3VODA

Crystal structure of mutant marr c80s from e.coli
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
136
structure length
136
Chain Sequence
NEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRCAACITPVELKKVLSVDLGALTRMLDRLVSKGWVERLPNPNDKRGVLVKLTTGGAAICEQCHQLVGQDLHQELTKNLTADEVATLEYLLKKVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multiple antibiotic resistance protein marR
publication title The multiple antibiotic resistance regulator MarR is a copper sensor in Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 40
structure length 136
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3vodA00
2DTRA 4YG2F 2WTEA 4ZYEA 3R0AA 2DU9A 2WWYA 4P55A 1SMYF 4BYYA 3ZN1A 3SXYA 4HBLA 5HLIA 1P4XA 3ECOA 1IN4A 3JW4A 4EVIA 1R36A 1MDMA 2ETHA 3V4GA 4OIPF 2LNBA 4EGZA 4XRFA 2NAZA 1HW2A 3IRQA 2M45A 3TOBA 5ICCA 2ZFWA 1FPQA 3HTUA 2O3FA 3R60A 2IA2A 2ZXJA 3ZN0A 5L3DA 1T38A 4ENMA 4GYIA 1J5YA 2Y0MA 3T0YA 1HQCA 4CO8A 2HGCA 2HQRA 3M9AA 4E70A 1QGPA 3O2PE 2NNNA 1R5HA 2Y75A 1FYMA 3G73A 5ICFA 1SMTA 1HW1A 5E1ZB 5L3EA 2QM3A 1ZYRF 5HDGA 2CSOA 3LQRA 2EV6A 2HWVA 2DO7A 3U2RA 4PDKA 1FY7A 1TNTA 1IRFA 2VE9A 2FBIA 2TDXA 3JTGA 1B9NA 2PG4A 1REPC 2HZTA 3R4KA 1ZH5A 1BI1A 1Z6RA 2Z5UA 3VEPA 3ROUA 3DFGA 2K4BA 4ZYHA 3F22A 2XAFA 3TO9A 3GXOA 2K02A 4EM2A 4I7HA 2GWRA 1P6RA 4XBFA 3WTXC 3BJ6A 2YX7A 4KN7X 3RKWA 1YFHA 1OKRA 3KCCA 5E8GA 2Q8KA 2B0LA 1SFEA 1PUEE 3ABTA 2DBBA 3M1EA 2FOKA 2MH9A 2M5WA 3D0SA 1AWCA 4AIHA 4H0EA 4U7DA 1V4RA 2VXZA 3QP6A 1ZG1A 3L2CA 4ESBA 3ZQ7A 1J9IA 4YIIA 4L5JA 3DEUA 1ZRDA 1IN5A 2RDPA 1G3WA 1QBJA 3COAC 5ILVA 1DPUA 4LG0B 2HKOA 3L00A 2IW5A 3E5XA 1RIOH 1BM9A 3MWMA 1R58A 3TGNA 3NRVA 4KFCA 5DUKA 4MEYF 1TW3A 2F5CA 4XLNF 3WE2A 3TKYA 2MBFA 4R1HA 4GO1A 5D4SA 1YLFA 1AOYA 3IKTA 1S7AA 3J80Z 2K27A 1BI2A 2DLLA 1VTNC 1KU9A 3BJAA 4IRIA 3EYYA 1FX7A 1IXSB 1HKSA 3DPTA 5L3BA 1L3LA 2XROA 1K6OA 4LG0A 3HRTA 1JGSA 3PQKA 2DQLA 1ZN2A 4KMFA 1XGSA 2PI0A 3KP3A 1G3SA 3RPUA 2RQPA 4M74A 5LHGA 5CVUA 3EDPA 3KLOA 2E1CA 3GWZA 1R1TA 5LHHA 1JE8A 3ZP5A 4CHUA 2O61A 2CG4A 2H27A 2UWMA 2PFBA 1FSHA 1EV7A 4B09A 5E1XA 6PAXA 3KEOA 2AS5F 1S6LA 1YG2A 2VBWA 3LWFA 4U0VA 4EV0A 3WTYC 4MNUA 4CXFA 4NQWA 2O03A 2QQ9A 2HTSA 2P5KA 2RVCA 5E17F 1R22A 2W85A 2KJCA 4D0PA 3RPQA 5HLGA 2HOEA 4AWXB 2KIMA 4EMSA 4K2EA 1TLHB 3K1NA 1H9GA 4AIJA 1UHMA 4HQEA 2UZKA 1K79A 2A6HF 1CGPA 3KP2A 1IF1A 4ESFA 3GF2A 1Q1HA 1BJAA 2XKOA 3V7CA 1O3SA 3IC7A 5HS8A 2P5VA 4O3MA 3JSOA 4AD9A 1TTYA 4Y15A 3OOPA 1ZAOA 1YYVA 2NS0A 4P5OA 4M9ZA 2ACJA 4CZZA 5JR3A 1H0MA 3R0JA 2VT2A 1KYZA 3DV8A 3N4MA 2NRAC 3DF8A 3RYRA 2UXNA 3SHFA 2BBYA 4P9UA 3Q9VA 2DK5A 3E3VA 3KP4A 1IN6A 4M9SA 5FFZA 1LEAA 2L4MA 5LEKA 2EV0A 2BYVE 2Z3YA 3H3UA 3MZHA 1HSTA 4UV8A 5A2QK 2QQAA 4HDUA 3MZYA 1U78A 2JTVA 1BOAA 1CF7B 2PLYA 1YS7A 1O57A 2CO5A 3F21A 1LDKB 2ISZA 2LF7A 4RB1A 1U5TB 2DT5A 1TBXA 2A6EF 4U0WA 2MH2A 4LB5A 1USSA 3QOPA 2PJPA 1C0WA 2WC2A 4HX8A 4PZJA 2QUFA 2QYOA 2V9VA 3GZ6A 2L02A 4HF2A 5DD8A 5ICEA 4L18B 4QLCU 3I59B 1S7OA 2L54A 1QPMA 2QENA 5HOOA 1KQ8A 2YU3A 3I64A 5ILUA 2FXAA 2MLGA 5ERIA 4A5NA 1BC7C 4FX0A 1WRJA 3BDDA 2Q0OA 1MKMA 1Z7UA 4IHSA 4KA4A 2HQNA 1P4WA 4IF4A 2MA3A 2XHKA 4A6DA 4MHGA 1CF7A 1RUOA 1HBXG 2IJLA 2HKXA 4P96A 5BOXA 1SD5A 1U5TA 3TDUC 3HHHA 2GAUA 4BXUA 3GZ5A 2YPRA 2XVCA 3IL2A 1RI7A 3HIFA 3SZTA 1OYYA 2W25A 1KQ9A 4A2UA 3HTSB 5FD5A 3K9TA 1LVAA 3RIRA 2FF4A 2XAQA 1QZYA 2R7DA 4HV6A 5BMZA 3Q9SA 5J6XA 3J7AO 4JK1X 2K7LA 3I4PA 1XCVA 2FEZA 4ESJA 1W7PA 2J5OA 3K0LA 1S29A 1ZG3A 5CVJA 1D5VA 1BIBA 2L01A 3I58A 4XSXF 2XAGA 1WWXA 3JTHA 3DXJF 1I5ZA 4AIKA 1GVJA 3E97A 5E20A 5LBQA 2XGXA 2MD5A 4CDGA 2XKPA 4O6JA 2PMUA 2FBKA 3F23A 3GW2A 4KUMA 4UV9A 1G3YA 1G3TA 2D1HA 2JPCA 5K5RA 3GX4X 3FHZA 4RAZA 3GYHX 2FRHA 3G3ZA 2HDCA 1LDJA 5BPDA 2Q2EA 1XGMA 2FQ3A 4BNCA 3GFLA 5FO5A 3SQNA 3MQ0A 4ZYDA 3T1BA 3ZMDA 3CUOA 1ODDA 4M6XA 3V7SA 4UUVA 5DUIA 3PQJA 2JPBA 5FB2A 3GFMA 5JVTA 2IA1A 3F8CA 3WU0A 3NQOA 2VE8A 2OD5A 2ZCWA 2EFNA 2J5PA 1T98A 2AXLA 4YFKF 5E18F 4UXNA 2JSCA 4JQFA 3SFZA 4G6QA 4Q5SF 1T39A 5L3FA 2MC3A 3L9FA 1MGTA 2VOOA 3FM5A 1P92A 2DPUA 2ZKZA 1J0RA 5K5OA 1WSUA 4G94A 1A04A 1FOKA 5F6FA 1XGNA 1F4KA 1LNWA 5FFXA 2PEXA 5DCMB 4OMZA 3TOAA 2F2EA 4F7ZA 4GGGA 4RGUA 3H3ZA 3F8BA 1L0OC 2FU4A 3KEQA 2FSWA 4IRGA 1ZRFA 3ZMVA 4RB2C 1KU7A 4YIFA 2A5YB 3OV8A 4RGXA 2QZ8A 5IT9K 4I98B 2YR2A 2STWA 4L9JA 5D6EA 2A3SA 4UVAA 5D5WB 2ESNA 3T8TA 2W84A 4WXHA 4XLPF 4KICA 1K78B 3WTSC 3KP6A 4FX4A 3P7NA 4M72A 4L9TA 4G7HF 2RV8A 3WTTC 1PP8F 3RJPA 3KP7A 2K86A 5D8LB 1KYWA 2G7UA 2IVMA 3SZPA 5IT3A 3I53A 2UXXA 2XAJA 3K69A 1Z1DA 3TO6A 1FYKA 2E7WA 3DKWA 1O3QA 4Z2YA 5H20A 2EWNA 1LEBA 3LQQA 2EV5A 5HS9A 2H94A 1GHCA 4BAYA 1K78A 3WGGA 3EQLF 2HYFA 1BI3A 2KIUA 3FF5A 4LLNA 1R7JA 4A0ZA 3F8MA 2PQ8A 4N9IA 2ELHA 1B59A 4U7BA 5DCFA 3KZZA 2M87A 1IUYA 1EH6A 1HW5A 2K4JA 3CO6C 1V3FA 1ZGJA 2F5FA 1XSXA 4UVBA 1D8KA 2RN7A 4YFNF 1OMIA 3V8JA 2LF8A 2DI3A 1RNLA 1PP7U 1U8RA 1T6SA 5DV5A 1TQIA 2KIFA 3EYIA 2VODA 2VBZA 1QZZA 3CLOA 5CVIA 2OU2A 2VOPA 1ONVA 1KA8A 4I0BA 3WTVC 4I2OA 3ZPLA 4HQMA 4LK1F 4Y13A 1YS6A 4OOIA 2D2WA 2EFQA 4HW0A 3RDIA 3WU1B 4HDVA 1FYLA 3TDZC 1OYWA 3VODA 4KIFA 5DD4A 3BPVA 1D3YA 1ON2A 3K1MA 3QAHA 1E2XA 1FBQA 3CTAA 4L0YB 4IXAA 1Z05A 3K2ZA 2VC0A 3LFKA 2RC4A 4L9VA 5K1YA 5LGUA 2QQBA 3V7RA 4RB3C 3JAMK 3ZMSA 3L09A 1XSDA 1ZREA 4HYEA 3JSPA 5J8CA 5HLHA 2ZJ2A 2PBIA 3F72A 3ELKA 4ENKA 4JBAA 4RAYA 3IKVA 3MAJA 3C1DA 4OINF 4R79A 3HRSA 3KP5A 3GEZA 3BPXA 2A61A 3FXUA 3V8LA 4BQAA 1YW8A 5ICGA 2V6CA 5TRDA 4OU0A 3IRRA 2FNAA 1FT9A 3GLXA 4HV5A 1DP7P 3I5UA 4ENJA 3F3XA 5LGTA 2ESHA 3V8KA 1ON1A 3E6DA 1W4MA 3BP8A 4OIOF 1MZBA 1KGSA 1LDDA 3P9IA 2P7CB 3RI4A 3FXQA 4Q48A 1IAWA 3ECHA 3RKXA 1IZ1A 4EM0B 1T2KA 3QP5A 1PDNC 2M1BA 4A12A 3LA2A 1UCRA 3ZMZA 2P6SA 2VT3A 2HYGD 5IT9Z 3DQVC 4QWQA 1LQ1A 1W5SA 1FP2A 2XRNA 2O8XA 1WI9A 1YQAA 5H6RA 2C6YA 3ULQB 2GIVA 4UNOA 4WK8F 3TO7A 3FMQA 4I02A 3F6VA 1P2FA 2IT0A 4M9XA 1R5GA 3P9CA 4RGRA 2XASA 1G4DA 4GCVA 5D5VB 1O7LA 3BROA 4R8HA 5EEHA 5D5XB 2OAZA 1J75A 4WF2A 2ZMEB 2VBXA 1XSVA 2EFOA 5HS7A 2GQQA 3I0TA 3TQNA 4HX7A 2DK8A 5CJ9A 4LD5A 1U5TC 2L4AA 1P4AA 2GZWA 2HFHA 5AIPA 5HVQC 1FNNA 2GA1A 4WX9A 4GYGA 2EB7A 3K1PA 1YW7A 2GXBA 2HS5A 5LRRA 5DEQA 4HA8A 3U1DA 3ML6A 1FZPB 4L9NA 3W6KB 2A07F 4ETSA 4A6EA 4EJWA 5CVRA 1EH8A 1OPCA 4Q47A 3T5XA 3AAFA 5E8IA 4OIQF 2ZMEA 3I59A 2HTJA 3CO7C 1XN7A 3CUQB 4HOBA 4LK0F 4KT5C 4HLYA 2XV4S 4XSZF 1JHHA 4KDPA 3J80K 1F1ZA 4MQVA 5KVRA 4G7OF 1BIAA 4KNYA 1Z6TA 4EJOA 1Y0UA 4AVPA 3BY6A 3WTZA 3EETA 2DW4A 4O5VA 1B1BA 1MJBA 1XMKA 3VOEA 2OA4A 1ZRCA 3O6BB 1R1UA 4BH9A 5JI6A 5LHIA 3BZ6A 3ISPA 3I54A 1I6XA 3WE3A 4ON0A 2X0LA 1S3JA 3GFIA 3ZMTA 3L7WA 1B6AA 1UB9A 4CICA 3KZYA 2OZUA 1BN5A 1IW7F 3CUQA 3WTWC 1DPRA 5HDNA 5AIQA 5J8FA 1HXDA 2D45A 1HSJA 1IXRC 2FMYA 2CFXA 3C7JA 1RUNA 4IJAA 3JAMZ 1D8JA 1FLIA 4FT8A 3ZMUA 2A69F 1ZGAA 4BHBA 1ZARA 2RKHA 4YFXF 3HHGA 2X4HA 1Z91A 3MFKA 3P9KA 3W6JB 5BPIA 3EUHA 2E7XA 3BOQA 1TNSA 2G7HA 1MD0A 3KLNA 4EJVA 4FHTA 2O0YA 5F1RA 4EQQA 2FBHA 2P4WA 2DAOA 4WXDA 1SAXA 4HAMA 1Z9CA 1IXCA 2L3DA 2E1NA 4GXOA 3FWEA 4S04A 1HKTA 2GXGA 3DP7A 1MJAA 2XUBA 4RS8A 1QNTA 1IRGA 4WCGA 2P6TA 1MJ9A 3WGHA 1XB4A 3IWFA 2G9WA 1OYIA 1R00A 4KMUX 2QLZA 1IN7A 4NHJA 1I1SA 1KU2A 4MTDA 1ULYA 2VC1A 2DPDA 1W7PD 3FXRA 5BQTA 5FLXK 1R23A 4DQ2A 3H92A 5A2QZ 4LB6B 3QU6A 2F5DA 4EJUA 4A5MA 1JHFA 1J59A 1I27A 5ED4A 1UFMA 5DCMA 3FX3A 1XD7A 1BC8C 2JZYA 4KIGA 3O3KA 1WQ2A 4A0XA 3CDHA 4MEXF 2W57A 5EEGA 4KN4X 4ENNA 4S05A 1YO5C 1EH7A 1TW2A 4LLGF 4MQ9F 1SFUA 4EGYA 3C3WA 5L3CA 1RZ4A 2LSOA 1XDSA 1UHWA 1NHAA 2FNPA 4HF1A 1I1GA 1DUXC 1E17A 3M7GA 2BGCA 4PCQA 2WV0A 4NB5A 2BE5F 2XAHA 1U6GA 2QWWA 4Q4ZF 2IA0A 1FWZA 4ZZLA 2M30A 2EFWA 3I71A 3RKYA 2ADUA 3KE2A 1T0FA 4DNCA 1B4AA 5K5QA 1F5TA 2OQRA 2V1DA 1LB2A 4MGRA 4N9HA 1WKMA 1XGOA 2Z9OA 3C18A 3FZVA 5KK1A 2R3SA 1IN8A 4TV7A 2CQKA 3N97A 2V1XA 1O3TA 2NNYA 3E6CC 4ZZDA 2P7VB 4HZFA 2H09A 2H6BA 5HDKA 1QO0D 2P5LC 3HYIA 3J81K 2CWEA 2IP2A 2W24A 4M73A 2IPQX 2PN6A 1J2XA 2XIGA 1U3EM 1H9TA 3HUGA 3KFWX 3MCZA 1YIOA 4HX4A 1JXSA 1GXPA 2QBYB 3VFZA 3F6OA 2COMA 5D5UB 2CW0F 1FSEA 5JFRA 3LA3A 3FMRA 4I09A 4PGHA 1SD4A 1FBUA 2V79A 3QU3A 3GUDA 5ILSA 2Z33A 5D8KB 1G6NA 4I0AA 3HSEA 4M71A 4IPAA 2EK5A 4I01A 1ZHFA 1ZLJA 4PGGA 1FBSA 4BHPA 1O7FA 3E5QA 3WODF 2R7FA 4LMYA 4N0BA 4ASNA 4A0YA 3IHUA 2MLKA 1GXQA 2Y48A 2EA2A 4LLLA 1XCBA 2JT1A 2F5EA 1J7KA 5CYVA 3R6SA 3HOTA 4G6DA 2ZNZA 2QBYA 1LJ9A 3NEUA 2KKOA 1ZLKA 3VB2A 2OBPA 1SD7A 1BI0A 3ABUA 2VBYA 4CYDA 4RB0A 3T8RA 5FD6A 2KJBA 3GO5A 3HRUA 4WWCA 5FGMA 3QPTA 2RNJA 5AONA 2GA2A 2RGVA 1S8NA 3Q5FA 1FC3A 4KYWA 2FE3A 4LGWA 5TJJA 3B02A 2VN2A 5JHUA 3D5LA 4ZH4F 2LDUA 3GFJA 4RGSA 4IHTA 5H6QA 4HF0A 4G8XA 2FA5A 1SD6A 5D6FA 2CYYA 1KQ0A 4LFUA 1W5TA 3E6MA 3HOSA 2M8EA 4OIRF 3KETA 3F8FA 1TQMA 3RTRA 5E1WA 5FLXZ 1YTYA 2IRFG 1HKQA 3MEXA 3RYPA 2EFPA 1QQIA 5L3GA 1XMAA 1STZA 3REOA 2STTA 2EJRA 3M8EA 4HLXA 1DDNA 3LA7A 2YX4A 3BWGA 3E5UA 3LSTA 5F64A 2KRFA 3QRFF 2HR3A 3DPLC 2V1UA 1B9MA 4CGZA 4EJTA 4LJZF 4UHTA 4BHCA 5BS6A 2FMLA 2A68F 4P9FA 1KU3A 1TQPA 3WTUC 2HEOA 1YW9A 3S2WA 2OQGA 3FM3A 3F8NA 2LKPA 3LAJA 4L5IA 2OZ6A 4EM1A 3M8FA 5LGNA 4UVCA 5DYMA 5LLQA 3HSFA 4WXCA 1W7PB 5CVVA 2ZBKA 2P8TA 2O6GE 3HRMA 2ISYA 2PMHA 2DFIA 1O3RA 1USTA 3BJOA 1XDUA 4B8XA 1U2WA 3CJNA 2D1VA 1FP1D 1R1VA 2JRTA 5CLSA 2VONA 3WG9A 3LAPA 4ZYGA 5DDGA 1X3UA 1ZG5A 1OR7A 3B73A 3GVAA 3U9GA 3IWZA 1SFXA 5D4RA 2ZO4A 2YSRA 3HSRA 4MTEA 3WGIA 3PFIA 1MDMB 1F9NA 4U88A 5LRSA 3E6BA 4M6YA 2H6CA 4OMYA 4Y17A 5LEJA 3CUQC 1BBYA 3R61A 4U0YA 1K7AA 3J81Z 2CGPA 3FMSA 3ERED 4KIBA 2BEOA 4IRHA 2ZNYA 2DQRA 3QPHA 2QVOA 2BV6A 4G7ZF 2Z99A 4L0ZB 4IVNA 2EA4A 4G9YA 2NYXA
chains in the Genus database with same CATH superfamily
1IJWC 3SJMA 2DTRA 4YG2F 3GMEA 2WTEA 1ETKA 4ZYEA 4A3EJ 3R0AA 2DU9A 2CH0A 2WWYA 4HNVA 3CMEI 4P55A 1FIPA 3HOWJ 3A4CA 1SMYF 4KT6A 4BYYA 4XLHA 2EH3A 3A02A 4XN3A 2V9KA 4IQ4A 3FXKA 3ZN1A 4E7ZA 1GLNA 3SXYA 3K4MA 4HBLA 5HLIA 2R5ZA 1P4XA 3ECOA 2K5CA 1IN4A 2UUZA 3JW4A 4EVIA 3M3YJ 1R36A 1MDMA 2ETHA 1VI0A 3BQZA 4OAYA 3V4GA 3W2VA 4OIPF 3BR5A 2LNBA 2JA7J 2M9HA 2DFEA 4A93J 4EGZA 2XSJC 1RPWA 4XRFA 3FKJA 2NAZA 1HW2A 5F0HA 3S32A 3IRQA 2M45A 3TOBA 3GTKJ 2LLKA 2XPVA 1V55H 3F9KA 4BJTA 2W7NA 5ICCA 2X6XA 2R0QC 2ZFWA 1FOXA 3OL4A 3Q0VA 1FPQA 2AXTC 3HTUA 1W1WE 3ZQCA 2MFZA 4RDUA 3P5JA 4XIDA 3L2WA 2O3FA 3R60A 2IA2A 2ZXJA 3OOUA 3ZN0A 2E2IJ 5L3DA 3KYLA 4X1EA 3S3OA 1T38A 5FLVA 3JCUC 2QKLB 4ENMA 4GYIA 4NDLA 1J5YA 2Y0MA 2LBFA 3T0YA 1HQCA 4CO8A 3PSFA 2HGCA 2IS4A 3TMOA 3FXOA 2HQRA 1BA5A 2KDZA 3CCMI 3M9AA 3OS0A 2KDOA 4QPOA 4E70A 2XF7A 4NC6A 1QGPA 2COBA 3LSIA 2KT0A 1BOBA 3O2PE 4PFPA 2NNNA 5KNLA 1R5HA 2Y75A 3IV5A 1MIJA 1FYMA 3G73A 5ICFA 1SMTA 3OIOA 2OTLI 4F3QA 1H89C 3KEYA 1W36C 1HW1A 5E1ZB 1M1EB 5L3EA 3AFHA 2R7XA 2JVHA 4UB6C 3A01B 1O4XA 2QM3A 5FKNA 2R7ZJ 1ZYRF 2VKEA 2CSOA 2BVLA 5HDGA 1S72I 1HLVA 3LQRA 2EV6A 2HWVA 3HDDA 3CC7I 2DO7A 2GIZA 3U2RA 4PDKA 1FY7A 1TNTA 4M3DA 2LREA 3KYDB 1IRFA 2VE9A 2FBIA 2TDXA 1X1CA 1B72A 3JTGA 1ZR2A 1B9NA 2PG4A 3AG2H 1PYVA 2RNGA 5EZGA 1WJAA 1REPC 2HZTA 2BVMA 3R4KA 3HKZA 3U1KA 1MMSA 2ME0A 1ZH5A 1BI1A 3S14J 4L5EA 4BUPA 1Z6RA 2BZTA 2Z5UA 3MD2A 5M5WJ 3CDLA 2I8DA 3VYSB 3VEPA 5F1JA 4XICA 2VJJA 2ME6A 2VJ5A 3ROUA 2JA6J 3DFGA 1D5YA 1PVEA 4DBRA 2OJED 2K4BA 4ZYHA 2M4GA 3F22A 2XAFA 3TO9A 3GXOA 2K02A 1F43A 1VQPI 3OL3A 1QVTA 2EZLA 4M3EA 2Y2ZA 3MN2A 4HPQA 4EM2A 1K61A 5F08A 2ZFUA 4I7HA 2R7UA 2NS7A 3HZJA 3S1NJ 4C3JJ 2GWRA 1P6RA 4XN0A 4XBFA 3WTXC 3BJ6A 2YX7A 3H1CA 3GTMJ 1VQ7I 2E19A 2DA4A 4KN7X 3RKWA 1YFHA 1OKRA 1JKRC 3KCCA 5E8GA 1VF9A 3ABLH 2R5YB 2Q8KA 2B0LA 1SFEA 2KLOA 3OYMA 4Y3OA 2KMUA 4V2FA 3JR9A 1PUEE 1OFCX 3ABTA 3HOVJ 5J3LA 2DBBA 3S16J 1JKQC 3M1EA 2FOKA 2MH9A 2M5WA 4MLOA 5DS9A 2KFDA 3D0SA 1AWCA 4AIHA 2BHZA 4H0EA 4U7DA 1V4RA 1Y1WJ 2EIMH 2HI3A 4CCKA 3I4MJ 1OCOH 2VXZA 3MZ8A 1G59A 1G8XA 2R7TA 1T0FC 3QP6A 1ZG1A 3L2CA 4ESBA 1MBHA 3ZQ7A 1J9IA 4YIIA 3KYCB 3DEUA 4L5JA 2M0MA 5JLWA 1E3HA 1ZRDA 1IN5A 4DIQA 2RDPA 3PNVA 1G3WA 3C2BA 1QBJA 3C2GA 1KZHA 2KRCA 3COAC 1P9QC 1D1BA 5ILVA 2HOSA 1DPUA 4LG0B 2HKOA 2M8GX 3KX2A 3L00A 1OCRH 2CFOA 2IW5A 3E5XA 1RIOH 4RA2A 3IAS2 1FMVA 3CCRI 3ONQA 1BM9A 3MWMA 1R58A 3TGNA 3OYJA 1APLC 3NRVA 5IYBJ 4KFCA 3I55I 2LFBA 5DUKA 4MEYF 1TW3A 2YUSA 2F5CA 2XF5A 4XLNF 3QYEA 2MC4A 3OYEA 1LKXA 3WE2A 3TKYA 3BCAA 1ETQA 2MBFA 2RREA 4R1HA 2NXNB 4GO1A 5D4SA 1YLFA 2FX0A 3CCEI 1AOYA 3IKTA 1H88C 1S7AA 3J80Z 3G1MA 4KJZA 4F93B 2K27A 4B43A 1BI2A 2DLLA 3FK6A 1VTNC 1KU9A 3AL0B 1JKOC 3BJAA 5FKLA 4D9JA 4IRIA 3TEDA 1N25A 3JRCA 3H9GA 4KITB 3EYYA 3QODA 4IO9F 1LE8B 1X3ZB 4BBRJ 1FX7A 3RQIA 2DA3A 1MBJA 2E1MC 5EDNA 1IXSB 1HKSA 1ZGWA 3DPTA 2BY0A 3MKZA 5L3BA 1X1PA 1L3LA 2XROA 1K6OA 1FEXA 2M3AA 4LG0A 1W36D 4LIUA 3B6AA 3HRTA 1GVDA 1IV6A 3W2AA 1JGSA 4CYCB 3CCLI 5J47A 4YRVA 3PQKA 1IG7A 2DQLA 2L7MP 1ZN2A 2B7EA 4KMFA 1XGSA 2PI0A 1ETYA 3KP3A 4XNFA 3RZOJ 3RQ4A 1G3SA 1E3OC 2CJJA 3RPUA 2RQPA 4M74A 1S5LC 5LHGA 1IRZA 2DCEA 1T95A 2L2OA 5CVUA 1R6RA 3EDPA 3KLOA 1QHGA 3AG4H 2W48A 2X1CA 5E3LA 2E1CA 1RESA 3GWZA 4ITVA 4N4OB 1R1TA 2HVQA 2A05A 5LHHA 3S3MA 1JE8A 3BCBA 2EZHA 3ZP5A 3WG7H 4CHUA 1UMQA 2O61A 2CG4A 2H27A 2UWMA 1D1CA 2PFBA 2E34A 1FSHA 1EV7A 4B09A 2EPFA 3LSJA 4HNTA 5E1XA 6PAXA 3KEOA 2WAQA 2AS5F 1S6LA 1YG2A 2LR8A 2VBWA 3LWFA 4U0VA 4EV0A 3WTYC 1SVLA 4MNUA 4CXFA 1BW5A 4NQWA 1EA3A 1X1AA 4YIRX 1X58A 1LE8A 2O03A 2XB0X 3DCFA 2QQ9A 2HTSA 2W4SA 3SDBA 2P5KA 4UUSB 2RVCA 5E17F 2IGMA 1R22A 2W85A 3CD6I 2HPIA 2KJCA 4D0PA 3JRBA 2X85A 1MBGA 5H2FC 3BR0A 3RPQA 1E0EA 4BE2A 3PJRA 5HLGA 3M07A 1DGWY 1ETOA 2ZC2A 2HOEA 4AWXB 2KIMA 4EMSA 4K2EA 1LUJB 1TLHB 2HNHA 3BC8A 5GAHJ 1QA6A 3K1NA 1TWHJ 1H9GA 4AIJA 1UHMA 4HQEA 2HXIA 2UZKA 1K79A 2A6HF 1CGPA 3KP2A 3CF2A 2HPMA 1QZEA 1IF1A 4ESFA 2Y30A 4NC8A 1R71A 3BTIA 3GF2A 1Q1HA 2L9RA 3BR2A 1BJAA 2KIQA 2LMDA 2W00A 4JX6A 2XKOA 1WJCA 3V7CA 5JVGF 1SEUA 4OAZA 1O3SA 4I99C 3OIPA 2EZIA 3IC7A 5HS8A 4XORA 2P5VA 4O3MA 1Y39A 2R7SA 3JSOA 4DZPA 4AD9A 5EJCA 1TTYA 2VJIA 4Y15A 3EUAA 3OOPA 1YJNI 2DMNA 2QSGX 1ZAOA 2LC2A 5C44J 3OYIA 1YYVA 2R93J 2NS0A 1Z3XA 2PX9A 4P5OA 4M9ZA 2ACJA 4CZZA 3ZQHA 5JR3A 1R4NB 1H0MA 3R0JA 4PSWA 2VT2A 1KYZA 4XONA 2LY2A 3DV8A 3OS2A 3N4MA 2NRAC 3DF8A 3RYRA 3OSFA 1NH3A 4LITA 1WZ2A 2UXNA 3SHFA 2BBYA 3BG3A 3FIWA 2CQQA 3GZNB 2E2JJ 5EF6A 4P9UA 3Q9VA 1Z67A 2DK5A 3E3VA 3KP4A 1K4SA 1IN6A 4M9SA 2DMTA 5FFZA 2MYSA 3PIOF 3DBRB 1LEAA 4IHXA 3DTEA 2L4MA 5LEKA 2EV0A 4A3CJ 2BYVE 2Z3YA 3H3UA 3GTOJ 3LSRA 3MZHA 3L2VA 1HSTA 2D5VA 4UV8A 4A3MJ 5A2QK 2DYRH 2QQAA 3CDIA 5IYCJ 2HYJA 3MZYA 4HDUA 1U78A 1MBFA 2JTVA 1BOAA 1CF7B 2PLYA 4ZJZA 1YS7A 2DXIA 1O57A 2CO5A 3CF5F 3PO2J 4XRMA 3F21A 1LDKB 2ISZA 2L9SA 2LF7A 2MD0A 4RB1A 3EPZA 2JSPA 2KQRA 3VSLA 1U5TB 3DKYA 2DT5A 4XKCA 4PK4A 1TBXA 4UB8C 2A6EF 5M5YJ 5J1YA 4U0WA 1FTZA 2MH2A 2L5QA 4LB5A 1F36A 1LFBA 3HPHA 1USSA 3QOPA 1UG2A 2PJPA 4JYKA 2HU9A 1C0WA 2WC2A 2NS8A 1YITI 4HX8A 4PZJA 2QUFA 2QYOA 2V9VA 3BZCA 3LOCA 4JX5A 2L02A 4QIWN 3GZ6A 2KZGA 4HF2A 5DD8A 3VDXA 5ICEA 4BBSJ 2NVXJ 1X4OA 4L18B 1BR1A 4QLCU 4XOPA 3I59B 4JP0A 1S7OA 2L54A 1QPMA 2QENA 5HOOA 1KQ8A 2YU3A 4QTRA 3I64A 2R7VA 4CCJA 2FXAA 2MLGA 5ERIA 5ILUA 3S1MJ 3VPRA 4A5NA 4RM2A 1BC7C 3IH3A 2OUMA 1VQOI 4FX0A 1WRJA 3BDDA 2Q0OA 1MKMA 1Z7UA 4YEJA 3BR6A 4KA4A 4IHSA 2HQNA 1P4WA 1JGGA 3L2UA 1N78A 4IF4A 2MA3A 2XHKA 1UG0A 3KPHA 4MHGA 3CQZJ 4A6DA 2WA0A 4ANJA 1CF7A 1RUOA 5GTHC 2Y31A 1HBXG 1MNMC 2IJLA 1R49A 4F92B 1TWAJ 2FJ1A 2HKXA 2DFFA 4P96A 2IXSA 4II3A 4AVZA 5BOXA 1SD5A 1U5TA 1YIJI 3TDUC 3HHHA 1UZCA 2GAUA 4PJLA 4BXUA 1WFXA 3GZ5A 2YPRA 2XVCA 3HBLA 3IL2A 2ZSHB 2P0WA 1RI7A 3HIFA 3ERMA 3SZTA 1X2NA 4QSHA 2EIJH 4BACA 3K4KA 1OYYA 1SFOJ 2W25A 1GV5A 1KQ9A 1TWFJ 1G2HA 2QSFX 1BR4A 4A2UA 3JRGA 3HTSB 5F0CA 1GV2A 2XGDA 5FD5A 2WB1A 2VQGA 3K9TA 1LVAA 3GLLA 2Q1ZB 1YOVB 3RIRA 2FF4A 2XAQA 2DA5A 1QZYA 2R7DA 4HV6A 5GAEJ 5BMZA 3Q9SA 3LSKA 2Q2EB 4BY7J 4JK1X 2K7LA 2DJIA 5GADJ 5J6XA 3I4PA 3J7AO 1XCVA 1PJRA 2XF6A 3BR1A 2FEZA 4ESJA 4A3JJ 1W7PA 2J5OA 3K0LA 1S29A 5BNGA 3OWTA 1ZG3A 5CVJA 5K7HA 1NG7A 2X1EA 1D5VA 1BIBA 4C30A 2LY9A 2L01A 3I58A 2DOEA 4XSXF 2XAGA 1W0TA 3OR2C 4BJ5C 1WWXA 1D1AA 3LSHA 3JTHA 4UUTA 3DXJF 4IX7A 1IRXA 1LFPA 1I5ZA 4AIKA 1GVJA 2JN6A 3E97A 5E20A 5LBQA 2XGXA 2MD5A 3SZGA 4CDGA 1WJDA 3OSGA 2XKPA 3GCMA 4O6JA 2PMUA 3FHNA 2FBKA 3F23A 4DOZA 3GW2A 4AUXA 4KUMA 4DYQA 4UV9A 1G3YA 1G3TA 3TW7A 2D1HA 3BZKA 2JPCA 5LFAA 5K5RA 3GX4X 3L1PA 2V4JC 3FHZA 4EEFG 4RAZA 3GYHX 3OS1A 1R9TJ 2FRHA 3G3ZA 2XB5A 2HDCA 2PMZN 1HCRA 3G4SI 2BW3B 4PUSA 1LDJA 5HNFA 2CW8A 2HOTA 5BPDA 2Q2EA 5K7FA 2IBDA 1XGMA 2FQ3A 4OWRB 4DBQA 2VI6A 3H9QA 4BNCA 2O7OA 2TRTA 3GFLA 3S1QJ 2DA6A 1CQTA 3FBNB 3K70D 5FO5A 3SQNA 4MO7A 3MQ0A 1X3WB 4CCNA 4ZYDA 3T1BA 4Z6YA 3ZMDA 4B44A 3CUOA 1ODDA 4M6XA 4GDFA 3PSIA 4IKFA 4CCLA 2V7FA 3V7SA 1MMAA 4UUVA 5DUIA 3PQJA 2JPBA 2LTPA 3NARA 3KIOA 5FB2A 3GFMA 5JVTA 2H8RA 2IA1A 3F8CA 2VQCA 3WU0A 3NQOA 2VE8A 2Z16A 2OD5A 2FQ4A 2ZCWA 4M6VA 2EFNA 1VZ0A 4E7SA 1J09A 4B3AA 3K4NA 1I39A 1W0UA 2GBYA 2J5PA 1T98A 2AXLA 4YFKF 4E7LA 5E18F 4UXNA 4IHYA 5FKKA 2DYSH 2JSCA 4JQFA 3SFZA 3BG5A 4G6QA 3CZ6A 4Q5SF 2CW7A 1HA8A 2K9SA 1T39A 5L3FA 1FMWA 3CCSI 2MC3A 3L9FA 3J7ZI 1MGTA 2VOOA 3FM5A 1P92A 3TL4X 2FD5A 2DODA 4A3GJ 1IDYA 2F48A 2DPUA 5F27A 2ZKZA 3CMMA 1JI8A 1J0RA 5K5OA 1WSUA 4FASD 4AC0A 2M2EA 4G94A 1A04A 1X1DA 1FOKA 5F6FA 1XGNA 1F4KA 1LNWA 4RLQA 5FFXA 2PEXA 5DCMB 4PSXA 4OMZA 4FISA 1GDTA 3TOAA 2F2EA 2ZJRF 2DA1A 3S17J 4F7ZA 4GGGA 4RGUA 3H3ZA 3F8BA 1L0OC 2FU4A 3KEQA 2FSWA 4ZDLA 4IRGA 1ZRFA 1JKPC 3ZMVA 3CP8A 3VYRB 5IOZA 4RB2C 2QCOA 1TC3C 4IL6C 1XS9A 4B1RA 1KU7A 2E5NA 1PUFB 4YIFA 2A5YB 3OV8A 3TP3A 2CS3A 4RGXA 4DGWB 2QZ8A 5IT9K 5E3OA 4I98B 3NWSA 2HXOA 2YR2A 3JRAA 3S1RJ 1VQLI 2STWA 3AG3H 1BW6A 4L9JA 4F55A 3BG7A 5D6EA 2A3SA 4UVAA 5D5WB 2ESNA 3T8TA 2W84A 4WXHA 4XLPF 2LRDA 4I76A 4KICA 4BQOA 4A3KJ 1K78B 3PL8A 1ACIA 3WTSC 4IOCF 3KP6A 4FX4A 3P7NA 2BY3A 4M72A 4L9TA 1VQ8I 3A01A 1D0ZA 2RAEA 2AQEA 4F52A 3AG1H 4G7HF 2RV8A 1HC8A 1AKHB 3H5RA 3WTTC 1S9HA 1T56A 3H5NA 4XLAA 1PP8F 3QPSA 2DMUA 1EF4A 3RJPA 3DKXA 1FOWA 1VQ5I 3KP7A 2DT7B 2K86A 4IEJA 1RKTA 4NNJA 5D8LB 2X1DA 1KYWA 2VJ4A 3HOXJ 2G7UA 2IVMA 4D7MA 3SZPA 4PJ0C 5IT3A 3I53A 2UXXA 1N77A 4E7IA 3MKLA 2XAJA 1SFKA 4FTHA 3K69A 1Z1DA 5KHDA 4RAFA 3TO6A 1FYKA 4ZTFA 2E7WA 3DKWA 2JUGA 2EILH 1O3QA 4Z2YA 5H20A 4G12A 2EWNA 2HVSA 1LEBA 2EBIA 1ERDA 3VWBA 3LQQA 2EV5A 2JVGA 5HS9A 5IYDJ 2R4GA 2H94A 1GHCA 4BAYA 1K78A 3CMAI 3WGGA 3CP2A 3EQLF 5DM7F 4A3FJ 2HYFA 1Z77A 1BI3A 1Y8QB 2KIUA 3FXMA 1RR8C 2R7RA 2I5UA 3FF5A 4LLNA 3BG9A 3KZIC 4W1UA 4D5CA 2K9MA 2NVUB 3OIQA 3D1NI 1R7JA 3CCQI 1YHQI 4A0ZA 3F8MA 1DQUA 2PQ8A 2DMQA 2WBMA 4N9IA 2R5YA 2ELHA 1K4TA 1YX3A 1B59A 2LKSA 4U7BA 2IAIA 1AKHA 5DCFA 3KZZA 2M87A 1IUYA 3N05A 1EH6A 2GXAA 1HW5A 3RSNA 2VKVA 2K4JA 5FKOA 3CO6C 1V3FA 1ZGJA 2F5FA 1SVOA 1XSXA 1Z21A 4C2MJ 4UVBA 2F5VA 2IGOA 3G6EI 1D8KA 1FJLA 1YJWI 2RN7A 4YFNF 1OMIA 3V8JA 2LF8A 2DI3A 3IUOA 1RNLA 1PP7U 3I3LA 1U8RA 4A3IJ 2X6OA 1T6SA 2Z2SB 5DV5A 1LFUP 1TQIA 2KIFA 1HDDC 1MW7A 2H1KA 4AYBN 2HDWA 2O5RA 5JLXA 3EYIA 4C2UA 2VODA 4ZDOA 5J4VA 2VBZA 1BL0A 1QZZA 3PNTA 3CLOA 2GOXB 4RAGA 5CVIA 2OU2A 1SVMA 2VOPA 1ONVA 2L9NA 2KRHA 2DFHA 1XMXA 1KA8A 4I0BA 1XTAA 2HQ5A 2XPWA 3WTVC 3PUBA 4I2OA 3ZPLA 4HQMA 4LK1F 5M3FJ 2K40A 4Y13A 3OYHA 3Q3SA 1JUPA 1YS6A 4CCOA 4FCYA 2VQLA 4OOIA 2D2WA 2EFQA 4HW0A 3RDIA 3WU1B 4HDVA 3K7AJ 1FYLA 3TDZC 1OYWA 2XDVA 3VODA 3ZQIA 4KIFA 3AL0C 3RCOA 5DD4A 1X2MA 3BPVA 3K10A 1D3YA 1ON2A 2VASA 3ZCOA 3K1MA 3A0BC 2DA7A 1IUFA 1MMDA 1JJ6C 3S15J 2JMWA 1QHHD 1JTXA 4CSWA 3M4OJ 3QAHA 4YELA 1E2XA 1FBQA 2ID6A 1OCPA 3TP0A 3CTAA 1JUSA 1SANA 4IXAA 4L0YB 1Z05A 3TW6A 3K2ZA 2ZXIA 2VC0A 2CV0A 4V19K 3LFKA 1SC7A 5GPAA 1MMNA 5DTDA 2XPUA 4MFDA 2RC4A 4L9VA 5K1YA 2IGKA 5LGUA 1VQNI 2QQBA 3V7RA 3QYBA 3JAMK 1TT0A 4RB3C 4A3DJ 3IP4B 1TWGJ 3OYDA 3ZMSA 3L09A 1XSDA 2IS6A 1ZREA 4HYEA 3JSPA 5J8CA 5HLHA 1B8IB 4HRIA 1Q1VA 2ZJ2A 2NVYJ 3OYLA 1FIAA 3K4JA 2HOAA 2PBIA 3FDYA 3F72A 3DEEA 3ELKA 2LK2A 4CYCA 4ENKA 3JREA 1XC5A 4JBAA 2V6EA 2HZDA 4RAYA 1UHSA 4B3XA 3IKVA 3MAJA 3C1DA 3SEQA 4XKBA 1MNDA 2E60A 2CUJA 4E7JA 1RETA 4OINF 2PJRB 4R79A 2MG4A 3DPUA 3HRSA 4BQNA 3KP5A 3PUFA 3GEZA 3BPXA 2A61A 3FXUA 3V8LA 4BQAA 1R5ID 5DM6F 3F0CA 1YW8A 2EIKH 2XC7A 2E35A 3MKYB 4RM3A 5ICGA 2OTJI 2V6CA 1I3QJ 1POGA 3D5SC 5TRDA 4OU0A 3IRRA 2EINH 3OYCA 2FNAA 2K9NA 1FT9A 2KP6A 3FISA 3GLXA 1U8BA 3M8JA 2LH9A 4HV5A 4PJJA 3HOUJ 1DP7P 3I5UA 4ENJA 1RRJA 3LNQA 1X4PA 3F3XA 5LGTA 3UNGC 1T8IA 2V1NA 2ESHA 4UUSA 3V8KA 1ON1A 3E6DA 2M0CA 2X6WA 1W4MA 3BP8A 1B8IA 4OIOF 1MZBA 1K83J 1KGSA 1LDDA 1WGXA 2WADA 3P9IA 2P7CB 2ID3A 2YS9A 3RI4A 2BY1A 3FXQA 2KISA 2VPRA 5IY5H 2OCCH 4Q48A 1IAWA 2OPTA 2TCTA 1IC8A 3ECHA 1WVRA 3RKXA 3DTKA 1JTYA 1IZ1A 2W1OA 3A0HC 4EM0B 1T2KA 2PJRA 5GPCA 1MBEA 3QP5A 1NG6A 1PDNC 3LFUA 2M1BA 1ZKGA 5FLMJ 4A12A 3ZGKA 3LA2A 5GAGJ 5C4XJ 4N4NB 1UCRA 3ZMZA 2P6SA 2VT3A 2HYGD 2G0EA 5HNHA 3DQVC 4X0GA 5IT9Z 4QWQA 1LQ1A 1Y0NA 1W5SA 1DP3A 2MABA 3J7YJ 1FP2A 1FTTA 2XRNA 1WH5A 1WI9A 2O8XA 5CQEA 1YQAA 3CESA 3RKQA 5H6RA 4BKXA 2C6YA 2ZXWH 2ECCA 1XG1A 2Y0SN 2GIVA 3ULQB 2OF7A 3ZQFA 4D7NA 4UNOA 1X1BA 4XRSG 4WK8F 3TO7A 2E1OA 3FMQA 2JWTA 3S93A 1AA7A 4GFBA 3CJTB 3RPUD 2LD5A 2DA2A 4I02A 3F6VA 2VB6A 5FROA 1P2FA 2KL4A 2IT0A 4M9XA 1R5GA 3P9CA 4RGRA 2LG4A 2XASA 4HG2A 1G4DA 4GCVA 5D5VB 3Q0WA 1O7LA 3BROA 4R8HA 5EEHA 3HM5A 1BR2A 5D5XB 3W2WA 1WJEA 3BG6A 1WHUA 2OAZA 4M3BA 1J75A 4WF2A 2ZMEB 2VBXA 1XSVA 2EFOA 2KZVA 3D5RC 3HC7A 5HS7A 2GQQA 3ASNH 2M7BA 3OYNA 3I0TA 4XL9A 3TQNA 4BDYA 1T08B 3CCUI 4HX7A 2DK8A 5CJ9A 2ZB9A 4LD5A 3FXLA 4DW6A 1U5TC 2R7WA 2L4AA 2CU7A 1P4AA 3BT9A 2GZWA 1NK2P 3X2QH 2F4MB 2HFHA 1YRNB 5AIPA 5EG0B 5HVQC 2MW8A 2DDBA 1FNNA 3DWLE 2GA1A 4WX9A 4GYGA 4BY1J 2EQRA 3JRIA 2EB7A 3JRDA 2L9VA 3K1PA 4IOAF 1YW7A 2GXBA 1VQMI 4RBOA 2QSHX 2HS5A 1OISA 3ZQQA 4JX4A 5LRRA 1JJ8C 2KHMA 1BJZA 5DEQA 4HA8A 3U1DA 3ML6A 4BQQA 1E3PA 4BE0A 9ANTA 4PJNA 1HDPA 1SAUA 2CV1A 1FZPB 2BHYA 4L9NA 3W6KB 2A07F 4ETSA 3W6VA 5FRNA 4A6EA 4M3FA 4EJWA 5CVRA 1EH8A 1WH7A 1OPCA 1RR7A 4Q47A 3T5XA 3AAFA 2DT6A 5E8IA 4OIQF 1EJ9A 2ZMEA 3I59A 2HTJA 3HPGA 3CO7C 1MNEA 1XN7A 3CUQB 3G1OA 4HOBA 4LK0F 1QU3A 4KT5C 4HLYA 2XV4S 1MSEC 5EGOB 4NUBA 4XSZF 4XLEA 2JQ7A 2JA8J 1JHHA 3ABMH 4KDPA 3J80K 1F1ZA 4MQVA 1VNDA 5KVRA 3GTQJ 4G7OF 4PJMA 1Y56A 2VPLA 1BIAA 4KNYA 1Z6TA 4EJOA 3BQYA 2R5ZB 1Y0UA 4AVPA 1YX5A 2QKMB 3HJEA 4D5FA 2NVQJ 2ELJA 3BY6A 3WTZA 3EETA 1MSFC 2Y9ZA 5C4JJ 2JRMA 2Y0SA 2DW4A 4O5VA 2X9DA 1B1BA 1MJBA 1QRYA 1XMKA 2VXDA 4DYRA 1TZLA 3VOEA 4PFOA 2OA4A 1ZRCA 2HVRA 1IO2A 3O6BB 1R4MB 3HG9A 1A5JA 1R1UA 3K2AA 4BH9A 5KCMA 3OYFA 1XX5A 2E71A 5JI6A 4XKWA 4ZDPA 1GUUA 5LHIA 1ENHA 3BZ6A 3ISPA 3I54A 2AO9A 3QOEA 1I6XA 1U9NA 4ON0A 2X0LA 3WE3A 1S3JA 3GFIA 1I50J 3ZMTA 1ZELA 3L7WA 1B6AA 1UB9A 4CICA 2CV2A 2K3FA 2GLOA 3KZYA 2OZUA 1BN5A 3OMYA 1GT0C 1QPIA 1IW7F 3CUQA 2NOJB 1WPKA 3DBHB 1HF0A 5EGOA 4HSRA 4XQFA 2K9LA 1DPRA 3ZQGA 3WTWC 3MKWB 5HDNA 2KPMA 3E0JB 5AIQA 5J8FA 1HXDA 4P1WA 4IQJA 2D45A 1HSJA 1IXRC 3G71I 2FMYA 3PO3J 2CFXA 3FKIJ 3C7JA 1RUNA 3V42A 4DJAA 3I56I 4IJAA 3JAMZ 3U21A 5M3MJ 3JRHA 3EUHC 1D8JA 1FLIA 4FT8A 1H8AC 3ZMUA 2A69F 2VKDA 1ZGAA 1TWCJ 4FQGA 3S8PA 4BHBA 1ZARA 2CUZA 2ELKA 4Y4RA 4XRSA 2RKHA 4YFXF 5FJ8J 3K6GA 3SDGA 3HHGA 3CJRB 3DU6A 2B9SA 2X4HA 1Z91A 2K9QA 3MFKA 3P9KA 3W6JB 5BPIA 3EUHA 2JK3A 4FE4A 5IP6A 3CCYA 4B4CA 2E7XA 3BOQA 5B66C 1B72B 1TNSA 2G7HA 2Y9YA 3NWTA 1MD0A 3KLNA 3H0GJ 4EJVA 4FHTA 3CJQB 2JA2A 2O0YA 3Q0UA 5F1RA 3FK7A 4EQQA 4XMYA 2FBHA 2NVTJ 2P4WA 1OJLA 2A6TA 2DAOA 4WXDA 1ETXA 2IEKA 1SAXA 2IGNA 4HAMA 2K85A 2FOWA 3BLYA 2BW3A 2K3PA 4XOTA 2A5WA 1Z9CA 5TISC 1IXCA 3S2DJ 1P7IA 2LP0A 2HQAA 2L3DA 2LKXA 1IV8A 2E1NA 4GXOA 3FWEA 4S04A 1HKTA 4IZZA 2GXGA 3DP7A 1MJAA 2XUBA 2BXYA 2CUFA 3HOZJ 4RS8A 1QNTA 2LY1A 4XM3A 1U0JA 1IRGA 4WCGA 4ABZA 3ASOH 2P6TA 3I9V2 1MJ9A 4BS9A 3WGHA 1ZTRA 1XB4A 4ZTJA 3IWFA 2G9WA 2VKHA 1OYIA 1R00A 1NK3P 2BOLA 4UY8I 5LD2C 4KMUX 3G2BA 2QLZA 1IN7A 2QEXI 4NHJA 1I1SA 1KU2A 1WJFA 4MTDA 2CRGA 1ULYA 3CLQA 2VC1A 2DPDA 1UELB 4RLFA 4BJ6C 5HLTA 4XK4A 1W7PD 3FXRA 2M4KA 3AKZA 2CMPA 5GP9A 1UAAA 4DZJA 5BQTA 5FLXK 1R23A 1U9OA 4CZCA 1A6QA 3H92A 3PFYA 4DQ2A 2H8WA 2CQ7A 5A2QZ 4LB6B 1P7JA 2PMZA 3QU6A 3PM1A 2F5DA 1A35A 4ZYAA 4EJUA 4XLFA 2XSDC 4A5MA 3SEZA 4XR6A 5B5EC 1JHFA 3M1CA 3DEWA 4B48A 3PIPF 1J59A 1I27A 5ED4A 1KONA 1UFMA 2ZJQF 3H36A 1ZK8A 5DCMA 4I6ZA 3FX3A 1ZR4A 1XD7A 3QQAA 1BC8C 2JZYA 4KIGA 1XPXA 3O3KA 3VYUB 1WQ2A 2DDAA 2F4OB 3CDHA 2E5ZA 4A0XA 3BTLA 4MEXF 2BY2A 2W57A 5EEGA 1NTCA 4KN4X 2JUCA 3A03A 1DU0A 3S3NA 4BU2A 4ENNA 4JOMA 5KAIC 4S05A 4FE7A 1YO5C 1EH7A 1TW2A 2FUG2 3HXLA 4LLGF 4MQ9F 1PUFA 3K4LA 3C2HA 1SFUA 3OYAA 1WJ5A 5E79C 4EGYA 3C3WA 5C3EJ 5L3CA 1V54H 1TP4A 1RZ4A 2LSOA 3O8HA 2R92J 1JT6A 3UKGA 1XDSA 1UHWA 2OV7A 4BDZA 1NHAA 2MSYA 3ZOBA 3LSGA 2FNPA 4HF1A 2CQXA 3CMYA 1I1GA 3GBGA 4J19A 1DUXC 1OLTA 5FRMA 2WAQN 2X51A 5CPRB 1E17A 2X48A 3M7GA 1D0XA 3QWLA 1WCMJ 2IS2A 2BGCA 4HSTA 4PCQA 2WV0A 4NB5A 2BE5F 2XAHA 1OCCH 3MVPA 1U6GA 2QWWA 3VYTB 4Q4ZF 1V5EA 2IA0A 3FBIB 1Y1VJ 1FWZA 2ZJPF 4ZZLA 2M30A 3IAM2 2EFWA 3I71A 3RKYA 2ADUA 3KE2A 2I10A 3HGGA 3BTJA 3CCVI 1T0FA 1VQKI 4DNCA 1B4AA 4Y52J 5K5QA 1F5TA 2OQRA 4CCMA 3HUGB 3B6CA 4C3IJ 1VFCA 2E1MB 5B3SH 3G1LA 2V1DA 1LB2A 4MGRA 4N9HA 1JT0A 1WKMA 1ETVA 3GTGJ 1I6HJ 1XGOA 2Z9OA 3C18A 3FZVA 2GM4A 5KK1A 2R3SA 3WHBA 3SYTA 1IN8A 4HNUA 4TV7A 3ZQLA 5J1RA 2CQKA 3ESWB 2LYCA 3PNYA 4LG3A 2R7QA 5EEAA 3N97A 2V1XA 2CUEA 2EZKA 1O3TA 5JHFA 3DLAA 1I3AA 2M7AA 1HOMA 2NNYA 1LPQA 3E6CC 4BE1A 1OCTC 4ZZDA 2P7VB 4NQWB 4HZFA 2H09A 2H6BA 2OCEA 2QA4I 3OY9A 5HDKA 1QO0D 2P5LC 3HYIA 3J81K 2CWEA 2IP2A 4BGDA 4GRIA 3MMYB 2W24A 4QPQA 3GTLJ 4M73A 4IHVA 2IPQX 2PN6A 1Y8RB 1J2XA 2AQFA 2XIGA 2O9LA 1DGRM 2QQ8A 1U3EM 3I4NJ 2QGUA 1H9TA 3L2QA 4FETA 3HUGA 3KFWX 2ZXHA 3MCZA 1T33A 1YIOA 4HX4A 4HEA2 1JXSA 3L2RA 1GXPA 1IGNA 4LOCA 2QBYB 3VFZA 3F6OA 3UR3C 2COMA 5D5UB 5KAFC 2CW0F 1FSEA 1OQYA 5E3MA 4RMNA 5JFRA 3H0DA 3LA3A 2YU9J 3FMRA 2VIXA 3H5AA 4I09A 4A3LJ 3LMMA 1A6IA 1SD4A 1FBUA 2V79A 2Y69H 3GUDA 3QU3A 4PGHA 3LL7A 2H1LA 5ILSA 2V9PA 2Z33A 5D8KB 1G6NA 2OC6A 2F4IA 3O8GA 4I0AA 3ZR8X 5CKTA 3HSEA 4M71A 5HODA 4IPAA 2EK5A 4I01A 1ZHFA 1ZLJA 2E36A 4PGGA 4NC7A 1VQ4I 1FBSA 1WJBA 3HL2A 4E7KA 4BHPA 2E2HJ 1O7FA 3E5QA 3WODF 2R7FA 2WY7Q 1DU6A 4LMYA 2DOAA 4N0BA 4ASNA 4KISA 4A0YA 3IHUA 3DU5A 5F04A 2MLKA 2VLAA 2XRLA 3GTJJ 1GXQA 2Y48A 3ZRGA 2EA2A 4LLLA 1XCBA 2JT1A 3OYBA 3DLLF 2F5EA 1J7KA 2F6CA 5CYVA 3R6SA 4V2GA 4G6TB 4AIDA 4DYCA 3HOTA 1ITYA 5K7ZA 4G6DA 2ZNZA 2QBYA 1LJ9A 4J00A 3NEUA 2KKOA 1ZLKA 4IHWA 4AU7A 2ECBA 3VB2A 2OBPA 4CUGA 3J7AY 1OCZH 1SD7A 1BI0A 4AM3A 5FKMA 4M3GA 3ABUA 1AU7A 4S0HB 2VBYA 4AYBA 4C3HJ 4CYDA 2N8GA 4RB0A 3T8RA 2L7KA 5FD6A 1Z7LA 2KJBA 3GO5A 3HRUA 2O8KA 4WWCA 2DOFA 5EZHA 3E7LA 5FGMA 4E6KG 3QPTA 3EUKL 2RNJA 5AONA 1LVKA 2GA2A 5M5XJ 3HB9A 2XGCA 3GTPJ 2RGVA 3DTIA 1S8NA 2V26A 3IH2A 3Q5FA 1FC3A 4KYWA 2FE3A 4LGWA 3H3VK 3VSKA 1YE9A 4F91B 1D0YA 2ICWG 5TJJA 4E4HA 3B02A 3H35A 1TT5B 2VN2A 5JHUA 2L7ZA 3D5LA 4ZH4F 3S2HJ 2LDUA 3GFJA 2LVSA 4RGSA 4IHTA 5H6QA 4HF0A 4G8XA 2FA5A 1SD6A 5D6FA 2JA5J 2CYYA 1KQ0A 4CA0A 3A2KA 2ZSIB 4NBQA 2WB1N 1ZQ3P 4LFUA 1W5TA 3E6MA 3HOSA 3QPLA 2M8EA 1RC9A 4OIRF 3KETA 3W3CA 3F8FA 1TQMA 4A69C 2UV1A 4BXXJ 3LSPA 3RTRA 2WY8Q 2Z1DA 5E1WA 5FLXZ 1YTYA 2IRFG 1HKQA 3MEXA 3A1YA 1V5GA 3RYPA 2EFPA 3OYKA 3JRFA 1QQIA 2GOMA 2LOOA 1YI2I 5L3GA 3WU2C 1XMAA 1STZA 3REOA 2STTA 2EJRA 1Z3YA 3M8EA 3WHCA 5J4YA 3HOYJ 4H4KC 2W82A 4HLXA 4C9YA 4J01A 1DDNA 3LA7A 3K70C 2YX4A 1VQ6I 3BWGA 3E5UA 3LSTA 3DBLB 5F64A 2KRFA 2RQQA 3QRFF 2QF7A 2HR3A 2DJNA 3DPLC 2V1UA 1B9MA 4CGZA 4II2A 4Y33A 4EJTA 2NOGA 4LJZF 5J40A 3K4CA 4UHTA 4BL0B 4BHCA 2B63J 3HGYA 5BS6A 1A36A 1ORKA 2FMLA 2A68F 1A31A 5IPAA 1FOYA 5IOYA 4P9FA 2DTZA 1KU3A 1TQPA 5EYRA 3WTUC 5IP7J 4LIVA 2HEOA 3SFIA 1YW9A 3S2WA 1YJ9I 3BTCA 1Y6IA 2OQGA 3FM3A 1JUMA 3F8NA 2LKPA 3LAJA 4L5IA 2CQNA 2IS1A 2OZ6A 3HEFA 4BEHB 5GTIC 4B47A 4EM1A 3M8FA 5LGNA 4U87A 4UVCA 5B1BH 4XLCA 5B1AH 5DYMA 5LLQA 3HSFA 2AHQA 2ZMEC 4WXCA 1W7PB 2JJ7A 5CVVA 2ZBKA 1AHDP 2P81A 1IDZA 2L7FP 5F0FA 4D1QA 1Z0XA 5J1UA 1MBKA 2P8TA 2O6GE 1WI3A 3HRMA 2ISYA 4W97A 1MH4A 2PMHA 2X6YA 3ABKH 2DFIA 1O3RA 1USTA 2WAFA 5CQGA 5E3NA 1OR7C 3BJOA 1XDUA 3TBIA 4E7HA 4B8XA 1U2WA 1UJ8A 2BXZA 2D1VA 2DN0A 3CJNA 1FP1D 1R1VA 2JRTA 5CLSA 2VONA 3WG9A 3LAPA 1VQ9I 4MFEA 2DMPA 3E1SA 3ZXSA 3H9JA 2HDDA 4C2TA 2WAEA 1TL8A 4ZYGA 3FXJA 2L0KA 5DDGA 1X3UA 1ZG5A 1OR7A 4X6AJ 2VUMJ 5TGTA 3B73A 3GVAA 1YRNA 3U9GA 3IWZA 1QVUA 5EG0A 1SFXA 4ZC3A 5D4RA 2M34A 2VL8A 2ZO4A 2VQHA 2XGEA 2YSRA 2MGQA 2WV1A 3HSRA 4BEHA 4MTEA 3WGIA 3PFIA 1MDMB 2XAUA 4XKVA 1F9NA 4U88A 5LRSA 3RZDJ 3K4BA 3E6BA 3QYFA 4M6YA 3CC2I 1MMGA 3IH4A 4EATA 4MIMA 2H6CA 4OMYA 1ETWA 1X19A 3LSMA 4Y17A 5LEJA 3CUQC 1BBYA 3OYGA 4BXFA 3R61A 4U0YA 1K7AA 1MH3A 4CH7A 1EKEA 1K6YA 3J81Z 2CGPA 3BR3A 3FMSA 3CCJI 3ERED 4KIBA 3OR1C 2BEOA 4A3BJ 1W5CC 3HKZN 4IRHA 1S7EA 5IP9J 2ZNYA 3CC4I 1V5FA 2DQRA 3QPHA 4Y7NJ 1N75A 2QVOA 2BV6A 4G7ZF 2Z99A 4L0ZB 4IVNA 2EA4A 1RKWA 2LBFB 2R7OA 3NAUA 4G9YA 2NYXA
chains in the Genus database with same CATH topology
2DTRA 4YG2F 2WTEA 4ZYEA 3R0AA 2DU9A 2WWYA 4P55A 1SMYF 4BYYA 3ZN1A 3SXYA 4HBLA 5HLIA 1P4XA 3ECOA 1IN4A 3JW4A 4EVIA 1R36A 1MDMA 2ETHA 3V4GA 4OIPF 2LNBA 4EGZA 4XRFA 2NAZA 1HW2A 3IRQA 2M45A 3TOBA 5ICCA 2ZFWA 1FPQA 3HTUA 2O3FA 3R60A 2IA2A 2ZXJA 3ZN0A 5L3DA 1T38A 4ENMA 4GYIA 1J5YA 2Y0MA 3T0YA 1HQCA 4CO8A 2HGCA 2HQRA 3M9AA 4E70A 1QGPA 3O2PE 2NNNA 1R5HA 2Y75A 1FYMA 3G73A 5ICFA 1SMTA 1HW1A 5E1ZB 5L3EA 2QM3A 1ZYRF 5HDGA 2CSOA 3LQRA 2EV6A 2HWVA 2DO7A 3U2RA 4PDKA 1FY7A 1TNTA 1IRFA 2VE9A 2FBIA 2TDXA 3JTGA 1B9NA 2PG4A 1REPC 2HZTA 3R4KA 1ZH5A 1BI1A 1Z6RA 2Z5UA 3VEPA 3ROUA 3DFGA 2K4BA 4ZYHA 3F22A 2XAFA 3TO9A 3GXOA 2K02A 4EM2A 4I7HA 2GWRA 1P6RA 4XBFA 3WTXC 3BJ6A 2YX7A 4KN7X 3RKWA 1YFHA 1OKRA 3KCCA 5E8GA 2Q8KA 2B0LA 1SFEA 1PUEE 3ABTA 2DBBA 3M1EA 2FOKA 2MH9A 2M5WA 3D0SA 1AWCA 4AIHA 4H0EA 4U7DA 1V4RA 2VXZA 3QP6A 1ZG1A 3L2CA 4ESBA 3ZQ7A 1J9IA 4YIIA 4L5JA 3DEUA 1ZRDA 1IN5A 2RDPA 1G3WA 1QBJA 3COAC 5ILVA 1DPUA 4LG0B 2HKOA 3L00A 2IW5A 3E5XA 1RIOH 1BM9A 3MWMA 1R58A 3TGNA 3NRVA 4KFCA 5DUKA 4MEYF 1TW3A 2F5CA 4XLNF 3WE2A 3TKYA 2MBFA 4R1HA 4GO1A 5D4SA 1YLFA 1AOYA 3IKTA 1S7AA 3J80Z 2K27A 1BI2A 2DLLA 1VTNC 1KU9A 3BJAA 4IRIA 3EYYA 1FX7A 1IXSB 1HKSA 3DPTA 5L3BA 1L3LA 2XROA 1K6OA 4LG0A 3HRTA 1JGSA 3PQKA 2DQLA 1ZN2A 4KMFA 1XGSA 2PI0A 3KP3A 1G3SA 3RPUA 2RQPA 4M74A 5LHGA 5CVUA 3EDPA 3KLOA 2E1CA 3GWZA 1R1TA 5LHHA 1JE8A 3ZP5A 4CHUA 2O61A 2CG4A 2H27A 2UWMA 2PFBA 1FSHA 1EV7A 4B09A 5E1XA 6PAXA 3KEOA 2AS5F 1S6LA 1YG2A 2VBWA 3LWFA 4U0VA 4EV0A 3WTYC 4MNUA 4CXFA 4NQWA 2O03A 2QQ9A 2HTSA 2P5KA 2RVCA 5E17F 1R22A 2W85A 2KJCA 4D0PA 3RPQA 5HLGA 2HOEA 4AWXB 2KIMA 4EMSA 4K2EA 1TLHB 3K1NA 1H9GA 4AIJA 1UHMA 4HQEA 2UZKA 1K79A 2A6HF 1CGPA 3KP2A 1IF1A 4ESFA 3GF2A 1Q1HA 1BJAA 2XKOA 3V7CA 1O3SA 3IC7A 5HS8A 2P5VA 4O3MA 3JSOA 4AD9A 1TTYA 4Y15A 3OOPA 1ZAOA 1YYVA 2NS0A 4P5OA 4M9ZA 2ACJA 4CZZA 5JR3A 1H0MA 3R0JA 2VT2A 1KYZA 3DV8A 3N4MA 2NRAC 3DF8A 3RYRA 2UXNA 3SHFA 2BBYA 4P9UA 3Q9VA 2DK5A 3E3VA 3KP4A 1IN6A 4M9SA 5FFZA 1LEAA 2L4MA 5LEKA 2EV0A 2BYVE 2Z3YA 3H3UA 3MZHA 1HSTA 4UV8A 5A2QK 2QQAA 4HDUA 3MZYA 1U78A 2JTVA 1BOAA 1CF7B 2PLYA 1YS7A 1O57A 2CO5A 3F21A 1LDKB 2ISZA 2LF7A 4RB1A 1U5TB 2DT5A 1TBXA 2A6EF 4U0WA 2MH2A 4LB5A 1USSA 3QOPA 2PJPA 1C0WA 2WC2A 4HX8A 4PZJA 2QUFA 2QYOA 2V9VA 3GZ6A 2L02A 4HF2A 5DD8A 5ICEA 4L18B 4QLCU 3I59B 1S7OA 2L54A 1QPMA 2QENA 5HOOA 1KQ8A 2YU3A 3I64A 5ILUA 2FXAA 2MLGA 5ERIA 4A5NA 1BC7C 4FX0A 1WRJA 3BDDA 2Q0OA 1MKMA 1Z7UA 4IHSA 4KA4A 2HQNA 1P4WA 4IF4A 2MA3A 2XHKA 4A6DA 4MHGA 1CF7A 1RUOA 1HBXG 2IJLA 2HKXA 4P96A 5BOXA 1SD5A 1U5TA 3TDUC 3HHHA 2GAUA 4BXUA 3GZ5A 2YPRA 2XVCA 3IL2A 1RI7A 3HIFA 3SZTA 1OYYA 2W25A 1KQ9A 4A2UA 3HTSB 5FD5A 3K9TA 1LVAA 3RIRA 2FF4A 2XAQA 1QZYA 2R7DA 4HV6A 5BMZA 3Q9SA 5J6XA 3J7AO 4JK1X 2K7LA 3I4PA 1XCVA 2FEZA 4ESJA 1W7PA 2J5OA 3K0LA 1S29A 1ZG3A 5CVJA 1D5VA 1BIBA 2L01A 3I58A 4XSXF 2XAGA 1WWXA 3JTHA 3DXJF 1I5ZA 4AIKA 1GVJA 3E97A 5E20A 5LBQA 2XGXA 2MD5A 4CDGA 2XKPA 4O6JA 2PMUA 2FBKA 3F23A 3GW2A 4KUMA 4UV9A 1G3YA 1G3TA 2D1HA 2JPCA 5K5RA 3GX4X 3FHZA 4RAZA 3GYHX 2FRHA 3G3ZA 2HDCA 1LDJA 5BPDA 2Q2EA 1XGMA 2FQ3A 4BNCA 3GFLA 5FO5A 3SQNA 3MQ0A 4ZYDA 3T1BA 3ZMDA 3CUOA 1ODDA 4M6XA 3V7SA 4UUVA 5DUIA 3PQJA 2JPBA 5FB2A 3GFMA 5JVTA 2IA1A 3F8CA 3WU0A 3NQOA 2VE8A 2OD5A 2ZCWA 2EFNA 2J5PA 1T98A 2AXLA 4YFKF 5E18F 4UXNA 2JSCA 4JQFA 3SFZA 4G6QA 4Q5SF 1T39A 5L3FA 2MC3A 3L9FA 1MGTA 2VOOA 3FM5A 1P92A 2DPUA 2ZKZA 1J0RA 5K5OA 1WSUA 4G94A 1A04A 1FOKA 5F6FA 1XGNA 1F4KA 1LNWA 5FFXA 2PEXA 5DCMB 4OMZA 3TOAA 2F2EA 4F7ZA 4GGGA 4RGUA 3H3ZA 3F8BA 1L0OC 2FU4A 3KEQA 2FSWA 4IRGA 1ZRFA 3ZMVA 4RB2C 1KU7A 4YIFA 2A5YB 3OV8A 4RGXA 2QZ8A 5IT9K 4I98B 2YR2A 2STWA 4L9JA 5D6EA 2A3SA 4UVAA 5D5WB 2ESNA 3T8TA 2W84A 4WXHA 4XLPF 4KICA 1K78B 3WTSC 3KP6A 4FX4A 3P7NA 4M72A 4L9TA 4G7HF 2RV8A 3WTTC 1PP8F 3RJPA 3KP7A 2K86A 5D8LB 1KYWA 2G7UA 2IVMA 3SZPA 5IT3A 3I53A 2UXXA 2XAJA 3K69A 1Z1DA 3TO6A 1FYKA 2E7WA 3DKWA 1O3QA 4Z2YA 5H20A 2EWNA 1LEBA 3LQQA 2EV5A 5HS9A 2H94A 1GHCA 4BAYA 1K78A 3WGGA 3EQLF 2HYFA 1BI3A 2KIUA 3FF5A 4LLNA 1R7JA 4A0ZA 3F8MA 2PQ8A 4N9IA 2ELHA 1B59A 4U7BA 5DCFA 3KZZA 2M87A 1IUYA 1EH6A 1HW5A 2K4JA 3CO6C 1V3FA 1ZGJA 2F5FA 1XSXA 4UVBA 1D8KA 2RN7A 4YFNF 1OMIA 3V8JA 2LF8A 2DI3A 1RNLA 1PP7U 1U8RA 1T6SA 5DV5A 1TQIA 2KIFA 3EYIA 2VODA 2VBZA 1QZZA 3CLOA 5CVIA 2OU2A 2VOPA 1ONVA 1KA8A 4I0BA 3WTVC 4I2OA 3ZPLA 4HQMA 4LK1F 4Y13A 1YS6A 4OOIA 2D2WA 2EFQA 4HW0A 3RDIA 3WU1B 4HDVA 1FYLA 3TDZC 1OYWA 3VODA 4KIFA 5DD4A 3BPVA 1D3YA 1ON2A 3K1MA 3QAHA 1E2XA 1FBQA 3CTAA 4L0YB 4IXAA 1Z05A 3K2ZA 2VC0A 3LFKA 2RC4A 4L9VA 5K1YA 5LGUA 2QQBA 3V7RA 4RB3C 3JAMK 3ZMSA 3L09A 1XSDA 1ZREA 4HYEA 3JSPA 5J8CA 5HLHA 2ZJ2A 2PBIA 3F72A 3ELKA 4ENKA 4JBAA 4RAYA 3IKVA 3MAJA 3C1DA 4OINF 4R79A 3HRSA 3KP5A 3GEZA 3BPXA 2A61A 3FXUA 3V8LA 4BQAA 1YW8A 5ICGA 2V6CA 5TRDA 4OU0A 3IRRA 2FNAA 1FT9A 3GLXA 4HV5A 1DP7P 3I5UA 4ENJA 3F3XA 5LGTA 2ESHA 3V8KA 1ON1A 3E6DA 1W4MA 3BP8A 4OIOF 1MZBA 1KGSA 1LDDA 3P9IA 2P7CB 3RI4A 3FXQA 4Q48A 1IAWA 3ECHA 3RKXA 1IZ1A 4EM0B 1T2KA 3QP5A 1PDNC 2M1BA 4A12A 3LA2A 1UCRA 3ZMZA 2P6SA 2VT3A 2HYGD 5IT9Z 3DQVC 4QWQA 1LQ1A 1W5SA 1FP2A 2XRNA 2O8XA 1WI9A 1YQAA 5H6RA 2C6YA 3ULQB 2GIVA 4UNOA 4WK8F 3TO7A 3FMQA 4I02A 3F6VA 1P2FA 2IT0A 4M9XA 1R5GA 3P9CA 4RGRA 2XASA 1G4DA 4GCVA 5D5VB 1O7LA 3BROA 4R8HA 5EEHA 5D5XB 2OAZA 1J75A 4WF2A 2ZMEB 2VBXA 1XSVA 2EFOA 5HS7A 2GQQA 3I0TA 3TQNA 4HX7A 2DK8A 5CJ9A 4LD5A 1U5TC 2L4AA 1P4AA 2GZWA 2HFHA 5AIPA 5HVQC 1FNNA 2GA1A 4WX9A 4GYGA 2EB7A 3K1PA 1YW7A 2GXBA 2HS5A 5LRRA 5DEQA 4HA8A 3U1DA 3ML6A 1FZPB 4L9NA 3W6KB 2A07F 4ETSA 4A6EA 4EJWA 5CVRA 1EH8A 1OPCA 4Q47A 3T5XA 3AAFA 5E8IA 4OIQF 2ZMEA 3I59A 2HTJA 3CO7C 1XN7A 3CUQB 4HOBA 4LK0F 4KT5C 4HLYA 2XV4S 4XSZF 1JHHA 4KDPA 3J80K 1F1ZA 4MQVA 5KVRA 4G7OF 1BIAA 4KNYA 1Z6TA 4EJOA 1Y0UA 4AVPA 3BY6A 3WTZA 3EETA 2DW4A 4O5VA 1B1BA 1MJBA 1XMKA 3VOEA 2OA4A 1ZRCA 3O6BB 1R1UA 4BH9A 5JI6A 5LHIA 3BZ6A 3ISPA 3I54A 1I6XA 3WE3A 4ON0A 2X0LA 1S3JA 3GFIA 3ZMTA 3L7WA 1B6AA 1UB9A 4CICA 3KZYA 2OZUA 1BN5A 1IW7F 3CUQA 3WTWC 1DPRA 5HDNA 5AIQA 5J8FA 1HXDA 2D45A 1HSJA 1IXRC 2FMYA 2CFXA 3C7JA 1RUNA 4IJAA 3JAMZ 1D8JA 1FLIA 4FT8A 3ZMUA 2A69F 1ZGAA 4BHBA 1ZARA 2RKHA 4YFXF 3HHGA 2X4HA 1Z91A 3MFKA 3P9KA 3W6JB 5BPIA 3EUHA 2E7XA 3BOQA 1TNSA 2G7HA 1MD0A 3KLNA 4EJVA 4FHTA 2O0YA 5F1RA 4EQQA 2FBHA 2P4WA 2DAOA 4WXDA 1SAXA 4HAMA 1Z9CA 1IXCA 2L3DA 2E1NA 4GXOA 3FWEA 4S04A 1HKTA 2GXGA 3DP7A 1MJAA 2XUBA 4RS8A 1QNTA 1IRGA 4WCGA 2P6TA 1MJ9A 3WGHA 1XB4A 3IWFA 2G9WA 1OYIA 1R00A 4KMUX 2QLZA 1IN7A 4NHJA 1I1SA 1KU2A 4MTDA 1ULYA 2VC1A 2DPDA 1W7PD 3FXRA 5BQTA 5FLXK 1R23A 4DQ2A 3H92A 5A2QZ 4LB6B 3QU6A 2F5DA 4EJUA 4A5MA 1JHFA 1J59A 1I27A 5ED4A 1UFMA 5DCMA 3FX3A 1XD7A 1BC8C 2JZYA 4KIGA 3O3KA 1WQ2A 4A0XA 3CDHA 4MEXF 2W57A 5EEGA 4KN4X 4ENNA 4S05A 1YO5C 1EH7A 1TW2A 4LLGF 4MQ9F 1SFUA 4EGYA 3C3WA 5L3CA 1RZ4A 2LSOA 1XDSA 1UHWA 1NHAA 2FNPA 4HF1A 1I1GA 1DUXC 1E17A 3M7GA 2BGCA 4PCQA 2WV0A 4NB5A 2BE5F 2XAHA 1U6GA 2QWWA 4Q4ZF 2IA0A 1FWZA 4ZZLA 2M30A 2EFWA 3I71A 3RKYA 2ADUA 3KE2A 1T0FA 4DNCA 1B4AA 5K5QA 1F5TA 2OQRA 2V1DA 1LB2A 4MGRA 4N9HA 1WKMA 1XGOA 2Z9OA 3C18A 3FZVA 5KK1A 2R3SA 1IN8A 4TV7A 2CQKA 3N97A 2V1XA 1O3TA 2NNYA 3E6CC 4ZZDA 2P7VB 4HZFA 2H09A 2H6BA 5HDKA 1QO0D 2P5LC 3HYIA 3J81K 2CWEA 2IP2A 2W24A 4M73A 2IPQX 2PN6A 1J2XA 2XIGA 1U3EM 1H9TA 3HUGA 3KFWX 3MCZA 1YIOA 4HX4A 1JXSA 1GXPA 2QBYB 3VFZA 3F6OA 2COMA 5D5UB 2CW0F 1FSEA 5JFRA 3LA3A 3FMRA 4I09A 4PGHA 1SD4A 1FBUA 2V79A 3QU3A 3GUDA 5ILSA 2Z33A 5D8KB 1G6NA 4I0AA 3HSEA 4M71A 4IPAA 2EK5A 4I01A 1ZHFA 1ZLJA 4PGGA 1FBSA 4BHPA 1O7FA 3E5QA 3WODF 2R7FA 4LMYA 4N0BA 4ASNA 4A0YA 3IHUA 2MLKA 1GXQA 2Y48A 2EA2A 4LLLA 1XCBA 2JT1A 2F5EA 1J7KA 5CYVA 3R6SA 3HOTA 4G6DA 2ZNZA 2QBYA 1LJ9A 3NEUA 2KKOA 1ZLKA 3VB2A 2OBPA 1SD7A 1BI0A 3ABUA 2VBYA 4CYDA 4RB0A 3T8RA 5FD6A 2KJBA 3GO5A 3HRUA 4WWCA 5FGMA 3QPTA 2RNJA 5AONA 2GA2A 2RGVA 1S8NA 3Q5FA 1FC3A 4KYWA 2FE3A 4LGWA 5TJJA 3B02A 2VN2A 5JHUA 3D5LA 4ZH4F 2LDUA 3GFJA 4RGSA 4IHTA 5H6QA 4HF0A 4G8XA 2FA5A 1SD6A 5D6FA 2CYYA 1KQ0A 4LFUA 1W5TA 3E6MA 3HOSA 2M8EA 4OIRF 3KETA 3F8FA 1TQMA 3RTRA 5E1WA 5FLXZ 1YTYA 2IRFG 1HKQA 3MEXA 3RYPA 2EFPA 1QQIA 5L3GA 1XMAA 1STZA 3REOA 2STTA 2EJRA 3M8EA 4HLXA 1DDNA 3LA7A 2YX4A 3BWGA 3E5UA 3LSTA 5F64A 2KRFA 3QRFF 2HR3A 3DPLC 2V1UA 1B9MA 4CGZA 4EJTA 4LJZF 4UHTA 4BHCA 5BS6A 2FMLA 2A68F 4P9FA 1KU3A 1TQPA 3WTUC 2HEOA 1YW9A 3S2WA 2OQGA 3FM3A 3F8NA 2LKPA 3LAJA 4L5IA 2OZ6A 4EM1A 3M8FA 5LGNA 4UVCA 5DYMA 5LLQA 3HSFA 4WXCA 1W7PB 5CVVA 2ZBKA 2P8TA 2O6GE 3HRMA 2ISYA 2PMHA 2DFIA 1O3RA 1USTA 3BJOA 1XDUA 4B8XA 1U2WA 3CJNA 2D1VA 1FP1D 1R1VA 2JRTA 5CLSA 2VONA 3WG9A 3LAPA 4ZYGA 5DDGA 1X3UA 1ZG5A 1OR7A 3B73A 3GVAA 3U9GA 3IWZA 1SFXA 5D4RA 2ZO4A 2YSRA 3HSRA 4MTEA 3WGIA 3PFIA 1MDMB 1F9NA 4U88A 5LRSA 3E6BA 4M6YA 2H6CA 4OMYA 4Y17A 5LEJA 3CUQC 1BBYA 3R61A 4U0YA 1K7AA 3J81Z 2CGPA 3FMSA 3ERED 4KIBA 2BEOA 4IRHA 2ZNYA 2DQRA 3QPHA 2QVOA 2BV6A 4G7ZF 2Z99A 4L0ZB 4IVNA 2EA4A 4G9YA 2NYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DTR A;  4YG2 F;  2WTE A;  4ZYE A;  3R0A A;  2DU9 A;  2WWY A;  4P55 A;  1SMY F;  4BYY A;  3ZN1 A;  3SXY A;  4HBL A;  5HLI A;  1P4X A;  3ECO A;  1IN4 A;  3JW4 A;  4EVI A;  1R36 A;  1MDM A;  2ETH A;  3V4G A;  4OIP F;  2LNB A;  4EGZ A;  4XRF A;  2NAZ A;  1HW2 A;  3IRQ A;  2M45 A;  3TOB A;  5ICC A;  2ZFW A;  1FPQ A;  3HTU A;  2O3F A;  3R60 A;  2IA2 A;  2ZXJ A;  3ZN0 A;  5L3D A;  1T38 A;  4ENM A;  4GYI A;  1J5Y A;  2Y0M A;  3T0Y A;  1HQC A;  4CO8 A;  2HGC A;  2HQR A;  3M9A A;  4E70 A;  1QGP A;  3O2P E;  2NNN A;  1R5H A;  2Y75 A;  1FYM A;  3G73 A;  5ICF A;  1SMT A;  1HW1 A;  5E1Z B;  5L3E A;  2QM3 A;  1ZYR F;  5HDG A;  2CSO A;  3LQR A;  2EV6 A;  2HWV A;  2DO7 A;  3U2R A;  4PDK A;  1FY7 A;  1TNT A;  1IRF A;  2VE9 A;  2FBI A;  2TDX A;  3JTG A;  1B9N A;  2PG4 A;  1REP C;  2HZT A;  3R4K A;  1ZH5 A;  1BI1 A;  1Z6R A;  2Z5U A;  3VEP A;  3ROU A;  3DFG A;  2K4B A;  4ZYH A;  3F22 A;  2XAF A;  3TO9 A;  3GXO A;  2K02 A;  4EM2 A;  4I7H A;  2GWR A;  1P6R A;  4XBF A;  3WTX C;  3BJ6 A;  2YX7 A;  4KN7 X;  3RKW A;  1YFH A;  1OKR A;  3KCC A;  5E8G A;  2Q8K A;  2B0L A;  1SFE A;  1PUE E;  3ABT A;  2DBB A;  3M1E A;  2FOK A;  2MH9 A;  2M5W A;  3D0S A;  1AWC A;  4AIH A;  4H0E A;  4U7D A;  1V4R A;  2VXZ A;  3QP6 A;  1ZG1 A;  3L2C A;  4ESB A;  3ZQ7 A;  1J9I A;  4YII A;  4L5J A;  3DEU A;  1ZRD A;  1IN5 A;  2RDP A;  1G3W A;  1QBJ A;  3COA C;  5ILV A;  1DPU A;  4LG0 B;  2HKO A;  3L00 A;  2IW5 A;  3E5X A;  1RIO H;  1BM9 A;  3MWM A;  1R58 A;  3TGN A;  3NRV A;  4KFC A;  5DUK A;  4MEY F;  1TW3 A;  2F5C A;  4XLN F;  3WE2 A;  3TKY A;  2MBF A;  4R1H A;  4GO1 A;  5D4S A;  1YLF A;  1AOY A;  3IKT A;  1S7A A;  3J80 Z;  2K27 A;  1BI2 A;  2DLL A;  1VTN C;  1KU9 A;  3BJA A;  4IRI A;  3EYY A;  1FX7 A;  1IXS B;  1HKS A;  3DPT A;  5L3B A;  1L3L A;  2XRO A;  1K6O A;  4LG0 A;  3HRT A;  1JGS A;  3PQK A;  2DQL A;  1ZN2 A;  4KMF A;  1XGS A;  2PI0 A;  3KP3 A;  1G3S A;  3RPU A;  2RQP A;  4M74 A;  5LHG A;  5CVU A;  3EDP A;  3KLO A;  2E1C A;  3GWZ A;  1R1T A;  5LHH A;  1JE8 A;  3ZP5 A;  4CHU A;  2O61 A;  2CG4 A;  2H27 A;  2UWM A;  2PFB A;  1FSH A;  1EV7 A;  4B09 A;  5E1X A;  6PAX A;  3KEO A;  2AS5 F;  1S6L A;  1YG2 A;  2VBW A;  3LWF A;  4U0V A;  4EV0 A;  3WTY C;  4MNU A;  4CXF A;  4NQW A;  2O03 A;  2QQ9 A;  2HTS A;  2P5K A;  2RVC A;  5E17 F;  1R22 A;  2W85 A;  2KJC A;  4D0P A;  3RPQ A;  5HLG A;  2HOE A;  4AWX B;  2KIM A;  4EMS A;  4K2E A;  1TLH B;  3K1N A;  1H9G A;  4AIJ A;  1UHM A;  4HQE A;  2UZK A;  1K79 A;  2A6H F;  1CGP A;  3KP2 A;  1IF1 A;  4ESF A;  3GF2 A;  1Q1H A;  1BJA A;  2XKO A;  3V7C A;  1O3S A;  3IC7 A;  5HS8 A;  2P5V A;  4O3M A;  3JSO A;  4AD9 A;  1TTY A;  4Y15 A;  3OOP A;  1ZAO A;  1YYV A;  2NS0 A;  4P5O A;  4M9Z A;  2ACJ A;  4CZZ A;  5JR3 A;  1H0M A;  3R0J A;  2VT2 A;  1KYZ A;  3DV8 A;  3N4M A;  2NRA C;  3DF8 A;  3RYR A;  2UXN A;  3SHF A;  2BBY A;  4P9U A;  3Q9V A;  2DK5 A;  3E3V A;  3KP4 A;  1IN6 A;  4M9S A;  5FFZ A;  1LEA A;  2L4M A;  5LEK A;  2EV0 A;  2BYV E;  2Z3Y A;  3H3U A;  3MZH A;  1HST A;  4UV8 A;  5A2Q K;  2QQA A;  4HDU A;  3MZY A;  1U78 A;  2JTV A;  1BOA A;  1CF7 B;  2PLY A;  1YS7 A;  1O57 A;  2CO5 A;  3F21 A;  1LDK B;  2ISZ A;  2LF7 A;  4RB1 A;  1U5T B;  2DT5 A;  1TBX A;  2A6E F;  4U0W A;  2MH2 A;  4LB5 A;  1USS A;  3QOP A;  2PJP A;  1C0W A;  2WC2 A;  4HX8 A;  4PZJ A;  2QUF A;  2QYO A;  2V9V A;  3GZ6 A;  2L02 A;  4HF2 A;  5DD8 A;  5ICE A;  4L18 B;  4QLC U;  3I59 B;  1S7O A;  2L54 A;  1QPM A;  2QEN A;  5HOO A;  1KQ8 A;  2YU3 A;  3I64 A;  5ILU A;  2FXA A;  2MLG A;  5ERI A;  4A5N A;  1BC7 C;  4FX0 A;  1WRJ A;  3BDD A;  2Q0O A;  1MKM A;  1Z7U A;  4IHS A;  4KA4 A;  2HQN A;  1P4W A;  4IF4 A;  2MA3 A;  2XHK A;  4A6D A;  4MHG A;  1CF7 A;  1RUO A;  1HBX G;  2IJL A;  2HKX A;  4P96 A;  5BOX A;  1SD5 A;  1U5T A;  3TDU C;  3HHH A;  2GAU A;  4BXU A;  3GZ5 A;  2YPR A;  2XVC A;  3IL2 A;  1RI7 A;  3HIF A;  3SZT A;  1OYY A;  2W25 A;  1KQ9 A;  4A2U A;  3HTS B;  5FD5 A;  3K9T A;  1LVA A;  3RIR A;  2FF4 A;  2XAQ A;  1QZY A;  2R7D A;  4HV6 A;  5BMZ A;  3Q9S A;  5J6X A;  3J7A O;  4JK1 X;  2K7L A;  3I4P A;  1XCV A;  2FEZ A;  4ESJ A;  1W7P A;  2J5O A;  3K0L A;  1S29 A;  1ZG3 A;  5CVJ A;  1D5V A;  1BIB A;  2L01 A;  3I58 A;  4XSX F;  2XAG A;  1WWX A;  3JTH A;  3DXJ F;  1I5Z A;  4AIK A;  1GVJ A;  3E97 A;  5E20 A;  5LBQ A;  2XGX A;  2MD5 A;  4CDG A;  2XKP A;  4O6J A;  2PMU A;  2FBK A;  3F23 A;  3GW2 A;  4KUM A;  4UV9 A;  1G3Y A;  1G3T A;  2D1H A;  2JPC A;  5K5R A;  3GX4 X;  3FHZ A;  4RAZ A;  3GYH X;  2FRH A;  3G3Z A;  2HDC A;  1LDJ A;  5BPD A;  2Q2E A;  1XGM A;  2FQ3 A;  4BNC A;  3GFL A;  5FO5 A;  3SQN A;  3MQ0 A;  4ZYD A;  3T1B A;  3ZMD A;  3CUO A;  1ODD A;  4M6X A;  3V7S A;  4UUV A;  5DUI A;  3PQJ A;  2JPB A;  5FB2 A;  3GFM A;  5JVT A;  2IA1 A;  3F8C A;  3WU0 A;  3NQO A;  2VE8 A;  2OD5 A;  2ZCW A;  2EFN A;  2J5P A;  1T98 A;  2AXL A;  4YFK F;  5E18 F;  4UXN A;  2JSC A;  4JQF A;  3SFZ A;  4G6Q A;  4Q5S F;  1T39 A;  5L3F A;  2MC3 A;  3L9F A;  1MGT A;  2VOO A;  3FM5 A;  1P92 A;  2DPU A;  2ZKZ A;  1J0R A;  5K5O A;  1WSU A;  4G94 A;  1A04 A;  1FOK A;  5F6F A;  1XGN A;  1F4K A;  1LNW A;  5FFX A;  2PEX A;  5DCM B;  4OMZ A;  3TOA A;  2F2E A;  4F7Z A;  4GGG A;  4RGU A;  3H3Z A;  3F8B A;  1L0O C;  2FU4 A;  3KEQ A;  2FSW A;  4IRG A;  1ZRF A;  3ZMV A;  4RB2 C;  1KU7 A;  4YIF A;  2A5Y B;  3OV8 A;  4RGX A;  2QZ8 A;  5IT9 K;  4I98 B;  2YR2 A;  2STW A;  4L9J A;  5D6E A;  2A3S A;  4UVA A;  5D5W B;  2ESN A;  3T8T A;  2W84 A;  4WXH A;  4XLP F;  4KIC A;  1K78 B;  3WTS C;  3KP6 A;  4FX4 A;  3P7N A;  4M72 A;  4L9T A;  4G7H F;  2RV8 A;  3WTT C;  1PP8 F;  3RJP A;  3KP7 A;  2K86 A;  5D8L B;  1KYW A;  2G7U A;  2IVM A;  3SZP A;  5IT3 A;  3I53 A;  2UXX A;  2XAJ A;  3K69 A;  1Z1D A;  3TO6 A;  1FYK A;  2E7W A;  3DKW A;  1O3Q A;  4Z2Y A;  5H20 A;  2EWN A;  1LEB A;  3LQQ A;  2EV5 A;  5HS9 A;  2H94 A;  1GHC A;  4BAY A;  1K78 A;  3WGG A;  3EQL F;  2HYF A;  1BI3 A;  2KIU A;  3FF5 A;  4LLN A;  1R7J A;  4A0Z A;  3F8M A;  2PQ8 A;  4N9I A;  2ELH A;  1B59 A;  4U7B A;  5DCF A;  3KZZ A;  2M87 A;  1IUY A;  1EH6 A;  1HW5 A;  2K4J A;  3CO6 C;  1V3F A;  1ZGJ A;  2F5F A;  1XSX A;  4UVB A;  1D8K A;  2RN7 A;  4YFN F;  1OMI A;  3V8J A;  2LF8 A;  2DI3 A;  1RNL A;  1PP7 U;  1U8R A;  1T6S A;  5DV5 A;  1TQI A;  2KIF A;  3EYI A;  2VOD A;  2VBZ A;  1QZZ A;  3CLO A;  5CVI A;  2OU2 A;  2VOP A;  1ONV A;  1KA8 A;  4I0B A;  3WTV C;  4I2O A;  3ZPL A;  4HQM A;  4LK1 F;  4Y13 A;  1YS6 A;  4OOI A;  2D2W A;  2EFQ A;  4HW0 A;  3RDI A;  3WU1 B;  4HDV A;  1FYL A;  3TDZ C;  1OYW A;  3VOD A;  4KIF A;  5DD4 A;  3BPV A;  1D3Y A;  1ON2 A;  3K1M A;  3QAH A;  1E2X A;  1FBQ A;  3CTA A;  4L0Y B;  4IXA A;  1Z05 A;  3K2Z A;  2VC0 A;  3LFK A;  2RC4 A;  4L9V A;  5K1Y A;  5LGU A;  2QQB A;  3V7R A;  4RB3 C;  3JAM K;  3ZMS A;  3L09 A;  1XSD A;  1ZRE A;  4HYE A;  3JSP A;  5J8C A;  5HLH A;  2ZJ2 A;  2PBI A;  3F72 A;  3ELK A;  4ENK A;  4JBA A;  4RAY A;  3IKV A;  3MAJ A;  3C1D A;  4OIN F;  4R79 A;  3HRS A;  3KP5 A;  3GEZ A;  3BPX A;  2A61 A;  3FXU A;  3V8L A;  4BQA A;  1YW8 A;  5ICG A;  2V6C A;  5TRD A;  4OU0 A;  3IRR A;  2FNA A;  1FT9 A;  3GLX A;  4HV5 A;  1DP7 P;  3I5U A;  4ENJ A;  3F3X A;  5LGT A;  2ESH A;  3V8K A;  1ON1 A;  3E6D A;  1W4M A;  3BP8 A;  4OIO F;  1MZB A;  1KGS A;  1LDD A;  3P9I A;  2P7C B;  3RI4 A;  3FXQ A;  4Q48 A;  1IAW A;  3ECH A;  3RKX A;  1IZ1 A;  4EM0 B;  1T2K A;  3QP5 A;  1PDN C;  2M1B A;  4A12 A;  3LA2 A;  1UCR A;  3ZMZ A;  2P6S A;  2VT3 A;  2HYG D;  5IT9 Z;  3DQV C;  4QWQ A;  1LQ1 A;  1W5S A;  1FP2 A;  2XRN A;  2O8X A;  1WI9 A;  1YQA A;  5H6R A;  2C6Y A;  3ULQ B;  2GIV A;  4UNO A;  4WK8 F;  3TO7 A;  3FMQ A;  4I02 A;  3F6V A;  1P2F A;  2IT0 A;  4M9X A;  1R5G A;  3P9C A;  4RGR A;  2XAS A;  1G4D A;  4GCV A;  5D5V B;  1O7L A;  3BRO A;  4R8H A;  5EEH A;  5D5X B;  2OAZ A;  1J75 A;  4WF2 A;  2ZME B;  2VBX A;  1XSV A;  2EFO A;  5HS7 A;  2GQQ A;  3I0T A;  3TQN A;  4HX7 A;  2DK8 A;  5CJ9 A;  4LD5 A;  1U5T C;  2L4A A;  1P4A A;  2GZW A;  2HFH A;  5AIP A;  5HVQ C;  1FNN A;  2GA1 A;  4WX9 A;  4GYG A;  2EB7 A;  3K1P A;  1YW7 A;  2GXB A;  2HS5 A;  5LRR A;  5DEQ A;  4HA8 A;  3U1D A;  3ML6 A;  1FZP B;  4L9N A;  3W6K B;  2A07 F;  4ETS A;  4A6E A;  4EJW A;  5CVR A;  1EH8 A;  1OPC A;  4Q47 A;  3T5X A;  3AAF A;  5E8I A;  4OIQ F;  2ZME A;  3I59 A;  2HTJ A;  3CO7 C;  1XN7 A;  3CUQ B;  4HOB A;  4LK0 F;  4KT5 C;  4HLY A;  2XV4 S;  4XSZ F;  1JHH A;  4KDP A;  3J80 K;  1F1Z A;  4MQV A;  5KVR A;  4G7O F;  1BIA A;  4KNY A;  1Z6T A;  4EJO A;  1Y0U A;  4AVP A;  3BY6 A;  3WTZ A;  3EET A;  2DW4 A;  4O5V A;  1B1B A;  1MJB A;  1XMK A;  3VOE A;  2OA4 A;  1ZRC A;  3O6B B;  1R1U A;  4BH9 A;  5JI6 A;  5LHI A;  3BZ6 A;  3ISP A;  3I54 A;  1I6X A;  3WE3 A;  4ON0 A;  2X0L A;  1S3J A;  3GFI A;  3ZMT A;  3L7W A;  1B6A A;  1UB9 A;  4CIC A;  3KZY A;  2OZU A;  1BN5 A;  1IW7 F;  3CUQ A;  3WTW C;  1DPR A;  5HDN A;  5AIQ A;  5J8F A;  1HXD A;  2D45 A;  1HSJ A;  1IXR C;  2FMY A;  2CFX A;  3C7J A;  1RUN A;  4IJA A;  3JAM Z;  1D8J A;  1FLI A;  4FT8 A;  3ZMU A;  2A69 F;  1ZGA A;  4BHB A;  1ZAR A;  2RKH A;  4YFX F;  3HHG A;  2X4H A;  1Z91 A;  3MFK A;  3P9K A;  3W6J B;  5BPI A;  3EUH A;  2E7X A;  3BOQ A;  1TNS A;  2G7H A;  1MD0 A;  3KLN A;  4EJV A;  4FHT A;  2O0Y A;  5F1R A;  4EQQ A;  2FBH A;  2P4W A;  2DAO A;  4WXD A;  1SAX A;  4HAM A;  1Z9C A;  1IXC A;  2L3D A;  2E1N A;  4GXO A;  3FWE A;  4S04 A;  1HKT A;  2GXG A;  3DP7 A;  1MJA A;  2XUB A;  4RS8 A;  1QNT A;  1IRG A;  4WCG A;  2P6T A;  1MJ9 A;  3WGH A;  1XB4 A;  3IWF A;  2G9W A;  1OYI A;  1R00 A;  4KMU X;  2QLZ A;  1IN7 A;  4NHJ A;  1I1S A;  1KU2 A;  4MTD A;  1ULY A;  2VC1 A;  2DPD A;  1W7P D;  3FXR A;  5BQT A;  5FLX K;  1R23 A;  4DQ2 A;  3H92 A;  5A2Q Z;  4LB6 B;  3QU6 A;  2F5D A;  4EJU A;  4A5M A;  1JHF A;  1J59 A;  1I27 A;  5ED4 A;  1UFM A;  5DCM A;  3FX3 A;  1XD7 A;  1BC8 C;  2JZY A;  4KIG A;  3O3K A;  1WQ2 A;  4A0X A;  3CDH A;  4MEX F;  2W57 A;  5EEG A;  4KN4 X;  4ENN A;  4S05 A;  1YO5 C;  1EH7 A;  1TW2 A;  4LLG F;  4MQ9 F;  1SFU A;  4EGY A;  3C3W A;  5L3C A;  1RZ4 A;  2LSO A;  1XDS A;  1UHW A;  1NHA A;  2FNP A;  4HF1 A;  1I1G A;  1DUX C;  1E17 A;  3M7G A;  2BGC A;  4PCQ A;  2WV0 A;  4NB5 A;  2BE5 F;  2XAH A;  1U6G A;  2QWW A;  4Q4Z F;  2IA0 A;  1FWZ A;  4ZZL A;  2M30 A;  2EFW A;  3I71 A;  3RKY A;  2ADU A;  3KE2 A;  1T0F A;  4DNC A;  1B4A A;  5K5Q A;  1F5T A;  2OQR A;  2V1D A;  1LB2 A;  4MGR A;  4N9H A;  1WKM A;  1XGO A;  2Z9O A;  3C18 A;  3FZV A;  5KK1 A;  2R3S A;  1IN8 A;  4TV7 A;  2CQK A;  3N97 A;  2V1X A;  1O3T A;  2NNY A;  3E6C C;  4ZZD A;  2P7V B;  4HZF A;  2H09 A;  2H6B A;  5HDK A;  1QO0 D;  2P5L C;  3HYI A;  3J81 K;  2CWE A;  2IP2 A;  2W24 A;  4M73 A;  2IPQ X;  2PN6 A;  1J2X A;  2XIG A;  1U3E M;  1H9T A;  3HUG A;  3KFW X;  3MCZ A;  1YIO A;  4HX4 A;  1JXS A;  1GXP A;  2QBY B;  3VFZ A;  3F6O A;  2COM A;  5D5U B;  2CW0 F;  1FSE A;  5JFR A;  3LA3 A;  3FMR A;  4I09 A;  4PGH A;  1SD4 A;  1FBU A;  2V79 A;  3QU3 A;  3GUD A;  5ILS A;  2Z33 A;  5D8K B;  1G6N A;  4I0A A;  3HSE A;  4M71 A;  4IPA A;  2EK5 A;  4I01 A;  1ZHF A;  1ZLJ A;  4PGG A;  1FBS A;  4BHP A;  1O7F A;  3E5Q A;  3WOD F;  2R7F A;  4LMY A;  4N0B A;  4ASN A;  4A0Y A;  3IHU A;  2MLK A;  1GXQ A;  2Y48 A;  2EA2 A;  4LLL A;  1XCB A;  2JT1 A;  2F5E A;  1J7K A;  5CYV A;  3R6S A;  3HOT A;  4G6D A;  2ZNZ A;  2QBY A;  1LJ9 A;  3NEU A;  2KKO A;  1ZLK A;  3VB2 A;  2OBP A;  1SD7 A;  1BI0 A;  3ABU A;  2VBY A;  4CYD A;  4RB0 A;  3T8R A;  5FD6 A;  2KJB A;  3GO5 A;  3HRU A;  4WWC A;  5FGM A;  3QPT A;  2RNJ A;  5AON A;  2GA2 A;  2RGV A;  1S8N A;  3Q5F A;  1FC3 A;  4KYW A;  2FE3 A;  4LGW A;  5TJJ A;  3B02 A;  2VN2 A;  5JHU A;  3D5L A;  4ZH4 F;  2LDU A;  3GFJ A;  4RGS A;  4IHT A;  5H6Q A;  4HF0 A;  4G8X A;  2FA5 A;  1SD6 A;  5D6F A;  2CYY A;  1KQ0 A;  4LFU A;  1W5T A;  3E6M A;  3HOS A;  2M8E A;  4OIR F;  3KET A;  3F8F A;  1TQM A;  3RTR A;  5E1W A;  5FLX Z;  1YTY A;  2IRF G;  1HKQ A;  3MEX A;  3RYP A;  2EFP A;  1QQI A;  5L3G A;  1XMA A;  1STZ A;  3REO A;  2STT A;  2EJR A;  3M8E A;  4HLX A;  1DDN A;  3LA7 A;  2YX4 A;  3BWG A;  3E5U A;  3LST A;  5F64 A;  2KRF A;  3QRF F;  2HR3 A;  3DPL C;  2V1U A;  1B9M A;  4CGZ A;  4EJT A;  4LJZ F;  4UHT A;  4BHC A;  5BS6 A;  2FML A;  2A68 F;  4P9F A;  1KU3 A;  1TQP A;  3WTU C;  2HEO A;  1YW9 A;  3S2W A;  2OQG A;  3FM3 A;  3F8N A;  2LKP A;  3LAJ A;  4L5I A;  2OZ6 A;  4EM1 A;  3M8F A;  5LGN A;  4UVC A;  5DYM A;  5LLQ A;  3HSF A;  4WXC A;  1W7P B;  5CVV A;  2ZBK A;  2P8T A;  2O6G E;  3HRM A;  2ISY A;  2PMH A;  2DFI A;  1O3R A;  1UST A;  3BJO A;  1XDU A;  4B8X A;  1U2W A;  3CJN A;  2D1V A;  1FP1 D;  1R1V A;  2JRT A;  5CLS A;  2VON A;  3WG9 A;  3LAP A;  4ZYG A;  5DDG A;  1X3U A;  1ZG5 A;  1OR7 A;  3B73 A;  3GVA A;  3U9G A;  3IWZ A;  1SFX A;  5D4R A;  2ZO4 A;  2YSR A;  3HSR A;  4MTE A;  3WGI A;  3PFI A;  1MDM B;  1F9N A;  4U88 A;  5LRS A;  3E6B A;  4M6Y A;  2H6C A;  4OMY A;  4Y17 A;  5LEJ A;  3CUQ C;  1BBY A;  3R61 A;  4U0Y A;  1K7A A;  3J81 Z;  2CGP A;  3FMS A;  3ERE D;  4KIB A;  2BEO A;  4IRH A;  2ZNY A;  2DQR A;  3QPH A;  2QVO A;  2BV6 A;  4G7Z F;  2Z99 A;  4L0Z B;  4IVN A;  2EA4 A;  4G9Y A;  2NYX A; 
#chains in the Genus database with same CATH topology
 1IJW C;  3SJM A;  2DTR A;  4YG2 F;  3GME A;  2WTE A;  1ETK A;  4ZYE A;  4A3E J;  3R0A A;  2DU9 A;  2CH0 A;  2WWY A;  4HNV A;  3CME I;  4P55 A;  1FIP A;  3HOW J;  3A4C A;  1SMY F;  4KT6 A;  4BYY A;  4XLH A;  2EH3 A;  3A02 A;  4XN3 A;  2V9K A;  4IQ4 A;  3FXK A;  3ZN1 A;  4E7Z A;  1GLN A;  3SXY A;  3K4M A;  4HBL A;  5HLI A;  2R5Z A;  1P4X A;  3ECO A;  2K5C A;  1IN4 A;  2UUZ A;  3JW4 A;  4EVI A;  3M3Y J;  1R36 A;  1MDM A;  2ETH A;  1VI0 A;  3BQZ A;  4OAY A;  3V4G A;  3W2V A;  4OIP F;  3BR5 A;  2LNB A;  2JA7 J;  2M9H A;  2DFE A;  4A93 J;  4EGZ A;  2XSJ C;  1RPW A;  4XRF A;  3FKJ A;  2NAZ A;  1HW2 A;  5F0H A;  3S32 A;  3IRQ A;  2M45 A;  3TOB A;  3GTK J;  2LLK A;  2XPV A;  1V55 H;  3F9K A;  4BJT A;  2W7N A;  5ICC A;  2X6X A;  2R0Q C;  2ZFW A;  1FOX A;  3OL4 A;  3Q0V A;  1FPQ A;  2AXT C;  3HTU A;  1W1W E;  3ZQC A;  2MFZ A;  4RDU A;  3P5J A;  4XID A;  3L2W A;  2O3F A;  3R60 A;  2IA2 A;  2ZXJ A;  3OOU A;  3ZN0 A;  2E2I J;  5L3D A;  3KYL A;  4X1E A;  3S3O A;  1T38 A;  5FLV A;  3JCU C;  2QKL B;  4ENM A;  4GYI A;  4NDL A;  1J5Y A;  2Y0M A;  2LBF A;  3T0Y A;  1HQC A;  4CO8 A;  3PSF A;  2HGC A;  2IS4 A;  3TMO A;  3FXO A;  2HQR A;  1BA5 A;  2KDZ A;  3CCM I;  3M9A A;  3OS0 A;  2KDO A;  4QPO A;  4E70 A;  2XF7 A;  4NC6 A;  1QGP A;  2COB A;  3LSI A;  2KT0 A;  1BOB A;  3O2P E;  4PFP A;  2NNN A;  5KNL A;  1R5H A;  2Y75 A;  3IV5 A;  1MIJ A;  1FYM A;  3G73 A;  5ICF A;  1SMT A;  3OIO A;  2OTL I;  4F3Q A;  1H89 C;  3KEY A;  1W36 C;  1HW1 A;  5E1Z B;  1M1E B;  5L3E A;  3AFH A;  2R7X A;  2JVH A;  4UB6 C;  3A01 B;  1O4X A;  2QM3 A;  5FKN A;  2R7Z J;  1ZYR F;  2VKE A;  2CSO A;  2BVL A;  5HDG A;  1S72 I;  1HLV A;  3LQR A;  2EV6 A;  2HWV A;  3HDD A;  3CC7 I;  2DO7 A;  2GIZ A;  3U2R A;  4PDK A;  1FY7 A;  1TNT A;  4M3D A;  2LRE A;  3KYD B;  1IRF A;  2VE9 A;  2FBI A;  2TDX A;  1X1C A;  1B72 A;  3JTG A;  1ZR2 A;  1B9N A;  2PG4 A;  3AG2 H;  1PYV A;  2RNG A;  5EZG A;  1WJA A;  1REP C;  2HZT A;  2BVM A;  3R4K A;  3HKZ A;  3U1K A;  1MMS A;  2ME0 A;  1ZH5 A;  1BI1 A;  3S14 J;  4L5E A;  4BUP A;  1Z6R A;  2BZT A;  2Z5U A;  3MD2 A;  5M5W J;  3CDL A;  2I8D A;  3VYS B;  3VEP A;  5F1J A;  4XIC A;  2VJJ A;  2ME6 A;  2VJ5 A;  3ROU A;  2JA6 J;  3DFG A;  1D5Y A;  1PVE A;  4DBR A;  2OJE D;  2K4B A;  4ZYH A;  2M4G A;  3F22 A;  2XAF A;  3TO9 A;  3GXO A;  2K02 A;  1F43 A;  1VQP I;  3OL3 A;  1QVT A;  2EZL A;  4M3E A;  2Y2Z A;  3MN2 A;  4HPQ A;  4EM2 A;  1K61 A;  5F08 A;  2ZFU A;  4I7H A;  2R7U A;  2NS7 A;  3HZJ A;  3S1N J;  4C3J J;  2GWR A;  1P6R A;  4XN0 A;  4XBF A;  3WTX C;  3BJ6 A;  2YX7 A;  3H1C A;  3GTM J;  1VQ7 I;  2E19 A;  2DA4 A;  4KN7 X;  3RKW A;  1YFH A;  1OKR A;  1JKR C;  3KCC A;  5E8G A;  1VF9 A;  3ABL H;  2R5Y B;  2Q8K A;  2B0L A;  1SFE A;  2KLO A;  3OYM A;  4Y3O A;  2KMU A;  4V2F A;  3JR9 A;  1PUE E;  1OFC X;  3ABT A;  3HOV J;  5J3L A;  2DBB A;  3S16 J;  1JKQ C;  3M1E A;  2FOK A;  2MH9 A;  2M5W A;  4MLO A;  5DS9 A;  2KFD A;  3D0S A;  1AWC A;  4AIH A;  2BHZ A;  4H0E A;  4U7D A;  1V4R A;  1Y1W J;  2EIM H;  2HI3 A;  4CCK A;  3I4M J;  1OCO H;  2VXZ A;  3MZ8 A;  1G59 A;  1G8X A;  2R7T A;  1T0F C;  3QP6 A;  1ZG1 A;  3L2C A;  4ESB A;  1MBH A;  3ZQ7 A;  1J9I A;  4YII A;  3KYC B;  3DEU A;  4L5J A;  2M0M A;  5JLW A;  1E3H A;  1ZRD A;  1IN5 A;  4DIQ A;  2RDP A;  3PNV A;  1G3W A;  3C2B A;  1QBJ A;  3C2G A;  1KZH A;  2KRC A;  3COA C;  1P9Q C;  1D1B A;  5ILV A;  2HOS A;  1DPU A;  4LG0 B;  2HKO A;  2M8G X;  3KX2 A;  3L00 A;  1OCR H;  2CFO A;  2IW5 A;  3E5X A;  1RIO H;  4RA2 A;  3IAS 2;  1FMV A;  3CCR I;  3ONQ A;  1BM9 A;  3MWM A;  1R58 A;  3TGN A;  3OYJ A;  1APL C;  3NRV A;  5IYB J;  4KFC A;  3I55 I;  2LFB A;  5DUK A;  4MEY F;  1TW3 A;  2YUS A;  2F5C A;  2XF5 A;  4XLN F;  3QYE A;  2MC4 A;  3OYE A;  1LKX A;  3WE2 A;  3TKY A;  3BCA A;  1ETQ A;  2MBF A;  2RRE A;  4R1H A;  2NXN B;  4GO1 A;  5D4S A;  1YLF A;  2FX0 A;  3CCE I;  1AOY A;  3IKT A;  1H88 C;  1S7A A;  3J80 Z;  3G1M A;  4KJZ A;  4F93 B;  2K27 A;  4B43 A;  1BI2 A;  2DLL A;  3FK6 A;  1VTN C;  1KU9 A;  3AL0 B;  1JKO C;  3BJA A;  5FKL A;  4D9J A;  4IRI A;  3TED A;  1N25 A;  3JRC A;  3H9G A;  4KIT B;  3EYY A;  3QOD A;  4IO9 F;  1LE8 B;  1X3Z B;  4BBR J;  1FX7 A;  3RQI A;  2DA3 A;  1MBJ A;  2E1M C;  5EDN A;  1IXS B;  1HKS A;  1ZGW A;  3DPT A;  2BY0 A;  3MKZ A;  5L3B A;  1X1P A;  1L3L A;  2XRO A;  1K6O A;  1FEX A;  2M3A A;  4LG0 A;  1W36 D;  4LIU A;  3B6A A;  3HRT A;  1GVD A;  1IV6 A;  3W2A A;  1JGS A;  4CYC B;  3CCL I;  5J47 A;  4YRV A;  3PQK A;  1IG7 A;  2DQL A;  2L7M P;  1ZN2 A;  2B7E A;  4KMF A;  1XGS A;  2PI0 A;  1ETY A;  3KP3 A;  4XNF A;  3RZO J;  3RQ4 A;  1G3S A;  1E3O C;  2CJJ A;  3RPU A;  2RQP A;  4M74 A;  1S5L C;  5LHG A;  1IRZ A;  2DCE A;  1T95 A;  2L2O A;  5CVU A;  1R6R A;  3EDP A;  3KLO A;  1QHG A;  3AG4 H;  2W48 A;  2X1C A;  5E3L A;  2E1C A;  1RES A;  3GWZ A;  4ITV A;  4N4O B;  1R1T A;  2HVQ A;  2A05 A;  5LHH A;  3S3M A;  1JE8 A;  3BCB A;  2EZH A;  3ZP5 A;  3WG7 H;  4CHU A;  1UMQ A;  2O61 A;  2CG4 A;  2H27 A;  2UWM A;  1D1C A;  2PFB A;  2E34 A;  1FSH A;  1EV7 A;  4B09 A;  2EPF A;  3LSJ A;  4HNT A;  5E1X A;  6PAX A;  3KEO A;  2WAQ A;  2AS5 F;  1S6L A;  1YG2 A;  2LR8 A;  2VBW A;  3LWF A;  4U0V A;  4EV0 A;  3WTY C;  1SVL A;  4MNU A;  4CXF A;  1BW5 A;  4NQW A;  1EA3 A;  1X1A A;  4YIR X;  1X58 A;  1LE8 A;  2O03 A;  2XB0 X;  3DCF A;  2QQ9 A;  2HTS A;  2W4S A;  3SDB A;  2P5K A;  4UUS B;  2RVC A;  5E17 F;  2IGM A;  1R22 A;  2W85 A;  3CD6 I;  2HPI A;  2KJC A;  4D0P A;  3JRB A;  2X85 A;  1MBG A;  5H2F C;  3BR0 A;  3RPQ A;  1E0E A;  4BE2 A;  3PJR A;  5HLG A;  3M07 A;  1DGW Y;  1ETO A;  2ZC2 A;  2HOE A;  4AWX B;  2KIM A;  4EMS A;  4K2E A;  1LUJ B;  1TLH B;  2HNH A;  3BC8 A;  5GAH J;  1QA6 A;  3K1N A;  1TWH J;  1H9G A;  4AIJ A;  1UHM A;  4HQE A;  2HXI A;  2UZK A;  1K79 A;  2A6H F;  1CGP A;  3KP2 A;  3CF2 A;  2HPM A;  1QZE A;  1IF1 A;  4ESF A;  2Y30 A;  4NC8 A;  1R71 A;  3BTI A;  3GF2 A;  1Q1H A;  2L9R A;  3BR2 A;  1BJA A;  2KIQ A;  2LMD A;  2W00 A;  4JX6 A;  2XKO A;  1WJC A;  3V7C A;  5JVG F;  1SEU A;  4OAZ A;  1O3S A;  4I99 C;  3OIP A;  2EZI A;  3IC7 A;  5HS8 A;  4XOR A;  2P5V A;  4O3M A;  1Y39 A;  2R7S A;  3JSO A;  4DZP A;  4AD9 A;  5EJC A;  1TTY A;  2VJI A;  4Y15 A;  3EUA A;  3OOP A;  1YJN I;  2DMN A;  2QSG X;  1ZAO A;  2LC2 A;  5C44 J;  3OYI A;  1YYV A;  2R93 J;  2NS0 A;  1Z3X A;  2PX9 A;  4P5O A;  4M9Z A;  2ACJ A;  4CZZ A;  3ZQH A;  5JR3 A;  1R4N B;  1H0M A;  3R0J A;  4PSW A;  2VT2 A;  1KYZ A;  4XON A;  2LY2 A;  3DV8 A;  3OS2 A;  3N4M A;  2NRA C;  3DF8 A;  3RYR A;  3OSF A;  1NH3 A;  4LIT A;  1WZ2 A;  2UXN A;  3SHF A;  2BBY A;  3BG3 A;  3FIW A;  2CQQ A;  3GZN B;  2E2J J;  5EF6 A;  4P9U A;  3Q9V A;  1Z67 A;  2DK5 A;  3E3V A;  3KP4 A;  1K4S A;  1IN6 A;  4M9S A;  2DMT A;  5FFZ A;  2MYS A;  3PIO F;  3DBR B;  1LEA A;  4IHX A;  3DTE A;  2L4M A;  5LEK A;  2EV0 A;  4A3C J;  2BYV E;  2Z3Y A;  3H3U A;  3GTO J;  3LSR A;  3MZH A;  3L2V A;  1HST A;  2D5V A;  4UV8 A;  4A3M J;  5A2Q K;  2DYR H;  2QQA A;  3CDI A;  5IYC J;  2HYJ A;  3MZY A;  4HDU A;  1U78 A;  1MBF A;  2JTV A;  1BOA A;  1CF7 B;  2PLY A;  4ZJZ A;  1YS7 A;  2DXI A;  1O57 A;  2CO5 A;  3CF5 F;  3PO2 J;  4XRM A;  3F21 A;  1LDK B;  2ISZ A;  2L9S A;  2LF7 A;  2MD0 A;  4RB1 A;  3EPZ A;  2JSP A;  2KQR A;  3VSL A;  1U5T B;  3DKY A;  2DT5 A;  4XKC A;  4PK4 A;  1TBX A;  4UB8 C;  2A6E F;  5M5Y J;  5J1Y A;  4U0W A;  1FTZ A;  2MH2 A;  2L5Q A;  4LB5 A;  1F36 A;  1LFB A;  3HPH A;  1USS A;  3QOP A;  1UG2 A;  2PJP A;  4JYK A;  2HU9 A;  1C0W A;  2WC2 A;  2NS8 A;  1YIT I;  4HX8 A;  4PZJ A;  2QUF A;  2QYO A;  2V9V A;  3BZC A;  3LOC A;  4JX5 A;  2L02 A;  4QIW N;  3GZ6 A;  2KZG A;  4HF2 A;  5DD8 A;  3VDX A;  5ICE A;  4BBS J;  2NVX J;  1X4O A;  4L18 B;  1BR1 A;  4QLC U;  4XOP A;  3I59 B;  4JP0 A;  1S7O A;  2L54 A;  1QPM A;  2QEN A;  5HOO A;  1KQ8 A;  2YU3 A;  4QTR A;  3I64 A;  2R7V A;  4CCJ A;  2FXA A;  2MLG A;  5ERI A;  5ILU A;  3S1M J;  3VPR A;  4A5N A;  4RM2 A;  1BC7 C;  3IH3 A;  2OUM A;  1VQO I;  4FX0 A;  1WRJ A;  3BDD A;  2Q0O A;  1MKM A;  1Z7U A;  4YEJ A;  3BR6 A;  4KA4 A;  4IHS A;  2HQN A;  1P4W A;  1JGG A;  3L2U A;  1N78 A;  4IF4 A;  2MA3 A;  2XHK A;  1UG0 A;  3KPH A;  4MHG A;  3CQZ J;  4A6D A;  2WA0 A;  4ANJ A;  1CF7 A;  1RUO A;  5GTH C;  2Y31 A;  1HBX G;  1MNM C;  2IJL A;  1R49 A;  4F92 B;  1TWA J;  2FJ1 A;  2HKX A;  2DFF A;  4P96 A;  2IXS A;  4II3 A;  4AVZ A;  5BOX A;  1SD5 A;  1U5T A;  1YIJ I;  3TDU C;  3HHH A;  1UZC A;  2GAU A;  4PJL A;  4BXU A;  1WFX A;  3GZ5 A;  2YPR A;  2XVC A;  3HBL A;  3IL2 A;  2ZSH B;  2P0W A;  1RI7 A;  3HIF A;  3ERM A;  3SZT A;  1X2N A;  4QSH A;  2EIJ H;  4BAC A;  3K4K A;  1OYY A;  1SFO J;  2W25 A;  1GV5 A;  1KQ9 A;  1TWF J;  1G2H A;  2QSF X;  1BR4 A;  4A2U A;  3JRG A;  3HTS B;  5F0C A;  1GV2 A;  2XGD A;  5FD5 A;  2WB1 A;  2VQG A;  3K9T A;  1LVA A;  3GLL A;  2Q1Z B;  1YOV B;  3RIR A;  2FF4 A;  2XAQ A;  2DA5 A;  1QZY A;  2R7D A;  4HV6 A;  5GAE J;  5BMZ A;  3Q9S A;  3LSK A;  2Q2E B;  4BY7 J;  4JK1 X;  2K7L A;  2DJI A;  5GAD J;  5J6X A;  3I4P A;  3J7A O;  1XCV A;  1PJR A;  2XF6 A;  3BR1 A;  2FEZ A;  4ESJ A;  4A3J J;  1W7P A;  2J5O A;  3K0L A;  1S29 A;  5BNG A;  3OWT A;  1ZG3 A;  5CVJ A;  5K7H A;  1NG7 A;  2X1E A;  1D5V A;  1BIB A;  4C30 A;  2LY9 A;  2L01 A;  3I58 A;  2DOE A;  4XSX F;  2XAG A;  1W0T A;  3OR2 C;  4BJ5 C;  1WWX A;  1D1A A;  3LSH A;  3JTH A;  4UUT A;  3DXJ F;  4IX7 A;  1IRX A;  1LFP A;  1I5Z A;  4AIK A;  1GVJ A;  2JN6 A;  3E97 A;  5E20 A;  5LBQ A;  2XGX A;  2MD5 A;  3SZG A;  4CDG A;  1WJD A;  3OSG A;  2XKP A;  3GCM A;  4O6J A;  2PMU A;  3FHN A;  2FBK A;  3F23 A;  4DOZ A;  3GW2 A;  4AUX A;  4KUM A;  4DYQ A;  4UV9 A;  1G3Y A;  1G3T A;  3TW7 A;  2D1H A;  3BZK A;  2JPC A;  5LFA A;  5K5R A;  3GX4 X;  3L1P A;  2V4J C;  3FHZ A;  4EEF G;  4RAZ A;  3GYH X;  3OS1 A;  1R9T J;  2FRH A;  3G3Z A;  2XB5 A;  2HDC A;  2PMZ N;  1HCR A;  3G4S I;  2BW3 B;  4PUS A;  1LDJ A;  5HNF A;  2CW8 A;  2HOT A;  5BPD A;  2Q2E A;  5K7F A;  2IBD A;  1XGM A;  2FQ3 A;  4OWR B;  4DBQ A;  2VI6 A;  3H9Q A;  4BNC A;  2O7O A;  2TRT A;  3GFL A;  3S1Q J;  2DA6 A;  1CQT A;  3FBN B;  3K70 D;  5FO5 A;  3SQN A;  4MO7 A;  3MQ0 A;  1X3W B;  4CCN A;  4ZYD A;  3T1B A;  4Z6Y A;  3ZMD A;  4B44 A;  3CUO A;  1ODD A;  4M6X A;  4GDF A;  3PSI A;  4IKF A;  4CCL A;  2V7F A;  3V7S A;  1MMA A;  4UUV A;  5DUI A;  3PQJ A;  2JPB A;  2LTP A;  3NAR A;  3KIO A;  5FB2 A;  3GFM A;  5JVT A;  2H8R A;  2IA1 A;  3F8C A;  2VQC A;  3WU0 A;  3NQO A;  2VE8 A;  2Z16 A;  2OD5 A;  2FQ4 A;  2ZCW A;  4M6V A;  2EFN A;  1VZ0 A;  4E7S A;  1J09 A;  4B3A A;  3K4N A;  1I39 A;  1W0U A;  2GBY A;  2J5P A;  1T98 A;  2AXL A;  4YFK F;  4E7L A;  5E18 F;  4UXN A;  4IHY A;  5FKK A;  2DYS H;  2JSC A;  4JQF A;  3SFZ A;  3BG5 A;  4G6Q A;  3CZ6 A;  4Q5S F;  2CW7 A;  1HA8 A;  2K9S A;  1T39 A;  5L3F A;  1FMW A;  3CCS I;  2MC3 A;  3L9F A;  3J7Z I;  1MGT A;  2VOO A;  3FM5 A;  1P92 A;  3TL4 X;  2FD5 A;  2DOD A;  4A3G J;  1IDY A;  2F48 A;  2DPU A;  5F27 A;  2ZKZ A;  3CMM A;  1JI8 A;  1J0R A;  5K5O A;  1WSU A;  4FAS D;  4AC0 A;  2M2E A;  4G94 A;  1A04 A;  1X1D A;  1FOK A;  5F6F A;  1XGN A;  1F4K A;  1LNW A;  4RLQ A;  5FFX A;  2PEX A;  5DCM B;  4PSX A;  4OMZ A;  4FIS A;  1GDT A;  3TOA A;  2F2E A;  2ZJR F;  2DA1 A;  3S17 J;  4F7Z A;  4GGG A;  4RGU A;  3H3Z A;  3F8B A;  1L0O C;  2FU4 A;  3KEQ A;  2FSW A;  4ZDL A;  4IRG A;  1ZRF A;  1JKP C;  3ZMV A;  3CP8 A;  3VYR B;  5IOZ A;  4RB2 C;  2QCO A;  1TC3 C;  4IL6 C;  1XS9 A;  4B1R A;  1KU7 A;  2E5N A;  1PUF B;  4YIF A;  2A5Y B;  3OV8 A;  3TP3 A;  2CS3 A;  4RGX A;  4DGW B;  2QZ8 A;  5IT9 K;  5E3O A;  4I98 B;  3NWS A;  2HXO A;  2YR2 A;  3JRA A;  3S1R J;  1VQL I;  2STW A;  3AG3 H;  1BW6 A;  4L9J A;  4F55 A;  3BG7 A;  5D6E A;  2A3S A;  4UVA A;  5D5W B;  2ESN A;  3T8T A;  2W84 A;  4WXH A;  4XLP F;  2LRD A;  4I76 A;  4KIC A;  4BQO A;  4A3K J;  1K78 B;  3PL8 A;  1ACI A;  3WTS C;  4IOC F;  3KP6 A;  4FX4 A;  3P7N A;  2BY3 A;  4M72 A;  4L9T A;  1VQ8 I;  3A01 A;  1D0Z A;  2RAE A;  2AQE A;  4F52 A;  3AG1 H;  4G7H F;  2RV8 A;  1HC8 A;  1AKH B;  3H5R A;  3WTT C;  1S9H A;  1T56 A;  3H5N A;  4XLA A;  1PP8 F;  3QPS A;  2DMU A;  1EF4 A;  3RJP A;  3DKX A;  1FOW A;  1VQ5 I;  3KP7 A;  2DT7 B;  2K86 A;  4IEJ A;  1RKT A;  4NNJ A;  5D8L B;  2X1D A;  1KYW A;  2VJ4 A;  3HOX J;  2G7U A;  2IVM A;  4D7M A;  3SZP A;  4PJ0 C;  5IT3 A;  3I53 A;  2UXX A;  1N77 A;  4E7I A;  3MKL A;  2XAJ A;  1SFK A;  4FTH A;  3K69 A;  1Z1D A;  5KHD A;  4RAF A;  3TO6 A;  1FYK A;  4ZTF A;  2E7W A;  3DKW A;  2JUG A;  2EIL H;  1O3Q A;  4Z2Y A;  5H20 A;  4G12 A;  2EWN A;  2HVS A;  1LEB A;  2EBI A;  1ERD A;  3VWB A;  3LQQ A;  2EV5 A;  2JVG A;  5HS9 A;  5IYD J;  2R4G A;  2H94 A;  1GHC A;  4BAY A;  1K78 A;  3CMA I;  3WGG A;  3CP2 A;  3EQL F;  5DM7 F;  4A3F J;  2HYF A;  1Z77 A;  1BI3 A;  1Y8Q B;  2KIU A;  3FXM A;  1RR8 C;  2R7R A;  2I5U A;  3FF5 A;  4LLN A;  3BG9 A;  3KZI C;  4W1U A;  4D5C A;  2K9M A;  2NVU B;  3OIQ A;  3D1N I;  1R7J A;  3CCQ I;  1YHQ I;  4A0Z A;  3F8M A;  1DQU A;  2PQ8 A;  2DMQ A;  2WBM A;  4N9I A;  2R5Y A;  2ELH A;  1K4T A;  1YX3 A;  1B59 A;  2LKS A;  4U7B A;  2IAI A;  1AKH A;  5DCF A;  3KZZ A;  2M87 A;  1IUY A;  3N05 A;  1EH6 A;  2GXA A;  1HW5 A;  3RSN A;  2VKV A;  2K4J A;  5FKO A;  3CO6 C;  1V3F A;  1ZGJ A;  2F5F A;  1SVO A;  1XSX A;  1Z21 A;  4C2M J;  4UVB A;  2F5V A;  2IGO A;  3G6E I;  1D8K A;  1FJL A;  1YJW I;  2RN7 A;  4YFN F;  1OMI A;  3V8J A;  2LF8 A;  2DI3 A;  3IUO A;  1RNL A;  1PP7 U;  3I3L A;  1U8R A;  4A3I J;  2X6O A;  1T6S A;  2Z2S B;  5DV5 A;  1LFU P;  1TQI A;  2KIF A;  1HDD C;  1MW7 A;  2H1K A;  4AYB N;  2HDW A;  2O5R A;  5JLX A;  3EYI A;  4C2U A;  2VOD A;  4ZDO A;  5J4V A;  2VBZ A;  1BL0 A;  1QZZ A;  3PNT A;  3CLO A;  2GOX B;  4RAG A;  5CVI A;  2OU2 A;  1SVM A;  2VOP A;  1ONV A;  2L9N A;  2KRH A;  2DFH A;  1XMX A;  1KA8 A;  4I0B A;  1XTA A;  2HQ5 A;  2XPW A;  3WTV C;  3PUB A;  4I2O A;  3ZPL A;  4HQM A;  4LK1 F;  5M3F J;  2K40 A;  4Y13 A;  3OYH A;  3Q3S A;  1JUP A;  1YS6 A;  4CCO A;  4FCY A;  2VQL A;  4OOI A;  2D2W A;  2EFQ A;  4HW0 A;  3RDI A;  3WU1 B;  4HDV A;  3K7A J;  1FYL A;  3TDZ C;  1OYW A;  2XDV A;  3VOD A;  3ZQI A;  4KIF A;  3AL0 C;  3RCO A;  5DD4 A;  1X2M A;  3BPV A;  3K10 A;  1D3Y A;  1ON2 A;  2VAS A;  3ZCO A;  3K1M A;  3A0B C;  2DA7 A;  1IUF A;  1MMD A;  1JJ6 C;  3S15 J;  2JMW A;  1QHH D;  1JTX A;  4CSW A;  3M4O J;  3QAH A;  4YEL A;  1E2X A;  1FBQ A;  2ID6 A;  1OCP A;  3TP0 A;  3CTA A;  1JUS A;  1SAN A;  4IXA A;  4L0Y B;  1Z05 A;  3TW6 A;  3K2Z A;  2ZXI A;  2VC0 A;  2CV0 A;  4V19 K;  3LFK A;  1SC7 A;  5GPA A;  1MMN A;  5DTD A;  2XPU A;  4MFD A;  2RC4 A;  4L9V A;  5K1Y A;  2IGK A;  5LGU A;  1VQN I;  2QQB A;  3V7R A;  3QYB A;  3JAM K;  1TT0 A;  4RB3 C;  4A3D J;  3IP4 B;  1TWG J;  3OYD A;  3ZMS A;  3L09 A;  1XSD A;  2IS6 A;  1ZRE A;  4HYE A;  3JSP A;  5J8C A;  5HLH A;  1B8I B;  4HRI A;  1Q1V A;  2ZJ2 A;  2NVY J;  3OYL A;  1FIA A;  3K4J A;  2HOA A;  2PBI A;  3FDY A;  3F72 A;  3DEE A;  3ELK A;  2LK2 A;  4CYC A;  4ENK A;  3JRE A;  1XC5 A;  4JBA A;  2V6E A;  2HZD A;  4RAY A;  1UHS A;  4B3X A;  3IKV A;  3MAJ A;  3C1D A;  3SEQ A;  4XKB A;  1MND A;  2E60 A;  2CUJ A;  4E7J A;  1RET A;  4OIN F;  2PJR B;  4R79 A;  2MG4 A;  3DPU A;  3HRS A;  4BQN A;  3KP5 A;  3PUF A;  3GEZ A;  3BPX A;  2A61 A;  3FXU A;  3V8L A;  4BQA A;  1R5I D;  5DM6 F;  3F0C A;  1YW8 A;  2EIK H;  2XC7 A;  2E35 A;  3MKY B;  4RM3 A;  5ICG A;  2OTJ I;  2V6C A;  1I3Q J;  1POG A;  3D5S C;  5TRD A;  4OU0 A;  3IRR A;  2EIN H;  3OYC A;  2FNA A;  2K9N A;  1FT9 A;  2KP6 A;  3FIS A;  3GLX A;  1U8B A;  3M8J A;  2LH9 A;  4HV5 A;  4PJJ A;  3HOU J;  1DP7 P;  3I5U A;  4ENJ A;  1RRJ A;  3LNQ A;  1X4P A;  3F3X A;  5LGT A;  3UNG C;  1T8I A;  2V1N A;  2ESH A;  4UUS A;  3V8K A;  1ON1 A;  3E6D A;  2M0C A;  2X6W A;  1W4M A;  3BP8 A;  1B8I A;  4OIO F;  1MZB A;  1K83 J;  1KGS A;  1LDD A;  1WGX A;  2WAD A;  3P9I A;  2P7C B;  2ID3 A;  2YS9 A;  3RI4 A;  2BY1 A;  3FXQ A;  2KIS A;  2VPR A;  5IY5 H;  2OCC H;  4Q48 A;  1IAW A;  2OPT A;  2TCT A;  1IC8 A;  3ECH A;  1WVR A;  3RKX A;  3DTK A;  1JTY A;  1IZ1 A;  2W1O A;  3A0H C;  4EM0 B;  1T2K A;  2PJR A;  5GPC A;  1MBE A;  3QP5 A;  1NG6 A;  1PDN C;  3LFU A;  2M1B A;  1ZKG A;  5FLM J;  4A12 A;  3ZGK A;  3LA2 A;  5GAG J;  5C4X J;  4N4N B;  1UCR A;  3ZMZ A;  2P6S A;  2VT3 A;  2HYG D;  2G0E A;  5HNH A;  3DQV C;  4X0G A;  5IT9 Z;  4QWQ A;  1LQ1 A;  1Y0N A;  1W5S A;  1DP3 A;  2MAB A;  3J7Y J;  1FP2 A;  1FTT A;  2XRN A;  1WH5 A;  1WI9 A;  2O8X A;  5CQE A;  1YQA A;  3CES A;  3RKQ A;  5H6R A;  4BKX A;  2C6Y A;  2ZXW H;  2ECC A;  1XG1 A;  2Y0S N;  2GIV A;  3ULQ B;  2OF7 A;  3ZQF A;  4D7N A;  4UNO A;  1X1B A;  4XRS G;  4WK8 F;  3TO7 A;  2E1O A;  3FMQ A;  2JWT A;  3S93 A;  1AA7 A;  4GFB A;  3CJT B;  3RPU D;  2LD5 A;  2DA2 A;  4I02 A;  3F6V A;  2VB6 A;  5FRO A;  1P2F A;  2KL4 A;  2IT0 A;  4M9X A;  1R5G A;  3P9C A;  4RGR A;  2LG4 A;  2XAS A;  4HG2 A;  1G4D A;  4GCV A;  5D5V B;  3Q0W A;  1O7L A;  3BRO A;  4R8H A;  5EEH A;  3HM5 A;  1BR2 A;  5D5X B;  3W2W A;  1WJE A;  3BG6 A;  1WHU A;  2OAZ A;  4M3B A;  1J75 A;  4WF2 A;  2ZME B;  2VBX A;  1XSV A;  2EFO A;  2KZV A;  3D5R C;  3HC7 A;  5HS7 A;  2GQQ A;  3ASN H;  2M7B A;  3OYN A;  3I0T A;  4XL9 A;  3TQN A;  4BDY A;  1T08 B;  3CCU I;  4HX7 A;  2DK8 A;  5CJ9 A;  2ZB9 A;  4LD5 A;  3FXL A;  4DW6 A;  1U5T C;  2R7W A;  2L4A A;  2CU7 A;  1P4A A;  3BT9 A;  2GZW A;  1NK2 P;  3X2Q H;  2F4M B;  2HFH A;  1YRN B;  5AIP A;  5EG0 B;  5HVQ C;  2MW8 A;  2DDB A;  1FNN A;  3DWL E;  2GA1 A;  4WX9 A;  4GYG A;  4BY1 J;  2EQR A;  3JRI A;  2EB7 A;  3JRD A;  2L9V A;  3K1P A;  4IOA F;  1YW7 A;  2GXB A;  1VQM I;  4RBO A;  2QSH X;  2HS5 A;  1OIS A;  3ZQQ A;  4JX4 A;  5LRR A;  1JJ8 C;  2KHM A;  1BJZ A;  5DEQ A;  4HA8 A;  3U1D A;  3ML6 A;  4BQQ A;  1E3P A;  4BE0 A;  9ANT A;  4PJN A;  1HDP A;  1SAU A;  2CV1 A;  1FZP B;  2BHY A;  4L9N A;  3W6K B;  2A07 F;  4ETS A;  3W6V A;  5FRN A;  4A6E A;  4M3F A;  4EJW A;  5CVR A;  1EH8 A;  1WH7 A;  1OPC A;  1RR7 A;  4Q47 A;  3T5X A;  3AAF A;  2DT6 A;  5E8I A;  4OIQ F;  1EJ9 A;  2ZME A;  3I59 A;  2HTJ A;  3HPG A;  3CO7 C;  1MNE A;  1XN7 A;  3CUQ B;  3G1O A;  4HOB A;  4LK0 F;  1QU3 A;  4KT5 C;  4HLY A;  2XV4 S;  1MSE C;  5EGO B;  4NUB A;  4XSZ F;  4XLE A;  2JQ7 A;  2JA8 J;  1JHH A;  3ABM H;  4KDP A;  3J80 K;  1F1Z A;  4MQV A;  1VND A;  5KVR A;  3GTQ J;  4G7O F;  4PJM A;  1Y56 A;  2VPL A;  1BIA A;  4KNY A;  1Z6T A;  4EJO A;  3BQY A;  2R5Z B;  1Y0U A;  4AVP A;  1YX5 A;  2QKM B;  3HJE A;  4D5F A;  2NVQ J;  2ELJ A;  3BY6 A;  3WTZ A;  3EET A;  1MSF C;  2Y9Z A;  5C4J J;  2JRM A;  2Y0S A;  2DW4 A;  4O5V A;  2X9D A;  1B1B A;  1MJB A;  1QRY A;  1XMK A;  2VXD A;  4DYR A;  1TZL A;  3VOE A;  4PFO A;  2OA4 A;  1ZRC A;  2HVR A;  1IO2 A;  3O6B B;  1R4M B;  3HG9 A;  1A5J A;  1R1U A;  3K2A A;  4BH9 A;  5KCM A;  3OYF A;  1XX5 A;  2E71 A;  5JI6 A;  4XKW A;  4ZDP A;  1GUU A;  5LHI A;  1ENH A;  3BZ6 A;  3ISP A;  3I54 A;  2AO9 A;  3QOE A;  1I6X A;  1U9N A;  4ON0 A;  2X0L A;  3WE3 A;  1S3J A;  3GFI A;  1I50 J;  3ZMT A;  1ZEL A;  3L7W A;  1B6A A;  1UB9 A;  4CIC A;  2CV2 A;  2K3F A;  2GLO A;  3KZY A;  2OZU A;  1BN5 A;  3OMY A;  1GT0 C;  1QPI A;  1IW7 F;  3CUQ A;  2NOJ B;  1WPK A;  3DBH B;  1HF0 A;  5EGO A;  4HSR A;  4XQF A;  2K9L A;  1DPR A;  3ZQG A;  3WTW C;  3MKW B;  5HDN A;  2KPM A;  3E0J B;  5AIQ A;  5J8F A;  1HXD A;  4P1W A;  4IQJ A;  2D45 A;  1HSJ A;  1IXR C;  3G71 I;  2FMY A;  3PO3 J;  2CFX A;  3FKI J;  3C7J A;  1RUN A;  3V42 A;  4DJA A;  3I56 I;  4IJA A;  3JAM Z;  3U21 A;  5M3M J;  3JRH A;  3EUH C;  1D8J A;  1FLI A;  4FT8 A;  1H8A C;  3ZMU A;  2A69 F;  2VKD A;  1ZGA A;  1TWC J;  4FQG A;  3S8P A;  4BHB A;  1ZAR A;  2CUZ A;  2ELK A;  4Y4R A;  4XRS A;  2RKH A;  4YFX F;  5FJ8 J;  3K6G A;  3SDG A;  3HHG A;  3CJR B;  3DU6 A;  2B9S A;  2X4H A;  1Z91 A;  2K9Q A;  3MFK A;  3P9K A;  3W6J B;  5BPI A;  3EUH A;  2JK3 A;  4FE4 A;  5IP6 A;  3CCY A;  4B4C A;  2E7X A;  3BOQ A;  5B66 C;  1B72 B;  1TNS A;  2G7H A;  2Y9Y A;  3NWT A;  1MD0 A;  3KLN A;  3H0G J;  4EJV A;  4FHT A;  3CJQ B;  2JA2 A;  2O0Y A;  3Q0U A;  5F1R A;  3FK7 A;  4EQQ A;  4XMY A;  2FBH A;  2NVT J;  2P4W A;  1OJL A;  2A6T A;  2DAO A;  4WXD A;  1ETX A;  2IEK A;  1SAX A;  2IGN A;  4HAM A;  2K85 A;  2FOW A;  3BLY A;  2BW3 A;  2K3P A;  4XOT A;  2A5W A;  1Z9C A;  5TIS C;  1IXC A;  3S2D J;  1P7I A;  2LP0 A;  2HQA A;  2L3D A;  2LKX A;  1IV8 A;  2E1N A;  4GXO A;  3FWE A;  4S04 A;  1HKT A;  4IZZ A;  2GXG A;  3DP7 A;  1MJA A;  2XUB A;  2BXY A;  2CUF A;  3HOZ J;  4RS8 A;  1QNT A;  2LY1 A;  4XM3 A;  1U0J A;  1IRG A;  4WCG A;  4ABZ A;  3ASO H;  2P6T A;  3I9V 2;  1MJ9 A;  4BS9 A;  3WGH A;  1ZTR A;  1XB4 A;  4ZTJ A;  3IWF A;  2G9W A;  2VKH A;  1OYI A;  1R00 A;  1NK3 P;  2BOL A;  4UY8 I;  5LD2 C;  4KMU X;  3G2B A;  2QLZ A;  1IN7 A;  2QEX I;  4NHJ A;  1I1S A;  1KU2 A;  1WJF A;  4MTD A;  2CRG A;  1ULY A;  3CLQ A;  2VC1 A;  2DPD A;  1UEL B;  4RLF A;  4BJ6 C;  5HLT A;  4XK4 A;  1W7P D;  3FXR A;  2M4K A;  3AKZ A;  2CMP A;  5GP9 A;  1UAA A;  4DZJ A;  5BQT A;  5FLX K;  1R23 A;  1U9O A;  4CZC A;  1A6Q A;  3H92 A;  3PFY A;  4DQ2 A;  2H8W A;  2CQ7 A;  5A2Q Z;  4LB6 B;  1P7J A;  2PMZ A;  3QU6 A;  3PM1 A;  2F5D A;  1A35 A;  4ZYA A;  4EJU A;  4XLF A;  2XSD C;  4A5M A;  3SEZ A;  4XR6 A;  5B5E C;  1JHF A;  3M1C A;  3DEW A;  4B48 A;  3PIP F;  1J59 A;  1I27 A;  5ED4 A;  1KON A;  1UFM A;  2ZJQ F;  3H36 A;  1ZK8 A;  5DCM A;  4I6Z A;  3FX3 A;  1ZR4 A;  1XD7 A;  3QQA A;  1BC8 C;  2JZY A;  4KIG A;  1XPX A;  3O3K A;  3VYU B;  1WQ2 A;  2DDA A;  2F4O B;  3CDH A;  2E5Z A;  4A0X A;  3BTL A;  4MEX F;  2BY2 A;  2W57 A;  5EEG A;  1NTC A;  4KN4 X;  2JUC A;  3A03 A;  1DU0 A;  3S3N A;  4BU2 A;  4ENN A;  4JOM A;  5KAI C;  4S05 A;  4FE7 A;  1YO5 C;  1EH7 A;  1TW2 A;  2FUG 2;  3HXL A;  4LLG F;  4MQ9 F;  1PUF A;  3K4L A;  3C2H A;  1SFU A;  3OYA A;  1WJ5 A;  5E79 C;  4EGY A;  3C3W A;  5C3E J;  5L3C A;  1V54 H;  1TP4 A;  1RZ4 A;  2LSO A;  3O8H A;  2R92 J;  1JT6 A;  3UKG A;  1XDS A;  1UHW A;  2OV7 A;  4BDZ A;  1NHA A;  2MSY A;  3ZOB A;  3LSG A;  2FNP A;  4HF1 A;  2CQX A;  3CMY A;  1I1G A;  3GBG A;  4J19 A;  1DUX C;  1OLT A;  5FRM A;  2WAQ N;  2X51 A;  5CPR B;  1E17 A;  2X48 A;  3M7G A;  1D0X A;  3QWL A;  1WCM J;  2IS2 A;  2BGC A;  4HST A;  4PCQ A;  2WV0 A;  4NB5 A;  2BE5 F;  2XAH A;  1OCC H;  3MVP A;  1U6G A;  2QWW A;  3VYT B;  4Q4Z F;  1V5E A;  2IA0 A;  3FBI B;  1Y1V J;  1FWZ A;  2ZJP F;  4ZZL A;  2M30 A;  3IAM 2;  2EFW A;  3I71 A;  3RKY A;  2ADU A;  3KE2 A;  2I10 A;  3HGG A;  3BTJ A;  3CCV I;  1T0F A;  1VQK I;  4DNC A;  1B4A A;  4Y52 J;  5K5Q A;  1F5T A;  2OQR A;  4CCM A;  3HUG B;  3B6C A;  4C3I J;  1VFC A;  2E1M B;  5B3S H;  3G1L A;  2V1D A;  1LB2 A;  4MGR A;  4N9H A;  1JT0 A;  1WKM A;  1ETV A;  3GTG J;  1I6H J;  1XGO A;  2Z9O A;  3C18 A;  3FZV A;  2GM4 A;  5KK1 A;  2R3S A;  3WHB A;  3SYT A;  1IN8 A;  4HNU A;  4TV7 A;  3ZQL A;  5J1R A;  2CQK A;  3ESW B;  2LYC A;  3PNY A;  4LG3 A;  2R7Q A;  5EEA A;  3N97 A;  2V1X A;  2CUE A;  2EZK A;  1O3T A;  5JHF A;  3DLA A;  1I3A A;  2M7A A;  1HOM A;  2NNY A;  1LPQ A;  3E6C C;  4BE1 A;  1OCT C;  4ZZD A;  2P7V B;  4NQW B;  4HZF A;  2H09 A;  2H6B A;  2OCE A;  2QA4 I;  3OY9 A;  5HDK A;  1QO0 D;  2P5L C;  3HYI A;  3J81 K;  2CWE A;  2IP2 A;  4BGD A;  4GRI A;  3MMY B;  2W24 A;  4QPQ A;  3GTL J;  4M73 A;  4IHV A;  2IPQ X;  2PN6 A;  1Y8R B;  1J2X A;  2AQF A;  2XIG A;  2O9L A;  1DGR M;  2QQ8 A;  1U3E M;  3I4N J;  2QGU A;  1H9T A;  3L2Q A;  4FET A;  3HUG A;  3KFW X;  2ZXH A;  3MCZ A;  1T33 A;  1YIO A;  4HX4 A;  4HEA 2;  1JXS A;  3L2R A;  1GXP A;  1IGN A;  4LOC A;  2QBY B;  3VFZ A;  3F6O A;  3UR3 C;  2COM A;  5D5U B;  5KAF C;  2CW0 F;  1FSE A;  1OQY A;  5E3M A;  4RMN A;  5JFR A;  3H0D A;  3LA3 A;  2YU9 J;  3FMR A;  2VIX A;  3H5A A;  4I09 A;  4A3L J;  3LMM A;  1A6I A;  1SD4 A;  1FBU A;  2V79 A;  2Y69 H;  3GUD A;  3QU3 A;  4PGH A;  3LL7 A;  2H1L A;  5ILS A;  2V9P A;  2Z33 A;  5D8K B;  1G6N A;  2OC6 A;  2F4I A;  3O8G A;  4I0A A;  3ZR8 X;  5CKT A;  3HSE A;  4M71 A;  5HOD A;  4IPA A;  2EK5 A;  4I01 A;  1ZHF A;  1ZLJ A;  2E36 A;  4PGG A;  4NC7 A;  1VQ4 I;  1FBS A;  1WJB A;  3HL2 A;  4E7K A;  4BHP A;  2E2H J;  1O7F A;  3E5Q A;  3WOD F;  2R7F A;  2WY7 Q;  1DU6 A;  4LMY A;  2DOA A;  4N0B A;  4ASN A;  4KIS A;  4A0Y A;  3IHU A;  3DU5 A;  5F04 A;  2MLK A;  2VLA A;  2XRL A;  3GTJ J;  1GXQ A;  2Y48 A;  3ZRG A;  2EA2 A;  4LLL A;  1XCB A;  2JT1 A;  3OYB A;  3DLL F;  2F5E A;  1J7K A;  2F6C A;  5CYV A;  3R6S A;  4V2G A;  4G6T B;  4AID A;  4DYC A;  3HOT A;  1ITY A;  5K7Z A;  4G6D A;  2ZNZ A;  2QBY A;  1LJ9 A;  4J00 A;  3NEU A;  2KKO A;  1ZLK A;  4IHW A;  4AU7 A;  2ECB A;  3VB2 A;  2OBP A;  4CUG A;  3J7A Y;  1OCZ H;  1SD7 A;  1BI0 A;  4AM3 A;  5FKM A;  4M3G A;  3ABU A;  1AU7 A;  4S0H B;  2VBY A;  4AYB A;  4C3H J;  4CYD A;  2N8G A;  4RB0 A;  3T8R A;  2L7K A;  5FD6 A;  1Z7L A;  2KJB A;  3GO5 A;  3HRU A;  2O8K A;  4WWC A;  2DOF A;  5EZH A;  3E7L A;  5FGM A;  4E6K G;  3QPT A;  3EUK L;  2RNJ A;  5AON A;  1LVK A;  2GA2 A;  5M5X J;  3HB9 A;  2XGC A;  3GTP J;  2RGV A;  3DTI A;  1S8N A;  2V26 A;  3IH2 A;  3Q5F A;  1FC3 A;  4KYW A;  2FE3 A;  4LGW A;  3H3V K;  3VSK A;  1YE9 A;  4F91 B;  1D0Y A;  2ICW G;  5TJJ A;  4E4H A;  3B02 A;  3H35 A;  1TT5 B;  2VN2 A;  5JHU A;  2L7Z A;  3D5L A;  4ZH4 F;  3S2H J;  2LDU A;  3GFJ A;  2LVS A;  4RGS A;  4IHT A;  5H6Q A;  4HF0 A;  4G8X A;  2FA5 A;  1SD6 A;  5D6F A;  2JA5 J;  2CYY A;  1KQ0 A;  4CA0 A;  3A2K A;  2ZSI B;  4NBQ A;  2WB1 N;  1ZQ3 P;  4LFU A;  1W5T A;  3E6M A;  3HOS A;  3QPL A;  2M8E A;  1RC9 A;  4OIR F;  3KET A;  3W3C A;  3F8F A;  1TQM A;  4A69 C;  2UV1 A;  4BXX J;  3LSP A;  3RTR A;  2WY8 Q;  2Z1D A;  5E1W A;  5FLX Z;  1YTY A;  2IRF G;  1HKQ A;  3MEX A;  3A1Y A;  1V5G A;  3RYP A;  2EFP A;  3OYK A;  3JRF A;  1QQI A;  2GOM A;  2LOO A;  1YI2 I;  5L3G A;  3WU2 C;  1XMA A;  1STZ A;  3REO A;  2STT A;  2EJR A;  1Z3Y A;  3M8E A;  3WHC A;  5J4Y A;  3HOY J;  4H4K C;  2W82 A;  4HLX A;  4C9Y A;  4J01 A;  1DDN A;  3LA7 A;  3K70 C;  2YX4 A;  1VQ6 I;  3BWG A;  3E5U A;  3LST A;  3DBL B;  5F64 A;  2KRF A;  2RQQ A;  3QRF F;  2QF7 A;  2HR3 A;  2DJN A;  3DPL C;  2V1U A;  1B9M A;  4CGZ A;  4II2 A;  4Y33 A;  4EJT A;  2NOG A;  4LJZ F;  5J40 A;  3K4C A;  4UHT A;  4BL0 B;  4BHC A;  2B63 J;  3HGY A;  5BS6 A;  1A36 A;  1ORK A;  2FML A;  2A68 F;  1A31 A;  5IPA A;  1FOY A;  5IOY A;  4P9F A;  2DTZ A;  1KU3 A;  1TQP A;  5EYR A;  3WTU C;  5IP7 J;  4LIV A;  2HEO A;  3SFI A;  1YW9 A;  3S2W A;  1YJ9 I;  3BTC A;  1Y6I A;  2OQG A;  3FM3 A;  1JUM A;  3F8N A;  2LKP A;  3LAJ A;  4L5I A;  2CQN A;  2IS1 A;  2OZ6 A;  3HEF A;  4BEH B;  5GTI C;  4B47 A;  4EM1 A;  3M8F A;  5LGN A;  4U87 A;  4UVC A;  5B1B H;  4XLC A;  5B1A H;  5DYM A;  5LLQ A;  3HSF A;  2AHQ A;  2ZME C;  4WXC A;  1W7P B;  2JJ7 A;  5CVV A;  2ZBK A;  1AHD P;  2P81 A;  1IDZ A;  2L7F P;  5F0F A;  4D1Q A;  1Z0X A;  5J1U A;  1MBK A;  2P8T A;  2O6G E;  1WI3 A;  3HRM A;  2ISY A;  4W97 A;  1MH4 A;  2PMH A;  2X6Y A;  3ABK H;  2DFI A;  1O3R A;  1UST A;  2WAF A;  5CQG A;  5E3N A;  1OR7 C;  3BJO A;  1XDU A;  3TBI A;  4E7H A;  4B8X A;  1U2W A;  1UJ8 A;  2BXZ A;  2D1V A;  2DN0 A;  3CJN A;  1FP1 D;  1R1V A;  2JRT A;  5CLS A;  2VON A;  3WG9 A;  3LAP A;  1VQ9 I;  4MFE A;  2DMP A;  3E1S A;  3ZXS A;  3H9J A;  2HDD A;  4C2T A;  2WAE A;  1TL8 A;  4ZYG A;  3FXJ A;  2L0K A;  5DDG A;  1X3U A;  1ZG5 A;  1OR7 A;  4X6A J;  2VUM J;  5TGT A;  3B73 A;  3GVA A;  1YRN A;  3U9G A;  3IWZ A;  1QVU A;  5EG0 A;  1SFX A;  4ZC3 A;  5D4R A;  2M34 A;  2VL8 A;  2ZO4 A;  2VQH A;  2XGE A;  2YSR A;  2MGQ A;  2WV1 A;  3HSR A;  4BEH A;  4MTE A;  3WGI A;  3PFI A;  1MDM B;  2XAU A;  4XKV A;  1F9N A;  4U88 A;  5LRS A;  3RZD J;  3K4B A;  3E6B A;  3QYF A;  4M6Y A;  3CC2 I;  1MMG A;  3IH4 A;  4EAT A;  4MIM A;  2H6C A;  4OMY A;  1ETW A;  1X19 A;  3LSM A;  4Y17 A;  5LEJ A;  3CUQ C;  1BBY A;  3OYG A;  4BXF A;  3R61 A;  4U0Y A;  1K7A A;  1MH3 A;  4CH7 A;  1EKE A;  1K6Y A;  3J81 Z;  2CGP A;  3BR3 A;  3FMS A;  3CCJ I;  3ERE D;  4KIB A;  3OR1 C;  2BEO A;  4A3B J;  1W5C C;  3HKZ N;  4IRH A;  1S7E A;  5IP9 J;  2ZNY A;  3CC4 I;  1V5F A;  2DQR A;  3QPH A;  4Y7N J;  1N75 A;  2QVO A;  2BV6 A;  4G7Z F;  2Z99 A;  4L0Z B;  4IVN A;  2EA4 A;  1RKW A;  2LBF B;  2R7O A;  3NAU A;  4G9Y A;  2NYX A; 
#chains in the Genus database with same CATH homology
 2DTR A;  4YG2 F;  2WTE A;  4ZYE A;  3R0A A;  2DU9 A;  2WWY A;  4P55 A;  1SMY F;  4BYY A;  3ZN1 A;  3SXY A;  4HBL A;  5HLI A;  1P4X A;  3ECO A;  1IN4 A;  3JW4 A;  4EVI A;  1R36 A;  1MDM A;  2ETH A;  3V4G A;  4OIP F;  2LNB A;  4EGZ A;  4XRF A;  2NAZ A;  1HW2 A;  3IRQ A;  2M45 A;  3TOB A;  5ICC A;  2ZFW A;  1FPQ A;  3HTU A;  2O3F A;  3R60 A;  2IA2 A;  2ZXJ A;  3ZN0 A;  5L3D A;  1T38 A;  4ENM A;  4GYI A;  1J5Y A;  2Y0M A;  3T0Y A;  1HQC A;  4CO8 A;  2HGC A;  2HQR A;  3M9A A;  4E70 A;  1QGP A;  3O2P E;  2NNN A;  1R5H A;  2Y75 A;  1FYM A;  3G73 A;  5ICF A;  1SMT A;  1HW1 A;  5E1Z B;  5L3E A;  2QM3 A;  1ZYR F;  5HDG A;  2CSO A;  3LQR A;  2EV6 A;  2HWV A;  2DO7 A;  3U2R A;  4PDK A;  1FY7 A;  1TNT A;  1IRF A;  2VE9 A;  2FBI A;  2TDX A;  3JTG A;  1B9N A;  2PG4 A;  1REP C;  2HZT A;  3R4K A;  1ZH5 A;  1BI1 A;  1Z6R A;  2Z5U A;  3VEP A;  3ROU A;  3DFG A;  2K4B A;  4ZYH A;  3F22 A;  2XAF A;  3TO9 A;  3GXO A;  2K02 A;  4EM2 A;  4I7H A;  2GWR A;  1P6R A;  4XBF A;  3WTX C;  3BJ6 A;  2YX7 A;  4KN7 X;  3RKW A;  1YFH A;  1OKR A;  3KCC A;  5E8G A;  2Q8K A;  2B0L A;  1SFE A;  1PUE E;  3ABT A;  2DBB A;  3M1E A;  2FOK A;  2MH9 A;  2M5W A;  3D0S A;  1AWC A;  4AIH A;  4H0E A;  4U7D A;  1V4R A;  2VXZ A;  3QP6 A;  1ZG1 A;  3L2C A;  4ESB A;  3ZQ7 A;  1J9I A;  4YII A;  4L5J A;  3DEU A;  1ZRD A;  1IN5 A;  2RDP A;  1G3W A;  1QBJ A;  3COA C;  5ILV A;  1DPU A;  4LG0 B;  2HKO A;  3L00 A;  2IW5 A;  3E5X A;  1RIO H;  1BM9 A;  3MWM A;  1R58 A;  3TGN A;  3NRV A;  4KFC A;  5DUK A;  4MEY F;  1TW3 A;  2F5C A;  4XLN F;  3WE2 A;  3TKY A;  2MBF A;  4R1H A;  4GO1 A;  5D4S A;  1YLF A;  1AOY A;  3IKT A;  1S7A A;  3J80 Z;  2K27 A;  1BI2 A;  2DLL A;  1VTN C;  1KU9 A;  3BJA A;  4IRI A;  3EYY A;  1FX7 A;  1IXS B;  1HKS A;  3DPT A;  5L3B A;  1L3L A;  2XRO A;  1K6O A;  4LG0 A;  3HRT A;  1JGS A;  3PQK A;  2DQL A;  1ZN2 A;  4KMF A;  1XGS A;  2PI0 A;  3KP3 A;  1G3S A;  3RPU A;  2RQP A;  4M74 A;  5LHG A;  5CVU A;  3EDP A;  3KLO A;  2E1C A;  3GWZ A;  1R1T A;  5LHH A;  1JE8 A;  3ZP5 A;  4CHU A;  2O61 A;  2CG4 A;  2H27 A;  2UWM A;  2PFB A;  1FSH A;  1EV7 A;  4B09 A;  5E1X A;  6PAX A;  3KEO A;  2AS5 F;  1S6L A;  1YG2 A;  2VBW A;  3LWF A;  4U0V A;  4EV0 A;  3WTY C;  4MNU A;  4CXF A;  4NQW A;  2O03 A;  2QQ9 A;  2HTS A;  2P5K A;  2RVC A;  5E17 F;  1R22 A;  2W85 A;  2KJC A;  4D0P A;  3RPQ A;  5HLG A;  2HOE A;  4AWX B;  2KIM A;  4EMS A;  4K2E A;  1TLH B;  3K1N A;  1H9G A;  4AIJ A;  1UHM A;  4HQE A;  2UZK A;  1K79 A;  2A6H F;  1CGP A;  3KP2 A;  1IF1 A;  4ESF A;  3GF2 A;  1Q1H A;  1BJA A;  2XKO A;  3V7C A;  1O3S A;  3IC7 A;  5HS8 A;  2P5V A;  4O3M A;  3JSO A;  4AD9 A;  1TTY A;  4Y15 A;  3OOP A;  1ZAO A;  1YYV A;  2NS0 A;  4P5O A;  4M9Z A;  2ACJ A;  4CZZ A;  5JR3 A;  1H0M A;  3R0J A;  2VT2 A;  1KYZ A;  3DV8 A;  3N4M A;  2NRA C;  3DF8 A;  3RYR A;  2UXN A;  3SHF A;  2BBY A;  4P9U A;  3Q9V A;  2DK5 A;  3E3V A;  3KP4 A;  1IN6 A;  4M9S A;  5FFZ A;  1LEA A;  2L4M A;  5LEK A;  2EV0 A;  2BYV E;  2Z3Y A;  3H3U A;  3MZH A;  1HST A;  4UV8 A;  5A2Q K;  2QQA A;  4HDU A;  3MZY A;  1U78 A;  2JTV A;  1BOA A;  1CF7 B;  2PLY A;  1YS7 A;  1O57 A;  2CO5 A;  3F21 A;  1LDK B;  2ISZ A;  2LF7 A;  4RB1 A;  1U5T B;  2DT5 A;  1TBX A;  2A6E F;  4U0W A;  2MH2 A;  4LB5 A;  1USS A;  3QOP A;  2PJP A;  1C0W A;  2WC2 A;  4HX8 A;  4PZJ A;  2QUF A;  2QYO A;  2V9V A;  3GZ6 A;  2L02 A;  4HF2 A;  5DD8 A;  5ICE A;  4L18 B;  4QLC U;  3I59 B;  1S7O A;  2L54 A;  1QPM A;  2QEN A;  5HOO A;  1KQ8 A;  2YU3 A;  3I64 A;  5ILU A;  2FXA A;  2MLG A;  5ERI A;  4A5N A;  1BC7 C;  4FX0 A;  1WRJ A;  3BDD A;  2Q0O A;  1MKM A;  1Z7U A;  4IHS A;  4KA4 A;  2HQN A;  1P4W A;  4IF4 A;  2MA3 A;  2XHK A;  4A6D A;  4MHG A;  1CF7 A;  1RUO A;  1HBX G;  2IJL A;  2HKX A;  4P96 A;  5BOX A;  1SD5 A;  1U5T A;  3TDU C;  3HHH A;  2GAU A;  4BXU A;  3GZ5 A;  2YPR A;  2XVC A;  3IL2 A;  1RI7 A;  3HIF A;  3SZT A;  1OYY A;  2W25 A;  1KQ9 A;  4A2U A;  3HTS B;  5FD5 A;  3K9T A;  1LVA A;  3RIR A;  2FF4 A;  2XAQ A;  1QZY A;  2R7D A;  4HV6 A;  5BMZ A;  3Q9S A;  5J6X A;  3J7A O;  4JK1 X;  2K7L A;  3I4P A;  1XCV A;  2FEZ A;  4ESJ A;  1W7P A;  2J5O A;  3K0L A;  1S29 A;  1ZG3 A;  5CVJ A;  1D5V A;  1BIB A;  2L01 A;  3I58 A;  4XSX F;  2XAG A;  1WWX A;  3JTH A;  3DXJ F;  1I5Z A;  4AIK A;  1GVJ A;  3E97 A;  5E20 A;  5LBQ A;  2XGX A;  2MD5 A;  4CDG A;  2XKP A;  4O6J A;  2PMU A;  2FBK A;  3F23 A;  3GW2 A;  4KUM A;  4UV9 A;  1G3Y A;  1G3T A;  2D1H A;  2JPC A;  5K5R A;  3GX4 X;  3FHZ A;  4RAZ A;  3GYH X;  2FRH A;  3G3Z A;  2HDC A;  1LDJ A;  5BPD A;  2Q2E A;  1XGM A;  2FQ3 A;  4BNC A;  3GFL A;  5FO5 A;  3SQN A;  3MQ0 A;  4ZYD A;  3T1B A;  3ZMD A;  3CUO A;  1ODD A;  4M6X A;  3V7S A;  4UUV A;  5DUI A;  3PQJ A;  2JPB A;  5FB2 A;  3GFM A;  5JVT A;  2IA1 A;  3F8C A;  3WU0 A;  3NQO A;  2VE8 A;  2OD5 A;  2ZCW A;  2EFN A;  2J5P A;  1T98 A;  2AXL A;  4YFK F;  5E18 F;  4UXN A;  2JSC A;  4JQF A;  3SFZ A;  4G6Q A;  4Q5S F;  1T39 A;  5L3F A;  2MC3 A;  3L9F A;  1MGT A;  2VOO A;  3FM5 A;  1P92 A;  2DPU A;  2ZKZ A;  1J0R A;  5K5O A;  1WSU A;  4G94 A;  1A04 A;  1FOK A;  5F6F A;  1XGN A;  1F4K A;  1LNW A;  5FFX A;  2PEX A;  5DCM B;  4OMZ A;  3TOA A;  2F2E A;  4F7Z A;  4GGG A;  4RGU A;  3H3Z A;  3F8B A;  1L0O C;  2FU4 A;  3KEQ A;  2FSW A;  4IRG A;  1ZRF A;  3ZMV A;  4RB2 C;  1KU7 A;  4YIF A;  2A5Y B;  3OV8 A;  4RGX A;  2QZ8 A;  5IT9 K;  4I98 B;  2YR2 A;  2STW A;  4L9J A;  5D6E A;  2A3S A;  4UVA A;  5D5W B;  2ESN A;  3T8T A;  2W84 A;  4WXH A;  4XLP F;  4KIC A;  1K78 B;  3WTS C;  3KP6 A;  4FX4 A;  3P7N A;  4M72 A;  4L9T A;  4G7H F;  2RV8 A;  3WTT C;  1PP8 F;  3RJP A;  3KP7 A;  2K86 A;  5D8L B;  1KYW A;  2G7U A;  2IVM A;  3SZP A;  5IT3 A;  3I53 A;  2UXX A;  2XAJ A;  3K69 A;  1Z1D A;  3TO6 A;  1FYK A;  2E7W A;  3DKW A;  1O3Q A;  4Z2Y A;  5H20 A;  2EWN A;  1LEB A;  3LQQ A;  2EV5 A;  5HS9 A;  2H94 A;  1GHC A;  4BAY A;  1K78 A;  3WGG A;  3EQL F;  2HYF A;  1BI3 A;  2KIU A;  3FF5 A;  4LLN A;  1R7J A;  4A0Z A;  3F8M A;  2PQ8 A;  4N9I A;  2ELH A;  1B59 A;  4U7B A;  5DCF A;  3KZZ A;  2M87 A;  1IUY A;  1EH6 A;  1HW5 A;  2K4J A;  3CO6 C;  1V3F A;  1ZGJ A;  2F5F A;  1XSX A;  4UVB A;  1D8K A;  2RN7 A;  4YFN F;  1OMI A;  3V8J A;  2LF8 A;  2DI3 A;  1RNL A;  1PP7 U;  1U8R A;  1T6S A;  5DV5 A;  1TQI A;  2KIF A;  3EYI A;  2VOD A;  2VBZ A;  1QZZ A;  3CLO A;  5CVI A;  2OU2 A;  2VOP A;  1ONV A;  1KA8 A;  4I0B A;  3WTV C;  4I2O A;  3ZPL A;  4HQM A;  4LK1 F;  4Y13 A;  1YS6 A;  4OOI A;  2D2W A;  2EFQ A;  4HW0 A;  3RDI A;  3WU1 B;  4HDV A;  1FYL A;  3TDZ C;  1OYW A;  3VOD A;  4KIF A;  5DD4 A;  3BPV A;  1D3Y A;  1ON2 A;  3K1M A;  3QAH A;  1E2X A;  1FBQ A;  3CTA A;  4L0Y B;  4IXA A;  1Z05 A;  3K2Z A;  2VC0 A;  3LFK A;  2RC4 A;  4L9V A;  5K1Y A;  5LGU A;  2QQB A;  3V7R A;  4RB3 C;  3JAM K;  3ZMS A;  3L09 A;  1XSD A;  1ZRE A;  4HYE A;  3JSP A;  5J8C A;  5HLH A;  2ZJ2 A;  2PBI A;  3F72 A;  3ELK A;  4ENK A;  4JBA A;  4RAY A;  3IKV A;  3MAJ A;  3C1D A;  4OIN F;  4R79 A;  3HRS A;  3KP5 A;  3GEZ A;  3BPX A;  2A61 A;  3FXU A;  3V8L A;  4BQA A;  1YW8 A;  5ICG A;  2V6C A;  5TRD A;  4OU0 A;  3IRR A;  2FNA A;  1FT9 A;  3GLX A;  4HV5 A;  1DP7 P;  3I5U A;  4ENJ A;  3F3X A;  5LGT A;  2ESH A;  3V8K A;  1ON1 A;  3E6D A;  1W4M A;  3BP8 A;  4OIO F;  1MZB A;  1KGS A;  1LDD A;  3P9I A;  2P7C B;  3RI4 A;  3FXQ A;  4Q48 A;  1IAW A;  3ECH A;  3RKX A;  1IZ1 A;  4EM0 B;  1T2K A;  3QP5 A;  1PDN C;  2M1B A;  4A12 A;  3LA2 A;  1UCR A;  3ZMZ A;  2P6S A;  2VT3 A;  2HYG D;  5IT9 Z;  3DQV C;  4QWQ A;  1LQ1 A;  1W5S A;  1FP2 A;  2XRN A;  2O8X A;  1WI9 A;  1YQA A;  5H6R A;  2C6Y A;  3ULQ B;  2GIV A;  4UNO A;  4WK8 F;  3TO7 A;  3FMQ A;  4I02 A;  3F6V A;  1P2F A;  2IT0 A;  4M9X A;  1R5G A;  3P9C A;  4RGR A;  2XAS A;  1G4D A;  4GCV A;  5D5V B;  1O7L A;  3BRO A;  4R8H A;  5EEH A;  5D5X B;  2OAZ A;  1J75 A;  4WF2 A;  2ZME B;  2VBX A;  1XSV A;  2EFO A;  5HS7 A;  2GQQ A;  3I0T A;  3TQN A;  4HX7 A;  2DK8 A;  5CJ9 A;  4LD5 A;  1U5T C;  2L4A A;  1P4A A;  2GZW A;  2HFH A;  5AIP A;  5HVQ C;  1FNN A;  2GA1 A;  4WX9 A;  4GYG A;  2EB7 A;  3K1P A;  1YW7 A;  2GXB A;  2HS5 A;  5LRR A;  5DEQ A;  4HA8 A;  3U1D A;  3ML6 A;  1FZP B;  4L9N A;  3W6K B;  2A07 F;  4ETS A;  4A6E A;  4EJW A;  5CVR A;  1EH8 A;  1OPC A;  4Q47 A;  3T5X A;  3AAF A;  5E8I A;  4OIQ F;  2ZME A;  3I59 A;  2HTJ A;  3CO7 C;  1XN7 A;  3CUQ B;  4HOB A;  4LK0 F;  4KT5 C;  4HLY A;  2XV4 S;  4XSZ F;  1JHH A;  4KDP A;  3J80 K;  1F1Z A;  4MQV A;  5KVR A;  4G7O F;  1BIA A;  4KNY A;  1Z6T A;  4EJO A;  1Y0U A;  4AVP A;  3BY6 A;  3WTZ A;  3EET A;  2DW4 A;  4O5V A;  1B1B A;  1MJB A;  1XMK A;  3VOE A;  2OA4 A;  1ZRC A;  3O6B B;  1R1U A;  4BH9 A;  5JI6 A;  5LHI A;  3BZ6 A;  3ISP A;  3I54 A;  1I6X A;  3WE3 A;  4ON0 A;  2X0L A;  1S3J A;  3GFI A;  3ZMT A;  3L7W A;  1B6A A;  1UB9 A;  4CIC A;  3KZY A;  2OZU A;  1BN5 A;  1IW7 F;  3CUQ A;  3WTW C;  1DPR A;  5HDN A;  5AIQ A;  5J8F A;  1HXD A;  2D45 A;  1HSJ A;  1IXR C;  2FMY A;  2CFX A;  3C7J A;  1RUN A;  4IJA A;  3JAM Z;  1D8J A;  1FLI A;  4FT8 A;  3ZMU A;  2A69 F;  1ZGA A;  4BHB A;  1ZAR A;  2RKH A;  4YFX F;  3HHG A;  2X4H A;  1Z91 A;  3MFK A;  3P9K A;  3W6J B;  5BPI A;  3EUH A;  2E7X A;  3BOQ A;  1TNS A;  2G7H A;  1MD0 A;  3KLN A;  4EJV A;  4FHT A;  2O0Y A;  5F1R A;  4EQQ A;  2FBH A;  2P4W A;  2DAO A;  4WXD A;  1SAX A;  4HAM A;  1Z9C A;  1IXC A;  2L3D A;  2E1N A;  4GXO A;  3FWE A;  4S04 A;  1HKT A;  2GXG A;  3DP7 A;  1MJA A;  2XUB A;  4RS8 A;  1QNT A;  1IRG A;  4WCG A;  2P6T A;  1MJ9 A;  3WGH A;  1XB4 A;  3IWF A;  2G9W A;  1OYI A;  1R00 A;  4KMU X;  2QLZ A;  1IN7 A;  4NHJ A;  1I1S A;  1KU2 A;  4MTD A;  1ULY A;  2VC1 A;  2DPD A;  1W7P D;  3FXR A;  5BQT A;  5FLX K;  1R23 A;  4DQ2 A;  3H92 A;  5A2Q Z;  4LB6 B;  3QU6 A;  2F5D A;  4EJU A;  4A5M A;  1JHF A;  1J59 A;  1I27 A;  5ED4 A;  1UFM A;  5DCM A;  3FX3 A;  1XD7 A;  1BC8 C;  2JZY A;  4KIG A;  3O3K A;  1WQ2 A;  4A0X A;  3CDH A;  4MEX F;  2W57 A;  5EEG A;  4KN4 X;  4ENN A;  4S05 A;  1YO5 C;  1EH7 A;  1TW2 A;  4LLG F;  4MQ9 F;  1SFU A;  4EGY A;  3C3W A;  5L3C A;  1RZ4 A;  2LSO A;  1XDS A;  1UHW A;  1NHA A;  2FNP A;  4HF1 A;  1I1G A;  1DUX C;  1E17 A;  3M7G A;  2BGC A;  4PCQ A;  2WV0 A;  4NB5 A;  2BE5 F;  2XAH A;  1U6G A;  2QWW A;  4Q4Z F;  2IA0 A;  1FWZ A;  4ZZL A;  2M30 A;  2EFW A;  3I71 A;  3RKY A;  2ADU A;  3KE2 A;  1T0F A;  4DNC A;  1B4A A;  5K5Q A;  1F5T A;  2OQR A;  2V1D A;  1LB2 A;  4MGR A;  4N9H A;  1WKM A;  1XGO A;  2Z9O A;  3C18 A;  3FZV A;  5KK1 A;  2R3S A;  1IN8 A;  4TV7 A;  2CQK A;  3N97 A;  2V1X A;  1O3T A;  2NNY A;  3E6C C;  4ZZD A;  2P7V B;  4HZF A;  2H09 A;  2H6B A;  5HDK A;  1QO0 D;  2P5L C;  3HYI A;  3J81 K;  2CWE A;  2IP2 A;  2W24 A;  4M73 A;  2IPQ X;  2PN6 A;  1J2X A;  2XIG A;  1U3E M;  1H9T A;  3HUG A;  3KFW X;  3MCZ A;  1YIO A;  4HX4 A;  1JXS A;  1GXP A;  2QBY B;  3VFZ A;  3F6O A;  2COM A;  5D5U B;  2CW0 F;  1FSE A;  5JFR A;  3LA3 A;  3FMR A;  4I09 A;  4PGH A;  1SD4 A;  1FBU A;  2V79 A;  3QU3 A;  3GUD A;  5ILS A;  2Z33 A;  5D8K B;  1G6N A;  4I0A A;  3HSE A;  4M71 A;  4IPA A;  2EK5 A;  4I01 A;  1ZHF A;  1ZLJ A;  4PGG A;  1FBS A;  4BHP A;  1O7F A;  3E5Q A;  3WOD F;  2R7F A;  4LMY A;  4N0B A;  4ASN A;  4A0Y A;  3IHU A;  2MLK A;  1GXQ A;  2Y48 A;  2EA2 A;  4LLL A;  1XCB A;  2JT1 A;  2F5E A;  1J7K A;  5CYV A;  3R6S A;  3HOT A;  4G6D A;  2ZNZ A;  2QBY A;  1LJ9 A;  3NEU A;  2KKO A;  1ZLK A;  3VB2 A;  2OBP A;  1SD7 A;  1BI0 A;  3ABU A;  2VBY A;  4CYD A;  4RB0 A;  3T8R A;  5FD6 A;  2KJB A;  3GO5 A;  3HRU A;  4WWC A;  5FGM A;  3QPT A;  2RNJ A;  5AON A;  2GA2 A;  2RGV A;  1S8N A;  3Q5F A;  1FC3 A;  4KYW A;  2FE3 A;  4LGW A;  5TJJ A;  3B02 A;  2VN2 A;  5JHU A;  3D5L A;  4ZH4 F;  2LDU A;  3GFJ A;  4RGS A;  4IHT A;  5H6Q A;  4HF0 A;  4G8X A;  2FA5 A;  1SD6 A;  5D6F A;  2CYY A;  1KQ0 A;  4LFU A;  1W5T A;  3E6M A;  3HOS A;  2M8E A;  4OIR F;  3KET A;  3F8F A;  1TQM A;  3RTR A;  5E1W A;  5FLX Z;  1YTY A;  2IRF G;  1HKQ A;  3MEX A;  3RYP A;  2EFP A;  1QQI A;  5L3G A;  1XMA A;  1STZ A;  3REO A;  2STT A;  2EJR A;  3M8E A;  4HLX A;  1DDN A;  3LA7 A;  2YX4 A;  3BWG A;  3E5U A;  3LST A;  5F64 A;  2KRF A;  3QRF F;  2HR3 A;  3DPL C;  2V1U A;  1B9M A;  4CGZ A;  4EJT A;  4LJZ F;  4UHT A;  4BHC A;  5BS6 A;  2FML A;  2A68 F;  4P9F A;  1KU3 A;  1TQP A;  3WTU C;  2HEO A;  1YW9 A;  3S2W A;  2OQG A;  3FM3 A;  3F8N A;  2LKP A;  3LAJ A;  4L5I A;  2OZ6 A;  4EM1 A;  3M8F A;  5LGN A;  4UVC A;  5DYM A;  5LLQ A;  3HSF A;  4WXC A;  1W7P B;  5CVV A;  2ZBK A;  2P8T A;  2O6G E;  3HRM A;  2ISY A;  2PMH A;  2DFI A;  1O3R A;  1UST A;  3BJO A;  1XDU A;  4B8X A;  1U2W A;  3CJN A;  2D1V A;  1FP1 D;  1R1V A;  2JRT A;  5CLS A;  2VON A;  3WG9 A;  3LAP A;  4ZYG A;  5DDG A;  1X3U A;  1ZG5 A;  1OR7 A;  3B73 A;  3GVA A;  3U9G A;  3IWZ A;  1SFX A;  5D4R A;  2ZO4 A;  2YSR A;  3HSR A;  4MTE A;  3WGI A;  3PFI A;  1MDM B;  1F9N A;  4U88 A;  5LRS A;  3E6B A;  4M6Y A;  2H6C A;  4OMY A;  4Y17 A;  5LEJ A;  3CUQ C;  1BBY A;  3R61 A;  4U0Y A;  1K7A A;  3J81 Z;  2CGP A;  3FMS A;  3ERE D;  4KIB A;  2BEO A;  4IRH A;  2ZNY A;  2DQR A;  3QPH A;  2QVO A;  2BV6 A;  4G7Z F;  2Z99 A;  4L0Z B;  4IVN A;  2EA4 A;  4G9Y A;  2NYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...