5D5XB

Crystal structure of chaetomium thermophilum skn7 with ssre dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
103
structure length
99
Chain Sequence
SDFVRKLYKMLEDPSYHSVVRWSDDGDSFVVLENEKFTKTILPKHFKHSNFASFVRQLNKYDFHKVRHNDEPYGRDAWEFKHPEFRADRKDNLDNIRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human heat-shock transcription factor 1 in complex with DNA.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Transcription
molecule keywords SSRE DNA strand 1
total genus 29
structure length 99
sequence length 103
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00447 HSF_DNA-bind HSF-type DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5d5xB00
3GFMA 2EJRA 4EM0B 3DFGA 2DFIA 4L9VA 4EMSA 1DPRA 1O3SA 1D8KA 3C18A 4HDVA 1XGMA 4P9FA 2ZKZA 3HTSB 3JSPA 1IAWA 2MBFA 3R4KA 3P7NA 1SFUA 4KUMA 1IN8A 2IW5A 4UVBA 1R5HA 2EV6A 4IRIA 2O61A 2EFNA 5E8GA 4KN7X 2EFPA 3JAMZ 2E7XA 3WG9A 1O3RA 3F8BA 3FX3A 4LG0B 2UXXA 2Z5UA 5L3FA 1PP7U 1WKMA 3E6DA 1SFXA 5IT9K 4HW0A 1G3YA 3R61A 1R1TA 1OYWA 1FC3A 1QZZA 3KFWX 2PQ8A 3OV8A 1I6XA 3MZYA 4RB0A 3V8JA 2W57A 4EJWA 5FD6A 4I98B 4WXHA 3WTXC 4L0ZB 2QWWA 4G6DA 4ESBA 2O6GE 4P9UA 4CICA 3RPUA 4TV7A 1W5TA 1CF7A 5FLXZ 1O3TA 4CHUA 2L3DA 3F22A 1EH7A 3K0LA 4FX0A 5LGUA 2RVCA 1ZG1A 3EUHA 2BBYA 2ZJ2A 3K1MA 2M30A 3HYIA 2YSRA 2GA2A 3CUQA 2KJCA 4Z2YA 1BBYA 3V8LA 3M1EA 1LDDA 4OIPF 2P5LC 5DDGA 3I71A 2NRAC 1P92A 1U6GA 4LB5A 1J2XA 3IWZA 4I0BA 1P6RA 4LFUA 2DW4A 3RYPA 2QQBA 3C3WA 4ZYDA 4G94A 3ZMVA 4G6QA 3SQNA 4RGSA 1J5YA 1HBXG 1RNLA 2LSOA 5JHUA 1DDNA 4FT8A 2YX4A 3FM3A 2PLYA 5ICCA 3ZMTA 3F21A 2XUBA 1ZRCA 3WTUC 2HTJA 4H0EA 4BHPA 1BC8C 2QQ9A 1YS6A 4ON0A 4HV5A 4M74A 4KIGA 2QBYA 1EV7A 3WTZA 4Q4ZF 4U7DA 1Q1HA 3J81K 2L02A 4Y15A 2E1CA 3FM5A 3JW4A 4R8HA 2UXNA 1HQCA 1FWZA 2QM3A 2EB7A 1WRJA 1U2WA 2J5OA 1H9GA 2CFXA 5KVRA 4BHBA 3GF2A 4IVNA 1U78A 5D4SA 4HF2A 3WU0A 5HLHA 3LA3A 4IF4A 3RPQA 2CW0F 3D5LA 5DEQA 3BPVA 2CYYA 2MH2A 5L3BA 4BHCA 1UHMA 2XAGA 3R0JA 2K02A 2IA0A 2K7LA 3RDIA 3ULQB 1BI1A 1JHFA 4AD9A 2CWEA 4EV0A 4GYGA 5LEJA 5CLSA 4EVIA 3QP5A 3BOQA 4AIHA 2FRHA 2IVMA 3DV8A 3H92A 3IKTA 2V1XA 1XMKA 5JI6A 1S3JA 5F64A 1ZN2A 2K86A 3F8MA 5D6FA 1LDJA 2Q0OA 4ASNA 2HTSA 2OZUA 1YW8A 3GLXA 3RKXA 2V1DA 3O3KA 1KU9A 3GFIA 2ZCWA 1XDSA 2VODA 2A69F 1R36A 4BXUA 3QP6A 4ZYEA 1E2XA 1OR7A 1UCRA 3KP4A 3P9KA 2P7CB 2EWNA 3QPHA 3K69A 3WTYC 5HDKA 2HEOA 1BC7C 5LRSA 3HUGA 1BM9A 1TBXA 3CTAA 3K1NA 1ZREA 5HOOA 1OMIA 3FMRA 1MKMA 4KT5C 3KLNA 3RIRA 4A2UA 1T0FA 2VOPA 4MTEA 1RZ4A 5H6RA 1J75A 1L3LA 2P6TA 2JPCA 1LVAA 2PMUA 2GXBA 1KQ9A 1FPQA 2EV5A 3V4GA 4HA8A 2P7VB 2K4BA 2BYVE 3I59B 3R60A 2R3SA 4RB3C 2DO7A 1SD5A 2A6EF 3BJ6A 4XBFA 3WTVC 2H94A 2JT1A 1V4RA 4L18B 5DUIA 1PP8F 2H09A 1FY7A 3ECHA 2WTEA 3GXOA 5LEKA 2QLZA 3DP7A 3FWEA 2EFQA 4Q5SF 4CO8A 3E6CC 3T5XA 5JR3A 1R00A 5ILUA 4UHTA 5A2QK 5K1YA 4PGHA 4UVAA 4KYWA 4LLLA 1R1UA 2HR3A 3SFZA 1ZHFA 4RAZA 2OAZA 3GUDA 5E17F 1HW5A 2RDPA 5AONA 1KYWA 3F8CA 5DYMA 2Z99A 3TGNA 2WWYA 2A68F 4UVCA 2G7UA 4EJOA 2M87A 2STTA 5LBQA 3GO5A 4RS8A 4DNCA 3ZMUA 3V8KA 1XD7A 3M7GA 3HRTA 5AIQA 1LJ9A 4GYIA 4ESJA 5CVIA 3AAFA 3CDHA 3DF8A 3I64A 2PI0A 1P4AA 3R6SA 4BQAA 4O3MA 2ZFWA 1XCVA 3MZHA 2VBXA 3WGHA 1DUXC 2D1VA 2QZ8A 3MAJA 1ZLKA 4A6EA 1YYVA 2UZKA 1USSA 2F5EA 1XCBA 3RKYA 3SXYA 3IWFA 5H6QA 2XAJA 2RC4A 4OIOF 3KP3A 2QYOA 1H9TA 2JRTA 4KMFA 3GWZA 4ZYHA 3WODF 1DP7P 3IRRA 5H20A 3I58A 2A6HF 3VB2A 3EYYA 4EJTA 3DEUA 3L9FA 3WE3A 1BIBA 1BIAA 2XKPA 2L01A 1ON2A 1FOKA 5DCMA 4RB1A 3GFLA 1TNSA 1SD4A 1KU2A 4Y13A 1K79A 3DPTA 4RGXA 2DK8A 1KYZA 2MC3A 4UV8A 5E1ZB 3T0YA 5L3GA 3C1DA 1HW2A 2DU9A 2FU4A 5D5VB 3W6JB 2QQAA 3IHUA 3FXUA 2FBIA 3GW2A 2QENA 1VTNC 2DPUA 2C6YA 3ZMDA 5DCMB 1S7AA 3VODA 2VE8A 1X3UA 2ISYA 1Z1DA 1SD7A 2COMA 1R58A 4G9YA 1P2FA 2VBZA 3CLOA 2GWRA 4WCGA 4U7BA 3LAPA 3PQJA 4LLNA 3HOSA 3TDUC 1D8JA 4HF1A 3F23A 2P5VA 3NQOA 4CDGA 3M8EA 2R7DA 2ZBKA 3ABTA 1ZGJA 3WGIA 1FZPB 4KIFA 4EM1A 4PGGA 3DPLC 2FBKA 3WGGA 1F4KA 2XROA 2ZMEA 3L09A 4R79A 1R22A 4N9IA 2L4MA 3NEUA 2LKPA 1AOYA 2HS5A 2HQRA 3RTRA 2KRFA 2FXAA 2FSWA 3ROUA 5HLGA 3I4PA 2ACJA 2OBPA 3QAHA 3EQLF 3O6BB 4EM2A 1IRFA 4DQ2A 2QBYB 1HXDA 2G9WA 4IPAA 3H3UA 3KCCA 3T8RA 3B73A 5F1RA 1HKTA 2OQGA 2KIMA 1QO0D 4A5NA 1IW7F 4L9TA 4HLXA 1ZG3A 2V6CA 1XSDA 3U2RA 2XIGA 3GFJA 4RB2C 1TW3A 2FNAA 3M9AA 3KETA 3GX4X 2GZWA 4FHTA 2HKOA 4JBAA 2CGPA 3I54A 1KQ8A 3P9CA 4HX4A 3RI4A 5BPDA 1TQMA 1LNWA 1OKRA 1O7LA 2ELHA 3MEXA 3QU3A 3VOEA 4FX4A 4WF2A 2NS0A 4M6XA 5L3DA 2VBYA 2BE5F 2YU3A 3KP6A 1SAXA 2W25A 3L2CA 4RGUA 1JE8A 2VXZA 4LB6B 5J6XA 4A0YA 3FMQA 4IJAA 4LMYA 5D8LB 1IN4A 1FSHA 3E6BA 2WV0A 5EEHA 1BI2A 2A07F 4MNUA 2FQ3A 1KU3A 1FNNA 4PDKA 1FBSA 1FP2A 3T8TA 2D2WA 4K2EA 3L00A 1FYLA 3I59A 4YFXF 1DPUA 3JAMK 2XHKA 3VEPA 4I2OA 3COAC 1KGSA 3I5UA 5HVQC 2ADUA 4M9ZA 3R0AA 1J9IA 4CYDA 4YIFA 5AIPA 1B4AA 4WXDA 3BZ6A 5BQTA 4I09A 4AWXB 2A5YB 3Q9VA 2FMYA 5LHIA 3ZQ7A 1KQ0A 1FLIA 4L0YB 4EGYA 5LHGA 5TRDA 3GZ5A 3W6KB 3KEOA 1T39A 2UWMA 5J8FA 2FA5A 1U5TC 4CXFA 2HYFA 2DLLA 3N4MA 4KNYA 2Q2EA 1ZG5A 1TLHB 5LLQA 3H3ZA 3SHFA 5CVRA 2VT2A 4OOIA 2WC2A 3IKVA 2MLGA 2Z33A 3WU1B 2Y48A 3HIFA 2ZNZA 1RIOH 4XLNF 1WQ2A 2Z9OA 2MLKA 3P9IA 2EK5A 3WTSC 4LJZF 3LFKA 3G3ZA 1HSJA 4CGZA 2NNNA 4IHTA 2K27A 5ILVA 4L5JA 4KDPA 4XSZF 1GXPA 2BGCA 4EQQA 1ZRFA 3BY6A 1MJAA 3PFIA 1PDNC 2HWVA 4RAYA 2ZMEB 4YFNF 4O6JA 1IRGA 1MGTA 2PBIA 1R23A 2B0LA 2Y75A 4HZFA 1E17A 4BH9A 3FF5A 4QLCU 2LNBA 2EV0A 4KMUX 2D45A 2KJBA 2Q8KA 1HSTA 2DAOA 4OMYA 2M1BA 1W5SA 4B8XA 4M73A 4OMZA 1I27A 1FYKA 2NNYA 3E6MA 5L3CA 4L9JA 3FMSA 3E3VA 5E18F 1REPC 5F6FA 4E70A 2FE3A 5HS7A 1F1ZA 3DQVC 1J59A 3ISPA 3LA7A 4EGZA 5K5OA 1G3WA 4MHGA 2PFBA 2JSCA 3CUOA 4KFCA 5BPIA 3F3XA 1XDUA 4CZZA 1EH6A 4NB5A 1S29A 3REOA 1L0OC 2H6BA 2P8TA 1QNTA 1B9NA 4A0ZA 3E5QA 1G3TA 3E5UA 1YW9A 5ILSA 1YLFA 2RQPA 1ODDA 3MCZA 3JSOA 2HKXA 1FBQA 1B6AA 3I0TA 1HW1A 5CVVA 1U8RA 3EETA 3TO7A 1TW2A 5IT9Z 2ZO4A 1CF7B 3S2WA 2HDCA 2XAFA 4NQWA 1ZGAA 4Q47A 1ZH5A 4IRGA 4F7ZA 3JTGA 2H27A 1LDKB 1YS7A 2V1UA 1YQAA 1Z7UA 4ZZDA 3HOTA 3F72A 3LSTA 1YO5C 3BPXA 3QOPA 3LWFA 1TNTA 1Z05A 1SFEA 2KIUA 3TKYA 4LG0A 1MDMA 1ZRDA 2DTRA 1D5VA 4IHSA 2K4JA 5L3EA 4YFKF 4GO1A 3WTTC 1RUOA 1MD0A 4GXOA 4LK0F 2JPBA 2F5CA 5KK1A 3TO6A 1EH8A 3KLOA 1H0MA 3K2ZA 3LQRA 1TTYA 5FFZA 4B09A 2RV8A 2VOOA 2O0YA 2DI3A 2P4WA 1WI9A 2J5PA 3GEZA 2OQRA 2RGVA 1ONVA 4OU0A 4BYYA 1KU7A 1ZYRF 2GAUA 1KA8A 4MEYF 2PG4A 3G73A 1P4WA 5FFXA 2DBBA 1T38A 3OOPA 5ICEA 3SZTA 4ENNA 1MJ9A 3HRMA 3FXRA 3CUQC 2G7HA 3CUQB 2Z3YA 2HZTA 5E1XA 2PJPA 4HOBA 1IF1A 4OIQF 3ZN0A 1S8NA 1S6LA 2DK5A 5FB2A 1ZLJA 5A2QZ 1BI3A 4WX9A 2VE9A 1Y0UA 1UHWA 3F8FA 1GHCA 4N9HA 1FSEA 4S04A 3MFKA 4LK1F 3RJPA 5E1WA 2CSOA 3KP7A 1R7JA 3LAJA 2RN7A 1W7PA 3KP5A 2X0LA 1CGPA 4I01A 4D0PA 2ZNYA 2IA2A 3VFZA 1PUEE 2RNJA 5CYVA 5HDNA 3ZP5A 3TOBA 2CQKA 5FLXK 3LA2A 5E20A 5HDGA 2JTVA 4UNOA 1R5GA 1XB4A 1FT9A 2A61A 2FF4A 1XGSA 1SMTA 5EEGA 1YFHA 4ZZLA 2F5FA 1IN7A 3CJNA 4KIBA 3U9GA 5BOXA 3SZPA 1O57A 1B59A 3ABUA 2P5KA 1MZBA 4A5MA 3QU6A 3J80Z 3TOAA 1P4XA 4M9SA 1Z6TA 5D4RA 5E8IA 2M45A 3GVAA 1STZA 3CO7C 2HFHA 2KIFA 5ED4A 1J0RA 5JVTA 3D0SA 1IZ1A 2D1HA 3T1BA 2R7FA 3KZZA 3HRUA 4HDUA 1U5TA 4MGRA 3ZN1A 1K7AA 4QWQA 4LGWA 2MH9A 1ZARA 3MWMA 3KEQA 3BP8A 3N97A 4G7HF 1K6OA 2MA3A 3HSRA 4MQVA 4KA4A 2XASA 2M5WA 4Q48A 1FX7A 1GXQA 1R1VA 3E5XA 5LGNA 4ESFA 2H6CA 4A0XA 2XGXA 3J7AO 4JK1X 1SD6A 2FMLA 1LEAA 4ETSA 1UFMA 2EA2A 5D5UB 4G8XA 2QUFA 5DCFA 5ICGA 3TDZC 5FD5A 3Q5FA 2IPQX 1K78A 4UV9A 1OYYA 1BOAA 4M72A 3BDDA 1A04A 4WWCA 4MEXF 1RUNA 2W24A 3ECOA 3ELKA 4N0BA 5HS9A 3F8NA 3HHGA 2MD5A 1Z9CA 1G3SA 2V9VA 2XAQA 2FEZA 4PCQA 4I0AA 2OU2A 5IT3A 4WK8F 2HGCA 1OYIA 2X4HA 3KZYA 4NHJA 3V7RA 2KKOA 2GA1A 2DQLA 2TDXA 3O2PE 5JFRA 3Q9SA 2F5DA 4S05A 4MQ9F 5CJ9A 1YIOA 2ISZA 2CG4A 5FGMA 1G4DA 3IL2A 4HBLA 1HKSA 2V79A 4HQMA 2IT0A 2IA1A 6PAXA 4XLPF 5FO5A 3K9TA 2BV6A 4O5VA 4OINF 4JQFA 2STWA 4G7ZF 3HSFA 1ZAOA 2XVCA 1T2KA 2E7WA 2PN6A 1Z6RA 1NHAA 3BWGA 4U0WA 2ZXJA 5DD4A 3JTHA 1IN5A 4UUVA 2DQRA 3ERED 4P55A 5CVJA 3GZ6A 3BJOA 2XKOA 2P6SA 5TJJA 5BMZA 1JXSA 3E97A 1XN7A 5DD8A 3V7CA 1W7PD 2VC0A 4U0VA 4AIKA 1W7PB 5D6EA 5HLIA 1BN5A 1IN6A 2XV4S 1D3YA 4AVPA 1F9NA 2GIVA 2EFOA 2HOEA 4M71A 4HYEA 5ICFA 1IXCA 4GGGA 1XSVA 4UXNA 2BEOA 2E1NA 3KE2A 3ZMZA 4G7OF 4A6DA 2FBHA 2FNPA 2GQQA 4I02A 2HQNA 4ZH4F 1XMAA 2CO5A 2A3SA 1T6SA 2FOKA 4ENKA 4P5OA 1LQ1A 3J81Z 1IUYA 4R1HA 5ERIA 4MTDA 1FP1D 4I7HA 2VC1A 2HYGD 3DKWA 4HX7A 2YR2A 3DXJF 1XGNA 3WE2A 3EDPA 2O3FA 3QRFF 1HKQA 5D5XB 2VBWA 5D5WB 1U3EM 3PQKA 1MDMB 4HV6A 1WWXA 4M9XA 1G6NA 5K5RA 5CVUA 5BS6A 1QQIA 2O03A 1V3FA 1K78B 1IXSB 4EJUA 4HX8A 1QGPA 3QPTA 1JGSA 2LDUA 2OD5A 3KP2A 4Y17A 1MJBA 4HQEA 3F6VA 2AS5F 4KICA 2GXGA 4BAYA 2LF7A 1AWCA 3FXQA 1YW7A 1ULYA 5DUKA 4WXCA 1FBUA 1LB2A 2Y0MA 1TQIA 1J7KA 3ZMSA 1USTA 4M6YA 3FZVA 3BJAA 2RKHA 3FHZA 3HRSA 2YPRA 3V7SA 5DV5A 1F5TA 1OPCA 4HLYA 2NAZA 4RGRA 2QVOA 5LHHA 2LF8A 2AXLA 2EFWA 1IXRC 2L4AA 3J80K 1TQPA 4YIIA 3HTUA 2W85A 1B1BA 1I1SA 4P96A 4BNCA 1B9MA 2PMHA 3BROA 2L54A 2M8EA 1BJAA 4HAMA 3MQ0A 4IXAA 2ESHA 2EA4A 1GVJA 3HSEA 3ZPLA 3F6OA 1SMYF 5J8CA 5HS8A 2OA4A 4L5IA 4PZJA 2IJLA 1C0WA 3L7WA 3CO6C 3TQNA 3M8FA 2VONA 5D8KB 3HHHA 4IRHA 2ESNA 4AIJA 4ENMA 3EYIA 1W4MA 1ON1A 1S7OA 3NRVA 2DT5A 4XSXF 4ENJA 5K5QA 1I5ZA 3IC7A 1QZYA 4LLGF 2VN2A 3LQQA 4YG2F 2PEXA 4OIRF 1YTYA 4A12A 3B02A 2O8XA 1FYMA 4HF0A 1YG2A 3K1PA 3RKWA 3GYHX 1T98A 3RYRA 2W84A 2DPDA 4U0YA 2XRNA 1WSUA 2JZYA 2OZ6A 2YX7A 3I53A 1QBJA 2F2EA 4EJVA 2IP2A 2XAHA 3U1DA 3IRQA 1QPMA 1I1GA 1JHHA 1UB9A 2VT3A 2NYXA 4L9NA 2ETHA 3WTWC 1Z91A 4GCVA 1U5TB 1BI0A 4KN4X 5LGTA 2IRFG 1RI7A 1LEBA 3TO9A 4LD5A 1XGOA 1O3QA 4U88A 5LRRA 3ML6A 4XRFA 1O7FA 3C7JA 4ZYGA 1XSXA
chains in the Genus database with same CATH superfamily
3GFMA 2EJRA 2HQ5A 4EM0B 1Z21A 3DFGA 3GTKJ 2DFIA 4L9VA 1NH3A 1WJDA 3DBRB 3JCUC 2QA4I 4EMSA 2CV0A 1MNMC 1DPRA 1O3SA 1D8KA 3C18A 4HDVA 3ESWB 1XGMA 4P9FA 2AHQA 2ZKZA 3HTSB 2AQEA 3JSPA 3D5SC 1IAWA 2MBFA 3R4KA 1RC9A 5K7HA 3DLAA 1Y39A 3P7NA 1SFUA 1FMWA 4KUMA 4NDLA 4DYRA 2YS9A 2DXIA 1IN8A 2IW5A 4UVBA 1PVEA 1R5HA 3FBIB 2EV6A 2GOXB 3BZCA 4IRIA 2O61A 2EFNA 1B8IA 5E8GA 4KN7X 2EFPA 3JAMZ 4QTRA 4YRVA 2E7XA 3WG9A 3FBNB 1O3RA 5DM6F 3F8BA 3FX3A 3FXKA 4LG0B 2UXXA 2CV1A 3SJMA 3ZGKA 1N78A 2Z5UA 5L3FA 1T8IA 1PP7U 1WKMA 3E6DA 5EYRA 3ZQFA 3CCLI 4XOTA 1SFXA 2XSDC 5IT9K 4HW0A 1G3YA 5E3MA 5M3FJ 3R61A 1R1TA 1D1CA 4RAGA 1OYWA 1FC3A 1ACIA 3OSGA 3AL0B 1Z67A 1QZZA 3KFWX 4JX6A 2CV2A 3BC8A 2PQ8A 3OV8A 4EEFG 3HJEA 4F3QA 4IQ4A 1I6XA 3FXJA 3MZYA 4RB0A 2KZGA 3V8JA 2W57A 4EJWA 5FD6A 3H5AA 1X19A 3BTLA 4I98B 4WXHA 4MLOA 5GP9A 3WTXC 1ZR2A 3QYFA 1HA8A 4L0ZB 2CW8A 2WAEA 2QWWA 1T08B 3QPLA 3ZQIA 4G6DA 4ESBA 3TP0A 2R7SA 2O6GE 1W0TA 2K9QA 4P9UA 4CICA 3NARA 4E7IA 3RPUA 4NQWB 3FKJA 4TV7A 1W5TA 1CF7A 1TWFJ 2BY2A 2HXIA 5FLXZ 1S9HA 3L2QA 1O3TA 4CHUA 3M3YJ 4FASD 1TWCJ 1JKQC 2V6EA 2L3DA 2V1NA 3F22A 4I6ZA 1EH7A 1X1DA 2OF7A 3K0LA 4FX0A 5LGUA 2RVCA 1ZG1A 2XPUA 3ABLH 4LOCA 3EUHA 2ZJ2A 2BBYA 2E35A 3K1MA 4M3BA 2M30A 3HYIA 1KZHA 5FLMJ 3RSNA 3CZ6A 2YSRA 2GA2A 3CUQA 2KJCA 4Z2YA 4XRSG 3H35A 1BBYA 3TMOA 3V8LA 3M1EA 1LDDA 1A6QA 4OIPF 2P5LC 5DDGA 4GFBA 3I71A 2NRAC 2YU9J 1P92A 2A5WA 1U6GA 2DMQA 1ORKA 4LB5A 4PJMA 1J2XA 3IWZA 4IOCF 4I0BA 1P6RA 1E3PA 4LFUA 2DW4A 3RYPA 2QQBA 3C3WA 4DBRA 2LY2A 4ZYDA 4G94A 3ZMVA 5EGOB 3BQZA 4G6QA 3U21A 1VFCA 3SQNA 4RGSA 1J5YA 1HBXG 4FTHA 3DU6A 1MMNA 1RNLA 2JMWA 3CJTB 2LSOA 5JHUA 1DDNA 4FT8A 2O5RA 2YX4A 3FM3A 3ZQGA 3I55I 1DU0A 5GPCA 1EJ9A 2PLYA 3LSMA 2HOAA 4RDUA 5ICCA 2CW7A 3S1MJ 3ZMTA 4E7KA 3DKXA 3F21A 2XUBA 1ZRCA 3WTUC 2EILH 3HPGA 2HTJA 3UNGC 4DIQA 1XPXA 1QVTA 4H0EA 4BHPA 1BC8C 2QQ9A 3SEZA 1YS6A 4ON0A 4HV5A 4M74A 1T95A 3S32A 2WV1A 1MSFC 4KIGA 2QBYA 1EV7A 3WTZA 3G6EI 2F4MB 4Q4ZF 4U7DA 1Q1HA 3J81K 2L02A 4Y15A 3CCJI 2XF5A 3FM5A 3JW4A 2E1CA 3FIWA 4R8HA 1H88C 4ZDLA 2OV7A 2UXNA 3FKIJ 2H8RA 4MFDA 3PNYA 1HQCA 1ZELA 2CMPA 1FWZA 2QM3A 2VJJA 2EB7A 1WRJA 1U2WA 1MMGA 1VQOI 2B7EA 4CCNA 2J5OA 4HPQA 1H9GA 2CFXA 4IZZA 2VB6A 2EIMH 1IG7A 4CYCA 5KVRA 4BHBA 3OYGA 4XL9A 5M3MJ 2IAIA 2VQHA 2DMPA 1IRXA 3GF2A 4IVNA 1U78A 5D4SA 4HF2A 1FMVA 2HVSA 3WU0A 2E1OA 5HLHA 3LA3A 4E7LA 4IF4A 2L9RA 3RPQA 4BGDA 2CW0F 3D5LA 5DEQA 3CJQB 5IP7J 3BPVA 4X1EA 2CYYA 3RZDJ 2MH2A 3CP2A 4AYBN 4HRIA 2CH0A 4JOMA 4X6AJ 3CF5F 4CCOA 2DA6A 5L3BA 4BHCA 2EIJH 3G1LA 1UHMA 2TRTA 2XAGA 3R0JA 2K02A 3ZQQA 4C9YA 3DPUA 1ITYA 2IA0A 2K7LA 3RDIA 3ULQB 3O8HA 1BI1A 3K4JA 2M34A 1OCPA 2DT7B 3OIPA 1JHFA 4Y3OA 5GAEJ 1W0UA 2VI6A 4AD9A 1A6IA 5C3EJ 3OS0A 4FQGA 2CWEA 1WHUA 4EV0A 4GYGA 2KP6A 5LEJA 5CLSA 2LG4A 4EVIA 3DWLE 3QP5A 3BOQA 1ENHA 1OISA 4AIHA 5DS9A 3MZ8A 2FRHA 2IVMA 3DU5A 3DV8A 3K10A 3H92A 3ZXSA 3RCOA 3IKTA 2V1XA 1XMKA 5JI6A 1S3JA 4DJAA 5F64A 1ZN2A 2K86A 3F8MA 4NC8A 5D6FA 1LDJA 2Q0OA 4ASNA 2HTSA 2OZUA 4B4CA 5TGTA 1YW8A 2ZB9A 3GLXA 3RKXA 2DYSH 2V1DA 1IO2A 1MMSA 1MH3A 3O3KA 1KU9A 2HI3A 2ZCWA 4V2GA 3GFIA 1ETWA 1XDSA 2VODA 2A69F 3HG9A 3OYCA 1R36A 4BXUA 3AG3H 2OUMA 3QP6A 2HOTA 4ZYEA 2FUG2 3KYCB 1E2XA 2VPRA 1OR7A 1UCRA 4BJ6C 3KP4A 4V19K 3HOWJ 4PJLA 3KEYA 3P9KA 3KYLA 2P7CB 2EWNA 3QPHA 5K7FA 1H8AC 2VJ5A 1OCRH 2GXAA 3K69A 3WTYC 4BE0A 1MBFA 5HDKA 2HEOA 1BC7C 5LRSA 2HU9A 3HUGA 1BM9A 1TBXA 3CTAA 3CCEI 3K1NA 1Y8RB 3SDBA 1ZREA 2LREA 2VKEA 2Z2SB 3TL4X 5HOOA 1OMIA 3FMRA 1MKMA 1O4XA 1XC5A 4KT5C 1R4MB 2KQRA 2M7BA 4IKFA 3KLNA 3OYIA 3RIRA 4RMNA 4A2UA 1T0FA 2Y31A 2VOPA 1UHSA 4MTEA 3VWBA 1RZ4A 2X1CA 2H1KA 5H6RA 1J75A 2O8KA 1L3LA 2P6TA 2JPCA 1V54H 3NWSA 2OPTA 3BZKA 3GTGJ 3I4MJ 1LVAA 2PMUA 4A93J 2GXBA 1KQ9A 1FPQA 4BACA 2QSGX 2EV5A 3V4GA 4HA8A 2P7VB 2K4BA 2JUGA 4LITA 2BYVE 1F36A 2LY9A 3I59B 3R60A 2R3SA 1UZCA 2ZSIB 4RB3C 2DO7A 1SD5A 2A6EF 3S93A 1ZKGA 3CC7I 3BJ6A 1CQTA 4XBFA 3WTVC 3S17J 2HNHA 4C3HJ 1LPQA 3I3LA 4C2MJ 2HVQA 2H94A 2LBFB 2JT1A 1V4RA 2L0KA 4DOZA 5EEAA 2MD0A 4L18B 5DUIA 3MMYB 1PP8F 2H09A 4QPQA 4AVZA 1FY7A 3HPHA 2EZKA 2LFBA 3ECHA 4BE1A 2EBIA 2WTEA 3GXOA 4L5EA 5LEKA 2M2EA 2QLZA 3DP7A 3FWEA 5EJCA 1AKHB 5HNFA 3PIOF 2EFQA 3S16J 4AIDA 4Q5SF 3U1KA 4CO8A 1PJRA 3E6CC 2W82A 4CUGA 4XMYA 3AFHA 3A01A 3T5XA 5JR3A 1JKOC 4XOPA 1R00A 1SEUA 5ILUA 1GV2A 2YUSA 1MBGA 4UHTA 5A2QK 2L2OA 3HB9A 2TCTA 4PGHA 1V5FA 4UVAA 5K1YA 3LSKA 4KYWA 4LLLA 2VPLA 1R1UA 4B3AA 2HDDA 2HR3A 3HC7A 3SFZA 1HDPA 1XX5A 1ZHFA 4RAZA 1X2NA 2OAZA 3GUDA 5HODA 1GT0C 5E17F 4BY7J 4OAYA 4UY8I 2ME0A 2JQ7A 1HW5A 2E34A 1IV8A 1LE8A 2W00A 5JHFA 2RDPA 5AONA 4F55A 5FKOA 1KYWA 3F8CA 5DYMA 3M4OJ 1HLVA 3MD2A 1IRZA 3ZOBA 4XN0A 2NS8A 2H1LA 1EKEA 1ZR4A 2Z99A 2XPWA 3TGNA 1D0ZA 1FTTA 2FQ4A 2QQ8A 5GADJ 2E1MC 2WWYA 2A68F 4UVCA 2G7UA 3UR3C 4I76A 2MSYA 4EJOA 3ZR8X 2M87A 3JRFA 2STTA 5LBQA 3GO5A 4RM2A 4RS8A 4DNCA 3ZMUA 1Y6IA 5GTHC 3OYLA 3V8KA 2E2HJ 1XD7A 3M7GA 3HRTA 2K40A 1DP3A 4CCLA 2E36A 3OYEA 5AIQA 2F4OB 1LJ9A 4GYIA 4ESJA 5CVIA 1TT0A 5FKNA 3AAFA 3CDHA 3D1NI 3DF8A 3I64A 2LBFA 3OYJA 1Y1VJ 2DOEA 2PI0A 2JRMA 1P4AA 3R6SA 4BQAA 1VQNI 4FISA 5TISC 4F52A 4O3MA 2GIZA 3OS1A 3OR1C 2ZFWA 1XCVA 2R5YB 3MZHA 4D9JA 2VBXA 3WGHA 1DUXC 4EATA 2D1VA 2QZ8A 3MAJA 1ZLKA 2X1EA 4A6EA 1YYVA 2W7NA 2UZKA 3K4BA 1USSA 2CQNA 2F5EA 1XCBA 2NXNB 3RKYA 3SXYA 2R93J 3H3VK 3IWFA 5EZGA 2MG4A 5H6QA 2XAJA 3ZQLA 2RC4A 4OIOF 3KP3A 1K6YA 2QYOA 1H9TA 2JRTA 3PNTA 4KMFA 3GWZA 4ZYHA 3WODF 1S5LC 1DP7P 3IRRA 5H20A 3I58A 2A6HF 3VB2A 2BOLA 2IS2A 2XB5A 1R71A 2L7FP 3WG7H 3EYYA 2BY0A 2PJRA 4EJTA 3DEUA 3L9FA 3OOUA 3WE3A 1BIBA 1BIAA 1AU7A 3QODA 1HDDC 2Y9ZA 4D7MA 2XKPA 4QIWN 1YJ9I 2L01A 3CDLA 1ON2A 4IO9F 1FOKA 1BR1A 5DCMA 4RB1A 2IS4A 3GFLA 1TNSA 1SD4A 2VJIA 2JWTA 4DW6A 2LP0A 1MH4A 4A3BJ 4XM3A 3A03A 1KU2A 4Y13A 1K79A 3DPTA 3LSIA 4RGXA 2CUJA 2IS1A 1SVOA 2DK8A 2GLOA 1DQUA 2DJNA 2CQ7A 2LVSA 2K3FA 1KYZA 4G12A 2MC3A 2QKLB 4UV8A 5E1ZB 1PUFB 3T0YA 5L3GA 1Z77A 2UV1A 3K4KA 3BTJA 1OCOH 3C1DA 1HW2A 3OYHA 2DU9A 1RESA 2FU4A 5D5VB 4ZYAA 2QQAA 3W6JB 3IHUA 4M3FA 3FXUA 1YHQI 4XN3A 1MNDA 2FJ1A 2FBIA 3GW2A 2QENA 2VQGA 3PUBA 3GTOJ 1VTNC 2L7KA 2DPUA 2C6YA 2BHYA 3ZMDA 4BXFA 1Q1VA 3S1NJ 5DCMB 3OL3A 3F0CA 1S7AA 3VODA 2GBYA 2VE8A 3MKWB 3S3MA 1X3UA 3PUFA 2ISYA 1Z1DA 1SD7A 2COMA 3C2BA 1R58A 4G9YA 2KZVA 2VJ4A 1P2FA 2VBZA 3FXMA 1WJBA 3CLOA 2GWRA 3V42A 3DEWA 4A69C 4WCGA 4U7BA 3LAPA 4PSWA 3PQJA 1WJCA 3W3CA 3OYFA 3QQAA 3HOSA 1RRJA 4LLNA 3TDUC 1D1BA 5E3OA 1D8JA 4HF1A 3F23A 2P5VA 2VL8A 4A3JJ 1XS9A 3NQOA 4CDGA 3FHNA 1OJLA 3M8EA 2R7DA 2I5UA 2FX0A 2ZBKA 2V9PA 3ABTA 1ZGJA 3LSPA 5IYBJ 3WGIA 1DU6A 1FZPB 4HSRA 4KIFA 4EM1A 2BHZA 4PGGA 2DN0A 3DPLC 1WCMJ 3LFUA 1VQ6I 4IHYA 2FBKA 2DA7A 3WGGA 1F4KA 2XROA 2R5ZA 1JJ6C 2ZMEA 3N05A 1QPIA 3L09A 4R79A 2V7FA 1R22A 4N9IA 4G6TB 1FOXA 2EZIA 2L4MA 3NEUA 2LKPA 4ZTFA 4V2FA 1ZK8A 1AOYA 4JP0A 2HS5A 2BY1A 1VNDA 2HQRA 3RTRA 1SFKA 2KRFA 2FXAA 5DM7F 2FSWA 3ROUA 1OCTC 4S0HB 5HLGA 2KPMA 3I4PA 3OR2C 2Y30A 2ACJA 3VYTB 4CCJA 3HL2A 3F9KA 1U9OA 2OBPA 3QAHA 3H9GA 4XIDA 3I56I 3EQLF 3O6BB 3OYMA 3DBHB 3H0GJ 4EM2A 2E2IJ 1IRFA 2R7WA 4DQ2A 2QBYB 3JRGA 1HXDA 2G9WA 4IPAA 2M7AA 3H3UA 1UJ8A 3KCCA 3T8RA 3B73A 1E3HA 2KMUA 5F1RA 1HKTA 2OQGA 2KIMA 1QO0D 4A5NA 5C4XJ 1IW7F 4L9TA 4HLXA 1ZG3A 2V6CA 1XSDA 4PJNA 3U2RA 4DGWB 3KZIC 2XIGA 1LE8B 3GFJA 2DOFA 4RB2C 1TP4A 3CF2A 1GLNA 1E0EA 5GAHJ 2MABA 1TW3A 4DBQA 2XSJC 4W1UA 2FNAA 4RLFA 3M9AA 3KETA 4JYKA 4J01A 1OLTA 1GUUA 4BS9A 2Q2EB 3L2RA 3GX4X 4PSXA 1LFUP 2GZWA 4FHTA 5EZHA 2HKOA 4JBAA 2X1DA 1G8XA 2CGPA 1W36C 2M9HA 2ZXHA 5CQEA 2BVMA 3I54A 1KQ8A 3P9CA 4HX4A 4B48A 3RI4A 4B1RA 5BPDA 1TQMA 3G71I 4M3EA 2DA2A 1LNWA 1OKRA 1O7LA 2ELHA 3MEXA 3QU3A 5CQGA 3VOEA 4BE2A 4FX4A 1IGNA 4WF2A 2NS0A 4M6XA 5L3DA 2VBYA 2FD5A 3BR5A 2BE5F 2YU3A 3KP6A 1SAXA 2W25A 3L2CA 2OCCH 4RGUA 4ZDPA 1JE8A 5J1UA 2VXZA 4A3FJ 2A05A 3OY9A 4LB6B 5J6XA 4A0YA 4Z6YA 3FMQA 4IJAA 4LMYA 4C3IJ 5D8LB 4HNVA 1IN4A 3K4CA 2DFHA 3CMEI 1FSHA 3E6BA 2WV0A 5EEHA 2F48A 1BI2A 2A07F 4MNUA 1ERDA 2XRLA 3HBLA 2FQ3A 1KU3A 1FNNA 4PDKA 1FBSA 1BL0A 1FP2A 3T8TA 2D2WA 1JKPC 4K2EA 3L00A 1FYLA 2R7XA 1BOBA 4NC7A 3I59A 4YFXF 3OWTA 1DPUA 4UUSA 4UUSB 4CZCA 3JAMK 2XHKA 3DTKA 3VEPA 4I2OA 3COAC 1ETOA 3Q0UA 3FISA 1KGSA 2LOOA 2EINH 2M8GX 2K3PA 4LIVA 1S7EA 3E7LA 3IH3A 3VYRB 1D1AA 3I5UA 5HVQC 2R5YA 4QSHA 3CDIA 5IPAA 2ADUA 4D7NA 4M9ZA 3R0AA 1J9IA 2I10A 4CYDA 4BL0B 3S2DJ 4YIFA 1I3QJ 3OYAA 5AIPA 1ZGWA 1B4AA 4WXDA 3OYBA 2Q1ZB 3BZ6A 5BQTA 4I09A 3G2BA 1WH7A 4AWXB 3BR2A 1FIPA 1WJAA 5GPAA 2A5YB 1HC8A 3Q9VA 1QA6A 3JRCA 3AG2H 4J19A 2FMYA 5LHIA 3HUGB 3WHCA 3ZQ7A 1KQ0A 1U8BA 4PUSA 3L1PA 4HSTA 3JREA 2BZTA 1FLIA 5E79C 3SYTA 1FOYA 4CSWA 4L0YB 4EGYA 4KISA 3BCBA 4D5CA 5B66C 1APLC 1NG6A 1XMXA 2R4GA 5LHGA 5TRDA 1VQ5I 3I9V2 3GZ5A 2COBA 3X2QH 4C2UA 3W6KB 3KEOA 1T39A 1B8IB 2DJIA 2UWMA 1UELB 5J8FA 1MBKA 2FA5A 1U5TC 3CCYA 1X4PA 2HYFA 4CXFA 2DLLA 3N4MA 2L7ZA 4X0GA 4KNYA 3C2GA 2Q2EA 5F0FA 1ZG5A 2ELKA 4HG2A 1TLHB 4DZPA 3H3ZA 5LLQA 3SHFA 5CVRA 2VT2A 4OOIA 3K70D 2JVGA 2WC2A 3IKVA 2MLGA 2ICWG 3VPRA 3H1CA 2Z33A 2KDOA 2L9VA 2QCOA 3OIOA 3WU1B 2Y48A 3HIFA 2ZNZA 2K5CA 1RIOH 3BG5A 4IHVA 2RNGA 1MBJA 4XLNF 3W6VA 1WQ2A 3EUKL 2CUFA 3EUHC 2Z9OA 4Y52J 1X1PA 2MLKA 3P9IA 2EK5A 3WTSC 1HOMA 3FXOA 3K4MA 2XB0X 4LJZF 2DMNA 3L2VA 2L9NA 4B44A 3CCSI 2E1MB 3LFKA 3G3ZA 4F91B 1HSJA 4D5FA 1T56A 4CGZA 2NNNA 4IHTA 1QZEA 2K27A 4C3JJ 5ILVA 1UG0A 2QF7A 4L5JA 4BJTA 4KDPA 4IL6C 3FK6A 1MBHA 4XSZF 1GXPA 2ZMEC 2BY3A 2BGCA 3BR6A 4EQQA 3MKZA 1Z3XA 1V5EA 3B6AA 1ZRFA 2AQFA 3BG3A 2JUCA 1YRNB 3BY6A 1MJAA 3PFIA 1PDNC 2H8WA 2HWVA 1JTYA 2EZHA 2K85A 2ZMEB 4RAYA 5FKLA 4YFNF 3S3NA 2R5ZB 4XICA 2PMZA 4O6JA 1IRGA 3QYEA 1MMDA 2JK3A 2LTPA 1MGTA 1OR7C 2PBIA 3KPHA 4A3DJ 1R23A 4JX4A 1BW5A 2B0LA 2Y75A 4HZFA 1E17A 5FLVA 4E7HA 2LR8A 4BH9A 2OJED 3FF5A 4QLCU 2LNBA 2EV0A 1G59A 5IOYA 4KMUX 1IC8A 2D45A 1FEXA 2KJBA 3ZQHA 2Q8KA 1HSTA 1DGRM 2CQXA 2DAOA 4XRSA 1D5YA 4CYCB 3DTIA 4OMYA 2VKDA 2XAUA 3RQ4A 1U0JA 3HKZA 1LUJB 2KT0A 1YX3A 3K6GA 1R5ID 4Y33A 2M1BA 2LRDA 3SEQA 3OYDA 2QSFX 3JRDA 1W5SA 2NVXJ 1UMQA 4B8XA 3ABKH 1JGGA 4KJZA 1BR4A 2DOAA 4M73A 2QKMB 3H5NA 4OMZA 1I27A 3DLLF 2HZDA 3HGYA 1SANA 1VQMI 1FYKA 1MBEA 2X48A 2NNYA 2X51A 2PX9A 3E6MA 1I50J 5L3CA 4L9JA 1IDYA 3FMSA 3E3VA 5E18F 5EDNA 2R92J 4HNUA 3HDDA 2DA1A 3CQZJ 1FJLA 3TP3A 4N4OB 4KITB 1REPC 3GTJJ 2HDWA 5F6FA 4E70A 1A5JA 2FE3A 2KISA 5HS7A 1F1ZA 3IUOA 5E3NA 3DQVC 3PM1A 4BY1J 1J59A 2QSHX 3ISPA 3BQYA 1A35A 3LA7A 1QU3A 4EGZA 1I39A 4DYCA 5K5OA 2XC7A 2DFEA 1G3WA 4MHGA 2AXTC 2PFBA 4MIMA 1PUFA 2JSCA 3CUOA 4KFCA 5BPIA 2BVLA 4P1WA 1W5CC 4E7ZA 1PYVA 2HOSA 3LSRA 2M4KA 3F3XA 3WU2C 1XTAA 1XDUA 4CZZA 4XRMA 3UKGA 1EH6A 5J3LA 4NB5A 2JA2A 3S2HJ 5DTDA 1S29A 3REOA 3KIOA 2E60A 2B9SA 4RLQA 1L0OC 5E3LA 3A02A 3MN2A 3A4CA 2H6BA 5M5YJ 1EA3A 2P8TA 2NOJB 1VZ0A 1GVDA 3K70C 1QNTA 3S1QJ 3BG9A 1B9NA 4A0ZA 3E5QA 1G3TA 1QRYA 3E5UA 2WBMA 4ANJA 1YW9A 5ILSA 1YLFA 1X1BA 4IHXA 4I99C 3CCQI 2RQPA 4M6VA 1ODDA 1RPWA 3K4LA 2PJRB 5F08A 3MCZA 3JSOA 1JUSA 1MMAA 2HKXA 1FBQA 2DCEA 4ITVA 3RQIA 2IGKA 2CJJA 3TW7A 1B6AA 3I0TA 5C44J 1HW1A 5CVVA 5KNLA 1U8RA 5FRMA 1WPKA 3EETA 1Y8QB 3TO7A 1TW2A 4XLAA 2HQAA 2ZO4A 2QEXI 5F1JA 1CF7B 5IT9Z 5IYCJ 3S2WA 3H5RA 3BTIA 2HDCA 2XAFA 4NQWA 4BBSJ 1ZGAA 4U87A 1BW6A 3ZQCA 1P7IA 4Q47A 1ZH5A 1BA5A 4IRGA 4F7ZA 3JTGA 2H27A 1LDKB 2XGDA 1D0YA 1YS7A 2MC4A 3CCUI 3CESA 1TT5B 2V1UA 1YQAA 4OAZA 1Z7UA 2L7MP 4ZZDA 3HOTA 3HZJA 2HVRA 2DYRH 2O9LA 3F72A 3LSTA 1YO5C 3BPXA 2VQLA 3QOPA 2RREA 3LWFA 1TNTA 3JRIA 1RKTA 4FE4A 2D5VA 2E5NA 3RZOJ 1Z05A 2XGEA 3PL8A 1SVLA 4BDYA 1SFEA 2JJ7A 1Y1WJ 4B43A 2KIUA 5KHDA 2LK2A 1ETQA 4CCKA 1X3ZB 3TKYA 4LG0A 1MDMA 1IJWC 5C4JJ 1ZRDA 3PJRA 2DTRA 2UUZA 1J09A 4M3DA 1U9NA 4UUTA 4A3CJ 1UAAA 1D5VA 3OS2A 4IHSA 2K4JA 1VQ7I 5L3EA 4YFKF 5K7ZA 3IAM2 4GO1A 3WTTC 1RUOA 4PFPA 1MD0A 4OWRB 4GXOA 4MO7A 4DZJA 4B3XA 4LK0F 2VIXA 4E7JA 2JPBA 2HYJA 2F5CA 2QGUA 5KK1A 4D1QA 1HF0A 4IX7A 3TO6A 1EH8A 3BCAA 3KLOA 1H0MA 3K2ZA 3LQRA 1TTYA 1ZQ3P 1TWHJ 2XPVA 1JJ8C 5J4VA 2LLKA 2BXYA 5FFZA 4B09A 2RV8A 3ABMH 2O0YA 2CQQA 2VASA 4XLFA 5IP9J 2VOOA 2DI3A 2P4WA 1WI9A 2J5PA 2M0CA 3NAUA 3GEZA 4B47A 3A01B 3CC2I 2OQRA 2IXSA 2RGVA 1ONVA 4OU0A 4BJ5C 3CMAI 1JKRC 3LOCA 1WJEA 4BYYA 1KU7A 1ZYRF 2GAUA 1KA8A 4MEYF 5F0HA 3QWLA 2PG4A 3G73A 1P4WA 1QVUA 2G0EA 1AKHA 5FFXA 2LY1A 1VQ9I 2DBBA 1T38A 3GCMA 4A3IJ 4AYBA 3OOPA 1F43A 5ICEA 1YX5A 1K83J 3WHBA 3SZTA 5FJ8J 1MJ9A 3M07A 3HRMA 2EIKH 4ENNA 2NVQJ 3FXRA 3CUQC 3K4NA 1SAUA 2G7HA 3CUQB 4PK4A 2K9NA 2HPIA 2Z3YA 2W1OA 2HZTA 5E1XA 4FETA 4HOBA 2PJPA 2ID6A 1IF1A 4MFEA 3ZN0A 1S8NA 4OIQF 2Y0SN 3CMYA 1S6LA 3LNQA 3OSFA 2DK5A 1NK2P 5FB2A 1ZLJA 1N77A 1N75A 5A2QZ 2KIQA 1BI3A 1R6RA 4WX9A 2M3AA 1Y0UA 2VE9A 2NVTJ 1UHWA 2K9MA 3F8FA 2KFDA 2XF6A 3FK7A 3FDYA 5J40A 3PSIA 5FROA 2B63J 1A36A 1GHCA 4N9HA 1FSEA 1JTXA 1A31A 4S04A 3J7AY 3MFKA 3EUAA 2WA0A 4LK1F 4IQJA 2EPFA 2A6TA 3H9QA 3RJPA 5E1WA 2CSOA 1GV5A 3KP7A 5BNGA 1R7JA 5B5EC 3LAJA 2RN7A 1W7PA 1R4NB 3KP5A 1RKWA 2WADA 2IS6A 2X0LA 4IEJA 4BXXJ 4AU7A 4I01A 1CGPA 2DMUA 2ZNYA 4D0PA 2IA2A 2LKSA 2CRGA 5IP6A 2WAQA 3S8PA 3VFZA 3K2AA 3BR0A 1PUEE 2LD5A 2RNJA 4AC0A 5CYVA 1W1WE 4RM3A 3HOUJ 5HDNA 3ZP5A 2R7OA 3TOBA 2CQKA 2DODA 5FLXK 4A3GJ 3LA2A 2VKHA 5E20A 4C30A 5HDGA 2XGCA 1FOWA 5GTIC 2IBDA 2JTVA 2WY8Q 4UNOA 3BT9A 1R5GA 1XB4A 1FT9A 2Y69H 1MIJA 2A61A 2FF4A 5J1YA 1XGSA 1SMTA 5EEGA 4XNFA 2NVUB 1YFHA 4ZZLA 1TWAJ 1YITI 4QPOA 2F5FA 2ME6A 5EF6A 1E3OC 1IV6A 1IN7A 3CJNA 4KIBA 3U9GA 5BOXA 2LC2A 3SZPA 3MKLA 1ETXA 2BW3B 1VF9A 2NS7A 3H9JA 4F92B 2P0WA 1O57A 3E1SA 5LFAA 2W4SA 1B59A 2DMTA 3ABUA 5KCMA 4E6KG 2P5KA 1MZBA 2K9LA 2V26A 3S3OA 2VXDA 3TEDA 2AO9A 4A5MA 3QU6A 3J80Z 1YJWI 4GRIA 3TOAA 4UB8C 2F4IA 3GTQJ 4XKCA 3HEFA 1P4XA 1JT6A 2VLAA 2CU7A 4M9SA 1N25A 2DDBA 1Z6TA 5D4RA 2L5QA 5E8IA 2M45A 2FOWA 3GVAA 1STZA 3CO7C 3GBGA 3QPSA 3ONQA 2K9SA 1V55H 2JA7J 4NNJA 2HFHA 2KIFA 5ED4A 3CCVI 1ETVA 1XG1A 1J0RA 4FCYA 4RAFA 1SFOJ 5JVTA 3OYNA 4XKVA 1VI0A 3Q3SA 2IGMA 3D0SA 4II3A 2MW8A 2KRHA 3W2VA 5IY5H 1IZ1A 3CC4I 5GAGJ 2D1HA 2R7TA 1WH5A 1P7JA 2DDAA 3T1BA 2R7FA 1JI8A 1MSEC 2DA4A 3KZZA 3HRUA 2VQCA 1Z7LA 2PMZN 4HDUA 1OQYA 2JA8J 4A3LJ 2NOGA 1U5TA 3BR3A 4IHWA 4MGRA 3ZN1A 1K7AA 2ECCA 4QWQA 1QHGA 2GM4A 3A2KA 4LGWA 2MH9A 5HNHA 1ETKA 1WI3A 4GDFA 1ZARA 3MWMA 1T33A 4A3KJ 3KEQA 3BP8A 3JRAA 3N97A 3MVPA 4G7HF 1G2HA 1K6OA 2MA3A 3HSRA 2R7ZJ 2KL4A 3HGGA 1WZ2A 4MQVA 3BG6A 3AG4H 1TL8A 2BXZA 4KA4A 3GTPJ 2OTJI 2XASA 2M5WA 3LL7A 3RPUD 3OYKA 1RR8C 4Q48A 1FX7A 1GXQA 2HPMA 1R1VA 3E5XA 5LGNA 4ESFA 3PIPF 2H6CA 2WB1N 4A0XA 2JSPA 2XGXA 3J7AO 3HOZJ 4BKXA 5FKMA 2Z1DA 4JK1X 3GTMJ 1SD6A 2FMLA 1I3AA 2MFZA 4UB6C 1LEAA 2VUMJ 4ETSA 2M4GA 1UFMA 3G1OA 2EA2A 5D5UB 4G8XA 4ZJZA 1DGWY 2QUFA 2ID3A 5DCFA 5ICGA 1FIAA 3M8JA 4XLHA 4YIRX 3TDZC 5FD5A 3Q5FA 2IPQX 1HCRA 1K78A 4UV9A 1OYYA 2E71A 3H0DA 1BOAA 3ZRGA 3JRBA 4M72A 3IH2A 4CCMA 2WAFA 3BDDA 1A04A 4WWCA 4MEXF 1RUNA 3JRHA 2W24A 1VQ8I 3ECOA 2OC6A 3ELKA 4N0BA 5HS9A 1MW7A 3F8NA 3A0HC 2JN6A 3HHGA 1YE9A 2MD5A 1Z9CA 4Y4RA 1G3SA 2V9VA 3K7AJ 1MNEA 3QYBA 2XAQA 5LD2C 2FEZA 4PCQA 4I0AA 2GOMA 3G1MA 4J00A 2OU2A 2DFFA 2ZSHB 5IT3A 4WK8F 2HGCA 1OYIA 2X4HA 3KZYA 4NHJA 3V7RA 1X3WB 3HOVJ 5JLXA 3OMYA 4RBOA 3J7ZI 2KKOA 2GA1A 4PJ0C 2CUZA 4XQFA 5EGOA 2DQLA 2TDXA 3O2PE 5B1BH 1Z3YA 4ZDOA 5JFRA 3Q9SA 3PO2J 3GLLA 3KYDB 2F5DA 4S05A 5IYDJ 3DEEA 4H4KC 1YIOA 3H36A 4MQ9F 5CJ9A 2ISZA 2CG4A 4XLCA 5FGMA 5B3SH 1G4DA 5F04A 5EG0B 4XKWA 5FKKA 1VQPI 1JT0A 3IL2A 2OTLI 4HBLA 4CA0A 4HEA2 2ZJQF 1HKSA 1V5GA 2V79A 4HQMA 2IT0A 2IA1A 1AA7A 4BQNA 2BW3A 3S15J 6PAXA 4XLPF 5FO5A 3K9TA 2BV6A 4O5VA 1QHHD 4OINF 4JQFA 3B6CA 2STWA 4G7ZF 3I4NJ 4E7SA 3HSFA 1ZAOA 2XVCA 1T2KA 2E7WA 2PN6A 3S14J 1I6HJ 1POGA 3HKZN 1Z0XA 4AUXA 1Z6RA 3DKYA 1NHAA 3BWGA 4AM3A 3LSGA 2W48A 2XDVA 3TBIA 2R0QC 4U0WA 2ECBA 4BEHA 3AKZA 2ZXJA 2V4JC 2X6YA 5DD4A 3J7YJ 3JTHA 1IN5A 3BTCA 4CH7A 1R49A 4UUVA 2DQRA 3ERED 4P55A 5CVJA 1BJZA 3GZ6A 3BJOA 2XKOA 3BLYA 2I8DA 2P6SA 5TJJA 2JA6J 4JX5A 2DA3A 5BMZA 4ABZA 3E97A 3HM5A 3BR1A 1JXSA 3SFIA 5J47A 3IH4A 3SDGA 4NBQA 1XN7A 5DD8A 3V7CA 5JVGF 4BDZA 4A3MJ 3QOEA 3W2AA 3MKYB 1W7PD 2VC0A 3EPZA 4U0VA 4AIKA 1W7PB 2XF7A 2M0MA 5D6EA 2ZFUA 2NVYJ 5HLIA 1BN5A 1RR7A 1IN6A 4HNTA 2XV4S 3OIQA 1D3YA 2E2JJ 4AVPA 1F9NA 2GIVA 3CCRI 4BEHB 2E19A 2EFOA 2HOEA 4YELA 4M71A 1X1AA 4HYEA 1YJNI 5ICFA 1IXCA 1EF4A 3G4SI 4FE7A 3L2WA 5B1AH 4GGGA 1Y0NA 3W2WA 1YI2I 1XSVA 4UXNA 2BEOA 2DT6A 2EH3A 2E1NA 3KE2A 3ZMZA 1LKXA 5J4YA 4G7OF 1FTZA 4A6DA 2FBHA 2ZJPF 2FNPA 3PO3J 4IOAF 2GQQA 4I02A 2HQNA 2X6XA 4ZH4F 1XMAA 1Y56A 1AHDP 2VKVA 2JA5J 2CO5A 1VQLI 2KDZA 4NUBA 3DCFA 2MGQA 2A3SA 4PJJA 1OFCX 1T6SA 2Y2ZA 4DYQA 3ZCOA 2FOKA 4ENKA 4P5OA 3VDXA 1LQ1A 3IAS2 3AG1H 3J81Z 1IUYA 3JR9A 1X2MA 3KX2A 2R7VA 4R1HA 5H2FC 1SC7A 5KAIC 5ERIA 1UG2A 4MTDA 3ERMA 1FP1D 2HXOA 4I7HA 1TWGJ 3DTEA 2VC1A 2HYGD 3DKWA 2LH9A 5J1RA 2P81A 1LFBA 4HX7A 3TW6A 1W36D 2RAEA 4RA2A 2YR2A 3DXJF 1WVRA 1X4OA 1XGNA 2ELJA 3EDPA 3WE2A 2O3FA 3AL0C 3QRFF 1HKQA 2O7OA 5D5XB 4ZTJA 2VBWA 1ZTRA 5D5WB 1U3EM 1X1CA 3LSHA 3NWTA 3CP8A 3PQKA 1MDMB 4HV6A 1WWXA 4M9XA 1G6NA 2CUEA 3Q0WA 5CVUA 5K5RA 5BS6A 1QQIA 2LYCA 2O03A 1V3FA 2F5VA 4PFOA 2WAQN 1K78B 1IXSB 4HX8A 4EJUA 4E4HA 1QGPA 3QPTA 1R9TJ 1JGSA 3CJRB 9ANTA 2LDUA 2OD5A 3OL4A 3KP2A 4Y17A 2OCEA 1MJBA 4HQEA 3F6VA 2X6WA 4XKBA 2AS5F 1D0XA 4KICA 2GXGA 2DTZA 4BAYA 5KAFC 1B72A 2ZC2A 2LF7A 1AWCA 1SVMA 3FXQA 1YW7A 2V9KA 4XORA 1ULYA 5DUKA 4WXCA 1KONA 2Y9YA 1FBUA 3CMMA 4BU2A 2Y0MA 2R7RA 1LB2A 1TQIA 3C2HA 1J7KA 3ZMSA 1GDTA 1USTA 4M6YA 1K4SA 1NK3P 3FZVA 3BJAA 2RKHA 3FHZA 2WB1A 3HRSA 2YPRA 3V7SA 1K61A 3HXLA 2F6CA 5DV5A 1F5TA 2DA5A 1OPCA 4HLYA 2ZXWH 2KLOA 4KT6A 4XONA 2L9SA 5F0CA 2NAZA 3FXLA 2KHMA 4RGRA 2QVOA 5LHHA 2LF8A 4BUPA 2ZXIA 2AXLA 2E5ZA 1YIJI 3VYSB 2EFWA 1IXRC 2L4AA 3J80K 1TQPA 5EG0A 4YIIA 3HTUA 2W85A 3S1RJ 1H89C 5F27A 1B1BA 2X6OA 1I1SA 1WFXA 3ASNH 4P96A 3L2UA 1P9QC 4BNCA 1B9MA 4YEJA 5JLWA 1WJ5A 2CS3A 2PMHA 4NC6A 2EQRA 1ETYA 3BROA 3M1CA 2L54A 2M8EA 1BJAA 4HAMA 1IDZA 3MQ0A 1NTCA 2KRCA 3E0JB 4BQOA 1TZLA 3LMMA 4IXAA 2ESHA 3O8GA 4Y7NJ 2EA4A 1GVJA 2WY7Q 3HSEA 4F93B 3ZPLA 3F6OA 1SMYF 5J8CA 1WJFA 4C2TA 4BBRJ 1TC3C 5HS8A 2OA4A 4L5IA 1T0FC 4PZJA 2IJLA 1C0WA 5CPRB 3L7WA 3CO6C 1YOVB 3P5JA 3TQNA 3IV5A 2X9DA 3M8FA 3ASOH 2VONA 5D8KB 3HHHA 3GTLJ 4IRHA 4BQQA 2ESNA 4AIJA 3Q0VA 4ENMA 5M5XJ 1BR2A 1VQKI 4XK4A 1JUPA 2MYSA 2JVHA 3PSFA 2R7UA 3EYIA 3PNVA 1W4MA 3A0BC 2EZLA 1ON1A 1S7OA 3NRVA 3CD6I 2DT5A 4XSXF 4ENJA 1K4TA 5K5QA 1I5ZA 1LFPA 5M5WJ 3IC7A 2R7QA 1QZYA 3D5RC 4LLGF 2VN2A 3RKQA 3LQQA 4YG2F 4II2A 5CKTA 2PEXA 1NG7A 2CFOA 4OIRF 1YTYA 4A12A 2IEKA 3B02A 2O8XA 1FYMA 4HF0A 3CCMI 1YG2A 4N4NB 4XR6A 3K1PA 3RKWA 4LG3A 3GYHX 1T98A 1B72B 3RYRA 2W84A 2DPDA 3LSJA 4U0YA 1IUFA 2XRNA 1JUMA 4M3GA 1S72I 3SZGA 1WSUA 1RETA 2JZYA 3DBLB 2ZJRF 2OZ6A 2YX7A 2Y0SA 3I53A 1QBJA 2F2EA 3IP4B 4EJVA 3A1YA 2IP2A 2IGOA 2X85A 2XAHA 1QPMA 3PFYA 4XLEA 3U1DA 3IRQA 2RQQA 2N8GA 1I1GA 1JHHA 1UB9A 4W97A 2VT3A 2NYXA 4L9NA 2ETHA 3WTWC 1Z91A 3VSKA 1YRNA 5IOZA 4GCVA 1VQ4I 3GZNB 1OCCH 1OCZH 1U5TB 3BG7A 1BI0A 4KN4X 5LGTA 1WGXA 2IRFG 3CLQA 1X58A 3VYUB 4A3EJ 3HOXJ 1RI7A 1LVKA 3VSLA 5FRNA 2IGNA 3TO9A 4LD5A 1LEBA 3HOYJ 4LIUA 1XGOA 1O3QA 2Z16A 4U88A 5LRRA 3ML6A 4XRFA 1O7FA 4ZC3A 2LMDA 2LKXA 3GMEA 3C7JA 4ZYGA 1XSXA 5HLTA 1M1EB
chains in the Genus database with same CATH topology
3GFMA 2EJRA 4EM0B 3DFGA 2DFIA 4L9VA 4EMSA 1DPRA 1O3SA 1D8KA 3C18A 4HDVA 1XGMA 4P9FA 2ZKZA 3HTSB 3JSPA 1IAWA 2MBFA 3R4KA 3P7NA 1SFUA 4KUMA 1IN8A 2IW5A 4UVBA 1R5HA 2EV6A 4IRIA 2O61A 2EFNA 5E8GA 4KN7X 2EFPA 3JAMZ 2E7XA 3WG9A 1O3RA 3F8BA 3FX3A 4LG0B 2UXXA 2Z5UA 5L3FA 1PP7U 1WKMA 3E6DA 1SFXA 5IT9K 4HW0A 1G3YA 3R61A 1R1TA 1OYWA 1FC3A 1QZZA 3KFWX 2PQ8A 3OV8A 1I6XA 3MZYA 4RB0A 3V8JA 2W57A 4EJWA 5FD6A 4I98B 4WXHA 3WTXC 4L0ZB 2QWWA 4G6DA 4ESBA 2O6GE 4P9UA 4CICA 3RPUA 4TV7A 1W5TA 1CF7A 5FLXZ 1O3TA 4CHUA 2L3DA 3F22A 1EH7A 3K0LA 4FX0A 5LGUA 2RVCA 1ZG1A 3EUHA 2BBYA 2ZJ2A 3K1MA 2M30A 3HYIA 2YSRA 2GA2A 3CUQA 2KJCA 4Z2YA 1BBYA 3V8LA 3M1EA 1LDDA 4OIPF 2P5LC 5DDGA 3I71A 2NRAC 1P92A 1U6GA 4LB5A 1J2XA 3IWZA 4I0BA 1P6RA 4LFUA 2DW4A 3RYPA 2QQBA 3C3WA 4ZYDA 4G94A 3ZMVA 4G6QA 3SQNA 4RGSA 1J5YA 1HBXG 1RNLA 2LSOA 5JHUA 1DDNA 4FT8A 2YX4A 3FM3A 2PLYA 5ICCA 3ZMTA 3F21A 2XUBA 1ZRCA 3WTUC 2HTJA 4H0EA 4BHPA 1BC8C 2QQ9A 1YS6A 4ON0A 4HV5A 4M74A 4KIGA 2QBYA 1EV7A 3WTZA 4Q4ZF 4U7DA 1Q1HA 3J81K 2L02A 4Y15A 2E1CA 3FM5A 3JW4A 4R8HA 2UXNA 1HQCA 1FWZA 2QM3A 2EB7A 1WRJA 1U2WA 2J5OA 1H9GA 2CFXA 5KVRA 4BHBA 3GF2A 4IVNA 1U78A 5D4SA 4HF2A 3WU0A 5HLHA 3LA3A 4IF4A 3RPQA 2CW0F 3D5LA 5DEQA 3BPVA 2CYYA 2MH2A 5L3BA 4BHCA 1UHMA 2XAGA 3R0JA 2K02A 2IA0A 2K7LA 3RDIA 3ULQB 1BI1A 1JHFA 4AD9A 2CWEA 4EV0A 4GYGA 5LEJA 5CLSA 4EVIA 3QP5A 3BOQA 4AIHA 2FRHA 2IVMA 3DV8A 3H92A 3IKTA 2V1XA 1XMKA 5JI6A 1S3JA 5F64A 1ZN2A 2K86A 3F8MA 5D6FA 1LDJA 2Q0OA 4ASNA 2HTSA 2OZUA 1YW8A 3GLXA 3RKXA 2V1DA 3O3KA 1KU9A 3GFIA 2ZCWA 1XDSA 2VODA 2A69F 1R36A 4BXUA 3QP6A 4ZYEA 1E2XA 1OR7A 1UCRA 3KP4A 3P9KA 2P7CB 2EWNA 3QPHA 3K69A 3WTYC 5HDKA 2HEOA 1BC7C 5LRSA 3HUGA 1BM9A 1TBXA 3CTAA 3K1NA 1ZREA 5HOOA 1OMIA 3FMRA 1MKMA 4KT5C 3KLNA 3RIRA 4A2UA 1T0FA 2VOPA 4MTEA 1RZ4A 5H6RA 1J75A 1L3LA 2P6TA 2JPCA 1LVAA 2PMUA 2GXBA 1KQ9A 1FPQA 2EV5A 3V4GA 4HA8A 2P7VB 2K4BA 2BYVE 3I59B 3R60A 2R3SA 4RB3C 2DO7A 1SD5A 2A6EF 3BJ6A 4XBFA 3WTVC 2H94A 2JT1A 1V4RA 4L18B 5DUIA 1PP8F 2H09A 1FY7A 3ECHA 2WTEA 3GXOA 5LEKA 2QLZA 3DP7A 3FWEA 2EFQA 4Q5SF 4CO8A 3E6CC 3T5XA 5JR3A 1R00A 5ILUA 4UHTA 5A2QK 5K1YA 4PGHA 4UVAA 4KYWA 4LLLA 1R1UA 2HR3A 3SFZA 1ZHFA 4RAZA 2OAZA 3GUDA 5E17F 1HW5A 2RDPA 5AONA 1KYWA 3F8CA 5DYMA 2Z99A 3TGNA 2WWYA 2A68F 4UVCA 2G7UA 4EJOA 2M87A 2STTA 5LBQA 3GO5A 4RS8A 4DNCA 3ZMUA 3V8KA 1XD7A 3M7GA 3HRTA 5AIQA 1LJ9A 4GYIA 4ESJA 5CVIA 3AAFA 3CDHA 3DF8A 3I64A 2PI0A 1P4AA 3R6SA 4BQAA 4O3MA 2ZFWA 1XCVA 3MZHA 2VBXA 3WGHA 1DUXC 2D1VA 2QZ8A 3MAJA 1ZLKA 4A6EA 1YYVA 2UZKA 1USSA 2F5EA 1XCBA 3RKYA 3SXYA 3IWFA 5H6QA 2XAJA 2RC4A 4OIOF 3KP3A 2QYOA 1H9TA 2JRTA 4KMFA 3GWZA 4ZYHA 3WODF 1DP7P 3IRRA 5H20A 3I58A 2A6HF 3VB2A 3EYYA 4EJTA 3DEUA 3L9FA 3WE3A 1BIBA 1BIAA 2XKPA 2L01A 1ON2A 1FOKA 5DCMA 4RB1A 3GFLA 1TNSA 1SD4A 1KU2A 4Y13A 1K79A 3DPTA 4RGXA 2DK8A 1KYZA 2MC3A 4UV8A 5E1ZB 3T0YA 5L3GA 3C1DA 1HW2A 2DU9A 2FU4A 5D5VB 3W6JB 2QQAA 3IHUA 3FXUA 2FBIA 3GW2A 2QENA 1VTNC 2DPUA 2C6YA 3ZMDA 5DCMB 1S7AA 3VODA 2VE8A 1X3UA 2ISYA 1Z1DA 1SD7A 2COMA 1R58A 4G9YA 1P2FA 2VBZA 3CLOA 2GWRA 4WCGA 4U7BA 3LAPA 3PQJA 4LLNA 3HOSA 3TDUC 1D8JA 4HF1A 3F23A 2P5VA 3NQOA 4CDGA 3M8EA 2R7DA 2ZBKA 3ABTA 1ZGJA 3WGIA 1FZPB 4KIFA 4EM1A 4PGGA 3DPLC 2FBKA 3WGGA 1F4KA 2XROA 2ZMEA 3L09A 4R79A 1R22A 4N9IA 2L4MA 3NEUA 2LKPA 1AOYA 2HS5A 2HQRA 3RTRA 2KRFA 2FXAA 2FSWA 3ROUA 5HLGA 3I4PA 2ACJA 2OBPA 3QAHA 3EQLF 3O6BB 4EM2A 1IRFA 4DQ2A 2QBYB 1HXDA 2G9WA 4IPAA 3H3UA 3KCCA 3T8RA 3B73A 5F1RA 1HKTA 2OQGA 2KIMA 1QO0D 4A5NA 1IW7F 4L9TA 4HLXA 1ZG3A 2V6CA 1XSDA 3U2RA 2XIGA 3GFJA 4RB2C 1TW3A 2FNAA 3M9AA 3KETA 3GX4X 2GZWA 4FHTA 2HKOA 4JBAA 2CGPA 3I54A 1KQ8A 3P9CA 4HX4A 3RI4A 5BPDA 1TQMA 1LNWA 1OKRA 1O7LA 2ELHA 3MEXA 3QU3A 3VOEA 4FX4A 4WF2A 2NS0A 4M6XA 5L3DA 2VBYA 2BE5F 2YU3A 3KP6A 1SAXA 2W25A 3L2CA 4RGUA 1JE8A 2VXZA 4LB6B 5J6XA 4A0YA 3FMQA 4IJAA 4LMYA 5D8LB 1IN4A 1FSHA 3E6BA 2WV0A 5EEHA 1BI2A 2A07F 4MNUA 2FQ3A 1KU3A 1FNNA 4PDKA 1FBSA 1FP2A 3T8TA 2D2WA 4K2EA 3L00A 1FYLA 3I59A 4YFXF 1DPUA 3JAMK 2XHKA 3VEPA 4I2OA 3COAC 1KGSA 3I5UA 5HVQC 2ADUA 4M9ZA 3R0AA 1J9IA 4CYDA 4YIFA 5AIPA 1B4AA 4WXDA 3BZ6A 5BQTA 4I09A 4AWXB 2A5YB 3Q9VA 2FMYA 5LHIA 3ZQ7A 1KQ0A 1FLIA 4L0YB 4EGYA 5LHGA 5TRDA 3GZ5A 3W6KB 3KEOA 1T39A 2UWMA 5J8FA 2FA5A 1U5TC 4CXFA 2HYFA 2DLLA 3N4MA 4KNYA 2Q2EA 1ZG5A 1TLHB 5LLQA 3H3ZA 3SHFA 5CVRA 2VT2A 4OOIA 2WC2A 3IKVA 2MLGA 2Z33A 3WU1B 2Y48A 3HIFA 2ZNZA 1RIOH 4XLNF 1WQ2A 2Z9OA 2MLKA 3P9IA 2EK5A 3WTSC 4LJZF 3LFKA 3G3ZA 1HSJA 4CGZA 2NNNA 4IHTA 2K27A 5ILVA 4L5JA 4KDPA 4XSZF 1GXPA 2BGCA 4EQQA 1ZRFA 3BY6A 1MJAA 3PFIA 1PDNC 2HWVA 4RAYA 2ZMEB 4YFNF 4O6JA 1IRGA 1MGTA 2PBIA 1R23A 2B0LA 2Y75A 4HZFA 1E17A 4BH9A 3FF5A 4QLCU 2LNBA 2EV0A 4KMUX 2D45A 2KJBA 2Q8KA 1HSTA 2DAOA 4OMYA 2M1BA 1W5SA 4B8XA 4M73A 4OMZA 1I27A 1FYKA 2NNYA 3E6MA 5L3CA 4L9JA 3FMSA 3E3VA 5E18F 1REPC 5F6FA 4E70A 2FE3A 5HS7A 1F1ZA 3DQVC 1J59A 3ISPA 3LA7A 4EGZA 5K5OA 1G3WA 4MHGA 2PFBA 2JSCA 3CUOA 4KFCA 5BPIA 3F3XA 1XDUA 4CZZA 1EH6A 4NB5A 1S29A 3REOA 1L0OC 2H6BA 2P8TA 1QNTA 1B9NA 4A0ZA 3E5QA 1G3TA 3E5UA 1YW9A 5ILSA 1YLFA 2RQPA 1ODDA 3MCZA 3JSOA 2HKXA 1FBQA 1B6AA 3I0TA 1HW1A 5CVVA 1U8RA 3EETA 3TO7A 1TW2A 5IT9Z 2ZO4A 1CF7B 3S2WA 2HDCA 2XAFA 4NQWA 1ZGAA 4Q47A 1ZH5A 4IRGA 4F7ZA 3JTGA 2H27A 1LDKB 1YS7A 2V1UA 1YQAA 1Z7UA 4ZZDA 3HOTA 3F72A 3LSTA 1YO5C 3BPXA 3QOPA 3LWFA 1TNTA 1Z05A 1SFEA 2KIUA 3TKYA 4LG0A 1MDMA 1ZRDA 2DTRA 1D5VA 4IHSA 2K4JA 5L3EA 4YFKF 4GO1A 3WTTC 1RUOA 1MD0A 4GXOA 4LK0F 2JPBA 2F5CA 5KK1A 3TO6A 1EH8A 3KLOA 1H0MA 3K2ZA 3LQRA 1TTYA 5FFZA 4B09A 2RV8A 2VOOA 2O0YA 2DI3A 2P4WA 1WI9A 2J5PA 3GEZA 2OQRA 2RGVA 1ONVA 4OU0A 4BYYA 1KU7A 1ZYRF 2GAUA 1KA8A 4MEYF 2PG4A 3G73A 1P4WA 5FFXA 2DBBA 1T38A 3OOPA 5ICEA 3SZTA 4ENNA 1MJ9A 3HRMA 3FXRA 3CUQC 2G7HA 3CUQB 2Z3YA 2HZTA 5E1XA 2PJPA 4HOBA 1IF1A 4OIQF 3ZN0A 1S8NA 1S6LA 2DK5A 5FB2A 1ZLJA 5A2QZ 1BI3A 4WX9A 2VE9A 1Y0UA 1UHWA 3F8FA 1GHCA 4N9HA 1FSEA 4S04A 3MFKA 4LK1F 3RJPA 5E1WA 2CSOA 3KP7A 1R7JA 3LAJA 2RN7A 1W7PA 3KP5A 2X0LA 1CGPA 4I01A 4D0PA 2ZNYA 2IA2A 3VFZA 1PUEE 2RNJA 5CYVA 5HDNA 3ZP5A 3TOBA 2CQKA 5FLXK 3LA2A 5E20A 5HDGA 2JTVA 4UNOA 1R5GA 1XB4A 1FT9A 2A61A 2FF4A 1XGSA 1SMTA 5EEGA 1YFHA 4ZZLA 2F5FA 1IN7A 3CJNA 4KIBA 3U9GA 5BOXA 3SZPA 1O57A 1B59A 3ABUA 2P5KA 1MZBA 4A5MA 3QU6A 3J80Z 3TOAA 1P4XA 4M9SA 1Z6TA 5D4RA 5E8IA 2M45A 3GVAA 1STZA 3CO7C 2HFHA 2KIFA 5ED4A 1J0RA 5JVTA 3D0SA 1IZ1A 2D1HA 3T1BA 2R7FA 3KZZA 3HRUA 4HDUA 1U5TA 4MGRA 3ZN1A 1K7AA 4QWQA 4LGWA 2MH9A 1ZARA 3MWMA 3KEQA 3BP8A 3N97A 4G7HF 1K6OA 2MA3A 3HSRA 4MQVA 4KA4A 2XASA 2M5WA 4Q48A 1FX7A 1GXQA 1R1VA 3E5XA 5LGNA 4ESFA 2H6CA 4A0XA 2XGXA 3J7AO 4JK1X 1SD6A 2FMLA 1LEAA 4ETSA 1UFMA 2EA2A 5D5UB 4G8XA 2QUFA 5DCFA 5ICGA 3TDZC 5FD5A 3Q5FA 2IPQX 1K78A 4UV9A 1OYYA 1BOAA 4M72A 3BDDA 1A04A 4WWCA 4MEXF 1RUNA 2W24A 3ECOA 3ELKA 4N0BA 5HS9A 3F8NA 3HHGA 2MD5A 1Z9CA 1G3SA 2V9VA 2XAQA 2FEZA 4PCQA 4I0AA 2OU2A 5IT3A 4WK8F 2HGCA 1OYIA 2X4HA 3KZYA 4NHJA 3V7RA 2KKOA 2GA1A 2DQLA 2TDXA 3O2PE 5JFRA 3Q9SA 2F5DA 4S05A 4MQ9F 5CJ9A 1YIOA 2ISZA 2CG4A 5FGMA 1G4DA 3IL2A 4HBLA 1HKSA 2V79A 4HQMA 2IT0A 2IA1A 6PAXA 4XLPF 5FO5A 3K9TA 2BV6A 4O5VA 4OINF 4JQFA 2STWA 4G7ZF 3HSFA 1ZAOA 2XVCA 1T2KA 2E7WA 2PN6A 1Z6RA 1NHAA 3BWGA 4U0WA 2ZXJA 5DD4A 3JTHA 1IN5A 4UUVA 2DQRA 3ERED 4P55A 5CVJA 3GZ6A 3BJOA 2XKOA 2P6SA 5TJJA 5BMZA 1JXSA 3E97A 1XN7A 5DD8A 3V7CA 1W7PD 2VC0A 4U0VA 4AIKA 1W7PB 5D6EA 5HLIA 1BN5A 1IN6A 2XV4S 1D3YA 4AVPA 1F9NA 2GIVA 2EFOA 2HOEA 4M71A 4HYEA 5ICFA 1IXCA 4GGGA 1XSVA 4UXNA 2BEOA 2E1NA 3KE2A 3ZMZA 4G7OF 4A6DA 2FBHA 2FNPA 2GQQA 4I02A 2HQNA 4ZH4F 1XMAA 2CO5A 2A3SA 1T6SA 2FOKA 4ENKA 4P5OA 1LQ1A 3J81Z 1IUYA 4R1HA 5ERIA 4MTDA 1FP1D 4I7HA 2VC1A 2HYGD 3DKWA 4HX7A 2YR2A 3DXJF 1XGNA 3WE2A 3EDPA 2O3FA 3QRFF 1HKQA 5D5XB 2VBWA 5D5WB 1U3EM 3PQKA 1MDMB 4HV6A 1WWXA 4M9XA 1G6NA 5K5RA 5CVUA 5BS6A 1QQIA 2O03A 1V3FA 1K78B 1IXSB 4EJUA 4HX8A 1QGPA 3QPTA 1JGSA 2LDUA 2OD5A 3KP2A 4Y17A 1MJBA 4HQEA 3F6VA 2AS5F 4KICA 2GXGA 4BAYA 2LF7A 1AWCA 3FXQA 1YW7A 1ULYA 5DUKA 4WXCA 1FBUA 1LB2A 2Y0MA 1TQIA 1J7KA 3ZMSA 1USTA 4M6YA 3FZVA 3BJAA 2RKHA 3FHZA 3HRSA 2YPRA 3V7SA 5DV5A 1F5TA 1OPCA 4HLYA 2NAZA 4RGRA 2QVOA 5LHHA 2LF8A 2AXLA 2EFWA 1IXRC 2L4AA 3J80K 1TQPA 4YIIA 3HTUA 2W85A 1B1BA 1I1SA 4P96A 4BNCA 1B9MA 2PMHA 3BROA 2L54A 2M8EA 1BJAA 4HAMA 3MQ0A 4IXAA 2ESHA 2EA4A 1GVJA 3HSEA 3ZPLA 3F6OA 1SMYF 5J8CA 5HS8A 2OA4A 4L5IA 4PZJA 2IJLA 1C0WA 3L7WA 3CO6C 3TQNA 3M8FA 2VONA 5D8KB 3HHHA 4IRHA 2ESNA 4AIJA 4ENMA 3EYIA 1W4MA 1ON1A 1S7OA 3NRVA 2DT5A 4XSXF 4ENJA 5K5QA 1I5ZA 3IC7A 1QZYA 4LLGF 2VN2A 3LQQA 4YG2F 2PEXA 4OIRF 1YTYA 4A12A 3B02A 2O8XA 1FYMA 4HF0A 1YG2A 3K1PA 3RKWA 3GYHX 1T98A 3RYRA 2W84A 2DPDA 4U0YA 2XRNA 1WSUA 2JZYA 2OZ6A 2YX7A 3I53A 1QBJA 2F2EA 4EJVA 2IP2A 2XAHA 3U1DA 3IRQA 1QPMA 1I1GA 1JHHA 1UB9A 2VT3A 2NYXA 4L9NA 2ETHA 3WTWC 1Z91A 4GCVA 1U5TB 1BI0A 4KN4X 5LGTA 2IRFG 1RI7A 1LEBA 3TO9A 4LD5A 1XGOA 1O3QA 4U88A 5LRRA 3ML6A 4XRFA 1O7FA 3C7JA 4ZYGA 1XSXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GFM A;  2EJR A;  4EM0 B;  3DFG A;  2DFI A;  4L9V A;  4EMS A;  1DPR A;  1O3S A;  1D8K A;  3C18 A;  4HDV A;  1XGM A;  4P9F A;  2ZKZ A;  3HTS B;  3JSP A;  1IAW A;  2MBF A;  3R4K A;  3P7N A;  1SFU A;  4KUM A;  1IN8 A;  2IW5 A;  4UVB A;  1R5H A;  2EV6 A;  4IRI A;  2O61 A;  2EFN A;  5E8G A;  4KN7 X;  2EFP A;  3JAM Z;  2E7X A;  3WG9 A;  1O3R A;  3F8B A;  3FX3 A;  4LG0 B;  2UXX A;  2Z5U A;  5L3F A;  1PP7 U;  1WKM A;  3E6D A;  1SFX A;  5IT9 K;  4HW0 A;  1G3Y A;  3R61 A;  1R1T A;  1OYW A;  1FC3 A;  1QZZ A;  3KFW X;  2PQ8 A;  3OV8 A;  1I6X A;  3MZY A;  4RB0 A;  3V8J A;  2W57 A;  4EJW A;  5FD6 A;  4I98 B;  4WXH A;  3WTX C;  4L0Z B;  2QWW A;  4G6D A;  4ESB A;  2O6G E;  4P9U A;  4CIC A;  3RPU A;  4TV7 A;  1W5T A;  1CF7 A;  5FLX Z;  1O3T A;  4CHU A;  2L3D A;  3F22 A;  1EH7 A;  3K0L A;  4FX0 A;  5LGU A;  2RVC A;  1ZG1 A;  3EUH A;  2BBY A;  2ZJ2 A;  3K1M A;  2M30 A;  3HYI A;  2YSR A;  2GA2 A;  3CUQ A;  2KJC A;  4Z2Y A;  1BBY A;  3V8L A;  3M1E A;  1LDD A;  4OIP F;  2P5L C;  5DDG A;  3I71 A;  2NRA C;  1P92 A;  1U6G A;  4LB5 A;  1J2X A;  3IWZ A;  4I0B A;  1P6R A;  4LFU A;  2DW4 A;  3RYP A;  2QQB A;  3C3W A;  4ZYD A;  4G94 A;  3ZMV A;  4G6Q A;  3SQN A;  4RGS A;  1J5Y A;  1HBX G;  1RNL A;  2LSO A;  5JHU A;  1DDN A;  4FT8 A;  2YX4 A;  3FM3 A;  2PLY A;  5ICC A;  3ZMT A;  3F21 A;  2XUB A;  1ZRC A;  3WTU C;  2HTJ A;  4H0E A;  4BHP A;  1BC8 C;  2QQ9 A;  1YS6 A;  4ON0 A;  4HV5 A;  4M74 A;  4KIG A;  2QBY A;  1EV7 A;  3WTZ A;  4Q4Z F;  4U7D A;  1Q1H A;  3J81 K;  2L02 A;  4Y15 A;  2E1C A;  3FM5 A;  3JW4 A;  4R8H A;  2UXN A;  1HQC A;  1FWZ A;  2QM3 A;  2EB7 A;  1WRJ A;  1U2W A;  2J5O A;  1H9G A;  2CFX A;  5KVR A;  4BHB A;  3GF2 A;  4IVN A;  1U78 A;  5D4S A;  4HF2 A;  3WU0 A;  5HLH A;  3LA3 A;  4IF4 A;  3RPQ A;  2CW0 F;  3D5L A;  5DEQ A;  3BPV A;  2CYY A;  2MH2 A;  5L3B A;  4BHC A;  1UHM A;  2XAG A;  3R0J A;  2K02 A;  2IA0 A;  2K7L A;  3RDI A;  3ULQ B;  1BI1 A;  1JHF A;  4AD9 A;  2CWE A;  4EV0 A;  4GYG A;  5LEJ A;  5CLS A;  4EVI A;  3QP5 A;  3BOQ A;  4AIH A;  2FRH A;  2IVM A;  3DV8 A;  3H92 A;  3IKT A;  2V1X A;  1XMK A;  5JI6 A;  1S3J A;  5F64 A;  1ZN2 A;  2K86 A;  3F8M A;  5D6F A;  1LDJ A;  2Q0O A;  4ASN A;  2HTS A;  2OZU A;  1YW8 A;  3GLX A;  3RKX A;  2V1D A;  3O3K A;  1KU9 A;  3GFI A;  2ZCW A;  1XDS A;  2VOD A;  2A69 F;  1R36 A;  4BXU A;  3QP6 A;  4ZYE A;  1E2X A;  1OR7 A;  1UCR A;  3KP4 A;  3P9K A;  2P7C B;  2EWN A;  3QPH A;  3K69 A;  3WTY C;  5HDK A;  2HEO A;  1BC7 C;  5LRS A;  3HUG A;  1BM9 A;  1TBX A;  3CTA A;  3K1N A;  1ZRE A;  5HOO A;  1OMI A;  3FMR A;  1MKM A;  4KT5 C;  3KLN A;  3RIR A;  4A2U A;  1T0F A;  2VOP A;  4MTE A;  1RZ4 A;  5H6R A;  1J75 A;  1L3L A;  2P6T A;  2JPC A;  1LVA A;  2PMU A;  2GXB A;  1KQ9 A;  1FPQ A;  2EV5 A;  3V4G A;  4HA8 A;  2P7V B;  2K4B A;  2BYV E;  3I59 B;  3R60 A;  2R3S A;  4RB3 C;  2DO7 A;  1SD5 A;  2A6E F;  3BJ6 A;  4XBF A;  3WTV C;  2H94 A;  2JT1 A;  1V4R A;  4L18 B;  5DUI A;  1PP8 F;  2H09 A;  1FY7 A;  3ECH A;  2WTE A;  3GXO A;  5LEK A;  2QLZ A;  3DP7 A;  3FWE A;  2EFQ A;  4Q5S F;  4CO8 A;  3E6C C;  3T5X A;  5JR3 A;  1R00 A;  5ILU A;  4UHT A;  5A2Q K;  5K1Y A;  4PGH A;  4UVA A;  4KYW A;  4LLL A;  1R1U A;  2HR3 A;  3SFZ A;  1ZHF A;  4RAZ A;  2OAZ A;  3GUD A;  5E17 F;  1HW5 A;  2RDP A;  5AON A;  1KYW A;  3F8C A;  5DYM A;  2Z99 A;  3TGN A;  2WWY A;  2A68 F;  4UVC A;  2G7U A;  4EJO A;  2M87 A;  2STT A;  5LBQ A;  3GO5 A;  4RS8 A;  4DNC A;  3ZMU A;  3V8K A;  1XD7 A;  3M7G A;  3HRT A;  5AIQ A;  1LJ9 A;  4GYI A;  4ESJ A;  5CVI A;  3AAF A;  3CDH A;  3DF8 A;  3I64 A;  2PI0 A;  1P4A A;  3R6S A;  4BQA A;  4O3M A;  2ZFW A;  1XCV A;  3MZH A;  2VBX A;  3WGH A;  1DUX C;  2D1V A;  2QZ8 A;  3MAJ A;  1ZLK A;  4A6E A;  1YYV A;  2UZK A;  1USS A;  2F5E A;  1XCB A;  3RKY A;  3SXY A;  3IWF A;  5H6Q A;  2XAJ A;  2RC4 A;  4OIO F;  3KP3 A;  2QYO A;  1H9T A;  2JRT A;  4KMF A;  3GWZ A;  4ZYH A;  3WOD F;  1DP7 P;  3IRR A;  5H20 A;  3I58 A;  2A6H F;  3VB2 A;  3EYY A;  4EJT A;  3DEU A;  3L9F A;  3WE3 A;  1BIB A;  1BIA A;  2XKP A;  2L01 A;  1ON2 A;  1FOK A;  5DCM A;  4RB1 A;  3GFL A;  1TNS A;  1SD4 A;  1KU2 A;  4Y13 A;  1K79 A;  3DPT A;  4RGX A;  2DK8 A;  1KYZ A;  2MC3 A;  4UV8 A;  5E1Z B;  3T0Y A;  5L3G A;  3C1D A;  1HW2 A;  2DU9 A;  2FU4 A;  5D5V B;  3W6J B;  2QQA A;  3IHU A;  3FXU A;  2FBI A;  3GW2 A;  2QEN A;  1VTN C;  2DPU A;  2C6Y A;  3ZMD A;  5DCM B;  1S7A A;  3VOD A;  2VE8 A;  1X3U A;  2ISY A;  1Z1D A;  1SD7 A;  2COM A;  1R58 A;  4G9Y A;  1P2F A;  2VBZ A;  3CLO A;  2GWR A;  4WCG A;  4U7B A;  3LAP A;  3PQJ A;  4LLN A;  3HOS A;  3TDU C;  1D8J A;  4HF1 A;  3F23 A;  2P5V A;  3NQO A;  4CDG A;  3M8E A;  2R7D A;  2ZBK A;  3ABT A;  1ZGJ A;  3WGI A;  1FZP B;  4KIF A;  4EM1 A;  4PGG A;  3DPL C;  2FBK A;  3WGG A;  1F4K A;  2XRO A;  2ZME A;  3L09 A;  4R79 A;  1R22 A;  4N9I A;  2L4M A;  3NEU A;  2LKP A;  1AOY A;  2HS5 A;  2HQR A;  3RTR A;  2KRF A;  2FXA A;  2FSW A;  3ROU A;  5HLG A;  3I4P A;  2ACJ A;  2OBP A;  3QAH A;  3EQL F;  3O6B B;  4EM2 A;  1IRF A;  4DQ2 A;  2QBY B;  1HXD A;  2G9W A;  4IPA A;  3H3U A;  3KCC A;  3T8R A;  3B73 A;  5F1R A;  1HKT A;  2OQG A;  2KIM A;  1QO0 D;  4A5N A;  1IW7 F;  4L9T A;  4HLX A;  1ZG3 A;  2V6C A;  1XSD A;  3U2R A;  2XIG A;  3GFJ A;  4RB2 C;  1TW3 A;  2FNA A;  3M9A A;  3KET A;  3GX4 X;  2GZW A;  4FHT A;  2HKO A;  4JBA A;  2CGP A;  3I54 A;  1KQ8 A;  3P9C A;  4HX4 A;  3RI4 A;  5BPD A;  1TQM A;  1LNW A;  1OKR A;  1O7L A;  2ELH A;  3MEX A;  3QU3 A;  3VOE A;  4FX4 A;  4WF2 A;  2NS0 A;  4M6X A;  5L3D A;  2VBY A;  2BE5 F;  2YU3 A;  3KP6 A;  1SAX A;  2W25 A;  3L2C A;  4RGU A;  1JE8 A;  2VXZ A;  4LB6 B;  5J6X A;  4A0Y A;  3FMQ A;  4IJA A;  4LMY A;  5D8L B;  1IN4 A;  1FSH A;  3E6B A;  2WV0 A;  5EEH A;  1BI2 A;  2A07 F;  4MNU A;  2FQ3 A;  1KU3 A;  1FNN A;  4PDK A;  1FBS A;  1FP2 A;  3T8T A;  2D2W A;  4K2E A;  3L00 A;  1FYL A;  3I59 A;  4YFX F;  1DPU A;  3JAM K;  2XHK A;  3VEP A;  4I2O A;  3COA C;  1KGS A;  3I5U A;  5HVQ C;  2ADU A;  4M9Z A;  3R0A A;  1J9I A;  4CYD A;  4YIF A;  5AIP A;  1B4A A;  4WXD A;  3BZ6 A;  5BQT A;  4I09 A;  4AWX B;  2A5Y B;  3Q9V A;  2FMY A;  5LHI A;  3ZQ7 A;  1KQ0 A;  1FLI A;  4L0Y B;  4EGY A;  5LHG A;  5TRD A;  3GZ5 A;  3W6K B;  3KEO A;  1T39 A;  2UWM A;  5J8F A;  2FA5 A;  1U5T C;  4CXF A;  2HYF A;  2DLL A;  3N4M A;  4KNY A;  2Q2E A;  1ZG5 A;  1TLH B;  5LLQ A;  3H3Z A;  3SHF A;  5CVR A;  2VT2 A;  4OOI A;  2WC2 A;  3IKV A;  2MLG A;  2Z33 A;  3WU1 B;  2Y48 A;  3HIF A;  2ZNZ A;  1RIO H;  4XLN F;  1WQ2 A;  2Z9O A;  2MLK A;  3P9I A;  2EK5 A;  3WTS C;  4LJZ F;  3LFK A;  3G3Z A;  1HSJ A;  4CGZ A;  2NNN A;  4IHT A;  2K27 A;  5ILV A;  4L5J A;  4KDP A;  4XSZ F;  1GXP A;  2BGC A;  4EQQ A;  1ZRF A;  3BY6 A;  1MJA A;  3PFI A;  1PDN C;  2HWV A;  4RAY A;  2ZME B;  4YFN F;  4O6J A;  1IRG A;  1MGT A;  2PBI A;  1R23 A;  2B0L A;  2Y75 A;  4HZF A;  1E17 A;  4BH9 A;  3FF5 A;  4QLC U;  2LNB A;  2EV0 A;  4KMU X;  2D45 A;  2KJB A;  2Q8K A;  1HST A;  2DAO A;  4OMY A;  2M1B A;  1W5S A;  4B8X A;  4M73 A;  4OMZ A;  1I27 A;  1FYK A;  2NNY A;  3E6M A;  5L3C A;  4L9J A;  3FMS A;  3E3V A;  5E18 F;  1REP C;  5F6F A;  4E70 A;  2FE3 A;  5HS7 A;  1F1Z A;  3DQV C;  1J59 A;  3ISP A;  3LA7 A;  4EGZ A;  5K5O A;  1G3W A;  4MHG A;  2PFB A;  2JSC A;  3CUO A;  4KFC A;  5BPI A;  3F3X A;  1XDU A;  4CZZ A;  1EH6 A;  4NB5 A;  1S29 A;  3REO A;  1L0O C;  2H6B A;  2P8T A;  1QNT A;  1B9N A;  4A0Z A;  3E5Q A;  1G3T A;  3E5U A;  1YW9 A;  5ILS A;  1YLF A;  2RQP A;  1ODD A;  3MCZ A;  3JSO A;  2HKX A;  1FBQ A;  1B6A A;  3I0T A;  1HW1 A;  5CVV A;  1U8R A;  3EET A;  3TO7 A;  1TW2 A;  5IT9 Z;  2ZO4 A;  1CF7 B;  3S2W A;  2HDC A;  2XAF A;  4NQW A;  1ZGA A;  4Q47 A;  1ZH5 A;  4IRG A;  4F7Z A;  3JTG A;  2H27 A;  1LDK B;  1YS7 A;  2V1U A;  1YQA A;  1Z7U A;  4ZZD A;  3HOT A;  3F72 A;  3LST A;  1YO5 C;  3BPX A;  3QOP A;  3LWF A;  1TNT A;  1Z05 A;  1SFE A;  2KIU A;  3TKY A;  4LG0 A;  1MDM A;  1ZRD A;  2DTR A;  1D5V A;  4IHS A;  2K4J A;  5L3E A;  4YFK F;  4GO1 A;  3WTT C;  1RUO A;  1MD0 A;  4GXO A;  4LK0 F;  2JPB A;  2F5C A;  5KK1 A;  3TO6 A;  1EH8 A;  3KLO A;  1H0M A;  3K2Z A;  3LQR A;  1TTY A;  5FFZ A;  4B09 A;  2RV8 A;  2VOO A;  2O0Y A;  2DI3 A;  2P4W A;  1WI9 A;  2J5P A;  3GEZ A;  2OQR A;  2RGV A;  1ONV A;  4OU0 A;  4BYY A;  1KU7 A;  1ZYR F;  2GAU A;  1KA8 A;  4MEY F;  2PG4 A;  3G73 A;  1P4W A;  5FFX A;  2DBB A;  1T38 A;  3OOP A;  5ICE A;  3SZT A;  4ENN A;  1MJ9 A;  3HRM A;  3FXR A;  3CUQ C;  2G7H A;  3CUQ B;  2Z3Y A;  2HZT A;  5E1X A;  2PJP A;  4HOB A;  1IF1 A;  4OIQ F;  3ZN0 A;  1S8N A;  1S6L A;  2DK5 A;  5FB2 A;  1ZLJ A;  5A2Q Z;  1BI3 A;  4WX9 A;  2VE9 A;  1Y0U A;  1UHW A;  3F8F A;  1GHC A;  4N9H A;  1FSE A;  4S04 A;  3MFK A;  4LK1 F;  3RJP A;  5E1W A;  2CSO A;  3KP7 A;  1R7J A;  3LAJ A;  2RN7 A;  1W7P A;  3KP5 A;  2X0L A;  1CGP A;  4I01 A;  4D0P A;  2ZNY A;  2IA2 A;  3VFZ A;  1PUE E;  2RNJ A;  5CYV A;  5HDN A;  3ZP5 A;  3TOB A;  2CQK A;  5FLX K;  3LA2 A;  5E20 A;  5HDG A;  2JTV A;  4UNO A;  1R5G A;  1XB4 A;  1FT9 A;  2A61 A;  2FF4 A;  1XGS A;  1SMT A;  5EEG A;  1YFH A;  4ZZL A;  2F5F A;  1IN7 A;  3CJN A;  4KIB A;  3U9G A;  5BOX A;  3SZP A;  1O57 A;  1B59 A;  3ABU A;  2P5K A;  1MZB A;  4A5M A;  3QU6 A;  3J80 Z;  3TOA A;  1P4X A;  4M9S A;  1Z6T A;  5D4R A;  5E8I A;  2M45 A;  3GVA A;  1STZ A;  3CO7 C;  2HFH A;  2KIF A;  5ED4 A;  1J0R A;  5JVT A;  3D0S A;  1IZ1 A;  2D1H A;  3T1B A;  2R7F A;  3KZZ A;  3HRU A;  4HDU A;  1U5T A;  4MGR A;  3ZN1 A;  1K7A A;  4QWQ A;  4LGW A;  2MH9 A;  1ZAR A;  3MWM A;  3KEQ A;  3BP8 A;  3N97 A;  4G7H F;  1K6O A;  2MA3 A;  3HSR A;  4MQV A;  4KA4 A;  2XAS A;  2M5W A;  4Q48 A;  1FX7 A;  1GXQ A;  1R1V A;  3E5X A;  5LGN A;  4ESF A;  2H6C A;  4A0X A;  2XGX A;  3J7A O;  4JK1 X;  1SD6 A;  2FML A;  1LEA A;  4ETS A;  1UFM A;  2EA2 A;  5D5U B;  4G8X A;  2QUF A;  5DCF A;  5ICG A;  3TDZ C;  5FD5 A;  3Q5F A;  2IPQ X;  1K78 A;  4UV9 A;  1OYY A;  1BOA A;  4M72 A;  3BDD A;  1A04 A;  4WWC A;  4MEX F;  1RUN A;  2W24 A;  3ECO A;  3ELK A;  4N0B A;  5HS9 A;  3F8N A;  3HHG A;  2MD5 A;  1Z9C A;  1G3S A;  2V9V A;  2XAQ A;  2FEZ A;  4PCQ A;  4I0A A;  2OU2 A;  5IT3 A;  4WK8 F;  2HGC A;  1OYI A;  2X4H A;  3KZY A;  4NHJ A;  3V7R A;  2KKO A;  2GA1 A;  2DQL A;  2TDX A;  3O2P E;  5JFR A;  3Q9S A;  2F5D A;  4S05 A;  4MQ9 F;  5CJ9 A;  1YIO A;  2ISZ A;  2CG4 A;  5FGM A;  1G4D A;  3IL2 A;  4HBL A;  1HKS A;  2V79 A;  4HQM A;  2IT0 A;  2IA1 A;  6PAX A;  4XLP F;  5FO5 A;  3K9T A;  2BV6 A;  4O5V A;  4OIN F;  4JQF A;  2STW A;  4G7Z F;  3HSF A;  1ZAO A;  2XVC A;  1T2K A;  2E7W A;  2PN6 A;  1Z6R A;  1NHA A;  3BWG A;  4U0W A;  2ZXJ A;  5DD4 A;  3JTH A;  1IN5 A;  4UUV A;  2DQR A;  3ERE D;  4P55 A;  5CVJ A;  3GZ6 A;  3BJO A;  2XKO A;  2P6S A;  5TJJ A;  5BMZ A;  1JXS A;  3E97 A;  1XN7 A;  5DD8 A;  3V7C A;  1W7P D;  2VC0 A;  4U0V A;  4AIK A;  1W7P B;  5D6E A;  5HLI A;  1BN5 A;  1IN6 A;  2XV4 S;  1D3Y A;  4AVP A;  1F9N A;  2GIV A;  2EFO A;  2HOE A;  4M71 A;  4HYE A;  5ICF A;  1IXC A;  4GGG A;  1XSV A;  4UXN A;  2BEO A;  2E1N A;  3KE2 A;  3ZMZ A;  4G7O F;  4A6D A;  2FBH A;  2FNP A;  2GQQ A;  4I02 A;  2HQN A;  4ZH4 F;  1XMA A;  2CO5 A;  2A3S A;  1T6S A;  2FOK A;  4ENK A;  4P5O A;  1LQ1 A;  3J81 Z;  1IUY A;  4R1H A;  5ERI A;  4MTD A;  1FP1 D;  4I7H A;  2VC1 A;  2HYG D;  3DKW A;  4HX7 A;  2YR2 A;  3DXJ F;  1XGN A;  3WE2 A;  3EDP A;  2O3F A;  3QRF F;  1HKQ A;  5D5X B;  2VBW A;  5D5W B;  1U3E M;  3PQK A;  1MDM B;  4HV6 A;  1WWX A;  4M9X A;  1G6N A;  5K5R A;  5CVU A;  5BS6 A;  1QQI A;  2O03 A;  1V3F A;  1K78 B;  1IXS B;  4EJU A;  4HX8 A;  1QGP A;  3QPT A;  1JGS A;  2LDU A;  2OD5 A;  3KP2 A;  4Y17 A;  1MJB A;  4HQE A;  3F6V A;  2AS5 F;  4KIC A;  2GXG A;  4BAY A;  2LF7 A;  1AWC A;  3FXQ A;  1YW7 A;  1ULY A;  5DUK A;  4WXC A;  1FBU A;  1LB2 A;  2Y0M A;  1TQI A;  1J7K A;  3ZMS A;  1UST A;  4M6Y A;  3FZV A;  3BJA A;  2RKH A;  3FHZ A;  3HRS A;  2YPR A;  3V7S A;  5DV5 A;  1F5T A;  1OPC A;  4HLY A;  2NAZ A;  4RGR A;  2QVO A;  5LHH A;  2LF8 A;  2AXL A;  2EFW A;  1IXR C;  2L4A A;  3J80 K;  1TQP A;  4YII A;  3HTU A;  2W85 A;  1B1B A;  1I1S A;  4P96 A;  4BNC A;  1B9M A;  2PMH A;  3BRO A;  2L54 A;  2M8E A;  1BJA A;  4HAM A;  3MQ0 A;  4IXA A;  2ESH A;  2EA4 A;  1GVJ A;  3HSE A;  3ZPL A;  3F6O A;  1SMY F;  5J8C A;  5HS8 A;  2OA4 A;  4L5I A;  4PZJ A;  2IJL A;  1C0W A;  3L7W A;  3CO6 C;  3TQN A;  3M8F A;  2VON A;  5D8K B;  3HHH A;  4IRH A;  2ESN A;  4AIJ A;  4ENM A;  3EYI A;  1W4M A;  1ON1 A;  1S7O A;  3NRV A;  2DT5 A;  4XSX F;  4ENJ A;  5K5Q A;  1I5Z A;  3IC7 A;  1QZY A;  4LLG F;  2VN2 A;  3LQQ A;  4YG2 F;  2PEX A;  4OIR F;  1YTY A;  4A12 A;  3B02 A;  2O8X A;  1FYM A;  4HF0 A;  1YG2 A;  3K1P A;  3RKW A;  3GYH X;  1T98 A;  3RYR A;  2W84 A;  2DPD A;  4U0Y A;  2XRN A;  1WSU A;  2JZY A;  2OZ6 A;  2YX7 A;  3I53 A;  1QBJ A;  2F2E A;  4EJV A;  2IP2 A;  2XAH A;  3U1D A;  3IRQ A;  1QPM A;  1I1G A;  1JHH A;  1UB9 A;  2VT3 A;  2NYX A;  4L9N A;  2ETH A;  3WTW C;  1Z91 A;  4GCV A;  1U5T B;  1BI0 A;  4KN4 X;  5LGT A;  2IRF G;  1RI7 A;  1LEB A;  3TO9 A;  4LD5 A;  1XGO A;  1O3Q A;  4U88 A;  5LRR A;  3ML6 A;  4XRF A;  1O7F A;  3C7J A;  4ZYG A;  1XSX A; 
#chains in the Genus database with same CATH topology
 3GFM A;  2EJR A;  2HQ5 A;  4EM0 B;  1Z21 A;  3DFG A;  3GTK J;  2DFI A;  4L9V A;  1NH3 A;  1WJD A;  3DBR B;  3JCU C;  2QA4 I;  4EMS A;  2CV0 A;  1MNM C;  1DPR A;  1O3S A;  1D8K A;  3C18 A;  4HDV A;  3ESW B;  1XGM A;  4P9F A;  2AHQ A;  2ZKZ A;  3HTS B;  2AQE A;  3JSP A;  3D5S C;  1IAW A;  2MBF A;  3R4K A;  1RC9 A;  5K7H A;  3DLA A;  1Y39 A;  3P7N A;  1SFU A;  1FMW A;  4KUM A;  4NDL A;  4DYR A;  2YS9 A;  2DXI A;  1IN8 A;  2IW5 A;  4UVB A;  1PVE A;  1R5H A;  3FBI B;  2EV6 A;  2GOX B;  3BZC A;  4IRI A;  2O61 A;  2EFN A;  1B8I A;  5E8G A;  4KN7 X;  2EFP A;  3JAM Z;  4QTR A;  4YRV A;  2E7X A;  3WG9 A;  3FBN B;  1O3R A;  5DM6 F;  3F8B A;  3FX3 A;  3FXK A;  4LG0 B;  2UXX A;  2CV1 A;  3SJM A;  3ZGK A;  1N78 A;  2Z5U A;  5L3F A;  1T8I A;  1PP7 U;  1WKM A;  3E6D A;  5EYR A;  3ZQF A;  3CCL I;  4XOT A;  1SFX A;  2XSD C;  5IT9 K;  4HW0 A;  1G3Y A;  5E3M A;  5M3F J;  3R61 A;  1R1T A;  1D1C A;  4RAG A;  1OYW A;  1FC3 A;  1ACI A;  3OSG A;  3AL0 B;  1Z67 A;  1QZZ A;  3KFW X;  4JX6 A;  2CV2 A;  3BC8 A;  2PQ8 A;  3OV8 A;  4EEF G;  3HJE A;  4F3Q A;  4IQ4 A;  1I6X A;  3FXJ A;  3MZY A;  4RB0 A;  2KZG A;  3V8J A;  2W57 A;  4EJW A;  5FD6 A;  3H5A A;  1X19 A;  3BTL A;  4I98 B;  4WXH A;  4MLO A;  5GP9 A;  3WTX C;  1ZR2 A;  3QYF A;  1HA8 A;  4L0Z B;  2CW8 A;  2WAE A;  2QWW A;  1T08 B;  3QPL A;  3ZQI A;  4G6D A;  4ESB A;  3TP0 A;  2R7S A;  2O6G E;  1W0T A;  2K9Q A;  4P9U A;  4CIC A;  3NAR A;  4E7I A;  3RPU A;  4NQW B;  3FKJ A;  4TV7 A;  1W5T A;  1CF7 A;  1TWF J;  2BY2 A;  2HXI A;  5FLX Z;  1S9H A;  3L2Q A;  1O3T A;  4CHU A;  3M3Y J;  4FAS D;  1TWC J;  1JKQ C;  2V6E A;  2L3D A;  2V1N A;  3F22 A;  4I6Z A;  1EH7 A;  1X1D A;  2OF7 A;  3K0L A;  4FX0 A;  5LGU A;  2RVC A;  1ZG1 A;  2XPU A;  3ABL H;  4LOC A;  3EUH A;  2ZJ2 A;  2BBY A;  2E35 A;  3K1M A;  4M3B A;  2M30 A;  3HYI A;  1KZH A;  5FLM J;  3RSN A;  3CZ6 A;  2YSR A;  2GA2 A;  3CUQ A;  2KJC A;  4Z2Y A;  4XRS G;  3H35 A;  1BBY A;  3TMO A;  3V8L A;  3M1E A;  1LDD A;  1A6Q A;  4OIP F;  2P5L C;  5DDG A;  4GFB A;  3I71 A;  2NRA C;  2YU9 J;  1P92 A;  2A5W A;  1U6G A;  2DMQ A;  1ORK A;  4LB5 A;  4PJM A;  1J2X A;  3IWZ A;  4IOC F;  4I0B A;  1P6R A;  1E3P A;  4LFU A;  2DW4 A;  3RYP A;  2QQB A;  3C3W A;  4DBR A;  2LY2 A;  4ZYD A;  4G94 A;  3ZMV A;  5EGO B;  3BQZ A;  4G6Q A;  3U21 A;  1VFC A;  3SQN A;  4RGS A;  1J5Y A;  1HBX G;  4FTH A;  3DU6 A;  1MMN A;  1RNL A;  2JMW A;  3CJT B;  2LSO A;  5JHU A;  1DDN A;  4FT8 A;  2O5R A;  2YX4 A;  3FM3 A;  3ZQG A;  3I55 I;  1DU0 A;  5GPC A;  1EJ9 A;  2PLY A;  3LSM A;  2HOA A;  4RDU A;  5ICC A;  2CW7 A;  3S1M J;  3ZMT A;  4E7K A;  3DKX A;  3F21 A;  2XUB A;  1ZRC A;  3WTU C;  2EIL H;  3HPG A;  2HTJ A;  3UNG C;  4DIQ A;  1XPX A;  1QVT A;  4H0E A;  4BHP A;  1BC8 C;  2QQ9 A;  3SEZ A;  1YS6 A;  4ON0 A;  4HV5 A;  4M74 A;  1T95 A;  3S32 A;  2WV1 A;  1MSF C;  4KIG A;  2QBY A;  1EV7 A;  3WTZ A;  3G6E I;  2F4M B;  4Q4Z F;  4U7D A;  1Q1H A;  3J81 K;  2L02 A;  4Y15 A;  3CCJ I;  2XF5 A;  3FM5 A;  3JW4 A;  2E1C A;  3FIW A;  4R8H A;  1H88 C;  4ZDL A;  2OV7 A;  2UXN A;  3FKI J;  2H8R A;  4MFD A;  3PNY A;  1HQC A;  1ZEL A;  2CMP A;  1FWZ A;  2QM3 A;  2VJJ A;  2EB7 A;  1WRJ A;  1U2W A;  1MMG A;  1VQO I;  2B7E A;  4CCN A;  2J5O A;  4HPQ A;  1H9G A;  2CFX A;  4IZZ A;  2VB6 A;  2EIM H;  1IG7 A;  4CYC A;  5KVR A;  4BHB A;  3OYG A;  4XL9 A;  5M3M J;  2IAI A;  2VQH A;  2DMP A;  1IRX A;  3GF2 A;  4IVN A;  1U78 A;  5D4S A;  4HF2 A;  1FMV A;  2HVS A;  3WU0 A;  2E1O A;  5HLH A;  3LA3 A;  4E7L A;  4IF4 A;  2L9R A;  3RPQ A;  4BGD A;  2CW0 F;  3D5L A;  5DEQ A;  3CJQ B;  5IP7 J;  3BPV A;  4X1E A;  2CYY A;  3RZD J;  2MH2 A;  3CP2 A;  4AYB N;  4HRI A;  2CH0 A;  4JOM A;  4X6A J;  3CF5 F;  4CCO A;  2DA6 A;  5L3B A;  4BHC A;  2EIJ H;  3G1L A;  1UHM A;  2TRT A;  2XAG A;  3R0J A;  2K02 A;  3ZQQ A;  4C9Y A;  3DPU A;  1ITY A;  2IA0 A;  2K7L A;  3RDI A;  3ULQ B;  3O8H A;  1BI1 A;  3K4J A;  2M34 A;  1OCP A;  2DT7 B;  3OIP A;  1JHF A;  4Y3O A;  5GAE J;  1W0U A;  2VI6 A;  4AD9 A;  1A6I A;  5C3E J;  3OS0 A;  4FQG A;  2CWE A;  1WHU A;  4EV0 A;  4GYG A;  2KP6 A;  5LEJ A;  5CLS A;  2LG4 A;  4EVI A;  3DWL E;  3QP5 A;  3BOQ A;  1ENH A;  1OIS A;  4AIH A;  5DS9 A;  3MZ8 A;  2FRH A;  2IVM A;  3DU5 A;  3DV8 A;  3K10 A;  3H92 A;  3ZXS A;  3RCO A;  3IKT A;  2V1X A;  1XMK A;  5JI6 A;  1S3J A;  4DJA A;  5F64 A;  1ZN2 A;  2K86 A;  3F8M A;  4NC8 A;  5D6F A;  1LDJ A;  2Q0O A;  4ASN A;  2HTS A;  2OZU A;  4B4C A;  5TGT A;  1YW8 A;  2ZB9 A;  3GLX A;  3RKX A;  2DYS H;  2V1D A;  1IO2 A;  1MMS A;  1MH3 A;  3O3K A;  1KU9 A;  2HI3 A;  2ZCW A;  4V2G A;  3GFI A;  1ETW A;  1XDS A;  2VOD A;  2A69 F;  3HG9 A;  3OYC A;  1R36 A;  4BXU A;  3AG3 H;  2OUM A;  3QP6 A;  2HOT A;  4ZYE A;  2FUG 2;  3KYC B;  1E2X A;  2VPR A;  1OR7 A;  1UCR A;  4BJ6 C;  3KP4 A;  4V19 K;  3HOW J;  4PJL A;  3KEY A;  3P9K A;  3KYL A;  2P7C B;  2EWN A;  3QPH A;  5K7F A;  1H8A C;  2VJ5 A;  1OCR H;  2GXA A;  3K69 A;  3WTY C;  4BE0 A;  1MBF A;  5HDK A;  2HEO A;  1BC7 C;  5LRS A;  2HU9 A;  3HUG A;  1BM9 A;  1TBX A;  3CTA A;  3CCE I;  3K1N A;  1Y8R B;  3SDB A;  1ZRE A;  2LRE A;  2VKE A;  2Z2S B;  3TL4 X;  5HOO A;  1OMI A;  3FMR A;  1MKM A;  1O4X A;  1XC5 A;  4KT5 C;  1R4M B;  2KQR A;  2M7B A;  4IKF A;  3KLN A;  3OYI A;  3RIR A;  4RMN A;  4A2U A;  1T0F A;  2Y31 A;  2VOP A;  1UHS A;  4MTE A;  3VWB A;  1RZ4 A;  2X1C A;  2H1K A;  5H6R A;  1J75 A;  2O8K A;  1L3L A;  2P6T A;  2JPC A;  1V54 H;  3NWS A;  2OPT A;  3BZK A;  3GTG J;  3I4M J;  1LVA A;  2PMU A;  4A93 J;  2GXB A;  1KQ9 A;  1FPQ A;  4BAC A;  2QSG X;  2EV5 A;  3V4G A;  4HA8 A;  2P7V B;  2K4B A;  2JUG A;  4LIT A;  2BYV E;  1F36 A;  2LY9 A;  3I59 B;  3R60 A;  2R3S A;  1UZC A;  2ZSI B;  4RB3 C;  2DO7 A;  1SD5 A;  2A6E F;  3S93 A;  1ZKG A;  3CC7 I;  3BJ6 A;  1CQT A;  4XBF A;  3WTV C;  3S17 J;  2HNH A;  4C3H J;  1LPQ A;  3I3L A;  4C2M J;  2HVQ A;  2H94 A;  2LBF B;  2JT1 A;  1V4R A;  2L0K A;  4DOZ A;  5EEA A;  2MD0 A;  4L18 B;  5DUI A;  3MMY B;  1PP8 F;  2H09 A;  4QPQ A;  4AVZ A;  1FY7 A;  3HPH A;  2EZK A;  2LFB A;  3ECH A;  4BE1 A;  2EBI A;  2WTE A;  3GXO A;  4L5E A;  5LEK A;  2M2E A;  2QLZ A;  3DP7 A;  3FWE A;  5EJC A;  1AKH B;  5HNF A;  3PIO F;  2EFQ A;  3S16 J;  4AID A;  4Q5S F;  3U1K A;  4CO8 A;  1PJR A;  3E6C C;  2W82 A;  4CUG A;  4XMY A;  3AFH A;  3A01 A;  3T5X A;  5JR3 A;  1JKO C;  4XOP A;  1R00 A;  1SEU A;  5ILU A;  1GV2 A;  2YUS A;  1MBG A;  4UHT A;  5A2Q K;  2L2O A;  3HB9 A;  2TCT A;  4PGH A;  1V5F A;  4UVA A;  5K1Y A;  3LSK A;  4KYW A;  4LLL A;  2VPL A;  1R1U A;  4B3A A;  2HDD A;  2HR3 A;  3HC7 A;  3SFZ A;  1HDP A;  1XX5 A;  1ZHF A;  4RAZ A;  1X2N A;  2OAZ A;  3GUD A;  5HOD A;  1GT0 C;  5E17 F;  4BY7 J;  4OAY A;  4UY8 I;  2ME0 A;  2JQ7 A;  1HW5 A;  2E34 A;  1IV8 A;  1LE8 A;  2W00 A;  5JHF A;  2RDP A;  5AON A;  4F55 A;  5FKO A;  1KYW A;  3F8C A;  5DYM A;  3M4O J;  1HLV A;  3MD2 A;  1IRZ A;  3ZOB A;  4XN0 A;  2NS8 A;  2H1L A;  1EKE A;  1ZR4 A;  2Z99 A;  2XPW A;  3TGN A;  1D0Z A;  1FTT A;  2FQ4 A;  2QQ8 A;  5GAD J;  2E1M C;  2WWY A;  2A68 F;  4UVC A;  2G7U A;  3UR3 C;  4I76 A;  2MSY A;  4EJO A;  3ZR8 X;  2M87 A;  3JRF A;  2STT A;  5LBQ A;  3GO5 A;  4RM2 A;  4RS8 A;  4DNC A;  3ZMU A;  1Y6I A;  5GTH C;  3OYL A;  3V8K A;  2E2H J;  1XD7 A;  3M7G A;  3HRT A;  2K40 A;  1DP3 A;  4CCL A;  2E36 A;  3OYE A;  5AIQ A;  2F4O B;  1LJ9 A;  4GYI A;  4ESJ A;  5CVI A;  1TT0 A;  5FKN A;  3AAF A;  3CDH A;  3D1N I;  3DF8 A;  3I64 A;  2LBF A;  3OYJ A;  1Y1V J;  2DOE A;  2PI0 A;  2JRM A;  1P4A A;  3R6S A;  4BQA A;  1VQN I;  4FIS A;  5TIS C;  4F52 A;  4O3M A;  2GIZ A;  3OS1 A;  3OR1 C;  2ZFW A;  1XCV A;  2R5Y B;  3MZH A;  4D9J A;  2VBX A;  3WGH A;  1DUX C;  4EAT A;  2D1V A;  2QZ8 A;  3MAJ A;  1ZLK A;  2X1E A;  4A6E A;  1YYV A;  2W7N A;  2UZK A;  3K4B A;  1USS A;  2CQN A;  2F5E A;  1XCB A;  2NXN B;  3RKY A;  3SXY A;  2R93 J;  3H3V K;  3IWF A;  5EZG A;  2MG4 A;  5H6Q A;  2XAJ A;  3ZQL A;  2RC4 A;  4OIO F;  3KP3 A;  1K6Y A;  2QYO A;  1H9T A;  2JRT A;  3PNT A;  4KMF A;  3GWZ A;  4ZYH A;  3WOD F;  1S5L C;  1DP7 P;  3IRR A;  5H20 A;  3I58 A;  2A6H F;  3VB2 A;  2BOL A;  2IS2 A;  2XB5 A;  1R71 A;  2L7F P;  3WG7 H;  3EYY A;  2BY0 A;  2PJR A;  4EJT A;  3DEU A;  3L9F A;  3OOU A;  3WE3 A;  1BIB A;  1BIA A;  1AU7 A;  3QOD A;  1HDD C;  2Y9Z A;  4D7M A;  2XKP A;  4QIW N;  1YJ9 I;  2L01 A;  3CDL A;  1ON2 A;  4IO9 F;  1FOK A;  1BR1 A;  5DCM A;  4RB1 A;  2IS4 A;  3GFL A;  1TNS A;  1SD4 A;  2VJI A;  2JWT A;  4DW6 A;  2LP0 A;  1MH4 A;  4A3B J;  4XM3 A;  3A03 A;  1KU2 A;  4Y13 A;  1K79 A;  3DPT A;  3LSI A;  4RGX A;  2CUJ A;  2IS1 A;  1SVO A;  2DK8 A;  2GLO A;  1DQU A;  2DJN A;  2CQ7 A;  2LVS A;  2K3F A;  1KYZ A;  4G12 A;  2MC3 A;  2QKL B;  4UV8 A;  5E1Z B;  1PUF B;  3T0Y A;  5L3G A;  1Z77 A;  2UV1 A;  3K4K A;  3BTJ A;  1OCO H;  3C1D A;  1HW2 A;  3OYH A;  2DU9 A;  1RES A;  2FU4 A;  5D5V B;  4ZYA A;  2QQA A;  3W6J B;  3IHU A;  4M3F A;  3FXU A;  1YHQ I;  4XN3 A;  1MND A;  2FJ1 A;  2FBI A;  3GW2 A;  2QEN A;  2VQG A;  3PUB A;  3GTO J;  1VTN C;  2L7K A;  2DPU A;  2C6Y A;  2BHY A;  3ZMD A;  4BXF A;  1Q1V A;  3S1N J;  5DCM B;  3OL3 A;  3F0C A;  1S7A A;  3VOD A;  2GBY A;  2VE8 A;  3MKW B;  3S3M A;  1X3U A;  3PUF A;  2ISY A;  1Z1D A;  1SD7 A;  2COM A;  3C2B A;  1R58 A;  4G9Y A;  2KZV A;  2VJ4 A;  1P2F A;  2VBZ A;  3FXM A;  1WJB A;  3CLO A;  2GWR A;  3V42 A;  3DEW A;  4A69 C;  4WCG A;  4U7B A;  3LAP A;  4PSW A;  3PQJ A;  1WJC A;  3W3C A;  3OYF A;  3QQA A;  3HOS A;  1RRJ A;  4LLN A;  3TDU C;  1D1B A;  5E3O A;  1D8J A;  4HF1 A;  3F23 A;  2P5V A;  2VL8 A;  4A3J J;  1XS9 A;  3NQO A;  4CDG A;  3FHN A;  1OJL A;  3M8E A;  2R7D A;  2I5U A;  2FX0 A;  2ZBK A;  2V9P A;  3ABT A;  1ZGJ A;  3LSP A;  5IYB J;  3WGI A;  1DU6 A;  1FZP B;  4HSR A;  4KIF A;  4EM1 A;  2BHZ A;  4PGG A;  2DN0 A;  3DPL C;  1WCM J;  3LFU A;  1VQ6 I;  4IHY A;  2FBK A;  2DA7 A;  3WGG A;  1F4K A;  2XRO A;  2R5Z A;  1JJ6 C;  2ZME A;  3N05 A;  1QPI A;  3L09 A;  4R79 A;  2V7F A;  1R22 A;  4N9I A;  4G6T B;  1FOX A;  2EZI A;  2L4M A;  3NEU A;  2LKP A;  4ZTF A;  4V2F A;  1ZK8 A;  1AOY A;  4JP0 A;  2HS5 A;  2BY1 A;  1VND A;  2HQR A;  3RTR A;  1SFK A;  2KRF A;  2FXA A;  5DM7 F;  2FSW A;  3ROU A;  1OCT C;  4S0H B;  5HLG A;  2KPM A;  3I4P A;  3OR2 C;  2Y30 A;  2ACJ A;  3VYT B;  4CCJ A;  3HL2 A;  3F9K A;  1U9O A;  2OBP A;  3QAH A;  3H9G A;  4XID A;  3I56 I;  3EQL F;  3O6B B;  3OYM A;  3DBH B;  3H0G J;  4EM2 A;  2E2I J;  1IRF A;  2R7W A;  4DQ2 A;  2QBY B;  3JRG A;  1HXD A;  2G9W A;  4IPA A;  2M7A A;  3H3U A;  1UJ8 A;  3KCC A;  3T8R A;  3B73 A;  1E3H A;  2KMU A;  5F1R A;  1HKT A;  2OQG A;  2KIM A;  1QO0 D;  4A5N A;  5C4X J;  1IW7 F;  4L9T A;  4HLX A;  1ZG3 A;  2V6C A;  1XSD A;  4PJN A;  3U2R A;  4DGW B;  3KZI C;  2XIG A;  1LE8 B;  3GFJ A;  2DOF A;  4RB2 C;  1TP4 A;  3CF2 A;  1GLN A;  1E0E A;  5GAH J;  2MAB A;  1TW3 A;  4DBQ A;  2XSJ C;  4W1U A;  2FNA A;  4RLF A;  3M9A A;  3KET A;  4JYK A;  4J01 A;  1OLT A;  1GUU A;  4BS9 A;  2Q2E B;  3L2R A;  3GX4 X;  4PSX A;  1LFU P;  2GZW A;  4FHT A;  5EZH A;  2HKO A;  4JBA A;  2X1D A;  1G8X A;  2CGP A;  1W36 C;  2M9H A;  2ZXH A;  5CQE A;  2BVM A;  3I54 A;  1KQ8 A;  3P9C A;  4HX4 A;  4B48 A;  3RI4 A;  4B1R A;  5BPD A;  1TQM A;  3G71 I;  4M3E A;  2DA2 A;  1LNW A;  1OKR A;  1O7L A;  2ELH A;  3MEX A;  3QU3 A;  5CQG A;  3VOE A;  4BE2 A;  4FX4 A;  1IGN A;  4WF2 A;  2NS0 A;  4M6X A;  5L3D A;  2VBY A;  2FD5 A;  3BR5 A;  2BE5 F;  2YU3 A;  3KP6 A;  1SAX A;  2W25 A;  3L2C A;  2OCC H;  4RGU A;  4ZDP A;  1JE8 A;  5J1U A;  2VXZ A;  4A3F J;  2A05 A;  3OY9 A;  4LB6 B;  5J6X A;  4A0Y A;  4Z6Y A;  3FMQ A;  4IJA A;  4LMY A;  4C3I J;  5D8L B;  4HNV A;  1IN4 A;  3K4C A;  2DFH A;  3CME I;  1FSH A;  3E6B A;  2WV0 A;  5EEH A;  2F48 A;  1BI2 A;  2A07 F;  4MNU A;  1ERD A;  2XRL A;  3HBL A;  2FQ3 A;  1KU3 A;  1FNN A;  4PDK A;  1FBS A;  1BL0 A;  1FP2 A;  3T8T A;  2D2W A;  1JKP C;  4K2E A;  3L00 A;  1FYL A;  2R7X A;  1BOB A;  4NC7 A;  3I59 A;  4YFX F;  3OWT A;  1DPU A;  4UUS A;  4UUS B;  4CZC A;  3JAM K;  2XHK A;  3DTK A;  3VEP A;  4I2O A;  3COA C;  1ETO A;  3Q0U A;  3FIS A;  1KGS A;  2LOO A;  2EIN H;  2M8G X;  2K3P A;  4LIV A;  1S7E A;  3E7L A;  3IH3 A;  3VYR B;  1D1A A;  3I5U A;  5HVQ C;  2R5Y A;  4QSH A;  3CDI A;  5IPA A;  2ADU A;  4D7N A;  4M9Z A;  3R0A A;  1J9I A;  2I10 A;  4CYD A;  4BL0 B;  3S2D J;  4YIF A;  1I3Q J;  3OYA A;  5AIP A;  1ZGW A;  1B4A A;  4WXD A;  3OYB A;  2Q1Z B;  3BZ6 A;  5BQT A;  4I09 A;  3G2B A;  1WH7 A;  4AWX B;  3BR2 A;  1FIP A;  1WJA A;  5GPA A;  2A5Y B;  1HC8 A;  3Q9V A;  1QA6 A;  3JRC A;  3AG2 H;  4J19 A;  2FMY A;  5LHI A;  3HUG B;  3WHC A;  3ZQ7 A;  1KQ0 A;  1U8B A;  4PUS A;  3L1P A;  4HST A;  3JRE A;  2BZT A;  1FLI A;  5E79 C;  3SYT A;  1FOY A;  4CSW A;  4L0Y B;  4EGY A;  4KIS A;  3BCB A;  4D5C A;  5B66 C;  1APL C;  1NG6 A;  1XMX A;  2R4G A;  5LHG A;  5TRD A;  1VQ5 I;  3I9V 2;  3GZ5 A;  2COB A;  3X2Q H;  4C2U A;  3W6K B;  3KEO A;  1T39 A;  1B8I B;  2DJI A;  2UWM A;  1UEL B;  5J8F A;  1MBK A;  2FA5 A;  1U5T C;  3CCY A;  1X4P A;  2HYF A;  4CXF A;  2DLL A;  3N4M A;  2L7Z A;  4X0G A;  4KNY A;  3C2G A;  2Q2E A;  5F0F A;  1ZG5 A;  2ELK A;  4HG2 A;  1TLH B;  4DZP A;  3H3Z A;  5LLQ A;  3SHF A;  5CVR A;  2VT2 A;  4OOI A;  3K70 D;  2JVG A;  2WC2 A;  3IKV A;  2MLG A;  2ICW G;  3VPR A;  3H1C A;  2Z33 A;  2KDO A;  2L9V A;  2QCO A;  3OIO A;  3WU1 B;  2Y48 A;  3HIF A;  2ZNZ A;  2K5C A;  1RIO H;  3BG5 A;  4IHV A;  2RNG A;  1MBJ A;  4XLN F;  3W6V A;  1WQ2 A;  3EUK L;  2CUF A;  3EUH C;  2Z9O A;  4Y52 J;  1X1P A;  2MLK A;  3P9I A;  2EK5 A;  3WTS C;  1HOM A;  3FXO A;  3K4M A;  2XB0 X;  4LJZ F;  2DMN A;  3L2V A;  2L9N A;  4B44 A;  3CCS I;  2E1M B;  3LFK A;  3G3Z A;  4F91 B;  1HSJ A;  4D5F A;  1T56 A;  4CGZ A;  2NNN A;  4IHT A;  1QZE A;  2K27 A;  4C3J J;  5ILV A;  1UG0 A;  2QF7 A;  4L5J A;  4BJT A;  4KDP A;  4IL6 C;  3FK6 A;  1MBH A;  4XSZ F;  1GXP A;  2ZME C;  2BY3 A;  2BGC A;  3BR6 A;  4EQQ A;  3MKZ A;  1Z3X A;  1V5E A;  3B6A A;  1ZRF A;  2AQF A;  3BG3 A;  2JUC A;  1YRN B;  3BY6 A;  1MJA A;  3PFI A;  1PDN C;  2H8W A;  2HWV A;  1JTY A;  2EZH A;  2K85 A;  2ZME B;  4RAY A;  5FKL A;  4YFN F;  3S3N A;  2R5Z B;  4XIC A;  2PMZ A;  4O6J A;  1IRG A;  3QYE A;  1MMD A;  2JK3 A;  2LTP A;  1MGT A;  1OR7 C;  2PBI A;  3KPH A;  4A3D J;  1R23 A;  4JX4 A;  1BW5 A;  2B0L A;  2Y75 A;  4HZF A;  1E17 A;  5FLV A;  4E7H A;  2LR8 A;  4BH9 A;  2OJE D;  3FF5 A;  4QLC U;  2LNB A;  2EV0 A;  1G59 A;  5IOY A;  4KMU X;  1IC8 A;  2D45 A;  1FEX A;  2KJB A;  3ZQH A;  2Q8K A;  1HST A;  1DGR M;  2CQX A;  2DAO A;  4XRS A;  1D5Y A;  4CYC B;  3DTI A;  4OMY A;  2VKD A;  2XAU A;  3RQ4 A;  1U0J A;  3HKZ A;  1LUJ B;  2KT0 A;  1YX3 A;  3K6G A;  1R5I D;  4Y33 A;  2M1B A;  2LRD A;  3SEQ A;  3OYD A;  2QSF X;  3JRD A;  1W5S A;  2NVX J;  1UMQ A;  4B8X A;  3ABK H;  1JGG A;  4KJZ A;  1BR4 A;  2DOA A;  4M73 A;  2QKM B;  3H5N A;  4OMZ A;  1I27 A;  3DLL F;  2HZD A;  3HGY A;  1SAN A;  1VQM I;  1FYK A;  1MBE A;  2X48 A;  2NNY A;  2X51 A;  2PX9 A;  3E6M A;  1I50 J;  5L3C A;  4L9J A;  1IDY A;  3FMS A;  3E3V A;  5E18 F;  5EDN A;  2R92 J;  4HNU A;  3HDD A;  2DA1 A;  3CQZ J;  1FJL A;  3TP3 A;  4N4O B;  4KIT B;  1REP C;  3GTJ J;  2HDW A;  5F6F A;  4E70 A;  1A5J A;  2FE3 A;  2KIS A;  5HS7 A;  1F1Z A;  3IUO A;  5E3N A;  3DQV C;  3PM1 A;  4BY1 J;  1J59 A;  2QSH X;  3ISP A;  3BQY A;  1A35 A;  3LA7 A;  1QU3 A;  4EGZ A;  1I39 A;  4DYC A;  5K5O A;  2XC7 A;  2DFE A;  1G3W A;  4MHG A;  2AXT C;  2PFB A;  4MIM A;  1PUF A;  2JSC A;  3CUO A;  4KFC A;  5BPI A;  2BVL A;  4P1W A;  1W5C C;  4E7Z A;  1PYV A;  2HOS A;  3LSR A;  2M4K A;  3F3X A;  3WU2 C;  1XTA A;  1XDU A;  4CZZ A;  4XRM A;  3UKG A;  1EH6 A;  5J3L A;  4NB5 A;  2JA2 A;  3S2H J;  5DTD A;  1S29 A;  3REO A;  3KIO A;  2E60 A;  2B9S A;  4RLQ A;  1L0O C;  5E3L A;  3A02 A;  3MN2 A;  3A4C A;  2H6B A;  5M5Y J;  1EA3 A;  2P8T A;  2NOJ B;  1VZ0 A;  1GVD A;  3K70 C;  1QNT A;  3S1Q J;  3BG9 A;  1B9N A;  4A0Z A;  3E5Q A;  1G3T A;  1QRY A;  3E5U A;  2WBM A;  4ANJ A;  1YW9 A;  5ILS A;  1YLF A;  1X1B A;  4IHX A;  4I99 C;  3CCQ I;  2RQP A;  4M6V A;  1ODD A;  1RPW A;  3K4L A;  2PJR B;  5F08 A;  3MCZ A;  3JSO A;  1JUS A;  1MMA A;  2HKX A;  1FBQ A;  2DCE A;  4ITV A;  3RQI A;  2IGK A;  2CJJ A;  3TW7 A;  1B6A A;  3I0T A;  5C44 J;  1HW1 A;  5CVV A;  5KNL A;  1U8R A;  5FRM A;  1WPK A;  3EET A;  1Y8Q B;  3TO7 A;  1TW2 A;  4XLA A;  2HQA A;  2ZO4 A;  2QEX I;  5F1J A;  1CF7 B;  5IT9 Z;  5IYC J;  3S2W A;  3H5R A;  3BTI A;  2HDC A;  2XAF A;  4NQW A;  4BBS J;  1ZGA A;  4U87 A;  1BW6 A;  3ZQC A;  1P7I A;  4Q47 A;  1ZH5 A;  1BA5 A;  4IRG A;  4F7Z A;  3JTG A;  2H27 A;  1LDK B;  2XGD A;  1D0Y A;  1YS7 A;  2MC4 A;  3CCU I;  3CES A;  1TT5 B;  2V1U A;  1YQA A;  4OAZ A;  1Z7U A;  2L7M P;  4ZZD A;  3HOT A;  3HZJ A;  2HVR A;  2DYR H;  2O9L A;  3F72 A;  3LST A;  1YO5 C;  3BPX A;  2VQL A;  3QOP A;  2RRE A;  3LWF A;  1TNT A;  3JRI A;  1RKT A;  4FE4 A;  2D5V A;  2E5N A;  3RZO J;  1Z05 A;  2XGE A;  3PL8 A;  1SVL A;  4BDY A;  1SFE A;  2JJ7 A;  1Y1W J;  4B43 A;  2KIU A;  5KHD A;  2LK2 A;  1ETQ A;  4CCK A;  1X3Z B;  3TKY A;  4LG0 A;  1MDM A;  1IJW C;  5C4J J;  1ZRD A;  3PJR A;  2DTR A;  2UUZ A;  1J09 A;  4M3D A;  1U9N A;  4UUT A;  4A3C J;  1UAA A;  1D5V A;  3OS2 A;  4IHS A;  2K4J A;  1VQ7 I;  5L3E A;  4YFK F;  5K7Z A;  3IAM 2;  4GO1 A;  3WTT C;  1RUO A;  4PFP A;  1MD0 A;  4OWR B;  4GXO A;  4MO7 A;  4DZJ A;  4B3X A;  4LK0 F;  2VIX A;  4E7J A;  2JPB A;  2HYJ A;  2F5C A;  2QGU A;  5KK1 A;  4D1Q A;  1HF0 A;  4IX7 A;  3TO6 A;  1EH8 A;  3BCA A;  3KLO A;  1H0M A;  3K2Z A;  3LQR A;  1TTY A;  1ZQ3 P;  1TWH J;  2XPV A;  1JJ8 C;  5J4V A;  2LLK A;  2BXY A;  5FFZ A;  4B09 A;  2RV8 A;  3ABM H;  2O0Y A;  2CQQ A;  2VAS A;  4XLF A;  5IP9 J;  2VOO A;  2DI3 A;  2P4W A;  1WI9 A;  2J5P A;  2M0C A;  3NAU A;  3GEZ A;  4B47 A;  3A01 B;  3CC2 I;  2OQR A;  2IXS A;  2RGV A;  1ONV A;  4OU0 A;  4BJ5 C;  3CMA I;  1JKR C;  3LOC A;  1WJE A;  4BYY A;  1KU7 A;  1ZYR F;  2GAU A;  1KA8 A;  4MEY F;  5F0H A;  3QWL A;  2PG4 A;  3G73 A;  1P4W A;  1QVU A;  2G0E A;  1AKH A;  5FFX A;  2LY1 A;  1VQ9 I;  2DBB A;  1T38 A;  3GCM A;  4A3I J;  4AYB A;  3OOP A;  1F43 A;  5ICE A;  1YX5 A;  1K83 J;  3WHB A;  3SZT A;  5FJ8 J;  1MJ9 A;  3M07 A;  3HRM A;  2EIK H;  4ENN A;  2NVQ J;  3FXR A;  3CUQ C;  3K4N A;  1SAU A;  2G7H A;  3CUQ B;  4PK4 A;  2K9N A;  2HPI A;  2Z3Y A;  2W1O A;  2HZT A;  5E1X A;  4FET A;  4HOB A;  2PJP A;  2ID6 A;  1IF1 A;  4MFE A;  3ZN0 A;  1S8N A;  4OIQ F;  2Y0S N;  3CMY A;  1S6L A;  3LNQ A;  3OSF A;  2DK5 A;  1NK2 P;  5FB2 A;  1ZLJ A;  1N77 A;  1N75 A;  5A2Q Z;  2KIQ A;  1BI3 A;  1R6R A;  4WX9 A;  2M3A A;  1Y0U A;  2VE9 A;  2NVT J;  1UHW A;  2K9M A;  3F8F A;  2KFD A;  2XF6 A;  3FK7 A;  3FDY A;  5J40 A;  3PSI A;  5FRO A;  2B63 J;  1A36 A;  1GHC A;  4N9H A;  1FSE A;  1JTX A;  1A31 A;  4S04 A;  3J7A Y;  3MFK A;  3EUA A;  2WA0 A;  4LK1 F;  4IQJ A;  2EPF A;  2A6T A;  3H9Q A;  3RJP A;  5E1W A;  2CSO A;  1GV5 A;  3KP7 A;  5BNG A;  1R7J A;  5B5E C;  3LAJ A;  2RN7 A;  1W7P A;  1R4N B;  3KP5 A;  1RKW A;  2WAD A;  2IS6 A;  2X0L A;  4IEJ A;  4BXX J;  4AU7 A;  4I01 A;  1CGP A;  2DMU A;  2ZNY A;  4D0P A;  2IA2 A;  2LKS A;  2CRG A;  5IP6 A;  2WAQ A;  3S8P A;  3VFZ A;  3K2A A;  3BR0 A;  1PUE E;  2LD5 A;  2RNJ A;  4AC0 A;  5CYV A;  1W1W E;  4RM3 A;  3HOU J;  5HDN A;  3ZP5 A;  2R7O A;  3TOB A;  2CQK A;  2DOD A;  5FLX K;  4A3G J;  3LA2 A;  2VKH A;  5E20 A;  4C30 A;  5HDG A;  2XGC A;  1FOW A;  5GTI C;  2IBD A;  2JTV A;  2WY8 Q;  4UNO A;  3BT9 A;  1R5G A;  1XB4 A;  1FT9 A;  2Y69 H;  1MIJ A;  2A61 A;  2FF4 A;  5J1Y A;  1XGS A;  1SMT A;  5EEG A;  4XNF A;  2NVU B;  1YFH A;  4ZZL A;  1TWA J;  1YIT I;  4QPO A;  2F5F A;  2ME6 A;  5EF6 A;  1E3O C;  1IV6 A;  1IN7 A;  3CJN A;  4KIB A;  3U9G A;  5BOX A;  2LC2 A;  3SZP A;  3MKL A;  1ETX A;  2BW3 B;  1VF9 A;  2NS7 A;  3H9J A;  4F92 B;  2P0W A;  1O57 A;  3E1S A;  5LFA A;  2W4S A;  1B59 A;  2DMT A;  3ABU A;  5KCM A;  4E6K G;  2P5K A;  1MZB A;  2K9L A;  2V26 A;  3S3O A;  2VXD A;  3TED A;  2AO9 A;  4A5M A;  3QU6 A;  3J80 Z;  1YJW I;  4GRI A;  3TOA A;  4UB8 C;  2F4I A;  3GTQ J;  4XKC A;  3HEF A;  1P4X A;  1JT6 A;  2VLA A;  2CU7 A;  4M9S A;  1N25 A;  2DDB A;  1Z6T A;  5D4R A;  2L5Q A;  5E8I A;  2M45 A;  2FOW A;  3GVA A;  1STZ A;  3CO7 C;  3GBG A;  3QPS A;  3ONQ A;  2K9S A;  1V55 H;  2JA7 J;  4NNJ A;  2HFH A;  2KIF A;  5ED4 A;  3CCV I;  1ETV A;  1XG1 A;  1J0R A;  4FCY A;  4RAF A;  1SFO J;  5JVT A;  3OYN A;  4XKV A;  1VI0 A;  3Q3S A;  2IGM A;  3D0S A;  4II3 A;  2MW8 A;  2KRH A;  3W2V A;  5IY5 H;  1IZ1 A;  3CC4 I;  5GAG J;  2D1H A;  2R7T A;  1WH5 A;  1P7J A;  2DDA A;  3T1B A;  2R7F A;  1JI8 A;  1MSE C;  2DA4 A;  3KZZ A;  3HRU A;  2VQC A;  1Z7L A;  2PMZ N;  4HDU A;  1OQY A;  2JA8 J;  4A3L J;  2NOG A;  1U5T A;  3BR3 A;  4IHW A;  4MGR A;  3ZN1 A;  1K7A A;  2ECC A;  4QWQ A;  1QHG A;  2GM4 A;  3A2K A;  4LGW A;  2MH9 A;  5HNH A;  1ETK A;  1WI3 A;  4GDF A;  1ZAR A;  3MWM A;  1T33 A;  4A3K J;  3KEQ A;  3BP8 A;  3JRA A;  3N97 A;  3MVP A;  4G7H F;  1G2H A;  1K6O A;  2MA3 A;  3HSR A;  2R7Z J;  2KL4 A;  3HGG A;  1WZ2 A;  4MQV A;  3BG6 A;  3AG4 H;  1TL8 A;  2BXZ A;  4KA4 A;  3GTP J;  2OTJ I;  2XAS A;  2M5W A;  3LL7 A;  3RPU D;  3OYK A;  1RR8 C;  4Q48 A;  1FX7 A;  1GXQ A;  2HPM A;  1R1V A;  3E5X A;  5LGN A;  4ESF A;  3PIP F;  2H6C A;  2WB1 N;  4A0X A;  2JSP A;  2XGX A;  3J7A O;  3HOZ J;  4BKX A;  5FKM A;  2Z1D A;  4JK1 X;  3GTM J;  1SD6 A;  2FML A;  1I3A A;  2MFZ A;  4UB6 C;  1LEA A;  2VUM J;  4ETS A;  2M4G A;  1UFM A;  3G1O A;  2EA2 A;  5D5U B;  4G8X A;  4ZJZ A;  1DGW Y;  2QUF A;  2ID3 A;  5DCF A;  5ICG A;  1FIA A;  3M8J A;  4XLH A;  4YIR X;  3TDZ C;  5FD5 A;  3Q5F A;  2IPQ X;  1HCR A;  1K78 A;  4UV9 A;  1OYY A;  2E71 A;  3H0D A;  1BOA A;  3ZRG A;  3JRB A;  4M72 A;  3IH2 A;  4CCM A;  2WAF A;  3BDD A;  1A04 A;  4WWC A;  4MEX F;  1RUN A;  3JRH A;  2W24 A;  1VQ8 I;  3ECO A;  2OC6 A;  3ELK A;  4N0B A;  5HS9 A;  1MW7 A;  3F8N A;  3A0H C;  2JN6 A;  3HHG A;  1YE9 A;  2MD5 A;  1Z9C A;  4Y4R A;  1G3S A;  2V9V A;  3K7A J;  1MNE A;  3QYB A;  2XAQ A;  5LD2 C;  2FEZ A;  4PCQ A;  4I0A A;  2GOM A;  3G1M A;  4J00 A;  2OU2 A;  2DFF A;  2ZSH B;  5IT3 A;  4WK8 F;  2HGC A;  1OYI A;  2X4H A;  3KZY A;  4NHJ A;  3V7R A;  1X3W B;  3HOV J;  5JLX A;  3OMY A;  4RBO A;  3J7Z I;  2KKO A;  2GA1 A;  4PJ0 C;  2CUZ A;  4XQF A;  5EGO A;  2DQL A;  2TDX A;  3O2P E;  5B1B H;  1Z3Y A;  4ZDO A;  5JFR A;  3Q9S A;  3PO2 J;  3GLL A;  3KYD B;  2F5D A;  4S05 A;  5IYD J;  3DEE A;  4H4K C;  1YIO A;  3H36 A;  4MQ9 F;  5CJ9 A;  2ISZ A;  2CG4 A;  4XLC A;  5FGM A;  5B3S H;  1G4D A;  5F04 A;  5EG0 B;  4XKW A;  5FKK A;  1VQP I;  1JT0 A;  3IL2 A;  2OTL I;  4HBL A;  4CA0 A;  4HEA 2;  2ZJQ F;  1HKS A;  1V5G A;  2V79 A;  4HQM A;  2IT0 A;  2IA1 A;  1AA7 A;  4BQN A;  2BW3 A;  3S15 J;  6PAX A;  4XLP F;  5FO5 A;  3K9T A;  2BV6 A;  4O5V A;  1QHH D;  4OIN F;  4JQF A;  3B6C A;  2STW A;  4G7Z F;  3I4N J;  4E7S A;  3HSF A;  1ZAO A;  2XVC A;  1T2K A;  2E7W A;  2PN6 A;  3S14 J;  1I6H J;  1POG A;  3HKZ N;  1Z0X A;  4AUX A;  1Z6R A;  3DKY A;  1NHA A;  3BWG A;  4AM3 A;  3LSG A;  2W48 A;  2XDV A;  3TBI A;  2R0Q C;  4U0W A;  2ECB A;  4BEH A;  3AKZ A;  2ZXJ A;  2V4J C;  2X6Y A;  5DD4 A;  3J7Y J;  3JTH A;  1IN5 A;  3BTC A;  4CH7 A;  1R49 A;  4UUV A;  2DQR A;  3ERE D;  4P55 A;  5CVJ A;  1BJZ A;  3GZ6 A;  3BJO A;  2XKO A;  3BLY A;  2I8D A;  2P6S A;  5TJJ A;  2JA6 J;  4JX5 A;  2DA3 A;  5BMZ A;  4ABZ A;  3E97 A;  3HM5 A;  3BR1 A;  1JXS A;  3SFI A;  5J47 A;  3IH4 A;  3SDG A;  4NBQ A;  1XN7 A;  5DD8 A;  3V7C A;  5JVG F;  4BDZ A;  4A3M J;  3QOE A;  3W2A A;  3MKY B;  1W7P D;  2VC0 A;  3EPZ A;  4U0V A;  4AIK A;  1W7P B;  2XF7 A;  2M0M A;  5D6E A;  2ZFU A;  2NVY J;  5HLI A;  1BN5 A;  1RR7 A;  1IN6 A;  4HNT A;  2XV4 S;  3OIQ A;  1D3Y A;  2E2J J;  4AVP A;  1F9N A;  2GIV A;  3CCR I;  4BEH B;  2E19 A;  2EFO A;  2HOE A;  4YEL A;  4M71 A;  1X1A A;  4HYE A;  1YJN I;  5ICF A;  1IXC A;  1EF4 A;  3G4S I;  4FE7 A;  3L2W A;  5B1A H;  4GGG A;  1Y0N A;  3W2W A;  1YI2 I;  1XSV A;  4UXN A;  2BEO A;  2DT6 A;  2EH3 A;  2E1N A;  3KE2 A;  3ZMZ A;  1LKX A;  5J4Y A;  4G7O F;  1FTZ A;  4A6D A;  2FBH A;  2ZJP F;  2FNP A;  3PO3 J;  4IOA F;  2GQQ A;  4I02 A;  2HQN A;  2X6X A;  4ZH4 F;  1XMA A;  1Y56 A;  1AHD P;  2VKV A;  2JA5 J;  2CO5 A;  1VQL I;  2KDZ A;  4NUB A;  3DCF A;  2MGQ A;  2A3S A;  4PJJ A;  1OFC X;  1T6S A;  2Y2Z A;  4DYQ A;  3ZCO A;  2FOK A;  4ENK A;  4P5O A;  3VDX A;  1LQ1 A;  3IAS 2;  3AG1 H;  3J81 Z;  1IUY A;  3JR9 A;  1X2M A;  3KX2 A;  2R7V A;  4R1H A;  5H2F C;  1SC7 A;  5KAI C;  5ERI A;  1UG2 A;  4MTD A;  3ERM A;  1FP1 D;  2HXO A;  4I7H A;  1TWG J;  3DTE A;  2VC1 A;  2HYG D;  3DKW A;  2LH9 A;  5J1R A;  2P81 A;  1LFB A;  4HX7 A;  3TW6 A;  1W36 D;  2RAE A;  4RA2 A;  2YR2 A;  3DXJ F;  1WVR A;  1X4O A;  1XGN A;  2ELJ A;  3EDP A;  3WE2 A;  2O3F A;  3AL0 C;  3QRF F;  1HKQ A;  2O7O A;  5D5X B;  4ZTJ A;  2VBW A;  1ZTR A;  5D5W B;  1U3E M;  1X1C A;  3LSH A;  3NWT A;  3CP8 A;  3PQK A;  1MDM B;  4HV6 A;  1WWX A;  4M9X A;  1G6N A;  2CUE A;  3Q0W A;  5CVU A;  5K5R A;  5BS6 A;  1QQI A;  2LYC A;  2O03 A;  1V3F A;  2F5V A;  4PFO A;  2WAQ N;  1K78 B;  1IXS B;  4HX8 A;  4EJU A;  4E4H A;  1QGP A;  3QPT A;  1R9T J;  1JGS A;  3CJR B;  9ANT A;  2LDU A;  2OD5 A;  3OL4 A;  3KP2 A;  4Y17 A;  2OCE A;  1MJB A;  4HQE A;  3F6V A;  2X6W A;  4XKB A;  2AS5 F;  1D0X A;  4KIC A;  2GXG A;  2DTZ A;  4BAY A;  5KAF C;  1B72 A;  2ZC2 A;  2LF7 A;  1AWC A;  1SVM A;  3FXQ A;  1YW7 A;  2V9K A;  4XOR A;  1ULY A;  5DUK A;  4WXC A;  1KON A;  2Y9Y A;  1FBU A;  3CMM A;  4BU2 A;  2Y0M A;  2R7R A;  1LB2 A;  1TQI A;  3C2H A;  1J7K A;  3ZMS A;  1GDT A;  1UST A;  4M6Y A;  1K4S A;  1NK3 P;  3FZV A;  3BJA A;  2RKH A;  3FHZ A;  2WB1 A;  3HRS A;  2YPR A;  3V7S A;  1K61 A;  3HXL A;  2F6C A;  5DV5 A;  1F5T A;  2DA5 A;  1OPC A;  4HLY A;  2ZXW H;  2KLO A;  4KT6 A;  4XON A;  2L9S A;  5F0C A;  2NAZ A;  3FXL A;  2KHM A;  4RGR A;  2QVO A;  5LHH A;  2LF8 A;  4BUP A;  2ZXI A;  2AXL A;  2E5Z A;  1YIJ I;  3VYS B;  2EFW A;  1IXR C;  2L4A A;  3J80 K;  1TQP A;  5EG0 A;  4YII A;  3HTU A;  2W85 A;  3S1R J;  1H89 C;  5F27 A;  1B1B A;  2X6O A;  1I1S A;  1WFX A;  3ASN H;  4P96 A;  3L2U A;  1P9Q C;  4BNC A;  1B9M A;  4YEJ A;  5JLW A;  1WJ5 A;  2CS3 A;  2PMH A;  4NC6 A;  2EQR A;  1ETY A;  3BRO A;  3M1C A;  2L54 A;  2M8E A;  1BJA A;  4HAM A;  1IDZ A;  3MQ0 A;  1NTC A;  2KRC A;  3E0J B;  4BQO A;  1TZL A;  3LMM A;  4IXA A;  2ESH A;  3O8G A;  4Y7N J;  2EA4 A;  1GVJ A;  2WY7 Q;  3HSE A;  4F93 B;  3ZPL A;  3F6O A;  1SMY F;  5J8C A;  1WJF A;  4C2T A;  4BBR J;  1TC3 C;  5HS8 A;  2OA4 A;  4L5I A;  1T0F C;  4PZJ A;  2IJL A;  1C0W A;  5CPR B;  3L7W A;  3CO6 C;  1YOV B;  3P5J A;  3TQN A;  3IV5 A;  2X9D A;  3M8F A;  3ASO H;  2VON A;  5D8K B;  3HHH A;  3GTL J;  4IRH A;  4BQQ A;  2ESN A;  4AIJ A;  3Q0V A;  4ENM A;  5M5X J;  1BR2 A;  1VQK I;  4XK4 A;  1JUP A;  2MYS A;  2JVH A;  3PSF A;  2R7U A;  3EYI A;  3PNV A;  1W4M A;  3A0B C;  2EZL A;  1ON1 A;  1S7O A;  3NRV A;  3CD6 I;  2DT5 A;  4XSX F;  4ENJ A;  1K4T A;  5K5Q A;  1I5Z A;  1LFP A;  5M5W J;  3IC7 A;  2R7Q A;  1QZY A;  3D5R C;  4LLG F;  2VN2 A;  3RKQ A;  3LQQ A;  4YG2 F;  4II2 A;  5CKT A;  2PEX A;  1NG7 A;  2CFO A;  4OIR F;  1YTY A;  4A12 A;  2IEK A;  3B02 A;  2O8X A;  1FYM A;  4HF0 A;  3CCM I;  1YG2 A;  4N4N B;  4XR6 A;  3K1P A;  3RKW A;  4LG3 A;  3GYH X;  1T98 A;  1B72 B;  3RYR A;  2W84 A;  2DPD A;  3LSJ A;  4U0Y A;  1IUF A;  2XRN A;  1JUM A;  4M3G A;  1S72 I;  3SZG A;  1WSU A;  1RET A;  2JZY A;  3DBL B;  2ZJR F;  2OZ6 A;  2YX7 A;  2Y0S A;  3I53 A;  1QBJ A;  2F2E A;  3IP4 B;  4EJV A;  3A1Y A;  2IP2 A;  2IGO A;  2X85 A;  2XAH A;  1QPM A;  3PFY A;  4XLE A;  3U1D A;  3IRQ A;  2RQQ A;  2N8G A;  1I1G A;  1JHH A;  1UB9 A;  4W97 A;  2VT3 A;  2NYX A;  4L9N A;  2ETH A;  3WTW C;  1Z91 A;  3VSK A;  1YRN A;  5IOZ A;  4GCV A;  1VQ4 I;  3GZN B;  1OCC H;  1OCZ H;  1U5T B;  3BG7 A;  1BI0 A;  4KN4 X;  5LGT A;  1WGX A;  2IRF G;  3CLQ A;  1X58 A;  3VYU B;  4A3E J;  3HOX J;  1RI7 A;  1LVK A;  3VSL A;  5FRN A;  2IGN A;  3TO9 A;  4LD5 A;  1LEB A;  3HOY J;  4LIU A;  1XGO A;  1O3Q A;  2Z16 A;  4U88 A;  5LRR A;  3ML6 A;  4XRF A;  1O7F A;  4ZC3 A;  2LMD A;  2LKX A;  3GME A;  3C7J A;  4ZYG A;  1XSX A;  5HLT A;  1M1E B; 
#chains in the Genus database with same CATH homology
 3GFM A;  2EJR A;  4EM0 B;  3DFG A;  2DFI A;  4L9V A;  4EMS A;  1DPR A;  1O3S A;  1D8K A;  3C18 A;  4HDV A;  1XGM A;  4P9F A;  2ZKZ A;  3HTS B;  3JSP A;  1IAW A;  2MBF A;  3R4K A;  3P7N A;  1SFU A;  4KUM A;  1IN8 A;  2IW5 A;  4UVB A;  1R5H A;  2EV6 A;  4IRI A;  2O61 A;  2EFN A;  5E8G A;  4KN7 X;  2EFP A;  3JAM Z;  2E7X A;  3WG9 A;  1O3R A;  3F8B A;  3FX3 A;  4LG0 B;  2UXX A;  2Z5U A;  5L3F A;  1PP7 U;  1WKM A;  3E6D A;  1SFX A;  5IT9 K;  4HW0 A;  1G3Y A;  3R61 A;  1R1T A;  1OYW A;  1FC3 A;  1QZZ A;  3KFW X;  2PQ8 A;  3OV8 A;  1I6X A;  3MZY A;  4RB0 A;  3V8J A;  2W57 A;  4EJW A;  5FD6 A;  4I98 B;  4WXH A;  3WTX C;  4L0Z B;  2QWW A;  4G6D A;  4ESB A;  2O6G E;  4P9U A;  4CIC A;  3RPU A;  4TV7 A;  1W5T A;  1CF7 A;  5FLX Z;  1O3T A;  4CHU A;  2L3D A;  3F22 A;  1EH7 A;  3K0L A;  4FX0 A;  5LGU A;  2RVC A;  1ZG1 A;  3EUH A;  2BBY A;  2ZJ2 A;  3K1M A;  2M30 A;  3HYI A;  2YSR A;  2GA2 A;  3CUQ A;  2KJC A;  4Z2Y A;  1BBY A;  3V8L A;  3M1E A;  1LDD A;  4OIP F;  2P5L C;  5DDG A;  3I71 A;  2NRA C;  1P92 A;  1U6G A;  4LB5 A;  1J2X A;  3IWZ A;  4I0B A;  1P6R A;  4LFU A;  2DW4 A;  3RYP A;  2QQB A;  3C3W A;  4ZYD A;  4G94 A;  3ZMV A;  4G6Q A;  3SQN A;  4RGS A;  1J5Y A;  1HBX G;  1RNL A;  2LSO A;  5JHU A;  1DDN A;  4FT8 A;  2YX4 A;  3FM3 A;  2PLY A;  5ICC A;  3ZMT A;  3F21 A;  2XUB A;  1ZRC A;  3WTU C;  2HTJ A;  4H0E A;  4BHP A;  1BC8 C;  2QQ9 A;  1YS6 A;  4ON0 A;  4HV5 A;  4M74 A;  4KIG A;  2QBY A;  1EV7 A;  3WTZ A;  4Q4Z F;  4U7D A;  1Q1H A;  3J81 K;  2L02 A;  4Y15 A;  2E1C A;  3FM5 A;  3JW4 A;  4R8H A;  2UXN A;  1HQC A;  1FWZ A;  2QM3 A;  2EB7 A;  1WRJ A;  1U2W A;  2J5O A;  1H9G A;  2CFX A;  5KVR A;  4BHB A;  3GF2 A;  4IVN A;  1U78 A;  5D4S A;  4HF2 A;  3WU0 A;  5HLH A;  3LA3 A;  4IF4 A;  3RPQ A;  2CW0 F;  3D5L A;  5DEQ A;  3BPV A;  2CYY A;  2MH2 A;  5L3B A;  4BHC A;  1UHM A;  2XAG A;  3R0J A;  2K02 A;  2IA0 A;  2K7L A;  3RDI A;  3ULQ B;  1BI1 A;  1JHF A;  4AD9 A;  2CWE A;  4EV0 A;  4GYG A;  5LEJ A;  5CLS A;  4EVI A;  3QP5 A;  3BOQ A;  4AIH A;  2FRH A;  2IVM A;  3DV8 A;  3H92 A;  3IKT A;  2V1X A;  1XMK A;  5JI6 A;  1S3J A;  5F64 A;  1ZN2 A;  2K86 A;  3F8M A;  5D6F A;  1LDJ A;  2Q0O A;  4ASN A;  2HTS A;  2OZU A;  1YW8 A;  3GLX A;  3RKX A;  2V1D A;  3O3K A;  1KU9 A;  3GFI A;  2ZCW A;  1XDS A;  2VOD A;  2A69 F;  1R36 A;  4BXU A;  3QP6 A;  4ZYE A;  1E2X A;  1OR7 A;  1UCR A;  3KP4 A;  3P9K A;  2P7C B;  2EWN A;  3QPH A;  3K69 A;  3WTY C;  5HDK A;  2HEO A;  1BC7 C;  5LRS A;  3HUG A;  1BM9 A;  1TBX A;  3CTA A;  3K1N A;  1ZRE A;  5HOO A;  1OMI A;  3FMR A;  1MKM A;  4KT5 C;  3KLN A;  3RIR A;  4A2U A;  1T0F A;  2VOP A;  4MTE A;  1RZ4 A;  5H6R A;  1J75 A;  1L3L A;  2P6T A;  2JPC A;  1LVA A;  2PMU A;  2GXB A;  1KQ9 A;  1FPQ A;  2EV5 A;  3V4G A;  4HA8 A;  2P7V B;  2K4B A;  2BYV E;  3I59 B;  3R60 A;  2R3S A;  4RB3 C;  2DO7 A;  1SD5 A;  2A6E F;  3BJ6 A;  4XBF A;  3WTV C;  2H94 A;  2JT1 A;  1V4R A;  4L18 B;  5DUI A;  1PP8 F;  2H09 A;  1FY7 A;  3ECH A;  2WTE A;  3GXO A;  5LEK A;  2QLZ A;  3DP7 A;  3FWE A;  2EFQ A;  4Q5S F;  4CO8 A;  3E6C C;  3T5X A;  5JR3 A;  1R00 A;  5ILU A;  4UHT A;  5A2Q K;  5K1Y A;  4PGH A;  4UVA A;  4KYW A;  4LLL A;  1R1U A;  2HR3 A;  3SFZ A;  1ZHF A;  4RAZ A;  2OAZ A;  3GUD A;  5E17 F;  1HW5 A;  2RDP A;  5AON A;  1KYW A;  3F8C A;  5DYM A;  2Z99 A;  3TGN A;  2WWY A;  2A68 F;  4UVC A;  2G7U A;  4EJO A;  2M87 A;  2STT A;  5LBQ A;  3GO5 A;  4RS8 A;  4DNC A;  3ZMU A;  3V8K A;  1XD7 A;  3M7G A;  3HRT A;  5AIQ A;  1LJ9 A;  4GYI A;  4ESJ A;  5CVI A;  3AAF A;  3CDH A;  3DF8 A;  3I64 A;  2PI0 A;  1P4A A;  3R6S A;  4BQA A;  4O3M A;  2ZFW A;  1XCV A;  3MZH A;  2VBX A;  3WGH A;  1DUX C;  2D1V A;  2QZ8 A;  3MAJ A;  1ZLK A;  4A6E A;  1YYV A;  2UZK A;  1USS A;  2F5E A;  1XCB A;  3RKY A;  3SXY A;  3IWF A;  5H6Q A;  2XAJ A;  2RC4 A;  4OIO F;  3KP3 A;  2QYO A;  1H9T A;  2JRT A;  4KMF A;  3GWZ A;  4ZYH A;  3WOD F;  1DP7 P;  3IRR A;  5H20 A;  3I58 A;  2A6H F;  3VB2 A;  3EYY A;  4EJT A;  3DEU A;  3L9F A;  3WE3 A;  1BIB A;  1BIA A;  2XKP A;  2L01 A;  1ON2 A;  1FOK A;  5DCM A;  4RB1 A;  3GFL A;  1TNS A;  1SD4 A;  1KU2 A;  4Y13 A;  1K79 A;  3DPT A;  4RGX A;  2DK8 A;  1KYZ A;  2MC3 A;  4UV8 A;  5E1Z B;  3T0Y A;  5L3G A;  3C1D A;  1HW2 A;  2DU9 A;  2FU4 A;  5D5V B;  3W6J B;  2QQA A;  3IHU A;  3FXU A;  2FBI A;  3GW2 A;  2QEN A;  1VTN C;  2DPU A;  2C6Y A;  3ZMD A;  5DCM B;  1S7A A;  3VOD A;  2VE8 A;  1X3U A;  2ISY A;  1Z1D A;  1SD7 A;  2COM A;  1R58 A;  4G9Y A;  1P2F A;  2VBZ A;  3CLO A;  2GWR A;  4WCG A;  4U7B A;  3LAP A;  3PQJ A;  4LLN A;  3HOS A;  3TDU C;  1D8J A;  4HF1 A;  3F23 A;  2P5V A;  3NQO A;  4CDG A;  3M8E A;  2R7D A;  2ZBK A;  3ABT A;  1ZGJ A;  3WGI A;  1FZP B;  4KIF A;  4EM1 A;  4PGG A;  3DPL C;  2FBK A;  3WGG A;  1F4K A;  2XRO A;  2ZME A;  3L09 A;  4R79 A;  1R22 A;  4N9I A;  2L4M A;  3NEU A;  2LKP A;  1AOY A;  2HS5 A;  2HQR A;  3RTR A;  2KRF A;  2FXA A;  2FSW A;  3ROU A;  5HLG A;  3I4P A;  2ACJ A;  2OBP A;  3QAH A;  3EQL F;  3O6B B;  4EM2 A;  1IRF A;  4DQ2 A;  2QBY B;  1HXD A;  2G9W A;  4IPA A;  3H3U A;  3KCC A;  3T8R A;  3B73 A;  5F1R A;  1HKT A;  2OQG A;  2KIM A;  1QO0 D;  4A5N A;  1IW7 F;  4L9T A;  4HLX A;  1ZG3 A;  2V6C A;  1XSD A;  3U2R A;  2XIG A;  3GFJ A;  4RB2 C;  1TW3 A;  2FNA A;  3M9A A;  3KET A;  3GX4 X;  2GZW A;  4FHT A;  2HKO A;  4JBA A;  2CGP A;  3I54 A;  1KQ8 A;  3P9C A;  4HX4 A;  3RI4 A;  5BPD A;  1TQM A;  1LNW A;  1OKR A;  1O7L A;  2ELH A;  3MEX A;  3QU3 A;  3VOE A;  4FX4 A;  4WF2 A;  2NS0 A;  4M6X A;  5L3D A;  2VBY A;  2BE5 F;  2YU3 A;  3KP6 A;  1SAX A;  2W25 A;  3L2C A;  4RGU A;  1JE8 A;  2VXZ A;  4LB6 B;  5J6X A;  4A0Y A;  3FMQ A;  4IJA A;  4LMY A;  5D8L B;  1IN4 A;  1FSH A;  3E6B A;  2WV0 A;  5EEH A;  1BI2 A;  2A07 F;  4MNU A;  2FQ3 A;  1KU3 A;  1FNN A;  4PDK A;  1FBS A;  1FP2 A;  3T8T A;  2D2W A;  4K2E A;  3L00 A;  1FYL A;  3I59 A;  4YFX F;  1DPU A;  3JAM K;  2XHK A;  3VEP A;  4I2O A;  3COA C;  1KGS A;  3I5U A;  5HVQ C;  2ADU A;  4M9Z A;  3R0A A;  1J9I A;  4CYD A;  4YIF A;  5AIP A;  1B4A A;  4WXD A;  3BZ6 A;  5BQT A;  4I09 A;  4AWX B;  2A5Y B;  3Q9V A;  2FMY A;  5LHI A;  3ZQ7 A;  1KQ0 A;  1FLI A;  4L0Y B;  4EGY A;  5LHG A;  5TRD A;  3GZ5 A;  3W6K B;  3KEO A;  1T39 A;  2UWM A;  5J8F A;  2FA5 A;  1U5T C;  4CXF A;  2HYF A;  2DLL A;  3N4M A;  4KNY A;  2Q2E A;  1ZG5 A;  1TLH B;  5LLQ A;  3H3Z A;  3SHF A;  5CVR A;  2VT2 A;  4OOI A;  2WC2 A;  3IKV A;  2MLG A;  2Z33 A;  3WU1 B;  2Y48 A;  3HIF A;  2ZNZ A;  1RIO H;  4XLN F;  1WQ2 A;  2Z9O A;  2MLK A;  3P9I A;  2EK5 A;  3WTS C;  4LJZ F;  3LFK A;  3G3Z A;  1HSJ A;  4CGZ A;  2NNN A;  4IHT A;  2K27 A;  5ILV A;  4L5J A;  4KDP A;  4XSZ F;  1GXP A;  2BGC A;  4EQQ A;  1ZRF A;  3BY6 A;  1MJA A;  3PFI A;  1PDN C;  2HWV A;  4RAY A;  2ZME B;  4YFN F;  4O6J A;  1IRG A;  1MGT A;  2PBI A;  1R23 A;  2B0L A;  2Y75 A;  4HZF A;  1E17 A;  4BH9 A;  3FF5 A;  4QLC U;  2LNB A;  2EV0 A;  4KMU X;  2D45 A;  2KJB A;  2Q8K A;  1HST A;  2DAO A;  4OMY A;  2M1B A;  1W5S A;  4B8X A;  4M73 A;  4OMZ A;  1I27 A;  1FYK A;  2NNY A;  3E6M A;  5L3C A;  4L9J A;  3FMS A;  3E3V A;  5E18 F;  1REP C;  5F6F A;  4E70 A;  2FE3 A;  5HS7 A;  1F1Z A;  3DQV C;  1J59 A;  3ISP A;  3LA7 A;  4EGZ A;  5K5O A;  1G3W A;  4MHG A;  2PFB A;  2JSC A;  3CUO A;  4KFC A;  5BPI A;  3F3X A;  1XDU A;  4CZZ A;  1EH6 A;  4NB5 A;  1S29 A;  3REO A;  1L0O C;  2H6B A;  2P8T A;  1QNT A;  1B9N A;  4A0Z A;  3E5Q A;  1G3T A;  3E5U A;  1YW9 A;  5ILS A;  1YLF A;  2RQP A;  1ODD A;  3MCZ A;  3JSO A;  2HKX A;  1FBQ A;  1B6A A;  3I0T A;  1HW1 A;  5CVV A;  1U8R A;  3EET A;  3TO7 A;  1TW2 A;  5IT9 Z;  2ZO4 A;  1CF7 B;  3S2W A;  2HDC A;  2XAF A;  4NQW A;  1ZGA A;  4Q47 A;  1ZH5 A;  4IRG A;  4F7Z A;  3JTG A;  2H27 A;  1LDK B;  1YS7 A;  2V1U A;  1YQA A;  1Z7U A;  4ZZD A;  3HOT A;  3F72 A;  3LST A;  1YO5 C;  3BPX A;  3QOP A;  3LWF A;  1TNT A;  1Z05 A;  1SFE A;  2KIU A;  3TKY A;  4LG0 A;  1MDM A;  1ZRD A;  2DTR A;  1D5V A;  4IHS A;  2K4J A;  5L3E A;  4YFK F;  4GO1 A;  3WTT C;  1RUO A;  1MD0 A;  4GXO A;  4LK0 F;  2JPB A;  2F5C A;  5KK1 A;  3TO6 A;  1EH8 A;  3KLO A;  1H0M A;  3K2Z A;  3LQR A;  1TTY A;  5FFZ A;  4B09 A;  2RV8 A;  2VOO A;  2O0Y A;  2DI3 A;  2P4W A;  1WI9 A;  2J5P A;  3GEZ A;  2OQR A;  2RGV A;  1ONV A;  4OU0 A;  4BYY A;  1KU7 A;  1ZYR F;  2GAU A;  1KA8 A;  4MEY F;  2PG4 A;  3G73 A;  1P4W A;  5FFX A;  2DBB A;  1T38 A;  3OOP A;  5ICE A;  3SZT A;  4ENN A;  1MJ9 A;  3HRM A;  3FXR A;  3CUQ C;  2G7H A;  3CUQ B;  2Z3Y A;  2HZT A;  5E1X A;  2PJP A;  4HOB A;  1IF1 A;  4OIQ F;  3ZN0 A;  1S8N A;  1S6L A;  2DK5 A;  5FB2 A;  1ZLJ A;  5A2Q Z;  1BI3 A;  4WX9 A;  2VE9 A;  1Y0U A;  1UHW A;  3F8F A;  1GHC A;  4N9H A;  1FSE A;  4S04 A;  3MFK A;  4LK1 F;  3RJP A;  5E1W A;  2CSO A;  3KP7 A;  1R7J A;  3LAJ A;  2RN7 A;  1W7P A;  3KP5 A;  2X0L A;  1CGP A;  4I01 A;  4D0P A;  2ZNY A;  2IA2 A;  3VFZ A;  1PUE E;  2RNJ A;  5CYV A;  5HDN A;  3ZP5 A;  3TOB A;  2CQK A;  5FLX K;  3LA2 A;  5E20 A;  5HDG A;  2JTV A;  4UNO A;  1R5G A;  1XB4 A;  1FT9 A;  2A61 A;  2FF4 A;  1XGS A;  1SMT A;  5EEG A;  1YFH A;  4ZZL A;  2F5F A;  1IN7 A;  3CJN A;  4KIB A;  3U9G A;  5BOX A;  3SZP A;  1O57 A;  1B59 A;  3ABU A;  2P5K A;  1MZB A;  4A5M A;  3QU6 A;  3J80 Z;  3TOA A;  1P4X A;  4M9S A;  1Z6T A;  5D4R A;  5E8I A;  2M45 A;  3GVA A;  1STZ A;  3CO7 C;  2HFH A;  2KIF A;  5ED4 A;  1J0R A;  5JVT A;  3D0S A;  1IZ1 A;  2D1H A;  3T1B A;  2R7F A;  3KZZ A;  3HRU A;  4HDU A;  1U5T A;  4MGR A;  3ZN1 A;  1K7A A;  4QWQ A;  4LGW A;  2MH9 A;  1ZAR A;  3MWM A;  3KEQ A;  3BP8 A;  3N97 A;  4G7H F;  1K6O A;  2MA3 A;  3HSR A;  4MQV A;  4KA4 A;  2XAS A;  2M5W A;  4Q48 A;  1FX7 A;  1GXQ A;  1R1V A;  3E5X A;  5LGN A;  4ESF A;  2H6C A;  4A0X A;  2XGX A;  3J7A O;  4JK1 X;  1SD6 A;  2FML A;  1LEA A;  4ETS A;  1UFM A;  2EA2 A;  5D5U B;  4G8X A;  2QUF A;  5DCF A;  5ICG A;  3TDZ C;  5FD5 A;  3Q5F A;  2IPQ X;  1K78 A;  4UV9 A;  1OYY A;  1BOA A;  4M72 A;  3BDD A;  1A04 A;  4WWC A;  4MEX F;  1RUN A;  2W24 A;  3ECO A;  3ELK A;  4N0B A;  5HS9 A;  3F8N A;  3HHG A;  2MD5 A;  1Z9C A;  1G3S A;  2V9V A;  2XAQ A;  2FEZ A;  4PCQ A;  4I0A A;  2OU2 A;  5IT3 A;  4WK8 F;  2HGC A;  1OYI A;  2X4H A;  3KZY A;  4NHJ A;  3V7R A;  2KKO A;  2GA1 A;  2DQL A;  2TDX A;  3O2P E;  5JFR A;  3Q9S A;  2F5D A;  4S05 A;  4MQ9 F;  5CJ9 A;  1YIO A;  2ISZ A;  2CG4 A;  5FGM A;  1G4D A;  3IL2 A;  4HBL A;  1HKS A;  2V79 A;  4HQM A;  2IT0 A;  2IA1 A;  6PAX A;  4XLP F;  5FO5 A;  3K9T A;  2BV6 A;  4O5V A;  4OIN F;  4JQF A;  2STW A;  4G7Z F;  3HSF A;  1ZAO A;  2XVC A;  1T2K A;  2E7W A;  2PN6 A;  1Z6R A;  1NHA A;  3BWG A;  4U0W A;  2ZXJ A;  5DD4 A;  3JTH A;  1IN5 A;  4UUV A;  2DQR A;  3ERE D;  4P55 A;  5CVJ A;  3GZ6 A;  3BJO A;  2XKO A;  2P6S A;  5TJJ A;  5BMZ A;  1JXS A;  3E97 A;  1XN7 A;  5DD8 A;  3V7C A;  1W7P D;  2VC0 A;  4U0V A;  4AIK A;  1W7P B;  5D6E A;  5HLI A;  1BN5 A;  1IN6 A;  2XV4 S;  1D3Y A;  4AVP A;  1F9N A;  2GIV A;  2EFO A;  2HOE A;  4M71 A;  4HYE A;  5ICF A;  1IXC A;  4GGG A;  1XSV A;  4UXN A;  2BEO A;  2E1N A;  3KE2 A;  3ZMZ A;  4G7O F;  4A6D A;  2FBH A;  2FNP A;  2GQQ A;  4I02 A;  2HQN A;  4ZH4 F;  1XMA A;  2CO5 A;  2A3S A;  1T6S A;  2FOK A;  4ENK A;  4P5O A;  1LQ1 A;  3J81 Z;  1IUY A;  4R1H A;  5ERI A;  4MTD A;  1FP1 D;  4I7H A;  2VC1 A;  2HYG D;  3DKW A;  4HX7 A;  2YR2 A;  3DXJ F;  1XGN A;  3WE2 A;  3EDP A;  2O3F A;  3QRF F;  1HKQ A;  5D5X B;  2VBW A;  5D5W B;  1U3E M;  3PQK A;  1MDM B;  4HV6 A;  1WWX A;  4M9X A;  1G6N A;  5K5R A;  5CVU A;  5BS6 A;  1QQI A;  2O03 A;  1V3F A;  1K78 B;  1IXS B;  4EJU A;  4HX8 A;  1QGP A;  3QPT A;  1JGS A;  2LDU A;  2OD5 A;  3KP2 A;  4Y17 A;  1MJB A;  4HQE A;  3F6V A;  2AS5 F;  4KIC A;  2GXG A;  4BAY A;  2LF7 A;  1AWC A;  3FXQ A;  1YW7 A;  1ULY A;  5DUK A;  4WXC A;  1FBU A;  1LB2 A;  2Y0M A;  1TQI A;  1J7K A;  3ZMS A;  1UST A;  4M6Y A;  3FZV A;  3BJA A;  2RKH A;  3FHZ A;  3HRS A;  2YPR A;  3V7S A;  5DV5 A;  1F5T A;  1OPC A;  4HLY A;  2NAZ A;  4RGR A;  2QVO A;  5LHH A;  2LF8 A;  2AXL A;  2EFW A;  1IXR C;  2L4A A;  3J80 K;  1TQP A;  4YII A;  3HTU A;  2W85 A;  1B1B A;  1I1S A;  4P96 A;  4BNC A;  1B9M A;  2PMH A;  3BRO A;  2L54 A;  2M8E A;  1BJA A;  4HAM A;  3MQ0 A;  4IXA A;  2ESH A;  2EA4 A;  1GVJ A;  3HSE A;  3ZPL A;  3F6O A;  1SMY F;  5J8C A;  5HS8 A;  2OA4 A;  4L5I A;  4PZJ A;  2IJL A;  1C0W A;  3L7W A;  3CO6 C;  3TQN A;  3M8F A;  2VON A;  5D8K B;  3HHH A;  4IRH A;  2ESN A;  4AIJ A;  4ENM A;  3EYI A;  1W4M A;  1ON1 A;  1S7O A;  3NRV A;  2DT5 A;  4XSX F;  4ENJ A;  5K5Q A;  1I5Z A;  3IC7 A;  1QZY A;  4LLG F;  2VN2 A;  3LQQ A;  4YG2 F;  2PEX A;  4OIR F;  1YTY A;  4A12 A;  3B02 A;  2O8X A;  1FYM A;  4HF0 A;  1YG2 A;  3K1P A;  3RKW A;  3GYH X;  1T98 A;  3RYR A;  2W84 A;  2DPD A;  4U0Y A;  2XRN A;  1WSU A;  2JZY A;  2OZ6 A;  2YX7 A;  3I53 A;  1QBJ A;  2F2E A;  4EJV A;  2IP2 A;  2XAH A;  3U1D A;  3IRQ A;  1QPM A;  1I1G A;  1JHH A;  1UB9 A;  2VT3 A;  2NYX A;  4L9N A;  2ETH A;  3WTW C;  1Z91 A;  4GCV A;  1U5T B;  1BI0 A;  4KN4 X;  5LGT A;  2IRF G;  1RI7 A;  1LEB A;  3TO9 A;  4LD5 A;  1XGO A;  1O3Q A;  4U88 A;  5LRR A;  3ML6 A;  4XRF A;  1O7F A;  3C7J A;  4ZYG A;  1XSX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...