3CF5F

Thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
144
structure length
144
Chain Sequence
MKKVAGIVKLQLPAGKATPAPPVGPALGQYGANIMEFTKAFNAQTADKGDAIIPVEITIYADRSFTFITKTPPMSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGVTVEGGPNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 50S RIBOSOMAL PROTEIN L33
publication title Translational Regulation Via L11: Molecular Switches on the Ribosome Turned on and Off by Thiostrepton and Micrococcin.
pubmed doi rcsb
total genus 17
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2008-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
F PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3cf5F02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 3cf5F01
3CJSB 3I55I 2FOWA 1MMSA 1QA6A 4IO9F 2ZJRF 3PIPF 5GADJ 2H8WA 3G4SI 1VQ4I 3EGVB 4UY8I 3CCRI 3G6EI 3CF5F 2JQ7A 2QEXI 3CCSI 1VQMI 1VQOI 1VQ6I 1YJ9I 1YJNI 1ACIA 4V19K 1VQKI 1VQ5I 1VQLI 3CJTB 5GAEJ 5DM6F 3J7YJ 1VQNI 1VQPI 5GAHJ 2E35A 3DLLF 3CCJI 3CCLI 1WIBA 2K3FA 1YHQI 3CCEI 1FOYA 2QA4I 3J7ZI 3CCVI 2OTLI 3I56I 3CCUI 1VQ8I 2E36A 1HC8A 4IOAF 2OTJI 3CCQI 1VQ7I 1S72I 1YIJI 5GAGJ 3CJQB 1YI2I 3CMAI 1FOXA 3CC7I 3CD6I 2E34A 1Y39A 2NXNB 3CMEI 3PIOF 5JVGF 2ZJPF 3CCMI 1VQ9I 1YITI 2ZJQF 3CJRB 4IOCF 5DM7F 3G71I 1FOWA 3CC4I 1YJWI 3CC2I
chains in the Genus database with same CATH superfamily
1HKTA 1J7KA 5IP9J 2XGDA 5LRSA 2BE5F 4J00A 2XPVA 4W1UA 2BW3A 2K9SA 4IHSA 2EIMH 1JTXA 5CVIA 2JK3A 4HG2A 4IO9F 2ZBKA 2NVYJ 4BQQA 5M5YJ 1FEXA 5ICFA 2DYRH 4BXXJ 1TWAJ 4JBAA 1T56A 5CVUA 1G3YA 3K1NA 3EPZA 5JI6A 4HAMA 1XSVA 2K4JA 5B1BH 3WE3A 2AO9A 2HQAA 2R7RA 2XF6A 1UFMA 2K02A 1UMQA 2ESHA 2XB5A 1ETQA 3V4GA 5BPIA 1F1ZA 4UHTA 1D3YA 3FXKA 2HOEA 4AVPA 1X4PA 3BR6A 3F22A 4M3DA 2O8KA 4XRSA 1YJ9I 2XKPA 2LRDA 4HYEA 4F3QA 4ESFA 2K85A 5EEGA 1Z6TA 4ZZLA 1VQLI 2V6EA 3KP2A 2VE9A 1J2XA 4LG0B 4I02A 1ON2A 2WV0A 1P6RA 3OWTA 3DQVC 3H5RA 1CQTA 1V55H 2RGVA 1A5JA 2CUJA 4FTHA 2COMA 1QHHD 4E7SA 3S8PA 1T8IA 4S0HB 1DGWY 2EZLA 4O5VA 3C1DA 3I4PA 1IW7F 2DMPA 2A07F 1MBFA 2KKOA 4U88A 5B5EC 4XR6A 4KIFA 2CRGA 3E6DA 2P5VA 1SFEA 2XHKA 4M3FA 4HDUA 3VYSB 5DDGA 2KQRA 3GCMA 2PMHA 1XCBA 2YPRA 4CDGA 2GXGA 5ICEA 2IA1A 1YLFA 2Z33A 5H20A 1YQAA 2OTJI 2VPLA 4BQAA 3CMMA 1TLHB 2XASA 1YX5A 3A01A 3TW6A 4A6EA 1FOXA 1A35A 2X1CA 1OYIA 1KONA 2KRCA 2M4KA 4XSXF 2STTA 4UNOA 3VYUB 3JAMZ 4Q4ZF 1R23A 2E34A 3OYAA 2I5UA 4U0VA 5FROA 3WGGA 2D1VA 1DUXC 4MO7A 5M3FJ 5LGNA 3WTZA 1A36A 5EEHA 2RC4A 1LFPA 3PUBA 1HF0A 2DFEA 2OCEA 4C3HJ 2DA6A 4ENJA 1L0OC 3EUAA 1VNDA 4RAZA 3OS2A 1B9NA 1IO2A 3ZMZA 3E6MA 2BXZA 4P96A 3G71I 5JHUA 3IH4A 3GTQJ 1GT0C 3LFKA 2HOTA 3JRBA 3PSFA 3OYLA 3DPLC 1XGMA 4DW6A 5F04A 2IGMA 1N77A 3L2VA 1R1VA 1JGGA 1O3RA 1YTYA 3WG7H 2L9VA 5K7ZA 4UUSA 1VQ4I 4BY7J 1OFCX 4U7BA 2BV6A 2YUSA 3SDGA 3HSFA 2IRFG 2K3PA 1SVLA 2M8GX 3DKYA 2STWA 2DOFA 4A12A 1XMXA 2ZSHB 2DK5A 3CCSI 4PZJA 1R5GA 3JRAA 2HR3A 4EM2A 4HQMA 3IRQA 3O3KA 4XN0A 4G94A 4NC8A 3L2CA 2A05A 3MZ8A 1OKRA 2XB0X 4ENKA 1PUFA 2VKDA 1ETYA 4UB8C 1WFXA 2WY8Q 4IX7A 1D1AA 1SFOJ 2JA6J 3VEPA 1T08B 1NK3P 3GTGJ 4RB0A 5EZHA 3QYEA 2G9WA 2G0EA 4D5CA 3LA2A 2E35A 5J6XA 2JA7J 3FXJA 4PSWA 3FF5A 4X1EA 3J80Z 3M7GA 5EGOB 2EV0A 3KYLA 2EQRA 2EFNA 3KZIC 2IS4A 2FX0A 3WHBA 4HNVA 4PJJA 1Y56A 1S6LA 1X1DA 5C44J 2OTLI 4UV8A 3JAMK 2DPDA 3IWZA 3ZN1A 3TO9A 4CCNA 4GXOA 4ABZA 3ASOH 2QGUA 4B43A 1NK2P 3K4MA 3KEOA 3CZ6A 1D0ZA 2DMNA 4FT8A 2R7TA 4XIDA 3BR1A 3LSRA 5J3LA 1I3QJ 4XBFA 5CPRB 2NXNB 1IG7A 2VODA 1B8IA 3SDBA 2KRHA 2X1DA 2V9VA 4R1HA 1HBXG 3OYMA 3W2WA 2ESNA 5E18F 3GX4X 1NH3A 1GUUA 2TDXA 4XORA 5JFRA 1LQ1A 3CDIA 2D1HA 4HLYA 4I2OA 3E5XA 1TW3A 2DA7A 5E8IA 1KYZA 4IZZA 4ZYHA 1JXSA 2QUFA 3C7JA 1P2FA 5J1RA 3HGGA 3CC4I 1XS9A 2X9DA 2CQKA 1PJRA 4KT5C 3SZTA 3MN2A 1WH5A 2DTZA 1FIAA 1QU3A 2MD5A 1XX5A 1BM9A 5KCMA 5B66C 1QZZA 5M3MJ 2HDWA 3HSRA 3A1YA 1H9GA 1ZYRF 2AQFA 1T0FC 2VQGA 1IRGA 2VPRA 4WX9A 1K7AA 3IH3A 2OPTA 2KT0A 3LAPA 2DA4A 4QWQA 3RQIA 2RQPA 3EUHA 1JKQC 1SVOA 2IA2A 3HRMA 5CVRA 1OCRH 2HZTA 4FCYA 2BVMA 3I71A 3HHGA 4V19K 1X1PA 3G1MA 3J80K 2VQLA 4M9SA 1ZGAA 3S1MJ 2CFOA 3NWSA 2Z9OA 4EQQA 2E5NA 2PEXA 1PUEE 3OL4A 2GOXB 1D1CA 3NWTA 2E7WA 4OIOF 2DI3A 2JVHA 4E7LA 3PNTA 2RREA 1OPCA 3S93A 1NHAA 4PJ0C 4X6AJ 5BS6A 2ICWG 3U9GA 3S1QJ 3K7AJ 5D8LB 2XRNA 4A0YA 2PJRB 2E1MC 3KZYA 3K10A 2EV6A 4PDKA 2EJRA 3HIFA 5CLSA 2QSHX 1GVDA 3VOEA 3E0JB 1W1WE 2H1KA 3S3NA 2A5WA 4IPAA 1P4WA 3GUDA 1VQ7I 2NOJB 3K4BA 2M4GA 1VI0A 2P7VB 5H6QA 5LBQA 2IA0A 3P7NA 4WXDA 3T8RA 3K2AA 1IC8A 4B09A 4G7HF 2P0WA 4I0AA 4LGWA 3CD6I 1ZK8A 2Q2EA 1Y39A 1KZHA 2L9SA 2M7BA 4B3XA 1MMGA 3HOWJ 2WAEA 1H9TA 3WTSC 1G3SA 1TWGJ 3FXLA 4S05A 1B72A 3S17J 2KMUA 4XLAA 5L3FA 1ZTRA 2EB7A 1ZRCA 1JTYA 4JYKA 3AG3H 1SD7A 1XGNA 1A6IA 4IJAA 4OIRF 5IT3A 2UXNA 3LSTA 1A31A 1IJWC 2V9KA 1W0UA 4HNTA 3LL7A 5LD2C 1Z7LA 1BI2A 3QPHA 4IRHA 2WA0A 2LREA 3F8NA 2ACJA 2OU2A 1QA6A 4RB3C 5JLWA 3O8GA 2LLKA 1LPQA 1SFKA 3CP8A 1Z77A 2GXAA 2M1BA 2ZC2A 3HRSA 1XC5A 5LLQA 1J09A 1QQIA 2LKPA 2BOLA 3R61A 3G4SI 3RZDJ 4JP0A 1V4RA 2CWEA 3GFMA 3TDUC 1S9HA 3E7LA 3BCAA 4LLNA 1KGSA 2HVSA 4CCLA 2JQ7A 2PFBA 2O03A 4JK1X 3HC7A 2FF4A 2W1OA 3GFLA 3DEEA 2FMYA 1R9TJ 2XGEA 1WRJA 2GA2A 3F6VA 2DTRA 2JSCA 5FKKA 2QZ8A 3CJNA 2K7LA 4CZCA 1USSA 1OR7C 3HSEA 1H8AC 4C9YA 1W36C 1IAWA 5IPAA 2NNNA 2ME6A 1RI7A 2WB1A 2LH9A 1UHWA 3IC7A 3KPHA 2R93J 4EGZA 1Z67A 1I27A 1P4XA 2HTJA 3BZKA 4M6XA 1TNSA 4KMUX 3LSKA 3ML6A 4UVBA 3CMYA 4E70A 4L5JA 3CCJI 4A3MJ 4KYWA 2OC6A 4FASD 1F36A 3K70C 1XN7A 5J8CA 1QZEA 3M8FA 2DJIA 4ZTJA 3V7CA 5DD8A 4BHCA 4KITB 3F0CA 3H3ZA 1FOYA 3ERMA 3L7WA 3QQAA 2M3AA 1O7LA 2X4HA 4PSXA 4I6ZA 2KPMA 3A4CA 3RTRA 4E7KA 3SFZA 3FX3A 4YELA 5DYMA 4MGRA 5CQEA 1FBUA 1BR2A 1XGSA 2IGOA 2R7DA 2MFZA 3N4MA 3KP4A 4UV9A 2LY1A 5F1RA 2HWVA 3GTKJ 2HKOA 1WJAA 3ABMH 1B9MA 4HDVA 4RDUA 2FNPA 3OS0A 2OUMA 1WJBA 4LG3A 2DFIA 1RR7A 2PX9A 2R7VA 1I6XA 1LUJB 2XAGA 3L2UA 2IGNA 2OD5A 1LEBA 3OV8A 2Y31A 1QVTA 3PFIA 3IH2A 3U21A 3P5JA 3CUQA 5DCMA 4B44A 1OISA 2FE3A 3DPUA 5IP6A 4AIJA 4YRVA 4ZDOA 5EYRA 2WV1A 5E20A 3V8LA 1LDKB 2CQXA 2A6EF 3BG9A 2XDVA 3W6VA 4E6KG 3KP7A 3IUOA 3RKYA 2DA3A 4HZFA 2WB1N 4WXHA 3PO2J 2D5VA 2KHMA 3FXUA 4FETA 1XTAA 2XAJA 3MMYB 3T5XA 4EJWA 3IHUA 5B3SH 2LP0A 2IBDA 1D1BA 2EINH 1POGA 1R4MB 2MH9A 3QPSA 2VT2A 1VZ0A 4M72A 4Y4RA 2Y0SA 5J1UA 4BBRJ 2M34A 2A61A 4IL6C 3ZQHA 1U5TC 4K2EA 1SD6A 2ELKA 1TQMA 1K6OA 5F0FA 2HXOA 5FFXA 1CF7A 3F72A 3HRUA 3K6GA 1UB9A 2X6WA 3ZMVA 3IKTA 2DA1A 4AC0A 1B8IB 1ZHFA 2HDDA 3F21A 2E1MB 2R5ZA 4A3GJ 5D5XB 3OYBA 4HBLA 5DM6F 2V4JC 1R4NB 4U87A 2EFOA 4MQVA 2H94A 3LSHA 1O3SA 1VQNI 2OF7A 3CLQA 4Q48A 4Y13A 3DLLF 4DGWB 2KJCA 1N25A 2CQ7A 4PCQA 1HA8A 1BOBA 3G3ZA 1YE9A 3CCLI 3VWBA 1X3ZB 2K3FA 2B7EA 3AKZA 1J0RA 3DP7A 1K78A 5D5VB 3TOAA 2VT3A 3A0HC 5M5WJ 2FOKA 4XMYA 2Q1ZB 4CSWA 1HC8A 2Q8KA 1I1SA 1HKSA 5AIQA 2COBA 3C2HA 3G2BA 3HGYA 5E1ZB 1ETWA 4QTRA 1H88C 1FJLA 3HB9A 4II2A 1S8NA 3I3LA 4IHXA 1G6NA 3HBLA 2DFHA 4MTEA 2DDAA 2QQBA 1IRXA 2MGQA 2EK5A 4NB5A 1STZA 5IYCJ 3CLOA 4XNFA 2K9QA 4CCOA 2A5YB 2W57A 3SEZA 2KDZA 4XONA 5ILVA 1B6AA 5FGMA 2VJ4A 2DA5A 1BBYA 4KICA 4RAFA 3OYCA 3RYPA 1TWFJ 1G8XA 4ITVA 2Y0SN 4N4NB 5F0CA 1O3QA 2NVXJ 4LB5A 1QZYA 4V2GA 1KQ0A 3CTAA 1RZ4A 1BC8C 2NNYA 2FD5A 2JWTA 1Y8QB 1FMVA 3KFWX 5GPAA 5D5UB 5FJ8J 1FC3A 1Z3XA 4BAYA 2IS6A 3MKWB 2K86A 4CO8A 1MJAA 4II3A 1WGXA 2Z1DA 2O9LA 4A3BJ 3CJSB 3I53A 3I55I 2LYCA 3N97A 4C2UA 3D5RC 2VIXA 4L5EA 1OCOH 3MKLA 5HVQC 2MA3A 4M3GA 1W0TA 1BOAA 3I59A 3HUGA 5DTDA 1TC3C 2MD0A 4EGYA 2QENA 1AHDP 3JR9A 5E17F 1TQPA 3AFHA 4AYBA 1FLIA 5LEJA 3HYIA 1XD7A 3J7AY 3REOA 1BR1A 1S7AA 2HS5A 4M9XA 2KJBA 5BQTA 5JLXA 1FNNA 2GIZA 2JUCA 1TWCJ 4UXNA 2HQRA 3CQZJ 1S29A 4MQ9F 3I58A 5FFZA 2V26A 1G3WA 2JPCA 1WHUA 5FB2A 4EJVA 3L2WA 4EMSA 4XKVA 5H2FC 4OMZA 4IHVA 1A04A 3QYBA 1FP2A 1LVKA 1Z6RA 2F5DA 4ON0A 2R0QC 1MDMB 1BJZA 4KT6A 2DT5A 1IDZA 3K69A 2RAEA 3FMQA 5D6EA 2DQLA 1KA8A 2R7WA 2CW0F 2FU4A 2ECCA 2R7QA 4GRIA 4G12A 3O6BB 1YHQI 1XB4A 3FIWA 2E2JJ 1X58A 1HW1A 4A5MA 3FM3A 3CCUI 4BJTA 3KP5A 3KZZA 1LDJA 3VPRA 1ZREA 1W7PD 4NQWA 3JRDA 2R3SA 2GXBA 4XRFA 1N75A 2Y0MA 4HX7A 2IEKA 2WAQA 3H5AA 3SFIA 3D5LA 1MBGA 2ZCWA 3LOCA 1QRYA 3GW2A 2NRAC 3UKGA 4RM2A 2L5QA 1YIJI 2VUMJ 1YYVA 4NHJA 1F43A 1EH8A 1Y6IA 2CGPA 4PJNA 3GTMJ 2K5CA 2ID6A 4KN7X 1Z7UA 5JHFA 5AIPA 3VYRB 1BW5A 5DV5A 2QKLB 4BJ6C 1TT5B 3IAM2 1R00A 5TGTA 3TL4X 2LK2A 4OINF 1GHCA 3SYTA 2HPIA 3CCMI 2CUZA 5DUIA 2FBKA 3ZR8X 4AYBN 2X1EA 3FZVA 2JSPA 3OYNA 4CGZA 4MIMA 1G59A 4JX5A 4BE0A 5DCFA 3WTXC 5D5WB 3L2QA 3OOPA 1WJEA 4NBQA 5GADJ 3H9GA 3P9IA 4B4CA 4A3FJ 3S32A 1U5TB 3FKJA 3H9QA 3S16J 1OCZH 3P9KA 4RBOA 3JRGA 1BIAA 2OJED 2M8EA 1ETVA 2XF7A 4F52A 1Z21A 1T38A 3S14J 4Y7NJ 1IN4A 1WQ2A 1ZELA 3U1DA 4LD5A 3JW4A 4I7HA 3LSIA 5HODA 3BR3A 2F4MB 3A0BC 3LAJA 1IN5A 1EA3A 2P81A 3HOVJ 2YR2A 2ME0A 3ONQA 3PJRA 3DV8A 4RAYA 3DCFA 2QVOA 2XUBA 3QYFA 1TTYA 1HSJA 2Y30A 1TBXA 3F8BA 4C3IJ 2A69F 5LRRA 2M0MA 1EJ9A 4F92B 1R36A 2WAQN 4FX0A 1BI0A 4RGUA 2Y9ZA 1MMDA 3NQOA 2R5YA 4G9YA 2MLGA 1X1BA 4JX6A 1VQPI 2KIQA 1ETKA 4CCJA 1RKTA 1XMKA 3FBNB 2UWMA 4CYCA 3GMEA 3CUQB 3F8MA 1JT6A 4MEYF 3LSMA 4BKXA 1U78A 4A3EJ 4A0XA 4BXFA 3WTYC 2EH3A 4FE7A 3HOUJ 2JT1A 4O3MA 5D4SA 4CCKA 4CICA 4D5FA 3PSIA 4XLCA 1PDNC 1P92A 3CCVI 2ZMEA 4IQ4A 4EM1A 3OIQA 1FIPA 2PMZA 2Y48A 4IOAF 3WTWC 5FLMJ 4HSRA 1X3UA 4UUTA 1Y0UA 4C30A 2VJ5A 1WSUA 1FWZA 1P9QC 3HEFA 2CH0A 1P7JA 3V8KA 3KP3A 4GFBA 2VBZA 1HCRA 1OLTA 1QO0D 2FBIA 2M87A 3CMEI 1Y1VJ 2LY9A 5J4YA 4KMFA 4ZYGA 4ENMA 5F0HA 2DBBA 4RLFA 3HOXJ 1B1BA 2LKXA 1CF7B 4P5OA 4KISA 3ELKA 1ZLJA 2DPUA 2VJJA 5DD4A 2PLYA 2OV7A 2R5ZB 4KIBA 1EH7A 2ZJQF 1ZRDA 1MNDA 4BHBA 4D7MA 2A6TA 4G8XA 2EPFA 3HOZJ 4MEXF 1D5YA 2KRFA 2CFXA 5A2QZ 4Z6YA 2H8RA 4XN3A 2PQ8A 4BEHA 1OJLA 2WAFA 2L7MP 4ZYAA 2ZXWH 2CG4A 1YIOA 1BL0A 1I50J 4MFEA 1T33A 4CH7A 2R7ZJ 1WJDA 4RMNA 2Z5UA 2KISA 2ZSIB 4RA2A 1E0EA 4CYDA 1LE8A 2M7AA 3FM5A 4EEFG 4QPQA 2P6SA 1XPXA 3BTJA 4A5NA 1X2NA 3K2ZA 5LHGA 1S3JA 4ZYEA 5DUKA 1VQMI 2M5WA 1MMNA 3FMRA 1ZN2A 2DK8A 4LK0F 1J75A 3IV5A 3IWFA 2DN0A 3LA7A 2R7FA 5E3NA 1FSHA 2DMQA 4NNJA 3C3WA 1HDPA 2PMZN 3B02A 3JTGA 3WTUC 3KYCB 2NS0A 1HW5A 1RPWA 2DMTA 2VJIA 4L0YB 2E2IJ 4MHGA 1MNMC 4DYRA 3J7YJ 3Q9SA 1HOMA 1Z9CA 1IZ1A 3K9TA 5HDGA 2FBHA 1R1UA 3HM5A 4IVNA 4KUMA 5FD6A 4MLOA 4BHPA 3J81Z 3ZQLA 3A03A 2E60A 2CMPA 3QU6A 3M3YJ 2VE8A 3S1NJ 5ERIA 3RZOJ 2JVGA 2X0LA 3MD2A 5BMZA 3K4CA 3S2WA 1G3TA 5TJJA 3RJPA 5ICCA 4L9VA 2KIUA 5CKTA 4DYQA 1BR4A 5HLTA 3K1PA 3BQZA 1UJ8A 2V1DA 3HOTA 1GV5A 3SHFA 5KK1A 5TRDA 1FTTA 3RPUD 4NC6A 2OQGA 3HUGB 1MGTA 5F08A 2BXYA 3QP6A 1YRNB 2DCEA 2JN6A 2IGKA 4OIPF 4UB6C 3DKWA 2DLLA 1KU7A 3CP2A 2VQHA 4CUGA 3HPGA 1WJCA 2BY2A 3MZYA 4ZDPA 5IOYA 3F23A 1YS7A 3TEDA 1AWCA 1N78A 2KFDA 3ZCOA 4XLFA 1Z91A 2W24A 1AKHB 1IRFA 4HF2A 2KLOA 2DYSH 3HDDA 4L5IA 3TKYA 3BWGA 4LB6B 4XOTA 2QQ9A 3U1KA 3P9CA 1SC7A 5FRNA 3DTIA 2BW3B 5E1XA 5A2QK 3VSLA 2EFQA 2RNGA 3CJRB 4LLGF 3HRTA 1OYYA 2HGCA 2V1NA 1IN7A 4E4HA 2O3FA 2ZNZA 2W85A 1LVAA 3JRCA 5BOXA 1IF1A 3WU0A 4M3BA 3CC2I 3R0AA 2B0LA 3PNVA 2IXSA 2E19A 1S7EA 2GLOA 1U9OA 2AS5F 2LF7A 1IXSB 1A6QA 2ZXJA 1XCVA 2P7CB 4IKFA 1D0XA 2AXTC 5LEKA 2KDOA 1JJ6C 3B73A 3DU6A 2XAUA 1RC9A 4RLQA 3TMOA 5D6FA 1SAXA 3DBHB 2X6YA 4S04A 1WPKA 4NQWB 4G7OF 2Z99A 1LDDA 2L01A 2M2EA 5GTIC 4BACA 5C4XJ 1MBJA 2VKEA 1BC7C 3SZPA 4QPOA 4N0BA 2BY3A 1WI9A 2F5EA 3BZCA 3KLNA 2XC7A 3EUHC 3KIOA 2PBIA 1OYWA 1BJAA 4OAZA 3J81K 2HI3A 1I5ZA 3ABUA 1RUOA 3HJEA 4IF4A 4A3JJ 1KQ9A 3RI4A 5KHDA 2D2WA 4BXUA 1WCMJ 3I0TA 2VBXA 2YU3A 2X48A 1AA7A 2GIVA 3JREA 3GVAA 3OYJA 3Q0UA 4LK1F 1GXQA 3C18A 3X2QH 4ZZDA 2W82A 3A01B 3GZNB 3R4KA 3M9AA 3AAFA 2CQNA 4V2FA 3OY9A 1LFBA 5LHIA 2LKSA 3BG6A 2UV1A 3DF8A 2HPMA 3K4NA 3L09A 3AG1H 3J7ZI 2B9SA 4LG0A 3CUOA 2ZFWA 3T8TA 2L4AA 2ZB9A 1K4SA 1GV2A 1MIJA 2L7ZA 5DEQA 1TL8A 1VQ8I 4GDFA 4B48A 4CZZA 9ANTA 3TW7A 3OYIA 3OYDA 2IVMA 1SAUA 1BN5A 3BDDA 3F3XA 4GCVA 2VBWA 3H36A 4DJAA 4BE1A 1T39A 4AIDA 2GZWA 3BJ6A 4FHTA 3K4LA 3C2BA 4HF0A 4LFUA 3EUKL 3HOYJ 3Q0VA 2XAQA 3NRVA 4XLPF 2E1CA 2QSGX 1X2MA 3E6BA 4BL0B 2JA8J 4L9JA 3TO7A 5HLIA 4UUVA 1MNEA 3QPLA 3WG9A 2M45A 2ZO4A 2IT0A 4BY1J 3TO6A 1Z3YA 3F6OA 3RPUA 1XDUA 1IGNA 1VQ9I 4IQJA 3OR1C 2MC4A 2Z2SB 3MKYB 3M1EA 2PG4A 3OIOA 2FQ3A 1IXCA 4H4KC 4HV6A 3CDHA 2GAUA 4JOMA 4YIIA 3TP3A 1K4TA 1PVEA 4UUSB 2R4GA 2ZKZA 3AL0C 4CYCB 1HQCA 1YJWI 5HLGA 5CVVA 5F64A 2H6CA 5HS7A 2NVQJ 3ZQ7A 2HVRA 2JUGA 4A93J 3C2GA 5K1YA 4YFXF 4Z2YA 5KAFC 2O5RA 3PIPF 3PM1A 1UHSA 2ZMEB 2BY1A 1HLVA 1ITYA 2DFFA 5E1WA 1PUFB 3KLOA 2LF8A 1TWHJ 3FK7A 2BY0A 4RB1A 3TOBA 4L9NA 2CU7A 2VKVA 2E71A 3UNGC 1I39A 2D45A 3M1CA 1LKXA 3HPHA 2WWYA 2C6YA 4A2UA 2XGXA 1K6YA 2CV1A 2I8DA 4ZYDA 4I01A 4MNUA 1EH6A 1FPQA 1VTNC 4BGDA 1FYMA 1IUYA 4D9JA 5EF6A 3GEZA 4L9TA 2UUZA 5HDKA 3ABTA 4IRIA 5JR3A 1JUSA 1XDSA 4ZC3A 2R92J 1DU6A 2R7OA 2K9NA 3FK6A 2HEOA 4AWXB 5FLXZ 1UELB 1SFUA 4HOBA 3GTLJ 3O8HA 1ODDA 5BNGA 5KNLA 2K27A 2UZKA 3CESA 2FUG2 4BEHB 2DMUA 2PMUA 5ILSA 3LQRA 4IXAA 1V5EA 1U9NA 3S2HJ 1YG2A 2F2EA 5J47A 1X4OA 2YSRA 1UG2A 2LC2A 1S72I 2WADA 2M30A 1USTA 4EVIA 4FQGA 5EGOA 2L02A 3RKXA 4WCGA 2DDBA 2E1OA 2QM3A 1SFXA 2BHZA 5F1JA 4MTDA 2Z3YA 3PQKA 2NYXA 3E1SA 2NVUB 3JSOA 1KU9A 1WWXA 1ORKA 1U6GA 1V3FA 1ERDA 4MFDA 3WE2A 4DIQA 1DPRA 1XGOA 5CYVA 4OIQF 3DEUA 1QVUA 2BGCA 2IAIA 1O7FA 1L3LA 3K4KA 4JX4A 3EQLF 3CUQC 1LJ9A 5DM7F 2JPBA 3H3UA 5GTHC 3KEQA 2V1UA 1IV6A 1DU0A 3HL2A 1ETXA 3VSKA 1P4AA 1R5HA 1T95A 2VQCA 5HNHA 3SEQA 4HQEA 1ZH5A 2EBIA 2F4OB 1E3OC 5EDNA 4F91B 5IY5H 5H6RA 1OCTC 4YG2F 4IHWA 2V6CA 2VOPA 1G4DA 4AVZA 2GA1A 4DNCA 2LDUA 2CW7A 2N8GA 2XRLA 3OYHA 3CF5F 1JUPA 1X1CA 1ZG3A 2LG4A 2ELHA 3FXQA 4B1RA 4A69C 4F55A 2DT6A 4BUPA 5EG0A 2VN2A 3RKWA 3BR5A 3ZMUA 2XSJC 5CQGA 1JKPC 2QF7A 4M6YA 5FO5A 4IHTA 3IRRA 4BBSJ 2MABA 5AONA 2BYVE 3QAHA 4XM3A 4I98B 4KDPA 5HOOA 2HFHA 2CS3A 3GLLA 3TP0A 5FLXK 1RRJA 4BJ5C 1YW8A 3GZ6A 3SXYA 1ZRFA 4JQFA 4PJMA 4A3KJ 3R0JA 2L7FP 3TBIA 4G7ZF 1R49A 1DGRM 2EA2A 1Q1VA 1E2XA 4M3EA 3ZQIA 3CF2A 1X3WB 1ZGWA 2W84A 3ZQQA 4LMYA 4DYCA 3OYKA 1YO5C 2K4BA 3QOPA 4C3JJ 3LQQA 4GO1A 4XLNF 2QYOA 4BNCA 2QSFX 3W2AA 2I10A 2QBYA 5K5RA 4C2MJ 2P5KA 2Q2EB 4G6DA 2EA4A 2QQAA 3DLAA 3WHCA 1WZ2A 4Y17A 3RSNA 4AIKA 2E36A 3D5SC 5LFAA 1HKQA 3COAC 2MG4A 1B72B 3DBLB 2OZUA 2K9LA 4ZH4F 3V8JA 3EETA 3FISA 1RR8C 4YIFA 4M9ZA 3CC7I 2PJRA 2X51A 5D8KB 1D8KA 1QNTA 2W4SA 3H92A 1G2HA 5HS8A 3AL0B 4GGGA 2HDCA 1ZR2A 4PUSA 2ZJPF 2FQ4A 1S5LC 3DEWA 1ENHA 5D4RA 3JTHA 1QPIA 1QGPA 1FY7A 3V42A 4CCMA 3N05A 4BS9A 3OMYA 1YITI 3O2PE 1TT0A 3BR2A 3MCZA 1K79A 3M4OJ 3D1NI 1R22A 1QPMA 3NARA 1MZBA 3R60A 4PFOA 5KAIC 2ZJ2A 4FE4A 5F27A 3IP4B 3GYHX 3PL8A 2E2HJ 4KIGA 3QP5A 5FKMA 2V7FA 2F5CA 1MMAA 1KYWA 3I54A 2DOEA 4ASNA 1CGPA 4LIUA 2EV5A 1FBQA 1QBJA 2LFBA 3BC8A 1T98A 1MBEA 2LR8A 3WU1B 2O8XA 1AU7A 2K9MA 1LB2A 3CCRI 4U7DA 3MVPA 3GLXA 3FDYA 2VLAA 3L2RA 1MD0A 1TP4A 3IL2A 4ESBA 3ZP5A 3S1RJ 4DBQA 4A0ZA 1YW9A 3V7RA 1VQ6I 4KJZA 5GPCA 2Y69H 2VASA 1WJFA 2F4IA 1ACIA 3RIRA 3OYEA 3Q3SA 4L18B 2XVCA 2HOAA 2R7XA 1LNWA 1TQIA 4XLHA 3CJTB 1APLC 2VXZA 3H0GJ 5HNFA 4ZDLA 3F8FA 3DXJF 3LSJA 2HQNA 3LSPA 4OU0A 5J1YA 3GFIA 1FX7A 4EATA 4CHUA 1ON1A 4OAYA 2NVTJ 2WY7Q 3ZGKA 4YEJA 3MZHA 2FA5A 4YFKF 2FSWA 5DS9A 3ROUA 3GTJJ 1EF4A 2OBPA 4NUBA 2DA2A 1WH7A 3H5NA 2KZGA 3CCEI 3GXOA 2O61A 2EIJH 3TGNA 1UG0A 3K4JA 3L1PA 4EJUA 3L00A 2IPQX 3H9JA 4ZJZA 1R58A 4HPQA 4BQNA 3I4MJ 1FMWA 2H27A 1GLNA 1YS6A 1KQ8A 4F7ZA 2HVQA 3ZQFA 1R5ID 1DPUA 3RQ4A 3ZMSA 5GAGJ 3LA3A 1YI2I 2X85A 3ABKH 3CMAI 4ESJA 4HSTA 5DCMB 2ZXHA 3ZQGA 2LBFA 3CO6C 1MH4A 1O57A 2CSOA 3BJAA 4N9HA 1JKRC 4U0WA 3F8CA 4EJTA 1Y1WJ 2P5LC 1HXDA 3S15J 3FXRA 2XPWA 4IHYA 4Y33A 4X0GA 2HNHA 2PI0A 2J5PA 4DQ2A 2H6BA 2LVSA 1B4AA 3H1CA 1F9NA 3QU3A 4RGRA 1FOWA 1O3TA 3G73A 3MQ0A 1RIOH 1UZCA 3JRHA 1RETA 4XQFA 1BIBA 4WXCA 4XRMA 1OQYA 2ISYA 4HF1A 3DWLE 2VONA 1FT9A 4N4OB 1IXRC 4WK8F 4ANJA 4UVAA 1JHFA 2DOAA 2EWNA 4EV0A 4FX4A 3KX2A 3VYTB 1T0FA 1W7PA 1W36D 3DU5A 2F6CA 1B59A 3FXMA 3NAUA 3QWLA 4KN4X 2RV8A 5K7FA 3LFUA 1EV7A 4U0YA 1FP1D 2GBYA 2XSDC 6PAXA 4O6JA 4UY8I 4P55A 1J5YA 4Q5SF 3I5UA 3G6EI 1R7JA 1XG1A 3I9V2 3HKZA 4DZPA 3VB2A 4AIHA 2GQQA 3K70D 3KCCA 1W4MA 4GYIA 3OOUA 1YJNI 3M8EA 1MSFC 1VQKI 4RAGA 3UR3C 1SD5A 4CXFA 2NS7A 3D0SA 1YX3A 3BLYA 2VBYA 5IYDJ 1K78B 2YS9A 2W48A 4R8HA 4I09A 3VODA 3H35A 3FHNA 2OQRA 1ZGJA 2BZTA 2E1NA 3W2VA 4WWCA 1Y8RB 2CQQA 2VB6A 1FTZA 3OS1A 1C0WA 3E5UA 3HHHA 2LSOA 2LNBA 2XV4S 3VDXA 2RVCA 4AD9A 5IT9Z 5LGTA 1X19A 1DP7P 2BVLA 1VF9A 3AG4H 2ZMEC 2HYGD 1PP7U 4P1WA 3QPTA 1WVRA 4DOZA 4I99C 1D8JA 3S3MA 2B63J 3M07A 3RKQA 1HW2A 2XF5A 5L3DA 3BOQA 3BZ6A 2YX7A 3OYGA 1JT0A 4B3AA 2DO7A 2IP2A 3ERED 4HEA2 2FNAA 2BBYA 1T2KA 4ENNA 1IRZA 2P4WA 1GXPA 1ZG1A 4E7JA 1SEUA 5K5QA 3WODF 5EG0B 2MW8A 1WI3A 1JGSA 2YX4A 2XROA 5IP7J 2W25A 3TQNA 4I76A 2HU9A 3W6KB 2L9NA 1YFHA 2P8TA 5J40A 3Q9VA 3ZMDA 3K0LA 4AM3A 2L54A 3I59B 2RDPA 2F48A 2W00A 3BT9A 1FYKA 3HKZN 5CVJA 4M6VA 3ZMTA 2QQ8A 4KFCA 1REPC 3ZPLA 3K1MA 1U3EM 2CV0A 1E3PA 2JJ7A 4NDLA 2AXLA 2NS8A 4RS8A 2QBYB 2CUEA 3BROA 4AUXA 3EYYA 3MEXA 4AU7A 2DW4A 3GTPJ 4EM0B 4QIWN 3ECHA 4Y15A 5BPDA 2ID3A 3WTVC 5E8GA 3T0YA 3EGVB 3V7SA 4B47A 3I4NJ 2L0KA 3MKZA 3BTIA 5M5XJ 2VC1A 4BH9A 2IJLA 4DZJA 2QEXI 2EFWA 1U8BA 4WF2A 3CO7C 4D7NA 1M1EB 4PJLA 1Q1HA 3WGIA 2JA5J 4PGGA 3R6SA 3FKIJ 4HNUA 2JRTA 4HX8A 1OR7A 5FRMA 2FXAA 1ZKGA 1VQ5I 3RYRA 1K61A 1J9IA 2MH2A 1HSTA 2E7XA 2UXXA 2L3DA 4NC7A 4G6QA 5IT9K 2G7UA 4J01A 3W6JB 3KETA 2KZVA 4XKCA 5CJ9A 3T1BA 3QRFF 2MYSA 2XAHA 3PQJA 5J8FA 1RNLA 3SZGA 1PP8F 3H3VK 1JE8A 1QHGA 2WBMA 4A6DA 2VKHA 4UVCA 3JSPA 5E3LA 2XPUA 1V5FA 3GZ5A 3ZQCA 2V9PA 4PK4A 1E3HA 2Y9YA 3ZN0A 5L3CA 2VI6A 1EKEA 5E3MA 2QA4I 3BQYA 5EJCA 5IOZA 3FBIB 5L3BA 1MDMA 4HLXA 4Y3OA 3JRFA 1Z1DA 2DXIA 5ED4A 1NG7A 3LWFA 3CCQI 4QLCU 1IV8A 2G7HA 2L9RA 4FISA 1RUNA 1D5VA 2JTVA 2ZXIA 1SD4A 2DU9A 3RDIA 2O7OA 2GM4A 1HDDC 1ETOA 3OSGA 1DP3A 2DQRA 1F4KA 3JRIA 3PUFA 2CV2A 2WC2A 4EJOA 5FKNA 4BDZA 1JI8A 3QODA 3DTEA 4I0BA 2L7KA 4KNYA 3BP8A 2IW5A 1SMTA 2NAZA 3ZXSA 3E3VA 3PO3J 1JJ8C 4C2TA 1ONVA 5HS9A 4A3LJ 1XSXA 2KIMA 4XL9A 5FD5A 2LMDA 1UAAA 5KVRA 1U8RA 4A3CJ 1U2WA 2A68F 4F93B 1FSEA 4IOCF 3HZJA 1NTCA 4W97A 3SQNA 3E97A 4E7IA 2FMLA 1KU3A 4J19A 3PNYA 2JRMA 5HDNA 3BPXA 2LOOA 5E79C 3GO5A 3NEUA 3Q5FA 1E17A 1SMYF 3U2RA 3W3CA 2BEOA 3LNQA 2OZ6A 1JUMA 4D1QA 2FOWA 2L4MA 1R71A 1IN8A 1MMSA 2HOSA 3GBGA 5C3EJ 2OCCH 2ZJRF 2DJNA 3GWZA 3F9KA 1SVMA 3EDPA 1ZLKA 2HTSA 2RQQA 3CCYA 1IN6A 2H8WA 5FKOA 3BY6A 4TV7A 4M73A 2HXIA 2R5YB 1XMAA 2O0YA 3ISPA 3ULQB 3J7AO 2OA4A 1U5TA 4LITA 4XICA 1JHHA 1MJ9A 2X6OA 2MBFA 1ZR4A 1VQOI 3VFZA 3TDZC 4XSZF 1I6HJ 2LBFB 5LGUA 4BU2A 4M74A 4R79A 1MW7A 1BI3A 2WTEA 2RKHA 3MAJA 2ECBA 3BPVA 4BQOA 4ZTFA 1W5CC 3B6AA 1K83J 3HG9A 1W5SA 1Z05A 1R1TA 2EZIA 3HTUA 3FHZA 5B1AH 3BG5A 1TZLA 4PGHA 1YOVB 2A6HF 5GAHJ 2YU9J 3A2KA 2KP6A 3ECOA 3BJOA 1BA5A 3E6CC 4HV5A 2JA2A 1MH3A 3A02A 1WIBA 1ZAOA 2Q0OA 2QKMB 3KP6A 1ZQ3P 1IDYA 2R7SA 1MJBA 1OCCH 2MSYA 2ZNYA 4ETSA 2HYFA 1MSEC 2QCOA 2VOOA 3H0DA 4E7HA 3I56I 2K40A 2KL4A 1VFCA 1UCRA 1TNTA 2CJJA 2FEZA 4IRGA 2IS1A 3G1LA 3BTLA 3HTSB 1DQUA 2VXDA 3GF2A 4XK4A 1W7PB 3HXLA 4XRSG 3DBRB 1FZPB 2EZKA 2XIGA 5ILUA 2V79A 1H0MA 1T6SA 1UHMA 3GFJA 2GWRA 2QWWA 1SANA 4XKWA 4CA0A 2VL8A 5JVGF 3CDLA 3ZOBA 2RNJA 1X1AA 1DDNA 5IYBJ 3ESWB 3KYDB 1H89C 5EEAA 3IAS2 1ZG5A 3MFKA 5C4JJ 4E7ZA 2LY2A 3KE2A 4RM3A 1V54H 2EFPA 3BCBA 3B6CA 4LLLA 5LHHA 3WGHA 3ASNH 1GDTA 1I1GA 3GTOJ 1RKWA 3KEYA 2VC0A 1MBHA 1LE8B 5ICGA 2KIFA 1U0JA 3WTTC 4YFNF 2Z16A 1I3AA 1LEAA 2GOMA 4BYYA 3OIPA 2FJ1A 3IKVA 3PFYA 2RN7A 5JVTA 2JZYA 2CYYA 4HA8A 1ULYA 2ADUA 3S3OA 4Y52J 2M9HA 4B8XA 3OR2C 4H0EA 2MLKA 3BG3A 3Q0WA 3AG2H 2A3SA 4M71A 2XKOA 1KU2A 3RPQA 2XAFA 1XSDA 1IUFA 5TISC 2L2OA 1Y0NA 2Y75A 2OAZA 4RGXA 4DBRA 1ZARA 4PFPA 2EIKH 4HW0A 1BW6A 2IS2A 3ZRGA 3LMMA 2CUFA 4LJZF 2ETHA 3M8JA 2R7UA 3DKXA 1P7IA 1D0YA 3MWMA 2TCTA 4OWRB 4G6TB 5GP9A 1FBSA 2HQ5A 2V1XA 2Y2ZA 3QOEA 5GAEJ 3E5QA 2ZFUA 4D0PA 1RESA 4HRIA 2EZHA 2O6GE 2HKXA 1OMIA 1F5TA 4QSHA 2F5FA 1FYLA 2AQEA 5HLHA 2DT7B 2H1LA 2F5VA 1OCPA 1AOYA 1PYVA 2AHQA 4Q47A 3EYIA 5J4VA 4KA4A 1FOKA 2CW8A 1Z0XA 4HX4A 2H09A 5L3GA 2JMWA 3FXOA 5K5OA 4GYGA 1MKMA 2X6XA 3FWEA 4YIRX 5FKLA 2E5ZA 2EILH 2J5OA 1WKMA 2HZDA 1W5TA 2P6TA 1J59A 1GVJA 2LTPA 1R6RA 4OMYA 3DTKA 4A3IJ 2LD5A 1WJ5A 3OYFA 5K7HA 1S7OA 1MBKA 3SJMA 3ABLH 4IEJA 3CJQB 4XOPA 3DPTA 4BDYA 3HOSA 1LFUP 2QLZA 1V5GA 2ELJA 3JCUC 4P9UA 4LOCA 4LIVA 4BE2A 4N9IA 3L9FA 2XGCA 3I64A 3OSFA 2ISZA 4P9FA 5F6FA 1YW7A 3PIOF 2FRHA 1BI1A 3LSGA 2PN6A 5L3EA 2NOGA 4A3DJ 5EZGA 3OL3A 2TRTA 4XKBA 5E3OA 3S2DJ 4RB2C 4L0ZB 2PJPA 3BG7A 2MC3A 3BTCA 1YRNA 2HYJA 4XLEA 1TW2A 2BHYA 4RGSA 4OOIA 2CO5A 1O4XA 2DODA 1JKOC 2M0CA 3DFGA 1NG6A 5FLVA 3WU2C 1AKHA 3RCOA 2DAOA 3G1OA 2W7NA 3BR0A 3FMSA
chains in the Genus database with same CATH topology
3CJSB 3I55I 2FOWA 1MMSA 1QA6A 4IO9F 2ZJRF 3PIPF 5GADJ 2H8WA 3G4SI 1VQ4I 3EGVB 4UY8I 3CCRI 3G6EI 3CF5F 2JQ7A 2QEXI 3CCSI 1VQMI 1VQOI 1VQ6I 1YJ9I 1YJNI 1ACIA 4V19K 1VQKI 1VQ5I 1VQLI 3CJTB 5GAEJ 5DM6F 3J7YJ 1VQNI 1VQPI 5GAHJ 2E35A 3DLLF 3CCJI 3CCLI 1WIBA 2K3FA 1YHQI 3CCEI 1FOYA 2QA4I 3J7ZI 3CCVI 2OTLI 3I56I 3CCUI 1VQ8I 2E36A 1HC8A 4IOAF 2OTJI 3CCQI 1VQ7I 1S72I 1YIJI 5GAGJ 3CJQB 1YI2I 3CMAI 1FOXA 3CC7I 3CD6I 2E34A 1Y39A 2NXNB 3CMEI 3PIOF 5JVGF 2ZJPF 3CCMI 1VQ9I 1YITI 2ZJQF 3CJRB 4IOCF 5DM7F 3G71I 1FOWA 3CC4I 1YJWI 3CC2I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CJS B;  3I55 I;  2FOW A;  1MMS A;  1QA6 A;  4IO9 F;  2ZJR F;  3PIP F;  5GAD J;  2H8W A;  3G4S I;  1VQ4 I;  3EGV B;  4UY8 I;  3CCR I;  3G6E I;  3CF5 F;  2JQ7 A;  2QEX I;  3CCS I;  1VQM I;  1VQO I;  1VQ6 I;  1YJ9 I;  1YJN I;  1ACI A;  4V19 K;  1VQK I;  1VQ5 I;  1VQL I;  3CJT B;  5GAE J;  5DM6 F;  3J7Y J;  1VQN I;  1VQP I;  5GAH J;  2E35 A;  3DLL F;  3CCJ I;  3CCL I;  1WIB A;  2K3F A;  1YHQ I;  3CCE I;  1FOY A;  2QA4 I;  3J7Z I;  3CCV I;  2OTL I;  3I56 I;  3CCU I;  1VQ8 I;  2E36 A;  1HC8 A;  4IOA F;  2OTJ I;  3CCQ I;  1VQ7 I;  1S72 I;  1YIJ I;  5GAG J;  3CJQ B;  1YI2 I;  3CMA I;  1FOX A;  3CC7 I;  3CD6 I;  2E34 A;  1Y39 A;  2NXN B;  3CME I;  3PIO F;  5JVG F;  2ZJP F;  3CCM I;  1VQ9 I;  1YIT I;  2ZJQ F;  3CJR B;  4IOC F;  5DM7 F;  3G71 I;  1FOW A;  3CC4 I;  1YJW I;  3CC2 I; 
#chains in the Genus database with same CATH topology
 1HKT A;  1J7K A;  5IP9 J;  2XGD A;  5LRS A;  2BE5 F;  4J00 A;  2XPV A;  4W1U A;  2BW3 A;  2K9S A;  4IHS A;  2EIM H;  1JTX A;  5CVI A;  2JK3 A;  4HG2 A;  4IO9 F;  2ZBK A;  2NVY J;  4BQQ A;  5M5Y J;  1FEX A;  5ICF A;  2DYR H;  4BXX J;  1TWA J;  4JBA A;  1T56 A;  5CVU A;  1G3Y A;  3K1N A;  3EPZ A;  5JI6 A;  4HAM A;  1XSV A;  2K4J A;  5B1B H;  3WE3 A;  2AO9 A;  2HQA A;  2R7R A;  2XF6 A;  1UFM A;  2K02 A;  1UMQ A;  2ESH A;  2XB5 A;  1ETQ A;  3V4G A;  5BPI A;  1F1Z A;  4UHT A;  1D3Y A;  3FXK A;  2HOE A;  4AVP A;  1X4P A;  3BR6 A;  3F22 A;  4M3D A;  2O8K A;  4XRS A;  1YJ9 I;  2XKP A;  2LRD A;  4HYE A;  4F3Q A;  4ESF A;  2K85 A;  5EEG A;  1Z6T A;  4ZZL A;  1VQL I;  2V6E A;  3KP2 A;  2VE9 A;  1J2X A;  4LG0 B;  4I02 A;  1ON2 A;  2WV0 A;  1P6R A;  3OWT A;  3DQV C;  3H5R A;  1CQT A;  1V55 H;  2RGV A;  1A5J A;  2CUJ A;  4FTH A;  2COM A;  1QHH D;  4E7S A;  3S8P A;  1T8I A;  4S0H B;  1DGW Y;  2EZL A;  4O5V A;  3C1D A;  3I4P A;  1IW7 F;  2DMP A;  2A07 F;  1MBF A;  2KKO A;  4U88 A;  5B5E C;  4XR6 A;  4KIF A;  2CRG A;  3E6D A;  2P5V A;  1SFE A;  2XHK A;  4M3F A;  4HDU A;  3VYS B;  5DDG A;  2KQR A;  3GCM A;  2PMH A;  1XCB A;  2YPR A;  4CDG A;  2GXG A;  5ICE A;  2IA1 A;  1YLF A;  2Z33 A;  5H20 A;  1YQA A;  2OTJ I;  2VPL A;  4BQA A;  3CMM A;  1TLH B;  2XAS A;  1YX5 A;  3A01 A;  3TW6 A;  4A6E A;  1FOX A;  1A35 A;  2X1C A;  1OYI A;  1KON A;  2KRC A;  2M4K A;  4XSX F;  2STT A;  4UNO A;  3VYU B;  3JAM Z;  4Q4Z F;  1R23 A;  2E34 A;  3OYA A;  2I5U A;  4U0V A;  5FRO A;  3WGG A;  2D1V A;  1DUX C;  4MO7 A;  5M3F J;  5LGN A;  3WTZ A;  1A36 A;  5EEH A;  2RC4 A;  1LFP A;  3PUB A;  1HF0 A;  2DFE A;  2OCE A;  4C3H J;  2DA6 A;  4ENJ A;  1L0O C;  3EUA A;  1VND A;  4RAZ A;  3OS2 A;  1B9N A;  1IO2 A;  3ZMZ A;  3E6M A;  2BXZ A;  4P96 A;  3G71 I;  5JHU A;  3IH4 A;  3GTQ J;  1GT0 C;  3LFK A;  2HOT A;  3JRB A;  3PSF A;  3OYL A;  3DPL C;  1XGM A;  4DW6 A;  5F04 A;  2IGM A;  1N77 A;  3L2V A;  1R1V A;  1JGG A;  1O3R A;  1YTY A;  3WG7 H;  2L9V A;  5K7Z A;  4UUS A;  1VQ4 I;  4BY7 J;  1OFC X;  4U7B A;  2BV6 A;  2YUS A;  3SDG A;  3HSF A;  2IRF G;  2K3P A;  1SVL A;  2M8G X;  3DKY A;  2STW A;  2DOF A;  4A12 A;  1XMX A;  2ZSH B;  2DK5 A;  3CCS I;  4PZJ A;  1R5G A;  3JRA A;  2HR3 A;  4EM2 A;  4HQM A;  3IRQ A;  3O3K A;  4XN0 A;  4G94 A;  4NC8 A;  3L2C A;  2A05 A;  3MZ8 A;  1OKR A;  2XB0 X;  4ENK A;  1PUF A;  2VKD A;  1ETY A;  4UB8 C;  1WFX A;  2WY8 Q;  4IX7 A;  1D1A A;  1SFO J;  2JA6 J;  3VEP A;  1T08 B;  1NK3 P;  3GTG J;  4RB0 A;  5EZH A;  3QYE A;  2G9W A;  2G0E A;  4D5C A;  3LA2 A;  2E35 A;  5J6X A;  2JA7 J;  3FXJ A;  4PSW A;  3FF5 A;  4X1E A;  3J80 Z;  3M7G A;  5EGO B;  2EV0 A;  3KYL A;  2EQR A;  2EFN A;  3KZI C;  2IS4 A;  2FX0 A;  3WHB A;  4HNV A;  4PJJ A;  1Y56 A;  1S6L A;  1X1D A;  5C44 J;  2OTL I;  4UV8 A;  3JAM K;  2DPD A;  3IWZ A;  3ZN1 A;  3TO9 A;  4CCN A;  4GXO A;  4ABZ A;  3ASO H;  2QGU A;  4B43 A;  1NK2 P;  3K4M A;  3KEO A;  3CZ6 A;  1D0Z A;  2DMN A;  4FT8 A;  2R7T A;  4XID A;  3BR1 A;  3LSR A;  5J3L A;  1I3Q J;  4XBF A;  5CPR B;  2NXN B;  1IG7 A;  2VOD A;  1B8I A;  3SDB A;  2KRH A;  2X1D A;  2V9V A;  4R1H A;  1HBX G;  3OYM A;  3W2W A;  2ESN A;  5E18 F;  3GX4 X;  1NH3 A;  1GUU A;  2TDX A;  4XOR A;  5JFR A;  1LQ1 A;  3CDI A;  2D1H A;  4HLY A;  4I2O A;  3E5X A;  1TW3 A;  2DA7 A;  5E8I A;  1KYZ A;  4IZZ A;  4ZYH A;  1JXS A;  2QUF A;  3C7J A;  1P2F A;  5J1R A;  3HGG A;  3CC4 I;  1XS9 A;  2X9D A;  2CQK A;  1PJR A;  4KT5 C;  3SZT A;  3MN2 A;  1WH5 A;  2DTZ A;  1FIA A;  1QU3 A;  2MD5 A;  1XX5 A;  1BM9 A;  5KCM A;  5B66 C;  1QZZ A;  5M3M J;  2HDW A;  3HSR A;  3A1Y A;  1H9G A;  1ZYR F;  2AQF A;  1T0F C;  2VQG A;  1IRG A;  2VPR A;  4WX9 A;  1K7A A;  3IH3 A;  2OPT A;  2KT0 A;  3LAP A;  2DA4 A;  4QWQ A;  3RQI A;  2RQP A;  3EUH A;  1JKQ C;  1SVO A;  2IA2 A;  3HRM A;  5CVR A;  1OCR H;  2HZT A;  4FCY A;  2BVM A;  3I71 A;  3HHG A;  4V19 K;  1X1P A;  3G1M A;  3J80 K;  2VQL A;  4M9S A;  1ZGA A;  3S1M J;  2CFO A;  3NWS A;  2Z9O A;  4EQQ A;  2E5N A;  2PEX A;  1PUE E;  3OL4 A;  2GOX B;  1D1C A;  3NWT A;  2E7W A;  4OIO F;  2DI3 A;  2JVH A;  4E7L A;  3PNT A;  2RRE A;  1OPC A;  3S93 A;  1NHA A;  4PJ0 C;  4X6A J;  5BS6 A;  2ICW G;  3U9G A;  3S1Q J;  3K7A J;  5D8L B;  2XRN A;  4A0Y A;  2PJR B;  2E1M C;  3KZY A;  3K10 A;  2EV6 A;  4PDK A;  2EJR A;  3HIF A;  5CLS A;  2QSH X;  1GVD A;  3VOE A;  3E0J B;  1W1W E;  2H1K A;  3S3N A;  2A5W A;  4IPA A;  1P4W A;  3GUD A;  1VQ7 I;  2NOJ B;  3K4B A;  2M4G A;  1VI0 A;  2P7V B;  5H6Q A;  5LBQ A;  2IA0 A;  3P7N A;  4WXD A;  3T8R A;  3K2A A;  1IC8 A;  4B09 A;  4G7H F;  2P0W A;  4I0A A;  4LGW A;  3CD6 I;  1ZK8 A;  2Q2E A;  1Y39 A;  1KZH A;  2L9S A;  2M7B A;  4B3X A;  1MMG A;  3HOW J;  2WAE A;  1H9T A;  3WTS C;  1G3S A;  1TWG J;  3FXL A;  4S05 A;  1B72 A;  3S17 J;  2KMU A;  4XLA A;  5L3F A;  1ZTR A;  2EB7 A;  1ZRC A;  1JTY A;  4JYK A;  3AG3 H;  1SD7 A;  1XGN A;  1A6I A;  4IJA A;  4OIR F;  5IT3 A;  2UXN A;  3LST A;  1A31 A;  1IJW C;  2V9K A;  1W0U A;  4HNT A;  3LL7 A;  5LD2 C;  1Z7L A;  1BI2 A;  3QPH A;  4IRH A;  2WA0 A;  2LRE A;  3F8N A;  2ACJ A;  2OU2 A;  1QA6 A;  4RB3 C;  5JLW A;  3O8G A;  2LLK A;  1LPQ A;  1SFK A;  3CP8 A;  1Z77 A;  2GXA A;  2M1B A;  2ZC2 A;  3HRS A;  1XC5 A;  5LLQ A;  1J09 A;  1QQI A;  2LKP A;  2BOL A;  3R61 A;  3G4S I;  3RZD J;  4JP0 A;  1V4R A;  2CWE A;  3GFM A;  3TDU C;  1S9H A;  3E7L A;  3BCA A;  4LLN A;  1KGS A;  2HVS A;  4CCL A;  2JQ7 A;  2PFB A;  2O03 A;  4JK1 X;  3HC7 A;  2FF4 A;  2W1O A;  3GFL A;  3DEE A;  2FMY A;  1R9T J;  2XGE A;  1WRJ A;  2GA2 A;  3F6V A;  2DTR A;  2JSC A;  5FKK A;  2QZ8 A;  3CJN A;  2K7L A;  4CZC A;  1USS A;  1OR7 C;  3HSE A;  1H8A C;  4C9Y A;  1W36 C;  1IAW A;  5IPA A;  2NNN A;  2ME6 A;  1RI7 A;  2WB1 A;  2LH9 A;  1UHW A;  3IC7 A;  3KPH A;  2R93 J;  4EGZ A;  1Z67 A;  1I27 A;  1P4X A;  2HTJ A;  3BZK A;  4M6X A;  1TNS A;  4KMU X;  3LSK A;  3ML6 A;  4UVB A;  3CMY A;  4E70 A;  4L5J A;  3CCJ I;  4A3M J;  4KYW A;  2OC6 A;  4FAS D;  1F36 A;  3K70 C;  1XN7 A;  5J8C A;  1QZE A;  3M8F A;  2DJI A;  4ZTJ A;  3V7C A;  5DD8 A;  4BHC A;  4KIT B;  3F0C A;  3H3Z A;  1FOY A;  3ERM A;  3L7W A;  3QQA A;  2M3A A;  1O7L A;  2X4H A;  4PSX A;  4I6Z A;  2KPM A;  3A4C A;  3RTR A;  4E7K A;  3SFZ A;  3FX3 A;  4YEL A;  5DYM A;  4MGR A;  5CQE A;  1FBU A;  1BR2 A;  1XGS A;  2IGO A;  2R7D A;  2MFZ A;  3N4M A;  3KP4 A;  4UV9 A;  2LY1 A;  5F1R A;  2HWV A;  3GTK J;  2HKO A;  1WJA A;  3ABM H;  1B9M A;  4HDV A;  4RDU A;  2FNP A;  3OS0 A;  2OUM A;  1WJB A;  4LG3 A;  2DFI A;  1RR7 A;  2PX9 A;  2R7V A;  1I6X A;  1LUJ B;  2XAG A;  3L2U A;  2IGN A;  2OD5 A;  1LEB A;  3OV8 A;  2Y31 A;  1QVT A;  3PFI A;  3IH2 A;  3U21 A;  3P5J A;  3CUQ A;  5DCM A;  4B44 A;  1OIS A;  2FE3 A;  3DPU A;  5IP6 A;  4AIJ A;  4YRV A;  4ZDO A;  5EYR A;  2WV1 A;  5E20 A;  3V8L A;  1LDK B;  2CQX A;  2A6E F;  3BG9 A;  2XDV A;  3W6V A;  4E6K G;  3KP7 A;  3IUO A;  3RKY A;  2DA3 A;  4HZF A;  2WB1 N;  4WXH A;  3PO2 J;  2D5V A;  2KHM A;  3FXU A;  4FET A;  1XTA A;  2XAJ A;  3MMY B;  3T5X A;  4EJW A;  3IHU A;  5B3S H;  2LP0 A;  2IBD A;  1D1B A;  2EIN H;  1POG A;  1R4M B;  2MH9 A;  3QPS A;  2VT2 A;  1VZ0 A;  4M72 A;  4Y4R A;  2Y0S A;  5J1U A;  4BBR J;  2M34 A;  2A61 A;  4IL6 C;  3ZQH A;  1U5T C;  4K2E A;  1SD6 A;  2ELK A;  1TQM A;  1K6O A;  5F0F A;  2HXO A;  5FFX A;  1CF7 A;  3F72 A;  3HRU A;  3K6G A;  1UB9 A;  2X6W A;  3ZMV A;  3IKT A;  2DA1 A;  4AC0 A;  1B8I B;  1ZHF A;  2HDD A;  3F21 A;  2E1M B;  2R5Z A;  4A3G J;  5D5X B;  3OYB A;  4HBL A;  5DM6 F;  2V4J C;  1R4N B;  4U87 A;  2EFO A;  4MQV A;  2H94 A;  3LSH A;  1O3S A;  1VQN I;  2OF7 A;  3CLQ A;  4Q48 A;  4Y13 A;  3DLL F;  4DGW B;  2KJC A;  1N25 A;  2CQ7 A;  4PCQ A;  1HA8 A;  1BOB A;  3G3Z A;  1YE9 A;  3CCL I;  3VWB A;  1X3Z B;  2K3F A;  2B7E A;  3AKZ A;  1J0R A;  3DP7 A;  1K78 A;  5D5V B;  3TOA A;  2VT3 A;  3A0H C;  5M5W J;  2FOK A;  4XMY A;  2Q1Z B;  4CSW A;  1HC8 A;  2Q8K A;  1I1S A;  1HKS A;  5AIQ A;  2COB A;  3C2H A;  3G2B A;  3HGY A;  5E1Z B;  1ETW A;  4QTR A;  1H88 C;  1FJL A;  3HB9 A;  4II2 A;  1S8N A;  3I3L A;  4IHX A;  1G6N A;  3HBL A;  2DFH A;  4MTE A;  2DDA A;  2QQB A;  1IRX A;  2MGQ A;  2EK5 A;  4NB5 A;  1STZ A;  5IYC J;  3CLO A;  4XNF A;  2K9Q A;  4CCO A;  2A5Y B;  2W57 A;  3SEZ A;  2KDZ A;  4XON A;  5ILV A;  1B6A A;  5FGM A;  2VJ4 A;  2DA5 A;  1BBY A;  4KIC A;  4RAF A;  3OYC A;  3RYP A;  1TWF J;  1G8X A;  4ITV A;  2Y0S N;  4N4N B;  5F0C A;  1O3Q A;  2NVX J;  4LB5 A;  1QZY A;  4V2G A;  1KQ0 A;  3CTA A;  1RZ4 A;  1BC8 C;  2NNY A;  2FD5 A;  2JWT A;  1Y8Q B;  1FMV A;  3KFW X;  5GPA A;  5D5U B;  5FJ8 J;  1FC3 A;  1Z3X A;  4BAY A;  2IS6 A;  3MKW B;  2K86 A;  4CO8 A;  1MJA A;  4II3 A;  1WGX A;  2Z1D A;  2O9L A;  4A3B J;  3CJS B;  3I53 A;  3I55 I;  2LYC A;  3N97 A;  4C2U A;  3D5R C;  2VIX A;  4L5E A;  1OCO H;  3MKL A;  5HVQ C;  2MA3 A;  4M3G A;  1W0T A;  1BOA A;  3I59 A;  3HUG A;  5DTD A;  1TC3 C;  2MD0 A;  4EGY A;  2QEN A;  1AHD P;  3JR9 A;  5E17 F;  1TQP A;  3AFH A;  4AYB A;  1FLI A;  5LEJ A;  3HYI A;  1XD7 A;  3J7A Y;  3REO A;  1BR1 A;  1S7A A;  2HS5 A;  4M9X A;  2KJB A;  5BQT A;  5JLX A;  1FNN A;  2GIZ A;  2JUC A;  1TWC J;  4UXN A;  2HQR A;  3CQZ J;  1S29 A;  4MQ9 F;  3I58 A;  5FFZ A;  2V26 A;  1G3W A;  2JPC A;  1WHU A;  5FB2 A;  4EJV A;  3L2W A;  4EMS A;  4XKV A;  5H2F C;  4OMZ A;  4IHV A;  1A04 A;  3QYB A;  1FP2 A;  1LVK A;  1Z6R A;  2F5D A;  4ON0 A;  2R0Q C;  1MDM B;  1BJZ A;  4KT6 A;  2DT5 A;  1IDZ A;  3K69 A;  2RAE A;  3FMQ A;  5D6E A;  2DQL A;  1KA8 A;  2R7W A;  2CW0 F;  2FU4 A;  2ECC A;  2R7Q A;  4GRI A;  4G12 A;  3O6B B;  1YHQ I;  1XB4 A;  3FIW A;  2E2J J;  1X58 A;  1HW1 A;  4A5M A;  3FM3 A;  3CCU I;  4BJT A;  3KP5 A;  3KZZ A;  1LDJ A;  3VPR A;  1ZRE A;  1W7P D;  4NQW A;  3JRD A;  2R3S A;  2GXB A;  4XRF A;  1N75 A;  2Y0M A;  4HX7 A;  2IEK A;  2WAQ A;  3H5A A;  3SFI A;  3D5L A;  1MBG A;  2ZCW A;  3LOC A;  1QRY A;  3GW2 A;  2NRA C;  3UKG A;  4RM2 A;  2L5Q A;  1YIJ I;  2VUM J;  1YYV A;  4NHJ A;  1F43 A;  1EH8 A;  1Y6I A;  2CGP A;  4PJN A;  3GTM J;  2K5C A;  2ID6 A;  4KN7 X;  1Z7U A;  5JHF A;  5AIP A;  3VYR B;  1BW5 A;  5DV5 A;  2QKL B;  4BJ6 C;  1TT5 B;  3IAM 2;  1R00 A;  5TGT A;  3TL4 X;  2LK2 A;  4OIN F;  1GHC A;  3SYT A;  2HPI A;  3CCM I;  2CUZ A;  5DUI A;  2FBK A;  3ZR8 X;  4AYB N;  2X1E A;  3FZV A;  2JSP A;  3OYN A;  4CGZ A;  4MIM A;  1G59 A;  4JX5 A;  4BE0 A;  5DCF A;  3WTX C;  5D5W B;  3L2Q A;  3OOP A;  1WJE A;  4NBQ A;  5GAD J;  3H9G A;  3P9I A;  4B4C A;  4A3F J;  3S32 A;  1U5T B;  3FKJ A;  3H9Q A;  3S16 J;  1OCZ H;  3P9K A;  4RBO A;  3JRG A;  1BIA A;  2OJE D;  2M8E A;  1ETV A;  2XF7 A;  4F52 A;  1Z21 A;  1T38 A;  3S14 J;  4Y7N J;  1IN4 A;  1WQ2 A;  1ZEL A;  3U1D A;  4LD5 A;  3JW4 A;  4I7H A;  3LSI A;  5HOD A;  3BR3 A;  2F4M B;  3A0B C;  3LAJ A;  1IN5 A;  1EA3 A;  2P81 A;  3HOV J;  2YR2 A;  2ME0 A;  3ONQ A;  3PJR A;  3DV8 A;  4RAY A;  3DCF A;  2QVO A;  2XUB A;  3QYF A;  1TTY A;  1HSJ A;  2Y30 A;  1TBX A;  3F8B A;  4C3I J;  2A69 F;  5LRR A;  2M0M A;  1EJ9 A;  4F92 B;  1R36 A;  2WAQ N;  4FX0 A;  1BI0 A;  4RGU A;  2Y9Z A;  1MMD A;  3NQO A;  2R5Y A;  4G9Y A;  2MLG A;  1X1B A;  4JX6 A;  1VQP I;  2KIQ A;  1ETK A;  4CCJ A;  1RKT A;  1XMK A;  3FBN B;  2UWM A;  4CYC A;  3GME A;  3CUQ B;  3F8M A;  1JT6 A;  4MEY F;  3LSM A;  4BKX A;  1U78 A;  4A3E J;  4A0X A;  4BXF A;  3WTY C;  2EH3 A;  4FE7 A;  3HOU J;  2JT1 A;  4O3M A;  5D4S A;  4CCK A;  4CIC A;  4D5F A;  3PSI A;  4XLC A;  1PDN C;  1P92 A;  3CCV I;  2ZME A;  4IQ4 A;  4EM1 A;  3OIQ A;  1FIP A;  2PMZ A;  2Y48 A;  4IOA F;  3WTW C;  5FLM J;  4HSR A;  1X3U A;  4UUT A;  1Y0U A;  4C30 A;  2VJ5 A;  1WSU A;  1FWZ A;  1P9Q C;  3HEF A;  2CH0 A;  1P7J A;  3V8K A;  3KP3 A;  4GFB A;  2VBZ A;  1HCR A;  1OLT A;  1QO0 D;  2FBI A;  2M87 A;  3CME I;  1Y1V J;  2LY9 A;  5J4Y A;  4KMF A;  4ZYG A;  4ENM A;  5F0H A;  2DBB A;  4RLF A;  3HOX J;  1B1B A;  2LKX A;  1CF7 B;  4P5O A;  4KIS A;  3ELK A;  1ZLJ A;  2DPU A;  2VJJ A;  5DD4 A;  2PLY A;  2OV7 A;  2R5Z B;  4KIB A;  1EH7 A;  2ZJQ F;  1ZRD A;  1MND A;  4BHB A;  4D7M A;  2A6T A;  4G8X A;  2EPF A;  3HOZ J;  4MEX F;  1D5Y A;  2KRF A;  2CFX A;  5A2Q Z;  4Z6Y A;  2H8R A;  4XN3 A;  2PQ8 A;  4BEH A;  1OJL A;  2WAF A;  2L7M P;  4ZYA A;  2ZXW H;  2CG4 A;  1YIO A;  1BL0 A;  1I50 J;  4MFE A;  1T33 A;  4CH7 A;  2R7Z J;  1WJD A;  4RMN A;  2Z5U A;  2KIS A;  2ZSI B;  4RA2 A;  1E0E A;  4CYD A;  1LE8 A;  2M7A A;  3FM5 A;  4EEF G;  4QPQ A;  2P6S A;  1XPX A;  3BTJ A;  4A5N A;  1X2N A;  3K2Z A;  5LHG A;  1S3J A;  4ZYE A;  5DUK A;  1VQM I;  2M5W A;  1MMN A;  3FMR A;  1ZN2 A;  2DK8 A;  4LK0 F;  1J75 A;  3IV5 A;  3IWF A;  2DN0 A;  3LA7 A;  2R7F A;  5E3N A;  1FSH A;  2DMQ A;  4NNJ A;  3C3W A;  1HDP A;  2PMZ N;  3B02 A;  3JTG A;  3WTU C;  3KYC B;  2NS0 A;  1HW5 A;  1RPW A;  2DMT A;  2VJI A;  4L0Y B;  2E2I J;  4MHG A;  1MNM C;  4DYR A;  3J7Y J;  3Q9S A;  1HOM A;  1Z9C A;  1IZ1 A;  3K9T A;  5HDG A;  2FBH A;  1R1U A;  3HM5 A;  4IVN A;  4KUM A;  5FD6 A;  4MLO A;  4BHP A;  3J81 Z;  3ZQL A;  3A03 A;  2E60 A;  2CMP A;  3QU6 A;  3M3Y J;  2VE8 A;  3S1N J;  5ERI A;  3RZO J;  2JVG A;  2X0L A;  3MD2 A;  5BMZ A;  3K4C A;  3S2W A;  1G3T A;  5TJJ A;  3RJP A;  5ICC A;  4L9V A;  2KIU A;  5CKT A;  4DYQ A;  1BR4 A;  5HLT A;  3K1P A;  3BQZ A;  1UJ8 A;  2V1D A;  3HOT A;  1GV5 A;  3SHF A;  5KK1 A;  5TRD A;  1FTT A;  3RPU D;  4NC6 A;  2OQG A;  3HUG B;  1MGT A;  5F08 A;  2BXY A;  3QP6 A;  1YRN B;  2DCE A;  2JN6 A;  2IGK A;  4OIP F;  4UB6 C;  3DKW A;  2DLL A;  1KU7 A;  3CP2 A;  2VQH A;  4CUG A;  3HPG A;  1WJC A;  2BY2 A;  3MZY A;  4ZDP A;  5IOY A;  3F23 A;  1YS7 A;  3TED A;  1AWC A;  1N78 A;  2KFD A;  3ZCO A;  4XLF A;  1Z91 A;  2W24 A;  1AKH B;  1IRF A;  4HF2 A;  2KLO A;  2DYS H;  3HDD A;  4L5I A;  3TKY A;  3BWG A;  4LB6 B;  4XOT A;  2QQ9 A;  3U1K A;  3P9C A;  1SC7 A;  5FRN A;  3DTI A;  2BW3 B;  5E1X A;  5A2Q K;  3VSL A;  2EFQ A;  2RNG A;  3CJR B;  4LLG F;  3HRT A;  1OYY A;  2HGC A;  2V1N A;  1IN7 A;  4E4H A;  2O3F A;  2ZNZ A;  2W85 A;  1LVA A;  3JRC A;  5BOX A;  1IF1 A;  3WU0 A;  4M3B A;  3CC2 I;  3R0A A;  2B0L A;  3PNV A;  2IXS A;  2E19 A;  1S7E A;  2GLO A;  1U9O A;  2AS5 F;  2LF7 A;  1IXS B;  1A6Q A;  2ZXJ A;  1XCV A;  2P7C B;  4IKF A;  1D0X A;  2AXT C;  5LEK A;  2KDO A;  1JJ6 C;  3B73 A;  3DU6 A;  2XAU A;  1RC9 A;  4RLQ A;  3TMO A;  5D6F A;  1SAX A;  3DBH B;  2X6Y A;  4S04 A;  1WPK A;  4NQW B;  4G7O F;  2Z99 A;  1LDD A;  2L01 A;  2M2E A;  5GTI C;  4BAC A;  5C4X J;  1MBJ A;  2VKE A;  1BC7 C;  3SZP A;  4QPO A;  4N0B A;  2BY3 A;  1WI9 A;  2F5E A;  3BZC A;  3KLN A;  2XC7 A;  3EUH C;  3KIO A;  2PBI A;  1OYW A;  1BJA A;  4OAZ A;  3J81 K;  2HI3 A;  1I5Z A;  3ABU A;  1RUO A;  3HJE A;  4IF4 A;  4A3J J;  1KQ9 A;  3RI4 A;  5KHD A;  2D2W A;  4BXU A;  1WCM J;  3I0T A;  2VBX A;  2YU3 A;  2X48 A;  1AA7 A;  2GIV A;  3JRE A;  3GVA A;  3OYJ A;  3Q0U A;  4LK1 F;  1GXQ A;  3C18 A;  3X2Q H;  4ZZD A;  2W82 A;  3A01 B;  3GZN B;  3R4K A;  3M9A A;  3AAF A;  2CQN A;  4V2F A;  3OY9 A;  1LFB A;  5LHI A;  2LKS A;  3BG6 A;  2UV1 A;  3DF8 A;  2HPM A;  3K4N A;  3L09 A;  3AG1 H;  3J7Z I;  2B9S A;  4LG0 A;  3CUO A;  2ZFW A;  3T8T A;  2L4A A;  2ZB9 A;  1K4S A;  1GV2 A;  1MIJ A;  2L7Z A;  5DEQ A;  1TL8 A;  1VQ8 I;  4GDF A;  4B48 A;  4CZZ A;  9ANT A;  3TW7 A;  3OYI A;  3OYD A;  2IVM A;  1SAU A;  1BN5 A;  3BDD A;  3F3X A;  4GCV A;  2VBW A;  3H36 A;  4DJA A;  4BE1 A;  1T39 A;  4AID A;  2GZW A;  3BJ6 A;  4FHT A;  3K4L A;  3C2B A;  4HF0 A;  4LFU A;  3EUK L;  3HOY J;  3Q0V A;  2XAQ A;  3NRV A;  4XLP F;  2E1C A;  2QSG X;  1X2M A;  3E6B A;  4BL0 B;  2JA8 J;  4L9J A;  3TO7 A;  5HLI A;  4UUV A;  1MNE A;  3QPL A;  3WG9 A;  2M45 A;  2ZO4 A;  2IT0 A;  4BY1 J;  3TO6 A;  1Z3Y A;  3F6O A;  3RPU A;  1XDU A;  1IGN A;  1VQ9 I;  4IQJ A;  3OR1 C;  2MC4 A;  2Z2S B;  3MKY B;  3M1E A;  2PG4 A;  3OIO A;  2FQ3 A;  1IXC A;  4H4K C;  4HV6 A;  3CDH A;  2GAU A;  4JOM A;  4YII A;  3TP3 A;  1K4T A;  1PVE A;  4UUS B;  2R4G A;  2ZKZ A;  3AL0 C;  4CYC B;  1HQC A;  1YJW I;  5HLG A;  5CVV A;  5F64 A;  2H6C A;  5HS7 A;  2NVQ J;  3ZQ7 A;  2HVR A;  2JUG A;  4A93 J;  3C2G A;  5K1Y A;  4YFX F;  4Z2Y A;  5KAF C;  2O5R A;  3PIP F;  3PM1 A;  1UHS A;  2ZME B;  2BY1 A;  1HLV A;  1ITY A;  2DFF A;  5E1W A;  1PUF B;  3KLO A;  2LF8 A;  1TWH J;  3FK7 A;  2BY0 A;  4RB1 A;  3TOB A;  4L9N A;  2CU7 A;  2VKV A;  2E71 A;  3UNG C;  1I39 A;  2D45 A;  3M1C A;  1LKX A;  3HPH A;  2WWY A;  2C6Y A;  4A2U A;  2XGX A;  1K6Y A;  2CV1 A;  2I8D A;  4ZYD A;  4I01 A;  4MNU A;  1EH6 A;  1FPQ A;  1VTN C;  4BGD A;  1FYM A;  1IUY A;  4D9J A;  5EF6 A;  3GEZ A;  4L9T A;  2UUZ A;  5HDK A;  3ABT A;  4IRI A;  5JR3 A;  1JUS A;  1XDS A;  4ZC3 A;  2R92 J;  1DU6 A;  2R7O A;  2K9N A;  3FK6 A;  2HEO A;  4AWX B;  5FLX Z;  1UEL B;  1SFU A;  4HOB A;  3GTL J;  3O8H A;  1ODD A;  5BNG A;  5KNL A;  2K27 A;  2UZK A;  3CES A;  2FUG 2;  4BEH B;  2DMU A;  2PMU A;  5ILS A;  3LQR A;  4IXA A;  1V5E A;  1U9N A;  3S2H J;  1YG2 A;  2F2E A;  5J47 A;  1X4O A;  2YSR A;  1UG2 A;  2LC2 A;  1S72 I;  2WAD A;  2M30 A;  1UST A;  4EVI A;  4FQG A;  5EGO A;  2L02 A;  3RKX A;  4WCG A;  2DDB A;  2E1O A;  2QM3 A;  1SFX A;  2BHZ A;  5F1J A;  4MTD A;  2Z3Y A;  3PQK A;  2NYX A;  3E1S A;  2NVU B;  3JSO A;  1KU9 A;  1WWX A;  1ORK A;  1U6G A;  1V3F A;  1ERD A;  4MFD A;  3WE2 A;  4DIQ A;  1DPR A;  1XGO A;  5CYV A;  4OIQ F;  3DEU A;  1QVU A;  2BGC A;  2IAI A;  1O7F A;  1L3L A;  3K4K A;  4JX4 A;  3EQL F;  3CUQ C;  1LJ9 A;  5DM7 F;  2JPB A;  3H3U A;  5GTH C;  3KEQ A;  2V1U A;  1IV6 A;  1DU0 A;  3HL2 A;  1ETX A;  3VSK A;  1P4A A;  1R5H A;  1T95 A;  2VQC A;  5HNH A;  3SEQ A;  4HQE A;  1ZH5 A;  2EBI A;  2F4O B;  1E3O C;  5EDN A;  4F91 B;  5IY5 H;  5H6R A;  1OCT C;  4YG2 F;  4IHW A;  2V6C A;  2VOP A;  1G4D A;  4AVZ A;  2GA1 A;  4DNC A;  2LDU A;  2CW7 A;  2N8G A;  2XRL A;  3OYH A;  3CF5 F;  1JUP A;  1X1C A;  1ZG3 A;  2LG4 A;  2ELH A;  3FXQ A;  4B1R A;  4A69 C;  4F55 A;  2DT6 A;  4BUP A;  5EG0 A;  2VN2 A;  3RKW A;  3BR5 A;  3ZMU A;  2XSJ C;  5CQG A;  1JKP C;  2QF7 A;  4M6Y A;  5FO5 A;  4IHT A;  3IRR A;  4BBS J;  2MAB A;  5AON A;  2BYV E;  3QAH A;  4XM3 A;  4I98 B;  4KDP A;  5HOO A;  2HFH A;  2CS3 A;  3GLL A;  3TP0 A;  5FLX K;  1RRJ A;  4BJ5 C;  1YW8 A;  3GZ6 A;  3SXY A;  1ZRF A;  4JQF A;  4PJM A;  4A3K J;  3R0J A;  2L7F P;  3TBI A;  4G7Z F;  1R49 A;  1DGR M;  2EA2 A;  1Q1V A;  1E2X A;  4M3E A;  3ZQI A;  3CF2 A;  1X3W B;  1ZGW A;  2W84 A;  3ZQQ A;  4LMY A;  4DYC A;  3OYK A;  1YO5 C;  2K4B A;  3QOP A;  4C3J J;  3LQQ A;  4GO1 A;  4XLN F;  2QYO A;  4BNC A;  2QSF X;  3W2A A;  2I10 A;  2QBY A;  5K5R A;  4C2M J;  2P5K A;  2Q2E B;  4G6D A;  2EA4 A;  2QQA A;  3DLA A;  3WHC A;  1WZ2 A;  4Y17 A;  3RSN A;  4AIK A;  2E36 A;  3D5S C;  5LFA A;  1HKQ A;  3COA C;  2MG4 A;  1B72 B;  3DBL B;  2OZU A;  2K9L A;  4ZH4 F;  3V8J A;  3EET A;  3FIS A;  1RR8 C;  4YIF A;  4M9Z A;  3CC7 I;  2PJR A;  2X51 A;  5D8K B;  1D8K A;  1QNT A;  2W4S A;  3H92 A;  1G2H A;  5HS8 A;  3AL0 B;  4GGG A;  2HDC A;  1ZR2 A;  4PUS A;  2ZJP F;  2FQ4 A;  1S5L C;  3DEW A;  1ENH A;  5D4R A;  3JTH A;  1QPI A;  1QGP A;  1FY7 A;  3V42 A;  4CCM A;  3N05 A;  4BS9 A;  3OMY A;  1YIT I;  3O2P E;  1TT0 A;  3BR2 A;  3MCZ A;  1K79 A;  3M4O J;  3D1N I;  1R22 A;  1QPM A;  3NAR A;  1MZB A;  3R60 A;  4PFO A;  5KAI C;  2ZJ2 A;  4FE4 A;  5F27 A;  3IP4 B;  3GYH X;  3PL8 A;  2E2H J;  4KIG A;  3QP5 A;  5FKM A;  2V7F A;  2F5C A;  1MMA A;  1KYW A;  3I54 A;  2DOE A;  4ASN A;  1CGP A;  4LIU A;  2EV5 A;  1FBQ A;  1QBJ A;  2LFB A;  3BC8 A;  1T98 A;  1MBE A;  2LR8 A;  3WU1 B;  2O8X A;  1AU7 A;  2K9M A;  1LB2 A;  3CCR I;  4U7D A;  3MVP A;  3GLX A;  3FDY A;  2VLA A;  3L2R A;  1MD0 A;  1TP4 A;  3IL2 A;  4ESB A;  3ZP5 A;  3S1R J;  4DBQ A;  4A0Z A;  1YW9 A;  3V7R A;  1VQ6 I;  4KJZ A;  5GPC A;  2Y69 H;  2VAS A;  1WJF A;  2F4I A;  1ACI A;  3RIR A;  3OYE A;  3Q3S A;  4L18 B;  2XVC A;  2HOA A;  2R7X A;  1LNW A;  1TQI A;  4XLH A;  3CJT B;  1APL C;  2VXZ A;  3H0G J;  5HNF A;  4ZDL A;  3F8F A;  3DXJ F;  3LSJ A;  2HQN A;  3LSP A;  4OU0 A;  5J1Y A;  3GFI A;  1FX7 A;  4EAT A;  4CHU A;  1ON1 A;  4OAY A;  2NVT J;  2WY7 Q;  3ZGK A;  4YEJ A;  3MZH A;  2FA5 A;  4YFK F;  2FSW A;  5DS9 A;  3ROU A;  3GTJ J;  1EF4 A;  2OBP A;  4NUB A;  2DA2 A;  1WH7 A;  3H5N A;  2KZG A;  3CCE I;  3GXO A;  2O61 A;  2EIJ H;  3TGN A;  1UG0 A;  3K4J A;  3L1P A;  4EJU A;  3L00 A;  2IPQ X;  3H9J A;  4ZJZ A;  1R58 A;  4HPQ A;  4BQN A;  3I4M J;  1FMW A;  2H27 A;  1GLN A;  1YS6 A;  1KQ8 A;  4F7Z A;  2HVQ A;  3ZQF A;  1R5I D;  1DPU A;  3RQ4 A;  3ZMS A;  5GAG J;  3LA3 A;  1YI2 I;  2X85 A;  3ABK H;  3CMA I;  4ESJ A;  4HST A;  5DCM B;  2ZXH A;  3ZQG A;  2LBF A;  3CO6 C;  1MH4 A;  1O57 A;  2CSO A;  3BJA A;  4N9H A;  1JKR C;  4U0W A;  3F8C A;  4EJT A;  1Y1W J;  2P5L C;  1HXD A;  3S15 J;  3FXR A;  2XPW A;  4IHY A;  4Y33 A;  4X0G A;  2HNH A;  2PI0 A;  2J5P A;  4DQ2 A;  2H6B A;  2LVS A;  1B4A A;  3H1C A;  1F9N A;  3QU3 A;  4RGR A;  1FOW A;  1O3T A;  3G73 A;  3MQ0 A;  1RIO H;  1UZC A;  3JRH A;  1RET A;  4XQF A;  1BIB A;  4WXC A;  4XRM A;  1OQY A;  2ISY A;  4HF1 A;  3DWL E;  2VON A;  1FT9 A;  4N4O B;  1IXR C;  4WK8 F;  4ANJ A;  4UVA A;  1JHF A;  2DOA A;  2EWN A;  4EV0 A;  4FX4 A;  3KX2 A;  3VYT B;  1T0F A;  1W7P A;  1W36 D;  3DU5 A;  2F6C A;  1B59 A;  3FXM A;  3NAU A;  3QWL A;  4KN4 X;  2RV8 A;  5K7F A;  3LFU A;  1EV7 A;  4U0Y A;  1FP1 D;  2GBY A;  2XSD C;  6PAX A;  4O6J A;  4UY8 I;  4P55 A;  1J5Y A;  4Q5S F;  3I5U A;  3G6E I;  1R7J A;  1XG1 A;  3I9V 2;  3HKZ A;  4DZP A;  3VB2 A;  4AIH A;  2GQQ A;  3K70 D;  3KCC A;  1W4M A;  4GYI A;  3OOU A;  1YJN I;  3M8E A;  1MSF C;  1VQK I;  4RAG A;  3UR3 C;  1SD5 A;  4CXF A;  2NS7 A;  3D0S A;  1YX3 A;  3BLY A;  2VBY A;  5IYD J;  1K78 B;  2YS9 A;  2W48 A;  4R8H A;  4I09 A;  3VOD A;  3H35 A;  3FHN A;  2OQR A;  1ZGJ A;  2BZT A;  2E1N A;  3W2V A;  4WWC A;  1Y8R B;  2CQQ A;  2VB6 A;  1FTZ A;  3OS1 A;  1C0W A;  3E5U A;  3HHH A;  2LSO A;  2LNB A;  2XV4 S;  3VDX A;  2RVC A;  4AD9 A;  5IT9 Z;  5LGT A;  1X19 A;  1DP7 P;  2BVL A;  1VF9 A;  3AG4 H;  2ZME C;  2HYG D;  1PP7 U;  4P1W A;  3QPT A;  1WVR A;  4DOZ A;  4I99 C;  1D8J A;  3S3M A;  2B63 J;  3M07 A;  3RKQ A;  1HW2 A;  2XF5 A;  5L3D A;  3BOQ A;  3BZ6 A;  2YX7 A;  3OYG A;  1JT0 A;  4B3A A;  2DO7 A;  2IP2 A;  3ERE D;  4HEA 2;  2FNA A;  2BBY A;  1T2K A;  4ENN A;  1IRZ A;  2P4W A;  1GXP A;  1ZG1 A;  4E7J A;  1SEU A;  5K5Q A;  3WOD F;  5EG0 B;  2MW8 A;  1WI3 A;  1JGS A;  2YX4 A;  2XRO A;  5IP7 J;  2W25 A;  3TQN A;  4I76 A;  2HU9 A;  3W6K B;  2L9N A;  1YFH A;  2P8T A;  5J40 A;  3Q9V A;  3ZMD A;  3K0L A;  4AM3 A;  2L54 A;  3I59 B;  2RDP A;  2F48 A;  2W00 A;  3BT9 A;  1FYK A;  3HKZ N;  5CVJ A;  4M6V A;  3ZMT A;  2QQ8 A;  4KFC A;  1REP C;  3ZPL A;  3K1M A;  1U3E M;  2CV0 A;  1E3P A;  2JJ7 A;  4NDL A;  2AXL A;  2NS8 A;  4RS8 A;  2QBY B;  2CUE A;  3BRO A;  4AUX A;  3EYY A;  3MEX A;  4AU7 A;  2DW4 A;  3GTP J;  4EM0 B;  4QIW N;  3ECH A;  4Y15 A;  5BPD A;  2ID3 A;  3WTV C;  5E8G A;  3T0Y A;  3EGV B;  3V7S A;  4B47 A;  3I4N J;  2L0K A;  3MKZ A;  3BTI A;  5M5X J;  2VC1 A;  4BH9 A;  2IJL A;  4DZJ A;  2QEX I;  2EFW A;  1U8B A;  4WF2 A;  3CO7 C;  4D7N A;  1M1E B;  4PJL A;  1Q1H A;  3WGI A;  2JA5 J;  4PGG A;  3R6S A;  3FKI J;  4HNU A;  2JRT A;  4HX8 A;  1OR7 A;  5FRM A;  2FXA A;  1ZKG A;  1VQ5 I;  3RYR A;  1K61 A;  1J9I A;  2MH2 A;  1HST A;  2E7X A;  2UXX A;  2L3D A;  4NC7 A;  4G6Q A;  5IT9 K;  2G7U A;  4J01 A;  3W6J B;  3KET A;  2KZV A;  4XKC A;  5CJ9 A;  3T1B A;  3QRF F;  2MYS A;  2XAH A;  3PQJ A;  5J8F A;  1RNL A;  3SZG A;  1PP8 F;  3H3V K;  1JE8 A;  1QHG A;  2WBM A;  4A6D A;  2VKH A;  4UVC A;  3JSP A;  5E3L A;  2XPU A;  1V5F A;  3GZ5 A;  3ZQC A;  2V9P A;  4PK4 A;  1E3H A;  2Y9Y A;  3ZN0 A;  5L3C A;  2VI6 A;  1EKE A;  5E3M A;  2QA4 I;  3BQY A;  5EJC A;  5IOZ A;  3FBI B;  5L3B A;  1MDM A;  4HLX A;  4Y3O A;  3JRF A;  1Z1D A;  2DXI A;  5ED4 A;  1NG7 A;  3LWF A;  3CCQ I;  4QLC U;  1IV8 A;  2G7H A;  2L9R A;  4FIS A;  1RUN A;  1D5V A;  2JTV A;  2ZXI A;  1SD4 A;  2DU9 A;  3RDI A;  2O7O A;  2GM4 A;  1HDD C;  1ETO A;  3OSG A;  1DP3 A;  2DQR A;  1F4K A;  3JRI A;  3PUF A;  2CV2 A;  2WC2 A;  4EJO A;  5FKN A;  4BDZ A;  1JI8 A;  3QOD A;  3DTE A;  4I0B A;  2L7K A;  4KNY A;  3BP8 A;  2IW5 A;  1SMT A;  2NAZ A;  3ZXS A;  3E3V A;  3PO3 J;  1JJ8 C;  4C2T A;  1ONV A;  5HS9 A;  4A3L J;  1XSX A;  2KIM A;  4XL9 A;  5FD5 A;  2LMD A;  1UAA A;  5KVR A;  1U8R A;  4A3C J;  1U2W A;  2A68 F;  4F93 B;  1FSE A;  4IOC F;  3HZJ A;  1NTC A;  4W97 A;  3SQN A;  3E97 A;  4E7I A;  2FML A;  1KU3 A;  4J19 A;  3PNY A;  2JRM A;  5HDN A;  3BPX A;  2LOO A;  5E79 C;  3GO5 A;  3NEU A;  3Q5F A;  1E17 A;  1SMY F;  3U2R A;  3W3C A;  2BEO A;  3LNQ A;  2OZ6 A;  1JUM A;  4D1Q A;  2FOW A;  2L4M A;  1R71 A;  1IN8 A;  1MMS A;  2HOS A;  3GBG A;  5C3E J;  2OCC H;  2ZJR F;  2DJN A;  3GWZ A;  3F9K A;  1SVM A;  3EDP A;  1ZLK A;  2HTS A;  2RQQ A;  3CCY A;  1IN6 A;  2H8W A;  5FKO A;  3BY6 A;  4TV7 A;  4M73 A;  2HXI A;  2R5Y B;  1XMA A;  2O0Y A;  3ISP A;  3ULQ B;  3J7A O;  2OA4 A;  1U5T A;  4LIT A;  4XIC A;  1JHH A;  1MJ9 A;  2X6O A;  2MBF A;  1ZR4 A;  1VQO I;  3VFZ A;  3TDZ C;  4XSZ F;  1I6H J;  2LBF B;  5LGU A;  4BU2 A;  4M74 A;  4R79 A;  1MW7 A;  1BI3 A;  2WTE A;  2RKH A;  3MAJ A;  2ECB A;  3BPV A;  4BQO A;  4ZTF A;  1W5C C;  3B6A A;  1K83 J;  3HG9 A;  1W5S A;  1Z05 A;  1R1T A;  2EZI A;  3HTU A;  3FHZ A;  5B1A H;  3BG5 A;  1TZL A;  4PGH A;  1YOV B;  2A6H F;  5GAH J;  2YU9 J;  3A2K A;  2KP6 A;  3ECO A;  3BJO A;  1BA5 A;  3E6C C;  4HV5 A;  2JA2 A;  1MH3 A;  3A02 A;  1WIB A;  1ZAO A;  2Q0O A;  2QKM B;  3KP6 A;  1ZQ3 P;  1IDY A;  2R7S A;  1MJB A;  1OCC H;  2MSY A;  2ZNY A;  4ETS A;  2HYF A;  1MSE C;  2QCO A;  2VOO A;  3H0D A;  4E7H A;  3I56 I;  2K40 A;  2KL4 A;  1VFC A;  1UCR A;  1TNT A;  2CJJ A;  2FEZ A;  4IRG A;  2IS1 A;  3G1L A;  3BTL A;  3HTS B;  1DQU A;  2VXD A;  3GF2 A;  4XK4 A;  1W7P B;  3HXL A;  4XRS G;  3DBR B;  1FZP B;  2EZK A;  2XIG A;  5ILU A;  2V79 A;  1H0M A;  1T6S A;  1UHM A;  3GFJ A;  2GWR A;  2QWW A;  1SAN A;  4XKW A;  4CA0 A;  2VL8 A;  5JVG F;  3CDL A;  3ZOB A;  2RNJ A;  1X1A A;  1DDN A;  5IYB J;  3ESW B;  3KYD B;  1H89 C;  5EEA A;  3IAS 2;  1ZG5 A;  3MFK A;  5C4J J;  4E7Z A;  2LY2 A;  3KE2 A;  4RM3 A;  1V54 H;  2EFP A;  3BCB A;  3B6C A;  4LLL A;  5LHH A;  3WGH A;  3ASN H;  1GDT A;  1I1G A;  3GTO J;  1RKW A;  3KEY A;  2VC0 A;  1MBH A;  1LE8 B;  5ICG A;  2KIF A;  1U0J A;  3WTT C;  4YFN F;  2Z16 A;  1I3A A;  1LEA A;  2GOM A;  4BYY A;  3OIP A;  2FJ1 A;  3IKV A;  3PFY A;  2RN7 A;  5JVT A;  2JZY A;  2CYY A;  4HA8 A;  1ULY A;  2ADU A;  3S3O A;  4Y52 J;  2M9H A;  4B8X A;  3OR2 C;  4H0E A;  2MLK A;  3BG3 A;  3Q0W A;  3AG2 H;  2A3S A;  4M71 A;  2XKO A;  1KU2 A;  3RPQ A;  2XAF A;  1XSD A;  1IUF A;  5TIS C;  2L2O A;  1Y0N A;  2Y75 A;  2OAZ A;  4RGX A;  4DBR A;  1ZAR A;  4PFP A;  2EIK H;  4HW0 A;  1BW6 A;  2IS2 A;  3ZRG A;  3LMM A;  2CUF A;  4LJZ F;  2ETH A;  3M8J A;  2R7U A;  3DKX A;  1P7I A;  1D0Y A;  3MWM A;  2TCT A;  4OWR B;  4G6T B;  5GP9 A;  1FBS A;  2HQ5 A;  2V1X A;  2Y2Z A;  3QOE A;  5GAE J;  3E5Q A;  2ZFU A;  4D0P A;  1RES A;  4HRI A;  2EZH A;  2O6G E;  2HKX A;  1OMI A;  1F5T A;  4QSH A;  2F5F A;  1FYL A;  2AQE A;  5HLH A;  2DT7 B;  2H1L A;  2F5V A;  1OCP A;  1AOY A;  1PYV A;  2AHQ A;  4Q47 A;  3EYI A;  5J4V A;  4KA4 A;  1FOK A;  2CW8 A;  1Z0X A;  4HX4 A;  2H09 A;  5L3G A;  2JMW A;  3FXO A;  5K5O A;  4GYG A;  1MKM A;  2X6X A;  3FWE A;  4YIR X;  5FKL A;  2E5Z A;  2EIL H;  2J5O A;  1WKM A;  2HZD A;  1W5T A;  2P6T A;  1J59 A;  1GVJ A;  2LTP A;  1R6R A;  4OMY A;  3DTK A;  4A3I J;  2LD5 A;  1WJ5 A;  3OYF A;  5K7H A;  1S7O A;  1MBK A;  3SJM A;  3ABL H;  4IEJ A;  3CJQ B;  4XOP A;  3DPT A;  4BDY A;  3HOS A;  1LFU P;  2QLZ A;  1V5G A;  2ELJ A;  3JCU C;  4P9U A;  4LOC A;  4LIV A;  4BE2 A;  4N9I A;  3L9F A;  2XGC A;  3I64 A;  3OSF A;  2ISZ A;  4P9F A;  5F6F A;  1YW7 A;  3PIO F;  2FRH A;  1BI1 A;  3LSG A;  2PN6 A;  5L3E A;  2NOG A;  4A3D J;  5EZG A;  3OL3 A;  2TRT A;  4XKB A;  5E3O A;  3S2D J;  4RB2 C;  4L0Z B;  2PJP A;  3BG7 A;  2MC3 A;  3BTC A;  1YRN A;  2HYJ A;  4XLE A;  1TW2 A;  2BHY A;  4RGS A;  4OOI A;  2CO5 A;  1O4X A;  2DOD A;  1JKO C;  2M0C A;  3DFG A;  1NG6 A;  5FLV A;  3WU2 C;  1AKH A;  3RCO A;  2DAO A;  3G1O A;  2W7N A;  3BR0 A;  3FMS A; 
#chains in the Genus database with same CATH homology
 3CJS B;  3I55 I;  2FOW A;  1MMS A;  1QA6 A;  4IO9 F;  2ZJR F;  3PIP F;  5GAD J;  2H8W A;  3G4S I;  1VQ4 I;  3EGV B;  4UY8 I;  3CCR I;  3G6E I;  3CF5 F;  2JQ7 A;  2QEX I;  3CCS I;  1VQM I;  1VQO I;  1VQ6 I;  1YJ9 I;  1YJN I;  1ACI A;  4V19 K;  1VQK I;  1VQ5 I;  1VQL I;  3CJT B;  5GAE J;  5DM6 F;  3J7Y J;  1VQN I;  1VQP I;  5GAH J;  2E35 A;  3DLL F;  3CCJ I;  3CCL I;  1WIB A;  2K3F A;  1YHQ I;  3CCE I;  1FOY A;  2QA4 I;  3J7Z I;  3CCV I;  2OTL I;  3I56 I;  3CCU I;  1VQ8 I;  2E36 A;  1HC8 A;  4IOA F;  2OTJ I;  3CCQ I;  1VQ7 I;  1S72 I;  1YIJ I;  5GAG J;  3CJQ B;  1YI2 I;  3CMA I;  1FOX A;  3CC7 I;  3CD6 I;  2E34 A;  1Y39 A;  2NXN B;  3CME I;  3PIO F;  5JVG F;  2ZJP F;  3CCM I;  1VQ9 I;  1YIT I;  2ZJQ F;  3CJR B;  4IOC F;  5DM7 F;  3G71 I;  1FOW A;  3CC4 I;  1YJW I;  3CC2 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...