3VODA

Crystal structure of mutant marr c80s from e.coli
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
136
structure length
136
Chain Sequence
NEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRCAACITPVELKKVLSVDLGALTRMLDRLVSKGWVERLPNPNDKRGVLVKLTTGGAAICEQCHQLVGQDLHQELTKNLTADEVATLEYLLKKVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multiple antibiotic resistance protein marR
publication title The multiple antibiotic resistance regulator MarR is a copper sensor in Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 40
structure length 136
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3vodA00
1MJ9A 2LKPA 1H9GA 5DD4A 5E20A 1Z9CA 4G8XA 1F9NA 3GO5A 3F8NA 2ZMEA 3ZN1A 4IPAA 1ZLJA 4P96A 1QO0D 3ROUA 1YS6A 1FP2A 3AAFA 2RV8A 2K02A 3HTUA 4U0VA 2Y0MA 3WTWC 1AWCA 2WV0A 3T1BA 3GX4X 1OMIA 4EJWA 4N9IA 4CO8A 4IJAA 1XDUA 3L9FA 2MC3A 1XCVA 1JXSA 4L0ZB 1CF7A 2MD5A 1USTA 1SFEA 4EM2A 4MEYF 1ZH5A 3R61A 1G3YA 2MH9A 5LGTA 1TQMA 3VB2A 2F5CA 2P7VB 4PGHA 2K27A 1S3JA 1U78A 3WTTC 2DPDA 4Y13A 2XKOA 3WTYC 4U7BA 2STTA 2F5FA 4WXHA 3WE2A 3GLXA 1R5HA 2R7DA 3FXUA 3V8LA 3FWEA 2DO7A 1IUYA 4L9VA 4A6DA 3P9CA 5F6FA 1O57A 1IN8A 2CSOA 4LK0F 3JSPA 4HW0A 1D8JA 4Z2YA 2JZYA 3GUDA 2ZMEB 1RNLA 5ICGA 3W6JB 2JPCA 4BYYA 4IRIA 1D8KA 1BI0A 2MBFA 2DK5A 2RGVA 4KNYA 5K5OA 2IA2A 2EV5A 2W25A 5DEQA 2XIGA 1I5ZA 4B8XA 4AIJA 2BV6A 2C6YA 4WXDA 3V7SA 2FF4A 3RIRA 2QVOA 1CF7B 1O7FA 4A6EA 5HOOA 4CXFA 4GCVA 5ERIA 2HYFA 4UV8A 2XASA 3WE3A 4A5MA 1O3SA 4HAMA 2P6TA 1FLIA 3Q9SA 3IC7A 4EJTA 1HW1A 5L3DA 4ZYDA 4M9ZA 4U0YA 4EJUA 4B09A 3ERED 1R1UA 2H94A 2OBPA 4UUVA 2JSCA 2KIMA 3T8RA 3FMQA 4KIFA 4LLGF 1J2XA 5EEHA 4H0EA 2Z9OA 3C1DA 4WX9A 4EM0B 2IA0A 1R00A 5ICFA 2RKHA 4IXAA 5H20A 1K6OA 3J80Z 1B59A 2RN7A 1KQ8A 1RUNA 2W24A 5DYMA 3IKTA 2XGXA 3VEPA 1A04A 3QPHA 3M8FA 4WXCA 5LGUA 1ZN2A 3K1NA 1FC3A 3RTRA 4P9UA 3M8EA 3F8BA 1YQAA 1HKQA 1F5TA 2L4AA 4OOIA 2HDCA 2FMYA 2EV6A 1BI1A 1SD5A 2E1CA 4KDPA 3CUQA 5DCMA 3MCZA 3IKVA 2DFIA 1IXRC 3GVAA 1EH7A 4HLXA 1BIAA 2IA1A 1I6XA 5CLSA 1O3RA 1S7OA 1DPRA 1BBYA 1L0OC 5K1YA 5LRSA 4G9YA 4I2OA 1XSVA 2LNBA 4Q4ZF 1TQPA 3I71A 3N97A 2MLGA 4ENJA 3L2CA 2AXLA 2ETHA 2CYYA 2KIFA 2UWMA 2Q0OA 2OZUA 2GQQA 4HQMA 1I1GA 3EETA 1R5GA 4XLNF 4OIOF 2DU9A 3F22A 5ILVA 2XUBA 5DCFA 1O7LA 3HRTA 1TNTA 4Y17A 1T6SA 1P92A 2CG4A 4MNUA 1B1BA 1IXSB 1YG2A 2A07F 3CUQB 5DCMB 4BAYA 5E1WA 2LSOA 5L3FA 3HIFA 4BXUA 1BOAA 5D6FA 4A0ZA 4CDGA 3R4KA 4I0AA 3GFMA 4M6YA 3FX3A 5DDGA 2V1UA 3C3WA 4LMYA 1ZRDA 4D0PA 2HKXA 4LJZF 2WWYA 1HBXG 5DD8A 3WU1B 3OOPA 2K7LA 1L3LA 4ENKA 1IRGA 2BGCA 2MLKA 4YG2F 1IN7A 4R1HA 3KEQA 1FYKA 4XSXF 3O3KA 1S29A 1DP7P 5E8GA 2D1VA 1GXPA 5ILSA 3QPTA 2VOPA 2JRTA 1ONVA 2DBBA 4WCGA 3QP6A 4EJVA 3J7AO 2JT1A 1FOKA 2XRNA 3EDPA 3WGHA 1MD0A 1RI7A 1ZAOA 5HLGA 2BE5F 2DPUA 3I58A 3QU3A 3FMSA 3QP5A 5E1XA 1FT9A 3WTZA 5BMZA 1Z7UA 3Q5FA 2F2EA 2A5YB 1ULYA 3I59A 1CGPA 5HS9A 3LAPA 3HSFA 1PP8F 5E1ZB 3ZPLA 3WG9A 4M6XA 2FRHA 1OYIA 2O8XA 3KLNA 3LWFA 2QQBA 2H6CA 1XGNA 1LDJA 1U5TC 5CVUA 1TTYA 2EB7A 2MH2A 1YW9A 3FF5A 4YIFA 3J80K 1IN4A 5LHHA 4IVNA 4OMZA 4XLPF 3FXQA 4BQAA 3ELKA 1R1TA 2DAOA 5ICEA 1G4DA 2PBIA 3HHHA 1FNNA 3SQNA 3REOA 2A6EF 4JBAA 4AWXB 4OINF 4ASNA 1QBJA 4M9XA 3ZMSA 3W6KB 3PQJA 2B0LA 4U88A 2DTRA 3GW2A 3DKWA 2NS0A 4Q5SF 3LA7A 4KICA 4LB6B 4NHJA 4U7DA 2O0YA 4MTDA 1ON2A 4HDUA 2A68F 2W85A 2VBXA 2Q2EA 4S04A 3I59B 4DNCA 2FEZA 2E7XA 3BJ6A 3H3ZA 1OYWA 2W84A 2FNPA 3HYIA 5FD6A 3K9TA 1KU7A 5DV5A 2DI3A 1B9NA 1W7PD 3JTGA 2EFPA 2A69F 3KCCA 5DUIA 2EA2A 2OQRA 4P55A 4KIGA 3CDHA 1T98A 5CJ9A 5L3CA 4NB5A 2KIUA 3IWZA 4ZH4F 5LHGA 3DPLC 4KT5C 4LG0A 4MQVA 3QRFF 2L01A 3WODF 4A0YA 3BZ6A 1BN5A 2QM3A 3TO6A 3DEUA 2OAZA 4HF0A 1B4AA 3G73A 3K0LA 3TDUC 3V8KA 3TOAA 1K78A 3BY6A 3KP7A 2KRFA 4M73A 2Z33A 2F5EA 1SMTA 1O3QA 1SFXA 2NAZA 2LF7A 5JHUA 2QWWA 4U0WA 1TNSA 1HKTA 2JPBA 3F6VA 3HRSA 1PDNC 1TLHB 4R79A 3QAHA 2CGPA 2V79A 2V9VA 2VONA 1R7JA 4BNCA 2E7WA 4OIRF 3HSEA 1SMYF 3FMRA 4BHCA 5HLHA 5HDKA 1W5SA 2XAFA 1H0MA 3E5UA 1BC8C 2PEXA 2ZBKA 3N4MA 4LG0B 1R23A 1TQIA 3DPTA 2EA4A 1Z6TA 5BOXA 3P9IA 4UVBA 2HTSA 3GZ5A 3F23A 4LGWA 3FZVA 4G7HF 3BJOA 2FQ3A 4PCQA 1X3UA 3RKXA 3IRQA 2BYVE 3RJPA 2FBHA 4BH9A 2QYOA 5D5VB 1K78B 2PMUA 3V7CA 1KU2A 2V6CA 5HS7A 1G3SA 2ZNYA 3RPUA 4A0XA 4M9SA 1REPC 1ZYRF 1LEBA 2O3FA 2QZ8A 1LEAA 4ZZLA 3QU6A 3GF2A 4L5IA 2RVCA 3ULQB 2K86A 2YR2A 2GA2A 3CUQC 4YFKF 1UFMA 2ZKZA 2XVCA 3TOBA 3F8MA 1JHFA 1QGPA 5F64A 2WTEA 3KZYA 4HLYA 1OR7A 3OV8A 2HZTA 3ZQ7A 3LA2A 2XAQA 4HA8A 1W7PA 2X4HA 5HDNA 3KP6A 4M72A 3HOTA 2FE3A 3RPQA 4Q48A 3WTUC 2ZXJA 2V1XA 3SHFA 3WTSC 4L9JA 4KN4X 2ESNA 1JE8A 3R60A 5TRDA 1ZRFA 3P7NA 4MTEA 4UV9A 3PQKA 3T5XA 2EJRA 1MDMA 2HFHA 2H6BA 5D5XB 1KA8A 4CYDA 2ZO4A 3CO7C 3BOQA 1DUXC 4G6QA 2YX4A 4EM1A 1QZYA 4AD9A 2QQ9A 2RNJA 5LEKA 2BBYA 1DDNA 4S05A 3WTVC 2UXXA 4CICA 3VOEA 5F1RA 1WI9A 4YIIA 4I98B 1RZ4A 4KYWA 3K1PA 3JSOA 5FD5A 1TW3A 4KMUX 4AIKA 4HOBA 1LVAA 1EH6A 5FLXK 5JI6A 3JAMK 2HR3A 5ILUA 2NNYA 4QWQA 1XSDA 1XMAA 3JW4A 3EYYA 4WF2A 1IF1A 5DUKA 2GIVA 2L4MA 3U9GA 2QQAA 2K4BA 1FPQA 4IHSA 5CVRA 1BJAA 3DV8A 1W7PB 3ISPA 3R6SA 3IWFA 1O3TA 5D8LB 3CLOA 2AS5F 1XGSA 4PGGA 3ABUA 5E18F 3K69A 1MZBA 3H92A 2QBYA 1K79A 1MDMB 1T38A 1KYWA 3BWGA 1QZZA 1ON1A 5K5QA 4HBLA 4ZZDA 5LBQA 3RDIA 3I64A 3F8CA 1QPMA 5FB2A 4HV5A 2UZKA 4PDKA 2P5VA 4JK1X 1T2KA 3L7WA 1BIBA 3LA3A 1WWXA 1J5YA 1YO5C 2H27A 2M87A 4I02A 4UXNA 5J8CA 1FYMA 4R8HA 2XHKA 1J0RA 3KETA 4IRGA 4G7ZF 4IRHA 3ZMVA 5CYVA 3RI4A 2D1HA 1G3WA 1FBSA 4L9NA 1R1VA 1V4RA 1ODDA 3KP5A 2HYGD 2OD5A 1SAXA 3LFKA 3MFKA 1Z1DA 1HQCA 4HV6A 3HTSB 1XGMA 4EJOA 2M30A 3LQQA 2TDXA 3FHZA 3U1DA 1RUOA 1IXCA 1J59A 1OYYA 2M1BA 3KP2A 2NYXA 5AIPA 4FX0A 2QBYB 3BPVA 4AIHA 1F4KA 2ESHA 2PG4A 2HQRA 3RYPA 3ZN0A 3GWZA 2IPQX 1V3FA 1KQ9A 1TBXA 2F5DA 4LFUA 1U2WA 1ZARA 1I27A 2DW4A 1KU3A 1UCRA 1UB9A 1IN5A 1YS7A 2FA5A 3MQ0A 3GYHX 3WGGA 3MWMA 4YFXF 3BP8A 3QOPA 3I5UA 2DQRA 3T0YA 5IT9K 2HKOA 1UHMA 2PFBA 4L18B 1KU9A 4HDVA 2H09A 2IP2A 1YW8A 4OIQF 4ZYHA 1FYLA 4UNOA 2P7CB 1Z6RA 5FFXA 4UHTA 3LAJA 1UHWA 4RAZA 2OQGA 3E3VA 2P5LC 2CO5A 3I0TA 2RQPA 2YU3A 4LB5A 5BPDA 5KVRA 3R0JA 1ZLKA 1FSEA 5FGMA 2ISYA 3E5XA 1U6GA 2EK5A 3DFGA 2LDUA 2XKPA 2KKOA 2QUFA 2IT0A 1OKRA 1G3TA 1FP1D 1W5TA 1MGTA 2CW0F 3TGNA 1J75A 2NNNA 5CVVA 3R0AA 2Z99A 2VXZA 1B6AA 3BPXA 1FWZA 3Q9VA 5KK1A 4XSZF 2DT5A 1G6NA 3E6CC 1LQ1A 3SFZA 1S6LA 1XSXA 1J9IA 3HRUA 2QENA 5JVTA 4RS8A 4RGUA 2HWVA 1USSA 2EFQA 2MA3A 3HSRA 5D8KB 5FLXZ 4KFCA 3JAMZ 3NEUA 4EMSA 4RGRA 1NHAA 4O3MA 3FM5A 5LEJA 4OIPF 1C0WA 4GGGA 4MEXF 2HGCA 1XGOA 1FBQA 5A2QK 4G94A 2LF8A 4BHBA 3SXYA 1U5TA 2UXNA 3BROA 1XDSA 2P4WA 3CO6C 4HYEA 1XD7A 1EV7A 2RC4A 2PJPA 3VODA 4MGRA 4RGSA 1P2FA 2PI0A 1P6RA 3M9AA 4PZJA 1WQ2A 3ZP5A 4L9TA 2HS5A 4A12A 1S8NA 4FT8A 4L0YB 3BJAA 3E97A 5HVQC 2X0LA 4GXOA 3V4GA 3JTHA 4RB0A 3GZ6A 3I4PA 5LLQA 1U8RA 5TJJA 1WRJA 2ZFWA 4I01A 2HQNA 4N0BA 4RB1A 5L3BA 2XAGA 3GFJA 3F21A 3D5LA 3V8JA 2OZ6A 2GA1A 2CQKA 4KA4A 2CWEA 3HHGA 1YYVA 3BDDA 1Q1HA 4GYGA 1D5VA 2W57A 2IJLA 2IW5A 4N9HA 3WTXC 4LD5A 2STWA 1PP7U 1IW7F 4P9FA 1ZG3A 2FNAA 2PMHA 4EV0A 2R3SA 3FM3A 3COAC 3I53A 3L09A 1FZPB 4O6JA 4KN7X 4MQ9F 1LDKB 3IRRA 1U5TB 3LQRA 1W4MA 2HTJA 2ADUA 4IHTA 1WKMA 4G7OF 5D5UB 5CVJA 4HX7A 2G7HA 5K5RA 3M1EA 4YFNF 5BS6A 2FOKA 2A6HF 3GXOA 1SD4A 1XMKA 5LHIA 3C7JA 4KIBA 3DXJF 2NRAC 1SD7A 1ZGJA 2L02A 3V7RA 4M71A 1ZG5A 1ZGAA 2V1DA 1T39A 2D2WA 1KGSA 1BI2A 3RKWA 1IRFA 2J5OA 1RIOH 1VTNC 4L5JA 2YX7A 2ZNZA 5IT9Z 3VFZA 1J7KA 2Z3YA 2VBZA 3E6BA 2ZJ2A 3MEXA 1ZG1A 2Y75A 3SZPA 3F72A 2YSRA 2XAJA 1QNTA 3KEOA 3RKYA 4UVCA 3F6OA 5H6QA 3IL2A 1IZ1A 2ISZA 4ZYEA 1Y0UA 2EFOA 1IAWA 5FFZA 1FSHA 4EVIA 4FHTA 1PUEE 2PQ8A 1FX7A 3CUOA 5D5WB 3D0SA 4KMFA 1HXDA 2VC1A 3HOSA 4O5VA 1LB2A 1LDDA 3TQNA 2PN6A 5HDGA 3J81Z 2FU4A 4FX4A 1GXQA 3LSTA 1I1SA 1HW2A 1P4AA 5HS8A 3ZMZA 1F1ZA 4DQ2A 2P5KA 6PAXA 1FY7A 1YTYA 1STZA 4HX4A 4QLCU 3L00A 2G9WA 4UVAA 2WC2A 4ENMA 3K1MA 2EWNA 1MKMA 3MZHA 1HW5A 3IHUA 4I0BA 4RGXA 2L54A 2VE8A 2COMA 3DP7A 3NRVA 1E17A 3FXRA 4EGYA 1KQ0A 2DLLA 2P6SA 2DQLA 5IT3A 1ZRCA 2KJBA 2PLYA 2G7UA 3MZYA 2DK8A 3EYIA 5A2QZ 3E6MA 5D4SA 2R7FA 4JQFA 3GFLA 4ESFA 2ACJA 2GXBA 3ML6A 2FBIA 4ESJA 4MHGA 4E70A 2ZCWA 2QLZA 1YIOA 4LLLA 3RYRA 2KJCA 4ON0A 4K2EA 5AONA 1YLFA 3P9KA 2Q8KA 1FBUA 3ZMUA 3ECHA 3S2WA 3NQOA 1YW7A 5LRRA 2BEOA 4RB2C 3F3XA 1JHHA 2HEOA 3EQLF 1YFHA 1LNWA 2VBYA 3SZTA 4WWCA 4ETSA 5ED4A 4GYIA 4RB3C 3CJNA 1IN6A 4LLNA 4I09A 1SD6A 4TV7A 2L3DA 3ZMTA 5D6EA 1T0FA 4CGZA 2J5PA 2VODA 1R36A 5D4RA 5BQTA 4EGZA 3WGIA 5H6RA 4HF2A 1BI3A 3E5QA 3I54A 1XB4A 4P5OA 4HZFA 1EH8A 4F7ZA 2OA4A 3KP3A 3B73A 1OPCA 4I7HA 1S7AA 2VT3A 2OU2A 4GO1A 4ENNA 1ZHFA 4OU0A 2A3SA 1HSTA 2O6GE 1HSJA 3ECOA 4HQEA 2EFNA 2O61A 1AOYA 2XROA 2VT2A 1GVJA 2Y48A 1WSUA 1SFUA 3DQVC 2YPRA 4RAYA 3MAJA 1BM9A 2JTVA 4BHPA 5L3EA 5BPIA 3EUHA 1Z05A 2FXAA 1LJ9A 4KUMA 4CHUA 2FSWA 4OMYA 1ZREA 1BC7C 3DF8A 3H3UA 3K2ZA 3WU0A 3CTAA 2ELHA 1E2XA 4LK1F 4CZZA 2VC0A 4XRFA 2EFWA 3O2PE 4NQWA 4M74A 3T8TA 5CVIA 2FMLA 3F8FA 3HRMA 4Y15A 5JFRA 4A5NA 3HUGA 3TO7A 1GHCA 1B9MA 2GWRA 2VOOA 2P8TA 2FBKA 2GXGA 4ESBA 2EV0A 3M7GA 5L3GA 4ZYGA 3KFWX 4AVPA 3PFIA 2D45A 1MJAA 4XBFA 5LGNA 2CFXA 5ICCA 4A2UA 3J81K 3B02A 2Z5UA 1HKSA 4Q47A 2RDPA 1QQIA 1XCBA 2GZWA 2A61A 5JR3A 2GAUA 1H9TA 5E17F 1Z91A 2VN2A 1MJBA 5J8FA 2HOEA 4HX8A 3C18A 1P4WA 1JGSA 3U2RA 2M8EA 5E8IA 3ZMDA 3TDZC 3GEZA 5AIQA 2IVMA 5EEGA 5FO5A 2M5WA 2M45A 1U3EM 3TO9A 3KE2A 5J6XA 3KZZA 4IF4A 4HF1A 2XV4S 3KP4A 1DPUA 3ABTA 1D3YA 3KLOA 2VBWA 1XN7A 2O03A 4WK8F 3G3ZA 1P4XA 4G6DA 3E6DA 5HLIA 1R58A 2IRFG 1R22A 1TW2A 2K4JA 4EQQA 2XAHA 1K7AA 3GFIA 2E1NA 3O6BB 2VE9A 3TKYA 1KYZA
chains in the Genus database with same CATH superfamily
1MJ9A 1ZELA 2LKPA 3BR3A 1H9GA 5DD4A 5E20A 4XORA 1Z9CA 3BG3A 4G8XA 1F9NA 5HNHA 2M4GA 3GO5A 2LOOA 2Q1ZB 3F8NA 1DQUA 2ZMEA 3ZN1A 2NVYJ 4IPAA 4A3FJ 1ZLJA 3HB9A 4P96A 1QO0D 2CUZA 1YS6A 3ROUA 4RDUA 1FP2A 3AAFA 5EDNA 1JJ8C 2HVRA 2ZJPF 2RV8A 2K02A 2TCTA 2RAEA 3HTUA 4J00A 2CRGA 3BR1A 4U0VA 3WHBA 1X2NA 2Y0MA 3WTWC 4FCYA 1AWCA 4JP0A 2E19A 2WV0A 5C44J 3T1BA 3GX4X 3ZOBA 1OMIA 1IUFA 3H9GA 4EJWA 3HG9A 3KYDB 1LKXA 4N9IA 3L2QA 4IHVA 4CO8A 4IJAA 1XDUA 3L9FA 1KZHA 2MC3A 2DT6A 1XCVA 1JXSA 3WU2C 1LVKA 4L0ZB 4RLQA 5JLWA 1CF7A 2MD5A 1JT6A 1Y0NA 1USTA 3CJQB 2ZSIB 3KEYA 1JUPA 1SFEA 4EM2A 4MEYF 1ZH5A 2R0QC 3C2HA 3R61A 1G3YA 2L7KA 2MH9A 4KT6A 4JX6A 2Q2EB 5LGTA 5EF6A 3EUKL 1TQMA 3VB2A 1BOBA 1AA7A 2F5CA 2P7VB 4PGHA 2K27A 1S3JA 1U78A 4X1EA 1EKEA 5HNFA 3HGYA 3OYDA 2BY3A 3WTTC 2LY9A 2DPDA 4Y13A 2XKOA 2CV0A 4BQOA 3WTYC 2WADA 3K4BA 4Y7NJ 4U7BA 4XQFA 1GV2A 3DEEA 4NC8A 2STTA 1OCZH 2F5FA 5K7FA 3OYJA 4WXHA 3WE2A 2WAFA 1R5HA 3GLXA 2R7DA 4CUGA 1Z0XA 3FXUA 3V8LA 5IY5H 3FWEA 2DO7A 1IUYA 4L9VA 4A6DA 4IOAF 3A0BC 3P9CA 3OSFA 5F6FA 1O57A 1IN8A 1N75A 1WI3A 2CSOA 1OR7C 4LK0F 4C2MJ 3JSPA 2NVQJ 4HW0A 1D8JA 1VQ5I 4Z2YA 2QKMB 3MN2A 2JZYA 3GUDA 4RM3A 2ZMEB 1RNLA 5ICGA 1POGA 3W6JB 2JPCA 3KYLA 2NOJB 3BG9A 3TMOA 4BYYA 1FOWA 5E3NA 4IRIA 4B48A 1D8KA 1BI0A 2MBFA 2DK5A 2RGVA 3OS2A 2ZXHA 4KNYA 1A6QA 1VNDA 2IGKA 2IA2A 5K5OA 2OPTA 4B4CA 5M3MJ 5EZHA 2EV5A 3K70D 1TP4A 2W25A 1P9QC 5DEQA 2XIGA 2BHYA 2M7BA 2KZGA 2CQNA 2DJIA 1I5ZA 4B8XA 3CCVI 4AIJA 2R4GA 1ETOA 3FBNB 3A01A 3M07A 2BV6A 2HOAA 2C6YA 1JJ6C 4WXDA 3BC8A 4XM3A 4BY1J 4IEJA 3V7SA 2FF4A 3RIRA 2QVOA 4BS9A 1CF7B 1O7FA 4A6EA 5HOOA 3LSHA 3CCMI 4LITA 3DU5A 4CXFA 4GCVA 2OCEA 2FUG2 5ERIA 1A31A 2HYFA 4UV8A 2XASA 2H1LA 3WE3A 4A5MA 1O3SA 4HAMA 3OSGA 2P6TA 4RMNA 2NVXJ 1FLIA 3Q9SA 3IC7A 1S7EA 1RR7A 4EJTA 1HW1A 5L3DA 1LE8A 4ZYDA 1UHSA 3DU6A 4M9ZA 3ESWB 1BR1A 1B8IA 2VKDA 4U0YA 2XSJC 4EJUA 4B09A 2VQGA 1FMVA 5BNGA 3ERED 1R1UA 2H94A 4NC6A 2OBPA 4ZDOA 4UUVA 2JSCA 2KIMA 5IYCJ 3T8RA 3FMQA 4KIFA 4AYBN 4LLGF 1J2XA 5EEHA 5FLVA 1S5LC 4H0EA 1WJCA 2K9MA 2M3AA 2Z9OA 2G0EA 3C1DA 3PO3J 4WX9A 2X6YA 2X1CA 4EM0B 2IA0A 1MBKA 1R00A 1JKPC 3G4SI 5ICFA 2RKHA 2WY8Q 4IXAA 5H20A 2LR8A 1K6OA 3J80Z 1VQ6I 1B59A 2IAIA 2RN7A 1KQ8A 1YX5A 2W24A 5DYMA 1RUNA 3IKTA 2XGXA 1VFCA 4XNFA 2VJJA 5DM7F 4BE0A 3FHNA 3VEPA 1A04A 3IH4A 4X6AJ 3SZGA 2QCOA 1HCRA 3QPHA 3M8FA 3ASNH 4WXCA 4AUXA 2NVUB 2EZIA 3A01B 1WJEA 5LGUA 1ZN2A 3K1NA 1TL8A 3PNYA 1FC3A 3RTRA 4XKBA 3BR2A 2X51A 4P9UA 3SDGA 2F5VA 1ERDA 3M8EA 3F8BA 1YQAA 1HKQA 1F5TA 2L4AA 2L9RA 2I8DA 4OOIA 2HDCA 2FMYA 4HSTA 1RESA 4PSXA 4ZTFA 2EV6A 2X1EA 1OCPA 1BI1A 4A69C 1QU3A 1SD5A 5F0FA 3MKYB 2CS3A 2E1CA 4KDPA 1Y1WJ 3CUQA 5DCMA 3HPHA 1JT0A 2ZC2A 1LE8B 1Z77A 3MCZA 3IKVA 2KL4A 2VKHA 3QOEA 3J7YJ 1B8IB 5EJCA 2DFIA 3PNTA 1IXRC 3GVAA 1EH7A 3K4LA 3K4MA 4HLXA 4ABZA 3LSRA 1D1CA 1T0FC 1BIAA 2IA1A 1I6XA 5CLSA 1O3RA 3HDDA 1S7OA 2OCCH 1DPRA 1BBYA 2DMPA 3PO2J 1L0OC 4ZDPA 5CQGA 2VQCA 5K1YA 5LRSA 4KITB 4G9YA 4I2OA 3SFIA 1XSVA 2LNBA 3S1MJ 4E7ZA 2EZHA 2LMDA 4Q4ZF 1TQPA 3I71A 3N97A 2Y69H 2MLGA 1LPQA 4BJ6C 1DP3A 4ENJA 2FQ4A 3K6GA 3L2CA 2AXLA 4U87A 2H1KA 2KRHA 4A3BJ 2ETHA 4XL9A 2F4OB 3OYGA 2CYYA 2PX9A 1I39A 2M4KA 3E1SA 2KIFA 2UWMA 3W2AA 1BL0A 2Q0OA 2OZUA 2GQQA 2JA7J 4HQMA 1I1GA 3EETA 1R5GA 3OOUA 1OCRH 2Y0SA 2LYCA 4XLNF 2DU9A 4OIOF 3L2VA 3F22A 5ILVA 2XUBA 5DCFA 3LSGA 1O7LA 3HRTA 1TNTA 4Y17A 3CCRI 3EUHC 3ZCOA 1T6SA 1P92A 1NH3A 5GPCA 1T95A 2CG4A 5GAEJ 2X6XA 1WCMJ 1HC8A 4MNUA 1B1BA 1IXSB 1YG2A 3CQZJ 3K2AA 2A07F 2XPVA 4ZDLA 3OYAA 1YJWI 4UY8I 3CUQB 5DCMB 4BAYA 5E1WA 2YS9A 4BU2A 2GXAA 2LSOA 1QA6A 1SEUA 1VQ7I 3UR3C 2O7OA 4XRSA 5L3FA 2R7UA 3HIFA 3HM5A 4BXUA 1WVRA 1BOAA 2XGEA 3OR1C 3NARA 1APLC 2E35A 5D6FA 4V2FA 4A0ZA 1YOVB 1SAUA 4CDGA 3R4KA 4I0AA 4AU7A 3GFMA 1MH3A 4M6YA 3FX3A 3BR6A 5DDGA 2V1UA 5IP6A 1K6YA 3C3WA 4UB6C 2LH9A 4LMYA 3OS0A 2LG4A 1ZRDA 4D0PA 2HKXA 4CCLA 2D5VA 2DYSH 4LJZF 1IJWC 3SDBA 3DLLF 1T8IA 5J4VA 2WWYA 2XF7A 5DD8A 3WU1B 1HBXG 3MD2A 2FX0A 2BHZA 3OOPA 2K7LA 1L3LA 4ENKA 3G2BA 2DMNA 1IRGA 2BGCA 1HDPA 5CPRB 3OYLA 2ZFUA 2Y0SN 3RZOJ 1RC9A 2MLKA 3S14J 4YG2F 1JKQC 1IN7A 4R1HA 2DTZA 5IP9J 2WY7Q 4YIRX 3KEQA 3L1PA 1FYKA 4XSXF 3O3KA 2IGMA 3QYEA 4BGDA 1S29A 1DP7P 1H88C 5E8GA 2D1VA 3TW6A 2K9NA 1GXPA 3MVPA 1UMQA 3IV5A 1BW6A 3TP3A 5ILSA 5DS9A 3QPTA 2VQLA 2HQ5A 1W36D 2MC4A 2VOPA 2E5NA 4D5FA 1HOMA 1DGRM 2JRTA 1ONVA 1I3AA 4HPQA 3LNQA 2DBBA 4WCGA 2COBA 3QP6A 2DFFA 4EJVA 1UAAA 4CZCA 3O8HA 4IHYA 3J7AO 2IS4A 3A02A 1I3QJ 2JT1A 4H4KC 2HVSA 1FOKA 5CQEA 1EF4A 2XRNA 3EDPA 4EEFG 4NDLA 1BJZA 3H35A 3WGHA 5J4YA 1A5JA 1MD0A 4IO9F 3S93A 2YU9J 3TBIA 1MSEC 1RRJA 1XC5A 1X4OA 2OF7A 2M34A 1RI7A 1ZAOA 5HLGA 1JTYA 2BE5F 3I58A 1OFCX 3PSIA 3FMSA 3QU3A 1N77A 4CH7A 2DPUA 4HRIA 3CJTB 3OYHA 3QP5A 5E1XA 1FT9A 3WTZA 4PJJA 5BMZA 1Z7UA 2XB0X 3OMYA 2F2EA 3L2RA 3Q5FA 2A5YB 1ULYA 2BW3A 2VKVA 3I59A 1BR4A 1X1AA 5GTHC 3JR9A 1CGPA 5HS9A 3H3VK 3LAPA 3HSFA 1PP8F 5E1ZB 3ZPLA 3WG9A 2HZDA 1QHHD 4M6XA 4M3DA 1VQ9I 1MNEA 2FRHA 3OYFA 1OYIA 4DIQA 2JQ7A 5KAFC 2GOXB 2O8XA 5HODA 3CC7I 4A93J 3KLNA 4C30A 5B1AH 2XRLA 3ZR8X 3LWFA 1ZR2A 2IGOA 2QQBA 3RZDJ 2H6CA 1JKOC 2H8WA 1XGNA 1LDJA 1U5TC 5CVUA 1TTYA 2EB7A 2MH2A 1YW9A 2EIJH 3FF5A 4YIFA 4RBOA 3J80K 1FOXA 1IN4A 1MW7A 5LHHA 4IVNA 1V54H 4OMZA 1E3HA 3FXQA 4XLPF 4BQAA 3ELKA 1R1TA 2DAOA 1U9NA 5ICEA 1G4DA 5EG0A 2PBIA 3HHHA 5FROA 2ZMEC 1FNNA 1MMNA 1EJ9A 3RPUD 3SQNA 3REOA 2A6EF 1ZK8A 4JBAA 4AWXB 2JA5J 4OINF 4ASNA 1QBJA 3DWLE 1UELB 4RA2A 4D7MA 4M9XA 3ZMSA 3W6KB 2WA0A 4LOCA 3OYNA 3PQJA 2B0LA 1D0ZA 4U88A 2DTRA 3GW2A 3DKWA 3JRFA 2NS0A 4Q5SF 3HXLA 3LA7A 4KICA 2X48A 4LB6B 3SEQA 4NHJA 4U7DA 2O0YA 4MTDA 2CW7A 3OIPA 3ZQCA 2K40A 1D0XA 1ON2A 4HDUA 2A68F 3ZQGA 2W85A 2K9LA 2VBXA 4DBRA 2Q2EA 2DN0A 4QIWN 4S04A 3I59B 2BW3B 3HC7A 4DNCA 2FEZA 2E7XA 3BJ6A 3H3ZA 2KZVA 1OYWA 2W84A 2FNPA 3HYIA 3P5JA 5FD6A 3K9TA 2VB6A 3GLLA 2LC2A 1KU7A 5DV5A 2DI3A 1B9NA 1T08B 1W7PD 2KQRA 3JTGA 2EFPA 2A69F 2EINH 3KCCA 1I6HJ 5DUIA 3BQYA 3S2HJ 2EA2A 4A3IJ 2OQRA 4P55A 5IOZA 1MH4A 4KIGA 3CDHA 4CCOA 2MFZA 1T98A 3DCFA 5K7ZA 4PK4A 3BG7A 1E3OC 3OS1A 4QPQA 5CJ9A 5L3CA 4NB5A 2KIUA 3IWZA 3IUOA 4ZH4F 2Z16A 1AKHB 1DU6A 5LHGA 1X1DA 3DPLC 4BE1A 4KT5C 1R9TJ 4UB8C 5EG0B 4LG0A 3OY9A 4MQVA 1QPIA 1OCCH 2L01A 3QRFF 4IX7A 4BQQA 3WODF 2KRCA 4A3CJ 1NK2P 4A0YA 3BZ6A 1BN5A 3BTIA 5F0CA 2NOGA 1UG2A 2QM3A 4BBSJ 2PJRA 3VYTB 2HVQA 3TO6A 3DEUA 3HEFA 1XMXA 2OAZA 4HF0A 1B4AA 3G73A 3DTEA 3K0LA 1YX3A 3TDUC 3V8KA 4Z6YA 3TOAA 4XLCA 2HDWA 1K78A 3ABMH 2X9DA 3BY6A 1F43A 3KP7A 2XDVA 1UJ8A 2KRFA 2M7AA 3GTQJ 4M73A 4AIDA 1JTXA 4MLOA 5EZGA 3RSNA 2Z33A 2F5EA 1JGGA 1SMTA 1O3QA 1SFXA 2NAZA 1Z7LA 2R92J 2BVLA 3KZIC 2LF7A 5JHUA 1X19A 3SEZA 3PIOF 4C2TA 2XPWA 1Y8RB 2QWWA 4U0WA 1QZEA 1S72I 1BR2A 1TNSA 1HKTA 2CH0A 2HXIA 3H0DA 2LY2A 2KFDA 2KDZA 2JPBA 4A3MJ 2OV7A 3F6VA 2ZXIA 1RKTA 3HRSA 4NNJA 1PDNC 1TLHB 1T33A 2GBYA 3BLYA 4DW6A 4R79A 2JUGA 3QAHA 4D9JA 5JLXA 3CCUI 1GLNA 3VYUB 2ID3A 1SC7A 2CGPA 2V79A 3K4NA 1IDYA 2V9VA 3C2GA 3SYTA 2VONA 1YI2I 4BXXJ 1R7JA 1DU0A 4J01A 1MSFC 4BNCA 2E7WA 4OIRF 3HSEA 1E3PA 1SMYF 4N4OB 3FMRA 3CCQI 3FK6A 2VXDA 4B43A 4BHCA 4V2GA 4RLFA 4AYBA 5HLHA 5HDKA 1W5SA 1ZTRA 2XAFA 1H0MA 3E5UA 1BC8C 2PEXA 2ZBKA 3VYSB 3N4MA 2JK3A 2HPIA 5FJ8J 4LG0B 1R23A 1TQIA 3GTKJ 3DPTA 3GTLJ 2EA4A 1Z6TA 5BOXA 3P9IA 4UVBA 2HTSA 1N25A 3GZ5A 3F23A 4LGWA 3RQ4A 3HPGA 3FZVA 3OYEA 2BXYA 4G7HF 5F08A 3BJOA 2FQ3A 3S17J 4PCQA 1X3UA 1MMAA 4OAZA 2LY1A 2PJRB 2LREA 5DM6F 2HXOA 3RKXA 3IRQA 2BYVE 1MBFA 3D5SC 1JUMA 1QHGA 3OL4A 2IS2A 4AM3A 3RJPA 2FBHA 4BH9A 5TGTA 1SVLA 2QYOA 2HNHA 5D5VB 3ZXSA 2R7TA 1K78B 3LOCA 4D5CA 3EPZA 2PMUA 3V7CA 1KU2A 2V6CA 1MMSA 1XS9A 5HS7A 1G3SA 4QSHA 2GIZA 2VJ5A 4PSWA 2ZNYA 3TEDA 5JHFA 3RPUA 3Q0WA 2OUMA 4M9SA 5FKMA 4A0XA 2VI6A 1ZYRF 3CCSI 1REPC 3HBLA 1NG7A 2LFBA 2O3FA 2QZ8A 1LEAA 3G1OA 5M5YJ 4QTRA 3BCBA 3PUFA 1LEBA 1G8XA 4ZZLA 3QU6A 4BDYA 1LFPA 3A1YA 3A0HC 2DOFA 1FEXA 3ZQQA 2ZXWH 3GF2A 4A3DJ 4L5IA 2RVCA 3LFUA 3ULQB 3GBGA 2K86A 2KIQA 5K7HA 2Z1DA 4IOCF 2CV2A 2YR2A 3CDLA 1ETKA 2GA2A 3CUQC 4L5EA 4DZJA 4YFKF 4PUSA 1UFMA 3ZGKA 2ZKZA 2XVCA 5F27A 3TOBA 5GTIC 1AU7A 3F8MA 1JHFA 3ZQLA 1QGPA 4JX5A 5F64A 2WTEA 3F9KA 3KZYA 1X1PA 2CQXA 4EATA 4MFEA 3VPRA 4HLYA 1OR7A 2WAQA 3OV8A 2HZTA 3ZQ7A 3V42A 3LA2A 2XAQA 4HA8A 1W7PA 3PIPF 4PJMA 1IV6A 3IH3A 2X4HA 5HDNA 1MBEA 2Y2ZA 2JN6A 3KP6A 3BTCA 1Z3YA 4RM2A 4M72A 2ECBA 4LIUA 3HOTA 2FE3A 3RPQA 4Q48A 3WTUC 2ZXJA 3DEWA 4M3BA 2V1XA 1WFXA 3SHFA 3S3NA 3WTSC 2VASA 1CQTA 4L9JA 5FRMA 1FIPA 2ESNA 4KN4X 1JE8A 2V7FA 3R60A 4V19K 2CV1A 5TRDA 3MZ8A 1IDZA 2DT7B 1ZRFA 3A03A 2E2IJ 1IGNA 3P7NA 4MTEA 1VQ8I 4UV9A 3PQKA 3T5XA 2W1OA 2E1MC 1P7IA 2EJRA 3K10A 5J1UA 1MDMA 2HFHA 2H6BA 5D5XB 1KA8A 4CYDA 2ZO4A 3CO7C 1H8AC 2JA8J 3BOQA 3DKYA 1R49A 3UKGA 1DUXC 3PSFA 4G6QA 2YX4A 3HGGA 3CJRB 4EM1A 1QZYA 4AD9A 5E79C 2ZJQF 2QQ9A 2RNJA 5LEKA 4GFBA 2BBYA 1DDNA 1SVOA 3S32A 4S05A 1HA8A 3N05A 3WTVC 4DYCA 3HKZA 4BBRJ 3VYRB 2UXXA 1SVMA 5J3LA 3VOEA 4CICA 5F1RA 2XSDC 1WI9A 1GVDA 4YIIA 4I98B 2RQQA 2M0MA 3BTJA 1RZ4A 3E7LA 2ELKA 4KYWA 4OWRB 3K70C 3K1PA 4QPOA 3JSOA 5JVGF 4XMYA 5FD5A 1TW3A 4KMUX 1WHUA 2HYJA 4AIKA 4HOBA 1LVAA 4F3QA 1EH6A 5FLXK 5JI6A 5ILUA 2HR3A 3JAMK 2WAQN 2NNYA 4IHXA 2Y31A 3FXKA 4QWQA 1R4NB 2DA7A 2ICWG 1YHQI 1ITYA 1I50J 1XSDA 2UUZA 1Q1VA 1XMAA 3JW4A 3QWLA 5M5XJ 3EYYA 4WF2A 4CYCA 3HOXJ 1IF1A 3H5AA 5DUKA 2GIVA 4E6KG 2LLKA 2FD5A 1V5FA 2L4MA 3U9GA 2QQAA 2K4BA 1FPQA 1Y1VJ 4IHSA 2DA5A 4F91B 5CVRA 1BJAA 3DV8A 1W7PB 2V26A 1WJFA 3VDXA 3JRAA 3ISPA 3VWBA 3R6SA 1VQMI 2JWTA 3IWFA 3UNGC 1O3TA 1F36A 5D8LB 2DA3A 3CCJI 5FKLA 3CLOA 2AS5F 1XGSA 4PGGA 3ABUA 3AL0C 2RREA 5E18F 3AFHA 3K69A 2CMPA 2EZLA 2M2EA 1MZBA 1WJDA 3DKXA 3H92A 2LTPA 2QBYA 1K79A 3GTMJ 3W2VA 1MDMB 2R7RA 1T38A 2JVHA 4BKXA 1KYWA 3BWGA 1QZZA 4XKVA 2A05A 2R7QA 3IP4B 1W0UA 3I55I 1ON1A 5K5QA 4HBLA 4ZZDA 3MKZA 3HKZN 2LKXA 5LBQA 3RDIA 3I64A 3F8CA 1QPMA 2VL8A 1VF9A 5FB2A 2OJED 5F1JA 4HV5A 2AHQA 2UZKA 4PDKA 2P5VA 1V55H 4JK1X 5C3EJ 1T2KA 3H36A 3L7WA 1MNMC 1BIBA 1X2MA 3LA3A 2KP6A 3KYCB 3G6EI 1WWXA 3K4CA 4FETA 3G71I 5FKKA 2NXNB 1J5YA 1YO5C 9ANTA 2ZSHB 2LBFB 2MW8A 2H27A 4PFOA 1W1WE 2M87A 4I02A 2DA1A 4UXNA 2HDDA 5J8CA 1FYMA 4R8HA 3JRCA 2XHKA 1J0RA 3KETA 4KISA 4IRGA 4XKCA 3AG4H 3AKZA 3DBRB 4G7ZF 4IRHA 2DMUA 4CYCB 3ZMVA 5CYVA 3RI4A 4ZTJA 2D1HA 1G3WA 1FBSA 4XRMA 4L9NA 3O8GA 1UG0A 4Y3OA 1R1VA 4ANJA 5FRNA 2B63J 1G2HA 5GAHJ 1AHDP 2GLOA 3I4MJ 1B72A 3S3OA 1V4RA 1ODDA 3KP5A 2HYGD 3RKQA 3FKIJ 2OD5A 1SAXA 2V9KA 3LFKA 3CD6I 1ZGWA 1PJRA 3MFKA 1Z1DA 1HQCA 4HV6A 3HTSB 1XGMA 4EJOA 4A3EJ 2V6EA 2M30A 3LQQA 2TDXA 5IYDJ 3FHZA 3U1DA 1H89C 1RUOA 1IXCA 2OTJI 3IAS2 1J59A 1OYYA 1PYVA 4I76A 2M1BA 1JUSA 1FOYA 2CQ7A 3KP2A 4GRIA 2NYXA 5KCMA 5AIPA 4B1RA 4FX0A 2QBYB 3FXLA 2EILH 3BPVA 4M3FA 4S0HB 4BJ5C 1ZR4A 4CA0A 4AIHA 1F4KA 2ESHA 2PG4A 2PMZA 3TW7A 4DYQA 2RNGA 2HQRA 2NVTJ 3J7AY 3RYPA 3ZN0A 4E7IA 3GWZA 2IPQX 1V3FA 2DFHA 1KQ9A 1TBXA 2R5YA 2F5DA 4LFUA 5FKOA 1U2WA 1ZARA 1I27A 2DW4A 2VIXA 4C3HJ 1YJNI 4GDFA 1KU3A 2P81A 1UCRA 3W3CA 2HPMA 1UB9A 1IN5A 4XLAA 1YS7A 2FA5A 1ENHA 3MQ0A 4HSRA 3GYHX 2WB1A 3WGGA 3MWMA 3CDIA 4YFXF 2DXIA 1FTTA 3BP8A 3QOPA 4B47A 3I5UA 4C3IJ 2F48A 4A3GJ 2DQRA 4MFDA 3T0YA 3FKJA 5IT9K 2HKOA 3QPSA 1ETQA 2MGQA 2QA4I 1UHMA 2NS8A 2PFBA 3KX2A 3JCUC 4BXFA 4DJAA 4L18B 1KU9A 4HDVA 1NTCA 1Z67A 2WAEA 2H09A 2IP2A 2VLAA 1Y6IA 4F52A 1YW8A 4OIQF 4ZYHA 3Q0VA 3ZRGA 1FYLA 2JJ7A 4UNOA 4M3EA 2P7CB 1Z6RA 5LD2C 3HOUJ 1OCOH 5FFXA 3LSPA 1HDDC 2XPUA 4UHTA 2KT0A 1GV5A 3LAJA 1A6IA 1UHWA 4RAZA 2OQGA 4MIMA 4JYKA 1B72B 3E3VA 2P5LC 2CO5A 4DYRA 4E7LA 3AG1H 3I0TA 3DBLB 3H0GJ 2RQPA 2MD0A 2YU3A 2DA2A 3PJRA 4LB5A 4Y4RA 5BPDA 5IYBJ 4BY7J 2W82A 3BZKA 3JRGA 5KVRA 3MMYB 2DDAA 3R0JA 1ZLKA 1FSEA 5FGMA 2V1NA 2ISYA 3E5XA 3J7ZI 1U6GA 2EK5A 1TZLA 3DFGA 2LDUA 2XKPA 2KKOA 2QUFA 2IT0A 2PMZN 1OKRA 4IL6C 4D1QA 2IS6A 1G3TA 1FP1D 1W5TA 1Y56A 1MGTA 1X1BA 1XTAA 3F0CA 2CW0F 1AKHA 4PJ0C 2QF7A 3TGNA 1X1CA 1TWGJ 1J75A 3HJEA 1ETWA 1HF0A 1D0YA 2NNNA 2LRDA 5CVVA 3R0AA 2Z99A 2VXZA 1MBHA 5GAGJ 2LD5A 1B6AA 1Y8QB 3BPXA 3FXMA 4XIDA 3W6VA 1FWZA 2ELJA 3Q9VA 2XF6A 5KK1A 2R5YB 2WB1N 4XSZF 1JI8A 2DT5A 4XLHA 1G6NA 1KONA 5KAIC 3E6CC 4HG2A 5M5WJ 2XC7A 3K4JA 1LQ1A 3D5RC 4F92B 2A5WA 3SFZA 1S6LA 1MIJA 1XSXA 3LL7A 2A6TA 2X1DA 5F04A 2MSYA 3S1NJ 5C4XJ 1J9IA 2R7OA 4D7NA 3HRUA 2QENA 5JVTA 4LIVA 4RS8A 4RGUA 2HWVA 1USSA 2W48A 4RAGA 1UZCA 1V5GA 3GZNB 1ZKGA 2EFQA 2DODA 5B66C 2MA3A 3HSRA 3CC2I 4AVZA 1MBJA 4IHWA 5D8KB 3GMEA 5B1BH 3CMYA 1U8BA 2R7XA 2JUCA 3HOVJ 1W36C 5FLXZ 2BOLA 4KFCA 3JAMZ 3NEUA 4EMSA 1NK3P 2VUMJ 2L2OA 4ZC3A 4RGRA 1NHAA 3ZQIA 1YRNA 4O3MA 3PNVA 3FM5A 1SANA 4JOMA 2R7WA 5LEJA 2QSHX 5FLMJ 1K4TA 4OIPF 1C0WA 4GGGA 2IGNA 4MEXF 2K85A 2HGCA 2W4SA 1QVTA 1XGOA 1FBQA 2XB5A 5A2QK 2XGDA 4G94A 1ZQ3P 2LF8A 4BHBA 5J40A 3SXYA 1U5TA 3IH2A 2UXNA 3BROA 1XDSA 2P4WA 3CO6C 4HYEA 1XD7A 3MKLA 1EV7A 2RC4A 4XN3A 1IC8A 2PJPA 3VODA 2DOEA 4MGRA 3CMEI 1W0TA 4A3KJ 1RPWA 4RGSA 1P2FA 2PI0A 2EIKH 1P6RA 3BTLA 3M9AA 1VQPI 4PZJA 1WQ2A 3ZP5A 3FXOA 4J19A 4L9TA 2HS5A 4A12A 5M3FJ 5HLTA 4I6ZA 3GTPJ 1S8NA 4E4HA 4FT8A 4L0YB 3BJAA 4A3JJ 2M9HA 2FJ1A 1ETXA 3E97A 3CP8A 4II3A 3Q0UA 5HVQC 2X0LA 4GXOA 1LUJB 3V4GA 4ITVA 3JTHA 2W00A 1K83J 4RB0A 3GZ6A 2AQEA 3I4PA 2EPFA 1EA3A 4PJLA 3OIQA 4G12A 5LLQA 1U8RA 2E1OA 2CFOA 5TJJA 3KPHA 1WRJA 3FXJA 1GT0C 4AC0A 2O8KA 2ZFWA 3MKWB 4I01A 2HQNA 4N0BA 5E3OA 4RB1A 5L3BA 2XAGA 3PFYA 3GFJA 1E0EA 3F21A 3JRDA 1NG6A 3D5LA 5KHDA 3LSJA 1OISA 3I9V2 3V8JA 4IKFA 3HL2A 2OZ6A 1FMWA 2GA1A 2BY2A 2CQKA 4KA4A 2CWEA 3HHGA 1YYVA 3BDDA 1YRNB 2DCEA 1Q1HA 4F93B 2L9VA 3QODA 4GYGA 4M6VA 3ZQFA 1TT5B 3I4NJ 1V5EA 2L0KA 1D5VA 2W57A 2IJLA 2IW5A 4N9HA 3LSMA 3WTXC 1RR8C 4LD5A 2STWA 1PP7U 3S1QJ 1IW7F 2UV1A 3G1MA 4II2A 4P9FA 4I99C 1ZG3A 2FNAA 1SFKA 1WGXA 2K3FA 1RETA 2XAUA 5E3LA 2PMHA 4EV0A 2R3SA 3FM3A 3COAC 2ZB9A 3JRBA 3I53A 3L09A 1FZPB 4O6JA 3VSKA 4KN7X 4MQ9F 1LDKB 1U5TB 3LQRA 1W4MA 4FASD 3IRRA 1OCTC 2HTJA 5B5EC 2ADUA 4X0GA 2EBIA 1WKMA 4IHTA 4G7OF 3OYIA 1ETYA 5D5UB 3CLQA 4FISA 4CCJA 2EQRA 5CVJA 4HX7A 3BZCA 1WH5A 2G7HA 5K5RA 2N8GA 2K9SA 3M1EA 3D1NI 4YFNF 5BS6A 2B9SA 2FOKA 3U21A 2A6HF 3GXOA 2HOSA 1SD4A 1TWAJ 1MMDA 1TWCJ 2LK2A 3SJMA 1XMKA 4PJNA 3OR2C 5LHIA 3C7JA 4KIBA 3DXJF 3GTJJ 2NRAC 3KIOA 1SD7A 3QYFA 1ZGJA 2L02A 3V7RA 2BVMA 4M71A 1ZG5A 1ZGAA 2V1DA 2X6OA 1DGWY 1T39A 2D2WA 1KGSA 1ETVA 4IQJA 1BI2A 1IRZA 2JSPA 3ABLH 3RKWA 1IRFA 3BT9A 4Y33A 2J5OA 5KNLA 1VTNC 1RIOH 3OWTA 4L5JA 3S15J 3OIOA 2V4JC 3TL4X 3AG3H 4XK4A 2YX7A 2ZNZA 5IT9Z 4W1UA 2H8RA 3VFZA 1J7KA 2Z3YA 2JMWA 2TRTA 2VBZA 3E6BA 5DTDA 1YJ9I 4KJZA 2HI3A 4BACA 2ZJ2A 3MEXA 1ZG1A 2CW8A 1VQNI 1IO2A 1WPKA 2Y75A 2QGUA 3PL8A 3SZPA 1RKWA 1Z3XA 5IOYA 3F72A 3DTKA 4UUSA 1LFBA 3ONQA 2YSRA 2XAJA 1QNTA 3NWSA 3KEOA 3RKYA 4UVCA 3F6OA 4W97A 5J47A 2AXTC 5H6QA 3IL2A 1TT0A 1BW5A 3WHCA 3S16J 1IZ1A 2ISZA 2K9QA 1MNDA 2JA2A 4ZYEA 4IZZA 5EGOA 1Y0UA 3ABKH 3CCYA 2EFOA 3HOZJ 3CMAI 1IAWA 4XR6A 1TC3C 5FFZA 3JREA 3HZJA 5E3MA 1FSHA 4EVIA 1U0JA 2V9PA 4FHTA 1PUEE 3CCLI 4IQ4A 2VKEA 2AO9A 2E36A 2PQ8A 3DTIA 1FX7A 2E2HJ 3BG6A 1OQYA 3CUOA 5D5WB 1JKRC 3D0SA 4KMFA 2KISA 2R7VA 1HXDA 2VC1A 3HOSA 4O5VA 1LB2A 1LDDA 3BG5A 3TQNA 2PN6A 2QSFX 5HDGA 4DZPA 3J81Z 1MBGA 2L7MP 1WJAA 4M3GA 1TWFJ 3PM1A 2E71A 2FU4A 1VQ4I 2DYRH 3FK7A 4FX4A 1GXQA 3H5NA 3LSTA 3S1RJ 1I1SA 1HW2A 1P4AA 3ASOH 5HS8A 2MYSA 3ZMZA 1F1ZA 2CUJA 4DQ2A 2P5KA 3OL3A 6PAXA 3X2QH 1FY7A 3G1LA 1YTYA 1STZA 4HX4A 4QLCU 3M4OJ 3L00A 1J09A 2G9WA 4UVAA 2WC2A 4ENMA 1SFOJ 1R5ID 3K1MA 4FTHA 4C2UA 2EWNA 4DOZA 3BCAA 1MKMA 3MZHA 2JA6J 1HW5A 3IHUA 4MO7A 4I0BA 3FBIB 4RGXA 2L54A 2VE8A 2COMA 3DP7A 3NRVA 2BY1A 1E17A 2CUEA 2R93J 1PVEA 3FXRA 1QVUA 1IRXA 2DJNA 4EGYA 4UUSB 1KQ0A 2E60A 2LBFA 5GP9A 2E2JJ 3BR5A 2OTLI 4FQGA 2DLLA 2P6SA 1R4MB 1X58A 1OJLA 2DQLA 4RAFA 4LG3A 5IT3A 2I10A 1ZRCA 2ECCA 2KJBA 2LP0A 2PLYA 5IPAA 2G7UA 1VQKI 3MZYA 2Y9ZA 5EGOB 1N78A 2DK8A 1D5YA 3EYIA 1ORKA 1Z21A 2XGCA 5A2QZ 3E6MA 5D4SA 5F0HA 4BEHA 4FE7A 2KHMA 2R7FA 4JQFA 3GFLA 3IAM2 3GCMA 4ESFA 1XG1A 2ACJA 3M1CA 2GXBA 2ME0A 3ML6A 2FBIA 4ESJA 4MHGA 4E70A 2WBMA 2DA6A 5EEAA 3A2KA 2LVSA 2ZCWA 2QLZA 1YIOA 3VSLA 4XN0A 2E34A 3H5RA 4LLLA 2DMQA 3RYRA 4XRSG 4XKWA 1PUFA 2DA4A 2KJCA 4ON0A 4K2EA 1A35A 5AONA 1YLFA 3P9KA 1VZ0A 2Q8KA 1FBUA 2VJ4A 1GUUA 2VJIA 3ZMUA 3ECHA 3S2WA 2HOTA 1WZ2A 3U1KA 3FIWA 2QQ8A 3NQOA 3OYBA 1YW7A 3B6CA 5LRRA 2BEOA 2BZTA 4RB2C 3F3XA 1JHHA 2HEOA 2L7ZA 3EQLF 1YFHA 1LNWA 2VBYA 3SZTA 3PUBA 2ME6A 4WWCA 3OYKA 4ETSA 4E7JA 1IV8A 5ED4A 4JX4A 4GYIA 4UUTA 4YRVA 4RB3C 3OYMA 3CJNA 1IN6A 4C9YA 4LLNA 4BJTA 4I09A 3C2BA 3JRIA 2DOAA 1SD6A 1TWHJ 4B44A 4TV7A 2EIMH 2L3DA 3ZMTA 5D6EA 2VQHA 1T0FA 4CGZA 2J5PA 3FDYA 3LMMA 5C4JJ 2R5ZA 2VODA 3JRHA 1HLVA 1R36A 3K4KA 5D4RA 5BQTA 4EGZA 3WGIA 5H6RA 1WJBA 3AG2H 1BI3A 3E5QA 3I54A 4HF2A 1XB4A 4P5OA 4HZFA 1EH8A 4YELA 4F7ZA 2OA4A 3KP3A 3CC4I 4XICA 3B73A 4OAYA 1OPCA 3CF5F 4I7HA 4YEJA 1YITI 1S7AA 2L9SA 4BL0B 1YIJI 2ID6A 2VT3A 2OU2A 4GO1A 5GPAA 1ZHFA 4ENNA 1ACIA 4BEHB 4OU0A 2A3SA 1HSTA 4CCNA 2O6GE 1HSJA 3CF2A 4E7KA 2VPLA 4FE4A 3ECOA 1A36A 4HQEA 2L7FP 2EFNA 2O61A 3CCEI 1AOYA 4BQNA 1M1EB 2LKSA 2XROA 2VT2A 1GVJA 5GADJ 3E0JB 2Y48A 1WSUA 3DPUA 4XLFA 1SFUA 5B3SH 3DQVC 2YPRA 3QQAA 4RAYA 3S3MA 3ZQHA 4N4NB 1WH7A 3MAJA 1GDTA 4A3LJ 3FISA 1BM9A 2JTVA 1PUFB 4BHPA 2NS7A 2QSGX 1MMGA 5L3EA 4PFPA 5BPIA 1XPXA 2E1MB 2I5UA 4C3JJ 2CJJA 3CESA 3NWTA 5EYRA 3EUHA 1Z05A 2IEKA 2QKLB 2FXAA 1LJ9A 4KUMA 4CHUA 2FSWA 3GTGJ 4OMYA 2KMUA 4F55A 3NAUA 4XONA 1ZREA 5FKNA 2DFEA 4CCKA 1BC7C 4NBQA 3RCOA 3DF8A 3H3UA 3K2ZA 3WU0A 3CTAA 2JVGA 1D1BA 3K7AJ 2X85A 2F6CA 3CP2A 1G59A 3BQZA 2ELHA 4DGWB 3DBHB 1K4SA 1E2XA 1X3ZB 5H2FC 3Q3SA 1BA5A 3WG7H 1OLTA 2YUSA 3QYBA 4LK1F 2IS1A 4CZZA 2VC0A 4XRFA 5TISC 3I3LA 4HNVA 2EFWA 3O2PE 4NQWA 2R5ZB 3GTOJ 1XX5A 3M3YJ 3I56I 2BXZA 4M74A 3T8TA 2IXSA 1P7JA 5CVIA 3H9JA 2EH3A 2FMLA 3L2UA 3F8FA 3HRMA 2QEXI 4Y15A 5JFRA 4A5NA 4BDZA 2K5CA 3HUGA 3TO7A 1GHCA 4ZJZA 1S9HA 4B3AA 1B9MA 3CMMA 2MG4A 2CU7A 2GWRA 2P8TA 2VOOA 2R7SA 2FBKA 2GXGA 1W5CC 4ESBA 2EV0A 3M7GA 1R71A 5J1RA 3DLAA 5L3GA 4ZYGA 3KFWX 2FOWA 3B6AA 2WV1A 2HU9A 4AVPA 4ZYAA 3OYCA 3PFIA 4BE2A 1O4XA 1FTZA 2BY0A 3S2DJ 2KDOA 1K61A 1VI0A 2D45A 1VQLI 2CUFA 2K3PA 5IP7J 1MJAA 4XBFA 1X4PA 3BR0A 2CFXA 5CKTA 5LGNA 5ICCA 4A2UA 3AL0B 3J81K 3EUAA 4HNUA 4CCMA 2R7ZJ 3B02A 1R6RA 2Z5UA 1HKSA 4Q47A 2RDPA 1QQIA 4B3XA 2Y9YA 1D1AA 1XCBA 3QPLA 4NC7A 2P0WA 2GZWA 2M0CA 2A61A 2O9LA 1T56A 5JR3A 2GAUA 1H9TA 2F4IA 2MABA 5E17F 1Z91A 2VN2A 1MJBA 4E7SA 5J8FA 2OC6A 3CZ6A 2HOEA 4HX8A 1VQOI 4Y52J 2ZJRF 2AQFA 2VPRA 3LSKA 3C18A 1P4WA 4P1WA 1FJLA 3W2WA 4E7HA 3L2WA 1JGSA 3U2RA 4CSWA 4XOTA 2M8EA 2KPMA 3S8PA 2XF5A 1LFUP 5E8IA 3ZMDA 2DMTA 3TDZC 3GEZA 1QRYA 5AIQA 2W7NA 2M8GX 2Y30A 4DBQA 2IVMA 4NQWB 3M8JA 4HEA2 2EZKA 5EEGA 5FO5A 1FIAA 3TP0A 5LFAA 5J1YA 2M5WA 2M45A 1U3EM 2DDBA 2JRMA 1U9OA 3TO9A 3KE2A 2E5ZA 4BUPA 5J6XA 2Z2SB 3KZZA 3H9QA 3HUGB 4IF4A 3ERMA 4HF1A 2KLOA 2XV4S 3KP4A 1DPUA 1X3WB 1IG7A 3ABTA 3HOYJ 1D3YA 2CQQA 4HNTA 4G6TB 2IBDA 2B7EA 3KLOA 2X6WA 2VBWA 4XOPA 1XN7A 2O03A 3LSIA 4WK8F 3HOWJ 3G3ZA 1P4XA 2GOMA 2L9NA 1YE9A 4G6DA 3E6DA 5HLIA 1R58A 2F4MB 2IRFG 1R22A 1TW2A 2O5RA 3H1CA 1WJ5A 2K4JA 4EQQA 2XAHA 1K7AA 4XLEA 3GFIA 2E1NA 3O6BB 2HQAA 3RQIA 2VE9A 4NUBA 3TKYA 1Y39A 2GM4A 3A4CA 2L5QA 1KYZA
chains in the Genus database with same CATH topology
1MJ9A 2LKPA 1H9GA 5DD4A 5E20A 1Z9CA 4G8XA 1F9NA 3GO5A 3F8NA 2ZMEA 3ZN1A 4IPAA 1ZLJA 4P96A 1QO0D 3ROUA 1YS6A 1FP2A 3AAFA 2RV8A 2K02A 3HTUA 4U0VA 2Y0MA 3WTWC 1AWCA 2WV0A 3T1BA 3GX4X 1OMIA 4EJWA 4N9IA 4CO8A 4IJAA 1XDUA 3L9FA 2MC3A 1XCVA 1JXSA 4L0ZB 1CF7A 2MD5A 1USTA 1SFEA 4EM2A 4MEYF 1ZH5A 3R61A 1G3YA 2MH9A 5LGTA 1TQMA 3VB2A 2F5CA 2P7VB 4PGHA 2K27A 1S3JA 1U78A 3WTTC 2DPDA 4Y13A 2XKOA 3WTYC 4U7BA 2STTA 2F5FA 4WXHA 3WE2A 3GLXA 1R5HA 2R7DA 3FXUA 3V8LA 3FWEA 2DO7A 1IUYA 4L9VA 4A6DA 3P9CA 5F6FA 1O57A 1IN8A 2CSOA 4LK0F 3JSPA 4HW0A 1D8JA 4Z2YA 2JZYA 3GUDA 2ZMEB 1RNLA 5ICGA 3W6JB 2JPCA 4BYYA 4IRIA 1D8KA 1BI0A 2MBFA 2DK5A 2RGVA 4KNYA 5K5OA 2IA2A 2EV5A 2W25A 5DEQA 2XIGA 1I5ZA 4B8XA 4AIJA 2BV6A 2C6YA 4WXDA 3V7SA 2FF4A 3RIRA 2QVOA 1CF7B 1O7FA 4A6EA 5HOOA 4CXFA 4GCVA 5ERIA 2HYFA 4UV8A 2XASA 3WE3A 4A5MA 1O3SA 4HAMA 2P6TA 1FLIA 3Q9SA 3IC7A 4EJTA 1HW1A 5L3DA 4ZYDA 4M9ZA 4U0YA 4EJUA 4B09A 3ERED 1R1UA 2H94A 2OBPA 4UUVA 2JSCA 2KIMA 3T8RA 3FMQA 4KIFA 4LLGF 1J2XA 5EEHA 4H0EA 2Z9OA 3C1DA 4WX9A 4EM0B 2IA0A 1R00A 5ICFA 2RKHA 4IXAA 5H20A 1K6OA 3J80Z 1B59A 2RN7A 1KQ8A 1RUNA 2W24A 5DYMA 3IKTA 2XGXA 3VEPA 1A04A 3QPHA 3M8FA 4WXCA 5LGUA 1ZN2A 3K1NA 1FC3A 3RTRA 4P9UA 3M8EA 3F8BA 1YQAA 1HKQA 1F5TA 2L4AA 4OOIA 2HDCA 2FMYA 2EV6A 1BI1A 1SD5A 2E1CA 4KDPA 3CUQA 5DCMA 3MCZA 3IKVA 2DFIA 1IXRC 3GVAA 1EH7A 4HLXA 1BIAA 2IA1A 1I6XA 5CLSA 1O3RA 1S7OA 1DPRA 1BBYA 1L0OC 5K1YA 5LRSA 4G9YA 4I2OA 1XSVA 2LNBA 4Q4ZF 1TQPA 3I71A 3N97A 2MLGA 4ENJA 3L2CA 2AXLA 2ETHA 2CYYA 2KIFA 2UWMA 2Q0OA 2OZUA 2GQQA 4HQMA 1I1GA 3EETA 1R5GA 4XLNF 4OIOF 2DU9A 3F22A 5ILVA 2XUBA 5DCFA 1O7LA 3HRTA 1TNTA 4Y17A 1T6SA 1P92A 2CG4A 4MNUA 1B1BA 1IXSB 1YG2A 2A07F 3CUQB 5DCMB 4BAYA 5E1WA 2LSOA 5L3FA 3HIFA 4BXUA 1BOAA 5D6FA 4A0ZA 4CDGA 3R4KA 4I0AA 3GFMA 4M6YA 3FX3A 5DDGA 2V1UA 3C3WA 4LMYA 1ZRDA 4D0PA 2HKXA 4LJZF 2WWYA 1HBXG 5DD8A 3WU1B 3OOPA 2K7LA 1L3LA 4ENKA 1IRGA 2BGCA 2MLKA 4YG2F 1IN7A 4R1HA 3KEQA 1FYKA 4XSXF 3O3KA 1S29A 1DP7P 5E8GA 2D1VA 1GXPA 5ILSA 3QPTA 2VOPA 2JRTA 1ONVA 2DBBA 4WCGA 3QP6A 4EJVA 3J7AO 2JT1A 1FOKA 2XRNA 3EDPA 3WGHA 1MD0A 1RI7A 1ZAOA 5HLGA 2BE5F 2DPUA 3I58A 3QU3A 3FMSA 3QP5A 5E1XA 1FT9A 3WTZA 5BMZA 1Z7UA 3Q5FA 2F2EA 2A5YB 1ULYA 3I59A 1CGPA 5HS9A 3LAPA 3HSFA 1PP8F 5E1ZB 3ZPLA 3WG9A 4M6XA 2FRHA 1OYIA 2O8XA 3KLNA 3LWFA 2QQBA 2H6CA 1XGNA 1LDJA 1U5TC 5CVUA 1TTYA 2EB7A 2MH2A 1YW9A 3FF5A 4YIFA 3J80K 1IN4A 5LHHA 4IVNA 4OMZA 4XLPF 3FXQA 4BQAA 3ELKA 1R1TA 2DAOA 5ICEA 1G4DA 2PBIA 3HHHA 1FNNA 3SQNA 3REOA 2A6EF 4JBAA 4AWXB 4OINF 4ASNA 1QBJA 4M9XA 3ZMSA 3W6KB 3PQJA 2B0LA 4U88A 2DTRA 3GW2A 3DKWA 2NS0A 4Q5SF 3LA7A 4KICA 4LB6B 4NHJA 4U7DA 2O0YA 4MTDA 1ON2A 4HDUA 2A68F 2W85A 2VBXA 2Q2EA 4S04A 3I59B 4DNCA 2FEZA 2E7XA 3BJ6A 3H3ZA 1OYWA 2W84A 2FNPA 3HYIA 5FD6A 3K9TA 1KU7A 5DV5A 2DI3A 1B9NA 1W7PD 3JTGA 2EFPA 2A69F 3KCCA 5DUIA 2EA2A 2OQRA 4P55A 4KIGA 3CDHA 1T98A 5CJ9A 5L3CA 4NB5A 2KIUA 3IWZA 4ZH4F 5LHGA 3DPLC 4KT5C 4LG0A 4MQVA 3QRFF 2L01A 3WODF 4A0YA 3BZ6A 1BN5A 2QM3A 3TO6A 3DEUA 2OAZA 4HF0A 1B4AA 3G73A 3K0LA 3TDUC 3V8KA 3TOAA 1K78A 3BY6A 3KP7A 2KRFA 4M73A 2Z33A 2F5EA 1SMTA 1O3QA 1SFXA 2NAZA 2LF7A 5JHUA 2QWWA 4U0WA 1TNSA 1HKTA 2JPBA 3F6VA 3HRSA 1PDNC 1TLHB 4R79A 3QAHA 2CGPA 2V79A 2V9VA 2VONA 1R7JA 4BNCA 2E7WA 4OIRF 3HSEA 1SMYF 3FMRA 4BHCA 5HLHA 5HDKA 1W5SA 2XAFA 1H0MA 3E5UA 1BC8C 2PEXA 2ZBKA 3N4MA 4LG0B 1R23A 1TQIA 3DPTA 2EA4A 1Z6TA 5BOXA 3P9IA 4UVBA 2HTSA 3GZ5A 3F23A 4LGWA 3FZVA 4G7HF 3BJOA 2FQ3A 4PCQA 1X3UA 3RKXA 3IRQA 2BYVE 3RJPA 2FBHA 4BH9A 2QYOA 5D5VB 1K78B 2PMUA 3V7CA 1KU2A 2V6CA 5HS7A 1G3SA 2ZNYA 3RPUA 4A0XA 4M9SA 1REPC 1ZYRF 1LEBA 2O3FA 2QZ8A 1LEAA 4ZZLA 3QU6A 3GF2A 4L5IA 2RVCA 3ULQB 2K86A 2YR2A 2GA2A 3CUQC 4YFKF 1UFMA 2ZKZA 2XVCA 3TOBA 3F8MA 1JHFA 1QGPA 5F64A 2WTEA 3KZYA 4HLYA 1OR7A 3OV8A 2HZTA 3ZQ7A 3LA2A 2XAQA 4HA8A 1W7PA 2X4HA 5HDNA 3KP6A 4M72A 3HOTA 2FE3A 3RPQA 4Q48A 3WTUC 2ZXJA 2V1XA 3SHFA 3WTSC 4L9JA 4KN4X 2ESNA 1JE8A 3R60A 5TRDA 1ZRFA 3P7NA 4MTEA 4UV9A 3PQKA 3T5XA 2EJRA 1MDMA 2HFHA 2H6BA 5D5XB 1KA8A 4CYDA 2ZO4A 3CO7C 3BOQA 1DUXC 4G6QA 2YX4A 4EM1A 1QZYA 4AD9A 2QQ9A 2RNJA 5LEKA 2BBYA 1DDNA 4S05A 3WTVC 2UXXA 4CICA 3VOEA 5F1RA 1WI9A 4YIIA 4I98B 1RZ4A 4KYWA 3K1PA 3JSOA 5FD5A 1TW3A 4KMUX 4AIKA 4HOBA 1LVAA 1EH6A 5FLXK 5JI6A 3JAMK 2HR3A 5ILUA 2NNYA 4QWQA 1XSDA 1XMAA 3JW4A 3EYYA 4WF2A 1IF1A 5DUKA 2GIVA 2L4MA 3U9GA 2QQAA 2K4BA 1FPQA 4IHSA 5CVRA 1BJAA 3DV8A 1W7PB 3ISPA 3R6SA 3IWFA 1O3TA 5D8LB 3CLOA 2AS5F 1XGSA 4PGGA 3ABUA 5E18F 3K69A 1MZBA 3H92A 2QBYA 1K79A 1MDMB 1T38A 1KYWA 3BWGA 1QZZA 1ON1A 5K5QA 4HBLA 4ZZDA 5LBQA 3RDIA 3I64A 3F8CA 1QPMA 5FB2A 4HV5A 2UZKA 4PDKA 2P5VA 4JK1X 1T2KA 3L7WA 1BIBA 3LA3A 1WWXA 1J5YA 1YO5C 2H27A 2M87A 4I02A 4UXNA 5J8CA 1FYMA 4R8HA 2XHKA 1J0RA 3KETA 4IRGA 4G7ZF 4IRHA 3ZMVA 5CYVA 3RI4A 2D1HA 1G3WA 1FBSA 4L9NA 1R1VA 1V4RA 1ODDA 3KP5A 2HYGD 2OD5A 1SAXA 3LFKA 3MFKA 1Z1DA 1HQCA 4HV6A 3HTSB 1XGMA 4EJOA 2M30A 3LQQA 2TDXA 3FHZA 3U1DA 1RUOA 1IXCA 1J59A 1OYYA 2M1BA 3KP2A 2NYXA 5AIPA 4FX0A 2QBYB 3BPVA 4AIHA 1F4KA 2ESHA 2PG4A 2HQRA 3RYPA 3ZN0A 3GWZA 2IPQX 1V3FA 1KQ9A 1TBXA 2F5DA 4LFUA 1U2WA 1ZARA 1I27A 2DW4A 1KU3A 1UCRA 1UB9A 1IN5A 1YS7A 2FA5A 3MQ0A 3GYHX 3WGGA 3MWMA 4YFXF 3BP8A 3QOPA 3I5UA 2DQRA 3T0YA 5IT9K 2HKOA 1UHMA 2PFBA 4L18B 1KU9A 4HDVA 2H09A 2IP2A 1YW8A 4OIQF 4ZYHA 1FYLA 4UNOA 2P7CB 1Z6RA 5FFXA 4UHTA 3LAJA 1UHWA 4RAZA 2OQGA 3E3VA 2P5LC 2CO5A 3I0TA 2RQPA 2YU3A 4LB5A 5BPDA 5KVRA 3R0JA 1ZLKA 1FSEA 5FGMA 2ISYA 3E5XA 1U6GA 2EK5A 3DFGA 2LDUA 2XKPA 2KKOA 2QUFA 2IT0A 1OKRA 1G3TA 1FP1D 1W5TA 1MGTA 2CW0F 3TGNA 1J75A 2NNNA 5CVVA 3R0AA 2Z99A 2VXZA 1B6AA 3BPXA 1FWZA 3Q9VA 5KK1A 4XSZF 2DT5A 1G6NA 3E6CC 1LQ1A 3SFZA 1S6LA 1XSXA 1J9IA 3HRUA 2QENA 5JVTA 4RS8A 4RGUA 2HWVA 1USSA 2EFQA 2MA3A 3HSRA 5D8KB 5FLXZ 4KFCA 3JAMZ 3NEUA 4EMSA 4RGRA 1NHAA 4O3MA 3FM5A 5LEJA 4OIPF 1C0WA 4GGGA 4MEXF 2HGCA 1XGOA 1FBQA 5A2QK 4G94A 2LF8A 4BHBA 3SXYA 1U5TA 2UXNA 3BROA 1XDSA 2P4WA 3CO6C 4HYEA 1XD7A 1EV7A 2RC4A 2PJPA 3VODA 4MGRA 4RGSA 1P2FA 2PI0A 1P6RA 3M9AA 4PZJA 1WQ2A 3ZP5A 4L9TA 2HS5A 4A12A 1S8NA 4FT8A 4L0YB 3BJAA 3E97A 5HVQC 2X0LA 4GXOA 3V4GA 3JTHA 4RB0A 3GZ6A 3I4PA 5LLQA 1U8RA 5TJJA 1WRJA 2ZFWA 4I01A 2HQNA 4N0BA 4RB1A 5L3BA 2XAGA 3GFJA 3F21A 3D5LA 3V8JA 2OZ6A 2GA1A 2CQKA 4KA4A 2CWEA 3HHGA 1YYVA 3BDDA 1Q1HA 4GYGA 1D5VA 2W57A 2IJLA 2IW5A 4N9HA 3WTXC 4LD5A 2STWA 1PP7U 1IW7F 4P9FA 1ZG3A 2FNAA 2PMHA 4EV0A 2R3SA 3FM3A 3COAC 3I53A 3L09A 1FZPB 4O6JA 4KN7X 4MQ9F 1LDKB 3IRRA 1U5TB 3LQRA 1W4MA 2HTJA 2ADUA 4IHTA 1WKMA 4G7OF 5D5UB 5CVJA 4HX7A 2G7HA 5K5RA 3M1EA 4YFNF 5BS6A 2FOKA 2A6HF 3GXOA 1SD4A 1XMKA 5LHIA 3C7JA 4KIBA 3DXJF 2NRAC 1SD7A 1ZGJA 2L02A 3V7RA 4M71A 1ZG5A 1ZGAA 2V1DA 1T39A 2D2WA 1KGSA 1BI2A 3RKWA 1IRFA 2J5OA 1RIOH 1VTNC 4L5JA 2YX7A 2ZNZA 5IT9Z 3VFZA 1J7KA 2Z3YA 2VBZA 3E6BA 2ZJ2A 3MEXA 1ZG1A 2Y75A 3SZPA 3F72A 2YSRA 2XAJA 1QNTA 3KEOA 3RKYA 4UVCA 3F6OA 5H6QA 3IL2A 1IZ1A 2ISZA 4ZYEA 1Y0UA 2EFOA 1IAWA 5FFZA 1FSHA 4EVIA 4FHTA 1PUEE 2PQ8A 1FX7A 3CUOA 5D5WB 3D0SA 4KMFA 1HXDA 2VC1A 3HOSA 4O5VA 1LB2A 1LDDA 3TQNA 2PN6A 5HDGA 3J81Z 2FU4A 4FX4A 1GXQA 3LSTA 1I1SA 1HW2A 1P4AA 5HS8A 3ZMZA 1F1ZA 4DQ2A 2P5KA 6PAXA 1FY7A 1YTYA 1STZA 4HX4A 4QLCU 3L00A 2G9WA 4UVAA 2WC2A 4ENMA 3K1MA 2EWNA 1MKMA 3MZHA 1HW5A 3IHUA 4I0BA 4RGXA 2L54A 2VE8A 2COMA 3DP7A 3NRVA 1E17A 3FXRA 4EGYA 1KQ0A 2DLLA 2P6SA 2DQLA 5IT3A 1ZRCA 2KJBA 2PLYA 2G7UA 3MZYA 2DK8A 3EYIA 5A2QZ 3E6MA 5D4SA 2R7FA 4JQFA 3GFLA 4ESFA 2ACJA 2GXBA 3ML6A 2FBIA 4ESJA 4MHGA 4E70A 2ZCWA 2QLZA 1YIOA 4LLLA 3RYRA 2KJCA 4ON0A 4K2EA 5AONA 1YLFA 3P9KA 2Q8KA 1FBUA 3ZMUA 3ECHA 3S2WA 3NQOA 1YW7A 5LRRA 2BEOA 4RB2C 3F3XA 1JHHA 2HEOA 3EQLF 1YFHA 1LNWA 2VBYA 3SZTA 4WWCA 4ETSA 5ED4A 4GYIA 4RB3C 3CJNA 1IN6A 4LLNA 4I09A 1SD6A 4TV7A 2L3DA 3ZMTA 5D6EA 1T0FA 4CGZA 2J5PA 2VODA 1R36A 5D4RA 5BQTA 4EGZA 3WGIA 5H6RA 4HF2A 1BI3A 3E5QA 3I54A 1XB4A 4P5OA 4HZFA 1EH8A 4F7ZA 2OA4A 3KP3A 3B73A 1OPCA 4I7HA 1S7AA 2VT3A 2OU2A 4GO1A 4ENNA 1ZHFA 4OU0A 2A3SA 1HSTA 2O6GE 1HSJA 3ECOA 4HQEA 2EFNA 2O61A 1AOYA 2XROA 2VT2A 1GVJA 2Y48A 1WSUA 1SFUA 3DQVC 2YPRA 4RAYA 3MAJA 1BM9A 2JTVA 4BHPA 5L3EA 5BPIA 3EUHA 1Z05A 2FXAA 1LJ9A 4KUMA 4CHUA 2FSWA 4OMYA 1ZREA 1BC7C 3DF8A 3H3UA 3K2ZA 3WU0A 3CTAA 2ELHA 1E2XA 4LK1F 4CZZA 2VC0A 4XRFA 2EFWA 3O2PE 4NQWA 4M74A 3T8TA 5CVIA 2FMLA 3F8FA 3HRMA 4Y15A 5JFRA 4A5NA 3HUGA 3TO7A 1GHCA 1B9MA 2GWRA 2VOOA 2P8TA 2FBKA 2GXGA 4ESBA 2EV0A 3M7GA 5L3GA 4ZYGA 3KFWX 4AVPA 3PFIA 2D45A 1MJAA 4XBFA 5LGNA 2CFXA 5ICCA 4A2UA 3J81K 3B02A 2Z5UA 1HKSA 4Q47A 2RDPA 1QQIA 1XCBA 2GZWA 2A61A 5JR3A 2GAUA 1H9TA 5E17F 1Z91A 2VN2A 1MJBA 5J8FA 2HOEA 4HX8A 3C18A 1P4WA 1JGSA 3U2RA 2M8EA 5E8IA 3ZMDA 3TDZC 3GEZA 5AIQA 2IVMA 5EEGA 5FO5A 2M5WA 2M45A 1U3EM 3TO9A 3KE2A 5J6XA 3KZZA 4IF4A 4HF1A 2XV4S 3KP4A 1DPUA 3ABTA 1D3YA 3KLOA 2VBWA 1XN7A 2O03A 4WK8F 3G3ZA 1P4XA 4G6DA 3E6DA 5HLIA 1R58A 2IRFG 1R22A 1TW2A 2K4JA 4EQQA 2XAHA 1K7AA 3GFIA 2E1NA 3O6BB 2VE9A 3TKYA 1KYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MJ9 A;  2LKP A;  1H9G A;  5DD4 A;  5E20 A;  1Z9C A;  4G8X A;  1F9N A;  3GO5 A;  3F8N A;  2ZME A;  3ZN1 A;  4IPA A;  1ZLJ A;  4P96 A;  1QO0 D;  3ROU A;  1YS6 A;  1FP2 A;  3AAF A;  2RV8 A;  2K02 A;  3HTU A;  4U0V A;  2Y0M A;  3WTW C;  1AWC A;  2WV0 A;  3T1B A;  3GX4 X;  1OMI A;  4EJW A;  4N9I A;  4CO8 A;  4IJA A;  1XDU A;  3L9F A;  2MC3 A;  1XCV A;  1JXS A;  4L0Z B;  1CF7 A;  2MD5 A;  1UST A;  1SFE A;  4EM2 A;  4MEY F;  1ZH5 A;  3R61 A;  1G3Y A;  2MH9 A;  5LGT A;  1TQM A;  3VB2 A;  2F5C A;  2P7V B;  4PGH A;  2K27 A;  1S3J A;  1U78 A;  3WTT C;  2DPD A;  4Y13 A;  2XKO A;  3WTY C;  4U7B A;  2STT A;  2F5F A;  4WXH A;  3WE2 A;  3GLX A;  1R5H A;  2R7D A;  3FXU A;  3V8L A;  3FWE A;  2DO7 A;  1IUY A;  4L9V A;  4A6D A;  3P9C A;  5F6F A;  1O57 A;  1IN8 A;  2CSO A;  4LK0 F;  3JSP A;  4HW0 A;  1D8J A;  4Z2Y A;  2JZY A;  3GUD A;  2ZME B;  1RNL A;  5ICG A;  3W6J B;  2JPC A;  4BYY A;  4IRI A;  1D8K A;  1BI0 A;  2MBF A;  2DK5 A;  2RGV A;  4KNY A;  5K5O A;  2IA2 A;  2EV5 A;  2W25 A;  5DEQ A;  2XIG A;  1I5Z A;  4B8X A;  4AIJ A;  2BV6 A;  2C6Y A;  4WXD A;  3V7S A;  2FF4 A;  3RIR A;  2QVO A;  1CF7 B;  1O7F A;  4A6E A;  5HOO A;  4CXF A;  4GCV A;  5ERI A;  2HYF A;  4UV8 A;  2XAS A;  3WE3 A;  4A5M A;  1O3S A;  4HAM A;  2P6T A;  1FLI A;  3Q9S A;  3IC7 A;  4EJT A;  1HW1 A;  5L3D A;  4ZYD A;  4M9Z A;  4U0Y A;  4EJU A;  4B09 A;  3ERE D;  1R1U A;  2H94 A;  2OBP A;  4UUV A;  2JSC A;  2KIM A;  3T8R A;  3FMQ A;  4KIF A;  4LLG F;  1J2X A;  5EEH A;  4H0E A;  2Z9O A;  3C1D A;  4WX9 A;  4EM0 B;  2IA0 A;  1R00 A;  5ICF A;  2RKH A;  4IXA A;  5H20 A;  1K6O A;  3J80 Z;  1B59 A;  2RN7 A;  1KQ8 A;  1RUN A;  2W24 A;  5DYM A;  3IKT A;  2XGX A;  3VEP A;  1A04 A;  3QPH A;  3M8F A;  4WXC A;  5LGU A;  1ZN2 A;  3K1N A;  1FC3 A;  3RTR A;  4P9U A;  3M8E A;  3F8B A;  1YQA A;  1HKQ A;  1F5T A;  2L4A A;  4OOI A;  2HDC A;  2FMY A;  2EV6 A;  1BI1 A;  1SD5 A;  2E1C A;  4KDP A;  3CUQ A;  5DCM A;  3MCZ A;  3IKV A;  2DFI A;  1IXR C;  3GVA A;  1EH7 A;  4HLX A;  1BIA A;  2IA1 A;  1I6X A;  5CLS A;  1O3R A;  1S7O A;  1DPR A;  1BBY A;  1L0O C;  5K1Y A;  5LRS A;  4G9Y A;  4I2O A;  1XSV A;  2LNB A;  4Q4Z F;  1TQP A;  3I71 A;  3N97 A;  2MLG A;  4ENJ A;  3L2C A;  2AXL A;  2ETH A;  2CYY A;  2KIF A;  2UWM A;  2Q0O A;  2OZU A;  2GQQ A;  4HQM A;  1I1G A;  3EET A;  1R5G A;  4XLN F;  4OIO F;  2DU9 A;  3F22 A;  5ILV A;  2XUB A;  5DCF A;  1O7L A;  3HRT A;  1TNT A;  4Y17 A;  1T6S A;  1P92 A;  2CG4 A;  4MNU A;  1B1B A;  1IXS B;  1YG2 A;  2A07 F;  3CUQ B;  5DCM B;  4BAY A;  5E1W A;  2LSO A;  5L3F A;  3HIF A;  4BXU A;  1BOA A;  5D6F A;  4A0Z A;  4CDG A;  3R4K A;  4I0A A;  3GFM A;  4M6Y A;  3FX3 A;  5DDG A;  2V1U A;  3C3W A;  4LMY A;  1ZRD A;  4D0P A;  2HKX A;  4LJZ F;  2WWY A;  1HBX G;  5DD8 A;  3WU1 B;  3OOP A;  2K7L A;  1L3L A;  4ENK A;  1IRG A;  2BGC A;  2MLK A;  4YG2 F;  1IN7 A;  4R1H A;  3KEQ A;  1FYK A;  4XSX F;  3O3K A;  1S29 A;  1DP7 P;  5E8G A;  2D1V A;  1GXP A;  5ILS A;  3QPT A;  2VOP A;  2JRT A;  1ONV A;  2DBB A;  4WCG A;  3QP6 A;  4EJV A;  3J7A O;  2JT1 A;  1FOK A;  2XRN A;  3EDP A;  3WGH A;  1MD0 A;  1RI7 A;  1ZAO A;  5HLG A;  2BE5 F;  2DPU A;  3I58 A;  3QU3 A;  3FMS A;  3QP5 A;  5E1X A;  1FT9 A;  3WTZ A;  5BMZ A;  1Z7U A;  3Q5F A;  2F2E A;  2A5Y B;  1ULY A;  3I59 A;  1CGP A;  5HS9 A;  3LAP A;  3HSF A;  1PP8 F;  5E1Z B;  3ZPL A;  3WG9 A;  4M6X A;  2FRH A;  1OYI A;  2O8X A;  3KLN A;  3LWF A;  2QQB A;  2H6C A;  1XGN A;  1LDJ A;  1U5T C;  5CVU A;  1TTY A;  2EB7 A;  2MH2 A;  1YW9 A;  3FF5 A;  4YIF A;  3J80 K;  1IN4 A;  5LHH A;  4IVN A;  4OMZ A;  4XLP F;  3FXQ A;  4BQA A;  3ELK A;  1R1T A;  2DAO A;  5ICE A;  1G4D A;  2PBI A;  3HHH A;  1FNN A;  3SQN A;  3REO A;  2A6E F;  4JBA A;  4AWX B;  4OIN F;  4ASN A;  1QBJ A;  4M9X A;  3ZMS A;  3W6K B;  3PQJ A;  2B0L A;  4U88 A;  2DTR A;  3GW2 A;  3DKW A;  2NS0 A;  4Q5S F;  3LA7 A;  4KIC A;  4LB6 B;  4NHJ A;  4U7D A;  2O0Y A;  4MTD A;  1ON2 A;  4HDU A;  2A68 F;  2W85 A;  2VBX A;  2Q2E A;  4S04 A;  3I59 B;  4DNC A;  2FEZ A;  2E7X A;  3BJ6 A;  3H3Z A;  1OYW A;  2W84 A;  2FNP A;  3HYI A;  5FD6 A;  3K9T A;  1KU7 A;  5DV5 A;  2DI3 A;  1B9N A;  1W7P D;  3JTG A;  2EFP A;  2A69 F;  3KCC A;  5DUI A;  2EA2 A;  2OQR A;  4P55 A;  4KIG A;  3CDH A;  1T98 A;  5CJ9 A;  5L3C A;  4NB5 A;  2KIU A;  3IWZ A;  4ZH4 F;  5LHG A;  3DPL C;  4KT5 C;  4LG0 A;  4MQV A;  3QRF F;  2L01 A;  3WOD F;  4A0Y A;  3BZ6 A;  1BN5 A;  2QM3 A;  3TO6 A;  3DEU A;  2OAZ A;  4HF0 A;  1B4A A;  3G73 A;  3K0L A;  3TDU C;  3V8K A;  3TOA A;  1K78 A;  3BY6 A;  3KP7 A;  2KRF A;  4M73 A;  2Z33 A;  2F5E A;  1SMT A;  1O3Q A;  1SFX A;  2NAZ A;  2LF7 A;  5JHU A;  2QWW A;  4U0W A;  1TNS A;  1HKT A;  2JPB A;  3F6V A;  3HRS A;  1PDN C;  1TLH B;  4R79 A;  3QAH A;  2CGP A;  2V79 A;  2V9V A;  2VON A;  1R7J A;  4BNC A;  2E7W A;  4OIR F;  3HSE A;  1SMY F;  3FMR A;  4BHC A;  5HLH A;  5HDK A;  1W5S A;  2XAF A;  1H0M A;  3E5U A;  1BC8 C;  2PEX A;  2ZBK A;  3N4M A;  4LG0 B;  1R23 A;  1TQI A;  3DPT A;  2EA4 A;  1Z6T A;  5BOX A;  3P9I A;  4UVB A;  2HTS A;  3GZ5 A;  3F23 A;  4LGW A;  3FZV A;  4G7H F;  3BJO A;  2FQ3 A;  4PCQ A;  1X3U A;  3RKX A;  3IRQ A;  2BYV E;  3RJP A;  2FBH A;  4BH9 A;  2QYO A;  5D5V B;  1K78 B;  2PMU A;  3V7C A;  1KU2 A;  2V6C A;  5HS7 A;  1G3S A;  2ZNY A;  3RPU A;  4A0X A;  4M9S A;  1REP C;  1ZYR F;  1LEB A;  2O3F A;  2QZ8 A;  1LEA A;  4ZZL A;  3QU6 A;  3GF2 A;  4L5I A;  2RVC A;  3ULQ B;  2K86 A;  2YR2 A;  2GA2 A;  3CUQ C;  4YFK F;  1UFM A;  2ZKZ A;  2XVC A;  3TOB A;  3F8M A;  1JHF A;  1QGP A;  5F64 A;  2WTE A;  3KZY A;  4HLY A;  1OR7 A;  3OV8 A;  2HZT A;  3ZQ7 A;  3LA2 A;  2XAQ A;  4HA8 A;  1W7P A;  2X4H A;  5HDN A;  3KP6 A;  4M72 A;  3HOT A;  2FE3 A;  3RPQ A;  4Q48 A;  3WTU C;  2ZXJ A;  2V1X A;  3SHF A;  3WTS C;  4L9J A;  4KN4 X;  2ESN A;  1JE8 A;  3R60 A;  5TRD A;  1ZRF A;  3P7N A;  4MTE A;  4UV9 A;  3PQK A;  3T5X A;  2EJR A;  1MDM A;  2HFH A;  2H6B A;  5D5X B;  1KA8 A;  4CYD A;  2ZO4 A;  3CO7 C;  3BOQ A;  1DUX C;  4G6Q A;  2YX4 A;  4EM1 A;  1QZY A;  4AD9 A;  2QQ9 A;  2RNJ A;  5LEK A;  2BBY A;  1DDN A;  4S05 A;  3WTV C;  2UXX A;  4CIC A;  3VOE A;  5F1R A;  1WI9 A;  4YII A;  4I98 B;  1RZ4 A;  4KYW A;  3K1P A;  3JSO A;  5FD5 A;  1TW3 A;  4KMU X;  4AIK A;  4HOB A;  1LVA A;  1EH6 A;  5FLX K;  5JI6 A;  3JAM K;  2HR3 A;  5ILU A;  2NNY A;  4QWQ A;  1XSD A;  1XMA A;  3JW4 A;  3EYY A;  4WF2 A;  1IF1 A;  5DUK A;  2GIV A;  2L4M A;  3U9G A;  2QQA A;  2K4B A;  1FPQ A;  4IHS A;  5CVR A;  1BJA A;  3DV8 A;  1W7P B;  3ISP A;  3R6S A;  3IWF A;  1O3T A;  5D8L B;  3CLO A;  2AS5 F;  1XGS A;  4PGG A;  3ABU A;  5E18 F;  3K69 A;  1MZB A;  3H92 A;  2QBY A;  1K79 A;  1MDM B;  1T38 A;  1KYW A;  3BWG A;  1QZZ A;  1ON1 A;  5K5Q A;  4HBL A;  4ZZD A;  5LBQ A;  3RDI A;  3I64 A;  3F8C A;  1QPM A;  5FB2 A;  4HV5 A;  2UZK A;  4PDK A;  2P5V A;  4JK1 X;  1T2K A;  3L7W A;  1BIB A;  3LA3 A;  1WWX A;  1J5Y A;  1YO5 C;  2H27 A;  2M87 A;  4I02 A;  4UXN A;  5J8C A;  1FYM A;  4R8H A;  2XHK A;  1J0R A;  3KET A;  4IRG A;  4G7Z F;  4IRH A;  3ZMV A;  5CYV A;  3RI4 A;  2D1H A;  1G3W A;  1FBS A;  4L9N A;  1R1V A;  1V4R A;  1ODD A;  3KP5 A;  2HYG D;  2OD5 A;  1SAX A;  3LFK A;  3MFK A;  1Z1D A;  1HQC A;  4HV6 A;  3HTS B;  1XGM A;  4EJO A;  2M30 A;  3LQQ A;  2TDX A;  3FHZ A;  3U1D A;  1RUO A;  1IXC A;  1J59 A;  1OYY A;  2M1B A;  3KP2 A;  2NYX A;  5AIP A;  4FX0 A;  2QBY B;  3BPV A;  4AIH A;  1F4K A;  2ESH A;  2PG4 A;  2HQR A;  3RYP A;  3ZN0 A;  3GWZ A;  2IPQ X;  1V3F A;  1KQ9 A;  1TBX A;  2F5D A;  4LFU A;  1U2W A;  1ZAR A;  1I27 A;  2DW4 A;  1KU3 A;  1UCR A;  1UB9 A;  1IN5 A;  1YS7 A;  2FA5 A;  3MQ0 A;  3GYH X;  3WGG A;  3MWM A;  4YFX F;  3BP8 A;  3QOP A;  3I5U A;  2DQR A;  3T0Y A;  5IT9 K;  2HKO A;  1UHM A;  2PFB A;  4L18 B;  1KU9 A;  4HDV A;  2H09 A;  2IP2 A;  1YW8 A;  4OIQ F;  4ZYH A;  1FYL A;  4UNO A;  2P7C B;  1Z6R A;  5FFX A;  4UHT A;  3LAJ A;  1UHW A;  4RAZ A;  2OQG A;  3E3V A;  2P5L C;  2CO5 A;  3I0T A;  2RQP A;  2YU3 A;  4LB5 A;  5BPD A;  5KVR A;  3R0J A;  1ZLK A;  1FSE A;  5FGM A;  2ISY A;  3E5X A;  1U6G A;  2EK5 A;  3DFG A;  2LDU A;  2XKP A;  2KKO A;  2QUF A;  2IT0 A;  1OKR A;  1G3T A;  1FP1 D;  1W5T A;  1MGT A;  2CW0 F;  3TGN A;  1J75 A;  2NNN A;  5CVV A;  3R0A A;  2Z99 A;  2VXZ A;  1B6A A;  3BPX A;  1FWZ A;  3Q9V A;  5KK1 A;  4XSZ F;  2DT5 A;  1G6N A;  3E6C C;  1LQ1 A;  3SFZ A;  1S6L A;  1XSX A;  1J9I A;  3HRU A;  2QEN A;  5JVT A;  4RS8 A;  4RGU A;  2HWV A;  1USS A;  2EFQ A;  2MA3 A;  3HSR A;  5D8K B;  5FLX Z;  4KFC A;  3JAM Z;  3NEU A;  4EMS A;  4RGR A;  1NHA A;  4O3M A;  3FM5 A;  5LEJ A;  4OIP F;  1C0W A;  4GGG A;  4MEX F;  2HGC A;  1XGO A;  1FBQ A;  5A2Q K;  4G94 A;  2LF8 A;  4BHB A;  3SXY A;  1U5T A;  2UXN A;  3BRO A;  1XDS A;  2P4W A;  3CO6 C;  4HYE A;  1XD7 A;  1EV7 A;  2RC4 A;  2PJP A;  3VOD A;  4MGR A;  4RGS A;  1P2F A;  2PI0 A;  1P6R A;  3M9A A;  4PZJ A;  1WQ2 A;  3ZP5 A;  4L9T A;  2HS5 A;  4A12 A;  1S8N A;  4FT8 A;  4L0Y B;  3BJA A;  3E97 A;  5HVQ C;  2X0L A;  4GXO A;  3V4G A;  3JTH A;  4RB0 A;  3GZ6 A;  3I4P A;  5LLQ A;  1U8R A;  5TJJ A;  1WRJ A;  2ZFW A;  4I01 A;  2HQN A;  4N0B A;  4RB1 A;  5L3B A;  2XAG A;  3GFJ A;  3F21 A;  3D5L A;  3V8J A;  2OZ6 A;  2GA1 A;  2CQK A;  4KA4 A;  2CWE A;  3HHG A;  1YYV A;  3BDD A;  1Q1H A;  4GYG A;  1D5V A;  2W57 A;  2IJL A;  2IW5 A;  4N9H A;  3WTX C;  4LD5 A;  2STW A;  1PP7 U;  1IW7 F;  4P9F A;  1ZG3 A;  2FNA A;  2PMH A;  4EV0 A;  2R3S A;  3FM3 A;  3COA C;  3I53 A;  3L09 A;  1FZP B;  4O6J A;  4KN7 X;  4MQ9 F;  1LDK B;  3IRR A;  1U5T B;  3LQR A;  1W4M A;  2HTJ A;  2ADU A;  4IHT A;  1WKM A;  4G7O F;  5D5U B;  5CVJ A;  4HX7 A;  2G7H A;  5K5R A;  3M1E A;  4YFN F;  5BS6 A;  2FOK A;  2A6H F;  3GXO A;  1SD4 A;  1XMK A;  5LHI A;  3C7J A;  4KIB A;  3DXJ F;  2NRA C;  1SD7 A;  1ZGJ A;  2L02 A;  3V7R A;  4M71 A;  1ZG5 A;  1ZGA A;  2V1D A;  1T39 A;  2D2W A;  1KGS A;  1BI2 A;  3RKW A;  1IRF A;  2J5O A;  1RIO H;  1VTN C;  4L5J A;  2YX7 A;  2ZNZ A;  5IT9 Z;  3VFZ A;  1J7K A;  2Z3Y A;  2VBZ A;  3E6B A;  2ZJ2 A;  3MEX A;  1ZG1 A;  2Y75 A;  3SZP A;  3F72 A;  2YSR A;  2XAJ A;  1QNT A;  3KEO A;  3RKY A;  4UVC A;  3F6O A;  5H6Q A;  3IL2 A;  1IZ1 A;  2ISZ A;  4ZYE A;  1Y0U A;  2EFO A;  1IAW A;  5FFZ A;  1FSH A;  4EVI A;  4FHT A;  1PUE E;  2PQ8 A;  1FX7 A;  3CUO A;  5D5W B;  3D0S A;  4KMF A;  1HXD A;  2VC1 A;  3HOS A;  4O5V A;  1LB2 A;  1LDD A;  3TQN A;  2PN6 A;  5HDG A;  3J81 Z;  2FU4 A;  4FX4 A;  1GXQ A;  3LST A;  1I1S A;  1HW2 A;  1P4A A;  5HS8 A;  3ZMZ A;  1F1Z A;  4DQ2 A;  2P5K A;  6PAX A;  1FY7 A;  1YTY A;  1STZ A;  4HX4 A;  4QLC U;  3L00 A;  2G9W A;  4UVA A;  2WC2 A;  4ENM A;  3K1M A;  2EWN A;  1MKM A;  3MZH A;  1HW5 A;  3IHU A;  4I0B A;  4RGX A;  2L54 A;  2VE8 A;  2COM A;  3DP7 A;  3NRV A;  1E17 A;  3FXR A;  4EGY A;  1KQ0 A;  2DLL A;  2P6S A;  2DQL A;  5IT3 A;  1ZRC A;  2KJB A;  2PLY A;  2G7U A;  3MZY A;  2DK8 A;  3EYI A;  5A2Q Z;  3E6M A;  5D4S A;  2R7F A;  4JQF A;  3GFL A;  4ESF A;  2ACJ A;  2GXB A;  3ML6 A;  2FBI A;  4ESJ A;  4MHG A;  4E70 A;  2ZCW A;  2QLZ A;  1YIO A;  4LLL A;  3RYR A;  2KJC A;  4ON0 A;  4K2E A;  5AON A;  1YLF A;  3P9K A;  2Q8K A;  1FBU A;  3ZMU A;  3ECH A;  3S2W A;  3NQO A;  1YW7 A;  5LRR A;  2BEO A;  4RB2 C;  3F3X A;  1JHH A;  2HEO A;  3EQL F;  1YFH A;  1LNW A;  2VBY A;  3SZT A;  4WWC A;  4ETS A;  5ED4 A;  4GYI A;  4RB3 C;  3CJN A;  1IN6 A;  4LLN A;  4I09 A;  1SD6 A;  4TV7 A;  2L3D A;  3ZMT A;  5D6E A;  1T0F A;  4CGZ A;  2J5P A;  2VOD A;  1R36 A;  5D4R A;  5BQT A;  4EGZ A;  3WGI A;  5H6R A;  4HF2 A;  1BI3 A;  3E5Q A;  3I54 A;  1XB4 A;  4P5O A;  4HZF A;  1EH8 A;  4F7Z A;  2OA4 A;  3KP3 A;  3B73 A;  1OPC A;  4I7H A;  1S7A A;  2VT3 A;  2OU2 A;  4GO1 A;  4ENN A;  1ZHF A;  4OU0 A;  2A3S A;  1HST A;  2O6G E;  1HSJ A;  3ECO A;  4HQE A;  2EFN A;  2O61 A;  1AOY A;  2XRO A;  2VT2 A;  1GVJ A;  2Y48 A;  1WSU A;  1SFU A;  3DQV C;  2YPR A;  4RAY A;  3MAJ A;  1BM9 A;  2JTV A;  4BHP A;  5L3E A;  5BPI A;  3EUH A;  1Z05 A;  2FXA A;  1LJ9 A;  4KUM A;  4CHU A;  2FSW A;  4OMY A;  1ZRE A;  1BC7 C;  3DF8 A;  3H3U A;  3K2Z A;  3WU0 A;  3CTA A;  2ELH A;  1E2X A;  4LK1 F;  4CZZ A;  2VC0 A;  4XRF A;  2EFW A;  3O2P E;  4NQW A;  4M74 A;  3T8T A;  5CVI A;  2FML A;  3F8F A;  3HRM A;  4Y15 A;  5JFR A;  4A5N A;  3HUG A;  3TO7 A;  1GHC A;  1B9M A;  2GWR A;  2VOO A;  2P8T A;  2FBK A;  2GXG A;  4ESB A;  2EV0 A;  3M7G A;  5L3G A;  4ZYG A;  3KFW X;  4AVP A;  3PFI A;  2D45 A;  1MJA A;  4XBF A;  5LGN A;  2CFX A;  5ICC A;  4A2U A;  3J81 K;  3B02 A;  2Z5U A;  1HKS A;  4Q47 A;  2RDP A;  1QQI A;  1XCB A;  2GZW A;  2A61 A;  5JR3 A;  2GAU A;  1H9T A;  5E17 F;  1Z91 A;  2VN2 A;  1MJB A;  5J8F A;  2HOE A;  4HX8 A;  3C18 A;  1P4W A;  1JGS A;  3U2R A;  2M8E A;  5E8I A;  3ZMD A;  3TDZ C;  3GEZ A;  5AIQ A;  2IVM A;  5EEG A;  5FO5 A;  2M5W A;  2M45 A;  1U3E M;  3TO9 A;  3KE2 A;  5J6X A;  3KZZ A;  4IF4 A;  4HF1 A;  2XV4 S;  3KP4 A;  1DPU A;  3ABT A;  1D3Y A;  3KLO A;  2VBW A;  1XN7 A;  2O03 A;  4WK8 F;  3G3Z A;  1P4X A;  4G6D A;  3E6D A;  5HLI A;  1R58 A;  2IRF G;  1R22 A;  1TW2 A;  2K4J A;  4EQQ A;  2XAH A;  1K7A A;  3GFI A;  2E1N A;  3O6B B;  2VE9 A;  3TKY A;  1KYZ A; 
#chains in the Genus database with same CATH topology
 1MJ9 A;  1ZEL A;  2LKP A;  3BR3 A;  1H9G A;  5DD4 A;  5E20 A;  4XOR A;  1Z9C A;  3BG3 A;  4G8X A;  1F9N A;  5HNH A;  2M4G A;  3GO5 A;  2LOO A;  2Q1Z B;  3F8N A;  1DQU A;  2ZME A;  3ZN1 A;  2NVY J;  4IPA A;  4A3F J;  1ZLJ A;  3HB9 A;  4P96 A;  1QO0 D;  2CUZ A;  1YS6 A;  3ROU A;  4RDU A;  1FP2 A;  3AAF A;  5EDN A;  1JJ8 C;  2HVR A;  2ZJP F;  2RV8 A;  2K02 A;  2TCT A;  2RAE A;  3HTU A;  4J00 A;  2CRG A;  3BR1 A;  4U0V A;  3WHB A;  1X2N A;  2Y0M A;  3WTW C;  4FCY A;  1AWC A;  4JP0 A;  2E19 A;  2WV0 A;  5C44 J;  3T1B A;  3GX4 X;  3ZOB A;  1OMI A;  1IUF A;  3H9G A;  4EJW A;  3HG9 A;  3KYD B;  1LKX A;  4N9I A;  3L2Q A;  4IHV A;  4CO8 A;  4IJA A;  1XDU A;  3L9F A;  1KZH A;  2MC3 A;  2DT6 A;  1XCV A;  1JXS A;  3WU2 C;  1LVK A;  4L0Z B;  4RLQ A;  5JLW A;  1CF7 A;  2MD5 A;  1JT6 A;  1Y0N A;  1UST A;  3CJQ B;  2ZSI B;  3KEY A;  1JUP A;  1SFE A;  4EM2 A;  4MEY F;  1ZH5 A;  2R0Q C;  3C2H A;  3R61 A;  1G3Y A;  2L7K A;  2MH9 A;  4KT6 A;  4JX6 A;  2Q2E B;  5LGT A;  5EF6 A;  3EUK L;  1TQM A;  3VB2 A;  1BOB A;  1AA7 A;  2F5C A;  2P7V B;  4PGH A;  2K27 A;  1S3J A;  1U78 A;  4X1E A;  1EKE A;  5HNF A;  3HGY A;  3OYD A;  2BY3 A;  3WTT C;  2LY9 A;  2DPD A;  4Y13 A;  2XKO A;  2CV0 A;  4BQO A;  3WTY C;  2WAD A;  3K4B A;  4Y7N J;  4U7B A;  4XQF A;  1GV2 A;  3DEE A;  4NC8 A;  2STT A;  1OCZ H;  2F5F A;  5K7F A;  3OYJ A;  4WXH A;  3WE2 A;  2WAF A;  1R5H A;  3GLX A;  2R7D A;  4CUG A;  1Z0X A;  3FXU A;  3V8L A;  5IY5 H;  3FWE A;  2DO7 A;  1IUY A;  4L9V A;  4A6D A;  4IOA F;  3A0B C;  3P9C A;  3OSF A;  5F6F A;  1O57 A;  1IN8 A;  1N75 A;  1WI3 A;  2CSO A;  1OR7 C;  4LK0 F;  4C2M J;  3JSP A;  2NVQ J;  4HW0 A;  1D8J A;  1VQ5 I;  4Z2Y A;  2QKM B;  3MN2 A;  2JZY A;  3GUD A;  4RM3 A;  2ZME B;  1RNL A;  5ICG A;  1POG A;  3W6J B;  2JPC A;  3KYL A;  2NOJ B;  3BG9 A;  3TMO A;  4BYY A;  1FOW A;  5E3N A;  4IRI A;  4B48 A;  1D8K A;  1BI0 A;  2MBF A;  2DK5 A;  2RGV A;  3OS2 A;  2ZXH A;  4KNY A;  1A6Q A;  1VND A;  2IGK A;  2IA2 A;  5K5O A;  2OPT A;  4B4C A;  5M3M J;  5EZH A;  2EV5 A;  3K70 D;  1TP4 A;  2W25 A;  1P9Q C;  5DEQ A;  2XIG A;  2BHY A;  2M7B A;  2KZG A;  2CQN A;  2DJI A;  1I5Z A;  4B8X A;  3CCV I;  4AIJ A;  2R4G A;  1ETO A;  3FBN B;  3A01 A;  3M07 A;  2BV6 A;  2HOA A;  2C6Y A;  1JJ6 C;  4WXD A;  3BC8 A;  4XM3 A;  4BY1 J;  4IEJ A;  3V7S A;  2FF4 A;  3RIR A;  2QVO A;  4BS9 A;  1CF7 B;  1O7F A;  4A6E A;  5HOO A;  3LSH A;  3CCM I;  4LIT A;  3DU5 A;  4CXF A;  4GCV A;  2OCE A;  2FUG 2;  5ERI A;  1A31 A;  2HYF A;  4UV8 A;  2XAS A;  2H1L A;  3WE3 A;  4A5M A;  1O3S A;  4HAM A;  3OSG A;  2P6T A;  4RMN A;  2NVX J;  1FLI A;  3Q9S A;  3IC7 A;  1S7E A;  1RR7 A;  4EJT A;  1HW1 A;  5L3D A;  1LE8 A;  4ZYD A;  1UHS A;  3DU6 A;  4M9Z A;  3ESW B;  1BR1 A;  1B8I A;  2VKD A;  4U0Y A;  2XSJ C;  4EJU A;  4B09 A;  2VQG A;  1FMV A;  5BNG A;  3ERE D;  1R1U A;  2H94 A;  4NC6 A;  2OBP A;  4ZDO A;  4UUV A;  2JSC A;  2KIM A;  5IYC J;  3T8R A;  3FMQ A;  4KIF A;  4AYB N;  4LLG F;  1J2X A;  5EEH A;  5FLV A;  1S5L C;  4H0E A;  1WJC A;  2K9M A;  2M3A A;  2Z9O A;  2G0E A;  3C1D A;  3PO3 J;  4WX9 A;  2X6Y A;  2X1C A;  4EM0 B;  2IA0 A;  1MBK A;  1R00 A;  1JKP C;  3G4S I;  5ICF A;  2RKH A;  2WY8 Q;  4IXA A;  5H20 A;  2LR8 A;  1K6O A;  3J80 Z;  1VQ6 I;  1B59 A;  2IAI A;  2RN7 A;  1KQ8 A;  1YX5 A;  2W24 A;  5DYM A;  1RUN A;  3IKT A;  2XGX A;  1VFC A;  4XNF A;  2VJJ A;  5DM7 F;  4BE0 A;  3FHN A;  3VEP A;  1A04 A;  3IH4 A;  4X6A J;  3SZG A;  2QCO A;  1HCR A;  3QPH A;  3M8F A;  3ASN H;  4WXC A;  4AUX A;  2NVU B;  2EZI A;  3A01 B;  1WJE A;  5LGU A;  1ZN2 A;  3K1N A;  1TL8 A;  3PNY A;  1FC3 A;  3RTR A;  4XKB A;  3BR2 A;  2X51 A;  4P9U A;  3SDG A;  2F5V A;  1ERD A;  3M8E A;  3F8B A;  1YQA A;  1HKQ A;  1F5T A;  2L4A A;  2L9R A;  2I8D A;  4OOI A;  2HDC A;  2FMY A;  4HST A;  1RES A;  4PSX A;  4ZTF A;  2EV6 A;  2X1E A;  1OCP A;  1BI1 A;  4A69 C;  1QU3 A;  1SD5 A;  5F0F A;  3MKY B;  2CS3 A;  2E1C A;  4KDP A;  1Y1W J;  3CUQ A;  5DCM A;  3HPH A;  1JT0 A;  2ZC2 A;  1LE8 B;  1Z77 A;  3MCZ A;  3IKV A;  2KL4 A;  2VKH A;  3QOE A;  3J7Y J;  1B8I B;  5EJC A;  2DFI A;  3PNT A;  1IXR C;  3GVA A;  1EH7 A;  3K4L A;  3K4M A;  4HLX A;  4ABZ A;  3LSR A;  1D1C A;  1T0F C;  1BIA A;  2IA1 A;  1I6X A;  5CLS A;  1O3R A;  3HDD A;  1S7O A;  2OCC H;  1DPR A;  1BBY A;  2DMP A;  3PO2 J;  1L0O C;  4ZDP A;  5CQG A;  2VQC A;  5K1Y A;  5LRS A;  4KIT B;  4G9Y A;  4I2O A;  3SFI A;  1XSV A;  2LNB A;  3S1M J;  4E7Z A;  2EZH A;  2LMD A;  4Q4Z F;  1TQP A;  3I71 A;  3N97 A;  2Y69 H;  2MLG A;  1LPQ A;  4BJ6 C;  1DP3 A;  4ENJ A;  2FQ4 A;  3K6G A;  3L2C A;  2AXL A;  4U87 A;  2H1K A;  2KRH A;  4A3B J;  2ETH A;  4XL9 A;  2F4O B;  3OYG A;  2CYY A;  2PX9 A;  1I39 A;  2M4K A;  3E1S A;  2KIF A;  2UWM A;  3W2A A;  1BL0 A;  2Q0O A;  2OZU A;  2GQQ A;  2JA7 J;  4HQM A;  1I1G A;  3EET A;  1R5G A;  3OOU A;  1OCR H;  2Y0S A;  2LYC A;  4XLN F;  2DU9 A;  4OIO F;  3L2V A;  3F22 A;  5ILV A;  2XUB A;  5DCF A;  3LSG A;  1O7L A;  3HRT A;  1TNT A;  4Y17 A;  3CCR I;  3EUH C;  3ZCO A;  1T6S A;  1P92 A;  1NH3 A;  5GPC A;  1T95 A;  2CG4 A;  5GAE J;  2X6X A;  1WCM J;  1HC8 A;  4MNU A;  1B1B A;  1IXS B;  1YG2 A;  3CQZ J;  3K2A A;  2A07 F;  2XPV A;  4ZDL A;  3OYA A;  1YJW I;  4UY8 I;  3CUQ B;  5DCM B;  4BAY A;  5E1W A;  2YS9 A;  4BU2 A;  2GXA A;  2LSO A;  1QA6 A;  1SEU A;  1VQ7 I;  3UR3 C;  2O7O A;  4XRS A;  5L3F A;  2R7U A;  3HIF A;  3HM5 A;  4BXU A;  1WVR A;  1BOA A;  2XGE A;  3OR1 C;  3NAR A;  1APL C;  2E35 A;  5D6F A;  4V2F A;  4A0Z A;  1YOV B;  1SAU A;  4CDG A;  3R4K A;  4I0A A;  4AU7 A;  3GFM A;  1MH3 A;  4M6Y A;  3FX3 A;  3BR6 A;  5DDG A;  2V1U A;  5IP6 A;  1K6Y A;  3C3W A;  4UB6 C;  2LH9 A;  4LMY A;  3OS0 A;  2LG4 A;  1ZRD A;  4D0P A;  2HKX A;  4CCL A;  2D5V A;  2DYS H;  4LJZ F;  1IJW C;  3SDB A;  3DLL F;  1T8I A;  5J4V A;  2WWY A;  2XF7 A;  5DD8 A;  3WU1 B;  1HBX G;  3MD2 A;  2FX0 A;  2BHZ A;  3OOP A;  2K7L A;  1L3L A;  4ENK A;  3G2B A;  2DMN A;  1IRG A;  2BGC A;  1HDP A;  5CPR B;  3OYL A;  2ZFU A;  2Y0S N;  3RZO J;  1RC9 A;  2MLK A;  3S14 J;  4YG2 F;  1JKQ C;  1IN7 A;  4R1H A;  2DTZ A;  5IP9 J;  2WY7 Q;  4YIR X;  3KEQ A;  3L1P A;  1FYK A;  4XSX F;  3O3K A;  2IGM A;  3QYE A;  4BGD A;  1S29 A;  1DP7 P;  1H88 C;  5E8G A;  2D1V A;  3TW6 A;  2K9N A;  1GXP A;  3MVP A;  1UMQ A;  3IV5 A;  1BW6 A;  3TP3 A;  5ILS A;  5DS9 A;  3QPT A;  2VQL A;  2HQ5 A;  1W36 D;  2MC4 A;  2VOP A;  2E5N A;  4D5F A;  1HOM A;  1DGR M;  2JRT A;  1ONV A;  1I3A A;  4HPQ A;  3LNQ A;  2DBB A;  4WCG A;  2COB A;  3QP6 A;  2DFF A;  4EJV A;  1UAA A;  4CZC A;  3O8H A;  4IHY A;  3J7A O;  2IS4 A;  3A02 A;  1I3Q J;  2JT1 A;  4H4K C;  2HVS A;  1FOK A;  5CQE A;  1EF4 A;  2XRN A;  3EDP A;  4EEF G;  4NDL A;  1BJZ A;  3H35 A;  3WGH A;  5J4Y A;  1A5J A;  1MD0 A;  4IO9 F;  3S93 A;  2YU9 J;  3TBI A;  1MSE C;  1RRJ A;  1XC5 A;  1X4O A;  2OF7 A;  2M34 A;  1RI7 A;  1ZAO A;  5HLG A;  1JTY A;  2BE5 F;  3I58 A;  1OFC X;  3PSI A;  3FMS A;  3QU3 A;  1N77 A;  4CH7 A;  2DPU A;  4HRI A;  3CJT B;  3OYH A;  3QP5 A;  5E1X A;  1FT9 A;  3WTZ A;  4PJJ A;  5BMZ A;  1Z7U A;  2XB0 X;  3OMY A;  2F2E A;  3L2R A;  3Q5F A;  2A5Y B;  1ULY A;  2BW3 A;  2VKV A;  3I59 A;  1BR4 A;  1X1A A;  5GTH C;  3JR9 A;  1CGP A;  5HS9 A;  3H3V K;  3LAP A;  3HSF A;  1PP8 F;  5E1Z B;  3ZPL A;  3WG9 A;  2HZD A;  1QHH D;  4M6X A;  4M3D A;  1VQ9 I;  1MNE A;  2FRH A;  3OYF A;  1OYI A;  4DIQ A;  2JQ7 A;  5KAF C;  2GOX B;  2O8X A;  5HOD A;  3CC7 I;  4A93 J;  3KLN A;  4C30 A;  5B1A H;  2XRL A;  3ZR8 X;  3LWF A;  1ZR2 A;  2IGO A;  2QQB A;  3RZD J;  2H6C A;  1JKO C;  2H8W A;  1XGN A;  1LDJ A;  1U5T C;  5CVU A;  1TTY A;  2EB7 A;  2MH2 A;  1YW9 A;  2EIJ H;  3FF5 A;  4YIF A;  4RBO A;  3J80 K;  1FOX A;  1IN4 A;  1MW7 A;  5LHH A;  4IVN A;  1V54 H;  4OMZ A;  1E3H A;  3FXQ A;  4XLP F;  4BQA A;  3ELK A;  1R1T A;  2DAO A;  1U9N A;  5ICE A;  1G4D A;  5EG0 A;  2PBI A;  3HHH A;  5FRO A;  2ZME C;  1FNN A;  1MMN A;  1EJ9 A;  3RPU D;  3SQN A;  3REO A;  2A6E F;  1ZK8 A;  4JBA A;  4AWX B;  2JA5 J;  4OIN F;  4ASN A;  1QBJ A;  3DWL E;  1UEL B;  4RA2 A;  4D7M A;  4M9X A;  3ZMS A;  3W6K B;  2WA0 A;  4LOC A;  3OYN A;  3PQJ A;  2B0L A;  1D0Z A;  4U88 A;  2DTR A;  3GW2 A;  3DKW A;  3JRF A;  2NS0 A;  4Q5S F;  3HXL A;  3LA7 A;  4KIC A;  2X48 A;  4LB6 B;  3SEQ A;  4NHJ A;  4U7D A;  2O0Y A;  4MTD A;  2CW7 A;  3OIP A;  3ZQC A;  2K40 A;  1D0X A;  1ON2 A;  4HDU A;  2A68 F;  3ZQG A;  2W85 A;  2K9L A;  2VBX A;  4DBR A;  2Q2E A;  2DN0 A;  4QIW N;  4S04 A;  3I59 B;  2BW3 B;  3HC7 A;  4DNC A;  2FEZ A;  2E7X A;  3BJ6 A;  3H3Z A;  2KZV A;  1OYW A;  2W84 A;  2FNP A;  3HYI A;  3P5J A;  5FD6 A;  3K9T A;  2VB6 A;  3GLL A;  2LC2 A;  1KU7 A;  5DV5 A;  2DI3 A;  1B9N A;  1T08 B;  1W7P D;  2KQR A;  3JTG A;  2EFP A;  2A69 F;  2EIN H;  3KCC A;  1I6H J;  5DUI A;  3BQY A;  3S2H J;  2EA2 A;  4A3I J;  2OQR A;  4P55 A;  5IOZ A;  1MH4 A;  4KIG A;  3CDH A;  4CCO A;  2MFZ A;  1T98 A;  3DCF A;  5K7Z A;  4PK4 A;  3BG7 A;  1E3O C;  3OS1 A;  4QPQ A;  5CJ9 A;  5L3C A;  4NB5 A;  2KIU A;  3IWZ A;  3IUO A;  4ZH4 F;  2Z16 A;  1AKH B;  1DU6 A;  5LHG A;  1X1D A;  3DPL C;  4BE1 A;  4KT5 C;  1R9T J;  4UB8 C;  5EG0 B;  4LG0 A;  3OY9 A;  4MQV A;  1QPI A;  1OCC H;  2L01 A;  3QRF F;  4IX7 A;  4BQQ A;  3WOD F;  2KRC A;  4A3C J;  1NK2 P;  4A0Y A;  3BZ6 A;  1BN5 A;  3BTI A;  5F0C A;  2NOG A;  1UG2 A;  2QM3 A;  4BBS J;  2PJR A;  3VYT B;  2HVQ A;  3TO6 A;  3DEU A;  3HEF A;  1XMX A;  2OAZ A;  4HF0 A;  1B4A A;  3G73 A;  3DTE A;  3K0L A;  1YX3 A;  3TDU C;  3V8K A;  4Z6Y A;  3TOA A;  4XLC A;  2HDW A;  1K78 A;  3ABM H;  2X9D A;  3BY6 A;  1F43 A;  3KP7 A;  2XDV A;  1UJ8 A;  2KRF A;  2M7A A;  3GTQ J;  4M73 A;  4AID A;  1JTX A;  4MLO A;  5EZG A;  3RSN A;  2Z33 A;  2F5E A;  1JGG A;  1SMT A;  1O3Q A;  1SFX A;  2NAZ A;  1Z7L A;  2R92 J;  2BVL A;  3KZI C;  2LF7 A;  5JHU A;  1X19 A;  3SEZ A;  3PIO F;  4C2T A;  2XPW A;  1Y8R B;  2QWW A;  4U0W A;  1QZE A;  1S72 I;  1BR2 A;  1TNS A;  1HKT A;  2CH0 A;  2HXI A;  3H0D A;  2LY2 A;  2KFD A;  2KDZ A;  2JPB A;  4A3M J;  2OV7 A;  3F6V A;  2ZXI A;  1RKT A;  3HRS A;  4NNJ A;  1PDN C;  1TLH B;  1T33 A;  2GBY A;  3BLY A;  4DW6 A;  4R79 A;  2JUG A;  3QAH A;  4D9J A;  5JLX A;  3CCU I;  1GLN A;  3VYU B;  2ID3 A;  1SC7 A;  2CGP A;  2V79 A;  3K4N A;  1IDY A;  2V9V A;  3C2G A;  3SYT A;  2VON A;  1YI2 I;  4BXX J;  1R7J A;  1DU0 A;  4J01 A;  1MSF C;  4BNC A;  2E7W A;  4OIR F;  3HSE A;  1E3P A;  1SMY F;  4N4O B;  3FMR A;  3CCQ I;  3FK6 A;  2VXD A;  4B43 A;  4BHC A;  4V2G A;  4RLF A;  4AYB A;  5HLH A;  5HDK A;  1W5S A;  1ZTR A;  2XAF A;  1H0M A;  3E5U A;  1BC8 C;  2PEX A;  2ZBK A;  3VYS B;  3N4M A;  2JK3 A;  2HPI A;  5FJ8 J;  4LG0 B;  1R23 A;  1TQI A;  3GTK J;  3DPT A;  3GTL J;  2EA4 A;  1Z6T A;  5BOX A;  3P9I A;  4UVB A;  2HTS A;  1N25 A;  3GZ5 A;  3F23 A;  4LGW A;  3RQ4 A;  3HPG A;  3FZV A;  3OYE A;  2BXY A;  4G7H F;  5F08 A;  3BJO A;  2FQ3 A;  3S17 J;  4PCQ A;  1X3U A;  1MMA A;  4OAZ A;  2LY1 A;  2PJR B;  2LRE A;  5DM6 F;  2HXO A;  3RKX A;  3IRQ A;  2BYV E;  1MBF A;  3D5S C;  1JUM A;  1QHG A;  3OL4 A;  2IS2 A;  4AM3 A;  3RJP A;  2FBH A;  4BH9 A;  5TGT A;  1SVL A;  2QYO A;  2HNH A;  5D5V B;  3ZXS A;  2R7T A;  1K78 B;  3LOC A;  4D5C A;  3EPZ A;  2PMU A;  3V7C A;  1KU2 A;  2V6C A;  1MMS A;  1XS9 A;  5HS7 A;  1G3S A;  4QSH A;  2GIZ A;  2VJ5 A;  4PSW A;  2ZNY A;  3TED A;  5JHF A;  3RPU A;  3Q0W A;  2OUM A;  4M9S A;  5FKM A;  4A0X A;  2VI6 A;  1ZYR F;  3CCS I;  1REP C;  3HBL A;  1NG7 A;  2LFB A;  2O3F A;  2QZ8 A;  1LEA A;  3G1O A;  5M5Y J;  4QTR A;  3BCB A;  3PUF A;  1LEB A;  1G8X A;  4ZZL A;  3QU6 A;  4BDY A;  1LFP A;  3A1Y A;  3A0H C;  2DOF A;  1FEX A;  3ZQQ A;  2ZXW H;  3GF2 A;  4A3D J;  4L5I A;  2RVC A;  3LFU A;  3ULQ B;  3GBG A;  2K86 A;  2KIQ A;  5K7H A;  2Z1D A;  4IOC F;  2CV2 A;  2YR2 A;  3CDL A;  1ETK A;  2GA2 A;  3CUQ C;  4L5E A;  4DZJ A;  4YFK F;  4PUS A;  1UFM A;  3ZGK A;  2ZKZ A;  2XVC A;  5F27 A;  3TOB A;  5GTI C;  1AU7 A;  3F8M A;  1JHF A;  3ZQL A;  1QGP A;  4JX5 A;  5F64 A;  2WTE A;  3F9K A;  3KZY A;  1X1P A;  2CQX A;  4EAT A;  4MFE A;  3VPR A;  4HLY A;  1OR7 A;  2WAQ A;  3OV8 A;  2HZT A;  3ZQ7 A;  3V42 A;  3LA2 A;  2XAQ A;  4HA8 A;  1W7P A;  3PIP F;  4PJM A;  1IV6 A;  3IH3 A;  2X4H A;  5HDN A;  1MBE A;  2Y2Z A;  2JN6 A;  3KP6 A;  3BTC A;  1Z3Y A;  4RM2 A;  4M72 A;  2ECB A;  4LIU A;  3HOT A;  2FE3 A;  3RPQ A;  4Q48 A;  3WTU C;  2ZXJ A;  3DEW A;  4M3B A;  2V1X A;  1WFX A;  3SHF A;  3S3N A;  3WTS C;  2VAS A;  1CQT A;  4L9J A;  5FRM A;  1FIP A;  2ESN A;  4KN4 X;  1JE8 A;  2V7F A;  3R60 A;  4V19 K;  2CV1 A;  5TRD A;  3MZ8 A;  1IDZ A;  2DT7 B;  1ZRF A;  3A03 A;  2E2I J;  1IGN A;  3P7N A;  4MTE A;  1VQ8 I;  4UV9 A;  3PQK A;  3T5X A;  2W1O A;  2E1M C;  1P7I A;  2EJR A;  3K10 A;  5J1U A;  1MDM A;  2HFH A;  2H6B A;  5D5X B;  1KA8 A;  4CYD A;  2ZO4 A;  3CO7 C;  1H8A C;  2JA8 J;  3BOQ A;  3DKY A;  1R49 A;  3UKG A;  1DUX C;  3PSF A;  4G6Q A;  2YX4 A;  3HGG A;  3CJR B;  4EM1 A;  1QZY A;  4AD9 A;  5E79 C;  2ZJQ F;  2QQ9 A;  2RNJ A;  5LEK A;  4GFB A;  2BBY A;  1DDN A;  1SVO A;  3S32 A;  4S05 A;  1HA8 A;  3N05 A;  3WTV C;  4DYC A;  3HKZ A;  4BBR J;  3VYR B;  2UXX A;  1SVM A;  5J3L A;  3VOE A;  4CIC A;  5F1R A;  2XSD C;  1WI9 A;  1GVD A;  4YII A;  4I98 B;  2RQQ A;  2M0M A;  3BTJ A;  1RZ4 A;  3E7L A;  2ELK A;  4KYW A;  4OWR B;  3K70 C;  3K1P A;  4QPO A;  3JSO A;  5JVG F;  4XMY A;  5FD5 A;  1TW3 A;  4KMU X;  1WHU A;  2HYJ A;  4AIK A;  4HOB A;  1LVA A;  4F3Q A;  1EH6 A;  5FLX K;  5JI6 A;  5ILU A;  2HR3 A;  3JAM K;  2WAQ N;  2NNY A;  4IHX A;  2Y31 A;  3FXK A;  4QWQ A;  1R4N B;  2DA7 A;  2ICW G;  1YHQ I;  1ITY A;  1I50 J;  1XSD A;  2UUZ A;  1Q1V A;  1XMA A;  3JW4 A;  3QWL A;  5M5X J;  3EYY A;  4WF2 A;  4CYC A;  3HOX J;  1IF1 A;  3H5A A;  5DUK A;  2GIV A;  4E6K G;  2LLK A;  2FD5 A;  1V5F A;  2L4M A;  3U9G A;  2QQA A;  2K4B A;  1FPQ A;  1Y1V J;  4IHS A;  2DA5 A;  4F91 B;  5CVR A;  1BJA A;  3DV8 A;  1W7P B;  2V26 A;  1WJF A;  3VDX A;  3JRA A;  3ISP A;  3VWB A;  3R6S A;  1VQM I;  2JWT A;  3IWF A;  3UNG C;  1O3T A;  1F36 A;  5D8L B;  2DA3 A;  3CCJ I;  5FKL A;  3CLO A;  2AS5 F;  1XGS A;  4PGG A;  3ABU A;  3AL0 C;  2RRE A;  5E18 F;  3AFH A;  3K69 A;  2CMP A;  2EZL A;  2M2E A;  1MZB A;  1WJD A;  3DKX A;  3H92 A;  2LTP A;  2QBY A;  1K79 A;  3GTM J;  3W2V A;  1MDM B;  2R7R A;  1T38 A;  2JVH A;  4BKX A;  1KYW A;  3BWG A;  1QZZ A;  4XKV A;  2A05 A;  2R7Q A;  3IP4 B;  1W0U A;  3I55 I;  1ON1 A;  5K5Q A;  4HBL A;  4ZZD A;  3MKZ A;  3HKZ N;  2LKX A;  5LBQ A;  3RDI A;  3I64 A;  3F8C A;  1QPM A;  2VL8 A;  1VF9 A;  5FB2 A;  2OJE D;  5F1J A;  4HV5 A;  2AHQ A;  2UZK A;  4PDK A;  2P5V A;  1V55 H;  4JK1 X;  5C3E J;  1T2K A;  3H36 A;  3L7W A;  1MNM C;  1BIB A;  1X2M A;  3LA3 A;  2KP6 A;  3KYC B;  3G6E I;  1WWX A;  3K4C A;  4FET A;  3G71 I;  5FKK A;  2NXN B;  1J5Y A;  1YO5 C;  9ANT A;  2ZSH B;  2LBF B;  2MW8 A;  2H27 A;  4PFO A;  1W1W E;  2M87 A;  4I02 A;  2DA1 A;  4UXN A;  2HDD A;  5J8C A;  1FYM A;  4R8H A;  3JRC A;  2XHK A;  1J0R A;  3KET A;  4KIS A;  4IRG A;  4XKC A;  3AG4 H;  3AKZ A;  3DBR B;  4G7Z F;  4IRH A;  2DMU A;  4CYC B;  3ZMV A;  5CYV A;  3RI4 A;  4ZTJ A;  2D1H A;  1G3W A;  1FBS A;  4XRM A;  4L9N A;  3O8G A;  1UG0 A;  4Y3O A;  1R1V A;  4ANJ A;  5FRN A;  2B63 J;  1G2H A;  5GAH J;  1AHD P;  2GLO A;  3I4M J;  1B72 A;  3S3O A;  1V4R A;  1ODD A;  3KP5 A;  2HYG D;  3RKQ A;  3FKI J;  2OD5 A;  1SAX A;  2V9K A;  3LFK A;  3CD6 I;  1ZGW A;  1PJR A;  3MFK A;  1Z1D A;  1HQC A;  4HV6 A;  3HTS B;  1XGM A;  4EJO A;  4A3E J;  2V6E A;  2M30 A;  3LQQ A;  2TDX A;  5IYD J;  3FHZ A;  3U1D A;  1H89 C;  1RUO A;  1IXC A;  2OTJ I;  3IAS 2;  1J59 A;  1OYY A;  1PYV A;  4I76 A;  2M1B A;  1JUS A;  1FOY A;  2CQ7 A;  3KP2 A;  4GRI A;  2NYX A;  5KCM A;  5AIP A;  4B1R A;  4FX0 A;  2QBY B;  3FXL A;  2EIL H;  3BPV A;  4M3F A;  4S0H B;  4BJ5 C;  1ZR4 A;  4CA0 A;  4AIH A;  1F4K A;  2ESH A;  2PG4 A;  2PMZ A;  3TW7 A;  4DYQ A;  2RNG A;  2HQR A;  2NVT J;  3J7A Y;  3RYP A;  3ZN0 A;  4E7I A;  3GWZ A;  2IPQ X;  1V3F A;  2DFH A;  1KQ9 A;  1TBX A;  2R5Y A;  2F5D A;  4LFU A;  5FKO A;  1U2W A;  1ZAR A;  1I27 A;  2DW4 A;  2VIX A;  4C3H J;  1YJN I;  4GDF A;  1KU3 A;  2P81 A;  1UCR A;  3W3C A;  2HPM A;  1UB9 A;  1IN5 A;  4XLA A;  1YS7 A;  2FA5 A;  1ENH A;  3MQ0 A;  4HSR A;  3GYH X;  2WB1 A;  3WGG A;  3MWM A;  3CDI A;  4YFX F;  2DXI A;  1FTT A;  3BP8 A;  3QOP A;  4B47 A;  3I5U A;  4C3I J;  2F48 A;  4A3G J;  2DQR A;  4MFD A;  3T0Y A;  3FKJ A;  5IT9 K;  2HKO A;  3QPS A;  1ETQ A;  2MGQ A;  2QA4 I;  1UHM A;  2NS8 A;  2PFB A;  3KX2 A;  3JCU C;  4BXF A;  4DJA A;  4L18 B;  1KU9 A;  4HDV A;  1NTC A;  1Z67 A;  2WAE A;  2H09 A;  2IP2 A;  2VLA A;  1Y6I A;  4F52 A;  1YW8 A;  4OIQ F;  4ZYH A;  3Q0V A;  3ZRG A;  1FYL A;  2JJ7 A;  4UNO A;  4M3E A;  2P7C B;  1Z6R A;  5LD2 C;  3HOU J;  1OCO H;  5FFX A;  3LSP A;  1HDD C;  2XPU A;  4UHT A;  2KT0 A;  1GV5 A;  3LAJ A;  1A6I A;  1UHW A;  4RAZ A;  2OQG A;  4MIM A;  4JYK A;  1B72 B;  3E3V A;  2P5L C;  2CO5 A;  4DYR A;  4E7L A;  3AG1 H;  3I0T A;  3DBL B;  3H0G J;  2RQP A;  2MD0 A;  2YU3 A;  2DA2 A;  3PJR A;  4LB5 A;  4Y4R A;  5BPD A;  5IYB J;  4BY7 J;  2W82 A;  3BZK A;  3JRG A;  5KVR A;  3MMY B;  2DDA A;  3R0J A;  1ZLK A;  1FSE A;  5FGM A;  2V1N A;  2ISY A;  3E5X A;  3J7Z I;  1U6G A;  2EK5 A;  1TZL A;  3DFG A;  2LDU A;  2XKP A;  2KKO A;  2QUF A;  2IT0 A;  2PMZ N;  1OKR A;  4IL6 C;  4D1Q A;  2IS6 A;  1G3T A;  1FP1 D;  1W5T A;  1Y56 A;  1MGT A;  1X1B A;  1XTA A;  3F0C A;  2CW0 F;  1AKH A;  4PJ0 C;  2QF7 A;  3TGN A;  1X1C A;  1TWG J;  1J75 A;  3HJE A;  1ETW A;  1HF0 A;  1D0Y A;  2NNN A;  2LRD A;  5CVV A;  3R0A A;  2Z99 A;  2VXZ A;  1MBH A;  5GAG J;  2LD5 A;  1B6A A;  1Y8Q B;  3BPX A;  3FXM A;  4XID A;  3W6V A;  1FWZ A;  2ELJ A;  3Q9V A;  2XF6 A;  5KK1 A;  2R5Y B;  2WB1 N;  4XSZ F;  1JI8 A;  2DT5 A;  4XLH A;  1G6N A;  1KON A;  5KAI C;  3E6C C;  4HG2 A;  5M5W J;  2XC7 A;  3K4J A;  1LQ1 A;  3D5R C;  4F92 B;  2A5W A;  3SFZ A;  1S6L A;  1MIJ A;  1XSX A;  3LL7 A;  2A6T A;  2X1D A;  5F04 A;  2MSY A;  3S1N J;  5C4X J;  1J9I A;  2R7O A;  4D7N A;  3HRU A;  2QEN A;  5JVT A;  4LIV A;  4RS8 A;  4RGU A;  2HWV A;  1USS A;  2W48 A;  4RAG A;  1UZC A;  1V5G A;  3GZN B;  1ZKG A;  2EFQ A;  2DOD A;  5B66 C;  2MA3 A;  3HSR A;  3CC2 I;  4AVZ A;  1MBJ A;  4IHW A;  5D8K B;  3GME A;  5B1B H;  3CMY A;  1U8B A;  2R7X A;  2JUC A;  3HOV J;  1W36 C;  5FLX Z;  2BOL A;  4KFC A;  3JAM Z;  3NEU A;  4EMS A;  1NK3 P;  2VUM J;  2L2O A;  4ZC3 A;  4RGR A;  1NHA A;  3ZQI A;  1YRN A;  4O3M A;  3PNV A;  3FM5 A;  1SAN A;  4JOM A;  2R7W A;  5LEJ A;  2QSH X;  5FLM J;  1K4T A;  4OIP F;  1C0W A;  4GGG A;  2IGN A;  4MEX F;  2K85 A;  2HGC A;  2W4S A;  1QVT A;  1XGO A;  1FBQ A;  2XB5 A;  5A2Q K;  2XGD A;  4G94 A;  1ZQ3 P;  2LF8 A;  4BHB A;  5J40 A;  3SXY A;  1U5T A;  3IH2 A;  2UXN A;  3BRO A;  1XDS A;  2P4W A;  3CO6 C;  4HYE A;  1XD7 A;  3MKL A;  1EV7 A;  2RC4 A;  4XN3 A;  1IC8 A;  2PJP A;  3VOD A;  2DOE A;  4MGR A;  3CME I;  1W0T A;  4A3K J;  1RPW A;  4RGS A;  1P2F A;  2PI0 A;  2EIK H;  1P6R A;  3BTL A;  3M9A A;  1VQP I;  4PZJ A;  1WQ2 A;  3ZP5 A;  3FXO A;  4J19 A;  4L9T A;  2HS5 A;  4A12 A;  5M3F J;  5HLT A;  4I6Z A;  3GTP J;  1S8N A;  4E4H A;  4FT8 A;  4L0Y B;  3BJA A;  4A3J J;  2M9H A;  2FJ1 A;  1ETX A;  3E97 A;  3CP8 A;  4II3 A;  3Q0U A;  5HVQ C;  2X0L A;  4GXO A;  1LUJ B;  3V4G A;  4ITV A;  3JTH A;  2W00 A;  1K83 J;  4RB0 A;  3GZ6 A;  2AQE A;  3I4P A;  2EPF A;  1EA3 A;  4PJL A;  3OIQ A;  4G12 A;  5LLQ A;  1U8R A;  2E1O A;  2CFO A;  5TJJ A;  3KPH A;  1WRJ A;  3FXJ A;  1GT0 C;  4AC0 A;  2O8K A;  2ZFW A;  3MKW B;  4I01 A;  2HQN A;  4N0B A;  5E3O A;  4RB1 A;  5L3B A;  2XAG A;  3PFY A;  3GFJ A;  1E0E A;  3F21 A;  3JRD A;  1NG6 A;  3D5L A;  5KHD A;  3LSJ A;  1OIS A;  3I9V 2;  3V8J A;  4IKF A;  3HL2 A;  2OZ6 A;  1FMW A;  2GA1 A;  2BY2 A;  2CQK A;  4KA4 A;  2CWE A;  3HHG A;  1YYV A;  3BDD A;  1YRN B;  2DCE A;  1Q1H A;  4F93 B;  2L9V A;  3QOD A;  4GYG A;  4M6V A;  3ZQF A;  1TT5 B;  3I4N J;  1V5E A;  2L0K A;  1D5V A;  2W57 A;  2IJL A;  2IW5 A;  4N9H A;  3LSM A;  3WTX C;  1RR8 C;  4LD5 A;  2STW A;  1PP7 U;  3S1Q J;  1IW7 F;  2UV1 A;  3G1M A;  4II2 A;  4P9F A;  4I99 C;  1ZG3 A;  2FNA A;  1SFK A;  1WGX A;  2K3F A;  1RET A;  2XAU A;  5E3L A;  2PMH A;  4EV0 A;  2R3S A;  3FM3 A;  3COA C;  2ZB9 A;  3JRB A;  3I53 A;  3L09 A;  1FZP B;  4O6J A;  3VSK A;  4KN7 X;  4MQ9 F;  1LDK B;  1U5T B;  3LQR A;  1W4M A;  4FAS D;  3IRR A;  1OCT C;  2HTJ A;  5B5E C;  2ADU A;  4X0G A;  2EBI A;  1WKM A;  4IHT A;  4G7O F;  3OYI A;  1ETY A;  5D5U B;  3CLQ A;  4FIS A;  4CCJ A;  2EQR A;  5CVJ A;  4HX7 A;  3BZC A;  1WH5 A;  2G7H A;  5K5R A;  2N8G A;  2K9S A;  3M1E A;  3D1N I;  4YFN F;  5BS6 A;  2B9S A;  2FOK A;  3U21 A;  2A6H F;  3GXO A;  2HOS A;  1SD4 A;  1TWA J;  1MMD A;  1TWC J;  2LK2 A;  3SJM A;  1XMK A;  4PJN A;  3OR2 C;  5LHI A;  3C7J A;  4KIB A;  3DXJ F;  3GTJ J;  2NRA C;  3KIO A;  1SD7 A;  3QYF A;  1ZGJ A;  2L02 A;  3V7R A;  2BVM A;  4M71 A;  1ZG5 A;  1ZGA A;  2V1D A;  2X6O A;  1DGW Y;  1T39 A;  2D2W A;  1KGS A;  1ETV A;  4IQJ A;  1BI2 A;  1IRZ A;  2JSP A;  3ABL H;  3RKW A;  1IRF A;  3BT9 A;  4Y33 A;  2J5O A;  5KNL A;  1VTN C;  1RIO H;  3OWT A;  4L5J A;  3S15 J;  3OIO A;  2V4J C;  3TL4 X;  3AG3 H;  4XK4 A;  2YX7 A;  2ZNZ A;  5IT9 Z;  4W1U A;  2H8R A;  3VFZ A;  1J7K A;  2Z3Y A;  2JMW A;  2TRT A;  2VBZ A;  3E6B A;  5DTD A;  1YJ9 I;  4KJZ A;  2HI3 A;  4BAC A;  2ZJ2 A;  3MEX A;  1ZG1 A;  2CW8 A;  1VQN I;  1IO2 A;  1WPK A;  2Y75 A;  2QGU A;  3PL8 A;  3SZP A;  1RKW A;  1Z3X A;  5IOY A;  3F72 A;  3DTK A;  4UUS A;  1LFB A;  3ONQ A;  2YSR A;  2XAJ A;  1QNT A;  3NWS A;  3KEO A;  3RKY A;  4UVC A;  3F6O A;  4W97 A;  5J47 A;  2AXT C;  5H6Q A;  3IL2 A;  1TT0 A;  1BW5 A;  3WHC A;  3S16 J;  1IZ1 A;  2ISZ A;  2K9Q A;  1MND A;  2JA2 A;  4ZYE A;  4IZZ A;  5EGO A;  1Y0U A;  3ABK H;  3CCY A;  2EFO A;  3HOZ J;  3CMA I;  1IAW A;  4XR6 A;  1TC3 C;  5FFZ A;  3JRE A;  3HZJ A;  5E3M A;  1FSH A;  4EVI A;  1U0J A;  2V9P A;  4FHT A;  1PUE E;  3CCL I;  4IQ4 A;  2VKE A;  2AO9 A;  2E36 A;  2PQ8 A;  3DTI A;  1FX7 A;  2E2H J;  3BG6 A;  1OQY A;  3CUO A;  5D5W B;  1JKR C;  3D0S A;  4KMF A;  2KIS A;  2R7V A;  1HXD A;  2VC1 A;  3HOS A;  4O5V A;  1LB2 A;  1LDD A;  3BG5 A;  3TQN A;  2PN6 A;  2QSF X;  5HDG A;  4DZP A;  3J81 Z;  1MBG A;  2L7M P;  1WJA A;  4M3G A;  1TWF J;  3PM1 A;  2E71 A;  2FU4 A;  1VQ4 I;  2DYR H;  3FK7 A;  4FX4 A;  1GXQ A;  3H5N A;  3LST A;  3S1R J;  1I1S A;  1HW2 A;  1P4A A;  3ASO H;  5HS8 A;  2MYS A;  3ZMZ A;  1F1Z A;  2CUJ A;  4DQ2 A;  2P5K A;  3OL3 A;  6PAX A;  3X2Q H;  1FY7 A;  3G1L A;  1YTY A;  1STZ A;  4HX4 A;  4QLC U;  3M4O J;  3L00 A;  1J09 A;  2G9W A;  4UVA A;  2WC2 A;  4ENM A;  1SFO J;  1R5I D;  3K1M A;  4FTH A;  4C2U A;  2EWN A;  4DOZ A;  3BCA A;  1MKM A;  3MZH A;  2JA6 J;  1HW5 A;  3IHU A;  4MO7 A;  4I0B A;  3FBI B;  4RGX A;  2L54 A;  2VE8 A;  2COM A;  3DP7 A;  3NRV A;  2BY1 A;  1E17 A;  2CUE A;  2R93 J;  1PVE A;  3FXR A;  1QVU A;  1IRX A;  2DJN A;  4EGY A;  4UUS B;  1KQ0 A;  2E60 A;  2LBF A;  5GP9 A;  2E2J J;  3BR5 A;  2OTL I;  4FQG A;  2DLL A;  2P6S A;  1R4M B;  1X58 A;  1OJL A;  2DQL A;  4RAF A;  4LG3 A;  5IT3 A;  2I10 A;  1ZRC A;  2ECC A;  2KJB A;  2LP0 A;  2PLY A;  5IPA A;  2G7U A;  1VQK I;  3MZY A;  2Y9Z A;  5EGO B;  1N78 A;  2DK8 A;  1D5Y A;  3EYI A;  1ORK A;  1Z21 A;  2XGC A;  5A2Q Z;  3E6M A;  5D4S A;  5F0H A;  4BEH A;  4FE7 A;  2KHM A;  2R7F A;  4JQF A;  3GFL A;  3IAM 2;  3GCM A;  4ESF A;  1XG1 A;  2ACJ A;  3M1C A;  2GXB A;  2ME0 A;  3ML6 A;  2FBI A;  4ESJ A;  4MHG A;  4E70 A;  2WBM A;  2DA6 A;  5EEA A;  3A2K A;  2LVS A;  2ZCW A;  2QLZ A;  1YIO A;  3VSL A;  4XN0 A;  2E34 A;  3H5R A;  4LLL A;  2DMQ A;  3RYR A;  4XRS G;  4XKW A;  1PUF A;  2DA4 A;  2KJC A;  4ON0 A;  4K2E A;  1A35 A;  5AON A;  1YLF A;  3P9K A;  1VZ0 A;  2Q8K A;  1FBU A;  2VJ4 A;  1GUU A;  2VJI A;  3ZMU A;  3ECH A;  3S2W A;  2HOT A;  1WZ2 A;  3U1K A;  3FIW A;  2QQ8 A;  3NQO A;  3OYB A;  1YW7 A;  3B6C A;  5LRR A;  2BEO A;  2BZT A;  4RB2 C;  3F3X A;  1JHH A;  2HEO A;  2L7Z A;  3EQL F;  1YFH A;  1LNW A;  2VBY A;  3SZT A;  3PUB A;  2ME6 A;  4WWC A;  3OYK A;  4ETS A;  4E7J A;  1IV8 A;  5ED4 A;  4JX4 A;  4GYI A;  4UUT A;  4YRV A;  4RB3 C;  3OYM A;  3CJN A;  1IN6 A;  4C9Y A;  4LLN A;  4BJT A;  4I09 A;  3C2B A;  3JRI A;  2DOA A;  1SD6 A;  1TWH J;  4B44 A;  4TV7 A;  2EIM H;  2L3D A;  3ZMT A;  5D6E A;  2VQH A;  1T0F A;  4CGZ A;  2J5P A;  3FDY A;  3LMM A;  5C4J J;  2R5Z A;  2VOD A;  3JRH A;  1HLV A;  1R36 A;  3K4K A;  5D4R A;  5BQT A;  4EGZ A;  3WGI A;  5H6R A;  1WJB A;  3AG2 H;  1BI3 A;  3E5Q A;  3I54 A;  4HF2 A;  1XB4 A;  4P5O A;  4HZF A;  1EH8 A;  4YEL A;  4F7Z A;  2OA4 A;  3KP3 A;  3CC4 I;  4XIC A;  3B73 A;  4OAY A;  1OPC A;  3CF5 F;  4I7H A;  4YEJ A;  1YIT I;  1S7A A;  2L9S A;  4BL0 B;  1YIJ I;  2ID6 A;  2VT3 A;  2OU2 A;  4GO1 A;  5GPA A;  1ZHF A;  4ENN A;  1ACI A;  4BEH B;  4OU0 A;  2A3S A;  1HST A;  4CCN A;  2O6G E;  1HSJ A;  3CF2 A;  4E7K A;  2VPL A;  4FE4 A;  3ECO A;  1A36 A;  4HQE A;  2L7F P;  2EFN A;  2O61 A;  3CCE I;  1AOY A;  4BQN A;  1M1E B;  2LKS A;  2XRO A;  2VT2 A;  1GVJ A;  5GAD J;  3E0J B;  2Y48 A;  1WSU A;  3DPU A;  4XLF A;  1SFU A;  5B3S H;  3DQV C;  2YPR A;  3QQA A;  4RAY A;  3S3M A;  3ZQH A;  4N4N B;  1WH7 A;  3MAJ A;  1GDT A;  4A3L J;  3FIS A;  1BM9 A;  2JTV A;  1PUF B;  4BHP A;  2NS7 A;  2QSG X;  1MMG A;  5L3E A;  4PFP A;  5BPI A;  1XPX A;  2E1M B;  2I5U A;  4C3J J;  2CJJ A;  3CES A;  3NWT A;  5EYR A;  3EUH A;  1Z05 A;  2IEK A;  2QKL B;  2FXA A;  1LJ9 A;  4KUM A;  4CHU A;  2FSW A;  3GTG J;  4OMY A;  2KMU A;  4F55 A;  3NAU A;  4XON A;  1ZRE A;  5FKN A;  2DFE A;  4CCK A;  1BC7 C;  4NBQ A;  3RCO A;  3DF8 A;  3H3U A;  3K2Z A;  3WU0 A;  3CTA A;  2JVG A;  1D1B A;  3K7A J;  2X85 A;  2F6C A;  3CP2 A;  1G59 A;  3BQZ A;  2ELH A;  4DGW B;  3DBH B;  1K4S A;  1E2X A;  1X3Z B;  5H2F C;  3Q3S A;  1BA5 A;  3WG7 H;  1OLT A;  2YUS A;  3QYB A;  4LK1 F;  2IS1 A;  4CZZ A;  2VC0 A;  4XRF A;  5TIS C;  3I3L A;  4HNV A;  2EFW A;  3O2P E;  4NQW A;  2R5Z B;  3GTO J;  1XX5 A;  3M3Y J;  3I56 I;  2BXZ A;  4M74 A;  3T8T A;  2IXS A;  1P7J A;  5CVI A;  3H9J A;  2EH3 A;  2FML A;  3L2U A;  3F8F A;  3HRM A;  2QEX I;  4Y15 A;  5JFR A;  4A5N A;  4BDZ A;  2K5C A;  3HUG A;  3TO7 A;  1GHC A;  4ZJZ A;  1S9H A;  4B3A A;  1B9M A;  3CMM A;  2MG4 A;  2CU7 A;  2GWR A;  2P8T A;  2VOO A;  2R7S A;  2FBK A;  2GXG A;  1W5C C;  4ESB A;  2EV0 A;  3M7G A;  1R71 A;  5J1R A;  3DLA A;  5L3G A;  4ZYG A;  3KFW X;  2FOW A;  3B6A A;  2WV1 A;  2HU9 A;  4AVP A;  4ZYA A;  3OYC A;  3PFI A;  4BE2 A;  1O4X A;  1FTZ A;  2BY0 A;  3S2D J;  2KDO A;  1K61 A;  1VI0 A;  2D45 A;  1VQL I;  2CUF A;  2K3P A;  5IP7 J;  1MJA A;  4XBF A;  1X4P A;  3BR0 A;  2CFX A;  5CKT A;  5LGN A;  5ICC A;  4A2U A;  3AL0 B;  3J81 K;  3EUA A;  4HNU A;  4CCM A;  2R7Z J;  3B02 A;  1R6R A;  2Z5U A;  1HKS A;  4Q47 A;  2RDP A;  1QQI A;  4B3X A;  2Y9Y A;  1D1A A;  1XCB A;  3QPL A;  4NC7 A;  2P0W A;  2GZW A;  2M0C A;  2A61 A;  2O9L A;  1T56 A;  5JR3 A;  2GAU A;  1H9T A;  2F4I A;  2MAB A;  5E17 F;  1Z91 A;  2VN2 A;  1MJB A;  4E7S A;  5J8F A;  2OC6 A;  3CZ6 A;  2HOE A;  4HX8 A;  1VQO I;  4Y52 J;  2ZJR F;  2AQF A;  2VPR A;  3LSK A;  3C18 A;  1P4W A;  4P1W A;  1FJL A;  3W2W A;  4E7H A;  3L2W A;  1JGS A;  3U2R A;  4CSW A;  4XOT A;  2M8E A;  2KPM A;  3S8P A;  2XF5 A;  1LFU P;  5E8I A;  3ZMD A;  2DMT A;  3TDZ C;  3GEZ A;  1QRY A;  5AIQ A;  2W7N A;  2M8G X;  2Y30 A;  4DBQ A;  2IVM A;  4NQW B;  3M8J A;  4HEA 2;  2EZK A;  5EEG A;  5FO5 A;  1FIA A;  3TP0 A;  5LFA A;  5J1Y A;  2M5W A;  2M45 A;  1U3E M;  2DDB A;  2JRM A;  1U9O A;  3TO9 A;  3KE2 A;  2E5Z A;  4BUP A;  5J6X A;  2Z2S B;  3KZZ A;  3H9Q A;  3HUG B;  4IF4 A;  3ERM A;  4HF1 A;  2KLO A;  2XV4 S;  3KP4 A;  1DPU A;  1X3W B;  1IG7 A;  3ABT A;  3HOY J;  1D3Y A;  2CQQ A;  4HNT A;  4G6T B;  2IBD A;  2B7E A;  3KLO A;  2X6W A;  2VBW A;  4XOP A;  1XN7 A;  2O03 A;  3LSI A;  4WK8 F;  3HOW J;  3G3Z A;  1P4X A;  2GOM A;  2L9N A;  1YE9 A;  4G6D A;  3E6D A;  5HLI A;  1R58 A;  2F4M B;  2IRF G;  1R22 A;  1TW2 A;  2O5R A;  3H1C A;  1WJ5 A;  2K4J A;  4EQQ A;  2XAH A;  1K7A A;  4XLE A;  3GFI A;  2E1N A;  3O6B B;  2HQA A;  3RQI A;  2VE9 A;  4NUB A;  3TKY A;  1Y39 A;  2GM4 A;  3A4C A;  2L5Q A;  1KYZ A; 
#chains in the Genus database with same CATH homology
 1MJ9 A;  2LKP A;  1H9G A;  5DD4 A;  5E20 A;  1Z9C A;  4G8X A;  1F9N A;  3GO5 A;  3F8N A;  2ZME A;  3ZN1 A;  4IPA A;  1ZLJ A;  4P96 A;  1QO0 D;  3ROU A;  1YS6 A;  1FP2 A;  3AAF A;  2RV8 A;  2K02 A;  3HTU A;  4U0V A;  2Y0M A;  3WTW C;  1AWC A;  2WV0 A;  3T1B A;  3GX4 X;  1OMI A;  4EJW A;  4N9I A;  4CO8 A;  4IJA A;  1XDU A;  3L9F A;  2MC3 A;  1XCV A;  1JXS A;  4L0Z B;  1CF7 A;  2MD5 A;  1UST A;  1SFE A;  4EM2 A;  4MEY F;  1ZH5 A;  3R61 A;  1G3Y A;  2MH9 A;  5LGT A;  1TQM A;  3VB2 A;  2F5C A;  2P7V B;  4PGH A;  2K27 A;  1S3J A;  1U78 A;  3WTT C;  2DPD A;  4Y13 A;  2XKO A;  3WTY C;  4U7B A;  2STT A;  2F5F A;  4WXH A;  3WE2 A;  3GLX A;  1R5H A;  2R7D A;  3FXU A;  3V8L A;  3FWE A;  2DO7 A;  1IUY A;  4L9V A;  4A6D A;  3P9C A;  5F6F A;  1O57 A;  1IN8 A;  2CSO A;  4LK0 F;  3JSP A;  4HW0 A;  1D8J A;  4Z2Y A;  2JZY A;  3GUD A;  2ZME B;  1RNL A;  5ICG A;  3W6J B;  2JPC A;  4BYY A;  4IRI A;  1D8K A;  1BI0 A;  2MBF A;  2DK5 A;  2RGV A;  4KNY A;  5K5O A;  2IA2 A;  2EV5 A;  2W25 A;  5DEQ A;  2XIG A;  1I5Z A;  4B8X A;  4AIJ A;  2BV6 A;  2C6Y A;  4WXD A;  3V7S A;  2FF4 A;  3RIR A;  2QVO A;  1CF7 B;  1O7F A;  4A6E A;  5HOO A;  4CXF A;  4GCV A;  5ERI A;  2HYF A;  4UV8 A;  2XAS A;  3WE3 A;  4A5M A;  1O3S A;  4HAM A;  2P6T A;  1FLI A;  3Q9S A;  3IC7 A;  4EJT A;  1HW1 A;  5L3D A;  4ZYD A;  4M9Z A;  4U0Y A;  4EJU A;  4B09 A;  3ERE D;  1R1U A;  2H94 A;  2OBP A;  4UUV A;  2JSC A;  2KIM A;  3T8R A;  3FMQ A;  4KIF A;  4LLG F;  1J2X A;  5EEH A;  4H0E A;  2Z9O A;  3C1D A;  4WX9 A;  4EM0 B;  2IA0 A;  1R00 A;  5ICF A;  2RKH A;  4IXA A;  5H20 A;  1K6O A;  3J80 Z;  1B59 A;  2RN7 A;  1KQ8 A;  1RUN A;  2W24 A;  5DYM A;  3IKT A;  2XGX A;  3VEP A;  1A04 A;  3QPH A;  3M8F A;  4WXC A;  5LGU A;  1ZN2 A;  3K1N A;  1FC3 A;  3RTR A;  4P9U A;  3M8E A;  3F8B A;  1YQA A;  1HKQ A;  1F5T A;  2L4A A;  4OOI A;  2HDC A;  2FMY A;  2EV6 A;  1BI1 A;  1SD5 A;  2E1C A;  4KDP A;  3CUQ A;  5DCM A;  3MCZ A;  3IKV A;  2DFI A;  1IXR C;  3GVA A;  1EH7 A;  4HLX A;  1BIA A;  2IA1 A;  1I6X A;  5CLS A;  1O3R A;  1S7O A;  1DPR A;  1BBY A;  1L0O C;  5K1Y A;  5LRS A;  4G9Y A;  4I2O A;  1XSV A;  2LNB A;  4Q4Z F;  1TQP A;  3I71 A;  3N97 A;  2MLG A;  4ENJ A;  3L2C A;  2AXL A;  2ETH A;  2CYY A;  2KIF A;  2UWM A;  2Q0O A;  2OZU A;  2GQQ A;  4HQM A;  1I1G A;  3EET A;  1R5G A;  4XLN F;  4OIO F;  2DU9 A;  3F22 A;  5ILV A;  2XUB A;  5DCF A;  1O7L A;  3HRT A;  1TNT A;  4Y17 A;  1T6S A;  1P92 A;  2CG4 A;  4MNU A;  1B1B A;  1IXS B;  1YG2 A;  2A07 F;  3CUQ B;  5DCM B;  4BAY A;  5E1W A;  2LSO A;  5L3F A;  3HIF A;  4BXU A;  1BOA A;  5D6F A;  4A0Z A;  4CDG A;  3R4K A;  4I0A A;  3GFM A;  4M6Y A;  3FX3 A;  5DDG A;  2V1U A;  3C3W A;  4LMY A;  1ZRD A;  4D0P A;  2HKX A;  4LJZ F;  2WWY A;  1HBX G;  5DD8 A;  3WU1 B;  3OOP A;  2K7L A;  1L3L A;  4ENK A;  1IRG A;  2BGC A;  2MLK A;  4YG2 F;  1IN7 A;  4R1H A;  3KEQ A;  1FYK A;  4XSX F;  3O3K A;  1S29 A;  1DP7 P;  5E8G A;  2D1V A;  1GXP A;  5ILS A;  3QPT A;  2VOP A;  2JRT A;  1ONV A;  2DBB A;  4WCG A;  3QP6 A;  4EJV A;  3J7A O;  2JT1 A;  1FOK A;  2XRN A;  3EDP A;  3WGH A;  1MD0 A;  1RI7 A;  1ZAO A;  5HLG A;  2BE5 F;  2DPU A;  3I58 A;  3QU3 A;  3FMS A;  3QP5 A;  5E1X A;  1FT9 A;  3WTZ A;  5BMZ A;  1Z7U A;  3Q5F A;  2F2E A;  2A5Y B;  1ULY A;  3I59 A;  1CGP A;  5HS9 A;  3LAP A;  3HSF A;  1PP8 F;  5E1Z B;  3ZPL A;  3WG9 A;  4M6X A;  2FRH A;  1OYI A;  2O8X A;  3KLN A;  3LWF A;  2QQB A;  2H6C A;  1XGN A;  1LDJ A;  1U5T C;  5CVU A;  1TTY A;  2EB7 A;  2MH2 A;  1YW9 A;  3FF5 A;  4YIF A;  3J80 K;  1IN4 A;  5LHH A;  4IVN A;  4OMZ A;  4XLP F;  3FXQ A;  4BQA A;  3ELK A;  1R1T A;  2DAO A;  5ICE A;  1G4D A;  2PBI A;  3HHH A;  1FNN A;  3SQN A;  3REO A;  2A6E F;  4JBA A;  4AWX B;  4OIN F;  4ASN A;  1QBJ A;  4M9X A;  3ZMS A;  3W6K B;  3PQJ A;  2B0L A;  4U88 A;  2DTR A;  3GW2 A;  3DKW A;  2NS0 A;  4Q5S F;  3LA7 A;  4KIC A;  4LB6 B;  4NHJ A;  4U7D A;  2O0Y A;  4MTD A;  1ON2 A;  4HDU A;  2A68 F;  2W85 A;  2VBX A;  2Q2E A;  4S04 A;  3I59 B;  4DNC A;  2FEZ A;  2E7X A;  3BJ6 A;  3H3Z A;  1OYW A;  2W84 A;  2FNP A;  3HYI A;  5FD6 A;  3K9T A;  1KU7 A;  5DV5 A;  2DI3 A;  1B9N A;  1W7P D;  3JTG A;  2EFP A;  2A69 F;  3KCC A;  5DUI A;  2EA2 A;  2OQR A;  4P55 A;  4KIG A;  3CDH A;  1T98 A;  5CJ9 A;  5L3C A;  4NB5 A;  2KIU A;  3IWZ A;  4ZH4 F;  5LHG A;  3DPL C;  4KT5 C;  4LG0 A;  4MQV A;  3QRF F;  2L01 A;  3WOD F;  4A0Y A;  3BZ6 A;  1BN5 A;  2QM3 A;  3TO6 A;  3DEU A;  2OAZ A;  4HF0 A;  1B4A A;  3G73 A;  3K0L A;  3TDU C;  3V8K A;  3TOA A;  1K78 A;  3BY6 A;  3KP7 A;  2KRF A;  4M73 A;  2Z33 A;  2F5E A;  1SMT A;  1O3Q A;  1SFX A;  2NAZ A;  2LF7 A;  5JHU A;  2QWW A;  4U0W A;  1TNS A;  1HKT A;  2JPB A;  3F6V A;  3HRS A;  1PDN C;  1TLH B;  4R79 A;  3QAH A;  2CGP A;  2V79 A;  2V9V A;  2VON A;  1R7J A;  4BNC A;  2E7W A;  4OIR F;  3HSE A;  1SMY F;  3FMR A;  4BHC A;  5HLH A;  5HDK A;  1W5S A;  2XAF A;  1H0M A;  3E5U A;  1BC8 C;  2PEX A;  2ZBK A;  3N4M A;  4LG0 B;  1R23 A;  1TQI A;  3DPT A;  2EA4 A;  1Z6T A;  5BOX A;  3P9I A;  4UVB A;  2HTS A;  3GZ5 A;  3F23 A;  4LGW A;  3FZV A;  4G7H F;  3BJO A;  2FQ3 A;  4PCQ A;  1X3U A;  3RKX A;  3IRQ A;  2BYV E;  3RJP A;  2FBH A;  4BH9 A;  2QYO A;  5D5V B;  1K78 B;  2PMU A;  3V7C A;  1KU2 A;  2V6C A;  5HS7 A;  1G3S A;  2ZNY A;  3RPU A;  4A0X A;  4M9S A;  1REP C;  1ZYR F;  1LEB A;  2O3F A;  2QZ8 A;  1LEA A;  4ZZL A;  3QU6 A;  3GF2 A;  4L5I A;  2RVC A;  3ULQ B;  2K86 A;  2YR2 A;  2GA2 A;  3CUQ C;  4YFK F;  1UFM A;  2ZKZ A;  2XVC A;  3TOB A;  3F8M A;  1JHF A;  1QGP A;  5F64 A;  2WTE A;  3KZY A;  4HLY A;  1OR7 A;  3OV8 A;  2HZT A;  3ZQ7 A;  3LA2 A;  2XAQ A;  4HA8 A;  1W7P A;  2X4H A;  5HDN A;  3KP6 A;  4M72 A;  3HOT A;  2FE3 A;  3RPQ A;  4Q48 A;  3WTU C;  2ZXJ A;  2V1X A;  3SHF A;  3WTS C;  4L9J A;  4KN4 X;  2ESN A;  1JE8 A;  3R60 A;  5TRD A;  1ZRF A;  3P7N A;  4MTE A;  4UV9 A;  3PQK A;  3T5X A;  2EJR A;  1MDM A;  2HFH A;  2H6B A;  5D5X B;  1KA8 A;  4CYD A;  2ZO4 A;  3CO7 C;  3BOQ A;  1DUX C;  4G6Q A;  2YX4 A;  4EM1 A;  1QZY A;  4AD9 A;  2QQ9 A;  2RNJ A;  5LEK A;  2BBY A;  1DDN A;  4S05 A;  3WTV C;  2UXX A;  4CIC A;  3VOE A;  5F1R A;  1WI9 A;  4YII A;  4I98 B;  1RZ4 A;  4KYW A;  3K1P A;  3JSO A;  5FD5 A;  1TW3 A;  4KMU X;  4AIK A;  4HOB A;  1LVA A;  1EH6 A;  5FLX K;  5JI6 A;  3JAM K;  2HR3 A;  5ILU A;  2NNY A;  4QWQ A;  1XSD A;  1XMA A;  3JW4 A;  3EYY A;  4WF2 A;  1IF1 A;  5DUK A;  2GIV A;  2L4M A;  3U9G A;  2QQA A;  2K4B A;  1FPQ A;  4IHS A;  5CVR A;  1BJA A;  3DV8 A;  1W7P B;  3ISP A;  3R6S A;  3IWF A;  1O3T A;  5D8L B;  3CLO A;  2AS5 F;  1XGS A;  4PGG A;  3ABU A;  5E18 F;  3K69 A;  1MZB A;  3H92 A;  2QBY A;  1K79 A;  1MDM B;  1T38 A;  1KYW A;  3BWG A;  1QZZ A;  1ON1 A;  5K5Q A;  4HBL A;  4ZZD A;  5LBQ A;  3RDI A;  3I64 A;  3F8C A;  1QPM A;  5FB2 A;  4HV5 A;  2UZK A;  4PDK A;  2P5V A;  4JK1 X;  1T2K A;  3L7W A;  1BIB A;  3LA3 A;  1WWX A;  1J5Y A;  1YO5 C;  2H27 A;  2M87 A;  4I02 A;  4UXN A;  5J8C A;  1FYM A;  4R8H A;  2XHK A;  1J0R A;  3KET A;  4IRG A;  4G7Z F;  4IRH A;  3ZMV A;  5CYV A;  3RI4 A;  2D1H A;  1G3W A;  1FBS A;  4L9N A;  1R1V A;  1V4R A;  1ODD A;  3KP5 A;  2HYG D;  2OD5 A;  1SAX A;  3LFK A;  3MFK A;  1Z1D A;  1HQC A;  4HV6 A;  3HTS B;  1XGM A;  4EJO A;  2M30 A;  3LQQ A;  2TDX A;  3FHZ A;  3U1D A;  1RUO A;  1IXC A;  1J59 A;  1OYY A;  2M1B A;  3KP2 A;  2NYX A;  5AIP A;  4FX0 A;  2QBY B;  3BPV A;  4AIH A;  1F4K A;  2ESH A;  2PG4 A;  2HQR A;  3RYP A;  3ZN0 A;  3GWZ A;  2IPQ X;  1V3F A;  1KQ9 A;  1TBX A;  2F5D A;  4LFU A;  1U2W A;  1ZAR A;  1I27 A;  2DW4 A;  1KU3 A;  1UCR A;  1UB9 A;  1IN5 A;  1YS7 A;  2FA5 A;  3MQ0 A;  3GYH X;  3WGG A;  3MWM A;  4YFX F;  3BP8 A;  3QOP A;  3I5U A;  2DQR A;  3T0Y A;  5IT9 K;  2HKO A;  1UHM A;  2PFB A;  4L18 B;  1KU9 A;  4HDV A;  2H09 A;  2IP2 A;  1YW8 A;  4OIQ F;  4ZYH A;  1FYL A;  4UNO A;  2P7C B;  1Z6R A;  5FFX A;  4UHT A;  3LAJ A;  1UHW A;  4RAZ A;  2OQG A;  3E3V A;  2P5L C;  2CO5 A;  3I0T A;  2RQP A;  2YU3 A;  4LB5 A;  5BPD A;  5KVR A;  3R0J A;  1ZLK A;  1FSE A;  5FGM A;  2ISY A;  3E5X A;  1U6G A;  2EK5 A;  3DFG A;  2LDU A;  2XKP A;  2KKO A;  2QUF A;  2IT0 A;  1OKR A;  1G3T A;  1FP1 D;  1W5T A;  1MGT A;  2CW0 F;  3TGN A;  1J75 A;  2NNN A;  5CVV A;  3R0A A;  2Z99 A;  2VXZ A;  1B6A A;  3BPX A;  1FWZ A;  3Q9V A;  5KK1 A;  4XSZ F;  2DT5 A;  1G6N A;  3E6C C;  1LQ1 A;  3SFZ A;  1S6L A;  1XSX A;  1J9I A;  3HRU A;  2QEN A;  5JVT A;  4RS8 A;  4RGU A;  2HWV A;  1USS A;  2EFQ A;  2MA3 A;  3HSR A;  5D8K B;  5FLX Z;  4KFC A;  3JAM Z;  3NEU A;  4EMS A;  4RGR A;  1NHA A;  4O3M A;  3FM5 A;  5LEJ A;  4OIP F;  1C0W A;  4GGG A;  4MEX F;  2HGC A;  1XGO A;  1FBQ A;  5A2Q K;  4G94 A;  2LF8 A;  4BHB A;  3SXY A;  1U5T A;  2UXN A;  3BRO A;  1XDS A;  2P4W A;  3CO6 C;  4HYE A;  1XD7 A;  1EV7 A;  2RC4 A;  2PJP A;  3VOD A;  4MGR A;  4RGS A;  1P2F A;  2PI0 A;  1P6R A;  3M9A A;  4PZJ A;  1WQ2 A;  3ZP5 A;  4L9T A;  2HS5 A;  4A12 A;  1S8N A;  4FT8 A;  4L0Y B;  3BJA A;  3E97 A;  5HVQ C;  2X0L A;  4GXO A;  3V4G A;  3JTH A;  4RB0 A;  3GZ6 A;  3I4P A;  5LLQ A;  1U8R A;  5TJJ A;  1WRJ A;  2ZFW A;  4I01 A;  2HQN A;  4N0B A;  4RB1 A;  5L3B A;  2XAG A;  3GFJ A;  3F21 A;  3D5L A;  3V8J A;  2OZ6 A;  2GA1 A;  2CQK A;  4KA4 A;  2CWE A;  3HHG A;  1YYV A;  3BDD A;  1Q1H A;  4GYG A;  1D5V A;  2W57 A;  2IJL A;  2IW5 A;  4N9H A;  3WTX C;  4LD5 A;  2STW A;  1PP7 U;  1IW7 F;  4P9F A;  1ZG3 A;  2FNA A;  2PMH A;  4EV0 A;  2R3S A;  3FM3 A;  3COA C;  3I53 A;  3L09 A;  1FZP B;  4O6J A;  4KN7 X;  4MQ9 F;  1LDK B;  3IRR A;  1U5T B;  3LQR A;  1W4M A;  2HTJ A;  2ADU A;  4IHT A;  1WKM A;  4G7O F;  5D5U B;  5CVJ A;  4HX7 A;  2G7H A;  5K5R A;  3M1E A;  4YFN F;  5BS6 A;  2FOK A;  2A6H F;  3GXO A;  1SD4 A;  1XMK A;  5LHI A;  3C7J A;  4KIB A;  3DXJ F;  2NRA C;  1SD7 A;  1ZGJ A;  2L02 A;  3V7R A;  4M71 A;  1ZG5 A;  1ZGA A;  2V1D A;  1T39 A;  2D2W A;  1KGS A;  1BI2 A;  3RKW A;  1IRF A;  2J5O A;  1RIO H;  1VTN C;  4L5J A;  2YX7 A;  2ZNZ A;  5IT9 Z;  3VFZ A;  1J7K A;  2Z3Y A;  2VBZ A;  3E6B A;  2ZJ2 A;  3MEX A;  1ZG1 A;  2Y75 A;  3SZP A;  3F72 A;  2YSR A;  2XAJ A;  1QNT A;  3KEO A;  3RKY A;  4UVC A;  3F6O A;  5H6Q A;  3IL2 A;  1IZ1 A;  2ISZ A;  4ZYE A;  1Y0U A;  2EFO A;  1IAW A;  5FFZ A;  1FSH A;  4EVI A;  4FHT A;  1PUE E;  2PQ8 A;  1FX7 A;  3CUO A;  5D5W B;  3D0S A;  4KMF A;  1HXD A;  2VC1 A;  3HOS A;  4O5V A;  1LB2 A;  1LDD A;  3TQN A;  2PN6 A;  5HDG A;  3J81 Z;  2FU4 A;  4FX4 A;  1GXQ A;  3LST A;  1I1S A;  1HW2 A;  1P4A A;  5HS8 A;  3ZMZ A;  1F1Z A;  4DQ2 A;  2P5K A;  6PAX A;  1FY7 A;  1YTY A;  1STZ A;  4HX4 A;  4QLC U;  3L00 A;  2G9W A;  4UVA A;  2WC2 A;  4ENM A;  3K1M A;  2EWN A;  1MKM A;  3MZH A;  1HW5 A;  3IHU A;  4I0B A;  4RGX A;  2L54 A;  2VE8 A;  2COM A;  3DP7 A;  3NRV A;  1E17 A;  3FXR A;  4EGY A;  1KQ0 A;  2DLL A;  2P6S A;  2DQL A;  5IT3 A;  1ZRC A;  2KJB A;  2PLY A;  2G7U A;  3MZY A;  2DK8 A;  3EYI A;  5A2Q Z;  3E6M A;  5D4S A;  2R7F A;  4JQF A;  3GFL A;  4ESF A;  2ACJ A;  2GXB A;  3ML6 A;  2FBI A;  4ESJ A;  4MHG A;  4E70 A;  2ZCW A;  2QLZ A;  1YIO A;  4LLL A;  3RYR A;  2KJC A;  4ON0 A;  4K2E A;  5AON A;  1YLF A;  3P9K A;  2Q8K A;  1FBU A;  3ZMU A;  3ECH A;  3S2W A;  3NQO A;  1YW7 A;  5LRR A;  2BEO A;  4RB2 C;  3F3X A;  1JHH A;  2HEO A;  3EQL F;  1YFH A;  1LNW A;  2VBY A;  3SZT A;  4WWC A;  4ETS A;  5ED4 A;  4GYI A;  4RB3 C;  3CJN A;  1IN6 A;  4LLN A;  4I09 A;  1SD6 A;  4TV7 A;  2L3D A;  3ZMT A;  5D6E A;  1T0F A;  4CGZ A;  2J5P A;  2VOD A;  1R36 A;  5D4R A;  5BQT A;  4EGZ A;  3WGI A;  5H6R A;  4HF2 A;  1BI3 A;  3E5Q A;  3I54 A;  1XB4 A;  4P5O A;  4HZF A;  1EH8 A;  4F7Z A;  2OA4 A;  3KP3 A;  3B73 A;  1OPC A;  4I7H A;  1S7A A;  2VT3 A;  2OU2 A;  4GO1 A;  4ENN A;  1ZHF A;  4OU0 A;  2A3S A;  1HST A;  2O6G E;  1HSJ A;  3ECO A;  4HQE A;  2EFN A;  2O61 A;  1AOY A;  2XRO A;  2VT2 A;  1GVJ A;  2Y48 A;  1WSU A;  1SFU A;  3DQV C;  2YPR A;  4RAY A;  3MAJ A;  1BM9 A;  2JTV A;  4BHP A;  5L3E A;  5BPI A;  3EUH A;  1Z05 A;  2FXA A;  1LJ9 A;  4KUM A;  4CHU A;  2FSW A;  4OMY A;  1ZRE A;  1BC7 C;  3DF8 A;  3H3U A;  3K2Z A;  3WU0 A;  3CTA A;  2ELH A;  1E2X A;  4LK1 F;  4CZZ A;  2VC0 A;  4XRF A;  2EFW A;  3O2P E;  4NQW A;  4M74 A;  3T8T A;  5CVI A;  2FML A;  3F8F A;  3HRM A;  4Y15 A;  5JFR A;  4A5N A;  3HUG A;  3TO7 A;  1GHC A;  1B9M A;  2GWR A;  2VOO A;  2P8T A;  2FBK A;  2GXG A;  4ESB A;  2EV0 A;  3M7G A;  5L3G A;  4ZYG A;  3KFW X;  4AVP A;  3PFI A;  2D45 A;  1MJA A;  4XBF A;  5LGN A;  2CFX A;  5ICC A;  4A2U A;  3J81 K;  3B02 A;  2Z5U A;  1HKS A;  4Q47 A;  2RDP A;  1QQI A;  1XCB A;  2GZW A;  2A61 A;  5JR3 A;  2GAU A;  1H9T A;  5E17 F;  1Z91 A;  2VN2 A;  1MJB A;  5J8F A;  2HOE A;  4HX8 A;  3C18 A;  1P4W A;  1JGS A;  3U2R A;  2M8E A;  5E8I A;  3ZMD A;  3TDZ C;  3GEZ A;  5AIQ A;  2IVM A;  5EEG A;  5FO5 A;  2M5W A;  2M45 A;  1U3E M;  3TO9 A;  3KE2 A;  5J6X A;  3KZZ A;  4IF4 A;  4HF1 A;  2XV4 S;  3KP4 A;  1DPU A;  3ABT A;  1D3Y A;  3KLO A;  2VBW A;  1XN7 A;  2O03 A;  4WK8 F;  3G3Z A;  1P4X A;  4G6D A;  3E6D A;  5HLI A;  1R58 A;  2IRF G;  1R22 A;  1TW2 A;  2K4J A;  4EQQ A;  2XAH A;  1K7A A;  3GFI A;  2E1N A;  3O6B B;  2VE9 A;  3TKY A;  1KYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...