3VODA

Crystal structure of mutant marr c80s from e.coli
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
136
structure length
136
Chain Sequence
b'NEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRCAACITPVELKKVLSVDLGALTRMLDRLVSKGWVERLPNPNDKRGVLVKLTTGGAAICEQCHQLVGQDLHQELTKNLTADEVATLEYLLKKVLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multiple antibiotic resistance protein marR
publication title The multiple antibiotic resistance regulator MarR is a copper sensor in Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 40
structure length 136
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3vodA00
3K2ZA 1XGOA 3K1MA 2ETHA 2MLGA 4Y15A 2K7LA 4ENKA 4L5JA 1S6LA 1I6XA 4XLNF 5ICEA 4LFUA 1MZBA 3AAFA 5LGNA 3C3WA 1G3YA 3I53A 3QAHA 1TBXA 2LSOA 3WTUC 1TNSA 3ISPA 2FEZA 1IXCA 3U9GA 1P4XA 1ZRDA 3HIFA 3F3XA 5CYVA 3ABUA 1FNNA 1AWCA 5J6XA 2FBIA 2GXGA 1MKMA 2GWRA 3JTGA 5LEJA 1KU3A 4AIKA 3M1EA 1SD4A 1O3QA 4HA8A 3BDDA 4HX8A 2EFWA 2RV8A 2PG4A 1ZYRF 3L7WA 3J81Z 2IJLA 4EJOA 1FWZA 4ESFA 3LSTA 1KQ9A 1JXSA 3KEOA 3FHZA 5H6QA 4LD5A 2QWWA 4M73A 2A69F 2CFXA 2FF4A 4RGSA 4HDVA 4KA4A 1W7PA 4UNOA 3WTXC 1QBJA 2VOPA 4GO1A 2STTA 4P9FA 2PI0A 2HS5A 3DP7A 5K5OA 5ERIA 3M8EA 2XAHA 4HX7A 4UV8A 5ICCA 5FFZA 4PDKA 2NNNA 4HF2A 1J0RA 4EMSA 1QGPA 4KYWA 2VXZA 1ZARA 3WGIA 2VBWA 2IA1A 2RDPA 1S29A 3MZHA 2PBIA 1OYIA 4ETSA 5EEHA 1U2WA 3C18A 1G4DA 1R1VA 3JAMZ 4OMZA 2VODA 2NYXA 3HOSA 2OU2A 1O3RA 2HQRA 5DCMB 5HVQC 2EB7A 1J9IA 3GW2A 1P92A 3DFGA 1P4WA 1BN5A 4UVCA 1T2KA 3I58A 2EK5A 5K1YA 2C6YA 3RYPA 3HYIA 1IXSB 4E70A 4B8XA 3WTZA 2EA4A 3JSOA 2W85A 5L3GA 1J5YA 3ECHA 2XAGA 3IWFA 2FMLA 2D2WA 5E1XA 3LA2A 3TGNA 2MD5A 4O5VA 5DDGA 1K78B 4HV5A 4GYIA 2O6GE 1B9MA 5AIQA 1OMIA 3DF8A 5LRRA 3T5XA 1CF7B 1BM9A 2W25A 1XSVA 4QWQA 2P8TA 2KJCA 2PEXA 4AD9A 4OIPF 2QENA 1GXPA 3KZYA 2ZNYA 4M72A 4OMYA 1Q1HA 1R5HA 1KYWA 4H0EA 5JFRA 5CJ9A 5AONA 3CUQA 5DV5A 2DLLA 1BI2A 1OKRA 1XMKA 3ZN1A 5H6RA 1LEBA 4L9TA 5CVUA 3BOQA 3V4GA 1B4AA 4RS8A 3BJ6A 1LJ9A 3TDUC 3WTYC 4BHPA 3LAPA 3KE2A 1ZLJA 2RGVA 2CWEA 5LLQA 1IUYA 1JE8A 2RKHA 3KEQA 3N4MA 1JHHA 3T8RA 3F8FA 2CW0F 2XRNA 2K4JA 4BYYA 3CJNA 4MQVA 3I59B 3QU6A 5HDNA 1KU9A 2O8XA 3T0YA 1STZA 2RC4A 3TQNA 2ADUA 4CICA 2PMUA 3KLOA 3K1NA 1UHWA 3J7AO 4A0YA 3EUHA 3DQVC 5H20A 1TTYA 2GIVA 3KZZA 2V9VA 4NQWA 2FQ3A 2QBYA 4Q47A 2VC1A 1IN7A 3HRUA 2ZMEB 3KP3A 1T6SA 2M1BA 1JGSA 3DPLC 3SQNA 1B9NA 1XCBA 1Y0UA 4BQAA 4A2UA 4UUVA 1G6NA 4A12A 5BPDA 1Z7UA 1O3TA 2MC3A 3K0LA 1TW2A 4CYDA 2FXAA 3CO7C 1Z6TA 1BBYA 2BBYA 1H0MA 4LB6B 3I71A 2P4WA 5F1RA 3RKWA 3CUQC 3WE2A 1REPC 1T38A 1LQ1A 1XGSA 3VB2A 2YX4A 1KGSA 4I7HA 1S8NA 2STWA 4IPAA 3IC7A 4F7ZA 2HQNA 2V1UA 1L0OC 2DW4A 5BOXA 3H3UA 1FYLA 3RI4A 5EEGA 1ZH5A 3E5UA 1UCRA 1FSHA 1IN5A 4NB5A 1IW7F 2KKOA 2UXNA 2EFNA 4KN7X 2J5OA 3JSPA 1D3YA 1D5VA 2IP2A 4U0VA 1C0WA 3TO6A 1IRGA 1UB9A 3G3ZA 4I02A 4LLNA 1D8KA 5ICGA 4G6QA 4M9SA 4KIGA 5F64A 1ZHFA 4A0ZA 5D4RA 1HBXG 1YW7A 4G8XA 2O0YA 4DQ2A 3ABTA 4IHSA 3HHGA 3LA3A 2J5PA 3R61A 4OOIA 1S7OA 5CVJA 4KUMA 4BH9A 2CYYA 2E1CA 5L3FA 4RGRA 5FO5A 1MGTA 3JAMK 2R7FA 1ON1A 3EQLF 5DYMA 1F4KA 5D8LB 5LBQA 1SFEA 1XMAA 1SD5A 1U5TB 1FX7A 2O03A 4U7BA 1KU7A 2RVCA 2OA4A 1TNTA 1ONVA 2BEOA 1I27A 2K4BA 1BI0A 4R79A 3LQRA 5A2QZ 1DDNA 1KU2A 1BC7C 2G7HA 5LEKA 2H09A 3BPXA 3GUDA 3KLNA 3FWEA 2Z5UA 3HRSA 2JRTA 4WWCA 3RTRA 4RB0A 2FOKA 4YFXF 4HLYA 1HW2A 3JTHA 5DCFA 4AIJA 4LMYA 1LDDA 3OV8A 5AIPA 3KETA 2DI3A 4CGZA 4ZYGA 3KP5A 1V3FA 2Y48A 4HYEA 2ISYA 4XBFA 2EV6A 4I0AA 1ODDA 3WODF 3TO7A 3GFLA 3FM3A 3D5LA 5JHUA 3L09A 5CVIA 4HLXA 3ELKA 5D6EA 4HW0A 2DQRA 3F21A 4ZZLA 1EH6A 3L9FA 3VEPA 4I09A 4GCVA 2M30A 5FD6A 4S05A 2MH9A 3IRQA 3IRRA 3ML6A 3P7NA 4IHTA 3MAJA 4EM2A 2ZBKA 1LVAA 3I0TA 3KP2A 3IKTA 2YR2A 1XCVA 2DPDA 2NRAC 3I54A 1T98A 1DUXC 4M6YA 3ZMUA 1LDJA 3DEUA 3O2PE 3NEUA 3DV8A 5HS9A 3DXJF 4R8HA 4HDUA 2V6CA 1WWXA 2D1VA 3F72A 2DK8A 4M74A 5DEQA 2ESNA 1MJAA 3RDIA 4ZZDA 4FX0A 2F5FA 1TW3A 4P5OA 3GX4X 3BY6A 2XV4S 1J75A 1B6AA 1EH7A 1O7LA 1S7AA 4YFKF 4LLGF 4EJTA 3BWGA 3T8TA 1IRFA 2XROA 3GFJA 1PP7U 5DD8A 3NRVA 4FHTA 2L3DA 3KP6A 4L18B 3FM5A 4BXUA 4ZYEA 1ZGAA 1FBUA 3J80Z 2H27A 2F5DA 1U8RA 2R3SA 1X3UA 4UV9A 4ENMA 3I64A 3PQKA 4IRHA 1FZPB 5ED4A 1USSA 1VTNC 4WXHA 1SFXA 1MD0A 5TRDA 2RNJA 3V8JA 2OQGA 1G3SA 3R0JA 4A0XA 4Z2YA 2ZCWA 1ZREA 3HSFA 5DUIA 2DK5A 5BPIA 4L9JA 1ON2A 1XSXA 1FP2A 4RGXA 4P9UA 1K6OA 4BNCA 5DUKA 5DCMA 4KIBA 2HYGD 4MNUA 5LHIA 1FYKA 3TO9A 3MZYA 4D0PA 1BOAA 3GZ5A 3TOAA 1RUNA 3FX3A 5JI6A 4MTEA 1PP8F 4OIOF 2DQLA 2E7XA 1GVJA 1IZ1A 2GQQA 2BE5F 2HGCA 4YFNF 2IA0A 1IN6A 2AXLA 5HLIA 4HAMA 2OZ6A 2H6CA 4XLPF 2MBFA 1NHAA 2OD5A 3E6DA 3LWFA 1K78A 1H9GA 1IN4A 1FYMA 1MDMB 4UHTA 2XHKA 2CO5A 5IT3A 2KIFA 4MEXF 2EA2A 2P7CB 3EETA 1YW8A 4I2OA 4HQMA 5ILSA 4IJAA 3C1DA 3CLOA 5E8GA 5D5VB 1R36A 1YYVA 1HSTA 2V1XA 4JK1X 3V8LA 1A04A 3O3KA 2EV0A 1W4MA 4HOBA 1F9NA 3TKYA 3LAJA 4ON0A 3WTWC 4HQEA 2ZO4A 1QQIA 2GA1A 1B59A 2ZJ2A 4AWXB 1ZRCA 4A6EA 2Y75A 3FMSA 4XSXF 1ZN2A 1IAWA 1CGPA 4L0YB 3L00A 1YQAA 2JPCA 4GGGA 1SAXA 4EJVA 2LDUA 1MJ9A 2HEOA 1QPMA 3I59A 4KMFA 2PQ8A 1P4AA 2K86A 4I98B 4DNCA 1DP7P 2IPQX 2BYVE 5ILUA 2UWMA 3Q9SA 2V79A 3QP6A 5JR3A 2Q0OA 3F8BA 2M8EA 1G3WA 2K27A 2KIMA 4JBAA 2JTVA 3WE3A 1IXRC 2ZMEA 1HSJA 4KIFA 4BHCA 2M87A 4O6JA 1SMTA 2JPBA 1SFUA 4G9YA 2F5EA 2FE3A 1Z9CA 2MH2A 3FMRA 2MLKA 5FGMA 5E1WA 4RAZA 3E6MA 5D8KB 5FLXZ 3F23A 1S3JA 1SMYF 2EFOA 1FP1D 3E5QA 3ECOA 4R1HA 2G9WA 4ENNA 3ERED 3F8CA 4KDPA 4LG0B 4N9HA 4Q4ZF 3E97A 3C7JA 2BGCA 1HQCA 4KN4X 3TDZC 2ACJA 3H92A 1OYYA 3IL2A 3WU0A 4EGYA 2A3SA 2GA2A 2X0LA 1OR7A 2P5LC 4JQFA 2VBZA 2ZKZA 1J7KA 4IRGA 3SZTA 3RPUA 3WGGA 1R1UA 3EYYA 3J81K 4YG2F 2HWVA 2VBYA 2TDXA 2XAQA 3R4KA 3LA7A 4Y13A 2QQBA 1YS7A 3J80K 2XKPA 3IWZA 1WQ2A 4M6XA 4IF4A 2OBPA 5DD4A 5ICFA 5D4SA 5E17F 2FSWA 3KP4A 1PDNC 2E1NA 5BS6A 3QP5A 2O3FA 4PZJA 3DPTA 3GWZA 3K9TA 2WTEA 2FA5A 1XN7A 3V7RA 3RIRA 3Q5FA 2UZKA 3GFIA 1YIOA 5CVVA 1O57A 1FT9A 1XSDA 2VBXA 4RGUA 2RQPA 4YIFA 3V7SA 2ZXJA 2XAFA 3CUOA 2HZTA 3QU3A 3VODA 1FPQA 1TQPA 4N0BA 1HW1A 2L4MA 3RJPA 3QPTA 4CZZA 4ASNA 3RKXA 4G94A 3ZP5A 3B73A 1U5TA 3HTUA 1W5SA 1R22A 2IVMA 3K69A 4KICA 3CDHA 3P9CA 3Q9VA 5K5QA 2EFQA 1QZZA 4RB2C 3FXUA 5HLGA 1BI1A 1K7AA 4WK8F 2B0LA 4ZH4F 4G7HF 3IHUA 5FFXA 3F8MA 4I0BA 2JSCA 2LKPA 4CHUA 2QQAA 1RI7A 4XRFA 1ZG1A 1O3SA 4MHGA 3MWMA 2UXXA 4Q5SF 1XGMA 2GXBA 2NNYA 3L2CA 1AOYA 1O7FA 2VE8A 2VN2A 4HF1A 3GVAA 3HRMA 3F22A 3IKVA 2XIGA 2XVCA 2A61A 4CO8A 4YIIA 1FBSA 1TQMA 3MQ0A 2EFPA 4HBLA 1F1ZA 3ZMTA 1BI3A 1YG2A 2W24A 3OOPA 5HDGA 3GFMA 3JW4A 3WGHA 2HDCA 1HKTA 3ULQB 4LLLA 2M5WA 1HW5A 1ZLKA 1QO0D 2FNAA 1KA8A 2Z3YA 1T0FA 2V1DA 4P96A 2H6BA 4MEYF 4KMUX 4L0ZB 1LDKB 3P9IA 2OQRA 2HTJA 1U5TC 2PMHA 3PQJA 4ENJA 2PN6A 4Y17A 3RPQA 2ZFWA 4MTDA 2QVOA 3GZ6A 1BIAA 4EM1A 3HTSB 1U3EM 2YPRA 5D5UB 3PFIA 2AS5F 3ZQ7A 2QUFA 2FBHA 1KQ8A 3EYIA 4HF0A 1R58A 2WV0A 1LEAA 2A07F 2Z33A 2XASA 2QM3A 1DPUA 3KFWX 2EWNA 3F8NA 1ULYA 1YO5C 3V8KA 3LFKA 2EJRA 4M9XA 3GYHX 2BV6A 3R60A 2VE9A 4IVNA 4ZYDA 1IF1A 4QLCU 4TV7A 4NHJA 2RN7A 2VOOA 3QRFF 3DKWA 3V7CA 1QZYA 2P5VA 2CGPA 1FLIA 5FD5A 4L9NA 4OIRF 3M8FA 1U6GA 5FLXK 3RKYA 5HOOA 4IRIA 3WTSC 5TJJA 4WXCA 1FC3A 4G6DA 2LNBA 1R1TA 5HLHA 3ZMZA 4HZFA 4FX4A 5IT9Z 5D5WB 4L5IA 2P5KA 4WX9A 2HTSA 2P6TA 3E6BA 5BMZA 1YTYA 2R7DA 4LJZF 2COMA 2FMYA 1L3LA 2ELHA 1Z1DA 5LGUA 3M7GA 4EVIA 2Z9OA 1F5TA 5KK1A 2HR3A 3G73A 1XB4A 3HSRA 2A68F 3S2WA 3WG9A 3CTAA 4UVAA 1R23A 1E2XA 2IRFG 4AIHA 1V4RA 1W7PB 3CO6C 1XD7A 2FRHA 2Z99A 4FT8A 1RUOA 1R00A 1MDMA 2PLYA 1ZG5A 1P6RA 1KYZA 2VONA 5L3BA 4LK0F 1I1SA 4WF2A 2DU9A 1D8JA 3H3ZA 2WC2A 4LGWA 3FMQA 2XKOA 1K79A 1IN8A 1EV7A 2PJPA 3WTTC 2IW5A 4XSZF 2HOEA 3FXQA 1YS6A 3ZMDA 4PGHA 3GO5A 3ZMVA 1GXQA 2HFHA 5ILVA 1CF7A 4WCGA 3GXOA 4Q48A 3GEZA 1TQIA 4OINF 3RYRA 2DBBA 5KVRA 3BJAA 2GAUA 2DT5A 1FBQA 2OAZA 2JT1A 4GXOA 1UFMA 1W5TA 1U78A 4BHBA 5HDKA 1EH8A 4OU0A 1BC8C 2DAOA 2L01A 3HRTA 3E3VA 3F6VA 3ZN0A 2MA3A 3O6BB 4EJWA 2VT3A 1WRJA 3I4PA 1H9TA 4HV6A 3SFZA 1J59A 3EDPA 1DPRA 5A2QK 2LF7A 4OIQF 3TOBA 4O3MA 2DFIA 4KNYA 1OYWA 4WXDA 2Q8KA 4S04A 3F6OA 3SHFA 1HKQA 1YLFA 2L02A 3BROA 3ROUA 2DPUA 2IT0A 3GF2A 2NAZA 3E5XA 2A6EF 4HX4A 2W84A 3BP8A 4EJUA 4ZYHA 4K2EA 2Q2EA 3M9AA 5J8FA 3ZMSA 2EV5A 2K02A 2P6SA 2X4HA 4RB3C 3CUQB 5F6FA 1I1GA 5L3EA 3WU1B 3KP7A 1OPCA 4AVPA 5E20A 5D5XB 5LHHA 6PAXA 4RAYA 3HUGA 1R5GA 2DO7A 2FBKA 1SD7A 3BJOA 2Y0MA 3D0SA 3W6JB 4BAYA 2ISZA 2D45A 3FZVA 4UXNA 3MCZA 4LG0A 2L4AA 4N9IA 2HKXA 3U1DA 5CLSA 1PUEE 1Z91A 1TLHB 2P7VB 3VFZA 1XGNA 2JZYA 4RB1A 1B1BA 4CDGA 3QPHA 2VC0A 1MJBA 3W6KB 2CQKA 2L54A 1I5ZA 3P9KA 3HHHA 2F2EA 1ZRFA 2GZWA 2W57A 2LF8A 2E7WA 3HSEA 4EGZA 2CSOA 2KIUA 5L3DA 2ESHA 1BJAA 4MGRA 1GHCA 2YSRA 4A6DA 4EQQA 4PCQA 2XUBA 4ESBA 1FY7A 2QBYB 3I5UA 3REOA 5CVRA 3VOEA 2IA2A 3WTVC 2H94A 4U0WA 5FB2A 1W7PD 4U88A 3N97A 2FU4A 4P55A 2DTRA 1XDUA 3B02A 2YX7A 1ZAOA 1WSUA 1LB2A 2QQ9A 3E6CC 1UHMA 3MEXA 1FSEA 1RNLA 3HOTA 3U2RA 1SD6A 5IT9K 3NQOA 1YW9A 1J2XA 2G7UA 2D1HA 4EV0A 3SXYA 4EM0B 5J8CA 3T1BA 2O61A 4MQ9F 2HYFA 3R0AA 1JHFA 2QZ8A 1XDSA 2VT2A 1QNTA 4UVBA 1HKSA 1RZ4A 4M71A 2WWYA 4KFCA 5JVTA 3MFKA 5E8IA 2PFBA 3FF5A 4U7DA 4KT5C 3KCCA 5L3CA 4B09A 4LK1F 1FOKA 2QYOA 5LHGA 1E17A 2A5YB 1G3TA 3K1PA 5E1ZB 3LQQA 3BZ6A 2F5CA 1LNWA 3R6SA 4L9VA 2NS0A 3BPVA 1Z05A 5LGTA 4U0YA 4CXFA 4A5MA 1P2FA 3QOPA 4ESJA 1WI9A 1ZG3A 3SZPA 1USTA 5E18F 4M9ZA 2YU3A 3COAC 2KRFA 2HKOA 4PGGA 1KQ0A 4LB5A 2FNPA 1BIBA 1T39A 3GLXA 2CG4A 4I01A 2A6HF 1HXDA 5LRSA 5HS8A 1R7JA 4GYGA 1WKMA 2XGXA 5K5RA 1Z6RA 3ZPLA 2OZUA 4G7OF 2QLZA 5BQTA 2M45A 1YFHA 4G7ZF 1ZGJA 4IXAA 1RIOH 5HS7A 4A5NA 2ZNZA 2KJBA 5D6FA 2XAJA 3FXRA
chains in the Genus database with same CATH superfamily
1MMAA 2XB0X 3K2ZA 1XGOA 3K1MA 9ANTA 4LITA 2ETHA 2MLGA 4Y15A 4CCLA 2K7LA 4ENKA 1X3WB 2CRGA 4L5JA 1W0TA 2LH9A 1S6LA 1I6XA 3E1SA 4XLNF 4CH7A 5ICEA 4LFUA 1MZBA 3CJRB 1TP4A 3AAFA 2RAEA 1R71A 3KYDB 3O8GA 2BXZA 5LGNA 1TWCJ 4QTRA 1X1AA 3C3WA 1G3YA 2IAIA 4AU7A 1MBJA 2M8GX 2DJNA 2DMQA 3I53A 3QAHA 1TBXA 3UKGA 2VUMJ 4DOZA 2LSOA 3SDBA 1VQ9I 3WTUC 1TNSA 3ISPA 3H3VK 5IYDJ 1WJDA 1ZKGA 5DM6F 1N78A 1FMWA 2FEZA 4FCYA 2LG4A 3H0DA 1IXCA 3U9GA 1P4XA 1OFCX 3CQZJ 1ZRDA 4BGDA 3CC7I 3HIFA 3F3XA 5CYVA 3ABUA 5C44J 1IRXA 2L7ZA 3S3OA 2VPRA 1FNNA 3CJTB 3PNVA 1AWCA 4KISA 5J6XA 1JTXA 2FBIA 4RAGA 3OIPA 1WJCA 2GXGA 1I50J 1MKMA 2GWRA 5K7FA 5B3SH 3JTGA 3CMYA 5LEJA 1KU3A 4AIKA 3M1EA 1SD4A 1O3QA 5FJ8J 4HA8A 2DXIA 3BDDA 4HX8A 4D7MA 3CZ6A 2IS2A 1ETOA 1DP3A 2EFWA 2RV8A 4M6VA 2XGEA 2PG4A 1YJWI 1ZYRF 3L7WA 3J81Z 2IJLA 2ZXHA 2GM4A 1IUFA 4EJOA 3E0JB 1FWZA 1VQ6I 2X6YA 2CU7A 4ESFA 3MN2A 1PUFB 1WHUA 1ETVA 3LSTA 2B63J 1KQ9A 1TWAJ 1JXSA 3BG5A 3KEOA 3FHZA 5H6QA 3OYEA 4LD5A 2WV1A 2QWWA 1QPIA 2ME6A 4M73A 3VYTB 4XLAA 3HOWJ 2A69F 2CFXA 2FF4A 4RGSA 3DTIA 3LFUA 4HDVA 4KA4A 3GTPJ 2HVRA 2DA6A 1K6YA 4Y3OA 1X4OA 3BG9A 2Y9ZA 1W7PA 4UNOA 4B44A 2BW3B 5H2FC 2HPMA 3WTXC 1QBJA 2VOPA 4GO1A 2STTA 4P9FA 2PI0A 4V2GA 3Q3SA 2HS5A 2LKSA 4A3GJ 4PFOA 3DP7A 5K5OA 5ERIA 5DTDA 5JHFA 3L2VA 2I10A 4B48A 3G71I 2V9KA 2CUEA 3M8EA 2L7MP 2XPVA 2XAHA 3OYLA 3ZXSA 5CQGA 4HX7A 2KRHA 2R5ZB 1DU0A 3I9V2 4UV8A 5ICCA 5FFZA 1W0UA 1A31A 4PDKA 2NNNA 1MMGA 4ZDPA 4HF2A 1UG0A 1VI0A 4DGWB 1YX5A 1J0RA 3F9KA 1QGPA 3M1CA 4EMSA 2JN6A 4NC8A 4KYWA 2VXZA 2R5YB 1ZARA 3WGIA 3L2WA 2VBWA 5B1BH 3JRHA 2IA1A 2RDPA 1S29A 3HZJA 5GAEJ 3MZHA 1MW7A 2PBIA 3ZRGA 1OLTA 1OYIA 2K9QA 2M9HA 4ETSA 5EEHA 4V19K 1D0YA 1U2WA 3C18A 1G4DA 1R1VA 2DDAA 3JAMZ 4OMZA 2VODA 2NYXA 3HOSA 2OU2A 1O3RA 2HQRA 1J09A 1R9TJ 5DCMB 4HPQA 3H35A 2W00A 5HVQC 3MKLA 2EB7A 4W1UA 4UUSB 1Y6IA 1GUUA 1J9IA 4QPQA 2CW8A 1HDPA 2I5UA 2X6XA 2TRTA 3GW2A 4AYBA 1P92A 3DFGA 1P4WA 1BN5A 1W1WE 2KHMA 1AU7A 2ME0A 4UVCA 1WZ2A 1T2KA 2BHYA 3B6AA 3I58A 2EK5A 5J4VA 2R4GA 4CCOA 5K1YA 3S93A 2E60A 2C6YA 2O8KA 2ELJA 3RYPA 1DU6A 3HYIA 2VQCA 3FBIB 3IH2A 1VQOI 2F4MB 1IXSB 4E70A 4PJLA 2CV0A 4B8XA 3WTZA 2EA4A 2E1OA 3JSOA 4LIVA 1R5ID 2W85A 3VYRB 2LBFB 5L3GA 5FKOA 3G4SI 1J5YA 3ECHA 5F0FA 1FEXA 2XAGA 4A3CJ 3IWFA 2FMLA 3JRBA 2D2WA 3LA2A 1D0ZA 5E1XA 3TGNA 2MD5A 2X85A 4II2A 4O5VA 2A05A 5DDGA 1Z67A 1K78B 3CP8A 2E2HJ 1WJFA 3LMMA 4IEJA 2OJED 4HV5A 4F3QA 3FDYA 3GTOJ 4GYIA 2O6GE 1B9MA 5AIQA 1X1CA 1OMIA 3DF8A 1E3OC 4A3MJ 5LRRA 1SC7A 5EYRA 3T5XA 4J19A 1BM9A 1CF7B 2W25A 5EEAA 1XSVA 4E7HA 4QWQA 2P8TA 2XAUA 2KJCA 2BY2A 2OTJI 5HLTA 2PEXA 4AD9A 4AIDA 2QENA 1B8IB 4OIPF 2NOGA 1GXPA 1ENHA 4BDYA 4FISA 4AYBN 5IYCJ 3OYMA 3ESWB 2AO9A 4ZJZA 3NARA 3D1NI 3KZYA 2ZNYA 2O5RA 4M72A 4OMYA 1OJLA 1Q1HA 1R5HA 1KYWA 2JMWA 4H0EA 1KZHA 5JFRA 2CUZA 1S72I 5CJ9A 5AONA 3QYEA 2BY0A 2EIKH 3CUQA 5DV5A 2DLLA 4KJZA 3OS1A 2OV7A 1BI2A 1V5EA 1OKRA 1XMKA 3ZN1A 2LRDA 4G12A 1V5FA 5H6RA 1LEBA 4NNJA 4L9TA 5CVUA 3BOQA 1X19A 4DJAA 2KT0A 3AG1H 3HOUJ 3LOCA 3V4GA 3FXOA 2DMPA 1B4AA 4RS8A 3PNYA 2IGOA 3BJ6A 1LJ9A 2H1KA 3LSHA 3TDUC 3DU6A 3WTYC 4BHPA 3CMAI 3LAPA 3OIOA 3KE2A 4V2FA 1ZLJA 3RSNA 1T95A 1WI3A 2RGVA 2CWEA 2DA7A 3JRFA 5LLQA 2VQHA 1X1DA 3G1MA 4H4KC 1IUYA 1JE8A 2RKHA 1VZ0A 2CJJA 3HPGA 3KEQA 3BG6A 3A1YA 3TW7A 3N4MA 1JHHA 3T8RA 2HQ5A 1TT5B 3F8FA 2CW0F 2NVQJ 2XRNA 1JT6A 2YU9J 4AUXA 4IHYA 3S3NA 2CQ7A 2K4JA 4BYYA 1BW6A 5M3MJ 2LY1A 3CJNA 4XOTA 3WHCA 4MQVA 4KITB 3DKXA 1SVLA 3I59B 4CCJA 3QU6A 2JA7J 5HDNA 1KU9A 2O8XA 3T0YA 1STZA 3S32A 1FTTA 2R7WA 2RC4A 3TQNA 2ADUA 4CICA 2PMUA 2LOOA 3K4KA 3KLOA 4BU2A 3K1NA 4W97A 1UHWA 4AM3A 3J7AO 4QSHA 1A6IA 4A0YA 1QZEA 3EUHA 2JRMA 3DQVC 5H20A 1TTYA 1X1PA 2GIVA 3KZZA 2V9VA 4NQWA 1E0EA 3QPLA 3DEEA 2HOSA 2EIMH 2FQ3A 2QBYA 4Q47A 4A3DJ 3KIOA 4YELA 2HZDA 2VC1A 4PSXA 1IN7A 3HRUA 3C2HA 2ZMEB 3KP3A 1T6SA 2M1BA 3NWTA 1JGSA 3DPLC 3DBHB 3H0GJ 3SQNA 1B9NA 1T08B 2KL4A 1A36A 1XCBA 1Y0UA 4BQAA 4A2UA 4UUVA 1G6NA 1JJ6C 4A12A 1XPXA 5BPDA 1Z7UA 3I55I 2F6CA 1O3TA 2E5NA 2IGKA 2MC3A 1K61A 1ETYA 2VASA 5M5XJ 3K0LA 3DPUA 1TW2A 4CYDA 2FXAA 3CO7C 1Z6TA 1BBYA 4C3IJ 2BBYA 3ASNH 2F4IA 1H0MA 4LB6B 3I71A 2P4WA 5F1RA 5FRNA 3RZDJ 3RKWA 3CUQC 4Y7NJ 3WE2A 2JVGA 4A3EJ 2XSJC 1T38A 1REPC 1I6HJ 1LQ1A 1XGSA 2KIQA 2VKDA 4BDZA 1MMSA 4EATA 3VB2A 1ZQ3P 2YX4A 1KGSA 2FX0A 4I7HA 1S8NA 4HRIA 2QQ8A 4BY7J 4IPAA 1SFOJ 2STWA 5C4XJ 3IC7A 2LY9A 1SFKA 4F7ZA 3PSIA 2HQNA 3DTKA 2V1UA 3DTEA 2JA5J 5FKMA 1UJ8A 2V1NA 1L0OC 1IC8A 3H9QA 2DW4A 5BOXA 3H3UA 1FYLA 3RI4A 2CUJA 5EEGA 1ZH5A 3E5UA 1LVKA 3ABMH 3BG3A 3CP2A 1UCRA 1FSHA 1TWHJ 1IN5A 1IJWC 3BC8A 4NB5A 2HPIA 3IH4A 1IW7F 2KKOA 2OCEA 2VI6A 2UXNA 2DA4A 2EFNA 4KN7X 2J5OA 3HC7A 1I39A 1MIJA 3JSPA 5GTIC 1D3YA 1UHSA 2M2EA 1D5VA 2IP2A 1X3ZB 2R7RA 3JRCA 2GXAA 4IHVA 4U0VA 1GLNA 4CSWA 1C0WA 3CD6I 3TO6A 2DFFA 1IRGA 1UB9A 4F52A 4A3IJ 3G1OA 3G3ZA 2R7VA 4I02A 2ID6A 4LLNA 1D8KA 1MBKA 3HOXJ 3BCBA 4G6QA 5ICGA 4M9SA 3EUHC 2LY2A 1P7JA 3VDXA 4KIGA 5F64A 2Y69H 1NK2P 5CKTA 3LL7A 2W1OA 1ZHFA 4A3LJ 2VJ5A 4A0ZA 5D4RA 1HBXG 1YW7A 2MABA 1Y8RB 3KZIC 4G8XA 4PUSA 2O0YA 3L1PA 3C2BA 1LUJB 1IDYA 3HOVJ 2CV2A 4DQ2A 3HKZA 3ABTA 1XS9A 2VKVA 3M07A 4IHSA 3HHGA 3LA3A 1MBFA 2J5PA 3TW6A 1BA5A 3R61A 2HQAA 4OOIA 1S7OA 4A3KJ 4C2MJ 5CVJA 2VIXA 4KUMA 3SFIA 2JA6J 5IYBJ 4BH9A 3L2RA 4XN3A 3D5RC 2CYYA 1D1CA 2LC2A 2DFEA 2EINH 3RQ4A 2XF6A 2E1CA 5L3FA 5K7HA 4RGRA 2ECBA 5FO5A 1MGTA 4M3FA 3JAMK 2PMZN 2R7FA 1ON1A 3EQLF 5DYMA 3BLYA 1A35A 4CYCB 1F4KA 4CCNA 5D8LB 2CQNA 3Q0UA 3BTLA 5LBQA 2JQ7A 1MMDA 2GIZA 1FIPA 1SFEA 2MSYA 4I6ZA 4RDUA 1XMAA 3WG7H 1SD5A 1U5TB 1FX7A 3JR9A 4BJTA 3KX2A 2O03A 5F0CA 4U7BA 1VQLI 1MNMC 1KU7A 2RVCA 2DOFA 2OA4A 1TNTA 1ONVA 2BEOA 1I27A 2K4BA 4FQGA 1BI0A 4R79A 3LQRA 5A2QZ 1DDNA 3DU5A 2ZJQF 2HVQA 1LFPA 1KU2A 3AL0B 2IS4A 1BC7C 3OS2A 1JJ8C 1JKRC 2G7HA 4XICA 1YRNB 5LEKA 2H09A 3UR3C 2BHZA 3BPXA 3GUDA 3KLNA 3N05A 4XMYA 3FWEA 3HKZN 3MVPA 2Z5UA 1HLVA 1ETWA 4XIDA 3HRSA 1ZR2A 2JRTA 4WWCA 3RTRA 4RB0A 2FOKA 3FIWA 4YFXF 4HLYA 4IQJA 1HW2A 3JTHA 5DCFA 4AIJA 1GDTA 4LMYA 3OYGA 3H9JA 3HGYA 1LDDA 4D1QA 2R93J 3OV8A 4ZYAA 1W36D 5AIPA 3KETA 2DI3A 4CGZA 4ZYGA 2AQEA 3KP5A 1V3FA 4C2TA 2Y48A 2F5VA 4HYEA 2ISYA 4E7LA 2E2JJ 4XBFA 2EV6A 2KZVA 2WBMA 3GBGA 1LKXA 4I0AA 1ODDA 3WODF 3TO7A 2WAQA 3GFLA 3FM3A 3D5LA 3WHBA 5JHUA 2XSDC 3L09A 4XR6A 1X4PA 5CVIA 4UY8I 2GOMA 4HLXA 3ELKA 3K4CA 5D6EA 4HW0A 2DQRA 3F21A 4ZZLA 1EH6A 3TL4X 4BEHB 3L9FA 3VEPA 4I09A 4GCVA 1BR1A 2M30A 5FD6A 5GP9A 4S05A 1OCPA 2MH9A 2Z2SB 3IRQA 3IRRA 3ML6A 2E34A 3VSKA 5JVGF 1TL8A 3P7NA 2PX9A 1K83J 4IHTA 4NC7A 3MAJA 4NUBA 4EM2A 5GPAA 1XX5A 2ZBKA 1LVAA 3I0TA 3KP2A 1QVUA 3IKTA 1MBGA 2R7QA 2YR2A 1XCVA 2Y0SA 2DPDA 4KT6A 3I54A 1T98A 3OYKA 1Q1VA 4M6YA 1DUXC 2NRAC 3ZMUA 4IZZA 3A2KA 1LDJA 2M0CA 3DEUA 4PJJA 2OUMA 2L2OA 3O2PE 4PFPA 2EILH 3NEUA 4XORA 1XG1A 1Z0XA 3DV8A 5HS9A 1FJLA 3DXJF 4R8HA 3CCRI 2LFBA 3JRGA 1SAUA 2V6CA 5FLMJ 4HDUA 1WWXA 2D1VA 3F72A 4FETA 3W3CA 2DK8A 1N75A 1VQNI 4M74A 5DEQA 2ESNA 1MJAA 2LYCA 2P0WA 1IG7A 1VQ7I 2MFZA 3CMMA 4BE0A 2KLOA 4IL6C 3RDIA 3OYDA 2IEKA 1IV8A 3UNGC 4FX0A 4ZZDA 1XC5A 2F5FA 1TW3A 4P5OA 4IKFA 4M3EA 3TMOA 2Z16A 1ETQA 3GX4X 3BY6A 2XV4S 2CS3A 1J75A 1B6AA 1PUFA 4BBSJ 1EH7A 1O7LA 2L7KA 1S7AA 2ZSHB 1Z3XA 2V7FA 4LLGF 4DZPA 4YFKF 1R4NB 4EJTA 3I4MJ 3BWGA 3T8TA 1IRFA 3ZQIA 2XROA 3FXJA 3GFJA 3SEZA 1PP7U 2KPMA 2DT7B 4I99C 5DD8A 3DEWA 3NRVA 4UB8C 5IOYA 4D9JA 4FHTA 3QPSA 4XRSA 5KNLA 2ZJRF 2MD0A 3HG9A 3LSMA 2BW3A 4IOAF 4MLOA 2L3DA 3KP6A 1GV5A 4L18B 3FM5A 3A4CA 4BXUA 3OYNA 4ZYEA 1ZGAA 1FBUA 5J1RA 3J80Z 2H27A 1R4MB 4JP0A 2F5DA 2FQ4A 1U8RA 1VNDA 3C2GA 2QSFX 2R3SA 1X3UA 4X6AJ 1TWGJ 4UV9A 4ENMA 3I64A 3JCUC 3MKWB 1WJAA 3EUKL 3PQKA 4IRHA 4C2UA 1HDDC 3SDGA 1FZPB 5ED4A 1USSA 3RPUD 3HXLA 4WXHA 1VTNC 1SFXA 1MD0A 3BR0A 3BZCA 2R5ZA 2RQQA 2RNJA 5TRDA 3V8JA 5F27A 2OQGA 1H88C 3I4NJ 1G3SA 3R0JA 3DLAA 4A0XA 4Z2YA 2ZCWA 1ZREA 5HODA 2GBYA 3CCSI 3HSFA 5DUIA 3LSJA 4OAYA 4DYCA 2DK5A 3ZQHA 1RPWA 2BOLA 3I3LA 2R5YA 3OR1C 4EEFG 2A5WA 1QHHD 5JLXA 3CCLI 3V42A 1B72B 3QWLA 4YEJA 5BPIA 4L9JA 1ON2A 1LFUP 1VQ8I 1XSXA 1FP2A 4RGXA 3CCJI 2X6OA 2ZXWH 4P9UA 1P9QC 3CF2A 1W5CC 3OL3A 4HNVA 1K6OA 3L2UA 1NH3A 4BNCA 5DUKA 5DCMA 4KIBA 1BR4A 2VJ4A 3K7AJ 2HYGD 4MNUA 3ZOBA 4UUSA 5LHIA 1FYKA 4C30A 3X2QH 3TO9A 1N25A 3MZYA 4ABZA 4D0PA 1BOAA 3GZ5A 5BNGA 4DYRA 3TOAA 1RUNA 3FX3A 5JI6A 2L9NA 4MTEA 2E71A 3FXKA 1PP8F 4OIOF 1GVDA 4LOCA 2DQLA 1E3PA 2E7XA 5KAFC 1VQ5I 1K4TA 1GVJA 1IZ1A 3PSFA 3OR2C 2GQQA 3KYCB 3OYAA 3A0HC 1F43A 2BE5F 2HGCA 4YFNF 2H8RA 2IA0A 1IN6A 5GPCA 4HSRA 2AXLA 5HLIA 2LBFA 1UZCA 4HAMA 4IHXA 5F08A 2Z1DA 2OZ6A 2ELKA 4XRMA 2H6CA 4XLPF 1ERDA 2MBFA 1NHAA 2CMPA 2OD5A 3E6DA 3LWFA 1K78A 1H9GA 1IN4A 1FYMA 2NXNB 4G6TB 1FOWA 1HCRA 1LE8B 2FJ1A 1MDMB 2R7UA 4UHTA 2XHKA 4PK4A 2JK3A 3TP3A 2CO5A 3GCMA 3AG4H 1EJ9A 5IT3A 3PIOF 3K70D 4XKVA 2KIFA 1A5JA 4MEXF 3ZQCA 2EA2A 1QHGA 2K9SA 2XRLA 4JYKA 1WH7A 3EETA 2P7CB 2OCCH 4F93B 1YW8A 3LSPA 4I2OA 4HQMA 1JT0A 2LMDA 5ILSA 2WB1A 4IJAA 1MNEA 3C1DA 3CLOA 5E8GA 2VLAA 5D5VB 1R36A 1YYVA 1HSTA 2E35A 4L5EA 2DA5A 2V1XA 4E7KA 4JK1X 3LSKA 1WFXA 2QF7A 3V8LA 1A04A 4CCMA 4YRVA 5GAGJ 3O3KA 3TEDA 1JTYA 3L2QA 2EV0A 1W4MA 2L9RA 4HOBA 3H36A 1F9NA 3TKYA 1BJZA 3LAJA 4N4OB 3P5JA 4ON0A 3WTWC 3OL4A 1OISA 2NVUB 4HQEA 2HU9A 3CCQI 4D5CA 2ZO4A 1QQIA 2YS9A 2GA1A 3H5RA 1B59A 4ANJA 2ZJ2A 4AWXB 1U0JA 1RKWA 3QODA 1ZRCA 1VFCA 4A6EA 2XF7A 1PJRA 2XB5A 2Y75A 5JLWA 3FMSA 4A93J 3CESA 4XSXF 1ZN2A 1IAWA 1CGPA 4L0YB 3S1NJ 3L00A 3GTGJ 1YQAA 2JPCA 4DBQA 4GGGA 3K10A 1SAXA 3GTMJ 4EJVA 1MNDA 1I3QJ 2LDUA 2BVMA 2WB1N 1YE9A 2AHQA 1MJ9A 2IGMA 1JGGA 3ERMA 1IO2A 2HEOA 1QPMA 3HOYJ 3I59A 1BR2A 4KMFA 3A0BC 3IH3A 2X1DA 2PQ8A 1P4AA 2K86A 4I98B 4DNCA 1DP7P 2ZJPF 2IPQX 2BYVE 2LP0A 4OAZA 3HM5A 1JUSA 3FXLA 3OMYA 1OCOH 5ILUA 4LG3A 3OYIA 2UWMA 3OYCA 3Q9SA 2E2IJ 2E1MB 2V79A 3QP6A 1OCZH 5HNFA 3QYBA 5JR3A 2Q0OA 3F8BA 2M8EA 1G3WA 1YHQI 2K27A 1JKQC 2JSPA 3BZKA 4IHWA 2E36A 2KIMA 4M3BA 1RR8C 2BXYA 4JBAA 5B1AH 2JTVA 4JOMA 3WE3A 2DODA 4BACA 1IXRC 2ZMEA 1HSJA 2R92J 4KIFA 5M5WJ 2KDOA 3GTQJ 4BHCA 5F1JA 1PVEA 2M87A 2L9VA 4NBQA 4O6JA 2JA8J 2Y30A 1SMTA 3S17J 2JPBA 2CW7A 4G9YA 1SFUA 3OYBA 4GFBA 4PJ0C 2F5EA 2FE3A 1Z9CA 3ZQQA 2K5CA 3S1RJ 1JKOC 2MH2A 3OS0A 2Q2EB 3FMRA 2MLKA 2X48A 2CQXA 5DS9A 5FGMA 5E1WA 4RAZA 3E6MA 1JUMA 4E6KG 3QOEA 2R7TA 3GTKJ 5D8KB 5FLXZ 3G6EI 3F23A 1SMYF 1S3JA 1XMXA 2EFOA 3HUGB 1FP1D 3E5QA 3ECOA 4R1HA 2G9WA 3AKZA 3CJQB 4ENNA 3ERED 3W6VA 3F8CA 1Y1VJ 4CZCA 4KDPA 2NVXJ 5E3NA 4LG0B 4N9HA 4Q4ZF 3E97A 2Q1ZB 3C7JA 2BGCA 2HVSA 4YIRX 2R7ZJ 1HQCA 2K9NA 2KP6A 3ZQGA 4KN4X 3TDZC 3SJMA 1T33A 2IBDA 3ZQFA 5CQEA 1W36C 2ACJA 2PJRA 3H92A 1OYYA 3IL2A 1APLC 1AKHB 2TCTA 3WU0A 3EPZA 2W82A 1NG7A 4EGYA 2A3SA 4XLEA 2GA2A 2X0LA 1OR7A 1SANA 2P5LC 1RETA 4JQFA 4UUTA 2VBZA 2BZTA 3WU2C 4BKXA 2ZKZA 1RC9A 2IGNA 2RREA 5EZHA 1H89C 1J7KA 4ZDOA 4IRGA 3SZTA 3RPUA 1QVTA 3WGGA 4PSWA 1R1UA 5C4JJ 3EYYA 3J81K 5E3OA 4YG2F 1SEUA 2HWVA 2VBYA 2TDXA 2XAQA 3R4KA 3W2VA 5LD2C 3LA7A 4Y13A 3J7AY 2QQBA 3S14J 1UMQA 1YS7A 2DFHA 2LD5A 3PFYA 2FUG2 3J80K 2XKPA 3IWZA 1WQ2A 4M6XA 3K6GA 4RM3A 4IF4A 3NAUA 2OBPA 5DD4A 5ICFA 3SYTA 4BL0B 1FOYA 5D4SA 1GT0C 2OTLI 1VQMI 5E17F 2FSWA 3KP4A 5EG0B 2E5ZA 1PDNC 4XRSG 4DW6A 2E1NA 5BS6A 1EA3A 2HXIA 3PM1A 3QP5A 1ETXA 4ZC3A 2M34A 1V55H 4RBOA 2ZMEC 2LVSA 5E79C 3HPHA 2O3FA 4LIUA 2R7XA 4PZJA 3DKYA 3DPTA 3GWZA 3K9TA 2WTEA 4E7ZA 2FA5A 2HDDA 1XN7A 3V7RA 3RIRA 3Q5FA 2ZB9A 4E7SA 2EBIA 2UZKA 3GFIA 2V4JC 4ITVA 1YIOA 5CVVA 1O57A 1FT9A 3HEFA 1XSDA 2VBXA 4RGUA 2RQPA 4YIFA 2LLKA 3V7SA 2ZXJA 2XAFA 3CUOA 2HZTA 3CCVI 3QU3A 4B1RA 1SVOA 3VODA 3HDDA 3S1QJ 5KAIC 2CFOA 1FPQA 1TQPA 4N0BA 1HW1A 3ABLH 4CYCA 3CMEI 2L4MA 3CDIA 1YJNI 2L5QA 3RJPA 3QPTA 4CZZA 4ASNA 5EGOB 4DIQA 3RKXA 3DBLB 4G94A 3ZP5A 1F36A 3B73A 2WAEA 1U5TA 3HTUA 3A01B 1W5SA 1H8AC 1R22A 2IVMA 3S2HJ 3K69A 5B5EC 4KICA 3BQZA 3CDHA 3HB9A 3P9CA 3Q9VA 5K5QA 2EFQA 2DTZA 4M3DA 1QZZA 4RB2C 3HJEA 3FXUA 5HLGA 1BI1A 2EZIA 3VWBA 1K7AA 4WK8F 4JX4A 1ZR4A 3PO3J 2B0LA 1YRNA 3K2AA 2DMNA 3PO2J 2W48A 4ZH4F 3JREA 2K85A 4G7HF 1OR7C 3IHUA 5FFXA 1MMNA 1S9HA 2W4SA 5K7ZA 3F8MA 2AXTC 4I0BA 2DMTA 2JSCA 4MFEA 3HOZJ 2X1CA 2LKPA 5EF6A 4CHUA 2QQAA 1RI7A 4XRFA 1ZG1A 1O3SA 1HF0A 4MHGA 1JUPA 3MWMA 2UXXA 2OF7A 3VPRA 4Q5SF 1XGMA 4XOPA 2GXBA 2N8GA 2K9MA 4F92B 4C9YA 3MKYB 2NNYA 4FE7A 3L2CA 2EZLA 3MMYB 1AOYA 1O7FA 2VE8A 2VN2A 1TT0A 2I8DA 4XLFA 4S0HB 4HF1A 3GVAA 4A69C 2GOXB 3HRMA 1D1AA 1IDZA 3F22A 3IKVA 2XIGA 3LNQA 4BEHA 2XVCA 2A61A 3PL8A 2QKMB 4BE2A 1MBHA 3LSIA 4CO8A 4YIIA 1FBSA 1TQMA 3MQ0A 2NS7A 1WCMJ 2BY1A 2COBA 5CPRB 2EFPA 2XGDA 3JRAA 4HBLA 1F1ZA 3G1LA 3TBIA 3ZMTA 1BI3A 3S1MJ 2KRCA 2DMUA 2O9LA 3AG3H 4XN0A 1YG2A 2W24A 3OOPA 5HDGA 3PUFA 2EZKA 1GV2A 3GFMA 3JW4A 1WJ5A 3WGHA 2M4KA 1R6RA 2HDCA 1HKTA 3ULQB 2K9LA 4LLLA 3F0CA 3HGGA 4DYQA 2M5WA 1HW5A 1ZLKA 1QO0D 2FNAA 1KA8A 2Z3YA 1T0FA 5EZGA 2V1DA 4P96A 2KDZA 2H6BA 4MEYF 4KMUX 3OY9A 2X1EA 4L0ZB 1LDKB 2H1LA 5FROA 2LR8A 3P9IA 2OQRA 3OYFA 2HTJA 1U5TC 1VQ4I 2IS6A 2PMHA 4AVZA 1T56A 3PQJA 1G2HA 2X51A 2F4OB 4ENJA 2OC6A 1YJ9I 2PN6A 4Y17A 3RPQA 4XNFA 5J40A 1WH5A 3AL0C 1EKEA 1NTCA 2ZFWA 4MTDA 3SZGA 2MYSA 1YITI 2QVOA 2UV1A 3GZ6A 1BIAA 2JWTA 1U9OA 2QGUA 4EM1A 3LSRA 3MKZA 1U3EM 3HTSB 2YPRA 5D5UB 3PFIA 2AS5F 3A03A 3K70C 2B7EA 3ZQ7A 2QUFA 2MGQA 2WAQN 2FBHA 2DCEA 2UUZA 1KQ8A 3EYIA 2ID3A 1HC8A 5B66C 4HF0A 1X2NA 1QA6A 1R58A 3S2DJ 2WV0A 1LEAA 1WPKA 2A07F 3ZGKA 2Z33A 2XASA 2QM3A 3BR6A 1DPUA 4RLQA 3KFWX 1UELB 2EWNA 3BTJA 3F8NA 3IUOA 1ULYA 2NOJB 3IV5A 1YO5C 1WGXA 1ORKA 4ZTJA 3V8KA 1FOXA 2WY7Q 1U8BA 1X58A 3LFKA 4I76A 2QEXI 2EJRA 4M9XA 2AQFA 3GYHX 4F55A 2BV6A 3FBNB 2Y0SN 3R60A 2R7OA 3TP0A 2VE9A 2M0MA 4IVNA 2CQQA 4ZYDA 1IF1A 4B43A 2O7OA 4TV7A 4QLCU 1DGRM 2HOTA 4NHJA 2RN7A 2VOOA 1N77A 3ONQA 3CC2I 3QRFF 3DKWA 3V7CA 2VQLA 1QZYA 2P5VA 4Y4RA 2CGPA 1B72A 1ACIA 1FLIA 4PJNA 5FD5A 4L9NA 3PNTA 2M4GA 4OIRF 3M8FA 1U6GA 5FLXK 3RKYA 3K4NA 3HBLA 5HOOA 4IRIA 1O4XA 2QSGX 1S5LC 3WTSC 1ZK8A 5TJJA 4WXCA 1FC3A 4G6DA 2LKXA 3RCOA 3G2BA 2LNBA 1R1TA 3NWSA 3LSGA 1Z21A 2HDWA 4HZFA 3ZMZA 5HLHA 2FOWA 4FX4A 1ZELA 4RLFA 1T0FC 2QKLB 1Y1WJ 5M5YJ 3CF5F 5IT9Z 4HSTA 4D7NA 5D5WB 2VJIA 4L5IA 2P5KA 4WX9A 2HTSA 2P6TA 3PUBA 3E6BA 3ZR8X 5BMZA 5F04A 2D5VA 1YTYA 2R7DA 4LJZF 2COMA 1NK3P 2FMYA 2Y31A 1RRJA 4CA0A 3S3MA 1L3LA 2ELHA 4XLHA 2KMUA 3OOUA 1X1BA 1Z1DA 5LGUA 3M7GA 2VJJA 2JJ7A 4EVIA 2DOAA 2XGCA 2Z9OA 1OCCH 1F5TA 5KK1A 2HR3A 3G73A 1XB4A 3HSRA 2KZGA 2A68F 3S2WA 4XK4A 1Z7LA 2RNGA 5IP6A 1P7IA 3WG9A 4BJ5C 3CTAA 4UVAA 1RESA 1R23A 1E2XA 5E3LA 2JUGA 2IRFG 4AIHA 1KONA 1V4RA 1W7PB 2ECCA 1TC3C 4NDLA 4II3A 3CO6C 2DOEA 1XD7A 2FRHA 4XKBA 2Z99A 4FT8A 3CCUI 1RUOA 1G59A 1R00A 3J7ZI 1YIJI 1LE8A 4IO9F 1MDMA 4XKWA 2PLYA 1ZG5A 1FIAA 1P6RA 1KYZA 2EH3A 1POGA 4UB6C 2VONA 1HOMA 1K4SA 1Y8QB 1Z3YA 4BJ6C 5L3BA 4LK0F 1I1SA 3H5NA 1X2MA 4WF2A 2DU9A 1D8JA 1Z77A 1OQYA 4HNTA 1MBEA 2VPLA 2B9SA 1UG2A 3H3ZA 2WC2A 4LGWA 3OSGA 3FMQA 5J1YA 2XKOA 2ZFUA 1K79A 1IN8A 3OYJA 1EV7A 1G8XA 3M8JA 3BTCA 4A3FJ 3WTTC 2PJPA 1JKPC 2IW5A 2QSHX 4XSZF 2HOEA 1VQKI 3FXQA 1DGWY 1YS6A 4GRIA 3ZMDA 5FKKA 4B47A 3IAS2 4PGHA 2DYSH 3M3YJ 2DJIA 3DCFA 3GO5A 4MFDA 3ZMVA 1GXQA 2HFHA 5TGTA 5EDNA 4FE4A 1RKTA 4J01A 5ILVA 3JRIA 3OYHA 1CF7A 4X1EA 3OSFA 4WCGA 3BR2A 2W7NA 1B8IA 1S7EA 3GXOA 4Q48A 4U87A 1CQTA 1ZTRA 4RAFA 3GEZA 1TQIA 4OINF 1V54H 2NS8A 4C3JJ 2E19A 3RYRA 2X9DA 2DBBA 5KVRA 4BXFA 1YX3A 3BJAA 3BR5A 4HNUA 2EIJH 2GAUA 2LK2A 2DT5A 1FBQA 2OAZA 2JT1A 3W2AA 4GXOA 1SVMA 4C3HJ 3B6CA 3SEQA 3PJRA 1UFMA 1W5TA 1Y0NA 4E4HA 4N4NB 1U78A 3QYFA 1MSFC 3U21A 4ZDLA 4XONA 4QPOA 1YOVB 3AG2H 4BHBA 4BBRJ 5HDKA 2VKHA 2DT6A 3K4BA 2HI3A 1EH8A 4OU0A 2XC7A 1BC8C 2DAOA 3CDLA 2L01A 3HRTA 4BUPA 3E3VA 3F6VA 3ZN0A 2L9SA 2MA3A 3O6BB 4EJWA 1LFBA 2VT3A 1WRJA 3I4PA 3K4JA 1H9TA 4HV6A 3MD2A 3CC4I 3SFZA 1IRZA 2DA1A 1TWFJ 1J59A 3EDPA 1DPRA 5A2QK 2LF7A 4OIQF 3TOBA 3EUAA 4O3MA 5HNHA 2HOAA 4IOCF 2DFIA 4KNYA 4Z6YA 1OYWA 2HYJA 2R0QC 4WXDA 2Q8KA 4S04A 1I3AA 1VF9A 3FXMA 3F6OA 3SHFA 3RZOJ 1HKQA 1YLFA 4BS9A 2L02A 3BROA 3ROUA 2XF5A 1ETKA 1FMVA 1BOBA 3CCEI 4BXXJ 4D5FA 3BQYA 2K40A 2JA2A 3GTLJ 2DPUA 4IQ4A 2IT0A 3S8PA 2L0KA 2NAZA 3E5XA 3GF2A 2A6EF 5KCMA 4E7IA 4HX4A 4X0GA 2W84A 3BP8A 3AFHA 2VL8A 1YI2I 4EJUA 4A3BJ 5KHDA 4ZYHA 4K2EA 2Q2EA 3M9AA 4XL9A 5J8FA 3ZMSA 2EV5A 2K02A 2P6SA 2X4HA 2X6WA 4RB3C 3CUQB 5F6FA 2JVHA 4F91B 1D0XA 3FKIJ 3BCAA 1I1GA 5L3EA 4B3XA 3KP7A 4AVPA 1OPCA 3K4MA 3WU1B 1MSEC 2YUSA 5E20A 5D5XB 5LHHA 6PAXA 4RAYA 3HUGA 1R5GA 3KYLA 2DO7A 2FBKA 4J00A 2QCOA 1SD7A 3BJOA 2Y0MA 2DA2A 3ASOH 3D0SA 3W6JB 4AC0A 2JUCA 3VYUB 4BAYA 3FK7A 2ISZA 2D45A 3FZVA 4UXNA 3MCZA 4LG0A 2L4AA 2CUFA 4N9IA 2HKXA 4RA2A 2G0EA 1A6QA 4CCKA 2A6TA 5FKNA 3U1DA 3KEYA 1T8IA 5CLSA 1PUEE 1Z91A 1TLHB 2P7VB 2WA0A 5FLVA 3VFZA 1XGNA 2JZYA 3S15J 4RB1A 1B1BA 4P1WA 2HNHA 1BL0A 2MG4A 4CDGA 3QPHA 1AKHA 2M3AA 3GLLA 2EQRA 2VC0A 1MJBA 3W6KB 3FKJA 2CQKA 1HA8A 2L54A 1I5ZA 3RQIA 2VKEA 3P9KA 5TISC 1VQPI 2F48A 3HHHA 2F2EA 1ZRFA 2GZWA 1D1BA 2W57A 4NC6A 2LF8A 4QIWN 1UAAA 2E7WA 2P81A 3HSEA 4EGZA 2CV1A 2CSOA 3M4OJ 2XPWA 1WVRA 4HG2A 4MO7A 2KIUA 1BJAA 2ESHA 4MGRA 5L3DA 5DM7F 3BR1A 1LPQA 5GTHC 1GHCA 1DQUA 4Y52J 4BQOA 2YSRA 4A6DA 1ZGWA 4EQQA 2E1MC 2XUBA 4PCQA 4ESBA 4NQWB 1FY7A 2QBYB 3IP4B 3BT9A 5EG0A 4GDFA 1E3HA 2L7FP 3I5UA 4XM3A 3REOA 4CUGA 5CVRA 2VXDA 1D5YA 3DBRB 3VOEA 5E3MA 2IA2A 3WTVC 3DWLE 2H94A 4U0WA 3S16J 2R7SA 5FB2A 1W7PD 3CLQA 4U88A 3MZ8A 3N97A 5FKLA 2FU4A 1ITYA 4P55A 2NVTJ 5J47A 2KQRA 2DTRA 1XDUA 3B02A 5GAHJ 5FRMA 2YX7A 1ZAOA 1WSUA 1LB2A 5GADJ 2QQ9A 3E6CC 3Q0WA 4DZJA 1UHMA 1EF4A 1Y56A 3MEXA 1FSEA 1AA7A 3IAM2 1OCRH 1RNLA 1PYVA 4XLCA 3HOTA 1XTAA 2PJRB 3U2RA 2BVLA 5EJCA 3JRDA 2CH0A 3ABKH 3KPHA 4BQNA 4BE1A 1SD6A 3A02A 5IT9K 3NQOA 3E7LA 3O8HA 5EGOA 1YW9A 1J2XA 1JI8A 5M3FJ 2G7UA 2D1HA 4EV0A 3A01A 3SXYA 2DN0A 4EM0B 3Q0VA 5J8CA 1BW5A 1RR7A 1AHDP 2MC4A 2PMZA 3T1BA 4B3AA 2O61A 2WY8Q 4E7JA 4JX6A 4Y33A 3BR3A 4MQ9F 1M1EB 2HYFA 3PIPF 4HEA2 3R0AA 1JHFA 2QZ8A 2Y9YA 1XDSA 3OWTA 2VT2A 1QNTA 3HL2A 3FK6A 1Y39A 3W2WA 4UVBA 1HKSA 1RZ4A 4M71A 2WWYA 4KFCA 5JVTA 1TZLA 1V5GA 5F0HA 2OPTA 5E8IA 2PFBA 3MFKA 3H1CA 3CCMI 2HXOA 3FF5A 5J4YA 4U7DA 2V9PA 4XKCA 2IS1A 4KT5C 3KCCA 5J3LA 5L3CA 3H9GA 5IP7J 4B09A 4LK1F 3FHNA 1WJEA 1FOKA 2QYOA 5LHGA 2H8WA 5IPAA 2A5YB 1E17A 3GMEA 1G3TA 4XQFA 3K1PA 5C3EJ 5E1ZB 3LQQA 3BZ6A 2F5CA 2QA4I 1LNWA 3R6SA 3CCYA 2LREA 4OWRB 4L9VA 2DDBA 1MH4A 4ZTFA 2NS0A 1OCTC 2Y2ZA 3BPVA 1Z05A 2FD5A 4B4CA 4BQQA 5LGTA 2EPFA 4CXFA 4U0YA 4A5MA 4M3GA 3ZCOA 1P2FA 3H5AA 2LTPA 3QOPA 3GZNB 2M7BA 4ESJA 1WI9A 1ZG3A 4RMNA 3SZPA 1USTA 4PJMA 4FASD 5E18F 4M9ZA 2K3FA 4IX7A 2YU3A 3COAC 2KRFA 3K4LA 2HKOA 3RKQA 4FTHA 4PGGA 4BY1J 1KQ0A 4LB5A 2FNPA 1BIBA 3VYSB 1T39A 1IV6A 3GLXA 2CG4A 2WADA 4RM2A 4I01A 2A6HF 1U9NA 2ICWG 2ZSIB 3QQAA 1HXDA 3BTIA 5HS8A 5LRSA 4DBRA 1FTZA 2XPUA 1R7JA 4GYGA 2BY3A 1WKMA 2M7AA 2XGXA 5K5RA 5IY5H 4JX5A 2NVYJ 4MIMA 5IP9J 1Z6RA 3ZPLA 3VSLA 2OZUA 2EZHA 4G7OF 2K3PA 2KISA 2DYRH 2QLZA 2ZXIA 2VB6A 5BQTA 2M45A 5LFAA 1YFHA 2GLOA 4G7ZF 1WJBA 1ZGJA 5IOZA 3ZQLA 3U1KA 2WAFA 3BG7A 3GTJJ 2ZC2A 2DA3A 3D5SC 2V6EA 2IXSA 4IXAA 5J1UA 1RIOH 1IGNA 1QRYA 3FISA 5HS7A 3J7YJ 4A5NA 2VQGA 2ZNZA 2KFDA 2XDVA 2V26A 3I56I 2MW8A 1NG6A 2KJBA 1R49A 3DLLF 5D6FA 3OIQA 2XAJA 1QU3A 3FXRA 4A3JJ 1MH3A
chains in the Genus database with same CATH topology
3K2ZA 1XGOA 3K1MA 2ETHA 2MLGA 4Y15A 2K7LA 4ENKA 4L5JA 1S6LA 1I6XA 4XLNF 5ICEA 4LFUA 1MZBA 3AAFA 5LGNA 3C3WA 1G3YA 3I53A 3QAHA 1TBXA 2LSOA 3WTUC 1TNSA 3ISPA 2FEZA 1IXCA 3U9GA 1P4XA 1ZRDA 3HIFA 3F3XA 5CYVA 3ABUA 1FNNA 1AWCA 5J6XA 2FBIA 2GXGA 1MKMA 2GWRA 3JTGA 5LEJA 1KU3A 4AIKA 3M1EA 1SD4A 1O3QA 4HA8A 3BDDA 4HX8A 2EFWA 2RV8A 2PG4A 1ZYRF 3L7WA 3J81Z 2IJLA 4EJOA 1FWZA 4ESFA 3LSTA 1KQ9A 1JXSA 3KEOA 3FHZA 5H6QA 4LD5A 2QWWA 4M73A 2A69F 2CFXA 2FF4A 4RGSA 4HDVA 4KA4A 1W7PA 4UNOA 3WTXC 1QBJA 2VOPA 4GO1A 2STTA 4P9FA 2PI0A 2HS5A 3DP7A 5K5OA 5ERIA 3M8EA 2XAHA 4HX7A 4UV8A 5ICCA 5FFZA 4PDKA 2NNNA 4HF2A 1J0RA 4EMSA 1QGPA 4KYWA 2VXZA 1ZARA 3WGIA 2VBWA 2IA1A 2RDPA 1S29A 3MZHA 2PBIA 1OYIA 4ETSA 5EEHA 1U2WA 3C18A 1G4DA 1R1VA 3JAMZ 4OMZA 2VODA 2NYXA 3HOSA 2OU2A 1O3RA 2HQRA 5DCMB 5HVQC 2EB7A 1J9IA 3GW2A 1P92A 3DFGA 1P4WA 1BN5A 4UVCA 1T2KA 3I58A 2EK5A 5K1YA 2C6YA 3RYPA 3HYIA 1IXSB 4E70A 4B8XA 3WTZA 2EA4A 3JSOA 2W85A 5L3GA 1J5YA 3ECHA 2XAGA 3IWFA 2FMLA 2D2WA 5E1XA 3LA2A 3TGNA 2MD5A 4O5VA 5DDGA 1K78B 4HV5A 4GYIA 2O6GE 1B9MA 5AIQA 1OMIA 3DF8A 5LRRA 3T5XA 1CF7B 1BM9A 2W25A 1XSVA 4QWQA 2P8TA 2KJCA 2PEXA 4AD9A 4OIPF 2QENA 1GXPA 3KZYA 2ZNYA 4M72A 4OMYA 1Q1HA 1R5HA 1KYWA 4H0EA 5JFRA 5CJ9A 5AONA 3CUQA 5DV5A 2DLLA 1BI2A 1OKRA 1XMKA 3ZN1A 5H6RA 1LEBA 4L9TA 5CVUA 3BOQA 3V4GA 1B4AA 4RS8A 3BJ6A 1LJ9A 3TDUC 3WTYC 4BHPA 3LAPA 3KE2A 1ZLJA 2RGVA 2CWEA 5LLQA 1IUYA 1JE8A 2RKHA 3KEQA 3N4MA 1JHHA 3T8RA 3F8FA 2CW0F 2XRNA 2K4JA 4BYYA 3CJNA 4MQVA 3I59B 3QU6A 5HDNA 1KU9A 2O8XA 3T0YA 1STZA 2RC4A 3TQNA 2ADUA 4CICA 2PMUA 3KLOA 3K1NA 1UHWA 3J7AO 4A0YA 3EUHA 3DQVC 5H20A 1TTYA 2GIVA 3KZZA 2V9VA 4NQWA 2FQ3A 2QBYA 4Q47A 2VC1A 1IN7A 3HRUA 2ZMEB 3KP3A 1T6SA 2M1BA 1JGSA 3DPLC 3SQNA 1B9NA 1XCBA 1Y0UA 4BQAA 4A2UA 4UUVA 1G6NA 4A12A 5BPDA 1Z7UA 1O3TA 2MC3A 3K0LA 1TW2A 4CYDA 2FXAA 3CO7C 1Z6TA 1BBYA 2BBYA 1H0MA 4LB6B 3I71A 2P4WA 5F1RA 3RKWA 3CUQC 3WE2A 1REPC 1T38A 1LQ1A 1XGSA 3VB2A 2YX4A 1KGSA 4I7HA 1S8NA 2STWA 4IPAA 3IC7A 4F7ZA 2HQNA 2V1UA 1L0OC 2DW4A 5BOXA 3H3UA 1FYLA 3RI4A 5EEGA 1ZH5A 3E5UA 1UCRA 1FSHA 1IN5A 4NB5A 1IW7F 2KKOA 2UXNA 2EFNA 4KN7X 2J5OA 3JSPA 1D3YA 1D5VA 2IP2A 4U0VA 1C0WA 3TO6A 1IRGA 1UB9A 3G3ZA 4I02A 4LLNA 1D8KA 5ICGA 4G6QA 4M9SA 4KIGA 5F64A 1ZHFA 4A0ZA 5D4RA 1HBXG 1YW7A 4G8XA 2O0YA 4DQ2A 3ABTA 4IHSA 3HHGA 3LA3A 2J5PA 3R61A 4OOIA 1S7OA 5CVJA 4KUMA 4BH9A 2CYYA 2E1CA 5L3FA 4RGRA 5FO5A 1MGTA 3JAMK 2R7FA 1ON1A 3EQLF 5DYMA 1F4KA 5D8LB 5LBQA 1SFEA 1XMAA 1SD5A 1U5TB 1FX7A 2O03A 4U7BA 1KU7A 2RVCA 2OA4A 1TNTA 1ONVA 2BEOA 1I27A 2K4BA 1BI0A 4R79A 3LQRA 5A2QZ 1DDNA 1KU2A 1BC7C 2G7HA 5LEKA 2H09A 3BPXA 3GUDA 3KLNA 3FWEA 2Z5UA 3HRSA 2JRTA 4WWCA 3RTRA 4RB0A 2FOKA 4YFXF 4HLYA 1HW2A 3JTHA 5DCFA 4AIJA 4LMYA 1LDDA 3OV8A 5AIPA 3KETA 2DI3A 4CGZA 4ZYGA 3KP5A 1V3FA 2Y48A 4HYEA 2ISYA 4XBFA 2EV6A 4I0AA 1ODDA 3WODF 3TO7A 3GFLA 3FM3A 3D5LA 5JHUA 3L09A 5CVIA 4HLXA 3ELKA 5D6EA 4HW0A 2DQRA 3F21A 4ZZLA 1EH6A 3L9FA 3VEPA 4I09A 4GCVA 2M30A 5FD6A 4S05A 2MH9A 3IRQA 3IRRA 3ML6A 3P7NA 4IHTA 3MAJA 4EM2A 2ZBKA 1LVAA 3I0TA 3KP2A 3IKTA 2YR2A 1XCVA 2DPDA 2NRAC 3I54A 1T98A 1DUXC 4M6YA 3ZMUA 1LDJA 3DEUA 3O2PE 3NEUA 3DV8A 5HS9A 3DXJF 4R8HA 4HDUA 2V6CA 1WWXA 2D1VA 3F72A 2DK8A 4M74A 5DEQA 2ESNA 1MJAA 3RDIA 4ZZDA 4FX0A 2F5FA 1TW3A 4P5OA 3GX4X 3BY6A 2XV4S 1J75A 1B6AA 1EH7A 1O7LA 1S7AA 4YFKF 4LLGF 4EJTA 3BWGA 3T8TA 1IRFA 2XROA 3GFJA 1PP7U 5DD8A 3NRVA 4FHTA 2L3DA 3KP6A 4L18B 3FM5A 4BXUA 4ZYEA 1ZGAA 1FBUA 3J80Z 2H27A 2F5DA 1U8RA 2R3SA 1X3UA 4UV9A 4ENMA 3I64A 3PQKA 4IRHA 1FZPB 5ED4A 1USSA 1VTNC 4WXHA 1SFXA 1MD0A 5TRDA 2RNJA 3V8JA 2OQGA 1G3SA 3R0JA 4A0XA 4Z2YA 2ZCWA 1ZREA 3HSFA 5DUIA 2DK5A 5BPIA 4L9JA 1ON2A 1XSXA 1FP2A 4RGXA 4P9UA 1K6OA 4BNCA 5DUKA 5DCMA 4KIBA 2HYGD 4MNUA 5LHIA 1FYKA 3TO9A 3MZYA 4D0PA 1BOAA 3GZ5A 3TOAA 1RUNA 3FX3A 5JI6A 4MTEA 1PP8F 4OIOF 2DQLA 2E7XA 1GVJA 1IZ1A 2GQQA 2BE5F 2HGCA 4YFNF 2IA0A 1IN6A 2AXLA 5HLIA 4HAMA 2OZ6A 2H6CA 4XLPF 2MBFA 1NHAA 2OD5A 3E6DA 3LWFA 1K78A 1H9GA 1IN4A 1FYMA 1MDMB 4UHTA 2XHKA 2CO5A 5IT3A 2KIFA 4MEXF 2EA2A 2P7CB 3EETA 1YW8A 4I2OA 4HQMA 5ILSA 4IJAA 3C1DA 3CLOA 5E8GA 5D5VB 1R36A 1YYVA 1HSTA 2V1XA 4JK1X 3V8LA 1A04A 3O3KA 2EV0A 1W4MA 4HOBA 1F9NA 3TKYA 3LAJA 4ON0A 3WTWC 4HQEA 2ZO4A 1QQIA 2GA1A 1B59A 2ZJ2A 4AWXB 1ZRCA 4A6EA 2Y75A 3FMSA 4XSXF 1ZN2A 1IAWA 1CGPA 4L0YB 3L00A 1YQAA 2JPCA 4GGGA 1SAXA 4EJVA 2LDUA 1MJ9A 2HEOA 1QPMA 3I59A 4KMFA 2PQ8A 1P4AA 2K86A 4I98B 4DNCA 1DP7P 2IPQX 2BYVE 5ILUA 2UWMA 3Q9SA 2V79A 3QP6A 5JR3A 2Q0OA 3F8BA 2M8EA 1G3WA 2K27A 2KIMA 4JBAA 2JTVA 3WE3A 1IXRC 2ZMEA 1HSJA 4KIFA 4BHCA 2M87A 4O6JA 1SMTA 2JPBA 1SFUA 4G9YA 2F5EA 2FE3A 1Z9CA 2MH2A 3FMRA 2MLKA 5FGMA 5E1WA 4RAZA 3E6MA 5D8KB 5FLXZ 3F23A 1S3JA 1SMYF 2EFOA 1FP1D 3E5QA 3ECOA 4R1HA 2G9WA 4ENNA 3ERED 3F8CA 4KDPA 4LG0B 4N9HA 4Q4ZF 3E97A 3C7JA 2BGCA 1HQCA 4KN4X 3TDZC 2ACJA 3H92A 1OYYA 3IL2A 3WU0A 4EGYA 2A3SA 2GA2A 2X0LA 1OR7A 2P5LC 4JQFA 2VBZA 2ZKZA 1J7KA 4IRGA 3SZTA 3RPUA 3WGGA 1R1UA 3EYYA 3J81K 4YG2F 2HWVA 2VBYA 2TDXA 2XAQA 3R4KA 3LA7A 4Y13A 2QQBA 1YS7A 3J80K 2XKPA 3IWZA 1WQ2A 4M6XA 4IF4A 2OBPA 5DD4A 5ICFA 5D4SA 5E17F 2FSWA 3KP4A 1PDNC 2E1NA 5BS6A 3QP5A 2O3FA 4PZJA 3DPTA 3GWZA 3K9TA 2WTEA 2FA5A 1XN7A 3V7RA 3RIRA 3Q5FA 2UZKA 3GFIA 1YIOA 5CVVA 1O57A 1FT9A 1XSDA 2VBXA 4RGUA 2RQPA 4YIFA 3V7SA 2ZXJA 2XAFA 3CUOA 2HZTA 3QU3A 3VODA 1FPQA 1TQPA 4N0BA 1HW1A 2L4MA 3RJPA 3QPTA 4CZZA 4ASNA 3RKXA 4G94A 3ZP5A 3B73A 1U5TA 3HTUA 1W5SA 1R22A 2IVMA 3K69A 4KICA 3CDHA 3P9CA 3Q9VA 5K5QA 2EFQA 1QZZA 4RB2C 3FXUA 5HLGA 1BI1A 1K7AA 4WK8F 2B0LA 4ZH4F 4G7HF 3IHUA 5FFXA 3F8MA 4I0BA 2JSCA 2LKPA 4CHUA 2QQAA 1RI7A 4XRFA 1ZG1A 1O3SA 4MHGA 3MWMA 2UXXA 4Q5SF 1XGMA 2GXBA 2NNYA 3L2CA 1AOYA 1O7FA 2VE8A 2VN2A 4HF1A 3GVAA 3HRMA 3F22A 3IKVA 2XIGA 2XVCA 2A61A 4CO8A 4YIIA 1FBSA 1TQMA 3MQ0A 2EFPA 4HBLA 1F1ZA 3ZMTA 1BI3A 1YG2A 2W24A 3OOPA 5HDGA 3GFMA 3JW4A 3WGHA 2HDCA 1HKTA 3ULQB 4LLLA 2M5WA 1HW5A 1ZLKA 1QO0D 2FNAA 1KA8A 2Z3YA 1T0FA 2V1DA 4P96A 2H6BA 4MEYF 4KMUX 4L0ZB 1LDKB 3P9IA 2OQRA 2HTJA 1U5TC 2PMHA 3PQJA 4ENJA 2PN6A 4Y17A 3RPQA 2ZFWA 4MTDA 2QVOA 3GZ6A 1BIAA 4EM1A 3HTSB 1U3EM 2YPRA 5D5UB 3PFIA 2AS5F 3ZQ7A 2QUFA 2FBHA 1KQ8A 3EYIA 4HF0A 1R58A 2WV0A 1LEAA 2A07F 2Z33A 2XASA 2QM3A 1DPUA 3KFWX 2EWNA 3F8NA 1ULYA 1YO5C 3V8KA 3LFKA 2EJRA 4M9XA 3GYHX 2BV6A 3R60A 2VE9A 4IVNA 4ZYDA 1IF1A 4QLCU 4TV7A 4NHJA 2RN7A 2VOOA 3QRFF 3DKWA 3V7CA 1QZYA 2P5VA 2CGPA 1FLIA 5FD5A 4L9NA 4OIRF 3M8FA 1U6GA 5FLXK 3RKYA 5HOOA 4IRIA 3WTSC 5TJJA 4WXCA 1FC3A 4G6DA 2LNBA 1R1TA 5HLHA 3ZMZA 4HZFA 4FX4A 5IT9Z 5D5WB 4L5IA 2P5KA 4WX9A 2HTSA 2P6TA 3E6BA 5BMZA 1YTYA 2R7DA 4LJZF 2COMA 2FMYA 1L3LA 2ELHA 1Z1DA 5LGUA 3M7GA 4EVIA 2Z9OA 1F5TA 5KK1A 2HR3A 3G73A 1XB4A 3HSRA 2A68F 3S2WA 3WG9A 3CTAA 4UVAA 1R23A 1E2XA 2IRFG 4AIHA 1V4RA 1W7PB 3CO6C 1XD7A 2FRHA 2Z99A 4FT8A 1RUOA 1R00A 1MDMA 2PLYA 1ZG5A 1P6RA 1KYZA 2VONA 5L3BA 4LK0F 1I1SA 4WF2A 2DU9A 1D8JA 3H3ZA 2WC2A 4LGWA 3FMQA 2XKOA 1K79A 1IN8A 1EV7A 2PJPA 3WTTC 2IW5A 4XSZF 2HOEA 3FXQA 1YS6A 3ZMDA 4PGHA 3GO5A 3ZMVA 1GXQA 2HFHA 5ILVA 1CF7A 4WCGA 3GXOA 4Q48A 3GEZA 1TQIA 4OINF 3RYRA 2DBBA 5KVRA 3BJAA 2GAUA 2DT5A 1FBQA 2OAZA 2JT1A 4GXOA 1UFMA 1W5TA 1U78A 4BHBA 5HDKA 1EH8A 4OU0A 1BC8C 2DAOA 2L01A 3HRTA 3E3VA 3F6VA 3ZN0A 2MA3A 3O6BB 4EJWA 2VT3A 1WRJA 3I4PA 1H9TA 4HV6A 3SFZA 1J59A 3EDPA 1DPRA 5A2QK 2LF7A 4OIQF 3TOBA 4O3MA 2DFIA 4KNYA 1OYWA 4WXDA 2Q8KA 4S04A 3F6OA 3SHFA 1HKQA 1YLFA 2L02A 3BROA 3ROUA 2DPUA 2IT0A 3GF2A 2NAZA 3E5XA 2A6EF 4HX4A 2W84A 3BP8A 4EJUA 4ZYHA 4K2EA 2Q2EA 3M9AA 5J8FA 3ZMSA 2EV5A 2K02A 2P6SA 2X4HA 4RB3C 3CUQB 5F6FA 1I1GA 5L3EA 3WU1B 3KP7A 1OPCA 4AVPA 5E20A 5D5XB 5LHHA 6PAXA 4RAYA 3HUGA 1R5GA 2DO7A 2FBKA 1SD7A 3BJOA 2Y0MA 3D0SA 3W6JB 4BAYA 2ISZA 2D45A 3FZVA 4UXNA 3MCZA 4LG0A 2L4AA 4N9IA 2HKXA 3U1DA 5CLSA 1PUEE 1Z91A 1TLHB 2P7VB 3VFZA 1XGNA 2JZYA 4RB1A 1B1BA 4CDGA 3QPHA 2VC0A 1MJBA 3W6KB 2CQKA 2L54A 1I5ZA 3P9KA 3HHHA 2F2EA 1ZRFA 2GZWA 2W57A 2LF8A 2E7WA 3HSEA 4EGZA 2CSOA 2KIUA 5L3DA 2ESHA 1BJAA 4MGRA 1GHCA 2YSRA 4A6DA 4EQQA 4PCQA 2XUBA 4ESBA 1FY7A 2QBYB 3I5UA 3REOA 5CVRA 3VOEA 2IA2A 3WTVC 2H94A 4U0WA 5FB2A 1W7PD 4U88A 3N97A 2FU4A 4P55A 2DTRA 1XDUA 3B02A 2YX7A 1ZAOA 1WSUA 1LB2A 2QQ9A 3E6CC 1UHMA 3MEXA 1FSEA 1RNLA 3HOTA 3U2RA 1SD6A 5IT9K 3NQOA 1YW9A 1J2XA 2G7UA 2D1HA 4EV0A 3SXYA 4EM0B 5J8CA 3T1BA 2O61A 4MQ9F 2HYFA 3R0AA 1JHFA 2QZ8A 1XDSA 2VT2A 1QNTA 4UVBA 1HKSA 1RZ4A 4M71A 2WWYA 4KFCA 5JVTA 3MFKA 5E8IA 2PFBA 3FF5A 4U7DA 4KT5C 3KCCA 5L3CA 4B09A 4LK1F 1FOKA 2QYOA 5LHGA 1E17A 2A5YB 1G3TA 3K1PA 5E1ZB 3LQQA 3BZ6A 2F5CA 1LNWA 3R6SA 4L9VA 2NS0A 3BPVA 1Z05A 5LGTA 4U0YA 4CXFA 4A5MA 1P2FA 3QOPA 4ESJA 1WI9A 1ZG3A 3SZPA 1USTA 5E18F 4M9ZA 2YU3A 3COAC 2KRFA 2HKOA 4PGGA 1KQ0A 4LB5A 2FNPA 1BIBA 1T39A 3GLXA 2CG4A 4I01A 2A6HF 1HXDA 5LRSA 5HS8A 1R7JA 4GYGA 1WKMA 2XGXA 5K5RA 1Z6RA 3ZPLA 2OZUA 4G7OF 2QLZA 5BQTA 2M45A 1YFHA 4G7ZF 1ZGJA 4IXAA 1RIOH 5HS7A 4A5NA 2ZNZA 2KJBA 5D6FA 2XAJA 3FXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K2Z A;  1XGO A;  3K1M A;  2ETH A;  2MLG A;  4Y15 A;  2K7L A;  4ENK A;  4L5J A;  1S6L A;  1I6X A;  4XLN F;  5ICE A;  4LFU A;  1MZB A;  3AAF A;  5LGN A;  3C3W A;  1G3Y A;  3I53 A;  3QAH A;  1TBX A;  2LSO A;  3WTU C;  1TNS A;  3ISP A;  2FEZ A;  1IXC A;  3U9G A;  1P4X A;  1ZRD A;  3HIF A;  3F3X A;  5CYV A;  3ABU A;  1FNN A;  1AWC A;  5J6X A;  2FBI A;  2GXG A;  1MKM A;  2GWR A;  3JTG A;  5LEJ A;  1KU3 A;  4AIK A;  3M1E A;  1SD4 A;  1O3Q A;  4HA8 A;  3BDD A;  4HX8 A;  2EFW A;  2RV8 A;  2PG4 A;  1ZYR F;  3L7W A;  3J81 Z;  2IJL A;  4EJO A;  1FWZ A;  4ESF A;  3LST A;  1KQ9 A;  1JXS A;  3KEO A;  3FHZ A;  5H6Q A;  4LD5 A;  2QWW A;  4M73 A;  2A69 F;  2CFX A;  2FF4 A;  4RGS A;  4HDV A;  4KA4 A;  1W7P A;  4UNO A;  3WTX C;  1QBJ A;  2VOP A;  4GO1 A;  2STT A;  4P9F A;  2PI0 A;  2HS5 A;  3DP7 A;  5K5O A;  5ERI A;  3M8E A;  2XAH A;  4HX7 A;  4UV8 A;  5ICC A;  5FFZ A;  4PDK A;  2NNN A;  4HF2 A;  1J0R A;  4EMS A;  1QGP A;  4KYW A;  2VXZ A;  1ZAR A;  3WGI A;  2VBW A;  2IA1 A;  2RDP A;  1S29 A;  3MZH A;  2PBI A;  1OYI A;  4ETS A;  5EEH A;  1U2W A;  3C18 A;  1G4D A;  1R1V A;  3JAM Z;  4OMZ A;  2VOD A;  2NYX A;  3HOS A;  2OU2 A;  1O3R A;  2HQR A;  5DCM B;  5HVQ C;  2EB7 A;  1J9I A;  3GW2 A;  1P92 A;  3DFG A;  1P4W A;  1BN5 A;  4UVC A;  1T2K A;  3I58 A;  2EK5 A;  5K1Y A;  2C6Y A;  3RYP A;  3HYI A;  1IXS B;  4E70 A;  4B8X A;  3WTZ A;  2EA4 A;  3JSO A;  2W85 A;  5L3G A;  1J5Y A;  3ECH A;  2XAG A;  3IWF A;  2FML A;  2D2W A;  5E1X A;  3LA2 A;  3TGN A;  2MD5 A;  4O5V A;  5DDG A;  1K78 B;  4HV5 A;  4GYI A;  2O6G E;  1B9M A;  5AIQ A;  1OMI A;  3DF8 A;  5LRR A;  3T5X A;  1CF7 B;  1BM9 A;  2W25 A;  1XSV A;  4QWQ A;  2P8T A;  2KJC A;  2PEX A;  4AD9 A;  4OIP F;  2QEN A;  1GXP A;  3KZY A;  2ZNY A;  4M72 A;  4OMY A;  1Q1H A;  1R5H A;  1KYW A;  4H0E A;  5JFR A;  5CJ9 A;  5AON A;  3CUQ A;  5DV5 A;  2DLL A;  1BI2 A;  1OKR A;  1XMK A;  3ZN1 A;  5H6R A;  1LEB A;  4L9T A;  5CVU A;  3BOQ A;  3V4G A;  1B4A A;  4RS8 A;  3BJ6 A;  1LJ9 A;  3TDU C;  3WTY C;  4BHP A;  3LAP A;  3KE2 A;  1ZLJ A;  2RGV A;  2CWE A;  5LLQ A;  1IUY A;  1JE8 A;  2RKH A;  3KEQ A;  3N4M A;  1JHH A;  3T8R A;  3F8F A;  2CW0 F;  2XRN A;  2K4J A;  4BYY A;  3CJN A;  4MQV A;  3I59 B;  3QU6 A;  5HDN A;  1KU9 A;  2O8X A;  3T0Y A;  1STZ A;  2RC4 A;  3TQN A;  2ADU A;  4CIC A;  2PMU A;  3KLO A;  3K1N A;  1UHW A;  3J7A O;  4A0Y A;  3EUH A;  3DQV C;  5H20 A;  1TTY A;  2GIV A;  3KZZ A;  2V9V A;  4NQW A;  2FQ3 A;  2QBY A;  4Q47 A;  2VC1 A;  1IN7 A;  3HRU A;  2ZME B;  3KP3 A;  1T6S A;  2M1B A;  1JGS A;  3DPL C;  3SQN A;  1B9N A;  1XCB A;  1Y0U A;  4BQA A;  4A2U A;  4UUV A;  1G6N A;  4A12 A;  5BPD A;  1Z7U A;  1O3T A;  2MC3 A;  3K0L A;  1TW2 A;  4CYD A;  2FXA A;  3CO7 C;  1Z6T A;  1BBY A;  2BBY A;  1H0M A;  4LB6 B;  3I71 A;  2P4W A;  5F1R A;  3RKW A;  3CUQ C;  3WE2 A;  1REP C;  1T38 A;  1LQ1 A;  1XGS A;  3VB2 A;  2YX4 A;  1KGS A;  4I7H A;  1S8N A;  2STW A;  4IPA A;  3IC7 A;  4F7Z A;  2HQN A;  2V1U A;  1L0O C;  2DW4 A;  5BOX A;  3H3U A;  1FYL A;  3RI4 A;  5EEG A;  1ZH5 A;  3E5U A;  1UCR A;  1FSH A;  1IN5 A;  4NB5 A;  1IW7 F;  2KKO A;  2UXN A;  2EFN A;  4KN7 X;  2J5O A;  3JSP A;  1D3Y A;  1D5V A;  2IP2 A;  4U0V A;  1C0W A;  3TO6 A;  1IRG A;  1UB9 A;  3G3Z A;  4I02 A;  4LLN A;  1D8K A;  5ICG A;  4G6Q A;  4M9S A;  4KIG A;  5F64 A;  1ZHF A;  4A0Z A;  5D4R A;  1HBX G;  1YW7 A;  4G8X A;  2O0Y A;  4DQ2 A;  3ABT A;  4IHS A;  3HHG A;  3LA3 A;  2J5P A;  3R61 A;  4OOI A;  1S7O A;  5CVJ A;  4KUM A;  4BH9 A;  2CYY A;  2E1C A;  5L3F A;  4RGR A;  5FO5 A;  1MGT A;  3JAM K;  2R7F A;  1ON1 A;  3EQL F;  5DYM A;  1F4K A;  5D8L B;  5LBQ A;  1SFE A;  1XMA A;  1SD5 A;  1U5T B;  1FX7 A;  2O03 A;  4U7B A;  1KU7 A;  2RVC A;  2OA4 A;  1TNT A;  1ONV A;  2BEO A;  1I27 A;  2K4B A;  1BI0 A;  4R79 A;  3LQR A;  5A2Q Z;  1DDN A;  1KU2 A;  1BC7 C;  2G7H A;  5LEK A;  2H09 A;  3BPX A;  3GUD A;  3KLN A;  3FWE A;  2Z5U A;  3HRS A;  2JRT A;  4WWC A;  3RTR A;  4RB0 A;  2FOK A;  4YFX F;  4HLY A;  1HW2 A;  3JTH A;  5DCF A;  4AIJ A;  4LMY A;  1LDD A;  3OV8 A;  5AIP A;  3KET A;  2DI3 A;  4CGZ A;  4ZYG A;  3KP5 A;  1V3F A;  2Y48 A;  4HYE A;  2ISY A;  4XBF A;  2EV6 A;  4I0A A;  1ODD A;  3WOD F;  3TO7 A;  3GFL A;  3FM3 A;  3D5L A;  5JHU A;  3L09 A;  5CVI A;  4HLX A;  3ELK A;  5D6E A;  4HW0 A;  2DQR A;  3F21 A;  4ZZL A;  1EH6 A;  3L9F A;  3VEP A;  4I09 A;  4GCV A;  2M30 A;  5FD6 A;  4S05 A;  2MH9 A;  3IRQ A;  3IRR A;  3ML6 A;  3P7N A;  4IHT A;  3MAJ A;  4EM2 A;  2ZBK A;  1LVA A;  3I0T A;  3KP2 A;  3IKT A;  2YR2 A;  1XCV A;  2DPD A;  2NRA C;  3I54 A;  1T98 A;  1DUX C;  4M6Y A;  3ZMU A;  1LDJ A;  3DEU A;  3O2P E;  3NEU A;  3DV8 A;  5HS9 A;  3DXJ F;  4R8H A;  4HDU A;  2V6C A;  1WWX A;  2D1V A;  3F72 A;  2DK8 A;  4M74 A;  5DEQ A;  2ESN A;  1MJA A;  3RDI A;  4ZZD A;  4FX0 A;  2F5F A;  1TW3 A;  4P5O A;  3GX4 X;  3BY6 A;  2XV4 S;  1J75 A;  1B6A A;  1EH7 A;  1O7L A;  1S7A A;  4YFK F;  4LLG F;  4EJT A;  3BWG A;  3T8T A;  1IRF A;  2XRO A;  3GFJ A;  1PP7 U;  5DD8 A;  3NRV A;  4FHT A;  2L3D A;  3KP6 A;  4L18 B;  3FM5 A;  4BXU A;  4ZYE A;  1ZGA A;  1FBU A;  3J80 Z;  2H27 A;  2F5D A;  1U8R A;  2R3S A;  1X3U A;  4UV9 A;  4ENM A;  3I64 A;  3PQK A;  4IRH A;  1FZP B;  5ED4 A;  1USS A;  1VTN C;  4WXH A;  1SFX A;  1MD0 A;  5TRD A;  2RNJ A;  3V8J A;  2OQG A;  1G3S A;  3R0J A;  4A0X A;  4Z2Y A;  2ZCW A;  1ZRE A;  3HSF A;  5DUI A;  2DK5 A;  5BPI A;  4L9J A;  1ON2 A;  1XSX A;  1FP2 A;  4RGX A;  4P9U A;  1K6O A;  4BNC A;  5DUK A;  5DCM A;  4KIB A;  2HYG D;  4MNU A;  5LHI A;  1FYK A;  3TO9 A;  3MZY A;  4D0P A;  1BOA A;  3GZ5 A;  3TOA A;  1RUN A;  3FX3 A;  5JI6 A;  4MTE A;  1PP8 F;  4OIO F;  2DQL A;  2E7X A;  1GVJ A;  1IZ1 A;  2GQQ A;  2BE5 F;  2HGC A;  4YFN F;  2IA0 A;  1IN6 A;  2AXL A;  5HLI A;  4HAM A;  2OZ6 A;  2H6C A;  4XLP F;  2MBF A;  1NHA A;  2OD5 A;  3E6D A;  3LWF A;  1K78 A;  1H9G A;  1IN4 A;  1FYM A;  1MDM B;  4UHT A;  2XHK A;  2CO5 A;  5IT3 A;  2KIF A;  4MEX F;  2EA2 A;  2P7C B;  3EET A;  1YW8 A;  4I2O A;  4HQM A;  5ILS A;  4IJA A;  3C1D A;  3CLO A;  5E8G A;  5D5V B;  1R36 A;  1YYV A;  1HST A;  2V1X A;  4JK1 X;  3V8L A;  1A04 A;  3O3K A;  2EV0 A;  1W4M A;  4HOB A;  1F9N A;  3TKY A;  3LAJ A;  4ON0 A;  3WTW C;  4HQE A;  2ZO4 A;  1QQI A;  2GA1 A;  1B59 A;  2ZJ2 A;  4AWX B;  1ZRC A;  4A6E A;  2Y75 A;  3FMS A;  4XSX F;  1ZN2 A;  1IAW A;  1CGP A;  4L0Y B;  3L00 A;  1YQA A;  2JPC A;  4GGG A;  1SAX A;  4EJV A;  2LDU A;  1MJ9 A;  2HEO A;  1QPM A;  3I59 A;  4KMF A;  2PQ8 A;  1P4A A;  2K86 A;  4I98 B;  4DNC A;  1DP7 P;  2IPQ X;  2BYV E;  5ILU A;  2UWM A;  3Q9S A;  2V79 A;  3QP6 A;  5JR3 A;  2Q0O A;  3F8B A;  2M8E A;  1G3W A;  2K27 A;  2KIM A;  4JBA A;  2JTV A;  3WE3 A;  1IXR C;  2ZME A;  1HSJ A;  4KIF A;  4BHC A;  2M87 A;  4O6J A;  1SMT A;  2JPB A;  1SFU A;  4G9Y A;  2F5E A;  2FE3 A;  1Z9C A;  2MH2 A;  3FMR A;  2MLK A;  5FGM A;  5E1W A;  4RAZ A;  3E6M A;  5D8K B;  5FLX Z;  3F23 A;  1S3J A;  1SMY F;  2EFO A;  1FP1 D;  3E5Q A;  3ECO A;  4R1H A;  2G9W A;  4ENN A;  3ERE D;  3F8C A;  4KDP A;  4LG0 B;  4N9H A;  4Q4Z F;  3E97 A;  3C7J A;  2BGC A;  1HQC A;  4KN4 X;  3TDZ C;  2ACJ A;  3H92 A;  1OYY A;  3IL2 A;  3WU0 A;  4EGY A;  2A3S A;  2GA2 A;  2X0L A;  1OR7 A;  2P5L C;  4JQF A;  2VBZ A;  2ZKZ A;  1J7K A;  4IRG A;  3SZT A;  3RPU A;  3WGG A;  1R1U A;  3EYY A;  3J81 K;  4YG2 F;  2HWV A;  2VBY A;  2TDX A;  2XAQ A;  3R4K A;  3LA7 A;  4Y13 A;  2QQB A;  1YS7 A;  3J80 K;  2XKP A;  3IWZ A;  1WQ2 A;  4M6X A;  4IF4 A;  2OBP A;  5DD4 A;  5ICF A;  5D4S A;  5E17 F;  2FSW A;  3KP4 A;  1PDN C;  2E1N A;  5BS6 A;  3QP5 A;  2O3F A;  4PZJ A;  3DPT A;  3GWZ A;  3K9T A;  2WTE A;  2FA5 A;  1XN7 A;  3V7R A;  3RIR A;  3Q5F A;  2UZK A;  3GFI A;  1YIO A;  5CVV A;  1O57 A;  1FT9 A;  1XSD A;  2VBX A;  4RGU A;  2RQP A;  4YIF A;  3V7S A;  2ZXJ A;  2XAF A;  3CUO A;  2HZT A;  3QU3 A;  3VOD A;  1FPQ A;  1TQP A;  4N0B A;  1HW1 A;  2L4M A;  3RJP A;  3QPT A;  4CZZ A;  4ASN A;  3RKX A;  4G94 A;  3ZP5 A;  3B73 A;  1U5T A;  3HTU A;  1W5S A;  1R22 A;  2IVM A;  3K69 A;  4KIC A;  3CDH A;  3P9C A;  3Q9V A;  5K5Q A;  2EFQ A;  1QZZ A;  4RB2 C;  3FXU A;  5HLG A;  1BI1 A;  1K7A A;  4WK8 F;  2B0L A;  4ZH4 F;  4G7H F;  3IHU A;  5FFX A;  3F8M A;  4I0B A;  2JSC A;  2LKP A;  4CHU A;  2QQA A;  1RI7 A;  4XRF A;  1ZG1 A;  1O3S A;  4MHG A;  3MWM A;  2UXX A;  4Q5S F;  1XGM A;  2GXB A;  2NNY A;  3L2C A;  1AOY A;  1O7F A;  2VE8 A;  2VN2 A;  4HF1 A;  3GVA A;  3HRM A;  3F22 A;  3IKV A;  2XIG A;  2XVC A;  2A61 A;  4CO8 A;  4YII A;  1FBS A;  1TQM A;  3MQ0 A;  2EFP A;  4HBL A;  1F1Z A;  3ZMT A;  1BI3 A;  1YG2 A;  2W24 A;  3OOP A;  5HDG A;  3GFM A;  3JW4 A;  3WGH A;  2HDC A;  1HKT A;  3ULQ B;  4LLL A;  2M5W A;  1HW5 A;  1ZLK A;  1QO0 D;  2FNA A;  1KA8 A;  2Z3Y A;  1T0F A;  2V1D A;  4P96 A;  2H6B A;  4MEY F;  4KMU X;  4L0Z B;  1LDK B;  3P9I A;  2OQR A;  2HTJ A;  1U5T C;  2PMH A;  3PQJ A;  4ENJ A;  2PN6 A;  4Y17 A;  3RPQ A;  2ZFW A;  4MTD A;  2QVO A;  3GZ6 A;  1BIA A;  4EM1 A;  3HTS B;  1U3E M;  2YPR A;  5D5U B;  3PFI A;  2AS5 F;  3ZQ7 A;  2QUF A;  2FBH A;  1KQ8 A;  3EYI A;  4HF0 A;  1R58 A;  2WV0 A;  1LEA A;  2A07 F;  2Z33 A;  2XAS A;  2QM3 A;  1DPU A;  3KFW X;  2EWN A;  3F8N A;  1ULY A;  1YO5 C;  3V8K A;  3LFK A;  2EJR A;  4M9X A;  3GYH X;  2BV6 A;  3R60 A;  2VE9 A;  4IVN A;  4ZYD A;  1IF1 A;  4QLC U;  4TV7 A;  4NHJ A;  2RN7 A;  2VOO A;  3QRF F;  3DKW A;  3V7C A;  1QZY A;  2P5V A;  2CGP A;  1FLI A;  5FD5 A;  4L9N A;  4OIR F;  3M8F A;  1U6G A;  5FLX K;  3RKY A;  5HOO A;  4IRI A;  3WTS C;  5TJJ A;  4WXC A;  1FC3 A;  4G6D A;  2LNB A;  1R1T A;  5HLH A;  3ZMZ A;  4HZF A;  4FX4 A;  5IT9 Z;  5D5W B;  4L5I A;  2P5K A;  4WX9 A;  2HTS A;  2P6T A;  3E6B A;  5BMZ A;  1YTY A;  2R7D A;  4LJZ F;  2COM A;  2FMY A;  1L3L A;  2ELH A;  1Z1D A;  5LGU A;  3M7G A;  4EVI A;  2Z9O A;  1F5T A;  5KK1 A;  2HR3 A;  3G73 A;  1XB4 A;  3HSR A;  2A68 F;  3S2W A;  3WG9 A;  3CTA A;  4UVA A;  1R23 A;  1E2X A;  2IRF G;  4AIH A;  1V4R A;  1W7P B;  3CO6 C;  1XD7 A;  2FRH A;  2Z99 A;  4FT8 A;  1RUO A;  1R00 A;  1MDM A;  2PLY A;  1ZG5 A;  1P6R A;  1KYZ A;  2VON A;  5L3B A;  4LK0 F;  1I1S A;  4WF2 A;  2DU9 A;  1D8J A;  3H3Z A;  2WC2 A;  4LGW A;  3FMQ A;  2XKO A;  1K79 A;  1IN8 A;  1EV7 A;  2PJP A;  3WTT C;  2IW5 A;  4XSZ F;  2HOE A;  3FXQ A;  1YS6 A;  3ZMD A;  4PGH A;  3GO5 A;  3ZMV A;  1GXQ A;  2HFH A;  5ILV A;  1CF7 A;  4WCG A;  3GXO A;  4Q48 A;  3GEZ A;  1TQI A;  4OIN F;  3RYR A;  2DBB A;  5KVR A;  3BJA A;  2GAU A;  2DT5 A;  1FBQ A;  2OAZ A;  2JT1 A;  4GXO A;  1UFM A;  1W5T A;  1U78 A;  4BHB A;  5HDK A;  1EH8 A;  4OU0 A;  1BC8 C;  2DAO A;  2L01 A;  3HRT A;  3E3V A;  3F6V A;  3ZN0 A;  2MA3 A;  3O6B B;  4EJW A;  2VT3 A;  1WRJ A;  3I4P A;  1H9T A;  4HV6 A;  3SFZ A;  1J59 A;  3EDP A;  1DPR A;  5A2Q K;  2LF7 A;  4OIQ F;  3TOB A;  4O3M A;  2DFI A;  4KNY A;  1OYW A;  4WXD A;  2Q8K A;  4S04 A;  3F6O A;  3SHF A;  1HKQ A;  1YLF A;  2L02 A;  3BRO A;  3ROU A;  2DPU A;  2IT0 A;  3GF2 A;  2NAZ A;  3E5X A;  2A6E F;  4HX4 A;  2W84 A;  3BP8 A;  4EJU A;  4ZYH A;  4K2E A;  2Q2E A;  3M9A A;  5J8F A;  3ZMS A;  2EV5 A;  2K02 A;  2P6S A;  2X4H A;  4RB3 C;  3CUQ B;  5F6F A;  1I1G A;  5L3E A;  3WU1 B;  3KP7 A;  1OPC A;  4AVP A;  5E20 A;  5D5X B;  5LHH A;  6PAX A;  4RAY A;  3HUG A;  1R5G A;  2DO7 A;  2FBK A;  1SD7 A;  3BJO A;  2Y0M A;  3D0S A;  3W6J B;  4BAY A;  2ISZ A;  2D45 A;  3FZV A;  4UXN A;  3MCZ A;  4LG0 A;  2L4A A;  4N9I A;  2HKX A;  3U1D A;  5CLS A;  1PUE E;  1Z91 A;  1TLH B;  2P7V B;  3VFZ A;  1XGN A;  2JZY A;  4RB1 A;  1B1B A;  4CDG A;  3QPH A;  2VC0 A;  1MJB A;  3W6K B;  2CQK A;  2L54 A;  1I5Z A;  3P9K A;  3HHH A;  2F2E A;  1ZRF A;  2GZW A;  2W57 A;  2LF8 A;  2E7W A;  3HSE A;  4EGZ A;  2CSO A;  2KIU A;  5L3D A;  2ESH A;  1BJA A;  4MGR A;  1GHC A;  2YSR A;  4A6D A;  4EQQ A;  4PCQ A;  2XUB A;  4ESB A;  1FY7 A;  2QBY B;  3I5U A;  3REO A;  5CVR A;  3VOE A;  2IA2 A;  3WTV C;  2H94 A;  4U0W A;  5FB2 A;  1W7P D;  4U88 A;  3N97 A;  2FU4 A;  4P55 A;  2DTR A;  1XDU A;  3B02 A;  2YX7 A;  1ZAO A;  1WSU A;  1LB2 A;  2QQ9 A;  3E6C C;  1UHM A;  3MEX A;  1FSE A;  1RNL A;  3HOT A;  3U2R A;  1SD6 A;  5IT9 K;  3NQO A;  1YW9 A;  1J2X A;  2G7U A;  2D1H A;  4EV0 A;  3SXY A;  4EM0 B;  5J8C A;  3T1B A;  2O61 A;  4MQ9 F;  2HYF A;  3R0A A;  1JHF A;  2QZ8 A;  1XDS A;  2VT2 A;  1QNT A;  4UVB A;  1HKS A;  1RZ4 A;  4M71 A;  2WWY A;  4KFC A;  5JVT A;  3MFK A;  5E8I A;  2PFB A;  3FF5 A;  4U7D A;  4KT5 C;  3KCC A;  5L3C A;  4B09 A;  4LK1 F;  1FOK A;  2QYO A;  5LHG A;  1E17 A;  2A5Y B;  1G3T A;  3K1P A;  5E1Z B;  3LQQ A;  3BZ6 A;  2F5C A;  1LNW A;  3R6S A;  4L9V A;  2NS0 A;  3BPV A;  1Z05 A;  5LGT A;  4U0Y A;  4CXF A;  4A5M A;  1P2F A;  3QOP A;  4ESJ A;  1WI9 A;  1ZG3 A;  3SZP A;  1UST A;  5E18 F;  4M9Z A;  2YU3 A;  3COA C;  2KRF A;  2HKO A;  4PGG A;  1KQ0 A;  4LB5 A;  2FNP A;  1BIB A;  1T39 A;  3GLX A;  2CG4 A;  4I01 A;  2A6H F;  1HXD A;  5LRS A;  5HS8 A;  1R7J A;  4GYG A;  1WKM A;  2XGX A;  5K5R A;  1Z6R A;  3ZPL A;  2OZU A;  4G7O F;  2QLZ A;  5BQT A;  2M45 A;  1YFH A;  4G7Z F;  1ZGJ A;  4IXA A;  1RIO H;  5HS7 A;  4A5N A;  2ZNZ A;  2KJB A;  5D6F A;  2XAJ A;  3FXR A; 
#chains in the Genus database with same CATH topology
 1MMA A;  2XB0 X;  3K2Z A;  1XGO A;  3K1M A;  9ANT A;  4LIT A;  2ETH A;  2MLG A;  4Y15 A;  4CCL A;  2K7L A;  4ENK A;  1X3W B;  2CRG A;  4L5J A;  1W0T A;  2LH9 A;  1S6L A;  1I6X A;  3E1S A;  4XLN F;  4CH7 A;  5ICE A;  4LFU A;  1MZB A;  3CJR B;  1TP4 A;  3AAF A;  2RAE A;  1R71 A;  3KYD B;  3O8G A;  2BXZ A;  5LGN A;  1TWC J;  4QTR A;  1X1A A;  3C3W A;  1G3Y A;  2IAI A;  4AU7 A;  1MBJ A;  2M8G X;  2DJN A;  2DMQ A;  3I53 A;  3QAH A;  1TBX A;  3UKG A;  2VUM J;  4DOZ A;  2LSO A;  3SDB A;  1VQ9 I;  3WTU C;  1TNS A;  3ISP A;  3H3V K;  5IYD J;  1WJD A;  1ZKG A;  5DM6 F;  1N78 A;  1FMW A;  2FEZ A;  4FCY A;  2LG4 A;  3H0D A;  1IXC A;  3U9G A;  1P4X A;  1OFC X;  3CQZ J;  1ZRD A;  4BGD A;  3CC7 I;  3HIF A;  3F3X A;  5CYV A;  3ABU A;  5C44 J;  1IRX A;  2L7Z A;  3S3O A;  2VPR A;  1FNN A;  3CJT B;  3PNV A;  1AWC A;  4KIS A;  5J6X A;  1JTX A;  2FBI A;  4RAG A;  3OIP A;  1WJC A;  2GXG A;  1I50 J;  1MKM A;  2GWR A;  5K7F A;  5B3S H;  3JTG A;  3CMY A;  5LEJ A;  1KU3 A;  4AIK A;  3M1E A;  1SD4 A;  1O3Q A;  5FJ8 J;  4HA8 A;  2DXI A;  3BDD A;  4HX8 A;  4D7M A;  3CZ6 A;  2IS2 A;  1ETO A;  1DP3 A;  2EFW A;  2RV8 A;  4M6V A;  2XGE A;  2PG4 A;  1YJW I;  1ZYR F;  3L7W A;  3J81 Z;  2IJL A;  2ZXH A;  2GM4 A;  1IUF A;  4EJO A;  3E0J B;  1FWZ A;  1VQ6 I;  2X6Y A;  2CU7 A;  4ESF A;  3MN2 A;  1PUF B;  1WHU A;  1ETV A;  3LST A;  2B63 J;  1KQ9 A;  1TWA J;  1JXS A;  3BG5 A;  3KEO A;  3FHZ A;  5H6Q A;  3OYE A;  4LD5 A;  2WV1 A;  2QWW A;  1QPI A;  2ME6 A;  4M73 A;  3VYT B;  4XLA A;  3HOW J;  2A69 F;  2CFX A;  2FF4 A;  4RGS A;  3DTI A;  3LFU A;  4HDV A;  4KA4 A;  3GTP J;  2HVR A;  2DA6 A;  1K6Y A;  4Y3O A;  1X4O A;  3BG9 A;  2Y9Z A;  1W7P A;  4UNO A;  4B44 A;  2BW3 B;  5H2F C;  2HPM A;  3WTX C;  1QBJ A;  2VOP A;  4GO1 A;  2STT A;  4P9F A;  2PI0 A;  4V2G A;  3Q3S A;  2HS5 A;  2LKS A;  4A3G J;  4PFO A;  3DP7 A;  5K5O A;  5ERI A;  5DTD A;  5JHF A;  3L2V A;  2I10 A;  4B48 A;  3G71 I;  2V9K A;  2CUE A;  3M8E A;  2L7M P;  2XPV A;  2XAH A;  3OYL A;  3ZXS A;  5CQG A;  4HX7 A;  2KRH A;  2R5Z B;  1DU0 A;  3I9V 2;  4UV8 A;  5ICC A;  5FFZ A;  1W0U A;  1A31 A;  4PDK A;  2NNN A;  1MMG A;  4ZDP A;  4HF2 A;  1UG0 A;  1VI0 A;  4DGW B;  1YX5 A;  1J0R A;  3F9K A;  1QGP A;  3M1C A;  4EMS A;  2JN6 A;  4NC8 A;  4KYW A;  2VXZ A;  2R5Y B;  1ZAR A;  3WGI A;  3L2W A;  2VBW A;  5B1B H;  3JRH A;  2IA1 A;  2RDP A;  1S29 A;  3HZJ A;  5GAE J;  3MZH A;  1MW7 A;  2PBI A;  3ZRG A;  1OLT A;  1OYI A;  2K9Q A;  2M9H A;  4ETS A;  5EEH A;  4V19 K;  1D0Y A;  1U2W A;  3C18 A;  1G4D A;  1R1V A;  2DDA A;  3JAM Z;  4OMZ A;  2VOD A;  2NYX A;  3HOS A;  2OU2 A;  1O3R A;  2HQR A;  1J09 A;  1R9T J;  5DCM B;  4HPQ A;  3H35 A;  2W00 A;  5HVQ C;  3MKL A;  2EB7 A;  4W1U A;  4UUS B;  1Y6I A;  1GUU A;  1J9I A;  4QPQ A;  2CW8 A;  1HDP A;  2I5U A;  2X6X A;  2TRT A;  3GW2 A;  4AYB A;  1P92 A;  3DFG A;  1P4W A;  1BN5 A;  1W1W E;  2KHM A;  1AU7 A;  2ME0 A;  4UVC A;  1WZ2 A;  1T2K A;  2BHY A;  3B6A A;  3I58 A;  2EK5 A;  5J4V A;  2R4G A;  4CCO A;  5K1Y A;  3S93 A;  2E60 A;  2C6Y A;  2O8K A;  2ELJ A;  3RYP A;  1DU6 A;  3HYI A;  2VQC A;  3FBI B;  3IH2 A;  1VQO I;  2F4M B;  1IXS B;  4E70 A;  4PJL A;  2CV0 A;  4B8X A;  3WTZ A;  2EA4 A;  2E1O A;  3JSO A;  4LIV A;  1R5I D;  2W85 A;  3VYR B;  2LBF B;  5L3G A;  5FKO A;  3G4S I;  1J5Y A;  3ECH A;  5F0F A;  1FEX A;  2XAG A;  4A3C J;  3IWF A;  2FML A;  3JRB A;  2D2W A;  3LA2 A;  1D0Z A;  5E1X A;  3TGN A;  2MD5 A;  2X85 A;  4II2 A;  4O5V A;  2A05 A;  5DDG A;  1Z67 A;  1K78 B;  3CP8 A;  2E2H J;  1WJF A;  3LMM A;  4IEJ A;  2OJE D;  4HV5 A;  4F3Q A;  3FDY A;  3GTO J;  4GYI A;  2O6G E;  1B9M A;  5AIQ A;  1X1C A;  1OMI A;  3DF8 A;  1E3O C;  4A3M J;  5LRR A;  1SC7 A;  5EYR A;  3T5X A;  4J19 A;  1BM9 A;  1CF7 B;  2W25 A;  5EEA A;  1XSV A;  4E7H A;  4QWQ A;  2P8T A;  2XAU A;  2KJC A;  2BY2 A;  2OTJ I;  5HLT A;  2PEX A;  4AD9 A;  4AID A;  2QEN A;  1B8I B;  4OIP F;  2NOG A;  1GXP A;  1ENH A;  4BDY A;  4FIS A;  4AYB N;  5IYC J;  3OYM A;  3ESW B;  2AO9 A;  4ZJZ A;  3NAR A;  3D1N I;  3KZY A;  2ZNY A;  2O5R A;  4M72 A;  4OMY A;  1OJL A;  1Q1H A;  1R5H A;  1KYW A;  2JMW A;  4H0E A;  1KZH A;  5JFR A;  2CUZ A;  1S72 I;  5CJ9 A;  5AON A;  3QYE A;  2BY0 A;  2EIK H;  3CUQ A;  5DV5 A;  2DLL A;  4KJZ A;  3OS1 A;  2OV7 A;  1BI2 A;  1V5E A;  1OKR A;  1XMK A;  3ZN1 A;  2LRD A;  4G12 A;  1V5F A;  5H6R A;  1LEB A;  4NNJ A;  4L9T A;  5CVU A;  3BOQ A;  1X19 A;  4DJA A;  2KT0 A;  3AG1 H;  3HOU J;  3LOC A;  3V4G A;  3FXO A;  2DMP A;  1B4A A;  4RS8 A;  3PNY A;  2IGO A;  3BJ6 A;  1LJ9 A;  2H1K A;  3LSH A;  3TDU C;  3DU6 A;  3WTY C;  4BHP A;  3CMA I;  3LAP A;  3OIO A;  3KE2 A;  4V2F A;  1ZLJ A;  3RSN A;  1T95 A;  1WI3 A;  2RGV A;  2CWE A;  2DA7 A;  3JRF A;  5LLQ A;  2VQH A;  1X1D A;  3G1M A;  4H4K C;  1IUY A;  1JE8 A;  2RKH A;  1VZ0 A;  2CJJ A;  3HPG A;  3KEQ A;  3BG6 A;  3A1Y A;  3TW7 A;  3N4M A;  1JHH A;  3T8R A;  2HQ5 A;  1TT5 B;  3F8F A;  2CW0 F;  2NVQ J;  2XRN A;  1JT6 A;  2YU9 J;  4AUX A;  4IHY A;  3S3N A;  2CQ7 A;  2K4J A;  4BYY A;  1BW6 A;  5M3M J;  2LY1 A;  3CJN A;  4XOT A;  3WHC A;  4MQV A;  4KIT B;  3DKX A;  1SVL A;  3I59 B;  4CCJ A;  3QU6 A;  2JA7 J;  5HDN A;  1KU9 A;  2O8X A;  3T0Y A;  1STZ A;  3S32 A;  1FTT A;  2R7W A;  2RC4 A;  3TQN A;  2ADU A;  4CIC A;  2PMU A;  2LOO A;  3K4K A;  3KLO A;  4BU2 A;  3K1N A;  4W97 A;  1UHW A;  4AM3 A;  3J7A O;  4QSH A;  1A6I A;  4A0Y A;  1QZE A;  3EUH A;  2JRM A;  3DQV C;  5H20 A;  1TTY A;  1X1P A;  2GIV A;  3KZZ A;  2V9V A;  4NQW A;  1E0E A;  3QPL A;  3DEE A;  2HOS A;  2EIM H;  2FQ3 A;  2QBY A;  4Q47 A;  4A3D J;  3KIO A;  4YEL A;  2HZD A;  2VC1 A;  4PSX A;  1IN7 A;  3HRU A;  3C2H A;  2ZME B;  3KP3 A;  1T6S A;  2M1B A;  3NWT A;  1JGS A;  3DPL C;  3DBH B;  3H0G J;  3SQN A;  1B9N A;  1T08 B;  2KL4 A;  1A36 A;  1XCB A;  1Y0U A;  4BQA A;  4A2U A;  4UUV A;  1G6N A;  1JJ6 C;  4A12 A;  1XPX A;  5BPD A;  1Z7U A;  3I55 I;  2F6C A;  1O3T A;  2E5N A;  2IGK A;  2MC3 A;  1K61 A;  1ETY A;  2VAS A;  5M5X J;  3K0L A;  3DPU A;  1TW2 A;  4CYD A;  2FXA A;  3CO7 C;  1Z6T A;  1BBY A;  4C3I J;  2BBY A;  3ASN H;  2F4I A;  1H0M A;  4LB6 B;  3I71 A;  2P4W A;  5F1R A;  5FRN A;  3RZD J;  3RKW A;  3CUQ C;  4Y7N J;  3WE2 A;  2JVG A;  4A3E J;  2XSJ C;  1T38 A;  1REP C;  1I6H J;  1LQ1 A;  1XGS A;  2KIQ A;  2VKD A;  4BDZ A;  1MMS A;  4EAT A;  3VB2 A;  1ZQ3 P;  2YX4 A;  1KGS A;  2FX0 A;  4I7H A;  1S8N A;  4HRI A;  2QQ8 A;  4BY7 J;  4IPA A;  1SFO J;  2STW A;  5C4X J;  3IC7 A;  2LY9 A;  1SFK A;  4F7Z A;  3PSI A;  2HQN A;  3DTK A;  2V1U A;  3DTE A;  2JA5 J;  5FKM A;  1UJ8 A;  2V1N A;  1L0O C;  1IC8 A;  3H9Q A;  2DW4 A;  5BOX A;  3H3U A;  1FYL A;  3RI4 A;  2CUJ A;  5EEG A;  1ZH5 A;  3E5U A;  1LVK A;  3ABM H;  3BG3 A;  3CP2 A;  1UCR A;  1FSH A;  1TWH J;  1IN5 A;  1IJW C;  3BC8 A;  4NB5 A;  2HPI A;  3IH4 A;  1IW7 F;  2KKO A;  2OCE A;  2VI6 A;  2UXN A;  2DA4 A;  2EFN A;  4KN7 X;  2J5O A;  3HC7 A;  1I39 A;  1MIJ A;  3JSP A;  5GTI C;  1D3Y A;  1UHS A;  2M2E A;  1D5V A;  2IP2 A;  1X3Z B;  2R7R A;  3JRC A;  2GXA A;  4IHV A;  4U0V A;  1GLN A;  4CSW A;  1C0W A;  3CD6 I;  3TO6 A;  2DFF A;  1IRG A;  1UB9 A;  4F52 A;  4A3I J;  3G1O A;  3G3Z A;  2R7V A;  4I02 A;  2ID6 A;  4LLN A;  1D8K A;  1MBK A;  3HOX J;  3BCB A;  4G6Q A;  5ICG A;  4M9S A;  3EUH C;  2LY2 A;  1P7J A;  3VDX A;  4KIG A;  5F64 A;  2Y69 H;  1NK2 P;  5CKT A;  3LL7 A;  2W1O A;  1ZHF A;  4A3L J;  2VJ5 A;  4A0Z A;  5D4R A;  1HBX G;  1YW7 A;  2MAB A;  1Y8R B;  3KZI C;  4G8X A;  4PUS A;  2O0Y A;  3L1P A;  3C2B A;  1LUJ B;  1IDY A;  3HOV J;  2CV2 A;  4DQ2 A;  3HKZ A;  3ABT A;  1XS9 A;  2VKV A;  3M07 A;  4IHS A;  3HHG A;  3LA3 A;  1MBF A;  2J5P A;  3TW6 A;  1BA5 A;  3R61 A;  2HQA A;  4OOI A;  1S7O A;  4A3K J;  4C2M J;  5CVJ A;  2VIX A;  4KUM A;  3SFI A;  2JA6 J;  5IYB J;  4BH9 A;  3L2R A;  4XN3 A;  3D5R C;  2CYY A;  1D1C A;  2LC2 A;  2DFE A;  2EIN H;  3RQ4 A;  2XF6 A;  2E1C A;  5L3F A;  5K7H A;  4RGR A;  2ECB A;  5FO5 A;  1MGT A;  4M3F A;  3JAM K;  2PMZ N;  2R7F A;  1ON1 A;  3EQL F;  5DYM A;  3BLY A;  1A35 A;  4CYC B;  1F4K A;  4CCN A;  5D8L B;  2CQN A;  3Q0U A;  3BTL A;  5LBQ A;  2JQ7 A;  1MMD A;  2GIZ A;  1FIP A;  1SFE A;  2MSY A;  4I6Z A;  4RDU A;  1XMA A;  3WG7 H;  1SD5 A;  1U5T B;  1FX7 A;  3JR9 A;  4BJT A;  3KX2 A;  2O03 A;  5F0C A;  4U7B A;  1VQL I;  1MNM C;  1KU7 A;  2RVC A;  2DOF A;  2OA4 A;  1TNT A;  1ONV A;  2BEO A;  1I27 A;  2K4B A;  4FQG A;  1BI0 A;  4R79 A;  3LQR A;  5A2Q Z;  1DDN A;  3DU5 A;  2ZJQ F;  2HVQ A;  1LFP A;  1KU2 A;  3AL0 B;  2IS4 A;  1BC7 C;  3OS2 A;  1JJ8 C;  1JKR C;  2G7H A;  4XIC A;  1YRN B;  5LEK A;  2H09 A;  3UR3 C;  2BHZ A;  3BPX A;  3GUD A;  3KLN A;  3N05 A;  4XMY A;  3FWE A;  3HKZ N;  3MVP A;  2Z5U A;  1HLV A;  1ETW A;  4XID A;  3HRS A;  1ZR2 A;  2JRT A;  4WWC A;  3RTR A;  4RB0 A;  2FOK A;  3FIW A;  4YFX F;  4HLY A;  4IQJ A;  1HW2 A;  3JTH A;  5DCF A;  4AIJ A;  1GDT A;  4LMY A;  3OYG A;  3H9J A;  3HGY A;  1LDD A;  4D1Q A;  2R93 J;  3OV8 A;  4ZYA A;  1W36 D;  5AIP A;  3KET A;  2DI3 A;  4CGZ A;  4ZYG A;  2AQE A;  3KP5 A;  1V3F A;  4C2T A;  2Y48 A;  2F5V A;  4HYE A;  2ISY A;  4E7L A;  2E2J J;  4XBF A;  2EV6 A;  2KZV A;  2WBM A;  3GBG A;  1LKX A;  4I0A A;  1ODD A;  3WOD F;  3TO7 A;  2WAQ A;  3GFL A;  3FM3 A;  3D5L A;  3WHB A;  5JHU A;  2XSD C;  3L09 A;  4XR6 A;  1X4P A;  5CVI A;  4UY8 I;  2GOM A;  4HLX A;  3ELK A;  3K4C A;  5D6E A;  4HW0 A;  2DQR A;  3F21 A;  4ZZL A;  1EH6 A;  3TL4 X;  4BEH B;  3L9F A;  3VEP A;  4I09 A;  4GCV A;  1BR1 A;  2M30 A;  5FD6 A;  5GP9 A;  4S05 A;  1OCP A;  2MH9 A;  2Z2S B;  3IRQ A;  3IRR A;  3ML6 A;  2E34 A;  3VSK A;  5JVG F;  1TL8 A;  3P7N A;  2PX9 A;  1K83 J;  4IHT A;  4NC7 A;  3MAJ A;  4NUB A;  4EM2 A;  5GPA A;  1XX5 A;  2ZBK A;  1LVA A;  3I0T A;  3KP2 A;  1QVU A;  3IKT A;  1MBG A;  2R7Q A;  2YR2 A;  1XCV A;  2Y0S A;  2DPD A;  4KT6 A;  3I54 A;  1T98 A;  3OYK A;  1Q1V A;  4M6Y A;  1DUX C;  2NRA C;  3ZMU A;  4IZZ A;  3A2K A;  1LDJ A;  2M0C A;  3DEU A;  4PJJ A;  2OUM A;  2L2O A;  3O2P E;  4PFP A;  2EIL H;  3NEU A;  4XOR A;  1XG1 A;  1Z0X A;  3DV8 A;  5HS9 A;  1FJL A;  3DXJ F;  4R8H A;  3CCR I;  2LFB A;  3JRG A;  1SAU A;  2V6C A;  5FLM J;  4HDU A;  1WWX A;  2D1V A;  3F72 A;  4FET A;  3W3C A;  2DK8 A;  1N75 A;  1VQN I;  4M74 A;  5DEQ A;  2ESN A;  1MJA A;  2LYC A;  2P0W A;  1IG7 A;  1VQ7 I;  2MFZ A;  3CMM A;  4BE0 A;  2KLO A;  4IL6 C;  3RDI A;  3OYD A;  2IEK A;  1IV8 A;  3UNG C;  4FX0 A;  4ZZD A;  1XC5 A;  2F5F A;  1TW3 A;  4P5O A;  4IKF A;  4M3E A;  3TMO A;  2Z16 A;  1ETQ A;  3GX4 X;  3BY6 A;  2XV4 S;  2CS3 A;  1J75 A;  1B6A A;  1PUF A;  4BBS J;  1EH7 A;  1O7L A;  2L7K A;  1S7A A;  2ZSH B;  1Z3X A;  2V7F A;  4LLG F;  4DZP A;  4YFK F;  1R4N B;  4EJT A;  3I4M J;  3BWG A;  3T8T A;  1IRF A;  3ZQI A;  2XRO A;  3FXJ A;  3GFJ A;  3SEZ A;  1PP7 U;  2KPM A;  2DT7 B;  4I99 C;  5DD8 A;  3DEW A;  3NRV A;  4UB8 C;  5IOY A;  4D9J A;  4FHT A;  3QPS A;  4XRS A;  5KNL A;  2ZJR F;  2MD0 A;  3HG9 A;  3LSM A;  2BW3 A;  4IOA F;  4MLO A;  2L3D A;  3KP6 A;  1GV5 A;  4L18 B;  3FM5 A;  3A4C A;  4BXU A;  3OYN A;  4ZYE A;  1ZGA A;  1FBU A;  5J1R A;  3J80 Z;  2H27 A;  1R4M B;  4JP0 A;  2F5D A;  2FQ4 A;  1U8R A;  1VND A;  3C2G A;  2QSF X;  2R3S A;  1X3U A;  4X6A J;  1TWG J;  4UV9 A;  4ENM A;  3I64 A;  3JCU C;  3MKW B;  1WJA A;  3EUK L;  3PQK A;  4IRH A;  4C2U A;  1HDD C;  3SDG A;  1FZP B;  5ED4 A;  1USS A;  3RPU D;  3HXL A;  4WXH A;  1VTN C;  1SFX A;  1MD0 A;  3BR0 A;  3BZC A;  2R5Z A;  2RQQ A;  2RNJ A;  5TRD A;  3V8J A;  5F27 A;  2OQG A;  1H88 C;  3I4N J;  1G3S A;  3R0J A;  3DLA A;  4A0X A;  4Z2Y A;  2ZCW A;  1ZRE A;  5HOD A;  2GBY A;  3CCS I;  3HSF A;  5DUI A;  3LSJ A;  4OAY A;  4DYC A;  2DK5 A;  3ZQH A;  1RPW A;  2BOL A;  3I3L A;  2R5Y A;  3OR1 C;  4EEF G;  2A5W A;  1QHH D;  5JLX A;  3CCL I;  3V42 A;  1B72 B;  3QWL A;  4YEJ A;  5BPI A;  4L9J A;  1ON2 A;  1LFU P;  1VQ8 I;  1XSX A;  1FP2 A;  4RGX A;  3CCJ I;  2X6O A;  2ZXW H;  4P9U A;  1P9Q C;  3CF2 A;  1W5C C;  3OL3 A;  4HNV A;  1K6O A;  3L2U A;  1NH3 A;  4BNC A;  5DUK A;  5DCM A;  4KIB A;  1BR4 A;  2VJ4 A;  3K7A J;  2HYG D;  4MNU A;  3ZOB A;  4UUS A;  5LHI A;  1FYK A;  4C30 A;  3X2Q H;  3TO9 A;  1N25 A;  3MZY A;  4ABZ A;  4D0P A;  1BOA A;  3GZ5 A;  5BNG A;  4DYR A;  3TOA A;  1RUN A;  3FX3 A;  5JI6 A;  2L9N A;  4MTE A;  2E71 A;  3FXK A;  1PP8 F;  4OIO F;  1GVD A;  4LOC A;  2DQL A;  1E3P A;  2E7X A;  5KAF C;  1VQ5 I;  1K4T A;  1GVJ A;  1IZ1 A;  3PSF A;  3OR2 C;  2GQQ A;  3KYC B;  3OYA A;  3A0H C;  1F43 A;  2BE5 F;  2HGC A;  4YFN F;  2H8R A;  2IA0 A;  1IN6 A;  5GPC A;  4HSR A;  2AXL A;  5HLI A;  2LBF A;  1UZC A;  4HAM A;  4IHX A;  5F08 A;  2Z1D A;  2OZ6 A;  2ELK A;  4XRM A;  2H6C A;  4XLP F;  1ERD A;  2MBF A;  1NHA A;  2CMP A;  2OD5 A;  3E6D A;  3LWF A;  1K78 A;  1H9G A;  1IN4 A;  1FYM A;  2NXN B;  4G6T B;  1FOW A;  1HCR A;  1LE8 B;  2FJ1 A;  1MDM B;  2R7U A;  4UHT A;  2XHK A;  4PK4 A;  2JK3 A;  3TP3 A;  2CO5 A;  3GCM A;  3AG4 H;  1EJ9 A;  5IT3 A;  3PIO F;  3K70 D;  4XKV A;  2KIF A;  1A5J A;  4MEX F;  3ZQC A;  2EA2 A;  1QHG A;  2K9S A;  2XRL A;  4JYK A;  1WH7 A;  3EET A;  2P7C B;  2OCC H;  4F93 B;  1YW8 A;  3LSP A;  4I2O A;  4HQM A;  1JT0 A;  2LMD A;  5ILS A;  2WB1 A;  4IJA A;  1MNE A;  3C1D A;  3CLO A;  5E8G A;  2VLA A;  5D5V B;  1R36 A;  1YYV A;  1HST A;  2E35 A;  4L5E A;  2DA5 A;  2V1X A;  4E7K A;  4JK1 X;  3LSK A;  1WFX A;  2QF7 A;  3V8L A;  1A04 A;  4CCM A;  4YRV A;  5GAG J;  3O3K A;  3TED A;  1JTY A;  3L2Q A;  2EV0 A;  1W4M A;  2L9R A;  4HOB A;  3H36 A;  1F9N A;  3TKY A;  1BJZ A;  3LAJ A;  4N4O B;  3P5J A;  4ON0 A;  3WTW C;  3OL4 A;  1OIS A;  2NVU B;  4HQE A;  2HU9 A;  3CCQ I;  4D5C A;  2ZO4 A;  1QQI A;  2YS9 A;  2GA1 A;  3H5R A;  1B59 A;  4ANJ A;  2ZJ2 A;  4AWX B;  1U0J A;  1RKW A;  3QOD A;  1ZRC A;  1VFC A;  4A6E A;  2XF7 A;  1PJR A;  2XB5 A;  2Y75 A;  5JLW A;  3FMS A;  4A93 J;  3CES A;  4XSX F;  1ZN2 A;  1IAW A;  1CGP A;  4L0Y B;  3S1N J;  3L00 A;  3GTG J;  1YQA A;  2JPC A;  4DBQ A;  4GGG A;  3K10 A;  1SAX A;  3GTM J;  4EJV A;  1MND A;  1I3Q J;  2LDU A;  2BVM A;  2WB1 N;  1YE9 A;  2AHQ A;  1MJ9 A;  2IGM A;  1JGG A;  3ERM A;  1IO2 A;  2HEO A;  1QPM A;  3HOY J;  3I59 A;  1BR2 A;  4KMF A;  3A0B C;  3IH3 A;  2X1D A;  2PQ8 A;  1P4A A;  2K86 A;  4I98 B;  4DNC A;  1DP7 P;  2ZJP F;  2IPQ X;  2BYV E;  2LP0 A;  4OAZ A;  3HM5 A;  1JUS A;  3FXL A;  3OMY A;  1OCO H;  5ILU A;  4LG3 A;  3OYI A;  2UWM A;  3OYC A;  3Q9S A;  2E2I J;  2E1M B;  2V79 A;  3QP6 A;  1OCZ H;  5HNF A;  3QYB A;  5JR3 A;  2Q0O A;  3F8B A;  2M8E A;  1G3W A;  1YHQ I;  2K27 A;  1JKQ C;  2JSP A;  3BZK A;  4IHW A;  2E36 A;  2KIM A;  4M3B A;  1RR8 C;  2BXY A;  4JBA A;  5B1A H;  2JTV A;  4JOM A;  3WE3 A;  2DOD A;  4BAC A;  1IXR C;  2ZME A;  1HSJ A;  2R92 J;  4KIF A;  5M5W J;  2KDO A;  3GTQ J;  4BHC A;  5F1J A;  1PVE A;  2M87 A;  2L9V A;  4NBQ A;  4O6J A;  2JA8 J;  2Y30 A;  1SMT A;  3S17 J;  2JPB A;  2CW7 A;  4G9Y A;  1SFU A;  3OYB A;  4GFB A;  4PJ0 C;  2F5E A;  2FE3 A;  1Z9C A;  3ZQQ A;  2K5C A;  3S1R J;  1JKO C;  2MH2 A;  3OS0 A;  2Q2E B;  3FMR A;  2MLK A;  2X48 A;  2CQX A;  5DS9 A;  5FGM A;  5E1W A;  4RAZ A;  3E6M A;  1JUM A;  4E6K G;  3QOE A;  2R7T A;  3GTK J;  5D8K B;  5FLX Z;  3G6E I;  3F23 A;  1SMY F;  1S3J A;  1XMX A;  2EFO A;  3HUG B;  1FP1 D;  3E5Q A;  3ECO A;  4R1H A;  2G9W A;  3AKZ A;  3CJQ B;  4ENN A;  3ERE D;  3W6V A;  3F8C A;  1Y1V J;  4CZC A;  4KDP A;  2NVX J;  5E3N A;  4LG0 B;  4N9H A;  4Q4Z F;  3E97 A;  2Q1Z B;  3C7J A;  2BGC A;  2HVS A;  4YIR X;  2R7Z J;  1HQC A;  2K9N A;  2KP6 A;  3ZQG A;  4KN4 X;  3TDZ C;  3SJM A;  1T33 A;  2IBD A;  3ZQF A;  5CQE A;  1W36 C;  2ACJ A;  2PJR A;  3H92 A;  1OYY A;  3IL2 A;  1APL C;  1AKH B;  2TCT A;  3WU0 A;  3EPZ A;  2W82 A;  1NG7 A;  4EGY A;  2A3S A;  4XLE A;  2GA2 A;  2X0L A;  1OR7 A;  1SAN A;  2P5L C;  1RET A;  4JQF A;  4UUT A;  2VBZ A;  2BZT A;  3WU2 C;  4BKX A;  2ZKZ A;  1RC9 A;  2IGN A;  2RRE A;  5EZH A;  1H89 C;  1J7K A;  4ZDO A;  4IRG A;  3SZT A;  3RPU A;  1QVT A;  3WGG A;  4PSW A;  1R1U A;  5C4J J;  3EYY A;  3J81 K;  5E3O A;  4YG2 F;  1SEU A;  2HWV A;  2VBY A;  2TDX A;  2XAQ A;  3R4K A;  3W2V A;  5LD2 C;  3LA7 A;  4Y13 A;  3J7A Y;  2QQB A;  3S14 J;  1UMQ A;  1YS7 A;  2DFH A;  2LD5 A;  3PFY A;  2FUG 2;  3J80 K;  2XKP A;  3IWZ A;  1WQ2 A;  4M6X A;  3K6G A;  4RM3 A;  4IF4 A;  3NAU A;  2OBP A;  5DD4 A;  5ICF A;  3SYT A;  4BL0 B;  1FOY A;  5D4S A;  1GT0 C;  2OTL I;  1VQM I;  5E17 F;  2FSW A;  3KP4 A;  5EG0 B;  2E5Z A;  1PDN C;  4XRS G;  4DW6 A;  2E1N A;  5BS6 A;  1EA3 A;  2HXI A;  3PM1 A;  3QP5 A;  1ETX A;  4ZC3 A;  2M34 A;  1V55 H;  4RBO A;  2ZME C;  2LVS A;  5E79 C;  3HPH A;  2O3F A;  4LIU A;  2R7X A;  4PZJ A;  3DKY A;  3DPT A;  3GWZ A;  3K9T A;  2WTE A;  4E7Z A;  2FA5 A;  2HDD A;  1XN7 A;  3V7R A;  3RIR A;  3Q5F A;  2ZB9 A;  4E7S A;  2EBI A;  2UZK A;  3GFI A;  2V4J C;  4ITV A;  1YIO A;  5CVV A;  1O57 A;  1FT9 A;  3HEF A;  1XSD A;  2VBX A;  4RGU A;  2RQP A;  4YIF A;  2LLK A;  3V7S A;  2ZXJ A;  2XAF A;  3CUO A;  2HZT A;  3CCV I;  3QU3 A;  4B1R A;  1SVO A;  3VOD A;  3HDD A;  3S1Q J;  5KAI C;  2CFO A;  1FPQ A;  1TQP A;  4N0B A;  1HW1 A;  3ABL H;  4CYC A;  3CME I;  2L4M A;  3CDI A;  1YJN I;  2L5Q A;  3RJP A;  3QPT A;  4CZZ A;  4ASN A;  5EGO B;  4DIQ A;  3RKX A;  3DBL B;  4G94 A;  3ZP5 A;  1F36 A;  3B73 A;  2WAE A;  1U5T A;  3HTU A;  3A01 B;  1W5S A;  1H8A C;  1R22 A;  2IVM A;  3S2H J;  3K69 A;  5B5E C;  4KIC A;  3BQZ A;  3CDH A;  3HB9 A;  3P9C A;  3Q9V A;  5K5Q A;  2EFQ A;  2DTZ A;  4M3D A;  1QZZ A;  4RB2 C;  3HJE A;  3FXU A;  5HLG A;  1BI1 A;  2EZI A;  3VWB A;  1K7A A;  4WK8 F;  4JX4 A;  1ZR4 A;  3PO3 J;  2B0L A;  1YRN A;  3K2A A;  2DMN A;  3PO2 J;  2W48 A;  4ZH4 F;  3JRE A;  2K85 A;  4G7H F;  1OR7 C;  3IHU A;  5FFX A;  1MMN A;  1S9H A;  2W4S A;  5K7Z A;  3F8M A;  2AXT C;  4I0B A;  2DMT A;  2JSC A;  4MFE A;  3HOZ J;  2X1C A;  2LKP A;  5EF6 A;  4CHU A;  2QQA A;  1RI7 A;  4XRF A;  1ZG1 A;  1O3S A;  1HF0 A;  4MHG A;  1JUP A;  3MWM A;  2UXX A;  2OF7 A;  3VPR A;  4Q5S F;  1XGM A;  4XOP A;  2GXB A;  2N8G A;  2K9M A;  4F92 B;  4C9Y A;  3MKY B;  2NNY A;  4FE7 A;  3L2C A;  2EZL A;  3MMY B;  1AOY A;  1O7F A;  2VE8 A;  2VN2 A;  1TT0 A;  2I8D A;  4XLF A;  4S0H B;  4HF1 A;  3GVA A;  4A69 C;  2GOX B;  3HRM A;  1D1A A;  1IDZ A;  3F22 A;  3IKV A;  2XIG A;  3LNQ A;  4BEH A;  2XVC A;  2A61 A;  3PL8 A;  2QKM B;  4BE2 A;  1MBH A;  3LSI A;  4CO8 A;  4YII A;  1FBS A;  1TQM A;  3MQ0 A;  2NS7 A;  1WCM J;  2BY1 A;  2COB A;  5CPR B;  2EFP A;  2XGD A;  3JRA A;  4HBL A;  1F1Z A;  3G1L A;  3TBI A;  3ZMT A;  1BI3 A;  3S1M J;  2KRC A;  2DMU A;  2O9L A;  3AG3 H;  4XN0 A;  1YG2 A;  2W24 A;  3OOP A;  5HDG A;  3PUF A;  2EZK A;  1GV2 A;  3GFM A;  3JW4 A;  1WJ5 A;  3WGH A;  2M4K A;  1R6R A;  2HDC A;  1HKT A;  3ULQ B;  2K9L A;  4LLL A;  3F0C A;  3HGG A;  4DYQ A;  2M5W A;  1HW5 A;  1ZLK A;  1QO0 D;  2FNA A;  1KA8 A;  2Z3Y A;  1T0F A;  5EZG A;  2V1D A;  4P96 A;  2KDZ A;  2H6B A;  4MEY F;  4KMU X;  3OY9 A;  2X1E A;  4L0Z B;  1LDK B;  2H1L A;  5FRO A;  2LR8 A;  3P9I A;  2OQR A;  3OYF A;  2HTJ A;  1U5T C;  1VQ4 I;  2IS6 A;  2PMH A;  4AVZ A;  1T56 A;  3PQJ A;  1G2H A;  2X51 A;  2F4O B;  4ENJ A;  2OC6 A;  1YJ9 I;  2PN6 A;  4Y17 A;  3RPQ A;  4XNF A;  5J40 A;  1WH5 A;  3AL0 C;  1EKE A;  1NTC A;  2ZFW A;  4MTD A;  3SZG A;  2MYS A;  1YIT I;  2QVO A;  2UV1 A;  3GZ6 A;  1BIA A;  2JWT A;  1U9O A;  2QGU A;  4EM1 A;  3LSR A;  3MKZ A;  1U3E M;  3HTS B;  2YPR A;  5D5U B;  3PFI A;  2AS5 F;  3A03 A;  3K70 C;  2B7E A;  3ZQ7 A;  2QUF A;  2MGQ A;  2WAQ N;  2FBH A;  2DCE A;  2UUZ A;  1KQ8 A;  3EYI A;  2ID3 A;  1HC8 A;  5B66 C;  4HF0 A;  1X2N A;  1QA6 A;  1R58 A;  3S2D J;  2WV0 A;  1LEA A;  1WPK A;  2A07 F;  3ZGK A;  2Z33 A;  2XAS A;  2QM3 A;  3BR6 A;  1DPU A;  4RLQ A;  3KFW X;  1UEL B;  2EWN A;  3BTJ A;  3F8N A;  3IUO A;  1ULY A;  2NOJ B;  3IV5 A;  1YO5 C;  1WGX A;  1ORK A;  4ZTJ A;  3V8K A;  1FOX A;  2WY7 Q;  1U8B A;  1X58 A;  3LFK A;  4I76 A;  2QEX I;  2EJR A;  4M9X A;  2AQF A;  3GYH X;  4F55 A;  2BV6 A;  3FBN B;  2Y0S N;  3R60 A;  2R7O A;  3TP0 A;  2VE9 A;  2M0M A;  4IVN A;  2CQQ A;  4ZYD A;  1IF1 A;  4B43 A;  2O7O A;  4TV7 A;  4QLC U;  1DGR M;  2HOT A;  4NHJ A;  2RN7 A;  2VOO A;  1N77 A;  3ONQ A;  3CC2 I;  3QRF F;  3DKW A;  3V7C A;  2VQL A;  1QZY A;  2P5V A;  4Y4R A;  2CGP A;  1B72 A;  1ACI A;  1FLI A;  4PJN A;  5FD5 A;  4L9N A;  3PNT A;  2M4G A;  4OIR F;  3M8F A;  1U6G A;  5FLX K;  3RKY A;  3K4N A;  3HBL A;  5HOO A;  4IRI A;  1O4X A;  2QSG X;  1S5L C;  3WTS C;  1ZK8 A;  5TJJ A;  4WXC A;  1FC3 A;  4G6D A;  2LKX A;  3RCO A;  3G2B A;  2LNB A;  1R1T A;  3NWS A;  3LSG A;  1Z21 A;  2HDW A;  4HZF A;  3ZMZ A;  5HLH A;  2FOW A;  4FX4 A;  1ZEL A;  4RLF A;  1T0F C;  2QKL B;  1Y1W J;  5M5Y J;  3CF5 F;  5IT9 Z;  4HST A;  4D7N A;  5D5W B;  2VJI A;  4L5I A;  2P5K A;  4WX9 A;  2HTS A;  2P6T A;  3PUB A;  3E6B A;  3ZR8 X;  5BMZ A;  5F04 A;  2D5V A;  1YTY A;  2R7D A;  4LJZ F;  2COM A;  1NK3 P;  2FMY A;  2Y31 A;  1RRJ A;  4CA0 A;  3S3M A;  1L3L A;  2ELH A;  4XLH A;  2KMU A;  3OOU A;  1X1B A;  1Z1D A;  5LGU A;  3M7G A;  2VJJ A;  2JJ7 A;  4EVI A;  2DOA A;  2XGC A;  2Z9O A;  1OCC H;  1F5T A;  5KK1 A;  2HR3 A;  3G73 A;  1XB4 A;  3HSR A;  2KZG A;  2A68 F;  3S2W A;  4XK4 A;  1Z7L A;  2RNG A;  5IP6 A;  1P7I A;  3WG9 A;  4BJ5 C;  3CTA A;  4UVA A;  1RES A;  1R23 A;  1E2X A;  5E3L A;  2JUG A;  2IRF G;  4AIH A;  1KON A;  1V4R A;  1W7P B;  2ECC A;  1TC3 C;  4NDL A;  4II3 A;  3CO6 C;  2DOE A;  1XD7 A;  2FRH A;  4XKB A;  2Z99 A;  4FT8 A;  3CCU I;  1RUO A;  1G59 A;  1R00 A;  3J7Z I;  1YIJ I;  1LE8 A;  4IO9 F;  1MDM A;  4XKW A;  2PLY A;  1ZG5 A;  1FIA A;  1P6R A;  1KYZ A;  2EH3 A;  1POG A;  4UB6 C;  2VON A;  1HOM A;  1K4S A;  1Y8Q B;  1Z3Y A;  4BJ6 C;  5L3B A;  4LK0 F;  1I1S A;  3H5N A;  1X2M A;  4WF2 A;  2DU9 A;  1D8J A;  1Z77 A;  1OQY A;  4HNT A;  1MBE A;  2VPL A;  2B9S A;  1UG2 A;  3H3Z A;  2WC2 A;  4LGW A;  3OSG A;  3FMQ A;  5J1Y A;  2XKO A;  2ZFU A;  1K79 A;  1IN8 A;  3OYJ A;  1EV7 A;  1G8X A;  3M8J A;  3BTC A;  4A3F J;  3WTT C;  2PJP A;  1JKP C;  2IW5 A;  2QSH X;  4XSZ F;  2HOE A;  1VQK I;  3FXQ A;  1DGW Y;  1YS6 A;  4GRI A;  3ZMD A;  5FKK A;  4B47 A;  3IAS 2;  4PGH A;  2DYS H;  3M3Y J;  2DJI A;  3DCF A;  3GO5 A;  4MFD A;  3ZMV A;  1GXQ A;  2HFH A;  5TGT A;  5EDN A;  4FE4 A;  1RKT A;  4J01 A;  5ILV A;  3JRI A;  3OYH A;  1CF7 A;  4X1E A;  3OSF A;  4WCG A;  3BR2 A;  2W7N A;  1B8I A;  1S7E A;  3GXO A;  4Q48 A;  4U87 A;  1CQT A;  1ZTR A;  4RAF A;  3GEZ A;  1TQI A;  4OIN F;  1V54 H;  2NS8 A;  4C3J J;  2E19 A;  3RYR A;  2X9D A;  2DBB A;  5KVR A;  4BXF A;  1YX3 A;  3BJA A;  3BR5 A;  4HNU A;  2EIJ H;  2GAU A;  2LK2 A;  2DT5 A;  1FBQ A;  2OAZ A;  2JT1 A;  3W2A A;  4GXO A;  1SVM A;  4C3H J;  3B6C A;  3SEQ A;  3PJR A;  1UFM A;  1W5T A;  1Y0N A;  4E4H A;  4N4N B;  1U78 A;  3QYF A;  1MSF C;  3U21 A;  4ZDL A;  4XON A;  4QPO A;  1YOV B;  3AG2 H;  4BHB A;  4BBR J;  5HDK A;  2VKH A;  2DT6 A;  3K4B A;  2HI3 A;  1EH8 A;  4OU0 A;  2XC7 A;  1BC8 C;  2DAO A;  3CDL A;  2L01 A;  3HRT A;  4BUP A;  3E3V A;  3F6V A;  3ZN0 A;  2L9S A;  2MA3 A;  3O6B B;  4EJW A;  1LFB A;  2VT3 A;  1WRJ A;  3I4P A;  3K4J A;  1H9T A;  4HV6 A;  3MD2 A;  3CC4 I;  3SFZ A;  1IRZ A;  2DA1 A;  1TWF J;  1J59 A;  3EDP A;  1DPR A;  5A2Q K;  2LF7 A;  4OIQ F;  3TOB A;  3EUA A;  4O3M A;  5HNH A;  2HOA A;  4IOC F;  2DFI A;  4KNY A;  4Z6Y A;  1OYW A;  2HYJ A;  2R0Q C;  4WXD A;  2Q8K A;  4S04 A;  1I3A A;  1VF9 A;  3FXM A;  3F6O A;  3SHF A;  3RZO J;  1HKQ A;  1YLF A;  4BS9 A;  2L02 A;  3BRO A;  3ROU A;  2XF5 A;  1ETK A;  1FMV A;  1BOB A;  3CCE I;  4BXX J;  4D5F A;  3BQY A;  2K40 A;  2JA2 A;  3GTL J;  2DPU A;  4IQ4 A;  2IT0 A;  3S8P A;  2L0K A;  2NAZ A;  3E5X A;  3GF2 A;  2A6E F;  5KCM A;  4E7I A;  4HX4 A;  4X0G A;  2W84 A;  3BP8 A;  3AFH A;  2VL8 A;  1YI2 I;  4EJU A;  4A3B J;  5KHD A;  4ZYH A;  4K2E A;  2Q2E A;  3M9A A;  4XL9 A;  5J8F A;  3ZMS A;  2EV5 A;  2K02 A;  2P6S A;  2X4H A;  2X6W A;  4RB3 C;  3CUQ B;  5F6F A;  2JVH A;  4F91 B;  1D0X A;  3FKI J;  3BCA A;  1I1G A;  5L3E A;  4B3X A;  3KP7 A;  4AVP A;  1OPC A;  3K4M A;  3WU1 B;  1MSE C;  2YUS A;  5E20 A;  5D5X B;  5LHH A;  6PAX A;  4RAY A;  3HUG A;  1R5G A;  3KYL A;  2DO7 A;  2FBK A;  4J00 A;  2QCO A;  1SD7 A;  3BJO A;  2Y0M A;  2DA2 A;  3ASO H;  3D0S A;  3W6J B;  4AC0 A;  2JUC A;  3VYU B;  4BAY A;  3FK7 A;  2ISZ A;  2D45 A;  3FZV A;  4UXN A;  3MCZ A;  4LG0 A;  2L4A A;  2CUF A;  4N9I A;  2HKX A;  4RA2 A;  2G0E A;  1A6Q A;  4CCK A;  2A6T A;  5FKN A;  3U1D A;  3KEY A;  1T8I A;  5CLS A;  1PUE E;  1Z91 A;  1TLH B;  2P7V B;  2WA0 A;  5FLV A;  3VFZ A;  1XGN A;  2JZY A;  3S15 J;  4RB1 A;  1B1B A;  4P1W A;  2HNH A;  1BL0 A;  2MG4 A;  4CDG A;  3QPH A;  1AKH A;  2M3A A;  3GLL A;  2EQR A;  2VC0 A;  1MJB A;  3W6K B;  3FKJ A;  2CQK A;  1HA8 A;  2L54 A;  1I5Z A;  3RQI A;  2VKE A;  3P9K A;  5TIS C;  1VQP I;  2F48 A;  3HHH A;  2F2E A;  1ZRF A;  2GZW A;  1D1B A;  2W57 A;  4NC6 A;  2LF8 A;  4QIW N;  1UAA A;  2E7W A;  2P81 A;  3HSE A;  4EGZ A;  2CV1 A;  2CSO A;  3M4O J;  2XPW A;  1WVR A;  4HG2 A;  4MO7 A;  2KIU A;  1BJA A;  2ESH A;  4MGR A;  5L3D A;  5DM7 F;  3BR1 A;  1LPQ A;  5GTH C;  1GHC A;  1DQU A;  4Y52 J;  4BQO A;  2YSR A;  4A6D A;  1ZGW A;  4EQQ A;  2E1M C;  2XUB A;  4PCQ A;  4ESB A;  4NQW B;  1FY7 A;  2QBY B;  3IP4 B;  3BT9 A;  5EG0 A;  4GDF A;  1E3H A;  2L7F P;  3I5U A;  4XM3 A;  3REO A;  4CUG A;  5CVR A;  2VXD A;  1D5Y A;  3DBR B;  3VOE A;  5E3M A;  2IA2 A;  3WTV C;  3DWL E;  2H94 A;  4U0W A;  3S16 J;  2R7S A;  5FB2 A;  1W7P D;  3CLQ A;  4U88 A;  3MZ8 A;  3N97 A;  5FKL A;  2FU4 A;  1ITY A;  4P55 A;  2NVT J;  5J47 A;  2KQR A;  2DTR A;  1XDU A;  3B02 A;  5GAH J;  5FRM A;  2YX7 A;  1ZAO A;  1WSU A;  1LB2 A;  5GAD J;  2QQ9 A;  3E6C C;  3Q0W A;  4DZJ A;  1UHM A;  1EF4 A;  1Y56 A;  3MEX A;  1FSE A;  1AA7 A;  3IAM 2;  1OCR H;  1RNL A;  1PYV A;  4XLC A;  3HOT A;  1XTA A;  2PJR B;  3U2R A;  2BVL A;  5EJC A;  3JRD A;  2CH0 A;  3ABK H;  3KPH A;  4BQN A;  4BE1 A;  1SD6 A;  3A02 A;  5IT9 K;  3NQO A;  3E7L A;  3O8H A;  5EGO A;  1YW9 A;  1J2X A;  1JI8 A;  5M3F J;  2G7U A;  2D1H A;  4EV0 A;  3A01 A;  3SXY A;  2DN0 A;  4EM0 B;  3Q0V A;  5J8C A;  1BW5 A;  1RR7 A;  1AHD P;  2MC4 A;  2PMZ A;  3T1B A;  4B3A A;  2O61 A;  2WY8 Q;  4E7J A;  4JX6 A;  4Y33 A;  3BR3 A;  4MQ9 F;  1M1E B;  2HYF A;  3PIP F;  4HEA 2;  3R0A A;  1JHF A;  2QZ8 A;  2Y9Y A;  1XDS A;  3OWT A;  2VT2 A;  1QNT A;  3HL2 A;  3FK6 A;  1Y39 A;  3W2W A;  4UVB A;  1HKS A;  1RZ4 A;  4M71 A;  2WWY A;  4KFC A;  5JVT A;  1TZL A;  1V5G A;  5F0H A;  2OPT A;  5E8I A;  2PFB A;  3MFK A;  3H1C A;  3CCM I;  2HXO A;  3FF5 A;  5J4Y A;  4U7D A;  2V9P A;  4XKC A;  2IS1 A;  4KT5 C;  3KCC A;  5J3L A;  5L3C A;  3H9G A;  5IP7 J;  4B09 A;  4LK1 F;  3FHN A;  1WJE A;  1FOK A;  2QYO A;  5LHG A;  2H8W A;  5IPA A;  2A5Y B;  1E17 A;  3GME A;  1G3T A;  4XQF A;  3K1P A;  5C3E J;  5E1Z B;  3LQQ A;  3BZ6 A;  2F5C A;  2QA4 I;  1LNW A;  3R6S A;  3CCY A;  2LRE A;  4OWR B;  4L9V A;  2DDB A;  1MH4 A;  4ZTF A;  2NS0 A;  1OCT C;  2Y2Z A;  3BPV A;  1Z05 A;  2FD5 A;  4B4C A;  4BQQ A;  5LGT A;  2EPF A;  4CXF A;  4U0Y A;  4A5M A;  4M3G A;  3ZCO A;  1P2F A;  3H5A A;  2LTP A;  3QOP A;  3GZN B;  2M7B A;  4ESJ A;  1WI9 A;  1ZG3 A;  4RMN A;  3SZP A;  1UST A;  4PJM A;  4FAS D;  5E18 F;  4M9Z A;  2K3F A;  4IX7 A;  2YU3 A;  3COA C;  2KRF A;  3K4L A;  2HKO A;  3RKQ A;  4FTH A;  4PGG A;  4BY1 J;  1KQ0 A;  4LB5 A;  2FNP A;  1BIB A;  3VYS B;  1T39 A;  1IV6 A;  3GLX A;  2CG4 A;  2WAD A;  4RM2 A;  4I01 A;  2A6H F;  1U9N A;  2ICW G;  2ZSI B;  3QQA A;  1HXD A;  3BTI A;  5HS8 A;  5LRS A;  4DBR A;  1FTZ A;  2XPU A;  1R7J A;  4GYG A;  2BY3 A;  1WKM A;  2M7A A;  2XGX A;  5K5R A;  5IY5 H;  4JX5 A;  2NVY J;  4MIM A;  5IP9 J;  1Z6R A;  3ZPL A;  3VSL A;  2OZU A;  2EZH A;  4G7O F;  2K3P A;  2KIS A;  2DYR H;  2QLZ A;  2ZXI A;  2VB6 A;  5BQT A;  2M45 A;  5LFA A;  1YFH A;  2GLO A;  4G7Z F;  1WJB A;  1ZGJ A;  5IOZ A;  3ZQL A;  3U1K A;  2WAF A;  3BG7 A;  3GTJ J;  2ZC2 A;  2DA3 A;  3D5S C;  2V6E A;  2IXS A;  4IXA A;  5J1U A;  1RIO H;  1IGN A;  1QRY A;  3FIS A;  5HS7 A;  3J7Y J;  4A5N A;  2VQG A;  2ZNZ A;  2KFD A;  2XDV A;  2V26 A;  3I56 I;  2MW8 A;  1NG6 A;  2KJB A;  1R49 A;  3DLL F;  5D6F A;  3OIQ A;  2XAJ A;  1QU3 A;  3FXR A;  4A3J J;  1MH3 A; 
#chains in the Genus database with same CATH homology
 3K2Z A;  1XGO A;  3K1M A;  2ETH A;  2MLG A;  4Y15 A;  2K7L A;  4ENK A;  4L5J A;  1S6L A;  1I6X A;  4XLN F;  5ICE A;  4LFU A;  1MZB A;  3AAF A;  5LGN A;  3C3W A;  1G3Y A;  3I53 A;  3QAH A;  1TBX A;  2LSO A;  3WTU C;  1TNS A;  3ISP A;  2FEZ A;  1IXC A;  3U9G A;  1P4X A;  1ZRD A;  3HIF A;  3F3X A;  5CYV A;  3ABU A;  1FNN A;  1AWC A;  5J6X A;  2FBI A;  2GXG A;  1MKM A;  2GWR A;  3JTG A;  5LEJ A;  1KU3 A;  4AIK A;  3M1E A;  1SD4 A;  1O3Q A;  4HA8 A;  3BDD A;  4HX8 A;  2EFW A;  2RV8 A;  2PG4 A;  1ZYR F;  3L7W A;  3J81 Z;  2IJL A;  4EJO A;  1FWZ A;  4ESF A;  3LST A;  1KQ9 A;  1JXS A;  3KEO A;  3FHZ A;  5H6Q A;  4LD5 A;  2QWW A;  4M73 A;  2A69 F;  2CFX A;  2FF4 A;  4RGS A;  4HDV A;  4KA4 A;  1W7P A;  4UNO A;  3WTX C;  1QBJ A;  2VOP A;  4GO1 A;  2STT A;  4P9F A;  2PI0 A;  2HS5 A;  3DP7 A;  5K5O A;  5ERI A;  3M8E A;  2XAH A;  4HX7 A;  4UV8 A;  5ICC A;  5FFZ A;  4PDK A;  2NNN A;  4HF2 A;  1J0R A;  4EMS A;  1QGP A;  4KYW A;  2VXZ A;  1ZAR A;  3WGI A;  2VBW A;  2IA1 A;  2RDP A;  1S29 A;  3MZH A;  2PBI A;  1OYI A;  4ETS A;  5EEH A;  1U2W A;  3C18 A;  1G4D A;  1R1V A;  3JAM Z;  4OMZ A;  2VOD A;  2NYX A;  3HOS A;  2OU2 A;  1O3R A;  2HQR A;  5DCM B;  5HVQ C;  2EB7 A;  1J9I A;  3GW2 A;  1P92 A;  3DFG A;  1P4W A;  1BN5 A;  4UVC A;  1T2K A;  3I58 A;  2EK5 A;  5K1Y A;  2C6Y A;  3RYP A;  3HYI A;  1IXS B;  4E70 A;  4B8X A;  3WTZ A;  2EA4 A;  3JSO A;  2W85 A;  5L3G A;  1J5Y A;  3ECH A;  2XAG A;  3IWF A;  2FML A;  2D2W A;  5E1X A;  3LA2 A;  3TGN A;  2MD5 A;  4O5V A;  5DDG A;  1K78 B;  4HV5 A;  4GYI A;  2O6G E;  1B9M A;  5AIQ A;  1OMI A;  3DF8 A;  5LRR A;  3T5X A;  1CF7 B;  1BM9 A;  2W25 A;  1XSV A;  4QWQ A;  2P8T A;  2KJC A;  2PEX A;  4AD9 A;  4OIP F;  2QEN A;  1GXP A;  3KZY A;  2ZNY A;  4M72 A;  4OMY A;  1Q1H A;  1R5H A;  1KYW A;  4H0E A;  5JFR A;  5CJ9 A;  5AON A;  3CUQ A;  5DV5 A;  2DLL A;  1BI2 A;  1OKR A;  1XMK A;  3ZN1 A;  5H6R A;  1LEB A;  4L9T A;  5CVU A;  3BOQ A;  3V4G A;  1B4A A;  4RS8 A;  3BJ6 A;  1LJ9 A;  3TDU C;  3WTY C;  4BHP A;  3LAP A;  3KE2 A;  1ZLJ A;  2RGV A;  2CWE A;  5LLQ A;  1IUY A;  1JE8 A;  2RKH A;  3KEQ A;  3N4M A;  1JHH A;  3T8R A;  3F8F A;  2CW0 F;  2XRN A;  2K4J A;  4BYY A;  3CJN A;  4MQV A;  3I59 B;  3QU6 A;  5HDN A;  1KU9 A;  2O8X A;  3T0Y A;  1STZ A;  2RC4 A;  3TQN A;  2ADU A;  4CIC A;  2PMU A;  3KLO A;  3K1N A;  1UHW A;  3J7A O;  4A0Y A;  3EUH A;  3DQV C;  5H20 A;  1TTY A;  2GIV A;  3KZZ A;  2V9V A;  4NQW A;  2FQ3 A;  2QBY A;  4Q47 A;  2VC1 A;  1IN7 A;  3HRU A;  2ZME B;  3KP3 A;  1T6S A;  2M1B A;  1JGS A;  3DPL C;  3SQN A;  1B9N A;  1XCB A;  1Y0U A;  4BQA A;  4A2U A;  4UUV A;  1G6N A;  4A12 A;  5BPD A;  1Z7U A;  1O3T A;  2MC3 A;  3K0L A;  1TW2 A;  4CYD A;  2FXA A;  3CO7 C;  1Z6T A;  1BBY A;  2BBY A;  1H0M A;  4LB6 B;  3I71 A;  2P4W A;  5F1R A;  3RKW A;  3CUQ C;  3WE2 A;  1REP C;  1T38 A;  1LQ1 A;  1XGS A;  3VB2 A;  2YX4 A;  1KGS A;  4I7H A;  1S8N A;  2STW A;  4IPA A;  3IC7 A;  4F7Z A;  2HQN A;  2V1U A;  1L0O C;  2DW4 A;  5BOX A;  3H3U A;  1FYL A;  3RI4 A;  5EEG A;  1ZH5 A;  3E5U A;  1UCR A;  1FSH A;  1IN5 A;  4NB5 A;  1IW7 F;  2KKO A;  2UXN A;  2EFN A;  4KN7 X;  2J5O A;  3JSP A;  1D3Y A;  1D5V A;  2IP2 A;  4U0V A;  1C0W A;  3TO6 A;  1IRG A;  1UB9 A;  3G3Z A;  4I02 A;  4LLN A;  1D8K A;  5ICG A;  4G6Q A;  4M9S A;  4KIG A;  5F64 A;  1ZHF A;  4A0Z A;  5D4R A;  1HBX G;  1YW7 A;  4G8X A;  2O0Y A;  4DQ2 A;  3ABT A;  4IHS A;  3HHG A;  3LA3 A;  2J5P A;  3R61 A;  4OOI A;  1S7O A;  5CVJ A;  4KUM A;  4BH9 A;  2CYY A;  2E1C A;  5L3F A;  4RGR A;  5FO5 A;  1MGT A;  3JAM K;  2R7F A;  1ON1 A;  3EQL F;  5DYM A;  1F4K A;  5D8L B;  5LBQ A;  1SFE A;  1XMA A;  1SD5 A;  1U5T B;  1FX7 A;  2O03 A;  4U7B A;  1KU7 A;  2RVC A;  2OA4 A;  1TNT A;  1ONV A;  2BEO A;  1I27 A;  2K4B A;  1BI0 A;  4R79 A;  3LQR A;  5A2Q Z;  1DDN A;  1KU2 A;  1BC7 C;  2G7H A;  5LEK A;  2H09 A;  3BPX A;  3GUD A;  3KLN A;  3FWE A;  2Z5U A;  3HRS A;  2JRT A;  4WWC A;  3RTR A;  4RB0 A;  2FOK A;  4YFX F;  4HLY A;  1HW2 A;  3JTH A;  5DCF A;  4AIJ A;  4LMY A;  1LDD A;  3OV8 A;  5AIP A;  3KET A;  2DI3 A;  4CGZ A;  4ZYG A;  3KP5 A;  1V3F A;  2Y48 A;  4HYE A;  2ISY A;  4XBF A;  2EV6 A;  4I0A A;  1ODD A;  3WOD F;  3TO7 A;  3GFL A;  3FM3 A;  3D5L A;  5JHU A;  3L09 A;  5CVI A;  4HLX A;  3ELK A;  5D6E A;  4HW0 A;  2DQR A;  3F21 A;  4ZZL A;  1EH6 A;  3L9F A;  3VEP A;  4I09 A;  4GCV A;  2M30 A;  5FD6 A;  4S05 A;  2MH9 A;  3IRQ A;  3IRR A;  3ML6 A;  3P7N A;  4IHT A;  3MAJ A;  4EM2 A;  2ZBK A;  1LVA A;  3I0T A;  3KP2 A;  3IKT A;  2YR2 A;  1XCV A;  2DPD A;  2NRA C;  3I54 A;  1T98 A;  1DUX C;  4M6Y A;  3ZMU A;  1LDJ A;  3DEU A;  3O2P E;  3NEU A;  3DV8 A;  5HS9 A;  3DXJ F;  4R8H A;  4HDU A;  2V6C A;  1WWX A;  2D1V A;  3F72 A;  2DK8 A;  4M74 A;  5DEQ A;  2ESN A;  1MJA A;  3RDI A;  4ZZD A;  4FX0 A;  2F5F A;  1TW3 A;  4P5O A;  3GX4 X;  3BY6 A;  2XV4 S;  1J75 A;  1B6A A;  1EH7 A;  1O7L A;  1S7A A;  4YFK F;  4LLG F;  4EJT A;  3BWG A;  3T8T A;  1IRF A;  2XRO A;  3GFJ A;  1PP7 U;  5DD8 A;  3NRV A;  4FHT A;  2L3D A;  3KP6 A;  4L18 B;  3FM5 A;  4BXU A;  4ZYE A;  1ZGA A;  1FBU A;  3J80 Z;  2H27 A;  2F5D A;  1U8R A;  2R3S A;  1X3U A;  4UV9 A;  4ENM A;  3I64 A;  3PQK A;  4IRH A;  1FZP B;  5ED4 A;  1USS A;  1VTN C;  4WXH A;  1SFX A;  1MD0 A;  5TRD A;  2RNJ A;  3V8J A;  2OQG A;  1G3S A;  3R0J A;  4A0X A;  4Z2Y A;  2ZCW A;  1ZRE A;  3HSF A;  5DUI A;  2DK5 A;  5BPI A;  4L9J A;  1ON2 A;  1XSX A;  1FP2 A;  4RGX A;  4P9U A;  1K6O A;  4BNC A;  5DUK A;  5DCM A;  4KIB A;  2HYG D;  4MNU A;  5LHI A;  1FYK A;  3TO9 A;  3MZY A;  4D0P A;  1BOA A;  3GZ5 A;  3TOA A;  1RUN A;  3FX3 A;  5JI6 A;  4MTE A;  1PP8 F;  4OIO F;  2DQL A;  2E7X A;  1GVJ A;  1IZ1 A;  2GQQ A;  2BE5 F;  2HGC A;  4YFN F;  2IA0 A;  1IN6 A;  2AXL A;  5HLI A;  4HAM A;  2OZ6 A;  2H6C A;  4XLP F;  2MBF A;  1NHA A;  2OD5 A;  3E6D A;  3LWF A;  1K78 A;  1H9G A;  1IN4 A;  1FYM A;  1MDM B;  4UHT A;  2XHK A;  2CO5 A;  5IT3 A;  2KIF A;  4MEX F;  2EA2 A;  2P7C B;  3EET A;  1YW8 A;  4I2O A;  4HQM A;  5ILS A;  4IJA A;  3C1D A;  3CLO A;  5E8G A;  5D5V B;  1R36 A;  1YYV A;  1HST A;  2V1X A;  4JK1 X;  3V8L A;  1A04 A;  3O3K A;  2EV0 A;  1W4M A;  4HOB A;  1F9N A;  3TKY A;  3LAJ A;  4ON0 A;  3WTW C;  4HQE A;  2ZO4 A;  1QQI A;  2GA1 A;  1B59 A;  2ZJ2 A;  4AWX B;  1ZRC A;  4A6E A;  2Y75 A;  3FMS A;  4XSX F;  1ZN2 A;  1IAW A;  1CGP A;  4L0Y B;  3L00 A;  1YQA A;  2JPC A;  4GGG A;  1SAX A;  4EJV A;  2LDU A;  1MJ9 A;  2HEO A;  1QPM A;  3I59 A;  4KMF A;  2PQ8 A;  1P4A A;  2K86 A;  4I98 B;  4DNC A;  1DP7 P;  2IPQ X;  2BYV E;  5ILU A;  2UWM A;  3Q9S A;  2V79 A;  3QP6 A;  5JR3 A;  2Q0O A;  3F8B A;  2M8E A;  1G3W A;  2K27 A;  2KIM A;  4JBA A;  2JTV A;  3WE3 A;  1IXR C;  2ZME A;  1HSJ A;  4KIF A;  4BHC A;  2M87 A;  4O6J A;  1SMT A;  2JPB A;  1SFU A;  4G9Y A;  2F5E A;  2FE3 A;  1Z9C A;  2MH2 A;  3FMR A;  2MLK A;  5FGM A;  5E1W A;  4RAZ A;  3E6M A;  5D8K B;  5FLX Z;  3F23 A;  1S3J A;  1SMY F;  2EFO A;  1FP1 D;  3E5Q A;  3ECO A;  4R1H A;  2G9W A;  4ENN A;  3ERE D;  3F8C A;  4KDP A;  4LG0 B;  4N9H A;  4Q4Z F;  3E97 A;  3C7J A;  2BGC A;  1HQC A;  4KN4 X;  3TDZ C;  2ACJ A;  3H92 A;  1OYY A;  3IL2 A;  3WU0 A;  4EGY A;  2A3S A;  2GA2 A;  2X0L A;  1OR7 A;  2P5L C;  4JQF A;  2VBZ A;  2ZKZ A;  1J7K A;  4IRG A;  3SZT A;  3RPU A;  3WGG A;  1R1U A;  3EYY A;  3J81 K;  4YG2 F;  2HWV A;  2VBY A;  2TDX A;  2XAQ A;  3R4K A;  3LA7 A;  4Y13 A;  2QQB A;  1YS7 A;  3J80 K;  2XKP A;  3IWZ A;  1WQ2 A;  4M6X A;  4IF4 A;  2OBP A;  5DD4 A;  5ICF A;  5D4S A;  5E17 F;  2FSW A;  3KP4 A;  1PDN C;  2E1N A;  5BS6 A;  3QP5 A;  2O3F A;  4PZJ A;  3DPT A;  3GWZ A;  3K9T A;  2WTE A;  2FA5 A;  1XN7 A;  3V7R A;  3RIR A;  3Q5F A;  2UZK A;  3GFI A;  1YIO A;  5CVV A;  1O57 A;  1FT9 A;  1XSD A;  2VBX A;  4RGU A;  2RQP A;  4YIF A;  3V7S A;  2ZXJ A;  2XAF A;  3CUO A;  2HZT A;  3QU3 A;  3VOD A;  1FPQ A;  1TQP A;  4N0B A;  1HW1 A;  2L4M A;  3RJP A;  3QPT A;  4CZZ A;  4ASN A;  3RKX A;  4G94 A;  3ZP5 A;  3B73 A;  1U5T A;  3HTU A;  1W5S A;  1R22 A;  2IVM A;  3K69 A;  4KIC A;  3CDH A;  3P9C A;  3Q9V A;  5K5Q A;  2EFQ A;  1QZZ A;  4RB2 C;  3FXU A;  5HLG A;  1BI1 A;  1K7A A;  4WK8 F;  2B0L A;  4ZH4 F;  4G7H F;  3IHU A;  5FFX A;  3F8M A;  4I0B A;  2JSC A;  2LKP A;  4CHU A;  2QQA A;  1RI7 A;  4XRF A;  1ZG1 A;  1O3S A;  4MHG A;  3MWM A;  2UXX A;  4Q5S F;  1XGM A;  2GXB A;  2NNY A;  3L2C A;  1AOY A;  1O7F A;  2VE8 A;  2VN2 A;  4HF1 A;  3GVA A;  3HRM A;  3F22 A;  3IKV A;  2XIG A;  2XVC A;  2A61 A;  4CO8 A;  4YII A;  1FBS A;  1TQM A;  3MQ0 A;  2EFP A;  4HBL A;  1F1Z A;  3ZMT A;  1BI3 A;  1YG2 A;  2W24 A;  3OOP A;  5HDG A;  3GFM A;  3JW4 A;  3WGH A;  2HDC A;  1HKT A;  3ULQ B;  4LLL A;  2M5W A;  1HW5 A;  1ZLK A;  1QO0 D;  2FNA A;  1KA8 A;  2Z3Y A;  1T0F A;  2V1D A;  4P96 A;  2H6B A;  4MEY F;  4KMU X;  4L0Z B;  1LDK B;  3P9I A;  2OQR A;  2HTJ A;  1U5T C;  2PMH A;  3PQJ A;  4ENJ A;  2PN6 A;  4Y17 A;  3RPQ A;  2ZFW A;  4MTD A;  2QVO A;  3GZ6 A;  1BIA A;  4EM1 A;  3HTS B;  1U3E M;  2YPR A;  5D5U B;  3PFI A;  2AS5 F;  3ZQ7 A;  2QUF A;  2FBH A;  1KQ8 A;  3EYI A;  4HF0 A;  1R58 A;  2WV0 A;  1LEA A;  2A07 F;  2Z33 A;  2XAS A;  2QM3 A;  1DPU A;  3KFW X;  2EWN A;  3F8N A;  1ULY A;  1YO5 C;  3V8K A;  3LFK A;  2EJR A;  4M9X A;  3GYH X;  2BV6 A;  3R60 A;  2VE9 A;  4IVN A;  4ZYD A;  1IF1 A;  4QLC U;  4TV7 A;  4NHJ A;  2RN7 A;  2VOO A;  3QRF F;  3DKW A;  3V7C A;  1QZY A;  2P5V A;  2CGP A;  1FLI A;  5FD5 A;  4L9N A;  4OIR F;  3M8F A;  1U6G A;  5FLX K;  3RKY A;  5HOO A;  4IRI A;  3WTS C;  5TJJ A;  4WXC A;  1FC3 A;  4G6D A;  2LNB A;  1R1T A;  5HLH A;  3ZMZ A;  4HZF A;  4FX4 A;  5IT9 Z;  5D5W B;  4L5I A;  2P5K A;  4WX9 A;  2HTS A;  2P6T A;  3E6B A;  5BMZ A;  1YTY A;  2R7D A;  4LJZ F;  2COM A;  2FMY A;  1L3L A;  2ELH A;  1Z1D A;  5LGU A;  3M7G A;  4EVI A;  2Z9O A;  1F5T A;  5KK1 A;  2HR3 A;  3G73 A;  1XB4 A;  3HSR A;  2A68 F;  3S2W A;  3WG9 A;  3CTA A;  4UVA A;  1R23 A;  1E2X A;  2IRF G;  4AIH A;  1V4R A;  1W7P B;  3CO6 C;  1XD7 A;  2FRH A;  2Z99 A;  4FT8 A;  1RUO A;  1R00 A;  1MDM A;  2PLY A;  1ZG5 A;  1P6R A;  1KYZ A;  2VON A;  5L3B A;  4LK0 F;  1I1S A;  4WF2 A;  2DU9 A;  1D8J A;  3H3Z A;  2WC2 A;  4LGW A;  3FMQ A;  2XKO A;  1K79 A;  1IN8 A;  1EV7 A;  2PJP A;  3WTT C;  2IW5 A;  4XSZ F;  2HOE A;  3FXQ A;  1YS6 A;  3ZMD A;  4PGH A;  3GO5 A;  3ZMV A;  1GXQ A;  2HFH A;  5ILV A;  1CF7 A;  4WCG A;  3GXO A;  4Q48 A;  3GEZ A;  1TQI A;  4OIN F;  3RYR A;  2DBB A;  5KVR A;  3BJA A;  2GAU A;  2DT5 A;  1FBQ A;  2OAZ A;  2JT1 A;  4GXO A;  1UFM A;  1W5T A;  1U78 A;  4BHB A;  5HDK A;  1EH8 A;  4OU0 A;  1BC8 C;  2DAO A;  2L01 A;  3HRT A;  3E3V A;  3F6V A;  3ZN0 A;  2MA3 A;  3O6B B;  4EJW A;  2VT3 A;  1WRJ A;  3I4P A;  1H9T A;  4HV6 A;  3SFZ A;  1J59 A;  3EDP A;  1DPR A;  5A2Q K;  2LF7 A;  4OIQ F;  3TOB A;  4O3M A;  2DFI A;  4KNY A;  1OYW A;  4WXD A;  2Q8K A;  4S04 A;  3F6O A;  3SHF A;  1HKQ A;  1YLF A;  2L02 A;  3BRO A;  3ROU A;  2DPU A;  2IT0 A;  3GF2 A;  2NAZ A;  3E5X A;  2A6E F;  4HX4 A;  2W84 A;  3BP8 A;  4EJU A;  4ZYH A;  4K2E A;  2Q2E A;  3M9A A;  5J8F A;  3ZMS A;  2EV5 A;  2K02 A;  2P6S A;  2X4H A;  4RB3 C;  3CUQ B;  5F6F A;  1I1G A;  5L3E A;  3WU1 B;  3KP7 A;  1OPC A;  4AVP A;  5E20 A;  5D5X B;  5LHH A;  6PAX A;  4RAY A;  3HUG A;  1R5G A;  2DO7 A;  2FBK A;  1SD7 A;  3BJO A;  2Y0M A;  3D0S A;  3W6J B;  4BAY A;  2ISZ A;  2D45 A;  3FZV A;  4UXN A;  3MCZ A;  4LG0 A;  2L4A A;  4N9I A;  2HKX A;  3U1D A;  5CLS A;  1PUE E;  1Z91 A;  1TLH B;  2P7V B;  3VFZ A;  1XGN A;  2JZY A;  4RB1 A;  1B1B A;  4CDG A;  3QPH A;  2VC0 A;  1MJB A;  3W6K B;  2CQK A;  2L54 A;  1I5Z A;  3P9K A;  3HHH A;  2F2E A;  1ZRF A;  2GZW A;  2W57 A;  2LF8 A;  2E7W A;  3HSE A;  4EGZ A;  2CSO A;  2KIU A;  5L3D A;  2ESH A;  1BJA A;  4MGR A;  1GHC A;  2YSR A;  4A6D A;  4EQQ A;  4PCQ A;  2XUB A;  4ESB A;  1FY7 A;  2QBY B;  3I5U A;  3REO A;  5CVR A;  3VOE A;  2IA2 A;  3WTV C;  2H94 A;  4U0W A;  5FB2 A;  1W7P D;  4U88 A;  3N97 A;  2FU4 A;  4P55 A;  2DTR A;  1XDU A;  3B02 A;  2YX7 A;  1ZAO A;  1WSU A;  1LB2 A;  2QQ9 A;  3E6C C;  1UHM A;  3MEX A;  1FSE A;  1RNL A;  3HOT A;  3U2R A;  1SD6 A;  5IT9 K;  3NQO A;  1YW9 A;  1J2X A;  2G7U A;  2D1H A;  4EV0 A;  3SXY A;  4EM0 B;  5J8C A;  3T1B A;  2O61 A;  4MQ9 F;  2HYF A;  3R0A A;  1JHF A;  2QZ8 A;  1XDS A;  2VT2 A;  1QNT A;  4UVB A;  1HKS A;  1RZ4 A;  4M71 A;  2WWY A;  4KFC A;  5JVT A;  3MFK A;  5E8I A;  2PFB A;  3FF5 A;  4U7D A;  4KT5 C;  3KCC A;  5L3C A;  4B09 A;  4LK1 F;  1FOK A;  2QYO A;  5LHG A;  1E17 A;  2A5Y B;  1G3T A;  3K1P A;  5E1Z B;  3LQQ A;  3BZ6 A;  2F5C A;  1LNW A;  3R6S A;  4L9V A;  2NS0 A;  3BPV A;  1Z05 A;  5LGT A;  4U0Y A;  4CXF A;  4A5M A;  1P2F A;  3QOP A;  4ESJ A;  1WI9 A;  1ZG3 A;  3SZP A;  1UST A;  5E18 F;  4M9Z A;  2YU3 A;  3COA C;  2KRF A;  2HKO A;  4PGG A;  1KQ0 A;  4LB5 A;  2FNP A;  1BIB A;  1T39 A;  3GLX A;  2CG4 A;  4I01 A;  2A6H F;  1HXD A;  5LRS A;  5HS8 A;  1R7J A;  4GYG A;  1WKM A;  2XGX A;  5K5R A;  1Z6R A;  3ZPL A;  2OZU A;  4G7O F;  2QLZ A;  5BQT A;  2M45 A;  1YFH A;  4G7Z F;  1ZGJ A;  4IXA A;  1RIO H;  5HS7 A;  4A5N A;  2ZNZ A;  2KJB A;  5D6F A;  2XAJ A;  3FXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...