1NG6A

Structure of cytosolic protein of unknown function yqey from bacillus subtilis
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
148
structure length
148
Chain Sequence
MSLLERLNQDMKLYMKNREKDKLTVVRMVKASLQNEAIKLKKDSLTEDEELTVLSRELKQRKDSLQEFSNANRLDLVDKVQKELDILEVYLPEQLSEEELRTIVNETIAEVGASSKADMGKVMGAIMPKVKGKADGSLINKLVSSQLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yqeY
publication title 1.4A crystal structure of hypothetical cytosolic protein YQEY
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 63
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2002-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09424 YqeY Yqey-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.410 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1ng6A02
1.10.1510.10 Mainly Alpha Orthogonal Bundle Hypothetical Protein Yqey; Chain: A; domain1 Hypothetical Protein Yqey; Chain: A; domain1 1ng6A01
3AL0B 3IP4B 1NG6A
chains in the Genus database with same CATH superfamily
3OSFA 1W0TA 1J5YA 1JJ6C 1DU0A 3V42A 1R58A 5ILVA 2CUZA 2F6CA 2CO5A 3OYIA 1R1TA 2UZKA 2HYJA 2FOKA 4PZJA 1VF9A 1A5JA 2L2OA 3GTJJ 5LRRA 4WXCA 5E18F 1ZR4A 1VQ6I 2R7SA 3H0GJ 4ENNA 1VQLI 2VPRA 1S7OA 3GWZA 4JYKA 4ENMA 3S14J 2K02A 1QRYA 3E7LA 4NHJA 3J7AY 2EV0A 4RB2C 1EV7A 1MMNA 5JR3A 2ID3A 5CQEA 4BHCA 2BXZA 4XLAA 2H8RA 4PJ0C 4AM3A 2HOTA 4M9ZA 2PI0A 1G2HA 4YELA 1IN7A 3BG9A 1A6IA 3K4MA 2NRAC 5JLXA 1A6QA 5FKKA 1TW2A 2X1EA 4EVIA 3ABTA 1MIJA 4YEJA 2L9RA 4A3BJ 1V4RA 2M45A 3P9IA 2M9HA 2QBYA 4FX0A 5E1ZB 4HPQA 4ENJA 5LD2C 2JZYA 4MFEA 1WJ5A 2P81A 4JK1X 2Z9OA 3BTIA 2DPDA 1X58A 3FZVA 1D5YA 4BXXJ 3G73A 2HGCA 4NQWB 3LFUA 4B1RA 2Z33A 2M7AA 5AIPA 5B1BH 3AG4H 4ZDPA 4DOZA 2LOOA 3ONQA 5L3EA 1ZRFA 3S17J 2MG4A 3DCFA 1GVJA 2CW0F 2CUFA 5BPDA 5JFRA 2LP0A 2VKDA 4ON0A 3GTLJ 4KYWA 5BPIA 1LFUP 1I1GA 1UZCA 1V5FA 3ZQFA 1Z3YA 2DQLA 3VEPA 4C3JJ 4NBQA 3VOEA 1F43A 2GAUA 3HUGB 2CUEA 4HQMA 2L5QA 3RQ4A 3ZN0A 2IJLA 4D7MA 1ETQA 5IP6A 3ISPA 3CP8A 3WTZA 3M8FA 3A01B 1A35A 1TZLA 4M6YA 2MSYA 2FSWA 1AU7A 1D1AA 4A3JJ 4O5VA 4PSXA 1GLNA 3RQIA 2H6CA 2W57A 3PUBA 2CQ7A 1NHAA 1T39A 1YJ9I 2R3SA 1FEXA 1XG1A 1IRFA 2VT3A 4N9IA 4MQVA 1ETYA 4KISA 1REPC 1KU9A 3F72A 2NVTJ 4HV5A 3UNGC 2AS5F 2DMNA 3TW6A 2QSHX 3BZCA 4C2TA 4ZDOA 2ELHA 3H5NA 1JUPA 2ZXIA 3HKZA 3PUFA 2DI3A 4BUPA 2Y48A 3TKYA 3I64A 2IS2A 2IS1A 2KT0A 2CU7A 4BQQA 2XVCA 3OMYA 1SAXA 3GZ5A 2IS6A 4UUSB 2XKOA 4J19A 2XGEA 5H6QA 2ZXWH 1Z6TA 2VJ5A 3HOUJ 5J8FA 3KIOA 1Y0NA 5IOYA 3F8BA 1R22A 3N05A 1FPQA 3CD6I 1G4DA 1IGNA 3RPUA 4FTHA 1JKQC 1ZGAA 2KRHA 1VQ8I 2VLAA 2WV1A 3I71A 2M8EA 4XK4A 1FYMA 2BW3B 4HG2A 4BHPA 1GXPA 3L7WA 1QA6A 1D0XA 1VQPI 2L4AA 2TDXA 2WY7Q 1MBHA 3CTAA 1YRNA 2O5RA 5FROA 1H89C 4XQFA 2JUGA 3QAHA 4IPAA 4XLPF 3S16J 1JKRC 5CVUA 3U2RA 4EV0A 4HNVA 3DBLB 3K7AJ 1YE9A 4PFPA 5LEJA 4S04A 5C3EJ 4IOAF 2JA2A 1LEBA 2P5KA 3HJEA 4HNUA 2BE5F 1P6RA 3TO6A 4BDZA 2AXTC 1ACIA 4DYQA 5DM7F 1BA5A 1SMTA 1RR7A 1IDZA 3ZN1A 1F4KA 1GHCA 3BR1A 5IT3A 4H0EA 3NEUA 1GXQA 3BY6A 5KNLA 2ZB9A 2IA2A 2XHKA 3E6CC 2UXXA 3ROUA 4DNCA 1YHQI 2KZVA 1U78A 4M6VA 3MCZA 1YW9A 4GYIA 3B6AA 2KL4A 1EH7A 3A0BC 4IEJA 4RGUA 2QSGX 5GTIC 9ANTA 2VI6A 4WX9A 3DEUA 4E7SA 3M3YJ 2R7UA 5ICEA 4UV9A 4UVBA 1U9NA 4M72A 3BC8A 2K9SA 4BL0B 1RKWA 1YI2I 1P2FA 2G7UA 4YIIA 3WGIA 2QUFA 2NS8A 1T0FA 3DEWA 5EYRA 2NVQJ 1P4XA 3HOXJ 4B8XA 2CV2A 2DO7A 2IT0A 1G3SA 2G0EA 2XAGA 2IA1A 1ZGWA 4II3A 3WU2C 4BACA 1QZYA 2P0WA 3BWGA 2FE3A 3HGYA 1TLHB 1GDTA 4BNCA 1UG2A 1FSHA 3CLOA 1D8KA 3RZOJ 3V7RA 5IY5H 3ZQIA 5EEHA 4M3EA 2PBIA 4LK1F 4A3LJ 1U9OA 1LPQA 3RKXA 3DKWA 1X2NA 3QODA 2W4SA 3QPSA 2RNGA 1HKTA 4BBRJ 3K1MA 1GVDA 2O8XA 3HPGA 5DCFA 3CCQI 2E60A 3FXQA 4HDVA 2EFWA 2GA2A 5D4RA 1T95A 1Z67A 4G6TB 2UUZA 2LKPA 5F64A 1Y8RB 3J81K 2HYGD 3F8FA 3GFJA 2KIUA 1X1DA 2A6HF 3PQJA 1IN6A 4A93J 3TP3A 2QLZA 3K4CA 5E3MA 1LFPA 2HPIA 2ZJPF 1I5ZA 5LBQA 3KEYA 4EMSA 4A0YA 1DPUA 3H1CA 1Y0UA 1UMQA 4CCJA 4HX4A 1BI3A 4E7LA 2LBFB 2DK8A 4LG0B 2DYRH 3DBHB 3W2VA 3OL3A 4BYYA 5IT9Z 1FBSA 2IS4A 3HBLA 5FLVA 2BY2A 3SDBA 5FB2A 4G8XA 3KCCA 4CXFA 2Z16A 1OCZH 4U88A 2MFZA 5E79C 5E3LA 1MSFC 2Q8KA 4UB8C 4LJZF 1S29A 1FY7A 1WH5A 3M07A 1BR4A 2JN6A 2MD0A 2RKHA 4EEFG 3S3MA 3OYKA 2WWYA 2NNNA 3Q9SA 1JTYA 4DGWB 1FLIA 2W25A 2HVRA 2Y0MA 2QKLB 4I01A 2BVLA 2JWTA 1LUJB 1VQ7I 2LC2A 1LJ9A 2ELKA 3OYNA 4K2EA 5D4SA 5DV5A 3CUOA 4M9SA 2I10A 3EPZA 4L5JA 5CVVA 4BAYA 3HSFA 3ZQ7A 2LLKA 3IUOA 4M74A 2IEKA 4ASNA 1HW2A 3IWZA 3HKZN 3VODA 2DW4A 1MBKA 2HS5A 2LKXA 2LY1A 2XUBA 3C2HA 2E1MB 4LMYA 5DEQA 2JPBA 3L2RA 4Y3OA 4A3KJ 4PUSA 1YS6A 3LSJA 1LEAA 4KDPA 2QA4I 3AG3H 1F5TA 2QBYB 2O03A 4IX7A 5F08A 3VB2A 3GF2A 2E35A 4AC0A 1TWCJ 3D5RC 3KZIC 1SFXA 1Z0XA 2OD5A 5ED4A 5L3DA 3CCMI 1USSA 1I6HJ 3K0LA 1E3OC 5DM6F 3GEZA 1IC8A 4YIFA 4IHYA 3DF8A 3CO7C 3VSLA 2FQ4A 1IZ1A 4Z6YA 4FISA 2CJJA 3ML6A 2LKSA 4LOCA 1SD4A 1P4WA 4EJWA 3JSPA 2L7FP 4OIRF 3AG1H 1ZRDA 2E34A 2F5FA 3F8NA 3OL4A 3J7ZI 1JGSA 4UVAA 4HQEA 1XGOA 2NXNB 1SVOA 1XMXA 3DKXA 4CCLA 2QZ8A 4AIHA 3DXJF 2E5ZA 1ZGJA 1Y8QB 2OBPA 2VQHA 2A07F 3OS1A 3LWFA 1H8AC 2OCEA 2LMDA 3IH2A 2IA0A 3SFIA 2YX4A 1U8BA 3NRVA 1XDSA 3J81Z 2QYOA 3KLNA 3MVPA 4QLCU 2PN6A 5HNHA 1MBEA 3FK6A 3ZGKA 5L3FA 3QPTA 4CZCA 2GIZA 2GXGA 1OPCA 4R79A 1B4AA 2CQQA 1WKMA 2K3PA 4FHTA 4GRIA 3GFLA 2JPCA 1MMGA 2YUSA 2IGOA 4I02A 3IRQA 1NG6A 4G7OF 2VIXA 4KA4A 2ZSIB 3C18A 4G6QA 4KJZA 1KQ8A 3HC7A 1ODDA 2EPFA 4PFOA 3QPHA 5J8CA 3QOPA 1FIPA 5FKLA 1U5TA 2E1MC 1FJLA 4HLYA 1ZLKA 2M30A 2VOOA 2EWNA 3FHNA 1IV6A 3CP2A 4KICA 1ZN2A 4N9HA 3E5XA 4YFKF 5HVQC 2LSOA 4JX4A 4DJAA 2X0LA 3BP8A 1T2KA 3Q5FA 5HLTA 3VWBA 2VONA 5E1XA 1MNMC 2M5WA 2HYFA 5EEAA 4PJJA 3LOCA 3IKTA 1WFXA 4P9FA 3VYUB 2JA6J 3P9KA 1SVLA 3PNTA 5FKMA 2EIKH 3B02A 3TOBA 3CLQA 2KQRA 3PFYA 2H1KA 3C7JA 3ZOBA 5F0FA 4I09A 1I39A 3QPLA 4CYDA 1KU2A 1WJFA 3CDHA 1IXSB 4V19K 2DFIA 3BG6A 4L5IA 2A5WA 3H5AA 1PVEA 2CQXA 2XAUA 2MYSA 3IHUA 1IXCA 2R7DA 1QO0D 1JGGA 3ERED 3MZ8A 2GZWA 1IRZA 5B1AH 4A6DA 3C2BA 4LB6B 1ZARA 4DZJA 4IQ4A 4EM2A 3IRRA 1RUOA 3G2BA 4HF2A 3H9GA 4A0ZA 3DTKA 2STTA 1S7EA 2EV6A 3CJNA 5HDNA 2M87A 3WTYC 3GZNB 4I0BA 3FK7A 1YLFA 3BR6A 3JRAA 3MKYB 2HR3A 1TQIA 2V1DA 3GFMA 1SMYF 4CCKA 1R71A 1LNWA 1JJ8C 4B09A 2MBFA 3FKJA 3BDDA 4UB6C 4XKWA 2WY8Q 1X1PA 1ZR2A 3HDDA 1PUFB 3F22A 3E6DA 2VPLA 1W5SA 1KZHA 4D5FA 2L7MP 1TP4A 2VQCA 2NOGA 1W1WE 3TOAA 1RETA 4I76A 2ECBA 1RR8C 3O2PE 3FDYA 5F0CA 4I0AA 2FEZA 5J40A 3HEFA 1XGMA 3ZQHA 3KYCB 3EUAA 4WWCA 4MNUA 4RMNA 2K3FA 1JKPC 4LK0F 2W7NA 1ZH5A 2Y0SA 4NDLA 2P7CB 2RDPA 2VXZA 3KP5A 2OCCH 1KU7A 4A3GJ 5DYMA 1IG7A 2I5UA 2STWA 1LDDA 3CJRB 4IF4A 1GUUA 3TW7A 4ZYGA 4NNJA 4IVNA 4E70A 4X0GA 2ZJRF 2HZTA 4XL9A 5HODA 1MGTA 3CCEI 2XC7A 2KIMA 3RJPA 3I56I 3L2WA 1VTNC 3JRFA 3H9QA 4IHWA 3AG2H 4PK4A 2KKOA 5FLMJ 4I7HA 4MEXF 2JA5J 3CZ6A 3BLYA 2VJIA 1MNDA 1IUYA 1PYVA 5ILUA 2GXBA 3EDPA 3N97A 4F52A 5FD5A 1N77A 3S1NJ 3Q3SA 1FP1D 1JE8A 2X6WA 2P8TA 2VUMJ 2N8GA 3ZQCA 3RSNA 3OYMA 2O61A 2OUMA 4KIFA 3PFIA 1QGPA 4RAFA 2P4WA 4CCMA 1E2XA 3D1NI 3DQVC 3DU6A 1FSEA 3WTSC 2IGNA 2YSRA 2WV0A 1LVKA 1G3WA 3OIOA 4B4CA 2KIFA 5ILSA 2XPWA 1M1EB 2F4MB 2R4GA 2HKXA 5D8LB 3TEDA 1B9MA 1XGSA 1WJDA 2YPRA 3FXMA 1TWFJ 2Y30A 2RVCA 3I3LA 1CF7A 4MQ9F 3E5UA 1ZELA 2CW7A 3T8TA 3H35A 3K4LA 3RDIA 3CCUI 5EEGA 4LG0A 1SEUA 5EF6A 3FISA 2L9SA 1P4AA 2JRTA 2X6YA 3F8MA 3BZKA 1IV8A 1IWPG 1P9QC 4XOPA 2H09A 3V7SA 1G59A 1R4MB 3L2CA 1XSVA 1T0FC 5HOOA 4OMYA 1V5EA 1J09A 3LA2A 4LB5A 3H9JA 1BIAA 2VC1A 2FF4A 3LA3A 3BJ6A 5A2QK 2HEOA 2DOFA 1F36A 1Z6RA 2DT7B 4MLOA 1U8RA 2E1CA 2CUJA 1LB2A 5DUKA 4BY7J 3TP0A 1ETKA 1OYIA 1HF0A 2LREA 1NTCA 2FJ1A 2Z5UA 1K61A 4F91B 3WU1B 1B6AA 4OIQF 1UHSA 2DK5A 3HL2A 1BW5A 4C9YA 1QHHD 2KRCA 2P6SA 3VYSB 5BMZA 3CJTB 3CMMA 1UFMA 4LFUA 1S7AA 3LAPA 3QRFF 2XGXA 1K78A 1SD6A 3D0SA 3PIPF 3GTOJ 1D3YA 3GXOA 4E7KA 2A68F 2FBKA 3S15J 2LDUA 2KDZA 3B73A 2EZLA 2QQBA 4WCGA 3A4CA 3PSFA 1HA8A 4QTRA 1BI0A 2D1VA 1SFEA 4W1UA 1FTTA 1I1SA 1DIOG 2P6TA 4OAZA 3SEQA 4F3QA 3CMYA 3A03A 1YJWI 3ECHA 5J1YA 1VI0A 2FD5A 2DFHA 4WXHA 4OOIA 4LLLA 3RKWA 2OA4A 3V8JA 4B43A 4EJVA 3K9TA 1XGNA 2FXAA 4OMZA 4P55A 1BJZA 2DQRA 3TO9A 1W5CC 1YTYA 4OU0A 4CA0A 3KYLA 2R93J 3IAS2 2HDDA 3CQZJ 2HDCA 3ZCOA 4CGZA 4ABZA 5IYBJ 4Y15A 2WAQA 5FKNA 3OIQA 1OR7C 4QPQA 1W4MA 3FXUA 3FMSA 1G3YA 2UXNA 3LSTA 1DPRA 2A5YB 2MA3A 3HZJA 1UC4G 2X1DA 1EJ9A 1MBFA 3R0JA 5FKOA 3Q0VA 3QP5A 4AYBA 4A0XA 2DCEA 1WSUA 3H0DA 4RBOA 2OQGA 1J59A 4GGGA 5DCMA 2R7XA 1VFCA 3HRTA 4BXFA 1TT0A 4A3MJ 2ZCWA 4FE4A 5LGUA 3J7YJ 5E8GA 1ETWA 3K4NA 3DU5A 4DW6A 2L01A 4CDGA 1RIOH 2FBHA 3L2QA 4BQAA 1QVTA 1WH7A 4FX4A 1U5TB 1Y1WJ 2E1NA 3R4KA 3R6SA 2V1NA 4Q48A 4IL6C 2YX7A 2VBYA 3CC2I 2V1XA 2DU9A 2R7FA 1YQAA 2HFHA 2XF6A 4BJTA 2JMWA 1S5LC 2JVGA 4Q5SF 1WJBA 3BG7A 1X1BA 2HTSA 2Y0SN 1LFBA 3SHFA 1AA7A 2F2EA 2UWMA 2CFOA 3W6JB 2YR2A 5GPAA 3GTKJ 1XCVA 2LNBA 3RYPA 1A36A 2HQRA 3CUQC 5A2QZ 5K5OA 4HZFA 3I53A 1OCPA 5H6RA 1E17A 1U6GA 5GADJ 4XM3A 1HDDC 4MFDA 4X6AJ 5DTDA 2VE9A 2Z99A 1HLVA 5IT9K 2IBDA 1S8NA 1Y6IA 2ISYA 2K9QA 3ASNH 3HRMA 3I9V2 1BOBA 4RA2A 3LL7A 5F1JA 2M0CA 3P7NA 4RAZA 3REOA 1APLC 4ZH4F 5F0HA 1L0OC 3C1DA 3IWFA 5F1RA 5B5EC 2ZKZA 2IXSA 3ZPLA 5M3FJ 2FOWA 2DA2A 5F04A 5H2FC 1Z05A 1E3HA 3WE3A 2M3AA 3F8CA 1R5HA 4AU7A 1W7PA 2F5EA 3O8HA 1RPWA 4F92B 2FX0A 1O3QA 1OCTC 4UXNA 2OF7A 3JW4A 1I50J 4XN3A 1U0JA 3BTCA 3S1QJ 4KN7X 1QU3A 4JBAA 4GCVA 2WB1A 4U87A 3SQNA 4LIVA 1R49A 1X3ZB 2KJCA 1SD5A 1T6SA 4U0VA 2CFXA 3QP6A 1YW8A 1W7PD 4L0ZB 3R61A 2BV6A 2CW8A 2XGDA 4RAYA 3L2VA 1QHGA 4AD9A 3EYYA 5EGOB 2PMHA 2ESHA 2XDVA 2IVMA 1J7KA 3ASOH 4CCNA 1D1BA 4FQGA 2HXIA 4ENKA 1IF1A 4E7ZA 5HLHA 1F9NA 3ZQLA 2PG4A 1OYYA 1U5TC 4XONA 3E0JB 3A2KA 2F4OB 3T8RA 1MMFG 2XSJC 1OCRH 2XIGA 3LSGA 3DKYA 4IRGA 4F7ZA 1EGMG 3O6BB 4A3IJ 1HSJA 1PUFA 1WI3A 1O7LA 1ZHFA 1X1CA 2R0QC 3U21A 4BKXA 3MEXA 1VQKI 3FF5A 2HOEA 2E36A 2VE8A 3RZDJ 2W85A 2ZXHA 4UUTA 1T8IA 2XKPA 3OOUA 2DBBA 4DZPA 4IHVA 3JREA 4QWQA 3KZYA 2XF5A 2EIJH 2R7RA 1N78A 1TWGJ 1DP7P 2XPVA 3GTPJ 3OIPA 4HOBA 4KFCA 1O3RA 2K27A 1K6YA 4A5NA 1WJAA 3BJAA 3BR2A 3RKQA 1MBGA 3ULQB 3DLAA 4E7HA 1H88C 1OISA 3T5XA 4ZZDA 1T08B 3OS2A 1ZQ3P 2WAEA 2LF7A 2LY9A 1TWAJ 1C0WA 4G94A 2Q2EB 1OLTA 1W36D 2YU9J 3LFKA 3LSRA 3N4MA 1AOYA 2KLOA 3GTGJ 2ZNYA 1WGXA 1R7JA 4F55A 1WHUA 1YX5A 1JT6A 1SFKA 3TDZC 1MZBA 3U1DA 4ANJA 4DBRA 4KITB 2R92J 1UHWA 2ESNA 3F3XA 4M3GA 2LVSA 1Y1VJ 3DEEA 3WGGA 3UKGA 1FYLA 4PGHA 3W2WA 3JAMZ 1YG2A 4GYGA 3SZPA 2JVHA 1CF7B 2J5OA 4FT8A 1IDYA 5LHIA 3TGNA 4L0YB 3I4NJ 2W1OA 1X2MA 1ZK8A 2W84A 3WTVC 3BQYA 1GV2A 2K86A 2K9MA 2DDAA 2QQ9A 2DA5A 2WAQN 2RGVA 1QPMA 2VJJA 1MSEC 3FMRA 1SC7A 4R8HA 3HSEA 2B0LA 2M34A 2QKMB 5L3BA 1L3LA 5C44J 1OYWA 3I0TA 1NK2P 1KA8A 1BBYA 1MH4A 4XRSG 2ZFWA 4EM0B 1N25A 2PQ8A 3S3OA 3F21A 3ZMTA 5H20A 1OR7A 4A69C 2L9NA 3V4GA 1HCRA 3DP7A 2OC6A 1V55H 2FA5A 1ZLJA 2HPMA 3COAC 4E6KG 2QSFX 4I98B 1SFUA 4DIQA 1BR2A 2EH3A 3DPUA 4RDUA 2VOPA 4RGSA 1MMAA 4LG3A 3GMEA 4NC7A 4Q47A 1XDUA 4AIDA 1T56A 3FX3A 4XORA 1PJRA 3PM1A 1K78B 2WA0A 3GO5A 5TGTA 1WRJA 1WCMJ 2DMTA 3KP4A 4XKCA 3G1OA 4RM3A 4YIRX 1Y39A 4P96A 3ERMA 2O8KA 1JUSA 3KX2A 5K5RA 3HOWJ 2FRHA 3KYDB 1BC7C 2OV7A 3GFIA 3BTJA 5IP9J 2RC4A 1TQPA 2VT2A 1QVUA 2PMUA 2Z1DA 3FM3A 4HV6A 5KK1A 2RN7A 1FX7A 2VKEA 4KMUX 1QNTA 4RAGA 3E5QA 2DJIA 3I54A 4PCQA 4A6EA 3HOTA 2V6EA 3PO3J 3OYDA 3CUQA 3DTIA 1LE8A 1TWHJ 4CHUA 2W00A 4O3MA 2DFEA 2LF8A 4Y13A 1BL0A 1MJAA 4LLNA 1X3WB 3HRSA 2DN0A 1VQOI 4NC8A 3S1MJ 4OWRB 1J9IA 2MH2A 2ISZA 4D5CA 4U7BA 1BM9A 4XSZF 4YRVA 1B8IA 2PJPA 3PL8A 2VQLA 2ZNZA 3GCMA 5L3CA 3VYRB 1YFHA 1ITYA 3FHZA 5LRSA 1KYZA 3G3ZA 1Q1VA 4IHSA 1Z7UA 1SVMA 2JRMA 4IJAA 4HNTA 3CCLI 3QU6A 2WB1N 2KP6A 3JR9A 5DCMB 1D8JA 2K4BA 4BEHB 2D5VA 4G9YA 3GBGA 3MMYB 4PDKA 2LH9A 3D5SC 3K2ZA 2AO9A 3FIWA 5L3GA 4XICA 2C6YA 2IAIA 3F9KA 2DOAA 2K7LA 2LY2A 5CPRB 5C4XJ 3PSIA 5IP7J 3ZQGA 2M0MA 3BR0A 5LGTA 3ZMDA 5KHDA 3WHBA 5E20A 2JA7J 2YU3A 2BGCA 3EUHA 3QU3A 4E7JA 4UNOA 5LLQA 3CF5F 3K1NA 2WADA 2RV8A 2K4JA 4G6DA 1IN5A 1R00A 3MZHA 1Y56A 1QPIA 2E7XA 1B9NA 2HOAA 3BROA 3OYEA 2DT5A 3WODF 2NYXA 3CCJI 1ETVA 2BOLA 3IP4B 1ZTRA 4AWXB 4XBFA 2EQRA 2L3DA 4HX7A 2COBA 2AQEA 4Q4ZF 3R0AA 3LNQA 1V5GA 2K85A 5D5VB 1Z1DA 2R5ZB 1B1BA 1XB4A 1HW1A 3OYJA 4BJ5C 1RUNA 1EA3A 4JX5A 4WXDA 1Z7LA 1FOYA 5F27A 1I6XA 4CICA 4PSWA 4OIOF 3S2WA 2A05A 2H8WA 1XC5A 2HVQA 2VASA 1FWZA 2DODA 2VXDA 3AL0B 1W7PB 2Y31A 3NAUA 4M3DA 4KNYA 2DYSH 1WWXA 1OQYA 2OJED 3D5LA 3UR3C 1SFOJ 5GAHJ 1R5ID 2P7VB 1SD7A 2LTPA 4LIUA 1X4OA 2M7BA 3J7AO 3QWLA 3MAJA 2MLKA 2PJRB 1D5VA 3G1MA 1KGSA 5ICGA 5DS9A 5LGNA 3GZ6A 4BE2A 5GTHC 2MC4A 4XIDA 1RC9A 4WK8F 2F48A 3F6OA 3MQ0A 4JQFA 1H0MA 4CCOA 1WVRA 1OCOH 4XKBA 3ZR8X 3HHHA 5B3SH 1YYVA 2E2HJ 1UELB 1HBXG 3BJOA 3QYFA 2A6EF 4ZDLA 2DLLA 2CQNA 1LDKB 3T0YA 2DT6A 1S6LA 4UVCA 1VQ5I 3W6VA 1EKEA 2HDWA 3K2AA 3K70D 5EGOA 3JCUC 3ZMSA 3K4JA 3OSGA 4BXUA 1DGRM 1OJLA 4O6JA 1Q1HA 3ZMVA 4BH9A 2XAHA 2BVMA 2VC0A 5JLWA 2D1HA 3LMMA 3MFKA 4Y17A 1FYKA 3E6MA 4I2OA 4BE1A 2X48A 3P5JA 4LD5A 3MD2A 2L7ZA 3ZP5A 5GPCA 3VYTB 2PX9A 5LHGA 1RI7A 3RPQA 3VPRA 2EB7A 3G4SI 1XSDA 2OZUA 1YITI 5D5WB 3A1YA 1JUMA 1BN5A 2ME0A 2VBZA 4HW0A 3OS0A 4G7ZF 1AWCA 1LKXA 1B72A 1HDPA 4YFXF 4HF0A 2LG4A 2W82A 4MGRA 3SDGA 2CWEA 1RRJA 3TQNA 4B44A 4EJUA 4P5OA 3HPHA 3HM5A 4D9JA 2EBIA 3H3UA 2BY1A 3I59B 1FC3A 3AL0C 1MH3A 5B66C 1H9TA 3MWMA 4LGWA 3HTSB 4M73A 2XAJA 3E6BA 3DWLE 1DUXC 1OMIA 1DGWY 2QENA 4BHBA 1TBXA 2FUG2 2B9SA 5ICFA 2GBYA 2H94A 5CJ9A 2JSCA 2E7WA 3CDIA 5HS9A 1GT0C 1USTA 2HKOA 4GDFA 1R6RA 2Q2EA 3ABUA 5TRDA 1ZREA 1MDMA 1IWBG 1RZ4A 1K7AA 4C2UA 4MO7A 2R7VA 4UUVA 5E17F 3IH3A 4M9XA 4A2UA 1WQ2A 3P9CA 2CMPA 2GWRA 2HZDA 1ZG3A 2VQGA 3I4PA 4EQQA 1TTYA 4L9VA 2EK5A 3DBRB 3K1PA 2XPUA 2GLOA 2Y69H 4D0PA 2DA3A 5K1YA 4OINF 3F0CA 1D0ZA 1MMDA 1G8XA 1P7JA 2JSPA 2BHZA 4QIWN 1X19A 1XCBA 5K7ZA 2RQPA 2R5YB 1D1CA 2DTRA 5GAEJ 4XKVA 4EGZA 4CYCA 1JTXA 3M1EA 1MBJA 2Y9YA 3LSHA 3G71I 3L9FA 3LQQA 3HOZJ 3DPTA 2KJBA 2X1CA 1ZYRF 3KLOA 3GLXA 1XSXA 2V9PA 4FCYA 1OKRA 3HGGA 5EDNA 3HTUA 4RB3C 3WTWC 3OYLA 3S3NA 1W36C 4Y52J 4IXAA 1IRXA 3HRUA 5HNFA 1O4XA 1I3AA 4ETSA 5GAGJ 2VKVA 2XV4S 1KONA 1OFCX 3OYCA 2IGKA 3CCYA 2X4HA 3A0HC 1T33A 3H3VK 2NS0A 1YJNI 2DFFA 1XD7A 5FRMA 5AONA 1FOXA 3IH4A 4C30A 1MNEA 3I4MJ 2IRFG 3I55I 4IO9F 2V6CA 1EF4A 3ZRGA 2GM4A 3BOQA 4XMYA 2L9VA 5M5XJ 4EGYA 2VBXA 2BHYA 3CESA 2QQAA 3AFHA 2CV1A 2MC3A 3CUQB 1LE8B 5JVTA 2ZJQF 1K79A 3ECOA 1TNTA 4L9TA 3WTUC 4RB0A 3BTLA 2EILH 4MTDA 3OOPA 4XLCA 2K5CA 4C3IJ 3FM5A 1NH3A 3ABLH 1WJCA 4I99C 5E1WA 1J0RA 4ZTFA 1X4PA 2XGCA 4IKFA 4XLEA 1B8IB 5D5XB 1W5TA 1XMKA 2LFBA 2M4KA 3FXKA 2DA7A 2ACJA 2JK3A 2LR8A 1U3EM 1ORKA 5FO5A 4A3EJ 2DA4A 4BS9A 2ZBKA 1G6NA 5J6XA 2CGPA 1S9HA 3KE2A 4XRSA 2B63J 1JXSA 3U9GA 4CH7A 4HLXA 2GXAA 3QOEA 3FWEA 1RESA 3K4KA 2HNHA 1FBQA 3S1RJ 4R1HA 4N4OB 3WE2A 1DU6A 4MIMA 3V8LA 3VDXA 1J2XA 1UCRA 5E8IA 3J80Z 1O3TA 4BEHA 1R23A 1EH8A 2JA8J 4DQ2A 3OYAA 1A04A 4BDYA 4HAMA 4W97A 3Q0WA 4FETA 4ESBA 3KP6A 1MKMA 3I5UA 3OYFA 4M3BA 3HIFA 2AXLA 3ZQQA 2HVSA 2CRGA 1HSTA 4UV8A 1WZ2A 3KEQA 3ABMH 2XRNA 3WTXC 4ZYHA 3SYTA 4UHTA 3HOYJ 4HA8A 1EH6A 3IL2A 4ZYAA 3GX4X 2XAFA 4XRFA 2P5LC 1K83J 2KISA 2V26A 1ETOA 4QSHA 4EM1A 3FXJA 1J75A 3K69A 4ZJZA 3HHGA 1ETXA 4ZC3A 2GOMA 4BY1J 4BJ6C 2VKHA 3TDUC 4BBSJ 4A3CJ 4JX6A 2ZFUA 4GO1A 2VB6A 1W0UA 1TL8A 4PJNA 2H27A 1UAAA 4V2FA 5CKTA 1TQMA 2COMA 3EYIA 3JAMK 3CC4I 5FLXK 5K7HA 2R5ZA 1VQMI 3OV8A 1HXDA 1YX3A 1AKHA 4Y4RA 3SZTA 1S3JA 3E3VA 1JHHA 1GV5A 1FIAA 2MD5A 2WTEA 3ESWB 4M71A 2AHQA 3L2UA 4II2A 1R9TJ 2G7HA 2JQ7A 1LVAA 3CCRI 2DPUA 3GTMJ 3LAJA 4U7DA 3QYBA 2KFDA 5FJ8J 4ITVA 4S0HB 4RM2A 2G9WA 3O3KA 4KN4X 2RNJA 2DMUA 2L0KA 2F5DA 2DA6A 4IZZA 1WJEA 2PLYA 4L9NA 3RTRA 1POGA 3TMOA 4DYRA 2BEOA 1I27A 4F93B 1QQIA 2KHMA 3BPVA 2CG4A 1UG0A 2ZSHB 4L9JA 1BJAA 3EUHC 3CMAI 1FNNA 2A6TA 1EGVG 2O3FA 5BNGA 1N75A 5HS7A 5JHFA 2PJRA 2O0YA 3FXLA 5FFZA 2XB5A 3GTQJ 3V8KA 3H92A 1IW7F 5CVJA 3RPUD 1KQ9A 4KT6A 2KDOA 3S8PA 1YO5C 4JOMA 2X9DA 1UC5G 1V54H 2ID6A 1S72I 3W2AA 2JTVA 4PGGA 2E71A 3RI4A 4U0WA 2HQ5A 3EUKL 2L02A 3K6GA 2CH0A 2X51A 5ICCA 2EA2A 3HOSA 2GIVA 2XROA 2NVYJ 3FBNB 3SXYA 4BE0A 2DMQA 2V1UA 3ZMZA 2AQFA 3SJMA 2JUCA 1ENHA 1PP8F 1VQ9I 2XRLA 2MABA 4G12A 4L5EA 5BQTA 2EA4A 1FBUA 1QBJA 5EG0A 1B72B 5KAFC 3U1KA 3OWTA 1WI9A 2XAQA 2ZXJA 1ULYA 3GLLA 2BY0A 4YG2F 2VJ4A 5FFXA 4ESJA 2Q0OA 1CQTA 3KFWX 3MKZA 3GVAA 2H6BA 3DPLC 4P9UA 3IC7A 5TJJA 1DQUA 3VSKA 2V9KA 2HQAA 3RYRA 5JVGF 1NG7A 1T98A 5KVRA 5GP9A 3BG5A 1IJWC 3LQRA 3GYHX 4RLQA 3W3CA 2O6GE 1XMAA 4V2GA 2FU4A 5J3LA 4FE7A 2L7KA 2NVUB 1MDMB 1HKSA 1X3UA 3I59A 3SZGA 2VN2A 1XPXA 5LFAA 2F4IA 2ICWG 2UV1A 3KPHA 3HYIA 2B7EA 1MJBA 1ZAOA 3SEZA 2HI3A 2JJ7A 5DDGA 4H4KC 1H9GA 3K70C 1FP2A 2ZJ2A 2VL8A 2H1LA 3FXRA 2EFOA 1U2WA 3QQAA 2V4JC 2BBYA 3H3ZA 1ZRCA 5FLXZ 5HDKA 1IN8A 5J4YA 2CSOA 2ADUA 3HSRA 1VZ0A 2F5CA 2W24A 3MKWB 3KZZA 3JSOA 1R36A 2XF7A 3ABKH 3LSPA 3L1PA 3MKLA 3BR5A 3KEOA 1EEXG 2ELJA 1QZZA 4CYCB 3CC7I 2P5VA 2EZHA 2WC2A 4AYBN 3CCVI 2X6OA 2NAZA 3NWTA 1LQ1A 2I8DA 1BIBA 4IHXA 1Z2ZA 1NK3P 2ZMEB 5J4VA 2M8GX 5HLGA 4DBQA 3OY9A 3JRDA 5DD4A 4B3XA 2FBIA 5JHUA 4P1WA 3G1LA 1JKOC 2M2EA 1JHFA 2NNYA 4Z2YA 3KP3A 2R5YA 1ON1A 5J1RA 4FASD 5C4JJ 1BOAA 3BCAA 3H36A 4HYEA 2EZKA 3OYGA 4C3HJ 1MMSA 3C2GA 4A3FJ 4ZYDA 4AIJA 2E1OA 4GXOA 5FGMA 2K40A 2HOSA 2LD5A 4ZTJA 3WGHA 2CYYA 2XASA 1IUFA 2WBMA 4J00A 2KRFA 4M3FA 3PNYA 5M3MJ 1ONVA 2DMPA 3Q9VA 4B47A 3M7GA 3IKVA 4XNFA 3BR3A 3BPXA 2EIMH 3O8GA 3SFZA 1TC3C 4HF1A 1K6OA 1YW7A 4Y7NJ 4EJTA 1R1VA 5BOXA 3A02A 2FNAA 2V79A 4IHTA 2K9NA 5F6FA 5FRNA 2PMZA 1F1ZA 1YIOA 4XOTA 1ZG5A 4RS8A 1MD0A 3KP7A 1P92A 2QQ8A 2HXOA 2MW8A 4IRHA 4A12A 3CO6C 2ZO4A 2XB0X 4CO8A 1YIJI 2EFPA 2MLGA 5K5QA 4LITA 1DP3A 5IYCJ 3IV5A 4RB1A 3JTGA 5DUIA 2O7OA 1HC8A 5KCMA 3BZ6A 1BR1A 3K4BA 1O57A 2M4GA 5J1UA 3OYHA 1JI8A 4AVPA 3S93A 5EZHA 3JRIA 1HW5A 1ERDA 3PQKA 2Y2ZA 4I6ZA 1BC8C 5LEKA 1IN4A 2DJNA 4M6XA 3JTHA 4KT5C 4IQJA 2O9LA 2ZMEC 1FT9A 2QF7A 5J47A 3OR2C 3Q0UA 1E0EA 2FMLA 5HDGA 2HU9A 1TNSA 4XLFA 2YS9A 3FBIB 3HXLA 2KPMA 1FTZA 2XSDC 3M9AA 2CQKA 2QGUA 5K7FA 2NOJB 4KIGA 4NQWA 1V3FA 1FMVA 1B59A 3GW2A 4KUMA 1VQNI 1PUEE 4BGDA 2EFNA 2OAZA 4XR6A 3M4OJ 1IXRC 1LDJA 1IRGA 1YS7A 4NC6A 4XSXF 1R1UA 1G3TA 3HUGA 1XN7A 3LSIA 4N4NB 1ON2A 3JRGA 1TT5B 4MHGA 4J01A 2BZTA 3LA7A 4NUBA 3WU0A 3JRBA 2E19A 2Y75A 3LSKA 1UJ8A 3A01A 1K4TA 3KETA 5M5YJ 4ESFA 4UY8I 3RIRA 2PFBA 1UB9A 4EJOA 1DDNA 1I3QJ 3PNVA 3IAM2 1AHDP 3F23A 2ZC2A 3BQZA 4ZYEA 1YOVB 2RQQA 1AKHB 5IPAA 2WAFA 2E5NA 2VBWA 2QVOA 4HSRA 5E3OA 1IAWA 1VNDA 4E4HA 2A61A 4AUXA 4D1QA 3CCSI 3CJQB 4PJMA 4RGRA 2R7OA 2OU2A 1MJ9A 1XX5A 4XN0A 2IGMA 3ELKA 5M5WJ 1FMWA 2M1BA 3R60A 3HB9A 5BS6A 1RKTA 5EZGA 2IP2A 3HG9A 3TBIA 1FOWA 1P7IA 2Z2SB 2X85A 3M8JA 4NB5A 4N0BA 2ECCA 3H5RA 5D8KB 2MGQA 3CDLA 2DA1A 4L18B 2R7TA 2FNPA 3WG7H 4UUSA 6PAXA 2LK2A 3HOVJ 1Z91A 1K4SA 1CGPA 1Z3XA 3JRCA 1KQ0A 4C2MJ 1Z77A 4AIKA 1R5GA 3AUJG 3CF2A 3S32A 4E7IA 2R7ZJ 2DTZA 2GQQA 2HTJA 3OR1C 3DTEA 2NVXJ 2R7QA 3FKIJ 1XTAA 1YRNB 2KIQA 2L4MA 1SANA 2JT1A 1WPKA 5HS8A 3FXOA 2X6XA 5D5UB 2K9LA 1O7FA 3TL4X 1HOMA 5CQGA 1RNLA 1STZA 2D2WA 3NARA 1BI1A 2KMUA 5AIQA 4CSWA 2OTLI 2BW3A 4CUGA 5IYDJ 1D0YA 2VODA 1OCCH 1TW3A 2OTJI 2GOXB 3EETA 2E2JJ 2EINH 2L54A 3X2QH 2QWWA 4XLNF 3KP2A 1X1AA 5D6EA 2Y9ZA 3PJRA 4HDUA 4HRIA 1JT0A 3L00A 3B6CA 3M8EA 5EJCA 2BY3A 5E3NA 4YFNF 5LHHA 3BT9A 2OPTA 5EG0B 1T38A 1KU3A 2IW5A 3GUDA 1A31A 2EV5A 3LSMA 3DV8A 3I58A 3K10A 3DLLF 2W48A 3G6EI 3MZYA 3ZXSA 1UHMA 1HQCA 3CMEI 1QZEA 2FMYA 5CLSA 4HSTA 1Z9CA 4BU2A 1HKQA 4B48A 3PIOF 4BQOA 2PEXA 4OAYA 3QYEA 1ZG1A 3S2HJ 1SAUA 4TV7A 2TRTA 4U0YA 2A3SA 3PO2J 2QCOA 3S2DJ 2A69F 2LRDA 1XS9A 2DAOA 5JI6A 3W6KB 2Q1ZB 2RAEA 4RLFA 2ME6A 2DDBA 1PDNC 1MW7A 2HWVA 4HEA2 2V7FA 2MH9A 1PP7U 4GFBA 2TCTA 4JP0A 4RGXA 5CYVA 1BW6A 2CS3A 2PMZN 3FMQA 2V9VA 2FQ3A 3AKZA 4WF2A 5D6FA 4CZZA 4A5MA 2KZGA 3L09A 3T1BA 1BI2A 2GA1A 2D45A 4KMFA 2BYVE 5KAIC 4S05A 3RCOA 3J80K 2CV0A 3ZMUA 5FD6A 1KYWA 3TO7A 1O3SA 3BCBA 2J5PA 4XRMA 2E2IJ 4DYCA 2BXYA 1VQ4I 2IPQX 4ZZLA 3WTTC 4HBLA 5DD8A 4QPOA 2DOEA 3BG3A 1FZPB 3AAFA 3VFZA 2EFQA 2EJRA 3JRHA 4MEYF 3M1CA 3MN2A 4BQNA 4EATA 2QEXI 1ZKGA 5CVIA 3DFGA 4PJLA 4G7HF 3E1SA 3WHCA 2HQNA 2OQRA 2ETHA 3RKYA 2QM3A 3NQOA 3NWSA 4HX8A 2Z3YA 3WG9A 1FOKA 4IRIA 2DXIA 2EZIA 3C3WA 2F5VA 1E3PA 5TISC 2LYCA 4KIBA 4OIPF 5CVRA 2RREA 3F6VA 4IOCF 4B3AA 1Z21A 2LBFA 2ZMEA 1R4NB 4Y33A 3E97A 5ERIA 2R7WA 2OZ6A 1IO2A 3V7CA 3EQLF 5HLIA 4X1EA 4MTEA 3OYBA 4AVZA 4XLHA 4LLGF 4A3DJ 2NS7A 4D7NA 5IOZA
chains in the Genus database with same CATH topology
3BG6A 2A5WA 1WJEA 3H5AA 4DIQA 1BR2A 3RTRA 3DPUA 3TMOA 3V42A 4IZZA 2XAUA 1MMAA 2CUZA 2F6CA 2MYSA 3OYIA 4LG3A 4F93B 4NC7A 2KHMA 2ZSHB 1UG0A 4XORA 3EUHC 1PJRA 2A6TA 2WA0A 5TGTA 1EGVG 1N75A 2L2OA 4XKCA 5JHFA 2PJRA 4IQ4A 4RM3A 3G2BA 3H9GA 3DTKA 2R7SA 3KX2A 3RPUD 4KT6A 2KDOA 3S8PA 4JOMA 1UC5G 3J7AY 2OV7A 3MKYB 3W2AA 1MMNA 5CQEA 4CCKA 4XLAA 2Z1DA 3EUKL 3FKJA 3K6GA 2CH0A 2X51A 4YELA 4XKWA 2WY8Q 3HOSA 3K4MA 3FBNB 2DJIA 4BE0A 2VPLA 3HOTA 2V6EA 2AQFA 2X1EA 3OYDA 3DTIA 4YEJA 2VQCA 2MABA 2W00A 3FDYA 4HPQA 5LD2C 3OWTA 4NC8A 4OWRB 1WJ5A 3EUAA 4U7BA 4RMNA 4YRVA 2VJ4A 3PL8A 2VQLA 3VYRB 3MKZA 2W7NA 2Y0SA 3DPLC 4NQWB 2VXZA 3LFUA 4HNTA 2M7AA 2KP6A 4ZDPA 4DOZA 1DQUA 2LOOA 3ONQA 4BEHB 3VSKA 2V9KA 2HQAA 3GBGA 3MMYB 1NG7A 2LH9A 3D5SC 3F9KA 2VKDA 3CJRB 2DOAA 4X0GA 4NNJA 2LY2A 4RLQA 5CPRB 3W3CA 3PSIA 4XL9A 2XC7A 1V5FA 1Z3YA 2M0MA 3L2WA 2L7KA 5KHDA 3HUGB 3RQ4A 2L5QA 3H9QA 4PK4A 3SZGA 3CP8A 4E7JA 5LFAA 2F4IA 2UV1A 3SEZA 3CZ6A 1TZLA 3BLYA 4H4KC 2WADA 3K70C 2VJIA 1D1AA 1MNDA 2VL8A 1PYVA 1GLNA 4PSXA 2V4JC 3PUBA 4F52A 1Y56A 1N77A 2X6WA 3OYEA 3RSNA 3OYMA 2OUMA 2BOLA 1VZ0A 3IP4B 4KISA 4CCMA 3DQVC 3DU6A 3MKWB 3UNGC 2XF7A 2IGNA 1LVKA 2AQEA 1V5GA 4C2TA 4ZDOA 2R4GA 3H5NA 1EEXG 2ZXIA 3HKZA 2ELJA 4BUPA 1WJDA 2IS2A 2IS1A 3OYJA 4BJ5C 3NWTA 3I3LA 2I8DA 1EA3A 4BQQA 3OMYA 1Z2ZA 1ZELA 2CW7A 2IS6A 3H35A 3K4LA 4DBQA 3OY9A 1Z7LA 2L9SA 4PSWA 2X6YA 4B3XA 1IWPG 1P9QC 4P1WA 4XOPA 1G59A 2VJ5A 2HVQA 2VASA 1T0FC 4FASD 5HOOA 2VXDA 3BCAA 3OYGA 1V5EA 3AL0B 1J09A 3C2GA 3H9JA 3N05A 3D5LA 3UR3C 2DT7B 4MLOA 4ZTJA 2KRHA 2CUJA 2VLAA 4LIUA 2WBMA 1X4OA 2M7BA 4J00A 2BW3B 4HG2A 2LREA 2PJRB 3PNYA 4B47A 1D0XA 4XNFA 4F91B 4BE2A 2WY7Q 2MC4A 2O5RA 5FROA 4XQFA 4JQFA 3HL2A 2JUGA 4CCOA 4C9YA 1QHHD 2KRCA 3VYSB 4PFPA 1YE9A 4XKBA 3ZR8X 2JA2A 3CMMA 5FRNA 2PMZA 4HNUA 1UELB 4XOTA 4BDZA 3QYFA 4ZDLA 1LDKB 4E7KA 2DT6A 2HDWA 3K70D 3A4CA 3PSFA 1HA8A 3K4JA 1DGRM 4LITA 1DP3A 1DIOG 5KNLA 4OAZA 3SEQA 2BVMA 4F3QA 3LMMA 5KCMA 2KZVA 1BR1A 3K4BA 4BE1A 2M4GA 3OYHA 1JI8A 3MD2A 3S93A 4B43A 3VYTB 2KL4A 1ERDA 4E7SA 2R7UA 3A1YA 3BC8A 4CA0A 4BL0B 3KYLA 3IAS2 3OS0A 4IQJA 3ZCOA 1LKXA 2LG4A 2W82A 2WAQA 3OIQA 3OR2C 2CV2A 1OR7C 1E0EA 4QPQA 4II3A 4B44A 4BACA 2P0WA 1UC4G 4P5OA 2HU9A 2X1DA 3HPHA 4XLFA 4D9JA 3FBIB 4AYBA 3HXLA 2KPMA 2DCEA 3AL0C 2NOJB 3H0DA 1FMVA 2R7XA 3DWLE 4BXFA 1TT0A 3QODA 4BGDA 2W4SA 1DGWY 2RNGA 2FUG2 4XR6A 3HPGA 3K4NA 3DU5A 2E60A 3L2QA 1R6RA 1T95A 4G6TB 2UUZA 1IWBG 3LSIA 4N4NB 4C2UA 4J01A 2R7VA 4NUBA 1X1DA 2V1NA 3LSKA 3K4CA 2XF6A 1LFPA 4BJTA 2CMPA 2HPIA 3PNVA 2HZDA 2JVGA 3IAM2 2VQGA 3KEYA 1WJBA 3BG7A 2RQQA 1X1BA 2WAFA 2E5NA 1AA7A 4CCJA 2UWMA 4HSRA 2CFOA 4E7LA 4E4HA 2LBFB 4D1QA 3CJQB 4PJMA 3OL3A 3W2VA 1D0ZA 2R7OA 1MMDA 1G8XA 4XN0A 2IGMA 2JSPA 2IS4A 3SDBA 1FMWA 1X19A 1D1CA 4XKVA 2Z16A 3HG9A 3TBIA 2MFZA 4XM3A 2Z2SB 2X85A 3LSHA 3M8JA 3DPTA 3H5RA 1Y6IA 3I9V2 1BOBA 2R7TA 2X1CA 3LL7A 1Z3XA 1BR4A 2MD0A 3S3MA 3OYLA 3OYKA 3S3NA 3CF2A 1W36C 3AUJG 3S32A 4E7IA 2IXSA 4DGWB 1IRXA 5HNFA 2HVRA 3OR1C 2QKLB 3DTEA 2BVLA 2M3AA 1KONA 3OYCA 2IGKA 2LC2A 2R7QA 4AU7A 4F92B 3OYNA 4XN3A 1QU3A 1U0JA 2X6XA 5FRMA 3EPZA 2K9LA 2WB1A 4U87A 4C30A 1MNEA 4LIVA 3TL4X 5CQGA 3IUOA 3ZRGA 4XMYA 2KMUA 4CSWA 2BW3A 4CUGA 2CW8A 3CESA 1D0YA 3L2VA 1QHGA 2LY1A 2GOXB 3C2HA 3AFHA 2CV1A 2E1MB 3L2RA 1X1AA 2XDVA 3PJRA 4HRIA 4Y3OA 4CCNA 1D1BA 4PUSA 4E7ZA 4XLCA 2K5CA 1WJCA 4IX7A 4XONA 3E0JB 3A2KA 3LSMA 3D5RC 4ZTFA 1MMFG 1X4PA 3K10A 2XSJC 4XLEA 4IKFA 3ZXSA 2M4KA 3LSGA 3DKYA 1EGMG 4HSTA 4BU2A 1X1CA 4B48A 3U21A 4BQOA 4OAYA 3VSLA 3QYEA 1SAUA 4BS9A 2ZXHA 1S9HA 3OOUA 4CH7A 2LRDA 3QOEA 2XF5A 2Q1ZB 3OL4A 4RLFA 2R7RA 3K4KA 2HNHA 1N78A 3OIPA 3DKXA 1MW7A 4HEA2 4CCLA 2V7FA 2E5ZA 4N4OB 2VQHA 1K6YA 3OS1A 1WJAA 3VDXA 2CS3A 3DLAA 4BEHA 4E7HA 5HNHA 3AKZA 3OYAA 4BDYA 3ZGKA 4FETA 3OS2A 2WAEA 4CZCA 3OYFA 2Q2EB 1OLTA 1W36D 3ZQQA 4R79A 2HVSA 3RCOA 2CV0A 2KLOA 3BCBA 2K3PA 4GRIA 4F55A 1YX5A 4KITB 1SFKA 3SYTA 4ANJA 4DBRA 1MMGA 2IGOA 4QPOA 1NG6A 4ZYAA 3DEEA 2VIXA 2ZSIB 2V26A 3W2WA 4KJZA 2JVHA 3M1CA 4BQNA 4EATA 4ZJZA 3HC7A 4PFOA 4PJLA 4ZC3A 3E1SA 2GOMA 2W1OA 4BJ6C 2VKHA 2E1MC 2ZFUA 3FHNA 2VB6A 3CP2A 4PJNA 1UAAA 2K9MA 3NWSA 5CKTA 5HVQC 4DJAA 2DXIA 2VJJA 2F5VA 3VWBA 5HLTA 1YX3A 2LYCA 2QKMB 4Y4RA 2RREA 4PJJA 1WFXA 3L2UA 1Z21A 3VYUB 2LBFA 4II2A 3S3OA 4Y33A 3PNTA 2R7WA 2KQRA 3PFYA 2L9NA 3QYBA 3OYBA 4ITVA 2OC6A 4RM2A 4AVZA 4XLHA 1WJFA 2HPMA 4E6KG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AL0 B;  3IP4 B;  1NG6 A; 
#chains in the Genus database with same CATH topology
 3OSF A;  1W0T A;  1J5Y A;  1JJ6 C;  1DU0 A;  3V42 A;  1R58 A;  5ILV A;  2CUZ A;  2F6C A;  2CO5 A;  3OYI A;  1R1T A;  2UZK A;  2HYJ A;  2FOK A;  4PZJ A;  1VF9 A;  1A5J A;  2L2O A;  3GTJ J;  5LRR A;  4WXC A;  5E18 F;  1ZR4 A;  1VQ6 I;  2R7S A;  3H0G J;  4ENN A;  1VQL I;  2VPR A;  1S7O A;  3GWZ A;  4JYK A;  4ENM A;  3S14 J;  2K02 A;  1QRY A;  3E7L A;  4NHJ A;  3J7A Y;  2EV0 A;  4RB2 C;  1EV7 A;  1MMN A;  5JR3 A;  2ID3 A;  5CQE A;  4BHC A;  2BXZ A;  4XLA A;  2H8R A;  4PJ0 C;  4AM3 A;  2HOT A;  4M9Z A;  2PI0 A;  1G2H A;  4YEL A;  1IN7 A;  3BG9 A;  1A6I A;  3K4M A;  2NRA C;  5JLX A;  1A6Q A;  5FKK A;  1TW2 A;  2X1E A;  4EVI A;  3ABT A;  1MIJ A;  4YEJ A;  2L9R A;  4A3B J;  1V4R A;  2M45 A;  3P9I A;  2M9H A;  2QBY A;  4FX0 A;  5E1Z B;  4HPQ A;  4ENJ A;  5LD2 C;  2JZY A;  4MFE A;  1WJ5 A;  2P81 A;  4JK1 X;  2Z9O A;  3BTI A;  2DPD A;  1X58 A;  3FZV A;  1D5Y A;  4BXX J;  3G73 A;  2HGC A;  4NQW B;  3LFU A;  4B1R A;  2Z33 A;  2M7A A;  5AIP A;  5B1B H;  3AG4 H;  4ZDP A;  4DOZ A;  2LOO A;  3ONQ A;  5L3E A;  1ZRF A;  3S17 J;  2MG4 A;  3DCF A;  1GVJ A;  2CW0 F;  2CUF A;  5BPD A;  5JFR A;  2LP0 A;  2VKD A;  4ON0 A;  3GTL J;  4KYW A;  5BPI A;  1LFU P;  1I1G A;  1UZC A;  1V5F A;  3ZQF A;  1Z3Y A;  2DQL A;  3VEP A;  4C3J J;  4NBQ A;  3VOE A;  1F43 A;  2GAU A;  3HUG B;  2CUE A;  4HQM A;  2L5Q A;  3RQ4 A;  3ZN0 A;  2IJL A;  4D7M A;  1ETQ A;  5IP6 A;  3ISP A;  3CP8 A;  3WTZ A;  3M8F A;  3A01 B;  1A35 A;  1TZL A;  4M6Y A;  2MSY A;  2FSW A;  1AU7 A;  1D1A A;  4A3J J;  4O5V A;  4PSX A;  1GLN A;  3RQI A;  2H6C A;  2W57 A;  3PUB A;  2CQ7 A;  1NHA A;  1T39 A;  1YJ9 I;  2R3S A;  1FEX A;  1XG1 A;  1IRF A;  2VT3 A;  4N9I A;  4MQV A;  1ETY A;  4KIS A;  1REP C;  1KU9 A;  3F72 A;  2NVT J;  4HV5 A;  3UNG C;  2AS5 F;  2DMN A;  3TW6 A;  2QSH X;  3BZC A;  4C2T A;  4ZDO A;  2ELH A;  3H5N A;  1JUP A;  2ZXI A;  3HKZ A;  3PUF A;  2DI3 A;  4BUP A;  2Y48 A;  3TKY A;  3I64 A;  2IS2 A;  2IS1 A;  2KT0 A;  2CU7 A;  4BQQ A;  2XVC A;  3OMY A;  1SAX A;  3GZ5 A;  2IS6 A;  4UUS B;  2XKO A;  4J19 A;  2XGE A;  5H6Q A;  2ZXW H;  1Z6T A;  2VJ5 A;  3HOU J;  5J8F A;  3KIO A;  1Y0N A;  5IOY A;  3F8B A;  1R22 A;  3N05 A;  1FPQ A;  3CD6 I;  1G4D A;  1IGN A;  3RPU A;  4FTH A;  1JKQ C;  1ZGA A;  2KRH A;  1VQ8 I;  2VLA A;  2WV1 A;  3I71 A;  2M8E A;  4XK4 A;  1FYM A;  2BW3 B;  4HG2 A;  4BHP A;  1GXP A;  3L7W A;  1QA6 A;  1D0X A;  1VQP I;  2L4A A;  2TDX A;  2WY7 Q;  1MBH A;  3CTA A;  1YRN A;  2O5R A;  5FRO A;  1H89 C;  4XQF A;  2JUG A;  3QAH A;  4IPA A;  4XLP F;  3S16 J;  1JKR C;  5CVU A;  3U2R A;  4EV0 A;  4HNV A;  3DBL B;  3K7A J;  1YE9 A;  4PFP A;  5LEJ A;  4S04 A;  5C3E J;  4IOA F;  2JA2 A;  1LEB A;  2P5K A;  3HJE A;  4HNU A;  2BE5 F;  1P6R A;  3TO6 A;  4BDZ A;  2AXT C;  1ACI A;  4DYQ A;  5DM7 F;  1BA5 A;  1SMT A;  1RR7 A;  1IDZ A;  3ZN1 A;  1F4K A;  1GHC A;  3BR1 A;  5IT3 A;  4H0E A;  3NEU A;  1GXQ A;  3BY6 A;  5KNL A;  2ZB9 A;  2IA2 A;  2XHK A;  3E6C C;  2UXX A;  3ROU A;  4DNC A;  1YHQ I;  2KZV A;  1U78 A;  4M6V A;  3MCZ A;  1YW9 A;  4GYI A;  3B6A A;  2KL4 A;  1EH7 A;  3A0B C;  4IEJ A;  4RGU A;  2QSG X;  5GTI C;  9ANT A;  2VI6 A;  4WX9 A;  3DEU A;  4E7S A;  3M3Y J;  2R7U A;  5ICE A;  4UV9 A;  4UVB A;  1U9N A;  4M72 A;  3BC8 A;  2K9S A;  4BL0 B;  1RKW A;  1YI2 I;  1P2F A;  2G7U A;  4YII A;  3WGI A;  2QUF A;  2NS8 A;  1T0F A;  3DEW A;  5EYR A;  2NVQ J;  1P4X A;  3HOX J;  4B8X A;  2CV2 A;  2DO7 A;  2IT0 A;  1G3S A;  2G0E A;  2XAG A;  2IA1 A;  1ZGW A;  4II3 A;  3WU2 C;  4BAC A;  1QZY A;  2P0W A;  3BWG A;  2FE3 A;  3HGY A;  1TLH B;  1GDT A;  4BNC A;  1UG2 A;  1FSH A;  3CLO A;  1D8K A;  3RZO J;  3V7R A;  5IY5 H;  3ZQI A;  5EEH A;  4M3E A;  2PBI A;  4LK1 F;  4A3L J;  1U9O A;  1LPQ A;  3RKX A;  3DKW A;  1X2N A;  3QOD A;  2W4S A;  3QPS A;  2RNG A;  1HKT A;  4BBR J;  3K1M A;  1GVD A;  2O8X A;  3HPG A;  5DCF A;  3CCQ I;  2E60 A;  3FXQ A;  4HDV A;  2EFW A;  2GA2 A;  5D4R A;  1T95 A;  1Z67 A;  4G6T B;  2UUZ A;  2LKP A;  5F64 A;  1Y8R B;  3J81 K;  2HYG D;  3F8F A;  3GFJ A;  2KIU A;  1X1D A;  2A6H F;  3PQJ A;  1IN6 A;  4A93 J;  3TP3 A;  2QLZ A;  3K4C A;  5E3M A;  1LFP A;  2HPI A;  2ZJP F;  1I5Z A;  5LBQ A;  3KEY A;  4EMS A;  4A0Y A;  1DPU A;  3H1C A;  1Y0U A;  1UMQ A;  4CCJ A;  4HX4 A;  1BI3 A;  4E7L A;  2LBF B;  2DK8 A;  4LG0 B;  2DYR H;  3DBH B;  3W2V A;  3OL3 A;  4BYY A;  5IT9 Z;  1FBS A;  2IS4 A;  3HBL A;  5FLV A;  2BY2 A;  3SDB A;  5FB2 A;  4G8X A;  3KCC A;  4CXF A;  2Z16 A;  1OCZ H;  4U88 A;  2MFZ A;  5E79 C;  5E3L A;  1MSF C;  2Q8K A;  4UB8 C;  4LJZ F;  1S29 A;  1FY7 A;  1WH5 A;  3M07 A;  1BR4 A;  2JN6 A;  2MD0 A;  2RKH A;  4EEF G;  3S3M A;  3OYK A;  2WWY A;  2NNN A;  3Q9S A;  1JTY A;  4DGW B;  1FLI A;  2W25 A;  2HVR A;  2Y0M A;  2QKL B;  4I01 A;  2BVL A;  2JWT A;  1LUJ B;  1VQ7 I;  2LC2 A;  1LJ9 A;  2ELK A;  3OYN A;  4K2E A;  5D4S A;  5DV5 A;  3CUO A;  4M9S A;  2I10 A;  3EPZ A;  4L5J A;  5CVV A;  4BAY A;  3HSF A;  3ZQ7 A;  2LLK A;  3IUO A;  4M74 A;  2IEK A;  4ASN A;  1HW2 A;  3IWZ A;  3HKZ N;  3VOD A;  2DW4 A;  1MBK A;  2HS5 A;  2LKX A;  2LY1 A;  2XUB A;  3C2H A;  2E1M B;  4LMY A;  5DEQ A;  2JPB A;  3L2R A;  4Y3O A;  4A3K J;  4PUS A;  1YS6 A;  3LSJ A;  1LEA A;  4KDP A;  2QA4 I;  3AG3 H;  1F5T A;  2QBY B;  2O03 A;  4IX7 A;  5F08 A;  3VB2 A;  3GF2 A;  2E35 A;  4AC0 A;  1TWC J;  3D5R C;  3KZI C;  1SFX A;  1Z0X A;  2OD5 A;  5ED4 A;  5L3D A;  3CCM I;  1USS A;  1I6H J;  3K0L A;  1E3O C;  5DM6 F;  3GEZ A;  1IC8 A;  4YIF A;  4IHY A;  3DF8 A;  3CO7 C;  3VSL A;  2FQ4 A;  1IZ1 A;  4Z6Y A;  4FIS A;  2CJJ A;  3ML6 A;  2LKS A;  4LOC A;  1SD4 A;  1P4W A;  4EJW A;  3JSP A;  2L7F P;  4OIR F;  3AG1 H;  1ZRD A;  2E34 A;  2F5F A;  3F8N A;  3OL4 A;  3J7Z I;  1JGS A;  4UVA A;  4HQE A;  1XGO A;  2NXN B;  1SVO A;  1XMX A;  3DKX A;  4CCL A;  2QZ8 A;  4AIH A;  3DXJ F;  2E5Z A;  1ZGJ A;  1Y8Q B;  2OBP A;  2VQH A;  2A07 F;  3OS1 A;  3LWF A;  1H8A C;  2OCE A;  2LMD A;  3IH2 A;  2IA0 A;  3SFI A;  2YX4 A;  1U8B A;  3NRV A;  1XDS A;  3J81 Z;  2QYO A;  3KLN A;  3MVP A;  4QLC U;  2PN6 A;  5HNH A;  1MBE A;  3FK6 A;  3ZGK A;  5L3F A;  3QPT A;  4CZC A;  2GIZ A;  2GXG A;  1OPC A;  4R79 A;  1B4A A;  2CQQ A;  1WKM A;  2K3P A;  4FHT A;  4GRI A;  3GFL A;  2JPC A;  1MMG A;  2YUS A;  2IGO A;  4I02 A;  3IRQ A;  1NG6 A;  4G7O F;  2VIX A;  4KA4 A;  2ZSI B;  3C18 A;  4G6Q A;  4KJZ A;  1KQ8 A;  3HC7 A;  1ODD A;  2EPF A;  4PFO A;  3QPH A;  5J8C A;  3QOP A;  1FIP A;  5FKL A;  1U5T A;  2E1M C;  1FJL A;  4HLY A;  1ZLK A;  2M30 A;  2VOO A;  2EWN A;  3FHN A;  1IV6 A;  3CP2 A;  4KIC A;  1ZN2 A;  4N9H A;  3E5X A;  4YFK F;  5HVQ C;  2LSO A;  4JX4 A;  4DJA A;  2X0L A;  3BP8 A;  1T2K A;  3Q5F A;  5HLT A;  3VWB A;  2VON A;  5E1X A;  1MNM C;  2M5W A;  2HYF A;  5EEA A;  4PJJ A;  3LOC A;  3IKT A;  1WFX A;  4P9F A;  3VYU B;  2JA6 J;  3P9K A;  1SVL A;  3PNT A;  5FKM A;  2EIK H;  3B02 A;  3TOB A;  3CLQ A;  2KQR A;  3PFY A;  2H1K A;  3C7J A;  3ZOB A;  5F0F A;  4I09 A;  1I39 A;  3QPL A;  4CYD A;  1KU2 A;  1WJF A;  3CDH A;  1IXS B;  4V19 K;  2DFI A;  3BG6 A;  4L5I A;  2A5W A;  3H5A A;  1PVE A;  2CQX A;  2XAU A;  2MYS A;  3IHU A;  1IXC A;  2R7D A;  1QO0 D;  1JGG A;  3ERE D;  3MZ8 A;  2GZW A;  1IRZ A;  5B1A H;  4A6D A;  3C2B A;  4LB6 B;  1ZAR A;  4DZJ A;  4IQ4 A;  4EM2 A;  3IRR A;  1RUO A;  3G2B A;  4HF2 A;  3H9G A;  4A0Z A;  3DTK A;  2STT A;  1S7E A;  2EV6 A;  3CJN A;  5HDN A;  2M87 A;  3WTY C;  3GZN B;  4I0B A;  3FK7 A;  1YLF A;  3BR6 A;  3JRA A;  3MKY B;  2HR3 A;  1TQI A;  2V1D A;  3GFM A;  1SMY F;  4CCK A;  1R71 A;  1LNW A;  1JJ8 C;  4B09 A;  2MBF A;  3FKJ A;  3BDD A;  4UB6 C;  4XKW A;  2WY8 Q;  1X1P A;  1ZR2 A;  3HDD A;  1PUF B;  3F22 A;  3E6D A;  2VPL A;  1W5S A;  1KZH A;  4D5F A;  2L7M P;  1TP4 A;  2VQC A;  2NOG A;  1W1W E;  3TOA A;  1RET A;  4I76 A;  2ECB A;  1RR8 C;  3O2P E;  3FDY A;  5F0C A;  4I0A A;  2FEZ A;  5J40 A;  3HEF A;  1XGM A;  3ZQH A;  3KYC B;  3EUA A;  4WWC A;  4MNU A;  4RMN A;  2K3F A;  1JKP C;  4LK0 F;  2W7N A;  1ZH5 A;  2Y0S A;  4NDL A;  2P7C B;  2RDP A;  2VXZ A;  3KP5 A;  2OCC H;  1KU7 A;  4A3G J;  5DYM A;  1IG7 A;  2I5U A;  2STW A;  1LDD A;  3CJR B;  4IF4 A;  1GUU A;  3TW7 A;  4ZYG A;  4NNJ A;  4IVN A;  4E70 A;  4X0G A;  2ZJR F;  2HZT A;  4XL9 A;  5HOD A;  1MGT A;  3CCE I;  2XC7 A;  2KIM A;  3RJP A;  3I56 I;  3L2W A;  1VTN C;  3JRF A;  3H9Q A;  4IHW A;  3AG2 H;  4PK4 A;  2KKO A;  5FLM J;  4I7H A;  4MEX F;  2JA5 J;  3CZ6 A;  3BLY A;  2VJI A;  1MND A;  1IUY A;  1PYV A;  5ILU A;  2GXB A;  3EDP A;  3N97 A;  4F52 A;  5FD5 A;  1N77 A;  3S1N J;  3Q3S A;  1FP1 D;  1JE8 A;  2X6W A;  2P8T A;  2VUM J;  2N8G A;  3ZQC A;  3RSN A;  3OYM A;  2O61 A;  2OUM A;  4KIF A;  3PFI A;  1QGP A;  4RAF A;  2P4W A;  4CCM A;  1E2X A;  3D1N I;  3DQV C;  3DU6 A;  1FSE A;  3WTS C;  2IGN A;  2YSR A;  2WV0 A;  1LVK A;  1G3W A;  3OIO A;  4B4C A;  2KIF A;  5ILS A;  2XPW A;  1M1E B;  2F4M B;  2R4G A;  2HKX A;  5D8L B;  3TED A;  1B9M A;  1XGS A;  1WJD A;  2YPR A;  3FXM A;  1TWF J;  2Y30 A;  2RVC A;  3I3L A;  1CF7 A;  4MQ9 F;  3E5U A;  1ZEL A;  2CW7 A;  3T8T A;  3H35 A;  3K4L A;  3RDI A;  3CCU I;  5EEG A;  4LG0 A;  1SEU A;  5EF6 A;  3FIS A;  2L9S A;  1P4A A;  2JRT A;  2X6Y A;  3F8M A;  3BZK A;  1IV8 A;  1IWP G;  1P9Q C;  4XOP A;  2H09 A;  3V7S A;  1G59 A;  1R4M B;  3L2C A;  1XSV A;  1T0F C;  5HOO A;  4OMY A;  1V5E A;  1J09 A;  3LA2 A;  4LB5 A;  3H9J A;  1BIA A;  2VC1 A;  2FF4 A;  3LA3 A;  3BJ6 A;  5A2Q K;  2HEO A;  2DOF A;  1F36 A;  1Z6R A;  2DT7 B;  4MLO A;  1U8R A;  2E1C A;  2CUJ A;  1LB2 A;  5DUK A;  4BY7 J;  3TP0 A;  1ETK A;  1OYI A;  1HF0 A;  2LRE A;  1NTC A;  2FJ1 A;  2Z5U A;  1K61 A;  4F91 B;  3WU1 B;  1B6A A;  4OIQ F;  1UHS A;  2DK5 A;  3HL2 A;  1BW5 A;  4C9Y A;  1QHH D;  2KRC A;  2P6S A;  3VYS B;  5BMZ A;  3CJT B;  3CMM A;  1UFM A;  4LFU A;  1S7A A;  3LAP A;  3QRF F;  2XGX A;  1K78 A;  1SD6 A;  3D0S A;  3PIP F;  3GTO J;  1D3Y A;  3GXO A;  4E7K A;  2A68 F;  2FBK A;  3S15 J;  2LDU A;  2KDZ A;  3B73 A;  2EZL A;  2QQB A;  4WCG A;  3A4C A;  3PSF A;  1HA8 A;  4QTR A;  1BI0 A;  2D1V A;  1SFE A;  4W1U A;  1FTT A;  1I1S A;  1DIO G;  2P6T A;  4OAZ A;  3SEQ A;  4F3Q A;  3CMY A;  3A03 A;  1YJW I;  3ECH A;  5J1Y A;  1VI0 A;  2FD5 A;  2DFH A;  4WXH A;  4OOI A;  4LLL A;  3RKW A;  2OA4 A;  3V8J A;  4B43 A;  4EJV A;  3K9T A;  1XGN A;  2FXA A;  4OMZ A;  4P55 A;  1BJZ A;  2DQR A;  3TO9 A;  1W5C C;  1YTY A;  4OU0 A;  4CA0 A;  3KYL A;  2R93 J;  3IAS 2;  2HDD A;  3CQZ J;  2HDC A;  3ZCO A;  4CGZ A;  4ABZ A;  5IYB J;  4Y15 A;  2WAQ A;  5FKN A;  3OIQ A;  1OR7 C;  4QPQ A;  1W4M A;  3FXU A;  3FMS A;  1G3Y A;  2UXN A;  3LST A;  1DPR A;  2A5Y B;  2MA3 A;  3HZJ A;  1UC4 G;  2X1D A;  1EJ9 A;  1MBF A;  3R0J A;  5FKO A;  3Q0V A;  3QP5 A;  4AYB A;  4A0X A;  2DCE A;  1WSU A;  3H0D A;  4RBO A;  2OQG A;  1J59 A;  4GGG A;  5DCM A;  2R7X A;  1VFC A;  3HRT A;  4BXF A;  1TT0 A;  4A3M J;  2ZCW A;  4FE4 A;  5LGU A;  3J7Y J;  5E8G A;  1ETW A;  3K4N A;  3DU5 A;  4DW6 A;  2L01 A;  4CDG A;  1RIO H;  2FBH A;  3L2Q A;  4BQA A;  1QVT A;  1WH7 A;  4FX4 A;  1U5T B;  1Y1W J;  2E1N A;  3R4K A;  3R6S A;  2V1N A;  4Q48 A;  4IL6 C;  2YX7 A;  2VBY A;  3CC2 I;  2V1X A;  2DU9 A;  2R7F A;  1YQA A;  2HFH A;  2XF6 A;  4BJT A;  2JMW A;  1S5L C;  2JVG A;  4Q5S F;  1WJB A;  3BG7 A;  1X1B A;  2HTS A;  2Y0S N;  1LFB A;  3SHF A;  1AA7 A;  2F2E A;  2UWM A;  2CFO A;  3W6J B;  2YR2 A;  5GPA A;  3GTK J;  1XCV A;  2LNB A;  3RYP A;  1A36 A;  2HQR A;  3CUQ C;  5A2Q Z;  5K5O A;  4HZF A;  3I53 A;  1OCP A;  5H6R A;  1E17 A;  1U6G A;  5GAD J;  4XM3 A;  1HDD C;  4MFD A;  4X6A J;  5DTD A;  2VE9 A;  2Z99 A;  1HLV A;  5IT9 K;  2IBD A;  1S8N A;  1Y6I A;  2ISY A;  2K9Q A;  3ASN H;  3HRM A;  3I9V 2;  1BOB A;  4RA2 A;  3LL7 A;  5F1J A;  2M0C A;  3P7N A;  4RAZ A;  3REO A;  1APL C;  4ZH4 F;  5F0H A;  1L0O C;  3C1D A;  3IWF A;  5F1R A;  5B5E C;  2ZKZ A;  2IXS A;  3ZPL A;  5M3F J;  2FOW A;  2DA2 A;  5F04 A;  5H2F C;  1Z05 A;  1E3H A;  3WE3 A;  2M3A A;  3F8C A;  1R5H A;  4AU7 A;  1W7P A;  2F5E A;  3O8H A;  1RPW A;  4F92 B;  2FX0 A;  1O3Q A;  1OCT C;  4UXN A;  2OF7 A;  3JW4 A;  1I50 J;  4XN3 A;  1U0J A;  3BTC A;  3S1Q J;  4KN7 X;  1QU3 A;  4JBA A;  4GCV A;  2WB1 A;  4U87 A;  3SQN A;  4LIV A;  1R49 A;  1X3Z B;  2KJC A;  1SD5 A;  1T6S A;  4U0V A;  2CFX A;  3QP6 A;  1YW8 A;  1W7P D;  4L0Z B;  3R61 A;  2BV6 A;  2CW8 A;  2XGD A;  4RAY A;  3L2V A;  1QHG A;  4AD9 A;  3EYY A;  5EGO B;  2PMH A;  2ESH A;  2XDV A;  2IVM A;  1J7K A;  3ASO H;  4CCN A;  1D1B A;  4FQG A;  2HXI A;  4ENK A;  1IF1 A;  4E7Z A;  5HLH A;  1F9N A;  3ZQL A;  2PG4 A;  1OYY A;  1U5T C;  4XON A;  3E0J B;  3A2K A;  2F4O B;  3T8R A;  1MMF G;  2XSJ C;  1OCR H;  2XIG A;  3LSG A;  3DKY A;  4IRG A;  4F7Z A;  1EGM G;  3O6B B;  4A3I J;  1HSJ A;  1PUF A;  1WI3 A;  1O7L A;  1ZHF A;  1X1C A;  2R0Q C;  3U21 A;  4BKX A;  3MEX A;  1VQK I;  3FF5 A;  2HOE A;  2E36 A;  2VE8 A;  3RZD J;  2W85 A;  2ZXH A;  4UUT A;  1T8I A;  2XKP A;  3OOU A;  2DBB A;  4DZP A;  4IHV A;  3JRE A;  4QWQ A;  3KZY A;  2XF5 A;  2EIJ H;  2R7R A;  1N78 A;  1TWG J;  1DP7 P;  2XPV A;  3GTP J;  3OIP A;  4HOB A;  4KFC A;  1O3R A;  2K27 A;  1K6Y A;  4A5N A;  1WJA A;  3BJA A;  3BR2 A;  3RKQ A;  1MBG A;  3ULQ B;  3DLA A;  4E7H A;  1H88 C;  1OIS A;  3T5X A;  4ZZD A;  1T08 B;  3OS2 A;  1ZQ3 P;  2WAE A;  2LF7 A;  2LY9 A;  1TWA J;  1C0W A;  4G94 A;  2Q2E B;  1OLT A;  1W36 D;  2YU9 J;  3LFK A;  3LSR A;  3N4M A;  1AOY A;  2KLO A;  3GTG J;  2ZNY A;  1WGX A;  1R7J A;  4F55 A;  1WHU A;  1YX5 A;  1JT6 A;  1SFK A;  3TDZ C;  1MZB A;  3U1D A;  4ANJ A;  4DBR A;  4KIT B;  2R92 J;  1UHW A;  2ESN A;  3F3X A;  4M3G A;  2LVS A;  1Y1V J;  3DEE A;  3WGG A;  3UKG A;  1FYL A;  4PGH A;  3W2W A;  3JAM Z;  1YG2 A;  4GYG A;  3SZP A;  2JVH A;  1CF7 B;  2J5O A;  4FT8 A;  1IDY A;  5LHI A;  3TGN A;  4L0Y B;  3I4N J;  2W1O A;  1X2M A;  1ZK8 A;  2W84 A;  3WTV C;  3BQY A;  1GV2 A;  2K86 A;  2K9M A;  2DDA A;  2QQ9 A;  2DA5 A;  2WAQ N;  2RGV A;  1QPM A;  2VJJ A;  1MSE C;  3FMR A;  1SC7 A;  4R8H A;  3HSE A;  2B0L A;  2M34 A;  2QKM B;  5L3B A;  1L3L A;  5C44 J;  1OYW A;  3I0T A;  1NK2 P;  1KA8 A;  1BBY A;  1MH4 A;  4XRS G;  2ZFW A;  4EM0 B;  1N25 A;  2PQ8 A;  3S3O A;  3F21 A;  3ZMT A;  5H20 A;  1OR7 A;  4A69 C;  2L9N A;  3V4G A;  1HCR A;  3DP7 A;  2OC6 A;  1V55 H;  2FA5 A;  1ZLJ A;  2HPM A;  3COA C;  4E6K G;  2QSF X;  4I98 B;  1SFU A;  4DIQ A;  1BR2 A;  2EH3 A;  3DPU A;  4RDU A;  2VOP A;  4RGS A;  1MMA A;  4LG3 A;  3GME A;  4NC7 A;  4Q47 A;  1XDU A;  4AID A;  1T56 A;  3FX3 A;  4XOR A;  1PJR A;  3PM1 A;  1K78 B;  2WA0 A;  3GO5 A;  5TGT A;  1WRJ A;  1WCM J;  2DMT A;  3KP4 A;  4XKC A;  3G1O A;  4RM3 A;  4YIR X;  1Y39 A;  4P96 A;  3ERM A;  2O8K A;  1JUS A;  3KX2 A;  5K5R A;  3HOW J;  2FRH A;  3KYD B;  1BC7 C;  2OV7 A;  3GFI A;  3BTJ A;  5IP9 J;  2RC4 A;  1TQP A;  2VT2 A;  1QVU A;  2PMU A;  2Z1D A;  3FM3 A;  4HV6 A;  5KK1 A;  2RN7 A;  1FX7 A;  2VKE A;  4KMU X;  1QNT A;  4RAG A;  3E5Q A;  2DJI A;  3I54 A;  4PCQ A;  4A6E A;  3HOT A;  2V6E A;  3PO3 J;  3OYD A;  3CUQ A;  3DTI A;  1LE8 A;  1TWH J;  4CHU A;  2W00 A;  4O3M A;  2DFE A;  2LF8 A;  4Y13 A;  1BL0 A;  1MJA A;  4LLN A;  1X3W B;  3HRS A;  2DN0 A;  1VQO I;  4NC8 A;  3S1M J;  4OWR B;  1J9I A;  2MH2 A;  2ISZ A;  4D5C A;  4U7B A;  1BM9 A;  4XSZ F;  4YRV A;  1B8I A;  2PJP A;  3PL8 A;  2VQL A;  2ZNZ A;  3GCM A;  5L3C A;  3VYR B;  1YFH A;  1ITY A;  3FHZ A;  5LRS A;  1KYZ A;  3G3Z A;  1Q1V A;  4IHS A;  1Z7U A;  1SVM A;  2JRM A;  4IJA A;  4HNT A;  3CCL I;  3QU6 A;  2WB1 N;  2KP6 A;  3JR9 A;  5DCM B;  1D8J A;  2K4B A;  4BEH B;  2D5V A;  4G9Y A;  3GBG A;  3MMY B;  4PDK A;  2LH9 A;  3D5S C;  3K2Z A;  2AO9 A;  3FIW A;  5L3G A;  4XIC A;  2C6Y A;  2IAI A;  3F9K A;  2DOA A;  2K7L A;  2LY2 A;  5CPR B;  5C4X J;  3PSI A;  5IP7 J;  3ZQG A;  2M0M A;  3BR0 A;  5LGT A;  3ZMD A;  5KHD A;  3WHB A;  5E20 A;  2JA7 J;  2YU3 A;  2BGC A;  3EUH A;  3QU3 A;  4E7J A;  4UNO A;  5LLQ A;  3CF5 F;  3K1N A;  2WAD A;  2RV8 A;  2K4J A;  4G6D A;  1IN5 A;  1R00 A;  3MZH A;  1Y56 A;  1QPI A;  2E7X A;  1B9N A;  2HOA A;  3BRO A;  3OYE A;  2DT5 A;  3WOD F;  2NYX A;  3CCJ I;  1ETV A;  2BOL A;  3IP4 B;  1ZTR A;  4AWX B;  4XBF A;  2EQR A;  2L3D A;  4HX7 A;  2COB A;  2AQE A;  4Q4Z F;  3R0A A;  3LNQ A;  1V5G A;  2K85 A;  5D5V B;  1Z1D A;  2R5Z B;  1B1B A;  1XB4 A;  1HW1 A;  3OYJ A;  4BJ5 C;  1RUN A;  1EA3 A;  4JX5 A;  4WXD A;  1Z7L A;  1FOY A;  5F27 A;  1I6X A;  4CIC A;  4PSW A;  4OIO F;  3S2W A;  2A05 A;  2H8W A;  1XC5 A;  2HVQ A;  2VAS A;  1FWZ A;  2DOD A;  2VXD A;  3AL0 B;  1W7P B;  2Y31 A;  3NAU A;  4M3D A;  4KNY A;  2DYS H;  1WWX A;  1OQY A;  2OJE D;  3D5L A;  3UR3 C;  1SFO J;  5GAH J;  1R5I D;  2P7V B;  1SD7 A;  2LTP A;  4LIU A;  1X4O A;  2M7B A;  3J7A O;  3QWL A;  3MAJ A;  2MLK A;  2PJR B;  1D5V A;  3G1M A;  1KGS A;  5ICG A;  5DS9 A;  5LGN A;  3GZ6 A;  4BE2 A;  5GTH C;  2MC4 A;  4XID A;  1RC9 A;  4WK8 F;  2F48 A;  3F6O A;  3MQ0 A;  4JQF A;  1H0M A;  4CCO A;  1WVR A;  1OCO H;  4XKB A;  3ZR8 X;  3HHH A;  5B3S H;  1YYV A;  2E2H J;  1UEL B;  1HBX G;  3BJO A;  3QYF A;  2A6E F;  4ZDL A;  2DLL A;  2CQN A;  1LDK B;  3T0Y A;  2DT6 A;  1S6L A;  4UVC A;  1VQ5 I;  3W6V A;  1EKE A;  2HDW A;  3K2A A;  3K70 D;  5EGO A;  3JCU C;  3ZMS A;  3K4J A;  3OSG A;  4BXU A;  1DGR M;  1OJL A;  4O6J A;  1Q1H A;  3ZMV A;  4BH9 A;  2XAH A;  2BVM A;  2VC0 A;  5JLW A;  2D1H A;  3LMM A;  3MFK A;  4Y17 A;  1FYK A;  3E6M A;  4I2O A;  4BE1 A;  2X48 A;  3P5J A;  4LD5 A;  3MD2 A;  2L7Z A;  3ZP5 A;  5GPC A;  3VYT B;  2PX9 A;  5LHG A;  1RI7 A;  3RPQ A;  3VPR A;  2EB7 A;  3G4S I;  1XSD A;  2OZU A;  1YIT I;  5D5W B;  3A1Y A;  1JUM A;  1BN5 A;  2ME0 A;  2VBZ A;  4HW0 A;  3OS0 A;  4G7Z F;  1AWC A;  1LKX A;  1B72 A;  1HDP A;  4YFX F;  4HF0 A;  2LG4 A;  2W82 A;  4MGR A;  3SDG A;  2CWE A;  1RRJ A;  3TQN A;  4B44 A;  4EJU A;  4P5O A;  3HPH A;  3HM5 A;  4D9J A;  2EBI A;  3H3U A;  2BY1 A;  3I59 B;  1FC3 A;  3AL0 C;  1MH3 A;  5B66 C;  1H9T A;  3MWM A;  4LGW A;  3HTS B;  4M73 A;  2XAJ A;  3E6B A;  3DWL E;  1DUX C;  1OMI A;  1DGW Y;  2QEN A;  4BHB A;  1TBX A;  2FUG 2;  2B9S A;  5ICF A;  2GBY A;  2H94 A;  5CJ9 A;  2JSC A;  2E7W A;  3CDI A;  5HS9 A;  1GT0 C;  1UST A;  2HKO A;  4GDF A;  1R6R A;  2Q2E A;  3ABU A;  5TRD A;  1ZRE A;  1MDM A;  1IWB G;  1RZ4 A;  1K7A A;  4C2U A;  4MO7 A;  2R7V A;  4UUV A;  5E17 F;  3IH3 A;  4M9X A;  4A2U A;  1WQ2 A;  3P9C A;  2CMP A;  2GWR A;  2HZD A;  1ZG3 A;  2VQG A;  3I4P A;  4EQQ A;  1TTY A;  4L9V A;  2EK5 A;  3DBR B;  3K1P A;  2XPU A;  2GLO A;  2Y69 H;  4D0P A;  2DA3 A;  5K1Y A;  4OIN F;  3F0C A;  1D0Z A;  1MMD A;  1G8X A;  1P7J A;  2JSP A;  2BHZ A;  4QIW N;  1X19 A;  1XCB A;  5K7Z A;  2RQP A;  2R5Y B;  1D1C A;  2DTR A;  5GAE J;  4XKV A;  4EGZ A;  4CYC A;  1JTX A;  3M1E A;  1MBJ A;  2Y9Y A;  3LSH A;  3G71 I;  3L9F A;  3LQQ A;  3HOZ J;  3DPT A;  2KJB A;  2X1C A;  1ZYR F;  3KLO A;  3GLX A;  1XSX A;  2V9P A;  4FCY A;  1OKR A;  3HGG A;  5EDN A;  3HTU A;  4RB3 C;  3WTW C;  3OYL A;  3S3N A;  1W36 C;  4Y52 J;  4IXA A;  1IRX A;  3HRU A;  5HNF A;  1O4X A;  1I3A A;  4ETS A;  5GAG J;  2VKV A;  2XV4 S;  1KON A;  1OFC X;  3OYC A;  2IGK A;  3CCY A;  2X4H A;  3A0H C;  1T33 A;  3H3V K;  2NS0 A;  1YJN I;  2DFF A;  1XD7 A;  5FRM A;  5AON A;  1FOX A;  3IH4 A;  4C30 A;  1MNE A;  3I4M J;  2IRF G;  3I55 I;  4IO9 F;  2V6C A;  1EF4 A;  3ZRG A;  2GM4 A;  3BOQ A;  4XMY A;  2L9V A;  5M5X J;  4EGY A;  2VBX A;  2BHY A;  3CES A;  2QQA A;  3AFH A;  2CV1 A;  2MC3 A;  3CUQ B;  1LE8 B;  5JVT A;  2ZJQ F;  1K79 A;  3ECO A;  1TNT A;  4L9T A;  3WTU C;  4RB0 A;  3BTL A;  2EIL H;  4MTD A;  3OOP A;  4XLC A;  2K5C A;  4C3I J;  3FM5 A;  1NH3 A;  3ABL H;  1WJC A;  4I99 C;  5E1W A;  1J0R A;  4ZTF A;  1X4P A;  2XGC A;  4IKF A;  4XLE A;  1B8I B;  5D5X B;  1W5T A;  1XMK A;  2LFB A;  2M4K A;  3FXK A;  2DA7 A;  2ACJ A;  2JK3 A;  2LR8 A;  1U3E M;  1ORK A;  5FO5 A;  4A3E J;  2DA4 A;  4BS9 A;  2ZBK A;  1G6N A;  5J6X A;  2CGP A;  1S9H A;  3KE2 A;  4XRS A;  2B63 J;  1JXS A;  3U9G A;  4CH7 A;  4HLX A;  2GXA A;  3QOE A;  3FWE A;  1RES A;  3K4K A;  2HNH A;  1FBQ A;  3S1R J;  4R1H A;  4N4O B;  3WE2 A;  1DU6 A;  4MIM A;  3V8L A;  3VDX A;  1J2X A;  1UCR A;  5E8I A;  3J80 Z;  1O3T A;  4BEH A;  1R23 A;  1EH8 A;  2JA8 J;  4DQ2 A;  3OYA A;  1A04 A;  4BDY A;  4HAM A;  4W97 A;  3Q0W A;  4FET A;  4ESB A;  3KP6 A;  1MKM A;  3I5U A;  3OYF A;  4M3B A;  3HIF A;  2AXL A;  3ZQQ A;  2HVS A;  2CRG A;  1HST A;  4UV8 A;  1WZ2 A;  3KEQ A;  3ABM H;  2XRN A;  3WTX C;  4ZYH A;  3SYT A;  4UHT A;  3HOY J;  4HA8 A;  1EH6 A;  3IL2 A;  4ZYA A;  3GX4 X;  2XAF A;  4XRF A;  2P5L C;  1K83 J;  2KIS A;  2V26 A;  1ETO A;  4QSH A;  4EM1 A;  3FXJ A;  1J75 A;  3K69 A;  4ZJZ A;  3HHG A;  1ETX A;  4ZC3 A;  2GOM A;  4BY1 J;  4BJ6 C;  2VKH A;  3TDU C;  4BBS J;  4A3C J;  4JX6 A;  2ZFU A;  4GO1 A;  2VB6 A;  1W0U A;  1TL8 A;  4PJN A;  2H27 A;  1UAA A;  4V2F A;  5CKT A;  1TQM A;  2COM A;  3EYI A;  3JAM K;  3CC4 I;  5FLX K;  5K7H A;  2R5Z A;  1VQM I;  3OV8 A;  1HXD A;  1YX3 A;  1AKH A;  4Y4R A;  3SZT A;  1S3J A;  3E3V A;  1JHH A;  1GV5 A;  1FIA A;  2MD5 A;  2WTE A;  3ESW B;  4M71 A;  2AHQ A;  3L2U A;  4II2 A;  1R9T J;  2G7H A;  2JQ7 A;  1LVA A;  3CCR I;  2DPU A;  3GTM J;  3LAJ A;  4U7D A;  3QYB A;  2KFD A;  5FJ8 J;  4ITV A;  4S0H B;  4RM2 A;  2G9W A;  3O3K A;  4KN4 X;  2RNJ A;  2DMU A;  2L0K A;  2F5D A;  2DA6 A;  4IZZ A;  1WJE A;  2PLY A;  4L9N A;  3RTR A;  1POG A;  3TMO A;  4DYR A;  2BEO A;  1I27 A;  4F93 B;  1QQI A;  2KHM A;  3BPV A;  2CG4 A;  1UG0 A;  2ZSH B;  4L9J A;  1BJA A;  3EUH C;  3CMA I;  1FNN A;  2A6T A;  1EGV G;  2O3F A;  5BNG A;  1N75 A;  5HS7 A;  5JHF A;  2PJR A;  2O0Y A;  3FXL A;  5FFZ A;  2XB5 A;  3GTQ J;  3V8K A;  3H92 A;  1IW7 F;  5CVJ A;  3RPU D;  1KQ9 A;  4KT6 A;  2KDO A;  3S8P A;  1YO5 C;  4JOM A;  2X9D A;  1UC5 G;  1V54 H;  2ID6 A;  1S72 I;  3W2A A;  2JTV A;  4PGG A;  2E71 A;  3RI4 A;  4U0W A;  2HQ5 A;  3EUK L;  2L02 A;  3K6G A;  2CH0 A;  2X51 A;  5ICC A;  2EA2 A;  3HOS A;  2GIV A;  2XRO A;  2NVY J;  3FBN B;  3SXY A;  4BE0 A;  2DMQ A;  2V1U A;  3ZMZ A;  2AQF A;  3SJM A;  2JUC A;  1ENH A;  1PP8 F;  1VQ9 I;  2XRL A;  2MAB A;  4G12 A;  4L5E A;  5BQT A;  2EA4 A;  1FBU A;  1QBJ A;  5EG0 A;  1B72 B;  5KAF C;  3U1K A;  3OWT A;  1WI9 A;  2XAQ A;  2ZXJ A;  1ULY A;  3GLL A;  2BY0 A;  4YG2 F;  2VJ4 A;  5FFX A;  4ESJ A;  2Q0O A;  1CQT A;  3KFW X;  3MKZ A;  3GVA A;  2H6B A;  3DPL C;  4P9U A;  3IC7 A;  5TJJ A;  1DQU A;  3VSK A;  2V9K A;  2HQA A;  3RYR A;  5JVG F;  1NG7 A;  1T98 A;  5KVR A;  5GP9 A;  3BG5 A;  1IJW C;  3LQR A;  3GYH X;  4RLQ A;  3W3C A;  2O6G E;  1XMA A;  4V2G A;  2FU4 A;  5J3L A;  4FE7 A;  2L7K A;  2NVU B;  1MDM B;  1HKS A;  1X3U A;  3I59 A;  3SZG A;  2VN2 A;  1XPX A;  5LFA A;  2F4I A;  2ICW G;  2UV1 A;  3KPH A;  3HYI A;  2B7E A;  1MJB A;  1ZAO A;  3SEZ A;  2HI3 A;  2JJ7 A;  5DDG A;  4H4K C;  1H9G A;  3K70 C;  1FP2 A;  2ZJ2 A;  2VL8 A;  2H1L A;  3FXR A;  2EFO A;  1U2W A;  3QQA A;  2V4J C;  2BBY A;  3H3Z A;  1ZRC A;  5FLX Z;  5HDK A;  1IN8 A;  5J4Y A;  2CSO A;  2ADU A;  3HSR A;  1VZ0 A;  2F5C A;  2W24 A;  3MKW B;  3KZZ A;  3JSO A;  1R36 A;  2XF7 A;  3ABK H;  3LSP A;  3L1P A;  3MKL A;  3BR5 A;  3KEO A;  1EEX G;  2ELJ A;  1QZZ A;  4CYC B;  3CC7 I;  2P5V A;  2EZH A;  2WC2 A;  4AYB N;  3CCV I;  2X6O A;  2NAZ A;  3NWT A;  1LQ1 A;  2I8D A;  1BIB A;  4IHX A;  1Z2Z A;  1NK3 P;  2ZME B;  5J4V A;  2M8G X;  5HLG A;  4DBQ A;  3OY9 A;  3JRD A;  5DD4 A;  4B3X A;  2FBI A;  5JHU A;  4P1W A;  3G1L A;  1JKO C;  2M2E A;  1JHF A;  2NNY A;  4Z2Y A;  3KP3 A;  2R5Y A;  1ON1 A;  5J1R A;  4FAS D;  5C4J J;  1BOA A;  3BCA A;  3H36 A;  4HYE A;  2EZK A;  3OYG A;  4C3H J;  1MMS A;  3C2G A;  4A3F J;  4ZYD A;  4AIJ A;  2E1O A;  4GXO A;  5FGM A;  2K40 A;  2HOS A;  2LD5 A;  4ZTJ A;  3WGH A;  2CYY A;  2XAS A;  1IUF A;  2WBM A;  4J00 A;  2KRF A;  4M3F A;  3PNY A;  5M3M J;  1ONV A;  2DMP A;  3Q9V A;  4B47 A;  3M7G A;  3IKV A;  4XNF A;  3BR3 A;  3BPX A;  2EIM H;  3O8G A;  3SFZ A;  1TC3 C;  4HF1 A;  1K6O A;  1YW7 A;  4Y7N J;  4EJT A;  1R1V A;  5BOX A;  3A02 A;  2FNA A;  2V79 A;  4IHT A;  2K9N A;  5F6F A;  5FRN A;  2PMZ A;  1F1Z A;  1YIO A;  4XOT A;  1ZG5 A;  4RS8 A;  1MD0 A;  3KP7 A;  1P92 A;  2QQ8 A;  2HXO A;  2MW8 A;  4IRH A;  4A12 A;  3CO6 C;  2ZO4 A;  2XB0 X;  4CO8 A;  1YIJ I;  2EFP A;  2MLG A;  5K5Q A;  4LIT A;  1DP3 A;  5IYC J;  3IV5 A;  4RB1 A;  3JTG A;  5DUI A;  2O7O A;  1HC8 A;  5KCM A;  3BZ6 A;  1BR1 A;  3K4B A;  1O57 A;  2M4G A;  5J1U A;  3OYH A;  1JI8 A;  4AVP A;  3S93 A;  5EZH A;  3JRI A;  1HW5 A;  1ERD A;  3PQK A;  2Y2Z A;  4I6Z A;  1BC8 C;  5LEK A;  1IN4 A;  2DJN A;  4M6X A;  3JTH A;  4KT5 C;  4IQJ A;  2O9L A;  2ZME C;  1FT9 A;  2QF7 A;  5J47 A;  3OR2 C;  3Q0U A;  1E0E A;  2FML A;  5HDG A;  2HU9 A;  1TNS A;  4XLF A;  2YS9 A;  3FBI B;  3HXL A;  2KPM A;  1FTZ A;  2XSD C;  3M9A A;  2CQK A;  2QGU A;  5K7F A;  2NOJ B;  4KIG A;  4NQW A;  1V3F A;  1FMV A;  1B59 A;  3GW2 A;  4KUM A;  1VQN I;  1PUE E;  4BGD A;  2EFN A;  2OAZ A;  4XR6 A;  3M4O J;  1IXR C;  1LDJ A;  1IRG A;  1YS7 A;  4NC6 A;  4XSX F;  1R1U A;  1G3T A;  3HUG A;  1XN7 A;  3LSI A;  4N4N B;  1ON2 A;  3JRG A;  1TT5 B;  4MHG A;  4J01 A;  2BZT A;  3LA7 A;  4NUB A;  3WU0 A;  3JRB A;  2E19 A;  2Y75 A;  3LSK A;  1UJ8 A;  3A01 A;  1K4T A;  3KET A;  5M5Y J;  4ESF A;  4UY8 I;  3RIR A;  2PFB A;  1UB9 A;  4EJO A;  1DDN A;  1I3Q J;  3PNV A;  3IAM 2;  1AHD P;  3F23 A;  2ZC2 A;  3BQZ A;  4ZYE A;  1YOV B;  2RQQ A;  1AKH B;  5IPA A;  2WAF A;  2E5N A;  2VBW A;  2QVO A;  4HSR A;  5E3O A;  1IAW A;  1VND A;  4E4H A;  2A61 A;  4AUX A;  4D1Q A;  3CCS I;  3CJQ B;  4PJM A;  4RGR A;  2R7O A;  2OU2 A;  1MJ9 A;  1XX5 A;  4XN0 A;  2IGM A;  3ELK A;  5M5W J;  1FMW A;  2M1B A;  3R60 A;  3HB9 A;  5BS6 A;  1RKT A;  5EZG A;  2IP2 A;  3HG9 A;  3TBI A;  1FOW A;  1P7I A;  2Z2S B;  2X85 A;  3M8J A;  4NB5 A;  4N0B A;  2ECC A;  3H5R A;  5D8K B;  2MGQ A;  3CDL A;  2DA1 A;  4L18 B;  2R7T A;  2FNP A;  3WG7 H;  4UUS A;  6PAX A;  2LK2 A;  3HOV J;  1Z91 A;  1K4S A;  1CGP A;  1Z3X A;  3JRC A;  1KQ0 A;  4C2M J;  1Z77 A;  4AIK A;  1R5G A;  3AUJ G;  3CF2 A;  3S32 A;  4E7I A;  2R7Z J;  2DTZ A;  2GQQ A;  2HTJ A;  3OR1 C;  3DTE A;  2NVX J;  2R7Q A;  3FKI J;  1XTA A;  1YRN B;  2KIQ A;  2L4M A;  1SAN A;  2JT1 A;  1WPK A;  5HS8 A;  3FXO A;  2X6X A;  5D5U B;  2K9L A;  1O7F A;  3TL4 X;  1HOM A;  5CQG A;  1RNL A;  1STZ A;  2D2W A;  3NAR A;  1BI1 A;  2KMU A;  5AIQ A;  4CSW A;  2OTL I;  2BW3 A;  4CUG A;  5IYD J;  1D0Y A;  2VOD A;  1OCC H;  1TW3 A;  2OTJ I;  2GOX B;  3EET A;  2E2J J;  2EIN H;  2L54 A;  3X2Q H;  2QWW A;  4XLN F;  3KP2 A;  1X1A A;  5D6E A;  2Y9Z A;  3PJR A;  4HDU A;  4HRI A;  1JT0 A;  3L00 A;  3B6C A;  3M8E A;  5EJC A;  2BY3 A;  5E3N A;  4YFN F;  5LHH A;  3BT9 A;  2OPT A;  5EG0 B;  1T38 A;  1KU3 A;  2IW5 A;  3GUD A;  1A31 A;  2EV5 A;  3LSM A;  3DV8 A;  3I58 A;  3K10 A;  3DLL F;  2W48 A;  3G6E I;  3MZY A;  3ZXS A;  1UHM A;  1HQC A;  3CME I;  1QZE A;  2FMY A;  5CLS A;  4HST A;  1Z9C A;  4BU2 A;  1HKQ A;  4B48 A;  3PIO F;  4BQO A;  2PEX A;  4OAY A;  3QYE A;  1ZG1 A;  3S2H J;  1SAU A;  4TV7 A;  2TRT A;  4U0Y A;  2A3S A;  3PO2 J;  2QCO A;  3S2D J;  2A69 F;  2LRD A;  1XS9 A;  2DAO A;  5JI6 A;  3W6K B;  2Q1Z B;  2RAE A;  4RLF A;  2ME6 A;  2DDB A;  1PDN C;  1MW7 A;  2HWV A;  4HEA 2;  2V7F A;  2MH9 A;  1PP7 U;  4GFB A;  2TCT A;  4JP0 A;  4RGX A;  5CYV A;  1BW6 A;  2CS3 A;  2PMZ N;  3FMQ A;  2V9V A;  2FQ3 A;  3AKZ A;  4WF2 A;  5D6F A;  4CZZ A;  4A5M A;  2KZG A;  3L09 A;  3T1B A;  1BI2 A;  2GA1 A;  2D45 A;  4KMF A;  2BYV E;  5KAI C;  4S05 A;  3RCO A;  3J80 K;  2CV0 A;  3ZMU A;  5FD6 A;  1KYW A;  3TO7 A;  1O3S A;  3BCB A;  2J5P A;  4XRM A;  2E2I J;  4DYC A;  2BXY A;  1VQ4 I;  2IPQ X;  4ZZL A;  3WTT C;  4HBL A;  5DD8 A;  4QPO A;  2DOE A;  3BG3 A;  1FZP B;  3AAF A;  3VFZ A;  2EFQ A;  2EJR A;  3JRH A;  4MEY F;  3M1C A;  3MN2 A;  4BQN A;  4EAT A;  2QEX I;  1ZKG A;  5CVI A;  3DFG A;  4PJL A;  4G7H F;  3E1S A;  3WHC A;  2HQN A;  2OQR A;  2ETH A;  3RKY A;  2QM3 A;  3NQO A;  3NWS A;  4HX8 A;  2Z3Y A;  3WG9 A;  1FOK A;  4IRI A;  2DXI A;  2EZI A;  3C3W A;  2F5V A;  1E3P A;  5TIS C;  2LYC A;  4KIB A;  4OIP F;  5CVR A;  2RRE A;  3F6V A;  4IOC F;  4B3A A;  1Z21 A;  2LBF A;  2ZME A;  1R4N B;  4Y33 A;  3E97 A;  5ERI A;  2R7W A;  2OZ6 A;  1IO2 A;  3V7C A;  3EQL F;  5HLI A;  4X1E A;  4MTE A;  3OYB A;  4AVZ A;  4XLH A;  4LLG F;  4A3D J;  2NS7 A;  4D7N A;  5IOZ A; 
#chains in the Genus database with same CATH homology
 3BG6 A;  2A5W A;  1WJE A;  3H5A A;  4DIQ A;  1BR2 A;  3RTR A;  3DPU A;  3TMO A;  3V42 A;  4IZZ A;  2XAU A;  1MMA A;  2CUZ A;  2F6C A;  2MYS A;  3OYI A;  4LG3 A;  4F93 B;  4NC7 A;  2KHM A;  2ZSH B;  1UG0 A;  4XOR A;  3EUH C;  1PJR A;  2A6T A;  2WA0 A;  5TGT A;  1EGV G;  1N75 A;  2L2O A;  4XKC A;  5JHF A;  2PJR A;  4IQ4 A;  4RM3 A;  3G2B A;  3H9G A;  3DTK A;  2R7S A;  3KX2 A;  3RPU D;  4KT6 A;  2KDO A;  3S8P A;  4JOM A;  1UC5 G;  3J7A Y;  2OV7 A;  3MKY B;  3W2A A;  1MMN A;  5CQE A;  4CCK A;  4XLA A;  2Z1D A;  3EUK L;  3FKJ A;  3K6G A;  2CH0 A;  2X51 A;  4YEL A;  4XKW A;  2WY8 Q;  3HOS A;  3K4M A;  3FBN B;  2DJI A;  4BE0 A;  2VPL A;  3HOT A;  2V6E A;  2AQF A;  2X1E A;  3OYD A;  3DTI A;  4YEJ A;  2VQC A;  2MAB A;  2W00 A;  3FDY A;  4HPQ A;  5LD2 C;  3OWT A;  4NC8 A;  4OWR B;  1WJ5 A;  3EUA A;  4U7B A;  4RMN A;  4YRV A;  2VJ4 A;  3PL8 A;  2VQL A;  3VYR B;  3MKZ A;  2W7N A;  2Y0S A;  3DPL C;  4NQW B;  2VXZ A;  3LFU A;  4HNT A;  2M7A A;  2KP6 A;  4ZDP A;  4DOZ A;  1DQU A;  2LOO A;  3ONQ A;  4BEH B;  3VSK A;  2V9K A;  2HQA A;  3GBG A;  3MMY B;  1NG7 A;  2LH9 A;  3D5S C;  3F9K A;  2VKD A;  3CJR B;  2DOA A;  4X0G A;  4NNJ A;  2LY2 A;  4RLQ A;  5CPR B;  3W3C A;  3PSI A;  4XL9 A;  2XC7 A;  1V5F A;  1Z3Y A;  2M0M A;  3L2W A;  2L7K A;  5KHD A;  3HUG B;  3RQ4 A;  2L5Q A;  3H9Q A;  4PK4 A;  3SZG A;  3CP8 A;  4E7J A;  5LFA A;  2F4I A;  2UV1 A;  3SEZ A;  3CZ6 A;  1TZL A;  3BLY A;  4H4K C;  2WAD A;  3K70 C;  2VJI A;  1D1A A;  1MND A;  2VL8 A;  1PYV A;  1GLN A;  4PSX A;  2V4J C;  3PUB A;  4F52 A;  1Y56 A;  1N77 A;  2X6W A;  3OYE A;  3RSN A;  3OYM A;  2OUM A;  2BOL A;  1VZ0 A;  3IP4 B;  4KIS A;  4CCM A;  3DQV C;  3DU6 A;  3MKW B;  3UNG C;  2XF7 A;  2IGN A;  1LVK A;  2AQE A;  1V5G A;  4C2T A;  4ZDO A;  2R4G A;  3H5N A;  1EEX G;  2ZXI A;  3HKZ A;  2ELJ A;  4BUP A;  1WJD A;  2IS2 A;  2IS1 A;  3OYJ A;  4BJ5 C;  3NWT A;  3I3L A;  2I8D A;  1EA3 A;  4BQQ A;  3OMY A;  1Z2Z A;  1ZEL A;  2CW7 A;  2IS6 A;  3H35 A;  3K4L A;  4DBQ A;  3OY9 A;  1Z7L A;  2L9S A;  4PSW A;  2X6Y A;  4B3X A;  1IWP G;  1P9Q C;  4P1W A;  4XOP A;  1G59 A;  2VJ5 A;  2HVQ A;  2VAS A;  1T0F C;  4FAS D;  5HOO A;  2VXD A;  3BCA A;  3OYG A;  1V5E A;  3AL0 B;  1J09 A;  3C2G A;  3H9J A;  3N05 A;  3D5L A;  3UR3 C;  2DT7 B;  4MLO A;  4ZTJ A;  2KRH A;  2CUJ A;  2VLA A;  4LIU A;  2WBM A;  1X4O A;  2M7B A;  4J00 A;  2BW3 B;  4HG2 A;  2LRE A;  2PJR B;  3PNY A;  4B47 A;  1D0X A;  4XNF A;  4F91 B;  4BE2 A;  2WY7 Q;  2MC4 A;  2O5R A;  5FRO A;  4XQF A;  4JQF A;  3HL2 A;  2JUG A;  4CCO A;  4C9Y A;  1QHH D;  2KRC A;  3VYS B;  4PFP A;  1YE9 A;  4XKB A;  3ZR8 X;  2JA2 A;  3CMM A;  5FRN A;  2PMZ A;  4HNU A;  1UEL B;  4XOT A;  4BDZ A;  3QYF A;  4ZDL A;  1LDK B;  4E7K A;  2DT6 A;  2HDW A;  3K70 D;  3A4C A;  3PSF A;  1HA8 A;  3K4J A;  1DGR M;  4LIT A;  1DP3 A;  1DIO G;  5KNL A;  4OAZ A;  3SEQ A;  2BVM A;  4F3Q A;  3LMM A;  5KCM A;  2KZV A;  1BR1 A;  3K4B A;  4BE1 A;  2M4G A;  3OYH A;  1JI8 A;  3MD2 A;  3S93 A;  4B43 A;  3VYT B;  2KL4 A;  1ERD A;  4E7S A;  2R7U A;  3A1Y A;  3BC8 A;  4CA0 A;  4BL0 B;  3KYL A;  3IAS 2;  3OS0 A;  4IQJ A;  3ZCO A;  1LKX A;  2LG4 A;  2W82 A;  2WAQ A;  3OIQ A;  3OR2 C;  2CV2 A;  1OR7 C;  1E0E A;  4QPQ A;  4II3 A;  4B44 A;  4BAC A;  2P0W A;  1UC4 G;  4P5O A;  2HU9 A;  2X1D A;  3HPH A;  4XLF A;  4D9J A;  3FBI B;  4AYB A;  3HXL A;  2KPM A;  2DCE A;  3AL0 C;  2NOJ B;  3H0D A;  1FMV A;  2R7X A;  3DWL E;  4BXF A;  1TT0 A;  3QOD A;  4BGD A;  2W4S A;  1DGW Y;  2RNG A;  2FUG 2;  4XR6 A;  3HPG A;  3K4N A;  3DU5 A;  2E60 A;  3L2Q A;  1R6R A;  1T95 A;  4G6T B;  2UUZ A;  1IWB G;  3LSI A;  4N4N B;  4C2U A;  4J01 A;  2R7V A;  4NUB A;  1X1D A;  2V1N A;  3LSK A;  3K4C A;  2XF6 A;  1LFP A;  4BJT A;  2CMP A;  2HPI A;  3PNV A;  2HZD A;  2JVG A;  3IAM 2;  2VQG A;  3KEY A;  1WJB A;  3BG7 A;  2RQQ A;  1X1B A;  2WAF A;  2E5N A;  1AA7 A;  4CCJ A;  2UWM A;  4HSR A;  2CFO A;  4E7L A;  4E4H A;  2LBF B;  4D1Q A;  3CJQ B;  4PJM A;  3OL3 A;  3W2V A;  1D0Z A;  2R7O A;  1MMD A;  1G8X A;  4XN0 A;  2IGM A;  2JSP A;  2IS4 A;  3SDB A;  1FMW A;  1X19 A;  1D1C A;  4XKV A;  2Z16 A;  3HG9 A;  3TBI A;  2MFZ A;  4XM3 A;  2Z2S B;  2X85 A;  3LSH A;  3M8J A;  3DPT A;  3H5R A;  1Y6I A;  3I9V 2;  1BOB A;  2R7T A;  2X1C A;  3LL7 A;  1Z3X A;  1BR4 A;  2MD0 A;  3S3M A;  3OYL A;  3OYK A;  3S3N A;  3CF2 A;  1W36 C;  3AUJ G;  3S32 A;  4E7I A;  2IXS A;  4DGW B;  1IRX A;  5HNF A;  2HVR A;  3OR1 C;  2QKL B;  3DTE A;  2BVL A;  2M3A A;  1KON A;  3OYC A;  2IGK A;  2LC2 A;  2R7Q A;  4AU7 A;  4F92 B;  3OYN A;  4XN3 A;  1QU3 A;  1U0J A;  2X6X A;  5FRM A;  3EPZ A;  2K9L A;  2WB1 A;  4U87 A;  4C30 A;  1MNE A;  4LIV A;  3TL4 X;  5CQG A;  3IUO A;  3ZRG A;  4XMY A;  2KMU A;  4CSW A;  2BW3 A;  4CUG A;  2CW8 A;  3CES A;  1D0Y A;  3L2V A;  1QHG A;  2LY1 A;  2GOX B;  3C2H A;  3AFH A;  2CV1 A;  2E1M B;  3L2R A;  1X1A A;  2XDV A;  3PJR A;  4HRI A;  4Y3O A;  4CCN A;  1D1B A;  4PUS A;  4E7Z A;  4XLC A;  2K5C A;  1WJC A;  4IX7 A;  4XON A;  3E0J B;  3A2K A;  3LSM A;  3D5R C;  4ZTF A;  1MMF G;  1X4P A;  3K10 A;  2XSJ C;  4XLE A;  4IKF A;  3ZXS A;  2M4K A;  3LSG A;  3DKY A;  1EGM G;  4HST A;  4BU2 A;  1X1C A;  4B48 A;  3U21 A;  4BQO A;  4OAY A;  3VSL A;  3QYE A;  1SAU A;  4BS9 A;  2ZXH A;  1S9H A;  3OOU A;  4CH7 A;  2LRD A;  3QOE A;  2XF5 A;  2Q1Z B;  3OL4 A;  4RLF A;  2R7R A;  3K4K A;  2HNH A;  1N78 A;  3OIP A;  3DKX A;  1MW7 A;  4HEA 2;  4CCL A;  2V7F A;  2E5Z A;  4N4O B;  2VQH A;  1K6Y A;  3OS1 A;  1WJA A;  3VDX A;  2CS3 A;  3DLA A;  4BEH A;  4E7H A;  5HNH A;  3AKZ A;  3OYA A;  4BDY A;  3ZGK A;  4FET A;  3OS2 A;  2WAE A;  4CZC A;  3OYF A;  2Q2E B;  1OLT A;  1W36 D;  3ZQQ A;  4R79 A;  2HVS A;  3RCO A;  2CV0 A;  2KLO A;  3BCB A;  2K3P A;  4GRI A;  4F55 A;  1YX5 A;  4KIT B;  1SFK A;  3SYT A;  4ANJ A;  4DBR A;  1MMG A;  2IGO A;  4QPO A;  1NG6 A;  4ZYA A;  3DEE A;  2VIX A;  2ZSI B;  2V26 A;  3W2W A;  4KJZ A;  2JVH A;  3M1C A;  4BQN A;  4EAT A;  4ZJZ A;  3HC7 A;  4PFO A;  4PJL A;  4ZC3 A;  3E1S A;  2GOM A;  2W1O A;  4BJ6 C;  2VKH A;  2E1M C;  2ZFU A;  3FHN A;  2VB6 A;  3CP2 A;  4PJN A;  1UAA A;  2K9M A;  3NWS A;  5CKT A;  5HVQ C;  4DJA A;  2DXI A;  2VJJ A;  2F5V A;  3VWB A;  5HLT A;  1YX3 A;  2LYC A;  2QKM B;  4Y4R A;  2RRE A;  4PJJ A;  1WFX A;  3L2U A;  1Z21 A;  3VYU B;  2LBF A;  4II2 A;  3S3O A;  4Y33 A;  3PNT A;  2R7W A;  2KQR A;  3PFY A;  2L9N A;  3QYB A;  3OYB A;  4ITV A;  2OC6 A;  4RM2 A;  4AVZ A;  4XLH A;  1WJF A;  2HPM A;  4E6K G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...