2DFEA

Crystal structure of tk-rnase hii(1-200)-c
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
209
structure length
209
Chain Sequence
MKIAGIDEAGRGPVIGPMVIAAVVVDENSLPKLEELKVRDSKKLTPKRREKLFNEILGVLDDYVILELPPDVIGSREGTLNEFEVENFAKALNSLKVKPDVIYADAADVDEERFARELGERLNFEAEVVAKHKADDIFPVVSAASILAKVTRDRAVEKLKEEYGEIGSGYPSDPRTRAFLENYYREHGEFPPIVRKGWKTTQDMINKST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease HII
publication title Conformational contagion in a protein: Structural properties of a chameleon sequence
pubmed doi rcsb
source organism Thermococcus kodakarensis
total genus 69
structure length 209
sequence length 209
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 2dfeA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2dfeA01
4KHQA 3O3GA 4KB1A 3K5MA 2G8KA 3L2WA 4JRPA 1X9SA 3PX4A 3CFOA 3ISNC 3KLIA 4DTSA 4I7FA 3RR8A 2VG7A 1HJRA 2YKNA 3NDKA 4CEAA 1D9DA 3K5LA 2R7YA 2KTQA 2X6SA 3QETA 2IOCA 1Z26A 4FJGA 4N41A 4FLZA 3LAMA 2Z1HA 4CFBA 1IKWA 1LWCA 3HSTB 1RDCA 1C0TA 1ZBFA 1LWEA 3AO3A 3ZSVA 4KHNA 3AO1A 4CJ3A 4BDZA 2RKIA 2QKBA 3HO1A 2X6NA 4E7HA 3LALA 1TK0A 3OYCA 4K8ZA 3QIOA 1QSSA 4O55A 3TAQA 3HPHA 1ASWA 4FZZA 2FBYA 3K2PA 4CEDA 3WNFA 4DQIA 4KTQA 1L5UA 1U48A 3DI6A 2KZMA 4CK2A 1F21A 4N56A 4N47A 1KLNA 5KRTA 3NH1A 1WSJA 3UIQA 3AVBA 5FDLA 1JL1A 4C8NA 4CECA 4IKFA 5FROA 1HYZA 1GOBA 2Z1IA 1U4BA 3LWMA 3TARA 5DMRA 3VQ8A 2XRIA 4GW6A 1GOAA 4O4GA 4QAGA 3KTQA 4FK0A 2IC3A 3CYMA 1WSEA 1S9GA 2YHAA 3RTVA 3S9HA 4H4MA 3OYJA 3AVKA 4EZ6A 3L3VA 1XI1A 3ZT4A 4F3TA 4ID5A 4M3RA 4CEFA 3LZIA 1TL1A 2BE2A 2G8WA 2FBTA 4CHOA 5HRSA 4C8LA 3LWLA 2DY4A 4RW9A 3VA0A 3AVMA 3IG1A 4I9LA 3VQ6A 3OJUA 3WNEA 4M3ZA 1HNIA 1VSJA 2OPPA 4Z4HA 2VWKA 3C95A 3NF8A 3V9WA 1SL1A 4AHTA 4CIFA 3SZ2A 1SL2A 2OPRA 5FRMA 3AVAA 4OPJA 3ZT3A 5E41A 1ZBIA 3HT3A 4OGCA 3VA3A 3TABA 1NKCA 1DTQA 2G8HA 3KK2A 2E6MA 3TAFA 1C1BA 1LAVA 1NK5A 2I5JA 4CF0A 4CJQA 1VRTA 4LH5A 2XY7A 1QTMA 1CLQA 1ZBUA 1Q9XA 4FJIA 3DM2A 4M41A 1W9HA 2FBXA 3LAKA 4CFDA 4CGDA 1D8YA 2HVIA 1R0AA 1VSKA 4F2SA 1EX4A 3NH0A 3SYZA 5JS2A 5J2PA 2Y1JA 3PO4A 4CEZA 1RBSA 2GBZA 1WSIA 1RBVA 3EY1A 3BGRA 2KFZA 1JL2A 3HP9A 1XHZA 1GOCA 3K57A 4NCBA 3ASMA 4OGEA 4KI4A 2VG6A 4DFJA 4FJLA 3CM6A 2BGGA 1L3UA 3HVTA 2A1RA 1FKOA 4IG0A 1JLAA 1NKEA 1YVUA 1KVAA 5C24A 1CZBA 3OYEA 4W5NA 1RBUA 1W0HA 4XIUA 4CF9A 3F73A 4CEEA 5J2QA 4NCGA 3OYFA 3BDPA 1N6QA 2WOMA 1J54A 1RNHA 1HYVA 3DRSA 3DLKA 1HRHA 3M8PA 3AA4A 3V81A 1JLCA 1NK0A 3QESA 4K8XA 1RDDA 1HQEA 2VWJA 1UOCA 4IFYA 5KRSA 3OYMA 1DTTA 4FCYA 3HVRA 4ICLA 1WLJA 1UA1A 2KW4A 4YFUA 1LV5A 2DFEA 5HP1A 4ZTJA 5FRNA 1TKXA 1BHLA 3HPGA 3K5OA 3ZT1A 2HHTA 1B9DA 2HVHA 2B4JA 5SZTA 3OJSA 1KCFA 3T19A 2W42A 4L8RB 1BIZA 3U3YA 4E1NA 3O3FA 2VG5A 4RG8A 3TAGA 3O3HA 4KPYA 3AVFA 2KFNA 3RRHA 4J2EA 3VQPA 3KLEA 1VSLA 2D0CA 4CHNA 3NHGA 1HQUA 3NBPA 4IDKA 1LW2A 4Z4CA 3OYDA 1SV5A 3DRRA 3SUQA 3ZSRA 4E7JA 3ZCMA 3SQ4A 3TI0A 3SUPA 3PO5A 2OZSA 1EXQA 3LPUA 3F9KA 1IKVA 4AHUA 3AVHA 3KLGA 4DTRA 3CFPA 1G15A 3QEPA 3HK2A 1QHTA 3ITHA 4CHQA 3RMAA 3KJVA 4J2AA 1O1WA 4M3YA 3SPZA 1BISA 3MXIA 4JRQA 1JLEA 4BDPA 4DG1A 3CM5A 4FJNA 4B9NA 2YHBA 3KLFA 4AHRA 1YTUA 4CGGA 4BWJA 2YKMA 3HPOA 4CJTA 1BQMA 1XC9A 2PZSA 4CJPA 2P5GA 1YTAA 3EYZA 1IKYA 1BL3A 4CJ4A 3SV3A 4E7KA 1S6PA 2ETJA 3P83D 4CCHA 4M42A 3HXMA 4FJKA 2HB5A 4OJRA 4KREA 1J5OA 4H8KA 1VSEA 4IG3A 4RW8A 4DLEA 4CEQA 2RF2A 2HNYA 4KO0A 3K58A 3K59A 4OLAA 1CXQA 3I8DA 1WSFA 2A1SA 2PYJA 4FJ5A 3DRPA 3C6TA 5C25A 3TAEA 4HTUA 4DSEA 2HHWA 3ULDA 1BIUA 4F3OA 3MXMA 3OY9A 1FXXA 3VQ4A 1JLBA 3L2UA 1U47A 4AH9A 1JXEA 3OYAA 3QINA 5KI6A 4DFKA 4Z4GA 3VQQA 2Z1GA 3KLHA 3VQ5A 3AVNA 5HRNA 3P5JA 3KK1A 4J2BA 4NYFA 4CJVA 4BWMA 2XY5A 3MXJA 4QCLA 1CXUA 3TAMA 2HHQA 3L2RA 1KLMA 3OVNA 2HHSA 4FM0A 4Z4EA 1VSDA 1RT5A 4B8AB 3TR8A 3ZSXA 4HUGA 4DTXA 1A5XA 4R5PA 2DFFA 2BANA 3VQBA 3OYHA 3P1GA 3V6DA 2PYLA 1WN7A 2ATQA 4DTMA 4KTZA 2X74A 3ZSOA 2OYQA 3B6PA 4W5TA 1NK4A 5D3GA 4KKOA 3SJJA 2HNDA 1RT1A 4DMNA 4B9LA 4O5BA 2YNIA 4CFAA 3LZJA 1IG9A 4FJ9A 3NF6A 2QXFA 5T7BA 4BACA 1KFSA 2DFHA 4KAZA 1B9FA 1FK9A 4CJSA 4CJLA 4CGHA 1JXBA 1VSMA 1J53A 2Z1JA 1SKRA 2X78A 4B08A 4DTNA 2F8TA 1K6YA 1S1WA 4FK2A 2EX3A 1QSYA 4M45A 3T3FA 3MEGA 4F2RA 4NCAA 3CG7A 4YNQA 1EETA 4CFCA 2O4IA 3OYBA 3OYKA 2XO7A 3NFAA 4CESA 4E0DA 5C42A 3SI6A 1KTQA 2HHUA 1S1UA 1BCMA 3AVIA 4FW2A 4JS5A 3HP6A 5CZ2A 1NJYA 1HNVA 3HM9A 4FZXC 1RTIA 4KHYA 1TL3A 1XWLA 3LP1A 3ZSZA 1CZ9A 2NUBA 3NGYA 3NF9A 4M3TA 4FJ8A 2XY6A 4Q0BA 1RT6A 2GV9A 1BI4A 3LANA 4IFVA 4KB0A 3JYTA 3L2QA 4DQRA 3C94A 3VQDA 4FLTA 1KRPA 2ZD1A 4ELUA 2QK9A 3HYFA 3LP0A 3V4IA 1UA0A 4OKJA 1HMVA 3TWHA 1S1TA 1TV6A 4FM1A 3OS1A 5HLFA 1U49A 2IAJA 5J2NA 2D0AA 2YV0X 4CJWA 3RMDA 1TAUA 3LDSA 2AJQA 4HUEA 4E7IA 1JKHA 2OA8A 4PY5A 2E4LA 2ZE2A 4DSIA 4CJRA 4LH4A 4DQSA 1T05A 4OVLA 3SQ0A 1A5WA 2E6LA 1EP4A 4BE2A 1NKBA 1C0MA 4DQQA 4FJHA 1LW0A 1UAXA 4BE0A 3V1QA 3V9XA 1KVCA 3IAYA 1QSLA 1JLGA 3IS9A 3KD5E 4B8CA 4HHTA 3VQCA 3ZT2A 5KTQA 3OS2A 1ITGA 2RPIA 5DK5A 4W5OA 3OS0A 1HYSA 1IO2A 3MEDA 4CJFA 4DLGA 3TAPA 2ITGA 2KZZA 3CFRA 4Y1DA 1TVRA 3LP3A 4J2DA 4CF1A 4HVJA 4E3SA 5J2MA 4I2PA 4E7LA 3PX0A 4FLWA 3QNOA 1TKZA 4M3UA 1WAJA 4ID1A 5HRPA 4Z4FA 4RW7A 3B6OA 1X1PA 3QLHA 4DU3A 1SL0A 1KSPA 4C8OA 3KD1E 3DYAA 4N76A 1REVA 3G10A 4KTWA 4BE1A 1S1VA 3NCIA 1ZBLA 3AO2A 4FLYA 1S9EA 1X9MA 4E19A 4DU4A 3THVA 4DTPA 3NAEA 4FM2A 4KHUA 3MEEA 4Q5VA 3AA5X 1YT3A 4CJKA 1TK8A 4FYDA 3SV4A 1X9WA 1VSIA 4H4OA 3ZT0A 2HNZA 3QNNA 2LSNA 2Y1IA 1Q8IA 2OPQA 3OYLA 3OYGA 2OZMA 2HHXA 1RTJA 4KI6A 1RT3A 2EHGA 3AO4A 3VQAA 4AHCA 4CIGA 3S3MA 3ZSYA 5JS1A 1NOZA 4CHPA 3ZSWA 2B6AA 4B9MA 4B9VA 1TAQA 1BI4B 3NH2A 2IS3A 4FK4A 1VSFA 4WE1A 3DLBA 3NGIA 4FJMA 4Z4IA 4DTOA 3LP2A 3DMJA 4JS4A 4DF8A 4HCCA 1NK8A 3ALYA 3SPYA 5HRRA 4TSXA 4W5QA 2JLEA 1XHXA 4OKEA 3S3OA 4GVMA 2XHBA 1BQNA 1QE1A 1RT7A 3WNGA 4DTUA 1ZYQA 2B5JA 3IRXA 1IH7A 1TKDA 2FC0A 2GUIA 4CJEA 3H08A 4AHSA 4CIEA 4DF4A 1I39A 1NJXA 4KHSA 3V9UA 3AVJA 4MQ3A 4ZHRA 4C8MA 1LWFA 4CE9A 3C6UA 2O4GA 1RDAA 2FBVA 3DLGA 3L3UA 4JLHA 4CJUA 4N5SA 4UQGA 1WSHA 1UWBA 1Z25A 2YNHA 3DOKA 4CGFA 3AO5A 3D45A 3OYNA 4CERA 3SUNA 2HMIA 2P5OA 4C8KA 4DSLA 3DOLA 4G1QA 1U45A 3TANA 4RW4A 1MU2A 5J1EA 4OPKA 4BDYA 3U6FA 3L2VA 1RTHA 3I0RA 3SCXA 3LPTA 1L3VA 3OYIA 3AVCA 3RRGA 4PWDA 4E1MA 2YNFA 1NK9A 1QQCA 3M8SA 1RTDA 4KRFA 4CJ5A 3S3NA 4LSNA 4RW6A 3JSMA 1SKWA 4DSJA 3WNHA 3V9ZA 1LAWA 4CHZA 1T03A 3KK3A 4B3OA 1L3SA 5SWMA 3KKRA 2ZQBA 3AVLA 3VQEA 4DU1A 3RMCA 4LD0A 1C1AA 4PA1A 4O0JA 1BGXT 3M8QA 3AA2A 4Z0UA 3V1OA 1J9AA 3VQ7A 4FLVA 2D0BA 1VSHA 4Y1CA 3QEWA 1NJZA 1VRUA 5CY4A 1HPZA 4PUOA 1SKSA 2D5RA 4AILC 1T8EA 4O44A 3QO9A 1EKEA 1WSGA 4CF8A 4EP5A 1RCHA 3QEXA 4M3XA 4DS4A 4FVMA 4FXDA 4LSLA 3NF7A 3PY8A 1D9FA 4F4KA 1B92A 5HBMA 4FLUA 4E89A 4FJXA 1I3AA 2F96A 4M3WA 3M8RA 1RT4A 4FW1A 2QKKA 1Q9YA 3AVGA 1C0UA 4OKKA 4PQUA 4LY7A 3RMBA 1RBTA 4AHVA 4CF2A 3CQ8A 1ZBHA 5I42A 4B9UA 1NK7A 2PY5A 3AA3A 4CEBA 3PUFA 1FKPA 1S1XA 5EU7A 4FJJA 4B9TA 3U3GA 1RILA 3EZ5A 4FLXA 2RN2A 3D0PA 1ASVA 3QEIA 2P1JA 3QERA 5KGXA 1NK6A 4I9QA 4HCBA 3SQ2A 1JLFA 4FZYA 5K14A 1D5AA 1N5YA 1BCOA 4GMJB 1RBRA 2Q3SA 3DLHA 1WAFA 4I2QA 1RDBA 3FFIA 5KGWA 2G8FA 4O0IA 1WNSA 2IDOA 3SNNA 2WONA 4W5RA 4DQPA 4OLBA 2IGIA 5HROA 1TKTA 4MFBA 4DWIA 2F8SA 1TGOA 5CYQA 1SUQA 2HHVA 4ZTFA 2DTUA 4DTJA 5I3UA 1IKXA 3RWUA 1DLOA 1NJWA 4KV8A 3V1RA 3ZSQA 2YNGA 4DSKA 4ELTA 2G8VA 5CZ1A 4B9SA 3QIPA 1JLQA 2JGUA 3I0SA 4IBNA 3VN5A 3V9SA 4NYNA 3T1AA 4DSFA 1KVBA 1L3TA 1C1CA 4KHWA 4F8RA 3SUOA 3HL8A 4EZ9A 2G8IA 4CEOA 3O4NA 3NGZA 3E01A 4ELVA 3K5NA 3DLRA 4EP4A 4DS5A 4QOZB 1S5JA 3AV9A 2BDPA 1KFDA 2KQ2A 1TK5A 3DLEA 3KIOA 4CK3A 4DFMA 1T7PA 3KKSA 3PV8A 3HJFA 3SQ1A 4DFPA 2XY8A 1A5VA 3MAQA 4CGJA 5CYMA 3QEVA 4CHYA 3RR7A 1VK0A 3A2FA 3NE6A 3L8BA 2P51A 3PX6A 3G0ZA 3VQ9A 3MECA 2OPSA 4CGIA 1Y97A 2G8UA 4KFBA 1U04A 1RT2A 1C6VA 4CK1A 3O4QA 1QS4A 2HW3A 1ASUA 4HUFA 1NOYA 1S6QA 4FJ7A
chains in the Genus database with same CATH superfamily
1RZ4A 2F2EA 3UKGA 3ISNC 3RR8A 3CUOA 4D7MA 4H0PA 1GLJO 2L9VA 3WHBA 3H3UA 3ZR8X 3J7YJ 3V7SA 3KEOA 4KHNA 2BOLA 4CZGA 1SD7A 4YOYA 2LREA 3GFLA 4ZDPA 4C8NA 3VQ8A 4FK0A 2PBIA 3QPSA 2QSHX 1ZH5A 4F3TA 4IOXA 2FBTA 1TT5B 1W7AA 3VDXA 5IYDJ 4A2BA 3WNEA 1ZBSA 4DYRA 1REPC 3VA3A 4OAYA 1WJBA 4XRSG 4DV7K 3FZKA 3CMAN 4KDPA 1CLQA 1EF4A 4LFCK 2LOOA 2FNPA 4FASD 1HW5A 2QWOA 4BHPA 4DFJA 3F23A 4PGHA 4IEEA 2L7FP 2VLAA 1XGOA 4EHTA 1N6QA 3LM2A 2QYOA 4BRPA 3MD2A 3LA7A 1B9MA 3HOWJ 1RDDA 1X9JA 3TW7A 3HVRA 5AQIA 1YI2N 3QPLA 1I6HJ 1LV5A 4ZTJA 3HPGA 4DQ8A 2B4JA 2W42A 5FFXA 3N4PA 3TAGA 3U1DA 1VSLA 4BXFA 4BQQA 2DDAA 3HJEA 1K61A 2XF5A 2M4KA 1X3UA 2A6AA 5E84A 3QEPA 5DEQA 1VFCA 1Y1WJ 4JI6K 1FW6A 4BROA 2LBFB 1T95A 1ERDA 2M1BA 1N8RO 3LDOA 3HPOA 4CJ4A 2H3GX 3PQJA 2ETJA 2HB5A 4CVNE 3K70C 4WX9A 3LWFA 4FJ5A 4FX4A 3RZDJ 4DSEA 2HHWA 1MBJA 4C1NK 1JXEA 2HI3A 3ZMZA 2P9LB 4DFKA 4Z4GA 2PMZN 5J1UA 2YPRA 1IJWC 4BWMA 3AAQA 2XY5A 1Z67A 1KLMA 2XAGA 1MJ9A 1W0TA 2ATQA 4DTMA 2UXCK 3EQLF 5D3GA 2OYQA 4RAYA 1J0RA 5LGNA 2RC4A 1VSMA 3M7GA 2PMUA 2HTSA 3GTMJ 2EX3A 3I33A 2DMQA 3DTIA 4E0DA 3K4NA 3DKYA 3VODA 2K02A 3LP1A 3CERA 4NLBA 5CVRA 2D5VA 4H0OA 4MEYF 5A2QZ 3LANA 2E2IJ 3LAPA 1KRPA 2ZD1A 2MGQA 5TGTA 2C6YA 1HMVA 3PUBA 2VOPA 1JE8A 2X6WA 4DQSA 4O5VA 4FJHA 1XC5A 4JI8K 1ETVA 4DV1K 1P90A 3LSIA 1LOTB 2VXDA 5IT9Z 1ILYA 4PL8A 2YI1A 5LRSA 3F8FA 3M9AA 3JAMO 4DNCA 3QU3A 5J4YA 2CQ7A 3IWFA 2ZNYA 4UHTA 3LSJA 2CYYA 3HRMA 3GBTA 2E5ZA 2CH5A 5B5EC 3VQAA 5JS1A 4B9MA 5B8HA 3I3LA 1TAQA 4UV8A 2UXDK 3BR6A 3H9JA 3DMJA 4ILHA 1FIPA 1X2MA 3WGGA 2QSGX 1NMNA 3C0BA 1GLEG 3IH2A 4CE9A 4N5SA 3FM5A 4EFHA 5J1EA 3FE1A 3KEYA 1WBDA 5DM7F 1JKOC 4DU1A 2FLOA 1VF9A 2JA5J 2VJ5A 3V7CA 3K1NA 4AYBN 3CF5L 4AILC 4W1UA 5IY5H 4M3XA 2O8DA 2DA3A 3FZFA 4LSLA 3PY8A 2HYJA 1ATNA 3JSOA 3MFKA 1NGEA 3HTUA 4B9UA 4TV7A 2FBKA 4RB0A 4IO9F 3EZ5A 2CUFA 2NRXA 2DJIA 5KGWA 1HR0K 3DBLB 4I0BA 4JI5K 4PZJA 1IAWA 1W97L 1NBWA 5CYQA 3FM3A 3FKIJ 5ED4A 1HBXG 4KV8A 4G7OF 3FMRA 4HQEA 4NCBA 2ZFUA 1C1CA 3TSPA 4M6XA 3S93A 4CEOA 2KHOA 2H09A 1XDUA 2V51B 2MD5A 3MAQA 1OH5A 4FWPA 2PEXA 2FBIA 4FO0A 1MJAA 3C2HA 3G0ZA 1S6LA 4YOVA 3FIWA 3FXUA 3CMMA 5IPAA 1RT2A 4ENJA 1N25A 3X2QH 2L01A 5AQYA 1QGPA 5DCMB 3CC7N 2NOJB 3IRQA 1HJOA 3B8AX 4LG0A 1GLLO 1TNTA 1A6QA 4ESJA 2QQ9A 4XOTA 3CUQA 5FLXZ 3QIOA 3HRGA 1IG7A 4CEDA 1S72N 2XASA 4YOWA 1ZARA 5K5QA 2N8GA 3GZNB 4UVAA 2XRIA 4O4GA 4KN4X 4M3RA 4UVBA 5HRSA 4C8LA 2NYXA 3VQ6A 5B1AH 3GF2A 1KQ0A 1R1VA 2BEOA 1O7LA 4XIDA 3GFIA 4KIBA 4WQ5C 1RI7A 2E6MA 2AS5F 1C1BA 4CJQA 1LUJB 2Q2EB 1VRTA 3LL7A 4DR4K 1ZG3A 2WAQN 2NRZA 4G9ZA 4ZYDA 5J2PA 1RBSA 1B4AA 3Q5FA 1LDKB 1VQNI 4B3MK 3IP4B 1CZBA 4C2UA 4J00A 2BY3A 3V81A 3KP5A 4A0XA 4FOEA 4OU0A 3SBGA 4DV0K 3THXB 5DUKA 4NXMK 4XKBA 4ISEA 1T0FA 2QCOA 2M4GA 2F5DA 3VOVA 4J2EA 1WPKA 1JTYA 2VT3A 1HQUA 1BBYA 1LW2A 2YHYA 4D5CA 3LPUA 3BR2A 1NG7A 2E8AA 2VN2A 1BI3A 2GOXB 3FGUA 3BP8A 1YW9A 4NQWB 2UXNA 1ORKA 3NWTA 4CEQA 2RF2A 4ISGA 2PYJA 1NGJA 5IWAK 4BBRJ 4G6TB 1MDMB 4LF5K 1IXRC 5CJ9A 1U2VB 2EIJH 4LJZF 3DU5A 3KP2A 1DP7P 2CMPA 4G7HF 5DM6L 2HYFA 4W5TA 3MZ8A 4O5FA 2HNDA 5FKOA 3WEEA 2DFHA 4FHTA 3DEUA 2JT1A 2X78A 2JSCA 3SEQA 2F8TA 3K6GA 1JJ2M 5ILVA 3PIPL 1IBMK 3COAC 3Q0WA 4FW2A 1HNVA 5CVUA 3LDPA 1IXSB 3EKUA 5GTIC 3W3DA 2HVQA 2CV2A 4M6VA 2GV9A 1YLFA 3ZX0A 2DPDA 2NVQJ 4X65K 2DLLA 4BRLA 4PJMA 4HRIA 2YV0X 3PL8A 4HUEA 2ADUA 3LOCA 2MW8A 1JLGA 1LJ9A 2HOAA 3IC7A 5HRPA 1HLVA 4BUPA 1OH6A 1ETXA 2HU9A 3KD1E 1TYQA 4BRFA 3ABLH 1ZXOA 4DR5K 4FM2A 3SAHA 4FYDA 4LF8K 4WF9L 3ZGKA 2OPQA 1ONVA 1RTJA 5F1JA 1WWXA 4RBOA 3DFGA 3R6SA 1IG8A 1M1EB 3JAMK 4DF8A 1NK8A 3F22A 1JHHA 4W5QA 2JLEA 2NRVA 4BKXA 4K41A 3G6EI 1BQNA 3MMYB 4BNCA 4OPAA 3E6MA 2FC0A 2R92J 1BJZA 4DF4A 1NJXA 4C8MA 2FBVA 2NS7A 2PLYA 3D45A 1U0JA 4BDYA 3GX4X 4LFUA 2PJPA 3JSMA 2LH9A 2ZQBA 2JWLA 4DHYA 2BGCA 2DYRH 3AA2A 5CY4A 1HPZA 2GLOA 5FPDA 4OAZA 5IYBJ 1NGIA 5GADP 1TWAJ 3VYRB 1D9FA 2F96A 4JOMA 3M8RA 1RT4A 2QKKA 3OR1C 1QZ5A 3LL3A 5LY3A 3G1MA 1FKPA 3W6KB 3WTZA 2ZJQF 3M6GA 3FFKB 2DYSH 5AQTA 1WRJA 1R5HA 2IGIA 4DWIA 3DAWA 4XKWA 5GPAA 4DSKA 2Y30A 4IBNA 3F9MA 4UUTA 1KVBA 2WB1N 2IPQX 3UB5A 3OIPA 1U5TA 4P96A 4IJAA 1KFDA 3B6AA 3KIOA 4DFMA 3KK7A 4H0TB 2MC4A 4Q4ZF 3A2FA 4IRHA 4CGIA 2OPSA 2O03A 3VFZA 1U04A 2CGKA 2E2PA 5CE3A 3GTKJ 1HKBA 1USSA 4A59A 2G8KA 4YIFA 4RAFA 3JTGA 2RVCA 2PAVA 1D9DA 4XLAA 3EN9A 2GAUA 3RPUA 2BTFA 1WH7A 2HS5A 4CJ3A 2EBIA 4Z94A 1MMGA 3WXIA 4DQIA 2D0PA 2YSRA 1YITI 1U48A 1W4MA 5M1NA 2XAUA 1GOAA 1Y39A 3DXKB 1O7FA 4EATA 1WCMJ 4ID5A 1F5TA 2ZC2A 4MQVA 4DUZK 5E17F 3VA0A 4I9LA 2GWRA 2ZJPF 3ZETB 1ZBIA 3HT3A 2A5XA 1AU7A 3EUHA 4B3RK 2P9NB 4B1RA 2NVTJ 1X3NA 3ZMDA 2VQGA 3CI5A 1G8XA 4JX6A 3F3XA 3BF1A 4CFDA 1D8YA 3NH0A 3SYZA 3CCLI 5CR4A 1X1BA 1J2XA 4DBQA 3JTHA 3IKTA 4FJLA 3CM6A 2EV0A 5AQFA 3J81Z 3SJMA 1S22A 1JJ8C 3OYFA 4P5OA 2WOMA 2O8EB 5TRDA 4M3BA 1VQ8I 1KU9A 1NK0A 2NRAC 1SVLA 1IRFA 5HLGA 4CYDA 2NRTA 5BPDA 4XLPF 3KP7A 5TISC 3FXLA 3MDQA 3NHGA 4JI4K 4JYKA 1SV5A 3ERMA 4EGZA 1BM9A 5IP9J 4DTRA 3CFPA 2CQQA 2M7AA 3ITHA 2V1NA 1R59O 1JLEA 4IRGA 4H0EA 2QSFX 3SV3A 1KU3A 5EJCA 3VEOA 1VQ6I 4OLAA 2FXUA 5C25A 3C6TA 3AG3H 1F43A 1WBBA 4AM6A 1U47A 3QINA 2Z1GA 1F4KA 3AVNA 1IN4A 5C12A 4II2A 1ZC6A 4FM0A 2ECCA 3ABUA 1YFHA 4U67L 2ETHA 2A40A 3B6PA 3F6OA 3PO3J 5LMNK 4Q5SF 5C44J 4CBUA 1NGBA 5JFRA 4H03B 4XQFA 4I02A 4KT6A 4KIFA 4DTNA 3WTTC 5DM7L 3BTJA 2MYSA 4CH7A 1KTQA 1DEJA 2HHUA 3RKYA 4FZXC 5DCMA 2NUBA 1RT6A 4B4CA 1ZHFA 1W36D 2QKLB 3BZKA 1TV6A 3ZRGA 3I56I 1D1BA 3D2EB 4CJRA 1T05A 1KC8O 5LHIA 1A5WA 5C2DA 4J19A 4IO9L 2Y75A 1KVCA 1QSLA 1ENHA 3IFRA 4BS9A 3GTPJ 1NMDA 3MEDA 3CFRA 4Y1DA 1WI9A 2DCEA 2LY9A 3EZWA 2EH3A 3BWGA 3QNOA 3P38A 5AIPA 3RPQA 2R7SA 4Y15A 1REVA 2JK3A 1ZYRF 5BOXA 2XPVA 4CJKA 1X9WA 5AZIB 1P4XA 1A5JA 2EHGA 1GT0C 1HSJA 4CZCA 2X9DA 3ELKA 1NOZA 3TL4X 5ICGA 2FOKA 2OQGA 2ZO4A 4FJMA 2VODA 2KKZA 2AQEA 3L2CA 4IO8A 3L00A 3VEZA 4JK8A 4PSWA 1TKDA 1XSVA 4CIEA 3AVJA 2O4GA 2R7DA 1QBJA 3SUNA 2O9LA 1AWCA 1L3VA 4PJJA 5K7HA 2KLAA 1RTDA 3W2WA 1VQPI 3KK3A 3S1NJ 4F9OA 3R4KA 5KAIC 3D1NI 5L3BA 4C9YA 1K8AO 1XD7A 3KZIC 3HSFA 4DR2K 2K5CA 5KQDA 4HV6A 2JMWA 3R0JA 5EOYA 3UKUA 2ESHA 2V4JC 3I55I 3KLOA 5C10A 1QRYA 3UNGC 2W25A 2HQAA 2K85A 2HVRA 3ESWB 2UUZA 4ESFA 1YHQI 4BU2A 4HEA2 1D5AA 1N5YA 4GMJB 3W3CA 1HKCA 3CLOA 2KIMA 4QS9A 3MWTA 4NQWA 3L7WA 4DTJA 1Z91A 2IA2A 3V9SA 1JLQA 4DZPA 3LFUA 3NGZA 3JRCA 4EP4A 1RNLA 1S5JA 2IBDA 4S0HB 4OO1J 3HJFA 2KIFA 1C0GA 1GXPA 4IDHA 3HXLA 4YFXF 3IV5A 2P51A 4BVPA 2G8UA 3ONQA 4Q48A 5FLMJ 3QP5A 4MO4A 1S6QA 3O3GA 4A3CJ 2L02A 2ZBKA 1ZG5A 4N41A 1EH6A 1ZREA 3WE2A 1ZBFA 1LWEA 1VQNN 1QSSA 1U78A 3IKMA 4ANJA 4CK2A 1F21A 4N47A 2LF8A 1Q82O 1U4BA 4IQ4A 3CP2A 2HPMA 1DU0A 1MMAA 2CH0A 2CUEA 1STZA 2VOOA 3IG1A 3QP6A 2L4MA 3SZ2A 1VI0A 3AVAA 3WXJA 3HOYJ 3HOZJ 3ZQHA 1FYLA 2DI3A 4RWTA 4M41A 2VKVA 3NQOA 1HW2A 4U87A 4X0GA 3MCZA 3PO4A 2O8XA 3FMSA 5GINA 2A05A 4RAGA 1U8RA 3K57A 2M45A 5BS6A 1KYWA 3FLCO 3CJRB 2W40A 1L3UA 3OBYA 2KHMA 2X6XA 1SEUA 1NKEA 1RNHA 4JI0K 4BEHB 3MCPA 5KNLA 4ITVA 3PIOL 2JRMA 3TBIA 4FCYA 3I4NJ 1UA1A 4MO5A 1B9DA 4KNYA 1X3MA 3O3HA 4JNEA 4KPYA 1OPCA 3AVFA 2FSWA 2D0CA 2V79A 1OH7A 3IAS2 2OZSA 3A0BC 3J7AY 3VWBA 3VEWA 3H3NO 1IKVA 4FPAA 4AHUA 2IA0A 3RTRA 2Q8KA 4LF7K 3JAMZ 1YTUA 3FBIB 4BWJA 2PMZA 4C23A 4CJPA 3QPTA 4E7KA 3TPQA 5AQQA 4DYCA 3HUGA 4ILJA 1CXQA 2GTDA 1JKPC 3DRPA 1PJRA 1R9TJ 3HRSA 1R4MB 3E6DA 2R7ZJ 1LCUA 4F91B 2HHQA 1CXUA 3TAMA 5HNHA 3KP3A 3BR0A 2ZGYA 3CCRI 1A5XA 2DFFA 2PJRA 3OYHA 1YRNA 2XGXA 2O8FA 3GCMA 3FZLA 1QQOA 3SJJA 3K4MA 3LZJA 1TLHB 5FD6A 2P6SA 5E3OA 4D0PA 3D5SC 3GLLA 4G94A 1KYZA 3HTSB 3WTVC 3DJCA 3V42A 4MO7A 2UYTA 1EETA 5AQLA 3G6EN 4JK7A 1I27A 1E3MA 1BI4A 1QQNA 3FXMA 4UUSA 3LP0A 1Q18A 4FWSA 1LE8A 1TAUA 4KUMA 1BIAA 2LFBA 3TQNA 2CRGA 3V1QA 2Z5UA 2CV0A 4FWQA 3QICA 1JT6A 3DV8A 3H3ZA 4WWCA 2OD5A 2HDCA 2P9SA 2VT2A 4CZIA 4C8OA 2A3SA 4BE1A 3FK7A 4BBSJ 2VJIA 4A3EJ 2V9PA 2QF7A 3SAGA 4B3XA 1V3FA 4XH4A 4KMFA 1LNWA 1I94K 1J09A 3IH3A 1HXDA 3VSKA 4X62K 4IOAF 4HCCA 1MWKA 2MH2A 3CP8A 1IH7A 4CJEA 2OTLI 5C3EJ 4KHWA 1OCRH 1K78B 1Q1VA 4JKFA 4AYBA 3GYHX 4R79A 4G1QA 4C1NI 1MGTA 3U6FA 1X1AA 1NK9A 4GKJK 3S3NA 4CCJA 2Q0OA 5HNFA 2QQBA 4FQGA 1J9AA 2EIMH 1UHWA 1G6NA 4XH5A 4UY8O 5J4VA 3KHYA 2FSKA 1YO5C 1HW1A 4QPQA 4OKKA 1HUXA 2ZJPL 3NEUA 1NK7A 5F27A 1S1XA 1LEAA 1XMQK 5LJWA 3GVAA 1NGDA 4FZYA 2F5CA 3DLLF 3D2FB 1RDUA 5AFUA 4W5RA 4MFBA 1D0XA 3KVGA 4XONA 4NUBA 1Y0NA 2KL4A 1S29A 2KQ2A 3CXCM 4MLEA 2R0QC 1Y97A 2DXIA 3BG7A 3H1CA 1OVYA 3ZEUB 2DOEA 5JVGF 2OA4A 1HJRA 5D6FA 3CCLN 3QETA 2QVOA 4CD1A 1U6ZA 3D7EO 3ULQB 1Z21A 3W0LA 2I7NA 3HPHA 1QNTA 4FZZA 2EFWA 1VQ8N 1WSJA 4D9JA 4AIJA 4E7ZA 2Z1IA 2P6TA 1K4SA 2YHAA 2P81A 2CW8A 2FEZA 4UV9A 3LZIA 2BE2A 3RIRA 5M1PA 2WWYA 1KXPA 4HAMA 2HBLA 2MC3A 1IRXA 4CZHA 1HNIA 3GZ6A 3KZYA 4G9YA 3CCVN 2ZNZA 1SL1A 2WAQA 2FU4A 2NVUB 5K7FA 4M3GA 2O8KA 2JSPA 4B1XB 1ODDA 2HXIA 3AG2H 4CGDA 2H94A 2HVIA 4GGGA 1R7JA 2F9TA 2BHZA 2VKHA 2IVOA 3IH4A 3OSFA 2VBWA 1LB2A 2CUZA 3C2GA 2Z33A 1R5GA 2X1DA 2A6HF 3CC4I 3AA4A 2LDUA 3ZLJA 2OC6A 2OAZA 4WXCA 3OR2C 1WLJA 5E3MA 4N9IA 2ZXIA 2P9KB 2KJBA 3O3FA 2GELA 3KLEA 3ISPA 4DGWB 1KA8A 4E7JA 1YTYA 3SQ4A 3TI0A 2O8BA 3SUPA 1DUXC 4WCGA 4MDBA 3LM9A 3HK2A 1QHTA 3KJVA 4JRQA 1VQLI 5E1WA 3SDBA 3E5XA 3I56N 1ETQA 2I10A 3CCQI 3G4SI 5D5XB 3TOAA 4BH9A 4KO0A 3H46O 5E79C 2LMDA 4AIKA 1S7OA 4Z6YA 4LG3A 4HOBA 2EZHA 3CDLA 5BRFA 2UXXA 1ETWA 3KK1A 4IWVA 4JKAA 2HHSA 1V5FA 2JPCA 3FKJA 1B72A 2LKPA 4ASNA 1DT9A 1WJDA 3TTCA 3P9CA 5D6EA 2MABA 2IS6A 2EFOA 1LEBA 1TWHJ 1G3SA 1B9FA 3CCJI 2KT0A 3CCEI 1X3ZB 2CGLA 4CFCA 4E6KG 4PL7A 2VQFK 4BRNA 1V55H 4A3KJ 4X1EA 1S8NA 3MMVA 5AQRA 4IFVA 2UV1A 4KT5C 5JI6A 2CQKA 2QK9A 3VQDA 2YX6A 4BR0A 3V4IA 2YU9J 2L3DA 2HVSA 4OIQF 2EFQA 1VQPN 3SQ0A 1JUMA 1XX5A 1XDSA 3HB9A 1LW0A 1HC8A 4IRIA 4B09A 4OX9K 4G8XA 4FLWA 2M87A 2GWKA 3QFPA 3M5RA 4V19S 3I55N 4OIRF 4HX7A 1W5TA 2WV0A 3AL0C 2QWQA 4Q5VA 3AA5X 1AKHA 1BJAA 2EINH 2K7LA 5CYVA 1YHQN 3ZSYA 3ROUA 4KIGA 2ELKA 2K9LA 3U9GA 3BROA 3HDDA 3HOSA 1GLFO 2X0LA 4JS4A 1QZZA 3PO2J 2DA7A 2ZSIB 3K0SA 1ZYQA 4CZFA 4Y52J 4CJUA 4MLHA 1KQSM 3DTEA 4DSLA 4WQ4A 4LK1F 3L2VA 4JHDA 4P9FA 2WC2A 2YNFA 4KBOA 5DYMA 4BEHA 1Z3XA 3RMCA 3F6VA 1BO5O 1LVKA 4ZJZA 3EUAA 5AONA 2XAHA 4EJUA 4OMZA 2ZJRL 4XSXF 2BW3B 3CCMI 2Z1DA 3FZMA 2KISA 2Y48A 3KZBA 1RILA 3I4MJ 2P9UA 1G2HA 4L9VA 2OU2A 4BR7A 5AQXA 2IEKA 2VPLA 4ZTFA 5ELZA 2WY7Q 3I0SA 3BZCA 3KWIA 1MA9B 3AY9A 2QM1A 4KH5A 4A61A 4H5NA 1QO0D 4LIUA 2QTDA 3K69A 3SLCA 1YYVA 1HF0A 4PJNA 4LF9K 4R1HA 3U9DA 2Y31A 1T08B 1JT0A 4CZKA 1LWCA 3K4LA 1SD4A 4BJTA 5EDNA 4M6YA 2FBYA 3WNFA 2Z16A 4C3HJ 1I3QJ 4H5WA 5FROA 2ZXJA 4HSRA 3HSCA 2UUAK 4XLEA 4DV2K 1N78A 2L5QA 1KU2A 4A3IJ 3VGLA 4BR2A 4N4OB 4JD2A 3A01A 3TU5A 5C15A 2FNAA 2F4IA 4FSVA 4LITA 1N36K 2QQAA 1W9HA 2IVPA 1I1SA 1T2KA 1R0AA 4F2SA 1U3EM 3VEXA 1UG0A 4OGEA 4KI4A 4NBQA 1FOXA 3KETA 2L54A 4WFBL 2VCPA 2EQRA 3WGIA 1JLCA 1YIJN 1UOCA 5J47A 3OIQA 1BUPA 3DQVC 2YX7A 5LJVA 1WB9A 3D5RC 1K9MO 1LDJA 1YJ9I 3RRHA 9ANTA 3R3LA 3WUHA 1PUFB 4CJ7A 5AQJA 3AVHA 3KLGA 3S41A 4CHQA 2LSOA 2FJ1A 2GEMA 4NXNK 4DG1A 1N32K 2P8TA 3FR0A 2VBXA 1LFPA 1BQMA 3G71N 1FP2A 3N4QA 2CUJA 4IEIA 4LLLA 3ULDA 3OYAA 4K2EA 2I7PA 2R7QA 3BEXA 5LLQA 3R9PA 1LFUP 4DTXA 3L09A 4KTZA 1TQMA 1XSXA 2XF6A 2KJCA 5CPRB 2VWBA 4IX7A 1PUEE 2M7BA 1H9TA 1SKRA 1IBKK 1QPIA 4B08A 3WU1B 3T3FA 5E3LA 2DDBA 1OQYA 3SZPA 2OTLN 4RGXA 4B1VA 4AQYK 1ZTRA 3PSFA 1NG9A 4ELUA 3HYFA 2HPIA 1A31A 1S9HA 4LC9B 1NG6A 1YS7A 2QXLA 4PY5A 1MBEA 1MBKA 4DV3K 2GZWA 3CUQC 1EP4A 1OJLA 1UAAA 3S2WA 3SZGA 5FPEA 3QOPA 3ZT2A 3DLLL 5DK5A 3ABKH 3TAPA 2XHKA 4HLXA 4PSXA 4A3JJ 4J2DA 3E6BA 4I2PA 1ZR4A 5BRDA 3ZP5A 4A93J 4P55A 4FLYA 1BOAA 2JN6A 1R23A 2O3FA 3SV4A 2WTEA 1VAZA 1RT3A 1SAUA 1JGSA 4IQJA 4B1UB 4AM7A 4Z4IA 1TWFJ 3FHZA 4NNJA 5JVGL 4S04A 4FX0A 5AQVA 3AAPA 2B5JA 3V8KA 3D6RA 3BJOA 2EK5A 4XNFA 2ME0A 4YOXA 3KWGA 4JKGA 4OWRB 4D1QA 2CSOA 5LGUA 4B1ZA 3BR3A 4DQ2A 5B66C 2WY8Q 2EZIA 2PG4A 1WJCA 1DGWY 3RYRA 1SMTA 3CMEN 2QEXI 2FSNA 4HF2A 4J01A 2EZLA 3ZX2A 3DXJF 4BRMA 1WH5A 3E5UA 3HOXJ 4CDGA 4F4KA 1I3AA 5CQGA 3H1VX 2D1KA 3CJBA 3RMBA 1BR2A 2PFBA 2STWA 5FKMA 3PUFA 4C3IJ 4B48A 3SQ2A 3DBHB 1Y8QB 2W00A 4AC0A 2F8SA 2R4GA 4DR7K 3A5NC 4BVOA 3V1RA 2YNGA 4WQ5A 2UUBK 6PAXA 2P0WA 2M0MA 2XY8A 4EAHD 4KFBA 1ZN2A 4CK1A 2O8DB 4RS8A 3ID8A 4EHUA 2O0YA 4I7FA 3BTIA 3ZX3A 2CG4A 4PKHA 3CJ9A 2BY0A 4CYCA 3LAMA 1RUNA 4E7HA 5CHIA 4K8ZA 3TAQA 1HKSA 4B1WB 2CQNA 2M8EA 4EM0B 1J9IA 3U8XA 4DBRA 1GOBA 1Z6TA 5EF6A 4QAGA 2FXAA 2M30A 3L9FA 3L3VA 3T1BA 1GV2A 2E1ZA 1MNDA 2IS1A 1SFKA 4BC5A 3OV8A 3H5NA 3OJUA 1OFCX 1FTZA 2CGJA 4Z4HA 1GLNA 1IBLK 1SL2A 4HV5A 1VQLN 3T8RA 3CDHA 3OHRA 4LG0B 4CF0A 3QWLA 1OCZH 2UXBK 1ZQ3P 3CUQB 4CI6A 4IHYA 1EX4A 4BGDA 4PUSA 2GBZA 3BGRA 1BA1A 1XHZA 5EEGA 1NGGA 4BRIA 2PI0A 1P4AA 1D3YA 1T39A 3AGRA 4GV9A 3ZQIA 4CF9A 3VMFB 3U4LA 4MLOA 3VERA 3K4BA 4ICLA 3QOEA 3CCJN 3K5OA 3ZT1A 1RRJA 2MD0A 5JVTA 3HKZN 2BY1A 2MLKA 5GAHP 2QGUA 1XMAA 3JXUA 2AO9A 2ZMEB 3RPUD 2IS2A 3BCBA 4ZYAA 1XN7A 5M1KA 1N34K 3BY6A 5LHGA 1R6RA 1HDPA 3WTXC 4FJKA 3T8TA 1J5OA 3VQ4A 3THYA 2MLGA 1J5EK 3CTAA 4A3MJ 3RSEA 1U2WA 3O5BA 3L4IA 3OVNA 5KHDA 5BN9A 4M3FA 4BJ6C 2BANA 2PYLA 2E35A 4KKOA 3HL2A 4YEJA 1BI0A 1FWZA 4DV6K 1NK2P 2OV7A 2IRFG 4GKKK 2NVYJ 1VZ0A 3NARA 3TOBA 3MKWB 4MTEA 3GWZA 1UFMA 3NGYA 1FPQA 1GDTA 2DBBA 2VB6A 2K4BA 4S05A 1UA0A 1SZ2A 4K43A 2OA8A 1RPWA 4GFBA 1MH3A 3SJHA 2E5LK 5GAGP 3BTCA 3H9GA 1SD6A 3PNVA 4CJFA 2XSJC 4HX4A 5AJ3K 1TVRA 3PX0A 1WAJA 3WEEB 1S7AA 1WFXA 2M34A 1HCRA 3EE9A 2B7EA 3CCMN 3CC2I 3NAEA 3RQ4A 3MX2A 1USTA 4CCNA 1TW2A 2VBYA 2B6AA 1EH7A 5EGOA 3GFMA 3DP7A 3EUHC 3E9OA 4BRHA 4GVMA 3OOUA 5H2FC 2OBPA 4A12A 3C6UA 2FE3A 2R5YB 1ON2A 3PNTA 1Z9CA 3HRUA 5F0CA 4OPKA 4FOIA 3RRGA 2QWRA 3AVCA 4E1MA 1QQCA 4DSJA 1APLC 3V9ZA 2IJLA 1VQ9N 1TYQB 4PUOA 5F1RA 3GTOJ 4CF8A 5FGMA 2ZF5O 1M90O 1BW5A 3D5LA 1FY7A 2OTJI 4XR6A 1R5ID 4XRFA 3IL2A 2H8RA 4A3BJ 5J40A 4CXFA 1PUFA 3CQ8A 1ZBHA 3ZXSA 2QBYA 1CGPA 3HHGA 3LNQA 3BJAA 1K73O 4A2AA 3WG9A 4DQPA 1F1ZA 3I0TA 5F04A 1GLDG 2R7FA 2JZYA 1X19A 4A2UA 1SVOA 2KIUA 5CQEA 3DCFA 4D7NA 3O9TA 3S16J 1Q81O 4CGJA 3NE6A 4LOCA 3P31A 3M1EA 4HUFA 2XVCA 5C2FA 5LEJA 4GV6A 2DK5A 5D8KB 3V8JA 4QLCU 1H9GA 5BMZA 2NXNB 2R7YA 4FJGA 4FLZA 2VYPA 5M5WJ 3S14J 1RR8C 3AO3A 1QZ6A 3LAJA 3REOA 1EH8A 3TGNA 4Y4RA 4A0YA 4N56A 4BG9A 4IKFA 4M3DA 3VGMA 1FBQA 1U5TB 2DT6A 2M9HA 1YJNI 2ASMA 5E1ZB 4BY1J 4CICA 1YJ9N 2G8WA 1XNRK 1VSJA 1OMIA 2NZTA 5J8FA 3Q9SA 3SDGA 5L3EA 2HOEA 4XK4A 5JLFA 1WQ2A 3K0LA 2ISZA 4XKVA 4RB3C 1ZBUA 4UVCA 2FBXA 3LAKA 5GADJ 2BVMA 2IAIA 1NTCA 2HDDA 2DT7B 4XICA 4YORA 5IT9O 3DEEA 3DTKA 2VJJA 1FYMA 2A1RA 1T44A 4BR9A 5AQUA 2X85A 3LMMA 3DLKA 4KHPK 2VWJA 3THWA 3OYMA 1H88C 3SBTA 3T1YK 2L9NA 4XLNF 1X4PA 5FRNA 1BHLA 3TP0A 4IHWA 1M1KO 2HHTA 3M8FA 1KCFA 2GXAA 4LK0F 5AQMA 1BW6A 3NBPA 5JLWA 3DRRA 3A1YA 2XC7A 3HHHA 1GXQA 3CZ6A 4YOTA 2K3FA 4ENMA 3RMAA 3CPEA 2HSTA 4MFDA 4B9NA 1YTAA 1VQMI 4RW8A 2CQXA 2VE8A 3DEWA 4IOCL 3QBWA 1BOTO 1FXXA 5HRNA 3P5JA 4J2BA 5FJ8J 4XLFA 2NNYA 2X6OA 3MXJA 3UE5A 1ULYA 2JWTA 2HMPA 4Z4EA 1VSDA 3M1FA 1I1GA 4BAYA 2FMLA 3H3OB 5FLVA 3K9TA 4Z2YA 3O9SA 3TMOA 4O5BA 4CZEA 3RDIA 1XG1A 5T7BA 2FMYA 3P9KA 2OPTA 1JXBA 2COMA 3RYPA 1OKRA 2VGNA 2DO7A 3MEGA 4MGRA 4DJAA 2XROA 4LB6B 3OYBA 3VB2A 1S1UA 1NJYA 3O1BA 2LNBA 1FTTA 3MWPA 1CZ9A 3KPHA 4IVNA 3VEPA 2VQLA 3CO6C 3S15J 3MVPA 1FNNA 3TWHA 2EWNA 1Y56A 2BYVE 5AQSA 1UAXA 2IGMA 4M7XA 4W5OA 4A6DA 2ITGA 2EIKH 3DBRB 5J2MA 2QEXN 2MFZA 4ID1A 5D4SA 4ISFA 4ILGB 3H45C 2VXZA 4AF1A 1ZBLA 2KPMA 2HNZA 2NAZA 2QM3A 5L3FA 1Z77A 2OCCH 4AHCA 4Q47A 4L5IA 5K5RA 3DLBA 4GXOA 2A61A 1XHXA 4OKEA 3I4PA 2W7NA 4LFBK 4WFNL 4N0BA 2M3AA 3VYTB 3DOKA 2DA1A 3PQKA 2CW7A 4CZMA 4CJ5A 2Z9OA 3IDHA 2QWMA 4KICA 4YIIA 3T0YA 2XRLA 3CD6I 1V5GA 1R1TA 2GBYA 2Q36A 3W6JB 1U9OA 1ZRCA 2P9IA 2HZTA 1P4WA 1ATSA 3H92A 2B9SA 4E89A 3C7NA 2DW4A 1U6GA 2A41A 2RQPA 1MNEA 4XBFA 1QA6A 2ZMEA 2MG4A 1T38A 3QERA 3D0PA 1NK6A 1R4NB 1ZAOA 1SFUA 3R8EA 3LDLA 4I2QA 2NVXJ 2B0LA 2RNJA 4QS7A 1TGOA 2DN0A 2UZKA 3RWUA 3WQTA 4DV5K 2D4WA 2IGOA 5B1BH 1MDUB 2K9NA 4XMYA 3FF5A 2BDPA 4Y0WA 3J7ZO 2YR2A 2L2OA 4J8FA 1Z1DA 2NS8A 5L3CA 3L8BA 2XKOA 1SC7A 2JA8J 3UKUB 5AIQA 4Y33A 4EMSA 4HNUA 5HODA 2YKNA 4QSHA 5JLXA 2LR8A 2KTQA 2V7YA 3O9RA 1A36A 4G7ZF 1IKWA 1E4FT 4OOIA 3ZSVA 2QUFA 5E8IA 2QKBA 3LALA 1D0YA 3IKVA 4O55A 1UCRA 3K2PA 5FKNA 4DUYK 3LWMA 3FXOA 3KYLA 2VPRA 5IOYA 5M1OA 1KAZA 1IV0A 2AP1A 1UHMA 1P9QC 3BC8A 3R6MA 5BPMA 2HNHA 3M07A 4CBXA 4JI7K 4CIFA 3BR5A 2I5UA 2H1KA 1HX1A 1YW7A 2A3ZA 4HQMA 1NK5A 2GIZA 2XAQA 4CCOA 3KX2A 3ASOH 3G2BA 3MKYB 3HC7A 2YS9A 2WC9A 1K8KB 1QVFM 2FQ4A 1P92A 1ZLKA 1GOCA 2F4VK 1QU3A 2BGGA 2OUMA 2W24A 2DMTA 4YDUA 1IV8A 4UY8I 2HBJA 3EL2A 4V2FA 1IDYA 2STTA 1B8IB 2V7FA 4L9JA 3DPTA 4K8XA 4HF0A 3T69A 5IT9K 2R5YA 5D8LB 3ULEA 3RKWA 3OJSA 3T19A 1BIZA 3DXMA 2KFNA 3SMPA 4I7HA 2FF4A 2EV5A 3ASNH 4M9SA 1Z7UA 3OYDA 3SUQA 3KYDB 2Q1ZB 4I2OA 1MSEC 2RHKA 1VTNC 4AHRA 4NB4A 4FE4A 2H8WA 2R7TA 2JA2A 4DLEA 5AQZA 3TSQA 1WSFA 1JCFA 4HTUA 1UHSA 1XGMA 4MNUA 2AQFA 1VQ4I 4L9TA 1BI2A 2XUBA 3VYUB 1MJBA 3L4QA 2VONA 1YQAA 2JJ7A 2YX4A 2F4MB 2FF3B 3EE8A 3CC2N 3C2BA 1ZRDA 3LQQA 1T3VA 2IGKA 4BR5A 3VSLA 2BVLA 1GUUA 5J1YA 1IN7A 3A8YA 2JUGA 4EGYA 3W2AA 3NFAA 3WU0A 4UB8C 3AVIA 3HUGB 1W7PA 5J8CA 4KB0A 3FBNB 5AZJA 5I9EB 5GTHC 3BLYA 2E4LA 4LH4A 2E6LA 4JKDA 2HVHA 3IS9A 2XGEA 5TKWA 2PJRB 4EJTA 1YRNB 2O8FB 2RN7A 5F0HA 4ZZLA 4BGBA 2XDVA 4E3SA 4BC4A 5EY4A 2MH9A 4Z4FA 3QLHA 2OTJN 3NCIA 5EEAA 1UZCA 3BQZA 3TDUC 4DU4A 1BWFO 3QNNA 3OYGA 4KI6A 4FWRA 3ML6A 4PJLA 4CZZA 1BI4B 4CCKA 2GA1A 1EV7A 4UUSB 3R0AA 1O3TA 1LE8B 3RJPA 1QE1A 2H6CA 3FX3A 1N33K 1MW7A 3Q3SA 1LWFA 3UIQA 4FT8A 2YNHA 3AO5A 4A0ZA 2VIXA 5BQTA 3FXJA 3I0RA 4BJ5C 1U9NA 4LSNA 2X1EA 4YELA 1LAWA 3FHNA 3VGKA 2P9SB 2HBKA 3KKRA 1UELB 3MCAB 2HWVA 2ZFWA 1UB9A 1RCHA 3J81O 2QQ8A 3C3WA 3TDZC 5I42A 1K79A 4I9QA 4C3JJ 4LD5A 2E36A 4JKHA 2E7WA 1YJNN 5HROA 2PMHA 2EZKA 4L3QA 1P6RA 3I54A 1DDNA 5CZ1A 1VQ5I 3QDKA 4DSFA 3E1SA 3HL8A 3NMUA 4FL9A 1TK5A 1T7PA 1X2NA 4IXCA 5DD4A 5F0FA 4AIHA 3VQ9A 2H27A 2L0KA 4LF4K 2HW3A 3SQNA 2RDPA 4DW6A 5DD8A 4KB1A 5BN8A 4PJ0C 3KP6A 3WHCA 3L2WA 4JRPA 3KLIA 2CS3A 3SFZA 4EM1A 4D5FA 3CCVI 4X66K 3GO5A 4I6MB 4U0YA 3OL4A 4WFAL 1T6CA 4BXUA 3DLAA 3HSTB 1OH8A 2XAJA 4QS8A 4IHVA 5DM6F 1HLUA 1W2BM 5FDLA 3F8BA 1QZEA 4HG2A 3KTQA 1BC7C 3RTVA 1TTYA 1B6AA 4CEFA 4Y3OA 3A02A 3A4CA 3PM1A 3OBWA 2HGCA 3TW6A 2D0OA 4CZLA 3SAFA 4XN3A 3O08A 4AHTA 2D1HA 3LA3A 3L1PA 2A69F 4FE7A 4JV5K 1DTQA 5JICA 1QTMA 3GW2A 1FSHA 1VQMN 2HYGD 3H36A 1AHDP 3N05A 5KVRA 3HP9A 4FVUA 4ENKA 3MAJA 1KVAA 3M4OJ 3OYEA 4M71A 1MMSA 4CEEA 1J54A 4JI3K 3HKZA 3GXOA 1WGXA 1HQEA 4R8HA 1B1BA 1DTTA 1KONA 2ZCWA 1GLBG 1TKXA 4PCQA 5HDKA 1G59A 3U3YA 3ZQFA 3E9LA 1HSTA 3CJTB 2Y2ZA 4K42A 4WQ4C 5HOOA 5FFZA 4JN4A 2TDXA 4IPAA 2WUSA 4MFEA 3SK3A 4CJTA 2HQ5A 3ENBA 1S6PA 3JRAA 4GVEA 1VSEA 2XV4S 5HS9A 2A6EF 3K58A 2A1SA 1HKQA 1KD1O 2CFXA 3MXMA 4BY9C 2HOTA 1VQOI 4JKCA 2IP2A 4CGZA 2CO5A 2VC0A 1MBFA 3LSMA 1IN6A 2UWMA 2FSJA 2KZVA 3LFKA 4R5PA 1QZYA 1NJIO 4U7BA 2CFOA 2YUSA 3K70D 4B9LA 3A2KA 2YNIA 4L9NA 3NF6A 2O8BB 3ZMVA 4LLGF 3PJRA 1W36C 2G9WA 1FK9A 1HA8A 2ZWHA 5CVVA 1KAYA 2KLOA 2IT0A 4YFKF 2P9PA 3P9IA 1NHAA 3MQ0A 3ZQCA 2HDWA 5C42A 2X4HA 1JUPA 3ECOA 4JS5A 2L7MP 5AQGA 5E3NA 1RTIA 1TL3A 4RB2C 4M3TA 2CGPA 1YX5A 4KJZA 4DQRA 3DPUA 4V19K 1S1TA 4FM1A 1LQ1A 1T6SA 3GTJJ 2D0AA 3G1LA 3RMDA 2A5YB 4EVIA 2ICWG 3E6CC 2R7VA 1B72B 4BE0A 3IAYA 4C2TA 5KTQA 3CD6N 1XMXA 3OS2A 2RPIA 1IO2A 4BQOA 1CF7A 1YXQA 4E7LA 2O5RA 4BREA 1PP8F 3QBXA 4RW7A 3DYAA 3I59A 2PQ8A 4DTPA 3KEQA 2FD5A 4H4OA 3UKRA 3ZT0A 5FPNA 1WKMA 5M1QA 2LG4A 4XKCA 4YOUA 3ENHA 1MBHA 4X64K 5JVHL 1EWRA 1SFOJ 3BQYA 2V52B 3A03A 2DK8A 3E5QA 2E2NA 3SPYA 4WYBA 3H9QA 3E0JB 3WNGA 4BHCA 1K8KA 3CMYA 4AHSA 2LD5A 1E3PA 5AQPA 4JLHA 3ZOBA 4ZZDA 4RW4A 3HG9A 4PKGA 1MSFC 4PWDA 2V9VA 1B8IA 2RE2A 3SXYA 5DS9A 3GTGJ 5AQKA 4XN0A 4PA1A 1BGXT 3M8QA 1QVUA 2R7OA 4RLQA 1ETOA 2F4OB 4JK9A 2BV6A 4EQQA 2D5RA 1AKHB 3FZHA 4O8KA 3QEXA 3BZ6A 4LMYA 4E70A 1V4RA 4NHJA 4M3WA 2GWJA 1Z05A 5BPIA 4RGRA 1D1AA 4QWQA 3JREA 2HKOA 2P1JA 5EG0A 3DLHA 1OVQA 4AUXA 2NRRA 1JCGA 2WONA 4OLBA 3CO7C 3QB0A 1SUQA 3J81K 2YCHA 4JK1X 1E17A 1DLOA 1F9NA 3ABTA 4JHDB 1L3TA 3K4JA 3HOVJ 5AQHA 2X6YA 1XUPO 4IFEA 1MD0A 2DA6A 4A5NA 1KAXA 3KKSA 1SS6A 1XNQK 1O3RA 3PX6A 2Y9ZA 1QS4A 1O13A 2HKXA 3VYSB 1X4OA 5J3LA 1PYVA 4CEAA 3JRDA 1WJFA 3H5RA 2Z1HA 3VEYA 2P9UB 4BDZA 2RKIA 3V8LA 2D2WA 4I01A 2E5NA 1JL1A 1ATRA 3TARA 2DODA 3CYMA 5EXWA 1YOVB 3Q9VA 4CHOA 3BPVA 2DY4A 1FIAA 4B47A 4CW7B 3MN9A 4IZZA 2R7XA 2DTRA 3NF8A 3KFWX 1FSEA 5D5UB 3SFIA 1YIJI 3WT0A 5FRMA 1BU6O 2R5ZA 4N4NB 2V9KA 1NKCA 2TCTA 3Q0VA 1Y1VJ 5HS7A 5JR3A 4IJNA 4FJIA 3DM2A 1Y64A 2XPWA 1BR1A 3W6VA 1OR7C 1FC3A 1TP4A 4EIAA 4O8UA 4ZDOA 2L7KA 1VQ4N 3HVTA 3OSGA 1RBUA 3G71I 1IV6A 3M8PA 1LDDA 4A3GJ 3AG4H 3K2ZA 4JD2B 2ZJQL 5HP1A 1ZR2A 2BXYA 1X1DA 3LQRA 4UB6C 3A01B 3IAM2 1JJ6C 2ZM6K 2E19A 5EVZA 4B3AA 2R7RA 1NWKA 3QQAA 3PO5A 4JEPA 3CCSI 5H20A 1G15A 1W5SA 3ZMTA 1HNXK 3LA2A 4LF6K 1WVRA 5ICFA 5F08A 3ZMSA 3KLFA 4IF4A 1XGSA 3ZN1A 4I76A 1K6OA 3TAEA 3MN2A 4F3OA 5IYCJ 3ATUA 2DMPA 2QENA 2EV6A 3ERED 2DPUA 2QKMB 4EJWA 4QCLA 5DDGA 1G99A 3HRTA 2CJJA 1RT5A 3TR8A 3VPRA 3VQBA 5F64A 4GYGA 5JHUA 2R3SA 3F0CA 2O8CA 3EYYA 3IHUA 1DGKN 1JHFA 4IEJA 4XEIA 3P4IA 4CJLA 2I8DA 1S1WA 1QSYA 4M45A 4RTFD 1XQSC 5AQWA 3O8HA 3MKLA 4CESA 2O6GE 3RI4A 3ZSZA 1HDDC 2G0EA 3JYTA 3C94A 4I6MA 4NC7A 3G25A 4OKJA 5J2NA 4CJWA 2W57A 1JKHA 3HGYA 3DWLA 2QWNA 4BC2A 2W82A 1I5ZA 4B8CA 3VQCA 5GAEP 1ITGA 3A5LC 1NGCA 1RDWX 4HVJA 1VHXA 1FJGK 4GO1A 3B6OA 1X1PA 4DU3A 3V4GA 5C4JJ 3ENOA 4NC6A 2OZMA 1Z6RA 3OYLA 3J7YP 3K7AJ 3EEQA 1BDGA 2E88A 3ZSWA 4B9VA 1OYWA 2ID6A 3CMEI 1OYYA 3NVKA 1QVTA 1DU6A 3NH2A 3FISA 4WE1A 5J1RA 3BT9A 2GIVA 2FF6A 3I9V2 4TSXA 3S3OA 1KQ9A 3FXKA 1VQ5N 3S1RJ 4BQZA 4PDKA 1VQ7N 1Z25A 4WXHA 4CGFA 5KPZA 3W2VA 4ESBA 3CLQA 4CZJA 1U45A 5KQ8A 4NO7A 3OYIA 2QWPA 1S5LC 3V7RA 4RW6A 4CHZA 3I5UA 4B3OA 5SWMA 2LKXA 1OKJA 4YIRX 3JW4A 2ELJA 4O44A 1T8EA 3H3VK 4NB5A 2B63J 2JA6J 3K1PA 3F8CA 5GPCA 1HNWK 1X3WB 4FW1A 3QU6A 3WTUC 1J6ZA 2XPUA 4B9QA 1TQIA 3VF2A 3PIOF 4KA4A 5B3SH 4CEBA 4BRDA 1OISA 4B9TA 2LP0A 3QEIA 5GIPA 3WU2C 2Q3SA 2KKOA 1RDBA 2G8FA 3ABMH 4ZYHA 1TC3C 2ACJA 4JKGB 1QHHD 2G8VA 1RKTA 4HWIA 1R58A 3QIPA 4HNVA 3RVCA 4NYNA 3S2DJ 2KDZA 3VENA 3BTLA 3O4NA 2Y9YA 3DLRA 3PV8A 2P5LC 2Q1NA 1A5VA 2FRHA 4I6ZA 5IP6A 2QI2A 1C6VA 4CUGA 2P5VA 3I58A 3PX4A 3EUKL 4RMNA 2BY2A 3AARA 5K7ZA 2AHQA 1T8IA 3WTWC 5FO5A 1C0TA 3AAFA 1JGGA 5M5YJ 4I99C 3KCCA 2XRNA 2BBYA 1ASWA 2OQRA 1TUUA 3J80O 1BG3A 3ATVA 4F7ZA 3QFUA 2KZMA 3B02A 3R61A 3N97A 4CCLA 5K5OA 3WXLA 3JRFA 4FWLA 2HOSA 1WSEA 2F6CA 4H4MA 1JTXA 4OINF 1LKXA 2E71A 1IF1A 4PK4A 1ETKA 3GLXA 4A3LJ 3EPZA 4BC3A 3M3ZA 3FDYA 4Y13A 3CJAA 5E41A 4M72A 2RV8A 1XTAA 4F93B 4GNIA 4LH5A 2XY7A 3T7ZA 2FUG2 4CYCB 1RGIA 1HOMA 2BUPA 1YJWI 2Q0RA 4A3DJ 2LBFA 1RBVA 1WSIA 2A42A 1EWQA 1VQON 4ZH4F 1D8KA 1YX3A 3BG9A 4UXNA 4X6AJ 4IHXA 4XIUA 1FX7A 4CSWA 4NCGA 5TKYA 3JR9A 4BL0B 5HVQC 3PNYA 3QESA 2P9LA 1VNDA 5KRSA 3AFHA 2W85A 2DFEA 1ACIA 5K1YA 5SZTA 1N77A 1JKRC 3S1QJ 1BR4A 3VQPA 1Z3YA 3K2AA 1XPXA 2RQQA 1JKQC 3ZCMA 2D45A 1MMNA 1MZBA 2VKEA 1NU0A 3BJ6A 2DPNA 4J2AA 2VASA 1O1WA 3ID6A 2XGCA 3LSRA 1IKYA 1KQ8A 5HDNA 3TTDA 3LSTA 2F5VA 2HNYA 3JRHA 3I8DA 5EX5A 4M74A 4E4HA 2BZTA 4IHSA 1BOBA 1JLBA 1XCBA 5BNGA 4AH9A 1ZK8A 4C2MJ 3KLHA 1PVEA 4RCHA 2Q0UA 1Z0XA 4HUGA 5ADXA 2CWEA 1WJEA 3OTOK 1K83J 1NK4A 3CJ1A 3BR1A 4DMNA 3N4MA 3ZPLA 4CGHA 4ZYEA 1HKGA 4I09A 2DA2A 4A3FJ 2E60A 3H5AA 5E18F 4F2RA 4YNQA 2XGDA 3OYKA 2XO7A 3WXMB 4I98B 3HM9A 1IJJA 2HF4A 4FJ8A 3S32A 3FXRA 5ILUA 1MMDA 1TQPA 4XLCA 3THYB 1U49A 1ON1A 3BUZB 2NOGA 3RSEB 4H4KC 4DQQA 3ZCOA 2V1XA 5BRHA 5MLCQ 4DLGA 2V7ZA 1W0UA 1RKWA 3U1KA 1D0ZA 1P8ZA 2E1YA 3G10A 4KTWA 4O3MA 3AO2A 2QA4I 4BQLA 2P4WA 3CF2A 3IRRA 1RUOA 5CVIA 1YT3A 1R49A 2BXZA 1Q8IA 1VQ9I 2XKPA 3HYIA 1AOYA 2R7WA 3AO4A 4XRSA 1TNSA 3GMEA 3K4CA 2E34A 3O9QA 3TO7A 1O57A 5GAHJ 1B59A 2DQRA 2VKDA 1R22A 4DTOA 4LFAK 1RC9A 1UG2A 2GUIA 3HTVA 1RDAA 1UWBA 3WG7H 4CERA 3VPZA 3DOLA 3E66A 4HLYA 2E1NA 3QRFF 5LRRA 5DV5A 1T03A 1FBSA 2BH1A 2GUPA 1VSHA 3MZHA 2W41A 1GV5A 1V54H 4EP5A 1CZAN 1NLVA 4JX5A 4ENNA 4FXDA 1O3SA 2ELHA 1OLTA 1B92A 3BDDA 4NLCA 4WK8F 1C0UA 2WAFA 1U8BA 5EGOB 2EB7A 4CF2A 4XOPA 4O6JA 3H0DA 4HCBA 1JLFA 1POGA 1WAFA 2BHYA 2GQQA 3E9PA 2IDOA 2FX0A 3QMLA 3HSRA 2DTUA 1BIBA 1IC8A 1IKXA 1E4GT 1TL8A 4A57A 3CESA 2EA2A 1IUYA 3A5MC 3FMQA 4B9SA 3C1DA 1ZGJA 2WA0A 3GE1A 4QOZB 3DLEA 2K40A 5L3DA 5GAGJ 2ASOA 4CHYA 4FISA 3VTHA 2KDOA 2IVNA 1ASUA 2JVHA 4OIPF 4KHQA 1T98A 1X9SA 1K7AA 3NDKA 1LPQA 1QHAA 2AXLA 2X6SA 2Q2EA 1DPRA 4AU7A 1Z26A 2QBYB 4ZYGA 1VQKI 3ZYYX 3DKWA 4AVZA 1GLCG 2NS0A 2Y0SA 3NVMA 3O1WA 4KTQA 1L5UA 2F5EA 3DI6A 1KLNA 5KRTA 4KH6A 3AVBA 1HYZA 4A5AA 1QPMA 5DMRA 4GW6A 2VQEK 2E2QA 4L5JA 3OYJA 1XI1A 1TL1A 4IOAL 4HW0A 2K27A 4DKWA 4RW9A 4WCEL 3J80K 3THXA 3ZQGA 1Y0UA 4IXAA 2VWKA 3H6EA 3CCSN 3HGGA 3ZMUA 2MBFA 4KISA 2GX9A 4N9HA 3M8JA 3SHFA 4MIMA 3WTYC 1VSKA 2F7TA 3QYFA 4CEZA 2XIGA 4M7YA 1R1UA 2XAFA 1NK3P 4EV0A 2EFNA 1OCCH 1FKOA 1JLAA 2NNWA 2QW9A 4A62A 3F73A 4HX8A 3C6HA 1MDMA 4RGUA 1D1CA 2EWSA 4IFYA 1U2VA 5F1XA 2KW4A 4H5RA 5FKKA 4E1NA 4RG8A 3EDPA 1V4TA 3G1OA 4CHNA 2L4AA 3VF4A 3MEXA 3L6QA 3F21A 1EXQA 2V6EA 1BISA 3MXIA 3VETA 3J7ZI 2ZJ2A 3P83D 3B73A 4CCHA 3GBGA 3TO6A 4Y17A 1XMKA 3BPXA 2VBZA 4UUVA 1BIUA 3J8AA 3TO9A 3OY9A 4PFPA 1SVMA 1WJ5A 3O6WA 3THWB 2RAEA 1WJAA 4NYFA 2ZMEC 3L2RA 2W4SA 2ZJRF 1FOWA 3S1MJ 2WBNA 2L7ZA 1RT1A 5BR8K 4HA8A 4CFAA 2TRTA 4FJ9A 4RGSA 4BACA 1KFSA 1WOQA 2O7OA 3RSNA 1K6YA 1K4TA 3SI6A 1BCMA 1T0FC 4P9UA 4KHYA 2NNNA 5EYRA 2J4RA 2DOAA 3H35A 3CJ7A 3TEDA 1NGHA 1FP1D 4AVPA 2ECBA 2ZE2A 1SD5A 2YJEA 3Q7CA 5L3GA 4EJVA 3CQZJ 1C0MA 1XB4A 2XB5A 3JSPA 1O3QA 4BRQA 1TBXA 3CPWM 1SANA 1ZG1A 4BRKA 5KPRA 3VESA 4KITB 1F36A 1TT0A 4I0AA 2MA3A 1SL0A 1I6XA 2ZXWH 1S1VA 1S9EA 3THVA 2FQ3A 2JVGA 5EEHA 2DMNA 3GDQA 3MKZA 2LSNA 2Y1IA 4BY7J 2EFPA 5LGTA 4P1WA 5KAFC 4JI1K 5HLHA 1GHCA 2P7CB 2E2JJ 3LP2A 3PLAA 5BPNA 1GVJA 2XHBA 4DTUA 4PHTX 2W1OA 4UQGA 1ZRFA 4BQAA 3A0HC 4C8KA 4U88A 3CCYA 3RZOJ 4Y7NJ 1J5YA 4HBLA 2P5KA 4A5BA 4MTDA 3JRBA 4YDUC 1L3SA 3E1YA 2M5WA 1G3WA 4Z0UA 1IN8A 2D0BA 3QEWA 4XM3A 4ZC3A 3JCUC 2YJFA 4RM2A 3WE3A 2PX9A 4FVMA 2RNGA 2PBDA 2DT5A 2LLKA 5H6RA 4FJXA 1P7IA 3AVGA 1W7PD 4LY7A 3U9ZA 2X51A 4HTLA 4AHVA 5ILSA 4JP0A 2RN2A 4HF1A 3RCOA 1A04A 4GRIA 2ME6A 1BN5A 4DR1K 3K9KA 4O0IA 4MHGA 3HEFA 1DQUA 4NC8A 1EQYA 4GYIA 1B9NA 2HHVA 2HFHA 3BY5A 2G8IA 3K5NA 3DXKA 3CDIA 3R60A 3SQ1A 4G6DA 4DFPA 2UU9K 2IS4A 1VK0A 3VEVA 3ZN0A 3OW2M 3LSGA 3G3ZA 4DB3A 1NOYA 4DZJA 2P9IB 4M42A 2DA5A 3ZETA 3K5MA 3CFOA 1YJWN 4DTSA 4E1JA 3RKQA 2P9NA 3O3KA 3C7NB 1X58A 1SFXA 1ZKGA 5C4XJ 4CFBA 3KP4A 1RDCA 3HO1A 3LSHA 2LRDA 1JI8A 3AO1A 1FMWA 2E1MC 4GDFA 3NH1A 2DMUA 1MNMC 4CECA 1W5CC 4EEFG 3PFIA 4ETSA 4OIOF 2O8EA 2V6CA 3SEZA 1BL0A 3LWLA 3T5XA 4ABZA 2QLZA 4XSZF 4V2GA 3C95A 1IRZA 3V9WA 3H0GJ 5M1FA 2OPRA 4OPJA 4YRVA 2CU7A 3VTIA 4HZFA 3TABA 3KK2A 1LAVA 2I5JA 1FJLA 2FA5A 1U5TC 1YITN 1D8JA 2DOFA 2KFZA 3EY1A 3GFJA 5E26A 1A6IA 4RM3A 1H1VA 3S8PA 4CO8A 4F92B 5CVJA 5BPLA 3FWEA 1UMQA 1W0HA 5J2QA 3BDPA 1CQTA 1HYVA 1HRHA 3P7NA 3GZ5A 3RKXA 1RIOH 3K10A 3RQIA 5JMVA 3K1MA 2E1CA 2DA4A 4YFUA 1WSUA 2Q97A 2LTPA 1N75A 2KP6A 2XSDC 3TKYA 2KRCA 4BQNA 1JXSA 2LYCA 4RAZA 4F55A 1KZHA 3F9KA 3IWZA 3IUCA 1XC3A 3CCUI 2GXGA 4U0WA 2ZGZA 2VGMA 2YHBA 3HBTA 2YKMA 3OWTA 1XC9A 2JPBA 4M73A 1NH3A 5AR0A 4FPBA 4RDUA 2WBMA 4LB5A 5EZHA 2YHWA 3L2UA 2DAOA 1OCOH 1KU7A 5KI6A 3MWMA 5M5XJ 3D2EA 3JRIA 1SMYF 5E1XA 2EJRA 2GA2A 3ULEB 1XMOK 4PKIA 1DGRM 2QA4N 3DXMB 2LVSA 1TW3A 4GV3A 4H0XB 3JS6A 2K9SA 2ZKZA 2QZ8A 4KAZA 2ISYA 4OMYA 3LSPA 5HLTA 3F5TA 5FB2A 4H0YB 2AA4A 1JCEA 3F2KA 2VQHA 3ZQQA 1VQ6N 5ADXH 1NGAA 3CG7A 5AZIA 3NAUA 1D5VA 3MN6A 2OF7A 3E7LA 5CZ2A 2HHHK 2GM4A 1XWLA 2V26A 1BC8C 2OJED 4EJOA 3L2QA 3WQUA 4KYWA 4MDAA 1ESVA 5D4RA 4KMUX 1FMVA 3GUDA 2AJQA 4E7IA 2DU9A 2UUCK 4PFOA 4KFCA 1XGNA 4YG2F 3EKSA 3LDNA 2LK2A 3M1CA 1IGNA 3HBLA 3KLNA 2QWLA 4JKEA 2WTUA 2A07F 5IP7J 2FOWA 4E19A 1H89C 1ETYA 4XLHA 4JAXA 2E1MB 3HZJA 3C7JA 2VC1A 2HHXA 3QODA 4MEXF 1OYIA 2DJNA 3S3MA 4CIGA 1W7PB 3DWLE 3TSUA 1DPUA 3ALYA 5HRRA 2ZB9A 2JTVA 5AZJB 2PFUA 4XH1A 4DIQA 3BG3A 3H08A 4KHSA 1QHGA 1FOYA 3MN5A 1WI3A 3LPTA 4NDLA 3J80Z 3AVLA 4HPQA 4LD0A 1C1AA 4L0YB 1SKSA 2W6LA 4DCHA 3O6BB 3QYEA 3Q7BA 1IN5A 3AG1H 4DS4A 5A2QO 1J7KA 1YG2A 3NF7A 1VQKN 4RB1A 1Q9YA 3DKXA 4EM2A 2LC2A 1NGFA 2PY5A 4FWOA 1S3XA 3I8BA 4FLXA 2K9MA 1BCOA 4BRAA 1WNSA 1ZLJA 2D1VA 5I3UA 5E8GA 3MK6A 4ZDLA 3AKZA 5HL7L 1ZELA 3U21A 2NLXA 2Z99A 2JUCA 2XB0X 2G7UA 3AV9A 2KQRA 3KE2A 3QEVA 1L3LA 1ZGAA 1G3YA 5F0XA 5GP9A 2H1LA 3O4QA 1IUFA 1HPMA 5KK1A 2GOMA 2VG7A 1TWGJ 2DFIA 4PGGA 1GLAG 4G12A 3I64A 3K5LA 4XRMA 3OL3A 4B1YB 2E20A 4FETA 4W97A 2JRTA 3I71A 5BREA 2X6NA 1HQCA 4BHBA 3OYCA 1KGSA 1R00A 2WAEA 2PN6A 3O80A 1T6DA 3SZTA 4WXDA 2IC3A 1G3TA 3GL1A 3S9HA 3AVKA 3ZT4A 4YHHK 2FBHA 3EETA 3O8MA 3AVMA 4M3ZA 1OCPA 5AQOA 5E20A 1G4DA 2IIRA 1SAZA 1FEXA 3DF8A 3ZT3A 4OGCA 3PSIA 2HF3A 1QQIA 2IXSA 1SFEA 4BR4A 1Q9XA 1FYKA 4HDUA 2CW0F 2WB1A 3SYTA 1BI1A 3QYBA 2W6KA 1JL2A 4BGAA 3HSEA 1PDNC 1YIOA 1YAGA 1MH4A 4W5NA 1LVAA 5JHFA 2L9RA 3ECHA 4JKBA 3S2HJ 1MKMA 2KFDA 3KYCB 4GCVA 2ZXHA 3IUOA 4IZ9A 1RR7A 3HI0A 4YY3K 3F8MA 5LFAA 4L8RB 2WADA 5IT3A 3BG6A 2K86A 4B8XA 5ERIA 2VJ4A 4M9XA 1EA3A 5FLXO 5F6FA 3WXKA 2R7UA 5J6XA 3BG5A 1W1WE 3CM5A 1ITYA 2VQCA 2PZSA 3CMAI 2J5PA 3C65A 4OJRA 1O4XA 4L18B 4H8KA 5HS8A 4IG3A 3K59A 3F8NA 5CLSA 3OMYA 3OIOA 5DTDA 3HM5A 2JA7J 3VQQA 5TJJA 3H1QA 2IVMA 1Y8RB 3GG4A 3GTQJ 4B8AB 4B3TK 3NWSA 5ICEA 1WN7A 2X74A 3ZSOA 2M8GX 3DPLC 3IMXA 2IGNA 4AD9A 1YI2I 2QXFA 5LEKA 3C6AA 1XCVA 4CJSA 4JYAK 1J53A 2HTJA 4H5VA 4XORA 5FPMA 2A5WA 1YF5L 2M2EA 5LBQA 3G73A 4AIDA 1Q86O 1H8AC 3CCRN 1Z7LA 3BOQA 5M3MJ 3OS1A 2IAJA 2OANA 3R1XA 3AL0B 2HXOA 5KCMA 3J7AP 1DKGD 3NRVA 4OVLA 3AGKA 4KN7X 4BE2A 1D5YA 2A68F 1DP3A 3V9XA 3KD5E 1JUSA 2F48A 3B6CA 1K78A 5BR9A 1HYSA 1J75A 4ON0A 1QVGM 4A6EA 4CF1A 1UJ8A 1E0EA 4B44A 1D4XA 4BXXJ 5AQNA 1TKZA 4M3UA 2W48A 2XF7A 1KSPA 4N76A 2Z2SB 3HOUJ 1X9MA 2P9PB 1NM1A 2NRWA 2VUMJ 2VE9A 3LSKA 2CV1A 4CHPA 2H6BA 1YVNA 3M8EA 3GEZA 2IS3A 4FK4A 1V4SA 4IHTA 3ZQ7A 1EJ9A 1NNEA 2F5FA 1RT7A 2LY1A 3IRXA 3D2FA 4CBWA 4ZHRA 4MQ3A 5H6QA 2HBMA 3DLGA 3L3UA 3SCXA 3HM8A 3HOTA 2HMIA 3UR3C 1MU2A 4M3YA 1CF7B 4OPHA 3O9UA 4KRFA 3LDQA 3M8SA 2YHXA 1SKWA 3C18A 3WNHA 3ZQLA 3I59B 2VL8A 1MWMA 4O0JA 1Q7YO 1HKTA 3EYIA 2A6TA 1EKEA 1WSGA 3UKRB 3OOPA 1XS9A 2DTZA 3HIFA 4E7SA 1FLIA 3DU6A 3ZEUA 5HBMA 3FXQA 4G6QA 3L0QA 2LKSA 4PQUA 4CA0A 1S7EA 1TZLA 4FJJA 5EU7A 1IW7F 3MZYA 2KRHA 4DOZA 5CKTA 3CQXA 3M3YJ 2JQ7A 5A2QK 4C30A 2X48A 5FKLA 1TKTA 3KZZA 1GVDA 1SAXA 4M9ZA 5LL6Z 4ELTA 1X1CA 2JGUA 2K3PA 4DYQA 3CHWA 3T1AA 2KMUA 4F8RA 3SUOA 2Y0MA 4IL6C 4QTRA 1H0MA 2P7VB 4DS5A 2E2HJ 2COBA 1XSDA 1IDZA 3J7AO 4LGWA 1C0WA 2YU3A 4RLFA 5HDGA 1OR7A 5CYMA 3MECA 5JLHA 4FJ7A 1TWCJ 3MN7A 2O61A 1Q1HA 4IOCF 1E3OC 3U2RA 5ICCA 2IOCA 1IRGA 2G7HA 3O2PE 5EG0B 1RESA 1FT9A 1TK0A 1R71A 3GOIA 3GTLJ 1C0FA 3O4WA 3CQYA 1PP7U 5EZGA 4FWNA 4UNOA 1S9GA 4EZ6A 3CF5F 2MSYA 4BG8A 4BRGA 2R93J 3T1HK 3Q0UA 4CCMA 1E3HA 4A5MA 2KIQA 4BYYA 2OPPA 4MQ9F 2P9KA 1MBGA 3FK6A 3CCUN 1I50J 2W84A 2HEOA 2G8HA 3TAFA 4JX4A 1FZPB 1T33A 3MX5A 3SMSA 5JS2A 2Y1JA 3CC7I 5C0YA 2M0CA 3ASMA 4LLNA 5LMUK 2VG6A 4IG0A 1YVUA 5C24A 1R36A 1S72I 3E97A 3DRSA 4XL9A 3EO3A 4CHUA 2Q2RA 2IA1A 3PFYA 2V1DA 2OZUA 1WUAA 5AFUH 3E3VA 4YFNF 4JBAA 4HNTA 2LF7A 1BA5A 2VG5A 2ITMA 2OZ6A 1HNZK 2AXTC 2R5ZB 2BE5F 2V1UA 4IDKA 4Z4CA 4M63C 3A5OC 5F2RA 3ZSRA 2RKHA 2Z3YA 3K9JA 2HZDA 1P7JA 3SPZA 3CJNA 4BDPA 4H0VB 4FJNA 2Q31A 4GY2B 4CGGA 2P5GA 3EYZA 1BL3A 3CC4N 4H5TA 3HXMA 4KREA 4HDVA 2KZGA 2CH6A 2EA4A 5IOZA 2ESNA 5HLIA 1WHUA 3BCAA 5FLXK 4QPOA 4B43A 1WZ2A 4FWKA 2RGVA 1IXCA 3VQ5A 1FBUA 4CJVA 1L0OC 1YE9A 2K4JA 4JQFA 3ZSXA 3V6DA 3P1GA 2HQRA 1YS6A 1IZ1A 1T56A 5LD2C 1IG9A 5D5WB 4FTHA 1YUWA 2HQNA 2Z1JA 4B3SK 2VI6A 3CCQN 2ASPA 3I53A 3G4SN 5D5VB 4FK2A 1EO1A 4NCAA 2O4IA 2QWWA 3WGHA 5KPTA 3CIPA 1S3JA 3HP6A 3K4KA 3NF9A 2XY6A 4Q0BA 3QPHA 4K25A 4BRCA 4FLTA 1J59A 5HLFA 1P2FA 3CJCA 3LDSA 2IW5A 5GIOA 4DSIA 4U0VA 1NKBA 4HHTA 1Y6IA 3OS0A 5DCFA 3CETA 2KZZA 2J5OA 3LP3A 3CCEN 1E2XA 1YW8A 4A69C 2O8CB 4II3A 1ZGWA 1VQ7I 1MIJA 1V5EA 4F3QA 2ID3A 4F52A 3VOEA 2K9QA 4AWXB 4K0KK 4KHUA 3MEEA 1TK8A 1VSIA 2OCEA 2L9SA 3BF3A 3CJQB 2BW3A 4L0ZB 2JWKA 4U7DA 1VSFA 3NGIA 5M3FJ 3O8GA 3FZVA 2X1CA 3F72A 2F9WA 1LFBA 1I39A 3V9UA 1NJZA 2RREA 1WSHA 3OYNA 2P5OA 1AA7A 3TANA 2E7XA 2WV1A 2GXBA 1RTHA 1BA0A 4DV4K 2Y0SN 3VQEA 3PIPF 3OA9A 4L5EA 3WODF 3VQ7A 2EPFA 4FLVA 2E1OA 3V1OA 4LIVA 4Y1CA 2E2OA 4WF2A 1VRUA 5LHHA 3QO9A 4RA2A 3P39A 4AM3A 5FD5A 3HZ6A 4KH4A 4JI2K 4HYEA 4FLUA 2LY2A 4HSTA 2HR3A 1RBTA 3D0SA 3TP3A 3VF6A 2ZSHB 5DUIA 4DR6K 3AA3A 5H1SQ 3U3GA 1A35A 3QAHA 2EILH 3A0IX 1ASVA 5KGXA 1FOKA 5K14A 1RBRA 3FFIA 4DR3K 3SNNA 4CD3A 2KRFA 3JRGA 2WFBA 4FWMA 1NJWA 3ZSQA 4M3EA 3VN5A 1RETA 2NRHA 4EZ9A 2Y69H 3WTSC 3E01A 4ELVA 3S17J 2DQLA 1RFQA 4CK3A 1TUYA 1QQMA 4QIWN 3RR7A 3TTFA 5GAEJ 1OCTC 1SQKA
chains in the Genus database with same CATH topology
4KHQA 3O3GA 4KB1A 3K5MA 2G8KA 3L2WA 4JRPA 1X9SA 3PX4A 3CFOA 3ISNC 3KLIA 4DTSA 4I7FA 3RR8A 2VG7A 1HJRA 2YKNA 3NDKA 4CEAA 1D9DA 3K5LA 2R7YA 2KTQA 2X6SA 3QETA 2IOCA 1Z26A 4FJGA 4N41A 4FLZA 3LAMA 2Z1HA 4CFBA 1IKWA 1LWCA 3HSTB 1RDCA 1C0TA 1ZBFA 1LWEA 3AO3A 3ZSVA 4KHNA 3AO1A 4CJ3A 4BDZA 2RKIA 2QKBA 3HO1A 2X6NA 4E7HA 3LALA 1TK0A 3OYCA 4K8ZA 3QIOA