2DFEA

Crystal structure of tk-rnase hii(1-200)-c
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
209
structure length
209
Chain Sequence
MKIAGIDEAGRGPVIGPMVIAAVVVDENSLPKLEELKVRDSKKLTPKRREKLFNEILGVLDDYVILELPPDVIGSREGTLNEFEVENFAKALNSLKVKPDVIYADAADVDEERFARELGERLNFEAEVVAKHKADDIFPVVSAASILAKVTRDRAVEKLKEEYGEIGSGYPSDPRTRAFLENYYREHGEFPPIVRKGWKTTQDMINKST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational contagion in a protein: Structural properties of a chameleon sequence
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
molecule keywords Ribonuclease HII
total genus 69
structure length 209
sequence length 209
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 2dfeA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2dfeA01
3E01A 1TV6A 2HNZA 1YT3A 5JS2A 1RILA 3NGZA 1BI4A 4C8LA 2G8HA 1K6YA 1IH7A 4ELVA 4DSEA 2NUBA 1RBTA 4FJ5A 1FKOA 3CQ8A 3PO4A 3V1RA 1L5UA 4FYDA 2ZQBA 4GVMA 1VRUA 4DTUA 5CY4A 2HNYA 3I8DA 4CIFA 1EX4A 1SV5A 2JLEA 4KAZA 4CEBA 3OYMA 3V9UA 3BDPA 1WSFA 2R7YA 1CZBA 1U49A 4DSKA 3ZSXA 3I0SA 3AA4A 4RW9A 4CF1A 3VQCA 1BIZA 4AHVA 3QEWA 4CF0A 1RT4A 5D3GA 4OLAA 3OS2A 4LY7A 1HNIA 3U6FA 5FRNA 2YKMA 1BHLA 1REVA 4OGCA 4FJJA 3NH2A 4FCYA 3L2VA 1KVAA 3VQ6A 1SKSA 4KHSA 3O4NA 3VA3A 1IKXA 3S3MA 4CGIA 4CGGA 1TKZA 3SUNA 1EP4A 3ZSYA 3PV8A 1D5AA 4CEFA 2HNDA 4FLXA 4BE1A 4N47A 1LV5A 2KQ2A 4OVLA 2ZD1A 4DFPA 3PX0A 1DTTA 4HTUA 4EZ6A 4W5TA 2Z1HA 2ZE2A 3AVAA 1L3VA 4O5BA 1UOCA 3LZIA 1D9DA 4AHRA 5J1EA 4FLUA 4Q0BA 4DFMA 1JL2A 3LAMA 3RMBA 1MU2A 1DLOA 3HXMA 3DLBA 1LW0A 4DQIA 4PQUA 1JLQA 3O4QA 3QESA 3SUQA 4DMNA 5HRPA 3UIQA 3LDSA 1RTDA 2YNGA 3VQDA 1TAQA 4JRQA 3QINA 1F21A 4M3ZA 4B8CA 4DS4A 3O3HA 1S1TA 2Q3SA 1RTHA 5EU7A 3U3YA 4O0IA 3HYFA 3KLEA 2B6AA 4CEAA 1L3SA 1J9AA 3VQ4A 2G8FA 5K14A 3VQ9A 2XRIA 3DYAA 1NKCA 3WNEA 3AVBA 3G10A 4KKOA 1Q8IA 4IG0A 3HO1A 1RCHA 2LSNA 1X9MA 1BGXT 1CXUA 1VSMA 2OZMA 4FJKA 2F96A 1S6QA 3VQ8A 1N6QA 3KLGA 3NCIA 1ASVA 3QIOA 3NH0A 4KPYA 4HVJA 1C0MA 2IS3A 3EYZA 3AVHA 1UAXA 1BQNA 3OS0A 2OYQA 1ZBHA 3V4IA 2E6LA 5I3UA 1ZYQA 4M45A 3SV3A 1TK5A 4KTZA 4CJKA 1ASUA 2O4GA 4W5QA 1HPZA 3WNFA 3SV4A 3KD5E 4KI6A 4BACA 4M3TA 3LANA 1RDDA 4ID1A 4JRPA 1J54A 3LPTA 1IKYA 2Z1IA 3RR7A 4Y1DA 1TAUA 3HP9A 4E89A 1VSEA 2XY5A 1D8YA 3IAYA 4KRFA 1JLCA 3RMDA 4CJPA 4KI4A 1WN7A 3NAEA 3QERA 1ASWA 2O4IA 4R5PA 4UQGA 1TK8A 4QAGA 3P5JA 1VSIA 2VWJA 1JXBA 3MEGA 1T7PA 3LP2A 1EETA 4B8AB 4DS5A 3AA2A 1L3TA 4N41A 1RT7A 4IBNA 1G15A 4DLGA 3P83D 3ISNC 2EX3A 1NOYA 4B9SA 4Z4HA 4DG1A 2G8IA 3QEVA 3TAGA 3VQAA 1BQMA 4CHYA 3OYIA 2QXFA 3G0ZA 3AO4A 3HVTA 3MXJA 3RRGA 2B4JA 3LP0A 2DFEA 4OKEA 4OGEA 4JS4A 1FK9A 4J2AA 4PUOA 1XWLA 1JLFA 3OJSA 3A2FA 3CG7A 4MFBA 4YFUA 4E7IA 4B9UA 4L8RB 4Z4EA 4LH5A 4EP5A 2RF2A 3DRSA 4BWMA 3NE6A 3F73A 3LZJA 3H08A 1NK8A 1TGOA 4FJXA 3WNHA 1U48A 1B9DA 3NF6A 3TANA 4I2PA 3LALA 1D9FA 1WLJA 2WONA 5DK5A 4CK1A 1TL3A 3AVNA 4CK3A 4M3UA 3T1AA 5HLFA 3KK1A 3SZ2A 3TAPA 5FROA 4DFJA 3TAEA 3ZT0A 3SJJA 3KK3A 1LWEA 4FJ7A 3L2UA 3ZSZA 4ID5A 4Y1CA 2YNHA 1C1CA 3NDKA 2ATQA 3K5OA 4CESA 5C25A 1KVCA 3TARA 1ZBUA 3AVIA 1KTQA 4ZTFA 4FM0A 2OA8A 2HHUA 5KTQA 1NJZA 4F8RA 4CJRA 2HVIA 1LW2A 2F8SA 1WSJA 1RDBA 4RW4A 4ELUA 1RDAA 3ZT1A 4CHOA 3V9XA 1QSSA 4KB1A 1WNSA 1TK0A 4DSJA 4CE9A 4TSXA 4CGJA 4DTXA 3O3FA 1RT3A 3OJUA 4DLEA 4Z4GA 1ZBFA 1HQUA 1WSEA 1I3AA 2JGUA 1S1VA 3VN5A 4LD0A 2KZZA 4DTPA 1KVBA 1VSJA 3S3NA 4B9NA 2RKIA 2OPQA 5KI6A 5KRTA 4KTQA 4FJ9A 1QSYA 4EP4A 2RN2A 1VRTA 3L3UA 1NK7A 3M8RA 3RMCA 2HHXA 2P51A 3SCXA 2OPPA 3T19A 4AH9A 3OYCA 4CJVA 3V9WA 2Y1JA 4FJ8A 2QKBA 1TL1A 2KFNA 3CM6A 5JS1A 1RDCA 1C1BA 1KFDA 2YKNA 3PO5A 1TKXA 4O55A 3EZ5A 2VG5A 1LAWA 4HUEA 3OYHA 4FLVA 3RMAA 3AO3A 1U47A 3KLFA 2KTQA 2YHBA 4DQSA 4DTSA 4AILC 4KHUA 4QCLA 3D0PA 3M8QA 4CIGA 2GV9A 4E3SA 3TAFA 5C24A 1Q9YA 4JS5A 1KFSA 4F2RA 2FC0A 1EKEA 4B08A 2VWKA 3C95A 1RBVA 4CFDA 4CJ4A 1JXEA 3QEPA 4ICLA 4DSFA 1X9WA 4B9VA 4B9MA 4Z4FA 4CF8A 4GW6A 3L2QA 1C0TA 3MEDA 4O4GA 3OYFA 1XHZA 4M3YA 3ZT2A 1JKHA 5SZTA 2OPRA 1S1WA 3PX4A 2BDPA 2Z1GA 2BE2A 4KB0A 2QKKA 3HJFA 1S9EA 4M3RA 3ITHA 4AHCA 1NK4A 1R0AA 4F3OA 4H8KA 3CFRA 3AV9A 4CFAA 4DTRA 4DQPA 4M42A 4OLBA 2KZMA 3ZSVA 3T3FA 3DOLA 4BE0A 4IDKA 1TVRA 1EXQA 3SQ0A 3CFOA 2YNIA 4FK2A 1BL3A 1O1WA 1RT1A 5HRRA 3OYJA 3L2RA 1NK5A 4DWIA 3BGRA 3K5MA 4CF9A 4CJTA 2VG6A 4I7FA 3TWHA 4E7KA 4DQRA 2YNFA 3AA5X 2GBZA 4FLWA 2IC3A 5HROA 2G8UA 3LWMA 2KW4A 4YNQA 2G8VA 2OPSA 3AA3A 1KSPA 1Z25A 2IAJA 3TR8A 1UA0A 4NYFA 4FJHA 4FZYA 4CJQA 4CJFA 4HCCA 4IFVA 3QEXA 2DFHA 4E19A 1SKWA 4G1QA 1HNVA 3ZSRA 4FJGA 3KLHA 3SQ1A 2HVHA 4KTWA 1Y97A 1JL1A 4O44A 1CLQA 4DQQA 1XC9A 3OYKA 5HBMA 4OKKA 1HYVA 2E4LA 3IRXA 4DTJA 4ZTJA 1Q9XA 1C0UA 3K58A 1LWCA 1GOCA 3AO2A 3QEIA 4CJSA 4CJWA 4DSLA 3QLHA 1RBRA 2P1JA 3DI6A 1HRHA 2KFZA 1VSDA 5J2MA 1JLGA 3VA0A 1VK0A 1FXXA 3NF8A 4FXDA 4F4KA 4CHNA 4F3TA 2HHSA 2WOMA 3MECA 2D0BA 4BDYA 1HYZA 4NCAA 1LAVA 2Y1IA 3OYEA 3TAMA 4HCBA 4OJRA 4FM1A 3AVLA 5C42A 3AVKA 3HL8A 4CHPA 3S3OA 1T8EA 4W5RA 2P5OA 4J2DA 4Z0UA 1BCMA 3TAQA 2HW3A 2FBXA 5T7BA 3P1GA 2RPIA 3IG1A 3DRRA 3JYTA 1WSHA 1S5JA 1S9GA 1NKBA 2FBTA 3SPYA 4GMJB 3K5NA 4DTNA 3L2WA 4I9QA 2A1SA 3RRHA 4M3XA 1IKWA 4E1NA 1TKTA 3DLHA 4DTOA 4CEQA 2IOCA 1N5YA 2XO7A 1S1UA 4CGHA 3HP6A 4IG3A 4OKJA 3ULDA 3IS9A 3NFAA 4E7HA 1RTJA 4I9LA 4NCGA 4CIEA 4CEDA 4C8MA 3AO1A 5HP1A 1BISA 3WNGA 2HHVA 1UWBA 3HPGA 1KLMA 3AVFA 3OYDA 3V9SA 3OYBA 3OYAA 4DF8A 3MXIA 3S9HA 3OY9A 3NF9A 3CYMA 4Q5VA 3RTVA 4F2SA 3NF7A 1QSLA 4MQ3A 3THVA 1W9HA 1QQCA 4IFYA 3OYNA 4J2EA 3I0RA 3VQQA 4FJLA 4KHNA 2A1RA 5KGXA 4WE1A 1T03A 3LP1A 1SKRA 3OYGA 4LSNA 4DU3A 4FZZA 1NJXA 3VQ5A 1IG9A 4DFKA 2DTUA 4E7LA 1C1AA 3LWLA 4AHUA 3KLIA 2HB5A 2I5JA 3KKSA 1KLNA 2D0AA 1NJWA 4CEOA 3ALYA 4CERA 3PY8A 4E0DA 1YVUA 4H4OA 1QE1A 4CJEA 4CK2A 4OPKA 1KCFA 1WSGA 5SWMA 1ITGA 1U4BA 1I39A 3PUFA 3SNNA 2PZSA 2VG7A 4FM2A 1X9SA 2BANA 2FBVA 3QO9A 3V1OA 1WSIA 4M41A 5FDLA 3K5LA 4KHWA 4KV8A 1RT2A 4K8ZA 4Z4IA 1J53A 3LAKA 3LP3A 4B9TA 1YTUA 4CGDA 1B9FA 2F8TA 3TABA 1GOAA 4FLYA 3AVMA 4E1MA 1RBSA 5J2PA 2QK9A 4CHQA 1VSLA 3KKRA 1S6PA 1RTIA 3OVNA 3NH1A 3JSMA 1KRPA 2ETJA 3KD1E 3V9ZA 4DU4A 3QNOA 4LSLA 3C6TA 4B3OA 1A5VA 2ITGA 2W42A 4N5SA 3V81A 3KTQA 3NBPA 4DTMA 4KREA 1SL1A 3L8BA 4FVMA 5J2NA 2G8KA 3QIPA 3AVCA 4CJLA 2G8WA 4N76A 1XI1A 4RW8A 1LWFA 2DFFA 3DLGA 4CF2A 2YHAA 4BDZA 4C8KA 3HPOA 1VSKA 4LH4A 3V1QA 3EY1A 3ASMA 4EZ9A 1NKEA 4NYNA 5KGWA 3KIOA 4RW7A 4W5OA 1X1PA 4C8OA 2HHQA 1NK6A 4FJNA 4PWDA 1WAFA 3C6UA 2YV0X 2Z1JA 4DU1A 1FKPA 4C8NA 2XHBA 4N56A 4HHTA 4BDPA 4W5NA 1BIUA 2X6SA 3K57A 3DMJA 1QHTA 2B5JA 4FLZA 4CJUA 1UA1A 1T05A 1J5OA 5HRSA 3SYZA 3AO5A 3SUPA 1C6VA 3DRPA 3QNNA 1VSHA 3CM5A 2IGIA 5DMRA 4AHTA 3O3GA 4BE2A 1DTQA 4OPJA 4J2BA 2D5RA 2X78A 2FBYA 2HHWA 3ZCMA 2XY7A 1HJRA 4H4MA 3K59A 3VQPA 1XHXA 5CYQA 4FK4A 4FZXC 3L3VA 1VSFA 3HM9A 1JLBA 3U3GA 4XIUA 3ZSQA 2X74A 5FRMA 4HUGA 1SL2A 2OZSA 3DM2A 4KO0A 4DSIA 4CJ3A 1RBUA 3PX6A 3VQEA 3MAQA 4CEZA 3HK2A 4KFBA 3V6DA 2PYLA 3NGIA 1B92A 3KJVA 3VQBA 4FLTA 5CZ1A 3RWUA 3OS1A 4ZHRA 3NHGA 3SQ2A 1CZ9A 4I2QA 4CJ5A 3HPHA 3K2PA 5CZ2A 3SI6A 4NCBA 2HMIA 3RR8A 4CHZA 4AHSA 4O0JA 3FFIA 5KRSA 1W0HA 2XY6A 5J2QA 1SL0A 3NGYA 2XY8A 4RW6A 2DY4A 1HQEA 1IO2A 2PY5A 4FJIA 4FW1A 1NJYA 4CECA 1RT5A 2E6MA 1NK9A 1HMVA 3SUOA 1L3UA 4PY5A 3HSTB 3MEEA 4E7JA 3ZT4A 3ZSWA 4FJMA 3AVJA 3CFPA 3AVGA 2HHTA 4RG8A 4Z4CA 4BWJA 5I42A 1JLAA 1ZBLA 4B9LA 2AJQA 2IDOA 2D0CA 2P5GA 3B6PA 5HRNA 2PYJA 3KK2A 1U45A 3OYLA 1A5WA 1TKDA 4K8XA 3DLRA 4DF4A 3DOKA 2BGGA 3M8PA 3SPZA 1RNHA 4CEEA 4KHYA 1GOBA 4FW2A 1NK0A 3DLKA 3D45A 1HYSA 1BI4B 4JLHA 4IKFA 1ZBIA 2GUIA 5CYMA 3F9KA 1NOZA 1CXQA 3TI0A 4CCHA 4CFBA 4FK0A 1YTAA 4HUFA 3QETA 4KHQA 1IKVA 3VQ7A 4QOZB 3B6OA 1SUQA 1QS4A 3ZT3A 3HVRA 4ELTA 1JLEA 4M3WA 3MXMA 4CFCA 1WAJA 2EHGA 3M8SA 5E41A 2X6NA 4CGFA 1Z26A 1BCOA 1S1XA 4PA1A 3LPUA 1U04A 3HT3A 1QTMA 3ZSOA 1RT6A 3SQ4A 3DLEA 1A5XA 3C94A
chains in the Genus database with same CATH superfamily
3E01A 3FLCO 2V9KA 3FZLA 3H1VX 5BPIA 3CUQC 1W5TA 3I53A 5D5WB 4DNCA 2NUBA 4HV6A 4DSEA 3ZN0A 1GUUA 1JT0A 3LDQA 3ERED 1AKHA 3JXUA 3RKXA 2NRRA 3V1RA 1HKSA 2ZQBA 2XB0X 5JVGL 1VQ7I 5BR8K 2K9SA 2Z9OA 3IWZA 4IQ4A 1YRNA 4CIFA 4FX0A 4L9NA 4PK4A 4AVPA 3I8DA 2O8FA 2FBKA 4JI0K 1MZBA 1BUPA 2GELA 3OR1C 2CQXA 2ZC2A 3Q0WA 1ZHFA 1H88C 1AWCA 3A0BC 5M5XJ 4ZYGA 4PKHA 4DR5K 3AA4A 3J80Z 4RW9A 2DW4A 4FOIA 2W57A 3J7YP 3I64A 5D8KB 2OU2A 2WUSA 3O5BA 4AHVA 2ELKA 4DV1K 4U0VA 5H6QA 3H5AA 4K25A 5BN8A 5IP9J 1XSXA 2DOFA 1HNIA 3M1EA 2BXZA 5GADJ 2X48A 1PYVA 3HXLA 4M3DA 4FCYA 3NH2A 1XX5A 4I09A 3FZKA 3R4KA 3ISPA 1O4XA 2DU9A 4XLEA 3VA3A 1IKXA 1EWQA 3IH4A 2F4MB 4HSTA 3G71I 1LVKA 2KL4A 4IO9L 1EP4A 4DV4K 3PV8A 1TC3C 1YJNI 4N47A 1OKRA 2KQ2A 3RQIA 1KAXA 2NYXA 3PX0A 3RKQA 3ABUA 4W5TA 2DAOA 5JVHL 5C12A 3WEEB 2LOOA 2LKXA 4XLPF 3IKMA 1GLAG 5BOXA 1D9DA 3QPSA 3DEEA 5CLSA 3C6AA 3WTZA 4FLUA 3ZQHA 5KAFC 3GTQJ 4XOTA 1NK3P 3S93A 4ANJA 3I8BA 3RMBA 1KU2A 3G3ZA 1DLOA 2FLOA 1LW0A 1ZXOA 2QWNA 1BWFO 3VFZA 5F1JA 1JLQA 3O4QA 4YOYA 2DJNA 3HOTA 5HRPA 2D1KA 4B1YB 1RTDA 2E5ZA 2YNGA 3VQDA 4RDUA 1F21A 2OJED 1SAUA 3NAUA 3QINA 1N75A 4B8CA 4CZLA 1QNTA 3ZQQA 4LF7K 3H3UA 4DBQA 3C7NB 2NS7A 4KNYA 3HYFA 3GWZA 4LD5A 3V7RA 4I7HA 4BU2A 3KLEA 1YAGA 3W0LA 1MBJA 2F6CA 3QQAA 1QVUA 3GZ6A 3FMSA 3AGRA 4KMUX 3DYAA 4A3IJ 3VQ9A 2IVOA 1Q86O 2GQQA 1Q8IA 1BW5A 5J3LA 4IEIA 5HDGA 2LSNA 4JQFA 2Y9YA 2F8TA 1QHGA 3NQOA 1MD0A 2VBXA 3SMSA 2D4WA 1D3YA 3UKUA 4MTDA 2AHQA 3RRGA 4FQGA 2I8DA 1V3FA 4HVJA 3EYZA 1ZBHA 2XUBA 3OS0A 3P7NA 2W00A 2R7OA 1TK5A 1KU3A 4H0YB 3CCEI 4M9SA 1HPZA 3K0LA 4CGZA 5M5YJ 3ZETA 4WCEL 3A2KA 4KI6A 4EEFG 1FMVA 2UV1A 3K4LA 3KP7A 5KAIC 3WTTC 1RDDA 3R6SA 2M34A 1IKYA 4JRPA 1PDNC 4DV7K 3BR3A 4DQ8A 4E89A 1FLIA 3VYSB 4S0HB 2ZJPL 4RWTA 4XN0A 1JLCA 2VL8A 4CJPA 5LJWA 1HC8A 4YOWA 1VQON 2O6GE 4KI4A 3CUOA 4R5PA 3EE9A 4Z4EA 3F9MA 2MH2A 3MEGA 4KYWA 1EETA 3DPLC 4AYBA 3SAGA 1H8AC 1D8KA 3QFPA 2VCPA 4PKGA 4N41A 4DBRA 2ECBA 3UKUB 3KLOA 2Q1ZB 1G15A 3P83D 4DLGA 2EX3A 4B9SA 2G8IA 2HU9A 3IH3A 3ZMDA 4LLNA 3VQAA 1BQMA 4CHYA 2K9MA 3HVTA 2O8BB 5F0HA 1U2VB 5DV5A 3L00A 3CIPA 4JKGB 3TP3A 3SAFA 1IN4A 4BY1J 1QU3A 1VQ9I 5IYCJ 1FK9A 4JS4A 4AQYK 2O8DA 1D0XA 3SXYA 4YFUA 3MZYA 5AJ3K 1D1CA 3FWEA 4EP5A 1VQ8N 4WFAL 1LDDA 4DYRA 4BWMA 4FOEA 3ULQB 3F73A 4HF2A 3H08A 1MNDA 5K1YA 3WNHA 1B9DA 3VMFB 2YHXA 3CJRB 5LY3A 2GLOA 4CK3A 4M3UA 1GLCG 2GOXB 4O3MA 1YI2I 1WGXA 1BOBA 5C44J 3TAPA 3OL3A 3ZT0A 1LJ9A 2DDAA 4FYDA 3HSCA 2AXLA 1HR0K 1POGA 4ID5A 1U6GA 4YRVA 4CESA 3TARA 1U9NA 3AVIA 1KTQA 1YYVA 3AG2H 4ZYAA 3QRFF 2X6XA 1SFXA 4P55A 4CJRA 5K7FA 5D8LB 1K79A 1VAZA 2L9VA 3TQNA 3PO3J 3A5NC 4CHOA 4KB1A 1FEXA 3ZX2A 3V9XA 3BR2A 4QPOA 1NGFA 4BY9C 1X19A 5AR0A 3WUHA 4FASD 2LP0A 4IOCF 1CZAN 4B1VA 4CGJA 1RT3A 1Z91A 2V7YA 4DTXA 3BJ6A 1BR4A 3I55N 4MQ9F 1I3AA 4BRDA 2WFBA 3BJAA 2KZZA 1VSJA 1TNTA 2EA2A 4F93B 2RKIA 2XV4S 1BC8C 2OPQA 2AA4A 5B1BH 1QSYA 5FFXA 3S16J 4AM6A 4AM7A 3BP8A 1VRTA 3LL7A 3L3UA 1EH7A 3K1NA 3KP5A 3M7GA 3QAHA 3ZSZA 3G6EN 2JRTA 4Q48A 4AVZA 2QKBA 1JJ6C 1XTAA 1GXPA 1EQYA 3JS6A 3WU2C 1CGPA 1TL1A 4CJVA 2Y1JA 1QRYA 2K4JA 3HDDA 1L5UA 2O8CA 2XB5A 1OCTC 1C1BA 1KFDA 1U8BA 1HKBA 3A5MC 2DQRA 2QENA 4O55A 1E2XA 4B09A 1FBQA 5J1YA 5E18F 3PO5A 4J19A 5DD4A 4DV2K 3VEWA 2KRCA 5D5XB 2VQHA 2IS1A 2YHBA 5CHIA 5GTIC 2DA5A 5K5RA 3EKSA 4QCLA 1WPKA 2CW8A 1SFEA 3ESWB 1BA0A 4CIGA 3D0PA 1OR7C 2R92J 1XMKA 1S22A 5C24A 5E79C 5J40A 2FC0A 4CFDA 2E35A 2QBYB 1JXEA 4DV3K 2GIVA 3K4BA 1G2HA 3UKRB 3IMXA 1OH5A 4PDKA 2FF6A 1BIAA 3KP4A 3L2QA 4GW6A 2P8TA 3MEDA 3TGNA 4BHPA 4IJNA 3GZNB 4O4GA 5JHFA 1ONVA 2PJRA 4BEHA 1HLVA 4ENMA 2ETHA 3WQUA 4U88A 4ELVA 1IDYA 2Y0MA 3SDBA 3JCUC 2VWBA 2QKKA 1USSA 2A6TA 2ZCWA 3HOYJ 3CFRA 4DQPA 3K69A 5L3DA 3LWFA 2WC9A 4MIMA 3O9TA 3CPWM 4M6VA 3OSFA 3TTCA 3SFZA 5LMUK 1XGSA 4IDKA 1Y56A 4IPAA 3MFKA 4M9XA 4GCVA 3BLYA 1ZKGA 3BQYA 2K5CA 3JTHA 4RAZA 5LEJA 4XKWA 4KDPA 1P92A 3CFOA 1V5GA 4ZZDA 5LHIA 2GX9A 5HRRA 1GLLO 5C2DA 4CF9A 1WJDA 2VG6A 2PI0A 3WQTA 2A5WA 4CJTA 3TWHA 2L9NA 2M30A 3HBLA 3BWGA 1RRJA 2IC3A 4XMYA 5E8GA 5AQNA 3MAJA 5HROA 2G8UA 4NC8A 1G59A 2J5PA 4YNQA 1Y39A 2G8VA 2L9SA 4XK4A 3JRHA 1Z25A 2IAJA 1ETKA 4CYCA 3DWLA 4NYFA 5ICEA 4BR9A 4ESJA 2VODA 2Y69H 1J9IA 5C4JJ 1DT9A 4HCCA 1MMNA 4G1QA 4FJGA 2XGEA 2VQLA 3LSPA 3D1NI 2XSJC 4LK0F 2H3GX 4MDBA 5GAEP 2X6WA 3F23A 5DD8A 1JL1A 3WTWC 2O61A 1Y97A 4O44A 1YJ9N 1Z67A 4CO8A 1JCEA 4IJAA 4M42A 5IYBJ 4Y52J 3FR0A 2K9LA 1R5HA 1R00A 3K7AJ 4PL8A 1OMIA 3C6HA 3IRXA 2BVLA 1LWCA 2LG4A 1S72I 4CJSA 5LGNA 4CJWA 3VB2A 3V7CA 1T6CA 2P1JA 4DSLA 4HZFA 1VSDA 2IGMA 2ZMEC 3MCZA 4HLYA 3RZDJ 1P4WA 4II3A 4D1QA 1YIJI 1FXXA 1KXPA 5AZJB 3TTDA 2M9HA 3CCRI 2F5EA 1R5GA 4AIDA 3H5RA 3RZOJ 1K8KB 4XH4A 2HHSA 5EG0B 4N0BA 1LAVA 2IS2A 2Q2EA 4XH1A 3J7AP 3GOIA 1QHHD 3AAFA 1FTZA 2E7XA 4MO7A 3D2EB 4BYYA 2JN6A 2CGLA 4W5RA 4LF5K 4ESBA 3JW4A 4CJ7A 1BCMA 3TAQA 2NNNA 3NEUA 2RPIA 3IG1A 3DRRA 1XDUA 4XR6A 3T8RA 2LH9A 2FBTA 3REOA 4CH7A 4GMJB 4PL7A 5IT3A 4DTNA 3D5LA 3MWMA 2P9IA 4M3XA 3IC7A 3ENBA 2HZDA 4II2A 1IKWA 1VQPN 5GAEJ 5DYMA 5C0YA 3QYBA 1HKCA 1TYQA 4BG8A 2VJ5A 2YPRA 1HKQA 5B1AH 2Q31A 1N5YA 1B6AA 1TW3A 2JSCA 1IUYA 2A68F 3ULDA 2XAUA 3E6MA 3RPUD 3K6GA 2O8EA 4HNUA 3GFIA 4WXCA 4A59A 4CD3A 1T33A 2KDZA 3AO1A 2BGCA 1NU0A 4OAYA 2OPTA 2RREA 3CF5F 5HP1A 3RDIA 1G6NA 1ETOA 4C3HJ 1ERDA 2IS4A 4JK9A 2Q8KA 2I10A 3OYAA 4CCKA 3MXIA 2G8FA 5GTHC 4F2SA 3KCCA 1FBUA 2BYVE 4M3GA 2A6HF 4XKVA 3LOCA 4HYEA 1ZRDA 2W24A 3OYNA 4K2EA 3ENHA 3GE1A 2A1RA 4M6XA 3S1MJ 2E2IJ 1SKRA 1IV8A 3OYGA 4LSNA 2E8AA 4EJVA 1TT5B 3PIPF 3MAQA 4FZZA 4W97A 4A6DA 3VQ5A 1IG9A 1R23A 2XKPA 3FF5A 4E7LA 3EO3A 4AHUA 1F4KA 4CCOA 3DTEA 1MSEC 3DXJF 2M7BA 1YIOA 2D0AA 3KKSA 4GKJK 2E1YA 4CZFA 3PY8A 4E0DA 5M1QA 1X1CA 2LBFA 4G6TB 4CJEA 4CK2A 3M3YJ 4OPKA 3W6JB 1ITGA 1NGIA 2CMPA 2OA4A 5C4XJ 1I39A 3PUFA 2VG7A 4EV0A 3L7WA 1P8ZA 2FBVA 3CI5A 3QO9A 2P0WA 4X1EA 1L0OC 4C3JJ 1UB9A 1OCOH 2WV1A 5F27A 3WHBA 1NM1A 5IP6A 1A04A 3HZJA 3LP3A 5HS9A 2TCTA 1B9FA 1F9NA 3B6AA 3TABA 5BNGA 1KAZA 2BTFA 2QZ8A 3O8HA 2NOGA 4NDLA 4A3GJ 1RBSA 3MCAB 3OVNA 1RTIA 3E1YA 2WAQN 4KUMA 3AL0B 3U4LA 5KPRA 3V9ZA 1YHQN 3PO4A 4DQ2A 3KD1E 3ZRGA 3PFYA 2F9WA 3KTQA 3P9CA 2YUSA 4PGHA 2A5YB 4TV7A 1MBEA 3C18A 1G3SA 1T56A 4I02A 4M3EA 3ATVA 1NGCA 4F55A 1H1VA 2VQFK 2YHWA 4JYKA 2DFFA 3DLGA 2YHAA 3HPOA 3HKZN 3LDLA 3V1QA 5KPZA 3ASMA 4HX4A 3EY1A 3EYYA 2KIUA 1KYWA 4HNTA 2DO7A 2L4AA 4PWDA 5AQMA 3C6UA 2ELHA 3THWB 1Z05A 4IVNA 2YV0X 4FTHA 4LF9K 1FKPA 3J81O 4N56A 5EF6A 4OPHA 4W5NA 3K57A 2FXAA 2H1KA 3F5TA 1IG7A 1AA7A 3HRMA 3HM5A 1J5OA 4F7ZA 4OIRF 1C6VA 1ENHA 4UHTA 4MHGA 2K40A 1OKJA 3ZSQA 3E97A 4DIQA 2X78A 2HHWA 4ZYHA 1ETVA 5GIOA 2XY7A 1HJRA 5LRRA 1NGDA 3EN9A 1UFMA 3RCOA 4UY8I 2ZGZA 3MX5A 3K59A 1V4TA 3HGGA 1K73O 3FKJA 1Q81O 2HQNA 3MCPA 1VQLN 2OZSA 3ZLJA 4MEYF 2R0QC 1MDMB 4KO0A 1WHUA 2Z16A 4DSIA 3K9JA 4YDUA 5B3SH 1U2VA 2FOKA 4Y4RA 3SAHA 3LSHA 3PX6A 5F1RA 1UG2A 3F3XA 1B8IA 2BOLA 4IOXA 2VIXA 4HV5A 4CEZA 1B92A 3S2DJ 1T38A 3KJVA 4FLTA 2PYLA 4LGWA 4MFDA 2STWA 1AU7A 2M45A 4BGDA 3H3VK 3SQ2A 3PM1A 3BDDA 4HPQA 5F6FA 3UKGA 2E2OA 2K02A 5CZ2A 2HMIA 2NNWA 2O8BA 2ME6A 2HXOA 2ME0A 3FFIA 2XY6A 2HPIA 4FWKA 3PFIA 3NGYA 2FF4A 1J5YA 3G1MA 4RW6A 2G7HA 2XKOA 2X1DA 3WXKA 3ZQLA 2WTUA 4LMYA 1BR2A 2AQFA 2ZJ2A 5D6EA 4F3QA 3RKWA 4FW1A 4FJIA 1NK9A 1HW1A 3ECOA 5CQGA 1HMVA 4DB3A 4DR2K 1BI3A 3HSTB 1D8JA 3HIFA 3ZSWA 3ZT4A 4FJMA 3AVJA 5ADXA 2MYSA 3GVAA 2HHTA 1EH8A 4B9LA 1LKXA 1VQ7N 4R79A 1N25A 1E3MA 2MA3A 1R58A 3T5XA 2BH1A 5E84A 2P5OA 2XGXA 4OOIA 3TO7A 4K8XA 3MZHA 1BM9A 1Z7LA 2BGGA 1OH6A 2DPUA 4LF6K 1WJ5A 5D4RA 4CZMA 4DR3K 1TNSA 2O03A 3V42A 3KZIC 3DLKA 3ZEUB 1J5EK 5LRSA 2EJRA 2WB1N 2RN7A 3S2WA 1NGHA 3F9KA 2COMA 1CXQA 2BEOA 3E66A 4XONA 1MBFA 3QDKA 1YUWA 2HF4A 3QETA 4AU7A 1QS4A 3HVRA 2QKMB 1FMWA 3P9KA 1JLEA 4C1NI 4M3WA 4PJLA 3H5NA 1SEUA 4ENJA 3PSFA 1VQKI 3VPZA 4RB2C 5E41A 2X6NA 1WH5A 4AYBN 4BRLA 1VQMI 3KHYA 1BCOA 4M7YA 4XRFA 3VPRA 1VQNN 2M87A 2LTPA 2EZIA 5E1ZB 1QGPA 2FXUA 3VGLA 3ZSOA 5LHHA 1T6SA 2J5OA 2CW0F 4LJZF 4CZHA 3C94A 4JI7K 2RQQA 5JS2A 1RILA 3IRQA 2HWVA 1IH7A 3B73A 2EH3A 3COAC 3KK7A 2DMTA 5FKNA 4PJMA 5H2FC 4FJ5A 1FKOA 4B48A 1HQCA 2YSRA 3EL2A 1YI2N 5HDNA 1FJGK 4FE4A 1V5FA 2QWRA 5DDGA 2YJEA 4IDHA 5IP7J 5CY4A 1ZLJA 1YFHA 3Q9SA 4EGZA 1SV5A 2JLEA 4KAZA 4A3LJ 3ZPLA 1A36A 3KETA 2R7YA 1R6RA 1PVEA 1CZBA 3N4MA 2QXLA 3ZSXA 2CV1A 2M4KA 3G2BA 2UXNA 2O7OA 1CF7B 3SBTA 2ISZA 2KIFA 5GPAA 1FJLA 2XPUA 3RQ4A 3S1RJ 1OR7A 2VPLA 3VQCA 1H89C 1QQIA 2E1ZA 4X64K 1Z6TA 1I27A 4LIVA 4I6MA 4CF0A 1RT4A 3THXB 2A3ZA 2X4HA 3UKRA 1FIPA 4OGCA 2UU9K 3VQ6A 1B72B 1SKSA 1GLFO 2NRTA 3O4NA 4BEHB 1DPUA 4KHSA 4HX7A 5EGOA 4KISA 2DMUA 3ZP5A 4JK1X 4IOAF 1D5AA 5TJJA 2HNDA 3SMPA 4CEFA 4FLXA 2GWKA 4BE1A 3G25A 1UHWA 5AIPA 1MIJA 4OVLA 4MLOA 1W2BM 1DTTA 4IHYA 4WQ5A 5AFUH 3BY6A 5AQQA 2Z1HA 4HBLA 5ILVA 2MC4A 4XLCA 4S05A 1M90O 3KP3A 3RTRA 1ULYA 5CVIA 3LSTA 5FLXZ 1X9JA 4CBUA 4DFMA 2KRHA 3J7YJ 4NQWA 4F52A 2HTSA 4F4KA 3SJMA 2E36A 4FL9A 2HMPA 4DQIA 3GMEA 4Y17A 4V19K 3DCFA 4AIHA 3TSQA 4DMNA 1JI8A 3QESA 1I50J 2JUGA 3GUDA 4M3ZA 1SVOA 4JAXA 1W5SA 5FO5A 4DS4A 2BBYA 1DEJA 2X9DA 3K4JA 1OVQA 3HBTA 1RTHA 2V1DA 3ZOBA 3SLCA 4DHYA 2V7FA 3A0HC 1YW8A 2IVNA 3U3YA 3THWA 1RNLA 3GG4A 1Q82O 4ZDOA 2VYPA 2DOAA 5GIPA 3JSMA 1Y0UA 1N33K 1YIJN 5J1UA 5KCMA 4IWVA 3K1PA 4IRGA 2DTRA 2NVYJ 2MG4A 2AO9A 3N05A 4DYQA 1X3NA 5K14A 3CLQA 2GOMA 4DKWA 3VEOA 3T1YK 2HKOA 3LDOA 3H36A 4KKOA 4IG0A 4OMZA 3ABMH 2L0KA 1T3VA 4ESFA 1C0WA 1CXUA 5EVZA 3A0IX 2F96A 3HM8A 1SD5A 1FPQA 4H4KC 1E4GT 3KLGA 2XAQA 3BTLA 1ASVA 4BR5A 4EM0B 3NCIA 2PBIA 3RVCA 3KZZA 1DDNA 4FPAA 3AVHA 1BQNA 2FSWA 3D0SA 2OYQA 1Z6RA 3V4IA 3FX3A 2COBA 1HNZK 1VQ9N 4KTZA 3CESA 2A07F 4CJKA 4FWPA 4DR6K 3H0DA 3J81Z 2R7DA 3H35A 1LQ1A 3R8EA 2R5YB 4BACA 5BPNA 3LANA 3KD5E 3I4MJ 3RJPA 4B1ZA 3L6QA 3PNTA 3Q0UA 2EFWA 3WTVC 2NVXJ 2Z1IA 3LPTA 4Y1DA 1TAUA 4GV6A 3HP9A 2UUZA 2EFPA 1TTYA 2XY5A 1D8YA 3IAYA 1QZZA 2M4GA 2DYRH 1OJLA 2KJCA 2OF7A 2W4SA 3A1YA 1BA5A 1ASWA 1WN7A 4YG2F 4UUTA 3VOVA 3J7ZI 4QAGA 2VXZA 2GIZA 3A02A 3BTJA 1HW2A 1XNQK 1GXQA 2D0PA 4OINF 1NGGA 3LP2A 4KMFA 5BMZA 3ELKA 3TW7A 2J4RA 3H0GJ 1RT7A 4IBNA 3QB0A 4BRQA 4ZH4F 2F7TA 3QICA 3TAGA 2QQ8A 5CE3A 2QXFA 2EILH 2R7TA 3G0ZA 2LY9A 3LM2A 2B9SA 2B4JA 2QEXI 2DFEA 2W7NA 3KWGA 2V4JC 4WXHA 3LP0A 4OGEA 1JT6A 3MD2A 1U8RA 1JLFA 3WU0A 1RESA 1DQUA 2DDBA 4CSWA 5A2QK 3H1CA 1K78B 4FWQA 4LH5A 1OVYA 4IO8A 4EFHA 3G71N 3GL1A 2G9WA 2E2QA 3CMEN 4I0AA 4WXDA 3CPEA 2HQRA 5C3EJ 1QZYA 5JHUA 3LALA 2OQGA 1D9FA 2OUMA 4HEA2 5DK5A 4CK1A 1TL3A 3BF3A 2HQ5A 2L02A 4DZJA 1S5LC 1Y6IA 4IHVA 4ISFA 2NRZA 2V1UA 1H9GA 3SZ2A 4DFJA 5HLFA 3IKVA 1HF0A 4I99C 3NDKA 2QQAA 3EETA 3RSEA 2OV7A 2H6CA 4ZTFA 1KVCA 3ZQCA 5D5UB 5AQXA 1OCPA 4FM0A 2OA8A 3R1XA 3ASOH 3OBWA 5AQPA 5KTQA 1NJZA 2UYTA 2ZO4A 4GXOA 1LFUP 2HVIA 4A6EA 3FDYA 4LK1F 3AY9A 3EZWA 3RKYA 1IRGA 3J8AA 4RW4A 3WXJA 2O8CB 1QSSA 4KA4A 1WNSA 1MJ9A 4BJ5C 4RBOA 4HDUA 4PHTX 3BPVA 1X58A 3WGIA 4CA0A 3J81K 1ESVA 2A5XA 2FSKA 4DR1K 4DLEA 1XWLA 3FZHA 3U1DA 1NTCA 1U78A 3C7NA 1WSEA 2DLLA 3VN5A 4HX8A 1S1VA 2JGUA 4LD0A 2VUMJ 1ATNA 4XIDA 3S3NA 1KVBA 4CI6A 4B9NA 1OFCX 3C2GA 5KI6A 3CC4N 1KU9A 3P31A 4RGSA 3S17J 2RN2A 4EP4A 2E1MC 2KLOA 4PUSA 3SHFA 3ZR8X 2P51A 3I56I 2HHXA 1M1EB 2G0EA 1JKPC 5HS8A 4BGAA 4NHJA 2GUPA 3CM6A 5EY4A 5JVTA 3HOZJ 4OX9K 1X1DA 5J8FA 3L0QA 3GW2A 4JBAA 3HOVJ 4ZZLA 1YQAA 5ILSA 2PJRB 2F4VK 4HUEA 1LAWA 4FLVA 1W7AA 2L7ZA 4EM2A 2XGDA 3KLFA 2JVHA 1FOXA 5EJCA 4H0PA 3OJUA 4EJUA 2YI1A 2JK3A 1ZELA 2CW7A 4KHUA 3HOSA 1D1AA 2HS5A 3QU6A 1CQTA 3KEYA 1UMQA 5L3GA 2GV9A 4CCMA 3J7ZO 5AQGA 2M1BA 3UE5A 3PJRA 1KFSA 1MMDA 4QIWN 2ZJRF 1EKEA 4KIBA 4EZ9A 1GVDA 1RBVA 4CJ4A 1X9WA 3BG9A 3HHHA 1U3EM 2JA6J 1YO5C 4L0YB 2HBKA 4B9MA 3C1DA 2DXIA 4OIQF 1YJWN 5F1XA 3BR0A 4QLCU 2ZXIA 4CF8A 3CDIA 5L3FA 1XHZA 1IRFA 1J2XA 5DCMA 1YS6A 2ZFWA 1JKHA 1TW2A 4JI4K 3IDHA 4GV3A 1W36D 2EFQA 3HRUA 3U8XA 1MDMA 1HA8A 2OPRA 2LREA 3HTUA 5LFAA 3BZKA 3FXLA 1S1WA 2BE2A 2QM1A 2Z1GA 1RPWA 4M3RA 4BRIA 4YFKF 4AHCA 1NK4A 3HL2A 1R0AA 2VJIA 1NGEA 3AV9A 4CFAA 2MH9A 4KN4X 1FIAA 2ZJQL 3T3FA 2X1CA 4I6ZA 1W97L 1MGTA 3IKTA 4J2AA 4BE0A 4MLHA 1X4OA 2MD5A 1IF1A 3K2ZA 2B7EA 2P9SA 2E71A 3SJJA 3FHZA 1ZG3A 2JJ7A 4FHTA 1UELB 4JKAA 5C15A 4B9QA 3PLAA 1QQOA 1YG2A 3SQ0A 5ED4A 2HFHA 1OYIA 3WEEA 1SMYF 4FK2A 1NK5A 1RT1A 4DWIA 3DTIA 3K5MA 4E7KA 2LDUA 4I7FA 1TQMA 4ETSA 2RC4A 4GYGA 2QI2A 5AQRA 3E0JB 4P1WA 4FLWA 1W7PD 2JMWA 4G6QA 2XGCA 5FPMA 3ABTA 2V6CA 5F0FA 4IQJA 4M9ZA 4O8UA 3LSRA 1T0FA 3TBIA 3AA3A 3TR8A 3ZQGA 4KBOA 2H8RA 2LR8A 3VEYA 1UAAA 4CJQA 3CCQN 4FZYA 3HRTA 3QEXA 2DFHA 2XPVA 4WK8F 1SKWA 3OL4A 4WQ5C 2VKDA 1EH6A 1G4DA 3NARA 4C9YA 2FF3B 4KITB 2A40A 2E2NA 1S8NA 1CLQA 4NLBA 2Z2SB 1TLHB 4YFNF 4B1XB 3IP4B 5HBMA 2ASMA 1S9HA 4PGGA 1TZLA 2PMUA 2E5LK 2XROA 4N9HA 4F9OA 4B3OA 4EJOA 4ZTJA 3DXMB 4R1HA 2I7PA 1KYZA 1QPMA 2A3SA 3DLLF 3L4IA 2LD5A 2HDCA 2NS0A 1RBRA 4D7MA 2LVSA 3M1FA 1ZYRF 3GXOA 3CMYA 2KJBA 1JLGA 2I7NA 2R7FA 5TKYA 3B8AX 3VA0A 1D4XA 4QS9A 4CHNA 1KC8O 4F3TA 2Z99A 4HQMA 1NNEA 3DKXA 4J8FA 2KKOA 1ETWA 1P7IA 4NCAA 4MQVA 2ZXWH 2W6KA 4CW7B 1DU0A 4CBXA 2O8FB 2HI3A 4FM1A 3ZMSA 1XS9A 1QA6A 2QWOA 1T8EA 2O8EB 1R4MB 4EMSA 4BBSJ 1XNRK 3R9PA 4LB5A 2LRDA 3GBGA 3CDLA 1YTYA 3E3VA 3DWLE 1E3HA 5IY5H 1KD1O 2X51A 1WSHA 5ELZA 3HOWJ 1HJOA 4F92B 1S9GA 1FWZA 4GV9A 5FKOA 3K5NA 1BI1A 4CDGA 4V19S 4UUVA 1FX7A 3A03A 1OYWA 3F8NA 5HLGA 2QSFX 1SC7A 1JE8A 3CMMA 1YITN 3H9JA 4IL6C 2ACJA 3RYRA 5AQHA 4CE9A 1I1SA 3JRFA 4JI6K 2IOCA 2XPWA 4IZZA 3G4SI 1VQNI 3HP6A 4KH6A 2HYFA 2CQNA 1RKWA 2VJ4A 4OKJA 1J6ZA 2MD0A 4E6KG 4YIFA 1IV6A 4BKXA 4E7HA 1R36A 2ZGYA 4I9LA 1NH3A 2D1VA 1EV7A 4BQQA 1KQ0A 3Q9VA 3FGUA 3THXA 3CCLI 5IOZA 2RNGA 1BISA 2PG4A 3AVFA 3V9SA 4I2OA 1XPXA 2KRFA 3QOPA 1B72A 2JA7J 1P90A 4OIOF 3FE1A 3NF9A 4BHBA 3CYMA 3RTVA 1DGRM 1WBBA 1QSLA 5ERIA 1EO1A 3TDUC 5D4SA 1QBJA 4JP0A 1HSTA 2WC2A 3I9V2 4ZDPA 4L18B 4H5TA 2ZNZA 5LGUA 3WXIA 4FLYA 4FJLA 4JD2A 1T03A 3LP1A 2NZTA 1P7JA 2KP6A 3HUGA 3JR9A 2L54A 3E5QA 3W2VA 2N8GA 5J4YA 3HTVA 3JRAA 2DQLA 1IUFA 2DTUA 1C1AA 1GLJO 1ITYA 1YS7A 3EDPA 1L3LA 3KLIA 2HB5A 2EZHA 2O0YA 2PMHA 4XH5A 3WXLA 5IT9Z 1J59A 2KIMA 1GLDG 3ALYA 4H4OA 1PUFA 1JCFA 3SJHA 5HVQC 1VF9A 5AQFA 5F0XA 1X9SA 1NJIO 3V1OA 3ZQFA 4CYCB 3R0AA 5FDLA 4IHTA 2NS8A 4DV5K 1J53A 1SD7A 3FMQA 3QPTA 3CCJI 4CGDA 2IGKA 5HNFA 2HEOA 2M7AA 3MEXA 4JX5A 3W3CA 2XSDC 3OWTA 3HSRA 1GOAA 2VGNA 1B1BA 2EINH 1O57A 3PNYA 3RPUA 3GFLA 3ZN1A 4D9JA 3AVMA 3H6EA 1S6PA 1IN6A 1MNMC 1I5ZA 1LVAA 1UZCA 3HJEA 1RGIA 3M3ZA 3NH1A 3MN7A 2BW3A 1YX5A 2EV0A 5DUIA 1A5VA 2ITGA 3C6TA 3TU5A 3CP8A 2W42A 5E1WA 2WWYA 3NBPA 3S41A 4DTMA 5J2NA 1S3XA 2PN6A 1SL1A 4BBRJ 2CV0A 4CHUA 2G8KA 4CJLA 4RAYA 2HOTA 3WG7H 2WTEA 5EEAA 3BF1A 3N4QA 5K7ZA 3GTGJ 5KGWA 4EM1A 1ZGJA 1HLUA 2HDWA 3CP2A 3I59A 2O8XA 3CC7I 3CF2A 4JI5K 4W5OA 4JI2K 1RETA 3ZQIA 5FLVA 2CH5A 1ZLKA 3LSIA 4KICA 3IV5A 2ZWHA 3CTAA 2EQRA 1BIBA 3D2EA 2XHBA 2R3SA 2PFBA 4O5VA 4U0WA 1BIUA 1N32K 3JAMK 2DPNA 3H9GA 2XC7A 3W6VA 5E26A 2B5JA 5EYRA 1OQYA 3C0BA 1X1BA 3GFMA 4MTEA 4PSXA 5KK1A 3ZMTA 4ABZA 1A31A 2DODA 2QWPA 3SUPA 1RR7A 1FYKA 2L9RA 1VSHA 4BC4A 3BJOA 2HVRA 4BE2A 3CM5A 4JHDB 2GWRA 4DUYK 4OPJA 5K5QA 2FBYA 3THYB 3CCRN 3ZCMA 4P9FA 3CETA 3G1LA 4HDVA 3D5SC 2M2EA 4B1RA 2NXNB 5BQTA 3CCSI 1XHXA 5CYQA 3L3VA 2ZNYA 3HM9A 2QEXN 1JLBA 4FZXC 2X74A 2KQRA 1ORKA 1WCMJ 1KONA 4P9UA 1GT0C 2GEMA 5JLFA 3F8BA 5HNHA 4XRMA 3CMEI 3DU6A 2ZM6K 2LY2A 3GTKJ 3HK2A 3NGIA 2XVCA 2PJPA 4GVEA 3VQBA 4HNVA 3KE2A 5M1OA 3DPTA 2EPFA 3ZCOA 5CVJA 1YHQI 2P7VB 2JUCA 4ZJZA 5TGTA 2DPDA 1CZ9A 4I2QA 4YORA 2GWJA 4BC3A 4A5BA 4O5FA 1FY7A 3PQKA 1LFBA 5FPNA 1FP1D 5K7HA 5J2QA 1SL0A 3KWIA 4BG9A 3NRVA 3PQJA 2XY8A 2CYYA 5HOOA 1ZBSA 4Z94A 2RAEA 2DY4A 4IHSA 3VOEA 2H6BA 2PY5A 2RGVA 1A5JA 1MH3A 2ESNA 4XN3A 4PFOA 3DPUA 4WF2A 1VFCA 3MEEA 1OCRH 4Z6YA 3R6MA 2QWWA 1MBHA 3ENOA 3UB5A 3CFPA 3AVGA 3BG6A 4RG8A 4JK7A 2AJQA 3ZMUA 1ZBLA 2CUZA 1MW7A 2CWEA 3DU5A 3F8CA 1JHFA 5DM6L 2VOPA 3B6PA 5HRNA 2PYJA 4WFNL 1U45A 3MVPA 3VYTB 3CCEN 2UXDK 2VQGA 3OW2M 2R5ZA 1WOQA 3A5LC 3M07A 1SFKA 4LLGF 3TW6A 5J1RA 5EOYA 2Y31A 4QSHA 1I6HJ 3CHWA 1JCGA 2V9VA 3DQVC 2R5ZB 3T7ZA 1HYSA 2LF7A 4JLHA 2GUIA 4DYCA 4A5NA 2JVGA 5CYMA 3ZX3A 1KAYA 1NOZA 2F2EA 4PFPA 4ISGA 3ULEA 4CVNE 1TQPA 2EFNA 1F36A 4UUSA 2FUG2 3DEWA 1SUQA 2CUEA 3VF6A 1XGMA 4M3BA 2K7LA 2HTJA 3SQNA 4L3QA 2CG4A 3UR3C 4AIKA 1ZTRA 2E1NA 1WAJA 3OHRA 1FT9A 2G7UA 4FWLA 3M8SA 4G9ZA 4RAGA 4PA1A 1U04A 2UZKA 2R93J 4WX9A 2GA1A 3AL0C 2F9TA 3CCVN 3DLEA 1GLNA 1A5XA 3ML6A 1O3RA 3S1NJ 1NMNA 2HNZA 5H1SQ 4JKFA 4ON0A 5AIQA 3K9TA 3E5UA 1K6YA 4XL9A 4OPAA 1K9MO 2G8HA 2NLXA 3WTUC 2HZTA 4MFEA 1XC5A 4BY7J 1RBTA 4QTRA 1TP4A 3TKYA 3S8PA 4CYDA 4A93J 1C0GA 4FWOA 1FP2A 4BRHA 2W85A 3BTCA 4A3DJ 3LQQA 3U9DA 1HDDC 3IAS2 1O3SA 1D5YA 3ZETB 4CEBA 1WJAA 2LKPA 2KHOA 1Y64A 1WSFA 2KLAA 3V9UA 3BDPA 2NVTJ 2YR2A 1FBSA 2H1LA 3M4OJ 4B3AA 3RSNA 2WBNA 3O9RA 1U49A 1C0FA 1HNXK 1VNDA 5FFZA 4CZCA 3TP0A 1A35A 3NWSA 3QEWA 4NO7A 5FGMA 3O1BA 5FRNA 2K3FA 4NQWB 4KPYA 1LDJA 3G1OA 2EK5A 4FJJA 2XAFA 2E60A 3JREA 3L2VA 2VI6A 5CR4A 5BR9A 3BG7A 4BRMA 3E1SA 3S3MA 4CGGA 4H5VA 2AQEA 2P9NA 3ZMVA 1GV2A 2CFXA 4OAZA 1TKZA 4RMNA 3ZSYA 2Y0SA 2E2HJ 3GTJJ 1IXRC 1OCZH 2FNPA 2H27A 3I55I 4HRIA 4IFEA 1LV5A 4C23A 4NXNK 1B59A 3VF2A 2VLAA 1ZQ3P 3QWLA 1B9MA 3BOQA 2ZE2A 4OO1J 5AQSA 1L3VA 1JHHA 1UJ8A 4D5FA 1B8IB 4Y7NJ 4EHUA 3LZIA 4A5MA 5J1EA 3X2QH 4Q0BA 2GM4A 2HHHK 2P5VA 5AQLA 2WY8Q 1JL2A 2DFIA 2QTDA 1R22A 1U0JA 1W0UA 1MU2A 2Z1DA 2WAEA 4FISA 3DLBA 4PQUA 1IN5A 1X3UA 4BHCA 3KZBA 2ITMA 3UIQA 3SFIA 4JRQA 4BREA 3DKYA 1S1TA 2P9UA 3O3HA 1O7FA 2FRHA 1XGNA 3JAMZ 3JRBA 3MN6A 1ZREA 1K8KA 2FEZA 3HTSB 3DXKA 3H3ZA 3TSUA 1YJNN 4O0IA 1RDUA 1EF4A 2DMNA 2E1OA 2F4IA 2FMYA 1BC7C 2B6AA 2VBYA 3LA2A 1IRXA 2ZMEB 5EX5A 4CEAA 4DV0K 1U4BA 1D0YA 3QP6A 2Z33A 5IT9K 4IEJA 3WNEA 4JKHA 2EFOA 1H9TA 3HO1A 5EEGA 1RCHA 5BPLA 4UV9A 1BGXT 1K4SA 2OZMA 2F48A 1VTNC 1BO5O 1UG0A 4FJKA 2LMDA 1S6QA 3CUQA 3OIPA 3BR5A 5JMVA 2QUFA 2LY1A 4A0YA 3QIOA 3HEFA 4L9VA 1C0MA 3CJAA 2CU7A 1UAXA 3ZEUA 2E1MB 3CJCA 2XF5A 3Q0VA 2Q97A 1ZYQA 1ZRFA 4OMYA 2ID3A 4C2TA 4JN4A 2MW8A 3QYFA 1DP7P 2GBYA 4EATA 3WNFA 3SV4A 4BR0A 2E7WA 4BRKA 3K70C 4UB8C 2O9LA 1IG8A 2F4OB 3EUHC 2W40A 4XLFA 1IXCA 3NAEA 3GDQA 3RMDA 2QWMA 4KRFA 2O4IA 2A6EF 4Y3OA 4KH5A 2BHYA 4KT6A 5L3EA 1XGOA 1VSIA 2VWJA 1JXBA 1T7PA 3TO9A 2CGPA 1OPCA 3E5XA 4B8AB 1BW6A 2E2JJ 3AA2A 4BVOA 1L3TA 3VODA 3PNVA 1Y8RB 2B63J 4QS7A 1E0EA 4A2UA 3TTFA 4MDAA 3VWBA 4DG1A 2DA1A 4Z4HA 2ISYA 5AQUA 3O4WA 1CF7A 3QEVA 1Q7YO 3MXJA 1K8AO 4IHWA 1TUUA 3O6WA 1EWRA 4E7IA 4B9UA 3A2FA 4MFBA 4ILJA 2K9NA 2LBFB 1WQ2A 4BR7A 2FQ3A 3LZJA 1NK8A 4FJXA 2EWNA 3HRSA 3CJ9A 5ADXH 1G3WA 4I2PA 5FLXK 3OTOK 2WONA 1BI0A 3F72A 4XKCA 4NB4A 5LGTA 3AVNA 3K2AA 3CCMN 5F2RA 4WQ4A 2HBJA 4U0YA 2X6OA 3AKZA 5FROA 3TAEA 3U9ZA 3J80K 4IZ9A 3HOXJ 3KK3A 1R1UA 3L2UA 4FJ7A 2NOJB 2GXAA 4NNJA 1C1CA 2ATQA 1RKTA 3A01B 5C25A 1ZBUA 4PKIA 1IBLK 5EGOB 2HHUA 3DJCA 1UHSA 3TO6A 5IPAA 4Z2YA 1LW2A 2BZTA 2F8SA 4F91B 1LEBA 3S1QJ 1RDBA 4JKCA 1A6QA 4RB3C 1RDAA 3ZT1A 9ANTA 5C2FA 1NHAA 1QZEA 5M1FA 1TK0A 4DSJA 3TSPA 1VZ0A 4FWRA 1U9OA 1W7PB 1ZARA 2GZWA 2FBIA 3IUCA 3T8TA 4PSWA 3LM9A 2DA7A 3LAPA 3GTMJ 4TSXA 3VTHA 4A57A 3O3FA 3BCAA 4C3IJ 4HF1A 2TRTA 1ZBFA 2NAZA 2QGUA 4BAYA 1GLBG 1HQUA 3CQXA 4M7XA 4CZGA 2CV2A 1J7KA 3T1BA 3TOBA 1VQ6I 1YW9A 4E4HA 2UUCK 1ON1A 2OTLN 4KTQA 3C2BA 1BI2A 1Z1DA 2DOEA 1LB2A 1REPC 1N78A 4IOCL 3ID6A 1NK7A 3T69A 2BHZA 2FX0A 1J75A 2OPPA 3OYCA 4PCQA 3T19A 4AH9A 4FETA 4EQQA 5F64A 1RDCA 3I59B 4YOTA 2WA0A 2YKNA 2DCEA 2IEKA 4BQAA 2VASA 1O3QA 1TKXA 2ZB9A 2R7WA 2MBFA 4AC0A 3AO3A 3H45C 1Z3XA 1U47A 2L7KA 3CDHA 2KTQA 3CD6N 4YY3K 2XRNA 4AIJA 2CQQA 3RYPA 3VESA 2DTZA 1PP7U 2KPMA 2ZJRL 4DTSA 2YU3A 1OH8A 4H5RA 3QYEA 2HSTA 4RM3A 5E3OA 4ZC3A 3HOUJ 3M8QA 3SK3A 1S29A 4UNOA 3L8BA 3BCBA 4XRSA 1DUXC 5CVVA 5A2QO 4YOUA 4B08A 3O1WA 3C95A 5F08A 1JUSA 4RA2A 3IL2A 3C65A 4ICLA 5JICA 1S7AA 4BXUA 5KQDA 4DSFA 3CC7N 5GPCA 2RV8A 3K4KA 2VT2A 2QA4N 3CJ7A 4A3MJ 2P7CB 1C0TA 2MC3A 4Z4FA 4B44A 4M3YA 3E9LA 4B8XA 2KZGA 4B3SK 4C8LA 1VHXA 4IXCA 2VC0A 3OIOA 5CQEA 2CUJA 1N8RO 3V8KA 4IHXA 4FK4A 1MMSA 2D1HA 1BOTO 1TYQB 4H0XB 2BDPA 1W4MA 4BVPA 4KB0A 3ITHA 1XUPO 3GO5A 3MKLA 4DTRA 3BZCA 3D7EO 3ZSVA 1B9NA 3ASNH 1YW7A 4DUZK 1N34K 1TVRA 4X0GA 3LA7A 1FW6A 1EXQA 4XLNF 5KQ8A 3V8JA 2O5RA 2DYSH 4XQFA 3JSOA 2YNIA 5J8CA 2XAJA 3OYJA 2IJLA 4PJNA 1S7OA 4R8HA 3JRIA 5FD6A 1HBXG 3BGRA 3D2FB 4FSVA 1I94K 4BC2A 4BRNA 4DQRA 2YNFA 5JLXA 3NVKA 3FXUA 2IVMA 2KISA 4A0XA 2HXIA 4B3RK 2DK5A 1JGSA 5LLQA 3CD6I 1ZK8A 4EJWA 4G94A 1ZC6A 2KW4A 2OPSA 1KSPA 3VEZA 2F5CA 1BOAA 3G73A 4CJFA 2W41A 2CJJA 4IFVA 4BS9A 4E19A 3T0YA 2ELJA 4ISEA 1Y1WJ 3L1PA 1WSUA 2IS6A 2VQEK 3KLHA 3SQ1A 1IJJA 3O2PE 1R9TJ 4LFBK 1TWHJ 2MABA 1IZ1A 3FMRA 3MMYB 4GO1A 1FOWA 3BG5A 4E1JA 3HI0A 3W6KB 1BR1A 1PUEE 4HW0A 4Q4ZF 3L4QA 2IVPA 4ZYDA 2K3PA 1X3ZB 1Z7UA 4RGXA 2TDXA 3I71A 3S2HJ 5DEQA 3SZTA 2E4LA 3RSEB 2UUAK 3K4CA 4FWSA 1C0UA 2OAZA 1WH7A 1YLFA 1GOCA 4YELA 1FSEA 3CCLN 2JA8J 2IGNA 3DI6A 1HRHA 5J2MA 2KIQA 4A3EJ 4DJAA 1DU6A 3JRDA 1ZH5A 2D0BA 2HVQA 1I1GA 1V5EA 4BDYA 3N97A 1STZA 4AM3A 2DT5A 1HYZA 3F8FA 4L5JA 2E2PA 2VGMA 1E17A 4HCBA 5KPTA 1OYYA 2IPQX 3DKWA 5BN9A 5LD2C 3BPXA 3S3OA 3AVKA 4CZJA 3VEVA 4J2DA 1X3WB 2HW3A 2Y48A 3U2RA 5B66C 3IRRA 4CZKA 3JYTA 5B5EC 1S5JA 5LHGA 3CC2I 5BPMA 1NKBA 2FQ4A 3SPYA 3R3LA 2FJ1A 3EUHA 4I9QA 3PL8A 4CZZA 3RRHA 3TMOA 2L3DA 4D7NA 3M9AA 5DM7F 2AS5F 2HVSA 1WRJA 4XSZF 3BT9A 2P81A 3ZXSA 3BG3A 4E1NA 4B3TK 3EEQA 4CEQA 3QBWA 2XO7A 4LFUA 4CZEA 2DJIA 2ASPA 1NGAA 4HOBA 2X1EA 3R61A 3FXJA 4E70A 1JJ8C 4A5AA 3CC2N 4JEPA 5LBQA 2OZUA 2EWSA 3HZ6A 1KGSA 3KZYA 5AQKA 3IHUA 1SD6A 4KV8A 3F0CA 1HKTA 4C8MA 1BU6O 4CEDA 3CJBA 1KQSM 4H0TB 2P9LA 4KH4A 3ABKH 1X3MA 5JVGF 3WNGA 1ZGWA 1UWBA 2HHVA 2Y75A 4GGGA 4A3JJ 1N36K 1U2WA 2DMPA 3OYBA 2VC1A 1FOKA 3I4NJ 2CSOA 4MO5A 4DF8A 1IDZA 3S9HA 2AXTC 3OY9A 4Q5VA 4JI8K 4AUXA 3NF7A 5AQJA 1W9HA 1QQCA 3U9GA 4IFYA 2FA5A 4I76A 1DKGD 3I0RA 2AP1A 4MLEA 2CUFA 2EZLA 2PX9A 5C10A 3S14J 1WJFA 3O6BB 1WJEA 1Y8QB 4IF4A 1RI7A 2FSNA 4DU3A 4GYIA 3WE2A 1NJXA 5J47A 2XAHA 2DT7B 5IT9O 4B3XA 1TL8A 4DFKA 3BZ6A 1R59O 3LWLA 2JPBA 4DR4K 4ASNA 1KLNA 4EAHD 2LKSA 1XMAA 4CEOA 4CERA 2RKHA 3EYIA 2XF6A 1LE8A 4N5SA 1EA3A 2A61A 1KCFA 1S6LA 4N9IA 2YCHA 3N4PA 2VQCA 2EIKH 3CCVI 2FNAA 1IJWC 5B8HA 3SNNA 2PZSA 2JZYA 4JYAK 2E34A 3L09A 3HSEA 2BANA 4M41A 2Q0UA 1RT2A 2BE5F 2OD5A 1ETQA 3FZVA 1YTUA 3LQRA 1W36C 2BXYA 4KJZA 1IN7A 3FIWA 3TDZC 1ZGAA 2YX6A 5K5OA 1JUMA 1WJCA 5J2PA 3AG3H 1MMAA 1VSLA 3H9QA 3K0SA 1QVFM 2MSYA 2W25A 1K4TA 2ETJA 4DU4A 3QNOA 6PAXA 4LSLA 5EG0A 3CMAN 1G8XA 2P9UB 4KREA 4V2FA 3BY5A 5LJVA 3QIPA 1R5ID 2O3FA 3LA3A 4RAFA 5HLHA 4M71A 4N76A 3PUBA 2DI3A 4RW8A 4RLFA 1LDKB 2ZMEA 1LWFA 5AQTA 4BDZA 2E19A 3THYA 4ZYEA 3UNGC 1IW7F 2XF7A 5HS7A 4CBWA 4NYNA 2V51B 2VE8A 1XDSA 1WBDA 3KIOA 4EJTA 4NC7A 2C6YA 1X1PA 2BY2A 4FE7A 3BEXA 4RW7A 1NK6A 2HOAA 1WAFA 1F1ZA 2EIJH 1OCCH 3KP2A 3OIQA 2HR3A 4IRIA 1X2MA 3MWTA 2NRHA 4BDPA 1QQNA 2GAUA 2HGCA 4YDUC 3VEXA 1O3TA 3OV8A 3GZ5A 3LSGA 4WCGA 4CJUA 3KFWX 4DGWB 4S04A 1KA8A 3MDQA 1YITI 4E1MA 2UXCK 2RDPA 3AO5A 2P9KB 3CQYA 5AQYA 1WFXA 4BR4A 3DRPA 4M73A 4BQOA 4LC9B 2QKLB 5IOYA 5FLMJ 3O9QA 5DMRA 1NLVA 2D5RA 3BR6A 5CVRA 4RS8A 2PFUA 4HTLA 3FZFA 4H4MA 3SEZA 4NUBA 5M1PA 1P4XA 1WJBA 2HYGD 3PSIA 4Y33A 4B3MK 5DCFA 2FOWA 5BRDA 2LNBA 4XIUA 4XICA 2UWMA 2QSGX 4JOMA 5FRMA 4JX6A 2CFOA 4B4CA 5HDKA 4Q47A 1RBUA 1TQIA 3LSJA 2HF3A 2UXBK 1BN5A 1B4AA 2HNHA 3CCYA 1XMXA 2BY1A 2X85A 2ZF5O 5DM7L 1Q1VA 5E3MA 3RWUA 4HQEA 3OS1A 3TEDA 2BUPA 3CCUN 3VENA 4DOZA 2W82A 4GFBA 4EHTA 1Z3YA 3JTGA 4FPBA 3M6GA 2KT0A 1ZR2A 2ID6A 2E1CA 1TWCJ 3K2PA 4RCHA 5ICGA 4QS8A 4NCBA 2QK9A 3MQ0A 3MKYB 3ATUA 4BH9A 3VERA 4CHZA 2EA4A 4G7OF 3Q7BA 3I5UA 5CPRB 5TISC 2IAIA 2OBPA 5LEKA 3G4SN 3K4MA 2PQ8A 4PZJA 1AOYA 1RC9A 2BY0A 5M1NA 4UXNA 1NJYA 1RT5A 1MJAA 2VN2A 2IXSA 3AAPA 1YX3A 5GADP 4UVBA 3SUOA 3U21A 3U1KA 4PY5A 2ZXJA 2P5LC 2E5NA 4NBQA 4E7JA 1PJRA 2L01A 2LC2A 4AF1A 5I42A 4BC5A 4BWJA 1JLAA 3TOAA 1KU7A 3FXOA 3PIOL 4QPQA 4Z4IA 1WZ2A 4ENNA 2EB7A 4EGYA 3HUGB 4XM3A 1TWFJ 2D0CA 2FSJA 2VXDA 1RUNA 2QW9A 2JA2A 3KK2A 2HPMA 3CCMI 1LEAA 3BUZB 4BRGA 1TKDA 4DF4A 4H03B 1XB4A 3DOKA 2WAFA 5BPDA 1T08B 1P4AA 3SPZA 1RNHA 4CEEA 1OH7A 1GOBA 2YS9A 2UXXA 3WODF 4FW2A 4KHYA 1NK0A 1APLC 3D45A 1MBKA 4P96A 4FO0A 4WYBA 5LL6Z 4A62A 2X6YA 3QPHA 1VQ4I 5AFUA 1ZBIA 1Y1VJ 1J0RA 3DP7A 3O3KA 3JAMO 1W0TA 4D0PA 3V8LA 4CCHA 4CFBA 3OOUA 4XLHA 4FK0A 4HUFA 3P39A 4KHQA 4QOZB 3VQ7A 4CCLA 2W1OA 3B6OA 4ELTA 1VQLI 1ZR4A 4KIFA 3ZT3A 1UHMA 2W84A 1QVTA 3MXMA 4JI3K 2KZVA 2V1NA 3LNQA 1D1BA 3P4IA 3GTPJ 3PIPL 4CGFA 4FVUA 1K6OA 2CGKA 2R4GA 3EQLF 1S1XA 2JWKA 3LPUA 3CCJN 2IA0A 1SANA 1NBWA 4U67L 3JRGA 2A41A 1TUYA 1QTMA 4JKBA 1RT6A 2KHMA 4DFPA 4OWRB 3ONQA 2VB6A 1TV6A 1WWXA 1YT3A 3WGGA 4PJJA 5GAGJ 1BI4A 4C1NK 3NGZA 3VF4A 1FSHA 4LB6B 2NRWA 3CQ8A 1MNEA 4G7ZF 3F6VA 1KZHA 3DAWA 1IBKK 3MKWB 4CZIA 1YVNA 4GVMA 1VRUA 2QF7A 4DTUA 3CO6C 2HNYA 2NRXA 4N4OB 3RPQA 4LFAK 2I5UA 4E7SA 3FISA 1EX4A 2KFDA 3OYMA 5FKMA 4L0ZB 2VBZA 4I98B 2VT3A 2QWQA 4JHDA 3E7LA 3I0SA 4A69C 2FMLA 3G6EI 3KPHA 4LF8K 4CF1A 1S72N 1VQMN 1XC3A 1TBXA 1NMDA 4JKGA 4U7DA 3W2WA 1BIZA 4C2MJ 2HDDA 1ODDA 2FE3A 3DTKA 5AQVA 3VYRB 3F8MA 5D3GA 4OLAA 3OS2A 4LY7A 3A8YA 3U6FA 2D2WA 4PJ0C 2YKMA 1BHLA 2FBHA 1REVA 1WB9A 4UV8A 3VDXA 2IP2A 3VEPA 5GAHJ 1KVAA 4DR7K 1AHDP 4W1UA 1AKHB 3OBYA 3GLXA 1U6ZA 4K43A 3W3DA 5M1KA 5F04A 4CGIA 4DV6K 1VQ8I 1JJ2M 1UCRA 3SUNA 4HLXA 1SVMA 4V2GA 1W1WE 2WBMA 3CJ1A 2E88A 5MLCQ 2H09A 3TL4X 4BQLA 2R7SA 2ZD1A 1TWGJ 2Q0OA 2XDVA 3D2FA 4HTUA 4EZ6A 5FB2A 4IO9F 4J01A 5AONA 3I58A 3AVAA 4O5BA 2B0LA 4KN7X 4M74A 1UOCA 4YIRX 2XRLA 1HDPA 4LLLA 4AHRA 2M5WA 2QLZA 2OTJI 1R1VA 2QM3A 3LAMA 2IW5A 4JV5K 5FKLA 3HXMA 3KX2A 4O6JA 3MWPA 3KYDB 3E9OA 3EE8A 5TRDA 3SUQA 1E3PA 3LDSA 3CUQB 1TAQA 1JKQC 3BROA 3HRGA 1QQMA 3O9SA 1BG3A 2Q3SA 5E3NA 2OCEA 1LFPA 2LK2A 5EU7A 1E4FT 2JPCA 4BNCA 4ENKA 4CHQA 2CRGA 1T98A 1T2KA 1J9AA 1MJBA 3ABLH 1Q18A 3EUAA 1BDGA 2HBLA 3VQ4A 2VKVA 2XRIA 1NKCA 1LPQA 2Y2ZA 2OC6A 2OZ6A 3AVBA 4LG0A 3G10A 1X9MA 2K27A 2W48A 3SZPA 5HODA 4MEXF 3CCSN 1IAWA 4ILHA 1S3JA 1V55H 4BL0B 1VSMA 3GX4X 2R7XA 2A69F 2LSOA 3OMYA 4JKEA 4IRHA 3VQ8A 1N6QA 2MLKA 5H6RA 1RIOH 2YJFA 3O8MA 3NH0A 3A4CA 2IS3A 1WKMA 4QWQA 1I6XA 5E17F 2E6LA 5I3UA 4M45A 3SV3A 1NGJA 1ASUA 2O4GA 3GF2A 4W5QA 1V4SA 2V79A 2QYOA 2WB1A 3FKIJ 4M3TA 1LNWA 3GBTA 1JUPA 4ID1A 1ZN2A 3SDGA 1NK2P 1Z9CA 1J54A 1SFOJ 1T6DA 4XEIA 2IIRA 5EXWA 3TPQA 2QBYA 4BRAA 3RR7A 2OTJN 3ZYYX 3ZGKA 4U7BA 1XCBA 2PMZN 4UVCA 2PBDA 1VSEA 3FK6A 3GTLJ 1FTTA 3QERA 1XMOK 4U87A 1QZ5A 4UQGA 2GXBA 2KKZA 2V26A 3P5JA 1MWMA 4RGUA 1TK8A 1P2FA 3CC4I 2ZJPF 4HF0A 4DS5A 2QQBA 4IEEA 1NGBA 4JD2B 1NOYA 3ISNC 2YU9J 2RE2A 3FM3A 5BS6A 4BROA 2EBIA 3KVGA 3OYIA 4YFXF 3AO4A 2ZFUA 5DUKA 4OKEA 4BQZA 2MGQA 2P6TA 3QODA 3Q5FA 4PUOA 1ZG5A 1MBGA 4G6DA 1IC8A 4G12A 3CG7A 4K41A 5DCMB 4L8RB 2RVCA 3C7JA 2RF2A 3DRSA 1PUFB 3NE6A 1VQ5N 4XRSG 3OSGA 2DBBA 2Z5UA 1YJ9I 1T8IA 1TGOA 4ILGB 2CS3A 4X66K 4B1WB 1U48A 3TANA 3NF6A 1IV0A 1DGKN 3I0TA 4J00A 1WLJA 5GINA 2CH0A 3WTYC 3QBXA 2IGOA 1ATRA 3VETA 3GCMA 3V7SA 2OANA 3T1AA 3FXRA 3KK1A 2P9PA 3LFKA 1IXSB 4EIAA 3CQZJ 4NB5A 1U5TC 3OA9A 4JK8A 1JKRC 2ASOA 2VKHA 1F5TA 1LWEA 5BRHA 3I3LA 3IAM2 2R7UA 1KQ8A 4Y1CA 5E20A 1R7JA 4FT8A 4A0ZA 2YNHA 3K5OA 1DGWY 2P9PB 3EKUA 3F22A 4X65K 4I01A 3IFRA 5GAHP 1RR8C 5AZIA 1Z77A 4F8RA 1T44A 2NRVA 3QFUA 1NWKA 3KLNA 2R7QA 1WSJA 2L5QA 4ELUA 2VJJA 2ZXHA 2E20A 3CXCM 3M8JA 1U5TB 2H8WA 2KDOA 3R60A 4CUGA 1ILYA 1WI3A 1X1AA 1MMGA 4G9YA 4P5OA 3MX2A 3SBGA 1NG9A 3HG9A 5CKTA 1BL0A 2Q2EB 3AFHA 3W2AA 1D0ZA 2L4MA 1SMTA 4L5IA 4A3KJ 4H0VB 3MN2A 3OJSA 4Z4GA 3LDPA 4Y15A 2V52B 3ROUA 3WG9A 4CCNA 3IUOA 4DCHA 4DTPA 1GDTA 2A6AA 4XKBA 1SAXA 5KRTA 5CYVA 4FJ9A 2PLYA 3HHGA 2M8EA 5FKKA 2CH6A 3A5OC 5KVRA 2VKEA 3I33A 3M8RA 3RMCA 3SCXA 4L9TA 4YEJA 5IYDJ 3DXKB 3V9WA 3B02A 3CCUI 2R5YA 1PP8F 5AQZA 1YOVB 4XORA 5JLHA 4FJ8A 2WAQA 2K86A 5JLWA 2KFNA 5JS1A 2ADUA 4RGRA 2Q0RA 3CCQI 2W6LA 1W5CC 3EZ5A 3C3WA 2RQPA 4JI1K 2EV6A 3S32A 1HUXA 3OYHA 2VG5A 4C30A 1K83J 4EVIA 1FNNA 4LIUA 1SFUA 1YRNB 4HWIA 3RMAA 1MH4A 2IA2A 4YIIA 3MKZA 3CO7C 4DQSA 2HOSA 3QU3A 2P5KA 3Q3SA 3D6RA 4AILC 2VONA 1O13A 3NHGA 3M1CA 4E3SA 2NNYA 5M3FJ 3TAFA 4B1UB 1JKOC 3KP6A 4XLAA 1Q9YA 4JS5A 1O7LA 5FJ8J 5I9EB 4F2RA 5FPDA 2VWKA 3DLLL 4B9VA 3QEPA 4YOXA 3ZMZA 2MFZA 3BR1A 4YOVA 3OYFA 1NG6A 1K78A 2IBDA 2L7MP 2FD5A 1QPIA 3ZT2A 2P9KA 4IOAL 3IH2A 3QMLA 3J7AY 5SZTA 3PX4A 1JGGA 3J80O 3M8EA 3HJFA 1FYMA 3WE3A 1BA1A 2CQKA 1S9EA 1MKMA 4Q5SF 2DN0A 1FZPB 1QO0D 3CLOA 1HX1A 1SD4A 2VOOA 4H8KA 1WVRA 4F3OA 4M6YA 5J4VA 4OLBA 4UY8O 3F6OA 3H92A 2CGJA 2KZMA 3DOLA 3NVMA 4XSXF 3BC8A 1IGNA 2DMQA 5EZHA 3RI4A 3RIRA 3ZX0A 2OTLI 1YXQA 4LOCA 3FHNA 4DW6A 5HLTA 5F0CA 3L2RA 1BL3A 1O1WA 1V4RA 5KHDA 4JNEA 4BUPA 3Q7CA 3AA5X 2K9QA 1ACIA 3M8FA 5E1XA 3FK7A 4D5CA 1OISA 2GBZA 3PO2J 2LF8A 3AARA 2P6SA 5CJ9A 1E3OC 1FYLA 3ID8A 3LWMA 3E6BA 3PIOF 3LDNA 4DZPA 4HA8A 1UA0A 3DLAA 1R49A 4FJHA 1MA9B 4A3CJ 2XHKA 2STTA 2XAGA 1IN8A 1XMQK 4KHPK 3O9UA 1HNVA 1HSJA 1JTXA 2L2OA 3ZSRA 3ULEB 4BRFA 1Z0XA 1JTYA 1XQSC 2HVHA 3AG1H 3CJNA 4KTWA 1BBYA 5E3LA 3F2KA 4DQQA 1XC9A 4M72A 3OYKA 4CD1A 4ZDLA 5L3BA 3KYLA 4XNFA 3OR2C 2IRFG 4OKKA 2HQAA 4MGRA 2ZJQF 3A01A 1HYVA 4DTJA 1Q9XA 2ESHA 4H5WA 1VQ6N 3K58A 3AO2A 3QEIA 3V4GA 1R71A 2Y0SN 1P6RA 2ZSIB 3QLHA 1HW5A 2KFZA 3DFGA 2JWLA 4BJTA 3L2CA 1VK0A 1ETXA 3NF8A 4FXDA 2D45A 3U3GA 2Y30A 2JA5J 2XIGA 2MLGA 2WOMA 3MECA 1MWKA 5AQIA 3H1QA 2JT1A 2Y1IA 3OYEA 3TAMA 4OJRA 5TKWA 2ZKZA 3AVLA 5ICFA 4OU0A 3H3OB 3H46O 3HL8A 2K4BA 3LL3A 2PEXA 4MO4A 4WQ4C 4CHPA 5C42A 3HYIA 4WF9L 2UUBK 4Z0UA 2FBXA 3J7AO 3EPZA 5T7BA 3P1GA 1R1TA 2EZKA 1X4PA 3CZ6A 1HKGA 3SEQA 2R7ZJ 3BQZA 3DBRB 2YX4A 1K61A 1YF5L 3L2WA 1G3YA 4L5EA 1Z21A 2A1SA 4C2UA 1QZ6A 2VBWA 1SAZA 3AG4H 4M3FA 2JWTA 1TKTA 3DLHA 2V6EA 4DTOA 1USTA 1FOYA 4CXFA 1ATSA 1G3TA 3VYUB 1S1UA 2P9NB 1M1KO 4A3BJ 2QWLA 5M5WJ 4IG3A 4CGHA 2BV6A 2ECCA 3I4PA 5FLXO 4LFCK 3IS9A 5AQOA 5EZGA 3NFAA 3LAJA 2JSPA 1P9QC 3HSFA 3BTIA 2WADA 1RTJA 4NCGA 1G99A 1VQKN 3ERMA 1RZ4A 3CMAI 4H0EA 5HL7L 1DP3A 3KEQA 1VI0A 3DF8A 4N4NB 4ITVA 5AQWA 3HPGA 5L3CA 4BR2A 3OYDA 1KLMA 3EUKL 1KQ9A 2IA1A 4BRPA 1SVLA 3GLLA 3ECHA 1LOTB 2EIMH 1OLTA 3MN5A 1VQ4N 4MQ3A 3CF5L 3THVA 4J2EA 2A05A 3VQQA 2OCCH 4BJ6C 4KHNA 5KGXA 4WE1A 5H20A 2Z3YA 3HKZA 1N77A 3M5RA 2QA4I 4I0BA 3ZQ7A 2V1XA 1L3SA 3GFJA 5DS9A 2I5JA 4JKDA 4AWXB 4L9JA 1NJWA 4Y0WA 1ON2A 4KT5C 1YVUA 1V54H 1QE1A 1ZG1A 1WSGA 2IT0A 5SWMA 1R4NB 1VQOI 1F43A 1IRZA 5BREA 1FC3A 3L9FA 4A2BA 4FM2A 3WGHA 1RDWX 3I56N 4IX7A 1WSIA 3OOPA 3K5LA 4KHWA 4OIPF 3LMMA 5E8IA 1HPMA 3LAKA 4K8ZA 4B9TA 3K1MA 4KIGA 2D0OA 3LFUA 3O80A 2LYCA 3AGKA 2NRAC 1JXSA 2CQ7A 2WY7Q 3QOEA 3O8GA 2DA6A 3QPLA 4WWCA 3WTSC 3LSMA 3MZ8A 3K70D 5KNLA 1SZ2A 3KKRA 3MN9A 1KRPA 3E6DA 2V7ZA 2DK8A 4HG2A 1ZAOA 3JSPA 1RFQA 1XSDA 4B47A 2M3AA 4FWNA 3V81A 4LG0B 2QSHX 2GXGA 3CJTB 3KYCB 2GA2A 3AAQA 3E9PA 2DA3A 2HYJA 4X6AJ 3AVCA 4FVMA 2G8WA 4M63C 3MK6A 1NG7A 2P4WA 3WXMB 2JTVA 1GVJA 2O8KA 1XI1A 4G7HF 2PAVA 4CF2A 4C8KA 5LMNK 1Q1HA 2LFBA 4CCJA 5JI6A 1GV5A 5A2QZ 1VSKA 4LH4A 5EEHA 1NKEA 1YJWI 5HLIA 2HKXA 2Q1NA 3VTIA 3FXKA 1QVGM 3DEUA 3K10A 2O8DB 4GKKK 4C8OA 2HHQA 2L7FP 3VSLA 3WTXC 2R7VA 1MDUB 1DPRA 4BGBA 1IBMK 4FJNA 1BJAA 4K42A 2JQ7A 4UUSB 2Z1JA 4X62K 4DU1A 5J6XA 4A12A 4A3FJ 2R7RA 1I3QJ 4C8NA 1GLEG 4HHTA 2X6SA 1SS6A 3DMJA 3K4NA 1QHTA 4FLZA 1UA1A 2D5VA 3B6CA 1T05A 1WI9A 3FXMA 5HRSA 3SYZA 2Q36A 3DBLB 2F5DA 4CIEA 1S7EA 1EJ9A 2BVMA 1HCRA 3QNNA 3NMUA 4KFCA 2DA4A 2IGIA 4AHTA 3O3GA 3SYTA 4HAMA 3SZGA 1H0MA 1DTQA 4NXMK 3WHCA 4YHHK 4J2BA 2QQ9A 3S15J 2RHKA 2ICWG 4H5NA 3VGKA 1TWAJ 2NVQJ 2EV5A 3MMVA 3VQPA 4I6MB 1WUAA 3QP5A 1VSFA 1YE9A 2LLKA 4RM2A 5DM6F 1LUJB 5CVUA 2YHYA 3CERA 3P38A 2F5FA 2Y9ZA 4GNIA 4HUGA 1SL2A 4B43A 4WFBL 3DM2A 5ILUA 1VQ5I 4CJ3A 4RTFD 3F21A 1T39A 3FBNB 3GTOJ 3VQEA 1K7AA 4DSKA 1RUOA 3FZMA 4KFBA 3V6DA 2F5VA 2DT6A 3GEZA 4A2AA 5CZ1A 3WT0A 1XSVA 5M3MJ 4BXXJ 4ZHRA 2VE9A 4XOPA 1LCUA 3H3NO 2M8GX 5EDNA 5JR3A 2BY3A 2RNJA 4CJ5A 3HPHA 4LITA 3SI6A 3RR8A 4AHSA 4O0JA 5KRSA 5IWAK 1A6IA 2K85A 1QHAA 2FU4A 1W0HA 2H94A 5GP9A 1XCVA 3JRCA 3FFKB 4BRCA 2X0LA 3I54A 1HQEA 1IO2A 2A42A 2P9LB 4A61A 1W7PA 2CO5A 1HOMA 4Y13A 3E6CC 4HSRA 4CECA 2E6MA 4G8XA 2HBMA 1VQPI 4K0KK 2XASA 1L3UA 4GRIA 1HNWK 3P9IA 2M0CA 3IWFA 2P9SB 3HB9A 1D5VA 4E7ZA 4MNUA 5AZIB 4FWMA 3R0JA 1X2NA 4Z4CA 1T95A 1MSFC 2Q2RA 4JX4A 2BW3B 2YX7A 4BXFA 4CICA 1LE8B 2IDOA 5FPEA 3T1HK 2KMUA 2P5GA 3DV8A 3HC7A 1U5TA 5DTDA 2ZSHB 3OYLA 1A5WA 2NVUB 2GTDA 3VSKA 2DA2A 3DLRA 3K9KA 2WV0A 3C2HA 1XN7A 3D5RC 4IXAA 2ZBKA 4RB0A 1ETYA 5D5VB 3M8PA 3NWTA 3O08A 5BRFA 4LF4K 3HGYA 4NC6A 5D6FA 1T0FC 2V9PA 1BI4B 4IKFA 3WU1B 4GY2B 4FX4A 5GAGP 3TI0A 2QCOA 4BQNA 5ICCA 3FBIB 2VPRA 3DBHB 4UVAA 2JRMA 2PMZA 3FM5A 1YTAA 1IKVA 1XG1A 1XD7A 1HXDA 1BJZA 1ZRCA 4NLCA 5AZJA 3CJQB 4AD9A 2HOEA 4GDFA 4CFCA 1TT0A 5JFRA 2EHGA 4O8KA 4XBFA 1GHCA 1J09A 3KEOA 3LSKA 3FXQA 1Z26A 1Y0NA 2QVOA 4LG3A 4RLQA 4RB1A 2OQRA 2P9IB 3DXMA 4H0OA 3VGMA 3GYHX 2M0MA 3HT3A 4UB6C 1SQKA 3SQ4A 5FD5A
chains in the Genus database with same CATH topology
3E01A 1TV6A 2HNZA 1YT3A 5JS2A 1RILA 3NGZA 1BI4A 4C8LA 2G8HA 1K6YA 1IH7A 4ELVA 4DSEA 2NUBA 1RBTA 4FJ5A 1FKOA 3CQ8A 3PO4A 3V1RA 1L5UA 4FYDA 2ZQBA 4GVMA 1VRUA 4DTUA 5CY4A 2HNYA 3I8DA 4CIFA 1EX4A 1SV5A 2JLEA 4KAZA 4CEBA 3OYMA 3V9UA 3BDPA 1WSFA 2R7YA 1CZBA 1U49A 4DSKA 3ZSXA 3I0SA 3AA4A 4RW9A 4CF1A 3VQCA 1BIZA 4AHVA 3QEWA 4CF0A 1RT4A 5D3GA 4OLAA 3OS2A