3G71I

Co-crystal structure of bruceantin bound to the large ribosomal subunit
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 8
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3g71I00
3DLLF 3J7YJ 2ZJPF 1FOYA 3I56I 3CCUI 1YJ9I 3PIPF 2ZJQF 3G4SI 3I55I 2QEXI 2ZJRF 4UY8I 5GAEJ 1VQOI 3CC7I 1YJWI 3CJTB 3CF5F 1YI2I 5GADJ 2FOWA 3CCEI 5JVGF 1VQMI 1YIJI 5GAGJ 1VQ5I 3G6EI 3CC4I 1HC8A 2NXNB 1VQ4I 4IO9F 1FOWA 1ACIA 2E36A 1QA6A 1VQ8I 1VQLI 3CC2I 4IOCF 5DM7F 2H8WA 2K3FA 1Y39A 3CCQI 1VQ9I 2QA4I 1VQ6I 3CCRI 1VQPI 1YJNI 4IOAF 3CD6I 3CCJI 3CCMI 1VQKI 3CCVI 1S72I 2JQ7A 3CCSI 2E35A 3G71I 3CMAI 1MMSA 3CCLI 2OTJI 2E34A 5GAHJ 3CMEI 3PIOF 1YHQI 1VQ7I 2OTLI 1FOXA 1YITI 5DM6F 4V19K 3J7ZI 1VQNI
chains in the Genus database with same CATH superfamily
3F8CA 3FXOA 2ESNA 3WODF 3BROA 3R61A 3SYTA 5IP6A 4UY8I 3TDZC 2ZSIB 3FK7A 2FOKA 5EGOA 2NVXJ 2LY9A 3PO3J 2D2WA 2P5VA 5L3EA 2DA5A 3SXYA 2HQAA 4D0PA 4PFPA 1MSFC 2A05A 1SD7A 3CD6I 2NVTJ 1R9TJ 1R1UA 2I10A 1T8IA 1LVKA 1S7OA 2J5PA 3KEOA 4O5VA 2QGUA 1BI2A 2VKEA 3MZHA 2XF7A 2HOAA 1EKEA 3JTHA 1H88C 1X19A 4HSRA 4RGXA 4KDPA 1XSDA 1XCBA 1ZLJA 3H9JA 3A1YA 2QYOA 1ODDA 5FFXA 2KPMA 2DA6A 2Y0SA 4BE0A 1FYKA 3K4CA 5GADJ 1NK2P 2A6EF 4RB3C 4DYQA 3BZCA 3S3NA 1AOYA 1E3PA 4EJUA 4BS9A 1BJZA 4E7ZA 3KP3A 4I7HA 2CUFA 3W6JB 4PJJA 2DT5A 2OQGA 5FJ8J 4XLNF 1XGNA 3IWZA 3F8MA 2ZKZA 5K1YA 3PO2J 3LFKA 5F0HA 4PJLA 2EIJH 4CYDA 3BR3A 4BYYA 4LOCA 5C4XJ 1G6NA 2M1BA 2VBZA 4A3CJ 2DI3A 2L2OA 4I02A 4FHTA 3RKWA 4CCLA 2KIFA 1T98A 3WG7H 1SMTA 3EYYA 4PJNA 1KYZA 1IN5A 3ABUA 3KFWX 3PUFA 2LC2A 5L3DA 4BNCA 1FC3A 4O6JA 4RDUA 3ZN0A 2XDVA 5KAFC 1E3HA 5EEGA 2DQRA 4M74A 3O2PE 2FU4A 3G1MA 4NUBA 1IRZA 2QQBA 4IZZA 1WH5A 2Y75A 4E6KG 4C3IJ 1F5TA 4BY7J 3FK6A 3B6CA 4XIDA 3BP8A 2WC2A 4MFEA 4GFBA 1W7PB 3RSNA 4N4NB 4HAMA 2RNJA 4ENJA 4AYBN 2A61A 4NQWA 4Q5SF 4YELA 2K3PA 5D8KB 3VYUB 1BI0A 4R79A 2OCCH 1SFKA 1SEUA 2R92J 3DPUA 1ONVA 1W7PA 1UHMA 4HQMA 1JUSA 4H0EA 1KU7A 2DQLA 4MHGA 1AHDP 4EGYA 3SEZA 4MO7A 4U0YA 3KP7A 1PUFB 2OAZA 1Z3YA 3RQ4A 1TL8A 3VWBA 4YEJA 4RS8A 2DOFA 2K9NA 3HRSA 1N75A 3HKZA 3CC2I 5B1BH 2FXAA 2X48A 5FLVA 2L9SA 1LJ9A 3VSKA 2Y9YA 2VJ5A 2L7FP 3IC7A 3S15J 3HG9A 4ZC3A 2XPVA 5E3NA 1I1SA 2EZKA 1NHAA 3LSKA 2DA2A 2WB1N 2XVCA 2ZNYA 4NC6A 3OSFA 4IQJA 2QQAA 1FWZA 1BOAA 1D0YA 3BC8A 4F3QA 4WWCA 3U9GA 3FM3A 1YJ9I 2EJRA 1WI3A 1YJWI 1LFUP 4PSWA 4AUXA 2Y31A 4JP0A 2E71A 1XN7A 3IV5A 4LFUA 5EEAA 3CO7C 2Q2EB 4Q47A 3RCOA 3KIOA 1MMDA 3PNTA 2JQ7A 3HOVJ 2ZCWA 4AYBA 4QLCU 4WXHA 1TWFJ 2LY1A 2BY3A 5CVIA 4BJ5C 2XGEA 1LE8B 4BXUA 1JGGA 3GZ5A 1QVTA 1SAXA 2KRFA 1X4OA 3QYBA 5GAEJ 5KNLA 3I4MJ 3TOBA 2V9KA 5JVTA 3CJQB 4CCOA 4DZJA 2NVQJ 2VQCA 2KISA 5IPAA 1JUPA 1W5CC 3GUDA 2LK2A 5CVVA 3E97A 4IRIA 4XR6A 3IRRA 1G3YA 2MGQA 1QGPA 2IA1A 4CICA 2O61A 2W84A 1USTA 2O0YA 2DMUA 3HTSB 3HBLA 3CESA 1IV8A 5CKTA 3JRIA 1SFXA 4LGWA 2V1DA 2W00A 1UB9A 4RA2A 3CC7I 5IYCJ 4LIUA 2XIGA 3DPLC 2EH3A 3AFHA 2JUGA 3HKZN 1U8BA 4EJOA 4PZJA 1FTTA 2PFBA 1TT5B 4CCJA 3SQNA 1YS7A 4UVCA 2V79A 4F91B 4CCNA 2Q8KA 4OAZA 3ECHA 4XNFA 3ZQFA 1P2FA 1QHGA 3RZOJ 4I09A 5HODA 3DU6A 3E6DA 4A3FJ 3K4MA 2JK3A 4QPQA 4Y13A 2XROA 4MTDA 2CQQA 1IW7F 3L09A 4UV9A 3M8EA 3I4PA 1ZYRF 5ILVA 2Y0SN 1QA6A 1VQLI 3BCBA 3I64A 2L0KA 2ZXWH 1UZCA 3C1DA 2DMNA 2R7WA 4LMYA 1V5EA 3M8JA 3NQOA 4UUVA 1XGMA 1DUXC 4B3XA 2RQPA 1JE8A 2QKMB 2W85A 3E1SA 2QBYB 2EK5A 3I54A 4JX5A 4U7DA 2VPLA 3JW4A 4ZJZA 2ZSHB 5L3CA 2HPMA 3BDDA 3WTVC 5E18F 1YI2I 1FT9A 2LSOA 2VB6A 1WKMA 1Z3XA 4C2UA 2STWA 3M7GA 3Q0UA 3CUQB 2RREA 2W1OA 3I3LA 1AWCA 1IUYA 2XSDC 5H2FC 2LY2A 1IN8A 2DMPA 2HQRA 3K0LA 2XGCA 1DQUA 1I1GA 2VOPA 3JRDA 2CJJA 2MH2A 2JPBA 1XCVA 5FKOA 3H3VK 5F04A 5LEJA 3QOPA 2FQ4A 4IJAA 3O8HA 4PDKA 2WY7Q 1R22A 4YFKF 2HEOA 3F0CA 1FOYA 4F7ZA 4EM0B 3BG9A 1JI8A 3MKZA 3F9KA 3E0JB 4N0BA 3KLOA 4NB5A 1PVEA 2NXNB 4IHVA 3HIFA 4YIIA 4Y52J 1HW1A 4HEA2 1IXRC 1Q1HA 3CP2A 2OV7A 1ZKGA 5HLIA 4P1WA 2O7OA 3RQIA 3CQZJ 1X1CA 2JRMA 3JTGA 1ZK8A 3LSIA 1L0OC 2K4BA 1GXPA 2F4IA 1WJ5A 3KYDB 2QSGX 3S2HJ 2VI6A 5EG0A 1K4SA 2DFFA 4IHYA 5J3LA 2EFWA 1V5GA 2BY2A 4M3BA 2VKDA 2GOXB 2VN2A 2DO7A 2FOWA 3FISA 2XAGA 4L9JA 4MGRA 3LNQA 3HRMA 1QHHD 1LUJB 3CP8A 3H5AA 1A31A 2P0WA 4MEYF 3WHBA 5FD6A 4UUTA 1YS6A 4OIOF 4IHSA 2MD0A 3SHFA 3QU6A 1W36D 2X1DA 3ZR8X 3CMEI 1H89C 1EA3A 1YW7A 2XAHA 1ZRCA 4PK4A 1X3WB 1W0TA 3I58A 4D1QA 4UVBA 3OYLA 3H5RA 3ZMSA 1XTAA 5C44J 4LG0B 2E7XA 1XMAA 3G1LA 2UXXA 4AD9A 3V7CA 1T38A 4V2GA 1D5YA 2IGMA 3ISPA 1KZHA 3U1KA 4PGHA 4P9FA 1CF7A 4M3DA 2DDAA 5K5RA 1E0EA 2OJED 4M3FA 4MNUA 3H0DA 3DWLE 3JRBA 4TV7A 3ZGKA 1O3TA 2HR3A 4AM3A 4ZYEA 1YHQI 4BQAA 3KP5A 2R7VA 5BS6A 2XUBA 3QOEA 2Z16A 2DOAA 3OS1A 2XB5A 3VPRA 3P7NA 2IVMA 1B8IA 4YFXF 1ZGWA 2LF8A 1YW9A 5LFAA 4LK1F 1BW5A 2GAUA 3MWMA 5TRDA 2Y30A 4OOIA 3VB2A 2DTRA 3CF2A 5D5UB 2VLAA 1ZG1A 1VQPI 1F36A 2EPFA 3AKZA 2LR8A 1G4DA 4F92B 3BTLA 1TZLA 2B9SA 3RDIA 5JR3A 3H36A 4YRVA 1SFEA 4LLLA 2MLKA 4HQEA 2XRNA 2E19A 4E70A 5J1UA 4P96A 3IH2A 2O5RA 1LKXA 4OWRB 1MD0A 3FM5A 1Y8QB 1YLFA 3I55I 3KLNA 5FGMA 3GF2A 3FZVA 3CF5F 3LMMA 1ETYA 2VE8A 2ZXHA 5K5OA 2DA1A 2EV5A 3QYFA 3GYHX 3RZDJ 2KDZA 4C9YA 3FIWA 2UWMA 1P4WA 1S6LA 1APLC 3CCVI 4AIJA 4LB6B 5F08A 4LITA 1GDTA 2HYJA 3WTYC 1KA8A 2JA7J 2E2IJ 5HS7A 3U21A 3ZQIA 1BW6A 3SFIA 1TNSA 2HS5A 2Z3YA 4I01A 2QCOA 3LA2A 1Z0XA 4B3AA 3CLOA 5J4YA 5J4VA 3WTSC 2Q2EA 1T95A 3GFJA 1UG2A 3CLQA 2YS9A 5FROA 2WAQA 2FMLA 2EZIA 4R8HA 2OF7A 4XSXF 4IRHA 3TMOA 3WU2C 4XLFA 1FY7A 3GTKJ 1DPRA 1UELB 1OCOH 2IGNA 2V1XA 1OPCA 3BJAA 2HQNA 4HG2A 1U8RA 4DYRA 2CU7A 1MGTA 1JTXA 2DJNA 3E5XA 1CQTA 4AVPA 3K10A 2H8RA 2B7EA 3E3VA 2GQQA 4DGWB 3DQVC 2EILH 4A93J 3H92A 1I6HJ 2FBHA 3BTJA 3FHNA 1FLIA 3PSIA 1HBXG 1B59A 1HXDA 3MFKA 1ZH5A 1IDYA 3TOAA 4HNTA 3S93A 5J6XA 2L3DA 2UUZA 5E3MA 2R7TA 5LGUA 1ZG3A 1ETXA 1ITYA 3LSGA 3G73A 5IP9J 5ICFA 1L3LA 1MSEC 4YG2F 2IS1A 2R3SA 2K7LA 4UB6C 2QEXI 1SD4A 4FTHA 3U2RA 3M07A 4E4HA 5E1WA 4LLGF 2OD5A 1OQYA 4XN3A 4MQ9F 3K2AA 2D5VA 1XPXA 3W2WA 5D5XB 2R7SA 3L7WA 1CGPA 3DKYA 2VBXA 1DP7P 4XLAA 5DCMA 4IX7A 1IC8A 2QSHX 2HKOA 5H20A 4DNCA 2QWWA 5TJJA 2OPTA 1K79A 1OCRH 3IH4A 1MNDA 4XQFA 3GVAA 4ANJA 4E7SA 4F55A 2HTSA 2O9LA 5AONA 4HRIA 2LNBA 3BR5A 1SC7A 2XRLA 4X6AJ 1P4XA 1IZ1A 2GA1A 2R0QC 2HXOA 3BWGA 3BJOA 1D3YA 3B73A 3FBNB 3GTJJ 1P4AA 2ZB9A 4II2A 2IGKA 2L54A 2M0MA 5IYBJ 3M4OJ 1FMVA 4BQOA 2ME6A 2M8GX 4S05A 3HGGA 5D4SA 3BY6A 1T0FC 5B5EC 5HLHA 2BZTA 3EYIA 4M9SA 4A0YA 3BT9A 1X3UA 3KP6A 3FKJA 1YRNB 1Z1DA 2BXYA 4RB0A 1SANA 2G7HA 2LYCA 4HZFA 3BG6A 1SVLA 4B43A 4BJ6C 1HCRA 4U0WA 4BAYA 5FLMJ 4DBQA 3H1CA 2ZXJA 3PM1A 3V42A 2ID3A 3S1NJ 3RYPA 1D1CA 4Y15A 1FP2A 2KFDA 1RI7A 1I3QJ 2Q1ZB 3ROUA 4A3KJ 2ECBA 2HDCA 4HF2A 3TP0A 2OA4A 1FOKA 1MNEA 3S1QJ 3GBGA 2GLOA 5EF6A 2ZJQF 3JR9A 1TQPA 4A3JJ 3MZ8A 2CGPA 4M6XA 2STTA 1ON2A 2XB0X 4M3GA 3H3ZA 3ZP5A 3QODA 5EZHA 4UV8A 1MBJA 1QBJA 3CMYA 4N9HA 4DZPA 4BEHA 4M6YA 3KYCB 3COAC 2NVYJ 3ZMVA 3W3CA 1J09A 3Q3SA 2IBDA 2VBYA 4RGUA 2CW7A 4Q48A 2K02A 1D0XA 3C3WA 2CQXA 4NC8A 2HXIA 2VODA 2CH0A 1QVUA 2W25A 2CRGA 2WAFA 1DGWY 4LK0F 2EQRA 2GIZA 3OL3A 4XL9A 1OLTA 2CS3A 2H1KA 4D5FA 3J80K 2DT6A 1R7JA 4L9VA 1VQ5I 1FJLA 3HUGB 1USSA 2KRCA 1V4RA 2FNPA 3U1DA 4X0GA 1IDZA 3MAJA 3WTZA 1WJEA 1X1BA 5JHUA 1O3SA 3J81Z 3HEFA 4G94A 3GTMJ 2G7UA 2HFHA 4N9IA 2YR2A 4E7IA 3QPTA 4BXFA 4RB2C 3WTTC 3LSTA 2EFQA 4RLQA 1YX5A 3GTQJ 1LDKB 2MD5A 5HDNA 1GV2A 2BEOA 2OQRA 3NWTA 3H35A 3TKYA 3WTWC 1AKHA 3DFGA 1FP1D 2JN6A 1NG6A 1XGOA 3VEPA 4AIKA 2HDDA 1D8KA 5J47A 1VQMI 2ETHA 3VDXA 1HW5A 3WU1B 5BPIA 1CF7B 1QQIA 3C18A 3IP4B 3RPUD 3UR3C 3IH3A 3V7SA 4FQGA 4IVNA 3D5LA 1U5TA 4MIMA 2Z33A 4IL6C 1R36A 3BR2A 5IOYA 5J40A 2Z5UA 1STZA 3BOQA 3P9IA 3N97A 2OU2A 2RGVA 3EETA 5FD5A 1U5TB 4W97A 5AIQA 5KHDA 1BR1A 4EGZA 2K9QA 3DEUA 5GAGJ 4AVZA 4XRMA 1ZELA 4JQFA 5JLWA 4DYCA 2HQ5A 2K3FA 2QQ8A 2EA2A 2MC4A 3PJRA 3CCRI 1D0ZA 1RKWA 2EZHA 2M4GA 4B09A 1BOBA 4UVAA 4OINF 3C2HA 2LVSA 1K78A 1IRGA 5GTHC 5K5QA 4BE2A 3FXKA 1UHWA 2P81A 3J81K 1R1VA 1FBUA 3B02A 3QQAA 1ZRDA 2GM4A 1BC7C 2ZMEC 5IP7J 3S3OA 2PMUA 5DDGA 3KE2A 4IEJA 3LSPA 3CUQA 5E17F 3ZMTA 1W7PD 2ZXIA 2CMPA 3ZMDA 3OSGA 1DDNA 3DTIA 2LKPA 3ZXSA 1JTYA 3ULQB 2ISZA 1EV7A 2FF4A 5EGOB 1E2XA 3ML6A 3GXOA 1NG7A 2UV1A 4EJTA 3E6MA 2VC0A 1RKTA 2K85A 5DUIA 1FTZA 2V26A 1RPWA 3WGGA 3BR6A 5BOXA 2KP6A 5DM6F 3PFIA 1D5VA 1DU0A 1B6AA 2CFOA 4KITB 1Q1VA 1LDJA 4UB8C 2W48A 2I8DA 2DXIA 2R93J 1FBQA 2L02A 4KIFA 4CYCA 3KETA 3HGYA 6PAXA 1D8JA 3TBIA 4ZYHA 1V55H 1YIJI 5D4RA 3KZZA 5HS9A 2VONA 5F27A 1WJDA 3MKYB 1X2NA 3I59A 1YYVA 1N77A 1ERDA 4A12A 3A4CA 3KX2A 3K4KA 3G3ZA 1ZQ3P 2X9DA 4U88A 4XBFA 3PIOF 3T8TA 4HX8A 1E3OC 3BTIA 5B1AH 1IUFA 2R7QA 3M3YJ 2OBPA 5FKNA 5E1XA 2ZJRF 2HOSA 3V8JA 3DCFA 3GTOJ 2QZ8A 1P6RA 2EWNA 3TO9A 1ETKA 3JAMZ 2E1MB 3MEXA 3SDBA 5F1JA 1HOMA 1VQ6I 2UXNA 1ZGJA 2CQKA 1KU2A 1ZN2A 2DLLA 4GXOA 4E7HA 3GLLA 3SEQA 3CCLI 5ED4A 3OYKA 1OYYA 1YE9A 2V9VA 5FRMA 2V7FA 2PMZA 4Y33A 1LFPA 3J7ZI 3MKLA 3G1OA 1K83J 2KDOA 3OYHA 2X0LA 5IY5H 3TL4X 3OYIA 2PI0A 3JRHA 3QWLA 3DPTA 4B48A 1PP7U 2DPUA 2MYSA 3PQJA 3IAS2 2P6TA 4CUGA 4WXDA 4L5EA 4M9XA 4XICA 3IAM2 3LL7A 4JBAA 4WF2A 5EZGA 2E7WA 1RIOH 5M5XJ 1OR7A 4BHPA 2PJRA 1HDDC 2YUSA 5DEQA 1I5ZA 1QPMA 4IXAA 4C3HJ 3R6SA 2D1VA 4LLNA 2E2HJ 1N78A 3FDYA 3DTKA 4BE1A 1WHUA 3AAFA 2ACJA 2JWTA 4RAZA 4BHCA 5FLXZ 5ICGA 3HM5A 2H6CA 4KN4X 1EH7A 3ZQLA 3BR1A 4LG3A 1UMQA 5F1RA 1F43A 2IXSA 4QWQA 5L3BA 5CJ9A 1VI0A 2VASA 4CZCA 3CJRB 4YIRX 2XF6A 4HV5A 4P55A 3FKIJ 1YITI 1WVRA 4S04A 3A0BC 2ADUA 3FXUA 2QENA 2LKSA 2PX9A 3K4LA 4L9TA 3W6KB 4FX4A 4GCVA 4JX6A 5KCMA 1OKRA 1QO0D 1U0JA 2ZO4A 2FQ3A 1VQ4I 4CXFA 1HF0A 4P5OA 3C7JA 4U7BA 2DTZA 3F21A 1YJNI 2ME0A 4IOAF 2NOGA 4OIPF 3BQYA 1SFUA 3SZTA 1ZLKA 2XGXA 5FKMA 3BLYA 2Y69H 5GPAA 4ZH4F 3CMMA 4HOBA 1T56A 2M45A 2BHYA 4X1EA 3W2VA 4WK8F 4A3GJ 1TWGJ 2NS0A 1JJ6C 5M5YJ 2KLOA 3DEEA 2EBIA 3ERED 1O57A 4G7HF 2H8WA 1DP3A 3ESWB 4EEFG 4ASNA 1IO2A 2NNNA 2H27A 1ZR2A 2D45A 3Q9SA 4F52A 2JSCA 4E7JA 4KIBA 4QSHA 5EYRA 2ZBKA 1O7FA 2BY0A 2CQ7A 2YX4A 5LGNA 3ZN1A 4BBRJ 2KKOA 4KNYA 4HW0A 4XOPA 3R4KA 4LIVA 1RRJA 2CW8A 1Z7LA 2BBYA 3PNVA 1ETWA 2KL4A 3OYEA 3GZ6A 2JA2A 2QA4I 3BG5A 1QZYA 3OYGA 3S1MJ 2CV2A 2M9HA 1MIJA 1WPKA 3SJMA 1TBXA 5EJCA 1U2WA 3H5NA 1LQ1A 1TW3A 3J7AY 1RETA 2E60A 5ERIA 2W24A 4HX7A 3IHUA 1RUOA 3ASOH 5FKLA 3HL2A 3GMEA 3M9AA 3K1PA 5ILUA 1OCPA 2JVGA 3M1EA 3ZRGA 3VYTB 3ERMA 3HHGA 2G0EA 3FXQA 3O3KA 3AG3H 3ZOBA 2VXZA 4ZTFA 4AWXB 1UCRA 2F2EA 3V7RA 2GXBA 3OYNA 4XKBA 4KIGA 2ID6A 1LDDA 2H09A 3K1NA 5DUKA 2BW3B 4LB5A 4N4OB 3Q9VA 1A6QA 1S29A 4C2MJ 1J9IA 1TP4A 1VQOI 3LA7A 3LQQA 4XOTA 3AG1H 3NWSA 5K7HA 4EMSA 1F4KA 4PJ0C 4KN7X 4NDLA 3P5JA 3HSFA 1Z6TA 3V8KA 4P9UA 1FYLA 3D5RC 2CWEA 5CVJA 2IS2A 3FX3A 3CCJI 1TWAJ 3HYIA 4DQ2A 4PJMA 3RIRA 4OIRF 1U3EM 1T6SA 3AG4H 1TWHJ 2IT0A 1GVJA 2EZLA 2ZMEB 1H8AC 2VJIA 4W1UA 1Y0NA 1B72A 3FXRA 1MBFA 1VNDA 3K70D 5GP9A 3L2CA 3HRUA 1REPC 1KQ0A 1ZTRA 1W0UA 2N8GA 1WZ2A 2E5NA 2JMWA 2ZMEA 4XKWA 3BG7A 2JA5J 2RDPA 5B3SH 2JSPA 4HLYA 3ZMUA 1YG2A 1GVDA 4B44A 1VQ8I 2XV4S 1GLNA 2V9PA 3MMYB 4NNJA 3W6VA 1Y6IA 2PBIA 4B4CA 4XMYA 2PJPA 4QTRA 4I99C 2DYRH 1QZEA 4ZTJA 1K61A 2PN6A 3ONQA 3DLAA 4HDUA 5GAHJ 2W7NA 2IJLA 2WY8Q 5D8LB 5HNFA 3I5UA 4CDGA 1UG0A 1X58A 3ELKA 4EV0A 2MG4A 2R7OA 1XMXA 5HS8A 2JA6J 4FISA 2C6YA 4CHUA 3OS0A 2CG4A 2EFOA 3E7LA 4V2FA 4Y4RA 3AL0B 3PFYA 4I76A 3F6VA 3S32A 5FRNA 3GZNB 3ZQQA 1EH6A 1HA8A 2XAJA 3LSMA 4A6DA 2E34A 1GUUA 1K6YA 5K7ZA 1BN5A 1O7LA 3DLLF 2XAUA 2XKOA 1OISA 3D5SC 2VXDA 3BJ6A 3O6BB 3CJTB 4L9NA 1P7IA 5IT9K 5FLXK 1NH3A 2K9MA 2XAQA 5ILSA 4U87A 1TW2A 1JGSA 1MZBA 1U6GA 2VT3A 4KMUX 1BA5A 3TDUC 2VUMJ 1MBHA 2WAEA 4ESBA 4PUSA 2JRTA 1YX3A 4B1RA 2L5QA 5F0CA 2IEKA 1K4TA 2BOLA 3OIQA 4G6TB 1WI9A 3CCYA 1HLVA 4HA8A 4WXCA 2E1NA 3TEDA 2DW4A 1SFOJ 5D5VB 2VC1A 4HDVA 1FOXA 4XONA 3GCMA 3WU0A 1FEXA 3I71A 3VYRB 2ELJA 4Y17A 3BG3A 5CQGA 2DA4A 3G4SI 5IT3A 4AU7A 1VF9A 1ZRFA 3MQ0A 5E8IA 4RGSA 3A03A 4AIDA 3OOPA 1WJAA 1EJ9A 3IUOA 2M4KA 2FD5A 5HLTA 2X6XA 1ZREA 1R5ID 1ENHA 3CJNA 3QYEA 1B8IB 1V5FA 5LD2C 5JLXA 3DKWA 2E5ZA 4J01A 1P7JA 2JTVA 5D6FA 2FMYA 4KISA 2P4WA 1X1PA 3KZYA 4YIFA 3GWZA 4KA4A 3VSLA 5KK1A 2DODA 4G6QA 1W5SA 2WB1A 2AO9A 1GT0C 2EIKH 4HF0A 3WHCA 2RKHA 3ABMH 5EEHA 3FBIB 2FEZA 4B8XA 3JAMK 2FRHA 5H6QA 3CC4I 2FBIA 1RESA 2DAOA 3M1CA 2HOEA 3CDIA 2WV1A 1FIPA 3FXJA 5LRRA 3TP3A 3L2UA 3K70C 1ETOA 1ETQA 4RAFA 3CCQI 3PL8A 4L5JA 4RM3A 1T0FA 1ZGAA 1OCCH 2OC6A 1TNTA 5HOOA 3F23A 2CUZA 2OTJI 4XRSG 1XMKA 2CFXA 4BKXA 4Y3OA 2WV0A 1X1AA 3FMSA 2X4HA 1SD5A 2CO5A 2MW8A 3CCUI 3RPUA 3ECOA 4EVIA 3GFMA 5F64A 1KU9A 3J7AO 3TQNA 3HPGA 4B47A 1MJAA 4A3LJ 1FZPB 1UHSA 1R5GA 2IPQX 3HZJA 3VFZA 1SVMA 2J5OA 4IOCF 2IA0A 1QNTA 2LFBA 1VFCA 2HOTA 2R7XA 3I59B 2QUFA 5D5WB 2EV6A 2QLZA 2KJBA 4M6VA 3GTGJ 4ZDPA 2H1LA 1NTCA 3IRQA 3V4GA 2GA2A 2VQLA 1Z67A 4OIQF 4GYIA 3OV8A 4ZZLA 3ZCOA 3BPVA 3H9QA 3QP6A 4ZZDA 3OS2A 3KP2A 1TWCJ 1TQIA 2FUG2 4M73A 2V6CA 1K6OA 1V3FA 4UNOA 3NRVA 1OYWA 2X85A 5E1ZB 2EINH 2A68F 5J1YA 2XKPA 3ABLH 1S3JA 4EATA 1JXSA 2EA4A 3BZKA 5IYDJ 3DEWA 3F8NA 2CUJA 2O3FA 5LLQA 1MBEA 2O03A 3H0GJ 4Z6YA 5J8CA 4Q4ZF 3I56I 2F5CA 3KP4A 4ZYAA 3MKWB 1R58A 1D1BA 2PQ8A 3S14J 1EH8A 1KQ9A 1U5TC 1WWXA 2HPIA 4I0BA 3Q0WA 3N05A 2YU3A 2LOOA 3WG9A 1SMYF 4EJVA 2GWRA 1XSVA 2E1CA 3HDDA 1Y56A 3DP7A 3HXLA 2JT1A 1GXQA 5LHIA 1PP8F 1YW8A 3GFIA 2F5DA 1ORKA 3HJEA 3RPQA 2Z99A 1IJWC 3QPSA 3FXMA 2LG4A 2WADA 5LHGA 2X51A 5J1RA 2Y0MA 1MBKA 3QAHA 4ZDOA 5DD4A 2RAEA 1R49A 3TGNA 4BHBA 4PSXA 3T0YA 1YFHA 1OMIA 1SD6A 5DD8A 2XPUA 2W82A 1AU7A 2HVQA 4XKVA 4XLHA 5L3FA 2PMHA 4AIHA 3E5QA 2ISYA 3LAPA 2DBBA 1MKMA 4II3A 1HC8A 2ZFUA 4G12A 2RC4A 3IKTA 2P7CB 2Q0OA 2IGOA 2TCTA 2PJRB 2M5WA 2JPCA 3MVPA 5DCFA 1KONA 1A35A 4OMYA 1XDSA 4JK1X 4HYEA 2XHKA 4MFDA 2MC3A 1G3TA 5E20A 5IOZA 3G71I 4ENKA 1OR7C 2DFHA 1NK3P 3RI4A 3OIOA 2HI3A 1WCMJ 2P7VB 1ULYA 2KT0A 2JA8J 2AS5F 4MQVA 2P5KA 1I3AA 3J7YJ 2ZJPF 2ZC2A 2DOEA 3PIPF 1JJ8C 2OUMA 3LSHA 1RUNA 1TQMA 4HF1A 2LREA 2M7BA 3FXLA 3EUHA 3HOTA 3J80Z 4L5IA 2E1OA 1FSEA 1F9NA 2VPRA 2YX7A 4HBLA 3RKXA 2X1CA 1B1BA 3MD2A 2LKXA 4R1HA 5BQTA 4BY1J 4ENNA 4CZZA 1OCZH 2LDUA 4Y7NJ 3A01A 2JUCA 3K4BA 1S72I 2DU9A 1SAUA 2KZGA 4M71A 3VOEA 5L3GA 1B72B 2KIUA 3QPLA 3HOWJ 2KRHA 2A6TA 2P5LC 2HZTA 1S8NA 2OCEA 1KGSA 3OYAA 3GX4X 2AXLA 3IWFA 1JT0A 1R00A 1UJ8A 3SFZA 2AQFA 2BE5F 3RYRA 2O8KA 4XK4A 1YRNA 1YOVB 4A2UA 2FSWA 2L4AA 1G3SA 1ZHFA 1Z91A 2E2JJ 1MJBA 3OYCA 4BACA 3QPHA 2WWYA 4BJTA 2JVHA 5M3MJ 5E3OA 3NEUA 2A5WA 2MLGA 3KZIC 2BYVE 3S3MA 2L01A 2FE3A 4S0HB 4ZDLA 5EDNA 3HOZJ 4ABZA 4G7OF 3WTUC 2EFPA 1SVOA 3JSOA 3OYBA 1YIOA 3WTXC 2DN0A 2AXTC 2Z1DA 5F6FA 4BL0B 2R5ZB 3S1RJ 1DU6A 2KIQA 4IRGA 4A3DJ 2V1UA 3R0AA 4IPAA 3G6EI 1O4XA 4BUPA 1Z21A 2XPWA 5FO5A 1Y1WJ 4A3MJ 5ICEA 2JZYA 1YTYA 3HPHA 4NHJA 4M3EA 4D7NA 1OCTC 4GRIA 4I98B 2ZJ2A 1BI1A 1R1TA 2P6SA 4HSTA 2EV0A 2LMDA 1ZAOA 1N25A 2H6BA 2G9WA 2BVLA 3S2WA 1HKTA 3DBHB 3ABKH 3RKYA 1KYWA 2GBYA 3DU5A 2QSFX 3QU3A 5LEKA 3OL4A 3EUKL 1MW7A 2ZNZA 2A5YB 1I27A 2F6CA 3GLXA 2UZKA 3CUQC 5FFZA 3RJPA 1MMSA 4RAGA 3T8RA 4AC0A 4EM2A 1FBSA 4FE7A 4LD5A 5KAIC 1U9OA 3S2DJ 3SDGA 4DOZA 4A69C 5A2QK 1A04A 4A0ZA 2R5YA 4G7ZF 1U78A 4IHXA 4A3IJ 2ICWG 3TO7A 4FCYA 2DDBA 5E8GA 1TLHB 3LSJA 3JSPA 1AKHB 4I0AA 1GV5A 4NBQA 1BIBA 1X4PA 1IXSB 2DFIA 2DYSH 4ZYGA 2HVSA 4HNUA 1JUMA 1ZARA 2FJ1A 3JRAA 2O6GE 3N4MA 1J59A 2R7UA 3R60A 4L18B 2E35A 4GO1A 2X6OA 3B6AA 3MCZA 4M9ZA 1MBGA 3K2ZA 2MSYA 1RR7A 2K40A 2OTLI 2FBKA 3Q5FA 3CO6C 2CW0F 3CDLA 5LRSA 4HX4A 3DKXA 4DJAA 4F93B 3S17J 1PDNC 3T1BA 1ETVA 3GTPJ 3C2BA 3LQRA 1Z77A 1XG1A 1GHCA 1JKQC 1DGRM 4XSZF 1IN4A 2IP2A 1R4MB 2QKLB 3EUHC 2KMUA 1FSHA 2ELKA 1RZ4A 3OIPA 4WCGA 2CV1A 2K27A 4U0VA 1KQ8A 5B66C 3REOA 3FHZA 2XF5A 4C2TA 3F6OA 3V8LA 5DYMA 3DV8A 2RVCA 1MMGA 1Z7UA 4RMNA 3HRTA 2DK5A 2AHQA 5F0FA 3L2RA 5DM7F 2D1HA 2CUEA 1G2HA 3AL0C 4E7KA 1IRFA 4A6EA 1JKRC 2BGCA 3EDPA 4D5CA 1WRJA 2DMQA 3E5UA 4BEHB 1K7AA 3LWFA 2HZDA 2NVUB 1R4NB 1G8XA 3UNGC 2VE9A 1QPIA 2P8TA 2XSJC 4CH7A 3L9FA 1WQ2A 3OY9A 5D6EA 3GO5A 2QVOA 1HW2A 2AQEA 1BR2A 2F4OB 3DBLB 4IO9F 1FPQA 3P9CA 5CVUA 3BZ6A 3I53A 2VOOA 2W4SA 3E6CC 2V4JC 5EG0B 1VQKI 5K7FA 2PLYA 1WGXA 3GFLA 3E6BA 1C0WA 3OYMA 4G8XA 4L0YB 3MZYA 4MLOA 2A07F 3R0JA 2H94A 2BHZA 1BBYA 2YU9J 4LG0A 3OMYA 2Y2ZA 3VODA 4RM2A 3CTAA 3X2QH 3ZQCA 1B9MA 2F5FA 4KJZA 1HKQA 5CLSA 1IN7A 3NARA 4QIWN 3FWEA 5HDGA 3RKQA 1MNMC 2HVRA 4ON0A 3OOUA 1VQ9I 1LVAA 2VIXA 1X2MA 2VJ4A 1LEBA 3K9TA 3NAUA 2ELHA 3I4NJ 1Z05A 5CVRA 1R23A 3K6GA 1P92A 2M8EA 4V19K 2XGDA 1WJCA 2XAFA 1TTYA 1BI3A 3OR1C 2ECCA 3OR2C 2BVMA 2YSRA 1A5JA 3ZQGA 2QF7A 4G6DA 1J0RA 2R7DA 3KEYA 4I2OA 1WSUA 1W1WE 1I6XA 2COBA 3K69A 5E79C 3D1NI 3CCMI 2L7KA 3L2VA 3IKVA 1BIAA 2TRTA 5HNHA 3CMAI 2KHMA 1Z9CA 3WGIA 4IKFA 4EM1A 3HOUJ 1IXCA 2COMA 2X6WA 2K4JA 2PEXA 2HKXA 4C3JJ 2GZWA 2K5CA 2L9RA 4DBRA 2RN7A 3A02A 1U9NA 3JREA 2LD5A 2VQGA 4IF4A 4ESJA 1XB4A 2BY1A 1MH4A 1WH7A 4RGRA 3A01B 3F8FA 1XDUA 4XM3A 2DA3A 3ASNH 1I50J 2IAIA 5LHHA 1FMWA 4CCMA 2NAZA 3HB9A 1VTNC 1AA7A 4RLFA 1H9TA 2VQHA 3TW7A 1XSXA 1EF4A 3LFUA 1R6RA 1BL0A 1TC3C 1WFXA 1PUFA 4A3BJ 1F1ZA 1LFBA 2QM3A 3K4NA 4H4KC 3OYJA 4MEXF 2KZVA 5LBQA 4RB1A 1J75A 3GEZA 3CCEI 4BXXJ 1VZ0A 3QRFF 1PJRA 5DV5A 5DS9A 1ACIA 1G3WA 2M7AA 3A2KA 4OAYA 1BR4A 3KYLA 2DCEA 4OMZA 3LSRA 2IS4A 1S9HA 3CCSI 2A69F 2NYXA 4KICA 2F5EA 2IRFG 1W36C 3KEQA 3KCCA 4UHTA 2DT7B 3BCAA 2IS6A 1HSTA 4UXNA 2KJCA 1JT6A 2X6YA 3MN2A 1OYIA 2DA7A 5M3FJ 3EUAA 2W57A 3WGHA 1OFCX 2M3AA 4EJWA 3O8GA 2CQNA 4GDFA 3HC7A 1UFMA 3H9GA 2A3SA 3OYDA 5H6RA 5E3LA 1XC5A 2CSOA 3TW6A 1S7AA 3Q0VA 4BQNA 4ETSA 3S16J 3FMRA 3WE3A 4JX4A 3PQKA 4I6ZA 4HNVA 4HV6A 2K9SA 4D7MA 2X1EA 4FASD 3EPZA 4PGGA 5HDKA 1LE8A 4LJZF 1Y8RB 2EFNA 2K9LA 3AG2H 2V6EA 1BJAA 4XKCA 1LB2A 3L1PA 3L2WA 1IAWA 3F3XA 1Y1VJ 4K2EA 3W2AA 2NRAC 4GGGA 2DFEA 1IGNA 2LBFB 1A6IA 1MMAA 5DCMB 2TDXA 2HYGD 4D9JA 3VYSB 2LF7A 2MH9A 2FA5A 1IF1A 1Y0UA 2HGCA 1UAAA 2HTJA 1T08B 2NNYA 1HDPA 2XASA 2DK8A 4DIQA 3KPHA 2FX0A 5A2QZ 5BPDA 2LBFA 1BM9A 2RNGA 4IQ4A 3RTRA 3WE2A 3LOCA 2CYYA 2M34A 1QRYA 5CQEA 2EIMH 1ZG5A 1IN6A 3OWTA 3K4JA 5HLGA 4DW6A 3I9V2 4A0XA 4G9YA 5JI6A 2I5UA 3PSFA 5JHFA 2DJIA 2IA2A 2K86A 1HQCA 1JKOC 3JRGA 5IT9Z 3EQLF 3IL2A 2B0LA 4JYKA 5JFRA 4J00A 2L9VA 1XGSA 2VKVA 3D0SA 2R5YB 1Z6RA 1QU3A 2ZFWA 4CGZA 2L9NA 1MMNA 1XS9A 1POGA 4PFOA 4OU0A 1YQAA 3CZ6A 5CPRB 4BDZA 1FYMA 3FF5A 1J7KA 2F48A 4NQWB 1BC8C 4IHTA 2WAQN 2F4MB 4A5NA 2M0CA 2M2EA 1QZZA 3F72A 2BW3A 4CSWA 2M87A 3ZQ7A 5GPCA 4HPQA 1XD7A 4CA0A 1H9GA 1JHHA 4HLXA 3JRFA 3HOXJ 4C30A 1S5LC 5TISC 1LPQA 2HDWA 2DPDA 1X1DA 4FX0A 4GYGA 2OZUA 3S8PA 2E1MC 4XLEA 1V54H 2RV8A 1LNWA 2VKHA 3CDHA 3DBRB 2V1NA 1FIAA 5DTDA 5HVQC 2LTPA 4EQQA 1D1AA 2L7MP 5M5WJ 2VL8A 1G59A 1VQNI 4FETA 2B63J 1PUEE 3H3UA 2DMTA 1IV6A 3M8FA 3FMQA 2GXGA 3SZGA 3ZPLA 2NS7A 4XRSA 1A36A 4RAYA 4MTEA 5GTIC 1MH3A 3BR0A 1FX7A 3K7AJ 4Z2YA 1KU3A 1R5HA 5FB2A 4RBOA 3QP5A 2BXZA 3SZPA 4WX9A 5C4JJ 1IRXA 4CYCB 3P9KA 2VJJA 4BGDA 2Z2SB 2R5ZA 4E7LA 2KQRA 1RNLA 2HNHA 3BTCA 1MJ9A 2FNAA 2RQQA 2PG4A 2LP0A 4FE4A 1O3QA 1LEAA 1S7EA 5C3EJ 1H0MA 3HSEA 4A5MA 2IW5A 5JVGF 1B4AA 3L2QA 2YPRA 5FKKA 3GTLJ 4BH9A 3BPXA 2VBWA 4KYWA 1E17A 3G2BA 4CO8A 5KVRA 2LRDA 1WJBA 1RC9A 4KT6A 1O3RA 4ITVA 3ZMZA 1PYVA 4O3MA 2QQ9A 2GOMA 2R7RA 1B9NA 1P9QC 2L4MA 2LH9A 3DTEA 2CV0A 2HWVA 4UUSA 5J8FA 3L00A 3HUGA 1R71A 2JJ7A 2HYFA 3LAJA 3PUBA 3LA3A 2PMZN 4XLCA 1FNNA 4KFCA 1JKPC 1J2XA 4XLPF 1XX5A 4UUSB 1IG7A 1T2KA 1WJFA 1T33A 1Y39A 1I39A 2MBFA 1MDMA 3K1MA 3HSRA 3A0HC 2F5VA 3ZQHA 4CCKA 2R7FA 4YFNF 1W5TA 3I0TA 3JRCA 2EB7A 1OJLA 4IHWA 1X3ZB 2LLKA 2KIMA 2HU9A 4KUMA 4FT8A 3HOYJ 3ABTA 4KT5C 1VQ7I 1MDMB 2BV6A 2NS8A 4ENMA 2A6HF 1YO5C 1J5YA 2M30A 5LGTA 4XORA 5CYVA 1T39A 2GIVA 2WBMA 2Z9OA 5BNGA 2R4GA 2Y48A 5BMZA 4ZYDA 2MFZA 4BDYA 3DF8A 2QBYA 1DPUA 1RR8C 2E36A 3HTUA 4BQQA 4L0ZB 4M72A 2MA3A 4A3EJ 3TO6A 4XN0A 4QPOA 2MABA 3CUOA 1K78B 4KMFA 2GXAA 4BBSJ 1HKSA 2VT2A 3T5XA 5ICCA 2O8XA 3JCUC 2XC7A 3GW2A 4BU2A 1W4MA 3F8BA 1HSJA 4ESFA 3HOSA 2Y9ZA 4J19A 3F22A 2ESHA 3C2GA 2R7ZJ 2NOJB 3HHHA 9ANTA 1FOWA 1M1EB 3OYFA 3DXJF 2OZ6A 3UKGA 5AIPA 2L7ZA 1TT0A 4PCQA 1ZR4A 1JHFA 4XRFA 3PNYA 1ON1A 3BQZA 4NC7A 4JOMA 5TGTA 2WA0A 2WTEA
chains in the Genus database with same CATH topology
3DLLF 3J7YJ 2ZJPF 1FOYA 3I56I 3CCUI 1YJ9I 3PIPF 2ZJQF 3G4SI 3I55I 2QEXI 2ZJRF 4UY8I 5GAEJ 1VQOI 3CC7I 1YJWI 3CJTB 3CF5F 1YI2I 5GADJ 2FOWA 3CCEI 5JVGF 1VQMI 1YIJI 5GAGJ 1VQ5I 3G6EI 3CC4I 1HC8A 2NXNB 1VQ4I 4IO9F 1FOWA 1ACIA 2E36A 1QA6A 1VQ8I 1VQLI 3CC2I 4IOCF 5DM7F 2H8WA 2K3FA 1Y39A 3CCQI 1VQ9I 2QA4I 1VQ6I 3CCRI 1VQPI 1YJNI 4IOAF 3CD6I 3CCJI 3CCMI 1VQKI 3CCVI 1S72I 2JQ7A 3CCSI 2E35A 3G71I 3CMAI 1MMSA 3CCLI 2OTJI 2E34A 5GAHJ 3CMEI 3PIOF 1YHQI 1VQ7I 2OTLI 1FOXA 1YITI 5DM6F 4V19K 3J7ZI 1VQNI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DLL F;  3J7Y J;  2ZJP F;  1FOY A;  3I56 I;  3CCU I;  1YJ9 I;  3PIP F;  2ZJQ F;  3G4S I;  3I55 I;  2QEX I;  2ZJR F;  4UY8 I;  5GAE J;  1VQO I;  3CC7 I;  1YJW I;  3CJT B;  3CF5 F;  1YI2 I;  5GAD J;  2FOW A;  3CCE I;  5JVG F;  1VQM I;  1YIJ I;  5GAG J;  1VQ5 I;  3G6E I;  3CC4 I;  1HC8 A;  2NXN B;  1VQ4 I;  4IO9 F;  1FOW A;  1ACI A;  2E36 A;  1QA6 A;  1VQ8 I;  1VQL I;  3CC2 I;  4IOC F;  5DM7 F;  2H8W A;  2K3F A;  1Y39 A;  3CCQ I;  1VQ9 I;  2QA4 I;  1VQ6 I;  3CCR I;  1VQP I;  1YJN I;  4IOA F;  3CD6 I;  3CCJ I;  3CCM I;  1VQK I;  3CCV I;  1S72 I;  2JQ7 A;  3CCS I;  2E35 A;  3G71 I;  3CMA I;  1MMS A;  3CCL I;  2OTJ I;  2E34 A;  5GAH J;  3CME I;  3PIO F;  1YHQ I;  1VQ7 I;  2OTL I;  1FOX A;  1YIT I;  5DM6 F;  4V19 K;  3J7Z I;  1VQN I; 
#chains in the Genus database with same CATH topology
 3F8C A;  3FXO A;  2ESN A;  3WOD F;  3BRO A;  3R61 A;  3SYT A;  5IP6 A;  4UY8 I;  3TDZ C;  2ZSI B;  3FK7 A;  2FOK A;  5EGO A;  2NVX J;  2LY9 A;  3PO3 J;  2D2W A;  2P5V A;  5L3E A;  2DA5 A;  3SXY A;  2HQA A;  4D0P A;  4PFP A;  1MSF C;  2A05 A;  1SD7 A;  3CD6 I;  2NVT J;  1R9T J;  1R1U A;  2I10 A;  1T8I A;  1LVK A;  1S7O A;  2J5P A;  3KEO A;  4O5V A;  2QGU A;  1BI2 A;  2VKE A;  3MZH A;  2XF7 A;  2HOA A;  1EKE A;  3JTH A;  1H88 C;  1X19 A;  4HSR A;  4RGX A;  4KDP A;  1XSD A;  1XCB A;  1ZLJ A;  3H9J A;  3A1Y A;  2QYO A;  1ODD A;  5FFX A;  2KPM A;  2DA6 A;  2Y0S A;  4BE0 A;  1FYK A;  3K4C A;  5GAD J;  1NK2 P;  2A6E F;  4RB3 C;  4DYQ A;  3BZC A;  3S3N A;  1AOY A;  1E3P A;  4EJU A;  4BS9 A;  1BJZ A;  4E7Z A;  3KP3 A;  4I7H A;  2CUF A;  3W6J B;  4PJJ A;  2DT5 A;  2OQG A;  5FJ8 J;  4XLN F;  1XGN A;  3IWZ A;  3F8M A;  2ZKZ A;  5K1Y A;  3PO2 J;  3LFK A;  5F0H A;  4PJL A;  2EIJ H;  4CYD A;  3BR3 A;  4BYY A;  4LOC A;  5C4X J;  1G6N A;  2M1B A;  2VBZ A;  4A3C J;  2DI3 A;  2L2O A;  4I02 A;  4FHT A;  3RKW A;  4CCL A;  2KIF A;  1T98 A;  3WG7 H;  1SMT A;  3EYY A;  4PJN A;  1KYZ A;  1IN5 A;  3ABU A;  3KFW X;  3PUF A;  2LC2 A;  5L3D A;  4BNC A;  1FC3 A;  4O6J A;  4RDU A;  3ZN0 A;  2XDV A;  5KAF C;  1E3H A;  5EEG A;  2DQR A;  4M74 A;  3O2P E;  2FU4 A;  3G1M A;  4NUB A;  1IRZ A;  2QQB A;  4IZZ A;  1WH5 A;  2Y75 A;  4E6K G;  4C3I J;  1F5T A;  4BY7 J;  3FK6 A;  3B6C A;  4XID A;  3BP8 A;  2WC2 A;  4MFE A;  4GFB A;  1W7P B;  3RSN A;  4N4N B;  4HAM A;  2RNJ A;  4ENJ A;  4AYB N;  2A61 A;  4NQW A;  4Q5S F;  4YEL A;  2K3P A;  5D8K B;  3VYU B;  1BI0 A;  4R79 A;  2OCC H;  1SFK A;  1SEU A;  2R92 J;  3DPU A;  1ONV A;  1W7P A;  1UHM A;  4HQM A;  1JUS A;  4H0E A;  1KU7 A;  2DQL A;  4MHG A;  1AHD P;  4EGY A;  3SEZ A;  4MO7 A;  4U0Y A;  3KP7 A;  1PUF B;  2OAZ A;  1Z3Y A;  3RQ4 A;  1TL8 A;  3VWB A;  4YEJ A;  4RS8 A;  2DOF A;  2K9N A;  3HRS A;  1N75 A;  3HKZ A;  3CC2 I;  5B1B H;  2FXA A;  2X48 A;  5FLV A;  2L9S A;  1LJ9 A;  3VSK A;  2Y9Y A;  2VJ5 A;  2L7F P;  3IC7 A;  3S15 J;  3HG9 A;  4ZC3 A;  2XPV A;  5E3N A;  1I1S A;  2EZK A;  1NHA A;  3LSK A;  2DA2 A;  2WB1 N;  2XVC A;  2ZNY A;  4NC6 A;  3OSF A;  4IQJ A;  2QQA A;  1FWZ A;  1BOA A;  1D0Y A;  3BC8 A;  4F3Q A;  4WWC A;  3U9G A;  3FM3 A;  1YJ9 I;  2EJR A;  1WI3 A;  1YJW I;  1LFU P;  4PSW A;  4AUX A;  2Y31 A;  4JP0 A;  2E71 A;  1XN7 A;  3IV5 A;  4LFU A;  5EEA A;  3CO7 C;  2Q2E B;  4Q47 A;  3RCO A;  3KIO A;  1MMD A;  3PNT A;  2JQ7 A;  3HOV J;  2ZCW A;  4AYB A;  4QLC U;  4WXH A;  1TWF J;  2LY1 A;  2BY3 A;  5CVI A;  4BJ5 C;  2XGE A;  1LE8 B;  4BXU A;  1JGG A;  3GZ5 A;  1QVT A;  1SAX A;  2KRF A;  1X4O A;  3QYB A;  5GAE J;  5KNL A;  3I4M J;  3TOB A;  2V9K A;  5JVT A;  3CJQ B;  4CCO A;  4DZJ A;  2NVQ J;  2VQC A;  2KIS A;  5IPA A;  1JUP A;  1W5C C;  3GUD A;  2LK2 A;  5CVV A;  3E97 A;  4IRI A;  4XR6 A;  3IRR A;  1G3Y A;  2MGQ A;  1QGP A;  2IA1 A;  4CIC A;  2O61 A;  2W84 A;  1UST A;  2O0Y A;  2DMU A;  3HTS B;  3HBL A;  3CES A;  1IV8 A;  5CKT A;  3JRI A;  1SFX A;  4LGW A;  2V1D A;  2W00 A;  1UB9 A;  4RA2 A;  3CC7 I;  5IYC J;  4LIU A;  2XIG A;  3DPL C;  2EH3 A;  3AFH A;  2JUG A;  3HKZ N;  1U8B A;  4EJO A;  4PZJ A;  1FTT A;  2PFB A;  1TT5 B;  4CCJ A;  3SQN A;  1YS7 A;  4UVC A;  2V79 A;  4F91 B;  4CCN A;  2Q8K A;  4OAZ A;  3ECH A;  4XNF A;  3ZQF A;  1P2F A;  1QHG A;  3RZO J;  4I09 A;  5HOD A;  3DU6 A;  3E6D A;  4A3F J;  3K4M A;  2JK3 A;  4QPQ A;  4Y13 A;  2XRO A;  4MTD A;  2CQQ A;  1IW7 F;  3L09 A;  4UV9 A;  3M8E A;  3I4P A;  1ZYR F;  5ILV A;  2Y0S N;  1QA6 A;  1VQL I;  3BCB A;  3I64 A;  2L0K A;  2ZXW H;  1UZC A;  3C1D A;  2DMN A;  2R7W A;  4LMY A;  1V5E A;  3M8J A;  3NQO A;  4UUV A;  1XGM A;  1DUX C;  4B3X A;  2RQP A;  1JE8 A;  2QKM B;  2W85 A;  3E1S A;  2QBY B;  2EK5 A;  3I54 A;  4JX5 A;  4U7D A;  2VPL A;  3JW4 A;  4ZJZ A;  2ZSH B;  5L3C A;  2HPM A;  3BDD A;  3WTV C;  5E18 F;  1YI2 I;  1FT9 A;  2LSO A;  2VB6 A;  1WKM A;  1Z3X A;  4C2U A;  2STW A;  3M7G A;  3Q0U A;  3CUQ B;  2RRE A;  2W1O A;  3I3L A;  1AWC A;  1IUY A;  2XSD C;  5H2F C;  2LY2 A;  1IN8 A;  2DMP A;  2HQR A;  3K0L A;  2XGC A;  1DQU A;  1I1G A;  2VOP A;  3JRD A;  2CJJ A;  2MH2 A;  2JPB A;  1XCV A;  5FKO A;  3H3V K;  5F04 A;  5LEJ A;  3QOP A;  2FQ4 A;  4IJA A;  3O8H A;  4PDK A;  2WY7 Q;  1R22 A;  4YFK F;  2HEO A;  3F0C A;  1FOY A;  4F7Z A;  4EM0 B;  3BG9 A;  1JI8 A;  3MKZ A;  3F9K A;  3E0J B;  4N0B A;  3KLO A;  4NB5 A;  1PVE A;  2NXN B;  4IHV A;  3HIF A;  4YII A;  4Y52 J;  1HW1 A;  4HEA 2;  1IXR C;  1Q1H A;  3CP2 A;  2OV7 A;  1ZKG A;  5HLI A;  4P1W A;  2O7O A;  3RQI A;  3CQZ J;  1X1C A;  2JRM A;  3JTG A;  1ZK8 A;  3LSI A;  1L0O C;  2K4B A;  1GXP A;  2F4I A;  1WJ5 A;  3KYD B;  2QSG X;  3S2H J;  2VI6 A;  5EG0 A;  1K4S A;  2DFF A;  4IHY A;  5J3L A;  2EFW A;  1V5G A;  2BY2 A;  4M3B A;  2VKD A;  2GOX B;  2VN2 A;  2DO7 A;  2FOW A;  3FIS A;  2XAG A;  4L9J A;  4MGR A;  3LNQ A;  3HRM A;  1QHH D;  1LUJ B;  3CP8 A;  3H5A A;  1A31 A;  2P0W A;  4MEY F;  3WHB A;  5FD6 A;  4UUT A;  1YS6 A;  4OIO F;  4IHS A;  2MD0 A;  3SHF A;  3QU6 A;  1W36 D;  2X1D A;  3ZR8 X;  3CME I;  1H89 C;  1EA3 A;  1YW7 A;  2XAH A;  1ZRC A;  4PK4 A;  1X3W B;  1W0T A;  3I58 A;  4D1Q A;  4UVB A;  3OYL A;  3H5R A;  3ZMS A;  1XTA A;  5C44 J;  4LG0 B;  2E7X A;  1XMA A;  3G1L A;  2UXX A;  4AD9 A;  3V7C A;  1T38 A;  4V2G A;  1D5Y A;  2IGM A;  3ISP A;  1KZH A;  3U1K A;  4PGH A;  4P9F A;  1CF7 A;  4M3D A;  2DDA A;  5K5R A;  1E0E A;  2OJE D;  4M3F A;  4MNU A;  3H0D A;  3DWL E;  3JRB A;  4TV7 A;  3ZGK A;  1O3T A;  2HR3 A;  4AM3 A;  4ZYE A;  1YHQ I;  4BQA A;  3KP5 A;  2R7V A;  5BS6 A;  2XUB A;  3QOE A;  2Z16 A;  2DOA A;  3OS1 A;  2XB5 A;  3VPR A;  3P7N A;  2IVM A;  1B8I A;  4YFX F;  1ZGW A;  2LF8 A;  1YW9 A;  5LFA A;  4LK1 F;  1BW5 A;  2GAU A;  3MWM A;  5TRD A;  2Y30 A;  4OOI A;  3VB2 A;  2DTR A;  3CF2 A;  5D5U B;  2VLA A;  1ZG1 A;  1VQP I;  1F36 A;  2EPF A;  3AKZ A;  2LR8 A;  1G4D A;  4F92 B;  3BTL A;  1TZL A;  2B9S A;  3RDI A;  5JR3 A;  3H36 A;  4YRV A;  1SFE A;  4LLL A;  2MLK A;  4HQE A;  2XRN A;  2E19 A;  4E70 A;  5J1U A;  4P96 A;  3IH2 A;  2O5R A;  1LKX A;  4OWR B;  1MD0 A;  3FM5 A;  1Y8Q B;  1YLF A;  3I55 I;  3KLN A;  5FGM A;  3GF2 A;  3FZV A;  3CF5 F;  3LMM A;  1ETY A;  2VE8 A;  2ZXH A;  5K5O A;  2DA1 A;  2EV5 A;  3QYF A;  3GYH X;  3RZD J;  2KDZ A;  4C9Y A;  3FIW A;  2UWM A;  1P4W A;  1S6L A;  1APL C;  3CCV I;  4AIJ A;  4LB6 B;  5F08 A;  4LIT A;  1GDT A;  2HYJ A;  3WTY C;  1KA8 A;  2JA7 J;  2E2I J;  5HS7 A;  3U21 A;  3ZQI A;  1BW6 A;  3SFI A;  1TNS A;  2HS5 A;  2Z3Y A;  4I01 A;  2QCO A;  3LA2 A;  1Z0X A;  4B3A A;  3CLO A;  5J4Y A;  5J4V A;  3WTS C;  2Q2E A;  1T95 A;  3GFJ A;  1UG2 A;  3CLQ A;  2YS9 A;  5FRO A;  2WAQ A;  2FML A;  2EZI A;  4R8H A;  2OF7 A;  4XSX F;  4IRH A;  3TMO A;  3WU2 C;  4XLF A;  1FY7 A;  3GTK J;  1DPR A;  1UEL B;  1OCO H;  2IGN A;  2V1X A;  1OPC A;  3BJA A;  2HQN A;  4HG2 A;  1U8R A;  4DYR A;  2CU7 A;  1MGT A;  1JTX A;  2DJN A;  3E5X A;  1CQT A;  4AVP A;  3K10 A;  2H8R A;  2B7E A;  3E3V A;  2GQQ A;  4DGW B;  3DQV C;  2EIL H;  4A93 J;  3H92 A;  1I6H J;  2FBH A;  3BTJ A;  3FHN A;  1FLI A;  3PSI A;  1HBX G;  1B59 A;  1HXD A;  3MFK A;  1ZH5 A;  1IDY A;  3TOA A;  4HNT A;  3S93 A;  5J6X A;  2L3D A;  2UUZ A;  5E3M A;  2R7T A;  5LGU A;  1ZG3 A;  1ETX A;  1ITY A;  3LSG A;  3G73 A;  5IP9 J;  5ICF A;  1L3L A;  1MSE C;  4YG2 F;  2IS1 A;  2R3S A;  2K7L A;  4UB6 C;  2QEX I;  1SD4 A;  4FTH A;  3U2R A;  3M07 A;  4E4H A;  5E1W A;  4LLG F;  2OD5 A;  1OQY A;  4XN3 A;  4MQ9 F;  3K2A A;  2D5V A;  1XPX A;  3W2W A;  5D5X B;  2R7S A;  3L7W A;  1CGP A;  3DKY A;  2VBX A;  1DP7 P;  4XLA A;  5DCM A;  4IX7 A;  1IC8 A;  2QSH X;  2HKO A;  5H20 A;  4DNC A;  2QWW A;  5TJJ A;  2OPT A;  1K79 A;  1OCR H;  3IH4 A;  1MND A;  4XQF A;  3GVA A;  4ANJ A;  4E7S A;  4F55 A;  2HTS A;  2O9L A;  5AON A;  4HRI A;  2LNB A;  3BR5 A;  1SC7 A;  2XRL A;  4X6A J;  1P4X A;  1IZ1 A;  2GA1 A;  2R0Q C;  2HXO A;  3BWG A;  3BJO A;  1D3Y A;  3B73 A;  3FBN B;  3GTJ J;  1P4A A;  2ZB9 A;  4II2 A;  2IGK A;  2L54 A;  2M0M A;  5IYB J;  3M4O J;  1FMV A;  4BQO A;  2ME6 A;  2M8G X;  4S05 A;  3HGG A;  5D4S A;  3BY6 A;  1T0F C;  5B5E C;  5HLH A;  2BZT A;  3EYI A;  4M9S A;  4A0Y A;  3BT9 A;  1X3U A;  3KP6 A;  3FKJ A;  1YRN B;  1Z1D A;  2BXY A;  4RB0 A;  1SAN A;  2G7H A;  2LYC A;  4HZF A;  3BG6 A;  1SVL A;  4B43 A;  4BJ6 C;  1HCR A;  4U0W A;  4BAY A;  5FLM J;  4DBQ A;  3H1C A;  2ZXJ A;  3PM1 A;  3V42 A;  2ID3 A;  3S1N J;  3RYP A;  1D1C A;  4Y15 A;  1FP2 A;  2KFD A;  1RI7 A;  1I3Q J;  2Q1Z B;  3ROU A;  4A3K J;  2ECB A;  2HDC A;  4HF2 A;  3TP0 A;  2OA4 A;  1FOK A;  1MNE A;  3S1Q J;  3GBG A;  2GLO A;  5EF6 A;  2ZJQ F;  3JR9 A;  1TQP A;  4A3J J;  3MZ8 A;  2CGP A;  4M6X A;  2STT A;  1ON2 A;  2XB0 X;  4M3G A;  3H3Z A;  3ZP5 A;  3QOD A;  5EZH A;  4UV8 A;  1MBJ A;  1QBJ A;  3CMY A;  4N9H A;  4DZP A;  4BEH A;  4M6Y A;  3KYC B;  3COA C;  2NVY J;  3ZMV A;  3W3C A;  1J09 A;  3Q3S A;  2IBD A;  2VBY A;  4RGU A;  2CW7 A;  4Q48 A;  2K02 A;  1D0X A;  3C3W A;  2CQX A;  4NC8 A;  2HXI A;  2VOD A;  2CH0 A;  1QVU A;  2W25 A;  2CRG A;  2WAF A;  1DGW Y;  4LK0 F;  2EQR A;  2GIZ A;  3OL3 A;  4XL9 A;  1OLT A;  2CS3 A;  2H1K A;  4D5F A;  3J80 K;  2DT6 A;  1R7J A;  4L9V A;  1VQ5 I;  1FJL A;  3HUG B;  1USS A;  2KRC A;  1V4R A;  2FNP A;  3U1D A;  4X0G A;  1IDZ A;  3MAJ A;  3WTZ A;  1WJE A;  1X1B A;  5JHU A;  1O3S A;  3J81 Z;  3HEF A;  4G94 A;  3GTM J;  2G7U A;  2HFH A;  4N9I A;  2YR2 A;  4E7I A;  3QPT A;  4BXF A;  4RB2 C;  3WTT C;  3LST A;  2EFQ A;  4RLQ A;  1YX5 A;  3GTQ J;  1LDK B;  2MD5 A;  5HDN A;  1GV2 A;  2BEO A;  2OQR A;  3NWT A;  3H35 A;  3TKY A;  3WTW C;  1AKH A;  3DFG A;  1FP1 D;  2JN6 A;  1NG6 A;  1XGO A;  3VEP A;  4AIK A;  2HDD A;  1D8K A;  5J47 A;  1VQM I;  2ETH A;  3VDX A;  1HW5 A;  3WU1 B;  5BPI A;  1CF7 B;  1QQI A;  3C18 A;  3IP4 B;  3RPU D;  3UR3 C;  3IH3 A;  3V7S A;  4FQG A;  4IVN A;  3D5L A;  1U5T A;  4MIM A;  2Z33 A;  4IL6 C;  1R36 A;  3BR2 A;  5IOY A;  5J40 A;  2Z5U A;  1STZ A;  3BOQ A;  3P9I A;  3N97 A;  2OU2 A;  2RGV A;  3EET A;  5FD5 A;  1U5T B;  4W97 A;  5AIQ A;  5KHD A;  1BR1 A;  4EGZ A;  2K9Q A;  3DEU A;  5GAG J;  4AVZ A;  4XRM A;  1ZEL A;  4JQF A;  5JLW A;  4DYC A;  2HQ5 A;  2K3F A;  2QQ8 A;  2EA2 A;  2MC4 A;  3PJR A;  3CCR I;  1D0Z A;  1RKW A;  2EZH A;  2M4G A;  4B09 A;  1BOB A;  4UVA A;  4OIN F;  3C2H A;  2LVS A;  1K78 A;  1IRG A;  5GTH C;  5K5Q A;  4BE2 A;  3FXK A;  1UHW A;  2P81 A;  3J81 K;  1R1V A;  1FBU A;  3B02 A;  3QQA A;  1ZRD A;  2GM4 A;  1BC7 C;  2ZME C;  5IP7 J;  3S3O A;  2PMU A;  5DDG A;  3KE2 A;  4IEJ A;  3LSP A;  3CUQ A;  5E17 F;  3ZMT A;  1W7P D;  2ZXI A;  2CMP A;  3ZMD A;  3OSG A;  1DDN A;  3DTI A;  2LKP A;  3ZXS A;  1JTY A;  3ULQ B;  2ISZ A;  1EV7 A;  2FF4 A;  5EGO B;  1E2X A;  3ML6 A;  3GXO A;  1NG7 A;  2UV1 A;  4EJT A;  3E6M A;  2VC0 A;  1RKT A;  2K85 A;  5DUI A;  1FTZ A;  2V26 A;  1RPW A;  3WGG A;  3BR6 A;  5BOX A;  2KP6 A;  5DM6 F;  3PFI A;  1D5V A;  1DU0 A;  1B6A A;  2CFO A;  4KIT B;  1Q1V A;  1LDJ A;  4UB8 C;  2W48 A;  2I8D A;  2DXI A;  2R93 J;  1FBQ A;  2L02 A;  4KIF A;  4CYC A;  3KET A;  3HGY A;  6PAX A;  1D8J A;  3TBI A;  4ZYH A;  1V55 H;  1YIJ I;  5D4R A;  3KZZ A;  5HS9 A;  2VON A;  5F27 A;  1WJD A;  3MKY B;  1X2N A;  3I59 A;  1YYV A;  1N77 A;  1ERD A;  4A12 A;  3A4C A;  3KX2 A;  3K4K A;  3G3Z A;  1ZQ3 P;  2X9D A;  4U88 A;  4XBF A;  3PIO F;  3T8T A;  4HX8 A;  1E3O C;  3BTI A;  5B1A H;  1IUF A;  2R7Q A;  3M3Y J;  2OBP A;  5FKN A;  5E1X A;  2ZJR F;  2HOS A;  3V8J A;  3DCF A;  3GTO J;  2QZ8 A;  1P6R A;  2EWN A;  3TO9 A;  1ETK A;  3JAM Z;  2E1M B;  3MEX A;  3SDB A;  5F1J A;  1HOM A;  1VQ6 I;  2UXN A;  1ZGJ A;  2CQK A;  1KU2 A;  1ZN2 A;  2DLL A;  4GXO A;  4E7H A;  3GLL A;  3SEQ A;  3CCL I;  5ED4 A;  3OYK A;  1OYY A;  1YE9 A;  2V9V A;  5FRM A;  2V7F A;  2PMZ A;  4Y33 A;  1LFP A;  3J7Z I;  3MKL A;  3G1O A;  1K83 J;  2KDO A;  3OYH A;  2X0L A;  5IY5 H;  3TL4 X;  3OYI A;  2PI0 A;  3JRH A;  3QWL A;  3DPT A;  4B48 A;  1PP7 U;  2DPU A;  2MYS A;  3PQJ A;  3IAS 2;  2P6T A;  4CUG A;  4WXD A;  4L5E A;  4M9X A;  4XIC A;  3IAM 2;  3LL7 A;  4JBA A;  4WF2 A;  5EZG A;  2E7W A;  1RIO H;  5M5X J;  1OR7 A;  4BHP A;  2PJR A;  1HDD C;  2YUS A;  5DEQ A;  1I5Z A;  1QPM A;  4IXA A;  4C3H J;  3R6S A;  2D1V A;  4LLN A;  2E2H J;  1N78 A;  3FDY A;  3DTK A;  4BE1 A;  1WHU A;  3AAF A;  2ACJ A;  2JWT A;  4RAZ A;  4BHC A;  5FLX Z;  5ICG A;  3HM5 A;  2H6C A;  4KN4 X;  1EH7 A;  3ZQL A;  3BR1 A;  4LG3 A;  1UMQ A;  5F1R A;  1F43 A;  2IXS A;  4QWQ A;  5L3B A;  5CJ9 A;  1VI0 A;  2VAS A;  4CZC A;  3CJR B;  4YIR X;  2XF6 A;  4HV5 A;  4P55 A;  3FKI J;  1YIT I;  1WVR A;  4S04 A;  3A0B C;  2ADU A;  3FXU A;  2QEN A;  2LKS A;  2PX9 A;  3K4L A;  4L9T A;  3W6K B;  4FX4 A;  4GCV A;  4JX6 A;  5KCM A;  1OKR A;  1QO0 D;  1U0J A;  2ZO4 A;  2FQ3 A;  1VQ4 I;  4CXF A;  1HF0 A;  4P5O A;  3C7J A;  4U7B A;  2DTZ A;  3F21 A;  1YJN I;  2ME0 A;  4IOA F;  2NOG A;  4OIP F;  3BQY A;  1SFU A;  3SZT A;  1ZLK A;  2XGX A;  5FKM A;  3BLY A;  2Y69 H;  5GPA A;  4ZH4 F;  3CMM A;  4HOB A;  1T56 A;  2M45 A;  2BHY A;  4X1E A;  3W2V A;  4WK8 F;  4A3G J;  1TWG J;  2NS0 A;  1JJ6 C;  5M5Y J;  2KLO A;  3DEE A;  2EBI A;  3ERE D;  1O57 A;  4G7H F;  2H8W A;  1DP3 A;  3ESW B;  4EEF G;  4ASN A;  1IO2 A;  2NNN A;  2H27 A;  1ZR2 A;  2D45 A;  3Q9S A;  4F52 A;  2JSC A;  4E7J A;  4KIB A;  4QSH A;  5EYR A;  2ZBK A;  1O7F A;  2BY0 A;  2CQ7 A;  2YX4 A;  5LGN A;  3ZN1 A;  4BBR J;  2KKO A;  4KNY A;  4HW0 A;  4XOP A;  3R4K A;  4LIV A;  1RRJ A;  2CW8 A;  1Z7L A;  2BBY A;  3PNV A;  1ETW A;  2KL4 A;  3OYE A;  3GZ6 A;  2JA2 A;  2QA4 I;  3BG5 A;  1QZY A;  3OYG A;  3S1M J;  2CV2 A;  2M9H A;  1MIJ A;  1WPK A;  3SJM A;  1TBX A;  5EJC A;  1U2W A;  3H5N A;  1LQ1 A;  1TW3 A;  3J7A Y;  1RET A;  2E60 A;  5ERI A;  2W24 A;  4HX7 A;  3IHU A;  1RUO A;  3ASO H;  5FKL A;  3HL2 A;  3GME A;  3M9A A;  3K1P A;  5ILU A;  1OCP A;  2JVG A;  3M1E A;  3ZRG A;  3VYT B;  3ERM A;  3HHG A;  2G0E A;  3FXQ A;  3O3K A;  3AG3 H;  3ZOB A;  2VXZ A;  4ZTF A;  4AWX B;  1UCR A;  2F2E A;  3V7R A;  2GXB A;  3OYN A;  4XKB A;  4KIG A;  2ID6 A;  1LDD A;  2H09 A;  3K1N A;  5DUK A;  2BW3 B;  4LB5 A;  4N4O B;  3Q9V A;  1A6Q A;  1S29 A;  4C2M J;  1J9I A;  1TP4 A;  1VQO I;  3LA7 A;  3LQQ A;  4XOT A;  3AG1 H;  3NWS A;  5K7H A;  4EMS A;  1F4K A;  4PJ0 C;  4KN7 X;  4NDL A;  3P5J A;  3HSF A;  1Z6T A;  3V8K A;  4P9U A;  1FYL A;  3D5R C;  2CWE A;  5CVJ A;  2IS2 A;  3FX3 A;  3CCJ I;  1TWA J;  3HYI A;  4DQ2 A;  4PJM A;  3RIR A;  4OIR F;  1U3E M;  1T6S A;  3AG4 H;  1TWH J;  2IT0 A;  1GVJ A;  2EZL A;  2ZME B;  1H8A C;  2VJI A;  4W1U A;  1Y0N A;  1B72 A;  3FXR A;  1MBF A;  1VND A;  3K70 D;  5GP9 A;  3L2C A;  3HRU A;  1REP C;  1KQ0 A;  1ZTR A;  1W0U A;  2N8G A;  1WZ2 A;  2E5N A;  2JMW A;  2ZME A;  4XKW A;  3BG7 A;  2JA5 J;  2RDP A;  5B3S H;  2JSP A;  4HLY A;  3ZMU A;  1YG2 A;  1GVD A;  4B44 A;  1VQ8 I;  2XV4 S;  1GLN A;  2V9P A;  3MMY B;  4NNJ A;  3W6V A;  1Y6I A;  2PBI A;  4B4C A;  4XMY A;  2PJP A;  4QTR A;  4I99 C;  2DYR H;  1QZE A;  4ZTJ A;  1K61 A;  2PN6 A;  3ONQ A;  3DLA A;  4HDU A;  5GAH J;  2W7N A;  2IJL A;  2WY8 Q;  5D8L B;  5HNF A;  3I5U A;  4CDG A;  1UG0 A;  1X58 A;  3ELK A;  4EV0 A;  2MG4 A;  2R7O A;  1XMX A;  5HS8 A;  2JA6 J;  4FIS A;  2C6Y A;  4CHU A;  3OS0 A;  2CG4 A;  2EFO A;  3E7L A;  4V2F A;  4Y4R A;  3AL0 B;  3PFY A;  4I76 A;  3F6V A;  3S32 A;  5FRN A;  3GZN B;  3ZQQ A;  1EH6 A;  1HA8 A;  2XAJ A;  3LSM A;  4A6D A;  2E34 A;  1GUU A;  1K6Y A;  5K7Z A;  1BN5 A;  1O7L A;  3DLL F;  2XAU A;  2XKO A;  1OIS A;  3D5S C;  2VXD A;  3BJ6 A;  3O6B B;  3CJT B;  4L9N A;  1P7I A;  5IT9 K;  5FLX K;  1NH3 A;  2K9M A;  2XAQ A;  5ILS A;  4U87 A;  1TW2 A;  1JGS A;  1MZB A;  1U6G A;  2VT3 A;  4KMU X;  1BA5 A;  3TDU C;  2VUM J;  1MBH A;  2WAE A;  4ESB A;  4PUS A;  2JRT A;  1YX3 A;  4B1R A;  2L5Q A;  5F0C A;  2IEK A;  1K4T A;  2BOL A;  3OIQ A;  4G6T B;  1WI9 A;  3CCY A;  1HLV A;  4HA8 A;  4WXC A;  2E1N A;  3TED A;  2DW4 A;  1SFO J;  5D5V B;  2VC1 A;  4HDV A;  1FOX A;  4XON A;  3GCM A;  3WU0 A;  1FEX A;  3I71 A;  3VYR B;  2ELJ A;  4Y17 A;  3BG3 A;  5CQG A;  2DA4 A;  3G4S I;  5IT3 A;  4AU7 A;  1VF9 A;  1ZRF A;  3MQ0 A;  5E8I A;  4RGS A;  3A03 A;  4AID A;  3OOP A;  1WJA A;  1EJ9 A;  3IUO A;  2M4K A;  2FD5 A;  5HLT A;  2X6X A;  1ZRE A;  1R5I D;  1ENH A;  3CJN A;  3QYE A;  1B8I B;  1V5F A;  5LD2 C;  5JLX A;  3DKW A;  2E5Z A;  4J01 A;  1P7J A;  2JTV A;  5D6F A;  2FMY A;  4KIS A;  2P4W A;  1X1P A;  3KZY A;  4YIF A;  3GWZ A;  4KA4 A;  3VSL A;  5KK1 A;  2DOD A;  4G6Q A;  1W5S A;  2WB1 A;  2AO9 A;  1GT0 C;  2EIK H;  4HF0 A;  3WHC A;  2RKH A;  3ABM H;  5EEH A;  3FBI B;  2FEZ A;  4B8X A;  3JAM K;  2FRH A;  5H6Q A;  3CC4 I;  2FBI A;  1RES A;  2DAO A;  3M1C A;  2HOE A;  3CDI A;  2WV1 A;  1FIP A;  3FXJ A;  5LRR A;  3TP3 A;  3L2U A;  3K70 C;  1ETO A;  1ETQ A;  4RAF A;  3CCQ I;  3PL8 A;  4L5J A;  4RM3 A;  1T0F A;  1ZGA A;  1OCC H;  2OC6 A;  1TNT A;  5HOO A;  3F23 A;  2CUZ A;  2OTJ I;  4XRS G;  1XMK A;  2CFX A;  4BKX A;  4Y3O A;  2WV0 A;  1X1A A;  3FMS A;  2X4H A;  1SD5 A;  2CO5 A;  2MW8 A;  3CCU I;  3RPU A;  3ECO A;  4EVI A;  3GFM A;  5F64 A;  1KU9 A;  3J7A O;  3TQN A;  3HPG A;  4B47 A;  1MJA A;  4A3L J;  1FZP B;  1UHS A;  1R5G A;  2IPQ X;  3HZJ A;  3VFZ A;  1SVM A;  2J5O A;  4IOC F;  2IA0 A;  1QNT A;  2LFB A;  1VFC A;  2HOT A;  2R7X A;  3I59 B;  2QUF A;  5D5W B;  2EV6 A;  2QLZ A;  2KJB A;  4M6V A;  3GTG J;  4ZDP A;  2H1L A;  1NTC A;  3IRQ A;  3V4G A;  2GA2 A;  2VQL A;  1Z67 A;  4OIQ F;  4GYI A;  3OV8 A;  4ZZL A;  3ZCO A;  3BPV A;  3H9Q A;  3QP6 A;  4ZZD A;  3OS2 A;  3KP2 A;  1TWC J;  1TQI A;  2FUG 2;  4M73 A;  2V6C A;  1K6O A;  1V3F A;  4UNO A;  3NRV A;  1OYW A;  2X85 A;  5E1Z B;  2EIN H;  2A68 F;  5J1Y A;  2XKP A;  3ABL H;  1S3J A;  4EAT A;  1JXS A;  2EA4 A;  3BZK A;  5IYD J;  3DEW A;  3F8N A;  2CUJ A;  2O3F A;  5LLQ A;  1MBE A;  2O03 A;  3H0G J;  4Z6Y A;  5J8C A;  4Q4Z F;  3I56 I;  2F5C A;  3KP4 A;  4ZYA A;  3MKW B;  1R58 A;  1D1B A;  2PQ8 A;  3S14 J;  1EH8 A;  1KQ9 A;  1U5T C;  1WWX A;  2HPI A;  4I0B A;  3Q0W A;  3N05 A;  2YU3 A;  2LOO A;  3WG9 A;  1SMY F;  4EJV A;  2GWR A;  1XSV A;  2E1C A;  3HDD A;  1Y56 A;  3DP7 A;  3HXL A;  2JT1 A;  1GXQ A;  5LHI A;  1PP8 F;  1YW8 A;  3GFI A;  2F5D A;  1ORK A;  3HJE A;  3RPQ A;  2Z99 A;  1IJW C;  3QPS A;  3FXM A;  2LG4 A;  2WAD A;  5LHG A;  2X51 A;  5J1R A;  2Y0M A;  1MBK A;  3QAH A;  4ZDO A;  5DD4 A;  2RAE A;  1R49 A;  3TGN A;  4BHB A;  4PSX A;  3T0Y A;  1YFH A;  1OMI A;  1SD6 A;  5DD8 A;  2XPU A;  2W82 A;  1AU7 A;  2HVQ A;  4XKV A;  4XLH A;  5L3F A;  2PMH A;  4AIH A;  3E5Q A;  2ISY A;  3LAP A;  2DBB A;  1MKM A;  4II3 A;  1HC8 A;  2ZFU A;  4G12 A;  2RC4 A;  3IKT A;  2P7C B;  2Q0O A;  2IGO A;  2TCT A;  2PJR B;  2M5W A;  2JPC A;  3MVP A;  5DCF A;  1KON A;  1A35 A;  4OMY A;  1XDS A;  4JK1 X;  4HYE A;  2XHK A;  4MFD A;  2MC3 A;  1G3T A;  5E20 A;  5IOZ A;  3G71 I;  4ENK A;  1OR7 C;  2DFH A;  1NK3 P;  3RI4 A;  3OIO A;  2HI3 A;  1WCM J;  2P7V B;  1ULY A;  2KT0 A;  2JA8 J;  2AS5 F;  4MQV A;  2P5K A;  1I3A A;  3J7Y J;  2ZJP F;  2ZC2 A;  2DOE A;  3PIP F;  1JJ8 C;  2OUM A;  3LSH A;  1RUN A;  1TQM A;  4HF1 A;  2LRE A;  2M7B A;  3FXL A;  3EUH A;  3HOT A;  3J80 Z;  4L5I A;  2E1O A;  1FSE A;  1F9N A;  2VPR A;  2YX7 A;  4HBL A;  3RKX A;  2X1C A;  1B1B A;  3MD2 A;  2LKX A;  4R1H A;  5BQT A;  4BY1 J;  4ENN A;  4CZZ A;  1OCZ H;  2LDU A;  4Y7N J;  3A01 A;  2JUC A;  3K4B A;  1S72 I;  2DU9 A;  1SAU A;  2KZG A;  4M71 A;  3VOE A;  5L3G A;  1B72 B;  2KIU A;  3QPL A;  3HOW J;  2KRH A;  2A6T A;  2P5L C;  2HZT A;  1S8N A;  2OCE A;  1KGS A;  3OYA A;  3GX4 X;  2AXL A;  3IWF A;  1JT0 A;  1R00 A;  1UJ8 A;  3SFZ A;  2AQF A;  2BE5 F;  3RYR A;  2O8K A;  4XK4 A;  1YRN A;  1YOV B;  4A2U A;  2FSW A;  2L4A A;  1G3S A;  1ZHF A;  1Z91 A;  2E2J J;  1MJB A;  3OYC A;  4BAC A;  3QPH A;  2WWY A;  4BJT A;  2JVH A;  5M3M J;  5E3O A;  3NEU A;  2A5W A;  2MLG A;  3KZI C;  2BYV E;  3S3M A;  2L01 A;  2FE3 A;  4S0H B;  4ZDL A;  5EDN A;  3HOZ J;  4ABZ A;  4G7O F;  3WTU C;  2EFP A;  1SVO A;  3JSO A;  3OYB A;  1YIO A;  3WTX C;  2DN0 A;  2AXT C;  2Z1D A;  5F6F A;  4BL0 B;  2R5Z B;  3S1R J;  1DU6 A;  2KIQ A;  4IRG A;  4A3D J;  2V1U A;  3R0A A;  4IPA A;  3G6E I;  1O4X A;  4BUP A;  1Z21 A;  2XPW A;  5FO5 A;  1Y1W J;  4A3M J;  5ICE A;  2JZY A;  1YTY A;  3HPH A;  4NHJ A;  4M3E A;  4D7N A;  1OCT C;  4GRI A;  4I98 B;  2ZJ2 A;  1BI1 A;  1R1T A;  2P6S A;  4HST A;  2EV0 A;  2LMD A;  1ZAO A;  1N25 A;  2H6B A;  2G9W A;  2BVL A;  3S2W A;  1HKT A;  3DBH B;  3ABK H;  3RKY A;  1KYW A;  2GBY A;  3DU5 A;  2QSF X;  3QU3 A;  5LEK A;  3OL4 A;  3EUK L;  1MW7 A;  2ZNZ A;  2A5Y B;  1I27 A;  2F6C A;  3GLX A;  2UZK A;  3CUQ C;  5FFZ A;  3RJP A;  1MMS A;  4RAG A;  3T8R A;  4AC0 A;  4EM2 A;  1FBS A;  4FE7 A;  4LD5 A;  5KAI C;  1U9O A;  3S2D J;  3SDG A;  4DOZ A;  4A69 C;  5A2Q K;  1A04 A;  4A0Z A;  2R5Y A;  4G7Z F;  1U78 A;  4IHX A;  4A3I J;  2ICW G;  3TO7 A;  4FCY A;  2DDB A;  5E8G A;  1TLH B;  3LSJ A;  3JSP A;  1AKH B;  4I0A A;  1GV5 A;  4NBQ A;  1BIB A;  1X4P A;  1IXS B;  2DFI A;  2DYS H;  4ZYG A;  2HVS A;  4HNU A;  1JUM A;  1ZAR A;  2FJ1 A;  3JRA A;  2O6G E;  3N4M A;  1J59 A;  2R7U A;  3R60 A;  4L18 B;  2E35 A;  4GO1 A;  2X6O A;  3B6A A;  3MCZ A;  4M9Z A;  1MBG A;  3K2Z A;  2MSY A;  1RR7 A;  2K40 A;  2OTL I;  2FBK A;  3Q5F A;  3CO6 C;  2CW0 F;  3CDL A;  5LRS A;  4HX4 A;  3DKX A;  4DJA A;  4F93 B;  3S17 J;  1PDN C;  3T1B A;  1ETV A;  3GTP J;  3C2B A;  3LQR A;  1Z77 A;  1XG1 A;  1GHC A;  1JKQ C;  1DGR M;  4XSZ F;  1IN4 A;  2IP2 A;  1R4M B;  2QKL B;  3EUH C;  2KMU A;  1FSH A;  2ELK A;  1RZ4 A;  3OIP A;  4WCG A;  2CV1 A;  2K27 A;  4U0V A;  1KQ8 A;  5B66 C;  3REO A;  3FHZ A;  2XF5 A;  4C2T A;  3F6O A;  3V8L A;  5DYM A;  3DV8 A;  2RVC A;  1MMG A;  1Z7U A;  4RMN A;  3HRT A;  2DK5 A;  2AHQ A;  5F0F A;  3L2R A;  5DM7 F;  2D1H A;  2CUE A;  1G2H A;  3AL0 C;  4E7K A;  1IRF A;  4A6E A;  1JKR C;  2BGC A;  3EDP A;  4D5C A;  1WRJ A;  2DMQ A;  3E5U A;  4BEH B;  1K7A A;  3LWF A;  2HZD A;  2NVU B;  1R4N B;  1G8X A;  3UNG C;  2VE9 A;  1QPI A;  2P8T A;  2XSJ C;  4CH7 A;  3L9F A;  1WQ2 A;  3OY9 A;  5D6E A;  3GO5 A;  2QVO A;  1HW2 A;  2AQE A;  1BR2 A;  2F4O B;  3DBL B;  4IO9 F;  1FPQ A;  3P9C A;  5CVU A;  3BZ6 A;  3I53 A;  2VOO A;  2W4S A;  3E6C C;  2V4J C;  5EG0 B;  1VQK I;  5K7F A;  2PLY A;  1WGX A;  3GFL A;  3E6B A;  1C0W A;  3OYM A;  4G8X A;  4L0Y B;  3MZY A;  4MLO A;  2A07 F;  3R0J A;  2H94 A;  2BHZ A;  1BBY A;  2YU9 J;  4LG0 A;  3OMY A;  2Y2Z A;  3VOD A;  4RM2 A;  3CTA A;  3X2Q H;  3ZQC A;  1B9M A;  2F5F A;  4KJZ A;  1HKQ A;  5CLS A;  1IN7 A;  3NAR A;  4QIW N;  3FWE A;  5HDG A;  3RKQ A;  1MNM C;  2HVR A;  4ON0 A;  3OOU A;  1VQ9 I;  1LVA A;  2VIX A;  1X2M A;  2VJ4 A;  1LEB A;  3K9T A;  3NAU A;  2ELH A;  3I4N J;  1Z05 A;  5CVR A;  1R23 A;  3K6G A;  1P92 A;  2M8E A;  4V19 K;  2XGD A;  1WJC A;  2XAF A;  1TTY A;  1BI3 A;  3OR1 C;  2ECC A;  3OR2 C;  2BVM A;  2YSR A;  1A5J A;  3ZQG A;  2QF7 A;  4G6D A;  1J0R A;  2R7D A;  3KEY A;  4I2O A;  1WSU A;  1W1W E;  1I6X A;  2COB A;  3K69 A;  5E79 C;  3D1N I;  3CCM I;  2L7K A;  3L2V A;  3IKV A;  1BIA A;  2TRT A;  5HNH A;  3CMA I;  2KHM A;  1Z9C A;  3WGI A;  4IKF A;  4EM1 A;  3HOU J;  1IXC A;  2COM A;  2X6W A;  2K4J A;  2PEX A;  2HKX A;  4C3J J;  2GZW A;  2K5C A;  2L9R A;  4DBR A;  2RN7 A;  3A02 A;  1U9N A;  3JRE A;  2LD5 A;  2VQG A;  4IF4 A;  4ESJ A;  1XB4 A;  2BY1 A;  1MH4 A;  1WH7 A;  4RGR A;  3A01 B;  3F8F A;  1XDU A;  4XM3 A;  2DA3 A;  3ASN H;  1I50 J;  2IAI A;  5LHH A;  1FMW A;  4CCM A;  2NAZ A;  3HB9 A;  1VTN C;  1AA7 A;  4RLF A;  1H9T A;  2VQH A;  3TW7 A;  1XSX A;  1EF4 A;  3LFU A;  1R6R A;  1BL0 A;  1TC3 C;  1WFX A;  1PUF A;  4A3B J;  1F1Z A;  1LFB A;  2QM3 A;  3K4N A;  4H4K C;  3OYJ A;  4MEX F;  2KZV A;  5LBQ A;  4RB1 A;  1J75 A;  3GEZ A;  3CCE I;  4BXX J;  1VZ0 A;  3QRF F;  1PJR A;  5DV5 A;  5DS9 A;  1ACI A;  1G3W A;  2M7A A;  3A2K A;  4OAY A;  1BR4 A;  3KYL A;  2DCE A;  4OMZ A;  3LSR A;  2IS4 A;  1S9H A;  3CCS I;  2A69 F;  2NYX A;  4KIC A;  2F5E A;  2IRF G;  1W36 C;  3KEQ A;  3KCC A;  4UHT A;  2DT7 B;  3BCA A;  2IS6 A;  1HST A;  4UXN A;  2KJC A;  1JT6 A;  2X6Y A;  3MN2 A;  1OYI A;  2DA7 A;  5M3F J;  3EUA A;  2W57 A;  3WGH A;  1OFC X;  2M3A A;  4EJW A;  3O8G A;  2CQN A;  4GDF A;  3HC7 A;  1UFM A;  3H9G A;  2A3S A;  3OYD A;  5H6R A;  5E3L A;  1XC5 A;  2CSO A;  3TW6 A;  1S7A A;  3Q0V A;  4BQN A;  4ETS A;  3S16 J;  3FMR A;  3WE3 A;  4JX4 A;  3PQK A;  4I6Z A;  4HNV A;  4HV6 A;  2K9S A;  4D7M A;  2X1E A;  4FAS D;  3EPZ A;  4PGG A;  5HDK A;  1LE8 A;  4LJZ F;  1Y8R B;  2EFN A;  2K9L A;  3AG2 H;  2V6E A;  1BJA A;  4XKC A;  1LB2 A;  3L1P A;  3L2W A;  1IAW A;  3F3X A;  1Y1V J;  4K2E A;  3W2A A;  2NRA C;  4GGG A;  2DFE A;  1IGN A;  2LBF B;  1A6I A;  1MMA A;  5DCM B;  2TDX A;  2HYG D;  4D9J A;  3VYS B;  2LF7 A;  2MH9 A;  2FA5 A;  1IF1 A;  1Y0U A;  2HGC A;  1UAA A;  2HTJ A;  1T08 B;  2NNY A;  1HDP A;  2XAS A;  2DK8 A;  4DIQ A;  3KPH A;  2FX0 A;  5A2Q Z;  5BPD A;  2LBF A;  1BM9 A;  2RNG A;  4IQ4 A;  3RTR A;  3WE2 A;  3LOC A;  2CYY A;  2M34 A;  1QRY A;  5CQE A;  2EIM H;  1ZG5 A;  1IN6 A;  3OWT A;  3K4J A;  5HLG A;  4DW6 A;  3I9V 2;  4A0X A;  4G9Y A;  5JI6 A;  2I5U A;  3PSF A;  5JHF A;  2DJI A;  2IA2 A;  2K86 A;  1HQC A;  1JKO C;  3JRG A;  5IT9 Z;  3EQL F;  3IL2 A;  2B0L A;  4JYK A;  5JFR A;  4J00 A;  2L9V A;  1XGS A;  2VKV A;  3D0S A;  2R5Y B;  1Z6R A;  1QU3 A;  2ZFW A;  4CGZ A;  2L9N A;  1MMN A;  1XS9 A;  1POG A;  4PFO A;  4OU0 A;  1YQA A;  3CZ6 A;  5CPR B;  4BDZ A;  1FYM A;  3FF5 A;  1J7K A;  2F48 A;  4NQW B;  1BC8 C;  4IHT A;  2WAQ N;  2F4M B;  4A5N A;  2M0C A;  2M2E A;  1QZZ A;  3F72 A;  2BW3 A;  4CSW A;  2M87 A;  3ZQ7 A;  5GPC A;  4HPQ A;  1XD7 A;  4CA0 A;  1H9G A;  1JHH A;  4HLX A;  3JRF A;  3HOX J;  4C30 A;  1S5L C;  5TIS C;  1LPQ A;  2HDW A;  2DPD A;  1X1D A;  4FX0 A;  4GYG A;  2OZU A;  3S8P A;  2E1M C;  4XLE A;  1V54 H;  2RV8 A;  1LNW A;  2VKH A;  3CDH A;  3DBR B;  2V1N A;  1FIA A;  5DTD A;  5HVQ C;  2LTP A;  4EQQ A;  1D1A A;  2L7M P;  5M5W J;  2VL8 A;  1G59 A;  1VQN I;  4FET A;  2B63 J;  1PUE E;  3H3U A;  2DMT A;  1IV6 A;  3M8F A;  3FMQ A;  2GXG A;  3SZG A;  3ZPL A;  2NS7 A;  4XRS A;  1A36 A;  4RAY A;  4MTE A;  5GTI C;  1MH3 A;  3BR0 A;  1FX7 A;  3K7A J;  4Z2Y A;  1KU3 A;  1R5H A;  5FB2 A;  4RBO A;  3QP5 A;  2BXZ A;  3SZP A;  4WX9 A;  5C4J J;  1IRX A;  4CYC B;  3P9K A;  2VJJ A;  4BGD A;  2Z2S B;  2R5Z A;  4E7L A;  2KQR A;  1RNL A;  2HNH A;  3BTC A;  1MJ9 A;  2FNA A;  2RQQ A;  2PG4 A;  2LP0 A;  4FE4 A;  1O3Q A;  1LEA A;  1S7E A;  5C3E J;  1H0M A;  3HSE A;  4A5M A;  2IW5 A;  5JVG F;  1B4A A;  3L2Q A;  2YPR A;  5FKK A;  3GTL J;  4BH9 A;  3BPX A;  2VBW A;  4KYW A;  1E17 A;  3G2B A;  4CO8 A;  5KVR A;  2LRD A;  1WJB A;  1RC9 A;  4KT6 A;  1O3R A;  4ITV A;  3ZMZ A;  1PYV A;  4O3M A;  2QQ9 A;  2GOM A;  2R7R A;  1B9N A;  1P9Q C;  2L4M A;  2LH9 A;  3DTE A;  2CV0 A;  2HWV A;  4UUS A;  5J8F A;  3L00 A;  3HUG A;  1R71 A;  2JJ7 A;  2HYF A;  3LAJ A;  3PUB A;  3LA3 A;  2PMZ N;  4XLC A;  1FNN A;  4KFC A;  1JKP C;  1J2X A;  4XLP F;  1XX5 A;  4UUS B;  1IG7 A;  1T2K A;  1WJF A;  1T33 A;  1Y39 A;  1I39 A;  2MBF A;  1MDM A;  3K1M A;  3HSR A;  3A0H C;  2F5V A;  3ZQH A;  4CCK A;  2R7F A;  4YFN F;  1W5T A;  3I0T A;  3JRC A;  2EB7 A;  1OJL A;  4IHW A;  1X3Z B;  2LLK A;  2KIM A;  2HU9 A;  4KUM A;  4FT8 A;  3HOY J;  3ABT A;  4KT5 C;  1VQ7 I;  1MDM B;  2BV6 A;  2NS8 A;  4ENM A;  2A6H F;  1YO5 C;  1J5Y A;  2M30 A;  5LGT A;  4XOR A;  5CYV A;  1T39 A;  2GIV A;  2WBM A;  2Z9O A;  5BNG A;  2R4G A;  2Y48 A;  5BMZ A;  4ZYD A;  2MFZ A;  4BDY A;  3DF8 A;  2QBY A;  1DPU A;  1RR8 C;  2E36 A;  3HTU A;  4BQQ A;  4L0Z B;  4M72 A;  2MA3 A;  4A3E J;  3TO6 A;  4XN0 A;  4QPO A;  2MAB A;  3CUO A;  1K78 B;  4KMF A;  2GXA A;  4BBS J;  1HKS A;  2VT2 A;  3T5X A;  5ICC A;  2O8X A;  3JCU C;  2XC7 A;  3GW2 A;  4BU2 A;  1W4M A;  3F8B A;  1HSJ A;  4ESF A;  3HOS A;  2Y9Z A;  4J19 A;  3F22 A;  2ESH A;  3C2G A;  2R7Z J;  2NOJ B;  3HHH A;  9ANT A;  1FOW A;  1M1E B;  3OYF A;  3DXJ F;  2OZ6 A;  3UKG A;  5AIP A;  2L7Z A;  1TT0 A;  4PCQ A;  1ZR4 A;  1JHF A;  4XRF A;  3PNY A;  1ON1 A;  3BQZ A;  4NC7 A;  4JOM A;  5TGT A;  2WA0 A;  2WTE A; 
#chains in the Genus database with same CATH homology
 3DLL F;  3J7Y J;  2ZJP F;  1FOY A;  3I56 I;  3CCU I;  1YJ9 I;  3PIP F;  2ZJQ F;  3G4S I;  3I55 I;  2QEX I;  2ZJR F;  4UY8 I;  5GAE J;  1VQO I;  3CC7 I;  1YJW I;  3CJT B;  3CF5 F;  1YI2 I;  5GAD J;  2FOW A;  3CCE I;  5JVG F;  1VQM I;  1YIJ I;  5GAG J;  1VQ5 I;  3G6E I;  3CC4 I;  1HC8 A;  2NXN B;  1VQ4 I;  4IO9 F;  1FOW A;  1ACI A;  2E36 A;  1QA6 A;  1VQ8 I;  1VQL I;  3CC2 I;  4IOC F;  5DM7 F;  2H8W A;  2K3F A;  1Y39 A;  3CCQ I;  1VQ9 I;  2QA4 I;  1VQ6 I;  3CCR I;  1VQP I;  1YJN I;  4IOA F;  3CD6 I;  3CCJ I;  3CCM I;  1VQK I;  3CCV I;  1S72 I;  2JQ7 A;  3CCS I;  2E35 A;  3G71 I;  3CMA I;  1MMS A;  3CCL I;  2OTJ I;  2E34 A;  5GAH J;  3CME I;  3PIO F;  1YHQ I;  1VQ7 I;  2OTL I;  1FOX A;  1YIT I;  5DM6 F;  4V19 K;  3J7Z I;  1VQN I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...