3G71I

Co-crystal structure of bruceantin bound to the large ribosomal subunit
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
total genus 8
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3g71I00
3CCMI 3CCJI 2E36A 3PIOF 3CCSI 3CCQI 2ZJQF 1YJNI 2K3FA 1QA6A 1YJ9I 3G71I 2FOWA 1Y39A 1FOYA 1VQPI 2ZJPF 1VQ4I 3CF5F 2JQ7A 3CC7I 3CJTB 5DM7F 3CD6I 3CCVI 5GADJ 5GAGJ 1VQ7I 2E35A 1VQLI 2H8WA 1YIJI 1YHQI 4IOCF 1VQKI 3J7ZI 3G4SI 2OTJI 1YITI 1YJWI 2NXNB 3CCRI 1HC8A 5DM6F 2QEXI 3J7YJ 3CC2I 1S72I 5GAHJ 4IOAF 3DLLF 1ACIA 3CCUI 1VQ8I 3G6EI 5JVGF 4IO9F 1VQNI 1VQ5I 3CCLI 4V19K 2ZJRF 1VQMI 1MMSA 5GAEJ 3CMEI 1VQ6I 1VQ9I 2OTLI 1FOWA 2E34A 3CMAI 3I56I 1VQOI 1YI2I 3CCEI 2QA4I 1FOXA 3PIPF 3CC4I 4UY8I 3I55I
chains in the Genus database with same CATH superfamily
3HXLA 1Z7UA 4ZDOA 1FYMA 1H0MA 3LWFA 3G73A 4UVCA 3SZTA 2YS9A 5D5XB 3S17J 2A68F 3S3NA 4YIIA 4GCVA 2Z99A 4CHUA 4LD5A 2W82A 4D9JA 3QAHA 1Y39A 2L5QA 1XPXA 2WB1N 3DEUA 2DN0A 2WC2A 5K1YA 1B4AA 2VIXA 2CU7A 2JVGA 2VPRA 3GWZA 3HOVJ 5LGNA 3R0AA 4X1EA 2DQLA 3RZOJ 3J80K 2Y2ZA 3DU5A 4L9JA 3DV8A 2ZMEC 1G3TA 4BBSJ 3R4KA 5JVTA 2EIMH 3F8CA 4PK4A 1MJBA 2EINH 2K9MA 1RR7A 2NAZA 3FXMA 3SZGA 5HODA 4HQEA 2VT2A 2DA2A 1Z05A 2GOXB 3W3CA 3GFJA 5F1RA 2E2IJ 3CTAA 1LFBA 3QQAA 3QU3A 3M8JA 1GUUA 4OIRF 2EIJH 4KDPA 3CLQA 3M1CA 1MD0A 2JA7J 2DODA 2QZ8A 5GPCA 2DJIA 2FUG2 3WGHA 2XHKA 4PSWA 2WAFA 4A3BJ 1HF0A 2MSYA 2FNPA 2OZ6A 4IQ4A 3GTKJ 2L9VA 2HOEA 3K0LA 2DK8A 3QP6A 3CP8A 4N0BA 4UB6C 4HX8A 4QLCU 1YJWI 4A69C 2H8RA 4GFBA 3JRHA 1YYVA 1HC8A 2Z1DA 4C2MJ 4GYIA 3BQZA 4RGUA 4AUXA 3W6VA 2KKOA 2GOMA 3GFIA 1IW7F 3LSRA 3COAC 3I3LA 1ZELA 3HUGA 3NEUA 1ZTRA 3IC7A 2DI3A 3ZR8X 1B8IB 4KMFA 4ZC3A 1H9GA 4N9HA 5GPAA 5FLVA 1OLTA 1LVKA 3LNQA 2P0WA 1Z3YA 1MJ9A 3FWEA 3G6EI 1OYWA 2WV0A 2ZKZA 4E6KG 2IS1A 3KP2A 1VTNC 2VN2A 3DP7A 3OMYA 4F93B 4W1UA 1X1AA 3OV8A 3G2BA 4KFCA 1V54H 2LY1A 5F27A 2KMUA 2X85A 4E7HA 1IN7A 2F4IA 4HF0A 4HDUA 2N8GA 2XF5A 1Q1VA 3O8HA 1MBFA 4U0WA 2M3AA 4LG3A 4WXDA 3MKLA 2X1EA 4NQWB 5IY5H 4RDUA 4C2TA 3E0JB 2FEZA 2M87A 2AHQA 4EQQA 1APLC 4XLHA 1Y8RB 1IG7A 2H09A 4XKCA 5DCFA 1P6RA 4XKBA 3VDXA 4C3JJ 1B9NA 1JKOC 2LY9A 3RJPA 4HLYA 1FEXA 4E7IA 5HDGA 1HOMA 1JTYA 1SVLA 2DTZA 2E36A 3CCSI 2NVTJ 1Z6RA 4WXCA 2W85A 4LG0A 1J09A 2VQHA 3RQ4A 2XV4S 2QGUA 2V79A 3NWTA 2DOAA 2VI6A 2VKHA 4EJUA 2A07F 1NHAA 3DXJF 4XLNF 2XF7A 2W84A 5CQGA 2FXAA 1UZCA 2VE8A 1R49A 4BL0B 4U0VA 2UV1A 4HOBA 3H3ZA 3CD6I 1SFKA 3H0DA 4UUVA 3WTUC 1W5SA 4PUSA 4G12A 4ZH4F 1B59A 3P9CA 4U88A 3U1KA 5FLMJ 2VE9A 1HA8A 2BV6A 5FKLA 4RB2C 4GO1A 5HLGA 4BE2A 4IOCF 3A2KA 1WI3A 1ZYRF 3HKZA 2QSFX 1XMXA 3E5XA 2CFOA 2O6GE 4A3LJ 1FTTA 3MAJA 3G4SI 4QPQA 3GW2A 1YG2A 4YFNF 4JX6A 3C2HA 3FM3A 1W4MA 1X19A 3UR3C 4M6XA 1TL8A 2FMYA 1EJ9A 5TJJA 4I0BA 2ZBKA 4L18B 3IWZA 3J7YJ 2R7WA 1REPC 2NRAC 4KIFA 1N25A 1UG2A 4ZDLA 3R6SA 2K9LA 5FROA 2EA2A 4YG2F 1VFCA 2HXIA 2Y30A 3RYPA 3HPHA 2HQRA 3GUDA 3TP0A 3E5QA 4EEFG 4CCLA 1FYKA 4CXFA 2W25A 4KITB 3KZYA 3PJRA 4XIDA 4GDFA 3WE2A 2CW0F 4IL6C 4A3MJ 4OIOF 4Z6YA 1VQNI 1XX5A 2FQ4A 3OYHA 5K7FA 2M8GX 2ZJRF 4RAFA 3LSJA 4Y17A 4NDLA 5E8GA 2W24A 4ZYAA 4ABZA 1VQ6I 2F4OB 2X6OA 1P92A 2XB0X 3BR2A 1GDTA 2DMPA 2VC1A 1KONA 3CMAI 2R5ZB 1X58A 4KIBA 1T38A 3BG6A 1ORKA 2IJLA 3BG5A 2A6EF 4DQ2A 1JUMA 1WJBA 5J8CA 2M34A 3H5NA 1GVDA 1JXSA 1UAAA 5FRMA 3LFKA 2QA4I 4CCMA 2Y0SN 3ZQ7A 4I6ZA 4ANJA 1RNLA 2X1DA 4DIQA 5FD5A 4RBOA 4FCYA 4BQOA 3DKXA 2BW3A 2R7OA 4TV7A 5J1RA 1K7AA 2DA5A 3B6AA 3GYHX 4UUTA 1TP4A 1TWAJ 4IRGA 5L3DA 1TNSA 4A6EA 2DW4A 2PEXA 3VWBA 1SAUA 1X1CA 2CW7A 5EGOB 4B3AA 2NVXJ 2X48A 3IKTA 4PJMA 2NVQJ 3M7GA 2A5WA 1S6LA 2HKXA 2LF7A 3P9KA 4ZYDA 1DGWY 3QODA 1R5HA 3KP5A 3R60A 2ELJA 1VQ4I 1X1BA 1JHFA 2HYGD 5HLTA 1MBJA 3CC7I 2AQFA 1EF4A 4NHJA 2VJ4A 4BU2A 2DPDA 3LSMA 5B1BH 1J2XA 1BJAA 3QYBA 2BHZA 2B9SA 3AG4H 3ZMSA 2CGPA 2ZSHB 2DA1A 2EBIA 1ZLJA 2LVSA 3Q0UA 1S7AA 1X3UA 3RQIA 2G7HA 4AIJA 2F5FA 2LH9A 3ZCOA 2JRMA 1T0FC 4JQFA 4EMSA 3CUQC 3H9QA 1R5GA 4O3MA 1VNDA 3ZQHA 4HBLA 3C7JA 4A3CJ 2BVMA 2YX7A 3BG3A 4AM3A 2FMLA 4CA0A 3A01B 3JREA 4CICA 3OOPA 1PUEE 4XMYA 4RS8A 4EATA 3R0JA 2NNNA 2G9WA 4OIPF 3PQKA 3HC7A 5KK1A 2X51A 3QP5A 3RTRA 4MTDA 3W6JB 2XC7A 4LLNA 2IBDA 3WU2C 1XCBA 2QUFA 5LRRA 4LK1F 1FBQA 2YUSA 2IW5A 1V3FA 2GXGA 4AVPA 2PJRA 2H94A 4YEJA 1WKMA 1HLVA 5HNHA 2RVCA 2IT0A 5IP6A 1U78A 1G6NA 5E3OA 1BR1A 4L9VA 3T1BA 4UV9A 1R1TA 1P4AA 1TWCJ 2KDZA 5GAEJ 1UHMA 3JRBA 1BOAA 4Z2YA 5H6RA 3VSKA 5J47A 5ICGA 2HNHA 1SANA 3K7AJ 3JSOA 5CKTA 4EGZA 3VFZA 3E1SA 1FC3A 3KP3A 3BTJA 3PL8A 5LBQA 5JR3A 1MKMA 1WH7A 2EH3A 1E3PA 1G3WA 3L2RA 1HSJA 4ZJZA 4ZZDA 2MC4A 4G94A 1KYWA 1WJAA 3FDYA 4ZTJA 2GXAA 3G1OA 3L2QA 2LSOA 3DPUA 1VZ0A 2XKPA 4JYKA 4IZZA 1RR8C 1L3LA 1RUOA 2HDDA 1LEBA 2KJBA 2DA6A 2TRTA 5CVJA 2ZB9A 4BQNA 4L0ZB 4OMZA 2CV2A 2CUJA 4I02A 4XLFA 2JSPA 3F8NA 2KHMA 5D5WB 4EJVA 4C3HJ 4E7JA 3PM1A 3MKWB 1E17A 5D6EA 1A6QA 4BDZA 4IPAA 4PCQA 3CF5F 3HGGA 4HZFA 3EPZA 2WADA 1FSHA 5EG0A 2RDPA 2E1MB 3KYDB 3DEWA 2PJPA 2R7ZJ 2R5YB 2JJ7A 2A6TA 3BPXA 5LGUA 3OYEA 1ZAOA 4LLLA 1YHQI 3ERMA 3K10A 4C2UA 5JLXA 2VODA 2X6WA 2F5DA 1LKXA 4ZTFA 3LSKA 3ZMVA 3E5UA 2FD5A 4G7ZF 1E2XA 2ETHA 1BW6A 1FTZA 4X0GA 4BACA 1D0YA 2BY2A 3OIPA 5CVVA 1I6XA 4HX7A 2L9RA 2CSOA 5E1ZB 1IXRC 4AIDA 4B3XA 3AG2H 3SEQA 1IF1A 2DA4A 4MQ9F 2QENA 3LOCA 4AVZA 2PMZA 1XGNA 4V2FA 5LHIA 2L01A 3O2PE 3PFIA 2P81A 3I59B 1TWHJ 1S8NA 1YIOA 3JTGA 3SFIA 3DBRB 3PUBA 1R36A 1UB9A 3CDLA 3LA2A 2K85A 2JTVA 2KZVA 2DMNA 2BOLA 3CMYA 1VQMI 3D0SA 3H3UA 2F4MB 4GRIA 3S3OA 3I58A 3M9AA 2RV8A 4HAMA 1QPMA 4YIFA 1FYLA 3L2CA 4NQWA 3QPLA 4B4CA 2R93J 1X4OA 2HS5A 2PG4A 4NNJA 2XB5A 1GV5A 3ASNH 3SDGA 2L7FP 1XDUA 2ECBA 2EZHA 5JFRA 4OAZA 2VPLA 4JBAA 3RKYA 1JHHA 1ZHFA 1EH7A 2V7FA 3ZPLA 2IGMA 3QPTA 1BIAA 1RZ4A 2R7RA 3NQOA 3VYTB 1OISA 4UVBA 4NC7A 1BA5A 1K4SA 5HS7A 3K9TA 1RI7A 1RESA 2LMDA 1TNTA 5TGTA 2QBYB 2W1OA 3JRDA 1S7EA 1W7PA 2GBYA 2RKHA 3FBNB 3HOZJ 2JRTA 5DYMA 1UG0A 4CDGA 1DPUA 3C3WA 1QHGA 1T56A 3OYCA 4HPQA 1QNTA 1MZBA 3M4OJ 3J7AO 5ILUA 3OYLA 3CLOA 3K4NA 2KIQA 4AYBN 4XRSG 1D5VA 1TLHB 1J75A 4RM2A 2Y9YA 2K7LA 3JCUC 2Q2EB 2UWMA 2QQBA 2KZGA 1TW3A 3OYBA 3RKQA 2F5CA 1FBUA 3TW6A 2DFFA 1TZLA 3OYJA 3KE2A 4E4HA 2X6YA 2OD5A 3L2WA 3BR5A 1BC8C 1T33A 2R7QA 4BGDA 2DFEA 3QYEA 1VQKI 4M3GA 2IA0A 4G6QA 5EYRA 4LB6B 4FETA 1IUFA 1AU7A 2CQNA 4LIUA 1TTYA 3VB2A 2LYCA 4XORA 5H20A 4HQMA 3H36A 1CF7B 2C6YA 1SFUA 1G4DA 3ONQA 1WJDA 2GAUA 1OJLA 1USTA 3FIWA 1ON2A 3BDDA 3L9FA 4ASNA 4BXFA 2DJNA 5F6FA 2DA7A 3I0TA 2GIVA 2P8TA 1JKPC 1T2KA 5HLIA 3BCBA 3I9V2 3DWLE 2A61A 4G8XA 4DOZA 2AXTC 1M1EB 1NH3A 2MA3A 1YS6A 2PMHA 2HVSA 2XIGA 4A3DJ 3CQZJ 2CG4A 1LQ1A 3P7NA 1KGSA 4XICA 2FSWA 2ISYA 1ZH5A 5E17F 5IOZA 3S1QJ 1Y8QB 4HSRA 3RKWA 2ZMEA 3HSRA 3DCFA 4EV0A 1Z9CA 2EB7A 2R5ZA 3MKZA 4O6JA 2OTLI 3NARA 1IUYA 1ETOA 3DBLB 2LTPA 3WTZA 3H1CA 1V5GA 4D5CA 2R7VA 2VLAA 3H5AA 1IRGA 5EZHA 4U87A 1P4WA 2DT5A 4I0AA 1OCOH 3M8EA 3FMQA 4EM0B 3ASOH 1YI2I 4HEA2 2OC6A 1QZYA 3F0CA 3QPHA 5E20A 2YPRA 5F0FA 2P4WA 2ICWG 4UY8I 3I55I 1Z0XA 1YRNB 4F91B 2EV5A 1EH8A 3SFZA 5BOXA 3BR0A 5K5RA 3CCJI 1HBXG 2XUBA 5FGMA 3Q0VA 3AG1H 3HOYJ 3TDUC 5KVRA 3GTJJ 5FRNA 4QPOA 2BY1A 4BAYA 4LITA 5B1AH 2QM3A 2DFIA 5KAIC 1QZZA 2LLKA 1FOYA 3VSLA 1ZK8A 3BG7A 2IA1A 4IHWA 2KL4A 2FQ3A 1VQPI 2ZFWA 2QWWA 1Y0UA 1OKRA 2VQCA 2V6EA 2P6TA 4FX0A 1I1SA 2IA2A 2YU9J 4B43A 2KRFA 1AKHA 2HQNA 1FSEA 3FXQA 1ETKA 5JHUA 2H1KA 2YX4A 4MIMA 1OCCH 3EETA 4XSZF 5GADJ 2XKOA 3JRGA 4XR6A 2M2EA 2X6XA 1YFHA 1IZ1A 2E1CA 1D8KA 4XOPA 4BY7J 1R00A 5JHFA 5DCMB 1LE8A 1WJFA 4KT5C 2OQGA 1K6YA 4M6YA 4Y33A 3FMSA 5E8IA 3BZCA 1V4RA 2STWA 4G6DA 1HDPA 2EZLA 3I5UA 1R5ID 3S14J 2D2WA 4XQFA 3A1YA 4C9YA 3D5RC 1KA8A 5C3EJ 4RLQA 5DM6F 2K4BA 3BROA 3U2RA 3DLAA 1JJ6C 2L7KA 1SC7A 1S72I 2LDUA 3OYMA 3HZJA 2PI0A 2F2EA 3FXUA 1RPWA 2L9SA 2L54A 4D1QA 1MDMA 1MMAA 1BBYA 5C4XJ 1YW7A 1YX3A 1ETVA 4XKWA 2DYRH 1QVTA 4PFOA 2IAIA 5EZGA 3TKYA 4FE4A 2O3FA 3I54A 3HB9A 3SZPA 4YFXF 1U9NA 2EWNA 2V9VA 3FXOA 2DLLA 3PNTA 4BHBA 3KP7A 4BYYA 3F9KA 2E34A 3TMOA 1F5TA 3DKYA 1IO2A 2JMWA 3GO5A 5HDKA 2YU3A 1VQOI 4S04A 4IX7A 2OCCH 4BHPA 2W4SA 1WH5A 1XCVA 1OPCA 3VEPA 2LF8A 4HNUA 3HOXJ 1LDJA 2EIKH 4CCJA 3I53A 3TOBA 1O3RA 3F8MA 4CZCA 3PIPF 1OMIA 4A3EJ 5DS9A 1KQ8A 4DW6A 5FLXK 2A6HF 4CCOA 5BPDA 3CCMI 3MFKA 4BJTA 5F0CA 2XPUA 4IHVA 2P5VA 2O7OA 3HM5A 4BKXA 1FT9A 2FBKA 2M45A 3KEQA 3IL2A 3V7SA 4K2EA 2JK3A 1IRZA 2XDVA 3HYIA 5E3LA 2FOWA 2V1UA 2O61A 1V5EA 2J5OA 2HZDA 1R9TJ 1FBSA 3HRMA 2FOKA 2P6SA 3PNYA 3QRFF 5D5UB 3T5XA 3OL4A 1DPRA 3BR3A 1KYZA 3KEYA 4NC6A 2R5YA 3CCVI 3BT9A 3HHGA 4CSWA 4LGWA 2XF6A 1XG1A 2K86A 1H8AC 2MW8A 4XN3A 4Y3OA 4ZZLA 3LQQA 4IRIA 3OOUA 3RSNA 3BTLA 1I3AA 2KLOA 1GVJA 3AG3H 3JAMK 1ZARA 3K4BA 3G1LA 3L09A 3A0HC 3KP6A 1I3QJ 3OIQA 3WODF 3IH2A 4LMYA 1IRFA 2ID6A 4BNCA 2DDBA 3V4GA 3H0GJ 3AFHA 4XRMA 4RB3C 3ZOBA 5LFAA 1WSUA 3A4CA 2LBFA 4ENJA 3QPSA 4BEHA 1JE8A 5GAHJ 1HSTA 5HNFA 3CESA 4MQVA 3L7WA 4B09A 1WGXA 5AIQA 1G59A 1R23A 3A03A 4YIRX 1ITYA 2WWYA 1U0JA 1Y6IA 3B02A 2AO9A 1XMAA 4Y7NJ 3K2ZA 1LB2A 4EM1A 2XAQA 3O6BB 4L5IA 5IP9J 5E3NA 3M07A 2TDXA 2CS3A 2VKDA 4AC0A 3ML6A 4PGGA 1VQ9I 4D7MA 2WAQA 2ELHA 2Q0OA 4E7ZA 3F23A 2LG4A 2CWEA 2PLYA 2TCTA 3BCAA 5LEJA 3W2WA 1BC7C 5IT9Z 4M73A 2FF4A 2GIZA 1R1VA 2RQPA 3S2HJ 4FQGA 4HF2A 2E71A 4FISA 4FASD 3ZRGA 1T0FA 2IVMA 3H3VK 5HS9A 3CUQA 2E1MC 2NYXA 4L0YB 3FXRA 1XD7A 3GBGA 3GVAA 4EVIA 4RM3A 4WXHA 5J1UA 4DBQA 1IDYA 4UNOA 2G0EA 1POGA 3CCQI 3SHFA 3H35A 1TWFJ 1R6RA 3FK6A 2VASA 1R4NB 2AQEA 5LEKA 3GTQJ 4BQQA 3M1EA 2AXLA 3M8FA 3Q5FA 3S93A 5HS8A 3CJTB 5DM7F 1LFUP 4ITVA 2Q2EA 3CZ6A 2HVQA 2L9NA 2RNJA 2ME6A 1I50J 5CVUA 4P96A 2IXSA 2D5VA 3WTWC 1VQ7I 1SVOA 4RAGA 3G1MA 1ONVA 3BP8A 5FFXA 1PUFB 4JP0A 2P5LC 3S1RJ 5DDGA 2HR3A 3MZYA 3ROUA 4RGRA 3T8RA 2R92J 1U3EM 2NVUB 4M72A 3V7CA 2Z2SB 3EDPA 3LA7A 3GFLA 3C1DA 5FFZA 5B3SH 3HKZN 4Y52J 5FKKA 2KFDA 3HHHA 1FP1D 1RC9A 2XAJA 1IV8A 2LK2A 4YRVA 3RKXA 4M9ZA 1PP8F 1Y1WJ 5CYVA 1W5TA 3TDZC 5FD6A 5HLHA 4HX4A 4I7HA 3BPVA 4PJNA 3NWSA 4IXAA 3KFWX 1I39A 5LHGA 2E1NA 4NC8A 2L2OA 3ABLH 1IN4A 1R1UA 2DU9A 2ZNZA 3LA3A 1J5YA 2M4GA 1NK3P 2W7NA 1FY7A 3MD2A 2HYJA 4XM3A 4XONA 4KA4A 4X6AJ 1FOWA 2KP6A 3ZQGA 1GV2A 1TQPA 1WJ5A 3F72A 2M9HA 3WTXC 1OCTC 5DD8A 2HOTA 2LR8A 1QVUA 2DQRA 2MD5A 2KIFA 3Q9SA 2E2HJ 2ACJA 4F55A 2B7EA 5F1JA 2BYVE 2F5VA 1MSFC 2MH9A 2OPTA 3FX3A 1SFEA 5HVQC 2P7VB 3JRAA 1J7KA 2DT7B 2CJJA 3IKVA 1Z21A 2P7CB 4XOTA 5E79C 3UKGA 3JR9A 3C2GA 4XLEA 3OYNA 3ZN1A 3AAFA 1WHUA 2K4JA 5ED4A 3GX4X 4OMYA 2JSCA 4UVAA 1MBHA 2PQ8A 1K4TA 2CV1A 3CJNA 2YSRA 3HOTA 1YJNI 2VUMJ 2Z16A 1YE9A 3ISPA 1P2FA 3D1NI 3PSIA 2E19A 2Y31A 2O0YA 2EPFA 4DZJA 2IS6A 4QWQA 1ERDA 3HG9A 4OOIA 3SYTA 4UXNA 1T08B 2HDCA 2M1BA 5IYBJ 2L4AA 1N78A 4A3JJ 2Y75A 1IC8A 3W2VA 3ULQB 1WFXA 3VYRB 3RI4A 3JRCA 4B1RA 1FIAA 5K5OA 5GTIC 1WRJA 9ANTA 1ULYA 1U2WA 1F9NA 2COMA 2A05A 2DCEA 1QQIA 5B66C 3IH4A 1A35A 4NBQA 1HW5A 3FKIJ 3HUGB 1WI9A 4P1WA 3I64A 2R0QC 2V1DA 3OS0A 1JKQC 4L5EA 1H88C 1PDNC 5AIPA 3OYFA 4A6DA 4HF1A 1D8JA 3OIOA 4N4OB 2UXNA 4B8XA 2E60A 1XTAA 3KIOA 3CCRI 4ENNA 3MMYB 1RRJA 3I4PA 3IRRA 3PQJA 1D3YA 1HW1A 2V26A 2VT3A 2QSGX 4HSTA 4A3KJ 3CMMA 1BI3A 3K4JA 4ESJA 3CC2I 2HQAA 4M3EA 4M9SA 1J9IA 3QU6A 1T98A 3JTHA 4I01A 3IP4B 3QOPA 2PX9A 1JJ8C 1ON1A 3LAJA 2FBHA 3BTIA 2EQRA 3WG7H 1VQ8I 4Y15A 1KZHA 2VB6A 4II3A 1DQUA 3MEXA 4FTHA 1ZG5A 2OQRA 2QVOA 2NNYA 1XSXA 1CQTA 2IGKA 1BM9A 4LOCA 2M30A 2GM4A 4PJLA 1YO5C 4H4KC 5K7ZA 1AWCA 4J01A 1D1AA 3A02A 3K1MA 4BXUA 4LG0B 2H1LA 3TO9A 1B8IA 1ZQ3P 1LPQA 3FZVA 4BDYA 2LRDA 1ZLKA 3FXLA 2EV0A 3KLNA 4XNFA 3BWGA 3SQNA 5E1WA 3OYAA 1PVEA 3GTOJ 5M5XJ 4FHTA 1FOXA 3FHZA 1KQ9A 2VC0A 3BTCA 3W6KB 2K5CA 1QO0D 3IV5A 3CC4I 3CJQB 1STZA 3PNVA 1WJCA 1OYIA 1IXCA 1CGPA 2HKOA 4CUGA 4PJ0C 2LD5A 2W48A 2QKLB 4N4NB 2A3SA 3EUHC 4KJZA 2JA8J 3E6BA 2BZTA 3FXKA 2ZJQF 2CW8A 1HDDC 1Y56A 5L3CA 1YJ9I 1B9MA 1P7JA 3I4NJ 3GEZA 5F04A 2XAFA 1WPKA 2CYYA 3LQRA 3BZ6A 4I2OA 1VF9A 2K9QA 5ICEA 5J6XA 5EDNA 5D8KB 3MKYB 3RZDJ 4Y13A 1P4XA 1MNDA 2DYSH 2MC3A 2LOOA 3J81Z 3DBHB 4BQAA 5B5EC 3GCMA 2VQGA 3ZQQA 4BJ6C 1GLNA 3OL3A 4CZZA 2QSHX 1F1ZA 2RREA 2XAHA 4S05A 1FIPA 5BMZA 2MLGA 4XRFA 2I10A 3CDHA 3ZMZA 2O8XA 2HGCA 3P9IA 5IT3A 3J7ZI 1YQAA 3H5RA 4HV6A 2VKEA 2QQ9A 3LL7A 2X9DA 5BQTA 3FM5A 2EFWA 1KU2A 2QEXI 1SAXA 2CUEA 2BVLA 3ESWB 4GGGA 2DXIA 2XSDC 4IHSA 3RYRA 4F7ZA 2MG4A 5L3GA 2XRLA 3ZGKA 4BE0A 2Y9ZA 2E5ZA 1X2NA 3FK7A 3KP4A 1LUJB 1ENHA 4KMUX 3TEDA 3BLYA 4DGWB 3V8KA 1FZPB 4ESFA 3RPUD 1JKRC 2PMZN 2VJJA 4OINF 3OY9A 3DFGA 3ZXSA 4XLPF 3S2DJ 5ICFA 2JN6A 4UUSB 2BE5F 2BW3B 3GLXA 3KCCA 3Q3SA 4H0EA 5FKNA 4XRSA 1O3QA 2DA3A 2NS8A 4LJZF 4U7DA 1D0ZA 2HTJA 3HBLA 3DKWA 2G7UA 1AA7A 2HOSA 1QU3A 1BI2A 3EQLF 2ID3A 2Z5UA 3JSPA 2Q8KA 5DD4A 2XRNA 1X1PA 1S9HA 2O03A 3LSHA 2ELKA 2M0CA 4C3IJ 4MEYF 5L3EA 3PIOF 4N9IA 2WB1A 2FE3A 3WTVC 2D1HA 2CQKA 3QYFA 4OAYA 3F22A 3AL0B 1K78B 2B63J 4KN7X 4XBFA 3NAUA 1ZR4A 1QA6A 1MSEC 4EJWA 5J4VA 4BUPA 4EJOA 3TP3A 3IWFA 3PSFA 3HOWJ 4PFPA 3TW7A 1L0OC 3T8TA 4Q4ZF 3WTTC 5EJCA 5BPIA 3BR1A 5ERIA 1A36A 2LKXA 2GLOA 1MBGA 3VYSB 4EJTA 3HRSA 4CYCB 4M71A 2EFPA 2X0LA 1LDKB 3W2AA 2WY8Q 1R7JA 1XGSA 2CQ7A 5EGOA 4BY1J 4CO8A 4LK0F 4OWRB 3KETA 2HZTA 3ZN0A 3LMMA 3MVPA 1P9QC 1YW9A 4DYQA 2VOPA 4LLGF 1HKQA 2ZXIA 1QRYA 4KUMA 4S0HB 1HXDA 2DBBA 2FA5A 1C0WA 1F43A 2HOAA 2XGCA 4QIWN 5CVRA 2QYOA 2RC4A 3OYGA 5F64A 4G7HF 3HJEA 3GLLA 2PFBA 4M3FA 3B73A 5J8FA 2QLZA 6PAXA 2K3PA 4L9NA 3Q0WA 1R71A 1IN8A 2D1VA 3DTEA 2BXYA 4A0YA 1JTXA 4UV8A 1BR2A 1QGPA 2R7FA 1ZN2A 2XGDA 3N05A 4G7OF 1R22A 1DGRM 5CLSA 4A0ZA 2JT1A 4PGHA 3OSFA 3RDIA 3HIFA 3LSIA 3K2AA 4XLCA 5HDNA 2EJRA 2J5PA 1EV7A 2EV6A 4JX5A 3KX2A 4HW0A 5GTHC 5M3FJ 2VBXA 5M3MJ 4KT6A 3GZNB 2V1XA 1E3HA 2E1OA 3KZZA 1VQ5I 1DP3A 3G3ZA 3A01A 1U8RA 4JOMA 4BH9A 4A3FJ 2WAEA 1FX7A 2R4GA 2O8KA 3DTKA 5D5VB 1JT0A 1I5ZA 4PJJA 1D1BA 3IH3A 1HCRA 1OCZH 4HNTA 3EYYA 1X1DA 1FLIA 2IGOA 4BHCA 3BJAA 3ABTA 3HOSA 4HLXA 1ZRFA 2DMQA 3BOQA 4A2UA 3D5SC 2K02A 4Q48A 4Y4RA 5ILSA 3OYKA 3U21A 1U5TB 1ZKGA 2ZFUA 5KCMA 2DO7A 3LSTA 1ZRDA 1ZREA 1UCRA 3Q9VA 1SFOJ 4V2GA 2VONA 5J40A 4CGZA 1BN5A 1O7FA 1IXSB 3E7LA 4FX4A 4J00A 1E0EA 3N4MA 5CJ9A 1SMYF 2MLKA 5EG0B 1XGOA 1BL0A 1UHWA 3E6CC 2MABA 5E1XA 2CRGA 2ZNYA 3KYLA 1UHSA 3MZHA 3G71I 3O3KA 4EGYA 1IN6A 1A5JA 2JA5J 3MCZA 3ELKA 2CQXA 4MTEA 1WJEA 4ZYEA 2V1NA 4A0XA 2HDWA 1OR7C 1Z1DA 2XGEA 4RA2A 1ZGAA 1DU0A 5IOYA 2Z9OA 2DK5A 1R4MB 2FBIA 3CJRB 5FJ8J 3GTMJ 4G6TB 4RMNA 4D7NA 3R61A 1ETQA 3E3VA 1G3YA 2MH2A 1KU7A 1WVRA 2JPCA 3WGGA 1B72B 5EEGA 2H8WA 3IAS2 3WGIA 1MNEA 1JGGA 1YIJI 1YX5A 1Z77A 4AD9A 2ESNA 1FNNA 2ZO4A 5LHHA 4IHYA 3GTPJ 1SEUA 1ETWA 1ETXA 3WTSC 4A5NA 1X4PA 1BW5A 3FKJA 2X4HA 2DT6A 2BXZA 3F6OA 4M9XA 1MW7A 1TT5B 2OTJI 5FO5A 3IRQA 2K9NA 3OR1C 2JWTA 2XROA 1YLFA 3C18A 3E6DA 1H9TA 1BI1A 1J0RA 1KQ0A 2FRHA 4IHTA 1GHCA 1VI0A 2LKSA 3K4CA 4IJAA 4RGXA 1O3TA 2O9LA 4U7BA 2EFOA 5FKMA 1JUSA 1B1BA 1MIJA 2ZC2A 4YFKF 3DLLF 3L2UA 1I1GA 2WTEA 3I71A 4C30A 1RETA 5D4RA 1D1CA 2DOEA 1SD4A 2BHYA 2H6BA 4LFUA 4EM2A 5L3BA 1QBJA 2A5YB 1A6IA 1HKTA 1AOYA 3BG9A 3LSGA 1K61A 2M4KA 1NG7A 2HI3A 2RNGA 1O3SA 4F52A 4HDVA 1UFMA 4BBRJ 2VJ5A 2ECCA 4UB8C 2Y0SA 4JX4A 3I56I 1Y1VJ 5LGTA 1W7PB 2M5WA 4HNVA 5A2QZ 1QHHD 2FX0A 4R79A 3KEOA 4MEXF 4IKFA 5K7HA 3I59A 4GXOA 3FMRA 3TGNA 3MN2A 2I5UA 2HTSA 3LAPA 1MH4A 2V4JC 3BJ6A 4W97A 1D0XA 2E5NA 3L2VA 4P55A 4BXXJ 1BIBA 5LLQA 1X3ZB 2A69F 4XSXF 1GXPA 2NS0A 3KYCB 2OU2A 2XPWA 1MGTA 1TC3C 2KQRA 1UELB 3B6CA 2HPMA 2L7ZA 3DQVC 3GZ5A 1HQCA 1IRXA 3H92A 5EF6A 4G9YA 3PO3J 5ILVA 5J4YA 4IEJA 3GTLJ 1LDDA 4L5JA 5M5WJ 1OQYA 1WZ2A 1BR4A 1SD6A 1YTYA 2H27A 5J3LA 4Q5SF 4IQJA 2OV7A 3ZP5A 3C2BA 4ON0A 2OUMA 4FT8A 3TBIA 3HTSB 3J81K 4MGRA 2CH0A 2F6CA 4AU7A 3VODA 1S3JA 2M7BA 4B48A 2QBYA 2KRHA 2FU4A 5CQEA 1VQLI 3J7AY 1OFCX 3BQYA 3SEZA 4D0PA 3HOUJ 2K9SA 4E7SA 4B44A 2F48A 3ZMUA 2W00A 2MYSA 1TW2A 4ZDPA 3TO6A 2MFZA 3K4KA 3EUKL 2DPUA 3ZQLA 4XK4A 1T8IA 2GA2A 3I4MJ 3EUAA 2GXBA 2NXNB 3FF5A 5LRSA 2HQ5A 3E6MA 2STTA 2F5EA 1OYYA 3HGYA 1J59A 1U8BA 1ZRCA 1FOKA 2ZMEB 2P5KA 1MMDA 4J19A 4P9UA 1EKEA 1Y0NA 5F0HA 2OAZA 2OJED 5BS6A 3QOEA 3NRVA 4QTRA 4U0YA 2DAOA 5DTDA 3IHUA 2JPBA 5EEAA 1HKSA 1ACIA 1FWZA 5C4JJ 3PO2J 2X1CA 1ZGWA 4NB5A 4IO9F 1P7IA 2HPIA 1IJWC 3ZMTA 4RLFA 2ESHA 1HW2A 5M5YJ 3HSFA 2KDOA 4UUSA 2OBPA 1CF7A 1SVMA 3VYUB 5D4SA 1NG6A 1TQMA 4I76A 3K4MA 3X2QH 4DYRA 3ECOA 2MGQA 1F4KA 4HV5A 1H89C 1X2MA 2QKMB 3V8LA 3WG9A 2RN7A 3CO7C 3S32A 1GXQA 4I98B 3TO7A 1MH3A 3FHNA 4ENKA 1DUXC 2HU9A 4RAYA 1R58A 1UJ8A 3BR6A 1JT6A 1IAWA 4A5MA 4MFEA 3CCEI 2WAQN 5TRDA 1MJAA 2VXDA 4OIQF 3S3MA 4HG2A 4E7LA 2ISZA 3IUOA 5FKOA 2R7DA 2ZXWH 2HXOA 2WV1A 1AKHB 5E18F 3F8FA 4OU0A 4XN0A 2B0LA 2L3DA 4GYGA 4MFDA 4AIHA 1K78A 4P9FA 1JUPA 1I6HJ 1U6GA 2I8DA 2V6CA 1PYVA 1LJ9A 4AWXB 1LE8B 4RB0A 2VL8A 3GFMA 1NK2P 3F3XA 2ZJPF 2IEKA 4WCGA 3CO6C 3EYIA 1OCRH 2DMTA 1ODDA 2HWVA 5AONA 3WE3A 4DYCA 1A04A 1YRNA 2JQ7A 1Q1HA 3CCYA 1O7LA 1A31A 3M3YJ 2VBYA 4RAZA 2WBMA 4CYCA 3J80Z 2DDAA 2ZJ2A 3GTGJ 3U1DA 2R7UA 4PZJA 4IVNA 1YS7A 1IDZA 5TISC 1XSVA 4RB1A 3DF8A 3ABMH 2FJ1A 1FMWA 3ERED 1XSDA 1OCPA 2R3SA 1N75A 3S1NJ 1K79A 4A93J 1IN5A 2E7XA 3SXYA 2DTRA 5F08A 1MDMB 2O5RA 1LVAA 4WF2A 3HEFA 3HRTA 2R7XA 1FP2A 3KZIC 3VOEA 2IP2A 1XN7A 2IS2A 1MBKA 4I09A 2EZKA 3CP2A 4ESBA 1XB4A 4M3DA 4BE1A 1FJLA 2PN6A 3WTYC 5DCMA 4O5VA 4F92B 1RUNA 2JUGA 1JGSA 1NTCA 3EUHA 3WHCA 1D5YA 2KISA 4WWCA 5D8LB 2LP0A 1SD7A 2KIMA 2HEOA 1USSA 1O4XA 2QCOA 2NOGA 3WU1B 4I99C 2XSJC 3L00A 4HA8A 1XGMA 5FLXZ 2LREA 4DJAA 4M6VA 3AL0C 2R7TA 1TT0A 3S2WA 2GA1A 3FISA 1RKTA 1XDSA 5D6FA 2RQQA 1AHDP 4II2A 2V9KA 3ZQFA 1Z67A 2EZIA 5H6QA 2FNAA 1LEAA 1W1WE 3K6GA 1W0TA 4MHGA 1U5TA 4CH7A 1QZEA 2YR2A 2L4MA 3V7RA 3OYDA 2EFNA 2H6CA 2IPQX 2NVYJ 2DMUA 1BOBA 1O57A 2LY2A 4CCNA 2MD0A 1RKWA 1MNMC 2XAGA 1B6AA 3RCOA 3O8GA 2EILH 2XAUA 5GP9A 3RIRA 3HRUA 3BC8A 3RPQA 4KNYA 1YOVB 3U9GA 5DV5A 1WCMJ 1BJZA 4KN4X 1DDNA 3FXJA 5DEQA 1T39A 2OF7A 3CUOA 5DUIA 4AYBA 1SFXA 3PUFA 2E2JJ 2Z3YA 4PSXA 1S29A 4KYWA 4DNCA 4A3IJ 1S5LC 3JAMZ 1PJRA 4AIKA 3RPUA 2EFQA 5H2FC 2XASA 2UXXA 3K1PA 4LB5A 2XPVA 1W5CC 2M7AA 4FE7A 2Y48A 2UUZA 3SJMA 3MZ8A 2V9PA 2OZUA 2L0KA 1B72A 3KPHA 2HFHA 3H9GA 2CV0A 2E35A 3OS1A 2D45A 2LKPA 5BNGA 4ENMA 1LNWA 2QF7A 5J1YA 2DFHA 4R8HA 2LBFB 4BEHB 1ETYA 2QQ8A 3HSEA 1XS9A 2CO5A 2K40A 1Z6TA 4XL9A 3TQNA 2ZCWA 2RGVA 2ADUA 3JRFA 2WA0A 1G8XA 4CCKA 1YITI 4JK1X 5IYDJ 3MWMA 1YW8A 2Y0MA 3ABKH 3T0YA 1FPQA 1BI0A 2LC2A 5IP7J 5K5QA 1ZR2A 3ABUA 5CVIA 3OSGA 2IS4A 2BEOA 1E3OC 3E97A 2ZXJA 5DUKA 3DU6A 3K69A 2HVRA 4DZPA 4QSHA 1U5TC 3BZKA 3S16J 3TL4X 4HYEA 5LD2C 2E7WA 3F8BA 2CUZA 3CCUI 2W57A 2VOOA 2KIUA 4PDKA 1RIOH 1KU9A 1Z7LA 4CYDA 1EH6A 1LFPA 4ZYHA 5JVGF 3F6VA 4M3BA 3V8JA 3CCLI 3S1MJ 3OS2A 2Y69H 3CUQB 2LNBA 3S15J 1MBEA 1MMSA 2HYFA 5L3FA 1DU6A 1F36A 1PP7U 3CMEI 2CUFA 4BJ5C 3TOAA 2OA4A 3P5JA 3DTIA 1KU3A 1G2HA 2BY3A 5A2QK 5IPAA 2KT0A 4HRIA 3WHBA 2Z33A 1ZG1A 3HDDA 4KISA 1S7OA 3H9JA 3ZQIA 3CDIA 2XGXA 2PBIA 3GZ6A 3F21A 1TQIA 2GQQA 5JLWA 2L7MP 4BS9A 2M8EA 1WWXA 1Z91A 2L02A 2NOJB 4KIGA 5EEHA 3V42A 1GT0C 3REOA 1XC5A 2JA2A 1V5FA 2NS7A 3SDBA 1QPIA 4YELA 4IF4A 4M74A 1MMNA 2IRFG 2R7SA 2KJCA 3HPGA 2K3FA 1W0UA 4UHTA 1SMTA 1Z3XA 5IT9K 1TWGJ 1JI8A 1UMQA 3OR2C 3ZQCA 1MMGA 5KAFC 4ETSA 3DEEA 3A0BC 3JRIA 2JA6J 1T95A 3FBIB 2ME0A 1W36C 3HL2A 3K70C 2BY0A 4F3QA 3LSPA 4E70A 2BBYA 3PFYA 3OYIA 2JUCA 2CQQA 2ZXHA 1W36D 4DBRA 2AS5F 2CFXA 3K70D 3IAM2 5GAGJ 3ZMDA 3DPTA 3N97A 4WK8F 2JVHA 4RGSA 4D5FA 4LIVA 2COBA 2VBWA 3K4LA 3L1PA 2QQAA 5KHDA 3ECHA 1EA3A 4A12A 5HOOA 1ZG3A 4IHXA 4Q47A 2K27A 2KRCA 2VQLA 2LFBA 1N77A 3BY6A 1K6OA 1K83J 3QWLA 2BGCA 2PMUA 2CMPA 4NUBA 3LFUA 2M0MA 4KICA 1U9OA 2EA4A 5KNLA 3WU0A 1T6SA 5ICCA 4A3GJ 1PUFA 3GMEA 4WX9A 1IGNA 2MBFA 2VKVA 1W7PD 2VBZA 5CPRB 1TBXA 1IV6A 1ZGJA 3GF2A 3CF2A 1WQ2A 4B47A 4IOAF 4XKVA 1DP7P 3K1NA 4XLAA 2PJRB 1G3SA 3OWTA 5JI6A 4ZYGA 2WY7Q 2VXZA 1V55H 2DOFA 2EK5A 4MO7A 4V19K 3GXOA 3UNGC 1I27A 3BJOA 1OR7A 2KPMA 3DPLC 2GWRA 2RAEA 2Q1ZB 3MQ0A 4MLOA 2XVCA 5IYCJ 4L9TA 1FMVA 3HTUA 1XMKA 4P5OA 1X3WB 4IRHA 3AKZA 3JW4A 2ZSIB 3S8PA 3D5LA 3KLOA 5FB2A 2JZYA 5E3MA 2IGNA 4MNUA 3VPRA 1SD5A 4E7KA 2GZWA 2UZKA 2OCEA 4R1HA 5C44J 2VJIA
chains in the Genus database with same CATH topology
3CCMI 3CCJI 2E36A 3PIOF 3CCSI 3CCQI 2ZJQF 1YJNI 2K3FA 1QA6A 1YJ9I 3G71I 2FOWA 1Y39A 1FOYA 1VQPI 2ZJPF 1VQ4I 3CF5F 2JQ7A 3CC7I 3CJTB 5DM7F 3CD6I 3CCVI 5GADJ 5GAGJ 1VQ7I 2E35A 1VQLI 2H8WA 1YIJI 1YHQI 4IOCF 1VQKI 3J7ZI 3G4SI 2OTJI 1YITI 1YJWI 2NXNB 3CCRI 1HC8A 5DM6F 2QEXI 3J7YJ 3CC2I 1S72I 5GAHJ 4IOAF 3DLLF 1ACIA 3CCUI 1VQ8I 3G6EI 5JVGF 4IO9F 1VQNI 1VQ5I 3CCLI 4V19K 2ZJRF 1VQMI 1MMSA 5GAEJ 3CMEI 1VQ6I 1VQ9I 2OTLI 1FOWA 2E34A 3CMAI 3I56I 1VQOI 1YI2I 3CCEI 2QA4I 1FOXA 3PIPF 3CC4I 4UY8I 3I55I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCM I;  3CCJ I;  2E36 A;  3PIO F;  3CCS I;  3CCQ I;  2ZJQ F;  1YJN I;  2K3F A;  1QA6 A;  1YJ9 I;  3G71 I;  2FOW A;  1Y39 A;  1FOY A;  1VQP I;  2ZJP F;  1VQ4 I;  3CF5 F;  2JQ7 A;  3CC7 I;  3CJT B;  5DM7 F;  3CD6 I;  3CCV I;  5GAD J;  5GAG J;  1VQ7 I;  2E35 A;  1VQL I;  2H8W A;  1YIJ I;  1YHQ I;  4IOC F;  1VQK I;  3J7Z I;  3G4S I;  2OTJ I;  1YIT I;  1YJW I;  2NXN B;  3CCR I;  1HC8 A;  5DM6 F;  2QEX I;  3J7Y J;  3CC2 I;  1S72 I;  5GAH J;  4IOA F;  3DLL F;  1ACI A;  3CCU I;  1VQ8 I;  3G6E I;  5JVG F;  4IO9 F;  1VQN I;  1VQ5 I;  3CCL I;  4V19 K;  2ZJR F;  1VQM I;  1MMS A;  5GAE J;  3CME I;  1VQ6 I;  1VQ9 I;  2OTL I;  1FOW A;  2E34 A;  3CMA I;  3I56 I;  1VQO I;  1YI2 I;  3CCE I;  2QA4 I;  1FOX A;  3PIP F;  3CC4 I;  4UY8 I;  3I55 I; 
#chains in the Genus database with same CATH topology
 3HXL A;  1Z7U A;  4ZDO A;  1FYM A;  1H0M A;  3LWF A;  3G73 A;  4UVC A;  3SZT A;  2YS9 A;  5D5X B;  3S17 J;  2A68 F;  3S3N A;  4YII A;  4GCV A;  2Z99 A;  4CHU A;  4LD5 A;  2W82 A;  4D9J A;  3QAH A;  1Y39 A;  2L5Q A;  1XPX A;  2WB1 N;  3DEU A;  2DN0 A;  2WC2 A;  5K1Y A;  1B4A A;  2VIX A;  2CU7 A;  2JVG A;  2VPR A;  3GWZ A;  3HOV J;  5LGN A;  3R0A A;  4X1E A;  2DQL A;  3RZO J;  3J80 K;  2Y2Z A;  3DU5 A;  4L9J A;  3DV8 A;  2ZME C;  1G3T A;  4BBS J;  3R4K A;  5JVT A;  2EIM H;  3F8C A;  4PK4 A;  1MJB A;  2EIN H;  2K9M A;  1RR7 A;  2NAZ A;  3FXM A;  3SZG A;  5HOD A;  4HQE A;  2VT2 A;  2DA2 A;  1Z05 A;  2GOX B;  3W3C A;  3GFJ A;  5F1R A;  2E2I J;  3CTA A;  1LFB A;  3QQA A;  3QU3 A;  3M8J A;  1GUU A;  4OIR F;  2EIJ H;  4KDP A;  3CLQ A;  3M1C A;  1MD0 A;  2JA7 J;  2DOD A;  2QZ8 A;  5GPC A;  2DJI A;  2FUG 2;  3WGH A;  2XHK A;  4PSW A;  2WAF A;  4A3B J;  1HF0 A;  2MSY A;  2FNP A;  2OZ6 A;  4IQ4 A;  3GTK J;  2L9V A;  2HOE A;  3K0L A;  2DK8 A;  3QP6 A;  3CP8 A;  4N0B A;  4UB6 C;  4HX8 A;  4QLC U;  1YJW I;  4A69 C;  2H8R A;  4GFB A;  3JRH A;  1YYV A;  1HC8 A;  2Z1D A;  4C2M J;  4GYI A;  3BQZ A;  4RGU A;  4AUX A;  3W6V A;  2KKO A;  2GOM A;  3GFI A;  1IW7 F;  3LSR A;  3COA C;  3I3L A;  1ZEL A;  3HUG A;  3NEU A;  1ZTR A;  3IC7 A;  2DI3 A;  3ZR8 X;  1B8I B;  4KMF A;  4ZC3 A;  1H9G A;  4N9H A;  5GPA A;  5FLV A;  1OLT A;  1LVK A;  3LNQ A;  2P0W A;  1Z3Y A;  1MJ9 A;  3FWE A;  3G6E I;  1OYW A;  2WV0 A;  2ZKZ A;  4E6K G;  2IS1 A;  3KP2 A;  1VTN C;  2VN2 A;  3DP7 A;  3OMY A;  4F93 B;  4W1U A;  1X1A A;  3OV8 A;  3G2B A;  4KFC A;  1V54 H;  2LY1 A;  5F27 A;  2KMU A;  2X85 A;  4E7H A;  1IN7 A;  2F4I A;  4HF0 A;  4HDU A;  2N8G A;  2XF5 A;  1Q1V A;  3O8H A;  1MBF A;  4U0W A;  2M3A A;  4LG3 A;  4WXD A;  3MKL A;  2X1E A;  4NQW B;  5IY5 H;  4RDU A;  4C2T A;  3E0J B;  2FEZ A;  2M87 A;  2AHQ A;  4EQQ A;  1APL C;  4XLH A;  1Y8R B;  1IG7 A;  2H09 A;  4XKC A;  5DCF A;  1P6R A;  4XKB A;  3VDX A;  4C3J J;  1B9N A;  1JKO C;  2LY9 A;  3RJP A;  4HLY A;  1FEX A;  4E7I A;  5HDG A;  1HOM A;  1JTY A;  1SVL A;  2DTZ A;  2E36 A;  3CCS I;  2NVT J;  1Z6R A;  4WXC A;  2W85 A;  4LG0 A;  1J09 A;  2VQH A;  3RQ4 A;  2XV4 S;  2QGU A;  2V79 A;  3NWT A;  2DOA A;  2VI6 A;  2VKH A;  4EJU A;  2A07 F;  1NHA A;  3DXJ F;  4XLN F;  2XF7 A;  2W84 A;  5CQG A;  2FXA A;  1UZC A;  2VE8 A;  1R49 A;  4BL0 B;  4U0V A;  2UV1 A;  4HOB A;  3H3Z A;  3CD6 I;  1SFK A;  3H0D A;  4UUV A;  3WTU C;  1W5S A;  4PUS A;  4G12 A;  4ZH4 F;  1B59 A;  3P9C A;  4U88 A;  3U1K A;  5FLM J;  2VE9 A;  1HA8 A;  2BV6 A;  5FKL A;  4RB2 C;  4GO1 A;  5HLG A;  4BE2 A;  4IOC F;  3A2K A;  1WI3 A;  1ZYR F;  3HKZ A;  2QSF X;  1XMX A;  3E5X A;  2CFO A;  2O6G E;  4A3L J;  1FTT A;  3MAJ A;  3G4S I;  4QPQ A;  3GW2 A;  1YG2 A;  4YFN F;  4JX6 A;  3C2H A;  3FM3 A;  1W4M A;  1X19 A;  3UR3 C;  4M6X A;  1TL8 A;  2FMY A;  1EJ9 A;  5TJJ A;  4I0B A;  2ZBK A;  4L18 B;  3IWZ A;  3J7Y J;  2R7W A;  1REP C;  2NRA C;  4KIF A;  1N25 A;  1UG2 A;  4ZDL A;  3R6S A;  2K9L A;  5FRO A;  2EA2 A;  4YG2 F;  1VFC A;  2HXI A;  2Y30 A;  3RYP A;  3HPH A;  2HQR A;  3GUD A;  3TP0 A;  3E5Q A;  4EEF G;  4CCL A;  1FYK A;  4CXF A;  2W25 A;  4KIT B;  3KZY A;  3PJR A;  4XID A;  4GDF A;  3WE2 A;  2CW0 F;  4IL6 C;  4A3M J;  4OIO F;  4Z6Y A;  1VQN I;  1XX5 A;  2FQ4 A;  3OYH A;  5K7F A;  2M8G X;  2ZJR F;  4RAF A;  3LSJ A;  4Y17 A;  4NDL A;  5E8G A;  2W24 A;  4ZYA A;  4ABZ A;  1VQ6 I;  2F4O B;  2X6O A;  1P92 A;  2XB0 X;  3BR2 A;  1GDT A;  2DMP A;  2VC1 A;  1KON A;  3CMA I;  2R5Z B;  1X58 A;  4KIB A;  1T38 A;  3BG6 A;  1ORK A;  2IJL A;  3BG5 A;  2A6E F;  4DQ2 A;  1JUM A;  1WJB A;  5J8C A;  2M34 A;  3H5N A;  1GVD A;  1JXS A;  1UAA A;  5FRM A;  3LFK A;  2QA4 I;  4CCM A;  2Y0S N;  3ZQ7 A;  4I6Z A;  4ANJ A;  1RNL A;  2X1D A;  4DIQ A;  5FD5 A;  4RBO A;  4FCY A;  4BQO A;  3DKX A;  2BW3 A;  2R7O A;  4TV7 A;  5J1R A;  1K7A A;  2DA5 A;  3B6A A;  3GYH X;  4UUT A;  1TP4 A;  1TWA J;  4IRG A;  5L3D A;  1TNS A;  4A6E A;  2DW4 A;  2PEX A;  3VWB A;  1SAU A;  1X1C A;  2CW7 A;  5EGO B;  4B3A A;  2NVX J;  2X48 A;  3IKT A;  4PJM A;  2NVQ J;  3M7G A;  2A5W A;  1S6L A;  2HKX A;  2LF7 A;  3P9K A;  4ZYD A;  1DGW Y;  3QOD A;  1R5H A;  3KP5 A;  3R60 A;  2ELJ A;  1VQ4 I;  1X1B A;  1JHF A;  2HYG D;  5HLT A;  1MBJ A;  3CC7 I;  2AQF A;  1EF4 A;  4NHJ A;  2VJ4 A;  4BU2 A;  2DPD A;  3LSM A;  5B1B H;  1J2X A;  1BJA A;  3QYB A;  2BHZ A;  2B9S A;  3AG4 H;  3ZMS A;  2CGP A;  2ZSH B;  2DA1 A;  2EBI A;  1ZLJ A;  2LVS A;  3Q0U A;  1S7A A;  1X3U A;  3RQI A;  2G7H A;  4AIJ A;  2F5F A;  2LH9 A;  3ZCO A;  2JRM A;  1T0F C;  4JQF A;  4EMS A;  3CUQ C;  3H9Q A;  1R5G A;  4O3M A;  1VND A;  3ZQH A;  4HBL A;  3C7J A;  4A3C J;  2BVM A;  2YX7 A;  3BG3 A;  4AM3 A;  2FML A;  4CA0 A;  3A01 B;  3JRE A;  4CIC A;  3OOP A;  1PUE E;  4XMY A;  4RS8 A;  4EAT A;  3R0J A;  2NNN A;  2G9W A;  4OIP F;  3PQK A;  3HC7 A;  5KK1 A;  2X51 A;  3QP5 A;  3RTR A;  4MTD A;  3W6J B;  2XC7 A;  4LLN A;  2IBD A;  3WU2 C;  1XCB A;  2QUF A;  5LRR A;  4LK1 F;  1FBQ A;  2YUS A;  2IW5 A;  1V3F A;  2GXG A;  4AVP A;  2PJR A;  2H94 A;  4YEJ A;  1WKM A;  1HLV A;  5HNH A;  2RVC A;  2IT0 A;  5IP6 A;  1U78 A;  1G6N A;  5E3O A;  1BR1 A;  4L9V A;  3T1B A;  4UV9 A;  1R1T A;  1P4A A;  1TWC J;  2KDZ A;  5GAE J;  1UHM A;  3JRB A;  1BOA A;  4Z2Y A;  5H6R A;  3VSK A;  5J47 A;  5ICG A;  2HNH A;  1SAN A;  3K7A J;  3JSO A;  5CKT A;  4EGZ A;  3VFZ A;  3E1S A;  1FC3 A;  3KP3 A;  3BTJ A;  3PL8 A;  5LBQ A;  5JR3 A;  1MKM A;  1WH7 A;  2EH3 A;  1E3P A;  1G3W A;  3L2R A;  1HSJ A;  4ZJZ A;  4ZZD A;  2MC4 A;  4G94 A;  1KYW A;  1WJA A;  3FDY A;  4ZTJ A;  2GXA A;  3G1O A;  3L2Q A;  2LSO A;  3DPU A;  1VZ0 A;  2XKP A;  4JYK A;  4IZZ A;  1RR8 C;  1L3L A;  1RUO A;  2HDD A;  1LEB A;  2KJB A;  2DA6 A;  2TRT A;  5CVJ A;  2ZB9 A;  4BQN A;  4L0Z B;  4OMZ A;  2CV2 A;  2CUJ A;  4I02 A;  4XLF A;  2JSP A;  3F8N A;  2KHM A;  5D5W B;  4EJV A;  4C3H J;  4E7J A;  3PM1 A;  3MKW B;  1E17 A;  5D6E A;  1A6Q A;  4BDZ A;  4IPA A;  4PCQ A;  3CF5 F;  3HGG A;  4HZF A;  3EPZ A;  2WAD A;  1FSH A;  5EG0 A;  2RDP A;  2E1M B;  3KYD B;  3DEW A;  2PJP A;  2R7Z J;  2R5Y B;  2JJ7 A;  2A6T A;  3BPX A;  5LGU A;  3OYE A;  1ZAO A;  4LLL A;  1YHQ I;  3ERM A;  3K10 A;  4C2U A;  5JLX A;  2VOD A;  2X6W A;  2F5D A;  1LKX A;  4ZTF A;  3LSK A;  3ZMV A;  3E5U A;  2FD5 A;  4G7Z F;  1E2X A;  2ETH A;  1BW6 A;  1FTZ A;  4X0G A;  4BAC A;  1D0Y A;  2BY2 A;  3OIP A;  5CVV A;  1I6X A;  4HX7 A;  2L9R A;  2CSO A;  5E1Z B;  1IXR C;  4AID A;  4B3X A;  3AG2 H;  3SEQ A;  1IF1 A;  2DA4 A;  4MQ9 F;  2QEN A;  3LOC A;  4AVZ A;  2PMZ A;  1XGN A;  4V2F A;  5LHI A;  2L01 A;  3O2P E;  3PFI A;  2P81 A;  3I59 B;  1TWH J;  1S8N A;  1YIO A;  3JTG A;  3SFI A;  3DBR B;  3PUB A;  1R36 A;  1UB9 A;  3CDL A;  3LA2 A;  2K85 A;  2JTV A;  2KZV A;  2DMN A;  2BOL A;  3CMY A;  1VQM I;  3D0S A;  3H3U A;  2F4M B;  4GRI A;  3S3O A;  3I58 A;  3M9A A;  2RV8 A;  4HAM A;  1QPM A;  4YIF A;  1FYL A;  3L2C A;  4NQW A;  3QPL A;  4B4C A;  2R93 J;  1X4O A;  2HS5 A;  2PG4 A;  4NNJ A;  2XB5 A;  1GV5 A;  3ASN H;  3SDG A;  2L7F P;  1XDU A;  2ECB A;  2EZH A;  5JFR A;  4OAZ A;  2VPL A;  4JBA A;  3RKY A;  1JHH A;  1ZHF A;  1EH7 A;  2V7F A;  3ZPL A;  2IGM A;  3QPT A;  1BIA A;  1RZ4 A;  2R7R A;  3NQO A;  3VYT B;  1OIS A;  4UVB A;  4NC7 A;  1BA5 A;  1K4S A;  5HS7 A;  3K9T A;  1RI7 A;  1RES A;  2LMD A;  1TNT A;  5TGT A;  2QBY B;  2W1O A;  3JRD A;  1S7E A;  1W7P A;  2GBY A;  2RKH A;  3FBN B;  3HOZ J;  2JRT A;  5DYM A;  1UG0 A;  4CDG A;  1DPU A;  3C3W A;  1QHG A;  1T56 A;  3OYC A;  4HPQ A;  1QNT A;  1MZB A;  3M4O J;  3J7A O;  5ILU A;  3OYL A;  3CLO A;  3K4N A;  2KIQ A;  4AYB N;  4XRS G;  1D5V A;  1TLH B;  1J75 A;  4RM2 A;  2Y9Y A;  2K7L A;  3JCU C;  2Q2E B;  2UWM A;  2QQB A;  2KZG A;  1TW3 A;  3OYB A;  3RKQ A;  2F5C A;  1FBU A;  3TW6 A;  2DFF A;  1TZL A;  3OYJ A;  3KE2 A;  4E4H A;  2X6Y A;  2OD5 A;  3L2W A;  3BR5 A;  1BC8 C;  1T33 A;  2R7Q A;  4BGD A;  2DFE A;  3QYE A;  1VQK I;  4M3G A;  2IA0 A;  4G6Q A;  5EYR A;  4LB6 B;  4FET A;  1IUF A;  1AU7 A;  2CQN A;  4LIU A;  1TTY A;  3VB2 A;  2LYC A;  4XOR A;  5H20 A;  4HQM A;  3H36 A;  1CF7 B;  2C6Y A;  1SFU A;  1G4D A;  3ONQ A;  1WJD A;  2GAU A;  1OJL A;  1UST A;  3FIW A;  1ON2 A;  3BDD A;  3L9F A;  4ASN A;  4BXF A;  2DJN A;  5F6F A;  2DA7 A;  3I0T A;  2GIV A;  2P8T A;  1JKP C;  1T2K A;  5HLI A;  3BCB A;  3I9V 2;  3DWL E;  2A61 A;  4G8X A;  4DOZ A;  2AXT C;  1M1E B;  1NH3 A;  2MA3 A;  1YS6 A;  2PMH A;  2HVS A;  2XIG A;  4A3D J;  3CQZ J;  2CG4 A;  1LQ1 A;  3P7N A;  1KGS A;  4XIC A;  2FSW A;  2ISY A;  1ZH5 A;  5E17 F;  5IOZ A;  3S1Q J;  1Y8Q B;  4HSR A;  3RKW A;  2ZME A;  3HSR A;  3DCF A;  4EV0 A;  1Z9C A;  2EB7 A;  2R5Z A;  3MKZ A;  4O6J A;  2OTL I;  3NAR A;  1IUY A;  1ETO A;  3DBL B;  2LTP A;  3WTZ A;  3H1C A;  1V5G A;  4D5C A;  2R7V A;  2VLA A;  3H5A A;  1IRG A;  5EZH A;  4U87 A;  1P4W A;  2DT5 A;  4I0A A;  1OCO H;  3M8E A;  3FMQ A;  4EM0 B;  3ASO H;  1YI2 I;  4HEA 2;  2OC6 A;  1QZY A;  3F0C A;  3QPH A;  5E20 A;  2YPR A;  5F0F A;  2P4W A;  2ICW G;  4UY8 I;  3I55 I;  1Z0X A;  1YRN B;  4F91 B;  2EV5 A;  1EH8 A;  3SFZ A;  5BOX A;  3BR0 A;  5K5R A;  3CCJ I;  1HBX G;  2XUB A;  5FGM A;  3Q0V A;  3AG1 H;  3HOY J;  3TDU C;  5KVR A;  3GTJ J;  5FRN A;  4QPO A;  2BY1 A;  4BAY A;  4LIT A;  5B1A H;  2QM3 A;  2DFI A;  5KAI C;  1QZZ A;  2LLK A;  1FOY A;  3VSL A;  1ZK8 A;  3BG7 A;  2IA1 A;  4IHW A;  2KL4 A;  2FQ3 A;  1VQP I;  2ZFW A;  2QWW A;  1Y0U A;  1OKR A;  2VQC A;  2V6E A;  2P6T A;  4FX0 A;  1I1S A;  2IA2 A;  2YU9 J;  4B43 A;  2KRF A;  1AKH A;  2HQN A;  1FSE A;  3FXQ A;  1ETK A;  5JHU A;  2H1K A;  2YX4 A;  4MIM A;  1OCC H;  3EET A;  4XSZ F;  5GAD J;  2XKO A;  3JRG A;  4XR6 A;  2M2E A;  2X6X A;  1YFH A;  1IZ1 A;  2E1C A;  1D8K A;  4XOP A;  4BY7 J;  1R00 A;  5JHF A;  5DCM B;  1LE8 A;  1WJF A;  4KT5 C;  2OQG A;  1K6Y A;  4M6Y A;  4Y33 A;  3FMS A;  5E8I A;  3BZC A;  1V4R A;  2STW A;  4G6D A;  1HDP A;  2EZL A;  3I5U A;  1R5I D;  3S14 J;  2D2W A;  4XQF A;  3A1Y A;  4C9Y A;  3D5R C;  1KA8 A;  5C3E J;  4RLQ A;  5DM6 F;  2K4B A;  3BRO A;  3U2R A;  3DLA A;  1JJ6 C;  2L7K A;  1SC7 A;  1S72 I;  2LDU A;  3OYM A;  3HZJ A;  2PI0 A;  2F2E A;  3FXU A;  1RPW A;  2L9S A;  2L54 A;  4D1Q A;  1MDM A;  1MMA A;  1BBY A;  5C4X J;  1YW7 A;  1YX3 A;  1ETV A;  4XKW A;  2DYR H;  1QVT A;  4PFO A;  2IAI A;  5EZG A;  3TKY A;  4FE4 A;  2O3F A;  3I54 A;  3HB9 A;  3SZP A;  4YFX F;  1U9N A;  2EWN A;  2V9V A;  3FXO A;  2DLL A;  3PNT A;  4BHB A;  3KP7 A;  4BYY A;  3F9K A;  2E34 A;  3TMO A;  1F5T A;  3DKY A;  1IO2 A;  2JMW A;  3GO5 A;  5HDK A;  2YU3 A;  1VQO I;  4S04 A;  4IX7 A;  2OCC H;  4BHP A;  2W4S A;  1WH5 A;  1XCV A;  1OPC A;  3VEP A;  2LF8 A;  4HNU A;  3HOX J;  1LDJ A;  2EIK H;  4CCJ A;  3I53 A;  3TOB A;  1O3R A;  3F8M A;  4CZC A;  3PIP F;  1OMI A;  4A3E J;  5DS9 A;  1KQ8 A;  4DW6 A;  5FLX K;  2A6H F;  4CCO A;  5BPD A;  3CCM I;  3MFK A;  4BJT A;  5F0C A;  2XPU A;  4IHV A;  2P5V A;  2O7O A;  3HM5 A;  4BKX A;  1FT9 A;  2FBK A;  2M45 A;  3KEQ A;  3IL2 A;  3V7S A;  4K2E A;  2JK3 A;  1IRZ A;  2XDV A;  3HYI A;  5E3L A;  2FOW A;  2V1U A;  2O61 A;  1V5E A;  2J5O A;  2HZD A;  1R9T J;  1FBS A;  3HRM A;  2FOK A;  2P6S A;  3PNY A;  3QRF F;  5D5U B;  3T5X A;  3OL4 A;  1DPR A;  3BR3 A;  1KYZ A;  3KEY A;  4NC6 A;  2R5Y A;  3CCV I;  3BT9 A;  3HHG A;  4CSW A;  4LGW A;  2XF6 A;  1XG1 A;  2K86 A;  1H8A C;  2MW8 A;  4XN3 A;  4Y3O A;  4ZZL A;  3LQQ A;  4IRI A;  3OOU A;  3RSN A;  3BTL A;  1I3A A;  2KLO A;  1GVJ A;  3AG3 H;  3JAM K;  1ZAR A;  3K4B A;  3G1L A;  3L09 A;  3A0H C;  3KP6 A;  1I3Q J;  3OIQ A;  3WOD F;  3IH2 A;  4LMY A;  1IRF A;  2ID6 A;  4BNC A;  2DDB A;  3V4G A;  3H0G J;  3AFH A;  4XRM A;  4RB3 C;  3ZOB A;  5LFA A;  1WSU A;  3A4C A;  2LBF A;  4ENJ A;  3QPS A;  4BEH A;  1JE8 A;  5GAH J;  1HST A;  5HNF A;  3CES A;  4MQV A;  3L7W A;  4B09 A;  1WGX A;  5AIQ A;  1G59 A;  1R23 A;  3A03 A;  4YIR X;  1ITY A;  2WWY A;  1U0J A;  1Y6I A;  3B02 A;  2AO9 A;  1XMA A;  4Y7N J;  3K2Z A;  1LB2 A;  4EM1 A;  2XAQ A;  3O6B B;  4L5I A;  5IP9 J;  5E3N A;  3M07 A;  2TDX A;  2CS3 A;  2VKD A;  4AC0 A;  3ML6 A;  4PGG A;  1VQ9 I;  4D7M A;  2WAQ A;  2ELH A;  2Q0O A;  4E7Z A;  3F23 A;  2LG4 A;  2CWE A;  2PLY A;  2TCT A;  3BCA A;  5LEJ A;  3W2W A;  1BC7 C;  5IT9 Z;  4M73 A;  2FF4 A;  2GIZ A;  1R1V A;  2RQP A;  3S2H J;  4FQG A;  4HF2 A;  2E71 A;  4FIS A;  4FAS D;  3ZRG A;  1T0F A;  2IVM A;  3H3V K;  5HS9 A;  3CUQ A;  2E1M C;  2NYX A;  4L0Y B;  3FXR A;  1XD7 A;  3GBG A;  3GVA A;  4EVI A;  4RM3 A;  4WXH A;  5J1U A;  4DBQ A;  1IDY A;  4UNO A;  2G0E A;  1POG A;  3CCQ I;  3SHF A;  3H35 A;  1TWF J;  1R6R A;  3FK6 A;  2VAS A;  1R4N B;  2AQE A;  5LEK A;  3GTQ J;  4BQQ A;  3M1E A;  2AXL A;  3M8F A;  3Q5F A;  3S93 A;  5HS8 A;  3CJT B;  5DM7 F;  1LFU P;  4ITV A;  2Q2E A;  3CZ6 A;  2HVQ A;  2L9N A;  2RNJ A;  2ME6 A;  1I50 J;  5CVU A;  4P96 A;  2IXS A;  2D5V A;  3WTW C;  1VQ7 I;  1SVO A;  4RAG A;  3G1M A;  1ONV A;  3BP8 A;  5FFX A;  1PUF B;  4JP0 A;  2P5L C;  3S1R J;  5DDG A;  2HR3 A;  3MZY A;  3ROU A;  4RGR A;  3T8R A;  2R92 J;  1U3E M;  2NVU B;  4M72 A;  3V7C A;  2Z2S B;  3EDP A;  3LA7 A;  3GFL A;  3C1D A;  5FFZ A;  5B3S H;  3HKZ N;  4Y52 J;  5FKK A;  2KFD A;  3HHH A;  1FP1 D;  1RC9 A;  2XAJ A;  1IV8 A;  2LK2 A;  4YRV A;  3RKX A;  4M9Z A;  1PP8 F;  1Y1W J;  5CYV A;  1W5T A;  3TDZ C;  5FD6 A;  5HLH A;  4HX4 A;  4I7H A;  3BPV A;  4PJN A;  3NWS A;  4IXA A;  3KFW X;  1I39 A;  5LHG A;  2E1N A;  4NC8 A;  2L2O A;  3ABL H;  1IN4 A;  1R1U A;  2DU9 A;  2ZNZ A;  3LA3 A;  1J5Y A;  2M4G A;  1NK3 P;  2W7N A;  1FY7 A;  3MD2 A;  2HYJ A;  4XM3 A;  4XON A;  4KA4 A;  4X6A J;  1FOW A;  2KP6 A;  3ZQG A;  1GV2 A;  1TQP A;  1WJ5 A;  3F72 A;  2M9H A;  3WTX C;  1OCT C;  5DD8 A;  2HOT A;  2LR8 A;  1QVU A;  2DQR A;  2MD5 A;  2KIF A;  3Q9S A;  2E2H J;  2ACJ A;  4F55 A;  2B7E A;  5F1J A;  2BYV E;  2F5V A;  1MSF C;  2MH9 A;  2OPT A;  3FX3 A;  1SFE A;  5HVQ C;  2P7V B;  3JRA A;  1J7K A;  2DT7 B;  2CJJ A;  3IKV A;  1Z21 A;  2P7C B;  4XOT A;  5E79 C;  3UKG A;  3JR9 A;  3C2G A;  4XLE A;  3OYN A;  3ZN1 A;  3AAF A;  1WHU A;  2K4J A;  5ED4 A;  3GX4 X;  4OMY A;  2JSC A;  4UVA A;  1MBH A;  2PQ8 A;  1K4T A;  2CV1 A;  3CJN A;  2YSR A;  3HOT A;  1YJN I;  2VUM J;  2Z16 A;  1YE9 A;  3ISP A;  1P2F A;  3D1N I;  3PSI A;  2E19 A;  2Y31 A;  2O0Y A;  2EPF A;  4DZJ A;  2IS6 A;  4QWQ A;  1ERD A;  3HG9 A;  4OOI A;  3SYT A;  4UXN A;  1T08 B;  2HDC A;  2M1B A;  5IYB J;  2L4A A;  1N78 A;  4A3J J;  2Y75 A;  1IC8 A;  3W2V A;  3ULQ B;  1WFX A;  3VYR B;  3RI4 A;  3JRC A;  4B1R A;  1FIA A;  5K5O A;  5GTI C;  1WRJ A;  9ANT A;  1ULY A;  1U2W A;  1F9N A;  2COM A;  2A05 A;  2DCE A;  1QQI A;  5B66 C;  3IH4 A;  1A35 A;  4NBQ A;  1HW5 A;  3FKI J;  3HUG B;  1WI9 A;  4P1W A;  3I64 A;  2R0Q C;  2V1D A;  3OS0 A;  1JKQ C;  4L5E A;  1H88 C;  1PDN C;  5AIP A;  3OYF A;  4A6D A;  4HF1 A;  1D8J A;  3OIO A;  4N4O B;  2UXN A;  4B8X A;  2E60 A;  1XTA A;  3KIO A;  3CCR I;  4ENN A;  3MMY B;  1RRJ A;  3I4P A;  3IRR A;  3PQJ A;  1D3Y A;  1HW1 A;  2V26 A;  2VT3 A;  2QSG X;  4HST A;  4A3K J;  3CMM A;  1BI3 A;  3K4J A;  4ESJ A;  3CC2 I;  2HQA A;  4M3E A;  4M9S A;  1J9I A;  3QU6 A;  1T98 A;  3JTH A;  4I01 A;  3IP4 B;  3QOP A;  2PX9 A;  1JJ8 C;  1ON1 A;  3LAJ A;  2FBH A;  3BTI A;  2EQR A;  3WG7 H;  1VQ8 I;  4Y15 A;  1KZH A;  2VB6 A;  4II3 A;  1DQU A;  3MEX A;  4FTH A;  1ZG5 A;  2OQR A;  2QVO A;  2NNY A;  1XSX A;  1CQT A;  2IGK A;  1BM9 A;  4LOC A;  2M30 A;  2GM4 A;  4PJL A;  1YO5 C;  4H4K C;  5K7Z A;  1AWC A;  4J01 A;  1D1A A;  3A02 A;  3K1M A;  4BXU A;  4LG0 B;  2H1L A;  3TO9 A;  1B8I A;  1ZQ3 P;  1LPQ A;  3FZV A;  4BDY A;  2LRD A;  1ZLK A;  3FXL A;  2EV0 A;  3KLN A;  4XNF A;  3BWG A;  3SQN A;  5E1W A;  3OYA A;  1PVE A;  3GTO J;  5M5X J;  4FHT A;  1FOX A;  3FHZ A;  1KQ9 A;  2VC0 A;  3BTC A;  3W6K B;  2K5C A;  1QO0 D;  3IV5 A;  3CC4 I;  3CJQ B;  1STZ A;  3PNV A;  1WJC A;  1OYI A;  1IXC A;  1CGP A;  2HKO A;  4CUG A;  4PJ0 C;  2LD5 A;  2W48 A;  2QKL B;  4N4N B;  2A3S A;  3EUH C;  4KJZ A;  2JA8 J;  3E6B A;  2BZT A;  3FXK A;  2ZJQ F;  2CW8 A;  1HDD C;  1Y56 A;  5L3C A;  1YJ9 I;  1B9M A;  1P7J A;  3I4N J;  3GEZ A;  5F04 A;  2XAF A;  1WPK A;  2CYY A;  3LQR A;  3BZ6 A;  4I2O A;  1VF9 A;  2K9Q A;  5ICE A;  5J6X A;  5EDN A;  5D8K B;  3MKY B;  3RZD J;  4Y13 A;  1P4X A;  1MND A;  2DYS H;  2MC3 A;  2LOO A;  3J81 Z;  3DBH B;  4BQA A;  5B5E C;  3GCM A;  2VQG A;  3ZQQ A;  4BJ6 C;  1GLN A;  3OL3 A;  4CZZ A;  2QSH X;  1F1Z A;  2RRE A;  2XAH A;  4S05 A;  1FIP A;  5BMZ A;  2MLG A;  4XRF A;  2I10 A;  3CDH A;  3ZMZ A;  2O8X A;  2HGC A;  3P9I A;  5IT3 A;  3J7Z I;  1YQA A;  3H5R A;  4HV6 A;  2VKE A;  2QQ9 A;  3LL7 A;  2X9D A;  5BQT A;  3FM5 A;  2EFW A;  1KU2 A;  2QEX I;  1SAX A;  2CUE A;  2BVL A;  3ESW B;  4GGG A;  2DXI A;  2XSD C;  4IHS A;  3RYR A;  4F7Z A;  2MG4 A;  5L3G A;  2XRL A;  3ZGK A;  4BE0 A;  2Y9Z A;  2E5Z A;  1X2N A;  3FK7 A;  3KP4 A;  1LUJ B;  1ENH A;  4KMU X;  3TED A;  3BLY A;  4DGW B;  3V8K A;  1FZP B;  4ESF A;  3RPU D;  1JKR C;  2PMZ N;  2VJJ A;  4OIN F;  3OY9 A;  3DFG A;  3ZXS A;  4XLP F;  3S2D J;  5ICF A;  2JN6 A;  4UUS B;  2BE5 F;  2BW3 B;  3GLX A;  3KCC A;  3Q3S A;  4H0E A;  5FKN A;  4XRS A;  1O3Q A;  2DA3 A;  2NS8 A;  4LJZ F;  4U7D A;  1D0Z A;  2HTJ A;  3HBL A;  3DKW A;  2G7U A;  1AA7 A;  2HOS A;  1QU3 A;  1BI2 A;  3EQL F;  2ID3 A;  2Z5U A;  3JSP A;  2Q8K A;  5DD4 A;  2XRN A;  1X1P A;  1S9H A;  2O03 A;  3LSH A;  2ELK A;  2M0C A;  4C3I J;  4MEY F;  5L3E A;  3PIO F;  4N9I A;  2WB1 A;  2FE3 A;  3WTV C;  2D1H A;  2CQK A;  3QYF A;  4OAY A;  3F22 A;  3AL0 B;  1K78 B;  2B63 J;  4KN7 X;  4XBF A;  3NAU A;  1ZR4 A;  1QA6 A;  1MSE C;  4EJW A;  5J4V A;  4BUP A;  4EJO A;  3TP3 A;  3IWF A;  3PSF A;  3HOW J;  4PFP A;  3TW7 A;  1L0O C;  3T8T A;  4Q4Z F;  3WTT C;  5EJC A;  5BPI A;  3BR1 A;  5ERI A;  1A36 A;  2LKX A;  2GLO A;  1MBG A;  3VYS B;  4EJT A;  3HRS A;  4CYC B;  4M71 A;  2EFP A;  2X0L A;  1LDK B;  3W2A A;  2WY8 Q;  1R7J A;  1XGS A;  2CQ7 A;  5EGO A;  4BY1 J;  4CO8 A;  4LK0 F;  4OWR B;  3KET A;  2HZT A;  3ZN0 A;  3LMM A;  3MVP A;  1P9Q C;  1YW9 A;  4DYQ A;  2VOP A;  4LLG F;  1HKQ A;  2ZXI A;  1QRY A;  4KUM A;  4S0H B;  1HXD A;  2DBB A;  2FA5 A;  1C0W A;  1F43 A;  2HOA A;  2XGC A;  4QIW N;  5CVR A;  2QYO A;  2RC4 A;  3OYG A;  5F64 A;  4G7H F;  3HJE A;  3GLL A;  2PFB A;  4M3F A;  3B73 A;  5J8F A;  2QLZ A;  6PAX A;  2K3P A;  4L9N A;  3Q0W A;  1R71 A;  1IN8 A;  2D1V A;  3DTE A;  2BXY A;  4A0Y A;  1JTX A;  4UV8 A;  1BR2 A;  1QGP A;  2R7F A;  1ZN2 A;  2XGD A;  3N05 A;  4G7O F;  1R22 A;  1DGR M;  5CLS A;  4A0Z A;  2JT1 A;  4PGH A;  3OSF A;  3RDI A;  3HIF A;  3LSI A;  3K2A A;  4XLC A;  5HDN A;  2EJR A;  2J5P A;  1EV7 A;  2EV6 A;  4JX5 A;  3KX2 A;  4HW0 A;  5GTH C;  5M3F J;  2VBX A;  5M3M J;  4KT6 A;  3GZN B;  2V1X A;  1E3H A;  2E1O A;  3KZZ A;  1VQ5 I;  1DP3 A;  3G3Z A;  3A01 A;  1U8R A;  4JOM A;  4BH9 A;  4A3F J;  2WAE A;  1FX7 A;  2R4G A;  2O8K A;  3DTK A;  5D5V B;  1JT0 A;  1I5Z A;  4PJJ A;  1D1B A;  3IH3 A;  1HCR A;  1OCZ H;  4HNT A;  3EYY A;  1X1D A;  1FLI A;  2IGO A;  4BHC A;  3BJA A;  3ABT A;  3HOS A;  4HLX A;  1ZRF A;  2DMQ A;  3BOQ A;  4A2U A;  3D5S C;  2K02 A;  4Q48 A;  4Y4R A;  5ILS A;  3OYK A;  3U21 A;  1U5T B;  1ZKG A;  2ZFU A;  5KCM A;  2DO7 A;  3LST A;  1ZRD A;  1ZRE A;  1UCR A;  3Q9V A;  1SFO J;  4V2G A;  2VON A;  5J40 A;  4CGZ A;  1BN5 A;  1O7F A;  1IXS B;  3E7L A;  4FX4 A;  4J00 A;  1E0E A;  3N4M A;  5CJ9 A;  1SMY F;  2MLK A;  5EG0 B;  1XGO A;  1BL0 A;  1UHW A;  3E6C C;  2MAB A;  5E1X A;  2CRG A;  2ZNY A;  3KYL A;  1UHS A;  3MZH A;  3G71 I;  3O3K A;  4EGY A;  1IN6 A;  1A5J A;  2JA5 J;  3MCZ A;  3ELK A;  2CQX A;  4MTE A;  1WJE A;  4ZYE A;  2V1N A;  4A0X A;  2HDW A;  1OR7 C;  1Z1D A;  2XGE A;  4RA2 A;  1ZGA A;  1DU0 A;  5IOY A;  2Z9O A;  2DK5 A;  1R4M B;  2FBI A;  3CJR B;  5FJ8 J;  3GTM J;  4G6T B;  4RMN A;  4D7N A;  3R61 A;  1ETQ A;  3E3V A;  1G3Y A;  2MH2 A;  1KU7 A;  1WVR A;  2JPC A;  3WGG A;  1B72 B;  5EEG A;  2H8W A;  3IAS 2;  3WGI A;  1MNE A;  1JGG A;  1YIJ I;  1YX5 A;  1Z77 A;  4AD9 A;  2ESN A;  1FNN A;  2ZO4 A;  5LHH A;  4IHY A;  3GTP J;  1SEU A;  1ETW A;  1ETX A;  3WTS C;  4A5N A;  1X4P A;  1BW5 A;  3FKJ A;  2X4H A;  2DT6 A;  2BXZ A;  3F6O A;  4M9X A;  1MW7 A;  1TT5 B;  2OTJ I;  5FO5 A;  3IRQ A;  2K9N A;  3OR1 C;  2JWT A;  2XRO A;  1YLF A;  3C18 A;  3E6D A;  1H9T A;  1BI1 A;  1J0R A;  1KQ0 A;  2FRH A;  4IHT A;  1GHC A;  1VI0 A;  2LKS A;  3K4C A;  4IJA A;  4RGX A;  1O3T A;  2O9L A;  4U7B A;  2EFO A;  5FKM A;  1JUS A;  1B1B A;  1MIJ A;  2ZC2 A;  4YFK F;  3DLL F;  3L2U A;  1I1G A;  2WTE A;  3I71 A;  4C30 A;  1RET A;  5D4R A;  1D1C A;  2DOE A;  1SD4 A;  2BHY A;  2H6B A;  4LFU A;  4EM2 A;  5L3B A;  1QBJ A;  2A5Y B;  1A6I A;  1HKT A;  1AOY A;  3BG9 A;  3LSG A;  1K61 A;  2M4K A;  1NG7 A;  2HI3 A;  2RNG A;  1O3S A;  4F52 A;  4HDV A;  1UFM A;  4BBR J;  2VJ5 A;  2ECC A;  4UB8 C;  2Y0S A;  4JX4 A;  3I56 I;  1Y1V J;  5LGT A;  1W7P B;  2M5W A;  4HNV A;  5A2Q Z;  1QHH D;  2FX0 A;  4R79 A;  3KEO A;  4MEX F;  4IKF A;  5K7H A;  3I59 A;  4GXO A;  3FMR A;  3TGN A;  3MN2 A;  2I5U A;  2HTS A;  3LAP A;  1MH4 A;  2V4J C;  3BJ6 A;  4W97 A;  1D0X A;  2E5N A;  3L2V A;  4P55 A;  4BXX J;  1BIB A;  5LLQ A;  1X3Z B;  2A69 F;  4XSX F;  1GXP A;  2NS0 A;  3KYC B;  2OU2 A;  2XPW A;  1MGT A;  1TC3 C;  2KQR A;  1UEL B;  3B6C A;  2HPM A;  2L7Z A;  3DQV C;  3GZ5 A;  1HQC A;  1IRX A;  3H92 A;  5EF6 A;  4G9Y A;  3PO3 J;  5ILV A;  5J4Y A;  4IEJ A;  3GTL J;  1LDD A;  4L5J A;  5M5W J;  1OQY A;  1WZ2 A;  1BR4 A;  1SD6 A;  1YTY A;  2H27 A;  5J3L A;  4Q5S F;  4IQJ A;  2OV7 A;  3ZP5 A;  3C2B A;  4ON0 A;  2OUM A;  4FT8 A;  3TBI A;  3HTS B;  3J81 K;  4MGR A;  2CH0 A;  2F6C A;  4AU7 A;  3VOD A;  1S3J A;  2M7B A;  4B48 A;  2QBY A;  2KRH A;  2FU4 A;  5CQE A;  1VQL I;  3J7A Y;  1OFC X;  3BQY A;  3SEZ A;  4D0P A;  3HOU J;  2K9S A;  4E7S A;  4B44 A;  2F48 A;  3ZMU A;  2W00 A;  2MYS A;  1TW2 A;  4ZDP A;  3TO6 A;  2MFZ A;  3K4K A;  3EUK L;  2DPU A;  3ZQL A;  4XK4 A;  1T8I A;  2GA2 A;  3I4M J;  3EUA A;  2GXB A;  2NXN B;  3FF5 A;  5LRS A;  2HQ5 A;  3E6M A;  2STT A;  2F5E A;  1OYY A;  3HGY A;  1J59 A;  1U8B A;  1ZRC A;  1FOK A;  2ZME B;  2P5K A;  1MMD A;  4J19 A;  4P9U A;  1EKE A;  1Y0N A;  5F0H A;  2OAZ A;  2OJE D;  5BS6 A;  3QOE A;  3NRV A;  4QTR A;  4U0Y A;  2DAO A;  5DTD A;  3IHU A;  2JPB A;  5EEA A;  1HKS A;  1ACI A;  1FWZ A;  5C4J J;  3PO2 J;  2X1C A;  1ZGW A;  4NB5 A;  4IO9 F;  1P7I A;  2HPI A;  1IJW C;  3ZMT A;  4RLF A;  2ESH A;  1HW2 A;  5M5Y J;  3HSF A;  2KDO A;  4UUS A;  2OBP A;  1CF7 A;  1SVM A;  3VYU B;  5D4S A;  1NG6 A;  1TQM A;  4I76 A;  3K4M A;  3X2Q H;  4DYR A;  3ECO A;  2MGQ A;  1F4K A;  4HV5 A;  1H89 C;  1X2M A;  2QKM B;  3V8L A;  3WG9 A;  2RN7 A;  3CO7 C;  3S32 A;  1GXQ A;  4I98 B;  3TO7 A;  1MH3 A;  3FHN A;  4ENK A;  1DUX C;  2HU9 A;  4RAY A;  1R58 A;  1UJ8 A;  3BR6 A;  1JT6 A;  1IAW A;  4A5M A;  4MFE A;  3CCE I;  2WAQ N;  5TRD A;  1MJA A;  2VXD A;  4OIQ F;  3S3M A;  4HG2 A;  4E7L A;  2ISZ A;  3IUO A;  5FKO A;  2R7D A;  2ZXW H;  2HXO A;  2WV1 A;  1AKH B;  5E18 F;  3F8F A;  4OU0 A;  4XN0 A;  2B0L A;  2L3D A;  4GYG A;  4MFD A;  4AIH A;  1K78 A;  4P9F A;  1JUP A;  1I6H J;  1U6G A;  2I8D A;  2V6C A;  1PYV A;  1LJ9 A;  4AWX B;  1LE8 B;  4RB0 A;  2VL8 A;  3GFM A;  1NK2 P;  3F3X A;  2ZJP F;  2IEK A;  4WCG A;  3CO6 C;  3EYI A;  1OCR H;  2DMT A;  1ODD A;  2HWV A;  5AON A;  3WE3 A;  4DYC A;  1A04 A;  1YRN A;  2JQ7 A;  1Q1H A;  3CCY A;  1O7L A;  1A31 A;  3M3Y J;  2VBY A;  4RAZ A;  2WBM A;  4CYC A;  3J80 Z;  2DDA A;  2ZJ2 A;  3GTG J;  3U1D A;  2R7U A;  4PZJ A;  4IVN A;  1YS7 A;  1IDZ A;  5TIS C;  1XSV A;  4RB1 A;  3DF8 A;  3ABM H;  2FJ1 A;  1FMW A;  3ERE D;  1XSD A;  1OCP A;  2R3S A;  1N75 A;  3S1N J;  1K79 A;  4A93 J;  1IN5 A;  2E7X A;  3SXY A;  2DTR A;  5F08 A;  1MDM B;  2O5R A;  1LVA A;  4WF2 A;  3HEF A;  3HRT A;  2R7X A;  1FP2 A;  3KZI C;  3VOE A;  2IP2 A;  1XN7 A;  2IS2 A;  1MBK A;  4I09 A;  2EZK A;  3CP2 A;  4ESB A;  1XB4 A;  4M3D A;  4BE1 A;  1FJL A;  2PN6 A;  3WTY C;  5DCM A;  4O5V A;  4F92 B;  1RUN A;  2JUG A;  1JGS A;  1NTC A;  3EUH A;  3WHC A;  1D5Y A;  2KIS A;  4WWC A;  5D8L B;  2LP0 A;  1SD7 A;  2KIM A;  2HEO A;  1USS A;  1O4X A;  2QCO A;  2NOG A;  3WU1 B;  4I99 C;  2XSJ C;  3L00 A;  4HA8 A;  1XGM A;  5FLX Z;  2LRE A;  4DJA A;  4M6V A;  3AL0 C;  2R7T A;  1TT0 A;  3S2W A;  2GA1 A;  3FIS A;  1RKT A;  1XDS A;  5D6F A;  2RQQ A;  1AHD P;  4II2 A;  2V9K A;  3ZQF A;  1Z67 A;  2EZI A;  5H6Q A;  2FNA A;  1LEA A;  1W1W E;  3K6G A;  1W0T A;  4MHG A;  1U5T A;  4CH7 A;  1QZE A;  2YR2 A;  2L4M A;  3V7R A;  3OYD A;  2EFN A;  2H6C A;  2IPQ X;  2NVY J;  2DMU A;  1BOB A;  1O57 A;  2LY2 A;  4CCN A;  2MD0 A;  1RKW A;  1MNM C;  2XAG A;  1B6A A;  3RCO A;  3O8G A;  2EIL H;  2XAU A;  5GP9 A;  3RIR A;  3HRU A;  3BC8 A;  3RPQ A;  4KNY A;  1YOV B;  3U9G A;  5DV5 A;  1WCM J;  1BJZ A;  4KN4 X;  1DDN A;  3FXJ A;  5DEQ A;  1T39 A;  2OF7 A;  3CUO A;  5DUI A;  4AYB A;  1SFX A;  3PUF A;  2E2J J;  2Z3Y A;  4PSX A;  1S29 A;  4KYW A;  4DNC A;  4A3I J;  1S5L C;  3JAM Z;  1PJR A;  4AIK A;  3RPU A;  2EFQ A;  5H2F C;  2XAS A;  2UXX A;  3K1P A;  4LB5 A;  2XPV A;  1W5C C;  2M7A A;  4FE7 A;  2Y48 A;  2UUZ A;  3SJM A;  3MZ8 A;  2V9P A;  2OZU A;  2L0K A;  1B72 A;  3KPH A;  2HFH A;  3H9G A;  2CV0 A;  2E35 A;  3OS1 A;  2D45 A;  2LKP A;  5BNG A;  4ENM A;  1LNW A;  2QF7 A;  5J1Y A;  2DFH A;  4R8H A;  2LBF B;  4BEH B;  1ETY A;  2QQ8 A;  3HSE A;  1XS9 A;  2CO5 A;  2K40 A;  1Z6T A;  4XL9 A;  3TQN A;  2ZCW A;  2RGV A;  2ADU A;  3JRF A;  2WA0 A;  1G8X A;  4CCK A;  1YIT I;  4JK1 X;  5IYD J;  3MWM A;  1YW8 A;  2Y0M A;  3ABK H;  3T0Y A;  1FPQ A;  1BI0 A;  2LC2 A;  5IP7 J;  5K5Q A;  1ZR2 A;  3ABU A;  5CVI A;  3OSG A;  2IS4 A;  2BEO A;  1E3O C;  3E97 A;  2ZXJ A;  5DUK A;  3DU6 A;  3K69 A;  2HVR A;  4DZP A;  4QSH A;  1U5T C;  3BZK A;  3S16 J;  3TL4 X;  4HYE A;  5LD2 C;  2E7W A;  3F8B A;  2CUZ A;  3CCU I;  2W57 A;  2VOO A;  2KIU A;  4PDK A;  1RIO H;  1KU9 A;  1Z7L A;  4CYD A;  1EH6 A;  1LFP A;  4ZYH A;  5JVG F;  3F6V A;  4M3B A;  3V8J A;  3CCL I;  3S1M J;  3OS2 A;  2Y69 H;  3CUQ B;  2LNB A;  3S15 J;  1MBE A;  1MMS A;  2HYF A;  5L3F A;  1DU6 A;  1F36 A;  1PP7 U;  3CME I;  2CUF A;  4BJ5 C;  3TOA A;  2OA4 A;  3P5J A;  3DTI A;  1KU3 A;  1G2H A;  2BY3 A;  5A2Q K;  5IPA A;  2KT0 A;  4HRI A;  3WHB A;  2Z33 A;  1ZG1 A;  3HDD A;  4KIS A;  1S7O A;  3H9J A;  3ZQI A;  3CDI A;  2XGX A;  2PBI A;  3GZ6 A;  3F21 A;  1TQI A;  2GQQ A;  5JLW A;  2L7M P;  4BS9 A;  2M8E A;  1WWX A;  1Z91 A;  2L02 A;  2NOJ B;  4KIG A;  5EEH A;  3V42 A;  1GT0 C;  3REO A;  1XC5 A;  2JA2 A;  1V5F A;  2NS7 A;  3SDB A;  1QPI A;  4YEL A;  4IF4 A;  4M74 A;  1MMN A;  2IRF G;  2R7S A;  2KJC A;  3HPG A;  2K3F A;  1W0U A;  4UHT A;  1SMT A;  1Z3X A;  5IT9 K;  1TWG J;  1JI8 A;  1UMQ A;  3OR2 C;  3ZQC A;  1MMG A;  5KAF C;  4ETS A;  3DEE A;  3A0B C;  3JRI A;  2JA6 J;  1T95 A;  3FBI B;  2ME0 A;  1W36 C;  3HL2 A;  3K70 C;  2BY0 A;  4F3Q A;  3LSP A;  4E70 A;  2BBY A;  3PFY A;  3OYI A;  2JUC A;  2CQQ A;  2ZXH A;  1W36 D;  4DBR A;  2AS5 F;  2CFX A;  3K70 D;  3IAM 2;  5GAG J;  3ZMD A;  3DPT A;  3N97 A;  4WK8 F;  2JVH A;  4RGS A;  4D5F A;  4LIV A;  2COB A;  2VBW A;  3K4L A;  3L1P A;  2QQA A;  5KHD A;  3ECH A;  1EA3 A;  4A12 A;  5HOO A;  1ZG3 A;  4IHX A;  4Q47 A;  2K27 A;  2KRC A;  2VQL A;  2LFB A;  1N77 A;  3BY6 A;  1K6O A;  1K83 J;  3QWL A;  2BGC A;  2PMU A;  2CMP A;  4NUB A;  3LFU A;  2M0M A;  4KIC A;  1U9O A;  2EA4 A;  5KNL A;  3WU0 A;  1T6S A;  5ICC A;  4A3G J;  1PUF A;  3GME A;  4WX9 A;  1IGN A;  2MBF A;  2VKV A;  1W7P D;  2VBZ A;  5CPR B;  1TBX A;  1IV6 A;  1ZGJ A;  3GF2 A;  3CF2 A;  1WQ2 A;  4B47 A;  4IOA F;  4XKV A;  1DP7 P;  3K1N A;  4XLA A;  2PJR B;  1G3S A;  3OWT A;  5JI6 A;  4ZYG A;  2WY7 Q;  2VXZ A;  1V55 H;  2DOF A;  2EK5 A;  4MO7 A;  4V19 K;  3GXO A;  3UNG C;  1I27 A;  3BJO A;  1OR7 A;  2KPM A;  3DPL C;  2GWR A;  2RAE A;  2Q1Z B;  3MQ0 A;  4MLO A;  2XVC A;  5IYC J;  4L9T A;  1FMV A;  3HTU A;  1XMK A;  4P5O A;  1X3W B;  4IRH A;  3AKZ A;  3JW4 A;  2ZSI B;  3S8P A;  3D5L A;  3KLO A;  5FB2 A;  2JZY A;  5E3M A;  2IGN A;  4MNU A;  3VPR A;  1SD5 A;  4E7K A;  2GZW A;  2UZK A;  2OCE A;  4R1H A;  5C44 J;  2VJI A; 
#chains in the Genus database with same CATH homology
 3CCM I;  3CCJ I;  2E36 A;  3PIO F;  3CCS I;  3CCQ I;  2ZJQ F;  1YJN I;  2K3F A;  1QA6 A;  1YJ9 I;  3G71 I;  2FOW A;  1Y39 A;  1FOY A;  1VQP I;  2ZJP F;  1VQ4 I;  3CF5 F;  2JQ7 A;  3CC7 I;  3CJT B;  5DM7 F;  3CD6 I;  3CCV I;  5GAD J;  5GAG J;  1VQ7 I;  2E35 A;  1VQL I;  2H8W A;  1YIJ I;  1YHQ I;  4IOC F;  1VQK I;  3J7Z I;  3G4S I;  2OTJ I;  1YIT I;  1YJW I;  2NXN B;  3CCR I;  1HC8 A;  5DM6 F;  2QEX I;  3J7Y J;  3CC2 I;  1S72 I;  5GAH J;  4IOA F;  3DLL F;  1ACI A;  3CCU I;  1VQ8 I;  3G6E I;  5JVG F;  4IO9 F;  1VQN I;  1VQ5 I;  3CCL I;  4V19 K;  2ZJR F;  1VQM I;  1MMS A;  5GAE J;  3CME I;  1VQ6 I;  1VQ9 I;  2OTL I;  1FOW A;  2E34 A;  3CMA I;  3I56 I;  1VQO I;  1YI2 I;  3CCE I;  2QA4 I;  1FOX A;  3PIP F;  3CC4 I;  4UY8 I;  3I55 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...