2DFEA

Crystal structure of tk-rnase hii(1-200)-c
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
209
structure length
209
Chain Sequence
MKIAGIDEAGRGPVIGPMVIAAVVVDENSLPKLEELKVRDSKKLTPKRREKLFNEILGVLDDYVILELPPDVIGSREGTLNEFEVENFAKALNSLKVKPDVIYADAADVDEERFARELGERLNFEAEVVAKHKADDIFPVVSAASILAKVTRDRAVEKLKEEYGEIGSGYPSDPRTRAFLENYYREHGEFPPIVRKGWKTTQDMINKST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational contagion in a protein: Structural properties of a chameleon sequence
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
molecule keywords Ribonuclease HII
total genus 69
structure length 209
sequence length 209
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 2dfeA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2dfeA01
4F4KA 1BCOA 2VWKA 3VQEA 1WSFA 3LPUA 4CGDA 4DS4A 1QTMA 4CFBA 1IO2A 3C95A 4K8ZA 1C0MA 1WN7A 2KZZA 4M3WA 1SL0A 4IDKA 4CJQA 3QETA 4FZYA 4M3XA 3UIQA 4DSFA 4DU1A 4DS5A 4NCBA 4CEFA 3MXJA 3RTVA 3AVIA 3KK2A 3PX0A 5KI6A 1NK0A 4MQ3A 3QLHA 1QHTA 2HNYA 3B6OA 4CERA 4CJ3A 4DTRA 4W5OA 3QEIA 3MXIA 3S3MA 1FKPA 1LV5A 1L3SA 4DSLA 4HUEA 1VSEA 1XHZA 4RW4A 1JXEA 3RRHA 1ZYQA 1S1XA 3AVBA 3K2PA 1U47A 1TL1A 2DFEA 3ZT3A 4B3OA 3K57A 4CEQA 2Z1JA 4FM1A 1HQUA 1JXBA 3KTQA 3QIPA 3RWUA 4PUOA 4CECA 3T19A 4O0IA 2ITGA 3D0PA 3QINA 2DFHA 5CY4A 1K6YA 3DLBA 4FK4A 1C6VA 3TWHA 4JRPA 4E7HA 1KLNA 3AO3A 5HRSA 5KRSA 4H4OA 3ZT2A 3VQDA 1WNSA 2P5GA 1S6QA 3S3OA 4B9SA 3SJJA 3ZSRA 3RR7A 1RNHA 2YNGA 2P5OA 3TR8A 2I5JA 3ZSQA 4KAZA 5CZ1A 1RDCA 2X6NA 2FBYA 1GOBA 3M8RA 1IG9A 2QXFA 1CZBA 5HRRA 4KFBA 3SZ2A 1Q9YA 4FLWA 1REVA 4FW1A 4M3TA 4E7JA 1ITGA 4KI6A 4F2RA 3K5OA 3O3FA 3NCIA 4FLZA 1RT2A 3OS2A 2HVIA 4KHQA 3HL8A 4FJ8A 1SV5A 3LWLA 1C1AA 1T03A 4CFAA 3KK1A 4Z4CA 2QK9A 2XY6A 4IG3A 3OJUA 3CFPA 4KHWA 3K5NA 4KRFA 3AA5X 4BACA 4FLUA 1DLOA 3O3HA 1BIZA 2IDOA 2QKKA 1MU2A 3V1QA 4LD0A 2LSNA 3TAQA 3VQBA 1A5WA 4PA1A 4CESA 2G8WA 3SQ4A 4F3OA 4FM0A 3AA2A 1T8EA 3M8SA 4DTOA 4ZTFA 4FVMA 5SWMA 1VRUA 2BANA 2YV0X 3NAEA 4KB0A 4OJRA 3KLIA 1RT6A 1EETA 1RT1A 3LP3A 1HJRA 4Z0UA 4DSKA 3S3NA 3U3GA 3CQ8A 1ZBFA 3RMDA 1BQMA 1TKTA 5KGXA 4ELTA 4JRQA 4AHCA 1EKEA 1JLBA 2G8UA 4B9VA 4DFJA 1ASUA 2XRIA 4B8AB 4WE1A 1BQNA 4EZ6A 2HHVA 1IKWA 1S9GA 3NGYA 4AHVA 2KW4A 4KTWA 3TAEA 4M42A 4CF8A 4OLBA 3BGRA 1WLJA 4LSLA 1NOZA 3RMCA 3NFAA 1BISA 1W0HA 2YKNA 4CJ4A 1A5XA 2VG6A 5I42A 3G0ZA 2GUIA 2BE2A 4H4MA 1EX4A 2HVHA 4OLAA 3QIOA 3KD5E 5J2MA 2X74A 4DTSA 4CHZA 5HRPA 1KVBA 3QNOA 4DSJA 1S1WA 4HUGA 1CZ9A 1T05A 3TABA 1NK5A 4DTUA 3LP2A 3L8BA 2RKIA 2Y1JA 4DQPA 2KFNA 1S1UA 3DYAA 4DU3A 1HMVA 4LH5A 3RR8A 3OJSA 3PV8A 2G8VA 1QQCA 4ID1A 4CK3A 4DU4A 2PYJA 4E0DA 3K5LA 4W5QA 1SL2A 4G1QA 4CEZA 4CJ5A 1HRHA 2OPQA 1LWEA 1KSPA 3HT3A 4RG8A 4CF9A 1I3AA 3ISNC 4AH9A 3CFRA 2Q3SA 3VQPA 2XY8A 4M45A 1ZBLA 5CZ2A 3DLGA 3NF8A 2JGUA 2VWJA 4B9MA 4IKFA 4J2AA 4KHUA 2D0CA 3QO9A 3OYCA 4HTUA 4PWDA 4O4GA 3NGZA 2HHUA 1TKXA 1NJWA 2HB5A 3ITHA 1KLMA 2XO7A 1L3TA 3DRPA 1SKSA 1BGXT 3DLRA 4EP4A 1VSMA 4KHYA 1HNVA 3THVA 1JLFA 3AVJA 3H08A 2YHBA 3VQ4A 3MEDA 5J2PA 4CJLA 3F9KA 4J2DA 3HP9A 3U6FA 1NOYA 3AVGA 4M3ZA 4QOZB 2P1JA 4AHTA 4OKJA 4CF2A 1UWBA 2Z1IA 4CEEA 3KKRA 3RMAA 1TK5A 3VQ7A 2IS3A 3MXMA 1IKXA 1JL1A 3LPTA 2VG5A 3WNFA 3ASMA 1Z25A 4IG0A 2R7YA 4E19A 4NCAA 3KLEA 4FJMA 3NH0A 4N76A 5FRNA 1VSLA 2B4JA 1VSIA 1JL2A 3MEEA 4CHYA 3SQ2A 4FJJA 3HJFA 4UQGA 1D9FA 4ELVA 1IKVA 3ZT4A 3KJVA 1TK0A 3HVTA 4Y1DA 3TAGA 3ZT0A 4DMNA 1I39A 3ZSOA 4ID5A 4CJWA 3LP0A 1TK8A 1N5YA 2OZSA 2HHXA 1D9DA 1ZBIA 1YVUA 3ZSVA 4M3UA 1KRPA 2RF2A 1C1BA 3KD1E 4CGHA 3I0RA 1KFDA 4GVMA 4KHSA 3V9UA 3ZSWA 4I2PA 3T1AA 5J2NA 3O3GA 4CIEA 2BDPA 2OYQA 4FJGA 3QEVA 1U49A 1F21A 4OGEA 4Z4GA 3EY1A 4HCCA 4B8CA 4HVJA 1CLQA 2DFFA 1QS4A 4CFCA 4CE9A 4AHUA 3OYHA 1BL3A 3NGIA 4PQUA 3VQQA 3OYAA 1QSLA 4DQIA 1RCHA 4GW6A 1NK9A 5C24A 1FK9A 3AV9A 2Y1IA 4CJRA 4CCHA 1JLQA 3CG7A 1NK6A 2G8IA 3OYBA 4DLEA 4F3TA 4BE1A 3DLEA 1Y97A 1LW0A 1VSFA 2E6MA 3AO5A 3VQ6A 1QSYA 3LWMA 4CF1A 4DQQA 1LW2A 3EYZA 1ASVA 1B9FA 3SPYA 4KTQA 3DLKA 1YTAA 2WOMA 1Z26A 1RBVA 1NK7A 2ATQA 4EZ9A 1NJXA 2JLEA 1U48A 3AVMA 3IS9A 2P51A 2YNIA 3HK2A 1RBTA 4KB1A 3NDKA 3NBPA 3RRGA 4K8XA 3CM6A 1SUQA 3AO2A 1RT3A 5T7BA 4J2BA 4KHNA 2VG7A 1LAVA 1RT4A 1HYZA 3WNHA 4RW8A 4CFDA 3U3YA 2X6SA 3V4IA 1WSGA 4I9QA 2HNZA 3CFOA 4FLXA 1JLEA 3OVNA 3OYLA 4RW7A 4C8LA 4CGFA 3SQ1A 3PX4A 4N41A 1RILA 4CHNA 3L2WA 3NF6A 3LP1A 3LAMA 2D0BA 1UAXA 3QEXA 3BDPA 3ZSZA 1RDDA 1XI1A 1WAJA 2E6LA 3AVFA 4KKOA 4W5RA 3EZ5A 2ETJA 3V9XA 3ZSXA 4DTJA 2AJQA 1TV6A 4FJHA 3WNEA 4B9NA 3QEWA 3KLGA 5I3UA 3VQ8A 4W5TA 2YNFA 1VRTA 4CHQA 2KZMA 3FFIA 5HBMA 2E4LA 2KQ2A 1ZBUA 2ZQBA 3D45A 2O4IA 2DY4A 4KI4A 3PUFA 1RTJA 5DMRA 4F2SA 3MAQA 4JLHA 1J5OA 1DTTA 3VA3A 2YKMA 3NF7A 2ZE2A 3DRRA 4XIUA 3DLHA 1FKOA 2RN2A 4Z4FA 1SKRA 4DFPA 3VQAA 1N6QA 1TAQA 1UOCA 3KLFA 1X9MA 4FYDA 2G8HA 3DOLA 4BE2A 2HMIA 1A5VA 4LH4A 3V81A 4QCLA 3L2RA 4MFBA 2G8FA 3OS0A 1RTHA 2OPSA 1JLAA 4E3SA 1YT3A 3SUPA 3G10A 3SPZA 1DTQA 4BDPA 5C25A 3HXMA 2IGIA 4NYFA 4O5BA 1S6PA 1WSHA 4CJSA 2OPPA 4DTNA 4OPJA 3NE6A 2O4GA 3AVAA 4E7IA 4DFMA 2B6AA 2YNHA 4DLGA 3OY9A 1D5AA 1Q9XA 1KFSA 4AHRA 4C8NA 2W42A 5EU7A 4OVLA 1C0TA 4CJKA 1SKWA 1BHLA 1RTDA 4CEOA 4CK2A 4FM2A 3RMBA 4CGGA 3HSTB 4DSIA 4L8RB 3AO4A 4M3RA 4HUFA 4FJIA 4TSXA 3AVKA 3ULDA 1J54A 1O1WA 3DMJA 4AHSA 1NKCA 4C8KA 4CF0A 4CJEA 4E89A 3SI6A 3V9SA 5C42A 4FK2A 2HHQA 3P1GA 1FXXA 3LALA 3VQ5A 1VSJA 3V1RA 5KTQA 3SNNA 1SL1A 1LAWA 5FRMA 4BDYA 3K5MA 3T3FA 4CHOA 4DTXA 3QESA 1S1TA 3V6DA 1U04A 4KO0A 3OYNA 4HHTA 2QKBA 1CXUA 5JS2A 3C6UA 4CGIA 3ZCMA 3S9HA 2F8TA 3E01A 2EX3A 1B9DA 4ZTJA 2GV9A 3ZSYA 4CEDA 4DQSA 3TAPA 2PY5A 1TAUA 4IBNA 5KRTA 3HYFA 3QNNA 4FK0A 1EXQA 2IC3A 3LANA 4N5SA 2F8SA 1S1VA 4H8KA 4E1MA 1X9SA 2RPIA 4I7FA 3MECA 1KCFA 4DF4A 4C8OA 4OPKA 1WSEA 1XWLA 4R5PA 2FBXA 1G15A 4CK1A 1U4BA 3M8QA 3TI0A 1UA0A 3TAMA 3KIOA 2FBVA 1WSJA 4JS4A 1NJZA 2F96A 4DSEA 4E1NA 4Q0BA 5DK5A 3VA0A 3HVRA 1VSKA 3LAKA 4M3YA 4RW6A 3OYJA 3DM2A 1RTIA 4B9LA 4DTMA 1S5JA 1TL3A 4RW9A 2B5JA 5HRNA 4FLYA 3MEGA 3SV4A 3SV3A 4FZXC 4N56A 3AA4A 3L2VA 2BGGA 3CYMA 3K58A 3P5JA 1GOCA 1HQEA 3SYZA 4KREA 1WSIA 1TVRA 4OKKA 4FZZA 3VN5A 3TARA 3L2QA 4CIFA 4FJ5A 4O0JA 2HNDA 2PZSA 3OYGA 5E41A 3F73A 3LZJA 2D0AA 4FW2A 4KV8A 3TAFA 3TANA 2XY5A 1XHXA 3OYMA 3NF9A 3PY8A 5CYQA 4NYNA 3OYKA 4FLVA 3KLHA 3IRXA 4CJTA 1NKEA 1RDAA 3KKSA 4B08A 3JSMA 5KGWA 2KFZA 3M8PA 1HYVA 1RT7A 3L3VA 1X1PA 1CXQA 3AVCA 1KTQA 4O44A 4B9TA 3LZIA 1QE1A 3PX6A 5SZTA 3DI6A 3L3UA 4BWJA 5CYMA 3PO4A 4Z4EA 1RDBA 3HPGA 4EP5A 3V9WA 2HHTA 2DTUA 3AVHA 1KVAA 3DRSA 1T7PA 2ZD1A 1UA1A 2IOCA 1Q8IA 3A2FA 4QAGA 4CJVA 2FBTA 3VQCA 3L2UA 1HYSA 2HHSA 3V9ZA 3SUOA 3NHGA 4LSNA 3JYTA 4IFVA 3DOKA 4CGJA 4KPYA 1BI4A 4Y1CA 3NH2A 4CEBA 1B92A 4I2QA 1RT5A 3AA3A 4DF8A 3OYIA 3QERA 1HPZA 4OKEA 2YHAA 3SUNA 2OPRA 1EP4A 3C94A 4IFYA 4FJNA 4HCBA 1VSDA 1XC9A 5HP1A 4CJPA 5J1EA 1TKDA 4CJFA 1RBRA 1WAFA 4NCGA 1ZBHA 1BI4B 1JLCA 5FROA 4OGCA 4FLTA 4FJ9A 3HM9A 5J2QA 2HHWA 1L3UA 3I0SA 3O4NA 3SUQA 4B9UA 4FJ7A 1J53A 1BCMA 3OYEA 4BE0A 4Z4HA 2IAJA 4FCYA 4DTPA 3LDSA 3HO1A 4PY5A 2X78A 2Z1HA 3B6PA 1GOAA 5D3GA 2A1RA 1JLGA 3O4QA 3K59A 4CIGA 3P83D 4Z4IA 1L5UA 3PO5A 2NUBA 4BWMA 4CHPA 4ICLA 4YFUA 2KTQA 4E7KA 4DFKA 3QEPA 3OS1A 3SCXA 2A1SA 5HROA 1NK4A 2PYLA 4LY7A 1QSSA 4JS5A 1RBSA 3OYDA 4KTZA 5HLFA 3AVNA 1VK0A 1NK8A 4CEAA 2Z1GA 3AO1A 1X9WA 4E7LA 1YTUA 5JS1A 1LWFA 1L3VA 4ELUA 1IKYA 1TGOA 4F8RA 4DG1A 2XY7A 4FJXA 2OA8A 4GMJB 3ZT1A 3SQ0A 5K14A 1JKHA 1RBUA 1W9HA 3HPHA 4J2EA 1U45A 1ASWA 3IAYA 3V1OA 4Q5VA 1TKZA 2D5RA 4N47A 1IH7A 3HPOA 1LWCA 2WONA 4CJUA 4YNQA 1J9AA 4FJKA 2GBZA 5FDLA 3I8DA 1NKBA 3C6TA 4BDZA 1D8YA 3WNGA 3OYFA 4DQRA 4W5NA 4ZHRA 1BIUA 4C8MA 1R0AA 3KK3A 2FC0A 3ALYA 1VSHA 4M41A 3NH1A 1HNIA 1KVCA 3VQ9A 1NJYA 4AILC 4FXDA 1C0UA 1S9EA 4O55A 3AVLA 3CM5A 4FJLA 4DWIA 2EHGA 1C1CA 4I9LA 3HP6A 3IG1A 2OZMA 2HW3A 2G8KA 2XHBA
chains in the Genus database with same CATH superfamily
1ZHFA 2K02A 3BQZA 2IA1A 4N4NB 4F4KA 2QYOA 3DQVC 3GF2A 4KJZA 3ZP5A 4BRMA 4DS4A 1QTMA 1IO2A 1UB9A 2M4GA 3C95A 2VGMA 3H3OB 1WN7A 1V4RA 4EM2A 5ICFA 5DS9A 1HW2A 4M3WA 2PMZA 3MX2A 4HZFA 5KPZA 2OCEA 4NCBA 1P9QC 4CEFA 3MXJA 3FISA 2XHKA 3KK2A 3PX0A 2A41A 1HQCA 3HOWJ 1J09A 4XNFA 4NUBA 2UU9K 4Q4ZF 1K73O 4CJ3A 3OHRA 2FD5A 3I59B 3VESA 4PFPA 5CVIA 2Q31A 1Q7YO 2WY7Q 1NMNA 2PJPA 4HUEA 1VSEA 3RCOA 1OFCX 2DT7B 4M9XA 1T38A 5E8GA 4IXAA 1S1XA 4RW4A 3RRHA 1ZYQA 4DQ2A 4B3TK 3FXRA 3OMYA 3F8FA 2V9KA 1TL1A 1XG1A 1OVQA 3H3NO 2XAJA 3PNYA 3E97A 3ZT3A 3G1LA 4LFBK 2Z1JA 4FM1A 3RWUA 3T19A 3RJPA 3E66A 3QB0A 1B4AA 2DFHA 3D0PA 1R4NB 1HW5A 1I1SA 4EAHD 1JKPC 1VQKI 3D2EA 4FWRA 4FK4A 3KK7A 2HNHA 4M72A 3G71I 4AIHA 4DYRA 1HX1A 4PKGA 3ESWB 2P5GA 4A5MA 3F22A 4AM7A 3F72A 1LEAA 4WYBA 5KPTA 1LKXA 1R1UA 3CP2A 3GE1A 3ZSRA 2XSJC 4BY7J 1SAZA 3CI5A 4B1ZA 3AG4H 2BH1A 2I5JA 3H9QA 2HF4A 4KAZA 2KHMA 3V42A 3RKQA 3LSTA 2P9LA 3BTJA 3K9KA 2UUCK 1FX7A 1VAZA 5BMZA 4L18B 4G7OF 3WTXC 1CZBA 5CJ9A 1MA9B 1QQNA 3DAWA 5HRRA 3WXJA 4HTLA 4AVPA 2Q2RA 4DW6A 5IP9J 3WTUC 1REVA 4FW1A 4X62K 4M3TA 2F5FA 1AA7A 4F2RA 2ID6A 2NZTA 4FWQA 2K85A 1T8IA 4GNIA 4C3IJ 4ENKA 3KZYA 4PL8A 4RWTA 2XF7A 1BWFO 5ICEA 3HL8A 3G4SN 4KHQA 2MA3A 1SV5A 2P9IB 2L2OA 1JGSA 1PJRA 1XD7A 3DWLE 4KN7X 1NGCA 2YI1A 5AQOA 2O4IA 1VQNI 3VPZA 1DPRA 4KRFA 2DTRA 3S1MJ 4BBRJ 2BXYA 1LVKA 1YX3A 3IUOA 4RBOA 1TL8A 1IJJA 4DKWA 4LG0B 3O3HA 2QKKA 1ZBHA 4LD0A 3VQBA 2IRFG 1A5WA 1ETYA 2QQ9A 2G8WA 4F3OA 4S05A 3HGGA 2JA8J 4JI5K 1R1VA 2CH6A 4L9TA 3O5BA 4DTOA 2EA2A 2K3FA 3H1CA 1QBJA 1VTNC 3QPTA 2ASOA 5DUIA 2BANA 1WKMA 3FK6A 1K6OA 1EQYA 2RNGA 5M1QA 3ZYYX 3NAEA 3CF5L 5E3MA 3MWPA 2L9VA 1RT1A 4Z0UA 1HJRA 2DDBA 3U9GA 3S3NA 1N33K 2DOAA 1QQIA 2CQKA 2Z9OA 3OBWA 3LAJA 5KHDA 4I2OA 2O3FA 2B9SA 4JRQA 5H6QA 5KAIC 1OQYA 3MKYB 3WG7H 2WWYA 4DQ8A 2G8UA 4DFJA 3CJ9A 2M7AA 2E1NA 3UNGC 1MMGA 3DWLA 3C65A 2HGCA 4KTWA 3TAEA 4M42A 3O08A 3S93A 3G4SI 3LM2A 3FXUA 1HW1A 2LDUA 3WEEA 1Q1HA 2V51B 1SAXA 3I56I 3S41A 1BISA 1FW6A 2QW9A 3D2FA 3DXMA 2ZGZA 2VL8A 2DK8A 2P9PB 3ULQB 2HYFA 1KU3A 2GUIA 2BE2A 4MLEA 1EX4A 1DT9A 2XHBA 5DCMB 2X74A 2CYYA 4CHZA 3QNOA 1KVBA 4DSJA 2PBDA 3LMMA 4JBAA 2VC1A 4DTUA 1NK5A 3LP2A 2OANA 4F92B 3ASNH 4DQPA 2KFNA 3F6OA 4HW0A 2HQNA 3T8RA 3KETA 4GKKK 5J6XA 3U9ZA 4F93B 5JHUA 3GFJA 4LH5A 4AIDA 5IYDJ 1SD5A 3IL2A 5FPEA 1IGNA 4ID1A 4DU4A 4KIGA 5CHIA 2VPRA 4FHTA 3MFKA 1U47A 3Q0WA 1SL2A 4CEZA 3M3ZA 3JREA 4CJ5A 1BIAA 1VQ9N 1HRHA 4YIRX 3QYEA 4RGRA 2OPQA 2EJRA 3RKWA 4DGWB 4JKGB 1KSPA 3CFRA 1TUUA 2ASMA 2BXZA 1XC3A 4WFBL 1V5GA 1IG7A 4C2UA 3VQPA 4F7ZA 3GDQA 2ZF5O 5C2DA 1N25A 4DV0K 2IEKA 4B9MA 4J2AA 3QO9A 4HTUA 1OVYA 2DI3A 4O4GA 3CCEN 4PWDA 1IAWA 4QS9A 1OLTA 3TMOA 2HB5A 4CW7B 3SHFA 3E9PA 1SKSA 5AQHA 4CBWA 2K7LA 5CVUA 5BPLA 3D5RC 5FO5A 3E3VA 3MMVA 3THVA 2CV0A 2VE8A 1JLFA 3AVJA 5AFUH 3OSFA 2D1KA 5J8FA 2Z33A 4B1YB 1FWZA 1BA1A 1DP7P 3MEDA 4CJLA 3TP0A 2V7ZA 2ISYA 2JK3A 4EHTA 5JVGF 2P1JA 4AHTA 2KFDA 1TK5A 2M1BA 1QHAA 3KKRA 1OCPA 4XLNF 1MDMB 1WB9A 1W5SA 2VG5A 3J7YP 2R7YA 1WJAA 2H6BA 3KVGA 1KGSA 4XICA 1WGXA 1HCRA 2DDAA 2BBYA 2V26A 3MEEA 1K8KB 2ID3A 4HOBA 1BC8C 2EFOA 4UQGA 1APLC 1SEUA 2H8RA 1XPXA 3ZT4A 1IN8A 4I0BA 4PJ0C 3TOBA 2JA7J 4QIWN 3D5SC 2CH0A 2HDDA 3ZT0A 3TAGA 3VTIA 2KPMA 3MN6A 4CJWA 2K9MA 1Y8RB 3HSCA 1IZ1A 2E2QA 4KIBA 3T69A 2GZWA 4KIFA 4J00A 5GAEP 1E4FT 3ZSVA 1D9DA 2OZSA 2HHXA 3ZMUA 3KD1E 1U2VA 3ZQ7A 2RAEA 2Y30A 1SFXA 4ASNA 1ZGWA 2GLOA 3ZSWA 3T1HK 5HDNA 3ABLH 1FYMA 1CGPA 4CIEA 3O3GA 3CMAN 1R00A 1V55H 2BVMA 5J2NA 2OYQA 2ZJRL 3ELKA 4HCCA 1CLQA 2LY9A 3ZMSA 5B1AH 4FTHA 3VPRA 1TC3C 1FBQA 3EETA 2LP0A 3TU5A 3WQUA 1N32K 3O9RA 5K5OA 4CZEA 3HI0A 3M1EA 2I10A 3OYAA 1QSLA 4DQIA 5FKNA 4PDKA 1KU2A 4A3BJ 3AV9A 2KMUA 2CQNA 1JJ8C 1WH7A 4IHVA 5CQGA 3FKIJ 5IOZA 1JLQA 1MMSA 2Y1IA 4CCHA 1LUJB 2I7NA 3BR6A 3M8EA 1MBKA 4R1HA 2JRTA 4A3DJ 4WXCA 2HF3A 1Y97A 1EV7A 2P8TA 2UUBK 4XEIA 3BLYA 2WY8Q 3LWMA 1VQPN 1X3ZB 5D6FA 1RC9A 4LG3A 1YTAA 2FBHA 1RBVA 3I55N 1NK3P 5M5XJ 2JLEA 1FSEA 1S8NA 3M9AA 3FXLA 2VKHA 2CFOA 3HK2A 4K8XA 4A6EA 5AQSA 2F5DA 2IVMA 2KIUA 2P6SA 4UUTA 4AC0A 4B3XA 4D1QA 2XSDC 1VQMI 3CM6A 3WXMB 2WUSA 4BR0A 3BG3A 1SZ2A 1RT4A 3WNHA 4RGXA 4CFDA 4RW8A 3ZLJA 2F4VK 2P9SA 1RETA 2HNZA 4XRSG 4HF2A 3I59A 4FLXA 2JA5J 5EVZA 4L9NA 3VSLA 3PO3J 3N4QA 4C8LA 2YU3A 1BU6O 2GX9A 3PX4A 3SQ1A 2YJFA 3L2WA 1ILYA 4BVOA 3DLLL 5BN8A 2COMA 3LFUA 2VKVA 3BG6A 2IS4A 1UAXA 3LAMA 1ZQ3P 1R23A 1WHUA 3BDPA 1MMAA 1TYQA 1WAJA 2E6LA 4KKOA 1MBEA 2VJ4A 4PSXA 4JK1X 3CCMI 4BC2A 1YYVA 3V7RA 2O6GE 2E2PA 4ILJA 3P4IA 3H45C 3SZGA 2HPIA 4Y15A 3LAPA 2GUPA 4JKEA 3QEWA 4JD2A 4X1EA 2OF7A 5HNHA 4A3MJ 1VRTA 2A3ZA 4PK4A 3CETA 3A2KA 5HBMA 4X64K 1OMIA 4BUPA 3MN7A 2MD0A 4EVIA 2HU9A 3ATVA 4KI4A 5DMRA 3QMLA 2YKMA 4K2EA 4MTEA 3SXYA 4EV0A 1CF7B 4XIUA 2ZXWH 3QDKA 3W2VA 2E5ZA 4I7HA 4IOXA 1K9MO 2RN2A 5HS9A 3DLHA 1SKRA 4KNYA 4NXMK 3VQAA 2ZJ2A 1TWCJ 1NK2P 3SAFA 1N6QA 2WBMA 4CSWA 5DV5A 4QCLA 1A5VA 1HSJA 2E34A 3M1CA 2V6EA 2OTJN 3CCSI 2MFZA 2YPRA 5A2QZ 3TDUC 4MFBA 2G8FA 4KH5A 4CK2A 4IJNA 4KPYA 3HXMA 2IGIA 3D1NI 4NYFA 2DMPA 3FZVA 4CJSA 2DJNA 2HVQA 2XROA 3M5RA 4KITB 3ZQLA 3CQZJ 3TPQA 4EGZA 1D5AA 1KFSA 2BGCA 2QM3A 1W36D 2W42A 4C8NA 3D0SA 3IP4B 4OVLA 5EU7A 5AQIA 1BHLA 1W7PA 2E1CA 2XGEA 1X4PA 2VQCA 5IP7J 4OIQF 5EXWA 3S32A 2HKXA 1FOXA 1UZCA 2CW7A 2QEXI 2UZKA 3AO4A 2LF7A 1VQKN 4FJIA 5E3OA 2BW3B 3AVKA 3GZNB 1PYVA 1J54A 2ZO4A 2JVGA 4OINF 1GLEG 4AHSA 5FKMA 4G9YA 3DV8A 3NVMA 3C7NA 5C2FA 1QVGM 4C8KA 4FK2A 4HLYA 2PQ8A 3V1RA 2QWWA 3SNNA 3PIPL 3K5MA 3T3FA 1QO0D 4BRFA 1IN6A 4OOIA 1WBBA 3SLCA 1K8KA 4CCKA 2QKBA 5JS2A 3C6UA 2F8TA 3ZMVA 2F48A 3E01A 3S9HA 1B9DA 2OTLN 4RTFD 4DQSA 2E60A 2A42A 2JWLA 3BUZB 4CEDA 4ILGB 1MSEC 2PY5A 1J0RA 2P7VB 3CCLN 2F8SA 3OL3A 4IRIA 3MECA 3FXKA 4A5BA 1ZXOA 4JNEA 2HDCA 1WSEA 1U2VB 4BXFA 4E6KG 4R5PA 2LLKA 4YEJA 3C0BA 1LDDA 1HA8A 4CK1A 4EJWA 1R59O 2E1OA 3KIOA 4ILHA 2KIMA 2F96A 4G6DA 4LF6K 3HVRA 1SC7A 1VSKA 4HSTA 3JAMK 4M3YA 4IJAA 1ZRCA 3OYJA 4DCHA 1RTIA 2JJ7A 2JPBA 4AU7A 4BRKA 2FMYA 3BC8A 2CQXA 1ETXA 3I71A 2YJEA 2IJLA 3MEGA 3SV3A 4DR4K 3LNQA 3NEUA 5TRDA 5GAGP 2L7MP 2RQQA 1KQ8A 2CW8A 1HQEA 2P9UB 4BRCA 1JHHA 4FZZA 3QQAA 1QVUA 1UJ8A 5ADXA 3VN5A 4CD3A 3GVAA 4BXUA 3BWGA 4GYIA 3CCYA 1FTTA 2QA4N 4DR1K 3UR3C 4AM3A 1MJBA 3TGNA 4WCGA 4OIRF 4DJAA 3HOUJ 1FLIA 1D8JA 4AWXB 3F73A 1XGNA 5IPAA 1PUFA 2VUMJ 2D4WA 4FW2A 4KV8A 2ZNYA 5JLHA 2X9DA 1YE9A 2QWRA 5ELZA 2PAVA 5LRRA 4ZZDA 4I0AA 2P9LB 4NYNA 3KLHA 3IRXA 4CJTA 4V19K 2HTJA 2KT0A 1RDAA 1X9JA 1MBJA 1NTCA 5KGWA 3K6GA 1HYVA 3FDYA 2XKOA 2K3PA 3S15J 1AOYA 1FOYA 1RT7A 3AVCA 4QSHA 3FM3A 1QZYA 1D1AA 2DPUA 1N77A 3EE8A 3P9CA 4BWJA 5SZTA 3PO4A 3FK7A 5C10A 2EK5A 2FXAA 4Z4EA 2HHTA 3IHUA 3AVHA 3DRSA 3DBRB 2F4IA 4CJVA 1Q8IA 4HA8A 4ANJA 1GLFO 2FBTA 1P4WA 3SYTA 2Q97A 2HHSA 4CCOA 2XRLA 5CVRA 1ZR2A 2DMNA 4AM6A 3JYTA 3NHGA 4CZHA 2NRWA 1YTYA 1LE8B 1BC7C 1W0UA 2O9LA 1KD1O 1QNTA 4I2QA 1RT5A 3LL7A 4DF8A 2P5KA 3UKRB 4G7ZF 1HKCA 3QERA 1OYIA 2QLZA 2FBIA 2YHAA 3KX2A 1U5TA 4WFAL 2OPRA 2N8GA 1EP4A 1MWKA 3JAMO 1NJIO 2UUAK 3QBWA 3S1RJ 1J59A 4GV9A 1VSDA 3LOCA 4YFNF 5HP1A 3M1FA 1JE8A 2FNAA 3T0YA 1NLVA 2OBPA 5D4RA 3WE3A 4H0EA 2V4JC 4F55A 1W7PD 1UCRA 2KP6A 4KT5C 3ZGKA 1AHDP 5FROA 3JRBA 4OGCA 2AO9A 5F1RA 3I5UA 2FQ4A 1CF7A 2E88A 3MK6A 2WTUA 5BPNA 2KTQA 4FJ9A 4I6ZA 4LOCA 2DO7A 1ZC6A 5BRHA 4MHGA 3HM9A 5FLXZ 4BL0B 3VEPA 1BI0A 3ZQCA 3SUQA 4FJ7A 4FCYA 4BE0A 1J53A 4Z4HA 4RAGA 4KFCA 2QVOA 1KAZA 3E1YA 2Z1HA 3B6PA 4K43A 4Q5SF 5HL7L 4DR7K 2OTJI 2PEXA 3R0AA 2E8AA 3LSMA 5KQDA 3O4QA 3TTCA 4CIGA 1H0MA 1RPWA 2NUBA 3ZX0A 4A69C 1JT6A 4ICLA 3KFWX 5C12A 3H0DA 2K9LA 5B8HA 2I8DA 2PYLA 4BR4A 1Z0XA 2YUSA 2KRCA 3ERMA 1Z05A 5CVJA 3A5NC 1X19A 1WI3A 2XASA 1TQPA 3KEYA 1FYLA 4HF1A 4KTZA 4X6AJ 2F2EA 4CEAA 5E3NA 2D45A 2M3AA 4H5WA 1X9WA 2HFHA 1Z1DA 2E36A 4C3HJ 1HUXA 1YTUA 4KHPK 5JS1A 2GM4A 2LBFA 3BG5A 1SD6A 4ELUA 2QF7A 3P9IA 5J1RA 3BPVA 3DTIA 2P9KA 2IGMA 4F8RA 3EO3A 1WBDA 5L3GA 2FU4A 4XLHA 4FJXA 1FIPA 2E7XA 2LSOA 3WTYC 1KXPA 2CUZA 2P9NB 1JKHA 2YHWA 4M63C 3ZT1A 4BREA 3SQ0A 3VERA 4EEFG 1ASWA 4Q5VA 2QM1A 3IAYA 2ZJPL 1Z3YA 1TKZA 4L5JA 4N47A 2Y0SA 4DHYA 5J4YA 1LWCA 3CESA 2GOMA 2HZTA 4IZ9A 1J9AA 5AQPA 2G9WA 1P6RA 2WV1A 4CJUA 4YNQA 1N8RO 1D8YA 2OD5A 3OYFA 4W97A 3DLLF 1C0WA 3LL3A 1I3QJ 2B63J 4W5NA 3HRGA 2NVYJ 1QA6A 1RFQA 3LDLA 5C44J 1YOVB 4MLHA 4B44A 1F9NA 3QRFF 2KLAA 4CVNE 2JQ7A 1HNIA 2FUG2 5LMUK 2O03A 5FKKA 4FXDA 1C0UA 3G6EI 3CM5A 3GEZA 2R3SA 3SBTA 5K7HA 3GO5A 3ULEB 5BRDA 4FJLA 1R7JA 3GZ5A 4G8XA 1C1CA 4YFKF 3MN5A 2RNJA 5BREA 2JA2A 1WJDA 2LYCA 1K79A 4DUZK 1YI2N 3J7ZI 3W2AA 1TNSA 4CFBA 1V5EA 3DKYA 1C0MA 3I58A 2V79A 2OAZA 3DU6A 3V7SA 3THYA 1SL0A 5K7FA 2E71A 1EH6A 4FT8A 4DSFA 3UIQA 4DS5A 3RTRA 3FIWA 3O3KA 3OR1C 3RTVA 2OU2A 1XQSC 1TT5B 3EUHA 2COBA 4G6QA 4BC4A 5ADXH 1MJ9A 3FWEA 3S14J 1RUOA 1A6QA 1RDWX 3ZX3A 4DSLA 3CC7N 2JVHA 3PUBA 1GV2A 1LFPA 2A5YB 1P4XA 4AVZA 2VOOA 2WAQN 1XSXA 4PKIA 1A04A 1BJAA 4RB1A 3K2PA 2O8CA 2DBBA 1AWCA 1HLUA 2GWJA 4B3MK 1HDPA 2NNYA 5E84A 3O6BB 2DYRH 1UG2A 3K0LA 4IWVA 2BY3A 1JXBA 5AQFA 3E5QA 5EG0B 3KTQA 4JI7K 4PUOA 3CC7I 2VASA 1YW7A 4O0IA 2MH9A 3B02A 3ZQGA 3JTHA 4P55A 2NXNB 3J80K 4O5VA 1C6VA 4A61A 2QCOA 1KLNA 3AO3A 2HYJA 5HRSA 1USTA 5KRSA 3CCQI 4U88A 3S16J 4X65K 2FOWA 1XMAA 3R6MA 4LFCK 1YS6A 3S3OA 1T0FC 1YJWI 3WQTA 2MW8A 4BQLA 3SJJA 4BXXJ 1H89C 2VI6A 2YNGA 2P5OA 3GMEA 2HOEA 3ZSQA 4DV5K 3RZDJ 3MEXA 2H1LA 4FWSA 3R3LA 3I53A 4UY8O 4F52A 3UKGA 4LFAK 1IG9A 4I76A 5BR9A 5ED4A 5KPRA 4G9ZA 1VQ8I 4BRDA 3KP6A 3A5MC 1Q81O 4DBRA 3ENHA 4FLWA 3HOYJ 4E7JA 1FMWA 1RZ4A 2A6EF 3F8NA 3QP5A 3HL2A 3JS6A 4IXCA 5BPIA 3F5TA 3K5OA 2GA1A 2P0WA 5J1UA 3OS2A 5D6EA 2W24A 2DJIA 5D4SA 4U0VA 1RT2A 4LK0F 1SMYF 1WI9A 4BGDA 1J5YA 2HBMA 4IVNA 1FNNA 2BVLA 2JRMA 4D7MA 1C1AA 2STTA 4CFAA 3SAHA 2F9WA 1WRJA 2CH5A 3CFPA 3KP3A 2NRHA 3T1YK 5AQJA 1HKBA 4JX4A 4P5OA 3WGHA 1ZLJA 1IXCA 2CJJA 5DD8A 2XF6A 2FQ3A 3DXJF 2B7EA 1N78A 1MU2A 2CGLA 4FM0A 4HSRA 4O8KA 3VMFB 2DK5A 2R7OA 2IGNA 2Q2EA 3JSOA 2AS5F 1OH8A 2VIXA 5DYMA 5SWMA 3R0JA 4KICA 3AL0C 4NO7A 2W1OA 2YV0X 1GLDG 4FLZA 4OJRA 1JT0A 1JGGA 1EETA 4YELA 5ILSA 3CCSN 3HHGA 3RYRA 4QWQA 1VQ5I 2VWBA 3PIPF 1RUNA 4JKAA 2MG4A 3RMDA 5KGXA 4E70A 2BHYA 3RIRA 4AHCA 1EKEA 1MD0A 3LSIA 1JLBA 4EFHA 2EQRA 3BCAA 1ASUA 1VQ8N 3GTLJ 4B8AB 2NYXA 3Q9VA 2ZMEA 3FMQA 1T2KA 3J81K 1S9GA 3FLCO 4OU0A 4AHVA 4M9SA 3WE2A 3EKSA 4CF8A 4CJ7A 2QKLB 1FY7A 3H5AA 1WLJA 1MBFA 3BGRA 1P2FA 3P7NA 4JK8A 3VEYA 4CZLA 2QSFX 2X4HA 3NFAA 3MVPA 2VGNA 1J5EK 1QZZA 2BTFA 4B1RA 4JKFA 4BYYA 3GTGJ 2VG6A 4RLQA 3LSKA 4P1WA 2HXOA 4M7XA 2KDOA 2RKHA 3MCPA 3GLXA 3DXKB 4I6MA 4PUSA 3SFIA 3MZYA 2LY1A 1YVNA 4DTSA 2X6WA 5HRPA 1FYKA 4XLCA 1S1WA 3CJNA 1T05A 3SFZA 1Y1WJ 2ECCA 5LRSA 3R4KA 2RVCA 1KU9A 2JWTA 4E1JA 1D3YA 4IO9F 3U1KA 1SFUA 2RKIA 3A8YA 5GINA 2LTPA 2Y1JA 3DYAA 3IRRA 2NRXA 4HX7A 2FBKA 3ULEA 3L3VA 1TQIA 1HMVA 4DU3A 4BAYA 4QS7A 3RR8A 5AQZA 4Y4RA 4JX6A 4BRGA 1QQCA 2G8VA 2V9VA 2QWQA 1WJFA 2L3DA 3ATUA 2LD5A 2ACJA 1POGA 1I1GA 1LWEA 4RG8A 4CF9A 2ZBKA 1I3AA 2V1DA 2ZFWA 1QPIA 3HDDA 3ISNC 3AFHA 5JVTA 1XGMA 3D2EB 3THYB 4M45A 4R79A 4H0OA 5CZ2A 3CUOA 3VYTB 2QQ8A 1BDGA 3ERED 4IKFA 2WC9A 4KHUA 5FD5A 1BN5A 4U87A 4FO0A 3NGZA 4BRIA 1KYWA 1WPKA 3GWZA 2AP1A 4BQAA 1S7EA 3GTOJ 4GV6A 4LITA 2BE5F 2QENA 1P90A 1BGXT 2IS6A 1F43A 5DM7L 4KHYA 4LF8K 1D0YA 5DUKA 1S5LC 1F36A 3H08A 2HQRA 3I4MJ 2J4RA 5J2PA 5I9EB 5GPCA 3HM5A 4QOZB 2NNNA 3HSEA 3KCCA 3AVGA 2MSYA 3U6FA 1TNTA 2G0EA 2QWLA 4XN0A 5BQTA 4OO1J 4LGWA 3MXMA 3WNFA 4MO4A 1WCMJ 3ASMA 1Z25A 3PNTA 5ERIA 4IG0A 1YJ9I 1QQOA 2A5XA 2P4WA 2FE3A 3DTEA 3H5NA 4MEXF 5A2QO 3KLEA 3CZ6A 4L5EA 4N76A 5FRNA 4GKJK 2B4JA 5FLXK 4ESBA 4FJJA 3SQ2A 3THWB 2R7FA 3UKUA 4RW6A 2HPMA 4IEJA 4FWPA 2O8BB 3HVTA 4HG2A 1RIOH 1MBHA 4LG0A 4DMNA 4DR3K 2QUFA 2JUGA 3TO6A 1MJAA 4CJFA 2R7QA 1FBUA 4ABZA 2FA5A 2MABA 4BHBA 1W2BM 1EF4A 2E1YA 5EEHA 2RF2A 1P7JA 4XSXF 4I99C 5F64A 2GWKA 3I0RA 2EH3A 3LWFA 3M8FA 4OAZA 4TV7A 2FLOA 4JHDB 3HUGB 4I2PA 4Y7NJ 3ABKH 4BKXA 4HEA2 2IPQX 5BOXA 3T1AA 4FJGA 2DT6A 1F5TA 4S04A 4OGEA 1RKTA 5J1YA 4JKHA 3VYRB 2DFFA 3CPWM 4BG9A 1HR0K 4HRIA 4CE9A 3G25A 4FWKA 5AQXA 1TUYA 3HYIA 3KP2A 4BU2A 3O8HA 1G99A 4EMSA 1DKGD 1BOAA 1QGPA 3PNVA 3I4PA 1ZYRF 5J40A 1YW8A 1RCHA 3I8BA 2QEXN 4D9JA 5B5EC 3J80Z 5HLTA 3CJCA 1S6LA 2EA4A 3CG7A 4ETSA 4DBQA 1EJ9A 3ZPLA 2R93J 2G8IA 2FSKA 4DLEA 4F3TA 1TWFJ 4GVEA 2CV2A 1VSFA 1YQAA 3AO5A 2LOOA 4ZYGA 3VQ6A 4CF1A 5DCMA 4WX9A 2HI3A 1B9FA 3CCUN 2YX7A 1BA5A 3DPUA 3PFYA 2VOPA 1OR7A 4BEHB 1Z26A 3CPEA 4RLFA 2VYPA 3MCAB 1NK7A 5K7ZA 2YX6A 5BPMA 3QPHA 3THXA 4C1NI 2GXAA 2YNIA 5L3DA 1WH5A 3NBPA 3MMYB 3G1OA 1FJGK 4XM3A 2NVTJ 5T7BA 4J2BA 4YY3K 4ZZLA 4IRHA 2ZMEB 4UHTA 1V4SA 1NWKA 5AONA 1X3UA 1ETVA 4MO7A 1ACIA 3TO9A 1WSGA 4A3KJ 3CFOA 3V4IA 5AQYA 4JKGA 3OYLA 4CICA 4RW7A 3TL4X 4FWNA 3E7LA 4N41A 2F6CA 1MSFC 2X48A 2NS0A 4LIVA 3NARA 4XR6A 5JLWA 1ATSA 3ID6A 4A3FJ 3B8AX 1RI7A 4GXOA 3VENA 4BRAA 2UXNA 3IKVA 3HRMA 3KPHA 4JQFA 5M1KA 1XI1A 3FXOA 2ETJA 2AJQA 3CDIA 4YOVA 1J7KA 4U0YA 3WNEA 1DU6A 5IT3A 2ELJA 3K0SA 5I3UA 1DUXC 4ZYAA 3VQ8A 4LF5K 5HS7A 2ELHA 1VQ6N 5BNGA 2W57A 4YIIA 4GYGA 3OSGA 1F4KA 5EF6A 1W97L 3NRVA 1ZBUA 2KQ2A 2ZQBA 5FPNA 2KZGA 3TOAA 2Q1NA 2LK2A 1RTJA 4JV5K 1DTTA 1PP8F 3CUQB 2IXSA 3BROA 1V4TA 3VA3A 2ZE2A 1X4OA 2WTEA 4D0PA 1GVJA 3CHWA 1T0FA 2VXZA 5HS8A 3L00A 4DFPA 3VEWA 2CUEA 2OPTA 3CDHA 3F21A 1TAQA 3KLFA 1X9MA 2G8HA 4FYDA 2DMUA 2HMIA 3V81A 1OCTC 3K4CA 3F9MA 2KJBA 1LE8A 2X6OA 4AYBN 3SUPA 3HC7A 4KN4X 3MZ8A 5AQMA 3SBGA 2XAQA 3BQYA 1K8AO 1DU0A 3ID8A 4PY5A 5TKYA 3WTZA 1W7AA 4ZYEA 4F9OA 2OPPA 3ZMZA 4E7IA 2O4GA 4OPJA 3NE6A 5JVHL 2GA2A 2B6AA 1B6AA 2YNHA 2GIVA 3BF3A 4DLGA 4DFMA 4LB6B 4CYDA 4FX4A 1R5ID 2UV1A 3NAUA 4KDPA 3ZETB 4CJKA 2Z3YA 4DSIA 3PJRA 3PL8A 2Y9YA 3HSTB 4L8RB 2ZNZA 1E17A 2KDZA 3DJCA 1VQNN 3I64A 2HQ5A 4P9FA 5CYVA 5C4JJ 1QU3A 1ZTRA 5GAHJ 2L4AA 3ULDA 1NKCA 3FX3A 4FJ8A 1NNEA 1O3QA 3SEZA 2XVCA 5K1YA 5BN9A 2EFWA 3LQQA 4MQVA 1B72B 4CJEA 1TWAJ 3V9SA 1FXXA 3LALA 2WAEA 1VSJA 5AQGA 1SL1A 3K2ZA 4G7HF 3CC2N 1JI8A 1HJOA 1E3PA 1W7PB 2QTDA 2ITMA 2HOTA 1RGIA 1S1TA 3QESA 5CQEA 3V6DA 2RQPA 5KVRA 4B9TA 2FRHA 5KK1A 5M1PA 4HHTA 3THWA 3MWTA 2VB6A 4O44A 4JYKA 3ECOA 4A0ZA 3CCLI 2GV9A 4J8FA 2DFIA 1TAUA 3A03A 2W6LA 2E1MC 1X2NA 4LIUA 5AQUA 3HYFA 2CG4A 2HTSA 5DTDA 2TRTA 2IC3A 3LANA 4CBUA 4E1MA 1S7OA 2RPIA 4E4HA 3SK3A 4AQYK 4C8OA 5HDGA 1EA3A 4OPKA 1ZKGA 2M2EA 3ZQQA 1BR1A 4BS9A 2ZMEC 2FBXA 1IXSB 3ZR8X 3HUGA 5J2MA 3GTJJ 1X2MA 1GLLO 2VBYA 3TI0A 3JRDA 1WSJA 2OC6A 3CCRN 3IWFA 2DTZA 4Q0BA 4FVUA 3VA0A 2XAGA 3R8EA 3PLAA 3J81O 3MKLA 2WBNA 1VHXA 2P9NA 5JFRA 2JTVA 3M07A 4ZYHA 4RW9A 4XSZF 2BY1A 4D5FA 1S7AA 2W7NA 2B5JA 4YOYA 2DYSH 1ZBSA 3O1BA 1MMNA 1XMXA 2H09A 1X1DA 1UAAA 3HTUA 3OBYA 4CZGA 3K58A 3SYZA 2OTLI 3AGRA 3EYYA 5F0FA 4B43A 2W41A 3BJ6A 1BI1A 1Z67A 2HOSA 2NLXA 5BRFA 4RMNA 2ME6A 3WU2C 3L2QA 3TARA 1ENHA 1KQ9A 1FP1D 2HNDA 3HTVA 2PZSA 4FJ5A 1MNEA 1X1CA 2VN2A 1T6CA 3K9TA 1YI2I 2BY0A 2D0AA 4E7ZA 2HS5A 1VQLN 1SVOA 2HVSA 4H0XB 3TAFA 2XY5A 3TANA 2LNBA 1YXQA 3I0TA 3VDXA 4XLPF 2CV1A 4L3QA 4GV3A 1K7AA 1BW5A 1JCEA 1IBMK 3KKSA 1ZN2A 1E4GT 2P9PA 2BY2A 3H1QA 1OPCA 4OAYA 3PM1A 3VYSB 1IXRC 1EH7A 2EIMH 1KTQA 5AQLA 1QE1A 2DODA 2IVPA 2JN6A 4QLCU 4I01A 3J81Z 1NGGA 3CQXA 3FR0A 3HPGA 3CJTB 2NS7A 5CYMA 3TW7A 2QWNA 1YIJN 2CGPA 2VC0A 3BOQA 1JUPA 5LEJA 1UA1A 2OZUA 4FASD 3SUOA 1KA8A 5E8IA 3EE9A 4UVCA 4OIOF 4LSNA 2X85A 1M90O 3WU0A 5AJ3K 3BDDA 1VQON 3IWZA 3AA3A 5J8CA 3H6EA 4A6DA 3M4OJ 1GXQA 3OYIA 1MGTA 1HPZA 3SUNA 3MWMA 4NLBA 3GL1A 5F2RA 1XDUA 2TDXA 4A3LJ 1ZRFA 1DGRM 3C94A 2VKEA 4JI2K 4FJNA 2EWNA 4CJPA 5J1EA 1RBRA 3HSRA 1NGAA 1WAFA 4CD1A 3BZCA 1BI4B 1G3YA 1JLCA 4MDAA 5M1FA 4DNCA 2ZC2A 2QKMB 5EGOA 1RNLA 1KAYA 4IO8A 5E1XA 3S17J 3UKRA 3ZRGA 5FB2A 4ZC3A 1O13A 1HDDC 4NC6A 2O8BA 1RR7A 2X1EA 1GHCA 3RPQA 2KIQA 2IA0A 5J2QA 1TWHJ 1LDJA 1USSA 2KIFA 3EUAA 3I0SA 4NDLA 3O4NA 3NWSA 5AZIB 5GADJ 1XNQK 3K4KA 1E2XA 3A01A 1U8RA 2NOGA 3CUQC 4O8UA 3K4MA 2Q0RA 3AG2H 2K4BA 3H35A 3LDQA 3P83D 2LRDA 5EY4A 4QS8A 5FLMJ 4CHPA 2WC2A 4XIDA 4YFUA 3DU5A 3B6CA 1S29A 2LBFB 2L9SA 2NAZA 4Y3OA 1MDMA 1S22A 2I7PA 4BRLA 3I56N 4K41A 5JI6A 1BL0A 2W85A 4LY7A 3H3ZA 5KCMA 3OYDA 1SQKA 1TW2A 5LGTA 4BNCA 3N4MA 4X66K 3S2HJ 4DR5K 3AVNA 2LKSA 4O3MA 1BOTO 4M73A 4LD5A 5DD4A 3GW2A 3K70C 4M9ZA 2Z1GA 4EM0B 3DTKA 4LMYA 4RB3C 4JN4A 3RSEB 3IAS2 2HDWA 2PMZN 4HYEA 4IQJA 5IP6A 3X2QH 2KL4A 3FXMA 5KNLA 2XY7A 3CO7C 4GCVA 3S2WA 1KZHA 4GMJB 3K7AJ 5FJ8J 5K14A 3HPHA 1B1BA 1S72I 4BVPA 5HODA 5E20A 1U45A 1ZREA 4ENNA 3HZ6A 3BR0A 2D5RA 3LDPA 1XX5A 3QOPA 1KAXA 1W4MA 2E5NA 4BHPA 1IH7A 4RCHA 1OR7C 1MIJA 3KEOA 1TLHB 2EILH 2GBZA 5FDLA 4YIFA 2CWEA 1NKBA 3C6TA 3WNGA 2ZSHB 2HXIA 1TQMA 2KISA 3DPTA 1R0AA 1D0XA 1ZR4A 1E3OC 2FC0A 2HMPA 3KK3A 2Q1ZB 3ALYA 1RR8C 3MZHA 2OUMA 4M41A 1OH7A 2DCEA 1EWRA 3FF5A 4HNVA 3NH1A 3DEEA 4XKWA 3R60A 3A5OC 2Y9ZA 4BR7A 2GQQA 2M34A 1BG3A 2NVXJ 3RDIA 1ZGJA 2L4MA 3DPLC 4FL9A 3VSKA 3R61A 4XRMA 3QFUA 4I9LA 3K57A 2NRAC 2W82A 2VWKA 3VEVA 3VQEA 4PZJA 4KH6A 2M4KA 4CGDA 4L0YB 3O8GA 4M3DA 1FTZA 4RS8A 2L7FP 3QFPA 1S72N 3TKYA 1R9TJ 4HAMA 4IDKA 1U9NA 4IQ4A 4CJQA 3KP4A 3QETA 4FZYA 5GIPA 4M3XA 4D5CA 1T33A 3AVIA 3CC4N 4B1UB 3O9TA 2CMPA 4NQWA 1NK0A 3QLHA 1U5TB 4CERA 4AUXA 2JSPA 3WXKA 4DTRA 1U5TC 3CCVI 3QEIA 3OWTA 1W1WE 3MXIA 3C7JA 1LV5A 5IOYA 4BRNA 3BG9A 4CYCB 1XHZA 1QVFM 1JXEA 1XSVA 3ZOBA 2H94A 3LSJA 3EYIA 4XLFA 5AZJA 1HNZK 9ANTA 2DFEA 4A3JJ 1FSHA 3MCZA 2A6AA 3ZMTA 2R4GA 2PJRA 4LJZF 3S1QJ 4CZFA 4DV4K 1HQUA 1SFKA 5IT9K 2F5EA 1U9OA 1NH3A 4JEPA 4YHHK 1XB4A 4JD2B 2W00A 2JPCA 5LGUA 3JRIA 2ITGA 2P81A 3QINA 3HOVJ 4H5VA 3D7EO 4M6XA 5CY4A 1FEXA 1ETWA 3ZETA 1V54H 3N05A 3KE2A 3QPLA 2VT3A 4H4OA 3E1SA 4L0ZB 1WNSA 4XH1A 4BQQA 1S6QA 4B9SA 3HEFA 4C1NK 3WXLA 4LF7K 1ODDA 2Q36A 4ENMA 4DR6K 1GLAG 3RR7A 1K4TA 1RNHA 4KMUX 3IH2A 1KC8O 1ERDA 1YJWN 2QWMA 1NGDA 5CZ1A 3K59A 1XS9A 3HOZJ 1RDCA 3QICA 3G71N 1NGHA 3H92A 5J47A 5FLVA 1GOBA 2DW4A 5HLGA 1HOMA 1VQPI 3M8RA 2QXFA 3DCFA 2NOJB 4DOZA 1YJ9N 3JRCA 4KFBA 1UG0A 3SZ2A 1N36K 3EEQA 4BRHA 1FOWA 4ISGA 3C6HA 3HRUA 2B0LA 4CCJA 3NQOA 3NCIA 5C15A 3IFRA 3LWLA 1T03A 1O7FA 2VQEK 2QK9A 3EPZA 4Z4CA 3H9GA 4IG3A 2E5LK 2BW3A 3HBLA 4JS5A 2VPLA 4E7SA 3JW4A 4PGGA 3G3ZA 4KHWA 2CRGA 3AA5X 1J9IA 3HBTA 4FOIA 1OCOH 3GFMA 1BIZA 1C0GA 4WXHA 2IDOA 1YITN 4M6YA 3I4NJ 2LSNA 2CSOA 5AZIA 3PFIA 3SDBA 4PA1A 5LHGA 1EH8A 3H3VK 3SQ4A 1IRGA 3AA2A 3J7AY 5M1OA 3FZLA 2DAOA 1FT9A 4NNJA 3AAQA 4A62A 3M8SA 4FVMA 1HF0A 3MN9A 3HOTA 2KLOA 4MFDA 3J7ZO 4BJ5C 2Z5UA 3KLIA 5M5YJ 3IAM2 4PL7A 4B8XA 1A5JA 3F2KA 3C1DA 1J6ZA 3LP3A 4B9QA 4DSKA 1LB2A 3C6AA 3GOIA 1ZBFA 3CP8A 2HWVA 1QHHD 2EB7A 3BG7A 2QBYB 4ELTA 1W36C 2Q2EB 4CO8A 4YOTA 4CUGA 4WE1A 1KQ0A 1BQNA 3DXKA 1IKWA 2JUCA 2VQLA 4I6MB 2EIKH 5IYBJ 3CO6C 1H1VA 4N9IA 3PSIA 2P9SB 1QVTA 4OLBA 4LSLA 2WAFA 3IC7A 5DCFA 1NOZA 1WOQA 2GEMA 2DA4A 4FWMA 5JR3A 5E18F 2M0MA 2ZCWA 5AIPA 4Q47A 2BV6A 3OV8A 3FZKA 1G3TA 4H0TB 3Q3SA 5I42A 1FJLA 4ON0A 2J5PA 4LFUA 4DV6K 5D5WB 3QU6A 4FX0A 3V4GA 3KD5E 2PMUA 1ZELA 1FC3A 4AIKA 1HKSA 5D5XB 4B4CA 5LLQA 3CMYA 4Z94A 1T44A 4XRFA 1SFEA 2CQQA 3LA7A 3EUHC 5F0CA 2ZGYA 2QA4I 1SVMA 1TT0A 1ZG5A 2PFUA 4BQZA 2M9HA 4XKCA 3Q7CA 3L8BA 1GXPA 2O8CB 4RAYA 2MC3A 1W5CC 4DV1K 4JP0A 2R5ZB 5C4XJ 2L9RA 3FKJA 2O0YA 4HDUA 3PV8A 2M0CA 1VQOI 2PYJA 3CCQN 1YS7A 5TJJA 3K5LA 5IY5H 3DKWA 2EINH 3ASOH 3CDLA 1W0TA 3EZWA 3K4BA 4BR5A 4II3A 5M3FJ 2VCPA 3IH4A 4MFEA 1ZBLA 2FF6A 1Y6IA 4UNOA 3DLGA 4EZ9A 2WB1N 2GXGA 1WVRA 3OIQA 4DZJA 1BW6A 5D5UB 3AG1H 1SVLA 4F3QA 3OYCA 1YLFA 2M30A 5B66C 2R5YB 1NGEA 3L0QA 3H3UA 2VBWA 4XKBA 2KHOA 3ITHA 3N4PA 3O80A 2VXDA 3DRPA 1P7IA 1T08B 2I5UA 5AQKA 3UB5A 1VSMA 3GTMJ 3HKZA 5KAFC 4FISA 4OIPF 3U2RA 1U2WA 1HSTA 4A2BA 2V9PA 2K27A 3BCBA 3QODA 4XK4A 2D1VA 1NG7A 1T95A 3F9KA 4GO1A 1X3NA 3HP9A 2PJRB 1VFCA 4BR9A 1NOYA 5IT9O 1U78A 4CF2A 1Q18A 2Z1IA 1JKQC 4CEEA 3C18A 4LF9K 3ZEUA 1JL1A 1IUYA 3G73A 1ONVA 4BQOA 4E19A 1LVAA 2F4MB 4FJMA 3DEWA 3ZQHA 1YRNB 2KRHA 3LSGA 4XOPA 4WQ4C 3K4NA 2XPVA 3KLOA 1BJZA 2H1KA 1VSIA 4BG8A 4CHYA 1STZA 4DB3A 4ELVA 2GBYA 4NB5A 1IKVA 4JHDA 2JT1A 4IF4A 1Z9CA 4MGRA 4DZPA 3FZMA 3GG4A 2UXCK 4A0XA 4HNUA 4Y1DA 4HLXA 1I39A 3ZSOA 4A57A 2M8EA 3BZKA 3DBHB 3K9JA 2NVQJ 3Q5FA 3CMAI 1TK8A 1LOTB 2VQHA 2O8FA 1LCUA 1L0OC 5HNFA 4ENJA 4XRSA 4MIMA 4M3UA 5HDKA 3S1NJ 5CLSA 5AIQA 4CGHA 3FHNA 1XMKA 4LC9B 4GVMA 4EHUA 4GRIA 2Z99A 3CCVN 3V9UA 3QOEA 1Q82O 1E3MA 2ZSIB 4RAFA 3VOEA 1U49A 3GLLA 1F21A 5FFXA 3W3CA 1IBKK 3W6KB 3SJMA 4B8CA 4HVJA 2A6HF 4BY9C 1DGWY 2PFBA 1GV5A 5EOYA 4CFCA 3CJ1A 4IFEA 4M3FA 3NGIA 4DV3K 4R8HA 1R36A 1JKOC 2CQ7A 4YG2F 4V2GA 5CR4A 2K86A 3NVKA 4AF1A 1P4AA 2GTDA 4K42A 2P9UA 1WWXA 1TW3A 3TP3A 3THXB 2JSCA 2X6YA 1NK6A 4WQ5C 6PAXA 3K10A 3IKMA 4BC5A 3OYBA 1WFXA 3K70D 1IJWC 1FZPB 3DLEA 2E6MA 2UUZA 3AG3H 4BH9A 1QSYA 2O8EA 2E35A 2FSJA 3EYZA 1ASVA 2M7BA 4Y52J 1M1KO 4KT6A 2O5RA 5F27A 1PUFB 2LY2A 4KTQA 5HLIA 2G7HA 1BO5O 1NJXA 5LL6Z 5DM6F 4G12A 5LEKA 4HX4A 3AVMA 1Z7UA 3JR9A 1Z6TA 1T3VA 5ICGA 3HRSA 1E3HA 1NM1A 1RBTA 2R7ZJ 2P51A 2QBYA 3BF1A 1K78B 4H5NA 3VF4A 4RM2A 4HPQA 2HKOA 3J7AO 5C3EJ 1KONA 1DGKN 1RT3A 3JRGA 4KHNA 2VG7A 1LAVA 2XAFA 2GIZA 1I5ZA 1XGSA 2X6SA 4UUVA 1R22A 2XKPA 4J19A 3GUDA 1JLEA 2WFBA 3FZHA 3HM8A 5H1SQ 3E5UA 4BBSJ 1IRZA 1RILA 2CGJA 4CHNA 4CYCA 3NF6A 3LP1A 3FMSA 5LY3A 4M3EA 3AKZA 3TQNA 2HZDA 3BR5A 4N0BA 2LMDA 3ZQFA 1YJNI 3ZSZA 1H8AC 4HQEA 3AVFA 2FF3B 1QZ5A 3H46O 2IGOA 2YCHA 3EZ5A 3R9PA 1TV6A 5FFZA 2L02A 3O9QA 4B9NA 4FJHA 1T39A 1VQ4N 2ZXJA 4IHXA 2YR2A 3WTVC 4CHQA 5F0XA 1F1ZA 3DEUA 1DP3A 1T6DA 4CZCA 1BR2A 3D45A 2VQFK 3PUFA 2XAUA 1LFUP 2R7DA 3WHBA 4IHYA 3QP6A 3MAQA 4CDGA 1WJEA 1X58A 3LM9A 3NF7A 2MLKA 1WUAA 1DPUA 2ETHA 3KYCB 3U9DA 4A3IJ 3CJBA 4Z4FA 3WGIA 1ZARA 2LREA 4AYBA 1XUPO 3WUHA 4H4KC 2A05A 3FBIB 4AD9A 4BE2A 4JK7A 4LH4A 4PHTX 4KISA 1MZBA 5E79C 5J3LA 1Y56A 3L2RA 3OS0A 1RTHA 2MC4A 2YSRA 4IZZA 4E3SA 2IBDA 4LB5A 1HKTA 1YT3A 2HBJA 3G10A 4XH4A 3SPZA 4I98B 4BDPA 1TTYA 3HZJA 5DDGA 2YS9A 4CGJA 3ZN0A 3F23A 1WSHA 1NG6A 3OR2C 3O4WA 4CZKA 4DTNA 2O61A 5GTHC 2X1CA 1Q9XA 1R71A 1BM9A 3NMUA 3OY9A 3VEOA 2X51A 4RAZA 3IRQA 1CQTA 2DA6A 1WQ2A 4B09A 1C0TA 1RTDA 4FM2A 2D0CA 3JXUA 3E6CC 4M3RA 3T7ZA 2W25A 4IHSA 1O1WA 4DUYK 4L9JA 2OJED 4CZZA 1REPC 4YDUA 4CF0A 3SI6A 2HHQA 3DF8A 1XSDA 4LLGF 4Y0WA 3SJHA 3N97A 3VQ5A 5LHIA 5FLXO 1HBXG 1LAWA 5FRMA 1XCBA 2P9KB 3J7AP 2O8DB 1NGIA 1GLNA 4DIQA 2E19A 2VJ5A 3A0IX 3KP5A 1YRNA 2HSTA 2O7OA 4CHOA 2Q8KA 1XNRK 4B3RK 5GTIC 1U04A 3OYNA 4B47A 3SZPA 1CXUA 3ZCMA 3CMMA 5AQVA 5HVQC 2EX3A 4B1XB 4ZTJA 2QWOA 3Q9SA 5F6FA 2V52B 4IBNA 1A36A 3KWIA 3QNNA 5CPRB 3M3YJ 4N5SA 1S1VA 4H8KA 1X9SA 4I7FA 2YU9J 1Y0NA 2DA3A 1KCFA 2XIGA 3CD6N 1XWLA 1O57A 4HWIA 3EN9A 4YRVA 1ZLKA 3K69A 4IOCL 4UXNA 2IAIA 4CXFA 4NC7A 4IX7A 3M8QA 2H8WA 4EIAA 3WXIA 1BI3A 2IVNA 2XB5A 5DK5A 4BGBA 3KZZA 4LK1F 2MH2A 1D4XA 3CLOA 3GTKJ 4CI6A 2ZM6K 2W40A 3TSPA 2VJJA 5JHFA 3L09A 1YG2A 1Z7LA 4XORA 1Z6RA 2XPUA 3JRHA 4ESJA 3DM2A 3MX5A 4DTMA 1S5JA 4A12A 5HRNA 3F8MA 3GBTA 4FZXC 3LDOA 4N56A 3L2VA 2GOXB 3L2CA 2BGGA 2E2OA 1ZK8A 2JGUA 4OPAA 2XF5A 1IN5A 2PBIA 3P5JA 4WFNL 5GP9A 4KREA 5JMVA 4EJOA 5AQWA 3KZIC 4WXDA 3IUCA 4O0JA 3D5LA 3H5RA 1OYWA 2ICWG 5LGNA 4HDVA 3OYGA 4CZJA 1GVDA 1BOBA 2XGCA 1DEJA 3F0CA 2IVOA 3F8BA 2QQAA 1SFOJ 2V1UA 1HC8A 3TSQA 2ELKA 4PCQA 2KJCA 1XHXA 4I02A 4FWOA 4EJVA 3CJRB 3CF2A 3JSMA 1VNDA 4EM1A 2ZFUA 1X1PA 1YIJI 5EZHA 4UVAA 1UHSA 4UY8I 4UUSA 1A35A 3CERA 1R1TA 3L3UA 1RDBA 2DTUA 2ISZA 4EP5A 5H2FC 5JVGL 3GCMA 1JHFA 1T7PA 1MWMA 2ZD1A 2EV0A 2IOCA 1HYSA 4Z6YA 5L3FA 3PO2J 3L2UA 3VQCA 1B8IA 3KEQA 1MH3A 3MKWB 1BR4A 2R7SA 1YW9A 3V9ZA 4C30A 1Z21A 1U6ZA 2QSGX 3DOKA 2STWA 3P9KA 3QYFA 3K1MA 1BI4A 4IFVA 4BHCA 4Y1CA 4CEBA 5GIOA 5F08A 5AQTA 3T5XA 1NGFA 1YF5L 3NH2A 4CGZA 4L5IA 1WJ5A 4A2AA 4ITVA 3FM5A 3TEDA 4RGSA 3AAFA 1G3WA 4M71A 2ZXHA 1SAUA 3BTIA 3DFGA 4GY2B 1MMDA 1XC9A 1TKDA 2L54A 3TW6A 2Y0MA 2RREA 3QYBA 2H3GX 2L7ZA 4WQ4A 5CVVA 2OZ6A 3CD6I 3TTDA 1I50J 1D1CA 1I6XA 2HHWA 2EV5A 1X3MA 3L4IA 4A3CJ 4IHTA 3A4CA 2A6TA 2EPFA 3OYEA 2IAJA 4DTPA 3I54A 2E2NA 3BTLA 2X78A 2JA6J 4A3EJ 1GOAA 3O1WA 2F9TA 2ZJQL 2LH9A 2A1RA 2NRTA 1LJ9A 5B3SH 5BPDA 3PO5A 1Y39A 1YHQN 2W4SA 5ICCA 4KA4A 1ZH5A 1NG9A 1QRYA 2VT2A 4DFKA 3EKUA 4I09A 3OS1A 3SCXA 2A1SA 2R7VA 5HROA 1QSSA 1TWGJ 3KWGA 2K9NA 1RBSA 4O5FA 1R5HA 3BJAA 2HEOA 3VETA 2XAHA 4N9HA 2EWSA 5H6RA 3AO1A 4E7LA 1O3RA 3WG9A 4K25A 3BP8A 3LQRA 4CZIA 4EQQA 3IKTA 1IKYA 1AU7A 3ONQA 5D8KB 2WADA 3KYLA 1TGOA 2OA8A 1ON2A 2OA4A 1W9HA 3VWBA 2HOAA 1RBUA 3ECHA 4YOWA 4J2EA 2O8EB 1IN4A 2YHYA 3RSEA 2XV4S 4JOMA 4A0YA 5KQ8A 4J01A 4HQMA 2KQRA 2P6TA 2GWRA 4YOXA 4RB2C 4IRGA 2M45A 3Q0UA 3HOSA 2AHQA 4IPAA 3HPOA 4MLOA 1MNMC 1NHAA 3WODF 4BDZA 1IV6A 3CQYA 4DQRA 1IUFA 1BIUA 3G6EN 1D8KA 4C8MA 3L1PA 3HG9A 4QPQA 2FOKA 1R6RA 2ZKZA 4FE7A 2CFXA 4FPBA 3K4JA 4NBQA 1XMOK 3FHZA 1KVCA 4BJ6C 1FMVA 1QHGA 2Y0SN 3K1NA 4UV9A 4XLAA 2FNPA 2YX4A 3CIPA 1OJLA 2EHGA 3I33A 3RKYA 4FETA 5LHHA 4NB4A 3AL0B 1XTAA 2HW3A 1E0EA 4PJNA 1BCOA 2PG4A 3K1PA 1WSFA 3LPUA 2LG4A 2DA2A 2AA4A 3OL4A 4FQGA 1H9GA 2AXLA 4K8ZA 3BR2A 3OA9A 1VQ7N 2V7FA 5J4VA 2UXBK 2KZZA 2OCCH 2UWMA 4JAXA 5E26A 3BEXA 3QBXA 4W1UA 3I3LA 3T1BA 1KQSM 3GX4X 4ZDPA 5F1XA 4DU1A 2IS1A 1L3TA 1N34K 1ATNA 1OKJA 2R92J 4DV2K 5KI6A 3ZCOA 4ZYDA 3ZX2A 3IDHA 4MQ3A 4AIJA 1QHTA 2HNYA 1C0FA 2V7YA 3B6OA 4W5OA 3SZTA 3S3MA 1FKPA 4A5NA 5FKLA 1L3SA 2LVSA 4PJJA 3C2BA 5EDNA 3CLQA 5IT9Z 1MNDA 3AVBA 3WHCA 2IIRA 4DYCA 2ZB9A 3CCEI 2GAUA 2R5ZA 4XKVA 1U8BA 4B3OA 2VE9A 4CEQA 3FXQA 1YJNN 4NQWB 2OV7A 1UHWA 4P9UA 2XB0X 3C2GA 3QIPA 4LLNA 4CECA 2PN6A 2F4OB 5DEQA 4ZH4F 5DM7F 1K6YA 2FSNA 3NWTA 2FXUA 4JKDA 3DLBA 3TWHA 4E7HA 1JCGA 4JRPA 3A01B 5EEAA 3CJQB 4B9VA 3ZXSA 3GTQJ 3ZT2A 3CUQA 1JXSA 2L0KA 3VQDA 3LSPA 3E6DA 1UFMA 1B9MA 4UVBA 2W84A 5E3LA 2R5YA 3RZOJ 1ULYA 2BEOA 3BR3A 4BRPA 5AFUA 2MYSA 3AARA 4YDUC 2X1DA 3H1VX 1RKWA 4C2TA 1B9NA 1S3XA 4ISEA 3TR8A 1QPMA 2UXDK 2VBXA 2X6NA 2D2WA 2K9QA 2FBYA 1IBLK 2IGKA 5FPMA 2VBZA 3I9V2 1IDZA 4DYQA 3AAPA 1AKHA 4CCLA 3CF5F 5AQQA 2A07F 1Q9YA 3LSHA 4C9YA 2JMWA 3RPUA 3WGGA 1ITGA 4JI6K 3E0JB 2Y48A 5TISC 5CE3A 4KI6A 1Q1VA 3LA3A 3O3FA 2HVIA 1LDKB 3C3WA 3HXLA 3OOUA 3VOVA 5FD6A 2DPNA 3KK1A 4ZDOA 4JKCA 2XY6A 2R7UA 3OJUA 1DDNA 3A0BC 2VLAA 4HBLA 1H9TA 1NGBA 3K5NA 4BACA 4FLUA 1DLOA 4PSWA 3JRFA 1VI0A 3IH3A 2QWPA 3V1QA 3TAQA 1UELB 3E9OA 4CESA 3L6QA 4OMZA 1NGJA 2V1XA 3FBNB 4CCMA 3EL2A 1T8EA 2EZIA 3OOPA 1XMQK 2O8FB 2D5VA 1HKGA 4DR2K 3R1XA 4ZTFA 2BUPA 5LMNK 3CCJN 1VRUA 4IEIA 4EGYA 1Z91A 4KB0A 3C2HA 2IP2A 1RT6A 2K5CA 1YO5C 5FPDA 5GAHP 2KRFA 2IT0A 3U3GA 3M8JA 3CQ8A 3TDZC 2E1ZA 1BQMA 1TKTA 4EJUA 4JI8K 5IWAK 4QPOA 1H88C 5GAEJ 5EYRA 2XRIA 3A02A 1EO1A 2HHVA 4EZ6A 2X6XA 3WTSC 5HOOA 3NGYA 3E5XA 2KKOA 4MEYF 3I55I 2KW4A 3H0GJ 4JI3K 2G7UA 3BPXA 4JX5A 2VODA 4XOTA 3ISPA 1SS6A 3VEZA 4OMYA 3L9FA 5EEGA 4O6JA 4EP4A 1ORKA 3RMCA 1JUSA 4B3SK 3OIPA 3GXOA 2D0PA 4FOEA 2OQGA 1W0HA 4H5TA 2YKNA 4CJ4A 4CCNA 1A5XA 4Q48A 2QXLA 3G0ZA 3W3DA 4H4MA 1IRXA 1X3WB 2HVHA 4OLAA 5L3EA 3QIOA 1G8XA 2LKPA 3J8AA 3HOXJ 4BC3A 4H0PA 4HUGA 1CZ9A 3KP7A 1SMTA 3TABA 1OYYA 1OCCH 3CJAA 2CGKA 4ZJZA 1D5YA 3HHHA 1W5TA 3WEEB 4AH9A 1Y1VJ 2CW0F 1RESA 4PKHA 5EX5A 1S1UA 2F5VA 4IOCF 5AZJB 3EDPA 1IV0A 1VQLI 1X1AA 2GXBA 2ECBA 2P5LC 3OJSA 4E0DA 4Y13A 2R7XA 1MDUB 2NRVA 4CK3A 1R49A 3CC4I 4W5QA 4G1QA 1XDSA 2A40A 3OW2M 3G2BA 4M6VA 4CHUA 4KYWA 2M87A 3M6GA 3HT3A 1GUUA 1LPQA 3QPSA 1IG8A 2Q3SA 4U0WA 1Y0UA 2XY8A 2CU7A 4A2UA 3SEQA 3HB9A 3NF8A 1UHMA 1BIBA 1R4MB 2BZTA 3W6JB 2Q0OA 5IYCJ 4WWCA 3ML6A 4H03B 2VWJA 2HHUA 4U7DA 3GFIA 2L9NA 4L9VA 2EZHA 1TKXA 1KLMA 2XO7A 1NJWA 2EZLA 4WCEL 4JYAK 4IHWA 3SAGA 1JTYA 2FF4A 3HGYA 1TBXA 3DLRA 4BRQA 1WJBA 1XC5A 2A5WA 2BYVE 4HNTA 3CCRI 1HNVA 5BS6A 1GT0C 2YHBA 3VQ4A 5C0YA 2QGUA 1MW7A 4A3GJ 4J2DA 2K40A 4MO5A 4M3ZA 3H36A 2QQBA 3EUKL 1U0JA 4HF0A 1OISA 4XN3A 1D5VA 1UWBA 4OKJA 4OPHA 3CXCM 4XONA 2IS3A 3VQ7A 1KU7A 3RMAA 5LBQA 3E6MA 4PGHA 1IKXA 2ZWHA 3FXJA 2DOEA 2E1MB 3LPTA 4H0YB 4NCAA 3F3XA 5TKWA 2Q0UA 5HLHA 2NRRA 1VQ5N 1HLVA 1O3SA 3NH0A 2RE2A 1VSLA 4P96A 1JL2A 2VKDA 3P39A 3HJFA 4U7BA 1V3FA 3FGUA 1D9FA 5EJCA 3R6SA 3KYDB 1TP4A 3GBGA 3O2PE 3QU3A 3GYHX 1VQ7I 2ZJPF 2ASPA 3KJVA 1TK0A 1YFHA 4GGGA 2QI2A 3RI4A 1YUWA 2PLYA 4ID5A 3LP0A 4FSVA 2KZVA 4M7YA 5L3BA 1N5YA 2V6CA 2DQLA 5M5WJ 3GTPJ 1ZBIA 1YVUA 4H0VB 2NS8A 2XPWA 4G94A 5JICA 1C1BA 1BA0A 1KRPA 4KMFA 1KFDA 2RHKA 2AQFA 1PP7U 1HXDA 1VZ0A 4IEEA 3CMEN 4KHSA 1M1EB 3REOA 3O9UA 1OCZH 2LR8A 3H9JA 3QEVA 4JK9A 4Z4GA 3EY1A 1ETQA 3VB2A 3D6RA 3IMXA 2ZJQF 1QS4A 2DMQA 4II2A 3WU1B 2E7WA 1P92A 5GADP 3OYHA 1XGOA 3BJOA 5F1JA 1BL3A 1SD7A 3ABUA 1ETOA 1G59A 3VQQA 4PQUA 2Z16A 4JI0K 3U21A 4B48A 3MDQA 2DOFA 1IC8A 4GW6A 4HV5A 2RV8A 1FK9A 4IDHA 5C24A 2MBFA 1NK9A 3L7WA 4CJRA 4U67L 4RB0A 5A2QK 4G6TB 5F0HA 1K78A 5DM6L 2A3SA 2MLGA 2EV6A 5L3CA 3BT9A 3MD2A 4BE1A 1LW0A 3L4QA 4UB6C 2CO5A 4IL6C 2RC4A 4PFOA 5TGTA 3ABMH 2OQRA 5D8LB 3LSRA 1LW2A 5H20A 1XCVA 2PI0A 4NHJA 4DQQA 3DLKA 4D7NA 3SPYA 2WOMA 3FZFA 1Z3XA 1MH4A 2ATQA 2DXIA 1U48A 1FOKA 3P38A 3IS9A 3DBLB 3BR1A 3PQKA 4KB1A 2BOLA 2RN7A 3S2DJ 3FFKB 3NDKA 3W2WA 3RRGA 3HRTA 2FX0A 2HBKA 1SUQA 2JZYA 5LFAA 2R7WA 2WV0A 3AO2A 3A0HC 2D1HA 1TYQB 4YORA 1HYZA 3MQ0A 4LLLA 2RDPA 5LJWA 3U3YA 1I94K 2EIJH 4K0KK 4I9QA 3OVNA 1ZG3A 2P5VA 2HVRA 3HTSB 1YAGA 4CGFA 3O8MA 4XH5A 3F6VA 5FGMA 3RVCA 1J2XA 4M3GA 3LA2A 2D0BA 3QEXA 2DU9A 3SDGA 1ITYA 2F5CA 1RDDA 3ENBA 2HYGD 2XUBA 3A5LC 4W5RA 3ZSXA 1IV8A 3ZMDA 1WJCA 2CUFA 2DA1A 3QWLA 3RPUD 4ESFA 3CCJI 2UYTA 2HBLA 4BROA 3K2AA 2DT5A 2R7RA 4JKBA 2YNFA 4W5TA 3KLGA 3V9XA 3T8TA 2CS3A 1VQ9I 4ISFA 2QSHX 3RQIA 5JLXA 2E4LA 3CJ7A 1JTXA 3FFIA 4Z2YA 2EBIA 2WA0A 3WTTC 2DY4A 4F2SA 4JLHA 5LD2C 4BR2A 1J5OA 3RKXA 2DA5A 5EGOB 4HX8A 2NRZA 3DRRA 1EWQA 4MNUA 3PQJA 1J75A 1FKOA 2KZMA 4IOAL 1UOCA 4KH4A 3ZEUB 4NLCA 3JAMZ 3DOLA 1HKQA 2GELA 4OX9K 5E1ZB 2ESHA 1JLAA 2OPSA 4RM3A 3PSFA 1DTQA 1OKRA 3KLNA 4C23A 2Y2ZA 1AKHB 3F8CA 1GLJO 1S6PA 4O5BA 1BI2A 5C25A 2Z1DA 1PDNC 3GZ6A 2MGQA 1I27A 1IDYA 4HV6A 3AVAA 3W6VA 1JKRC 4N4OB 2H6CA 1WZ2A 2O8DA 3Q7BA 3QAHA 4AHRA 1SANA 2EFQA 1HPMA 3RQ4A 5AQRA 1SKWA 2VQGA 3S8PA 3TTFA 4NC8A 4CEOA 1U3EM 2DQRA 4CGGA 3RMBA 1X1BA 1D1BA 5LJVA 2DLLA 4HUFA 4TSXA 3PIOF 2WB1A 2Y69H 1G6NA 2EZKA 4UV8A 2TCTA 3DMJA 4E89A 1G4DA 3HSFA 2K9SA 5C42A 3P1GA 4IOAF 2R0QC 5KTQA 2FSWA 2P7CB 4BDYA 2JWKA 3U8XA 5GPAA 1S3JA 1N75A 4DTXA 1L3LA 4FE4A 4QTRA 4AHUA 4KO0A 4CGIA 3UKUB 4V2FA 2W6KA 2AQEA 2QZ8A 3IV5A 3ZSYA 3TAPA 3TSUA 1O4XA 2K4JA 2ADUA 5KRTA 3Q0VA 3V7CA 4BQNA 1EXQA 3WT0A 4FK0A 4C2MJ 4Y17A 4WQ5A 2D0OA 4NXNK 1TZLA 2O8XA 1A31A 5AR0A 4DF4A 5EZGA 3WTWC 2LKXA 2XRNA 1IF1A 1V5FA 1G15A 5E1WA 3DP7A 4B1WB 3PIOL 1HNXK 1GLBG 1U4BA 1UA0A 3SMSA 2FBVA 3TAMA 3W0LA 4X0GA 4JS4A 2O8KA 3MAJA 3A1YA 4E1NA 4DSEA 1NJZA 4YOUA 1YHQI 1K4SA 4BY1J 3LAKA 3VEXA 4IO9L 3SMPA 3B73A 2DA7A 3VYUB 4B9LA 1T56A 1TL3A 2VJIA 2W48A 3V8JA 4WK8F 2EFPA 3P31A 2MD5A 4FLYA 3SV4A 2BDPA 2R7TA 2UXXA 3AA4A 1P8ZA 3G1MA 3M7GA 4XLEA 4H5RA 3CYMA 1GOCA 4V19S 1WSIA 1TVRA 4DV7K 4OKKA 4M3BA 2EFNA 4B3AA 1JCFA 4CIFA 2PX9A 1YITI 1QQMA 1SD4A 1R5GA 3E6BA 3ROUA 4XBFA 1ZGAA 2F7TA 3E9LA 4ZDLA 5E41A 1IW7F 1XN7A 5AQNA 3LZJA 1NU0A 1GDTA 4XQFA 5F04A 2DN0A 3TO7A 1G3SA 4WF2A 4XL9A 4BEHA 4KUMA 5B1BH 3OYMA 2DPDA 3NF9A 2E2JJ 3VF2A 5CYQA 5ILUA 1MBGA 3OYKA 1B8IB 4FLVA 1NKEA 3PY8A 3D2FB 3DXMB 4EATA 4B08A 4RGUA 2KFZA 4FWLA 1LNWA 3M8PA 4PJLA 4GFBA 1CXQA 2LFBA 4A93J 4MDBA 3LZIA 2HQAA 3PX6A 3DI6A 1FPQA 5ILVA 1O3TA 3J7YJ 3U1DA 2RGVA 3V9WA 3U4LA 1LFBA 2J5OA 1ZRDA 1PVEA 1KVAA 3BZ6A 5K5RA 3A2FA 4QAGA 1HNWK 4GDFA 1VQ4I 4DTJA 4XMYA 3VTHA 5GAGJ 4A5AA 3VGKA 3OTOK 1QZEA 3B6AA 4RA2A 1T6SA 2Z2SB 2NVUB 3CC2I 1B92A 3JCUC 4B1VA 2L7KA 2FJ1A 3ENOA 4OKEA 2IA2A 1RRJA 1IRFA 3VFZA 5K5QA 3LDNA 4IFYA 4HCBA 3ZN1A 1FP2A 1GLCG 3OIOA 1ZAOA 2FMLA 1BBYA 3GFLA 3HIFA 3HKZN 4CA0A 2C6YA 1NBWA 1JJ6C 1QZ6A 3KZBA 4NCGA 1FBSA 3RSNA 1LQ1A 4EJTA 1NMDA 1IN7A 2L01A 4YFXF 3TBIA 2NNWA 3VF6A 3CCUI 1I6HJ 3KHYA 3BTCA 4FLTA 2HR3A 3C7NB 5EG0A 4M74A 1OH5A 3SQNA 1L3UA 1Y8QB 5MLCQ 4B9UA 1BCMA 3HO1A 2P9IA 3LDSA 3RYPA 1T98A 1K61A 3AY9A 5D3GA 2H27A 4RDUA 1UMQA 2KKZA 3CTAA 1ETKA 3DKXA 1BUPA 1JLGA 3DLAA 3EQLF 4BJTA 3JRAA 4FPAA 1L5UA 1JJ2M 4LF4K 4Z4IA 2WAQA 4BWMA 1OH6A 1FIAA 2DMTA 3JSPA 5E17F 4E7KA 1Z77A 2YHXA 3QEPA 1ON1A 4WF9L 1A6IA 2FEZA 4OWRB 4Y33A 4MTDA 2E2IJ 2L5QA 1NK4A 1VF9A 2XC7A 2XGDA 2CUJA 1D0ZA 2A61A 5HLFA 1ATRA 5M3MJ 1YX5A 1VK0A 1NK8A 3COAC 4JI1K 2IS2A 3ZQIA 3FMRA 1ESVA 2E20A 3BY6A 2E2HJ 1B72A 1LWFA 3VGMA 1L3VA 3VODA 2Y75A 3VGLA 3MN2A 4DG1A 2VONA 3BY5A 1U6GA 3FE1A 3MKZA 5M1NA 1B59A 1O7LA 2Y31A 3LFKA 2ZJRF 3AGKA 4CBXA 3O6WA 3V1OA 3HJEA 1YIOA 4C3JJ 1WSUA 1K83J 2A69F 4UB8C 1MKMA 4F91B 2HHHK 1ZG1A 1S9HA 2ME0A 4MQ9F 2WONA 3J80O 5CKTA 1OCRH 4FJKA 2V1NA 3I8DA 3V8LA 2ESNA 4CZMA 1VQMN 3JTGA 1JUMA 4BGAA 4KBOA 4ZHRA 3V8KA 2AXTC 3CMEI 5JLFA 1CZAN 1R58A 4PJMA 3O9SA 1G2HA 5FKOA 1VSHA 4A59A 1VQ6I 2X0LA 3CCMN 2IW5A 1Q86O 2LF8A 2BHZA 2XGXA 3ABTA 2XDVA 2ZXIA 4S0HB 4JI4K 3UE5A 3VQ9A 4CH7A 2A68F 2LC2A 2M5WA 4AILC 1NJYA 1S9EA 4O55A 2M8GX 3AVLA 5D5VB 2PMHA 5BR8K 3K4LA 1LEBA 1Y64A 4DWIA 3HP6A 1KYZA 3IG1A 2OZMA 1RDUA 4UUSB 1DQUA 2G8KA 1PUEE
chains in the Genus database with same CATH topology
4F4KA 1BCOA 2VWKA 3VQEA 1WSFA 3LPUA 4CGDA 4DS4A 1QTMA 4CFBA 1IO2A 3C95A 4K8ZA 1C0MA 1WN7A 2KZZA 4M3WA 1SL0A 4IDKA 4CJQA 3QETA 4FZYA 4M3XA 3UIQA 4DSFA 4DU1A 4DS5A 4NCBA 4CEFA 3MXJA 3RTVA 3AVIA 3KK2A 3PX0A 5KI6A 1NK0A 4MQ3A 3QLHA 1QHTA 2HNYA 3B6OA 4CERA 4CJ3A 4DTRA 4W5OA 3QEIA 3MXIA 3S3MA 1FKPA 1LV5A 1L3SA 4DSLA 4HUEA 1VSEA 1XHZA 4RW4A 1JXEA 3RRHA