1ENHA

Structural studies of the engrailed homeodomain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
54
structure length
54
Chain Sequence
RPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNKRAKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENGRAILED HOMEODOMAIN
publication title Structural studies of the engrailed homeodomain.
pubmed rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
total genus 22
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 1994-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1enhA00
2W48A 3HM5A 2ME6A 3WHCA 5K7FA 2N8GA 4IEJA 5C4JJ 4XIDA 1IG7A 3S2DJ 1QVUA 2MG4A 3BR6A 2OF7A 4C3JJ 1AKHB 2HOSA 3OSGA 2HYJA 5BNGA 3GTOJ 3LSPA 3G1OA 2Y2ZA 2AHQA 1ETXA 2ME0A 2VUMJ 1FJLA 2HXOA 5C3EJ 1H8AC 3E7LA 1ETOA 2B63J 2M34A 2ID6A 9ANTA 1FTTA 4A3KJ 3C2BA 1ETVA 1TWGJ 5F08A 3BR0A 1Y1WJ 1IDYA 2ECCA 1LFUP 2CQXA 2E2JJ 5F0CA 2X9DA 5IP9J 4UUTA 3CDLA 5J3LA 3OIOA 5IYCJ 1MSFC 2L7FP 2AO9A 2PMZN 3S14J 4EEFG 2R93J 3DCFA 1X2MA 1H88C 1MBFA 4MFEA 4W97A 4B3AA 5J1RA 5GPAA 2DMPA 5F04A 1UHSA 4M3DA 1ZGWA 4DYRA 5EDNA 1X58A 2K9QA 3GTMJ 1MBJA 2FJ1A 4BY1J 3SDGA 1ETWA 1HDDC 1YRNA 4FE7A 1U8BA 2FD5A 5FLMJ 5M3FJ 3HGGA 3H0GJ 5EG0B 2K9NA 3VPRA 1B8IB 2XB5A 2EQRA 4M3GA 2H1KA 3S2HJ 4AC0A 1YRNB 3FKIJ 5EGOB 1SFOJ 4I6ZA 2ZB9A 5M5WJ 1IJWC 4JX5A 3ZQGA 3LNQA 4A69C 1W0TA 5M3MJ 2R0QC 1JGGA 1TWFJ 3MN2A 1QRYA 2MW8A 3JR9A 1JUSA 2Y30A 2DA1A 3IV5A 1MH4A 3BG9A 2L9RA 5IYBJ 4Y7NJ 1ETYA 4UUSB 5E3MA 2GM4A 4FE4A 5FKNA 1TWHJ 2XGDA 1A6IA 1O4XA 5F0FA 5M5XJ 3SJMA 3BTCA 2YS9A 2DN0A 1U9OA 1WH5A 3H3VK 2HI3A 3ZQLA 1BA5A 4XICA 1JKOC 4M6VA 4A3IJ 4QIWN 4RBOA 1APLC 3JRIA 1MH3A 5IPAA 3NAUA 2CQQA 1VFCA 1F43A 3RZDJ 4BBSJ 3OOUA 4IHWA 1FEXA 1ZQ3P 2XPWA 1RR7A 2IEKA 4D5CA 1CQTA 5J1UA 2NOGA 3ZQIA 3B6CA 2DMQA 1I6HJ 1B72A 4B1RA 4L5EA 3LSRA 2O8KA 2MGQA 5IP7J 3FK7A 3Q3SA 2DA7A 3W6VA 2DA4A 3CQZJ 2M8GX 3HGYA 5FKLA 2E19A 1K83J 4XRMA 2JJ7A 2NS7A 5J1YA 3HBLA 1WCMJ 2CUFA 2XGEA 1B72B 1GT0C 4D7MA 1WGXA 3FK6A 5E3NA 1GV5A 3BTLA 3K7AJ 2YUSA 1ETKA 2R7ZJ 1Z0XA 1MBKA 1HCRA 2R5YA 1T56A 3JRAA 2E1OA 3S1QJ 2JA7J 4JX4A 2X6OA 3BTJA 2Y9ZA 1TC3C 4C2MJ 1ZKGA 2WV1A 4NDLA 3M4OJ 2KT0A 5FJ8J 1TWAJ 2R5YB 4MIMA 3BR1A 2TCTA 2NVXJ 3S1MJ 1OJLA 2FQ4A 2NS8A 1PUFA 2CU7A 3BT9A 1GVDA 2R5ZA 1JKQC 1GDTA 2JK3A 5EZGA 2IBDA 4JP0A 2LK2A 4RDUA 1Z77A 2WAQN 3BR3A 3GTKJ 1ZR4A 1MNMC 2EZLA 5FKKA 4XK4A 2OPTA 2ELKA 2HXIA 2CJJA 2R5ZB 3WHBA 2HQ5A 2XSDC 3S15J 1GUUA 1IRZA 5M5YJ 3MVPA 1W0UA 5F0HA 1R9TJ 1RKTA 4M3BA 4GFBA 2M9HA 4IHXA 3JRBA 1VI0A 3GBGA 4S0HB 2Y31A 2K40A 5IOZA 3A02A 1OFCX 3JREA 4QSHA 3PO3J 1VF9A 1S7EA 5EEAA 3PO2J 1OCTC 4M3FA 1POGA 4MFDA 1HF0A 1F36A 4FCYA 3SFIA 2VKVA 1HDPA 2MSYA 3Q0WA 3GTLJ 1MBHA 3DEWA 1IUFA 1ZR2A 1JUPA 3GTGJ 3BR2A 1I3QJ 2KDZA 4LOCA 2O9LA 1BJZA 1HLVA 4C3HJ 3F0CA 2XPUA 1AHDP 2NVQJ 2DA6A 4B4CA 5IOYA 3HOYJ 2QCOA 2QF7A 3TW7A 3LSJA 1JT6A 1IDZA 4MO7A 1VNDA 1MBEA 1U78A 2EZHA 4AYBN 5EF6A 3CMYA 3MKLA 4X1EA 1RESA 1JUMA 1IGNA 3BR5A 2L0KA 1ETQA 4A3EJ 4A3FJ 1TWCJ 2LP0A 3ZQCA 3Q0UA 1RETA 4DYQA 4A3CJ 3BQZA 5EYRA 3BTIA 4ABZA 2JA8J 1MBGA 2EZIA 1WPKA 2NVTJ 3HOWJ 5K7ZA 2XPVA 2YU9J 2G0EA 2LKXA 2Y9YA 1JJ8C 4DZJA 3QQAA 1K61A 4DW6A 2JWTA 3Q0VA 3S1RJ 2M0CA 1JJ6C 3O8GA 1ORKA 2NVYJ 1WH7A 4JYKA 3K2AA 3D1NI 3QPSA 1UMQA 4D7NA 1E3OC 1AKHA 3RKQA 2LLKA 2L7MP 1FTZA 3ZOBA 1JKRC 3HB9A 2LY9A 2DMNA 5DS9A 5K7HA 1DU0A 2VKEA 3HKZN 2JMWA 1QPIA 4BY7J 4IHVA 2ID3A 1P7IA 2JA5J 5FKOA 1BL0A 1NK2P 3FISA 4MLOA 3JRFA 2HOAA 5HODA 5DTDA 1ITYA 3O8HA 2CRGA 2JN6A 3HOVJ 1G2HA 2TRTA 5F27A 5IP6A 2L7ZA 2VPRA 1EF4A 4A3JJ 2X48A 4A3MJ 2I10A 1ENHA 1PUFB 4A3DJ 1Q1VA 4QTRA 5C44J 4A3LJ 1XC5A 1Y1VJ 5EZHA 2DA5A 3NARA 3G1MA 1H89C 3GTQJ 3L1PA 2LVSA 1XS9A 2DJNA 1I50J 1RPWA 2EZKA 1JKPC 3FIWA 5C4XJ 4D5FA 2EH3A 2VI6A 2RAEA 3QPLA 2DA2A 4M3EA 1IC8A 5FLVA 2H8RA 4IHYA 5EG0A 1AU7A 3JRGA 1XG1A 1B8IA 1FIPA 4XRSG 5F1JA 2LTPA 3RQIA 5JLXA 5EGOA 1WI3A 4G12A 1UG2A 4A3GJ 1LE8A 4V2FA 3JRHA 2FX0A 3GTPJ 1D5YA 2GBYA 3ZQFA 4CYCA 1QVTA 3LOCA 3UKGA 1NK3P 2O7OA 1X2NA 1MSEC 4HNVA 2DMUA 4FTHA 4W1UA 2E2IJ 3I4NJ 3JRDA 1LE8B 5E3LA 2DTZA 2EBIA 1P7JA 4UUSA 2M2EA 2K9SA 2CUEA 4CYCB 2Y0SN 3IH3A 1OCPA 2JA6J 3HOZJ 2GLOA 4A93J 5GP9A 3PM1A 3HOUJ 1SANA 1LFBA 3I4MJ 3TP3A 2XGCA 4I76A 1BW5A 3HEFA 3S16J 5GPCA 4AUXA 1U9NA 5JLWA 3LSGA 4C3IJ 4J19A 5FKMA 4BXXJ 1A5JA 4V2GA 3A01A 3HOXJ 1BW6A 4XRSA 2LR8A 2ECBA 2HOTA 2HDDA 2D5VA 1T33A 1IV6A 3IH2A 3BG5A 3OSFA 1ZTRA 3TEDA 3S1NJ 1ZK8A 2DMTA 3G1LA 4BKXA 1HOMA 2XB0X 3GTJJ 2R92J 5IYDJ 3A01B 1FIAA 1RKWA 2COBA 3A03A 4A3BJ 3HDDA 3BG3A 3IH4A 4FISA 3JRCA 1JTYA 2WB1N 3S17J 1GV2A 3M3YJ 3CCYA 3ZQHA 3BQYA 3RZOJ 1DU6A 1JTXA 4JX6A 4DYCA 4X6AJ 2DA3A 3B6AA 2IAIA 3TP0A 3TW6A 4DZPA 1JT0A 4BBRJ 2E2HJ 2LFBA 4Y52J 1NTCA 2XRLA 5E3OA 2P81A 2LD5A
chains in the Genus database with same CATH superfamily
5DM6F 3PUBA 1IN6A 3AG3H 3WHCA 1FOXA 3BG7A 3FXQA 1DQUA 3FXLA 3M8FA 1QVUA 2X6XA 4XIDA 3WTUC 3KP6A 1CF7B 2ESNA 2B0LA 5KNLA 4D1QA 4C3JJ 2ACJA 1AKHB 4RGRA 5BNGA 2HPIA 3CCUI 1D1CA 4EQQA 3G1OA 2Y2ZA 2DXIA 3IWFA 2FA5A 1MNEA 2VUMJ 1ZRCA 2I8DA 2HXOA 1SEUA 1FOWA 2YX7A 4NC7A 2IGKA 1A04A 1ETOA 4UVCA 1WWXA 2PJRA 2FF4A 9ANTA 1N78A 3KX2A 2R7UA 5LBQA 4B44A 1G59A 2ECCA 4XLNF 3T8RA 4ESJA 2M3AA 2HVSA 2X9DA 3MZ8A 4UUTA 2PJRB 2F4OB 1MSFC 2L7FP 2PMZN 2F5EA 3BZKA 4EEFG 2R93J 2P7VB 5HDKA 4WXCA 4E4HA 1YLFA 3D5SC 4S04A 1H88C 2W1OA 2KKOA 3ABKH 2GA1A 3OR2C 2MLKA 5F04A 3HG9A 5L3BA 4M3DA 3K4KA 4DYRA 3ZCOA 3IC7A 3SEQA 3AG4H 3VYSB 2VQCA 3LQQA 1MBJA 3WTTC 3SDGA 1XMAA 4I98B 3LA7A 4NB5A 2GIZA 3D5LA 2LF7A 2X1EA 2B9SA 2IPQX 2K9NA 3KP4A 2E1MB 3VPRA 1TNTA 1B8IB 2XB5A 1JE8A 3BP8A 3QU3A 3RDIA 1P4WA 4DJAA 1HW1A 3RPUD 1P9QC 2WA0A 4TV7A 2DI3A 5FGMA 2DAOA 2EB7A 2R0QC 4BNCA 1F1ZA 2KP6A 1JGGA 1JUSA 2Y30A 3IV5A 1UHMA 4B47A 5B66C 5GTHC 2L9RA 2A6TA 3QYFA 5IYBJ 1ETYA 1MDMA 3ZMZA 4UUSB 5FLXK 3JSPA 5LD2C 1NG6A 1Z6TA 5B1AH 3WODF 3K4MA 4WF2A 3SJMA 2HYFA 3JW4A 3MKYB 3ECOA 4RLQA 3R4KA 2WC2A 1FP2A 4PDKA 1E17A 1Q1HA 2H6CA 3FMSA 2L7KA 4KIFA 3LA2A 1YHQI 2E7WA 2EIJH 4C2TA 1WJCA 1F43A 4G8XA 2D2WA 3CO6C 5CJ9A 4BBSJ 4EGZA 1T0FC 2XPWA 2IEKA 1I27A 2NOGA 4IKFA 4AD9A 5CYVA 2ZO4A 2IGMA 3SYTA 1FX7A 2FOKA 4R1HA 3ZQQA 1BI1A 5D6EA 5E17F 5FB2A 3L09A 2O8KA 5FRMA 1FT9A 2MGQA 3F6VA 4N4NB 1DPUA 3PQJA 5H2FC 2R7SA 4S05A 5H6RA 2VE8A 4DBQA 1K83J 1OQYA 4M6XA 4HSRA 3L2WA 2JJ7A 4WCGA 1EKEA 3HBLA 3PQKA 3I59A 1FPQA 1USTA 3H9JA 3DBHB 3BZCA 2YSRA 1A31A 2EIMH 2MD0A 3K7AJ 2ETHA 3OL3A 1O3SA 1ETKA 2P6TA 4XLFA 1SFUA 1P4AA 4ITVA 4LB5A 1QPMA 1YIOA 1J2XA 3FBNB 3I59B 3AKZA 3BZ6A 3JRAA 4ESFA 3HRSA 5HVQC 2DT7B 2E1OA 3HRMA 4B8XA 3MCZA 3EUHC 2P0WA 4CO8A 1YS6A 2WV1A 4NDLA 3M4OJ 3H9QA 4XM3A 1EH8A 4LGWA 2VB6A 2IGOA 2ZKZA 3MWMA 3ZGKA 4MIMA 1MGTA 2TCTA 2GXAA 2Q8KA 2CW0F 5L3GA 1YTYA 2V7FA 2BE5F 2QQBA 2VQHA 1L3LA 1PUFA 1YJ9I 1EH7A 2DOFA 2YPRA 4MTEA 1MW7A 2CU7A 3RYPA 4JQFA 3OYJA 1SD7A 3F8NA 2R5ZA 4Y17A 4UV9A 4JP0A 2LK2A 1XTAA 3GTKJ 3KLOA 5TISC 3HRTA 5CVUA 4XOTA 2GAUA 4NQWB 4XK4A 2OPTA 2ELKA 1RI7A 2HXIA 2PMUA 3KZIC 4I2OA 2R5ZB 1WJAA 3LFUA 4PGGA 2PLYA 2HYGD 1TQIA 4RAFA 5TGTA 3SXYA 2HQ5A 2EA4A 3S15J 5DDGA 1GXQA 3TKYA 3CMEI 3EQLF 2ZXHA 2XIGA 4M3BA 2K86A 1G4DA 1TLHB 1TZLA 2V1NA 1G6NA 2Y31A 5F6FA 1XDUA 2L3DA 5IOZA 1OFCX 4KNYA 4OMZA 2ICWG 2DBBA 1Z21A 3WTVC 4L5IA 2V1DA 4BH9A 3IKTA 4RM3A 1U0JA 1HF0A 3BPXA 2MC4A 3K0LA 4MEYF 1F36A 4FCYA 2WTEA 1YFHA 3P7NA 2P6SA 3E5UA 2MSYA 1B9MA 4RAZA 4CXFA 1IUFA 3K9TA 3DTKA 3DPTA 2YR2A 2A6EF 3OYDA 3EYIA 2O3FA 1I3QJ 2QSHX 3KZYA 2HOEA 3R6SA 3TOBA 3TQNA 2DTRA 2HS5A 2CH0A 2NVQJ 4GXOA 5LHIA 1FBQA 3HC7A 1D8JA 1GXPA 3HOYJ 1PP7U 2QF7A 1TBXA 3FXMA 5BPDA 2QGUA 1NG7A 1IDZA 4U0WA 5CVVA 4ZYAA 2L9VA 2QSGX 4MEXF 1WI9A 4F55A 3CP8A 5EF6A 3MKLA 2FBHA 2HZTA 3R0AA 2HEOA 1SMTA 1J9IA 2B7EA 4G94A 3BR5A 3OYMA 1O3RA 4HX4A 1ETQA 2E1MC 3I9V2 4F3QA 1RETA 2DFEA 3IKVA 5EYRA 2JA8J 1O3QA 2NVTJ 4OIOF 5K7ZA 2YU9J 4ENNA 2LKXA 4E6KG 4C9YA 1OMIA 3DLAA 2AXTC 1K61A 1Y39A 2UXXA 1R5GA 3K1PA 3MKWB 2IXSA 3G3ZA 3Q0VA 3S1RJ 2I5UA 1V54H 1WH7A 2XKPA 1X1BA 4XLPF 5BMZA 3QPSA 2Y69H 1TQPA 1E3OC 3VDXA 3RKQA 3NQOA 1K7AA 1FTZA 2KQRA 2QWWA 1JKRC 4KN7X 3FMQA 2DMNA 3I0TA 2MLGA 5K7HA 1DU0A 2CMPA 2XAUA 3CCMI 2VKEA 1W5TA 1LEAA 2VOOA 4BY7J 3L2QA 2HZDA 4IHVA 3FMRA 3IP4B 2ID3A 4NUBA 1P7IA 5EEGA 5CKTA 4HLYA 5IY5H 1BL0A 2F48A 4M71A 3K70D 2HOAA 5HODA 2L02A 2EINH 2V6EA 1HXDA 1WRJA 4XONA 3V7CA 3VSKA 1A35A 4CDGA 3KE2A 2W24A 3S93A 2QA4I 3V8JA 5IP6A 2VPRA 1EF4A 1BJAA 2V4JC 4LITA 2X1DA 2I10A 5KCMA 2O61A 3I5UA 1WHUA 2BZTA 1P92A 3ZP5A 3C18A 1XC5A 2CSOA 5EZHA 3PIPF 3C2HA 3FKJA 3GTQJ 2M7BA 3T0YA 4UXNA 3WG7H 1KONA 1XCVA 4IF4A 4DBRA 1X19A 1IRXA 4RB3C 3L1PA 2CWEA 1V3FA 1XS9A 2DJNA 1D1BA 6PAXA 1FBUA 1JKPC 1MJBA 5C4XJ 4D5FA 2VI6A 4DIQA 2W84A 4EV0A 1R1UA 1FNNA 4M3EA 2J5PA 3G6EI 4RGXA 3WTWC 3ZQ7A 3JRGA 1XG1A 2NNNA 3HSRA 4XRSG 4XBFA 3CUQA 1W5SA 1WI3A 2NYXA 3MQ0A 1W7PA 2FX0A 2X85A 4XSXF 3QP5A 2XAJA 1BIBA 3ZMDA 4CYCA 2VLAA 3L2RA 3QOPA 4PJNA 1KQ0A 2ADUA 3UKGA 2O7OA 1R4NB 1X2NA 2EFQA 4YRVA 3OS1A 4LG3A 1OPCA 1QNTA 2CFXA 1Y8RB 4E7SA 2QLZA 5E3LA 4UY8I 2EBIA 1X1CA 4ZTFA 2M2EA 2HPMA 4PJJA 4CYCB 2JA6J 2GLOA 1BI0A 1ZGAA 1H9GA 3HOUJ 1PYVA 1LFBA 3I4MJ 3MKZA 2RN7A 1BW5A 3HEFA 1DPRA 3RQ4A 3S2WA 1U9NA 4C3IJ 2G7HA 3QODA 5FKMA 4BXXJ 4V2GA 1LQ1A 1T33A 2HTJA 3HXLA 3H36A 3K1NA 2ZJRF 4L0ZB 1FY7A 2HDCA 3CO7C 2OV7A 4BKXA 2IW5A 2PFBA 1T08B 2WAFA 4KN4X 2VL8A 1RKWA 3BY6A 1TT5B 3GFIA 3HDDA 3BG3A 3J7AO 4Q47A 2DW4A 1ZAOA 2A3SA 1ZELA 5ED4A 1J7KA 1VQ8I 4LLNA 1GV2A 4OIPF 4ESBA 1P4XA 2LREA 4ON0A 1IV8A 1G3SA 2K9MA 3VYRB 1K6OA 1MKMA 4X6AJ 2XC7A 1X4OA 2XF7A 2JZYA 1B1BA 1YYVA 1D0YA 5B1BH 1VQPI 3WTSC 4BXFA 3OYNA 1U6GA 4XLHA 1YX3A 2V1UA 2FSWA 3F22A 5K7FA 1UZCA 1SVOA 3CESA 3CJQB 3HPGA 2HQNA 3JAMK 2LY1A 2HOSA 5LEJA 1HSJA 4AIHA 2BV6A 3DPUA 1E2XA 3FF5A 4M74A 2VPLA 1FJLA 1UFMA 3GFJA 3BJ6A 5D4RA 2X0LA 3M8EA 5EJCA 3WTXC 2Z16A 4XLAA 3UNGC 3JSOA 1KU2A 3FZVA 3HSEA 5HS8A 5IT3A 3CD6I 1IAWA 3GO5A 2QBYB 2EFPA 4JBAA 3KFWX 4PJMA 5F08A 4KMUX 4ZYEA 1LFUP 2MA3A 1D0XA 3FBIB 5DV5A 4OINF 4BHPA 4F92B 4EJWA 5IP9J 1JI8A 2EA2A 4HX8A 5ICFA 5GAGJ 4IZZA 3S14J 1MMAA 1J59A 3LSTA 1CGPA 5DCFA 3OMYA 3DCFA 1X2MA 2TDXA 4RM2A 5E8IA 4B3AA 5J1RA 2F5DA 1SFKA 2LH9A 2WAQA 4BS9A 1ZRDA 2VQLA 2VJ5A 1Y0NA 3I71A 3OYEA 5HOOA 3VYTB 1O57A 1R58A 1DDNA 1XGSA 4CCLA 2Z2SB 4BY1J 3G2BA 5GADJ 3V4GA 1MJ9A 2IRFG 3KETA 4HF2A 2LG4A 3HHHA 3KP5A 1Y0UA 4Z6YA 3TBIA 3JCUC 5CLSA 4FE7A 2BXZA 2FD5A 5FLMJ 2HVQA 2OAZA 3I4PA 5FFZA 2Z5UA 1LVAA 1OLTA 1Z7LA 2EIKH 5EG0B 2UXNA 2UZKA 2EQRA 4M3GA 3WGIA 2D1VA 1GLNA 2KZVA 1SFOJ 4FQGA 1DGRM 4K2EA 4OWRB 3CCEI 3LNQA 3I56I 1D3YA 1W0TA 2FU4A 5M3MJ 3ZXSA 4WXDA 1Z05A 2R7QA 1ZG5A 2IS4A 2MW8A 3JR9A 2DQRA 1O7LA 3V8LA 4F7ZA 1TW2A 1MH4A 2P5LC 2ZJ2A 1FC3A 3FDYA 4RGUA 4J00A 2FBIA 1IRGA 5E3MA 4FE4A 5FKNA 1KQ8A 2CQNA 1WZ2A 1RC9A 2D1HA 1B6AA 4D9JA 4CZZA 4RLFA 1O4XA 1IXRC 2XAFA 4IOAF 3L7WA 3BTCA 2DN0A 3E6CC 2VKHA 5CQEA 1YX5A 2XUBA 4M9XA 3BCBA 5DD8A 4ASNA 3CZ6A 1ON1A 2E36A 1APLC 2XROA 3ECHA 3JRIA 3HRUA 3E5QA 2P7CB 4Y13A 5F1RA 4H4KC 1LDDA 2CQQA 4L5JA 1A6QA 4XN0A 3V8KA 2K4BA 1QQIA 3RZDJ 4IHWA 4A6DA 5D8LB 1D5VA 4U0VA 1B59A 5J1UA 5ICEA 4PZJA 2DMQA 1XGOA 2RC4A 1PDNC 4XNFA 1I6HJ 2OU2A 3L9FA 2ZNZA 4L5EA 4CCNA 3P9KA 3LSRA 3LL7A 3DTEA 4LJZF 5FKLA 2M8GX 2E19A 2FEZA 2M30A 1AA7A 2K7LA 3D0SA 4E7ZA 5J1YA 2CUFA 2XGEA 3C2GA 1DGWY 1HKQA 4D7MA 4G9YA 2Z99A 1GT0C 3FK6A 3CF2A 2BXYA 3GLXA 2YUSA 2JRMA 5J4VA 4XKCA 3J81K 4CCJA 3IAS2 4M6YA 2R7ZJ 3GZ6A 3RIRA 1HCRA 5J8CA 4GCVA 3OYIA 2P8TA 3ML6A 2WV0A 2JA7J 1TC3C 5HLTA 2R7DA 4R8HA 4ZH4F 3OIQA 1J75A 2IVMA 4RAGA 4UB8C 1YJWI 5FJ8J 3SQNA 4BQQA 2GZWA 2MC3A 3BR1A 3BJAA 2QEXI 1TP4A 1FZPB 2NVXJ 1HQCA 3U1KA 4FHTA 3S1MJ 2IS1A 2MH2A 3HJEA 4CUGA 2R7RA 3V42A 1BR4A 3PIOF 4I01A 3TOAA 1LB2A 1TQMA 4QPQA 1BIAA 1JKQC 2K85A 4HSTA 2H6BA 3R60A 2E5NA 5EZGA 2J5OA 2OCCH 2IBDA 4Q48A 2LMDA 3DFGA 1K6YA 1XSXA 2K4JA 2VQGA 5FKKA 4ENJA 1FWZA 2VODA 1O3TA 1R1VA 3MEXA 4HOBA 1C0WA 3WHBA 4AIKA 2HR3A 1GUUA 2DOEA 1IRZA 4B3XA 4AM3A 1OCCH 4F52A 2VT2A 4IPAA 1R9TJ 4YEJA 1VI0A 4BQOA 3OV8A 4S0HB 2NAZA 2BGCA 1VQNI 2WY8Q 3J81Z 4Z2YA 4BJ6C 1R71A 1S7EA 5EEAA 3PO2J 1H0MA 2DPDA 1B9NA 4L0YB 2ZMEA 5F64A 2F6CA 4WK8F 3PFYA 4XN3A 1Y8QB 1WVRA 2BYVE 3SFIA 2Y0SA 1HDPA 5HNFA 3GMEA 4HQEA 1UB9A 3DKWA 2DFFA 3K70C 1SFEA 2VJJA 4XMYA 1ZR2A 1JUPA 2A05A 1KQ9A 4ANJA 2CV0A 1BJZA 2OZ6A 3BJOA 3HTSB 3PSFA 1LFPA 2X6YA 4M9SA 1MDMB 1EA3A 1AHDP 3QOEA 5IOYA 1JGSA 1MMNA 2KIQA 3TGNA 2QCOA 1DUXC 2E35A 4LG0A 2R7XA 4ENKA 3RYRA 3S3OA 3H5AA 4RMNA 1JT6A 2VC0A 2O5RA 4EATA 2ZJPF 4UV8A 4BDYA 1OR7C 1VNDA 3LWFA 1MBEA 3CJTB 1U78A 4O3MA 3GVAA 1U5TA 1RIOH 2IA1A 4AYBN 5J4YA 1RESA 1IGNA 4LG0B 2L0KA 3IWZA 4BJTA 3K2ZA 3C1DA 2DO7A 4DYQA 2D45A 3BTIA 3CDHA 4M72A 4ABZA 1U5TB 1YW9A 1WPKA 3QWLA 1RRJA 2ISZA 4F91B 2G0EA 2W25A 2QUFA 2Y9YA 3DBLB 1JJ8C 4DZJA 4BQAA 2GOXB 3QQAA 2A68F 4DW6A 2JWTA 2Y48A 5ILVA 2OBPA 2XAGA 2M0CA 1OYYA 2NVYJ 5GTIC 1YE9A 1YIJI 2DQLA 4MHGA 4MTDA 3CCLI 1J5YA 5KHDA 4IHSA 1QHHD 2IA2A 4IQ4A 2M8EA 3TDZC 3W6KB 1MJAA 3ABLH 4L9JA 3AG1H 5CPRB 4CCOA 4ZZDA 2LY9A 3E6DA 2PJPA 2Z9OA 5H20A 2JMWA 3AL0B 3J7AY 4Q4ZF 1XSDA 3ERMA 4C30A 2BOLA 2PQ8A 2UWMA 5FKOA 3KYDB 4KA4A 1NK2P 3FISA 1ITYA 2KMUA 2JN6A 3HOVJ 1UELB 4NNJA 4XL9A 3WU2C 2BY2A 1ZRFA 3GEZA 3QPHA 1S5LC 2WY7Q 2PMZA 4HF1A 3CLOA 4PGHA 3T8TA 4IRIA 3WTZA 3I55I 3EYYA 4HG2A 1ENHA 1PUFB 3K1MA 4BEHA 3KCCA 4HX7A 2IS6A 5L3DA 1Z3XA 3BC8A 2K3FA 1YITI 4EM0B 4HAMA 1I50J 1RPWA 5E1WA 3PNTA 1YQAA 3FIWA 4FX4A 2EH3A 4RB0A 2WAEA 2H8RA 4IHYA 1AU7A 5IT9Z 2HDWA 2VN2A 2NRAC 3J80K 5AIPA 5F1JA 1WJ5A 3DQVC 3RQIA 1BBYA 5EGOA 3ASOH 2KISA 2ELJA 4V2FA 4AVZA 1PJRA 1XCBA 4ZJZA 2CS3A 4CSWA 1SVLA 1D5YA 1R7JA 2K3PA 4MQ9F 4IVNA 3LOCA 2R4GA 3GFLA 2LRDA 3F21A 3GXOA 4ZZLA 4IRHA 4FTHA 2EFNA 3I4NJ 2PEXA 1MIJA 2O6GE 2WBMA 2ZXWH 4YIRX 2P4WA 1OCPA 3N4MA 3RPUA 5GP9A 3PM1A 1XX5A 3TP3A 5L3FA 1LVKA 4WX9A 4J01A 3VYUB 2BHZA 1MD0A 3MAJA 3A2KA 1HA8A 1X4PA 3IUOA 1HC8A 2F5VA 4J19A 3F8CA 3H35A 4LIUA 2CUJA 3AG2H 2ELHA 3H0DA 1T8IA 2HDDA 2D5VA 2Q2EA 1IV6A 3BG5A 3P9IA 2OJED 5FO5A 3ZN1A 3GZ5A 1WJBA 3TEDA 3OSFA 1ZK8A 3G1LA 3S1NJ 3ESWB 1SAXA 4I99C 3GTJJ 2KRFA 2IA0A 3OIPA 5DEQA 2COBA 1R23A 4UHTA 1Z7UA 3BPVA 1XPXA 3W2AA 4A3BJ 4P5OA 4YIIA 1V4RA 1ZLJA 3RKYA 1ZGJA 3QYBA 1XMXA 3CCYA 5KK1A 3ZQHA 3PUFA 3BQYA 3RZOJ 1JTXA 2DA3A 2HFHA 4UB6C 3J80Z 2E2HJ 2LFBA 2ZSIB 2R7TA 5H6QA 3FHZA 2K27A 1UJ8A 3S32A 2HQRA 1Z9CA 3HM5A 2ME6A 4PFOA 4IEJA 5E79C 5D4SA 3S2DJ 1IG7A 4HEA2 1EV7A 3RKWA 3HTUA 2VT3A 3BR6A 4I0AA 3CC2I 3OSGA 2HYJA 2JUGA 2F5CA 2X4HA 5J6XA 4L18B 1FYKA 3GTOJ 1V55H 4OIRF 4CYDA 2AHQA 4PJLA 2LSOA 1ETXA 3L2VA 2OZUA 3ZMTA 5C3EJ 4OAZA 4E7LA 2KRCA 2KIMA 2B63J 2M34A 5BS6A 4II2A 1FTTA 2RV8A 4A3KJ 3FM3A 2BW3A 5LRSA 1XGMA 1IZ1A 2KJBA 1VQ7I 1TWGJ 1QGPA 1KGSA 3SZPA 3BR0A 1IDYA 1ZH5A 4XLCA 2CQXA 5F0CA 4KITB 1L0OC 3SZTA 3H5RA 5J3LA 3OIOA 1N75A 5HLIA 2NOJB 1LEBA 3U9GA 2BW3B 1U5TC 3BG6A 5KAFC 3H5NA 1MBFA 1USSA 3QRFF 1WSUA 4LFUA 3CUOA 2QYOA 2VIXA 3MMYB 4A0XA 5GPAA 1UHSA 4KYWA 2OA4A 3F8MA 5CVJA 2IT0A 2LKPA 5EDNA 4RB1A 1X58A 2K9QA 1W36C 2KHMA 1IUYA 2FJ1A 3VB2A 2FNPA 1T6SA 4G7HF 3ZN0A 1ETWA 1WQ2A 4CHUA 1HDDC 4XQFA 1U8BA 4LK1F 3KYLA 4RAYA 3U21A 4KJZA 2KDOA 2EV6A 3M07A 4H0EA 4EM1A 1D8KA 2IJLA 3AL0C 5E1ZB 2KIUA 3A1YA 4AC0A 3OY9A 3CUQB 3CP2A 3P5JA 3FKIJ 1TTYA 3CJNA 3S3NA 2XHKA 4PUSA 2L2OA 3IHUA 1W7PB 4A2UA 5M5WJ 4ENMA 4A6EA 4JX5A 1LDJA 3VEPA 4UNOA 2Y0MA 1BI2A 3DLLF 2Z1DA 3DP7A 3W6JB 2R7FA 4Q5SF 1TWFJ 2JTVA 2R7VA 3OYCA 4BGDA 2DA1A 1Z67A 1KU7A 3BG9A 1N77A 4N0BA 2FMLA 1F5TA 2ZC2A 4Y7NJ 3DBRB 5B5EC 1X3WB 1FYLA 2GM4A 2RNJA 4L9NA 5JI6A 2XGDA 1HW5A 5FFXA 2FQ3A 2OQRA 1MMSA 1PP8F 1VQ9I 5F0FA 5M5XJ 3S3MA 2VONA 1WH5A 4OIQF 2OC6A 4AU7A 2AQFA 2M7AA 4V19K 3ZQLA 1BA5A 4XICA 3QYEA 4KICA 1JKOC 4M6VA 4A3IJ 4QIWN 1BI3A 2BEOA 1MH3A 5AONA 1QU3A 2M4GA 4EGYA 4PK4A 3NAUA 1VFCA 4OMYA 2DFHA 1KZHA 1IN8A 3FXKA 4N9HA 1XSVA 3OL4A 3L00A 1YJNI 4WXHA 1SVMA 1RR7A 1CQTA 4D5CA 2F5FA 2A61A 2F4MB 4II3A 4B09A 2STTA 2STWA 3J7YJ 4BL0B 1B72A 3L2UA 4A0ZA 1SD5A 2P5VA 5B3SH 4FT8A 4EM2A 5IP7J 3FK7A 2DA7A 2DA4A 3CQZJ 3HGYA 5LRRA 1ERDA 3CTAA 3KZZA 1VTNC 1S8NA 2EV0A 4GYGA 1XB4A 2EV5A 3DF8A 4IOCF 4BE1A 2RVCA 1B72B 1WCMJ 5DUKA 1ON2A 3ONQA 3QPTA 2V6CA 5DCMA 3F6OA 2HTSA 2LDUA 5JHUA 2DDAA 4CCMA 5BPIA 2RGVA 4FASD 5GAHJ 2E5ZA 1MBKA 2JUCA 4BUPA 1G3WA 4CH7A 2FNAA 3DU5A 1U3EM 2FXAA 1VQKI 4HYEA 2R5YA 1T56A 3KYCB 4G7OF 1B4AA 2A07F 1S3JA 1NH3A 3S1QJ 4JX4A 1J09A 3BTJA 2KFDA 1KU3A 3CDIA 2Y9ZA 3K4JA 2BY3A 1WJEA 1ZKGA 4A12A 4O5VA 1ZG1A 3W2WA 4D0PA 1J0RA 5ICCA 2R5YB 2QQ8A 3GFMA 4E7HA 2W82A 3A4CA 3VWBA 4HF0A 3NRVA 1OJLA 3BROA 2NS8A 2H27A 2AS5F 3BT9A 4CGZA 2RQPA 3OYHA 3FXRA 1GVDA 2JK3A 2QKMB 4I09A 1H9TA 1Z77A 1ZR4A 4CICA 3Q9VA 1MNMC 3FM5A 2CV1A 2EZLA 4M73A 2A69F 1K78A 2A5WA 2K5CA 3ABTA 2EK5A 3GYHX 4HRIA 1R5HA 1HKSA 4P55A 4DNCA 2O0YA 5HDNA 2GWRA 2DDBA 1R00A 5BQTA 1LJ9A 1P6RA 1T0FA 1V5GA 2XSDC 1QZEA 1R49A 1R22A 2HNHA 4A5NA 4IHXA 3K4BA 2MBFA 2K40A 3HHGA 3A02A 2CW7A 3JREA 4QSHA 4YFXF 4YFKF 4HZFA 2VJIA 2GOMA 4M3FA 2X6WA 1POGA 3P9CA 4MFDA 1X1PA 1QA6A 3I3LA 5JVTA 4KUMA 5LLQA 1FLIA 2ZNYA 3GTLJ 1MNDA 4DOZA 3OWTA 2RKHA 2OTJI 5DD4A 3RTRA 4LOCA 2O9LA 2EJRA 3E97A 5FRNA 2QSFX 3NWTA 1U8RA 2XVCA 2VXZA 3F0CA 5L3EA 1OYWA 2DA6A 4IX7A 3HZJA 3M1CA 3TW7A 3CCQI 4B48A 3O3KA 2VBWA 1O7FA 3PFIA 2DCEA 2GA2A 4GGGA 1Z91A 1SFXA 4MO7A 5E1XA 5J40A 1BC8C 5EEHA 2EZHA 3B73A 3HIFA 5HDGA 1Y6IA 4P1WA 3CF5F 4X1EA 1JUMA 2A6HF 4N9IA 1F9NA 4L9TA 1W36D 1STZA 1XMKA 2R7WA 3DXJF 4A3FJ 1TWCJ 2LP0A 3ZQCA 5D5VB 3BQZA 3E3VA 3LMMA 3CUQC 3FXUA 3HOWJ 3GZNB 3AFHA 1R6RA 2BVLA 5E20A 3BWGA 5L3CA 4MGRA 4UVBA 4RGSA 2BY1A 4JYKA 2HVRA 2QENA 2CYYA 3K2AA 4PCQA 2FE3A 3GF2A 1UMQA 1AKHA 1ACIA 1ZHFA 1BM9A 1OISA 1IXCA 1D0ZA 2DJIA 4BAYA 2XAQA 2OTLI 4BYYA 2ZFWA 2JPCA 2KZGA 3HKZA 3SDBA 3ZRGA 2CFOA 5DS9A 4KFCA 1BOBA 4BDZA 2MFZA 2GQQA 2PN6A 1I6XA 5D5UB 2K9LA 4A0YA 2XKOA 4E70A 2GXGA 5LGTA 4HV5A 5CVRA 2AQEA 1WKMA 2JA5J 3KEQA 5ILUA 2LOOA 3KEYA 4MQVA 4IRGA 4GO1A 3SZGA 3FWEA 4U88A 1XGNA 2VBYA 5F27A 3ABMH 1KYZA 2W7NA 2X48A 1UHWA 5JVGF 2HWVA 4A3MJ 4RS8A 2HU9A 4BXUA 3FXOA 2R7OA 1Q1VA 3O6BB 4QTRA 5C44J 3W2VA 4A3LJ 1VQ4I 1Y1VJ 4U7BA 3WU1B 3H9GA 3Q9SA 4EJOA 3G1MA 1JHFA 2OQGA 1H89C 5K5RA 2LVSA 2NVUB 2V9VA 4WWCA 4KT6A 1VQ6I 3C3WA 4QLCU 4GYIA 1IN5A 1IC8A 2V26A 4NC8A 3E0JB 1M1EB 3RKXA 3AAFA 1B8IA 3LSMA 3M8JA 1ZLKA 3WGHA 4EJVA 4I0BA 5JLXA 4CA0A 1D1AA 2WADA 1UG2A 3EUKL 5TRDA 2BBYA 4O6JA 1LNWA 1LE8A 2DODA 3JRHA 4HV6A 3T1BA 2GBYA 5KVRA 3OYAA 3CC4I 2L9SA 3OS2A 1NK3P 2MD5A 2W00A 1MSEC 4OU0A 4HNVA 5KAIC 4G6TB 5A2QK 3MFKA 2H09A 1LE8B 1E3PA 1KA8A 3CCRI 4DQ2A 3J7ZI 4PSWA 4YFNF 2ZMEB 2V79A 3MD2A 4P96A 4UUSA 2K9SA 1EJ9A 1FOKA 3IH3A 3HOZJ 4ZYHA 2E34A 2V1XA 2IGNA 4A93J 1IW7F 5HLGA 3KP7A 4NC6A 2W4SA 2LC2A 2Y75A 4Y4RA 1X1DA 2XGCA 1R1TA 3VODA 1OCRH 5GPCA 4HLXA 4AUXA 2X51A 5FD6A 3KPHA 1W1WE 2WWYA 5K5QA 1FBSA 2EPFA 1SD4A 4XKBA 3HOXJ 1BW6A 4XRSA 2LR8A 3MZYA 2HOTA 3E6BA 3ZMUA 3RSNA 3IH2A 4MNUA 3QAHA 2LKSA 2DMTA 3A0HC 2DLLA 3C7JA 2XB0X 3HUGA 4EJTA 4KIBA 2R92J 5IYDJ 2WB1A 2YU3A 1FIAA 3A03A 3V7SA 2PBIA 4L9VA 2L4AA 3JRCA 2KL4A 1FMWA 4XR6A 2X1CA 3BCAA 3S17J 3M3YJ 3ULQB 1VQ5I 4BHCA 3HUGB 1BC7C 4PFPA 1KYWA 5TJJA 1DU6A 4JX6A 5IT9K 3B6AA 3TW6A 4DZPA 3GLLA 3LAPA 3G73A 2M4KA 2V9PA 3PNVA 3LSKA 2AXLA 3K4NA 1K79A 1S29A 2XRNA 2P81A 2QVOA 3DTIA 2W48A 2LD5A 3TO7A 2DOAA 2N8GA 5DUIA 3LSIA 2VKDA 4LIVA 5C4JJ 3N97A 1QBJA 2MG4A 1S9HA 5HS9A 3VSLA 2OF7A 4JK1X 5JFRA 5A2QZ 1IF1A 1FYMA 3LSPA 2MH9A 4XSZF 3PNYA 5LEKA 4HPQA 2DT5A 2ME0A 5D8KB 5BOXA 1VZ0A 4AIDA 1H8AC 4IHTA 2VASA 2JSCA 3E7LA 3WTYC 2ID6A 3LFKA 1UAAA 3GCMA 1BN5A 3C2BA 1K4TA 3V7RA 3WE3A 5FLXZ 2M5WA 1ETVA 1XN7A 1TW3A 1HSTA 3E6MA 5DYMA 1UG0A 3NEUA 1Y1WJ 3PL8A 1BOAA 3R0JA 3HOTA 2Q0OA 2E2JJ 1W4MA 4PJ0C 1PUEE 3EETA 4LLGF 3CDLA 1YG2A 3H3ZA 5IYCJ 2AO9A 2IS2A 1JXSA 3DWLE 4HDUA 2RQQA 2E60A 2XGXA 3PJRA 3GWZA 2XF6A 2O03A 4MFEA 1RZ4A 4W97A 5K1YA 4NQWA 1VQOI 2DMPA 1QO0D 1ZGWA 1G3TA 2L4MA 2W57A 2ZBKA 4BEHB 2W85A 3GTMJ 4HQMA 1FP1D 4R79A 2H8WA 1BR2A 1BR1A 1W7PD 2QQ9A 1WJDA 4LB6B 2MYSA 3CJRB 2JSPA 4Y33A 5DM7F 2XSJC 3I64A 2LBFA 1YRNA 4LLLA 1IRFA 2QKLB 5M3FJ 2ZFUA 4NBQA 3FHNA 5HS7A 2FUG2 2H94A 2NS0A 3H0GJ 3HGGA 4U0YA 1FSHA 1LPQA 2H1KA 4E7KA 3S2HJ 2LBFB 1YRNB 1X1AA 2VC1A 5EGOB 3IL2A 4I6ZA 2ZB9A 1VQMI 1R4MB 1IJWC 5D6FA 1SAUA 4NHJA 3ZQGA 4A69C 5HNHA 1RUNA 4IQJA 3ASNH 3MN2A 1QRYA 5FD5A 4P9UA 1FOYA 1GVJA 4G6DA 4IJAA 1ULYA 2HGCA 1S7OA 2C6YA 3KP3A 3TO9A 5JHFA 1G8XA 3ABUA 3MZHA 4YELA 1TWHJ 2Z3YA 3IAM2 1A6IA 3DEEA 1FMVA 4DGWB 2RREA 5AIQA 3S8PA 5ICGA 2PMHA 3CC7I 3R61A 3TMOA 4A5MA 2YS9A 4YIFA 1U9OA 3M9AA 3H3VK 2ZSHB 2HI3A 2L9NA 4RBOA 3F72A 2LY2A 5E8GA 5IPAA 1X3UA 2E1CA 2JPBA 1Z3YA 2Q2EB 4AYBA 4IO9F 1I39A 3FX3A 4KIGA 1FEXA 3KP2A 3OOUA 4ZC3A 1ZQ3P 1AOYA 3VFZA 3ZQIA 3B6CA 2E1NA 3K69A 2M1BA 1YW7A 2Q1ZB 2QQAA 4BHBA 4B1RA 1PVEA 2F4IA 2ISYA 2PX9A 3CMMA 4IL6C 4IXAA 2G7UA 3Q3SA 4XLEA 3W6VA 4U87A 3GW2A 3OYLA 5LHHA 2DK5A 2L5QA 2ZMEC 4LD5A 3OYFA 2DT6A 1QZYA 4XRMA 3DKXA 3EUAA 1Z6RA 2NS7A 4YG2F 1HBXG 3LQRA 1ZREA 1WGXA 1EH6A 2FOWA 2OUMA 4GRIA 2UV1A 5E3NA 1I1SA 2H1LA 1IN4A 1GV5A 2PG4A 3BTLA 4FETA 3H3UA 2XASA 1LUJB 1Z0XA 2M45A 1F4KA 2V9KA 3ROUA 1U2WA 3IRRA 3LAJA 2Z33A 1ZARA 3F3XA 2X6OA 2FBKA 5LGUA 2LYCA 4C2MJ 3RI4A 2BHYA 2JT1A 4LMYA 1WFXA 1S6LA 2KJCA 2KT0A 4F93B 1TWAJ 4RB2C 2QZ8A 3CLQA 5D5WB 1IXSB 3O2PE 2OCEA 4HW0A 2KPMA 3GX4X 2FQ4A 3FXJA 2EFOA 1E3HA 1QZZA 2L01A 3GUDA 4XRFA 3UR3C 3OYBA 4XKWA 4BACA 5D5XB 1GDTA 2BVMA 2QM3A 1OKRA 3F8BA 4RDUA 2WAQN 2DU9A 3BR3A 4U7DA 2VE9A 1VQLI 3F9KA 4Y3OA 2CG4A 4HNTA 1UCRA 2VOPA 4ZDPA 1TNSA 3OR1C 4I7HA 2CJJA 4E7IA 3JTGA 1Z1DA 1N25A 2UUZA 3U1DA 3OYKA 4Y15A 1LKXA 1JHHA 3N05A 4GDFA 2DYSH 3DKYA 5M5YJ 5E18F 3MVPA 1W0UA 3QP6A 5F0HA 3HPHA 1KU9A 1X3ZB 2M87A 4UVAA 2JVHA 2DFIA 2CO5A 4N4OB 4HNUA 1RKTA 4GFBA 1R36A 5LGNA 2COMA 3EPZA 2M9HA 4EVIA 3JRBA 3GBGA 4BE0A 4JOMA 1ZYRF 2FRHA 2XF5A 3PO3J 1VF9A 3H92A 4LK0F 5HLHA 1OCTC 5J47A 1MZBA 4UUVA 1S7AA 2EFWA 3WU0A 2VBZA 2VKVA 5LHGA 3Q0WA 1MBHA 3DEWA 3HOSA 4HA8A 3RPQA 3HL2A 1DP3A 1YO5C 3GTGJ 2M0MA 3BR2A 4X0GA 2KDZA 1R5ID 2O8XA 2NNYA 2XAHA 1HLVA 4C3HJ 2HQAA 2ZCWA 2XPUA 3IRQA 4B4CA 2E71A 2HKOA 4ZYDA 4G7ZF 1ZG3A 2DYRH 3HSFA 3LSJA 4BQNA 3F8FA 5CVIA 3CCJI 5ILSA 4C2UA 4EMSA 2KRHA 3REOA 1GHCA 3ISPA 1E0EA 3I58A 3VOEA 4CZCA 3ZR8X 1YW8A 2ESHA 2XDVA 3TL4X 3U2RA 3CMYA 3QU6A 2JVGA 1WJFA 3D5RC 2E7XA 4A3EJ 1SMYF 2CQKA 3Q0UA 3JTHA 3SEZA 4A3CJ 1NHAA 3LA3A 3HYIA 1MBGA 2EZIA 3G4SI 2EILH 4ZDLA 4B43A 1OCOH 2A5YB 2XPVA 2DPUA 2LNBA 1YOVB 5ERIA 4HDVA 1I1GA 1HKTA 3E1SA 4BU2A 1RUOA 3ELKA 1T98A 2P5KA 4KMFA 3A0BC 3SHFA 1SC7A 1JJ6C 3O8GA 1ORKA 4EJUA 1XDSA 1REPC 2GIVA 3D1NI 3T5XA 2CGPA 3WG9A 1G3YA 2CW8A 4D7NA 5GAEJ 3BOQA 1W5CC 2LLKA 2DK8A 1RNLA 2L7MP 3ZOBA 2ZJQF 2ZXIA 3I53A 3HB9A 5DCMB 4KISA 5J8FA 4ZYGA 2NXNB 3RJPA 2VBXA 4QWQA 3HKZN 2KIFA 1QPIA 2L54A 1T2KA 4RA2A 1LDKB 2YX4A 1T39A 2QBYA 2R3SA 3K6GA 3K4CA 2RDPA 3LSHA 1QHGA 4G6QA 1HW2A 1V5EA 4MLOA 3JRFA 5DTDA 3O8HA 4KT5C 3PSIA 3CMAI 2XV4S 1FSEA 2CRGA 3H1CA 1Y56A 2F2EA 3E5XA 1G2HA 2TRTA 3X2QH 4AVPA 3BLYA 2L7ZA 4XOPA 4QPOA 3SFZA 4ETSA 4A3JJ 3L2CA 1SD6A 4KDPA 3ERED 1OYIA 4A3DJ 1TL8A 1T38A 2VJ4A 3KLNA 3KEOA 2DA5A 3NARA 4HBLA 5JR3A 2LF8A 1XD7A 5FROA 3M1EA 1ONVA 1OR7A 2G9WA 3ZMVA 3CCSI 2EZKA 2ZXJA 2RNGA 1K78B 2RAEA 3QPLA 2DA2A 3TDUC 5FLVA 1I3AA 2EWNA 5EG0A 1A36A 1I5ZA 1FIPA 4PSXA 2JA2A 3DV8A 2BY0A 2LTPA 4G12A 2CV2A 4A3GJ 1ZN2A 1YS7A 2MABA 2K02A 3GTPJ 2CUZA 3ZQFA 3B02A 3DEUA 2GXBA 1QVTA 3OS0A 3JAMZ 4ZDOA 2HKXA 2DMUA 4W1UA 2E2IJ 3JRDA 4XKVA 4ZTJA 3BDDA 2DTZA 1P7JA 4P9FA 2CUEA 2Y0SN 1V5FA 1P2FA 3KIOA 3K10A 2OD5A 1SANA 4AWXB 1AWCA 2JRTA 1MMGA 4I76A 3WGGA 1K4SA 2PI0A 2IP2A 3S16J 3EUHA 3COAC 1S72I 3DPLC 3OOPA 5JLWA 3LSGA 4E7JA 4OAYA 1A5JA 3A01A 2ECBA 1YI2I 1DP7P 3K4LA 4BJ5C 2VXDA 3Q5FA 1ZTRA 1HOMA 3EDPA 4AIJA 5K5OA 3M7GA 3F23A 5CQGA 3DU6A 3A01B 2FMYA 3OYGA 3RCOA 4BE2A 3IH4A 4OOIA 4FISA 4XORA 3CCVI 1IN7A 5LFAA 1JTYA 2WB1N 4I02A 1T95A 4CCKA 2JQ7A 3I54A 3ZPLA 2CQ7A 4DYCA 2IAIA 3NWSA 3TP0A 1TT0A 1IO2A 3TO6A 1OCZH 3WE2A 1JT0A 2KLOA 4BBRJ 4M9ZA 1CF7A 1MMDA 3G71I 4FX0A 1RR8C 4Y52J 1NTCA 2XRLA 1ODDA 5E3OA 3W3CA 3ZMSA
chains in the Genus database with same CATH topology
2W48A 3HM5A 2ME6A 3WHCA 5K7FA 2N8GA 4IEJA 5C4JJ 4XIDA 1IG7A 3S2DJ 1QVUA 2MG4A 3BR6A 2OF7A 4C3JJ 1AKHB 2HOSA 3OSGA 2HYJA 5BNGA 3GTOJ 3LSPA 3G1OA 2Y2ZA 2AHQA 1ETXA 2ME0A 2VUMJ 1FJLA 2HXOA 5C3EJ 1H8AC 3E7LA 1ETOA 2B63J 2M34A 2ID6A 9ANTA 1FTTA 4A3KJ 3C2BA 1ETVA 1TWGJ 5F08A 3BR0A 1Y1WJ 1IDYA 2ECCA 1LFUP 2CQXA 2E2JJ 5F0CA 2X9DA 5IP9J 4UUTA 3CDLA 5J3LA 3OIOA 5IYCJ 1MSFC 2L7FP 2AO9A 2PMZN 3S14J 4EEFG 2R93J 3DCFA 1X2MA 1H88C 1MBFA 4MFEA 4W97A 4B3AA 5J1RA 5GPAA 2DMPA 5F04A 1UHSA 4M3DA 1ZGWA 4DYRA 5EDNA 1X58A 2K9QA 3GTMJ 1MBJA 2FJ1A 4BY1J 3SDGA 1ETWA 1HDDC 1YRNA 4FE7A 1U8BA 2FD5A 5FLMJ 5M3FJ 3HGGA 3H0GJ 5EG0B 2K9NA 3VPRA 1B8IB 2XB5A 2EQRA 4M3GA 2H1KA 3S2HJ 4AC0A 1YRNB 3FKIJ 5EGOB 1SFOJ 4I6ZA 2ZB9A 5M5WJ 1IJWC 4JX5A 3ZQGA 3LNQA 4A69C 1W0TA 5M3MJ 2R0QC 1JGGA 1TWFJ 3MN2A 1QRYA 2MW8A 3JR9A 1JUSA 2Y30A 2DA1A 3IV5A 1MH4A 3BG9A 2L9RA 5IYBJ 4Y7NJ 1ETYA 4UUSB 5E3MA 2GM4A 4FE4A 5FKNA 1TWHJ 2XGDA 1A6IA 1O4XA 5F0FA 5M5XJ 3SJMA 3BTCA 2YS9A 2DN0A 1U9OA 1WH5A 3H3VK 2HI3A 3ZQLA 1BA5A 4XICA 1JKOC 4M6VA 4A3IJ 4QIWN 4RBOA 1APLC 3JRIA 1MH3A 5IPAA 3NAUA 2CQQA 1VFCA 1F43A 3RZDJ 4BBSJ 3OOUA 4IHWA 1FEXA 1ZQ3P 2XPWA 1RR7A 2IEKA 4D5CA 1CQTA 5J1UA 2NOGA 3ZQIA 3B6CA 2DMQA 1I6HJ 1B72A 4B1RA 4L5EA 3LSRA 2O8KA 2MGQA 5IP7J 3FK7A 3Q3SA 2DA7A 3W6VA 2DA4A 3CQZJ 2M8GX 3HGYA 5FKLA 2E19A 1K83J 4XRMA 2JJ7A 2NS7A 5J1YA 3HBLA 1WCMJ 2CUFA 2XGEA 1B72B 1GT0C 4D7MA 1WGXA 3FK6A 5E3NA 1GV5A 3BTLA 3K7AJ 2YUSA 1ETKA 2R7ZJ 1Z0XA 1MBKA 1HCRA 2R5YA 1T56A 3JRAA 2E1OA 3S1QJ 2JA7J 4JX4A 2X6OA 3BTJA 2Y9ZA 1TC3C 4C2MJ 1ZKGA 2WV1A 4NDLA 3M4OJ 2KT0A 5FJ8J 1TWAJ 2R5YB 4MIMA 3BR1A 2TCTA 2NVXJ 3S1MJ 1OJLA 2FQ4A 2NS8A 1PUFA 2CU7A 3BT9A 1GVDA 2R5ZA 1JKQC 1GDTA 2JK3A 5EZGA 2IBDA 4JP0A 2LK2A 4RDUA 1Z77A 2WAQN 3BR3A 3GTKJ 1ZR4A 1MNMC 2EZLA 5FKKA 4XK4A 2OPTA 2ELKA 2HXIA 2CJJA 2R5ZB 3WHBA 2HQ5A 2XSDC 3S15J 1GUUA 1IRZA 5M5YJ 3MVPA 1W0UA 5F0HA 1R9TJ 1RKTA 4M3BA 4GFBA 2M9HA 4IHXA 3JRBA 1VI0A 3GBGA 4S0HB 2Y31A 2K40A 5IOZA 3A02A 1OFCX 3JREA 4QSHA 3PO3J 1VF9A 1S7EA 5EEAA 3PO2J 1OCTC 4M3FA 1POGA 4MFDA 1HF0A 1F36A 4FCYA 3SFIA 2VKVA 1HDPA 2MSYA 3Q0WA 3GTLJ 1MBHA 3DEWA 1IUFA 1ZR2A 1JUPA 3GTGJ 3BR2A 1I3QJ 2KDZA 4LOCA 2O9LA 1BJZA 1HLVA 4C3HJ 3F0CA 2XPUA 1AHDP 2NVQJ 2DA6A 4B4CA 5IOYA 3HOYJ 2QCOA 2QF7A 3TW7A 3LSJA 1JT6A 1IDZA 4MO7A 1VNDA 1MBEA 1U78A 2EZHA 4AYBN 5EF6A 3CMYA 3MKLA 4X1EA 1RESA 1JUMA 1IGNA 3BR5A 2L0KA 1ETQA 4A3EJ 4A3FJ 1TWCJ 2LP0A 3ZQCA 3Q0UA 1RETA 4DYQA 4A3CJ 3BQZA 5EYRA 3BTIA 4ABZA 2JA8J 1MBGA 2EZIA 1WPKA 2NVTJ 3HOWJ 5K7ZA 2XPVA 2YU9J 2G0EA 2LKXA 2Y9YA 1JJ8C 4DZJA 3QQAA 1K61A 4DW6A 2JWTA 3Q0VA 3S1RJ 2M0CA 1JJ6C 3O8GA 1ORKA 2NVYJ 1WH7A 4JYKA 3K2AA 3D1NI 3QPSA 1UMQA 4D7NA 1E3OC 1AKHA 3RKQA 2LLKA 2L7MP 1FTZA 3ZOBA 1JKRC 3HB9A 2LY9A 2DMNA 5DS9A 5K7HA 1DU0A 2VKEA 3HKZN 2JMWA 1QPIA 4BY7J 4IHVA 2ID3A 1P7IA 2JA5J 5FKOA 1BL0A 1NK2P 3FISA 4MLOA 3JRFA 2HOAA 5HODA 5DTDA 1ITYA 3O8HA 2CRGA 2JN6A 3HOVJ 1G2HA 2TRTA 5F27A 5IP6A 2L7ZA 2VPRA 1EF4A 4A3JJ 2X48A 4A3MJ 2I10A 1ENHA 1PUFB 4A3DJ 1Q1VA 4QTRA 5C44J 4A3LJ 1XC5A 1Y1VJ 5EZHA 2DA5A 3NARA 3G1MA 1H89C 3GTQJ 3L1PA 2LVSA 1XS9A 2DJNA 1I50J 1RPWA 2EZKA 1JKPC 3FIWA 5C4XJ 4D5FA 2EH3A 2VI6A 2RAEA 3QPLA 2DA2A 4M3EA 1IC8A 5FLVA 2H8RA 4IHYA 5EG0A 1AU7A 3JRGA 1XG1A 1B8IA 1FIPA 4XRSG 5F1JA 2LTPA 3RQIA 5JLXA 5EGOA 1WI3A 4G12A 1UG2A 4A3GJ 1LE8A 4V2FA 3JRHA 2FX0A 3GTPJ 1D5YA 2GBYA 3ZQFA 4CYCA 1QVTA 3LOCA 3UKGA 1NK3P 2O7OA 1X2NA 1MSEC 4HNVA 2DMUA 4FTHA 4W1UA 2E2IJ 3I4NJ 3JRDA 1LE8B 5E3LA 2DTZA 2EBIA 1P7JA 4UUSA 2M2EA 2K9SA 2CUEA 4CYCB 2Y0SN 3IH3A 1OCPA 2JA6J 3HOZJ 2GLOA 4A93J 5GP9A 3PM1A 3HOUJ 1SANA 1LFBA 3I4MJ 3TP3A 2XGCA 4I76A 1BW5A 3HEFA 3S16J 5GPCA 4AUXA 1U9NA 5JLWA 3LSGA 4C3IJ 4J19A 5FKMA 4BXXJ 1A5JA 4V2GA 3A01A 3HOXJ 1BW6A 4XRSA 2LR8A 2ECBA 2HOTA 2HDDA 2D5VA 1T33A 1IV6A 3IH2A 3BG5A 3OSFA 1ZTRA 3TEDA 3S1NJ 1ZK8A 2DMTA 3G1LA 4BKXA 1HOMA 2XB0X 3GTJJ 2R92J 5IYDJ 3A01B 1FIAA 1RKWA 2COBA 3A03A 4A3BJ 3HDDA 3BG3A 3IH4A 4FISA 3JRCA 1JTYA 2WB1N 3S17J 1GV2A 3M3YJ 3CCYA 3ZQHA 3BQYA 3RZOJ 1DU6A 1JTXA 4JX6A 4DYCA 4X6AJ 2DA3A 3B6AA 2IAIA 3TP0A 3TW6A 4DZPA 1JT0A 4BBRJ 2E2HJ 2LFBA 4Y52J 1NTCA 2XRLA 5E3OA 2P81A 2LD5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W48 A;  3HM5 A;  2ME6 A;  3WHC A;  5K7F A;  2N8G A;  4IEJ A;  5C4J J;  4XID A;  1IG7 A;  3S2D J;  1QVU A;  2MG4 A;  3BR6 A;  2OF7 A;  4C3J J;  1AKH B;  2HOS A;  3OSG A;  2HYJ A;  5BNG A;  3GTO J;  3LSP A;  3G1O A;  2Y2Z A;  2AHQ A;  1ETX A;  2ME0 A;  2VUM J;  1FJL A;  2HXO A;  5C3E J;  1H8A C;  3E7L A;  1ETO A;  2B63 J;  2M34 A;  2ID6 A;  9ANT A;  1FTT A;  4A3K J;  3C2B A;  1ETV A;  1TWG J;  5F08 A;  3BR0 A;  1Y1W J;  1IDY A;  2ECC A;  1LFU P;  2CQX A;  2E2J J;  5F0C A;  2X9D A;  5IP9 J;  4UUT A;  3CDL A;  5J3L A;  3OIO A;  5IYC J;  1MSF C;  2L7F P;  2AO9 A;  2PMZ N;  3S14 J;  4EEF G;  2R93 J;  3DCF A;  1X2M A;  1H88 C;  1MBF A;  4MFE A;  4W97 A;  4B3A A;  5J1R A;  5GPA A;  2DMP A;  5F04 A;  1UHS A;  4M3D A;  1ZGW A;  4DYR A;  5EDN A;  1X58 A;  2K9Q A;  3GTM J;  1MBJ A;  2FJ1 A;  4BY1 J;  3SDG A;  1ETW A;  1HDD C;  1YRN A;  4FE7 A;  1U8B A;  2FD5 A;  5FLM J;  5M3F J;  3HGG A;  3H0G J;  5EG0 B;  2K9N A;  3VPR A;  1B8I B;  2XB5 A;  2EQR A;  4M3G A;  2H1K A;  3S2H J;  4AC0 A;  1YRN B;  3FKI J;  5EGO B;  1SFO J;  4I6Z A;  2ZB9 A;  5M5W J;  1IJW C;  4JX5 A;  3ZQG A;  3LNQ A;  4A69 C;  1W0T A;  5M3M J;  2R0Q C;  1JGG A;  1TWF J;  3MN2 A;  1QRY A;  2MW8 A;  3JR9 A;  1JUS A;  2Y30 A;  2DA1 A;  3IV5 A;  1MH4 A;  3BG9 A;  2L9R A;  5IYB J;  4Y7N J;  1ETY A;  4UUS B;  5E3M A;  2GM4 A;  4FE4 A;  5FKN A;  1TWH J;  2XGD A;  1A6I A;  1O4X A;  5F0F A;  5M5X J;  3SJM A;  3BTC A;  2YS9 A;  2DN0 A;  1U9O A;  1WH5 A;  3H3V K;  2HI3 A;  3ZQL A;  1BA5 A;  4XIC A;  1JKO C;  4M6V A;  4A3I J;  4QIW N;  4RBO A;  1APL C;  3JRI A;  1MH3 A;  5IPA A;  3NAU A;  2CQQ A;  1VFC A;  1F43 A;  3RZD J;  4BBS J;  3OOU A;  4IHW A;  1FEX A;  1ZQ3 P;  2XPW A;  1RR7 A;  2IEK A;  4D5C A;  1CQT A;  5J1U A;  2NOG A;  3ZQI A;  3B6C A;  2DMQ A;  1I6H J;  1B72 A;  4B1R A;  4L5E A;  3LSR A;  2O8K A;  2MGQ A;  5IP7 J;  3FK7 A;  3Q3S A;  2DA7 A;  3W6V A;  2DA4 A;  3CQZ J;  2M8G X;  3HGY A;  5FKL A;  2E19 A;  1K83 J;  4XRM A;  2JJ7 A;  2NS7 A;  5J1Y A;  3HBL A;  1WCM J;  2CUF A;  2XGE A;  1B72 B;  1GT0 C;  4D7M A;  1WGX A;  3FK6 A;  5E3N A;  1GV5 A;  3BTL A;  3K7A J;  2YUS A;  1ETK A;  2R7Z J;  1Z0X A;  1MBK A;  1HCR A;  2R5Y A;  1T56 A;  3JRA A;  2E1O A;  3S1Q J;  2JA7 J;  4JX4 A;  2X6O A;  3BTJ A;  2Y9Z A;  1TC3 C;  4C2M J;  1ZKG A;  2WV1 A;  4NDL A;  3M4O J;  2KT0 A;  5FJ8 J;  1TWA J;  2R5Y B;  4MIM A;  3BR1 A;  2TCT A;  2NVX J;  3S1M J;  1OJL A;  2FQ4 A;  2NS8 A;  1PUF A;  2CU7 A;  3BT9 A;  1GVD A;  2R5Z A;  1JKQ C;  1GDT A;  2JK3 A;  5EZG A;  2IBD A;  4JP0 A;  2LK2 A;  4RDU A;  1Z77 A;  2WAQ N;  3BR3 A;  3GTK J;  1ZR4 A;  1MNM C;  2EZL A;  5FKK A;  4XK4 A;  2OPT A;  2ELK A;  2HXI A;  2CJJ A;  2R5Z B;  3WHB A;  2HQ5 A;  2XSD C;  3S15 J;  1GUU A;  1IRZ A;  5M5Y J;  3MVP A;  1W0U A;  5F0H A;  1R9T J;  1RKT A;  4M3B A;  4GFB A;  2M9H A;  4IHX A;  3JRB A;  1VI0 A;  3GBG A;  4S0H B;  2Y31 A;  2K40 A;  5IOZ A;  3A02 A;  1OFC X;  3JRE A;  4QSH A;  3PO3 J;  1VF9 A;  1S7E A;  5EEA A;  3PO2 J;  1OCT C;  4M3F A;  1POG A;  4MFD A;  1HF0 A;  1F36 A;  4FCY A;  3SFI A;  2VKV A;  1HDP A;  2MSY A;  3Q0W A;  3GTL J;  1MBH A;  3DEW A;  1IUF A;  1ZR2 A;  1JUP A;  3GTG J;  3BR2 A;  1I3Q J;  2KDZ A;  4LOC A;  2O9L A;  1BJZ A;  1HLV A;  4C3H J;  3F0C A;  2XPU A;  1AHD P;  2NVQ J;  2DA6 A;  4B4C A;  5IOY A;  3HOY J;  2QCO A;  2QF7 A;  3TW7 A;  3LSJ A;  1JT6 A;  1IDZ A;  4MO7 A;  1VND A;  1MBE A;  1U78 A;  2EZH A;  4AYB N;  5EF6 A;  3CMY A;  3MKL A;  4X1E A;  1RES A;  1JUM A;  1IGN A;  3BR5 A;  2L0K A;  1ETQ A;  4A3E J;  4A3F J;  1TWC J;  2LP0 A;  3ZQC A;  3Q0U A;  1RET A;  4DYQ A;  4A3C J;  3BQZ A;  5EYR A;  3BTI A;  4ABZ A;  2JA8 J;  1MBG A;  2EZI A;  1WPK A;  2NVT J;  3HOW J;  5K7Z A;  2XPV A;  2YU9 J;  2G0E A;  2LKX A;  2Y9Y A;  1JJ8 C;  4DZJ A;  3QQA A;  1K61 A;  4DW6 A;  2JWT A;  3Q0V A;  3S1R J;  2M0C A;  1JJ6 C;  3O8G A;  1ORK A;  2NVY J;  1WH7 A;  4JYK A;  3K2A A;  3D1N I;  3QPS A;  1UMQ A;  4D7N A;  1E3O C;  1AKH A;  3RKQ A;  2LLK A;  2L7M P;  1FTZ A;  3ZOB A;  1JKR C;  3HB9 A;  2LY9 A;  2DMN A;  5DS9 A;  5K7H A;  1DU0 A;  2VKE A;  3HKZ N;  2JMW A;  1QPI A;  4BY7 J;  4IHV A;  2ID3 A;  1P7I A;  2JA5 J;  5FKO A;  1BL0 A;  1NK2 P;  3FIS A;  4MLO A;  3JRF A;  2HOA A;  5HOD A;  5DTD A;  1ITY A;  3O8H A;  2CRG A;  2JN6 A;  3HOV J;  1G2H A;  2TRT A;  5F27 A;  5IP6 A;  2L7Z A;  2VPR A;  1EF4 A;  4A3J J;  2X48 A;  4A3M J;  2I10 A;  1ENH A;  1PUF B;  4A3D J;  1Q1V A;  4QTR A;  5C44 J;  4A3L J;  1XC5 A;  1Y1V J;  5EZH A;  2DA5 A;  3NAR A;  3G1M A;  1H89 C;  3GTQ J;  3L1P A;  2LVS A;  1XS9 A;  2DJN A;  1I50 J;  1RPW A;  2EZK A;  1JKP C;  3FIW A;  5C4X J;  4D5F A;  2EH3 A;  2VI6 A;  2RAE A;  3QPL A;  2DA2 A;  4M3E A;  1IC8 A;  5FLV A;  2H8R A;  4IHY A;  5EG0 A;  1AU7 A;  3JRG A;  1XG1 A;  1B8I A;  1FIP A;  4XRS G;  5F1J A;  2LTP A;  3RQI A;  5JLX A;  5EGO A;  1WI3 A;  4G12 A;  1UG2 A;  4A3G J;  1LE8 A;  4V2F A;  3JRH A;  2FX0 A;  3GTP J;  1D5Y A;  2GBY A;  3ZQF A;  4CYC A;  1QVT A;  3LOC A;  3UKG A;  1NK3 P;  2O7O A;  1X2N A;  1MSE C;  4HNV A;  2DMU A;  4FTH A;  4W1U A;  2E2I J;  3I4N J;  3JRD A;  1LE8 B;  5E3L A;  2DTZ A;  2EBI A;  1P7J A;  4UUS A;  2M2E A;  2K9S A;  2CUE A;  4CYC B;  2Y0S N;  3IH3 A;  1OCP A;  2JA6 J;  3HOZ J;  2GLO A;  4A93 J;  5GP9 A;  3PM1 A;  3HOU J;  1SAN A;  1LFB A;  3I4M J;  3TP3 A;  2XGC A;  4I76 A;  1BW5 A;  3HEF A;  3S16 J;  5GPC A;  4AUX A;  1U9N A;  5JLW A;  3LSG A;  4C3I J;  4J19 A;  5FKM A;  4BXX J;  1A5J A;  4V2G A;  3A01 A;  3HOX J;  1BW6 A;  4XRS A;  2LR8 A;  2ECB A;  2HOT A;  2HDD A;  2D5V A;  1T33 A;  1IV6 A;  3IH2 A;  3BG5 A;  3OSF A;  1ZTR A;  3TED A;  3S1N J;  1ZK8 A;  2DMT A;  3G1L A;  4BKX A;  1HOM A;  2XB0 X;  3GTJ J;  2R92 J;  5IYD J;  3A01 B;  1FIA A;  1RKW A;  2COB A;  3A03 A;  4A3B J;  3HDD A;  3BG3 A;  3IH4 A;  4FIS A;  3JRC A;  1JTY A;  2WB1 N;  3S17 J;  1GV2 A;  3M3Y J;  3CCY A;  3ZQH A;  3BQY A;  3RZO J;  1DU6 A;  1JTX A;  4JX6 A;  4DYC A;  4X6A J;  2DA3 A;  3B6A A;  2IAI A;  3TP0 A;  3TW6 A;  4DZP A;  1JT0 A;  4BBR J;  2E2H J;  2LFB A;  4Y52 J;  1NTC A;  2XRL A;  5E3O A;  2P81 A;  2LD5 A; 
#chains in the Genus database with same CATH topology
 5DM6 F;  3PUB A;  1IN6 A;  3AG3 H;  3WHC A;  1FOX A;  3BG7 A;  3FXQ A;  1DQU A;  3FXL A;  3M8F A;  1QVU A;  2X6X A;  4XID A;  3WTU C;  3KP6 A;  1CF7 B;  2ESN A;  2B0L A;  5KNL A;  4D1Q A;  4C3J J;  2ACJ A;  1AKH B;  4RGR A;  5BNG A;  2HPI A;  3CCU I;  1D1C A;  4EQQ A;  3G1O A;  2Y2Z A;  2DXI A;  3IWF A;  2FA5 A;  1MNE A;  2VUM J;  1ZRC A;  2I8D A;  2HXO A;  1SEU A;  1FOW A;  2YX7 A;  4NC7 A;  2IGK A;  1A04 A;  1ETO A;  4UVC A;  1WWX A;  2PJR A;  2FF4 A;  9ANT A;  1N78 A;  3KX2 A;  2R7U A;  5LBQ A;  4B44 A;  1G59 A;  2ECC A;  4XLN F;  3T8R A;  4ESJ A;  2M3A A;  2HVS A;  2X9D A;  3MZ8 A;  4UUT A;  2PJR B;  2F4O B;  1MSF C;  2L7F P;  2PMZ N;  2F5E A;  3BZK A;  4EEF G;  2R93 J;  2P7V B;  5HDK A;  4WXC A;  4E4H A;  1YLF A;  3D5S C;  4S04 A;  1H88 C;  2W1O A;  2KKO A;  3ABK H;  2GA1 A;  3OR2 C;  2MLK A;  5F04 A;  3HG9 A;  5L3B A;  4M3D A;  3K4K A;  4DYR A;  3ZCO A;  3IC7 A;  3SEQ A;  3AG4 H;  3VYS B;  2VQC A;  3LQQ A;  1MBJ A;  3WTT C;  3SDG A;  1XMA A;  4I98 B;  3LA7 A;  4NB5 A;  2GIZ A;  3D5L A;  2LF7 A;  2X1E A;  2B9S A;  2IPQ X;  2K9N A;  3KP4 A;  2E1M B;  3VPR A;  1TNT A;  1B8I B;  2XB5 A;  1JE8 A;  3BP8 A;  3QU3 A;  3RDI A;  1P4W A;  4DJA A;  1HW1 A;  3RPU D;  1P9Q C;  2WA0 A;  4TV7 A;  2DI3 A;  5FGM A;  2DAO A;  2EB7 A;  2R0Q C;  4BNC A;  1F1Z A;  2KP6 A;  1JGG A;  1JUS A;  2Y30 A;  3IV5 A;  1UHM A;  4B47 A;  5B66 C;  5GTH C;  2L9R A;  2A6T A;  3QYF A;  5IYB J;  1ETY A;  1MDM A;  3ZMZ A;  4UUS B;  5FLX K;  3JSP A;  5LD2 C;  1NG6 A;  1Z6T A;  5B1A H;  3WOD F;  3K4M A;  4WF2 A;  3SJM A;  2HYF A;  3JW4 A;  3MKY B;  3ECO A;  4RLQ A;  3R4K A;  2WC2 A;  1FP2 A;  4PDK A;  1E17 A;  1Q1H A;  2H6C A;  3FMS A;  2L7K A;  4KIF A;  3LA2 A;  1YHQ I;  2E7W A;  2EIJ H;  4C2T A;  1WJC A;  1F43 A;  4G8X A;  2D2W A;  3CO6 C;  5CJ9 A;  4BBS J;  4EGZ A;  1T0F C;  2XPW A;  2IEK A;  1I27 A;  2NOG A;  4IKF A;  4AD9 A;  5CYV A;  2ZO4 A;  2IGM A;  3SYT A;  1FX7 A;  2FOK A;  4R1H A;  3ZQQ A;  1BI1 A;  5D6E A;  5E17 F;  5FB2 A;  3L09 A;  2O8K A;  5FRM A;  1FT9 A;  2MGQ A;  3F6V A;  4N4N B;  1DPU A;  3PQJ A;  5H2F C;  2R7S A;  4S05 A;  5H6R A;  2VE8 A;  4DBQ A;  1K83 J;  1OQY A;  4M6X A;  4HSR A;  3L2W A;  2JJ7 A;  4WCG A;  1EKE A;  3HBL A;  3PQK A;  3I59 A;  1FPQ A;  1UST A;  3H9J A;  3DBH B;  3BZC A;  2YSR A;  1A31 A;  2EIM H;  2MD0 A;  3K7A J;  2ETH A;  3OL3 A;  1O3S A;  1ETK A;  2P6T A;  4XLF A;  1SFU A;  1P4A A;  4ITV A;  4LB5 A;  1QPM A;  1YIO A;  1J2X A;  3FBN B;  3I59 B;  3AKZ A;  3BZ6 A;  3JRA A;  4ESF A;  3HRS A;  5HVQ C;  2DT7 B;  2E1O A;  3HRM A;  4B8X A;  3MCZ A;  3EUH C;  2P0W A;  4CO8 A;  1YS6 A;  2WV1 A;  4NDL A;  3M4O J;  3H9Q A;  4XM3 A;  1EH8 A;  4LGW A;  2VB6 A;  2IGO A;  2ZKZ A;  3MWM A;  3ZGK A;  4MIM A;  1MGT A;  2TCT A;  2GXA A;  2Q8K A;  2CW0 F;  5L3G A;  1YTY A;  2V7F A;  2BE5 F;  2QQB A;  2VQH A;  1L3L A;  1PUF A;  1YJ9 I;  1EH7 A;  2DOF A;  2YPR A;  4MTE A;  1MW7 A;  2CU7 A;  3RYP A;  4JQF A;  3OYJ A;  1SD7 A;  3F8N A;  2R5Z A;  4Y17 A;  4UV9 A;  4JP0 A;  2LK2 A;  1XTA A;  3GTK J;  3KLO A;  5TIS C;  3HRT A;  5CVU A;  4XOT A;  2GAU A;  4NQW B;  4XK4 A;  2OPT A;  2ELK A;  1RI7 A;  2HXI A;  2PMU A;  3KZI C;  4I2O A;  2R5Z B;  1WJA A;  3LFU A;  4PGG A;  2PLY A;  2HYG D;  1TQI A;  4RAF A;  5TGT A;  3SXY A;  2HQ5 A;  2EA4 A;  3S15 J;  5DDG A;  1GXQ A;  3TKY A;  3CME I;  3EQL F;  2ZXH A;  2XIG A;  4M3B A;  2K86 A;  1G4D A;  1TLH B;  1TZL A;  2V1N A;  1G6N A;  2Y31 A;  5F6F A;  1XDU A;  2L3D A;  5IOZ A;  1OFC X;  4KNY A;  4OMZ A;  2ICW G;  2DBB A;  1Z21 A;  3WTV C;  4L5I A;  2V1D A;  4BH9 A;  3IKT A;  4RM3 A;  1U0J A;  1HF0 A;  3BPX A;  2MC4 A;  3K0L A;  4MEY F;  1F36 A;  4FCY A;  2WTE A;  1YFH A;  3P7N A;  2P6S A;  3E5U A;  2MSY A;  1B9M A;  4RAZ A;  4CXF A;  1IUF A;  3K9T A;  3DTK A;  3DPT A;  2YR2 A;  2A6E F;  3OYD A;  3EYI A;  2O3F A;  1I3Q J;  2QSH X;  3KZY A;  2HOE A;  3R6S A;  3TOB A;  3TQN A;  2DTR A;  2HS5 A;  2CH0 A;  2NVQ J;  4GXO A;  5LHI A;  1FBQ A;  3HC7 A;  1D8J A;  1GXP A;  3HOY J;  1PP7 U;  2QF7 A;  1TBX A;  3FXM A;  5BPD A;  2QGU A;  1NG7 A;  1IDZ A;  4U0W A;  5CVV A;  4ZYA A;  2L9V A;  2QSG X;  4MEX F;  1WI9 A;  4F55 A;  3CP8 A;  5EF6 A;  3MKL A;  2FBH A;  2HZT A;  3R0A A;  2HEO A;  1SMT A;  1J9I A;  2B7E A;  4G94 A;  3BR5 A;  3OYM A;  1O3R A;  4HX4 A;  1ETQ A;  2E1M C;  3I9V 2;  4F3Q A;  1RET A;  2DFE A;  3IKV A;  5EYR A;  2JA8 J;  1O3Q A;  2NVT J;  4OIO F;  5K7Z A;  2YU9 J;  4ENN A;  2LKX A;  4E6K G;  4C9Y A;  1OMI A;  3DLA A;  2AXT C;  1K61 A;  1Y39 A;  2UXX A;  1R5G A;  3K1P A;  3MKW B;  2IXS A;  3G3Z A;  3Q0V A;  3S1R J;  2I5U A;  1V54 H;  1WH7 A;  2XKP A;  1X1B A;  4XLP F;  5BMZ A;  3QPS A;  2Y69 H;  1TQP A;  1E3O C;  3VDX A;  3RKQ A;  3NQO A;  1K7A A;  1FTZ A;  2KQR A;  2QWW A;  1JKR C;  4KN7 X;  3FMQ A;  2DMN A;  3I0T A;  2MLG A;  5K7H A;  1DU0 A;  2CMP A;  2XAU A;  3CCM I;  2VKE A;  1W5T A;  1LEA A;  2VOO A;  4BY7 J;  3L2Q A;  2HZD A;  4IHV A;  3FMR A;  3IP4 B;  2ID3 A;  4NUB A;  1P7I A;  5EEG A;  5CKT A;  4HLY A;  5IY5 H;  1BL0 A;  2F48 A;  4M71 A;  3K70 D;  2HOA A;  5HOD A;  2L02 A;  2EIN H;  2V6E A;  1HXD A;  1WRJ A;  4XON A;  3V7C A;  3VSK A;  1A35 A;  4CDG A;  3KE2 A;  2W24 A;  3S93 A;  2QA4 I;  3V8J A;  5IP6 A;  2VPR A;  1EF4 A;  1BJA A;  2V4J C;  4LIT A;  2X1D A;  2I10 A;  5KCM A;  2O61 A;  3I5U A;  1WHU A;  2BZT A;  1P92 A;  3ZP5 A;  3C18 A;  1XC5 A;  2CSO A;  5EZH A;  3PIP F;  3C2H A;  3FKJ A;  3GTQ J;  2M7B A;  3T0Y A;  4UXN A;  3WG7 H;  1KON A;  1XCV A;  4IF4 A;  4DBR A;  1X19 A;  1IRX A;  4RB3 C;  3L1P A;  2CWE A;  1V3F A;  1XS9 A;  2DJN A;  1D1B A;  6PAX A;  1FBU A;  1JKP C;  1MJB A;  5C4X J;  4D5F A;  2VI6 A;  4DIQ A;  2W84 A;  4EV0 A;  1R1U A;  1FNN A;  4M3E A;  2J5P A;  3G6E I;  4RGX A;  3WTW C;  3ZQ7 A;  3JRG A;  1XG1 A;  2NNN A;  3HSR A;  4XRS G;  4XBF A;  3CUQ A;  1W5S A;  1WI3 A;  2NYX A;  3MQ0 A;  1W7P A;  2FX0 A;  2X85 A;  4XSX F;  3QP5 A;  2XAJ A;  1BIB A;  3ZMD A;  4CYC A;  2VLA A;  3L2R A;  3QOP A;  4PJN A;  1KQ0 A;  2ADU A;  3UKG A;  2O7O A;  1R4N B;  1X2N A;  2EFQ A;  4YRV A;  3OS1 A;  4LG3 A;  1OPC A;  1QNT A;  2CFX A;  1Y8R B;  4E7S A;  2QLZ A;  5E3L A;  4UY8 I;  2EBI A;  1X1C A;  4ZTF A;  2M2E A;  2HPM A;  4PJJ A;  4CYC B;  2JA6 J;  2GLO A;  1BI0 A;  1ZGA A;  1H9G A;  3HOU J;  1PYV A;  1LFB A;  3I4M J;  3MKZ A;  2RN7 A;  1BW5 A;  3HEF A;  1DPR A;  3RQ4 A;  3S2W A;  1U9N A;  4C3I J;  2G7H A;  3QOD A;  5FKM A;  4BXX J;  4V2G A;  1LQ1 A;  1T33 A;  2HTJ A;  3HXL A;  3H36 A;  3K1N A;  2ZJR F;  4L0Z B;  1FY7 A;  2HDC A;  3CO7 C;  2OV7 A;  4BKX A;  2IW5 A;  2PFB A;  1T08 B;  2WAF A;  4KN4 X;  2VL8 A;  1RKW A;  3BY6 A;  1TT5 B;  3GFI A;  3HDD A;  3BG3 A;  3J7A O;  4Q47 A;  2DW4 A;  1ZAO A;  2A3S A;  1ZEL A;  5ED4 A;  1J7K A;  1VQ8 I;  4LLN A;  1GV2 A;  4OIP F;  4ESB A;  1P4X A;  2LRE A;  4ON0 A;  1IV8 A;  1G3S A;  2K9M A;  3VYR B;  1K6O A;  1MKM A;  4X6A J;  2XC7 A;  1X4O A;  2XF7 A;  2JZY A;  1B1B A;  1YYV A;  1D0Y A;  5B1B H;  1VQP I;  3WTS C;  4BXF A;  3OYN A;  1U6G A;  4XLH A;  1YX3 A;  2V1U A;  2FSW A;  3F22 A;  5K7F A;  1UZC A;  1SVO A;  3CES A;  3CJQ B;  3HPG A;  2HQN A;  3JAM K;  2LY1 A;  2HOS A;  5LEJ A;  1HSJ A;  4AIH A;  2BV6 A;  3DPU A;  1E2X A;  3FF5 A;  4M74 A;  2VPL A;  1FJL A;  1UFM A;  3GFJ A;  3BJ6 A;  5D4R A;  2X0L A;  3M8E A;  5EJC A;  3WTX C;  2Z16 A;  4XLA A;  3UNG C;  3JSO A;  1KU2 A;  3FZV A;  3HSE A;  5HS8 A;  5IT3 A;  3CD6 I;  1IAW A;  3GO5 A;  2QBY B;  2EFP A;  4JBA A;  3KFW X;  4PJM A;  5F08 A;  4KMU X;  4ZYE A;  1LFU P;  2MA3 A;  1D0X A;  3FBI B;  5DV5 A;  4OIN F;  4BHP A;  4F92 B;  4EJW A;  5IP9 J;  1JI8 A;  2EA2 A;  4HX8 A;  5ICF A;  5GAG J;  4IZZ A;  3S14 J;  1MMA A;  1J59 A;  3LST A;  1CGP A;  5DCF A;  3OMY A;  3DCF A;  1X2M A;  2TDX A;  4RM2 A;  5E8I A;  4B3A A;  5J1R A;  2F5D A;  1SFK A;  2LH9 A;  2WAQ A;  4BS9 A;  1ZRD A;  2VQL A;  2VJ5 A;  1Y0N A;  3I71 A;  3OYE A;  5HOO A;  3VYT B;  1O57 A;  1R58 A;  1DDN A;  1XGS A;  4CCL A;  2Z2S B;  4BY1 J;  3G2B A;  5GAD J;  3V4G A;  1MJ9 A;  2IRF G;  3KET A;  4HF2 A;  2LG4 A;  3HHH A;  3KP5 A;  1Y0U A;  4Z6Y A;  3TBI A;  3JCU C;  5CLS A;  4FE7 A;  2BXZ A;  2FD5 A;  5FLM J;  2HVQ A;  2OAZ A;  3I4P A;  5FFZ A;  2Z5U A;  1LVA A;  1OLT A;  1Z7L A;  2EIK H;  5EG0 B;  2UXN A;  2UZK A;  2EQR A;  4M3G A;  3WGI A;  2D1V A;  1GLN A;  2KZV A;  1SFO J;  4FQG A;  1DGR M;  4K2E A;  4OWR B;  3CCE I;  3LNQ A;  3I56 I;  1D3Y A;  1W0T A;  2FU4 A;  5M3M J;  3ZXS A;  4WXD A;  1Z05 A;  2R7Q A;  1ZG5 A;  2IS4 A;  2MW8 A;  3JR9 A;  2DQR A;  1O7L A;  3V8L A;  4F7Z A;  1TW2 A;  1MH4 A;  2P5L C;  2ZJ2 A;  1FC3 A;  3FDY A;  4RGU A;  4J00 A;  2FBI A;  1IRG A;  5E3M A;  4FE4 A;  5FKN A;  1KQ8 A;  2CQN A;  1WZ2 A;  1RC9 A;  2D1H A;  1B6A A;  4D9J A;  4CZZ A;  4RLF A;  1O4X A;  1IXR C;  2XAF A;  4IOA F;  3L7W A;  3BTC A;  2DN0 A;  3E6C C;  2VKH A;  5CQE A;  1YX5 A;  2XUB A;  4M9X A;  3BCB A;  5DD8 A;  4ASN A;  3CZ6 A;  1ON1 A;  2E36 A;  1APL C;  2XRO A;  3ECH A;  3JRI A;  3HRU A;  3E5Q A;  2P7C B;  4Y13 A;  5F1R A;  4H4K C;  1LDD A;  2CQQ A;  4L5J A;  1A6Q A;  4XN0 A;  3V8K A;  2K4B A;  1QQI A;  3RZD J;  4IHW A;  4A6D A;  5D8L B;  1D5V A;  4U0V A;  1B59 A;  5J1U A;  5ICE A;  4PZJ A;  2DMQ A;  1XGO A;  2RC4 A;  1PDN C;  4XNF A;  1I6H J;  2OU2 A;  3L9F A;  2ZNZ A;  4L5E A;  4CCN A;  3P9K A;  3LSR A;  3LL7 A;  3DTE A;  4LJZ F;  5FKL A;  2M8G X;  2E19 A;  2FEZ A;  2M30 A;  1AA7 A;  2K7L A;  3D0S A;  4E7Z A;  5J1Y A;  2CUF A;  2XGE A;  3C2G A;  1DGW Y;  1HKQ A;  4D7M A;  4G9Y A;  2Z99 A;  1GT0 C;  3FK6 A;  3CF2 A;  2BXY A;  3GLX A;  2YUS A;  2JRM A;  5J4V A;  4XKC A;  3J81 K;  4CCJ A;  3IAS 2;  4M6Y A;  2R7Z J;  3GZ6 A;  3RIR A;  1HCR A;  5J8C A;  4GCV A;  3OYI A;  2P8T A;  3ML6 A;  2WV0 A;  2JA7 J;  1TC3 C;  5HLT A;  2R7D A;  4R8H A;  4ZH4 F;  3OIQ A;  1J75 A;  2IVM A;  4RAG A;  4UB8 C;  1YJW I;  5FJ8 J;  3SQN A;  4BQQ A;  2GZW A;  2MC3 A;  3BR1 A;  3BJA A;  2QEX I;  1TP4 A;  1FZP B;  2NVX J;  1HQC A;  3U1K A;  4FHT A;  3S1M J;  2IS1 A;  2MH2 A;  3HJE A;  4CUG A;  2R7R A;  3V42 A;  1BR4 A;  3PIO F;  4I01 A;  3TOA A;  1LB2 A;  1TQM A;  4QPQ A;  1BIA A;  1JKQ C;  2K85 A;  4HST A;  2H6B A;  3R60 A;  2E5N A;  5EZG A;  2J5O A;  2OCC H;  2IBD A;  4Q48 A;  2LMD A;  3DFG A;  1K6Y A;  1XSX A;  2K4J A;  2VQG A;  5FKK A;  4ENJ A;  1FWZ A;  2VOD A;  1O3T A;  1R1V A;  3MEX A;  4HOB A;  1C0W A;  3WHB A;  4AIK A;  2HR3 A;  1GUU A;  2DOE A;  1IRZ A;  4B3X A;  4AM3 A;  1OCC H;  4F52 A;  2VT2 A;  4IPA A;  1R9T J;  4YEJ A;  1VI0 A;  4BQO A;  3OV8 A;  4S0H B;  2NAZ A;  2BGC A;  1VQN I;  2WY8 Q;  3J81 Z;  4Z2Y A;  4BJ6 C;  1R71 A;  1S7E A;  5EEA A;  3PO2 J;  1H0M A;  2DPD A;  1B9N A;  4L0Y B;  2ZME A;  5F64 A;  2F6C A;  4WK8 F;  3PFY A;  4XN3 A;  1Y8Q B;  1WVR A;  2BYV E;  3SFI A;  2Y0S A;  1HDP A;  5HNF A;  3GME A;  4HQE A;  1UB9 A;  3DKW A;  2DFF A;  3K70 C;  1SFE A;  2VJJ A;  4XMY A;  1ZR2 A;  1JUP A;  2A05 A;  1KQ9 A;  4ANJ A;  2CV0 A;  1BJZ A;  2OZ6 A;  3BJO A;  3HTS B;  3PSF A;  1LFP A;  2X6Y A;  4M9S A;  1MDM B;  1EA3 A;  1AHD P;  3QOE A;  5IOY A;  1JGS A;  1MMN A;  2KIQ A;  3TGN A;  2QCO A;  1DUX C;  2E35 A;  4LG0 A;  2R7X A;  4ENK A;  3RYR A;  3S3O A;  3H5A A;  4RMN A;  1JT6 A;  2VC0 A;  2O5R A;  4EAT A;  2ZJP F;  4UV8 A;  4BDY A;  1OR7 C;  1VND A;  3LWF A;  1MBE A;  3CJT B;  1U78 A;  4O3M A;  3GVA A;  1U5T A;  1RIO H;  2IA1 A;  4AYB N;  5J4Y A;  1RES A;  1IGN A;  4LG0 B;  2L0K A;  3IWZ A;  4BJT A;  3K2Z A;  3C1D A;  2DO7 A;  4DYQ A;  2D45 A;  3BTI A;  3CDH A;  4M72 A;  4ABZ A;  1U5T B;  1YW9 A;  1WPK A;  3QWL A;  1RRJ A;  2ISZ A;  4F91 B;  2G0E A;  2W25 A;  2QUF A;  2Y9Y A;  3DBL B;  1JJ8 C;  4DZJ A;  4BQA A;  2GOX B;  3QQA A;  2A68 F;  4DW6 A;  2JWT A;  2Y48 A;  5ILV A;  2OBP A;  2XAG A;  2M0C A;  1OYY A;  2NVY J;  5GTI C;  1YE9 A;  1YIJ I;  2DQL A;  4MHG A;  4MTD A;  3CCL I;  1J5Y A;  5KHD A;  4IHS A;  1QHH D;  2IA2 A;  4IQ4 A;  2M8E A;  3TDZ C;  3W6K B;  1MJA A;  3ABL H;  4L9J A;  3AG1 H;  5CPR B;  4CCO A;  4ZZD A;  2LY9 A;  3E6D A;  2PJP A;  2Z9O A;  5H20 A;  2JMW A;  3AL0 B;  3J7A Y;  4Q4Z F;  1XSD A;  3ERM A;  4C30 A;  2BOL A;  2PQ8 A;  2UWM A;  5FKO A;  3KYD B;  4KA4 A;  1NK2 P;  3FIS A;  1ITY A;  2KMU A;  2JN6 A;  3HOV J;  1UEL B;  4NNJ A;  4XL9 A;  3WU2 C;  2BY2 A;  1ZRF A;  3GEZ A;  3QPH A;  1S5L C;  2WY7 Q;  2PMZ A;  4HF1 A;  3CLO A;  4PGH A;  3T8T A;  4IRI A;  3WTZ A;  3I55 I;  3EYY A;  4HG2 A;  1ENH A;  1PUF B;  3K1M A;  4BEH A;  3KCC A;  4HX7 A;  2IS6 A;  5L3D A;  1Z3X A;  3BC8 A;  2K3F A;  1YIT I;  4EM0 B;  4HAM A;  1I50 J;  1RPW A;  5E1W A;  3PNT A;  1YQA A;  3FIW A;  4FX4 A;  2EH3 A;  4RB0 A;  2WAE A;  2H8R A;  4IHY A;  1AU7 A;  5IT9 Z;  2HDW A;  2VN2 A;  2NRA C;  3J80 K;  5AIP A;  5F1J A;  1WJ5 A;  3DQV C;  3RQI A;  1BBY A;  5EGO A;  3ASO H;  2KIS A;  2ELJ A;  4V2F A;  4AVZ A;  1PJR A;  1XCB A;  4ZJZ A;  2CS3 A;  4CSW A;  1SVL A;  1D5Y A;  1R7J A;  2K3P A;  4MQ9 F;  4IVN A;  3LOC A;  2R4G A;  3GFL A;  2LRD A;  3F21 A;  3GXO A;  4ZZL A;  4IRH A;  4FTH A;  2EFN A;  3I4N J;  2PEX A;  1MIJ A;  2O6G E;  2WBM A;  2ZXW H;  4YIR X;  2P4W A;  1OCP A;  3N4M A;  3RPU A;  5GP9 A;  3PM1 A;  1XX5 A;  3TP3 A;  5L3F A;  1LVK A;  4WX9 A;  4J01 A;  3VYU B;  2BHZ A;  1MD0 A;  3MAJ A;  3A2K A;  1HA8 A;  1X4P A;  3IUO A;  1HC8 A;  2F5V A;  4J19 A;  3F8C A;  3H35 A;  4LIU A;  2CUJ A;  3AG2 H;  2ELH A;  3H0D A;  1T8I A;  2HDD A;  2D5V A;  2Q2E A;  1IV6 A;  3BG5 A;  3P9I A;  2OJE D;  5FO5 A;  3ZN1 A;  3GZ5 A;  1WJB A;  3TED A;  3OSF A;  1ZK8 A;  3G1L A;  3S1N J;  3ESW B;  1SAX A;  4I99 C;  3GTJ J;  2KRF A;  2IA0 A;  3OIP A;  5DEQ A;  2COB A;  1R23 A;  4UHT A;  1Z7U A;  3BPV A;  1XPX A;  3W2A A;  4A3B J;  4P5O A;  4YII A;  1V4R A;  1ZLJ A;  3RKY A;  1ZGJ A;  3QYB A;  1XMX A;  3CCY A;  5KK1 A;  3ZQH A;  3PUF A;  3BQY A;  3RZO J;  1JTX A;  2DA3 A;  2HFH A;  4UB6 C;  3J80 Z;  2E2H J;  2LFB A;  2ZSI B;  2R7T A;  5H6Q A;  3FHZ A;  2K27 A;  1UJ8 A;  3S32 A;  2HQR A;  1Z9C A;  3HM5 A;  2ME6 A;  4PFO A;  4IEJ A;  5E79 C;  5D4S A;  3S2D J;  1IG7 A;  4HEA 2;  1EV7 A;  3RKW A;  3HTU A;  2VT3 A;  3BR6 A;  4I0A A;  3CC2 I;  3OSG A;  2HYJ A;  2JUG A;  2F5C A;  2X4H A;  5J6X A;  4L18 B;  1FYK A;  3GTO J;  1V55 H;  4OIR F;  4CYD A;  2AHQ A;  4PJL A;  2LSO A;  1ETX A;  3L2V A;  2OZU A;  3ZMT A;  5C3E J;  4OAZ A;  4E7L A;  2KRC A;  2KIM A;  2B63 J;  2M34 A;  5BS6 A;  4II2 A;  1FTT A;  2RV8 A;  4A3K J;  3FM3 A;  2BW3 A;  5LRS A;  1XGM A;  1IZ1 A;  2KJB A;  1VQ7 I;  1TWG J;  1QGP A;  1KGS A;  3SZP A;  3BR0 A;  1IDY A;  1ZH5 A;  4XLC A;  2CQX A;  5F0C A;  4KIT B;  1L0O C;  3SZT A;  3H5R A;  5J3L A;  3OIO A;  1N75 A;  5HLI A;  2NOJ B;  1LEB A;  3U9G A;  2BW3 B;  1U5T C;  3BG6 A;  5KAF C;  3H5N A;  1MBF A;  1USS A;  3QRF F;  1WSU A;  4LFU A;  3CUO A;  2QYO A;  2VIX A;  3MMY B;  4A0X A;  5GPA A;  1UHS A;  4KYW A;  2OA4 A;  3F8M A;  5CVJ A;  2IT0 A;  2LKP A;  5EDN A;  4RB1 A;  1X58 A;  2K9Q A;  1W36 C;  2KHM A;  1IUY A;  2FJ1 A;  3VB2 A;  2FNP A;  1T6S A;  4G7H F;  3ZN0 A;  1ETW A;  1WQ2 A;  4CHU A;  1HDD C;  4XQF A;  1U8B A;  4LK1 F;  3KYL A;  4RAY A;  3U21 A;  4KJZ A;  2KDO A;  2EV6 A;  3M07 A;  4H0E A;  4EM1 A;  1D8K A;  2IJL A;  3AL0 C;  5E1Z B;  2KIU A;  3A1Y A;  4AC0 A;  3OY9 A;  3CUQ B;  3CP2 A;  3P5J A;  3FKI J;  1TTY A;  3CJN A;  3S3N A;  2XHK A;  4PUS A;  2L2O A;  3IHU A;  1W7P B;  4A2U A;  5M5W J;  4ENM A;  4A6E A;  4JX5 A;  1LDJ A;  3VEP A;  4UNO A;  2Y0M A;  1BI2 A;  3DLL F;  2Z1D A;  3DP7 A;  3W6J B;  2R7F A;  4Q5S F;  1TWF J;  2JTV A;  2R7V A;  3OYC A;  4BGD A;  2DA1 A;  1Z67 A;  1KU7 A;  3BG9 A;  1N77 A;  4N0B A;  2FML A;  1F5T A;  2ZC2 A;  4Y7N J;  3DBR B;  5B5E C;  1X3W B;  1FYL A;  2GM4 A;  2RNJ A;  4L9N A;  5JI6 A;  2XGD A;  1HW5 A;  5FFX A;  2FQ3 A;  2OQR A;  1MMS A;  1PP8 F;  1VQ9 I;  5F0F A;  5M5X J;  3S3M A;  2VON A;  1WH5 A;  4OIQ F;  2OC6 A;  4AU7 A;  2AQF A;  2M7A A;  4V19 K;  3ZQL A;  1BA5 A;  4XIC A;  3QYE A;  4KIC A;  1JKO C;  4M6V A;  4A3I J;  4QIW N;  1BI3 A;  2BEO A;  1MH3 A;  5AON A;  1QU3 A;  2M4G A;  4EGY A;  4PK4 A;  3NAU A;  1VFC A;  4OMY A;  2DFH A;  1KZH A;  1IN8 A;  3FXK A;  4N9H A;  1XSV A;  3OL4 A;  3L00 A;  1YJN I;  4WXH A;  1SVM A;  1RR7 A;  1CQT A;  4D5C A;  2F5F A;  2A61 A;  2F4M B;  4II3 A;  4B09 A;  2STT A;  2STW A;  3J7Y J;  4BL0 B;  1B72 A;  3L2U A;  4A0Z A;  1SD5 A;  2P5V A;  5B3S H;  4FT8 A;  4EM2 A;  5IP7 J;  3FK7 A;  2DA7 A;  2DA4 A;  3CQZ J;  3HGY A;  5LRR A;  1ERD A;  3CTA A;  3KZZ A;  1VTN C;  1S8N A;  2EV0 A;  4GYG A;  1XB4 A;  2EV5 A;  3DF8 A;  4IOC F;  4BE1 A;  2RVC A;  1B72 B;  1WCM J;  5DUK A;  1ON2 A;  3ONQ A;  3QPT A;  2V6C A;  5DCM A;  3F6O A;  2HTS A;  2LDU A;  5JHU A;  2DDA A;  4CCM A;  5BPI A;  2RGV A;  4FAS D;  5GAH J;  2E5Z A;  1MBK A;  2JUC A;  4BUP A;  1G3W A;  4CH7 A;  2FNA A;  3DU5 A;  1U3E M;  2FXA A;  1VQK I;  4HYE A;  2R5Y A;  1T56 A;  3KYC B;  4G7O F;  1B4A A;  2A07 F;  1S3J A;  1NH3 A;  3S1Q J;  4JX4 A;  1J09 A;  3BTJ A;  2KFD A;  1KU3 A;  3CDI A;  2Y9Z A;  3K4J A;  2BY3 A;  1WJE A;  1ZKG A;  4A12 A;  4O5V A;  1ZG1 A;  3W2W A;  4D0P A;  1J0R A;  5ICC A;  2R5Y B;  2QQ8 A;  3GFM A;  4E7H A;  2W82 A;  3A4C A;  3VWB A;  4HF0 A;  3NRV A;  1OJL A;  3BRO A;  2NS8 A;  2H27 A;  2AS5 F;  3BT9 A;  4CGZ A;  2RQP A;  3OYH A;  3FXR A;  1GVD A;  2JK3 A;  2QKM B;  4I09 A;  1H9T A;  1Z77 A;  1ZR4 A;  4CIC A;  3Q9V A;  1MNM C;  3FM5 A;  2CV1 A;  2EZL A;  4M73 A;  2A69 F;  1K78 A;  2A5W A;  2K5C A;  3ABT A;  2EK5 A;  3GYH X;  4HRI A;  1R5H A;  1HKS A;  4P55 A;  4DNC A;  2O0Y A;  5HDN A;  2GWR A;  2DDB A;  1R00 A;  5BQT A;  1LJ9 A;  1P6R A;  1T0F A;  1V5G A;  2XSD C;  1QZE A;  1R49 A;  1R22 A;  2HNH A;  4A5N A;  4IHX A;  3K4B A;  2MBF A;  2K40 A;  3HHG A;  3A02 A;  2CW7 A;  3JRE A;  4QSH A;  4YFX F;  4YFK F;  4HZF A;  2VJI A;  2GOM A;  4M3F A;  2X6W A;  1POG A;  3P9C A;  4MFD A;  1X1P A;  1QA6 A;  3I3L A;  5JVT A;  4KUM A;  5LLQ A;  1FLI A;  2ZNY A;  3GTL J;  1MND A;  4DOZ A;  3OWT A;  2RKH A;  2OTJ I;  5DD4 A;  3RTR A;  4LOC A;  2O9L A;  2EJR A;  3E97 A;  5FRN A;  2QSF X;  3NWT A;  1U8R A;  2XVC A;  2VXZ A;  3F0C A;  5L3E A;  1OYW A;  2DA6 A;  4IX7 A;  3HZJ A;  3M1C A;  3TW7 A;  3CCQ I;  4B48 A;  3O3K A;  2VBW A;  1O7F A;  3PFI A;  2DCE A;  2GA2 A;  4GGG A;  1Z91 A;  1SFX A;  4MO7 A;  5E1X A;  5J40 A;  1BC8 C;  5EEH A;  2EZH A;  3B73 A;  3HIF A;  5HDG A;  1Y6I A;  4P1W A;  3CF5 F;  4X1E A;  1JUM A;  2A6H F;  4N9I A;  1F9N A;  4L9T A;  1W36 D;  1STZ A;  1XMK A;  2R7W A;  3DXJ F;  4A3F J;  1TWC J;  2LP0 A;  3ZQC A;  5D5V B;  3BQZ A;  3E3V A;  3LMM A;  3CUQ C;  3FXU A;  3HOW J;  3GZN B;  3AFH A;  1R6R A;  2BVL A;  5E20 A;  3BWG A;  5L3C A;  4MGR A;  4UVB A;  4RGS A;  2BY1 A;  4JYK A;  2HVR A;  2QEN A;  2CYY A;  3K2A A;  4PCQ A;  2FE3 A;  3GF2 A;  1UMQ A;  1AKH A;  1ACI A;  1ZHF A;  1BM9 A;  1OIS A;  1IXC A;  1D0Z A;  2DJI A;  4BAY A;  2XAQ A;  2OTL I;  4BYY A;  2ZFW A;  2JPC A;  2KZG A;  3HKZ A;  3SDB A;  3ZRG A;  2CFO A;  5DS9 A;  4KFC A;  1BOB A;  4BDZ A;  2MFZ A;  2GQQ A;  2PN6 A;  1I6X A;  5D5U B;  2K9L A;  4A0Y A;  2XKO A;  4E70 A;  2GXG A;  5LGT A;  4HV5 A;  5CVR A;  2AQE A;  1WKM A;  2JA5 J;  3KEQ A;  5ILU A;  2LOO A;  3KEY A;  4MQV A;  4IRG A;  4GO1 A;  3SZG A;  3FWE A;  4U88 A;  1XGN A;  2VBY A;  5F27 A;  3ABM H;  1KYZ A;  2W7N A;  2X48 A;  1UHW A;  5JVG F;  2HWV A;  4A3M J;  4RS8 A;  2HU9 A;  4BXU A;  3FXO A;  2R7O A;  1Q1V A;  3O6B B;  4QTR A;  5C44 J;  3W2V A;  4A3L J;  1VQ4 I;  1Y1V J;  4U7B A;  3WU1 B;  3H9G A;  3Q9S A;  4EJO A;  3G1M A;  1JHF A;  2OQG A;  1H89 C;  5K5R A;  2LVS A;  2NVU B;  2V9V A;  4WWC A;  4KT6 A;  1VQ6 I;  3C3W A;  4QLC U;  4GYI A;  1IN5 A;  1IC8 A;  2V26 A;  4NC8 A;  3E0J B;  1M1E B;  3RKX A;  3AAF A;  1B8I A;  3LSM A;  3M8J A;  1ZLK A;  3WGH A;  4EJV A;  4I0B A;  5JLX A;  4CA0 A;  1D1A A;  2WAD A;  1UG2 A;  3EUK L;  5TRD A;  2BBY A;  4O6J A;  1LNW A;  1LE8 A;  2DOD A;  3JRH A;  4HV6 A;  3T1B A;  2GBY A;  5KVR A;  3OYA A;  3CC4 I;  2L9S A;  3OS2 A;  1NK3 P;  2MD5 A;  2W00 A;  1MSE C;  4OU0 A;  4HNV A;  5KAI C;  4G6T B;  5A2Q K;  3MFK A;  2H09 A;  1LE8 B;  1E3P A;  1KA8 A;  3CCR I;  4DQ2 A;  3J7Z I;  4PSW A;  4YFN F;  2ZME B;  2V79 A;  3MD2 A;  4P96 A;  4UUS A;  2K9S A;  1EJ9 A;  1FOK A;  3IH3 A;  3HOZ J;  4ZYH A;  2E34 A;  2V1X A;  2IGN A;  4A93 J;  1IW7 F;  5HLG A;  3KP7 A;  4NC6 A;  2W4S A;  2LC2 A;  2Y75 A;  4Y4R A;  1X1D A;  2XGC A;  1R1T A;  3VOD A;  1OCR H;  5GPC A;  4HLX A;  4AUX A;  2X51 A;  5FD6 A;  3KPH A;  1W1W E;  2WWY A;  5K5Q A;  1FBS A;  2EPF A;  1SD4 A;  4XKB A;  3HOX J;  1BW6 A;  4XRS A;  2LR8 A;  3MZY A;  2HOT A;  3E6B A;  3ZMU A;  3RSN A;  3IH2 A;  4MNU A;  3QAH A;  2LKS A;  2DMT A;  3A0H C;  2DLL A;  3C7J A;  2XB0 X;  3HUG A;  4EJT A;  4KIB A;  2R92 J;  5IYD J;  2WB1 A;  2YU3 A;  1FIA A;  3A03 A;  3V7S A;  2PBI A;  4L9V A;  2L4A A;  3JRC A;  2KL4 A;  1FMW A;  4XR6 A;  2X1C A;  3BCA A;  3S17 J;  3M3Y J;  3ULQ B;  1VQ5 I;  4BHC A;  3HUG B;  1BC7 C;  4PFP A;  1KYW A;  5TJJ A;  1DU6 A;  4JX6 A;  5IT9 K;  3B6A A;  3TW6 A;  4DZP A;  3GLL A;  3LAP A;  3G73 A;  2M4K A;  2V9P A;  3PNV A;  3LSK A;  2AXL A;  3K4N A;  1K79 A;  1S29 A;  2XRN A;  2P81 A;  2QVO A;  3DTI A;  2W48 A;  2LD5 A;  3TO7 A;  2DOA A;  2N8G A;  5DUI A;  3LSI A;  2VKD A;  4LIV A;  5C4J J;  3N97 A;  1QBJ A;  2MG4 A;  1S9H A;  5HS9 A;  3VSL A;  2OF7 A;  4JK1 X;  5JFR A;  5A2Q Z;  1IF1 A;  1FYM A;  3LSP A;  2MH9 A;  4XSZ F;  3PNY A;  5LEK A;  4HPQ A;  2DT5 A;  2ME0 A;  5D8K B;  5BOX A;  1VZ0 A;  4AID A;  1H8A C;  4IHT A;  2VAS A;  2JSC A;  3E7L A;  3WTY C;  2ID6 A;  3LFK A;  1UAA A;  3GCM A;  1BN5 A;  3C2B A;  1K4T A;  3V7R A;  3WE3 A;  5FLX Z;  2M5W A;  1ETV A;  1XN7 A;  1TW3 A;  1HST A;  3E6M A;  5DYM A;  1UG0 A;  3NEU A;  1Y1W J;  3PL8 A;  1BOA A;  3R0J A;  3HOT A;  2Q0O A;  2E2J J;  1W4M A;  4PJ0 C;  1PUE E;  3EET A;  4LLG F;  3CDL A;  1YG2 A;  3H3Z A;  5IYC J;  2AO9 A;  2IS2 A;  1JXS A;  3DWL E;  4HDU A;  2RQQ A;  2E60 A;  2XGX A;  3PJR A;  3GWZ A;  2XF6 A;  2O03 A;  4MFE A;  1RZ4 A;  4W97 A;  5K1Y A;  4NQW A;  1VQO I;  2DMP A;  1QO0 D;  1ZGW A;  1G3T A;  2L4M A;  2W57 A;  2ZBK A;  4BEH B;  2W85 A;  3GTM J;  4HQM A;  1FP1 D;  4R79 A;  2H8W A;  1BR2 A;  1BR1 A;  1W7P D;  2QQ9 A;  1WJD A;  4LB6 B;  2MYS A;  3CJR B;  2JSP A;  4Y33 A;  5DM7 F;  2XSJ C;  3I64 A;  2LBF A;  1YRN A;  4LLL A;  1IRF A;  2QKL B;  5M3F J;  2ZFU A;  4NBQ A;  3FHN A;  5HS7 A;  2FUG 2;  2H94 A;  2NS0 A;  3H0G J;  3HGG A;  4U0Y A;  1FSH A;  1LPQ A;  2H1K A;  4E7K A;  3S2H J;  2LBF B;  1YRN B;  1X1A A;  2VC1 A;  5EGO B;  3IL2 A;  4I6Z A;  2ZB9 A;  1VQM I;  1R4M B;  1IJW C;  5D6F A;  1SAU A;  4NHJ A;  3ZQG A;  4A69 C;  5HNH A;  1RUN A;  4IQJ A;  3ASN H;  3MN2 A;  1QRY A;  5FD5 A;  4P9U A;  1FOY A;  1GVJ A;  4G6D A;  4IJA A;  1ULY A;  2HGC A;  1S7O A;  2C6Y A;  3KP3 A;  3TO9 A;  5JHF A;  1G8X A;  3ABU A;  3MZH A;  4YEL A;  1TWH J;  2Z3Y A;  3IAM 2;  1A6I A;  3DEE A;  1FMV A;  4DGW B;  2RRE A;  5AIQ A;  3S8P A;  5ICG A;  2PMH A;  3CC7 I;  3R61 A;  3TMO A;  4A5M A;  2YS9 A;  4YIF A;  1U9O A;  3M9A A;  3H3V K;  2ZSH B;  2HI3 A;  2L9N A;  4RBO A;  3F72 A;  2LY2 A;  5E8G A;  5IPA A;  1X3U A;  2E1C A;  2JPB A;  1Z3Y A;  2Q2E B;  4AYB A;  4IO9 F;  1I39 A;  3FX3 A;  4KIG A;  1FEX A;  3KP2 A;  3OOU A;  4ZC3 A;  1ZQ3 P;  1AOY A;  3VFZ A;  3ZQI A;  3B6C A;  2E1N A;  3K69 A;  2M1B A;  1YW7 A;  2Q1Z B;  2QQA A;  4BHB A;  4B1R A;  1PVE A;  2F4I A;  2ISY A;  2PX9 A;  3CMM A;  4IL6 C;  4IXA A;  2G7U A;  3Q3S A;  4XLE A;  3W6V A;  4U87 A;  3GW2 A;  3OYL A;  5LHH A;  2DK5 A;  2L5Q A;  2ZME C;  4LD5 A;  3OYF A;  2DT6 A;  1QZY A;  4XRM A;  3DKX A;  3EUA A;  1Z6R A;  2NS7 A;  4YG2 F;  1HBX G;  3LQR A;  1ZRE A;  1WGX A;  1EH6 A;  2FOW A;  2OUM A;  4GRI A;  2UV1 A;  5E3N A;  1I1S A;  2H1L A;  1IN4 A;  1GV5 A;  2PG4 A;  3BTL A;  4FET A;  3H3U A;  2XAS A;  1LUJ B;  1Z0X A;  2M45 A;  1F4K A;  2V9K A;  3ROU A;  1U2W A;  3IRR A;  3LAJ A;  2Z33 A;  1ZAR A;  3F3X A;  2X6O A;  2FBK A;  5LGU A;  2LYC A;  4C2M J;  3RI4 A;  2BHY A;  2JT1 A;  4LMY A;  1WFX A;  1S6L A;  2KJC A;  2KT0 A;  4F93 B;  1TWA J;  4RB2 C;  2QZ8 A;  3CLQ A;  5D5W B;  1IXS B;  3O2P E;  2OCE A;  4HW0 A;  2KPM A;  3GX4 X;  2FQ4 A;  3FXJ A;  2EFO A;  1E3H A;  1QZZ A;  2L01 A;  3GUD A;  4XRF A;  3UR3 C;  3OYB A;  4XKW A;  4BAC A;  5D5X B;  1GDT A;  2BVM A;  2QM3 A;  1OKR A;  3F8B A;  4RDU A;  2WAQ N;  2DU9 A;  3BR3 A;  4U7D A;  2VE9 A;  1VQL I;  3F9K A;  4Y3O A;  2CG4 A;  4HNT A;  1UCR A;  2VOP A;  4ZDP A;  1TNS A;  3OR1 C;  4I7H A;  2CJJ A;  4E7I A;  3JTG A;  1Z1D A;  1N25 A;  2UUZ A;  3U1D A;  3OYK A;  4Y15 A;  1LKX A;  1JHH A;  3N05 A;  4GDF A;  2DYS H;  3DKY A;  5M5Y J;  5E18 F;  3MVP A;  1W0U A;  3QP6 A;  5F0H A;  3HPH A;  1KU9 A;  1X3Z B;  2M87 A;  4UVA A;  2JVH A;  2DFI A;  2CO5 A;  4N4O B;  4HNU A;  1RKT A;  4GFB A;  1R36 A;  5LGN A;  2COM A;  3EPZ A;  2M9H A;  4EVI A;  3JRB A;  3GBG A;  4BE0 A;  4JOM A;  1ZYR F;  2FRH A;  2XF5 A;  3PO3 J;  1VF9 A;  3H92 A;  4LK0 F;  5HLH A;  1OCT C;  5J47 A;  1MZB A;  4UUV A;  1S7A A;  2EFW A;  3WU0 A;  2VBZ A;  2VKV A;  5LHG A;  3Q0W A;  1MBH A;  3DEW A;  3HOS A;  4HA8 A;  3RPQ A;  3HL2 A;  1DP3 A;  1YO5 C;  3GTG J;  2M0M A;  3BR2 A;  4X0G A;  2KDZ A;  1R5I D;  2O8X A;  2NNY A;  2XAH A;  1HLV A;  4C3H J;  2HQA A;  2ZCW A;  2XPU A;  3IRQ A;  4B4C A;  2E71 A;  2HKO A;  4ZYD A;  4G7Z F;  1ZG3 A;  2DYR H;  3HSF A;  3LSJ A;  4BQN A;  3F8F A;  5CVI A;  3CCJ I;  5ILS A;  4C2U A;  4EMS A;  2KRH A;  3REO A;  1GHC A;  3ISP A;  1E0E A;  3I58 A;  3VOE A;  4CZC A;  3ZR8 X;  1YW8 A;  2ESH A;  2XDV A;  3TL4 X;  3U2R A;  3CMY A;  3QU6 A;  2JVG A;  1WJF A;  3D5R C;  2E7X A;  4A3E J;  1SMY F;  2CQK A;  3Q0U A;  3JTH A;  3SEZ A;  4A3C J;  1NHA A;  3LA3 A;  3HYI A;  1MBG A;  2EZI A;  3G4S I;  2EIL H;  4ZDL A;  4B43 A;  1OCO H;  2A5Y B;  2XPV A;  2DPU A;  2LNB A;  1YOV B;  5ERI A;  4HDV A;  1I1G A;  1HKT A;  3E1S A;  4BU2 A;  1RUO A;  3ELK A;  1T98 A;  2P5K A;  4KMF A;  3A0B C;  3SHF A;  1SC7 A;  1JJ6 C;  3O8G A;  1ORK A;  4EJU A;  1XDS A;  1REP C;  2GIV A;  3D1N I;  3T5X A;  2CGP A;  3WG9 A;  1G3Y A;  2CW8 A;  4D7N A;  5GAE J;  3BOQ A;  1W5C C;  2LLK A;  2DK8 A;  1RNL A;  2L7M P;  3ZOB A;  2ZJQ F;  2ZXI A;  3I53 A;  3HB9 A;  5DCM B;  4KIS A;  5J8F A;  4ZYG A;  2NXN B;  3RJP A;  2VBX A;  4QWQ A;  3HKZ N;  2KIF A;  1QPI A;  2L54 A;  1T2K A;  4RA2 A;  1LDK B;  2YX4 A;  1T39 A;  2QBY A;  2R3S A;  3K6G A;  3K4C A;  2RDP A;  3LSH A;  1QHG A;  4G6Q A;  1HW2 A;  1V5E A;  4MLO A;  3JRF A;  5DTD A;  3O8H A;  4KT5 C;  3PSI A;  3CMA I;  2XV4 S;  1FSE A;  2CRG A;  3H1C A;  1Y56 A;  2F2E A;  3E5X A;  1G2H A;  2TRT A;  3X2Q H;  4AVP A;  3BLY A;  2L7Z A;  4XOP A;  4QPO A;  3SFZ A;  4ETS A;  4A3J J;  3L2C A;  1SD6 A;  4KDP A;  3ERE D;  1OYI A;  4A3D J;  1TL8 A;  1T38 A;  2VJ4 A;  3KLN A;  3KEO A;  2DA5 A;  3NAR A;  4HBL A;  5JR3 A;  2LF8 A;  1XD7 A;  5FRO A;  3M1E A;  1ONV A;  1OR7 A;  2G9W A;  3ZMV A;  3CCS I;  2EZK A;  2ZXJ A;  2RNG A;  1K78 B;  2RAE A;  3QPL A;  2DA2 A;  3TDU C;  5FLV A;  1I3A A;  2EWN A;  5EG0 A;  1A36 A;  1I5Z A;  1FIP A;  4PSX A;  2JA2 A;  3DV8 A;  2BY0 A;  2LTP A;  4G12 A;  2CV2 A;  4A3G J;  1ZN2 A;  1YS7 A;  2MAB A;  2K02 A;  3GTP J;  2CUZ A;  3ZQF A;  3B02 A;  3DEU A;  2GXB A;  1QVT A;  3OS0 A;  3JAM Z;  4ZDO A;  2HKX A;  2DMU A;  4W1U A;  2E2I J;  3JRD A;  4XKV A;  4ZTJ A;  3BDD A;  2DTZ A;  1P7J A;  4P9F A;  2CUE A;  2Y0S N;  1V5F A;  1P2F A;  3KIO A;  3K10 A;  2OD5 A;  1SAN A;  4AWX B;  1AWC A;  2JRT A;  1MMG A;  4I76 A;  3WGG A;  1K4S A;  2PI0 A;  2IP2 A;  3S16 J;  3EUH A;  3COA C;  1S72 I;  3DPL C;  3OOP A;  5JLW A;  3LSG A;  4E7J A;  4OAY A;  1A5J A;  3A01 A;  2ECB A;  1YI2 I;  1DP7 P;  3K4L A;  4BJ5 C;  2VXD A;  3Q5F A;  1ZTR A;  1HOM A;  3EDP A;  4AIJ A;  5K5O A;  3M7G A;  3F23 A;  5CQG A;  3DU6 A;  3A01 B;  2FMY A;  3OYG A;  3RCO A;  4BE2 A;  3IH4 A;  4OOI A;  4FIS A;  4XOR A;  3CCV I;  1IN7 A;  5LFA A;  1JTY A;  2WB1 N;  4I02 A;  1T95 A;  4CCK A;  2JQ7 A;  3I54 A;  3ZPL A;  2CQ7 A;  4DYC A;  2IAI A;  3NWS A;  3TP0 A;  1TT0 A;  1IO2 A;  3TO6 A;  1OCZ H;  3WE2 A;  1JT0 A;  2KLO A;  4BBR J;  4M9Z A;  1CF7 A;  1MMD A;  3G71 I;  4FX0 A;  1RR8 C;  4Y52 J;  1NTC A;  2XRL A;  1ODD A;  5E3O A;  3W3C A;  3ZMS A; 
#chains in the Genus database with same CATH homology
 2W48 A;  3HM5 A;  2ME6 A;  3WHC A;  5K7F A;  2N8G A;  4IEJ A;  5C4J J;  4XID A;  1IG7 A;  3S2D J;  1QVU A;  2MG4 A;  3BR6 A;  2OF7 A;  4C3J J;  1AKH B;  2HOS A;  3OSG A;  2HYJ A;  5BNG A;  3GTO J;  3LSP A;  3G1O A;  2Y2Z A;  2AHQ A;  1ETX A;  2ME0 A;  2VUM J;  1FJL A;  2HXO A;  5C3E J;  1H8A C;  3E7L A;  1ETO A;  2B63 J;  2M34 A;  2ID6 A;  9ANT A;  1FTT A;  4A3K J;  3C2B A;  1ETV A;  1TWG J;  5F08 A;  3BR0 A;  1Y1W J;  1IDY A;  2ECC A;  1LFU P;  2CQX A;  2E2J J;  5F0C A;  2X9D A;  5IP9 J;  4UUT A;  3CDL A;  5J3L A;  3OIO A;  5IYC J;  1MSF C;  2L7F P;  2AO9 A;  2PMZ N;  3S14 J;  4EEF G;  2R93 J;  3DCF A;  1X2M A;  1H88 C;  1MBF A;  4MFE A;  4W97 A;  4B3A A;  5J1R A;  5GPA A;  2DMP A;  5F04 A;  1UHS A;  4M3D A;  1ZGW A;  4DYR A;  5EDN A;  1X58 A;  2K9Q A;  3GTM J;  1MBJ A;  2FJ1 A;  4BY1 J;  3SDG A;  1ETW A;  1HDD C;  1YRN A;  4FE7 A;  1U8B A;  2FD5 A;  5FLM J;  5M3F J;  3HGG A;  3H0G J;  5EG0 B;  2K9N A;  3VPR A;  1B8I B;  2XB5 A;  2EQR A;  4M3G A;  2H1K A;  3S2H J;  4AC0 A;  1YRN B;  3FKI J;  5EGO B;  1SFO J;  4I6Z A;  2ZB9 A;  5M5W J;  1IJW C;  4JX5 A;  3ZQG A;  3LNQ A;  4A69 C;  1W0T A;  5M3M J;  2R0Q C;  1JGG A;  1TWF J;  3MN2 A;  1QRY A;  2MW8 A;  3JR9 A;  1JUS A;  2Y30 A;  2DA1 A;  3IV5 A;  1MH4 A;  3BG9 A;  2L9R A;  5IYB J;  4Y7N J;  1ETY A;  4UUS B;  5E3M A;  2GM4 A;  4FE4 A;  5FKN A;  1TWH J;  2XGD A;  1A6I A;  1O4X A;  5F0F A;  5M5X J;  3SJM A;  3BTC A;  2YS9 A;  2DN0 A;  1U9O A;  1WH5 A;  3H3V K;  2HI3 A;  3ZQL A;  1BA5 A;  4XIC A;  1JKO C;  4M6V A;  4A3I J;  4QIW N;  4RBO A;  1APL C;  3JRI A;  1MH3 A;  5IPA A;  3NAU A;  2CQQ A;  1VFC A;  1F43 A;  3RZD J;  4BBS J;  3OOU A;  4IHW A;  1FEX A;  1ZQ3 P;  2XPW A;  1RR7 A;  2IEK A;  4D5C A;  1CQT A;  5J1U A;  2NOG A;  3ZQI A;  3B6C A;  2DMQ A;  1I6H J;  1B72 A;  4B1R A;  4L5E A;  3LSR A;  2O8K A;  2MGQ A;  5IP7 J;  3FK7 A;  3Q3S A;  2DA7 A;  3W6V A;  2DA4 A;  3CQZ J;  2M8G X;  3HGY A;  5FKL A;  2E19 A;  1K83 J;  4XRM A;  2JJ7 A;  2NS7 A;  5J1Y A;  3HBL A;  1WCM J;  2CUF A;  2XGE A;  1B72 B;  1GT0 C;  4D7M A;  1WGX A;  3FK6 A;  5E3N A;  1GV5 A;  3BTL A;  3K7A J;  2YUS A;  1ETK A;  2R7Z J;  1Z0X A;  1MBK A;  1HCR A;  2R5Y A;  1T56 A;  3JRA A;  2E1O A;  3S1Q J;  2JA7 J;  4JX4 A;  2X6O A;  3BTJ A;  2Y9Z A;  1TC3 C;  4C2M J;  1ZKG A;  2WV1 A;  4NDL A;  3M4O J;  2KT0 A;  5FJ8 J;  1TWA J;  2R5Y B;  4MIM A;  3BR1 A;  2TCT A;  2NVX J;  3S1M J;  1OJL A;  2FQ4 A;  2NS8 A;  1PUF A;  2CU7 A;  3BT9 A;  1GVD A;  2R5Z A;  1JKQ C;  1GDT A;  2JK3 A;  5EZG A;  2IBD A;  4JP0 A;  2LK2 A;  4RDU A;  1Z77 A;  2WAQ N;  3BR3 A;  3GTK J;  1ZR4 A;  1MNM C;  2EZL A;  5FKK A;  4XK4 A;  2OPT A;  2ELK A;  2HXI A;  2CJJ A;  2R5Z B;  3WHB A;  2HQ5 A;  2XSD C;  3S15 J;  1GUU A;  1IRZ A;  5M5Y J;  3MVP A;  1W0U A;  5F0H A;  1R9T J;  1RKT A;  4M3B A;  4GFB A;  2M9H A;  4IHX A;  3JRB A;  1VI0 A;  3GBG A;  4S0H B;  2Y31 A;  2K40 A;  5IOZ A;  3A02 A;  1OFC X;  3JRE A;  4QSH A;  3PO3 J;  1VF9 A;  1S7E A;  5EEA A;  3PO2 J;  1OCT C;  4M3F A;  1POG A;  4MFD A;  1HF0 A;  1F36 A;  4FCY A;  3SFI A;  2VKV A;  1HDP A;  2MSY A;  3Q0W A;  3GTL J;  1MBH A;  3DEW A;  1IUF A;  1ZR2 A;  1JUP A;  3GTG J;  3BR2 A;  1I3Q J;  2KDZ A;  4LOC A;  2O9L A;  1BJZ A;  1HLV A;  4C3H J;  3F0C A;  2XPU A;  1AHD P;  2NVQ J;  2DA6 A;  4B4C A;  5IOY A;  3HOY J;  2QCO A;  2QF7 A;  3TW7 A;  3LSJ A;  1JT6 A;  1IDZ A;  4MO7 A;  1VND A;  1MBE A;  1U78 A;  2EZH A;  4AYB N;  5EF6 A;  3CMY A;  3MKL A;  4X1E A;  1RES A;  1JUM A;  1IGN A;  3BR5 A;  2L0K A;  1ETQ A;  4A3E J;  4A3F J;  1TWC J;  2LP0 A;  3ZQC A;  3Q0U A;  1RET A;  4DYQ A;  4A3C J;  3BQZ A;  5EYR A;  3BTI A;  4ABZ A;  2JA8 J;  1MBG A;  2EZI A;  1WPK A;  2NVT J;  3HOW J;  5K7Z A;  2XPV A;  2YU9 J;  2G0E A;  2LKX A;  2Y9Y A;  1JJ8 C;  4DZJ A;  3QQA A;  1K61 A;  4DW6 A;  2JWT A;  3Q0V A;  3S1R J;  2M0C A;  1JJ6 C;  3O8G A;  1ORK A;  2NVY J;  1WH7 A;  4JYK A;  3K2A A;  3D1N I;  3QPS A;  1UMQ A;  4D7N A;  1E3O C;  1AKH A;  3RKQ A;  2LLK A;  2L7M P;  1FTZ A;  3ZOB A;  1JKR C;  3HB9 A;  2LY9 A;  2DMN A;  5DS9 A;  5K7H A;  1DU0 A;  2VKE A;  3HKZ N;  2JMW A;  1QPI A;  4BY7 J;  4IHV A;  2ID3 A;  1P7I A;  2JA5 J;  5FKO A;  1BL0 A;  1NK2 P;  3FIS A;  4MLO A;  3JRF A;  2HOA A;  5HOD A;  5DTD A;  1ITY A;  3O8H A;  2CRG A;  2JN6 A;  3HOV J;  1G2H A;  2TRT A;  5F27 A;  5IP6 A;  2L7Z A;  2VPR A;  1EF4 A;  4A3J J;  2X48 A;  4A3M J;  2I10 A;  1ENH A;  1PUF B;  4A3D J;  1Q1V A;  4QTR A;  5C44 J;  4A3L J;  1XC5 A;  1Y1V J;  5EZH A;  2DA5 A;  3NAR A;  3G1M A;  1H89 C;  3GTQ J;  3L1P A;  2LVS A;  1XS9 A;  2DJN A;  1I50 J;  1RPW A;  2EZK A;  1JKP C;  3FIW A;  5C4X J;  4D5F A;  2EH3 A;  2VI6 A;  2RAE A;  3QPL A;  2DA2 A;  4M3E A;  1IC8 A;  5FLV A;  2H8R A;  4IHY A;  5EG0 A;  1AU7 A;  3JRG A;  1XG1 A;  1B8I A;  1FIP A;  4XRS G;  5F1J A;  2LTP A;  3RQI A;  5JLX A;  5EGO A;  1WI3 A;  4G12 A;  1UG2 A;  4A3G J;  1LE8 A;  4V2F A;  3JRH A;  2FX0 A;  3GTP J;  1D5Y A;  2GBY A;  3ZQF A;  4CYC A;  1QVT A;  3LOC A;  3UKG A;  1NK3 P;  2O7O A;  1X2N A;  1MSE C;  4HNV A;  2DMU A;  4FTH A;  4W1U A;  2E2I J;  3I4N J;  3JRD A;  1LE8 B;  5E3L A;  2DTZ A;  2EBI A;  1P7J A;  4UUS A;  2M2E A;  2K9S A;  2CUE A;  4CYC B;  2Y0S N;  3IH3 A;  1OCP A;  2JA6 J;  3HOZ J;  2GLO A;  4A93 J;  5GP9 A;  3PM1 A;  3HOU J;  1SAN A;  1LFB A;  3I4M J;  3TP3 A;  2XGC A;  4I76 A;  1BW5 A;  3HEF A;  3S16 J;  5GPC A;  4AUX A;  1U9N A;  5JLW A;  3LSG A;  4C3I J;  4J19 A;  5FKM A;  4BXX J;  1A5J A;  4V2G A;  3A01 A;  3HOX J;  1BW6 A;  4XRS A;  2LR8 A;  2ECB A;  2HOT A;  2HDD A;  2D5V A;  1T33 A;  1IV6 A;  3IH2 A;  3BG5 A;  3OSF A;  1ZTR A;  3TED A;  3S1N J;  1ZK8 A;  2DMT A;  3G1L A;  4BKX A;  1HOM A;  2XB0 X;  3GTJ J;  2R92 J;  5IYD J;  3A01 B;  1FIA A;  1RKW A;  2COB A;  3A03 A;  4A3B J;  3HDD A;  3BG3 A;  3IH4 A;  4FIS A;  3JRC A;  1JTY A;  2WB1 N;  3S17 J;  1GV2 A;  3M3Y J;  3CCY A;  3ZQH A;  3BQY A;  3RZO J;  1DU6 A;  1JTX A;  4JX6 A;  4DYC A;  4X6A J;  2DA3 A;  3B6A A;  2IAI A;  3TP0 A;  3TW6 A;  4DZP A;  1JT0 A;  4BBR J;  2E2H J;  2LFB A;  4Y52 J;  1NTC A;  2XRL A;  5E3O A;  2P81 A;  2LD5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...