4A3FJ 1IV8A 3I54A 1MBGA 1AA7A 3WTSC 3ASNH 3SEZA 3Q0UA 3HC7A 1ZK8A 1VZ0A 2NXNB 1OKRA 3CCYA 4XLHA 5KCMA 4BE0A 3ESWB 5GPAA 3FXLA 1XX5A 1HBXG 2R3SA 2EV6A 1MNEA 2HXIA 3PNVA 2MLKA 1U2WA 2E1MC 2JSCA 2Y0SN 2H8WA 1Z3YA 2KLOA 3WODF 4FTHA 3VYUB 2M2EA 5DCMA 3HGYA 3SJMA 4BEHA 2E1OA 3JRCA 2FSWA 5BPIA 2TRTA 2VKEA 2QWWA 3QP5A 1D1CA 5HODA 2ZSHB 1JKOC 2ZJQF 3DKXA 5FFXA 2UXXA 1JTYA 4I99C 3RKXA 1MBJA 1Y6IA 5FROA 2JN6A 1GVJA 2HDDA 2ELKA 3LL7A 2JRMA 3N05A 4B1RA 4G8XA 5EG0B 4YFXF 1YW8A 5DUIA 4ESFA 5LD2C 3DPTA 2XIGA 1WVRA 4KN7X 2O8XA 1ETVA 1X3ZB 4F91B 3U1KA 2XVCA 3KEYA 3ZP5A 3O8GA 3VWBA 3B02A 2ZMEC 4II3A 5E1XA 5KAFC 1ETOA 4JQFA 2LKSA 4XSXF 5FKKA 2WTEA 4JK1X 5JHUA 3M7GA 3M8JA 2QSHX 4KIBA 3QYBA 4NUBA 1MBHA 2Y31A 3SQNA 4GFBA 4WCGA 3IKVA 2PJRB 2Z2SB 5IP9J 1XMKA 4HQEA 2HVRA 4KDPA 3BCAA 3HGGA 2HEOA 3LA3A 5FKNA 3LA2A 5D8LB 4OIPF 4BQAA 2HGCA 2OTLI 2Y69H 1ZHFA 2OBPA 2I5UA 3FF5A 1IDZA 2NS7A 1QHGA 1QVUA 3EYIA 1DQUA 2JA7J 4XR6A 3JR9A 2LP0A 4I2OA 1UCRA 2ICWG 3H9GA 5H20A 3F8MA 1X1PA 3KZYA 2XV4S 4OAZA 1J2XA 2H09A 3EUHA 3COAC 3QPHA 3FXRA 1T0FA 1QPMA 4CCLA 4HBLA 4BY7J 4A3CJ 3HSRA 3WHBA 4BAYA 4G94A 4XLNF 2W1OA 4BQOA 5LHGA 4LLLA 3U2RA 5K7ZA 2F4IA 2QVOA 3FMRA 3W6JB 1FLIA 1GLNA 2ELHA 4BE2A 2DA1A 3WU2C 3LFUA 1TWGJ 2QGUA 2K5CA 2VBWA 4F92B 3LNQA 5L3BA 3BZ6A 1K83J 2Y75A 2OZUA 4V2FA 1XTAA 3G73A 4A3IJ 2H27A 4KIFA 2EQRA 2CQ7A 3FMSA 4M74A 1MZBA 1XGMA 4BDYA 2LOOA 2AO9A 2D45A 2O5RA 3B6CA 3C1DA 1W5SA 3NRVA 5HLTA 3ULQB 3DTKA 2B63J 2FOKA 3EUKL 3G1OA 4LG0B 3L2UA 3BG6A 1TWAJ 2E71A 4CXFA 1HA8A 1ZRDA 4A6EA 2D1HA 1TBXA 2K7LA 1IO2A 3LSJA 1IRGA 3ZQLA 1DUXC 3JSOA 2VB6A 1YW7A 1SD6A 2PJRA 3CCRI 1SVMA 3GTQJ 5D5XB 3CJRB 2ELJA 2FU4A 5F0CA 5EYRA 1H8AC 1IGNA 2X6YA 5J4VA 2Z9OA 2FQ3A 2RQPA 3CDLA 2PI0A 1RETA 4BQNA 1U5TA 3NAUA 3A0BC 2R5ZB 1T6SA 3HHHA 3FZVA 5J3LA 2QKMB 3WU1B 4HZFA 2JVGA 2IS6A 1BR2A 1K79A 5FLVA 4XL9A 1BI3A 4UVCA 1YOVB 2IS2A 3L09A 3MQ0A 5GAHJ 5FLXK 2VIXA 4A3GJ 4MNUA 1IUFA 2HQ5A 1Z6TA 4AVPA 2MC3A 5CVJA 4UV8A 4A3LJ 3RQ4A 2R7FA 2MYSA 1OLTA 2DA4A 1ZN2A 1A31A 5M3MJ 2CUFA 2X1DA 4WXDA 1JHHA 1QRYA 2VBZA 1ZELA 2EIJH 1HKQA 4AU7A 3TDZC 3VODA 2V6CA 4UY8I 3K9TA 1JUSA 3OYKA 1IXSB 2V9KA 4LK1F 1R4NB 5A2QZ 4N4OB 1BW6A 2F6CA 3OSFA 3TP0A 1YO5C 3PQJA 2ISYA 1YJWI 4GRIA 1IN6A 4B8XA 3AG1H 3BJ6A 1S9HA 2L5QA 1WH7A 5D5UB 4AC0A 5HLGA 3GVAA 4M72A 3G3ZA 2VASA 3RQIA 4XKCA 1GUUA 5FRNA 3BZCA 2ME0A 1MMAA 3GFMA 5EJCA 1SEUA 3GTJJ 2P5KA 4HSTA 2PG4A 3ZQ7A 4A3EJ 4U7DA 2BXZA 2QSFX 1UZCA 4RB1A 4NQWA 1JKPC 1RKTA 4NDLA 5F6FA 2WB1N 3CTAA 3SFIA 2L3DA 1VQOI 2V7FA 4ZDLA 3DTIA 1TT0A 1JI8A 2LSOA 1XG1A 1QZEA 3BCBA 3EPZA 3FXUA 1WCMJ 1ZRFA 3J80Z 1Q1HA 4DNCA 3W6KB 1LJ9A 3H5AA 1FSHA 3ZMZA 2DFHA 4BGDA 4OOIA 3CCSI 3T8RA 3OL4A 3L2WA 2RNJA 2PJPA 2KDZA 4UVBA 2FBIA 4AYBN 2K27A 3NEUA 2ZMEA 2RREA 2RV8A 3HOSA 1O3QA 5DD4A 3WG9A 1DP7P 1EKEA 4HF1A 1FEXA 5IP7J 3CMMA 3K7AJ 3S3NA 2HYGD 4XONA 3P9IA 5KHDA 4LLGF 4Q47A 2LNBA 2A6TA 3BG3A 4I7HA 4OAYA 1TLHB 4PUSA 2AHQA 1W5CC 5D5WB 1J5YA 2XPUA 4DJAA 4L0ZB 3GTLJ 1WI3A 1XSVA 2DPDA 2HNHA 2CYYA 5E17F 4CSWA 3V8KA 5DDGA 4IF4A 3TOBA 1P92A 2EBIA 4DOZA 4DZJA 4HX7A 4U88A 3IP4B 2QCOA 2V6EA 5BNGA 3CMEI 2QYOA 4O5VA 3IC7A 1YS6A 2QA4I 3OSGA 2CW0F 4L9TA 1CGPA 2DA6A 3GLXA 2IGMA 1F36A 4EJUA 1HQCA 2VT2A 1CF7B 4HEA2 2K9QA 2LBFA 1DGRM 1P7JA 2GIVA 3HUGB 3KZIC 2VJ4A 5LLQA 2IEKA 3ZMVA 1JXSA 1FSEA 1G2HA 3FK6A 1FIAA 2L01A 4RA2A 4JBAA 1G6NA 2OU2A 4OINF 5L3GA 3DXJF 2QSGX 2HTSA 1V5FA 5D8KB 3CCUI 2DT5A 2M1BA 3HOWJ 4P9FA 3AL0B 2DJIA 3MZ8A 4DQ2A 1WPKA 2XF6A 3F6OA 5E3MA 2IRFG 3KX2A 1YI2I 3OOPA 1A04A 2DU9A 5JI6A 4U0YA 3BR2A 3KEQA 3UR3C 4D5FA 3N97A 2M3AA 1RKWA 4UV9A 3SYTA 5FD6A 1P4AA 2Q2EB 1BOBA 3HHGA 3BG5A 1BC7C 2XUBA 1A5JA 3MKLA 3RPQA 4FCYA 3IH2A 4M6XA 4IXAA 5B5EC 2FMYA 2UWMA 5IPAA 1SFUA 2UZKA 3R6SA 2QEXI 1JKQC 2OJED 3MKZA 1MKMA 2UXNA 1SC7A 2YSRA 1IN7A 4CCJA 1IW7F 5C44J 1R23A 3IH3A 2NYXA 1I3AA 1G4DA 4GYGA 2HOSA 3T1BA 4M73A 2EV5A 2GOMA 3HYIA 2O9LA 4XKWA 3I3LA 2BW3B 4P5OA 2JJ7A 3RIRA 3F21A 2X51A 1J59A 1ZR4A 1JJ8C 2JA8J 5HDKA 1CF7A 4W1UA 5TJJA 3EQLF 2MG4A 1X19A 2NVXJ 4LD5A 2DK5A 4M71A 3OYMA 3QQAA 4RB0A 3HUGA 6PAXA 2NRAC 1K61A 3BJAA 1O7LA 1XDSA 2RQQA 1D5YA 2XAJA 3S1RJ 3D1NI 1YJ9I 5LRSA 4RAYA 2FE3A 1U9NA 3OV8A 4BBRJ 2EZHA 3CMYA 2V1XA 2IP2A 3I59B 4MHGA 4KMUX 5F1JA 2BHZA 2K9MA 3P9KA 3H5RA 2CU7A 2ZJ2A 4P9UA 4L0YB 4XKVA 1GV5A 3HKZA 2QQ8A 1MJ9A 1ETQA 3A02A 5J47A 4HV5A 3IWZA 4BDZA 1R6RA 1MW7A 1PVEA 1U0JA 2E1NA 5L3DA 3P9CA 1G3YA 3MN2A 4EATA 3OYNA 1M1EB 5JVTA 2QBYB 3C2BA 4QSHA 2COBA 2Y30A 4U0VA 5FB2A 2EZLA 3J7ZI 4HNTA 2V79A 4JX4A 2O3FA 4PJLA 2GM4A 3CJTB 1R7JA 2EZIA 3C18A 2XSDC 1LUJB 4BY1J 4P55A 3RCOA 1JT0A 3WE3A 2VQHA 2L7ZA 4FT8A 2ZFWA 2JWTA 5KAIC 4CYCB 2P0WA 2GAUA 2HQRA 1KU9A 3PL8A 5CQEA 5M5WJ 1T98A 1NH3A 3ZPLA 5EDNA 4JP0A 4MO7A 4R8HA 1TP4A 1HLVA 2HOAA 2P6TA 5JHFA 1FJLA 3S1QJ 4MFEA 3HIFA 4U87A 2LY2A 4ITVA 3OYDA 1BBYA 1ZG1A 3QYEA 2BW3A 3DBRB 4OMYA 2E35A 2XGEA 4XQFA 2CQKA 3FX3A 2WADA 2DYRH 4YIIA 2OD5A 2DYSH 3WGGA 3DU5A 4Q5SF 1OFCX 1OPCA 4Y7NJ 3I56I 4FISA 1K4SA 1KU3A 3HRSA 3A01A 1S29A 3I4PA 3M4OJ 1QHHD 2LYCA 2BHYA 2OTJI 3WTTC 1QO0D 3VYSB 1X1AA 2M8GX 4PJNA 2FEZA 3S32A 2NNYA 2X1EA 1TWCJ 3JRGA 2RDPA 1LEBA 1VQ5I 2A05A 2M30A 5H2FC 3K6GA 2BVMA 3H3UA 2DQLA 1WHUA 2L2OA 1D1BA 4PSWA 2EIKH 4OWRB 1FC3A 3PJRA 2QENA 5FD5A 4ZJZA 1HW1A 4GXOA 3ZMUA 3CCLI 4IOCF 2DI3A 3KETA 1CQTA 1Y1WJ 3H1CA 2VC1A 3KFWX 3KPHA 2XPVA 4IRGA 4BU2A 5CVRA 4XOTA 1IN4A 4E70A 4EJOA 1R5HA 1GXQA 3CLOA 4XMYA 2K9LA 5CVUA 1FP2A 2M9HA 4L9JA 1PYVA 1YE9A 2ECBA 1YG2A 3NQOA 1Z1DA 2BBYA 2CG4A 2L9NA 3BOQA 1U78A 2P7CB 2P5LC 1TWFJ 1R5GA 2ZXIA 2F5DA 3JRDA 1GDTA 1B72A 2HR3A 2DA5A 1EA3A 2Y9ZA 4UNOA 1TWHJ 4QIWN 4A93J 4UUTA 2FF4A 1D8JA 2GLOA 3BY6A 2JA6J 3LA7A 4I02A 3KP7A 1WJAA 4DYQA 1XMAA 3L7WA 3FMQA 1OCZH 3D5RC 3DPUA 4FE4A 4M3EA 1LFUP 1LDKB 1OCPA 4BS9A 2DFIA 1X4PA 2R7QA 5JFRA 4GO1A 5ILSA 3JSPA 1SFOJ 2M4GA 3GLLA 4YIFA 2XB5A 2R5YA 3DBLB 1F43A 1Z7LA 2JUGA 1J75A 2Y0SA 1GT0C 2KRHA 2LRDA 4YIRX 3CC4I 4RAZA 1O3TA 1G8XA 1WJEA 1R49A 3L2RA 4M3GA 2E5ZA 5HLHA 2BY2A 1ITYA 2FJ1A 3AG4H 2JTVA 4XRMA 2VPLA 4FX0A 4CGZA 1XD7A 2A6EF 4E4HA 1D0YA 1YLFA 1XGOA 2EINH 1E3OC 3OYEA 3GFIA 3TMOA 2F4OB 2VPRA 4FETA 1XPXA 5EGOB 3E5QA 2R7XA 4AM3A 5C4JJ 3IL2A 5F0HA 1HF0A 4PSXA 3CCEI 2HOTA 2DMUA 2O61A 1HXDA 2GQQA 2DQRA 1XMXA 3F8NA 2XRNA 5L3EA 3BR5A 2K4JA 4EJVA 2KFDA 4KUMA 3BZKA 3HBLA 4OIQF 3FXJA 1Z77A 2LMDA 3GEZA 5DD8A 3DLLF 2Z33A 2XF5A 1QNTA 1R22A 1P7IA 5GPCA 4UUVA 2OA4A 4G6DA 1V54H 1ZKGA 2CFOA 1Z91A 3PO3J 4A0ZA 1REPC 2H6CA 4C3IJ 1APLC 5LHIA 1TC3C 2OZ6A 1R1VA 5KVRA 5HOOA 4EM0B 1LE8A 2LTPA 3RTRA 1ODDA 3ML6A 4C2UA 2LFBA 2NVYJ 3PSFA 3W6VA 4GCVA 1B8IB 2L4AA 1RUNA 1ZTRA 4M9XA 3KZZA 3WG7H 4GDFA 4BKXA 1HCRA 3JRAA 1FBQA 1MNDA 3ZRGA 4DW6A 1T39A 4LB5A 5F0FA 1OYYA 4J19A 3K4LA 4JX6A 1E2XA 2IJLA 4LG3A 2GA2A 3BJOA 3IH4A 5DM6F 5TGTA 2IGKA 1R71A 3HOUJ 2D5VA 3K10A 2KKOA 3CCVI 5EEGA 1N75A 2X6OA 2E34A 2HS5A 2KZGA 3F0CA 5FLXZ 4CCMA 3OS2A 2E2HJ 2L7KA 5EGOA 1YFHA 2LY9A 3LSRA 4RM3A 4UB6C 5BPDA 2GIZA 2EPFA 2ADUA 1MBEA 5ICEA 1ZREA 2Y9YA 5IYDJ 1I27A 3BTJA 1GXPA 3EYYA 1Z3XA 3CC2I 4MLOA 4EVIA 2WAFA 3K70D 1U6GA 5FO5A 2V9VA 3Q0VA 5HS9A 2STTA 5DUKA 3BG7A 4ABZA 3CMAI 1DU0A 2Z99A 1WJ5A 3OYLA 3VSLA 3GX4X 4ZTJA 5BS6A 2D2WA 2JRTA 1I1GA 2VQGA 1TW3A 2Y48A 4Z6YA 4AUXA 1VF9A 3TKYA 1ZGWA 3BPXA 1IZ1A 3W2WA 1XS9A 4A3BJ 2P8TA 4G6QA 1S72I 2OV7A 3S1MJ 2W57A 2BE5F 4IPAA 4PFPA 3DEEA 4QPQA 1FBSA 1VQKI 1RRJA 3S16J 4G9YA 2JSPA 3K4JA 4CICA 4HQMA 4BXFA 1IC8A 1W1WE 4I01A 3ASOH 5DS9A 4KISA 2LY1A 2H8RA 4EJTA 2LG4A 4CO8A 1UG0A 3LFKA 5BQTA 3L2VA 4WWCA 4F3QA 1VQNI 1ZGAA 3A2KA 1MJBA 3L9FA 4FHTA 4XLEA 2N8GA 4BXUA 1MNMC 2GXBA 2G7UA 1I6HJ 2O0YA 3A0HC 5IT3A 5EG0A 4KMFA 1HW5A 3CJQB 1H9TA 2H6BA 2WY7Q 2Z1DA 2P5VA 2A3SA 2GZWA 3BR3A 3E5XA 3ABLH 5GP9A 5JLXA 1K6OA 2CV2A 2CO5A 2VC0A 1T56A 2GXAA 2DAOA 2IBDA 3JAMK 1BI1A 4D5CA 2RAEA 2Z5UA 2DT7B 2HQNA 5IP6A 3WGIA 2XRLA 3QYFA 4JOMA 4XKBA 1JUPA 2HQAA 2WY8Q 1Y1VJ 4HW0A 2XPWA 3I53A 1R4MB 2KT0A 2KIUA 4DIQA 3ZMTA 2ESHA 1R00A 2UV1A 2Z3YA 3WE2A 3MKYB 1VQ7I 1KYZA 2LH9A 3KP6A 1WJCA 4BHCA 5FKLA 3IRQA 2A69F 4BXXJ 2M0CA 4F93B 4A12A 4E7LA 2G9WA 4B44A 3JTGA 2ZSIB 2FBHA 4B09A 2CV0A 3H5NA 2J5OA 3NWTA 3GCMA 3BLYA 3HTUA 3WU0A 3ABTA 2ETHA 3RYRA 4ZYGA 1FYLA 4E7KA 3QRFF 3DU6A 1ZR2A 3V7CA 3QOEA 2IS1A 2JK3A 5HLIA 1W0UA 3RKYA 1T38A 2WB1A 2JA2A 3QU3A 4MIMA 1ZYRF 3IHUA 4RS8A 2M7AA 3RPUD 3B73A 3MVPA 3HB9A 4Y13A 5CVIA 1R1UA 1ZAOA 3HOTA 4XBFA 1L0OC 2XGDA 1IXCA 3TO6A 2K02A 2KRCA 3HPHA 3LQQA 1MBFA 1LVAA 3DQVC 1XDUA 3S14J 2TCTA 4HX4A 5B66C 5EEAA 4L9VA 3WHCA 4HSRA 3ZQQA 2L0KA 5JR3A 4LIVA 1USTA 3AG3H 3C7JA 4Y3OA 4LB6B 1ZG3A 3C2HA 4AYBA 2DJNA 3E6BA 2W84A 3PQKA 3AL0C 9ANTA 4I0BA 2A6HF 1ONVA 2M8EA 1BOAA 2FUG2 4RAFA 5E3OA 1JE8A 4QWQA 3FM5A 2L7MP 2DMPA 1FIPA 1YJNI 3KCCA 5J40A 2VXDA 4H0EA 1B9MA 4LG0A 5J8FA 4G7OF 4BL0B 3ZR8X 3SZPA 4I6ZA 1W0TA 4HG2A 1FOXA 1MD0A 1FYKA 2A5YB 3MAJA 3BR1A 1WZ2A 1WJBA 1RUOA 4I09A 2PQ8A 1X4OA 3VPRA 4C9YA 3K0LA 2FOWA 3ISPA 3SXYA 3ZCOA 4H4KC 2R5ZA 1ULYA 2DFEA 3BP8A 1IUYA 3F8BA 2BGCA 4V19K 3PNTA 1E3PA 3ZQFA 2K85A 3JTHA 1HSTA 2JPCA 4P96A 3UKGA 1BR4A 3ZMSA 2AXLA 5CYVA 1LQ1A 2EWNA 1U8RA 3BTIA 2CQXA 1LVKA 2VBYA 2R7ZJ 2ZC2A 5EEHA 3R4KA 2MC4A 5EZHA 4CYDA 3TW7A 3FM3A 3OYBA 3VSKA 4BNCA 3MKWB 3Q9SA 1X58A 5E3NA 2KZVA 1TT5B 1PP7U 1SFXA 1S8NA 1XGSA 5M5XJ 1JHFA 1ZGJA 2XAHA 3TQNA 1TL8A 2IGOA 3DCFA 1G3TA 2A68F 1LNWA 1PDNC 1WQ2A 1HDDC 1FT9A 1RNLA 4KT6A 4S0HB 4ESBA 2R7TA 1MMNA 4ZZLA 4YELA 2QQAA 5DEQA 3KP3A 5BMZA 2K9SA 5E1WA 1BM9A 3H9JA 3WTWC 3MZHA 3ZQCA 3CO6C 3S3OA 2V26A 5LGNA 1WGXA 1YX5A 4KNYA 2DO7A 2IVMA 2JMWA 5ED4A 3GMEA 3OIOA 4Y17A 2R7SA 2Q1ZB 5LEKA 2VN2A 4UVAA 2W00A 3ZGKA 3DKWA 4ZYAA 4S05A 3OIPA 5JLWA 1AU7A 4ENNA 3CUOA 4XRSA 2X85A 4N4NB 1ETXA 2BY1A 3FKIJ 3L1PA 4LITA 5FKMA 3I4MJ 1BA5A 1MDMB 2V9PA 2HVQA 4BE1A 1T33A 2LKPA 2I10A 2O7OA 4Z2YA 4A3KJ 3LWFA 4MEYF 3JRHA 3REOA 1PUEE 3X2QH 3KEOA 2KHMA 1LKXA 1Y39A 1PUFB 3JRBA 2DXIA 2E60A 3RI4A 3O3KA 3RZOJ 5B1AH 2K40A 4NC7A 2XAQA 1SFEA 4B4CA 1VQPI 1KU7A 2K3FA 5F27A 2LKXA 3M1CA 1HW2A 2HWVA 3FXKA 1BN5A 3O6BB 4LIUA 5HVQC 3Q0WA 5LGUA 1FTTA 1D5VA 3QPTA 1EF4A 2WAQN 3SHFA 3D0SA 2NVUB 1MMDA 1Z7UA 1SVLA 3Q3SA 3KE2A 1Q1VA 2ZCWA 4UUSB 2NS8A 4HAMA 4KA4A 2UUZA 2WV0A 3FIWA 2XKOA 3WTZA 5LGTA 4MFDA 2MH2A 3HRUA 2ZNYA 4FX4A 1HDPA 1FOKA 2CS3A 3OS1A 2F5FA 2HYFA 1Z9CA 5DM7F 4FASD 2K9NA 3ABMH 1BL0A 2X4HA 4ENKA 4D9JA 1Z6RA 3MEXA 3RKWA 4ZYDA 2YUSA 1HOMA 3CZ6A 2KJBA 4RBOA 1V4RA 2KDOA 2R4GA 1BR1A 1T2KA 1F5TA 4LGWA 3B6AA 2E36A 3V8LA 3J7YJ 1HKTA 1OQYA 1SAXA 3S2DJ 2HKXA 2EA4A 4IL6C 1SMYF 3K4MA 4XN0A 3M8EA 3F72A 2JA5J 2HZDA 3PUFA 2E19A 3GO5A 3I0TA 1IN5A 4A69C 3CC7I 4ANJA 1PJRA 4MGRA 1TW2A 3E6DA 3Q9VA 1KGSA 2XB0X 4RGXA 2E7WA 2LF8A 5ICCA 2DOEA 3CCQI 3M07A 4EMSA 2PLYA 4BH9A 3MZYA 5ICFA 2CQNA 2WA0A 3HG9A 4E7ZA 4LJZF 5GTHC 5IYCJ 5DYMA 2VOOA 1KYWA 2O8KA 1IRXA 1ZH5A 3CCMI 2DDBA 4C2MJ 3OR2C 3CCJI 3ABKH 2M4KA 1D0XA 1NTCA 5DCFA 4A3DJ 2LVSA 4M9SA 2Q2EA 4ASNA 2XROA 2H1LA 3K1PA 3L00A 2PMUA 3BWGA 3C2GA 4XRFA 1EV7A 3G6EI 3LSIA 2RC4A 2R7RA 2FQ4A 1FBUA 1J09A 4XOPA 4HF2A 1BC8C 4EGYA 2IA1A 1EH6A 2EFPA 4CCOA 2GA1A 1FPQA 2XSJC 1ETWA 3CQZJ 2XF7A 2CMPA 4NNJA 4OU0A 1DU6A 4PJJA 1SD5A 1WJDA 4I0AA 4M3BA 1W36D 4K2EA 1DPUA 2KPMA 3IAM2 3R0JA 3U21A 4KJZA 4PGGA 1X1BA 3PIPF 5E3LA 2QQBA 3D5SC 3ZN0A 2R7UA 3GTKJ 3NWSA 3RDIA 1OCOH 2VJIA 3BTLA 1B1BA 3E0JB 3I4NJ 4G7HF 1DGWY 3WTUC 2DOAA 2EJRA 1MMSA 3T0YA 4IO9F 1G3SA 3K1NA 1UG2A 2RKHA 3K2ZA 3CUQB 3TL4X 4D7NA 3TO7A 4N0BA 4IX7A 1SD4A 2PMZN 3I59A 3CDHA 3FXMA 4PJMA 2X1CA 1OYIA 5AIPA 1VQMI 4PZJA 5K5QA 1YIOA 2GBYA 1D8KA 3T5XA 4PJ0C 2AQFA 2DMQA 4XM3A 4AIHA 3K2AA 1IG7A 4G7ZF 1BW5A 3K4CA 3BDDA 3I64A 2LREA 1AWCA 2QBYA 3RPUA 1Z21A 2NVQJ 3ZQIA 5ERIA 2IA2A 1R5ID 4LK0F 5GAGJ 2W7NA 2WWYA 2KISA 2DN0A 1W7PB 2V4JC 3KIOA 4D1QA 1GVDA 1O57A 4FE7A 1UHSA 3P7NA 4B3AA 4EQQA 4W97A 1MJAA 3GYHX 4CYCA 2BEOA 2HU9A 3OYJA 4OMZA 1FTZA 1POGA 1SAUA 1XSXA 3V8JA 2VE8A 5M5YJ 3V7SA 3K1MA
chains in the Genus database with same CATH topology
3QAHA 2OQRA 3E3VA 1SMTA 1NHAA 1QBJA 2M5WA 5FGMA 2YR2A 3WTXC 2P6SA 2EB7A 2LDUA 2QM3A 2HFHA 3VOEA 2YU3A 5L3FA 4WK8F 1F4KA 2LF7A 3BPVA 1J7KA 5J8CA 3F22A 3SFZA 5DCMB 1LDDA 1S7OA 2O03A 4HX8A 3EETA 5IT9K 4A6DA 3WTYC 3ZMDA 3FXQA 2NS0A 4ENJA 3ECHA 2W24A 4ON0A 4A0XA 4IRHA 1HKSA 3GUDA 1KQ0A 3U9GA 5F1RA 1R1TA 4HDVA 4BHBA 2OAZA 4MTDA 1FNNA 3HTSB 5D4SA 1UFMA 2PBIA 2XKPA 4IHTA 4CDGA 2FXAA 2A61A 5BOXA 1WRJA 3JAMZ 4WF2A 4RB2C 3J81K 2CGPA 2BV6A 4GGGA 2R7DA 2YX4A 1W5TA 2ACJA 1OYWA 4A5NA 2VE9A 4EV0A 3ERED 2L4MA 3QP6A 5CLSA 2EFWA 1B9NA 1S7AA 3IKTA 3E5UA 4XLPF 1BIBA 3H92A 3EDPA 4Y15A 3LSTA 5D5VB 1S3JA 4KICA 2RN7A 2W25A 4WXHA 2COMA 1K78B 3C3WA 5D6EA 1OMIA 4MTEA 4N9HA 4A0YA 4M6YA 1OR7A 2VT3A 5FFZA 2J5PA 3VFZA 4WXCA 1C0WA 4ZYEA 2FRHA 2AS5F 2VBXA 3K69A 2Q8KA 4MQ9F 1JGSA 2F5CA 3LAJA 2L02A 2DTRA 3ZN1A 1MGTA 4QLCU 1U5TB 4EM2A 4AIJA 4L18B 2JZYA 2V1DA 2FBKA 3LAPA 4EM1A 1TNTA 3J7AO 3DFGA 1FYMA 4HYEA 3D5LA 3SZTA 4AWXB 4PDKA 4LMYA 3HSEA 2G7HA 4YG2F 3HRMA 3MCZA 4O3MA 2EFQA 3M1EA 3MFKA 3GWZA 2EV0A 2K4BA 2P7VB 1IAWA 2KRFA 3FWEA 1PP8F 1K78A 3GZ5A 3F8FA 3VEPA 1KQ9A 4NHJA 1ZARA 2JT1A 1YTYA 2MH9A 4KFCA 2ZXJA 2V1UA 1WKMA 1ZLJA 4KN4X 3V4GA 5LHHA 3IRRA 2E7XA 4L5JA 4HV6A 2XHKA 1J9IA 5E8GA 2A07F 1ON2A 1IXRC 2VONA 1YYVA 2WC2A 4YFKF 1DDNA 1UHWA 5K5RA 1WWXA 2DW4A 3F23A 3DPLC 3TDUC 4EGZA 2QLZA 1FWZA 1P4XA 1P4WA 3BROA 3TO9A 1Z05A 4ESJA 3MWMA 1RIOH 2ZMEB 1FY7A 2HTJA 4HOBA 4KT5C 4HF0A 2EA2A 1YQAA 1LB2A 1XCBA 3L2CA 2ISZA 1F9NA 2NNNA 3F6VA 2L54A 1FP1D 1VTNC 1GHCA 2OQGA 4ZZDA 4EJWA 1QZYA 2DPUA 1AOYA 1H9GA 4IHSA 1LDJA 2YX7A 3E6MA 2KIMA 1YW9A 2MBFA 2E1CA 1SD7A 5DV5A 5CVVA 1TQPA 3H3ZA 3O2PE 2FNPA 5HDGA 1D3YA 4ENMA 2Y0MA 2IA0A 1W7PD 1B6AA 4OIOF 2FA5A 2K86A 2P4WA 3DP7A 4N9IA 1KA8A 2W85A 3ABUA 1UB9A 1XCVA 1XB4A 1QGPA 5L3CA 1RZ4A 2RGVA 5KK1A 3N4MA 5F64A 2PEXA 4AIKA 5AIQA 5AONA 2ESNA 1I6XA 2Q0OA 4S04A 3R0AA 4D0PA 2GXGA 2TDXA 1STZA 4LFUA 3M9AA 1EH8A 3IWFA 2DLLA 5LEJA 4MQVA 2ZKZA 3M8FA 4RGSA 1O7FA 1XGNA 3WGHA 3WTVC 4BYYA 2KIFA 3GZ6A 2DK8A 4L9NA 3GF2A 4U0WA 2STWA 1KU2A 3RYPA 1S6LA 1XN7A 1G3WA 5H6RA 2MLGA 5ILVA 1BI0A 3DEUA 2XASA 2HKOA 2EK5A 1XSDA 3T8TA 4A5MA 4WX9A 4LLNA 1TQIA 5A2QK 1R36A 3HSFA 4AD9A 3HRTA 2FMLA 2CFXA 3CUQC 4HA8A 1W4MA 4A2UA 3RJPA 2CWEA 5HDNA 1USSA 5E20A 5ICGA 1J0RA 2QUFA 3I58A 1UHMA 3S2WA 2IPQX 5D6FA 1E17A 5D4RA 1ON1A 4I98B 1F1ZA 2F5EA 1QZZA 2HOEA 4CHUA 1ZLKA 4KIGA 2VOPA 2RVCA 1P6RA 2JPBA 4HLYA 4NB5A 2BYVE 1ZG5A 4RGUA 3PFIA 4HDUA 1MDMA 3J80K 4ETSA 4YFNF 2XAFA 2GWRA 2QQ9A 5ILUA 1YS7A 1IF1A 3F3XA 4PCQA 1L3LA 3GW2A 3F8CA 3KP2A 2MD5A 2DBBA 1EH7A 4RGRA 4GYIA 2M45A 4Q48A 2KJCA 2YPRA 3KLOA 4ZYHA 3R61A 1B4AA 4UXNA 2HZTA 4R79A 3ROUA 2QZ8A 3V7RA 3E97A 2EFNA 2EFOA 4IRIA 1QQIA 2MA3A 1K7AA 5IT9Z 3E6CC 2XGXA 2VXZA 2CSOA 3QU6A 3I5UA 1P2FA 2IT0A 1WI9A 4IVNA 4O6JA 2HDCA 3FHZA 3Q5FA 3TOAA 1H0MA 2IW5A 3GFLA 2H94A 1U3EM 3JW4A 3KP4A 1FZPB 3U1DA 5E1ZB 3R60A 3KLNA 1RI7A 4PGHA 4BHPA 1FX7A 3J81Z 2ZBKA 5LRRA 2M87A 2ZO4A 1B59A 2X0LA 5H6QA 1O3SA 5K1YA 3AAFA 2PFBA 4KYWA 3GFJA 5LBQA 2F2EA 1BJAA 2FNAA 1TTYA 1I5ZA 1IRFA 5E18F 5E8IA 2XAGA 4M9ZA 2O6GE 4R1HA 3ELKA 5K5OA 4F7ZA 5CJ9A 3CJNA 1ZRCA 5TRDA 5J6XA 4RB3C 3KP5A 1DPRA 2ZNZA 1WSUA 3CUQA 3LQRA 1TNSA 1O3RA 1IN8A 1I1SA 4U7BA 1LEAA 4CZZA 2PN6A 3ECOA 1TQMA 1U5TC 1X3UA 4Q4ZF 4XSZF 4MEXF 4HLXA 3DF8A 3VB2A 1V3FA 4OIRF 1BI2A 3GXOA 1HSJA 4UHTA 3I71A 1R58A 1W7PA 2D1VA 3CO7C 3TGNA 2PMHA 5HS7A 4TV7A 4L5IA 5HS8A 2B0LA 2NAZA 4IJAA 1Y0UA 2VODA 4ZH4F 1BIAA 2C6YA 1KQ8A 3DV8A 3QOPA 3I54A 3WTSC 1OKRA 1HBXG 2R3SA 2EV6A 2MLKA 1U2WA 2JSCA 3WODF 5DCMA 5BPIA 2FSWA 2QWWA 3QP5A 5FFXA 2UXXA 3RKXA 1GVJA 4G8XA 4YFXF 1YW8A 5DUIA 4ESFA 3DPTA 2XIGA 4KN7X 2O8XA 2XVCA 3ZP5A 3B02A 5E1XA 4JQFA 4XSXF 2WTEA 4JK1X 5JHUA 3M7GA 4KIBA 3SQNA 4WCGA 3IKVA 1XMKA 4HQEA 4KDPA 2HEOA 3LA3A 3LA2A 5D8LB 4OIPF 4BQAA 2HGCA 1ZHFA 2OBPA 3FF5A 3EYIA 4I2OA 1UCRA 5H20A 3F8MA 3KZYA 2XV4S 1J2XA 2H09A 3EUHA 3COAC 3QPHA 3FXRA 1T0FA 1QPMA 4HBLA 3HSRA 4BAYA 4G94A 4XLNF 5LHGA 4LLLA 3U2RA 2QVOA 3FMRA 3W6JB 1FLIA 2ELHA 2VBWA 5L3BA 3BZ6A 2Y75A 2OZUA 3G73A 2H27A 4KIFA 3FMSA 4M74A 1MZBA 1XGMA 2D45A 3C1DA 1W5SA 3NRVA 3ULQB 2FOKA 4LG0B 4CXFA 1ZRDA 4A6EA 2D1HA 1TBXA 2K7LA 1IRGA 1DUXC 3JSOA 1YW7A 1SD6A 5D5XB 2FU4A 2Z9OA 2FQ3A 2RQPA 2PI0A 1U5TA 1T6SA 3HHHA 3WU1B 3FZVA 4HZFA 1K79A 1BI3A 4UVCA 3L09A 3MQ0A 5FLXK 4MNUA 1Z6TA 4AVPA 2MC3A 5CVJA 4UV8A 2R7FA 1ZN2A 4WXDA 1JHHA 2VBZA 1HKQA 3TDZC 3VODA 2V6CA 3K9TA 1IXSB 4LK1F 5A2QZ 1YO5C 3PQJA 2ISYA 1IN6A 4B8XA 3BJ6A 5D5UB 5HLGA 3GVAA 4M72A 3G3ZA 3GFMA 2P5KA 3ZQ7A 2PG4A 4U7DA 4RB1A 4NQWA 5F6FA 3CTAA 2L3DA 2LSOA 3FXUA 1ZRFA 3J80Z 1Q1HA 4DNCA 3W6KB 1LJ9A 1FSHA 3ZMZA 4OOIA 3T8RA 2RNJA 2PJPA 4UVBA 2FBIA 2K27A 3NEUA 2ZMEA 2RV8A 3HOSA 1O3QA 5DD4A 3WG9A 1DP7P 4HF1A 2HYGD 3P9IA 4LLGF 4Q47A 2LNBA 4I7HA 1TLHB 5D5WB 1J5YA 4L0ZB 1XSVA 2DPDA 2CYYA 5E17F 3V8KA 5DDGA 4IF4A 3TOBA 1P92A 4HX7A 4U88A 2QYOA 4O5VA 3IC7A 1YS6A 2CW0F 4L9TA 1CGPA 3GLXA 4EJUA 1HQCA 2VT2A 1CF7B 2GIVA 5LLQA 3ZMVA 1JXSA 1FSEA 2L01A 4JBAA 1G6NA 2OU2A 4OINF 5L3GA 3DXJF 2HTSA 5D8KB 2DT5A 2M1BA 4P9FA 4DQ2A 3F6OA 2IRFG 3OOPA 1A04A 2DU9A 5JI6A 4U0YA 3KEQA 3N97A 4UV9A 5FD6A 1P4AA 3HHGA 1BC7C 2XUBA 3RPQA 4M6XA 4IXAA 2FMYA 2UWMA 1SFUA 2UZKA 3R6SA 1MKMA 2UXNA 2YSRA 1IN7A 1IW7F 1R23A 2NYXA 1G4DA 4GYGA 3T1BA 4M73A 2EV5A 3HYIA 4P5OA 3RIRA 3F21A 1J59A 5HDKA 1CF7A 5TJJA 3EQLF 4LD5A 2DK5A 4M71A 4RB0A 3HUGA 6PAXA 2NRAC 3BJAA 1O7LA 1XDSA 2XAJA 5LRSA 4RAYA 2FE3A 3OV8A 2V1XA 2IP2A 3I59B 4MHGA 4KMUX 3P9KA 2ZJ2A 4P9UA 4L0YB 1MJ9A 4HV5A 3IWZA 2E1NA 5L3DA 3P9CA 1G3YA 5JVTA 2QBYB 4U0VA 5FB2A 2V79A 2O3FA 1R7JA 3C18A 4P55A 3WE3A 4FT8A 2ZFWA 2GAUA 2HQRA 1KU9A 1T98A 3ZPLA 4R8HA 2P6TA 3HIFA 1BBYA 1ZG1A 4OMYA 2CQKA 3FX3A 4YIIA 2OD5A 3WGGA 4Q5SF 1OPCA 1KU3A 3HRSA 1S29A 3I4PA 3WTTC 1QO0D 2FEZA 2NNYA 2RDPA 1LEBA 2M30A 3H3UA 2DQLA 1FC3A 2QENA 5FD5A 1HW1A 4GXOA 3ZMUA 2DI3A 3KETA 2VC1A 3KFWX 4IRGA 5CVRA 1IN4A 4E70A 4EJOA 1R5HA 1GXQA 3CLOA 5CVUA 1FP2A 4L9JA 1YG2A 3NQOA 1Z1DA 2BBYA 2CG4A 3BOQA 1U78A 2P7CB 2P5LC 1R5GA 2F5DA 2HR3A 4UNOA 2FF4A 1D8JA 3BY6A 3LA7A 4I02A 3KP7A 1XMAA 3L7WA 3FMQA 1LDKB 2DFIA 5JFRA 4GO1A 5ILSA 3JSPA 4YIFA 1J75A 4RAZA 1O3TA 5HLHA 2JTVA 4FX0A 4CGZA 1XD7A 2A6EF 1YLFA 1XGOA 3GFIA 3E5QA 3IL2A 2O61A 1HXDA 2GQQA 2DQRA 3F8NA 2XRNA 5L3EA 2K4JA 4EJVA 4KUMA 4OIQF 3GEZA 5DD8A 2Z33A 1QNTA 1R22A 4UUVA 2OA4A 4G6DA 1Z91A 4A0ZA 1REPC 2H6CA 5LHIA 2OZ6A 1R1VA 5KVRA 5HOOA 4EM0B 3RTRA 1ODDA 3ML6A 4GCVA 2L4AA 1RUNA 4M9XA 3KZZA 1FBQA 1T39A 4LB5A 1OYYA 1E2XA 2IJLA 2GA2A 3BJOA 2KKOA 5EEGA 5FLXZ 2HS5A 1YFHA 5BPDA 2ADUA 5ICEA 1ZREA 1I27A 1GXPA 3EYYA 4EVIA 1U6GA 5FO5A 2V9VA 5HS9A 2STTA 5DUKA 2Z99A 3GX4X 5BS6A 2D2WA 2JRTA 1I1GA 1TW3A 2Y48A 3TKYA 3BPXA 1IZ1A 2P8TA 4G6QA 2W57A 2BE5F 4IPAA 1FBSA 4G9YA 4CICA 4HQMA 4I01A 4EJTA 4CO8A 3LFKA 5BQTA 4WWCA 1ZGAA 1MJBA 3L9FA 4FHTA 4BXUA 2GXBA 2G7UA 2O0YA 5IT3A 4KMFA 1HW5A 1H9TA 2H6BA 2P5VA 2A3SA 2GZWA 3E5XA 1K6OA 2CO5A 2VC0A 2DAOA 3JAMK 1BI1A 2Z5UA 2HQNA 3WGIA 4HW0A 3I53A 2KIUA 3ZMTA 2ESHA 1R00A 2Z3YA 3WE2A 1KYZA 3KP6A 4BHCA 3IRQA 2A69F 4A12A 2G9WA 3JTGA 2FBHA 4B09A 2J5OA 3HTUA 3WU0A 3ABTA 2ETHA 3RYRA 4ZYGA 1FYLA 3QRFF 3V7CA 5HLIA 3RKYA 1T38A 3QU3A 1ZYRF 3IHUA 4RS8A 3B73A 4Y13A 5CVIA 1R1UA 1ZAOA 3HOTA 4XBFA 1L0OC 1IXCA 3TO6A 2K02A 3LQQA 1LVAA 3DQVC 1XDUA 4HX4A 4L9VA 5JR3A 1USTA 3C7JA 4LB6B 1ZG3A 3E6BA 2W84A 3PQKA 4I0BA 2A6HF 1ONVA 2M8EA 1BOAA 1JE8A 4QWQA 3FM5A 3KCCA 4H0EA 1B9MA 4LG0A 5J8FA 4G7OF 3SZPA 1MD0A 1FYKA 2A5YB 3MAJA 1RUOA 4I09A 2PQ8A 3K0LA 3ISPA 3SXYA 1ULYA 3BP8A 1IUYA 3F8BA 2BGCA 3JTHA 1HSTA 2JPCA 4P96A 3ZMSA 2AXLA 5CYVA 1LQ1A 2EWNA 1U8RA 2VBYA 5EEHA 3R4KA 4CYDA 3FM3A 4BNCA 3Q9SA 1PP7U 1SFXA 1S8NA 1XGSA 1JHFA 1ZGJA 2XAHA 3TQNA 2A68F 1G3TA 1PDNC 1LNWA 1WQ2A 1FT9A 1RNLA 4ESBA 4ZZLA 2QQAA 5DEQA 3KP3A 5BMZA 5E1WA 1BM9A 3WTWC 3MZHA 3CO6C 5LGNA 4KNYA 2DO7A 2IVMA 5ED4A 4Y17A 5LEKA 2VN2A 4UVAA 3DKWA 4S05A 4ENNA 3CUOA 1MDMB 2LKPA 4Z2YA 3LWFA 4MEYF 3REOA 1PUEE 3KEOA 3RI4A 3O3KA 2XAQA 1SFEA 1KU7A 1HW2A 2HWVA 1BN5A 3O6BB 5HVQC 5LGUA 1D5VA 3QPTA 3SHFA 3D0SA 1Z7UA 3KE2A 2ZCWA 4KA4A 4HAMA 2WV0A 2XKOA 3WTZA 5LGTA 2MH2A 3HRUA 2ZNYA 4FX4A 1FOKA 2F5FA 2HYFA 1Z9CA 2X4HA 4ENKA 1Z6RA 3MEXA 3RKWA 4ZYDA 2KJBA 1V4RA 1T2KA 1F5TA 4LGWA 3V8LA 1HKTA 1SAXA 2HKXA 2EA4A 1SMYF 3M8EA 3F72A 3GO5A 3I0TA 1IN5A 4MGRA 1TW2A 3E6DA 3Q9VA 1KGSA 4RGXA 2E7WA 2LF8A 5ICCA 4EMSA 2PLYA 4BH9A 3MZYA 5ICFA 2VOOA 4LJZF 5DYMA 1KYWA 1ZH5A 5DCFA 4M9SA 2Q2EA 4ASNA 2XROA 3K1PA 3L00A 2PMUA 3BWGA 4XRFA 1EV7A 2RC4A 1FBUA 4HF2A 1BC8C 4EGYA 2IA1A 1EH6A 2EFPA 2GA1A 1FPQA 4OU0A 1SD5A 4I0AA 4K2EA 1DPUA 3R0JA 4PGGA 2QQBA 3ZN0A 3RDIA 1B1BA 4G7HF 3WTUC 2EJRA 3T0YA 1G3SA 3K1NA 2RKHA 3K2ZA 3CUQB 3TO7A 4N0BA 1SD4A 3I59A 3CDHA 1OYIA 5AIPA 4PZJA 5K5QA 1YIOA 1D8KA 3T5XA 4AIHA 4G7ZF 3BDDA 3I64A 1AWCA 2QBYA 3RPUA 5ERIA 2IA2A 4LK0F 2WWYA 1W7PB 1O57A 3P7NA 4EQQA 1MJAA 3GYHX 2BEOA 4OMZA 1XSXA 3V8JA 2VE8A 3V7SA 3K1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QAH A;  2OQR A;  3E3V A;  1SMT A;  1NHA A;  1QBJ A;  2M5W A;  5FGM A;  2YR2 A;  3WTX C;  2P6S A;  2EB7 A;  2LDU A;  2QM3 A;  2HFH A;  3VOE A;  2YU3 A;  5L3F A;  4WK8 F;  1F4K A;  2LF7 A;  3BPV A;  1J7K A;  5J8C A;  3F22 A;  3SFZ A;  5DCM B;  1LDD A;  1S7O A;  2O03 A;  4HX8 A;  3EET A;  5IT9 K;  4A6D A;  3WTY C;  3ZMD A;  3FXQ A;  2NS0 A;  4ENJ A;  3ECH A;  2W24 A;  4ON0 A;  4A0X A;  4IRH A;  1HKS A;  3GUD A;  1KQ0 A;  3U9G A;  5F1R A;  1R1T A;  4HDV A;  4BHB A;  2OAZ A;  4MTD A;  1FNN A;  3HTS B;  5D4S A;  1UFM A;  2PBI A;  2XKP A;  4IHT A;  4CDG A;  2FXA A;  2A61 A;  5BOX A;  1WRJ A;  3JAM Z;  4WF2 A;  4RB2 C;  3J81 K;  2CGP A;  2BV6 A;  4GGG A;  2R7D A;  2YX4 A;  1W5T A;  2ACJ A;  1OYW A;  4A5N A;  2VE9 A;  4EV0 A;  3ERE D;  2L4M A;  3QP6 A;  5CLS A;  2EFW A;  1B9N A;  1S7A A;  3IKT A;  3E5U A;  4XLP F;  1BIB A;  3H92 A;  3EDP A;  4Y15 A;  3LST A;  5D5V B;  1S3J A;  4KIC A;  2RN7 A;  2W25 A;  4WXH A;  2COM A;  1K78 B;  3C3W A;  5D6E A;  1OMI A;  4MTE A;  4N9H A;  4A0Y A;  4M6Y A;  1OR7 A;  2VT3 A;  5FFZ A;  2J5P A;  3VFZ A;  4WXC A;  1C0W A;  4ZYE A;  2FRH A;  2AS5 F;  2VBX A;  3K69 A;  2Q8K A;  4MQ9 F;  1JGS A;  2F5C A;  3LAJ A;  2L02 A;  2DTR A;  3ZN1 A;  1MGT A;  4QLC U;  1U5T B;  4EM2 A;  4AIJ A;  4L18 B;  2JZY A;  2V1D A;  2FBK A;  3LAP A;  4EM1 A;  1TNT A;  3J7A O;  3DFG A;  1FYM A;  4HYE A;  3D5L A;  3SZT A;  4AWX B;  4PDK A;  4LMY A;  3HSE A;  2G7H A;  4YG2 F;  3HRM A;  3MCZ A;  4O3M A;  2EFQ A;  3M1E A;  3MFK A;  3GWZ A;  2EV0 A;  2K4B A;  2P7V B;  1IAW A;  2KRF A;  3FWE A;  1PP8 F;  1K78 A;  3GZ5 A;  3F8F A;  3VEP A;  1KQ9 A;  4NHJ A;  1ZAR A;  2JT1 A;  1YTY A;  2MH9 A;  4KFC A;  2ZXJ A;  2V1U A;  1WKM A;  1ZLJ A;  4KN4 X;  3V4G A;  5LHH A;  3IRR A;  2E7X A;  4L5J A;  4HV6 A;  2XHK A;  1J9I A;  5E8G A;  2A07 F;  1ON2 A;  1IXR C;  2VON A;  1YYV A;  2WC2 A;  4YFK F;  1DDN A;  1UHW A;  5K5R A;  1WWX A;  2DW4 A;  3F23 A;  3DPL C;  3TDU C;  4EGZ A;  2QLZ A;  1FWZ A;  1P4X A;  1P4W A;  3BRO A;  3TO9 A;  1Z05 A;  4ESJ A;  3MWM A;  1RIO H;  2ZME B;  1FY7 A;  2HTJ A;  4HOB A;  4KT5 C;  4HF0 A;  2EA2 A;  1YQA A;  1LB2 A;  1XCB A;  3L2C A;  2ISZ A;  1F9N A;  2NNN A;  3F6V A;  2L54 A;  1FP1 D;  1VTN C;  1GHC A;  2OQG A;  4ZZD A;  4EJW A;  1QZY A;  2DPU A;  1AOY A;  1H9G A;  4IHS A;  1LDJ A;  2YX7 A;  3E6M A;  2KIM A;  1YW9 A;  2MBF A;  2E1C A;  1SD7 A;  5DV5 A;  5CVV A;  1TQP A;  3H3Z A;  3O2P E;  2FNP A;  5HDG A;  1D3Y A;  4ENM A;  2Y0M A;  2IA0 A;  1W7P D;  1B6A A;  4OIO F;  2FA5 A;  2K86 A;  2P4W A;  3DP7 A;  4N9I A;  1KA8 A;  2W85 A;  3ABU A;  1UB9 A;  1XCV A;  1XB4 A;  1QGP A;  5L3C A;  1RZ4 A;  2RGV A;  5KK1 A;  3N4M A;  5F64 A;  2PEX A;  4AIK A;  5AIQ A;  5AON A;  2ESN A;  1I6X A;  2Q0O A;  4S04 A;  3R0A A;  4D0P A;  2GXG A;  2TDX A;  1STZ A;  4LFU A;  3M9A A;  1EH8 A;  3IWF A;  2DLL A;  5LEJ A;  4MQV A;  2ZKZ A;  3M8F A;  4RGS A;  1O7F A;  1XGN A;  3WGH A;  3WTV C;  4BYY A;  2KIF A;  3GZ6 A;  2DK8 A;  4L9N A;  3GF2 A;  4U0W A;  2STW A;  1KU2 A;  3RYP A;  1S6L A;  1XN7 A;  1G3W A;  5H6R A;  2MLG A;  5ILV A;  1BI0 A;  3DEU A;  2XAS A;  2HKO A;  2EK5 A;  1XSD A;  3T8T A;  4A5M A;  4WX9 A;  4LLN A;  1TQI A;  5A2Q K;  1R36 A;  3HSF A;  4AD9 A;  3HRT A;  2FML A;  2CFX A;  3CUQ C;  4HA8 A;  1W4M A;  4A2U A;  3RJP A;  2CWE A;  5HDN A;  1USS A;  5E20 A;  5ICG A;  1J0R A;  2QUF A;  3I58 A;  1UHM A;  3S2W A;  2IPQ X;  5D6F A;  1E17 A;  5D4R A;  1ON1 A;  4I98 B;  1F1Z A;  2F5E A;  1QZZ A;  2HOE A;  4CHU A;  1ZLK A;  4KIG A;  2VOP A;  2RVC A;  1P6R A;  2JPB A;  4HLY A;  4NB5 A;  2BYV E;  1ZG5 A;  4RGU A;  3PFI A;  4HDU A;  1MDM A;  3J80 K;  4ETS A;  4YFN F;  2XAF A;  2GWR A;  2QQ9 A;  5ILU A;  1YS7 A;  1IF1 A;  3F3X A;  4PCQ A;  1L3L A;  3GW2 A;  3F8C A;  3KP2 A;  2MD5 A;  2DBB A;  1EH7 A;  4RGR A;  4GYI A;  2M45 A;  4Q48 A;  2KJC A;  2YPR A;  3KLO A;  4ZYH A;  3R61 A;  1B4A A;  4UXN A;  2HZT A;  4R79 A;  3ROU A;  2QZ8 A;  3V7R A;  3E97 A;  2EFN A;  2EFO A;  4IRI A;  1QQI A;  2MA3 A;  1K7A A;  5IT9 Z;  3E6C C;  2XGX A;  2VXZ A;  2CSO A;  3QU6 A;  3I5U A;  1P2F A;  2IT0 A;  1WI9 A;  4IVN A;  4O6J A;  2HDC A;  3FHZ A;  3Q5F A;  3TOA A;  1H0M A;  2IW5 A;  3GFL A;  2H94 A;  1U3E M;  3JW4 A;  3KP4 A;  1FZP B;  3U1D A;  5E1Z B;  3R60 A;  3KLN A;  1RI7 A;  4PGH A;  4BHP A;  1FX7 A;  3J81 Z;  2ZBK A;  5LRR A;  2M87 A;  2ZO4 A;  1B59 A;  2X0L A;  5H6Q A;  1O3S A;  5K1Y A;  3AAF A;  2PFB A;  4KYW A;  3GFJ A;  5LBQ A;  2F2E A;  1BJA A;  2FNA A;  1TTY A;  1I5Z A;  1IRF A;  5E18 F;  5E8I A;  2XAG A;  4M9Z A;  2O6G E;  4R1H A;  3ELK A;  5K5O A;  4F7Z A;  5CJ9 A;  3CJN A;  1ZRC A;  5TRD A;  5J6X A;  4RB3 C;  3KP5 A;  1DPR A;  2ZNZ A;  1WSU A;  3CUQ A;  3LQR A;  1TNS A;  1O3R A;  1IN8 A;  1I1S A;  4U7B A;  1LEA A;  4CZZ A;  2PN6 A;  3ECO A;  1TQM A;  1U5T C;  1X3U A;  4Q4Z F;  4XSZ F;  4MEX F;  4HLX A;  3DF8 A;  3VB2 A;  1V3F A;  4OIR F;  1BI2 A;  3GXO A;  1HSJ A;  4UHT A;  3I71 A;  1R58 A;  1W7P A;  2D1V A;  3CO7 C;  3TGN A;  2PMH A;  5HS7 A;  4TV7 A;  4L5I A;  5HS8 A;  2B0L A;  2NAZ A;  4IJA A;  1Y0U A;  2VOD A;  4ZH4 F;  1BIA A;  2C6Y A;  1KQ8 A;  3DV8 A;  3QOP A;  3I54 A;  3WTS C;  1OKR A;  1HBX G;  2R3S A;  2EV6 A;  2MLK A;  1U2W A;  2JSC A;  3WOD F;  5DCM A;  5BPI A;  2FSW A;  2QWW A;  3QP5 A;  5FFX A;  2UXX A;  3RKX A;  1GVJ A;  4G8X A;  4YFX F;  1YW8 A;  5DUI A;  4ESF A;  3DPT A;  2XIG A;  4KN7 X;  2O8X A;  2XVC A;  3ZP5 A;  3B02 A;  5E1X A;  4JQF A;  4XSX F;  2WTE A;  4JK1 X;  5JHU A;  3M7G A;  4KIB A;  3SQN A;  4WCG A;  3IKV A;  1XMK A;  4HQE A;  4KDP A;  2HEO A;  3LA3 A;  3LA2 A;  5D8L B;  4OIP F;  4BQA A;  2HGC A;  1ZHF A;  2OBP A;  3FF5 A;  3EYI A;  4I2O A;  1UCR A;  5H20 A;  3F8M A;  3KZY A;  2XV4 S;  1J2X A;  2H09 A;  3EUH A;  3COA C;  3QPH A;  3FXR A;  1T0F A;  1QPM A;  4HBL A;  3HSR A;  4BAY A;  4G94 A;  4XLN F;  5LHG A;  4LLL A;  3U2R A;  2QVO A;  3FMR A;  3W6J B;  1FLI A;  2ELH A;  2VBW A;  5L3B A;  3BZ6 A;  2Y75 A;  2OZU A;  3G73 A;  2H27 A;  4KIF A;  3FMS A;  4M74 A;  1MZB A;  1XGM A;  2D45 A;  3C1D A;  1W5S A;  3NRV A;  3ULQ B;  2FOK A;  4LG0 B;  4CXF A;  1ZRD A;  4A6E A;  2D1H A;  1TBX A;  2K7L A;  1IRG A;  1DUX C;  3JSO A;  1YW7 A;  1SD6 A;  5D5X B;  2FU4 A;  2Z9O A;  2FQ3 A;  2RQP A;  2PI0 A;  1U5T A;  1T6S A;  3HHH A;  3WU1 B;  3FZV A;  4HZF A;  1K79 A;  1BI3 A;  4UVC A;  3L09 A;  3MQ0 A;  5FLX K;  4MNU A;  1Z6T A;  4AVP A;  2MC3 A;  5CVJ A;  4UV8 A;  2R7F A;  1ZN2 A;  4WXD A;  1JHH A;  2VBZ A;  1HKQ A;  3TDZ C;  3VOD A;  2V6C A;  3K9T A;  1IXS B;  4LK1 F;  5A2Q Z;  1YO5 C;  3PQJ A;  2ISY A;  1IN6 A;  4B8X A;  3BJ6 A;  5D5U B;  5HLG A;  3GVA A;  4M72 A;  3G3Z A;  3GFM A;  2P5K A;  3ZQ7 A;  2PG4 A;  4U7D A;  4RB1 A;  4NQW A;  5F6F A;  3CTA A;  2L3D A;  2LSO A;  3FXU A;  1ZRF A;  3J80 Z;  1Q1H A;  4DNC A;  3W6K B;  1LJ9 A;  1FSH A;  3ZMZ A;  4OOI A;  3T8R A;  2RNJ A;  2PJP A;  4UVB A;  2FBI A;  2K27 A;  3NEU A;  2ZME A;  2RV8 A;  3HOS A;  1O3Q A;  5DD4 A;  3WG9 A;  1DP7 P;  4HF1 A;  2HYG D;  3P9I A;  4LLG F;  4Q47 A;  2LNB A;  4I7H A;  1TLH B;  5D5W B;  1J5Y A;  4L0Z B;  1XSV A;  2DPD A;  2CYY A;  5E17 F;  3V8K A;  5DDG A;  4IF4 A;  3TOB A;  1P92 A;  4HX7 A;  4U88 A;  2QYO A;  4O5V A;  3IC7 A;  1YS6 A;  2CW0 F;  4L9T A;  1CGP A;  3GLX A;  4EJU A;  1HQC A;  2VT2 A;  1CF7 B;  2GIV A;  5LLQ A;  3ZMV A;  1JXS A;  1FSE A;  2L01 A;  4JBA A;  1G6N A;  2OU2 A;  4OIN F;  5L3G A;  3DXJ F;  2HTS A;  5D8K B;  2DT5 A;  2M1B A;  4P9F A;  4DQ2 A;  3F6O A;  2IRF G;  3OOP A;  1A04 A;  2DU9 A;  5JI6 A;  4U0Y A;  3KEQ A;  3N97 A;  4UV9 A;  5FD6 A;  1P4A A;  3HHG A;  1BC7 C;  2XUB A;  3RPQ A;  4M6X A;  4IXA A;  2FMY A;  2UWM A;  1SFU A;  2UZK A;  3R6S A;  1MKM A;  2UXN A;  2YSR A;  1IN7 A;  1IW7 F;  1R23 A;  2NYX A;  1G4D A;  4GYG A;  3T1B A;  4M73 A;  2EV5 A;  3HYI A;  4P5O A;  3RIR A;  3F21 A;  1J59 A;  5HDK A;  1CF7 A;  5TJJ A;  3EQL F;  4LD5 A;  2DK5 A;  4M71 A;  4RB0 A;  3HUG A;  6PAX A;  2NRA C;  3BJA A;  1O7L A;  1XDS A;  2XAJ A;  5LRS A;  4RAY A;  2FE3 A;  3OV8 A;  2V1X A;  2IP2 A;  3I59 B;  4MHG A;  4KMU X;  3P9K A;  2ZJ2 A;  4P9U A;  4L0Y B;  1MJ9 A;  4HV5 A;  3IWZ A;  2E1N A;  5L3D A;  3P9C A;  1G3Y A;  5JVT A;  2QBY B;  4U0V A;  5FB2 A;  2V79 A;  2O3F A;  1R7J A;  3C18 A;  4P55 A;  3WE3 A;  4FT8 A;  2ZFW A;  2GAU A;  2HQR A;  1KU9 A;  1T98 A;  3ZPL A;  4R8H A;  2P6T A;  3HIF A;  1BBY A;  1ZG1 A;  4OMY A;  2CQK A;  3FX3 A;  4YII A;  2OD5 A;  3WGG A;  4Q5S F;  1OPC A;  1KU3 A;  3HRS A;  1S29 A;  3I4P A;  3WTT C;  1QO0 D;  2FEZ A;  2NNY A;  2RDP A;  1LEB A;  2M30 A;  3H3U A;  2DQL A;  1FC3 A;  2QEN A;  5FD5 A;  1HW1 A;  4GXO A;  3ZMU A;  2DI3 A;  3KET A;  2VC1 A;  3KFW X;  4IRG A;  5CVR A;  1IN4 A;  4E70 A;  4EJO A;  1R5H A;  1GXQ A;  3CLO A;  5CVU A;  1FP2 A;  4L9J A;  1YG2 A;  3NQO A;  1Z1D A;  2BBY A;  2CG4 A;  3BOQ A;  1U78 A;  2P7C B;  2P5L C;  1R5G A;  2F5D A;  2HR3 A;  4UNO A;  2FF4 A;  1D8J A;  3BY6 A;  3LA7 A;  4I02 A;  3KP7 A;  1XMA A;  3L7W A;  3FMQ A;  1LDK B;  2DFI A;  5JFR A;  4GO1 A;  5ILS A;  3JSP A;  4YIF A;  1J75 A;  4RAZ A;  1O3T A;  5HLH A;  2JTV A;  4FX0 A;  4CGZ A;  1XD7 A;  2A6E F;  1YLF A;  1XGO A;  3GFI A;  3E5Q A;  3IL2 A;  2O61 A;  1HXD A;  2GQQ A;  2DQR A;  3F8N A;  2XRN A;  5L3E A;  2K4J A;  4EJV A;  4KUM A;  4OIQ F;  3GEZ A;  5DD8 A;  2Z33 A;  1QNT A;  1R22 A;  4UUV A;  2OA4 A;  4G6D A;  1Z91 A;  4A0Z A;  1REP C;  2H6C A;  5LHI A;  2OZ6 A;  1R1V A;  5KVR A;  5HOO A;  4EM0 B;  3RTR A;  1ODD A;  3ML6 A;  4GCV A;  2L4A A;  1RUN A;  4M9X A;  3KZZ A;  1FBQ A;  1T39 A;  4LB5 A;  1OYY A;  1E2X A;  2IJL A;  2GA2 A;  3BJO A;  2KKO A;  5EEG A;  5FLX Z;  2HS5 A;  1YFH A;  5BPD A;  2ADU A;  5ICE A;  1ZRE A;  1I27 A;  1GXP A;  3EYY A;  4EVI A;  1U6G A;  5FO5 A;  2V9V A;  5HS9 A;  2STT A;  5DUK A;  2Z99 A;  3GX4 X;  5BS6 A;  2D2W A;  2JRT A;  1I1G A;  1TW3 A;  2Y48 A;  3TKY A;  3BPX A;  1IZ1 A;  2P8T A;  4G6Q A;  2W57 A;  2BE5 F;  4IPA A;  1FBS A;  4G9Y A;  4CIC A;  4HQM A;  4I01 A;  4EJT A;  4CO8 A;  3LFK A;  5BQT A;  4WWC A;  1ZGA A;  1MJB A;  3L9F A;  4FHT A;  4BXU A;  2GXB A;  2G7U A;  2O0Y A;  5IT3 A;  4KMF A;  1HW5 A;  1H9T A;  2H6B A;  2P5V A;  2A3S A;  2GZW A;  3E5X A;  1K6O A;  2CO5 A;  2VC0 A;  2DAO A;  3JAM K;  1BI1 A;  2Z5U A;  2HQN A;  3WGI A;  4HW0 A;  3I53 A;  2KIU A;  3ZMT A;  2ESH A;  1R00 A;  2Z3Y A;  3WE2 A;  1KYZ A;  3KP6 A;  4BHC A;  3IRQ A;  2A69 F;  4A12 A;  2G9W A;  3JTG A;  2FBH A;  4B09 A;  2J5O A;  3HTU A;  3WU0 A;  3ABT A;  2ETH A;  3RYR A;  4ZYG A;  1FYL A;  3QRF F;  3V7C A;  5HLI A;  3RKY A;  1T38 A;  3QU3 A;  1ZYR F;  3IHU A;  4RS8 A;  3B73 A;  4Y13 A;  5CVI A;  1R1U A;  1ZAO A;  3HOT A;  4XBF A;  1L0O C;  1IXC A;  3TO6 A;  2K02 A;  3LQQ A;  1LVA A;  3DQV C;  1XDU A;  4HX4 A;  4L9V A;  5JR3 A;  1UST A;  3C7J A;  4LB6 B;  1ZG3 A;  3E6B A;  2W84 A;  3PQK A;  4I0B A;  2A6H F;  1ONV A;  2M8E A;  1BOA A;  1JE8 A;  4QWQ A;  3FM5 A;  3KCC A;  4H0E A;  1B9M A;  4LG0 A;  5J8F A;  4G7O F;  3SZP A;  1MD0 A;  1FYK A;  2A5Y B;  3MAJ A;  1RUO A;  4I09 A;  2PQ8 A;  3K0L A;  3ISP A;  3SXY A;  1ULY A;  3BP8 A;  1IUY A;  3F8B A;  2BGC A;  3JTH A;  1HST A;  2JPC A;  4P96 A;  3ZMS A;  2AXL A;  5CYV A;  1LQ1 A;  2EWN A;  1U8R A;  2VBY A;  5EEH A;  3R4K A;  4CYD A;  3FM3 A;  4BNC A;  3Q9S A;  1PP7 U;  1SFX A;  1S8N A;  1XGS A;  1JHF A;  1ZGJ A;  2XAH A;  3TQN A;  2A68 F;  1G3T A;  1PDN C;  1LNW A;  1WQ2 A;  1FT9 A;  1RNL A;  4ESB A;  4ZZL A;  2QQA A;  5DEQ A;  3KP3 A;  5BMZ A;  5E1W A;  1BM9 A;  3WTW C;  3MZH A;  3CO6 C;  5LGN A;  4KNY A;  2DO7 A;  2IVM A;  5ED4 A;  4Y17 A;  5LEK A;  2VN2 A;  4UVA A;  3DKW A;  4S05 A;  4ENN A;  3CUO A;  1MDM B;  2LKP A;  4Z2Y A;  3LWF A;  4MEY F;  3REO A;  1PUE E;  3KEO A;  3RI4 A;  3O3K A;  2XAQ A;  1SFE A;  1KU7 A;  1HW2 A;  2HWV A;  1BN5 A;  3O6B B;  5HVQ C;  5LGU A;  1D5V A;  3QPT A;  3SHF A;  3D0S A;  1Z7U A;  3KE2 A;  2ZCW A;  4KA4 A;  4HAM A;  2WV0 A;  2XKO A;  3WTZ A;  5LGT A;  2MH2 A;  3HRU A;  2ZNY A;  4FX4 A;  1FOK A;  2F5F A;  2HYF A;  1Z9C A;  2X4H A;  4ENK A;  1Z6R A;  3MEX A;  3RKW A;  4ZYD A;  2KJB A;  1V4R A;  1T2K A;  1F5T A;  4LGW A;  3V8L A;  1HKT A;  1SAX A;  2HKX A;  2EA4 A;  1SMY F;  3M8E A;  3F72 A;  3GO5 A;  3I0T A;  1IN5 A;  4MGR A;  1TW2 A;  3E6D A;  3Q9V A;  1KGS A;  4RGX A;  2E7W A;  2LF8 A;  5ICC A;  4EMS A;  2PLY A;  4BH9 A;  3MZY A;  5ICF A;  2VOO A;  4LJZ F;  5DYM A;  1KYW A;  1ZH5 A;  5DCF A;  4M9S A;  2Q2E A;  4ASN A;  2XRO A;  3K1P A;  3L00 A;  2PMU A;  3BWG A;  4XRF A;  1EV7 A;  2RC4 A;  1FBU A;  4HF2 A;  1BC8 C;  4EGY A;  2IA1 A;  1EH6 A;  2EFP A;  2GA1 A;  1FPQ A;  4OU0 A;  1SD5 A;  4I0A A;  4K2E A;  1DPU A;  3R0J A;  4PGG A;  2QQB A;  3ZN0 A;  3RDI A;  1B1B A;  4G7H F;  3WTU C;  2EJR A;  3T0Y A;  1G3S A;  3K1N A;  2RKH A;  3K2Z A;  3CUQ B;  3TO7 A;  4N0B A;  1SD4 A;  3I59 A;  3CDH A;  1OYI A;  5AIP A;  4PZJ A;  5K5Q A;  1YIO A;  1D8K A;  3T5X A;  4AIH A;  4G7Z F;  3BDD A;  3I64 A;  1AWC A;  2QBY A;  3RPU A;  5ERI A;  2IA2 A;  4LK0 F;  2WWY A;  1W7P B;  1O57 A;  3P7N A;  4EQQ A;  1MJA A;  3GYH X;  2BEO A;  4OMZ A;  1XSX A;  3V8J A;  2VE8 A;  3V7S A;  3K1M A; 
#chains in the Genus database with same CATH topology
 3QAH A;  2IGN A;  1K6Y A;  2OQR A;  3E3V A;  1SMT A;  2VUM J;  2MFZ A;  3G2B A;  1NHA A;  1QBJ A;  1T08 B;  3GTM J;  2M5W A;  3OYC A;  3CLQ A;  4C30 A;  3W2A A;  1V5E A;  2FX0 A;  5FGM A;  2YR2 A;  4CUG A;  2W48 A;  2P6S A;  3WTX C;  2EB7 A;  2LDU A;  4IHY A;  1IV6 A;  1Z0X A;  5B1B H;  1VND A;  2QM3 A;  3LSM A;  2HFH A;  2L9R A;  3VOE A;  2YU3 A;  5L3F A;  3VDX A;  4ZDO A;  1X2M A;  2OUM A;  4WK8 F;  1F4K A;  2LF7 A;  3BPV A;  5CKT A;  1J7K A;  5J8C A;  3F22 A;  3SFZ A;  1QA6 A;  5DCM B;  1LDD A;  1S7O A;  2O03 A;  4HX8 A;  4BEH B;  3EET A;  2CW7 A;  4C3J J;  5IT9 K;  4A6D A;  3WTY C;  3ZMD A;  3FXQ A;  2NS0 A;  1R9T J;  2QF7 A;  4YRV A;  3CP2 A;  4D7M A;  1W36 C;  1JT6 A;  4ENJ A;  3ECH A;  2OC6 A;  4AVZ A;  2W24 A;  2VKV A;  4ON0 A;  4A0X A;  4IRH A;  1HKS A;  4II2 A;  3L2Q A;  3AKZ A;  3FXO A;  4E7J A;  3GUD A;  1KQ0 A;  3U9G A;  3SEQ A;  2ECC A;  5F1R A;  1R1T A;  4G12 A;  4HDV A;  1E3H A;  4BHB A;  2M0M A;  4BAC A;  2OAZ A;  1KZH A;  3S1N J;  3FIS A;  2IAI A;  5J4Y A;  2B9S A;  3G1L A;  3A1Y A;  2LR8 A;  3K4K A;  4MTD A;  3HOZ J;  1FNN A;  3OYG A;  3HTS B;  3K4B A;  5D4S A;  1UFM A;  2OCE A;  2PBI A;  3H0G J;  2XKP A;  4IHT A;  1P9Q C;  3S17 J;  3I55 I;  2KP6 A;  4CDG A;  2VQL A;  3FDY A;  2FXA A;  2A61 A;  5BOX A;  1WRJ A;  3JAM Z;  3ERM A;  4WF2 A;  3JRI A;  3H3V K;  4RB2 C;  3J81 K;  4PFO A;  3ONQ A;  2CGP A;  2BV6 A;  2A5W A;  4GGG A;  1YIT I;  2R7D A;  2YX4 A;  5IOY A;  1W5T A;  1BJZ A;  2VKH A;  2ACJ A;  4B43 A;  1OYW A;  4A5N A;  1I3Q J;  3CF2 A;  2BY3 A;  2VE9 A;  1JTX A;  4A3M J;  4EV0 A;  3ERE D;  2MW8 A;  2KL4 A;  3HJE A;  1T8I A;  2L4M A;  4NBQ A;  3QP6 A;  5J1U A;  5CLS A;  2EFW A;  1B9N A;  1S7A A;  3PUB A;  3V42 A;  3IKT A;  3E5U A;  3A03 A;  4XLP F;  1FMV A;  4XID A;  3KYD B;  3OYH A;  3FBI B;  1BIB A;  4E7I A;  1H89 C;  2EZK A;  2R0Q C;  4M3D A;  3KYC B;  5C4X J;  3RSN A;  3H92 A;  3EDP A;  3SDG A;  1I39 A;  4Y15 A;  3LST A;  1FOY A;  3CDI A;  5J1R A;  5D5V B;  1YX3 A;  1S3J A;  4KIC A;  2QKL B;  4I76 A;  2RN7 A;  1MIJ A;  2KIQ A;  1N77 A;  3ZOB A;  2DDA A;  2W25 A;  4JYK A;  4WXH A;  1VFC A;  2EH3 A;  2VQC A;  2COM A;  1K78 B;  4F52 A;  3C3W A;  5D6E A;  1OMI A;  4MTE A;  4XRS G;  4N9H A;  4A0Y A;  3LMM A;  4M6Y A;  3FKJ A;  2DCE A;  1OR7 A;  1A6Q A;  2VT3 A;  4F55 A;  5FFZ A;  1X3W B;  1VQ8 I;  4M6V A;  2J5P A;  2ID6 A;  4WXC A;  3VFZ A;  3SDB A;  1C0W A;  4ZYE A;  2FRH A;  2AS5 F;  2VBX A;  3K69 A;  2Q8K A;  5CPR B;  5GAD J;  1QVT A;  4ZC3 A;  4MQ9 F;  2YU9 J;  3DKY A;  1JGS A;  2F5C A;  3LAJ A;  3GBG A;  4G6T B;  4CCN A;  2L02 A;  1B8I A;  2DTR A;  3TBI A;  3ZN1 A;  1ORK A;  1MGT A;  4XOR A;  4YEJ A;  3S8P A;  4QLC U;  1SVO A;  5FLM J;  2CUE A;  1U5T B;  2X6W A;  3BC8 A;  2B7E A;  4EM2 A;  1MH4 A;  4BUP A;  3LSH A;  4AIJ A;  3GZN B;  3PFY A;  4L18 B;  2JZY A;  2V1D A;  2FBK A;  1VQ6 I;  2MSY A;  3LAP A;  4EM1 A;  1TNT A;  2XGC A;  3J7A O;  2RNG A;  3DFG A;  1FYM A;  4HYE A;  3D5L A;  5F04 A;  3SZT A;  3VYR B;  4L5E A;  4AWX B;  4PDK A;  4DZP A;  4LMY A;  5FJ8 J;  1MMG A;  3HSE A;  3LSP A;  2G7H A;  4YG2 F;  3HRM A;  3MCZ A;  4O3M A;  2EFQ A;  3ZXS A;  3DTE A;  3M1E A;  3GWZ A;  3MFK A;  2EV0 A;  2K4B A;  2WBM A;  4C3H J;  2P7V B;  4CH7 A;  2KRF A;  1IAW A;  4NC6 A;  2HXO A;  3FWE A;  1PP8 F;  3S2H J;  4RM2 A;  3QPS A;  3OY9 A;  2DFF A;  1K78 A;  1OCC H;  2CH0 A;  1EJ9 A;  2M34 A;  3GZ5 A;  3F8F A;  3HXL A;  5FRM A;  2JUC A;  3HOY J;  4ZDP A;  3VEP A;  1KQ9 A;  4NHJ A;  1ZAR A;  2JT1 A;  3OL3 A;  3TP3 A;  2F48 A;  1X1D A;  2MH9 A;  3BT9 A;  1YTY A;  1O4X A;  4KFC A;  2ZXJ A;  2KQR A;  1U8B A;  2V1U A;  1WKM A;  1ZLJ A;  4KN4 X;  3V4G A;  5LHH A;  3IRR A;  2DMT A;  4IQ4 A;  5F08 A;  2E1M B;  2E7X A;  2XDV A;  3TW6 A;  1VQ4 I;  1MH3 A;  1Y56 A;  2HPI A;  4L5J A;  4HV6 A;  2CUZ A;  1A6I A;  4Y4R A;  2XHK A;  4XIC A;  1J9I A;  2BVL A;  2ZXH A;  3JCU C;  5E8G A;  2E2J J;  2A07 F;  1ON2 A;  3BQY A;  1IXR C;  2HDW A;  2VON A;  1YYV A;  3K70 C;  2WC2 A;  2XAU A;  4YFK F;  5IY5 H;  5M3F J;  4NQW B;  1DDN A;  5GAE J;  4XK4 A;  1ERD A;  3OIQ A;  5DTD A;  1SFK A;  5GTI C;  1OIS A;  1UHW A;  5LFA A;  3W3C A;  5K5R A;  2OF7 A;  1WWX A;  2DW4 A;  5JVG F;  3F23 A;  3DPL C;  3TDU C;  4EGZ A;  2K3P A;  3PNY A;  2QLZ A;  5B3S H;  2L9S A;  4HRI A;  4QPO A;  1FWZ A;  1P4X A;  5K7F A;  2V1N A;  3LOC A;  3I9V 2;  1P4W A;  3BRO A;  3QPL A;  3FK7 A;  2M7B A;  3TO9 A;  1Z05 A;  4ESJ A;  3MWM A;  1RIO H;  1MSF C;  2ZME B;  1FY7 A;  2HTJ A;  2G0E A;  4HOB A;  4KT5 C;  2VI6 A;  4HF0 A;  4Y52 J;  4RLQ A;  2EA2 A;  4B47 A;  1YQA A;  1LB2 A;  1DP3 A;  1VQ9 I;  4XLF A;  1XCB A;  3EUA A;  3ZQG A;  1NK2 P;  5EZG A;  3L2C A;  2ISZ A;  2GOX B;  1JKR C;  4ZTF A;  4IHV A;  1F9N A;  4IHW A;  2JVH A;  2NNN A;  3F6V A;  2L54 A;  2EIM H;  1FP1 D;  1VTN C;  1GHC A;  2OQG A;  2LLK A;  4ZZD A;  4EJW A;  4RMN A;  1QZY A;  2DPU A;  4EEF G;  1AOY A;  3S3M A;  4RAG A;  1NK3 P;  1H9G A;  2HPM A;  2CJJ A;  3FHN A;  4P1W A;  3G1M A;  4IHS A;  1LDJ A;  2LC2 A;  1Y8R B;  2YX7 A;  3E6M A;  3G71 I;  1Y8Q B;  2OCC H;  3DEW A;  2KIM A;  1YW9 A;  3PO2 J;  2MBF A;  2DT6 A;  2E1C A;  4JX5 A;  1SD7 A;  2ZJP F;  1ZQ3 P;  5DV5 A;  1SAN A;  2ZFU A;  5CVV A;  1JGG A;  1TQP A;  3H3Z A;  3LSK A;  3O2P E;  3J7A Y;  2FNP A;  5HDG A;  2LBF B;  5EF6 A;  1D3Y A;  4X6A J;  2X48 A;  4BQQ A;  4ENM A;  2Y0M A;  2IS4 A;  4XNF A;  2IA0 A;  1W7P D;  1B6A A;  4OIO F;  2FA5 A;  2K86 A;  2P4W A;  1D0Z A;  3DP7 A;  4N9I A;  1KA8 A;  2W85 A;  4LOC A;  4NC8 A;  3ABU A;  1UB9 A;  1XCV A;  3ZQH A;  3BR0 A;  1XB4 A;  2CQQ A;  1QGP A;  5L3C A;  1RZ4 A;  2RGV A;  5KK1 A;  3H0D A;  3N4M A;  4RDU A;  3H35 A;  5F64 A;  2L7F P;  2PEX A;  4AIK A;  5AIQ A;  5AON A;  2WAQ A;  2ZXW H;  3RKQ A;  2ESN A;  1I6X A;  2NVT J;  4IOA F;  2PX9 A;  2Q0O A;  4HNU A;  4S04 A;  3R0A A;  4D0P A;  2GXG A;  2TDX A;  1IJW C;  2KMU A;  1STZ A;  4CA0 A;  4LFU A;  3M9A A;  3TED A;  1EH8 A;  1WH5 A;  3IWF A;  2DLL A;  5LEJ A;  4MQV A;  2ZKZ A;  3W2V A;  3DBH B;  3M8F A;  2H1K A;  4RGS A;  3OYA A;  5IOZ A;  2IXS A;  3BR6 A;  1O7F A;  1XGN A;  2LK2 A;  3WGH A;  2AXT C;  3WTV C;  2MD0 A;  3F9K A;  1X2N A;  2DA3 A;  2KIF A;  4BYY A;  1K4T A;  3GZ6 A;  2DK8 A;  2R7W A;  4DGW B;  4L9N A;  3K4N A;  2Z16 A;  3GF2 A;  2BZT A;  4U0W A;  3HEF A;  4A3J J;  2STW A;  1KU2 A;  2R92 J;  3RYP A;  2LD5 A;  3HL2 A;  1VQL I;  3LSG A;  1S6L A;  2E2I J;  2BXY A;  1IRZ A;  1XN7 A;  4DYC A;  4E7S A;  1G3W A;  3FBN B;  5H6R A;  3IV5 A;  2MLG A;  1OCT C;  2XC7 A;  4XLC A;  5ILV A;  1T95 A;  1BI0 A;  3DEU A;  2XAS A;  2HKO A;  2EK5 A;  1XSD A;  1MSE C;  3GTG J;  3T8T A;  4A5M A;  4WX9 A;  4LLN A;  1TQI A;  5A2Q K;  4CZC A;  1R36 A;  3HSF A;  1QPI A;  3O8H A;  3HRT A;  4AD9 A;  1I50 J;  2FML A;  2CFX A;  3CUQ C;  4HA8 A;  1W4M A;  4A2U A;  4J01 A;  3RJP A;  2CWE A;  5HDN A;  1USS A;  3MD2 A;  3BTC A;  3PSI A;  5E20 A;  1J0R A;  3I58 A;  2QUF A;  1S5L C;  5ICG A;  1UHM A;  3S2W A;  2IPQ X;  5D6F A;  5HNF A;  1E17 A;  1TZL A;  5D4R A;  1ON1 A;  2WV1 A;  1ACI A;  4M3F A;  3IAS 2;  2L9V A;  4I98 B;  1F1Z A;  2F5E A;  1QZZ A;  2HOE A;  3CES A;  4CHU A;  4BBS J;  1X1C A;  1ZLK A;  4KIG A;  2FD5 A;  2VOP A;  3JRF A;  2RVC A;  4AID A;  1P6R A;  3QOD A;  1WFX A;  2JPB A;  4HLY A;  4NB5 A;  2W4S A;  2BYV E;  2NOG A;  1ZG5 A;  4RGU A;  3PFI A;  4HDU A;  2R7O A;  4J00 A;  1MDM A;  4XLA A;  2CRG A;  3J80 K;  4ETS A;  4YFN F;  2XAF A;  2GWR A;  4IQJ A;  3HDD A;  2QQ9 A;  2ZJR F;  5ILU A;  2W82 A;  1YS7 A;  3A4C A;  3JRE A;  1IF1 A;  1YHQ I;  4RLF A;  1RPW A;  3F3X A;  1QU3 A;  4PCQ A;  2CV1 A;  1LFP A;  4IZZ A;  1L3L A;  4X1E A;  3GTP J;  1PUF A;  3GW2 A;  1JJ6 C;  3F8C A;  4QTR A;  3E7L A;  3KP2 A;  2MD5 A;  1UAA A;  2DBB A;  1EH7 A;  4RGR A;  1OCR H;  4GYI A;  1YIJ I;  2M45 A;  4Q48 A;  2KJC A;  2OPT A;  1UMQ A;  2YPR A;  3KLO A;  4ZYH A;  3A01 B;  2PMZ A;  3S93 A;  2CUJ A;  1RR8 C;  2P81 A;  3R61 A;  4E6K G;  1B4A A;  1RC9 A;  2DA2 A;  2HZT A;  3DLA A;  4UXN A;  4R79 A;  5FKO A;  2YS9 A;  3ROU A;  2QZ8 A;  3SZG A;  1D1A A;  1S7E A;  1XC5 A;  3V7R A;  2EIL H;  3OR1 C;  3E97 A;  2EFN A;  2EFO A;  4IRI A;  1QQI A;  2MA3 A;  1K7A A;  1HC8 A;  3GTO J;  4UUS A;  5IT9 Z;  3E6C C;  2MGQ A;  1N78 A;  2R93 J;  2XGX A;  1UJ8 A;  2VXZ A;  2CSO A;  2MAB A;  3AG2 H;  3OWT A;  3QU6 A;  3CP8 A;  3I5U A;  2WAE A;  1P2F A;  1LFB A;  5C3E J;  1U9O A;  2IT0 A;  1WI9 A;  4UB8 C;  4IVN A;  3PIO F;  2F5V A;  4O6J A;  2HDC A;  3FHZ A;  2DA7 A;  3HZJ A;  3TOA A;  5J1Y A;  3Q5F A;  1H0M A;  1VI0 A;  4DBQ A;  2IW5 A;  3E1S A;  3GFL A;  2CW8 A;  2H94 A;  4HNV A;  3JW4 A;  1U3E M;  1B72 B;  3KP4 A;  1Z67 A;  2HVS A;  1FZP B;  1OR7 C;  2HI3 A;  3U1D A;  1NG7 A;  2AQE A;  5HNH A;  1ENH A;  5E1Z B;  3R60 A;  3KLN A;  1H88 C;  1RI7 A;  4PGH A;  3OMY A;  4HPQ A;  2NOJ B;  4DYR A;  5TIS C;  3S15 J;  4BHP A;  1FX7 A;  3J81 Z;  2ZBK A;  2R7V A;  3RZD J;  1E0E A;  2I8D A;  5LRR A;  2ME6 A;  2R5Y B;  3G4S I;  2M87 A;  4B48 A;  2X9D A;  1B59 A;  2ZO4 A;  4Y33 A;  2ID3 A;  3HKZ N;  1AKH B;  4B3X A;  2X0L A;  4C2T A;  2F4M B;  5H6Q A;  1O3S A;  3CF5 F;  2VLA A;  5K1Y A;  1Y0N A;  2DOD A;  5K7H A;  3AAF A;  2PFB A;  3OOU A;  3EUH C;  1FMW A;  3GFJ A;  4KYW A;  1T0F C;  1RES A;  1A35 A;  3H9Q A;  5LBQ A;  2BY0 A;  2F2E A;  1V5G A;  1A36 A;  2X6X A;  2DTZ A;  3DWL E;  4BJ6 C;  2VJ5 A;  2DMN A;  4CCK A;  1BJA A;  3KYL A;  2FNA A;  3P5J A;  2DOF A;  5E79 C;  1LPQ A;  2VKD A;  5CQG A;  1YRN B;  1RR7 A;  1MBK A;  1TTY A;  2Y2Z A;  1IDY A;  4V2G A;  3UNG C;  1I5Z A;  1OJL A;  1IRF A;  3OS0 A;  1ETK A;  5E18 F;  4PK4 A;  2ZB9 A;  5E8I A;  2XAG A;  3BQZ A;  4M9Z A;  2O6G E;  1FOW A;  1NG6 A;  4R1H A;  3ELK A;  5K5O A;  4DBR A;  1WJF A;  4F7Z A;  3CD6 I;  5CJ9 A;  3CJN A;  1ZRC A;  1JUM A;  5J6X A;  5TRD A;  4RB3 C;  1AHD P;  2JQ7 A;  3QWL A;  3KP5 A;  5IYB J;  1UEL B;  1DPR A;  4FQG A;  2ZNZ A;  1V55 H;  3IUO A;  1WSU A;  3OYI A;  2HYJ A;  3CUQ A;  3LQR A;  3PM1 A;  1TNS A;  1O3R A;  3HOV J;  3OYF A;  1LE8 B;  1IN8 A;  2E5N A;  1I1S A;  4U7B A;  4E7H A;  1LEA A;  4CZZ A;  3HPG A;  4IHX A;  2PN6 A;  4IKF A;  3AFH A;  1GV2 A;  3ECO A;  4BJT A;  1TQM A;  1U5T C;  1X3U A;  4KIT B;  1AKH A;  1N25 A;  4Q4Z F;  4XSZ F;  4MEX F;  4HLX A;  3DF8 A;  3BG9 A;  3HM5 A;  3VB2 A;  1V3F A;  4OIR F;  1G59 A;  1BI2 A;  2VL8 A;  3M3Y J;  2VJJ A;  3GXO A;  4XN3 A;  1HSJ A;  3I71 A;  4UHT A;  3VYT B;  1R58 A;  1W7P A;  3HOX J;  2D1V A;  3CO7 C;  1KON A;  3TGN A;  3MMY B;  2PMH A;  2BOL A;  5HS7 A;  4BJ5 C;  4TV7 A;  4L5I A;  5HS8 A;  2B0L A;  2NAZ A;  4IJA A;  1Y0U A;  2VOD A;  4ZH4 F;  5KNL A;  1ETY A;  1YRN A;  3H36 A;  4X0G A;  1BIA A;  2C6Y A;  1KQ8 A;  3DV8 A;  3QOP A;  4IEJ A;  3NAR A;  4A3F J;  1IV8 A;  3I54 A;  1MBG A;  1AA7 A;  3WTS C;  3ASN H;  3SEZ A;  3Q0U A;  3HC7 A;  1ZK8 A;  1VZ0 A;  2NXN B;  1OKR A;  3CCY A;  4XLH A;  5KCM A;  4BE0 A;  3ESW B;  5GPA A;  3FXL A;  1XX5 A;  1HBX G;  2R3S A;  2EV6 A;  1MNE A;  2HXI A;  3PNV A;  2MLK A;  1U2W A;  2E1M C;  2JSC A;  2Y0S N;  2H8W A;  1Z3Y A;  2KLO A;  3WOD F;  4FTH A;  3VYU B;  2M2E A;  5DCM A;  3HGY A;  3SJM A;  4BEH A;  2E1O A;  3JRC A;  2FSW A;  5BPI A;  2TRT A;  2VKE A;  2QWW A;  3QP5 A;  1D1C A;  5HOD A;  2ZSH B;  1JKO C;  2ZJQ F;  3DKX A;  5FFX A;  2UXX A;  1JTY A;  4I99 C;  3RKX A;  1MBJ A;  1Y6I A;  5FRO A;  2JN6 A;  1GVJ A;  2HDD A;  2ELK A;  3LL7 A;  2JRM A;  3N05 A;  4B1R A;  4G8X A;  5EG0 B;  4YFX F;  1YW8 A;  5DUI A;  4ESF A;  5LD2 C;  3DPT A;  2XIG A;  1WVR A;  4KN7 X;  2O8X A;  1ETV A;  1X3Z B;  4F91 B;  3U1K A;  2XVC A;  3KEY A;  3ZP5 A;  3O8G A;  3VWB A;  3B02 A;  2ZME C;  4II3 A;  5E1X A;  5KAF C;  1ETO A;  4JQF A;  2LKS A;  4XSX F;  5FKK A;  2WTE A;  4JK1 X;  5JHU A;  3M7G A;  3M8J A;  2QSH X;  4KIB A;  3QYB A;  4NUB A;  1MBH A;  2Y31 A;  3SQN A;  4GFB A;  4WCG A;  3IKV A;  2PJR B;  2Z2S B;  5IP9 J;  1XMK A;  4HQE A;  2HVR A;  4KDP A;  3BCA A;  3HGG A;  2HEO A;  3LA3 A;  5FKN A;  3LA2 A;  5D8L B;  4OIP F;  4BQA A;  2HGC A;  2OTL I;  2Y69 H;  1ZHF A;  2OBP A;  2I5U A;  3FF5 A;  1IDZ A;  2NS7 A;  1QHG A;  1QVU A;  3EYI A;  1DQU A;  2JA7 J;  4XR6 A;  3JR9 A;  2LP0 A;  4I2O A;  1UCR A;  2ICW G;  3H9G A;  5H20 A;  3F8M A;  1X1P A;  3KZY A;  2XV4 S;  4OAZ A;  1J2X A;  2H09 A;  3EUH A;  3COA C;  3QPH A;  3FXR A;  1T0F A;  1QPM A;  4CCL A;  4HBL A;  4BY7 J;  4A3C J;  3HSR A;  3WHB A;  4BAY A;  4G94 A;  4XLN F;  2W1O A;  4BQO A;  5LHG A;  4LLL A;  3U2R A;  5K7Z A;  2F4I A;  2QVO A;  3FMR A;  3W6J B;  1FLI A;  1GLN A;  2ELH A;  4BE2 A;  2DA1 A;  3WU2 C;  3LFU A;  1TWG J;  2QGU A;  2K5C A;  2VBW A;  4F92 B;  3LNQ A;  5L3B A;  3BZ6 A;  1K83 J;  2Y75 A;  2OZU A;  4V2F A;  1XTA A;  3G73 A;  4A3I J;  2H27 A;  4KIF A;  2EQR A;  2CQ7 A;  3FMS A;  4M74 A;  1MZB A;  1XGM A;  4BDY A;  2LOO A;  2AO9 A;  2D45 A;  2O5R A;  3B6C A;  3C1D A;  1W5S A;  3NRV A;  5HLT A;  3ULQ B;  3DTK A;  2B63 J;  2FOK A;  3EUK L;  3G1O A;  4LG0 B;  3L2U A;  3BG6 A;  1TWA J;  2E71 A;  4CXF A;  1HA8 A;  1ZRD A;  4A6E A;  2D1H A;  1TBX A;  2K7L A;  1IO2 A;  3LSJ A;  1IRG A;  3ZQL A;  1DUX C;  3JSO A;  2VB6 A;  1YW7 A;  1SD6 A;  2PJR A;  3CCR I;  1SVM A;  3GTQ J;  5D5X B;  3CJR B;  2ELJ A;  2FU4 A;  5F0C A;  5EYR A;  1H8A C;  1IGN A;  2X6Y A;  5J4V A;  2Z9O A;  2FQ3 A;  2RQP A;  3CDL A;  2PI0 A;  1RET A;  4BQN A;  1U5T A;  3NAU A;  3A0B C;  2R5Z B;  1T6S A;  3HHH A;  3FZV A;  5J3L A;  2QKM B;  3WU1 B;  4HZF A;  2JVG A;  2IS6 A;  1BR2 A;  1K79 A;  5FLV A;  4XL9 A;  1BI3 A;  4UVC A;  1YOV B;  2IS2 A;  3L09 A;  3MQ0 A;  5GAH J;  5FLX K;  2VIX A;  4A3G J;  4MNU A;  1IUF A;  2HQ5 A;  1Z6T A;  4AVP A;  2MC3 A;  5CVJ A;  4UV8 A;  4A3L J;  3RQ4 A;  2R7F A;  2MYS A;  1OLT A;  2DA4 A;  1ZN2 A;  1A31 A;  5M3M J;  2CUF A;  2X1D A;  4WXD A;  1JHH A;  1QRY A;  2VBZ A;  1ZEL A;  2EIJ H;  1HKQ A;  4AU7 A;  3TDZ C;  3VOD A;  2V6C A;  4UY8 I;  3K9T A;  1JUS A;  3OYK A;  1IXS B;  2V9K A;  4LK1 F;  1R4N B;  5A2Q Z;  4N4O B;  1BW6 A;  2F6C A;  3OSF A;  3TP0 A;  1YO5 C;  3PQJ A;  2ISY A;  1YJW I;  4GRI A;  1IN6 A;  4B8X A;  3AG1 H;  3BJ6 A;  1S9H A;  2L5Q A;  1WH7 A;  5D5U B;  4AC0 A;  5HLG A;  3GVA A;  4M72 A;  3G3Z A;  2VAS A;  3RQI A;  4XKC A;  1GUU A;  5FRN A;  3BZC A;  2ME0 A;  1MMA A;  3GFM A;  5EJC A;  1SEU A;  3GTJ J;  2P5K A;  4HST A;  2PG4 A;  3ZQ7 A;  4A3E J;  4U7D A;  2BXZ A;  2QSF X;  1UZC A;  4RB1 A;  4NQW A;  1JKP C;  1RKT A;  4NDL A;  5F6F A;  2WB1 N;  3CTA A;  3SFI A;  2L3D A;  1VQO I;  2V7F A;  4ZDL A;  3DTI A;  1TT0 A;  1JI8 A;  2LSO A;  1XG1 A;  1QZE A;  3BCB A;  3EPZ A;  3FXU A;  1WCM J;  1ZRF A;  3J80 Z;  1Q1H A;  4DNC A;  3W6K B;  1LJ9 A;  3H5A A;  1FSH A;  3ZMZ A;  2DFH A;  4BGD A;  4OOI A;  3CCS I;  3T8R A;  3OL4 A;  3L2W A;  2RNJ A;  2PJP A;  2KDZ A;  4UVB A;  2FBI A;  4AYB N;  2K27 A;  3NEU A;  2ZME A;  2RRE A;  2RV8 A;  3HOS A;  1O3Q A;  5DD4 A;  3WG9 A;  1DP7 P;  1EKE A;  4HF1 A;  1FEX A;  5IP7 J;  3CMM A;  3K7A J;  3S3N A;  2HYG D;  4XON A;  3P9I A;  5KHD A;  4LLG F;  4Q47 A;  2LNB A;  2A6T A;  3BG3 A;  4I7H A;  4OAY A;  1TLH B;  4PUS A;  2AHQ A;  1W5C C;  5D5W B;  1J5Y A;  2XPU A;  4DJA A;  4L0Z B;  3GTL J;  1WI3 A;  1XSV A;  2DPD A;  2HNH A;  2CYY A;  5E17 F;  4CSW A;  3V8K A;  5DDG A;  4IF4 A;  3TOB A;  1P92 A;  2EBI A;  4DOZ A;  4DZJ A;  4HX7 A;  4U88 A;  3IP4 B;  2QCO A;  2V6E A;  5BNG A;  3CME I;  2QYO A;  4O5V A;  3IC7 A;  1YS6 A;  2QA4 I;  3OSG A;  2CW0 F;  4L9T A;  1CGP A;  2DA6 A;  3GLX A;  2IGM A;  1F36 A;  4EJU A;  1HQC A;  2VT2 A;  1CF7 B;  4HEA 2;  2K9Q A;  2LBF A;  1DGR M;  1P7J A;  2GIV A;  3HUG B;  3KZI C;  2VJ4 A;  5LLQ A;  2IEK A;  3ZMV A;  1JXS A;  1FSE A;  1G2H A;  3FK6 A;  1FIA A;  2L01 A;  4RA2 A;  4JBA A;  1G6N A;  2OU2 A;  4OIN F;  5L3G A;  3DXJ F;  2QSG X;  2HTS A;  1V5F A;  5D8K B;  3CCU I;  2DT5 A;  2M1B A;  3HOW J;  4P9F A;  3AL0 B;  2DJI A;  3MZ8 A;  4DQ2 A;  1WPK A;  2XF6 A;  3F6O A;  5E3M A;  2IRF G;  3KX2 A;  1YI2 I;  3OOP A;  1A04 A;  2DU9 A;  5JI6 A;  4U0Y A;  3BR2 A;  3KEQ A;  3UR3 C;  4D5F A;  3N97 A;  2M3A A;  1RKW A;  4UV9 A;  3SYT A;  5FD6 A;  1P4A A;  2Q2E B;  1BOB A;  3HHG A;  3BG5 A;  1BC7 C;  2XUB A;  1A5J A;  3MKL A;  3RPQ A;  4FCY A;  3IH2 A;  4M6X A;  4IXA A;  5B5E C;  2FMY A;  2UWM A;  5IPA A;  1SFU A;  2UZK A;  3R6S A;  2QEX I;  1JKQ C;  2OJE D;  3MKZ A;  1MKM A;  2UXN A;  1SC7 A;  2YSR A;  1IN7 A;  4CCJ A;  1IW7 F;  5C44 J;  1R23 A;  3IH3 A;  2NYX A;  1I3A A;  1G4D A;  4GYG A;  2HOS A;  3T1B A;  4M73 A;  2EV5 A;  2GOM A;  3HYI A;  2O9L A;  4XKW A;  3I3L A;  2BW3 B;  4P5O A;  2JJ7 A;  3RIR A;  3F21 A;  2X51 A;  1J59 A;  1ZR4 A;  1JJ8 C;  2JA8 J;  5HDK A;  1CF7 A;  4W1U A;  5TJJ A;  3EQL F;  2MG4 A;  1X19 A;  2NVX J;  4LD5 A;  2DK5 A;  4M71 A;  3OYM A;  3QQA A;  4RB0 A;  3HUG A;  6PAX A;  2NRA C;  1K61 A;  3BJA A;  1O7L A;  1XDS A;  2RQQ A;  1D5Y A;  2XAJ A;  3S1R J;  3D1N I;  1YJ9 I;  5LRS A;  4RAY A;  2FE3 A;  1U9N A;  3OV8 A;  4BBR J;  2EZH A;  3CMY A;  2V1X A;  2IP2 A;  3I59 B;  4MHG A;  4KMU X;  5F1J A;  2BHZ A;  2K9M A;  3P9K A;  3H5R A;  2CU7 A;  2ZJ2 A;  4P9U A;  4L0Y B;  4XKV A;  1GV5 A;  3HKZ A;  2QQ8 A;  1MJ9 A;  1ETQ A;  3A02 A;  5J47 A;  4HV5 A;  3IWZ A;  4BDZ A;  1R6R A;  1MW7 A;  1PVE A;  1U0J A;  2E1N A;  5L3D A;  3P9C A;  1G3Y A;  3MN2 A;  4EAT A;  3OYN A;  1M1E B;  5JVT A;  2QBY B;  3C2B A;  4QSH A;  2COB A;  2Y30 A;  4U0V A;  5FB2 A;  2EZL A;  3J7Z I;  4HNT A;  2V79 A;  4JX4 A;  2O3F A;  4PJL A;  2GM4 A;  3CJT B;  1R7J A;  2EZI A;  3C18 A;  2XSD C;  1LUJ B;  4BY1 J;  4P55 A;  3RCO A;  1JT0 A;  3WE3 A;  2VQH A;  2L7Z A;  4FT8 A;  2ZFW A;  2JWT A;  5KAI C;  4CYC B;  2P0W A;  2GAU A;  2HQR A;  1KU9 A;  3PL8 A;  5CQE A;  5M5W J;  1T98 A;  1NH3 A;  3ZPL A;  5EDN A;  4JP0 A;  4MO7 A;  4R8H A;  1TP4 A;  1HLV A;  2HOA A;  2P6T A;  5JHF A;  1FJL A;  3S1Q J;  4MFE A;  3HIF A;  4U87 A;  2LY2 A;  4ITV A;  3OYD A;  1BBY A;  1ZG1 A;  3QYE A;  2BW3 A;  3DBR B;  4OMY A;  2E35 A;  2XGE A;  4XQF A;  2CQK A;  3FX3 A;  2WAD A;  2DYR H;  4YII A;  2OD5 A;  2DYS H;  3WGG A;  3DU5 A;  4Q5S F;  1OFC X;  1OPC A;  4Y7N J;  3I56 I;  4FIS A;  1K4S A;  1KU3 A;  3HRS A;  3A01 A;  1S29 A;  3I4P A;  3M4O J;  1QHH D;  2LYC A;  2BHY A;  2OTJ I;  3WTT C;  1QO0 D;  3VYS B;  1X1A A;  2M8G X;  4PJN A;  2FEZ A;  3S32 A;  2NNY A;  2X1E A;  1TWC J;  3JRG A;  2RDP A;  1LEB A;  1VQ5 I;  2A05 A;  2M30 A;  5H2F C;  3K6G A;  2BVM A;  3H3U A;  2DQL A;  1WHU A;  2L2O A;  1D1B A;  4PSW A;  2EIK H;  4OWR B;  1FC3 A;  3PJR A;  2QEN A;  5FD5 A;  4ZJZ A;  1HW1 A;  4GXO A;  3ZMU A;  3CCL I;  4IOC F;  2DI3 A;  3KET A;  1CQT A;  1Y1W J;  3H1C A;  2VC1 A;  3KFW X;  3KPH A;  2XPV A;  4IRG A;  4BU2 A;  5CVR A;  4XOT A;  1IN4 A;  4E70 A;  4EJO A;  1R5H A;  1GXQ A;  3CLO A;  4XMY A;  2K9L A;  5CVU A;  1FP2 A;  2M9H A;  4L9J A;  1PYV A;  1YE9 A;  2ECB A;  1YG2 A;  3NQO A;  1Z1D A;  2BBY A;  2CG4 A;  2L9N A;  3BOQ A;  1U78 A;  2P7C B;  2P5L C;  1TWF J;  1R5G A;  2ZXI A;  2F5D A;  3JRD A;  1GDT A;  1B72 A;  2HR3 A;  2DA5 A;  1EA3 A;  2Y9Z A;  4UNO A;  1TWH J;  4QIW N;  4A93 J;  4UUT A;  2FF4 A;  1D8J A;  2GLO A;  3BY6 A;  2JA6 J;  3LA7 A;  4I02 A;  3KP7 A;  1WJA A;  4DYQ A;  1XMA A;  3L7W A;  3FMQ A;  1OCZ H;  3D5R C;  3DPU A;  4FE4 A;  4M3E A;  1LFU P;  1LDK B;  1OCP A;  4BS9 A;  2DFI A;  1X4P A;  2R7Q A;  5JFR A;  4GO1 A;  5ILS A;  3JSP A;  1SFO J;  2M4G A;  3GLL A;  4YIF A;  2XB5 A;  2R5Y A;  3DBL B;  1F43 A;  1Z7L A;  2JUG A;  1J75 A;  2Y0S A;  1GT0 C;  2KRH A;  2LRD A;  4YIR X;  3CC4 I;  4RAZ A;  1O3T A;  1G8X A;  1WJE A;  1R49 A;  3L2R A;  4M3G A;  2E5Z A;  5HLH A;  2BY2 A;  1ITY A;  2FJ1 A;  3AG4 H;  2JTV A;  4XRM A;  2VPL A;  4FX0 A;  4CGZ A;  1XD7 A;  2A6E F;  4E4H A;  1D0Y A;  1YLF A;  1XGO A;  2EIN H;  1E3O C;  3OYE A;  3GFI A;  3TMO A;  2F4O B;  2VPR A;  4FET A;  1XPX A;  5EGO B;  3E5Q A;  2R7X A;  4AM3 A;  5C4J J;  3IL2 A;  5F0H A;  1HF0 A;  4PSX A;  3CCE I;  2HOT A;  2DMU A;  2O61 A;  1HXD A;  2GQQ A;  2DQR A;  1XMX A;  3F8N A;  2XRN A;  5L3E A;  3BR5 A;  2K4J A;  4EJV A;  2KFD A;  4KUM A;  3BZK A;  3HBL A;  4OIQ F;  3FXJ A;  1Z77 A;  2LMD A;  3GEZ A;  5DD8 A;  3DLL F;  2Z33 A;  2XF5 A;  1QNT A;  1R22 A;  1P7I A;  5GPC A;  4UUV A;  2OA4 A;  4G6D A;  1V54 H;  1ZKG A;  2CFO A;  1Z91 A;  3PO3 J;  4A0Z A;  1REP C;  2H6C A;  4C3I J;  1APL C;  5LHI A;  1TC3 C;  2OZ6 A;  1R1V A;  5KVR A;  5HOO A;  4EM0 B;  1LE8 A;  2LTP A;  3RTR A;  1ODD A;  3ML6 A;  4C2U A;  2LFB A;  2NVY J;  3PSF A;  3W6V A;  4GCV A;  1B8I B;  2L4A A;  1RUN A;  1ZTR A;  4M9X A;  3KZZ A;  3WG7 H;  4GDF A;  4BKX A;  1HCR A;  3JRA A;  1FBQ A;  1MND A;  3ZRG A;  4DW6 A;  1T39 A;  4LB5 A;  5F0F A;  1OYY A;  4J19 A;  3K4L A;  4JX6 A;  1E2X A;  2IJL A;  4LG3 A;  2GA2 A;  3BJO A;  3IH4 A;  5DM6 F;  5TGT A;  2IGK A;  1R71 A;  3HOU J;  2D5V A;  3K10 A;  2KKO A;  3CCV I;  5EEG A;  1N75 A;  2X6O A;  2E34 A;  2HS5 A;  2KZG A;  3F0C A;  5FLX Z;  4CCM A;  3OS2 A;  2E2H J;  2L7K A;  5EGO A;  1YFH A;  2LY9 A;  3LSR A;  4RM3 A;  4UB6 C;  5BPD A;  2GIZ A;  2EPF A;  2ADU A;  1MBE A;  5ICE A;  1ZRE A;  2Y9Y A;  5IYD J;  1I27 A;  3BTJ A;  1GXP A;  3EYY A;  1Z3X A;  3CC2 I;  4MLO A;  4EVI A;  2WAF A;  3K70 D;  1U6G A;  5FO5 A;  2V9V A;  3Q0V A;  5HS9 A;  2STT A;  5DUK A;  3BG7 A;  4ABZ A;  3CMA I;  1DU0 A;  2Z99 A;  1WJ5 A;  3OYL A;  3VSL A;  3GX4 X;  4ZTJ A;  5BS6 A;  2D2W A;  2JRT A;  1I1G A;  2VQG A;  1TW3 A;  2Y48 A;  4Z6Y A;  4AUX A;  1VF9 A;  3TKY A;  1ZGW A;  3BPX A;  1IZ1 A;  3W2W A;  1XS9 A;  4A3B J;  2P8T A;  4G6Q A;  1S72 I;  2OV7 A;  3S1M J;  2W57 A;  2BE5 F;  4IPA A;  4PFP A;  3DEE A;  4QPQ A;  1FBS A;  1VQK I;  1RRJ A;  3S16 J;  4G9Y A;  2JSP A;  3K4J A;  4CIC A;  4HQM A;  4BXF A;  1IC8 A;  1W1W E;  4I01 A;  3ASO H;  5DS9 A;  4KIS A;  2LY1 A;  2H8R A;  4EJT A;  2LG4 A;  4CO8 A;  1UG0 A;  3LFK A;  5BQT A;  3L2V A;  4WWC A;  4F3Q A;  1VQN I;  1ZGA A;  3A2K A;  1MJB A;  3L9F A;  4FHT A;  4XLE A;  2N8G A;  4BXU A;  1MNM C;  2GXB A;  2G7U A;  1I6H J;  2O0Y A;  3A0H C;  5IT3 A;  5EG0 A;  4KMF A;  1HW5 A;  3CJQ B;  1H9T A;  2H6B A;  2WY7 Q;  2Z1D A;  2P5V A;  2A3S A;  2GZW A;  3BR3 A;  3E5X A;  3ABL H;  5GP9 A;  5JLX A;  1K6O A;  2CV2 A;  2CO5 A;  2VC0 A;  1T56 A;  2GXA A;  2DAO A;  2IBD A;  3JAM K;  1BI1 A;  4D5C A;  2RAE A;  2Z5U A;  2DT7 B;  2HQN A;  5IP6 A;  3WGI A;  2XRL A;  3QYF A;  4JOM A;  4XKB A;  1JUP A;  2HQA A;  2WY8 Q;  1Y1V J;  4HW0 A;  2XPW A;  3I53 A;  1R4M B;  2KT0 A;  2KIU A;  4DIQ A;  3ZMT A;  2ESH A;  1R00 A;  2UV1 A;  2Z3Y A;  3WE2 A;  3MKY B;  1VQ7 I;  1KYZ A;  2LH9 A;  3KP6 A;  1WJC A;  4BHC A;  5FKL A;  3IRQ A;  2A69 F;  4BXX J;  2M0C A;  4F93 B;  4A12 A;  4E7L A;  2G9W A;  4B44 A;  3JTG A;  2ZSI B;  2FBH A;  4B09 A;  2CV0 A;  3H5N A;  2J5O A;  3NWT A;  3GCM A;  3BLY A;  3HTU A;  3WU0 A;  3ABT A;  2ETH A;  3RYR A;  4ZYG A;  1FYL A;  4E7K A;  3QRF F;  3DU6 A;  1ZR2 A;  3V7C A;  3QOE A;  2IS1 A;  2JK3 A;  5HLI A;  1W0U A;  3RKY A;  1T38 A;  2WB1 A;  2JA2 A;  3QU3 A;  4MIM A;  1ZYR F;  3IHU A;  4RS8 A;  2M7A A;  3RPU D;  3B73 A;  3MVP A;  3HB9 A;  4Y13 A;  5CVI A;  1R1U A;  1ZAO A;  3HOT A;  4XBF A;  1L0O C;  2XGD A;  1IXC A;  3TO6 A;  2K02 A;  2KRC A;  3HPH A;  3LQQ A;  1MBF A;  1LVA A;  3DQV C;  1XDU A;  3S14 J;  2TCT A;  4HX4 A;  5B66 C;  5EEA A;  4L9V A;  3WHC A;  4HSR A;  3ZQQ A;  2L0K A;  5JR3 A;  4LIV A;  1UST A;  3AG3 H;  3C7J A;  4Y3O A;  4LB6 B;  1ZG3 A;  3C2H A;  4AYB A;  2DJN A;  3E6B A;  2W84 A;  3PQK A;  3AL0 C;  9ANT A;  4I0B A;  2A6H F;  1ONV A;  2M8E A;  1BOA A;  2FUG 2;  4RAF A;  5E3O A;  1JE8 A;  4QWQ A;  3FM5 A;  2L7M P;  2DMP A;  1FIP A;  1YJN I;  3KCC A;  5J40 A;  2VXD A;  4H0E A;  1B9M A;  4LG0 A;  5J8F A;  4G7O F;  4BL0 B;  3ZR8 X;  3SZP A;  4I6Z A;  1W0T A;  4HG2 A;  1FOX A;  1MD0 A;  1FYK A;  2A5Y B;  3MAJ A;  3BR1 A;  1WZ2 A;  1WJB A;  1RUO A;  4I09 A;  2PQ8 A;  1X4O A;  3VPR A;  4C9Y A;  3K0L A;  2FOW A;  3ISP A;  3SXY A;  3ZCO A;  4H4K C;  2R5Z A;  1ULY A;  2DFE A;  3BP8 A;  1IUY A;  3F8B A;  2BGC A;  4V19 K;  3PNT A;  1E3P A;  3ZQF A;  2K85 A;  3JTH A;  1HST A;  2JPC A;  4P96 A;  3UKG A;  1BR4 A;  3ZMS A;  2AXL A;  5CYV A;  1LQ1 A;  2EWN A;  1U8R A;  3BTI A;  2CQX A;  1LVK A;  2VBY A;  2R7Z J;  2ZC2 A;  5EEH A;  3R4K A;  2MC4 A;  5EZH A;  4CYD A;  3TW7 A;  3FM3 A;  3OYB A;  3VSK A;  4BNC A;  3MKW B;  3Q9S A;  1X58 A;  5E3N A;  2KZV A;  1TT5 B;  1PP7 U;  1SFX A;  1S8N A;  1XGS A;  5M5X J;  1JHF A;  1ZGJ A;  2XAH A;  3TQN A;  1TL8 A;  2IGO A;  3DCF A;  1G3T A;  2A68 F;  1LNW A;  1PDN C;  1WQ2 A;  1HDD C;  1FT9 A;  1RNL A;  4KT6 A;  4S0H B;  4ESB A;  2R7T A;  1MMN A;  4ZZL A;  4YEL A;  2QQA A;  5DEQ A;  3KP3 A;  5BMZ A;  2K9S A;  5E1W A;  1BM9 A;  3H9J A;  3WTW C;  3MZH A;  3ZQC A;  3CO6 C;  3S3O A;  2V26 A;  5LGN A;  1WGX A;  1YX5 A;  4KNY A;  2DO7 A;  2IVM A;  2JMW A;  5ED4 A;  3GME A;  3OIO A;  4Y17 A;  2R7S A;  2Q1Z B;  5LEK A;  2VN2 A;  4UVA A;  2W00 A;  3ZGK A;  3DKW A;  4ZYA A;  4S05 A;  3OIP A;  5JLW A;  1AU7 A;  4ENN A;  3CUO A;  4XRS A;  2X85 A;  4N4N B;  1ETX A;  2BY1 A;  3FKI J;  3L1P A;  4LIT A;  5FKM A;  3I4M J;  1BA5 A;  1MDM B;  2V9P A;  2HVQ A;  4BE1 A;  1T33 A;  2LKP A;  2I10 A;  2O7O A;  4Z2Y A;  4A3K J;  3LWF A;  4MEY F;  3JRH A;  3REO A;  1PUE E;  3X2Q H;  3KEO A;  2KHM A;  1LKX A;  1Y39 A;  1PUF B;  3JRB A;  2DXI A;  2E60 A;  3RI4 A;  3O3K A;  3RZO J;  5B1A H;  2K40 A;  4NC7 A;  2XAQ A;  1SFE A;  4B4C A;  1VQP I;  1KU7 A;  2K3F A;  5F27 A;  2LKX A;  3M1C A;  1HW2 A;  2HWV A;  3FXK A;  1BN5 A;  3O6B B;  4LIU A;  5HVQ C;  3Q0W A;  5LGU A;  1FTT A;  1D5V A;  3QPT A;  1EF4 A;  2WAQ N;  3SHF A;  3D0S A;  2NVU B;  1MMD A;  1Z7U A;  1SVL A;  3Q3S A;  3KE2 A;  1Q1V A;  2ZCW A;  4UUS B;  2NS8 A;  4HAM A;  4KA4 A;  2UUZ A;  2WV0 A;  3FIW A;  2XKO A;  3WTZ A;  5LGT A;  4MFD A;  2MH2 A;  3HRU A;  2ZNY A;  4FX4 A;  1HDP A;  1FOK A;  2CS3 A;  3OS1 A;  2F5F A;  2HYF A;  1Z9C A;  5DM7 F;  4FAS D;  2K9N A;  3ABM H;  1BL0 A;  2X4H A;  4ENK A;  4D9J A;  1Z6R A;  3MEX A;  3RKW A;  4ZYD A;  2YUS A;  1HOM A;  3CZ6 A;  2KJB A;  4RBO A;  1V4R A;  2KDO A;  2R4G A;  1BR1 A;  1T2K A;  1F5T A;  4LGW A;  3B6A A;  2E36 A;  3V8L A;  3J7Y J;  1HKT A;  1OQY A;  1SAX A;  3S2D J;  2HKX A;  2EA4 A;  4IL6 C;  1SMY F;  3K4M A;  4XN0 A;  3M8E A;  3F72 A;  2JA5 J;  2HZD A;  3PUF A;  2E19 A;  3GO5 A;  3I0T A;  1IN5 A;  4A69 C;  3CC7 I;  4ANJ A;  1PJR A;  4MGR A;  1TW2 A;  3E6D A;  3Q9V A;  1KGS A;  2XB0 X;  4RGX A;  2E7W A;  2LF8 A;  5ICC A;  2DOE A;  3CCQ I;  3M07 A;  4EMS A;  2PLY A;  4BH9 A;  3MZY A;  5ICF A;  2CQN A;  2WA0 A;  3HG9 A;  4E7Z A;  4LJZ F;  5GTH C;  5IYC J;  5DYM A;  2VOO A;  1KYW A;  2O8K A;  1IRX A;  1ZH5 A;  3CCM I;  2DDB A;  4C2M J;  3OR2 C;  3CCJ I;  3ABK H;  2M4K A;  1D0X A;  1NTC A;  5DCF A;  4A3D J;  2LVS A;  4M9S A;  2Q2E A;  4ASN A;  2XRO A;  2H1L A;  3K1P A;  3L00 A;  2PMU A;  3BWG A;  3C2G A;  4XRF A;  1EV7 A;  3G6E I;  3LSI A;  2RC4 A;  2R7R A;  2FQ4 A;  1FBU A;  1J09 A;  4XOP A;  4HF2 A;  1BC8 C;  4EGY A;  2IA1 A;  1EH6 A;  2EFP A;  4CCO A;  2GA1 A;  1FPQ A;  2XSJ C;  1ETW A;  3CQZ J;  2XF7 A;  2CMP A;  4NNJ A;  4OU0 A;  1DU6 A;  4PJJ A;  1SD5 A;  1WJD A;  4I0A A;  4M3B A;  1W36 D;  4K2E A;  1DPU A;  2KPM A;  3IAM 2;  3R0J A;  3U21 A;  4KJZ A;  4PGG A;  1X1B A;  3PIP F;  5E3L A;  2QQB A;  3D5S C;  3ZN0 A;  2R7U A;  3GTK J;  3NWS A;  3RDI A;  1OCO H;  2VJI A;  3BTL A;  1B1B A;  3E0J B;  3I4N J;  4G7H F;  1DGW Y;  3WTU C;  2DOA A;  2EJR A;  1MMS A;  3T0Y A;  4IO9 F;  1G3S A;  3K1N A;  1UG2 A;  2RKH A;  3K2Z A;  3CUQ B;  3TL4 X;  4D7N A;  3TO7 A;  4N0B A;  4IX7 A;  1SD4 A;  2PMZ N;  3I59 A;  3CDH A;  3FXM A;  4PJM A;  2X1C A;  1OYI A;  5AIP A;  1VQM I;  4PZJ A;  5K5Q A;  1YIO A;  2GBY A;  1D8K A;  3T5X A;  4PJ0 C;  2AQF A;  2DMQ A;  4XM3 A;  4AIH A;  3K2A A;  1IG7 A;  4G7Z F;  1BW5 A;  3K4C A;  3BDD A;  3I64 A;  2LRE A;  1AWC A;  2QBY A;  3RPU A;  1Z21 A;  2NVQ J;  3ZQI A;  5ERI A;  2IA2 A;  1R5I D;  4LK0 F;  5GAG J;  2W7N A;  2WWY A;  2KIS A;  2DN0 A;  1W7P B;  2V4J C;  3KIO A;  4D1Q A;  1GVD A;  1O57 A;  4FE7 A;  1UHS A;  3P7N A;  4B3A A;  4EQQ A;  4W97 A;  1MJA A;  3GYH X;  4CYC A;  2BEO A;  2HU9 A;  3OYJ A;  4OMZ A;  1FTZ A;  1POG A;  1SAU A;  1XSX A;  3V8J A;  2VE8 A;  5M5Y J;  3V7S A;  3K1M A; 
#chains in the Genus database with same CATH homology
 3QAH A;  2OQR A;  3E3V A;  1SMT A;  1NHA A;  1QBJ A;  2M5W A;  5FGM A;  2YR2 A;  3WTX C;  2P6S A;  2EB7 A;  2LDU A;  2QM3 A;  2HFH A;  3VOE A;  2YU3 A;  5L3F A;  4WK8 F;  1F4K A;  2LF7 A;  3BPV A;  1J7K A;  5J8C A;  3F22 A;  3SFZ A;  5DCM B;  1LDD A;  1S7O A;  2O03 A;  4HX8 A;  3EET A;  5IT9 K;  4A6D A;  3WTY C;  3ZMD A;  3FXQ A;  2NS0 A;  4ENJ A;  3ECH A;  2W24 A;  4ON0 A;  4A0X A;  4IRH A;  1HKS A;  3GUD A;  1KQ0 A;  3U9G A;  5F1R A;  1R1T A;  4HDV A;  4BHB A;  2OAZ A;  4MTD A;  1FNN A;  3HTS B;  5D4S A;  1UFM A;  2PBI A;  2XKP A;  4IHT A;  4CDG A;  2FXA A;  2A61 A;  5BOX A;  1WRJ A;  3JAM Z;  4WF2 A;  4RB2 C;  3J81 K;  2CGP A;  2BV6 A;  4GGG A;  2R7D A;  2YX4 A;  1W5T A;  2ACJ A;  1OYW A;  4A5N A;  2VE9 A;  4EV0 A;  3ERE D;  2L4M A;  3QP6 A;  5CLS A;  2EFW A;  1B9N A;  1S7A A;  3IKT A;  3E5U A;  4XLP F;  1BIB A;  3H92 A;  3EDP A;  4Y15 A;  3LST A;  5D5V B;  1S3J A;  4KIC A;  2RN7 A;  2W25 A;  4WXH A;  2COM A;  1K78 B;  3C3W A;  5D6E A;  1OMI A;  4MTE A;  4N9H A;  4A0Y A;  4M6Y A;  1OR7 A;  2VT3 A;  5FFZ A;  2J5P A;  3VFZ A;  4WXC A;  1C0W A;  4ZYE A;  2FRH A;  2AS5 F;  2VBX A;  3K69 A;  2Q8K A;  4MQ9 F;  1JGS A;  2F5C A;  3LAJ A;  2L02 A;  2DTR A;  3ZN1 A;  1MGT A;  4QLC U;  1U5T B;  4EM2 A;  4AIJ A;  4L18 B;  2JZY A;  2V1D A;  2FBK A;  3LAP A;  4EM1 A;  1TNT A;  3J7A O;  3DFG A;  1FYM A;  4HYE A;  3D5L A;  3SZT A;  4AWX B;  4PDK A;  4LMY A;  3HSE A;  2G7H A;  4YG2 F;  3HRM A;  3MCZ A;  4O3M A;  2EFQ A;  3M1E A;  3MFK A;  3GWZ A;  2EV0 A;  2K4B A;  2P7V B;  1IAW A;  2KRF A;  3FWE A;  1PP8 F;  1K78 A;  3GZ5 A;  3F8F A;  3VEP A;  1KQ9 A;  4NHJ A;  1ZAR A;  2JT1 A;  1YTY A;  2MH9 A;  4KFC A;  2ZXJ A;  2V1U A;  1WKM A;  1ZLJ A;  4KN4 X;  3V4G A;  5LHH A;  3IRR A;  2E7X A;  4L5J A;  4HV6 A;  2XHK A;  1J9I A;  5E8G A;  2A07 F;  1ON2 A;  1IXR C;  2VON A;  1YYV A;  2WC2 A;  4YFK F;  1DDN A;  1UHW A;  5K5R A;  1WWX A;  2DW4 A;  3F23 A;  3DPL C;  3TDU C;  4EGZ A;  2QLZ A;  1FWZ A;  1P4X A;  1P4W A;  3BRO A;  3TO9 A;  1Z05 A;  4ESJ A;  3MWM A;  1RIO H;  2ZME B;  1FY7 A;  2HTJ A;  4HOB A;  4KT5 C;  4HF0 A;  2EA2 A;  1YQA A;  1LB2 A;  1XCB A;  3L2C A;  2ISZ A;  1F9N A;  2NNN A;  3F6V A;  2L54 A;  1FP1 D;  1VTN C;  1GHC A;  2OQG A;  4ZZD A;  4EJW A;  1QZY A;  2DPU A;  1AOY A;  1H9G A;  4IHS A;  1LDJ A;  2YX7 A;  3E6M A;  2KIM A;  1YW9 A;  2MBF A;  2E1C A;  1SD7 A;  5DV5 A;  5CVV A;  1TQP A;  3H3Z A;  3O2P E;  2FNP A;  5HDG A;  1D3Y A;  4ENM A;  2Y0M A;  2IA0 A;  1W7P D;  1B6A A;  4OIO F;  2FA5 A;  2K86 A;  2P4W A;  3DP7 A;  4N9I A;  1KA8 A;  2W85 A;  3ABU A;  1UB9 A;  1XCV A;  1XB4 A;  1QGP A;  5L3C A;  1RZ4 A;  2RGV A;  5KK1 A;  3N4M A;  5F64 A;  2PEX A;  4AIK A;  5AIQ A;  5AON A;  2ESN A;  1I6X A;  2Q0O A;  4S04 A;  3R0A A;  4D0P A;  2GXG A;  2TDX A;  1STZ A;  4LFU A;  3M9A A;  1EH8 A;  3IWF A;  2DLL A;  5LEJ A;  4MQV A;  2ZKZ A;  3M8F A;  4RGS A;  1O7F A;  1XGN A;  3WGH A;  3WTV C;  4BYY A;  2KIF A;  3GZ6 A;  2DK8 A;  4L9N A;  3GF2 A;  4U0W A;  2STW A;  1KU2 A;  3RYP A;  1S6L A;  1XN7 A;  1G3W A;  5H6R A;  2MLG A;  5ILV A;  1BI0 A;  3DEU A;  2XAS A;  2HKO A;  2EK5 A;  1XSD A;  3T8T A;  4A5M A;  4WX9 A;  4LLN A;  1TQI A;  5A2Q K;  1R36 A;  3HSF A;  4AD9 A;  3HRT A;  2FML A;  2CFX A;  3CUQ C;  4HA8 A;  1W4M A;  4A2U A;  3RJP A;  2CWE A;  5HDN A;  1USS A;  5E20 A;  5ICG A;  1J0R A;  2QUF A;  3I58 A;  1UHM A;  3S2W A;  2IPQ X;  5D6F A;  1E17 A;  5D4R A;  1ON1 A;  4I98 B;  1F1Z A;  2F5E A;  1QZZ A;  2HOE A;  4CHU A;  1ZLK A;  4KIG A;  2VOP A;  2RVC A;  1P6R A;  2JPB A;  4HLY A;  4NB5 A;  2BYV E;  1ZG5 A;  4RGU A;  3PFI A;  4HDU A;  1MDM A;  3J80 K;  4ETS A;  4YFN F;  2XAF A;  2GWR A;  2QQ9 A;  5ILU A;  1YS7 A;  1IF1 A;  3F3X A;  4PCQ A;  1L3L A;  3GW2 A;  3F8C A;  3KP2 A;  2MD5 A;  2DBB A;  1EH7 A;  4RGR A;  4GYI A;  2M45 A;  4Q48 A;  2KJC A;  2YPR A;  3KLO A;  4ZYH A;  3R61 A;  1B4A A;  4UXN A;  2HZT A;  4R79 A;  3ROU A;  2QZ8 A;  3V7R A;  3E97 A;  2EFN A;  2EFO A;  4IRI A;  1QQI A;  2MA3 A;  1K7A A;  5IT9 Z;  3E6C C;  2XGX A;  2VXZ A;  2CSO A;  3QU6 A;  3I5U A;  1P2F A;  2IT0 A;  1WI9 A;  4IVN A;  4O6J A;  2HDC A;  3FHZ A;  3Q5F A;  3TOA A;  1H0M A;  2IW5 A;  3GFL A;  2H94 A;  1U3E M;  3JW4 A;  3KP4 A;  1FZP B;  3U1D A;  5E1Z B;  3R60 A;  3KLN A;  1RI7 A;  4PGH A;  4BHP A;  1FX7 A;  3J81 Z;  2ZBK A;  5LRR A;  2M87 A;  2ZO4 A;  1B59 A;  2X0L A;  5H6Q A;  1O3S A;  5K1Y A;  3AAF A;  2PFB A;  4KYW A;  3GFJ A;  5LBQ A;  2F2E A;  1BJA A;  2FNA A;  1TTY A;  1I5Z A;  1IRF A;  5E18 F;  5E8I A;  2XAG A;  4M9Z A;  2O6G E;  4R1H A;  3ELK A;  5K5O A;  4F7Z A;  5CJ9 A;  3CJN A;  1ZRC A;  5TRD A;  5J6X A;  4RB3 C;  3KP5 A;  1DPR A;  2ZNZ A;  1WSU A;  3CUQ A;  3LQR A;  1TNS A;  1O3R A;  1IN8 A;  1I1S A;  4U7B A;  1LEA A;  4CZZ A;  2PN6 A;  3ECO A;  1TQM A;  1U5T C;  1X3U A;  4Q4Z F;  4XSZ F;  4MEX F;  4HLX A;  3DF8 A;  3VB2 A;  1V3F A;  4OIR F;  1BI2 A;  3GXO A;  1HSJ A;  4UHT A;  3I71 A;  1R58 A;  1W7P A;  2D1V A;  3CO7 C;  3TGN A;  2PMH A;  5HS7 A;  4TV7 A;  4L5I A;  5HS8 A;  2B0L A;  2NAZ A;  4IJA A;  1Y0U A;  2VOD A;  4ZH4 F;  1BIA A;  2C6Y A;  1KQ8 A;  3DV8 A;  3QOP A;  3I54 A;  3WTS C;  1OKR A;  1HBX G;  2R3S A;  2EV6 A;  2MLK A;  1U2W A;  2JSC A;  3WOD F;  5DCM A;  5BPI A;  2FSW A;  2QWW A;  3QP5 A;  5FFX A;  2UXX A;  3RKX A;  1GVJ A;  4G8X A;  4YFX F;  1YW8 A;  5DUI A;  4ESF A;  3DPT A;  2XIG A;  4KN7 X;  2O8X A;  2XVC A;  3ZP5 A;  3B02 A;  5E1X A;  4JQF A;  4XSX F;  2WTE A;  4JK1 X;  5JHU A;  3M7G A;  4KIB A;  3SQN A;  4WCG A;  3IKV A;  1XMK A;  4HQE A;  4KDP A;  2HEO A;  3LA3 A;  3LA2 A;  5D8L B;  4OIP F;  4BQA A;  2HGC A;  1ZHF A;  2OBP A;  3FF5 A;  3EYI A;  4I2O A;  1UCR A;  5H20 A;  3F8M A;  3KZY A;  2XV4 S;  1J2X A;  2H09 A;  3EUH A;  3COA C;  3QPH A;  3FXR A;  1T0F A;  1QPM A;  4HBL A;  3HSR A;  4BAY A;  4G94 A;  4XLN F;  5LHG A;  4LLL A;  3U2R A;  2QVO A;  3FMR A;  3W6J B;  1FLI A;  2ELH A;  2VBW A;  5L3B A;  3BZ6 A;  2Y75 A;  2OZU A;  3G73 A;  2H27 A;  4KIF A;  3FMS A;  4M74 A;  1MZB A;  1XGM A;  2D45 A;  3C1D A;  1W5S A;  3NRV A;  3ULQ B;  2FOK A;  4LG0 B;  4CXF A;  1ZRD A;  4A6E A;  2D1H A;  1TBX A;  2K7L A;  1IRG A;  1DUX C;  3JSO A;  1YW7 A;  1SD6 A;  5D5X B;  2FU4 A;  2Z9O A;  2FQ3 A;  2RQP A;  2PI0 A;  1U5T A;  1T6S A;  3HHH A;  3WU1 B;  3FZV A;  4HZF A;  1K79 A;  1BI3 A;  4UVC A;  3L09 A;  3MQ0 A;  5FLX K;  4MNU A;  1Z6T A;  4AVP A;  2MC3 A;  5CVJ A;  4UV8 A;  2R7F A;  1ZN2 A;  4WXD A;  1JHH A;  2VBZ A;  1HKQ A;  3TDZ C;  3VOD A;  2V6C A;  3K9T A;  1IXS B;  4LK1 F;  5A2Q Z;  1YO5 C;  3PQJ A;  2ISY A;  1IN6 A;  4B8X A;  3BJ6 A;  5D5U B;  5HLG A;  3GVA A;  4M72 A;  3G3Z A;  3GFM A;  2P5K A;  3ZQ7 A;  2PG4 A;  4U7D A;  4RB1 A;  4NQW A;  5F6F A;  3CTA A;  2L3D A;  2LSO A;  3FXU A;  1ZRF A;  3J80 Z;  1Q1H A;  4DNC A;  3W6K B;  1LJ9 A;  1FSH A;  3ZMZ A;  4OOI A;  3T8R A;  2RNJ A;  2PJP A;  4UVB A;  2FBI A;  2K27 A;  3NEU A;  2ZME A;  2RV8 A;  3HOS A;  1O3Q A;  5DD4 A;  3WG9 A;  1DP7 P;  4HF1 A;  2HYG D;  3P9I A;  4LLG F;  4Q47 A;  2LNB A;  4I7H A;  1TLH B;  5D5W B;  1J5Y A;  4L0Z B;  1XSV A;  2DPD A;  2CYY A;  5E17 F;  3V8K A;  5DDG A;  4IF4 A;  3TOB A;  1P92 A;  4HX7 A;  4U88 A;  2QYO A;  4O5V A;  3IC7 A;  1YS6 A;  2CW0 F;  4L9T A;  1CGP A;  3GLX A;  4EJU A;  1HQC A;  2VT2 A;  1CF7 B;  2GIV A;  5LLQ A;  3ZMV A;  1JXS A;  1FSE A;  2L01 A;  4JBA A;  1G6N A;  2OU2 A;  4OIN F;  5L3G A;  3DXJ F;  2HTS A;  5D8K B;  2DT5 A;  2M1B A;  4P9F A;  4DQ2 A;  3F6O A;  2IRF G;  3OOP A;  1A04 A;  2DU9 A;  5JI6 A;  4U0Y A;  3KEQ A;  3N97 A;  4UV9 A;  5FD6 A;  1P4A A;  3HHG A;  1BC7 C;  2XUB A;  3RPQ A;  4M6X A;  4IXA A;  2FMY A;  2UWM A;  1SFU A;  2UZK A;  3R6S A;  1MKM A;  2UXN A;  2YSR A;  1IN7 A;  1IW7 F;  1R23 A;  2NYX A;  1G4D A;  4GYG A;  3T1B A;  4M73 A;  2EV5 A;  3HYI A;  4P5O A;  3RIR A;  3F21 A;  1J59 A;  5HDK A;  1CF7 A;  5TJJ A;  3EQL F;  4LD5 A;  2DK5 A;  4M71 A;  4RB0 A;  3HUG A;  6PAX A;  2NRA C;  3BJA A;  1O7L A;  1XDS A;  2XAJ A;  5LRS A;  4RAY A;  2FE3 A;  3OV8 A;  2V1X A;  2IP2 A;  3I59 B;  4MHG A;  4KMU X;  3P9K A;  2ZJ2 A;  4P9U A;  4L0Y B;  1MJ9 A;  4HV5 A;  3IWZ A;  2E1N A;  5L3D A;  3P9C A;  1G3Y A;  5JVT A;  2QBY B;  4U0V A;  5FB2 A;  2V79 A;  2O3F A;  1R7J A;  3C18 A;  4P55 A;  3WE3 A;  4FT8 A;  2ZFW A;  2GAU A;  2HQR A;  1KU9 A;  1T98 A;  3ZPL A;  4R8H A;  2P6T A;  3HIF A;  1BBY A;  1ZG1 A;  4OMY A;  2CQK A;  3FX3 A;  4YII A;  2OD5 A;  3WGG A;  4Q5S F;  1OPC A;  1KU3 A;  3HRS A;  1S29 A;  3I4P A;  3WTT C;  1QO0 D;  2FEZ A;  2NNY A;  2RDP A;  1LEB A;  2M30 A;  3H3U A;  2DQL A;  1FC3 A;  2QEN A;  5FD5 A;  1HW1 A;  4GXO A;  3ZMU A;  2DI3 A;  3KET A;  2VC1 A;  3KFW X;  4IRG A;  5CVR A;  1IN4 A;  4E70 A;  4EJO A;  1R5H A;  1GXQ A;  3CLO A;  5CVU A;  1FP2 A;  4L9J A;  1YG2 A;  3NQO A;  1Z1D A;  2BBY A;  2CG4 A;  3BOQ A;  1U78 A;  2P7C B;  2P5L C;  1R5G A;  2F5D A;  2HR3 A;  4UNO A;  2FF4 A;  1D8J A;  3BY6 A;  3LA7 A;  4I02 A;  3KP7 A;  1XMA A;  3L7W A;  3FMQ A;  1LDK B;  2DFI A;  5JFR A;  4GO1 A;  5ILS A;  3JSP A;  4YIF A;  1J75 A;  4RAZ A;  1O3T A;  5HLH A;  2JTV A;  4FX0 A;  4CGZ A;  1XD7 A;  2A6E F;  1YLF A;  1XGO A;  3GFI A;  3E5Q A;  3IL2 A;  2O61 A;  1HXD A;  2GQQ A;  2DQR A;  3F8N A;  2XRN A;  5L3E A;  2K4J A;  4EJV A;  4KUM A;  4OIQ F;  3GEZ A;  5DD8 A;  2Z33 A;  1QNT A;  1R22 A;  4UUV A;  2OA4 A;  4G6D A;  1Z91 A;  4A0Z A;  1REP C;  2H6C A;  5LHI A;  2OZ6 A;  1R1V A;  5KVR A;  5HOO A;  4EM0 B;  3RTR A;  1ODD A;  3ML6 A;  4GCV A;  2L4A A;  1RUN A;  4M9X A;  3KZZ A;  1FBQ A;  1T39 A;  4LB5 A;  1OYY A;  1E2X A;  2IJL A;  2GA2 A;  3BJO A;  2KKO A;  5EEG A;  5FLX Z;  2HS5 A;  1YFH A;  5BPD A;  2ADU A;  5ICE A;  1ZRE A;  1I27 A;  1GXP A;  3EYY A;  4EVI A;  1U6G A;  5FO5 A;  2V9V A;  5HS9 A;  2STT A;  5DUK A;  2Z99 A;  3GX4 X;  5BS6 A;  2D2W A;  2JRT A;  1I1G A;  1TW3 A;  2Y48 A;  3TKY A;  3BPX A;  1IZ1 A;  2P8T A;  4G6Q A;  2W57 A;  2BE5 F;  4IPA A;  1FBS A;  4G9Y A;  4CIC A;  4HQM A;  4I01 A;  4EJT A;  4CO8 A;  3LFK A;  5BQT A;  4WWC A;  1ZGA A;  1MJB A;  3L9F A;  4FHT A;  4BXU A;  2GXB A;  2G7U A;  2O0Y A;  5IT3 A;  4KMF A;  1HW5 A;  1H9T A;  2H6B A;  2P5V A;  2A3S A;  2GZW A;  3E5X A;  1K6O A;  2CO5 A;  2VC0 A;  2DAO A;  3JAM K;  1BI1 A;  2Z5U A;  2HQN A;  3WGI A;  4HW0 A;  3I53 A;  2KIU A;  3ZMT A;  2ESH A;  1R00 A;  2Z3Y A;  3WE2 A;  1KYZ A;  3KP6 A;  4BHC A;  3IRQ A;  2A69 F;  4A12 A;  2G9W A;  3JTG A;  2FBH A;  4B09 A;  2J5O A;  3HTU A;  3WU0 A;  3ABT A;  2ETH A;  3RYR A;  4ZYG A;  1FYL A;  3QRF F;  3V7C A;  5HLI A;  3RKY A;  1T38 A;  3QU3 A;  1ZYR F;  3IHU A;  4RS8 A;  3B73 A;  4Y13 A;  5CVI A;  1R1U A;  1ZAO A;  3HOT A;  4XBF A;  1L0O C;  1IXC A;  3TO6 A;  2K02 A;  3LQQ A;  1LVA A;  3DQV C;  1XDU A;  4HX4 A;  4L9V A;  5JR3 A;  1UST A;  3C7J A;  4LB6 B;  1ZG3 A;  3E6B A;  2W84 A;  3PQK A;  4I0B A;  2A6H F;  1ONV A;  2M8E A;  1BOA A;  1JE8 A;  4QWQ A;  3FM5 A;  3KCC A;  4H0E A;  1B9M A;  4LG0 A;  5J8F A;  4G7O F;  3SZP A;  1MD0 A;  1FYK A;  2A5Y B;  3MAJ A;  1RUO A;  4I09 A;  2PQ8 A;  3K0L A;  3ISP A;  3SXY A;  1ULY A;  3BP8 A;  1IUY A;  3F8B A;  2BGC A;  3JTH A;  1HST A;  2JPC A;  4P96 A;  3ZMS A;  2AXL A;  5CYV A;  1LQ1 A;  2EWN A;  1U8R A;  2VBY A;  5EEH A;  3R4K A;  4CYD A;  3FM3 A;  4BNC A;  3Q9S A;  1PP7 U;  1SFX A;  1S8N A;  1XGS A;  1JHF A;  1ZGJ A;  2XAH A;  3TQN A;  2A68 F;  1G3T A;  1PDN C;  1LNW A;  1WQ2 A;  1FT9 A;  1RNL A;  4ESB A;  4ZZL A;  2QQA A;  5DEQ A;  3KP3 A;  5BMZ A;  5E1W A;  1BM9 A;  3WTW C;  3MZH A;  3CO6 C;  5LGN A;  4KNY A;  2DO7 A;  2IVM A;  5ED4 A;  4Y17 A;  5LEK A;  2VN2 A;  4UVA A;  3DKW A;  4S05 A;  4ENN A;  3CUO A;  1MDM B;  2LKP A;  4Z2Y A;  3LWF A;  4MEY F;  3REO A;  1PUE E;  3KEO A;  3RI4 A;  3O3K A;  2XAQ A;  1SFE A;  1KU7 A;  1HW2 A;  2HWV A;  1BN5 A;  3O6B B;  5HVQ C;  5LGU A;  1D5V A;  3QPT A;  3SHF A;  3D0S A;  1Z7U A;  3KE2 A;  2ZCW A;  4KA4 A;  4HAM A;  2WV0 A;  2XKO A;  3WTZ A;  5LGT A;  2MH2 A;  3HRU A;  2ZNY A;  4FX4 A;  1FOK A;  2F5F A;  2HYF A;  1Z9C A;  2X4H A;  4ENK A;  1Z6R A;  3MEX A;  3RKW A;  4ZYD A;  2KJB A;  1V4R A;  1T2K A;  1F5T A;  4LGW A;  3V8L A;  1HKT A;  1SAX A;  2HKX A;  2EA4 A;  1SMY F;  3M8E A;  3F72 A;  3GO5 A;  3I0T A;  1IN5 A;  4MGR A;  1TW2 A;  3E6D A;  3Q9V A;  1KGS A;  4RGX A;  2E7W A;  2LF8 A;  5ICC A;  4EMS A;  2PLY A;  4BH9 A;  3MZY A;  5ICF A;  2VOO A;  4LJZ F;  5DYM A;  1KYW A;  1ZH5 A;  5DCF A;  4M9S A;  2Q2E A;  4ASN A;  2XRO A;  3K1P A;  3L00 A;  2PMU A;  3BWG A;  4XRF A;  1EV7 A;  2RC4 A;  1FBU A;  4HF2 A;  1BC8 C;  4EGY A;  2IA1 A;  1EH6 A;  2EFP A;  2GA1 A;  1FPQ A;  4OU0 A;  1SD5 A;  4I0A A;  4K2E A;  1DPU A;  3R0J A;  4PGG A;  2QQB A;  3ZN0 A;  3RDI A;  1B1B A;  4G7H F;  3WTU C;  2EJR A;  3T0Y A;  1G3S A;  3K1N A;  2RKH A;  3K2Z A;  3CUQ B;  3TO7 A;  4N0B A;  1SD4 A;  3I59 A;  3CDH A;  1OYI A;  5AIP A;  4PZJ A;  5K5Q A;  1YIO A;  1D8K A;  3T5X A;  4AIH A;  4G7Z F;  3BDD A;  3I64 A;  1AWC A;  2QBY A;  3RPU A;  5ERI A;  2IA2 A;  4LK0 F;  2WWY A;  1W7P B;  1O57 A;  3P7N A;  4EQQ A;  1MJA A;  3GYH X;  2BEO A;  4OMZ A;  1XSX A;  3V8J A;  2VE8 A;  3V7S A;  3K1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...