5D5XB

Crystal structure of chaetomium thermophilum skn7 with ssre dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
103
structure length
99
Chain Sequence
SDFVRKLYKMLEDPSYHSVVRWSDDGDSFVVLENEKFTKTILPKHFKHSNFASFVRQLNKYDFHKVRHNDEPYGRDAWEFKHPEFRADRKDNLDNIRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human heat-shock transcription factor 1 in complex with DNA.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Transcription
molecule keywords SSRE DNA strand 1
total genus 29
structure length 99
sequence length 103
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00447 HSF_DNA-bind HSF-type DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5d5xB00
3GFLA 1B9MA 2XIGA 4RGSA 1XGNA 2O8XA 1HKQA 3CUQA 2ZXJA 2JSCA 4ESBA 5F64A 3RIRA 2XVCA 3CJNA 1Z1DA 4P5OA 1BM9A 3ZMUA 3LFKA 3Q5FA 1O7LA 4ZYDA 3LSTA 2HS5A 5K1YA 3R61A 2EV6A 1ON1A 1IZ1A 5D8KB 5D8LB 1DUXC 4I0BA 3SQNA 2HTJA 2QM3A 4WXHA 2P8TA 1Z6RA 1ODDA 2C6YA 2EJRA 1S7AA 1D3YA 2V79A 1LDKB 3K1PA 5TJJA 2WWYA 5BMZA 3V8KA 1R1UA 3D0SA 2H94A 3RPQA 1XD7A 3DPTA 3MEXA 1IRGA 5BS6A 3GF2A 1UHMA 5DUIA 3F3XA 3E5QA 4XBFA 1EH7A 1KYWA 2OZ6A 4RAZA 5L3BA 1YIOA 5DDGA 3HOSA 2DT5A 3T8TA 3NRVA 2LKPA 3JSPA 5DCMB 3R4KA 4YIIA 4HDVA 5HS9A 2FE3A 3GLXA 1W7PD 2ISYA 4UVAA 1FYKA 5DYMA 2DK8A 3LQQA 2PLYA 3EYIA 1J75A 3E6CC 3I59B 1QZZA 1KQ9A 1TLHB 2QWWA 2KKOA 4OIQF 4EVIA 4KUMA 4DQ2A 4ENJA 3F8FA 1LJ9A 2XAQA 1W5TA 3WE2A 2B0LA 5ICFA 2W85A 4XSZF 1UFMA 4RB1A 1S8NA 1PP8F 3J81Z 4JBAA 1JHFA 4NHJA 1MJBA 1CF7A 1GVJA 4N9IA 2QZ8A 4HF1A 4BHCA 2FOKA 4OU0A 1ZYRF 3T0YA 2ZFWA 4RB3C 4EM2A 1RNLA 1F9NA 3CUQC 2HKXA 3W6JB 2PEXA 1RUOA 1DDNA 4RB0A 4EJUA 3KEQA 2O0YA 2K4BA 2FXAA 5LLQA 4KIGA 4CDGA 5A2QZ 3VOEA 3E97A 2HKOA 1LVAA 3DXJF 1XN7A 3HRUA 4TV7A 1S7OA 3QP6A 1FOKA 4LG0B 2EA4A 4B09A 2PG4A 5LHHA 3IRQA 2KJCA 1PP7U 4ENNA 3OV8A 3BPXA 1RI7A 3R0JA 5CJ9A 2RDPA 5J6XA 2Z3YA 1JE8A 5FO5A 2UXXA 3JW4A 4JQFA 4LMYA 1P2FA 4U88A 4EGZA 5LHGA 1O7FA 1ZG5A 3V7SA 1T98A 3BPVA 3FHZA 4PDKA 5HDGA 2J5OA 3M7GA 3ZMTA 1YTYA 1ZAOA 2R3SA 1H9TA 1T0FA 3BWGA 2PQ8A 2ZNYA 3T1BA 3ML6A 5D5XB 2VN2A 2EFQA 3CLOA 3BP8A 1NHAA 1LDJA 3P7NA 2BEOA 5HVQC 4HOBA 1HKSA 2MH9A 3RYPA 5FD5A 1SFUA 2V1XA 2PFBA 5LGTA 4KA4A 3BJ6A 2CGPA 2VOOA 1UCRA 2VE8A 4CICA 1R7JA 1W4MA 4HAMA 4KIBA 5F1RA 4EMSA 3J7AO 4LK1F 2RVCA 5DD4A 2DK5A 2E1NA 2P6SA 3DQVC 2DBBA 1UHWA 2O3FA 4N0BA 4FX0A 4YG2F 4I0AA 2DQLA 2RN7A 1LQ1A 3GO5A 3I54A 3LA2A 4MTEA 4KN7X 2D1HA 4G6DA 4ZYGA 2FMLA 1IXCA 1FY7A 1KU7A 1O3TA 3DV8A 4HA8A 3MZHA 3CO6C 2L4AA 1KU3A 1TQMA 1Q1HA 2Z33A 3B73A 1OR7A 1AWCA 2G7HA 1JXSA 4GO1A 5LGNA 4XLPF 3RKWA 4A5NA 1H0MA 5L3GA 2BGCA 2NNYA 3PFIA 5D5VB 5FFZA 4A12A 5E1XA 3WU1B 2ZNZA 2MLGA 2P7VB 4MQ9F 1KYZA 1ZLJA 1T2KA 4EM1A 2Z9OA 1IN5A 4HV5A 2A68F 2EFOA 4Q48A 4EQQA 3C7JA 4M71A 3E3VA 2HWVA 5K5OA 1RUNA 4G8XA 5JR3A 4ON0A 3K1MA 3DFGA 2XHKA 2ESHA 4MEYF 4H0EA 3BROA 2VC1A 4YIFA 1FSEA 2IW5A 1P6RA 3GXOA 1YW8A 1V3FA 3O2PE 3FZVA 3LAPA 3HTUA 4HYEA 2NYXA 3R6SA 4MGRA 3TOAA 2QYOA 2ELHA 1BOAA 3SZPA 4RB2C 2DLLA 1XGOA 3EQLF 5BPIA 2BE5F 2Q8KA 3TDUC 4B8XA 3J81K 2QQAA 4U0VA 2A07F 1IN8A 5ILSA 2CSOA 2P7CB 3NQOA 2FNAA 4A6DA 4WK8F 5EEHA 1R00A 4JK1X 2FBIA 3MAJA 3VB2A 5D5UB 3WGHA 4EM0B 1BIAA 4LB5A 4HV6A 1XSXA 4L5IA 2X0LA 2EFWA 2MD5A 2V1UA 1I1GA 3EUHA 5ICCA 4NB5A 1QQIA 4HQEA 1B9NA 3MQ0A 2O61A 1YQAA 2UWMA 1O3QA 1S3JA 1OYWA 2DAOA 4AIHA 2XAGA 2OU2A 3K69A 1CGPA 3KFWX 1F4KA 5DCMA 3O3KA 4HX8A 3F6OA 4M9XA 4L9VA 5H6QA 4KMFA 4GCVA 4HX7A 1TQPA 2GZWA 3WG9A 4U7DA 5KK1A 5E8IA 4CYDA 3V4GA 2FMYA 1FP2A 4L9TA 3ELKA 2W84A 1DPRA 4GYGA 1BC8C 1XMAA 1IN6A 2CQKA 3ZPLA 3COAC 2XGXA 1KQ0A 3CTAA 4A0ZA 3ECOA 4UV8A 1ZN2A 2VONA 3HHGA 2NRAC 2DTRA 2EFNA 3WTWC 3JAMZ 1BN5A 3ISPA 2XV4S 5FB2A 2E7WA 2F5DA 3KE2A 3E6BA 4LJZF 1OYYA 4L0ZB 1WWXA 4YFKF 2M1BA 3DP7A 4ZZLA 1MKMA 1SD7A 1BI2A 3ZQ7A 4IHTA 1KQ8A 2JZYA 1J7KA 2MA3A 5E1ZB 2GXGA 2ESNA 3GW2A 1YO5C 4BXUA 3C1DA 2L4MA 2P5VA 1FYLA 3FXRA 1TBXA 4R8HA 3FXUA 5J8CA 3U2RA 3P9IA 4WCGA 5KVRA 3WTYC 5IT9K 1MJAA 4LLGF 4Q4ZF 2M45A 1XGMA 3R0AA 1KGSA 2GQQA 1GXPA 2KRFA 2KIMA 2ADUA 5HDNA 2CFXA 3ABTA 1SMYF 1FP1D 4KDPA 2UZKA 3JAMK 1G3TA 3JSOA 3N4MA 3WTUC 2R7DA 1KA8A 1F5TA 1I6XA 4FHTA 1T39A 1YS7A 1W7PA 1C0WA 3ERED 3TGNA 2OD5A 3L00A 4O3MA 1FX7A 2K27A 3GUDA 1MZBA 2ZBKA 3GZ5A 4UVCA 1YLFA 1J9IA 5H20A 2V6CA 4OINF 3ABUA 5LHIA 5JFRA 2BYVE 3I58A 2CW0F 4LLLA 4QLCU 2XAFA 1V4RA 3J80K 4IXAA 3L7WA 4I2OA 1O3SA 5HLGA 3RYRA 5EEGA 1WRJA 3ZMSA 4EJTA 1ZHFA 4EV0A 2IA1A 1HQCA 5FLXK 4HQMA 2VC0A 3P9CA 2GAUA 2COMA 4A2UA 2DPDA 1ZRCA 1JGSA 1FYMA 2W25A 1QBJA 1YW7A 2E1CA 3B02A 1HW2A 5ERIA 2LF8A 3ZN1A 4LGWA 4Q47A 2MH2A 3FX3A 4P96A 2VBWA 3BJAA 2L01A 2EFPA 4Y15A 5H6RA 3LAJA 5LEJA 1SFXA 3E5UA 4BH9A 3KZZA 4G9YA 2F5EA 1OPCA 2Y48A 5AIPA 2P6TA 2RV8A 1U78A 5K5RA 4OIOF 2EV5A 4WXCA 1YW9A 1HW5A 2MC3A 1DP7P 3F8MA 2JRTA 2CG4A 3QOPA 2DQRA 3E5XA 3FMQA 4BNCA 5JHUA 1FWZA 3WODF 1B59A 2H6BA 3FM3A 3L09A 2P5KA 2XASA 3ECHA 1G6NA 2JPCA 1I27A 3DF8A 3FMSA 3GYHX 1TNSA 2A6HF 3RKXA 1P4WA 1FBUA 1Z9CA 2GXBA 3QRFF 3OOPA 1E17A 4E70A 2YR2A 3J80Z 3ZMDA 2JPBA 4ZH4F 3IRRA 2LF7A 1FT9A 2HR3A 1USSA 5CVJA 1K7AA 5E1WA 1XSVA 2QLZA 3Q9SA 1MD0A 2X4HA 1K78A 3K2ZA 2G7UA 4HLYA 2A69F 5HLHA 1G4DA 1XCVA 3K0LA 1J2XA 1L0OC 3WU0A 4OMYA 2F2EA 1QNTA 1TNTA 3FWEA 3AAFA 1U6GA 3LWFA 3GZ6A 3M8FA 3MWMA 3WTZA 4YFXF 5D5WB 2QBYA 2GWRA 1MJ9A 2ZO4A 4PZJA 1P92A 2YU3A 3RJPA 1W7PB 1YFHA 3IL2A 5LGUA 4HDUA 1R5HA 4O5VA 3IKTA 2EB7A 3C3WA 1ZLKA 3F72A 1TW3A 1OKRA 4RS8A 3HOTA 1QGPA 2XRNA 3ULQB 3LA3A 2VOPA 1EH6A 4HZFA 3BOQA 3RPUA 1PDNC 3HHHA 5L3CA 3PQJA 3T8RA 4I09A 2STWA 2IRFG 1W5SA 5CYVA 5FD6A 2ISZA 4XRFA 1XB4A 4HW0A 1ZG1A 2A6EF 4L9JA 5LEKA 1ZRDA 1OMIA 4UNOA 1ZH5A 4M9SA 4M74A 4HF2A 2HYFA 3SHFA 2EV0A 5HDKA 3HUGA 3W6KB 1ZGAA 3QU3A 2ETHA 2OQRA 4MNUA 3G73A 4AIJA 4IF4A 4CHUA 4RGUA 3F8NA 1G3YA 3KLOA 1BIBA 3H92A 2PMUA 1XDSA 3EDPA 2VBYA 2K4JA 2AS5F 1RIOH 3ZP5A 5ILUA 5JVTA 3WTSC 4LB6B 1BBYA 4Y13A 4G94A 3VEPA 4LD5A 2VODA 1TQIA 1GXQA 5ILVA 2O6GE 1ZGJA 4XSXF 1U8RA 2H27A 1G3WA 3HSRA 4S04A 5HOOA 1D8KA 2FNPA 2K02A 3RKYA 1QZYA 4ENKA 3SFZA 4M6YA 3HIFA 1WSUA 3P9KA 1I5ZA 1SD4A 2QQBA 4U0YA 1KU2A 2XKPA 1AOYA 3I53A 4WWCA 1XGSA 2L3DA 1IRFA 4IJAA 2PBIA 2FBHA 3MCZA 1S6LA 3CDHA 5F6FA 4AWXB 4A0YA 2R7FA 2HOEA 1K6OA 1JHHA 1ON2A 1IXRC 3WGGA 1HSTA 1VTNC 2ACJA 2XAJA 1FZPB 2EWNA 4CGZA 1O3RA 4AIKA 1IN4A 2GIVA 3GVAA 3I71A 3LA7A 4R1HA 4LLNA 1TW2A 4G7ZF 4GXOA 4PGHA 5JI6A 2L02A 3LQRA 5ICGA 1K79A 2D2WA 1LEBA 4IRIA 3WTXC 3VFZA 2BV6A 3TQNA 5TRDA 3TDZC 4L9NA 4Y17A 3FXQA 3ROUA 5FFXA 5CVVA 1FNNA 2DO7A 1SAXA 3WE3A 4LG0A 3RTRA 1R1VA 3C18A 3I64A 3QPHA 1K78B 1BJAA 1IXSB 3ZMZA 1ZREA 3QAHA 2FF4A 3MZYA 4M6XA 2Y0MA 2FU4A 3F21A 1U3EM 3PQKA 2IPQX 3QP5A 4ESJA 1FBQA 4RGXA 3IHUA 1WKMA 3HRMA 2KJBA 4OOIA 4MQVA 4HX4A 5L3DA 2YX7A 1IW7F 3GWZA 3NEUA 5BOXA 2HYGD 3U9GA 2CO5A 1FC3A 3CUOA 3TO6A 1G3SA 1T6SA 4WXDA 2RKHA 3RI4A 1EV7A 4A0XA 3WTVC 2MLKA 3JTHA 3GFMA 3F8BA 5ICEA 4KICA 5E17F 1STZA 3SXYA 4KN4X 3KP5A 3HRSA 4NQWA 4AVPA 3HSFA 1HW1A 4GGGA 3IKVA 2IA2A 4ASNA 2OBPA 1IN7A 5L3FA 1PUEE 3TO7A 2M87A 4OIPF 2CWEA 3IC7A 4KYWA 3EYYA 2YPRA 1I1SA 4EGYA 3R60A 2YSRA 1P4AA 2HFHA 3FM5A 3BZ6A 5DEQA 1LNWA 4ZZDA 1F1ZA 2HDCA 4M72A 1QO0D 3KP4A 2A3SA 3M9AA 4ENMA 2M30A 2Y75A 3G3ZA 5DD8A 2H6CA 2STTA 4OMZA 2WC2A 1R23A 4P9FA 4HBLA 1J5YA 2M5WA 4EJOA 2K86A 4IRGA 2CYYA 1WI9A 4MTDA 1E2XA 1SD5A 4RAYA 5D4RA 2XAHA 3GEZA 1R5GA 2F5CA 3KP7A 2LNBA 2MBFA 5E20A 1YS6A 1BI0A 1H9GA 2XUBA 2DI3A 4CXFA 1RZ4A 4KNYA 2DU9A 2OAZA 1QPMA 1B4AA 3JTGA 4I02A 3V8LA 2DW4A 1REPC 5LBQA 1T38A 1FLIA 2EA2A 1R58A 3CO7C 3IWFA 1TTYA 2IT0A 2O03A 1HXDA 2IP2A 1BI1A 4HF0A 3RDIA 2Q0OA 1ZARA 1OYIA 1HKTA 4UHTA 3L2CA 2VBXA 2PJPA 1WQ2A 1CF7B 2HTSA 5IT9Z 3I4PA 5E18F 2RGVA 1LB2A 2FEZA 2HQRA 5IT3A 4Z2YA 2M8EA 3KZYA 5D6FA 4ZYEA 2ZCWA 2OA4A 4AD9A 2UXNA 2YX4A 4P9UA 1KU9A 3KP6A 1GHCA 5HLIA 4EJVA 3DPLC 2F5FA 3M1EA 4R79A 2V1DA 1X3UA 4U0WA 3HRTA 3F22A 4ESFA 2GA2A 5LRSA 3K1NA 4BHPA 4IRHA 2D45A 2FSWA 3IWZA 2AXLA 4IPAA 1ULYA 3FF5A 5A2QK 4G6QA 2PI0A 4K2EA 4M9ZA 4MEXF 4F7ZA 5ED4A 1MDMA 5AONA 4D0PA 2FBKA 4UXNA 5DV5A 2A61A 2JT1A 2NAZA 5E8GA 2FA5A 3ZMVA 3QPTA 1Y0UA 3T5XA 2KIFA 4WF2A 4RGRA 3KCCA 4PGGA 1SFEA 3F6VA 4KIFA 2VE9A 2XKOA 3HTSB 3WGIA 5BQTA 5CVRA 1EH8A 2QENA 3F23A 2ZJ2A 4ZYHA 5D4SA 1HSJA 1HBXG 2WTEA 2LDUA 5J8FA 2RQPA 1LDDA 4G7OF 1R1TA 2P4WA 4L18B 1SMTA 5LRRA 2H09A 3VODA 2IA0A 4UUVA 3DEUA 1MGTA 3K9TA 4MHGA 4DNCA 1XMKA 4ETSA 2QQ9A 4O6JA 5HS7A 5CLSA 4FT8A 1IAWA 1Z91A 4A5MA 3HSEA 3I5UA 3GX4X 1B1BA 2LSOA 3I0TA 3DKWA 4S05A 3L9FA 1Z7UA 4QWQA 3V7CA 1LEAA 4PCQA 2W24A 2BBYA 1DPUA 4BHBA 3KP3A 3KLNA 2V9VA 1SD6A 3D5LA 2ZMEB 2WV0A 2PN6A 5HS8A 2L54A 2TDXA 4IVNA 1R22A 1XDUA 4P55A 3TOBA 3O6BB 2FRHA 3MFKA 3N97A 6PAXA 2Q2EA 4KFCA 1FPQA 5L3EA 1R36A 1J0RA 1Z6TA 1J59A 4LFUA 1A04A 4YFNF 5D6EA 5CVIA 2QBYB 2Z99A 5FGMA 3GFIA 1L3LA 2J5PA 2VT3A 3I59A 2OZUA 2VT2A 4KMUX 4L0YB 3REOA 3E6MA 2QUFA 3BDDA 1ONVA 3GFJA 2A5YB 3S2WA 2NS0A 2PMHA 4BQAA 2W57A 1D5VA 3QU6A 4I98B 4XLNF 1FSHA 1ZG3A 3U1DA 2GA1A 4CZZA 3TKYA 4BAYA 3Q9VA 2E7XA 4N9HA 1FBSA 5AIQA 2QVOA 2HGCA 2KIUA 1D8JA 2XROA 1USTA 2EK5A 2DPUA 3WTTC 2HZTA 4UVBA 2IVMA 3TO9A 2G9WA 3KEOA 4BYYA 1B6AA 1O57A 1Z05A 2HQNA 3KP2A 5DUKA 4CO8A 4WX9A 2OQGA 5BPDA 1IUYA 1S29A 4L5JA 2NNNA 4I01A 1BC7C 4G7HF 1ZRFA 2RNJA 4I7HA 4Q5SF 3V7RA 2D1VA 5K5QA 3H3ZA 2VBZA 2HEOA 2DFIA 4OIRF 4IHSA 3BJOA 2VXZA 4GYIA 3F8CA 1XSDA 4UV9A 4M73A 1MDMB 1YYVA 3H3UA 2K7LA 2JTVA 1IF1A 3BY6A 4KT5C 2ZKZA 3M8EA 2Z5UA 2ZMEA 4A6EA 1U5TA 3CUQB 5FLXZ 4FX4A 4HLXA 1XCBA 1U2WA 4U7BA 1YG2A 1UB9A 3ZN0A 1BI3A 3FMRA 2P5LC 1U5TB 3EETA 2IJLA 5CVUA 3V8JA 2RC4A 1P4XA 4LK0F 3E6DA 1U5TC 5DCFA 2FQ3A 4EJWA 3SZTA 3HYIA 3KETA
chains in the Genus database with same CATH superfamily
4CUGA 1TWFJ 3GFLA 5E3NA 1B9MA 2XIGA 4RGSA 1XGNA 4UUSB 4BJTA 2O8XA 1X1BA 1HKQA 3J7AY 3K4NA 3CUQA 2ZXJA 2JSCA 4ESBA 2E2IJ 5F64A 3RIRA 2XVCA 3CJNA 2V9PA 3GTPJ 1RR8C 1Z1DA 3FKIJ 4P5OA 1BM9A 3ZMUA 2K3FA 2DT6A 3LFKA 3P5JA 3Q5FA 1O7LA 2TRTA 2XF6A 3TBIA 1FOXA 2R7SA 3KEYA 3VWBA 4ZYDA 3LSTA 2HS5A 5K1YA 3R61A 2EV6A 1ON1A 1MBEA 5KAFC 1IZ1A 5D8KB 3H0GJ 5D8LB 4CA0A 1DUXC 3B6AA 3A2KA 4I0BA 3OWTA 1IUFA 3SQNA 2ELKA 3G71I 3GTOJ 2HTJA 1HDDC 3B6CA 4E7LA 1Z0XA 3V42A 2BW3B 2K9MA 2E35A 2EBIA 2QM3A 1WJ5A 2HYJA 1Y1VJ 3DLAA 3HJEA 2P8TA 4WXHA 1Z6RA 1ODDA 2XGCA 2EJRA 2BZTA 2C6YA 3D5RC 1S7AA 1T0FC 3ZQIA 5GAGJ 3HC7A 3BTCA 3ABLH 1D3YA 2AQEA 1H88C 2EINH 2VLAA 2V79A 1ZR4A 1LDKB 2M34A 3PO2J 3K1PA 5TJJA 1WJAA 2WWYA 3EUKL 5BMZA 3V8KA 1R1UA 1E3HA 3D0SA 4B44A 2H94A 3RPQA 1XD7A 3DPTA 3MEXA 1IRGA 3HZJA 5F0HA 5BS6A 3MZ8A 3GF2A 4GFBA 1UHMA 5DUIA 2CS3A 3F3XA 3E5QA 4XKWA 1YX5A 2VJIA 3GCMA 5M5WJ 4XBFA 4DOZA 4FCYA 4F3QA 1EH7A 5J40A 1KYWA 2OZ6A 4RAZA 4B47A 2O8KA 3W2AA 5L3BA 1YIOA 2XGEA 1HA8A 3M4OJ 5DDGA 3G1LA 3HOSA 2UV1A 2DT5A 3T8TA 3AG2H 3NRVA 3PUBA 2LKPA 1VQ7I 2KZGA 5K7FA 3JSPA 1POGA 5DCMB 1BR4A 3R4KA 4PJJA 3NWSA 4YIIA 4HDVA 4IO9F 5HS9A 2V6EA 2FE3A 3GLXA 1W7PD 2ISYA 4MO7A 3HB9A 4UVAA 3G6EI 1FYKA 2HVSA 2EZIA 5DYMA 3I3LA 2DK8A 4ZDPA 3LQQA 2LOOA 2PLYA 2X1CA 3EYIA 1J75A 3MD2A 4E7ZA 3E6CC 3I59B 1QZZA 2CRGA 1KQ9A 1TLHB 2QWWA 2KKOA 4OIQF 3L2UA 2E36A 4EVIA 4KUMA 1FOWA 4DQ2A 4ENJA 3S2DJ 3F8FA 1HDPA 2HDWA 4XIDA 1LJ9A 2XAQA 3CF5F 2M3AA 1W5TA 3WE2A 4J01A 2B0LA 5ICFA 2W85A 4XSZF 1UFMA 4RB1A 1S8NA 1PP8F 2E5NA 5C44J 1JUPA 2WY8Q 2KISA 2DCEA 3MKWB 2NOJB 3J81Z 3LSRA 4JBAA 1JHFA 2HQAA 4QTRA 4NHJA 1MJBA 4I76A 1CF7A 1DQUA 1GVJA 2WBMA 3CCYA 2VJ4A 4N9IA 2QZ8A 4A3LJ 3IAS2 1W36D 4HF1A 4BHCA 2FOKA 4OU0A 1ZYRF 3T0YA 2ZFWA 4RB3C 4EM2A 1MSEC 1RNLA 1F9NA 3CUQC 4CCJA 2HKXA 5F0CA 1R49A 3H5RA 1JKQC 3W6JB 1WVRA 2PEXA 2XB5A 3FKJA 1RUOA 1DDNA 4RB0A 4EJUA 2NVUB 3KEQA 2DN0A 2O0YA 4ZTJA 2K4BA 3JCUC 2FXAA 5LLQA 1QVTA 2P0WA 4KIGA 4CDGA 5A2QZ 1NH3A 3VOEA 3N05A 3E97A 2QF7A 2EQRA 2QKLB 4A3FJ 4B4CA 2HKOA 3MN2A 2JJ7A 5FKKA 1LVAA 2F5VA 3SEZA 3DXJF 1XN7A 5M3MJ 3HRUA 4IX7A 4TV7A 1S7OA 2MYSA 3QP6A 1I6HJ 1FOKA 4LG0B 2EA4A 2YUSA 4B09A 2H8RA 2PG4A 5LHHA 3IRQA 2KJCA 1PP7U 2K9NA 1WH5A 2M4KA 4ENNA 3DBHB 2X6YA 3OV8A 4IHWA 1A6QA 3BPXA 3ZQGA 1OISA 3OYDA 1EJ9A 1RI7A 1NG7A 3R0JA 1XC5A 3CC2I 5CJ9A 2RDPA 1Y56A 3DEEA 5HNFA 5EGOB 1JJ8C 1VQKI 3CP2A 5J6XA 4B3XA 2DOEA 1MH3A 2Z3YA 2ME6A 2DA5A 1JE8A 2L5QA 5FO5A 1MSFC 4D5CA 1D1BA 2UXXA 3JW4A 4XR6A 1RESA 4JQFA 1ZELA 4LMYA 3KYDB 2CQQA 1P2FA 4U88A 2W4SA 5IOYA 4EGZA 5LHGA 2DTZA 2QEXI 1TL8A 1O7FA 1ZG5A 1VI0A 3V7SA 2JN6A 1T98A 3BPVA 3FHZA 1GVDA 4PDKA 2FOWA 3OL3A 5HDGA 4FE4A 2V7FA 1U9OA 2J5OA 3M7GA 3ZMTA 1YTYA 5C4XJ 1ZAOA 2R3SA 3D5SC 5J3LA 4E7HA 4EATA 1Y39A 1H9TA 1T0FA 3BWGA 2PQ8A 2ZNYA 5EJCA 2VKHA 2KIQA 3S3NA 3T1BA 2ZFUA 3IP4B 3ML6A 1QVUA 4XLAA 4FASD 5D5XB 2VN2A 4F93B 2EFQA 3CLOA 3BP8A 5FKLA 3VSLA 4BXFA 1NHAA 4D1QA 1LDJA 1V55H 3P7NA 2F4MB 3QYFA 2IGNA 1RRJA 2BEOA 1OCPA 5HVQC 4HOBA 1UELB 1HKSA 2MH9A 3RYPA 2MD0A 4M3GA 5FD5A 3S15J 5IPAA 1SFUA 2Q1ZB 4LIUA 2V1XA 2PFBA 5LGTA 2HOSA 3OYFA 4KA4A 2Y30A 3BJ6A 1MNEA 3H0DA 2CGPA 2VOOA 4BDYA 1U8BA 1UCRA 2VE8A 4CCNA 4BBRJ 4CICA 1R7JA 1W4MA 4M3FA 1WJFA 1LE8A 2K85A 4HAMA 4KIBA 5F1RA 5M5XJ 4EMSA 1HLVA 3J7AO 3L1PA 4LK1F 5FKOA 2RVCA 3DTKA 1MNMC 5DD4A 3PIOF 2DK5A 2E1NA 2P6SA 2EZLA 3DQVC 2DBBA 3PNVA 1UHWA 2O3FA 3BCAA 4N0BA 4DBRA 4FX0A 1AHDP 4GDFA 4YG2F 4I0AA 2DQLA 4B3AA 3G4SI 4DYRA 2BY0A 2KDOA 5FRNA 2RN7A 1LQ1A 4BGDA 4XN3A 4XLEA 4HG2A 3OY9A 3GO5A 3I54A 2DA2A 2DOAA 3LA2A 1VQ5I 4KN7X 4MTEA 1GV2A 3DU5A 2D1HA 3BZKA 1T56A 4G6DA 4ZYGA 1IXCA 1FY7A 2FMLA 3DEWA 3LSKA 1KU7A 1QZEA 1O3TA 3DV8A 4E7SA 1ACIA 4HA8A 3MZHA 3CO6C 2L4AA 2V26A 4DIQA 2ZJQF 1KU3A 1TQMA 4BQOA 4A3DJ 1NG6A 3H5AA 3SDGA 1Q1HA 1VFCA 2WADA 2Z33A 3B73A 2JA8J 4Z6YA 3GTLJ 1OR7A 5H2FC 1AWCA 2G7HA 2IGOA 5FROA 2Z16A 3K7AJ 1JXSA 4GO1A 5LGNA 2ZXIA 3PSIA 1RR7A 4XK4A 4AUXA 1PYVA 4XLPF 3RKWA 1DGWY 4A5NA 1H0MA 1G8XA 2WAQN 4DYCA 2W82A 2ZXWH 3FXLA 3BZCA 1YX3A 2FD5A 4D7MA 2M4GA 5L3GA 2BGCA 2NNYA 3OMYA 3MKYB 4CCMA 1APLC 3PFIA 4BEHA 1OCOH 5D5VB 2JA5J 2OTLI 5IY5H 3AG4H 5FFZA 4A12A 1IG7A 3BG7A 1JJ6C 4PJ0C 5E1XA 3WU1B 1VQOI 4PJLA 3CF2A 2ZNZA 3OOUA 2MLGA 2P7VB 4P1WA 4MQ9F 3SYTA 3SEQA 1KYZA 2LKXA 1D0ZA 3OIQA 1ZLJA 1T2KA 2XSDC 4EM1A 2Z9OA 1IN5A 2O7OA 4E6KG 3PJRA 2ZC2A 3OIPA 4HV5A 1ETVA 2A68F 2XRLA 2EFOA 3TW6A 1DGRM 4Q48A 4EQQA 3HOWJ 2W7NA 3HKZN 3ZCOA 3C7JA 3OR2C 5DS9A 1SVMA 4M71A 1HCRA 4F92B 3QODA 5EZGA 1VQNI 2H1KA 3E3VA 2HWVA 5K5OA 1RUNA 4G8XA 4ON0A 5JR3A 3J7YJ 3K1MA 4QPQA 3DFGA 2EIJH 2XHKA 3RQ4A 2H8WA 2ESHA 4MEYF 4H0EA 2HNHA 1IDYA 2WAQA 2Y0SA 2JRMA 2XPUA 3BC8A 3BROA 2VC1A 1UJ8A 4YIFA 3HOYJ 1UAAA 1FSEA 1VNDA 2EZKA 1I39A 2JWTA 4BJ6C 2IW5A 2LRDA 1P6RA 3GXOA 1YW8A 2H1LA 1V3FA 3O2PE 3FZVA 2CW8A 4DZPA 1FIPA 2CW7A 5B1BH 3LAPA 3HTUA 4HYEA 2NYXA 3R6SA 4YELA 4MGRA 3TOAA 2QYOA 1PVEA 1NTCA 2ELHA 5LD2C 1BOAA 5B1AH 5JVGF 2IS1A 2VKEA 3SZPA 4RB2C 3W6VA 2DLLA 2DOFA 1XGOA 3EQLF 3H9GA 5BPIA 2DXIA 2BE5F 2Q8KA 3TDUC 4B8XA 3J81K 2R7RA 2QQAA 4U0VA 3HM5A 4BS9A 2E1MB 3S3MA 2L9SA 2A07F 5IYCJ 1IN8A 5ILSA 2CSOA 5FJ8J 5IYDJ 2P7CB 3NQOA 2FNAA 4A6DA 1X1AA 1IRZA 4WK8F 2R7ZJ 5EEHA 3ZGKA 1IRXA 3W2VA 1R00A 3GTGJ 4JK1X 2FBIA 2L0KA 3MAJA 1X3WB 3VB2A 4BQNA 5D5UB 3WGHA 4EM0B 1BIAA 4LB5A 2VJ5A 4HV6A 1XSXA 2R7XA 4L5IA 2X0LA 4CYCB 3TEDA 1N25A 2COBA 2N8GA 3CCVI 2EFWA 2MD5A 2V1UA 4A93J 2QQ8A 1I1GA 3EUHA 2Y31A 5ICCA 1VQPI 2E60A 1ETOA 4NB5A 3C2GA 3Q3SA 2ZSIB 5JHFA 4XQFA 1QQIA 4HQEA 4HSTA 3M1CA 1GT0C 4AYBA 1B9NA 2LP0A 1A35A 3MQ0A 2O61A 2RREA 1YQAA 2UWMA 1GUUA 1O3QA 1S3JA 1OYWA 2QA4I 2DAOA 4XL9A 4AIHA 2VPLA 2XAGA 2OU2A 2K40A 1RKWA 3K69A 3K4KA 1IV8A 4XKCA 1CGPA 1BJZA 3JRHA 1D0YA 3KFWX 2VUMJ 3GLLA 3LOCA 3FBNB 2GIZA 2IXSA 3CCSI 3G1OA 1F4KA 2R92J 2ZMEC 5EYRA 1UZCA 2F4OB 2IAIA 5DCMA 1ITYA 3O3KA 4HX8A 2KRHA 3F6OA 4M9XA 2K9SA 4L9VA 5H6QA 4KMFA 2JA7J 1VQ4I 2LBFA 3BR5A 4GCVA 2CV0A 2MFZA 4HX7A 1TQPA 2GZWA 4NDLA 4B48A 1DP3A 1E3OC 3WG9A 4U7DA 4IHYA 5KK1A 2HPMA 5E8IA 4LG3A 4CYDA 3V4GA 3HOZJ 3BTIA 3OSFA 2FMYA 1FP2A 3CC7I 1WHUA 1JKRC 4ANJA 4L9TA 3ELKA 2W84A 2BXZA 1DPRA 4GYGA 2CQXA 1BC8C 4HNVA 3BR1A 4M3EA 3GTKJ 1XMAA 1IN6A 2AO9A 2CQKA 3ZPLA 3COAC 2XGXA 1KQ0A 3CTAA 1TWCJ 3I9V2 4A0ZA 3HOXJ 3ECOA 4UV8A 1JT6A 1ZN2A 3CJRB 2VONA 3HHGA 2KL4A 1WJDA 4X1EA 2NRAC 4IQJA 3FXJA 2DTRA 1KONA 2EFNA 4KJZA 3BQZA 3WTWC 3DTEA 3JAMZ 2B9SA 1ETQA 1BN5A 3ISPA 2XV4S 4ZDLA 1FIAA 3U21A 5FB2A 1VQLI 1BA5A 2E7WA 2F5DA 3KE2A 3E6BA 1WFXA 4LJZF 1OYYA 2OV7A 1YRNB 2ZJRF 3SDBA 4L0ZB 3VYRB 1WWXA 1EKEA 3Q0WA 2JA2A 3BTJA 4YFKF 4C2MJ 2M1BA 3DP7A 4ZZLA 3F9KA 2KLOA 3K4LA 3PNYA 3VPRA 1MKMA 1SD7A 3OL4A 5TGTA 1BI2A 3ZQ7A 3CMAI 4IHTA 1KQ8A 4W97A 2QCOA 1Q1VA 2W48A 1ZR2A 2MW8A 2JZYA 2X51A 1X1CA 3OSGA 1J7KA 2KDZA 1QPIA 1Z3XA 1VQMI 1JTXA 4A3CJ 2MA3A 1YJ9I 1MMAA 3WHCA 1Z67A 4CYCA 5E1ZB 2GXGA 5B3SH 2ESNA 2DFEA 2LREA 2W00A 3GW2A 3PO3J 1YO5C 5TISC 3KZIC 4B1RA 1IJWC 4A3BJ 1AA7A 2OCEA 4BXUA 5FLMJ 3C1DA 2L4MA 2Q2EB 5J4YA 3HDDA 2D5VA 3K10A 4ZYAA 1JGGA 2E2JJ 2P5VA 2CV1A 3AFHA 1FYLA 2R7QA 3IH4A 1W36C 3FXRA 1TBXA 4R8HA 1LFPA 3FXUA 3U2RA 3P9IA 1WPKA 5KVRA 5GTIC 5J8CA 4WCGA 3WTYC 1WGXA 2OCCH 1KZHA 1MMDA 3ASNH 5IT9K 1MJAA 4LLGF 2ZB9A 4Q4ZF 3S17J 2M45A 3OYIA 3BR6A 1XGMA 3D1NI 3R0AA 2L9NA 1KGSA 3ONQA 2GQQA 2IS2A 3FXOA 4KT6A 2KRFA 2KIMA 2OJED 1GXPA 2ADUA 5HDNA 4LOCA 2XSJC 4XRSA 1UG2A 2CFXA 3ABTA 1SMYF 1FP1D 4E7IA 2UZKA 4KDPA 2ECCA 3JAMK 4LITA 2MSYA 3K6GA 1MBHA 1G3TA 3JSOA 2F6CA 1YI2I 2HI3A 1YHQI 2KP6A 4MFEA 3N4MA 3WTUC 1JT0A 2R7DA 1KA8A 1F5TA 1I6XA 4FHTA 1T39A 2XF7A 1VF9A 3K2AA 5FKMA 2ELJA 1S72I 3I4NJ 2A6TA 1YS7A 1H89C 3PM1A 4A3GJ 2VKVA 1WCMJ 2KRCA 3ZXSA 4E7KA 1W7PA 1C0WA 3ERED 2AQFA 2JVGA 3TGNA 2OD5A 2ZXHA 2LD5A 3L00A 2KFDA 3CMMA 1YITI 5GP9A 4O3MA 1FX7A 2K27A 3GUDA 1DU0A 1MZBA 2ZBKA 5HODA 3GZ5A 4UVCA 1YLFA 4RAFA 4DJAA 1J9IA 5H20A 3GTQJ 2V6CA 4OINF 4UB8C 3ABUA 3BTLA 5LHIA 4RM3A 4DBQA 5JFRA 2BYVE 5JLXA 1XTAA 3I58A 2NOGA 5F27A 3IH3A 2CW0F 2VQHA 4LLLA 3TP3A 4IOCF 4A3EJ 2OC6A 4RMNA 4XN0A 4QLCU 3KIOA 2XAFA 3A0BC 1ETYA 1V4RA 1VQ8I 4I99C 3J80K 2LG4A 1K6YA 1T08B 1YRNA 2WB1A 4IXAA 3L7WA 4I2OA 1HC8A 3H1CA 1O3SA 5HLGA 2EZHA 3OYCA 3OYEA 3RYRA 5EEGA 1WRJA 5E3LA 3ZMSA 3JREA 4EJTA 1ZHFA 4EV0A 3RCOA 2X6XA 2IA1A 4UY8I 1ORKA 1HQCA 3CD6I 2DYRH 5FLXK 4HQMA 2XB0X 2VC0A 3S3OA 3P9CA 3SJMA 2GAUA 3ZOBA 2IGKA 2COMA 4A2UA 2DPDA 1ZRCA 1JGSA 1PUFB 1FYMA 2W25A 4NNJA 1QBJA 3PNTA 4J19A 3H9JA 1YW7A 3Q0UA 3RKQA 2E1CA 3B02A 2I8DA 3ZR8X 1JUMA 1HW2A 5ERIA 2LF8A 3ZN1A 4I6ZA 3NWTA 4LGWA 5IP9J 1H8AC 4X0GA 4Q47A 1E3PA 2MH2A 9ANTA 3FX3A 4P96A 4FETA 2RNGA 2VBWA 3BJAA 2PJRA 5FRMA 2R5ZB 2L01A 1GLNA 5DTDA 2EFPA 4LIVA 4E4HA 4Y15A 5H6RA 3LAJA 5LEJA 2PMZN 2DFHA 1SFXA 5K7ZA 3E5UA 1Z7LA 4BH9A 4XM3A 4XOPA 3NARA 3MVPA 3KZZA 3HL2A 4M3BA 5GTHC 1VQ6I 4NC6A 4N4OB 4G9YA 5IP6A 2F5EA 5JLWA 1OPCA 2CQNA 3AL0C 2Y48A 3BG6A 2NVYJ 5AIPA 1U9NA 2Y0SN 2P6TA 2RV8A 4II2A 5HNHA 3BR3A 4D7NA 3W2WA 1R71A 5K5RA 1U78A 4OIOF 2EV5A 4XKVA 4WXCA 1YW9A 1E0EA 1HW5A 2M8GX 2MC3A 4JOMA 1DP7P 2R7TA 3PL8A 3F8MA 2JRTA 4KITB 2CG4A 1K4TA 3QOPA 2DQRA 2L7MP 3Q0VA 3E5XA 4XOTA 3FMQA 4BNCA 4CCOA 5JHUA 1FWZA 2X1EA 3WODF 3CC4I 1B59A 3HUGB 1SFKA 1LUJB 4A69C 3S2HJ 3IUOA 2LK2A 3ZQFA 2H6BA 2EIKH 3FM3A 4BE1A 5CQGA 3L09A 4L5EA 2P5KA 2XASA 1A31A 3ECHA 1G6NA 4RLQA 2JPCA 1I27A 3DF8A 3FMSA 3GYHX 1V54H 2LMDA 1TNSA 1ZQ3P 2HU9A 2A6HF 3CCLI 4IQ4A 3ABKH 2WAFA 1K61A 2V1NA 3S1RJ 2NS7A 3RKXA 1WJCA 1P4WA 4CZCA 1QA6A 1FBUA 1Z9CA 2GXBA 3QRFF 3OOPA 1E17A 2DMUA 4XLFA 4E70A 5HLTA 2YU9J 1JUSA 2YR2A 3J80Z 3E7LA 3ZMDA 4JX5A 2EPFA 5F04A 3RSNA 1RPWA 2BHYA 2DJNA 2DA4A 2JPBA 4IHVA 1W0TA 4ZH4F 3IRRA 3WHBA 4UUTA 2LF7A 1FT9A 2HR3A 1USSA 5CVJA 1K7AA 2DDAA 3FK6A 5E1WA 1XSVA 2QLZA 3Q9SA 3QYEA 1MD0A 5J4VA 2X4HA 2MC4A 1X19A 1K78A 3K2ZA 2PJRB 2G7UA 3LSMA 1X1PA 2FQ4A 1EA3A 1DU6A 1Y0NA 4HLYA 2A69F 5HLHA 1G4DA 2IS4A 3JRBA 1YOVB 2A5WA 1XCVA 2NVQJ 3K0LA 1J2XA 1L0OC 5GPCA 1I3QJ 4A3KJ 3WU0A 4OMYA 1TC3C 3LMMA 4BKXA 3BLYA 1BOBA 2F2EA 4ZC3A 1QNTA 3GZNB 4PSXA 1TNTA 3FWEA 3AAFA 1U6GA 3LWFA 3GZ6A 2L7KA 1R5ID 2HQ5A 3JRGA 3M8FA 3BR0A 3MWMA 3WTZA 3IV5A 3BT9A 3A02A 4YFXF 1YJNI 5D5WB 2CUZA 2R7VA 2HDDA 2EH3A 2QBYA 2I5UA 2GWRA 5C4JJ 1MJ9A 3ABMH 2ZO4A 4PZJA 3LNQA 1P92A 2YU3A 3S1MJ 3HPGA 3RJPA 1W7PB 1OR7C 3IL2A 1YFHA 2KHMA 4XORA 3U1KA 5LGUA 4HDUA 4BEHB 4CSWA 1R5HA 2E1MC 4O5VA 3IKTA 3LSHA 2EB7A 4FQGA 3C3WA 1ZLKA 2A05A 3LL7A 1B8IB 2JVHA 3H3VK 3F72A 1TW3A 5EDNA 1OKRA 4RS8A 4DZJA 3HOTA 1QGPA 2XRNA 2K5CA 3ULQB 4J00A 3LA3A 2VOPA 2O5RA 1EH6A 4HZFA 3BOQA 3RPUA 1PDNC 1J09A 2ZSHB 3HHHA 5L3CA 1ETXA 4BDZA 3PQJA 3T8RA 1TP4A 4I09A 3OR1C 3CCMI 5CQEA 2STWA 2IRFG 1QHHD 1W5SA 3KX2A 5CYVA 1MW7A 5FD6A 3DBLB 2MGQA 2JA6J 2ISZA 5EEAA 4XRFA 2E34A 1XB4A 4HW0A 4ZTFA 1ZG1A 1T95A 2OF7A 2A6EF 2RQQA 4L9JA 5LEKA 1ZRDA 1OMIA 4UNOA 1ZH5A 2PX9A 4M9SA 3M8JA 4M74A 4HF2A 2HYFA 3SHFA 2R93J 2ME0A 2XPWA 4HNTA 2EV0A 5HDKA 3HUGA 3W6KB 1ZGAA 3QU3A 2ETHA 2OQRA 5GAHJ 4MNUA 3G73A 2XDVA 4IF4A 4AIJA 1SC7A 4CHUA 4RGUA 3F8NA 2Y9ZA 2PMZA 3PUFA 1G3YA 3KLOA 3J7ZI 5IYBJ 1AU7A 1BIBA 3H92A 2PMUA 1XDSA 2LYCA 2VBYA 3EDPA 4W1UA 2K4JA 2AS5F 1TWHJ 1D1AA 1RIOH 3ZP5A 5ILUA 3M07A 3OIOA 4V2FA 2GXAA 2L9VA 5JVTA 3WTSC 4LB6B 1OFCX 2X6WA 4JYKA 1W0UA 1IV6A 1BBYA 4Y13A 3QYBA 3PSFA 2JQ7A 2Y9YA 4G94A 3VEPA 5J47A 3CCEI 3ZRGA 4YEJA 4LD5A 5F1JA 2EILH 2VODA 1TQIA 1GXQA 5ILVA 4FISA 2O6GE 1ZGJA 4XSXF 1U8RA 2H27A 4FE7A 3ZQLA 1G3WA 3A1YA 3HSRA 4XNFA 4S04A 1XMXA 5IOZA 5HOOA 1D8KA 2FNPA 3HBLA 2AXTC 5E3MA 2L9RA 2K02A 3BQYA 3HGYA 3RKYA 2WB1N 4D9JA 1QZYA 4ENKA 3SFZA 1K4SA 4M6YA 3HIFA 1WSUA 3CMYA 3P9KA 3K70D 1I5ZA 2HVRA 2VL8A 4IHXA 1SD4A 2QQBA 4U0YA 2NVTJ 1KU2A 2XKPA 1AOYA 2DODA 4BU2A 4XONA 1PUFA 3FBIB 3I53A 1T33A 3MKZA 3ESWB 3DU6A 3K4MA 4WWCA 1GV5A 1XGSA 1I50J 2L3DA 1LFUP 1IRFA 3DBRB 5KAIC 4OWRB 4IJAA 4FTHA 2PBIA 2FBHA 3MCZA 2LBFB 1S6LA 2LH9A 3CDHA 5F6FA 4AWXB 1NK3P 4A0YA 2R7FA 1ENHA 1SFOJ 1V5GA 1ERDA 2HOEA 1K6OA 1JHHA 2X85A 5KCMA 1ON2A 2XAUA 3I4MJ 4C2UA 1IXRC 3GMEA 4PK4A 3WGGA 2Y69H 1HSTA 1VTNC 2ACJA 2XAJA 1FZPB 2HXIA 2EWNA 4G12A 4CGZA 3OS2A 1O3RA 2VXDA 4IKFA 2DFFA 4AIKA 1FOYA 1IN4A 2CUFA 2GIVA 4E7JA 5EF6A 2BVLA 1MMSA 1FTZA 2JMWA 3GVAA 3I71A 3BCBA 3LA7A 4R1HA 4LLNA 1TW2A 4G7ZF 3I56I 4GXOA 4A3MJ 2L2OA 4PGHA 2M7AA 5JI6A 3CESA 2L02A 3CP8A 4BE2A 3LQRA 5ICGA 1K79A 3K4CA 3S1NJ 4F91B 2D2WA 1LEBA 4IRIA 3WTXC 3VFZA 4RDUA 2VQLA 2BV6A 2DJIA 3TQNA 1X4OA 3JRDA 5TRDA 3QPLA 3TDZC 2V9KA 3A4CA 1Y6IA 4L9NA 4Y17A 3FXKA 2R5YA 2DMQA 3FXQA 1WZ2A 3ROUA 5FFXA 1IDZA 5CVVA 1FNNA 2DO7A 4M3DA 1IC8A 5FLVA 4AIDA 1SAXA 3CJTB 3WE3A 3RQIA 4LG0A 3RTRA 4IZZA 3K4JA 1R1VA 3C18A 3I64A 3QPHA 3EPZA 2FUG2 1K78B 3S1QJ 1BJAA 5E3OA 1IXSB 1OCTC 3ZMZA 2R0QC 2GOXB 2LKSA 4AVZA 1ZREA 3QAHA 2RAEA 4CCKA 4IEJA 2FF4A 2UUZA 3BR2A 3MZYA 4M6XA 2Y0MA 2FU4A 2FX0A 3F21A 1HOMA 4PSWA 1U3EM 2JUGA 4HPQA 5CPRB 3VDXA 1R4MB 3PQKA 3DKXA 4MFDA 4A3JJ 2P81A 2IPQX 3QP5A 2GLOA 4ZJZA 1QRYA 1BL0A 4ESJA 2DT7B 1FBQA 1MBGA 4RGXA 2DA1A 3IHUA 1IO2A 3CZ6A 3WG7H 1WKMA 3HRMA 4Y33A 2KJBA 4OOIA 3AKZA 1X1DA 4MQVA 4HX4A 5L3DA 2YX7A 1IW7F 5GPAA 3OYAA 2E1OA 1JKOC 3GWZA 3NEUA 5BOXA 2HYGD 3U9GA 2CO5A 1N77A 1VQ9I 1FC3A 3CUOA 4PUSA 3TO6A 3VYTB 1FMVA 3C2BA 1G3SA 1T6SA 4YRVA 4WXDA 2RKHA 3RI4A 1RKTA 3DKYA 3H36A 1EV7A 1PJRA 1P7IA 4A0XA 3WTVC 4BL0B 1AKHA 3KYCB 2MLKA 3JTHA 3GFMA 3F8BA 5F0FA 2ID6A 4KICA 5ICEA 4YIRX 1LE8B 1STZA 1X4PA 5E17F 1FMWA 1SANA 2BOLA 2M2EA 3SXYA 4KN4X 2LC2A 3KP5A 3HRSA 3DCFA 1X2NA 4U87A 1TT0A 1Y8RB 4NQWA 4RLFA 4AVPA 3HSFA 2BY1A 2VQCA 4PJNA 1HW1A 3EUAA 2R4GA 4HNUA 4GGGA 3HGGA 3IKVA 1XX5A 1WI3A 2IA2A 4ASNA 3S32A 4II3A 4AU7A 2OBPA 1IN7A 1X3ZB 3HEFA 3FK7A 1MBKA 4X6AJ 3OYMA 5L3FA 2VPRA 1PUEE 3TO7A 2E2HJ 2M87A 3DPUA 4OIPF 3FIWA 3CCJI 2CWEA 3IC7A 3IAM2 4KYWA 3EYYA 1N75A 4XICA 4G6TB 2YPRA 2IS6A 1I1SA 4V2GA 3ZQQA 4EGYA 1R4NB 2HOAA 3R60A 2KQRA 4PFOA 1SVOA 2YSRA 1P4AA 2M0CA 2HFHA 3FM5A 3BZ6A 5DEQA 1SAUA 1LNWA 2NS8A 4ZZDA 1F1ZA 4A3IJ 1BR2A 5F08A 1Y1WJ 4M72A 2HDCA 4BXXJ 1QO0D 3KP4A 4OAZA 4XKBA 1BW6A 2A3SA 3M9AA 4F52A 3I55I 1TWGJ 4ENMA 5E79C 3JRIA 2M30A 3E1SA 2Y75A 3G3ZA 1SEUA 5DD8A 2H6CA 2STTA 5FKNA 1BW5A 4OMZA 1MH4A 2WC2A 5EGOA 1R23A 4P9FA 2LFBA 5DM6F 4HBLA 2Z1DA 3AG1H 1J5YA 2M5WA 4EJOA 2K86A 4IRGA 2CYYA 1WI9A 4MTDA 1E2XA 1SD5A 1W5CC 4RAYA 5D4RA 2XAHA 3ASOH 2X6OA 3GEZA 5J1YA 3GBGA 1R5GA 2F5CA 3KP7A 3CDIA 2LNBA 1ZKGA 2MBFA 5E20A 1YS6A 2VIXA 1BI0A 5DM7F 1RETA 4F55A 1H9GA 2XUBA 2B7EA 2DI3A 4HRIA 4QPOA 3ZQHA 4CXFA 1RZ4A 4NUBA 3X2QH 4KNYA 2DU9A 2KZVA 1Y8QB 4Y3OA 4B43A 4BJ5C 2OAZA 1S7EA 4MIMA 1K83J 3W3CA 4ITVA 5B66C 1QPMA 2R7UA 1B4AA 3JTGA 4I02A 3V8LA 3S16J 4M6VA 3F0CA 3LSJA 1X58A 2DW4A 3G2BA 4XRMA 1REPC 5LBQA 2R7OA 4JP0A 3WU2C 1F43A 2Z2SB 4GRIA 1G2HA 1TWAJ 4BQQA 1OCCH 1T38A 3VYSB 2WV1A 4BY1J 1FLIA 2EA2A 3OS0A 4KISA 2DMNA 1R58A 3FHNA 3CO7C 4CH7A 3TP0A 1MMNA 3IWFA 1TTYA 2IT0A 2O03A 4UB6C 1FJLA 1HXDA 2IP2A 1BI1A 2I10A 4HF0A 1S9HA 3LFUA 3RDIA 3HXLA 2Q0OA 3QWLA 1ZARA 1OYIA 5LFAA 3JRCA 1HKTA 4UHTA 1OJLA 3O8GA 3L2CA 2JUCA 2VBXA 2PJPA 1WQ2A 1CF7B 2HTSA 2G0EA 2DYSH 3CJQB 2B63J 5IT9Z 2CU7A 2DMTA 5M3FJ 1P7JA 3I4PA 5E18F 4BBSJ 2RGVA 1N78A 4C2TA 1UMQA 1LB2A 2FEZA 3HG9A 3BG5A 4Y4RA 2HQRA 2CUJA 5IT3A 3GTJJ 3L2WA 4Z2YA 2CH0A 1BR1A 2M8EA 3KZYA 3CQZJ 5D6FA 1A6IA 4ZYEA 2VKDA 4PJMA 2MG4A 2ZCWA 2OA4A 2HVQA 3RZOJ 2XF5A 4AD9A 2XPVA 3FISA 2V4JC 2HXOA 4C9YA 2UXNA 2YX4A 4C3JJ 4P9UA 1KU9A 3KP6A 1GHCA 1ZK8A 3IH2A 5HLIA 4EJVA 3DPLC 2F5FA 3M1EA 3TW7A 2HOTA 3A03A 1V5FA 4R79A 2V1DA 1EF4A 3ERMA 3CCUI 2LVSA 1X3UA 4U0WA 2VJJA 3HRTA 4ESFA 3F22A 2GA2A 5LRSA 3TL4X 3UR3C 3K1NA 4D5FA 4BHPA 4IRHA 2D45A 2FSWA 3ZQCA 1FEXA 3OYKA 3IWZA 1MBFA 2AXLA 4IPAA 3CDLA 1ULYA 1P9QC 3FF5A 5A2QK 3H35A 4G6QA 2PI0A 2HZDA 4K2EA 3L2QA 4M9ZA 3S14J 4MEXF 4F7ZA 5KHDA 5ED4A 1MDMA 1F36A 4XLHA 3CCRI 2X9DA 5AONA 4D0PA 1D0XA 2FBKA 4C3IJ 4UXNA 2MABA 4HSRA 2F4IA 5DV5A 4NQWB 2A61A 1TT5B 3JRAA 2JT1A 2NAZA 2KT0A 2DA3A 2LY1A 5E8GA 3HOUJ 2FA5A 3KYLA 2CJJA 3ZMVA 3OYJA 3QPTA 2K9QA 1FTTA 4OAYA 2LY9A 1Y0UA 1UHSA 3T5XA 1WJBA 2VI6A 5IP7J 2KIFA 4WF2A 1W1WE 4RGRA 3KCCA 2K9LA 1UG0A 4PGGA 1SFEA 3F6VA 4KIFA 3O8HA 2OPTA 2VE9A 1GDTA 1U0JA 2XKOA 3TMOA 3HTSB 4BUPA 1LVKA 3HOVJ 4UUSA 3WGIA 3K70C 2BY3A 5BQTA 1X2MA 3FDYA 5CVRA 1IGNA 1EH8A 3OYLA 2QSHX 5GADJ 2QENA 3F23A 3FXMA 4XRSG 2ZJ2A 2EIMH 1MNDA 2WA0A 4ZYHA 2KPMA 5D4SA 1R6RA 1HSJA 1HBXG 1Z77A 2WTEA 1LFBA 1AKHB 2LDUA 5J8FA 2RQPA 1LDDA 1XG1A 3NAUA 1R1TA 3JRFA 4G7OF 2OTJI 1LKXA 2FJ1A 2P4WA 4L18B 1SMTA 1D5YA 2VASA 5LRRA 4XLCA 2H09A 2NVXJ 3VODA 3DWLE 2E19A 2IA0A 2DMPA 3QQAA 4V19K 4UUVA 3DEUA 1MGTA 3K9TA 2BVMA 2O9LA 4MHGA 5J1RA 1HF0A 4DNCA 3MKLA 2QGUA 1D1CA 3QPSA 3K4BA 4N4NB 3H5NA 1XMKA 4ABZA 2DA7A 4ETSA 1XS9A 1JI8A 1OCRH 5EZHA 2QQ9A 4O6JA 5HS7A 5CLSA 4FT8A 1IAWA 1Z91A 3AG3H 4A5MA 3LSPA 3HSEA 1Z3YA 2TCTA 2LTPA 3L2VA 3RPUD 3I5UA 3EUHC 5CKTA 1OCZH 2R5YB 3DTIA 3SFIA 4DYQA 1B1BA 5J1UA 3GX4X 3LSGA 1YIJI 3AL0B 3M3YJ 2LSOA 3BG9A 3I0TA 3DKWA 2LLKA 4S05A 3L9FA 1Z7UA 1B72A 1A36A 2NXNB 4QWQA 3V7CA 1LEAA 4PCQA 2W24A 2BBYA 1DPUA 1V5EA 4QIWN 2ID3A 2IEKA 3UKGA 1YE9A 4BHBA 3KP3A 4RBOA 1Z21A 3A01A 2M9HA 4BE0A 3RZDJ 1MBJA 2Y2ZA 3VSKA 3L2RA 2VQGA 3KLNA 2V9VA 1SD6A 4AYBN 2L7ZA 1QHGA 3D5LA 2ZMEB 3OYHA 2WV0A 2GOMA 2IGMA 2PN6A 5HS8A 2L54A 5GAEJ 4RM2A 2TDXA 4IVNA 1R22A 1XDUA 4P55A 3TOBA 5EG0B 2F48A 1NK2P 3O6BB 2FRHA 3MFKA 3SZGA 3N97A 6PAXA 2Q2EA 4KFCA 1FPQA 5L3EA 1R36A 2BHZA 4JX6A 1J0RA 2BY2A 2JK3A 1Z6TA 1CQTA 3LSIA 1OQYA 1J59A 4LFUA 4JX4A 5B5EC 1A04A 5BNGA 4YFNF 5D6EA 5CVIA 1LPQA 2QBYB 2E5ZA 3VYUB 2Z99A 2CQ7A 5M5YJ 2L7FP 2X1DA 5FGMA 3GFIA 1R9TJ 4XMYA 1L3LA 3HKZA 2CFOA 2J5PA 3C2HA 1YJWI 3GTMJ 2VT3A 4IL6C 5KNLA 3I59A 2OZUA 4IOAF 2VT2A 3JR9A 4EEFG 2QSFX 1M1EB 4KMUX 2YS9A 4L0YB 3REOA 1SVLA 1ETWA 1S5LC 3E0JB 1WJEA 3E6MA 2GM4A 2QUFA 3BDDA 3PIPF 2R5ZA 1ONVA 1JTYA 3GFJA 2A5YB 3S2WA 2NS0A 2PMHA 4DGWB 4NC7A 1MIJA 3S8PA 2W57A 1XPXA 4BQAA 1D5VA 3QU6A 4I98B 1VZ0A 2VB6A 4XLNF 1FSHA 1ZG3A 3U1DA 2QKMB 2GA1A 4C30A 3QOEA 4CZZA 4RAGA 3TKYA 4BAYA 4BY7J 2JSPA 2X48A 3Q9VA 2E7XA 3PFYA 4N9HA 1FBSA 1T8IA 5AIQA 1B8IA 2QVOA 2ECBA 2QSGX 2ZJPF 2HGCA 2KIUA 1D8JA 2XROA 1USTA 2EK5A 3HPHA 4CCLA 2DPUA 3CCQI 3H9QA 2HZTA 3WTTC 4AM3A 1I3AA 4UVBA 2R7WA 1G59A 2K3PA 3BG3A 2IVMA 3TO9A 2LR8A 2CV2A 2G9WA 2IBDA 3KEOA 1TZLA 4BYYA 2XGDA 1B6AA 1O57A 1Z05A 2HQNA 3KP2A 5DUKA 4CO8A 4WX9A 2LY2A 3MMYB 2XC7A 2OQGA 2DA6A 2CMPA 5BPDA 4RA2A 1IUYA 1S29A 4L5JA 2BXYA 4NC8A 2NNNA 3S93A 3UNGC 3DLLF 5K7HA 1O4XA 4I01A 1ZGWA 2AHQA 1BC7C 2BW3A 4G7HF 3KPHA 1ZRFA 2RNJA 4I7HA 4Q5SF 3A01B 3V7RA 2D1VA 5K5QA 3H3ZA 2VBZA 2HEOA 4C3HJ 1ZTRA 2DFIA 4OIRF 4IHSA 3BJOA 2VXZA 1JKPC 4GYIA 3F8CA 1XSDA 4UV9A 4M73A 2WAEA 1YYVA 4MLOA 1MDMB 3H3UA 4Y7NJ 2K7LA 5EG0A 2JTVA 1IF1A 3BY6A 4H4KC 4KT5C 2ZKZA 3M8EA 2GBYA 2Z5UA 2ZMEA 4A6EA 1U5TA 3OS1A 4QSHA 3CUQB 5FLXZ 5C3EJ 2ICWG 4BACA 4S0HB 4FX4A 2KMUA 2M7BA 4HLXA 4Y52J 1WH7A 3OYGA 3A0HC 4NBQA 3OYBA 1XCBA 1U2WA 4U7BA 1YG2A 1B72B 1UB9A 3ZN0A 4AC0A 1BI3A 3OYNA 1OLTA 3FMRA 2P5LC 4DW6A 1U5TB 4HEA2 3EETA 2W1OA 2IJLA 2OUMA 2WY7Q 3G1MA 2HPIA 5CVUA 3V8JA 1ETKA 3CLQA 2RC4A 2DDBA 1P4XA 2E71A 1MMGA 4LK0F 3E6DA 2M0MA 1U5TC 2CUEA 4PFPA 5DCFA 1RC9A 2FQ3A 3CMEI 4EJWA 3SZTA 1QU3A 4ZDOA 1A5JA 3HYIA 3KETA
chains in the Genus database with same CATH topology
3GFLA 1B9MA 2XIGA 4RGSA 1XGNA 2O8XA 1HKQA 3CUQA 2ZXJA 2JSCA 4ESBA 5F64A 3RIRA 2XVCA 3CJNA 1Z1DA 4P5OA 1BM9A 3ZMUA 3LFKA 3Q5FA 1O7LA 4ZYDA 3LSTA 2HS5A 5K1YA 3R61A 2EV6A 1ON1A 1IZ1A 5D8KB 5D8LB 1DUXC 4I0BA 3SQNA 2HTJA 2QM3A 4WXHA 2P8TA 1Z6RA 1ODDA 2C6YA 2EJRA 1S7AA 1D3YA 2V79A 1LDKB 3K1PA 5TJJA 2WWYA 5BMZA 3V8KA 1R1UA 3D0SA 2H94A 3RPQA 1XD7A 3DPTA 3MEXA 1IRGA 5BS6A 3GF2A 1UHMA 5DUIA 3F3XA 3E5QA 4XBFA 1EH7A 1KYWA 2OZ6A 4RAZA 5L3BA 1YIOA 5DDGA 3HOSA 2DT5A 3T8TA 3NRVA 2LKPA 3JSPA 5DCMB 3R4KA 4YIIA 4HDVA 5HS9A 2FE3A 3GLXA 1W7PD 2ISYA 4UVAA 1FYKA 5DYMA 2DK8A 3LQQA 2PLYA 3EYIA 1J75A 3E6CC 3I59B 1QZZA 1KQ9A 1TLHB 2QWWA 2KKOA 4OIQF 4EVIA 4KUMA 4DQ2A 4ENJA 3F8FA 1LJ9A 2XAQA 1W5TA 3WE2A 2B0LA 5ICFA 2W85A 4XSZF 1UFMA 4RB1A 1S8NA 1PP8F 3J81Z 4JBAA 1JHFA 4NHJA 1MJBA 1CF7A 1GVJA 4N9IA 2QZ8A 4HF1A 4BHCA 2FOKA 4OU0A 1ZYRF 3T0YA 2ZFWA 4RB3C 4EM2A 1RNLA 1F9NA 3CUQC 2HKXA 3W6JB 2PEXA 1RUOA 1DDNA 4RB0A 4EJUA 3KEQA 2O0YA 2K4BA 2FXAA 5LLQA 4KIGA 4CDGA 5A2QZ 3VOEA 3E97A 2HKOA 1LVAA 3DXJF 1XN7A 3HRUA 4TV7A 1S7OA 3QP6A 1FOKA 4LG0B 2EA4A 4B09A 2PG4A 5LHHA 3IRQA 2KJCA 1PP7U 4ENNA 3OV8A 3BPXA 1RI7A 3R0JA 5CJ9A 2RDPA 5J6XA 2Z3YA 1JE8A 5FO5A 2UXXA 3JW4A 4JQFA 4LMYA 1P2FA 4U88A 4EGZA 5LHGA 1O7FA 1ZG5A 3V7SA 1T98A 3BPVA 3FHZA 4PDKA 5HDGA 2J5OA 3M7GA 3ZMTA 1YTYA 1ZAOA 2R3SA 1H9TA 1T0FA 3BWGA 2PQ8A 2ZNYA 3T1BA 3ML6A 5D5XB 2VN2A 2EFQA 3CLOA 3BP8A 1NHAA 1LDJA 3P7NA 2BEOA 5HVQC 4HOBA 1HKSA 2MH9A 3RYPA 5FD5A 1SFUA 2V1XA 2PFBA 5LGTA 4KA4A 3BJ6A 2CGPA 2VOOA 1UCRA 2VE8A 4CICA 1R7JA 1W4MA 4HAMA 4KIBA 5F1RA 4EMSA 3J7AO 4LK1F 2RVCA 5DD4A 2DK5A 2E1NA 2P6SA 3DQVC 2DBBA 1UHWA 2O3FA 4N0BA 4FX0A 4YG2F 4I0AA 2DQLA 2RN7A 1LQ1A 3GO5A 3I54A 3LA2A 4MTEA 4KN7X 2D1HA 4G6DA 4ZYGA 2FMLA 1IXCA 1FY7A 1KU7A 1O3TA 3DV8A 4HA8A 3MZHA 3CO6C 2L4AA 1KU3A 1TQMA 1Q1HA 2Z33A 3B73A 1OR7A 1AWCA 2G7HA 1JXSA 4GO1A 5LGNA 4XLPF 3RKWA 4A5NA 1H0MA 5L3GA 2BGCA 2NNYA 3PFIA 5D5VB 5FFZA 4A12A 5E1XA 3WU1B 2ZNZA 2MLGA 2P7VB 4MQ9F 1KYZA 1ZLJA 1T2KA 4EM1A 2Z9OA 1IN5A 4HV5A 2A68F 2EFOA 4Q48A 4EQQA 3C7JA 4M71A 3E3VA 2HWVA 5K5OA 1RUNA 4G8XA 5JR3A 4ON0A 3K1MA 3DFGA 2XHKA 2ESHA 4MEYF 4H0EA 3BROA 2VC1A 4YIFA 1FSEA 2IW5A 1P6RA 3GXOA 1YW8A 1V3FA 3O2PE 3FZVA 3LAPA 3HTUA 4HYEA 2NYXA 3R6SA 4MGRA 3TOAA 2QYOA 2ELHA 1BOAA 3SZPA 4RB2C 2DLLA 1XGOA 3EQLF 5BPIA 2BE5F 2Q8KA 3TDUC 4B8XA 3J81K 2QQAA 4U0VA 2A07F 1IN8A 5ILSA 2CSOA 2P7CB 3NQOA 2FNAA 4A6DA 4WK8F 5EEHA 1R00A 4JK1X 2FBIA 3MAJA 3VB2A 5D5UB 3WGHA 4EM0B 1BIAA 4LB5A 4HV6A 1XSXA 4L5IA 2X0LA 2EFWA 2MD5A 2V1UA 1I1GA 3EUHA 5ICCA 4NB5A 1QQIA 4HQEA 1B9NA 3MQ0A 2O61A 1YQAA 2UWMA 1O3QA 1S3JA 1OYWA 2DAOA 4AIHA 2XAGA 2OU2A 3K69A 1CGPA 3KFWX 1F4KA 5DCMA 3O3KA 4HX8A 3F6OA 4M9XA 4L9VA 5H6QA 4KMFA 4GCVA 4HX7A 1TQPA 2GZWA 3WG9A 4U7DA 5KK1A 5E8IA 4CYDA 3V4GA 2FMYA 1FP2A 4L9TA 3ELKA 2W84A 1DPRA 4GYGA 1BC8C 1XMAA 1IN6A 2CQKA 3ZPLA 3COAC 2XGXA 1KQ0A 3CTAA 4A0ZA 3ECOA 4UV8A 1ZN2A 2VONA 3HHGA 2NRAC 2DTRA 2EFNA 3WTWC 3JAMZ 1BN5A 3ISPA 2XV4S 5FB2A 2E7WA 2F5DA 3KE2A 3E6BA 4LJZF 1OYYA 4L0ZB 1WWXA 4YFKF 2M1BA 3DP7A 4ZZLA 1MKMA 1SD7A 1BI2A 3ZQ7A 4IHTA 1KQ8A 2JZYA 1J7KA 2MA3A 5E1ZB 2GXGA 2ESNA 3GW2A 1YO5C 4BXUA 3C1DA 2L4MA 2P5VA 1FYLA 3FXRA 1TBXA 4R8HA 3FXUA 5J8CA 3U2RA 3P9IA 4WCGA 5KVRA 3WTYC 5IT9K 1MJAA 4LLGF 4Q4ZF 2M45A 1XGMA 3R0AA 1KGSA 2GQQA 1GXPA 2KRFA 2KIMA 2ADUA 5HDNA 2CFXA 3ABTA 1SMYF 1FP1D 4KDPA 2UZKA 3JAMK 1G3TA 3JSOA 3N4MA 3WTUC 2R7DA 1KA8A 1F5TA 1I6XA 4FHTA 1T39A 1YS7A 1W7PA 1C0WA 3ERED 3TGNA 2OD5A 3L00A 4O3MA 1FX7A 2K27A 3GUDA 1MZBA 2ZBKA 3GZ5A 4UVCA 1YLFA 1J9IA 5H20A 2V6CA 4OINF 3ABUA 5LHIA 5JFRA 2BYVE 3I58A 2CW0F 4LLLA 4QLCU 2XAFA 1V4RA 3J80K 4IXAA 3L7WA 4I2OA 1O3SA 5HLGA 3RYRA 5EEGA 1WRJA 3ZMSA 4EJTA 1ZHFA 4EV0A 2IA1A 1HQCA 5FLXK 4HQMA 2VC0A 3P9CA 2GAUA 2COMA 4A2UA 2DPDA 1ZRCA 1JGSA 1FYMA 2W25A 1QBJA 1YW7A 2E1CA 3B02A 1HW2A 5ERIA 2LF8A 3ZN1A 4LGWA 4Q47A 2MH2A 3FX3A 4P96A 2VBWA 3BJAA 2L01A 2EFPA 4Y15A 5H6RA 3LAJA 5LEJA 1SFXA 3E5UA 4BH9A 3KZZA 4G9YA 2F5EA 1OPCA 2Y48A 5AIPA 2P6TA 2RV8A 1U78A 5K5RA 4OIOF 2EV5A 4WXCA 1YW9A 1HW5A 2MC3A 1DP7P 3F8MA 2JRTA 2CG4A 3QOPA 2DQRA 3E5XA 3FMQA 4BNCA 5JHUA 1FWZA 3WODF 1B59A 2H6BA 3FM3A 3L09A 2P5KA 2XASA 3ECHA 1G6NA 2JPCA 1I27A 3DF8A 3FMSA 3GYHX 1TNSA 2A6HF 3RKXA 1P4WA 1FBUA 1Z9CA 2GXBA 3QRFF 3OOPA 1E17A 4E70A 2YR2A 3J80Z 3ZMDA 2JPBA 4ZH4F 3IRRA 2LF7A 1FT9A 2HR3A 1USSA 5CVJA 1K7AA 5E1WA 1XSVA 2QLZA 3Q9SA 1MD0A 2X4HA 1K78A 3K2ZA 2G7UA 4HLYA 2A69F 5HLHA 1G4DA 1XCVA 3K0LA 1J2XA 1L0OC 3WU0A 4OMYA 2F2EA 1QNTA 1TNTA 3FWEA 3AAFA 1U6GA 3LWFA 3GZ6A 3M8FA 3MWMA 3WTZA 4YFXF 5D5WB 2QBYA 2GWRA 1MJ9A 2ZO4A 4PZJA 1P92A 2YU3A 3RJPA 1W7PB 1YFHA 3IL2A 5LGUA 4HDUA 1R5HA 4O5VA 3IKTA 2EB7A 3C3WA 1ZLKA 3F72A 1TW3A 1OKRA 4RS8A 3HOTA 1QGPA 2XRNA 3ULQB 3LA3A 2VOPA 1EH6A 4HZFA 3BOQA 3RPUA 1PDNC 3HHHA 5L3CA 3PQJA 3T8RA 4I09A 2STWA 2IRFG 1W5SA 5CYVA 5FD6A 2ISZA 4XRFA 1XB4A 4HW0A 1ZG1A 2A6EF 4L9JA 5LEKA 1ZRDA 1OMIA 4UNOA 1ZH5A 4M9SA 4M74A 4HF2A 2HYFA 3SHFA 2EV0A 5HDKA 3HUGA 3W6KB 1ZGAA 3QU3A 2ETHA 2OQRA 4MNUA 3G73A 4AIJA 4IF4A 4CHUA 4RGUA 3F8NA 1G3YA 3KLOA 1BIBA 3H92A 2PMUA 1XDSA 3EDPA 2VBYA 2K4JA 2AS5F 1RIOH 3ZP5A 5ILUA 5JVTA 3WTSC 4LB6B 1BBYA 4Y13A 4G94A 3VEPA 4LD5A 2VODA 1TQIA 1GXQA 5ILVA 2O6GE 1ZGJA 4XSXF 1U8RA 2H27A 1G3WA 3HSRA 4S04A 5HOOA 1D8KA 2FNPA 2K02A 3RKYA 1QZYA 4ENKA 3SFZA 4M6YA 3HIFA 1WSUA 3P9KA 1I5ZA 1SD4A 2QQBA 4U0YA 1KU2A 2XKPA 1AOYA 3I53A 4WWCA 1XGSA 2L3DA 1IRFA 4IJAA 2PBIA 2FBHA 3MCZA 1S6LA 3CDHA 5F6FA 4AWXB 4A0YA 2R7FA 2HOEA 1K6OA 1JHHA 1ON2A 1IXRC 3WGGA 1HSTA 1VTNC 2ACJA 2XAJA 1FZPB 2EWNA 4CGZA 1O3RA 4AIKA 1IN4A 2GIVA 3GVAA 3I71A 3LA7A 4R1HA 4LLNA 1TW2A 4G7ZF 4GXOA 4PGHA 5JI6A 2L02A 3LQRA 5ICGA 1K79A 2D2WA 1LEBA 4IRIA 3WTXC 3VFZA 2BV6A 3TQNA 5TRDA 3TDZC 4L9NA 4Y17A 3FXQA 3ROUA 5FFXA 5CVVA 1FNNA 2DO7A 1SAXA 3WE3A 4LG0A 3RTRA 1R1VA 3C18A 3I64A 3QPHA 1K78B 1BJAA 1IXSB 3ZMZA 1ZREA 3QAHA 2FF4A 3MZYA 4M6XA 2Y0MA 2FU4A 3F21A 1U3EM 3PQKA 2IPQX 3QP5A 4ESJA 1FBQA 4RGXA 3IHUA 1WKMA 3HRMA 2KJBA 4OOIA 4MQVA 4HX4A 5L3DA 2YX7A 1IW7F 3GWZA 3NEUA 5BOXA 2HYGD 3U9GA 2CO5A 1FC3A 3CUOA 3TO6A 1G3SA 1T6SA 4WXDA 2RKHA 3RI4A 1EV7A 4A0XA 3WTVC 2MLKA 3JTHA 3GFMA 3F8BA 5ICEA 4KICA 5E17F 1STZA 3SXYA 4KN4X 3KP5A 3HRSA 4NQWA 4AVPA 3HSFA 1HW1A 4GGGA 3IKVA 2IA2A 4ASNA 2OBPA 1IN7A 5L3FA 1PUEE 3TO7A 2M87A 4OIPF 2CWEA 3IC7A 4KYWA 3EYYA 2YPRA 1I1SA 4EGYA 3R60A 2YSRA 1P4AA 2HFHA 3FM5A 3BZ6A 5DEQA 1LNWA 4ZZDA 1F1ZA 2HDCA 4M72A 1QO0D 3KP4A 2A3SA 3M9AA 4ENMA 2M30A 2Y75A 3G3ZA 5DD8A 2H6CA 2STTA 4OMZA 2WC2A 1R23A 4P9FA 4HBLA 1J5YA 2M5WA 4EJOA 2K86A 4IRGA 2CYYA 1WI9A 4MTDA 1E2XA 1SD5A 4RAYA 5D4RA 2XAHA 3GEZA 1R5GA 2F5CA 3KP7A 2LNBA 2MBFA 5E20A 1YS6A 1BI0A 1H9GA 2XUBA 2DI3A 4CXFA 1RZ4A 4KNYA 2DU9A 2OAZA 1QPMA 1B4AA 3JTGA 4I02A 3V8LA 2DW4A 1REPC 5LBQA 1T38A 1FLIA 2EA2A 1R58A 3CO7C 3IWFA 1TTYA 2IT0A 2O03A 1HXDA 2IP2A 1BI1A 4HF0A 3RDIA 2Q0OA 1ZARA 1OYIA 1HKTA 4UHTA 3L2CA 2VBXA 2PJPA 1WQ2A 1CF7B 2HTSA 5IT9Z 3I4PA 5E18F 2RGVA 1LB2A 2FEZA 2HQRA 5IT3A 4Z2YA 2M8EA 3KZYA 5D6FA 4ZYEA 2ZCWA 2OA4A 4AD9A 2UXNA 2YX4A 4P9UA 1KU9A 3KP6A 1GHCA 5HLIA 4EJVA 3DPLC 2F5FA 3M1EA 4R79A 2V1DA 1X3UA 4U0WA 3HRTA 3F22A 4ESFA 2GA2A 5LRSA 3K1NA 4BHPA 4IRHA 2D45A 2FSWA 3IWZA 2AXLA 4IPAA 1ULYA 3FF5A 5A2QK 4G6QA 2PI0A 4K2EA 4M9ZA 4MEXF 4F7ZA 5ED4A 1MDMA 5AONA 4D0PA 2FBKA 4UXNA 5DV5A 2A61A 2JT1A 2NAZA 5E8GA 2FA5A 3ZMVA 3QPTA 1Y0UA 3T5XA 2KIFA 4WF2A 4RGRA 3KCCA 4PGGA 1SFEA 3F6VA 4KIFA 2VE9A 2XKOA 3HTSB 3WGIA 5BQTA 5CVRA 1EH8A 2QENA 3F23A 2ZJ2A 4ZYHA 5D4SA 1HSJA 1HBXG 2WTEA 2LDUA 5J8FA 2RQPA 1LDDA 4G7OF 1R1TA 2P4WA 4L18B 1SMTA 5LRRA 2H09A 3VODA 2IA0A 4UUVA 3DEUA 1MGTA 3K9TA 4MHGA 4DNCA 1XMKA 4ETSA 2QQ9A 4O6JA 5HS7A 5CLSA 4FT8A 1IAWA 1Z91A 4A5MA 3HSEA 3I5UA 3GX4X 1B1BA 2LSOA 3I0TA 3DKWA 4S05A 3L9FA 1Z7UA 4QWQA 3V7CA 1LEAA 4PCQA 2W24A 2BBYA 1DPUA 4BHBA 3KP3A 3KLNA 2V9VA 1SD6A 3D5LA 2ZMEB 2WV0A 2PN6A 5HS8A 2L54A 2TDXA 4IVNA 1R22A 1XDUA 4P55A 3TOBA 3O6BB 2FRHA 3MFKA 3N97A 6PAXA 2Q2EA 4KFCA 1FPQA 5L3EA 1R36A 1J0RA 1Z6TA 1J59A 4LFUA 1A04A 4YFNF 5D6EA 5CVIA 2QBYB 2Z99A 5FGMA 3GFIA 1L3LA 2J5PA 2VT3A 3I59A 2OZUA 2VT2A 4KMUX 4L0YB 3REOA 3E6MA 2QUFA 3BDDA 1ONVA 3GFJA 2A5YB 3S2WA 2NS0A 2PMHA 4BQAA 2W57A 1D5VA 3QU6A 4I98B 4XLNF 1FSHA 1ZG3A 3U1DA 2GA1A 4CZZA 3TKYA 4BAYA 3Q9VA 2E7XA 4N9HA 1FBSA 5AIQA 2QVOA 2HGCA 2KIUA 1D8JA 2XROA 1USTA 2EK5A 2DPUA 3WTTC 2HZTA 4UVBA 2IVMA 3TO9A 2G9WA 3KEOA 4BYYA 1B6AA 1O57A 1Z05A 2HQNA 3KP2A 5DUKA 4CO8A 4WX9A 2OQGA 5BPDA 1IUYA 1S29A 4L5JA 2NNNA 4I01A 1BC7C 4G7HF 1ZRFA 2RNJA 4I7HA 4Q5SF 3V7RA 2D1VA 5K5QA 3H3ZA 2VBZA 2HEOA 2DFIA 4OIRF 4IHSA 3BJOA 2VXZA 4GYIA 3F8CA 1XSDA 4UV9A 4M73A 1MDMB 1YYVA 3H3UA 2K7LA 2JTVA 1IF1A 3BY6A 4KT5C 2ZKZA 3M8EA 2Z5UA 2ZMEA 4A6EA 1U5TA 3CUQB 5FLXZ 4FX4A 4HLXA 1XCBA 1U2WA 4U7BA 1YG2A 1UB9A 3ZN0A 1BI3A 3FMRA 2P5LC 1U5TB 3EETA 2IJLA 5CVUA 3V8JA 2RC4A 1P4XA 4LK0F 3E6DA 1U5TC 5DCFA 2FQ3A 4EJWA 3SZTA 3HYIA 3KETA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GFL A;  1B9M A;  2XIG A;  4RGS A;  1XGN A;  2O8X A;  1HKQ A;  3CUQ A;  2ZXJ A;  2JSC A;  4ESB A;  5F64 A;  3RIR A;  2XVC A;  3CJN A;  1Z1D A;  4P5O A;  1BM9 A;  3ZMU A;  3LFK A;  3Q5F A;  1O7L A;  4ZYD A;  3LST A;  2HS5 A;  5K1Y A;  3R61 A;  2EV6 A;  1ON1 A;  1IZ1 A;  5D8K B;  5D8L B;  1DUX C;  4I0B A;  3SQN A;  2HTJ A;  2QM3 A;  4WXH A;  2P8T A;  1Z6R A;  1ODD A;  2C6Y A;  2EJR A;  1S7A A;  1D3Y A;  2V79 A;  1LDK B;  3K1P A;  5TJJ A;  2WWY A;  5BMZ A;  3V8K A;  1R1U A;  3D0S A;  2H94 A;  3RPQ A;  1XD7 A;  3DPT A;  3MEX A;  1IRG A;  5BS6 A;  3GF2 A;  1UHM A;  5DUI A;  3F3X A;  3E5Q A;  4XBF A;  1EH7 A;  1KYW A;  2OZ6 A;  4RAZ A;  5L3B A;  1YIO A;  5DDG A;  3HOS A;  2DT5 A;  3T8T A;  3NRV A;  2LKP A;  3JSP A;  5DCM B;  3R4K A;  4YII A;  4HDV A;  5HS9 A;  2FE3 A;  3GLX A;  1W7P D;  2ISY A;  4UVA A;  1FYK A;  5DYM A;  2DK8 A;  3LQQ A;  2PLY A;  3EYI A;  1J75 A;  3E6C C;  3I59 B;  1QZZ A;  1KQ9 A;  1TLH B;  2QWW A;  2KKO A;  4OIQ F;  4EVI A;  4KUM A;  4DQ2 A;  4ENJ A;  3F8F A;  1LJ9 A;  2XAQ A;  1W5T A;  3WE2 A;  2B0L A;  5ICF A;  2W85 A;  4XSZ F;  1UFM A;  4RB1 A;  1S8N A;  1PP8 F;  3J81 Z;  4JBA A;  1JHF A;  4NHJ A;  1MJB A;  1CF7 A;  1GVJ A;  4N9I A;  2QZ8 A;  4HF1 A;  4BHC A;  2FOK A;  4OU0 A;  1ZYR F;  3T0Y A;  2ZFW A;  4RB3 C;  4EM2 A;  1RNL A;  1F9N A;  3CUQ C;  2HKX A;  3W6J B;  2PEX A;  1RUO A;  1DDN A;  4RB0 A;  4EJU A;  3KEQ A;  2O0Y A;  2K4B A;  2FXA A;  5LLQ A;  4KIG A;  4CDG A;  5A2Q Z;  3VOE A;  3E97 A;  2HKO A;  1LVA A;  3DXJ F;  1XN7 A;  3HRU A;  4TV7 A;  1S7O A;  3QP6 A;  1FOK A;  4LG0 B;  2EA4 A;  4B09 A;  2PG4 A;  5LHH A;  3IRQ A;  2KJC A;  1PP7 U;  4ENN A;  3OV8 A;  3BPX A;  1RI7 A;  3R0J A;  5CJ9 A;  2RDP A;  5J6X A;  2Z3Y A;  1JE8 A;  5FO5 A;  2UXX A;  3JW4 A;  4JQF A;  4LMY A;  1P2F A;  4U88 A;  4EGZ A;  5LHG A;  1O7F A;  1ZG5 A;  3V7S A;  1T98 A;  3BPV A;  3FHZ A;  4PDK A;  5HDG A;  2J5O A;  3M7G A;  3ZMT A;  1YTY A;  1ZAO A;  2R3S A;  1H9T A;  1T0F A;  3BWG A;  2PQ8 A;  2ZNY A;  3T1B A;  3ML6 A;  5D5X B;  2VN2 A;  2EFQ A;  3CLO A;  3BP8 A;  1NHA A;  1LDJ A;  3P7N A;  2BEO A;  5HVQ C;  4HOB A;  1HKS A;  2MH9 A;  3RYP A;  5FD5 A;  1SFU A;  2V1X A;  2PFB A;  5LGT A;  4KA4 A;  3BJ6 A;  2CGP A;  2VOO A;  1UCR A;  2VE8 A;  4CIC A;  1R7J A;  1W4M A;  4HAM A;  4KIB A;  5F1R A;  4EMS A;  3J7A O;  4LK1 F;  2RVC A;  5DD4 A;  2DK5 A;  2E1N A;  2P6S A;  3DQV C;  2DBB A;  1UHW A;  2O3F A;  4N0B A;  4FX0 A;  4YG2 F;  4I0A A;  2DQL A;  2RN7 A;  1LQ1 A;  3GO5 A;  3I54 A;  3LA2 A;  4MTE A;  4KN7 X;  2D1H A;  4G6D A;  4ZYG A;  2FML A;  1IXC A;  1FY7 A;  1KU7 A;  1O3T A;  3DV8 A;  4HA8 A;  3MZH A;  3CO6 C;  2L4A A;  1KU3 A;  1TQM A;  1Q1H A;  2Z33 A;  3B73 A;  1OR7 A;  1AWC A;  2G7H A;  1JXS A;  4GO1 A;  5LGN A;  4XLP F;  3RKW A;  4A5N A;  1H0M A;  5L3G A;  2BGC A;  2NNY A;  3PFI A;  5D5V B;  5FFZ A;  4A12 A;  5E1X A;  3WU1 B;  2ZNZ A;  2MLG A;  2P7V B;  4MQ9 F;  1KYZ A;  1ZLJ A;  1T2K A;  4EM1 A;  2Z9O A;  1IN5 A;  4HV5 A;  2A68 F;  2EFO A;  4Q48 A;  4EQQ A;  3C7J A;  4M71 A;  3E3V A;  2HWV A;  5K5O A;  1RUN A;  4G8X A;  5JR3 A;  4ON0 A;  3K1M A;  3DFG A;  2XHK A;  2ESH A;  4MEY F;  4H0E A;  3BRO A;  2VC1 A;  4YIF A;  1FSE A;  2IW5 A;  1P6R A;  3GXO A;  1YW8 A;  1V3F A;  3O2P E;  3FZV A;  3LAP A;  3HTU A;  4HYE A;  2NYX A;  3R6S A;  4MGR A;  3TOA A;  2QYO A;  2ELH A;  1BOA A;  3SZP A;  4RB2 C;  2DLL A;  1XGO A;  3EQL F;  5BPI A;  2BE5 F;  2Q8K A;  3TDU C;  4B8X A;  3J81 K;  2QQA A;  4U0V A;  2A07 F;  1IN8 A;  5ILS A;  2CSO A;  2P7C B;  3NQO A;  2FNA A;  4A6D A;  4WK8 F;  5EEH A;  1R00 A;  4JK1 X;  2FBI A;  3MAJ A;  3VB2 A;  5D5U B;  3WGH A;  4EM0 B;  1BIA A;  4LB5 A;  4HV6 A;  1XSX A;  4L5I A;  2X0L A;  2EFW A;  2MD5 A;  2V1U A;  1I1G A;  3EUH A;  5ICC A;  4NB5 A;  1QQI A;  4HQE A;  1B9N A;  3MQ0 A;  2O61 A;  1YQA A;  2UWM A;  1O3Q A;  1S3J A;  1OYW A;  2DAO A;  4AIH A;  2XAG A;  2OU2 A;  3K69 A;  1CGP A;  3KFW X;  1F4K A;  5DCM A;  3O3K A;  4HX8 A;  3F6O A;  4M9X A;  4L9V A;  5H6Q A;  4KMF A;  4GCV A;  4HX7 A;  1TQP A;  2GZW A;  3WG9 A;  4U7D A;  5KK1 A;  5E8I A;  4CYD A;  3V4G A;  2FMY A;  1FP2 A;  4L9T A;  3ELK A;  2W84 A;  1DPR A;  4GYG A;  1BC8 C;  1XMA A;  1IN6 A;  2CQK A;  3ZPL A;  3COA C;  2XGX A;  1KQ0 A;  3CTA A;  4A0Z A;  3ECO A;  4UV8 A;  1ZN2 A;  2VON A;  3HHG A;  2NRA C;  2DTR A;  2EFN A;  3WTW C;  3JAM Z;  1BN5 A;  3ISP A;  2XV4 S;  5FB2 A;  2E7W A;  2F5D A;  3KE2 A;  3E6B A;  4LJZ F;  1OYY A;  4L0Z B;  1WWX A;  4YFK F;  2M1B A;  3DP7 A;  4ZZL A;  1MKM A;  1SD7 A;  1BI2 A;  3ZQ7 A;  4IHT A;  1KQ8 A;  2JZY A;  1J7K A;  2MA3 A;  5E1Z B;  2GXG A;  2ESN A;  3GW2 A;  1YO5 C;  4BXU A;  3C1D A;  2L4M A;  2P5V A;  1FYL A;  3FXR A;  1TBX A;  4R8H A;  3FXU A;  5J8C A;  3U2R A;  3P9I A;  4WCG A;  5KVR A;  3WTY C;  5IT9 K;  1MJA A;  4LLG F;  4Q4Z F;  2M45 A;  1XGM A;  3R0A A;  1KGS A;  2GQQ A;  1GXP A;  2KRF A;  2KIM A;  2ADU A;  5HDN A;  2CFX A;  3ABT A;  1SMY F;  1FP1 D;  4KDP A;  2UZK A;  3JAM K;  1G3T A;  3JSO A;  3N4M A;  3WTU C;  2R7D A;  1KA8 A;  1F5T A;  1I6X A;  4FHT A;  1T39 A;  1YS7 A;  1W7P A;  1C0W A;  3ERE D;  3TGN A;  2OD5 A;  3L00 A;  4O3M A;  1FX7 A;  2K27 A;  3GUD A;  1MZB A;  2ZBK A;  3GZ5 A;  4UVC A;  1YLF A;  1J9I A;  5H20 A;  2V6C A;  4OIN F;  3ABU A;  5LHI A;  5JFR A;  2BYV E;  3I58 A;  2CW0 F;  4LLL A;  4QLC U;  2XAF A;  1V4R A;  3J80 K;  4IXA A;  3L7W A;  4I2O A;  1O3S A;  5HLG A;  3RYR A;  5EEG A;  1WRJ A;  3ZMS A;  4EJT A;  1ZHF A;  4EV0 A;  2IA1 A;  1HQC A;  5FLX K;  4HQM A;  2VC0 A;  3P9C A;  2GAU A;  2COM A;  4A2U A;  2DPD A;  1ZRC A;  1JGS A;  1FYM A;  2W25 A;  1QBJ A;  1YW7 A;  2E1C A;  3B02 A;  1HW2 A;  5ERI A;  2LF8 A;  3ZN1 A;  4LGW A;  4Q47 A;  2MH2 A;  3FX3 A;  4P96 A;  2VBW A;  3BJA A;  2L01 A;  2EFP A;  4Y15 A;  5H6R A;  3LAJ A;  5LEJ A;  1SFX A;  3E5U A;  4BH9 A;  3KZZ A;  4G9Y A;  2F5E A;  1OPC A;  2Y48 A;  5AIP A;  2P6T A;  2RV8 A;  1U78 A;  5K5R A;  4OIO F;  2EV5 A;  4WXC A;  1YW9 A;  1HW5 A;  2MC3 A;  1DP7 P;  3F8M A;  2JRT A;  2CG4 A;  3QOP A;  2DQR A;  3E5X A;  3FMQ A;  4BNC A;  5JHU A;  1FWZ A;  3WOD F;  1B59 A;  2H6B A;  3FM3 A;  3L09 A;  2P5K A;  2XAS A;  3ECH A;  1G6N A;  2JPC A;  1I27 A;  3DF8 A;  3FMS A;  3GYH X;  1TNS A;  2A6H F;  3RKX A;  1P4W A;  1FBU A;  1Z9C A;  2GXB A;  3QRF F;  3OOP A;  1E17 A;  4E70 A;  2YR2 A;  3J80 Z;  3ZMD A;  2JPB A;  4ZH4 F;  3IRR A;  2LF7 A;  1FT9 A;  2HR3 A;  1USS A;  5CVJ A;  1K7A A;  5E1W A;  1XSV A;  2QLZ A;  3Q9S A;  1MD0 A;  2X4H A;  1K78 A;  3K2Z A;  2G7U A;  4HLY A;  2A69 F;  5HLH A;  1G4D A;  1XCV A;  3K0L A;  1J2X A;  1L0O C;  3WU0 A;  4OMY A;  2F2E A;  1QNT A;  1TNT A;  3FWE A;  3AAF A;  1U6G A;  3LWF A;  3GZ6 A;  3M8F A;  3MWM A;  3WTZ A;  4YFX F;  5D5W B;  2QBY A;  2GWR A;  1MJ9 A;  2ZO4 A;  4PZJ A;  1P92 A;  2YU3 A;  3RJP A;  1W7P B;  1YFH A;  3IL2 A;  5LGU A;  4HDU A;  1R5H A;  4O5V A;  3IKT A;  2EB7 A;  3C3W A;  1ZLK A;  3F72 A;  1TW3 A;  1OKR A;  4RS8 A;  3HOT A;  1QGP A;  2XRN A;  3ULQ B;  3LA3 A;  2VOP A;  1EH6 A;  4HZF A;  3BOQ A;  3RPU A;  1PDN C;  3HHH A;  5L3C A;  3PQJ A;  3T8R A;  4I09 A;  2STW A;  2IRF G;  1W5S A;  5CYV A;  5FD6 A;  2ISZ A;  4XRF A;  1XB4 A;  4HW0 A;  1ZG1 A;  2A6E F;  4L9J A;  5LEK A;  1ZRD A;  1OMI A;  4UNO A;  1ZH5 A;  4M9S A;  4M74 A;  4HF2 A;  2HYF A;  3SHF A;  2EV0 A;  5HDK A;  3HUG A;  3W6K B;  1ZGA A;  3QU3 A;  2ETH A;  2OQR A;  4MNU A;  3G73 A;  4AIJ A;  4IF4 A;  4CHU A;  4RGU A;  3F8N A;  1G3Y A;  3KLO A;  1BIB A;  3H92 A;  2PMU A;  1XDS A;  3EDP A;  2VBY A;  2K4J A;  2AS5 F;  1RIO H;  3ZP5 A;  5ILU A;  5JVT A;  3WTS C;  4LB6 B;  1BBY A;  4Y13 A;  4G94 A;  3VEP A;  4LD5 A;  2VOD A;  1TQI A;  1GXQ A;  5ILV A;  2O6G E;  1ZGJ A;  4XSX F;  1U8R A;  2H27 A;  1G3W A;  3HSR A;  4S04 A;  5HOO A;  1D8K A;  2FNP A;  2K02 A;  3RKY A;  1QZY A;  4ENK A;  3SFZ A;  4M6Y A;  3HIF A;  1WSU A;  3P9K A;  1I5Z A;  1SD4 A;  2QQB A;  4U0Y A;  1KU2 A;  2XKP A;  1AOY A;  3I53 A;  4WWC A;  1XGS A;  2L3D A;  1IRF A;  4IJA A;  2PBI A;  2FBH A;  3MCZ A;  1S6L A;  3CDH A;  5F6F A;  4AWX B;  4A0Y A;  2R7F A;  2HOE A;  1K6O A;  1JHH A;  1ON2 A;  1IXR C;  3WGG A;  1HST A;  1VTN C;  2ACJ A;  2XAJ A;  1FZP B;  2EWN A;  4CGZ A;  1O3R A;  4AIK A;  1IN4 A;  2GIV A;  3GVA A;  3I71 A;  3LA7 A;  4R1H A;  4LLN A;  1TW2 A;  4G7Z F;  4GXO A;  4PGH A;  5JI6 A;  2L02 A;  3LQR A;  5ICG A;  1K79 A;  2D2W A;  1LEB A;  4IRI A;  3WTX C;  3VFZ A;  2BV6 A;  3TQN A;  5TRD A;  3TDZ C;  4L9N A;  4Y17 A;  3FXQ A;  3ROU A;  5FFX A;  5CVV A;  1FNN A;  2DO7 A;  1SAX A;  3WE3 A;  4LG0 A;  3RTR A;  1R1V A;  3C18 A;  3I64 A;  3QPH A;  1K78 B;  1BJA A;  1IXS B;  3ZMZ A;  1ZRE A;  3QAH A;  2FF4 A;  3MZY A;  4M6X A;  2Y0M A;  2FU4 A;  3F21 A;  1U3E M;  3PQK A;  2IPQ X;  3QP5 A;  4ESJ A;  1FBQ A;  4RGX A;  3IHU A;  1WKM A;  3HRM A;  2KJB A;  4OOI A;  4MQV A;  4HX4 A;  5L3D A;  2YX7 A;  1IW7 F;  3GWZ A;  3NEU A;  5BOX A;  2HYG D;  3U9G A;  2CO5 A;  1FC3 A;  3CUO A;  3TO6 A;  1G3S A;  1T6S A;  4WXD A;  2RKH A;  3RI4 A;  1EV7 A;  4A0X A;  3WTV C;  2MLK A;  3JTH A;  3GFM A;  3F8B A;  5ICE A;  4KIC A;  5E17 F;  1STZ A;  3SXY A;  4KN4 X;  3KP5 A;  3HRS A;  4NQW A;  4AVP A;  3HSF A;  1HW1 A;  4GGG A;  3IKV A;  2IA2 A;  4ASN A;  2OBP A;  1IN7 A;  5L3F A;  1PUE E;  3TO7 A;  2M87 A;  4OIP F;  2CWE A;  3IC7 A;  4KYW A;  3EYY A;  2YPR A;  1I1S A;  4EGY A;  3R60 A;  2YSR A;  1P4A A;  2HFH A;  3FM5 A;  3BZ6 A;  5DEQ A;  1LNW A;  4ZZD A;  1F1Z A;  2HDC A;  4M72 A;  1QO0 D;  3KP4 A;  2A3S A;  3M9A A;  4ENM A;  2M30 A;  2Y75 A;  3G3Z A;  5DD8 A;  2H6C A;  2STT A;  4OMZ A;  2WC2 A;  1R23 A;  4P9F A;  4HBL A;  1J5Y A;  2M5W A;  4EJO A;  2K86 A;  4IRG A;  2CYY A;  1WI9 A;  4MTD A;  1E2X A;  1SD5 A;  4RAY A;  5D4R A;  2XAH A;  3GEZ A;  1R5G A;  2F5C A;  3KP7 A;  2LNB A;  2MBF A;  5E20 A;  1YS6 A;  1BI0 A;  1H9G A;  2XUB A;  2DI3 A;  4CXF A;  1RZ4 A;  4KNY A;  2DU9 A;  2OAZ A;  1QPM A;  1B4A A;  3JTG A;  4I02 A;  3V8L A;  2DW4 A;  1REP C;  5LBQ A;  1T38 A;  1FLI A;  2EA2 A;  1R58 A;  3CO7 C;  3IWF A;  1TTY A;  2IT0 A;  2O03 A;  1HXD A;  2IP2 A;  1BI1 A;  4HF0 A;  3RDI A;  2Q0O A;  1ZAR A;  1OYI A;  1HKT A;  4UHT A;  3L2C A;  2VBX A;  2PJP A;  1WQ2 A;  1CF7 B;  2HTS A;  5IT9 Z;  3I4P A;  5E18 F;  2RGV A;  1LB2 A;  2FEZ A;  2HQR A;  5IT3 A;  4Z2Y A;  2M8E A;  3KZY A;  5D6F A;  4ZYE A;  2ZCW A;  2OA4 A;  4AD9 A;  2UXN A;  2YX4 A;  4P9U A;  1KU9 A;  3KP6 A;  1GHC A;  5HLI A;  4EJV A;  3DPL C;  2F5F A;  3M1E A;  4R79 A;  2V1D A;  1X3U A;  4U0W A;  3HRT A;  3F22 A;  4ESF A;  2GA2 A;  5LRS A;  3K1N A;  4BHP A;  4IRH A;  2D45 A;  2FSW A;  3IWZ A;  2AXL A;  4IPA A;  1ULY A;  3FF5 A;  5A2Q K;  4G6Q A;  2PI0 A;  4K2E A;  4M9Z A;  4MEX F;  4F7Z A;  5ED4 A;  1MDM A;  5AON A;  4D0P A;  2FBK A;  4UXN A;  5DV5 A;  2A61 A;  2JT1 A;  2NAZ A;  5E8G A;  2FA5 A;  3ZMV A;  3QPT A;  1Y0U A;  3T5X A;  2KIF A;  4WF2 A;  4RGR A;  3KCC A;  4PGG A;  1SFE A;  3F6V A;  4KIF A;  2VE9 A;  2XKO A;  3HTS B;  3WGI A;  5BQT A;  5CVR A;  1EH8 A;  2QEN A;  3F23 A;  2ZJ2 A;  4ZYH A;  5D4S A;  1HSJ A;  1HBX G;  2WTE A;  2LDU A;  5J8F A;  2RQP A;  1LDD A;  4G7O F;  1R1T A;  2P4W A;  4L18 B;  1SMT A;  5LRR A;  2H09 A;  3VOD A;  2IA0 A;  4UUV A;  3DEU A;  1MGT A;  3K9T A;  4MHG A;  4DNC A;  1XMK A;  4ETS A;  2QQ9 A;  4O6J A;  5HS7 A;  5CLS A;  4FT8 A;  1IAW A;  1Z91 A;  4A5M A;  3HSE A;  3I5U A;  3GX4 X;  1B1B A;  2LSO A;  3I0T A;  3DKW A;  4S05 A;  3L9F A;  1Z7U A;  4QWQ A;  3V7C A;  1LEA A;  4PCQ A;  2W24 A;  2BBY A;  1DPU A;  4BHB A;  3KP3 A;  3KLN A;  2V9V A;  1SD6 A;  3D5L A;  2ZME B;  2WV0 A;  2PN6 A;  5HS8 A;  2L54 A;  2TDX A;  4IVN A;  1R22 A;  1XDU A;  4P55 A;  3TOB A;  3O6B B;  2FRH A;  3MFK A;  3N97 A;  6PAX A;  2Q2E A;  4KFC A;  1FPQ A;  5L3E A;  1R36 A;  1J0R A;  1Z6T A;  1J59 A;  4LFU A;  1A04 A;  4YFN F;  5D6E A;  5CVI A;  2QBY B;  2Z99 A;  5FGM A;  3GFI A;  1L3L A;  2J5P A;  2VT3 A;  3I59 A;  2OZU A;  2VT2 A;  4KMU X;  4L0Y B;  3REO A;  3E6M A;  2QUF A;  3BDD A;  1ONV A;  3GFJ A;  2A5Y B;  3S2W A;  2NS0 A;  2PMH A;  4BQA A;  2W57 A;  1D5V A;  3QU6 A;  4I98 B;  4XLN F;  1FSH A;  1ZG3 A;  3U1D A;  2GA1 A;  4CZZ A;  3TKY A;  4BAY A;  3Q9V A;  2E7X A;  4N9H A;  1FBS A;  5AIQ A;  2QVO A;  2HGC A;  2KIU A;  1D8J A;  2XRO A;  1UST A;  2EK5 A;  2DPU A;  3WTT C;  2HZT A;  4UVB A;  2IVM A;  3TO9 A;  2G9W A;  3KEO A;  4BYY A;  1B6A A;  1O57 A;  1Z05 A;  2HQN A;  3KP2 A;  5DUK A;  4CO8 A;  4WX9 A;  2OQG A;  5BPD A;  1IUY A;  1S29 A;  4L5J A;  2NNN A;  4I01 A;  1BC7 C;  4G7H F;  1ZRF A;  2RNJ A;  4I7H A;  4Q5S F;  3V7R A;  2D1V A;  5K5Q A;  3H3Z A;  2VBZ A;  2HEO A;  2DFI A;  4OIR F;  4IHS A;  3BJO A;  2VXZ A;  4GYI A;  3F8C A;  1XSD A;  4UV9 A;  4M73 A;  1MDM B;  1YYV A;  3H3U A;  2K7L A;  2JTV A;  1IF1 A;  3BY6 A;  4KT5 C;  2ZKZ A;  3M8E A;  2Z5U A;  2ZME A;  4A6E A;  1U5T A;  3CUQ B;  5FLX Z;  4FX4 A;  4HLX A;  1XCB A;  1U2W A;  4U7B A;  1YG2 A;  1UB9 A;  3ZN0 A;  1BI3 A;  3FMR A;  2P5L C;  1U5T B;  3EET A;  2IJL A;  5CVU A;  3V8J A;  2RC4 A;  1P4X A;  4LK0 F;  3E6D A;  1U5T C;  5DCF A;  2FQ3 A;  4EJW A;  3SZT A;  3HYI A;  3KET A; 
#chains in the Genus database with same CATH topology
 4CUG A;  1TWF J;  3GFL A;  5E3N A;  1B9M A;  2XIG A;  4RGS A;  1XGN A;  4UUS B;  4BJT A;  2O8X A;  1X1B A;  1HKQ A;  3J7A Y;  3K4N A;  3CUQ A;  2ZXJ A;  2JSC A;  4ESB A;  2E2I J;  5F64 A;  3RIR A;  2XVC A;  3CJN A;  2V9P A;  3GTP J;  1RR8 C;  1Z1D A;  3FKI J;  4P5O A;  1BM9 A;  3ZMU A;  2K3F A;  2DT6 A;  3LFK A;  3P5J A;  3Q5F A;  1O7L A;  2TRT A;  2XF6 A;  3TBI A;  1FOX A;  2R7S A;  3KEY A;  3VWB A;  4ZYD A;  3LST A;  2HS5 A;  5K1Y A;  3R61 A;  2EV6 A;  1ON1 A;  1MBE A;  5KAF C;  1IZ1 A;  5D8K B;  3H0G J;  5D8L B;  4CA0 A;  1DUX C;  3B6A A;  3A2K A;  4I0B A;  3OWT A;  1IUF A;  3SQN A;  2ELK A;  3G71 I;  3GTO J;  2HTJ A;  1HDD C;  3B6C A;  4E7L A;  1Z0X A;  3V42 A;  2BW3 B;  2K9M A;  2E35 A;  2EBI A;  2QM3 A;  1WJ5 A;  2HYJ A;  1Y1V J;  3DLA A;  3HJE A;  2P8T A;  4WXH A;  1Z6R A;  1ODD A;  2XGC A;  2EJR A;  2BZT A;  2C6Y A;  3D5R C;  1S7A A;  1T0F C;  3ZQI A;  5GAG J;  3HC7 A;  3BTC A;  3ABL H;  1D3Y A;  2AQE A;  1H88 C;  2EIN H;  2VLA A;  2V79 A;  1ZR4 A;  1LDK B;  2M34 A;  3PO2 J;  3K1P A;  5TJJ A;  1WJA A;  2WWY A;  3EUK L;  5BMZ A;  3V8K A;  1R1U A;  1E3H A;  3D0S A;  4B44 A;  2H94 A;  3RPQ A;  1XD7 A;  3DPT A;  3MEX A;  1IRG A;  3HZJ A;  5F0H A;  5BS6 A;  3MZ8 A;  3GF2 A;  4GFB A;  1UHM A;  5DUI A;  2CS3 A;  3F3X A;  3E5Q A;  4XKW A;  1YX5 A;  2VJI A;  3GCM A;  5M5W J;  4XBF A;  4DOZ A;  4FCY A;  4F3Q A;  1EH7 A;  5J40 A;  1KYW A;  2OZ6 A;  4RAZ A;  4B47 A;  2O8K A;  3W2A A;  5L3B A;  1YIO A;  2XGE A;  1HA8 A;  3M4O J;  5DDG A;  3G1L A;  3HOS A;  2UV1 A;  2DT5 A;  3T8T A;  3AG2 H;  3NRV A;  3PUB A;  2LKP A;  1VQ7 I;  2KZG A;  5K7F A;  3JSP A;  1POG A;  5DCM B;  1BR4 A;  3R4K A;  4PJJ A;  3NWS A;  4YII A;  4HDV A;  4IO9 F;  5HS9 A;  2V6E A;  2FE3 A;  3GLX A;  1W7P D;  2ISY A;  4MO7 A;  3HB9 A;  4UVA A;  3G6E I;  1FYK A;  2HVS A;  2EZI A;  5DYM A;  3I3L A;  2DK8 A;  4ZDP A;  3LQQ A;  2LOO A;  2PLY A;  2X1C A;  3EYI A;  1J75 A;  3MD2 A;  4E7Z A;  3E6C C;  3I59 B;  1QZZ A;  2CRG A;  1KQ9 A;  1TLH B;  2QWW A;  2KKO A;  4OIQ F;  3L2U A;  2E36 A;  4EVI A;  4KUM A;  1FOW A;  4DQ2 A;  4ENJ A;  3S2D J;  3F8F A;  1HDP A;  2HDW A;  4XID A;  1LJ9 A;  2XAQ A;  3CF5 F;  2M3A A;  1W5T A;  3WE2 A;  4J01 A;  2B0L A;  5ICF A;  2W85 A;  4XSZ F;  1UFM A;  4RB1 A;  1S8N A;  1PP8 F;  2E5N A;  5C44 J;  1JUP A;  2WY8 Q;  2KIS A;  2DCE A;  3MKW B;  2NOJ B;  3J81 Z;  3LSR A;  4JBA A;  1JHF A;  2HQA A;  4QTR A;  4NHJ A;  1MJB A;  4I76 A;  1CF7 A;  1DQU A;  1GVJ A;  2WBM A;  3CCY A;  2VJ4 A;  4N9I A;  2QZ8 A;  4A3L J;  3IAS 2;  1W36 D;  4HF1 A;  4BHC A;  2FOK A;  4OU0 A;  1ZYR F;  3T0Y A;  2ZFW A;  4RB3 C;  4EM2 A;  1MSE C;  1RNL A;  1F9N A;  3CUQ C;  4CCJ A;  2HKX A;  5F0C A;  1R49 A;  3H5R A;  1JKQ C;  3W6J B;  1WVR A;  2PEX A;  2XB5 A;  3FKJ A;  1RUO A;  1DDN A;  4RB0 A;  4EJU A;  2NVU B;  3KEQ A;  2DN0 A;  2O0Y A;  4ZTJ A;  2K4B A;  3JCU C;  2FXA A;  5LLQ A;  1QVT A;  2P0W A;  4KIG A;  4CDG A;  5A2Q Z;  1NH3 A;  3VOE A;  3N05 A;  3E97 A;  2QF7 A;  2EQR A;  2QKL B;  4A3F J;  4B4C A;  2HKO A;  3MN2 A;  2JJ7 A;  5FKK A;  1LVA A;  2F5V A;  3SEZ A;  3DXJ F;  1XN7 A;  5M3M J;  3HRU A;  4IX7 A;  4TV7 A;  1S7O A;  2MYS A;  3QP6 A;  1I6H J;  1FOK A;  4LG0 B;  2EA4 A;  2YUS A;  4B09 A;  2H8R A;  2PG4 A;  5LHH A;  3IRQ A;  2KJC A;  1PP7 U;  2K9N A;  1WH5 A;  2M4K A;  4ENN A;  3DBH B;  2X6Y A;  3OV8 A;  4IHW A;  1A6Q A;  3BPX A;  3ZQG A;  1OIS A;  3OYD A;  1EJ9 A;  1RI7 A;  1NG7 A;  3R0J A;  1XC5 A;  3CC2 I;  5CJ9 A;  2RDP A;  1Y56 A;  3DEE A;  5HNF A;  5EGO B;  1JJ8 C;  1VQK I;  3CP2 A;  5J6X A;  4B3X A;  2DOE A;  1MH3 A;  2Z3Y A;  2ME6 A;  2DA5 A;  1JE8 A;  2L5Q A;  5FO5 A;  1MSF C;  4D5C A;  1D1B A;  2UXX A;  3JW4 A;  4XR6 A;  1RES A;  4JQF A;  1ZEL A;  4LMY A;  3KYD B;  2CQQ A;  1P2F A;  4U88 A;  2W4S A;  5IOY A;  4EGZ A;  5LHG A;  2DTZ A;  2QEX I;  1TL8 A;  1O7F A;  1ZG5 A;  1VI0 A;  3V7S A;  2JN6 A;  1T98 A;  3BPV A;  3FHZ A;  1GVD A;  4PDK A;  2FOW A;  3OL3 A;  5HDG A;  4FE4 A;  2V7F A;  1U9O A;  2J5O A;  3M7G A;  3ZMT A;  1YTY A;  5C4X J;  1ZAO A;  2R3S A;  3D5S C;  5J3L A;  4E7H A;  4EAT A;  1Y39 A;  1H9T A;  1T0F A;  3BWG A;  2PQ8 A;  2ZNY A;  5EJC A;  2VKH A;  2KIQ A;  3S3N A;  3T1B A;  2ZFU A;  3IP4 B;  3ML6 A;  1QVU A;  4XLA A;  4FAS D;  5D5X B;  2VN2 A;  4F93 B;  2EFQ A;  3CLO A;  3BP8 A;  5FKL A;  3VSL A;  4BXF A;  1NHA A;  4D1Q A;  1LDJ A;  1V55 H;  3P7N A;  2F4M B;  3QYF A;  2IGN A;  1RRJ A;  2BEO A;  1OCP A;  5HVQ C;  4HOB A;  1UEL B;  1HKS A;  2MH9 A;  3RYP A;  2MD0 A;  4M3G A;  5FD5 A;  3S15 J;  5IPA A;  1SFU A;  2Q1Z B;  4LIU A;  2V1X A;  2PFB A;  5LGT A;  2HOS A;  3OYF A;  4KA4 A;  2Y30 A;  3BJ6 A;  1MNE A;  3H0D A;  2CGP A;  2VOO A;  4BDY A;  1U8B A;  1UCR A;  2VE8 A;  4CCN A;  4BBR J;  4CIC A;  1R7J A;  1W4M A;  4M3F A;  1WJF A;  1LE8 A;  2K85 A;  4HAM A;  4KIB A;  5F1R A;  5M5X J;  4EMS A;  1HLV A;  3J7A O;  3L1P A;  4LK1 F;  5FKO A;  2RVC A;  3DTK A;  1MNM C;  5DD4 A;  3PIO F;  2DK5 A;  2E1N A;  2P6S A;  2EZL A;  3DQV C;  2DBB A;  3PNV A;  1UHW A;  2O3F A;  3BCA A;  4N0B A;  4DBR A;  4FX0 A;  1AHD P;  4GDF A;  4YG2 F;  4I0A A;  2DQL A;  4B3A A;  3G4S I;  4DYR A;  2BY0 A;  2KDO A;  5FRN A;  2RN7 A;  1LQ1 A;  4BGD A;  4XN3 A;  4XLE A;  4HG2 A;  3OY9 A;  3GO5 A;  3I54 A;  2DA2 A;  2DOA A;  3LA2 A;  1VQ5 I;  4KN7 X;  4MTE A;  1GV2 A;  3DU5 A;  2D1H A;  3BZK A;  1T56 A;  4G6D A;  4ZYG A;  1IXC A;  1FY7 A;  2FML A;  3DEW A;  3LSK A;  1KU7 A;  1QZE A;  1O3T A;  3DV8 A;  4E7S A;  1ACI A;  4HA8 A;  3MZH A;  3CO6 C;  2L4A A;  2V26 A;  4DIQ A;  2ZJQ F;  1KU3 A;  1TQM A;  4BQO A;  4A3D J;  1NG6 A;  3H5A A;  3SDG A;  1Q1H A;  1VFC A;  2WAD A;  2Z33 A;  3B73 A;  2JA8 J;  4Z6Y A;  3GTL J;  1OR7 A;  5H2F C;  1AWC A;  2G7H A;  2IGO A;  5FRO A;  2Z16 A;  3K7A J;  1JXS A;  4GO1 A;  5LGN A;  2ZXI A;  3PSI A;  1RR7 A;  4XK4 A;  4AUX A;  1PYV A;  4XLP F;  3RKW A;  1DGW Y;  4A5N A;  1H0M A;  1G8X A;  2WAQ N;  4DYC A;  2W82 A;  2ZXW H;  3FXL A;  3BZC A;  1YX3 A;  2FD5 A;  4D7M A;  2M4G A;  5L3G A;  2BGC A;  2NNY A;  3OMY A;  3MKY B;  4CCM A;  1APL C;  3PFI A;  4BEH A;  1OCO H;  5D5V B;  2JA5 J;  2OTL I;  5IY5 H;  3AG4 H;  5FFZ A;  4A12 A;  1IG7 A;  3BG7 A;  1JJ6 C;  4PJ0 C;  5E1X A;  3WU1 B;  1VQO I;  4PJL A;  3CF2 A;  2ZNZ A;  3OOU A;  2MLG A;  2P7V B;  4P1W A;  4MQ9 F;  3SYT A;  3SEQ A;  1KYZ A;  2LKX A;  1D0Z A;  3OIQ A;  1ZLJ A;  1T2K A;  2XSD C;  4EM1 A;  2Z9O A;  1IN5 A;  2O7O A;  4E6K G;  3PJR A;  2ZC2 A;  3OIP A;  4HV5 A;  1ETV A;  2A68 F;  2XRL A;  2EFO A;  3TW6 A;  1DGR M;  4Q48 A;  4EQQ A;  3HOW J;  2W7N A;  3HKZ N;  3ZCO A;  3C7J A;  3OR2 C;  5DS9 A;  1SVM A;  4M71 A;  1HCR A;  4F92 B;  3QOD A;  5EZG A;  1VQN I;  2H1K A;  3E3V A;  2HWV A;  5K5O A;  1RUN A;  4G8X A;  4ON0 A;  5JR3 A;  3J7Y J;  3K1M A;  4QPQ A;  3DFG A;  2EIJ H;  2XHK A;  3RQ4 A;  2H8W A;  2ESH A;  4MEY F;  4H0E A;  2HNH A;  1IDY A;  2WAQ A;  2Y0S A;  2JRM A;  2XPU A;  3BC8 A;  3BRO A;  2VC1 A;  1UJ8 A;  4YIF A;  3HOY J;  1UAA A;  1FSE A;  1VND A;  2EZK A;  1I39 A;  2JWT A;  4BJ6 C;  2IW5 A;  2LRD A;  1P6R A;  3GXO A;  1YW8 A;  2H1L A;  1V3F A;  3O2P E;  3FZV A;  2CW8 A;  4DZP A;  1FIP A;  2CW7 A;  5B1B H;  3LAP A;  3HTU A;  4HYE A;  2NYX A;  3R6S A;  4YEL A;  4MGR A;  3TOA A;  2QYO A;  1PVE A;  1NTC A;  2ELH A;  5LD2 C;  1BOA A;  5B1A H;  5JVG F;  2IS1 A;  2VKE A;  3SZP A;  4RB2 C;  3W6V A;  2DLL A;  2DOF A;  1XGO A;  3EQL F;  3H9G A;  5BPI A;  2DXI A;  2BE5 F;  2Q8K A;  3TDU C;  4B8X A;  3J81 K;  2R7R A;  2QQA A;  4U0V A;  3HM5 A;  4BS9 A;  2E1M B;  3S3M A;  2L9S A;  2A07 F;  5IYC J;  1IN8 A;  5ILS A;  2CSO A;  5FJ8 J;  5IYD J;  2P7C B;  3NQO A;  2FNA A;  4A6D A;  1X1A A;  1IRZ A;  4WK8 F;  2R7Z J;  5EEH A;  3ZGK A;  1IRX A;  3W2V A;  1R00 A;  3GTG J;  4JK1 X;  2FBI A;  2L0K A;  3MAJ A;  1X3W B;  3VB2 A;  4BQN A;  5D5U B;  3WGH A;  4EM0 B;  1BIA A;  4LB5 A;  2VJ5 A;  4HV6 A;  1XSX A;  2R7X A;  4L5I A;  2X0L A;  4CYC B;  3TED A;  1N25 A;  2COB A;  2N8G A;  3CCV I;  2EFW A;  2MD5 A;  2V1U A;  4A93 J;  2QQ8 A;  1I1G A;  3EUH A;  2Y31 A;  5ICC A;  1VQP I;  2E60 A;  1ETO A;  4NB5 A;  3C2G A;  3Q3S A;  2ZSI B;  5JHF A;  4XQF A;  1QQI A;  4HQE A;  4HST A;  3M1C A;  1GT0 C;  4AYB A;  1B9N A;  2LP0 A;  1A35 A;  3MQ0 A;  2O61 A;  2RRE A;  1YQA A;  2UWM A;  1GUU A;  1O3Q A;  1S3J A;  1OYW A;  2QA4 I;  2DAO A;  4XL9 A;  4AIH A;  2VPL A;  2XAG A;  2OU2 A;  2K40 A;  1RKW A;  3K69 A;  3K4K A;  1IV8 A;  4XKC A;  1CGP A;  1BJZ A;  3JRH A;  1D0Y A;  3KFW X;  2VUM J;  3GLL A;  3LOC A;  3FBN B;  2GIZ A;  2IXS A;  3CCS I;  3G1O A;  1F4K A;  2R92 J;  2ZME C;  5EYR A;  1UZC A;  2F4O B;  2IAI A;  5DCM A;  1ITY A;  3O3K A;  4HX8 A;  2KRH A;  3F6O A;  4M9X A;  2K9S A;  4L9V A;  5H6Q A;  4KMF A;  2JA7 J;  1VQ4 I;  2LBF A;  3BR5 A;  4GCV A;  2CV0 A;  2MFZ A;  4HX7 A;  1TQP A;  2GZW A;  4NDL A;  4B48 A;  1DP3 A;  1E3O C;  3WG9 A;  4U7D A;  4IHY A;  5KK1 A;  2HPM A;  5E8I A;  4LG3 A;  4CYD A;  3V4G A;  3HOZ J;  3BTI A;  3OSF A;  2FMY A;  1FP2 A;  3CC7 I;  1WHU A;  1JKR C;  4ANJ A;  4L9T A;  3ELK A;  2W84 A;  2BXZ A;  1DPR A;  4GYG A;  2CQX A;  1BC8 C;  4HNV A;  3BR1 A;  4M3E A;  3GTK J;  1XMA A;  1IN6 A;  2AO9 A;  2CQK A;  3ZPL A;  3COA C;  2XGX A;  1KQ0 A;  3CTA A;  1TWC J;  3I9V 2;  4A0Z A;  3HOX J;  3ECO A;  4UV8 A;  1JT6 A;  1ZN2 A;  3CJR B;  2VON A;  3HHG A;  2KL4 A;  1WJD A;  4X1E A;  2NRA C;  4IQJ A;  3FXJ A;  2DTR A;  1KON A;  2EFN A;  4KJZ A;  3BQZ A;  3WTW C;  3DTE A;  3JAM Z;  2B9S A;  1ETQ A;  1BN5 A;  3ISP A;  2XV4 S;  4ZDL A;  1FIA A;  3U21 A;  5FB2 A;  1VQL I;  1BA5 A;  2E7W A;  2F5D A;  3KE2 A;  3E6B A;  1WFX A;  4LJZ F;  1OYY A;  2OV7 A;  1YRN B;  2ZJR F;  3SDB A;  4L0Z B;  3VYR B;  1WWX A;  1EKE A;  3Q0W A;  2JA2 A;  3BTJ A;  4YFK F;  4C2M J;  2M1B A;  3DP7 A;  4ZZL A;  3F9K A;  2KLO A;  3K4L A;  3PNY A;  3VPR A;  1MKM A;  1SD7 A;  3OL4 A;  5TGT A;  1BI2 A;  3ZQ7 A;  3CMA I;  4IHT A;  1KQ8 A;  4W97 A;  2QCO A;  1Q1V A;  2W48 A;  1ZR2 A;  2MW8 A;  2JZY A;  2X51 A;  1X1C A;  3OSG A;  1J7K A;  2KDZ A;  1QPI A;  1Z3X A;  1VQM I;  1JTX A;  4A3C J;  2MA3 A;  1YJ9 I;  1MMA A;  3WHC A;  1Z67 A;  4CYC A;  5E1Z B;  2GXG A;  5B3S H;  2ESN A;  2DFE A;  2LRE A;  2W00 A;  3GW2 A;  3PO3 J;  1YO5 C;  5TIS C;  3KZI C;  4B1R A;  1IJW C;  4A3B J;  1AA7 A;  2OCE A;  4BXU A;  5FLM J;  3C1D A;  2L4M A;  2Q2E B;  5J4Y A;  3HDD A;  2D5V A;  3K10 A;  4ZYA A;  1JGG A;  2E2J J;  2P5V A;  2CV1 A;  3AFH A;  1FYL A;  2R7Q A;  3IH4 A;  1W36 C;  3FXR A;  1TBX A;  4R8H A;  1LFP A;  3FXU A;  3U2R A;  3P9I A;  1WPK A;  5KVR A;  5GTI C;  5J8C A;  4WCG A;  3WTY C;  1WGX A;  2OCC H;  1KZH A;  1MMD A;  3ASN H;  5IT9 K;  1MJA A;  4LLG F;  2ZB9 A;  4Q4Z F;  3S17 J;  2M45 A;  3OYI A;  3BR6 A;  1XGM A;  3D1N I;  3R0A A;  2L9N A;  1KGS A;  3ONQ A;  2GQQ A;  2IS2 A;  3FXO A;  4KT6 A;  2KRF A;  2KIM A;  2OJE D;  1GXP A;  2ADU A;  5HDN A;  4LOC A;  2XSJ C;  4XRS A;  1UG2 A;  2CFX A;  3ABT A;  1SMY F;  1FP1 D;  4E7I A;  2UZK A;  4KDP A;  2ECC A;  3JAM K;  4LIT A;  2MSY A;  3K6G A;  1MBH A;  1G3T A;  3JSO A;  2F6C A;  1YI2 I;  2HI3 A;  1YHQ I;  2KP6 A;  4MFE A;  3N4M A;  3WTU C;  1JT0 A;  2R7D A;  1KA8 A;  1F5T A;  1I6X A;  4FHT A;  1T39 A;  2XF7 A;  1VF9 A;  3K2A A;  5FKM A;  2ELJ A;  1S72 I;  3I4N J;  2A6T A;  1YS7 A;  1H89 C;  3PM1 A;  4A3G J;  2VKV A;  1WCM J;  2KRC A;  3ZXS A;  4E7K A;  1W7P A;  1C0W A;  3ERE D;  2AQF A;  2JVG A;  3TGN A;  2OD5 A;  2ZXH A;  2LD5 A;  3L00 A;  2KFD A;  3CMM A;  1YIT I;  5GP9 A;  4O3M A;  1FX7 A;  2K27 A;  3GUD A;  1DU0 A;  1MZB A;  2ZBK A;  5HOD A;  3GZ5 A;  4UVC A;  1YLF A;  4RAF A;  4DJA A;  1J9I A;  5H20 A;  3GTQ J;  2V6C A;  4OIN F;  4UB8 C;  3ABU A;  3BTL A;  5LHI A;  4RM3 A;  4DBQ A;  5JFR A;  2BYV E;  5JLX A;  1XTA A;  3I58 A;  2NOG A;  5F27 A;  3IH3 A;  2CW0 F;  2VQH A;  4LLL A;  3TP3 A;  4IOC F;  4A3E J;  2OC6 A;  4RMN A;  4XN0 A;  4QLC U;  3KIO A;  2XAF A;  3A0B C;  1ETY A;  1V4R A;  1VQ8 I;  4I99 C;  3J80 K;  2LG4 A;  1K6Y A;  1T08 B;  1YRN A;  2WB1 A;  4IXA A;  3L7W A;  4I2O A;  1HC8 A;  3H1C A;  1O3S A;  5HLG A;  2EZH A;  3OYC A;  3OYE A;  3RYR A;  5EEG A;  1WRJ A;  5E3L A;  3ZMS A;  3JRE A;  4EJT A;  1ZHF A;  4EV0 A;  3RCO A;  2X6X A;  2IA1 A;  4UY8 I;  1ORK A;  1HQC A;  3CD6 I;  2DYR H;  5FLX K;  4HQM A;  2XB0 X;  2VC0 A;  3S3O A;  3P9C A;  3SJM A;  2GAU A;  3ZOB A;  2IGK A;  2COM A;  4A2U A;  2DPD A;  1ZRC A;  1JGS A;  1PUF B;  1FYM A;  2W25 A;  4NNJ A;  1QBJ A;  3PNT A;  4J19 A;  3H9J A;  1YW7 A;  3Q0U A;  3RKQ A;  2E1C A;  3B02 A;  2I8D A;  3ZR8 X;  1JUM A;  1HW2 A;  5ERI A;  2LF8 A;  3ZN1 A;  4I6Z A;  3NWT A;  4LGW A;  5IP9 J;  1H8A C;  4X0G A;  4Q47 A;  1E3P A;  2MH2 A;  9ANT A;  3FX3 A;  4P96 A;  4FET A;  2RNG A;  2VBW A;  3BJA A;  2PJR A;  5FRM A;  2R5Z B;  2L01 A;  1GLN A;  5DTD A;  2EFP A;  4LIV A;  4E4H A;  4Y15 A;  5H6R A;  3LAJ A;  5LEJ A;  2PMZ N;  2DFH A;  1SFX A;  5K7Z A;  3E5U A;  1Z7L A;  4BH9 A;  4XM3 A;  4XOP A;  3NAR A;  3MVP A;  3KZZ A;  3HL2 A;  4M3B A;  5GTH C;  1VQ6 I;  4NC6 A;  4N4O B;  4G9Y A;  5IP6 A;  2F5E A;  5JLW A;  1OPC A;  2CQN A;  3AL0 C;  2Y48 A;  3BG6 A;  2NVY J;  5AIP A;  1U9N A;  2Y0S N;  2P6T A;  2RV8 A;  4II2 A;  5HNH A;  3BR3 A;  4D7N A;  3W2W A;  1R71 A;  5K5R A;  1U78 A;  4OIO F;  2EV5 A;  4XKV A;  4WXC A;  1YW9 A;  1E0E A;  1HW5 A;  2M8G X;  2MC3 A;  4JOM A;  1DP7 P;  2R7T A;  3PL8 A;  3F8M A;  2JRT A;  4KIT B;  2CG4 A;  1K4T A;  3QOP A;  2DQR A;  2L7M P;  3Q0V A;  3E5X A;  4XOT A;  3FMQ A;  4BNC A;  4CCO A;  5JHU A;  1FWZ A;  2X1E A;  3WOD F;  3CC4 I;  1B59 A;  3HUG B;  1SFK A;  1LUJ B;  4A69 C;  3S2H J;  3IUO A;  2LK2 A;  3ZQF A;  2H6B A;  2EIK H;  3FM3 A;  4BE1 A;  5CQG A;  3L09 A;  4L5E A;  2P5K A;  2XAS A;  1A31 A;  3ECH A;  1G6N A;  4RLQ A;  2JPC A;  1I27 A;  3DF8 A;  3FMS A;  3GYH X;  1V54 H;  2LMD A;  1TNS A;  1ZQ3 P;  2HU9 A;  2A6H F;  3CCL I;  4IQ4 A;  3ABK H;  2WAF A;  1K61 A;  2V1N A;  3S1R J;  2NS7 A;  3RKX A;  1WJC A;  1P4W A;  4CZC A;  1QA6 A;  1FBU A;  1Z9C A;  2GXB A;  3QRF F;  3OOP A;  1E17 A;  2DMU A;  4XLF A;  4E70 A;  5HLT A;  2YU9 J;  1JUS A;  2YR2 A;  3J80 Z;  3E7L A;  3ZMD A;  4JX5 A;  2EPF A;  5F04 A;  3RSN A;  1RPW A;  2BHY A;  2DJN A;  2DA4 A;  2JPB A;  4IHV A;  1W0T A;  4ZH4 F;  3IRR A;  3WHB A;  4UUT A;  2LF7 A;  1FT9 A;  2HR3 A;  1USS A;  5CVJ A;  1K7A A;  2DDA A;  3FK6 A;  5E1W A;  1XSV A;  2QLZ A;  3Q9S A;  3QYE A;  1MD0 A;  5J4V A;  2X4H A;  2MC4 A;  1X19 A;  1K78 A;  3K2Z A;  2PJR B;  2G7U A;  3LSM A;  1X1P A;  2FQ4 A;  1EA3 A;  1DU6 A;  1Y0N A;  4HLY A;  2A69 F;  5HLH A;  1G4D A;  2IS4 A;  3JRB A;  1YOV B;  2A5W A;  1XCV A;  2NVQ J;  3K0L A;  1J2X A;  1L0O C;  5GPC A;  1I3Q J;  4A3K J;  3WU0 A;  4OMY A;  1TC3 C;  3LMM A;  4BKX A;  3BLY A;  1BOB A;  2F2E A;  4ZC3 A;  1QNT A;  3GZN B;  4PSX A;  1TNT A;  3FWE A;  3AAF A;  1U6G A;  3LWF A;  3GZ6 A;  2L7K A;  1R5I D;  2HQ5 A;  3JRG A;  3M8F A;  3BR0 A;  3MWM A;  3WTZ A;  3IV5 A;  3BT9 A;  3A02 A;  4YFX F;  1YJN I;  5D5W B;  2CUZ A;  2R7V A;  2HDD A;  2EH3 A;  2QBY A;  2I5U A;  2GWR A;  5C4J J;  1MJ9 A;  3ABM H;  2ZO4 A;  4PZJ A;  3LNQ A;  1P92 A;  2YU3 A;  3S1M J;  3HPG A;  3RJP A;  1W7P B;  1OR7 C;  3IL2 A;  1YFH A;  2KHM A;  4XOR A;  3U1K A;  5LGU A;  4HDU A;  4BEH B;  4CSW A;  1R5H A;  2E1M C;  4O5V A;  3IKT A;  3LSH A;  2EB7 A;  4FQG A;  3C3W A;  1ZLK A;  2A05 A;  3LL7 A;  1B8I B;  2JVH A;  3H3V K;  3F72 A;  1TW3 A;  5EDN A;  1OKR A;  4RS8 A;  4DZJ A;  3HOT A;  1QGP A;  2XRN A;  2K5C A;  3ULQ B;  4J00 A;  3LA3 A;  2VOP A;  2O5R A;  1EH6 A;  4HZF A;  3BOQ A;  3RPU A;  1PDN C;  1J09 A;  2ZSH B;  3HHH A;  5L3C A;  1ETX A;  4BDZ A;  3PQJ A;  3T8R A;  1TP4 A;  4I09 A;  3OR1 C;  3CCM I;  5CQE A;  2STW A;  2IRF G;  1QHH D;  1W5S A;  3KX2 A;  5CYV A;  1MW7 A;  5FD6 A;  3DBL B;  2MGQ A;  2JA6 J;  2ISZ A;  5EEA A;  4XRF A;  2E34 A;  1XB4 A;  4HW0 A;  4ZTF A;  1ZG1 A;  1T95 A;  2OF7 A;  2A6E F;  2RQQ A;  4L9J A;  5LEK A;  1ZRD A;  1OMI A;  4UNO A;  1ZH5 A;  2PX9 A;  4M9S A;  3M8J A;  4M74 A;  4HF2 A;  2HYF A;  3SHF A;  2R93 J;  2ME0 A;  2XPW A;  4HNT A;  2EV0 A;  5HDK A;  3HUG A;  3W6K B;  1ZGA A;  3QU3 A;  2ETH A;  2OQR A;  5GAH J;  4MNU A;  3G73 A;  2XDV A;  4IF4 A;  4AIJ A;  1SC7 A;  4CHU A;  4RGU A;  3F8N A;  2Y9Z A;  2PMZ A;  3PUF A;  1G3Y A;  3KLO A;  3J7Z I;  5IYB J;  1AU7 A;  1BIB A;  3H92 A;  2PMU A;  1XDS A;  2LYC A;  2VBY A;  3EDP A;  4W1U A;  2K4J A;  2AS5 F;  1TWH J;  1D1A A;  1RIO H;  3ZP5 A;  5ILU A;  3M07 A;  3OIO A;  4V2F A;  2GXA A;  2L9V A;  5JVT A;  3WTS C;  4LB6 B;  1OFC X;  2X6W A;  4JYK A;  1W0U A;  1IV6 A;  1BBY A;  4Y13 A;  3QYB A;  3PSF A;  2JQ7 A;  2Y9Y A;  4G94 A;  3VEP A;  5J47 A;  3CCE I;  3ZRG A;  4YEJ A;  4LD5 A;  5F1J A;  2EIL H;  2VOD A;  1TQI A;  1GXQ A;  5ILV A;  4FIS A;  2O6G E;  1ZGJ A;  4XSX F;  1U8R A;  2H27 A;  4FE7 A;  3ZQL A;  1G3W A;  3A1Y A;  3HSR A;  4XNF A;  4S04 A;  1XMX A;  5IOZ A;  5HOO A;  1D8K A;  2FNP A;  3HBL A;  2AXT C;  5E3M A;  2L9R A;  2K02 A;  3BQY A;  3HGY A;  3RKY A;  2WB1 N;  4D9J A;  1QZY A;  4ENK A;  3SFZ A;  1K4S A;  4M6Y A;  3HIF A;  1WSU A;  3CMY A;  3P9K A;  3K70 D;  1I5Z A;  2HVR A;  2VL8 A;  4IHX A;  1SD4 A;  2QQB A;  4U0Y A;  2NVT J;  1KU2 A;  2XKP A;  1AOY A;  2DOD A;  4BU2 A;  4XON A;  1PUF A;  3FBI B;  3I53 A;  1T33 A;  3MKZ A;  3ESW B;  3DU6 A;  3K4M A;  4WWC A;  1GV5 A;  1XGS A;  1I50 J;  2L3D A;  1LFU P;  1IRF A;  3DBR B;  5KAI C;  4OWR B;  4IJA A;  4FTH A;  2PBI A;  2FBH A;  3MCZ A;  2LBF B;  1S6L A;  2LH9 A;  3CDH A;  5F6F A;  4AWX B;  1NK3 P;  4A0Y A;  2R7F A;  1ENH A;  1SFO J;  1V5G A;  1ERD A;  2HOE A;  1K6O A;  1JHH A;  2X85 A;  5KCM A;  1ON2 A;  2XAU A;  3I4M J;  4C2U A;  1IXR C;  3GME A;  4PK4 A;  3WGG A;  2Y69 H;  1HST A;  1VTN C;  2ACJ A;  2XAJ A;  1FZP B;  2HXI A;  2EWN A;  4G12 A;  4CGZ A;  3OS2 A;  1O3R A;  2VXD A;  4IKF A;  2DFF A;  4AIK A;  1FOY A;  1IN4 A;  2CUF A;  2GIV A;  4E7J A;  5EF6 A;  2BVL A;  1MMS A;  1FTZ A;  2JMW A;  3GVA A;  3I71 A;  3BCB A;  3LA7 A;  4R1H A;  4LLN A;  1TW2 A;  4G7Z F;  3I56 I;  4GXO A;  4A3M J;  2L2O A;  4PGH A;  2M7A A;  5JI6 A;  3CES A;  2L02 A;  3CP8 A;  4BE2 A;  3LQR A;  5ICG A;  1K79 A;  3K4C A;  3S1N J;  4F91 B;  2D2W A;  1LEB A;  4IRI A;  3WTX C;  3VFZ A;  4RDU A;  2VQL A;  2BV6 A;  2DJI A;  3TQN A;  1X4O A;  3JRD A;  5TRD A;  3QPL A;  3TDZ C;  2V9K A;  3A4C A;  1Y6I A;  4L9N A;  4Y17 A;  3FXK A;  2R5Y A;  2DMQ A;  3FXQ A;  1WZ2 A;  3ROU A;  5FFX A;  1IDZ A;  5CVV A;  1FNN A;  2DO7 A;  4M3D A;  1IC8 A;  5FLV A;  4AID A;  1SAX A;  3CJT B;  3WE3 A;  3RQI A;  4LG0 A;  3RTR A;  4IZZ A;  3K4J A;  1R1V A;  3C18 A;  3I64 A;  3QPH A;  3EPZ A;  2FUG 2;  1K78 B;  3S1Q J;  1BJA A;  5E3O A;  1IXS B;  1OCT C;  3ZMZ A;  2R0Q C;  2GOX B;  2LKS A;  4AVZ A;  1ZRE A;  3QAH A;  2RAE A;  4CCK A;  4IEJ A;  2FF4 A;  2UUZ A;  3BR2 A;  3MZY A;  4M6X A;  2Y0M A;  2FU4 A;  2FX0 A;  3F21 A;  1HOM A;  4PSW A;  1U3E M;  2JUG A;  4HPQ A;  5CPR B;  3VDX A;  1R4M B;  3PQK A;  3DKX A;  4MFD A;  4A3J J;  2P81 A;  2IPQ X;  3QP5 A;  2GLO A;  4ZJZ A;  1QRY A;  1BL0 A;  4ESJ A;  2DT7 B;  1FBQ A;  1MBG A;  4RGX A;  2DA1 A;  3IHU A;  1IO2 A;  3CZ6 A;  3WG7 H;  1WKM A;  3HRM A;  4Y33 A;  2KJB A;  4OOI A;  3AKZ A;  1X1D A;  4MQV A;  4HX4 A;  5L3D A;  2YX7 A;  1IW7 F;  5GPA A;  3OYA A;  2E1O A;  1JKO C;  3GWZ A;  3NEU A;  5BOX A;  2HYG D;  3U9G A;  2CO5 A;  1N77 A;  1VQ9 I;  1FC3 A;  3CUO A;  4PUS A;  3TO6 A;  3VYT B;  1FMV A;  3C2B A;  1G3S A;  1T6S A;  4YRV A;  4WXD A;  2RKH A;  3RI4 A;  1RKT A;  3DKY A;  3H36 A;  1EV7 A;  1PJR A;  1P7I A;  4A0X A;  3WTV C;  4BL0 B;  1AKH A;  3KYC B;  2MLK A;  3JTH A;  3GFM A;  3F8B A;  5F0F A;  2ID6 A;  4KIC A;  5ICE A;  4YIR X;  1LE8 B;  1STZ A;  1X4P A;  5E17 F;  1FMW A;  1SAN A;  2BOL A;  2M2E A;  3SXY A;  4KN4 X;  2LC2 A;  3KP5 A;  3HRS A;  3DCF A;  1X2N A;  4U87 A;  1TT0 A;  1Y8R B;  4NQW A;  4RLF A;  4AVP A;  3HSF A;  2BY1 A;  2VQC A;  4PJN A;  1HW1 A;  3EUA A;  2R4G A;  4HNU A;  4GGG A;  3HGG A;  3IKV A;  1XX5 A;  1WI3 A;  2IA2 A;  4ASN A;  3S32 A;  4II3 A;  4AU7 A;  2OBP A;  1IN7 A;  1X3Z B;  3HEF A;  3FK7 A;  1MBK A;  4X6A J;  3OYM A;  5L3F A;  2VPR A;  1PUE E;  3TO7 A;  2E2H J;  2M87 A;  3DPU A;  4OIP F;  3FIW A;  3CCJ I;  2CWE A;  3IC7 A;  3IAM 2;  4KYW A;  3EYY A;  1N75 A;  4XIC A;  4G6T B;  2YPR A;  2IS6 A;  1I1S A;  4V2G A;  3ZQQ A;  4EGY A;  1R4N B;  2HOA A;  3R60 A;  2KQR A;  4PFO A;  1SVO A;  2YSR A;  1P4A A;  2M0C A;  2HFH A;  3FM5 A;  3BZ6 A;  5DEQ A;  1SAU A;  1LNW A;  2NS8 A;  4ZZD A;  1F1Z A;  4A3I J;  1BR2 A;  5F08 A;  1Y1W J;  4M72 A;  2HDC A;  4BXX J;  1QO0 D;  3KP4 A;  4OAZ A;  4XKB A;  1BW6 A;  2A3S A;  3M9A A;  4F52 A;  3I55 I;  1TWG J;  4ENM A;  5E79 C;  3JRI A;  2M30 A;  3E1S A;  2Y75 A;  3G3Z A;  1SEU A;  5DD8 A;  2H6C A;  2STT A;  5FKN A;  1BW5 A;  4OMZ A;  1MH4 A;  2WC2 A;  5EGO A;  1R23 A;  4P9F A;  2LFB A;  5DM6 F;  4HBL A;  2Z1D A;  3AG1 H;  1J5Y A;  2M5W A;  4EJO A;  2K86 A;  4IRG A;  2CYY A;  1WI9 A;  4MTD A;  1E2X A;  1SD5 A;  1W5C C;  4RAY A;  5D4R A;  2XAH A;  3ASO H;  2X6O A;  3GEZ A;  5J1Y A;  3GBG A;  1R5G A;  2F5C A;  3KP7 A;  3CDI A;  2LNB A;  1ZKG A;  2MBF A;  5E20 A;  1YS6 A;  2VIX A;  1BI0 A;  5DM7 F;  1RET A;  4F55 A;  1H9G A;  2XUB A;  2B7E A;  2DI3 A;  4HRI A;  4QPO A;  3ZQH A;  4CXF A;  1RZ4 A;  4NUB A;  3X2Q H;  4KNY A;  2DU9 A;  2KZV A;  1Y8Q B;  4Y3O A;  4B43 A;  4BJ5 C;  2OAZ A;  1S7E A;  4MIM A;  1K83 J;  3W3C A;  4ITV A;  5B66 C;  1QPM A;  2R7U A;  1B4A A;  3JTG A;  4I02 A;  3V8L A;  3S16 J;  4M6V A;  3F0C A;  3LSJ A;  1X58 A;  2DW4 A;  3G2B A;  4XRM A;  1REP C;  5LBQ A;  2R7O A;  4JP0 A;  3WU2 C;  1F43 A;  2Z2S B;  4GRI A;  1G2H A;  1TWA J;  4BQQ A;  1OCC H;  1T38 A;  3VYS B;  2WV1 A;  4BY1 J;  1FLI A;  2EA2 A;  3OS0 A;  4KIS A;  2DMN A;  1R58 A;  3FHN A;  3CO7 C;  4CH7 A;  3TP0 A;  1MMN A;  3IWF A;  1TTY A;  2IT0 A;  2O03 A;  4UB6 C;  1FJL A;  1HXD A;  2IP2 A;  1BI1 A;  2I10 A;  4HF0 A;  1S9H A;  3LFU A;  3RDI A;  3HXL A;  2Q0O A;  3QWL A;  1ZAR A;  1OYI A;  5LFA A;  3JRC A;  1HKT A;  4UHT A;  1OJL A;  3O8G A;  3L2C A;  2JUC A;  2VBX A;  2PJP A;  1WQ2 A;  1CF7 B;  2HTS A;  2G0E A;  2DYS H;  3CJQ B;  2B63 J;  5IT9 Z;  2CU7 A;  2DMT A;  5M3F J;  1P7J A;  3I4P A;  5E18 F;  4BBS J;  2RGV A;  1N78 A;  4C2T A;  1UMQ A;  1LB2 A;  2FEZ A;  3HG9 A;  3BG5 A;  4Y4R A;  2HQR A;  2CUJ A;  5IT3 A;  3GTJ J;  3L2W A;  4Z2Y A;  2CH0 A;  1BR1 A;  2M8E A;  3KZY A;  3CQZ J;  5D6F A;  1A6I A;  4ZYE A;  2VKD A;  4PJM A;  2MG4 A;  2ZCW A;  2OA4 A;  2HVQ A;  3RZO J;  2XF5 A;  4AD9 A;  2XPV A;  3FIS A;  2V4J C;  2HXO A;  4C9Y A;  2UXN A;  2YX4 A;  4C3J J;  4P9U A;  1KU9 A;  3KP6 A;  1GHC A;  1ZK8 A;  3IH2 A;  5HLI A;  4EJV A;  3DPL C;  2F5F A;  3M1E A;  3TW7 A;  2HOT A;  3A03 A;  1V5F A;  4R79 A;  2V1D A;  1EF4 A;  3ERM A;  3CCU I;  2LVS A;  1X3U A;  4U0W A;  2VJJ A;  3HRT A;  4ESF A;  3F22 A;  2GA2 A;  5LRS A;  3TL4 X;  3UR3 C;  3K1N A;  4D5F A;  4BHP A;  4IRH A;  2D45 A;  2FSW A;  3ZQC A;  1FEX A;  3OYK A;  3IWZ A;  1MBF A;  2AXL A;  4IPA A;  3CDL A;  1ULY A;  1P9Q C;  3FF5 A;  5A2Q K;  3H35 A;  4G6Q A;  2PI0 A;  2HZD A;  4K2E A;  3L2Q A;  4M9Z A;  3S14 J;  4MEX F;  4F7Z A;  5KHD A;  5ED4 A;  1MDM A;  1F36 A;  4XLH A;  3CCR I;  2X9D A;  5AON A;  4D0P A;  1D0X A;  2FBK A;  4C3I J;  4UXN A;  2MAB A;  4HSR A;  2F4I A;  5DV5 A;  4NQW B;  2A61 A;  1TT5 B;  3JRA A;  2JT1 A;  2NAZ A;  2KT0 A;  2DA3 A;  2LY1 A;  5E8G A;  3HOU J;  2FA5 A;  3KYL A;  2CJJ A;  3ZMV A;  3OYJ A;  3QPT A;  2K9Q A;  1FTT A;  4OAY A;  2LY9 A;  1Y0U A;  1UHS A;  3T5X A;  1WJB A;  2VI6 A;  5IP7 J;  2KIF A;  4WF2 A;  1W1W E;  4RGR A;  3KCC A;  2K9L A;  1UG0 A;  4PGG A;  1SFE A;  3F6V A;  4KIF A;  3O8H A;  2OPT A;  2VE9 A;  1GDT A;  1U0J A;  2XKO A;  3TMO A;  3HTS B;  4BUP A;  1LVK A;  3HOV J;  4UUS A;  3WGI A;  3K70 C;  2BY3 A;  5BQT A;  1X2M A;  3FDY A;  5CVR A;  1IGN A;  1EH8 A;  3OYL A;  2QSH X;  5GAD J;  2QEN A;  3F23 A;  3FXM A;  4XRS G;  2ZJ2 A;  2EIM H;  1MND A;  2WA0 A;  4ZYH A;  2KPM A;  5D4S A;  1R6R A;  1HSJ A;  1HBX G;  1Z77 A;  2WTE A;  1LFB A;  1AKH B;  2LDU A;  5J8F A;  2RQP A;  1LDD A;  1XG1 A;  3NAU A;  1R1T A;  3JRF A;  4G7O F;  2OTJ I;  1LKX A;  2FJ1 A;  2P4W A;  4L18 B;  1SMT A;  1D5Y A;  2VAS A;  5LRR A;  4XLC A;  2H09 A;  2NVX J;  3VOD A;  3DWL E;  2E19 A;  2IA0 A;  2DMP A;  3QQA A;  4V19 K;  4UUV A;  3DEU A;  1MGT A;  3K9T A;  2BVM A;  2O9L A;  4MHG A;  5J1R A;  1HF0 A;  4DNC A;  3MKL A;  2QGU A;  1D1C A;  3QPS A;  3K4B A;  4N4N B;  3H5N A;  1XMK A;  4ABZ A;  2DA7 A;  4ETS A;  1XS9 A;  1JI8 A;  1OCR H;  5EZH A;  2QQ9 A;  4O6J A;  5HS7 A;  5CLS A;  4FT8 A;  1IAW A;  1Z91 A;  3AG3 H;  4A5M A;  3LSP A;  3HSE A;  1Z3Y A;  2TCT A;  2LTP A;  3L2V A;  3RPU D;  3I5U A;  3EUH C;  5CKT A;  1OCZ H;  2R5Y B;  3DTI A;  3SFI A;  4DYQ A;  1B1B A;  5J1U A;  3GX4 X;  3LSG A;  1YIJ I;  3AL0 B;  3M3Y J;  2LSO A;  3BG9 A;  3I0T A;  3DKW A;  2LLK A;  4S05 A;  3L9F A;  1Z7U A;  1B72 A;  1A36 A;  2NXN B;  4QWQ A;  3V7C A;  1LEA A;  4PCQ A;  2W24 A;  2BBY A;  1DPU A;  1V5E A;  4QIW N;  2ID3 A;  2IEK A;  3UKG A;  1YE9 A;  4BHB A;  3KP3 A;  4RBO A;  1Z21 A;  3A01 A;  2M9H A;  4BE0 A;  3RZD J;  1MBJ A;  2Y2Z A;  3VSK A;  3L2R A;  2VQG A;  3KLN A;  2V9V A;  1SD6 A;  4AYB N;  2L7Z A;  1QHG A;  3D5L A;  2ZME B;  3OYH A;  2WV0 A;  2GOM A;  2IGM A;  2PN6 A;  5HS8 A;  2L54 A;  5GAE J;  4RM2 A;  2TDX A;  4IVN A;  1R22 A;  1XDU A;  4P55 A;  3TOB A;  5EG0 B;  2F48 A;  1NK2 P;  3O6B B;  2FRH A;  3MFK A;  3SZG A;  3N97 A;  6PAX A;  2Q2E A;  4KFC A;  1FPQ A;  5L3E A;  1R36 A;  2BHZ A;  4JX6 A;  1J0R A;  2BY2 A;  2JK3 A;  1Z6T A;  1CQT A;  3LSI A;  1OQY A;  1J59 A;  4LFU A;  4JX4 A;  5B5E C;  1A04 A;  5BNG A;  4YFN F;  5D6E A;  5CVI A;  1LPQ A;  2QBY B;  2E5Z A;  3VYU B;  2Z99 A;  2CQ7 A;  5M5Y J;  2L7F P;  2X1D A;  5FGM A;  3GFI A;  1R9T J;  4XMY A;  1L3L A;  3HKZ A;  2CFO A;  2J5P A;  3C2H A;  1YJW I;  3GTM J;  2VT3 A;  4IL6 C;  5KNL A;  3I59 A;  2OZU A;  4IOA F;  2VT2 A;  3JR9 A;  4EEF G;  2QSF X;  1M1E B;  4KMU X;  2YS9 A;  4L0Y B;  3REO A;  1SVL A;  1ETW A;  1S5L C;  3E0J B;  1WJE A;  3E6M A;  2GM4 A;  2QUF A;  3BDD A;  3PIP F;  2R5Z A;  1ONV A;  1JTY A;  3GFJ A;  2A5Y B;  3S2W A;  2NS0 A;  2PMH A;  4DGW B;  4NC7 A;  1MIJ A;  3S8P A;  2W57 A;  1XPX A;  4BQA A;  1D5V A;  3QU6 A;  4I98 B;  1VZ0 A;  2VB6 A;  4XLN F;  1FSH A;  1ZG3 A;  3U1D A;  2QKM B;  2GA1 A;  4C30 A;  3QOE A;  4CZZ A;  4RAG A;  3TKY A;  4BAY A;  4BY7 J;  2JSP A;  2X48 A;  3Q9V A;  2E7X A;  3PFY A;  4N9H A;  1FBS A;  1T8I A;  5AIQ A;  1B8I A;  2QVO A;  2ECB A;  2QSG X;  2ZJP F;  2HGC A;  2KIU A;  1D8J A;  2XRO A;  1UST A;  2EK5 A;  3HPH A;  4CCL A;  2DPU A;  3CCQ I;  3H9Q A;  2HZT A;  3WTT C;  4AM3 A;  1I3A A;  4UVB A;  2R7W A;  1G59 A;  2K3P A;  3BG3 A;  2IVM A;  3TO9 A;  2LR8 A;  2CV2 A;  2G9W A;  2IBD A;  3KEO A;  1TZL A;  4BYY A;  2XGD A;  1B6A A;  1O57 A;  1Z05 A;  2HQN A;  3KP2 A;  5DUK A;  4CO8 A;  4WX9 A;  2LY2 A;  3MMY B;  2XC7 A;  2OQG A;  2DA6 A;  2CMP A;  5BPD A;  4RA2 A;  1IUY A;  1S29 A;  4L5J A;  2BXY A;  4NC8 A;  2NNN A;  3S93 A;  3UNG C;  3DLL F;  5K7H A;  1O4X A;  4I01 A;  1ZGW A;  2AHQ A;  1BC7 C;  2BW3 A;  4G7H F;  3KPH A;  1ZRF A;  2RNJ A;  4I7H A;  4Q5S F;  3A01 B;  3V7R A;  2D1V A;  5K5Q A;  3H3Z A;  2VBZ A;  2HEO A;  4C3H J;  1ZTR A;  2DFI A;  4OIR F;  4IHS A;  3BJO A;  2VXZ A;  1JKP C;  4GYI A;  3F8C A;  1XSD A;  4UV9 A;  4M73 A;  2WAE A;  1YYV A;  4MLO A;  1MDM B;  3H3U A;  4Y7N J;  2K7L A;  5EG0 A;  2JTV A;  1IF1 A;  3BY6 A;  4H4K C;  4KT5 C;  2ZKZ A;  3M8E A;  2GBY A;  2Z5U A;  2ZME A;  4A6E A;  1U5T A;  3OS1 A;  4QSH A;  3CUQ B;  5FLX Z;  5C3E J;  2ICW G;  4BAC A;  4S0H B;  4FX4 A;  2KMU A;  2M7B A;  4HLX A;  4Y52 J;  1WH7 A;  3OYG A;  3A0H C;  4NBQ A;  3OYB A;  1XCB A;  1U2W A;  4U7B A;  1YG2 A;  1B72 B;  1UB9 A;  3ZN0 A;  4AC0 A;  1BI3 A;  3OYN A;  1OLT A;  3FMR A;  2P5L C;  4DW6 A;  1U5T B;  4HEA 2;  3EET A;  2W1O A;  2IJL A;  2OUM A;  2WY7 Q;  3G1M A;  2HPI A;  5CVU A;  3V8J A;  1ETK A;  3CLQ A;  2RC4 A;  2DDB A;  1P4X A;  2E71 A;  1MMG A;  4LK0 F;  3E6D A;  2M0M A;  1U5T C;  2CUE A;  4PFP A;  5DCF A;  1RC9 A;  2FQ3 A;  3CME I;  4EJW A;  3SZT A;  1QU3 A;  4ZDO A;  1A5J A;  3HYI A;  3KET A; 
#chains in the Genus database with same CATH homology
 3GFL A;  1B9M A;  2XIG A;  4RGS A;  1XGN A;  2O8X A;  1HKQ A;  3CUQ A;  2ZXJ A;  2JSC A;  4ESB A;  5F64 A;  3RIR A;  2XVC A;  3CJN A;  1Z1D A;  4P5O A;  1BM9 A;  3ZMU A;  3LFK A;  3Q5F A;  1O7L A;  4ZYD A;  3LST A;  2HS5 A;  5K1Y A;  3R61 A;  2EV6 A;  1ON1 A;  1IZ1 A;  5D8K B;  5D8L B;  1DUX C;  4I0B A;  3SQN A;  2HTJ A;  2QM3 A;  4WXH A;  2P8T A;  1Z6R A;  1ODD A;  2C6Y A;  2EJR A;  1S7A A;  1D3Y A;  2V79 A;  1LDK B;  3K1P A;  5TJJ A;  2WWY A;  5BMZ A;  3V8K A;  1R1U A;  3D0S A;  2H94 A;  3RPQ A;  1XD7 A;  3DPT A;  3MEX A;  1IRG A;  5BS6 A;  3GF2 A;  1UHM A;  5DUI A;  3F3X A;  3E5Q A;  4XBF A;  1EH7 A;  1KYW A;  2OZ6 A;  4RAZ A;  5L3B A;  1YIO A;  5DDG A;  3HOS A;  2DT5 A;  3T8T A;  3NRV A;  2LKP A;  3JSP A;  5DCM B;  3R4K A;  4YII A;  4HDV A;  5HS9 A;  2FE3 A;  3GLX A;  1W7P D;  2ISY A;  4UVA A;  1FYK A;  5DYM A;  2DK8 A;  3LQQ A;  2PLY A;  3EYI A;  1J75 A;  3E6C C;  3I59 B;  1QZZ A;  1KQ9 A;  1TLH B;  2QWW A;  2KKO A;  4OIQ F;  4EVI A;  4KUM A;  4DQ2 A;  4ENJ A;  3F8F A;  1LJ9 A;  2XAQ A;  1W5T A;  3WE2 A;  2B0L A;  5ICF A;  2W85 A;  4XSZ F;  1UFM A;  4RB1 A;  1S8N A;  1PP8 F;  3J81 Z;  4JBA A;  1JHF A;  4NHJ A;  1MJB A;  1CF7 A;  1GVJ A;  4N9I A;  2QZ8 A;  4HF1 A;  4BHC A;  2FOK A;  4OU0 A;  1ZYR F;  3T0Y A;  2ZFW A;  4RB3 C;  4EM2 A;  1RNL A;  1F9N A;  3CUQ C;  2HKX A;  3W6J B;  2PEX A;  1RUO A;  1DDN A;  4RB0 A;  4EJU A;  3KEQ A;  2O0Y A;  2K4B A;  2FXA A;  5LLQ A;  4KIG A;  4CDG A;  5A2Q Z;  3VOE A;  3E97 A;  2HKO A;  1LVA A;  3DXJ F;  1XN7 A;  3HRU A;  4TV7 A;  1S7O A;  3QP6 A;  1FOK A;  4LG0 B;  2EA4 A;  4B09 A;  2PG4 A;  5LHH A;  3IRQ A;  2KJC A;  1PP7 U;  4ENN A;  3OV8 A;  3BPX A;  1RI7 A;  3R0J A;  5CJ9 A;  2RDP A;  5J6X A;  2Z3Y A;  1JE8 A;  5FO5 A;  2UXX A;  3JW4 A;  4JQF A;  4LMY A;  1P2F A;  4U88 A;  4EGZ A;  5LHG A;  1O7F A;  1ZG5 A;  3V7S A;  1T98 A;  3BPV A;  3FHZ A;  4PDK A;  5HDG A;  2J5O A;  3M7G A;  3ZMT A;  1YTY A;  1ZAO A;  2R3S A;  1H9T A;  1T0F A;  3BWG A;  2PQ8 A;  2ZNY A;  3T1B A;  3ML6 A;  5D5X B;  2VN2 A;  2EFQ A;  3CLO A;  3BP8 A;  1NHA A;  1LDJ A;  3P7N A;  2BEO A;  5HVQ C;  4HOB A;  1HKS A;  2MH9 A;  3RYP A;  5FD5 A;  1SFU A;  2V1X A;  2PFB A;  5LGT A;  4KA4 A;  3BJ6 A;  2CGP A;  2VOO A;  1UCR A;  2VE8 A;  4CIC A;  1R7J A;  1W4M A;  4HAM A;  4KIB A;  5F1R A;  4EMS A;  3J7A O;  4LK1 F;  2RVC A;  5DD4 A;  2DK5 A;  2E1N A;  2P6S A;  3DQV C;  2DBB A;  1UHW A;  2O3F A;  4N0B A;  4FX0 A;  4YG2 F;  4I0A A;  2DQL A;  2RN7 A;  1LQ1 A;  3GO5 A;  3I54 A;  3LA2 A;  4MTE A;  4KN7 X;  2D1H A;  4G6D A;  4ZYG A;  2FML A;  1IXC A;  1FY7 A;  1KU7 A;  1O3T A;  3DV8 A;  4HA8 A;  3MZH A;  3CO6 C;  2L4A A;  1KU3 A;  1TQM A;  1Q1H A;  2Z33 A;  3B73 A;  1OR7 A;  1AWC A;  2G7H A;  1JXS A;  4GO1 A;  5LGN A;  4XLP F;  3RKW A;  4A5N A;  1H0M A;  5L3G A;  2BGC A;  2NNY A;  3PFI A;  5D5V B;  5FFZ A;  4A12 A;  5E1X A;  3WU1 B;  2ZNZ A;  2MLG A;  2P7V B;  4MQ9 F;  1KYZ A;  1ZLJ A;  1T2K A;  4EM1 A;  2Z9O A;  1IN5 A;  4HV5 A;  2A68 F;  2EFO A;  4Q48 A;  4EQQ A;  3C7J A;  4M71 A;  3E3V A;  2HWV A;  5K5O A;  1RUN A;  4G8X A;  5JR3 A;  4ON0 A;  3K1M A;  3DFG A;  2XHK A;  2ESH A;  4MEY F;  4H0E A;  3BRO A;  2VC1 A;  4YIF A;  1FSE A;  2IW5 A;  1P6R A;  3GXO A;  1YW8 A;  1V3F A;  3O2P E;  3FZV A;  3LAP A;  3HTU A;  4HYE A;  2NYX A;  3R6S A;  4MGR A;  3TOA A;  2QYO A;  2ELH A;  1BOA A;  3SZP A;  4RB2 C;  2DLL A;  1XGO A;  3EQL F;  5BPI A;  2BE5 F;  2Q8K A;  3TDU C;  4B8X A;  3J81 K;  2QQA A;  4U0V A;  2A07 F;  1IN8 A;  5ILS A;  2CSO A;  2P7C B;  3NQO A;  2FNA A;  4A6D A;  4WK8 F;  5EEH A;  1R00 A;  4JK1 X;  2FBI A;  3MAJ A;  3VB2 A;  5D5U B;  3WGH A;  4EM0 B;  1BIA A;  4LB5 A;  4HV6 A;  1XSX A;  4L5I A;  2X0L A;  2EFW A;  2MD5 A;  2V1U A;  1I1G A;  3EUH A;  5ICC A;  4NB5 A;  1QQI A;  4HQE A;  1B9N A;  3MQ0 A;  2O61 A;  1YQA A;  2UWM A;  1O3Q A;  1S3J A;  1OYW A;  2DAO A;  4AIH A;  2XAG A;  2OU2 A;  3K69 A;  1CGP A;  3KFW X;  1F4K A;  5DCM A;  3O3K A;  4HX8 A;  3F6O A;  4M9X A;  4L9V A;  5H6Q A;  4KMF A;  4GCV A;  4HX7 A;  1TQP A;  2GZW A;  3WG9 A;  4U7D A;  5KK1 A;  5E8I A;  4CYD A;  3V4G A;  2FMY A;  1FP2 A;  4L9T A;  3ELK A;  2W84 A;  1DPR A;  4GYG A;  1BC8 C;  1XMA A;  1IN6 A;  2CQK A;  3ZPL A;  3COA C;  2XGX A;  1KQ0 A;  3CTA A;  4A0Z A;  3ECO A;  4UV8 A;  1ZN2 A;  2VON A;  3HHG A;  2NRA C;  2DTR A;  2EFN A;  3WTW C;  3JAM Z;  1BN5 A;  3ISP A;  2XV4 S;  5FB2 A;  2E7W A;  2F5D A;  3KE2 A;  3E6B A;  4LJZ F;  1OYY A;  4L0Z B;  1WWX A;  4YFK F;  2M1B A;  3DP7 A;  4ZZL A;  1MKM A;  1SD7 A;  1BI2 A;  3ZQ7 A;  4IHT A;  1KQ8 A;  2JZY A;  1J7K A;  2MA3 A;  5E1Z B;  2GXG A;  2ESN A;  3GW2 A;  1YO5 C;  4BXU A;  3C1D A;  2L4M A;  2P5V A;  1FYL A;  3FXR A;  1TBX A;  4R8H A;  3FXU A;  5J8C A;  3U2R A;  3P9I A;  4WCG A;  5KVR A;  3WTY C;  5IT9 K;  1MJA A;  4LLG F;  4Q4Z F;  2M45 A;  1XGM A;  3R0A A;  1KGS A;  2GQQ A;  1GXP A;  2KRF A;  2KIM A;  2ADU A;  5HDN A;  2CFX A;  3ABT A;  1SMY F;  1FP1 D;  4KDP A;  2UZK A;  3JAM K;  1G3T A;  3JSO A;  3N4M A;  3WTU C;  2R7D A;  1KA8 A;  1F5T A;  1I6X A;  4FHT A;  1T39 A;  1YS7 A;  1W7P A;  1C0W A;  3ERE D;  3TGN A;  2OD5 A;  3L00 A;  4O3M A;  1FX7 A;  2K27 A;  3GUD A;  1MZB A;  2ZBK A;  3GZ5 A;  4UVC A;  1YLF A;  1J9I A;  5H20 A;  2V6C A;  4OIN F;  3ABU A;  5LHI A;  5JFR A;  2BYV E;  3I58 A;  2CW0 F;  4LLL A;  4QLC U;  2XAF A;  1V4R A;  3J80 K;  4IXA A;  3L7W A;  4I2O A;  1O3S A;  5HLG A;  3RYR A;  5EEG A;  1WRJ A;  3ZMS A;  4EJT A;  1ZHF A;  4EV0 A;  2IA1 A;  1HQC A;  5FLX K;  4HQM A;  2VC0 A;  3P9C A;  2GAU A;  2COM A;  4A2U A;  2DPD A;  1ZRC A;  1JGS A;  1FYM A;  2W25 A;  1QBJ A;  1YW7 A;  2E1C A;  3B02 A;  1HW2 A;  5ERI A;  2LF8 A;  3ZN1 A;  4LGW A;  4Q47 A;  2MH2 A;  3FX3 A;  4P96 A;  2VBW A;  3BJA A;  2L01 A;  2EFP A;  4Y15 A;  5H6R A;  3LAJ A;  5LEJ A;  1SFX A;  3E5U A;  4BH9 A;  3KZZ A;  4G9Y A;  2F5E A;  1OPC A;  2Y48 A;  5AIP A;  2P6T A;  2RV8 A;  1U78 A;  5K5R A;  4OIO F;  2EV5 A;  4WXC A;  1YW9 A;  1HW5 A;  2MC3 A;  1DP7 P;  3F8M A;  2JRT A;  2CG4 A;  3QOP A;  2DQR A;  3E5X A;  3FMQ A;  4BNC A;  5JHU A;  1FWZ A;  3WOD F;  1B59 A;  2H6B A;  3FM3 A;  3L09 A;  2P5K A;  2XAS A;  3ECH A;  1G6N A;  2JPC A;  1I27 A;  3DF8 A;  3FMS A;  3GYH X;  1TNS A;  2A6H F;  3RKX A;  1P4W A;  1FBU A;  1Z9C A;  2GXB A;  3QRF F;  3OOP A;  1E17 A;  4E70 A;  2YR2 A;  3J80 Z;  3ZMD A;  2JPB A;  4ZH4 F;  3IRR A;  2LF7 A;  1FT9 A;  2HR3 A;  1USS A;  5CVJ A;  1K7A A;  5E1W A;  1XSV A;  2QLZ A;  3Q9S A;  1MD0 A;  2X4H A;  1K78 A;  3K2Z A;  2G7U A;  4HLY A;  2A69 F;  5HLH A;  1G4D A;  1XCV A;  3K0L A;  1J2X A;  1L0O C;  3WU0 A;  4OMY A;  2F2E A;  1QNT A;  1TNT A;  3FWE A;  3AAF A;  1U6G A;  3LWF A;  3GZ6 A;  3M8F A;  3MWM A;  3WTZ A;  4YFX F;  5D5W B;  2QBY A;  2GWR A;  1MJ9 A;  2ZO4 A;  4PZJ A;  1P92 A;  2YU3 A;  3RJP A;  1W7P B;  1YFH A;  3IL2 A;  5LGU A;  4HDU A;  1R5H A;  4O5V A;  3IKT A;  2EB7 A;  3C3W A;  1ZLK A;  3F72 A;  1TW3 A;  1OKR A;  4RS8 A;  3HOT A;  1QGP A;  2XRN A;  3ULQ B;  3LA3 A;  2VOP A;  1EH6 A;  4HZF A;  3BOQ A;  3RPU A;  1PDN C;  3HHH A;  5L3C A;  3PQJ A;  3T8R A;  4I09 A;  2STW A;  2IRF G;  1W5S A;  5CYV A;  5FD6 A;  2ISZ A;  4XRF A;  1XB4 A;  4HW0 A;  1ZG1 A;  2A6E F;  4L9J A;  5LEK A;  1ZRD A;  1OMI A;  4UNO A;  1ZH5 A;  4M9S A;  4M74 A;  4HF2 A;  2HYF A;  3SHF A;  2EV0 A;  5HDK A;  3HUG A;  3W6K B;  1ZGA A;  3QU3 A;  2ETH A;  2OQR A;  4MNU A;  3G73 A;  4AIJ A;  4IF4 A;  4CHU A;  4RGU A;  3F8N A;  1G3Y A;  3KLO A;  1BIB A;  3H92 A;  2PMU A;  1XDS A;  3EDP A;  2VBY A;  2K4J A;  2AS5 F;  1RIO H;  3ZP5 A;  5ILU A;  5JVT A;  3WTS C;  4LB6 B;  1BBY A;  4Y13 A;  4G94 A;  3VEP A;  4LD5 A;  2VOD A;  1TQI A;  1GXQ A;  5ILV A;  2O6G E;  1ZGJ A;  4XSX F;  1U8R A;  2H27 A;  1G3W A;  3HSR A;  4S04 A;  5HOO A;  1D8K A;  2FNP A;  2K02 A;  3RKY A;  1QZY A;  4ENK A;  3SFZ A;  4M6Y A;  3HIF A;  1WSU A;  3P9K A;  1I5Z A;  1SD4 A;  2QQB A;  4U0Y A;  1KU2 A;  2XKP A;  1AOY A;  3I53 A;  4WWC A;  1XGS A;  2L3D A;  1IRF A;  4IJA A;  2PBI A;  2FBH A;  3MCZ A;  1S6L A;  3CDH A;  5F6F A;  4AWX B;  4A0Y A;  2R7F A;  2HOE A;  1K6O A;  1JHH A;  1ON2 A;  1IXR C;  3WGG A;  1HST A;  1VTN C;  2ACJ A;  2XAJ A;  1FZP B;  2EWN A;  4CGZ A;  1O3R A;  4AIK A;  1IN4 A;  2GIV A;  3GVA A;  3I71 A;  3LA7 A;  4R1H A;  4LLN A;  1TW2 A;  4G7Z F;  4GXO A;  4PGH A;  5JI6 A;  2L02 A;  3LQR A;  5ICG A;  1K79 A;  2D2W A;  1LEB A;  4IRI A;  3WTX C;  3VFZ A;  2BV6 A;  3TQN A;  5TRD A;  3TDZ C;  4L9N A;  4Y17 A;  3FXQ A;  3ROU A;  5FFX A;  5CVV A;  1FNN A;  2DO7 A;  1SAX A;  3WE3 A;  4LG0 A;  3RTR A;  1R1V A;  3C18 A;  3I64 A;  3QPH A;  1K78 B;  1BJA A;  1IXS B;  3ZMZ A;  1ZRE A;  3QAH A;  2FF4 A;  3MZY A;  4M6X A;  2Y0M A;  2FU4 A;  3F21 A;  1U3E M;  3PQK A;  2IPQ X;  3QP5 A;  4ESJ A;  1FBQ A;  4RGX A;  3IHU A;  1WKM A;  3HRM A;  2KJB A;  4OOI A;  4MQV A;  4HX4 A;  5L3D A;  2YX7 A;  1IW7 F;  3GWZ A;  3NEU A;  5BOX A;  2HYG D;  3U9G A;  2CO5 A;  1FC3 A;  3CUO A;  3TO6 A;  1G3S A;  1T6S A;  4WXD A;  2RKH A;  3RI4 A;  1EV7 A;  4A0X A;  3WTV C;  2MLK A;  3JTH A;  3GFM A;  3F8B A;  5ICE A;  4KIC A;  5E17 F;  1STZ A;  3SXY A;  4KN4 X;  3KP5 A;  3HRS A;  4NQW A;  4AVP A;  3HSF A;  1HW1 A;  4GGG A;  3IKV A;  2IA2 A;  4ASN A;  2OBP A;  1IN7 A;  5L3F A;  1PUE E;  3TO7 A;  2M87 A;  4OIP F;  2CWE A;  3IC7 A;  4KYW A;  3EYY A;  2YPR A;  1I1S A;  4EGY A;  3R60 A;  2YSR A;  1P4A A;  2HFH A;  3FM5 A;  3BZ6 A;  5DEQ A;  1LNW A;  4ZZD A;  1F1Z A;  2HDC A;  4M72 A;  1QO0 D;  3KP4 A;  2A3S A;  3M9A A;  4ENM A;  2M30 A;  2Y75 A;  3G3Z A;  5DD8 A;  2H6C A;  2STT A;  4OMZ A;  2WC2 A;  1R23 A;  4P9F A;  4HBL A;  1J5Y A;  2M5W A;  4EJO A;  2K86 A;  4IRG A;  2CYY A;  1WI9 A;  4MTD A;  1E2X A;  1SD5 A;  4RAY A;  5D4R A;  2XAH A;  3GEZ A;  1R5G A;  2F5C A;  3KP7 A;  2LNB A;  2MBF A;  5E20 A;  1YS6 A;  1BI0 A;  1H9G A;  2XUB A;  2DI3 A;  4CXF A;  1RZ4 A;  4KNY A;  2DU9 A;  2OAZ A;  1QPM A;  1B4A A;  3JTG A;  4I02 A;  3V8L A;  2DW4 A;  1REP C;  5LBQ A;  1T38 A;  1FLI A;  2EA2 A;  1R58 A;  3CO7 C;  3IWF A;  1TTY A;  2IT0 A;  2O03 A;  1HXD A;  2IP2 A;  1BI1 A;  4HF0 A;  3RDI A;  2Q0O A;  1ZAR A;  1OYI A;  1HKT A;  4UHT A;  3L2C A;  2VBX A;  2PJP A;  1WQ2 A;  1CF7 B;  2HTS A;  5IT9 Z;  3I4P A;  5E18 F;  2RGV A;  1LB2 A;  2FEZ A;  2HQR A;  5IT3 A;  4Z2Y A;  2M8E A;  3KZY A;  5D6F A;  4ZYE A;  2ZCW A;  2OA4 A;  4AD9 A;  2UXN A;  2YX4 A;  4P9U A;  1KU9 A;  3KP6 A;  1GHC A;  5HLI A;  4EJV A;  3DPL C;  2F5F A;  3M1E A;  4R79 A;  2V1D A;  1X3U A;  4U0W A;  3HRT A;  3F22 A;  4ESF A;  2GA2 A;  5LRS A;  3K1N A;  4BHP A;  4IRH A;  2D45 A;  2FSW A;  3IWZ A;  2AXL A;  4IPA A;  1ULY A;  3FF5 A;  5A2Q K;  4G6Q A;  2PI0 A;  4K2E A;  4M9Z A;  4MEX F;  4F7Z A;  5ED4 A;  1MDM A;  5AON A;  4D0P A;  2FBK A;  4UXN A;  5DV5 A;  2A61 A;  2JT1 A;  2NAZ A;  5E8G A;  2FA5 A;  3ZMV A;  3QPT A;  1Y0U A;  3T5X A;  2KIF A;  4WF2 A;  4RGR A;  3KCC A;  4PGG A;  1SFE A;  3F6V A;  4KIF A;  2VE9 A;  2XKO A;  3HTS B;  3WGI A;  5BQT A;  5CVR A;  1EH8 A;  2QEN A;  3F23 A;  2ZJ2 A;  4ZYH A;  5D4S A;  1HSJ A;  1HBX G;  2WTE A;  2LDU A;  5J8F A;  2RQP A;  1LDD A;  4G7O F;  1R1T A;  2P4W A;  4L18 B;  1SMT A;  5LRR A;  2H09 A;  3VOD A;  2IA0 A;  4UUV A;  3DEU A;  1MGT A;  3K9T A;  4MHG A;  4DNC A;  1XMK A;  4ETS A;  2QQ9 A;  4O6J A;  5HS7 A;  5CLS A;  4FT8 A;  1IAW A;  1Z91 A;  4A5M A;  3HSE A;  3I5U A;  3GX4 X;  1B1B A;  2LSO A;  3I0T A;  3DKW A;  4S05 A;  3L9F A;  1Z7U A;  4QWQ A;  3V7C A;  1LEA A;  4PCQ A;  2W24 A;  2BBY A;  1DPU A;  4BHB A;  3KP3 A;  3KLN A;  2V9V A;  1SD6 A;  3D5L A;  2ZME B;  2WV0 A;  2PN6 A;  5HS8 A;  2L54 A;  2TDX A;  4IVN A;  1R22 A;  1XDU A;  4P55 A;  3TOB A;  3O6B B;  2FRH A;  3MFK A;  3N97 A;  6PAX A;  2Q2E A;  4KFC A;  1FPQ A;  5L3E A;  1R36 A;  1J0R A;  1Z6T A;  1J59 A;  4LFU A;  1A04 A;  4YFN F;  5D6E A;  5CVI A;  2QBY B;  2Z99 A;  5FGM A;  3GFI A;  1L3L A;  2J5P A;  2VT3 A;  3I59 A;  2OZU A;  2VT2 A;  4KMU X;  4L0Y B;  3REO A;  3E6M A;  2QUF A;  3BDD A;  1ONV A;  3GFJ A;  2A5Y B;  3S2W A;  2NS0 A;  2PMH A;  4BQA A;  2W57 A;  1D5V A;  3QU6 A;  4I98 B;  4XLN F;  1FSH A;  1ZG3 A;  3U1D A;  2GA1 A;  4CZZ A;  3TKY A;  4BAY A;  3Q9V A;  2E7X A;  4N9H A;  1FBS A;  5AIQ A;  2QVO A;  2HGC A;  2KIU A;  1D8J A;  2XRO A;  1UST A;  2EK5 A;  2DPU A;  3WTT C;  2HZT A;  4UVB A;  2IVM A;  3TO9 A;  2G9W A;  3KEO A;  4BYY A;  1B6A A;  1O57 A;  1Z05 A;  2HQN A;  3KP2 A;  5DUK A;  4CO8 A;  4WX9 A;  2OQG A;  5BPD A;  1IUY A;  1S29 A;  4L5J A;  2NNN A;  4I01 A;  1BC7 C;  4G7H F;  1ZRF A;  2RNJ A;  4I7H A;  4Q5S F;  3V7R A;  2D1V A;  5K5Q A;  3H3Z A;  2VBZ A;  2HEO A;  2DFI A;  4OIR F;  4IHS A;  3BJO A;  2VXZ A;  4GYI A;  3F8C A;  1XSD A;  4UV9 A;  4M73 A;  1MDM B;  1YYV A;  3H3U A;  2K7L A;  2JTV A;  1IF1 A;  3BY6 A;  4KT5 C;  2ZKZ A;  3M8E A;  2Z5U A;  2ZME A;  4A6E A;  1U5T A;  3CUQ B;  5FLX Z;  4FX4 A;  4HLX A;  1XCB A;  1U2W A;  4U7B A;  1YG2 A;  1UB9 A;  3ZN0 A;  1BI3 A;  3FMR A;  2P5L C;  1U5T B;  3EET A;  2IJL A;  5CVU A;  3V8J A;  2RC4 A;  1P4X A;  4LK0 F;  3E6D A;  1U5T C;  5DCF A;  2FQ3 A;  4EJW A;  3SZT A;  3HYI A;  3KET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...