2DFEA

Crystal structure of tk-rnase hii(1-200)-c
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
209
structure length
209
Chain Sequence
MKIAGIDEAGRGPVIGPMVIAAVVVDENSLPKLEELKVRDSKKLTPKRREKLFNEILGVLDDYVILELPPDVIGSREGTLNEFEVENFAKALNSLKVKPDVIYADAADVDEERFARELGERLNFEAEVVAKHKADDIFPVVSAASILAKVTRDRAVEKLKEEYGEIGSGYPSDPRTRAFLENYYREHGEFPPIVRKGWKTTQDMINKST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational contagion in a protein: Structural properties of a chameleon sequence
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
molecule keywords Ribonuclease HII
total genus 69
structure length 209
sequence length 209
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 2dfeA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2dfeA01
4F2SA 4I2QA 4CHPA 5KRTA 2HB5A 3CFOA 1DLOA 1BCMA 2OPQA 3D0PA 3EY1A 3RR7A 1T05A 1T8EA 1Q9XA 4KTWA 4IG3A 3SQ4A 3LPTA 4IBNA 2YHAA 1GOAA 2IC3A 3S9HA 3P1GA 5KTQA 4FK4A 4FJ9A 1TAQA 1NJZA 1J53A 3KK3A 4BDPA 5J2PA 3KJVA 1S9EA 3WNGA 3ZSWA 4CGIA 2D5RA 1JLCA 4LD0A 3PX4A 4Z4IA 1U48A 2P5OA 3VQDA 3O4QA 4OGEA 2XY5A 1KCFA 2HHTA 2G8VA 1S1UA 1I3AA 4E3SA 5J2NA 3T19A 3RR8A 4FZYA 4ID1A 1TKZA 1NKBA 3LP1A 1Z25A 1S5JA 1A5VA 3K5OA 3CFPA 2IGIA 4CJ4A 3TABA 3HJFA 1SL2A 4NYFA 3HVRA 3SNNA 3DLBA 1LAVA 1RTJA 1LAWA 2YHBA 4HUGA 4ZTFA 4JLHA 1NK9A 2G8FA 3IAYA 4CGHA 2OPSA 4FJJA 4CGFA 1RTIA 4CFDA 4AH9A 5HROA 3ISNC 1T03A 1RDCA 3K5MA 1TK8A 4CGJA 3B6PA 4CHYA 4BWMA 1HYZA 1QSLA 2FBYA 1C1BA 1ZBUA 5JS2A 4RW9A 3NH1A 1Q8IA 1LW0A 1W0HA 4BACA 3V9XA 2OYQA 4O0IA 4CFAA 1U47A 3RWUA 3K58A 4LH5A 1QSYA 3MEDA 3DYAA 4CJPA 4CJ5A 3CG7A 3LWLA 4FM0A 4BDZA 2HHQA 1WAFA 4CEZA 4FJGA 3SUNA 4DQSA 1SKSA 3HVTA 4ELTA 4K8XA 4F3OA 1IH7A 1HNVA 3UIQA 1VSIA 2HHSA 3RMCA 2RPIA 3AVCA 3CYMA 3BGRA 4AHTA 1X9WA 4DTMA 2B5JA 3HPOA 3VQCA 4BE2A 4DWIA 4E19A 1SV5A 1ITGA 2B6AA 2G8HA 3MXJA 3HXMA 5K14A 2ITGA 2HMIA 1ZBHA 4HHTA 1J54A 1B92A 3QIOA 3QNOA 1JLBA 1C0UA 3DMJA 2FBTA 2HNZA 2YNGA 3AO1A 4YNQA 4EZ9A 4OKKA 4F4KA 2ATQA 3AV9A 1JLGA 4DU3A 1QTMA 1DTTA 4CFCA 3BDPA 3AVKA 5DK5A 1UOCA 3HM9A 4KPYA 3CFRA 4CIGA 4KTQA 4N56A 1S1WA 2F8SA 4W5OA 1MU2A 4IFYA 5FDLA 4XIUA 1VSHA 1D8YA 4FM2A 2QXFA 3OYHA 2ZQBA 2F8TA 4CJRA 3TAEA 1N5YA 4CJQA 3H08A 4DG1A 4J2DA 4KTZA 3KK2A 3KLEA 3OVNA 4GVMA 5C42A 2YNHA 3V6DA 1SL1A 2G8WA 4R5PA 3OYFA 3ALYA 4DTRA 4PWDA 3E01A 1NKCA 4RW6A 1BQMA 1RBRA 3ZT3A 3NFAA 4DFKA 1S6QA 4C8NA 1FXXA 4GMJB 4DLEA 1I39A 1BCOA 1BQNA 2NUBA 1TK5A 3PO5A 3SCXA 3VA0A 4RW4A 1S9GA 4E7KA 2QK9A 5C24A 4Z0UA 3ZT2A 3CM6A 1D5AA 4LSNA 4ELUA 4OLAA 1IKVA 2Z1GA 1G15A 3C6TA 4DF8A 3VQPA 3VQ9A 3QEIA 4M3WA 1JKHA 3HYFA 1ASUA 1BL3A 3AA2A 1R0AA 2HVIA 3QEVA 2P1JA 3C95A 3SJJA 3MEGA 2HNYA 1F21A 4FLWA 4FLTA 3NGIA 3MEEA 1HQEA 2XO7A 1JLFA 3ZCMA 3O3HA 2PYLA 1RT1A 2X6NA 1NOYA 3O3GA 1D9DA 1NK4A 1L3TA 1NOZA 3RMAA 3NHGA 4DS4A 1U49A 1NK8A 4CIFA 2HNDA 4DMNA 4J2AA 3OYKA 4DQPA 1FK9A 1VSFA 1KVCA 4CHQA 3CQ8A 4OPJA 4M3YA 1U45A 5SWMA 4AHUA 4EP4A 1A5XA 4JRPA 1CZ9A 1XHZA 5FROA 1UA0A 2YNIA 3VQ5A 1NKEA 3L2UA 3L2VA 1EXQA 2P51A 4TSXA 2QKKA 4DFMA 5C25A 1X1PA 4Z4CA 2HHWA 2PYJA 2WOMA 3ZSQA 2IDOA 4CCHA 4EZ6A 1C1AA 3ZT4A 1WSEA 3OS0A 1RDBA 1TL1A 4FJ7A 4C8KA 1VRTA 3V1QA 2Y1IA 1O1WA 4O44A 1JL2A 4N5SA 3OYBA 3KLFA 4ZTJA 3KLIA 3OJUA 4CJWA 4FJMA 5FRNA 3NBPA 3ZSVA 4EP5A 4W5RA 4CK2A 1RBUA 4C8LA 4WE1A 2XY6A 3PX0A 4B9VA 4CGGA 4FJHA 3SPYA 3OYIA 4ELVA 4HVJA 1RNHA 2HHXA 4CK3A 1L3SA 1RCHA 3QEXA 1KSPA 3VA3A 4KB1A 5I42A 1KFSA 1RT3A 3LP3A 4F3TA 4FK0A 3HL8A 4OJRA 2RKIA 3L2QA 3TANA 3NAEA 4FJKA 1K6YA 1EKEA 2EHGA 3AA5X 4YFUA 5HP1A 4B9TA 4KV8A 3F9KA 4CK1A 3HP9A 3SQ1A 3NF7A 4CJEA 2E6MA 3QNNA 3DLRA 1L5UA 3KKSA 4DTJA 3OYNA 4PQUA 3VQ8A 3OS2A 2DFEA 1J9AA 2Z1JA 4GW6A 4I9LA 5J2MA 3AVNA 4CHZA 4CESA 1LWFA 3KLGA 1XWLA 3CM5A 4H4MA 5HRRA 4B8AB 2VG5A 1RT2A 2A1RA 3HO1A 3QO9A 3KK1A 3T1AA 3C6UA 4CF2A 3K59A 3V9UA 4B9SA 1SUQA 4CEBA 1RBTA 1UA1A 5CYQA 3MXIA 2KQ2A 2ZE2A 4F8RA 3NH0A 3QINA 4MQ3A 3I0RA 3ZSRA 1IO2A 3K5NA 3DRPA 2WONA 4FJNA 2GV9A 4FM1A 3TI0A 1TKDA 4Z4EA 2KFNA 4UQGA 4KFBA 3KD1E 3TAMA 2OA8A 3V9WA 4DSEA 2KTQA 3V9ZA 4DS5A 1RT7A 2GBZA 3AO3A 2YKNA 1TKTA 3FFIA 4AHVA 1W9HA 3TR8A 4O5BA 4AILC 1NK5A 4OLBA 1SL0A 1BHLA 3LDSA 4DTUA 3LP0A 1LWCA 4KKOA 4DTOA 4DTNA 4DSLA 2HW3A 4CHOA 3SYZA 2VWJA 1RTDA 2YKMA 4LSLA 3OYEA 3V1RA 3TAQA 4KAZA 4Z4HA 1B9FA 3RRGA 4AHRA 4DLGA 4DTXA 1BISA 4DQRA 2X6SA 4KHSA 3DRRA 4DQIA 1TKXA 2DFHA 2I5JA 4OGCA 1TK0A 4OKEA 1HYSA 1CZBA 1SKRA 3AO5A 1CLQA 4CJTA 4BE1A 3SZ2A 1Q9YA 3AVBA 3PO4A 3DOLA 1RT4A 4KHYA 3L2RA 3AVIA 3VQ6A 4FLVA 1LWEA 4NYNA 4N47A 4DF4A 1JLQA 3TAPA 3HPGA 3G10A 1S1VA 3SUQA 3VN5A 2F96A 4O4GA 1QE1A 1IKWA 3IS9A 1HJRA 1JL1A 5DMRA 5HLFA 2DFFA 3P5JA 2E4LA 4I2PA 1BI4A 3OS1A 2W42A 4W5NA 3C94A 4E0DA 2KZZA 4KRFA 4M45A 2RN2A 3NE6A 2E6LA 3SQ0A 4CECA 4N41A 3DOKA 2DTUA 1JLEA 1RTHA 4FJ8A 4DSIA 4FLUA 4CF1A 3LWMA 3DI6A 4I9QA 3SV4A 5EU7A 1DTQA 5CY4A 1REVA 3M8RA 4CJSA 3S3NA 5KI6A 2LSNA 4FJIA 3SQ2A 4B9NA 3LP2A 3QEPA 4QAGA 1QSSA 1GOBA 4DFPA 2P5GA 2BGGA 1IKYA 4DU4A 4CJ3A 4KHUA 4CEFA 4ID5A 3AO2A 3NCIA 4FJ5A 1WSJA 2JGUA 3ZT1A 5E41A 3V9SA 1QHTA 1IG9A 2Y1JA 1WNSA 4MFBA 5SZTA 4FVMA 3V1OA 4JRQA 5I3UA 1BIUA 3HSTB 4M3UA 1VRUA 3AVHA 4B8CA 3OYLA 3AVMA 4CFBA 5CZ1A 4HTUA 4M41A 1TL3A 1WN7A 3LPUA 1LV5A 1XI1A 1VSKA 1BGXT 4FZXC 4B3OA 3OJSA 1ZBLA 3I0SA 3KLHA 2KZMA 3PUFA 4OPKA 1FKPA 4M3TA 2X78A 3KIOA 3NDKA 2O4GA 1NJYA 4FJXA 4FK2A 4OKJA 5J2QA 1UAXA 1NJXA 5FRMA 2BANA 4IFVA 4CEQA 4M42A 3RTVA 1NJWA 5HRNA 1KLMA 4FYDA 1GOCA 2D0AA 2Z1HA 3D45A 3ASMA 4CF0A 3OYDA 1HQUA 2Z1IA 2R7YA 4CERA 1RT6A 2RF2A 4C8OA 4Y1DA 4L8RB 4QOZB 4CJUA 3V4IA 2DY4A 1RBSA 4PUOA 3F73A 2AJQA 1VSMA 2G8IA 3PV8A 4CJKA 3OY9A 3ITHA 4E7LA 3RRHA 2D0BA 3M8SA 1LW2A 5HRPA 1S1XA 1HPZA 2YV0X 4DSJA 4J2EA 3SV3A 1VSJA 2IS3A 4JS5A 2PY5A 2D0CA 3THVA 3O3FA 1BI4B 4M3RA 2HHUA 3AVGA 3DM2A 4CEDA 2O4IA 1YTAA 3U6FA 1KVBA 4ICLA 4HUEA 4BWJA 2FBVA 1NK0A 3QIPA 3LAKA 1BIZA 2JLEA 3U3YA 1J5OA 4K8ZA 3LAMA 1WSHA 4E7JA 1EX4A 4DSKA 4B9LA 2VG6A 4RW7A 3VQ4A 4CF8A 2ETJA 4LH4A 4NCGA 2IOCA 2GUIA 5T7BA 1HNIA 2YNFA 3JSMA 4CHNA 4CF9A 3OYMA 3ULDA 4RG8A 1L3VA 4KB0A 1SKWA 2KFZA 2FBXA 3QESA 4CJFA 3MXMA 1WSIA 4C8MA 4CEAA 5HBMA 3L2WA 4KI4A 3OYAA 2OPPA 4BE0A 4FCYA 1KRPA 4QCLA 3AVJA 1WSFA 3KKRA 3MAQA 3HPHA 4IG0A 1S6PA 3WNHA 4FLYA 2KW4A 3VQQA 4FLXA 4E7HA 1XC9A 1HRHA 3KTQA 1VK0A 4NCAA 1EETA 3AVAA 3G0ZA 3MECA 1ZBFA 3OYGA 2OPRA 1C1CA 4H8KA 1Z26A 5J1EA 1B9DA 3NH2A 3RMBA 3B6OA 2XY7A 3TWHA 1JLAA 4RW8A 3AA3A 1JXBA 2OZMA 1UWBA 3L3VA 1RDDA 4PY5A 3RMDA 4PA1A 1IKXA 3S3MA 1RT5A 4B08A 1C0TA 3EZ5A 3HK2A 4E1MA 3K57A 2XRIA 3LZJA 3NGYA 4FZZA 1QS4A 4W5TA 1TVRA 1WSGA 4HUFA 2BDPA 1TAUA 5CYMA 3K5LA 4M3ZA 4Z4GA 3LZIA 2HHVA 2G8KA 4DU1A 2VWKA 4KHWA 4E1NA 3LALA 4FXDA 4CGDA 3IG1A 3VQBA 1RILA 3PX6A 3HP6A 1CXQA 3NF6A 4FJLA 4IDKA 4H4OA 4N76A 1U04A 4CIEA 5JS1A 3EYZA 1ASWA 1KFDA 1KVAA 3SPZA 1X9MA 4CJLA 5KGWA 5KGXA 2G8UA 4KREA 4DTPA 1VSEA 3QERA 3AVLA 1S1TA 3S3OA 3NF9A 3QLHA 4FW2A 5D3GA 5HRSA 3AVFA 3LANA 1ASVA 4F2RA 1KLNA 3P83D 4BDYA 3TAFA 1X9SA 3V81A 3AO4A 4CEOA 3DLGA 1FKOA 3L3UA 1TGOA 4DFJA 3VQ7A 5KRSA 3ZSZA 3SI6A 3DLKA 3VQEA 4I7FA 4AHCA 4M3XA 3I8DA 1NK6A 3ZSOA 3JYTA 1ZBIA 3K2PA 2OZSA 3IRXA 3VQAA 3DLEA 3OYCA 1TV6A 1U4BA 3TAGA 4B9MA 4HCBA 1A5WA 4CJVA 3NGZA 4DQQA 4KHNA 3AA4A 4IKFA 1YT3A 1XHXA 3SUOA 2EX3A 1Y97A 2IAJA 3NF8A 3QEWA 4JS4A 4FLZA 1N6QA 1T7PA 3SUPA 3KD5E 2XY8A 2ZD1A 4CEEA 4KO0A 4O0JA 3WNEA 4E89A 1HYVA 1JXEA 3HT3A 4DSFA 2HVHA 3M8PA 2XHBA 1EP4A 1L3UA 1WAJA 1YVUA 4Z4FA 1QQCA 2PZSA 3O4NA 3ZSYA 3OYJA 4FW1A 4G1QA 1CXUA 3DLHA 4Y1CA 1KTQA 3PY8A 4OVLA 1D9FA 4KHQA 4W5QA 1NK7A 3TARA 1HMVA 2A1SA 1C6VA 1RBVA 5CZ2A 3U3GA 1WLJA 3WNFA 4E7IA 2Q3SA 2VG7A 1VSDA 3L8BA 4LY7A 1ZYQA 3QETA 4Q0BA 1RDAA 4O55A 3ZSXA 4CE9A 3ZT0A 2FC0A 1VSLA 4Q5VA 4J2BA 4HCCA 4KI6A 4NCBA 4B9UA 3A2FA 1C0MA 2BE2A 4AHSA 4ZHRA 1YTUA 2B4JA 2QKBA 2X74A 3DRSA 3M8QA 3T3FA 4DTSA
chains in the Genus database with same CATH superfamily
1S22A 2E2JJ 1FBUA 4A3JJ 1UZCA 5AQKA 1TQPA 3D0PA 2Q0RA 3I59B 3E66A 3DCFA 3DTKA 2PAVA 2P5VA 3KLNA 2LSOA 3S2WA 5K5RA 2ZXJA 3H6EA 4IG3A 4KTWA 1GOAA 2R7XA 2IC3A 1T33A 1PJRA 3M1EA 5EZHA 4FJ9A 1NJZA 1J53A 3KK3A 1G8XA 3L0QA 3BROA 4KB1A 1W5SA 3VWBA 1S9EA 4LF9K 2OCCH 4M7YA 3JRFA 4LD0A 3VF2A 2DCEA 2CYYA 2X1EA 3D6RA 3C6HA 3FXMA 1A31A 3JRDA 3JAMZ 1ZREA 2ZO4A 2HHTA 1T8IA 1FOXA 4FSVA 4E3SA 4IVNA 4LITA 3RR8A 1L3LA 1TKZA 3A8YA 2ASPA 1Z25A 3LP1A 1ZTRA 1Z0XA 1E4GT 2BY1A 2VASA 3F21A 1SL2A 4C2UA 1YJNI 4IZZA 4C23A 1WJFA 1YQAA 1RTJA 3HG9A 1BBYA 2NRAC 3MX2A 4V19K 3OV8A 1K83J 4FJJA 3TKYA 4KT6A 4OPHA 1MBHA 4O5VA 2HTSA 1SAZA 1PP7U 1RTIA 1MNMC 2HF4A 4CFDA 2WADA 3U1KA 5HROA 1T03A 3J81O 1HNWK 2O8CA 1TK8A 4CGJA 2CU7A 2NRRA 4CHYA 1S5LC 4UVBA 3UKRB 1QSLA 3C7JA 1DT9A 1ZBUA 3ELKA 4RW9A 5F0HA 1IRGA 5JS2A 3EN9A 3H46O 2F5FA 2R93J 1S29A 3ZQGA 3T69A 1U47A 2OYQA 3J7AY 1ERDA 3ZMSA 4JI1K 2E1NA 2EINH 2H6CA 5FKOA 5FLXZ 2OJED 3KYLA 1EV7A 2MA3A 3RVCA 2DT7B 2EV5A 2OA4A 2ELJA 4BXUA 4A0XA 4LLNA 1XNQK 2EB7A 4BR0A 4CEZA 4FJGA 3QICA 4LLGF 4DQSA 1SKSA 4RA2A 1HNVA 4XH1A 2KISA 3IP4B 4N0BA 1ON2A 4AHTA 2VT3A 1F5TA 4BQOA 4N41A 4QS7A 3CMAI 2DYRH 4BRHA 3HPOA 2X6XA 2OUMA 2V7FA 1SV5A 3HTUA 3CESA 5DUKA 3TSPA 2CRGA 3A01B 5K14A 4WFNL 2HMIA 2FOWA 3IWZA 3V7SA 1B92A 2C6YA 3KEQA 3KZIC 1C0UA 3GX4X 2FBTA 1VQ7I 2YNGA 3AO1A 3K4LA 4MDBA 4OKKA 3MVPA 5CVJA 4M71A 4H0VB 5E1XA 5F0FA 4RS8A 2FBIA 5JR3A 2PMHA 2XF7A 1U8RA 3FIWA 4XIUA 3ENBA 2DMPA 2ESHA 5FDLA 4D5CA 5ERIA 1F9NA 2QXFA 4L0ZB 3CJCA 2F8TA 1OKRA 2PMZA 4NC6A 3TAEA 2EQRA 1PDNC 4CJQA 3SLCA 3LA3A 4KTZA 5C42A 3VYTB 3A2KA 3V6DA 4XRMA 1UFMA 3K1NA 1SL1A 2KZVA 4R5PA 3ALYA 4DTRA 1EWRA 4LD5A 2VJIA 2K4JA 3AAQA 2Q97A 4A57A 3G1OA 4YIFA 4ESFA 3WTYC 2P9UA 3VPZA 3HOVJ 4DFKA 4BREA 4C8NA 5JMVA 2NUBA 3SHFA 3UKUB 1VQKN 2QWMA 4BRLA 2QI2A 4HTLA 5C24A 2QK9A 3ID8A 1IXRC 1X1AA 1D5AA 3CM6A 4YHHK 4RB2C 1GLDG 1SANA 4JI6K 2B9SA 4OLAA 1IKVA 1Z3XA 2BYVE 3OSFA 3EUKL 1G15A 2D4WA 2V7YA 4JKHA 3VQPA 2IVPA 4DF8A 3QEIA 4M3WA 4DYCA 2EWSA 3HYFA 1ASUA 1BL3A 1R0AA 3VYUB 2R5YB 3F8NA 5F1XA 1D5YA 3SJMA 3SJJA 4O8UA 4MTDA 5FPEA 1P7IA 4FLTA 3EL2A 3I0TA 2JA2A 3A4CA 2D45A 1ULYA 5GAEP 1FPQA 2MG4A 3MEEA 1HQEA 1JLFA 1WBDA 4GO1A 3E3VA 4KYWA 1BW6A 2ZCWA 2ADUA 1D0XA 2DODA 2PJRA 3H3NO 4JKGB 4F52A 3PIOL 3HZJA 2QEXN 1NOZA 2MFZA 2P81A 2WTEA 4M63C 2QA4N 4B8XA 3DTIA 3SDGA 1VZ0A 3IAM2 3OR1C 4DMNA 1GLCG 1K8KA 3OYKA 4BROA 3JAMK 4O3MA 1TYQA 2DXIA 4J2AA 2EIKH 2A69F 2RKHA 1VSFA 5EGOA 4UUSB 4OPJA 3CQ8A 3J7YJ 2VQEK 2P9LB 3KWIA 4EP4A 4JRPA 1CZ9A 2E20A 1N33K 2YNIA 1NKEA 1YITI 3K9KA 3VEVA 4DFMA 1X1PA 2DQRA 3JRGA 2Y9ZA 4YOWA 2HHWA 1MNDA 2PYJA 4EZ6A 4BY1J 4WXDA 2IDOA 1NGIA 2VJ4A 3GO5A 4CZJA 4LFBK 1T6SA 3BTLA 3PSIA 1VRTA 3C0BA 4YOXA 1QGPA 1O1WA 3OYBA 3O8MA 4N5SA 3KLFA 1TBXA 3AG2H 3ZETB 3OJUA 5AQFA 1S72I 1FZPB 3ZSVA 4EP5A 2O9LA 5AQQA 3ID6A 1RESA 5LD2C 2VPLA 4B9VA 2UUCK 4EATA 3SPYA 3OYIA 4HVJA 3E5QA 1WBBA 4CK3A 3AA4A 2HHXA 3BF3A 1IN4A 4WF2A 2L3DA 2A5XA 2HMPA 4JKAA 2UXCK 3BPVA 1T0FC 5D5VB 2XGEA 1HNXK 2B63J 3HL8A 2RKIA 2H6BA 2B7EA 3K6GA 3TANA 2CWEA 1NH3A 2PEXA 3F9KA 4BQNA 4A3CJ 4XLFA 1SFOJ 1MBKA 2ELHA 2DFEA 3OS2A 4ZC3A 2HVRA 3F2KA 4I9LA 2FNPA 3VQ8A 5HLGA 1LWFA 3LL3A 4CHZA 5D6EA 1VQPN 1R23A 1TT5B 1XG1A 3O6WA 4B8AB 1X2MA 2DA4A 1RT2A 3HYIA 2V1DA 5JI6A 3D2EB 5M1OA 4FWQA 5HL7L 4FWNA 2G9WA 3LSRA 3C6UA 3M5RA 2FXAA 1HNZK 1MBJA 1SUQA 2GAUA 5CYQA 4L5JA 1ZRFA 1NM1A 2E2IJ 4CDGA 3K5NA 2HHHK 4Q47A 1G3YA 3CQXA 1ILYA 5IYCJ 3CCJN 3ENHA 2JPBA 4IFEA 3IFRA 5A2QO 3TI0A 1J7KA 5E20A 4Z4EA 2KFNA 2NVTJ 2LLKA 3CQZJ 4NUBA 2V51B 2NVYJ 1MBGA 2L7MP 3LSJA 3ZN1A 3WG7H 1TWGJ 4I09A 1JGSA 2VWBA 4JI2K 4MHGA 4BH9A 1LPQA 1ZELA 4AQYK 2R7UA 2QWQA 5LMNK 4OLBA 2WAQA 1SD7A 4KKOA 4DSLA 4IL6C 2IVOA 1K73O 1S9HA 4P9UA 1XN7A 3J81Z 3SYZA 2HPIA 4PZJA 1S7AA 3P7NA 3HOWJ 4Y7NJ 2YKMA 1IN8A 3JR9A 3FZHA 4LSLA 2VWJA 4GV6A 3TAQA 2O8DA 4ZJZA 3E6BA 1VFCA 4YDUA 2QSHX 1XDUA 1I5ZA 1UHWA 1V55H 3WHCA 2FSJA 2BHYA 3I58A 2QLZA 3GG4A 1YJNN 4EJUA 2X6SA 4M7XA 2DFHA 3MX5A 4D7MA 4GYGA 3VGLA 1CZBA 1WHUA 4CJTA 4BE1A 4PFPA 1P4WA 3S1QJ 3FXLA 4BR4A 2KDOA 3M8JA 5HS9A 1HCRA 1LWEA 4NYNA 4FLVA 1JLQA 3QRFF 2HXOA 3HPGA 3G10A 2DA1A 2KZGA 3KP5A 1JTYA 4A6EA 3PL8A 4MDAA 2E60A 2Z2SB 2OPTA 3H35A 3PIOF 3CD6I 4O4GA 3IS9A 1JL1A 4DU4A 3MKLA 5HLFA 3NMUA 2E4LA 3OS1A 4GKJK 3E9OA 4DB3A 3CZ6A 1YE9A 5EZGA 6PAXA 4N9HA 4HNTA 2RN2A 5D4RA 5AZJA 4JEPA 3DOKA 4M42A 2P7VB 4H03B 2F5EA 4GCVA 1RTHA 4CF1A 4I9QA 4LF8K 3D1NI 4XNFA 4DNCA 5CY4A 2OC6A 1WJDA 1REVA 3J8AA 2NS0A 4MNUA 4XOPA 4A3IJ 2X9DA 3FHZA 5KI6A 4BR9A 2HYGD 3N4QA 3SQ2A 4B9NA 2DDBA 3RJPA 1BM9A 2IJLA 2ELKA 5LGTA 4DFPA 2BGGA 4C3IJ 1Y0UA 1U5TB 4ISGA 1KC8O 1ZC6A 2JT1A 4G94A 3ZGKA 2QUFA 1EJ9A 4CEFA 3JSPA 1X1DA 2EA2A 3WUHA 3TP0A 3EYIA 4LK0F 3ZT1A 5E41A 3V9SA 1QHTA 2R7ZJ 1FC3A 1IG9A 5JLXA 1P8ZA 5AQPA 4IQ4A 3KK7A 5SZTA 4FVMA 4ISFA 1JGGA 2E5NA 3ZEUA 4NC8A 4JRQA 5I3UA 1QVFM 4IOAL 2ZJ2A 3TO7A 2PMUA 2QVOA 1YIJN 3E1YA 4M41A 2QM3A 2Y9YA 2CJJA 4O6JA 4GDFA 3LPUA 3QPHA 4KBOA 1VSKA 1BGXT 3H5RA 4LF5K 1XMXA 2Z16A 4B1UB 1VQ7N 2WFBA 1CGPA 2FD5A 4JK7A 3KETA 3THYB 1WH5A 4I6MB 5DM7F 1XPXA 2E7WA 1GLBG 2P9PA 1N77A 3PUFA 4FX4A 1KAYA 3KLHA 3FBIB 1DEJA 1MNEA 4EVIA 2CO5A 4XICA 2K9NA 1ZG1A 2VE8A 1E3HA 1NGAA 1Z67A 3R4KA 3TSUA 3NDKA 3BTJA 5J1UA 3N05A 5FRMA 3O1WA 5ADXH 2M4GA 5EEAA 3GFIA 4L9TA 1NJWA 3R61A 1KLMA 2RC4A 1GOCA 4OX9K 3BPXA 5AQVA 3SUOA 4CF0A 3OYDA 3V8LA 2LMDA 2Z1IA 3O9SA 2RF2A 4C8OA 4L8RB 4B3AA 1RC9A 2CGLA 1ZN2A 4M3BA 2DY4A 2QSFX 4PUOA 2W7NA 2AJQA 3CUQA 3VEXA 1E3PA 2UYTA 1V4RA 2IBDA 3MFKA 1Z6RA 3JW4A 4XQFA 2KHMA 3PV8A 1KU9A 1IXSB 2ZJPL 2V79A 3HOZJ 3RRHA 1RGIA 3CF5L 2OTJI 1G2HA 1Z6TA 2VOOA 2ASMA 2YV0X 4DSJA 3EEQA 3A5MC 1BA5A 1D1AA 2KRFA 1SAXA 1QA6A 1YF5L 1ETKA 1VSJA 2M3AA 1TQIA 3ASNH 3I59A 3SV3A 3THVA 2PY5A 2KMUA 2ECCA 3P9KA 3DM2A 2HI3A 4Y4RA 3CCEI 5F0CA 2Q36A 3U3YA 4K8ZA 3M1CA 4DSKA 2DA6A 1SFUA 4RW7A 2NRWA 1NG9A 2X51A 4UY8I 3AARA 9ANTA 3PNYA 1FIAA 4NCGA 2CGJA 3Q9VA 2V7ZA 2VXZA 2Y30A 1JJ2M 5IYDJ 1JCGA 4CJ7A 1HNIA 4RMNA 2PQ8A 3O4WA 1YW7A 4XLHA 1A6QA 4JK1X 3ULDA 4KB0A 2Y0SN 4YFNF 1WUAA 2XHKA 1NJIO 3BEXA 5ADXA 3LM9A 3MXMA 1OPCA 4CEAA 1YITN 1TZLA 3OYAA 4BE0A 2QENA 4HG2A 3L4QA 4GGGA 2KFDA 2Q2EA 3H0DA 1Z3YA 1WSFA 1KRPA 4UUVA 3WNHA 2EFQA 1B72B 3MWMA 1S6PA 3FX3A 4FOEA 3VQQA 2FQ3A 1HA8A 2QWOA 1D0ZA 3HSFA 4P1WA 4R79A 1HKCA 1R6RA 1H1VA 1LVAA 1XGNA 2EJRA 2IVNA 3MECA 4FWPA 2OPRA 1J0RA 2LY2A 4B1ZA 3V4GA 3C6AA 1D5VA 4NXNK 2IS6A 2CMPA 1A04A 2M0MA 1K78B 3RMBA 4I0AA 3B6OA 2ZFWA 4LG0A 2E1MB 4OIRF 2DYSH 2EK5A 3FKJA 1R00A 4PGGA 1S6LA 2BY3A 1UWBA 4HX8A 1YW9A 2DOAA 1MKMA 4KT5C 4LF7K 3J80K 2AXLA 3RMDA 5B3SH 3VPRA 3EZ5A 4MO5A 2X85A 2LBFA 3U21A 1RI7A 3LFKA 2CH0A 2RGVA 4L5EA 1ZR4A 2XAGA 1U2VA 2Q1NA 1IUYA 2W00A 1TVRA 1WSGA 5IOYA 4C1NI 5FKLA 1QZEA 2FOKA 3K5LA 5AFUA 3LSIA 3CC7I 3WHBA 4GV3A 4M3ZA 5IT9Z 1TWHJ 3WTSC 3HGGA 2I7PA 3K10A 4FXDA 3CMMA 4RWTA 5JHUA 2VKEA 4ZYAA 1B8IA 5LHGA 2ZF5O 3VQBA 3HP6A 4H5VA 3CLOA 4IDKA 4H4OA 4H0PA 4Y13A 1MMGA 4H0YB 5JS1A 1Z1DA 3HIFA 1MBFA 2UWMA 5K7FA 1ASWA 3ULQB 4CA0A 4IOAF 5KGWA 2DBBA 5BR8K 4KREA 5D3GA 3NF9A 2RQQA 3OIPA 2Q2EB 5IYBJ 1FJLA 2VC1A 1EO1A 2V9PA 3VSLA 5FLXO 1OQYA 5CPRB 3JRIA 1N25A 1FKOA 5EYRA 1TGOA 4CEOA 2CUEA 2DT5A 4DFJA 2VUMJ 3AGRA 5EX5A 1XMAA 4I7FA 3RTRA 1LQ1A 4IO8A 4XEIA 3I8DA 1QQOA 3CC2N 4JYKA 4H5RA 2FXUA 3LM2A 1ZBIA 3K2PA 3DLLL 1NTCA 2CV1A 1TV6A 5CVRA 3SZTA 4HNVA 3ZP5A 4DQQA 1LE8A 2ZB9A 2QQBA 1RR8C 2LP0A 4G7HF 1HXDA 1DP7P 3W2AA 4IKFA 2EIJH 4EM2A 1XHXA 1SFKA 1FBSA 2CUZA 3QEWA 1Z05A 5BREA 1Y8RB 1MJAA 1N6QA 3R6SA 1REPC 2XY8A 4CEEA 4IEJA 4D9JA 3WNEA 3HT3A 3MXIA 1HBXG 1ZR2A 1HYVA 3T1HK 3CP2A 4FT8A 1OVYA 1MMDA 3M8PA 5CR4A 1PVEA 2L5QA 4U67L 5AQNA 1GVJA 3VEZA 1L3UA 1HR0K 2MC4A 2B0LA 2K5CA 3RI4A 4FQGA 5JVHL 1CXUA 4G7ZF 5JVTA 2DA3A 4Y1CA 5HDKA 4Y33A 1KTQA 2GWRA 4B1XB 1D9FA 1T6DA 4E7IA 2A1SA 5GAGP 5CZ2A 2JMWA 3WNFA 1Y6IA 4PKIA 4X62K 1JJ6C 2HYFA 1W5CC 4Q5VA 2K85A 1BOBA 4CE9A 3MKZA 2JWTA 3O3KA 1XC3A 3CUQB 4HCCA 1SD5A 3O1BA 1LDJA 5LRSA 2DLLA 1TUYA 3HM5A 1C0MA 2HZDA 2BE2A 5BN9A 4ZHRA 2QKBA 2X74A 1CF7B 3ABKH 5KPRA 4PKHA 1P92A 1VNDA 4CHPA 3KX2A 4ON0A 2CFXA 1IW7F 4QS9A 2HB5A 2JUCA 3BTCA 1NG6A 1MJ9A 2EH3A 3R9PA 3EY1A 4GY2B 1Q9XA 2K9MA 2ZKZA 1HDPA 3SQ4A 3RYRA 3WODF 5J8FA 1T39A 2P6SA 1J9IA 3ZQCA 3S9HA 2YX4A 2IGOA 2YS9A 3X2QH 4CUGA 2JPCA 3GTGJ 2HOSA 3HI0A 5J2PA 3THYA 1R5ID 1R58A 2P9LA 4CO8A 4M6YA 2KIUA 3SZPA 3TSQA 4JI3K 1T98A 4B44A 3ZSWA 3BCBA 4CD1A 1J6ZA 3ZEUB 3VYRB 4CGIA 3PX4A 5ICEA 3VQDA 3FGUA 3HKZN 5FPDA 2XY5A 4JI8K 4H5NA 5KQDA 2X0LA 4X0GA 4Y17A 1I3AA 2XGXA 3FM3A 3RQ4A 3Q0VA 5J2NA 5LGNA 1NKBA 4ZH4F 4KIBA 3FXOA 4YFXF 5M5XJ 1OYWA 2OBPA 2HR3A 1JKOC 1R5HA 4CJ4A 3TABA 3HJFA 2P9SA 3O5BA 4JBAA 2FBKA 1JJ8C 4NYFA 1W1WE 1USTA 2R3SA 4KN4X 3HVRA 2GLOA 2DOEA 4HX7A 5CQEA 1VQMI 4BNCA 1YVNA 3SNNA 4DW6A 3CC4I 1NK9A 3IAYA 4RB3C 3K4CA 1H89C 3J80Z 1I6HJ 2OPSA 4GVEA 2RNGA 1GHCA 3E6DA 2P9KA 1ZGAA 3ZCOA 3FBNB 4DBRA 1APLC 1I1GA 1CZAN 3KZBA 4RAFA 1HKQA 3AKZA 5BPDA 2F5DA 3S8PA 1A5JA 4IJNA 3GVAA 3O80A 3K5MA 5BOXA 1JKPC 2FBYA 1S7OA 2GXAA 2NS8A 4IHYA 3K57A 4DV2K 1NNEA 2GA1A 4GFBA 1OYYA 3DXKB 2GUPA 1HSJA 4LH5A 3H1CA 1QSYA 3DYAA 3WEEB 3K4MA 1S72N 5EOYA 1U9NA 3CG7A 4CJ5A 4BDZA 3SJHA 4FM0A 2HHQA 3HB9A 3D2FB 5BNGA 3TPQA 4DR2K 3SUNA 4C3JJ 5C12A 4ELTA 5K7HA 1BA1A 1IH7A 3M1FA 4LF4K 2HHSA 1T56A 3BR1A 3RMCA 2RPIA 3H5NA 4CZGA 4BG9A 1R1VA 3GTLJ 1ATNA 2KIQA 2KQRA 4YEJA 3VQCA 4BE2A 1DKGD 2KHOA 4DWIA 4E6KG 3FK7A 4IO9F 4E19A 5LEKA 5BPIA 2E1CA 3MXJA 5AQTA 3HXMA 1GDTA 2M8GX 1VQ4N 4RGUA 1J54A 3QIOA 4MTEA 1KU7A 4BRMA 3I9V2 5AIQA 3DMJA 3R0JA 1O3RA 4HDUA 2BUPA 3CCEN 1NG7A 2QZ8A 2QKLB 3RPUD 4EZ9A 4F4KA 1K61A 5KPTA 3AV9A 3I56N 1JLGA 4DU3A 1QTMA 1DTTA 4MO4A 4CFCA 1V5GA 5LHHA 1KXPA 3V7CA 4U0YA 5DK5A 3HM9A 3CCMI 3BDPA 2X1CA 2UUZA 4M9ZA 2VBWA 1S1WA 4E70A 2KLAA 4JD2B 1MU2A 3P39A 3TTDA 3CUOA 1HX1A 2ZSIB 3R0AA 4FM2A 3OYHA 2HVSA 3FWEA 4CJRA 3FMQA 3CDIA 4JP0A 5FPNA 1S3JA 1N5YA 4BYYA 4YRVA 2L01A 4DG1A 4J2DA 5IT9O 1HLUA 2XKPA 3BCAA 4HV6A 3J7ZI 1X3MA 5JHFA 3HOSA 2YNHA 1LEAA 3CCSI 3QFUA 4RDUA 4PWDA 1B6AA 3IUOA 1NGDA 3A5LC 5ICGA 1TT0A 3DBRB 1BQMA 4ASNA 3E0JB 3LSKA 4ESBA 1RBRA 3OBYA 3ZT3A 4HF1A 3NFAA 3DLAA 1QVUA 4UUTA 1WPKA 2XAFA 5TJJA 2JA5J 4A2AA 2DPUA 1LUJB 1KYWA 3K2ZA 1IUFA 1K9MO 3B6CA 4E7KA 3UKRA 5KCMA 2VKHA 3K70D 3AG4H 2ZJQF 1NLVA 2YX7A 1LEBA 3RKWA 3C1DA 3OA9A 2D0PA 5GAHP 3PLAA 4BGDA 4D7NA 3TW6A 3VENA 3C18A 2HVIA 5DS9A 1IJJA 1FP2A 4ZZLA 3ZSRA 2FF4A 1J5EK 1T95A 4X6AJ 4UQGA 3BR5A 3CCVN 2FEZA 3KP3A 3MEGA 4BR7A 2CG4A 2XASA 1IZ1A 1MSEC 2FRHA 2NAZA 2KDZA 1F21A 1Y64A 2GEMA 2ZXWH 2HNYA 4FLWA 2E2PA 5LJVA 3FDYA 2FSWA 4NHJA 1QPIA 2I10A 1BOAA 3F8MA 1ZARA 1IRZA 1RT1A 3CETA 3ABLH 1NOYA 3BZCA 1NK3P 3H1QA 1XDSA 1XGMA 2HU9A 1NK4A 4BQLA 1QRYA 5AQZA 3RKYA 1FOYA 3CO6C 3CD6N 3CDLA 4XONA 5L3GA 3S1MJ 3NHGA 1U49A 2HNDA 3C65A 3HEFA 2XB5A 2VQHA 2W48A 1POGA 1OCPA 2GWKA 1BR2A 1KVCA 4OOIA 1BUPA 1FMWA 2X4HA 1G6NA 1KQ8A 2L54A 1YUWA 1UHSA 3QWLA 5E17F 3OW2M 1SEUA 3JCUC 5K1YA 3VQ5A 1OKJA 1KD1O 2P51A 2CQXA 4TSXA 3RYPA 5C25A 2QKKA 2Y69H 3QAHA 3REOA 5J4VA 5JFRA 3DTEA 4Z4CA 4L0YB 4S04A 5FO5A 2VODA 2QWNA 2WOMA 1C1AA 1EH8A 1J09A 5L3BA 4A12A 1WSEA 1DPRA 3KEOA 4E1JA 2XVCA 4A3FJ 2ZJRF 3LDNA 1JL2A 3PSFA 1U3EM 3RCOA 3A0IX 3THXB 5FRNA 3JRBA 3TDZC 3A01A 2YHXA 2L0KA 3KP4A 1VQ5I 3NBPA 4XLEA 4CZMA 5JVGL 4M73A 4OO1J 2D1KA 2HKXA 5EVZA 3CI5A 2M45A 2A41A 4XKWA 5FKKA 2Z99A 3GZ6A 4OIQF 1L3SA 4S05A 2XSDC 1R7JA 3RZDJ 1IAWA 3IDHA 1KQSM 2M7BA 4GNIA 2AA4A 2YX6A 5I42A 1RT3A 3LP3A 3VOEA 5C0YA 3F6OA 2NZTA 4JNEA 2ZMEC 3L2QA 4FWKA 5C10A 4ILJA 1K6YA 3GZNB 1C0WA 4M74A 2Z9OA 3EYYA 3SQ1A 3QNNA 2IRFG 3DLRA 1L5UA 4DTJA 3OYNA 3CMYA 2F7TA 2ZXHA 1J9AA 2Z1JA 5J2MA 4HYEA 2HSTA 4BJ5C 1YHQN 4LG3A 4X65K 3W2WA 1ON1A 3KLGA 3RSEA 1VQ6N 3UE5A 3HKZA 3RPUA 4CZZA 4XSXF 2E1MC 1RNLA 2XUBA 4ANJA 4DIQA 1CQTA 1GLEG 4XH5A 3WTVC 1X1BA 2P9UB 3T1AA 4CBWA 4CF2A 1TW3A 3V9UA 3QODA 4UXNA 1RBTA 2G0EA 4CYDA 2ME6A 5F27A 4V2GA 2KQ2A 4A2UA 2CV2A 4PCQA 3H92A 4ZDOA 3BP8A 3QINA 3SFZA 1U2VB 4RTFD 1IO2A 4Y15A 3VETA 2GIVA 2JRMA 1VQ8I 2D0OA 2EFPA 4FJNA 4LC9B 2XB0X 3OIOA 3WE3A 4HNUA 1LCUA 1TKDA 5GIPA 1H9GA 2W25A 2IAIA 3NEUA 2ICWG 5IWAK 3TAMA 3QQAA 2LREA 5IP7J 2O0YA 4IRIA 1GLNA 3TU5A 3V9WA 4DSEA 2IA0A 3V9ZA 1FW6A 5E3NA 2LNBA 5E8IA 1K78A 4EEFG 5GIOA 3FFIA 4AHVA 1U5TC 2D2WA 3TR8A 2O8DB 4FPBA 2HNHA 4G6QA 4BU2A 4C2TA 4CCMA 2LH9A 1BHLA 2Q31A 1QZ5A 2RREA 5AQOA 2R0QC 3WXLA 4BC3A 4DTUA 3PNTA 4DTOA 1KONA 3Q0WA 5C3EJ 2M5WA 3MK6A 4CHOA 4U7BA 2F6CA 1Y1VJ 3HUGA 4MO7A 1TNSA 2FMLA 5TISC 3L00A 2HWVA 4XN0A 3RSNA 1RZ4A 3S15J 4IO9L 4KAZA 4AC0A 4AHRA 1X4PA 2YHWA 3DV8A 3OOPA 3HOUJ 1T0FA 2ZGYA 1YX3A 1BISA 3ATUA 3TTCA 4DTXA 4KHSA 3DRRA 4DQIA 3E7LA 2CSOA 2MD5A 1OCCH 5IPAA 4DR4K 1XX5A 2ZBKA 2O3FA 3SFIA 3AO5A 5DD8A 1GVDA 2AS5F 2CFOA 1JTXA 2DDAA 4KICA 3TP3A 4EHUA 1Q9YA 3PO4A 4KHYA 2XPWA 3VQ6A 4DF4A 4GXOA 1OFCX 3TAPA 1ZLKA 5TRDA 1QZ6A 2VQCA 2WTUA 4ZDPA 2F96A 3PIPL 2M0CA 4YG2F 2W57A 1YJWI 2V26A 3IRQA 1FYLA 5JICA 2Q1ZB 3CJQB 2JA6J 1FY7A 2QQAA 3P5JA 4I2PA 2W42A 4M3EA 1JT0A 1Y56A 3C94A 4E0DA 4KRFA 2A5YB 1YHQI 4M45A 4ZZDA 5GINA 5TKWA 4ZYGA 1WI9A 4FLUA 3LWMA 4AYBA 5EU7A 4HWIA 2VT2A 4L5IA 2MC3A 5IP9J 4CJSA 2I5UA 4BRCA 4W1UA 3ZQHA 1VQLN 4N4NB 2LSNA 5AQMA 1HKSA 3I54A 2LC2A 3FK6A 3DPTA 5GTHC 1WQ2A 3EKSA 3LP2A 1H8AC 5FJ8J 5IT3A 1GLJO 2AHQA 4QAGA 4DR3K 4BAYA 2W40A 1VQOI 3U9GA 3OSGA 3MN6A 4CJ3A 4H0EA 1YOVB 2MLKA 5CVVA 1OCOH 3BLYA 1ACIA 1JKRC 3AO2A 4ID5A 3NCIA 2H94A 4A3BJ 5FLXK 2VB6A 2JGUA 4BKXA 4H5WA 2RN7A 3WEEA 2RAEA 2V6CA 3IH4A 4A69C 3UNGC 1TUUA 2Y1JA 3VODA 1WNSA 2YR2A 4XLAA 1L0OC 3EE8A 3HSCA 2GXGA 5HNHA 3V1OA 2CQNA 4M3UA 4J8FA 2WBMA 3OYLA 4OWRB 4A3KJ 4I6MA 5CZ1A 3HRTA 5EG0A 3IKTA 1R22A 3TGNA 1TL3A 1WN7A 2AP1A 1XI1A 4A59A 1LV5A 1BI0A 4B3OA 4NQWB 2V1UA 1HF0A 2M30A 4KISA 3T1BA 1I94K 3G6EI 3M3ZA 1ETOA 3G3ZA 4WWCA 2M87A 2FA5A 3KIOA 1LFPA 1VTNC 4MQVA 2O4GA 3DXMA 4OKJA 5J2QA 1P9QC 1YLFA 2G7UA 1UAXA 4O5FA 3CCSN 2Z5UA 1K8KB 3KLOA 1OH5A 2VIXA 1ZXOA 1JKQC 1DPUA 1HKGA 4YOYA 3H3VK 2Q8KA 4FWRA 1Q7YO 5H2FC 4YOVA 1HQUA 4MEYF 4CERA 4XK4A 3WGHA 3CF5F 1MMSA 4QOZB 4XRFA 2HF3A 3V4IA 4RGXA 4DBQA 1RBSA 3MN9A 4YOTA 1LE8B 2J4RA 2P9NB 3VERA 3KE2A 1VSMA 5JLHA 3CDHA 2G8IA 3KPHA 1MMNA 2V9KA 4ENKA 1Y39A 1K79A 4IWVA 1SAUA 4DR6K 1UJ8A 2MGQA 1WSUA 1VAZA 2ZNZA 2AO9A 3W6VA 4KH6A 1ETXA 5GAGJ 1XMQK 1HPZA 5BPLA 2IXSA 3H36A 3JSOA 4JS5A 5B1BH 1BI4B 2O4IA 1D3YA 2O8XA 4CEDA 4WXCA 3V7RA 5ILUA 2JWKA 2KL4A 5HOOA 2A61A 4M3GA 2FBVA 1O3QA 3QIPA 1BIZA 2JLEA 4JK8A 2ZC2A 3G1LA 1USSA 1WSHA 2QSGX 3B8AX 4DKWA 3VEPA 1EX4A 1BI2A 2STWA 2TDXA 4I76A 2L7KA 5EDNA 2ETJA 4LH4A 5DYMA 1Z91A 3SZGA 2EV6A 4KMFA 1LOTB 2VBYA 2GUIA 4IRGA 2R7DA 3SMPA 1W7PB 5KQ8A 3DKYA 4IEIA 3VTIA 3CXCM 1TLHB 1OH7A 1IJWC 1OYIA 5B66C 3F0CA 3I3LA 2HBLA 3GBTA 4PL8A 3SBTA 4KHPK 1P7JA 4OAYA 3L2WA 1IXCA 4C8MA 4QCLA 3JTGA 2OPPA 2BXYA 3S1NJ 3ERED 4U0WA 3AVJA 1YIOA 2GIZA 3SEZA 4YDUC 3HPHA 1QBJA 1OLTA 4E7HA 1XC9A 4FLXA 1JUPA 1TL8A 1HRHA 5A2QZ 1NK2P 4ENMA 2GTDA 3CLQA 4CZHA 4IQJA 3AVAA 3G0ZA 1ZBFA 1W0TA 1B1BA 1HSTA 1C1CA 4JI0K 4H8KA 1FIPA 3C2BA 3FHNA 4UVCA 1O7FA 2E1ZA 2P5KA 3NH2A 3FZFA 4CZIA 3ZQFA 4CZLA 2WC2A 5CVUA 4EM1A 4CCOA 3WGIA 3AA3A 4MLHA 2OZMA 2DTZA 1IGNA 3GCMA 3N97A 2DMUA 4AM3A 1RT5A 4B08A 5CKTA 1W2BM 3K69A 2KT0A 4E1MA 4BGBA 4V19S 4K43A 4QTRA 2OQGA 4FZZA 4W5TA 2CQ7A 4HUFA 2BV6A 3M8FA 4CH7A 3ABUA 3B02A 5CYMA 2A6EF 5AQWA 3T7ZA 4V2FA 3O9QA 2VQFK 3S16J 4LFUA 2NRVA 4EMSA 4UHTA 2VCPA 5LEJA 4GV9A 5GAEJ 1X9JA 3T8TA 3S14J 3QU6A 2BTFA 4E1NA 3LAJA 1F4KA 4KHWA 5F08A 3S93A 3IG1A 3S32A 4IF4A 1RILA 4FJLA 3NF6A 2VI6A 2PBDA 1Q1VA 3CUQC 1U04A 3O2PE 4N76A 4CIEA 1X9MA 2NNNA 5KGXA 3F72A 3NVKA 5AFUH 2WAFA 1MDMA 4DTPA 1JT6A 5J47A 3AVLA 4M9SA 1S1TA 2HGCA 2IEKA 4BQQA 4WK8F 2HOTA 5HRSA 4I01A 3J7YP 2WV1A 1VQ6I 1ASVA 2L7ZA 4BDYA 3H1VX 3KVGA 2DA5A 2ECBA 4JK9A 5ELZA 3VF4A 2ZGZA 5BRFA 3FZKA 3VQ7A 4Q4ZF 1ETYA 4A3EJ 1ZRDA 3ZSOA 1W36C 4K2EA 3QB0A 4CBXA 5E79C 1SQKA 2OZSA 5GTIC 5HDGA 3OYCA 1MGTA 3ASOH 3JRCA 3DLEA 3TAGA 4B9MA 2CW8A 4CJVA 3CTAA 2DI3A 3MMVA 3N4PA 4B1WB 1YT3A 3C2HA 2ESNA 2K3PA 1G3WA 3BG7A 4LG0B 3NF8A 2IAJA 4CI6A 2EV0A 4HF0A 4JX4A 4BL0B 1K6OA 3NARA 2H1LA 1MWMA 3D2FA 4O0JA 4AIHA 3H3ZA 3RSEB 2HVHA 4A5AA 2XHBA 3BT9A 1V5EA 4G8XA 1WAJA 3W2VA 4Z4FA 3BY6A 5M5WJ 5KAFC 1FEXA 3V42A 1T6CA 2UXBK 1ZBSA 2P9IB 4FW1A 1XSVA 5ICFA 4BY7J 4Q5SF 4UV9A 1ATSA 2LTPA 1V3FA 4OVLA 1OCZH 3KP7A 1TYQB 3AGKA 2LDUA 3DXJF 3TOBA 2IA1A 1FTZA 4BQZA 4W5QA 1RBVA 5EXWA 1NK7A 3CPEA 3NRVA 2P6TA 4KNYA 2LFBA 3ERMA 5E1WA 4LY7A 3MCPA 5H1SQ 1RDAA 2L4MA 3LA7A 2RVCA 1Q82O 3VEYA 1F36A 3WTWC 4B9UA 3O6BB 2HXIA 4WQ5C 4AHSA 1YTUA 4MFDA 2B4JA 3DRSA 3M8QA 5F64A 3T3FA 4DTSA 2HQNA 2WY7Q 2ZFUA 3NWSA 4HX4A 1EQYA 1MDUB 1S3XA 2CS3A 4J00A 1DLOA 2OPQA 3CFOA 4ISEA 4DV1K 3TL4X 3VF6A 5C15A 1T05A 1YJWN 3KP2A 5J6XA 3LPTA 4IBNA 4M3DA 1XCBA 2P9IA 3HJEA 4HLXA 4YOUA 2O5RA 3QDKA 1TAQA 4BDPA 4DV3K 1X19A 1ZH5A 3FR0A 3TO6A 4QWQA 3LOCA 4R8HA 3EZWA 3KJVA 2KKZA 1Z7LA 1LVKA 3DAWA 1IRFA 5A2QK 2P7CB 3O4QA 3W3CA 4OGEA 3G2BA 1W7PA 1KCFA 4B1VA 1HW2A 2WUSA 1LFBA 1ONVA 1O4XA 2L2OA 3HRUA 1UMQA 1DGWY 1X3NA 3OWTA 4LLLA 3K5OA 5DEQA 4ID1A 3CFPA 2BZTA 2DQLA 2ID6A 4UB8C 3DLLF 1BJZA 5GPAA 3HC7A 2YUSA 3P38A 2UUAK 2O8CB 4LF6K 1LAWA 1QZZA 2K9QA 2DN0A 4FTHA 3S41A 2HDDA 1R71A 2PMZN 4HUGA 4KITB 2F9WA 2G8FA 4CSWA 3HM8A 3DFGA 3DU6A 4CGFA 2OF7A 4AH9A 3ISNC 3BF1A 1YW8A 1D8JA 2DW4A 2EILH 1RDCA 4KUMA 4JN4A 1ETVA 5FD6A 1YTYA 3B6PA 1HKTA 1R4MB 3GTKJ 1IDZA 1JCEA 4LK1F 4BACA 1W0HA 3QPLA 2GELA 4FE4A 2UZKA 1O13A 4CFAA 1HPMA 1P4XA 4PJNA 4OAZA 3TMOA 4DZPA 3UKGA 2LK2A 1YFHA 4L18B 1P6RA 2DMQA 1NGFA 1IBKK 3LSGA 3ONQA 3TO9A 5BPMA 1X1CA 3GF2A 2OQRA 5GAHJ 1WAFA 3LWLA 3CERA 3M3YJ 3BZKA 2NVXJ 2GOXB 3HVTA 2FJ1A 4AVZA 4K8XA 3G1MA 3G4SI 1VSIA 4BRQA 4YY3K 1YO5C 3UIQA 3CYMA 4JKFA 2F4OB 4DTMA 1TWAJ 4QIWN 4B43A 2A6TA 2K86A 2O6GE 2QBYA 2H8WA 2B5JA 4A5MA 3R8EA 1T08B 1SFEA 4JV5K 4FWOA 1IV8A 3ZMDA 5F2RA 3J7AP 5GP9A 2B6AA 2G8HA 1UG0A 1ESVA 4A5NA 3QPSA 1GLLO 1J2XA 2EWNA 1IBLK 1MSFC 3HUGB 1RFQA 4WYBA 4HHTA 1ZBHA 4JD2A 4XMYA 4I7HA 2HNZA 5DUIA 2XAHA 3HTSB 1NGBA 2L9SA 1BI3A 1DGKN 1MIJA 1PUFB 4MEXF 1T38A 2AQFA 2W4SA 4U87A 4E7ZA 1JE8A 2ACJA 1UOCA 3SBGA 3CFRA 4EIAA 4PSWA 4IFYA 4L9JA 2EFOA 3FF5A 2ME0A 1TW2A 2OD5A 4M3FA 4AIJA 3CJ7A 2O61A 3MCAB 4BRAA 5C4XJ 2F9TA 4RM2A 3MQ0A 4EFHA 1K4TA 2X1DA 4A0YA 4IOCL 3H08A 4MLEA 4RB0A 2HBJA 4XLNF 4CZCA 3QPTA 3FZMA 3OVNA 4GVMA 5AZIA 4MGRA 4KH4A 3IKMA 3KLEA 3K0LA 5FFXA 5IY5H 3CJNA 3OYFA 2G8WA 3J7ZO 2FF3B 4KTQA 4BJ6C 2EZKA 4KJZA 3VB2A 4AWXB 1BJAA 2QKMB 4FETA 1S6QA 3GEZA 4DQ8A 1FXXA 4GMJB 2LD5A 1BIBA 1ETQA 1I39A 1BCOA 1BQNA 3E5XA 3CCMN 1TK5A 4DOZA 4CHUA 5EEGA 3SDBA 4RW4A 3EQLF 1S9GA 4DGWB 1Y0NA 4Z0UA 3DKWA 4Q48A 3E5UA 4ELUA 2NRXA 4WQ5A 2BBYA 1U2WA 3QBXA 3S17J 5FKNA 1NGCA 4CYCB 4ENJA 3MAJA 2XIGA 1JKHA 2D1VA 3TEDA 1HQCA 3QEVA 2P1JA 3JXUA 4WFBL 2L9VA 3C95A 3C3WA 1JUMA 3CC2I 1W0UA 4F91B 1KQ0A 3EE9A 3IHUA 2LF8A 1MZBA 5ICCA 3COAC 1TWFJ 2XO7A 3LA2A 3DEUA 3O3HA 2X6NA 4CZFA 2E1OA 1U9OA 1U0JA 4B3TK 1DP3A 4CVNE 2O8BB 3SAFA 4HOBA 2M2EA 4DS4A 2Z33A 2H8RA 2PJRB 5D5XB 4XORA 1MH4A 5LGUA 3HBTA 3M6GA 2I8DA 3P4IA 1EA3A 4RGSA 2LR8A 4CHQA 1NGGA 1WKMA 4BRDA 2VC0A 2ZWHA 1U45A 5FFZA 3GTQJ 5E84A 4AHUA 1A5XA 1XHZA 2XAJA 3Q5FA 3CCQN 2O8KA 2GBYA 4P96A 3L2UA 4AD9A 1EXQA 2V52B 3D7EO 2HDWA 2LKXA 4PHTX 5IT9K 1R1TA 2WAEA 2M4KA 2JZYA 1DU0A 4UVAA 3ZSQA 4CCHA 1FBQA 1W36D 2E36A 5AIPA 5F04A 5KNLA 1RDBA 2CV0A 4F93B 1ZLJA 4PJMA 2V4JC 2KRCA 1GLFO 2Y1IA 2YU9J 4CCLA 2RHKA 4ENNA 1TQMA 4ZTJA 2CQQA 3KLIA 1VQON 3Q7CA 4FJMA 2VJ5A 3R1XA 4C8LA 3SXYA 4BVOA 4W5RA 4XRSG 2PJPA 3GWZA 3PX0A 4CGGA 1FP1D 4FJHA 2DT6A 4KA4A 4PGHA 3PJRA 4JKCA 4A5BA 1RNHA 3CHWA 2BVMA 2DTRA 4BHPA 5E3OA 1RCHA 4F7ZA 2JRTA 4ILHA 3SAHA 3VA3A 1BL0A 2IS2A 4DV6K 1KFSA 2I7NA 2M1BA 4F3TA 3O08A 4FK0A 1RKWA 4OJRA 5AR0A 3A5OC 3NAEA 4FJKA 1BO5O 4B9TA 2VXDA 4EJTA 1NMDA 4Z6YA 2UUBK 2DOFA 1WZ2A 2BXZA 4BBSJ 3HP9A 3I8BA 3LDQA 2DFIA 1MWKA 4C3HJ 4LGWA 5J1RA 3BG6A 5D5WB 3KKSA 3LMMA 4CJEA 4ABZA 1GV2A 3WU1B 2EFNA 4PQUA 2LRDA 4BHCA 4GW6A 2FBHA 1FLIA 3AVNA 1VQ5N 3CM5A 3PUBA 5HRRA 3FM5A 2VG5A 2K27A 4E4HA 2R7OA 5BRHA 2NYXA 3F8CA 5HLIA 5BMZA 2GOMA 3BR3A 5JLWA 3QO9A 5AQUA 1D1CA 3KK1A 1U8BA 3K59A 4XL9A 4X66K 2H27A 4BR2A 3F6VA 3CP8A 2XSJC 3HDDA 1BA0A 3BOQA 3ULEA 1UA1A 1OCRH 3G71I 1V5FA 4OIPF 4MQ3A 3I0RA 3U4LA 4DV0K 2P5OA 3DRPA 2WONA 4DYRA 2CH6A 3DP7A 1EF4A 4G7OF 4HQEA 4FM1A 1X3UA 3AFHA 3GLXA 3KD1E 3DEEA 2OA8A 4WCGA 2R7FA 4CYCA 4JKEA 1YX5A 2BW3B 1RUNA 2FX0A 1AKHB 3CCRI 3MDQA 2GBZA 2W84A 3LNQA 3CCQI 1Y8QB 2IP2A 4BHBA 4ZYHA 3G25A 4FO0A 1E3OC 1W9HA 4AILC 4JX5A 1Z9CA 4AF1A 3LDSA 3GOIA 3LP0A 1LWCA 5F6FA 2HW3A 3I71A 1I1SA 1FMVA 4HA8A 4M9XA 4LIUA 4B4CA 3RDIA 4AU7A 3CMEI 1XSDA 1XS9A 1P90A 4IOXA 4JKBA 3VGKA 3OYEA 3GBGA 4KIGA 1ETWA 4EGYA 1B9FA 3RRGA 1NBWA 4OMYA 3FXJA 3LDPA 5AZIB 4DQRA 4XBFA 1TKXA 2I5JA 1O57A 1ZGJA 3BTIA 1TK0A 3I4PA 5F1RA 5D4SA 5B5EC 3WTXC 3CCLI 1HYSA 3IH3A 4F55A 3OMYA 1WRJA 3JRHA 2KP6A 2IS1A 1E0EA 3BQZA 2QWWA 3AVBA 4U88A 5BN8A 3K1MA 5BS6A 5KPZA 2A5WA 4EQQA 3AVIA 3KYCB 2R5ZA 4XH4A 5HVQC 1WB9A 2CGPA 5DCFA 3DPUA 2ITMA 3D0SA 1IKWA 3ZQQA 5FGMA 4AUXA 4K41A 3MKWB 5DMRA 1WJ5A 2OZUA 3RQIA 1BI4A 3WU2C 1JI8A 1UELB 2VPRA 4BXXJ 3OBWA 2KZZA 2VONA 4YFKF 3FLCO 1IV6A 5I9EB 4HZFA 2E6LA 3PM1A 3NE6A 4HPQA 5CJ9A 1Q18A 3SK3A 2EBIA 1JLEA 4FJ8A 1IG7A 1DQUA 3DI6A 1B72A 1BOTO 3SV4A 1DTQA 2NRZA 1WJEA 3AG3H 5IP6A 3T8RA 5CVIA 3O9RA 3HHHA 3Q0UA 4FJIA 5CLSA 4LFCK 1GXQA 1IN7A 1G3SA 4GRIA 3N4MA 2WC9A 3EKUA 1GOBA 4IXCA 1KAZA 3BJOA 4JAXA 1SL0A 3KCCA 1N34K 2P5GA 3MN7A 2F5VA 1RPWA 4Z2YA 1SS6A 2E5ZA 2DPDA 4DR7K 3GL1A 4WXHA 4BEHA 1XCVA 4FJ5A 3Q7BA 1WSJA 4RBOA 2PX9A 4BGAA 2RV8A 2QTDA 3ZX3A 4PJ0C 5AQLA 3OHRA 3HK2A 4I02A 4J19A 3HSTB 1VRUA 2P9NA 5LRRA 1TWCJ 1IN5A 2FQ4A 4PSXA 3AVHA 4B8CA 3AVMA 1UHMA 4XR6A 4F3QA 3OL3A 4DQ2A 4A3DJ 1T44A 2QEXI 3P31A 4JI5K 3NH0A 1E3MA 1O7LA 1D8KA 3PFYA 1MH3A 1SVMA 4P9FA 2ZJPF 4JHDA 4NO7A 1ZBLA 2K9LA 2L4AA 3BY5A 1BR4A 2QCOA 2KZMA 3CCVI 3ECHA 4OPKA 2HQAA 1NJYA 3W3DA 3CC7N 4YIRX 3F9MA 2VBZA 1RETA 3K0SA 1OMIA 5HRNA 3CQYA 2Z1HA 1V4TA 3ASMA 3FE1A 2R7YA 4ZYEA 4OU0A 1RT6A 4AM7A 5HODA 4Y1DA 3GFJA 2IS4A 4IJAA 4I0BA 1XSXA 4G6TB 3A1YA 2E2HJ 1XTAA 4X64K 3FMSA 2PG4A 2NOGA 3VGMA 4CJKA 2R7SA 1VQPI 3OY9A 3HOYJ 3U8XA 3ITHA 4BG8A 3ESWB 1VF9A 1ZYRF 2EZIA 1I6XA 2RNJA 3DBHB 2D0BA 2UXDK 5HRPA 4CCNA 3QFPA 3T1YK 4PJLA 1P4AA 2XDVA 3D5RC 3GXOA 2DK5A 1JXSA 2DA2A 2FSNA 2IS3A 2IPQX 4XLCA 4A0ZA 2Q2RA 5M3FJ 3O3FA 4M3RA 4IHXA 5D6FA 3AVGA 3JAMO 1ZHFA 3DQVC 3U6FA 4HUEA 2JK3A 4BWJA 3WQTA 2HOAA 4DV4K 3FKIJ 3LAKA 4CIGA 1J5OA 1W7PD 3MZHA 4E7JA 2TRTA 2V6EA 3GLLA 4OMZA 4WX9A 3J7AO 3K9TA 3FXUA 4CF8A 3HBLA 3WGGA 3WQUA 2ASOA 2QYOA 2IOCA 4BEHB 2VYPA 4M6XA 2GXBA 5C4JJ 4IX7A 5T7BA 3KZYA 3JSMA 2H3GX 1UCRA 3IC7A 2YU3A 1H9TA 4CHNA 3OYMA 4CF9A 2BEOA 2QBYB 2KFZA 2GA2A 1HJOA 3QBWA 3QESA 2DMTA 3ML6A 4C2MJ 2PI0A 4CJFA 1WSIA 2FLOA 1Z7UA 2JVGA 3M4OJ 3EO3A 1WH7A 5EF6A 2Q0OA 5D5UB 3NWTA 4FLYA 2K40A 1GV5A 3ECOA 2DJIA 1Q1HA 3WXIA 3U9DA 4KN7X 3M9AA 3KTQA 5DCMB 1VK0A 3R6MA 2VQLA 4NCAA 4DYQA 2Y31A 2N8GA 4L9VA 5HDNA 2LKPA 3PIPF 3OYGA 3HOTA 1HOMA 2X78A 3IMXA 4FL9A 4EJOA 2A6HF 2O8EB 2VQGA 2P0WA 1ZG5A 2MSYA 2XY7A 1WVRA 1JLAA 4LB6B 4UV8A 1R59O 1KA8A 3FXRA 2WV0A 2NRTA 3HRMA 3Q9SA 2R7VA 2CH5A 1E4FT 1C0TA 3GFMA 3L9FA 3L1PA 3DEWA 4M72A 3MKYB 3HRSA 4FPAA 5BRDA 3HGYA 3I53A 4QSHA 1UG2A 2F4MB 2XV4S 4NBQA 3ZOBA 2E88A 2BY0A 3OL4A 4XKBA 1QS4A 5AQJA 2RE2A 4CK1A 1NGJA 5C2FA 1PYVA 5LBQA 1TAUA 4EGZA 1X4OA 3I56I 5KHDA 4Z4GA 2L02A 3LZIA 2HHVA 3IWFA 1NGEA 4DU1A 2IIRA 2VWKA 2PFBA 2NNYA 1U78A 3KP6A 2V9VA 5E26A 4LMYA 2CUFA 3ZLJA 4BC2A 4ESJA 3EYZA 2JUGA 2G8UA 1KU2A 1MBEA 4CJLA 5LJWA 2QQ8A 4NNJA 1S8NA 2VBXA 3W6JB 4BVPA 4XOTA 3L4IA 1W5TA 1JUSA 3IL2A 2EPFA 2P9PB 2ZM6K 2ZJRL 2ZJQL 3QLHA 3QERA 3QOPA 3CCUI 1V54H 3R60A 4BS9A 2KKOA 1V4SA 1KZHA 3HHGA 1AKHA 3LANA 1KLNA 3P83D 2STTA 2GQQA 1OVQA 3V81A 3L3UA 4BJTA 3V8JA 3SI6A 3DLKA 4H5TA 4M3XA 3ZMVA 2E2QA 2A40A 4H0OA 3E9PA 1NK6A 2F8SA 2TCTA 3H9JA 3ZQIA 4A6DA 4AIDA 3WXJA 3G71N 3IRXA 2W24A 3VQAA 4Z4IA 1N8RO 3L09A 1SVOA 3NGZA 1N36K 2XROA 4K0KK 2K4BA 5M3MJ 2EX3A 4BRKA 1X58A 3QP5A 4B9QA 2QW9A 5CE3A 2R7QA 4FLZA 4B47A 1T7PA 3KD5E 4DSFA 3CMEN 4E89A 2MH9A 1JXEA 5TGTA 5TKYA 1W97L 3WU0A 1YVUA 2BE5F 4GKKK 3S2HJ 1ZAOA 4LIVA 5K5QA 2JQ7A 3I64A 1BN5A 3OYJA 2A07F 3O4NA 3QMLA 3ZSYA 4AVPA 4BR5A 3L6QA 4FISA 2M9HA 3DXMB 3AG1H 3VEOA 2QXLA 1BR1A 2LY1A 3RKXA 3THWA 3CCLN 3AAPA 3PY8A 1DGRM 4DR5K 3DPLC 4NXMK 1R49A 3TARA 1C6VA 2F5CA 4NQWA 2W6LA 3K9JA 4BRNA 3LDOA 5M5YJ 2Q3SA 1T2KA 2VG7A 3W6KB 1VSDA 5AQRA 1IBMK 3QETA 3K4JA 4Q0BA 4O55A 3ZSXA 5L3EA 4J2BA 5CQGA 1CF7A 4KI6A 2Q0UA 4B1RA 3TDUC 3WE2A 1I27A 1OJLA 1IC8A 2HZTA 2KIFA 4IHTA 4A2BA 1F43A 5GADJ 1BIAA 5AQYA 4XM3A 3CF2A 5H6RA 3K70C 1M1KO 1O3SA 3DXKA 4F2SA 4I2QA 3BJ6A 2V1XA 4DHYA 2UXNA 5KRTA 2X48A 3ZR8X 1ENHA 4R1HA 1BCMA 2R7RA 3RKQA 3RR7A 1T8EA 4JKDA 1N32K 5CYVA 1XUPO 3LAPA 3TW7A 3K2AA 5H20A 2IGNA 2OCEA 1SMYF 2HVQA 2YHAA 3AL0C 5EJCA 1QU3A 1BG3A 3BWGA 2W6KA 3P1GA 5KTQA 3IV5A 3CJRB 4L3QA 2UV1A 1PUEE 2HEOA 3HZ6A 4YELA 4JHDB 2UXXA 2ETHA 4HSTA 1QVGM 1Z77A 4PK4A 1IN6A 1KU3A 3WNGA 1WJBA 1YYVA 2XPVA 5DTDA 2D5RA 1QZYA 1XGSA 4HSRA 1JLCA 3WXKA 5GPCA 1XGOA 4BRIA 1U48A 2KRHA 1A6IA 4QPOA 3O8GA 2P9SB 5M1FA 3KFWX 4B3MK 4MLOA 4XLPF 2G8VA 2NOJB 1S1UA 4FZYA 2E34A 2WB1N 3QP6A 3T19A 2AXTC 2HBMA 3NAUA 3O8HA 4EJVA 1A5VA 4LJZF 1S5JA 2IGIA 5AQIA 5LMUK 5CHIA 3THXA 3VESA 4NC7A 3B73A 2D5VA 1FOKA 3TQNA 2LVSA 1ITYA 2YCHA 2WA0A 1LAVA 1U5TA 2YHBA 4ZTFA 3DLBA 5LLQA 4JLHA 1FNNA 2D1HA 4CGHA 5M1QA 1IRXA 5E3MA 2VKVA 4H0TB 3SEQA 4EHTA 1J75A 5FB2A 4IHWA 1T3VA 5K5OA 3GMEA 2IVMA 2XF5A 3MWPA 3JREA 2DO7A 3D2EA 2DAOA 4WQ4C 3UB5A 3P9IA 4BWMA 3GZ5A 1C0FA 1HYZA 1WFXA 1C1BA 3NH1A 3E1SA 2JSPA 4EJWA 1LW0A 1Q8IA 2E1YA 3VMFB 4O0IA 3V9XA 3RWUA 3AAFA 3K58A 2JSCA 1UAAA 1KQ9A 4IDHA 3MEDA 4HEA2 2COMA 4CJPA 2L9NA 3CJTB 3DU5A 2WY8Q 1NU0A 3UKUA 2FUG2 3I55N 1VQNN 2LF7A 5L3CA 2OAZA 2G7HA 5D8LB 3GTMJ 2MYSA 3UR3C 4FK4A 1YS7A 3ROUA 2Y48A 4F3OA 4PFOA 4F9OA 2E19A 3AVCA 5ILVA 3BGRA 3CCYA 1X9WA 1MMAA 2VN2A 4WQ4A 4B3RK 1QQIA 1BWFO 4KFBA 3HSEA 2X6YA 1MD0A 4DUZK 1ITGA 2X6OA 3B6AA 5IOZA 5K7ZA 3THWB 2VGNA 4BRPA 1ATRA 5E1ZB 2ZMEB 2ITGA 3S2DJ 3QNOA 1JLBA 1XD7A 5BPNA 4YNQA 2XKOA 3K4KA 3GTPJ 3GTJJ 2O7OA 3LSMA 4ITVA 4IHVA 2ATQA 4RGRA 1SD6A 1SD4A 2FF6A 1VI0A 2CUJA 3AVKA 4KPYA 3MZ8A 1P2FA 1TNTA 4A3GJ 3SAGA 1XC5A 3DF8A 2COBA 4N56A 1VQKI 2R92J 1RKTA 1SFXA 4IXAA 3U9ZA 3EPZA 4W5OA 3G4SN 1B4AA 4HBLA 4JX6A 1VSHA 4C1NK 3FISA 5E3LA 2ZQBA 1D8YA 2ISZA 1K8AO 3E6CC 2L9RA 2BW3A 1FSHA 3MN5A 4G12A 5MLCQ 3E6MA 3KK2A 2YPRA 3EDPA 3GUDA 2Y0MA 4A61A 3KHYA 3D5SC 3P9CA 5KAIC 1TTYA 4RB1A 1SC7A 3TTFA 4JI7K 3E01A 5BQTA 1NKCA 4W97A 4K25A 4RW6A 5F0XA 2RDPA 3ZQLA 3WXMB 3GW2A 3I4MJ 3QU3A 4DLEA 3I33A 1YS6A 3PO5A 2A3SA 2O03A 3SCXA 1SVLA 2MABA 3VA0A 4UY8O 2BY2A 4KMUX 3ZX2A 1QVTA 2NVUB 1EH6A 2LOOA 1S7EA 1QHHD 1NHAA 1O3TA 2W41A 4ETSA 3ZT2A 4LSNA 4CZKA 1EH7A 2QF7A 3FXKA 3NQOA 5B8HA 2Z1GA 3C6TA 3EUHC 3VQ9A 3BR0A 2O8FB 3AA2A 2QWRA 2UU9K 3I55I 1VQNI 3FXQA 3LL7A 5LHIA 1LKXA 5EG0B 2YI1A 5FPMA 4ILGB 1YI2I 3OR2C 4B09A 5AJ3K 3PQJA 3NGIA 4NB4A 3QYBA 3ZCMA 2PYLA 1VQ9I 5DD4A 2WWYA 3O3GA 1D9DA 3M8EA 1D1BA 1AU7A 2HOEA 4CCJA 2HKOA 1L3TA 4DR1K 3BG5A 3RMAA 1NK8A 3GYHX 2FE3A 4CIFA 2R7WA 2NRHA 2JJ7A 4BC4A 2WAQN 4JOMA 2CGKA 4DQPA 2GZWA 3OOUA 1FK9A 3HRGA 1X3ZB 4BRFA 4M3YA 1WOQA 3CCUN 2KJCA 3KWGA 5SWMA 3MD2A 5FROA 2QGUA 5DCMA 3C2GA 4I2OA 3MCZA 3L2VA 3DWLA 1UA0A 4FE7A 3F8FA 4C9YA 5AQGA 3W0LA 3F8BA 2MBFA 1SZ2A 1TC3C 2E5LK 1TP4A 3CIPA 2E71A 2RQPA 4Y52J 3CJAA 3OS0A 3F23A 3ZT4A 1OH8A 3ZYYX 1TL1A 4FJ7A 4C8KA 1Q86O 2HPMA 1Y1WJ 3IH2A 4RCHA 3LWFA 3V1QA 4O44A 2MD0A 4EV0A 4H0XB 4M6VA 4Z94A 2R7TA 4CJWA 2R4GA 4BUPA 4QLCU 3CO7C 1RBUA 4CK2A 4WE1A 2XY6A 5EEHA 1JHFA 3WT0A 2OZ6A 1RRJA 4XSZF 3IRRA 2NVQJ 3DJCA 5BR9A 3G6EN 4ELVA 1RIOH 1JCFA 1DDNA 3QEXA 1KSPA 1NWKA 4S0HB 1QHAA 1QQNA 1AWCA 2HFHA 1MA9B 3E97A 1W7AA 1J5YA 4NB5A 2XF6A 2K7LA 4UNOA 5AQHA 1RR7A 2F2EA 5L3DA 4D1QA 3O9TA 5EY4A 1QO0D 1EKEA 2EHGA 3AA5X 5DM7L 4YFUA 5HP1A 3IKVA 5DM6F 2IGKA 4KV8A 1E2XA 3TOAA 5LL6Z 3DBLB 2H1KA 3NF7A 4CZEA 5KVRA 2E6MA 2VKDA 1VQMN 5HS7A 2YHYA 3I5UA 2Y2ZA 5HLHA 2EFWA 2QWPA 4FOIA 4CESA 2OTLI 1YJ9N 2VL8A 1XWLA 2NNWA 4H4MA 2DK8A 2DMNA 1AHDP 2A1RA 3HO1A 2VJJA 4OPAA 4J01A 4XKVA 3ZMUA 3RIRA 2A6AA 1QHGA 5L3FA 4B9SA 4CEBA 2BVLA 1WGXA 4LFAK 1LNWA 1VQ9N 4B9LA 3CJ9A 2ZE2A 4F8RA 3HL2A 1VQ4I 3AY9A 3SYTA 3EETA 1BW5A 3E9LA 4HQMA 1LB2A 1XMKA 5FKMA 2GV9A 2OU2A 4I6ZA 4A62A 1BDGA 3LQRA 1GUUA 2CW0F 4P55A 3LSTA 4PDKA 4X1EA 1IG8A 1ORKA 5AONA 1VHXA 3PX6A 1H0MA 2AQEA 1NGHA 3HTVA 1HKBA 4F92B 3K7AJ 4LB5A 4DS5A 2KTQA 3L7WA 1RT7A 2F4IA 3AO3A 2YKNA 1TKTA 3F5TA 1YG2A 3T5XA 1K4SA 2XRLA 3BZ6A 2ZXIA 2W1OA 3PO3J 2HDCA 4K42A 4O5BA 1NK5A 1ODDA 2M34A 2GWJA 3GE1A 3O9UA 3ZX0A 2A42A 4DTNA 3WTUC 5EGOB 4UUSA 1MDMB 2VGMA 4I99C 4G6DA 5C44J 1RTDA 1M1EB 1GLAG 3RZOJ 1KGSA 3BUZB 3V1RA 2M7AA 2QWLA 1OH6A 1R4NB 4Z4HA 2V1NA 4HRIA 3QYFA 2IW5A 4DLGA 4RLQA 5FD5A 4OGCA 4OKEA 1WJAA 2XPUA 3H5AA 1DU6A 4TV7A 3SMSA 3MZYA 1N75A 1SKRA 1CLQA 4N9IA 3A5NC 4U7DA 4FVUA 3A03A 3SZ2A 3KYDB 1GT0C 2PLYA 4CXFA 1E17A 1RT4A 3DOLA 2KPMA 3L2RA 2CQKA 2YSRA 4N47A 1X2NA 2IGMA 4ZDLA 3ATVA 4IPAA 2R5YA 3FZLA 1S1VA 4QPQA 2DA7A 3ULEB 3VN5A 3SUQA 3MEXA 2QA4I 1BC8C 1QE1A 2QQ9A 1HJRA 1Q81O 2DFFA 4RAYA 4W5NA 1XB4A 4JYAK 2FU4A 2IA2A 1R1UA 4B48A 3U1DA 4G9YA 3SQ0A 4CECA 4MQ9F 2HYJA 2DTUA 4JI4K 3C7NB 1WJCA 2E7XA 3SQNA 2XAQA 4DSIA 2J5PA 1MJBA 3ISPA 1YIJI 3FFKB 5FLMJ 3M8RA 3Q3SA 1RDWX 3S3NA 2IT0A 4II2A 4CCKA 5F1JA 1I3QJ 3QEPA 1U6GA 2ZSHB 3LQQA 3M7GA 3MN2A 5J1YA 2E8AA 5JLFA 1QSSA 4GYIA 2XAUA 1IV0A 2DPNA 2A3ZA 4D0PA 1IKYA 4HLYA 2JWLA 2LG4A 3WG9A 4KHUA 3ZXSA 5DDGA 3WTTC 3HOXJ 1W4MA 1OR7A 4FHTA 5KK1A 3VYSB 3V8KA 4FASD 1HC8A 4AM6A 2PN6A 3BR2A 1QPMA 3LFUA 5ED4A 4MFBA 5AQSA 3JRAA 5GADP 3ZETA 5E8GA 4NDLA 3ZN0A 1BIUA 2FNAA 2OANA 1YXQA 2XGDA 3BJAA 4RM3A 1WWXA 4UB6C 3F3XA 1D4XA 4XN3A 4CFBA 3EUHA 2JA8J 4HTUA 2Y75A 3A0HC 1ZG3A 1HW1A 2F48A 2E2NA 4FZXC 4E7SA 2P9KB 3OJSA 3BQYA 3I0SA 1LDKB 1GXPA 1HUXA 2J5OA 2JVHA 1Z21A 3C7NA 3PFIA 3FZVA 1FKPA 4M3TA 2OTJN 4FK2A 2K9SA 4FJXA 1FWZA 1QNTA 4QS8A 2E2OA 1NJXA 4KFCA 1XQSC 1X3WB 3DWLE 2A68F 5LFAA 2BANA 4HV5A 1KYZA 2EIMH 4IFVA 1FX7A 1H88C 1G99A 1AOYA 4CEQA 2D0AA 3RTVA 4FYDA 3D45A 2BOLA 5M1NA 2HTJA 2LKSA 2P4WA 2YJFA 4BQAA 4HW0A 3VSKA 3EUAA 4CJUA 4JKGA 2X6WA 4ZYDA 1YRNA 1C0GA 1ZKGA 2H09A 3F73A 4LOCA 3DKXA 5LY3A 4WFAL 2HQ5A 4E7LA 1OCTC 2W85A 4BRGA 1RUOA 1D0YA 4XRSA 3M8SA 1LW2A 5HLTA 1S1XA 3CC4N 3LSPA 2WBNA 3G73A 3CMAN 3VDXA 4FX0A 4OIOF 4J2EA 3TBIA 4Y0WA 2NS7A 4IRHA 2MH2A 3ZMTA 5E18F 2PFUA 2E35A 2D0CA 4HAMA 1YI2N 4FWSA 2F4VK 1YTAA 1FT9A 3FMRA 4PJJA 3ZMZA 3U2RA 1KVBA 1UB9A 3A0BC 4ICLA 4BC5A 1OISA 1NK0A 3HXLA 1VQ8N 3QOEA 1XMOK 3MWTA 4N4OB 4IOCF 2PBIA 1FYMA 3PNVA 4C30A 4YIIA 2CW7A 3I4NJ 3LAMA 1BI1A 2FSKA 1N78A 2NLXA 2VG6A 5DM6L 2Z3YA 3T0YA 3VQ4A 3IUCA 4MIMA 3H0GJ 4AYBN 1AA7A 4EM0B 2LY9A 1B8IB 2HBKA 1R36A 4IZ9A 4HDVA 2MLGA 2P8TA 2VE9A 3CJBA 4PUSA 4B1YB 3J81K 3H3OB 2YNFA 4KH5A 4DZJA 2WB1A 3OIQA 2ID3A 2MW8A 4MFEA 4RLFA 4RG8A 2HQRA 2VLAA 3IAS2 2FBXA 5AQXA 1SKWA 1L3VA 4EAHD 2DU9A 3VFZA 4KI4A 1XNRK 2JTVA 3BG3A 5ILSA 5HBMA 4FCYA 3ABMH 3K4NA 1ZGWA 1G4DA 3KKRA 2EZLA 2LBFB 3MAQA 2O8EA 3ENOA 4WF9L 4IG0A 2K02A 2P5LC 2KW4A 4H4KC 4L9NA 5J8CA 1J59A 4JQFA 2O8FA 1PUFA 1EETA 3ZPLA 2ZNYA 1YAGA 3BDDA 3BR6A 3WTZA 4XKCA 1A36A 2LYCA 2GM4A 1Z26A 1SMTA 4CD3A 1B9DA 5J1EA 4XIDA 3PO2J 3TWHA 3VEWA 1R9TJ 3K4BA 4RW8A 4CW7B 4BY9C 1EWQA 3ZRGA 4II3A 1JXBA 1MW7A 1K7AA 4OINF 3L3VA 3BC8A 1RDDA 4PY5A 3S3MA 5FLVA 4DJAA 1IKXA 4PA1A 5M1PA 1A35A 1B59A 3F22A 5J4YA 5DV5A 4A3MJ 5M1KA 2KIMA 3A02A 1ZQ3P 2VOPA 2XRIA 3LZJA 4B3SK 3NGYA 3H3UA 3QYEA 1FSEA 3KZZA 2BDPA 4FWLA 1G3TA 2XC7A 5JVGF 2A05A 3AL0B 3CCRN 4A3LJ 1IDYA 3RPQA 5H6QA 1FTTA 1BU6O 2EZHA 5C2DA 4G9ZA 3M07A 1HDDC 3CJ1A 3L2CA 4A93J 3HSRA 5D8KB 4CICA 4FWMA 3GFLA 4DV7K 3ZQ7A 3K1PA 2OTLN 3LALA 1DUXC 2JN6A 3LDLA 1PP8F 5AZJB 4CGDA 4IHSA 3H9GA 2KJBA 4D5FA 1CXQA 3GDQA 1G59A 2QM1A 2Y0SA 1KAXA 3SPZA 1LFUP 2BHZA 1KFDA 1KVAA 2HS5A 3JS6A 3S1RJ 1HLVA 2YJEA 1LJ9A 1VSEA 3S3OA 4DCHA 4FW2A 5J3LA 1YJ9I 3ABTA 4PKGA 2JA7J 4BXFA 3AVFA 2R5ZB 3OTOK 4F2RA 1R5GA 3TAFA 1X9SA 2HHUA 3AO4A 2ZMEA 3DLGA 1I50J 1B9MA 1FYKA 3ZSZA 5KRSA 3VQEA 2KLOA 2L7FP 4AHCA 2XGCA 1ZK8A 2M8EA 3JYTA 4Y3OA 4BBRJ 4CGZA 1LDDA 1U4BA 2W82A 2FMYA 3JTHA 4YORA 1A5WA 3NVMA 4HCBA 2Z1DA 4RAGA 4U0VA 1VQLI 4KHNA 3R3LA 2ISYA 4DUYK 1NMNA 4AIKA 1Y97A 2GX9A 1JHHA 4O8KA 4JS4A 4B3XA 3SUPA 3CPWM 2ZD1A 3J80O 4KO0A 4DV5K 1WCMJ 5J40A 2NXNB 1EP4A 1FOWA 4PL7A 1QQCA 2BH1A 3BG9A 2PZSA 4P5OA 5HNFA 1STZA 4NLBA 3H45C 4G1QA 4WCEL 3MMYB 3DLHA 3PQKA 2EA4A 1FJGK 4KHQA 2XRNA 1M90O 5HS8A 4CBUA 4RAZA 1U6ZA 1HMVA 1F1ZA 1HW5A 3U3GA 1WLJA 4IEEA 1B9NA 3D5LA 4NLCA 3L8BA 1ZYQA 2K3FA 2O8BA 3VOVA 3VTHA 1YRNB 3ZT0A 1OR7C 5B1AH 3LSHA 1ZRCA 3KEYA 1BC7C 1RDUA 1VSLA 2OV7A 2FC0A 1WI3A 3CCJI 4I98B 3GTOJ 4NCBA 4KIFA 2DJNA 4KDPA 3A2FA 3H9QA 1QQMA 2BGCA 1IF1A 2G8KA 4HF2A
chains in the Genus database with same CATH topology
4F2SA 4I2QA 4CHPA 5KRTA 2HB5A 3CFOA 1DLOA 1BCMA 2OPQA 3D0PA 3EY1A 3RR7A 1T05A 1T8EA 1Q9XA 4KTWA 4IG3A 3SQ4A 3LPTA 4IBNA 2YHAA 1GOAA 2IC3A 3S9HA 3P1GA 5KTQA 4FK4A 4FJ9A 1TAQA 1NJZA 1J53A 3KK3A 4BDPA 5J2PA 3KJVA 1S9EA 3WNGA 3ZSWA 4CGIA 2D5RA 1JLCA 4LD0A 3PX4A 4Z4IA 1U48A 2P5OA 3VQDA 3O4QA 4OGEA 2XY5A 1KCFA 2HHTA 2G8VA 1S1UA 1I3AA 4E3SA 5J2NA 3T19A