2DFEA

Crystal structure of tk-rnase hii(1-200)-c
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
209
structure length
209
Chain Sequence
MKIAGIDEAGRGPVIGPMVIAAVVVDENSLPKLEELKVRDSKKLTPKRREKLFNEILGVLDDYVILELPPDVIGSREGTLNEFEVENFAKALNSLKVKPDVIYADAADVDEERFARELGERLNFEAEVVAKHKADDIFPVVSAASILAKVTRDRAVEKLKEEYGEIGSGYPSDPRTRAFLENYYREHGEFPPIVRKGWKTTQDMINKST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HII
publication title Conformational contagion in a protein: Structural properties of a chameleon sequence
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
total genus 69
structure length 209
sequence length 209
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 2dfeA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2dfeA01
3RMDA 4IG0A 4CGDA 1L5UA 2KZZA 1KLMA 4FK4A 4ID1A 5FDLA 5SWMA 1SKWA 2HW3A 1G15A 4FJHA 4C8OA 1VRTA 2D0BA 4CJFA 1BQNA 1VSKA 4CCHA 1B9DA 4F4KA 4BE0A 2ATQA 3ZSWA 1VSDA 2BGGA 3DLKA 4Z4CA 3SQ0A 4AHSA 4FJ5A 2X6NA 1KTQA 3VQ9A 4F8RA 2E4LA 4J2DA 4E7KA 1RTDA 3SJJA 5E41A 1KVBA 1RDBA 2HNZA 2QKKA 4FK0A 4PWDA 1HNIA 1U04A 1RBVA 3O3GA 4FVMA 4OKEA 4Z4FA 3NCIA 4CJTA 3RMBA 5HP1A 3QETA 1ZBUA 1HPZA 4CECA 4XIUA 4CF2A 1ZYQA 3SQ2A 3LP2A 3KKRA 3TAPA 2FBTA 3SQ1A 3QNOA 4CHZA 2DFHA 3AVGA 3RR7A 1J5OA 4AH9A 3JYTA 4CIEA 1SL0A 3QIOA 4F3OA 2OYQA 4WE1A 3V9XA 3QEXA 1IO2A 3NF8A 3ZSOA 2VWJA 1QTMA 4F3TA 4FXDA 4O0JA 1TAUA 4FJMA 5HRSA 3ZSZA 1YTUA 1QHTA 3ZT4A 3WNFA 3JSMA 3AVBA 4FYDA 3KK2A 4QCLA 5C42A 3PX0A 4DSJA 5JS1A 3AV9A 1FKOA 3IAYA 4HCBA 1A5WA 1U4BA 3V9WA 3AVKA 4M3YA 3SCXA 3NAEA 3OS2A 4PA1A 4DLEA 3VQ5A 3DLEA 4H4OA 1CLQA 2HHXA 4LH5A 2YHAA 3QEPA 1UAXA 4CGGA 1TK5A 4FJ7A 5CZ2A 1J54A 3F73A 5J2MA 2KZMA 3OVNA 1C1CA 4M41A 1NJXA 3CG7A 3OYAA 4DTSA 1HYSA 3O3HA 3I0RA 3HP6A 3V4IA 1IG9A 4ID5A 4RW7A 4N56A 1BI4B 2IOCA 3HPHA 3OYEA 1HQUA 4NCAA 3D45A 4KREA 3ZCMA 3OYCA 1RTIA 3QERA 3NGZA 2PZSA 1WSEA 4FJJA 1HNVA 1RT1A 2O4GA 1SUQA 1UA0A 4MFBA 5SZTA 1FK9A 1EKEA 1NOZA 4M3RA 5HROA 4AHRA 1X9WA 1N6QA 1WSIA 1WSJA 3ZSRA 1IKWA 4LY7A 1TKTA 4CJVA 3V9ZA 4F2RA 4M42A 2Z1HA 2B4JA 4CJPA 1D5AA 3OYNA 3AVNA 1Z25A 1C6VA 3SV4A 4KHSA 2AJQA 2XO7A 2OPQA 4KB0A 1S5JA 4CFDA 4EP5A 3KK3A 4W5RA 1BGXT 4B9TA 3F9KA 3DI6A 1QSYA 3OJUA 3TAGA 3OYGA 5EU7A 4KKOA 3HVRA 3RTVA 1WSHA 3SUQA 2O4IA 1RNHA 1RTJA 4EZ6A 2RKIA 4DMNA 1TAQA 1D9DA 4H4MA 2OA8A 4CF8A 4B9UA 4M3TA 1EP4A 4FCYA 1BIZA 3AO4A 1X9MA 2FC0A 4GVMA 4JLHA 3CQ8A 3G0ZA 3C6TA 4GMJB 1BIUA 4DSLA 1KRPA 4CJKA 3LZIA 3LPUA 5I3UA 3NH0A 2XY8A 4B9MA 3AA2A 3LP1A 4KTWA 1VSIA 4AHVA 1BCOA 2IAJA 4EP4A 2PYLA 2HHQA 4C8KA 2P1JA 4QAGA 1BISA 4BDYA 3LALA 3ITHA 3TAMA 4CFBA 2YNGA 3DYAA 1TK8A 4CGHA 1SKRA 3VN5A 4C8NA 4CFAA 1IKVA 3OS0A 1L3UA 1ZBIA 2G8IA 4FLXA 1NKCA 3VA3A 3KKSA 3DOKA 4CEDA 4KPYA 1BL3A 3C6UA 3K5NA 4BWJA 1ZBLA 4KTQA 3DMJA 2OZSA 3NH2A 5KTQA 2A1RA 3UIQA 2Z1JA 1YVUA 4ZTFA 3NF9A 1REVA 4O0IA 3AVLA 1KVCA 4E1NA 3MECA 2F96A 3CFOA 2G8VA 1L3VA 4ELUA 3OY9A 4FM1A 4DFKA 4YNQA 3HPOA 1S9EA 3VQ4A 3OYJA 2JGUA 1LW2A 4DU1A 3VQAA 3VQQA 4NCGA 3KLIA 3O4QA 5J2PA 3BDPA 4E1MA 1ZBHA 4DTNA 3RRHA 3HT3A 3MEEA 1Q9XA 1RT6A 4KHUA 1XHZA 5K14A 3AO2A 1J53A 3DM2A 1JLFA 3WNEA 2Z1IA 1RDDA 4CGIA 4DG1A 4ICLA 4DQPA 2KFNA 2KFZA 1JLGA 2KTQA 4DF4A 4CE9A 5FRMA 1XI1A 3AVJA 4E7JA 4GW6A 4N41A 3V1OA 4RW9A 1T8EA 4JRPA 1A5VA 4DSEA 1KLNA 4Z4HA 1VSJA 3MEDA 1HMVA 2ETJA 1HYVA 4N47A 3VQPA 3DLRA 2RN2A 3QEVA 4KO0A 3T19A 4DFJA 4CJ4A 4CEQA 3SPZA 3ZSYA 3A2FA 1WAJA 1CXUA 4FLVA 3S3OA 4CHOA 4W5NA 2Z1GA 5CYQA 4B8CA 2G8UA 1WSGA 1WLJA 2X74A 4I9LA 4KHWA 4HHTA 3OYIA 4BDPA 4RW8A 1ASVA 1W9HA 4W5OA 2XY6A 1QS4A 3QESA 3E01A 1L3TA 4FM0A 1I3AA 1S1WA 2BANA 4FLUA 1GOAA 2P51A 1D8YA 3RRGA 3VQBA 4AHUA 4FJGA 1F21A 3OYKA 3V9SA 3K57A 4DQQA 4IBNA 4CK3A 4J2BA 3PY8A 2PYJA 5CZ1A 4DQRA 2D0AA 3SUOA 4PUOA 2WONA 4PQUA 1RTHA 3I0SA 1NOYA 4OGCA 5HRRA 3L3VA 4CK2A 3SUNA 4DF8A 4JS5A 4IFVA 1X9SA 3NGYA 4DSKA 4N5SA 3IRXA 3VQCA 5DMRA 5J2NA 3DLBA 4KHQA 3ASMA 5J1EA 3AVAA 3TAEA 1TL1A 1IKXA 1S1XA 2YKNA 3EYZA 4FJLA 4I9QA 4KHYA 4FW2A 4OLAA 2GV9A 4M45A 4IKFA 3HP9A 4AHTA 3D0PA 3NDKA 4E7HA 4F2SA 3TWHA 4BE1A 1QQCA 3TI0A 3KLGA 5T7BA 1RBUA 4DTMA 1NK5A 4CEFA 4Z4GA 1JL1A 2Y1JA 4M3ZA 3SQ4A 4KHNA 3AVIA 2Q3SA 1O1WA 3M8SA 2G8FA 3MXIA 2Y1IA 4CEZA 4DTRA 3VQ8A 5C25A 3LZJA 1GOCA 3MAQA 3ISNC 2HHWA 4CERA 4QOZB 3OYDA 1NKEA 4CEBA 1RBTA 1TVRA 1FKPA 2OPRA 2ZQBA 3OYMA 1QSLA 1UOCA 3CM6A 4MQ3A 3KIOA 3QEWA 3PO5A 1JL2A 2YNFA 4C8MA 4CHYA 3L2UA 3OYFA 1JLAA 3L8BA 1VSMA 1JLQA 3NF7A 3NH1A 3SV3A 1NK4A 1CXQA 4FJ8A 1A5XA 4FK2A 1SKSA 1RDAA 3RWUA 2YNHA 4FLYA 4KAZA 3VQ7A 4HUFA 4FM2A 1WN7A 1XHXA 1C0UA 3AA4A 1HJRA 1TGOA 4CJUA 2E6MA 3U6FA 2PY5A 3LAMA 4G1QA 2B6AA 4M3UA 4AILC 1LAWA 1LWEA 1UWBA 1QSSA 4Z4IA 3P5JA 1ASWA 4LD0A 3V9UA 2IS3A 4DS4A 2XY7A 1VSLA 3T1AA 1FXXA 4LSNA 3QEIA 1KCFA 3PV8A 4CEEA 3KJVA 3CYMA 3AVFA 3M8PA 1XWLA 2F8TA 2HB5A 1JLBA 3KLEA 1BQMA 1JKHA 4NYFA 3AVHA 3QINA 4E7IA 3PX4A 3KTQA 4K8XA 2G8WA 4DQIA 4KTZA 3OYHA 4FLZA 4RG8A 1WSFA 2KW4A 3OYBA 4DS5A 1N5YA 1IH7A 5KRSA 2BE2A 4I2PA 2QKBA 1D9FA 4FZZA 3L2RA 1NK6A 4K8ZA 4W5QA 3AVMA 3ZSQA 3TARA 4AHCA 3QLHA 3OJSA 4BE2A 4B9NA 1LW0A 4ZHRA 4OKKA 4O44A 1EXQA 3U3GA 3FFIA 1ZBFA 2IGIA 4ZTJA 1T03A 3KD5E 4Y1CA 1KVAA 1SV5A 1EX4A 2R7YA 3AA5X 4DFPA 3IS9A 2X6SA 5FRNA 4CF0A 4DSFA 1RT7A 4CJ5A 4FJ9A 4H8KA 4KI4A 3S3NA 1RT5A 3TAQA 1YTAA 4FZXC 2GBZA 2HVHA 2P5GA 3TANA 3TR8A 4YFUA 4E19A 5HRPA 3CFRA 3C95A 2X78A 3AO5A 4HUGA 2P5OA 3LWMA 3V1QA 1Z26A 1C1BA 4BWMA 1KFSA 2HHUA 1U47A 1RCHA 1EETA 3G10A 1XC9A 3MEGA 3HXMA 4B9SA 1NK7A 1BCMA 5D3GA 1RT4A 4OKJA 4CFCA 4Z4EA 2RPIA 4Q5VA 2G8HA 3KD1E 4BDZA 4B8AB 4KB1A 2FBYA 1NJZA 1HYZA 1UA1A 3SZ2A 1C1AA 1K6YA 3L3UA 4OPKA 3K58A 4DTXA 4C8LA 4FJKA 2GUIA 2ZE2A 4ELVA 1TKDA 4OLBA 4DTPA 3L2QA 4B3OA 4KRFA 1RBRA 3ULDA 1TKZA 3HPGA 3LANA 5KGWA 4OVLA 1HRHA 2HNYA 2VG5A 3ZT0A 2E6LA 1JXBA 2XHBA 4DQSA 3QNNA 4CIGA 4HCCA 3ZT3A 3DLHA 2B5JA 3CM5A 1B9FA 1LWFA 2RF2A 1KFDA 2OPSA 1HQEA 3NHGA 4DTUA 1R0AA 2JLEA 4DWIA 4FZYA 2QXFA 1S1VA 3AO3A 1ITGA 1VSFA 2VG7A 4IDKA 3KLFA 4DU4A 1LV5A 2G8KA 2WOMA 3HL8A 3AVCA 4CHNA 1I39A 1TK0A 1L3SA 4CEOA 1C0MA 4E89A 1S6QA 1U48A 2D5RA 1BI4A 3MXJA 1ASUA 4CESA 4CGFA 3AA3A 1VK0A 2FBXA 5HRNA 3HYFA 3MXMA 2HVIA 1DTTA 3HJFA 1X1PA 3VQEA 5CY4A 4EZ9A 4FJXA 4M3WA 2HHTA 2DTUA 4RW4A 1VSHA 1W0HA 2HNDA 5HBMA 1JLCA 1GOBA 2A1SA 4CJ3A 1B92A 1JXEA 4PY5A 3IG1A 1DLOA 3M8QA 2OZMA 3K2PA 3NF6A 4IG3A 2W42A 1LAVA 3RMAA 2HHVA 2ITGA 5HLFA 4HTUA 2DFFA 3B6PA 4CGJA 4CK1A 2YHBA 3K5LA 3TABA 3SNNA 4FW1A 5JS2A 1WNSA 3PX6A 3S9HA 1Q9YA 4CIFA 3DRSA 4TSXA 1LWCA 2I5JA 3P83D 4CJWA 3L2WA 3HSTB 4B9LA 5KI6A 4LH4A 3PUFA 3HO1A 1NJYA 3O3FA 3H08A 2DY4A 3QO9A 1Q8IA 1TL3A 3ZSVA 4CF9A 3LP0A 3NBPA 3KK1A 4NCBA 3OS1A 1RT2A 3EY1A 3NFAA 2OPPA 1RDCA 3TAFA 4CJEA 3SPYA 4J2EA 3V1RA 3SYZA 4DU3A 3QIPA 4DFMA 3V81A 1T05A 2QK9A 2KQ2A 4CJSA 3RR8A 4CEAA 3NE6A 3LPTA 4Z0UA 1NK8A 3VQDA 4BACA 3LP3A 4O4GA 4ELTA 4CHPA 1IKYA 4DLGA 4CF1A 3NGIA 4B08A 1YT3A 4O5BA 3C94A 2YNIA 1JLEA 1RILA 4DTJA 3LAKA 4OJRA 4OGEA 4UQGA 1C0TA 4HVJA 4FJIA 3M8RA 4FLTA 4CHQA 3KLHA 5I42A 1RBSA 3VQ6A 3WNHA 1VRUA 3LDSA 2HHSA 4E3SA 1NK0A 4CJLA 4B9VA 3DRRA 4FLWA 4I2QA 4RW6A 3THVA 3DRPA 5KGXA 1MU2A 1SL2A 4DSIA 3HK2A 1T7PA 2VWKA 4CJRA 1SL1A 3T3FA 2IC3A 3ZT1A 4OPJA 1KSPA 4NYNA 4KV8A 4Y1DA 3SUPA 1NK9A 4IFYA 1TV6A 3SI6A 2YKMA 4I7FA 3ZT2A 4E0DA 2XY5A 3ALYA 1WAFA 3DOLA 3HVTA 4E7LA 1DTQA 4FJNA 1U45A 3O4NA 3K59A 1S6PA 5FROA 4J2AA 2LSNA 3ZSXA 3EZ5A 1J9AA 3VA0A 2FBVA 4DTOA 3WNGA 2HMIA 1S1TA 1RT3A 2NUBA 4HUEA 4CJQA 3K5OA 4W5TA 2BDPA 3RMCA 1Y97A 2ZD1A 1BHLA 3B6OA 3P1GA 4N76A 1NJWA 1CZ9A 2D0CA 5C24A 1CZBA 1TKXA 2DFEA 3U3YA 2VG6A 3S3MA 1U49A 2YV0X 4JS4A 4M3XA 3HM9A 3DLGA 2IDOA 5KRTA 3AO1A 4KI6A 3BGRA 5DK5A 2XRIA 5CYMA 3CFPA 3PO4A 4L8RB 4JRQA 5J2QA 3L2VA 1NKBA 4R5PA 1VSEA 3OYLA 2EHGA 3LWLA 4Q0BA 1QE1A 1S9GA 3V6DA 4O55A 2EX3A 3I8DA 4KFBA 4LSLA 2F8SA 3K5MA 1S1UA
chains in the Genus database with same CATH superfamily
1FTTA 5M1OA 1SAUA 5FDLA 5E3NA 4B4CA 2F9TA 1X2MA 3CF2A 3BUZB 4PKGA 3SJJA 2QKKA 2QF7A 2QZ8A 2JWLA 1N32K 4CYCB 3C7NB 3CJNA 4M9ZA 1STZA 4P55A 4JI3K 2IA2A 4CZMA 2EK5A 1H0MA 2R7SA 4YOYA 3BLYA 3VEXA 3IAM2 1FIPA 2HHXA 3BG3A 4LH5A 2H1LA 4ZYEA 2JWKA 4L9VA 5B3SH 1DGKN 5LFAA 5K5QA 5BRDA 3FDYA 2VOPA 5M1NA 3HPHA 4LFBK 4KREA 2VCPA 4ZYDA 4OAYA 5GAEJ 1RT1A 1KAXA 2DAOA 2M7AA 2O3FA 3MVPA 3J7AO 1XDSA 2XO7A 1S5JA 4B9TA 3F9KA 4XLCA 3OYGA 3JSPA 4KKOA 2FA5A 3CC7N 1XMXA 2OA8A 3ZEUB 4M6YA 1DPUA 3BZCA 4JLHA 3CQ8A 4OOIA 5I3UA 3AA2A 1VSIA 2QM1A 4AIDA 5J3LA 3VN5A 2IS2A 3KKSA 3OTOK 1FW6A 4KPYA 1JJ8C 4BWJA 3R6SA 4KTQA 4B3MK 2Z1JA 3FM5A 5J8FA 4Q47A 2G8VA 4UUVA 2EJRA 1SFEA 3L1PA 4FHTA 3X2QH 2QWQA 1SC7A 3CP8A 3HSEA 4XEIA 1Q9XA 3AGKA 1KGSA 2KTQA 4GY2B 1X1BA 3F3XA 4E7JA 2F7TA 1KQ0A 4DYCA 2VQGA 3ABLH 1IRZA 1WAJA 1K78B 1YG2A 3OYIA 1Y0NA 3L09A 2A6AA 3Q0UA 5FD5A 3S17J 1SANA 2PYJA 2J5PA 4JAXA 5HS7A 3LOCA 1TP4A 4BRLA 4IF4A 5DMRA 2CGLA 3ML6A 3RIRA 2PX9A 4KT5C 3SAHA 3O80A 2KHMA 3THXA 4AF1A 2CQNA 2O61A 4KHNA 3ZQFA 2KT0A 2ZGZA 5E8GA 4JI4K 4IRGA 1WH5A 2QQBA 1TVRA 5GAHP 3CM6A 3LSJA 3PO5A 3I59A 1VQPI 3SV3A 3ABMH 4CZLA 4BY1J 1RFQA 2FRHA 2KDZA 3G25A 2GZWA 1FXXA 1T95A 4BHCA 2IA0A 4FWRA 2K9MA 3OBYA 4DQIA 4FLZA 1ZH5A 1Y1WJ 2H8RA 4I2PA 3HBTA 2KJBA 4IJNA 1VQ4N 3MX5A 1EXQA 4ZTJA 3MWTA 4Y1CA 4Z2YA 3BTCA 1YAGA 2R7RA 3KX2A 2Z2SB 1P7JA 1BW6A 2HVHA 4D1QA 1ETOA 2D1VA 2R5ZB 2WC9A 5B5EC 3ISPA 3HXMA 2UUAK 4ENJA 2P9IA 3U4LA 1D3YA 3PL8A 3Q9SA 3CCRN 2KFDA 1SD7A 1D0ZA 4OLBA 2WAEA 1MNEA 5DD4A 1TKZA 3DFGA 2IBDA 2DI3A 2RHKA 1VQMI 5IWAK 2WADA 1ITGA 2DW4A 3FXJA 3KP5A 2PEXA 4YELA 2MH2A 4OIOF 4XRMA 4M3WA 4RW4A 1VSHA 1GOBA 4BRFA 1F4KA 3IG1A 1K8AO 2DT6A 2UV1A 3RMAA 2XAUA 2DFFA 3ZGKA 3MN6A 1IXSB 2VBYA 4M3FA 2E2PA 2GXAA 4BR7A 2IT0A 4OAZA 2XGEA 1ENHA 4E4HA 1UHMA 3MCPA 3V7SA 2XRLA 3UR3C 5D5XB 2YNIA 2XF7A 5D5UB 3EDPA 3FMQA 3BR6A 2HOTA 5TJJA 5D5WB 1IXRC 1ZRCA 4LF5K 2XASA 4A59A 5ADXH 2OD5A 1ETQA 4J01A 4KV8A 2XF5A 2PBIA 5L3GA 3RPUD 3O9UA 4HPQA 2DJIA 3NAUA 4UVCA 2NUBA 1OKRA 3ZMVA 1CQTA 3CC2I 4S05A 4U7BA 3H5NA 3L2VA 1IG8A 4BY9C 3HOTA 4DJAA 2BW3B 3QU6A 4A3MJ 1XMAA 3PQKA 3O1WA 5K7ZA 2YCHA 3CXCM 5LHGA 5AQNA 1TUUA 2GWRA 4MNUA 1Z7LA 5F0XA 2HVRA 5DV5A 3QYBA 4YEJA 5D4RA 2CGPA 4CECA 4IO9F 2VJIA 2K86A 2L9SA 4F3OA 3QYFA 1QVTA 2DOAA 2PLYA 2XB5A 1X3MA 1E3OC 4BRDA 3AGRA 1NGDA 9ANTA 1YW7A 4BRIA 3H5AA 3BZKA 4LJZF 1B9MA 3QDKA 4FJ7A 1UG2A 2NRHA 3O8MA 4GXOA 2KZMA 3OVNA 5L3EA 1NGBA 1MJBA 1POGA 3HM8A 3MWMA 3ABUA 2EB7A 1HNVA 4PJLA 1U6ZA 5M5YJ 2HOSA 5JICA 3SZPA 1IKWA 4U67L 1BIBA 4EP5A 3CLOA 1TNTA 3I56N 2HEOA 3SUQA 1BA1A 4U88A 1HSJA 1ZC6A 3JREA 1E4GT 2HVQA 3WXKA 4H5WA 2FC0A 2XSJC 4QPQA 4DSLA 2VI6A 5GAGJ 4JKAA 5M1FA 1ZBIA 3H92A 5J47A 4CEDA 1Y8QB 3NH2A 3FBIB 3UIQA 2Q31A 1IV0A 2QA4N 1OH6A 2M87A 4LF7K 1JCGA 3CF5F 1S22A 5M3FJ 3TO7A 3CDHA 4A12A 5IYDJ 4IZZA 3QPSA 1T0FC 1Z6TA 1A5VA 3HDDA 4HF2A 5EEHA 4YG2F 2VOOA 3CCSI 5DUKA 4FLVA 5CYQA 4B8CA 1VHXA 5FPNA 3T5XA 4XH1A 2OQGA 2GXGA 1I94K 2LBFA 2M4GA 3N05A 2R7ZJ 3SUOA 3DF8A 3VDXA 1TL1A 4AD9A 2E2JJ 2V52B 2MGQA 3E9LA 3SXYA 1XPXA 1FOWA 1I50J 4HDVA 3OHRA 1NK3P 3E5QA 5KPTA 5ICFA 2V1NA 4H0PA 5AQTA 2VT2A 3MAQA 4CXFA 5AFUA 3I55N 4CEBA 3D2FB 4NB4A 2VKVA 4MFEA 1H88C 4IDHA 3WQUA 1JLAA 1Z1DA 3KPHA 2O8XA 4KYWA 3RWUA 5DM7F 1HLUA 1YHQN 4YDUA 4LLNA 3ENBA 5D8KB 4PL8A 1BJZA 2F8TA 3KLEA 1FX7A 3QINA 1YI2I 3DCFA 1WSFA 2KW4A 2VJ4A 2GUPA 3CC4N 3ZMUA 4M3YA 3PFIA 1SV5A 2R7YA 1R9TJ 3IS9A 4BL0B 1QHHD 4FJ9A 2GBZA 5HRPA 4FPBA 1P4AA 3V1QA 1X4PA 1RCHA 3MEGA 3O9TA 4MDAA 5KPRA 1NK7A 3JRHA 2BVLA 3KD1E 2P9LA 4FJKA 2GUIA 2DMUA 3LANA 3O6BB 2HNYA 2XHBA 2W4SA 2A68F 2KDOA 3OIQA 2R7UA 4OO1J 3AO3A 1BWFO 3MK6A 2IVNA 4LLGF 3GLLA 3WEEA 2VQFK 1ZTRA 1ASUA 1MGTA 2EWSA 3AA3A 4E70A 3SEQA 3VYSB 1XCVA 1BW5A 1CF7A 3QBXA 4BY7J 4K0KK 2BBYA 2P6SA 1YIJI 2O0YA 3S9HA 3T1BA 2O8EA 2A6TA 2ZFUA 2OUMA 3HRMA 2Z99A 4L9JA 5GP9A 4S04A 4DFMA 2KMUA 4LB6B 3E9PA 4O5VA 5CVRA 1BL0A 1DU6A 2KIQA 1YT3A 1RILA 1S6LA 2P9UB 1FMVA 4JI7K 4CZHA 2JRTA 4I2QA 4DSIA 1ZBSA 2VONA 4F52A 2MC4A 1K6OA 1RUOA 5EGOB 4I7FA 2MBFA 3DAWA 3KYDB 2QQAA 3QAHA 3KE2A 2X0LA 3VOEA 1RUNA 4BGBA 4BQZA 1R59O 1Y97A 2JA6J 2ZD1A 3P1GA 3EUHA 1HJOA 3I71A 5GAHJ 2AS5F 1U49A 4IOCF 2K4BA 4A0YA 3N4MA 3WTTC 5FO5A 1E3HA 2M30A 4C1NK 1QE1A 1JCFA 2Q97A 3RMDA 2O5RA 5SWMA 2HW3A 2HQAA 1J0RA 1B9DA 2H27A 3NARA 3A5MC 5EZGA 4FJ5A 2ZWHA 4B44A 1XN7A 1YIOA 4XIUA 4KN4X 1JTXA 3TAPA 3QNOA 3RR7A 4OMYA 4WE1A 3VWBA 4M6VA 3QEXA 4GCVA 1QHTA 4MLHA 1B72B 4BG9A 2PAVA 2WA0A 1U4BA 1BC7C 4NXMK 4JI2K 1FPQA 2RGVA 2HMPA 1ZELA 3OYAA 3VF2A 4DTSA 3V4IA 1O4XA 3N4PA 2O4GA 3FWEA 1W5SA 3W6JB 3SK3A 5AQOA 3A8YA 4BC3A 1USTA 4EZ6A 3RVCA 2OJED 4K41A 2K85A 4B1WB 1IBMK 2LFBA 1ZK8A 3LP1A 1MBJA 4AHVA 4DR7K 2QXLA 2HPMA 4I2OA 1TK8A 1QRYA 4C8NA 4CFAA 5IT9Z 3M8EA 4ILHA 1BL3A 1UG0A 1GT0C 1KVCA 1D1AA 3AG4H 4JEPA 1RRJA 1OCPA 3CUOA 3BR3A 1NG9A 3TW6A 1J53A 3DLAA 3LMMA 5LD2C 1FT9A 3ZQCA 2O8BA 3BJ6A 4NDLA 3MEDA 1ZREA 4PJNA 3ESWB 5IOYA 3A2FA 3E7LA 4CHOA 4JKFA 2G8UA 2CQKA 3HEFA 1QS4A 5MLCQ 1NH3A 4KICA 3UKUB 4CBUA 4IBNA 4I7HA 4DQRA 1OLTA 4LIVA 1YJWI 2FOWA 2ASMA 3ASMA 4DIQA 2NRTA 3EUHC 4FW2A 4OLAA 2EFNA 3K9JA 1AHDP 2JN6A 1RBUA 4X64K 2Q3SA 2FF6A 4ZC3A 2D1HA 5L3FA 3M8SA 2QKLB 3CJRB 3WTUC 2HHWA 5GINA 4FWPA 3E3VA 1QSLA 1FZPB 4HX4A 1O3QA 2YNFA 4BQQA 4DZPA 2CH5A 3WE3A 3VEVA 1RDUA 4BNCA 1C0UA 4B1YB 4UY8I 1LDJA 5BR9A 5CJ9A 1VSLA 3BWGA 1KD1O 1EWRA 4LSNA 3DXMA 5AQWA 2AQFA 3F8FA 3AVFA 3WODF 3PX4A 1KAYA 3I4NJ 2KLAA 4KTZA 1YS7A 3OYBA 4GRIA 1IJJA 1NK6A 4W5QA 2VE8A 3J81Z 5F2RA 3M1FA 2X6SA 4BHBA 3TDZC 2P9NB 1EF4A 1TUYA 2WUSA 1GV5A 2R7DA 5J8CA 1IDYA 1XNRK 1PVEA 2WBNA 4WCEL 1R36A 1K6YA 3K58A 4XN0A 3WTZA 2V1DA 5JLXA 4EHUA 3FLCO 4BQOA 3L2CA 2EZLA 3P9IA 1XG1A 1JXBA 4Z6YA 1DGRM 4PUSA 2VG7A 4HWIA 5CQGA 3CC7I 4KBOA 3BJAA 3AL0C 4OWRB 5FGMA 3HYFA 1IXCA 1FBSA 4EZ9A 1G4DA 3J7YP 1WSUA 4IHYA 1W7AA 3WGIA 4PY5A 2EA2A 2W42A 2NRZA 2DLLA 3GBGA 5KI6A 2TCTA 2Q2RA 3IV5A 1OISA 3WTWC 3I5UA 1RT2A 2WTUA 4F91B 3SPYA 3ZYYX 5HNFA 4IO9L 3LPTA 4EIAA 4B43A 1V55H 1VTNC 4DGWB 4CJLA 2LH9A 3WG7H 3DRPA 5LL6Z 4H0EA 1SL1A 4PFOA 1NWKA 4BXXJ 3CIPA 3RSEB 5C4XJ 2EA4A 4B1RA 4E7LA 1DKGD 1I6XA 2X6OA 4FISA 3VA0A 1FOYA 2HMIA 3BR2A 4Y3OA 4J00A 2HOEA 5EEAA 4HF0A 4F7ZA 4UUSA 1CZBA 2M34A 3VGMA 1HR0K 3Q5FA 4CYDA 3V7CA 5HDGA 3H1CA 3P7NA 1OYIA 3CCQI 1AKHA 4P9FA 3RKQA 2A5XA 2MD5A 3VQ9A 2P5LC 1HA8A 1LFPA 4CJTA 3T1YK 4CF2A 4CBWA 1YXQA 3JYTA 1W0UA 2VIXA 1TAUA 4FJMA 3BG9A 2R7QA 4ABZA 5M5WJ 2I7PA 2D5VA 1B8IA 1ZHFA 3T69A 3E1YA 2QQ8A 3CF5L 3MAJA 4X65K 1VQ4I 3V9WA 1TL8A 5J2MA 2DJNA 3K1MA 1YJ9N 2Z3YA 3OOPA 3S2WA 2DT7B 4EEFG 1N6QA 4E1JA 2ZSHB 3CJTB 4M42A 5B8HA 4W5RA 3QODA 5KVRA 1JJ6C 1QQMA 4BBSJ 2KL4A 3DU5A 4X66K 4L9TA 4GMJB 1GLBG 3LZIA 3K4NA 5ICEA 2HHQA 4YOXA 2NNNA 4CFBA 2XKPA 1ITYA 3K1NA 3IH3A 4XSXF 4PSXA 4E1NA 4E6KG 3GCMA 3QFPA 3OYJA 1OH8A 5DM7L 4FL9A 3H36A 3BROA 1BI0A 1B59A 4CO8A 2R92J 2L9VA 5FLXZ 1KU7A 1XMKA 4RW9A 5ICGA 1BJAA 3DTEA 2NZTA 3O08A 1IRGA 3T19A 4CJ4A 5BPNA 1VQON 1LFUP 3S2DJ 4M73A 2HQNA 3SAFA 5JVTA 1S1WA 4J8FA 5AQGA 4G6DA 1SFXA 1WCMJ 1ZARA 1VQ6N 2A6HF 3TTFA 1OCZH 2E20A 1D8KA 3D5RC 4GYIA 2RN7A 4AHTA 5LHHA 2WFBA 4CZJA 3FZLA 3B02A 5E17F 4AC0A 2Y1JA 1WJEA 4LOCA 1N34K 5C25A 5FPEA 4AYBA 3QRFF 1NKEA 2WC2A 3RPQA 5AQQA 3KIOA 4C8MA 1VSMA 3TSUA 2B9SA 4FJ8A 4NC7A 2YR2A 3HZJA 2Z1DA 3CZ6A 2B6AA 5AZIB 1ASWA 2EV0A 1XX5A 1FJLA 4CEEA 3CQZJ 3H1VX 1QO0D 3W0LA 3HOZJ 1N5YA 2E1NA 1LDKB 3DPLC 3REOA 2BE2A 1U3EM 3LDOA 3AVMA 2C6YA 4AHCA 1G3YA 4O44A 3OV8A 5C10A 1WJDA 3LNQA 4CF0A 1W2BM 4FZXC 3AO5A 1R6RA 1YS6A 1PUFB 3G10A 4LGWA 5JMVA 1VQ7N 1ACIA 4DW6A 3DWLE 4OVLA 1F1ZA 2M0CA 1R1TA 2KRFA 2M8EA 3I56I 2R7TA 3CCUN 1TZLA 3V7RA 2XAHA 4CEOA 4XM3A 1TYQA 3DP7A 3D2EA 2W84A 2LRDA 2FOKA 5IP7J 1K4SA 4UNOA 4BVPA 3TOAA 5ELZA 2GA2A 2HWVA 3M8QA 5K5OA 2HHVA 1LVKA 5LLQA 1BI1A 3R3LA 1WB9A 3DRSA 4CJWA 5FFZA 2ZXJA 1SMTA 3RI4A 2DY4A 2QA4I 3ZSVA 2EH3A 4NCBA 1XCBA 2CU7A 3EPZA 2XGDA 3NFAA 3V81A 4M9XA 3CETA 3S2HJ 3SJMA 5K1YA 3NE6A 3DU6A 1R1VA 3ERMA 2NXNB 4DKWA 2V1XA 4HVJA 1RBSA 3H3NO 1IC8A 4C3IJ 5E84A 3FBNB 4H0YB 1X1CA 1KSPA 4A5BA 1WAFA 2VT3A 3THYA 3ZSXA 4P96A 3RMCA 1J2XA 3HKZA 3HOXJ 1WWXA 2DK8A 1TKXA 3ZMTA 2MG4A 3MFKA 3ONQA 2EFWA 2F6CA 4L8RB 1GLAG 2QWMA 4MO5A 2FF3B 3PNTA 3I8DA 2KZZA 3I55I 4FK4A 4GO1A 1BOAA 4C2TA 4JV5K 3JTHA 4F8RA 4FK0A 3J7ZO 1YHQI 1JGSA 2R7VA 2E1ZA 2DYRH 4ZYAA 4CHZA 4GV3A 1MBEA 1QTMA 1N75A 4Y13A 3ZSZA 4YORA 1YO5C 3WNFA 3CC4I 3J81O 4BHPA 2BE5F 3FXUA 3CCLN 2L02A 4CVNE 1FLIA 4WQ5A 5FJ8J 1O13A 3F73A 1C1CA 3QPHA 3HP6A 3D1NI 3V42A 4ID5A 1MDUB 1A6IA 3S16J 1SUQA 4BEHA 5LJVA 2XGXA 2BH1A 3PIOF 1TKTA 1WI3A 2O8DB 3BG5A 1BGXT 1LEBA 4CI6A 5M3MJ 5FPDA 4KT6A 3ZPLA 4QWQA 2LNBA 2NRVA 3N4QA 4LF8K 2A41A 4RMNA 3IWFA 3TP3A 5A2QZ 3BEXA 3NH0A 1BISA 4KH6A 4O3MA 5ADXA 2G8IA 2DOFA 4A6EA 1DUXC 2IAIA 3C6UA 1YVUA 4UVAA 2FSKA 3MECA 2F96A 3DXKA 3D5LA 3VQQA 3F8MA 3O4QA 5J2PA 2OU2A 3O8HA 4ICLA 4NC6A 4CE9A 3S32A 3Q0VA 1GHCA 2LKSA 2DT5A 4DSEA 1HMVA 2BZTA 3ZQGA 5BPDA 5BN8A 2XUBA 3GLXA 2DA2A 1AA7A 4C9YA 3GZNB 3S3OA 4KN7X 4BR5A 3A0BC 1MSEC 3MZYA 4YFXF 4RW8A 3LDQA 4BAYA 1N77A 3K4MA 2J4RA 4W5OA 2X1CA 2ZJQF 2HU9A 4NO7A 2KIMA 3K57A 2YX4A 3O6WA 1RTHA 3I0SA 4CK2A 3L3VA 4IFVA 5IYCJ 4KA4A 1HW2A 2NVQJ 4DQ2A 4A57A 5KK1A 1IKXA 3JCUC 4RM2A 4I0BA 4UB8C 2F4MB 1KU2A 4YOVA 3TWHA 3BR0A 1HKTA 3KLGA 1NK5A 4CEFA 1JL1A 4BJ5C 3S93A 1XGOA 3A02A 3P38A 4GVEA 3QEWA 5FLVA 2KRHA 1LKXA 2ADUA 2R0QC 3IUOA 2DA3A 1QSSA 4EGYA 2Z9OA 3V9UA 3T1AA 4JKEA 2KZVA 2NRAC 5EVZA 4L5EA 5H2FC 1BO5O 4FWOA 2YU9J 4NYFA 4R8HA 4JKCA 4LFAK 3V4GA 4IJAA 4BQNA 2CV1A 4WFNL 4IVNA 1C0GA 1WFXA 3TSQA 2Q2EB 4WQ5C 2PI0A 2DYSH 3ZQ7A 2X85A 4OX9K 4H8KA 4XONA 4HUGA 2EZKA 3FKJA 3EYIA 3K1PA 4NC8A 4PFPA 2W7NA 3FXKA 4KB1A 1QU3A 2FBYA 4OPKA 3FZKA 2R5YB 3MKWB 4KRFA 2CUJA 1QZZA 3ULDA 2DA4A 4DV3K 5C2FA 3IAS2 2VE9A 3KLFA 4DU4A 2F4OB 2X51A 1FNNA 3DTIA 3F8NA 1WJAA 1MH3A 2D45A 3O9QA 3CJCA 2DTUA 2FEZA 3FR0A 5CY4A 4DV1K 1K8KB 2ACJA 2OPTA 2XB0X 3RZDJ 3QU3A 2WV0A 4B9LA 1PP7U 5AFUH 4JI6K 3O3FA 2DU9A 1ETYA 4HNTA 4UXNA 3TBIA 3FGUA 3OS1A 4WXHA 2OF7A 1DP7P 3GG4A 1MSFC 3TAFA 2XC7A 3IP4B 2DPNA 3RQ4A 2ZJPF 3TW7A 4PGHA 5CYVA 1IKYA 3C94A 4UHTA 4KDPA 3WXJA 4B9VA 4BQAA 3B8AX 3F21A 3KVGA 5J6XA 4BGDA 2VL8A 3C6AA 1NK9A 3RKXA 2YKMA 3HUGA 4FOIA 4FJNA 2QTDA 3MKZA 3FHZA 1QQNA 4CUGA 2BDPA 4DOZA 5C0YA 2FQ4A 3BDDA 2OTJN 2OV7A 2Y31A 3U3YA 1Q86O 1FYMA 2BEOA 2RE2A 2JVHA 1H9TA 3PO4A 3NVMA 4ENMA 2CV0A 2EHGA 1X3NA 3CI5A 5BS6A 2ZKZA 4A3KJ 4BC4A 4LG3A 5F0CA 4ID1A 1VSKA 1X58A 3TO9A 3E6CC 2FUG2 3C7JA 3PNVA 4EVIA 2QSHX 2ZF5O 2KJCA 1Z77A 1I3QJ 4FE4A 1X9JA 4B1UB 1LFBA 2MABA 4FXDA 4F3TA 3UNGC 3E5XA 3VF6A 5C42A 3K10A 1NJIO 4CCJA 4L3QA 4XLHA 4OMZA 4N56A 4EM0B 1K83J 4NQWB 3K4CA 4LF4K 3QERA 4G7ZF 2ZNYA 1WSIA 1Z3XA 4N4OB 5GTIC 1B1BA 3O4WA 3LSTA 3DKWA 2VBZA 2BYVE 2KQRA 4B1VA 4IOXA 1NU0A 1R22A 2AP1A 4GVMA 4DNCA 1Z3YA 2XY8A 2D0PA 1E2XA 4P1WA 5HLIA 3LALA 2WAQN 3VA3A 2QUFA 1EH6A 3WU0A 2L7ZA 5KTQA 3G1MA 2P0WA 3AVLA 3CJBA 3HPOA 1S9EA 4LF6K 4BUPA 1XHZA 3HJEA 5K14A 4CGIA 2VC1A 4DF4A 1A6QA 3WTSC 4L0ZB 3DXJF 4BKXA 3BTLA 1N78A 1K4TA 3SPZA 2KPMA 1VQKN 3FZVA 1ASVA 1XMQK 4JK9A 4FM0A 4AHUA 1T6CA 4B47A 3MKYB 4DQQA 2DPUA 1BI3A 5F04A 2VGNA 4DSKA 3Q7CA 4N9IA 3KEYA 4M72A 2KZGA 5E26A 3EUAA 1BDGA 3A01B 1P6RA 2BXYA 5HODA 1FC3A 2DMPA 3L4QA 2ICWG 2CGJA 3OYFA 4RB3C 4Y52J 2PJRA 3GMEA 3QICA 1RDAA 3H3ZA 1WN7A 1Z21A 2ZO4A 3OIOA 2HDWA 4XLFA 3O9RA 1L0OC 3CYMA 4CZKA 1JLBA 4DBRA 3PSFA 1FJGK 1HKSA 3S15J 2UXNA 1IJWC 4K25A 1Q18A 4OKKA 1BM9A 1RT7A 2BUPA 3KLOA 1T98A 2UUCK 5HLTA 1HDPA 4CYCA 3C7NA 1OR7A 4IHWA 4Q5VA 3SJHA 5HL7L 3LL3A 1YJ9I 2BOLA 4DTPA 3GZ5A 2NNYA 4DQSA 1APLC 2LY1A 5B66C 2B5JA 3P9CA 1Z6RA 1SVOA 3AVCA 1L3SA 1C0MA 1FOKA 4JQFA 1LQ1A 1YOVB 1IN6A 1DTTA 2P8TA 3TL4X 4L5IA 2ITMA 3R8EA 4H5NA 1DLOA 3C2GA 3GFIA 4CGJA 1IBLK 2O6GE 3A2KA 3DBRB 4H4KC 2DA1A 1E4FT 4DR1K 2FD5A 4I6MB 5AQYA 2M9HA 1Z0XA 1NGCA 4CJEA 5L3BA 1M1KO 4I6ZA 2MC3A 1MA9B 4CF1A 4JHDB 3VGLA 4GKJK 3HTUA 4HDUA 4XL9A 3KLHA 3IRRA 4E3SA 1U5TA 4RW6A 5JLWA 1VQOI 1SL2A 2O8CB 2IC3A 2KKZA 4EV0A 4Y7NJ 3FKIJ 4RAGA 3LQRA 4G7OF 3SI6A 2BY3A 1HXDA 4IEEA 3F6VA 1S6PA 1J9AA 1VQ6I 1FBQA 5AQRA 1OCRH 3GYHX 2F9WA 3CMYA 2FMLA 3GZ6A 3HHGA 2LP0A 5KAFC 3S3MA 2YV0X 3ATVA 1K78A 3HM9A 2XRIA 5CYMA 3PIOL 2HYJA 3CMAN 1ZGJA 3ZQLA 2B7EA 4RAZA 2QYOA 1G15A 4RM3A 5HDNA 4Z4CA 4AHSA 1KTQA 2IIRA 5E41A 4MQVA 4HSRA 1FTZA 1HNIA 3M8JA 4CBXA 3NCIA 2E1MB 4WFAL 1ZBUA 2BY0A 1OVQA 2OCCH 3LP2A 1O3TA 2NYXA 3SQ1A 2ASOA 2JA8J 3NF8A 1J09A 5L3DA 3NEUA 1JI8A 2Y0MA 4ESBA 4A69C 1KAZA 4QCLA 4G6TB 1U8BA 2K9SA 3AARA 4H5VA 1NGIA 2XRNA 1NJXA 1OR7C 3O3HA 3I0RA 4A0ZA 1U2WA 2QWRA 3GO5A 4EJUA 1FK9A 2V79A 4PHTX 2ZJQL 1VQ7I 2HOAA 2WY7Q 2Z1HA 2IJLA 4AVPA 3AVNA 1C6VA 1B9NA 2OPQA 4ZYGA 2A5YB 3TAGA 3RYPA 3BT9A 4LMYA 1HQCA 4JOMA 1FP2A 1SEUA 3BQZA 2EFPA 1EP4A 5C2DA 1BR4A 2R5ZA 1BIZA 3CCUI 4HX7A 2PMZN 4RWTA 2ZJ2A 3FXLA 2IAJA 1NG7A 2P1JA 1I5ZA 1L3UA 4HYEA 2YI1A 2JJ7A 4EM1A 1T8IA 3PO3J 3TOBA 4C1NI 1L3VA 2E5ZA 3CJ7A 1LW2A 4NCGA 3KLIA 3W2VA 2GX9A 2I5UA 1YF5L 3WNEA 4HQEA 4C23A 1I1SA 2CUFA 4XSZF 3V1OA 2FE3A 2QSFX 1KLNA 1LE8B 4YY3K 1TBXA 3ZSYA 1RR7A 3DEUA 1X1DA 1Y0UA 4W1UA 1OMIA 4JKHA 4XBFA 1R5ID 1RI7A 1I3AA 1GOAA 2P51A 1Q1VA 2V7YA 1R1UA 1ODDA 3PY8A 5CZ1A 3Q0WA 4EJTA 4ILGB 1EJ9A 1LB2A 3CDIA 3FXOA 2F5FA 3TAEA 1RPWA 4MQ9F 3D0PA 4Y33A 3HSFA 3NQOA 1S3XA 3GXOA 3HIFA 2VQEK 5GAGP 5BRFA 3DEEA 1GOCA 1RKTA 3HZ6A 1D5YA 3I8BA 3OYMA 2OPRA 3CO7C 4XH5A 3JAMZ 1P7IA 4XKCA 4JNEA 5AQKA 1A5XA 5E18F 4JI0K 4EM2A 2YPRA 1J6ZA 2KKOA 1WGXA 3LSGA 2PY5A 2F4IA 1SD6A 4M3UA 1E3MA 3TPQA 5C44J 4XLEA 2ME6A 4XLAA 4PGGA 1BQMA 1JKHA 2BW3A 2XVCA 5E3MA 3EE8A 4IO8A 4KUMA 4U0WA 1GLDG 2L9NA 3KYCB 3CCJN 1T03A 1EX4A 4KH4A 3OA9A 1PDNC 3LA2A 2ZJPL 3CCLI 3TANA 2P9KA 1A35A 2HHUA 5F0HA 4CSWA 1Q7YO 2RVCA 2F5VA 3PSIA 3ZQQA 3SZ2A 5EDNA 5FRNA 3L2QA 4BRQA 3RJPA 1KFDA 2GOXB 1S6QA 2ISZA 2H09A 2DFIA 1QZ6A 1E0EA 2CQ7A 1H8AC 1W0HA 2A1SA 4KH5A 3IFRA 1ATNA 2GWKA 3VENA 5HS9A 4GYGA 2O8KA 2YHBA 3SNNA 3CUQB 5LEKA 3GE1A 4IHVA 2F4VK 2JUCA 1I27A 2F5EA 3HO1A 2CQQA 4A2AA 3H0GJ 3DBHB 1GXPA 2Z16A 5J1UA 2WV1A 4IFEA 4RLQA 3Q7BA 2R4GA 3QFUA 2OZUA 3S1RJ 4EJVA 5JLHA 4O5BA 3GL1A 4FJIA 2YU3A 3M8RA 1BC8C 4U0YA 3ZETB 4FLWA 2I7NA 4XMYA 2VODA 2QM3A 3M4OJ 1TV6A 3ZLJA 3ZT2A 3GTKJ 3DOLA 4F55A 1U45A 3LQQA 3BQYA 4FOEA 4J2AA 4DTOA 2I10A 2HZDA 2DXIA 1NLVA 1NGJA 1NJWA 4QS7A 3HHHA 1U2VB 1FYLA 5KRTA 2IDOA 3KZIC 1MMNA 2QCOA 4P9UA 4R5PA 2X1EA 1XGMA 4BROA 2VLAA 5C15A 3GOIA 2UUZA 4DHYA 4BE0A 3GTPJ 4BRPA 1TT5B 2XV4S 2FSWA 3DTKA 2DQRA 1KU9A 2VKDA 4H0XB 1XDUA 3ZX3A 3GX4X 3FX3A 3M3ZA 5F1RA 2OYQA 3D2FA 2VWJA 4O0JA 5K5RA 4IEJA 4IX7A 5CVVA 4EMSA 4PL7A 1A5WA 4H0TB 3BJOA 5H1SQ 2IRFG 5F1JA 2YHAA 5BPIA 1UAXA 5CZ2A 3NVKA 4M41A 1HYSA 3CG7A 4WK8F 1ILYA 2ZXHA 1VQNN 1EH8A 2L2OA 2ASPA 3D45A 5CLSA 3NGZA 1WSEA 2ELHA 5JLFA 1UA0A 4AHRA 3VETA 4F2RA 4BRCA 4JYKA 1PJRA 3KK3A 4WXDA 4X0GA 4DMNA 3IKTA 4H4MA 1G6NA 1MKMA 3P39A 4FCYA 1WQ2A 3K0LA 4IOAF 3RQIA 4JK7A 5BR8K 4A2UA 1G3SA 5KHDA 3KEQA 4BDYA 3MZHA 5AZJB 3OS0A 3ZRGA 1YW8A 1PP8F 4UV8A 3B6AA 3RKWA 4OPHA 4XK4A 3OY9A 4DFKA 1ZLKA 2K9LA 4DU1A 3CO6C 3D5SC 3DM2A 4XKWA 3TU5A 1ETVA 5FD6A 2F48A 4GW6A 2NNWA 3ZOBA 5IOZA 3VQPA 2RN2A 4I98B 1ON2A 5LGTA 1S7OA 2W57A 2X74A 3RKYA 4JX5A 4B8XA 3I4PA 4YOWA 2IS1A 4H5TA 4CICA 2Y30A 4ZDOA 1OH5A 2VBWA 1BR1A 2Y0SN 2H1KA 4BJ6C 1JUMA 4KHQA 3ENHA 3GDQA 3UKRB 4DV7K 1S1XA 1RZ4A 3EYZA 1IV6A 3KP4A 2P9UA 3FXQA 4QTRA 2OBPA 3TI0A 2OTJI 4MEXF 5EG0B 4Z4GA 3ZMDA 1TNSA 2LY2A 3E6DA 3AVIA 4CEZA 3ZQIA 5AQSA 3I64A 3JRFA 5EGOA 4PKHA 4A3JJ 2DK5A 3PJRA 1IRFA 3NH1A 1WH7A 3E6MA 2X48A 4FLYA 2D2WA 1XHXA 5AQIA 5GPAA 1T0FA 1WRJA 3VESA 1H89C 2G8WA 1N25A 2LOOA 3BY6A 4B3TK 4MFDA 2D0OA 3M3YJ 1OPCA 4JD2B 2VGMA 3TR8A 2X78A 3KWGA 3R0JA 2X9DA 2ZBKA 1X19A 2NAZA 1LUJB 1TQMA 1VFCA 2IGNA 3BG7A 1MBKA 4B1ZA 1B72A 4DTXA 4II2A 4ELVA 5CVIA 2MA3A 4I99C 3JRAA 3QNNA 3DQVC 3IHUA 1BA5A 4DWIA 1QZEA 4KMUX 3MN2A 4ZDPA 1I39A 2WY8Q 5JVGF 3OMYA 2FXUA 3TTCA 1YTYA 3GFJA 3CP2A 1VI0A 2JRMA 1B4AA 1B92A 1QQIA 1T6SA 1Q81O 2W6LA 2ZNZA 2KIFA 4W97A 1Z9CA 4IHSA 1JKQC 4LH4A 5E1XA 3KK1A 5BOXA 2P9PB 4LC9B 2VXDA 3EY1A 2OPPA 2TDXA 3V1RA 3IH4A 1T05A 2QBYB 2XF6A 2QK9A 1QNTA 3HI0A 2JTVA 2E1CA 2V26A 3MN9A 3WXMB 4B08A 4Y15A 2QENA 3H3OB 1JLEA 1C0TA 5J40A 3L0QA 4RGXA 3THVA 1A04A 2M4KA 1VQKI 3ZT1A 4IPAA 3D6RA 2KIUA 3HTVA 3IDHA 4IFYA 4E0DA 5CR4A 2XY5A 1R58A 4G12A 3ABTA 2LSNA 2GQQA 2FNAA 2D0CA 1MNMC 5E3OA 3ELKA 3CQXA 2JWTA 1YRNB 1S7AA 3PO2J 3BZ6A 3JRBA 3V6DA 3HM5A 4O55A 3UKUA 4LSLA 3K5MA 1MNDA 3IC7A 1C0WA 2QWNA 2WAQA 3JAMO 1VRTA 1BQNA 4CCHA 1GVJA 4F4KA 2BGGA 3GTOJ 1XSVA 1W1WE 3PQJA 1HF0A 2JVGA 4NXNK 4B3SK 5BMZA 1HLVA 2PMUA 3DPUA 4U7DA 4KHPK 4R79A 3LSRA 1TWGJ 1U8RA 3JSMA 1HNZK 1NGGA 3PX0A 1JJ2M 1DU0A 2VBXA 4MLEA 2M8GX 4HCBA 4DLEA 1R49A 3GWZA 4GGGA 1R4MB 2K40A 3OWTA 1O7LA 1HQUA 4XRSG 1NOZA 3IKMA 3V9ZA 3V8JA 3OYNA 1RNLA 2YS9A 4UVBA 3OJUA 4DR5K 4HNVA 3LSKA 4B9UA 1YVNA 2IS4A 4M3TA 3A5OC 5HS8A 1X9MA 3LDPA 2TRTA 2VKEA 2P9SB 1BU6O 1KRPA 4CJKA 4B9MA 1BCOA 2A61A 3U8XA 1D9FA 1SKRA 1QBJA 1I1GA 4B1XB 2QWWA 4ZJZA 4OIQF 3BR1A 1X3WB 2QWPA 4DR6K 2OQRA 1MDMB 4CZEA 1S8NA 4XR6A 3THWB 4F9OA 4DTNA 3U1DA 2CW7A 4I09A 1RESA 4DUYK 5L3CA 4NUBA 2YJEA 2ZC2A 1T2KA 3FZFA 1FSHA 3OYKA 1U9OA 3KZYA 1OCCH 3WG9A 3LDLA 3O5BA 1SFKA 1NOYA 2O8FB 4DF8A 2WAFA 3NGYA 1OKJA 3IRXA 3VQCA 5J1EA 4QLCU 2HSTA 2G9WA 3ZCOA 2E2IJ 3WQTA 2QWOA 1Y56A 4EGZA 2Y9ZA 1QQCA 5LEJA 3ZN0A 3BCAA 4M3ZA 1T39A 3MWPA 1O1WA 2Y1IA 3RSEA 3CMAI 4WXCA 2HPIA 3I0TA 1K9MO 2LKXA 1UOCA 2Z33A 3LA3A 3TKYA 4KMFA 1JLQA 3NF7A 5AQXA 4FK2A 1AWCA 1SKSA 1ETXA 2W00A 2E6MA 1VQ5N 2HTSA 4JKDA 2VQCA 1DP3A 1TW2A 1OQYA 1SZ2A 2K9NA 1NK2P 1HKGA 2A3ZA 3AVHA 1AOYA 2HQRA 5TGTA 2W24A 3JAMK 2HKXA 4HF1A 4FZZA 3FIWA 4A5AA 1LW0A 2XKOA 4A93J 3KD5E 2VJJA 3S3NA 4RB1A 3FISA 3HB9A 5CHIA 3CFRA 3Q9VA 2ECBA 1WKMA 1EETA 4B9SA 1BCMA 2BY1A 3UE5A 2YHYA 5LGUA 4BDZA 2STTA 3WT0A 3EO3A 1O3SA 3CJ9A 2ZE2A 1YYVA 2FJ1A 3I4MJ 3HPGA 3GFLA 4EJWA 3MX2A 5JVHL 2LKPA 3ZT0A 1MWMA 1JGGA 3FK7A 3CM5A 1B9FA 3W6KB 2YHWA 3G6EN 3QOEA 1OVYA 2OZ6A 1ONVA 3CCVN 1JKRC 3LAPA 2E88A 2P4WA 1LJ9A 3VERA 5FPMA 5GIPA 1ESVA 4HTUA 3TABA 2E19A 5JS2A 3L2WA 3S1NJ 2EWNA 4HAMA 3DKYA 4BR9A 4AIKA 2IPQX 4LFUA 1RDCA 4EJOA 4J2EA 1GV2A 3RR8A 3F8CA 4HLYA 5DTDA 3LSPA 2GA1A 4L18B 4O8KA 4G94A 1HNWK 2VWKA 4OPJA 4WF2A 4NYNA 1QHAA 5IY5H 3CPWM 1DQUA 1XC3A 1WJBA 1W36C 3S8PA 3K59A 1K7AA 2ESNA 1HX1A 1S1TA 3E1SA 3B6OA 1BHLA 1X1AA 3KYLA 2RNJA 1QZ5A 1RETA 1YLFA 3DLLF 3BP8A 3VEYA 4M3XA 1NG6A 3K9TA 4JKGB 5J2QA 3EL2A 1T3VA 4JI1K 2PMZA 2VASA 1V4RA 4MTDA 4C8KA 4AM3A 4N4NB 4IOAL 2L4AA 3QQAA 2DTRA 2W48A 3BY5A 2M5WA 3J80Z 4J2DA 3CHWA 3BCBA 3W6VA 3T8RA 3O3GA 3ZXSA 2E2HJ 4Z4FA 1GLNA 4FASD 1ZYQA 3E97A 5TKYA 2OTLN 3V9XA 3G4SN 2MW8A 2GBYA 4XH4A 3AV9A 2V9PA 1FKOA 4MO4A 4PA1A 3CCJI 5AZIA 1TK5A 2UZKA 3EKUA 1ATSA 4O8UA 1BI4B 2CSOA 1RTIA 1T33A 2RREA 1MBGA 5CPRB 1EKEA 4MO7A 3ULQB 1R4NB 5E20A 3ZSRA 3SV4A 4DZJA 4HRIA 1ZRDA 4LK1F 3RTVA 3FZMA 4CF8A 2CWEA 1YJWN 3BOQA 1EWQA 1PUFA 1PYVA 4LLLA 3C6TA 2HXIA 1XS9A 2Q0RA 4ESJA 2HDDA 5JR3A 3OOUA 1UFMA 4CGHA 1YE9A 3MKLA 2GLOA 1ZBLA 1W5TA 2A1RA 4KITB 3IKVA 4QS8A 5H20A 3F2KA 3TSPA 3K4JA 3SZGA 3H1QA 4FVUA 2JPBA 4KHUA 3H9GA 1JLFA 3G71N 1JLGA 1VZ0A 4ON0A 4JRPA 3D0SA 2V1UA 3K2ZA 2I8DA 1VSJA 4M3DA 4KO0A 4UV9A 3BTJA 3RCOA 3VPZA 3L7WA 3DPTA 2Z1GA 1WSGA 1HKQA 2IXSA 1KYWA 1W9HA 2XY6A 1VQLN 3VQBA 4FJGA 1F21A 2VB6A 3HL2A 1V5GA 3HC7A 3IMXA 2XAFA 4I9QA 4FJLA 2A42A 1W36D 3NDKA 1ETKA 3E0JB 5LHIA 4RGSA 5M1PA 2BV6A 3MDQA 2YJFA 4CERA 1JHFA 2G0EA 5TISC 3L8BA 2K3PA 3VFZA 4BRGA 1ON1A 5JVGL 2YNHA 4HUFA 3AA4A 1TGOA 3JXUA 4CJUA 2OC6A 2YX6A 4AILC 1R00A 1SAZA 3LM2A 1ERDA 3R4KA 2ELKA 2W82A 4K8XA 2D1KA 2F5DA 3OYHA 1ATRA 4DS5A 3VPRA 4M63C 2QKBA 3PFYA 3L2RA 2UUBK 2HKOA 3ULEB 4NHJA 3ZSQA 1HDDC 2NRWA 1JKOC 4ELTA 3OJSA 4B9NA 1U5TB 1ZYRF 1J7KA 1MMDA 1IV8A 2FBKA 3AA5X 1MWKA 4YFUA 1CGPA 4GFBA 3SDBA 3LWMA 4BWMA 3F23A 1D0XA 4A5NA 3WHBA 1W5CC 4C3JJ 1VQNI 4X6AJ 2V4JC 2M1BA 3JW4A 3K6GA 4II3A 1A31A 3SFZA 2Y75A 3BPXA 2QVOA 5D6EA 2RF2A 2OPSA 2KISA 3MCAB 2EINH 4M3BA 3HL8A 4MIMA 3HSCA 4CESA 4OPAA 5LMUK 4J19A 4FJXA 4MEYF 1W7PD 4CJ3A 2OZMA 1K73O 2O8DA 3HXLA 4ASNA 3B6PA 1VF9A 3PX6A 1Q9YA 3L6QA 2RC4A 4LITA 3OBWA 1K79A 3CCQN 4ISGA 4CF9A 2FSJA 3J7AY 3VGKA 2DPDA 3ATUA 1RKWA 4RAFA 5D8LB 2EFQA 1W7PB 2ZMEB 3G1LA 4NB5A 3LDNA 4O4GA 2LF8A 4XN3A 2JPCA 3LAKA 4OJRA 1FSEA 5I42A 2DA5A 5IP6A 3WNHA 3K4KA 3CCRI 5H6RA 1J5EK 2GTDA 2XHKA 2KP6A 4LK0F 2NRRA 1FWZA 3O4NA 1D0YA 1IUFA 1KZHA 2FBVA 4CJQA 5GADJ 4W5TA 2GEMA 4F3QA 2GXBA 1H1VA 4DV0K 3U1KA 1KC8O 4CZIA 1VSEA 3OYLA 3LWLA 4AQYK 1S9GA 3F0CA 2XAQA 1WUAA 4KFBA 2F8SA 4D7NA 1KLMA 4BRNA 5AQVA 4C8OA 4LIUA 2GELA 2ATQA 2ZCWA 2CW0F 2VQLA 2X6NA 5F6FA 1RTDA 3I53A 4PWDA 2E71A 4AYBN 4YIIA 2HBLA 3BG6A 1F43A 1J75A 1IO2A 3LFKA 2L54A 2FU4A 3AVBA 3VTIA 4WFBL 2O03A 4H4OA 1ZG5A 3M1EA 4KIBA 4V19K 2DCEA 4A3FJ 1QVGM 1RC9A 3OL4A 4JP0A 1NTCA 4FJJA 2Y0SA 2ZB9A 1XQSC 1WSJA 1XUPO 2B4JA 2Q2EA 2P6TA 2UXXA 1WSHA 4HA8A 2RKHA 1RNHA 1RTJA 4FWQA 2E1OA 5BRHA 1D9DA 1D1BA 2E5NA 2QQ9A 2XPWA 1XSXA 1RGIA 2ME0A 2P81A 6PAXA 2VKHA 1Q82O 2R5YA 5BPLA 1SD4A 1NKCA 4HEA2 3PIPF 3C3WA 2DO7A 5DM6F 3CFOA 4YNQA 3HOUJ 1P2FA 4YOTA 4F93B 4Z94A 5GPCA 2R7OA 4A61A 3RRHA 4ZH4F 4CCNA 4HTLA 2DDAA 4DG1A 4LG0B 3CESA 2JA5J 1IZ1A 1K8KA 3OSGA 2BGCA 2W1OA 1HYVA 4CEQA 2P9KB 1CXUA 3C65A 2EZIA 3C2HA 4KNYA 1D8YA 4FLUA 3L4IA 1FEXA 4FSVA 2Q1NA 2UYTA 4CK3A 1MBFA 2M2EA 2L01A 2WONA 1OCTC 4OGCA 1SVLA 3SUNA 4Q5SF 4IOCL 3A1YA 4C2UA 3AVAA 4HV6A 3FZHA 2GV9A 4D5FA 3K70C 2QI2A 2NVXJ 5IT9O 2HFHA 4I02A 3LZJA 5KAIC 4QOZB 3SYTA 5DUIA 5DDGA 1RBTA 4LFCK 1SQKA 1FKPA 1SS6A 3ASOH 4KFCA 4YOUA 3HKZN 1NK4A 4RB2C 3CMEN 1QVFM 3VTHA 2NS8A 3J80O 3JRIA 4Z4IA 5LRSA 3U9ZA 2XY7A 2IS3A 2COMA 1ZQ3P 1GLLO 5FLMJ 5B1AH 2ZGYA 2H6CA 1ZG3A 3KJVA 3WTYC 4RDUA 1X4OA 4MGRA 4EQQA 5GIOA 2LG4A 2J5OA 3FXMA 2EV5A 1ZBFA 2E8AA 2CJJA 1RT5A 1YTAA 3L9FA 5DCFA 4GKKK 1MMSA 1C1BA 1FBUA 1U47A 3MEXA 3CJQB 2XSDC 3MMVA 2VJ5A 2CQXA 2V9VA 5BREA 2DODA 3GTQJ 2R7FA 1HYZA 3L3UA 4ENKA 1TKDA 2BY2A 4B3OA 2VG5A 1DT9A 3DLHA 4DTUA 1E17A 1HQEA 1R0AA 4FZYA 1LV5A 1YQAA 4B3RK 4ETSA 1DGWY 4NQWA 3MXJA 4BRKA 1D1CA 3DLLL 2FBXA 2HHTA 2ZSIB 3WU2C 3NF6A 4IG3A 1LAVA 2LC2A 3K5LA 3NRVA 2IGOA 1EQYA 1LWCA 1G3TA 1NJYA 1HSTA 1UMQA 1O3RA 1GLCG 2XPVA 4BYYA 1E3PA 4CW7B 2CW8A 4PJMA 4BACA 2AA4A 5AJ3K 4FX4A 3HRTA 3M9AA 4RS8A 3THXB 2YUSA 2WB1N 5KGXA 3HK2A 2B0LA 1SMYF 3WTXC 4JN4A 3SUPA 4PDKA 3EYYA 3HVTA 2Z5UA 4HSTA 3TP0A 2CYYA 3I59B 3WNGA 4HUEA 2CG4A 1JT0A 4CZGA 2RQQA 4CCKA 3DLGA 3AO1A 2QGUA 5DK5A 3HOVJ 4BC2A 4PZJA 2AXLA 4K43A 1NKBA 3H3VK 2NOJB 4PJJA 3HTSB 2JSPA 3K70D 1NGHA 4IG0A 4FWLA 1L5UA 2G7HA 2K02A 1SKWA 4FJHA 3LSHA 4CJFA 1J5YA 1ZR2A 3VEOA 2V6CA 5IT9K 3A01A 4E7KA 3FMSA 4M6XA 1FP1D 1RDBA 2HNZA 1JCEA 1VQ5I 2HBMA 5HP1A 3SQ2A 1J5OA 4AH9A 1V4SA 2P9IB 1WJFA 2VN2A 3LAJA 5HVQC 4HNUA 5HRSA 3G3ZA 1YTUA 2NLXA 4RA2A 1KQSM 2VPLA 3KP2A 2FBIA 3J80K 4DQ8A 2X4HA 4CJ7A 3NAEA 1IF1A 3AY9A 2E2NA 1J54A 2MD0A 3ERED 3VODA 3H9JA 2PZSA 5CVUA 5SZTA 5HROA 3OR1C 1X2NA 1KONA 1VQ8N 1Z25A 2AJQA 3DI6A 1SFUA 3QMLA 3HVRA 2W40A 2RKIA 1UCRA 3COAC 4BG8A 3R6MA 2P7VB 4GV6A 3BR5A 2P5KA 4QSHA 3G6EI 1BG3A 4DSJA 3JRGA 3B73A 2FQ3A 3CCVI 4QAGA 3F22A 4OU0A 2DQLA 2LMDA 1TT0A 3DMJA 4ZTFA 2RQPA 1QPIA 3HOYJ 4ELUA 3T7ZA 4Y4RA 3R9PA 4ANJA 3GTJJ 2OAZA 4IQJA 3M1CA 3MEEA 4DQPA 1RR8C 4M3EA 4CD3A 2KFZA 4DV4K 2HTJA 4YDUC 1G8XA 3J81K 4A3LJ 3QYEA 3DLRA 2NOGA 4DFJA 5KCMA 1QHGA 1U6GA 4W5NA 3CDLA 1W0TA 4I9LA 3E01A 3CCEN 4I6MA 3RRGA 4UB6C 1HKCA 3V9SA 3AAQA 2M0MA 4WQ4A 3WXLA 3MMYB 5M5XJ 1VNDA 2UXDK 4N5SA 1IUYA 3DLBA 3QB0A 4JHDA 1USSA 4M45A 3KP3A 2VC0A 3ZX0A 1OCOH 1D5VA 1RDWX 3EKSA 2G8FA 2O8CA 2GWJA 2E35A 5EJCA 4HBLA 3E5UA 2JK3A 4BR2A 3SBGA 3FF5A 2EBIA 1Y6IA 3E66A 2LTPA 2HQ5A 3K9KA 2Y69H 1CXQA 2R93J 2XPUA 3QOPA 5FLXO 2FMYA 3A03A 4CZCA 3LAMA 4AM6A 2MH9A 1ZXOA 3SFIA 3PV8A 4O5FA 2HB5A 2FF4A 2RDPA 4CD1A 2HR3A 4RG8A 2OTLI 3VSKA 2UXCK 3H46O 1HNXK 5C12A 3TARA 3G4SI 4CHUA 3QLHA 4ZHRA 4DB3A 3CPEA 3S41A 4BC5A 4DSFA 2DA7A 5EXWA 2P5OA 1VQ9N 2RAEA 1XSDA 1V5EA 1J9IA 3PNYA 1XC9A 4IXAA 4OKJA 3GTGJ 2RPIA 4P5OA 4B8AB 2XGCA 2KLOA 2PJPA 4IXCA 1P8ZA 5D5VB 1HRHA 4DR4K 1U78A 2E6LA 3P4IA 4ITVA 4HCCA 4V2GA 4G9ZA 1LWFA 3DEWA 5FKKA 3DBLB 1QQOA 1VSFA 2AXTC 4NBQA 2K9QA 1TK0A 5AQFA 5LRRA 4E89A 5HLGA 3M6GA 3AKZA 4AU7A 3I58A 1VK0A 2HVIA 2ELJA 2Q1ZB 3WTVC 5IP9J 1G3WA 2HNDA 2YX7A 4A3BJ 1JXEA 2BVMA 4Y0WA 4JKBA 5E3LA 3O1BA 4CK1A 4FW1A 4S0HB 2CH0A 4HX8A 3VMFB 2LBFB 1IAWA 1KA8A 2COBA 1NHAA 3H0DA 4CJSA 4A3EJ 3QBWA 3G71I 1NK8A 3EETA 1Z7UA 5DS9A 4DTJA 4JX4A 1X3ZB 2HYFA 5LY3A 3VQ6A 3DRRA 3VEZA 2EPFA 4U87A 5E1WA 4NLBA 4WQ4C 1KU3A 5B1BH 3NWTA 5DCMA 1H9GA 1SFOJ 1VQLI 3ENOA 3MD2A 3A4CA 4HOBA 1ZGWA 1S7EA 2HF4A 1LE8A 1P4XA 1MH4A 5M1QA 4ESFA 3W3DA 4BRAA 5IT3A 5ICCA 2FBHA 4RAYA 4CGDA 1BOBA 3RZOJ 3CCYA 3H9QA 2HYGD 1R5GA 1NGFA 1VSDA 2IVOA 3SQ0A 1OYWA 4PKIA 4YHHK 1DEJA 2PMHA 3CCMN 1Y1VJ 2JMWA 1KXPA 4KJZA 4LF9K 3AVGA 1TW3A 3PIPL 1SL0A 3SQNA 5DM6L 3A0HC 3VB2A 3SMPA 2P9LB 1NBWA 5FLXK 2W25A 2VUMJ 4ZDLA 1JTYA 5F0FA 3SCXA 2E1MC 1YITN 2CS3A 5F08A 2K7LA 1HOMA 1QGPA 3WEEB 4RW7A 2CH6A 3OYCA 1OJLA 2L4MA 1D4XA 5BN9A 1X9WA 4M3RA 1CF7B 3FM3A 4H0VB 3JR9A 4CJPA 2FSNA 1WBBA 4DCHA 1N8RO 4WF9L 4KB0A 2DMTA 4H03B 5FKLA 2O8EB 2OA4A 1TLHB 2V6EA 4X62K 4G9YA 1LDDA 5KNLA 2N8GA 3G0ZA 4XORA 1BIUA 4HW0A 2V51B 4XRFA 4V19S 1T6DA 3ITHA 5CE3A 2DMNA 3SAGA 4FLXA 2DA6A 5KPZA 3C18A 3K5NA 2Y9YA 5J4YA 1BI2A 3TDUC 4O0IA 5LBQA 4FWSA 5J1RA 1IN8A 4FM1A 2WWYA 3W2AA 2JGUA 5AQLA 3VQAA 2NVUB 4YFNF 3AO2A 1RDDA 2MLGA 2UWMA 3BF1A 2LSOA 5FRMA 3Q3SA 5LMNK 3EQLF 4IEIA 3HG9A 2OANA 2ECCA 2ETJA 1IN4A 1WI9A 3CLQA 4JBAA 2NRXA 4IRHA 3CUQA 2KRCA 3AAFA 3CD6N 3KZBA 1XNQK 4PQUA 5J2NA 5A2QO 3IUCA 4A3CJ 2RNGA 2EZHA 2L5QA 3EUKL 1T08B 1T56A 4F2SA 4BE1A 3ZETA 5T7BA 2MSYA 3SQ4A 1TQPA 2DDBA 3MXIA 3BF3A 4BBRJ 3ISNC 1U9NA 3OYDA 3ABKH 3ZEUA 2V9KA 2CUEA 1Z91A 1V4TA 1NM1A 1TTYA 1HC8A 1A36A 1IN5A 2GM4A 4I01A 4FM2A 3CJ1A 1U2VA 5I9EB 4DV2K 4D7MA 1XMOK 2B63J 4DS4A 3MZ8A 1KCFA 4L5JA 3TTDA 3S1MJ 3M8PA 1QVUA 2V7ZA 1JUPA 4E7IA 2K5CA 3FHNA 1EH7A 1IH7A 5KRSA 4K8ZA 4IRIA 4RB0A 2PFBA 3M8FA 4FETA 4BR4A 5JI6A 1LVAA 3BPVA 3KK7A 3TAQA 3KHYA 3QP5A 2P5GA 4AUXA 3C95A 4AM7A 2LLKA 1OH7A 5D3GA 1P9QC 3CERA 3AL0B 3ZQHA 1NJZA 3AG3H 4BH9A 5EYRA 5CQEA 4M9SA 1RBRA 2CMPA 2ZJRF 1UHWA 2GIVA 1BIAA 1MZBA 4A3IJ 2QXFA 1S1VA 1TWCJ 3R0AA 3OL3A 4CHNA 4BRHA 3GTLJ 2D5RA 5HNHA 3MXMA 2ID6A 1X1PA 1I6HJ 2O8BB 5HBMA 4BREA 4CZZA 3E9OA 1F9NA 4BGAA 2ITGA 5FKMA 3LSIA 3D7EO 5HLFA 2R7XA 3W2WA 4CIFA 3F6OA 1GUUA 3U9DA 2EIJH 3PUFA 3GEZA 1TL3A 2PBDA 5ILVA 3NBPA 3ZX2A 1G99A 2ZFWA 3VYTB 4DU3A 3ROUA 2BHYA 4GDFA 4Z0UA 5AZJA 4DLGA 3NGIA 3KLNA 3CUQC 2VPRA 2L7FP 4OGEA 5ERIA 5F27A 4CHQA 4FLTA 5BNGA 1Z05A 4OIRF 1FMWA 4MLOA 4C30A 4JI8K 2F5CA 2P5VA 3K5OA 3PUBA 4N76A 1CZ9A 1EV7A 1WZ2A 1XTAA 5EEGA 4WCGA 3BGRA 3K4BA 4B09A 3DXMB 1JUSA 3SLCA 2FLOA 1L3TA 1JXSA 3FK6A 5A2QK 3CTAA 3M07A 3DLKA 3UKRA 1P92A 2JSCA 4WYBA 3CMEI 3HOSA 1U04A 5EG0A 4IWVA 1GVDA 4FVMA 3SEZA 3RMBA 1HPZA 2QLZA 1WPKA 4B9QA 2DFHA 4FWKA 1BR2A 4V2FA 3C2BA 4M3GA 2GOMA 4FYDA 3IRQA 5JS1A 1TWFJ 4G6QA 5FFXA 3QPLA 3TEDA 1M90O 2YSRA 3VQ5A 3QEPA 4CGGA 4I76A 3F9MA 4PK4A 3WE2A 2K27A 2IOCA 1S72N 3OYEA 4NCAA 4BXUA 2HBKA 5AQMA 5GTHC 1WBDA 4KISA 1FY7A 4GV9A 1OYYA 2E1YA 4BU2A 4OIPF 4B3XA 1D5AA 1QPMA 2LYCA 4KHSA 2LR8A 2QEXN 1FOXA 4KIGA 2PQ8A 4JD2A 5AQJA 2VYPA 3O8GA 4CA0A 2Q0OA 3G73A 2X6XA 5F64A 4EFHA 4EP4A 5K7FA 1A5JA 3P31A 5J4VA 3J7AP 2E5LK 3S14J 4R1HA 1EA3A 2F2EA 2H6BA 1REVA 4AIHA 4YFKF 1N33K 1UJ8A 3DKXA 3BTIA 5H6QA 4DYQA 4EHTA 1LEAA 1C0FA 1RT6A 4L0YB 1YJNN 2EIKH 4MHGA 5KQ8A 5C4JJ 5BPMA 4O6JA 4DV6K 4UUSB 3I9V2 4NLCA 4FWMA 3OW2M 1WLJA 1Q1HA 4HHTA 4BJTA 3OR2C 1O7FA 3M5RA 2V7FA 2P9PA 3KETA 2XROA 1DDNA 2EFOA 5ED4A 1AKHB 2QBYA 1LPQA 4C2MJ 2L9RA 4QIWN 3B6CA 3PM1A 1V5FA 4BS9A 1P90A 3GUDA 3P9KA 4IKFA 3HP9A 4YRVA 4XICA 3O9SA 1UB9A 3GTMJ 4DTRA 4MQ3A 2LD5A 1JL2A 1B8IB 1LOTB 4G8XA 3KCCA 4DR3K 3K7AJ 2HXOA 4XLNF 2WTEA 3J7YJ 3K2AA 1LWEA 1UWBA 1XGNA 4QPOA 3ID6A 5EX5A 3SDGA 1YRNA 1HPMA 3ECOA 2CGKA 4LB5A 4FWNA 2GIZA 1R7JA 2JA2A 1TWAJ 3ZR8X 1J59A 3GFMA 1XGSA 3ZN1A 3C6HA 3RTRA 2WB1A 4KI4A 2YHXA 2JZYA 3IH2A 4OINF 1Z26A 4UY8O 4Z4EA 1SAXA 5EZHA 1C1AA 1O57A 4C8LA 1TQIA 1XC5A 2UU9K 1AU7A 1VQ8I 3IL2A 3O3KA 1GLEG 3ZT3A 4MDBA 3KP7A 1QZYA 1S5LC 4TV7A 3LA7A 4FT8A 4ZYHA 4IHXA 2BHZA 4K42A 2QW9A 2A05A 3K2PA 3N97A 2A6EF 4TSXA 4HZFA 3SMSA 3A5LC 3U2RA 3TO6A 3H08A 1Q8IA 3LWFA 2ISYA 4M7YA 5ILUA 4BXFA 2P9SA 2QWLA 4RTFD 3VSLA 4XKBA 3CQYA 1ZR4A 1PUEE 4D9JA 2FNPA 2ZXIA 4UQGA 5FKOA 4ENNA 1ZKGA 1MU2A 4G7HF 3T3FA 1TWHJ 1N36K 1MDMA 3ZMSA 3DJCA 3KZZA 1WJ5A 3THWA 1Y39A 3CCEI 3ALYA 1B6AA 3JSOA 5ILSA 3EZ5A 3PLAA 4H0OA 1MW7A 2PG4A 3EN9A 2VG6A 3MQ0A 4JS4A 3CFPA 4Q0BA 2EX3A 2HHHK 1Y8RB 1VQPN 2Q0UA 1NMNA 3C1DA 2E2QA 2KHOA 2O8FA 1U0JA 1EO1A 2D0BA 4LD5A 3WGHA 4A3GJ 2CFXA 2W85A 4KIFA 2E4LA 1IRXA 1KVBA 1GXQA 4DYRA 3NWSA 5KQDA 2JUGA 4UUTA 3KKRA 4K2EA 1GLJO 2FBTA 3HOWJ 5JFRA 1S3JA 2W41A 1MJ9A 2ETHA 1M1EB 3ZSOA 3KP6A 5CVJA 4RGRA 2HI3A 1P4WA 3AVKA 1CLQA 3GF2A 5AIQA 4N0BA 1L3LA 1ZG1A 1R23A 2NVYJ 1T44A 1TYQB 3V8KA 4AIJA 1IDZA 3D2EB 1VQ9I 1YX5A 3ZCMA 1HCRA 3K0SA 3OSFA 2E2OA 1WHUA 1W4MA 3ECHA 4CJVA 4C3HJ 5C3EJ 3F8BA 3O2PE 2XDVA 2E60A 4CFDA 1VQMN 2EIMH 5D6FA 3W3CA 3VOVA 2O4IA 1T38A 1V3FA 2MFZA 2NS0A 2IVPA 3AO4A 2AHQA 4A6DA 1R71A 4FTHA 4CH7A 1BN5A 4HG2A 4X1EA 3HRUA 3BC8A 5AQPA 2AQEA 3TAMA 1NMDA 2YNGA 1IKVA 2ID3A 2JQ7A 4XKVA 3H5RA 3CJAA 4ISEA 2ZXWH 1IGNA 2R3SA 2LK2A 2X6YA 3VQ4A 2CO5A 1HBXG 1ZBHA 1FIAA 3HT3A 2E34A 2W6KA 1WOQA 2KFNA 3THYB 3GBTA 3AVJA 3FMRA 1X3UA 4B48A 2K3FA 4D0PA 5LJWA 4N47A 4PCQA 3LL7A 3FFKB 4KHWA 1NNEA 4XOTA 4BDPA 1JKPC 4FX0A 1QA6A 3QESA 2LDUA 4DR2K 2M7BA 2HZTA 2LY9A 3QP6A 4PUOA 3VYUB 4JS5A 3R60A 3CC2N 2L3DA 3I3LA 4KHYA 3WGGA 1REPC 4RBOA 2HS5A 2Y48A 4XQFA 1ZGAA 4QS9A 3FE1A 2ZJRL 1F36A 2IGMA 3MCZA 3A0IX 1V54H 2ZQBA 4CHYA 2K4JA 5DD8A 4A0XA 3AAPA 4CCOA 1HJRA 4D5CA 3EEQA 3E6BA 3P5JA 4LD0A 3CCMI 4JKGA 4CGZA 1W97L 5FB2A 2HDCA 1XWLA 1UZCA 2JT1A 4JK8A 4MTEA 2O9LA 4CCLA 4BEHB 2CUZA 3HGYA 2IGIA 2VQHA 1KVAA 4DFPA 1RIOH 2E36A 3H3UA 3DV8A 1BBYA 1YITI 3H45C 5F1XA 3LSMA 4U0VA 3J8AA 2AO9A 4JI5K 4IL6C 3JS6A 3WXIA 2G8HA 4ISFA 2LF7A 3H35A 4E7SA 2CV2A 1VAZA 5FKNA 5EY4A 3G1OA 5KGWA 4M74A 1R5HA 4CIGA 3NHGA 5GAEP 2JLEA 3AFHA 3DXKB 4IDKA 4FQGA 2WOMA 4Q4ZF 4CZFA 1ORKA 1BI4A 4IZ9A 5DEQA 3AG1H 4CGFA 1D8JA 2Y2ZA 2FXAA 3AG2H 3SBTA 2HF3A 1F5TA 3I54A 3HJFA 1IN7A 3F5TA 3SHFA 3TQNA 2IEKA 2VWBA 4WWCA 3CMMA 1MIJA 1WNSA 2I5JA 3P83D 5AQHA 2DBBA 5HDKA 3QO9A 5AQUA 2MLKA 3LP0A 4M71A 2X6WA 1YUWA 3RSNA 1UELB 3QIPA 1BUPA 1WJCA 1MD0A 4CCMA 3VQDA 3GW2A 3CCSN 2VXZA 4A62A 2HHSA 1ZLJA 1T7PA 3UB5A 1Z67A 1HW5A 4YIFA 4XLPF 4XNFA 2P9NA 3RDIA 1NGAA 4Y1DA 4PSWA 3CD6I 2HGCA 2L7MP 1RT3A 1LNWA 1ETWA 3IWZA 2DFEA 4RLFA 2MYSA 2BXZA 1HUXA 2OCEA 2IGKA 4JRQA 4XOPA 3M7GA 3QWLA 5BQTA 3L00A 3LM9A 3T0YA 3ZSWA 1SD5A 1KQ9A 2LREA 2Q36A 3QPTA 3HRGA 1RBVA 5AR0A 4OKEA 3V8LA 3QETA 4L9NA 4ZZDA 1YI2N 3NMUA 4CIEA 3QIOA 1KYZA 4B3AA 4WX9A 3ZT4A 3KK2A 3ID8A 3IAYA 2UXBK 1KQ8A 3OS2A 4FE7A 3DLEA 1YFHA 5IYBJ 2HVSA 4EAHD 1IG9A 3WU1B 1TC3C 5GADP 2H8WA 1S29A 3EE9A 1YX3A 4MFBA 4BRMA 3ULEA 2NS7A 5AIPA 4LY7A 2BTFA 5E1ZB 5D4SA 2X1DA 1QSYA 5EU7A 2LVSA 4E7ZA 1LCUA 1TAQA 1ZAOA 5TKWA 2DMQA 2A40A 2Q8KA 4ZZLA 2DOEA 5AONA 3VYRB 3LPUA 3KWIA 4KTWA 2XAGA 2PYLA 4N9HA 4FPAA 2A3SA 3DYAA 3S1QJ 3KEOA 2HNHA 1YIJN 2JA7J 3DOKA 2XAJA 2G7UA 3WHCA 2OZSA 3NF9A 2IP2A 3MN7A 2A69F 4Q48A 4A3DJ 2EQRA 3UKGA 3K69A 3BDPA 3TMOA 3HUGB 4E1MA 1FYKA 4I0AA 2A07F 3H6EA 2Z1IA 1XB4A 1XI1A 4N41A 4RGUA 2STWA 1T8EA 5JHFA 4H5RA 1G59A 4Z4HA 4HV5A 2NVTJ 3QEVA 4A2BA 3FXRA 3HRSA 2R7WA 3JTGA 2BANA 4DUZK 2WBMA 2M45A 4J2BA 5K7HA 2D0AA 3JRCA 1W7PA 2ZMEA 5HRRA 1X9SA 5E79C 5M1KA 4DV5K 2YKNA 1MBHA 4E7HA 3ZP5A 1K61A 1S9HA 4DTMA 4BQLA 3EZWA 3MN5A 2ZM6K 2RV8A 3VQ8A 3TGNA 3ZMZA 2FX0A 1G2HA 4GNIA 3SZTA 2PFUA 1SVMA 4Y17A 3HSRA 5CKTA 3L2UA 1Y64A 1JE8A 2A5WA 4EATA 1BOTO 4YIRX 4KAZA 3VQ7A 1ZRFA 5E8IA 1OFCX 3U6FA 2CRGA 4G1QA 1BA0A 1LAWA 3HBLA 5J1YA 2E7WA 4HLXA 3QEIA 2IW5A 2QKMB 3C0BA 1UAAA 1IW7F 4F92B 4CDGA 3KTQA 1YW9A 4DBQA 3F72A 4RCHA 3RYRA 5JHUA 1GDTA 4JYAK 5EOYA 4BE2A 3J7ZI 3U3GA 3FFIA 5IPAA 4CJ5A 3R61A 1IG7A 5DCMB 4E19A 2IVMA 1KFSA 3ASNH 4JX6A 4AVZA 1RT4A 1NGEA 4CFCA 1S72I 3U9GA 1U5TC 1UA1A 3OIPA 2DTZA 5HLHA 4HQMA 2IA1A 2GAUA 2EV6A 4XIDA 4FO0A 2XIGA 3LFUA 2QEXI 1IBKK 2G8KA 1U48A 3GVAA 2EILH 3A5NC 1ZN2A 3DWLA 5HRNA 1MMGA 2E7XA 3VQEA 1GLFO 3U21A 4A5MA 4IHTA 1JLCA 2H3GX 1UHSA 1MMAA 5AQZA 5HOOA 3K4LA 3HSTB 3WUHA 2PN6A 4XRSA 4ILJA 2D4WA 2L0KA 1ULYA 3I33A 3SYZA 4AWXB 3VF4A 2KQ2A 3T8TA 4CEAA 1YJNI 2ESHA 3VEPA 1HW1A 3LP3A 4CHPA 2CFOA 2P7CB 4NNJA 1XD7A 3KFWX 1VRUA 3LDSA 3VEWA 1NK0A 4M7XA 4CJRA 3RPUA 3HGGA 5LGNA 1DPRA 1HKBA 4BVOA 2QSGX 2ZMEC 1JT6A 2L7KA 1DTQA 1MJAA 5FROA 4LG0A 4IQ4A 2PJRB 3R1XA 2IS6A 2HBJA 5C24A 1JHHA 2H94A 2DN0A 2M3AA 1CZAN 3HYIA 4BR0A 4KI6A 5TRDA 5EF6A 3G2BA 1WVRA 3T1HK 4JK1X 3JRDA 2O7OA 5DYMA 4PJ0C 1S1UA
chains in the Genus database with same CATH topology
3RMDA 4IG0A 4CGDA 1L5UA 2KZZA 1KLMA 4FK4A 4ID1A 5FDLA 5SWMA 1SKWA 2HW3A 1G15A 4FJHA 4C8OA 1VRTA 2D0BA 4CJFA 1BQNA 1VSKA 4CCHA 1B9DA 4F4KA 4BE0A 2ATQA 3ZSWA 1VSDA 2BGGA 3DLKA 4Z4CA 3SQ0A 4AHSA 4FJ5A 2X6NA 1KTQA 3VQ9A 4F8RA 2E4LA 4J2DA 4E7KA 1RTDA 3SJJA 5E41A 1KVBA 1RDBA 2HNZA 2QKKA 4FK0A 4PWDA 1HNIA 1U04A 1RBVA 3O3GA 4FVMA 4OKEA 4Z4FA 3NCIA