1NG6A

Structure of cytosolic protein of unknown function yqey from bacillus subtilis
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
148
structure length
148
Chain Sequence
b'MSLLERLNQDMKLYMKNREKDKLTVVRMVKASLQNEAIKLKKDSLTEDEELTVLSRELKQRKDSLQEFSNANRLDLVDKVQKELDILEVYLPEQLSEEELRTIVNETIAEVGASSKADMGKVMGAIMPKVKGKADGSLINKLVSSQLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yqeY
publication title 1.4A crystal structure of hypothetical cytosolic protein YQEY
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 63
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2002-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09424 YqeY Yqey-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.410 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1ng6A02
1.10.1510.10 Mainly Alpha Orthogonal Bundle Hypothetical Protein Yqey; Chain: A; domain1 Hypothetical Protein Yqey; Chain: A; domain1 1ng6A01
1NG6A 3AL0B 3IP4B
chains in the Genus database with same CATH superfamily
3DWLE 2H8WA 2HNHA 3JAMZ 1SAXA 2X1EA 3K1PA 4I98B 3HB9A 1IN5A 3BWGA 1BR2A 3MKYB 3DBRB 3BZ6A 4MGRA 1EA3A 1S5LC 1KU9A 1ZAOA 3RPQA 4FT8A 4LIVA 3GTPJ 5E17F 1WJ5A 1TZLA 1NTCA 1FNNA 1BI2A 1ZARA 4B47A 3Q0UA 1J0RA 2VN2A 3CP8A 3SEQA 1SVLA 2XKPA 1U2WA 2EILH 3BPVA 3P5JA 4PFOA 1X1DA 2O03A 4A69C 1FC3A 2E36A 4A3EJ 3DCFA 3HZJA 3KP2A 4U0YA 1OKRA 2JA2A 3GO5A 3V7CA 2L7FP 4U0WA 1RI7A 3IAM2 1I5ZA 1F43A 4XSXF 2DU9A 3H3ZA 2DXIA 3FXKA 2F4OB 4ENJA 1OJLA 2DDAA 3OMYA 5TRDA 2YS9A 2KFDA 1QZYA 2KL4A 4ZTJA 4U7DA 3KZIC 1V5FA 5H6QA 4GCVA 1WH5A 4PGHA 4EATA 4UUVA 4XIDA 2DQRA 4II3A 3S17J 4HQEA 1BW6A 1YX3A 3M9AA 4A3BJ 1IN8A 2E2HJ 1QBJA 3K2ZA 2LOOA 3KP4A 1B9MA 4Y33A 2IJLA 2IGMA 1O4XA 2XC7A 2ELJA 1J9IA 4EMSA 4IX7A 4EM0B 4B1RA 3FM3A 2EV5A 1PYVA 4HRIA 4O5VA 3HRUA 5LFAA 5KAFC 3LMMA 3OR2C 4L9TA 2V9VA 3Q3SA 3H92A 4XRSG 4UVBA 3VYTB 5DCMA 4LFUA 1IO2A 5B3SH 3BROA 4AU7A 2VKEA 3CDLA 5FJ8J 1BI0A 2HR3A 3DEUA 5D5UB 3CCQI 5AONA 2DPUA 1EH7A 5FKKA 3RQIA 3VYRB 2X6XA 2CV1A 4KFCA 2DMNA 4PSWA 3HBLA 2XSJC 5KNLA 5IPAA 4UHTA 2CFXA 5TISC 2Y2ZA 2Z5UA 3LSIA 3T1BA 3CUQC 4GYIA 2O8XA 2QLZA 3TO7A 3O3KA 4X6AJ 1O3QA 3IC7A 5JHUA 2HVRA 4Y7NJ 1YOVB 4B3XA 5HODA 1EF4A 2LC2A 3VEPA 1Z6RA 2CG4A 4A5MA 3A01B 2HQNA 4RLFA 4Y15A 4UUSB 1FOYA 3M07A 3HUGA 3L00A 1JKPC 2HKXA 3ZMDA 1OCPA 1K4TA 4YIRX 3MMYB 2EFWA 1OLTA 5M3MJ 3VSKA 4RMNA 4A0YA 5HNHA 4BE0A 2DK8A 3CESA 3E0JB 2MABA 2F5DA 4FX0A 2OV7A 5K7ZA 1Y39A 1ETWA 3FWEA 1ETKA 4XKBA 2STWA 1OPCA 1IF1A 2IA1A 4G9YA 1TP4A 1IZ1A 3VDXA 5GAEJ 2UUZA 1TNSA 3HG9A 4MTDA 4FHTA 3ESWB 3F22A 2CQNA 3UKGA 3KP6A 2HYJA 1QA6A 1GVDA 4IRHA 1J75A 2E1OA 2QGUA 2Y48A 2UXNA 2V6CA 3K70D 2KDOA 4DNCA 3KYCB 2EA4A 5LHGA 2KPMA 4A3MJ 2FOKA 4J19A 3CCMI 2OA4A 5F0HA 3BG7A 4DGWB 3W6JB 1IDZA 4E4HA 4A3DJ 2NOGA 2JSPA 3HRSA 3K7AJ 5IYBJ 2LF7A 2EIMH 3DU6A 3E6CC 2XHKA 4LITA 4OIRF 1A31A 1ERDA 2OTLI 4HAMA 4ZJZA 2OZUA 4O3MA 3CCUI 2EINH 3HSEA 5FD5A 4CZZA 4Q4ZF 1Z7LA 2ICWG 2XKOA 4M6VA 5LEJA 2PJPA 2EFPA 2VXDA 2W82A 4NQWB 4ZYGA 4QTRA 1E17A 2O5RA 2RDPA 2LDUA 3VYUB 2CQXA 2DMUA 4LIUA 1C0WA 4EJUA 4C30A 1HXDA 2E2IJ 3IL2A 3WGGA 1B72A 4BDZA 1SFXA 3QP6A 2UWMA 2Z33A 1W7PD 2FD5A 2X6YA 3ZCOA 4WWCA 3DP7A 1FT9A 4BGDA 3J7AO 2H1LA 2Q2EA 5KVRA 1N78A 1RKTA 5C44J 1VQOI 2IGNA 4LB6B 1S3JA 4NDLA 4UVCA 5GAGJ 1JE8A 1T98A 1O3SA 3GTLJ 2MLGA 2VL8A 3HOWJ 2W48A 2YR2A 1F1ZA 3P9CA 3MWMA 2MD0A 3F6OA 3BP8A 4HF1A 3R0JA 4G6TB 2HQAA 3A2KA 3EUHC 1BW5A 2CW0F 2P7VB 1V5EA 2PQ8A 3GBGA 2L9RA 3CCYA 1Z9CA 3FXRA 2E5ZA 5K1YA 2WWYA 3BTJA 4DZPA 3M8JA 3HYIA 5C3EJ 1QZEA 1MMAA 3OOUA 2DFEA 3WE3A 1I27A 2ZSIB 1ZKGA 1AU7A 3BZCA 4CCLA 2JK3A 4MFEA 1X2NA 3WTYC 2IS2A 1SVMA 5CYVA 3B6CA 4E7IA 1OMIA 3FXMA 3JRAA 5J4YA 1JT6A 1KU7A 2IT0A 1KYWA 2DK5A 3BG6A 1NK2P 1R1UA 2AO9A 3S1QJ 2CH0A 3W6KB 1OR7A 3GTMJ 2DDBA 3L09A 4I0BA 5E18F 2KIUA 3AKZA 2JPBA 3L2VA 1IC8A 4MLOA 4MEYF 1SANA 2HYGD 3HOVJ 3B73A 4MNUA 1H8AC 3K4NA 5KCMA 2LG4A 4CCOA 3FKJA 2JTVA 4KMUX 3SZPA 2HPIA 2FXAA 2HQ5A 1ZR4A 2E1CA 2P4WA 2XGEA 2DPDA 3S1NJ 2HYFA 1XD7A 4HLXA 3S3MA 2BXYA 4IEJA 5ILSA 1Z6TA 2LKPA 5FKLA 1U6GA 3I59A 1DGRM 4GYGA 4K2EA 2HGCA 2W1OA 1YRNB 4GGGA 2HDDA 5HLTA 1X3UA 2CYYA 3CLOA 3ERED 1WZ2A 1HKTA 2V4JC 5L3FA 1WFXA 2M0MA 1WJEA 2OZ6A 4F91B 1PUEE 3W2WA 2ME6A 5J3LA 5ERIA 3W2AA 1JUSA 3DLLF 3ZPLA 2G9WA 4U88A 5FFZA 2OF7A 1W1WE 5GAHJ 3SZTA 2M8GX 4AUXA 3GFIA 2HZDA 5JVTA 5LLQA 1EGVG 1ETQA 1XX5A 2HXOA 5FFXA 2BY3A 3PM1A 3H35A 5DM7F 2L9VA 2MLKA 3PUBA 2R7QA 2DMTA 2R92J 2HPMA 2Y0SN 5L3GA 3QPLA 2VT2A 1F9NA 5KHDA 1ORKA 4C2UA 2OCEA 4BHBA 4ZYEA 1ZH5A 2K9LA 1EH8A 1JTYA 3VYSB 4MTEA 1YS7A 2Y31A 5K7HA 3HOXJ 3OYCA 1D0YA 2R4GA 3F21A 1POGA 2MGQA 1R9TJ 5HNFA 1MNEA 1J5YA 3E1SA 3D5RC 1HLVA 1MMSA 1I3QJ 4MO7A 2LREA 1O7LA 2E1NA 3P7NA 2IEKA 3OYLA 5BOXA 2P5LC 5IT3A 1B6AA 4CCKA 1O3TA 3U2RA 1U5TA 2LH9A 2L9SA 3L2UA 3RDIA 3A0BC 3JRBA 3RIRA 3QRFF 1S8NA 2CGPA 1DDNA 2M4GA 4GFBA 1RKWA 3ZMSA 2BZTA 1RETA 3WG7H 5JLWA 2R5ZA 4BEHA 3FIWA 1WI3A 5EGOA 1TTYA 4ESFA 5EG0A 3WTSC 1YTYA 1FP1D 2JRTA 2VJ4A 1KYZA 4BH9A 2G7HA 3CC2I 3L2QA 3RI4A 1Y8RB 4QPOA 4HPQA 4DZJA 2DT7B 4OINF 5CVVA 1WJFA 1IWBG 5CQGA 3O8HA 1LKXA 5LGNA 4M74A 2JA7J 2V9KA 2RVCA 3RSNA 2OUMA 2Q8KA 1E2XA 3HL2A 1Z67A 3KYDB 1QPMA 4P9FA 1G59A 4KUMA 4U0VA 4EEFG 4UXNA 3KLNA 1QVTA 4RM2A 2QZ8A 3F0CA 2JA5J 1HF0A 2K7LA 2QSHX 3H1CA 2VIXA 2CUEA 2IW5A 1JTXA 2V79A 3S2WA 4XLHA 1G4DA 4RBOA 3SZGA 1MNDA 3SEZA 3BTLA 3D5SC 2KKOA 1FZPB 2JJ7A 3WE2A 1KQ0A 4BXXJ 2A6TA 3H9JA 3HGYA 3TO6A 3OL3A 2DJIA 3BPXA 1Q1VA 4E70A 2R7WA 3CZ6A 3JSOA 1P4XA 3LNQA 4KYWA 3M3YJ 3LL7A 2LYCA 3I56I 2GOXB 2DODA 3IUOA 3ZGKA 3M8EA 1FTZA 3I64A 1O7FA 2E2JJ 2V1DA 2EZLA 1BJAA 3IH3A 2E35A 1YJWI 2Y0SA 4LLGF 2M9HA 1FBSA 2X1DA 4MFDA 3ZQCA 2J5PA 3SDGA 1A35A 1T39A 2LBFA 4XN0A 5FKOA 5B5EC 4Y52J 1MBFA 3RZDJ 3D0SA 2BVLA 2GA1A 5E3OA 2GXAA 2BXZA 3GZNB 1UMQA 3ZXSA 3GFMA 2XGCA 2AQFA 1K61A 4KITB 4PJ0C 4HNUA 2QQAA 3BCBA 1DP3A 4BUPA 1H9GA 2LP0A 3C18A 3BY6A 3SHFA 2PMHA 3I0TA 1KA8A 1XCVA 3J7AY 2AXTC 1X58A 2Z2SB 2X4HA 2GBYA 2W84A 4UB8C 3E3VA 3EDPA 4HZFA 9ANTA 1D1BA 2TRTA 4ON0A 4EM2A 3RYPA 3HXLA 2BY2A 3N05A 3CMAI 2D1HA 5EYRA 4IHWA 4F3QA 1IWPG 2COBA 1Z1DA 2LMDA 2CMPA 4B48A 2F5FA 3L1PA 3V7RA 3CCVI 3FDYA 3ZMUA 3HDDA 3OWTA 3GUDA 1JGSA 1R58A 3Q0VA 3ZN1A 2XIGA 4RB2C 3GXOA 1B8IA 4ZYHA 1IV8A 1XMAA 1LUJB 5EZHA 4YIIA 3CCEI 2MC3A 3JRIA 2GXBA 1FOXA 2LNBA 2EZKA 2NVYJ 3RPUA 3H9GA 4IOCF 3T0YA 2V26A 2QM3A 4EGZA 1T38A 4BKXA 5HDGA 4C2MJ 2EH3A 4OIOF 3OYIA 1R4NB 3FXQA 4HX4A 1WHUA 3QYEA 2P81A 1YW9A 4XLEA 1A6IA 1IN6A 1P6RA 1XDSA 5GTHC 3K9TA 2FEZA 1RZ4A 2IS1A 4PFPA 3ABKH 2JRMA 1JKQC 3TEDA 1M1EB 1MMDA 5AIPA 3SXYA 5DUIA 5E79C 3K0LA 2L2OA 4KICA 2EZIA 3VWBA 1E3OC 4G6QA 3BQZA 3OV8A 2FRHA 2M0CA 2M7AA 1T0FA 1YYVA 2X1CA 3DU5A 3ASNH 5E8IA 2Y30A 1EKEA 2V7FA 5GPCA 2A3SA 4EM1A 1XTAA 3SDBA 2HVQA 3HOZJ 5FLMJ 4OAZA 1MKMA 4LK1F 3TW7A 2FJ1A 4A3FJ 2XF6A 2ZFUA 4KISA 1T56A 2NVQJ 1X2MA 4RAFA 3AG4H 3ASOH 5HS9A 3FHZA 2V1UA 3MKWB 4PCQA 3ECOA 5E3LA 1ZRCA 2DA7A 1R22A 1LPQA 1Y1VJ 3AAFA 4LB5A 2HXIA 3PNTA 3RYRA 1LEBA 2A61A 4E7JA 1SFOJ 4CGZA 1IRZA 2MSYA 4HNTA 4DYQA 1JJ6C 2ZNYA 4EVIA 5HS8A 1BOBA 2YSRA 3DQVC 4BBSJ 2Z9OA 2O9LA 2EWNA 4FQGA 4DJAA 3RKWA 4A5NA 1S6LA 4R1HA 3Q9VA 5DUKA 3FXOA 4DIQA 2VKDA 2LVSA 5K5QA 3QYBA 5LBQA 2MW8A 2ZXJA 3JRGA 1RESA 1P9QC 2EA2A 2M7BA 3A0HC 3CP2A 1TWAJ 3PQJA 4Q47A 2DA4A 2MFZA 2W00A 4KT5C 2VQLA 1BOAA 4JOMA 2F5CA 1G2HA 3HGGA 5ICCA 3CJQB 5KAIC 5J4VA 1GDTA 2KT0A 2CO5A 3I4PA 1NHAA 1YITI 2LTPA 1Z0XA 1GVJA 1LNWA 2L5QA 4RGXA 2KP6A 4F93B 4PJLA 3HJEA 4ESJA 1HW5A 2CSOA 5JI6A 3EUKL 4BQAA 1QHHD 5JVGF 3DEEA 1J7KA 2R3SA 3BTCA 5LGUA 1IGNA 4LG3A 1T2KA 3GTKJ 1H0MA 1MBHA 3A02A 3SFIA 3F23A 4YRVA 3OYHA 4KDPA 5HLGA 4CSWA 1PJRA 5CVIA 4DYCA 3OIPA 2P5VA 2BOLA 1MW7A 4M6YA 4UNOA 5TGTA 1RUOA 3JRHA 2ME0A 1D5VA 3FBIB 4F52A 4G8XA 3BJOA 4CDGA 1ITYA 4DYRA 4HV5A 4XL9A 2HOAA 2RREA 3CUQB 1SEUA 3CMYA 1HKSA 2M3AA 1IAWA 1NG7A 1ZG3A 5IOZA 2V1XA 2L4AA 1R36A 4KJZA 1BBYA 4D7NA 2DLLA 1OISA 2QA4I 3TO9A 1KONA 1MMNA 3FM5A 5C4JJ 4BHPA 1MNMC 3WHBA 1V4RA 5LRRA 2A68F 1SAUA 2NNNA 3C2BA 5DD8A 2P0WA 2ADUA 5JLXA 4D5CA 1S29A 1EGMG 1Z2ZA 1ZG5A 5DM6F 2WY7Q 1W0UA 3KEOA 3CLQA 3BCAA 1GV5A 2R7RA 2L7MP 2F5EA 3I53A 4JP0A 1AWCA 3CD6I 1CGPA 1AKHB 3DV8A 2ZB9A 3NWSA 5D8LB 2DFIA 3E7LA 3NAUA 3NEUA 2R7OA 1FLIA 3L2RA 2KRFA 2EB7A 4QSHA 4FASD 2VBXA 1HBXG 4U87A 1NK3P 1LDJA 3WU0A 1DU0A 4LLNA 4L9NA 1RUNA 3VPRA 2DFFA 2DI3A 5M5YJ 4XSZF 4FISA 2RV8A 1LFPA 4N4OB 1MJAA 3OS1A 5E1WA 3BR0A 1RR8C 2M1BA 4YFXF 2FBHA 3GTQJ 1VQ5I 4AIHA 3OYBA 1G3SA 3E5XA 4D9JA 1P2FA 1U78A 1H88C 4I76A 1UHSA 1WSUA 2PG4A 5DYMA 3ISPA 3A01A 1DP7P 5IYCJ 4UUSA 3N4MA 3PFYA 4B43A 1TW2A 3HOUJ 4XLCA 2JPCA 5D5WB 3MQ0A 3RZOJ 2HOSA 3CMMA 1VQ8I 1FMVA 2WTEA 2DA6A 3I54A 1G3WA 4HDUA 3TMOA 1QZZA 2CUJA 1W7PB 3WTWC 4IRGA 3J81K 1I3AA 1K7AA 4FE4A 3JTGA 1XGMA 3ELKA 4QWQA 4NC8A 3S8PA 4L9JA 3BG3A 3F8CA 1EH6A 1T95A 3LWFA 3K70C 1Y1WJ 5EEGA 1ZLJA 2HS5A 2EZHA 1JUMA 5F1JA 1HW1A 2IRFG 2YPRA 5J1UA 2CU7A 3IH2A 4FX4A 1QO0D 2VJ5A 4LD5A 4GXOA 2AQEA 3V8KA 1E0EA 5HVQC 1HKQA 1E3HA 3D1NI 2FMLA 3CF5F 1VNDA 3HHGA 1VQLI 1LE8B 1E3PA 2KHMA 1DGWY 1GHCA 2IS6A 3EUHA 2PI0A 3R0AA 3WTVC 3H5NA 4BL0B 2JN6A 4RM3A 1CF7B 2WY8Q 3OYFA 5L3EA 1TC3C 2YU9J 1MZBA 3DKYA 3VB2A 5HLIA 2AS5F 1IRFA 3E5QA 4M72A 5D5VB 3DXJF 2X6OA 2JUGA 1VFCA 2EV0A 5E1ZB 4QLCU 3G1OA 2MYSA 3J81Z 4G7HF 2KIMA 3BR3A 2XV4S 1JJ8C 2GZWA 4NQWA 3KCCA 2IP2A 4OOIA 5JHFA 2VJJA 4AYBN 1QGPA 4ESBA 1J2XA 2O7OA 5IP6A 3TOAA 4UV8A 3FX3A 4E7KA 3GYHX 1VQ9I 1ZGJA 2A07F 4A93J 1FIAA 4XLPF 2K9MA 2QYOA 1X1CA 2NXNB 5K5OA 3CQZJ 3HTUA 4P5OA 4XOTA 2OTJI 1DU6A 2OU2A 2FOWA 3EETA 2DA1A 2W24A 3REOA 2XAHA 4HNVA 3G3ZA 3H5AA 4B3AA 1BC8C 3PNVA 2DT6A 3KP3A 4JX4A 3GCMA 1QU3A 4PK4A 1ZK8A 2JVHA 1VI0A 4BY7J 1EJ9A 1SFKA 3LSGA 4A3IJ 3IWZA 2IAIA 1PP8F 3DTEA 1UHWA 3MKZA 3F8NA 5FKMA 3ECHA 4Y4RA 1N75A 1S7OA 1GXQA 1FSEA 2XDVA 3TBIA 4ASNA 3S14J 1RC9A 2D2WA 1USSA 3RKXA 1EV7A 2F5VA 5F64A 2XB0X 1J09A 1YO5C 1YQAA 1FOKA 2L02A 4HX8A 2ELKA 1IXCA 2XAJA 1IXSB 2DT5A 3A4CA 5FO5A 1XSXA 3LA7A 1HOMA 2DCEA 5EDNA 2VT3A 1YIOA 4RS8A 1YI2I 1SC7A 4JQFA 2F2EA 2PFBA 3BG5A 5LHHA 2BW3B 1MH3A 3E6BA 3RTRA 1ZREA 4BDYA 3OIOA 3HHHA 2L4MA 1FJLA 2ETHA 3MAJA 4CYDA 1X4PA 1YS6A 3BTIA 2HQRA 4KT6A 4IHVA 2DYRH 3WODF 2FBKA 3GF2A 3BDDA 2Z3YA 2QEXI 4FTHA 2QCOA 4IPAA 1W5CC 3I4MJ 4ZZLA 3ZQ7A 1OYYA 1DPUA 5IP9J 1YRNA 2DOEA 4PZJA 4BBRJ 3B02A 5FB2A 1ULYA 3ABTA 3JSPA 1ZG1A 2K9NA 3S32A 2A5WA 2DA2A 2VBYA 3E97A 4MQVA 1ON2A 3OOPA 3PSFA 1XG1A 3TDZC 4R79A 4ZTFA 3G1LA 3WTXC 4P55A 3GZ5A 4AYBA 1PUFB 2XGXA 1ZYRF 2ACJA 4IQJA 5BPIA 1FTTA 4XKWA 1D0ZA 2DA3A 2YX7A 4CHUA 3BG9A 4OAYA 2HVSA 4U7BA 2OJED 3GFLA 2X6WA 2L01A 2QKMB 1MH4A 3LSJA 2W25A 1WRJA 3LAPA 3TOBA 2WV0A 4L9VA 4M3EA 3F9KA 4XLNF 4LG0B 3U21A 1JI8A 1XS9A 1F5TA 2WADA 2E60A 1I1SA 2B9SA 2K9SA 5E3NA 5EZGA 3QPHA 1YE9A 2CV2A 2PJRB 5BPDA 1ZHFA 1RR7A 3QOPA 1GXPA 3Q0WA 3CO6C 3AG1H 2W57A 1DPRA 4BJ6C 2WAQN 3K4MA 1TWFJ 2R7FA 5HOOA 1A04A 1G3TA 1XN7A 2LSOA 3O8GA 1TWGJ 2QBYB 2HEOA 1FEXA 3S93A 2ECCA 4XRFA 3IH4A 1S7EA 5E3MA 1AHDP 2KMUA 1A6QA 3L2WA 3FXJA 2VJIA 3S3OA 1LQ1A 1UELB 2ZXWH 3C3WA 1DQUA 3DPUA 1MBJA 3V7SA 1FPQA 3IRRA 2WC2A 2VKVA 1R5ID 1WVRA 1FOWA 1HC8A 1XMKA 3BOQA 1P4WA 2C6YA 2D5VA 4JBAA 4W97A 3BR6A 4IO9F 2MC4A 3GX4X 2RNJA 5CVRA 3CJTB 3H9QA 4EJVA 1MBKA 1R49A 4MIMA 2JSCA 2D45A 2VE9A 1TQPA 2DA5A 3JRFA 5HLHA 3M1CA 4CYCB 3LA3A 1BA5A 1QRYA 2Y9YA 4P9UA 3I4NJ 5J47A 4EQQA 3BR1A 2EV6A 2VBWA 4ENMA 2XAQA 2HFHA 2VOPA 1TQIA 2FE3A 2HOEA 3FXUA 5ICGA 2OCCH 3ABLH 2E7XA 3TP3A 1MDMB 1OCTC 1IN7A 4BNCA 1SMYF 3L7WA 4PJMA 5F04A 4BY1J 4V2FA 1K79A 5ED4A 4B8XA 3KZZA 3U9GA 2CWEA 1CQTA 1NH3A 1OYWA 4MQ9F 4IKFA 2R5YB 1B4AA 2JWTA 4A2UA 1BJZA 1I50J 4IXAA 5ILVA 4IRIA 1XC5A 2A6HF 2ZXHA 4FE7A 3S3NA 3BC8A 3D5LA 4PDKA 3TKYA 1SD4A 2G7UA 3QOEA 1Q1HA 4HEA2 3LSKA 3LQQA 2BVMA 1EEXG 3SFZA 3X2QH 4I2OA 1XDUA 3BLYA 4F92B 3FK7A 4IOAF 4WXDA 2EFQA 2Q1ZB 2DW4A 2PEXA 2WAQA 2ZJQF 3WTTC 2I5UA 1N25A 4R8HA 1KQ8A 3HSFA 3PIPF 4RB3C 3WTUC 4HQMA 4BQNA 4OU0A 3K4LA 3J7YJ 1K6YA 1KU3A 4Y13A 3GW2A 3HIFA 3IHUA 5BQTA 3CC7I 2KIQA 2QSGX 2NOJB 2R7ZJ 2F4MB 1OYIA 3CDHA 1I6HJ 3LSMA 3JCUC 2FA5A 2ZNZA 5A2QK 2K40A 3MD2A 4G7ZF 5FKNA 3A1YA 2IXSA 2DMQA 3PFIA 4BQQA 1P7JA 2F48A 3TW6A 4CO8A 2E1MB 2PBIA 4UUTA 1VQ4I 2NVXJ 2BYVE 4RA2A 1LEAA 3TDUC 4CZCA 1IUYA 1B9NA 3WTZA 1UJ8A 5D6EA 2H6BA 4ABZA 1R7JA 4AC0A 1ODDA 1R5GA 3SQNA 2O61A 2QVOA 5J8FA 3OIQA 4IJAA 3G2BA 4IVNA 3PQKA 3QAHA 4A6EA 5LHIA 1IV6A 2R0QC 4XM3A 4A3LJ 4HF2A 3ZMVA 3Q9SA 4XRSA 1YW7A 3S1MJ 3K6GA 4WXHA 1X3ZB 2HKOA 3ZQIA 3F72A 3CF2A 2BE5F 2WAEA 2XF5A 5FGMA 5H6RA 2VODA 4AVPA 5L3BA 2P8TA 4A3JJ 1L0OC 4ENNA 3NARA 3P9IA 2GXGA 3ERMA 1H89C 1FMWA 3HOSA 2VPRA 5E20A 2DAOA 3R60A 2COMA 3HOYJ 3C2GA 3FZVA 4A12A 2EFOA 3HPGA 2KRCA 2XF7A 5A2QZ 3IRQA 3E6MA 1D5YA 2JA8J 3W6VA 1IG7A 5DTDA 2ZO4A 1FIPA 3JR9A 4AIJA 2R7TA 3K2AA 4NNJA 2E1MC 4X0GA 4XNFA 2ELHA 2CJJA 1SD5A 3AL0B 2LK2A 1VQMI 2DOAA 1VQ6I 2ZKZA 2XPVA 4FETA 2JUCA 4ZZDA 3KFWX 4E6KG 3DKXA 5JFRA 2ESNA 3M7GA 2MD5A 2H1KA 4B44A 1R5HA 3FF5A 4L18B 4UB6C 5L3DA 1VQPI 5D4RA 3ABMH 3GLLA 4CUGA 3GTGJ 1A5JA 2P5KA 1IRGA 3T8TA 2KIFA 2NAZA 4RGUA 3DKWA 3H36A 4XORA 1QHGA 4CCNA 1U8RA 2FBIA 2ISZA 5D5XB 4BACA 2NYXA 4M3DA 4HW0A 3V8JA 4YELA 4MEXF 1FWZA 2ZFWA 3HPHA 3KLOA 3VSLA 4P1WA 2H6CA 2EFNA 5AIQA 1YJNI 5IOYA 3L2CA 3AFHA 2A5YB 2HOTA 2H8RA 3JAMK 4JK1X 2KZGA 2M4KA 4E7LA 3F6VA 3HRTA 1O57A 2Z16A 4CICA 1T8IA 3GWZA 4HG2A 4HYEA 2IPQX 1RIOH 1YG2A 2KQRA 3W3CA 2ZJPF 3KEQA 2L7KA 2LR8A 2HTSA 2OQGA 3H5RA 3JTHA 4NBQA 1K78A 1HCRA 1XGOA 3M4OJ 1PP7U 5FD6A 2KRHA 3DF8A 3V8LA 1FSHA 3AL0C 1BI1A 3DPLC 3K1NA 1I6XA 4BJTA 3HEFA 5F6FA 5J8CA 1O3RA 2VLAA 2X0LA 2ZMEB 5BS6A 2HZTA 2X9DA 2LD5A 2UZKA 1X1PA 1TBXA 2DFHA 3RPUD 1OCCH 1F36A 1UB9A 2VASA 1IRXA 2VXZA 3ZMZA 4D5FA 4I01A 1G8XA 4IF4A 1MGTA 2BY0A 1BM9A 3GTOJ 1SFUA 2NVTJ 1SD7A 1W36D 1U9NA 1D1CA 1LFUP 2QKLB 1Y0NA 3G73A 4J01A 3CUQA 1T0FC 4BAYA 1I1GA 3UNGC 3I5UA 5FRMA 3IKVA 3C1DA 4XICA 4N9IA 1BI3A 2F4IA 2ID3A 2L9NA 4XN3A 3C2HA 4H0EA 1UAAA 1GUUA 1B1BA 2F6CA 4DOZA 1SMTA 1MSFC 4M9ZA 1Y6IA 1ZGWA 1WH7A 2EBIA 4GO1A 3EYYA 2Y75A 3NRVA 5D6FA 2HDWA 1JGGA 2Z1DA 2ISYA 2XASA 1ETXA 5LEKA 2JA6J 4UVAA 2BBYA 1D8KA 5EJCA 1D1AA 2LFBA 4H4KC 2ZMEC 2CRGA 1MBGA 1AKHA 2EK5A 1ZELA 2K5CA 2L54A 3QWLA 3R4KA 5D4SA 1ZRDA 1R4MB 1FBUA 2IGOA 2KZVA 5FROA 4BS9A 2FUG2 4D7MA 3QPSA 1SFEA 2M30A 3S1RJ 4C3JJ 2VPLA 5LGTA 2LKSA 4OMZA 1Z91A 3A03A 3HTSB 4IHYA 4ZDOA 1MBEA 1XCBA 2K3FA 2VKHA 4JX6A 4I0AA 3OYAA 2DJNA 3OYJA 2R7XA 3DEWA 1Z3XA 3WG9A 2QQ8A 4N4NB 1ETOA 4F55A 1HA8A 2KDZA 1XPXA 2WV1A 2DTZA 5TJJA 2BY1A 3CCRI 4DW6A 4ZYAA 4ZC3A 5D8KB 1Z7UA 4CCJA 4P96A 2O0YA 3ZQFA 1YIJI 3HM5A 1MMFG 3ZN0A 3LSHA 4HA8A 5DCMB 1GT0C 4J00A 3PL8A 2NS7A 3PNYA 3DBHB 2MH2A 1VF9A 1XMXA 2XPWA 1W7PA 4YIFA 3RJPA 3Q5FA 3CUOA 1WJDA 1YX5A 1WGXA 5E1XA 2GIZA 2P6SA 4ENKA 4EGYA 3IP4B 1Z05A 4KIGA 3N97A 1MJ9A 3ZR8X 5GTIC 3GEZA 3O2PE 2PX9A 2I10A 4PJNA 1ACIA 4WF2A 1PVEA 2GIVA 1NG6A 3FKIJ 3T8RA 3KYLA 1K4SA 4UY8I 1MD0A 2NRAC 2JVGA 3DTKA 2WBMA 1Y8QB 3GMEA 4M3GA 4RLQA 1HW2A 3FK6A 4XMYA 1WI9A 3KE2A 3FMSA 1V5GA 5F27A 4W1UA 2PMZN 2ECBA 1IN4A 4S0HB 3UR3C 4A3KJ 2G0EA 2R7UA 2N8GA 1R1VA 1W5TA 2Q0OA 3I58A 1X3WB 2MH9A 3VOEA 4CCMA 1U3EM 1K6OA 1LE8A 1LB2A 3HUGB 1FYLA 2E7WA 1XSDA 2RAEA 2Y69H 4XRMA 1A36A 4BYYA 5CJ9A 4G6DA 1CF7A 1GV2A 2GWRA 3MZYA 2LY2A 5J40A 2H94A 4DBRA 2I8DA 3ONQA 3V42A 3ULQB 1WKMA 4LLLA 4PGGA 1Z77A 3LQRA 2HTJA 4L5IA 3T5XA 3JREA 4QPQA 3TGNA 2FNPA 2YUSA 2E19A 1LJ9A 4FCYA 2OD5A 2QQ9A 4I7HA 2STTA 1ZN2A 3LOCA 3OYEA 5LD2C 4YEJA 3K10A 5DCFA 2M34A 4XLFA 3VODA 2PN6A 2IA2A 2PLYA 2BGCA 4NUBA 3OYNA 1V3FA 4AWXB 2H09A 4HF0A 2HI3A 3BJ6A 4LK0F 4RB1A 3CTAA 2XSDC 1FYMA 4BU2A 3PIOF 3DFGA 2QWWA 3DPTA 3KETA 5DV5A 2K86A 1JUPA 2M45A 1REPC 2E34A 4PJJA 1FX7A 1TQMA 3KP5A 3S2DJ 1N77A 4QIWN 2O3FA 4M71A 1UCRA 5KK1A 5F0CA 4RDUA 2OC6A 3HOTA 1QPIA 4LGWA 4GRIA 3CO7C 2EIJH 1IUFA 2ZXIA 3NQOA 1LDDA 4CA0A 1J59A 4OIQF 3FHNA 1WJCA 4Z2YA 4OMYA 3GTJJ 4Z6YA 5GP9A 2BV6A 4I6ZA 1BR1A 3PO2J 5HS7A 2KJCA 2R7DA 3MZ8A 2K02A 1FYKA 3F8BA 2DOFA 5K5RA 1TW3A 1TT5B 3H3UA 3MZHA 4IHXA 5CQEA 3KPHA 4ITVA 5LRSA 3ZQGA 4N0BA 1B72B 4C9YA 3DTIA 4BHCA 1YLFA 2VBZA 2RNGA 3ZMTA 5IY5H 3BR5A 1UZCA 2Q2EB 1F4KA 2QENA 5DS9A 2CUFA 2KLOA 1TWHJ 5F0FA 1D8JA 2DQLA 2PMUA 2HWVA 2R7SA 3CCSI 2A69F 3I9V2 4XK4A 3MKLA 1SD6A 2DTRA 3WHCA 1FP2A 3M1EA 2BW3A 2M8EA 3MVPA 2PMZA 3FXLA 1D3YA 1WWXA 2W85A 3BJAA 4CH7A 3BT9A 3DLAA 3I3LA 5FLXK 3TL4X 2ZSHB 2IGKA 1OQYA 4JX5A 4BE1A 4WXCA 4EJOA 2XB5A 2GA2A 2B0LA 3PO3J 1T08B 5J6XA 2AHQA 3OR1C 3CJNA 5F08A 5ICFA 5K7FA 3K69A 1LVKA 2EQRA 3DBLB 2ZCWA 4IHSA 2VQCA 2WAFA 4Q5SF 1R00A 4C3HJ 1MMGA 4Y17A 2DN0A 4E7HA 2QSFX 5GPAA 1W4MA 5IP7J 3OYDA 3GVAA 3RQ4A 3LAJA 4BJ5C 1T6SA 2XPUA 1KGSA 1RPWA 4UV9A 2RQPA 1FY7A 5IT9K 3OS2A 4WX9A 3OSFA 2VQHA 4S04A 1BIAA 2GQQA 3RCOA 1PUFA 1U9OA 1OCZH 4LOCA 1JHFA 2X51A 2ZJ2A 2XGDA 1ETYA 3JRCA 2R93J 3S15J 3CMEI 3CCJI 1MIJA 2EIKH 4KN4X 4AD9A 3QPTA 2P6TA 3JW4A 5FLXZ 3LA2A 3COAC 4L0YB 4LG0A 2L3DA 2UXXA 3BR2A 2NNYA 1S72I 1TLHB 2HU9A 3IAS2 1VZ0A 4IHTA 2ZC2A 1TWCJ 1WJAA 3I59B 2RC4A 2VC0A 1JKOC 1U0JA 1BC7C 1LDKB 2PJRA 3WGHA 1UFMA 1JHHA 4I09A 2O6GE 3NWTA 4I02A 2OBPA 4OIPF 3MFKA 4YG2F 2MG4A 4DQ2A 5FRNA 3PJRA 2XRNA 1OFCX 4ETSA 3M8FA 2DO7A 4XKCA 5M5WJ 3GZ6A 1VQKI 2QBYA 2ID6A 3F8FA 2OQRA 4GDFA 4C2TA 4KN7X 1ZRFA 4ANJA 1IXRC 2ZJRF 5IT9Z 1QVUA 2MA3A 3U1KA 3JRDA 4CXFA 4WCGA 1V55H 4BXFA 1X1BA 4KIBA 4IQ4A 5CPRB 4A0ZA 2OPTA 1WJBA 3G4SI 2P7CB 3OS0A 4XLAA 3E6DA 2XROA 2ESHA 1OR7C 3IWFA 2TDXA 4EJTA 6PAXA 4PUSA 5C4XJ 2IA0A 5DEQA 3P9KA 4A6DA 1W5SA 4ZDPA 4F7ZA 5GADJ 1VTNC 3IV5A 4HSRA 2JQ7A 4HX7A 1YHQI 3GLXA 3QYFA 2CUZA 2CFOA 2BHZA 2CV0A 2K85A 4I99C 3AG3H 2HDCA 2RN7A 2K27A 1USTA 5DDGA 1R6RA 1Z21A 3QU3A 3CJRB 1UHMA 3MEXA 5H2FC 5ICEA 3H3VK 4AVZA 3ZP5A 4HOBA 2VUMJ 1DUXC 3K4CA 4XBFA 3CCLI 4CYCA 2LKXA 4M3BA 1RRJA 5J1RA 3E5UA 2FSWA 2M87A 5J1YA 2IBDA 4HV6A 1U5TB 1AA7A 2FU4A 1KU2A 2L7ZA 3FBNB 3K4BA 5EEHA 5FLVA 1GLNA 1IDYA 3HRMA 3RKYA 4NC7A 4S05A 3EYIA 2GOMA 1R1TA 1MDMA 1AOYA 3KX2A 1YJ9I 2NS0A 3HKZN 3CC4I 2XUBA 2R5ZB 4BEHB 3HSRA 2RQQA 3ZQLA 5EGOB 4A0XA 5EG0B 2X85A 4XOPA 5B66C 3AUJG 2RGVA 1RNLA 1Y56A 4L5EA 1JT0A 4ZDLA 1LVAA 1ONVA 1JKRC 2R5YA 2VONA 4M6XA 3J7ZI 3GFJA 2FF4A 4HSTA 5EF6A 1OCOH 1QQIA 5CLSA 1LFBA 2K4JA 2XVCA 2XAGA 1ETVA 4XQFA 2AXLA 2Y0MA 2VC1A 3K4JA 3QODA 4RAZA 3ZQQA 3J80K 4RAGA 1ZLKA 3B6AA 3I55I 2A05A 1P7IA 2EPFA 3U1DA 1P92A 1UG2A 2NVUB 1X19A 3FMQA 1D0XA 4II2A 3OYKA 3VFZA 3SJMA 4BE2A 1DIOG 3K4KA 1V54H 4AIDA 3F8MA 3W2VA 2JMWA 1U8BA 1YFHA 4V2GA 3LSTA 4XR6A 1U5TC 2WB1N 3ZRGA 1Z3YA 4RGSA 1ZGAA 2JZYA 1ZR2A 2XAFA 3G6EI 1K83J 1BN5A 2CS3A 2D1VA 3G1MA 2GAUA 2VQGA 1SVOA 3H0DA 3K1MA 1HQCA 4DBQA 2GM4A 4ZH4F 2A6EF 3L9FA 4LJZF 4Y3OA 2VB6A 2JT1A 2IVMA 4LMYA 4G94A 1MJBA 3LFKA 5H20A 1WPKA 2E5NA 1YW8A 3TQNA 2W7NA 1KZHA 3RKQA 2LBFB 4ZYDA 2MBFA 3HC7A 3TP0A 4EJWA 5M5XJ 3LSPA 3PUFA 1W0TA 5HDNA 4O6JA 3QU6A 2CW8A 2DBBA 2YX4A 3J80Z 1ZTRA 3O6BB 4NC6A 2V1NA 2W4SA 3KP7A 4M73A 3OYMA 4MHGA 1R71A 2CQ7A 4YFNF 1XB4A 3LSRA 4KNYA 1WCMJ 2VI6A 1H9TA 3ML6A 3CDIA 3OL4A 1FBQA 1OCRH 2O8KA 1R23A 4M3FA 2V6EA 4M9XA 5IYDJ 3HKZA 1HDDC 1ENHA 4WK8F 1G6NA 4XKVA 5ILUA 1T33A 3KZYA 1UG0A 1ZQ3P 1XGNA 2TCTA 2M2EA 4D0PA 2V9PA 1UC4G 3R61A 1HDPA 4RB0A 4AIKA 2QQBA 4NHJA 1X4OA 2UV1A 4NB5A 4OWRB 3V4GA 1B8IB 1XSVA 1HSTA 1BIBA 2LLKA 2CQQA 5BNGA 4KIFA 2CW7A 1ON1A 2EJRA 2VE8A 4RGRA 2XRLA 2Z99A 2FNAA 2Y9ZA 3BQYA 1I39A 3F3XA 3KEYA 3WU1B 1BL0A 4BQOA 4G7OF 4D1QA 4KMFA 3BZKA 3PSIA 1G3YA 3OY9A 4C3IJ 2RKHA 2WA0A 5JR3A 2B63J 2IS4A 2FMYA 4HDVA 2YU3A 4EV0A 1L3LA 2GLOA 4B09A 2LF8A 2LRDA 1JXSA 2L0KA 4L5JA 2LY1A 2WB1A 3C7JA 2OAZA 2M5WA 2BHYA 5B1AH 5CVJA 3KIOA 3LFUA 3MCZA 4Q48A 4E7ZA 2QF7A 4L0ZB 5HDKA 3FMRA 2FQ4A 1VQ7I 4V19K 4B4CA 3EUAA 5M3FJ 1KQ9A 4X1EA 4KA4A 1QNTA 5EEAA 2B7EA 1X1AA 4YFKF 2ZBKA 3ABUA 4RAYA 4AM3A 2J5OA 2XAUA 1BR4A 2CQKA 1Y0UA 2K4BA 2K9QA 2KISA 1TL8A 1S9HA 1MSEC 2FQ3A 3R6SA 5BMZA 3H0GJ 2KJBA 3EQLF 3OSGA 4HBLA 4IL6C 3AG2H 1IW7F 1XGSA 5F1RA 2DMPA 3I71A 5DD4A 2X48A 1UC5G 1P4AA 1HSJA 2QUFA 3SYTA 1APLC 3QP5A 1IJWC 1STZA 2DYSH 3S2HJ 3ZOBA 2FX0A 4JYKA 1TNTA 5L3CA 2ZMEA 4PSXA 3EPZA 5CKTA 4A3CJ 5B1BH 4A3GJ 2NS8A 3QQAA 1W36C 4G12A 1B59A 4BXUA 1VQNI 5CVUA 2VOOA 3ZQHA 5E8GA 3FISA 3ROUA 3MN2A 1TT0A 3IKTA 2H27A 2E71A 3S16J 1WQ2A 4N9HA 1K78B 1PDNC 3WU2C 3OYGA 2K3PA 4E7SA 4IZZA 4TV7A 3G71I 1S7AA 2LY9A 3WGIA 4M9SA 2BEOA 4XONA 2R7VA 4HLYA
chains in the Genus database with same CATH topology
3U21A 1JI8A 3DWLE 2WADA 2HNHA 2E60A 2X1EA 5LD2C 3OYEA 4YEJA 1BR2A 3K10A 3MKYB 3J7AY 4XLFA 1EA3A 1YE9A 2Z2SB 2CV2A 2PJRB 4LIVA 4NUBA 1WJ5A 1TZLA 3OYNA 1D1BA 4B47A 3HXLA 3N05A 4BJ6C 4F3QA 3SEQA 1IWPG 3CP8A 3K4MA 4BU2A 5HOOA 2CMPA 4B48A 4PFOA 1X1DA 3DPTA 4PJJA 3FDYA 3S93A 2JA2A 3OWTA 1N77A 2KMUA 3IAM2 3L2WA 2OC6A 2DXIA 3HOTA 2VJIA 3S3OA 1UELB 4GRIA 3OMYA 1DQUA 2ZXIA 3DPUA 2KL4A 4CA0A 3FHNA 4ZTJA 1WJCA 1V5FA 3H9GA 4EATA 2V26A 4II3A 1BR1A 1YX3A 2MC4A 3OYIA 2LOOA 3H9QA 4Y33A 3QYEA 2IGMA 4XLEA 5CQEA 2XC7A 2ELJA 4ITVA 4IX7A 4C9YA 3DTIA 2RNGA 2IS1A 1PYVA 4PFPA 4HRIA 3M1CA 5LFAA 2Q2EB 2KLOA 3LMMA 3OR2C 1MMDA 2R7SA 2L2OA 3VYTB 3I9V2 3VWBA 4AU7A 2BW3A 2PMZA 2M7AA 4CH7A 2X1CA 3DU5A 3DLAA 3I3LA 3TL4X 2ZSHB 2IGKA 3VYRB 2X6XA 4BE1A 2CV1A 2V7FA 4PSWA 4PJMA 2XSJC 3SDBA 2HVQA 3OR1C 5KNLA 4OAZA 1LVKA 3LSIA 2VQCA 2WAFA 2XF6A 1MMGA 2ZFUA 4KISA 4IKFA 4E7HA 3MKWB 2HVRA 2ZXHA 3OYDA 3S3NA 3RQ4A 3BC8A 3D5LA 4B3XA 4BJ5C 2LC2A 3QOEA 3PNTA 4HEA2 3LSKA 4E7JA 2BVMA 1EEXG 4HNTA 3OS2A 3BLYA 4RLFA 4F92B 3DQVC 1BOBA 2VQHA 4DJAA 3RCOA 4DIQA 2Q1ZB 3MMYB 1OLTA 2VKDA 3VSKA 4RMNA 3QYBA 2X51A 2WAQA 5HNHA 3CESA 4BE0A 3E0JB 2MABA 1P9QC 2M7BA 3CP2A 2OV7A 2MFZA 2W00A 2VQLA 4XKBA 4JOMA 4BQNA 3CJQB 3K4LA 1K6YA 2HU9A 3IAS2 2NOJB 1VZ0A 2L5QA 2KP6A 3VDXA 1WJAA 2UUZA 4F93B 3HG9A 4PJLA 3LSMA 1U0JA 2PJRA 1LDKB 3EUKL 1QHHD 3DEEA 3MD2A 3A1YA 3NWTA 2IXSA 4LG3A 4BQQA 3K70D 2E1MB 2KDOA 5FRNA 3PJRA 4CZCA 4YRVA 4XKCA 2KPMA 3OYHA 4CSWA 1PJRA 3OIPA 4C2TA 2BOLA 1MW7A 3BG7A 4ANJA 4DGWB 3OIQA 5TGTA 3G2BA 4E4HA 2JSPA 3FBIB 3DU6A 4F52A 4BXFA 1X1BA 4LITA 4IQ4A 5CPRB 1ERDA 1WJBA 3OS0A 4XLAA 4XM3A 4ZJZA 1OR7C 4XL9A 3K6GA 4PUSA 2RREA 2M3AA 1NG7A 4ZDPA 1Z7LA 4HSRA 3CF2A 2XF5A 2WAEA 4KJZA 2VXDA 2W82A 2CUZA 3QYFA 4NQWB 2CFOA 2O5RA 2CV0A 1KONA 3VYUB 1MMNA 4LIUA 1R6RA 4C30A 1Z21A 1FMWA 3CJRB 3HOSA 4AVZA 3C2GA 1SAUA 4BDZA 2UWMA 2P0WA 3HPGA 3ZCOA 2KRCA 2X6YA 2XF7A 3K4CA 4BGDA 1EGMG 1Z2ZA 1N78A 2WY7Q 3BCAA 2IGNA 2R7RA 2R7TA 1AA7A 3FBNB 3K4BA 4NNJA 2VL8A 2E1MC 3NWSA 4X0GA 1GLNA 4NC7A 2R7OA 4XNFA 2MD0A 3L2RA 2GOMA 4FASD 4G6TB 3AL0B 4U87A 3KX2A 2HQAA 2DOAA 3A2KA 3EUHC 4BEHB 2RQQA 4FETA 1V5EA 4E6KG 3DKXA 3GBGA 2X85A 1LFPA 4N4OB 4XOPA 3AUJG 2E5ZA 3OS1A 4B44A 1Y56A 4ZDLA 3M8JA 1MMAA 3OOUA 4CUGA 2ZSIB 3OYBA 4CCLA 4HSTA 4D9JA 2IS2A 4XQFA 4E7IA 4XORA 1QHGA 4CCNA 3K4JA 4BACA 3QODA 3BG6A 3ZQQA 4YELA 3HPHA 3PFYA 4B43A 2CH0A 3VSLA 4P1WA 4XLCA 3CMMA 3AFHA 1FMVA 3AKZA 1X19A 3L2VA 1D0XA 4II2A 4MLOA 2M4KA 3TMOA 3OYKA 2CUJA 4BE2A 4E7LA 1DIOG 3K4KA 2Z16A 3K4NA 4HG2A 2LG4A 5KCMA 4CCOA 3FKJA 3W2VA 2HPIA 2KQRA 4XR6A 3W3CA 2L7KA 4NC8A 3S8PA 3ZRGA 3H5RA 1Z3YA 3S3MA 1T95A 3K70C 2KRHA 2CS3A 3AL0C 3DPLC 1DGRM 4BJTA 2VQGA 2W1OA 3H0DA 5HLTA 2VLAA 2VJ5A 2AQEA 4DBQA 2V4JC 1E0EA 5HVQC 4Y3OA 2VB6A 1WFXA 2M0MA 1WJEA 4F91B 3W2WA 3W2AA 2E5NA 2KHMA 1DGWY 2IS6A 2W7NA 2LBFB 3RPUD 3HC7A 2VASA 3H5NA 1IRXA 2VXZA 4BL0B 1EGVG 2HZDA 1G8XA 4RM3A 2CW8A 2WY8Q 3OYFA 3DKYA 3H35A 2V1NA 2W4SA 1W36D 1D1CA 3OYMA 3PUBA 2QKLB 2R7QA 2JUGA 4J01A 1T0FC 2HPMA 2MYSA 3UNGC 5KHDA 4C2UA 5FRMA 2F4IA 2K9LA 2L9NA 3OL4A 4XN3A 3C2HA 1UAAA 3VYSB 2F6CA 5JHFA 2VJJA 4DOZA 2V6EA 4E7KA 3OYCA 1D0YA 3HKZA 1Y6IA 2R4GA 5HNFA 1MNEA 3E1SA 2K9MA 3D5RC 4XKVA 1X1CA 2HDWA 2Z1DA 1UG0A 2LREA 4P5OA 4XOTA 3OYLA 1UC4G 1D1AA 4CCKA 4H4KC 3H5AA 1X4OA 2UV1A 2LH9A 2L9SA 4OWRB 3L2UA 3PNVA 1ZELA 2DT6A 2K5CA 1QU3A 4PK4A 2M4GA 2IGOA 2KZVA 2CW7A 5FROA 2JVHA 4BS9A 2FUG2 1SFKA 3LSGA 2VPLA 3KEYA 3DTEA 4BEHA 4ZDOA 4BQOA 2VKHA 4D1QA 3MKZA 3OYAA 3PSIA 2VJ4A 3OYJA 2R7XA 4Y4RA 3OY9A 1Z3XA 1N75A 2XDVA 3L2QA 3TBIA 2WA0A 2IS4A 4QPOA 4HPQA 4N4NB 2DT7B 2F5VA 1WJFA 1IWBG 5CQGA 4F55A 1LKXA 2LRDA 1HA8A 1J09A 2LY1A 2WB1A 2V9KA 3RSNA 2OUMA 3LFUA 3HL2A 4E7ZA 4ZYAA 4ZC3A 1G59A 4CCJA 4RM2A 3A4CA 3EUAA 1MMFG 2VIXA 3LSHA 4XLHA 2DCEA 4J00A 1X1AA 3PL8A 3PNYA 4JQFA 3SZGA 1MNDA 2BW3B 3SEZA 2XAUA 1BR4A 3RTRA 3D5SC 4BDYA 1WJDA 1S9HA 1YX5A 1X4PA 2A6TA 3H9JA 3IP4B 3OL3A 2DJIA 2R7WA 3ZR8X 3CZ6A 4KT6A 4PJNA 1UC5G 3LL7A 1NG6A 3KYLA 2LYCA 2GOXB 3SYTA 3IUOA 3ZGKA 2JVGA 3DTKA 2WBMA 4RLQA 4XMYA 1V5GA 2Y0SA 4PSXA 3EPZA 5CKTA 3UR3C 2R7UA 3S32A 2A5WA 2X1DA 4CCMA 3PSFA 4R79A 4ZTFA 1W36C 3HUGB 4AYBA 2LBFA 4XN0A 4IQJA 4XKWA 2BVLA 1D0ZA 1TT0A 2LY2A 4OAYA 2HVSA 4DBRA 4U7BA 2I8DA 3ONQA 3V42A 3ZXSA 2AQFA 2X6WA 2QKMB 4KITB 3OYGA 2K3PA 4E7SA 4HNUA 3BCBA 4IZZA 4QPQA 1DP3A 4BUPA 3F9KA 4XONA 2R7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NG6 A;  3AL0 B;  3IP4 B; 
#chains in the Genus database with same CATH topology
 3DWL E;  2H8W A;  2HNH A;  3JAM Z;  1SAX A;  2X1E A;  3K1P A;  4I98 B;  3HB9 A;  1IN5 A;  3BWG A;  1BR2 A;  3MKY B;  3DBR B;  3BZ6 A;  4MGR A;  1EA3 A;  1S5L C;  1KU9 A;  1ZAO A;  3RPQ A;  4FT8 A;  4LIV A;  3GTP J;  5E17 F;  1WJ5 A;  1TZL A;  1NTC A;  1FNN A;  1BI2 A;  1ZAR A;  4B47 A;  3Q0U A;  1J0R A;  2VN2 A;  3CP8 A;  3SEQ A;  1SVL A;  2XKP A;  1U2W A;  2EIL H;  3BPV A;  3P5J A;  4PFO A;  1X1D A;  2O03 A;  4A69 C;  1FC3 A;  2E36 A;  4A3E J;  3DCF A;  3HZJ A;  3KP2 A;  4U0Y A;  1OKR A;  2JA2 A;  3GO5 A;  3V7C A;  2L7F P;  4U0W A;  1RI7 A;  3IAM 2;  1I5Z A;  1F43 A;  4XSX F;  2DU9 A;  3H3Z A;  2DXI A;  3FXK A;  2F4O B;  4ENJ A;  1OJL A;  2DDA A;  3OMY A;  5TRD A;  2YS9 A;  2KFD A;  1QZY A;  2KL4 A;  4ZTJ A;  4U7D A;  3KZI C;  1V5F A;  5H6Q A;  4GCV A;  1WH5 A;  4PGH A;  4EAT A;  4UUV A;  4XID A;  2DQR A;  4II3 A;  3S17 J;  4HQE A;  1BW6 A;  1YX3 A;  3M9A A;  4A3B J;  1IN8 A;  2E2H J;  1QBJ A;  3K2Z A;  2LOO A;  3KP4 A;  1B9M A;  4Y33 A;  2IJL A;  2IGM A;  1O4X A;  2XC7 A;  2ELJ A;  1J9I A;  4EMS A;  4IX7 A;  4EM0 B;  4B1R A;  3FM3 A;  2EV5 A;  1PYV A;  4HRI A;  4O5V A;  3HRU A;  5LFA A;  5KAF C;  3LMM A;  3OR2 C;  4L9T A;  2V9V A;  3Q3S A;  3H92 A;  4XRS G;  4UVB A;  3VYT B;  5DCM A;  4LFU A;  1IO2 A;  5B3S H;  3BRO A;  4AU7 A;  2VKE A;  3CDL A;  5FJ8 J;  1BI0 A;  2HR3 A;  3DEU A;  5D5U B;  3CCQ I;  5AON A;  2DPU A;  1EH7 A;  5FKK A;  3RQI A;  3VYR B;  2X6X A;  2CV1 A;  4KFC A;  2DMN A;  4PSW A;  3HBL A;  2XSJ C;  5KNL A;  5IPA A;  4UHT A;  2CFX A;  5TIS C;  2Y2Z A;  2Z5U A;  3LSI A;  3T1B A;  3CUQ C;  4GYI A;  2O8X A;  2QLZ A;  3TO7 A;  3O3K A;  4X6A J;  1O3Q A;  3IC7 A;  5JHU A;  2HVR A;  4Y7N J;  1YOV B;  4B3X A;  5HOD A;  1EF4 A;  2LC2 A;  3VEP A;  1Z6R A;  2CG4 A;  4A5M A;  3A01 B;  2HQN A;  4RLF A;  4Y15 A;  4UUS B;  1FOY A;  3M07 A;  3HUG A;  3L00 A;  1JKP C;  2HKX A;  3ZMD A;  1OCP A;  1K4T A;  4YIR X;  3MMY B;  2EFW A;  1OLT A;  5M3M J;  3VSK A;  4RMN A;  4A0Y A;  5HNH A;  4BE0 A;  2DK8 A;  3CES A;  3E0J B;  2MAB A;  2F5D A;  4FX0 A;  2OV7 A;  5K7Z A;  1Y39 A;  1ETW A;  3FWE A;  1ETK A;  4XKB A;  2STW A;  1OPC A;  1IF1 A;  2IA1 A;  4G9Y A;  1TP4 A;  1IZ1 A;  3VDX A;  5GAE J;  2UUZ A;  1TNS A;  3HG9 A;  4MTD A;  4FHT A;  3ESW B;  3F22 A;  2CQN A;  3UKG A;  3KP6 A;  2HYJ A;  1QA6 A;  1GVD A;  4IRH A;  1J75 A;  2E1O A;  2QGU A;  2Y48 A;  2UXN A;  2V6C A;  3K70 D;  2KDO A;  4DNC A;  3KYC B;  2EA4 A;  5LHG A;  2KPM A;  4A3M J;  2FOK A;  4J19 A;  3CCM I;  2OA4 A;  5F0H A;  3BG7 A;  4DGW B;  3W6J B;  1IDZ A;  4E4H A;  4A3D J;  2NOG A;  2JSP A;  3HRS A;  3K7A J;  5IYB J;  2LF7 A;  2EIM H;  3DU6 A;  3E6C C;  2XHK A;  4LIT A;  4OIR F;  1A31 A;  1ERD A;  2OTL I;  4HAM A;  4ZJZ A;  2OZU A;  4O3M A;  3CCU I;  2EIN H;  3HSE A;  5FD5 A;  4CZZ A;  4Q4Z F;  1Z7L A;  2ICW G;  2XKO A;  4M6V A;  5LEJ A;  2PJP A;  2EFP A;  2VXD A;  2W82 A;  4NQW B;  4ZYG A;  4QTR A;  1E17 A;  2O5R A;  2RDP A;  2LDU A;  3VYU B;  2CQX A;  2DMU A;  4LIU A;  1C0W A;  4EJU A;  4C30 A;  1HXD A;  2E2I J;  3IL2 A;  3WGG A;  1B72 A;  4BDZ A;  1SFX A;  3QP6 A;  2UWM A;  2Z33 A;  1W7P D;  2FD5 A;  2X6Y A;  3ZCO A;  4WWC A;  3DP7 A;  1FT9 A;  4BGD A;  3J7A O;  2H1L A;  2Q2E A;  5KVR A;  1N78 A;  1RKT A;  5C44 J;  1VQO I;  2IGN A;  4LB6 B;  1S3J A;  4NDL A;  4UVC A;  5GAG J;  1JE8 A;  1T98 A;  1O3S A;  3GTL J;  2MLG A;  2VL8 A;  3HOW J;  2W48 A;  2YR2 A;  1F1Z A;  3P9C A;  3MWM A;  2MD0 A;  3F6O A;  3BP8 A;  4HF1 A;  3R0J A;  4G6T B;  2HQA A;  3A2K A;  3EUH C;  1BW5 A;  2CW0 F;  2P7V B;  1V5E A;  2PQ8 A;  3GBG A;  2L9R A;  3CCY A;  1Z9C A;  3FXR A;  2E5Z A;  5K1Y A;  2WWY A;  3BTJ A;  4DZP A;  3M8J A;  3HYI A;  5C3E J;  1QZE A;  1MMA A;  3OOU A;  2DFE A;  3WE3 A;  1I27 A;  2ZSI B;  1ZKG A;  1AU7 A;  3BZC A;  4CCL A;  2JK3 A;  4MFE A;  1X2N A;  3WTY C;  2IS2 A;  1SVM A;  5CYV A;  3B6C A;  4E7I A;  1OMI A;  3FXM A;  3JRA A;  5J4Y A;  1JT6 A;  1KU7 A;  2IT0 A;  1KYW A;  2DK5 A;  3BG6 A;  1NK2 P;  1R1U A;  2AO9 A;  3S1Q J;  2CH0 A;  3W6K B;  1OR7 A;  3GTM J;  2DDB A;  3L09 A;  4I0B A;  5E18 F;  2KIU A;  3AKZ A;  2JPB A;  3L2V A;  1IC8 A;  4MLO A;  4MEY F;  1SAN A;  2HYG D;  3HOV J;  3B73 A;  4MNU A;  1H8A C;  3K4N A;  5KCM A;  2LG4 A;  4CCO A;  3FKJ A;  2JTV A;  4KMU X;  3SZP A;  2HPI A;  2FXA A;  2HQ5 A;  1ZR4 A;  2E1C A;  2P4W A;  2XGE A;  2DPD A;  3S1N J;  2HYF A;  1XD7 A;  4HLX A;  3S3M A;  2BXY A;  4IEJ A;  5ILS A;  1Z6T A;  2LKP A;  5FKL A;  1U6G A;  3I59 A;  1DGR M;  4GYG A;  4K2E A;  2HGC A;  2W1O A;  1YRN B;  4GGG A;  2HDD A;  5HLT A;  1X3U A;  2CYY A;  3CLO A;  3ERE D;  1WZ2 A;  1HKT A;  2V4J C;  5L3F A;  1WFX A;  2M0M A;  1WJE A;  2OZ6 A;  4F91 B;  1PUE E;  3W2W A;  2ME6 A;  5J3L A;  5ERI A;  3W2A A;  1JUS A;  3DLL F;  3ZPL A;  2G9W A;  4U88 A;  5FFZ A;  2OF7 A;  1W1W E;  5GAH J;  3SZT A;  2M8G X;  4AUX A;  3GFI A;  2HZD A;  5JVT A;  5LLQ A;  1EGV G;  1ETQ A;  1XX5 A;  2HXO A;  5FFX A;  2BY3 A;  3PM1 A;  3H35 A;  5DM7 F;  2L9V A;  2MLK A;  3PUB A;  2R7Q A;  2DMT A;  2R92 J;  2HPM A;  2Y0S N;  5L3G A;  3QPL A;  2VT2 A;  1F9N A;  5KHD A;  1ORK A;  4C2U A;  2OCE A;  4BHB A;  4ZYE A;  1ZH5 A;  2K9L A;  1EH8 A;  1JTY A;  3VYS B;  4MTE A;  1YS7 A;  2Y31 A;  5K7H A;  3HOX J;  3OYC A;  1D0Y A;  2R4G A;  3F21 A;  1POG A;  2MGQ A;  1R9T J;  5HNF A;  1MNE A;  1J5Y A;  3E1S A;  3D5R C;  1HLV A;  1MMS A;  1I3Q J;  4MO7 A;  2LRE A;  1O7L A;  2E1N A;  3P7N A;  2IEK A;  3OYL A;  5BOX A;  2P5L C;  5IT3 A;  1B6A A;  4CCK A;  1O3T A;  3U2R A;  1U5T A;  2LH9 A;  2L9S A;  3L2U A;  3RDI A;  3A0B C;  3JRB A;  3RIR A;  3QRF F;  1S8N A;  2CGP A;  1DDN A;  2M4G A;  4GFB A;  1RKW A;  3ZMS A;  2BZT A;  1RET A;  3WG7 H;  5JLW A;  2R5Z A;  4BEH A;  3FIW A;  1WI3 A;  5EGO A;  1TTY A;  4ESF A;  5EG0 A;  3WTS C;  1YTY A;  1FP1 D;  2JRT A;  2VJ4 A;  1KYZ A;  4BH9 A;  2G7H A;  3CC2 I;  3L2Q A;  3RI4 A;  1Y8R B;  4QPO A;  4HPQ A;  4DZJ A;  2DT7 B;  4OIN F;  5CVV A;  1WJF A;  1IWB G;  5CQG A;  3O8H A;  1LKX A;  5LGN A;  4M74 A;  2JA7 J;  2V9K A;  2RVC A;  3RSN A;  2OUM A;  2Q8K A;  1E2X A;  3HL2 A;  1Z67 A;  3KYD B;  1QPM A;  4P9F A;  1G59 A;  4KUM A;  4U0V A;  4EEF G;  4UXN A;  3KLN A;  1QVT A;  4RM2 A;  2QZ8 A;  3F0C A;  2JA5 J;  1HF0 A;  2K7L A;  2QSH X;  3H1C A;  2VIX A;  2CUE A;  2IW5 A;  1JTX A;  2V79 A;  3S2W A;  4XLH A;  1G4D A;  4RBO A;  3SZG A;  1MND A;  3SEZ A;  3BTL A;  3D5S C;  2KKO A;  1FZP B;  2JJ7 A;  3WE2 A;  1KQ0 A;  4BXX J;  2A6T A;  3H9J A;  3HGY A;  3TO6 A;  3OL3 A;  2DJI A;  3BPX A;  1Q1V A;  4E70 A;  2R7W A;  3CZ6 A;  3JSO A;  1P4X A;  3LNQ A;  4KYW A;  3M3Y J;  3LL7 A;  2LYC A;  3I56 I;  2GOX B;  2DOD A;  3IUO A;  3ZGK A;  3M8E A;  1FTZ A;  3I64 A;  1O7F A;  2E2J J;  2V1D A;  2EZL A;  1BJA A;  3IH3 A;  2E35 A;  1YJW I;  2Y0S A;  4LLG F;  2M9H A;  1FBS A;  2X1D A;  4MFD A;  3ZQC A;  2J5P A;  3SDG A;  1A35 A;  1T39 A;  2LBF A;  4XN0 A;  5FKO A;  5B5E C;  4Y52 J;  1MBF A;  3RZD J;  3D0S A;  2BVL A;  2GA1 A;  5E3O A;  2GXA A;  2BXZ A;  3GZN B;  1UMQ A;  3ZXS A;  3GFM A;  2XGC A;  2AQF A;  1K61 A;  4KIT B;  4PJ0 C;  4HNU A;  2QQA A;  3BCB A;  1DP3 A;  4BUP A;  1H9G A;  2LP0 A;  3C18 A;  3BY6 A;  3SHF A;  2PMH A;  3I0T A;  1KA8 A;  1XCV A;  3J7A Y;  2AXT C;  1X58 A;  2Z2S B;  2X4H A;  2GBY A;  2W84 A;  4UB8 C;  3E3V A;  3EDP A;  4HZF A;  9ANT A;  1D1B A;  2TRT A;  4ON0 A;  4EM2 A;  3RYP A;  3HXL A;  2BY2 A;  3N05 A;  3CMA I;  2D1H A;  5EYR A;  4IHW A;  4F3Q A;  1IWP G;  2COB A;  1Z1D A;  2LMD A;  2CMP A;  4B48 A;  2F5F A;  3L1P A;  3V7R A;  3CCV I;  3FDY A;  3ZMU A;  3HDD A;  3OWT A;  3GUD A;  1JGS A;  1R58 A;  3Q0V A;  3ZN1 A;  2XIG A;  4RB2 C;  3GXO A;  1B8I A;  4ZYH A;  1IV8 A;  1XMA A;  1LUJ B;  5EZH A;  4YII A;  3CCE I;  2MC3 A;  3JRI A;  2GXB A;  1FOX A;  2LNB A;  2EZK A;  2NVY J;  3RPU A;  3H9G A;  4IOC F;  3T0Y A;  2V26 A;  2QM3 A;  4EGZ A;  1T38 A;  4BKX A;  5HDG A;  4C2M J;  2EH3 A;  4OIO F;  3OYI A;  1R4N B;  3FXQ A;  4HX4 A;  1WHU A;  3QYE A;  2P81 A;  1YW9 A;  4XLE A;  1A6I A;  1IN6 A;  1P6R A;  1XDS A;  5GTH C;  3K9T A;  2FEZ A;  1RZ4 A;  2IS1 A;  4PFP A;  3ABK H;  2JRM A;  1JKQ C;  3TED A;  1M1E B;  1MMD A;  5AIP A;  3SXY A;  5DUI A;  5E79 C;  3K0L A;  2L2O A;  4KIC A;  2EZI A;  3VWB A;  1E3O C;  4G6Q A;  3BQZ A;  3OV8 A;  2FRH A;  2M0C A;  2M7A A;  1T0F A;  1YYV A;  2X1C A;  3DU5 A;  3ASN H;  5E8I A;  2Y30 A;  1EKE A;  2V7F A;  5GPC A;  2A3S A;  4EM1 A;  1XTA A;  3SDB A;  2HVQ A;  3HOZ J;  5FLM J;  4OAZ A;  1MKM A;  4LK1 F;  3TW7 A;  2FJ1 A;  4A3F J;  2XF6 A;  2ZFU A;  4KIS A;  1T56 A;  2NVQ J;  1X2M A;  4RAF A;  3AG4 H;  3ASO H;  5HS9 A;  3FHZ A;  2V1U A;  3MKW B;  4PCQ A;  3ECO A;  5E3L A;  1ZRC A;  2DA7 A;  1R22 A;  1LPQ A;  1Y1V J;  3AAF A;  4LB5 A;  2HXI A;  3PNT A;  3RYR A;  1LEB A;  2A61 A;  4E7J A;  1SFO J;  4CGZ A;  1IRZ A;  2MSY A;  4HNT A;  4DYQ A;  1JJ6 C;  2ZNY A;  4EVI A;  5HS8 A;  1BOB A;  2YSR A;  3DQV C;  4BBS J;  2Z9O A;  2O9L A;  2EWN A;  4FQG A;  4DJA A;  3RKW A;  4A5N A;  1S6L A;  4R1H A;  3Q9V A;  5DUK A;  3FXO A;  4DIQ A;  2VKD A;  2LVS A;  5K5Q A;  3QYB A;  5LBQ A;  2MW8 A;  2ZXJ A;  3JRG A;  1RES A;  1P9Q C;  2EA2 A;  2M7B A;  3A0H C;  3CP2 A;  1TWA J;  3PQJ A;  4Q47 A;  2DA4 A;  2MFZ A;  2W00 A;  4KT5 C;  2VQL A;  1BOA A;  4JOM A;  2F5C A;  1G2H A;  3HGG A;  5ICC A;  3CJQ B;  5KAI C;  5J4V A;  1GDT A;  2KT0 A;  2CO5 A;  3I4P A;  1NHA A;  1YIT I;  2LTP A;  1Z0X A;  1GVJ A;  1LNW A;  2L5Q A;  4RGX A;  2KP6 A;  4F93 B;  4PJL A;  3HJE A;  4ESJ A;  1HW5 A;  2CSO A;  5JI6 A;  3EUK L;  4BQA A;  1QHH D;  5JVG F;  3DEE A;  1J7K A;  2R3S A;  3BTC A;  5LGU A;  1IGN A;  4LG3 A;  1T2K A;  3GTK J;  1H0M A;  1MBH A;  3A02 A;  3SFI A;  3F23 A;  4YRV A;  3OYH A;  4KDP A;  5HLG A;  4CSW A;  1PJR A;  5CVI A;  4DYC A;  3OIP A;  2P5V A;  2BOL A;  1MW7 A;  4M6Y A;  4UNO A;  5TGT A;  1RUO A;  3JRH A;  2ME0 A;  1D5V A;  3FBI B;  4F52 A;  4G8X A;  3BJO A;  4CDG A;  1ITY A;  4DYR A;  4HV5 A;  4XL9 A;  2HOA A;  2RRE A;  3CUQ B;  1SEU A;  3CMY A;  1HKS A;  2M3A A;  1IAW A;  1NG7 A;  1ZG3 A;  5IOZ A;  2V1X A;  2L4A A;  1R36 A;  4KJZ A;  1BBY A;  4D7N A;  2DLL A;  1OIS A;  2QA4 I;  3TO9 A;  1KON A;  1MMN A;  3FM5 A;  5C4J J;  4BHP A;  1MNM C;  3WHB A;  1V4R A;  5LRR A;  2A68 F;  1SAU A;  2NNN A;  3C2B A;  5DD8 A;  2P0W A;  2ADU A;  5JLX A;  4D5C A;  1S29 A;  1EGM G;  1Z2Z A;  1ZG5 A;  5DM6 F;  2WY7 Q;  1W0U A;  3KEO A;  3CLQ A;  3BCA A;  1GV5 A;  2R7R A;  2L7M P;  2F5E A;  3I53 A;  4JP0 A;  1AWC A;  3CD6 I;  1CGP A;  1AKH B;  3DV8 A;  2ZB9 A;  3NWS A;  5D8L B;  2DFI A;  3E7L A;  3NAU A;  3NEU A;  2R7O A;  1FLI A;  3L2R A;  2KRF A;  2EB7 A;  4QSH A;  4FAS D;  2VBX A;  1HBX G;  4U87 A;  1NK3 P;  1LDJ A;  3WU0 A;  1DU0 A;  4LLN A;  4L9N A;  1RUN A;  3VPR A;  2DFF A;  2DI3 A;  5M5Y J;  4XSZ F;  4FIS A;  2RV8 A;  1LFP A;  4N4O B;  1MJA A;  3OS1 A;  5E1W A;  3BR0 A;  1RR8 C;  2M1B A;  4YFX F;  2FBH A;  3GTQ J;  1VQ5 I;  4AIH A;  3OYB A;  1G3S A;  3E5X A;  4D9J A;  1P2F A;  1U78 A;  1H88 C;  4I76 A;  1UHS A;  1WSU A;  2PG4 A;  5DYM A;  3ISP A;  3A01 A;  1DP7 P;  5IYC J;  4UUS A;  3N4M A;  3PFY A;  4B43 A;  1TW2 A;  3HOU J;  4XLC A;  2JPC A;  5D5W B;  3MQ0 A;  3RZO J;  2HOS A;  3CMM A;  1VQ8 I;  1FMV A;  2WTE A;  2DA6 A;  3I54 A;  1G3W A;  4HDU A;  3TMO A;  1QZZ A;  2CUJ A;  1W7P B;  3WTW C;  4IRG A;  3J81 K;  1I3A A;  1K7A A;  4FE4 A;  3JTG A;  1XGM A;  3ELK A;  4QWQ A;  4NC8 A;  3S8P A;  4L9J A;  3BG3 A;  3F8C A;  1EH6 A;  1T95 A;  3LWF A;  3K70 C;  1Y1W J;  5EEG A;  1ZLJ A;  2HS5 A;  2EZH A;  1JUM A;  5F1J A;  1HW1 A;  2IRF G;  2YPR A;  5J1U A;  2CU7 A;  3IH2 A;  4FX4 A;  1QO0 D;  2VJ5 A;  4LD5 A;  4GXO A;  2AQE A;  3V8K A;  1E0E A;  5HVQ C;  1HKQ A;  1E3H A;  3D1N I;  2FML A;  3CF5 F;  1VND A;  3HHG A;  1VQL I;  1LE8 B;  1E3P A;  2KHM A;  1DGW Y;  1GHC A;  2IS6 A;  3EUH A;  2PI0 A;  3R0A A;  3WTV C;  3H5N A;  4BL0 B;  2JN6 A;  4RM3 A;  1CF7 B;  2WY8 Q;  3OYF A;  5L3E A;  1TC3 C;  2YU9 J;  1MZB A;  3DKY A;  3VB2 A;  5HLI A;  2AS5 F;  1IRF A;  3E5Q A;  4M72 A;  5D5V B;  3DXJ F;  2X6O A;  2JUG A;  1VFC A;  2EV0 A;  5E1Z B;  4QLC U;  3G1O A;  2MYS A;  3J81 Z;  4G7H F;  2KIM A;  3BR3 A;  2XV4 S;  1JJ8 C;  2GZW A;  4NQW A;  3KCC A;  2IP2 A;  4OOI A;  5JHF A;  2VJJ A;  4AYB N;  1QGP A;  4ESB A;  1J2X A;  2O7O A;  5IP6 A;  3TOA A;  4UV8 A;  3FX3 A;  4E7K A;  3GYH X;  1VQ9 I;  1ZGJ A;  2A07 F;  4A93 J;  1FIA A;  4XLP F;  2K9M A;  2QYO A;  1X1C A;  2NXN B;  5K5O A;  3CQZ J;  3HTU A;  4P5O A;  4XOT A;  2OTJ I;  1DU6 A;  2OU2 A;  2FOW A;  3EET A;  2DA1 A;  2W24 A;  3REO A;  2XAH A;  4HNV A;  3G3Z A;  3H5A A;  4B3A A;  1BC8 C;  3PNV A;  2DT6 A;  3KP3 A;  4JX4 A;  3GCM A;  1QU3 A;  4PK4 A;  1ZK8 A;  2JVH A;  1VI0 A;  4BY7 J;  1EJ9 A;  1SFK A;  3LSG A;  4A3I J;  3IWZ A;  2IAI A;  1PP8 F;  3DTE A;  1UHW A;  3MKZ A;  3F8N A;  5FKM A;  3ECH A;  4Y4R A;  1N75 A;  1S7O A;  1GXQ A;  1FSE A;  2XDV A;  3TBI A;  4ASN A;  3S14 J;  1RC9 A;  2D2W A;  1USS A;  3RKX A;  1EV7 A;  2F5V A;  5F64 A;  2XB0 X;  1J09 A;  1YO5 C;  1YQA A;  1FOK A;  2L02 A;  4HX8 A;  2ELK A;  1IXC A;  2XAJ A;  1IXS B;  2DT5 A;  3A4C A;  5FO5 A;  1XSX A;  3LA7 A;  1HOM A;  2DCE A;  5EDN A;  2VT3 A;  1YIO A;  4RS8 A;  1YI2 I;  1SC7 A;  4JQF A;  2F2E A;  2PFB A;  3BG5 A;  5LHH A;  2BW3 B;  1MH3 A;  3E6B A;  3RTR A;  1ZRE A;  4BDY A;  3OIO A;  3HHH A;  2L4M A;  1FJL A;  2ETH A;  3MAJ A;  4CYD A;  1X4P A;  1YS6 A;  3BTI A;  2HQR A;  4KT6 A;  4IHV A;  2DYR H;  3WOD F;  2FBK A;  3GF2 A;  3BDD A;  2Z3Y A;  2QEX I;  4FTH A;  2QCO A;  4IPA A;  1W5C C;  3I4M J;  4ZZL A;  3ZQ7 A;  1OYY A;  1DPU A;  5IP9 J;  1YRN A;  2DOE A;  4PZJ A;  4BBR J;  3B02 A;  5FB2 A;  1ULY A;  3ABT A;  3JSP A;  1ZG1 A;  2K9N A;  3S32 A;  2A5W A;  2DA2 A;  2VBY A;  3E97 A;  4MQV A;  1ON2 A;  3OOP A;  3PSF A;  1XG1 A;  3TDZ C;  4R79 A;  4ZTF A;  3G1L A;  3WTX C;  4P55 A;  3GZ5 A;  4AYB A;  1PUF B;  2XGX A;  1ZYR F;  2ACJ A;  4IQJ A;  5BPI A;  1FTT A;  4XKW A;  1D0Z A;  2DA3 A;  2YX7 A;  4CHU A;  3BG9 A;  4OAY A;  2HVS A;  4U7B A;  2OJE D;  3GFL A;  2X6W A;  2L01 A;  2QKM B;  1MH4 A;  3LSJ A;  2W25 A;  1WRJ A;  3LAP A;  3TOB A;  2WV0 A;  4L9V A;  4M3E A;  3F9K A;  4XLN F;  4LG0 B;  3U21 A;  1JI8 A;  1XS9 A;  1F5T A;  2WAD A;  2E60 A;  1I1S A;  2B9S A;  2K9S A;  5E3N A;  5EZG A;  3QPH A;  1YE9 A;  2CV2 A;  2PJR B;  5BPD A;  1ZHF A;  1RR7 A;  3QOP A;  1GXP A;  3Q0W A;  3CO6 C;  3AG1 H;  2W57 A;  1DPR A;  4BJ6 C;  2WAQ N;  3K4M A;  1TWF J;  2R7F A;  5HOO A;  1A04 A;  1G3T A;  1XN7 A;  2LSO A;  3O8G A;  1TWG J;  2QBY B;  2HEO A;  1FEX A;  3S93 A;  2ECC A;  4XRF A;  3IH4 A;  1S7E A;  5E3M A;  1AHD P;  2KMU A;  1A6Q A;  3L2W A;  3FXJ A;  2VJI A;  3S3O A;  1LQ1 A;  1UEL B;  2ZXW H;  3C3W A;  1DQU A;  3DPU A;  1MBJ A;  3V7S A;  1FPQ A;  3IRR A;  2WC2 A;  2VKV A;  1R5I D;  1WVR A;  1FOW A;  1HC8 A;  1XMK A;  3BOQ A;  1P4W A;  2C6Y A;  2D5V A;  4JBA A;  4W97 A;  3BR6 A;  4IO9 F;  2MC4 A;  3GX4 X;  2RNJ A;  5CVR A;  3CJT B;  3H9Q A;  4EJV A;  1MBK A;  1R49 A;  4MIM A;  2JSC A;  2D45 A;  2VE9 A;  1TQP A;  2DA5 A;  3JRF A;  5HLH A;  3M1C A;  4CYC B;  3LA3 A;  1BA5 A;  1QRY A;  2Y9Y A;  4P9U A;  3I4N J;  5J47 A;  4EQQ A;  3BR1 A;  2EV6 A;  2VBW A;  4ENM A;  2XAQ A;  2HFH A;  2VOP A;  1TQI A;  2FE3 A;  2HOE A;  3FXU A;  5ICG A;  2OCC H;  3ABL H;  2E7X A;  3TP3 A;  1MDM B;  1OCT C;  1IN7 A;  4BNC A;  1SMY F;  3L7W A;  4PJM A;  5F04 A;  4BY1 J;  4V2F A;  1K79 A;  5ED4 A;  4B8X A;  3KZZ A;  3U9G A;  2CWE A;  1CQT A;  1NH3 A;  1OYW A;  4MQ9 F;  4IKF A;  2R5Y B;  1B4A A;  2JWT A;  4A2U A;  1BJZ A;  1I50 J;  4IXA A;  5ILV A;  4IRI A;  1XC5 A;  2A6H F;  2ZXH A;  4FE7 A;  3S3N A;  3BC8 A;  3D5L A;  4PDK A;  3TKY A;  1SD4 A;  2G7U A;  3QOE A;  1Q1H A;  4HEA 2;  3LSK A;  3LQQ A;  2BVM A;  1EEX G;  3SFZ A;  3X2Q H;  4I2O A;  1XDU A;  3BLY A;  4F92 B;  3FK7 A;  4IOA F;  4WXD A;  2EFQ A;  2Q1Z B;  2DW4 A;  2PEX A;  2WAQ A;  2ZJQ F;  3WTT C;  2I5U A;  1N25 A;  4R8H A;  1KQ8 A;  3HSF A;  3PIP F;  4RB3 C;  3WTU C;  4HQM A;  4BQN A;  4OU0 A;  3K4L A;  3J7Y J;  1K6Y A;  1KU3 A;  4Y13 A;  3GW2 A;  3HIF A;  3IHU A;  5BQT A;  3CC7 I;  2KIQ A;  2QSG X;  2NOJ B;  2R7Z J;  2F4M B;  1OYI A;  3CDH A;  1I6H J;  3LSM A;  3JCU C;  2FA5 A;  2ZNZ A;  5A2Q K;  2K40 A;  3MD2 A;  4G7Z F;  5FKN A;  3A1Y A;  2IXS A;  2DMQ A;  3PFI A;  4BQQ A;  1P7J A;  2F48 A;  3TW6 A;  4CO8 A;  2E1M B;  2PBI A;  4UUT A;  1VQ4 I;  2NVX J;  2BYV E;  4RA2 A;  1LEA A;  3TDU C;  4CZC A;  1IUY A;  1B9N A;  3WTZ A;  1UJ8 A;  5D6E A;  2H6B A;  4ABZ A;  1R7J A;  4AC0 A;  1ODD A;  1R5G A;  3SQN A;  2O61 A;  2QVO A;  5J8F A;  3OIQ A;  4IJA A;  3G2B A;  4IVN A;  3PQK A;  3QAH A;  4A6E A;  5LHI A;  1IV6 A;  2R0Q C;  4XM3 A;  4A3L J;  4HF2 A;  3ZMV A;  3Q9S A;  4XRS A;  1YW7 A;  3S1M J;  3K6G A;  4WXH A;  1X3Z B;  2HKO A;  3ZQI A;  3F72 A;  3CF2 A;  2BE5 F;  2WAE A;  2XF5 A;  5FGM A;  5H6R A;  2VOD A;  4AVP A;  5L3B A;  2P8T A;  4A3J J;  1L0O C;  4ENN A;  3NAR A;  3P9I A;  2GXG A;  3ERM A;  1H89 C;  1FMW A;  3HOS A;  2VPR A;  5E20 A;  2DAO A;  3R60 A;  2COM A;  3HOY J;  3C2G A;  3FZV A;  4A12 A;  2EFO A;  3HPG A;  2KRC A;  2XF7 A;  5A2Q Z;  3IRQ A;  3E6M A;  1D5Y A;  2JA8 J;  3W6V A;  1IG7 A;  5DTD A;  2ZO4 A;  1FIP A;  3JR9 A;  4AIJ A;  2R7T A;  3K2A A;  4NNJ A;  2E1M C;  4X0G A;  4XNF A;  2ELH A;  2CJJ A;  1SD5 A;  3AL0 B;  2LK2 A;  1VQM I;  2DOA A;  1VQ6 I;  2ZKZ A;  2XPV A;  4FET A;  2JUC A;  4ZZD A;  3KFW X;  4E6K G;  3DKX A;  5JFR A;  2ESN A;  3M7G A;  2MD5 A;  2H1K A;  4B44 A;  1R5H A;  3FF5 A;  4L18 B;  4UB6 C;  5L3D A;  1VQP I;  5D4R A;  3ABM H;  3GLL A;  4CUG A;  3GTG J;  1A5J A;  2P5K A;  1IRG A;  3T8T A;  2KIF A;  2NAZ A;  4RGU A;  3DKW A;  3H36 A;  4XOR A;  1QHG A;  4CCN A;  1U8R A;  2FBI A;  2ISZ A;  5D5X B;  4BAC A;  2NYX A;  4M3D A;  4HW0 A;  3V8J A;  4YEL A;  4MEX F;  1FWZ A;  2ZFW A;  3HPH A;  3KLO A;  3VSL A;  4P1W A;  2H6C A;  2EFN A;  5AIQ A;  1YJN I;  5IOY A;  3L2C A;  3AFH A;  2A5Y B;  2HOT A;  2H8R A;  3JAM K;  4JK1 X;  2KZG A;  2M4K A;  4E7L A;  3F6V A;  3HRT A;  1O57 A;  2Z16 A;  4CIC A;  1T8I A;  3GWZ A;  4HG2 A;  4HYE A;  2IPQ X;  1RIO H;  1YG2 A;  2KQR A;  3W3C A;  2ZJP F;  3KEQ A;  2L7K A;  2LR8 A;  2HTS A;  2OQG A;  3H5R A;  3JTH A;  4NBQ A;  1K78 A;  1HCR A;  1XGO A;  3M4O J;  1PP7 U;  5FD6 A;  2KRH A;  3DF8 A;  3V8L A;  1FSH A;  3AL0 C;  1BI1 A;  3DPL C;  3K1N A;  1I6X A;  4BJT A;  3HEF A;  5F6F A;  5J8C A;  1O3R A;  2VLA A;  2X0L A;  2ZME B;  5BS6 A;  2HZT A;  2X9D A;  2LD5 A;  2UZK A;  1X1P A;  1TBX A;  2DFH A;  3RPU D;  1OCC H;  1F36 A;  1UB9 A;  2VAS A;  1IRX A;  2VXZ A;  3ZMZ A;  4D5F A;  4I01 A;  1G8X A;  4IF4 A;  1MGT A;  2BY0 A;  1BM9 A;  3GTO J;  1SFU A;  2NVT J;  1SD7 A;  1W36 D;  1U9N A;  1D1C A;  1LFU P;  2QKL B;  1Y0N A;  3G73 A;  4J01 A;  3CUQ A;  1T0F C;  4BAY A;  1I1G A;  3UNG C;  3I5U A;  5FRM A;  3IKV A;  3C1D A;  4XIC A;  4N9I A;  1BI3 A;  2F4I A;  2ID3 A;  2L9N A;  4XN3 A;  3C2H A;  4H0E A;  1UAA A;  1GUU A;  1B1B A;  2F6C A;  4DOZ A;  1SMT A;  1MSF C;  4M9Z A;  1Y6I A;  1ZGW A;  1WH7 A;  2EBI A;  4GO1 A;  3EYY A;  2Y75 A;  3NRV A;  5D6F A;  2HDW A;  1JGG A;  2Z1D A;  2ISY A;  2XAS A;  1ETX A;  5LEK A;  2JA6 J;  4UVA A;  2BBY A;  1D8K A;  5EJC A;  1D1A A;  2LFB A;  4H4K C;  2ZME C;  2CRG A;  1MBG A;  1AKH A;  2EK5 A;  1ZEL A;  2K5C A;  2L54 A;  3QWL A;  3R4K A;  5D4S A;  1ZRD A;  1R4M B;  1FBU A;  2IGO A;  2KZV A;  5FRO A;  4BS9 A;  2FUG 2;  4D7M A;  3QPS A;  1SFE A;  2M30 A;  3S1R J;  4C3J J;  2VPL A;  5LGT A;  2LKS A;  4OMZ A;  1Z91 A;  3A03 A;  3HTS B;  4IHY A;  4ZDO A;  1MBE A;  1XCB A;  2K3F A;  2VKH A;  4JX6 A;  4I0A A;  3OYA A;  2DJN A;  3OYJ A;  2R7X A;  3DEW A;  1Z3X A;  3WG9 A;  2QQ8 A;  4N4N B;  1ETO A;  4F55 A;  1HA8 A;  2KDZ A;  1XPX A;  2WV1 A;  2DTZ A;  5TJJ A;  2BY1 A;  3CCR I;  4DW6 A;  4ZYA A;  4ZC3 A;  5D8K B;  1Z7U A;  4CCJ A;  4P96 A;  2O0Y A;  3ZQF A;  1YIJ I;  3HM5 A;  1MMF G;  3ZN0 A;  3LSH A;  4HA8 A;  5DCM B;  1GT0 C;  4J00 A;  3PL8 A;  2NS7 A;  3PNY A;  3DBH B;  2MH2 A;  1VF9 A;  1XMX A;  2XPW A;  1W7P A;  4YIF A;  3RJP A;  3Q5F A;  3CUO A;  1WJD A;  1YX5 A;  1WGX A;  5E1X A;  2GIZ A;  2P6S A;  4ENK A;  4EGY A;  3IP4 B;  1Z05 A;  4KIG A;  3N97 A;  1MJ9 A;  3ZR8 X;  5GTI C;  3GEZ A;  3O2P E;  2PX9 A;  2I10 A;  4PJN A;  1ACI A;  4WF2 A;  1PVE A;  2GIV A;  1NG6 A;  3FKI J;  3T8R A;  3KYL A;  1K4S A;  4UY8 I;  1MD0 A;  2NRA C;  2JVG A;  3DTK A;  2WBM A;  1Y8Q B;  3GME A;  4M3G A;  4RLQ A;  1HW2 A;  3FK6 A;  4XMY A;  1WI9 A;  3KE2 A;  3FMS A;  1V5G A;  5F27 A;  4W1U A;  2PMZ N;  2ECB A;  1IN4 A;  4S0H B;  3UR3 C;  4A3K J;  2G0E A;  2R7U A;  2N8G A;  1R1V A;  1W5T A;  2Q0O A;  3I58 A;  1X3W B;  2MH9 A;  3VOE A;  4CCM A;  1U3E M;  1K6O A;  1LE8 A;  1LB2 A;  3HUG B;  1FYL A;  2E7W A;  1XSD A;  2RAE A;  2Y69 H;  4XRM A;  1A36 A;  4BYY A;  5CJ9 A;  4G6D A;  1CF7 A;  1GV2 A;  2GWR A;  3MZY A;  2LY2 A;  5J40 A;  2H94 A;  4DBR A;  2I8D A;  3ONQ A;  3V42 A;  3ULQ B;  1WKM A;  4LLL A;  4PGG A;  1Z77 A;  3LQR A;  2HTJ A;  4L5I A;  3T5X A;  3JRE A;  4QPQ A;  3TGN A;  2FNP A;  2YUS A;  2E19 A;  1LJ9 A;  4FCY A;  2OD5 A;  2QQ9 A;  4I7H A;  2STT A;  1ZN2 A;  3LOC A;  3OYE A;  5LD2 C;  4YEJ A;  3K10 A;  5DCF A;  2M34 A;  4XLF A;  3VOD A;  2PN6 A;  2IA2 A;  2PLY A;  2BGC A;  4NUB A;  3OYN A;  1V3F A;  4AWX B;  2H09 A;  4HF0 A;  2HI3 A;  3BJ6 A;  4LK0 F;  4RB1 A;  3CTA A;  2XSD C;  1FYM A;  4BU2 A;  3PIO F;  3DFG A;  2QWW A;  3DPT A;  3KET A;  5DV5 A;  2K86 A;  1JUP A;  2M45 A;  1REP C;  2E34 A;  4PJJ A;  1FX7 A;  1TQM A;  3KP5 A;  3S2D J;  1N77 A;  4QIW N;  2O3F A;  4M71 A;  1UCR A;  5KK1 A;  5F0C A;  4RDU A;  2OC6 A;  3HOT A;  1QPI A;  4LGW A;  4GRI A;  3CO7 C;  2EIJ H;  1IUF A;  2ZXI A;  3NQO A;  1LDD A;  4CA0 A;  1J59 A;  4OIQ F;  3FHN A;  1WJC A;  4Z2Y A;  4OMY A;  3GTJ J;  4Z6Y A;  5GP9 A;  2BV6 A;  4I6Z A;  1BR1 A;  3PO2 J;  5HS7 A;  2KJC A;  2R7D A;  3MZ8 A;  2K02 A;  1FYK A;  3F8B A;  2DOF A;  5K5R A;  1TW3 A;  1TT5 B;  3H3U A;  3MZH A;  4IHX A;  5CQE A;  3KPH A;  4ITV A;  5LRS A;  3ZQG A;  4N0B A;  1B72 B;  4C9Y A;  3DTI A;  4BHC A;  1YLF A;  2VBZ A;  2RNG A;  3ZMT A;  5IY5 H;  3BR5 A;  1UZC A;  2Q2E B;  1F4K A;  2QEN A;  5DS9 A;  2CUF A;  2KLO A;  1TWH J;  5F0F A;  1D8J A;  2DQL A;  2PMU A;  2HWV A;  2R7S A;  3CCS I;  2A69 F;  3I9V 2;  4XK4 A;  3MKL A;  1SD6 A;  2DTR A;  3WHC A;  1FP2 A;  3M1E A;  2BW3 A;  2M8E A;  3MVP A;  2PMZ A;  3FXL A;  1D3Y A;  1WWX A;  2W85 A;  3BJA A;  4CH7 A;  3BT9 A;  3DLA A;  3I3L A;  5FLX K;  3TL4 X;  2ZSH B;  2IGK A;  1OQY A;  4JX5 A;  4BE1 A;  4WXC A;  4EJO A;  2XB5 A;  2GA2 A;  2B0L A;  3PO3 J;  1T08 B;  5J6X A;  2AHQ A;  3OR1 C;  3CJN A;  5F08 A;  5ICF A;  5K7F A;  3K69 A;  1LVK A;  2EQR A;  3DBL B;  2ZCW A;  4IHS A;  2VQC A;  2WAF A;  4Q5S F;  1R00 A;  4C3H J;  1MMG A;  4Y17 A;  2DN0 A;  4E7H A;  2QSF X;  5GPA A;  1W4M A;  5IP7 J;  3OYD A;  3GVA A;  3RQ4 A;  3LAJ A;  4BJ5 C;  1T6S A;  2XPU A;  1KGS A;  1RPW A;  4UV9 A;  2RQP A;  1FY7 A;  5IT9 K;  3OS2 A;  4WX9 A;  3OSF A;  2VQH A;  4S04 A;  1BIA A;  2GQQ A;  3RCO A;  1PUF A;  1U9O A;  1OCZ H;  4LOC A;  1JHF A;  2X51 A;  2ZJ2 A;  2XGD A;  1ETY A;  3JRC A;  2R93 J;  3S15 J;  3CME I;  3CCJ I;  1MIJ A;  2EIK H;  4KN4 X;  4AD9 A;  3QPT A;  2P6T A;  3JW4 A;  5FLX Z;  3LA2 A;  3COA C;  4L0Y B;  4LG0 A;  2L3D A;  2UXX A;  3BR2 A;  2NNY A;  1S72 I;  1TLH B;  2HU9 A;  3IAS 2;  1VZ0 A;  4IHT A;  2ZC2 A;  1TWC J;  1WJA A;  3I59 B;  2RC4 A;  2VC0 A;  1JKO C;  1U0J A;  1BC7 C;  1LDK B;  2PJR A;  3WGH A;  1UFM A;  1JHH A;  4I09 A;  2O6G E;  3NWT A;  4I02 A;  2OBP A;  4OIP F;  3MFK A;  4YG2 F;  2MG4 A;  4DQ2 A;  5FRN A;  3PJR A;  2XRN A;  1OFC X;  4ETS A;  3M8F A;  2DO7 A;  4XKC A;  5M5W J;  3GZ6 A;  1VQK I;  2QBY A;  2ID6 A;  3F8F A;  2OQR A;  4GDF A;  4C2T A;  4KN7 X;  1ZRF A;  4ANJ A;  1IXR C;  2ZJR F;  5IT9 Z;  1QVU A;  2MA3 A;  3U1K A;  3JRD A;  4CXF A;  4WCG A;  1V55 H;  4BXF A;  1X1B A;  4KIB A;  4IQ4 A;  5CPR B;  4A0Z A;  2OPT A;  1WJB A;  3G4S I;  2P7C B;  3OS0 A;  4XLA A;  3E6D A;  2XRO A;  2ESH A;  1OR7 C;  3IWF A;  2TDX A;  4EJT A;  6PAX A;  4PUS A;  5C4X J;  2IA0 A;  5DEQ A;  3P9K A;  4A6D A;  1W5S A;  4ZDP A;  4F7Z A;  5GAD J;  1VTN C;  3IV5 A;  4HSR A;  2JQ7 A;  4HX7 A;  1YHQ I;  3GLX A;  3QYF A;  2CUZ A;  2CFO A;  2BHZ A;  2CV0 A;  2K85 A;  4I99 C;  3AG3 H;  2HDC A;  2RN7 A;  2K27 A;  1UST A;  5DDG A;  1R6R A;  1Z21 A;  3QU3 A;  3CJR B;  1UHM A;  3MEX A;  5H2F C;  5ICE A;  3H3V K;  4AVZ A;  3ZP5 A;  4HOB A;  2VUM J;  1DUX C;  3K4C A;  4XBF A;  3CCL I;  4CYC A;  2LKX A;  4M3B A;  1RRJ A;  5J1R A;  3E5U A;  2FSW A;  2M87 A;  5J1Y A;  2IBD A;  4HV6 A;  1U5T B;  1AA7 A;  2FU4 A;  1KU2 A;  2L7Z A;  3FBN B;  3K4B A;  5EEH A;  5FLV A;  1GLN A;  1IDY A;  3HRM A;  3RKY A;  4NC7 A;  4S05 A;  3EYI A;  2GOM A;  1R1T A;  1MDM A;  1AOY A;  3KX2 A;  1YJ9 I;  2NS0 A;  3HKZ N;  3CC4 I;  2XUB A;  2R5Z B;  4BEH B;  3HSR A;  2RQQ A;  3ZQL A;  5EGO B;  4A0X A;  5EG0 B;  2X85 A;  4XOP A;  5B66 C;  3AUJ G;  2RGV A;  1RNL A;  1Y56 A;  4L5E A;  1JT0 A;  4ZDL A;  1LVA A;  1ONV A;  1JKR C;  2R5Y A;  2VON A;  4M6X A;  3J7Z I;  3GFJ A;  2FF4 A;  4HST A;  5EF6 A;  1OCO H;  1QQI A;  5CLS A;  1LFB A;  2K4J A;  2XVC A;  2XAG A;  1ETV A;  4XQF A;  2AXL A;  2Y0M A;  2VC1 A;  3K4J A;  3QOD A;  4RAZ A;  3ZQQ A;  3J80 K;  4RAG A;  1ZLK A;  3B6A A;  3I55 I;  2A05 A;  1P7I A;  2EPF A;  3U1D A;  1P92 A;  1UG2 A;  2NVU B;  1X19 A;  3FMQ A;  1D0X A;  4II2 A;  3OYK A;  3VFZ A;  3SJM A;  4BE2 A;  1DIO G;  3K4K A;  1V54 H;  4AID A;  3F8M A;  3W2V A;  2JMW A;  1U8B A;  1YFH A;  4V2G A;  3LST A;  4XR6 A;  1U5T C;  2WB1 N;  3ZRG A;  1Z3Y A;  4RGS A;  1ZGA A;  2JZY A;  1ZR2 A;  2XAF A;  3G6E I;  1K83 J;  1BN5 A;  2CS3 A;  2D1V A;  3G1M A;  2GAU A;  2VQG A;  1SVO A;  3H0D A;  3K1M A;  1HQC A;  4DBQ A;  2GM4 A;  4ZH4 F;  2A6E F;  3L9F A;  4LJZ F;  4Y3O A;  2VB6 A;  2JT1 A;  2IVM A;  4LMY A;  4G94 A;  1MJB A;  3LFK A;  5H20 A;  1WPK A;  2E5N A;  1YW8 A;  3TQN A;  2W7N A;  1KZH A;  3RKQ A;  2LBF B;  4ZYD A;  2MBF A;  3HC7 A;  3TP0 A;  4EJW A;  5M5X J;  3LSP A;  3PUF A;  1W0T A;  5HDN A;  4O6J A;  3QU6 A;  2CW8 A;  2DBB A;  2YX4 A;  3J80 Z;  1ZTR A;  3O6B B;  4NC6 A;  2V1N A;  2W4S A;  3KP7 A;  4M73 A;  3OYM A;  4MHG A;  1R71 A;  2CQ7 A;  4YFN F;  1XB4 A;  3LSR A;  4KNY A;  1WCM J;  2VI6 A;  1H9T A;  3ML6 A;  3CDI A;  3OL4 A;  1FBQ A;  1OCR H;  2O8K A;  1R23 A;  4M3F A;  2V6E A;  4M9X A;  5IYD J;  3HKZ A;  1HDD C;  1ENH A;  4WK8 F;  1G6N A;  4XKV A;  5ILU A;  1T33 A;  3KZY A;  1UG0 A;  1ZQ3 P;  1XGN A;  2TCT A;  2M2E A;  4D0P A;  2V9P A;  1UC4 G;  3R61 A;  1HDP A;  4RB0 A;  4AIK A;  2QQB A;  4NHJ A;  1X4O A;  2UV1 A;  4NB5 A;  4OWR B;  3V4G A;  1B8I B;  1XSV A;  1HST A;  1BIB A;  2LLK A;  2CQQ A;  5BNG A;  4KIF A;  2CW7 A;  1ON1 A;  2EJR A;  2VE8 A;  4RGR A;  2XRL A;  2Z99 A;  2FNA A;  2Y9Z A;  3BQY A;  1I39 A;  3F3X A;  3KEY A;  3WU1 B;  1BL0 A;  4BQO A;  4G7O F;  4D1Q A;  4KMF A;  3BZK A;  3PSI A;  1G3Y A;  3OY9 A;  4C3I J;  2RKH A;  2WA0 A;  5JR3 A;  2B63 J;  2IS4 A;  2FMY A;  4HDV A;  2YU3 A;  4EV0 A;  1L3L A;  2GLO A;  4B09 A;  2LF8 A;  2LRD A;  1JXS A;  2L0K A;  4L5J A;  2LY1 A;  2WB1 A;  3C7J A;  2OAZ A;  2M5W A;  2BHY A;  5B1A H;  5CVJ A;  3KIO A;  3LFU A;  3MCZ A;  4Q48 A;  4E7Z A;  2QF7 A;  4L0Z B;  5HDK A;  3FMR A;  2FQ4 A;  1VQ7 I;  4V19 K;  4B4C A;  3EUA A;  5M3F J;  1KQ9 A;  4X1E A;  4KA4 A;  1QNT A;  5EEA A;  2B7E A;  1X1A A;  4YFK F;  2ZBK A;  3ABU A;  4RAY A;  4AM3 A;  2J5O A;  2XAU A;  1BR4 A;  2CQK A;  1Y0U A;  2K4B A;  2K9Q A;  2KIS A;  1TL8 A;  1S9H A;  1MSE C;  2FQ3 A;  3R6S A;  5BMZ A;  3H0G J;  2KJB A;  3EQL F;  3OSG A;  4HBL A;  4IL6 C;  3AG2 H;  1IW7 F;  1XGS A;  5F1R A;  2DMP A;  3I71 A;  5DD4 A;  2X48 A;  1UC5 G;  1P4A A;  1HSJ A;  2QUF A;  3SYT A;  1APL C;  3QP5 A;  1IJW C;  1STZ A;  2DYS H;  3S2H J;  3ZOB A;  2FX0 A;  4JYK A;  1TNT A;  5L3C A;  2ZME A;  4PSX A;  3EPZ A;  5CKT A;  4A3C J;  5B1B H;  4A3G J;  2NS8 A;  3QQA A;  1W36 C;  4G12 A;  1B59 A;  4BXU A;  1VQN I;  5CVU A;  2VOO A;  3ZQH A;  5E8G A;  3FIS A;  3ROU A;  3MN2 A;  1TT0 A;  3IKT A;  2H27 A;  2E71 A;  3S16 J;  1WQ2 A;  4N9H A;  1K78 B;  1PDN C;  3WU2 C;  3OYG A;  2K3P A;  4E7S A;  4IZZ A;  4TV7 A;  3G71 I;  1S7A A;  2LY9 A;  3WGI A;  4M9S A;  2BEO A;  4XON A;  2R7V A;  4HLY A; 
#chains in the Genus database with same CATH homology
 3U21 A;  1JI8 A;  3DWL E;  2WAD A;  2HNH A;  2E60 A;  2X1E A;  5LD2 C;  3OYE A;  4YEJ A;  1BR2 A;  3K10 A;  3MKY B;  3J7A Y;  4XLF A;  1EA3 A;  1YE9 A;  2Z2S B;  2CV2 A;  2PJR B;  4LIV A;  4NUB A;  1WJ5 A;  1TZL A;  3OYN A;  1D1B A;  4B47 A;  3HXL A;  3N05 A;  4BJ6 C;  4F3Q A;  3SEQ A;  1IWP G;  3CP8 A;  3K4M A;  4BU2 A;  5HOO A;  2CMP A;  4B48 A;  4PFO A;  1X1D A;  3DPT A;  4PJJ A;  3FDY A;  3S93 A;  2JA2 A;  3OWT A;  1N77 A;  2KMU A;  3IAM 2;  3L2W A;  2OC6 A;  2DXI A;  3HOT A;  2VJI A;  3S3O A;  1UEL B;  4GRI A;  3OMY A;  1DQU A;  2ZXI A;  3DPU A;  2KL4 A;  4CA0 A;  3FHN A;  4ZTJ A;  1WJC A;  1V5F A;  3H9G A;  4EAT A;  2V26 A;  4II3 A;  1BR1 A;  1YX3 A;  2MC4 A;  3OYI A;  2LOO A;  3H9Q A;  4Y33 A;  3QYE A;  2IGM A;  4XLE A;  5CQE A;  2XC7 A;  2ELJ A;  4ITV A;  4IX7 A;  4C9Y A;  3DTI A;  2RNG A;  2IS1 A;  1PYV A;  4PFP A;  4HRI A;  3M1C A;  5LFA A;  2Q2E B;  2KLO A;  3LMM A;  3OR2 C;  1MMD A;  2R7S A;  2L2O A;  3VYT B;  3I9V 2;  3VWB A;  4AU7 A;  2BW3 A;  2PMZ A;  2M7A A;  4CH7 A;  2X1C A;  3DU5 A;  3DLA A;  3I3L A;  3TL4 X;  2ZSH B;  2IGK A;  3VYR B;  2X6X A;  4BE1 A;  2CV1 A;  2V7F A;  4PSW A;  4PJM A;  2XSJ C;  3SDB A;  2HVQ A;  3OR1 C;  5KNL A;  4OAZ A;  1LVK A;  3LSI A;  2VQC A;  2WAF A;  2XF6 A;  1MMG A;  2ZFU A;  4KIS A;  4IKF A;  4E7H A;  3MKW B;  2HVR A;  2ZXH A;  3OYD A;  3S3N A;  3RQ4 A;  3BC8 A;  3D5L A;  4B3X A;  4BJ5 C;  2LC2 A;  3QOE A;  3PNT A;  4HEA 2;  3LSK A;  4E7J A;  2BVM A;  1EEX G;  4HNT A;  3OS2 A;  3BLY A;  4RLF A;  4F92 B;  3DQV C;  1BOB A;  2VQH A;  4DJA A;  3RCO A;  4DIQ A;  2Q1Z B;  3MMY B;  1OLT A;  2VKD A;  3VSK A;  4RMN A;  3QYB A;  2X51 A;  2WAQ A;  5HNH A;  3CES A;  4BE0 A;  3E0J B;  2MAB A;  1P9Q C;  2M7B A;  3CP2 A;  2OV7 A;  2MFZ A;  2W00 A;  2VQL A;  4XKB A;  4JOM A;  4BQN A;  3CJQ B;  3K4L A;  1K6Y A;  2HU9 A;  3IAS 2;  2NOJ B;  1VZ0 A;  2L5Q A;  2KP6 A;  3VDX A;  1WJA A;  2UUZ A;  4F93 B;  3HG9 A;  4PJL A;  3LSM A;  1U0J A;  2PJR A;  1LDK B;  3EUK L;  1QHH D;  3DEE A;  3MD2 A;  3A1Y A;  3NWT A;  2IXS A;  4LG3 A;  4BQQ A;  3K70 D;  2E1M B;  2KDO A;  5FRN A;  3PJR A;  4CZC A;  4YRV A;  4XKC A;  2KPM A;  3OYH A;  4CSW A;  1PJR A;  3OIP A;  4C2T A;  2BOL A;  1MW7 A;  3BG7 A;  4ANJ A;  4DGW B;  3OIQ A;  5TGT A;  3G2B A;  4E4H A;  2JSP A;  3FBI B;  3DU6 A;  4F52 A;  4BXF A;  1X1B A;  4LIT A;  4IQ4 A;  5CPR B;  1ERD A;  1WJB A;  3OS0 A;  4XLA A;  4XM3 A;  4ZJZ A;  1OR7 C;  4XL9 A;  3K6G A;  4PUS A;  2RRE A;  2M3A A;  1NG7 A;  4ZDP A;  1Z7L A;  4HSR A;  3CF2 A;  2XF5 A;  2WAE A;  4KJZ A;  2VXD A;  2W82 A;  2CUZ A;  3QYF A;  4NQW B;  2CFO A;  2O5R A;  2CV0 A;  1KON A;  3VYU B;  1MMN A;  4LIU A;  1R6R A;  4C30 A;  1Z21 A;  1FMW A;  3CJR B;  3HOS A;  4AVZ A;  3C2G A;  1SAU A;  4BDZ A;  2UWM A;  2P0W A;  3HPG A;  3ZCO A;  2KRC A;  2X6Y A;  2XF7 A;  3K4C A;  4BGD A;  1EGM G;  1Z2Z A;  1N78 A;  2WY7 Q;  3BCA A;  2IGN A;  2R7R A;  2R7T A;  1AA7 A;  3FBN B;  3K4B A;  4NNJ A;  2VL8 A;  2E1M C;  3NWS A;  4X0G A;  1GLN A;  4NC7 A;  2R7O A;  4XNF A;  2MD0 A;  3L2R A;  2GOM A;  4FAS D;  4G6T B;  3AL0 B;  4U87 A;  3KX2 A;  2HQA A;  2DOA A;  3A2K A;  3EUH C;  4BEH B;  2RQQ A;  4FET A;  1V5E A;  4E6K G;  3DKX A;  3GBG A;  2X85 A;  1LFP A;  4N4O B;  4XOP A;  3AUJ G;  2E5Z A;  3OS1 A;  4B44 A;  1Y56 A;  4ZDL A;  3M8J A;  1MMA A;  3OOU A;  4CUG A;  2ZSI B;  3OYB A;  4CCL A;  4HST A;  4D9J A;  2IS2 A;  4XQF A;  4E7I A;  4XOR A;  1QHG A;  4CCN A;  3K4J A;  4BAC A;  3QOD A;  3BG6 A;  3ZQQ A;  4YEL A;  3HPH A;  3PFY A;  4B43 A;  2CH0 A;  3VSL A;  4P1W A;  4XLC A;  3CMM A;  3AFH A;  1FMV A;  3AKZ A;  1X19 A;  3L2V A;  1D0X A;  4II2 A;  4MLO A;  2M4K A;  3TMO A;  3OYK A;  2CUJ A;  4BE2 A;  4E7L A;  1DIO G;  3K4K A;  2Z16 A;  3K4N A;  4HG2 A;  2LG4 A;  5KCM A;  4CCO A;  3FKJ A;  3W2V A;  2HPI A;  2KQR A;  4XR6 A;  3W3C A;  2L7K A;  4NC8 A;  3S8P A;  3ZRG A;  3H5R A;  1Z3Y A;  3S3M A;  1T95 A;  3K70 C;  2KRH A;  2CS3 A;  3AL0 C;  3DPL C;  1DGR M;  4BJT A;  2VQG A;  2W1O A;  3H0D A;  5HLT A;  2VLA A;  2VJ5 A;  2AQE A;  4DBQ A;  2V4J C;  1E0E A;  5HVQ C;  4Y3O A;  2VB6 A;  1WFX A;  2M0M A;  1WJE A;  4F91 B;  3W2W A;  3W2A A;  2E5N A;  2KHM A;  1DGW Y;  2IS6 A;  2W7N A;  2LBF B;  3RPU D;  3HC7 A;  2VAS A;  3H5N A;  1IRX A;  2VXZ A;  4BL0 B;  1EGV G;  2HZD A;  1G8X A;  4RM3 A;  2CW8 A;  2WY8 Q;  3OYF A;  3DKY A;  3H35 A;  2V1N A;  2W4S A;  1W36 D;  1D1C A;  3OYM A;  3PUB A;  2QKL B;  2R7Q A;  2JUG A;  4J01 A;  1T0F C;  2HPM A;  2MYS A;  3UNG C;  5KHD A;  4C2U A;  5FRM A;  2F4I A;  2K9L A;  2L9N A;  3OL4 A;  4XN3 A;  3C2H A;  1UAA A;  3VYS B;  2F6C A;  5JHF A;  2VJJ A;  4DOZ A;  2V6E A;  4E7K A;  3OYC A;  1D0Y A;  3HKZ A;  1Y6I A;  2R4G A;  5HNF A;  1MNE A;  3E1S A;  2K9M A;  3D5R C;  4XKV A;  1X1C A;  2HDW A;  2Z1D A;  1UG0 A;  2LRE A;  4P5O A;  4XOT A;  3OYL A;  1UC4 G;  1D1A A;  4CCK A;  4H4K C;  3H5A A;  1X4O A;  2UV1 A;  2LH9 A;  2L9S A;  4OWR B;  3L2U A;  3PNV A;  1ZEL A;  2DT6 A;  2K5C A;  1QU3 A;  4PK4 A;  2M4G A;  2IGO A;  2KZV A;  2CW7 A;  5FRO A;  2JVH A;  4BS9 A;  2FUG 2;  1SFK A;  3LSG A;  2VPL A;  3KEY A;  3DTE A;  4BEH A;  4ZDO A;  4BQO A;  2VKH A;  4D1Q A;  3MKZ A;  3OYA A;  3PSI A;  2VJ4 A;  3OYJ A;  2R7X A;  4Y4R A;  3OY9 A;  1Z3X A;  1N75 A;  2XDV A;  3L2Q A;  3TBI A;  2WA0 A;  2IS4 A;  4QPO A;  4HPQ A;  4N4N B;  2DT7 B;  2F5V A;  1WJF A;  1IWB G;  5CQG A;  4F55 A;  1LKX A;  2LRD A;  1HA8 A;  1J09 A;  2LY1 A;  2WB1 A;  2V9K A;  3RSN A;  2OUM A;  3LFU A;  3HL2 A;  4E7Z A;  4ZYA A;  4ZC3 A;  1G59 A;  4CCJ A;  4RM2 A;  3A4C A;  3EUA A;  1MMF G;  2VIX A;  3LSH A;  4XLH A;  2DCE A;  4J00 A;  1X1A A;  3PL8 A;  3PNY A;  4JQF A;  3SZG A;  1MND A;  2BW3 B;  3SEZ A;  2XAU A;  1BR4 A;  3RTR A;  3D5S C;  4BDY A;  1WJD A;  1S9H A;  1YX5 A;  1X4P A;  2A6T A;  3H9J A;  3IP4 B;  3OL3 A;  2DJI A;  2R7W A;  3ZR8 X;  3CZ6 A;  4KT6 A;  4PJN A;  1UC5 G;  3LL7 A;  1NG6 A;  3KYL A;  2LYC A;  2GOX B;  3SYT A;  3IUO A;  3ZGK A;  2JVG A;  3DTK A;  2WBM A;  4RLQ A;  4XMY A;  1V5G A;  2Y0S A;  4PSX A;  3EPZ A;  5CKT A;  3UR3 C;  2R7U A;  3S32 A;  2A5W A;  2X1D A;  4CCM A;  3PSF A;  4R79 A;  4ZTF A;  1W36 C;  3HUG B;  4AYB A;  2LBF A;  4XN0 A;  4IQJ A;  4XKW A;  2BVL A;  1D0Z A;  1TT0 A;  2LY2 A;  4OAY A;  2HVS A;  4DBR A;  4U7B A;  2I8D A;  3ONQ A;  3V42 A;  3ZXS A;  2AQF A;  2X6W A;  2QKM B;  4KIT B;  3OYG A;  2K3P A;  4E7S A;  4HNU A;  3BCB A;  4IZZ A;  4QPQ A;  1DP3 A;  4BUP A;  3F9K A;  4XON A;  2R7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...