5D5XB

Crystal structure of chaetomium thermophilum skn7 with ssre dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
103
structure length
99
Chain Sequence
SDFVRKLYKMLEDPSYHSVVRWSDDGDSFVVLENEKFTKTILPKHFKHSNFASFVRQLNKYDFHKVRHNDEPYGRDAWEFKHPEFRADRKDNLDNIRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords SSRE DNA strand 1
publication title Structure of human heat-shock transcription factor 1 in complex with DNA.
pubmed doi rcsb
source organism Chaetomium thermophilum
total genus 29
structure length 99
sequence length 103
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00447 HSF_DNA-bind HSF-type DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5d5xB00
2Q2EA 1RNLA 1I5ZA 1P2FA 4LFUA 3H3ZA 2XASA 1ODDA 2NAZA 2W25A 2KIMA 4BH9A 2W57A 4HA8A 2WWYA 3FZVA 3KZYA 1U5TC 5H6RA 1GVJA 3F23A 1JXSA 1S3JA 4EM1A 3BP8A 4CO8A 5D4RA 2ISYA 2HWVA 3VB2A 4G7OF 2DU9A 3VFZA 2GA2A 1KYZA 2COMA 1YW7A 3Q9VA 1IXRC 3KFWX 1K78A 3FMRA 2HZTA 2K7LA 5E1XA 2DI3A 1HKTA 3CTAA 1SAXA 3DF8A 2A6HF 5K5QA 3QRFF 2O6GE 5HVQC 4HDUA 3RDIA 2XAQA 4MTEA 3E5XA 2FNAA 2RGVA 1O3QA 4LLNA 4A6EA 5A2QZ 2ELHA 4Y13A 2A6EF 5BPDA 1F1ZA 2JT1A 3ABUA 2DQLA 1W4MA 1SFEA 5CVUA 2EFOA 1HSTA 2FBIA 2FF4A 1EH6A 3ISPA 4Y17A 5LBQA 1IRGA 2GZWA 3RPUA 3MEXA 1FPQA 1J0RA 4P55A 1IN8A 1B59A 4EJVA 1T6SA 2EFPA 1UFMA 4ESFA 2D1HA 3HSFA 4XSXF 3KZZA 3I54A 2CG4A 3J81K 4BHCA 4IJAA 3PQKA 3BJOA 3TGNA 2RKHA 3IRQA 2IA0A 2YU3A 5LHIA 3L9FA 2HYFA 3FWEA 2B0LA 4HDVA 2M1BA 3T0YA 5L3DA 3RJPA 4KNYA 1XMKA 3KETA 5CVVA 3LWFA 1YIOA 4MNUA 3ZN0A 2HKOA 2HEOA 4KT5C 2DAOA 5EEGA 5HLIA 1P4XA 3N97A 3T8RA 4XRFA 2VE9A 4ZYDA 1OPCA 3SFZA 1TBXA 3F8BA 1BI3A 5CVJA 2O61A 1KU9A 1XMAA 4L0ZB 1QGPA 2P7CB 3K69A 2RN7A 3MQ0A 3BPXA 3FXRA 5D6EA 4KIGA 4KMFA 3CUQC 2IT0A 1AOYA 1U2WA 1O7LA 2DT5A 2P5KA 5E8IA 4A5NA 3I5UA 5FFXA 4H0EA 2D1VA 3GFMA 4CYDA 5DUKA 2QENA 3JSOA 3LFKA 4GXOA 1BIAA 1DPRA 4WXCA 2AXLA 2CO5A 2FQ3A 3WODF 4EVIA 1WRJA 4JBAA 2X4HA 5ILUA 3ZMVA 2E1CA 1QPMA 3ZMDA 1ZRFA 3KP7A 4RGRA 2M8EA 5D6FA 1KQ0A 4G6DA 1SFUA 4LGWA 4ZZDA 3FF5A 5ICFA 3ZMSA 2IW5A 1EH8A 3CO6C 2XIGA 3DEUA 3COAC 1XDSA 4MQ9F 1ZHFA 3BDDA 3U2RA 3DFGA 4O5VA 5HDNA 3WGHA 3F8CA 5CVRA 2BE5F 3HHHA 1U3EM 3ZN1A 2W24A 2QLZA 3IRRA 2P6SA 2HYGD 2XRNA 4BHBA 3GFIA 4EV0A 4I01A 4GYIA 1CGPA 3J7AO 5BOXA 4IHSA 3WTUC 1J5YA 1YG2A 3L2CA 3ZQ7A 4ZH4F 5LEJA 5LHHA 4U7DA 2K02A 5FO5A 1R36A 1RIOH 3KLNA 3K1MA 3R4KA 1IZ1A 5DCMA 3U9GA 1FP1D 4GGGA 1G6NA 2LNBA 3QOPA 1ZLKA 1FT9A 2PMUA 2RVCA 3HRSA 2GA1A 1R5GA 1OR7A 3ERED 1R5HA 2J5OA 4LJZF 1XDUA 3MFKA 1O3RA 4XLNF 2MBFA 3JW4A 3I58A 3MZYA 4UNOA 4EGZA 2DK5A 4A0XA 4P9FA 1W7PB 4MEXF 2H6CA 4UV9A 2PQ8A 3WTTC 5HS8A 3HOSA 2OD5A 3V8KA 1XSVA 6PAXA 3HHGA 2Z99A 4LMYA 3IKVA 4JK1X 5K5RA 1J75A 1S7OA 1TLHB 1TQPA 4PGHA 2JPCA 1KA8A 2FRHA 2O03A 1MKMA 3RKYA 5DCFA 3MZHA 3HYIA 4FHTA 2VOPA 1U5TB 3F3XA 4YFKF 4IRIA 3LA7A 1BI1A 4ZYHA 3CUQA 4DNCA 2VT2A 2K27A 4ASNA 5HLHA 2GQQA 2FNPA 3WE3A 2STTA 3BPVA 3KP4A 2EA2A 2W85A 4CDGA 5D5VB 3J80K 4L9JA 3ECHA 2D45A 3B73A 1IW7F 2QBYB 3GVAA 1CF7B 3E3VA 4GYGA 1YLFA 1D5VA 2XVCA 3WTSC 5L3EA 4AD9A 2ZKZA 1MDMA 4ZYEA 2PI0A 3E6BA 4E70A 1BC7C 3ABTA 4L9TA 1T39A 2EFNA 2BYVE 5BPIA 4G7ZF 3WE2A 2OQRA 1BJAA 4Q47A 1ZLJA 1QBJA 2V6CA 1FSHA 5IT3A 3I64A 1BOAA 3FX3A 5IT9K 2XHKA 1R23A 1P4AA 1ON2A 5E8GA 4AVPA 2NNYA 4HZFA 4S04A 2RNJA 1KYWA 3D0SA 2IRFG 1FP2A 3FM5A 3BJ6A 1V4RA 1HBXG 4XBFA 2IVMA 2GAUA 2XGXA 2EK5A 2V1DA 3KP6A 3L09A 1S29A 4HAMA 1D8KA 5FGMA 3LA3A 2RV8A 1ZRCA 2OQGA 2RC4A 3Q5FA 3HSEA 3T8TA 3TO9A 4R8HA 4UHTA 4EM2A 2UXXA 1J59A 2YSRA 1TTYA 5L3CA 2ZMEA 1K6OA 4DQ2A 3FMSA 2FMYA 2VE8A 1Z91A 3IWFA 3G73A 1QNTA 4NB5A 2DTRA 3WU1B 3V7CA 1XSXA 2P5LC 4WXDA 1B9NA 2LKPA 3HUGA 2HQRA 3KP2A 3GZ5A 4LK1F 2WTEA 3JAMK 5FLXK 1FYKA 4EJUA 1IF1A 1W5SA 1FSEA 3CO7C 2R7FA 4WK8F 3OV8A 3V8JA 1LEAA 1TQMA 2FU4A 3PQJA 4EJOA 2X0LA 1SD5A 4UVBA 1RUNA 4IXAA 4YFXF 1TW3A 4CXFA 3WTYC 2OZUA 4AIHA 5L3BA 2DO7A 1VTNC 1FBUA 3NRVA 2HQNA 3CUQB 4Z2YA 3DPTA 1G3WA 1QO0D 2V1UA 4N0BA 1FBQA 4OMZA 3HRTA 5JHUA 2ZJ2A 1FX7A 1S7AA 3KEQA 2MLGA 3LSTA 4A12A 2IA2A 1HQCA 4HX8A 2Z33A 5FFZA 2IJLA 2XAHA 2ZNYA 3LAPA 1MDMB 1S6LA 3C18A 1P92A 3IC7A 4HQMA 5ICCA 4G9YA 1IXCA 2NS0A 2MD5A 4U0VA 4WCGA 1OMIA 5D8KB 2ZNZA 2FBHA 2A07F 5ICGA 3ROUA 4FX0A 4ENMA 1O57A 1K7AA 1XCBA 2WC2A 2ACJA 3HOTA 4G8XA 3J81Z 2XAGA 5E17F 5TJJA 2A3SA 2LSOA 3VOEA 5TRDA 4LB5A 5LRRA 3V7RA 3HTUA 5D8LB 2DK8A 3M8EA 2VONA 2MH2A 1IN6A 4LK0F 4NQWA 2HDCA 3BWGA 1R1UA 3W6JB 2CGPA 4FX4A 4I09A 3F8NA 2VT3A 2CQKA 4UV8A 4A2UA 5LRSA 1ZH5A 2ZMEB 1FOKA 5BS6A 1SD7A 3LQRA 4WX9A 2L3DA 4RAZA 1LJ9A 2QWWA 2ZBKA 4YFNF 5FB2A 2P8TA 3KP3A 1TNTA 3K0LA 4I7HA 3MAJA 5ILSA 2F2EA 1FYMA 3FXUA 2HS5A 3DKWA 3K1PA 2UXNA 3O2PE 1UHWA 3MWMA 1W7PA 4LLLA 5JI6A 1JGSA 5LHGA 2L01A 2HTSA 4OIOF 4KICA 1E2XA 3TOBA 3DPLC 5DD4A 2F5DA 5FD5A 2ISZA 4L9NA 3RI4A 2CSOA 2DW4A 1MJBA 3GLXA 2Y0MA 1U8RA 2H27A 3M8FA 4ENJA 1YW9A 1B9MA 1K79A 4RS8A 4L5JA 2DPDA 4MTDA 1U5TA 1FNNA 3KE2A 5KVRA 3DXJF 1GXPA 1HW2A 4AIKA 1LNWA 3P9KA 1KQ8A 2A5YB 2VODA 5D5UB 3E5UA 3C1DA 1DDNA 3RYPA 1MGTA 5L3FA 4EMSA 4ZZLA 4NHJA 2QM3A 3FHZA 2FA5A 3ZPLA 4WF2A 5F6FA 2LF8A 1WSUA 3CLOA 2QBYA 1CF7A 5BMZA 3GFJA 1I6XA 2CWEA 1OYIA 2DQRA 2QYOA 3GFLA 2HOEA 1HW5A 5EEHA 4IVNA 1G3YA 2E7WA 3REOA 4HV5A 1LDKB 5ED4A 3GXOA 1FZPB 4I98B 3TKYA 1YYVA 1B6AA 3BROA 4M9XA 4HOBA 2VBXA 4UUVA 4Y15A 3WG9A 4KA4A 2O0YA 1DUXC 2G9WA 1YQAA 4I02A 4G94A 2QQAA 3ZMUA 3WTVC 1ZAOA 2G7UA 3G3ZA 4CGZA 5AIPA 5ICEA 1R00A 3ML6A 5FD6A 4ESBA 2PFBA 4HBLA 5F1RA 1MJAA 1WQ2A 2FE3A 1DP7P 3SXYA 3DV8A 2ETHA 5E18F 4HX7A 4LG0A 1BC8C 1ZGJA 3Q9SA 3GW2A 1ZREA 4M9ZA 3QAHA 1NHAA 5CJ9A 3SHFA 3E5QA 3HRMA 2R7DA 4M71A 1B4AA 2QVOA 2GWRA 3DQVC 4U7BA 5DEQA 4M73A 1REPC 4A6DA 4OU0A 2BGCA 1XN7A 5ERIA 2PN6A 4EM0B 4EJTA 4OOIA 1F9NA 2EFQA 3EUHA 1KQ9A 4ENNA 3C3WA 3S2WA 1T38A 1RZ4A 2STWA 2EJRA 4KYWA 1ZARA 1ZGAA 3ZMZA 3GZ6A 1GHCA 2A61A 1BBYA 2QQ9A 1LEBA 4AWXB 3TO6A 4CZZA 4ENKA 2YX7A 5KK1A 3FXQA 1PP7U 2J5PA 3F8FA 3E6MA 4B09A 3IHUA 5J6XA 2EWNA 1ONVA 2H09A 3J80Z 1XD7A 4O6JA 1SD6A 2UZKA 1XSDA 2KRFA 2QUFA 2GXBA 2JSCA 1R1TA 5L3GA 3O6BB 2F5FA 4HF1A 4UVCA 2XROA 3RIRA 4P5OA 1SMTA 4IRGA 1YO5C 4PDKA 2ESNA 2ZXJA 2C6YA 3ECOA 5BQTA 2L02A 2EFWA 4RAYA 2BEOA 4RB0A 2MH9A 4YIFA 4LB6B 1QQIA 1QZZA 2Y48A 1P4WA 1XGMA 2FEZA 2IPQX 2JTVA 4BHPA 2NRAC 2CYYA 4N9IA 5IT9Z 4QWQA 5E1ZB 1IN7A 1KU2A 5DDGA 2ZCWA 2V79A 4P96A 2EV6A 3ZP5A 2OZ6A 1BI0A 3WTZA 3T5XA 5D5XB 2UWMA 3PFIA 2LDUA 5E1WA 1J9IA 2E7XA 1TQIA 3I59B 1YS6A 4LG0B 4CHUA 1EV7A 1GXQA 1AWCA 4RGSA 4LLGF 3F72A 1A04A 1LDJA 1IAWA 2JZYA 1I1SA 2GXGA 1YS7A 3R0JA 2R3SA 1PDNC 4L5IA 4M6XA 3RKXA 1R1VA 2K86A 4M9SA 2K4BA 5AONA 2V9VA 2XKPA 1R7JA 5H6QA 5J8FA 4U88A 3I0TA 2EA4A 4R1HA 1QZYA 3JAMZ 5FLXZ 2ZO4A 4HYEA 3EDPA 5JFRA 2YX4A 1O7FA 3NQOA 5ILVA 3FMQA 5F64A 3EYYA 3K9TA 4JQFA 4WWCA 2DPUA 2OBPA 1ZG5A 1UHMA 3E97A 3R61A 2NYXA 3QU6A 3SQNA 1WI9A 3LAJA 3ZMTA 4F7ZA 1Z6RA 3QPHA 2M30A 1W5TA 4HF2A 2NNNA 1HW1A 4RGUA 4MQVA 3QP6A 1KU7A 1OYWA 1R58A 2P4WA 4EQQA 2M87A 1LVAA 1WKMA 4KN7X 3VODA 4ON0A 2LF7A 2Z9OA 1FLIA 4KDPA 4IF4A 1H9TA 4OMYA 4MHGA 3P9CA 4L9VA 3BOQA 5A2QK 3LA2A 4FT8A 3GX4X 3P9IA 2ESHA 3FM3A 1O3SA 1SMYF 2XUBA 1KGSA 2HKXA 1JE8A 3WTXC 1PP8F 5DYMA 1YFHA 3EQLF 4Q48A 2HFHA 1IUYA 1EH7A 5HDGA 1FBSA 2GIVA 1FC3A 1U78A 2VC1A 3EYIA 4I0BA 4K2EA 1IN4A 1USSA 1Z6TA 3WU0A 2Z3YA 3IKTA 3E6CC 3OOPA 1USTA 1J2XA 1G3TA 3H3UA 4BYYA 3F21A 4IPAA 1S8NA 1P6RA 1BI2A 2JPBA 3B02A 2EV0A 2FBKA 4Q4ZF 4RGXA 3CUOA 3R6SA 2FSWA 3GYHX 2XAJA 1UCRA 2JRTA 1MZBA 1G4DA 1C0WA 1I1GA 4I0AA 3QPTA 3SZPA 1X3UA 4HLYA 1FY7A 2PBIA 2VXZA 2Q8KA 1BIBA 4L0YB 2KJCA 1TNSA 1XB4A 3E6DA 1J7KA 3TDZC 5LGUA 1V3FA 1F4KA 1XGNA 2Q0OA 2HTJA 4PCQA 2WV0A 2G7HA 2RDPA 2H94A 1ZG1A 1ZYRF 3GUDA 5DUIA 4MEYF 1L3LA 4GO1A 2XAFA 4M74A 4ETSA 3V8LA 2VBZA 2D2WA 2OAZA 4RB3C 2YR2A 3JSPA 4KN4X 2V1XA 4KIFA 1FYLA 5LLQA 1IN5A 4HV6A 2O3FA 4B8XA 3HSRA 1K78B 1Z9CA 2OA4A 1OYYA 3JTGA 3N4MA 4OIQF 5DD8A 3IWZA 2OU2A 1Z1DA 5AIQA 5DV5A 2ADUA 1LB2A 4KMUX 1KU3A 2ZFWA 3RKWA 4R79A 5LEKA 3RTRA 4I2OA 4G6QA 5JR3A 1U6GA 3TDUC 3WGIA 2TDXA 5LGNA 3GEZA 3KEOA 2P5VA 3QU3A 3ELKA 2E1NA 3F6VA 3L00A 2HGCA 4BQAA 1DPUA 4IRHA 2DLLA 1MJ9A 1H0MA 3BY6A 1UB9A 2Y75A 2KKOA 2W84A 2BBYA 4GCVA 3V4GA 1B1BA 1WWXA 3F8MA 4OINF 3TQNA 3F6OA 5J8CA 3I53A 1W7PD 5H20A 2KIFA 3KLOA 4HX4A 1SFXA 1Z05A 4YIIA 3CJNA 1MD0A 3QP5A 1E17A 4KUMA 1ON1A 3M9AA 1T0FA 3K2ZA 2H6BA 2XKOA 4HW0A 4RB2C 3VEPA 3C7JA 1R22A 3GO5A 3HIFA 2KJBA 3D5LA 1LQ1A 2DFIA 2MA3A 4N9HA 3I59A 3TOAA 2A68F 4XSZF 4QLCU 3LQQA 4RB1A 2L4AA 1F5TA 4YG2F 3RYRA 4KFCA 1H9GA 2P6TA 3AAFA 4S05A 1XCVA 1STZA 1T98A 4OIRF 3WGGA 1D3YA 1LDDA 1RI7A 4WXHA 2FMLA 4L18B 2IP2A 3IL2A 4PZJA 4D0PA 3HRUA 1T2KA 5D4SA 2AS5F 4AIJA 2MLKA 3EETA 3O3KA 3HTSB 3BZ6A 4HLXA 2PLYA 3M1EA 2PJPA 4A5MA 4U0YA 4BXUA 2FOKA 2FXAA 1OKRA 1TW2A 5HLGA 2M45A 3T1BA 1Z7UA 3V7SA 3SZTA 2Z5UA 5E20A 2VC0A 2MC3A 2VN2A 1ZG3A 1L0OC 3H92A 4CICA 3DP7A 4LD5A 5K1YA 4XLPF 2PG4A 2IA1A 4G7HF 2RQPA 1PUEE 2K4JA 3GF2A 2PEXA 3MCZA 4EGYA 2BV6A 4M72A 3RPQA 3GWZA 4BNCA 4P9UA 2O8XA 4UXNA 4HQEA 3KCCA 1Y0UA 4KIBA 1D8JA 1ZN2A 2XV4S 3M7GA 3KP5A 3U1DA 1XGSA 3K1NA 4EJWA 5D5WB 4Q5SF 3CDHA 3W6KB 4MGRA 3JTHA 5HOOA 4ZYGA 1RUOA 2KIUA 4TV7A 1JHHA 1HKSA 1HSJA 1HKQA 4UVAA 1SD4A 5LGTA 5HDKA 4A0ZA 4BAYA 2CFXA 2VBWA 3R0AA 1G3SA 1IXSB 2A69F 2F5EA 1IRFA 1I27A 1YTYA 2EV5A 4O3MA 2VOOA 2L54A 1BN5A 4HF0A 1BM9A 2P7VB 5K5OA 2L4MA 2QZ8A 3NEUA 2EB7A 2M5WA 5JVTA 4IHTA 1O3TA 2HR3A 2PMHA 1YW8A 3ULQB 3R60A 4PGGA 2F5CA 4U0WA 5CVIA 3BJAA 2DBBA 5HS7A 1JHFA 1Q1HA 3L7WA 4ESJA 1FWZA 1ULYA 2VBYA 2QQBA 3I4PA 3P7NA 5DCMB 4A0YA 5HS9A 2YPRA 3WTWC 4M6YA 1HXDA 5CYVA 3F22A 1XGOA 2CW0F 3TO7A 4OIPF 1ZRDA 5CLSA 3I71A
chains in the Genus database with same CATH superfamily
4ZDLA 2Q2EA 1RNLA 1I5ZA 3JREA 3HOUJ 4II2A 1Z0XA 2JQ7A 1P2FA 1N78A 4LFUA 3H3ZA 1DGWY 2XASA 1ODDA 2NAZA 2W25A 4IZZA 3PUBA 2KIMA 3C2HA 2CH0A 2COBA 4HNUA 4BGDA 3CCYA 3LOCA 4BH9A 1LFBA 1WH5A 1QHHD 2W57A 3PO3J 4HA8A 2WWYA 3B6CA 3FZVA 4XRSG 1MBKA 3KZYA 2NS8A 1U5TC 5H6RA 1GVJA 3F23A 1DP3A 3X2QH 1JXSA 1S3JA 4EM1A 3BP8A 4CO8A 5D4RA 2ISYA 2HWVA 2XSJC 3VB2A 2DU9A 3MKYB 3VFZA 2GA2A 2O9LA 2GLOA 1KYZA 2COMA 1PJRA 3OR2C 1YW7A 4CUGA 3Q9VA 1LFUP 1IXRC 1XX5A 3KFWX 1K78A 3FMRA 1VQ8I 3RKQA 3FBNB 2HZTA 2K7LA 5E1XA 2DI3A 3H0DA 1HKTA 1OQYA 3CTAA 4BQOA 5KCMA 1NTCA 5IPAA 4NC6A 4I6ZA 2R5YB 1SAXA 3DF8A 5IYDJ 2BY1A 2WB1N 2A6HF 1U9NA 1JTXA 5K5QA 3KPHA 2AXTC 4CCJA 1R4NB 3FIWA 3QRFF 2O6GE 1EA3A 3D1NI 2HOAA 1BW5A 5HVQC 2DJNA 1YX5A 4HDUA 2NOJB 2R93J 3IV5A 3RDIA 2KMUA 2WB1A 2XAQA 2UUZA 1ETKA 4MTEA 3E5XA 3I4MJ 2FNAA 2RGVA 3FBIB 1O3QA 4LLNA 4A6EA 5A2QZ 2ELHA 4Y13A 3M8JA 2A6EF 5BPDA 1F1ZA 2OV7A 3VSKA 2PJRA 2JT1A 2ID3A 1ZR2A 2DCEA 3ESWB 3ABUA 2ZFUA 4DBRA 3J7ZI 3ZGKA 2DQLA 1W4MA 1SFEA 3OYMA 5CVUA 2EFOA 1HSTA 2FBIA 2CMPA 2FF4A 5FLMJ 2ICWG 1WCMJ 1EH6A 1DU0A 1WI3A 5JVGF 3ISPA 1K61A 4Y17A 2LC2A 1TWHJ 5LBQA 1IRGA 5LD2C 1VQ4I 5EG0B 2E19A 3OIOA 4XKBA 4DOZA 2GZWA 2CJJA 3RPUA 3MEXA 2F4OB 4BE2A 3H3VK 1FPQA 1J0RA 4P55A 4IOCF 3QODA 1LE8B 1IN8A 1B59A 1B72A 2Y9YA 1MW7A 2EZKA 4EJVA 1YRNA 4A3JJ 4BUPA 2M34A 1T6SA 2EFPA 1UFMA 5M3FJ 4ESFA 2D1HA 1YITI 1AA7A 3HSFA 2LP0A 4XSXF 3VYSB 1K4SA 1NK2P 3KZZA 2MW8A 3I54A 3IP4B 2CG4A 3PNYA 1K83J 3J81K 4BHCA 4IJAA 3PQKA 3E1SA 1WPKA 3FXJA 1AHDP 2Y0SN 3BJOA 5GTHC 4P1WA 2DMNA 2K9QA 4C9YA 2H8WA 3DCFA 3TGNA 2RKHA 3IRQA 3NAUA 2IA0A 2YU3A 4XLHA 3BCBA 5LHIA 2XSDC 2RQQA 3GTMJ 2JSPA 3L9FA 2HYFA 2JUCA 2K9NA 2Y0SA 3IUOA 4LITA 3L2QA 3FWEA 2B0LA 5JLXA 4DYQA 3ZQFA 4HDVA 5EGOA 2M1BA 3T0YA 5L3DA 3RJPA 4KNYA 1XMKA 3CMMA 1TWCJ 1TWAJ 3KETA 2R5ZB 4CCOA 1KZHA 5H2FC 4G12A 3LWFA 1YIOA 2DODA 5CVVA 1V55H 4MNUA 3ZN0A 4A3IJ 2AO9A 1I6HJ 2DOFA 2HKOA 2HEOA 1W5CC 4KT5C 2DAOA 1R4MB 4ZTFA 5EEGA 2CUEA 4B44A 5HLIA 4KITB 1JJ6C 1Y8RB 1P4XA 3N97A 3T8RA 3FXOA 4XRFA 2VE9A 4ZYDA 1OPCA 3SFZA 3WU2C 3OMYA 1TBXA 3F8BA 4RM3A 4Y3OA 2HVSA 1BI3A 2HQAA 2K9SA 5CVJA 2E2JJ 1RRJA 1XTAA 1K6YA 4GFBA 2O61A 1KU9A 2QSHX 1VQLI 1XMAA 4L0ZB 1QGPA 2P7CB 4FE7A 3G71I 3K69A 2RN7A 3MQ0A 3BPXA 3FXRA 4X1EA 5D6EA 3HKZN 2MSYA 3LNQA 1P7IA 1T56A 4KIGA 2E2HJ 2KFDA 4KMFA 4E7ZA 3CUQC 3CDIA 2IT0A 1AOYA 3BR3A 1U2WA 1O7LA 4YELA 2DT5A 2P5KA 1IO2A 5E8IA 4A5NA 3I5UA 5FFXA 3HKZA 2IGKA 4H0EA 2D1VA 5IP7J 3J7YJ 3GFMA 4CYDA 5DUKA 2QENA 4FQGA 3JSOA 2YU9J 3LFKA 4GXOA 2V4JC 1BIAA 3BCAA 3H1CA 2BXZA 3S2HJ 1DPRA 4WXCA 2AXLA 2CO5A 2FQ3A 3FXKA 2HI3A 2VKDA 3WODF 5J1RA 4EVIA 1WRJA 4JBAA 2X4HA 5ILUA 1G59A 1S7EA 3ZMVA 2CQQA 3UNGC 3PJRA 4E4HA 2CFOA 2E1CA 3A01A 3BR5A 1UG2A 3UKGA 1QPMA 1Y0NA 3ZMDA 2AHQA 4IKFA 1ZRFA 3ASOH 1VQKI 3KP7A 1UG0A 4RGRA 2JN6A 4V2GA 1HDPA 2M8EA 5D6FA 1KQ0A 4IQ4A 4B47A 4G6DA 1SFUA 3F9KA 4IL6C 1R49A 4LGWA 2W7NA 1XC5A 4ZZDA 3CC4I 1FMVA 3FF5A 5ICFA 3ZMSA 4YIRX 4XORA 4C2TA 2CW8A 2IW5A 4XLEA 3OYDA 1EH8A 3TL4X 1SVMA 3AG2H 3CC2I 1V5GA 1D0YA 3CO6C 2JVGA 5FLVA 1OCPA 3Q3SA 2XIGA 3MKWB 3DEUA 5F0CA 3COAC 4H4KC 5E3OA 2OTJI 1XDSA 4LOCA 4MQ9F 1X4PA 1ZHFA 2E60A 3BDDA 2A05A 3U2RA 3L1PA 3DFGA 4O5VA 3BG5A 5HDNA 3WGHA 1YRNB 1IC8A 3F8CA 3BR6A 4RAGA 5CVRA 4M6VA 3O8HA 1WJAA 2BE5F 1S72I 4AC0A 3HHHA 4LIUA 1U3EM 3ZN1A 2W24A 1V54H 2QLZA 5J1YA 3IRRA 3L2WA 3DTIA 2P6SA 2F6CA 2H1KA 3S3OA 5F0HA 3CC7I 2IS1A 2HYGD 4XK4A 2XRNA 1JTYA 1R5ID 4BHBA 4I01A 4GYIA 4EV0A 3OYFA 3GFIA 2R7VA 2DA1A 1CGPA 2HOTA 1GV5A 1TC3C 2OF7A 2CW7A 4A3FJ 3J7AO 1WJCA 5BOXA 1MH4A 4IHSA 3WTUC 5F27A 4XR6A 4A3EJ 1NG6A 2ZMEC 1J5YA 2FD5A 2VIXA 1YG2A 4HSRA 2QCOA 3L2CA 3ZQ7A 4ZH4F 4AYBA 4Y33A 4NQWB 5LEJA 5BNGA 2XPUA 3S1NJ 5LHHA 2K02A 1RR7A 4HEA2 3MMYB 4U87A 4U7DA 5FO5A 4BY7J 1R36A 1RIOH 2P0WA 3KLNA 3GTPJ 3K1MA 3R4KA 1IZ1A 5DCMA 1K4TA 3U9GA 1E3PA 1FP1D 4GGGA 1G6NA 1TT0A 2LNBA 2PMZA 1HCRA 2E35A 4XONA 4X6AJ 3QOPA 3DBRB 1ZLKA 4HNTA 1YHQI 1FT9A 2IBDA 2PMUA 2RVCA 3HRSA 5EDNA 2GA1A 4PSXA 4DYRA 3GTLJ 4J19A 3CD6I 2B9SA 4A3DJ 1X58A 1R5GA 4XN3A 2M9HA 1OR7A 3BT9A 5GAHJ 3ERED 5FKNA 3FK7A 4UB8C 2QA4I 1V5FA 2DDBA 1R5HA 2J5OA 3JCUC 1XDUA 4LJZF 3MFKA 1O3RA 4XLNF 2MBFA 3JW4A 3I58A 3MZYA 2K85A 1TWGJ 4UNOA 4EGZA 5EEAA 2DK5A 4A0XA 4P9FA 4J01A 1W7PB 4MEXF 4ZDOA 2H6CA 4UV9A 2PQ8A 3WTTC 5HS8A 2V9PA 3HOSA 2OD5A 3FISA 3V8KA 1XSVA 1OCZH 6PAXA 3HHGA 2K9MA 2Z99A 4LMYA 1VQ6I 3IKVA 4JK1X 5K5RA 2JA6J 3ONQA 1J75A 4N4OB 1S7OA 1TLHB 1D5YA 1TQPA 4PGHA 4CYCB 1AU7A 1E3OC 3HDDA 1HOMA 2JPCA 1KA8A 2XF6A 2VASA 3NWTA 2FRHA 2O03A 1MKMA 1WJ5A 5DCFA 3RKYA 3HYIA 3MZHA 4FHTA 1JKQC 2R5YA 2VOPA 3OS0A 1U5TB 5GAEJ 4G7OF 2MFZA 3F3XA 2OJED 4YFKF 1VI0A 4IRIA 1VQ9I 3LA7A 1BI1A 5M5YJ 4ZYHA 3CUQA 2B63J 4DNCA 1T33A 3ZQQA 3DTEA 2VT2A 2K27A 4ASNA 5FKKA 3M3YJ 3FXLA 5HLHA 2GQQA 2FNPA 2YS9A 4XLFA 3WE3A 2STTA 3BPVA 3OYNA 2NS7A 3KP4A 2EA2A 1MMSA 2W85A 2WY8Q 4CDGA 3MN2A 5D5VB 4E7LA 3J80K 2X6XA 4L9JA 3ECHA 4FETA 2D45A 3OYBA 3B73A 1IW7F 3I4NJ 2CV2A 2BXYA 4D1QA 3G4SI 4BBSJ 1YI2I 4C3IJ 2QBYB 2IGMA 3GVAA 1CF7B 1R9TJ 3L2UA 3E3VA 4GYGA 1YLFA 4BJ6C 1D5VA 2XVCA 3PIOF 1XMXA 3SDBA 3WTSC 1RESA 5L3EA 4AD9A 4MIMA 2ZKZA 2IS2A 2M7AA 1MDMA 1H89C 4ZYEA 1ETVA 3A0HC 2PI0A 3DBLB 3E6BA 4E70A 4F52A 3CZ6A 1BC7C 3ABTA 4L9TA 5EG0A 1T39A 2RREA 2EFNA 2BYVE 3QWLA 2HZDA 5M3MJ 5BPIA 1ZR4A 1P7JA 4G7ZF 3BC8A 2OQRA 3WE2A 4FE4A 1BJAA 4Q47A 4M3DA 1LE8A 1ZLJA 2GOMA 1BA5A 4AIDA 1QBJA 2V6CA 5FKLA 1FSHA 1FJLA 1XPXA 5IT3A 3I64A 1W36D 2DDAA 1BOAA 2VPRA 3FX3A 3LSKA 5B5EC 5IT9K 2DOAA 1IRZA 2XHKA 1X3ZB 2X48A 1R23A 4KISA 1P4AA 3EUAA 3OYAA 1ON2A 5E8GA 4AVPA 2NNYA 4HZFA 4S04A 2RNJA 3BQYA 5IY5H 1KYWA 4RM2A 3D0SA 2IRFG 1FP2A 3FM5A 3BJ6A 4HPQA 1SEUA 2E71A 1WVRA 2VJIA 5GADJ 1V4RA 3M1CA 1HBXG 4BE1A 2X1CA 3OSGA 4XBFA 2IVMA 2GAUA 2XGXA 2EK5A 2V1DA 3QYEA 1SFOJ 3KP6A 4J00A 3LL7A 3L09A 1S29A 3GTQJ 2ELJA 4HAMA 1D8KA 5FGMA 3LA3A 2RV8A 3S1RJ 3ZRGA 1WGXA 3ZOBA 5J4VA 1ZRCA 2OQGA 2RC4A 3Q5FA 4ZYAA 3HSEA 3T8TA 3TO9A 1UAAA 2K3PA 2W48A 4R8HA 1ERDA 1YJ9I 4UHTA 4EM2A 2UXXA 2FQ4A 4CCNA 1J59A 2M0CA 5B1BH 2YSRA 3DKYA 5CQEA 1TTYA 1RETA 5L3CA 2ZMEA 3H5RA 1K6OA 1JT0A 4F93B 1OISA 4DQ2A 3FMSA 3CCSI 2FMYA 2VE8A 3W2VA 3CCJI 3HOZJ 1FOXA 1Z91A 4QIWN 1KONA 2EIJH 3IWFA 3G73A 1QNTA 4NB5A 2DOEA 3JRIA 3DBHB 2DTRA 3WU1B 3V7CA 3CCMI 3F0CA 1MBJA 1XSXA 4M3EA 3H9GA 3V42A 1T8IA 1OCTC 2DA7A 2P5LC 4WXDA 1Y39A 1B9NA 2LKPA 3HUGA 4IHXA 2HQRA 3W3CA 3KP2A 3GZ5A 4LK1F 2WTEA 3JAMK 5FLXK 1FYKA 4QSHA 1OFCX 4EJUA 1IF1A 1W5SA 2XGEA 3AFHA 2DJIA 4IO9F 2VB6A 3L2RA 2HDDA 1FSEA 3CO7C 3BG3A 4BEHA 2R7FA 4WK8F 3OYKA 3OV8A 1FOWA 1LEAA 3V8JA 2DFEA 1TQMA 2FU4A 2MC4A 3PQJA 4X0GA 1ZKGA 4EJOA 2ECCA 1SD5A 2X0LA 4UVBA 1RUNA 4IXAA 2EPFA 2FJ1A 3RQIA 4YFXF 5J3LA 3SDGA 1TW3A 3ZCOA 4CXFA 3WTYC 2OZUA 2MGQA 5M5XJ 2WA0A 1DU6A 3LFUA 4AIHA 5L3BA 3S17J 2DO7A 1I50J 1VTNC 1FBUA 3NRVA 2HQNA 3K4KA 5E79C 2R7ZJ 3CUQB 4Z2YA 4C3JJ 1HC8A 3MD2A 3DPTA 1G3WA 4XOPA 4LIVA 1QO0D 3DTKA 4B3AA 2V1UA 2EBIA 1HDDC 3I56I 4ITVA 4N0BA 2KRHA 3D5RC 3G1OA 2X6YA 1WJDA 2QKMB 1YJWI 2EILH 3O8GA 2VPLA 4BY1J 1FBQA 2HYJA 2VLAA 3ABLH 4OMZA 3HRTA 5JHUA 4IEJA 2EIKH 2OPTA 1ETXA 3S8PA 2ZJ2A 1FX7A 1S7AA 3KEQA 5B66C 2MLGA 3LSTA 4A12A 2DN0A 2IA2A 5K7HA 1HQCA 2GOXB 4BL0B 4HX8A 2Z33A 5FFZA 3HB9A 1JKPC 2R7QA 2IJLA 2XAHA 2ZNYA 3TW6A 3U21A 3LAPA 2JA7J 2L0KA 3AG1H 1MDMB 1S6LA 1GDTA 3C18A 2XB0X 1P92A 2LR8A 3IC7A 4RAFA 4HQMA 5ICCA 1SC7A 3LSGA 1T0FC 2DYSH 4G9YA 1IXCA 2NS0A 1Q1VA 3LSJA 5HNHA 1RKWA 2R7SA 2MD5A 4U0VA 1X1PA 2A5WA 1MBFA 3K4BA 1OMIA 4WCGA 4E7KA 5D8KB 2XF7A 2ZNZA 3IH4A 2FBHA 4HRIA 4IX7A 2A07F 5ICGA 3AG3H 3ROUA 1Y8QB 4FX0A 3CCLI 3WHBA 2MABA 4ENMA 1O57A 2LTPA 4UB6C 4G6TB 2KDZA 1K7AA 1T08B 3H5AA 1LFPA 3HGGA 1FIAA 1XCBA 2WC2A 2KHMA 2XGCA 3IH3A 2ACJA 1F43A 3HOTA 4G8XA 3J81Z 2XAGA 4YRVA 1HLVA 4UUTA 5E17F 2WAQN 3A4CA 5TJJA 2A3SA 3DKXA 3C2BA 2QGUA 2LSOA 3VOEA 5TRDA 4LB5A 5LRRA 1ZK8A 3V7RA 2LLKA 1JUPA 3HTUA 3K6GA 1Z3XA 5D8LB 4RLFA 2DK8A 3M8EA 4UY8I 2VONA 3I55I 2MH2A 5JHFA 2WAQA 3VYUB 1IN6A 4LK0F 4NQWA 2HDCA 2E34A 3BWGA 1R1UA 3MKLA 4F55A 2L7MP 1W0TA 3W6JB 2JK3A 2CGPA 3MZ8A 4FX4A 4I09A 3F8NA 4B3XA 2VT3A 2CS3A 2CQKA 3H5NA 4BXFA 4UV8A 4A2UA 4JX6A 3DLLF 3BZKA 4ANJA 2KZVA 3LSMA 1VQNI 3H9QA 5LRSA 1ZH5A 4AM3A 2ZMEB 1FOKA 1X4OA 1OCCH 1UMQA 1QU3A 4C3HJ 5BS6A 2M4KA 3EUHC 3PIPF 3PNTA 2K3FA 1SD7A 2P81A 1QPIA 3LQRA 4WX9A 2L3DA 4RAZA 1LJ9A 2QWWA 2BOLA 2ZBKA 5GPAA 4YFNF 5FB2A 3J7AY 2P8TA 3KP3A 3D5SC 2CQ7A 1TNTA 4XN0A 3K0LA 2EZHA 5FROA 1JT6A 3HUGB 1TT5B 2DTZA 4I7HA 4FCYA 3MAJA 5ILSA 2F2EA 2DA6A 1FYMA 2O7OA 3EPZA 1SVOA 3BG9A 2HS5A 3FXUA 3DWLE 3DKWA 3K1PA 4B1RA 5FKOA 4CH7A 3GTKJ 4NC8A 2UXNA 3O2PE 4XQFA 1LVKA 1UHWA 3VSLA 3MWMA 3RPUD 2M7BA 1W7PA 4LLLA 2LG4A 1JGSA 5JI6A 3OS2A 3TEDA 2L5QA 5LHGA 1X19A 2L01A 4BEHB 5EZHA 3A0BC 3L2VA 2HTSA 1BR4A 4OIOF 4KICA 2VXDA 4XRMA 3QPSA 1LUJB 1E2XA 3TOBA 3DPLC 1GV2A 2NXNB 1MSFC 5DD4A 2F5DA 4W1UA 2R0QC 4AVZA 5FD5A 2ISZA 4L9NA 4MO7A 3RI4A 3PO2J 2CSOA 2DW4A 1MJBA 3BR0A 3GLXA 4CYCA 2Y0MA 1U8RA 2H27A 3M8FA 4C30A 4ENJA 3ZQCA 1YW9A 1B9MA 4IHYA 1K79A 4RS8A 1TP4A 3ABMH 4L5JA 2DPDA 4MTDA 1U5TA 1FNNA 2KIQA 3KE2A 1B8IB 2KRCA 5KVRA 2ME0A 2OC6A 3DXJF 1GXPA 1HW2A 3OS1A 1X1CA 4AIKA 1LNWA 3P9KA 3DU6A 2LD5A 1KQ8A 2A5YB 2VODA 5D5UB 3E5UA 3C1DA 4XNFA 2I10A 1DDNA 3RYPA 1MGTA 5L3FA 4EMSA 4ZZLA 1UZCA 4A3BJ 4NHJA 5C4XJ 2QM3A 2LREA 1IDZA 2HXOA 3FHZA 2FA5A 4S0HB 2KLOA 2X6OA 3ZPLA 2V6EA 4BQNA 1V5EA 3GLLA 3CCQI 4WF2A 4OAYA 5K7FA 5F6FA 2LF8A 1RC9A 3CLOA 3QOEA 1WSUA 2QBYA 1CF7A 5BMZA 3GFJA 4XLAA 4PJMA 4BDYA 1G2HA 3CMAI 2CUZA 1I6XA 3SJMA 2CWEA 1OYIA 2DQRA 2QYOA 3GFLA 3N05A 2HOEA 4PJLA 1HW5A 2TRTA 2H1LA 2Z16A 5EEHA 4IVNA 5E3NA 1QZEA 3OY9A 1G3YA 2E7WA 3REOA 4HV5A 3H35A 3RZOJ 1LDKB 5ED4A 3GXOA 1APLC 1FZPB 1D1CA 4I98B 1MH3A 3TKYA 1YYVA 1B6AA 1BL0A 3BROA 2B7EA 3JRGA 4M9XA 4HOBA 2HPIA 2ELKA 4C2UA 2VBXA 4BKXA 5EZGA 4UUVA 2CUFA 3HPHA 1UJ8A 4Y15A 2CV1A 4F91B 3W2WA 3OR1C 3WG9A 4KA4A 2O0YA 2WAEA 2CUJA 3KIOA 2GM4A 3ASNH 2N8GA 4AYBN 1DUXC 2G9WA 1YQAA 2FX0A 4I02A 4G94A 2QQAA 3ZMUA 2OUMA 3WTVC 1ZAOA 2E2IJ 1QVUA 2XF5A 2G7UA 3G3ZA 1ETQA 4CGZA 5AIPA 2F4IA 5ICEA 1R00A 2YUSA 3ML6A 5FD6A 2V26A 4ESBA 1RR8C 2PFBA 4HBLA 3OYIA 3S32A 5F1RA 4E7IA 1MJAA 2MG4A 1WQ2A 2E36A 3PNVA 2CV0A 3OL4A 3S93A 2PMZN 4HNVA 2ZSHB 5J4YA 2VKEA 1VZ0A 2FE3A 3RZDJ 1MNMC 4NUBA 1DP7P 1A6QA 3SXYA 1MNEA 3DV8A 5GAGJ 2CQNA 1VNDA 2ETHA 5E18F 4HX7A 4D7NA 2FOWA 4LG0A 5KHDA 1BC8C 1ZGJA 4DW6A 4D7MA 3Q9SA 1BR1A 3GW2A 2X51A 1NG7A 3M07A 1ZREA 4M9ZA 3SFIA 3QAHA 3CF5F 1NHAA 1J09A 5CJ9A 3SHFA 1FMWA 3HOXJ 1A35A 4IQJA 3E5QA 3HRMA 2E5NA 2R7DA 4E7SA 2ZXHA 3HOVJ 4M71A 2ZB9A 2NOGA 1TL8A 3S15J 1B4AA 2QVOA 2DA5A 2L9SA 2GWRA 3DQVC 1PUFB 4U7BA 4XL9A 5DEQA 4M73A 1REPC 4D5CA 1A36A 2IS6A 4BACA 3CMEI 4A6DA 1ZQ3P 3AL0C 1POGA 4OU0A 2BGCA 1XN7A 2WADA 5ERIA 1H8AC 4QPQA 4YEJA 3WHCA 2G0EA 4DYCA 3CF2A 5LFAA 1IRXA 3RSNA 2PN6A 4EM0B 3GTGJ 4XICA 1SVLA 3PM1A 1UELB 4MFEA 4OOIA 4EJTA 1YE9A 1F9NA 1JKRC 2EQRA 2IS4A 2EFQA 3EUHA 1VF9A 3FHNA 2V1NA 1KQ9A 4ENNA 3C3WA 2IXSA 2I5UA 1ENHA 3S2WA 1FEXA 5FRNA 2E1MC 3FK6A 1T38A 3NARA 2OCCH 1QHGA 5HNFA 1GUUA 1RZ4A 3JRAA 2STWA 2LKSA 3LSIA 2EJRA 4KYWA 4CA0A 1P9QC 2NVTJ 1ZARA 4QPOA 1ZGAA 3CJRB 3ZMZA 2BHYA 3GZ6A 2JJ7A 3DEEA 3SEQA 1GHCA 2A61A 1VQ7I 1MNDA 1BBYA 2LKXA 2HQ5A 1JKOC 1WHUA 2QQ9A 3Q0VA 4DGWB 1BW6A 1LEBA 4GDFA 4AWXB 3TO6A 3TMOA 4CZZA 2M3AA 4ENKA 1A31A 2YX7A 5KK1A 2XGDA 4IOAF 3TP0A 3S3MA 4I99C 3FXQA 1WZ2A 3E7LA 1PP7U 2J5PA 2LK2A 3F8FA 3E6MA 4B09A 3IHUA 3JRCA 5J6XA 3CQZJ 2EWNA 5EJCA 1G8XA 1ONVA 2UV1A 1VQMI 2HOSA 2H09A 3J80Z 1XD7A 2QF7A 1SD6A 4O6JA 3OYJA 2O5RA 2UZKA 5CPRB 3CP8A 1XSDA 4Y52J 2KRFA 2QUFA 2DA4A 2E5ZA 4RLQA 2GXBA 4XOTA 2JSCA 3HOWJ 1R1TA 3O6BB 5L3GA 2BVLA 2F5FA 1AKHB 3GZNB 3DLAA 3ZR8X 4HF1A 1XG1A 2GBYA 1JUMA 4UVCA 2XROA 3BTJA 3RIRA 5JLWA 4P5OA 2X6WA 4JOMA 1SMTA 4IRGA 3I9V2 4BJ5C 1YO5C 2R4GA 3VYTB 4PDKA 3BTLA 1OLTA 2ESNA 3K4CA 2F4MB 2ZXJA 2C6YA 3ECOA 4F3QA 5BQTA 1A6IA 3KYCB 2L02A 3GMEA 2EFWA 3HGYA 4RAYA 2BEOA 4RB0A 2GXAA 2MH9A 4YIFA 4CZCA 4LB6B 1QQIA 1QZZA 2Y48A 3QYFA 1MIJA 1P4WA 2X1EA 1XGMA 2FEZA 2IPQX 2KPMA 2JTVA 4BHPA 3HEFA 2NRAC 1ETOA 2CYYA 2DYRH 4XKWA 4N9IA 5DM6F 2LFBA 5IT9Z 4QWQA 3G6EI 2L9NA 5E1ZB 1WJFA 1IN7A 1KU2A 3UR3C 4UUSB 5DDGA 2JA8J 2ZCWA 2V79A 4P96A 2EV6A 3ZP5A 2OZ6A 2X1DA 3OIQA 1BI0A 3NWSA 3WTZA 4BU2A 3A1YA 3T5XA 5D5XB 2UWMA 3W6VA 4A3LJ 3PFIA 2QQ8A 3KZIC 2LDUA 5E1WA 1J9IA 2E7XA 1TQIA 3HPGA 3I59B 1D1BA 3BR2A 1YS6A 3Q0WA 4LG0B 3C2GA 1IUFA 1CQTA 3CJTB 5IP9J 4CHUA 1EF4A 1EV7A 1GXQA 1AWCA 4PFPA 3ZQGA 1VQPI 4RGSA 3HG9A 1RKTA 4LLGF 3F72A 3OL3A 1A04A 1LDJA 1IAWA 2L9RA 2JZYA 1I1SA 2GXGA 1YS7A 3QYBA 3R0JA 2EH3A 3K7AJ 2R3SA 4XMYA 2KZGA 1OJLA 4L5IA 4M6XA 1MBHA 4LG3A 1PVEA 1PDNC 4BXXJ 2NVYJ 4V19K 3RKXA 1R1VA 2K86A 4M9SA 1I3AA 2K4BA 1Z7LA 5AONA 1M1EB 2ZXIA 2V9VA 2XKPA 1R7JA 4AU7A 4FASD 5KAFC 5H6QA 5J8FA 2R92J 4U88A 3I0TA 1H88C 5J1UA 3IAS2 2EA4A 4R1HA 4Y4RA 5B1AH 1QZYA 3JAMZ 2RNGA 4XKCA 5FLXZ 2ZO4A 1E3HA 4HYEA 4DZJA 3EDPA 5JFRA 1ETWA 1Z77A 2YX4A 4NNJA 1IG7A 1N75A 1SAUA 1O7FA 2QEXI 3NQOA 4KT6A 5ILVA 3FMQA 4RMNA 3QPLA 5F64A 4MLOA 4N4NB 3EYYA 4IHWA 3K9TA 4JX5A 4JQFA 4WWCA 2LYCA 3K2AA 3P5JA 3VDXA 1Z67A 2K9LA 5FJ8J 2DPUA 3CLQA 2OBPA 3RQ4A 2RAEA 1ZG5A 1UHMA 5F08A 3I3LA 3E97A 3R61A 3SYTA 2NYXA 5TGTA 3LSRA 3QU6A 3SQNA 3H0GJ 4Y7NJ 3OSFA 1WI9A 3LAJA 3BZCA 3ZMTA 3DU5A 3CESA 1Z6RA 3QPHA 4F7ZA 2M30A 1B8IA 4HG2A 1S5LC 4RBOA 1IV8A 1W5TA 4ZC3A 3BG7A 4HF2A 2NNNA 4CCKA 1IJWC 3WG7H 1MBGA 4ZJZA 1HW1A 4RGUA 4MQVA 4BE0A 3QP6A 2R7RA 2QKLB 1OYWA 1R58A 2P4WA 2VJJA 3HC7A 4XKVA 4EQQA 1KU7A 2M87A 2LRDA 2BY3A 1LVAA 4W97A 3Q0UA 1WKMA 4KN7X 2LY1A 2HU9A 3VODA 1O4XA 4ON0A 2LF7A 2Z9OA 1FLIA 2K40A 4QTRA 4KDPA 4IF4A 4PJNA 4DJAA 5C44J 4A3KJ 1H9TA 4PSWA 4IHVA 2A6TA 4OMYA 5EYRA 4MHGA 4M3GA 3P9CA 2CRGA 1JUSA 3BOQA 4L9VA 1LPQA 3LA2A 4FT8A 5A2QK 3GX4X 2VQCA 3P9IA 1QVTA 2ESHA 3FM3A 1O3SA 1SMYF 2ZC2A 2Z2SB 3TBIA 2XUBA 4BS9A 2KISA 1KGSA 4L5EA 2HKXA 1JE8A 3WTXC 1PP8F 3K4MA 5DYMA 1YFHA 3EQLF 3BLYA 3BTCA 5CQGA 3HXLA 3LMMA 1ACIA 1EJ9A 4Q48A 2VI6A 1Y6IA 2HFHA 2OCEA 3S14J 3S1MJ 1YIJI 2H8RA 1IUYA 1EH7A 5HDGA 1FBSA 3CCVI 1JI8A 3A03A 2GIVA 1OCRH 1FC3A 3U1KA 1QRYA 2R7TA 1U78A 2W4SA 2VC1A 3AG4H 1W1WE 3EYIA 1U0JA 4I0BA 4K2EA 3OYGA 1Y1VJ 1IN4A 2EZLA 5KAIC 1LKXA 2LH9A 1USSA 2VL8A 1Z6TA 3WU0A 2JUGA 5IP6A 2Z3YA 3BTIA 2E1OA 3IKTA 3OOPA 1USTA 1J2XA 3SZGA 3E6CC 1G3TA 3H3UA 3LSHA 4BYYA 3F21A 4IPAA 3A2KA 1S8NA 1P6RA 4XLCA 1X3WB 4XRSA 1BI2A 2JPBA 2BHZA 2EV0A 3B02A 2JA5J 2FBKA 3HL2A 4Q4ZF 4RGXA 1T95A 3CUOA 2FUG2 3R6SA 2XPWA 2KP6A 3S1QJ 3EUKL 2FSWA 3VWBA 4DIQA 3FDYA 3GYHX 2XAJA 2X85A 1UCRA 2JRTA 3GTOJ 1MZBA 1TZLA 1G4DA 1C0WA 1I1GA 1OR7C 4I0AA 2AQEA 3QPTA 3SZPA 1X3UA 9ANTA 4PJ0C 2DFHA 4HLYA 1FY7A 2PBIA 2VXZA 3OYLA 4BJTA 2Q8KA 1BIBA 4L0YB 2KJCA 2R7WA 1TNSA 3K70D 1XB4A 3HM5A 3E6DA 5IYBJ 1PUFA 2Y69H 1J7KA 3TDZC 5LGUA 1S9HA 1V3FA 3AKZA 3CJQB 4BBRJ 1F4KA 1N77A 1XGNA 2Q0OA 5E3LA 2HTJA 4PCQA 2LBFB 2Q2EB 2WV0A 2G7HA 2RDPA 4DZPA 2H94A 2KDOA 2DMTA 3K4NA 2D5VA 3VYRB 2M2EA 1W36C 2DMQA 4OAZA 1ZG1A 2NVQJ 1ZYRF 1N25A 3GUDA 3PSFA 3KX2A 3LSPA 5DUIA 3B6AA 4MEYF 1L3LA 4GO1A 2XAFA 4M74A 4ETSA 2Q1ZB 1MMGA 3V8LA 2EINH 2VBZA 3PUFA 2D2WA 3PFYA 4XIDA 1I39A 1DGRM 2OAZA 3H36A 3GCMA 4V2FA 1EKEA 2YR2A 4RB3C 3JSPA 4KN4X 2V1XA 3ZQLA 4KIFA 3AL0B 2XC7A 1FYLA 4FISA 5LLQA 1PYVA 1IN5A 4Z6YA 1BR2A 5GTIC 2DA3A 4OWRB 4HV6A 2O3FA 4B8XA 5IOZA 2R7XA 4D5FA 3HSRA 1VQ5I 4CCMA 1K78B 1D0XA 1Z9CA 2OA4A 1OYYA 3JTGA 3N4MA 4RDUA 2LVSA 4OIQF 5DD8A 2HVQA 4NBQA 3IWZA 2OU2A 1Z1DA 5AIQA 5DV5A 1TWFJ 2E1MB 2ADUA 2V7FA 1LB2A 1RPWA 4KMUX 1KU3A 3FKJA 2ZFWA 5DTDA 4DBQA 3W2AA 3RKWA 2EZIA 4R79A 2VUMJ 5KNLA 5LEKA 1SANA 3H9JA 3RTRA 4I2OA 2WAFA 5IOYA 4G6QA 5JR3A 1U6GA 3TDUC 4XM3A 3BG6A 2TDXA 4F92B 2VQGA 3WGIA 2W1OA 1F36A 2XPVA 5LGNA 3GEZA 3KEOA 2P5VA 3OIPA 3QU3A 2XB5A 3ELKA 2E1NA 3F6VA 4ZTJA 4A3MJ 3ZQIA 3JRDA 2KL4A 3L00A 2HGCA 1AKHA 1MSEC 4BQAA 1W0UA 1DPUA 5M5WJ 2L2OA 4MFDA 2PJRB 4IRHA 2ZJRF 2DLLA 1MJ9A 1H0MA 3BY6A 1UB9A 2M4GA 5F04A 1XS9A 2Y75A 2KKOA 2W84A 2BBYA 2HNHA 3PL8A 1SFKA 4GCVA 2GIZA 3V4GA 1B1BA 4PFOA 1WWXA 3F8MA 2IGOA 2R7OA 3KYDB 4OINF 3TQNA 2F5VA 3F6OA 4A3CJ 5DM7F 5J8CA 1ZGWA 4D9JA 3I53A 4A3GJ 2KQRA 2Y9ZA 1W7PD 5H20A 1U9OA 2KIFA 3KLOA 4JX4A 3CCUI 4HSTA 2NVUB 4HX4A 4JYKA 1SFXA 1B72B 4BQQA 1Z05A 4YIIA 3CJNA 1Z3YA 3DPUA 1MD0A 3QP5A 4C2MJ 1E17A 1GVDA 4KUMA 1ON1A 3M9AA 1T0FA 4EATA 2X9DA 5HODA 3K2ZA 5F1JA 3GTJJ 2H6BA 4UUSA 2XKOA 2NVXJ 2L7FP 2HDWA 4HW0A 1YJNI 1HA8A 4RB2C 4KJZA 3VEPA 3C7JA 2OTLI 1R22A 3GO5A 2AQFA 3HIFA 2KJBA 3D5LA 1LQ1A 4PK4A 2DFIA 2MA3A 4N9HA 1X2MA 2CQXA 2W82A 5FKMA 1FTTA 3I59A 2PX9A 2DA2A 2DT7B 2BW3A 2M8GX 3TOAA 2A68F 4XSZF 4QLCU 3PSIA 3LQQA 4RB1A 2L4AA 1IGNA 3IAM2 4PUSA 3BQZA 1FOYA 5EF6A 2L9VA 1QA6A 1F5TA 4YG2F 3RYRA 1IV6A 3HOYJ 5EGOB 3S2DJ 4KFCA 1H9GA 2P6TA 3AAFA 4S05A 1XCVA 1STZA 1T98A 2DT6A 1MMDA 4OIRF 2MYSA 3WGGA 1D3YA 1LDDA 5F0FA 1RI7A 2DMPA 2VJ5A 4WXHA 2FMLA 4L18B 2IP2A 4M3BA 3IL2A 4PZJA 1YX3A 4D0PA 2IGNA 3K10A 3ZXSA 2JMWA 3JRFA 3HRUA 3HJEA 4ZDPA 4NDLA 1X1AA 2JRMA 1T2KA 5D4SA 2AS5F 1ZELA 4AIJA 5E3MA 2MLKA 3EETA 3O3KA 3HTSB 3BZ6A 4HLXA 3OYEA 2PLYA 3M1EA 2PJPA 1WFXA 1JGGA 2Y31A 3DEWA 4CSWA 4A5MA 4U0YA 5HLTA 4BXUA 2FOKA 3KYLA 5GPCA 1X1DA 3FKIJ 2FXAA 1Y1WJ 1OKRA 3VPRA 1TW2A 5HLGA 5FRMA 4GRIA 2M45A 2ECBA 3T1BA 1Z7UA 1MBEA 1BOBA 3V7SA 2VKHA 3SZTA 1R71A 2JA2A 1FIPA 2ZXWH 2Z5UA 3KEYA 2L7KA 1DQUA 2EIMH 3HBLA 5E20A 5J47A 2VC0A 3M4OJ 2Y30A 2MC3A 5C4JJ 2VN2A 1ETYA 2R7UA 1ZG3A 1L0OC 1X2NA 3G1LA 3H92A 5CKTA 4CICA 3MVPA 3DP7A 2WY7Q 1ITYA 4LD5A 2TCTA 5K1YA 1I3QJ 4XLPF 3CCEI 2PG4A 2IA1A 4G7HF 1A5JA 1UHSA 2RQPA 2ID6A 3JRHA 1PUEE 4A69C 2K4JA 2V9KA 3GF2A 3K70C 2Y2ZA 5J40A 1VFCA 2PEXA 3MCZA 4EGYA 3E0JB 3A01B 2BV6A 4PJJA 4M72A 4RA2A 3RPQA 1JJ8C 3ERMA 3GWZA 4BNCA 4P9UA 2LOOA 2O8XA 2WV1A 3KCCA 4UXNA 4HQEA 4E7HA 3K4JA 1Y0UA 4KIBA 4I76A 1D8JA 5K7ZA 3QQAA 1ZN2A 2XV4S 3M7GA 3KP5A 1WJBA 2HXIA 3TW7A 1WH7A 2VKVA 3U1DA 2W00A 2QSFX 1XGSA 3K1NA 4EJWA 4B4CA 5D5WB 2QSGX 4Q5SF 2ME6A 3CDHA 3GBGA 2VQLA 5C3EJ 3W6KB 4MGRA 3JTHA 5HOOA 1WJEA 5DS9A 2KT0A 4BDZA 2XRLA 4ABZA 1MMAA 4ZYGA 3TP3A 1RUOA 4FTHA 2KIUA 4E7JA 3SEZA 4TV7A 1FTZA 1JHHA 3CP2A 2XAUA 2F48A 1HKSA 1ORKA 2DXIA 1Z21A 1HSJA 1HKQA 3ABKH 4UVAA 1D0ZA 1MMNA 2WBMA 1SD4A 5LGTA 4EEFG 5HDKA 2O8KA 4A0ZA 4AUXA 4CCLA 4BAYA 3BR1A 2K5CA 3MKZA 1GT0C 2CFXA 2VBWA 3R0AA 4NC7A 1G3SA 1VQOI 1IXSB 2LMDA 4E6KG 2I8DA 2VQHA 2A69F 2F5EA 1IRFA 2BY0A 2XDVA 1I27A 3G1MA 5B3SH 2ZJPF 1YTYA 2EV5A 3S16J 4O3MA 4II3A 2VOOA 5IYCJ 1HF0A 2L54A 1BN5A 2JVHA 1U8BA 1D1AA 4HF0A 3CMYA 4M3FA 1BM9A 2P7VB 3IH2A 2DFFA 5K5OA 2HPMA 3OOUA 4A93J 1NH3A 2L4MA 2QZ8A 3K4LA 3NEUA 2EB7A 2M5WA 5TISC 2VJ4A 5JVTA 4IHTA 1YOVB 1O3TA 2HR3A 1X1BA 3A02A 2PMHA 1YW8A 3ULQB 3R60A 4PGGA 3S3NA 3CDLA 2JWTA 3FXMA 2F5CA 4U0WA 3OWTA 5GP9A 2BW3B 2IAIA 5CVIA 2HVRA 1BJZA 3BJAA 2DBBA 2BY2A 4JP0A 1IDYA 2ZJQF 1NK3P 3OYHA 2ZSIB 5HS7A 2CU7A 1JHFA 1Q1HA 3L7WA 4ESJA 2DMUA 1FWZA 1Y56A 1E0EA 1ULYA 2VBYA 2M0MA 2QQBA 1GLNA 3I4PA 3P7NA 2L7ZA 3G2BA 5DCMB 3JR9A 4A0YA 5HS9A 2LY2A 1ZTRA 2YPRA 4B48A 3OYCA 2IEKA 4B43A 3WTWC 4M6YA 1HXDA 5CYVA 3JRBA 3CCRI 2LY9A 2R5ZA 2BZTA 2MD0A 3F22A 3HZJA 1OCOH 1XGOA 3RCOA 1R6RA 2BVMA 2CW0F 2Z1DA 3TO7A 4OIPF 3ZQHA 1ZRDA 5CLSA 2LBFA 3I71A
chains in the Genus database with same CATH topology
2Q2EA 1RNLA 1I5ZA 1P2FA 4LFUA 3H3ZA 2XASA 1ODDA 2NAZA 2W25A 2KIMA 4BH9A 2W57A 4HA8A 2WWYA 3FZVA 3KZYA 1U5TC 5H6RA 1GVJA 3F23A 1JXSA 1S3JA 4EM1A 3BP8A 4CO8A 5D4RA 2ISYA 2HWVA 3VB2A 4G7OF 2DU9A 3VFZA 2GA2A 1KYZA 2COMA 1YW7A 3Q9VA 1IXRC 3KFWX 1K78A 3FMRA 2HZTA 2K7LA 5E1XA 2DI3A 1HKTA 3CTAA 1SAXA 3DF8A 2A6HF 5K5QA 3QRFF 2O6GE 5HVQC 4HDUA 3RDIA 2XAQA 4MTEA 3E5XA 2FNAA 2RGVA 1O3QA 4LLNA 4A6EA 5A2QZ 2ELHA 4Y13A 2A6EF 5BPDA 1F1ZA 2JT1A 3ABUA 2DQLA 1W4MA 1SFEA 5CVUA 2EFOA 1HSTA 2FBIA 2FF4A 1EH6A 3ISPA 4Y17A 5LBQA 1IRGA 2GZWA 3RPUA 3MEXA 1FPQA 1J0RA 4P55A 1IN8A 1B59A 4EJVA 1T6SA 2EFPA 1UFMA 4ESFA 2D1HA 3HSFA 4XSXF 3KZZA 3I54A 2CG4A 3J81K 4BHCA 4IJAA 3PQKA 3BJOA 3TGNA 2RKHA 3IRQA 2IA0A 2YU3A 5LHIA 3L9FA 2HYFA 3FWEA 2B0LA 4HDVA 2M1BA 3T0YA 5L3DA 3RJPA 4KNYA 1XMKA 3KETA 5CVVA 3LWFA 1YIOA 4MNUA 3ZN0A 2HKOA 2HEOA 4KT5C 2DAOA 5EEGA 5HLIA 1P4XA 3N97A 3T8RA 4XRFA 2VE9A 4ZYDA 1OPCA 3SFZA 1TBXA 3F8BA 1BI3A 5CVJA 2O61A 1KU9A 1XMAA 4L0ZB 1QGPA 2P7CB 3K69A 2RN7A 3MQ0A 3BPXA 3FXRA 5D6EA 4KIGA 4KMFA 3CUQC 2IT0A 1AOYA 1U2WA 1O7LA 2DT5A 2P5KA 5E8IA 4A5NA 3I5UA 5FFXA 4H0EA 2D1VA 3GFMA 4CYDA 5DUKA 2QENA 3JSOA 3LFKA 4GXOA 1BIAA 1DPRA 4WXCA 2AXLA 2CO5A 2FQ3A 3WODF 4EVIA 1WRJA 4JBAA 2X4HA 5ILUA 3ZMVA 2E1CA 1QPMA 3ZMDA 1ZRFA 3KP7A 4RGRA 2M8EA 5D6FA 1KQ0A 4G6DA 1SFUA 4LGWA 4ZZDA 3FF5A 5ICFA 3ZMSA 2IW5A 1EH8A 3CO6C 2XIGA 3DEUA 3COAC 1XDSA 4MQ9F 1ZHFA 3BDDA 3U2RA 3DFGA 4O5VA 5HDNA 3WGHA 3F8CA 5CVRA 2BE5F 3HHHA 1U3EM 3ZN1A 2W24A 2QLZA 3IRRA 2P6SA 2HYGD 2XRNA 4BHBA 3GFIA 4EV0A 4I01A 4GYIA 1CGPA 3J7AO 5BOXA 4IHSA 3WTUC 1J5YA 1YG2A 3L2CA 3ZQ7A 4ZH4F 5LEJA 5LHHA 4U7DA 2K02A 5FO5A 1R36A 1RIOH 3KLNA 3K1MA 3R4KA 1IZ1A 5DCMA 3U9GA 1FP1D 4GGGA 1G6NA 2LNBA 3QOPA 1ZLKA 1FT9A 2PMUA 2RVCA 3HRSA 2GA1A 1R5GA 1OR7A 3ERED 1R5HA 2J5OA 4LJZF 1XDUA 3MFKA 1O3RA 4XLNF 2MBFA 3JW4A 3I58A 3MZYA 4UNOA 4EGZA 2DK5A 4A0XA 4P9FA 1W7PB 4MEXF 2H6CA 4UV9A 2PQ8A 3WTTC 5HS8A 3HOSA 2OD5A 3V8KA 1XSVA 6PAXA 3HHGA 2Z99A 4LMYA 3IKVA 4JK1X 5K5RA 1J75A 1S7OA 1TLHB 1TQPA 4PGHA 2JPCA 1KA8A 2FRHA 2O03A 1MKMA 3RKYA 5DCFA 3MZHA 3HYIA 4FHTA 2VOPA 1U5TB 3F3XA 4YFKF 4IRIA 3LA7A 1BI1A 4ZYHA 3CUQA 4DNCA 2VT2A 2K27A 4ASNA 5HLHA 2GQQA 2FNPA 3WE3A 2STTA 3BPVA 3KP4A 2EA2A 2W85A 4CDGA 5D5VB 3J80K 4L9JA 3ECHA 2D45A 3B73A 1IW7F 2QBYB 3GVAA 1CF7B 3E3VA 4GYGA 1YLFA 1D5VA 2XVCA 3WTSC 5L3EA 4AD9A 2ZKZA 1MDMA 4ZYEA 2PI0A 3E6BA 4E70A 1BC7C 3ABTA 4L9TA 1T39A 2EFNA 2BYVE 5BPIA 4G7ZF 3WE2A 2OQRA 1BJAA 4Q47A 1ZLJA 1QBJA 2V6CA 1FSHA 5IT3A 3I64A 1BOAA 3FX3A 5IT9K 2XHKA 1R23A 1P4AA 1ON2A 5E8GA 4AVPA 2NNYA 4HZFA 4S04A 2RNJA 1KYWA 3D0SA 2IRFG 1FP2A 3FM5A 3BJ6A 1V4RA 1HBXG 4XBFA 2IVMA 2GAUA 2XGXA 2EK5A 2V1DA 3KP6A 3L09A 1S29A 4HAMA 1D8KA 5FGMA 3LA3A 2RV8A 1ZRCA 2OQGA 2RC4A 3Q5FA 3HSEA 3T8TA 3TO9A 4R8HA 4UHTA 4EM2A 2UXXA 1J59A 2YSRA 1TTYA 5L3CA 2ZMEA 1K6OA 4DQ2A 3FMSA 2FMYA 2VE8A 1Z91A 3IWFA 3G73A 1QNTA 4NB5A 2DTRA 3WU1B 3V7CA 1XSXA 2P5LC 4WXDA 1B9NA 2LKPA 3HUGA 2HQRA 3KP2A 3GZ5A 4LK1F 2WTEA 3JAMK 5FLXK 1FYKA 4EJUA 1IF1A 1W5SA 1FSEA 3CO7C 2R7FA 4WK8F 3OV8A 3V8JA 1LEAA 1TQMA 2FU4A 3PQJA 4EJOA 2X0LA 1SD5A 4UVBA 1RUNA 4IXAA 4YFXF 1TW3A 4CXFA 3WTYC 2OZUA 4AIHA 5L3BA 2DO7A 1VTNC 1FBUA 3NRVA 2HQNA 3CUQB 4Z2YA 3DPTA 1G3WA 1QO0D 2V1UA 4N0BA 1FBQA 4OMZA 3HRTA 5JHUA 2ZJ2A 1FX7A 1S7AA 3KEQA 2MLGA 3LSTA 4A12A 2IA2A 1HQCA 4HX8A 2Z33A 5FFZA 2IJLA 2XAHA 2ZNYA 3LAPA 1MDMB 1S6LA 3C18A 1P92A 3IC7A 4HQMA 5ICCA 4G9YA 1IXCA 2NS0A 2MD5A 4U0VA 4WCGA 1OMIA 5D8KB 2ZNZA 2FBHA 2A07F 5ICGA 3ROUA 4FX0A 4ENMA 1O57A 1K7AA 1XCBA 2WC2A 2ACJA 3HOTA 4G8XA 3J81Z 2XAGA 5E17F 5TJJA 2A3SA 2LSOA 3VOEA 5TRDA 4LB5A 5LRRA 3V7RA 3HTUA 5D8LB 2DK8A 3M8EA 2VONA 2MH2A 1IN6A 4LK0F 4NQWA 2HDCA 3BWGA 1R1UA 3W6JB 2CGPA 4FX4A 4I09A 3F8NA 2VT3A 2CQKA 4UV8A 4A2UA 5LRSA 1ZH5A 2ZMEB 1FOKA 5BS6A 1SD7A 3LQRA 4WX9A 2L3DA 4RAZA 1LJ9A 2QWWA 2ZBKA 4YFNF 5FB2A 2P8TA 3KP3A 1TNTA 3K0LA 4I7HA 3MAJA 5ILSA 2F2EA 1FYMA 3FXUA 2HS5A 3DKWA 3K1PA 2UXNA 3O2PE 1UHWA 3MWMA 1W7PA 4LLLA 5JI6A 1JGSA 5LHGA 2L01A 2HTSA 4OIOF 4KICA 1E2XA 3TOBA 3DPLC 5DD4A 2F5DA 5FD5A 2ISZA 4L9NA 3RI4A 2CSOA 2DW4A 1MJBA 3GLXA 2Y0MA 1U8RA 2H27A 3M8FA 4ENJA 1YW9A 1B9MA 1K79A 4RS8A 4L5JA 2DPDA 4MTDA 1U5TA 1FNNA 3KE2A 5KVRA 3DXJF 1GXPA 1HW2A 4AIKA 1LNWA 3P9KA 1KQ8A 2A5YB 2VODA 5D5UB 3E5UA 3C1DA 1DDNA 3RYPA 1MGTA 5L3FA 4EMSA 4ZZLA 4NHJA 2QM3A 3FHZA 2FA5A 3ZPLA 4WF2A 5F6FA 2LF8A 1WSUA 3CLOA 2QBYA 1CF7A 5BMZA 3GFJA 1I6XA 2CWEA 1OYIA 2DQRA 2QYOA 3GFLA 2HOEA 1HW5A 5EEHA 4IVNA 1G3YA 2E7WA 3REOA 4HV5A 1LDKB 5ED4A 3GXOA 1FZPB 4I98B 3TKYA 1YYVA 1B6AA 3BROA 4M9XA 4HOBA 2VBXA 4UUVA 4Y15A 3WG9A 4KA4A 2O0YA 1DUXC 2G9WA 1YQAA 4I02A 4G94A 2QQAA 3ZMUA 3WTVC 1ZAOA 2G7UA 3G3ZA 4CGZA 5AIPA 5ICEA 1R00A 3ML6A 5FD6A 4ESBA 2PFBA 4HBLA 5F1RA 1MJAA 1WQ2A 2FE3A 1DP7P 3SXYA 3DV8A 2ETHA 5E18F 4HX7A 4LG0A 1BC8C 1ZGJA 3Q9SA 3GW2A 1ZREA 4M9ZA 3QAHA 1NHAA 5CJ9A 3SHFA 3E5QA 3HRMA 2R7DA 4M71A 1B4AA 2QVOA 2GWRA 3DQVC 4U7BA 5DEQA 4M73A 1REPC 4A6DA 4OU0A 2BGCA 1XN7A 5ERIA 2PN6A 4EM0B 4EJTA 4OOIA 1F9NA 2EFQA 3EUHA 1KQ9A 4ENNA 3C3WA 3S2WA 1T38A 1RZ4A 2STWA 2EJRA 4KYWA 1ZARA 1ZGAA 3ZMZA 3GZ6A 1GHCA 2A61A 1BBYA 2QQ9A 1LEBA 4AWXB 3TO6A 4CZZA 4ENKA 2YX7A 5KK1A 3FXQA 1PP7U 2J5PA 3F8FA 3E6MA 4B09A 3IHUA 5J6XA 2EWNA 1ONVA 2H09A 3J80Z 1XD7A 4O6JA 1SD6A 2UZKA 1XSDA 2KRFA 2QUFA 2GXBA 2JSCA 1R1TA 5L3GA 3O6BB 2F5FA 4HF1A 4UVCA 2XROA 3RIRA 4P5OA 1SMTA 4IRGA 1YO5C 4PDKA 2ESNA 2ZXJA 2C6YA 3ECOA 5BQTA 2L02A 2EFWA 4RAYA 2BEOA 4RB0A 2MH9A 4YIFA 4LB6B 1QQIA 1QZZA 2Y48A 1P4WA 1XGMA 2FEZA 2IPQX 2JTVA 4BHPA 2NRAC 2CYYA 4N9IA 5IT9Z 4QWQA 5E1ZB 1IN7A 1KU2A 5DDGA 2ZCWA 2V79A 4P96A 2EV6A 3ZP5A 2OZ6A 1BI0A 3WTZA 3T5XA 5D5XB 2UWMA 3PFIA 2LDUA 5E1WA 1J9IA 2E7XA 1TQIA 3I59B 1YS6A 4LG0B 4CHUA 1EV7A 1GXQA 1AWCA 4RGSA 4LLGF 3F72A 1A04A 1LDJA 1IAWA 2JZYA 1I1SA 2GXGA 1YS7A 3R0JA 2R3SA 1PDNC 4L5IA 4M6XA 3RKXA 1R1VA 2K86A 4M9SA 2K4BA 5AONA 2V9VA 2XKPA 1R7JA 5H6QA 5J8FA 4U88A 3I0TA 2EA4A 4R1HA 1QZYA 3JAMZ 5FLXZ 2ZO4A 4HYEA 3EDPA 5JFRA 2YX4A 1O7FA 3NQOA 5ILVA 3FMQA 5F64A 3EYYA 3K9TA 4JQFA 4WWCA 2DPUA 2OBPA 1ZG5A 1UHMA 3E97A 3R61A 2NYXA 3QU6A 3SQNA 1WI9A 3LAJA 3ZMTA 4F7ZA 1Z6RA 3QPHA 2M30A 1W5TA 4HF2A 2NNNA 1HW1A 4RGUA 4MQVA 3QP6A 1KU7A 1OYWA 1R58A 2P4WA 4EQQA 2M87A 1LVAA 1WKMA 4KN7X 3VODA 4ON0A 2LF7A 2Z9OA 1FLIA 4KDPA 4IF4A 1H9TA 4OMYA 4MHGA 3P9CA 4L9VA 3BOQA 5A2QK 3LA2A 4FT8A 3GX4X 3P9IA 2ESHA 3FM3A 1O3SA 1SMYF 2XUBA 1KGSA 2HKXA 1JE8A 3WTXC 1PP8F 5DYMA 1YFHA 3EQLF 4Q48A 2HFHA 1IUYA 1EH7A 5HDGA 1FBSA 2GIVA 1FC3A 1U78A 2VC1A 3EYIA 4I0BA 4K2EA 1IN4A 1USSA 1Z6TA 3WU0A 2Z3YA 3IKTA 3E6CC 3OOPA 1USTA 1J2XA 1G3TA 3H3UA 4BYYA 3F21A 4IPAA 1S8NA 1P6RA 1BI2A 2JPBA 3B02A 2EV0A 2FBKA 4Q4ZF 4RGXA 3CUOA 3R6SA 2FSWA 3GYHX 2XAJA 1UCRA 2JRTA 1MZBA 1G4DA 1C0WA 1I1GA 4I0AA 3QPTA 3SZPA 1X3UA 4HLYA 1FY7A 2PBIA 2VXZA 2Q8KA 1BIBA 4L0YB 2KJCA 1TNSA 1XB4A 3E6DA 1J7KA 3TDZC 5LGUA 1V3FA 1F4KA 1XGNA 2Q0OA 2HTJA 4PCQA 2WV0A 2G7HA 2RDPA 2H94A 1ZG1A 1ZYRF 3GUDA 5DUIA 4MEYF 1L3LA 4GO1A 2XAFA 4M74A 4ETSA 3V8LA 2VBZA 2D2WA 2OAZA 4RB3C 2YR2A 3JSPA 4KN4X 2V1XA 4KIFA 1FYLA 5LLQA 1IN5A 4HV6A 2O3FA 4B8XA 3HSRA 1K78B 1Z9CA 2OA4A 1OYYA 3JTGA 3N4MA 4OIQF 5DD8A 3IWZA 2OU2A 1Z1DA 5AIQA 5DV5A 2ADUA 1LB2A 4KMUX 1KU3A 2ZFWA 3RKWA 4R79A 5LEKA 3RTRA 4I2OA 4G6QA 5JR3A 1U6GA 3TDUC 3WGIA 2TDXA 5LGNA 3GEZA 3KEOA 2P5VA 3QU3A 3ELKA 2E1NA 3F6VA 3L00A 2HGCA 4BQAA 1DPUA 4IRHA 2DLLA 1MJ9A 1H0MA 3BY6A 1UB9A 2Y75A 2KKOA 2W84A 2BBYA 4GCVA 3V4GA 1B1BA 1WWXA 3F8MA 4OINF 3TQNA 3F6OA 5J8CA 3I53A 1W7PD 5H20A 2KIFA 3KLOA 4HX4A 1SFXA 1Z05A 4YIIA 3CJNA 1MD0A 3QP5A 1E17A 4KUMA 1ON1A 3M9AA 1T0FA 3K2ZA 2H6BA 2XKOA 4HW0A 4RB2C 3VEPA 3C7JA 1R22A 3GO5A 3HIFA 2KJBA 3D5LA 1LQ1A 2DFIA 2MA3A 4N9HA 3I59A 3TOAA 2A68F 4XSZF 4QLCU 3LQQA 4RB1A 2L4AA 1F5TA 4YG2F 3RYRA 4KFCA 1H9GA 2P6TA 3AAFA 4S05A 1XCVA 1STZA 1T98A 4OIRF 3WGGA 1D3YA 1LDDA 1RI7A 4WXHA 2FMLA 4L18B 2IP2A 3IL2A 4PZJA 4D0PA 3HRUA 1T2KA 5D4SA 2AS5F 4AIJA 2MLKA 3EETA 3O3KA 3HTSB 3BZ6A 4HLXA 2PLYA 3M1EA 2PJPA 4A5MA 4U0YA 4BXUA 2FOKA 2FXAA 1OKRA 1TW2A 5HLGA 2M45A 3T1BA 1Z7UA 3V7SA 3SZTA 2Z5UA 5E20A 2VC0A 2MC3A 2VN2A 1ZG3A 1L0OC 3H92A 4CICA 3DP7A 4LD5A 5K1YA 4XLPF 2PG4A 2IA1A 4G7HF 2RQPA 1PUEE 2K4JA 3GF2A 2PEXA 3MCZA 4EGYA 2BV6A 4M72A 3RPQA 3GWZA 4BNCA 4P9UA 2O8XA 4UXNA 4HQEA 3KCCA 1Y0UA 4KIBA 1D8JA 1ZN2A 2XV4S 3M7GA 3KP5A 3U1DA 1XGSA 3K1NA 4EJWA 5D5WB 4Q5SF 3CDHA 3W6KB 4MGRA 3JTHA 5HOOA 4ZYGA 1RUOA 2KIUA 4TV7A 1JHHA 1HKSA 1HSJA 1HKQA 4UVAA 1SD4A 5LGTA 5HDKA 4A0ZA 4BAYA 2CFXA 2VBWA 3R0AA 1G3SA 1IXSB 2A69F 2F5EA 1IRFA 1I27A 1YTYA 2EV5A 4O3MA 2VOOA 2L54A 1BN5A 4HF0A 1BM9A 2P7VB 5K5OA 2L4MA 2QZ8A 3NEUA 2EB7A 2M5WA 5JVTA 4IHTA 1O3TA 2HR3A 2PMHA 1YW8A 3ULQB 3R60A 4PGGA 2F5CA 4U0WA 5CVIA 3BJAA 2DBBA 5HS7A 1JHFA 1Q1HA 3L7WA 4ESJA 1FWZA 1ULYA 2VBYA 2QQBA 3I4PA 3P7NA 5DCMB 4A0YA 5HS9A 2YPRA 3WTWC 4M6YA 1HXDA 5CYVA 3F22A 1XGOA 2CW0F 3TO7A 4OIPF 1ZRDA 5CLSA 3I71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q2E A;  1RNL A;  1I5Z A;  1P2F A;  4LFU A;  3H3Z A;  2XAS A;  1ODD A;  2NAZ A;  2W25 A;  2KIM A;  4BH9 A;  2W57 A;  4HA8 A;  2WWY A;  3FZV A;  3KZY A;  1U5T C;  5H6R A;  1GVJ A;  3F23 A;  1JXS A;  1S3J A;  4EM1 A;  3BP8 A;  4CO8 A;  5D4R A;  2ISY A;  2HWV A;  3VB2 A;  4G7O F;  2DU9 A;  3VFZ A;  2GA2 A;  1KYZ A;  2COM A;  1YW7 A;  3Q9V A;  1IXR C;  3KFW X;  1K78 A;  3FMR A;  2HZT A;  2K7L A;  5E1X A;  2DI3 A;  1HKT A;  3CTA A;  1SAX A;  3DF8 A;  2A6H F;  5K5Q A;  3QRF F;  2O6G E;  5HVQ C;  4HDU A;  3RDI A;  2XAQ A;  4MTE A;  3E5X A;  2FNA A;  2RGV A;  1O3Q A;  4LLN A;  4A6E A;  5A2Q Z;  2ELH A;  4Y13 A;  2A6E F;  5BPD A;  1F1Z A;  2JT1 A;  3ABU A;  2DQL A;  1W4M A;  1SFE A;  5CVU A;  2EFO A;  1HST A;  2FBI A;  2FF4 A;  1EH6 A;  3ISP A;  4Y17 A;  5LBQ A;  1IRG A;  2GZW A;  3RPU A;  3MEX A;  1FPQ A;  1J0R A;  4P55 A;  1IN8 A;  1B59 A;  4EJV A;  1T6S A;  2EFP A;  1UFM A;  4ESF A;  2D1H A;  3HSF A;  4XSX F;  3KZZ A;  3I54 A;  2CG4 A;  3J81 K;  4BHC A;  4IJA A;  3PQK A;  3BJO A;  3TGN A;  2RKH A;  3IRQ A;  2IA0 A;  2YU3 A;  5LHI A;  3L9F A;  2HYF A;  3FWE A;  2B0L A;  4HDV A;  2M1B A;  3T0Y A;  5L3D A;  3RJP A;  4KNY A;  1XMK A;  3KET A;  5CVV A;  3LWF A;  1YIO A;  4MNU A;  3ZN0 A;  2HKO A;  2HEO A;  4KT5 C;  2DAO A;  5EEG A;  5HLI A;  1P4X A;  3N97 A;  3T8R A;  4XRF A;  2VE9 A;  4ZYD A;  1OPC A;  3SFZ A;  1TBX A;  3F8B A;  1BI3 A;  5CVJ A;  2O61 A;  1KU9 A;  1XMA A;  4L0Z B;  1QGP A;  2P7C B;  3K69 A;  2RN7 A;  3MQ0 A;  3BPX A;  3FXR A;  5D6E A;  4KIG A;  4KMF A;  3CUQ C;  2IT0 A;  1AOY A;  1U2W A;  1O7L A;  2DT5 A;  2P5K A;  5E8I A;  4A5N A;  3I5U A;  5FFX A;  4H0E A;  2D1V A;  3GFM A;  4CYD A;  5DUK A;  2QEN A;  3JSO A;  3LFK A;  4GXO A;  1BIA A;  1DPR A;  4WXC A;  2AXL A;  2CO5 A;  2FQ3 A;  3WOD F;  4EVI A;  1WRJ A;  4JBA A;  2X4H A;  5ILU A;  3ZMV A;  2E1C A;  1QPM A;  3ZMD A;  1ZRF A;  3KP7 A;  4RGR A;  2M8E A;  5D6F A;  1KQ0 A;  4G6D A;  1SFU A;  4LGW A;  4ZZD A;  3FF5 A;  5ICF A;  3ZMS A;  2IW5 A;  1EH8 A;  3CO6 C;  2XIG A;  3DEU A;  3COA C;  1XDS A;  4MQ9 F;  1ZHF A;  3BDD A;  3U2R A;  3DFG A;  4O5V A;  5HDN A;  3WGH A;  3F8C A;  5CVR A;  2BE5 F;  3HHH A;  1U3E M;  3ZN1 A;  2W24 A;  2QLZ A;  3IRR A;  2P6S A;  2HYG D;  2XRN A;  4BHB A;  3GFI A;  4EV0 A;  4I01 A;  4GYI A;  1CGP A;  3J7A O;  5BOX A;  4IHS A;  3WTU C;  1J5Y A;  1YG2 A;  3L2C A;  3ZQ7 A;  4ZH4 F;  5LEJ A;  5LHH A;  4U7D A;  2K02 A;  5FO5 A;  1R36 A;  1RIO H;  3KLN A;  3K1M A;  3R4K A;  1IZ1 A;  5DCM A;  3U9G A;  1FP1 D;  4GGG A;  1G6N A;  2LNB A;  3QOP A;  1ZLK A;  1FT9 A;  2PMU A;  2RVC A;  3HRS A;  2GA1 A;  1R5G A;  1OR7 A;  3ERE D;  1R5H A;  2J5O A;  4LJZ F;  1XDU A;  3MFK A;  1O3R A;  4XLN F;  2MBF A;  3JW4 A;  3I58 A;  3MZY A;  4UNO A;  4EGZ A;  2DK5 A;  4A0X A;  4P9F A;  1W7P B;  4MEX F;  2H6C A;  4UV9 A;  2PQ8 A;  3WTT C;  5HS8 A;  3HOS A;  2OD5 A;  3V8K A;  1XSV A;  6PAX A;  3HHG A;  2Z99 A;  4LMY A;  3IKV A;  4JK1 X;  5K5R A;  1J75 A;  1S7O A;  1TLH B;  1TQP A;  4PGH A;  2JPC A;  1KA8 A;  2FRH A;  2O03 A;  1MKM A;  3RKY A;  5DCF A;  3MZH A;  3HYI A;  4FHT A;  2VOP A;  1U5T B;  3F3X A;  4YFK F;  4IRI A;  3LA7 A;  1BI1 A;  4ZYH A;  3CUQ A;  4DNC A;  2VT2 A;  2K27 A;  4ASN A;  5HLH A;  2GQQ A;  2FNP A;  3WE3 A;  2STT A;  3BPV A;  3KP4 A;  2EA2 A;  2W85 A;  4CDG A;  5D5V B;  3J80 K;  4L9J A;  3ECH A;  2D45 A;  3B73 A;  1IW7 F;  2QBY B;  3GVA A;  1CF7 B;  3E3V A;  4GYG A;  1YLF A;  1D5V A;  2XVC A;  3WTS C;  5L3E A;  4AD9 A;  2ZKZ A;  1MDM A;  4ZYE A;  2PI0 A;  3E6B A;  4E70 A;  1BC7 C;  3ABT A;  4L9T A;  1T39 A;  2EFN A;  2BYV E;  5BPI A;  4G7Z F;  3WE2 A;  2OQR A;  1BJA A;  4Q47 A;  1ZLJ A;  1QBJ A;  2V6C A;  1FSH A;  5IT3 A;  3I64 A;  1BOA A;  3FX3 A;  5IT9 K;  2XHK A;  1R23 A;  1P4A A;  1ON2 A;  5E8G A;  4AVP A;  2NNY A;  4HZF A;  4S04 A;  2RNJ A;  1KYW A;  3D0S A;  2IRF G;  1FP2 A;  3FM5 A;  3BJ6 A;  1V4R A;  1HBX G;  4XBF A;  2IVM A;  2GAU A;  2XGX A;  2EK5 A;  2V1D A;  3KP6 A;  3L09 A;  1S29 A;  4HAM A;  1D8K A;  5FGM A;  3LA3 A;  2RV8 A;  1ZRC A;  2OQG A;  2RC4 A;  3Q5F A;  3HSE A;  3T8T A;  3TO9 A;  4R8H A;  4UHT A;  4EM2 A;  2UXX A;  1J59 A;  2YSR A;  1TTY A;  5L3C A;  2ZME A;  1K6O A;  4DQ2 A;  3FMS A;  2FMY A;  2VE8 A;  1Z91 A;  3IWF A;  3G73 A;  1QNT A;  4NB5 A;  2DTR A;  3WU1 B;  3V7C A;  1XSX A;  2P5L C;  4WXD A;  1B9N A;  2LKP A;  3HUG A;  2HQR A;  3KP2 A;  3GZ5 A;  4LK1 F;  2WTE A;  3JAM K;  5FLX K;  1FYK A;  4EJU A;  1IF1 A;  1W5S A;  1FSE A;  3CO7 C;  2R7F A;  4WK8 F;  3OV8 A;  3V8J A;  1LEA A;  1TQM A;  2FU4 A;  3PQJ A;  4EJO A;  2X0L A;  1SD5 A;  4UVB A;  1RUN A;  4IXA A;  4YFX F;  1TW3 A;  4CXF A;  3WTY C;  2OZU A;  4AIH A;  5L3B A;  2DO7 A;  1VTN C;  1FBU A;  3NRV A;  2HQN A;  3CUQ B;  4Z2Y A;  3DPT A;  1G3W A;  1QO0 D;  2V1U A;  4N0B A;  1FBQ A;  4OMZ A;  3HRT A;  5JHU A;  2ZJ2 A;  1FX7 A;  1S7A A;  3KEQ A;  2MLG A;  3LST A;  4A12 A;  2IA2 A;  1HQC A;  4HX8 A;  2Z33 A;  5FFZ A;  2IJL A;  2XAH A;  2ZNY A;  3LAP A;  1MDM B;  1S6L A;  3C18 A;  1P92 A;  3IC7 A;  4HQM A;  5ICC A;  4G9Y A;  1IXC A;  2NS0 A;  2MD5 A;  4U0V A;  4WCG A;  1OMI A;  5D8K B;  2ZNZ A;  2FBH A;  2A07 F;  5ICG A;  3ROU A;  4FX0 A;  4ENM A;  1O57 A;  1K7A A;  1XCB A;  2WC2 A;  2ACJ A;  3HOT A;  4G8X A;  3J81 Z;  2XAG A;  5E17 F;  5TJJ A;  2A3S A;  2LSO A;  3VOE A;  5TRD A;  4LB5 A;  5LRR A;  3V7R A;  3HTU A;  5D8L B;  2DK8 A;  3M8E A;  2VON A;  2MH2 A;  1IN6 A;  4LK0 F;  4NQW A;  2HDC A;  3BWG A;  1R1U A;  3W6J B;  2CGP A;  4FX4 A;  4I09 A;  3F8N A;  2VT3 A;  2CQK A;  4UV8 A;  4A2U A;  5LRS A;  1ZH5 A;  2ZME B;  1FOK A;  5BS6 A;  1SD7 A;  3LQR A;  4WX9 A;  2L3D A;  4RAZ A;  1LJ9 A;  2QWW A;  2ZBK A;  4YFN F;  5FB2 A;  2P8T A;  3KP3 A;  1TNT A;  3K0L A;  4I7H A;  3MAJ A;  5ILS A;  2F2E A;  1FYM A;  3FXU A;  2HS5 A;  3DKW A;  3K1P A;  2UXN A;  3O2P E;  1UHW A;  3MWM A;  1W7P A;  4LLL A;  5JI6 A;  1JGS A;  5LHG A;  2L01 A;  2HTS A;  4OIO F;  4KIC A;  1E2X A;  3TOB A;  3DPL C;  5DD4 A;  2F5D A;  5FD5 A;  2ISZ A;  4L9N A;  3RI4 A;  2CSO A;  2DW4 A;  1MJB A;  3GLX A;  2Y0M A;  1U8R A;  2H27 A;  3M8F A;  4ENJ A;  1YW9 A;  1B9M A;  1K79 A;  4RS8 A;  4L5J A;  2DPD A;  4MTD A;  1U5T A;  1FNN A;  3KE2 A;  5KVR A;  3DXJ F;  1GXP A;  1HW2 A;  4AIK A;  1LNW A;  3P9K A;  1KQ8 A;  2A5Y B;  2VOD A;  5D5U B;  3E5U A;  3C1D A;  1DDN A;  3RYP A;  1MGT A;  5L3F A;  4EMS A;  4ZZL A;  4NHJ A;  2QM3 A;  3FHZ A;  2FA5 A;  3ZPL A;  4WF2 A;  5F6F A;  2LF8 A;  1WSU A;  3CLO A;  2QBY A;  1CF7 A;  5BMZ A;  3GFJ A;  1I6X A;  2CWE A;  1OYI A;  2DQR A;  2QYO A;  3GFL A;  2HOE A;  1HW5 A;  5EEH A;  4IVN A;  1G3Y A;  2E7W A;  3REO A;  4HV5 A;  1LDK B;  5ED4 A;  3GXO A;  1FZP B;  4I98 B;  3TKY A;  1YYV A;  1B6A A;  3BRO A;  4M9X A;  4HOB A;  2VBX A;  4UUV A;  4Y15 A;  3WG9 A;  4KA4 A;  2O0Y A;  1DUX C;  2G9W A;  1YQA A;  4I02 A;  4G94 A;  2QQA A;  3ZMU A;  3WTV C;  1ZAO A;  2G7U A;  3G3Z A;  4CGZ A;  5AIP A;  5ICE A;  1R00 A;  3ML6 A;  5FD6 A;  4ESB A;  2PFB A;  4HBL A;  5F1R A;  1MJA A;  1WQ2 A;  2FE3 A;  1DP7 P;  3SXY A;  3DV8 A;  2ETH A;  5E18 F;  4HX7 A;  4LG0 A;  1BC8 C;  1ZGJ A;  3Q9S A;  3GW2 A;  1ZRE A;  4M9Z A;  3QAH A;  1NHA A;  5CJ9 A;  3SHF A;  3E5Q A;  3HRM A;  2R7D A;  4M71 A;  1B4A A;  2QVO A;  2GWR A;  3DQV C;  4U7B A;  5DEQ A;  4M73 A;  1REP C;  4A6D A;  4OU0 A;  2BGC A;  1XN7 A;  5ERI A;  2PN6 A;  4EM0 B;  4EJT A;  4OOI A;  1F9N A;  2EFQ A;  3EUH A;  1KQ9 A;  4ENN A;  3C3W A;  3S2W A;  1T38 A;  1RZ4 A;  2STW A;  2EJR A;  4KYW A;  1ZAR A;  1ZGA A;  3ZMZ A;  3GZ6 A;  1GHC A;  2A61 A;  1BBY A;  2QQ9 A;  1LEB A;  4AWX B;  3TO6 A;  4CZZ A;  4ENK A;  2YX7 A;  5KK1 A;  3FXQ A;  1PP7 U;  2J5P A;  3F8F A;  3E6M A;  4B09 A;  3IHU A;  5J6X A;  2EWN A;  1ONV A;  2H09 A;  3J80 Z;  1XD7 A;  4O6J A;  1SD6 A;  2UZK A;  1XSD A;  2KRF A;  2QUF A;  2GXB A;  2JSC A;  1R1T A;  5L3G A;  3O6B B;  2F5F A;  4HF1 A;  4UVC A;  2XRO A;  3RIR A;  4P5O A;  1SMT A;  4IRG A;  1YO5 C;  4PDK A;  2ESN A;  2ZXJ A;  2C6Y A;  3ECO A;  5BQT A;  2L02 A;  2EFW A;  4RAY A;  2BEO A;  4RB0 A;  2MH9 A;  4YIF A;  4LB6 B;  1QQI A;  1QZZ A;  2Y48 A;  1P4W A;  1XGM A;  2FEZ A;  2IPQ X;  2JTV A;  4BHP A;  2NRA C;  2CYY A;  4N9I A;  5IT9 Z;  4QWQ A;  5E1Z B;  1IN7 A;  1KU2 A;  5DDG A;  2ZCW A;  2V79 A;  4P96 A;  2EV6 A;  3ZP5 A;  2OZ6 A;  1BI0 A;  3WTZ A;  3T5X A;  5D5X B;  2UWM A;  3PFI A;  2LDU A;  5E1W A;  1J9I A;  2E7X A;  1TQI A;  3I59 B;  1YS6 A;  4LG0 B;  4CHU A;  1EV7 A;  1GXQ A;  1AWC A;  4RGS A;  4LLG F;  3F72 A;  1A04 A;  1LDJ A;  1IAW A;  2JZY A;  1I1S A;  2GXG A;  1YS7 A;  3R0J A;  2R3S A;  1PDN C;  4L5I A;  4M6X A;  3RKX A;  1R1V A;  2K86 A;  4M9S A;  2K4B A;  5AON A;  2V9V A;  2XKP A;  1R7J A;  5H6Q A;  5J8F A;  4U88 A;  3I0T A;  2EA4 A;  4R1H A;  1QZY A;  3JAM Z;  5FLX Z;  2ZO4 A;  4HYE A;  3EDP A;  5JFR A;  2YX4 A;  1O7F A;  3NQO A;  5ILV A;  3FMQ A;  5F64 A;  3EYY A;  3K9T A;  4JQF A;  4WWC A;  2DPU A;  2OBP A;  1ZG5 A;  1UHM A;  3E97 A;  3R61 A;  2NYX A;  3QU6 A;  3SQN A;  1WI9 A;  3LAJ A;  3ZMT A;  4F7Z A;  1Z6R A;  3QPH A;  2M30 A;  1W5T A;  4HF2 A;  2NNN A;  1HW1 A;  4RGU A;  4MQV A;  3QP6 A;  1KU7 A;  1OYW A;  1R58 A;  2P4W A;  4EQQ A;  2M87 A;  1LVA A;  1WKM A;  4KN7 X;  3VOD A;  4ON0 A;  2LF7 A;  2Z9O A;  1FLI A;  4KDP A;  4IF4 A;  1H9T A;  4OMY A;  4MHG A;  3P9C A;  4L9V A;  3BOQ A;  5A2Q K;  3LA2 A;  4FT8 A;  3GX4 X;  3P9I A;  2ESH A;  3FM3 A;  1O3S A;  1SMY F;  2XUB A;  1KGS A;  2HKX A;  1JE8 A;  3WTX C;  1PP8 F;  5DYM A;  1YFH A;  3EQL F;  4Q48 A;  2HFH A;  1IUY A;  1EH7 A;  5HDG A;  1FBS A;  2GIV A;  1FC3 A;  1U78 A;  2VC1 A;  3EYI A;  4I0B A;  4K2E A;  1IN4 A;  1USS A;  1Z6T A;  3WU0 A;  2Z3Y A;  3IKT A;  3E6C C;  3OOP A;  1UST A;  1J2X A;  1G3T A;  3H3U A;  4BYY A;  3F21 A;  4IPA A;  1S8N A;  1P6R A;  1BI2 A;  2JPB A;  3B02 A;  2EV0 A;  2FBK A;  4Q4Z F;  4RGX A;  3CUO A;  3R6S A;  2FSW A;  3GYH X;  2XAJ A;  1UCR A;  2JRT A;  1MZB A;  1G4D A;  1C0W A;  1I1G A;  4I0A A;  3QPT A;  3SZP A;  1X3U A;  4HLY A;  1FY7 A;  2PBI A;  2VXZ A;  2Q8K A;  1BIB A;  4L0Y B;  2KJC A;  1TNS A;  1XB4 A;  3E6D A;  1J7K A;  3TDZ C;  5LGU A;  1V3F A;  1F4K A;  1XGN A;  2Q0O A;  2HTJ A;  4PCQ A;  2WV0 A;  2G7H A;  2RDP A;  2H94 A;  1ZG1 A;  1ZYR F;  3GUD A;  5DUI A;  4MEY F;  1L3L A;  4GO1 A;  2XAF A;  4M74 A;  4ETS A;  3V8L A;  2VBZ A;  2D2W A;  2OAZ A;  4RB3 C;  2YR2 A;  3JSP A;  4KN4 X;  2V1X A;  4KIF A;  1FYL A;  5LLQ A;  1IN5 A;  4HV6 A;  2O3F A;  4B8X A;  3HSR A;  1K78 B;  1Z9C A;  2OA4 A;  1OYY A;  3JTG A;  3N4M A;  4OIQ F;  5DD8 A;  3IWZ A;  2OU2 A;  1Z1D A;  5AIQ A;  5DV5 A;  2ADU A;  1LB2 A;  4KMU X;  1KU3 A;  2ZFW A;  3RKW A;  4R79 A;  5LEK A;  3RTR A;  4I2O A;  4G6Q A;  5JR3 A;  1U6G A;  3TDU C;  3WGI A;  2TDX A;  5LGN A;  3GEZ A;  3KEO A;  2P5V A;  3QU3 A;  3ELK A;  2E1N A;  3F6V A;  3L00 A;  2HGC A;  4BQA A;  1DPU A;  4IRH A;  2DLL A;  1MJ9 A;  1H0M A;  3BY6 A;  1UB9 A;  2Y75 A;  2KKO A;  2W84 A;  2BBY A;  4GCV A;  3V4G A;  1B1B A;  1WWX A;  3F8M A;  4OIN F;  3TQN A;  3F6O A;  5J8C A;  3I53 A;  1W7P D;  5H20 A;  2KIF A;  3KLO A;  4HX4 A;  1SFX A;  1Z05 A;  4YII A;  3CJN A;  1MD0 A;  3QP5 A;  1E17 A;  4KUM A;  1ON1 A;  3M9A A;  1T0F A;  3K2Z A;  2H6B A;  2XKO A;  4HW0 A;  4RB2 C;  3VEP A;  3C7J A;  1R22 A;  3GO5 A;  3HIF A;  2KJB A;  3D5L A;  1LQ1 A;  2DFI A;  2MA3 A;  4N9H A;  3I59 A;  3TOA A;  2A68 F;  4XSZ F;  4QLC U;  3LQQ A;  4RB1 A;  2L4A A;  1F5T A;  4YG2 F;  3RYR A;  4KFC A;  1H9G A;  2P6T A;  3AAF A;  4S05 A;  1XCV A;  1STZ A;  1T98 A;  4OIR F;  3WGG A;  1D3Y A;  1LDD A;  1RI7 A;  4WXH A;  2FML A;  4L18 B;  2IP2 A;  3IL2 A;  4PZJ A;  4D0P A;  3HRU A;  1T2K A;  5D4S A;  2AS5 F;  4AIJ A;  2MLK A;  3EET A;  3O3K A;  3HTS B;  3BZ6 A;  4HLX A;  2PLY A;  3M1E A;  2PJP A;  4A5M A;  4U0Y A;  4BXU A;  2FOK A;  2FXA A;  1OKR A;  1TW2 A;  5HLG A;  2M45 A;  3T1B A;  1Z7U A;  3V7S A;  3SZT A;  2Z5U A;  5E20 A;  2VC0 A;  2MC3 A;  2VN2 A;  1ZG3 A;  1L0O C;  3H92 A;  4CIC A;  3DP7 A;  4LD5 A;  5K1Y A;  4XLP F;  2PG4 A;  2IA1 A;  4G7H F;  2RQP A;  1PUE E;  2K4J A;  3GF2 A;  2PEX A;  3MCZ A;  4EGY A;  2BV6 A;  4M72 A;  3RPQ A;  3GWZ A;  4BNC A;  4P9U A;  2O8X A;  4UXN A;  4HQE A;  3KCC A;  1Y0U A;  4KIB A;  1D8J A;  1ZN2 A;  2XV4 S;  3M7G A;  3KP5 A;  3U1D A;  1XGS A;  3K1N A;  4EJW A;  5D5W B;  4Q5S F;  3CDH A;  3W6K B;  4MGR A;  3JTH A;  5HOO A;  4ZYG A;  1RUO A;  2KIU A;  4TV7 A;  1JHH A;  1HKS A;  1HSJ A;  1HKQ A;  4UVA A;  1SD4 A;  5LGT A;  5HDK A;  4A0Z A;  4BAY A;  2CFX A;  2VBW A;  3R0A A;  1G3S A;  1IXS B;  2A69 F;  2F5E A;  1IRF A;  1I27 A;  1YTY A;  2EV5 A;  4O3M A;  2VOO A;  2L54 A;  1BN5 A;  4HF0 A;  1BM9 A;  2P7V B;  5K5O A;  2L4M A;  2QZ8 A;  3NEU A;  2EB7 A;  2M5W A;  5JVT A;  4IHT A;  1O3T A;  2HR3 A;  2PMH A;  1YW8 A;  3ULQ B;  3R60 A;  4PGG A;  2F5C A;  4U0W A;  5CVI A;  3BJA A;  2DBB A;  5HS7 A;  1JHF A;  1Q1H A;  3L7W A;  4ESJ A;  1FWZ A;  1ULY A;  2VBY A;  2QQB A;  3I4P A;  3P7N A;  5DCM B;  4A0Y A;  5HS9 A;  2YPR A;  3WTW C;  4M6Y A;  1HXD A;  5CYV A;  3F22 A;  1XGO A;  2CW0 F;  3TO7 A;  4OIP F;  1ZRD A;  5CLS A;  3I71 A; 
#chains in the Genus database with same CATH topology
 4ZDL A;  2Q2E A;  1RNL A;  1I5Z A;  3JRE A;  3HOU J;  4II2 A;  1Z0X A;  2JQ7 A;  1P2F A;  1N78 A;  4LFU A;  3H3Z A;  1DGW Y;  2XAS A;  1ODD A;  2NAZ A;  2W25 A;  4IZZ A;  3PUB A;  2KIM A;  3C2H A;  2CH0 A;  2COB A;  4HNU A;  4BGD A;  3CCY A;  3LOC A;  4BH9 A;  1LFB A;  1WH5 A;  1QHH D;  2W57 A;  3PO3 J;  4HA8 A;  2WWY A;  3B6C A;  3FZV A;  4XRS G;  1MBK A;  3KZY A;  2NS8 A;  1U5T C;  5H6R A;  1GVJ A;  3F23 A;  1DP3 A;  3X2Q H;  1JXS A;  1S3J A;  4EM1 A;  3BP8 A;  4CO8 A;  5D4R A;  2ISY A;  2HWV A;  2XSJ C;  3VB2 A;  2DU9 A;  3MKY B;  3VFZ A;  2GA2 A;  2O9L A;  2GLO A;  1KYZ A;  2COM A;  1PJR A;  3OR2 C;  1YW7 A;  4CUG A;  3Q9V A;  1LFU P;  1IXR C;  1XX5 A;  3KFW X;  1K78 A;  3FMR A;  1VQ8 I;  3RKQ A;  3FBN B;  2HZT A;  2K7L A;  5E1X A;  2DI3 A;  3H0D A;  1HKT A;  1OQY A;  3CTA A;  4BQO A;  5KCM A;  1NTC A;  5IPA A;  4NC6 A;  4I6Z A;  2R5Y B;  1SAX A;  3DF8 A;  5IYD J;  2BY1 A;  2WB1 N;  2A6H F;  1U9N A;  1JTX A;  5K5Q A;  3KPH A;  2AXT C;  4CCJ A;  1R4N B;  3FIW A;  3QRF F;  2O6G E;  1EA3 A;  3D1N I;  2HOA A;  1BW5 A;  5HVQ C;  2DJN A;  1YX5 A;  4HDU A;  2NOJ B;  2R93 J;  3IV5 A;  3RDI A;  2KMU A;  2WB1 A;  2XAQ A;  2UUZ A;  1ETK A;  4MTE A;  3E5X A;  3I4M J;  2FNA A;  2RGV A;  3FBI B;  1O3Q A;  4LLN A;  4A6E A;  5A2Q Z;  2ELH A;  4Y13 A;  3M8J A;  2A6E F;  5BPD A;  1F1Z A;  2OV7 A;  3VSK A;  2PJR A;  2JT1 A;  2ID3 A;  1ZR2 A;  2DCE A;  3ESW B;  3ABU A;  2ZFU A;  4DBR A;  3J7Z I;  3ZGK A;  2DQL A;  1W4M A;  1SFE A;  3OYM A;  5CVU A;  2EFO A;  1HST A;  2FBI A;  2CMP A;  2FF4 A;  5FLM J;  2ICW G;  1WCM J;  1EH6 A;  1DU0 A;  1WI3 A;  5JVG F;  3ISP A;  1K61 A;  4Y17 A;  2LC2 A;  1TWH J;  5LBQ A;  1IRG A;  5LD2 C;  1VQ4 I;  5EG0 B;  2E19 A;  3OIO A;  4XKB A;  4DOZ A;  2GZW A;  2CJJ A;  3RPU A;  3MEX A;  2F4O B;  4BE2 A;  3H3V K;  1FPQ A;  1J0R A;  4P55 A;  4IOC F;  3QOD A;  1LE8 B;  1IN8 A;  1B59 A;  1B72 A;  2Y9Y A;  1MW7 A;  2EZK A;  4EJV A;  1YRN A;  4A3J J;  4BUP A;  2M34 A;  1T6S A;  2EFP A;  1UFM A;  5M3F J;  4ESF A;  2D1H A;  1YIT I;  1AA7 A;  3HSF A;  2LP0 A;  4XSX F;  3VYS B;  1K4S A;  1NK2 P;  3KZZ A;  2MW8 A;  3I54 A;  3IP4 B;  2CG4 A;  3PNY A;  1K83 J;  3J81 K;  4BHC A;  4IJA A;  3PQK A;  3E1S A;  1WPK A;  3FXJ A;  1AHD P;  2Y0S N;  3BJO A;  5GTH C;  4P1W A;  2DMN A;  2K9Q A;  4C9Y A;  2H8W A;  3DCF A;  3TGN A;  2RKH A;  3IRQ A;  3NAU A;  2IA0 A;  2YU3 A;  4XLH A;  3BCB A;  5LHI A;  2XSD C;  2RQQ A;  3GTM J;  2JSP A;  3L9F A;  2HYF A;  2JUC A;  2K9N A;  2Y0S A;  3IUO A;  4LIT A;  3L2Q A;  3FWE A;  2B0L A;  5JLX A;  4DYQ A;  3ZQF A;  4HDV A;  5EGO A;  2M1B A;  3T0Y A;  5L3D A;  3RJP A;  4KNY A;  1XMK A;  3CMM A;  1TWC J;  1TWA J;  3KET A;  2R5Z B;  4CCO A;  1KZH A;  5H2F C;  4G12 A;  3LWF A;  1YIO A;  2DOD A;  5CVV A;  1V55 H;  4MNU A;  3ZN0 A;  4A3I J;  2AO9 A;  1I6H J;  2DOF A;  2HKO A;  2HEO A;  1W5C C;  4KT5 C;  2DAO A;  1R4M B;  4ZTF A;  5EEG A;  2CUE A;  4B44 A;  5HLI A;  4KIT B;  1JJ6 C;  1Y8R B;  1P4X A;  3N97 A;  3T8R A;  3FXO A;  4XRF A;  2VE9 A;  4ZYD A;  1OPC A;  3SFZ A;  3WU2 C;  3OMY A;  1TBX A;  3F8B A;  4RM3 A;  4Y3O A;  2HVS A;  1BI3 A;  2HQA A;  2K9S A;  5CVJ A;  2E2J J;  1RRJ A;  1XTA A;  1K6Y A;  4GFB A;  2O61 A;  1KU9 A;  2QSH X;  1VQL I;  1XMA A;  4L0Z B;  1QGP A;  2P7C B;  4FE7 A;  3G71 I;  3K69 A;  2RN7 A;  3MQ0 A;  3BPX A;  3FXR A;  4X1E A;  5D6E A;  3HKZ N;  2MSY A;  3LNQ A;  1P7I A;  1T56 A;  4KIG A;  2E2H J;  2KFD A;  4KMF A;  4E7Z A;  3CUQ C;  3CDI A;  2IT0 A;  1AOY A;  3BR3 A;  1U2W A;  1O7L A;  4YEL A;  2DT5 A;  2P5K A;  1IO2 A;  5E8I A;  4A5N A;  3I5U A;  5FFX A;  3HKZ A;  2IGK A;  4H0E A;  2D1V A;  5IP7 J;  3J7Y J;  3GFM A;  4CYD A;  5DUK A;  2QEN A;  4FQG A;  3JSO A;  2YU9 J;  3LFK A;  4GXO A;  2V4J C;  1BIA A;  3BCA A;  3H1C A;  2BXZ A;  3S2H J;  1DPR A;  4WXC A;  2AXL A;  2CO5 A;  2FQ3 A;  3FXK A;  2HI3 A;  2VKD A;  3WOD F;  5J1R A;  4EVI A;  1WRJ A;  4JBA A;  2X4H A;  5ILU A;  1G59 A;  1S7E A;  3ZMV A;  2CQQ A;  3UNG C;  3PJR A;  4E4H A;  2CFO A;  2E1C A;  3A01 A;  3BR5 A;  1UG2 A;  3UKG A;  1QPM A;  1Y0N A;  3ZMD A;  2AHQ A;  4IKF A;  1ZRF A;  3ASO H;  1VQK I;  3KP7 A;  1UG0 A;  4RGR A;  2JN6 A;  4V2G A;  1HDP A;  2M8E A;  5D6F A;  1KQ0 A;  4IQ4 A;  4B47 A;  4G6D A;  1SFU A;  3F9K A;  4IL6 C;  1R49 A;  4LGW A;  2W7N A;  1XC5 A;  4ZZD A;  3CC4 I;  1FMV A;  3FF5 A;  5ICF A;  3ZMS A;  4YIR X;  4XOR A;  4C2T A;  2CW8 A;  2IW5 A;  4XLE A;  3OYD A;  1EH8 A;  3TL4 X;  1SVM A;  3AG2 H;  3CC2 I;  1V5G A;  1D0Y A;  3CO6 C;  2JVG A;  5FLV A;  1OCP A;  3Q3S A;  2XIG A;  3MKW B;  3DEU A;  5F0C A;  3COA C;  4H4K C;  5E3O A;  2OTJ I;  1XDS A;  4LOC A;  4MQ9 F;  1X4P A;  1ZHF A;  2E60 A;  3BDD A;  2A05 A;  3U2R A;  3L1P A;  3DFG A;  4O5V A;  3BG5 A;  5HDN A;  3WGH A;  1YRN B;  1IC8 A;  3F8C A;  3BR6 A;  4RAG A;  5CVR A;  4M6V A;  3O8H A;  1WJA A;  2BE5 F;  1S72 I;  4AC0 A;  3HHH A;  4LIU A;  1U3E M;  3ZN1 A;  2W24 A;  1V54 H;  2QLZ A;  5J1Y A;  3IRR A;  3L2W A;  3DTI A;  2P6S A;  2F6C A;  2H1K A;  3S3O A;  5F0H A;  3CC7 I;  2IS1 A;  2HYG D;  4XK4 A;  2XRN A;  1JTY A;  1R5I D;  4BHB A;  4I01 A;  4GYI A;  4EV0 A;  3OYF A;  3GFI A;  2R7V A;  2DA1 A;  1CGP A;  2HOT A;  1GV5 A;  1TC3 C;  2OF7 A;  2CW7 A;  4A3F J;  3J7A O;  1WJC A;  5BOX A;  1MH4 A;  4IHS A;  3WTU C;  5F27 A;  4XR6 A;  4A3E J;  1NG6 A;  2ZME C;  1J5Y A;  2FD5 A;  2VIX A;  1YG2 A;  4HSR A;  2QCO A;  3L2C A;  3ZQ7 A;  4ZH4 F;  4AYB A;  4Y33 A;  4NQW B;  5LEJ A;  5BNG A;  2XPU A;  3S1N J;  5LHH A;  2K02 A;  1RR7 A;  4HEA 2;  3MMY B;  4U87 A;  4U7D A;  5FO5 A;  4BY7 J;  1R36 A;  1RIO H;  2P0W A;  3KLN A;  3GTP J;  3K1M A;  3R4K A;  1IZ1 A;  5DCM A;  1K4T A;  3U9G A;  1E3P A;  1FP1 D;  4GGG A;  1G6N A;  1TT0 A;  2LNB A;  2PMZ A;  1HCR A;  2E35 A;  4XON A;  4X6A J;  3QOP A;  3DBR B;  1ZLK A;  4HNT A;  1YHQ I;  1FT9 A;  2IBD A;  2PMU A;  2RVC A;  3HRS A;  5EDN A;  2GA1 A;  4PSX A;  4DYR A;  3GTL J;  4J19 A;  3CD6 I;  2B9S A;  4A3D J;  1X58 A;  1R5G A;  4XN3 A;  2M9H A;  1OR7 A;  3BT9 A;  5GAH J;  3ERE D;  5FKN A;  3FK7 A;  4UB8 C;  2QA4 I;  1V5F A;  2DDB A;  1R5H A;  2J5O A;  3JCU C;  1XDU A;  4LJZ F;  3MFK A;  1O3R A;  4XLN F;  2MBF A;  3JW4 A;  3I58 A;  3MZY A;  2K85 A;  1TWG J;  4UNO A;  4EGZ A;  5EEA A;  2DK5 A;  4A0X A;  4P9F A;  4J01 A;  1W7P B;  4MEX F;  4ZDO A;  2H6C A;  4UV9 A;  2PQ8 A;  3WTT C;  5HS8 A;  2V9P A;  3HOS A;  2OD5 A;  3FIS A;  3V8K A;  1XSV A;  1OCZ H;  6PAX A;  3HHG A;  2K9M A;  2Z99 A;  4LMY A;  1VQ6 I;  3IKV A;  4JK1 X;  5K5R A;  2JA6 J;  3ONQ A;  1J75 A;  4N4O B;  1S7O A;  1TLH B;  1D5Y A;  1TQP A;  4PGH A;  4CYC B;  1AU7 A;  1E3O C;  3HDD A;  1HOM A;  2JPC A;  1KA8 A;  2XF6 A;  2VAS A;  3NWT A;  2FRH A;  2O03 A;  1MKM A;  1WJ5 A;  5DCF A;  3RKY A;  3HYI A;  3MZH A;  4FHT A;  1JKQ C;  2R5Y A;  2VOP A;  3OS0 A;  1U5T B;  5GAE J;  4G7O F;  2MFZ A;  3F3X A;  2OJE D;  4YFK F;  1VI0 A;  4IRI A;  1VQ9 I;  3LA7 A;  1BI1 A;  5M5Y J;  4ZYH A;  3CUQ A;  2B63 J;  4DNC A;  1T33 A;  3ZQQ A;  3DTE A;  2VT2 A;  2K27 A;  4ASN A;  5FKK A;  3M3Y J;  3FXL A;  5HLH A;  2GQQ A;  2FNP A;  2YS9 A;  4XLF A;  3WE3 A;  2STT A;  3BPV A;  3OYN A;  2NS7 A;  3KP4 A;  2EA2 A;  1MMS A;  2W85 A;  2WY8 Q;  4CDG A;  3MN2 A;  5D5V B;  4E7L A;  3J80 K;  2X6X A;  4L9J A;  3ECH A;  4FET A;  2D45 A;  3OYB A;  3B73 A;  1IW7 F;  3I4N J;  2CV2 A;  2BXY A;  4D1Q A;  3G4S I;  4BBS J;  1YI2 I;  4C3I J;  2QBY B;  2IGM A;  3GVA A;  1CF7 B;  1R9T J;  3L2U A;  3E3V A;  4GYG A;  1YLF A;  4BJ6 C;  1D5V A;  2XVC A;  3PIO F;  1XMX A;  3SDB A;  3WTS C;  1RES A;  5L3E A;  4AD9 A;  4MIM A;  2ZKZ A;  2IS2 A;  2M7A A;  1MDM A;  1H89 C;  4ZYE A;  1ETV A;  3A0H C;  2PI0 A;  3DBL B;  3E6B A;  4E70 A;  4F52 A;  3CZ6 A;  1BC7 C;  3ABT A;  4L9T A;  5EG0 A;  1T39 A;  2RRE A;  2EFN A;  2BYV E;  3QWL A;  2HZD A;  5M3M J;  5BPI A;  1ZR4 A;  1P7J A;  4G7Z F;  3BC8 A;  2OQR A;  3WE2 A;  4FE4 A;  1BJA A;  4Q47 A;  4M3D A;  1LE8 A;  1ZLJ A;  2GOM A;  1BA5 A;  4AID A;  1QBJ A;  2V6C A;  5FKL A;  1FSH A;  1FJL A;  1XPX A;  5IT3 A;  3I64 A;  1W36 D;  2DDA A;  1BOA A;  2VPR A;  3FX3 A;  3LSK A;  5B5E C;  5IT9 K;  2DOA A;  1IRZ A;  2XHK A;  1X3Z B;  2X48 A;  1R23 A;  4KIS A;  1P4A A;  3EUA A;  3OYA A;  1ON2 A;  5E8G A;  4AVP A;  2NNY A;  4HZF A;  4S04 A;  2RNJ A;  3BQY A;  5IY5 H;  1KYW A;  4RM2 A;  3D0S A;  2IRF G;  1FP2 A;  3FM5 A;  3BJ6 A;  4HPQ A;  1SEU A;  2E71 A;  1WVR A;  2VJI A;  5GAD J;  1V4R A;  3M1C A;  1HBX G;  4BE1 A;  2X1C A;  3OSG A;  4XBF A;  2IVM A;  2GAU A;  2XGX A;  2EK5 A;  2V1D A;  3QYE A;  1SFO J;  3KP6 A;  4J00 A;  3LL7 A;  3L09 A;  1S29 A;  3GTQ J;  2ELJ A;  4HAM A;  1D8K A;  5FGM A;  3LA3 A;  2RV8 A;  3S1R J;  3ZRG A;  1WGX A;  3ZOB A;  5J4V A;  1ZRC A;  2OQG A;  2RC4 A;  3Q5F A;  4ZYA A;  3HSE A;  3T8T A;  3TO9 A;  1UAA A;  2K3P A;  2W48 A;  4R8H A;  1ERD A;  1YJ9 I;  4UHT A;  4EM2 A;  2UXX A;  2FQ4 A;  4CCN A;  1J59 A;  2M0C A;  5B1B H;  2YSR A;  3DKY A;  5CQE A;  1TTY A;  1RET A;  5L3C A;  2ZME A;  3H5R A;  1K6O A;  1JT0 A;  4F93 B;  1OIS A;  4DQ2 A;  3FMS A;  3CCS I;  2FMY A;  2VE8 A;  3W2V A;  3CCJ I;  3HOZ J;  1FOX A;  1Z91 A;  4QIW N;  1KON A;  2EIJ H;  3IWF A;  3G73 A;  1QNT A;  4NB5 A;  2DOE A;  3JRI A;  3DBH B;  2DTR A;  3WU1 B;  3V7C A;  3CCM I;  3F0C A;  1MBJ A;  1XSX A;  4M3E A;  3H9G A;  3V42 A;  1T8I A;  1OCT C;  2DA7 A;  2P5L C;  4WXD A;  1Y39 A;  1B9N A;  2LKP A;  3HUG A;  4IHX A;  2HQR A;  3W3C A;  3KP2 A;  3GZ5 A;  4LK1 F;  2WTE A;  3JAM K;  5FLX K;  1FYK A;  4QSH A;  1OFC X;  4EJU A;  1IF1 A;  1W5S A;  2XGE A;  3AFH A;  2DJI A;  4IO9 F;  2VB6 A;  3L2R A;  2HDD A;  1FSE A;  3CO7 C;  3BG3 A;  4BEH A;  2R7F A;  4WK8 F;  3OYK A;  3OV8 A;  1FOW A;  1LEA A;  3V8J A;  2DFE A;  1TQM A;  2FU4 A;  2MC4 A;  3PQJ A;  4X0G A;  1ZKG A;  4EJO A;  2ECC A;  1SD5 A;  2X0L A;  4UVB A;  1RUN A;  4IXA A;  2EPF A;  2FJ1 A;  3RQI A;  4YFX F;  5J3L A;  3SDG A;  1TW3 A;  3ZCO A;  4CXF A;  3WTY C;  2OZU A;  2MGQ A;  5M5X J;  2WA0 A;  1DU6 A;  3LFU A;  4AIH A;  5L3B A;  3S17 J;  2DO7 A;  1I50 J;  1VTN C;  1FBU A;  3NRV A;  2HQN A;  3K4K A;  5E79 C;  2R7Z J;  3CUQ B;  4Z2Y A;  4C3J J;  1HC8 A;  3MD2 A;  3DPT A;  1G3W A;  4XOP A;  4LIV A;  1QO0 D;  3DTK A;  4B3A A;  2V1U A;  2EBI A;  1HDD C;  3I56 I;  4ITV A;  4N0B A;  2KRH A;  3D5R C;  3G1O A;  2X6Y A;  1WJD A;  2QKM B;  1YJW I;  2EIL H;  3O8G A;  2VPL A;  4BY1 J;  1FBQ A;  2HYJ A;  2VLA A;  3ABL H;  4OMZ A;  3HRT A;  5JHU A;  4IEJ A;  2EIK H;  2OPT A;  1ETX A;  3S8P A;  2ZJ2 A;  1FX7 A;  1S7A A;  3KEQ A;  5B66 C;  2MLG A;  3LST A;  4A12 A;  2DN0 A;  2IA2 A;  5K7H A;  1HQC A;  2GOX B;  4BL0 B;  4HX8 A;  2Z33 A;  5FFZ A;  3HB9 A;  1JKP C;  2R7Q A;  2IJL A;  2XAH A;  2ZNY A;  3TW6 A;  3U21 A;  3LAP A;  2JA7 J;  2L0K A;  3AG1 H;  1MDM B;  1S6L A;  1GDT A;  3C18 A;  2XB0 X;  1P92 A;  2LR8 A;  3IC7 A;  4RAF A;  4HQM A;  5ICC A;  1SC7 A;  3LSG A;  1T0F C;  2DYS H;  4G9Y A;  1IXC A;  2NS0 A;  1Q1V A;  3LSJ A;  5HNH A;  1RKW A;  2R7S A;  2MD5 A;  4U0V A;  1X1P A;  2A5W A;  1MBF A;  3K4B A;  1OMI A;  4WCG A;  4E7K A;  5D8K B;  2XF7 A;  2ZNZ A;  3IH4 A;  2FBH A;  4HRI A;  4IX7 A;  2A07 F;  5ICG A;  3AG3 H;  3ROU A;  1Y8Q B;  4FX0 A;  3CCL I;  3WHB A;  2MAB A;  4ENM A;  1O57 A;  2LTP A;  4UB6 C;  4G6T B;  2KDZ A;  1K7A A;  1T08 B;  3H5A A;  1LFP A;  3HGG A;  1FIA A;  1XCB A;  2WC2 A;  2KHM A;  2XGC A;  3IH3 A;  2ACJ A;  1F43 A;  3HOT A;  4G8X A;  3J81 Z;  2XAG A;  4YRV A;  1HLV A;  4UUT A;  5E17 F;  2WAQ N;  3A4C A;  5TJJ A;  2A3S A;  3DKX A;  3C2B A;  2QGU A;  2LSO A;  3VOE A;  5TRD A;  4LB5 A;  5LRR A;  1ZK8 A;  3V7R A;  2LLK A;  1JUP A;  3HTU A;  3K6G A;  1Z3X A;  5D8L B;  4RLF A;  2DK8 A;  3M8E A;  4UY8 I;  2VON A;  3I55 I;  2MH2 A;  5JHF A;  2WAQ A;  3VYU B;  1IN6 A;  4LK0 F;  4NQW A;  2HDC A;  2E34 A;  3BWG A;  1R1U A;  3MKL A;  4F55 A;  2L7M P;  1W0T A;  3W6J B;  2JK3 A;  2CGP A;  3MZ8 A;  4FX4 A;  4I09 A;  3F8N A;  4B3X A;  2VT3 A;  2CS3 A;  2CQK A;  3H5N A;  4BXF A;  4UV8 A;  4A2U A;  4JX6 A;  3DLL F;  3BZK A;  4ANJ A;  2KZV A;  3LSM A;  1VQN I;  3H9Q A;  5LRS A;  1ZH5 A;  4AM3 A;  2ZME B;  1FOK A;  1X4O A;  1OCC H;  1UMQ A;  1QU3 A;  4C3H J;  5BS6 A;  2M4K A;  3EUH C;  3PIP F;  3PNT A;  2K3F A;  1SD7 A;  2P81 A;  1QPI A;  3LQR A;  4WX9 A;  2L3D A;  4RAZ A;  1LJ9 A;  2QWW A;  2BOL A;  2ZBK A;  5GPA A;  4YFN F;  5FB2 A;  3J7A Y;  2P8T A;  3KP3 A;  3D5S C;  2CQ7 A;  1TNT A;  4XN0 A;  3K0L A;  2EZH A;  5FRO A;  1JT6 A;  3HUG B;  1TT5 B;  2DTZ A;  4I7H A;  4FCY A;  3MAJ A;  5ILS A;  2F2E A;  2DA6 A;  1FYM A;  2O7O A;  3EPZ A;  1SVO A;  3BG9 A;  2HS5 A;  3FXU A;  3DWL E;  3DKW A;  3K1P A;  4B1R A;  5FKO A;  4CH7 A;  3GTK J;  4NC8 A;  2UXN A;  3O2P E;  4XQF A;  1LVK A;  1UHW A;  3VSL A;  3MWM A;  3RPU D;  2M7B A;  1W7P A;  4LLL A;  2LG4 A;  1JGS A;  5JI6 A;  3OS2 A;  3TED A;  2L5Q A;  5LHG A;  1X19 A;  2L01 A;  4BEH B;  5EZH A;  3A0B C;  3L2V A;  2HTS A;  1BR4 A;  4OIO F;  4KIC A;  2VXD A;  4XRM A;  3QPS A;  1LUJ B;  1E2X A;  3TOB A;  3DPL C;  1GV2 A;  2NXN B;  1MSF C;  5DD4 A;  2F5D A;  4W1U A;  2R0Q C;  4AVZ A;  5FD5 A;  2ISZ A;  4L9N A;  4MO7 A;  3RI4 A;  3PO2 J;  2CSO A;  2DW4 A;  1MJB A;  3BR0 A;  3GLX A;  4CYC A;  2Y0M A;  1U8R A;  2H27 A;  3M8F A;  4C30 A;  4ENJ A;  3ZQC A;  1YW9 A;  1B9M A;  4IHY A;  1K79 A;  4RS8 A;  1TP4 A;  3ABM H;  4L5J A;  2DPD A;  4MTD A;  1U5T A;  1FNN A;  2KIQ A;  3KE2 A;  1B8I B;  2KRC A;  5KVR A;  2ME0 A;  2OC6 A;  3DXJ F;  1GXP A;  1HW2 A;  3OS1 A;  1X1C A;  4AIK A;  1LNW A;  3P9K A;  3DU6 A;  2LD5 A;  1KQ8 A;  2A5Y B;  2VOD A;  5D5U B;  3E5U A;  3C1D A;  4XNF A;  2I10 A;  1DDN A;  3RYP A;  1MGT A;  5L3F A;  4EMS A;  4ZZL A;  1UZC A;  4A3B J;  4NHJ A;  5C4X J;  2QM3 A;  2LRE A;  1IDZ A;  2HXO A;  3FHZ A;  2FA5 A;  4S0H B;  2KLO A;  2X6O A;  3ZPL A;  2V6E A;  4BQN A;  1V5E A;  3GLL A;  3CCQ I;  4WF2 A;  4OAY A;  5K7F A;  5F6F A;  2LF8 A;  1RC9 A;  3CLO A;  3QOE A;  1WSU A;  2QBY A;  1CF7 A;  5BMZ A;  3GFJ A;  4XLA A;  4PJM A;  4BDY A;  1G2H A;  3CMA I;  2CUZ A;  1I6X A;  3SJM A;  2CWE A;  1OYI A;  2DQR A;  2QYO A;  3GFL A;  3N05 A;  2HOE A;  4PJL A;  1HW5 A;  2TRT A;  2H1L A;  2Z16 A;  5EEH A;  4IVN A;  5E3N A;  1QZE A;  3OY9 A;  1G3Y A;  2E7W A;  3REO A;  4HV5 A;  3H35 A;  3RZO J;  1LDK B;  5ED4 A;  3GXO A;  1APL C;  1FZP B;  1D1C A;  4I98 B;  1MH3 A;  3TKY A;  1YYV A;  1B6A A;  1BL0 A;  3BRO A;  2B7E A;  3JRG A;  4M9X A;  4HOB A;  2HPI A;  2ELK A;  4C2U A;  2VBX A;  4BKX A;  5EZG A;  4UUV A;  2CUF A;  3HPH A;  1UJ8 A;  4Y15 A;  2CV1 A;  4F91 B;  3W2W A;  3OR1 C;  3WG9 A;  4KA4 A;  2O0Y A;  2WAE A;  2CUJ A;  3KIO A;  2GM4 A;  3ASN H;  2N8G A;  4AYB N;  1DUX C;  2G9W A;  1YQA A;  2FX0 A;  4I02 A;  4G94 A;  2QQA A;  3ZMU A;  2OUM A;  3WTV C;  1ZAO A;  2E2I J;  1QVU A;  2XF5 A;  2G7U A;  3G3Z A;  1ETQ A;  4CGZ A;  5AIP A;  2F4I A;  5ICE A;  1R00 A;  2YUS A;  3ML6 A;  5FD6 A;  2V26 A;  4ESB A;  1RR8 C;  2PFB A;  4HBL A;  3OYI A;  3S32 A;  5F1R A;  4E7I A;  1MJA A;  2MG4 A;  1WQ2 A;  2E36 A;  3PNV A;  2CV0 A;  3OL4 A;  3S93 A;  2PMZ N;  4HNV A;  2ZSH B;  5J4Y A;  2VKE A;  1VZ0 A;  2FE3 A;  3RZD J;  1MNM C;  4NUB A;  1DP7 P;  1A6Q A;  3SXY A;  1MNE A;  3DV8 A;  5GAG J;  2CQN A;  1VND A;  2ETH A;  5E18 F;  4HX7 A;  4D7N A;  2FOW A;  4LG0 A;  5KHD A;  1BC8 C;  1ZGJ A;  4DW6 A;  4D7M A;  3Q9S A;  1BR1 A;  3GW2 A;  2X51 A;  1NG7 A;  3M07 A;  1ZRE A;  4M9Z A;  3SFI A;  3QAH A;  3CF5 F;  1NHA A;  1J09 A;  5CJ9 A;  3SHF A;  1FMW A;  3HOX J;  1A35 A;  4IQJ A;  3E5Q A;  3HRM A;  2E5N A;  2R7D A;  4E7S A;  2ZXH A;  3HOV J;  4M71 A;  2ZB9 A;  2NOG A;  1TL8 A;  3S15 J;  1B4A A;  2QVO A;  2DA5 A;  2L9S A;  2GWR A;  3DQV C;  1PUF B;  4U7B A;  4XL9 A;  5DEQ A;  4M73 A;  1REP C;  4D5C A;  1A36 A;  2IS6 A;  4BAC A;  3CME I;  4A6D A;  1ZQ3 P;  3AL0 C;  1POG A;  4OU0 A;  2BGC A;  1XN7 A;  2WAD A;  5ERI A;  1H8A C;  4QPQ A;  4YEJ A;  3WHC A;  2G0E A;  4DYC A;  3CF2 A;  5LFA A;  1IRX A;  3RSN A;  2PN6 A;  4EM0 B;  3GTG J;  4XIC A;  1SVL A;  3PM1 A;  1UEL B;  4MFE A;  4OOI A;  4EJT A;  1YE9 A;  1F9N A;  1JKR C;  2EQR A;  2IS4 A;  2EFQ A;  3EUH A;  1VF9 A;  3FHN A;  2V1N A;  1KQ9 A;  4ENN A;  3C3W A;  2IXS A;  2I5U A;  1ENH A;  3S2W A;  1FEX A;  5FRN A;  2E1M C;  3FK6 A;  1T38 A;  3NAR A;  2OCC H;  1QHG A;  5HNF A;  1GUU A;  1RZ4 A;  3JRA A;  2STW A;  2LKS A;  3LSI A;  2EJR A;  4KYW A;  4CA0 A;  1P9Q C;  2NVT J;  1ZAR A;  4QPO A;  1ZGA A;  3CJR B;  3ZMZ A;  2BHY A;  3GZ6 A;  2JJ7 A;  3DEE A;  3SEQ A;  1GHC A;  2A61 A;  1VQ7 I;  1MND A;  1BBY A;  2LKX A;  2HQ5 A;  1JKO C;  1WHU A;  2QQ9 A;  3Q0V A;  4DGW B;  1BW6 A;  1LEB A;  4GDF A;  4AWX B;  3TO6 A;  3TMO A;  4CZZ A;  2M3A A;  4ENK A;  1A31 A;  2YX7 A;  5KK1 A;  2XGD A;  4IOA F;  3TP0 A;  3S3M A;  4I99 C;  3FXQ A;  1WZ2 A;  3E7L A;  1PP7 U;  2J5P A;  2LK2 A;  3F8F A;  3E6M A;  4B09 A;  3IHU A;  3JRC A;  5J6X A;  3CQZ J;  2EWN A;  5EJC A;  1G8X A;  1ONV A;  2UV1 A;  1VQM I;  2HOS A;  2H09 A;  3J80 Z;  1XD7 A;  2QF7 A;  1SD6 A;  4O6J A;  3OYJ A;  2O5R A;  2UZK A;  5CPR B;  3CP8 A;  1XSD A;  4Y52 J;  2KRF A;  2QUF A;  2DA4 A;  2E5Z A;  4RLQ A;  2GXB A;  4XOT A;  2JSC A;  3HOW J;  1R1T A;  3O6B B;  5L3G A;  2BVL A;  2F5F A;  1AKH B;  3GZN B;  3DLA A;  3ZR8 X;  4HF1 A;  1XG1 A;  2GBY A;  1JUM A;  4UVC A;  2XRO A;  3BTJ A;  3RIR A;  5JLW A;  4P5O A;  2X6W A;  4JOM A;  1SMT A;  4IRG A;  3I9V 2;  4BJ5 C;  1YO5 C;  2R4G A;  3VYT B;  4PDK A;  3BTL A;  1OLT A;  2ESN A;  3K4C A;  2F4M B;  2ZXJ A;  2C6Y A;  3ECO A;  4F3Q A;  5BQT A;  1A6I A;  3KYC B;  2L02 A;  3GME A;  2EFW A;  3HGY A;  4RAY A;  2BEO A;  4RB0 A;  2GXA A;  2MH9 A;  4YIF A;  4CZC A;  4LB6 B;  1QQI A;  1QZZ A;  2Y48 A;  3QYF A;  1MIJ A;  1P4W A;  2X1E A;  1XGM A;  2FEZ A;  2IPQ X;  2KPM A;  2JTV A;  4BHP A;  3HEF A;  2NRA C;  1ETO A;  2CYY A;  2DYR H;  4XKW A;  4N9I A;  5DM6 F;  2LFB A;  5IT9 Z;  4QWQ A;  3G6E I;  2L9N A;  5E1Z B;  1WJF A;  1IN7 A;  1KU2 A;  3UR3 C;  4UUS B;  5DDG A;  2JA8 J;  2ZCW A;  2V79 A;  4P96 A;  2EV6 A;  3ZP5 A;  2OZ6 A;  2X1D A;  3OIQ A;  1BI0 A;  3NWS A;  3WTZ A;  4BU2 A;  3A1Y A;  3T5X A;  5D5X B;  2UWM A;  3W6V A;  4A3L J;  3PFI A;  2QQ8 A;  3KZI C;  2LDU A;  5E1W A;  1J9I A;  2E7X A;  1TQI A;  3HPG A;  3I59 B;  1D1B A;  3BR2 A;  1YS6 A;  3Q0W A;  4LG0 B;  3C2G A;  1IUF A;  1CQT A;  3CJT B;  5IP9 J;  4CHU A;  1EF4 A;  1EV7 A;  1GXQ A;  1AWC A;  4PFP A;  3ZQG A;  1VQP I;  4RGS A;  3HG9 A;  1RKT A;  4LLG F;  3F72 A;  3OL3 A;  1A04 A;  1LDJ A;  1IAW A;  2L9R A;  2JZY A;  1I1S A;  2GXG A;  1YS7 A;  3QYB A;  3R0J A;  2EH3 A;  3K7A J;  2R3S A;  4XMY A;  2KZG A;  1OJL A;  4L5I A;  4M6X A;  1MBH A;  4LG3 A;  1PVE A;  1PDN C;  4BXX J;  2NVY J;  4V19 K;  3RKX A;  1R1V A;  2K86 A;  4M9S A;  1I3A A;  2K4B A;  1Z7L A;  5AON A;  1M1E B;  2ZXI A;  2V9V A;  2XKP A;  1R7J A;  4AU7 A;  4FAS D;  5KAF C;  5H6Q A;  5J8F A;  2R92 J;  4U88 A;  3I0T A;  1H88 C;  5J1U A;  3IAS 2;  2EA4 A;  4R1H A;  4Y4R A;  5B1A H;  1QZY A;  3JAM Z;  2RNG A;  4XKC A;  5FLX Z;  2ZO4 A;  1E3H A;  4HYE A;  4DZJ A;  3EDP A;  5JFR A;  1ETW A;  1Z77 A;  2YX4 A;  4NNJ A;  1IG7 A;  1N75 A;  1SAU A;  1O7F A;  2QEX I;  3NQO A;  4KT6 A;  5ILV A;  3FMQ A;  4RMN A;  3QPL A;  5F64 A;  4MLO A;  4N4N B;  3EYY A;  4IHW A;  3K9T A;  4JX5 A;  4JQF A;  4WWC A;  2LYC A;  3K2A A;  3P5J A;  3VDX A;  1Z67 A;  2K9L A;  5FJ8 J;  2DPU A;  3CLQ A;  2OBP A;  3RQ4 A;  2RAE A;  1ZG5 A;  1UHM A;  5F08 A;  3I3L A;  3E97 A;  3R61 A;  3SYT A;  2NYX A;  5TGT A;  3LSR A;  3QU6 A;  3SQN A;  3H0G J;  4Y7N J;  3OSF A;  1WI9 A;  3LAJ A;  3BZC A;  3ZMT A;  3DU5 A;  3CES A;  1Z6R A;  3QPH A;  4F7Z A;  2M30 A;  1B8I A;  4HG2 A;  1S5L C;  4RBO A;  1IV8 A;  1W5T A;  4ZC3 A;  3BG7 A;  4HF2 A;  2NNN A;  4CCK A;  1IJW C;  3WG7 H;  1MBG A;  4ZJZ A;  1HW1 A;  4RGU A;  4MQV A;  4BE0 A;  3QP6 A;  2R7R A;  2QKL B;  1OYW A;  1R58 A;  2P4W A;  2VJJ A;  3HC7 A;  4XKV A;  4EQQ A;  1KU7 A;  2M87 A;  2LRD A;  2BY3 A;  1LVA A;  4W97 A;  3Q0U A;  1WKM A;  4KN7 X;  2LY1 A;  2HU9 A;  3VOD A;  1O4X A;  4ON0 A;  2LF7 A;  2Z9O A;  1FLI A;  2K40 A;  4QTR A;  4KDP A;  4IF4 A;  4PJN A;  4DJA A;  5C44 J;  4A3K J;  1H9T A;  4PSW A;  4IHV A;  2A6T A;  4OMY A;  5EYR A;  4MHG A;  4M3G A;  3P9C A;  2CRG A;  1JUS A;  3BOQ A;  4L9V A;  1LPQ A;  3LA2 A;  4FT8 A;  5A2Q K;  3GX4 X;  2VQC A;  3P9I A;  1QVT A;  2ESH A;  3FM3 A;  1O3S A;  1SMY F;  2ZC2 A;  2Z2S B;  3TBI A;  2XUB A;  4BS9 A;  2KIS A;  1KGS A;  4L5E A;  2HKX A;  1JE8 A;  3WTX C;  1PP8 F;  3K4M A;  5DYM A;  1YFH A;  3EQL F;  3BLY A;  3BTC A;  5CQG A;  3HXL A;  3LMM A;  1ACI A;  1EJ9 A;  4Q48 A;  2VI6 A;  1Y6I A;  2HFH A;  2OCE A;  3S14 J;  3S1M J;  1YIJ I;  2H8R A;  1IUY A;  1EH7 A;  5HDG A;  1FBS A;  3CCV I;  1JI8 A;  3A03 A;  2GIV A;  1OCR H;  1FC3 A;  3U1K A;  1QRY A;  2R7T A;  1U78 A;  2W4S A;  2VC1 A;  3AG4 H;  1W1W E;  3EYI A;  1U0J A;  4I0B A;  4K2E A;  3OYG A;  1Y1V J;  1IN4 A;  2EZL A;  5KAI C;  1LKX A;  2LH9 A;  1USS A;  2VL8 A;  1Z6T A;  3WU0 A;  2JUG A;  5IP6 A;  2Z3Y A;  3BTI A;  2E1O A;  3IKT A;  3OOP A;  1UST A;  1J2X A;  3SZG A;  3E6C C;  1G3T A;  3H3U A;  3LSH A;  4BYY A;  3F21 A;  4IPA A;  3A2K A;  1S8N A;  1P6R A;  4XLC A;  1X3W B;  4XRS A;  1BI2 A;  2JPB A;  2BHZ A;  2EV0 A;  3B02 A;  2JA5 J;  2FBK A;  3HL2 A;  4Q4Z F;  4RGX A;  1T95 A;  3CUO A;  2FUG 2;  3R6S A;  2XPW A;  2KP6 A;  3S1Q J;  3EUK L;  2FSW A;  3VWB A;  4DIQ A;  3FDY A;  3GYH X;  2XAJ A;  2X85 A;  1UCR A;  2JRT A;  3GTO J;  1MZB A;  1TZL A;  1G4D A;  1C0W A;  1I1G A;  1OR7 C;  4I0A A;  2AQE A;  3QPT A;  3SZP A;  1X3U A;  9ANT A;  4PJ0 C;  2DFH A;  4HLY A;  1FY7 A;  2PBI A;  2VXZ A;  3OYL A;  4BJT A;  2Q8K A;  1BIB A;  4L0Y B;  2KJC A;  2R7W A;  1TNS A;  3K70 D;  1XB4 A;  3HM5 A;  3E6D A;  5IYB J;  1PUF A;  2Y69 H;  1J7K A;  3TDZ C;  5LGU A;  1S9H A;  1V3F A;  3AKZ A;  3CJQ B;  4BBR J;  1F4K A;  1N77 A;  1XGN A;  2Q0O A;  5E3L A;  2HTJ A;  4PCQ A;  2LBF B;  2Q2E B;  2WV0 A;  2G7H A;  2RDP A;  4DZP A;  2H94 A;  2KDO A;  2DMT A;  3K4N A;  2D5V A;  3VYR B;  2M2E A;  1W36 C;  2DMQ A;  4OAZ A;  1ZG1 A;  2NVQ J;  1ZYR F;  1N25 A;  3GUD A;  3PSF A;  3KX2 A;  3LSP A;  5DUI A;  3B6A A;  4MEY F;  1L3L A;  4GO1 A;  2XAF A;  4M74 A;  4ETS A;  2Q1Z B;  1MMG A;  3V8L A;  2EIN H;  2VBZ A;  3PUF A;  2D2W A;  3PFY A;  4XID A;  1I39 A;  1DGR M;  2OAZ A;  3H36 A;  3GCM A;  4V2F A;  1EKE A;  2YR2 A;  4RB3 C;  3JSP A;  4KN4 X;  2V1X A;  3ZQL A;  4KIF A;  3AL0 B;  2XC7 A;  1FYL A;  4FIS A;  5LLQ A;  1PYV A;  1IN5 A;  4Z6Y A;  1BR2 A;  5GTI C;  2DA3 A;  4OWR B;  4HV6 A;  2O3F A;  4B8X A;  5IOZ A;  2R7X A;  4D5F A;  3HSR A;  1VQ5 I;  4CCM A;  1K78 B;  1D0X A;  1Z9C A;  2OA4 A;  1OYY A;  3JTG A;  3N4M A;  4RDU A;  2LVS A;  4OIQ F;  5DD8 A;  2HVQ A;  4NBQ A;  3IWZ A;  2OU2 A;  1Z1D A;  5AIQ A;  5DV5 A;  1TWF J;  2E1M B;  2ADU A;  2V7F A;  1LB2 A;  1RPW A;  4KMU X;  1KU3 A;  3FKJ A;  2ZFW A;  5DTD A;  4DBQ A;  3W2A A;  3RKW A;  2EZI A;  4R79 A;  2VUM J;  5KNL A;  5LEK A;  1SAN A;  3H9J A;  3RTR A;  4I2O A;  2WAF A;  5IOY A;  4G6Q A;  5JR3 A;  1U6G A;  3TDU C;  4XM3 A;  3BG6 A;  2TDX A;  4F92 B;  2VQG A;  3WGI A;  2W1O A;  1F36 A;  2XPV A;  5LGN A;  3GEZ A;  3KEO A;  2P5V A;  3OIP A;  3QU3 A;  2XB5 A;  3ELK A;  2E1N A;  3F6V A;  4ZTJ A;  4A3M J;  3ZQI A;  3JRD A;  2KL4 A;  3L00 A;  2HGC A;  1AKH A;  1MSE C;  4BQA A;  1W0U A;  1DPU A;  5M5W J;  2L2O A;  4MFD A;  2PJR B;  4IRH A;  2ZJR F;  2DLL A;  1MJ9 A;  1H0M A;  3BY6 A;  1UB9 A;  2M4G A;  5F04 A;  1XS9 A;  2Y75 A;  2KKO A;  2W84 A;  2BBY A;  2HNH A;  3PL8 A;  1SFK A;  4GCV A;  2GIZ A;  3V4G A;  1B1B A;  4PFO A;  1WWX A;  3F8M A;  2IGO A;  2R7O A;  3KYD B;  4OIN F;  3TQN A;  2F5V A;  3F6O A;  4A3C J;  5DM7 F;  5J8C A;  1ZGW A;  4D9J A;  3I53 A;  4A3G J;  2KQR A;  2Y9Z A;  1W7P D;  5H20 A;  1U9O A;  2KIF A;  3KLO A;  4JX4 A;  3CCU I;  4HST A;  2NVU B;  4HX4 A;  4JYK A;  1SFX A;  1B72 B;  4BQQ A;  1Z05 A;  4YII A;  3CJN A;  1Z3Y A;  3DPU A;  1MD0 A;  3QP5 A;  4C2M J;  1E17 A;  1GVD A;  4KUM A;  1ON1 A;  3M9A A;  1T0F A;  4EAT A;  2X9D A;  5HOD A;  3K2Z A;  5F1J A;  3GTJ J;  2H6B A;  4UUS A;  2XKO A;  2NVX J;  2L7F P;  2HDW A;  4HW0 A;  1YJN I;  1HA8 A;  4RB2 C;  4KJZ A;  3VEP A;  3C7J A;  2OTL I;  1R22 A;  3GO5 A;  2AQF A;  3HIF A;  2KJB A;  3D5L A;  1LQ1 A;  4PK4 A;  2DFI A;  2MA3 A;  4N9H A;  1X2M A;  2CQX A;  2W82 A;  5FKM A;  1FTT A;  3I59 A;  2PX9 A;  2DA2 A;  2DT7 B;  2BW3 A;  2M8G X;  3TOA A;  2A68 F;  4XSZ F;  4QLC U;  3PSI A;  3LQQ A;  4RB1 A;  2L4A A;  1IGN A;  3IAM 2;  4PUS A;  3BQZ A;  1FOY A;  5EF6 A;  2L9V A;  1QA6 A;  1F5T A;  4YG2 F;  3RYR A;  1IV6 A;  3HOY J;  5EGO B;  3S2D J;  4KFC A;  1H9G A;  2P6T A;  3AAF A;  4S05 A;  1XCV A;  1STZ A;  1T98 A;  2DT6 A;  1MMD A;  4OIR F;  2MYS A;  3WGG A;  1D3Y A;  1LDD A;  5F0F A;  1RI7 A;  2DMP A;  2VJ5 A;  4WXH A;  2FML A;  4L18 B;  2IP2 A;  4M3B A;  3IL2 A;  4PZJ A;  1YX3 A;  4D0P A;  2IGN A;  3K10 A;  3ZXS A;  2JMW A;  3JRF A;  3HRU A;  3HJE A;  4ZDP A;  4NDL A;  1X1A A;  2JRM A;  1T2K A;  5D4S A;  2AS5 F;  1ZEL A;  4AIJ A;  5E3M A;  2MLK A;  3EET A;  3O3K A;  3HTS B;  3BZ6 A;  4HLX A;  3OYE A;  2PLY A;  3M1E A;  2PJP A;  1WFX A;  1JGG A;  2Y31 A;  3DEW A;  4CSW A;  4A5M A;  4U0Y A;  5HLT A;  4BXU A;  2FOK A;  3KYL A;  5GPC A;  1X1D A;  3FKI J;  2FXA A;  1Y1W J;  1OKR A;  3VPR A;  1TW2 A;  5HLG A;  5FRM A;  4GRI A;  2M45 A;  2ECB A;  3T1B A;  1Z7U A;  1MBE A;  1BOB A;  3V7S A;  2VKH A;  3SZT A;  1R71 A;  2JA2 A;  1FIP A;  2ZXW H;  2Z5U A;  3KEY A;  2L7K A;  1DQU A;  2EIM H;  3HBL A;  5E20 A;  5J47 A;  2VC0 A;  3M4O J;  2Y30 A;  2MC3 A;  5C4J J;  2VN2 A;  1ETY A;  2R7U A;  1ZG3 A;  1L0O C;  1X2N A;  3G1L A;  3H92 A;  5CKT A;  4CIC A;  3MVP A;  3DP7 A;  2WY7 Q;  1ITY A;  4LD5 A;  2TCT A;  5K1Y A;  1I3Q J;  4XLP F;  3CCE I;  2PG4 A;  2IA1 A;  4G7H F;  1A5J A;  1UHS A;  2RQP A;  2ID6 A;  3JRH A;  1PUE E;  4A69 C;  2K4J A;  2V9K A;  3GF2 A;  3K70 C;  2Y2Z A;  5J40 A;  1VFC A;  2PEX A;  3MCZ A;  4EGY A;  3E0J B;  3A01 B;  2BV6 A;  4PJJ A;  4M72 A;  4RA2 A;  3RPQ A;  1JJ8 C;  3ERM A;  3GWZ A;  4BNC A;  4P9U A;  2LOO A;  2O8X A;  2WV1 A;  3KCC A;  4UXN A;  4HQE A;  4E7H A;  3K4J A;  1Y0U A;  4KIB A;  4I76 A;  1D8J A;  5K7Z A;  3QQA A;  1ZN2 A;  2XV4 S;  3M7G A;  3KP5 A;  1WJB A;  2HXI A;  3TW7 A;  1WH7 A;  2VKV A;  3U1D A;  2W00 A;  2QSF X;  1XGS A;  3K1N A;  4EJW A;  4B4C A;  5D5W B;  2QSG X;  4Q5S F;  2ME6 A;  3CDH A;  3GBG A;  2VQL A;  5C3E J;  3W6K B;  4MGR A;  3JTH A;  5HOO A;  1WJE A;  5DS9 A;  2KT0 A;  4BDZ A;  2XRL A;  4ABZ A;  1MMA A;  4ZYG A;  3TP3 A;  1RUO A;  4FTH A;  2KIU A;  4E7J A;  3SEZ A;  4TV7 A;  1FTZ A;  1JHH A;  3CP2 A;  2XAU A;  2F48 A;  1HKS A;  1ORK A;  2DXI A;  1Z21 A;  1HSJ A;  1HKQ A;  3ABK H;  4UVA A;  1D0Z A;  1MMN A;  2WBM A;  1SD4 A;  5LGT A;  4EEF G;  5HDK A;  2O8K A;  4A0Z A;  4AUX A;  4CCL A;  4BAY A;  3BR1 A;  2K5C A;  3MKZ A;  1GT0 C;  2CFX A;  2VBW A;  3R0A A;  4NC7 A;  1G3S A;  1VQO I;  1IXS B;  2LMD A;  4E6K G;  2I8D A;  2VQH A;  2A69 F;  2F5E A;  1IRF A;  2BY0 A;  2XDV A;  1I27 A;  3G1M A;  5B3S H;  2ZJP F;  1YTY A;  2EV5 A;  3S16 J;  4O3M A;  4II3 A;  2VOO A;  5IYC J;  1HF0 A;  2L54 A;  1BN5 A;  2JVH A;  1U8B A;  1D1A A;  4HF0 A;  3CMY A;  4M3F A;  1BM9 A;  2P7V B;  3IH2 A;  2DFF A;  5K5O A;  2HPM A;  3OOU A;  4A93 J;  1NH3 A;  2L4M A;  2QZ8 A;  3K4L A;  3NEU A;  2EB7 A;  2M5W A;  5TIS C;  2VJ4 A;  5JVT A;  4IHT A;  1YOV B;  1O3T A;  2HR3 A;  1X1B A;  3A02 A;  2PMH A;  1YW8 A;  3ULQ B;  3R60 A;  4PGG A;  3S3N A;  3CDL A;  2JWT A;  3FXM A;  2F5C A;  4U0W A;  3OWT A;  5GP9 A;  2BW3 B;  2IAI A;  5CVI A;  2HVR A;  1BJZ A;  3BJA A;  2DBB A;  2BY2 A;  4JP0 A;  1IDY A;  2ZJQ F;  1NK3 P;  3OYH A;  2ZSI B;  5HS7 A;  2CU7 A;  1JHF A;  1Q1H A;  3L7W A;  4ESJ A;  2DMU A;  1FWZ A;  1Y56 A;  1E0E A;  1ULY A;  2VBY A;  2M0M A;  2QQB A;  1GLN A;  3I4P A;  3P7N A;  2L7Z A;  3G2B A;  5DCM B;  3JR9 A;  4A0Y A;  5HS9 A;  2LY2 A;  1ZTR A;  2YPR A;  4B48 A;  3OYC A;  2IEK A;  4B43 A;  3WTW C;  4M6Y A;  1HXD A;  5CYV A;  3JRB A;  3CCR I;  2LY9 A;  2R5Z A;  2BZT A;  2MD0 A;  3F22 A;  3HZJ A;  1OCO H;  1XGO A;  3RCO A;  1R6R A;  2BVM A;  2CW0 F;  2Z1D A;  3TO7 A;  4OIP F;  3ZQH A;  1ZRD A;  5CLS A;  2LBF A;  3I71 A; 
#chains in the Genus database with same CATH homology
 2Q2E A;  1RNL A;  1I5Z A;  1P2F A;  4LFU A;  3H3Z A;  2XAS A;  1ODD A;  2NAZ A;  2W25 A;  2KIM A;  4BH9 A;  2W57 A;  4HA8 A;  2WWY A;  3FZV A;  3KZY A;  1U5T C;  5H6R A;  1GVJ A;  3F23 A;  1JXS A;  1S3J A;  4EM1 A;  3BP8 A;  4CO8 A;  5D4R A;  2ISY A;  2HWV A;  3VB2 A;  4G7O F;  2DU9 A;  3VFZ A;  2GA2 A;  1KYZ A;  2COM A;  1YW7 A;  3Q9V A;  1IXR C;  3KFW X;  1K78 A;  3FMR A;  2HZT A;  2K7L A;  5E1X A;  2DI3 A;  1HKT A;  3CTA A;  1SAX A;  3DF8 A;  2A6H F;  5K5Q A;  3QRF F;  2O6G E;  5HVQ C;  4HDU A;  3RDI A;  2XAQ A;  4MTE A;  3E5X A;  2FNA A;  2RGV A;  1O3Q A;  4LLN A;  4A6E A;  5A2Q Z;  2ELH A;  4Y13 A;  2A6E F;  5BPD A;  1F1Z A;  2JT1 A;  3ABU A;  2DQL A;  1W4M A;  1SFE A;  5CVU A;  2EFO A;  1HST A;  2FBI A;  2FF4 A;  1EH6 A;  3ISP A;  4Y17 A;  5LBQ A;  1IRG A;  2GZW A;  3RPU A;  3MEX A;  1FPQ A;  1J0R A;  4P55 A;  1IN8 A;  1B59 A;  4EJV A;  1T6S A;  2EFP A;  1UFM A;  4ESF A;  2D1H A;  3HSF A;  4XSX F;  3KZZ A;  3I54 A;  2CG4 A;  3J81 K;  4BHC A;  4IJA A;  3PQK A;  3BJO A;  3TGN A;  2RKH A;  3IRQ A;  2IA0 A;  2YU3 A;  5LHI A;  3L9F A;  2HYF A;  3FWE A;  2B0L A;  4HDV A;  2M1B A;  3T0Y A;  5L3D A;  3RJP A;  4KNY A;  1XMK A;  3KET A;  5CVV A;  3LWF A;  1YIO A;  4MNU A;  3ZN0 A;  2HKO A;  2HEO A;  4KT5 C;  2DAO A;  5EEG A;  5HLI A;  1P4X A;  3N97 A;  3T8R A;  4XRF A;  2VE9 A;  4ZYD A;  1OPC A;  3SFZ A;  1TBX A;  3F8B A;  1BI3 A;  5CVJ A;  2O61 A;  1KU9 A;  1XMA A;  4L0Z B;  1QGP A;  2P7C B;  3K69 A;  2RN7 A;  3MQ0 A;  3BPX A;  3FXR A;  5D6E A;  4KIG A;  4KMF A;  3CUQ C;  2IT0 A;  1AOY A;  1U2W A;  1O7L A;  2DT5 A;  2P5K A;  5E8I A;  4A5N A;  3I5U A;  5FFX A;  4H0E A;  2D1V A;  3GFM A;  4CYD A;  5DUK A;  2QEN A;  3JSO A;  3LFK A;  4GXO A;  1BIA A;  1DPR A;  4WXC A;  2AXL A;  2CO5 A;  2FQ3 A;  3WOD F;  4EVI A;  1WRJ A;  4JBA A;  2X4H A;  5ILU A;  3ZMV A;  2E1C A;  1QPM A;  3ZMD A;  1ZRF A;  3KP7 A;  4RGR A;  2M8E A;  5D6F A;  1KQ0 A;  4G6D A;  1SFU A;  4LGW A;  4ZZD A;  3FF5 A;  5ICF A;  3ZMS A;  2IW5 A;  1EH8 A;  3CO6 C;  2XIG A;  3DEU A;  3COA C;  1XDS A;  4MQ9 F;  1ZHF A;  3BDD A;  3U2R A;  3DFG A;  4O5V A;  5HDN A;  3WGH A;  3F8C A;  5CVR A;  2BE5 F;  3HHH A;  1U3E M;  3ZN1 A;  2W24 A;  2QLZ A;  3IRR A;  2P6S A;  2HYG D;  2XRN A;  4BHB A;  3GFI A;  4EV0 A;  4I01 A;  4GYI A;  1CGP A;  3J7A O;  5BOX A;  4IHS A;  3WTU C;  1J5Y A;  1YG2 A;  3L2C A;  3ZQ7 A;  4ZH4 F;  5LEJ A;  5LHH A;  4U7D A;  2K02 A;  5FO5 A;  1R36 A;  1RIO H;  3KLN A;  3K1M A;  3R4K A;  1IZ1 A;  5DCM A;  3U9G A;  1FP1 D;  4GGG A;  1G6N A;  2LNB A;  3QOP A;  1ZLK A;  1FT9 A;  2PMU A;  2RVC A;  3HRS A;  2GA1 A;  1R5G A;  1OR7 A;  3ERE D;  1R5H A;  2J5O A;  4LJZ F;  1XDU A;  3MFK A;  1O3R A;  4XLN F;  2MBF A;  3JW4 A;  3I58 A;  3MZY A;  4UNO A;  4EGZ A;  2DK5 A;  4A0X A;  4P9F A;  1W7P B;  4MEX F;  2H6C A;  4UV9 A;  2PQ8 A;  3WTT C;  5HS8 A;  3HOS A;  2OD5 A;  3V8K A;  1XSV A;  6PAX A;  3HHG A;  2Z99 A;  4LMY A;  3IKV A;  4JK1 X;  5K5R A;  1J75 A;  1S7O A;  1TLH B;  1TQP A;  4PGH A;  2JPC A;  1KA8 A;  2FRH A;  2O03 A;  1MKM A;  3RKY A;  5DCF A;  3MZH A;  3HYI A;  4FHT A;  2VOP A;  1U5T B;  3F3X A;  4YFK F;  4IRI A;  3LA7 A;  1BI1 A;  4ZYH A;  3CUQ A;  4DNC A;  2VT2 A;  2K27 A;  4ASN A;  5HLH A;  2GQQ A;  2FNP A;  3WE3 A;  2STT A;  3BPV A;  3KP4 A;  2EA2 A;  2W85 A;  4CDG A;  5D5V B;  3J80 K;  4L9J A;  3ECH A;  2D45 A;  3B73 A;  1IW7 F;  2QBY B;  3GVA A;  1CF7 B;  3E3V A;  4GYG A;  1YLF A;  1D5V A;  2XVC A;  3WTS C;  5L3E A;  4AD9 A;  2ZKZ A;  1MDM A;  4ZYE A;  2PI0 A;  3E6B A;  4E70 A;  1BC7 C;  3ABT A;  4L9T A;  1T39 A;  2EFN A;  2BYV E;  5BPI A;  4G7Z F;  3WE2 A;  2OQR A;  1BJA A;  4Q47 A;  1ZLJ A;  1QBJ A;  2V6C A;  1FSH A;  5IT3 A;  3I64 A;  1BOA A;  3FX3 A;  5IT9 K;  2XHK A;  1R23 A;  1P4A A;  1ON2 A;  5E8G A;  4AVP A;  2NNY A;  4HZF A;  4S04 A;  2RNJ A;  1KYW A;  3D0S A;  2IRF G;  1FP2 A;  3FM5 A;  3BJ6 A;  1V4R A;  1HBX G;  4XBF A;  2IVM A;  2GAU A;  2XGX A;  2EK5 A;  2V1D A;  3KP6 A;  3L09 A;  1S29 A;  4HAM A;  1D8K A;  5FGM A;  3LA3 A;  2RV8 A;  1ZRC A;  2OQG A;  2RC4 A;  3Q5F A;  3HSE A;  3T8T A;  3TO9 A;  4R8H A;  4UHT A;  4EM2 A;  2UXX A;  1J59 A;  2YSR A;  1TTY A;  5L3C A;  2ZME A;  1K6O A;  4DQ2 A;  3FMS A;  2FMY A;  2VE8 A;  1Z91 A;  3IWF A;  3G73 A;  1QNT A;  4NB5 A;  2DTR A;  3WU1 B;  3V7C A;  1XSX A;  2P5L C;  4WXD A;  1B9N A;  2LKP A;  3HUG A;  2HQR A;  3KP2 A;  3GZ5 A;  4LK1 F;  2WTE A;  3JAM K;  5FLX K;  1FYK A;  4EJU A;  1IF1 A;  1W5S A;  1FSE A;  3CO7 C;  2R7F A;  4WK8 F;  3OV8 A;  3V8J A;  1LEA A;  1TQM A;  2FU4 A;  3PQJ A;  4EJO A;  2X0L A;  1SD5 A;  4UVB A;  1RUN A;  4IXA A;  4YFX F;  1TW3 A;  4CXF A;  3WTY C;  2OZU A;  4AIH A;  5L3B A;  2DO7 A;  1VTN C;  1FBU A;  3NRV A;  2HQN A;  3CUQ B;  4Z2Y A;  3DPT A;  1G3W A;  1QO0 D;  2V1U A;  4N0B A;  1FBQ A;  4OMZ A;  3HRT A;  5JHU A;  2ZJ2 A;  1FX7 A;  1S7A A;  3KEQ A;  2MLG A;  3LST A;  4A12 A;  2IA2 A;  1HQC A;  4HX8 A;  2Z33 A;  5FFZ A;  2IJL A;  2XAH A;  2ZNY A;  3LAP A;  1MDM B;  1S6L A;  3C18 A;  1P92 A;  3IC7 A;  4HQM A;  5ICC A;  4G9Y A;  1IXC A;  2NS0 A;  2MD5 A;  4U0V A;  4WCG A;  1OMI A;  5D8K B;  2ZNZ A;  2FBH A;  2A07 F;  5ICG A;  3ROU A;  4FX0 A;  4ENM A;  1O57 A;  1K7A A;  1XCB A;  2WC2 A;  2ACJ A;  3HOT A;  4G8X A;  3J81 Z;  2XAG A;  5E17 F;  5TJJ A;  2A3S A;  2LSO A;  3VOE A;  5TRD A;  4LB5 A;  5LRR A;  3V7R A;  3HTU A;  5D8L B;  2DK8 A;  3M8E A;  2VON A;  2MH2 A;  1IN6 A;  4LK0 F;  4NQW A;  2HDC A;  3BWG A;  1R1U A;  3W6J B;  2CGP A;  4FX4 A;  4I09 A;  3F8N A;  2VT3 A;  2CQK A;  4UV8 A;  4A2U A;  5LRS A;  1ZH5 A;  2ZME B;  1FOK A;  5BS6 A;  1SD7 A;  3LQR A;  4WX9 A;  2L3D A;  4RAZ A;  1LJ9 A;  2QWW A;  2ZBK A;  4YFN F;  5FB2 A;  2P8T A;  3KP3 A;  1TNT A;  3K0L A;  4I7H A;  3MAJ A;  5ILS A;  2F2E A;  1FYM A;  3FXU A;  2HS5 A;  3DKW A;  3K1P A;  2UXN A;  3O2P E;  1UHW A;  3MWM A;  1W7P A;  4LLL A;  5JI6 A;  1JGS A;  5LHG A;  2L01 A;  2HTS A;  4OIO F;  4KIC A;  1E2X A;  3TOB A;  3DPL C;  5DD4 A;  2F5D A;  5FD5 A;  2ISZ A;  4L9N A;  3RI4 A;  2CSO A;  2DW4 A;  1MJB A;  3GLX A;  2Y0M A;  1U8R A;  2H27 A;  3M8F A;  4ENJ A;  1YW9 A;  1B9M A;  1K79 A;  4RS8 A;  4L5J A;  2DPD A;  4MTD A;  1U5T A;  1FNN A;  3KE2 A;  5KVR A;  3DXJ F;  1GXP A;  1HW2 A;  4AIK A;  1LNW A;  3P9K A;  1KQ8 A;  2A5Y B;  2VOD A;  5D5U B;  3E5U A;  3C1D A;  1DDN A;  3RYP A;  1MGT A;  5L3F A;  4EMS A;  4ZZL A;  4NHJ A;  2QM3 A;  3FHZ A;  2FA5 A;  3ZPL A;  4WF2 A;  5F6F A;  2LF8 A;  1WSU A;  3CLO A;  2QBY A;  1CF7 A;  5BMZ A;  3GFJ A;  1I6X A;  2CWE A;  1OYI A;  2DQR A;  2QYO A;  3GFL A;  2HOE A;  1HW5 A;  5EEH A;  4IVN A;  1G3Y A;  2E7W A;  3REO A;  4HV5 A;  1LDK B;  5ED4 A;  3GXO A;  1FZP B;  4I98 B;  3TKY A;  1YYV A;  1B6A A;  3BRO A;  4M9X A;  4HOB A;  2VBX A;  4UUV A;  4Y15 A;  3WG9 A;  4KA4 A;  2O0Y A;  1DUX C;  2G9W A;  1YQA A;  4I02 A;  4G94 A;  2QQA A;  3ZMU A;  3WTV C;  1ZAO A;  2G7U A;  3G3Z A;  4CGZ A;  5AIP A;  5ICE A;  1R00 A;  3ML6 A;  5FD6 A;  4ESB A;  2PFB A;  4HBL A;  5F1R A;  1MJA A;  1WQ2 A;  2FE3 A;  1DP7 P;  3SXY A;  3DV8 A;  2ETH A;  5E18 F;  4HX7 A;  4LG0 A;  1BC8 C;  1ZGJ A;  3Q9S A;  3GW2 A;  1ZRE A;  4M9Z A;  3QAH A;  1NHA A;  5CJ9 A;  3SHF A;  3E5Q A;  3HRM A;  2R7D A;  4M71 A;  1B4A A;  2QVO A;  2GWR A;  3DQV C;  4U7B A;  5DEQ A;  4M73 A;  1REP C;  4A6D A;  4OU0 A;  2BGC A;  1XN7 A;  5ERI A;  2PN6 A;  4EM0 B;  4EJT A;  4OOI A;  1F9N A;  2EFQ A;  3EUH A;  1KQ9 A;  4ENN A;  3C3W A;  3S2W A;  1T38 A;  1RZ4 A;  2STW A;  2EJR A;  4KYW A;  1ZAR A;  1ZGA A;  3ZMZ A;  3GZ6 A;  1GHC A;  2A61 A;  1BBY A;  2QQ9 A;  1LEB A;  4AWX B;  3TO6 A;  4CZZ A;  4ENK A;  2YX7 A;  5KK1 A;  3FXQ A;  1PP7 U;  2J5P A;  3F8F A;  3E6M A;  4B09 A;  3IHU A;  5J6X A;  2EWN A;  1ONV A;  2H09 A;  3J80 Z;  1XD7 A;  4O6J A;  1SD6 A;  2UZK A;  1XSD A;  2KRF A;  2QUF A;  2GXB A;  2JSC A;  1R1T A;  5L3G A;  3O6B B;  2F5F A;  4HF1 A;  4UVC A;  2XRO A;  3RIR A;  4P5O A;  1SMT A;  4IRG A;  1YO5 C;  4PDK A;  2ESN A;  2ZXJ A;  2C6Y A;  3ECO A;  5BQT A;  2L02 A;  2EFW A;  4RAY A;  2BEO A;  4RB0 A;  2MH9 A;  4YIF A;  4LB6 B;  1QQI A;  1QZZ A;  2Y48 A;  1P4W A;  1XGM A;  2FEZ A;  2IPQ X;  2JTV A;  4BHP A;  2NRA C;  2CYY A;  4N9I A;  5IT9 Z;  4QWQ A;  5E1Z B;  1IN7 A;  1KU2 A;  5DDG A;  2ZCW A;  2V79 A;  4P96 A;  2EV6 A;  3ZP5 A;  2OZ6 A;  1BI0 A;  3WTZ A;  3T5X A;  5D5X B;  2UWM A;  3PFI A;  2LDU A;  5E1W A;  1J9I A;  2E7X A;  1TQI A;  3I59 B;  1YS6 A;  4LG0 B;  4CHU A;  1EV7 A;  1GXQ A;  1AWC A;  4RGS A;  4LLG F;  3F72 A;  1A04 A;  1LDJ A;  1IAW A;  2JZY A;  1I1S A;  2GXG A;  1YS7 A;  3R0J A;  2R3S A;  1PDN C;  4L5I A;  4M6X A;  3RKX A;  1R1V A;  2K86 A;  4M9S A;  2K4B A;  5AON A;  2V9V A;  2XKP A;  1R7J A;  5H6Q A;  5J8F A;  4U88 A;  3I0T A;  2EA4 A;  4R1H A;  1QZY A;  3JAM Z;  5FLX Z;  2ZO4 A;  4HYE A;  3EDP A;  5JFR A;  2YX4 A;  1O7F A;  3NQO A;  5ILV A;  3FMQ A;  5F64 A;  3EYY A;  3K9T A;  4JQF A;  4WWC A;  2DPU A;  2OBP A;  1ZG5 A;  1UHM A;  3E97 A;  3R61 A;  2NYX A;  3QU6 A;  3SQN A;  1WI9 A;  3LAJ A;  3ZMT A;  4F7Z A;  1Z6R A;  3QPH A;  2M30 A;  1W5T A;  4HF2 A;  2NNN A;  1HW1 A;  4RGU A;  4MQV A;  3QP6 A;  1KU7 A;  1OYW A;  1R58 A;  2P4W A;  4EQQ A;  2M87 A;  1LVA A;  1WKM A;  4KN7 X;  3VOD A;  4ON0 A;  2LF7 A;  2Z9O A;  1FLI A;  4KDP A;  4IF4 A;  1H9T A;  4OMY A;  4MHG A;  3P9C A;  4L9V A;  3BOQ A;  5A2Q K;  3LA2 A;  4FT8 A;  3GX4 X;  3P9I A;  2ESH A;  3FM3 A;  1O3S A;  1SMY F;  2XUB A;  1KGS A;  2HKX A;  1JE8 A;  3WTX C;  1PP8 F;  5DYM A;  1YFH A;  3EQL F;  4Q48 A;  2HFH A;  1IUY A;  1EH7 A;  5HDG A;  1FBS A;  2GIV A;  1FC3 A;  1U78 A;  2VC1 A;  3EYI A;  4I0B A;  4K2E A;  1IN4 A;  1USS A;  1Z6T A;  3WU0 A;  2Z3Y A;  3IKT A;  3E6C C;  3OOP A;  1UST A;  1J2X A;  1G3T A;  3H3U A;  4BYY A;  3F21 A;  4IPA A;  1S8N A;  1P6R A;  1BI2 A;  2JPB A;  3B02 A;  2EV0 A;  2FBK A;  4Q4Z F;  4RGX A;  3CUO A;  3R6S A;  2FSW A;  3GYH X;  2XAJ A;  1UCR A;  2JRT A;  1MZB A;  1G4D A;  1C0W A;  1I1G A;  4I0A A;  3QPT A;  3SZP A;  1X3U A;  4HLY A;  1FY7 A;  2PBI A;  2VXZ A;  2Q8K A;  1BIB A;  4L0Y B;  2KJC A;  1TNS A;  1XB4 A;  3E6D A;  1J7K A;  3TDZ C;  5LGU A;  1V3F A;  1F4K A;  1XGN A;  2Q0O A;  2HTJ A;  4PCQ A;  2WV0 A;  2G7H A;  2RDP A;  2H94 A;  1ZG1 A;  1ZYR F;  3GUD A;  5DUI A;  4MEY F;  1L3L A;  4GO1 A;  2XAF A;  4M74 A;  4ETS A;  3V8L A;  2VBZ A;  2D2W A;  2OAZ A;  4RB3 C;  2YR2 A;  3JSP A;  4KN4 X;  2V1X A;  4KIF A;  1FYL A;  5LLQ A;  1IN5 A;  4HV6 A;  2O3F A;  4B8X A;  3HSR A;  1K78 B;  1Z9C A;  2OA4 A;  1OYY A;  3JTG A;  3N4M A;  4OIQ F;  5DD8 A;  3IWZ A;  2OU2 A;  1Z1D A;  5AIQ A;  5DV5 A;  2ADU A;  1LB2 A;  4KMU X;  1KU3 A;  2ZFW A;  3RKW A;  4R79 A;  5LEK A;  3RTR A;  4I2O A;  4G6Q A;  5JR3 A;  1U6G A;  3TDU C;  3WGI A;  2TDX A;  5LGN A;  3GEZ A;  3KEO A;  2P5V A;  3QU3 A;  3ELK A;  2E1N A;  3F6V A;  3L00 A;  2HGC A;  4BQA A;  1DPU A;  4IRH A;  2DLL A;  1MJ9 A;  1H0M A;  3BY6 A;  1UB9 A;  2Y75 A;  2KKO A;  2W84 A;  2BBY A;  4GCV A;  3V4G A;  1B1B A;  1WWX A;  3F8M A;  4OIN F;  3TQN A;  3F6O A;  5J8C A;  3I53 A;  1W7P D;  5H20 A;  2KIF A;  3KLO A;  4HX4 A;  1SFX A;  1Z05 A;  4YII A;  3CJN A;  1MD0 A;  3QP5 A;  1E17 A;  4KUM A;  1ON1 A;  3M9A A;  1T0F A;  3K2Z A;  2H6B A;  2XKO A;  4HW0 A;  4RB2 C;  3VEP A;  3C7J A;  1R22 A;  3GO5 A;  3HIF A;  2KJB A;  3D5L A;  1LQ1 A;  2DFI A;  2MA3 A;  4N9H A;  3I59 A;  3TOA A;  2A68 F;  4XSZ F;  4QLC U;  3LQQ A;  4RB1 A;  2L4A A;  1F5T A;  4YG2 F;  3RYR A;  4KFC A;  1H9G A;  2P6T A;  3AAF A;  4S05 A;  1XCV A;  1STZ A;  1T98 A;  4OIR F;  3WGG A;  1D3Y A;  1LDD A;  1RI7 A;  4WXH A;  2FML A;  4L18 B;  2IP2 A;  3IL2 A;  4PZJ A;  4D0P A;  3HRU A;  1T2K A;  5D4S A;  2AS5 F;  4AIJ A;  2MLK A;  3EET A;  3O3K A;  3HTS B;  3BZ6 A;  4HLX A;  2PLY A;  3M1E A;  2PJP A;  4A5M A;  4U0Y A;  4BXU A;  2FOK A;  2FXA A;  1OKR A;  1TW2 A;  5HLG A;  2M45 A;  3T1B A;  1Z7U A;  3V7S A;  3SZT A;  2Z5U A;  5E20 A;  2VC0 A;  2MC3 A;  2VN2 A;  1ZG3 A;  1L0O C;  3H92 A;  4CIC A;  3DP7 A;  4LD5 A;  5K1Y A;  4XLP F;  2PG4 A;  2IA1 A;  4G7H F;  2RQP A;  1PUE E;  2K4J A;  3GF2 A;  2PEX A;  3MCZ A;  4EGY A;  2BV6 A;  4M72 A;  3RPQ A;  3GWZ A;  4BNC A;  4P9U A;  2O8X A;  4UXN A;  4HQE A;  3KCC A;  1Y0U A;  4KIB A;  1D8J A;  1ZN2 A;  2XV4 S;  3M7G A;  3KP5 A;  3U1D A;  1XGS A;  3K1N A;  4EJW A;  5D5W B;  4Q5S F;  3CDH A;  3W6K B;  4MGR A;  3JTH A;  5HOO A;  4ZYG A;  1RUO A;  2KIU A;  4TV7 A;  1JHH A;  1HKS A;  1HSJ A;  1HKQ A;  4UVA A;  1SD4 A;  5LGT A;  5HDK A;  4A0Z A;  4BAY A;  2CFX A;  2VBW A;  3R0A A;  1G3S A;  1IXS B;  2A69 F;  2F5E A;  1IRF A;  1I27 A;  1YTY A;  2EV5 A;  4O3M A;  2VOO A;  2L54 A;  1BN5 A;  4HF0 A;  1BM9 A;  2P7V B;  5K5O A;  2L4M A;  2QZ8 A;  3NEU A;  2EB7 A;  2M5W A;  5JVT A;  4IHT A;  1O3T A;  2HR3 A;  2PMH A;  1YW8 A;  3ULQ B;  3R60 A;  4PGG A;  2F5C A;  4U0W A;  5CVI A;  3BJA A;  2DBB A;  5HS7 A;  1JHF A;  1Q1H A;  3L7W A;  4ESJ A;  1FWZ A;  1ULY A;  2VBY A;  2QQB A;  3I4P A;  3P7N A;  5DCM B;  4A0Y A;  5HS9 A;  2YPR A;  3WTW C;  4M6Y A;  1HXD A;  5CYV A;  3F22 A;  1XGO A;  2CW0 F;  3TO7 A;  4OIP F;  1ZRD A;  5CLS A;  3I71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...