3H36A

Structure of an uncharacterized domain in polyribonucleotide nucleotidyltransferase from streptococcus mutans ua159
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
78
structure length
78
Chain Sequence
QVDADLQAEIVGKYNADLQKAVQIEEKKASEIATEAVKEHVTAEYEERYAEHEEHDRIMRDVAEILEQMEHAEVRRLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Polyribonucleotide nucleotidyltransferase
publication title Structure of an uncharacterized domain in polyribonucleotide nucleotidyltransferase from Streptococcus mutans UA159
rcsb
source organism Streptococcus mutans
total genus 33
structure length 78
sequence length 78
ec nomenclature ec 2.7.7.8: Polyribonucleotide nucleotidyltransferase.
pdb deposition date 2009-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.400 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Polyribonucleotide nucleotidyltransferase, RNA-binding domain 3h36A00
1E3PA 3U1KA 3H36A 3H1CA 3GMEA 4AIDA 4NBQA 3CDIA 1WHUA 1E3HA 3GLLA 4AM3A 3GCMA
chains in the Genus database with same CATH superfamily
4HRIA 3ZQFA 2XIGA 3K1PA 2KDZA 3E6CC 1PP8F 3CTAA 2DT6A 4E7KA 4A3KJ 2GZWA 1W5SA 5JLXA 2XSDC 1MBKA 1ETWA 5IPAA 4I09A 3BTLA 4C3HJ 5LEJA 2FMLA 2OZUA 2R0QC 4FQGA 4XLPF 4HQMA 1GV2A 4CCJA 1MJBA 3ZMTA 2MC3A 3MAJA 4FHTA 4KNYA 3AL0B 2R3SA 2COBA 4OWRB 2A68F 2DK5A 4EGYA 1ZYRF 4G6QA 2XDVA 1HSJA 1R5GA 2IS4A 2NOJB 3K6GA 3I5UA 2Z2SB 5FD6A 3JSPA 3CCQI 2L4AA 1I5ZA 2HTSA 4G7HF 3S1RJ 3ABMH 3MFKA 5J47A 3C3WA 2P0WA 4RLFA 4RA2A 1RETA 1J59A 3BTJA 2CYYA 5D8KB 2DFHA 4MQVA 3UKGA 3L09A 5HDNA 2AHQA 3LSMA 1FSEA 3BY6A 1X1CA 2DFIA 4B44A 3HRUA 3H5NA 4L5IA 2IP2A 3SEQA 3DLLF 2EWNA 1XD7A 3CJQB 4CCOA 2E71A 3ABUA 2ZBKA 1DDNA 3CCRI 3H3VK 2KFDA 2X6OA 1HDPA 1MD0A 1XN7A 2KISA 5EZHA 5BPDA 2J5PA 1HXDA 5BS6A 1TQIA 1FJLA 3FHNA 4HF0A 3IKVA 4XLCA 2BHZA 2A5YB 1SFKA 2GXGA 2BW3A 1ZG5A 3E5QA 2FQ3A 3RZDJ 1P7IA 1BM9A 4UVCA 1FC3A 3LOCA 1B1BA 2OQGA 3CF5F 5A2QK 4D9JA 4U88A 4L9VA 4KDPA 4A3JJ 1LDJA 4A5NA 5CKTA 1GXQA 2LKPA 1ORKA 3SXYA 5D5UB 3QYEA 4JQFA 1E3PA 2MFZA 4XNFA 4BAYA 2YU3A 5EEHA 3FWEA 2DTRA 3HKZN 4II2A 3TMOA 4IHSA 2DMQA 4RGXA 3ML6A 4HBLA 2P5VA 1SMYF 3S1QJ 4UNOA 4AIDA 4BY1J 1JT0A 1VQLI 4ETSA 3KETA 3WE2A 4B09A 1GVDA 2E19A 1YW8A 1T56A 3K1NA 5J3LA 1QZYA 2I10A 5IT3A 4BH9A 5LHGA 2PX9A 3C2HA 5L3DA 2ZJ2A 3IRRA 1FBQA 2HOEA 4BHPA 4KIFA 3TL4X 4ZC3A 3VYTB 3ZN1A 2WAFA 4PFOA 5HDGA 1Y8RB 2GA2A 1OCZH 1RRJA 2PI0A 2CFXA 2O5RA 3BJ6A 1OCRH 3D5SC 3ROUA 1IDZA 3RQIA 2LY9A 4XN0A 4E7HA 4IRIA 3TOBA 5CQGA 2IAIA 3JRHA 2HKXA 2GOMA 3DTIA 1UG0A 4BJTA 5B5EC 1ZGWA 4UUTA 2E5NA 3FMSA 2OCEA 5D6FA 2PJPA 1VFCA 2ZB9A 4ZYGA 4CXFA 1QHHD 3M7GA 3ECHA 3CLQA 4AVPA 2MH9A 4UXNA 2V1UA 4HAMA 1WJAA 1ACIA 1OISA 2X6YA 2DPDA 3FKJA 2VPRA 1T08B 1R23A 1NHAA 4JX6A 2KDOA 4QLCU 1HF0A 2Z33A 2Y0SN 2EFPA 4BEHB 4GDFA 3AG4H 3SQNA 5CVVA 1E17A 5H20A 4D5FA 3F72A 2WADA 2PG4A 4ENNA 1QHGA 2DPUA 3SJMA 2KMUA 3LFUA 1FLIA 2BVLA 4RGUA 4PDKA 2A5WA 4CSWA 4Y13A 3S15J 1I39A 2W48A 1TW2A 2KJCA 3KP5A 1IRZA 4QPQA 1TT0A 2R7RA 2LR8A 3GW2A 1AWCA 1JI8A 1P4XA 4R8HA 1R71A 4DZJA 1B8IB 1XMAA 1ETKA 5D5VB 2WY7Q 4AUXA 2XAHA 1WZ2A 5B1AH 4XLHA 3PQJA 3ASOH 2H8RA 5FRMA 1N25A 2R7VA 3RKQA 2JVHA 2Y48A 2ZNZA 3FXLA 3D5RC 2STWA 1HA8A 2DA6A 3HPGA 3ECOA 4GO1A 4XKCA 2CGPA 3MKLA 2BV6A 2V1XA 1RIOH 3C18A 3PM1A 4Z2YA 2JN6A 2X51A 1SC7A 2R7FA 2XV4S 1STZA 2WAQA 1PP7U 2M4KA 1DU6A 1KQ9A 1TW3A 2YS9A 4LB5A 3IAM2 2VT3A 1X19A 5CVRA 4BHBA 1SMTA 4MEXF 3DWLE 3FM5A 4A0ZA 1VQ7I 2DMNA 5CLSA 3O2PE 2HYFA 3QQAA 2LF7A 1A04A 3SFIA 2AXTC 4LLGF 5EJCA 3AG1H 2LFBA 1IDYA 4IZZA 2VLAA 1AKHB 2BGCA 2MLKA 4YIRX 1ZLKA 4RLQA 1K78A 4PZJA 3MVPA 4BDZA 3CF2A 4HV6A 5B3SH 2FUG2 3K70D 1M1EB 5FROA 3RJPA 2LTPA 4AU7A 4NHJA 1KA8A 3WE3A 2LLKA 1OFCX 3B6AA 5DD4A 2L5QA 3G1OA 3LSHA 2ZSIB 2OAZA 5JFRA 2IS2A 3MKWB 4BQAA 2YPRA 1X4PA 1T98A 1XCVA 1EH6A 3QPTA 4GRIA 2TRTA 1R7JA 3F23A 4RM2A 5L3GA 1JHHA 1N77A 3BROA 2RNGA 4XIDA 2L02A 2YX7A 3I56I 1LQ1A 1ON2A 5AIQA 2V1DA 4PSXA 1R9TJ 4H4KC 5E8GA 2HDWA 4E4HA 3OOUA 4LD5A 2OUMA 4UB6C 2P5KA 3LFKA 3P5JA 2VASA 2Y0MA 3HYIA 1XSDA 4UUSA 4XSZF 3MEXA 1V55H 2AXLA 4LGWA 2HFHA 4OMZA 2MYSA 2WTEA 1K4TA 4QTRA 2FBIA 5CPRB 3J7AY 4IX7A 1YYVA 4BDYA 2Q1ZB 1S7OA 5TISC 4Y17A 4EM2A 3E5XA 2VPLA 3E6DA 2K3FA 4LITA 1W36D 3FISA 2EB7A 3ZR8X 1XGOA 2DK8A 4DZPA 1ZG1A 2EQRA 4YEJA 2LG4A 5FFZA 4MHGA 1VQMI 3GTGJ 1I6HJ 3H36A 5FJ8J 4HEA2 2EFOA 3F9KA 5ILSA 1BJAA 1I3AA 4N4NB 1U8RA 2MGQA 3QAHA 4KT6A 4MQ9F 2BZTA 4A3CJ 1U3EM 3GMEA 3F6VA 1SAUA 2DJIA 3P9KA 3IH4A 4C9YA 2F48A 1HKQA 3M8JA 5H2FC 3TW6A 2W57A 3AG3H 3VYSB 1POGA 4HPQA 1BW5A 1B9MA 4ABZA 2L0KA 1E2XA 1BR2A 3M9AA 1FIPA 2X9DA 4IOAF 3BR1A 3E6BA 1QGPA 3OR2C 3L00A 2R7QA 2EH3A 2HXOA 2TCTA 3E97A 5M5XJ 1C0WA 3MZHA 2NOGA 2Q8KA 1E3OC 2JA2A 5HODA 4RAGA 2E2IJ 3FDYA 1T39A 1Z21A 2A6EF 5DUIA 4JX5A 4XMYA 2CFOA 2F6CA 3J7YJ 2CO5A 2KIFA 2KIUA 2NVYJ 4D7NA 1LB2A 2XROA 1UG2A 4MTEA 3KZIC 3I4MJ 2L2OA 2DMUA 3G2BA 4Q47A 3V7SA 5J4VA 2VJ5A 1TTYA 3X2QH 1FTTA 3E5UA 1SFEA 2ZO4A 1MNMC 1J7KA 4Y7NJ 4N4OB 5E1XA 2JZYA 4N9IA 2XAFA 1S3JA 4XORA 3OYJA 3K4KA 1PDNC 1QO0D 1P7JA 3SZGA 1O3QA 3FX3A 4IKFA 2V9KA 3G4SI 3C1DA 2VXDA 1R1TA 2D45A 1SD4A 1VF9A 1Z7LA 3OYDA 3KP3A 3D0SA 4D1QA 4EEFG 2CMPA 4IHXA 2VONA 2HDDA 1IN7A 1SVLA 2PMZN 3AAFA 1E0EA 3DBLB 1Z6RA 2FX0A 1O57A 3WU1B 1R1UA 3HSFA 5F0CA 3MWMA 2QEXI 1S6LA 2FA5A 4B1RA 2UZKA 1YE9A 3OY9A 3RZOJ 1MW7A 3CLOA 2XAGA 3HRSA 1DUXC 2Y9YA 1EF4A 5GADJ 2QQ9A 5ICCA 3LSPA 1IV6A 3SEZA 1TBXA 2M34A 2O3FA 3FKIJ 3KPHA 3A01A 3GFMA 2NYXA 3LSIA 3W2WA 1MNDA 3TBIA 3G73A 4V19K 1IN6A 4P9FA 5J1RA 2L9RA 4LOCA 4OAYA 3F0CA 2IVMA 1R6RA 2QCOA 3TDUC 2HTJA 1R22A 3PNYA 4A3LJ 5KAIC 2BVMA 2HOAA 2HGCA 1FIAA 5LGNA 3DCFA 5D5WB 3T1BA 2HPMA 5KVRA 3J7AO 3MZYA 4ZZDA 3AL0C 3PQKA 1FMVA 3OSGA 4KA4A 4XLAA 4D7MA 2CJJA 2TDXA 4BL0B 4LK0F 4RAZA 3JRCA 2IEKA 1K78B 2ZCWA 1TL8A 1Y6IA 4RAFA 4BJ5C 4RBOA 1DU0A 3W3CA 4B3AA 3QU3A 1UHWA 2DFEA 4I98B 1T6SA 2W25A 2DA1A 1O7LA 1XSVA 1A35A 3PIPF 5HLGA 2M1BA 3GFJA 4I99C 1MIJA 4OU0A 4XKVA 2ETHA 1DGWY 1TWCJ 3BCAA 4DYCA 1VI0A 3N97A 2GWRA 2JMWA 2GA1A 4CZCA 4BJ6C 4F7ZA 1KU2A 1A6QA 4HLYA 1NG6A 2XGCA 3GTKJ 2K5CA 3ZXSA 2QQAA 1Y1WJ 5EGOA 3GLXA 2WV0A 2VKDA 2CG4A 2VE9A 3ZMZA 5EF6A 3FXOA 3ZQLA 4P5OA 1SVMA 4EJTA 4UUSB 3FBNB 1FY7A 2EA2A 2M2EA 2DN0A 3BR6A 2VXZA 3CQZJ 1Z77A 2CQ7A 1YHQI 2HKOA 4M3GA 2VQHA 2M3AA 4EJVA 4KISA 1JTYA 4WXCA 1V4RA 1USSA 4CYCA 1EKEA 2VL8A 3WTWC 3HXLA 3CCLI 1K6OA 4M3FA 1W1WE 1REPC 2K40A 1HW2A 5IYCJ 1YTYA 5D6EA 3BT9A 2CV1A 2KRHA 3RQ4A 1T2KA 2KRFA 2P6TA 2PFBA 2DYSH 5F6FA 1FNNA 2EA4A 2GAUA 4PJLA 3VSLA 1V5EA 1X2NA 4IHWA 3HGGA 4UUVA 2ZSHB 1MBHA 3I4PA 3RDIA 2EZLA 2XPUA 1YIOA 2WWYA 1BI1A 1MMGA 2EV0A 3E0JB 4YFXF 1FYLA 4XQFA 3JW4A 1YW9A 2DMPA 3R61A 4W1UA 2HWVA 4YIFA 1RESA 2QA4I 3L2VA 5M3FJ 5DUKA 1ZR2A 2Y75A 3GWZA 1OMIA 3JR9A 3LMMA 2IA1A 5H6RA 1PUEE 3MKZA 3V7CA 1GXPA 1Z1DA 4PK4A 2KQRA 2M45A 2O03A 3E3VA 3G3ZA 1MKMA 1WJFA 3QYBA 5IT9Z 3A2KA 1XMKA 2M0CA 2VQCA 1IAWA 3JRFA 3FXMA 2V79A 4L5JA 1HW1A 5DV5A 2ELJA 1I6XA 1W0UA 1RZ4A 2ICWG 4M71A 3U9GA 3GX4X 4IRHA 1ZH5A 1HW5A 2FSWA 4YFKF 1FP1D 1HOMA 2LKSA 4B47A 3HB9A 2GXBA 2F5EA 4ESBA 2H1KA 5F27A 2LVSA 3ABLH 2JUGA 3WGHA 3WU2C 4EJUA 2IJLA 5HNFA 3MCZA 5LLQA 1YQAA 1Y1VJ 2PBIA 1OR7C 2COMA 3L2QA 3ISPA 3GZ6A 2PJRB 1J9IA 4LG3A 4XICA 5LGUA 3QPLA 2X1EA 1YW7A 2M8EA 4LIUA 1G3YA 3FK7A 1IXSB 1WJCA 2CQQA 4GYGA 3ZP5A 1EV7A 1BBYA 2EFQA 3JREA 4AIKA 2W00A 3PSIA 1IC8A 1IXRC 1Z0XA 1R58A 3OYFA 2DMTA 2WC2A 3EUHA 3DU5A 4BY7J 4AVZA 1T0FA 2EIKH 2LY1A 3LAJA 3BCBA 3J80Z 2V4JC 1MZBA 4E7IA 2IS1A 3RKWA 5JHUA 3DV8A 1YJ9I 3OOPA 4I01A 1Y8QB 2VBZA 3BOQA 3A01B 3LAPA 3G71I 3EDPA 4WWCA 4FT8A 4OAZA 5BMZA 1G4DA 2V6CA 3KYCB 2XF7A 1ETQA 2ZNYA 1ZTRA 3B02A 3H9QA 4DYQA 5FRNA 2FOWA 3PIOF 2QKMB 3F3XA 3ZQCA 3FMQA 1KGSA 4IVNA 4MFDA 5IOYA 4YFNF 1X3ZB 3T8TA 1SD7A 2WB1A 3Q5FA 3GZ5A 4CCLA 4V2GA 4DQ2A 3HC7A 3ZCOA 2V7FA 3HL2A 3WHBA 3CC7I 4J01A 2QBYA 1RR7A 5C4JJ 5J8FA 4Q5SF 1OPCA 2R7OA 4B48A 2HPIA 3TKYA 1IJWC 2F5FA 4EATA 1LVAA 4HSRA 4BACA 3ZQGA 3BLYA 4EVIA 3LNQA 1Y0NA 3BZ6A 5E1WA 1IUYA 2DDBA 1PUFA 3IP4B 3ASNH 1AU7A 2P7VB 3I4NJ 2DA4A 4BHCA 2IS6A 1SEUA 2MH2A 2UUZA 3H5AA 4RS8A 5KNLA 3IKTA 1TWHJ 3Q3SA 3M8FA 1J0RA 4EGZA 2EK5A 3VSKA 2P4WA 5GAHJ 5K7HA 2DQLA 3SFZA 5EGOB 3O8HA 4XLEA 2ZFWA 4ITVA 3WTUC 5IP7J 2Z16A 2DJNA 3WTTC 1XDUA 5FKLA 1QA6A 1FTZA 3WU0A 4AIJA 4L9NA 1H8AC 4EJWA 4RGSA 1G3SA 3IAS2 3TW7A 5L3CA 1I27A 3JSOA 3I3LA 2IRFG 2VC0A 4HLXA 1VQ4I 3FBIB 4XM3A 2MA3A 1QPMA 2R93J 4NB5A 2ELHA 4BE1A 1R4NB 2DLLA 2OV7A 1B59A 2OD5A 4YG2F 2FBHA 2KPMA 3FIWA 2MG4A 3TEDA 3K69A 3GTQJ 4PJ0C 4U0WA 2QF7A 4CYCB 3U21A 2E5ZA 3LA7A 3LA2A 4Q48A 1JUPA 5J40A 2DOAA 1IZ1A 1KZHA 3TDZC 1JE8A 1PJRA 3DTKA 4AIHA 3ZMUA 1BR1A 3ABTA 2DOEA 4XLFA 4C3IJ 4L9TA 4A0YA 2VUMJ 1LE8B 5A2QZ 2MABA 1PYVA 3GLLA 1YO5C 2HOTA 2WA0A 4OIRF 4PUSA 5IOZA 4U7BA 1D5YA 2LBFA 2LRDA 1V5FA 3DLAA 4L0YB 4DYRA 1WPKA 3EYYA 3S32A 5LBQA 1MGTA 2IPQX 1GT0C 5EEGA 4KUMA 2DTZA 2KT0A 2QUFA 1QBJA 1ERDA 3JRIA 5CVJA 1T33A 1D0XA 2KKOA 3F8CA 2O6GE 1KQ0A 5FGMA 2K4JA 2QGUA 1DGRM 2W85A 2RKHA 4G94A 4F3QA 4J00A 2M5WA 4PGHA 1NG7A 4M74A 3AKZA 2B7EA 2IGOA 2IXSA 3GTJJ 1YX3A 1BC8C 3CDLA 3HGYA 2CW8A 2XPVA 3JCUC 4HV5A 5KAFC 2E2JJ 1BL0A 3NWSA 1G3WA 4G8XA 3IHUA 2NS7A 3S1MJ 2QVOA 5HLHA 3IC7A 5EG0A 5B66C 2EV5A 1RPWA 3KCCA 3RPQA 1A6IA 5E3LA 1BOAA 4FETA 5DCMB 2HVSA 2HS5A 3U2RA 1YRNA 4OIOF 5JR3A 2BY2A 3GVAA 4ON0A 3ABKH 4IL6C 2EFWA 2QKLB 2ZXWH 4I02A 2E7XA 3R0JA 3OYAA 3S8PA 1U5TA 2DXIA 3QOEA 4R79A 3IWZA 2JPCA 3QODA 4XOPA 2L7MP 2JUCA 2LOOA 4E6KG 2OBPA 3OYCA 3HHHA 4RB3C 1JGGA 3R4KA 1LDKB 4ZDPA 4XR6A 2A6HF 3IV5A 2H09A 2ZMEA 4PCQA 5GP9A 2CH0A 2EZHA 5FLVA 3NARA 1U9NA 4C30A 4FE7A 2RN7A 3CJTB 3L7WA 3PNVA 4O5VA 4G7OF 3BR5A 3GTOJ 5IP9J 4CA0A 3P9CA 3OS1A 1WWXA 3QP5A 4HDUA 1YI2I 2DO7A 5GPCA 2A05A 3FXUA 1ETVA 2JA5J 1NK2P 3Q0UA 1LEAA 3K2ZA 3PUBA 5BQTA 1TLHB 2QM3A 3DPUA 4PSWA 2LMDA 3BG7A 5CJ9A 4HNTA 1FYMA 2LP0A 4E70A 2XRLA 5J8CA 4M73A 3SYTA 4E7SA 2Z3YA 2GLOA 3PO3J 4MGRA 2BY1A 3WG9A 4RM3A 5DM6F 2AS5F 3B73A 3HRMA 2HQRA 4J19A 2K27A 3ZPLA 4A3GJ 1UAAA 2V9VA 3VEPA 1SVOA 2HYJA 2QBYB 3M1CA 2QENA 2L4MA 2A3SA 5L3BA 1ZGJA 4M3DA 2ESNA 2ELKA 3PNTA 4F55A 1JKQC 5GAEJ 1R49A 4FCYA 2PMUA 2OQRA 2CV0A 1WVRA 4I0AA 5DS9A 2JQ7A 3OL4A 3MKYB 1ETOA 2ZJQF 2HVRA 1BI2A 1PVEA 5HS7A 2HQNA 2OJED 1PUFB 2MD0A 3FHZA 1ULYA 2OPTA 2WB1N 4A0XA 3CCJI 1FSHA 1BOBA 5FFXA 3K7AJ 3HOUJ 1KU3A 2FRHA 4EQQA 2XASA 4Q4ZF 3BTCA 4GXOA 1FPQA 2BW3B 1FMWA 1MBGA 2K02A 2K3PA 3BJAA 3O8GA 3CCYA 3IH3A 3QOPA 5KHDA 4QWQA 1IW7F 5FO5A 3CDHA 1GHCA 1UFMA 2L9NA 3GCMA 2NAZA 5H6QA 3OS2A 2R7TA 2LYCA 1MBEA 1D0YA 2L54A 1K83J 3PFIA 3CUQA 4XLNF 5EZGA 1O4XA 3LA3A 4KYWA 2JRMA 1JJ8C 2VI6A 3GF2A 5F64A 3V4GA 2F2EA 4JP0A 3H92A 3VWBA 1XB4A 3DBHB 1MNEA 1R36A 1XMXA 4E7ZA 1F43A 2GM4A 2KJBA 2QLZA 2E1OA 4RDUA 1S72I 1JUMA 2VT2A 5F0HA 4G12A 4RB1A 1KYWA 2CUZA 3K70C 1LKXA 2LBFB 3I58A 4CZZA 4M72A 1FWZA 2CUEA 4IJAA 1XS9A 2DA7A 5LGTA 5GAGJ 1E3HA 4CO8A 2IW5A 1S9HA 2ZFUA 4WK8F 3HRTA 2F4IA 3KYDB 1Z05A 5DCFA 2EIMH 5IY5H 3BR3A 1IG7A 1HBXG 2ME0A 1AOYA 3FK6A 1FYKA 1J5YA 2HEOA 5K5QA 3CO6C 1H89C 3SDBA 2KHMA 3OWTA 2R7UA 4GGGA 3M8EA 1VZ0A 2R7WA 1HKSA 1MMNA 4PFPA 3OR1C 1MJAA 4KJZA 4P96A 4EM1A 4O3MA 3CO7C 4HNUA 4BYYA 5E3OA 4G9YA 4KIBA 2RQQA 5K5OA 3NEUA 3F22A 5GPAA 5EG0B 3M07A 1W36C 5HDKA 1MMDA 2QSGX 1W7PA 3JAMK 1YS7A 2R7SA 2XAQA 2DBBA 5IYDJ 2ZXJA 3RYPA 3TO9A 1TQPA 1UMQA 1WJBA 1R1VA 3I53A 2LDUA 3GTMJ 4CCNA 1KU9A 1K79A 2CW7A 2Y2ZA 1MMSA 1WH5A 2A07F 1U5TB 1VQNI 2Z5UA 3FMRA 3W6KB 2XF5A 3PO2J 5M5YJ 5BNGA 1VQ6I 3S16J 2OTJI 2HNHA 3KX2A 2ZMEB 4A69C 2R7XA 3V42A 4S04A 1QZEA 3HUGA 4M6YA 3CESA 4XKWA 5F04A 3GTLJ 1Z6TA 1WI3A 5ICFA 2R4GA 3TP3A 1B72A 3H1CA 3ELKA 4F92B 2PMHA 1BI0A 1OLTA 3AG2H 1T8IA 1S5LC 1QVTA 3HBLA 4X6AJ 5M5WJ 3P9IA 2FOKA 2O8XA 2Q0OA 3V8JA 2OU2A 2G7HA 2PEXA 4DBRA 1QZZA 2IA0A 4M6XA 3DF8A 3HOSA 5JHFA 2OZ6A 3QP6A 4Y4RA 4CGZA 1ETYA 2HZDA 2E1CA 5ERIA 1CGPA 4DW6A 3TQNA 5L3EA 4F93B 2BOLA 4B8XA 3P7NA 1NTCA 4UVBA 1A36A 2X0LA 1RKWA 3F8FA 5IP6A 1DP3A 5FLXK 4ZYHA 3K2AA 3PFYA 1WSUA 4A2UA 2D5VA 2XGEA 4DGWB 4UHTA 3MD2A 4ANJA 3L2CA 4RB2C 4ZDLA 2F4MB 3HEFA 3COAC 3SZTA 3S2WA 4G7ZF 4B43A 2IT0A 2B63J 5C44J 2QQBA 1XGMA 3ZMDA 4A6DA 5GTIC 4JX4A 4A3BJ 3RKYA 3CCUI 3T5XA 1N75A 3K4BA 1JTXA 3K4JA 1X2MA 1VNDA 2GQQA 1CQTA 2WAQN 1ZG3A 4PJMA 3L2RA 1BJZA 2YSRA 1UCRA 2ESHA 3CC4I 4N9HA 1GLNA 2MLGA 3G1MA 1LJ9A 2JJ7A 1OKRA 4EV0A 5J6XA 5E3NA 2K9NA 4Y3OA 2IA2A 2FF4A 3M1EA 1Z67A 1WKMA 4O6JA 1O3SA 3OYHA 1YIJI 1ENHA 3DPLC 4CH7A 2LK2A 4IQJA 1UZCA 2X6XA 4ESFA 4NNJA 5ED4A 3L9FA 4ENJA 3H0GJ 1WH7A 2W82A 2R5YA 3BJOA 3E1SA 4H0EA 2RVCA 1N78A 1TWFJ 3EUAA 3H3UA 1ZELA 4HX7A 3CUQB 1FEXA 2V6EA 5F1JA 3DEUA 3L1PA 2XRNA 4LMYA 3KIOA 5K5RA 1D0ZA 3HKZA 5IYBJ 2A69F 1OYIA 1I1SA 3OIQA 3DQVC 3HHGA 4KT5C 3CC2I 2LREA 2X85A 4IQ4A 3S1NJ 1H9TA 1OCOH 1ZR4A 3V8LA 1BA5A 4I0BA 3TGNA 2K9QA 3CCSI 1FP2A 1WFXA 2K9MA 2NNNA 3MMYB 1QU3A 2CV2A 1LFPA 3G1LA 4IEJA 4IOCF 4FE4A 2W7NA 4D5CA 1XGNA 4OIPF 2JA6J 2VKEA 4C2MJ 4A3FJ 4ENMA 2Q2EA 1JKOC 1P4AA 3LSJA 2YX4A 4IXAA 1LNWA 3IL2A 3BZCA 4BNCA 2J5OA 3RCOA 2P8TA 2JVGA 2UV1A 5DTDA 3OIOA 4M3BA 4FX4A 1UB9A 3KEYA 1B9NA 1G3TA 4MFEA 2O8KA 3GXOA 1Z91A 3EYIA 3BPVA 2YR2A 5E20A 2VBYA 2XKPA 3IWFA 2DODA 4XK4A 3TO7A 1WJDA 2CU7A 2GXAA 2ZKZA 2JSCA 3BR2A 2AO9A 2L3DA 2VJIA 2R7DA 1IN5A 3VDXA 1MDMA 1X3WB 2ID3A 2JT1A 3LSKA 4LG0A 1D8KA 2Y0SA 3K9TA 4E7JA 1L0OC 2RAEA 3C2BA 2FMYA 1W7PB 2BXYA 5D5XB 1SFXA 2Z1DA 2DA5A 1F36A 1F1ZA 1BN5A 2DI3A 4II3A 2ISZA 2RV8A 3RPUA 2L7FP 3BG6A 5EYRA 1U0JA 2E60A 3KYLA 2ZJRF 2R7ZJ 2M87A 5HNHA 3WTSC 1LEBA 1TZLA 3BTIA 3K1MA 2MBFA 4L0ZB 2M7AA 1APLC 5CQEA 2DYRH 3ZMVA 4NQWA 4ZZLA 2HQ5A 4XONA 4CICA 5F1RA 4CHUA 2ID6A 3HUGB 3LL7A 1KYZA 3J7ZI 1VQ9I 3CMYA 1RKTA 1B72B 3CMAI 2BY0A 2DDAA 2E1MC 5B1BH 4XRSA 2KP6A 2X1CA 1MJ9A 3HJEA 3REOA 4ZDOA 2EFNA 3RI4A 4BBSJ 2RGVA 4KICA 2BE5F 1I50J 1FOXA 1ZKGA 5D4SA 2G9WA 3OS0A 1FT9A 2Y69H 3GBGA 4UB8C 4IO9F 1D5VA 4NC8A 1ZRCA 4NC6A 1K4SA 1QVUA 2HR3A 4G6TB 5LEKA 3F6OA 1NH3A 4IF4A 3Q0WA 5JLWA 4B3XA 2WY8Q 2PQ8A 3BG5A 3EUHC 4HF1A 2C6YA 1T0FC 5HOOA 3G6EI 3KP2A 3HSEA 4BXUA 1U2WA 2VBXA 3JRDA 5JI6A 5FKKA 3N4MA 2ISYA 3KLNA 3M4OJ 5KCMA 2VOOA 3NQOA 4MEYF 1X58A 2CQNA 3DKXA 3IRQA 2XB5A 3OL3A 5LD2C 1RUOA 2M9HA 3Q0VA 1S8NA 2LY2A 3A1YA 1R5HA 1J2XA 3EUKL 5FKMA 5ICGA 3AFHA 1HKTA 1VQ5I 4U0VA 4OIQF 4AYBA 3K0LA 4LIVA 3OYIA 3KEQA 1JHFA 1I3QJ 1TQMA 1ZGAA 1SFUA 3WHCA 2X1DA 1MH3A 1DPUA 2MSYA 3DP7A 1UJ8A 4XRMA 2E35A 3A03A 3LQRA 5LRSA 2EPFA 2VJ4A 3DXJF 1TT5B 4XSXF 5FB2A 1VQPI 1Q1HA 5E17F 1UHMA 1BC7C 3HDDA 2E34A 2M30A 1AKHA 1X4OA 3BC8A 2IGNA 2BXZA 2OCCH 1IN4A 3KP4A 4M9ZA 4M9SA 2XB0X 4DJAA 4EM0B 4UVAA 3D1NI 4LB6B 4M3EA 3S93A 2R5YB 2BYVE 4BGDA 1P92A 3GFIA 1Z3YA 4YIIA 2M7BA 2RQPA 4BUPA 3F8MA 5BOXA 2LH9A 4S05A 2XSJC 5HS8A 1K7AA 2FNAA 1V54H 1WCMJ 2H1LA 3T8RA 3S17J 3U1KA 3H9GA 3BG9A 3B6CA 4KITB 1ZREA 2NNYA 3EPZA 2UXXA 2JTVA 3OYBA 1BR4A 1EJ9A 5DD8A 1OYYA 3CDIA 4HOBA 3E7LA 2CRGA 4L9JA 3JRBA 1TWGJ 1G6NA 2UXNA 4RAYA 3RYRA 2WV1A 3SZPA 1K6YA 2IGMA 5LRRA 4ZTJA 2Q2EB 2HZTA 1HDDC 2HOSA 3DU6A 1QNTA 3E6MA 5AONA 2CS3A 2ZC2A 5ICEA 2VOPA 4OINF 3S3OA 4R1HA 3TOAA 3N05A 1V5GA 2DA2A 1IO2A 1LVKA 2JSPA 2IGKA 4CYDA 3I0TA 5HS9A 2DQRA 5TJJA 3VB2A 4BU2A 3VYRB 2ZXIA 3HZJA 4X1EA 1YG2A 2EJRA 1QQIA 4RGRA 2X48A 1IV8A 1ON1A 3KZZA 4BXXJ 4QPOA 3HTUA 2FE3A 2L9VA 2P6SA 2F5VA 1IUFA 3ZRGA 2FNPA 4Y15A 3DKYA 3K4LA 4IPAA 2DT5A 3DEWA 4HNVA 1YJNI 1MDMB 5AIPA 1O3RA 2BBYA 4LG0B 5TGTA 4I76A 1F4KA 3EETA 2JA8J 4MNUA 3W6VA 5DM7F 4DBQA 4ZYDA 3UNGC 4CDGA 1HCRA 3GEZA 2CUJA 3ZMSA 1WQ2A 1YS6A 2IBDA 4PJJA 1JKRC 1D1BA 4S0HB 1OCCH 4QSHA 3VYUB 1LUJB 2ME6A 4NUBA 4M6VA 4AC0A 2E1MB 2VQLA 2ZJPF 4HX4A 1R00A 2XGDA 4CCMA 2M0MA 2RDPA 4NQWB 2H27A 1IRFA 2DCEA 2L7KA 1USTA 2W24A 4HW0A 4WXHA 2OF7A 1SAXA 3PUFA 4ASNA 4WCGA 2AQEA 2PMZA 2RC4A 1D1CA 1MMAA 4JOMA 3F21A 4EJOA 1U5TC 2XKOA 3OYMA 2JRTA 3GO5A 5FKNA 1VQOI 4KN7X 4F91B 4HX8A 1O7FA 1XTAA 3NRVA 4DNCA 1IGNA 2O61A 4N0BA 2VN2A 4HZFA 4DIQA 4ZYAA 1K61A 3VOEA 1RR8C 5GTHC 3S3MA 3V7RA 2ZMEC 1XCBA 4HYEA 3DKWA 2LC2A 5E1ZB 1JXSA 1BW6A 1H0MA 2DU9A 3H5RA 3CCMI 3WG7H 2NVQJ 4WF2A 2KLOA 3KE2A 4XRFA 5LHIA 4BQQA 5HVQC 3H9JA 2K9SA 4TV7A 1UHSA 1TNTA 3LQQA 1GVJA 2HDCA 3ZQHA 2K9LA 2K7LA 5KK1A 4FX0A 3W6JB 5HLTA 4ZJZA 2FQ4A 1J09A 1X3UA 3I59A 1XDSA 2E36A 1I1GA 5E79C 1YITI 3RSNA 2EBIA 2W1OA 1VTNC 1VQKI 3CD6I 3SHFA 4Y52J 2CQXA 3ZQ7A 2OC6A 2NVUB 2VKHA 2VJJA 2G7UA 3SDGA 3V8KA 4D0PA 3I55I 3CCVI 2W4SA 4KFCA 1FOKA 4ZYEA 3BQYA 5JVGF 1ZQ3P 3I71A 4AD9A 2DFFA 4NBQA 1DP7P 3OYNA 2JWTA 1WJEA 2CQKA 2HVQA 2N8GA 3FXRA 4IHVA 4JBAA 4K2EA 1WJ5A 3RKXA 5C3EJ 4KN4X 3JRAA 2X4HA 1JJ6C 3HOWJ 2QSFX 4PJNA 4X0GA 1JKPC 3RIRA 1D1AA 4AYBN 4GFBA 2JPBA 2Y30A 3OYLA 3DEEA 1YFHA 4A3MJ 1R4MB 3DTEA 3CMMA 2CUFA 2RREA 2RNJA 2CSOA 1FZPB 2EZIA 1XG1A 4BE2A 2P5LC 2V9PA 5FD5A 3ERMA 3I54A 4NDLA 2R5ZA 3ERED 5DYMA 3DPTA 3O6BB 3H0DA 2YUSA 3M3YJ 3ONQA 3HOYJ 1U6GA 4ZH4F 4I6ZA 1OCTC 3CUQC 3S3NA 2FJ1A 2FEZA 2K4BA 1G2HA 3R6SA 2BY3A 3QU6A 2VQGA 5CVIA 1GDTA 1OCPA 3HG9A 1IRGA 1EA3A 3FXJA 2F5CA 3OMYA 2GIVA 2NS0A 1WI9A 4U7DA 3FXKA 4CCKA 4FTHA 1RNLA 4AWXB 4YRVA 3VFZA 1TC3C 2VKVA 4WX9A 3S2DJ 1W7PD 2Y9ZA 2L7ZA 1H88C 3WTYC 3LWFA 1HQCA 3QPSA 2K85A 1EH8A 1P9QC 4A3IJ 5K1YA 2O7OA 4YELA 4RB0A 1S7EA 2LF8A 4LFUA 1IXCA 4RMNA 3OSFA 2GOXB 2BHYA 1ZRDA 4U87A 3RTRA 1WHUA 3MZ8A 1Q1VA 1KQ8A 1IRXA 2V1NA 1FBUA 1W5TA 3KP6A 1Z3XA 1A31A 2VC1A 4XBFA 1L3LA 2Y31A 2R92J 2H6CA 3ZOBA 1OJLA 3FM3A 1FOYA 1V3FA 2XC7A 5CVUA 5K7FA 1XPXA 2XHKA 3U1DA 4A6EA 2XUBA 3K10A 4IHYA 3CJRB 1IN8A 4MLOA 1ZN2A 1YRNB 3HPHA 4E7LA 4A3DJ 1T95A 4P9UA 3HOZJ 2QQ8A 3HOXJ 4AM3A 5TRDA 2EZKA 2FD5A 3QYFA 5K7ZA 1ZARA 3PSFA 1O3TA 2VIXA 3ZQQA 3HOTA 3CUOA 3JRGA 4Z6YA 2F5DA 2I8DA 2X6WA 2ADUA 4BKXA 2W84A 5D8LB 1MBFA 1SD5A 2CWEA 1XC5A 2D1HA 2F4OB 3KZYA 4UV9A 3W2AA 3PJRA 1MSFC 4OMYA 5EDNA 2VODA 2JA7J 3WTZA 1LPQA 1NK3P 3VODA 2KRCA 1QPIA 3H35A 2DT7B 3IUOA 4BQNA 1IF1A 2O9LA 4BXFA 1AA7A 4WXDA 4XN3A 2HXIA 4L5EA 4P1WA 3JAMZ 1VQ8I 4LLNA 4MO7A 1Z7UA 1W0TA 1DQUA 3F8BA 3KFWX 4GCVA 4KMUX 2ACJA 2EIJH 3BQZA 3ZN0A 2H6BA 4HF2A 3CZ6A 3L2WA 1B4AA 1CF7A 1T38A 2D2WA 2PJRA 3D5LA 2FU4A 1AHDP 3C2GA 3BDDA 1F9NA 4I7HA 5LHHA 5LFAA 2QYOA 4BS9A 1FBSA 3TO6A 3NAUA 1RI7A 1SANA 3UR3C 2DOFA 4L18B 1D8JA 3A02A 4UV8A 1HLVA 3LSRA 1X1DA 1W4MA 1XX5A 3DFGA 1Y39A 4ENKA 1R5ID 3HOVJ 5J1YA 4OOIA 3ZGKA 3OYKA 3I59B 3CP2A 5ILVA 2B9SA 1ETXA 1P2FA 3LSTA 6PAXA 1X1PA 2KZGA 3K4MA 1MBJA 4JK1X 2PN6A 4C2TA 3GZNB 1HSTA 2EINH 4A3EJ 2PLYA 4W97A 2NS8A 3MQ0A 2ZXHA 3GUDA 5ILUA 3R0AA 1ZAOA 2XVCA 5FLXZ 4IHTA 2HU9A 1KU7A 3H3ZA 1TNSA 1LFUP 1X1BA 4B4CA 5J1UA 4U0YA 5J4YA 2HQAA 5C4XJ 1YX5A 3QPHA 2NXNB 1MSEC 4KIGA 3KP7A 1X1AA 2CW0F 2EILH 2DW4A 2MD5A 3C7JA 1LDDA 4LK1F 3W2VA 2XAUA 5F0FA 1XGSA 4XRSG 3A0BC 3FF5A 2XAJA 1S7AA 1YJWI 3FXQA 5DEQA 1RC9A 4ESJA 2NRAC 4C3JJ 3GFLA 3EQLF 5FKOA 4LJZF 4P55A 1D3YA 2QWWA 3K4NA 2M8GX 2R5ZB 1SFOJ 3JTHA 2V26A 4XOTA 4QIWN 3HSRA 5E18F 2LD5A 4A12A 1U78A 4MTDA 1OYWA 2GBYA 3R60A 1G59A 1W5CC 4Y33A 1LFBA 1ZK8A 4C2UA 3J81K 2AQFA 2QSHX 3GTPJ 2WBMA 5D4RA 2DA3A 3BZKA 1ITYA 2G0EA 4BE0A 2HI3A 2XPWA 1YLFA 2E7WA 4IRGA 1P4WA 3TP0A 2EV6A 2M4GA 1RUNA 4BQOA 1BIBA 2L9SA 1FOWA 2VE8A 5F08A 3PL8A 2VB6A 2ECCA 3O3KA 2P81A 2KIQA 3S2HJ 4BBRJ 1U8BA 4HA8A 2OTLI 3I9V2 4GYIA 2YU9J 2VBWA 2A61A 2H94A 3IH2A 1MH4A 1S29A 4I2OA 1KONA 5BPIA 1Z9CA 3CMEI 2ECBA 1BIAA 1TWAJ 4FASD 3WGIA 2D1VA 3NWTA 3RPUD 1B6AA 3J81Z 1LE8A 2NVXJ 9ANTA 2GIZA 3I64A 5E3MA 1XSXA 1ZRFA 3L2UA 4HDVA 3GYHX 3OV8A 2XF6A 2MC4A 4UY8I 3KLOA 1QRYA 1HC8A 2LSOA 3KEOA 5IT9K 2B0LA 1DPRA 4HSTA 1U9OA 1Y56A 3K4CA 1ONVA 3HTSB 4MIMA 1FX7A 2E2HJ 1ODDA 4NC7A 1WRJA 4CUGA 4JYKA 2I5UA 2Z99A 5HLIA 2JK3A 2FXAA 3WGGA 3QRFF 3BG3A 5CYVA 4ZTFA 2E1NA 3ESWB 4F52A 1A5JA 4KMFA 1H9GA 3S14J 4A93J 3CP8A 3LSGA 3Q9VA 4A5MA 5EEAA 1TP4A 1UELB 2O0YA 2OA4A 4XKBA 2STTA 3HIFA 2WAEA 3OIPA 2MW8A 1SD6A 2K86A 3ZQIA 2LNBA 3FZVA 1GV5A 1JGSA 4XL9A 2KZVA 2LKXA 1WGXA 5L3FA 3DBRB 3OYEA 2L01A 3WTXC 1G8XA 3OYGA 4BEHA 4EMSA 1OR7A 2DAOA 5DCMA 3CJNA 3WTVC 2QZ8A 3T0YA 3HM5A 2NVTJ 1GUUA 2FBKA 1YOVB 2HYGD 3BR0A 4V2FA 3BPXA 1BI3A 4HG2A 2KL4A 4PGGA 1Y0UA 4DOZA 5DDGA 3J80K 1EH7A 1OQYA 1P6RA 3F8NA 3QWLA 3JTGA 2BEOA 2KIMA 1JT6A 1CF7B 5M3MJ 2XGXA 5E8IA 4LLLA 3BWGA 1ZLJA 4FISA 2Z9OA 1ZHFA 2H8WA 2UWMA 1J75A 3A0HC 3ULQB 4M9XA 2A6TA 3WODF 1B8IA 5FLMJ 3A4CA 5JVTA 2P7CB 4HQEA 1F5TA 3BP8A 3VPRA 1JUSA 3Q9SA 4G6DA 3CCEI 3MN2A
chains in the Genus database with same CATH topology
1E3PA 3U1KA 3H36A 3H1CA 3GMEA 4AIDA 4NBQA 3CDIA 1WHUA 1E3HA 3GLLA 4AM3A 3GCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E3P A;  3U1K A;  3H36 A;  3H1C A;  3GME A;  4AID A;  4NBQ A;  3CDI A;  1WHU A;  1E3H A;  3GLL A;  4AM3 A;  3GCM A; 
#chains in the Genus database with same CATH topology
 4HRI A;  3ZQF A;  2XIG A;  3K1P A;  2KDZ A;  3E6C C;  1PP8 F;  3CTA A;  2DT6 A;  4E7K A;  4A3K J;  2GZW A;  1W5S A;  5JLX A;  2XSD C;  1MBK A;  1ETW A;  5IPA A;  4I09 A;  3BTL A;  4C3H J;  5LEJ A;  2FML A;  2OZU A;  2R0Q C;  4FQG A;  4XLP F;  4HQM A;  1GV2 A;  4CCJ A;  1MJB A;  3ZMT A;  2MC3 A;  3MAJ A;  4FHT A;  4KNY A;  3AL0 B;  2R3S A;  2COB A;  4OWR B;  2A68 F;  2DK5 A;  4EGY A;  1ZYR F;  4G6Q A;  2XDV A;  1HSJ A;  1R5G A;  2IS4 A;  2NOJ B;  3K6G A;  3I5U A;  2Z2S B;  5FD6 A;  3JSP A;  3CCQ I;  2L4A A;  1I5Z A;  2HTS A;  4G7H F;  3S1R J;  3ABM H;  3MFK A;  5J47 A;  3C3W A;  2P0W A;  4RLF A;  4RA2 A;  1RET A;  1J59 A;  3BTJ A;  2CYY A;  5D8K B;  2DFH A;  4MQV A;  3UKG A;  3L09 A;  5HDN A;  2AHQ A;  3LSM A;  1FSE A;  3BY6 A;  1X1C A;  2DFI A;  4B44 A;  3HRU A;  3H5N A;  4L5I A;  2IP2 A;  3SEQ A;  3DLL F;  2EWN A;  1XD7 A;  3CJQ B;  4CCO A;  2E71 A;  3ABU A;  2ZBK A;  1DDN A;  3CCR I;  3H3V K;  2KFD A;  2X6O A;  1HDP A;  1MD0 A;  1XN7 A;  2KIS A;  5EZH A;  5BPD A;  2J5P A;  1HXD A;  5BS6 A;  1TQI A;  1FJL A;  3FHN A;  4HF0 A;  3IKV A;  4XLC A;  2BHZ A;  2A5Y B;  1SFK A;  2GXG A;  2BW3 A;  1ZG5 A;  3E5Q A;  2FQ3 A;  3RZD J;  1P7I A;  1BM9 A;  4UVC A;  1FC3 A;  3LOC A;  1B1B A;  2OQG A;  3CF5 F;  5A2Q K;  4D9J A;  4U88 A;  4L9V A;  4KDP A;  4A3J J;  1LDJ A;  4A5N A;  5CKT A;  1GXQ A;  2LKP A;  1ORK A;  3SXY A;  5D5U B;  3QYE A;  4JQF A;  1E3P A;  2MFZ A;  4XNF A;  4BAY A;  2YU3 A;  5EEH A;  3FWE A;  2DTR A;  3HKZ N;  4II2 A;  3TMO A;  4IHS A;  2DMQ A;  4RGX A;  3ML6 A;  4HBL A;  2P5V A;  1SMY F;  3S1Q J;  4UNO A;  4AID A;  4BY1 J;  1JT0 A;  1VQL I;  4ETS A;  3KET A;  3WE2 A;  4B09 A;  1GVD A;  2E19 A;  1YW8 A;  1T56 A;  3K1N A;  5J3L A;  1QZY A;  2I10 A;  5IT3 A;  4BH9 A;  5LHG A;  2PX9 A;  3C2H A;  5L3D A;  2ZJ2 A;  3IRR A;  1FBQ A;  2HOE A;  4BHP A;  4KIF A;  3TL4 X;  4ZC3 A;  3VYT B;  3ZN1 A;  2WAF A;  4PFO A;  5HDG A;  1Y8R B;  2GA2 A;  1OCZ H;  1RRJ A;  2PI0 A;  2CFX A;  2O5R A;  3BJ6 A;  1OCR H;  3D5S C;  3ROU A;  1IDZ A;  3RQI A;  2LY9 A;  4XN0 A;  4E7H A;  4IRI A;  3TOB A;  5CQG A;  2IAI A;  3JRH A;  2HKX A;  2GOM A;  3DTI A;  1UG0 A;  4BJT A;  5B5E C;  1ZGW A;  4UUT A;  2E5N A;  3FMS A;  2OCE A;  5D6F A;  2PJP A;  1VFC A;  2ZB9 A;  4ZYG A;  4CXF A;  1QHH D;  3M7G A;  3ECH A;  3CLQ A;  4AVP A;  2MH9 A;  4UXN A;  2V1U A;  4HAM A;  1WJA A;  1ACI A;  1OIS A;  2X6Y A;  2DPD A;  3FKJ A;  2VPR A;  1T08 B;  1R23 A;  1NHA A;  4JX6 A;  2KDO A;  4QLC U;  1HF0 A;  2Z33 A;  2Y0S N;  2EFP A;  4BEH B;  4GDF A;  3AG4 H;  3SQN A;  5CVV A;  1E17 A;  5H20 A;  4D5F A;  3F72 A;  2WAD A;  2PG4 A;  4ENN A;  1QHG A;  2DPU A;  3SJM A;  2KMU A;  3LFU A;  1FLI A;  2BVL A;  4RGU A;  4PDK A;  2A5W A;  4CSW A;  4Y13 A;  3S15 J;  1I39 A;  2W48 A;  1TW2 A;  2KJC A;  3KP5 A;  1IRZ A;  4QPQ A;  1TT0 A;  2R7R A;  2LR8 A;  3GW2 A;  1AWC A;  1JI8 A;  1P4X A;  4R8H A;  1R71 A;  4DZJ A;  1B8I B;  1XMA A;  1ETK A;  5D5V B;  2WY7 Q;  4AUX A;  2XAH A;  1WZ2 A;  5B1A H;  4XLH A;  3PQJ A;  3ASO H;  2H8R A;  5FRM A;  1N25 A;  2R7V A;  3RKQ A;  2JVH A;  2Y48 A;  2ZNZ A;  3FXL A;  3D5R C;  2STW A;  1HA8 A;  2DA6 A;  3HPG A;  3ECO A;  4GO1 A;  4XKC A;  2CGP A;  3MKL A;  2BV6 A;  2V1X A;  1RIO H;  3C18 A;  3PM1 A;  4Z2Y A;  2JN6 A;  2X51 A;  1SC7 A;  2R7F A;  2XV4 S;  1STZ A;  2WAQ A;  1PP7 U;  2M4K A;  1DU6 A;  1KQ9 A;  1TW3 A;  2YS9 A;  4LB5 A;  3IAM 2;  2VT3 A;  1X19 A;  5CVR A;  4BHB A;  1SMT A;  4MEX F;  3DWL E;  3FM5 A;  4A0Z A;  1VQ7 I;  2DMN A;  5CLS A;  3O2P E;  2HYF A;  3QQA A;  2LF7 A;  1A04 A;  3SFI A;  2AXT C;  4LLG F;  5EJC A;  3AG1 H;  2LFB A;  1IDY A;  4IZZ A;  2VLA A;  1AKH B;  2BGC A;  2MLK A;  4YIR X;  1ZLK A;  4RLQ A;  1K78 A;  4PZJ A;  3MVP A;  4BDZ A;  3CF2 A;  4HV6 A;  5B3S H;  2FUG 2;  3K70 D;  1M1E B;  5FRO A;  3RJP A;  2LTP A;  4AU7 A;  4NHJ A;  1KA8 A;  3WE3 A;  2LLK A;  1OFC X;  3B6A A;  5DD4 A;  2L5Q A;  3G1O A;  3LSH A;  2ZSI B;  2OAZ A;  5JFR A;  2IS2 A;  3MKW B;  4BQA A;  2YPR A;  1X4P A;  1T98 A;  1XCV A;  1EH6 A;  3QPT A;  4GRI A;  2TRT A;  1R7J A;  3F23 A;  4RM2 A;  5L3G A;  1JHH A;  1N77 A;  3BRO A;  2RNG A;  4XID A;  2L02 A;  2YX7 A;  3I56 I;  1LQ1 A;  1ON2 A;  5AIQ A;  2V1D A;  4PSX A;  1R9T J;  4H4K C;  5E8G A;  2HDW A;  4E4H A;  3OOU A;  4LD5 A;  2OUM A;  4UB6 C;  2P5K A;  3LFK A;  3P5J A;  2VAS A;  2Y0M A;  3HYI A;  1XSD A;  4UUS A;  4XSZ F;  3MEX A;  1V55 H;  2AXL A;  4LGW A;  2HFH A;  4OMZ A;  2MYS A;  2WTE A;  1K4T A;  4QTR A;  2FBI A;  5CPR B;  3J7A Y;  4IX7 A;  1YYV A;  4BDY A;  2Q1Z B;  1S7O A;  5TIS C;  4Y17 A;  4EM2 A;  3E5X A;  2VPL A;  3E6D A;  2K3F A;  4LIT A;  1W36 D;  3FIS A;  2EB7 A;  3ZR8 X;  1XGO A;  2DK8 A;  4DZP A;  1ZG1 A;  2EQR A;  4YEJ A;  2LG4 A;  5FFZ A;  4MHG A;  1VQM I;  3GTG J;  1I6H J;  3H36 A;  5FJ8 J;  4HEA 2;  2EFO A;  3F9K A;  5ILS A;  1BJA A;  1I3A A;  4N4N B;  1U8R A;  2MGQ A;  3QAH A;  4KT6 A;  4MQ9 F;  2BZT A;  4A3C J;  1U3E M;  3GME A;  3F6V A;  1SAU A;  2DJI A;  3P9K A;  3IH4 A;  4C9Y A;  2F48 A;  1HKQ A;  3M8J A;  5H2F C;  3TW6 A;  2W57 A;  3AG3 H;  3VYS B;  1POG A;  4HPQ A;  1BW5 A;  1B9M A;  4ABZ A;  2L0K A;  1E2X A;  1BR2 A;  3M9A A;  1FIP A;  2X9D A;  4IOA F;  3BR1 A;  3E6B A;  1QGP A;  3OR2 C;  3L00 A;  2R7Q A;  2EH3 A;  2HXO A;  2TCT A;  3E97 A;  5M5X J;  1C0W A;  3MZH A;  2NOG A;  2Q8K A;  1E3O C;  2JA2 A;  5HOD A;  4RAG A;  2E2I J;  3FDY A;  1T39 A;  1Z21 A;  2A6E F;  5DUI A;  4JX5 A;  4XMY A;  2CFO A;  2F6C A;  3J7Y J;  2CO5 A;  2KIF A;  2KIU A;  2NVY J;  4D7N A;  1LB2 A;  2XRO A;  1UG2 A;  4MTE A;  3KZI C;  3I4M J;  2L2O A;  2DMU A;  3G2B A;  4Q47 A;  3V7S A;  5J4V A;  2VJ5 A;  1TTY A;  3X2Q H;  1FTT A;  3E5U A;  1SFE A;  2ZO4 A;  1MNM C;  1J7K A;  4Y7N J;  4N4O B;  5E1X A;  2JZY A;  4N9I A;  2XAF A;  1S3J A;  4XOR A;  3OYJ A;  3K4K A;  1PDN C;  1QO0 D;  1P7J A;  3SZG A;  1O3Q A;  3FX3 A;  4IKF A;  2V9K A;  3G4S I;  3C1D A;  2VXD A;  1R1T A;  2D45 A;  1SD4 A;  1VF9 A;  1Z7L A;  3OYD A;  3KP3 A;  3D0S A;  4D1Q A;  4EEF G;  2CMP A;  4IHX A;  2VON A;  2HDD A;  1IN7 A;  1SVL A;  2PMZ N;  3AAF A;  1E0E A;  3DBL B;  1Z6R A;  2FX0 A;  1O57 A;  3WU1 B;  1R1U A;  3HSF A;  5F0C A;  3MWM A;  2QEX I;  1S6L A;  2FA5 A;  4B1R A;  2UZK A;  1YE9 A;  3OY9 A;  3RZO J;  1MW7 A;  3CLO A;  2XAG A;  3HRS A;  1DUX C;  2Y9Y A;  1EF4 A;  5GAD J;  2QQ9 A;  5ICC A;  3LSP A;  1IV6 A;  3SEZ A;  1TBX A;  2M34 A;  2O3F A;  3FKI J;  3KPH A;  3A01 A;  3GFM A;  2NYX A;  3LSI A;  3W2W A;  1MND A;  3TBI A;  3G73 A;  4V19 K;  1IN6 A;  4P9F A;  5J1R A;  2L9R A;  4LOC A;  4OAY A;  3F0C A;  2IVM A;  1R6R A;  2QCO A;  3TDU C;  2HTJ A;  1R22 A;  3PNY A;  4A3L J;  5KAI C;  2BVM A;  2HOA A;  2HGC A;  1FIA A;  5LGN A;  3DCF A;  5D5W B;  3T1B A;  2HPM A;  5KVR A;  3J7A O;  3MZY A;  4ZZD A;  3AL0 C;  3PQK A;  1FMV A;  3OSG A;  4KA4 A;  4XLA A;  4D7M A;  2CJJ A;  2TDX A;  4BL0 B;  4LK0 F;  4RAZ A;  3JRC A;  2IEK A;  1K78 B;  2ZCW A;  1TL8 A;  1Y6I A;  4RAF A;  4BJ5 C;  4RBO A;  1DU0 A;  3W3C A;  4B3A A;  3QU3 A;  1UHW A;  2DFE A;  4I98 B;  1T6S A;  2W25 A;  2DA1 A;  1O7L A;  1XSV A;  1A35 A;  3PIP F;  5HLG A;  2M1B A;  3GFJ A;  4I99 C;  1MIJ A;  4OU0 A;  4XKV A;  2ETH A;  1DGW Y;  1TWC J;  3BCA A;  4DYC A;  1VI0 A;  3N97 A;  2GWR A;  2JMW A;  2GA1 A;  4CZC A;  4BJ6 C;  4F7Z A;  1KU2 A;  1A6Q A;  4HLY A;  1NG6 A;  2XGC A;  3GTK J;  2K5C A;  3ZXS A;  2QQA A;  1Y1W J;  5EGO A;  3GLX A;  2WV0 A;  2VKD A;  2CG4 A;  2VE9 A;  3ZMZ A;  5EF6 A;  3FXO A;  3ZQL A;  4P5O A;  1SVM A;  4EJT A;  4UUS B;  3FBN B;  1FY7 A;  2EA2 A;  2M2E A;  2DN0 A;  3BR6 A;  2VXZ A;  3CQZ J;  1Z77 A;  2CQ7 A;  1YHQ I;  2HKO A;  4M3G A;  2VQH A;  2M3A A;  4EJV A;  4KIS A;  1JTY A;  4WXC A;  1V4R A;  1USS A;  4CYC A;  1EKE A;  2VL8 A;  3WTW C;  3HXL A;  3CCL I;  1K6O A;  4M3F A;  1W1W E;  1REP C;  2K40 A;  1HW2 A;  5IYC J;  1YTY A;  5D6E A;  3BT9 A;  2CV1 A;  2KRH A;  3RQ4 A;  1T2K A;  2KRF A;  2P6T A;  2PFB A;  2DYS H;  5F6F A;  1FNN A;  2EA4 A;  2GAU A;  4PJL A;  3VSL A;  1V5E A;  1X2N A;  4IHW A;  3HGG A;  4UUV A;  2ZSH B;  1MBH A;  3I4P A;  3RDI A;  2EZL A;  2XPU A;  1YIO A;  2WWY A;  1BI1 A;  1MMG A;  2EV0 A;  3E0J B;  4YFX F;  1FYL A;  4XQF A;  3JW4 A;  1YW9 A;  2DMP A;  3R61 A;  4W1U A;  2HWV A;  4YIF A;  1RES A;  2QA4 I;  3L2V A;  5M3F J;  5DUK A;  1ZR2 A;  2Y75 A;  3GWZ A;  1OMI A;  3JR9 A;  3LMM A;  2IA1 A;  5H6R A;  1PUE E;  3MKZ A;  3V7C A;  1GXP A;  1Z1D A;  4PK4 A;  2KQR A;  2M45 A;  2O03 A;  3E3V A;  3G3Z A;  1MKM A;  1WJF A;  3QYB A;  5IT9 Z;  3A2K A;  1XMK A;  2M0C A;  2VQC A;  1IAW A;  3JRF A;  3FXM A;  2V79 A;  4L5J A;  1HW1 A;  5DV5 A;  2ELJ A;  1I6X A;  1W0U A;  1RZ4 A;  2ICW G;  4M71 A;  3U9G A;  3GX4 X;  4IRH A;  1ZH5 A;  1HW5 A;  2FSW A;  4YFK F;  1FP1 D;  1HOM A;  2LKS A;  4B47 A;  3HB9 A;  2GXB A;  2F5E A;  4ESB A;  2H1K A;  5F27 A;  2LVS A;  3ABL H;  2JUG A;  3WGH A;  3WU2 C;  4EJU A;  2IJL A;  5HNF A;  3MCZ A;  5LLQ A;  1YQA A;  1Y1V J;  2PBI A;  1OR7 C;  2COM A;  3L2Q A;  3ISP A;  3GZ6 A;  2PJR B;  1J9I A;  4LG3 A;  4XIC A;  5LGU A;  3QPL A;  2X1E A;  1YW7 A;  2M8E A;  4LIU A;  1G3Y A;  3FK7 A;  1IXS B;  1WJC A;  2CQQ A;  4GYG A;  3ZP5 A;  1EV7 A;  1BBY A;  2EFQ A;  3JRE A;  4AIK A;  2W00 A;  3PSI A;  1IC8 A;  1IXR C;  1Z0X A;  1R58 A;  3OYF A;  2DMT A;  2WC2 A;  3EUH A;  3DU5 A;  4BY7 J;  4AVZ A;  1T0F A;  2EIK H;  2LY1 A;  3LAJ A;  3BCB A;  3J80 Z;  2V4J C;  1MZB A;  4E7I A;  2IS1 A;  3RKW A;  5JHU A;  3DV8 A;  1YJ9 I;  3OOP A;  4I01 A;  1Y8Q B;  2VBZ A;  3BOQ A;  3A01 B;  3LAP A;  3G71 I;  3EDP A;  4WWC A;  4FT8 A;  4OAZ A;  5BMZ A;  1G4D A;  2V6C A;  3KYC B;  2XF7 A;  1ETQ A;  2ZNY A;  1ZTR A;  3B02 A;  3H9Q A;  4DYQ A;  5FRN A;  2FOW A;  3PIO F;  2QKM B;  3F3X A;  3ZQC A;  3FMQ A;  1KGS A;  4IVN A;  4MFD A;  5IOY A;  4YFN F;  1X3Z B;  3T8T A;  1SD7 A;  2WB1 A;  3Q5F A;  3GZ5 A;  4CCL A;  4V2G A;  4DQ2 A;  3HC7 A;  3ZCO A;  2V7F A;  3HL2 A;  3WHB A;  3CC7 I;  4J01 A;  2QBY A;  1RR7 A;  5C4J J;  5J8F A;  4Q5S F;  1OPC A;  2R7O A;  4B48 A;  2HPI A;  3TKY A;  1IJW C;  2F5F A;  4EAT A;  1LVA A;  4HSR A;  4BAC A;  3ZQG A;  3BLY A;  4EVI A;  3LNQ A;  1Y0N A;  3BZ6 A;  5E1W A;  1IUY A;  2DDB A;  1PUF A;  3IP4 B;  3ASN H;  1AU7 A;  2P7V B;  3I4N J;  2DA4 A;  4BHC A;  2IS6 A;  1SEU A;  2MH2 A;  2UUZ A;  3H5A A;  4RS8 A;  5KNL A;  3IKT A;  1TWH J;  3Q3S A;  3M8F A;  1J0R A;  4EGZ A;  2EK5 A;  3VSK A;  2P4W A;  5GAH J;  5K7H A;  2DQL A;  3SFZ A;  5EGO B;  3O8H A;  4XLE A;  2ZFW A;  4ITV A;  3WTU C;  5IP7 J;  2Z16 A;  2DJN A;  3WTT C;  1XDU A;  5FKL A;  1QA6 A;  1FTZ A;  3WU0 A;  4AIJ A;  4L9N A;  1H8A C;  4EJW A;  4RGS A;  1G3S A;  3IAS 2;  3TW7 A;  5L3C A;  1I27 A;  3JSO A;  3I3L A;  2IRF G;  2VC0 A;  4HLX A;  1VQ4 I;  3FBI B;  4XM3 A;  2MA3 A;  1QPM A;  2R93 J;  4NB5 A;  2ELH A;  4BE1 A;  1R4N B;  2DLL A;  2OV7 A;  1B59 A;  2OD5 A;  4YG2 F;  2FBH A;  2KPM A;  3FIW A;  2MG4 A;  3TED A;  3K69 A;  3GTQ J;  4PJ0 C;  4U0W A;  2QF7 A;  4CYC B;  3U21 A;  2E5Z A;  3LA7 A;  3LA2 A;  4Q48 A;  1JUP A;  5J40 A;  2DOA A;  1IZ1 A;  1KZH A;  3TDZ C;  1JE8 A;  1PJR A;  3DTK A;  4AIH A;  3ZMU A;  1BR1 A;  3ABT A;  2DOE A;  4XLF A;  4C3I J;  4L9T A;  4A0Y A;  2VUM J;  1LE8 B;  5A2Q Z;  2MAB A;  1PYV A;  3GLL A;  1YO5 C;  2HOT A;  2WA0 A;  4OIR F;  4PUS A;  5IOZ A;  4U7B A;  1D5Y A;  2LBF A;  2LRD A;  1V5F A;  3DLA A;  4L0Y B;  4DYR A;  1WPK A;  3EYY A;  3S32 A;  5LBQ A;  1MGT A;  2IPQ X;  1GT0 C;  5EEG A;  4KUM A;  2DTZ A;  2KT0 A;  2QUF A;  1QBJ A;  1ERD A;  3JRI A;  5CVJ A;  1T33 A;  1D0X A;  2KKO A;  3F8C A;  2O6G E;  1KQ0 A;  5FGM A;  2K4J A;  2QGU A;  1DGR M;  2W85 A;  2RKH A;  4G94 A;  4F3Q A;  4J00 A;  2M5W A;  4PGH A;  1NG7 A;  4M74 A;  3AKZ A;  2B7E A;  2IGO A;  2IXS A;  3GTJ J;  1YX3 A;  1BC8 C;  3CDL A;  3HGY A;  2CW8 A;  2XPV A;  3JCU C;  4HV5 A;  5KAF C;  2E2J J;  1BL0 A;  3NWS A;  1G3W A;  4G8X A;  3IHU A;  2NS7 A;  3S1M J;  2QVO A;  5HLH A;  3IC7 A;  5EG0 A;  5B66 C;  2EV5 A;  1RPW A;  3KCC A;  3RPQ A;  1A6I A;  5E3L A;  1BOA A;  4FET A;  5DCM B;  2HVS A;  2HS5 A;  3U2R A;  1YRN A;  4OIO F;  5JR3 A;  2BY2 A;  3GVA A;  4ON0 A;  3ABK H;  4IL6 C;  2EFW A;  2QKL B;  2ZXW H;  4I02 A;  2E7X A;  3R0J A;  3OYA A;  3S8P A;  1U5T A;  2DXI A;  3QOE A;  4R79 A;  3IWZ A;  2JPC A;  3QOD A;  4XOP A;  2L7M P;  2JUC A;  2LOO A;  4E6K G;  2OBP A;  3OYC A;  3HHH A;  4RB3 C;  1JGG A;  3R4K A;  1LDK B;  4ZDP A;  4XR6 A;  2A6H F;  3IV5 A;  2H09 A;  2ZME A;  4PCQ A;  5GP9 A;  2CH0 A;  2EZH A;  5FLV A;  3NAR A;  1U9N A;  4C30 A;  4FE7 A;  2RN7 A;  3CJT B;  3L7W A;  3PNV A;  4O5V A;  4G7O F;  3BR5 A;  3GTO J;  5IP9 J;  4CA0 A;  3P9C A;  3OS1 A;  1WWX A;  3QP5 A;  4HDU A;  1YI2 I;  2DO7 A;  5GPC A;  2A05 A;  3FXU A;  1ETV A;  2JA5 J;  1NK2 P;  3Q0U A;  1LEA A;  3K2Z A;  3PUB A;  5BQT A;  1TLH B;  2QM3 A;  3DPU A;  4PSW A;  2LMD A;  3BG7 A;  5CJ9 A;  4HNT A;  1FYM A;  2LP0 A;  4E70 A;  2XRL A;  5J8C A;  4M73 A;  3SYT A;  4E7S A;  2Z3Y A;  2GLO A;  3PO3 J;  4MGR A;  2BY1 A;  3WG9 A;  4RM3 A;  5DM6 F;  2AS5 F;  3B73 A;  3HRM A;  2HQR A;  4J19 A;  2K27 A;  3ZPL A;  4A3G J;  1UAA A;  2V9V A;  3VEP A;  1SVO A;  2HYJ A;  2QBY B;  3M1C A;  2QEN A;  2L4M A;  2A3S A;  5L3B A;  1ZGJ A;  4M3D A;  2ESN A;  2ELK A;  3PNT A;  4F55 A;  1JKQ C;  5GAE J;  1R49 A;  4FCY A;  2PMU A;  2OQR A;  2CV0 A;  1WVR A;  4I0A A;  5DS9 A;  2JQ7 A;  3OL4 A;  3MKY B;  1ETO A;  2ZJQ F;  2HVR A;  1BI2 A;  1PVE A;  5HS7 A;  2HQN A;  2OJE D;  1PUF B;  2MD0 A;  3FHZ A;  1ULY A;  2OPT A;  2WB1 N;  4A0X A;  3CCJ I;  1FSH A;  1BOB A;  5FFX A;  3K7A J;  3HOU J;  1KU3 A;  2FRH A;  4EQQ A;  2XAS A;  4Q4Z F;  3BTC A;  4GXO A;  1FPQ A;  2BW3 B;  1FMW A;  1MBG A;  2K02 A;  2K3P A;  3BJA A;  3O8G A;  3CCY A;  3IH3 A;  3QOP A;  5KHD A;  4QWQ A;  1IW7 F;  5FO5 A;  3CDH A;  1GHC A;  1UFM A;  2L9N A;  3GCM A;  2NAZ A;  5H6Q A;  3OS2 A;  2R7T A;  2LYC A;  1MBE A;  1D0Y A;  2L54 A;  1K83 J;  3PFI A;  3CUQ A;  4XLN F;  5EZG A;  1O4X A;  3LA3 A;  4KYW A;  2JRM A;  1JJ8 C;  2VI6 A;  3GF2 A;  5F64 A;  3V4G A;  2F2E A;  4JP0 A;  3H92 A;  3VWB A;  1XB4 A;  3DBH B;  1MNE A;  1R36 A;  1XMX A;  4E7Z A;  1F43 A;  2GM4 A;  2KJB A;  2QLZ A;  2E1O A;  4RDU A;  1S72 I;  1JUM A;  2VT2 A;  5F0H A;  4G12 A;  4RB1 A;  1KYW A;  2CUZ A;  3K70 C;  1LKX A;  2LBF B;  3I58 A;  4CZZ A;  4M72 A;  1FWZ A;  2CUE A;  4IJA A;  1XS9 A;  2DA7 A;  5LGT A;  5GAG J;  1E3H A;  4CO8 A;  2IW5 A;  1S9H A;  2ZFU A;  4WK8 F;  3HRT A;  2F4I A;  3KYD B;  1Z05 A;  5DCF A;  2EIM H;  5IY5 H;  3BR3 A;  1IG7 A;  1HBX G;  2ME0 A;  1AOY A;  3FK6 A;  1FYK A;  1J5Y A;  2HEO A;  5K5Q A;  3CO6 C;  1H89 C;  3SDB A;  2KHM A;  3OWT A;  2R7U A;  4GGG A;  3M8E A;  1VZ0 A;  2R7W A;  1HKS A;  1MMN A;  4PFP A;  3OR1 C;  1MJA A;  4KJZ A;  4P96 A;  4EM1 A;  4O3M A;  3CO7 C;  4HNU A;  4BYY A;  5E3O A;  4G9Y A;  4KIB A;  2RQQ A;  5K5O A;  3NEU A;  3F22 A;  5GPA A;  5EG0 B;  3M07 A;  1W36 C;  5HDK A;  1MMD A;  2QSG X;  1W7P A;  3JAM K;  1YS7 A;  2R7S A;  2XAQ A;  2DBB A;  5IYD J;  2ZXJ A;  3RYP A;  3TO9 A;  1TQP A;  1UMQ A;  1WJB A;  1R1V A;  3I53 A;  2LDU A;  3GTM J;  4CCN A;  1KU9 A;  1K79 A;  2CW7 A;  2Y2Z A;  1MMS A;  1WH5 A;  2A07 F;  1U5T B;  1VQN I;  2Z5U A;  3FMR A;  3W6K B;  2XF5 A;  3PO2 J;  5M5Y J;  5BNG A;  1VQ6 I;  3S16 J;  2OTJ I;  2HNH A;  3KX2 A;  2ZME B;  4A69 C;  2R7X A;  3V42 A;  4S04 A;  1QZE A;  3HUG A;  4M6Y A;  3CES A;  4XKW A;  5F04 A;  3GTL J;  1Z6T A;  1WI3 A;  5ICF A;  2R4G A;  3TP3 A;  1B72 A;  3H1C A;  3ELK A;  4F92 B;  2PMH A;  1BI0 A;  1OLT A;  3AG2 H;  1T8I A;  1S5L C;  1QVT A;  3HBL A;  4X6A J;  5M5W J;  3P9I A;  2FOK A;  2O8X A;  2Q0O A;  3V8J A;  2OU2 A;  2G7H A;  2PEX A;  4DBR A;  1QZZ A;  2IA0 A;  4M6X A;  3DF8 A;  3HOS A;  5JHF A;  2OZ6 A;  3QP6 A;  4Y4R A;  4CGZ A;  1ETY A;  2HZD A;  2E1C A;  5ERI A;  1CGP A;  4DW6 A;  3TQN A;  5L3E A;  4F93 B;  2BOL A;  4B8X A;  3P7N A;  1NTC A;  4UVB A;  1A36 A;  2X0L A;  1RKW A;  3F8F A;  5IP6 A;  1DP3 A;  5FLX K;  4ZYH A;  3K2A A;  3PFY A;  1WSU A;  4A2U A;  2D5V A;  2XGE A;  4DGW B;  4UHT A;  3MD2 A;  4ANJ A;  3L2C A;  4RB2 C;  4ZDL A;  2F4M B;  3HEF A;  3COA C;  3SZT A;  3S2W A;  4G7Z F;  4B43 A;  2IT0 A;  2B63 J;  5C44 J;  2QQB A;  1XGM A;  3ZMD A;  4A6D A;  5GTI C;  4JX4 A;  4A3B J;  3RKY A;  3CCU I;  3T5X A;  1N75 A;  3K4B A;  1JTX A;  3K4J A;  1X2M A;  1VND A;  2GQQ A;  1CQT A;  2WAQ N;  1ZG3 A;  4PJM A;  3L2R A;  1BJZ A;  2YSR A;  1UCR A;  2ESH A;  3CC4 I;  4N9H A;  1GLN A;  2MLG A;  3G1M A;  1LJ9 A;  2JJ7 A;  1OKR A;  4EV0 A;  5J6X A;  5E3N A;  2K9N A;  4Y3O A;  2IA2 A;  2FF4 A;  3M1E A;  1Z67 A;  1WKM A;  4O6J A;  1O3S A;  3OYH A;  1YIJ I;  1ENH A;  3DPL C;  4CH7 A;  2LK2 A;  4IQJ A;  1UZC A;  2X6X A;  4ESF A;  4NNJ A;  5ED4 A;  3L9F A;  4ENJ A;  3H0G J;  1WH7 A;  2W82 A;  2R5Y A;  3BJO A;  3E1S A;  4H0E A;  2RVC A;  1N78 A;  1TWF J;  3EUA A;  3H3U A;  1ZEL A;  4HX7 A;  3CUQ B;  1FEX A;  2V6E A;  5F1J A;  3DEU A;  3L1P A;  2XRN A;  4LMY A;  3KIO A;  5K5R A;  1D0Z A;  3HKZ A;  5IYB J;  2A69 F;  1OYI A;  1I1S A;  3OIQ A;  3DQV C;  3HHG A;  4KT5 C;  3CC2 I;  2LRE A;  2X85 A;  4IQ4 A;  3S1N J;  1H9T A;  1OCO H;  1ZR4 A;  3V8L A;  1BA5 A;  4I0B A;  3TGN A;  2K9Q A;  3CCS I;  1FP2 A;  1WFX A;  2K9M A;  2NNN A;  3MMY B;  1QU3 A;  2CV2 A;  1LFP A;  3G1L A;  4IEJ A;  4IOC F;  4FE4 A;  2W7N A;  4D5C A;  1XGN A;  4OIP F;  2JA6 J;  2VKE A;  4C2M J;  4A3F J;  4ENM A;  2Q2E A;  1JKO C;  1P4A A;  3LSJ A;  2YX4 A;  4IXA A;  1LNW A;  3IL2 A;  3BZC A;  4BNC A;  2J5O A;  3RCO A;  2P8T A;  2JVG A;  2UV1 A;  5DTD A;  3OIO A;  4M3B A;  4FX4 A;  1UB9 A;  3KEY A;  1B9N A;  1G3T A;  4MFE A;  2O8K A;  3GXO A;  1Z91 A;  3EYI A;  3BPV A;  2YR2 A;  5E20 A;  2VBY A;  2XKP A;  3IWF A;  2DOD A;  4XK4 A;  3TO7 A;  1WJD A;  2CU7 A;  2GXA A;  2ZKZ A;  2JSC A;  3BR2 A;  2AO9 A;  2L3D A;  2VJI A;  2R7D A;  1IN5 A;  3VDX A;  1MDM A;  1X3W B;  2ID3 A;  2JT1 A;  3LSK A;  4LG0 A;  1D8K A;  2Y0S A;  3K9T A;  4E7J A;  1L0O C;  2RAE A;  3C2B A;  2FMY A;  1W7P B;  2BXY A;  5D5X B;  1SFX A;  2Z1D A;  2DA5 A;  1F36 A;  1F1Z A;  1BN5 A;  2DI3 A;  4II3 A;  2ISZ A;  2RV8 A;  3RPU A;  2L7F P;  3BG6 A;  5EYR A;  1U0J A;  2E60 A;  3KYL A;  2ZJR F;  2R7Z J;  2M87 A;  5HNH A;  3WTS C;  1LEB A;  1TZL A;  3BTI A;  3K1M A;  2MBF A;  4L0Z B;  2M7A A;  1APL C;  5CQE A;  2DYR H;  3ZMV A;  4NQW A;  4ZZL A;  2HQ5 A;  4XON A;  4CIC A;  5F1R A;  4CHU A;  2ID6 A;  3HUG B;  3LL7 A;  1KYZ A;  3J7Z I;  1VQ9 I;  3CMY A;  1RKT A;  1B72 B;  3CMA I;  2BY0 A;  2DDA A;  2E1M C;  5B1B H;  4XRS A;  2KP6 A;  2X1C A;  1MJ9 A;  3HJE A;  3REO A;  4ZDO A;  2EFN A;  3RI4 A;  4BBS J;  2RGV A;  4KIC A;  2BE5 F;  1I50 J;  1FOX A;  1ZKG A;  5D4S A;  2G9W A;  3OS0 A;  1FT9 A;  2Y69 H;  3GBG A;  4UB8 C;  4IO9 F;  1D5V A;  4NC8 A;  1ZRC A;  4NC6 A;  1K4S A;  1QVU A;  2HR3 A;  4G6T B;  5LEK A;  3F6O A;  1NH3 A;  4IF4 A;  3Q0W A;  5JLW A;  4B3X A;  2WY8 Q;  2PQ8 A;  3BG5 A;  3EUH C;  4HF1 A;  2C6Y A;  1T0F C;  5HOO A;  3G6E I;  3KP2 A;  3HSE A;  4BXU A;  1U2W A;  2VBX A;  3JRD A;  5JI6 A;  5FKK A;  3N4M A;  2ISY A;  3KLN A;  3M4O J;  5KCM A;  2VOO A;  3NQO A;  4MEY F;  1X58 A;  2CQN A;  3DKX A;  3IRQ A;  2XB5 A;  3OL3 A;  5LD2 C;  1RUO A;  2M9H A;  3Q0V A;  1S8N A;  2LY2 A;  3A1Y A;  1R5H A;  1J2X A;  3EUK L;  5FKM A;  5ICG A;  3AFH A;  1HKT A;  1VQ5 I;  4U0V A;  4OIQ F;  4AYB A;  3K0L A;  4LIV A;  3OYI A;  3KEQ A;  1JHF A;  1I3Q J;  1TQM A;  1ZGA A;  1SFU A;  3WHC A;  2X1D A;  1MH3 A;  1DPU A;  2MSY A;  3DP7 A;  1UJ8 A;  4XRM A;  2E35 A;  3A03 A;  3LQR A;  5LRS A;  2EPF A;  2VJ4 A;  3DXJ F;  1TT5 B;  4XSX F;  5FB2 A;  1VQP I;  1Q1H A;  5E17 F;  1UHM A;  1BC7 C;  3HDD A;  2E34 A;  2M30 A;  1AKH A;  1X4O A;  3BC8 A;  2IGN A;  2BXZ A;  2OCC H;  1IN4 A;  3KP4 A;  4M9Z A;  4M9S A;  2XB0 X;  4DJA A;  4EM0 B;  4UVA A;  3D1N I;  4LB6 B;  4M3E A;  3S93 A;  2R5Y B;  2BYV E;  4BGD A;  1P92 A;  3GFI A;  1Z3Y A;  4YII A;  2M7B A;  2RQP A;  4BUP A;  3F8M A;  5BOX A;  2LH9 A;  4S05 A;  2XSJ C;  5HS8 A;  1K7A A;  2FNA A;  1V54 H;  1WCM J;  2H1L A;  3T8R A;  3S17 J;  3U1K A;  3H9G A;  3BG9 A;  3B6C A;  4KIT B;  1ZRE A;  2NNY A;  3EPZ A;  2UXX A;  2JTV A;  3OYB A;  1BR4 A;  1EJ9 A;  5DD8 A;  1OYY A;  3CDI A;  4HOB A;  3E7L A;  2CRG A;  4L9J A;  3JRB A;  1TWG J;  1G6N A;  2UXN A;  4RAY A;  3RYR A;  2WV1 A;  3SZP A;  1K6Y A;  2IGM A;  5LRR A;  4ZTJ A;  2Q2E B;  2HZT A;  1HDD C;  2HOS A;  3DU6 A;  1QNT A;  3E6M A;  5AON A;  2CS3 A;  2ZC2 A;  5ICE A;  2VOP A;  4OIN F;  3S3O A;  4R1H A;  3TOA A;  3N05 A;  1V5G A;  2DA2 A;  1IO2 A;  1LVK A;  2JSP A;  2IGK A;  4CYD A;  3I0T A;  5HS9 A;  2DQR A;  5TJJ A;  3VB2 A;  4BU2 A;  3VYR B;  2ZXI A;  3HZJ A;  4X1E A;  1YG2 A;  2EJR A;  1QQI A;  4RGR A;  2X48 A;  1IV8 A;  1ON1 A;  3KZZ A;  4BXX J;  4QPO A;  3HTU A;  2FE3 A;  2L9V A;  2P6S A;  2F5V A;  1IUF A;  3ZRG A;  2FNP A;  4Y15 A;  3DKY A;  3K4L A;  4IPA A;  2DT5 A;  3DEW A;  4HNV A;  1YJN I;  1MDM B;  5AIP A;  1O3R A;  2BBY A;  4LG0 B;  5TGT A;  4I76 A;  1F4K A;  3EET A;  2JA8 J;  4MNU A;  3W6V A;  5DM7 F;  4DBQ A;  4ZYD A;  3UNG C;  4CDG A;  1HCR A;  3GEZ A;  2CUJ A;  3ZMS A;  1WQ2 A;  1YS6 A;  2IBD A;  4PJJ A;  1JKR C;  1D1B A;  4S0H B;  1OCC H;  4QSH A;  3VYU B;  1LUJ B;  2ME6 A;  4NUB A;  4M6V A;  4AC0 A;  2E1M B;  2VQL A;  2ZJP F;  4HX4 A;  1R00 A;  2XGD A;  4CCM A;  2M0M A;  2RDP A;  4NQW B;  2H27 A;  1IRF A;  2DCE A;  2L7K A;  1UST A;  2W24 A;  4HW0 A;  4WXH A;  2OF7 A;  1SAX A;  3PUF A;  4ASN A;  4WCG A;  2AQE A;  2PMZ A;  2RC4 A;  1D1C A;  1MMA A;  4JOM A;  3F21 A;  4EJO A;  1U5T C;  2XKO A;  3OYM A;  2JRT A;  3GO5 A;  5FKN A;  1VQO I;  4KN7 X;  4F91 B;  4HX8 A;  1O7F A;  1XTA A;  3NRV A;  4DNC A;  1IGN A;  2O61 A;  4N0B A;  2VN2 A;  4HZF A;  4DIQ A;  4ZYA A;  1K61 A;  3VOE A;  1RR8 C;  5GTH C;  3S3M A;  3V7R A;  2ZME C;  1XCB A;  4HYE A;  3DKW A;  2LC2 A;  5E1Z B;  1JXS A;  1BW6 A;  1H0M A;  2DU9 A;  3H5R A;  3CCM I;  3WG7 H;  2NVQ J;  4WF2 A;  2KLO A;  3KE2 A;  4XRF A;  5LHI A;  4BQQ A;  5HVQ C;  3H9J A;  2K9S A;  4TV7 A;  1UHS A;  1TNT A;  3LQQ A;  1GVJ A;  2HDC A;  3ZQH A;  2K9L A;  2K7L A;  5KK1 A;  4FX0 A;  3W6J B;  5HLT A;  4ZJZ A;  2FQ4 A;  1J09 A;  1X3U A;  3I59 A;  1XDS A;  2E36 A;  1I1G A;  5E79 C;  1YIT I;  3RSN A;  2EBI A;  2W1O A;  1VTN C;  1VQK I;  3CD6 I;  3SHF A;  4Y52 J;  2CQX A;  3ZQ7 A;  2OC6 A;  2NVU B;  2VKH A;  2VJJ A;  2G7U A;  3SDG A;  3V8K A;  4D0P A;  3I55 I;  3CCV I;  2W4S A;  4KFC A;  1FOK A;  4ZYE A;  3BQY A;  5JVG F;  1ZQ3 P;  3I71 A;  4AD9 A;  2DFF A;  4NBQ A;  1DP7 P;  3OYN A;  2JWT A;  1WJE A;  2CQK A;  2HVQ A;  2N8G A;  3FXR A;  4IHV A;  4JBA A;  4K2E A;  1WJ5 A;  3RKX A;  5C3E J;  4KN4 X;  3JRA A;  2X4H A;  1JJ6 C;  3HOW J;  2QSF X;  4PJN A;  4X0G A;  1JKP C;  3RIR A;  1D1A A;  4AYB N;  4GFB A;  2JPB A;  2Y30 A;  3OYL A;  3DEE A;  1YFH A;  4A3M J;  1R4M B;  3DTE A;  3CMM A;  2CUF A;  2RRE A;  2RNJ A;  2CSO A;  1FZP B;  2EZI A;  1XG1 A;  4BE2 A;  2P5L C;  2V9P A;  5FD5 A;  3ERM A;  3I54 A;  4NDL A;  2R5Z A;  3ERE D;  5DYM A;  3DPT A;  3O6B B;  3H0D A;  2YUS A;  3M3Y J;  3ONQ A;  3HOY J;  1U6G A;  4ZH4 F;  4I6Z A;  1OCT C;  3CUQ C;  3S3N A;  2FJ1 A;  2FEZ A;  2K4B A;  1G2H A;  3R6S A;  2BY3 A;  3QU6 A;  2VQG A;  5CVI A;  1GDT A;  1OCP A;  3HG9 A;  1IRG A;  1EA3 A;  3FXJ A;  2F5C A;  3OMY A;  2GIV A;  2NS0 A;  1WI9 A;  4U7D A;  3FXK A;  4CCK A;  4FTH A;  1RNL A;  4AWX B;  4YRV A;  3VFZ A;  1TC3 C;  2VKV A;  4WX9 A;  3S2D J;  1W7P D;  2Y9Z A;  2L7Z A;  1H88 C;  3WTY C;  3LWF A;  1HQC A;  3QPS A;  2K85 A;  1EH8 A;  1P9Q C;  4A3I J;  5K1Y A;  2O7O A;  4YEL A;  4RB0 A;  1S7E A;  2LF8 A;  4LFU A;  1IXC A;  4RMN A;  3OSF A;  2GOX B;  2BHY A;  1ZRD A;  4U87 A;  3RTR A;  1WHU A;  3MZ8 A;  1Q1V A;  1KQ8 A;  1IRX A;  2V1N A;  1FBU A;  1W5T A;  3KP6 A;  1Z3X A;  1A31 A;  2VC1 A;  4XBF A;  1L3L A;  2Y31 A;  2R92 J;  2H6C A;  3ZOB A;  1OJL A;  3FM3 A;  1FOY A;  1V3F A;  2XC7 A;  5CVU A;  5K7F A;  1XPX A;  2XHK A;  3U1D A;  4A6E A;  2XUB A;  3K10 A;  4IHY A;  3CJR B;  1IN8 A;  4MLO A;  1ZN2 A;  1YRN B;  3HPH A;  4E7L A;  4A3D J;  1T95 A;  4P9U A;  3HOZ J;  2QQ8 A;  3HOX J;  4AM3 A;  5TRD A;  2EZK A;  2FD5 A;  3QYF A;  5K7Z A;  1ZAR A;  3PSF A;  1O3T A;  2VIX A;  3ZQQ A;  3HOT A;  3CUO A;  3JRG A;  4Z6Y A;  2F5D A;  2I8D A;  2X6W A;  2ADU A;  4BKX A;  2W84 A;  5D8L B;  1MBF A;  1SD5 A;  2CWE A;  1XC5 A;  2D1H A;  2F4O B;  3KZY A;  4UV9 A;  3W2A A;  3PJR A;  1MSF C;  4OMY A;  5EDN A;  2VOD A;  2JA7 J;  3WTZ A;  1LPQ A;  1NK3 P;  3VOD A;  2KRC A;  1QPI A;  3H35 A;  2DT7 B;  3IUO A;  4BQN A;  1IF1 A;  2O9L A;  4BXF A;  1AA7 A;  4WXD A;  4XN3 A;  2HXI A;  4L5E A;  4P1W A;  3JAM Z;  1VQ8 I;  4LLN A;  4MO7 A;  1Z7U A;  1W0T A;  1DQU A;  3F8B A;  3KFW X;  4GCV A;  4KMU X;  2ACJ A;  2EIJ H;  3BQZ A;  3ZN0 A;  2H6B A;  4HF2 A;  3CZ6 A;  3L2W A;  1B4A A;  1CF7 A;  1T38 A;  2D2W A;  2PJR A;  3D5L A;  2FU4 A;  1AHD P;  3C2G A;  3BDD A;  1F9N A;  4I7H A;  5LHH A;  5LFA A;  2QYO A;  4BS9 A;  1FBS A;  3TO6 A;  3NAU A;  1RI7 A;  1SAN A;  3UR3 C;  2DOF A;  4L18 B;  1D8J A;  3A02 A;  4UV8 A;  1HLV A;  3LSR A;  1X1D A;  1W4M A;  1XX5 A;  3DFG A;  1Y39 A;  4ENK A;  1R5I D;  3HOV J;  5J1Y A;  4OOI A;  3ZGK A;  3OYK A;  3I59 B;  3CP2 A;  5ILV A;  2B9S A;  1ETX A;  1P2F A;  3LST A;  6PAX A;  1X1P A;  2KZG A;  3K4M A;  1MBJ A;  4JK1 X;  2PN6 A;  4C2T A;  3GZN B;  1HST A;  2EIN H;  4A3E J;  2PLY A;  4W97 A;  2NS8 A;  3MQ0 A;  2ZXH A;  3GUD A;  5ILU A;  3R0A A;  1ZAO A;  2XVC A;  5FLX Z;  4IHT A;  2HU9 A;  1KU7 A;  3H3Z A;  1TNS A;  1LFU P;  1X1B A;  4B4C A;  5J1U A;  4U0Y A;  5J4Y A;  2HQA A;  5C4X J;  1YX5 A;  3QPH A;  2NXN B;  1MSE C;  4KIG A;  3KP7 A;  1X1A A;  2CW0 F;  2EIL H;  2DW4 A;  2MD5 A;  3C7J A;  1LDD A;  4LK1 F;  3W2V A;  2XAU A;  5F0F A;  1XGS A;  4XRS G;  3A0B C;  3FF5 A;  2XAJ A;  1S7A A;  1YJW I;  3FXQ A;  5DEQ A;  1RC9 A;  4ESJ A;  2NRA C;  4C3J J;  3GFL A;  3EQL F;  5FKO A;  4LJZ F;  4P55 A;  1D3Y A;  2QWW A;  3K4N A;  2M8G X;  2R5Z B;  1SFO J;  3JTH A;  2V26 A;  4XOT A;  4QIW N;  3HSR A;  5E18 F;  2LD5 A;  4A12 A;  1U78 A;  4MTD A;  1OYW A;  2GBY A;  3R60 A;  1G59 A;  1W5C C;  4Y33 A;  1LFB A;  1ZK8 A;  4C2U A;  3J81 K;  2AQF A;  2QSH X;  3GTP J;  2WBM A;  5D4R A;  2DA3 A;  3BZK A;  1ITY A;  2G0E A;  4BE0 A;  2HI3 A;  2XPW A;  1YLF A;  2E7W A;  4IRG A;  1P4W A;  3TP0 A;  2EV6 A;  2M4G A;  1RUN A;  4BQO A;  1BIB A;  2L9S A;  1FOW A;  2VE8 A;  5F08 A;  3PL8 A;  2VB6 A;  2ECC A;  3O3K A;  2P81 A;  2KIQ A;  3S2H J;  4BBR J;  1U8B A;  4HA8 A;  2OTL I;  3I9V 2;  4GYI A;  2YU9 J;  2VBW A;  2A61 A;  2H94 A;  3IH2 A;  1MH4 A;  1S29 A;  4I2O A;  1KON A;  5BPI A;  1Z9C A;  3CME I;  2ECB A;  1BIA A;  1TWA J;  4FAS D;  3WGI A;  2D1V A;  3NWT A;  3RPU D;  1B6A A;  3J81 Z;  1LE8 A;  2NVX J;  9ANT A;  2GIZ A;  3I64 A;  5E3M A;  1XSX A;  1ZRF A;  3L2U A;  4HDV A;  3GYH X;  3OV8 A;  2XF6 A;  2MC4 A;  4UY8 I;  3KLO A;  1QRY A;  1HC8 A;  2LSO A;  3KEO A;  5IT9 K;  2B0L A;  1DPR A;  4HST A;  1U9O A;  1Y56 A;  3K4C A;  1ONV A;  3HTS B;  4MIM A;  1FX7 A;  2E2H J;  1ODD A;  4NC7 A;  1WRJ A;  4CUG A;  4JYK A;  2I5U A;  2Z99 A;  5HLI A;  2JK3 A;  2FXA A;  3WGG A;  3QRF F;  3BG3 A;  5CYV A;  4ZTF A;  2E1N A;  3ESW B;  4F52 A;  1A5J A;  4KMF A;  1H9G A;  3S14 J;  4A93 J;  3CP8 A;  3LSG A;  3Q9V A;  4A5M A;  5EEA A;  1TP4 A;  1UEL B;  2O0Y A;  2OA4 A;  4XKB A;  2STT A;  3HIF A;  2WAE A;  3OIP A;  2MW8 A;  1SD6 A;  2K86 A;  3ZQI A;  2LNB A;  3FZV A;  1GV5 A;  1JGS A;  4XL9 A;  2KZV A;  2LKX A;  1WGX A;  5L3F A;  3DBR B;  3OYE A;  2L01 A;  3WTX C;  1G8X A;  3OYG A;  4BEH A;  4EMS A;  1OR7 A;  2DAO A;  5DCM A;  3CJN A;  3WTV C;  2QZ8 A;  3T0Y A;  3HM5 A;  2NVT J;  1GUU A;  2FBK A;  1YOV B;  2HYG D;  3BR0 A;  4V2F A;  3BPX A;  1BI3 A;  4HG2 A;  2KL4 A;  4PGG A;  1Y0U A;  4DOZ A;  5DDG A;  3J80 K;  1EH7 A;  1OQY A;  1P6R A;  3F8N A;  3QWL A;  3JTG A;  2BEO A;  2KIM A;  1JT6 A;  1CF7 B;  5M3M J;  2XGX A;  5E8I A;  4LLL A;  3BWG A;  1ZLJ A;  4FIS A;  2Z9O A;  1ZHF A;  2H8W A;  2UWM A;  1J75 A;  3A0H C;  3ULQ B;  4M9X A;  2A6T A;  3WOD F;  1B8I A;  5FLM J;  3A4C A;  5JVT A;  2P7C B;  4HQE A;  1F5T A;  3BP8 A;  3VPR A;  1JUS A;  3Q9S A;  4G6D A;  3CCE I;  3MN2 A; 
#chains in the Genus database with same CATH homology
 1E3P A;  3U1K A;  3H36 A;  3H1C A;  3GME A;  4AID A;  4NBQ A;  3CDI A;  1WHU A;  1E3H A;  3GLL A;  4AM3 A;  3GCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...