1NG6A

Structure of cytosolic protein of unknown function yqey from bacillus subtilis
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
148
structure length
148
Chain Sequence
MSLLERLNQDMKLYMKNREKDKLTVVRMVKASLQNEAIKLKKDSLTEDEELTVLSRELKQRKDSLQEFSNANRLDLVDKVQKELDILEVYLPEQLSEEELRTIVNETIAEVGASSKADMGKVMGAIMPKVKGKADGSLINKLVSSQLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein yqeY
publication title 1.4A crystal structure of hypothetical cytosolic protein YQEY
rcsb
source organism Bacillus subtilis
total genus 63
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2002-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09424 YqeY Yqey-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.410 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1ng6A02
1.10.1510.10 Mainly Alpha Orthogonal Bundle Hypothetical Protein Yqey; Chain: A; domain1 Hypothetical Protein Yqey; Chain: A; domain1 1ng6A01
3IP4B 1NG6A 3AL0B
chains in the Genus database with same CATH superfamily
1YQAA 2A07F 5EG0B 4WX9A 4C2UA 4BQOA 2XGEA 3GFIA 1MNMC 1OR7C 3M1CA 2Z1DA 1GV5A 2Y9YA 2L7ZA 4M9ZA 2IGOA 1PJRA 2I5UA 2KJBA 5F64A 3A0HC 1KU3A 4N9IA 3C18A 1K4TA 1QPMA 2VB6A 5LBQA 1Y0UA 2YR2A 2GAUA 1AU7A 3BG3A 3V8JA 2MA3A 2OCCH 4PSWA 4HF2A 2CW0F 2E19A 3F8CA 1JT0A 3FK7A 2DODA 3BZCA 4KMUX 3F6VA 5EGOB 2PMUA 3JRFA 2KISA 1J9IA 3RYRA 3GTOJ 5F6FA 5H2FC 4V19K 2HXOA 3EPZA 3QPHA 1X1DA 5BPIA 5BPDA 2XV4S 2UUZA 3U2RA 1W4MA 4EV0A 1MJ9A 5E3NA 5IOYA 3OOUA 4PFPA 3ZCOA 1SVMA 2FQ4A 4IHSA 4L5EA 4ASNA 2XGCA 3MQ0A 3RKQA 2O5RA 2ZMEB 1YFHA 3I58A 3CF5F 1KQ8A 2MBFA 2LF7A 4OU0A 1UMQA 1K78A 3EYIA 2QYOA 2EJRA 4M71A 3J80K 1J59A 3MCZA 2ZMEA 2QM3A 1ETXA 3AG3H 3MMYB 3WTTC 2L02A 4N4NB 2R7OA 1J2XA 1FOXA 3LNQA 2Z9OA 4K2EA 1HA8A 2KP6A 4AIJA 5EYRA 4A93J 1E17A 2Q2EB 3BG6A 4XKCA 5JVTA 1U9OA 3IP4B 1R9TJ 3E6CC 1JJ6C 2XAUA 2XF5A 1Z6TA 3SDBA 1D8KA 3GUDA 3M3YJ 4G94A 4M3DA 1EGMG 2K4BA 4B47A 2VJJA 1SFUA 3F8NA 5IT9Z 2ZXIA 2LMDA 3KIOA 4W1UA 1FX7A 1OKRA 2DO7A 2EQRA 3ZMUA 5ILUA 4A3KJ 1W1WE 2FF4A 2ZXWH 2B9SA 4I09A 4RAYA 4L18B 2WB1A 3OS0A 1ETYA 3NQOA 1MDMB 1QBJA 2VC1A 2W4SA 4A12A 1ONVA 2XAQA 2LG4A 3E6MA 1U0JA 2LVSA 4GYIA 1ZG1A 2ZNZA 4C30A 1B59A 1IV8A 3H9JA 3DP7A 3SEZA 1EH7A 1GUUA 3CCRI 1MDMA 4CXFA 3B6AA 4KN7X 4PFOA 2F5EA 1IDZA 2L5QA 3O6BB 1R6RA 2BW3A 2CUZA 1S72I 3CCJI 1D5VA 4BQQA 4NQWB 2YU9J 3K2ZA 3ZQGA 1PP8F 4I6ZA 1VI0A 5CYVA 3B02A 2WADA 3SZPA 2NVTJ 1X1PA 5L3DA 3CMYA 3RKYA 3JR9A 4RBOA 2HQNA 4I01A 4BXUA 2R4GA 4II2A 2WAQA 4NQWA 1T2KA 5DDGA 4HNTA 2MD5A 4GO1A 1R4MB 3I56I 2XB0X 2WAEA 2XAJA 3LSIA 4I02A 2O6GE 2YS9A 2XASA 3PIPF 2A6HF 1YIJI 3BCBA 4FETA 4BACA 2HI3A 1VQ7I 2CFXA 4PUSA 4UB8C 2DFFA 3EETA 5BS6A 2K9MA 2JVHA 3RSNA 2Q0OA 2RC4A 1F5TA 2BV6A 2NOGA 1L3LA 1O7FA 3KP6A 3LA2A 5E20A 2XDVA 2Y30A 4OINF 3KP4A 1F9NA 3FXKA 3QWLA 3H5AA 5FFXA 3GFLA 4BJ5C 3A2KA 1EA3A 1MJBA 4BQNA 1OMIA 1RKTA 1TBXA 3TGNA 4C9YA 5K7HA 3IRQA 3G73A 4IRHA 1P2FA 3DBRB 1TWAJ 3VODA 1HKSA 1U8BA 1R1VA 1DIOG 2VQCA 1ZLKA 3GZ5A 3IHUA 2R7DA 3H9GA 3CTAA 3ZR8X 4F3QA 3RPQA 2MGQA 3OYIA 1FC3A 4CCJA 1WCMJ 1KONA 1X2NA 2BVMA 3E97A 1LDDA 3REOA 2TDXA 2CQNA 2JTVA 4NC8A 2L3DA 4UVAA 2B63J 5DCMA 4ZYEA 1P7IA 3GXOA 1JHHA 2STTA 4EJUA 3JRAA 3MZYA 1XPXA 1IAWA 1I39A 2EFOA 2ZNYA 3DEEA 3DKXA 4YIFA 5IP9J 1ZELA 4TV7A 5JVGF 3CUOA 5LFAA 1IW7F 2MW8A 4P9UA 1PUFB 4A3EJ 1Z05A 2QWWA 3VSLA 4BY7J 2BXZA 2C6YA 2JWTA 2E2JJ 2R7UA 2J5OA 4CH7A 4CZCA 4U0VA 1PUFA 2Z16A 3MN2A 1USTA 2LP0A 3DEUA 4IQJA 1WQ2A 1LFPA 2ETHA 1OCZH 2E1OA 3F3XA 3GZNB 1MNDA 3EUHA 1ZGAA 2KPMA 4P55A 5KHDA 2RREA 1MSFC 4L5JA 3CUQA 3RJPA 3T0YA 4ESFA 2D1VA 1B4AA 4RA2A 5LHHA 1UFMA 2OCEA 1H9TA 2CO5A 2DAOA 1UC4G 2R5ZB 2LKSA 3JREA 4MQ9F 2MYSA 2CSOA 4MNUA 4HNUA 4X0GA 1HQCA 3C2BA 5J8CA 4BHCA 1U2WA 4XRSG 3G1OA 4L0ZB 4IZZA 5JR3A 2MC4A 3KLNA 3S32A 1AOYA 4NHJA 3HEFA 4HW0A 2A68F 2XB5A 4MFDA 5AONA 3S3OA 2EIKH 1PDNC 1ETWA 2LSOA 5CVJA 2DDBA 3EQLF 2VBXA 4KISA 4KT6A 1Y0NA 2VQHA 2MD0A 4CCLA 3CCQI 1WH5A 2IA0A 1JT6A 3A02A 1OR7A 3AG1H 5IYCJ 1OCOH 4F93B 2DOEA 1QPIA 3IH2A 4U7DA 5J40A 3HRUA 3L09A 4YG2F 1D0YA 1FT9A 2X1DA 3VOEA 3WG7H 1G59A 4EM2A 3F72A 1OCPA 5FLVA 3KYLA 4Y33A 4Q5SF 2MABA 3K4CA 4DIQA 3G1MA 4A3FJ 2KIQA 1XS9A 2ISYA 3CD6I 3SFZA 1TWGJ 4YFXF 3GEZA 3DU5A 2CV2A 3TBIA 1ZGJA 3KEQA 4JX4A 1Q1VA 4F7ZA 1T95A 3BPVA 1SVOA 3T1BA 3Q0VA 2XAHA 5J4YA 3S8PA 1R23A 2QBYA 4HBLA 2OV7A 1FTTA 2GIVA 1DPUA 2BGCA 3K69A 4BYYA 3K4MA 2HTSA 3LAJA 5LGUA 1BL0A 1VNDA 4NC7A 2H6BA 2VQLA 2XHKA 4LLLA 2Z5UA 5FKLA 1XSDA 2IS1A 2LBFB 2A3SA 3CJNA 3CCMI 4KJZA 1JI8A 1W36D 3ECHA 2K27A 4UUSB 1UHSA 4RM3A 2K7LA 4JK1X 4B8XA 3QOPA 1KGSA 1YW9A 4EGZA 4OWRB 4BL0B 3V7CA 3MFKA 1P7JA 4YFNF 2JRMA 3LA3A 4F92B 1Z9CA 1TNTA 4XBFA 4MTDA 5E3OA 3SXYA 1TQMA 2OQRA 2VT3A 1KZHA 4L9VA 4KMFA 3HUGA 1X4OA 1UG0A 2ZCWA 2JN6A 5L3EA 4QTRA 1T39A 1XTAA 2OPTA 2FBHA 2F5DA 2BY3A 2P5VA 1SANA 5DCFA 3C3WA 4IL6C 3ZMZA 4AVPA 2ZJPF 2ID6A 1IG7A 4AYBA 3HGGA 2O3FA 1T8IA 1NK2P 1G3WA 3IL2A 2XAFA 1IWPG 4XN0A 4B3XA 4AM3A 2XRNA 4IPAA 5HLGA 1MNEA 4I76A 2PX9A 2PJRA 4MO7A 1CF7A 3GMEA 2W24A 4BDYA 2L4MA 3G2BA 1HSJA 2LREA 1QZZA 4G9YA 3RQ4A 3A1YA 2H1KA 3G71I 4HPQA 3HL2A 1IRGA 1DGRM 3PNTA 5DV5A 2HDWA 2Z33A 3HSEA 3D5SC 1U5TC 1JUPA 5E17F 2CUJA 3BJAA 5BNGA 3D5RC 1JGSA 2IP2A 4WF2A 1UJ8A 1V55H 2XGDA 3LQQA 1SFOJ 2A05A 2W57A 3N05A 4BGDA 5HDNA 4DW6A 4MGRA 2DMTA 3NAUA 4H4KC 1FY7A 3QP6A 1IN8A 2HPIA 1CQTA 2FUG2 4PJNA 4BJ6C 1ON1A 3HZJA 3WGGA 3SZTA 4FASD 1LNWA 1N77A 1FSHA 3I3LA 4KIBA 2L0KA 2Q1ZB 5EEAA 3FXQA 2DBBA 5HNFA 3M4OJ 1FOKA 5B1BH 4CCNA 3DWLE 2HWVA 4KA4A 1SD4A 2FNPA 4RAZA 2CG4A 4RAGA 4N9HA 1XSVA 2MSYA 3BPXA 2X51A 3OL3A 4KFCA 2UXNA 3QU6A 4C3IJ 2VXDA 1ULYA 1MBEA 5GTHC 2P6TA 5J1UA 4WWCA 2DYRH 4LJZF 4ETSA 2G0EA 1POGA 2EFPA 3JAMZ 1YIOA 5H6QA 1FYKA 1ZN2A 1TWFJ 4FHTA 4PSXA 3PFIA 5HLIA 3LSPA 3X2QH 2L7MP 1HDPA 1SVLA 5DM6F 3UKGA 2HS5A 2Z3YA 1N78A 3L2WA 2X6WA 3QODA 4WXCA 5JHUA 3HRTA 1QZEA 3FKIJ 2CU7A 2PJPA 3T8RA 4AU7A 4ANJA 1REPC 2F5FA 3BTCA 3GCMA 2R0QC 3E0JB 2DTZA 4AD9A 4M73A 3FBNB 2STWA 4S0HB 1OFCX 1KQ9A 4U0WA 1B72A 2ECBA 3K1NA 3S2HJ 2NNNA 3F8MA 3V8LA 2A6EF 5M5XJ 1P92A 5DEQA 3T8TA 1R49A 4XLHA 1BI1A 1OYIA 1E3PA 2ZJ2A 1H89C 2F4IA 5FKOA 3KP5A 4RGXA 5EEGA 2R7XA 2V1UA 1T38A 3BG7A 2DA1A 1C0WA 2HTJA 3A01B 2H1LA 3CDLA 1O3RA 1HDDC 1B9NA 1WJDA 2RNGA 3GTJJ 4BNCA 3BG9A 4IHVA 2V9VA 4RLQA 1YI2I 5FKKA 2G9WA 2A69F 2XPUA 4IF4A 2DPUA 5J6XA 4YRVA 3GTGJ 2XGXA 3CF2A 2I8DA 4ZZDA 4Z6YA 2X85A 4M6VA 5LGNA 4BQAA 3K70D 1B9MA 3LAPA 2R7TA 3W3CA 4B44A 3OYGA 2GWRA 4A3BJ 2X1EA 1MZBA 2BBYA 3DKWA 1T33A 3CO6C 4KICA 1O4XA 1FMWA 1XCBA 3PQJA 5B3SH 5FLMJ 3FXUA 4LFUA 5D8LB 1IZ1A 1MJAA 1ZRCA 1HF0A 1IF1A 4LG0B 3RQIA 5CKTA 2UXXA 2XKPA 2GXBA 5AIPA 3RPUD 3ZN1A 3LSHA 4BEHB 4BE0A 3UR3C 3Q0UA 4JQFA 3IRRA 2HDDA 1LE8A 3OYAA 4LGWA 4LB5A 2O7OA 2AQEA 3OYKA 3ABLH 1YITI 2HOEA 2NVYJ 1ZRDA 3F21A 1Y1VJ 5F1JA 1MBKA 2H8RA 2K9NA 3O3KA 3ZRGA 4HEA2 4BAYA 2HKOA 4BEHA 2ID3A 3HKZN 3JRBA 4EVIA 4MEXF 2HNHA 1X1CA 2LY1A 3N97A 3IC7A 5F1RA 3QOEA 4HV5A 1BIAA 2E5ZA 4DZPA 5B1AH 2CQ7A 1QRYA 3ZQCA 2X4HA 3GLXA 3TP0A 3S1NJ 3ZQHA 5ILVA 4PDKA 3KP2A 3KFWX 3RI4A 3VEPA 4WCGA 2KDZA 2JA8J 3CLQA 1V4RA 2PMHA 4A3JJ 4ZDOA 3VYRB 1WJAA 3QP5A 3ZMTA 2YX4A 2E7XA 2G7HA 2K9QA 3Q3SA 3J81Z 1J09A 2K40A 1MBFA 2ICWG 4UUTA 2BOLA 2P6SA 1S7AA 4B4CA 4Y7NJ 4M6XA 4E7JA 3PO2J 3VDXA 3BR0A 2HYFA 1ZG3A 3ZMDA 1GVDA 1ZLJA 2OC6A 3ZXSA 2E35A 3L2RA 4HDUA 4QPQA 1QHHD 4XKWA 2W25A 1AA7A 4YIRX 3WGIA 5DM7F 2HOTA 2K86A 4PGGA 4ENMA 3WU0A 4XLPF 1WVRA 3HHGA 2M45A 5EG0A 3Q9VA 5D6EA 4HSTA 4AWXB 3PSFA 3SJMA 3CZ6A 2EZKA 4ZYAA 4KT5C 3OS1A 4CICA 3CCYA 1ETKA 3WU1B 5H20A 1VQOI 2ADUA 3OYLA 2IGKA 4EJWA 3GTMJ 4I99C 4QWQA 3W6JB 4QSHA 2ESHA 2VIXA 1X3WB 2M30A 1OQYA 4RGUA 4AYBN 2BEOA 2KZGA 5EGOA 2DA7A 1RRJA 4OAYA 1LB2A 4CO8A 2R3SA 3EYYA 2V6CA 3IUOA 5A2QK 4A5MA 2DOFA 1Z3YA 1BA5A 2KLOA 5D4SA 1Z2ZA 1U5TB 1LFUP 1FP1D 4IHYA 3WODF 1Z77A 1Y56A 3GLLA 5BMZA 5IPAA 1UHWA 2LTPA 1IO2A 1X4PA 3ASNH 3K1MA 5IOZA 1MSEC 1BOAA 3CCVI 4R8HA 1U5TA 4AIKA 2L9VA 2IGMA 4CYDA 5CVIA 4JOMA 4P96A 2DXIA 3VYTB 1FBUA 1QHGA 2VJIA 3H5NA 1L0OC 3ROUA 2EINH 2EILH 2DW4A 3F23A 3BZ6A 4UVBA 3JTGA 1QA6A 3OYHA 5EZGA 2HOSA 1GXQA 1ZAOA 3FM3A 4BXFA 2H8WA 2PEXA 5L3CA 4D1QA 3IV5A 1FZPB 4QLCU 4XNFA 1ZR2A 2ZB9A 2NVQJ 3WE3A 1BI2A 1VF9A 1W7PB 3LL7A 1FYMA 4L0YB 5FGMA 3S3MA 4ZZLA 2Q2EA 2P8TA 2HQAA 3F8BA 4LIVA 2DT6A 5E18F 3CCUI 4LG3A 4M3GA 5TJJA 2LRDA 4E7LA 4EGYA 1X19A 3FX3A 3R61A 4PK4A 1UCRA 3BOQA 1VQNI 2V1XA 4XIDA 1LDKB 5DUIA 3BP8A 1DP3A 3TDZC 2CUEA 3HRSA 1FMVA 4Y15A 5LRRA 1J7KA 2DTRA 5E1XA 1WI9A 3F22A 3GYHX 4UV9A 2LC2A 2YU3A 4R1HA 2ZC2A 5KNLA 1RKWA 3WU2C 1WJBA 1A31A 2DN0A 5CVVA 2A5YB 2HXIA 2LF8A 3OYDA 2M0CA 2QQ8A 4KIFA 3R0AA 1TW3A 2E7WA 2CUFA 3WTZA 4AC0A 4KITB 1MH3A 4KIGA 1YJNI 2W7NA 6PAXA 3PQKA 2JK3A 2M1BA 1SFEA 1WHUA 2V1DA 4XKBA 3CC4I 1I27A 3KP3A 5E3MA 5DD4A 4FTHA 4YEJA 3LWFA 1XGMA 1BJZA 2VJ4A 4M6YA 5GAHJ 3J80Z 1ETOA 4XICA 3ZP5A 2P0WA 3KLOA 1O57A 1O3SA 1IUFA 1LVAA 2VBZA 3S1RJ 2D45A 2IA1A 1P9QC 2HOAA 2FBIA 1A6QA 2YSRA 1XGSA 3S14J 2JUCA 2LFBA 3D0SA 4UXNA 4ZJZA 1YJ9I 1X3ZB 1X3UA 3KP7A 4Y17A 3TL4X 4BE2A 1EGVG 1V5FA 3P5JA 3LSRA 3SQNA 1MMGA 4RLFA 1GDTA 3HOTA 4CYCB 1R5ID 1TL8A 2CS3A 1FPQA 1MMFG 4RS8A 4IXAA 1SD7A 4BY1J 1ERDA 2GXGA 1LEBA 3P9KA 5DTDA 1VQ6I 2FXAA 2JJ7A 4E6KG 2XC7A 4ENJA 3MEXA 5M5YJ 4ESJA 2OZ6A 3HTSB 2IPQX 2RV8A 1HLVA 2PG4A 4FT8A 5FLXK 3EDPA 3HG9A 2IS6A 1UZCA 5CQGA 2LLKA 2F6CA 3U21A 1OYYA 2BZTA 2HGCA 3WTSC 2GOMA 3RZDJ 3HPHA 4OMZA 1S5LC 2OAZA 1JGGA 4J19A 4IVNA 3QPLA 2IBDA 3IKVA 1YRNB 1UB9A 3ULQB 2ZJRF 2PLYA 4UHTA 3TQNA 4GYGA 2N8GA 2X6XA 4IHTA 4CGZA 2PBIA 3BDDA 1WFXA 5ICFA 5HS9A 2TCTA 5ILSA 2EV0A 1LEAA 2K5CA 1GVJA 4DNCA 2M9HA 5KVRA 1YLFA 1S7OA 2QKMB 4BS9A 1E3OC 3HRMA 2COBA 3WG9A 1HKTA 3FM5A 3QQAA 1EKEA 4HZFA 3CDHA 2CJJA 3ECOA 3DBHB 4GGGA 3MKYB 2HYGD 2NS8A 4O6JA 2FOWA 1Y8RB 2EV6A 2XPVA 4JYKA 4NB5A 2QVOA 3BLYA 1VQ9I 4ON0A 3MZ8A 1HC8A 1K61A 2QEXI 3OR2C 1A6IA 2OU2A 4AVZA 3NWTA 1LVKA 1JKQC 2E71A 3MKLA 1V5GA 3CESA 5L3GA 3PO3J 1EH6A 2CQKA 2HZDA 3CP2A 5LRSA 3GTLJ 2CQXA 4JX5A 2L9SA 4M9SA 5K5RA 1V5EA 1I3QJ 4EMSA 9ANTA 1V54H 3ZQQA 2R5YB 3WTYC 1I3AA 3CC2I 4G7HF 2R5ZA 3GTKJ 2P4WA 3S16J 2F4OB 4XR6A 4Y13A 2VLAA 5HDKA 4ESBA 1A36A 2IW5A 3Q0WA 3WHCA 3ONQA 1HBXG 3DPLC 1PUEE 1WJ5A 1KU7A 3U1DA 4IRGA 2CV1A 2VPRA 2XVCA 3O2PE 1BOBA 3BY6A 1U3EM 2Y31A 1JHFA 1FOYA 2RDPA 3OIPA 1I1GA 4U87A 3GO5A 1KA8A 1Z7UA 4G8XA 1APLC 4DYCA 3HM5A 5B66C 4X6AJ 3P9IA 3OYJA 4FE4A 3HPGA 1Y8QB 5FKNA 1I6HJ 3H0DA 3VFZA 1BR1A 4OIRF 1G3YA 2P5KA 3KZZA 3ELKA 3ZQLA 3ERED 5IP7J 2VOOA 2HYJA 3TW7A 4E7HA 3HKZA 1JE8A 5KAIC 2R7FA 5HS8A 4CCMA 5L3FA 4G7OF 1YW8A 3GVAA 5L3BA 4BU2A 4E4HA 1BW5A 3I64A 3BR1A 4LK0F 1S7EA 3J7AO 2I10A 4GCVA 4PZJA 2CGPA 2JA6J 4EQQA 1GV2A 2JA5J 2M5WA 4L9TA 2X48A 5F0HA 4IOAF 2HQRA 1U6GA 2DA2A 1NTCA 2BVLA 1T0FC 5FRNA 4CA0A 1B1BA 5K5QA 5C4JJ 1TQIA 3ABKH 3HTUA 2D2WA 5F0FA 2HQ5A 3DXJF 1K6OA 5JLWA 1S3JA 3LSJA 2BHZA 4MTEA 4OIQF 1IXRC 2LBFA 2DYSH 3DLLF 2E36A 4NBQA 3DPTA 5EEHA 4A3CJ 1YJWI 1FBSA 2QENA 3K4LA 4UUSA 3HGYA 2ZJQF 1FIAA 2ZFUA 3CCSI 3E3VA 5D5XB 4XQFA 4XK4A 4B3AA 4AIDA 5CJ9A 1H8AC 2X6OA 1BI3A 4CDGA 4KNYA 1R00A 4C2TA 4OIPF 4NDLA 5GPCA 1WPKA 5IYDJ 4MFEA 3BWGA 3H35A 2EZIA 5E8IA 4S04A 5J1RA 1IRFA 2DQLA 4V2FA 4L9JA 3WGHA 1MBHA 4S05A 2XPWA 2VE8A 2HFHA 4XRMA 3ABTA 3E6BA 4OIOF 1ZH5A 3S15J 3FXOA 1VTNC 3I54A 1FWZA 1XN7A 1IUYA 2E2HJ 3P7NA 2A6TA 3BR6A 1RPWA 2V26A 3PFYA 4HQEA 1R71A 1B8IB 2JZYA 5J47A 4O3MA 2K9LA 1YOVB 4G6QA 4HX7A 3DKYA 3CJRB 2ZKZA 1JXSA 4PJJA 2KMUA 4FX0A 2BY0A 1B8IA 3OSGA 2XAGA 4GXOA 3L2QA 1XG1A 2RAEA 3G3ZA 3MKWB 2M8GX 3KZIC 4J01A 2Z2SB 4HSRA 3PL8A 3VYUB 3AAFA 3GX4X 2M34A 1E2XA 1TNSA 1G2HA 1K7AA 2DU9A 5D6FA 2W82A 3KZYA 4UV8A 4L5IA 4HRIA 5KK1A 2IRFG 2DA6A 2O0YA 3W2WA 3V7SA 1ORKA 2DQRA 5E3LA 2Y75A 2P7CB 3FXJA 4C2MJ 3W2VA 3ZN0A 3LSKA 3OYCA 3CCLI 2RGVA 3IAM2 1DU6A 4PJMA 1XGNA 3COAC 4DGWB 1A35A 1IN6A 1K79A 1YTYA 2LKXA 1U78A 2X1CA 3FMSA 1IN4A 5KAFC 5J8FA 2GA2A 2L01A 1MGTA 3QPSA 1G4DA 1BM9A 1W5TA 2WWYA 2L9RA 1PVEA 1X1AA 3QU3A 2WTEA 4ITVA 3H1CA 1O3QA 1HSTA 3AL0C 2YUSA 4XONA 1QGPA 3K4NA 4M3FA 5IY5H 3V4GA 5LHIA 3J7YJ 1LQ1A 1NG7A 1TWHJ 3PUBA 5AIQA 1G3TA 1M1EB 1YO5C 3MVPA 2G7UA 1MD0A 4IX7A 4G12A 4D7MA 3WTUC 1XDUA 2IGNA 3JW4A 2KZVA 5BOXA 2LH9A 4A6EA 4HX8A 2VJ5A 5M3MJ 4RMNA 2HKXA 4A2UA 4IO9F 5GAGJ 2HVQA 2PI0A 4DBRA 1DP7P 2AO9A 2Y0SN 1ON2A 4NC6A 3AUJG 3KCCA 2O61A 1VFCA 1HW5A 2R7QA 3IAS2 4YFKF 2DDAA 1J0RA 2M8EA 3K4JA 3OOPA 3M1EA 1IRXA 3KEYA 3RTRA 2VKVA 4KDPA 2DFIA 2R92J 4U0YA 4UUVA 4DZJA 1IXCA 3M9AA 2ME0A 3FWEA 1HW1A 4I7HA 2BXYA 4Q4ZF 2M0MA 1FSEA 5CLSA 1XSXA 1RZ4A 2L4AA 4N4OB 3ZQIA 3OYMA 1JTXA 1S8NA 1TT5B 3DF8A 2CWEA 4LB6B 3FZVA 3TOAA 3TP3A 3ZQ7A 4QIWN 1USSA 3A01A 2DK5A 4ABZA 1Z7LA 4XLFA 4A0XA 1R1TA 1ZGWA 2E1MB 4CHUA 5F04A 4CZZA 4WXHA 3HOYJ 5GADJ 3VSKA 3WTVC 1E3HA 2OTLI 1BN5A 3E6DA 3JRGA 3HB9A 1XC5A 1D8JA 4XOPA 4M72A 1QVUA 1XMAA 4XLNF 4GRIA 4EEFG 5C44J 3KYDB 1YG2A 5IYBJ 4A6DA 1U8RA 2F48A 4GFBA 2Y9ZA 3JRHA 2RN7A 2WC2A 3HJEA 4Q48A 3BJOA 1RETA 3HSFA 4V2GA 3VYSB 4KN4X 1BC8C 2ZO4A 3TMOA 2IS4A 5C3EJ 2L2OA 5D5UB 4LG0A 3ZOBA 3I9V2 4ZC3A 4FQGA 2EV5A 2P7VB 1S9HA 2AXTC 1CGPA 2F4MB 2IJLA 1BI0A 2IS2A 2VBWA 3H9QA 2JPCA 4H0EA 3FKJA 2IAIA 2OF7A 2XIGA 3K4KA 1UELB 2AXLA 1QNTA 1XB4A 2ELHA 2Y0MA 3FMQA 5F0CA 5K7FA 2W48A 4Z2YA 1TZLA 2FEZA 4CSWA 1BR2A 3S17J 2VODA 2BHYA 2HR3A 1AKHB 2CH0A 2FE3A 2JA2A 4DYQA 1FYLA 3K9TA 2O8KA 2KRHA 2VKDA 3CMMA 2DI3A 1KU2A 3EUHC 4D9JA 3W6VA 4RB2C 1T0FA 3CUQC 3MD2A 2OJED 2ELJA 1TLHB 4UNOA 4EM0B 3HHHA 3GFMA 3MKZA 1O3TA 2EA2A 4CCKA 3SZGA 3E5QA 2D1HA 4RDUA 3FDYA 4MEYF 1R7JA 5K5OA 5HLTA 1SMYF 5D5WB 3FIWA 2B0LA 3K2AA 1DUXC 3S3NA 2MG4A 2W84A 3ZGKA 2VE9A 5B5EC 4M9XA 5HDGA 1OPCA 3KE2A 3V8KA 1X1BA 2M2EA 2CW7A 1TTYA 3A4CA 4Y4RA 1UG2A 1Z91A 4IHWA 1YE9A 2JSCA 2TRTA 5M3FJ 5J4VA 1PP7U 2WV1A 1N75A 1FP2A 1RR7A 2YX7A 1AHDP 2VI6A 3CMAI 1QO0D 2XF6A 4J00A 2KFDA 2R7SA 2ZSIB 2UV1A 5IT9K 3IH3A 5JLXA 4I98B 1NH3A 1BW6A 1R36A 3FISA 2ZBKA 3LQRA 3OY9A 2JMWA 2A5WA 1YHQI 3M07A 4P9FA 4AIHA 3I71A 3HXLA 1ZREA 4XLAA 2MC3A 1RC9A 2QQAA 3JTHA 3PNYA 2K4JA 3C7JA 5ICEA 1JKRC 3HOVJ 4E7SA 1DU0A 3SEQA 2DPDA 1D3YA 2H27A 1X58A 2KIFA 1A5JA 1VQMI 3GW2A 1FNNA 2R7ZJ 4BBSJ 2GOXB 5ED4A 2DK8A 4U7BA 3KETA 3K4BA 2K9SA 4LMYA 3PIOF 2DT5A 3OYEA 2QA4I 1K78B 4ZH4F 1WJEA 2OUMA 5FFZA 2KT0A 2EH3A 3K10A 4XLCA 3B73A 4E7KA 1VQPI 4OOIA 1FLIA 4PJ0C 2Q8KA 1ZK8A 2JVGA 1SD6A 1JKOC 2ZXHA 1JJ8C 2A61A 3KYCB 2L7FP 3D5LA 2EZLA 1SMTA 4XORA 1BIBA 1JKPC 2XKOA 4I2OA 4KUMA 1SAXA 4A3DJ 3GWZA 5E1WA 2JRTA 2X6YA 3OSFA 1KQ0A 2V7FA 1W7PA 4XMYA 2KIUA 4B43A 3G4SI 4YELA 3AL0B 4A3IJ 4E7IA 2W85A 1T6SA 1WGXA 2DJNA 1D1CA 2AQFA 3LOCA 1EV7A 4PCQA 3BR2A 1W0TA 1QVTA 3CQZJ 2DMNA 2IXSA 3H5RA 2CMPA 1LJ9A 4C3HJ 1BR4A 4FE7A 1QU3A 2XUBA 3DQVC 2EWNA 1TT0A 4IHXA 5A2QZ 4LD5A 1P4AA 3QYFA 4BDZA 2NNYA 3BR3A 2K3FA 4I0BA 3BG5A 1N25A 5LGTA 1D0XA 1LPQA 2QSFX 2E34A 4HYEA 2D5VA 2H09A 3DPUA 3JSPA 2GQQA 1YS6A 2BW3B 4HV6A 3IWZA 1EH8A 1GHCA 3L00A 3HDDA 3I4PA 2KRFA 2HU9A 3LFKA 2EA4A 1W0UA 1E0EA 1MMDA 4RB3C 1J75A 2GXAA 4LK1F 1SFKA 4C3JJ 2XROA 5E1ZB 3K0LA 4BKXA 4UVCA 3R60A 1H9GA 2QLZA 3IH4A 3LA7A 3P9CA 3HOXJ 4EJTA 1IRZA 2RVCA 4ZYHA 3L2VA 3BZKA 2GLOA 2NYXA 2E1NA 3DLAA 1NHAA 3ASOH 5C4XJ 1LFBA 5FKMA 2ECCA 2XSJC 2K85A 2RNJA 2KJCA 3WHBA 3H92A 2COMA 2DA5A 5D5VB 2ACJA 3JRCA 3S2DJ 4BH9A 4EJOA 3OS2A 3DTEA 4Q47A 4KYWA 4BHBA 3ESWB 3GTQJ 4LOCA 2PQ8A 4CYCA 4RB0A 3M8EA 1GT0C 4G7ZF 4FISA 5LHGA 2HPMA 1R5GA 1AWCA 2DA3A 2NOJB 2Y2ZA 3BQZA 1SAUA 3WE2A 3E1SA 4AUXA 5LLQA 4HLYA 2E60A 1SEUA 1SC7A 4JBAA 3BROA 2H6CA 2XSDC 3RKXA 3FXRA 3HOSA 1MMAA 2NRAC 5KCMA 3T5XA 2VKHA 4XM3A 4EM1A 3M8FA 5ICCA 5EDNA 2M3AA 2EFWA 1STZA 4IQ4A 2ZXJA 1MBJA 3AG4H 3F8FA 4HNVA 4XSXF 4G6DA 3RCOA 3K6GA 3Q5FA 5M5WJ 2M7AA 1ZYRF 1I5ZA 4A5NA 3TOBA 3FHZA 2M4KA 4IKFA 4NNJA 2JUGA 3C2HA 4X1EA 3PM1A 2BE5F 3M8JA 5DCMB 3E5XA 1YRNA 2UZKA 1TWCJ 2Y0SA 5DS9A 2O9LA 1PYVA 3I0TA 2EPFA 4DBQA 1W5CC 2LOOA 3M7GA 1W5SA 4RAFA 3QPTA 2M87A 2BYVE 4F55A 2HDCA 2VONA 5GPAA 2NXNB 5CVUA 2LNBA 4JX6A 2MLGA 2QQ9A 2QSHX 2J5PA 1MMNA 2OTJI 1NK3P 1Z21A 1J5YA 2QGUA 3FF5A 3W2AA 3GBGA 2VPLA 4N0BA 1XDSA 3I53A 4ZTFA 3CLOA 5FB2A 1D5YA 1I6XA 2F5CA 1OCTC 1Z6RA 2NS0A 1TW2A 2OZUA 2BY2A 2PMZN 4A0ZA 3H3ZA 3BTIA 1WSUA 3RPUA 2E1CA 1Z0XA 2DFEA 3CUQB 2R7WA 2V79A 3PNVA 3ZPLA 1IXSB 2FQ3A 2HZTA 1DGWY 5D4RA 5FLXZ 3MWMA 2DA4A 2VL8A 4RB1A 3DTIA 2JPBA 1GLNA 5E8GA 2CRGA 3PSIA 2ME6A 2E1MC 3DCFA 1JUMA 1ZARA 5IT3A 4O5VA 1Q1HA 4A0YA 2R5YA 1Y6IA 3S1MJ 3OYBA 2NVXJ 1EEXG 4A3GJ 2AHQA 5JHFA 1WZ2A 2DMPA 3NWSA 5HS7A 1FOWA 3DV8A 2K02A 3I55I 1SFXA 1VZ0A 4HQMA 2QF7A 3FBIB 2KRCA 3LSMA 2KIMA 4M74A 1GXPA 1MKMA 2WA0A 3DEWA 4XL9A 5CQEA 1G8XA 2FMYA 3FMRA 3S2WA 5TISC 1XMXA 4HX4A 3OL4A 3CJQB 2NS7A 3L7WA 3F0CA 1O7LA 1Z67A 1Z3XA 2FNAA 3OIQA 2EIJH 2VN2A 1ZR4A 1HCRA 3W6KB 4XLEA 2R93J 4BE1A 4IRIA 1FBQA 5ICGA 2O8XA 1QZYA 3OMYA 2RKHA 3I4NJ 2V9PA 4M3BA 4PJLA 4XRFA 4LLGF 3DTKA 2FA5A 1TQPA 1T98A 3FHNA 2IEKA 2V6EA 2QBYB 1P4WA 1DDNA 3O8GA 5GTIC 4LITA 2L7KA 4F91B 4A3MJ 1XGOA 2OD5A 4HF0A 1IC8A 2FX0A 5IP6A 3AKZA 2UWMA 3I4MJ 1WWXA 3NARA 4OMYA 1RUOA 3OYNA 4LLNA 3BR5A 2M4GA 4Y52J 4ZYDA 3ZQFA 1BC7C 3CDIA 3E5UA 1FJLA 2QKLB 3K7AJ 1T08B 1FTZA 2W1OA 3LSGA 5FRMA 4P5OA 3U9GA 1UHMA 2K3PA 3LMMA 1ITYA 1ENHA 3CJTB 1W36C 5GAEJ 2EFQA 5J1YA 3H3UA 4UY8I 1H0MA 1WJCA 3J7ZI 1ACIA 1K4SA 1WH7A 3JCUC 4XOTA 1F4KA 1ZHFA 1VQ4I 3ML6A 2B7EA 2ISZA 5F08A 3VB2A 2PFBA 4BXXJ 2CYYA 2OA4A 3ABUA 4WXDA 4Y3OA 5E79C 1TP4A 3L2CA 4BJTA 1DQUA 4R79A 2VKEA 3GTPJ 3HUGB 3HIFA 3ERMA 2OQGA 5EZHA 3PUFA 3R0JA 4MLOA 3CO7C 2LD5A 2QZ8A 3RKWA 1TC3C 3PJRA 3CMEI 5D8KB 3L1PA 4ZDLA 3BC8A 2FMLA 2EK5A 4D5CA 1K6YA 3G6EI 2KQRA 3HYIA 2EFNA 3QRFF 4HOBA 4A69C 1XMKA 3A0BC 2XF7A 5TGTA 3RIRA 4M3EA 4HA8A 2VASA 2NVUB 1WKMA 2PJRB 1CF7B 2RQQA 1XCVA 3HOWJ 2KDOA 5EF6A 2WB1N 2DMUA 5GP9A 2VXZA 3TO6A 3JAMK 2NAZA 3VPRA 2DMQA 1EJ9A 3SFIA 2WAFA 2CQQA 1OJLA 2KL4A 1JTYA 2IVMA 3TEDA 4B09A 1MW7A 1RR8C 3CC7I 3IWFA 1HW2A 3TKYA 4D0PA 3BT9A 2LY2A 5JI6A 3J7AY 1IN7A 2ESNA 3ZMSA 4FCYA 1ZQ3P 1FIPA 2WY8Q 4HDVA 4EATA 2DJIA 3E7LA 3H36A 2CV0A 4XRSA 2F2EA 1D0ZA 3KEOA 3TO9A 4PGHA 2KKOA 2W00A 4MIMA 3RZOJ 2R7RA 2MH9A 3TDUC 1UC5G 1YS7A 2FRHA 1YX3A 3HC7A 3I5UA 1R22A 1R5HA 2QUFA 2ZMEC 3AFHA 5K1YA 2DT7B 5LEJA 1VQKI 5LD2C 4B48A 1MMSA 2WAQN 1D1BA 5DD8A 3S93A 3HSRA 2L54A 3WTWC 2FSWA 1ETVA 4RGRA 2P5LC 5TRDA 1W7PD 2V1NA 3LSTA 1I50J 4B1RA 4UB6C 3WTXC 1R4NB 4CUGA 4LIUA 2H94A 3ISPA 2AS5F 2WV0A 3BQYA 2WBMA 3CP8A 2QQBA 2WY7Q 4CCOA 4DQ2A 3KPHA 1ZRFA 3BTJA 4II3A 4A3LJ 3R4KA 4XKVA 2FJ1A 3QYEA 3AG2H 2E5NA 1WRJA 2BY1A 4JP0A 2DOAA 3IKTA 3OV8A 1VQ5I 1KYWA 1OCCH 2Y69H 1OISA 3H0GJ 2OBPA 4RGSA 2EZHA 1ZG5A 1OCRH 1VQLI 4OAZA 3C1DA 4DYRA 3JRIA 1KYZA 1BJAA 2EIMH 2VQGA 1MH4A 4GDFA 2V4JC 2ZSHB 1U9NA 4HF1A 5CPRB 4MQVA 4XN3A 2MLKA 1ZKGA 1H88C 5BQTA 2GZWA 2QCOA 5HLHA 2EB7A 3D1NI 2GIZA 3OR1C 2Z99A 4NUBA 2CFOA 3FXLA 4L9NA 1B72B 4P1WA 1K83J 4HLXA 1P6RA 3DBLB 3SDGA 4HG2A 1IV6A 1VQ8I 2KHMA 2IA2A 1LDJA 1YX5A 3N4MA 2LDUA 3OIOA 1R58A 1UAAA 5F27A 2YPRA 2IT0A 2X0LA 3JSOA 4DJAA 1F1ZA 3V42A 1IDYA 3OWTA 4FX4A 1WI3A 5FD6A 3Q9SA 3KX2A 1HKQA 2XRLA 3SYTA 4G6TB 2GM4A 1IJWC 5HOOA 4E70A 1RI7A 2LK2A 4D5FA 1YW7A 1SD5A 3K1PA 2FU4A 3UNGC 4ZTJA 1IN5A 1KU9A 3A03A 3TO7A 1S29A 3LFUA 2JA7J 2JSPA 2EBIA 5K7ZA 3SHFA 2R7VA 2VUMJ 3VWBA 1G6NA 3I59B 4BBRJ 4ENNA 1ODDA 1NG6A 2LR8A 3L2UA 3MAJA 1HXDA 4MHGA 2L9NA 4IOCF 3QYBA 2JQ7A 3K70C 4WK8F 1OLTA 1D1AA 1S6LA 2PN6A 4XSZF 1Z1DA 1JUSA 2FBKA 2GA1A 3I59A 3J81K 3G1LA 1BBYA 3NRVA 3TW6A 1OYWA 1B6AA 1V3FA 2ZFWA 1IWBG 1ZTRA 3BTLA 3GZ6A 1QQIA 5HVQC 5HODA 4F52A 4DOZA 2VC0A 4ZDPA 1RUNA 5FD5A 1T56A 1XD7A 1G3SA 2LYCA 4ZYGA 1Y39A 1YYVA 3U1KA 2MFZA 4BHPA 4W97A 1F43A 3EUAA 1HOMA 1WJFA 1LKXA 3S1QJ 5J3LA 5FROA 1DPRA 1MIJA 4IJAA 2PMZA 2HVRA 5DYMA 1RESA 3GF2A 5ERIA 2GBYA 1Y1WJ 2X9DA 4EJVA 1RIOH 2LY9A 2CW8A 1LE8B 3L9FA 2FOKA 3B6CA 1LUJB 3C2GA 4ENKA 3BCAA 3NEUA 4QPOA 3OYFA 1FEXA 2M7BA 2JT1A 2QSGX 1EF4A 4BUPA 2VOPA 1ETQA 2ELKA 4U88A 1RNLA 3EUKL 5FJ8J 3HBLA 3BJ6A 1A04A 5EJCA 1F36A 2DCEA 5FO5A 2MH2A 3DFGA 1AKHA 3HOZJ 1MBGA 3R6SA 3ZMVA 1P4XA 3QAHA 3RDIA 3V7RA 2O03A 3FXMA 1XX5A 4D7NA 4YIIA 3F6OA 2RQPA 4E7ZA 4HAMA 2FD5A 3CCEI 3GFJA 3RYPA 2P81A 2E2IJ 3F9KA 2DLLA 3H3VK 2VBYA 2VT2A 5CVRA 5LEKA 3O8HA 4I0AA 1IGNA 3JRDA 2V9KA 4IEJA 3MZHA 5DUKA 2LKPA 2Y48A 5H6RA 3DU6A 2HEOA 4RM2A 2F5VA 5JFRA 2HVSA 1I1SA 2DFHA 5HNHA 1X2MA 3ABMH 3FK6A 1R1UA 3HOUJ
chains in the Genus database with same CATH topology
1N78A 3L2WA 4C2UA 4BQOA 2HPMA 1OR7C 3M1CA 2X6WA 2Z1DA 3QODA 2NOJB 1SAUA 2IGOA 1PJRA 3E1SA 2BVLA 1T0FC 4AU7A 4CA0A 2E60A 5FRNA 4ANJA 3E0JB 2VB6A 3FBNB 3HOSA 1MMAA 4PSWA 2LBFA 5KCMA 2VKHA 3DPTA 4XM3A 2M3AA 3K4LA 4IQ4A 2ZFUA 3RCOA 3K6GA 4XLHA 4XQFA 2M7AA 3EPZA 4IKFA 1X1DA 2M4KA 4NNJA 2JUGA 3C2HA 2F4IA 3M8JA 4C2TA 2R7XA 2Y0SA 3BG7A 1PYVA 2UUZA 3H35A 4DBQA 2LOOA 3OOUA 4PFPA 3ZCOA 4F55A 1WJDA 2RNGA 1MMNA 4RLQA 2O5RA 1Z21A 3W2AA 3GBGA 4YRVA 2VPLA 3CF2A 2I8DA 2A6TA 2X85A 2V26A 3PFYA 4ZTFA 3K70D 2K9LA 3W3CA 3MMYB 4B44A 4N4NB 3OYGA 2R7OA 3DKYA 3CJRB 2X1EA 1HA8A 4PJJA 2KP6A 2KMUA 2Q2EB 3BG6A 4XKCA 3L2QA 3IP4B 2R7WA 2XAUA 3PNVA 3MKWB 1FMWA 2XF5A 3SDBA 2Z2SB 4J01A 4HSRA 3PL8A 3VYUB 1EGMG 1DGWY 4B47A 2VJJA 2VL8A 3DTIA 1GLNA 2ZXIA 2W82A 3PSIA 2E1MC 5CKTA 4HRIA 1Y6IA 3RPUD 2WB1A 3W2WA 3OS0A 3OYBA 3LSHA 4BEHB 4BE0A 3UR3C 1EEXG 4JQFA 2W4SA 3W2VA 5JHFA 2LG4A 3LSKA 3OYCA 3NWSA 2AQEA 3OYAA 1U0JA 3OYKA 4C30A 3H9JA 3IAM2 4PJMA 1VZ0A 3SEZA 4DGWB 3ZRGA 4HEA2 3FBIB 4BEHA 2KRCA 3LSMA 2X1CA 4PFOA 2HNHA 2LY1A 2WA0A 1X1CA 2L5QA 4XL9A 1G8XA 5CQEA 1R6RA 3QOEA 2BW3A 2CUZA 2E5ZA 4BQQA 3OL4A 3CJQB 4NQWB 1Z3XA 2WADA 3OIQA 1X1AA 4ITVA 4XLEA 4BE1A 3AL0C 2R4GA 4II2A 2WAQA 3OMYA 4ZDOA 4XONA 3VYRB 1WJAA 4HNTA 4PJLA 3K4NA 1J09A 2WAEA 3LSIA 1NG7A 3PUBA 3DTKA 3BCBA 4FETA 4BACA 2BOLA 4E7JA 3FHNA 4PUSA 3VDXA 4IX7A 2K9MA 2V6EA 2JVHA 3RSNA 2OC6A 3ZXSA 2IGNA 3L2RA 4LITA 4QPQA 2KZVA 1QHHD 4XKWA 2L7KA 2LH9A 1AA7A 4F91B 2VJ5A 4RMNA 2XDVA 3AKZA 2UWMA 3OYNA 3H5AA 2HVQA 4HSTA 4BJ5C 3A2KA 2M4GA 3PSFA 3CZ6A 1EA3A 4ZYAA 4BQNA 4C9YA 4DBRA 3OS1A 3AUJG 2QKLB 2W1OA 2IGKA 3LSGA 4P5OA 3OYLA 5FRMA 2R7QA 2K3PA 3IAS2 1DIOG 3LMMA 1W36C 2VIXA 2VQCA 3H9GA 1WJCA 3K4JA 3ZR8X 4F3QA 1IRXA 4OAYA 3KEYA 4CCJA 3RTRA 4XOTA 3OYIA 1KONA 3IUOA 2BVMA 1Z3YA 2KLOA 4Y3OA 4NC8A 1Z2ZA 2M0MA 4BJTA 1DQUA 4R79A 3HUGB 3OYMA 4N4OB 1Y56A 2R7UA 1X4PA 3DEEA 4MLOA 1Z7LA 4XLFA 3DKXA 1ZELA 2E1MB 3PJRA 5LFAA 2IGMA 2DXIA 4JOMA 4ZDLA 3VYTB 3BC8A 1QHGA 2VJIA 3H5NA 3VSKA 3VSLA 1K6YA 2KQRA 4CH7A 4XOPA 2XF7A 5TGTA 4CZCA 3OYHA 4GRIA 2VASA 2Z16A 2PJRB 4BXFA 2RQQA 4D1QA 4IQJA 1LFPA 2KDOA 4XNFA 2VXZA 1MNDA 3LL7A 2KPMA 5KHDA 2RREA 3S3MA 2WAFA 2KL4A 2HQAA 4LIVA 2DT6A 4LG3A 1MW7A 2LRDA 4E7LA 1X19A 4PK4A 1UC4G 3VYSB 2MYSA 2LY2A 3TMOA 3J7AY 4HNUA 4X0GA 2IS4A 2L2OA 2WY8Q 4EATA 2DJIA 1LDKB 1DP3A 2CV0A 1D0ZA 3I9V2 4ZC3A 2W00A 1S9HA 2R7RA 4IZZA 1FMVA 2MC4A 1UC5G 1YX3A 3HC7A 3S32A 2IS2A 3H9QA 3S3OA 3AFHA 2DT7B 2R7TA 3FKJA 3K4KA 5LD2C 1UELB 4B48A 2LC2A 1D1BA 5KNLA 3S93A 4KISA 1WJBA 1TZLA 4CSWA 4KT6A 1BR2A 2VQHA 3OYDA 2MD0A 4CCLA 2CH0A 2JA2A 2V1NA 4KITB 2KRHA 2W7NA 2VKDA 3CMMA 4CUGA 4LIUA 4F93B 3EUHC 4D9JA 2WBMA 3CP8A 4XKBA 1D0YA 2X1DA 2WY7Q 3MD2A 2ELJA 4CCOA 1G59A 4YEJA 2VJ4A 3MKZA 3KYLA 2P0WA 4CCKA 4II3A 3SZGA 4Y33A 4XKVA 2MABA 3FDYA 3K4CA 3QYEA 4DIQA 2E5NA 1P9QC 5HLTA 2DOAA 3DU5A 2CV2A 3TBIA 4ZJZA 3S3NA 4BE2A 3TL4X 3ZGKA 1T95A 1EGVG 1V5FA 4OAZA 1MMGA 4RLFA 3S8PA 3HOTA 2VQGA 2V4JC 1X1BA 2OV7A 2CW7A 2CS3A 2ZSHB 3A4CA 1MMFG 4Y4RA 5CPRB 3K4MA 1ERDA 1YE9A 4XN3A 4NC7A 1N75A 2VQLA 4E6KG 2XC7A 3OR1C 4NUBA 2CFOA 2IS1A 2LBFB 2XF6A 4J00A 4P1WA 4KJZA 2R7SA 1JI8A 1W36D 2ZSIB 3HG9A 2UV1A 2IS6A 4HG2A 5CQGA 2KHMA 2F6CA 4RM3A 3U21A 2GOMA 1YX5A 3OY9A 4OWRB 4BL0B 2A5WA 3HPHA 1UAAA 3HXLA 4XLAA 4DJAA 3V42A 3OWTA 4F92B 3PNYA 4E7SA 2X6XA 3SEQA 3KX2A 3SYTA 4G6TB 1WFXA 5HOOA 1X4OA 2K5CA 1UG0A 3UNGC 4ZTJA 2QKMB 4BS9A 2GOXB 3LFUA 2JSPA 4U7BA 3K4BA 3OYEA 2R7VA 3VWBA 1WJEA 2OUMA 1NG6A 4AYBA 3K10A 3L2UA 3MKYB 2L9NA 4XLCA 3QYBA 4E7KA 1IWPG 4XN0A 4B3XA 3K70C 1OLTA 1D1AA 2JVGA 2ZXHA 3BLYA 1MNEA 3OR2C 3D5LA 4XORA 2PJRA 4AVZA 3NWTA 1LVKA 1IWBG 4BDYA 5HVQC 1V5GA 3G2BA 4DOZA 4F52A 3CESA 2X6YA 2LREA 4ZDPA 2HZDA 3CP2A 2V7FA 3RQ4A 4XMYA 4B43A 3AL0B 3A1YA 4YELA 2LYCA 4E7IA 4HPQA 1D1CA 2AQFA 1DGRM 2MFZA 3PNTA 3HL2A 2L9SA 2HDWA 1V5EA 3D5SC 3EUAA 1WJFA 2CUJA 1LKXA 3ZQQA 2IXSA 3H5RA 3D5RC 2CMPA 5FROA 1BR4A 2PMZA 2HVRA 1QU3A 4XR6A 2VLAA 3N05A 3DQVC 4BGDA 2CW8A 1TT0A 3QYFA 4BDZA 4H4KC 3C2GA 3ONQA 3BCAA 3DPLC 2HPIA 4QPOA 3OYFA 1D0XA 1WJ5A 2FUG2 2M7BA 4PJNA 4BJ6C 2CV1A 4BUPA 3DPUA 4FASD 1N77A 3I3LA 2Q1ZB 2BW3B 3EUKL 5HNFA 1BOBA 4CCNA 2DCEA 3DWLE 3OIPA 4U87A 2HU9A 1E0EA 1MMDA 3OYJA 4E7ZA 3HPGA 1SFKA 3H0DA 2X51A 3OL3A 1BR1A 3F9KA 2VXDA 3L2VA 4E7HA 3HKZA 3DLAA 2V9KA 2XSJC 4CCMA 3DU6A 2HVSA 4RM2A 2F5VA 4BU2A 4E4HA 5HNHA 4PSXA 3OS2A 3DTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IP4 B;  1NG6 A;  3AL0 B; 
#chains in the Genus database with same CATH topology
 1YQA A;  2A07 F;  5EG0 B;  4WX9 A;  4C2U A;  4BQO A;  2XGE A;  3GFI A;  1MNM C;  1OR7 C;  3M1C A;  2Z1D A;  1GV5 A;  2Y9Y A;  2L7Z A;  4M9Z A;  2IGO A;  1PJR A;  2I5U A;  2KJB A;  5F64 A;  3A0H C;  1KU3 A;  4N9I A;  3C18 A;  1K4T A;  1QPM A;  2VB6 A;  5LBQ A;  1Y0U A;  2YR2 A;  2GAU A;  1AU7 A;  3BG3 A;  3V8J A;  2MA3 A;  2OCC H;  4PSW A;  4HF2 A;  2CW0 F;  2E19 A;  3F8C A;  1JT0 A;  3FK7 A;  2DOD A;  3BZC A;  4KMU X;  3F6V A;  5EGO B;  2PMU A;  3JRF A;  2KIS A;  1J9I A;  3RYR A;  3GTO J;  5F6F A;  5H2F C;  4V19 K;  2HXO A;  3EPZ A;  3QPH A;  1X1D A;  5BPI A;  5BPD A;  2XV4 S;  2UUZ A;  3U2R A;  1W4M A;  4EV0 A;  1MJ9 A;  5E3N A;  5IOY A;  3OOU A;  4PFP A;  3ZCO A;  1SVM A;  2FQ4 A;  4IHS A;  4L5E A;  4ASN A;  2XGC A;  3MQ0 A;  3RKQ A;  2O5R A;  2ZME B;  1YFH A;  3I58 A;  3CF5 F;  1KQ8 A;  2MBF A;  2LF7 A;  4OU0 A;  1UMQ A;  1K78 A;  3EYI A;  2QYO A;  2EJR A;  4M71 A;  3J80 K;  1J59 A;  3MCZ A;  2ZME A;  2QM3 A;  1ETX A;  3AG3 H;  3MMY B;  3WTT C;  2L02 A;  4N4N B;  2R7O A;  1J2X A;  1FOX A;  3LNQ A;  2Z9O A;  4K2E A;  1HA8 A;  2KP6 A;  4AIJ A;  5EYR A;  4A93 J;  1E17 A;  2Q2E B;  3BG6 A;  4XKC A;  5JVT A;  1U9O A;  3IP4 B;  1R9T J;  3E6C C;  1JJ6 C;  2XAU A;  2XF5 A;  1Z6T A;  3SDB A;  1D8K A;  3GUD A;  3M3Y J;  4G94 A;  4M3D A;  1EGM G;  2K4B A;  4B47 A;  2VJJ A;  1SFU A;  3F8N A;  5IT9 Z;  2ZXI A;  2LMD A;  3KIO A;  4W1U A;  1FX7 A;  1OKR A;  2DO7 A;  2EQR A;  3ZMU A;  5ILU A;  4A3K J;  1W1W E;  2FF4 A;  2ZXW H;  2B9S A;  4I09 A;  4RAY A;  4L18 B;  2WB1 A;  3OS0 A;  1ETY A;  3NQO A;  1MDM B;  1QBJ A;  2VC1 A;  2W4S A;  4A12 A;  1ONV A;  2XAQ A;  2LG4 A;  3E6M A;  1U0J A;  2LVS A;  4GYI A;  1ZG1 A;  2ZNZ A;  4C30 A;  1B59 A;  1IV8 A;  3H9J A;  3DP7 A;  3SEZ A;  1EH7 A;  1GUU A;  3CCR I;  1MDM A;  4CXF A;  3B6A A;  4KN7 X;  4PFO A;  2F5E A;  1IDZ A;  2L5Q A;  3O6B B;  1R6R A;  2BW3 A;  2CUZ A;  1S72 I;  3CCJ I;  1D5V A;  4BQQ A;  4NQW B;  2YU9 J;  3K2Z A;  3ZQG A;  1PP8 F;  4I6Z A;  1VI0 A;  5CYV A;  3B02 A;  2WAD A;  3SZP A;  2NVT J;  1X1P A;  5L3D A;  3CMY A;  3RKY A;  3JR9 A;  4RBO A;  2HQN A;  4I01 A;  4BXU A;  2R4G A;  4II2 A;  2WAQ A;  4NQW A;  1T2K A;  5DDG A;  4HNT A;  2MD5 A;  4GO1 A;  1R4M B;  3I56 I;  2XB0 X;  2WAE A;  2XAJ A;  3LSI A;  4I02 A;  2O6G E;  2YS9 A;  2XAS A;  3PIP F;  2A6H F;  1YIJ I;  3BCB A;  4FET A;  4BAC A;  2HI3 A;  1VQ7 I;  2CFX A;  4PUS A;  4UB8 C;  2DFF A;  3EET A;  5BS6 A;  2K9M A;  2JVH A;  3RSN A;  2Q0O A;  2RC4 A;  1F5T A;  2BV6 A;  2NOG A;  1L3L A;  1O7F A;  3KP6 A;  3LA2 A;  5E20 A;  2XDV A;  2Y30 A;  4OIN F;  3KP4 A;  1F9N A;  3FXK A;  3QWL A;  3H5A A;  5FFX A;  3GFL A;  4BJ5 C;  3A2K A;  1EA3 A;  1MJB A;  4BQN A;  1OMI A;  1RKT A;  1TBX A;  3TGN A;  4C9Y A;  5K7H A;  3IRQ A;  3G73 A;  4IRH A;  1P2F A;  3DBR B;  1TWA J;  3VOD A;  1HKS A;  1U8B A;  1R1V A;  1DIO G;  2VQC A;  1ZLK A;  3GZ5 A;  3IHU A;  2R7D A;  3H9G A;  3CTA A;  3ZR8 X;  4F3Q A;  3RPQ A;  2MGQ A;  3OYI A;  1FC3 A;  4CCJ A;  1WCM J;  1KON A;  1X2N A;  2BVM A;  3E97 A;  1LDD A;  3REO A;  2TDX A;  2CQN A;  2JTV A;  4NC8 A;  2L3D A;  4UVA A;  2B63 J;  5DCM A;  4ZYE A;  1P7I A;  3GXO A;  1JHH A;  2STT A;  4EJU A;  3JRA A;  3MZY A;  1XPX A;  1IAW A;  1I39 A;  2EFO A;  2ZNY A;  3DEE A;  3DKX A;  4YIF A;  5IP9 J;  1ZEL A;  4TV7 A;  5JVG F;  3CUO A;  5LFA A;  1IW7 F;  2MW8 A;  4P9U A;  1PUF B;  4A3E J;  1Z05 A;  2QWW A;  3VSL A;  4BY7 J;  2BXZ A;  2C6Y A;  2JWT A;  2E2J J;  2R7U A;  2J5O A;  4CH7 A;  4CZC A;  4U0V A;  1PUF A;  2Z16 A;  3MN2 A;  1UST A;  2LP0 A;  3DEU A;  4IQJ A;  1WQ2 A;  1LFP A;  2ETH A;  1OCZ H;  2E1O A;  3F3X A;  3GZN B;  1MND A;  3EUH A;  1ZGA A;  2KPM A;  4P55 A;  5KHD A;  2RRE A;  1MSF C;  4L5J A;  3CUQ A;  3RJP A;  3T0Y A;  4ESF A;  2D1V A;  1B4A A;  4RA2 A;  5LHH A;  1UFM A;  2OCE A;  1H9T A;  2CO5 A;  2DAO A;  1UC4 G;  2R5Z B;  2LKS A;  3JRE A;  4MQ9 F;  2MYS A;  2CSO A;  4MNU A;  4HNU A;  4X0G A;  1HQC A;  3C2B A;  5J8C A;  4BHC A;  1U2W A;  4XRS G;  3G1O A;  4L0Z B;  4IZZ A;  5JR3 A;  2MC4 A;  3KLN A;  3S32 A;  1AOY A;  4NHJ A;  3HEF A;  4HW0 A;  2A68 F;  2XB5 A;  4MFD A;  5AON A;  3S3O A;  2EIK H;  1PDN C;  1ETW A;  2LSO A;  5CVJ A;  2DDB A;  3EQL F;  2VBX A;  4KIS A;  4KT6 A;  1Y0N A;  2VQH A;  2MD0 A;  4CCL A;  3CCQ I;  1WH5 A;  2IA0 A;  1JT6 A;  3A02 A;  1OR7 A;  3AG1 H;  5IYC J;  1OCO H;  4F93 B;  2DOE A;  1QPI A;  3IH2 A;  4U7D A;  5J40 A;  3HRU A;  3L09 A;  4YG2 F;  1D0Y A;  1FT9 A;  2X1D A;  3VOE A;  3WG7 H;  1G59 A;  4EM2 A;  3F72 A;  1OCP A;  5FLV A;  3KYL A;  4Y33 A;  4Q5S F;  2MAB A;  3K4C A;  4DIQ A;  3G1M A;  4A3F J;  2KIQ A;  1XS9 A;  2ISY A;  3CD6 I;  3SFZ A;  1TWG J;  4YFX F;  3GEZ A;  3DU5 A;  2CV2 A;  3TBI A;  1ZGJ A;  3KEQ A;  4JX4 A;  1Q1V A;  4F7Z A;  1T95 A;  3BPV A;  1SVO A;  3T1B A;  3Q0V A;  2XAH A;  5J4Y A;  3S8P A;  1R23 A;  2QBY A;  4HBL A;  2OV7 A;  1FTT A;  2GIV A;  1DPU A;  2BGC A;  3K69 A;  4BYY A;  3K4M A;  2HTS A;  3LAJ A;  5LGU A;  1BL0 A;  1VND A;  4NC7 A;  2H6B A;  2VQL A;  2XHK A;  4LLL A;  2Z5U A;  5FKL A;  1XSD A;  2IS1 A;  2LBF B;  2A3S A;  3CJN A;  3CCM I;  4KJZ A;  1JI8 A;  1W36 D;  3ECH A;  2K27 A;  4UUS B;  1UHS A;  4RM3 A;  2K7L A;  4JK1 X;  4B8X A;  3QOP A;  1KGS A;  1YW9 A;  4EGZ A;  4OWR B;  4BL0 B;  3V7C A;  3MFK A;  1P7J A;  4YFN F;  2JRM A;  3LA3 A;  4F92 B;  1Z9C A;  1TNT A;  4XBF A;  4MTD A;  5E3O A;  3SXY A;  1TQM A;  2OQR A;  2VT3 A;  1KZH A;  4L9V A;  4KMF A;  3HUG A;  1X4O A;  1UG0 A;  2ZCW A;  2JN6 A;  5L3E A;  4QTR A;  1T39 A;  1XTA A;  2OPT A;  2FBH A;  2F5D A;  2BY3 A;  2P5V A;  1SAN A;  5DCF A;  3C3W A;  4IL6 C;  3ZMZ A;  4AVP A;  2ZJP F;  2ID6 A;  1IG7 A;  4AYB A;  3HGG A;  2O3F A;  1T8I A;  1NK2 P;  1G3W A;  3IL2 A;  2XAF A;  1IWP G;  4XN0 A;  4B3X A;  4AM3 A;  2XRN A;  4IPA A;  5HLG A;  1MNE A;  4I76 A;  2PX9 A;  2PJR A;  4MO7 A;  1CF7 A;  3GME A;  2W24 A;  4BDY A;  2L4M A;  3G2B A;  1HSJ A;  2LRE A;  1QZZ A;  4G9Y A;  3RQ4 A;  3A1Y A;  2H1K A;  3G71 I;  4HPQ A;  3HL2 A;  1IRG A;  1DGR M;  3PNT A;  5DV5 A;  2HDW A;  2Z33 A;  3HSE A;  3D5S C;  1U5T C;  1JUP A;  5E17 F;  2CUJ A;  3BJA A;  5BNG A;  3D5R C;  1JGS A;  2IP2 A;  4WF2 A;  1UJ8 A;  1V55 H;  2XGD A;  3LQQ A;  1SFO J;  2A05 A;  2W57 A;  3N05 A;  4BGD A;  5HDN A;  4DW6 A;  4MGR A;  2DMT A;  3NAU A;  4H4K C;  1FY7 A;  3QP6 A;  1IN8 A;  2HPI A;  1CQT A;  2FUG 2;  4PJN A;  4BJ6 C;  1ON1 A;  3HZJ A;  3WGG A;  3SZT A;  4FAS D;  1LNW A;  1N77 A;  1FSH A;  3I3L A;  4KIB A;  2L0K A;  2Q1Z B;  5EEA A;  3FXQ A;  2DBB A;  5HNF A;  3M4O J;  1FOK A;  5B1B H;  4CCN A;  3DWL E;  2HWV A;  4KA4 A;  1SD4 A;  2FNP A;  4RAZ A;  2CG4 A;  4RAG A;  4N9H A;  1XSV A;  2MSY A;  3BPX A;  2X51 A;  3OL3 A;  4KFC A;  2UXN A;  3QU6 A;  4C3I J;  2VXD A;  1ULY A;  1MBE A;  5GTH C;  2P6T A;  5J1U A;  4WWC A;  2DYR H;  4LJZ F;  4ETS A;  2G0E A;  1POG A;  2EFP A;  3JAM Z;  1YIO A;  5H6Q A;  1FYK A;  1ZN2 A;  1TWF J;  4FHT A;  4PSX A;  3PFI A;  5HLI A;  3LSP A;  3X2Q H;  2L7M P;  1HDP A;  1SVL A;  5DM6 F;  3UKG A;  2HS5 A;  2Z3Y A;  1N78 A;  3L2W A;  2X6W A;  3QOD A;  4WXC A;  5JHU A;  3HRT A;  1QZE A;  3FKI J;  2CU7 A;  2PJP A;  3T8R A;  4AU7 A;  4ANJ A;  1REP C;  2F5F A;  3BTC A;  3GCM A;  2R0Q C;  3E0J B;  2DTZ A;  4AD9 A;  4M73 A;  3FBN B;  2STW A;  4S0H B;  1OFC X;  1KQ9 A;  4U0W A;  1B72 A;  2ECB A;  3K1N A;  3S2H J;  2NNN A;  3F8M A;  3V8L A;  2A6E F;  5M5X J;  1P92 A;  5DEQ A;  3T8T A;  1R49 A;  4XLH A;  1BI1 A;  1OYI A;  1E3P A;  2ZJ2 A;  1H89 C;  2F4I A;  5FKO A;  3KP5 A;  4RGX A;  5EEG A;  2R7X A;  2V1U A;  1T38 A;  3BG7 A;  2DA1 A;  1C0W A;  2HTJ A;  3A01 B;  2H1L A;  3CDL A;  1O3R A;  1HDD C;  1B9N A;  1WJD A;  2RNG A;  3GTJ J;  4BNC A;  3BG9 A;  4IHV A;  2V9V A;  4RLQ A;  1YI2 I;  5FKK A;  2G9W A;  2A69 F;  2XPU A;  4IF4 A;  2DPU A;  5J6X A;  4YRV A;  3GTG J;  2XGX A;  3CF2 A;  2I8D A;  4ZZD A;  4Z6Y A;  2X85 A;  4M6V A;  5LGN A;  4BQA A;  3K70 D;  1B9M A;  3LAP A;  2R7T A;  3W3C A;  4B44 A;  3OYG A;  2GWR A;  4A3B J;  2X1E A;  1MZB A;  2BBY A;  3DKW A;  1T33 A;  3CO6 C;  4KIC A;  1O4X A;  1FMW A;  1XCB A;  3PQJ A;  5B3S H;  5FLM J;  3FXU A;  4LFU A;  5D8L B;  1IZ1 A;  1MJA A;  1ZRC A;  1HF0 A;  1IF1 A;  4LG0 B;  3RQI A;  5CKT A;  2UXX A;  2XKP A;  2GXB A;  5AIP A;  3RPU D;  3ZN1 A;  3LSH A;  4BEH B;  4BE0 A;  3UR3 C;  3Q0U A;  4JQF A;  3IRR A;  2HDD A;  1LE8 A;  3OYA A;  4LGW A;  4LB5 A;  2O7O A;  2AQE A;  3OYK A;  3ABL H;  1YIT I;  2HOE A;  2NVY J;  1ZRD A;  3F21 A;  1Y1V J;  5F1J A;  1MBK A;  2H8R A;  2K9N A;  3O3K A;  3ZRG A;  4HEA 2;  4BAY A;  2HKO A;  4BEH A;  2ID3 A;  3HKZ N;  3JRB A;  4EVI A;  4MEX F;  2HNH A;  1X1C A;  2LY1 A;  3N97 A;  3IC7 A;  5F1R A;  3QOE A;  4HV5 A;  1BIA A;  2E5Z A;  4DZP A;  5B1A H;  2CQ7 A;  1QRY A;  3ZQC A;  2X4H A;  3GLX A;  3TP0 A;  3S1N J;  3ZQH A;  5ILV A;  4PDK A;  3KP2 A;  3KFW X;  3RI4 A;  3VEP A;  4WCG A;  2KDZ A;  2JA8 J;  3CLQ A;  1V4R A;  2PMH A;  4A3J J;  4ZDO A;  3VYR B;  1WJA A;  3QP5 A;  3ZMT A;  2YX4 A;  2E7X A;  2G7H A;  2K9Q A;  3Q3S A;  3J81 Z;  1J09 A;  2K40 A;  1MBF A;  2ICW G;  4UUT A;  2BOL A;  2P6S A;  1S7A A;  4B4C A;  4Y7N J;  4M6X A;  4E7J A;  3PO2 J;  3VDX A;  3BR0 A;  2HYF A;  1ZG3 A;  3ZMD A;  1GVD A;  1ZLJ A;  2OC6 A;  3ZXS A;  2E35 A;  3L2R A;  4HDU A;  4QPQ A;  1QHH D;  4XKW A;  2W25 A;  1AA7 A;  4YIR X;  3WGI A;  5DM7 F;  2HOT A;  2K86 A;  4PGG A;  4ENM A;  3WU0 A;  4XLP F;  1WVR A;  3HHG A;  2M45 A;  5EG0 A;  3Q9V A;  5D6E A;  4HST A;  4AWX B;  3PSF A;  3SJM A;  3CZ6 A;  2EZK A;  4ZYA A;  4KT5 C;  3OS1 A;  4CIC A;  3CCY A;  1ETK A;  3WU1 B;  5H20 A;  1VQO I;  2ADU A;  3OYL A;  2IGK A;  4EJW A;  3GTM J;  4I99 C;  4QWQ A;  3W6J B;  4QSH A;  2ESH A;  2VIX A;  1X3W B;  2M30 A;  1OQY A;  4RGU A;  4AYB N;  2BEO A;  2KZG A;  5EGO A;  2DA7 A;  1RRJ A;  4OAY A;  1LB2 A;  4CO8 A;  2R3S A;  3EYY A;  2V6C A;  3IUO A;  5A2Q K;  4A5M A;  2DOF A;  1Z3Y A;  1BA5 A;  2KLO A;  5D4S A;  1Z2Z A;  1U5T B;  1LFU P;  1FP1 D;  4IHY A;  3WOD F;  1Z77 A;  1Y56 A;  3GLL A;  5BMZ A;  5IPA A;  1UHW A;  2LTP A;  1IO2 A;  1X4P A;  3ASN H;  3K1M A;  5IOZ A;  1MSE C;  1BOA A;  3CCV I;  4R8H A;  1U5T A;  4AIK A;  2L9V A;  2IGM A;  4CYD A;  5CVI A;  4JOM A;  4P96 A;  2DXI A;  3VYT B;  1FBU A;  1QHG A;  2VJI A;  3H5N A;  1L0O C;  3ROU A;  2EIN H;  2EIL H;  2DW4 A;  3F23 A;  3BZ6 A;  4UVB A;  3JTG A;  1QA6 A;  3OYH A;  5EZG A;  2HOS A;  1GXQ A;  1ZAO A;  3FM3 A;  4BXF A;  2H8W A;  2PEX A;  5L3C A;  4D1Q A;  3IV5 A;  1FZP B;  4QLC U;  4XNF A;  1ZR2 A;  2ZB9 A;  2NVQ J;  3WE3 A;  1BI2 A;  1VF9 A;  1W7P B;  3LL7 A;  1FYM A;  4L0Y B;  5FGM A;  3S3M A;  4ZZL A;  2Q2E A;  2P8T A;  2HQA A;  3F8B A;  4LIV A;  2DT6 A;  5E18 F;  3CCU I;  4LG3 A;  4M3G A;  5TJJ A;  2LRD A;  4E7L A;  4EGY A;  1X19 A;  3FX3 A;  3R61 A;  4PK4 A;  1UCR A;  3BOQ A;  1VQN I;  2V1X A;  4XID A;  1LDK B;  5DUI A;  3BP8 A;  1DP3 A;  3TDZ C;  2CUE A;  3HRS A;  1FMV A;  4Y15 A;  5LRR A;  1J7K A;  2DTR A;  5E1X A;  1WI9 A;  3F22 A;  3GYH X;  4UV9 A;  2LC2 A;  2YU3 A;  4R1H A;  2ZC2 A;  5KNL A;  1RKW A;  3WU2 C;  1WJB A;  1A31 A;  2DN0 A;  5CVV A;  2A5Y B;  2HXI A;  2LF8 A;  3OYD A;  2M0C A;  2QQ8 A;  4KIF A;  3R0A A;  1TW3 A;  2E7W A;  2CUF A;  3WTZ A;  4AC0 A;  4KIT B;  1MH3 A;  4KIG A;  1YJN I;  2W7N A;  6PAX A;  3PQK A;  2JK3 A;  2M1B A;  1SFE A;  1WHU A;  2V1D A;  4XKB A;  3CC4 I;  1I27 A;  3KP3 A;  5E3M A;  5DD4 A;  4FTH A;  4YEJ A;  3LWF A;  1XGM A;  1BJZ A;  2VJ4 A;  4M6Y A;  5GAH J;  3J80 Z;  1ETO A;  4XIC A;  3ZP5 A;  2P0W A;  3KLO A;  1O57 A;  1O3S A;  1IUF A;  1LVA A;  2VBZ A;  3S1R J;  2D45 A;  2IA1 A;  1P9Q C;  2HOA A;  2FBI A;  1A6Q A;  2YSR A;  1XGS A;  3S14 J;  2JUC A;  2LFB A;  3D0S A;  4UXN A;  4ZJZ A;  1YJ9 I;  1X3Z B;  1X3U A;  3KP7 A;  4Y17 A;  3TL4 X;  4BE2 A;  1EGV G;  1V5F A;  3P5J A;  3LSR A;  3SQN A;  1MMG A;  4RLF A;  1GDT A;  3HOT A;  4CYC B;  1R5I D;  1TL8 A;  2CS3 A;  1FPQ A;  1MMF G;  4RS8 A;  4IXA A;  1SD7 A;  4BY1 J;  1ERD A;  2GXG A;  1LEB A;  3P9K A;  5DTD A;  1VQ6 I;  2FXA A;  2JJ7 A;  4E6K G;  2XC7 A;  4ENJ A;  3MEX A;  5M5Y J;  4ESJ A;  2OZ6 A;  3HTS B;  2IPQ X;  2RV8 A;  1HLV A;  2PG4 A;  4FT8 A;  5FLX K;  3EDP A;  3HG9 A;  2IS6 A;  1UZC A;  5CQG A;  2LLK A;  2F6C A;  3U21 A;  1OYY A;  2BZT A;  2HGC A;  3WTS C;  2GOM A;  3RZD J;  3HPH A;  4OMZ A;  1S5L C;  2OAZ A;  1JGG A;  4J19 A;  4IVN A;  3QPL A;  2IBD A;  3IKV A;  1YRN B;  1UB9 A;  3ULQ B;  2ZJR F;  2PLY A;  4UHT A;  3TQN A;  4GYG A;  2N8G A;  2X6X A;  4IHT A;  4CGZ A;  2PBI A;  3BDD A;  1WFX A;  5ICF A;  5HS9 A;  2TCT A;  5ILS A;  2EV0 A;  1LEA A;  2K5C A;  1GVJ A;  4DNC A;  2M9H A;  5KVR A;  1YLF A;  1S7O A;  2QKM B;  4BS9 A;  1E3O C;  3HRM A;  2COB A;  3WG9 A;  1HKT A;  3FM5 A;  3QQA A;  1EKE A;  4HZF A;  3CDH A;  2CJJ A;  3ECO A;  3DBH B;  4GGG A;  3MKY B;  2HYG D;  2NS8 A;  4O6J A;  2FOW A;  1Y8R B;  2EV6 A;  2XPV A;  4JYK A;  4NB5 A;  2QVO A;  3BLY A;  1VQ9 I;  4ON0 A;  3MZ8 A;  1HC8 A;  1K61 A;  2QEX I;  3OR2 C;  1A6I A;  2OU2 A;  4AVZ A;  3NWT A;  1LVK A;  1JKQ C;  2E71 A;  3MKL A;  1V5G A;  3CES A;  5L3G A;  3PO3 J;  1EH6 A;  2CQK A;  2HZD A;  3CP2 A;  5LRS A;  3GTL J;  2CQX A;  4JX5 A;  2L9S A;  4M9S A;  5K5R A;  1V5E A;  1I3Q J;  4EMS A;  9ANT A;  1V54 H;  3ZQQ A;  2R5Y B;  3WTY C;  1I3A A;  3CC2 I;  4G7H F;  2R5Z A;  3GTK J;  2P4W A;  3S16 J;  2F4O B;  4XR6 A;  4Y13 A;  2VLA A;  5HDK A;  4ESB A;  1A36 A;  2IW5 A;  3Q0W A;  3WHC A;  3ONQ A;  1HBX G;  3DPL C;  1PUE E;  1WJ5 A;  1KU7 A;  3U1D A;  4IRG A;  2CV1 A;  2VPR A;  2XVC A;  3O2P E;  1BOB A;  3BY6 A;  1U3E M;  2Y31 A;  1JHF A;  1FOY A;  2RDP A;  3OIP A;  1I1G A;  4U87 A;  3GO5 A;  1KA8 A;  1Z7U A;  4G8X A;  1APL C;  4DYC A;  3HM5 A;  5B66 C;  4X6A J;  3P9I A;  3OYJ A;  4FE4 A;  3HPG A;  1Y8Q B;  5FKN A;  1I6H J;  3H0D A;  3VFZ A;  1BR1 A;  4OIR F;  1G3Y A;  2P5K A;  3KZZ A;  3ELK A;  3ZQL A;  3ERE D;  5IP7 J;  2VOO A;  2HYJ A;  3TW7 A;  4E7H A;  3HKZ A;  1JE8 A;  5KAI C;  2R7F A;  5HS8 A;  4CCM A;  5L3F A;  4G7O F;  1YW8 A;  3GVA A;  5L3B A;  4BU2 A;  4E4H A;  1BW5 A;  3I64 A;  3BR1 A;  4LK0 F;  1S7E A;  3J7A O;  2I10 A;  4GCV A;  4PZJ A;  2CGP A;  2JA6 J;  4EQQ A;  1GV2 A;  2JA5 J;  2M5W A;  4L9T A;  2X48 A;  5F0H A;  4IOA F;  2HQR A;  1U6G A;  2DA2 A;  1NTC A;  2BVL A;  1T0F C;  5FRN A;  4CA0 A;  1B1B A;  5K5Q A;  5C4J J;  1TQI A;  3ABK H;  3HTU A;  2D2W A;  5F0F A;  2HQ5 A;  3DXJ F;  1K6O A;  5JLW A;  1S3J A;  3LSJ A;  2BHZ A;  4MTE A;  4OIQ F;  1IXR C;  2LBF A;  2DYS H;  3DLL F;  2E36 A;  4NBQ A;  3DPT A;  5EEH A;  4A3C J;  1YJW I;  1FBS A;  2QEN A;  3K4L A;  4UUS A;  3HGY A;  2ZJQ F;  1FIA A;  2ZFU A;  3CCS I;  3E3V A;  5D5X B;  4XQF A;  4XK4 A;  4B3A A;  4AID A;  5CJ9 A;  1H8A C;  2X6O A;  1BI3 A;  4CDG A;  4KNY A;  1R00 A;  4C2T A;  4OIP F;  4NDL A;  5GPC A;  1WPK A;  5IYD J;  4MFE A;  3BWG A;  3H35 A;  2EZI A;  5E8I A;  4S04 A;  5J1R A;  1IRF A;  2DQL A;  4V2F A;  4L9J A;  3WGH A;  1MBH A;  4S05 A;  2XPW A;  2VE8 A;  2HFH A;  4XRM A;  3ABT A;  3E6B A;  4OIO F;  1ZH5 A;  3S15 J;  3FXO A;  1VTN C;  3I54 A;  1FWZ A;  1XN7 A;  1IUY A;  2E2H J;  3P7N A;  2A6T A;  3BR6 A;  1RPW A;  2V26 A;  3PFY A;  4HQE A;  1R71 A;  1B8I B;  2JZY A;  5J47 A;  4O3M A;  2K9L A;  1YOV B;  4G6Q A;  4HX7 A;  3DKY A;  3CJR B;  2ZKZ A;  1JXS A;  4PJJ A;  2KMU A;  4FX0 A;  2BY0 A;  1B8I A;  3OSG A;  2XAG A;  4GXO A;  3L2Q A;  1XG1 A;  2RAE A;  3G3Z A;  3MKW B;  2M8G X;  3KZI C;  4J01 A;  2Z2S B;  4HSR A;  3PL8 A;  3VYU B;  3AAF A;  3GX4 X;  2M34 A;  1E2X A;  1TNS A;  1G2H A;  1K7A A;  2DU9 A;  5D6F A;  2W82 A;  3KZY A;  4UV8 A;  4L5I A;  4HRI A;  5KK1 A;  2IRF G;  2DA6 A;  2O0Y A;  3W2W A;  3V7S A;  1ORK A;  2DQR A;  5E3L A;  2Y75 A;  2P7C B;  3FXJ A;  4C2M J;  3W2V A;  3ZN0 A;  3LSK A;  3OYC A;  3CCL I;  2RGV A;  3IAM 2;  1DU6 A;  4PJM A;  1XGN A;  3COA C;  4DGW B;  1A35 A;  1IN6 A;  1K79 A;  1YTY A;  2LKX A;  1U78 A;  2X1C A;  3FMS A;  1IN4 A;  5KAF C;  5J8F A;  2GA2 A;  2L01 A;  1MGT A;  3QPS A;  1G4D A;  1BM9 A;  1W5T A;  2WWY A;  2L9R A;  1PVE A;  1X1A A;  3QU3 A;  2WTE A;  4ITV A;  3H1C A;  1O3Q A;  1HST A;  3AL0 C;  2YUS A;  4XON A;  1QGP A;  3K4N A;  4M3F A;  5IY5 H;  3V4G A;  5LHI A;  3J7Y J;  1LQ1 A;  1NG7 A;  1TWH J;  3PUB A;  5AIQ A;  1G3T A;  1M1E B;  1YO5 C;  3MVP A;  2G7U A;  1MD0 A;  4IX7 A;  4G12 A;  4D7M A;  3WTU C;  1XDU A;  2IGN A;  3JW4 A;  2KZV A;  5BOX A;  2LH9 A;  4A6E A;  4HX8 A;  2VJ5 A;  5M3M J;  4RMN A;  2HKX A;  4A2U A;  4IO9 F;  5GAG J;  2HVQ A;  2PI0 A;  4DBR A;  1DP7 P;  2AO9 A;  2Y0S N;  1ON2 A;  4NC6 A;  3AUJ G;  3KCC A;  2O61 A;  1VFC A;  1HW5 A;  2R7Q A;  3IAS 2;  4YFK F;  2DDA A;  1J0R A;  2M8E A;  3K4J A;  3OOP A;  3M1E A;  1IRX A;  3KEY A;  3RTR A;  2VKV A;  4KDP A;  2DFI A;  2R92 J;  4U0Y A;  4UUV A;  4DZJ A;  1IXC A;  3M9A A;  2ME0 A;  3FWE A;  1HW1 A;  4I7H A;  2BXY A;  4Q4Z F;  2M0M A;  1FSE A;  5CLS A;  1XSX A;  1RZ4 A;  2L4A A;  4N4O B;  3ZQI A;  3OYM A;  1JTX A;  1S8N A;  1TT5 B;  3DF8 A;  2CWE A;  4LB6 B;  3FZV A;  3TOA A;  3TP3 A;  3ZQ7 A;  4QIW N;  1USS A;  3A01 A;  2DK5 A;  4ABZ A;  1Z7L A;  4XLF A;  4A0X A;  1R1T A;  1ZGW A;  2E1M B;  4CHU A;  5F04 A;  4CZZ A;  4WXH A;  3HOY J;  5GAD J;  3VSK A;  3WTV C;  1E3H A;  2OTL I;  1BN5 A;  3E6D A;  3JRG A;  3HB9 A;  1XC5 A;  1D8J A;  4XOP A;  4M72 A;  1QVU A;  1XMA A;  4XLN F;  4GRI A;  4EEF G;  5C44 J;  3KYD B;  1YG2 A;  5IYB J;  4A6D A;  1U8R A;  2F48 A;  4GFB A;  2Y9Z A;  3JRH A;  2RN7 A;  2WC2 A;  3HJE A;  4Q48 A;  3BJO A;  1RET A;  3HSF A;  4V2G A;  3VYS B;  4KN4 X;  1BC8 C;  2ZO4 A;  3TMO A;  2IS4 A;  5C3E J;  2L2O A;  5D5U B;  4LG0 A;  3ZOB A;  3I9V 2;  4ZC3 A;  4FQG A;  2EV5 A;  2P7V B;  1S9H A;  2AXT C;  1CGP A;  2F4M B;  2IJL A;  1BI0 A;  2IS2 A;  2VBW A;  3H9Q A;  2JPC A;  4H0E A;  3FKJ A;  2IAI A;  2OF7 A;  2XIG A;  3K4K A;  1UEL B;  2AXL A;  1QNT A;  1XB4 A;  2ELH A;  2Y0M A;  3FMQ A;  5F0C A;  5K7F A;  2W48 A;  4Z2Y A;  1TZL A;  2FEZ A;  4CSW A;  1BR2 A;  3S17 J;  2VOD A;  2BHY A;  2HR3 A;  1AKH B;  2CH0 A;  2FE3 A;  2JA2 A;  4DYQ A;  1FYL A;  3K9T A;  2O8K A;  2KRH A;  2VKD A;  3CMM A;  2DI3 A;  1KU2 A;  3EUH C;  4D9J A;  3W6V A;  4RB2 C;  1T0F A;  3CUQ C;  3MD2 A;  2OJE D;  2ELJ A;  1TLH B;  4UNO A;  4EM0 B;  3HHH A;  3GFM A;  3MKZ A;  1O3T A;  2EA2 A;  4CCK A;  3SZG A;  3E5Q A;  2D1H A;  4RDU A;  3FDY A;  4MEY F;  1R7J A;  5K5O A;  5HLT A;  1SMY F;  5D5W B;  3FIW A;  2B0L A;  3K2A A;  1DUX C;  3S3N A;  2MG4 A;  2W84 A;  3ZGK A;  2VE9 A;  5B5E C;  4M9X A;  5HDG A;  1OPC A;  3KE2 A;  3V8K A;  1X1B A;  2M2E A;  2CW7 A;  1TTY A;  3A4C A;  4Y4R A;  1UG2 A;  1Z91 A;  4IHW A;  1YE9 A;  2JSC A;  2TRT A;  5M3F J;  5J4V A;  1PP7 U;  2WV1 A;  1N75 A;  1FP2 A;  1RR7 A;  2YX7 A;  1AHD P;  2VI6 A;  3CMA I;  1QO0 D;  2XF6 A;  4J00 A;  2KFD A;  2R7S A;  2ZSI B;  2UV1 A;  5IT9 K;  3IH3 A;  5JLX A;  4I98 B;  1NH3 A;  1BW6 A;  1R36 A;  3FIS A;  2ZBK A;  3LQR A;  3OY9 A;  2JMW A;  2A5W A;  1YHQ I;  3M07 A;  4P9F A;  4AIH A;  3I71 A;  3HXL A;  1ZRE A;  4XLA A;  2MC3 A;  1RC9 A;  2QQA A;  3JTH A;  3PNY A;  2K4J A;  3C7J A;  5ICE A;  1JKR C;  3HOV J;  4E7S A;  1DU0 A;  3SEQ A;  2DPD A;  1D3Y A;  2H27 A;  1X58 A;  2KIF A;  1A5J A;  1VQM I;  3GW2 A;  1FNN A;  2R7Z J;  4BBS J;  2GOX B;  5ED4 A;  2DK8 A;  4U7B A;  3KET A;  3K4B A;  2K9S A;  4LMY A;  3PIO F;  2DT5 A;  3OYE A;  2QA4 I;  1K78 B;  4ZH4 F;  1WJE A;  2OUM A;  5FFZ A;  2KT0 A;  2EH3 A;  3K10 A;  4XLC A;  3B73 A;  4E7K A;  1VQP I;  4OOI A;  1FLI A;  4PJ0 C;  2Q8K A;  1ZK8 A;  2JVG A;  1SD6 A;  1JKO C;  2ZXH A;  1JJ8 C;  2A61 A;  3KYC B;  2L7F P;  3D5L A;  2EZL A;  1SMT A;  4XOR A;  1BIB A;  1JKP C;  2XKO A;  4I2O A;  4KUM A;  1SAX A;  4A3D J;  3GWZ A;  5E1W A;  2JRT A;  2X6Y A;  3OSF A;  1KQ0 A;  2V7F A;  1W7P A;  4XMY A;  2KIU A;  4B43 A;  3G4S I;  4YEL A;  3AL0 B;  4A3I J;  4E7I A;  2W85 A;  1T6S A;  1WGX A;  2DJN A;  1D1C A;  2AQF A;  3LOC A;  1EV7 A;  4PCQ A;  3BR2 A;  1W0T A;  1QVT A;  3CQZ J;  2DMN A;  2IXS A;  3H5R A;  2CMP A;  1LJ9 A;  4C3H J;  1BR4 A;  4FE7 A;  1QU3 A;  2XUB A;  3DQV C;  2EWN A;  1TT0 A;  4IHX A;  5A2Q Z;  4LD5 A;  1P4A A;  3QYF A;  4BDZ A;  2NNY A;  3BR3 A;  2K3F A;  4I0B A;  3BG5 A;  1N25 A;  5LGT A;  1D0X A;  1LPQ A;  2QSF X;  2E34 A;  4HYE A;  2D5V A;  2H09 A;  3DPU A;  3JSP A;  2GQQ A;  1YS6 A;  2BW3 B;  4HV6 A;  3IWZ A;  1EH8 A;  1GHC A;  3L00 A;  3HDD A;  3I4P A;  2KRF A;  2HU9 A;  3LFK A;  2EA4 A;  1W0U A;  1E0E A;  1MMD A;  4RB3 C;  1J75 A;  2GXA A;  4LK1 F;  1SFK A;  4C3J J;  2XRO A;  5E1Z B;  3K0L A;  4BKX A;  4UVC A;  3R60 A;  1H9G A;  2QLZ A;  3IH4 A;  3LA7 A;  3P9C A;  3HOX J;  4EJT A;  1IRZ A;  2RVC A;  4ZYH A;  3L2V A;  3BZK A;  2GLO A;  2NYX A;  2E1N A;  3DLA A;  1NHA A;  3ASO H;  5C4X J;  1LFB A;  5FKM A;  2ECC A;  2XSJ C;  2K85 A;  2RNJ A;  2KJC A;  3WHB A;  3H92 A;  2COM A;  2DA5 A;  5D5V B;  2ACJ A;  3JRC A;  3S2D J;  4BH9 A;  4EJO A;  3OS2 A;  3DTE A;  4Q47 A;  4KYW A;  4BHB A;  3ESW B;  3GTQ J;  4LOC A;  2PQ8 A;  4CYC A;  4RB0 A;  3M8E A;  1GT0 C;  4G7Z F;  4FIS A;  5LHG A;  2HPM A;  1R5G A;  1AWC A;  2DA3 A;  2NOJ B;  2Y2Z A;  3BQZ A;  1SAU A;  3WE2 A;  3E1S A;  4AUX A;  5LLQ A;  4HLY A;  2E60 A;  1SEU A;  1SC7 A;  4JBA A;  3BRO A;  2H6C A;  2XSD C;  3RKX A;  3FXR A;  3HOS A;  1MMA A;  2NRA C;  5KCM A;  3T5X A;  2VKH A;  4XM3 A;  4EM1 A;  3M8F A;  5ICC A;  5EDN A;  2M3A A;  2EFW A;  1STZ A;  4IQ4 A;  2ZXJ A;  1MBJ A;  3AG4 H;  3F8F A;  4HNV A;  4XSX F;  4G6D A;  3RCO A;  3K6G A;  3Q5F A;  5M5W J;  2M7A A;  1ZYR F;  1I5Z A;  4A5N A;  3TOB A;  3FHZ A;  2M4K A;  4IKF A;  4NNJ A;  2JUG A;  3C2H A;  4X1E A;  3PM1 A;  2BE5 F;  3M8J A;  5DCM B;  3E5X A;  1YRN A;  2UZK A;  1TWC J;  2Y0S A;  5DS9 A;  2O9L A;  1PYV A;  3I0T A;  2EPF A;  4DBQ A;  1W5C C;  2LOO A;  3M7G A;  1W5S A;  4RAF A;  3QPT A;  2M87 A;  2BYV E;  4F55 A;  2HDC A;  2VON A;  5GPA A;  2NXN B;  5CVU A;  2LNB A;  4JX6 A;  2MLG A;  2QQ9 A;  2QSH X;  2J5P A;  1MMN A;  2OTJ I;  1NK3 P;  1Z21 A;  1J5Y A;  2QGU A;  3FF5 A;  3W2A A;  3GBG A;  2VPL A;  4N0B A;  1XDS A;  3I53 A;  4ZTF A;  3CLO A;  5FB2 A;  1D5Y A;  1I6X A;  2F5C A;  1OCT C;  1Z6R A;  2NS0 A;  1TW2 A;  2OZU A;  2BY2 A;  2PMZ N;  4A0Z A;  3H3Z A;  3BTI A;  1WSU A;  3RPU A;  2E1C A;  1Z0X A;  2DFE A;  3CUQ B;  2R7W A;  2V79 A;  3PNV A;  3ZPL A;  1IXS B;  2FQ3 A;  2HZT A;  1DGW Y;  5D4R A;  5FLX Z;  3MWM A;  2DA4 A;  2VL8 A;  4RB1 A;  3DTI A;  2JPB A;  1GLN A;  5E8G A;  2CRG A;  3PSI A;  2ME6 A;  2E1M C;  3DCF A;  1JUM A;  1ZAR A;  5IT3 A;  4O5V A;  1Q1H A;  4A0Y A;  2R5Y A;  1Y6I A;  3S1M J;  3OYB A;  2NVX J;  1EEX G;  4A3G J;  2AHQ A;  5JHF A;  1WZ2 A;  2DMP A;  3NWS A;  5HS7 A;  1FOW A;  3DV8 A;  2K02 A;  3I55 I;  1SFX A;  1VZ0 A;  4HQM A;  2QF7 A;  3FBI B;  2KRC A;  3LSM A;  2KIM A;  4M74 A;  1GXP A;  1MKM A;  2WA0 A;  3DEW A;  4XL9 A;  5CQE A;  1G8X A;  2FMY A;  3FMR A;  3S2W A;  5TIS C;  1XMX A;  4HX4 A;  3OL4 A;  3CJQ B;  2NS7 A;  3L7W A;  3F0C A;  1O7L A;  1Z67 A;  1Z3X A;  2FNA A;  3OIQ A;  2EIJ H;  2VN2 A;  1ZR4 A;  1HCR A;  3W6K B;  4XLE A;  2R93 J;  4BE1 A;  4IRI A;  1FBQ A;  5ICG A;  2O8X A;  1QZY A;  3OMY A;  2RKH A;  3I4N J;  2V9P A;  4M3B A;  4PJL A;  4XRF A;  4LLG F;  3DTK A;  2FA5 A;  1TQP A;  1T98 A;  3FHN A;  2IEK A;  2V6E A;  2QBY B;  1P4W A;  1DDN A;  3O8G A;  5GTI C;  4LIT A;  2L7K A;  4F91 B;  4A3M J;  1XGO A;  2OD5 A;  4HF0 A;  1IC8 A;  2FX0 A;  5IP6 A;  3AKZ A;  2UWM A;  3I4M J;  1WWX A;  3NAR A;  4OMY A;  1RUO A;  3OYN A;  4LLN A;  3BR5 A;  2M4G A;  4Y52 J;  4ZYD A;  3ZQF A;  1BC7 C;  3CDI A;  3E5U A;  1FJL A;  2QKL B;  3K7A J;  1T08 B;  1FTZ A;  2W1O A;  3LSG A;  5FRM A;  4P5O A;  3U9G A;  1UHM A;  2K3P A;  3LMM A;  1ITY A;  1ENH A;  3CJT B;  1W36 C;  5GAE J;  2EFQ A;  5J1Y A;  3H3U A;  4UY8 I;  1H0M A;  1WJC A;  3J7Z I;  1ACI A;  1K4S A;  1WH7 A;  3JCU C;  4XOT A;  1F4K A;  1ZHF A;  1VQ4 I;  3ML6 A;  2B7E A;  2ISZ A;  5F08 A;  3VB2 A;  2PFB A;  4BXX J;  2CYY A;  2OA4 A;  3ABU A;  4WXD A;  4Y3O A;  5E79 C;  1TP4 A;  3L2C A;  4BJT A;  1DQU A;  4R79 A;  2VKE A;  3GTP J;  3HUG B;  3HIF A;  3ERM A;  2OQG A;  5EZH A;  3PUF A;  3R0J A;  4MLO A;  3CO7 C;  2LD5 A;  2QZ8 A;  3RKW A;  1TC3 C;  3PJR A;  3CME I;  5D8K B;  3L1P A;  4ZDL A;  3BC8 A;  2FML A;  2EK5 A;  4D5C A;  1K6Y A;  3G6E I;  2KQR A;  3HYI A;  2EFN A;  3QRF F;  4HOB A;  4A69 C;  1XMK A;  3A0B C;  2XF7 A;  5TGT A;  3RIR A;  4M3E A;  4HA8 A;  2VAS A;  2NVU B;  1WKM A;  2PJR B;  1CF7 B;  2RQQ A;  1XCV A;  3HOW J;  2KDO A;  5EF6 A;  2WB1 N;  2DMU A;  5GP9 A;  2VXZ A;  3TO6 A;  3JAM K;  2NAZ A;  3VPR A;  2DMQ A;  1EJ9 A;  3SFI A;  2WAF A;  2CQQ A;  1OJL A;  2KL4 A;  1JTY A;  2IVM A;  3TED A;  4B09 A;  1MW7 A;  1RR8 C;  3CC7 I;  3IWF A;  1HW2 A;  3TKY A;  4D0P A;  3BT9 A;  2LY2 A;  5JI6 A;  3J7A Y;  1IN7 A;  2ESN A;  3ZMS A;  4FCY A;  1ZQ3 P;  1FIP A;  2WY8 Q;  4HDV A;  4EAT A;  2DJI A;  3E7L A;  3H36 A;  2CV0 A;  4XRS A;  2F2E A;  1D0Z A;  3KEO A;  3TO9 A;  4PGH A;  2KKO A;  2W00 A;  4MIM A;  3RZO J;  2R7R A;  2MH9 A;  3TDU C;  1UC5 G;  1YS7 A;  2FRH A;  1YX3 A;  3HC7 A;  3I5U A;  1R22 A;  1R5H A;  2QUF A;  2ZME C;  3AFH A;  5K1Y A;  2DT7 B;  5LEJ A;  1VQK I;  5LD2 C;  4B48 A;  1MMS A;  2WAQ N;  1D1B A;  5DD8 A;  3S93 A;  3HSR A;  2L54 A;  3WTW C;  2FSW A;  1ETV A;  4RGR A;  2P5L C;  5TRD A;  1W7P D;  2V1N A;  3LST A;  1I50 J;  4B1R A;  4UB6 C;  3WTX C;  1R4N B;  4CUG A;  4LIU A;  2H94 A;  3ISP A;  2AS5 F;  2WV0 A;  3BQY A;  2WBM A;  3CP8 A;  2QQB A;  2WY7 Q;  4CCO A;  4DQ2 A;  3KPH A;  1ZRF A;  3BTJ A;  4II3 A;  4A3L J;  3R4K A;  4XKV A;  2FJ1 A;  3QYE A;  3AG2 H;  2E5N A;  1WRJ A;  2BY1 A;  4JP0 A;  2DOA A;  3IKT A;  3OV8 A;  1VQ5 I;  1KYW A;  1OCC H;  2Y69 H;  1OIS A;  3H0G J;  2OBP A;  4RGS A;  2EZH A;  1ZG5 A;  1OCR H;  1VQL I;  4OAZ A;  3C1D A;  4DYR A;  3JRI A;  1KYZ A;  1BJA A;  2EIM H;  2VQG A;  1MH4 A;  4GDF A;  2V4J C;  2ZSH B;  1U9N A;  4HF1 A;  5CPR B;  4MQV A;  4XN3 A;  2MLK A;  1ZKG A;  1H88 C;  5BQT A;  2GZW A;  2QCO A;  5HLH A;  2EB7 A;  3D1N I;  2GIZ A;  3OR1 C;  2Z99 A;  4NUB A;  2CFO A;  3FXL A;  4L9N A;  1B72 B;  4P1W A;  1K83 J;  4HLX A;  1P6R A;  3DBL B;  3SDG A;  4HG2 A;  1IV6 A;  1VQ8 I;  2KHM A;  2IA2 A;  1LDJ A;  1YX5 A;  3N4M A;  2LDU A;  3OIO A;  1R58 A;  1UAA A;  5F27 A;  2YPR A;  2IT0 A;  2X0L A;  3JSO A;  4DJA A;  1F1Z A;  3V42 A;  1IDY A;  3OWT A;  4FX4 A;  1WI3 A;  5FD6 A;  3Q9S A;  3KX2 A;  1HKQ A;  2XRL A;  3SYT A;  4G6T B;  2GM4 A;  1IJW C;  5HOO A;  4E70 A;  1RI7 A;  2LK2 A;  4D5F A;  1YW7 A;  1SD5 A;  3K1P A;  2FU4 A;  3UNG C;  4ZTJ A;  1IN5 A;  1KU9 A;  3A03 A;  3TO7 A;  1S29 A;  3LFU A;  2JA7 J;  2JSP A;  2EBI A;  5K7Z A;  3SHF A;  2R7V A;  2VUM J;  3VWB A;  1G6N A;  3I59 B;  4BBR J;  4ENN A;  1ODD A;  1NG6 A;  2LR8 A;  3L2U A;  3MAJ A;  1HXD A;  4MHG A;  2L9N A;  4IOC F;  3QYB A;  2JQ7 A;  3K70 C;  4WK8 F;  1OLT A;  1D1A A;  1S6L A;  2PN6 A;  4XSZ F;  1Z1D A;  1JUS A;  2FBK A;  2GA1 A;  3I59 A;  3J81 K;  3G1L A;  1BBY A;  3NRV A;  3TW6 A;  1OYW A;  1B6A A;  1V3F A;  2ZFW A;  1IWB G;  1ZTR A;  3BTL A;  3GZ6 A;  1QQI A;  5HVQ C;  5HOD A;  4F52 A;  4DOZ A;  2VC0 A;  4ZDP A;  1RUN A;  5FD5 A;  1T56 A;  1XD7 A;  1G3S A;  2LYC A;  4ZYG A;  1Y39 A;  1YYV A;  3U1K A;  2MFZ A;  4BHP A;  4W97 A;  1F43 A;  3EUA A;  1HOM A;  1WJF A;  1LKX A;  3S1Q J;  5J3L A;  5FRO A;  1DPR A;  1MIJ A;  4IJA A;  2PMZ A;  2HVR A;  5DYM A;  1RES A;  3GF2 A;  5ERI A;  2GBY A;  1Y1W J;  2X9D A;  4EJV A;  1RIO H;  2LY9 A;  2CW8 A;  1LE8 B;  3L9F A;  2FOK A;  3B6C A;  1LUJ B;  3C2G A;  4ENK A;  3BCA A;  3NEU A;  4QPO A;  3OYF A;  1FEX A;  2M7B A;  2JT1 A;  2QSG X;  1EF4 A;  4BUP A;  2VOP A;  1ETQ A;  2ELK A;  4U88 A;  1RNL A;  3EUK L;  5FJ8 J;  3HBL A;  3BJ6 A;  1A04 A;  5EJC A;  1F36 A;  2DCE A;  5FO5 A;  2MH2 A;  3DFG A;  1AKH A;  3HOZ J;  1MBG A;  3R6S A;  3ZMV A;  1P4X A;  3QAH A;  3RDI A;  3V7R A;  2O03 A;  3FXM A;  1XX5 A;  4D7N A;  4YII A;  3F6O A;  2RQP A;  4E7Z A;  4HAM A;  2FD5 A;  3CCE I;  3GFJ A;  3RYP A;  2P81 A;  2E2I J;  3F9K A;  2DLL A;  3H3V K;  2VBY A;  2VT2 A;  5CVR A;  5LEK A;  3O8H A;  4I0A A;  1IGN A;  3JRD A;  2V9K A;  4IEJ A;  3MZH A;  5DUK A;  2LKP A;  2Y48 A;  5H6R A;  3DU6 A;  2HEO A;  4RM2 A;  2F5V A;  5JFR A;  2HVS A;  1I1S A;  2DFH A;  5HNH A;  1X2M A;  3ABM H;  3FK6 A;  1R1U A;  3HOU J; 
#chains in the Genus database with same CATH homology
 1N78 A;  3L2W A;  4C2U A;  4BQO A;  2HPM A;  1OR7 C;  3M1C A;  2X6W A;  2Z1D A;  3QOD A;  2NOJ B;  1SAU A;  2IGO A;  1PJR A;  3E1S A;  2BVL A;  1T0F C;  4AU7 A;  4CA0 A;  2E60 A;  5FRN A;  4ANJ A;  3E0J B;  2VB6 A;  3FBN B;  3HOS A;  1MMA A;  4PSW A;  2LBF A;  5KCM A;  2VKH A;  3DPT A;  4XM3 A;  2M3A A;  3K4L A;  4IQ4 A;  2ZFU A;  3RCO A;  3K6G A;  4XLH A;  4XQF A;  2M7A A;  3EPZ A;  4IKF A;  1X1D A;  2M4K A;  4NNJ A;  2JUG A;  3C2H A;  2F4I A;  3M8J A;  4C2T A;  2R7X A;  2Y0S A;  3BG7 A;  1PYV A;  2UUZ A;  3H35 A;  4DBQ A;  2LOO A;  3OOU A;  4PFP A;  3ZCO A;  4F55 A;  1WJD A;  2RNG A;  1MMN A;  4RLQ A;  2O5R A;  1Z21 A;  3W2A A;  3GBG A;  4YRV A;  2VPL A;  3CF2 A;  2I8D A;  2A6T A;  2X85 A;  2V26 A;  3PFY A;  4ZTF A;  3K70 D;  2K9L A;  3W3C A;  3MMY B;  4B44 A;  4N4N B;  3OYG A;  2R7O A;  3DKY A;  3CJR B;  2X1E A;  1HA8 A;  4PJJ A;  2KP6 A;  2KMU A;  2Q2E B;  3BG6 A;  4XKC A;  3L2Q A;  3IP4 B;  2R7W A;  2XAU A;  3PNV A;  3MKW B;  1FMW A;  2XF5 A;  3SDB A;  2Z2S B;  4J01 A;  4HSR A;  3PL8 A;  3VYU B;  1EGM G;  1DGW Y;  4B47 A;  2VJJ A;  2VL8 A;  3DTI A;  1GLN A;  2ZXI A;  2W82 A;  3PSI A;  2E1M C;  5CKT A;  4HRI A;  1Y6I A;  3RPU D;  2WB1 A;  3W2W A;  3OS0 A;  3OYB A;  3LSH A;  4BEH B;  4BE0 A;  3UR3 C;  1EEX G;  4JQF A;  2W4S A;  3W2V A;  5JHF A;  2LG4 A;  3LSK A;  3OYC A;  3NWS A;  2AQE A;  3OYA A;  1U0J A;  3OYK A;  4C30 A;  3H9J A;  3IAM 2;  4PJM A;  1VZ0 A;  3SEZ A;  4DGW B;  3ZRG A;  4HEA 2;  3FBI B;  4BEH A;  2KRC A;  3LSM A;  2X1C A;  4PFO A;  2HNH A;  2LY1 A;  2WA0 A;  1X1C A;  2L5Q A;  4XL9 A;  1G8X A;  5CQE A;  1R6R A;  3QOE A;  2BW3 A;  2CUZ A;  2E5Z A;  4BQQ A;  3OL4 A;  3CJQ B;  4NQW B;  1Z3X A;  2WAD A;  3OIQ A;  1X1A A;  4ITV A;  4XLE A;  4BE1 A;  3AL0 C;  2R4G A;  4II2 A;  2WAQ A;  3OMY A;  4ZDO A;  4XON A;  3VYR B;  1WJA A;  4HNT A;  4PJL A;  3K4N A;  1J09 A;  2WAE A;  3LSI A;  1NG7 A;  3PUB A;  3DTK A;  3BCB A;  4FET A;  4BAC A;  2BOL A;  4E7J A;  3FHN A;  4PUS A;  3VDX A;  4IX7 A;  2K9M A;  2V6E A;  2JVH A;  3RSN A;  2OC6 A;  3ZXS A;  2IGN A;  3L2R A;  4LIT A;  4QPQ A;  2KZV A;  1QHH D;  4XKW A;  2L7K A;  2LH9 A;  1AA7 A;  4F91 B;  2VJ5 A;  4RMN A;  2XDV A;  3AKZ A;  2UWM A;  3OYN A;  3H5A A;  2HVQ A;  4HST A;  4BJ5 C;  3A2K A;  2M4G A;  3PSF A;  3CZ6 A;  1EA3 A;  4ZYA A;  4BQN A;  4C9Y A;  4DBR A;  3OS1 A;  3AUJ G;  2QKL B;  2W1O A;  2IGK A;  3LSG A;  4P5O A;  3OYL A;  5FRM A;  2R7Q A;  2K3P A;  3IAS 2;  1DIO G;  3LMM A;  1W36 C;  2VIX A;  2VQC A;  3H9G A;  1WJC A;  3K4J A;  3ZR8 X;  4F3Q A;  1IRX A;  4OAY A;  3KEY A;  4CCJ A;  3RTR A;  4XOT A;  3OYI A;  1KON A;  3IUO A;  2BVM A;  1Z3Y A;  2KLO A;  4Y3O A;  4NC8 A;  1Z2Z A;  2M0M A;  4BJT A;  1DQU A;  4R79 A;  3HUG B;  3OYM A;  4N4O B;  1Y56 A;  2R7U A;  1X4P A;  3DEE A;  4MLO A;  1Z7L A;  4XLF A;  3DKX A;  1ZEL A;  2E1M B;  3PJR A;  5LFA A;  2IGM A;  2DXI A;  4JOM A;  4ZDL A;  3VYT B;  3BC8 A;  1QHG A;  2VJI A;  3H5N A;  3VSK A;  3VSL A;  1K6Y A;  2KQR A;  4CH7 A;  4XOP A;  2XF7 A;  5TGT A;  4CZC A;  3OYH A;  4GRI A;  2VAS A;  2Z16 A;  2PJR B;  4BXF A;  2RQQ A;  4D1Q A;  4IQJ A;  1LFP A;  2KDO A;  4XNF A;  2VXZ A;  1MND A;  3LL7 A;  2KPM A;  5KHD A;  2RRE A;  3S3M A;  2WAF A;  2KL4 A;  2HQA A;  4LIV A;  2DT6 A;  4LG3 A;  1MW7 A;  2LRD A;  4E7L A;  1X19 A;  4PK4 A;  1UC4 G;  3VYS B;  2MYS A;  2LY2 A;  3TMO A;  3J7A Y;  4HNU A;  4X0G A;  2IS4 A;  2L2O A;  2WY8 Q;  4EAT A;  2DJI A;  1LDK B;  1DP3 A;  2CV0 A;  1D0Z A;  3I9V 2;  4ZC3 A;  2W00 A;  1S9H A;  2R7R A;  4IZZ A;  1FMV A;  2MC4 A;  1UC5 G;  1YX3 A;  3HC7 A;  3S32 A;  2IS2 A;  3H9Q A;  3S3O A;  3AFH A;  2DT7 B;  2R7T A;  3FKJ A;  3K4K A;  5LD2 C;  1UEL B;  4B48 A;  2LC2 A;  1D1B A;  5KNL A;  3S93 A;  4KIS A;  1WJB A;  1TZL A;  4CSW A;  4KT6 A;  1BR2 A;  2VQH A;  3OYD A;  2MD0 A;  4CCL A;  2CH0 A;  2JA2 A;  2V1N A;  4KIT B;  2KRH A;  2W7N A;  2VKD A;  3CMM A;  4CUG A;  4LIU A;  4F93 B;  3EUH C;  4D9J A;  2WBM A;  3CP8 A;  4XKB A;  1D0Y A;  2X1D A;  2WY7 Q;  3MD2 A;  2ELJ A;  4CCO A;  1G59 A;  4YEJ A;  2VJ4 A;  3MKZ A;  3KYL A;  2P0W A;  4CCK A;  4II3 A;  3SZG A;  4Y33 A;  4XKV A;  2MAB A;  3FDY A;  3K4C A;  3QYE A;  4DIQ A;  2E5N A;  1P9Q C;  5HLT A;  2DOA A;  3DU5 A;  2CV2 A;  3TBI A;  4ZJZ A;  3S3N A;  4BE2 A;  3TL4 X;  3ZGK A;  1T95 A;  1EGV G;  1V5F A;  4OAZ A;  1MMG A;  4RLF A;  3S8P A;  3HOT A;  2VQG A;  2V4J C;  1X1B A;  2OV7 A;  2CW7 A;  2CS3 A;  2ZSH B;  3A4C A;  1MMF G;  4Y4R A;  5CPR B;  3K4M A;  1ERD A;  1YE9 A;  4XN3 A;  4NC7 A;  1N75 A;  2VQL A;  4E6K G;  2XC7 A;  3OR1 C;  4NUB A;  2CFO A;  2IS1 A;  2LBF B;  2XF6 A;  4J00 A;  4P1W A;  4KJZ A;  2R7S A;  1JI8 A;  1W36 D;  2ZSI B;  3HG9 A;  2UV1 A;  2IS6 A;  4HG2 A;  5CQG A;  2KHM A;  2F6C A;  4RM3 A;  3U21 A;  2GOM A;  1YX5 A;  3OY9 A;  4OWR B;  4BL0 B;  2A5W A;  3HPH A;  1UAA A;  3HXL A;  4XLA A;  4DJA A;  3V42 A;  3OWT A;  4F92 B;  3PNY A;  4E7S A;  2X6X A;  3SEQ A;  3KX2 A;  3SYT A;  4G6T B;  1WFX A;  5HOO A;  1X4O A;  2K5C A;  1UG0 A;  3UNG C;  4ZTJ A;  2QKM B;  4BS9 A;  2GOX B;  3LFU A;  2JSP A;  4U7B A;  3K4B A;  3OYE A;  2R7V A;  3VWB A;  1WJE A;  2OUM A;  1NG6 A;  4AYB A;  3K10 A;  3L2U A;  3MKY B;  2L9N A;  4XLC A;  3QYB A;  4E7K A;  1IWP G;  4XN0 A;  4B3X A;  3K70 C;  1OLT A;  1D1A A;  2JVG A;  2ZXH A;  3BLY A;  1MNE A;  3OR2 C;  3D5L A;  4XOR A;  2PJR A;  4AVZ A;  3NWT A;  1LVK A;  1IWB G;  4BDY A;  5HVQ C;  1V5G A;  3G2B A;  4DOZ A;  4F52 A;  3CES A;  2X6Y A;  2LRE A;  4ZDP A;  2HZD A;  3CP2 A;  2V7F A;  3RQ4 A;  4XMY A;  4B43 A;  3AL0 B;  3A1Y A;  4YEL A;  2LYC A;  4E7I A;  4HPQ A;  1D1C A;  2AQF A;  1DGR M;  2MFZ A;  3PNT A;  3HL2 A;  2L9S A;  2HDW A;  1V5E A;  3D5S C;  3EUA A;  1WJF A;  2CUJ A;  1LKX A;  3ZQQ A;  2IXS A;  3H5R A;  3D5R C;  2CMP A;  5FRO A;  1BR4 A;  2PMZ A;  2HVR A;  1QU3 A;  4XR6 A;  2VLA A;  3N05 A;  3DQV C;  4BGD A;  2CW8 A;  1TT0 A;  3QYF A;  4BDZ A;  4H4K C;  3C2G A;  3ONQ A;  3BCA A;  3DPL C;  2HPI A;  4QPO A;  3OYF A;  1D0X A;  1WJ5 A;  2FUG 2;  2M7B A;  4PJN A;  4BJ6 C;  2CV1 A;  4BUP A;  3DPU A;  4FAS D;  1N77 A;  3I3L A;  2Q1Z B;  2BW3 B;  3EUK L;  5HNF A;  1BOB A;  4CCN A;  2DCE A;  3DWL E;  3OIP A;  4U87 A;  2HU9 A;  1E0E A;  1MMD A;  3OYJ A;  4E7Z A;  3HPG A;  1SFK A;  3H0D A;  2X51 A;  3OL3 A;  1BR1 A;  3F9K A;  2VXD A;  3L2V A;  4E7H A;  3HKZ A;  3DLA A;  2V9K A;  2XSJ C;  4CCM A;  3DU6 A;  2HVS A;  4RM2 A;  2F5V A;  4BU2 A;  4E4H A;  5HNH A;  4PSX A;  3OS2 A;  3DTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...