2DFEA

Crystal structure of tk-rnase hii(1-200)-c
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
209
structure length
209
Chain Sequence
MKIAGIDEAGRGPVIGPMVIAAVVVDENSLPKLEELKVRDSKKLTPKRREKLFNEILGVLDDYVILELPPDVIGSREGTLNEFEVENFAKALNSLKVKPDVIYADAADVDEERFARELGERLNFEAEVVAKHKADDIFPVVSAASILAKVTRDRAVEKLKEEYGEIGSGYPSDPRTRAFLENYYREHGEFPPIVRKGWKTTQDMINKST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HII
publication title Conformational contagion in a protein: Structural properties of a chameleon sequence
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
total genus 69
structure length 209
sequence length 209
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 2dfeA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2dfeA01
4BWJA 3TAQA 3ZT3A 4CGFA 1VSKA 4C8MA 3RMDA 4ZTJA 1S6PA 4GVMA 1TL3A 3AA3A 1C1AA 1VSMA 3RWUA 1C1BA 3ZCMA 2P5OA 4FZXC 4PQUA 3ZSXA 4C8NA 3K5NA 2PZSA 3V9ZA 1X1PA 3VQ7A 4FJLA 3TABA 4IG0A 4OGEA 4F4KA 3SI6A 1EETA 1J53A 1L3TA 4FJ8A 4ZTFA 3AO3A 1D5AA 4CGHA 5J2QA 3O3GA 1JKHA 3O4NA 1TGOA 1JLAA 3HK2A 1WSIA 1N5YA 3U6FA 2RF2A 4HUFA 4DWIA 2IDOA 3SV3A 1L5UA 3K57A 4FM2A 3SQ0A 3NAEA 4J2AA 4OLBA 4KV8A 1BI4A 4AH9A 3DI6A 4N47A 3SCXA 4FXDA 1NJXA 2PY5A 4E89A 4KB1A 2YHAA 4CEBA 1HQEA 3QIOA 3HXMA 2YKNA 2Y1JA 3AVJA 4CJUA 3DOKA 5HP1A 4BE1A 4DSEA 4FW2A 3NF6A 3WNFA 4M41A 1NK9A 4K8ZA 5HBMA 3HVTA 4FM1A 1L3SA 5J2PA 3NHGA 4DTJA 2ZE2A 1S9EA 2P51A 4KHWA 4Q5VA 4AHSA 4DSKA 4KHQA 2D5RA 5FRMA 3CFPA 4FCYA 4DQPA 1FXXA 4CJ3A 4CGJA 3M8PA 1RBSA 3TI0A 1VSHA 3HT3A 4FJIA 3DLHA 4DSLA 4ICLA 1BQNA 1KTQA 2XRIA 4CIGA 2HHVA 1VSIA 1KFDA 2KQ2A 4R5PA 2F8TA 4FLYA 4AHUA 4DTPA 5KI6A 2YKMA 4XIUA 1X9SA 3SQ4A 1D9FA 3KD5E 1HQUA 2P1JA 2NUBA 3KLIA 1TL1A 3CQ8A 4FLXA 3LPTA 2O4GA 5CYQA 4CJKA 1XHXA 4NCGA 4HTUA 4B9SA 4CFBA 4F2RA 3AVNA 4AHCA 1W0HA 2Z1HA 4CF1A 3RMAA 1VRTA 3IAYA 4Z4EA 3HJFA 2AJQA 1KVAA 1TVRA 3I0RA 1WSGA 4CF0A 4E7JA 1EKEA 4LSNA 4Z4CA 4AHVA 3FFIA 5HRSA 3QEWA 3QNNA 3U3YA 1NK4A 5FRNA 4CCHA 1MU2A 1S1TA 4CFCA 3ZSQA 3C6UA 4CF8A 2XHBA 1Z25A 3LPUA 4CJ4A 3MXIA 1IKYA 4KFBA 4CGIA 3QINA 4CJRA 1ZBLA 1S9GA 3DRSA 4DQQA 4KAZA 4E0DA 4KHSA 4KHYA 5HRRA 4FJNA 4CHYA 1LWEA 3NGZA 4M3UA 4NCBA 3LP3A 4DLEA 4FJHA 1UOCA 5CZ1A 4QCLA 2XY7A 4KTQA 3AVIA 3KKRA 3L2UA 1RDBA 4GMJB 1U4BA 1BQMA 3WNGA 1IG9A 2B5JA 2E6MA 4CJPA 3A2FA 1O1WA 3L2RA 3K59A 1XC9A 4KHNA 4FJXA 1UWBA 3ZSOA 5J1EA 4DTUA 2BANA 3VA0A 4AHTA 4N56A 1NK6A 2BE2A 4CEAA 3VQQA 2A1SA 2IGIA 3VQCA 4CGGA 1UA1A 4AILC 3AVBA 2O4IA 2OPSA 4KREA 4M42A 4FK4A 1JXEA 3P5JA 3PO5A 3V9WA 2HHWA 3T1AA 3I0SA 5JS2A 1SUQA 2D0CA 1RT3A 1RCHA 3QIPA 3NBPA 4G1QA 2ETJA 3AVCA 3V1QA 3V9XA 4E7KA 1RBRA 2DTUA 1QSLA 4L8RB 4HHTA 4N5SA 2Z1JA 3S3NA 2G8UA 4M3WA 3SPYA 1RT7A 3L2VA 1S1UA 4FM0A 3ZSVA 1NJZA 4O0JA 3OYBA 3SUPA 4FZYA 3OYJA 2KZZA 2HNYA 4NCAA 2E6LA 5J2NA 3QO9A 1SKRA 4K8XA 4DS5A 5FROA 3K5LA 4Z4FA 1WNSA 1EXQA 2DY4A 3MXJA 3HM9A 2G8IA 4CK3A 1CLQA 4E7LA 3RR7A 3TR8A 1JL1A 5SWMA 3K58A 3SJJA 1YTAA 4IG3A 3HP6A 3DYAA 1TK5A 2IAJA 1LAVA 2FC0A 4I2PA 4KTWA 4OKKA 4RW9A 3KJVA 3VQ5A 1SKWA 1RTDA 4EZ9A 4TSXA 5KGWA 3CM5A 4DTXA 3NGIA 1RTHA 3VQ8A 1SKSA 3DM2A 1I39A 1LWFA 1ASUA 3NF9A 3P83D 3TARA 4DTSA 4IKFA 3LDSA 4O55A 4JS5A 1RDAA 1KCFA 2A1RA 3LP2A 5CY4A 4CJTA 4W5RA 2WONA 4O0IA 4I2QA 1S5JA 4DG1A 3KLEA 3PX0A 2QXFA 3B6OA 3DLEA 3ZT1A 4E1NA 3QESA 2OZSA 3VQBA 2HHTA 1TAUA 1B92A 1HPZA 4LD0A 4CEFA 2QKBA 4GW6A 2FBXA 1CZBA 1HRHA 4CEEA 1X9MA 4DSIA 5C25A 4ID1A 4MFBA 2G8HA 2ATQA 3OVNA 2OYQA 4CGDA 3RTVA 1NKCA 3VQPA 1ASVA 3AA5X 1Z26A 5T7BA 3IG1A 1EX4A 1RT6A 3DRPA 1S1XA 1IO2A 3HP9A 4CEZA 1NK7A 4ELVA 2X74A 4N41A 4YNQA 4M3XA 1RTJA 3VN5A 2D0BA 4C8OA 1JXBA 4CF9A 2G8VA 1RDCA 4CHZA 4CIFA 3LALA 1KSPA 4CERA 5KRSA 4DS4A 1FK9A 4DSJA 1ASWA 3C94A 3WNHA 3OY9A 2GUIA 3RRHA 3PX4A 1Q9XA 3QEVA 1WAFA 4RW4A 3V9UA 4I9QA 4Q0BA 4O5BA 4IFVA 3NH1A 1WSJA 4OVLA 3V1OA 4CJFA 3JYTA 4Z0UA 1LWCA 1HNVA 4JRPA 3VQAA 2Z1IA 3ZSWA 4EP5A 3M8QA 2KTQA 1ZBIA 3L3VA 4BACA 1DTTA 3K5OA 2OZMA 3DOLA 2BDPA 2YV0X 3JSMA 5HLFA 3LWLA 4KTZA 4PY5A 3SUQA 4CHQA 3S3OA 4CJEA 4DTOA 4QAGA 2YNIA 3F73A 1TK0A 2VG6A 4RG8A 1GOAA 3ZSRA 4LH5A 3NGYA 3KK2A 3LZJA 5D3GA 1A5WA 3PUFA 2HB5A 1HNIA 2YNFA 3LP1A 3NF7A 4OGCA 4B8AB 2X6SA 3HO1A 2HHSA 2OPPA 2X6NA 4IBNA 4CK1A 5SZTA 1NK8A 3DLRA 3M8RA 3V4IA 4DF8A 1VSLA 3ZT0A 3QEPA 2OPQA 5JS1A 3AO5A 4DMNA 1K6YA 3B6PA 4FZZA 4FLTA 4DFJA 1JLCA 4ZHRA 3CG7A 4CK2A 1KRPA 3SQ1A 1A5VA 4IDKA 1T7PA 3DLKA 3MEDA 4CJWA 3U3GA 2KZMA 4JLHA 3P1GA 3DRRA 4CEDA 3OYIA 4O44A 3I8DA 4H4OA 3KLFA 2HW3A 3F9KA 3PY8A 1REVA 2IOCA 5DK5A 1L3VA 2Q3SA 5KGXA 3AA4A 3D0PA 1C6VA 1XI1A 2G8FA 2KFNA 4KI6A 1NJYA 1LV5A 5CYMA 1BI4B 4C8LA 4KB0A 5HRNA 1XWLA 3AVGA 1BIZA 3MXMA 3LAKA 3VQ9A 3TAFA 1FKPA 2VWKA 1SV5A 4F8RA 1CZ9A 1WAJA 3OYHA 3C95A 2F96A 3AO4A 1CXUA 3ZT4A 4FJ9A 4Z4HA 4DSFA 2F8SA 4Z4IA 4DF4A 4W5QA 3BDPA 1KVBA 2B4JA 4FLUA 4UQGA 1NKEA 4F3OA 4OKEA 4KRFA 3OYFA 2HVIA 4PA1A 1BISA 3RRGA 1RNHA 1VSJA 3EZ5A 5C24A 5HROA 1UA0A 3O3HA 2G8WA 1F21A 1U45A 4O4GA 4W5TA 4I9LA 1BHLA 3OYAA 3KK3A 1HMVA 4E1MA 2X78A 1TKXA 1S6QA 1BCMA 4Y1CA 3NH2A 3NE6A 2VWJA 3PV8A 5E41A 3M8SA 1R0AA 1JL2A 5DMRA 1ZYQA 2QKKA 1LW0A 4KPYA 3OS2A 4J2EA 1KFSA 3H08A 3AV9A 2DFHA 1FKOA 3G0ZA 4PUOA 3G10A 1VRUA 1HYSA 1RT4A 3LP0A 1JLFA 4EZ6A 4OLAA 4NYNA 1T05A 4W5NA 1Q8IA 1QHTA 3OYMA 3K5MA 3PX6A 1IKWA 1S1VA 3SZ2A 4IFYA 3LAMA 1KLNA 4KKOA 1QS4A 4M3RA 3WNEA 1XHZA 1C0MA 4FJGA 1NKBA 4FK2A 4Y1DA 4JRQA 3THVA 3ZSZA 2WOMA 2RN2A 1WSHA 5KRTA 4DTNA 3OYDA 1GOBA 2Z1GA 4B9MA 4M3YA 2PYJA 3SNNA 3PO4A 2PYLA 1RTIA 1RT1A 3SQ2A 2OPRA 4WE1A 4DTMA 2DFEA 1QQCA 3TAEA 4C8KA 3QNOA 3OYGA 3KIOA 2JGUA 3TAMA 3HSTB 4CESA 1VSEA 3QEIA 1W9HA 3CFRA 2XY6A 3KLGA 3NH0A 4J2DA 4DQSA 1TKTA 1TKDA 1ZBHA 1YT3A 5FDLA 4CJLA 4H8KA 1TK8A 3NCIA 1QSSA 4CIEA 3NFAA 3D45A 3UIQA 2GV9A 3V6DA 1RT5A 2IC3A 3V81A 5I3UA 4EP4A 1VSDA 4HVJA 3CM6A 3KLHA 4B9NA 4HCCA 1VK0A 3OS1A 3TWHA 2R7YA 3QEXA 4FJKA 3AA2A 3VQ4A 4KO0A 2DFFA 1X9WA 4KI4A 2GBZA 4CFDA 4CJSA 4OKJA 3ITHA 3EYZA 4W5OA 4FJ5A 1KLMA 3L2WA 4Z4GA 3OS0A 3EY1A 3DLGA 1WSEA 1HYZA 1JLQA 2VG5A 4CJ5A 1T8EA 3RR8A 2XO7A 4RW8A 4OPJA 1ZBFA 1ZBUA 1HJRA 3SV4A 4B9LA 1LAWA 3AVMA 3KKSA 4CHNA 4FLZA 1U48A 1GOCA 3ISNC 3QLHA 4BDZA 4CEOA 3TAGA 3IS9A 1YVUA 2LSNA 2ZQBA 5KTQA 3LWMA 1BIUA 1BGXT 3L8BA 1S1WA 1I3AA 1WSFA 3VQEA 4E7IA 4DU4A 1U47A 1T03A 1VSFA 2JLEA 4RW7A 3T3FA 3MAQA 3S9HA 4N76A 3V1RA 4BDYA 1LW2A 2IS3A 2FBYA 4LSLA 1D9DA 4E3SA 4DTRA 4M3ZA 1UAXA 3RMCA 3DMJA 1JLBA 1IKXA 3ALYA 3ZT2A 2YNHA 4FJMA 1NK5A 3CYMA 1SL2A 1BL3A 1J9AA 4AHRA 4B8CA 4I7FA 2I5JA 4DFKA 2HHUA 3KK1A 4CJVA 5EU7A 3E01A 1Q9YA 1B9FA 3ASMA 4DLGA 3QETA 1CXQA 1WN7A 3K2PA 3OYNA 4BE2A 4M45A 4CEQA 4CHPA 4CF2A 4HUEA 1JLEA 1NJWA 1BCOA 4CE9A 1D8YA 3NF8A 3IRXA 3HVRA 3SUOA 1RDDA 1RT2A 4OPKA 4MQ3A 5CZ2A 3RMBA 3AVLA 3ZSYA 4HCBA 3O3FA 3OJUA 3O4QA 4OJRA 3L2QA 4B9TA 1A5XA 4HUGA 2KW4A 5HRPA 3HPOA 3SPZA 2HHQA 2XY8A 4FLVA 4DQIA 1TKZA 2HNZA 1NK0A 3TAPA 1TAQA 2HNDA 1IH7A 4ELUA 1NOYA 2ZD1A 4H4MA 4E19A 4NYFA 3OJSA 1U04A 5C42A 2W42A 4JS4A 4CHOA 4FJ7A 4FLWA 4BE0A 4F3TA 3OYCA 3HL8A 2B6AA 4ID5A 3OYLA 2HHXA 2Y1IA 2P5GA 1KVCA 2EHGA 3AO2A 2G8KA 1G15A 3KTQA 1C1CA 3T19A 1RBVA 1SL1A 3AVHA 4LH4A 3V9SA 1HYVA 3NDKA 4CFAA 4CECA 1J5OA 4QOZB 3CFOA 3VQDA 4DU3A 2OA8A 2FBTA 4KHUA 4M3TA 1Y97A 2KFZA 1IKVA 2YNGA 3MEGA 3LANA 1DLOA 3SYZA 5K14A 4DFPA 4B9UA 3ULDA 2ITGA 3S3MA 4F2SA 3KD1E 1RBUA 2EX3A 4E7HA 3BGRA 1DTQA 3HYFA 3L3UA 3AVAA 4LY7A 4DQRA 4FK0A 3AO1A 1YTUA 1QTMA 4FVMA 3HPGA 1U49A 4J2BA 1RILA 2HMIA 5I42A 2BGGA 4CJQA 2D0AA 4FW1A 3TANA 4B3OA 2VG7A 3QERA 1N6QA 4BWMA 3MECA 3VA3A 2XY5A 3OYEA 2RKIA 4BDPA 2QK9A 3OYKA 4FYDA 3AVFA 1C0UA 1RBTA 4YFUA 1SL0A 2FBVA 2YHBA 4RW6A 3LZIA 2HVHA 4ELTA 4FJJA 1B9DA 1ITGA 3VQ6A 3AVKA 4B08A 1QE1A 2E4LA 3SUNA 4B9VA 1L3UA 1C0TA 1NOZA 5J2MA 1QSYA 1WLJA 1TV6A 3HPHA 3DLBA 4DU1A 4DFMA 2RPIA 3C6TA 1EP4A 4PWDA 1J54A 1JLGA 3MEEA
chains in the Genus database with same CATH superfamily
2FBHA 2W84A 3VSLA 2EJRA 2P5OA 4CO8A 2D0OA 4A0XA 3O4NA 2D2WA 3TKYA 4M6VA 1E4FT 4HRIA 1S8NA 1HC8A 2K9NA 2CV0A 2FF3B 5AFUA 4CCOA 3D1NI 3CQXA 3RKXA 1O7FA 4PJMA 2K9QA 4DV0K 3ID6A 1QZ5A 2WAEA 2R7XA 4CIGA 5EEAA 4MLHA 1Y39A 1NGEA 2BV6A 3RQIA 3T8RA 2P1JA 4DGWB 2MD0A 2EBIA 4UNOA 1UHSA 1HW5A 2OUMA 1KVAA 3QEWA 3FWEA 3FFIA 1EO1A 5C3EJ 4JHDB 4IJAA 4KAZA 1LWEA 3NGZA 4NCBA 1UOCA 1E17A 1M1KO 4ILHA 2UYTA 3TOBA 3AVBA 1VQ6I 3Q9VA 2OTLN 4EJUA 3ISPA 4CCMA 1RBRA 2QBYB 1QZEA 3OYBA 3BG6A 2LREA 3B6AA 2HNYA 2QUFA 3OBYA 2VPLA 5F1JA 1YIOA 2P7VB 4PJ0C 2STWA 1T6DA 3MN2A 1IV8A 4BR5A 1TL8A 1MMSA 4DTXA 3BG5A 1SKSA 4JS5A 3F8FA 3DP7A 1YITI 1FYMA 2WONA 4B3TK 2QKBA 1X9JA 2HBJA 3RPUA 4S05A 5HNFA 2DYSH 1TWGJ 4QIWN 2F5DA 4CERA 3WNHA 4RW4A 4IFVA 5GP9A 3WTSC 2CGKA 1N78A 4LIVA 1DTTA 4Y15A 4PZJA 3M8EA 4CHQA 1I50J 2C6YA 1T8IA 2EFOA 2GWJA 1DPRA 2BEOA 4JI7K 3M4OJ 2DOEA 2L9SA 3R0JA 2OC6A 2VQHA 1XS9A 2QWPA 4YEJA 4HSTA 3B8AX 2LKSA 2XKOA 2HQNA 4IDKA 1D0YA 4F7ZA 3W2AA 3FZFA 3K4CA 2QM3A 2G8FA 4KI6A 1G3YA 3GBGA 1XWLA 4MEXF 1JTXA 2IEKA 2H8RA 3O8HA 3FZKA 4FJ9A 3D2EB 1BISA 5DD4A 1F21A 4IPAA 4AU7A 2OQRA 1S6QA 2W4SA 3FXUA 4KN7X 1JLFA 1S1VA 2ZSIB 3F22A 1W4MA 3IUCA 4ISGA 2BY2A 1TC3C 3M3ZA 2M0CA 3CCMN 5AQUA 1ERDA 1SC7A 1FZPB 3MKYB 5E1XA 1U2VB 4FWKA 2BYVE 2ZB9A 3GYHX 2NS8A 1NNEA 2YJFA 1W0TA 3R60A 2CYYA 1RFQA 2XAHA 5D5VB 4F93B 1ETWA 3KYLA 1HJRA 4KIBA 3VEPA 4CA0A 5DEQA 2VBWA 1NGAA 1WSFA 2VQGA 1XGNA 2RNJA 2Y9YA 1CF7A 5HLIA 4FJMA 1BL3A 3ZETB 2KIQA 4JKDA 5M5WJ 3VODA 2NOGA 2QSFX 3QRFF 1OYIA 2JSCA 1BCOA 1D8YA 4GFBA 3OIQA 4MFDA 4OPHA 2HVSA 2V4JC 3ZSYA 2FUG2 1WBDA 4X0GA 2E2PA 4ENKA 4H4MA 4XLPF 2RKHA 1ZYRF 2EHGA 4IXCA 1ZGAA 3NDKA 3BG3A 2WC2A 3VQDA 1XNRK 3CC2N 4UVCA 4L9JA 5C4JJ 5AQZA 3BGRA 4J2BA 3CF5F 3QERA 1LFUP 3RDIA 2Y31A 2YHBA 3LZIA 2LRDA 2WY8Q 1Q81O 5FPMA 5TGTA 3MEEA 4BWJA 4BVOA 1IRXA 1RC9A 3AA3A 4FZXC 4F4KA 1XGSA 1ETOA 1FTTA 4P1WA 4E70A 1WJFA 1JLAA 3HK2A 1XQSC 3IV5A 3H92A 3G1OA 3H45C 3SV3A 3NAEA 4E89A 4BJ5C 2E19A 3DOKA 3SZPA 5J8CA 1K8KB 3THYA 3FXRA 3P38A 3NF6A 3QFUA 2YU3A 4B1YB 3REOA 1T38A 2ZE2A 5CQGA 3TI0A 4G7ZF 1KFDA 1ETYA 1ORKA 1MJBA 4UUVA 5FKNA 3JRGA 3KD5E 2LFBA 4H5VA 3CMYA 1FWZA 5DM6L 3M1EA 3IAYA 4UVBA 4CZHA 3PNVA 3IWFA 4MHGA 1V55H 2V1UA 3K2ZA 1E4GT 3ZMZA 1ODDA 1QBJA 4U7DA 3ZEUA 4AM6A 5K7ZA 2CRGA 4D0PA 2R7SA 2VLAA 2LC2A 4B3XA 2Z1JA 1KXPA 4LGWA 2E6LA 5J2NA 4DS5A 2V9PA 3ENBA 4H5NA 4MLOA 3QQAA 5AQIA 3VGKA 3CO6C 3CCUI 1UHMA 2IT0A 4YOXA 4P9FA 2TDXA 3P83D 3LDSA 3VTHA 4I2QA 3PX0A 3KLEA 2QXFA 2HQAA 3DPLC 4CEFA 2LMDA 3KYDB 2G8HA 2DA6A 4FWRA 1SD5A 2QQBA 2JA7J 3SLCA 4LLLA 1IO2A 2X74A 2ECBA 4YNQA 1XC5A 3S14J 2K9SA 4NLCA 1RDCA 5KRSA 2Y0SN 3QB0A 1Q9XA 3DWLA 3PX4A 2ADUA 2NOJB 4KITB 1KZHA 5ICEA 2LKPA 1ZR2A 4A62A 4PY5A 2Q97A 3THWB 5H6RA 4BRIA 1QZ6A 3CJ9A 2HQ5A 2XSDC 2Y9ZA 5J8FA 4Z6YA 3LP1A 2QWNA 4DOZA 4IBNA 3EUHC 2ZWHA 1HCRA 3QEPA 2F4OB 3SQ1A 2ZFWA 3JSOA 1KU7A 5A2QK 3OYIA 2XAJA 1CQTA 2L4AA 2Q3SA 2E2NA 1U5TC 3VENA 2QEXN 2JSPA 3H9JA 3OYHA 4HW0A 2G7UA 1F4KA 3OYFA 1YRNA 3LSGA 3R1XA 2G8WA 3D5SC 1OQYA 3PNYA 2X6XA 1R0AA 2LDUA 4MQ9F 1FX7A 1WJAA 3G10A 2DA1A 1Q8IA 1MMNA 3ZQGA 1Z3XA 5D6FA 1C0MA 1BW6A 4JRQA 3CCVN 3OYDA 3HBLA 3HTUA 3OL4A 1NG7A 1PUFA 4WE1A 3OYGA 2XPWA 1X58A 3NH0A 2KRFA 5D8KB 3ZGKA 2GV9A 3DBLB 5ED4A 3WTVC 4BQLA 3MKZA 4BH9A 1VQMI 2GQQA 2ISZA 1GT0C 5KCMA 4NC8A 1HYZA 4CJ5A 3V8LA 2H1KA 1W97L 5L3DA 2ZJRF 2LSNA 1T03A 4N0BA 5HDKA 4N4NB 3EN9A 3OMYA 3RMCA 1OCZH 3ZT2A 1O57A 1XB4A 1SD6A 4CJVA 4U87A 1Q9YA 4BE2A 2PJRB 1O13A 2LNBA 1FP1D 3VESA 2E2JJ 1ZHFA 3AVLA 3E1YA 2DI3A 3O4QA 2FJ1A 2HHQA 3C2GA 2AXTC 4ELUA 3MDQA 5D5WB 1J9IA 2HHXA 1DT9A 4JK8A 2G8KA 1E0EA 4PUSA 2OA8A 2KFZA 2CV2A 3MEGA 3OTOK 4C2MJ 2OA4A 1VQKI 1FPQA 3HTVA 1JKOC 3GEZA 4CJQA 1YF5L 2Z33A 2L7ZA 3HM5A 4D7MA 3S1RJ 5GINA 3R4KA 4DR5K 4R8HA 3J81O 2NS0A 3TO9A 2P9KB 3SUNA 5K7FA 4YOVA 1J54A 1OCPA 4C8MA 2LY9A 4ZTJA 2QSHX 4M74A 1A04A 3EUAA 5CVJA 5L3GA 4ZTFA 3QPHA 3K4KA 2BXYA 1BI4A 4N47A 1NGGA 4P55A 5TKYA 4DR2K 4DSEA 1MDMA 2LF7A 3G4SN 1BQNA 4I6MB 4NB4A 2GXGA 2PMZN 3J7AP 1LE8B 2NUBA 2Z5UA 2JT1A 4HX7A 3TW7A 4NUBA 1IGNA 3L7WA 4CJKA 4NCGA 4HF0A 5FLMJ 5JLFA 2Z1HA 3F5TA 1K83J 4HX4A 5AQRA 2DAOA 4CGIA 4IQJA 4KHYA 1TT0A 1K78A 4JK9A 2O8EA 1A6IA 3MN5A 2P9UA 2E34A 1RUOA 4HA8A 3I53A 3PJRA 2OPSA 2XKPA 3FZLA 4XL9A 3I0SA 2ETJA 2F48A 5GADP 1GVJA 1YG2A 4N5SA 3H36A 2DJNA 2DJIA 3O2PE 3H3OB 3HOXJ 4U67L 2VI6A 1CLQA 1YTAA 3PQJA 1MBKA 2JMWA 2D4WA 2Q2EA 3U1KA 2HF3A 2KDOA 3C18A 3DXKB 5C12A 3MWMA 3VQ8A 2GWKA 4IKFA 5CQEA 3LP2A 4W5RA 2VODA 2FD5A 4XRFA 1B92A 4IHTA 3WEEB 4MFBA 1VTNC 4BQAA 2ATQA 3LSPA 3PL8A 1K4TA 1RT6A 3HP9A 3VN5A 2E20A 4BNCA 1VQ7I 3R61A 5DYMA 3HEFA 3OY9A 3RRHA 1G99A 2CQXA 4Q0BA 3NH1A 4OVLA 4Z0UA 1WJCA 2CH6A 1FOXA 2E1ZA 3I55N 4RLQA 1YJNN 2EZHA 1A5WA 4DKWA 2OPPA 4J00A 1T7PA 1EH8A 5DDGA 4E6KG 1OCCH 5D5XB 1DKGD 5K1YA 3IKTA 4UY8I 1OISA 5AIQA 1WAJA 4CZIA 2ZJ2A 4BQZA 2ID3A 1RGIA 1JTYA 2GTDA 3ZX0A 4M72A 1U45A 4WK8F 4WX9A 2XRLA 3CF2A 3CLQA 1FBSA 5KPZA 2L02A 1X1AA 1ZYQA 3HG9A 3AV9A 3BEXA 3CO7C 3E97A 4H03B 4W5NA 3K5MA 3LFUA 1UG0A 3WHCA 4Y1DA 1U6ZA 1Z91A 3HSEA 4XRSA 2WBNA 2OD5A 3MVPA 3FZVA 2PYLA 4DQ8A 1RT1A 2FOKA 3G71I 3D6RA 3TAEA 2A5XA 1OCOH 3HGYA 4HQMA 3DPUA 2IVPA 1VHXA 1MH3A 2D1VA 1UFMA 2HR3A 3VB2A 4AIKA 4E7SA 1LDJA 1VQOI 4EJVA 5I3UA 2KLAA 4CYCA 1LVKA 1VK0A 3SHFA 5GAGP 3TWHA 4KO0A 3AY9A 1OKJA 1V3FA 4Y17A 5EEGA 4H4KC 4RW8A 3CJCA 4OOIA 1HLUA 1OCTC 4CCLA 1LW2A 4GYGA 4HF1A 2R93J 4DFKA 4H5WA 4PFOA 3KWIA 1BC7C 2QWRA 3K9KA 2NRVA 4U0VA 1XUPO 2FE3A 4KMFA 3HVRA 1U5TB 4MQ3A 3IDHA 4HCBA 5HRPA 1H8AC 1IN6A 4E1JA 1BR4A 1DUXC 4F3TA 2H8WA 4XH5A 3HL8A 4Y4RA 4GRIA 2DA4A 2KKZA 1R9TJ 3S16J 2DQRA 2ITGA 1R49A 1LNWA 2I7PA 2F7TA 2HDDA 2LOOA 3HJEA 3DBRB 1GLFO 3LDNA 4FPAA 3ZQCA 1MSFC 1TQIA 4B08A 1SVLA 2EH3A 5GAEJ 3M8FA 1KQSM 4B9VA 2W85A 1EP4A 1JLGA 4CGFA 5C44J 4BRQA 3VOVA 3H3ZA 1QHGA 1C1BA 5BR8K 1X1PA 1C0WA 4J8FA 2RHKA 1L3TA 4NXMK 1BW5A 2M30A 2N8GA 5LLQA 1GXPA 2LD5A 1L5UA 1Y1WJ 3KP2A 3HSRA 3NRVA 1UELB 2K27A 2O5RA 3IRQA 5IT9O 4JYAK 4FW2A 1BO5O 1L3SA 2QENA 2EPFA 4KHQA 4KIFA 4BGDA 4QSHA 3TDUC 2OTLI 3HT3A 4DSLA 4R5PA 1JUSA 3BG7A 1R5HA 4HYEA 4BXFA 4A6DA 4OMYA 3A5OC 5DV5A 2X6WA 4CFBA 5DM7L 2K40A 1RRJA 4CF0A 5AQOA 1GXQA 2QWMA 1TYQA 3ZSQA 2XHBA 2DDBA 4CHYA 5E1WA 4DZPA 3AVIA 5ERIA 2FNAA 4FASD 3GDQA 5E3MA 2A5YB 2V9VA 5JMVA 2Q1NA 4MLEA 3VQCA 3CC7N 2O4IA 3M6GA 2YPRA 1SUQA 3WXJA 1HX1A 4BEHA 2B9SA 2HTJA 3SPYA 2MW8A 4O0JA 4K8XA 2IA0A 3W2WA 3MXJA 1IUFA 2DCEA 3HM9A 4CI6A 2IVOA 5BOXA 4JD2B 3KJVA 2E5NA 5EDNA 4I6ZA 2XUBA 2VUMJ 4CZFA 4E1NA 4L5JA 2O6GE 2E88A 4LD0A 4AYBA 3C2HA 2M3AA 1GVDA 2CS3A 1QHHD 2PG4A 2CGJA 3AAQA 1NK7A 3E6DA 3PFYA 4MDBA 2DMTA 2G9WA 4JYKA 4XLFA 2V52B 1WBBA 4CIFA 2X6OA 4IHVA 2P6SA 4I9QA 1ZH5A 2V51B 4UXNA 2A5WA 1B72A 1S22A 3K5OA 4ABZA 3HHHA 1YIJI 3L0QA 4HF2A 2D0PA 4XORA 5D3GA 2CSOA 5F2RA 2LG4A 4LMYA 4BGBA 2EILH 2WTEA 4ZYAA 1ZG1A 3U2RA 1K6YA 2VGMA 3FGUA 3EYIA 1MWMA 3N4PA 4II3A 1IF1A 2R0QC 3BG9A 4KICA 3F9KA 2R3SA 4JKHA 2FEZA 4CYDA 1YXQA 2IBDA 4PFPA 5DUKA 1ON2A 3C95A 3ZT4A 3F8CA 2ZCWA 3HRUA 5J40A 1SFEA 2VYPA 4W5TA 2UUZA 1BHLA 3LWFA 3GCMA 3NH2A 4PKGA 4RTFD 2QKKA 2KISA 1EWQA 1HYSA 3LP0A 3P9IA 2UU9K 1W36C 4A0ZA 3SZ2A 1KLNA 3KPHA 3QDKA 2Q8KA 2WOMA 1A35A 5KRTA 1H9TA 1EF4A 1YUWA 5LL6Z 1D5VA 4C8KA 3PIOL 4A5NA 3IP4B 4K43A 2W82A 1ZBHA 3I64A 4FWSA 3SBTA 4A3FJ 5CKTA 2ZNZA 1NGJA 1IN4A 3ZMVA 4CFDA 5J1YA 3EYZA 2BHYA 4JEPA 4IL6C 3CMAN 3KP6A 1T8EA 1MBJA 1HUXA 4S04A 4OPJA 1Q7YO 4JKEA 3ZMUA 3CC2I 1YVUA 2ZQBA 3BR1A 4O5FA 3WXLA 2HBMA 2EK5A 2HGCA 3V1RA 4CCNA 5EU7A 3FXOA 3K2PA 3THXB 4XKWA 3I58A 5K5QA 2E1CA 4DQIA 2D5VA 3Q7CA 2J5PA 1GUUA 4UY8O 2GA2A 3QYEA 3UE5A 3L00A 3T19A 3RZOJ 3G6EI 1X1BA 5IWAK 1DLOA 2MLKA 3V8JA 3GL1A 4F2SA 4U0YA 4HDVA 3UR3C 1EA3A 3V7CA 5AQYA 5JICA 4B3OA 3GFMA 3K4BA 1I3QJ 3RVCA 1O3TA 3OIPA 3OYKA 3DU6A 4BGAA 1IXCA 1C0TA 4BHCA 3EDPA 3L1PA 3H5AA 4B1WB 1Y8QB 5L3BA 1N33K 1FEXA 3H0DA 1QZYA 5FD6A 2RF2A 2EB7A 3AAPA 4D5FA 3VYUB 1SD4A 2PY5A 1H89C 4O5VA 1VQ6N 2LH9A 2I8DA 4BY9C 3K7AJ 4K8ZA 3HVTA 2KZGA 2D5RA 3BT9A 3LAJA 3HOUJ 1FXXA 1UHWA 4D1QA 4YORA 3CIPA 4DZJA 5M1FA 3WE3A 2R5YB 1HQUA 1P2FA 1RESA 3VGLA 3GWZA 4ISEA 4Y33A 2NVUB 3SMSA 4AHCA 1Z7UA 1M90O 3HJFA 4E7JA 4A2UA 3U3YA 2V6EA 4CJ4A 2ELJA 1IKYA 3KP3A 3QOPA 4M3UA 3GMEA 2HBKA 3ELKA 1W36D 4DB3A 2E6MA 5B3SH 2W40A 3K59A 4CDGA 2VQCA 5J1EA 2R7UA 1W5CC 3W2VA 2EFQA 2P9IA 4CEAA 2ITMA 1R00A 1OMIA 3BQYA 4HG2A 1RUNA 4BR0A 2P4WA 3QOEA 2QF7A 2YUSA 3TQNA 1NMDA 4CBWA 3TTDA 1NJZA 1YX3A 3JAMK 1PYVA 2A05A 2UXXA 3CF5L 4IG3A 2Z1DA 4ESFA 2IAJA 5GPCA 2CUEA 3BTLA 3F72A 1I39A 3BJAA 2DTZA 1LWFA 1RDAA 2R5ZA 2A1RA 1OJLA 1D8JA 1R4MB 3HYIA 3O8MA 2L9RA 4TV7A 2RGVA 3LSIA 3ZMSA 2DPUA 1OFCX 2WTUA 5JVHL 4CH7A 3U8XA 4F52A 4N41A 4CHZA 1H9GA 1ZLKA 1IV0A 5TJJA 3L4QA 5E18F 1QVGM 1J75A 3DTIA 4GGGA 3WTWC 3GFJA 5GAGJ 5BR9A 1YW7A 3M1CA 2LVSA 2KTQA 3K69A 1UMQA 2Y2ZA 2G0EA 1OVQA 4B09A 4K25A 3F21A 3K9TA 3PUFA 4YIRX 5F1XA 1NG6A 1XD7A 1DP7P 1JLCA 4LK0F 4CK2A 1A5VA 3CCVI 1Y64A 2COBA 4CJWA 1CZAN 1S7AA 5F04A 4BJ6C 3I8DA 2E60A 1REVA 2IOCA 5DK5A 2BH1A 4A61A 3HDDA 2QQ9A 3DJCA 1BC8C 3FE1A 2F8SA 3GZNB 5J6XA 1VQNN 4JNEA 5HROA 4DR4K 1ZK8A 3U1DA 1TKXA 2VWJA 1TBXA 2P0WA 4JKFA 1FKOA 1RT4A 3QBWA 2PMHA 5J3LA 3F6VA 4IFYA 3L9FA 5FD5A 1F5TA 4DTNA 1GOBA 3GW2A 5BPMA 3CC4N 2FSNA 4EAHD 2Q0RA 1SAUA 2ASMA 3QEIA 2UXDK 2XY6A 5DD8A 4H8KA 3UIQA 5KK1A 3ENOA 4CJ7A 4KI4A 1D1BA 4FJ5A 3IH3A 3LA3A 2KRCA 2VG5A 2F4MB 2UXBK 4B9LA 5IOYA 4A0YA 4I09A 4FLZA 1U8RA 3LWMA 1BGXT 4E7IA 2MA3A 2Q1ZB 4WQ5C 4BDYA 2IS6A 4LSLA 5AIPA 1ON1A 2GAUA 2IA1A 3K4NA 4H0OA 2DK5A 3LQQA 3DTEA 2W25A 2ETHA 3U21A 2AXLA 4DLGA 5JHFA 4LITA 4CHPA 2Q31A 4A5MA 3H3VK 2GZWA 1NGBA 3U9ZA 3GE1A 1KA8A 3UKRB 1ETXA 5CJ9A 5F6FA 2KW4A 2XHKA 1XMQK 2QWLA 2UZKA 3I54A 1NOYA 4NYFA 3GTGJ 4DCHA 1NGDA 2YX7A 4LH4A 1NWKA 2IXSA 3J7ZI 2E8AA 5K14A 3I9V2 3FR0A 3AVAA 3G4SI 2P9LA 2CFXA 1YTYA 3MECA 1ZRFA 1RBTA 3FBNB 3IUOA 1X3NA 3MX5A 2PI0A 3OA9A 1WPKA 2BBYA 3R3LA 5AQJA 3C6TA 1SFUA 4YOUA 3QFPA 3ZCMA 2XV4S 3V9ZA 1S7OA 2V7FA 3VQ7A 1TZLA 3U6FA 4JX5A 4XOPA 1JCGA 5A2QZ 1E3PA 4BRAA 3QBXA 4KV8A 3AFHA 1I1SA 2E2QA 3SXYA 1TP4A 3SEZA 3QIOA 2VKEA 5EJCA 4CZEA 1WH7A 4FM1A 2LSOA 4EMSA 5M1OA 3PM1A 3H5NA 3O9UA 2GM4A 1GLAG 4C30A 2NRXA 3WXMB 3ULEA 2R7WA 3W3CA 3IWZA 4ZH4F 1R4NB 2PBIA 4MEYF 4WXCA 3SK3A 1O3QA 1V5EA 3C3WA 4B9SA 4FWMA 3HL2A 1W0HA 1EKEA 2V9KA 2VJIA 3LPUA 1FOYA 1IJWC 3ERED 2M0MA 1YW9A 4KTQA 4EM1A 1GV2A 4XR6A 4DUYK 4ASNA 1RKWA 2RQPA 3FHNA 1WHUA 3AL0C 2DT7B 3P5JA 2OQGA 4C9YA 1NGIA 3LOCA 2A07F 1RT3A 3CCQN 3AVCA 3H9GA 5FKMA 5L3CA 4M3WA 2W6LA 3PO2J 2HHHK 4EJTA 3QO9A 1WJDA 3GLXA 2DY4A 2L9VA 1X4PA 3TSQA 4Y52J 5TKWA 2JUCA 2ZF5O 3BZ6A 4UB8C 4JKGA 4WXDA 1SKWA 1V54H 2L3DA 4OIPF 1VNDA 1YJNI 4PDKA 1LEAA 3CM5A 4DW6A 4BR7A 4O0IA 5BPDA 3A4CA 4IO8A 2V79A 1CZBA 4DSIA 1TQPA 1HKCA 3OVNA 4WQ4A 2OJED 3T69A 5AQQA 2IS2A 1XG1A 5CVRA 1YRNB 1JCEA 3C7NB 4A3IJ 1KSPA 1STZA 1ZRCA 4BRDA 4C1NK 4LF4K 2BHZA 3M8QA 3JSMA 5FLXK 4OO1J 3DCFA 4L5IA 2YNIA 2NVYJ 1Q18A 2DLLA 1MBGA 5EF6A 2R4GA 2DT6A 3HOVJ 3VTIA 4GKJK 3NF7A 2HHSA 1NK8A 4CCJA 5E3OA 4IOAF 2BY1A 3MEDA 2ZSHB 4C3JJ 1LVAA 4JLHA 4DYRA 5DUIA 4L18B 2HW3A 1Z05A 3I3LA 4KISA 3HHGA 2OBPA 1KAXA 5CYMA 4JKBA 2HEOA 1R1VA 3WU2C 2LY1A 4KRFA 2Y75A 1EWRA 3VEYA 4BY7J 2PMZA 1HMVA 2EA4A 5H2FC 1N25A 1TUYA 4FOEA 2QQAA 4MNUA 4BRNA 4EZ6A 3I33A 3U4LA 3PO4A 1K61A 2O8FB 1HKBA 2OPRA 4JHDA 2WAFA 3BTIA 3UB5A 4RAYA 3EE8A 2JGUA 2CUFA 1QNTA 1TKDA 1FNNA 2IGKA 3BY6A 3J7YP 4IHSA 5E26A 4J19A 5E79C 4LB5A 4MTEA 4HCCA 3QEXA 3AA2A 3VQ4A 2CH0A 4BHBA 5AQTA 4HNTA 1X4OA 3GLLA 2IIRA 5J4VA 3SV4A 2AP1A 4BDZA 3WHBA 1OR7C 4HAMA 1BIUA 3L8BA 2X1CA 1VSFA 5E1ZB 4AD9A 3EPZA 2IS3A 4B3MK 2DYRH 3HOTA 3MN7A 2HHUA 1G3TA 3QICA 1ZKGA 1NGFA 4CEQA 3NF8A 2JA2A 1BDGA 3SPZA 2K4JA 4O6JA 5EG0B 6PAXA 2FMLA 1EH7A 2CH5A 2XRNA 3ZPLA 1JKPC 3SDBA 2P9NB 3AO2A 4UVAA 5LEKA 1KYWA 1FOWA 2ME0A 2YNGA 1BI0A 3ERMA 2H6CA 4NQWB 1YTUA 4HTLA 1QRYA 2HMIA 4EV0A 3GUDA 3IFRA 4RS8A 4BWMA 3BLYA 3H1CA 4XSXF 3UNGC 4I0BA 2M2EA 1B9DA 1W7PA 2BE5F 5AQGA 4XLNF 1QSYA 1WLJA 4DV5K 4K0KK 5B1BH 3LM2A 1B9NA 1GLDG 3RPQA 2VE9A 1TL3A 1VSMA 1N34K 1T39A 4BXXJ 4FJLA 2UXCK 3TABA 1I94K 2WB1A 1J53A 2R7ZJ 2CW8A 1TGOA 3K57A 1MMDA 4FM2A 2KP6A 3SQ0A 3BR0A 2YHYA 1C0GA 3D2EA 5J2PA 2KPMA 1GDTA 2XPVA 4Q5VA 2HDCA 3CC7I 4PL8A 3FMRA 4IXAA 2ZXHA 3HRSA 4FJIA 4G8XA 4ICLA 2NRWA 1YJ9I 3GOIA 3KX2A 2JPBA 4BRCA 1PP7U 3DLLL 3O9SA 2XB0X 1I6XA 2JRMA 2NYXA 3A2KA 1G59A 3A8YA 1KONA 1K73O 2PZSA 4CF8A 3C6UA 3O6BB 4CJRA 1HSJA 1S9GA 4BC4A 2HI3A 4DLEA 3X2QH 3WNGA 3A2FA 3F6OA 3OR2C 4G6TB 3GVAA 1U2VA 4CGGA 4KREA 2WADA 2FNPA 1FIAA 3V9WA 5TISC 1EJ9A 1LJ9A 1TQMA 3NBPA 5LGTA 3SAGA 1KAYA 1ZC6A 4L8RB 2MG4A 5BMZA 2XAFA 3L2VA 4LFCK 4JI4K 4FZYA 3E5XA 2F5FA 5DTDA 4Z4FA 3Q3SA 4E7LA 1OVYA 3HP6A 1J5EK 1TK5A 1XPXA 5D5UB 4OKKA 4RW9A 4TSXA 2X9DA 3R8EA 5KGWA 3I59B 1O3SA 3ZETA 4V19K 2O8CB 3WE2A 2UUAK 1ASUA 3TARA 1OYYA 3LDPA 4C3IJ 2J5OA 1IRGA 3AA5X 3MFKA 4CF9A 1T2KA 4D9JA 3P39A 3CJNA 3MZYA 2E5ZA 3V42A 4YDUA 3GZ6A 2EZLA 1WSJA 2PN6A 2QM1A 1ONVA 3AG4H 3KZZA 4XRSG 4QPOA 2M45A 2DQLA 1AKHB 5HLFA 3DXMB 4P9UA 4H5TA 2JQ7A 4B1VA 5CE3A 3NAUA 3QP5A 4PL7A 3SQNA 5DM7F 3CUQC 1SD7A 2QW9A 3ZT0A 2JA6J 2QWWA 4DMNA 3B6PA 2ESHA 4A93J 1FYKA 3AL0B 1HOMA 5EX5A 1HW2A 5H6QA 2E71A 2PX9A 3FF5A 5KAFC 3LAKA 4F8RA 5B5EC 4DSFA 5EYRA 4W5QA 4FLUA 4UQGA 4XLHA 2WFBA 5AQKA 3CUOA 5JI6A 3KYCB 3OBWA 1HF0A 5BNGA 5E41A 4CSWA 3OIOA 1MJ9A 2FF4A 4XH1A 3CLOA 1WZ2A 1J0RA 5ILUA 3C6HA 2COMA 3M1FA 4KKOA 2IVMA 4M3RA 4EATA 1NKBA 3E9LA 3KFWX 3OSFA 4E7ZA 4B9MA 2PYJA 2UV1A 3A01A 3AG3H 2VXZA 3ZQLA 3RQ4A 3TAMA 3ABLH 4AQYK 1X3MA 3ABTA 2K3PA 4BQQA 2A61A 3V81A 4K2EA 3JR9A 4LK1F 3L4IA 3OS0A 5IYBJ 1ZBUA 3IH2A 3O4WA 3T1YK 2VPRA 3I4PA 3TAGA 4M6YA 1I3AA 1IN5A 3T3FA 3ZQFA 3WTTC 4B3SK 4FWQA 2Z9OA 1PDNC 3O80A 3F8NA 4G7OF 3VEZA 4DBRA 1M1EB 5CR4A 1RDDA 1D3YA 5ILSA 4F3QA 4FLVA 2NVQJ 4LG3A 3WODF 1U04A 4WFNL 4ID5A 2Y1IA 2P5GA 1REPC 1WVRA 2O61A 3C1DA 2A40A 4M3TA 3SYZA 3DAWA 3AARA 1POGA 5HLGA 2F9TA 3HRTA 3EO3A 4M63C 3THWA 5CVUA 5KAIC 2XY5A 1C0UA 4ZYDA 4BR9A 1XMAA 2BVMA 3FZMA 3HPHA 2VONA 2HSTA 3ZN0A 4B1ZA 4BYYA 1F1ZA 4B43A 4DTUA 1QSSA 1BOBA 2PFUA 5FKLA 3WU1B 3PIOF 4OGEA 3LA2A 1YJWN 3GTOJ 2WY7Q 1NH3A 3H6EA 4OLBA 1V5FA 4M71A 3SCXA 4DV6K 1HQEA 4EJWA 5C2DA 2BUPA 2P7CB 4V2GA 2K5CA 4M9XA 2JA8J 2GA1A 3CFPA 4CGJA 1WB9A 2ZJPL 2KQ2A 4ETSA 4AHUA 4DTPA 5AQSA 3HOZJ 4E4HA 1ITYA 3FMQA 1TL1A 4IEIA 3JRBA 3HIFA 2F6CA 3CJ7A 3E6BA 3RMAA 3PQKA 4ZDOA 2LLKA 2E1MC 1NK4A 3VWBA 4XH4A 2FU4A 4FJNA 3FX3A 1VQLN 1LPQA 2XY7A 1K6OA 3HKZA 2VKDA 1KD1O 1USSA 1BA1A 3L2RA 5FJ8J 2BGCA 3MAJA 5F0HA 1APLC 3VQQA 1YI2N 1ATSA 1VQ5I 1R1UA 4JKCA 3WUHA 4HHTA 3WXKA 3KEOA 4J01A 1WWXA 1RIOH 2JWKA 1YIJN 3JTHA 2W00A 2YI1A 1YLFA 3CJBA 1S9HA 2IA2A 5DCMB 2FC0A 2AQFA 2KL4A 5FKOA 3PNTA 3RCOA 4FL9A 3NGIA 1RTHA 3GFIA 1QPIA 4NLBA 3DM2A 5FLVA 1U9NA 2PJRA 5AQHA 1C0FA 1Z9CA 4OIQF 3G2BA 5GIOA 4FWLA 4CEEA 4H0TB 4ID1A 4B8XA 3VF4A 3DU5A 4FETA 1EX4A 4ELVA 4M3XA 3CCJN 3UKUB 3MD2A 1LFBA 2GOXB 2RN7A 1DGRM 1S29A 1SEUA 3SJHA 3GTJJ 4A59A 4CJFA 3CXCM 3PSFA 4JRPA 2PAVA 4C23A 3QP6A 3FM5A 1VQNI 2BDPA 3CCSI 1L0OC 3SUQA 4RB0A 1TK0A 3KK2A 2MD5A 1JGSA 2P9KA 4OGCA 2X6SA 2P9SB 2ESNA 3A0HC 4FZZA 3DQVC 5LHIA 2QKMB 3FKJA 4AIHA 3CDHA 2M87A 3CC4I 4A6EA 1E3MA 5DS9A 5AQMA 2R7VA 2H94A 5KGXA 4HV5A 4G9YA 2JPCA 1ATNA 1FKPA 4CD3A 4ENJA 1IBMK 4Z4IA 4PSXA 3MN9A 4KN4X 1N8RO 4RB2C 2UUBK 4IWVA 3O3HA 2XIGA 2KHMA 1XDSA 1FW6A 3PV8A 3CCLN 4F55A 2R7RA 2V1NA 3HM8A 3H08A 1LE8A 1XDUA 4OLAA 4D5CA 3LFKA 3E0JB 3HOSA 2F5VA 4QS8A 3MZHA 4FK2A 5JVGF 5E20A 5CYVA 2KLOA 5F08A 3GO5A 4L0YB 1ZAOA 3RKQA 1BOTO 4CZKA 4DYCA 1BI2A 1WOQA 5GIPA 4FO0A 5FDLA 4CJLA 2R92J 3NFAA 2R7TA 3KP5A 5EGOB 4LF9K 3ML6A 2R7YA 3G6EN 2X1DA 1AA7A 2GBZA 1N36K 4YELA 1TUUA 3QYBA 1T0FC 4BRLA 2XASA 4LF7K 3EY1A 4BXUA 3DLGA 3KLNA 2DO7A 1WSEA 4R79A 1JLQA 4H0VB 3BROA 1W0UA 4JP0A 5AQFA 3IAM2 3IMXA 3CUQB 1FBUA 4QWQA 4RW7A 5M5XJ 5AQPA 2HFHA 3MAQA 3JAMZ 4FOIA 4A3EJ 3DXKA 2OTJN 5D4RA 5F1RA 1VQPN 3SJMA 5E17F 2E36A 5KPRA 3L2QA 4B9TA 1A5XA 5CHIA 5D4SA 3WEEA 1NTCA 1TKZA 3HUGB 2YX4A 4XOTA 4M3DA 4U0WA 1IH7A 1MD0A 4E19A 3OJSA 2W42A 4BE0A 3P9KA 1KVCA 3TSPA 5BRFA 1T44A 3V9SA 2VJJA 4KHUA 2MC4A 5K5RA 3LAPA 2O9LA 2HWVA 2XF6A 3KD1E 2DU9A 4HPQA 2EV0A 2XGEA 1GLJO 4FW1A 4I76A 2M9HA 3WTZA 4UB6C 4FHTA 4G7HF 2KQRA 4M7YA 1BUPA 4ELTA 4FISA 4Q48A 4GDFA 1BA0A 3RWUA 3VSKA 4PQUA 3K5NA 2R7QA 2KT0A 1MA9B 4DUZK 1SVOA 1RKTA 2XAQA 2AS5F 2NNYA 2BY3A 3L6QA 4KJZA 3RIRA 3CHWA 1NJXA 3L2CA 4KB1A 3Q0UA 4KFCA 2DPDA 2YHAA 4AM3A 5FPDA 3QMLA 2EZIA 1SFKA 4WF9L 4HLXA 1ETVA 5GTHC 1RBSA 3DLHA 2F4VK 5AZIB 5FGMA 5BN8A 4B4CA 1R71A 3CCQI 2DTRA 2ZXJA 1OH7A 2E1OA 3MCPA 2EFPA 1XGOA 3CQ8A 4UV8A 1IDYA 3H5RA 3F23A 1RR7A 3HGGA 2AJQA 3T1BA 3O9RA 5HRSA 2OZ6A 1XMOK 3KK7A 2K3FA 1R36A 5CZ1A 1ETKA 5ADXH 3RTRA 4BC3A 3J7AO 1NGHA 3GTMJ 4IHXA 1Q1HA 4ZYEA 1HR0K 3ULQB 4AILC 5BREA 4M42A 2ZJQF 3MN6A 4IO9F 3V9XA 2YX6A 1IW7F 2JUGA 2WV0A 3O08A 3S3NA 1S1UA 4FM0A 4WFAL 2O8BA 3BCAA 1SMYF 3K5LA 1ZN2A 4UV9A 3ZQ7A 3J80K 2E5LK 3EUHA 2A68F 3TR8A 1JL1A 4IOCF 4EHTA 1KU2A 5F0XA 1WKMA 3ABUA 1RTDA 4JK7A 2UWMA 4Z94A 1LDKB 2NRZA 2ZGZA 1D1CA 3RSEB 1MNDA 2P8TA 3DKXA 1U5TA 1HKSA 4A2AA 5HLHA 4J2AA 2HHTA 2OZSA 2HKOA 1A31A 3BPVA 5CLSA 4WYBA 4KMUX 1ZLJA 4PHTX 3RTVA 2XAUA 1NKCA 5HL7L 3TOAA 2DN0A 1BG3A 2VQLA 4ANJA 5AQWA 2PFBA 4HNVA 3I71A 5A2QO 1R59O 3Q5FA 2LK2A 3SZGA 3L3VA 2VOPA 3BR3A 2KIMA 2M5WA 3BR5A 3ZSRA 2E1MB 4CZZA 2YNFA 3EKUA 1NM1A 1WCMJ 2OPQA 5JS1A 3U9DA 4RDUA 1KRPA 3MKLA 3DRRA 1VQ8N 4O44A 2VN2A 3D0PA 3LQRA 1NJYA 4WF2A 4C8LA 3CMMA 4QLCU 3TAFA 2DPNA 1Q82O 3DF8A 1ZELA 1A6QA 3SEQA 2GBYA 1PUEE 1NKEA 1HLVA 2HVIA 2XVCA 5ICGA 4WWCA 4XMYA 3K9JA 3LSKA 4O4GA 4PGGA 4IEJA 2X78A 1F43A 3ATVA 1T08B 1IG7A 1JUPA 2HS5A 3R9PA 5HLTA 3I56N 4XICA 2NAZA 3BJ6A 1P7JA 5BPIA 3ZSZA 1HKQA 4KH6A 4XK4A 2O3FA 1D0ZA 2ASOA 2ZMEC 4DTMA 1Z3YA 5C0YA 4BS9A 1BOAA 4J2DA 3D45A 4GYIA 3TDZC 3FXMA 3CTAA 5K7HA 2EFWA 2ELKA 3E9PA 4H0PA 3IC7A 4BG8A 3R6SA 4IZZA 2K85A 4YFNF 4YIIA 2QWQA 3AVMA 3E5UA 1WI3A 4JI5K 2ZM6K 2F9WA 3VQEA 2P9PB 4HWIA 2QQ8A 1MBEA 4LLNA 2MH9A 1D9DA 4DTRA 4JD2A 4GV9A 1J9AA 1ENHA 4RAFA 4IF4A 5AQVA 4HUEA 4CE9A 1HKGA 1RT2A 4OPKA 1XSXA 5CZ2A 1QU3A 3OJUA 2F5CA 4HUGA 2XY8A 4IOAL 3BJOA 5E84A 2HNZA 3KZYA 5L3FA 4JI1K 1GLEG 2OCCH 3MX2A 2JVHA 4EIAA 3HOWJ 3SZTA 4ON0A 1O4XA 4DU3A 2FBTA 4B9UA 2VBXA 3MWPA 4OU0A 1P92A 4OIRF 3GBTA 3HPGA 4FVMA 2Y69H 1YVNA 1U49A 2NRTA 4CHUA 4JI0K 4NXNK 4KH4A 1QVTA 3AVFA 2V6CA 5FLXZ 1NOZA 5J2MA 3HRGA 2HZDA 2W24A 4HBLA 5BN9A 2KIFA 4HDUA 4C8NA 5JLWA 3K1MA 3AO3A 4DNCA 3O3GA 2A41A 1N5YA 1U9OA 2IDOA 1W7PD 4AH9A 4RLFA 3QAHA 3MQ0A 4RGSA 3HXMA 3VEWA 3KP7A 2V26A 4DV7K 3KETA 2AA4A 3KZBA 1TLHB 5LJVA 5J1UA 5FRMA 4DV2K 2BOLA 4DHYA 2L9NA 4BHPA 1VI0A 3A5LC 3SQ4A 3JRCA 3KHYA 4IDHA 4M3BA 2IP2A 1P8ZA 2O4GA 5LMUK 4HTUA 4F2RA 1FOKA 4Z4EA 3EZWA 1MU2A 4KFBA 3NVKA 3B6CA 2A3ZA 4JI2K 4FJHA 1V5GA 4XEIA 1JT6A 3TPQA 2A69F 2DA3A 4EGYA 4LF5K 3S93A 3CP2A 2A1SA 2IGIA 4GCVA 4N9HA 4X66K 4KT6A 3O9TA 1KAZA 2D0CA 1U0JA 1IBLK 2L7KA 2OCEA 2IRFG 2VT2A 1WNSA 1Z21A 3O1BA 3RR7A 5SWMA 4YRVA 5EZHA 4I2PA 4DV1K 3N97A 5IYCJ 3THXA 1SS6A 4RGXA 1S5JA 2VXDA 3DLEA 4DQ2A 1OLTA 2GXBA 1WI9A 2FXUA 1Z26A 5BS6A 3DFGA 3DRPA 2VC0A 3Q0VA 2YHWA 1TNSA 5L3EA 1IRZA 5FO5A 2L5QA 1JXBA 1FK9A 2JA5J 5EXWA 4GNIA 1IXSB 4O5BA 4JBAA 1G3WA 2Z1IA 4FVUA 1XX5A 4U88A 3DLLF 3MZ8A 5GAHP 5AZJB 4P96A 2HB5A 4CZCA 4CK1A 4BJTA 1UG2A 1VSLA 9ANTA 1IDZA 3K6GA 2HOAA 4FLTA 4G6QA 1Z0XA 3PY8A 2E2OA 4DR7K 3W6KB 3ASNH 4HZFA 2A42A 3FIWA 2F96A 4FX4A 1MSEC 4ZZDA 3FFKB 4HX8A 3ZN1A 1S72N 2DFIA 4JKAA 1MBHA 1U78A 2FOWA 4I9LA 2I7NA 3GG4A 5LFAA 2KRHA 2RE2A 4CW7B 4J2EA 2R5YA 2CG4A 1VFCA 1VRUA 2FSKA 4XSZF 2YCHA 4NYNA 2ZBKA 1IKWA 3ZQQA 1F36A 3TP0A 3NWSA 1XHZA 1T98A 3BF3A 3IKMA 3VDXA 3UKGA 5LRRA 3CJQB 1Z7LA 1BWFO 1HW1A 3RJPA 1W9HA 3IRRA 1IJJA 3CDLA 3NCIA 4UUSB 1YHQN 4A3BJ 4RAGA 3M5RA 4Y3OA 4A3KJ 1E3HA 4A12A 3FBIB 4LF6K 3D2FB 3H9QA 3KKSA 4CHNA 3NMUA 3ISNC 1YS6A 2F5EA 4M9SA 1W7PB 2HBLA 2NRAC 2QVOA 1UAXA 3KZIC 2YNHA 4XRMA 1NHAA 2M7BA 4LC9B 3ASMA 1WN7A 1UCRA 3VEOA 4KDPA 3CDIA 3BDDA 1NJWA 3VETA 3IRXA 1JJ2M 3CCRN 1BN5A 1TAQA 3CZ6A 1YJWI 4EVIA 2QI2A 1WJEA 5C42A 4CHOA 1OCRH 2B6AA 3F8MA 3D5LA 1RBVA 1J5OA 5M1QA 2ZNYA 4BRGA 1IG8A 3E6MA 5JLXA 1YJ9N 4E7HA 4LY7A 1QTMA 3DTKA 2BGGA 1K8AO 1HKTA 2QZ8A 1D1AA 4FYDA 3HB9A 2HF4A 3AVKA 1IAWA 4HQEA 2ZMEB 2BW3B 3TSUA 4BL0B 3L09A 3ZT3A 4L3QA 1FYLA 3AKZA 3ENHA 3SI6A 3BR2A 1WGXA 5LD2C 2E35A 1X3ZB 3FDYA 3RYPA 4IFEA 1VQLI 1AWCA 3MCAB 4CEBA 4KUMA 4CJUA 2G7HA 5EEHA 2VOOA 1VZ0A 2P51A 1IZ1A 1YI2I 1B8IB 3O6WA 4DQPA 1ILYA 4M3EA 4L5EA 3RPUD 4JAXA 3T1HK 1X9SA 4JK1X 3E5QA 3KLIA 4F9OA 3SYTA 5FKKA 3AVNA 1WSGA 4B9QA 3W6VA 4LIUA 1FJLA 4HV6A 4XKCA 4NC7A 2RV8A 5HS8A 2HXIA 3QINA 4DQQA 2PJPA 3VEVA 4NO7A 2LBFB 2BVLA 4MO4A 2HU9A 1BQMA 1Z6TA 2R7FA 4KHNA 1XC9A 4L9NA 3ZSOA 3VA0A 1TWFJ 5J1RA 2DXIA 2DOFA 5ELZA 2ZXWH 4FK4A 1ZG3A 5LHHA 3BOQA 4G1QA 4RM2A 3CCJI 3T0YA 2KJBA 4C2UA 2FX0A 3ZQHA 1RT7A 1DU0A 5AQXA 1SKRA 5AQNA 4NNJA 2G8IA 1BR2A 1QHAA 3GF2A 1FJGK 4II2A 3LL3A 1KYZA 1KQ0A 2M4KA 1I5ZA 1X2MA 2M34A 3VPZA 1QGPA 1KU9A 3S2DJ 3OL3A 2D1KA 2O0YA 2VL8A 3FISA 2VCPA 3UKRA 5C25A 2EWSA 2DK8A 1NBWA 2MC3A 4CEZA 2ZFUA 4XLCA 3HSCA 2V7YA 4BC2A 4DSJA 1ASWA 1R58A 4DR1K 2HNHA 2ZJPF 5HS9A 1Y1VJ 2DOAA 1USTA 3BTCA 2M7AA 4LB6B 5J4YA 4DTOA 4QAGA 3CCLI 2VG6A 1W2BM 1HNIA 1X2NA 4Y7NJ 3A01B 3M8RA 3BWGA 3OR1C 2VASA 3TEDA 2CW7A 2OAZA 2CQKA 4NB5A 1NLVA 1B9MA 3H3NO 3GTLJ 2GXAA 2J4RA 1BIZA 2VWKA 4IRGA 3E66A 3BDPA 4F3OA 3RRGA 1RNHA 3EZ5A 3MCZA 3O3KA 4LFBK 4JX4A 1MIJA 5GAEP 3C65A 4X64K 1BCMA 3PIPL 5I9EB 1QQIA 2A6HF 3GXOA 3VYRB 1J5YA 3M7GA 1LW0A 3RYRA 3WQUA 3C6AA 2MFZA 2DFHA 1NU0A 3AGKA 1J09A 1JUMA 2B7EA 5GADJ 2DMUA 3THVA 3CCEN 1DGKN 1RTIA 4L0ZB 2L54A 3P9CA 1BM9A 3KIOA 3ECHA 4MO5A 2OTJI 4DQSA 1YO5C 4L9TA 1VQPI 3JRFA 2STTA 3OW2M 2H27A 4XBFA 2MLGA 2CV1A 2P5LC 4G94A 2P5VA 3FXLA 2O8DA 4CJSA 4FE4A 4CICA 4Z4GA 2IVNA 5B1AH 4MDAA 3ROUA 2FMYA 2UUCK 1U48A 3OOUA 5LMNK 5J47A 4BBSJ 2IW5A 4ILJA 4PJJA 2IS4A 4YG2F 4B3AA 4E3SA 1FT9A 4X62K 3KK1A 3E1SA 5JHUA 3KE2A 1X1DA 1CXQA 1K7AA 1JHHA 1JLEA 3NWTA 5IP9J 2OZUA 3WTUC 2X48A 3BY5A 5ILVA 2HNDA 2O8KA 4JS4A 4NDLA 3LDOA 4O3MA 3C7NA 3GFLA 1SL1A 3AVHA 2L4MA 2X6YA 3TW6A 1JKRC 1NG9A 1O7LA 2HYFA 4OAYA 2CW0F 3LANA 4FSVA 2O03A 5JLHA 3QWLA 1DTQA 3HYFA 4DQRA 3QPTA 2HZTA 1TW3A 1Z67A 4IRIA 3HZ6A 2D0AA 3TANA 2VG7A 2QTDA 2ECCA 2OU2A 2GIVA 1MZBA 1VF9A 3CMEN 4GKKK 2A3SA 1WUAA 1L3UA 1D5YA 3TAQA 5HVQC 2E1NA 5B66C 2BXZA 4C1NI 5JVGL 2OV7A 4CGHA 1YS7A 2CU7A 4U7BA 4DWIA 4IJNA 2DA2A 3DI6A 2EIKH 1HJOA 2X4HA 2X51A 4I0AA 2VWBA 3J81K 1NK9A 1VQ5N 5HODA 2XGXA 3D7EO 3CQYA 1VSHA 1VSIA 3IKVA 5IP6A 2HMPA 2CWEA 2JRTA 4YFXF 2DBBA 3ZYYX 1JJ6C 4BRPA 1VQ4N 3WT0A 1JCFA 1FLIA 4FLXA 3LPTA 3MMVA 4WFBL 1HBXG 5LY3A 3I0RA 1Y0NA 5FRNA 5GAHJ 2O8FA 4OIOF 4DBQA 3DRSA 4E0DA 1K9MO 5HRRA 3JAMO 4GY2B 4QCLA 4X6AJ 3ABMH 1MGTA 3KKRA 3COAC 1V4TA 1ULYA 5D8LB 2GEMA 1GLLO 2F4IA 3ECOA 1MNEA 2BANA 1NK6A 2FLOA 1CGPA 4WCGA 1I27A 3F9MA 5JR3A 4W1UA 2FBIA 5JS2A 3QIPA 3CCSN 2E2IJ 4WXHA 3DPTA 3TL4X 4CK3A 2YU9J 1CF7B 4EZ9A 3WXIA 4ENMA 2XB5A 4A3MJ 3EETA 3M3YJ 4JI8K 4H0EA 4O55A 4A3JJ 5KHDA 2P5KA 3HZJA 1LQ1A 1YX5A 1D4XA 1TWAJ 3VQBA 3FXKA 2WWYA 1KGSA 4IHWA 1Y56A 3T5XA 4V2FA 3JTGA 1WSUA 5EG0A 3C7JA 1VQ8I 3Q0WA 4ZDLA 5LGUA 4C8OA 2XDVA 3R6MA 2P9NA 3HSFA 2RDPA 3V1OA 4XN3A 1IBKK 4NQWA 2VBYA 3CERA 5B8HA 1HSTA 4XONA 4CJEA 3HTSB 2VKHA 3OV8A 4IEEA 3I56I 2QA4N 3V4IA 1U3EM 5LHGA 4ZHRA 2YHXA 3ZP5A 2QWOA 3P1GA 3KLFA 4DJAA 3LDLA 4M3GA 2H09A 3VQ9A 2HDWA 4BY1J 3AO4A 3G3ZA 4ZC3A 2EIMH 3THYB 4A57A 2Y0SA 1IXRC 4LG0A 3DWLE 2NZTA 3LM9A 1BR1A 2ZJQL 4Y1CA 4IO9L 4WQ5A 3JRDA 1FSEA 3CJ1A 3A02A 4A5BA 2HYJA 3OYMA 2OANA 3LSJA 4JQFA 3KEYA 4FJGA 5IPAA 3JRIA 2RN2A 4IOCL 2ELHA 1E3OC 5BPLA 2JJ7A 3BZCA 3F0CA 2LF8A 4RB3C 3CFRA 1TKTA 2W1OA 1UB9A 3CJTB 2HXOA 1SFXA 3KLHA 4HEA2 1ZGJA 3ZEUB 2CMPA 2DT5A 1K79A 5ADXA 5M3MJ 4YHHK 4AC0A 4CEOA 3BP8A 2FA5A 2MBFA 1U47A 3KCCA 3K10A 1N32K 4PKHA 3HI0A 1Z77A 5E8IA 4BG9A 1JKQC 2OF7A 4PSWA 3J80Z 3G25A 4I01A 3I8BA 4BR4A 4AHRA 2I5JA 3I59A 4LJZF 2O8CA 3SBGA 4RWTA 2WB1N 4M9ZA 1DU6A 1XMXA 1ZGWA 2QSGX 3SMPA 3K0LA 4HNUA 1E2XA 1T3VA 3G1LA 2Q36A 3T8TA 2NLXA 3OYLA 2NRHA 1G15A 1OPCA 2ACJA 1HYVA 3CFOA 1Y97A 4X65K 2DW4A 5HDGA 4DFPA 1QQOA 1KQ9A 3WQTA 2XF7A 2EX3A 1OH5A 4FK0A 2M4GA 1RILA 1P90A 4RAZA 1AKHA 3DXMA 1YOVB 2L7FP 4RW6A 2HVHA 3RKWA 1QE1A 4M6XA 4QTRA 1R6RA 2DMQA 4DFMA 2JWTA 3K4JA 3GTQJ 3GTPJ 4CD1A 1VQ9N 2WAQN 4GVMA 2XPUA 1C1AA 4QPQA 3ZSXA 5F0FA 1YE9A 4FJ8A 4IRHA 1TWCJ 3BPXA 3MKWB 3F3XA 2VJ5A 3WG9A 5E3LA 4FXDA 5KQ8A 4AF1A 2Y1JA 3AVJA 4M41A 3AAFA 5HBMA 3HC7A 4DTJA 2O8BB 4KHWA 2QYOA 4BREA 1NJIO 5TRDA 3WGHA 1R5ID 5EOYA 4AWXB 2HHVA 3CP8A 2YKMA 4XIUA 1BI1A 4EGZA 3J8AA 2K86A 1G3SA 3SDGA 4PCQA 1VRTA 4OPAA 3KEQA 1TVRA 2E1YA 3CPWM 5IT9K 3VMFB 1XNQK 1ZREA 1PUFB 1W1WE 3DEEA 3CJAA 1ZBLA 3D0SA 3L2UA 2CGPA 4FPBA 4A3CJ 1U4BA 2W7NA 4CJPA 1QO0D 1UWBA 2QCOA 4GVEA 4BBRJ 1UA1A 1BA5A 2WV1A 3EL2A 4JV5K 3EQLF 4CGZA 4Q5SF 2GIZA 4B1RA 2WUSA 3W0LA 1QSLA 1YFHA 2Y48A 1QZZA 2G8UA 2LP0A 1ESVA 4YFKF 3D5RC 3MMYB 5FROA 4FTHA 1PVEA 3SFZA 2MGQA 4S0HB 3R0AA 3ZOBA 4M7XA 4PJNA 3ASOH 3B6OA 3ABKH 5FLXO 2FBKA 1X9MA 3IHUA 3NARA 2XGDA 4CGDA 1S1XA 3AG2H 1D0XA 4YY3K 2D0BA 4KHPK 1F9NA 1MNMC 3NVMA 4DS4A 1P4XA 2GUIA 2VIXA 5EVZA 4M73A 4CXFA 3MEXA 4CZLA 2Z2SB 1LWCA 1R22A 1ZBIA 1S72I 1MW7A 4BACA 2QBYA 4LFUA 3CD6N 3ZMTA 4CBUA 3MK6A 1GOAA 2CQQA 5M3FJ 1QQMA 2V1XA 1T56A 1U6GA 2KIUA 1FY7A 2X6NA 3DLRA 4DR6K 4QS7A 2JVGA 2QXLA 5AFUH 1XN7A 1Y0UA 2W57A 5IOZA 2R7DA 2K9MA 3K4MA 2M8EA 5IYDJ 5FFZA 3LSHA 1BI4B 5AONA 5HRNA 1AU7A 1BL0A 4ILGB 3MXMA 1XC3A 3OSGA 1CZ9A 2RVCA 1YHQI 1MDMB 3QU6A 2Z3YA 1VSJA 4YOTA 1W5SA 1J6ZA 1OR7A 3TMOA 1LUJB 4KH5A 4PK4A 1FBQA 2HPMA 5H1SQ 5K5OA 2VGNA 3M8SA 5DMRA 2IAIA 1KFSA 4PUOA 4N4OB 1T05A 1QHTA 3PX6A 1GHCA 2YR2A 3RSNA 4DYQA 4ENNA 4M3YA 3SNNA 4Q47A 1R5GA 3I4MJ 1K78B 2QGUA 3CI5A 2O8EB 1YT3A 3DKYA 1JHFA 4ZJZA 2P9UB 4CIEA 3CCRI 1RT5A 2ME6A 2MSYA 4FWNA 4EP4A 4B3RK 1TW2A 4HVJA 4BC5A 4B9NA 3OS1A 5LJWA 3P4IA 5MLCQ 1ATRA 4OKJA 4XIDA 2IGOA 2NNNA 2E7WA 4I99C 1ZBFA 3ID8A 3S32A 1MH4A 1LEBA 2GUPA 1ZR4A 4N76A 3JRHA 2V1DA 2FBYA 2X85A 2W41A 1MBFA 4Q4ZF 2Q2EB 5DCMA 4MQVA 3CYMA 1SL2A 3QETA 3OYNA 1JT0A 3K0SA 1A36A 4G6DA 3OHRA 3O3FA 1VAZA 1MJAA 3WG7H 3PLAA 3CCMI 2ZD1A 3QODA 3WTYC 4JX6A 5FB2A 3WU0A 1P7IA 5KNLA 1NGCA 2HVRA 3QPLA 2W6KA 1IRFA 2LTPA 3UKUA 4QOZB 3GZ5A 1IKVA 1NMNA 4XN0A 3DBHB 3S3MA 2GX9A 3O1WA 4ZZLA 3JREA 3LDQA 3L3UA 3V7SA 3MWTA 1JJ8C 4A69C 4MIMA 3OOPA 3OYEA 2RKIA 4BDPA 3HRMA 1HDDC 2FBVA 4XQFA 2QLZA 4UHTA 4BUPA 3JRAA 3FZHA 1J2XA 2XROA 3TTFA 1JE8A 1B1BA 4DU1A 2P9SA 4NBQA 3ATUA 2PMUA 2GELA 2VQFK 1AHDP 3QU3A 2LY2A 4DV3K 2ISYA 3KP4A 1EETA 3A0IX 1D5AA 5J2QA 5M1KA 2EZKA 3CESA 3PUBA 4BRHA 3HKZN 1HNWK 1MWKA 5H20A 1FSHA 2M8GX 3VGMA 3LNQA 3NHGA 3BF1A 4Y0WA 2EV5A 1S3XA 3M8PA 3KWGA 1XTAA 2MH2A 3DLAA 2HQRA 4FLYA 1D9FA 4BVPA 4CCKA 3S2HJ 3N05A 1KQ8A 2I10A 1NK2P 1T6SA 1XHXA 1J59A 5BRDA 5GPAA 4LSNA 4Z4CA 3QNNA 2Q2RA 4OMZA 1Z25A 4EJOA 2TCTA 1LOTB 2IPQX 3CETA 2XAGA 1Y8RB 3P31A 3LP3A 4H5RA 5CVIA 4GMJB 1IG9A 3ZX2A 1O1WA 4I02A 4FWOA 4AM7A 2BE2A 4CYCB 5EGOA 4OX9K 1JXEA 3PO5A 1WJ5A 2HHWA 3V1QA 1S7EA 3JW4A 1K8KA 1FMWA 1SVMA 4GV3A 2FSWA 4FX0A 4B1UB 3RKYA 3SUPA 2KZZA 5GTIC 2LKXA 5IP7J 1HNXK 3CUQA 3LL7A 1EXQA 2RC4A 3K58A 1GLCG 3SJJA 5FPNA 3DYAA 4HLYA 4ZYGA 3VYTB 1LAVA 3PSIA 4KTWA 5ICCA 4PJLA 5HOOA 2HKXA 1RETA 1S3JA 4DG1A 2D1HA 4G12A 4GW6A 1AOYA 1HRHA 3HUGA 3A5MC 1P4AA 1ASVA 1DDNA 3IG1A 4FE7A 3HXLA 1Y6IA 2BY0A 1DGWY 1RTJA 2AO9A 1ACIA 5FPEA 3C94A 3DEUA 4A2BA 3V9UA 4B1XB 2HVQA 2VJ4A 2JK3A 1MMGA 1HNVA 1G4DA 3VQAA 3ZSWA 4EP5A 3S1QJ 3DOLA 5IT3A 4KTZA 2JZYA 4RG8A 1YYVA 1YITN 3K1NA 3K2AA 3ESWB 3TGNA 5DCFA 2EWNA 3CCEI 3U3GA 2H6BA 4CEDA 4H4OA 1BU6O 4ISFA 1L3VA 3AA4A 1C6VA 1FP2A 2YS9A 3A1YA 1LV5A 4KB0A 2Y0MA 2NVXJ 4RB1A 3OWTA 1Z6RA 5M1NA 4KT5C 2B4JA 1QA6A 4PA1A 3SAFA 5C24A 3OYAA 4PGHA 3TTCA 2IJLA 5E8GA 5AZIA 2XSJC 1JL2A 4A3GJ 1BBYA 4OAZA 4BAYA 4FQGA 3S17J 4A3DJ 4IZ9A 1X1CA 4GXOA 1ZTRA 1QS4A 3M8JA 2WC9A 1I6HJ 1WSHA 2Z1GA 2GWRA 2Z16A 1TYQB 4YOWA 2DFEA 1QQCA 2NS7A 3QNOA 5F27A 2FXAA 4AUXA 3ZCOA 3KLOA 5HNHA 3T7ZA 1MMAA 1VSDA 2QEXI 1U2WA 3DEWA 5C15A 4FJKA 2MYSA 1HPMA 5HS7A 4W5OA 4BQOA 4BEHB 3GX4X 1H1VA 1H88C 3VPRA 2ZXIA 2VQEK 3IS9A 2PLYA 5DM6F 1BI3A 3S8PA 1JGGA 2DMNA 1V4RA 1IN7A 4AVPA 3DMJA 1IKXA 2ZGYA 1B9FA 3CMEI 1UZCA 1IC8A 3LSRA 4CF2A 3RSEA 1ZBSA 3SUOA 4KIGA 1RI7A 1RDWX 3S41A 3HPOA 3H1VX 2Q0UA 2HYGD 5AQLA 2PEXA 2XGCA 3KTQA 3BZKA 3I0TA 3H3UA 4CFAA 4CECA 3VFZA 2RAEA 1Z1DA 4ITVA 5C2FA 3N4MA 1K4SA 3PIPF 2VE8A 1B72B 3I4NJ 3FM3A 2D45A 1ZXOA 5I42A 1XMKA 1LKXA 1QPMA 2ZO4A 1N6QA 4CZJA 3VA3A 1P4WA 2ASPA 3JXUA 1DPUA 4DR3K 4KNYA 3EE9A 1TV6A 4CUGA 1VQ4I 4PWDA 2HTSA 3JYTA 3KVGA 3TU5A 3RMDA 2KMUA 3CCYA 4O8UA 4IG0A 3K4LA 4KA4A 3BCBA 4F91B 1JKHA 2K9LA 4HUFA 1W5TA 3TBIA 1IN8A 3HOYJ 4A3LJ 4LOCA 1SQKA 1OKRA 5HP1A 2FF6A 4BE1A 2TRTA 3WNFA 4EEFG 2JWLA 1S9EA 3RZDJ 4DSKA 5F64A 4LLGF 1FIPA 3J7YJ 4KYWA 2XRIA 4V19S 5KI6A 4OWRB 2AHQA 4X1EA 3F2KA 4LFAK 4K42A 5CYQA 4R1HA 1IV6A 1DP3A 1XGMA 2IS1A 1BIBA 2UXNA 1T95A 3SAHA 1S1TA 4CFCA 2VBZA 1LB2A 3IL2A 5IY5H 5KPTA 2KKOA 1S6LA 4IVNA 1HXDA 4M3FA 1OH6A 2P6TA 4Y13A 4RGRA 1WRJA 1RDBA 2B5JA 5C10A 3CJRB 2Q0OA 4AHTA 3EUKL 2VB6A 4N56A 3K70C 4RGUA 2ZKZA 3H46O 4BRFA 5JVTA 4L9VA 4MO7A 2A6EF 4W97A 4CVNE 3T1AA 2CGLA 4E7KA 2DTUA 3VF6A 4Z2YA 2EQRA 3ZSVA 1MKMA 3OYJA 4NCAA 1QVFM 2O7OA 5CVVA 1JI8A 5KVRA 4G9ZA 4I6MA 2P9PA 2CUZA 4FWPA 4ZDPA 1X3UA 3A03A 1V4SA 4O8KA 2DDAA 3AGRA 4GO1A 5CY4A 2QA4I 2AQEA 3RI4A 3W3DA 3F8BA 2FBXA 1WH5A 2EFNA 2OYQA 5CPRB 3VQPA 5T7BA 1PP8F 2KDZA 1QVUA 3K1PA 2X1EA 1BIAA 3DKWA 5M5YJ 2V7ZA 3QEVA 3H1QA 1FTZA 1XCVA 2CFOA 2L0KA 2PQ8A 2OZMA 2ZJRL 3CCUN 1X3WB 3V8KA 2L7MP 3S3OA 3VERA 2RNGA 5EY4A 5KQDA 3F73A 4XNFA 4LH5A 1N77A 3NGYA 1OYWA 2LR8A 3WTXC 4LD5A 1WQ2A 3HO1A 1UJ8A 4DF8A 2EINH 3AO5A 4HOBA 4DFJA 3CPEA 3VF2A 2KZMA 3S15J 1XSVA 5LBQA 2QKLB 1R7JA 1S5LC 5ICFA 1XI1A 2X0LA 3AVGA 1P9QC 3S1NJ 2O8DB 2PBDA 1WFXA 1A5JA 1KC8O 1T0FA 4JN4A 4WQ4C 2Z99A 1O3RA 3A5NC 1G2HA 2WA0A 2CUJA 2JTVA 1UA0A 3J81Z 3I5UA 3V7RA 4B47A 3SFIA 1YQAA 4RA2A 3NE6A 4IQ4A 1L3LA 2B63J 1T6CA 3OS2A 3PO3J 3G0ZA 1RZ4A 3I55I 3BTJA 2VKVA 3LAMA 3WNEA 1YW8A 2KJCA 3SQ2A 1SAZA 4JOMA 4FT8A 3M9AA 1D8KA 1RDUA 1HQCA 1Q86O 1QQNA 3HSTB 2GLOA 2XF5A 3KLGA 1KU3A 3J7AY 1TK8A 3PFIA 1ZRDA 3LSMA 2IC3A 2P9IB 2CQNA 5F0CA 2DA5A 2IGMA 1LDDA 2DFFA 1X9WA 4YIFA 1KLMA 1X19A 3RR8A 2Y30A 4BRKA 3U9GA 1LAWA 2FQ3A 1GOCA 3QLHA 4DIQA 4IOXA 4QS9A 3K70D 1S1WA 1R1TA 4XM3A 1SFOJ 4M3ZA 1JLBA 3FHZA 4I7FA 2DMPA 3E01A 2DA7A 2RQQA 4M45A 5FFXA 2R5ZB 3H35A 3FXQA 3A0BC 5AR0A 3FK6A 2KHOA 4MGRA 4OJRA 1VQ9I 1B6AA 2MABA 4I2OA 1NK0A 2EA2A 3TAPA 2P81A 3W6JB 1SMTA 1VQMN 2LYCA 1NK3P 4AIJA 4FJ7A 4FLWA 3OYCA 4JI3K 3ZR8X 1C1CA 3TO7A 1R23A 2HPIA 3ULDA 2BZTA 3HBTA 1RBUA 3IAS2 2F2EA 4BQNA 3BR6A 3LA7A 2QK9A 1SL0A 3M07A 3BQZA 3ZXSA 2CQ7A 1ITGA 2WBMA 5AZJA 5M1PA 3DLBA 1W7AA 5C4XJ 3DV8A 1T33A 1VSKA 1S6PA 1IUYA 1HDPA 4CBXA 2L2OA 1RR8C 1MDUB 3AG1H 2YSRA 2EIJH 3P7NA 5LRSA 1WSIA 2E2HJ 4RMNA 1LCUA 3FK7A 2ICWG 3Q7BA 5E3NA 5LGNA 4AVZA 2E7XA 2YKNA 1VQKN 1J7KA 3O5BA 2CO5A 2H1LA 4AHSA 4FCYA 4CJ3A 4LF8K 3QPSA 1KTQA 2F8TA 3JSPA 1HNZK 3IH4A 1ZG5A 1YAGA 1TT5B 4C2TA 3TP3A 3JCUC 4ESBA 4WCEL 1H0MA 4CF1A 4AHVA 4H0XB 4CCHA 1PJRA 3MXIA 3VEXA 1TNTA 4RM3A 4KHSA 3NEUA 2FQ4A 2YJEA 3J80O 1FMVA 1HA8A 4FJXA 4UUSA 4NHJA 3WGGA 3B73A 3H0GJ 1XSDA 1GV5A 1RCHA 3ZQIA 1U8BA 1WJBA 3D2FA 2HOSA 1B59A 1SZ2A 2NRRA 4F92B 2L01A 3O8GA 2JN6A 3CD6I 3O9QA 3VQ5A 3ZX3A 1BJAA 3NF9A 4DTSA 1KCFA 4CJTA 2GOMA 1JXSA 3ZT1A 3QESA 5LEJA 5EZGA 1TAUA 1HPZA 1UAAA 3C0BA 2FRHA 4DV4K 3S1MJ 5D6EA 2R7OA 1B4AA 1SANA 4I7HA 4LG0B 1TWHJ 5BRHA 2G8VA 1N75A 1BJZA 2HOEA 4P5OA 3GTKJ 3LALA 4BU2A 1SAXA 3WGIA 1WAFA 4B44A 3LMMA 4BRMA 3BC8A 1RNLA 4MTDA 2YV0X 3LWLA 2P9LB 2BTFA 3G73A 2O8XA 3EEQA 3LZJA 4GV6A 1Q1VA 2WAQA 2ZMEA 2BW3A 2IGNA 5SZTA 2RREA 5BPNA 4PKIA 2H3GX 2KZVA 4C3HJ 1XCBA 1EH6A 3CG7A 4D7NA 3DLKA 2KFDA 4AIDA 1FC3A 4EHUA 4JI6K 1VQ7N 2KFNA 3J7ZO 2ZC2A 1SV5A 1TTYA 2A6TA 2M1BA 1CXUA 4Z4HA 2OPTA 4DF4A 1KVBA 4OKEA 4NC6A 3VOEA 1DQUA 4EM2A 2VT3A 4KBOA 1B8IA 3KK3A 4E1MA 4I98B 3ULEB 3EKSA 2HOTA 2W48A 4YDUC 4KPYA 4H0YB 2ID6A 2NVTJ 4MFEA 3FMSA 1G8XA 3V4GA 2K02A 2K4BA 3G1MA 3LSTA 3EYYA 4EQQA 4ESJA 1EV7A 3E6CC 4IHYA 4OINF 3N4QA 5IT9Z 4CESA 1VSEA 2LBFA 3ZMDA 2XC7A 4IX7A 1ZQ3P 1DEJA 1GLBG 3FLCO 3V6DA 3TO6A 3CM6A 3NQOA 3FXJA 3E3VA 3ITHA 4B48A 3JS6A 3L2WA 4XKVA 1ETQA 1G6NA 3DXJF 2XO7A 4XLAA 4BKXA 3CQZJ 3BUZB 2EV6A 5KTQA 3E9OA 4DU4A 4RBOA 2JLEA 2VC1A 3S2WA 3ZRGA 4UUTA 3S9HA 1GLNA 2NXNB 4JKGB 4RCHA 3G71N 3ALYA 5AJ3K 1NK5A 4B8CA 2FSJA 4ZYHA 2A6AA 4BR2A 3RMBA 4EFHA 1ZARA 1VQON 4XLEA 3ZLJA 1EQYA 5HDNA 4AYBN 4XKBA 3B02A 1P6RA 2DODA 4CZMA 5BQTA 3VYSB 1RPWA 2I5UA 3ONQA 2K7LA 3FKIJ 3CMAI 4K41A 3AO1A 3E7LA 1OH8A 5JFRA 3C2BA 4YOYA 1I1GA 4YFUA 1LFPA 4EM0B 2CJJA 3Q9SA 3QYFA 4HSRA 4FJJA 2B0LA 3VQ6A 2E4LA 2NNWA 4BROA 4A5AA 2RPIA 4B8AB 4N9IA 4CZGA
chains in the Genus database with same CATH topology
4BWJA 3TAQA 3ZT3A 4CGFA 1VSKA 4C8MA 3RMDA 4ZTJA 1S6PA 4GVMA 1TL3A 3AA3A 1C1AA 1VSMA 3RWUA 1C1BA 3ZCMA 2P5OA 4FZXC 4PQUA 3ZSXA 4C8NA 3K5NA 2PZSA 3V9ZA 1X1PA 3VQ7A 4FJLA 3TABA 4IG0A 4OGEA 4F4KA 3SI6A 1EETA 1J53A 1L3TA 4FJ8A 4ZTFA 3AO3A 1D5AA 4CGHA 5J2QA 3O3GA 1JKHA 3O4NA 1TGOA 1JLAA 3HK2A 1WSIA 1N5YA 3U6FA 2RF2A 4HUFA 4DWIA 2IDOA 3SV3A 1L5UA