2DFEA

Crystal structure of tk-rnase hii(1-200)-c
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
209
structure length
209
Chain Sequence
b'MKIAGIDEAGRGPVIGPMVIAAVVVDENSLPKLEELKVRDSKKLTPKRREKLFNEILGVLDDYVILELPPDVIGSREGTLNEFEVENFAKALNSLKVKPDVIYADAADVDEERFARELGERLNFEAEVVAKHKADDIFPVVSAASILAKVTRDRAVEKLKEEYGEIGSGYPSDPRTRAFLENYYREHGEFPPIVRKGWKTTQDMINKST'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HII
publication title Conformational contagion in a protein: Structural properties of a chameleon sequence
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
total genus 69
structure length 209
sequence length 209
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 2dfeA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2dfeA01
4I9LA 1D9DA 4IKFA 4RW8A 2P1JA 3WNFA 3AVLA 4DTMA 3KK3A 4AHVA 3O3GA 3MXIA 2G8WA 2PYLA 3AVJA 2Q3SA 4DF8A 3PX4A 2O4IA 4CERA 3T1AA 4J2DA 1NK6A 3QETA 1WNSA 4CESA 5CYMA 3OYIA 3EZ5A 3DOLA 3L8BA 4FJGA 5D3GA 1WN7A 1KRPA 3RRGA 4IFYA 4DFMA 5I3UA 4DU4A 2RN2A 3LWMA 3QNNA 3RTVA 4RW7A 5CZ1A 3SUNA 1RBSA 2EX3A 4JLHA 2X6SA 1LW2A 4CF9A 3SQ4A 2OZMA 1N5YA 3QIOA 3OJUA 1ZYQA 1NK8A 2ITGA 3ISNC 4CK1A 1L3SA 4B3OA 3HYFA 1X1PA 1BHLA 4FLWA 3DLBA 4LD0A 3EY1A 4CGIA 3NGZA 5T7BA 3V1RA 3O4NA 4N76A 4CEOA 1MU2A 3TAMA 3SPZA 1RDCA 4Z4IA 1SUQA 3LDSA 2GV9A 3L2RA 2YHBA 4E19A 3QERA 1TAUA 4EZ9A 3HP6A 1NJZA 3ZT4A 1DTTA 4OLBA 2XY7A 2VWJA 1L3TA 3K59A 4QAGA 4RG8A 3VA0A 3ZSOA 1IKYA 3TAGA 3B6OA 5KI6A 3OS1A 2HMIA 3AVNA 1A5XA 1RDAA 3QESA 1T03A 4W5NA 1ASUA 4CHPA 1VSFA 5C24A 4CJWA 1Q9YA 2E6LA 4CHOA 4Z4CA 3KD1E 5FRMA 2OYQA 4FJIA 3KKSA 3PY8A 3TAPA 3ZT3A 5HLFA 3PX6A 4FJMA 1QTMA 3K5NA 3TR8A 4CJ5A 4DSJA 4FJNA 1NOZA 3OYDA 5DMRA 4B9SA 3TABA 5K14A 4DSEA 4IG3A 4KHUA 1S9EA 1NK0A 4QOZB 4J2AA 5SWMA 1T7PA 3QO9A 4L8RB 3HL8A 4NYFA 3K2PA 1ZBFA 1TV6A 4MQ3A 3L2QA 5J2PA 1IKXA 4ELVA 1ZBHA 2QK9A 5HRNA 4FZZA 1LW0A 2HW3A 3ZCMA 1RNHA 3DI6A 2PY5A 4DQIA 5C42A 3NF8A 4IG0A 4YFUA 3VQ9A 3NDKA 4Z4GA 2F8TA 5KGXA 1RT3A 1WSIA 3K5OA 3AO5A 4CEBA 4FLUA 4E7KA 4F4KA 2BE2A 4KAZA 4E1MA 4Z4EA 2DY4A 4DWIA 3SUOA 1NKBA 4WE1A 1WSGA 3WNHA 4LY7A 4CK3A 4FLVA 4DSFA 1CXQA 4HUEA 1KFDA 1RBVA 1RT2A 4K8ZA 4RW4A 1JKHA 4FJ8A 4AILC 4FYDA 3AO1A 4IFVA 1TL3A 3KLEA 4HTUA 1HRHA 4GVMA 3V9SA 3SPYA 4FK2A 2FBYA 3E01A 2XO7A 4CJVA 4DTJA 3HO1A 1U04A 4B8AB 4J2EA 3HJFA 2KQ2A 3OVNA 2Y1JA 1WAFA 4M3YA 3HSTB 2KFNA 3AVAA 1KFSA 4I2PA 2Z1HA 3NHGA 3C94A 4M41A 4E1NA 4E7IA 3SJJA 1C1AA 5CY4A 3VQCA 4KHQA 3SQ0A 4DU3A 4HUFA 2G8UA 4H4OA 1Q9XA 3QIPA 3LP0A 3DMJA 4Y1DA 3NH2A 4DLEA 2QXFA 1HMVA 1HPZA 3FFIA 3VQ4A 5CYQA 4DG1A 4ELTA 4Y1CA 1SKSA 3CQ8A 1QSYA 1QSSA 3H08A 4N47A 4DTNA 3RMAA 3VQAA 4N5SA 3D0PA 1RTIA 3VQPA 1VSJA 2ZD1A 3LZJA 4M3WA 4DF4A 1S1WA 1CZBA 1GOBA 1VSKA 1XI1A 3QNOA 3AA2A 2VG6A 3C6UA 1NJWA 4FJHA 3AO4A 1QHTA 4DTPA 1BCMA 1RT7A 2D5RA 2JLEA 3NF6A 4KTWA 4NYNA 4OKEA 4B08A 4CF0A 3F9KA 4FK4A 3ALYA 1JLQA 1T8EA 4CEZA 5SZTA 3O3HA 2IGIA 4JRQA 3SQ2A 1EX4A 1KVAA 4E7HA 2HHTA 2Z1JA 3HVTA 3VN5A 4G1QA 1VSDA 1YVUA 3THVA 1RILA 4C8MA 1L5UA 4CHZA 2FC0A 3AVFA 1WAJA 2WOMA 3V4IA 1Y97A 4CEFA 3I8DA 4KRFA 1FK9A 4M3UA 2EHGA 1KTQA 4CGJA 1S6QA 4F2RA 2E4LA 3DLEA 4NCGA 4DFKA 1U4BA 4HVJA 4AHUA 4FW1A 4CF8A 2GUIA 4DS4A 1XWLA 4DU1A 3OYFA 4KKOA 2G8IA 2X74A 3P83D 3CFPA 2HHUA 1X9MA 3C95A 3VA3A 3ZSZA 3HVRA 2I5JA 3OYJA 3L2WA 4DFJA 4GMJB 4B9VA 1NKCA 5J2NA 4FJLA 4K8XA 4BE2A 2BANA 4O55A 2DFFA 1KLNA 1Q8IA 1B9FA 1S1TA 3S3NA 1WSFA 4BDPA 1GOCA 4IBNA 4LSLA 1J54A 4OPKA 3V1QA 3S3MA 4PQUA 2B4JA 3V1OA 4W5QA 1J9AA 1Z26A 3KLGA 1TK8A 4F3TA 1TKTA 3NBPA 4B9TA 4ELUA 4M42A 2XRIA 1JXEA 1VRTA 2ETJA 1D9FA 3QEPA 3M8PA 1NOYA 3OY9A 1HYVA 1F21A 1HQUA 1FKPA 1SV5A 1JLAA 2Z1IA 3DYAA 4KTZA 4M45A 4CIGA 3NH0A 4DTUA 4M3RA 3OYNA 1C0TA 3OYGA 4DSIA 3O3FA 2KZMA 3LPUA 3OYEA 4OKJA 3ITHA 3KLIA 4CJRA 3K5MA 2XY8A 4LH4A 4FJXA 2LSNA 3OS0A 1GOAA 1SL2A 1QSLA 2Z1GA 4Z0UA 1RTJA 2A1SA 4CJUA 4BACA 3K5LA 3IRXA 3RMCA 1JXBA 3QLHA 3VQ6A 3M8RA 4CEDA 4JRPA 3MXMA 3AV9A 4DQQA 4H4MA 5JS2A 1BL3A 4KO0A 2KW4A 1LAVA 1JL2A 4YNQA 3LZIA 1BCOA 1ITGA 2NUBA 5FROA 4CJQA 4ZHRA 4XIUA 1EETA 3NF7A 3VQ8A 4HUGA 3TARA 3AA3A 3AO2A 4CJLA 4FJKA 3MECA 3OYBA 4CJ4A 1QE1A 3LP1A 4CGHA 1SL0A 4C8OA 4CIFA 3K57A 1BQNA 1C1CA 3KLHA 1BGXT 4PWDA 2DTUA 4DMNA 1JLFA 1RT6A 1FXXA 1Z25A 1U47A 1I39A 3HPOA 1RBRA 4DQRA 3AVHA 4DTRA 4FCYA 2P5OA 3VQQA 3QEWA 1ZBIA 3S3OA 2KZZA 4ID5A 3OYAA 4CGFA 5HP1A 4CJ3A 4ICLA 4DLGA 3SYZA 4GW6A 1CLQA 1CZ9A 3RR7A 2RPIA 4O4GA 1DLOA 3SUPA 4W5TA 3UIQA 3QINA 2IAJA 1O1WA 5J2QA 1WSEA 1UAXA 3LALA 3MAQA 3LPTA 1NK4A 4KPYA 3F73A 5KRSA 3V81A 1HYSA 1C1BA 4DTOA 2GBZA 3PO5A 1W0HA 1IKWA 4CHYA 3JYTA 3EYZA 4AH9A 4CIEA 3SV4A 1LAWA 4BDYA 1TKXA 1TAQA 4F3OA 1ASWA 3VQ7A 3AVBA 1BQMA 1IKVA 1KCFA 4LSNA 4W5OA 3SV3A 3KD5E 2FBXA 3NF9A 1RBUA 4CGGA 4BDZA 4FLXA 3LP2A 3U6FA 3TWHA 1S1UA 4TSXA 4C8KA 1K6YA 3KLFA 3LP3A 3HM9A 1XHXA 2IS3A 1L3VA 4B9LA 3B6PA 3IAYA 5FRNA 1YTUA 4CFAA 2XHBA 2F96A 1SKWA 4FK0A 1JLCA 3MEDA 1NKEA 2QKBA 3M8QA 2PYJA 4CK2A 2IDOA 1RTHA 1RT4A 4KI4A 2ZQBA 2X6NA 2E6MA 3OYLA 4BE0A 4M3ZA 1EP4A 3OYHA 3IS9A 5J1EA 1JL1A 3V6DA 3NH1A 4KB1A 4E0DA 2VG5A 3PV8A 2Y1IA 1U49A 3DRPA 2FBTA 3AVIA 3IG1A 4CFCA 4DTXA 4DQPA 2G8VA 2HHQA 4EP4A 2B6AA 1X9WA 3ZT2A 5CZ2A 4B8CA 4KHSA 2PZSA 4N41A 3AA5X 1EKEA 3NCIA 2KTQA 4BWMA 1C0UA 4MFBA 3AVKA 4Q0BA 3HXMA 3V9WA 1NK9A 1LWFA 2HHXA 4KV8A 4F2SA 4OLAA 1JLEA 1VRUA 3OS2A 1L3UA 4E3SA 2HHVA 1B92A 3AO3A 4CCHA 3OJSA 1WSJA 2G8HA 1VSMA 1T05A 1NK5A 1QS4A 1J53A 4JS5A 4F8RA 1RT5A 5E41A 4FJ9A 1TKZA 1SL1A 5JS1A 5J2MA 3ULDA 4ID1A 1C0MA 5DK5A 4CFDA 2DFHA 3TAFA 2QKKA 1VSLA 3ASMA 3I0SA 1S5JA 4I2QA 4PA1A 3ZSYA 3QEXA 3LWLA 3D45A 3CYMA 3U3GA 3OYCA 3SQ1A 4B9UA 4KB0A 3PUFA 2WONA 1ASVA 3KKRA 2VG7A 1ZBUA 4NCBA 1UA1A 1REVA 4CEEA 1TGOA 2VWKA 4CECA 3SI6A 3LANA 1HNVA 1A5VA 3DLRA 2YNGA 4CEAA 3OYMA 2D0AA 1HNIA 3AVMA 1EXQA 2OPSA 1TK0A 2YHAA 2D0CA 4DTSA 4JS4A 1WLJA 4AHCA 4FLTA 1IH7A 4CJTA 2P5GA 1UWBA 3S9HA 4N56A 1YT3A 1HQEA 1S9GA 4CJFA 2JGUA 3VQDA 4KHNA 3VQEA 3V9ZA 2YV0X 4KHYA 4FXDA 2HHWA 4RW6A 3DOKA 1LWEA 3L3VA 4O44A 1ZBLA 4B9MA 3PX0A 4OJRA 4BE1A 1FKOA 3KK1A 3KTQA 4C8LA 4Q5VA 2DFEA 2FBVA 4Z4HA 4CJKA 4CE9A 4DS5A 1BIZA 2YNIA 2G8KA 5HROA 3C6TA 2BDPA 4FM2A 1TL1A 3RMBA 4UQGA 4E7JA 1WSHA 5C25A 4AHRA 1RT1A 1UA0A 3G10A 1TK5A 4ZTFA 4KTQA 2YNFA 5HBMA 4KHWA 1LWCA 3DLKA 5HRSA 4CEQA 3K58A 4FJ7A 3KJVA 1W9HA 3TANA 2OZSA 3A2FA 5KRTA 3L2UA 1B9DA 2W42A 1N6QA 3DRSA 2YNHA 4CGDA 3HT3A 3QEVA 3ZSWA 4CHQA 3SNNA 3CM5A 3HPGA 1S6PA 3WNGA 4FM0A 2YKNA 3DM2A 4FM1A 2XY6A 1VSEA 3SCXA 3RWUA 3MXJA 3NFAA 2HNYA 2B5JA 4M3XA 3DLGA 4OPJA 2X78A 4ZTJA 5I42A 5HRRA 1IO2A 4AHSA 3CFOA 3CFRA 4FJJA 4Z4FA 4OGEA 4KFBA 4R5PA 4CJPA 1NJXA 1J5OA 2YKMA 1NK7A 1X9SA 1RTDA 5FDLA 4FZXC 3SZ2A 4O5BA 4DSLA 4QCLA 3G0ZA 3ZSQA 3VQBA 3T3FA 4CJSA 1VSHA 4DQSA 1D5AA 4OGCA 3KK2A 3NGIA 4IDKA 3SUQA 3ZSRA 4O0JA 2ZE2A 3P1GA 4M3TA 3ZSXA 5HRPA 4B9NA 4NCAA 3AVCA 2HNZA 1RCHA 4PUOA 2IOCA 3HPHA 4LH5A 1BI4A 3LAKA 3HK2A 3ZT1A 2HVIA 1JLBA 4CF1A 2D0BA 4O0IA 4E7LA 1U45A 1VSIA 4DFPA 4DSKA 3RR8A 4CF2A 3VQ5A 1BISA 1YTAA 4W5RA 3U3YA 1SKRA 3KIOA 3I0RA 3P5JA 3L3UA 1HJRA 3RRHA 1IG9A 1KSPA 3BDPA 1DTQA 2HNDA 2O4GA 5KTQA 3NGYA 4BWJA 3ZT0A 1R0AA 1NJYA 3DRRA 2R7YA 4KI6A 4H8KA 4PY5A 3ZSVA 3HP9A 5EU7A 5KGWA 3V9UA 4HHTA 3L2VA 1KLMA 1CXUA 3MEEA 1S1XA 1BI4B 3NE6A 1TKDA 3CG7A 4EP5A 4J2BA 1HYZA 4OKKA 4FZYA 3V9XA 3PO4A 4RW9A 3AVGA 4AHTA 4FW2A 3OYKA 2OPRA 1U48A 2HB5A 2IC3A 3T19A 4I9QA 4C8NA 2F8SA 2G8FA 1RBTA 2ATQA 4OVLA 2RKIA 4FLZA 2XY5A 4CHNA 2A1RA 1C6VA 2OA8A 3M8SA 3DLHA 3JSMA 1XC9A 1XHZA 2AJQA 1A5WA 2HHSA 1QQCA 3CM6A 2BGGA 1S1VA 4FJ5A 3BGRA 1KVCA 3MEGA 4I7FA 1KVBA 3NAEA 4HCCA 1RDDA 1LV5A 3RMDA 3AA4A 2KFZA 1TVRA 3WNEA 4E89A 4FLYA 1UOCA 2HVHA 1RDBA 3O4QA 3TAQA 1VK0A 1JLGA 4KREA 1I3AA 1D8YA 3TI0A 3QEIA 2OPQA 2OPPA 3LAMA 4CJEA 1G15A 2P51A 4CFBA 4HCBA 4FVMA 4EZ6A 1BIUA 3TAEA 2RF2A
chains in the Genus database with same CATH superfamily
1YTYA 3MN2A 4Q4ZF 2K4BA 4X65K 3CF2A 3SHFA 3L8BA 2IPQX 4IWVA 2HKOA 1BI2A 4FL9A 4U67L 3CJAA 4ESFA 1TNTA 1ENHA 2QWWA 2ZKZA 2LC2A 3SMPA 1YHQN 2HVRA 1ZKGA 4B3OA 2NYXA 4FLWA 3J7ZO 3GTMJ 3QICA 3OW2M 3LDSA 3DLLF 1SFOJ 4U0YA 3MFKA 2FQ4A 4F55A 2XY7A 4QAGA 2E20A 3O80A 2HMIA 3OA9A 2EILH 4CHPA 1VSFA 5E3MA 1K78A 4FJIA 4CYCB 3DWLA 3JRHA 2NRVA 2KHOA 3QYFA 3AY9A 4PJ0C 2FLOA 2P9SA 5C42A 2JSCA 4ZC3A 3NDKA 3OWTA 2GWRA 3KZIC 4XICA 4JI1K 3RDIA 1W7AA 3I4PA 3I0TA 4G7ZF 3CDHA 4BRCA 3B6CA 3HO1A 4CCKA 1LDKB 4NDLA 1IXSB 2Y9YA 2ELJA 1XGSA 2O8KA 1ZC6A 1Q9XA 1JJ2M 4PHTX 1RTIA 2ZD1A 4B1XB 1XI1A 2DTRA 1NG6A 1MGTA 4FK4A 2QQ9A 1T8EA 4K42A 3EYYA 4BY9C 3KZYA 4R79A 3FKIJ 3THVA 1L5UA 2XF7A 1NMDA 1WAJA 3WGHA 5CKTA 2NXNB 4F2RA 4HDVA 2VE9A 2FBHA 3VA3A 4EJOA 3S2DJ 4DR1K 3LSGA 4BE2A 1B9FA 3BZ6A 4PQUA 3KEQA 2M3AA 4M45A 1FLIA 2F4OB 2I8DA 4JK7A 4CJRA 3A5LC 3L4IA 3QLHA 3M8RA 1V3FA 3H0GJ 3ASOH 4WFAL 2Q8KA 4XIUA 4PKGA 3AO2A 2E1CA 1MBKA 4XLHA 2DTUA 3GZ5A 1FXXA 1Z25A 1U47A 4L5IA 1MMNA 4F7ZA 3FWEA 4DTRA 1YS6A 1LEAA 4D5FA 3S3OA 5LMUK 2KZZA 1Z1DA 3SYZA 4O4GA 1DLOA 4CZEA 1IKWA 2A5YB 2IRFG 4DQ8A 1FY7A 2FSNA 4F3OA 1QNTA 1BQMA 3PQKA 1RBUA 2E36A 3WTXC 1V4TA 2G7UA 4U88A 5KPZA 2DCEA 3REOA 5HOOA 5L3CA 3PO3J 4A61A 3ZOBA 3HSFA 1EP4A 4RM3A 3IS9A 2CUFA 2IEKA 4FE7A 2HYFA 1I1SA 2E2NA 3L00A 5C3EJ 3LSHA 4DR2K 2X4HA 2KTQA 1EKEA 1GLNA 1DP3A 1N32K 1NK5A 4JX5A 1TKZA 3IKTA 4YOUA 4CFDA 3Q7CA 3C65A 1VSLA 2VJJA 1B72B 4JHDB 1HNWK 3WU2C 3SQ1A 3Q0UA 2PQ8A 4CECA 1TBXA 4B8XA 4EGZA 1S8NA 3O8GA 4DTSA 3HTVA 1WLJA 2E5LK 3VQEA 3O6WA 4KUMA 2Y0SA 2E2HJ 2KLOA 3QFPA 3MWPA 4DYRA 1BDGA 3M1EA 5C25A 3B8AX 2IBDA 4BAYA 5D5XB 2BYVE 5KRTA 2W42A 4ZDLA 3DRSA 3KCCA 4LB5A 1IRXA 3F0CA 4CHQA 4FM1A 2E2JJ 2E1MB 5L3GA 4QSHA 3QU3A 4BC2A 4WCEL 4M3FA 2X78A 3LM9A 4JNEA 1OPCA 4JI4K 3QP6A 1IG7A 5AJ3K 1XDUA 2EFNA 1D5AA 4XN3A 4L9JA 2ZE2A 2I7NA 5GIPA 1SD4A 3FISA 1HA8A 1DTQA 1W1WE 2HVSA 1RFQA 5EU7A 1WB9A 3G3ZA 4HHTA 1P92A 1XMAA 1NGGA 4J2BA 2IC3A 1B9NA 2K7LA 4OVLA 1X3MA 2K02A 5BOXA 2EB7A 4MNUA 2CH0A 4A69C 2XV4S 4YRVA 3SZGA 3TAQA 3UKRA 3I53A 1NH3A 4WQ4A 2BY0A 3KP5A 4RBOA 1Z7LA 1SVLA 2O3FA 5AZIB 2RN2A 4CW7B 1SAXA 4LFUA 4S04A 3QIOA 1ZYQA 2W25A 4CK1A 2ZGYA 4LD0A 4RWTA 1X19A 1MW7A 3DJCA 1WH7A 5E1XA 3QERA 1QA6A 5B8HA 3ZT4A 3K59A 4XK4A 2JWKA 5BNGA 3E0JB 3ERED 1R1TA 4FOIA 1Q9YA 1JT0A 2HPMA 3MX2A 3MZ8A 4IOXA 1QTMA 4AYBN 4FJNA 1R00A 3HRMA 3CF5F 2DW4A 1Y64A 5K14A 4L0YB 5ICFA 4KHUA 4G12A 1JKQC 4PJNA 1XNQK 2JVGA 3L2QA 3ABMH 2K3PA 2M4KA 2VOPA 4RB1A 3VOVA 5AQUA 3KWIA 3LDNA 3R9PA 4DV0K 5KGXA 4X66K 1BM9A 3HRTA 4E1MA 3V8LA 4JK9A 1Y8QB 4JD2B 4AILC 4FYDA 1NGEA 1GV2A 2OZUA 1S7AA 3AVAA 2KT0A 1HKQA 3HOZJ 3QOPA 3BJOA 2QXFA 3S16J 2FU4A 4V19K 3GG4A 3F8MA 2XVCA 2NVTJ 3MCPA 4DF4A 2VG6A 3PIOL 1J0RA 2O61A 1HR0K 3KWGA 5DYMA 2ZJRL 5HLHA 1CZAN 2FNPA 3HBTA 3G6EI 4CZLA 2VUMJ 4DU1A 2I5JA 2KQRA 4GMJB 3IWFA 1AA7A 3S3NA 3QAHA 2P0WA 4PUSA 1OVYA 3JW4A 3V1QA 3ZYYX 4XH4A 5J1RA 1TKTA 2OCEA 3D5RC 3M1CA 4BHPA 3Q7BA 4LH4A 4M7XA 4WCGA 3K70C 3DXMB 2PMZA 3K1NA 4CBUA 4DQQA 1BL3A 4NO7A 4MGRA 4YNQA 2R5YA 1XHZA 4HUGA 4RB2C 4CGHA 3K57A 1JLFA 2BXYA 3BPXA 2G9WA 4BR5A 4B3SK 2ZXWH 2OUMA 2P5OA 3PNYA 2ESHA 2RPIA 1UAAA 1IG8A 4BVOA 1HKTA 2I7PA 2RC4A 4BBRJ 2IJLA 1DUXC 3HXLA 4XORA 4D5CA 2HF3A 4OO1J 4KT6A 5CJ9A 1RRJA 1L3VA 2O9LA 2E1ZA 3R60A 1NJIO 3FMQA 4I0AA 2WAEA 4KB1A 2B6AA 1EH7A 3KP2A 4AWXB 2X6XA 2W00A 3P9CA 1BU6O 1C0UA 4EFHA 2Q2EB 4IZZA 3A0BC 2XGEA 1VRUA 4DV1K 5E41A 1BA5A 1WBBA 5J2MA 1HW1A 5LEJA 3FXLA 3ZETA 1TT0A 5C2DA 4LFCK 3ZQIA 2DA7A 2FSWA 3H3ZA 4PKHA 5GADJ 3E66A 1WJBA 2YNIA 2HTSA 4WXHA 1RT1A 1UA0A 4NC8A 4BGBA 4FJ7A 4Q47A 1N6QA 3DTEA 1KAYA 3QP5A 5F64A 3K9JA 3AGKA 3D2EA 3EUHA 1WCMJ 2NAZA 5HRRA 4KFBA 2QYOA 4CZMA 4KHPK 4IOAL 4OGCA 1H9GA 3KK2A 3T1BA 1JCFA 1IN6A 3HPHA 3KETA 4W1UA 2ZNYA 4IDHA 3BTJA 4CF2A 3VQ5A 3MN6A 3P5JA 2HNDA 4C9YA 2CQKA 4DQ2A 4CYDA 1CXUA 1ESVA 3T19A 5E3NA 1QZEA 1RBTA 1E17A 2K27A 1YJNN 4CHNA 3V8JA 1NG9A 1BIBA 4BEHA 1QQCA 1SD6A 1SD7A 4A12A 1WJFA 4O8UA 3OOUA 3CUQA 2H3GX 4UUSB 3AVJA 4JKAA 4IHSA 5CYMA 1Q18A 4IQ4A 2GXGA 4RMNA 3V42A 4CF9A 3OHRA 2Y0MA 4BQQA 1V55H 2NLXA 4G9YA 1TAUA 4CYCA 3OIOA 2HDWA 4F9OA 2F9WA 1W4MA 1D5YA 4OLBA 2V1XA 1J59A 3PY8A 1GLFO 5JLXA 4XRFA 4XRSG 1RDWX 3KK7A 1XTAA 3ZX2A 3RPUD 1T95A 3M4OJ 2O8CB 4NQWA 4B9SA 1T98A 5BR8K 3RPQA 3H9JA 4C1NK 2F2EA 1JCGA 5TRDA 1ZBFA 4XL9A 3H1QA 5FPNA 4DV4K 3JREA 4ESJA 3K5OA 3ECHA 4QS8A 3WNHA 4M9XA 1DU0A 1CXQA 1D0XA 5A2QK 1IRFA 3THXB 4BRMA 3HJFA 4LMYA 1REPC 2Y1JA 4HNUA 3PL8A 1KFSA 1MNDA 4XMYA 3SQ0A 2Z2SB 2L7ZA 3IUOA 2V52B 1Q82O 3LP0A 5J1YA 1Q81O 1SKSA 3G71I 3EEQA 4DB3A 3GYHX 1CZBA 4DR6K 4W97A 4OPAA 4KTWA 2GA2A 3F9KA 5E26A 1G3WA 4MHGA 2X9DA 1EX4A 4BREA 2Z1JA 4FPAA 4A62A 3Q9SA 1ZK8A 4AUXA 2NNWA 3M7GA 1VQKI 4HVJA 2CFOA 3ZXSA 4FISA 4YFKF 5J2NA 1VQ5N 4IPAA 4IF4A 4BDPA 3OBWA 2WAQA 4F3TA 3OL4A 4B9TA 3QEPA 3M8PA 1FPQA 3OY9A 2XAJA 3NH0A 5LD2C 2XY8A 1SL2A 2Z1GA 3ZLJA 4BGDA 3MXMA 2X6YA 3TO7A 3K1MA 2O8BB 5LLQA 4B3AA 2NUBA 3DXJF 5ILUA 3MECA 2QW9A 5M5WJ 4LB6B 5D8KB 1C1CA 4XBFA 5AQOA 3G4SN 5C4XJ 3O6BB 3QEWA 3QPHA 1ZN2A 5HP1A 3IL2A 2L9VA 1CLQA 2VKEA 3DCFA 5LJVA 3MAQA 1PUFA 3CTAA 3SBTA 2JPCA 3VSLA 2Y75A 3CCSI 5GAHP 3N05A 2MC4A 3NQOA 3F5TA 1PVEA 1KC8O 3CC2I 4M3ZA 1W7PB 4DQPA 3VERA 4WFNL 4HV6A 3ID8A 2XF6A 2CQQA 5BR9A 5CLSA 4L9TA 3OS2A 1JLEA 3AO3A 2YCHA 4FJ9A 3IH3A 1FOXA 4XKVA 1R23A 2V4JC 3PUFA 1ASVA 1ZBUA 3G1MA 2IXSA 1LFBA 3WE3A 4CA0A 2COBA 3IFRA 1E3PA 3W3CA 5M3FJ 4CJTA 3CJQB 5GTIC 3FK6A 4ILJA 1FP1D 2WB1N 5FPMA 4BNCA 4FXDA 3BCBA 3TW7A 1LEBA 4C8LA 5LJWA 4FM2A 3RMBA 2CU7A 3BZKA 5JVHL 4E4HA 1V5FA 2JUCA 3EPZA 4UUTA 1Q86O 2YKNA 4OINF 3QWLA 1YIJI 3JXUA 5FFXA 1NBWA 4YEJA 2YKMA 2JRMA 5MLCQ 1VSHA 3C6HA 4IDKA 3BC8A 5JHUA 4NCAA 2HNZA 5A2QZ 2IOCA 4WQ5A 1R1VA 5L3DA 3I0RA 1T39A 5FLMJ 3PO2J 3V9UA 4NLBA 3GMEA 3E6BA 2PI0A 2DDAA 4H0TB 5IP7J 3M8SA 3NMUA 1XC9A 2AJQA 3RKXA 3UE5A 3JAMZ 1HJOA 1LQ1A 4JI7K 4CHUA 2V6EA 3BEXA 3JTGA 1TWAJ 2Z3YA 4EZ6A 1DP7P 1I50J 4NXMK 2P1JA 3AVLA 2E2QA 3O3GA 2HKXA 2G8WA 4FWQA 3THYB 3RRGA 5I3UA 3RTVA 2JA7J 5K7HA 1PP7U 1ZLKA 2VQLA 5JMVA 4YG2F 3OJUA 4I09A 4RB0A 2QQAA 2XSJC 2DA1A 1RDCA 4CZZA 2B0LA 2DOEA 1E3HA 2RQPA 5GAGP 4PJMA 4I01A 5AQLA 3Q0WA 1H89C 3H46O 3CPEA 1MBGA 2VKDA 2F5DA 3OSFA 3TBIA 3TABA 3WTZA 4DYCA 5L3BA 1V4SA 4LF8K 4OU0A 4G9ZA 1AHDP 2ZNZA 1U2VA 2F8TA 1FBUA 2I10A 3O1BA 1HOMA 1VQ9I 1FJGK 5DCFA 2QA4I 4DWIA 4XLFA 2P9PB 4DW6A 4FSVA 1Z6RA 2LY9A 4A57A 1RBVA 1JKHA 2YX4A 4GVMA 1D1AA 4Y0WA 1WAFA 5E3LA 2IA1A 3LMMA 5CY4A 5K7ZA 3P7NA 2E19A 1HKCA 4BC5A 3HM5A 3RMAA 4N5SA 5KPTA 4EJVA 3M9AA 2H94A 1VQ7N 4M3WA 1S1WA 4EJWA 2UYTA 2CW0F 1TYQB 5LL6Z 1S29A 3ALYA 5SZTA 1YRNA 3VEPA 3AVFA 2WOMA 3P9IA 1UHSA 3QB0A 1W7PD 3F23A 4DUYK 3TOBA 1NGJA 5JLFA 1W97L 1F43A 2XAUA 1YYVA 3BG7A 4XEIA 4K8XA 1SQKA 1I27A 2GTDA 2P81A 2X1CA 5EGOB 3JRAA 2RE2A 3GFIA 2KJBA 5ICGA 1Z26A 3KLGA 5ADXH 3BTLA 3E6MA 4ELUA 1AKHB 1F21A 3C7NA 1NWKA 4FJXA 3CETA 2Y31A 2UUAK 2E2PA 1RTJA 3RYPA 1JXBA 4JRPA 1UZCA 1FTZA 5J6XA 2DOAA 3PNVA 1HKGA 3AA3A 4I6MB 2J4RA 3N97A 5GAHJ 5EG0A 1MMAA 4IHTA 1OMIA 2BTFA 2R7RA 4ID5A 3C0BA 4ICLA 4XH1A 2PMZN 3SZPA 3O9TA 2IAJA 1S5LC 1FSEA 2HOEA 4LIVA 2HGCA 3W2WA 2P9UA 3TSPA 2O6GE 1Y0UA 1R71A 3LA3A 3PFYA 5IOZA 3B6PA 3IAYA 4CFAA 4CSWA 5KNLA 3FZVA 4BE0A 2A6EF 2DO7A 4RA2A 3LDQA 3V6DA 1VQ8N 3PV8A 3CQZJ 4LG0A 2QENA 4BR2A 3SDBA 1U8RA 3HDDA 2NVQJ 3MKYB 3CF5L 3VMFB 2A5WA 2A3ZA 2XIGA 2L9NA 3W6JB 2IS4A 3SDGA 1VQMN 5ILVA 4B9UA 3OYCA 1U78A 3S1NJ 1WPKA 1UFMA 3EKUA 3AVMA 1X58A 2VQHA 2OPSA 2YHAA 4QS9A 2RREA 3HOSA 3VEYA 2JGUA 4J19A 2ZB9A 1SFUA 3IH2A 3HB9A 4FWNA 2FSKA 2EQRA 2LREA 5AQIA 3BTIA 3LNQA 3QEVA 1K4TA 3HPGA 2W84A 5DV5A 4Y3OA 2V79A 3F8FA 3GFMA 4A3DJ 4IO8A 1LE8B 2GBYA 4L3QA 4AM6A 3J7AP 2ME0A 3H36A 1IXRC 4W5RA 4I99C 3ZT0A 1R0AA 3HRUA 2UXXA 1ZRFA 3HSRA 4K2EA 1HCRA 3CG7A 2TDXA 2JSPA 3PO4A 3LFUA 2QA4N 2WBNA 4FLZA 2CV1A 3CCQN 3FLCO 2HHHK 1QVFM 3ZMDA 3VEWA 2ZMEC 2PJRA 3WNEA 1T6DA 1G99A 4K41A 4KREA 3LAMA 4HCBA 3I55I 3FBIB 4DTMA 1YX5A 1EO1A 6PAXA 1NNEA 3PX4A 4KN7X 2QWRA 5D3GA 2VXDA 1KRPA 4GV6A 3CCVI 4UVBA 4DR4K 1MMDA 1LW2A 2JWLA 2OZMA 1OCCH 1BHLA 2WA0A 1SUQA 5AFUH 1VQLI 4A3GJ 2HQNA 3L2RA 2F4IA 4E19A 2B7EA 3H1CA 2L7FP 3HP6A 5E79C 3S32A 1NTCA 1OYYA 2NRRA 1BBYA 3FIWA 2ZO4A 4FE4A 1K8KA 4KICA 2HQAA 1OYWA 2HU9A 5IPAA 1ZTRA 2M4GA 3I4NJ 3ZT3A 5A2QO 5HLFA 2ZXHA 3PX6A 2ZXJA 2K85A 4X62K 3EUKL 3RYRA 2JA5J 4DZJA 1MSFC 1ODDA 1RNHA 5DTDA 5J4YA 1WSIA 2BE2A 2K86A 2JUGA 3JAMO 1IJWC 3G25A 4BVPA 3JSOA 2OF7A 2FBYA 2HFHA 3IAS2 3A5OC 1Y0NA 3D1NI 4QPQA 2P9KB 4IEJA 4C2TA 4Y1CA 3ABUA 2XROA 4Q48A 3QNOA 1FP2A 1X2MA 4DTPA 2MLGA 3LQQA 2DJNA 1YVUA 1RILA 2CG4A 2VBYA 1PDNC 4M3UA 1IV6A 4NCGA 1R9TJ 1AWCA 1J7KA 1TQIA 1DPUA 2XGXA 3ZSZA 5AQRA 4B9VA 2QI2A 4X0GA 5D4SA 1PUEE 5C2FA 4IBNA 4R8HA 4GFBA 5AQJA 3A01B 1Z05A 1VRTA 1D0ZA 1K6OA 2GQQA 3HI0A 2PG4A 4HWIA 3OYNA 3KLIA 4AIHA 1MIJA 2A1SA 2YHXA 2HDDA 4Y33A 4QLCU 1JL2A 3LZIA 2E2IJ 3NF7A 1LUJB 1IAWA 5KHDA 2CW8A 2V9PA 4BQNA 2CSOA 1YW9A 1EA3A 3SMSA 1N34K 2NS8A 4B48A 3ULEA 3LOCA 3RR7A 3LALA 1PJRA 3CESA 3CC4N 1HSJA 4FTHA 3LA7A 4BRGA 1ASWA 2FBXA 3F8CA 1K6YA 2IS3A 3I56N 2W24A 4FK0A 3MEDA 4BG9A 3VEVA 3LDLA 3CMYA 3CJTB 5IP9J 3GTLJ 2Y1IA 3VGLA 3QPTA 5ICCA 3I5UA 3ZT2A 5CZ2A 4B8CA 3HRSA 3LQRA 4A0YA 2B63J 3SZTA 1KGSA 5M3MJ 1NK9A 1FNNA 1B92A 3P39A 4GXOA 4CCHA 2G8HA 4J8FA 4YIFA 2IVPA 1J75A 4CCJA 1LPQA 4NCBA 4GV3A 4A0ZA 5AQYA 1BWFO 2DA3A 3I55N 2BVMA 1BO5O 4CJFA 2R7QA 3CJ7A 2Y69H 3MVPA 1YI2N 5HL7L 3C6TA 5AQMA 5TKWA 1XMKA 2ASOA 1WSHA 3VEOA 4AHRA 2CV2A 4NB5A 1XGMA 2OZSA 1ETKA 1TC3C 4RTFD 4CGDA 1S6PA 1VSEA 1LKXA 1R5ID 2HQRA 2HNYA 1Z9CA 1WVRA 1IO2A 4R5PA 1G6NA 4CJPA 1Y39A 3TO6A 3R61A 2CYYA 2LMDA 4M3TA 1W2BM 2QCOA 1ATRA 2WADA 2E1OA 4LH5A 4CF1A 1Y8RB 2F5EA 2BUPA 4RAGA 3RRHA 5KTQA 2M34A 3K0LA 1WJEA 5DD4A 4FOEA 1UG2A 4I76A 4UVCA 4FW2A 3AKZA 1YFHA 4PCQA 1F1ZA 2ADUA 1WHUA 1J6ZA 1JUMA 3SYTA 5FLXZ 4EJTA 3NAEA 5H2FC 1TVRA 3VF6A 1QVGM 1JLGA 4H5RA 3IRRA 2HMPA 1BIUA 3QRFF 4RW8A 4E1JA 4AHVA 3T7ZA 4ITVA 2K5CA 2BZTA 1SAZA 4CESA 2O8DB 1BA0A 4ETSA 2XB5A 4DFMA 3U8XA 2NS7A 4DU4A 2H1LA 3LA2A 1T44A 3S14J 1DT9A 4PJJA 4G6DA 5H1SQ 2A61A 1KD1O 3C2HA 4JX6A 1KYZA 2GV9A 4LD5A 4G94A 1J5EK 2NZTA 1DGWY 1L3TA 1RUNA 3CCLN 2ITMA 1FYMA 1U6GA 3KD1E 3WTTC 3TSUA 4H0OA 2EPFA 3IC7A 4HG2A 4JI5K 2WV0A 4QWQA 1ZBHA 1IKXA 5TKYA 2Q0OA 4B44A 1FYLA 3PIPF 5IYBJ 3CCUN 1HLVA 1JGSA 1UHWA 3DAWA 3SUOA 1NKBA 4WE1A 2EFWA 1OCPA 4AD9A 2UZKA 1NG7A 1AU7A 1R7JA 1TL3A 4Y13A 1NK3P 5ADXA 1ACIA 2YJFA 3H0DA 1TNSA 4LJZF 1R5HA 2JA2A 3SJJA 4NB4A 2BY2A 5J47A 1TYQA 3Q9VA 3H08A 2BW3B 5EEHA 4IOCL 3VYUB 3HOXJ 1W0UA 3C6UA 2UXNA 2GX9A 4CF0A 1XG1A 4IQJA 4GYIA 3O3HA 1TP4A 2LF7A 4G1QA 2EIKH 1GLLO 4CEFA 4CCNA 3GXOA 3VYSB 4CUGA 5F1JA 2XDVA 3GFJA 1AKHA 2M0CA 4DFJA 1NKCA 1HW2A 5AQSA 2BANA 1ETQA 1GLJO 5GPCA 1UJ8A 4ZZLA 1WSFA 3CJNA 5AQXA 2P9IA 3PFIA 2B4JA 3V1OA 4W5QA 2P6SA 2P9LB 1HYVA 1SV5A 9ANTA 3R0AA 3VODA 2QM1A 2V1DA 4OKJA 4JV5K 3K5LA 2EA2A 1G59A 1ITGA 2YUSA 4BXFA 3GZ6A 1NM1A 4KITB 3RKWA 2YU3A 5IT9K 1I39A 3A8YA 4CVNE 1FIAA 2LFBA 5F27A 4FCYA 1OVQA 3L2CA 3EE9A 3RSEB 3OYAA 4IJNA 5FJ8J 4KPYA 2VT3A 3LPTA 1ON2A 2H8RA 4EJUA 3PO5A 3N4MA 4AH9A 4CIEA 1LAWA 3EN9A 1TKXA 4LK1F 5TGTA 3SV3A 3SQNA 3KD5E 3NF9A 3DF8A 1YTUA 3H3VK 2F96A 4H03B 4LFAK 2IDOA 2RQQA 3EE8A 1ETXA 3SAGA 1E4FT 3NH1A 2NRXA 2OAZA 4N41A 2W41A 1RUOA 1MWKA 4F2SA 3HUGB 4KT5C 3L0QA 3ASMA 1JGGA 1SZ2A 2DMPA 1ZQ3P 5M1PA 2M7BA 3SI6A 2E1MC 2CMPA 5B1BH 1MSEC 4KFCA 1UWBA 2FBIA 1JKPC 1YVNA 3G1OA 4KHNA 5LEKA 2YV0X 4PGHA 2HHWA 5IT3A 4O44A 3A1YA 4BRHA 3H3OB 4Q5VA 4CE9A 5KPRA 2EV0A 3WGGA 2DT5A 1TL1A 4Y15A 4CEQA 3MN5A 3LWFA 1S72I 3BY6A 2DN0A 1X3UA 2ID3A 2XY6A 2CS3A 1VQNN 3OOPA 3CFOA 4H0XB 1Z3YA 5BRHA 4G8XA 3CCEI 2V7YA 4XLCA 3T8RA 3J7YP 3E1SA 4LLLA 4BQZA 4B9NA 4WFBL 3MAJA 3ZT1A 2A6TA 2R5ZA 1POGA 1DU6A 3CCRI 1ZGAA 2LBFB 3J8AA 1IRGA 2Y30A 5AFUA 1X1DA 2HZDA 3VTIA 3AAPA 4D9JA 3TU5A 3AVGA 1U48A 2UUCK 2F8SA 5ILSA 4OAZA 3CQXA 1QZ5A 3FZHA 4IXAA 4YFXF 3CMAI 3N4QA 4BS9A 1SANA 3MDQA 3GBTA 1HUXA 4E7ZA 1RDBA 1RC9A 2MBFA 2ZWHA 3H35A 2OPQA 5EDNA 1G15A 4FVMA 5AQKA 1VQ6N 1SFKA 3NWTA 3WNFA 4NLCA 2FA5A 4CJ7A 2ASPA 3T1AA 1WNSA 4BRIA 4IOAF 4IEIA 3QQAA 2O5RA 3CMEN 3BG3A 3HOUJ 1MBHA 4A3MJ 5HS8A 4V2GA 1N5YA 2XGDA 5E84A 2XAFA 4U0WA 5FB2A 2OD5A 2YHBA 4NC7A 3ZQFA 2NNYA 3CQYA 3VGKA 2BHYA 2LY2A 2XAQA 3QESA 1MJBA 2XKPA 3VF4A 3ATVA 1NGAA 2QKMB 5IT9Z 4GY2B 2O8FB 1NK0A 4J2AA 4DV6K 3HL8A 4MQ3A 5HRNA 4FZZA 4FQGA 4FO0A 1I3QJ 3A0IX 2R3SA 3CC7N 5LGTA 2KIFA 3VOEA 2VXZA 3U9DA 1FX7A 2H6BA 1OCTC 1YS7A 4LLNA 3LDOA 3V7CA 5D6FA 1KFDA 5FLXO 1Q1VA 4R1HA 2GM4A 1R6RA 5J8CA 2F5VA 2XB0X 4ZDOA 4A5BA 4J2EA 4C2UA 2RAEA 4KHQA 3U9ZA 1C1AA 3NH2A 2HOTA 1YITN 5KAFC 1QSSA 2V1NA 2GZWA 2EK5A 1CQTA 3VESA 2LKPA 3ZRGA 4H0EA 2V9KA 3L6QA 1UG0A 2M8GX 4ENKA 4L5EA 1JE8A 3K4MA 4UV8A 3ZGKA 3FXMA 5GPAA 2ID6A 2PLYA 2F6CA 5JI6A 3SEZA 3U1KA 4A93J 2DMNA 4FW1A 1Q7YO 2X74A 3I9V2 3A02A 1XSXA 3UKUA 2YHWA 1QZYA 3KHYA 2DOFA 4HEA2 3VPZA 3TEDA 5C4JJ 1GOCA 4Z6YA 3THWB 4F92B 3I59A 1NOYA 1Y6IA 3DYAA 1VQON 2XRLA 3I8BA 3KZBA 2PMHA 1W5TA 1IRZA 2DA6A 4YIRX 2R0QC 4PJLA 3AV9A 2YI1A 4M72A 4B47A 1LAVA 1BCOA 3E6CC 3WU0A 2A42A 2GIVA 5AQGA 5JICA 4CIFA 1W0TA 4JN4A 5AZJB 4DQRA 3CCJN 2Q0RA 1RKTA 1IJJA 3M3YJ 4CGFA 4DLGA 1VQPN 2FUG2 3SUPA 3WUHA 2VBXA 3F73A 2GBZA 2XPWA 4YELA 4RM2A 2KMUA 5KCMA 1OH6A 2QEXN 4Y52J 3H3NO 4NUBA 1BG3A 1X9JA 3WGIA 4B9LA 5L3EA 2XHBA 2M30A 4EV0A 4FASD 3JRDA 3ZQGA 5HDNA 3T5XA 3W2AA 5BN9A 2KDOA 1A36A 3DRPA 2O8EB 1OR7C 4DTXA 3SLCA 3W6VA 4KH5A 3FZMA 1BJZA 2AXLA 3V9WA 3WTYC 5DCMA 1L3UA 3BR0A 1T33A 1T05A 1RT5A 1HNXK 2J5OA 3LSMA 5DK5A 4M7YA 2Q1NA 1U5TC 2QTDA 2DPDA 3CCMI 1REVA 1TGOA 5CVJA 2A69F 3OYMA 2D0CA 4JS4A 4AHCA 3VB2A 2P5GA 3S9HA 1TWCJ 3MKWB 5J3LA 4N56A 4AVZA 1S9GA 5D6EA 3V9ZA 2Y9ZA 3K69A 3ZQLA 3MCZA 1B4AA 2BXZA 1T8IA 3S2HJ 1MA9B 4Z4HA 4CJKA 2G8KA 3TTCA 3O2PE 2JK3A 3ZMVA 1TK5A 4ZTFA 5HBMA 5HLIA 1W9HA 2FNAA 3K4BA 1PP8F 4L0ZB 3ZSWA 3DKWA 4XLNF 3DM2A 4GRIA 5KK1A 3WEEB 2CGLA 2EBIA 1IDYA 1NK2P 3CMMA 3FK7A 3VQBA 2L4AA 4BRNA 1RZ4A 3QPSA 4F3QA 3GCMA 3PSIA 3CD6I 4RS8A 3UKGA 3LAKA 3VPRA 4HDUA 1JLBA 4M3DA 2YHYA 3L09A 3UNGC 2R7YA 3L4QA 4GKJK 3A4CA 2AHQA 4GKKK 2STWA 1Z3XA 4H5NA 3LAJA 2DI3A 2P9NA 2F48A 3P31A 4KA4A 3MEGA 4BRPA 2L5QA 3DBRB 3S1QJ 4JKGB 4E89A 1QPIA 2EZLA 3TI0A 5ICEA 3QEIA 2O8DA 4CFBA 1UA1A 4BUPA 2LTPA 3I71A 2X6WA 3DTIA 4XM3A 3H92A 3JRFA 2ZC2A 3S93A 5C0YA 5AQFA 3VYRB 1I5ZA 5CZ1A 2QM3A 3SUNA 4JLHA 4GVEA 3SQ4A 4OX9K 3HGGA 3DLBA 3R6MA 2P6TA 3C1DA 2H09A 4CEOA 1UB9A 2HBKA 2CQXA 1MDMB 4HSTA 1ERDA 3HTSB 2UXDK 3ROUA 2EV5A 3OS1A 2PAVA 1ASUA 3M07A 2E6LA 1YE9A 4FWSA 3Q0VA 1TQMA 3TR8A 4DSJA 1OFCX 1FOYA 2OCCH 2OTLN 1S9EA 2CRGA 4YHHK 5J2PA 2NOGA 4CZCA 4YFUA 2KFDA 1KONA 2HF4A 2K3FA 3ZQQA 2LH9A 3ENHA 2E7WA 5F6FA 4C3HJ 1X1AA 1CF7A 2HSTA 5FO5A 2P5LC 2OC6A 4RAFA 1YQAA 4M42A 4CDGA 1U04A 3ECOA 5EXWA 2BW3A 1HKSA 2Z1HA 1LDDA 3U1DA 4DLEA 2DYSH 2VYPA 3HKZA 1ZG3A 4XN0A 2AXTC 2LYCA 3AFHA 1OKRA 4OIOF 2MABA 2Z5UA 2FXUA 3HOVJ 5M1QA 3SBGA 3ZR8X 4E7HA 1EF4A 3HVTA 1VSDA 2KLAA 2NRZA 5EX5A 3M8JA 2QVOA 2QSHX 4DOZA 3I8DA 4KRFA 2YR2A 1XPXA 1DPRA 2WB1A 3SFZA 4P9FA 2XRNA 1X9MA 3PUBA 3L2WA 5E8IA 2DFFA 3BP8A 3DBLB 2HWVA 3KP4A 1N78A 4LF7K 5IT9O 4RAYA 4N9IA 5FKNA 1HQUA 3IH4A 1BW5A 4KDPA 2UWMA 3LFKA 2NRHA 4HOBA 4G7OF 3WU1B 1XB4A 4AVPA 3S8PA 4ZYDA 3OS0A 1GOAA 3EYIA 1S3JA 3IRXA 3RMCA 3ONQA 3GW2A 3FMSA 1RR8C 4U7BA 5M1NA 1NGHA 3FGUA 2VOOA 3KLHA 4DMNA 4AC0A 3HPOA 1E2XA 3FHNA 1GHCA 1MBEA 4XOPA 2XAHA 3ZPLA 2DMUA 3V7RA 2YU9J 2OTJI 1K79A 1N77A 5HODA 1E0EA 2F7TA 5KRSA 4H5WA 4GDFA 1MJAA 1WBDA 1APLC 2F4MB 4BDYA 5GP9A 3F6VA 1IKVA 2HI3A 3D2FA 4FLXA 4TSXA 2QBYA 2P4WA 2DAOA 2Q1ZB 4E7SA 2HEOA 4BRAA 4HAMA 1B1BA 4KI4A 2X6NA 3FXQA 1S3XA 1HC8A 3AVIA 4KJZA 2DK8A 1ZH5A 1BIAA 5L3FA 1U9NA 4GGGA 3SAHA 5M1KA 1TW3A 1HNZK 3K4JA 2QKKA 2IGMA 3CJRB 3PIPL 4OMZA 4O8KA 3PQJA 4KB0A 4P55A 2KPMA 2ZMEA 1FOKA 4CEEA 4XLAA 2OJED 3HZ6A 4M63C 5BPMA 2PMUA 1ZG5A 2HOAA 4AU7A 1MDUB 5LRRA 3DEEA 2DBBA 2CUZA 1U9OA 2FE3A 4OJRA 4BE1A 2FBVA 2NVYJ 3AG3H 4DS5A 2VPLA 4X6AJ 3HZJA 1M90O 4M9ZA 4BRQA 2Y2ZA 2HXOA 1W36D 3DLKA 4H0VB 1OLTA 3WXKA 3RWUA 2VLAA 5GINA 3QODA 2B5JA 4M3XA 1GT0C 2R7TA 1BR1A 1P4AA 3F21A 1OYIA 2L4MA 1NK7A 2PBIA 2EA4A 2KHMA 3QMLA 2P7VB 3ZSQA 4MIMA 4CJSA 2L7KA 3SUQA 2HXIA 2LBFA 2M7AA 3M8EA 4PK4A 4N0BA 3OR2C 2D0BA 4B3MK 2LRDA 3B6AA 3TQNA 2O4GA 1D0YA 2VASA 5KGWA 4F52A 4CH7A 3BROA 4OKKA 2OPRA 4C8NA 5C15A 4LG3A 4CZGA 3DPTA 1GV5A 4RCHA 4XOTA 4PFOA 1IN7A 5ED4A 2K9NA 3RMDA 4AQYK 4D7NA 2PYLA 1NK6A 2EZHA 4HRIA 3VETA 2A07F 3DOLA 1R59O 3J81K 2RV8A 3MMVA 3I54A 2LNBA 1X1BA 3BOQA 3AG1H 4EZ9A 4HLXA 2GELA 4XKBA 4RG8A 3S1MJ 3ZSOA 2IP2A 1IKYA 4HX4A 3TAGA 5TJJA 2O7OA 1YJWI 1ZR4A 1USSA 5FRMA 3RIRA 1FYKA 1GLBG 1RPWA 5DMRA 3ZX3A 4WXCA 1Z6TA 1QRYA 2OV7A 3ZQ7A 3SXYA 1ATNA 4LC9B 3HJEA 2XHKA 3DI6A 2PY5A 2VQCA 1VQ4I 4IG0A 2KFNA 1RT3A 4E7KA 2W57A 2ZXIA 1MH3A 2JVHA 1VHXA 4HNTA 5IWAK 1J2XA 2CGPA 4FK2A 4B43A 3K4NA 4A5NA 2R7ZJ 2VGNA 5H6QA 3DXKB 3HSTB 2ZF5O 4DGWB 4ZZDA 4E7IA 4M41A 2X85A 1ETOA 2WUSA 1X4PA 4ZYHA 3WG9A 3VQ4A 3K7AJ 4MTDA 2RNGA 4N47A 4DTNA 3VQPA 1YJ9I 1IBLK 4FJHA 5CQEA 5IY5H 2JLEA 3ZEUA 5LHHA 3UKRB 2MG4A 5AQTA 3ASNH 2FC0A 4BRDA 4JKEA 1ZYRF 2EHGA 2D1VA 2L01A 4AHUA 2GUIA 1XWLA 3U4LA 2FX0A 3OYJA 4QS7A 4BR4A 1J5YA 1S1TA 2KKOA 1J9AA 1HX1A 4CO8A 2ETJA 1D9FA 1DGRM 2AP1A 4DTUA 4M3RA 5JFRA 4UY8I 4ISGA 4P96A 2LSNA 2E71A 4BQAA 4CJUA 2DQRA 3VQ6A 4JYKA 2HBLA 2KW4A 1H9TA 2X51A 2HHVA 4BQOA 1U5TB 4M3BA 4FJKA 2IGOA 3LDPA 4A3IJ 4BRFA 2L2OA 1EH8A 1SD5A 1QHAA 1DQUA 3J7ZI 5D5WB 4CJ3A 2HBJA 5K7FA 1WSEA 4ZYGA 1HW5A 1ZGJA 3KEYA 4FWRA 1W0HA 1X3NA 4CHYA 2ICWG 3EYZA 3O4WA 3EQLF 4PSXA 1S1UA 2ASMA 1IBMK 3BQZA 1IUYA 4MQVA 1Z67A 1X1CA 5F0XA 1SMTA 1ZHFA 4PGGA 4UVAA 4PL7A 4YOYA 1HF0A 4FHTA 1X9WA 2IGNA 1YHQI 4BWMA 4KIBA 3AVKA 3HXMA 3GF2A 2HHXA 1TWGJ 4P9UA 3F6OA 2BY3A 2VJ4A 1YXQA 1QVUA 1VSMA 3NEUA 2M0MA 1BOAA 4BC4A 3J81Z 1IUFA 2CH5A 4YOXA 3CYMA 1Z21A 3KKRA 2Q36A 3RSNA 4BGAA 4AM7A 1IXCA 2E2OA 2CJJA 3LSTA 3HRGA 3LANA 1WJDA 4A3CJ 2D0AA 1MBFA 4U87A 4FLTA 1IH7A 2O0YA 4HQMA 3FXRA 3L3VA 1HLUA 2ZJQL 5FKOA 3KK1A 3GLLA 2BDPA 5LFAA 3W2VA 3HIFA 3G6EN 1LDJA 3WEEA 2K40A 2HOSA 4XONA 5JR3A 2VIXA 3CM5A 1EWQA 2VONA 4B09A 1SAUA 3DLAA 4JKHA 2L9SA 5I42A 2D2WA 4AHSA 2R5YB 2R7XA 1EWRA 2ZFWA 1LB2A 1X9SA 3OMYA 5FDLA 2FXAA 4DSLA 1J09A 2HNHA 4BXUA 2UUBK 2ISZA 3M8FA 5LRSA 4O0JA 3O5BA 2E5ZA 2VC0A 3TTDA 4O0IA 4RGXA 4EM0B 2W6KA 1XCBA 1YW8A 4OIPF 3O9SA 2PFUA 4EP5A 5F08A 2MFZA 2ZGZA 3FFKB 5IP6A 2ATQA 1O13A 2XY5A 3LSKA 3KPHA 1V54H 1YLFA 2ME6A 3QFUA 1XC5A 1HPMA 5DD8A 1KVCA 4I7FA 1H88C 4KN4X 3T8TA 4IFEA 2FEZA 2A6AA 1P9QC 2QGUA 3KP7A 2GWKA 4DNCA 1K73O 3E9OA 3SK3A 4IKFA 1D4XA 3MXIA 2Q3SA 3H5RA 3DQVC 4DF8A 2O4IA 2KP6A 4CERA 3RZOJ 5AQWA 2DDBA 1JJ8C 5EY4A 3ZETB 4CBWA 1LNWA 2DMTA 4H0YB 2X6SA 2WY7Q 1MDMA 1QPMA 4O5FA 1R49A 3HYFA 3BR5A 2E7XA 1YF5L 4Z4IA 2EFPA 1N8RO 3F2KA 2E88A 2YS9A 4BHCA 2VWJA 1QBJA 3B6OA 4L9VA 4CHOA 5E1ZB 3TAPA 1BI3A 3ELKA 5KVRA 1NGDA 2F5CA 4S05A 4DSEA 1XMXA 4FWLA 1QZ6A 2W48A 2KZVA 1TV6A 3D2EB 4X64K 4MO7A 1G3SA 3ZCMA 3CERA 1D8JA 3ABLH 2D45A 2MH9A 4KAZA 3GO5A 4LY7A 5H20A 3K2ZA 4DBQA 3VEXA 3JR9A 1T0FC 1HRHA 3MWMA 2XO7A 5BMZA 4CJVA 2LOOA 2GUPA 3AL0B 1BN5A 1P8ZA 2F4VK 5AQVA 1VTNC 2QQBA 2V1UA 1G3YA 5B5EC 3E3VA 1JI8A 3L9FA 4BEHB 3EL2A 4XR6A 3HG9A 3LZJA 3WXMB 2FOWA 5TISC 3IKMA 1QHTA 4EGYA 1RT7A 2D5RA 5CQGA 3LSJA 3GL1A 1B72A 4JHDA 2IGIA 4BRLA 3E5XA 4HSRA 2R7UA 4A3JJ 3IWZA 4IRHA 1O3SA 3D0SA 3CUQB 3HKZN 4DFKA 4LK0F 5HLGA 1XD7A 2GOXB 2OQGA 1V5GA 3Q5FA 3NBPA 5AQZA 1VZ0A 1O3RA 3HOYJ 1IDZA 3MWTA 2Z1IA 1JLAA 4JI8K 2X1EA 3OYEA 2Q0UA 2Q97A 1TUYA 2FMLA 1IF1A 4CJLA 1BJAA 3CPWM 2IVMA 4PWDA 4IOCF 5E1WA 1TZLA 3FXUA 4NQWB 1K61A 5M1OA 1MD0A 2ZFUA 3C6AA 4LGWA 1WRJA 3HBLA 3T1HK 1RI7A 2WTEA 2QWQA 3PM1A 5JVGF 3M5RA 3TL4X 3JYTA 1YW7A 2DA5A 1KCFA 3KX2A 4CGGA 4JKDA 1SKWA 2NVUB 3JSPA 3OIPA 3DKYA 3QDKA 3HL2A 3OYLA 1KZHA 5D4RA 2ISYA 4ON0A 1VAZA 2QWPA 5F2RA 1KAZA 5HS7A 4NHJA 2IVOA 3Q3SA 3LM2A 4Q0BA 4MLEA 2W40A 3KEOA 4CBXA 5AZIA 1J9IA 3MX5A 4HLYA 5CVVA 4F8RA 5BQTA 4RB3C 1LCUA 3I0SA 3ZSYA 1X2NA 2V51B 2QKLB 4GNIA 3QU6A 3GBGA 3G71N 3WODF 5BPNA 4L18B 2XPVA 1YOVB 2DFEA 1BIZA 2VKVA 4HQEA 1YG2A 4UQGA 5F04A 2Z9OA 1VQKN 2JN6A 4NXNK 4IO9F 4BR0A 3WXIA 5E3OA 1KAXA 2VQFK 1XCVA 3VFZA 2CQNA 1FJLA 3GTOJ 1NGFA 3BG6A 4KYWA 3DLGA 4OPJA 2VBWA 3DU5A 2V6CA 3W6KB 1N75A 4O5BA 1C0GA 1F9NA 2P5VA 1XSDA 3ZSXA 5HRPA 4PUOA 1M1KO 1K4SA 4JD2A 2R93J 1U45A 4DUZK 3U3YA 1KSPA 1ZBIA 1WQ2A 1PUFB 1KLMA 2L02A 4IEEA 2P7CB 1Y1VJ 1JHHA 2NNNA 2HR3A 3DEUA 3OYKA 1Z91A 5E17F 1IV8A 2RKIA 1UELB 3J81O 3CM6A 1FWZA 3RQ4A 1KVBA 1LV5A 4P5OA 3CCSN 1VK0A 2OANA 2K9MA 5E18F 2OPPA 2P51A 2V7ZA 4AF1A 4B1WB 3TAEA 3BR1A 2UUZA 4BC3A 2QWOA 1R22A 4O6JA 1F5TA 3CC2N 5BRDA 2JZYA 3RPUA 2EX3A 3I33A 1XGNA 4IJAA 3KYCB 2W85A 1RR7A 4CGIA 4WXDA 1N25A 2COMA 2DJIA 2DTZA 1FEXA 2JTVA 3FZFA 1D8KA 5GADP 2A05A 2FMYA 3DXMA 1A5XA 1RDAA 4FT8A 4LF9K 4XNFA 2W4SA 4CJ5A 4XLEA 3RKYA 2RHKA 1SFXA 3SJMA 5BPDA 1XSVA 3K0SA 1T7PA 4ELVA 5CYVA 3TW6A 4H5VA 5DDGA 4Z4GA 4CEBA 1FSHA 1WSGA 3DXKA 4YOTA 4CK3A 4FLVA 3R0JA 1YIJN 4FWOA 4JKFA 3DTKA 1DKGD 3AO1A 5CHIA 3ML6A 4I98B 4B8AB 1OH5A 3OVNA 4M3YA 3C94A 4E1NA 4A3LJ 3OSGA 2KRCA 2QLZA 3CQ8A 5FD6A 1QSYA 3MEXA 4FX4A 2Q2EA 2QZ8A 2PFBA 3SJHA 1SC7A 3CUOA 3VQAA 2DODA 5KAIC 2LDUA 1VSKA 1BCMA 2D0OA 5F1XA 1JLQA 4CEZA 4JRQA 4GO1A 4XKWA 1I6HJ 2HHTA 3CLOA 1VI0A 2FJ1A 4D7MA 3GUDA 2YSRA 3BG9A 5B3SH 1U4BA 1OR7A 3BTCA 4YIIA 2HTJA 3WHBA 4ILGB 2L9RA 4QIWN 3H6EA 1KU2A 1I6XA 2E8AA 1SEUA 2A5XA 3S3MA 3DWLE 3AG2H 3HSCA 4RLFA 3AGRA 2DU9A 2EV6A 5EEAA 1U5TA 2V9VA 3KZZA 5DM7F 4O5VA 4K43A 4MDBA 4CEDA 3RKQA 2STTA 3GTKJ 4FVUA 3VQ8A 5K5QA 1U3EM 1SL0A 1QE1A 3D5LA 3B02A 4BY7J 4ILHA 2BY1A 4DR5K 4IHVA 4RDUA 3WXJA 1RBRA 5H6RA 3AVHA 5JLHA 1ORKA 3T1YK 4G6TB 1YJNI 4GW6A 2XUBA 2X0LA 5F1RA 2XF5A 3QINA 5JHFA 1UAXA 1U2VB 2VWBA 2R92J 1R58A 3ESWB 2MD5A 4W5OA 2KJCA 4BDZA 3O9RA 3O8MA 3LL3A 3LP2A 2R7WA 3HM9A 2LVSA 3FXJA 3O9QA 2WWYA 3WQTA 2LSOA 2WBMA 4M6VA 1NKEA 1VQ9N 2WTUA 1JL1A 2LP0A 3D5SC 1QO0D 1U49A 3IG1A 2NRAC 4IHWA 2HHQA 3E1YA 4FWKA 1B9MA 1JTXA 4UUSA 1LWFA 2PEXA 4E3SA 3OJSA 1WSJA 4I0BA 1QS4A 1E3OC 3FMRA 2VQGA 3TAFA 1S5JA 3JCUC 1YRNB 1TWFJ 2FQ3A 4DR7K 3FM5A 3L1PA 5GAGJ 1WKMA 1HQEA 1HSTA 4E70A 3GOIA 5FFZA 5AIQA 3PX0A 1YAGA 4XKCA 2DFIA 1HQCA 5M5XJ 2YJEA 5C12A 3DP7A 5HRSA 2O8CA 5E20A 5K5RA 3WTUC 3L2UA 3A2FA 2DK5A 2YNHA 3C7NB 4V19S 3WNGA 3NFAA 1RETA 2IT0A 2FF6A 4OGEA 1J5OA 4FZXC 4I02A 2CH6A 4QCLA 3CJ9A 5EG0B 3ZSRA 1XDSA 2H1KA 1RCHA 1H1VA 3S2WA 4XSZF 4XQFA 3HK2A 5B1AH 4DSKA 3RR8A 2GLOA 2Y48A 4J01A 3THXA 2HPIA 1HDPA 3ZQHA 3NGYA 3ZN1A 1S1XA 3QYBA 2D0PA 4FZYA 4HF2A 2P9UB 4I9QA 4FPBA 2G8FA 4MQ9F 3KYLA 3FM3A 1U2WA 4MO5A 4CZHA 3QBWA 1MNMC 1N33K 3CP8A 1RESA 5M1FA 3BUZB 4HCCA 3UB5A 1X4OA 3AA4A 3DV8A 1I3AA 1R4MB 4LG0B 2CV0A 1VQ5I 3K4KA 2RF2A 4HA8A 4I9LA 3GVAA 1KXPA 4JK1X 3KK3A 5DM6F 3QETA 1T6CA 1X3WB 4JX4A 5JLWA 1TUUA 2ZJPL 3O08A 1JKRC 4I7HA 4M73A 3J7AO 2R4GA 1XMOK 2BEOA 1MU2A 3HOTA 4M6YA 2CGKA 3HEFA 2ESNA 3G4SI 3KP3A 2O8BA 5C24A 4IXCA 4KIFA 3C3WA 2HBMA 3HHHA 3VEZA 4HTLA 1C0FA 1VF9A 3WXLA 1S7EA 4FETA 4IG3A 4FWPA 4DV5K 3MZYA 3QO9A 1JJ6C 2RGVA 5CR4A 4XRSA 3LSIA 3FHZA 4F4KA 4Z4EA 2CWEA 4LF4K 1P2FA 4K8ZA 2IS2A 3SPYA 4DTJA 5EOYA 2VJIA 2H27A 3HSEA 3VQCA 3QOEA 1W7PA 2DPNA 1HBXG 4Y1DA 3RQIA 3FFIA 2KISA 5CYQA 3J80K 2GOMA 1QHGA 1STZA 4UUVA 4XLPF 4B08A 2KDZA 2PJRB 4KBOA 2M8EA 2IW5A 2EZKA 1K83J 3HYIA 3DLEA 4KKOA 2M45A 3M3ZA 3AAQA 3HVRA 2QQ8A 4YDUC 3BWGA 3DPLC 5FD5A 2L0KA 1J54A 4MLHA 2XKOA 2XRIA 4WF2A 3OV8A 4OOIA 3F22A 1QU3A 5HDGA 2YX7A 3CCVN 1QSLA 1WI3A 3GWZA 1B59A 4O3MA 1K8KB 1P6RA 4GYGA 1JHFA 1Y56A 2MSYA 3FE1A 4C8OA 1T6SA 1TL8A 1VQLN 2GWJA 1RT6A 3KYDB 4II3A 4EATA 2M87A 2KRFA 1SVOA 3BR2A 1E4GT 1ETWA 1L3LA 1DDNA 2R7SA 3UIQA 1SVMA 3P4IA 3DPUA 4JI0K 3V81A 5HS9A 4EHUA 3R1XA 1IW7F 3TGNA 4HF1A 3AVBA 4DZPA 4C8KA 2UU9K 3KLFA 3LP3A 1P4XA 1YO5C 3IMXA 4CK2A 4JBAA 1RT4A 2X48A 1G2HA 4A6EA 3GDQA 4N4OB 3B73A 3J7AY 3FR0A 1OH7A 1O7FA 2TRTA 3JAMK 4U7DA 3RVCA 2P8TA 4BJ5C 4HF0A 4U0VA 4OLAA 3THYA 1O7LA 4JS5A 1IN4A 3ULDA 1NU0A 2LD5A 3EKSA 2CO5A 1S22A 3BCAA 4MTEA 2VG7A 2R7DA 1D5VA 2BOLA 5LHGA 4DV7K 1ONVA 4CZJA 4C2MJ 1U8BA 4KHYA 3F8NA 3DOKA 2GA1A 4B9MA 4DKWA 2M1BA 1BC7C 3C2GA 2CW7A 3BR3A 4BG8A 4UV9A 3AARA 2L3DA 4ASNA 4QPOA 1OISA 3LAPA 5FKKA 3CLQA 1YUWA 1KA8A 4M3GA 2VBZA 3HHGA 4FJJA 4BXXJ 2QSFX 2EWNA 5LBQA 4AIKA 3SEQA 1ETYA 2P9PA 1Z7UA 1WFXA 4HBLA 3AVCA 3ULEB 2LKSA 4UXNA 1HJRA 2D5VA 1VQ7I 3QYEA 1NJYA 2PBDA 4EMSA 3DLLL 1ZAOA 1BI4B 4GV9A 1TW2A 1TT5B 2RNJA 3ATUA 5AQPA 3J80Z 4AIDA 1JUPA 1JCEA 1C6VA 4A6DA 2Q31A 1W36C 1A5WA 4YOWA 2FOKA 3H9GA 4Z94A 5FGMA 4TV7A 4A0XA 4ENJA 3F8BA 2MGQA 2KFZA 1FZPB 3H3UA 2HVHA 5IOYA 2V7FA 2XGCA 1ETVA 2H8WA 4B1RA 4N4NB 2ETHA 3ZX0A 2M9HA 3EZ5A 4FJGA 5LHIA 5EVZA 2ZBKA 1X3ZB 4RW7A 1RBSA 5EGOA 1ULYA 4NNJA 5JVGL 2ITGA 3ISNC 1X1PA 3CP2A 3NGZA 3SPZA 4NBQA 5BN8A 3GTPJ 2W1OA 5D5UB 2QXLA 2RN7A 1FT9A 2I5UA 3H5AA 3ISPA 2D1HA 1G4DA 2DPUA 4ZDPA 2FSJA 4Z4CA 1ZARA 2Y0SN 1LVAA 4G6QA 1T3VA 1A31A 4I6MA 1XGOA 1QQNA 2XASA 2ELKA 1EV7A 1FMWA 4NYFA 2QK9A 3WTSC 2GXAA 2GIZA 3NF8A 4A3BJ 1WOQA 1VQ8I 3LSRA 3COAC 3E7LA 1RT2A 4ISEA 4FJ8A 3N4PA 1A6IA 1G3TA 3V9SA 4HTUA 3E01A 3H45C 3K9KA 1B8IB 4ESBA 3ZMTA 1D3YA 3V4GA 3UR3C 4MLOA 2K9SA 4UB6C 3ZMZA 5CVRA 5E8GA 2JA8J 5EZHA 1D1CA 1VQMI 1HPZA 4BQLA 2VE8A 4IO9L 3CDIA 3D0PA 1DGKN 3ENOA 4OPHA 4CD3A 2QUFA 2PN6A 3CDLA 4AIJA 1BUPA 2CFXA 4CHZA 1A6QA 3MKZA 2ECCA 1P7JA 4PFPA 2KIUA 2WC2A 3V4IA 2NVXJ 4HX8A 5CVUA 1FK9A 4IX7A 2ECBA 4DS4A 3OYFA 1IC8A 2CUEA 3BPVA 4CZFA 3W0LA 2WY8Q 1TK8A 1MH4A 3ULQB 3O8HA 2ZJ2A 3S17J 3F9MA 3VYTB 3OYGA 2KIQA 3O3FA 5CPRB 3RCOA 4OAYA 3EZWA 5J8FA 1LE8A 1TWHJ 1RGIA 4CJ4A 2EFOA 1NGIA 5D8LB 3VQQA 2R7VA 4C1NI 4DR3K 3CCQI 4PDKA 4JEPA 1F36A 4W5TA 1RNLA 4IHYA 1O1WA 5J2QA 2EZIA 2VT2A 1QQMA 4KIGA 3VQ7A 1R5GA 5C10A 1N36K 5LGNA 1JLCA 4IZ9A 3WT0A 3M8QA 3CJBA 4LFBK 3V7SA 3OYHA 4WX9A 5LY3A 2L7MP 2FRHA 1BW6A 2G8VA 3IUCA 2PZSA 2EJRA 2BVLA 4LF5K 4BROA 4M9SA 4H5TA 4CGZA 2LLKA 3BF1A 2VKHA 5ELZA 3H5NA 4I2QA 3QEXA 3M6GA 1G8XA 3K4LA 1ZLJA 1HDDC 5FKMA 3S1RJ 3PSFA 1HNIA 1EXQA 1FOWA 1YT3A 3OL3A 4ZYAA 1HKBA 3GTJJ 3HM8A 1WJ5A 3E9LA 4RW6A 4BHBA 5ERIA 1IZ1A 2P9IB 5HROA 2DT7B 5HLTA 2IGKA 4BKXA 3ABTA 1QQIA 5DUIA 1BI0A 4M74A 3TANA 2MA3A 3K2AA 3L7WA 3MXJA 3CHWA 5K1YA 3EO3A 4ZTJA 4WWCA 4Z4FA 2K4JA 5D5VB 2HYGD 2VN2A 5F0HA 4A59A 5GAEP 4EIAA 3NGIA 1WWXA 2DA2A 4JK8A 4E7LA 3OBYA 1ZELA 4YORA 1V4RA 4IVNA 4Z2YA 3NVMA 3ZSVA 3L2VA 3EDPA 2JA6J 2EIMH 3V9XA 4RW9A 5BREA 2HB5A 3ENBA 2P9KA 4D0PA 2ZJQF 2A1RA 4XIDA 3ERMA 4XSXF 3JSMA 5FPDA 3W3DA 5DM7L 4AM3A 3TDUC 2Z33A 3DEWA 1E3MA 1T0FA 3O4QA 2BH1A 4WK8F 3WE2A 1ZR2A 4BL0B 4MO4A 3K4CA 4J2DA 3F3XA 1QQOA 4B1YB 2HS5A 4CICA 3LWMA 3QNNA 4BJTA 4ENMA 4DIQA 1L3SA 3A01A 4KMFA 2ZCWA 3V1RA 5CE3A 4N76A 1H8AC 3DU6A 3GTQJ 1IN5A 3NVKA 4LITA 4JI2K 1XN7A 1NJZA 1DTTA 3TP0A 4CI6A 3ZP5A 2C6YA 1WJAA 1JKOC 3KKSA 1OCRH 1O3QA 3CIPA 3CC4I 1Q1HA 2BHZA 1P7IA 3BZCA 2ELHA 1S9HA 1Z77A 4QOZB 2Z1DA 3K10A 3I56I 2FBKA 2VGMA 3M1FA 3TSQA 3VQ9A 1FBSA 3U9GA 3AO5A 3J80O 5K5OA 5FKLA 1S72N 4CCOA 4HUEA 4C23A 1VFCA 3CZ6A 2LR8A 2R5ZB 2Z99A 4WQ4C 1C0WA 3V8KA 3CCEN 1BC8C 4I2PA 4KH4A 1WH5A 4HUFA 4IRGA 4H4OA 1HMVA 2DYRH 3RZDJ 4ELTA 4MFDA 3K70D 2NS0A 3CCRN 1VSJA 2D1KA 1SS6A 3AO4A 1QGPA 2K9LA 3H9QA 4RLQA 1KVAA 3VN5A 2IAIA 3MMYB 1ZBSA 1LFPA 1ZG1A 1NGBA 4A3KJ 1YI2I 4ZH4F 2GAUA 1S6QA 3A5MC 3CMAN 1JUSA 4CF8A 5CVIA 1U6ZA 3MZHA 4H0PA 3C95A 1S7OA 4E6KG 2DT6A 4O55A 2W7NA 2KRHA 3HC7A 4LSLA 1KU3A 3ZMUA 3DFGA 1JXEA 4A2BA 3FF5A 1OCOH 4CIGA 1O3TA 1C0TA 4IRIA 4DSIA 3KVGA 3K5MA 1OCZH 4EM2A 4HW0A 5KQDA 3C18A 1RIOH 5DS9A 3J7YJ 4KO0A 3FX3A 4ZHRA 3ZQCA 2WV1A 3O9UA 1RKWA 2Z16A 4YOVA 3TPQA 2QF7A 2EINH 3DBHB 3C2BA 4EAHD 2MD0A 3LSPA 5DM6L 4V2FA 2X1DA 1ZRCA 3G73A 1NHAA 2E5NA 1NK4A 4BBSJ 1HYSA 2ACJA 4JQFA 2E1YA 1TTYA 2TCTA 2XSDC 3OR1C 1WI9A 3I58A 2QKBA 2YPRA 2EFQA 3T0YA 5BPIA 2MYSA 1YIOA 1BR4A 1SMYF 4E0DA 1GLDG 1D1BA 5F0CA 4CFCA 3O3KA 1R4NB 1VNDA 5FLXK 3VF2A 4QTRA 3AA5X 3TMOA 3NCIA 3GTGJ 2AQFA 2E1NA 4KV8A 4PSWA 3AAFA 4UNOA 3GX4X 2W82A 3IRQA 3LWLA 3CCLI 2DMQA 5LGUA 1QZZA 4ANJA 4CEAA 2HQ5A 1LVKA 3CCYA 1T38A 1NGCA 4A3EJ 3UKUB 3NARA 3VQDA 4C3IJ 4EM1A 4IHXA 4E7JA 3I59B 5GAEJ 2XAGA 4KTQA 4D1QA 3CCUI 3KJVA 2WAQN 1B9DA 2OZ6A 3RJPA 2A40A 5J4VA 4FM0A 3SCXA 4CZKA 3GFLA 3VSKA 2E34A 2LG4A 4BR7A 2DA4A 1LJ9A 5AR0A 3T3FA 2IA0A 4ZYEA 3P9KA 4DQSA 1TQPA 1Z0XA 4H4KC 1NLVA 4J00A 1BI4A 3KFWX 5EYRA 1BISA 3L3UA 5GIOA 4PKIA 3DRRA 5IYDJ 4PY5A 3IKVA 1MMSA 1TKDA 3D7EO 4AHTA 2QWLA 4RGUA 3DLHA 4Y17A 3BGRA 2JPBA 3JRIA 3FXOA 3BQYA 4FLYA 4P1WA 1MBJA 1EJ9A 3H1VX 3E6DA 1A35A 3HOWJ 5DCMB 2VB6A 3OYIA 1WN7A 4DHYA 2AQEA 2IIRA 4IFYA 4GCVA 4KISA 2IS1A 3R3LA 4M3EA 2VPRA 3G1LA 3WTVC 3IHUA 1QVTA 1GLCG 2A3SA 4JP0A 3EY1A 2P9LA 3O4NA 1SFEA 3TAMA 3EUHC 4N9HA 5BRFA 3G2BA 2XPUA 2VQEK 4EHTA 1GVJA 3VA0A 2EH3A 3X2QH 4W5NA 3AVNA 2PX9A 1T03A 3CCMN 2E35A 1W5CC 3GE1A 1XX5A 3U2RA 4FJMA 1MNEA 1NOZA 5GTHC 3KP6A 1BL0A 2UV1A 3TO9A 5JVTA 3AL0C 2W6LA 3RSEA 5SWMA 1K78B 2PJPA 4L8RB 4A5AA 3K2PA 2EWSA 1UMQA 2MW8A 2HW3A 3KLOA 3MD2A 3BLYA 4FLUA 2MH2A 1Y1WJ 1B8IA 2P9SB 4DSFA 2ZSHB 3FKJA 4RW4A 1KQSM 3T69A 2HYJA 4IFVA 3VWBA 3KLEA 1I1GA 2ZM6K 2LF8A 3OTOK 1UCRA 5EJCA 1P4WA 3A03A 2KQ2A 3CUQC 3NHGA 1MKMA 4DU3A 2G8UA 3IAM2 2O03A 3QIPA 3DMJA 3CD6N 1BOBA 3ZCOA 3BR6A 4DG1A 2BBYA 5HNFA 1KQ0A 4JKCA 2YX6A 1IBKK 2P9NB 3HUGA 4L9NA 1GOBA 2OQRA 5EF6A 2KL4A 3NF6A 4NYNA 4OKEA 2R7OA 3MCAB 3TTFA 4ZJZA 1O57A 5DEQA 4CZIA 3R6SA 4C8MA 4UB8C 2RDPA 2OU2A 1Y97A 5HNHA 4CGJA 4MDAA 4JI6K 3PLAA 2G8IA 3CFPA 4HZFA 4EVIA 4FJLA 4XRMA 1KLNA 3BT9A 4K0KK 1VQNI 1XNRK 3GLXA 1A5JA 2KZMA 3LPUA 1FBQA 1F4KA 3ITHA 1GLAG 3E5UA 3CXCM 1ZXOA 4S0HB 4CXFA 3S41A 4H4MA 4CJQA 3TARA 1EETA 3OYBA 3U21A 2JRTA 3LP1A 1BQNA 1BGXT 1GXPA 2JWTA 2IA2A 4B4CA 4NC6A 2E60A 3D6RA 3S15J 2AS5F 3CI5A 1WZ2A 4BYYA 3ZMSA 3HGYA 4DTOA 4JAXA 1USTA 3GEZA 3WQUA 1MWMA 1TAQA 1FTTA 1CF7B 2F9TA 5IYCJ 1VQ6I 5FRNA 3MQ0A 3KLNA 1CGPA 2PYJA 2A68F 3CO7C 1RTHA 4BJ6C 2ZQBA 2E6MA 5J1EA 3CMEI 2VG5A 2WAFA 1HXDA 2DXIA 4MEYF 2FF4A 4KHSA 5AIPA 4MFBA 1L0OC 1V5EA 4BRKA 1FC3A 2HVQA 3FZLA 1J53A 4DBRA 1XMQK 1SL1A 3K1PA 2DQLA 1C0MA 4X1EA 3E97A 4C30A 4HV5A 4OMYA 2GEMA 3U3GA 1BOTO 2WONA 4DYQA 1MMGA 2JT1A 2XC7A 2CGJA 4RAZA 2KZGA 2N8GA 1HNVA 1LOTB 2YNGA 2M2EA 3O1WA 2NRWA 1H0MA 4DCHA 2M5WA 2NOJB 4I6ZA 1YX3A 3SFIA 1LWEA 1ZBLA 5I9EB 4DV2K 4Y4RA 1PYVA 2JQ7A 3CC7I 3K9TA 2YNFA 1LWCA 3K58A 2H6CA 4PL8A 2O8FA 1D9DA 3NRVA 3A2KA 5B66C 4JOMA 2KIMA 1OH8A 4L5JA 2CQ7A 3PIOF 3MN7A 1NJXA 4DV3K 1IGNA 1RTDA 2IVNA 4A3FJ 2ZJRF 1QHHD 2LK2A 4I2OA 5EEGA 1W5SA 3NAUA 4EQQA 3P1GA 4B9QA 4B1UB 1YITI 4DJAA 3FDYA 1JTYA 1YTAA 3JS6A 5M5YJ 4BY1J 1SKRA 1IG9A 3BDPA 1ZGWA 4BR9A 4BWJA 4KI6A 3IDHA 4G7HF 2LY1A 5AQNA 3F72A 3KE2A 3FZKA 2RKHA 1R36A 2UXBK 5FLVA 1XC3A 3D2FB 2QBYB 2QWNA 2OA8A 4KMUX 1S1VA 4FJ5A 2OTJN 1BA1A 5J1UA 4Y7NJ 4WYBA 3EETA 4LIUA 3SAFA 1UOCA 1T56A 5KQ8A 4A5MA 2BGGA 3QBXA 2BV6A 4B3RK 2WFBA 4OIQF 4FWMA 1GDTA 2MLKA 1VQOI 4HX7A 1U0JA 2O8XA 2WC9A 1I94K 2G0EA 1TLHB 1ZREA 1IV0A 1A04A 3FXKA 1NK8A 1ON1A 1UHMA 2ZMEB 3THWA 1XUPO 3CJ1A 4CCLA 5T7BA 1M1EB 1NMNA 1KYWA 4AYBA 3JTHA 3I64A 3CCJI 3A5NC 2QSGX 3R4KA 2CUJA 3TKYA 1BR2A 3RTRA 5KI6A 3BJ6A 1VQPI 4CJWA 2HDCA 3TP3A 2OYQA 4YDUA 2VCPA 4WQ5C 1AOYA 4B3TK 3K5NA 3MN9A 3OYDA 2VL8A 5AZJA 3ZN0A 4JI3K 2QEXI 2R7FA 5J40A 1LW0A 2OBPA 4DQIA 4BH9A 4CCMA 3IV5A 1EQYA 1EH6A 2DY4A 3WTWC 4YY3K 5DUKA 4EEFG 5FPEA 2ZJPF 1MZBA 4PZJA 3TOAA 4LOCA 3P38A 2MC3A 4ABZA 3BJAA 2RVCA 2L54A 2O8EA 1KQ9A 1BI1A 3OIQA 3BDDA 2KKZA 2UXCK 2J5PA 4OWRB 4UHTA 3AA2A 1NJWA 1S6LA 3PNTA 1GVDA 4MFEA 5BPLA 3WG7H 2Q2RA 3SQ2A 1IN8A 1RDUA 2VC1A 4ISFA 2HZTA 1KTQA 3ABKH 3AG4H 2E4LA 2P5KA 1ILYA 3NWSA 1OKJA 3FBNB 3P83D 2HHUA 3JRBA 4CD1A 1FMVA 1P90A 3QPLA 1Q8IA 3TDZC 1ITYA 4OPKA 4Q5SF 3ID6A 4M6XA 1FKPA 4KTZA 2BE5F 4XH5A 1FIPA 3LL7A 4Z0UA 1O4XA 4BACA 5JS2A 3JRCA 4WF9L 5FROA 2BGCA 1KU9A 4JKBA 1JT6A 4JYAK 5LMNK 4LLGF 3VGMA 1KQ8A 1CZ9A 1YJWN 2FF3B 5HDKA 2A6HF 4YFNF 3EUAA 1JXSA 3BY5A 1C1BA 2QWMA 3VTHA 5AQHA 4K25A 2G7HA 2NRTA 3SV4A 1DEJA 4HYEA 3JRGA 4LSNA 3K6GA 1GLEG 2D4WA 3U6FA 3TWHA 1K8AO 1XHXA 3VDXA 1T08B 4II2A 1KU7A 4BU2A 5AONA 1VQ4N 5AQQA 1XQSC 1OJLA 4JKGA 3R8EA 3A0HC 2FBTA 4EP4A 4M71A 1WUAA 2AA4A 2EIJH 5F0FA 3GZNB 3BF3A 3E9PA 2OA4A 3MK6A 4A2AA 4MEXF 5JS1A 3I3LA 4ID1A 3ZEUB 2DFHA 5EZGA 4PA1A 1WSUA 3D45A 4F93B 1LFUP 4HPQA 2B9SA 2FD5A 4A2UA 3HTUA 2VWKA 1A5VA 4KH6A 3DLRA 4RGRA 1YJ9N 1TK0A 3BG5A 2OTLI 1ZRDA 3VENA 2K9QA 1B6AA 1GXQA 4KNYA 3MKLA 4OIRF 1FW6A 1FKOA 3KTQA 2X6OA 4C3JJ 4LF6K 4IL6C 3G10A 4KHWA 2V26A 3E5QA 2VODA 4B1ZA 3HT3A 3SNNA 3PJRA 1WGXA 5BS6A 2IS6A 2AO9A 4ENNA 1T2KA 2JMWA 1WJCA 1K9MO 2JJ7A 3CFRA 3CO6C 3SZ2A 3G0ZA 5HVQC 1MJ9A 2LKXA 4RGSA 1GUUA 1R1UA 3IP4B 4F91B 2HVIA 1VSIA 4DFPA 3I4MJ 1ATSA 3KIOA 2F5FA 3WHCA 2VJ5A 4H8KA 4HNVA 2A41A 3HP9A 3C7JA 4B3XA 3MEEA 3NE6A 3DKXA 2VI6A 1HYZA 3CJCA 2DLLA 1OQYA 1XS9A 2HHSA 4FX0A 2GXBA 2OPTA 2ZSIB 1RDDA 3RI4A 4B1VA 1D8YA 4CJEA 5C44J 1K7AA 4UY8O
chains in the Genus database with same CATH topology
4I9LA 1D9DA 4IKFA 4RW8A 2P1JA 3WNFA 3AVLA 4DTMA 3KK3A 4AHVA 3O3GA 3MXIA 2G8WA 2PYLA 3AVJA 2Q3SA 4DF8A 3PX4A 2O4IA 4CERA 3T1AA 4J2DA 1NK6A 3QETA 1WNSA 4CESA 5CYMA 3OYIA 3EZ5A 3DOLA 3L8BA 4FJGA 5D3GA 1WN7A 1KRPA 3RRGA 4IFYA 4DFMA 5I3UA 4DU4A 2RN2A 3LWMA 3QNNA 3RTVA 4RW7A 5CZ1A 3SUNA 1RBSA 2EX3A 4JLHA 2X6SA 1LW2A 4CF9A 3SQ4A 2OZMA 1N5YA 3QIOA