1ENHA

Structural studies of the engrailed homeodomain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
54
structure length
54
Chain Sequence
RPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNKRAKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords ENGRAILED HOMEODOMAIN
publication title Structural studies of the engrailed homeodomain.
pubmed rcsb
source organism Drosophila melanogaster
total genus 22
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 1994-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1enhA00
4A3KJ 3I4NJ 1HF0A 2ME6A 2EZHA 3QPLA 5J1YA 1GUUA 4C2MJ 3JREA 5C4XJ 1IJWC 1FTZA 3IV5A 1GVDA 4D7MA 1ZKGA 2AHQA 5M5WJ 4W97A 3FIWA 4A3IJ 1I3QJ 1W0UA 2R5YB 2E19A 4A93J 1A5JA 2LD5A 2HDDA 1QVUA 4A3MJ 3JRFA 2R5YA 3BQYA 3L1PA 1BL0A 3RZOJ 3MN2A 2LTPA 3OIOA 2M34A 2JWTA 3O8GA 4IEJA 4QIWN 1JUMA 5EF6A 4FE4A 1Y1WJ 2VUMJ 1Y1VJ 1RETA 4UUTA 1BW6A 2QF7A 3G1LA 2M2EA 4ABZA 2R0QC 5IYBJ 5JLWA 4XIDA 3BTLA 5E3MA 1POGA 3B6CA 1ETXA 2IBDA 3TP0A 2HQ5A 3GTKJ 2DMQA 3TP3A 3ZOBA 2XRLA 1VNDA 3UKGA 1DU0A 1IGNA 2O7OA 5HODA 5EG0B 3OSFA 3H3VK 2O9LA 4FISA 3ZQHA 3K2AA 5FLVA 1TWCJ 3IH2A 3HBLA 1JTXA 5GPCA 2LP0A 1HCRA 1OFCX 1LFBA 2DA1A 4JX6A 4D5FA 2WB1N 3VPRA 4JX4A 3GTGJ 1G2HA 1U9OA 3MVPA 5E3NA 5IP7J 2FQ4A 1MNMC 1P7JA 3C2BA 1B72B 3LOCA 3HM5A 1HLVA 1WCMJ 2YS9A 1R9TJ 3BTCA 3LSPA 3BR1A 2ME0A 5EDNA 4RDUA 5FKMA 3W6VA 3A02A 1MBKA 5GPAA 3OOUA 4UUSA 4XICA 1ETVA 4AUXA 2MG4A 1TWGJ 2DA2A 2CUEA 3HKZN 2DJNA 3HOYJ 3DEWA 2OPTA 2XPWA 9ANTA 1IRZA 1TC3C 3JR9A 5M3FJ 3JRDA 3S1MJ 1CQTA 4DZJA 1BJZA 2DA3A 2DMUA 4IHYA 2XPUA 5EEAA 2KDZA 1PUFB 2XGDA 3HGYA 4B3AA 1K61A 2ELKA 4M3EA 4XRMA 2E2HJ 3S2HJ 2D5VA 4L5EA 2Y9YA 2MW8A 1XS9A 1FJLA 3GTQJ 1ZK8A 2DA5A 3FK6A 1Z0XA 2JA8J 1U78A 3BR2A 2P81A 2FJ1A 2TRTA 2NVTJ 1E3OC 4GFBA 2GM4A 1JGGA 1QRYA 1XG1A 2CQXA 2NS8A 2CRGA 2LY9A 2LKXA 2ECCA 2LFBA 4DZPA 1O4XA 1JJ6C 1WPKA 2NVQJ 3LSRA 2DA4A 2OF7A 2ID6A 1GV5A 3M4OJ 1VF9A 3BG3A 3WHBA 1RKWA 5F0FA 1ETQA 1ZQ3P 5FKLA 1RR7A 3BR3A 4QSHA 5F1JA 3PM1A 4AYBN 2K40A 2EQRA 1I6HJ 1XC5A 4BBRJ 3GTJJ 1RESA 1IG7A 4DYRA 4BY7J 1ZTRA 4M3FA 5C4JJ 4C3IJ 5IYDJ 5IOZA 1GV2A 1UG2A 2HI3A 3QQAA 1JJ8C 4NDLA 4IHVA 2H8RA 3BTIA 1H8AC 5J3LA 5DTDA 5K7ZA 5DS9A 5FKKA 1MBJA 1T33A 4BY1J 1JKRC 2L0KA 4A3GJ 2JA7J 1UMQA 1MBFA 1GT0C 4JYKA 2L9RA 2MGQA 1HDPA 3Q0VA 2HOSA 4B4CA 2Y30A 2VI6A 2VKEA 2KT0A 1JTYA 2LLKA 3MKLA 2VKVA 3Q0UA 4JX5A 3BR5A 1WGXA 5C3EJ 2X48A 1ZR4A 2EH3A 4IHWA 1ETKA 1MBHA 1JUPA 5EG0A 5IOYA 2I10A 1JT6A 1GDTA 3ZQIA 1QPIA 3HOUJ 4A3FJ 3S16J 4V2FA 1JUSA 1NK2P 2ZB9A 2EZLA 4S0HB 1S7EA 4JP0A 3FISA 3CCYA 3IH4A 2JA6J 1MSEC 3PO3J 2DTZA 4FCYA 2E2IJ 1SANA 3S17J 1MBGA 5J1UA 1JKQC 1B72A 2ECBA 2LR8A 3B6AA 3PO2J 3E7LA 3IH3A 3FK7A 3K7AJ 3TW6A 1VFCA 1MSFC 2HXOA 3TW7A 1JKPC 1Q1VA 4X6AJ 4V2GA 1AU7A 2DA6A 3NAUA 1A6IA 2G0EA 3HGGA 2W48A 1F36A 5M5XJ 4CYCB 1WI3A 2Y0SN 1X2NA 4BKXA 4A3JJ 1FEXA 1LFUP 2HOTA 1RPWA 1RKTA 5M5YJ 4DW6A 1K83J 5C44J 2L7ZA 2EZKA 3BG9A 2HYJA 1H88C 4X1EA 1TWAJ 2X6OA 2M0CA 2WV1A 4I76A 2M9HA 4M3GA 1MH3A 2E2JJ 2VPRA 2GLOA 4QTRA 3S15J 2Y9ZA 2EZIA 5IP9J 2K9QA 1PUFA 1HOMA 2ID3A 1W0TA 2R5ZB 4MLOA 4AC0A 1ZGWA 3SJMA 2O8KA 2XSDC 3S1QJ 1AKHB 3SFIA 1SFOJ 1BA5A 3BR6A 1YRNB 1IC8A 3HOZJ 2PMZN 5IYCJ 1AKHA 2DMTA 3JRAA 3GTOJ 1X2MA 2JN6A 1NK3P 3TEDA 2H1KA 3LSJA 4A3LJ 3BG5A 1T56A 5F08A 1AHDP 1ETWA 2M8GX 4MFEA 1HDDC 1BW5A 4IHXA 2XB5A 3BTJA 4BXXJ 2HOAA 2MSYA 1JT0A 3JRBA 3SDGA 4HNVA 1F43A 3OSGA 3HB9A 5FJ8J 1UHSA 1D5YA 5FLMJ 3I4MJ 4LOCA 3G1MA 3ZQGA 4A69C 2DMNA 5E3OA 4C3JJ 4MIMA 5E3LA 3RKQA 1QVTA 3HEFA 3HDDA 2CU7A 1MH4A 1U8BA 1IDYA 4XRSG 5GP9A 1NTCA 2YU9J 2R92J 1FTTA 5EYRA 2DA7A 4XRSA 1IV6A 3ZQFA 3D1NI 3GBGA 2B63J 1OCTC 3QPSA 1X58A 1ITYA 3S2DJ 2NVYJ 1WH5A 5BNGA 3M3YJ 2QCOA 4M3DA 2RAEA 2Y2ZA 3LSGA 1DU6A 2DN0A 4W1UA 5EZGA 1P7IA 4D5CA 2CUFA 3O8HA 1TWFJ 1ETOA 4G12A 2K9NA 1I50J 5F27A 2EBIA 2COBA 3RQIA 2CJJA 4DYCA 2WAQN 2FX0A 1FIAA 2L7FP 4MO7A 4DYQA 3G1OA 4A3CJ 1OCPA 3LNQA 3JRGA 2TCTA 3F0CA 5F0CA 5K7HA 2FD5A 5IPAA 2LVSA 1APLC 2DMPA 3GTMJ 2JK3A 4B1RA 3ZQCA 4MFDA 3HOWJ 1EF4A 3BT9A 3WHCA 3JRIA 3ZQLA 1FIPA 2IAIA 3Q0WA 3Q3SA 5JLXA 5IP6A 1LE8B 4J19A 2LK2A 3H0GJ 2L7MP 4D7NA 5F04A 3RZDJ 1LE8A 5J1RA 2CQQA 5F0HA 1IUFA 3HOVJ 4FE7A 4CYCA 3DCFA 5EZHA 2R93J 4M3BA 3GTPJ 1TWHJ 2JMWA 2IEKA 4UUSB 1U9NA 4Y52J 4RBOA 1IDZA 1ORKA 1JKOC 3BQZA 5EGOB 3NARA 1OJLA 2AO9A 2X9DA 2XB0X 2XGEA 1VI0A 2R5ZA 2JA5J 5EGOA 2K9SA 2HXIA 2NVXJ 2GBYA 1WH7A 2N8GA 1ZR2A 2R7ZJ 2JJ7A 3JRHA 4A3DJ 5K7FA 3S1RJ 4A3BJ 3HOXJ 4A3EJ 1ETYA 2E1OA 4EEFG 1YRNA 3A01B 5FKNA 4BBSJ 3S14J 4XK4A 3S1NJ 3A01A 1ENHA 3A03A 1Z77A 3BR0A 3CMYA 2XGCA 4M6VA 3CQZJ 1H89C 1B8IB 2NOGA 4Y7NJ 2XPVA 3GTLJ 4C3HJ 4FTHA 1B8IA 3FKIJ 5FKOA 3JRCA 2YUSA 4I6ZA 3CDLA 5M3MJ 2Y31A 1MBEA 2NS7A
chains in the Genus database with same CATH superfamily
3U1DA 3CF2A 4OIOF 2ME6A 5KAIC 1FC3A 2LY2A 1TNSA 2LMDA 1F1ZA 2DAOA 3DFGA 4UNOA 3DBLB 1YTYA 2EV5A 2AHQA 4W97A 3FIWA 4LG0B 5B3SH 3WTUC 2E19A 4A93J 1A5JA 1STZA 4P9FA 2LD5A 5K5QA 3D5RC 3E6MA 4LJZF 1LFPA 4EMSA 2VIXA 2VQCA 4A3MJ 2CV0A 3LSMA 4HW0A 5LEKA 1SVMA 3IKTA 3ERED 3CF5F 5E8GA 4KICA 2M34A 2XVCA 3NWSA 2F5DA 2FEZA 3O8GA 1HQCA 2RNGA 3M8EA 1Y1WJ 1Y1VJ 5E17F 3B73A 4ASNA 1BW6A 1A36A 1IN4A 1ZLKA 2QF7A 3G1LA 4M72A 4RAYA 1AOYA 4PGHA 4XIDA 5E1XA 1MMDA 3HRSA 3B6CA 2DJIA 4EM1A 3K4NA 5JFRA 4MHGA 3IRQA 2ACJA 2DMQA 3TDUC 3TP3A 3JCUC 2HQAA 3QP6A 5ICCA 1PP7U 1PP8F 4WX9A 2L5QA 2P7CB 3RKYA 4KDPA 1RI7A 4XR6A 5D5WB 2F4IA 2W4SA 1K78A 1TWCJ 2A61A 3IH2A 3HBLA 1XCBA 4BHPA 3K9TA 3PJRA 3K4KA 2LP0A 2Y0SA 2XKOA 3OYAA 3DPLC 4JX6A 2DA1A 1N77A 2X1EA 2JZYA 1U9OA 3MVPA 5E3NA 3M7GA 1X1CA 4C9YA 1B72B 3HM5A 1WCMJ 2A6TA 3BC8A 1TW3A 4HF1A 3LSPA 3FXRA 2JQ7A 2KKOA 2EV6A 4BQNA 4PCQA 3CLQA 5FFZA 1OR7A 3P9KA 5FKMA 4FASD 1W36C 2IS6A 5CVUA 3A02A 5D8LB 2WBMA 4BS9A 5GPAA 1VQOI 1K4SA 3QODA 4XICA 1R1TA 1LQ1A 2WV0A 3KFWX 1QZYA 1D0ZA 3HOYJ 4NQWB 1SD7A 2PMZA 3PUFA 1TC3C 1GHCA 5M3FJ 3JRDA 2NOJB 3TOBA 2DA3A 1XDUA 3U1KA 4XQFA 1PUFB 2IGKA 4DOZA 4HX8A 2UV1A 4B3AA 4CUGA 1K61A 2ELKA 2GQQA 3VSLA 4GYIA 3NEUA 4XRMA 3MZHA 3OYMA 1XSVA 2D5VA 3UR3C 2Y75A 4L5EA 1FJLA 2MW8A 1Z6TA 2DA5A 2MYSA 3FK6A 4BHCA 2JA8J 1LNWA 2W84A 5KVRA 2DOAA 4D1QA 4JK1X 4BNCA 4GFBA 1VZ0A 2CQXA 2E35A 2E71A 5HLGA 2VL8A 4UXNA 2ELHA 2LFBA 2M30A 5D8KB 2NVQJ 1FNNA 2QSGX 2AQEA 2OF7A 2ID6A 2ZC2A 2WC2A 1GV5A 3AG2H 2RDPA 4E7HA 1RZ4A 4HV5A 2YU3A 1XMXA 3WHBA 3DV8A 5DUIA 1KGSA 1RUOA 5HLTA 2X6WA 1RR7A 4QSHA 3JTHA 3T0YA 4RM2A 2CFOA 4JOMA 1EH7A 2CQKA 3CUQB 4AYBN 1UG0A 2ZFWA 4LFUA 2BYVE 3LFKA 4BY7J 1D1CA 2DPUA 2VASA 2X6XA 1H0MA 1L3LA 1GV2A 2PBIA 2HI3A 2V1UA 4AIHA 3J7YJ 2I5UA 4IL6C 2W7NA 4IXAA 2H8RA 2IA1A 3S3NA 5DTDA 3CZ6A 5DS9A 4XLAA 1T2KA 5FKKA 1MBJA 2FNAA 4A0ZA 4KJZA 4F52A 1T33A 2XV4S 4NC7A 4IRIA 2L0KA 3K10A 2DPDA 2JA7J 5KAFC 1R7JA 4YFXF 1A6QA 2MD5A 2GA2A 4G94A 2Y30A 2VI6A 1O3SA 2KT0A 1JTYA 4LLNA 3MKLA 3K1NA 3C3WA 4PJNA 1WGXA 2ZCWA 2HTSA 4XKCA 1S6LA 4HG2A 1W1WE 4ZYHA 1I27A 1MBHA 3R0JA 2VOPA 3FMRA 2I10A 3OYFA 2Y0MA 2M7AA 3WTWC 3F6VA 4XSXF 3ZQIA 1QPIA 1ZG3A 4UVBA 1I6XA 3RCOA 5L3BA 2LH9A 2V79A 2V6CA 3AG4H 2FA5A 3KLOA 3ONQA 3OYDA 1W5SA 3K1MA 2OAZA 4WCGA 3IWZA 2B9SA 3OS2A 4BXFA 3H3ZA 2PN6A 3PO3J 2XAHA 5GADJ 2Z9OA 2L2OA 5H6QA 1SANA 2W82A 5KHDA 3S17J 3BY6A 2IRFG 2ECBA 3ECOA 3TW6A 1MSFC 3FK7A 1UHWA 5DCMA 2HXOA 2HOEA 1JKPC 2VXZA 3MZ8A 4X6AJ 3E5QA 4WXDA 1X2NA 2YR2A 4HF2A 2PFBA 2ZMEA 3C1DA 2WA0A 4OIRF 5LGUA 5J8FA 3GFIA 4OAYA 1S9HA 3GLLA 3ZQQA 3HOTA 1QO0D 2E5ZA 2QQ9A 3L09A 3PIOF 2WV1A 4I76A 2VBYA 3IHUA 4RAFA 3VEPA 5HS8A 3H5RA 2BBYA 3ZPLA 2AQFA 2EZIA 3BJAA 1WI9A 1WKMA 2M5WA 3I59B 3LWFA 1TW2A 4YG2F 2E34A 5E79C 2GA1A 5JVTA 2ID3A 2L9VA 3QAHA 2R5ZB 4G6DA 1Y0UA 2F5FA 4U7BA 4P5OA 1IRGA 1Z9CA 3S1QJ 4ZTFA 1SFOJ 1KU2A 3E3VA 3E1SA 2UUZA 3DEUA 5HS9A 3L2VA 3OYJA 3ROUA 3HOZJ 1AKHA 3NQOA 4IRGA 5IYCJ 1PDNC 3KPHA 3BG5A 3BPXA 1ACIA 1WFXA 1N75A 2ZO4A 4BXXJ 3W2WA 5LRSA 3JRBA 2V7FA 2L4MA 3OSGA 4EV0A 5LHHA 3HHHA 3CCSI 2BY3A 4LOCA 3ZQGA 2P5VA 4Z2YA 2RQPA 2IGOA 1GVJA 2ISZA 2PX9A 2RREA 3OYCA 1QVTA 2FUG2 3SZGA 2GZWA 1MH4A 2HQRA 2VODA 1U8BA 2H09A 2DT6A 2OU2A 1HKSA 4YEJA 3VDXA 3EUKL 5GP9A 3I54A 3EQLF 3DLAA 3FWEA 4IF4A 1I39A 1OCTC 4O3MA 1X58A 1ITYA 2NVYJ 2VN2A 4ZC3A 4KYWA 5BNGA 3M3YJ 2QCOA 3H9QA 4M3DA 5HDNA 2EIMH 1TBXA 1YX3A 3KZIC 4B8XA 2CSOA 1QBJA 2CUFA 3OYGA 4G12A 3X2QH 1G3SA 4QPQA 2COBA 2VQGA 2W25A 2KZGA 4XLEA 2WAQN 3CC2I 1XCVA 2DFHA 4MO7A 4PJMA 1XPXA 2O61A 2H1LA 1OCPA 5JI6A 4O6JA 1D3YA 2ZFUA 3CDHA 3I9V2 2FXAA 4FT8A 1FOKA 1YOVB 1XX5A 2FD5A 3HJEA 2R7VA 3PNTA 1QZEA 2JPCA 3U21A 4NHJA 3ABUA 4RS8A 4XLFA 3LA7A 2V1XA 4B1RA 3WG7H 2BHZA 2ZXHA 4MFDA 3HOWJ 3P5JA 3BOQA 1P92A 5ILVA 1FIPA 3Q0WA 3Q3SA 4KT6A 5IP6A 1LE8B 2KIFA 5LHIA 1BN5A 4ETSA 2OTLI 5DUKA 2L7MP 4BH9A 2FF4A 4PSXA 2Q1ZB 5J1RA 2CQQA 3WGIA 5FLXK 3QU6A 4N9IA 4FE7A 4OIPF 2OTJI 5E1WA 5EZHA 3EYYA 2WAEA 3S3MA 1NH3A 2L54A 3GTPJ 3I71A 4PGGA 2JMWA 4CH7A 2QWWA 4ITVA 1BI0A 2EJRA 3HSEA 2IEKA 4UUSB 4BHBA 5LFAA 1R4MB 3F8BA 1IDZA 2KIQA 2NYXA 2KRCA 3R61A 2O0YA 1YJ9I 4GCVA 3M8JA 3M1EA 4PK4A 2AO9A 2LG4A 4F3QA 3HOSA 1YJWI 2QKMB 3RPUA 5EGOA 2K9SA 4KFCA 2NVXJ 1VQKI 3JRHA 2J5PA 4A3BJ 3CCEI 1ETYA 3H9GA 2M7BA 2W24A 2A5YB 3TBIA 2LF7A 3A01B 1TT0A 5FKNA 4KITB 3F3XA 2BY2A 4XK4A 3W2VA 4PDKA 4Y3OA 2DTRA 1ENHA 3OV8A 3BR0A 2XUBA 1X4OA 2XGCA 1SD6A 4AYBA 2BXYA 4HSRA 3LSTA 1G3WA 2NOGA 3IL2A 3GFJA 3W2AA 4HDUA 2QLZA 3FKIJ 3JRCA 4AM3A 1F4KA 4E7KA 3MD2A 2JPBA 5FFXA 4AIKA 3KETA 2X51A 3I4NJ 2GOMA 3LAJA 2KIMA 5L3FA 1KQ0A 1GUUA 2P5KA 3G73A 2BHYA 1BI3A 1IJWC 1FTZA 4MGRA 2GOXB 3GEZA 3LFUA 4D7MA 1P6RA 1K4TA 2HTJA 2PMUA 1W0UA 3OYBA 3F22A 1B9NA 1FBUA 3T1BA 4LG0A 3JRFA 3OYNA 1RC9A 4L9NA 4XKVA 4ON0A 1Y39A 2FOKA 4A2UA 3TO7A 3K4MA 3GFLA 3A1YA 3MN2A 2LTPA 1TP4A 3OIOA 3BROA 1D5VA 1Z21A 5D6FA 4L9TA 3EYIA 3AKZA 4G9YA 4M74A 4FE4A 2H6BA 1WHUA 1IN8A 4TV7A 1W4MA 4UUTA 1V54H 4N9HA 3FXJA 1I5ZA 4HLYA 4XN3A 3QYBA 4BE2A 2KL4A 4ABZA 5IYBJ 2LBFB 2EK5A 3BTLA 1IRXA 1IRFA 4XLNF 2IA2A 3O6BB 2CW7A 2A07F 3CESA 3E5UA 2IBDA 4A0YA 3BWGA 3LSIA 2DK5A 3LL7A 3ZOBA 1R49A 2XRLA 3K2ZA 1VNDA 1YIJI 1G6NA 3JAMK 5L3EA 3GX4X 4Y4RA 2DT5A 1SAXA 3FXLA 3ZGKA 1IGNA 1TZLA 5HODA 5EG0B 2K5CA 2W57A 1V3FA 2LF8A 3ZQHA 1R23A 1DUXC 1J9IA 4E7SA 4YFNF 2BV6A 2KJCA 1LEBA 3CMMA 5GPCA 1WJ5A 5J47A 5ERIA 1YITI 1MMNA 3RKXA 4IOCF 1TNTA 2IA0A 3HXLA 3NRVA 3I4PA 3GTGJ 3CCJI 1G2HA 4EATA 4F7ZA 2FBKA 2FQ4A 3LOCA 1HLVA 1R9TJ 3FXOA 2IVMA 4P96A 3GLXA 4ZZLA 2QENA 2HU9A 5JR3A 1REPC 2IS2A 2KRHA 2XSJC 3F8NA 3K4LA 1WZ2A 3BJOA 1ETVA 3SFZA 4AUXA 5F6FA 1TWGJ 2DA2A 2LKSA 3HKZN 4Q47A 4RAZA 3G3ZA 4IVNA 2BVMA 3ZXSA 1J09A 2OPTA 1HBXG 9ANTA 2NRAC 1MW7A 4NQWA 2F6CA 1PVEA 4M9ZA 3J80K 6PAXA 5ICGA 1D0YA 1WRJA 2MH2A 2BY0A 3A4CA 3K4BA 2Z2SB 3HGYA 5F1RA 4M3EA 2CQ7A 4BUPA 1X3WB 1XS9A 3C2GA 3KP5A 5FD5A 1Z0XA 3K4CA 2XAUA 2FU4A 2K7LA 3DQVC 1XSDA 2FJ1A 1U2WA 1FYKA 2GM4A 5FRMA 2DOEA 2CG4A 1JGGA 1R36A 2LY9A 4RGUA 2ZMEC 5ILSA 4DZPA 1WPKA 3LSRA 2VBWA 1EKEA 5J40A 3F9KA 1B1BA 2BOLA 2JSPA 5CKTA 4S05A 1EA3A 1AWCA 3SZTA 1Z1DA 2VJIA 2PG4A 4C2UA 2X4HA 3DPUA 1TT5B 3PM1A 2UWMA 2EINH 3L9FA 3TOAA 1DGRM 4HX4A 3V42A 2MLKA 4I2OA 1GXQA 1OLTA 3CUQA 1Z67A 3WTTC 1IG7A 2CV1A 4RGSA 2CQNA 4M3FA 2RGVA 5LD2C 3QQAA 2M1BA 3EUAA 1JJ8C 1KYWA 4R1HA 2O6GE 2MABA 2H6CA 1KU3A 3GWZA 2WAQA 3SEQA 1UAAA 2KZVA 2XAGA 3PFYA 3JAMZ 3DKXA 4IX7A 1H8AC 3ZMZA 5J4YA 4XMYA 1W7PD 1T8IA 1HSTA 4BY1J 4NC8A 2EFWA 2IXSA 4A3GJ 4FHTA 4RB0A 2IGMA 1IZ1A 3E0JB 1MBFA 3COAC 1GT0C 4P55A 1HDPA 2HOSA 4B4CA 3KEOA 1TLHB 3GXOA 2VKEA 4EJOA 2GIZA 2BEOA 4ZH4F 2BVLA 4JX5A 3BR5A 2EFOA 2FMYA 5EEHA 2AS5F 2X48A 1R5HA 3U9GA 4NC6A 1FBQA 1ZH5A 2AXLA 1JUPA 4PFOA 2BGCA 1WSUA 3WE2A 1LVAA 5AIPA 1GDTA 3SHFA 1I3AA 3CCMI 4A3FJ 1NK2P 1MMSA 2QZ8A 1ZGAA 4CCNA 1FMWA 5H20A 1VQNI 2EZLA 3OYEA 3GF2A 1S7EA 4S0HB 3FISA 5B66C 2VOOA 2OQGA 2ZJRF 4U0VA 1JI8A 3LSHA 5DM7F 1W7PB 2K86A 4HF0A 2ZJQF 1JKQC 4CGZA 2LR8A 3T8TA 4CCLA 3B6AA 1LDJA 1BJAA 2KQRA 3K7AJ 1IXSB 2VBZA 5CJ9A 3L7WA 4HZFA 2VLAA 3TW7A 1Q1VA 4BQAA 4V2GA 1A6IA 2G0EA 2GIVA 4ENMA 5LBQA 4BKXA 1LFUP 4Q48A 3T5XA 4DW6A 1IN7A 3BG9A 4X1EA 1T98A 2M3AA 1TWAJ 3K70C 2M0CA 2XASA 1ZG1A 1SFUA 1SVLA 2VQHA 1A31A 2E2JJ 2K9LA 1XB4A 2R7XA 1OPCA 3S15J 2ISYA 2L4AA 3KEYA 3CCRI 2A5WA 4RGRA 2VJ4A 5GTIC 2HKXA 2XAQA 3BPVA 4MQ9F 4BEHB 4P1WA 3JW4A 4BQQA 1ZYRF 1OYIA 1EH8A 5CVJA 1YW9A 2CH0A 1ZGWA 5CYVA 3SYTA 2O8KA 3OYIA 3GFMA 3SFIA 4RA2A 5ED4A 2K4JA 4KUMA 3BR6A 1YRNB 3FX3A 4UB6C 2R7TA 4YRVA 3FXUA 3BCAA 3HUGB 1HKQA 5KCMA 3LSJA 2G7HA 3TEDA 1NK3P 1ZRFA 4A3LJ 3HTUA 5GTHC 2WY8Q 2EWNA 3R6SA 1WJAA 4DIQA 1BW5A 3QOPA 2XB5A 3M07A 1BC7C 1FSEA 1KQ9A 2NS0A 4LMYA 4FX4A 2HOAA 5BOXA 2ZNZA 4XM3A 2V9KA 4HNVA 1D1BA 4DGWB 3HB9A 5FJ8J 1UHSA 2HVSA 1RNLA 5FLMJ 2Z5UA 1Y56A 2KP6A 3WGGA 1YLFA 3G1MA 4A69C 3I4MJ 5E3OA 3O2PE 3VYSB 4C3JJ 2XGXA 3J7AY 3HTSB 3VB2A 4DNCA 2D1HA 2Z99A 1OYYA 2CGPA 1Z7UA 2CU7A 5EEGA 2VJJA 4L0ZB 5BMZA 3TDZC 1IDYA 1YX5A 3P9IA 2DOFA 1IN6A 1X3ZB 4XRSG 1FTTA 2YU9J 1M1EB 2ETHA 2I8DA 5EYRA 2DBBA 2CW0F 3ZQFA 4PSWA 2P7VB 3GBGA 5FD6A 1MZBA 1HSJA 2XC7A 2GXBA 2COMA 2F4MB 1WH5A 1G8XA 2HDWA 3FM5A 4KISA 2Q2EA 2GAUA 2DN0A 5LRRA 5EZGA 1P7IA 1LKXA 4KN7X 1LVKA 5DD8A 1NHAA 2HQNA 2K9NA 4IZZA 3AL0C 2EBIA 3LSKA 2VJ5A 3RQIA 1U0JA 2CJJA 3E97A 2JSCA 5CLSA 4E7JA 4B48A 1YFHA 2DCEA 2L7FP 4DYQA 3H92A 4A3CJ 2DFFA 1XSXA 3DXJF 1BOBA 3LNQA 1T6SA 2TCTA 3KYLA 4CSWA 1K78B 5D4RA 3K69A 2RVCA 1AA7A 5BQTA 5IPAA 2HNHA 4K2EA 1FP2A 1HKTA 2MBFA 2DMPA 1FYMA 1FSHA 4IHTA 2DYRH 3ZMUA 1XTAA 2IP2A 3HKZA 3CLOA 3WHCA 4U7DA 3KE2A 1JE8A 3ZQLA 2EB7A 2IAIA 4G6TB 1D0XA 4J19A 4D9JA 3WTXC 4YFKF 3DEEA 2PQ8A 3LA2A 4ZYGA 2ZSHB 2NNYA 1LE8A 4ZDOA 3RKWA 4Y17A 3HOVJ 4CYCA 1MKMA 1FPQA 1K6YA 3RPQA 1OCCH 2HYFA 3R60A 3KYDB 1TWHJ 2DXIA 2JRTA 3GUDA 2O5RA 2A3SA 2KJBA 1BOAA 4BJ6C 4UVAA 2ZSIB 3KZZA 4N4OB 3QRFF 3RSNA 4XLCA 1ORKA 1HW5A 3C7JA 4R79A 1OCZH 3NARA 2F5EA 1OJLA 2X9DA 2QQ8A 1LB2A 2XB0X 2XGEA 1OYWA 1LUJB 2JA5J 1DP7P 3U2RA 2HYGD 3IKVA 1Y8QB 4AIDA 4KMUX 1ZR2A 5K7FA 1EV7A 3HOXJ 1RUNA 3KP4A 1MMAA 5LGNA 4M6YA 5E20A 3GZ5A 1S29A 1ZREA 1WJBA 4RGXA 3MFKA 3PL8A 5H6RA 1J0RA 3KEQA 4IRHA 3TO9A 3S14J 5FROA 1RRJA 3A01A 2TDXA 1ZN2A 3BG6A 5E8IA 4G7ZF 3I53A 2KHMA 2MA3A 2K3PA 4M6VA 2OJED 4AVZA 1MMGA 3F21A 4Y7NJ 3HPGA 5TGTA 3F23A 4J01A 4I6ZA 2HKOA 4YIFA 2VC1A 4KMFA 2ZKZA 2Y31A 1MBEA 4DBRA 1DP3A 4A3KJ 1DPUA 2LREA 2EZHA 4LIUA 5ICFA 1U5TB 3RYPA 2XKPA 4C2MJ 1X1PA 2V6EA 4L9JA 1ZKGA 3HRMA 3MWMA 3NWTA 5M5WJ 2E1MB 1F9NA 2DFIA 4QLCU 2XDVA 1I3QJ 2R5YB 2UXNA 1R5ID 1S7OA 2M8EA 1MJAA 4IQJA 2CV2A 2XIGA 3HHGA 3L1PA 1SD4A 1BL0A 4L9VA 1XMAA 2VT3A 2JWTA 1HA8A 3D0SA 4IEJA 4QIWN 1WQ2A 3CMEI 5AONA 4D0PA 4PJLA 3IRRA 1BIBA 4E7LA 2VUMJ 3I5UA 4EGYA 3KX2A 1RETA 3O3KA 2V1NA 4PZJA 2LC2A 3EETA 4IO9F 2RNJA 4EJVA 2M2EA 1YI2I 1WJCA 5D5UB 3FZVA 4B44A 2OC6A 5JLWA 4MTEA 5CVIA 4A5MA 4BL0B 1ZELA 1UZCA 2OZ6A 2JT1A 2EIKH 4UUVA 4Y33A 5A2QK 2LBFA 5TISC 3GTKJ 1LEAA 2RKHA 4RM3A 5AIQA 2R7SA 3UKGA 2QQBA 2O7OA 4WWCA 3CUQC 3WG9A 3OSFA 2NXNB 1V55H 4M73A 1MDMA 4FISA 1VQ4I 2O9LA 4E7ZA 3RJPA 1O7FA 2H8WA 1JTXA 3BZKA 1HXDA 3FBNB 2QBYB 3OR1C 1IV8A 1LFBA 1X1BA 5L3DA 5K5RA 1T0FC 2LY1A 2WB1N 3VPRA 2HGCA 4G8XA 4JX4A 4D5FA 2ZNYA 1RIOH 3WU1B 3VYRB 3VWBA 5IP7J 4HLXA 3SZPA 1MNMC 3J7ZI 1P7JA 2VKHA 3MCZA 3BTCA 1YW8A 3CUOA 3A0BC 1USSA 2XF7A 4YIIA 5F64A 1BR4A 2ME0A 3T8RA 2FBIA 2UZKA 3W6VA 4CZCA 2ADUA 4KNYA 1MBKA 2DW4A 4ENJA 5HNFA 2EPFA 1YG2A 3WTYC 4BYYA 2L7KA 2J5OA 2Z1DA 3HSFA 3RYRA 2XPWA 4IKFA 4UHTA 1D8KA 3M8FA 5DDGA 4CHUA 3JR9A 3S1MJ 5DCFA 3RDIA 4DQ2A 1BJZA 2QGUA 2DMUA 1QQIA 3WODF 4HNTA 3J81K 2H27A 2MC3A 2UXXA 4V19K 2XPUA 2KDZA 1BBYA 2CUJA 2XGDA 2MH9A 2X6YA 2FOWA 4Q5SF 3H5NA 1OCOH 3S2HJ 2HWVA 3IAS2 3VSKA 5B5EC 1XGOA 1R22A 3CP8A 3OOPA 5KNLA 4XKBA 4EJTA 1NG6A 1X4PA 1RR8C 3BR2A 2RV8A 2P81A 4A12A 2NVTJ 1E3OC 4I0BA 1XGMA 4LB6B 3AG3H 2NS8A 2XF5A 2Q8KA 3ZMTA 2QEXI 3KLNA 1JJ6C 3PNVA 5B1AH 3QYEA 2G7UA 1T38A 3MEXA 1IN5A 1VF9A 1W36D 4IJAA 3BG3A 1RKWA 1YJNI 2STWA 3RQ4A 5FKLA 3S32A 3S2WA 2QM3A 3GMEA 3HSRA 5HLIA 1YQAA 1UJ8A 3LAPA 5DD4A 4OMZA 4CXFA 4RB3C 1XC5A 4G6QA 3DWLE 4DYRA 4HSTA 4G7OF 4BACA 2R7OA 2ZBKA 5IOZA 2FRHA 1H9TA 5A2QZ 2CW8A 1J5YA 5D6EA 2L3DA 1YW7A 2Q0OA 4NBQA 3AAFA 2E1NA 2BW3B 3BTIA 4ZDPA 5J3LA 1X1DA 1BR2A 4EM2A 1XMKA 1XGSA 3K1PA 2LYCA 4IQ4A 2M4GA 1E17A 2XAJA 4EM0B 1JKRC 5DV5A 5JHFA 2P6TA 1UMQA 1ZARA 1YO5C 4CICA 1U8RA 2O8XA 3W6JB 1FLIA 2P4WA 4HX7A 2E1CA 1YE9A 2LLKA 2QA4I 1WJFA 1YS7A 3BCBA 3Q0UA 5FGMA 3CC4I 1USTA 5FLXZ 5C3EJ 1QU3A 3H0DA 3GZ6A 2L9NA 2M4KA 1ZR4A 4IHWA 3WTZA 1JT6A 3I58A 1YYVA 3QU3A 2A68F 2FSWA 1S8NA 2X0LA 3OL3A 3IAM2 3ML6A 4O5VA 3BG7A 4CCKA 2ZB9A 3DU6A 1S5LC 1ODDA 3SDBA 2C6YA 2P8TA 4JP0A 2XROA 2KPMA 2PJRB 3CCYA 5HNHA 3IH4A 2JA6J 2K85A 1BM9A 1TL8A 4A0XA 1MSEC 1V4RA 2RC4A 2Z16A 1Z6RA 2DTZA 2XF6A 1IXCA 1MBGA 5J1UA 1SVOA 1B72A 3WTSC 4LK0F 4E7IA 2QKLB 1W7PA 3FM3A 3E7LA 3IH3A 5CPRB 2PJPA 3ISPA 2IS4A 1AU7A 3KP7A 4M6XA 3HGGA 2W48A 5M5XJ 3OS1A 5JVGF 1FEXA 2YPRA 2HOTA 1RKTA 5M5YJ 4Y15A 3REOA 2ZJPF 5C44J 1H9GA 2L7ZA 4C30A 2HYJA 3CCUI 4XONA 4UV9A 1MH3A 2PMHA 5GAHJ 4BJ5C 4Y13A 2Y9ZA 5IP9J 4AD9A 3K6GA 1PUFA 1HOMA 3OWTA 2HVQA 4GYGA 3MKYB 5B1BH 4ZYDA 1W0TA 1ONVA 1R6RA 4B43A 2WTEA 4E4HA 5H2FC 4E6KG 4ZTJA 1BA5A 1B4AA 1IC8A 3ELKA 1KONA 4ESFA 1FX7A 2R7DA 3JRAA 4XORA 2JN6A 1TTYA 2H1KA 2VPLA 2B7EA 5D5XB 2JRMA 2CMPA 1ETWA 3HUGA 2V4JC 3ZRGA 3BTJA 5L3GA 3FHZA 2R7UA 2V26A 4F93B 1JT0A 1GXPA 1W5CC 3QOEA 1T08B 1F43A 1MGTA 2HFHA 4BE0A 4ENKA 4Q4ZF 1JGSA 3AL0B 4XL9A 1ZAOA 1N25A 4XNFA 3L2RA 1XN7A 3BDDA 3DLLF 2W1OA 1VQ5I 3ABKH 4I7HA 5E3LA 3RKQA 2L01A 2KISA 4U87A 5IT3A 4XRFA 3ECHA 2IW5A 4YELA 1T39A 3E6CC 5ILUA 4UB8C 5HVQC 3Q9SA 1NTCA 1T0FA 3GCMA 1L0OC 2EIJH 2W00A 3F8MA 1EH6A 1C0WA 4OOIA 1KU7A 2DA7A 2LKPA 4XRSA 1IV6A 2K4BA 3D1NI 1K6OA 2B63J 3QPSA 3GW2A 3PQJA 3V7RA 1K7AA 1B59A 2LRDA 4LGWA 1TQIA 1P4WA 2WAFA 4D5CA 1TWFJ 3MZYA 2EA2A 3TO6A 5HDKA 3WE3A 1YHQI 1R1VA 2WB1A 4ZJZA 1TQPA 2XRNA 4DYCA 3DP7A 4XBFA 1WVRA 3PUBA 2FX0A 2KIUA 1FWZA 3ASNH 1E3HA 1FIAA 2FMLA 3G1OA 3OYKA 3V7SA 4H4KC 3Q9VA 2A6HF 4WF2A 3JRGA 3PQKA 5LEJA 2HVRA 4UY8I 3E6BA 5K7HA 3HPHA 1O3TA 2Y48A 3E5XA 1PYVA 1D8JA 2LVSA 1APLC 3GTMJ 3E6DA 4HQEA 4LB5A 2PI0A 2VT2A 2F5CA 3ZQCA 3KP3A 1EF4A 1HC8A 2KLOA 3J80Z 2QUFA 2Z33A 3HL2A 3PFIA 5E18F 3F72A 2P0WA 4AU7A 5F04A 3RZDJ 3R4KA 1CF7B 5F0HA 3L2UA 3H1CA 1IUFA 4F55A 1BI2A 1MNEA 3HRTA 4DBQA 3N97A 2R93J 1CGPA 3RI4A 1MJ9A 1Y0NA 4NUBA 3V8JA 1S7AA 2ELJA 2V1DA 5FO5A 3MMYB 4I02A 4RBOA 3OS0A 4GGGA 4AIJA 1B6AA 1A04A 2F48A 4LK1F 3BQZA 1FBSA 2JVGA 1Y6IA 2F4OB 3I59A 3SQNA 4EGZA 1VTNC 1YS6A 2HZTA 1KA8A 1S3JA 2XAFA 4KA4A 2R5ZA 1DQUA 2ESHA 3F8CA 5FB2A 2R7WA 3GVAA 2IPQX 2GBYA 1S72I 3CP2A 1QHHD 3MAJA 3PSIA 4XSZF 1E2XA 4B47A 4A3DJ 3OIQA 3W3CA 4BXUA 4A3EJ 4ENNA 1G59A 4IHSA 4EEFG 2LOOA 4ESBA 4BBSJ 3N4MA 4RB1A 1VQLI 3ABLH 2LNBA 2KDOA 2DI3A 4BU2A 4EJWA 5DEQA 2O03A 3A03A 2HS5A 3DTIA 5J4VA 1R58A 3CQZJ 2DO7A 3QYFA 4H0EA 1B8IB 3DU5A 5TJJA 4EJUA 4L18B 5IT9K 2HR3A 1FY7A 3A0HC 3I56I 4OWRB 1O3QA 2DODA 3GTLJ 2VXDA 2DT7B 3QPHA 4FTHA 5FKOA 3ZCOA 2IS1A 2VKDA 2O3FA 3HIFA 1U3EM 2NS7A 3TQNA 4MEXF 1G4DA 2WY7Q 4HBLA 4LIVA 1HF0A 3FKJA 4HEA2 3QPLA 3M1CA 5J1YA 5D5VB 3JREA 3A2KA 2DDAA 5C4XJ 3IV5A 1DDNA 1GVDA 4RLFA 3ZN0A 1U5TA 3Q5FA 1P4AA 4HQMA 1OKRA 3H35A 4A3IJ 2V9PA 3GZNB 2YX7A 2DK8A 2HDDA 4OU0A 3FF5A 1QVUA 4QWQA 2EFNA 4HNUA 5J8CA 2R5YA 3DPTA 3BQYA 1QNTA 2BY1A 4LLGF 4ESJA 3RZOJ 2ZXWH 3H36A 3S8PA 1ZG5A 1SD5A 3EUHC 1JUMA 1XD7A 5EF6A 5ICEA 2VONA 4CZZA 3H9JA 5BS6A 4WXCA 4UV8A 3SXYA 2MD0A 4WK8F 5FRNA 3ASOH 2PLYA 2R0QC 2IGNA 4I99C 3CDIA 2OCCH 5E3MA 3QPTA 1SFXA 2K9MA 1POGA 2PEXA 1ETXA 3TP0A 1BI1A 2HQ5A 4DJAA 2CO5A 5L3CA 1HW2A 4GDFA 1V5EA 3KCCA 2RN7A 4XN0A 3QP5A 1DU0A 2E60A 3EDPA 4BGDA 4U0YA 5CVVA 3UNGC 3H3VK 3ZMDA 3K2AA 3D5LA 5FLVA 1UHMA 3DTKA 3HYIA 5HOOA 3BP8A 2R7QA 4CDGA 4CCOA 5HLHA 4HDVA 1B9MA 2Z3YA 1FOXA 2FNPA 1HCRA 1OFCX 3RTRA 4GRIA 5CVRA 1DGWY 4CYDA 3FMQA 2FBHA 4G7HF 1R71A 2QBYA 3FDYA 4RLQA 2VC0A 3I0TA 1SC7A 2B0LA 3C2BA 1TQMA 1SMYF 3HRUA 2YS9A 4JQFA 4E70A 4ZYAA 5K1YA 1P2FA 3BR1A 1J75A 4PFPA 1MIJA 4HYEA 5EDNA 4RDUA 3WU0A 1LPQA 3VOEA 1A35A 2CYYA 3HG9A 3P9CA 4GXOA 4ZDLA 3OMYA 4ZYEA 2A69F 3OOUA 4LD5A 4LITA 2NNNA 1IXRC 4UUSA 1N78A 4FQGA 2MG4A 2X1CA 2CUEA 3K4JA 4XOTA 3S93A 4CA0A 2DJNA 1SFKA 3DEWA 2R7RA 4OINF 1P9QC 3OR2C 3F6OA 1E3PA 1ZRDA 1IRZA 2DQLA 2VE9A 2X1DA 1IAWA 2ESNA 3CMAI 1BR1A 3BLYA 4AVPA 1KU9A 3OL4A 1VQ7I 1CQTA 2W85A 2OCEA 4KIGA 4DZJA 5IT9Z 3KYCB 4HOBA 4IHYA 5EEAA 2Y69H 1IUYA 2RQQA 3CO6C 1J59A 1IO2A 2V9VA 1BIAA 3TL4X 2E2HJ 3JSPA 1EJ9A 2D45A 3C2HA 5GAEJ 2Y9YA 3GTQJ 1SEUA 1ZK8A 2OQRA 1WJDA 2ZJ2A 3R0AA 1U78A 3CJQB 3TMOA 3RIRA 1Y8RB 2TRTA 4M71A 1UFMA 4C2TA 3QWLA 1WWXA 1QRYA 1XG1A 4IPAA 1PJRA 2CRGA 2E7XA 4RAGA 2LKXA 1QGPA 2ECCA 3DKYA 1O4XA 2R7FA 2DA4A 2OA4A 4U0WA 4JBAA 1P4XA 3M4OJ 3BJ6A 4WXHA 5TRDA 1IW7F 5F0FA 4HPQA 1V5GA 3FHNA 3VYTB 1ETQA 3WTVC 1ZQ3P 3ABMH 3BR3A 4UVCA 3DKWA 3KZYA 3G71I 1SFEA 4MNUA 2IJLA 3VFZA 1MJBA 3I64A 4L5JA 3FMSA 5F1JA 1G3YA 3ZN1A 1QA6A 5IY5H 2NVUB 4HA8A 4QPOA 2K40A 2EQRA 1I6HJ 1OQYA 3V7CA 4BBRJ 4NNJA 1RESA 2JVHA 3GTJJ 2VE8A 3CCLI 3OY9A 2HPIA 1ZTRA 3DBRB 5C4JJ 4C3IJ 5IYDJ 5JHUA 1UG2A 4NB5A 1VQ6I 4NDLA 4IHVA 4L0YB 5J6XA 4EQQA 3IP4B 2HDCA 3CC7I 2QSHX 2KMUA 1ZHFA 5K7ZA 5E1ZB 1X19A 1I1GA 3V8LA 1FZPB 2BW3A 4OMYA 2Q2EB 2EFPA 5LGTA 2QVOA 2R4GA 4CO8A 1Z3YA 4XLHA 1ZRCA 4JYKA 2L9RA 1WJEA 2MGQA 3Q0VA 1W5TA 1QZZA 2E7WA 2L9SA 3ZMVA 2EA4A 1SMTA 5CQGA 2WWYA 1MNDA 3G2BA 2STTA 2VKVA 5HDGA 3PSFA 3LMMA 2QSFX 2EH3A 1ETKA 5EG0A 5IOYA 2DFEA 3ZP5A 3HOUJ 2JA2A 3S16J 2LDUA 1LDKB 4FX0A 4V2FA 1JUSA 2BE5F 1KYZA 4KT5C 1SAUA 1UCRA 1Z7LA 2EV0A 2CUZA 2YX4A 1FYLA 4II2A 4CCJA 2R3SA 4M9XA 3GO5A 4BQOA 1KQ8A 1ZLJA 4X0GA 3H5AA 4B3XA 1HW1A 4FCYA 2E2IJ 2PJRA 2FE3A 5DCMB 3ABTA 2OBPA 4M9SA 4BE1A 3G4SI 3IUOA 1JXSA 2P5LC 1FOWA 4B09A 3PO2J 2E5NA 2CS3A 3MQ0A 1YIOA 1VFCA 2CWEA 2F2EA 2ZMEB 1GLNA 3LQQA 2DA6A 3NAUA 4ZZDA 3C18A 4CYCB 1F36A 3ULQB 4A3JJ 1WI3A 2Y0SN 4EVIA 3CJNA 1RPWA 3VODA 2GXGA 1FMVA 1K83J 1ERDA 1O57A 2EZKA 2WADA 4L5IA 1H88C 1DPRA 2X6OA 2A6EF 2M9HA 4M3GA 2VPRA 2GLOA 1ON2A 2MC4A 4QTRA 2DDBA 5DYMA 1R5GA 3CO7C 2K9QA 2VB6A 2JTVA 5EJCA 3SEZA 3DTEA 4MEYF 1IF1A 2MLGA 4MLOA 4AC0A 4XKWA 3AFHA 3D5SC 3JSOA 3SJMA 4KIBA 3CTAA 2JUGA 3F8FA 2XSDC 2FQ3A 2L02A 1AKHB 1QHGA 2M45A 2E36A 3EUHA 3TGNA 3MKWB 2PMZN 2DMTA 3GTOJ 1X2MA 1LJ9A 2X85A 1XDSA 2OUMA 3BZ6A 3DF8A 1ON1A 1Z05A 1T56A 4U88A 4KN4X 5F08A 1NG7A 4BAYA 1AHDP 2M8GX 2QYOA 4MFEA 4MQVA 1HDDC 4OAZA 4IHXA 4II3A 2KRFA 1VQMI 1OR7C 2MSYA 1J2XA 3SDGA 3IC7A 1BC8C 3ZMSA 1D5YA 4PJ0C 1QPMA 2H94A 2DMNA 1JHFA 3OYLA 1JHHA 3ERMA 1VQ9I 1V5FA 4MIMA 3K0LA 2AXTC 2ZXIA 3W6KB 3K70D 5DM6F 3HEFA 3HDDA 2GWRA 3FBIB 4R8HA 3GYHX 5CQEA 3FXMA 1OISA 4F92B 2XHKA 2DQRA 3OYHA 2R92J 1O3RA 5KK1A 4J00A 1OCRH 1FOYA 2BXZA 2DYSH 3WGHA 4PUSA 4KIFA 5GAGJ 3N05A 3FXKA 3S2DJ 3L2QA 3B02A 2BZTA 2D2WA 3IWFA 3BZCA 1XGNA 2JUCA 2RAEA 4LG3A 3CCVI 2Y2ZA 3L00A 3LSGA 2OD5A 4N0BA 4F91B 3LA3A 4A6EA 1DU6A 1FP1D 4FETA 4W1UA 1ULYA 2A05A 3O8HA 3H3UA 2K27A 1ETOA 2HZDA 1I50J 5F27A 3FXQA 2MFZA 5BPDA 3AG1H 4BDYA 1KZHA 2OZUA 3CJTB 4LLLA 3PIPF 1U5TC 2OV7A 1K79A 3KP6A 1Z3XA 2G9WA 5K5OA 4MTDA 1MD0A 2E1MC 1O7LA 3F0CA 3HZJA 3DBHB 5F0CA 1MDMB 4I01A 3RPUD 2YSRA 2K02A 2DU9A 4HV6A 1VQPI 1Q1HA 3WU2C 2JK3A 1PUEE 1T95A 3OIPA 1OMIA 4IOAF 4XLPF 1R00A 1X1AA 4PJJA 1G3TA 3J81Z 2LSOA 3BT9A 3JRIA 4A6DA 3KIOA 5JLXA 3ZQ7A 2LK2A 3J7AO 2ZXJA 3H0GJ 3VYUB 1UELB 3L2CA 2HEOA 4D7NA 3P7NA 4CCMA 1I1SA 4OIQF 2CFXA 1R1UA 4A5NA 4YIRX 4BJTA 3KP2A 1VQ8I 4I09A 3DCFA 5LLQA 4M3BA 1F5TA 1CF7A 1D1AA 3ZR8X 1ZGJA 2ICWG 3CCQI 4BDZA 1LDDA 2M87A 2EILH 4P9UA 1U9NA 4GO1A 4Y52J 2EFQA 2D1VA 4HAMA 1JKOC 4Z6YA 3G6EI 4I0AA 2HPMA 5HS7A 3I55I 5EGOB 3L2WA 4S04A 4BEHA 1Z91A 3LQRA 1UB9A 1VI0A 2VBXA 5D4SA 1U6GA 2HXIA 2N8GA 1WH7A 2R7ZJ 2JJ7A 3S1RJ 3MKZA 2KFDA 3CD6I 2GXAA 3HC7A 2E1OA 3S3OA 4RB2C 1YRNA 4XOPA 3I3LA 3JTGA 3PNYA 2IT0A 4HRIA 3S1NJ 1Z77A 4I98B 5LHGA 2VQLA 3V4GA 3CMYA 1J7KA 1H89C 4RMNA 2F5VA 4ANJA 3V8KA 2M0MA 2XPVA 1FT9A 4C3HJ 2K3FA 2NAZA 4N4NB 2DLLA 1B8IA 3TKYA 2YUSA 1E0EA 1X3UA 2P6SA 5BPIA 1R4NB 3CJRB 3ESWB 3CDLA 3M9AA 2QQAA 4AWXB 3EPZA 5M3MJ
chains in the Genus database with same CATH topology
4A3KJ 3I4NJ 1HF0A 2ME6A 2EZHA 3QPLA 5J1YA 1GUUA 4C2MJ 3JREA 5C4XJ 1IJWC 1FTZA 3IV5A 1GVDA 4D7MA 1ZKGA 2AHQA 5M5WJ 4W97A 3FIWA 4A3IJ 1I3QJ 1W0UA 2R5YB 2E19A 4A93J 1A5JA 2LD5A 2HDDA 1QVUA 4A3MJ 3JRFA 2R5YA 3BQYA 3L1PA 1BL0A 3RZOJ 3MN2A 2LTPA 3OIOA 2M34A 2JWTA 3O8GA 4IEJA 4QIWN 1JUMA 5EF6A 4FE4A 1Y1WJ 2VUMJ 1Y1VJ 1RETA 4UUTA 1BW6A 2QF7A 3G1LA 2M2EA 4ABZA 2R0QC 5IYBJ 5JLWA 4XIDA 3BTLA 5E3MA 1POGA 3B6CA 1ETXA 2IBDA 3TP0A 2HQ5A 3GTKJ 2DMQA 3TP3A 3ZOBA 2XRLA 1VNDA 3UKGA 1DU0A 1IGNA 2O7OA 5HODA 5EG0B 3OSFA 3H3VK 2O9LA 4FISA 3ZQHA 3K2AA 5FLVA 1TWCJ 3IH2A 3HBLA 1JTXA 5GPCA 2LP0A 1HCRA 1OFCX 1LFBA 2DA1A 4JX6A 4D5FA 2WB1N 3VPRA 4JX4A 3GTGJ 1G2HA 1U9OA 3MVPA 5E3NA 5IP7J 2FQ4A 1MNMC 1P7JA 3C2BA 1B72B 3LOCA 3HM5A 1HLVA 1WCMJ 2YS9A 1R9TJ 3BTCA 3LSPA 3BR1A 2ME0A 5EDNA 4RDUA 5FKMA 3W6VA 3A02A 1MBKA 5GPAA 3OOUA 4UUSA 4XICA 1ETVA 4AUXA 2MG4A 1TWGJ 2DA2A 2CUEA 3HKZN 2DJNA 3HOYJ 3DEWA 2OPTA 2XPWA 9ANTA 1IRZA 1TC3C 3JR9A 5M3FJ 3JRDA 3S1MJ 1CQTA 4DZJA 1BJZA 2DA3A 2DMUA 4IHYA 2XPUA 5EEAA 2KDZA 1PUFB 2XGDA 3HGYA 4B3AA 1K61A 2ELKA 4M3EA 4XRMA 2E2HJ 3S2HJ 2D5VA 4L5EA 2Y9YA 2MW8A 1XS9A 1FJLA 3GTQJ 1ZK8A 2DA5A 3FK6A 1Z0XA 2JA8J 1U78A 3BR2A 2P81A 2FJ1A 2TRTA 2NVTJ 1E3OC 4GFBA 2GM4A 1JGGA 1QRYA 1XG1A 2CQXA 2NS8A 2CRGA 2LY9A 2LKXA 2ECCA 2LFBA 4DZPA 1O4XA 1JJ6C 1WPKA 2NVQJ 3LSRA 2DA4A 2OF7A 2ID6A 1GV5A 3M4OJ 1VF9A 3BG3A 3WHBA 1RKWA 5F0FA 1ETQA 1ZQ3P 5FKLA 1RR7A 3BR3A 4QSHA 5F1JA 3PM1A 4AYBN 2K40A 2EQRA 1I6HJ 1XC5A 4BBRJ 3GTJJ 1RESA 1IG7A 4DYRA 4BY7J 1ZTRA 4M3FA 5C4JJ 4C3IJ 5IYDJ 5IOZA 1GV2A 1UG2A 2HI3A 3QQAA 1JJ8C 4NDLA 4IHVA 2H8RA 3BTIA 1H8AC 5J3LA 5DTDA 5K7ZA 5DS9A 5FKKA 1MBJA 1T33A 4BY1J 1JKRC 2L0KA 4A3GJ 2JA7J 1UMQA 1MBFA 1GT0C 4JYKA 2L9RA 2MGQA 1HDPA 3Q0VA 2HOSA 4B4CA 2Y30A 2VI6A 2VKEA 2KT0A 1JTYA 2LLKA 3MKLA 2VKVA 3Q0UA 4JX5A 3BR5A 1WGXA 5C3EJ 2X48A 1ZR4A 2EH3A 4IHWA 1ETKA 1MBHA 1JUPA 5EG0A 5IOYA 2I10A 1JT6A 1GDTA 3ZQIA 1QPIA 3HOUJ 4A3FJ 3S16J 4V2FA 1JUSA 1NK2P 2ZB9A 2EZLA 4S0HB 1S7EA 4JP0A 3FISA 3CCYA 3IH4A 2JA6J 1MSEC 3PO3J 2DTZA 4FCYA 2E2IJ 1SANA 3S17J 1MBGA 5J1UA 1JKQC 1B72A 2ECBA 2LR8A 3B6AA 3PO2J 3E7LA 3IH3A 3FK7A 3K7AJ 3TW6A 1VFCA 1MSFC 2HXOA 3TW7A 1JKPC 1Q1VA 4X6AJ 4V2GA 1AU7A 2DA6A 3NAUA 1A6IA 2G0EA 3HGGA 2W48A 1F36A 5M5XJ 4CYCB 1WI3A 2Y0SN 1X2NA 4BKXA 4A3JJ 1FEXA 1LFUP 2HOTA 1RPWA 1RKTA 5M5YJ 4DW6A 1K83J 5C44J 2L7ZA 2EZKA 3BG9A 2HYJA 1H88C 4X1EA 1TWAJ 2X6OA 2M0CA 2WV1A 4I76A 2M9HA 4M3GA 1MH3A 2E2JJ 2VPRA 2GLOA 4QTRA 3S15J 2Y9ZA 2EZIA 5IP9J 2K9QA 1PUFA 1HOMA 2ID3A 1W0TA 2R5ZB 4MLOA 4AC0A 1ZGWA 3SJMA 2O8KA 2XSDC 3S1QJ 1AKHB 3SFIA 1SFOJ 1BA5A 3BR6A 1YRNB 1IC8A 3HOZJ 2PMZN 5IYCJ 1AKHA 2DMTA 3JRAA 3GTOJ 1X2MA 2JN6A 1NK3P 3TEDA 2H1KA 3LSJA 4A3LJ 3BG5A 1T56A 5F08A 1AHDP 1ETWA 2M8GX 4MFEA 1HDDC 1BW5A 4IHXA 2XB5A 3BTJA 4BXXJ 2HOAA 2MSYA 1JT0A 3JRBA 3SDGA 4HNVA 1F43A 3OSGA 3HB9A 5FJ8J 1UHSA 1D5YA 5FLMJ 3I4MJ 4LOCA 3G1MA 3ZQGA 4A69C 2DMNA 5E3OA 4C3JJ 4MIMA 5E3LA 3RKQA 1QVTA 3HEFA 3HDDA 2CU7A 1MH4A 1U8BA 1IDYA 4XRSG 5GP9A 1NTCA 2YU9J 2R92J 1FTTA 5EYRA 2DA7A 4XRSA 1IV6A 3ZQFA 3D1NI 3GBGA 2B63J 1OCTC 3QPSA 1X58A 1ITYA 3S2DJ 2NVYJ 1WH5A 5BNGA 3M3YJ 2QCOA 4M3DA 2RAEA 2Y2ZA 3LSGA 1DU6A 2DN0A 4W1UA 5EZGA 1P7IA 4D5CA 2CUFA 3O8HA 1TWFJ 1ETOA 4G12A 2K9NA 1I50J 5F27A 2EBIA 2COBA 3RQIA 2CJJA 4DYCA 2WAQN 2FX0A 1FIAA 2L7FP 4MO7A 4DYQA 3G1OA 4A3CJ 1OCPA 3LNQA 3JRGA 2TCTA 3F0CA 5F0CA 5K7HA 2FD5A 5IPAA 2LVSA 1APLC 2DMPA 3GTMJ 2JK3A 4B1RA 3ZQCA 4MFDA 3HOWJ 1EF4A 3BT9A 3WHCA 3JRIA 3ZQLA 1FIPA 2IAIA 3Q0WA 3Q3SA 5JLXA 5IP6A 1LE8B 4J19A 2LK2A 3H0GJ 2L7MP 4D7NA 5F04A 3RZDJ 1LE8A 5J1RA 2CQQA 5F0HA 1IUFA 3HOVJ 4FE7A 4CYCA 3DCFA 5EZHA 2R93J 4M3BA 3GTPJ 1TWHJ 2JMWA 2IEKA 4UUSB 1U9NA 4Y52J 4RBOA 1IDZA 1ORKA 1JKOC 3BQZA 5EGOB 3NARA 1OJLA 2AO9A 2X9DA 2XB0X 2XGEA 1VI0A 2R5ZA 2JA5J 5EGOA 2K9SA 2HXIA 2NVXJ 2GBYA 1WH7A 2N8GA 1ZR2A 2R7ZJ 2JJ7A 3JRHA 4A3DJ 5K7FA 3S1RJ 4A3BJ 3HOXJ 4A3EJ 1ETYA 2E1OA 4EEFG 1YRNA 3A01B 5FKNA 4BBSJ 3S14J 4XK4A 3S1NJ 3A01A 1ENHA 3A03A 1Z77A 3BR0A 3CMYA 2XGCA 4M6VA 3CQZJ 1H89C 1B8IB 2NOGA 4Y7NJ 2XPVA 3GTLJ 4C3HJ 4FTHA 1B8IA 3FKIJ 5FKOA 3JRCA 2YUSA 4I6ZA 3CDLA 5M3MJ 2Y31A 1MBEA 2NS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3K J;  3I4N J;  1HF0 A;  2ME6 A;  2EZH A;  3QPL A;  5J1Y A;  1GUU A;  4C2M J;  3JRE A;  5C4X J;  1IJW C;  1FTZ A;  3IV5 A;  1GVD A;  4D7M A;  1ZKG A;  2AHQ A;  5M5W J;  4W97 A;  3FIW A;  4A3I J;  1I3Q J;  1W0U A;  2R5Y B;  2E19 A;  4A93 J;  1A5J A;  2LD5 A;  2HDD A;  1QVU A;  4A3M J;  3JRF A;  2R5Y A;  3BQY A;  3L1P A;  1BL0 A;  3RZO J;  3MN2 A;  2LTP A;  3OIO A;  2M34 A;  2JWT A;  3O8G A;  4IEJ A;  4QIW N;  1JUM A;  5EF6 A;  4FE4 A;  1Y1W J;  2VUM J;  1Y1V J;  1RET A;  4UUT A;  1BW6 A;  2QF7 A;  3G1L A;  2M2E A;  4ABZ A;  2R0Q C;  5IYB J;  5JLW A;  4XID A;  3BTL A;  5E3M A;  1POG A;  3B6C A;  1ETX A;  2IBD A;  3TP0 A;  2HQ5 A;  3GTK J;  2DMQ A;  3TP3 A;  3ZOB A;  2XRL A;  1VND A;  3UKG A;  1DU0 A;  1IGN A;  2O7O A;  5HOD A;  5EG0 B;  3OSF A;  3H3V K;  2O9L A;  4FIS A;  3ZQH A;  3K2A A;  5FLV A;  1TWC J;  3IH2 A;  3HBL A;  1JTX A;  5GPC A;  2LP0 A;  1HCR A;  1OFC X;  1LFB A;  2DA1 A;  4JX6 A;  4D5F A;  2WB1 N;  3VPR A;  4JX4 A;  3GTG J;  1G2H A;  1U9O A;  3MVP A;  5E3N A;  5IP7 J;  2FQ4 A;  1MNM C;  1P7J A;  3C2B A;  1B72 B;  3LOC A;  3HM5 A;  1HLV A;  1WCM J;  2YS9 A;  1R9T J;  3BTC A;  3LSP A;  3BR1 A;  2ME0 A;  5EDN A;  4RDU A;  5FKM A;  3W6V A;  3A02 A;  1MBK A;  5GPA A;  3OOU A;  4UUS A;  4XIC A;  1ETV A;  4AUX A;  2MG4 A;  1TWG J;  2DA2 A;  2CUE A;  3HKZ N;  2DJN A;  3HOY J;  3DEW A;  2OPT A;  2XPW A;  9ANT A;  1IRZ A;  1TC3 C;  3JR9 A;  5M3F J;  3JRD A;  3S1M J;  1CQT A;  4DZJ A;  1BJZ A;  2DA3 A;  2DMU A;  4IHY A;  2XPU A;  5EEA A;  2KDZ A;  1PUF B;  2XGD A;  3HGY A;  4B3A A;  1K61 A;  2ELK A;  4M3E A;  4XRM A;  2E2H J;  3S2H J;  2D5V A;  4L5E A;  2Y9Y A;  2MW8 A;  1XS9 A;  1FJL A;  3GTQ J;  1ZK8 A;  2DA5 A;  3FK6 A;  1Z0X A;  2JA8 J;  1U78 A;  3BR2 A;  2P81 A;  2FJ1 A;  2TRT A;  2NVT J;  1E3O C;  4GFB A;  2GM4 A;  1JGG A;  1QRY A;  1XG1 A;  2CQX A;  2NS8 A;  2CRG A;  2LY9 A;  2LKX A;  2ECC A;  2LFB A;  4DZP A;  1O4X A;  1JJ6 C;  1WPK A;  2NVQ J;  3LSR A;  2DA4 A;  2OF7 A;  2ID6 A;  1GV5 A;  3M4O J;  1VF9 A;  3BG3 A;  3WHB A;  1RKW A;  5F0F A;  1ETQ A;  1ZQ3 P;  5FKL A;  1RR7 A;  3BR3 A;  4QSH A;  5F1J A;  3PM1 A;  4AYB N;  2K40 A;  2EQR A;  1I6H J;  1XC5 A;  4BBR J;  3GTJ J;  1RES A;  1IG7 A;  4DYR A;  4BY7 J;  1ZTR A;  4M3F A;  5C4J J;  4C3I J;  5IYD J;  5IOZ A;  1GV2 A;  1UG2 A;  2HI3 A;  3QQA A;  1JJ8 C;  4NDL A;  4IHV A;  2H8R A;  3BTI A;  1H8A C;  5J3L A;  5DTD A;  5K7Z A;  5DS9 A;  5FKK A;  1MBJ A;  1T33 A;  4BY1 J;  1JKR C;  2L0K A;  4A3G J;  2JA7 J;  1UMQ A;  1MBF A;  1GT0 C;  4JYK A;  2L9R A;  2MGQ A;  1HDP A;  3Q0V A;  2HOS A;  4B4C A;  2Y30 A;  2VI6 A;  2VKE A;  2KT0 A;  1JTY A;  2LLK A;  3MKL A;  2VKV A;  3Q0U A;  4JX5 A;  3BR5 A;  1WGX A;  5C3E J;  2X48 A;  1ZR4 A;  2EH3 A;  4IHW A;  1ETK A;  1MBH A;  1JUP A;  5EG0 A;  5IOY A;  2I10 A;  1JT6 A;  1GDT A;  3ZQI A;  1QPI A;  3HOU J;  4A3F J;  3S16 J;  4V2F A;  1JUS A;  1NK2 P;  2ZB9 A;  2EZL A;  4S0H B;  1S7E A;  4JP0 A;  3FIS A;  3CCY A;  3IH4 A;  2JA6 J;  1MSE C;  3PO3 J;  2DTZ A;  4FCY A;  2E2I J;  1SAN A;  3S17 J;  1MBG A;  5J1U A;  1JKQ C;  1B72 A;  2ECB A;  2LR8 A;  3B6A A;  3PO2 J;  3E7L A;  3IH3 A;  3FK7 A;  3K7A J;  3TW6 A;  1VFC A;  1MSF C;  2HXO A;  3TW7 A;  1JKP C;  1Q1V A;  4X6A J;  4V2G A;  1AU7 A;  2DA6 A;  3NAU A;  1A6I A;  2G0E A;  3HGG A;  2W48 A;  1F36 A;  5M5X J;  4CYC B;  1WI3 A;  2Y0S N;  1X2N A;  4BKX A;  4A3J J;  1FEX A;  1LFU P;  2HOT A;  1RPW A;  1RKT A;  5M5Y J;  4DW6 A;  1K83 J;  5C44 J;  2L7Z A;  2EZK A;  3BG9 A;  2HYJ A;  1H88 C;  4X1E A;  1TWA J;  2X6O A;  2M0C A;  2WV1 A;  4I76 A;  2M9H A;  4M3G A;  1MH3 A;  2E2J J;  2VPR A;  2GLO A;  4QTR A;  3S15 J;  2Y9Z A;  2EZI A;  5IP9 J;  2K9Q A;  1PUF A;  1HOM A;  2ID3 A;  1W0T A;  2R5Z B;  4MLO A;  4AC0 A;  1ZGW A;  3SJM A;  2O8K A;  2XSD C;  3S1Q J;  1AKH B;  3SFI A;  1SFO J;  1BA5 A;  3BR6 A;  1YRN B;  1IC8 A;  3HOZ J;  2PMZ N;  5IYC J;  1AKH A;  2DMT A;  3JRA A;  3GTO J;  1X2M A;  2JN6 A;  1NK3 P;  3TED A;  2H1K A;  3LSJ A;  4A3L J;  3BG5 A;  1T56 A;  5F08 A;  1AHD P;  1ETW A;  2M8G X;  4MFE A;  1HDD C;  1BW5 A;  4IHX A;  2XB5 A;  3BTJ A;  4BXX J;  2HOA A;  2MSY A;  1JT0 A;  3JRB A;  3SDG A;  4HNV A;  1F43 A;  3OSG A;  3HB9 A;  5FJ8 J;  1UHS A;  1D5Y A;  5FLM J;  3I4M J;  4LOC A;  3G1M A;  3ZQG A;  4A69 C;  2DMN A;  5E3O A;  4C3J J;  4MIM A;  5E3L A;  3RKQ A;  1QVT A;  3HEF A;  3HDD A;  2CU7 A;  1MH4 A;  1U8B A;  1IDY A;  4XRS G;  5GP9 A;  1NTC A;  2YU9 J;  2R92 J;  1FTT A;  5EYR A;  2DA7 A;  4XRS A;  1IV6 A;  3ZQF A;  3D1N I;  3GBG A;  2B63 J;  1OCT C;  3QPS A;  1X58 A;  1ITY A;  3S2D J;  2NVY J;  1WH5 A;  5BNG A;  3M3Y J;  2QCO A;  4M3D A;  2RAE A;  2Y2Z A;  3LSG A;  1DU6 A;  2DN0 A;  4W1U A;  5EZG A;  1P7I A;  4D5C A;  2CUF A;  3O8H A;  1TWF J;  1ETO A;  4G12 A;  2K9N A;  1I50 J;  5F27 A;  2EBI A;  2COB A;  3RQI A;  2CJJ A;  4DYC A;  2WAQ N;  2FX0 A;  1FIA A;  2L7F P;  4MO7 A;  4DYQ A;  3G1O A;  4A3C J;  1OCP A;  3LNQ A;  3JRG A;  2TCT A;  3F0C A;  5F0C A;  5K7H A;  2FD5 A;  5IPA A;  2LVS A;  1APL C;  2DMP A;  3GTM J;  2JK3 A;  4B1R A;  3ZQC A;  4MFD A;  3HOW J;  1EF4 A;  3BT9 A;  3WHC A;  3JRI A;  3ZQL A;  1FIP A;  2IAI A;  3Q0W A;  3Q3S A;  5JLX A;  5IP6 A;  1LE8 B;  4J19 A;  2LK2 A;  3H0G J;  2L7M P;  4D7N A;  5F04 A;  3RZD J;  1LE8 A;  5J1R A;  2CQQ A;  5F0H A;  1IUF A;  3HOV J;  4FE7 A;  4CYC A;  3DCF A;  5EZH A;  2R93 J;  4M3B A;  3GTP J;  1TWH J;  2JMW A;  2IEK A;  4UUS B;  1U9N A;  4Y52 J;  4RBO A;  1IDZ A;  1ORK A;  1JKO C;  3BQZ A;  5EGO B;  3NAR A;  1OJL A;  2AO9 A;  2X9D A;  2XB0 X;  2XGE A;  1VI0 A;  2R5Z A;  2JA5 J;  5EGO A;  2K9S A;  2HXI A;  2NVX J;  2GBY A;  1WH7 A;  2N8G A;  1ZR2 A;  2R7Z J;  2JJ7 A;  3JRH A;  4A3D J;  5K7F A;  3S1R J;  4A3B J;  3HOX J;  4A3E J;  1ETY A;  2E1O A;  4EEF G;  1YRN A;  3A01 B;  5FKN A;  4BBS J;  3S14 J;  4XK4 A;  3S1N J;  3A01 A;  1ENH A;  3A03 A;  1Z77 A;  3BR0 A;  3CMY A;  2XGC A;  4M6V A;  3CQZ J;  1H89 C;  1B8I B;  2NOG A;  4Y7N J;  2XPV A;  3GTL J;  4C3H J;  4FTH A;  1B8I A;  3FKI J;  5FKO A;  3JRC A;  2YUS A;  4I6Z A;  3CDL A;  5M3M J;  2Y31 A;  1MBE A;  2NS7 A; 
#chains in the Genus database with same CATH topology
 3U1D A;  3CF2 A;  4OIO F;  2ME6 A;  5KAI C;  1FC3 A;  2LY2 A;  1TNS A;  2LMD A;  1F1Z A;  2DAO A;  3DFG A;  4UNO A;  3DBL B;  1YTY A;  2EV5 A;  2AHQ A;  4W97 A;  3FIW A;  4LG0 B;  5B3S H;  3WTU C;  2E19 A;  4A93 J;  1A5J A;  1STZ A;  4P9F A;  2LD5 A;  5K5Q A;  3D5R C;  3E6M A;  4LJZ F;  1LFP A;  4EMS A;  2VIX A;  2VQC A;  4A3M J;  2CV0 A;  3LSM A;  4HW0 A;  5LEK A;  1SVM A;  3IKT A;  3ERE D;  3CF5 F;  5E8G A;  4KIC A;  2M34 A;  2XVC A;  3NWS A;  2F5D A;  2FEZ A;  3O8G A;  1HQC A;  2RNG A;  3M8E A;  1Y1W J;  1Y1V J;  5E17 F;  3B73 A;  4ASN A;  1BW6 A;  1A36 A;  1IN4 A;  1ZLK A;  2QF7 A;  3G1L A;  4M72 A;  4RAY A;  1AOY A;  4PGH A;  4XID A;  5E1X A;  1MMD A;  3HRS A;  3B6C A;  2DJI A;  4EM1 A;  3K4N A;  5JFR A;  4MHG A;  3IRQ A;  2ACJ A;  2DMQ A;  3TDU C;  3TP3 A;  3JCU C;  2HQA A;  3QP6 A;  5ICC A;  1PP7 U;  1PP8 F;  4WX9 A;  2L5Q A;  2P7C B;  3RKY A;  4KDP A;  1RI7 A;  4XR6 A;  5D5W B;  2F4I A;  2W4S A;  1K78 A;  1TWC J;  2A61 A;  3IH2 A;  3HBL A;  1XCB A;  4BHP A;  3K9T A;  3PJR A;  3K4K A;  2LP0 A;  2Y0S A;  2XKO A;  3OYA A;  3DPL C;  4JX6 A;  2DA1 A;  1N77 A;  2X1E A;  2JZY A;  1U9O A;  3MVP A;  5E3N A;  3M7G A;  1X1C A;  4C9Y A;  1B72 B;  3HM5 A;  1WCM J;  2A6T A;  3BC8 A;  1TW3 A;  4HF1 A;  3LSP A;  3FXR A;  2JQ7 A;  2KKO A;  2EV6 A;  4BQN A;  4PCQ A;  3CLQ A;  5FFZ A;  1OR7 A;  3P9K A;  5FKM A;  4FAS D;  1W36 C;  2IS6 A;  5CVU A;  3A02 A;  5D8L B;  2WBM A;  4BS9 A;  5GPA A;  1VQO I;  1K4S A;  3QOD A;  4XIC A;  1R1T A;  1LQ1 A;  2WV0 A;  3KFW X;  1QZY A;  1D0Z A;  3HOY J;  4NQW B;  1SD7 A;  2PMZ A;  3PUF A;  1TC3 C;  1GHC A;  5M3F J;  3JRD A;  2NOJ B;  3TOB A;  2DA3 A;  1XDU A;  3U1K A;  4XQF A;  1PUF B;  2IGK A;  4DOZ A;  4HX8 A;  2UV1 A;  4B3A A;  4CUG A;  1K61 A;  2ELK A;  2GQQ A;  3VSL A;  4GYI A;  3NEU A;  4XRM A;  3MZH A;  3OYM A;  1XSV A;  2D5V A;  3UR3 C;  2Y75 A;  4L5E A;  1FJL A;  2MW8 A;  1Z6T A;  2DA5 A;  2MYS A;  3FK6 A;  4BHC A;  2JA8 J;  1LNW A;  2W84 A;  5KVR A;  2DOA A;  4D1Q A;  4JK1 X;  4BNC A;  4GFB A;  1VZ0 A;  2CQX A;  2E35 A;  2E71 A;  5HLG A;  2VL8 A;  4UXN A;  2ELH A;  2LFB A;  2M30 A;  5D8K B;  2NVQ J;  1FNN A;  2QSG X;  2AQE A;  2OF7 A;  2ID6 A;  2ZC2 A;  2WC2 A;  1GV5 A;  3AG2 H;  2RDP A;  4E7H A;  1RZ4 A;  4HV5 A;  2YU3 A;  1XMX A;  3WHB A;  3DV8 A;  5DUI A;  1KGS A;  1RUO A;  5HLT A;  2X6W A;  1RR7 A;  4QSH A;  3JTH A;  3T0Y A;  4RM2 A;  2CFO A;  4JOM A;  1EH7 A;  2CQK A;  3CUQ B;  4AYB N;  1UG0 A;  2ZFW A;  4LFU A;  2BYV E;  3LFK A;  4BY7 J;  1D1C A;  2DPU A;  2VAS A;  2X6X A;  1H0M A;  1L3L A;  1GV2 A;  2PBI A;  2HI3 A;  2V1U A;  4AIH A;  3J7Y J;  2I5U A;  4IL6 C;  2W7N A;  4IXA A;  2H8R A;  2IA1 A;  3S3N A;  5DTD A;  3CZ6 A;  5DS9 A;  4XLA A;  1T2K A;  5FKK A;  1MBJ A;  2FNA A;  4A0Z A;  4KJZ A;  4F52 A;  1T33 A;  2XV4 S;  4NC7 A;  4IRI A;  2L0K A;  3K10 A;  2DPD A;  2JA7 J;  5KAF C;  1R7J A;  4YFX F;  1A6Q A;  2MD5 A;  2GA2 A;  4G94 A;  2Y30 A;  2VI6 A;  1O3S A;  2KT0 A;  1JTY A;  4LLN A;  3MKL A;  3K1N A;  3C3W A;  4PJN A;  1WGX A;  2ZCW A;  2HTS A;  4XKC A;  1S6L A;  4HG2 A;  1W1W E;  4ZYH A;  1I27 A;  1MBH A;  3R0J A;  2VOP A;  3FMR A;  2I10 A;  3OYF A;  2Y0M A;  2M7A A;  3WTW C;  3F6V A;  4XSX F;  3ZQI A;  1QPI A;  1ZG3 A;  4UVB A;  1I6X A;  3RCO A;  5L3B A;  2LH9 A;  2V79 A;  2V6C A;  3AG4 H;  2FA5 A;  3KLO A;  3ONQ A;  3OYD A;  1W5S A;  3K1M A;  2OAZ A;  4WCG A;  3IWZ A;  2B9S A;  3OS2 A;  4BXF A;  3H3Z A;  2PN6 A;  3PO3 J;  2XAH A;  5GAD J;  2Z9O A;  2L2O A;  5H6Q A;  1SAN A;  2W82 A;  5KHD A;  3S17 J;  3BY6 A;  2IRF G;  2ECB A;  3ECO A;  3TW6 A;  1MSF C;  3FK7 A;  1UHW A;  5DCM A;  2HXO A;  2HOE A;  1JKP C;  2VXZ A;  3MZ8 A;  4X6A J;  3E5Q A;  4WXD A;  1X2N A;  2YR2 A;  4HF2 A;  2PFB A;  2ZME A;  3C1D A;  2WA0 A;  4OIR F;  5LGU A;  5J8F A;  3GFI A;  4OAY A;  1S9H A;  3GLL A;  3ZQQ A;  3HOT A;  1QO0 D;  2E5Z A;  2QQ9 A;  3L09 A;  3PIO F;  2WV1 A;  4I76 A;  2VBY A;  3IHU A;  4RAF A;  3VEP A;  5HS8 A;  3H5R A;  2BBY A;  3ZPL A;  2AQF A;  2EZI A;  3BJA A;  1WI9 A;  1WKM A;  2M5W A;  3I59 B;  3LWF A;  1TW2 A;  4YG2 F;  2E34 A;  5E79 C;  2GA1 A;  5JVT A;  2ID3 A;  2L9V A;  3QAH A;  2R5Z B;  4G6D A;  1Y0U A;  2F5F A;  4U7B A;  4P5O A;  1IRG A;  1Z9C A;  3S1Q J;  4ZTF A;  1SFO J;  1KU2 A;  3E3V A;  3E1S A;  2UUZ A;  3DEU A;  5HS9 A;  3L2V A;  3OYJ A;  3ROU A;  3HOZ J;  1AKH A;  3NQO A;  4IRG A;  5IYC J;  1PDN C;  3KPH A;  3BG5 A;  3BPX A;  1ACI A;  1WFX A;  1N75 A;  2ZO4 A;  4BXX J;  3W2W A;  5LRS A;  3JRB A;  2V7F A;  2L4M A;  3OSG A;  4EV0 A;  5LHH A;  3HHH A;  3CCS I;  2BY3 A;  4LOC A;  3ZQG A;  2P5V A;  4Z2Y A;  2RQP A;  2IGO A;  1GVJ A;  2ISZ A;  2PX9 A;  2RRE A;  3OYC A;  1QVT A;  2FUG 2;  3SZG A;  2GZW A;  1MH4 A;  2HQR A;  2VOD A;  1U8B A;  2H09 A;  2DT6 A;  2OU2 A;  1HKS A;  4YEJ A;  3VDX A;  3EUK L;  5GP9 A;  3I54 A;  3EQL F;  3DLA A;  3FWE A;  4IF4 A;  1I39 A;  1OCT C;  4O3M A;  1X58 A;  1ITY A;  2NVY J;  2VN2 A;  4ZC3 A;  4KYW A;  5BNG A;  3M3Y J;  2QCO A;  3H9Q A;  4M3D A;  5HDN A;  2EIM H;  1TBX A;  1YX3 A;  3KZI C;  4B8X A;  2CSO A;  1QBJ A;  2CUF A;  3OYG A;  4G12 A;  3X2Q H;  1G3S A;  4QPQ A;  2COB A;  2VQG A;  2W25 A;  2KZG A;  4XLE A;  2WAQ N;  3CC2 I;  1XCV A;  2DFH A;  4MO7 A;  4PJM A;  1XPX A;  2O61 A;  2H1L A;  1OCP A;  5JI6 A;  4O6J A;  1D3Y A;  2ZFU A;  3CDH A;  3I9V 2;  2FXA A;  4FT8 A;  1FOK A;  1YOV B;  1XX5 A;  2FD5 A;  3HJE A;  2R7V A;  3PNT A;  1QZE A;  2JPC A;  3U21 A;  4NHJ A;  3ABU A;  4RS8 A;  4XLF A;  3LA7 A;  2V1X A;  4B1R A;  3WG7 H;  2BHZ A;  2ZXH A;  4MFD A;  3HOW J;  3P5J A;  3BOQ A;  1P92 A;  5ILV A;  1FIP A;  3Q0W A;  3Q3S A;  4KT6 A;  5IP6 A;  1LE8 B;  2KIF A;  5LHI A;  1BN5 A;  4ETS A;  2OTL I;  5DUK A;  2L7M P;  4BH9 A;  2FF4 A;  4PSX A;  2Q1Z B;  5J1R A;  2CQQ A;  3WGI A;  5FLX K;  3QU6 A;  4N9I A;  4FE7 A;  4OIP F;  2OTJ I;  5E1W A;  5EZH A;  3EYY A;  2WAE A;  3S3M A;  1NH3 A;  2L54 A;  3GTP J;  3I71 A;  4PGG A;  2JMW A;  4CH7 A;  2QWW A;  4ITV A;  1BI0 A;  2EJR A;  3HSE A;  2IEK A;  4UUS B;  4BHB A;  5LFA A;  1R4M B;  3F8B A;  1IDZ A;  2KIQ A;  2NYX A;  2KRC A;  3R61 A;  2O0Y A;  1YJ9 I;  4GCV A;  3M8J A;  3M1E A;  4PK4 A;  2AO9 A;  2LG4 A;  4F3Q A;  3HOS A;  1YJW I;  2QKM B;  3RPU A;  5EGO A;  2K9S A;  4KFC A;  2NVX J;  1VQK I;  3JRH A;  2J5P A;  4A3B J;  3CCE I;  1ETY A;  3H9G A;  2M7B A;  2W24 A;  2A5Y B;  3TBI A;  2LF7 A;  3A01 B;  1TT0 A;  5FKN A;  4KIT B;  3F3X A;  2BY2 A;  4XK4 A;  3W2V A;  4PDK A;  4Y3O A;  2DTR A;  1ENH A;  3OV8 A;  3BR0 A;  2XUB A;  1X4O A;  2XGC A;  1SD6 A;  4AYB A;  2BXY A;  4HSR A;  3LST A;  1G3W A;  2NOG A;  3IL2 A;  3GFJ A;  3W2A A;  4HDU A;  2QLZ A;  3FKI J;  3JRC A;  4AM3 A;  1F4K A;  4E7K A;  3MD2 A;  2JPB A;  5FFX A;  4AIK A;  3KET A;  2X51 A;  3I4N J;  2GOM A;  3LAJ A;  2KIM A;  5L3F A;  1KQ0 A;  1GUU A;  2P5K A;  3G73 A;  2BHY A;  1BI3 A;  1IJW C;  1FTZ A;  4MGR A;  2GOX B;  3GEZ A;  3LFU A;  4D7M A;  1P6R A;  1K4T A;  2HTJ A;  2PMU A;  1W0U A;  3OYB A;  3F22 A;  1B9N A;  1FBU A;  3T1B A;  4LG0 A;  3JRF A;  3OYN A;  1RC9 A;  4L9N A;  4XKV A;  4ON0 A;  1Y39 A;  2FOK A;  4A2U A;  3TO7 A;  3K4M A;  3GFL A;  3A1Y A;  3MN2 A;  2LTP A;  1TP4 A;  3OIO A;  3BRO A;  1D5V A;  1Z21 A;  5D6F A;  4L9T A;  3EYI A;  3AKZ A;  4G9Y A;  4M74 A;  4FE4 A;  2H6B A;  1WHU A;  1IN8 A;  4TV7 A;  1W4M A;  4UUT A;  1V54 H;  4N9H A;  3FXJ A;  1I5Z A;  4HLY A;  4XN3 A;  3QYB A;  4BE2 A;  2KL4 A;  4ABZ A;  5IYB J;  2LBF B;  2EK5 A;  3BTL A;  1IRX A;  1IRF A;  4XLN F;  2IA2 A;  3O6B B;  2CW7 A;  2A07 F;  3CES A;  3E5U A;  2IBD A;  4A0Y A;  3BWG A;  3LSI A;  2DK5 A;  3LL7 A;  3ZOB A;  1R49 A;  2XRL A;  3K2Z A;  1VND A;  1YIJ I;  1G6N A;  3JAM K;  5L3E A;  3GX4 X;  4Y4R A;  2DT5 A;  1SAX A;  3FXL A;  3ZGK A;  1IGN A;  1TZL A;  5HOD A;  5EG0 B;  2K5C A;  2W57 A;  1V3F A;  2LF8 A;  3ZQH A;  1R23 A;  1DUX C;  1J9I A;  4E7S A;  4YFN F;  2BV6 A;  2KJC A;  1LEB A;  3CMM A;  5GPC A;  1WJ5 A;  5J47 A;  5ERI A;  1YIT I;  1MMN A;  3RKX A;  4IOC F;  1TNT A;  2IA0 A;  3HXL A;  3NRV A;  3I4P A;  3GTG J;  3CCJ I;  1G2H A;  4EAT A;  4F7Z A;  2FBK A;  2FQ4 A;  3LOC A;  1HLV A;  1R9T J;  3FXO A;  2IVM A;  4P96 A;  3GLX A;  4ZZL A;  2QEN A;  2HU9 A;  5JR3 A;  1REP C;  2IS2 A;  2KRH A;  2XSJ C;  3F8N A;  3K4L A;  1WZ2 A;  3BJO A;  1ETV A;  3SFZ A;  4AUX A;  5F6F A;  1TWG J;  2DA2 A;  2LKS A;  3HKZ N;  4Q47 A;  4RAZ A;  3G3Z A;  4IVN A;  2BVM A;  3ZXS A;  1J09 A;  2OPT A;  1HBX G;  9ANT A;  2NRA C;  1MW7 A;  4NQW A;  2F6C A;  1PVE A;  4M9Z A;  3J80 K;  6PAX A;  5ICG A;  1D0Y A;  1WRJ A;  2MH2 A;  2BY0 A;  3A4C A;  3K4B A;  2Z2S B;  3HGY A;  5F1R A;  4M3E A;  2CQ7 A;  4BUP A;  1X3W B;  1XS9 A;  3C2G A;  3KP5 A;  5FD5 A;  1Z0X A;  3K4C A;  2XAU A;  2FU4 A;  2K7L A;  3DQV C;  1XSD A;  2FJ1 A;  1U2W A;  1FYK A;  2GM4 A;  5FRM A;  2DOE A;  2CG4 A;  1JGG A;  1R36 A;  2LY9 A;  4RGU A;  2ZME C;  5ILS A;  4DZP A;  1WPK A;  3LSR A;  2VBW A;  1EKE A;  5J40 A;  3F9K A;  1B1B A;  2BOL A;  2JSP A;  5CKT A;  4S05 A;  1EA3 A;  1AWC A;  3SZT A;  1Z1D A;  2VJI A;  2PG4 A;  4C2U A;  2X4H A;  3DPU A;  1TT5 B;  3PM1 A;  2UWM A;  2EIN H;  3L9F A;  3TOA A;  1DGR M;  4HX4 A;  3V42 A;  2MLK A;  4I2O A;  1GXQ A;  1OLT A;  3CUQ A;  1Z67 A;  3WTT C;  1IG7 A;  2CV1 A;  4RGS A;  2CQN A;  4M3F A;  2RGV A;  5LD2 C;  3QQA A;  2M1B A;  3EUA A;  1JJ8 C;  1KYW A;  4R1H A;  2O6G E;  2MAB A;  2H6C A;  1KU3 A;  3GWZ A;  2WAQ A;  3SEQ A;  1UAA A;  2KZV A;  2XAG A;  3PFY A;  3JAM Z;  3DKX A;  4IX7 A;  1H8A C;  3ZMZ A;  5J4Y A;  4XMY A;  1W7P D;  1T8I A;  1HST A;  4BY1 J;  4NC8 A;  2EFW A;  2IXS A;  4A3G J;  4FHT A;  4RB0 A;  2IGM A;  1IZ1 A;  3E0J B;  1MBF A;  3COA C;  1GT0 C;  4P55 A;  1HDP A;  2HOS A;  4B4C A;  3KEO A;  1TLH B;  3GXO A;  2VKE A;  4EJO A;  2GIZ A;  2BEO A;  4ZH4 F;  2BVL A;  4JX5 A;  3BR5 A;  2EFO A;  2FMY A;  5EEH A;  2AS5 F;  2X48 A;  1R5H A;  3U9G A;  4NC6 A;  1FBQ A;  1ZH5 A;  2AXL A;  1JUP A;  4PFO A;  2BGC A;  1WSU A;  3WE2 A;  1LVA A;  5AIP A;  1GDT A;  3SHF A;  1I3A A;  3CCM I;  4A3F J;  1NK2 P;  1MMS A;  2QZ8 A;  1ZGA A;  4CCN A;  1FMW A;  5H20 A;  1VQN I;  2EZL A;  3OYE A;  3GF2 A;  1S7E A;  4S0H B;  3FIS A;  5B66 C;  2VOO A;  2OQG A;  2ZJR F;  4U0V A;  1JI8 A;  3LSH A;  5DM7 F;  1W7P B;  2K86 A;  4HF0 A;  2ZJQ F;  1JKQ C;  4CGZ A;  2LR8 A;  3T8T A;  4CCL A;  3B6A A;  1LDJ A;  1BJA A;  2KQR A;  3K7A J;  1IXS B;  2VBZ A;  5CJ9 A;  3L7W A;  4HZF A;  2VLA A;  3TW7 A;  1Q1V A;  4BQA A;  4V2G A;  1A6I A;  2G0E A;  2GIV A;  4ENM A;  5LBQ A;  4BKX A;  1LFU P;  4Q48 A;  3T5X A;  4DW6 A;  1IN7 A;  3BG9 A;  4X1E A;  1T98 A;  2M3A A;  1TWA J;  3K70 C;  2M0C A;  2XAS A;  1ZG1 A;  1SFU A;  1SVL A;  2VQH A;  1A31 A;  2E2J J;  2K9L A;  1XB4 A;  2R7X A;  1OPC A;  3S15 J;  2ISY A;  2L4A A;  3KEY A;  3CCR I;  2A5W A;  4RGR A;  2VJ4 A;  5GTI C;  2HKX A;  2XAQ A;  3BPV A;  4MQ9 F;  4BEH B;  4P1W A;  3JW4 A;  4BQQ A;  1ZYR F;  1OYI A;  1EH8 A;  5CVJ A;  1YW9 A;  2CH0 A;  1ZGW A;  5CYV A;  3SYT A;  2O8K A;  3OYI A;  3GFM A;  3SFI A;  4RA2 A;  5ED4 A;  2K4J A;  4KUM A;  3BR6 A;  1YRN B;  3FX3 A;  4UB6 C;  2R7T A;  4YRV A;  3FXU A;  3BCA A;  3HUG B;  1HKQ A;  5KCM A;  3LSJ A;  2G7H A;  3TED A;  1NK3 P;  1ZRF A;  4A3L J;  3HTU A;  5GTH C;  2WY8 Q;  2EWN A;  3R6S A;  1WJA A;  4DIQ A;  1BW5 A;  3QOP A;  2XB5 A;  3M07 A;  1BC7 C;  1FSE A;  1KQ9 A;  2NS0 A;  4LMY A;  4FX4 A;  2HOA A;  5BOX A;  2ZNZ A;  4XM3 A;  2V9K A;  4HNV A;  1D1B A;  4DGW B;  3HB9 A;  5FJ8 J;  1UHS A;  2HVS A;  1RNL A;  5FLM J;  2Z5U A;  1Y56 A;  2KP6 A;  3WGG A;  1YLF A;  3G1M A;  4A69 C;  3I4M J;  5E3O A;  3O2P E;  3VYS B;  4C3J J;  2XGX A;  3J7A Y;  3HTS B;  3VB2 A;  4DNC A;  2D1H A;  2Z99 A;  1OYY A;  2CGP A;  1Z7U A;  2CU7 A;  5EEG A;  2VJJ A;  4L0Z B;  5BMZ A;  3TDZ C;  1IDY A;  1YX5 A;  3P9I A;  2DOF A;  1IN6 A;  1X3Z B;  4XRS G;  1FTT A;  2YU9 J;  1M1E B;  2ETH A;  2I8D A;  5EYR A;  2DBB A;  2CW0 F;  3ZQF A;  4PSW A;  2P7V B;  3GBG A;  5FD6 A;  1MZB A;  1HSJ A;  2XC7 A;  2GXB A;  2COM A;  2F4M B;  1WH5 A;  1G8X A;  2HDW A;  3FM5 A;  4KIS A;  2Q2E A;  2GAU A;  2DN0 A;  5LRR A;  5EZG A;  1P7I A;  1LKX A;  4KN7 X;  1LVK A;  5DD8 A;  1NHA A;  2HQN A;  2K9N A;  4IZZ A;  3AL0 C;  2EBI A;  3LSK A;  2VJ5 A;  3RQI A;  1U0J A;  2CJJ A;  3E97 A;  2JSC A;  5CLS A;  4E7J A;  4B48 A;  1YFH A;  2DCE A;  2L7F P;  4DYQ A;  3H92 A;  4A3C J;  2DFF A;  1XSX A;  3DXJ F;  1BOB A;  3LNQ A;  1T6S A;  2TCT A;  3KYL A;  4CSW A;  1K78 B;  5D4R A;  3K69 A;  2RVC A;  1AA7 A;  5BQT A;  5IPA A;  2HNH A;  4K2E A;  1FP2 A;  1HKT A;  2MBF A;  2DMP A;  1FYM A;  1FSH A;  4IHT A;  2DYR H;  3ZMU A;  1XTA A;  2IP2 A;  3HKZ A;  3CLO A;  3WHC A;  4U7D A;  3KE2 A;  1JE8 A;  3ZQL A;  2EB7 A;  2IAI A;  4G6T B;  1D0X A;  4J19 A;  4D9J A;  3WTX C;  4YFK F;  3DEE A;  2PQ8 A;  3LA2 A;  4ZYG A;  2ZSH B;  2NNY A;  1LE8 A;  4ZDO A;  3RKW A;  4Y17 A;  3HOV J;  4CYC A;  1MKM A;  1FPQ A;  1K6Y A;  3RPQ A;  1OCC H;  2HYF A;  3R60 A;  3KYD B;  1TWH J;  2DXI A;  2JRT A;  3GUD A;  2O5R A;  2A3S A;  2KJB A;  1BOA A;  4BJ6 C;  4UVA A;  2ZSI B;  3KZZ A;  4N4O B;  3QRF F;  3RSN A;  4XLC A;  1ORK A;  1HW5 A;  3C7J A;  4R79 A;  1OCZ H;  3NAR A;  2F5E A;  1OJL A;  2X9D A;  2QQ8 A;  1LB2 A;  2XB0 X;  2XGE A;  1OYW A;  1LUJ B;  2JA5 J;  1DP7 P;  3U2R A;  2HYG D;  3IKV A;  1Y8Q B;  4AID A;  4KMU X;  1ZR2 A;  5K7F A;  1EV7 A;  3HOX J;  1RUN A;  3KP4 A;  1MMA A;  5LGN A;  4M6Y A;  5E20 A;  3GZ5 A;  1S29 A;  1ZRE A;  1WJB A;  4RGX A;  3MFK A;  3PL8 A;  5H6R A;  1J0R A;  3KEQ A;  4IRH A;  3TO9 A;  3S14 J;  5FRO A;  1RRJ A;  3A01 A;  2TDX A;  1ZN2 A;  3BG6 A;  5E8I A;  4G7Z F;  3I53 A;  2KHM A;  2MA3 A;  2K3P A;  4M6V A;  2OJE D;  4AVZ A;  1MMG A;  3F21 A;  4Y7N J;  3HPG A;  5TGT A;  3F23 A;  4J01 A;  4I6Z A;  2HKO A;  4YIF A;  2VC1 A;  4KMF A;  2ZKZ A;  2Y31 A;  1MBE A;  4DBR A;  1DP3 A;  4A3K J;  1DPU A;  2LRE A;  2EZH A;  4LIU A;  5ICF A;  1U5T B;  3RYP A;  2XKP A;  4C2M J;  1X1P A;  2V6E A;  4L9J A;  1ZKG A;  3HRM A;  3MWM A;  3NWT A;  5M5W J;  2E1M B;  1F9N A;  2DFI A;  4QLC U;  2XDV A;  1I3Q J;  2R5Y B;  2UXN A;  1R5I D;  1S7O A;  2M8E A;  1MJA A;  4IQJ A;  2CV2 A;  2XIG A;  3HHG A;  3L1P A;  1SD4 A;  1BL0 A;  4L9V A;  1XMA A;  2VT3 A;  2JWT A;  1HA8 A;  3D0S A;  4IEJ A;  4QIW N;  1WQ2 A;  3CME I;  5AON A;  4D0P A;  4PJL A;  3IRR A;  1BIB A;  4E7L A;  2VUM J;  3I5U A;  4EGY A;  3KX2 A;  1RET A;  3O3K A;  2V1N A;  4PZJ A;  2LC2 A;  3EET A;  4IO9 F;  2RNJ A;  4EJV A;  2M2E A;  1YI2 I;  1WJC A;  5D5U B;  3FZV A;  4B44 A;  2OC6 A;  5JLW A;  4MTE A;  5CVI A;  4A5M A;  4BL0 B;  1ZEL A;  1UZC A;  2OZ6 A;  2JT1 A;  2EIK H;  4UUV A;  4Y33 A;  5A2Q K;  2LBF A;  5TIS C;  3GTK J;  1LEA A;  2RKH A;  4RM3 A;  5AIQ A;  2R7S A;  3UKG A;  2QQB A;  2O7O A;  4WWC A;  3CUQ C;  3WG9 A;  3OSF A;  2NXN B;  1V55 H;  4M73 A;  1MDM A;  4FIS A;  1VQ4 I;  2O9L A;  4E7Z A;  3RJP A;  1O7F A;  2H8W A;  1JTX A;  3BZK A;  1HXD A;  3FBN B;  2QBY B;  3OR1 C;  1IV8 A;  1LFB A;  1X1B A;  5L3D A;  5K5R A;  1T0F C;  2LY1 A;  2WB1 N;  3VPR A;  2HGC A;  4G8X A;  4JX4 A;  4D5F A;  2ZNY A;  1RIO H;  3WU1 B;  3VYR B;  3VWB A;  5IP7 J;  4HLX A;  3SZP A;  1MNM C;  3J7Z I;  1P7J A;  2VKH A;  3MCZ A;  3BTC A;  1YW8 A;  3CUO A;  3A0B C;  1USS A;  2XF7 A;  4YII A;  5F64 A;  1BR4 A;  2ME0 A;  3T8R A;  2FBI A;  2UZK A;  3W6V A;  4CZC A;  2ADU A;  4KNY A;  1MBK A;  2DW4 A;  4ENJ A;  5HNF A;  2EPF A;  1YG2 A;  3WTY C;  4BYY A;  2L7K A;  2J5O A;  2Z1D A;  3HSF A;  3RYR A;  2XPW A;  4IKF A;  4UHT A;  1D8K A;  3M8F A;  5DDG A;  4CHU A;  3JR9 A;  3S1M J;  5DCF A;  3RDI A;  4DQ2 A;  1BJZ A;  2QGU A;  2DMU A;  1QQI A;  3WOD F;  4HNT A;  3J81 K;  2H27 A;  2MC3 A;  2UXX A;  4V19 K;  2XPU A;  2KDZ A;  1BBY A;  2CUJ A;  2XGD A;  2MH9 A;  2X6Y A;  2FOW A;  4Q5S F;  3H5N A;  1OCO H;  3S2H J;  2HWV A;  3IAS 2;  3VSK A;  5B5E C;  1XGO A;  1R22 A;  3CP8 A;  3OOP A;  5KNL A;  4XKB A;  4EJT A;  1NG6 A;  1X4P A;  1RR8 C;  3BR2 A;  2RV8 A;  2P81 A;  4A12 A;  2NVT J;  1E3O C;  4I0B A;  1XGM A;  4LB6 B;  3AG3 H;  2NS8 A;  2XF5 A;  2Q8K A;  3ZMT A;  2QEX I;  3KLN A;  1JJ6 C;  3PNV A;  5B1A H;  3QYE A;  2G7U A;  1T38 A;  3MEX A;  1IN5 A;  1VF9 A;  1W36 D;  4IJA A;  3BG3 A;  1RKW A;  1YJN I;  2STW A;  3RQ4 A;  5FKL A;  3S32 A;  3S2W A;  2QM3 A;  3GME A;  3HSR A;  5HLI A;  1YQA A;  1UJ8 A;  3LAP A;  5DD4 A;  4OMZ A;  4CXF A;  4RB3 C;  1XC5 A;  4G6Q A;  3DWL E;  4DYR A;  4HST A;  4G7O F;  4BAC A;  2R7O A;  2ZBK A;  5IOZ A;  2FRH A;  1H9T A;  5A2Q Z;  2CW8 A;  1J5Y A;  5D6E A;  2L3D A;  1YW7 A;  2Q0O A;  4NBQ A;  3AAF A;  2E1N A;  2BW3 B;  3BTI A;  4ZDP A;  5J3L A;  1X1D A;  1BR2 A;  4EM2 A;  1XMK A;  1XGS A;  3K1P A;  2LYC A;  4IQ4 A;  2M4G A;  1E17 A;  2XAJ A;  4EM0 B;  1JKR C;  5DV5 A;  5JHF A;  2P6T A;  1UMQ A;  1ZAR A;  1YO5 C;  4CIC A;  1U8R A;  2O8X A;  3W6J B;  1FLI A;  2P4W A;  4HX7 A;  2E1C A;  1YE9 A;  2LLK A;  2QA4 I;  1WJF A;  1YS7 A;  3BCB A;  3Q0U A;  5FGM A;  3CC4 I;  1UST A;  5FLX Z;  5C3E J;  1QU3 A;  3H0D A;  3GZ6 A;  2L9N A;  2M4K A;  1ZR4 A;  4IHW A;  3WTZ A;  1JT6 A;  3I58 A;  1YYV A;  3QU3 A;  2A68 F;  2FSW A;  1S8N A;  2X0L A;  3OL3 A;  3IAM 2;  3ML6 A;  4O5V A;  3BG7 A;  4CCK A;  2ZB9 A;  3DU6 A;  1S5L C;  1ODD A;  3SDB A;  2C6Y A;  2P8T A;  4JP0 A;  2XRO A;  2KPM A;  2PJR B;  3CCY A;  5HNH A;  3IH4 A;  2JA6 J;  2K85 A;  1BM9 A;  1TL8 A;  4A0X A;  1MSE C;  1V4R A;  2RC4 A;  2Z16 A;  1Z6R A;  2DTZ A;  2XF6 A;  1IXC A;  1MBG A;  5J1U A;  1SVO A;  1B72 A;  3WTS C;  4LK0 F;  4E7I A;  2QKL B;  1W7P A;  3FM3 A;  3E7L A;  3IH3 A;  5CPR B;  2PJP A;  3ISP A;  2IS4 A;  1AU7 A;  3KP7 A;  4M6X A;  3HGG A;  2W48 A;  5M5X J;  3OS1 A;  5JVG F;  1FEX A;  2YPR A;  2HOT A;  1RKT A;  5M5Y J;  4Y15 A;  3REO A;  2ZJP F;  5C44 J;  1H9G A;  2L7Z A;  4C30 A;  2HYJ A;  3CCU I;  4XON A;  4UV9 A;  1MH3 A;  2PMH A;  5GAH J;  4BJ5 C;  4Y13 A;  2Y9Z A;  5IP9 J;  4AD9 A;  3K6G A;  1PUF A;  1HOM A;  3OWT A;  2HVQ A;  4GYG A;  3MKY B;  5B1B H;  4ZYD A;  1W0T A;  1ONV A;  1R6R A;  4B43 A;  2WTE A;  4E4H A;  5H2F C;  4E6K G;  4ZTJ A;  1BA5 A;  1B4A A;  1IC8 A;  3ELK A;  1KON A;  4ESF A;  1FX7 A;  2R7D A;  3JRA A;  4XOR A;  2JN6 A;  1TTY A;  2H1K A;  2VPL A;  2B7E A;  5D5X B;  2JRM A;  2CMP A;  1ETW A;  3HUG A;  2V4J C;  3ZRG A;  3BTJ A;  5L3G A;  3FHZ A;  2R7U A;  2V26 A;  4F93 B;  1JT0 A;  1GXP A;  1W5C C;  3QOE A;  1T08 B;  1F43 A;  1MGT A;  2HFH A;  4BE0 A;  4ENK A;  4Q4Z F;  1JGS A;  3AL0 B;  4XL9 A;  1ZAO A;  1N25 A;  4XNF A;  3L2R A;  1XN7 A;  3BDD A;  3DLL F;  2W1O A;  1VQ5 I;  3ABK H;  4I7H A;  5E3L A;  3RKQ A;  2L01 A;  2KIS A;  4U87 A;  5IT3 A;  4XRF A;  3ECH A;  2IW5 A;  4YEL A;  1T39 A;  3E6C C;  5ILU A;  4UB8 C;  5HVQ C;  3Q9S A;  1NTC A;  1T0F A;  3GCM A;  1L0O C;  2EIJ H;  2W00 A;  3F8M A;  1EH6 A;  1C0W A;  4OOI A;  1KU7 A;  2DA7 A;  2LKP A;  4XRS A;  1IV6 A;  2K4B A;  3D1N I;  1K6O A;  2B63 J;  3QPS A;  3GW2 A;  3PQJ A;  3V7R A;  1K7A A;  1B59 A;  2LRD A;  4LGW A;  1TQI A;  1P4W A;  2WAF A;  4D5C A;  1TWF J;  3MZY A;  2EA2 A;  3TO6 A;  5HDK A;  3WE3 A;  1YHQ I;  1R1V A;  2WB1 A;  4ZJZ A;  1TQP A;  2XRN A;  4DYC A;  3DP7 A;  4XBF A;  1WVR A;  3PUB A;  2FX0 A;  2KIU A;  1FWZ A;  3ASN H;  1E3H A;  1FIA A;  2FML A;  3G1O A;  3OYK A;  3V7S A;  4H4K C;  3Q9V A;  2A6H F;  4WF2 A;  3JRG A;  3PQK A;  5LEJ A;  2HVR A;  4UY8 I;  3E6B A;  5K7H A;  3HPH A;  1O3T A;  2Y48 A;  3E5X A;  1PYV A;  1D8J A;  2LVS A;  1APL C;  3GTM J;  3E6D A;  4HQE A;  4LB5 A;  2PI0 A;  2VT2 A;  2F5C A;  3ZQC A;  3KP3 A;  1EF4 A;  1HC8 A;  2KLO A;  3J80 Z;  2QUF A;  2Z33 A;  3HL2 A;  3PFI A;  5E18 F;  3F72 A;  2P0W A;  4AU7 A;  5F04 A;  3RZD J;  3R4K A;  1CF7 B;  5F0H A;  3L2U A;  3H1C A;  1IUF A;  4F55 A;  1BI2 A;  1MNE A;  3HRT A;  4DBQ A;  3N97 A;  2R93 J;  1CGP A;  3RI4 A;  1MJ9 A;  1Y0N A;  4NUB A;  3V8J A;  1S7A A;  2ELJ A;  2V1D A;  5FO5 A;  3MMY B;  4I02 A;  4RBO A;  3OS0 A;  4GGG A;  4AIJ A;  1B6A A;  1A04 A;  2F48 A;  4LK1 F;  3BQZ A;  1FBS A;  2JVG A;  1Y6I A;  2F4O B;  3I59 A;  3SQN A;  4EGZ A;  1VTN C;  1YS6 A;  2HZT A;  1KA8 A;  1S3J A;  2XAF A;  4KA4 A;  2R5Z A;  1DQU A;  2ESH A;  3F8C A;  5FB2 A;  2R7W A;  3GVA A;  2IPQ X;  2GBY A;  1S72 I;  3CP2 A;  1QHH D;  3MAJ A;  3PSI A;  4XSZ F;  1E2X A;  4B47 A;  4A3D J;  3OIQ A;  3W3C A;  4BXU A;  4A3E J;  4ENN A;  1G59 A;  4IHS A;  4EEF G;  2LOO A;  4ESB A;  4BBS J;  3N4M A;  4RB1 A;  1VQL I;  3ABL H;  2LNB A;  2KDO A;  2DI3 A;  4BU2 A;  4EJW A;  5DEQ A;  2O03 A;  3A03 A;  2HS5 A;  3DTI A;  5J4V A;  1R58 A;  3CQZ J;  2DO7 A;  3QYF A;  4H0E A;  1B8I B;  3DU5 A;  5TJJ A;  4EJU A;  4L18 B;  5IT9 K;  2HR3 A;  1FY7 A;  3A0H C;  3I56 I;  4OWR B;  1O3Q A;  2DOD A;  3GTL J;  2VXD A;  2DT7 B;  3QPH A;  4FTH A;  5FKO A;  3ZCO A;  2IS1 A;  2VKD A;  2O3F A;  3HIF A;  1U3E M;  2NS7 A;  3TQN A;  4MEX F;  1G4D A;  2WY7 Q;  4HBL A;  4LIV A;  1HF0 A;  3FKJ A;  4HEA 2;  3QPL A;  3M1C A;  5J1Y A;  5D5V B;  3JRE A;  3A2K A;  2DDA A;  5C4X J;  3IV5 A;  1DDN A;  1GVD A;  4RLF A;  3ZN0 A;  1U5T A;  3Q5F A;  1P4A A;  4HQM A;  1OKR A;  3H35 A;  4A3I J;  2V9P A;  3GZN B;  2YX7 A;  2DK8 A;  2HDD A;  4OU0 A;  3FF5 A;  1QVU A;  4QWQ A;  2EFN A;  4HNU A;  5J8C A;  2R5Y A;  3DPT A;  3BQY A;  1QNT A;  2BY1 A;  4LLG F;  4ESJ A;  3RZO J;  2ZXW H;  3H36 A;  3S8P A;  1ZG5 A;  1SD5 A;  3EUH C;  1JUM A;  1XD7 A;  5EF6 A;  5ICE A;  2VON A;  4CZZ A;  3H9J A;  5BS6 A;  4WXC A;  4UV8 A;  3SXY A;  2MD0 A;  4WK8 F;  5FRN A;  3ASO H;  2PLY A;  2R0Q C;  2IGN A;  4I99 C;  3CDI A;  2OCC H;  5E3M A;  3QPT A;  1SFX A;  2K9M A;  1POG A;  2PEX A;  1ETX A;  3TP0 A;  1BI1 A;  2HQ5 A;  4DJA A;  2CO5 A;  5L3C A;  1HW2 A;  4GDF A;  1V5E A;  3KCC A;  2RN7 A;  4XN0 A;  3QP5 A;  1DU0 A;  2E60 A;  3EDP A;  4BGD A;  4U0Y A;  5CVV A;  3UNG C;  3H3V K;  3ZMD A;  3K2A A;  3D5L A;  5FLV A;  1UHM A;  3DTK A;  3HYI A;  5HOO A;  3BP8 A;  2R7Q A;  4CDG A;  4CCO A;  5HLH A;  4HDV A;  1B9M A;  2Z3Y A;  1FOX A;  2FNP A;  1HCR A;  1OFC X;  3RTR A;  4GRI A;  5CVR A;  1DGW Y;  4CYD A;  3FMQ A;  2FBH A;  4G7H F;  1R71 A;  2QBY A;  3FDY A;  4RLQ A;  2VC0 A;  3I0T A;  1SC7 A;  2B0L A;  3C2B A;  1TQM A;  1SMY F;  3HRU A;  2YS9 A;  4JQF A;  4E70 A;  4ZYA A;  5K1Y A;  1P2F A;  3BR1 A;  1J75 A;  4PFP A;  1MIJ A;  4HYE A;  5EDN A;  4RDU A;  3WU0 A;  1LPQ A;  3VOE A;  1A35 A;  2CYY A;  3HG9 A;  3P9C A;  4GXO A;  4ZDL A;  3OMY A;  4ZYE A;  2A69 F;  3OOU A;  4LD5 A;  4LIT A;  2NNN A;  1IXR C;  4UUS A;  1N78 A;  4FQG A;  2MG4 A;  2X1C A;  2CUE A;  3K4J A;  4XOT A;  3S93 A;  4CA0 A;  2DJN A;  1SFK A;  3DEW A;  2R7R A;  4OIN F;  1P9Q C;  3OR2 C;  3F6O A;  1E3P A;  1ZRD A;  1IRZ A;  2DQL A;  2VE9 A;  2X1D A;  1IAW A;  2ESN A;  3CMA I;  1BR1 A;  3BLY A;  4AVP A;  1KU9 A;  3OL4 A;  1VQ7 I;  1CQT A;  2W85 A;  2OCE A;  4KIG A;  4DZJ A;  5IT9 Z;  3KYC B;  4HOB A;  4IHY A;  5EEA A;  2Y69 H;  1IUY A;  2RQQ A;  3CO6 C;  1J59 A;  1IO2 A;  2V9V A;  1BIA A;  3TL4 X;  2E2H J;  3JSP A;  1EJ9 A;  2D45 A;  3C2H A;  5GAE J;  2Y9Y A;  3GTQ J;  1SEU A;  1ZK8 A;  2OQR A;  1WJD A;  2ZJ2 A;  3R0A A;  1U78 A;  3CJQ B;  3TMO A;  3RIR A;  1Y8R B;  2TRT A;  4M71 A;  1UFM A;  4C2T A;  3QWL A;  1WWX A;  1QRY A;  1XG1 A;  4IPA A;  1PJR A;  2CRG A;  2E7X A;  4RAG A;  2LKX A;  1QGP A;  2ECC A;  3DKY A;  1O4X A;  2R7F A;  2DA4 A;  2OA4 A;  4U0W A;  4JBA A;  1P4X A;  3M4O J;  3BJ6 A;  4WXH A;  5TRD A;  1IW7 F;  5F0F A;  4HPQ A;  1V5G A;  3FHN A;  3VYT B;  1ETQ A;  3WTV C;  1ZQ3 P;  3ABM H;  3BR3 A;  4UVC A;  3DKW A;  3KZY A;  3G71 I;  1SFE A;  4MNU A;  2IJL A;  3VFZ A;  1MJB A;  3I64 A;  4L5J A;  3FMS A;  5F1J A;  1G3Y A;  3ZN1 A;  1QA6 A;  5IY5 H;  2NVU B;  4HA8 A;  4QPO A;  2K40 A;  2EQR A;  1I6H J;  1OQY A;  3V7C A;  4BBR J;  4NNJ A;  1RES A;  2JVH A;  3GTJ J;  2VE8 A;  3CCL I;  3OY9 A;  2HPI A;  1ZTR A;  3DBR B;  5C4J J;  4C3I J;  5IYD J;  5JHU A;  1UG2 A;  4NB5 A;  1VQ6 I;  4NDL A;  4IHV A;  4L0Y B;  5J6X A;  4EQQ A;  3IP4 B;  2HDC A;  3CC7 I;  2QSH X;  2KMU A;  1ZHF A;  5K7Z A;  5E1Z B;  1X19 A;  1I1G A;  3V8L A;  1FZP B;  2BW3 A;  4OMY A;  2Q2E B;  2EFP A;  5LGT A;  2QVO A;  2R4G A;  4CO8 A;  1Z3Y A;  4XLH A;  1ZRC A;  4JYK A;  2L9R A;  1WJE A;  2MGQ A;  3Q0V A;  1W5T A;  1QZZ A;  2E7W A;  2L9S A;  3ZMV A;  2EA4 A;  1SMT A;  5CQG A;  2WWY A;  1MND A;  3G2B A;  2STT A;  2VKV A;  5HDG A;  3PSF A;  3LMM A;  2QSF X;  2EH3 A;  1ETK A;  5EG0 A;  5IOY A;  2DFE A;  3ZP5 A;  3HOU J;  2JA2 A;  3S16 J;  2LDU A;  1LDK B;  4FX0 A;  4V2F A;  1JUS A;  2BE5 F;  1KYZ A;  4KT5 C;  1SAU A;  1UCR A;  1Z7L A;  2EV0 A;  2CUZ A;  2YX4 A;  1FYL A;  4II2 A;  4CCJ A;  2R3S A;  4M9X A;  3GO5 A;  4BQO A;  1KQ8 A;  1ZLJ A;  4X0G A;  3H5A A;  4B3X A;  1HW1 A;  4FCY A;  2E2I J;  2PJR A;  2FE3 A;  5DCM B;  3ABT A;  2OBP A;  4M9S A;  4BE1 A;  3G4S I;  3IUO A;  1JXS A;  2P5L C;  1FOW A;  4B09 A;  3PO2 J;  2E5N A;  2CS3 A;  3MQ0 A;  1YIO A;  1VFC A;  2CWE A;  2F2E A;  2ZME B;  1GLN A;  3LQQ A;  2DA6 A;  3NAU A;  4ZZD A;  3C18 A;  4CYC B;  1F36 A;  3ULQ B;  4A3J J;  1WI3 A;  2Y0S N;  4EVI A;  3CJN A;  1RPW A;  3VOD A;  2GXG A;  1FMV A;  1K83 J;  1ERD A;  1O57 A;  2EZK A;  2WAD A;  4L5I A;  1H88 C;  1DPR A;  2X6O A;  2A6E F;  2M9H A;  4M3G A;  2VPR A;  2GLO A;  1ON2 A;  2MC4 A;  4QTR A;  2DDB A;  5DYM A;  1R5G A;  3CO7 C;  2K9Q A;  2VB6 A;  2JTV A;  5EJC A;  3SEZ A;  3DTE A;  4MEY F;  1IF1 A;  2MLG A;  4MLO A;  4AC0 A;  4XKW A;  3AFH A;  3D5S C;  3JSO A;  3SJM A;  4KIB A;  3CTA A;  2JUG A;  3F8F A;  2XSD C;  2FQ3 A;  2L02 A;  1AKH B;  1QHG A;  2M45 A;  2E36 A;  3EUH A;  3TGN A;  3MKW B;  2PMZ N;  2DMT A;  3GTO J;  1X2M A;  1LJ9 A;  2X85 A;  1XDS A;  2OUM A;  3BZ6 A;  3DF8 A;  1ON1 A;  1Z05 A;  1T56 A;  4U88 A;  4KN4 X;  5F08 A;  1NG7 A;  4BAY A;  1AHD P;  2M8G X;  2QYO A;  4MFE A;  4MQV A;  1HDD C;  4OAZ A;  4IHX A;  4II3 A;  2KRF A;  1VQM I;  1OR7 C;  2MSY A;  1J2X A;  3SDG A;  3IC7 A;  1BC8 C;  3ZMS A;  1D5Y A;  4PJ0 C;  1QPM A;  2H94 A;  2DMN A;  1JHF A;  3OYL A;  1JHH A;  3ERM A;  1VQ9 I;  1V5F A;  4MIM A;  3K0L A;  2AXT C;  2ZXI A;  3W6K B;  3K70 D;  5DM6 F;  3HEF A;  3HDD A;  2GWR A;  3FBI B;  4R8H A;  3GYH X;  5CQE A;  3FXM A;  1OIS A;  4F92 B;  2XHK A;  2DQR A;  3OYH A;  2R92 J;  1O3R A;  5KK1 A;  4J00 A;  1OCR H;  1FOY A;  2BXZ A;  2DYS H;  3WGH A;  4PUS A;  4KIF A;  5GAG J;  3N05 A;  3FXK A;  3S2D J;  3L2Q A;  3B02 A;  2BZT A;  2D2W A;  3IWF A;  3BZC A;  1XGN A;  2JUC A;  2RAE A;  4LG3 A;  3CCV I;  2Y2Z A;  3L00 A;  3LSG A;  2OD5 A;  4N0B A;  4F91 B;  3LA3 A;  4A6E A;  1DU6 A;  1FP1 D;  4FET A;  4W1U A;  1ULY A;  2A05 A;  3O8H A;  3H3U A;  2K27 A;  1ETO A;  2HZD A;  1I50 J;  5F27 A;  3FXQ A;  2MFZ A;  5BPD A;  3AG1 H;  4BDY A;  1KZH A;  2OZU A;  3CJT B;  4LLL A;  3PIP F;  1U5T C;  2OV7 A;  1K79 A;  3KP6 A;  1Z3X A;  2G9W A;  5K5O A;  4MTD A;  1MD0 A;  2E1M C;  1O7L A;  3F0C A;  3HZJ A;  3DBH B;  5F0C A;  1MDM B;  4I01 A;  3RPU D;  2YSR A;  2K02 A;  2DU9 A;  4HV6 A;  1VQP I;  1Q1H A;  3WU2 C;  2JK3 A;  1PUE E;  1T95 A;  3OIP A;  1OMI A;  4IOA F;  4XLP F;  1R00 A;  1X1A A;  4PJJ A;  1G3T A;  3J81 Z;  2LSO A;  3BT9 A;  3JRI A;  4A6D A;  3KIO A;  5JLX A;  3ZQ7 A;  2LK2 A;  3J7A O;  2ZXJ A;  3H0G J;  3VYU B;  1UEL B;  3L2C A;  2HEO A;  4D7N A;  3P7N A;  4CCM A;  1I1S A;  4OIQ F;  2CFX A;  1R1U A;  4A5N A;  4YIR X;  4BJT A;  3KP2 A;  1VQ8 I;  4I09 A;  3DCF A;  5LLQ A;  4M3B A;  1F5T A;  1CF7 A;  1D1A A;  3ZR8 X;  1ZGJ A;  2ICW G;  3CCQ I;  4BDZ A;  1LDD A;  2M87 A;  2EIL H;  4P9U A;  1U9N A;  4GO1 A;  4Y52 J;  2EFQ A;  2D1V A;  4HAM A;  1JKO C;  4Z6Y A;  3G6E I;  4I0A A;  2HPM A;  5HS7 A;  3I55 I;  5EGO B;  3L2W A;  4S04 A;  4BEH A;  1Z91 A;  3LQR A;  1UB9 A;  1VI0 A;  2VBX A;  5D4S A;  1U6G A;  2HXI A;  2N8G A;  1WH7 A;  2R7Z J;  2JJ7 A;  3S1R J;  3MKZ A;  2KFD A;  3CD6 I;  2GXA A;  3HC7 A;  2E1O A;  3S3O A;  4RB2 C;  1YRN A;  4XOP A;  3I3L A;  3JTG A;  3PNY A;  2IT0 A;  4HRI A;  3S1N J;  1Z77 A;  4I98 B;  5LHG A;  2VQL A;  3V4G A;  3CMY A;  1J7K A;  1H89 C;  4RMN A;  2F5V A;  4ANJ A;  3V8K A;  2M0M A;  2XPV A;  1FT9 A;  4C3H J;  2K3F A;  2NAZ A;  4N4N B;  2DLL A;  1B8I A;  3TKY A;  2YUS A;  1E0E A;  1X3U A;  2P6S A;  5BPI A;  1R4N B;  3CJR B;  3ESW B;  3CDL A;  3M9A A;  2QQA A;  4AWX B;  3EPZ A;  5M3M J; 
#chains in the Genus database with same CATH homology
 4A3K J;  3I4N J;  1HF0 A;  2ME6 A;  2EZH A;  3QPL A;  5J1Y A;  1GUU A;  4C2M J;  3JRE A;  5C4X J;  1IJW C;  1FTZ A;  3IV5 A;  1GVD A;  4D7M A;  1ZKG A;  2AHQ A;  5M5W J;  4W97 A;  3FIW A;  4A3I J;  1I3Q J;  1W0U A;  2R5Y B;  2E19 A;  4A93 J;  1A5J A;  2LD5 A;  2HDD A;  1QVU A;  4A3M J;  3JRF A;  2R5Y A;  3BQY A;  3L1P A;  1BL0 A;  3RZO J;  3MN2 A;  2LTP A;  3OIO A;  2M34 A;  2JWT A;  3O8G A;  4IEJ A;  4QIW N;  1JUM A;  5EF6 A;  4FE4 A;  1Y1W J;  2VUM J;  1Y1V J;  1RET A;  4UUT A;  1BW6 A;  2QF7 A;  3G1L A;  2M2E A;  4ABZ A;  2R0Q C;  5IYB J;  5JLW A;  4XID A;  3BTL A;  5E3M A;  1POG A;  3B6C A;  1ETX A;  2IBD A;  3TP0 A;  2HQ5 A;  3GTK J;  2DMQ A;  3TP3 A;  3ZOB A;  2XRL A;  1VND A;  3UKG A;  1DU0 A;  1IGN A;  2O7O A;  5HOD A;  5EG0 B;  3OSF A;  3H3V K;  2O9L A;  4FIS A;  3ZQH A;  3K2A A;  5FLV A;  1TWC J;  3IH2 A;  3HBL A;  1JTX A;  5GPC A;  2LP0 A;  1HCR A;  1OFC X;  1LFB A;  2DA1 A;  4JX6 A;  4D5F A;  2WB1 N;  3VPR A;  4JX4 A;  3GTG J;  1G2H A;  1U9O A;  3MVP A;  5E3N A;  5IP7 J;  2FQ4 A;  1MNM C;  1P7J A;  3C2B A;  1B72 B;  3LOC A;  3HM5 A;  1HLV A;  1WCM J;  2YS9 A;  1R9T J;  3BTC A;  3LSP A;  3BR1 A;  2ME0 A;  5EDN A;  4RDU A;  5FKM A;  3W6V A;  3A02 A;  1MBK A;  5GPA A;  3OOU A;  4UUS A;  4XIC A;  1ETV A;  4AUX A;  2MG4 A;  1TWG J;  2DA2 A;  2CUE A;  3HKZ N;  2DJN A;  3HOY J;  3DEW A;  2OPT A;  2XPW A;  9ANT A;  1IRZ A;  1TC3 C;  3JR9 A;  5M3F J;  3JRD A;  3S1M J;  1CQT A;  4DZJ A;  1BJZ A;  2DA3 A;  2DMU A;  4IHY A;  2XPU A;  5EEA A;  2KDZ A;  1PUF B;  2XGD A;  3HGY A;  4B3A A;  1K61 A;  2ELK A;  4M3E A;  4XRM A;  2E2H J;  3S2H J;  2D5V A;  4L5E A;  2Y9Y A;  2MW8 A;  1XS9 A;  1FJL A;  3GTQ J;  1ZK8 A;  2DA5 A;  3FK6 A;  1Z0X A;  2JA8 J;  1U78 A;  3BR2 A;  2P81 A;  2FJ1 A;  2TRT A;  2NVT J;  1E3O C;  4GFB A;  2GM4 A;  1JGG A;  1QRY A;  1XG1 A;  2CQX A;  2NS8 A;  2CRG A;  2LY9 A;  2LKX A;  2ECC A;  2LFB A;  4DZP A;  1O4X A;  1JJ6 C;  1WPK A;  2NVQ J;  3LSR A;  2DA4 A;  2OF7 A;  2ID6 A;  1GV5 A;  3M4O J;  1VF9 A;  3BG3 A;  3WHB A;  1RKW A;  5F0F A;  1ETQ A;  1ZQ3 P;  5FKL A;  1RR7 A;  3BR3 A;  4QSH A;  5F1J A;  3PM1 A;  4AYB N;  2K40 A;  2EQR A;  1I6H J;  1XC5 A;  4BBR J;  3GTJ J;  1RES A;  1IG7 A;  4DYR A;  4BY7 J;  1ZTR A;  4M3F A;  5C4J J;  4C3I J;  5IYD J;  5IOZ A;  1GV2 A;  1UG2 A;  2HI3 A;  3QQA A;  1JJ8 C;  4NDL A;  4IHV A;  2H8R A;  3BTI A;  1H8A C;  5J3L A;  5DTD A;  5K7Z A;  5DS9 A;  5FKK A;  1MBJ A;  1T33 A;  4BY1 J;  1JKR C;  2L0K A;  4A3G J;  2JA7 J;  1UMQ A;  1MBF A;  1GT0 C;  4JYK A;  2L9R A;  2MGQ A;  1HDP A;  3Q0V A;  2HOS A;  4B4C A;  2Y30 A;  2VI6 A;  2VKE A;  2KT0 A;  1JTY A;  2LLK A;  3MKL A;  2VKV A;  3Q0U A;  4JX5 A;  3BR5 A;  1WGX A;  5C3E J;  2X48 A;  1ZR4 A;  2EH3 A;  4IHW A;  1ETK A;  1MBH A;  1JUP A;  5EG0 A;  5IOY A;  2I10 A;  1JT6 A;  1GDT A;  3ZQI A;  1QPI A;  3HOU J;  4A3F J;  3S16 J;  4V2F A;  1JUS A;  1NK2 P;  2ZB9 A;  2EZL A;  4S0H B;  1S7E A;  4JP0 A;  3FIS A;  3CCY A;  3IH4 A;  2JA6 J;  1MSE C;  3PO3 J;  2DTZ A;  4FCY A;  2E2I J;  1SAN A;  3S17 J;  1MBG A;  5J1U A;  1JKQ C;  1B72 A;  2ECB A;  2LR8 A;  3B6A A;  3PO2 J;  3E7L A;  3IH3 A;  3FK7 A;  3K7A J;  3TW6 A;  1VFC A;  1MSF C;  2HXO A;  3TW7 A;  1JKP C;  1Q1V A;  4X6A J;  4V2G A;  1AU7 A;  2DA6 A;  3NAU A;  1A6I A;  2G0E A;  3HGG A;  2W48 A;  1F36 A;  5M5X J;  4CYC B;  1WI3 A;  2Y0S N;  1X2N A;  4BKX A;  4A3J J;  1FEX A;  1LFU P;  2HOT A;  1RPW A;  1RKT A;  5M5Y J;  4DW6 A;  1K83 J;  5C44 J;  2L7Z A;  2EZK A;  3BG9 A;  2HYJ A;  1H88 C;  4X1E A;  1TWA J;  2X6O A;  2M0C A;  2WV1 A;  4I76 A;  2M9H A;  4M3G A;  1MH3 A;  2E2J J;  2VPR A;  2GLO A;  4QTR A;  3S15 J;  2Y9Z A;  2EZI A;  5IP9 J;  2K9Q A;  1PUF A;  1HOM A;  2ID3 A;  1W0T A;  2R5Z B;  4MLO A;  4AC0 A;  1ZGW A;  3SJM A;  2O8K A;  2XSD C;  3S1Q J;  1AKH B;  3SFI A;  1SFO J;  1BA5 A;  3BR6 A;  1YRN B;  1IC8 A;  3HOZ J;  2PMZ N;  5IYC J;  1AKH A;  2DMT A;  3JRA A;  3GTO J;  1X2M A;  2JN6 A;  1NK3 P;  3TED A;  2H1K A;  3LSJ A;  4A3L J;  3BG5 A;  1T56 A;  5F08 A;  1AHD P;  1ETW A;  2M8G X;  4MFE A;  1HDD C;  1BW5 A;  4IHX A;  2XB5 A;  3BTJ A;  4BXX J;  2HOA A;  2MSY A;  1JT0 A;  3JRB A;  3SDG A;  4HNV A;  1F43 A;  3OSG A;  3HB9 A;  5FJ8 J;  1UHS A;  1D5Y A;  5FLM J;  3I4M J;  4LOC A;  3G1M A;  3ZQG A;  4A69 C;  2DMN A;  5E3O A;  4C3J J;  4MIM A;  5E3L A;  3RKQ A;  1QVT A;  3HEF A;  3HDD A;  2CU7 A;  1MH4 A;  1U8B A;  1IDY A;  4XRS G;  5GP9 A;  1NTC A;  2YU9 J;  2R92 J;  1FTT A;  5EYR A;  2DA7 A;  4XRS A;  1IV6 A;  3ZQF A;  3D1N I;  3GBG A;  2B63 J;  1OCT C;  3QPS A;  1X58 A;  1ITY A;  3S2D J;  2NVY J;  1WH5 A;  5BNG A;  3M3Y J;  2QCO A;  4M3D A;  2RAE A;  2Y2Z A;  3LSG A;  1DU6 A;  2DN0 A;  4W1U A;  5EZG A;  1P7I A;  4D5C A;  2CUF A;  3O8H A;  1TWF J;  1ETO A;  4G12 A;  2K9N A;  1I50 J;  5F27 A;  2EBI A;  2COB A;  3RQI A;  2CJJ A;  4DYC A;  2WAQ N;  2FX0 A;  1FIA A;  2L7F P;  4MO7 A;  4DYQ A;  3G1O A;  4A3C J;  1OCP A;  3LNQ A;  3JRG A;  2TCT A;  3F0C A;  5F0C A;  5K7H A;  2FD5 A;  5IPA A;  2LVS A;  1APL C;  2DMP A;  3GTM J;  2JK3 A;  4B1R A;  3ZQC A;  4MFD A;  3HOW J;  1EF4 A;  3BT9 A;  3WHC A;  3JRI A;  3ZQL A;  1FIP A;  2IAI A;  3Q0W A;  3Q3S A;  5JLX A;  5IP6 A;  1LE8 B;  4J19 A;  2LK2 A;  3H0G J;  2L7M P;  4D7N A;  5F04 A;  3RZD J;  1LE8 A;  5J1R A;  2CQQ A;  5F0H A;  1IUF A;  3HOV J;  4FE7 A;  4CYC A;  3DCF A;  5EZH A;  2R93 J;  4M3B A;  3GTP J;  1TWH J;  2JMW A;  2IEK A;  4UUS B;  1U9N A;  4Y52 J;  4RBO A;  1IDZ A;  1ORK A;  1JKO C;  3BQZ A;  5EGO B;  3NAR A;  1OJL A;  2AO9 A;  2X9D A;  2XB0 X;  2XGE A;  1VI0 A;  2R5Z A;  2JA5 J;  5EGO A;  2K9S A;  2HXI A;  2NVX J;  2GBY A;  1WH7 A;  2N8G A;  1ZR2 A;  2R7Z J;  2JJ7 A;  3JRH A;  4A3D J;  5K7F A;  3S1R J;  4A3B J;  3HOX J;  4A3E J;  1ETY A;  2E1O A;  4EEF G;  1YRN A;  3A01 B;  5FKN A;  4BBS J;  3S14 J;  4XK4 A;  3S1N J;  3A01 A;  1ENH A;  3A03 A;  1Z77 A;  3BR0 A;  3CMY A;  2XGC A;  4M6V A;  3CQZ J;  1H89 C;  1B8I B;  2NOG A;  4Y7N J;  2XPV A;  3GTL J;  4C3H J;  4FTH A;  1B8I A;  3FKI J;  5FKO A;  3JRC A;  2YUS A;  4I6Z A;  3CDL A;  5M3M J;  2Y31 A;  1MBE A;  2NS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...