3CF5F

Thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
144
structure length
144
Chain Sequence
MKKVAGIVKLQLPAGKATPAPPVGPALGQYGANIMEFTKAFNAQTADKGDAIIPVEITIYADRSFTFITKTPPMSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGVTVEGGPNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S RIBOSOMAL PROTEIN L33
publication title Translational Regulation Via L11: Molecular Switches on the Ribosome Turned on and Off by Thiostrepton and Micrococcin.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 17
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2008-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
F PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3cf5F02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 3cf5F01
5DM7F 1HC8A 2FOWA 1S72I 1YHQI 1VQLI 3CCVI 4UY8I 3CCSI 3CJRB 1YJ9I 1YIJI 5GADJ 1FOYA 1QA6A 5GAEJ 1VQ5I 3CCJI 3J7YJ 1WIBA 3CC2I 1VQNI 2OTJI 1VQ6I 3CJQB 3PIPF 5DM6F 4IO9F 1Y39A 3CF5F 5GAGJ 3CCEI 3CJTB 3CMEI 3DLLF 1YI2I 2K3FA 1ACIA 2E36A 3CCLI 2QEXI 1VQKI 1YJWI 3EGVB 3CJSB 3CCRI 2JQ7A 1VQPI 3CD6I 2QA4I 5JVGF 4IOCF 2NXNB 3G4SI 3I56I 1VQ8I 3I55I 2H8WA 3G71I 3CC4I 3CCUI 1MMSA 1VQ7I 2ZJQF 3CCQI 1FOXA 3CMAI 1FOWA 4IOAF 2ZJRF 1VQOI 2ZJPF 1VQMI 1VQ9I 2OTLI 3PIOF 1YJNI 3J7ZI 2E34A 2E35A 3G6EI 1VQ4I 4V19K 3CC7I 1YITI 5GAHJ 3CCMI
chains in the Genus database with same CATH superfamily
3JRBA 1N75A 4YFNF 1GHCA 4G8XA 4AIHA 3SJMA 3LSRA 1U9OA 2Z5UA 1IV8A 2FBHA 1TNSA 2Y0MA 3ONQA 4XORA 1VFCA 2HVQA 3PSIA 2BGCA 2R7WA 5E8GA 1XPXA 4F7ZA 1K79A 1M1EB 5E1XA 4IHVA 1VNDA 1LPQA 3L09A 3FK6A 3FXRA 2DMUA 2W85A 4G6TB 5JR3A 5F0HA 2COMA 3DLAA 3CO7C 1Z67A 2BVLA 5DD8A 2D45A 1B8IB 5CPRB 4XN0A 5KHDA 2W82A 2W84A 3VWBA 5E17F 4XLNF 4LGWA 1P9QC 2HQNA 2DI3A 3M1EA 3F21A 2VQLA 1SVMA 2XAUA 1QHHD 5DM6F 3LSKA 5GAGJ 4BQQA 1TWFJ 3QAHA 2FD5A 1D1BA 3Q3SA 1MJAA 4IX7A 2F4IA 2HYFA 4BL0B 3HOWJ 3KIOA 1OCCH 3CCLI 4YIFA 3CCRI 1ONVA 2QSGX 2PI0A 1SVLA 1HSJA 5FROA 2Q2EB 2HZTA 4A3LJ 3CD6I 3KZZA 1BJZA 2XAJA 2CV2A 3QQAA 1MDMB 4ENNA 2NVUB 1IDYA 5M5XJ 2EH3A 2HXIA 3H9JA 5BOXA 2NNNA 2MYSA 1GXPA 2H8WA 1OYIA 5E1WA 3DTIA 4XONA 2HOAA 2DPDA 2E19A 2J5PA 3JRIA 2ZSHB 1C0WA 4A3IJ 2M7AA 1N77A 4A93J 1T38A 4DZJA 1I5ZA 2CQKA 3O8HA 4UXNA 2ZJRF 2GM4A 2D5VA 2WAQN 2L54A 3VODA 3EQLF 3BZ6A 3K4LA 4UB8C 1XCBA 2IGNA 2EILH 5IPAA 3PIOF 2Q1ZB 2D1VA 4CGZA 2X51A 2ZNZA 2W1OA 1IRFA 2NOJB 3RPQA 1F9NA 3FMRA 2VT3A 4LLNA 2WAQA 3IWZA 2F5CA 1GXQA 2MABA 5CVRA 1X3UA 2LKSA 3OS2A 1REPC 5GAHJ 3ABTA 4EJOA 3K1PA 5H20A 1T95A 2LYCA 4Z6YA 3KLNA 5K5QA 3BTLA 2CG4A 2GAUA 1VF9A 4L5JA 3LOCA 3BDDA 3FM3A 3RZDJ 2E5ZA 4D1QA 1K7AA 1B59A 3H92A 3OYGA 3M07A 3T8TA 2A05A 2DMPA 1S6LA 3V7SA 4UY8I 3T8RA 1E17A 2X1EA 4IHXA 1SANA 2JUGA 3PO3J 2BVMA 2L5QA 3WGGA 2GOXB 1X4PA 1B72A 2E5NA 2H6CA 2PMUA 1KU7A 2VQCA 3NAUA 4IHYA 3V7CA 4FX4A 3CMMA 3RKQA 5LGUA 2VONA 4OMZA 5D6FA 5AIPA 2G9WA 1VQNI 2M8GX 4IXAA 1XX5A 2XF6A 2DT5A 2ID6A 3OY9A 4KISA 1AOYA 2H1KA 4LIUA 2BXYA 2ZXIA 2LSOA 4KMFA 1GUUA 4LG0A 3VYSB 2BY2A 3MVPA 1K78A 3HOVJ 1JTXA 2ID3A 4ZDLA 3IC7A 5CYVA 3ZN1A 3S1MJ 4H0EA 2R5YA 3FXKA 4YRVA 2BBYA 3E5XA 3WHCA 3K4BA 1Z7LA 3OYIA 4HOBA 1VQKI 4U7DA 3I4NJ 1R00A 1X3ZB 2A3SA 2XF5A 5HODA 2JQ7A 4BAYA 2PMZA 3W6VA 4WF2A 2MBFA 2J5OA 3BWGA 3FXJA 3LQRA 4EM0B 3ERED 1R49A 2Z99A 1NK2P 3S14J 2Q0OA 2B63J 1KQ8A 3W6JB 2KJCA 1AU7A 4OIQF 1GVJA 1BC7C 1IXCA 1P7JA 1IXRC 3PNYA 3O2PE 3P5JA 3JRHA 1BN5A 4XLAA 2A6EF 1HW2A 4XRFA 1JKOC 4ZYHA 3HUGB 2COBA 1SD4A 4KUMA 1SMTA 2BY1A 3BR5A 3FBNB 2R0QC 4M9XA 1DU6A 1K61A 4U87A 5J6XA 3R4KA 3L2WA 2UV1A 4HZFA 2WADA 3FX3A 2PJRA 1VQOI 1KQ0A 3KEYA 3OIOA 1Y1WJ 2LG4A 1TTYA 1WJ5A 5EZHA 4RGSA 4AVPA 3GYHX 3A01B 4F55A 3RZOJ 3RIRA 1H9TA 1GDTA 1IGNA 4ON0A 2LFBA 5L3EA 4P55A 3J7ZI 1AWCA 1X2NA 2V26A 2IXSA 4RS8A 5DD4A 1BBYA 1POGA 1W7PA 3WE3A 2O5RA 2DPUA 2DQLA 1LUJB 3J81K 2KMUA 5DCMA 3FISA 4D7NA 4L9JA 1YFHA 2QF7A 1OCTC 2XF7A 1TQIA 2YUSA 3BT9A 1MNEA 3J80Z 3U1DA 3GTKJ 1XDSA 3HRSA 5B3SH 1V5EA 5F08A 2L2OA 3BPXA 3LNQA 3C2HA 3KYDB 5D5XB 2KPMA 4S05A 2XRLA 4BQAA 3E7LA 4CCOA 1BC8C 3A4CA 2QENA 4Y52J 1ZG1A 3PNVA 1BR2A 4E4HA 4FISA 1HQCA 2EA4A 3TBIA 3RDIA 4C3IJ 2QQBA 3HXLA 5GAEJ 2XV4S 2RC4A 4YFKF 5JFRA 4M6YA 3WTVC 4NQWB 2P7VB 2X4HA 4QWQA 1ETXA 1PUFB 3DPLC 2HXOA 3MKLA 3S1RJ 2JMWA 1I27A 3T5XA 3CDIA 1JGSA 1R9TJ 1D0XA 5K5RA 1W36C 3JSPA 2QQ9A 2RAEA 4OOIA 3DBRB 3OYNA 2ZMEC 3TKYA 1WFXA 3F8CA 3FHZA 4CYCA 1HKQA 3OL3A 1RKWA 1XD7A 1KQ9A 2DK5A 3N4MA 4A3JJ 5J4VA 2AXLA 4HBLA 5DCFA 5EG0A 2VBXA 2X1DA 4UUSB 1G8XA 1JHHA 2ELHA 3A0HC 1R1VA 2XSJC 2CSOA 2EFPA 2XKOA 4FETA 4ZYDA 1W7PD 2KT0A 3GFIA 3I71A 4DOZA 2R7DA 3N97A 3B73A 1E3PA 3ABKH 1IV6A 2HFHA 1LE8A 3E3VA 2Z3YA 2Y9ZA 2E60A 4CH7A 3DFGA 1ON1A 2R7ZJ 4BYYA 3OWTA 3S8PA 1SMYF 3OIPA 2JK3A 2H1LA 4Q47A 1UZCA 1OYWA 1UG0A 2MC4A 1UHSA 4KFCA 1TBXA 2BZTA 2DFIA 2JA6J 1FTTA 1SFUA 2ZSIB 5EDNA 4CZZA 1GVDA 5JLXA 2ZC2A 2NNYA 1SAUA 1X19A 2IGMA 3ZR8X 2EFQA 2DLLA 2Z9OA 3ISPA 1QZYA 1J5YA 4OIOF 3KETA 1ZG5A 2EFWA 4Y33A 4KMUX 1NHAA 3KFWX 1G2HA 1FBQA 3BQZA 1BW6A 1FWZA 2JPCA 1RIOH 1Q1HA 4Y7NJ 1FNNA 5E3NA 3QU3A 4M71A 1KA8A 2B0LA 2DA3A 3HGYA 2Y75A 1MIJA 4IRGA 2LF7A 2L7ZA 3IHUA 1DU0A 3CZ6A 1JUSA 5DV5A 5BPIA 2ECCA 4B1RA 5C3EJ 1SFOJ 1YX3A 3OYBA 4XKBA 1R22A 2BYVE 1XG1A 2LOOA 3PM1A 4BHPA 2XKPA 2EA2A 2Y48A 4DBQA 2XGXA 2ISZA 1X1AA 4AIDA 2R7XA 5CKTA 1RZ4A 2B9SA 1MGTA 3HHGA 3OIQA 3TP0A 4HNTA 2VT2A 4J19A 1YRNA 2M3AA 1UB9A 1E2XA 1WRJA 2QKMB 3HIFA 2MH9A 1APLC 4E70A 1XTAA 4PJNA 4OIRF 2ZMEB 3BR0A 3HPGA 1DGRM 5GPAA 5J3LA 4MO7A 2DA7A 2V1XA 3GLLA 1UJ8A 2M87A 3I0TA 2Y69H 3QOEA 2CQXA 4II3A 2XC7A 3LSTA 4UVBA 4RB0A 5CQEA 1IZ1A 3SZPA 5TJJA 3DWLE 3AG2H 2ZNYA 5GTHC 1IO2A 3R0AA 2KZGA 3PUFA 1EV7A 1WJAA 1ZTRA 3BR1A 5M5WJ 1QVUA 2X6XA 3O8GA 3HPHA 3P9KA 1D1AA 4I2OA 2M0MA 2NYXA 2G0EA 1E0EA 3JSOA 1YS7A 1GT0C 4G12A 3J80K 2KRCA 4IOAF 5FRMA 2IS6A 3TW6A 1E3HA 4A5NA 3EYYA 1U5TA 2DT6A 2V6CA 4PJLA 5EYRA 4BS9A 4XRSG 3W2VA 3ELKA 1Z1DA 3JRGA 2XAGA 4HQEA 4E7KA 1TWGJ 2BOLA 2JA7J 4BXXJ 1I6HJ 3OYLA 1LVKA 1SEUA 3M8EA 1BIAA 2X6OA 1UMQA 2OQRA 1LVAA 3KEQA 3WHBA 1PUEE 3R0JA 3CJNA 4XRMA 4FT8A 4BJTA 1YIOA 5LEKA 1OQYA 1RRJA 3PUBA 2G7UA 2RNJA 4EGZA 3ZGKA 3KP3A 4GYIA 1SD6A 1OISA 4DIQA 2NOGA 2EZKA 2L7MP 4BDZA 2M1BA 1S3JA 5E18F 2P4WA 2FOWA 1AHDP 1D1CA 2VJIA 5TGTA 3DKYA 4C2TA 1D5YA 3RYRA 1IN4A 4G6DA 2GXBA 4GGGA 5A2QK 3E1SA 1YTYA 1WWXA 4MHGA 1IXSB 4D5CA 2R93J 4YIIA 2O9LA 2X9DA 3PQKA 3U21A 1HXDA 4U7BA 4BUPA 2FJ1A 4DJAA 4ZC3A 2C6YA 2LP0A 3OSFA 2O7OA 1ETWA 2TCTA 2VJ5A 3IL2A 2I5UA 4XLCA 1T2KA 2GQQA 1IF1A 2FE3A 4OAYA 1QVTA 3W2AA 3WGIA 3PQJA 2P5LC 3Q0WA 1R1UA 4NB5A 2QBYA 5DEQA 3PFYA 2VQGA 3RQ4A 2UXNA 3H3ZA 2FNPA 1ZELA 3H5RA 1A35A 5KNLA 4IRIA 1MBKA 3WG7H 3ZMVA 1YS6A 4BBSJ 5TRDA 4OU0A 2LBFA 4RM3A 4I02A 5CJ9A 3ZCOA 1JKQC 2CV1A 3F6OA 1DP3A 4LB5A 3GTMJ 4WCGA 4UVCA 1A31A 2QCOA 4L9NA 3C3WA 4IOCF 2KJBA 3F0CA 3I53A 2D1HA 2EJRA 2UWMA 4MNUA 4RA2A 1HDDC 3K70D 2DCEA 2CU7A 2OU2A 3OYCA 1W5SA 4BKXA 4KT5C 2HQRA 1SVOA 4KJZA 1R1TA 4CYDA 2XB0X 5J47A 1LNWA 4DZPA 1FOWA 1XDUA 5H2FC 1FTZA 1MBGA 3C1DA 3K10A 3QYFA 4BXUA 4JQFA 1FT9A 2HR3A 2M7BA 2OZ6A 5JVTA 4KIBA 3H5AA 3JRFA 3CUOA 3JW4A 4EVIA 2DTZA 3VPRA 2IW5A 5D4RA 1FYLA 3ZMZA 2WY7Q 1YW7A 3E5QA 5JLWA 4AC0A 3RJPA 5E20A 5KCMA 2VKEA 5HVQC 3SZGA 4RAGA 2CV0A 4GRIA 1T0FA 2VBYA 1ZGWA 1BW5A 2WV0A 2O0YA 2H8RA 2L4AA 3SZTA 5K7FA 2GOMA 1Y6IA 1WHUA 2R3SA 4IHWA 3BZCA 4YEJA 2O8KA 3GZ6A 2KIUA 2RGVA 5ERIA 2FMLA 5FRNA 5D8LB 3G1OA 4R8HA 4OIPF 3HOXJ 1Y1VJ 3KP6A 1QNTA 4L0ZB 1FPQA 2DA6A 4C2UA 1Y8RB 4MTDA 4LMYA 3BTIA 3KP4A 5HDNA 3EUHA 1MJBA 3F3XA 3OMYA 5B5EC 1U3EM 5F64A 4AVZA 1AKHB 3FF5A 3VDXA 1MMDA 4DYRA 4HG2A 4EMSA 3AAFA 5E1ZB 1FP2A 3HG9A 1R58A 1V3FA 2PQ8A 3DPTA 2L0KA 3MEXA 1U9NA 2DOFA 2I10A 3WTZA 3O3KA 4B48A 2R4GA 3IRQA 3RYPA 2M4KA 4D5FA 3G2BA 5LGNA 1HA8A 1NG7A 2VN2A 4FE4A 1U78A 2XVCA 4XN3A 3U9GA 1UHMA 4WWCA 3WTXC 1JI8A 2M0CA 4XR6A 5KK1A 2STTA 3DPUA 2ZCWA 4N9IA 2DDAA 2QKLB 2LC2A 4A3GJ 4IKFA 2O03A 1ZARA 2Y2ZA 3LAPA 2QVOA 4A6DA 4EJVA 3H35A 3J81Z 2TRTA 1PDNC 1QZZA 3CCYA 4UV9A 2BV6A 2WBMA 2RN7A 3TQNA 3HJEA 1FLIA 4QIWN 3GXOA 2HKXA 3K0LA 1FZPB 2MA3A 4LJZF 3VSLA 3Q0UA 1ZLJA 2IBDA 9ANTA 1BM9A 1W5TA 2XGCA 5ICGA 4IJAA 3G71I 4A3FJ 1XSVA 2QSFX 3DBHB 2K86A 2F2EA 4BQNA 4PK4A 1XB4A 5F0CA 1Z91A 2DOEA 1WH5A 3TGNA 2B7EA 4NC8A 2K4JA 3EPZA 1MNMC 4J01A 4LFUA 2V79A 1JXSA 4A3CJ 3ABUA 3ABMH 2KL4A 4I98B 4BU2A 3ZQQA 2MFZA 2NVYJ 1DPUA 5FD6A 2EZHA 2M2EA 2DMQA 2F6CA 1OJLA 2E35A 1K83J 2FBKA 2RNGA 3M8FA 3G6EI 3S1NJ 1F4KA 2V9KA 3JREA 3LA2A 4CA0A 1PP8F 4LG3A 3CC7I 4A0YA 1IRZA 3AL0B 1ZK8A 4HLXA 3ZMUA 3CLOA 2KIMA 2OA4A 4XKVA 5DM7F 4EV0A 3TO7A 4EJTA 3I4MJ 1JJ6C 4CDGA 4E7JA 3GFJA 4L5EA 5DUKA 2BHYA 3A03A 1WJEA 1P7IA 3S3OA 3K2AA 1ZQ3P 5HOOA 3GFMA 4FE7A 5KAFC 3LAJA 1HDPA 4H4KC 4V2GA 2OV7A 3SEQA 3L00A 1FIPA 4IHSA 2FSWA 4BH9A 2AXTC 4P1WA 5M3FJ 2CUEA 1B8IA 5D5VB 3BQYA 4LK0F 5IOYA 1T39A 2D2WA 2AS5F 2HVSA 3DBLB 4I7HA 1FBSA 2IAIA 2CQ7A 4CICA 1LFUP 1QA6A 3VOEA 1XGMA 1ZR2A 2R7UA 4M6XA 2ESHA 4CSWA 1TLHB 4ZTJA 2HVRA 1ZR4A 1HSTA 1WGXA 2CO5A 3WU1B 5F6FA 2W48A 1WJDA 4II2A 4BDYA 3G1LA 2VLAA 4RLFA 3C2BA 2GA1A 3BTCA 3COAC 4CUGA 4MLOA 3N05A 4RBOA 4ENKA 4A3MJ 2UUZA 2G7HA 1WJFA 4Y4RA 1RKTA 3OS0A 2H27A 2PEXA 1MD0A 3BG3A 2KRFA 2AQFA 4DGWB 4OINF 3WTWC 2R7RA 1HKTA 3M7GA 2MD0A 1MBHA 2QUFA 2R92J 3CJSB 3E0JB 1LFPA 4AWXB 3CUQC 1MDMA 1X4OA 2K3PA 2HZDA 2YSRA 4N0BA 5IT9K 3FM5A 4HX7A 3FXUA 1MH3A 2PJRB 2V1NA 3KLOA 3RCOA 2E7XA 1K6YA 3OYAA 2KZVA 1HKSA 4Q48A 1FJLA 2CMPA 5IYBJ 1USSA 3IP4B 3GWZA 4QPOA 2PLYA 1GV5A 2XAHA 3CESA 2NVQJ 1KONA 1J0RA 2MGQA 5F0FA 3IKVA 5EGOA 1BOAA 1T56A 1VQ7I 2Y9YA 3EUKL 2EIJH 3A02A 2YX7A 4Y15A 3TP3A 4O6JA 1Z7UA 1OMIA 1O57A 3KZYA 4RGUA 4B09A 4ENJA 2WB1N 3ZQIA 2A61A 3OYDA 2EK5A 1H9GA 5DCMB 4Z2YA 3F8BA 3BG6A 3GUDA 4W97A 4ZDPA 1CQTA 3K2ZA 4AIKA 1VQ9I 3SHFA 5HLIA 1MBFA 3ZQFA 1KU9A 3NWSA 4DBRA 2OTLI 3AFHA 3M1CA 3KE2A 1IUYA 1FIAA 5J1YA 1R7JA 2LH9A 3HYIA 1IRXA 2P8TA 2M30A 2HNHA 3F9KA 4AYBN 2KP6A 3L2UA 5BS6A 2A69F 5CVVA 1IAWA 3VSKA 4N9HA 3DXJF 4PJ0C 3I4PA 5IY5H 2ISYA 5IP7J 3HSEA 4ABZA 3RPUA 4I99C 3BG7A 1EH6A 1YHQI 1VQLI 3PFIA 3WU2C 1SD7A 4L9TA 2NVTJ 4LOCA 5GPCA 3QYEA 3HOUJ 3B6CA 2ESNA 3VFZA 1QQIA 3HOZJ 3S16J 2K9LA 5HS7A 4XIDA 1Y56A 4HDUA 4ESJA 3BLYA 3QPLA 4ASNA 3UKGA 3KP5A 3HB9A 2GWRA 1A6QA 1QZEA 1YLFA 2QLZA 2F4OB 3EDPA 3HKZN 3BJOA 2LREA 1ZKGA 4CYCB 4N4NB 4JBAA 3WTYC 2VKDA 2NRAC 5K7ZA 2CYYA 2K9SA 2ME6A 3K1NA 2PG4A 3WTSC 2L9NA 1TQMA 3GEZA 5J8FA 3L9FA 1O7LA 2NS8A 2LD5A 3HKZA 1Z3YA 1FSEA 1JHFA 2E1NA 1JJ8C 3ZN0A 2ZB9A 3D0SA 2HI3A 1U8BA 4KA4A 1SAXA 4B44A 1IDZA 5J4YA 4PCQA 3E5UA 4C30A 3CP8A 3FXOA 3ASOH 3OYHA 2AQEA 5CVJA 3K4KA 1D0YA 2DA1A 4NDLA 4BY7J 1U5TC 3CUQB 3VB2A 2EIMH 5LEJA 2IJLA 2OD5A 3FIWA 2QZ8A 2HGCA 1VQ8I 4DYQA 2DFFA 4E7LA 2YX4A 1FOKA 2PMHA 2K85A 2R7SA 4R1HA 2DA5A 1I3QJ 4E7SA 3DKXA 1KYWA 5FKMA 2PFBA 3AG1H 1WJBA 4YFXF 3OS1A 2XB5A 1DDNA 1WZ2A 1XGNA 3HRMA 5A2QZ 3RPUD 1JUMA 2VXZA 2CW0F 3DEUA 4DYCA 5LLQA 4ZYGA 4RB2C 3A01A 1U0JA 3I5UA 4HSRA 4L18B 4E7IA 3LA7A 2E1OA 1VZ0A 3F72A 4JYKA 2WTEA 1CF7B 5HLHA 2FEZA 3T0YA 3TDZC 1JGGA 3KP2A 4JX5A 1F43A 5C4JJ 2IVMA 1UCRA 1FBUA 1Y8QB 5M3MJ 1QPMA 1IRGA 2IS2A 1G3TA 4ZZLA 5LGTA 1A04A 5L3GA 1X58A 1HC8A 2DOAA 2EBIA 2LTPA 1W4MA 1LEBA 2P0WA 1G4DA 1RNLA 4XBFA 1NK3P 3M8JA 4HSTA 1WVRA 2I8DA 5FD5A 3WG9A 3L2RA 1T6SA 3W2WA 2BW3B 2K9MA 2R7OA 3QODA 1TZLA 2JUCA 3RKXA 3OYFA 4IF4A 1YJ9I 2OCCH 2RVCA 3PNTA 3B6AA 4LK1F 4PJJA 5HLTA 1YRNB 3DTEA 1T8IA 4NQWA 1PUFA 2BE5F 2VXDA 3EUAA 3KYLA 4F52A 4EATA 1XSXA 5CQGA 5ICCA 2LY9A 4M3GA 5FJ8J 3Q0VA 1U8RA 3CC2I 4PUSA 1IG7A 3TL4X 3HDDA 1ETYA 2HS5A 2TDXA 3H0GJ 1J7KA 3IAS2 4UUVA 3RKYA 3B02A 1T08B 3FHNA 4IZZA 3AG4H 4IO9F 1EA3A 3OOPA 3H1CA 4MIMA 3QPSA 4MEYF 3BTJA 1XC5A 3CJTB 4A69C 4M72A 4CCLA 4D7MA 4EGYA 4M9SA 4RAFA 2Z2SB 2XAFA 4Q4ZF 1TL8A 2FMYA 4JX4A 3JTHA 4UUSA 2OF7A 3GF2A 3GTLJ 4DQ2A 2JJ7A 4L5IA 3ZMTA 3E97A 4HYEA 4MGRA 4X6AJ 4G6QA 2Y0SN 4C3JJ 2OUMA 3G1MA 1O3SA 2NXNB 2RKHA 5J40A 1BI3A 3S15J 2E2IJ 3JRCA 3CC4I 2UXXA 2KKOA 2QWWA 4B43A 3K7AJ 1MMGA 1YW8A 4YELA 4M9ZA 2MD5A 4B4CA 2LVSA 4MFDA 3M4OJ 2OQGA 1B9MA 1X3WB 2L3DA 4E7HA 3S17J 2KISA 4XL9A 2BXZA 4HV6A 4XSXF 4ESBA 3KCCA 3K4JA 5CLSA 2NVXJ 1FY7A 2K27A 2XHKA 4IQJA 4I01A 3MKYB 2R7FA 4W1UA 1TNTA 5LRSA 1Y0UA 2VASA 4PJMA 1H89C 1OCZH 1X2MA 2IRFG 1UFMA 5BMZA 4RAYA 1ETVA 3EUHC 2HPMA 1H0MA 1VQ4I 4V19K 1IN5A 2JA8J 4EEFG 3M3YJ 1K4SA 1HOMA 4BY1J 3CMYA 5EJCA 5ICEA 3EETA 1MJ9A 4ZYEA 1VTNC 4C3HJ 2GZWA 4D0PA 1S72I 3LMMA 5IP6A 4RMNA 2DJIA 3OL4A 3FWEA 4NC6A 4IPAA 1LDJA 4EJUA 1JTYA 1LFBA 3JAMK 1IW7F 2HKOA 3K4CA 2LKXA 4HF2A 2A5WA 2VOPA 3IWFA 5HDGA 1LKXA 4N4OB 3FK7A 1V54H 1Z6RA 1EKEA 1PYVA 3DU5A 2H6BA 3SDBA 1K6OA 3CJRB 2E71A 3NRVA 4IVNA 4ITVA 2QBYB 3ZP5A 4A3KJ 5LHIA 1FP1D 1FMVA 2FQ4A 1ZRFA 2P6TA 4BEHA 1XGOA 2JN6A 5H6RA 2JZYA 2WA0A 1PVEA 3FMSA 2JA5J 3J7YJ 4LIVA 3D5RC 4F93B 1RESA 5TISC 4LITA 2Y31A 5LRRA 2A6HF 4NHJA 2GIZA 1Z0XA 3KEOA 1KGSA 3OR2C 4ESFA 1B6AA 1WI3A 5DYMA 1QGPA 2YS9A 2W00A 3S3MA 5GTIC 2JVHA 2LKPA 1PJRA 2R7VA 2EZLA 2ZMEA 4BHCA 4KN7X 3H9QA 1ACIA 1HW5A 1B1BA 3GLXA 2CS3A 3EGVB 1XMAA 2Z1DA 4I6ZA 4HAMA 2V7FA 4ZTFA 2YR2A 2FQ3A 3A1YA 4HX8A 6PAXA 4AD9A 4A3BJ 2DBBA 4A5MA 4WXDA 2QA4I 3MZHA 5E79C 2VUMJ 3C7JA 1DP7P 3TDUC 1TWAJ 3IV5A 1EH7A 1OCPA 3QPTA 4GCVA 4CCNA 2FXAA 3BOQA 1P92A 2ZFUA 4OMYA 1MBEA 1SC7A 3G73A 3BJAA 3QRFF 1LEAA 3ABLH 1Q1VA 3UR3C 3L2QA 1W0UA 5JHUA 1HLVA 3LWFA 2ZBKA 2DO7A 2DYSH 3CTAA 1ZAOA 2XSDC 3IH3A 2PX9A 1ITYA 1I3AA 1FEXA 3L2VA 3D1NI 2E2JJ 3PO2J 5ED4A 4G7HF 2LRDA 4Y13A 4G9YA 5FLVA 2M5WA 3MKZA 3UNGC 2QGUA 5FKOA 2A07F 2R7TA 4HA8A 2DA4A 4XICA 2VOOA 1R71A 1LJ9A 3H3VK 3K4NA 2LK2A 2EV6A 2L01A 2HOSA 3DKWA 3I59A 1ZREA 4XOTA 4XQFA 5F1RA 1QPIA 3O6BB 2HWVA 3H36A 3V8KA 5ILVA 3BR3A 3VYUB 5IYCJ 3RSNA 2VC0A 3ZMSA 2IPQX 1W36D 2HU9A 2CUJA 1J09A 4XLFA 3Q9SA 1V5FA 3HZJA 2IS1A 5HNHA 5IT9Z 3CCSI 3FMQA 4X1EA 3GMEA 1FC3A 3D5LA 3WE2A 4E6KG 3OV8A 4JX6A 2M4GA 1B4AA 4XKWA 4Q5SF 1Z05A 4LB6B 2HDDA 1T98A 4C9YA 1OFCX 3HHHA 4NUBA 2DU9A 2O61A 1VI0A 4PFOA 1VQ5I 3R61A 1WKMA 3GFLA 3GO5A 4QLCU 4HEA2 1PP7U 3MKWB 3F8NA 1LB2A 3J7AO 4QPQA 2OTJI 4RDUA 3H5NA 1OCOH 4KICA 2DQRA 3W6KB 2VE9A 1I1SA 2HQAA 1EF4A 3FXLA 2F48A 5EEGA 1YX5A 3OOUA 3TW7A 4XKCA 5IP9J 2ZKZA 1V5GA 1WH7A 2E1CA 3CMEI 3HOSA 2NS7A 3D5SC 3S3NA 3DF8A 2EFOA 4KNYA 3P9IA 2YU3A 5IYDJ 2MW8A 1V55H 2LF8A 3ECOA 4BJ5C 4M3FA 2DDBA 1ETQA 2HQ5A 5FB2A 4U0VA 2JSPA 5F04A 5K1YA 4A6EA 1G3WA 2Z33A 2NS0A 2DFHA 2PN6A 3MMYB 3AKZA 3RKWA 2X85A 3CP2A 2QQAA 3KZIC 3SDGA 1MMSA 1ERDA 1ZYRF 3TMOA 1Y0NA 2FOKA 1QBJA 2RQQA 2K5CA 1O3RA 1YOVB 1D8KA 2VBWA 4FCYA 4I76A 3DQVC 1BL0A 1UHWA 1Z6TA 1VQMI 2HOTA 4HNUA 1B9NA 1ULYA 2WC2A 1RR7A 2L9SA 3V4GA 4M3EA 2DK8A 3SFZA 3BC8A 3LSIA 4FX0A 1MH4A 2JRTA 3HRUA 2R5ZA 1YJNI 1JE8A 3KYCB 1LQ1A 4UVAA 2M45A 3GTQJ 1UG2A 2VQHA 1H8AC 1P4WA 2ZXWH 1U2WA 1RI7A 4G7OF 3SYTA 2VKVA 5FO5A 2Z16A 1OYYA 2EQRA 3PSFA 1TWHJ 3SFIA 5HNFA 2K7LA 4XK4A 1O4XA 2WAEA 1D8JA 5KVRA 2QM3A 1O3TA 2MC3A 3HSFA 3U1KA 1ZRDA 4KITB 4M6VA 1YYVA 2BY3A 3BP8A 4KIGA 2HDWA 3HEFA 1OLTA 2P5VA 3OSGA 2LMDA 1AKHA 3VEPA 5HDKA 2LDUA 3R6SA 2KRHA 3LSHA 5LHHA 3MD2A 2F5VA 4XLEA 1YIJI 4BJ6C 3DP7A 3ZRGA 1MKMA 3I64A 5D4SA 3IRRA 2V1UA 3CCJI 3BCAA 1V4RA 5ILSA 4ENMA 3BR2A 3QYBA 3KX2A 2ELJA 1B72B 3HTSB 3C18A 2LY1A 3CLQA 2WAFA 5ILUA 2IP2A 3CF5F 1X1PA 4PGHA 3OYJA 1G59A 2LLKA 2ADUA 4LG0B 2L02A 1K78B 3FXMA 1YI2I 1OR7A 2GXAA 2CUZA 3FZVA 1U6GA 3BJ6A 3K69A 5EGOB 2QEXI 3PJRA 5K7HA 2R5YB 3HL2A 4BGDA 2FA5A 2E2HJ 1STZA 2M8EA 1E3OC 2CJJA 2DODA 2MLGA 1ZG3A 2FF4A 2L7FP 1TW3A 2OBPA 5EZGA 2ME0A 1D3YA 4KT6A 2R7QA 2CFXA 4WX9A 1OKRA 4TV7A 1YW9A 2CWEA 4ZZDA 2JTVA 3WODF 2ICWG 2O6GE 2UZKA 1J59A 2ZXJA 2EV0A 4HPQA 2L9VA 2YU9J 2XPWA 3ZMDA 1R6RA 2STWA 2JPBA 2VB6A 3AG3H 5LHGA 4PGGA 3GZ5A 4XOPA 4EM2A 1UELB 2Q2EA 5D6EA 1ZGJA 1R5GA 2W57A 2GA2A 5L3CA 3A0BC 3BCBA 5DS9A 4G94A 5C4XJ 1HBXG 3RTRA 4K2EA 2VI6A 4HV5A 1I50J 1EJ9A 3OYEA 1ORKA 3V8JA 4CO8A 2VL8A 4G7ZF 3QP6A 2EPFA 2DW4A 4KYWA 1MW7A 3A2KA 4M3BA 1XMXA 2XDVA 4MTEA 2EV5A 5B1AH 4DNCA 3L1PA 1EH8A 4U0YA 2P5KA 3S32A 2KLOA 2DMTA 5LFAA 5DUIA 3LSJA 4OWRB 1SFXA 1W7PB 4JOMA 4DW6A 4EJWA 4BE1A 2K4BA 1A5JA 3LFKA 2L9RA 2HYJA 5D5UB 3BR6A 2OC6A 5IT3A 1SD5A 2ECBA 5FLXZ 2OJED 2IA0A 5HLGA 3CCVI 1R4MB 2A6TA 2W4SA 3REOA 3LSPA 1KYZA 2X48A 2PMZN 2M9HA 2VE8A 2ACJA 2DT7B 2WB1A 1BR1A 5LD2C 1RETA 4BHBA 4Y17A 3GCMA 2IA2A 3DTKA 3HTUA 1YO5C 2DAOA 3U2RA 1N78A 2X1CA 4L0YB 1YE9A 1I39A 2CRGA 1L0OC 3H9GA 2IT0A 1IC8A 5E3MA 2PJPA 3LSMA 4BBRJ 1FYMA 3ZPLA 3J7AY 3TEDA 5BNGA 4AYBA 1ZN2A 1MMAA 1TWCJ 2XPVA 4HQMA 1RUOA 3Q5FA 3CO6C 4IEJA 2XROA 2DMNA 5FLMJ 2HTSA 3SQNA 3GTPJ 1MSFC 3CDLA 4C2MJ 2OCEA 3TOBA 4D9JA 4HW0A 1QO0D 5FFZA 1ZGAA 3LA3A 1R36A 3I3LA 3IH2A 4XLPF 2IGOA 2XIGA 1JKPC 5B1BH 2ZJ2A 2WY8Q 4HLYA 4J00A 4CHUA 3BY6A 1DGWY 4MQVA 3MWMA 5F27A 1QRYA 4E7ZA 3S2HJ 2E1MC 3K6GA 4F91B 1F36A 3DEWA 4M74A 3LSGA 4XM3A 5EG0B 3ROUA 1N25A 2WWYA 1TC3C 5BPDA 4AUXA 1GLNA 5ICFA 4B47A 1FYKA 3JAMZ 1F5TA 1TP4A 2JRMA 1I6XA 3CCQI 2OPTA 2VJ4A 4EM1A 1XSDA 3VYRB 1ZH5A 3M9AA 1LE8B 1OCRH 5D5WB 3PL8A 1SFEA 4ZDOA 1HF0A 3F6VA 3E6BA 1XGSA 2IEKA 3S93A 2KIFA 3EYIA 1S8NA 3CDHA 3QP5A 4GDFA 2EWNA 3F8MA 3LFUA 2K02A 3HUGA 2E34A 2P6SA 2ETHA 2P81A 3MZ8A 3P9CA 3OR1C 1NTCA 1FMWA 3LQQA 3HBLA 1T33A 3I54A 4ANJA 3OYMA 2M34A 2XUBA 5AONA 2HEOA 2XGEA 1R5HA 3K9TA 3K70C 3FXQA 3ZQ7A 5B66C 1BJAA 1IN8A 2QYOA 2VKHA 3HSRA 2EINH 4LLGF 1IUFA 3BG9A 4RB3C 2IA1A 1F1ZA 2K40A 1S7OA 4U0WA 1TW2A 3E6DA 2VPLA 1Z21A 4MQ9F 2CH0A 4XMYA 1TT0A 5DTDA 2JVGA 2FBIA 4GYGA 4BXFA 3IAM2 5FKKA 1X1CA 2V9PA 2CFOA 2L7KA 3JCUC 5CVIA 3H0DA 1RUNA 5BQTA 4P5OA 2EFNA 3QOPA 3FKIJ 4F3QA 2CQQA 1WIBA 1OPCA 4WK8F 4MEXF 4GO1A 2HYGD 2RDPA 1TQPA 3PIPF 4XNFA 1KU3A 2VODA 3IH4A 4YIRX 2MLKA 3JRAA 4QSHA 2XAQA 5EEAA 1ZHFA 2DTRA 1DUXC 3DLLF 2F4MB 1W1WE 3GTOJ 2K3FA 2QQ8A 2VJJA 1ETKA 1RR8C 3DEEA 2K9QA 3E6MA 2OZUA 1DPRA 2BHZA 3CUQA 4LLLA 4KDPA 1GV2A 2NAZA 5C44J 5L3FA 5JVGF 3GX4X 3ZQLA 2P7CB 2EIKH 2H09A 3TO9A 3CQZJ 2E1MB 1I1GA 1JUPA 2KIQA 4M3DA 3X2QH 3ERMA 5D8KB 3CF2A 2K9NA 2XPUA 5HS9A 3TOAA 1WJCA 2KDOA 2BY0A 4RGXA 4BNCA 3S2WA 5AIQA 4Y3OA 2LR8A 1FSHA 4NC7A 5FLXK 1XN7A 3MQ0A 4F92B 4HNVA 2EB7A 4OAZA 2VBZA 3H3UA 5K5OA 1CF7A 1HW1A 5M5YJ 1QU3A 3GZNB 5HS8A 3GVAA 2JT1A 1ENHA 2XASA 1S9HA 1U5TB 4V2FA 4AM3A 4I09A 3QU6A 3S2DJ 4PSWA 1FX7A 4KIFA 3K4MA 5KAIC 2W7NA 4ETSA 4L9VA 5GP9A 4HF1A 4S0HB 4I0AA 1S29A 1BR4A 3QPHA 1T0FC 1YITI 2Y0SA 3KP7A 3VYTB 1R5ID 2MH2A 1D0ZA 2ZO4A 4O5VA 2GLOA 1ODDA 5CVUA 2Q8KA 4PDKA 4IL6C 2HPIA 4BEHB 1O7FA 3HM5A 2LNBA 2GBYA 2GXGA 3JTGA 1JT6A 2DN0A 4IQ4A 2X6WA 4AIJA 2XRNA 1MMNA 2DA2A 2BW3A 2CUFA 1D5VA 3GBGA 2OAZA 4B3XA 5JI6A 3LL7A 1S7EA 2V9VA 1XMKA 3BZKA 4CCMA 2O3FA 3WGHA 1IN6A 1ETOA 1H88C 2F5EA 2RREA 3F8FA 4KN4X 4M73A 1W5CC 1YG2A 4MFEA 4RM2A 5GADJ 1AA7A 4PSXA 5E3OA 3GTGJ 5L3BA 1FOYA 4NNJA 3BROA 3L7WA 2DYRH 4A3EJ 4P9FA 1P4AA 5H6QA 1G6NA 1RC9A 1JT0A 1A6IA 1YQAA 3IUOA 5EEHA 4FTHA 3GW2A 1VQ6I 3CJQB 5FFXA 2PBIA 1P6RA 2CQNA 3DCFA 1K4TA 2QSHX 2VC1A 4CCKA 1G3YA 2ZFWA 2V4JC 4IHTA 2HOEA 4B8XA 4FASD 2W24A 1G3SA 1X1DA 4P96A 4UHTA 4FHTA 3DV8A 5FKNA 4B3AA 3ASNH 2FU4A 3QWLA 2KDZA 4A3DJ 3WTTC 1VQPI 1TT5B 1BI0A 1WCMJ 2HTJA 3MZYA 3R60A 3V7RA 2LBFB 4RB1A 2W25A 3HRTA 4JP0A 3KPHA 2BEOA 3FDYA 3G4SI 3I56I 2A5YB 1MZBA 3BPVA 3T1BA 5E3LA 2IS4A 2CW7A 4BE2A 5E8IA 3WTUC 2DJNA 1BA5A 5JHFA 1Z77A 2F5FA 4JK1X 2FRHA 1J75A 2ZJQF 1MBJA 4ZYAA 4HRIA 2VPRA 2CGPA 3CMAI 4XSZF 4WXCA 3HC7A 5F1JA 3I59B 1HCRA 4HF0A 3HGGA 2ELKA 2HDCA 1Z9CA 3RI4A 1R4NB 5FGMA 3V42A 3MCZA 2MG4A 3Q9VA 1QHGA 1S5LC 4P9UA 2CW8A 2L4MA 2JSCA 1CGPA 3V8LA 1L3LA 4A12A 1DQUA 1WQ2A 1ZLKA 1JKRC 2DFEA 2WV1A 4HX4A 3NWTA 2A68F 4NBQA 5EF6A 4PZJA 2AO9A 2LY2A 2ZXHA 2KFDA 4HDVA 2FX0A 3MAJA 3JR9A 4A0ZA 4BACA 5L3DA 3MN2A 1RPWA 4CXFA 2AHQA 4BE0A 1OR7C 4EQQA 3MFKA 3HOTA 1ZRCA 1UAAA 2KHMA 4XLHA 2V1DA 3IKTA 2GIVA 2DXIA 2IGKA 3HOYJ 1P2FA 3FKJA 4A0XA 3G3ZA 3ZQHA 3JRDA 1J9IA 2V6EA 1WPKA 1NH3A 3NARA 4ZH4F 4I0BA 3P7NA 4R79A 1MSEC 3OYKA 1Y39A 4GXOA 4UNOA 1SFKA 3WU0A 1USTA 5FKLA 3CCEI 1O3QA 5IOZA 1S7AA 3S1QJ 3W3CA 3E6CC 1ON2A 5DDGA 1X1BA 2E36A 4YG2F 4ZJZA 4S04A 3ULQB 1YJWI 1MNDA 3TO6A 3DU6A 4WXHA 3I9V2 1WI9A 1A36A 1Z3XA 1IJWC 3BG5A 3I58A 3ZQGA 1BI1A 1KZHA 2EZIA 1BI2A 4XRSA 3ZXSA 3F22A 2YPRA 4X0GA 3NQOA 2FNAA 2N8GA 1J2XA 4LD5A 1LDKB 4RLQA 4U88A 4RAZA 1WSUA 3I55I 2Y30A 4UUTA 3AL0C 2KQRA 2VIXA 4A2UA 3ECHA 3CCUI 2X6YA 4QTRA 4AU7A 3K1MA 2RQPA 3FBIB 1R23A 2R5ZB 3GTJJ 3C2GA 4GFBA 4UV8A 1P4XA 2FUG2 3NEUA 3L2CA 1KU2A 3ZOBA 1FOXA 2F5DA 4IRHA 3ESWB 4PFPA 5J1RA 4BQOA 1BIBA 2ZJPF 1W0TA 2X0LA 3RQIA 5J8CA 4UB6C 5J1UA 2JWTA 3ZQCA 1XCVA 5LBQA 4RGRA 4CCJA 4FQGA 2XGDA 2RV8A 2O8XA 3SXYA 1LDDA 1NG6A 3ML6A 1BOBA 2JA2A 4CZCA 3SEZA 1IN7A 2MSYA 1XS9A 4O3MA 3F23A 2H94A 2E7WA 3CCMI
chains in the Genus database with same CATH topology
5DM7F 1HC8A 2FOWA 1S72I 1YHQI 1VQLI 3CCVI 4UY8I 3CCSI 3CJRB 1YJ9I 1YIJI 5GADJ 1FOYA 1QA6A 5GAEJ 1VQ5I 3CCJI 3J7YJ 1WIBA 3CC2I 1VQNI 2OTJI 1VQ6I 3CJQB 3PIPF 5DM6F 4IO9F 1Y39A 3CF5F 5GAGJ 3CCEI 3CJTB 3CMEI 3DLLF 1YI2I 2K3FA 1ACIA 2E36A 3CCLI 2QEXI 1VQKI 1YJWI 3EGVB 3CJSB 3CCRI 2JQ7A 1VQPI 3CD6I 2QA4I 5JVGF 4IOCF 2NXNB 3G4SI 3I56I 1VQ8I 3I55I 2H8WA 3G71I 3CC4I 3CCUI 1MMSA 1VQ7I 2ZJQF 3CCQI 1FOXA 3CMAI 1FOWA 4IOAF 2ZJRF 1VQOI 2ZJPF 1VQMI 1VQ9I 2OTLI 3PIOF 1YJNI 3J7ZI 2E34A 2E35A 3G6EI 1VQ4I 4V19K 3CC7I 1YITI 5GAHJ 3CCMI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DM7 F;  1HC8 A;  2FOW A;  1S72 I;  1YHQ I;  1VQL I;  3CCV I;  4UY8 I;  3CCS I;  3CJR B;  1YJ9 I;  1YIJ I;  5GAD J;  1FOY A;  1QA6 A;  5GAE J;  1VQ5 I;  3CCJ I;  3J7Y J;  1WIB A;  3CC2 I;  1VQN I;  2OTJ I;  1VQ6 I;  3CJQ B;  3PIP F;  5DM6 F;  4IO9 F;  1Y39 A;  3CF5 F;  5GAG J;  3CCE I;  3CJT B;  3CME I;  3DLL F;  1YI2 I;  2K3F A;  1ACI A;  2E36 A;  3CCL I;  2QEX I;  1VQK I;  1YJW I;  3EGV B;  3CJS B;  3CCR I;  2JQ7 A;  1VQP I;  3CD6 I;  2QA4 I;  5JVG F;  4IOC F;  2NXN B;  3G4S I;  3I56 I;  1VQ8 I;  3I55 I;  2H8W A;  3G71 I;  3CC4 I;  3CCU I;  1MMS A;  1VQ7 I;  2ZJQ F;  3CCQ I;  1FOX A;  3CMA I;  1FOW A;  4IOA F;  2ZJR F;  1VQO I;  2ZJP F;  1VQM I;  1VQ9 I;  2OTL I;  3PIO F;  1YJN I;  3J7Z I;  2E34 A;  2E35 A;  3G6E I;  1VQ4 I;  4V19 K;  3CC7 I;  1YIT I;  5GAH J;  3CCM I; 
#chains in the Genus database with same CATH topology
 3JRB A;  1N75 A;  4YFN F;  1GHC A;  4G8X A;  4AIH A;  3SJM A;  3LSR A;  1U9O A;  2Z5U A;  1IV8 A;  2FBH A;  1TNS A;  2Y0M A;  3ONQ A;  4XOR A;  1VFC A;  2HVQ A;  3PSI A;  2BGC A;  2R7W A;  5E8G A;  1XPX A;  4F7Z A;  1K79 A;  1M1E B;  5E1X A;  4IHV A;  1VND A;  1LPQ A;  3L09 A;  3FK6 A;  3FXR A;  2DMU A;  2W85 A;  4G6T B;  5JR3 A;  5F0H A;  2COM A;  3DLA A;  3CO7 C;  1Z67 A;  2BVL A;  5DD8 A;  2D45 A;  1B8I B;  5CPR B;  4XN0 A;  5KHD A;  2W82 A;  2W84 A;  3VWB A;  5E17 F;  4XLN F;  4LGW A;  1P9Q C;  2HQN A;  2DI3 A;  3M1E A;  3F21 A;  2VQL A;  1SVM A;  2XAU A;  1QHH D;  5DM6 F;  3LSK A;  5GAG J;  4BQQ A;  1TWF J;  3QAH A;  2FD5 A;  1D1B A;  3Q3S A;  1MJA A;  4IX7 A;  2F4I A;  2HYF A;  4BL0 B;  3HOW J;  3KIO A;  1OCC H;  3CCL I;  4YIF A;  3CCR I;  1ONV A;  2QSG X;  2PI0 A;  1SVL A;  1HSJ A;  5FRO A;  2Q2E B;  2HZT A;  4A3L J;  3CD6 I;  3KZZ A;  1BJZ A;  2XAJ A;  2CV2 A;  3QQA A;  1MDM B;  4ENN A;  2NVU B;  1IDY A;  5M5X J;  2EH3 A;  2HXI A;  3H9J A;  5BOX A;  2NNN A;  2MYS A;  1GXP A;  2H8W A;  1OYI A;  5E1W A;  3DTI A;  4XON A;  2HOA A;  2DPD A;  2E19 A;  2J5P A;  3JRI A;  2ZSH B;  1C0W A;  4A3I J;  2M7A A;  1N77 A;  4A93 J;  1T38 A;  4DZJ A;  1I5Z A;  2CQK A;  3O8H A;  4UXN A;  2ZJR F;  2GM4 A;  2D5V A;  2WAQ N;  2L54 A;  3VOD A;  3EQL F;  3BZ6 A;  3K4L A;  4UB8 C;  1XCB A;  2IGN A;  2EIL H;  5IPA A;  3PIO F;  2Q1Z B;  2D1V A;  4CGZ A;  2X51 A;  2ZNZ A;  2W1O A;  1IRF A;  2NOJ B;  3RPQ A;  1F9N A;  3FMR A;  2VT3 A;  4LLN A;  2WAQ A;  3IWZ A;  2F5C A;  1GXQ A;  2MAB A;  5CVR A;  1X3U A;  2LKS A;  3OS2 A;  1REP C;  5GAH J;  3ABT A;  4EJO A;  3K1P A;  5H20 A;  1T95 A;  2LYC A;  4Z6Y A;  3KLN A;  5K5Q A;  3BTL A;  2CG4 A;  2GAU A;  1VF9 A;  4L5J A;  3LOC A;  3BDD A;  3FM3 A;  3RZD J;  2E5Z A;  4D1Q A;  1K7A A;  1B59 A;  3H92 A;  3OYG A;  3M07 A;  3T8T A;  2A05 A;  2DMP A;  1S6L A;  3V7S A;  4UY8 I;  3T8R A;  1E17 A;  2X1E A;  4IHX A;  1SAN A;  2JUG A;  3PO3 J;  2BVM A;  2L5Q A;  3WGG A;  2GOX B;  1X4P A;  1B72 A;  2E5N A;  2H6C A;  2PMU A;  1KU7 A;  2VQC A;  3NAU A;  4IHY A;  3V7C A;  4FX4 A;  3CMM A;  3RKQ A;  5LGU A;  2VON A;  4OMZ A;  5D6F A;  5AIP A;  2G9W A;  1VQN I;  2M8G X;  4IXA A;  1XX5 A;  2XF6 A;  2DT5 A;  2ID6 A;  3OY9 A;  4KIS A;  1AOY A;  2H1K A;  4LIU A;  2BXY A;  2ZXI A;  2LSO A;  4KMF A;  1GUU A;  4LG0 A;  3VYS B;  2BY2 A;  3MVP A;  1K78 A;  3HOV J;  1JTX A;  2ID3 A;  4ZDL A;  3IC7 A;  5CYV A;  3ZN1 A;  3S1M J;  4H0E A;  2R5Y A;  3FXK A;  4YRV A;  2BBY A;  3E5X A;  3WHC A;  3K4B A;  1Z7L A;  3OYI A;  4HOB A;  1VQK I;  4U7D A;  3I4N J;  1R00 A;  1X3Z B;  2A3S A;  2XF5 A;  5HOD A;  2JQ7 A;  4BAY A;  2PMZ A;  3W6V A;  4WF2 A;  2MBF A;  2J5O A;  3BWG A;  3FXJ A;  3LQR A;  4EM0 B;  3ERE D;  1R49 A;  2Z99 A;  1NK2 P;  3S14 J;  2Q0O A;  2B63 J;  1KQ8 A;  3W6J B;  2KJC A;  1AU7 A;  4OIQ F;  1GVJ A;  1BC7 C;  1IXC A;  1P7J A;  1IXR C;  3PNY A;  3O2P E;  3P5J A;  3JRH A;  1BN5 A;  4XLA A;  2A6E F;  1HW2 A;  4XRF A;  1JKO C;  4ZYH A;  3HUG B;  2COB A;  1SD4 A;  4KUM A;  1SMT A;  2BY1 A;  3BR5 A;  3FBN B;  2R0Q C;  4M9X A;  1DU6 A;  1K61 A;  4U87 A;  5J6X A;  3R4K A;  3L2W A;  2UV1 A;  4HZF A;  2WAD A;  3FX3 A;  2PJR A;  1VQO I;  1KQ0 A;  3KEY A;  3OIO A;  1Y1W J;  2LG4 A;  1TTY A;  1WJ5 A;  5EZH A;  4RGS A;  4AVP A;  3GYH X;  3A01 B;  4F55 A;  3RZO J;  3RIR A;  1H9T A;  1GDT A;  1IGN A;  4ON0 A;  2LFB A;  5L3E A;  4P55 A;  3J7Z I;  1AWC A;  1X2N A;  2V26 A;  2IXS A;  4RS8 A;  5DD4 A;  1BBY A;  1POG A;  1W7P A;  3WE3 A;  2O5R A;  2DPU A;  2DQL A;  1LUJ B;  3J81 K;  2KMU A;  5DCM A;  3FIS A;  4D7N A;  4L9J A;  1YFH A;  2QF7 A;  1OCT C;  2XF7 A;  1TQI A;  2YUS A;  3BT9 A;  1MNE A;  3J80 Z;  3U1D A;  3GTK J;  1XDS A;  3HRS A;  5B3S H;  1V5E A;  5F08 A;  2L2O A;  3BPX A;  3LNQ A;  3C2H A;  3KYD B;  5D5X B;  2KPM A;  4S05 A;  2XRL A;  4BQA A;  3E7L A;  4CCO A;  1BC8 C;  3A4C A;  2QEN A;  4Y52 J;  1ZG1 A;  3PNV A;  1BR2 A;  4E4H A;  4FIS A;  1HQC A;  2EA4 A;  3TBI A;  3RDI A;  4C3I J;  2QQB A;  3HXL A;  5GAE J;  2XV4 S;  2RC4 A;  4YFK F;  5JFR A;  4M6Y A;  3WTV C;  4NQW B;  2P7V B;  2X4H A;  4QWQ A;  1ETX A;  1PUF B;  3DPL C;  2HXO A;  3MKL A;  3S1R J;  2JMW A;  1I27 A;  3T5X A;  3CDI A;  1JGS A;  1R9T J;  1D0X A;  5K5R A;  1W36 C;  3JSP A;  2QQ9 A;  2RAE A;  4OOI A;  3DBR B;  3OYN A;  2ZME C;  3TKY A;  1WFX A;  3F8C A;  3FHZ A;  4CYC A;  1HKQ A;  3OL3 A;  1RKW A;  1XD7 A;  1KQ9 A;  2DK5 A;  3N4M A;  4A3J J;  5J4V A;  2AXL A;  4HBL A;  5DCF A;  5EG0 A;  2VBX A;  2X1D A;  4UUS B;  1G8X A;  1JHH A;  2ELH A;  3A0H C;  1R1V A;  2XSJ C;  2CSO A;  2EFP A;  2XKO A;  4FET A;  4ZYD A;  1W7P D;  2KT0 A;  3GFI A;  3I71 A;  4DOZ A;  2R7D A;  3N97 A;  3B73 A;  1E3P A;  3ABK H;  1IV6 A;  2HFH A;  1LE8 A;  3E3V A;  2Z3Y A;  2Y9Z A;  2E60 A;  4CH7 A;  3DFG A;  1ON1 A;  2R7Z J;  4BYY A;  3OWT A;  3S8P A;  1SMY F;  3OIP A;  2JK3 A;  2H1L A;  4Q47 A;  1UZC A;  1OYW A;  1UG0 A;  2MC4 A;  1UHS A;  4KFC A;  1TBX A;  2BZT A;  2DFI A;  2JA6 J;  1FTT A;  1SFU A;  2ZSI B;  5EDN A;  4CZZ A;  1GVD A;  5JLX A;  2ZC2 A;  2NNY A;  1SAU A;  1X19 A;  2IGM A;  3ZR8 X;  2EFQ A;  2DLL A;  2Z9O A;  3ISP A;  1QZY A;  1J5Y A;  4OIO F;  3KET A;  1ZG5 A;  2EFW A;  4Y33 A;  4KMU X;  1NHA A;  3KFW X;  1G2H A;  1FBQ A;  3BQZ A;  1BW6 A;  1FWZ A;  2JPC A;  1RIO H;  1Q1H A;  4Y7N J;  1FNN A;  5E3N A;  3QU3 A;  4M71 A;  1KA8 A;  2B0L A;  2DA3 A;  3HGY A;  2Y75 A;  1MIJ A;  4IRG A;  2LF7 A;  2L7Z A;  3IHU A;  1DU0 A;  3CZ6 A;  1JUS A;  5DV5 A;  5BPI A;  2ECC A;  4B1R A;  5C3E J;  1SFO J;  1YX3 A;  3OYB A;  4XKB A;  1R22 A;  2BYV E;  1XG1 A;  2LOO A;  3PM1 A;  4BHP A;  2XKP A;  2EA2 A;  2Y48 A;  4DBQ A;  2XGX A;  2ISZ A;  1X1A A;  4AID A;  2R7X A;  5CKT A;  1RZ4 A;  2B9S A;  1MGT A;  3HHG A;  3OIQ A;  3TP0 A;  4HNT A;  2VT2 A;  4J19 A;  1YRN A;  2M3A A;  1UB9 A;  1E2X A;  1WRJ A;  2QKM B;  3HIF A;  2MH9 A;  1APL C;  4E70 A;  1XTA A;  4PJN A;  4OIR F;  2ZME B;  3BR0 A;  3HPG A;  1DGR M;  5GPA A;  5J3L A;  4MO7 A;  2DA7 A;  2V1X A;  3GLL A;  1UJ8 A;  2M87 A;  3I0T A;  2Y69 H;  3QOE A;  2CQX A;  4II3 A;  2XC7 A;  3LST A;  4UVB A;  4RB0 A;  5CQE A;  1IZ1 A;  3SZP A;  5TJJ A;  3DWL E;  3AG2 H;  2ZNY A;  5GTH C;  1IO2 A;  3R0A A;  2KZG A;  3PUF A;  1EV7 A;  1WJA A;  1ZTR A;  3BR1 A;  5M5W J;  1QVU A;  2X6X A;  3O8G A;  3HPH A;  3P9K A;  1D1A A;  4I2O A;  2M0M A;  2NYX A;  2G0E A;  1E0E A;  3JSO A;  1YS7 A;  1GT0 C;  4G12 A;  3J80 K;  2KRC A;  4IOA F;  5FRM A;  2IS6 A;  3TW6 A;  1E3H A;  4A5N A;  3EYY A;  1U5T A;  2DT6 A;  2V6C A;  4PJL A;  5EYR A;  4BS9 A;  4XRS G;  3W2V A;  3ELK A;  1Z1D A;  3JRG A;  2XAG A;  4HQE A;  4E7K A;  1TWG J;  2BOL A;  2JA7 J;  4BXX J;  1I6H J;  3OYL A;  1LVK A;  1SEU A;  3M8E A;  1BIA A;  2X6O A;  1UMQ A;  2OQR A;  1LVA A;  3KEQ A;  3WHB A;  1PUE E;  3R0J A;  3CJN A;  4XRM A;  4FT8 A;  4BJT A;  1YIO A;  5LEK A;  1OQY A;  1RRJ A;  3PUB A;  2G7U A;  2RNJ A;  4EGZ A;  3ZGK A;  3KP3 A;  4GYI A;  1SD6 A;  1OIS A;  4DIQ A;  2NOG A;  2EZK A;  2L7M P;  4BDZ A;  2M1B A;  1S3J A;  5E18 F;  2P4W A;  2FOW A;  1AHD P;  1D1C A;  2VJI A;  5TGT A;  3DKY A;  4C2T A;  1D5Y A;  3RYR A;  1IN4 A;  4G6D A;  2GXB A;  4GGG A;  5A2Q K;  3E1S A;  1YTY A;  1WWX A;  4MHG A;  1IXS B;  4D5C A;  2R93 J;  4YII A;  2O9L A;  2X9D A;  3PQK A;  3U21 A;  1HXD A;  4U7B A;  4BUP A;  2FJ1 A;  4DJA A;  4ZC3 A;  2C6Y A;  2LP0 A;  3OSF A;  2O7O A;  1ETW A;  2TCT A;  2VJ5 A;  3IL2 A;  2I5U A;  4XLC A;  1T2K A;  2GQQ A;  1IF1 A;  2FE3 A;  4OAY A;  1QVT A;  3W2A A;  3WGI A;  3PQJ A;  2P5L C;  3Q0W A;  1R1U A;  4NB5 A;  2QBY A;  5DEQ A;  3PFY A;  2VQG A;  3RQ4 A;  2UXN A;  3H3Z A;  2FNP A;  1ZEL A;  3H5R A;  1A35 A;  5KNL A;  4IRI A;  1MBK A;  3WG7 H;  3ZMV A;  1YS6 A;  4BBS J;  5TRD A;  4OU0 A;  2LBF A;  4RM3 A;  4I02 A;  5CJ9 A;  3ZCO A;  1JKQ C;  2CV1 A;  3F6O A;  1DP3 A;  4LB5 A;  3GTM J;  4WCG A;  4UVC A;  1A31 A;  2QCO A;  4L9N A;  3C3W A;  4IOC F;  2KJB A;  3F0C A;  3I53 A;  2D1H A;  2EJR A;  2UWM A;  4MNU A;  4RA2 A;  1HDD C;  3K70 D;  2DCE A;  2CU7 A;  2OU2 A;  3OYC A;  1W5S A;  4BKX A;  4KT5 C;  2HQR A;  1SVO A;  4KJZ A;  1R1T A;  4CYD A;  2XB0 X;  5J47 A;  1LNW A;  4DZP A;  1FOW A;  1XDU A;  5H2F C;  1FTZ A;  1MBG A;  3C1D A;  3K10 A;  3QYF A;  4BXU A;  4JQF A;  1FT9 A;  2HR3 A;  2M7B A;  2OZ6 A;  5JVT A;  4KIB A;  3H5A A;  3JRF A;  3CUO A;  3JW4 A;  4EVI A;  2DTZ A;  3VPR A;  2IW5 A;  5D4R A;  1FYL A;  3ZMZ A;  2WY7 Q;  1YW7 A;  3E5Q A;  5JLW A;  4AC0 A;  3RJP A;  5E20 A;  5KCM A;  2VKE A;  5HVQ C;  3SZG A;  4RAG A;  2CV0 A;  4GRI A;  1T0F A;  2VBY A;  1ZGW A;  1BW5 A;  2WV0 A;  2O0Y A;  2H8R A;  2L4A A;  3SZT A;  5K7F A;  2GOM A;  1Y6I A;  1WHU A;  2R3S A;  4IHW A;  3BZC A;  4YEJ A;  2O8K A;  3GZ6 A;  2KIU A;  2RGV A;  5ERI A;  2FML A;  5FRN A;  5D8L B;  3G1O A;  4R8H A;  4OIP F;  3HOX J;  1Y1V J;  3KP6 A;  1QNT A;  4L0Z B;  1FPQ A;  2DA6 A;  4C2U A;  1Y8R B;  4MTD A;  4LMY A;  3BTI A;  3KP4 A;  5HDN A;  3EUH A;  1MJB A;  3F3X A;  3OMY A;  5B5E C;  1U3E M;  5F64 A;  4AVZ A;  1AKH B;  3FF5 A;  3VDX A;  1MMD A;  4DYR A;  4HG2 A;  4EMS A;  3AAF A;  5E1Z B;  1FP2 A;  3HG9 A;  1R58 A;  1V3F A;  2PQ8 A;  3DPT A;  2L0K A;  3MEX A;  1U9N A;  2DOF A;  2I10 A;  3WTZ A;  3O3K A;  4B48 A;  2R4G A;  3IRQ A;  3RYP A;  2M4K A;  4D5F A;  3G2B A;  5LGN A;  1HA8 A;  1NG7 A;  2VN2 A;  4FE4 A;  1U78 A;  2XVC A;  4XN3 A;  3U9G A;  1UHM A;  4WWC A;  3WTX C;  1JI8 A;  2M0C A;  4XR6 A;  5KK1 A;  2STT A;  3DPU A;  2ZCW A;  4N9I A;  2DDA A;  2QKL B;  2LC2 A;  4A3G J;  4IKF A;  2O03 A;  1ZAR A;  2Y2Z A;  3LAP A;  2QVO A;  4A6D A;  4EJV A;  3H35 A;  3J81 Z;  2TRT A;  1PDN C;  1QZZ A;  3CCY A;  4UV9 A;  2BV6 A;  2WBM A;  2RN7 A;  3TQN A;  3HJE A;  1FLI A;  4QIW N;  3GXO A;  2HKX A;  3K0L A;  1FZP B;  2MA3 A;  4LJZ F;  3VSL A;  3Q0U A;  1ZLJ A;  2IBD A;  9ANT A;  1BM9 A;  1W5T A;  2XGC A;  5ICG A;  4IJA A;  3G71 I;  4A3F J;  1XSV A;  2QSF X;  3DBH B;  2K86 A;  2F2E A;  4BQN A;  4PK4 A;  1XB4 A;  5F0C A;  1Z91 A;  2DOE A;  1WH5 A;  3TGN A;  2B7E A;  4NC8 A;  2K4J A;  3EPZ A;  1MNM C;  4J01 A;  4LFU A;  2V79 A;  1JXS A;  4A3C J;  3ABU A;  3ABM H;  2KL4 A;  4I98 B;  4BU2 A;  3ZQQ A;  2MFZ A;  2NVY J;  1DPU A;  5FD6 A;  2EZH A;  2M2E A;  2DMQ A;  2F6C A;  1OJL A;  2E35 A;  1K83 J;  2FBK A;  2RNG A;  3M8F A;  3G6E I;  3S1N J;  1F4K A;  2V9K A;  3JRE A;  3LA2 A;  4CA0 A;  1PP8 F;  4LG3 A;  3CC7 I;  4A0Y A;  1IRZ A;  3AL0 B;  1ZK8 A;  4HLX A;  3ZMU A;  3CLO A;  2KIM A;  2OA4 A;  4XKV A;  5DM7 F;  4EV0 A;  3TO7 A;  4EJT A;  3I4M J;  1JJ6 C;  4CDG A;  4E7J A;  3GFJ A;  4L5E A;  5DUK A;  2BHY A;  3A03 A;  1WJE A;  1P7I A;  3S3O A;  3K2A A;  1ZQ3 P;  5HOO A;  3GFM A;  4FE7 A;  5KAF C;  3LAJ A;  1HDP A;  4H4K C;  4V2G A;  2OV7 A;  3SEQ A;  3L00 A;  1FIP A;  4IHS A;  2FSW A;  4BH9 A;  2AXT C;  4P1W A;  5M3F J;  2CUE A;  1B8I A;  5D5V B;  3BQY A;  4LK0 F;  5IOY A;  1T39 A;  2D2W A;  2AS5 F;  2HVS A;  3DBL B;  4I7H A;  1FBS A;  2IAI A;  2CQ7 A;  4CIC A;  1LFU P;  1QA6 A;  3VOE A;  1XGM A;  1ZR2 A;  2R7U A;  4M6X A;  2ESH A;  4CSW A;  1TLH B;  4ZTJ A;  2HVR A;  1ZR4 A;  1HST A;  1WGX A;  2CO5 A;  3WU1 B;  5F6F A;  2W48 A;  1WJD A;  4II2 A;  4BDY A;  3G1L A;  2VLA A;  4RLF A;  3C2B A;  2GA1 A;  3BTC A;  3COA C;  4CUG A;  4MLO A;  3N05 A;  4RBO A;  4ENK A;  4A3M J;  2UUZ A;  2G7H A;  1WJF A;  4Y4R A;  1RKT A;  3OS0 A;  2H27 A;  2PEX A;  1MD0 A;  3BG3 A;  2KRF A;  2AQF A;  4DGW B;  4OIN F;  3WTW C;  2R7R A;  1HKT A;  3M7G A;  2MD0 A;  1MBH A;  2QUF A;  2R92 J;  3CJS B;  3E0J B;  1LFP A;  4AWX B;  3CUQ C;  1MDM A;  1X4O A;  2K3P A;  2HZD A;  2YSR A;  4N0B A;  5IT9 K;  3FM5 A;  4HX7 A;  3FXU A;  1MH3 A;  2PJR B;  2V1N A;  3KLO A;  3RCO A;  2E7X A;  1K6Y A;  3OYA A;  2KZV A;  1HKS A;  4Q48 A;  1FJL A;  2CMP A;  5IYB J;  1USS A;  3IP4 B;  3GWZ A;  4QPO A;  2PLY A;  1GV5 A;  2XAH A;  3CES A;  2NVQ J;  1KON A;  1J0R A;  2MGQ A;  5F0F A;  3IKV A;  5EGO A;  1BOA A;  1T56 A;  1VQ7 I;  2Y9Y A;  3EUK L;  2EIJ H;  3A02 A;  2YX7 A;  4Y15 A;  3TP3 A;  4O6J A;  1Z7U A;  1OMI A;  1O57 A;  3KZY A;  4RGU A;  4B09 A;  4ENJ A;  2WB1 N;  3ZQI A;  2A61 A;  3OYD A;  2EK5 A;  1H9G A;  5DCM B;  4Z2Y A;  3F8B A;  3BG6 A;  3GUD A;  4W97 A;  4ZDP A;  1CQT A;  3K2Z A;  4AIK A;  1VQ9 I;  3SHF A;  5HLI A;  1MBF A;  3ZQF A;  1KU9 A;  3NWS A;  4DBR A;  2OTL I;  3AFH A;  3M1C A;  3KE2 A;  1IUY A;  1FIA A;  5J1Y A;  1R7J A;  2LH9 A;  3HYI A;  1IRX A;  2P8T A;  2M30 A;  2HNH A;  3F9K A;  4AYB N;  2KP6 A;  3L2U A;  5BS6 A;  2A69 F;  5CVV A;  1IAW A;  3VSK A;  4N9H A;  3DXJ F;  4PJ0 C;  3I4P A;  5IY5 H;  2ISY A;  5IP7 J;  3HSE A;  4ABZ A;  3RPU A;  4I99 C;  3BG7 A;  1EH6 A;  1YHQ I;  1VQL I;  3PFI A;  3WU2 C;  1SD7 A;  4L9T A;  2NVT J;  4LOC A;  5GPC A;  3QYE A;  3HOU J;  3B6C A;  2ESN A;  3VFZ A;  1QQI A;  3HOZ J;  3S16 J;  2K9L A;  5HS7 A;  4XID A;  1Y56 A;  4HDU A;  4ESJ A;  3BLY A;  3QPL A;  4ASN A;  3UKG A;  3KP5 A;  3HB9 A;  2GWR A;  1A6Q A;  1QZE A;  1YLF A;  2QLZ A;  2F4O B;  3EDP A;  3HKZ N;  3BJO A;  2LRE A;  1ZKG A;  4CYC B;  4N4N B;  4JBA A;  3WTY C;  2VKD A;  2NRA C;  5K7Z A;  2CYY A;  2K9S A;  2ME6 A;  3K1N A;  2PG4 A;  3WTS C;  2L9N A;  1TQM A;  3GEZ A;  5J8F A;  3L9F A;  1O7L A;  2NS8 A;  2LD5 A;  3HKZ A;  1Z3Y A;  1FSE A;  1JHF A;  2E1N A;  1JJ8 C;  3ZN0 A;  2ZB9 A;  3D0S A;  2HI3 A;  1U8B A;  4KA4 A;  1SAX A;  4B44 A;  1IDZ A;  5J4Y A;  4PCQ A;  3E5U A;  4C30 A;  3CP8 A;  3FXO A;  3ASO H;  3OYH A;  2AQE A;  5CVJ A;  3K4K A;  1D0Y A;  2DA1 A;  4NDL A;  4BY7 J;  1U5T C;  3CUQ B;  3VB2 A;  2EIM H;  5LEJ A;  2IJL A;  2OD5 A;  3FIW A;  2QZ8 A;  2HGC A;  1VQ8 I;  4DYQ A;  2DFF A;  4E7L A;  2YX4 A;  1FOK A;  2PMH A;  2K85 A;  2R7S A;  4R1H A;  2DA5 A;  1I3Q J;  4E7S A;  3DKX A;  1KYW A;  5FKM A;  2PFB A;  3AG1 H;  1WJB A;  4YFX F;  3OS1 A;  2XB5 A;  1DDN A;  1WZ2 A;  1XGN A;  3HRM A;  5A2Q Z;  3RPU D;  1JUM A;  2VXZ A;  2CW0 F;  3DEU A;  4DYC A;  5LLQ A;  4ZYG A;  4RB2 C;  3A01 A;  1U0J A;  3I5U A;  4HSR A;  4L18 B;  4E7I A;  3LA7 A;  2E1O A;  1VZ0 A;  3F72 A;  4JYK A;  2WTE A;  1CF7 B;  5HLH A;  2FEZ A;  3T0Y A;  3TDZ C;  1JGG A;  3KP2 A;  4JX5 A;  1F43 A;  5C4J J;  2IVM A;  1UCR A;  1FBU A;  1Y8Q B;  5M3M J;  1QPM A;  1IRG A;  2IS2 A;  1G3T A;  4ZZL A;  5LGT A;  1A04 A;  5L3G A;  1X58 A;  1HC8 A;  2DOA A;  2EBI A;  2LTP A;  1W4M A;  1LEB A;  2P0W A;  1G4D A;  1RNL A;  4XBF A;  1NK3 P;  3M8J A;  4HST A;  1WVR A;  2I8D A;  5FD5 A;  3WG9 A;  3L2R A;  1T6S A;  3W2W A;  2BW3 B;  2K9M A;  2R7O A;  3QOD A;  1TZL A;  2JUC A;  3RKX A;  3OYF A;  4IF4 A;  1YJ9 I;  2OCC H;  2RVC A;  3PNT A;  3B6A A;  4LK1 F;  4PJJ A;  5HLT A;  1YRN B;  3DTE A;  1T8I A;  4NQW A;  1PUF A;  2BE5 F;  2VXD A;  3EUA A;  3KYL A;  4F52 A;  4EAT A;  1XSX A;  5CQG A;  5ICC A;  2LY9 A;  4M3G A;  5FJ8 J;  3Q0V A;  1U8R A;  3CC2 I;  4PUS A;  1IG7 A;  3TL4 X;  3HDD A;  1ETY A;  2HS5 A;  2TDX A;  3H0G J;  1J7K A;  3IAS 2;  4UUV A;  3RKY A;  3B02 A;  1T08 B;  3FHN A;  4IZZ A;  3AG4 H;  4IO9 F;  1EA3 A;  3OOP A;  3H1C A;  4MIM A;  3QPS A;  4MEY F;  3BTJ A;  1XC5 A;  3CJT B;  4A69 C;  4M72 A;  4CCL A;  4D7M A;  4EGY A;  4M9S A;  4RAF A;  2Z2S B;  2XAF A;  4Q4Z F;  1TL8 A;  2FMY A;  4JX4 A;  3JTH A;  4UUS A;  2OF7 A;  3GF2 A;  3GTL J;  4DQ2 A;  2JJ7 A;  4L5I A;  3ZMT A;  3E97 A;  4HYE A;  4MGR A;  4X6A J;  4G6Q A;  2Y0S N;  4C3J J;  2OUM A;  3G1M A;  1O3S A;  2NXN B;  2RKH A;  5J40 A;  1BI3 A;  3S15 J;  2E2I J;  3JRC A;  3CC4 I;  2UXX A;  2KKO A;  2QWW A;  4B43 A;  3K7A J;  1MMG A;  1YW8 A;  4YEL A;  4M9Z A;  2MD5 A;  4B4C A;  2LVS A;  4MFD A;  3M4O J;  2OQG A;  1B9M A;  1X3W B;  2L3D A;  4E7H A;  3S17 J;  2KIS A;  4XL9 A;  2BXZ A;  4HV6 A;  4XSX F;  4ESB A;  3KCC A;  3K4J A;  5CLS A;  2NVX J;  1FY7 A;  2K27 A;  2XHK A;  4IQJ A;  4I01 A;  3MKY B;  2R7F A;  4W1U A;  1TNT A;  5LRS A;  1Y0U A;  2VAS A;  4PJM A;  1H89 C;  1OCZ H;  1X2M A;  2IRF G;  1UFM A;  5BMZ A;  4RAY A;  1ETV A;  3EUH C;  2HPM A;  1H0M A;  1VQ4 I;  4V19 K;  1IN5 A;  2JA8 J;  4EEF G;  3M3Y J;  1K4S A;  1HOM A;  4BY1 J;  3CMY A;  5EJC A;  5ICE A;  3EET A;  1MJ9 A;  4ZYE A;  1VTN C;  4C3H J;  2GZW A;  4D0P A;  1S72 I;  3LMM A;  5IP6 A;  4RMN A;  2DJI A;  3OL4 A;  3FWE A;  4NC6 A;  4IPA A;  1LDJ A;  4EJU A;  1JTY A;  1LFB A;  3JAM K;  1IW7 F;  2HKO A;  3K4C A;  2LKX A;  4HF2 A;  2A5W A;  2VOP A;  3IWF A;  5HDG A;  1LKX A;  4N4O B;  3FK7 A;  1V54 H;  1Z6R A;  1EKE A;  1PYV A;  3DU5 A;  2H6B A;  3SDB A;  1K6O A;  3CJR B;  2E71 A;  3NRV A;  4IVN A;  4ITV A;  2QBY B;  3ZP5 A;  4A3K J;  5LHI A;  1FP1 D;  1FMV A;  2FQ4 A;  1ZRF A;  2P6T A;  4BEH A;  1XGO A;  2JN6 A;  5H6R A;  2JZY A;  2WA0 A;  1PVE A;  3FMS A;  2JA5 J;  3J7Y J;  4LIV A;  3D5R C;  4F93 B;  1RES A;  5TIS C;  4LIT A;  2Y31 A;  5LRR A;  2A6H F;  4NHJ A;  2GIZ A;  1Z0X A;  3KEO A;  1KGS A;  3OR2 C;  4ESF A;  1B6A A;  1WI3 A;  5DYM A;  1QGP A;  2YS9 A;  2W00 A;  3S3M A;  5GTI C;  2JVH A;  2LKP A;  1PJR A;  2R7V A;  2EZL A;  2ZME A;  4BHC A;  4KN7 X;  3H9Q A;  1ACI A;  1HW5 A;  1B1B A;  3GLX A;  2CS3 A;  3EGV B;  1XMA A;  2Z1D A;  4I6Z A;  4HAM A;  2V7F A;  4ZTF A;  2YR2 A;  2FQ3 A;  3A1Y A;  4HX8 A;  6PAX A;  4AD9 A;  4A3B J;  2DBB A;  4A5M A;  4WXD A;  2QA4 I;  3MZH A;  5E79 C;  2VUM J;  3C7J A;  1DP7 P;  3TDU C;  1TWA J;  3IV5 A;  1EH7 A;  1OCP A;  3QPT A;  4GCV A;  4CCN A;  2FXA A;  3BOQ A;  1P92 A;  2ZFU A;  4OMY A;  1MBE A;  1SC7 A;  3G73 A;  3BJA A;  3QRF F;  1LEA A;  3ABL H;  1Q1V A;  3UR3 C;  3L2Q A;  1W0U A;  5JHU A;  1HLV A;  3LWF A;  2ZBK A;  2DO7 A;  2DYS H;  3CTA A;  1ZAO A;  2XSD C;  3IH3 A;  2PX9 A;  1ITY A;  1I3A A;  1FEX A;  3L2V A;  3D1N I;  2E2J J;  3PO2 J;  5ED4 A;  4G7H F;  2LRD A;  4Y13 A;  4G9Y A;  5FLV A;  2M5W A;  3MKZ A;  3UNG C;  2QGU A;  5FKO A;  2A07 F;  2R7T A;  4HA8 A;  2DA4 A;  4XIC A;  2VOO A;  1R71 A;  1LJ9 A;  3H3V K;  3K4N A;  2LK2 A;  2EV6 A;  2L01 A;  2HOS A;  3DKW A;  3I59 A;  1ZRE A;  4XOT A;  4XQF A;  5F1R A;  1QPI A;  3O6B B;  2HWV A;  3H36 A;  3V8K A;  5ILV A;  3BR3 A;  3VYU B;  5IYC J;  3RSN A;  2VC0 A;  3ZMS A;  2IPQ X;  1W36 D;  2HU9 A;  2CUJ A;  1J09 A;  4XLF A;  3Q9S A;  1V5F A;  3HZJ A;  2IS1 A;  5HNH A;  5IT9 Z;  3CCS I;  3FMQ A;  4X1E A;  3GME A;  1FC3 A;  3D5L A;  3WE2 A;  4E6K G;  3OV8 A;  4JX6 A;  2M4G A;  1B4A A;  4XKW A;  4Q5S F;  1Z05 A;  4LB6 B;  2HDD A;  1T98 A;  4C9Y A;  1OFC X;  3HHH A;  4NUB A;  2DU9 A;  2O61 A;  1VI0 A;  4PFO A;  1VQ5 I;  3R61 A;  1WKM A;  3GFL A;  3GO5 A;  4QLC U;  4HEA 2;  1PP7 U;  3MKW B;  3F8N A;  1LB2 A;  3J7A O;  4QPQ A;  2OTJ I;  4RDU A;  3H5N A;  1OCO H;  4KIC A;  2DQR A;  3W6K B;  2VE9 A;  1I1S A;  2HQA A;  1EF4 A;  3FXL A;  2F48 A;  5EEG A;  1YX5 A;  3OOU A;  3TW7 A;  4XKC A;  5IP9 J;  2ZKZ A;  1V5G A;  1WH7 A;  2E1C A;  3CME I;  3HOS A;  2NS7 A;  3D5S C;  3S3N A;  3DF8 A;  2EFO A;  4KNY A;  3P9I A;  2YU3 A;  5IYD J;  2MW8 A;  1V55 H;  2LF8 A;  3ECO A;  4BJ5 C;  4M3F A;  2DDB A;  1ETQ A;  2HQ5 A;  5FB2 A;  4U0V A;  2JSP A;  5F04 A;  5K1Y A;  4A6E A;  1G3W A;  2Z33 A;  2NS0 A;  2DFH A;  2PN6 A;  3MMY B;  3AKZ A;  3RKW A;  2X85 A;  3CP2 A;  2QQA A;  3KZI C;  3SDG A;  1MMS A;  1ERD A;  1ZYR F;  3TMO A;  1Y0N A;  2FOK A;  1QBJ A;  2RQQ A;  2K5C A;  1O3R A;  1YOV B;  1D8K A;  2VBW A;  4FCY A;  4I76 A;  3DQV C;  1BL0 A;  1UHW A;  1Z6T A;  1VQM I;  2HOT A;  4HNU A;  1B9N A;  1ULY A;  2WC2 A;  1RR7 A;  2L9S A;  3V4G A;  4M3E A;  2DK8 A;  3SFZ A;  3BC8 A;  3LSI A;  4FX0 A;  1MH4 A;  2JRT A;  3HRU A;  2R5Z A;  1YJN I;  1JE8 A;  3KYC B;  1LQ1 A;  4UVA A;  2M45 A;  3GTQ J;  1UG2 A;  2VQH A;  1H8A C;  1P4W A;  2ZXW H;  1U2W A;  1RI7 A;  4G7O F;  3SYT A;  2VKV A;  5FO5 A;  2Z16 A;  1OYY A;  2EQR A;  3PSF A;  1TWH J;  3SFI A;  5HNF A;  2K7L A;  4XK4 A;  1O4X A;  2WAE A;  1D8J A;  5KVR A;  2QM3 A;  1O3T A;  2MC3 A;  3HSF A;  3U1K A;  1ZRD A;  4KIT B;  4M6V A;  1YYV A;  2BY3 A;  3BP8 A;  4KIG A;  2HDW A;  3HEF A;  1OLT A;  2P5V A;  3OSG A;  2LMD A;  1AKH A;  3VEP A;  5HDK A;  2LDU A;  3R6S A;  2KRH A;  3LSH A;  5LHH A;  3MD2 A;  2F5V A;  4XLE A;  1YIJ I;  4BJ6 C;  3DP7 A;  3ZRG A;  1MKM A;  3I64 A;  5D4S A;  3IRR A;  2V1U A;  3CCJ I;  3BCA A;  1V4R A;  5ILS A;  4ENM A;  3BR2 A;  3QYB A;  3KX2 A;  2ELJ A;  1B72 B;  3HTS B;  3C18 A;  2LY1 A;  3CLQ A;  2WAF A;  5ILU A;  2IP2 A;  3CF5 F;  1X1P A;  4PGH A;  3OYJ A;  1G59 A;  2LLK A;  2ADU A;  4LG0 B;  2L02 A;  1K78 B;  3FXM A;  1YI2 I;  1OR7 A;  2GXA A;  2CUZ A;  3FZV A;  1U6G A;  3BJ6 A;  3K69 A;  5EGO B;  2QEX I;  3PJR A;  5K7H A;  2R5Y B;  3HL2 A;  4BGD A;  2FA5 A;  2E2H J;  1STZ A;  2M8E A;  1E3O C;  2CJJ A;  2DOD A;  2MLG A;  1ZG3 A;  2FF4 A;  2L7F P;  1TW3 A;  2OBP A;  5EZG A;  2ME0 A;  1D3Y A;  4KT6 A;  2R7Q A;  2CFX A;  4WX9 A;  1OKR A;  4TV7 A;  1YW9 A;  2CWE A;  4ZZD A;  2JTV A;  3WOD F;  2ICW G;  2O6G E;  2UZK A;  1J59 A;  2ZXJ A;  2EV0 A;  4HPQ A;  2L9V A;  2YU9 J;  2XPW A;  3ZMD A;  1R6R A;  2STW A;  2JPB A;  2VB6 A;  3AG3 H;  5LHG A;  4PGG A;  3GZ5 A;  4XOP A;  4EM2 A;  1UEL B;  2Q2E A;  5D6E A;  1ZGJ A;  1R5G A;  2W57 A;  2GA2 A;  5L3C A;  3A0B C;  3BCB A;  5DS9 A;  4G94 A;  5C4X J;  1HBX G;  3RTR A;  4K2E A;  2VI6 A;  4HV5 A;  1I50 J;  1EJ9 A;  3OYE A;  1ORK A;  3V8J A;  4CO8 A;  2VL8 A;  4G7Z F;  3QP6 A;  2EPF A;  2DW4 A;  4KYW A;  1MW7 A;  3A2K A;  4M3B A;  1XMX A;  2XDV A;  4MTE A;  2EV5 A;  5B1A H;  4DNC A;  3L1P A;  1EH8 A;  4U0Y A;  2P5K A;  3S32 A;  2KLO A;  2DMT A;  5LFA A;  5DUI A;  3LSJ A;  4OWR B;  1SFX A;  1W7P B;  4JOM A;  4DW6 A;  4EJW A;  4BE1 A;  2K4B A;  1A5J A;  3LFK A;  2L9R A;  2HYJ A;  5D5U B;  3BR6 A;  2OC6 A;  5IT3 A;  1SD5 A;  2ECB A;  5FLX Z;  2OJE D;  2IA0 A;  5HLG A;  3CCV I;  1R4M B;  2A6T A;  2W4S A;  3REO A;  3LSP A;  1KYZ A;  2X48 A;  2PMZ N;  2M9H A;  2VE8 A;  2ACJ A;  2DT7 B;  2WB1 A;  1BR1 A;  5LD2 C;  1RET A;  4BHB A;  4Y17 A;  3GCM A;  2IA2 A;  3DTK A;  3HTU A;  1YO5 C;  2DAO A;  3U2R A;  1N78 A;  2X1C A;  4L0Y B;  1YE9 A;  1I39 A;  2CRG A;  1L0O C;  3H9G A;  2IT0 A;  1IC8 A;  5E3M A;  2PJP A;  3LSM A;  4BBR J;  1FYM A;  3ZPL A;  3J7A Y;  3TED A;  5BNG A;  4AYB A;  1ZN2 A;  1MMA A;  1TWC J;  2XPV A;  4HQM A;  1RUO A;  3Q5F A;  3CO6 C;  4IEJ A;  2XRO A;  2DMN A;  5FLM J;  2HTS A;  3SQN A;  3GTP J;  1MSF C;  3CDL A;  4C2M J;  2OCE A;  3TOB A;  4D9J A;  4HW0 A;  1QO0 D;  5FFZ A;  1ZGA A;  3LA3 A;  1R36 A;  3I3L A;  3IH2 A;  4XLP F;  2IGO A;  2XIG A;  1JKP C;  5B1B H;  2ZJ2 A;  2WY8 Q;  4HLY A;  4J00 A;  4CHU A;  3BY6 A;  1DGW Y;  4MQV A;  3MWM A;  5F27 A;  1QRY A;  4E7Z A;  3S2H J;  2E1M C;  3K6G A;  4F91 B;  1F36 A;  3DEW A;  4M74 A;  3LSG A;  4XM3 A;  5EG0 B;  3ROU A;  1N25 A;  2WWY A;  1TC3 C;  5BPD A;  4AUX A;  1GLN A;  5ICF A;  4B47 A;  1FYK A;  3JAM Z;  1F5T A;  1TP4 A;  2JRM A;  1I6X A;  3CCQ I;  2OPT A;  2VJ4 A;  4EM1 A;  1XSD A;  3VYR B;  1ZH5 A;  3M9A A;  1LE8 B;  1OCR H;  5D5W B;  3PL8 A;  1SFE A;  4ZDO A;  1HF0 A;  3F6V A;  3E6B A;  1XGS A;  2IEK A;  3S93 A;  2KIF A;  3EYI A;  1S8N A;  3CDH A;  3QP5 A;  4GDF A;  2EWN A;  3F8M A;  3LFU A;  2K02 A;  3HUG A;  2E34 A;  2P6S A;  2ETH A;  2P81 A;  3MZ8 A;  3P9C A;  3OR1 C;  1NTC A;  1FMW A;  3LQQ A;  3HBL A;  1T33 A;  3I54 A;  4ANJ A;  3OYM A;  2M34 A;  2XUB A;  5AON A;  2HEO A;  2XGE A;  1R5H A;  3K9T A;  3K70 C;  3FXQ A;  3ZQ7 A;  5B66 C;  1BJA A;  1IN8 A;  2QYO A;  2VKH A;  3HSR A;  2EIN H;  4LLG F;  1IUF A;  3BG9 A;  4RB3 C;  2IA1 A;  1F1Z A;  2K40 A;  1S7O A;  4U0W A;  1TW2 A;  3E6D A;  2VPL A;  1Z21 A;  4MQ9 F;  2CH0 A;  4XMY A;  1TT0 A;  5DTD A;  2JVG A;  2FBI A;  4GYG A;  4BXF A;  3IAM 2;  5FKK A;  1X1C A;  2V9P A;  2CFO A;  2L7K A;  3JCU C;  5CVI A;  3H0D A;  1RUN A;  5BQT A;  4P5O A;  2EFN A;  3QOP A;  3FKI J;  4F3Q A;  2CQQ A;  1WIB A;  1OPC A;  4WK8 F;  4MEX F;  4GO1 A;  2HYG D;  2RDP A;  1TQP A;  3PIP F;  4XNF A;  1KU3 A;  2VOD A;  3IH4 A;  4YIR X;  2MLK A;  3JRA A;  4QSH A;  2XAQ A;  5EEA A;  1ZHF A;  2DTR A;  1DUX C;  3DLL F;  2F4M B;  1W1W E;  3GTO J;  2K3F A;  2QQ8 A;  2VJJ A;  1ETK A;  1RR8 C;  3DEE A;  2K9Q A;  3E6M A;  2OZU A;  1DPR A;  2BHZ A;  3CUQ A;  4LLL A;  4KDP A;  1GV2 A;  2NAZ A;  5C44 J;  5L3F A;  5JVG F;  3GX4 X;  3ZQL A;  2P7C B;  2EIK H;  2H09 A;  3TO9 A;  3CQZ J;  2E1M B;  1I1G A;  1JUP A;  2KIQ A;  4M3D A;  3X2Q H;  3ERM A;  5D8K B;  3CF2 A;  2K9N A;  2XPU A;  5HS9 A;  3TOA A;  1WJC A;  2KDO A;  2BY0 A;  4RGX A;  4BNC A;  3S2W A;  5AIQ A;  4Y3O A;  2LR8 A;  1FSH A;  4NC7 A;  5FLX K;  1XN7 A;  3MQ0 A;  4F92 B;  4HNV A;  2EB7 A;  4OAZ A;  2VBZ A;  3H3U A;  5K5O A;  1CF7 A;  1HW1 A;  5M5Y J;  1QU3 A;  3GZN B;  5HS8 A;  3GVA A;  2JT1 A;  1ENH A;  2XAS A;  1S9H A;  1U5T B;  4V2F A;  4AM3 A;  4I09 A;  3QU6 A;  3S2D J;  4PSW A;  1FX7 A;  4KIF A;  3K4M A;  5KAI C;  2W7N A;  4ETS A;  4L9V A;  5GP9 A;  4HF1 A;  4S0H B;  4I0A A;  1S29 A;  1BR4 A;  3QPH A;  1T0F C;  1YIT I;  2Y0S A;  3KP7 A;  3VYT B;  1R5I D;  2MH2 A;  1D0Z A;  2ZO4 A;  4O5V A;  2GLO A;  1ODD A;  5CVU A;  2Q8K A;  4PDK A;  4IL6 C;  2HPI A;  4BEH B;  1O7F A;  3HM5 A;  2LNB A;  2GBY A;  2GXG A;  3JTG A;  1JT6 A;  2DN0 A;  4IQ4 A;  2X6W A;  4AIJ A;  2XRN A;  1MMN A;  2DA2 A;  2BW3 A;  2CUF A;  1D5V A;  3GBG A;  2OAZ A;  4B3X A;  5JI6 A;  3LL7 A;  1S7E A;  2V9V A;  1XMK A;  3BZK A;  4CCM A;  2O3F A;  3WGH A;  1IN6 A;  1ETO A;  1H88 C;  2F5E A;  2RRE A;  3F8F A;  4KN4 X;  4M73 A;  1W5C C;  1YG2 A;  4MFE A;  4RM2 A;  5GAD J;  1AA7 A;  4PSX A;  5E3O A;  3GTG J;  5L3B A;  1FOY A;  4NNJ A;  3BRO A;  3L7W A;  2DYR H;  4A3E J;  4P9F A;  1P4A A;  5H6Q A;  1G6N A;  1RC9 A;  1JT0 A;  1A6I A;  1YQA A;  3IUO A;  5EEH A;  4FTH A;  3GW2 A;  1VQ6 I;  3CJQ B;  5FFX A;  2PBI A;  1P6R A;  2CQN A;  3DCF A;  1K4T A;  2QSH X;  2VC1 A;  4CCK A;  1G3Y A;  2ZFW A;  2V4J C;  4IHT A;  2HOE A;  4B8X A;  4FAS D;  2W24 A;  1G3S A;  1X1D A;  4P96 A;  4UHT A;  4FHT A;  3DV8 A;  5FKN A;  4B3A A;  3ASN H;  2FU4 A;  3QWL A;  2KDZ A;  4A3D J;  3WTT C;  1VQP I;  1TT5 B;  1BI0 A;  1WCM J;  2HTJ A;  3MZY A;  3R60 A;  3V7R A;  2LBF B;  4RB1 A;  2W25 A;  3HRT A;  4JP0 A;  3KPH A;  2BEO A;  3FDY A;  3G4S I;  3I56 I;  2A5Y B;  1MZB A;  3BPV A;  3T1B A;  5E3L A;  2IS4 A;  2CW7 A;  4BE2 A;  5E8I A;  3WTU C;  2DJN A;  1BA5 A;  5JHF A;  1Z77 A;  2F5F A;  4JK1 X;  2FRH A;  1J75 A;  2ZJQ F;  1MBJ A;  4ZYA A;  4HRI A;  2VPR A;  2CGP A;  3CMA I;  4XSZ F;  4WXC A;  3HC7 A;  5F1J A;  3I59 B;  1HCR A;  4HF0 A;  3HGG A;  2ELK A;  2HDC A;  1Z9C A;  3RI4 A;  1R4N B;  5FGM A;  3V42 A;  3MCZ A;  2MG4 A;  3Q9V A;  1QHG A;  1S5L C;  4P9U A;  2CW8 A;  2L4M A;  2JSC A;  1CGP A;  3V8L A;  1L3L A;  4A12 A;  1DQU A;  1WQ2 A;  1ZLK A;  1JKR C;  2DFE A;  2WV1 A;  4HX4 A;  3NWT A;  2A68 F;  4NBQ A;  5EF6 A;  4PZJ A;  2AO9 A;  2LY2 A;  2ZXH A;  2KFD A;  4HDV A;  2FX0 A;  3MAJ A;  3JR9 A;  4A0Z A;  4BAC A;  5L3D A;  3MN2 A;  1RPW A;  4CXF A;  2AHQ A;  4BE0 A;  1OR7 C;  4EQQ A;  3MFK A;  3HOT A;  1ZRC A;  1UAA A;  2KHM A;  4XLH A;  2V1D A;  3IKT A;  2GIV A;  2DXI A;  2IGK A;  3HOY J;  1P2F A;  3FKJ A;  4A0X A;  3G3Z A;  3ZQH A;  3JRD A;  1J9I A;  2V6E A;  1WPK A;  1NH3 A;  3NAR A;  4ZH4 F;  4I0B A;  3P7N A;  4R79 A;  1MSE C;  3OYK A;  1Y39 A;  4GXO A;  4UNO A;  1SFK A;  3WU0 A;  1UST A;  5FKL A;  3CCE I;  1O3Q A;  5IOZ A;  1S7A A;  3S1Q J;  3W3C A;  3E6C C;  1ON2 A;  5DDG A;  1X1B A;  2E36 A;  4YG2 F;  4ZJZ A;  4S04 A;  3ULQ B;  1YJW I;  1MND A;  3TO6 A;  3DU6 A;  4WXH A;  3I9V 2;  1WI9 A;  1A36 A;  1Z3X A;  1IJW C;  3BG5 A;  3I58 A;  3ZQG A;  1BI1 A;  1KZH A;  2EZI A;  1BI2 A;  4XRS A;  3ZXS A;  3F22 A;  2YPR A;  4X0G A;  3NQO A;  2FNA A;  2N8G A;  1J2X A;  4LD5 A;  1LDK B;  4RLQ A;  4U88 A;  4RAZ A;  1WSU A;  3I55 I;  2Y30 A;  4UUT A;  3AL0 C;  2KQR A;  2VIX A;  4A2U A;  3ECH A;  3CCU I;  2X6Y A;  4QTR A;  4AU7 A;  3K1M A;  2RQP A;  3FBI B;  1R23 A;  2R5Z B;  3GTJ J;  3C2G A;  4GFB A;  4UV8 A;  1P4X A;  2FUG 2;  3NEU A;  3L2C A;  1KU2 A;  3ZOB A;  1FOX A;  2F5D A;  4IRH A;  3ESW B;  4PFP A;  5J1R A;  4BQO A;  1BIB A;  2ZJP F;  1W0T A;  2X0L A;  3RQI A;  5J8C A;  4UB6 C;  5J1U A;  2JWT A;  3ZQC A;  1XCV A;  5LBQ A;  4RGR A;  4CCJ A;  4FQG A;  2XGD A;  2RV8 A;  2O8X A;  3SXY A;  1LDD A;  1NG6 A;  3ML6 A;  1BOB A;  2JA2 A;  4CZC A;  3SEZ A;  1IN7 A;  2MSY A;  1XS9 A;  4O3M A;  3F23 A;  2H94 A;  2E7W A;  3CCM I; 
#chains in the Genus database with same CATH homology
 5DM7 F;  1HC8 A;  2FOW A;  1S72 I;  1YHQ I;  1VQL I;  3CCV I;  4UY8 I;  3CCS I;  3CJR B;  1YJ9 I;  1YIJ I;  5GAD J;  1FOY A;  1QA6 A;  5GAE J;  1VQ5 I;  3CCJ I;  3J7Y J;  1WIB A;  3CC2 I;  1VQN I;  2OTJ I;  1VQ6 I;  3CJQ B;  3PIP F;  5DM6 F;  4IO9 F;  1Y39 A;  3CF5 F;  5GAG J;  3CCE I;  3CJT B;  3CME I;  3DLL F;  1YI2 I;  2K3F A;  1ACI A;  2E36 A;  3CCL I;  2QEX I;  1VQK I;  1YJW I;  3EGV B;  3CJS B;  3CCR I;  2JQ7 A;  1VQP I;  3CD6 I;  2QA4 I;  5JVG F;  4IOC F;  2NXN B;  3G4S I;  3I56 I;  1VQ8 I;  3I55 I;  2H8W A;  3G71 I;  3CC4 I;  3CCU I;  1MMS A;  1VQ7 I;  2ZJQ F;  3CCQ I;  1FOX A;  3CMA I;  1FOW A;  4IOA F;  2ZJR F;  1VQO I;  2ZJP F;  1VQM I;  1VQ9 I;  2OTL I;  3PIO F;  1YJN I;  3J7Z I;  2E34 A;  2E35 A;  3G6E I;  1VQ4 I;  4V19 K;  3CC7 I;  1YIT I;  5GAH J;  3CCM I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...