4JBAA

Crystal structure of the oxidized form of marr from e.coli
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
138
structure length
134
Chain Sequence
b'LFNEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLSSIRSAASITPVELKKVLSVDLGALTRMLDRLVCKGWVERLPNPNVLVKLTTGGAAISEQSHQLVGQDLHQELTKNLTADEVATLEYLLKKVLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multiple antibiotic resistance protein MarR
publication title The multiple antibiotic resistance regulator MarR is a copper sensor in Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
total genus 44
structure length 134
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4jbaA00
1FPQA 1LNWA 2HKOA 1MJ9A 3LQRA 3GFIA 5KK1A 4RB0A 2QVOA 3ABUA 2P8TA 1CGPA 4ENMA 1QPMA 3ZP5A 3T1BA 5A2QZ 3ROUA 3WU0A 4HYEA 4EMSA 3U1DA 4AD9A 1CF7B 5DCMA 3MZYA 2HDCA 2ZMEB 2HKXA 3H3UA 2IW5A 2VXZA 3GYHX 1ODDA 1V4RA 4P5OA 5HOOA 4A12A 3FXQA 3ULQB 2RGVA 2P5LC 2M8EA 5FLXZ 2HFHA 2Q8KA 1IRGA 2PMUA 1D8KA 1I5ZA 1IN6A 2DPUA 4G94A 2MLGA 2Z3YA 1VTNC 4IRIA 2F2EA 3K1NA 5K5OA 1ONVA 3V4GA 3HRTA 3F22A 1Z9CA 1C0WA 1ZHFA 4OIRF 4MEXF 5LHGA 3DFGA 1B6AA 2W84A 4LGWA 2NRAC 4ENNA 2BGCA 3TDZC 3HIFA 3CUQA 3U2RA 5HDGA 2DW4A 3GUDA 4EJUA 5HDKA 2PG4A 2FE3A 4BXUA 3F6VA 3P9CA 3FMQA 1OYYA 5AIQA 2C6YA 1S7OA 1FT9A 2LDUA 2VT2A 4DQ2A 2F5DA 4HDUA 2QBYB 4YG2F 3WTWC 3K2ZA 5LGUA 2NNNA 2L4AA 2JPBA 2H6CA 2YR2A 4IRHA 4FX4A 3ML6A 3AAFA 4RB3C 5BOXA 1F1ZA 4HLXA 2MC3A 5CVUA 1SAXA 4HV5A 5CVJA 4KIBA 4U7BA 3M7GA 3KLOA 1QNTA 1T0FA 3WE2A 4Y17A 4EJOA 4IVNA 5FD6A 3BY6A 3VODA 2ZCWA 2YPRA 3D0SA 3WODF 1D3YA 1G4DA 2IA0A 2A5YB 3K69A 4RGUA 3JAMZ 2D2WA 4ENKA 4Y13A 3V8KA 2X0LA 3T0YA 3LA2A 1YS7A 5ILUA 3KP3A 2FU4A 2LF8A 2X4HA 4RB1A 2EB7A 4LG0B 3TGNA 5LHIA 3BJOA 1FC3A 2A6EF 1RIOH 1XSDA 2ACJA 4HX7A 3RKXA 3HRUA 3IWZA 1U78A 1YS6A 1BIAA 4ESBA 1R00A 2CWEA 4PDKA 1IF1A 2EFQA 2STWA 5D5UB 4M72A 4K2EA 3HHHA 1KQ9A 3KP7A 1SFXA 1XSXA 3F8NA 4U88A 3E97A 4DNCA 3GEZA 1TQMA 1J2XA 4RGSA 4L9JA 2G7HA 3T5XA 1YFHA 4IHSA 1BI3A 3ZMUA 4A0XA 1U5TB 2EFWA 1RUNA 3KEOA 4ON0A 4L5IA 2CYYA 3K9TA 4U0YA 2PJPA 4Z2YA 3GO5A 4GXOA 4HA8A 1S7AA 2F5EA 2EFNA 2EFPA 4CZZA 1R5HA 4MNUA 4BQAA 4B09A 3FMSA 2V9VA 2YX4A 4E70A 3K1MA 1LEAA 1AOYA 3MAJA 2DTRA 1S3JA 3LFKA 5LHHA 2D1VA 2J5OA 4XRFA 1XGNA 3ZQ7A 2O61A 2HTJA 4IPAA 3VOEA 1FX7A 3HSEA 4NQWA 5IT3A 1QO0D 2EV5A 2FBHA 4YIFA 5DD4A 5AIPA 2HWVA 1K78A 2GA1A 3F21A 3DKWA 3E6BA 2XAFA 5HLIA 3GF2A 4LLNA 3GZ5A 2GWRA 3F8FA 1U3EM 4I98B 5JR3A 3P7NA 4JK1X 1I27A 1SMYF 2HYGD 1KU3A 5HDNA 2IPQX 1O7FA 4MHGA 3MCZA 3I5UA 4WXDA 1YO5C 1DUXC 2PFBA 1PUEE 5DYMA 4UVAA 1BN5A 3WG9A 3V7SA 4XLNF 2K7LA 5ILSA 2M30A 1F5TA 1IN7A 2H6BA 3QRFF 2RDPA 3ZMVA 4HW0A 5DV5A 4LJZF 4OOIA 4KMFA 5EEHA 1HQCA 1YW9A 1HW2A 2YU3A 4NHJA 3NEUA 4F7ZA 3T8RA 2H94A 4BHBA 1ZH5A 2ETHA 4M9ZA 4IXAA 1S6LA 3I59B 4YFXF 2F5CA 2XGXA 3Q9SA 2CW0F 4M73A 3TO7A 5F1RA 1BC7C 3K0LA 3MFKA 1HBXG 3HTUA 1KQ8A 2QQBA 1TNTA 2QENA 3ECOA 3DP7A 2Z99A 5DD8A 4GGGA 1XCBA 1U2WA 2CSOA 2QLZA 3ZMZA 3TKYA 3I0TA 5HVQC 3R4KA 1JE8A 3CDHA 2O3FA 4N0BA 1UB9A 4M74A 4AVPA 3GW2A 4A0YA 1DDNA 3IC7A 2Y0MA 1H0MA 4PGGA 3J80Z 1STZA 4L9VA 1TBXA 1TW2A 1XN7A 4M6XA 3BJAA 4L5JA 2FNPA 1WKMA 3KFWX 1SFEA 3WTSC 4G9YA 2RQPA 2LF7A 3I53A 5ED4A 3ABTA 1IRFA 5BPDA 3E5QA 1DPRA 1Z6TA 1O3QA 3N97A 1E2XA 1U6GA 2A68F 4MTEA 3SZPA 4B8XA 2DFIA 3WTVC 3SHFA 2IJLA 1T38A 4KNYA 2K02A 2GXGA 3HTSB 2VN2A 4MEYF 2ISYA 3WTUC 2JZYA 4HBLA 1G3SA 5CJ9A 3TOBA 4XBFA 2PQ8A 2IA1A 3TQNA 1P4AA 1I1GA 1RUOA 1LDKB 2V1UA 4GYGA 2ELHA 4AWXB 1KU7A 2PBIA 1BI0A 5FFXA 4ZYDA 3ZN0A 3F8BA 5L3BA 3J81K 2XIGA 5CYVA 1V3FA 1ULYA 2Q0OA 3KP4A 3ZN1A 4EJWA 2AS5F 4H0EA 4EGYA 1FBUA 4WXCA 2JTVA 1BM9A 3QU3A 1LEBA 2CFXA 2FBIA 1ZLKA 5H6RA 1P92A 1XCVA 2RKHA 3HUGA 2MBFA 2HYFA 4Q48A 4BHCA 4G6QA 2KKOA 5HS7A 1XD7A 2EFOA 4P9FA 2FEZA 3CUQC 2Z5UA 4HZFA 2DQRA 1R5GA 2Y75A 4L18B 1ZGAA 3BP8A 3O3KA 4XSXF 3VEPA 3MWMA 1E17A 3O2PE 3RJPA 3TDUC 1TLHB 4HAMA 4GCVA 4WXHA 3C18A 4QLCU 1KU2A 4QWQA 4XLPF 3HRSA 6PAXA 3QPTA 2A6HF 1Z7UA 3JSOA 2O8XA 3TOAA 4Q5SF 3Q9VA 3IKTA 1KQ0A 2QUFA 2EWNA 3KCCA 2BE5F 2DT5A 3GWZA 4HV6A 4RS8A 4HDVA 5E17F 5LBQA 2L01A 1Q1HA 1O3RA 2FMYA 3G3ZA 2VBYA 4RAZA 4HOBA 1P4WA 2RC4A 4CHUA 1O57A 5JI6A 1SMTA 4MQ9F 1MDMA 5CVIA 4IRGA 4UV8A 4HQEA 2QZ8A 3IRQA 2ADUA 3ZMSA 3MEXA 4AIKA 4MQVA 4M9XA 1W4MA 4UXNA 1IXCA 2DQLA 4WWCA 3W6KB 2ZNZA 2UZKA 5L3EA 3I4PA 5BQTA 2Z9OA 2TDXA 1MJAA 4I0AA 3FX3A 2XKPA 3C3WA 2EK5A 2FA5A 4CDGA 2KIUA 1O7LA 1OYWA 1WI9A 2FXAA 1BI1A 1H9TA 2NNYA 2XHKA 2E7XA 2OD5A 3G73A 1QQIA 1FNNA 1KA8A 1MJBA 1B9MA 2BYVE 2B0LA 4CICA 2XAGA 3P9IA 1IN8A 3BPVA 3I64A 2WWYA 2KJBA 3KZYA 3D5LA 5E1WA 2LKPA 4BH9A 4BHPA 4HF1A 5DUKA 5J6XA 2XAHA 1FP2A 1TTYA 5J8CA 4ASNA 1H9GA 4LB6B 4CYDA 2YX7A 4A2UA 5JHUA 1T98A 3EQLF 5D4RA 2EV6A 4I02A 2Y48A 2KRFA 1K6OA 1BC8C 2FRHA 1TQIA 3KP5A 3WGGA 4ETSA 5HS9A 2DLLA 5E1XA 2QQ9A 2IA2A 5DEQA 4S05A 3K1PA 1LDDA 4BNCA 2VOOA 3RYPA 3R61A 5F6FA 2FSWA 3RIRA 2P7CB 3L9FA 5K5QA 1YQAA 1O3TA 2P5VA 2RNJA 2BV6A 1FYMA 4WF2A 3BOQA 4KIGA 1XB4A 2CG4A 4HQMA 4LB5A 3JTHA 1Z05A 3OOPA 4D0PA 5K1YA 3V8LA 1ZRFA 1WRJA 4HF0A 1Y0UA 1KGSA 2GQQA 1CF7A 2VBXA 4KICA 3FM3A 2FOKA 2OZ6A 3O6BB 4BAYA 1EH6A 2K4BA 3BJ6A 4KUMA 1F9NA 5CLSA 4RGRA 1R58A 2W57A 2ZMEA 1SD6A 3F6OA 3DPTA 5CVRA 3JSPA 1YG2A 3RYRA 4JBAA 3H92A 3BWGA 3RI4A 1OYIA 2LNBA 3R0AA 4L0ZB 3LA7A 3V7CA 5ICEA 1T6SA 3R60A 3NRVA 2IVMA 4LMYA 3LAPA 3B73A 1XGMA 4U0VA 5FD5A 2ZNYA 2P6SA 4IHTA 3KZZA 5HLGA 1J9IA 2ZO4A 4RAYA 4AIHA 1BOAA 4IJAA 1P6RA 1I1SA 2V79A 3M1EA 3ISPA 4YFNF 3GFJA 1ZYRF 1FWZA 3IWFA 4UNOA 1YTYA 2WC2A 1UHWA 5FB2A 4PCQA 5FO5A 3CUQB 1LB2A 3ERED 2Z33A 2XKOA 5D5WB 4KA4A 1RI7A 1XGOA 2XAQA 1ZRDA 4U0WA 3QU6A 2ZFWA 4BYYA 2O03A 2FBKA 1ZG5A 3FMRA 5IT9K 3GFLA 1YYVA 2QBYA 1ZN2A 1D8JA 4OIQF 5HLHA 1W7PB 2HS5A 4G6DA 1Z1DA 2J5PA 3H3ZA 2XASA 5E20A 1FY7A 2QYOA 4I2OA 2O0YA 1TW3A 2R3SA 3JW4A 1L3LA 2CQKA 1I6XA 3BPXA 4Y15A 4IF4A 1W5SA 5FFZA 3E6DA 4KMUX 4EV0A 1J0RA 1KYWA 1O3SA 1QZYA 4A0ZA 4A6DA 1JXSA 4GO1A 4A6EA 3LSTA 3S2WA 1ZAOA 4P96A 2V1XA 3F8CA 3LWFA 2DU9A 2VE8A 2O6GE 3LA3A 1OPCA 2LSOA 1L0OC 4LK1F 1USTA 3T8TA 2OQRA 4LG0A 4I01A 1ZREA 4FX0A 1IZ1A 4UV9A 1B59A 3QOPA 2G9WA 2EA4A 1GXPA 4M71A 2DPDA 3F23A 4JQFA 2VBZA 1B1BA 1B4AA 3I54A 1LQ1A 4FHTA 4EVIA 2FF4A 3FWEA 2OQGA 4EJVA 1A04A 2ZJ2A 4UHTA 1HKQA 4LFUA 1LDJA 1P2FA 3FZVA 3DEUA 5CVVA 1HKTA 4EM1A 3KEQA 4G7HF 2L4MA 2YSRA 3ZMTA 2ZBKA 4I0BA 5H6QA 1Z91A 3DQVC 5JFRA 2V6CA 2JRTA 1IXRC 2VC0A 1ON2A 4UUVA 1REPC 1U5TA 1PP7U 3PQKA 2IP2A 4FT8A 1DPUA 1QZZA 2OU2A 1U8RA 2F5FA 4RGXA 2EA2A 5KVRA 2Q2EA 2VT3A 3QPHA 3BROA 2DK5A 1ON1A 3FXUA 3IHUA 1IXSB 2HR3A 1YW8A 1R7JA 1JHFA 5ICFA 3WTYC 5E8IA 5LGTA 3WTXC 3MZHA 4HLYA 4NB5A 3COAC 5A2QK 3HSFA 2FNAA 3DV8A 2XAJA 4ZYGA 3RTRA 1HW5A 1R36A 3SQNA 4KFCA 3SXYA 3HOSA 1MZBA 1FBSA 1HKSA 4EM0B 1F4KA 2XRNA 4LLGF 5D6EA 4CO8A 2DAOA 3QP6A 2H09A 2VONA 5LGNA 5FLXK 1G3WA 3M8FA 3R0JA 4CGZA 4OMYA 1K78B 1UFMA 2M45A 4O6JA 2NAZA 2PLYA 1UHMA 1IUYA 4OINF 1J5YA 3R6SA 1ZARA 2R7DA 4Q47A 1HW1A 2RN7A 4A5MA 1PP8F 2JPCA 2IRFG 3P9KA 1ZG1A 2DBBA 3L2CA 1R23A 2IT0A 5BMZA 3RKYA 3EUHA 2HQRA 1KU9A 2RVCA 4EJTA 5D5VB 3RKWA 4ZYHA 2L54A 4R8HA 1TQPA 1MKMA 5BPIA 2GZWA 3NQOA 3E5UA 1GHCA 3ZPLA 4UVBA 4I09A 2P7VB 2GIVA 2W85A 2PN6A 2CO5A 3I59A 3FM5A 3HOTA 3PFIA 5LEJA 2XROA 3LAJA 3CO6C 1HXDA 4OMZA 1J75A 1FP1D 3HYIA 1W7PA 1BBYA 1RZ4A 2HZTA 2PEXA 4L0YB 1XDSA 1XGSA 4PGHA 1SD7A 1J7KA 4ZYEA 1FBQA 1IAWA 3DF8A 4LD5A 1WWXA 1MGTA 2QWWA 3EETA 3BDDA 1FYLA 2XVCA 4YFKF 3SZTA 5FGMA 3L09A 4WK8F 1FZPB 5K5RA 1FSEA 1YW7A 5ERIA 2P4WA 5D4SA 3REOA 4ZZLA 5D6FA 1T2KA 4R79A 1OKRA 3HRMA 3E6MA 4OIOF 4S04A 3CJNA 5EEGA 5D8LB 1XSVA 3KLNA 4N9IA 2VODA 3FXRA 4HX4A 2OZUA 1YIOA 1D5VA 3JAMK 3M8EA 2BEOA 2EJRA 4ESFA 5ILVA 2HTSA 4HX8A 1W7PD 4XSZF 4KN7X 2HQNA 5AONA 3CTAA 5BS6A 3IKVA 1PDNC 3C1DA 5L3CA 2W24A 1J59A 2H27A 2MLKA 2ISZA 3I71A 5L3GA 5E8GA 2OA4A 2AXLA 1B9NA 4MGRA 1ZGJA 2A69F 2HGCA 3ELKA 4ZH4F 3V8JA 1X3UA 2K27A 3CLOA 3E3VA 3PQJA 5E18F 5L3FA 2P6TA 2GXBA 1FOKA 2RV8A 4G7OF 2UXXA 4GYIA 4TV7A 1JGSA 2MD5A 2VE9A 1ZG3A 5J8FA 4Q4ZF 2KJCA 5LEKA 1LVAA 5H20A 1R22A 4KT5C 3GFMA 4CXFA 1HSJA 2DI3A 1G3TA 2L3DA 5LLQA 2GA2A 1GVJA 5HS8A 4I7HA 5DCMB 1GXQA 1XMAA 4ENJA 2EV0A 5DCFA 1G6NA 5D5XB 1AWCA 2P5KA 3F72A 5L3DA 1EH7A 4P55A 2ESHA 2NYXA 3U9GA 1RNLA 4MTDA 1HSTA 1IN4A 4EGZA 3KP6A 1SD5A 4YIIA 1ZRCA 2JSCA 2MH2A 3F3XA 2QQAA 1XDUA 3V7RA 4L9TA 1LJ9A 1FSHA 2V1DA 2CGPA 2R7FA 3EDPA 4U7DA 3J7AO 2NS0A 1G3YA 2L02A 1YLFA 4LLLA 4HF2A 1BI2A 2DK8A 3L7WA 2XUBA 2QM3A 1XMKA 2VBWA 5LRSA 5TRDA 1P4XA 2OAZA 5E1ZB 5ICCA 4A5NA 2A07F 1FLIA 1MD0A 1JHHA 1IN5A 2W25A 3FHZA 3GLXA 3LQQA 2VC1A 2E1NA 4KIFA 3KP2A 4M9SA 4N9HA 4O5VA 2JT1A 5IT9Z 1NHAA 2G7UA 2WTEA 1QBJA 1EH8A 1WQ2A 2M1BA 4RB2C 1SFUA 2D45A 3RPUA 1MDMB 4R1HA 2KIMA 1ZLJA 3CUOA 4G8XA 3W6JB 3GVAA 1QGPA 2M87A 2D1HA 3TO9A 2MA3A 2STTA 3DXJF 3WGHA 3IL2A 1R1VA 3KETA 3QP5A 1Z6RA 3L00A 2XV4S 3KE2A 4KYWA 3CO7C 2COMA 5ICGA 1BIBA 2PMHA 4O3MA 1T39A 1K7AA 2BBYA 2UXNA 1DP7P 4WCGA 1UCRA 3Q5FA 3HSRA 2HOEA 3IRRA 5LRRA 2GAUA 1S8NA 3WTZA 2E7WA 1K79A 3ECHA 3EYYA 3WTTC 3GZ6A 5DUIA 5DDGA 3FF5A 3M9AA 1S29A 4OIPF 2WV0A 4OU0A 4EQQA 5D8KB 4UVCA 1USSA 3DPLC 4PZJA 4P9UA 2FQ3A 3E6CC 2UWMA 4L9NA 3C7JA 3WU1B 3J80K 1OMIA 1R1TA 4WX9A 2ZKZA 2FMLA 3GX4X 3GXOA 2ZXJA 2E1CA 4KN4X 1U5TC 3OV8A 5F64A 3F8MA 4ESJA 1TNSA 3ZMDA 3I58A 3RDIA 3VB2A 2M5WA 2OBPA 2KIFA 2ESNA 3RPQA 4EM2A 1R1UA 3WE3A 2K86A 5TJJA 2MH9A 1IW7F 4LK0F 3JTGA 4ZZDA 2K4JA 3HHGA 5JVTA 3MQ0A 3E5XA 2HEOA 2A3SA 1KYZA 3VFZA 3BZ6A 1W5TA 1EV7A 1BJAA 3TO6A 4G7ZF 3QAHA 3J81Z 1OR7A 1SD4A 3EYIA 1FYKA 2DO7A 3N4MA 3SFZA 4M6YA 4AIJA 3WGIA 3B02A 4KDPA 2VOPA 1WSUA 2A61A 2PI0A
chains in the Genus database with same CATH superfamily
1FPQA 1LNWA 2NVYJ 2HKOA 2Y31A 1WH7A 1MJ9A 3CP8A 3LQRA 1LPQA 3GFIA 5KK1A 4RB0A 2QVOA 3ABUA 2P8TA 1CGPA 2OV7A 4ENMA 1QPMA 2MG4A 3T1BA 3LSHA 5A2QZ 3ROUA 3WU0A 3ZP5A 4HYEA 3A0BC 3CCQI 3CCJI 4CYCB 4EMSA 3U1DA 1BR1A 4AD9A 1CF7B 1ERDA 2HXIA 4V2FA 4CA0A 5DCMA 3MZYA 3OSFA 1MMNA 5B1BH 4F92B 2HDCA 3CC2I 2B63J 1I6HJ 2NOGA 2NS7A 2ZMEB 2HKXA 4Y4RA 1AKHA 3H3UA 2IW5A 2VXZA 2XF6A 3GYHX 1ODDA 4M6VA 1YI2I 1V4RA 5F0HA 3TMOA 1XMXA 3HM5A 4P5OA 5HOOA 4A12A 3FXQA 3G2BA 3ULQB 2RGVA 2P5LC 2M8EA 2WAQN 5FLXZ 4IEJA 1LFBA 3H1CA 2HFHA 2X51A 2AHQA 3CC7I 2Q8KA 1IRGA 3L2UA 2PMUA 1D8KA 3HJEA 1I5ZA 1IN6A 2L0KA 2DPUA 4G94A 4BS9A 2NS8A 2MLGA 2Z3YA 1VTNC 3OS0A 1IDZA 4IRIA 2IXSA 2F2EA 2M0MA 3K1NA 4NC8A 5K5OA 1PJRA 2IAIA 3FXKA 1ONVA 3K70D 3V4GA 3S17J 3HRTA 3F22A 2QCOA 1Z9CA 3ZXSA 1HC8A 1C0WA 1ZHFA 2LP0A 2MGQA 5EGOA 4OIRF 3ZQFA 3FIWA 4MEXF 5LHGA 3DFGA 1B6AA 2R93J 2W84A 4BL0B 4LGWA 1VQKI 3OWTA 2NRAC 2R7XA 2VKHA 4ENNA 3K4CA 2BGCA 3TDZC 2BZTA 3HIFA 4NDLA 2X85A 3CUQA 2HI3A 2XDVA 3PSIA 1B8IB 3U2RA 5HDGA 4IHXA 4BXXJ 2H8WA 3TW6A 4QPQA 3OYAA 2DW4A 3CCUI 2EZHA 1VZ0A 4AC0A 3GUDA 4EJUA 1XX5A 4JOMA 2E34A 3TP3A 5HDKA 3KYLA 3ZR8X 4YRVA 2PG4A 1BOBA 2RQQA 3ASNH 4RAGA 2FE3A 4BXUA 1FIPA 3F6VA 1HF0A 3P9CA 3FMQA 2HOAA 1IV6A 2K9LA 3EUAA 2IGNA 4II3A 4N4OB 2K9MA 2M0CA 1OYYA 2HXOA 3BG7A 3JRBA 2CUZA 3BG5A 2ZJRF 1TWHJ 3I9V2 4CCLA 3P5JA 5AIQA 2DCEA 2LLKA 3TL4X 1ZQ3P 2C6YA 4JX4A 3QWLA 2CUFA 1S7OA 1FT9A 2LDUA 3OL3A 2VT2A 4DQ2A 4E7JA 1OCTC 2F5DA 3BZCA 4HDUA 2QBYB 4YG2F 2BXZA 3WTWC 2DTZA 4PJMA 3K2ZA 3PUFA 5LGUA 2NNNA 2L4AA 1PUFB 3OOUA 1HDDC 2JPBA 4YIRX 2H6CA 2JK3A 2YR2A 4IRHA 4FX4A 2VQLA 3ML6A 3AAFA 4RB3C 1OCPA 5BOXA 2DMPA 1F1ZA 4HLXA 4A93J 4DZJA 4C2MJ 2MC3A 5GAGJ 5CVUA 1UG0A 3GTOJ 3HGGA 1SAXA 1H88C 4HV5A 5CVJA 1LFUP 4KIBA 4U7BA 3M7GA 5J3LA 3KLOA 2IBDA 1QNTA 1T0FA 3WE2A 3D1NI 3CLQA 1UMQA 4Y17A 3L2RA 4EJOA 4MIMA 4IVNA 2UV1A 2Y9YA 5FD6A 1VQNI 3BY6A 3VODA 1ORKA 2PMZN 2WAQA 2YPRA 2ZCWA 2LKSA 3D0SA 2DFHA 3BCBA 3EPZA 3F0CA 2CV1A 4OAZA 3PFYA 3WODF 1Y6IA 1D3YA 1G4DA 2IA0A 2A5YB 3HKZN 3K69A 4RGUA 3JAMZ 5IPAA 3ZQGA 2HZDA 2ZSIB 2D2WA 1Z7LA 2E36A 1DU0A 1Y39A 4ENKA 5C3EJ 1WJDA 4BACA 1P9QC 3OYNA 3OYIA 1WGXA 1UELB 2WV1A 2X9DA 5FKOA 4Y13A 1ENHA 3V8KA 2LTPA 5IP7J 5FKKA 2JSPA 2MD0A 4QSHA 2KISA 2X0LA 3T0YA 3FXOA 3LA2A 1YS7A 3S1RJ 5ILUA 3KP3A 2A5WA 2FU4A 1R49A 4XKWA 2QKLB 2LF8A 2X4HA 1JTYA 4RB1A 2EB7A 2JA7J 4LG0B 3TGNA 3BQZA 3JRDA 5LHIA 3BJOA 2R7OA 3LSIA 1FC3A 2A6EF 1RIOH 2BY1A 1XSDA 2ACJA 4HX7A 3RKXA 3S15J 3FXJA 2QF7A 4HNVA 3HRUA 1SVLA 3IWZA 1U78A 1YS6A 3DTKA 1VQOI 1BIAA 4ESBA 1UJ8A 2ZXIA 4XLFA 5F08A 1R00A 2LRDA 4A3MJ 2V9KA 2CWEA 3FBNB 1X2NA 2R5YA 3UR3C 2GLOA 1DP3A 2QEXI 1OFCX 5FRNA 4PDKA 1PYVA 1IF1A 2EFQA 3KEYA 2STWA 5D5UB 4M72A 4K2EA 3HHHA 4GRIA 1KQ9A 3KP7A 3NWSA 1SFXA 2I5UA 3A03A 4BKXA 1XSXA 3F8NA 3I4NJ 4U88A 3E97A 4DNCA 2K3FA 4IZZA 2KIQA 3GEZA 3RCOA 3A0HC 4BQOA 1X1PA 1TQMA 1J2XA 2CQXA 4RGSA 2IS4A 2XGDA 4L9JA 2G7HA 2PX9A 3S14J 1Z67A 1DU6A 3T5XA 4XK4A 5DTDA 1YFHA 4IHSA 2R7ZJ 1BI3A 3ZMUA 4A0XA 4I6ZA 1U5TB 2EFWA 1RUNA 3KEOA 4ON0A 3OYCA 5M5WJ 2X6OA 4L5IA 4XRSG 4CZCA 2O9LA 2CYYA 2LG4A 3GTMJ 3K9TA 2XRLA 4U0YA 2PJPA 3OYEA 4Z2YA 3GO5A 4GXOA 4HA8A 1D0ZA 1S7AA 2F5EA 2EFNA 2EFPA 4CZZA 3VPRA 3OIOA 1R5HA 4MNUA 4BQAA 4B09A 3FMSA 2GOXB 2Q2EB 2W48A 3GCMA 2V9VA 2YX4A 5EF6A 4E70A 3MKWB 3K1MA 1LEAA 1I3AA 1P7IA 3LMMA 2K5CA 1AOYA 1U8BA 2EINH 1T8IA 3CD6I 3HKZA 3MAJA 2D5VA 2DTRA 1S3JA 3DBLB 2FQ4A 3LFKA 2FOWA 1MW7A 1NG6A 5LHHA 5GP9A 1YJWI 3CC4I 2D1VA 2J5OA 4XRFA 1YX3A 5HLTA 1XGNA 3BR5A 3ZQ7A 2O61A 2HTJA 4IPAA 3VOEA 1FX7A 1ETQA 3HSEA 3JRHA 4NQWA 2LK2A 3HDDA 1W36C 5IT3A 1QO0D 3WHBA 2EV5A 2FBHA 1D1CA 4M3FA 4YIFA 3S1QJ 4JYKA 5DD4A 5AIPA 2NVTJ 2CV2A 2EIMH 2HWVA 3BZKA 1K78A 3PNTA 2GA1A 2Y0SN 2MW8A 5EDNA 3F21A 3DKWA 3E6BA 2JA2A 3M4OJ 3WHCA 3K6GA 1A36A 2XAFA 5HLIA 1MBKA 3GF2A 4C2TA 1OCRH 4XKVA 3GZ5A 1TL8A 4LLNA 5C4XJ 1MBFA 2GWRA 2X6YA 3L2QA 3FDYA 3F8FA 1U3EM 2OF7A 3S3OA 1JUPA 2K40A 3K4JA 4I98B 2PI0A 4XOPA 5J1YA 5JR3A 3P7NA 1ZGWA 4JK1X 1R6RA 1I27A 1SMYF 1QA6A 2HYGD 2ELJA 1KU3A 5HDNA 4X1EA 2IPQX 3ZRGA 1O7FA 4MHGA 3MCZA 3I5UA 4WXDA 3NWTA 2DT7B 2CJJA 1YO5C 1N77A 2V7FA 4XN3A 1DUXC 5LD2C 2PFBA 2LKXA 1PUEE 4FCYA 5DYMA 1J09A 1TZLA 4UVAA 1BN5A 1GLNA 2E1MB 3HZJA 3WG9A 2VKDA 3V7SA 4XLNF 2K7LA 5ILSA 3RSNA 2M30A 2CV0A 3S1MJ 5E3OA 1F5TA 1IN7A 1VI0A 2H6BA 3BR2A 3CJTB 3QRFF 2RDPA 2TCTA 3ZMVA 4HW0A 1A31A 4C30A 5DV5A 3ERMA 4LJZF 4OOIA 1OCCH 4KMFA 2DFFA 4DJAA 5KAIC 4E7HA 2HQAA 2ECBA 5EEHA 3RQIA 1HQCA 1YW9A 1HW2A 2YU3A 4NHJA 1DGRM 3NEUA 3FBIB 4F7ZA 4UUTA 5K7HA 1GUUA 2E5ZA 2WAEA 2YUSA 3T8RA 4NC6A 2H94A 4PJJA 2EILH 4BHBA 4XN0A 1ZH5A 3PJRA 3CF5F 4C3IJ 1G59A 1K6YA 2ETHA 4M9ZA 4IXAA 1S6LA 2VQCA 1RETA 3I59B 4LOCA 3V42A 4YFXF 1VFCA 1N78A 2F5CA 2XGXA 1KZHA 1EJ9A 3Q9SA 4IQ4A 1JUMA 2CW0F 3L2VA 5M5YJ 3CDLA 3FXMA 4M73A 3TO7A 2K9QA 3G6EI 2L7FP 1MBEA 5CQGA 1A5JA 5F1RA 1UZCA 4BBSJ 1R9TJ 3W6VA 3SFIA 2MC4A 1BC7C 3K0LA 3MFKA 1MIJA 1HBXG 3HTUA 3IH4A 1KQ8A 2QQBA 3HOWJ 1TNTA 2QENA 1WJAA 1FOWA 1Z3YA 3OYFA 3FXLA 3ECOA 4B47A 3CCRI 3DP7A 2Z99A 3ZOBA 3NAUA 5DD8A 4GGGA 2BXYA 4ZTJA 4A3BJ 1XCBA 1U2WA 2CSOA 2QLZA 5CPRB 3ZMZA 3TKYA 3I0TA 5HVQC 3R4KA 1W5CC 1JE8A 3CDHA 1G2HA 1I39A 2O3FA 3Q0WA 4N0BA 2IS2A 1UB9A 2CU7A 2KDZA 1FJLA 2WB1N 3HGYA 2HNHA 4JP0A 4M74A 4AVPA 4XIDA 2CQQA 3CCSI 2JQ7A 3K10A 1LKXA 3GW2A 4A0YA 1YJNI 5IY5H 3VYTB 3GTPJ 1DDNA 3DBRB 3VSKA 4W97A 2KRCA 3TW7A 3IC7A 3VDXA 2Y0MA 1H0MA 4PGGA 3J80Z 2LR8A 1STZA 4L9VA 1TBXA 1MNMC 1TW2A 1OR7C 1XN7A 4M6XA 3BJAA 4L5JA 1G8XA 2FNPA 1LFPA 1WKMA 4B1RA 3DPUA 3KFWX 1SFEA 1MMGA 3WTSC 4RLFA 1K61A 4G9YA 1M1EB 2IGOA 5J4VA 2RQPA 3K70C 2BW3B 2LF7A 2IS1A 1Z77A 3I53A 1FTZA 3H36A 5ED4A 3ABTA 1IRFA 2HVQA 5BPDA 3A2KA 2MFZA 3E5QA 1DPRA 3PO3J 1Z6TA 1O3QA 1FMWA 2KZGA 1FEXA 3N97A 1YITI 3M07A 2LYCA 5CKTA 1E2XA 1U6GA 2KDOA 1ETWA 4HEA2 2A68F 4MTEA 2Y9ZA 1OLTA 2WY8Q 3SZPA 4B8XA 2DFIA 1APLC 2O5RA 3WTVC 1WJCA 2VQGA 3SHFA 2IJLA 4EEFG 3F9KA 2L9NA 4E7ZA 3VYUB 2GOMA 1T38A 3KYDB 2K02A 2XSDC 4KNYA 2GXGA 3HTSB 5CQEA 2VN2A 1HA8A 4MEYF 2ISYA 3WTUC 1U9NA 4RDUA 2DMTA 2JZYA 4HBLA 1G3SA 5CJ9A 3DBHB 3TOBA 4XBFA 2YU9J 2HDWA 4UY8I 1WPKA 2PQ8A 2IA1A 4BDYA 3TQNA 1P4AA 1I1GA 1S72I 2WA0A 1RUOA 1E0EA 1LDKB 4A3FJ 2DA2A 2V1UA 2EH3A 2F5VA 4GYGA 2ELHA 4AWXB 2DOFA 3H9JA 1MMSA 1KU7A 2PBIA 1BI0A 2DA1A 5FFXA 4ZYDA 3ZN0A 3H9QA 2IS6A 4MO7A 3F8BA 3HB9A 5L3BA 3J81K 2XIGA 3DLAA 4LITA 5CYVA 1V3FA 1ULYA 1ZR4A 2EBIA 2KL4A 2Q0OA 2E19A 1VQPI 3S2HJ 3KP4A 2L5QA 3ZN1A 4EJWA 2AS5F 4H0EA 4YEJA 4EGYA 1WJFA 1FBUA 4WXCA 5M3FJ 3DLLF 4BY1J 1UHSA 2JTVA 4BXFA 1BM9A 2R7UA 1QRYA 2IGKA 2KZVA 3QU3A 3J7YJ 1LEBA 3JRAA 2CFXA 2FBIA 1ZLKA 2LOOA 5H6RA 4KITB 1FOXA 1FTTA 1P92A 3ABLH 1XCVA 2RKHA 1X4OA 3HUGA 5FKLA 2WB1A 2MBFA 2HYFA 3LSRA 1HLVA 4Q48A 4BHCA 4C2UA 4G6QA 2KKOA 5HS7A 1XD7A 3LFUA 5GAEJ 2EFOA 4P9FA 2FEZA 1X19A 3CUQC 3EUKL 3GTQJ 2Z5UA 4HZFA 2DQRA 1R5GA 2R7QA 2Y75A 3HL2A 3BCAA 1ZGAA 4U87A 4CCOA 4A3JJ 4L18B 3BP8A 3O3KA 4XSXF 3VEPA 1W1WE 3IUOA 3KIOA 3MWMA 1YOVB 1E17A 1BA5A 2L7ZA 2HQ5A 3O2PE 4F52A 3RJPA 3TDUC 4XONA 2HVSA 1WI3A 4CCJA 1ETYA 1TLHB 3AG1H 3KPHA 3DTIA 4M3GA 3I55I 4FE4A 4HAMA 2OPTA 2XB0X 4GCVA 2VI6A 3HEFA 1NH3A 1QVTA 4WXHA 5KHDA 3C18A 4DIQA 3AL0B 3FKJA 4QLCU 2XSJC 1KU2A 4QWQA 1RC9A 1JJ8C 4XLPF 3HRSA 3C2GA 6PAXA 1Y8QB 3QPTA 1X58A 2A6HF 1MBGA 1Z7UA 4B48A 1MNEA 3AG2H 1XTAA 5F27A 1MH3A 3JSOA 2O8XA 3TOAA 4Q5SF 2PJRB 4IOAF 1SVMA 4ZJZA 3Q9VA 1WFXA 3IKTA 1KQ0A 2QUFA 2EWNA 3KCCA 2BE5F 2DT5A 1BL0A 2ID6A 1SFKA 3GWZA 4HV6A 3TP0A 4AYBN 5EYRA 4RS8A 1B72B 3HOYJ 3FHNA 4HDVA 5E17F 5LBQA 2HYJA 2L01A 3AG3H 4FETA 1Q1HA 3CCYA 2LH9A 3I4MJ 1FIAA 4IO9F 1RKTA 1O3RA 2FMYA 1MH4A 1T0FC 3G3ZA 4CCKA 3GZNB 3H5NA 2VBYA 4RAZA 4HOBA 1P4WA 5KCMA 2GIZA 2RC4A 4CHUA 1O57A 3DKXA 5JI6A 1SMTA 3A1YA 3LSGA 4MQ9F 1MDMA 2WADA 5CVIA 3S3NA 1Q1VA 3IAM2 5EG0A 4IRGA 4UV8A 4HQEA 3G1OA 2QZ8A 4PUSA 3IRQA 4AM3A 3U21A 2F4OB 2DA7A 2VJIA 3MKLA 1Z21A 2ADUA 2HPMA 3ZMSA 5F0CA 3RZDJ 3FK7A 3MEXA 4AIKA 3LSJA 4MQVA 2DDBA 4M9XA 1W4MA 1WCMJ 4UXNA 1IXCA 2M7AA 1K4TA 5E79C 2DQLA 3H5RA 2DFEA 2X1EA 3W6KB 5J47A 4WWCA 2ZNZA 1VNDA 5F1JA 1Y56A 2UZKA 1V5GA 5J4YA 5L3EA 2DMUA 3H9GA 3I4PA 5BQTA 2W82A 3JREA 3A01B 2Z9OA 2TDXA 1MJAA 4I0AA 3FX3A 4LIUA 4YELA 4F93B 2R5ZB 4BEHB 3OSGA 1TT5B 2XKPA 1AU7A 3C3WA 2EK5A 2FA5A 4D1QA 4F91B 2KIUA 2CUJA 1O7LA 3ZQQA 1OYWA 4CDGA 1WI9A 2W1OA 1QZEA 3HOXJ 1UAAA 2FXAA 2LC2A 3BR1A 4RA2A 1BI1A 1H9TA 3HBLA 2BY0A 2NNYA 2XHKA 5GAHJ 2E7XA 1YJ9I 2OD5A 3OMYA 3G73A 1ZELA 3DKYA 1QQIA 2VJ5A 1FNNA 2L7KA 1KA8A 1MJBA 1B9MA 2BYVE 2B0LA 4CICA 2XAGA 3VSLA 3P9IA 2LD5A 2QQ8A 5KAFC 1IN8A 3W3CA 3BPVA 5IYBJ 3I64A 2WWYA 2V9PA 3S3MA 2ELKA 2KJBA 1IJWC 3KZYA 1VQLI 1POGA 3D5LA 5GADJ 4NUBA 5E1WA 3Q3SA 1NG7A 1CQTA 2RAEA 2LKPA 4BH9A 2EIJH 4BHPA 3HPHA 1YRNA 1WZ2A 4HF1A 5DUKA 5J6XA 2XAHA 1FP2A 1TTYA 3A02A 5J8CA 2R7WA 5FLVA 3BG3A 3S2DJ 2F4IA 4A3EJ 4ASNA 3QYEA 1H9GA 5DM6F 1P7JA 4LB6B 2DXIA 4CYDA 4IOCF 4E4HA 2YX7A 4A69C 4A2UA 5JHUA 1T98A 3EQLF 5D4RA 2EV6A 4I02A 2Y48A 2KRFA 1K6OA 3D5RC 1OISA 1BC8C 2FRHA 4DYQA 1Z0XA 1TQIA 3MZ8A 3TEDA 2CFOA 4OAYA 2E5NA 3KP5A 3WGGA 4ETSA 4RLQA 3M8JA 5HS9A 2DLLA 4BU2A 5KNLA 5TGTA 5E1XA 5B3SH 2X6XA 2QQ9A 4XR6A 2IA2A 3DCFA 5DEQA 3K1PA 1V54H 4S05A 1LDDA 1TWFJ 4BNCA 1YX5A 2VOOA 4BDZA 2KMUA 2K9SA 1TWGJ 3RYPA 1N75A 4UUSA 1D1AA 2JA8J 3R61A 2ZMEC 3B6CA 5F6FA 1D1BA 1MSFC 2FSWA 3RIRA 2P7CB 3L9FA 3FISA 5K5QA 1YQAA 3BG6A 1YE9A 4A3KJ 4Z6YA 3AKZA 3PO2J 1O3TA 2P5VA 2RNJA 2BV6A 1FYMA 4WF2A 3BOQA 2EIKH 4KIGA 1XB4A 2NVXJ 2CG4A 4XMYA 4HQMA 2NVUB 4LB5A 3JTHA 1Z05A 4PSXA 3OOPA 1X1AA 1RKWA 1IGNA 4D0PA 5K1YA 3V8LA 1ZRFA 2WY7Q 1WRJA 4HF0A 1Y0UA 1E3PA 4XRMA 1A35A 1KGSA 3HOVJ 2XGCA 2ME6A 4IQJA 4CYCA 2GQQA 2CRGA 1CF7A 3IH3A 2PMZA 2VBXA 3C2BA 3FM3A 4KICA 5B66C 3X2QH 2FOKA 4KJZA 4A3LJ 2OZ6A 3O6BB 4BAYA 1EH6A 4KT6A 2LVSA 2K4BA 3BJ6A 3GTGJ 4KUMA 2XGEA 1W0TA 1F9NA 5CLSA 1TP4A 2OCEA 2VJJA 1R58A 2W57A 2ZMEA 3OR1C 4RGRA 2M7BA 1SD6A 3F6OA 3TBIA 3DPTA 1X1DA 5CVRA 3JSPA 1U9OA 1YG2A 4MFEA 3VWBA 2VJ4A 3RYRA 4JBAA 1W0UA 3H92A 2IEKA 1TWAJ 5GTHC 3BWGA 3RI4A 1OYIA 1AKHB 4E7LA 5HNFA 2LNBA 1SANA 3R0AA 4L0ZB 4C3JJ 3LA7A 1WHUA 3V7CA 5ICEA 1GV2A 1T6SA 3R60A 3NRVA 3GTLJ 2IVMA 4LMYA 3LAPA 2A6TA 4FE7A 2COBA 3B73A 1XGMA 3D5SC 4U0VA 5FLMJ 3LNQA 5FD5A 3BTLA 3ZQIA 5JHFA 2ZNYA 1X3ZB 3BLYA 5IOYA 2P6SA 2DMQA 4IHTA 3KZZA 4Y3OA 3SJMA 3PSFA 5HLGA 3JRIA 1ZR2A 1IG7A 2QKMB 1J9IA 2ZO4A 4RAYA 4AIHA 1BOAA 3LSPA 3SDBA 4IJAA 5B1AH 1P6RA 1I1SA 1JKPC 2V79A 3SYTA 1TC3C 3M1EA 5FRMA 3ISPA 2X6WA 4YFNF 3GFJA 1ZYRF 1FWZA 3IWFA 4UNOA 2K85A 1YTYA 1B8IA 1ACIA 2WC2A 1OJLA 1UHWA 4BBRJ 3HG9A 5F0FA 3GTJJ 1EF4A 2VKEA 2DYRH 2ME0A 5EEAA 2NOJB 3H0GJ 5FB2A 4PCQA 1GVDA 5FO5A 3G71I 1VQ4I 3CUQB 1LB2A 3ERED 2Z33A 2XKOA 5D5WB 4KA4A 1RI7A 1XGOA 2XAQA 1X4PA 3IV5A 1ZRDA 2Y69H 4U0WA 3QU6A 2ZFWA 4P1WA 3CMYA 4BYYA 1MMDA 2HPIA 2O03A 2FBKA 2UUZA 1ZG5A 1JJ6C 3FMRA 5IT9K 4XLHA 1TT0A 4ANJA 2ZC2A 3GFLA 2VKVA 2L7MP 1YYVA 4RM3A 2X48A 2QBYA 4G6TB 2VPRA 3J7ZI 3PNVA 3CP2A 1LE8B 3HOZJ 1ZN2A 3K4BA 5IP9J 1PUFA 2XAUA 5HLHA 4BJTA 4OIQF 1D8JA 2KFDA 2FUG2 1W7PB 2HS5A 4G6DA 1Z1DA 2J5PA 3H3ZA 3BTCA 2XASA 2WBMA 5E20A 1WJEA 1FY7A 2QYOA 3H3VK 4XLCA 4I2OA 4DGWB 4JX6A 2O0YA 1TW3A 2R5ZA 4J00A 2R3SA 4GFBA 4PSWA 3JW4A 4XQFA 1L3LA 2CQKA 2JMWA 4B3AA 1I6XA 4FASD 3BPXA 3PUBA 4Y15A 2F4MB 1SVOA 4IF4A 1W5SA 4HNTA 5FFZA 3E6DA 2VIXA 2XPWA 4KMUX 1JT0A 5C44J 3KYCB 4L5EA 2KPMA 4EV0A 4II2A 1J0RA 1KYWA 4QIWN 2HOSA 2M3AA 3E7LA 1O3SA 2ZJQF 1QZYA 4A0ZA 3C2HA 4A6DA 1JXSA 4GO1A 4A6EA 3OYJA 1AHDP 3LSTA 2Y0SA 2Y30A 2W00A 3S2WA 3HC7A 1ZAOA 4P96A 2V1XA 3OYDA 3F8CA 3LWFA 2DU9A 2VE8A 4BY7J 4XRSA 4XKCA 2O6GE 3LA3A 2IGMA 1OPCA 3SEZA 2BHYA 2BVMA 2E2JJ 2LSOA 4HNUA 9ANTA 1L0OC 4LK1F 3LSMA 3RPUD 1USTA 3T8TA 2OQRA 4LG0A 2DOAA 2MABA 4I01A 1ZREA 4FX0A 1IZ1A 4UV9A 4Y7NJ 1B59A 3QOPA 4B43A 1MSEC 4Y52J 1RESA 1EA3A 2DODA 2G9WA 2M2EA 4BJ6C 3N05A 4PFOA 2EA4A 2R7RA 1GXPA 4M71A 4D7MA 2DPDA 3F23A 5J1RA 2QA4I 4RBOA 4RMNA 3ASOH 4JQFA 2VBZA 2LY1A 1B1BA 5HODA 3OYHA 1B4AA 3I54A 1LQ1A 4FHTA 4EVIA 3JRFA 2FF4A 3FWEA 2OQGA 4EJVA 1A04A 2ZJ2A 1JKQC 2F48A 5JLXA 2KLOA 4AU7A 1ETXA 4UHTA 1V55H 2VQHA 1HKQA 4ITVA 1LDJA 1P2FA 4LFUA 1GDTA 4IHWA 3FZVA 3CQZJ 4A3CJ 3DEUA 5CVVA 3Q0UA 2R0QC 1HKTA 2R5YB 4ZDLA 4EM1A 5LFAA 3KEQA 1WH5A 2HU9A 4G7HF 2L4MA 3DWLE 2YSRA 3SEQA 2KP6A 3ZMTA 3G4SI 2ZBKA 4I0BA 1FMVA 2GXAA 5H6QA 1Z91A 3DQVC 5JFRA 3S32A 1R4MB 2EQRA 2V6CA 2JRTA 1RR8C 3PL8A 1OCOH 3OY9A 1WJBA 1IXRC 2VC0A 3W2VA 3ONQA 1ON2A 4JX5A 3A4CA 4UUVA 3I3LA 1EKEA 1JUSA 2AQFA 1REPC 1U5TA 1PP7U 4QTRA 3PQKA 2R92J 5J40A 2IP2A 4PJ0C 4FT8A 1DPUA 2AO9A 2Q1ZB 4UB6C 1QZZA 3CJRB 2OUMA 2OU2A 4J19A 1U8RA 1IRXA 3QPLA 4C9YA 1VQ5I 1JGGA 4X0GA 2LBFB 2F5FA 3RQ4A 1A6IA 4RGXA 2R7TA 5TISC 1QVUA 2EA2A 5KVRA 3DEEA 2Q2EA 4E7SA 2VT3A 3QPHA 3BROA 2DK5A 2M34A 1ON1A 3FXUA 3IHUA 1IXSB 3JR9A 2HR3A 4C3HJ 1YW8A 1R7JA 1JHFA 5ICFA 2XF5A 3BR3A 3WTYC 3CCEI 3PIOF 2DJIA 1YIJI 2KT0A 3K4LA 1RPWA 5E8IA 2KQRA 5LGTA 3WTXC 3MZHA 2Z16A 4NB5A 4HLYA 2H1KA 2LREA 3COAC 2QSHX 5A2QK 3HSFA 2FNAA 3DV8A 2XAJA 4ZYGA 2E2IJ 1VQMI 1AA7A 3RTRA 3HPGA 1HW5A 1R36A 5EZGA 2CUEA 3PIPF 1I3QJ 3SQNA 5JLWA 4KFCA 1T08B 3SXYA 3EUHC 2XF7A 1IO2A 3BTIA 3WG7H 1MZBA 3HOSA 1FBSA 2E1MC 1HKSA 4EM0B 2VLAA 1F4KA 1V5EA 1V5FA 2M4KA 2DA6A 4FISA 4V2GA 2XRNA 3QYFA 4LLGF 1KONA 5D6EA 4E6KG 4CO8A 2DAOA 4NQWB 2MSYA 3OIQA 3MMYB 3QP6A 2H09A 2VONA 1JI8A 1OQYA 5LGNA 5FLXK 2F6CA 4LIVA 5K7FA 1G3WA 2JVHA 3M8FA 3R0JA 4W1UA 4CGZA 4OMYA 1K78B 1UFMA 2M45A 1D0XA 4O6JA 2R7SA 2JN6A 3ABKH 2NAZA 2VB6A 2PLYA 1UHMA 1IUYA 2DN0A 4OINF 1J5YA 1K4SA 3R6SA 1ZARA 2R7DA 3IAS2 1RRJA 3BT9A 1HW1A 2RN7A 4Q47A 4A5MA 4DBQA 3OR2C 1PP8F 2JPCA 2IRFG 3CCLI 3VYRB 3P9KA 1I50J 2ID3A 1GV5A 1ZG1A 2DBBA 1F36A 3L2CA 1R23A 4CCNA 3S1NJ 3JRCA 2IT0A 5BMZA 2RREA 3RKYA 3EUHA 5E3NA 2HQRA 4DOZA 1KU9A 3CCVI 2JJ7A 2RVCA 2NXNB 3BR0A 4EJTA 1T56A 5D5VB 2EPFA 3RKWA 3GTKJ 1ITYA 4ZYHA 2L54A 4R8HA 1TQPA 1MKMA 5BPIA 5GPAA 2V4JC 2JA5J 3ZQCA 4IL6C 2GZWA 3NQOA 3E5UA 3MN2A 1GHCA 3ZPLA 1Y0NA 4UVBA 5K7ZA 4FTHA 4I09A 3UKGA 4B44A 2P7VB 2M9HA 4XKBA 2GIVA 4D5FA 2W85A 2PN6A 2CO5A 2RNGA 2XB5A 2OCCH 1E3OC 3I59A 3FM5A 2M4GA 1PVEA 1LE8A 3HOTA 3GLLA 3PFIA 5LEJA 3K7AJ 2XROA 3LAJA 1HXDA 3CO6C 4OMZA 1J75A 1FP1D 3HYIA 1W7PA 2DJNA 4PJNA 1BBYA 1RZ4A 5IYDJ 4NBQA 2HZTA 3G1MA 2PEXA 4L0YB 1R4NB 1XDSA 1XGSA 4HPQA 3OS2A 4PGHA 3CMAI 3BC8A 1SD7A 4E7KA 2BY3A 1J7KA 1ETKA 3DU6A 5FKMA 1FBQA 4ZYEA 1IAWA 3DF8A 3CESA 4LD5A 1WWXA 1MGTA 2QWWA 3EETA 4RAFA 3BDDA 1ZK8A 1FYLA 2XVCA 4YFKF 3SZTA 2LFBA 4RM2A 5FGMA 2NVQJ 3L09A 2VUMJ 4WK8F 1BW6A 2JWTA 1FZPB 5K5RA 4X6AJ 4BE2A 1FSEA 1YW7A 2QSFX 5ERIA 1ZKGA 2DDAA 2P4WA 5D4SA 3REOA 4ZZLA 2DOEA 2E2HJ 2ICWG 5D6FA 5BNGA 1T2KA 3OIPA 3ESWB 4BUPA 4R79A 1OKRA 3L2WA 3HRMA 3ZQHA 3CDIA 3E6MA 4OIOF 4S04A 3CJNA 1JKOC 5FJ8J 5EEGA 1VQ8I 2VL8A 5D8LB 1FOYA 1S5LC 1XSVA 3KLNA 4FQGA 4N9IA 2XPUA 1SC7A 1ETOA 2VODA 3FXRA 4HX4A 2OZUA 4J01A 4IHYA 3IP4B 1YIOA 4V19K 5EZHA 2VXDA 4DYRA 1D5VA 4N4NB 4GDFA 3JAMK 1ZTRA 3M8EA 3CCMI 3BQYA 2BEOA 2EJRA 4ESFA 1IV8A 4ZDPA 2ZJPF 5ILVA 2HTSA 4HX8A 2BW3A 3H5AA 1W7PD 1QU3A 3CF2A 4XSZF 5IP6A 4KN7X 4AYBA 2HQNA 5AONA 2CW7A 3CTAA 3S8PA 3IKVA 5BS6A 1PDNC 2DA3A 2DMNA 2KRHA 3C1DA 5L3CA 4A3GJ 2W24A 1J59A 2W4SA 3KZIC 3RKQA 4LG3A 2H27A 2EZIA 2MLKA 5J1UA 2ISZA 1LUJB 5F04A 3I71A 3DTEA 3KX2A 5DM7F 5L3GA 5E8GA 2V6EA 2OA4A 3DU5A 2EZKA 3SZGA 2ZSHB 2BHZA 4IKFA 3QPSA 2CH0A 2AQEA 4D9JA 5FROA 4G12A 3HXLA 2AXLA 3FKIJ 3G1LA 3O8HA 4B3XA 1B9NA 2L9SA 1ZGJA 2A69F 4MGRA 2Y2ZA 2HGCA 4KISA 3ELKA 4ZH4F 2GM4A 2E71A 1F43A 3V8JA 4D5CA 1X3UA 2JRMA 2K27A 3CLOA 3E3VA 3PQJA 5E18F 5L3FA 2P6TA 2GXBA 1FOKA 3M1CA 4I99C 1GT0C 2RV8A 4G7OF 2DYSH 2UXXA 4GYIA 4XL9A 5E3MA 4HRIA 4TV7A 1JGSA 2MD5A 4NNJA 1ZG3A 2VE9A 5J8FA 4Q4ZF 2KJCA 5LEKA 2OTJI 3W2AA 1LVAA 5H20A 4DZPA 2B9SA 2LBFA 4M3DA 1R22A 2CQ7A 4KT5C 4M3EA 3AL0C 3CMMA 3GFMA 4CXFA 1HSJA 2DI3A 1G3TA 2L3DA 2QSGX 2BOLA 3K4KA 3W2WA 2L9VA 3OL4A 5LLQA 1X1BA 2R4GA 3JRGA 2JUGA 2FX0A 1HOMA 4Y33A 4OWRB 2GA2A 3K4MA 4CH7A 1GVJA 5HS8A 2VASA 2EZLA 5EJCA 2OC6A 4I7HA 3OYKA 5DCMB 4IX7A 4ZTFA 4CSWA 1GXQA 1XMAA 4ENJA 2EV0A 5DCFA 1T95A 2LY2A 4PK4A 3HUGB 1SEUA 4UB8C 2M8GX 2KHMA 1G6NA 4XICA 5D5XB 1AWCA 1HCRA 2P5KA 3F72A 5L3DA 4DBRA 4ZC3A 3JCUC 1EH7A 4BE0A 4MFDA 1BJZA 4P55A 2ESHA 4D7NA 1SFOJ 1OCZH 2NYXA 3U9GA 4AUXA 1BW5A 1RNLA 4MTDA 1HSTA 1IN4A 2G0EA 4EGZA 1MMAA 1YHQI 1WVRA 3KP6A 1SD5A 4YIIA 3BG9A 3LOCA 4IHVA 5JVGF 1ZRCA 2Z1DA 2CMPA 3GMEA 1VQ6I 2JSCA 2P0WA 2DA5A 1MBHA 2MH2A 3F3XA 2V1NA 4S0HB 2QQAA 1XDUA 3V7RA 4L9TA 1NTCA 2CW8A 1LJ9A 1FSHA 2V1DA 2CGPA 2H8RA 2R7FA 3EDPA 1UG2A 4U7DA 3J7AO 3MVPA 2B7EA 2WAFA 2NS0A 1G3YA 2L02A 3ZQLA 5EGOB 1YLFA 4LLLA 4HF2A 1BI2A 2DK8A 4XNFA 4BJ5C 5H2FC 3L7WA 2PJRA 3J7AY 2XUBA 2TRTA 3QOEA 2E60A 2QM3A 1XMKA 2VBWA 4ABZA 1VF9A 1X3WB 5LRSA 2DA4A 3CZ6A 5TRDA 1P4XA 2OAZA 5E1ZB 4ZDOA 5ICCA 1B72A 3ZGKA 4A5NA 2A07F 4F55A 1FLIA 3UNGC 1HDPA 1MD0A 1QPIA 1JHHA 3U1KA 1BR2A 3WU2C 1IN5A 4AVZA 4M3BA 3MKYB 2W25A 3FHZA 2E35A 3GLXA 3LQQA 1Y8RB 2VC1A 2E1NA 4HSRA 4KIFA 2FD5A 3H35A 3KP2A 1IDYA 4M9SA 4N9HA 4O5VA 2N8GA 4A3DJ 4ZYAA 1NK3P 2JT1A 5IT9Z 2ZFUA 1JTXA 1K83J 5IOZA 5M5XJ 4B4CA 1NHAA 2CQNA 1XC5A 2G7UA 2WTEA 1Y1WJ 1QBJA 1EH8A 1T33A 5FKNA 1WQ2A 2A05A 2M1BA 4RB2C 2O7OA 1SFUA 2O8KA 2D45A 3RPUA 1MDMB 4R1HA 2KIMA 4H4KC 1IC8A 1ZLJA 5EG0B 1H89C 2W7NA 2R7VA 4BQNA 1D5YA 2XPVA 3CUOA 3LSKA 5IYCJ 3MKZA 4G8XA 3W6JB 5HNHA 3GVAA 3Q0VA 1QGPA 2M87A 5GTIC 1DGWY 2Z2SB 1MBJA 2D1HA 3TO9A 1D0YA 1R71A 4XLAA 2ECCA 2MA3A 1QHHD 3M3YJ 3IH2A 3A01A 3B6AA 2STTA 3DXJF 2MYSA 1X2MA 2JUCA 3AG4H 3WGHA 4HG2A 4BEHA 3IL2A 2V26A 1R1VA 5M3MJ 3KETA 1ETVA 4PFPA 1LVKA 2ZXWH 1IRZA 3E0JB 3QP5A 5E3LA 1Z6RA 3L00A 2XV4S 3KE2A 1R5ID 2JA6J 2ZB9A 4XOTA 5GPCA 4KYWA 3CO7C 3QYBA 3AFHA 2COMA 4F3QA 5ICGA 4BGDA 1BIBA 2YS9A 1H8AC 2PMHA 2OTLI 4O3MA 1T39A 3LL7A 1K7AA 1SAUA 2BBYA 2JVGA 2UXNA 4AIDA 1DP7P 4WCGA 1UCRA 3CMEI 3Q5FA 3HSRA 2HOEA 4MLOA 4CUGA 2I8DA 2QGUA 3BR6A 3SDGA 2BY2A 3IRRA 5LRRA 2GAUA 1S8NA 1O4XA 3WTZA 2E7WA 1K79A 1W36D 3ECHA 3EYYA 3WTTC 3GZ6A 1U0JA 1MNDA 5DUIA 5DDGA 4E7IA 3FF5A 2VPLA 3M9AA 1JKRC 1TWCJ 1S29A 4OIPF 3CJQB 3HOUJ 3S93A 1WJ5A 2WV0A 4OU0A 2X1CA 3BTJA 4EQQA 3PM1A 1S9HA 4UVCA 5D8KB 1USSA 3DPLC 3OYGA 4BQQA 4PZJA 4P9UA 2FQ3A 2FJ1A 4I76A 4DW6A 5B5EC 3OYBA 1RR7A 2DT6A 3E6CC 2UWMA 3VYSB 4QPOA 4L9NA 2LMDA 3C7JA 1A6QA 1YRNB 3L1PA 2X1DA 1OMIA 3J80K 1R1TA 4WX9A 3WU1B 2ZKZA 2HOTA 2FMLA 3GX4X 3GXOA 2ZXJA 4PJLA 2E1CA 4KN4X 1U5TC 3OV8A 3K2AA 5F64A 3QODA 3F8MA 4XORA 3S16J 4ESJA 1TNSA 2ZXHA 2AXTC 3ZMDA 3I58A 3RDIA 3VB2A 1VQ7I 2M5WA 1XS9A 2GBYA 2KIFA 2OBPA 4DYCA 2LY9A 1N25A 4NC7A 2ESNA 3RPQA 1QHGA 4EM2A 1R1UA 2HDDA 1E3HA 3WE3A 2K86A 4EATA 5TJJA 3OYLA 1VQ9I 4XM3A 2MH9A 1IW7F 1XG1A 2E1OA 4A3IJ 4LK0F 3JTGA 3RZOJ 4ZZDA 2K4JA 3HHGA 5JVTA 3MQ0A 3E5XA 2I10A 3O8GA 2HEOA 2A3SA 2BVLA 1Y1VJ 1KYZA 3K4NA 3VFZA 1X1CA 3BZ6A 1W5TA 2OJED 2K3PA 2H1LA 1EV7A 1BJAA 1BR4A 3TO6A 4BE1A 4G7ZF 3QQAA 3QAHA 4XLEA 3J81Z 3H0DA 1OR7A 3ZCOA 4UUSB 4CCMA 1Z3XA 3FK6A 1SD4A 3OS1A 3EYIA 1FYKA 3OYMA 2DO7A 3N4MA 1IUFA 2P81A 3MD2A 3SFZA 4M6YA 3DEWA 4HSTA 1S7EA 2K9NA 4AIJA 3PNYA 3WGIA 2L2OA 5C4JJ 1NK2P 1DQUA 3B02A 4KDPA 3ABMH 5DS9A 1JT6A 2XC7A 2VOPA 3E1SA 1WSUA 3I56I 2HVRA 2L9RA 2A61A 2CS3A 3GBGA 3NARA 1XPXA
chains in the Genus database with same CATH topology
1FPQA 1LNWA 2HKOA 1MJ9A 3LQRA 3GFIA 5KK1A 4RB0A 2QVOA 3ABUA 2P8TA 1CGPA 4ENMA 1QPMA 3ZP5A 3T1BA 5A2QZ 3ROUA 3WU0A 4HYEA 4EMSA 3U1DA 4AD9A 1CF7B 5DCMA 3MZYA 2HDCA 2ZMEB 2HKXA 3H3UA 2IW5A 2VXZA 3GYHX 1ODDA 1V4RA 4P5OA 5HOOA 4A12A 3FXQA 3ULQB 2RGVA 2P5LC 2M8EA 5FLXZ 2HFHA 2Q8KA 1IRGA 2PMUA 1D8KA 1I5ZA 1IN6A 2DPUA 4G94A 2MLGA 2Z3YA 1VTNC 4IRIA 2F2EA 3K1NA 5K5OA 1ONVA 3V4GA 3HRTA 3F22A 1Z9CA 1C0WA 1ZHFA 4OIRF 4MEXF 5LHGA 3DFGA 1B6AA 2W84A 4LGWA 2NRAC 4ENNA 2BGCA 3TDZC 3HIFA 3CUQA 3U2RA 5HDGA 2DW4A 3GUDA 4EJUA 5HDKA 2PG4A 2FE3A 4BXUA 3F6VA 3P9CA 3FMQA 1OYYA 5AIQA 2C6YA 1S7OA 1FT9A 2LDUA 2VT2A 4DQ2A 2F5DA 4HDUA 2QBYB 4YG2F 3WTWC 3K2ZA 5LGUA 2NNNA 2L4AA 2JPBA 2H6CA 2YR2A 4IRHA 4FX4A 3ML6A 3AAFA 4RB3C 5BOXA 1F1ZA 4HLXA 2MC3A 5CVUA 1SAXA 4HV5A 5CVJA 4KIBA 4U7BA 3M7GA 3KLOA 1QNTA 1T0FA 3WE2A 4Y17A 4EJOA 4IVNA 5FD6A 3BY6A 3VODA 2ZCWA 2YPRA 3D0SA 3WODF 1D3YA 1G4DA 2IA0A 2A5YB 3K69A 4RGUA 3JAMZ 2D2WA 4ENKA 4Y13A 3V8KA 2X0LA 3T0YA 3LA2A 1YS7A 5ILUA 3KP3A 2FU4A 2LF8A 2X4HA 4RB1A 2EB7A 4LG0B 3TGNA 5LHIA 3BJOA 1FC3A 2A6EF 1RIOH 1XSDA 2ACJA 4HX7A 3RKXA 3HRUA 3IWZA 1U78A 1YS6A 1BIAA 4ESBA 1R00A 2CWEA 4PDKA 1IF1A 2EFQA 2STWA 5D5UB 4M72A 4K2EA 3HHHA 1KQ9A 3KP7A 1SFXA 1XSXA 3F8NA 4U88A 3E97A 4DNCA 3GEZA 1TQMA 1J2XA 4RGSA 4L9JA 2G7HA 3T5XA 1YFHA 4IHSA 1BI3A 3ZMUA 4A0XA 1U5TB 2EFWA 1RUNA 3KEOA 4ON0A 4L5IA 2CYYA 3K9TA 4U0YA 2PJPA 4Z2YA 3GO5A 4GXOA 4HA8A 1S7AA 2F5EA 2EFNA 2EFPA 4CZZA 1R5HA 4MNUA 4BQAA 4B09A 3FMSA 2V9VA 2YX4A 4E70A 3K1MA 1LEAA 1AOYA 3MAJA 2DTRA 1S3JA 3LFKA 5LHHA 2D1VA 2J5OA 4XRFA 1XGNA 3ZQ7A 2O61A 2HTJA 4IPAA 3VOEA 1FX7A 3HSEA 4NQWA 5IT3A 1QO0D 2EV5A 2FBHA 4YIFA 5DD4A 5AIPA 2HWVA 1K78A 2GA1A 3F21A 3DKWA 3E6BA 2XAFA 5HLIA 3GF2A 4LLNA 3GZ5A 2GWRA 3F8FA 1U3EM 4I98B 5JR3A 3P7NA 4JK1X 1I27A 1SMYF 2HYGD 1KU3A 5HDNA 2IPQX 1O7FA 4MHGA 3MCZA 3I5UA 4WXDA 1YO5C 1DUXC 2PFBA 1PUEE 5DYMA 4UVAA 1BN5A 3WG9A 3V7SA 4XLNF 2K7LA 5ILSA 2M30A 1F5TA 1IN7A 2H6BA 3QRFF 2RDPA 3ZMVA 4HW0A 5DV5A 4LJZF 4OOIA 4KMFA 5EEHA 1HQCA 1YW9A 1HW2A 2YU3A 4NHJA 3NEUA 4F7ZA 3T8RA 2H94A 4BHBA 1ZH5A 2ETHA 4M9ZA 4IXAA 1S6LA 3I59B 4YFXF 2F5CA 2XGXA 3Q9SA 2CW0F 4M73A 3TO7A 5F1RA 1BC7C 3K0LA 3MFKA 1HBXG 3HTUA 1KQ8A 2QQBA 1TNTA 2QENA 3ECOA 3DP7A 2Z99A 5DD8A 4GGGA 1XCBA 1U2WA 2CSOA 2QLZA 3ZMZA 3TKYA 3I0TA 5HVQC 3R4KA 1JE8A 3CDHA 2O3FA 4N0BA 1UB9A 4M74A 4AVPA 3GW2A 4A0YA 1DDNA 3IC7A 2Y0MA 1H0MA 4PGGA 3J80Z 1STZA 4L9VA 1TBXA 1TW2A 1XN7A 4M6XA 3BJAA 4L5JA 2FNPA 1WKMA 3KFWX 1SFEA 3WTSC 4G9YA 2RQPA 2LF7A 3I53A 5ED4A 3ABTA 1IRFA 5BPDA 3E5QA 1DPRA 1Z6TA 1O3QA 3N97A 1E2XA 1U6GA 2A68F 4MTEA 3SZPA 4B8XA 2DFIA 3WTVC 3SHFA 2IJLA 1T38A 4KNYA 2K02A 2GXGA 3HTSB 2VN2A 4MEYF 2ISYA 3WTUC 2JZYA 4HBLA 1G3SA 5CJ9A 3TOBA 4XBFA 2PQ8A 2IA1A 3TQNA 1P4AA 1I1GA 1RUOA 1LDKB 2V1UA 4GYGA 2ELHA 4AWXB 1KU7A 2PBIA 1BI0A 5FFXA 4ZYDA 3ZN0A 3F8BA 5L3BA 3J81K 2XIGA 5CYVA 1V3FA 1ULYA 2Q0OA 3KP4A 3ZN1A 4EJWA 2AS5F 4H0EA 4EGYA 1FBUA 4WXCA 2JTVA 1BM9A 3QU3A 1LEBA 2CFXA 2FBIA 1ZLKA 5H6RA 1P92A 1XCVA 2RKHA 3HUGA 2MBFA 2HYFA 4Q48A 4BHCA 4G6QA 2KKOA 5HS7A 1XD7A 2EFOA 4P9FA 2FEZA 3CUQC 2Z5UA 4HZFA 2DQRA 1R5GA 2Y75A 4L18B 1ZGAA 3BP8A 3O3KA 4XSXF 3VEPA 3MWMA 1E17A 3O2PE 3RJPA 3TDUC 1TLHB 4HAMA 4GCVA 4WXHA 3C18A 4QLCU 1KU2A 4QWQA 4XLPF 3HRSA 6PAXA 3QPTA 2A6HF 1Z7UA 3JSOA 2O8XA 3TOAA 4Q5SF 3Q9VA 3IKTA 1KQ0A 2QUFA 2EWNA 3KCCA 2BE5F 2DT5A 3GWZA 4HV6A 4RS8A 4HDVA 5E17F 5LBQA 2L01A 1Q1HA 1O3RA 2FMYA 3G3ZA 2VBYA 4RAZA 4HOBA 1P4WA 2RC4A 4CHUA 1O57A 5JI6A 1SMTA 4MQ9F 1MDMA 5CVIA 4IRGA 4UV8A 4HQEA 2QZ8A 3IRQA 2ADUA 3ZMSA 3MEXA 4AIKA 4MQVA 4M9XA 1W4MA 4UXNA 1IXCA 2DQLA 4WWCA 3W6KB 2ZNZA 2UZKA 5L3EA 3I4PA 5BQTA 2Z9OA 2TDXA 1MJAA 4I0AA 3FX3A 2XKPA 3C3WA 2EK5A 2FA5A 4CDGA 2KIUA 1O7LA 1OYWA 1WI9A 2FXAA 1BI1A 1H9TA 2NNYA 2XHKA 2E7XA 2OD5A 3G73A 1QQIA 1FNNA 1KA8A 1MJBA 1B9MA 2BYVE 2B0LA 4CICA 2XAGA 3P9IA 1IN8A 3BPVA 3I64A 2WWYA 2KJBA 3KZYA 3D5LA 5E1WA 2LKPA 4BH9A 4BHPA 4HF1A 5DUKA 5J6XA 2XAHA 1FP2A 1TTYA 5J8CA 4ASNA 1H9GA 4LB6B 4CYDA 2YX7A 4A2UA 5JHUA 1T98A 3EQLF 5D4RA 2EV6A 4I02A 2Y48A 2KRFA 1K6OA 1BC8C 2FRHA 1TQIA 3KP5A 3WGGA 4ETSA 5HS9A 2DLLA 5E1XA 2QQ9A 2IA2A 5DEQA 4S05A 3K1PA 1LDDA 4BNCA 2VOOA 3RYPA 3R61A 5F6FA 2FSWA 3RIRA 2P7CB 3L9FA 5K5QA 1YQAA 1O3TA 2P5VA 2RNJA 2BV6A 1FYMA 4WF2A 3BOQA 4KIGA 1XB4A 2CG4A 4HQMA 4LB5A 3JTHA 1Z05A 3OOPA 4D0PA 5K1YA 3V8LA 1ZRFA 1WRJA 4HF0A 1Y0UA 1KGSA 2GQQA 1CF7A 2VBXA 4KICA 3FM3A 2FOKA 2OZ6A 3O6BB 4BAYA 1EH6A 2K4BA 3BJ6A 4KUMA 1F9NA 5CLSA 4RGRA 1R58A 2W57A 2ZMEA 1SD6A 3F6OA 3DPTA 5CVRA 3JSPA 1YG2A 3RYRA 4JBAA 3H92A 3BWGA 3RI4A 1OYIA 2LNBA 3R0AA 4L0ZB 3LA7A 3V7CA 5ICEA 1T6SA 3R60A 3NRVA 2IVMA 4LMYA 3LAPA 3B73A 1XGMA 4U0VA 5FD5A 2ZNYA 2P6SA 4IHTA 3KZZA 5HLGA 1J9IA 2ZO4A 4RAYA 4AIHA 1BOAA 4IJAA 1P6RA 1I1SA 2V79A 3M1EA 3ISPA 4YFNF 3GFJA 1ZYRF 1FWZA 3IWFA 4UNOA 1YTYA 2WC2A 1UHWA 5FB2A 4PCQA 5FO5A 3CUQB 1LB2A 3ERED 2Z33A 2XKOA 5D5WB 4KA4A 1RI7A 1XGOA 2XAQA 1ZRDA 4U0WA 3QU6A 2ZFWA 4BYYA 2O03A 2FBKA 1ZG5A 3FMRA 5IT9K 3GFLA 1YYVA 2QBYA 1ZN2A 1D8JA 4OIQF 5HLHA 1W7PB 2HS5A 4G6DA 1Z1DA 2J5PA 3H3ZA 2XASA 5E20A 1FY7A 2QYOA 4I2OA 2O0YA 1TW3A 2R3SA 3JW4A 1L3LA 2CQKA 1I6XA 3BPXA 4Y15A 4IF4A 1W5SA 5FFZA 3E6DA 4KMUX 4EV0A 1J0RA 1KYWA 1O3SA 1QZYA 4A0ZA 4A6DA 1JXSA 4GO1A 4A6EA 3LSTA 3S2WA 1ZAOA 4P96A 2V1XA 3F8CA 3LWFA 2DU9A 2VE8A 2O6GE 3LA3A 1OPCA 2LSOA 1L0OC 4LK1F 1USTA 3T8TA 2OQRA 4LG0A 4I01A 1ZREA 4FX0A 1IZ1A 4UV9A 1B59A 3QOPA 2G9WA 2EA4A 1GXPA 4M71A 2DPDA 3F23A 4JQFA 2VBZA 1B1BA 1B4AA 3I54A 1LQ1A 4FHTA 4EVIA 2FF4A 3FWEA 2OQGA 4EJVA 1A04A 2ZJ2A 4UHTA 1HKQA 4LFUA 1LDJA 1P2FA 3FZVA 3DEUA 5CVVA 1HKTA 4EM1A 3KEQA 4G7HF 2L4MA 2YSRA 3ZMTA 2ZBKA 4I0BA 5H6QA 1Z91A 3DQVC 5JFRA 2V6CA 2JRTA 1IXRC 2VC0A 1ON2A 4UUVA 1REPC 1U5TA 1PP7U 3PQKA 2IP2A 4FT8A 1DPUA 1QZZA 2OU2A 1U8RA 2F5FA 4RGXA 2EA2A 5KVRA 2Q2EA 2VT3A 3QPHA 3BROA 2DK5A 1ON1A 3FXUA 3IHUA 1IXSB 2HR3A 1YW8A 1R7JA 1JHFA 5ICFA 3WTYC 5E8IA 5LGTA 3WTXC 3MZHA 4HLYA 4NB5A 3COAC 5A2QK 3HSFA 2FNAA 3DV8A 2XAJA 4ZYGA 3RTRA 1HW5A 1R36A 3SQNA 4KFCA 3SXYA 3HOSA 1MZBA 1FBSA 1HKSA 4EM0B 1F4KA 2XRNA 4LLGF 5D6EA 4CO8A 2DAOA 3QP6A 2H09A 2VONA 5LGNA 5FLXK 1G3WA 3M8FA 3R0JA 4CGZA 4OMYA 1K78B 1UFMA 2M45A 4O6JA 2NAZA 2PLYA 1UHMA 1IUYA 4OINF 1J5YA 3R6SA 1ZARA 2R7DA 4Q47A 1HW1A 2RN7A 4A5MA 1PP8F 2JPCA 2IRFG 3P9KA 1ZG1A 2DBBA 3L2CA 1R23A 2IT0A 5BMZA 3RKYA 3EUHA 2HQRA 1KU9A 2RVCA 4EJTA 5D5VB 3RKWA 4ZYHA 2L54A 4R8HA 1TQPA 1MKMA 5BPIA 2GZWA 3NQOA 3E5UA 1GHCA 3ZPLA 4UVBA 4I09A 2P7VB 2GIVA 2W85A 2PN6A 2CO5A 3I59A 3FM5A 3HOTA 3PFIA 5LEJA 2XROA 3LAJA 3CO6C 1HXDA 4OMZA 1J75A 1FP1D 3HYIA 1W7PA 1BBYA 1RZ4A 2HZTA 2PEXA 4L0YB 1XDSA 1XGSA 4PGHA 1SD7A 1J7KA 4ZYEA 1FBQA 1IAWA 3DF8A 4LD5A 1WWXA 1MGTA 2QWWA 3EETA 3BDDA 1FYLA 2XVCA 4YFKF 3SZTA 5FGMA 3L09A 4WK8F 1FZPB 5K5RA 1FSEA 1YW7A 5ERIA 2P4WA 5D4SA 3REOA 4ZZLA 5D6FA 1T2KA 4R79A 1OKRA 3HRMA 3E6MA 4OIOF 4S04A 3CJNA 5EEGA 5D8LB 1XSVA 3KLNA 4N9IA 2VODA 3FXRA 4HX4A 2OZUA 1YIOA 1D5VA 3JAMK 3M8EA 2BEOA 2EJRA 4ESFA 5ILVA 2HTSA 4HX8A 1W7PD 4XSZF 4KN7X 2HQNA 5AONA 3CTAA 5BS6A 3IKVA 1PDNC 3C1DA 5L3CA 2W24A 1J59A 2H27A 2MLKA 2ISZA 3I71A 5L3GA 5E8GA 2OA4A 2AXLA 1B9NA 4MGRA 1ZGJA 2A69F 2HGCA 3ELKA 4ZH4F 3V8JA 1X3UA 2K27A 3CLOA 3E3VA 3PQJA 5E18F 5L3FA 2P6TA 2GXBA 1FOKA 2RV8A 4G7OF 2UXXA 4GYIA 4TV7A 1JGSA 2MD5A 2VE9A 1ZG3A 5J8FA 4Q4ZF 2KJCA 5LEKA 1LVAA 5H20A 1R22A 4KT5C 3GFMA 4CXFA 1HSJA 2DI3A 1G3TA 2L3DA 5LLQA 2GA2A 1GVJA 5HS8A 4I7HA 5DCMB 1GXQA 1XMAA 4ENJA 2EV0A 5DCFA 1G6NA 5D5XB 1AWCA 2P5KA 3F72A 5L3DA 1EH7A 4P55A 2ESHA 2NYXA 3U9GA 1RNLA 4MTDA 1HSTA 1IN4A 4EGZA 3KP6A 1SD5A 4YIIA 1ZRCA 2JSCA 2MH2A 3F3XA 2QQAA 1XDUA 3V7RA 4L9TA 1LJ9A 1FSHA 2V1DA 2CGPA 2R7FA 3EDPA 4U7DA 3J7AO 2NS0A 1G3YA 2L02A 1YLFA 4LLLA 4HF2A 1BI2A 2DK8A 3L7WA 2XUBA 2QM3A 1XMKA 2VBWA 5LRSA 5TRDA 1P4XA 2OAZA 5E1ZB 5ICCA 4A5NA 2A07F 1FLIA 1MD0A 1JHHA 1IN5A 2W25A 3FHZA 3GLXA 3LQQA 2VC1A 2E1NA 4KIFA 3KP2A 4M9SA 4N9HA 4O5VA 2JT1A 5IT9Z 1NHAA 2G7UA 2WTEA 1QBJA 1EH8A 1WQ2A 2M1BA 4RB2C 1SFUA 2D45A 3RPUA 1MDMB 4R1HA 2KIMA 1ZLJA 3CUOA 4G8XA 3W6JB 3GVAA 1QGPA 2M87A 2D1HA 3TO9A 2MA3A 2STTA 3DXJF 3WGHA 3IL2A 1R1VA 3KETA 3QP5A 1Z6RA 3L00A 2XV4S 3KE2A 4KYWA 3CO7C 2COMA 5ICGA 1BIBA 2PMHA 4O3MA 1T39A 1K7AA 2BBYA 2UXNA 1DP7P 4WCGA 1UCRA 3Q5FA 3HSRA 2HOEA 3IRRA 5LRRA 2GAUA 1S8NA 3WTZA 2E7WA 1K79A 3ECHA 3EYYA 3WTTC 3GZ6A 5DUIA 5DDGA 3FF5A 3M9AA 1S29A 4OIPF 2WV0A 4OU0A 4EQQA 5D8KB 4UVCA 1USSA 3DPLC 4PZJA 4P9UA 2FQ3A 3E6CC 2UWMA 4L9NA 3C7JA 3WU1B 3J80K 1OMIA 1R1TA 4WX9A 2ZKZA 2FMLA 3GX4X 3GXOA 2ZXJA 2E1CA 4KN4X 1U5TC 3OV8A 5F64A 3F8MA 4ESJA 1TNSA 3ZMDA 3I58A 3RDIA 3VB2A 2M5WA 2OBPA 2KIFA 2ESNA 3RPQA 4EM2A 1R1UA 3WE3A 2K86A 5TJJA 2MH9A 1IW7F 4LK0F 3JTGA 4ZZDA 2K4JA 3HHGA 5JVTA 3MQ0A 3E5XA 2HEOA 2A3SA 1KYZA 3VFZA 3BZ6A 1W5TA 1EV7A 1BJAA 3TO6A 4G7ZF 3QAHA 3J81Z 1OR7A 1SD4A 3EYIA 1FYKA 2DO7A 3N4MA 3SFZA 4M6YA 4AIJA 3WGIA 3B02A 4KDPA 2VOPA 1WSUA 2A61A 2PI0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FPQ A;  1LNW A;  2HKO A;  1MJ9 A;  3LQR A;  3GFI A;  5KK1 A;  4RB0 A;  2QVO A;  3ABU A;  2P8T A;  1CGP A;  4ENM A;  1QPM A;  3ZP5 A;  3T1B A;  5A2Q Z;  3ROU A;  3WU0 A;  4HYE A;  4EMS A;  3U1D A;  4AD9 A;  1CF7 B;  5DCM A;  3MZY A;  2HDC A;  2ZME B;  2HKX A;  3H3U A;  2IW5 A;  2VXZ A;  3GYH X;  1ODD A;  1V4R A;  4P5O A;  5HOO A;  4A12 A;  3FXQ A;  3ULQ B;  2RGV A;  2P5L C;  2M8E A;  5FLX Z;  2HFH A;  2Q8K A;  1IRG A;  2PMU A;  1D8K A;  1I5Z A;  1IN6 A;  2DPU A;  4G94 A;  2MLG A;  2Z3Y A;  1VTN C;  4IRI A;  2F2E A;  3K1N A;  5K5O A;  1ONV A;  3V4G A;  3HRT A;  3F22 A;  1Z9C A;  1C0W A;  1ZHF A;  4OIR F;  4MEX F;  5LHG A;  3DFG A;  1B6A A;  2W84 A;  4LGW A;  2NRA C;  4ENN A;  2BGC A;  3TDZ C;  3HIF A;  3CUQ A;  3U2R A;  5HDG A;  2DW4 A;  3GUD A;  4EJU A;  5HDK A;  2PG4 A;  2FE3 A;  4BXU A;  3F6V A;  3P9C A;  3FMQ A;  1OYY A;  5AIQ A;  2C6Y A;  1S7O A;  1FT9 A;  2LDU A;  2VT2 A;  4DQ2 A;  2F5D A;  4HDU A;  2QBY B;  4YG2 F;  3WTW C;  3K2Z A;  5LGU A;  2NNN A;  2L4A A;  2JPB A;  2H6C A;  2YR2 A;  4IRH A;  4FX4 A;  3ML6 A;  3AAF A;  4RB3 C;  5BOX A;  1F1Z A;  4HLX A;  2MC3 A;  5CVU A;  1SAX A;  4HV5 A;  5CVJ A;  4KIB A;  4U7B A;  3M7G A;  3KLO A;  1QNT A;  1T0F A;  3WE2 A;  4Y17 A;  4EJO A;  4IVN A;  5FD6 A;  3BY6 A;  3VOD A;  2ZCW A;  2YPR A;  3D0S A;  3WOD F;  1D3Y A;  1G4D A;  2IA0 A;  2A5Y B;  3K69 A;  4RGU A;  3JAM Z;  2D2W A;  4ENK A;  4Y13 A;  3V8K A;  2X0L A;  3T0Y A;  3LA2 A;  1YS7 A;  5ILU A;  3KP3 A;  2FU4 A;  2LF8 A;  2X4H A;  4RB1 A;  2EB7 A;  4LG0 B;  3TGN A;  5LHI A;  3BJO A;  1FC3 A;  2A6E F;  1RIO H;  1XSD A;  2ACJ A;  4HX7 A;  3RKX A;  3HRU A;  3IWZ A;  1U78 A;  1YS6 A;  1BIA A;  4ESB A;  1R00 A;  2CWE A;  4PDK A;  1IF1 A;  2EFQ A;  2STW A;  5D5U B;  4M72 A;  4K2E A;  3HHH A;  1KQ9 A;  3KP7 A;  1SFX A;  1XSX A;  3F8N A;  4U88 A;  3E97 A;  4DNC A;  3GEZ A;  1TQM A;  1J2X A;  4RGS A;  4L9J A;  2G7H A;  3T5X A;  1YFH A;  4IHS A;  1BI3 A;  3ZMU A;  4A0X A;  1U5T B;  2EFW A;  1RUN A;  3KEO A;  4ON0 A;  4L5I A;  2CYY A;  3K9T A;  4U0Y A;  2PJP A;  4Z2Y A;  3GO5 A;  4GXO A;  4HA8 A;  1S7A A;  2F5E A;  2EFN A;  2EFP A;  4CZZ A;  1R5H A;  4MNU A;  4BQA A;  4B09 A;  3FMS A;  2V9V A;  2YX4 A;  4E70 A;  3K1M A;  1LEA A;  1AOY A;  3MAJ A;  2DTR A;  1S3J A;  3LFK A;  5LHH A;  2D1V A;  2J5O A;  4XRF A;  1XGN A;  3ZQ7 A;  2O61 A;  2HTJ A;  4IPA A;  3VOE A;  1FX7 A;  3HSE A;  4NQW A;  5IT3 A;  1QO0 D;  2EV5 A;  2FBH A;  4YIF A;  5DD4 A;  5AIP A;  2HWV A;  1K78 A;  2GA1 A;  3F21 A;  3DKW A;  3E6B A;  2XAF A;  5HLI A;  3GF2 A;  4LLN A;  3GZ5 A;  2GWR A;  3F8F A;  1U3E M;  4I98 B;  5JR3 A;  3P7N A;  4JK1 X;  1I27 A;  1SMY F;  2HYG D;  1KU3 A;  5HDN A;  2IPQ X;  1O7F A;  4MHG A;  3MCZ A;  3I5U A;  4WXD A;  1YO5 C;  1DUX C;  2PFB A;  1PUE E;  5DYM A;  4UVA A;  1BN5 A;  3WG9 A;  3V7S A;  4XLN F;  2K7L A;  5ILS A;  2M30 A;  1F5T A;  1IN7 A;  2H6B A;  3QRF F;  2RDP A;  3ZMV A;  4HW0 A;  5DV5 A;  4LJZ F;  4OOI A;  4KMF A;  5EEH A;  1HQC A;  1YW9 A;  1HW2 A;  2YU3 A;  4NHJ A;  3NEU A;  4F7Z A;  3T8R A;  2H94 A;  4BHB A;  1ZH5 A;  2ETH A;  4M9Z A;  4IXA A;  1S6L A;  3I59 B;  4YFX F;  2F5C A;  2XGX A;  3Q9S A;  2CW0 F;  4M73 A;  3TO7 A;  5F1R A;  1BC7 C;  3K0L A;  3MFK A;  1HBX G;  3HTU A;  1KQ8 A;  2QQB A;  1TNT A;  2QEN A;  3ECO A;  3DP7 A;  2Z99 A;  5DD8 A;  4GGG A;  1XCB A;  1U2W A;  2CSO A;  2QLZ A;  3ZMZ A;  3TKY A;  3I0T A;  5HVQ C;  3R4K A;  1JE8 A;  3CDH A;  2O3F A;  4N0B A;  1UB9 A;  4M74 A;  4AVP A;  3GW2 A;  4A0Y A;  1DDN A;  3IC7 A;  2Y0M A;  1H0M A;  4PGG A;  3J80 Z;  1STZ A;  4L9V A;  1TBX A;  1TW2 A;  1XN7 A;  4M6X A;  3BJA A;  4L5J A;  2FNP A;  1WKM A;  3KFW X;  1SFE A;  3WTS C;  4G9Y A;  2RQP A;  2LF7 A;  3I53 A;  5ED4 A;  3ABT A;  1IRF A;  5BPD A;  3E5Q A;  1DPR A;  1Z6T A;  1O3Q A;  3N97 A;  1E2X A;  1U6G A;  2A68 F;  4MTE A;  3SZP A;  4B8X A;  2DFI A;  3WTV C;  3SHF A;  2IJL A;  1T38 A;  4KNY A;  2K02 A;  2GXG A;  3HTS B;  2VN2 A;  4MEY F;  2ISY A;  3WTU C;  2JZY A;  4HBL A;  1G3S A;  5CJ9 A;  3TOB A;  4XBF A;  2PQ8 A;  2IA1 A;  3TQN A;  1P4A A;  1I1G A;  1RUO A;  1LDK B;  2V1U A;  4GYG A;  2ELH A;  4AWX B;  1KU7 A;  2PBI A;  1BI0 A;  5FFX A;  4ZYD A;  3ZN0 A;  3F8B A;  5L3B A;  3J81 K;  2XIG A;  5CYV A;  1V3F A;  1ULY A;  2Q0O A;  3KP4 A;  3ZN1 A;  4EJW A;  2AS5 F;  4H0E A;  4EGY A;  1FBU A;  4WXC A;  2JTV A;  1BM9 A;  3QU3 A;  1LEB A;  2CFX A;  2FBI A;  1ZLK A;  5H6R A;  1P92 A;  1XCV A;  2RKH A;  3HUG A;  2MBF A;  2HYF A;  4Q48 A;  4BHC A;  4G6Q A;  2KKO A;  5HS7 A;  1XD7 A;  2EFO A;  4P9F A;  2FEZ A;  3CUQ C;  2Z5U A;  4HZF A;  2DQR A;  1R5G A;  2Y75 A;  4L18 B;  1ZGA A;  3BP8 A;  3O3K A;  4XSX F;  3VEP A;  3MWM A;  1E17 A;  3O2P E;  3RJP A;  3TDU C;  1TLH B;  4HAM A;  4GCV A;  4WXH A;  3C18 A;  4QLC U;  1KU2 A;  4QWQ A;  4XLP F;  3HRS A;  6PAX A;  3QPT A;  2A6H F;  1Z7U A;  3JSO A;  2O8X A;  3TOA A;  4Q5S F;  3Q9V A;  3IKT A;  1KQ0 A;  2QUF A;  2EWN A;  3KCC A;  2BE5 F;  2DT5 A;  3GWZ A;  4HV6 A;  4RS8 A;  4HDV A;  5E17 F;  5LBQ A;  2L01 A;  1Q1H A;  1O3R A;  2FMY A;  3G3Z A;  2VBY A;  4RAZ A;  4HOB A;  1P4W A;  2RC4 A;  4CHU A;  1O57 A;  5JI6 A;  1SMT A;  4MQ9 F;  1MDM A;  5CVI A;  4IRG A;  4UV8 A;  4HQE A;  2QZ8 A;  3IRQ A;  2ADU A;  3ZMS A;  3MEX A;  4AIK A;  4MQV A;  4M9X A;  1W4M A;  4UXN A;  1IXC A;  2DQL A;  4WWC A;  3W6K B;  2ZNZ A;  2UZK A;  5L3E A;  3I4P A;  5BQT A;  2Z9O A;  2TDX A;  1MJA A;  4I0A A;  3FX3 A;  2XKP A;  3C3W A;  2EK5 A;  2FA5 A;  4CDG A;  2KIU A;  1O7L A;  1OYW A;  1WI9 A;  2FXA A;  1BI1 A;  1H9T A;  2NNY A;  2XHK A;  2E7X A;  2OD5 A;  3G73 A;  1QQI A;  1FNN A;  1KA8 A;  1MJB A;  1B9M A;  2BYV E;  2B0L A;  4CIC A;  2XAG A;  3P9I A;  1IN8 A;  3BPV A;  3I64 A;  2WWY A;  2KJB A;  3KZY A;  3D5L A;  5E1W A;  2LKP A;  4BH9 A;  4BHP A;  4HF1 A;  5DUK A;  5J6X A;  2XAH A;  1FP2 A;  1TTY A;  5J8C A;  4ASN A;  1H9G A;  4LB6 B;  4CYD A;  2YX7 A;  4A2U A;  5JHU A;  1T98 A;  3EQL F;  5D4R A;  2EV6 A;  4I02 A;  2Y48 A;  2KRF A;  1K6O A;  1BC8 C;  2FRH A;  1TQI A;  3KP5 A;  3WGG A;  4ETS A;  5HS9 A;  2DLL A;  5E1X A;  2QQ9 A;  2IA2 A;  5DEQ A;  4S05 A;  3K1P A;  1LDD A;  4BNC A;  2VOO A;  3RYP A;  3R61 A;  5F6F A;  2FSW A;  3RIR A;  2P7C B;  3L9F A;  5K5Q A;  1YQA A;  1O3T A;  2P5V A;  2RNJ A;  2BV6 A;  1FYM A;  4WF2 A;  3BOQ A;  4KIG A;  1XB4 A;  2CG4 A;  4HQM A;  4LB5 A;  3JTH A;  1Z05 A;  3OOP A;  4D0P A;  5K1Y A;  3V8L A;  1ZRF A;  1WRJ A;  4HF0 A;  1Y0U A;  1KGS A;  2GQQ A;  1CF7 A;  2VBX A;  4KIC A;  3FM3 A;  2FOK A;  2OZ6 A;  3O6B B;  4BAY A;  1EH6 A;  2K4B A;  3BJ6 A;  4KUM A;  1F9N A;  5CLS A;  4RGR A;  1R58 A;  2W57 A;  2ZME A;  1SD6 A;  3F6O A;  3DPT A;  5CVR A;  3JSP A;  1YG2 A;  3RYR A;  4JBA A;  3H92 A;  3BWG A;  3RI4 A;  1OYI A;  2LNB A;  3R0A A;  4L0Z B;  3LA7 A;  3V7C A;  5ICE A;  1T6S A;  3R60 A;  3NRV A;  2IVM A;  4LMY A;  3LAP A;  3B73 A;  1XGM A;  4U0V A;  5FD5 A;  2ZNY A;  2P6S A;  4IHT A;  3KZZ A;  5HLG A;  1J9I A;  2ZO4 A;  4RAY A;  4AIH A;  1BOA A;  4IJA A;  1P6R A;  1I1S A;  2V79 A;  3M1E A;  3ISP A;  4YFN F;  3GFJ A;  1ZYR F;  1FWZ A;  3IWF A;  4UNO A;  1YTY A;  2WC2 A;  1UHW A;  5FB2 A;  4PCQ A;  5FO5 A;  3CUQ B;  1LB2 A;  3ERE D;  2Z33 A;  2XKO A;  5D5W B;  4KA4 A;  1RI7 A;  1XGO A;  2XAQ A;  1ZRD A;  4U0W A;  3QU6 A;  2ZFW A;  4BYY A;  2O03 A;  2FBK A;  1ZG5 A;  3FMR A;  5IT9 K;  3GFL A;  1YYV A;  2QBY A;  1ZN2 A;  1D8J A;  4OIQ F;  5HLH A;  1W7P B;  2HS5 A;  4G6D A;  1Z1D A;  2J5P A;  3H3Z A;  2XAS A;  5E20 A;  1FY7 A;  2QYO A;  4I2O A;  2O0Y A;  1TW3 A;  2R3S A;  3JW4 A;  1L3L A;  2CQK A;  1I6X A;  3BPX A;  4Y15 A;  4IF4 A;  1W5S A;  5FFZ A;  3E6D A;  4KMU X;  4EV0 A;  1J0R A;  1KYW A;  1O3S A;  1QZY A;  4A0Z A;  4A6D A;  1JXS A;  4GO1 A;  4A6E A;  3LST A;  3S2W A;  1ZAO A;  4P96 A;  2V1X A;  3F8C A;  3LWF A;  2DU9 A;  2VE8 A;  2O6G E;  3LA3 A;  1OPC A;  2LSO A;  1L0O C;  4LK1 F;  1UST A;  3T8T A;  2OQR A;  4LG0 A;  4I01 A;  1ZRE A;  4FX0 A;  1IZ1 A;  4UV9 A;  1B59 A;  3QOP A;  2G9W A;  2EA4 A;  1GXP A;  4M71 A;  2DPD A;  3F23 A;  4JQF A;  2VBZ A;  1B1B A;  1B4A A;  3I54 A;  1LQ1 A;  4FHT A;  4EVI A;  2FF4 A;  3FWE A;  2OQG A;  4EJV A;  1A04 A;  2ZJ2 A;  4UHT A;  1HKQ A;  4LFU A;  1LDJ A;  1P2F A;  3FZV A;  3DEU A;  5CVV A;  1HKT A;  4EM1 A;  3KEQ A;  4G7H F;  2L4M A;  2YSR A;  3ZMT A;  2ZBK A;  4I0B A;  5H6Q A;  1Z91 A;  3DQV C;  5JFR A;  2V6C A;  2JRT A;  1IXR C;  2VC0 A;  1ON2 A;  4UUV A;  1REP C;  1U5T A;  1PP7 U;  3PQK A;  2IP2 A;  4FT8 A;  1DPU A;  1QZZ A;  2OU2 A;  1U8R A;  2F5F A;  4RGX A;  2EA2 A;  5KVR A;  2Q2E A;  2VT3 A;  3QPH A;  3BRO A;  2DK5 A;  1ON1 A;  3FXU A;  3IHU A;  1IXS B;  2HR3 A;  1YW8 A;  1R7J A;  1JHF A;  5ICF A;  3WTY C;  5E8I A;  5LGT A;  3WTX C;  3MZH A;  4HLY A;  4NB5 A;  3COA C;  5A2Q K;  3HSF A;  2FNA A;  3DV8 A;  2XAJ A;  4ZYG A;  3RTR A;  1HW5 A;  1R36 A;  3SQN A;  4KFC A;  3SXY A;  3HOS A;  1MZB A;  1FBS A;  1HKS A;  4EM0 B;  1F4K A;  2XRN A;  4LLG F;  5D6E A;  4CO8 A;  2DAO A;  3QP6 A;  2H09 A;  2VON A;  5LGN A;  5FLX K;  1G3W A;  3M8F A;  3R0J A;  4CGZ A;  4OMY A;  1K78 B;  1UFM A;  2M45 A;  4O6J A;  2NAZ A;  2PLY A;  1UHM A;  1IUY A;  4OIN F;  1J5Y A;  3R6S A;  1ZAR A;  2R7D A;  4Q47 A;  1HW1 A;  2RN7 A;  4A5M A;  1PP8 F;  2JPC A;  2IRF G;  3P9K A;  1ZG1 A;  2DBB A;  3L2C A;  1R23 A;  2IT0 A;  5BMZ A;  3RKY A;  3EUH A;  2HQR A;  1KU9 A;  2RVC A;  4EJT A;  5D5V B;  3RKW A;  4ZYH A;  2L54 A;  4R8H A;  1TQP A;  1MKM A;  5BPI A;  2GZW A;  3NQO A;  3E5U A;  1GHC A;  3ZPL A;  4UVB A;  4I09 A;  2P7V B;  2GIV A;  2W85 A;  2PN6 A;  2CO5 A;  3I59 A;  3FM5 A;  3HOT A;  3PFI A;  5LEJ A;  2XRO A;  3LAJ A;  3CO6 C;  1HXD A;  4OMZ A;  1J75 A;  1FP1 D;  3HYI A;  1W7P A;  1BBY A;  1RZ4 A;  2HZT A;  2PEX A;  4L0Y B;  1XDS A;  1XGS A;  4PGH A;  1SD7 A;  1J7K A;  4ZYE A;  1FBQ A;  1IAW A;  3DF8 A;  4LD5 A;  1WWX A;  1MGT A;  2QWW A;  3EET A;  3BDD A;  1FYL A;  2XVC A;  4YFK F;  3SZT A;  5FGM A;  3L09 A;  4WK8 F;  1FZP B;  5K5R A;  1FSE A;  1YW7 A;  5ERI A;  2P4W A;  5D4S A;  3REO A;  4ZZL A;  5D6F A;  1T2K A;  4R79 A;  1OKR A;  3HRM A;  3E6M A;  4OIO F;  4S04 A;  3CJN A;  5EEG A;  5D8L B;  1XSV A;  3KLN A;  4N9I A;  2VOD A;  3FXR A;  4HX4 A;  2OZU A;  1YIO A;  1D5V A;  3JAM K;  3M8E A;  2BEO A;  2EJR A;  4ESF A;  5ILV A;  2HTS A;  4HX8 A;  1W7P D;  4XSZ F;  4KN7 X;  2HQN A;  5AON A;  3CTA A;  5BS6 A;  3IKV A;  1PDN C;  3C1D A;  5L3C A;  2W24 A;  1J59 A;  2H27 A;  2MLK A;  2ISZ A;  3I71 A;  5L3G A;  5E8G A;  2OA4 A;  2AXL A;  1B9N A;  4MGR A;  1ZGJ A;  2A69 F;  2HGC A;  3ELK A;  4ZH4 F;  3V8J A;  1X3U A;  2K27 A;  3CLO A;  3E3V A;  3PQJ A;  5E18 F;  5L3F A;  2P6T A;  2GXB A;  1FOK A;  2RV8 A;  4G7O F;  2UXX A;  4GYI A;  4TV7 A;  1JGS A;  2MD5 A;  2VE9 A;  1ZG3 A;  5J8F A;  4Q4Z F;  2KJC A;  5LEK A;  1LVA A;  5H20 A;  1R22 A;  4KT5 C;  3GFM A;  4CXF A;  1HSJ A;  2DI3 A;  1G3T A;  2L3D A;  5LLQ A;  2GA2 A;  1GVJ A;  5HS8 A;  4I7H A;  5DCM B;  1GXQ A;  1XMA A;  4ENJ A;  2EV0 A;  5DCF A;  1G6N A;  5D5X B;  1AWC A;  2P5K A;  3F72 A;  5L3D A;  1EH7 A;  4P55 A;  2ESH A;  2NYX A;  3U9G A;  1RNL A;  4MTD A;  1HST A;  1IN4 A;  4EGZ A;  3KP6 A;  1SD5 A;  4YII A;  1ZRC A;  2JSC A;  2MH2 A;  3F3X A;  2QQA A;  1XDU A;  3V7R A;  4L9T A;  1LJ9 A;  1FSH A;  2V1D A;  2CGP A;  2R7F A;  3EDP A;  4U7D A;  3J7A O;  2NS0 A;  1G3Y A;  2L02 A;  1YLF A;  4LLL A;  4HF2 A;  1BI2 A;  2DK8 A;  3L7W A;  2XUB A;  2QM3 A;  1XMK A;  2VBW A;  5LRS A;  5TRD A;  1P4X A;  2OAZ A;  5E1Z B;  5ICC A;  4A5N A;  2A07 F;  1FLI A;  1MD0 A;  1JHH A;  1IN5 A;  2W25 A;  3FHZ A;  3GLX A;  3LQQ A;  2VC1 A;  2E1N A;  4KIF A;  3KP2 A;  4M9S A;  4N9H A;  4O5V A;  2JT1 A;  5IT9 Z;  1NHA A;  2G7U A;  2WTE A;  1QBJ A;  1EH8 A;  1WQ2 A;  2M1B A;  4RB2 C;  1SFU A;  2D45 A;  3RPU A;  1MDM B;  4R1H A;  2KIM A;  1ZLJ A;  3CUO A;  4G8X A;  3W6J B;  3GVA A;  1QGP A;  2M87 A;  2D1H A;  3TO9 A;  2MA3 A;  2STT A;  3DXJ F;  3WGH A;  3IL2 A;  1R1V A;  3KET A;  3QP5 A;  1Z6R A;  3L00 A;  2XV4 S;  3KE2 A;  4KYW A;  3CO7 C;  2COM A;  5ICG A;  1BIB A;  2PMH A;  4O3M A;  1T39 A;  1K7A A;  2BBY A;  2UXN A;  1DP7 P;  4WCG A;  1UCR A;  3Q5F A;  3HSR A;  2HOE A;  3IRR A;  5LRR A;  2GAU A;  1S8N A;  3WTZ A;  2E7W A;  1K79 A;  3ECH A;  3EYY A;  3WTT C;  3GZ6 A;  5DUI A;  5DDG A;  3FF5 A;  3M9A A;  1S29 A;  4OIP F;  2WV0 A;  4OU0 A;  4EQQ A;  5D8K B;  4UVC A;  1USS A;  3DPL C;  4PZJ A;  4P9U A;  2FQ3 A;  3E6C C;  2UWM A;  4L9N A;  3C7J A;  3WU1 B;  3J80 K;  1OMI A;  1R1T A;  4WX9 A;  2ZKZ A;  2FML A;  3GX4 X;  3GXO A;  2ZXJ A;  2E1C A;  4KN4 X;  1U5T C;  3OV8 A;  5F64 A;  3F8M A;  4ESJ A;  1TNS A;  3ZMD A;  3I58 A;  3RDI A;  3VB2 A;  2M5W A;  2OBP A;  2KIF A;  2ESN A;  3RPQ A;  4EM2 A;  1R1U A;  3WE3 A;  2K86 A;  5TJJ A;  2MH9 A;  1IW7 F;  4LK0 F;  3JTG A;  4ZZD A;  2K4J A;  3HHG A;  5JVT A;  3MQ0 A;  3E5X A;  2HEO A;  2A3S A;  1KYZ A;  3VFZ A;  3BZ6 A;  1W5T A;  1EV7 A;  1BJA A;  3TO6 A;  4G7Z F;  3QAH A;  3J81 Z;  1OR7 A;  1SD4 A;  3EYI A;  1FYK A;  2DO7 A;  3N4M A;  3SFZ A;  4M6Y A;  4AIJ A;  3WGI A;  3B02 A;  4KDP A;  2VOP A;  1WSU A;  2A61 A;  2PI0 A; 
#chains in the Genus database with same CATH topology
 1FPQ A;  1LNW A;  2NVY J;  2HKO A;  2Y31 A;  1WH7 A;  1MJ9 A;  3CP8 A;  3LQR A;  1LPQ A;  3GFI A;  5KK1 A;  4RB0 A;  2QVO A;  3ABU A;  2P8T A;  1CGP A;  2OV7 A;  4ENM A;  1QPM A;  2MG4 A;  3T1B A;  3LSH A;  5A2Q Z;  3ROU A;  3WU0 A;  3ZP5 A;  4HYE A;  3A0B C;  3CCQ I;  3CCJ I;  4CYC B;  4EMS A;  3U1D A;  1BR1 A;  4AD9 A;  1CF7 B;  1ERD A;  2HXI A;  4V2F A;  4CA0 A;  5DCM A;  3MZY A;  3OSF A;  1MMN A;  5B1B H;  4F92 B;  2HDC A;  3CC2 I;  2B63 J;  1I6H J;  2NOG A;  2NS7 A;  2ZME B;  2HKX A;  4Y4R A;  1AKH A;  3H3U A;  2IW5 A;  2VXZ A;  2XF6 A;  3GYH X;  1ODD A;  4M6V A;  1YI2 I;  1V4R A;  5F0H A;  3TMO A;  1XMX A;  3HM5 A;  4P5O A;  5HOO A;  4A12 A;  3FXQ A;  3G2B A;  3ULQ B;  2RGV A;  2P5L C;  2M8E A;  2WAQ N;  5FLX Z;  4IEJ A;  1LFB A;  3H1C A;  2HFH A;  2X51 A;  2AHQ A;  3CC7 I;  2Q8K A;  1IRG A;  3L2U A;  2PMU A;  1D8K A;  3HJE A;  1I5Z A;  1IN6 A;  2L0K A;  2DPU A;  4G94 A;  4BS9 A;  2NS8 A;  2MLG A;  2Z3Y A;  1VTN C;  3OS0 A;  1IDZ A;  4IRI A;  2IXS A;  2F2E A;  2M0M A;  3K1N A;  4NC8 A;  5K5O A;  1PJR A;  2IAI A;  3FXK A;  1ONV A;  3K70 D;  3V4G A;  3S17 J;  3HRT A;  3F22 A;  2QCO A;  1Z9C A;  3ZXS A;  1HC8 A;  1C0W A;  1ZHF A;  2LP0 A;  2MGQ A;  5EGO A;  4OIR F;  3ZQF A;  3FIW A;  4MEX F;  5LHG A;  3DFG A;  1B6A A;  2R93 J;  2W84 A;  4BL0 B;  4LGW A;  1VQK I;  3OWT A;  2NRA C;  2R7X A;  2VKH A;  4ENN A;  3K4C A;  2BGC A;  3TDZ C;  2BZT A;  3HIF A;  4NDL A;  2X85 A;  3CUQ A;  2HI3 A;  2XDV A;  3PSI A;  1B8I B;  3U2R A;  5HDG A;  4IHX A;  4BXX J;  2H8W A;  3TW6 A;  4QPQ A;  3OYA A;  2DW4 A;  3CCU I;  2EZH A;  1VZ0 A;  4AC0 A;  3GUD A;  4EJU A;  1XX5 A;  4JOM A;  2E34 A;  3TP3 A;  5HDK A;  3KYL A;  3ZR8 X;  4YRV A;  2PG4 A;  1BOB A;  2RQQ A;  3ASN H;  4RAG A;  2FE3 A;  4BXU A;  1FIP A;  3F6V A;  1HF0 A;  3P9C A;  3FMQ A;  2HOA A;  1IV6 A;  2K9L A;  3EUA A;  2IGN A;  4II3 A;  4N4O B;  2K9M A;  2M0C A;  1OYY A;  2HXO A;  3BG7 A;  3JRB A;  2CUZ A;  3BG5 A;  2ZJR F;  1TWH J;  3I9V 2;  4CCL A;  3P5J A;  5AIQ A;  2DCE A;  2LLK A;  3TL4 X;  1ZQ3 P;  2C6Y A;  4JX4 A;  3QWL A;  2CUF A;  1S7O A;  1FT9 A;  2LDU A;  3OL3 A;  2VT2 A;  4DQ2 A;  4E7J A;  1OCT C;  2F5D A;  3BZC A;  4HDU A;  2QBY B;  4YG2 F;  2BXZ A;  3WTW C;  2DTZ A;  4PJM A;  3K2Z A;  3PUF A;  5LGU A;  2NNN A;  2L4A A;  1PUF B;  3OOU A;  1HDD C;  2JPB A;  4YIR X;  2H6C A;  2JK3 A;  2YR2 A;  4IRH A;  4FX4 A;  2VQL A;  3ML6 A;  3AAF A;  4RB3 C;  1OCP A;  5BOX A;  2DMP A;  1F1Z A;  4HLX A;  4A93 J;  4DZJ A;  4C2M J;  2MC3 A;  5GAG J;  5CVU A;  1UG0 A;  3GTO J;  3HGG A;  1SAX A;  1H88 C;  4HV5 A;  5CVJ A;  1LFU P;  4KIB A;  4U7B A;  3M7G A;  5J3L A;  3KLO A;  2IBD A;  1QNT A;  1T0F A;  3WE2 A;  3D1N I;  3CLQ A;  1UMQ A;  4Y17 A;  3L2R A;  4EJO A;  4MIM A;  4IVN A;  2UV1 A;  2Y9Y A;  5FD6 A;  1VQN I;  3BY6 A;  3VOD A;  1ORK A;  2PMZ N;  2WAQ A;  2YPR A;  2ZCW A;  2LKS A;  3D0S A;  2DFH A;  3BCB A;  3EPZ A;  3F0C A;  2CV1 A;  4OAZ A;  3PFY A;  3WOD F;  1Y6I A;  1D3Y A;  1G4D A;  2IA0 A;  2A5Y B;  3HKZ N;  3K69 A;  4RGU A;  3JAM Z;  5IPA A;  3ZQG A;  2HZD A;  2ZSI B;  2D2W A;  1Z7L A;  2E36 A;  1DU0 A;  1Y39 A;  4ENK A;  5C3E J;  1WJD A;  4BAC A;  1P9Q C;  3OYN A;  3OYI A;  1WGX A;  1UEL B;  2WV1 A;  2X9D A;  5FKO A;  4Y13 A;  1ENH A;  3V8K A;  2LTP A;  5IP7 J;  5FKK A;  2JSP A;  2MD0 A;  4QSH A;  2KIS A;  2X0L A;  3T0Y A;  3FXO A;  3LA2 A;  1YS7 A;  3S1R J;  5ILU A;  3KP3 A;  2A5W A;  2FU4 A;  1R49 A;  4XKW A;  2QKL B;  2LF8 A;  2X4H A;  1JTY A;  4RB1 A;  2EB7 A;  2JA7 J;  4LG0 B;  3TGN A;  3BQZ A;  3JRD A;  5LHI A;  3BJO A;  2R7O A;  3LSI A;  1FC3 A;  2A6E F;  1RIO H;  2BY1 A;  1XSD A;  2ACJ A;  4HX7 A;  3RKX A;  3S15 J;  3FXJ A;  2QF7 A;  4HNV A;  3HRU A;  1SVL A;  3IWZ A;  1U78 A;  1YS6 A;  3DTK A;  1VQO I;  1BIA A;  4ESB A;  1UJ8 A;  2ZXI A;  4XLF A;  5F08 A;  1R00 A;  2LRD A;  4A3M J;  2V9K A;  2CWE A;  3FBN B;  1X2N A;  2R5Y A;  3UR3 C;  2GLO A;  1DP3 A;  2QEX I;  1OFC X;  5FRN A;  4PDK A;  1PYV A;  1IF1 A;  2EFQ A;  3KEY A;  2STW A;  5D5U B;  4M72 A;  4K2E A;  3HHH A;  4GRI A;  1KQ9 A;  3KP7 A;  3NWS A;  1SFX A;  2I5U A;  3A03 A;  4BKX A;  1XSX A;  3F8N A;  3I4N J;  4U88 A;  3E97 A;  4DNC A;  2K3F A;  4IZZ A;  2KIQ A;  3GEZ A;  3RCO A;  3A0H C;  4BQO A;  1X1P A;  1TQM A;  1J2X A;  2CQX A;  4RGS A;  2IS4 A;  2XGD A;  4L9J A;  2G7H A;  2PX9 A;  3S14 J;  1Z67 A;  1DU6 A;  3T5X A;  4XK4 A;  5DTD A;  1YFH A;  4IHS A;  2R7Z J;  1BI3 A;  3ZMU A;  4A0X A;  4I6Z A;  1U5T B;  2EFW A;  1RUN A;  3KEO A;  4ON0 A;  3OYC A;  5M5W J;  2X6O A;  4L5I A;  4XRS G;  4CZC A;  2O9L A;  2CYY A;  2LG4 A;  3GTM J;  3K9T A;  2XRL A;  4U0Y A;  2PJP A;  3OYE A;  4Z2Y A;  3GO5 A;  4GXO A;  4HA8 A;  1D0Z A;  1S7A A;  2F5E A;  2EFN A;  2EFP A;  4CZZ A;  3VPR A;  3OIO A;  1R5H A;  4MNU A;  4BQA A;  4B09 A;  3FMS A;  2GOX B;  2Q2E B;  2W48 A;  3GCM A;  2V9V A;  2YX4 A;  5EF6 A;  4E70 A;  3MKW B;  3K1M A;  1LEA A;  1I3A A;  1P7I A;  3LMM A;  2K5C A;  1AOY A;  1U8B A;  2EIN H;  1T8I A;  3CD6 I;  3HKZ A;  3MAJ A;  2D5V A;  2DTR A;  1S3J A;  3DBL B;  2FQ4 A;  3LFK A;  2FOW A;  1MW7 A;  1NG6 A;  5LHH A;  5GP9 A;  1YJW I;  3CC4 I;  2D1V A;  2J5O A;  4XRF A;  1YX3 A;  5HLT A;  1XGN A;  3BR5 A;  3ZQ7 A;  2O61 A;  2HTJ A;  4IPA A;  3VOE A;  1FX7 A;  1ETQ A;  3HSE A;  3JRH A;  4NQW A;  2LK2 A;  3HDD A;  1W36 C;  5IT3 A;  1QO0 D;  3WHB A;  2EV5 A;  2FBH A;  1D1C A;  4M3F A;  4YIF A;  3S1Q J;  4JYK A;  5DD4 A;  5AIP A;  2NVT J;  2CV2 A;  2EIM H;  2HWV A;  3BZK A;  1K78 A;  3PNT A;  2GA1 A;  2Y0S N;  2MW8 A;  5EDN A;  3F21 A;  3DKW A;  3E6B A;  2JA2 A;  3M4O J;  3WHC A;  3K6G A;  1A36 A;  2XAF A;  5HLI A;  1MBK A;  3GF2 A;  4C2T A;  1OCR H;  4XKV A;  3GZ5 A;  1TL8 A;  4LLN A;  5C4X J;  1MBF A;  2GWR A;  2X6Y A;  3L2Q A;  3FDY A;  3F8F A;  1U3E M;  2OF7 A;  3S3O A;  1JUP A;  2K40 A;  3K4J A;  4I98 B;  2PI0 A;  4XOP A;  5J1Y A;  5JR3 A;  3P7N A;  1ZGW A;  4JK1 X;  1R6R A;  1I27 A;  1SMY F;  1QA6 A;  2HYG D;  2ELJ A;  1KU3 A;  5HDN A;  4X1E A;  2IPQ X;  3ZRG A;  1O7F A;  4MHG A;  3MCZ A;  3I5U A;  4WXD A;  3NWT A;  2DT7 B;  2CJJ A;  1YO5 C;  1N77 A;  2V7F A;  4XN3 A;  1DUX C;  5LD2 C;  2PFB A;  2LKX A;  1PUE E;  4FCY A;  5DYM A;  1J09 A;  1TZL A;  4UVA A;  1BN5 A;  1GLN A;  2E1M B;  3HZJ A;  3WG9 A;  2VKD A;  3V7S A;  4XLN F;  2K7L A;  5ILS A;  3RSN A;  2M30 A;  2CV0 A;  3S1M J;  5E3O A;  1F5T A;  1IN7 A;  1VI0 A;  2H6B A;  3BR2 A;  3CJT B;  3QRF F;  2RDP A;  2TCT A;  3ZMV A;  4HW0 A;  1A31 A;  4C30 A;  5DV5 A;  3ERM A;  4LJZ F;  4OOI A;  1OCC H;  4KMF A;  2DFF A;  4DJA A;  5KAI C;  4E7H A;  2HQA A;  2ECB A;  5EEH A;  3RQI A;  1HQC A;  1YW9 A;  1HW2 A;  2YU3 A;  4NHJ A;  1DGR M;  3NEU A;  3FBI B;  4F7Z A;  4UUT A;  5K7H A;  1GUU A;  2E5Z A;  2WAE A;  2YUS A;  3T8R A;  4NC6 A;  2H94 A;  4PJJ A;  2EIL H;  4BHB A;  4XN0 A;  1ZH5 A;  3PJR A;  3CF5 F;  4C3I J;  1G59 A;  1K6Y A;  2ETH A;  4M9Z A;  4IXA A;  1S6L A;  2VQC A;  1RET A;  3I59 B;  4LOC A;  3V42 A;  4YFX F;  1VFC A;  1N78 A;  2F5C A;  2XGX A;  1KZH A;  1EJ9 A;  3Q9S A;  4IQ4 A;  1JUM A;  2CW0 F;  3L2V A;  5M5Y J;  3CDL A;  3FXM A;  4M73 A;  3TO7 A;  2K9Q A;  3G6E I;  2L7F P;  1MBE A;  5CQG A;  1A5J A;  5F1R A;  1UZC A;  4BBS J;  1R9T J;  3W6V A;  3SFI A;  2MC4 A;  1BC7 C;  3K0L A;  3MFK A;  1MIJ A;  1HBX G;  3HTU A;  3IH4 A;  1KQ8 A;  2QQB A;  3HOW J;  1TNT A;  2QEN A;  1WJA A;  1FOW A;  1Z3Y A;  3OYF A;  3FXL A;  3ECO A;  4B47 A;  3CCR I;  3DP7 A;  2Z99 A;  3ZOB A;  3NAU A;  5DD8 A;  4GGG A;  2BXY A;  4ZTJ A;  4A3B J;  1XCB A;  1U2W A;  2CSO A;  2QLZ A;  5CPR B;  3ZMZ A;  3TKY A;  3I0T A;  5HVQ C;  3R4K A;  1W5C C;  1JE8 A;  3CDH A;  1G2H A;  1I39 A;  2O3F A;  3Q0W A;  4N0B A;  2IS2 A;  1UB9 A;  2CU7 A;  2KDZ A;  1FJL A;  2WB1 N;  3HGY A;  2HNH A;  4JP0 A;  4M74 A;  4AVP A;  4XID A;  2CQQ A;  3CCS I;  2JQ7 A;  3K10 A;  1LKX A;  3GW2 A;  4A0Y A;  1YJN I;  5IY5 H;  3VYT B;  3GTP J;  1DDN A;  3DBR B;  3VSK A;  4W97 A;  2KRC A;  3TW7 A;  3IC7 A;  3VDX A;  2Y0M A;  1H0M A;  4PGG A;  3J80 Z;  2LR8 A;  1STZ A;  4L9V A;  1TBX A;  1MNM C;  1TW2 A;  1OR7 C;  1XN7 A;  4M6X A;  3BJA A;  4L5J A;  1G8X A;  2FNP A;  1LFP A;  1WKM A;  4B1R A;  3DPU A;  3KFW X;  1SFE A;  1MMG A;  3WTS C;  4RLF A;  1K61 A;  4G9Y A;  1M1E B;  2IGO A;  5J4V A;  2RQP A;  3K70 C;  2BW3 B;  2LF7 A;  2IS1 A;  1Z77 A;  3I53 A;  1FTZ A;  3H36 A;  5ED4 A;  3ABT A;  1IRF A;  2HVQ A;  5BPD A;  3A2K A;  2MFZ A;  3E5Q A;  1DPR A;  3PO3 J;  1Z6T A;  1O3Q A;  1FMW A;  2KZG A;  1FEX A;  3N97 A;  1YIT I;  3M07 A;  2LYC A;  5CKT A;  1E2X A;  1U6G A;  2KDO A;  1ETW A;  4HEA 2;  2A68 F;  4MTE A;  2Y9Z A;  1OLT A;  2WY8 Q;  3SZP A;  4B8X A;  2DFI A;  1APL C;  2O5R A;  3WTV C;  1WJC A;  2VQG A;  3SHF A;  2IJL A;  4EEF G;  3F9K A;  2L9N A;  4E7Z A;  3VYU B;  2GOM A;  1T38 A;  3KYD B;  2K02 A;  2XSD C;  4KNY A;  2GXG A;  3HTS B;  5CQE A;  2VN2 A;  1HA8 A;  4MEY F;  2ISY A;  3WTU C;  1U9N A;  4RDU A;  2DMT A;  2JZY A;  4HBL A;  1G3S A;  5CJ9 A;  3DBH B;  3TOB A;  4XBF A;  2YU9 J;  2HDW A;  4UY8 I;  1WPK A;  2PQ8 A;  2IA1 A;  4BDY A;  3TQN A;  1P4A A;  1I1G A;  1S72 I;  2WA0 A;  1RUO A;  1E0E A;  1LDK B;  4A3F J;  2DA2 A;  2V1U A;  2EH3 A;  2F5V A;  4GYG A;  2ELH A;  4AWX B;  2DOF A;  3H9J A;  1MMS A;  1KU7 A;  2PBI A;  1BI0 A;  2DA1 A;  5FFX A;  4ZYD A;  3ZN0 A;  3H9Q A;  2IS6 A;  4MO7 A;  3F8B A;  3HB9 A;  5L3B A;  3J81 K;  2XIG A;  3DLA A;  4LIT A;  5CYV A;  1V3F A;  1ULY A;  1ZR4 A;  2EBI A;  2KL4 A;  2Q0O A;  2E19 A;  1VQP I;  3S2H J;  3KP4 A;  2L5Q A;  3ZN1 A;  4EJW A;  2AS5 F;  4H0E A;  4YEJ A;  4EGY A;  1WJF A;  1FBU A;  4WXC A;  5M3F J;  3DLL F;  4BY1 J;  1UHS A;  2JTV A;  4BXF A;  1BM9 A;  2R7U A;  1QRY A;  2IGK A;  2KZV A;  3QU3 A;  3J7Y J;  1LEB A;  3JRA A;  2CFX A;  2FBI A;  1ZLK A;  2LOO A;  5H6R A;  4KIT B;  1FOX A;  1FTT A;  1P92 A;  3ABL H;  1XCV A;  2RKH A;  1X4O A;  3HUG A;  5FKL A;  2WB1 A;  2MBF A;  2HYF A;  3LSR A;  1HLV A;  4Q48 A;  4BHC A;  4C2U A;  4G6Q A;  2KKO A;  5HS7 A;  1XD7 A;  3LFU A;  5GAE J;  2EFO A;  4P9F A;  2FEZ A;  1X19 A;  3CUQ C;  3EUK L;  3GTQ J;  2Z5U A;  4HZF A;  2DQR A;  1R5G A;  2R7Q A;  2Y75 A;  3HL2 A;  3BCA A;  1ZGA A;  4U87 A;  4CCO A;  4A3J J;  4L18 B;  3BP8 A;  3O3K A;  4XSX F;  3VEP A;  1W1W E;  3IUO A;  3KIO A;  3MWM A;  1YOV B;  1E17 A;  1BA5 A;  2L7Z A;  2HQ5 A;  3O2P E;  4F52 A;  3RJP A;  3TDU C;  4XON A;  2HVS A;  1WI3 A;  4CCJ A;  1ETY A;  1TLH B;  3AG1 H;  3KPH A;  3DTI A;  4M3G A;  3I55 I;  4FE4 A;  4HAM A;  2OPT A;  2XB0 X;  4GCV A;  2VI6 A;  3HEF A;  1NH3 A;  1QVT A;  4WXH A;  5KHD A;  3C18 A;  4DIQ A;  3AL0 B;  3FKJ A;  4QLC U;  2XSJ C;  1KU2 A;  4QWQ A;  1RC9 A;  1JJ8 C;  4XLP F;  3HRS A;  3C2G A;  6PAX A;  1Y8Q B;  3QPT A;  1X58 A;  2A6H F;  1MBG A;  1Z7U A;  4B48 A;  1MNE A;  3AG2 H;  1XTA A;  5F27 A;  1MH3 A;  3JSO A;  2O8X A;  3TOA A;  4Q5S F;  2PJR B;  4IOA F;  1SVM A;  4ZJZ A;  3Q9V A;  1WFX A;  3IKT A;  1KQ0 A;  2QUF A;  2EWN A;  3KCC A;  2BE5 F;  2DT5 A;  1BL0 A;  2ID6 A;  1SFK A;  3GWZ A;  4HV6 A;  3TP0 A;  4AYB N;  5EYR A;  4RS8 A;  1B72 B;  3HOY J;  3FHN A;  4HDV A;  5E17 F;  5LBQ A;  2HYJ A;  2L01 A;  3AG3 H;  4FET A;  1Q1H A;  3CCY A;  2LH9 A;  3I4M J;  1FIA A;  4IO9 F;  1RKT A;  1O3R A;  2FMY A;  1MH4 A;  1T0F C;  3G3Z A;  4CCK A;  3GZN B;  3H5N A;  2VBY A;  4RAZ A;  4HOB A;  1P4W A;  5KCM A;  2GIZ A;  2RC4 A;  4CHU A;  1O57 A;  3DKX A;  5JI6 A;  1SMT A;  3A1Y A;  3LSG A;  4MQ9 F;  1MDM A;  2WAD A;  5CVI A;  3S3N A;  1Q1V A;  3IAM 2;  5EG0 A;  4IRG A;  4UV8 A;  4HQE A;  3G1O A;  2QZ8 A;  4PUS A;  3IRQ A;  4AM3 A;  3U21 A;  2F4O B;  2DA7 A;  2VJI A;  3MKL A;  1Z21 A;  2ADU A;  2HPM A;  3ZMS A;  5F0C A;  3RZD J;  3FK7 A;  3MEX A;  4AIK A;  3LSJ A;  4MQV A;  2DDB A;  4M9X A;  1W4M A;  1WCM J;  4UXN A;  1IXC A;  2M7A A;  1K4T A;  5E79 C;  2DQL A;  3H5R A;  2DFE A;  2X1E A;  3W6K B;  5J47 A;  4WWC A;  2ZNZ A;  1VND A;  5F1J A;  1Y56 A;  2UZK A;  1V5G A;  5J4Y A;  5L3E A;  2DMU A;  3H9G A;  3I4P A;  5BQT A;  2W82 A;  3JRE A;  3A01 B;  2Z9O A;  2TDX A;  1MJA A;  4I0A A;  3FX3 A;  4LIU A;  4YEL A;  4F93 B;  2R5Z B;  4BEH B;  3OSG A;  1TT5 B;  2XKP A;  1AU7 A;  3C3W A;  2EK5 A;  2FA5 A;  4D1Q A;  4F91 B;  2KIU A;  2CUJ A;  1O7L A;  3ZQQ A;  1OYW A;  4CDG A;  1WI9 A;  2W1O A;  1QZE A;  3HOX J;  1UAA A;  2FXA A;  2LC2 A;  3BR1 A;  4RA2 A;  1BI1 A;  1H9T A;  3HBL A;  2BY0 A;  2NNY A;  2XHK A;  5GAH J;  2E7X A;  1YJ9 I;  2OD5 A;  3OMY A;  3G73 A;  1ZEL A;  3DKY A;  1QQI A;  2VJ5 A;  1FNN A;  2L7K A;  1KA8 A;  1MJB A;  1B9M A;  2BYV E;  2B0L A;  4CIC A;  2XAG A;  3VSL A;  3P9I A;  2LD5 A;  2QQ8 A;  5KAF C;  1IN8 A;  3W3C A;  3BPV A;  5IYB J;  3I64 A;  2WWY A;  2V9P A;  3S3M A;  2ELK A;  2KJB A;  1IJW C;  3KZY A;  1VQL I;  1POG A;  3D5L A;  5GAD J;  4NUB A;  5E1W A;  3Q3S A;  1NG7 A;  1CQT A;  2RAE A;  2LKP A;  4BH9 A;  2EIJ H;  4BHP A;  3HPH A;  1YRN A;  1WZ2 A;  4HF1 A;  5DUK A;  5J6X A;  2XAH A;  1FP2 A;  1TTY A;  3A02 A;  5J8C A;  2R7W A;  5FLV A;  3BG3 A;  3S2D J;  2F4I A;  4A3E J;  4ASN A;  3QYE A;  1H9G A;  5DM6 F;  1P7J A;  4LB6 B;  2DXI A;  4CYD A;  4IOC F;  4E4H A;  2YX7 A;  4A69 C;  4A2U A;  5JHU A;  1T98 A;  3EQL F;  5D4R A;  2EV6 A;  4I02 A;  2Y48 A;  2KRF A;  1K6O A;  3D5R C;  1OIS A;  1BC8 C;  2FRH A;  4DYQ A;  1Z0X A;  1TQI A;  3MZ8 A;  3TED A;  2CFO A;  4OAY A;  2E5N A;  3KP5 A;  3WGG A;  4ETS A;  4RLQ A;  3M8J A;  5HS9 A;  2DLL A;  4BU2 A;  5KNL A;  5TGT A;  5E1X A;  5B3S H;  2X6X A;  2QQ9 A;  4XR6 A;  2IA2 A;  3DCF A;  5DEQ A;  3K1P A;  1V54 H;  4S05 A;  1LDD A;  1TWF J;  4BNC A;  1YX5 A;  2VOO A;  4BDZ A;  2KMU A;  2K9S A;  1TWG J;  3RYP A;  1N75 A;  4UUS A;  1D1A A;  2JA8 J;  3R61 A;  2ZME C;  3B6C A;  5F6F A;  1D1B A;  1MSF C;  2FSW A;  3RIR A;  2P7C B;  3L9F A;  3FIS A;  5K5Q A;  1YQA A;  3BG6 A;  1YE9 A;  4A3K J;  4Z6Y A;  3AKZ A;  3PO2 J;  1O3T A;  2P5V A;  2RNJ A;  2BV6 A;  1FYM A;  4WF2 A;  3BOQ A;  2EIK H;  4KIG A;  1XB4 A;  2NVX J;  2CG4 A;  4XMY A;  4HQM A;  2NVU B;  4LB5 A;  3JTH A;  1Z05 A;  4PSX A;  3OOP A;  1X1A A;  1RKW A;  1IGN A;  4D0P A;  5K1Y A;  3V8L A;  1ZRF A;  2WY7 Q;  1WRJ A;  4HF0 A;  1Y0U A;  1E3P A;  4XRM A;  1A35 A;  1KGS A;  3HOV J;  2XGC A;  2ME6 A;  4IQJ A;  4CYC A;  2GQQ A;  2CRG A;  1CF7 A;  3IH3 A;  2PMZ A;  2VBX A;  3C2B A;  3FM3 A;  4KIC A;  5B66 C;  3X2Q H;  2FOK A;  4KJZ A;  4A3L J;  2OZ6 A;  3O6B B;  4BAY A;  1EH6 A;  4KT6 A;  2LVS A;  2K4B A;  3BJ6 A;  3GTG J;  4KUM A;  2XGE A;  1W0T A;  1F9N A;  5CLS A;  1TP4 A;  2OCE A;  2VJJ A;  1R58 A;  2W57 A;  2ZME A;  3OR1 C;  4RGR A;  2M7B A;  1SD6 A;  3F6O A;  3TBI A;  3DPT A;  1X1D A;  5CVR A;  3JSP A;  1U9O A;  1YG2 A;  4MFE A;  3VWB A;  2VJ4 A;  3RYR A;  4JBA A;  1W0U A;  3H92 A;  2IEK A;  1TWA J;  5GTH C;  3BWG A;  3RI4 A;  1OYI A;  1AKH B;  4E7L A;  5HNF A;  2LNB A;  1SAN A;  3R0A A;  4L0Z B;  4C3J J;  3LA7 A;  1WHU A;  3V7C A;  5ICE A;  1GV2 A;  1T6S A;  3R60 A;  3NRV A;  3GTL J;  2IVM A;  4LMY A;  3LAP A;  2A6T A;  4FE7 A;  2COB A;  3B73 A;  1XGM A;  3D5S C;  4U0V A;  5FLM J;  3LNQ A;  5FD5 A;  3BTL A;  3ZQI A;  5JHF A;  2ZNY A;  1X3Z B;  3BLY A;  5IOY A;  2P6S A;  2DMQ A;  4IHT A;  3KZZ A;  4Y3O A;  3SJM A;  3PSF A;  5HLG A;  3JRI A;  1ZR2 A;  1IG7 A;  2QKM B;  1J9I A;  2ZO4 A;  4RAY A;  4AIH A;  1BOA A;  3LSP A;  3SDB A;  4IJA A;  5B1A H;  1P6R A;  1I1S A;  1JKP C;  2V79 A;  3SYT A;  1TC3 C;  3M1E A;  5FRM A;  3ISP A;  2X6W A;  4YFN F;  3GFJ A;  1ZYR F;  1FWZ A;  3IWF A;  4UNO A;  2K85 A;  1YTY A;  1B8I A;  1ACI A;  2WC2 A;  1OJL A;  1UHW A;  4BBR J;  3HG9 A;  5F0F A;  3GTJ J;  1EF4 A;  2VKE A;  2DYR H;  2ME0 A;  5EEA A;  2NOJ B;  3H0G J;  5FB2 A;  4PCQ A;  1GVD A;  5FO5 A;  3G71 I;  1VQ4 I;  3CUQ B;  1LB2 A;  3ERE D;  2Z33 A;  2XKO A;  5D5W B;  4KA4 A;  1RI7 A;  1XGO A;  2XAQ A;  1X4P A;  3IV5 A;  1ZRD A;  2Y69 H;  4U0W A;  3QU6 A;  2ZFW A;  4P1W A;  3CMY A;  4BYY A;  1MMD A;  2HPI A;  2O03 A;  2FBK A;  2UUZ A;  1ZG5 A;  1JJ6 C;  3FMR A;  5IT9 K;  4XLH A;  1TT0 A;  4ANJ A;  2ZC2 A;  3GFL A;  2VKV A;  2L7M P;  1YYV A;  4RM3 A;  2X48 A;  2QBY A;  4G6T B;  2VPR A;  3J7Z I;  3PNV A;  3CP2 A;  1LE8 B;  3HOZ J;  1ZN2 A;  3K4B A;  5IP9 J;  1PUF A;  2XAU A;  5HLH A;  4BJT A;  4OIQ F;  1D8J A;  2KFD A;  2FUG 2;  1W7P B;  2HS5 A;  4G6D A;  1Z1D A;  2J5P A;  3H3Z A;  3BTC A;  2XAS A;  2WBM A;  5E20 A;  1WJE A;  1FY7 A;  2QYO A;  3H3V K;  4XLC A;  4I2O A;  4DGW B;  4JX6 A;  2O0Y A;  1TW3 A;  2R5Z A;  4J00 A;  2R3S A;  4GFB A;  4PSW A;  3JW4 A;  4XQF A;  1L3L A;  2CQK A;  2JMW A;  4B3A A;  1I6X A;  4FAS D;  3BPX A;  3PUB A;  4Y15 A;  2F4M B;  1SVO A;  4IF4 A;  1W5S A;  4HNT A;  5FFZ A;  3E6D A;  2VIX A;  2XPW A;  4KMU X;  1JT0 A;  5C44 J;  3KYC B;  4L5E A;  2KPM A;  4EV0 A;  4II2 A;  1J0R A;  1KYW A;  4QIW N;  2HOS A;  2M3A A;  3E7L A;  1O3S A;  2ZJQ F;  1QZY A;  4A0Z A;  3C2H A;  4A6D A;  1JXS A;  4GO1 A;  4A6E A;  3OYJ A;  1AHD P;  3LST A;  2Y0S A;  2Y30 A;  2W00 A;  3S2W A;  3HC7 A;  1ZAO A;  4P96 A;  2V1X A;  3OYD A;  3F8C A;  3LWF A;  2DU9 A;  2VE8 A;  4BY7 J;  4XRS A;  4XKC A;  2O6G E;  3LA3 A;  2IGM A;  1OPC A;  3SEZ A;  2BHY A;  2BVM A;  2E2J J;  2LSO A;  4HNU A;  9ANT A;  1L0O C;  4LK1 F;  3LSM A;  3RPU D;  1UST A;  3T8T A;  2OQR A;  4LG0 A;  2DOA A;  2MAB A;  4I01 A;  1ZRE A;  4FX0 A;  1IZ1 A;  4UV9 A;  4Y7N J;  1B59 A;  3QOP A;  4B43 A;  1MSE C;  4Y52 J;  1RES A;  1EA3 A;  2DOD A;  2G9W A;  2M2E A;  4BJ6 C;  3N05 A;  4PFO A;  2EA4 A;  2R7R A;  1GXP A;  4M71 A;  4D7M A;  2DPD A;  3F23 A;  5J1R A;  2QA4 I;  4RBO A;  4RMN A;  3ASO H;  4JQF A;  2VBZ A;  2LY1 A;  1B1B A;  5HOD A;  3OYH A;  1B4A A;  3I54 A;  1LQ1 A;  4FHT A;  4EVI A;  3JRF A;  2FF4 A;  3FWE A;  2OQG A;  4EJV A;  1A04 A;  2ZJ2 A;  1JKQ C;  2F48 A;  5JLX A;  2KLO A;  4AU7 A;  1ETX A;  4UHT A;  1V55 H;  2VQH A;  1HKQ A;  4ITV A;  1LDJ A;  1P2F A;  4LFU A;  1GDT A;  4IHW A;  3FZV A;  3CQZ J;  4A3C J;  3DEU A;  5CVV A;  3Q0U A;  2R0Q C;  1HKT A;  2R5Y B;  4ZDL A;  4EM1 A;  5LFA A;  3KEQ A;  1WH5 A;  2HU9 A;  4G7H F;  2L4M A;  3DWL E;  2YSR A;  3SEQ A;  2KP6 A;  3ZMT A;  3G4S I;  2ZBK A;  4I0B A;  1FMV A;  2GXA A;  5H6Q A;  1Z91 A;  3DQV C;  5JFR A;  3S32 A;  1R4M B;  2EQR A;  2V6C A;  2JRT A;  1RR8 C;  3PL8 A;  1OCO H;  3OY9 A;  1WJB A;  1IXR C;  2VC0 A;  3W2V A;  3ONQ A;  1ON2 A;  4JX5 A;  3A4C A;  4UUV A;  3I3L A;  1EKE A;  1JUS A;  2AQF A;  1REP C;  1U5T A;  1PP7 U;  4QTR A;  3PQK A;  2R92 J;  5J40 A;  2IP2 A;  4PJ0 C;  4FT8 A;  1DPU A;  2AO9 A;  2Q1Z B;  4UB6 C;  1QZZ A;  3CJR B;  2OUM A;  2OU2 A;  4J19 A;  1U8R A;  1IRX A;  3QPL A;  4C9Y A;  1VQ5 I;  1JGG A;  4X0G A;  2LBF B;  2F5F A;  3RQ4 A;  1A6I A;  4RGX A;  2R7T A;  5TIS C;  1QVU A;  2EA2 A;  5KVR A;  3DEE A;  2Q2E A;  4E7S A;  2VT3 A;  3QPH A;  3BRO A;  2DK5 A;  2M34 A;  1ON1 A;  3FXU A;  3IHU A;  1IXS B;  3JR9 A;  2HR3 A;  4C3H J;  1YW8 A;  1R7J A;  1JHF A;  5ICF A;  2XF5 A;  3BR3 A;  3WTY C;  3CCE I;  3PIO F;  2DJI A;  1YIJ I;  2KT0 A;  3K4L A;  1RPW A;  5E8I A;  2KQR A;  5LGT A;  3WTX C;  3MZH A;  2Z16 A;  4NB5 A;  4HLY A;  2H1K A;  2LRE A;  3COA C;  2QSH X;  5A2Q K;  3HSF A;  2FNA A;  3DV8 A;  2XAJ A;  4ZYG A;  2E2I J;  1VQM I;  1AA7 A;  3RTR A;  3HPG A;  1HW5 A;  1R36 A;  5EZG A;  2CUE A;  3PIP F;  1I3Q J;  3SQN A;  5JLW A;  4KFC A;  1T08 B;  3SXY A;  3EUH C;  2XF7 A;  1IO2 A;  3BTI A;  3WG7 H;  1MZB A;  3HOS A;  1FBS A;  2E1M C;  1HKS A;  4EM0 B;  2VLA A;  1F4K A;  1V5E A;  1V5F A;  2M4K A;  2DA6 A;  4FIS A;  4V2G A;  2XRN A;  3QYF A;  4LLG F;  1KON A;  5D6E A;  4E6K G;  4CO8 A;  2DAO A;  4NQW B;  2MSY A;  3OIQ A;  3MMY B;  3QP6 A;  2H09 A;  2VON A;  1JI8 A;  1OQY A;  5LGN A;  5FLX K;  2F6C A;  4LIV A;  5K7F A;  1G3W A;  2JVH A;  3M8F A;  3R0J A;  4W1U A;  4CGZ A;  4OMY A;  1K78 B;  1UFM A;  2M45 A;  1D0X A;  4O6J A;  2R7S A;  2JN6 A;  3ABK H;  2NAZ A;  2VB6 A;  2PLY A;  1UHM A;  1IUY A;  2DN0 A;  4OIN F;  1J5Y A;  1K4S A;  3R6S A;  1ZAR A;  2R7D A;  3IAS 2;  1RRJ A;  3BT9 A;  1HW1 A;  2RN7 A;  4Q47 A;  4A5M A;  4DBQ A;  3OR2 C;  1PP8 F;  2JPC A;  2IRF G;  3CCL I;  3VYR B;  3P9K A;  1I50 J;  2ID3 A;  1GV5 A;  1ZG1 A;  2DBB A;  1F36 A;  3L2C A;  1R23 A;  4CCN A;  3S1N J;  3JRC A;  2IT0 A;  5BMZ A;  2RRE A;  3RKY A;  3EUH A;  5E3N A;  2HQR A;  4DOZ A;  1KU9 A;  3CCV I;  2JJ7 A;  2RVC A;  2NXN B;  3BR0 A;  4EJT A;  1T56 A;  5D5V B;  2EPF A;  3RKW A;  3GTK J;  1ITY A;  4ZYH A;  2L54 A;  4R8H A;  1TQP A;  1MKM A;  5BPI A;  5GPA A;  2V4J C;  2JA5 J;  3ZQC A;  4IL6 C;  2GZW A;  3NQO A;  3E5U A;  3MN2 A;  1GHC A;  3ZPL A;  1Y0N A;  4UVB A;  5K7Z A;  4FTH A;  4I09 A;  3UKG A;  4B44 A;  2P7V B;  2M9H A;  4XKB A;  2GIV A;  4D5F A;  2W85 A;  2PN6 A;  2CO5 A;  2RNG A;  2XB5 A;  2OCC H;  1E3O C;  3I59 A;  3FM5 A;  2M4G A;  1PVE A;  1LE8 A;  3HOT A;  3GLL A;  3PFI A;  5LEJ A;  3K7A J;  2XRO A;  3LAJ A;  1HXD A;  3CO6 C;  4OMZ A;  1J75 A;  1FP1 D;  3HYI A;  1W7P A;  2DJN A;  4PJN A;  1BBY A;  1RZ4 A;  5IYD J;  4NBQ A;  2HZT A;  3G1M A;  2PEX A;  4L0Y B;  1R4N B;  1XDS A;  1XGS A;  4HPQ A;  3OS2 A;  4PGH A;  3CMA I;  3BC8 A;  1SD7 A;  4E7K A;  2BY3 A;  1J7K A;  1ETK A;  3DU6 A;  5FKM A;  1FBQ A;  4ZYE A;  1IAW A;  3DF8 A;  3CES A;  4LD5 A;  1WWX A;  1MGT A;  2QWW A;  3EET A;  4RAF A;  3BDD A;  1ZK8 A;  1FYL A;  2XVC A;  4YFK F;  3SZT A;  2LFB A;  4RM2 A;  5FGM A;  2NVQ J;  3L09 A;  2VUM J;  4WK8 F;  1BW6 A;  2JWT A;  1FZP B;  5K5R A;  4X6A J;  4BE2 A;  1FSE A;  1YW7 A;  2QSF X;  5ERI A;  1ZKG A;  2DDA A;  2P4W A;  5D4S A;  3REO A;  4ZZL A;  2DOE A;  2E2H J;  2ICW G;  5D6F A;  5BNG A;  1T2K A;  3OIP A;  3ESW B;  4BUP A;  4R79 A;  1OKR A;  3L2W A;  3HRM A;  3ZQH A;  3CDI A;  3E6M A;  4OIO F;  4S04 A;  3CJN A;  1JKO C;  5FJ8 J;  5EEG A;  1VQ8 I;  2VL8 A;  5D8L B;  1FOY A;  1S5L C;  1XSV A;  3KLN A;  4FQG A;  4N9I A;  2XPU A;  1SC7 A;  1ETO A;  2VOD A;  3FXR A;  4HX4 A;  2OZU A;  4J01 A;  4IHY A;  3IP4 B;  1YIO A;  4V19 K;  5EZH A;  2VXD A;  4DYR A;  1D5V A;  4N4N B;  4GDF A;  3JAM K;  1ZTR A;  3M8E A;  3CCM I;  3BQY A;  2BEO A;  2EJR A;  4ESF A;  1IV8 A;  4ZDP A;  2ZJP F;  5ILV A;  2HTS A;  4HX8 A;  2BW3 A;  3H5A A;  1W7P D;  1QU3 A;  3CF2 A;  4XSZ F;  5IP6 A;  4KN7 X;  4AYB A;  2HQN A;  5AON A;  2CW7 A;  3CTA A;  3S8P A;  3IKV A;  5BS6 A;  1PDN C;  2DA3 A;  2DMN A;  2KRH A;  3C1D A;  5L3C A;  4A3G J;  2W24 A;  1J59 A;  2W4S A;  3KZI C;  3RKQ A;  4LG3 A;  2H27 A;  2EZI A;  2MLK A;  5J1U A;  2ISZ A;  1LUJ B;  5F04 A;  3I71 A;  3DTE A;  3KX2 A;  5DM7 F;  5L3G A;  5E8G A;  2V6E A;  2OA4 A;  3DU5 A;  2EZK A;  3SZG A;  2ZSH B;  2BHZ A;  4IKF A;  3QPS A;  2CH0 A;  2AQE A;  4D9J A;  5FRO A;  4G12 A;  3HXL A;  2AXL A;  3FKI J;  3G1L A;  3O8H A;  4B3X A;  1B9N A;  2L9S A;  1ZGJ A;  2A69 F;  4MGR A;  2Y2Z A;  2HGC A;  4KIS A;  3ELK A;  4ZH4 F;  2GM4 A;  2E71 A;  1F43 A;  3V8J A;  4D5C A;  1X3U A;  2JRM A;  2K27 A;  3CLO A;  3E3V A;  3PQJ A;  5E18 F;  5L3F A;  2P6T A;  2GXB A;  1FOK A;  3M1C A;  4I99 C;  1GT0 C;  2RV8 A;  4G7O F;  2DYS H;  2UXX A;  4GYI A;  4XL9 A;  5E3M A;  4HRI A;  4TV7 A;  1JGS A;  2MD5 A;  4NNJ A;  1ZG3 A;  2VE9 A;  5J8F A;  4Q4Z F;  2KJC A;  5LEK A;  2OTJ I;  3W2A A;  1LVA A;  5H20 A;  4DZP A;  2B9S A;  2LBF A;  4M3D A;  1R22 A;  2CQ7 A;  4KT5 C;  4M3E A;  3AL0 C;  3CMM A;  3GFM A;  4CXF A;  1HSJ A;  2DI3 A;  1G3T A;  2L3D A;  2QSG X;  2BOL A;  3K4K A;  3W2W A;  2L9V A;  3OL4 A;  5LLQ A;  1X1B A;  2R4G A;  3JRG A;  2JUG A;  2FX0 A;  1HOM A;  4Y33 A;  4OWR B;  2GA2 A;  3K4M A;  4CH7 A;  1GVJ A;  5HS8 A;  2VAS A;  2EZL A;  5EJC A;  2OC6 A;  4I7H A;  3OYK A;  5DCM B;  4IX7 A;  4ZTF A;  4CSW A;  1GXQ A;  1XMA A;  4ENJ A;  2EV0 A;  5DCF A;  1T95 A;  2LY2 A;  4PK4 A;  3HUG B;  1SEU A;  4UB8 C;  2M8G X;  2KHM A;  1G6N A;  4XIC A;  5D5X B;  1AWC A;  1HCR A;  2P5K A;  3F72 A;  5L3D A;  4DBR A;  4ZC3 A;  3JCU C;  1EH7 A;  4BE0 A;  4MFD A;  1BJZ A;  4P55 A;  2ESH A;  4D7N A;  1SFO J;  1OCZ H;  2NYX A;  3U9G A;  4AUX A;  1BW5 A;  1RNL A;  4MTD A;  1HST A;  1IN4 A;  2G0E A;  4EGZ A;  1MMA A;  1YHQ I;  1WVR A;  3KP6 A;  1SD5 A;  4YII A;  3BG9 A;  3LOC A;  4IHV A;  5JVG F;  1ZRC A;  2Z1D A;  2CMP A;  3GME A;  1VQ6 I;  2JSC A;  2P0W A;  2DA5 A;  1MBH A;  2MH2 A;  3F3X A;  2V1N A;  4S0H B;  2QQA A;  1XDU A;  3V7R A;  4L9T A;  1NTC A;  2CW8 A;  1LJ9 A;  1FSH A;  2V1D A;  2CGP A;  2H8R A;  2R7F A;  3EDP A;  1UG2 A;  4U7D A;  3J7A O;  3MVP A;  2B7E A;  2WAF A;  2NS0 A;  1G3Y A;  2L02 A;  3ZQL A;  5EGO B;  1YLF A;  4LLL A;  4HF2 A;  1BI2 A;  2DK8 A;  4XNF A;  4BJ5 C;  5H2F C;  3L7W A;  2PJR A;  3J7A Y;  2XUB A;  2TRT A;  3QOE A;  2E60 A;  2QM3 A;  1XMK A;  2VBW A;  4ABZ A;  1VF9 A;  1X3W B;  5LRS A;  2DA4 A;  3CZ6 A;  5TRD A;  1P4X A;  2OAZ A;  5E1Z B;  4ZDO A;  5ICC A;  1B72 A;  3ZGK A;  4A5N A;  2A07 F;  4F55 A;  1FLI A;  3UNG C;  1HDP A;  1MD0 A;  1QPI A;  1JHH A;  3U1K A;  1BR2 A;  3WU2 C;  1IN5 A;  4AVZ A;  4M3B A;  3MKY B;  2W25 A;  3FHZ A;  2E35 A;  3GLX A;  3LQQ A;  1Y8R B;  2VC1 A;  2E1N A;  4HSR A;  4KIF A;  2FD5 A;  3H35 A;  3KP2 A;  1IDY A;  4M9S A;  4N9H A;  4O5V A;  2N8G A;  4A3D J;  4ZYA A;  1NK3 P;  2JT1 A;  5IT9 Z;  2ZFU A;  1JTX A;  1K83 J;  5IOZ A;  5M5X J;  4B4C A;  1NHA A;  2CQN A;  1XC5 A;  2G7U A;  2WTE A;  1Y1W J;  1QBJ A;  1EH8 A;  1T33 A;  5FKN A;  1WQ2 A;  2A05 A;  2M1B A;  4RB2 C;  2O7O A;  1SFU A;  2O8K A;  2D45 A;  3RPU A;  1MDM B;  4R1H A;  2KIM A;  4H4K C;  1IC8 A;  1ZLJ A;  5EG0 B;  1H89 C;  2W7N A;  2R7V A;  4BQN A;  1D5Y A;  2XPV A;  3CUO A;  3LSK A;  5IYC J;  3MKZ A;  4G8X A;  3W6J B;  5HNH A;  3GVA A;  3Q0V A;  1QGP A;  2M87 A;  5GTI C;  1DGW Y;  2Z2S B;  1MBJ A;  2D1H A;  3TO9 A;  1D0Y A;  1R71 A;  4XLA A;  2ECC A;  2MA3 A;  1QHH D;  3M3Y J;  3IH2 A;  3A01 A;  3B6A A;  2STT A;  3DXJ F;  2MYS A;  1X2M A;  2JUC A;  3AG4 H;  3WGH A;  4HG2 A;  4BEH A;  3IL2 A;  2V26 A;  1R1V A;  5M3M J;  3KET A;  1ETV A;  4PFP A;  1LVK A;  2ZXW H;  1IRZ A;  3E0J B;  3QP5 A;  5E3L A;  1Z6R A;  3L00 A;  2XV4 S;  3KE2 A;  1R5I D;  2JA6 J;  2ZB9 A;  4XOT A;  5GPC A;  4KYW A;  3CO7 C;  3QYB A;  3AFH A;  2COM A;  4F3Q A;  5ICG A;  4BGD A;  1BIB A;  2YS9 A;  1H8A C;  2PMH A;  2OTL I;  4O3M A;  1T39 A;  3LL7 A;  1K7A A;  1SAU A;  2BBY A;  2JVG A;  2UXN A;  4AID A;  1DP7 P;  4WCG A;  1UCR A;  3CME I;  3Q5F A;  3HSR A;  2HOE A;  4MLO A;  4CUG A;  2I8D A;  2QGU A;  3BR6 A;  3SDG A;  2BY2 A;  3IRR A;  5LRR A;  2GAU A;  1S8N A;  1O4X A;  3WTZ A;  2E7W A;  1K79 A;  1W36 D;  3ECH A;  3EYY A;  3WTT C;  3GZ6 A;  1U0J A;  1MND A;  5DUI A;  5DDG A;  4E7I A;  3FF5 A;  2VPL A;  3M9A A;  1JKR C;  1TWC J;  1S29 A;  4OIP F;  3CJQ B;  3HOU J;  3S93 A;  1WJ5 A;  2WV0 A;  4OU0 A;  2X1C A;  3BTJ A;  4EQQ A;  3PM1 A;  1S9H A;  4UVC A;  5D8K B;  1USS A;  3DPL C;  3OYG A;  4BQQ A;  4PZJ A;  4P9U A;  2FQ3 A;  2FJ1 A;  4I76 A;  4DW6 A;  5B5E C;  3OYB A;  1RR7 A;  2DT6 A;  3E6C C;  2UWM A;  3VYS B;  4QPO A;  4L9N A;  2LMD A;  3C7J A;  1A6Q A;  1YRN B;  3L1P A;  2X1D A;  1OMI A;  3J80 K;  1R1T A;  4WX9 A;  3WU1 B;  2ZKZ A;  2HOT A;  2FML A;  3GX4 X;  3GXO A;  2ZXJ A;  4PJL A;  2E1C A;  4KN4 X;  1U5T C;  3OV8 A;  3K2A A;  5F64 A;  3QOD A;  3F8M A;  4XOR A;  3S16 J;  4ESJ A;  1TNS A;  2ZXH A;  2AXT C;  3ZMD A;  3I58 A;  3RDI A;  3VB2 A;  1VQ7 I;  2M5W A;  1XS9 A;  2GBY A;  2KIF A;  2OBP A;  4DYC A;  2LY9 A;  1N25 A;  4NC7 A;  2ESN A;  3RPQ A;  1QHG A;  4EM2 A;  1R1U A;  2HDD A;  1E3H A;  3WE3 A;  2K86 A;  4EAT A;  5TJJ A;  3OYL A;  1VQ9 I;  4XM3 A;  2MH9 A;  1IW7 F;  1XG1 A;  2E1O A;  4A3I J;  4LK0 F;  3JTG A;  3RZO J;  4ZZD A;  2K4J A;  3HHG A;  5JVT A;  3MQ0 A;  3E5X A;  2I10 A;  3O8G A;  2HEO A;  2A3S A;  2BVL A;  1Y1V J;  1KYZ A;  3K4N A;  3VFZ A;  1X1C A;  3BZ6 A;  1W5T A;  2OJE D;  2K3P A;  2H1L A;  1EV7 A;  1BJA A;  1BR4 A;  3TO6 A;  4BE1 A;  4G7Z F;  3QQA A;  3QAH A;  4XLE A;  3J81 Z;  3H0D A;  1OR7 A;  3ZCO A;  4UUS B;  4CCM A;  1Z3X A;  3FK6 A;  1SD4 A;  3OS1 A;  3EYI A;  1FYK A;  3OYM A;  2DO7 A;  3N4M A;  1IUF A;  2P81 A;  3MD2 A;  3SFZ A;  4M6Y A;  3DEW A;  4HST A;  1S7E A;  2K9N A;  4AIJ A;  3PNY A;  3WGI A;  2L2O A;  5C4J J;  1NK2 P;  1DQU A;  3B02 A;  4KDP A;  3ABM H;  5DS9 A;  1JT6 A;  2XC7 A;  2VOP A;  3E1S A;  1WSU A;  3I56 I;  2HVR A;  2L9R A;  2A61 A;  2CS3 A;  3GBG A;  3NAR A;  1XPX A; 
#chains in the Genus database with same CATH homology
 1FPQ A;  1LNW A;  2HKO A;  1MJ9 A;  3LQR A;  3GFI A;  5KK1 A;  4RB0 A;  2QVO A;  3ABU A;  2P8T A;  1CGP A;  4ENM A;  1QPM A;  3ZP5 A;  3T1B A;  5A2Q Z;  3ROU A;  3WU0 A;  4HYE A;  4EMS A;  3U1D A;  4AD9 A;  1CF7 B;  5DCM A;  3MZY A;  2HDC A;  2ZME B;  2HKX A;  3H3U A;  2IW5 A;  2VXZ A;  3GYH X;  1ODD A;  1V4R A;  4P5O A;  5HOO A;  4A12 A;  3FXQ A;  3ULQ B;  2RGV A;  2P5L C;  2M8E A;  5FLX Z;  2HFH A;  2Q8K A;  1IRG A;  2PMU A;  1D8K A;  1I5Z A;  1IN6 A;  2DPU A;  4G94 A;  2MLG A;  2Z3Y A;  1VTN C;  4IRI A;  2F2E A;  3K1N A;  5K5O A;  1ONV A;  3V4G A;  3HRT A;  3F22 A;  1Z9C A;  1C0W A;  1ZHF A;  4OIR F;  4MEX F;  5LHG A;  3DFG A;  1B6A A;  2W84 A;  4LGW A;  2NRA C;  4ENN A;  2BGC A;  3TDZ C;  3HIF A;  3CUQ A;  3U2R A;  5HDG A;  2DW4 A;  3GUD A;  4EJU A;  5HDK A;  2PG4 A;  2FE3 A;  4BXU A;  3F6V A;  3P9C A;  3FMQ A;  1OYY A;  5AIQ A;  2C6Y A;  1S7O A;  1FT9 A;  2LDU A;  2VT2 A;  4DQ2 A;  2F5D A;  4HDU A;  2QBY B;  4YG2 F;  3WTW C;  3K2Z A;  5LGU A;  2NNN A;  2L4A A;  2JPB A;  2H6C A;  2YR2 A;  4IRH A;  4FX4 A;  3ML6 A;  3AAF A;  4RB3 C;  5BOX A;  1F1Z A;  4HLX A;  2MC3 A;  5CVU A;  1SAX A;  4HV5 A;  5CVJ A;  4KIB A;  4U7B A;  3M7G A;  3KLO A;  1QNT A;  1T0F A;  3WE2 A;  4Y17 A;  4EJO A;  4IVN A;  5FD6 A;  3BY6 A;  3VOD A;  2ZCW A;  2YPR A;  3D0S A;  3WOD F;  1D3Y A;  1G4D A;  2IA0 A;  2A5Y B;  3K69 A;  4RGU A;  3JAM Z;  2D2W A;  4ENK A;  4Y13 A;  3V8K A;  2X0L A;  3T0Y A;  3LA2 A;  1YS7 A;  5ILU A;  3KP3 A;  2FU4 A;  2LF8 A;  2X4H A;  4RB1 A;  2EB7 A;  4LG0 B;  3TGN A;  5LHI A;  3BJO A;  1FC3 A;  2A6E F;  1RIO H;  1XSD A;  2ACJ A;  4HX7 A;  3RKX A;  3HRU A;  3IWZ A;  1U78 A;  1YS6 A;  1BIA A;  4ESB A;  1R00 A;  2CWE A;  4PDK A;  1IF1 A;  2EFQ A;  2STW A;  5D5U B;  4M72 A;  4K2E A;  3HHH A;  1KQ9 A;  3KP7 A;  1SFX A;  1XSX A;  3F8N A;  4U88 A;  3E97 A;  4DNC A;  3GEZ A;  1TQM A;  1J2X A;  4RGS A;  4L9J A;  2G7H A;  3T5X A;  1YFH A;  4IHS A;  1BI3 A;  3ZMU A;  4A0X A;  1U5T B;  2EFW A;  1RUN A;  3KEO A;  4ON0 A;  4L5I A;  2CYY A;  3K9T A;  4U0Y A;  2PJP A;  4Z2Y A;  3GO5 A;  4GXO A;  4HA8 A;  1S7A A;  2F5E A;  2EFN A;  2EFP A;  4CZZ A;  1R5H A;  4MNU A;  4BQA A;  4B09 A;  3FMS A;  2V9V A;  2YX4 A;  4E70 A;  3K1M A;  1LEA A;  1AOY A;  3MAJ A;  2DTR A;  1S3J A;  3LFK A;  5LHH A;  2D1V A;  2J5O A;  4XRF A;  1XGN A;  3ZQ7 A;  2O61 A;  2HTJ A;  4IPA A;  3VOE A;  1FX7 A;  3HSE A;  4NQW A;  5IT3 A;  1QO0 D;  2EV5 A;  2FBH A;  4YIF A;  5DD4 A;  5AIP A;  2HWV A;  1K78 A;  2GA1 A;  3F21 A;  3DKW A;  3E6B A;  2XAF A;  5HLI A;  3GF2 A;  4LLN A;  3GZ5 A;  2GWR A;  3F8F A;  1U3E M;  4I98 B;  5JR3 A;  3P7N A;  4JK1 X;  1I27 A;  1SMY F;  2HYG D;  1KU3 A;  5HDN A;  2IPQ X;  1O7F A;  4MHG A;  3MCZ A;  3I5U A;  4WXD A;  1YO5 C;  1DUX C;  2PFB A;  1PUE E;  5DYM A;  4UVA A;  1BN5 A;  3WG9 A;  3V7S A;  4XLN F;  2K7L A;  5ILS A;  2M30 A;  1F5T A;  1IN7 A;  2H6B A;  3QRF F;  2RDP A;  3ZMV A;  4HW0 A;  5DV5 A;  4LJZ F;  4OOI A;  4KMF A;  5EEH A;  1HQC A;  1YW9 A;  1HW2 A;  2YU3 A;  4NHJ A;  3NEU A;  4F7Z A;  3T8R A;  2H94 A;  4BHB A;  1ZH5 A;  2ETH A;  4M9Z A;  4IXA A;  1S6L A;  3I59 B;  4YFX F;  2F5C A;  2XGX A;  3Q9S A;  2CW0 F;  4M73 A;  3TO7 A;  5F1R A;  1BC7 C;  3K0L A;  3MFK A;  1HBX G;  3HTU A;  1KQ8 A;  2QQB A;  1TNT A;  2QEN A;  3ECO A;  3DP7 A;  2Z99 A;  5DD8 A;  4GGG A;  1XCB A;  1U2W A;  2CSO A;  2QLZ A;  3ZMZ A;  3TKY A;  3I0T A;  5HVQ C;  3R4K A;  1JE8 A;  3CDH A;  2O3F A;  4N0B A;  1UB9 A;  4M74 A;  4AVP A;  3GW2 A;  4A0Y A;  1DDN A;  3IC7 A;  2Y0M A;  1H0M A;  4PGG A;  3J80 Z;  1STZ A;  4L9V A;  1TBX A;  1TW2 A;  1XN7 A;  4M6X A;  3BJA A;  4L5J A;  2FNP A;  1WKM A;  3KFW X;  1SFE A;  3WTS C;  4G9Y A;  2RQP A;  2LF7 A;  3I53 A;  5ED4 A;  3ABT A;  1IRF A;  5BPD A;  3E5Q A;  1DPR A;  1Z6T A;  1O3Q A;  3N97 A;  1E2X A;  1U6G A;  2A68 F;  4MTE A;  3SZP A;  4B8X A;  2DFI A;  3WTV C;  3SHF A;  2IJL A;  1T38 A;  4KNY A;  2K02 A;  2GXG A;  3HTS B;  2VN2 A;  4MEY F;  2ISY A;  3WTU C;  2JZY A;  4HBL A;  1G3S A;  5CJ9 A;  3TOB A;  4XBF A;  2PQ8 A;  2IA1 A;  3TQN A;  1P4A A;  1I1G A;  1RUO A;  1LDK B;  2V1U A;  4GYG A;  2ELH A;  4AWX B;  1KU7 A;  2PBI A;  1BI0 A;  5FFX A;  4ZYD A;  3ZN0 A;  3F8B A;  5L3B A;  3J81 K;  2XIG A;  5CYV A;  1V3F A;  1ULY A;  2Q0O A;  3KP4 A;  3ZN1 A;  4EJW A;  2AS5 F;  4H0E A;  4EGY A;  1FBU A;  4WXC A;  2JTV A;  1BM9 A;  3QU3 A;  1LEB A;  2CFX A;  2FBI A;  1ZLK A;  5H6R A;  1P92 A;  1XCV A;  2RKH A;  3HUG A;  2MBF A;  2HYF A;  4Q48 A;  4BHC A;  4G6Q A;  2KKO A;  5HS7 A;  1XD7 A;  2EFO A;  4P9F A;  2FEZ A;  3CUQ C;  2Z5U A;  4HZF A;  2DQR A;  1R5G A;  2Y75 A;  4L18 B;  1ZGA A;  3BP8 A;  3O3K A;  4XSX F;  3VEP A;  3MWM A;  1E17 A;  3O2P E;  3RJP A;  3TDU C;  1TLH B;  4HAM A;  4GCV A;  4WXH A;  3C18 A;  4QLC U;  1KU2 A;  4QWQ A;  4XLP F;  3HRS A;  6PAX A;  3QPT A;  2A6H F;  1Z7U A;  3JSO A;  2O8X A;  3TOA A;  4Q5S F;  3Q9V A;  3IKT A;  1KQ0 A;  2QUF A;  2EWN A;  3KCC A;  2BE5 F;  2DT5 A;  3GWZ A;  4HV6 A;  4RS8 A;  4HDV A;  5E17 F;  5LBQ A;  2L01 A;  1Q1H A;  1O3R A;  2FMY A;  3G3Z A;  2VBY A;  4RAZ A;  4HOB A;  1P4W A;  2RC4 A;  4CHU A;  1O57 A;  5JI6 A;  1SMT A;  4MQ9 F;  1MDM A;  5CVI A;  4IRG A;  4UV8 A;  4HQE A;  2QZ8 A;  3IRQ A;  2ADU A;  3ZMS A;  3MEX A;  4AIK A;  4MQV A;  4M9X A;  1W4M A;  4UXN A;  1IXC A;  2DQL A;  4WWC A;  3W6K B;  2ZNZ A;  2UZK A;  5L3E A;  3I4P A;  5BQT A;  2Z9O A;  2TDX A;  1MJA A;  4I0A A;  3FX3 A;  2XKP A;  3C3W A;  2EK5 A;  2FA5 A;  4CDG A;  2KIU A;  1O7L A;  1OYW A;  1WI9 A;  2FXA A;  1BI1 A;  1H9T A;  2NNY A;  2XHK A;  2E7X A;  2OD5 A;  3G73 A;  1QQI A;  1FNN A;  1KA8 A;  1MJB A;  1B9M A;  2BYV E;  2B0L A;  4CIC A;  2XAG A;  3P9I A;  1IN8 A;  3BPV A;  3I64 A;  2WWY A;  2KJB A;  3KZY A;  3D5L A;  5E1W A;  2LKP A;  4BH9 A;  4BHP A;  4HF1 A;  5DUK A;  5J6X A;  2XAH A;  1FP2 A;  1TTY A;  5J8C A;  4ASN A;  1H9G A;  4LB6 B;  4CYD A;  2YX7 A;  4A2U A;  5JHU A;  1T98 A;  3EQL F;  5D4R A;  2EV6 A;  4I02 A;  2Y48 A;  2KRF A;  1K6O A;  1BC8 C;  2FRH A;  1TQI A;  3KP5 A;  3WGG A;  4ETS A;  5HS9 A;  2DLL A;  5E1X A;  2QQ9 A;  2IA2 A;  5DEQ A;  4S05 A;  3K1P A;  1LDD A;  4BNC A;  2VOO A;  3RYP A;  3R61 A;  5F6F A;  2FSW A;  3RIR A;  2P7C B;  3L9F A;  5K5Q A;  1YQA A;  1O3T A;  2P5V A;  2RNJ A;  2BV6 A;  1FYM A;  4WF2 A;  3BOQ A;  4KIG A;  1XB4 A;  2CG4 A;  4HQM A;  4LB5 A;  3JTH A;  1Z05 A;  3OOP A;  4D0P A;  5K1Y A;  3V8L A;  1ZRF A;  1WRJ A;  4HF0 A;  1Y0U A;  1KGS A;  2GQQ A;  1CF7 A;  2VBX A;  4KIC A;  3FM3 A;  2FOK A;  2OZ6 A;  3O6B B;  4BAY A;  1EH6 A;  2K4B A;  3BJ6 A;  4KUM A;  1F9N A;  5CLS A;  4RGR A;  1R58 A;  2W57 A;  2ZME A;  1SD6 A;  3F6O A;  3DPT A;  5CVR A;  3JSP A;  1YG2 A;  3RYR A;  4JBA A;  3H92 A;  3BWG A;  3RI4 A;  1OYI A;  2LNB A;  3R0A A;  4L0Z B;  3LA7 A;  3V7C A;  5ICE A;  1T6S A;  3R60 A;  3NRV A;  2IVM A;  4LMY A;  3LAP A;  3B73 A;  1XGM A;  4U0V A;  5FD5 A;  2ZNY A;  2P6S A;  4IHT A;  3KZZ A;  5HLG A;  1J9I A;  2ZO4 A;  4RAY A;  4AIH A;  1BOA A;  4IJA A;  1P6R A;  1I1S A;  2V79 A;  3M1E A;  3ISP A;  4YFN F;  3GFJ A;  1ZYR F;  1FWZ A;  3IWF A;  4UNO A;  1YTY A;  2WC2 A;  1UHW A;  5FB2 A;  4PCQ A;  5FO5 A;  3CUQ B;  1LB2 A;  3ERE D;  2Z33 A;  2XKO A;  5D5W B;  4KA4 A;  1RI7 A;  1XGO A;  2XAQ A;  1ZRD A;  4U0W A;  3QU6 A;  2ZFW A;  4BYY A;  2O03 A;  2FBK A;  1ZG5 A;  3FMR A;  5IT9 K;  3GFL A;  1YYV A;  2QBY A;  1ZN2 A;  1D8J A;  4OIQ F;  5HLH A;  1W7P B;  2HS5 A;  4G6D A;  1Z1D A;  2J5P A;  3H3Z A;  2XAS A;  5E20 A;  1FY7 A;  2QYO A;  4I2O A;  2O0Y A;  1TW3 A;  2R3S A;  3JW4 A;  1L3L A;  2CQK A;  1I6X A;  3BPX A;  4Y15 A;  4IF4 A;  1W5S A;  5FFZ A;  3E6D A;  4KMU X;  4EV0 A;  1J0R A;  1KYW A;  1O3S A;  1QZY A;  4A0Z A;  4A6D A;  1JXS A;  4GO1 A;  4A6E A;  3LST A;  3S2W A;  1ZAO A;  4P96 A;  2V1X A;  3F8C A;  3LWF A;  2DU9 A;  2VE8 A;  2O6G E;  3LA3 A;  1OPC A;  2LSO A;  1L0O C;  4LK1 F;  1UST A;  3T8T A;  2OQR A;  4LG0 A;  4I01 A;  1ZRE A;  4FX0 A;  1IZ1 A;  4UV9 A;  1B59 A;  3QOP A;  2G9W A;  2EA4 A;  1GXP A;  4M71 A;  2DPD A;  3F23 A;  4JQF A;  2VBZ A;  1B1B A;  1B4A A;  3I54 A;  1LQ1 A;  4FHT A;  4EVI A;  2FF4 A;  3FWE A;  2OQG A;  4EJV A;  1A04 A;  2ZJ2 A;  4UHT A;  1HKQ A;  4LFU A;  1LDJ A;  1P2F A;  3FZV A;  3DEU A;  5CVV A;  1HKT A;  4EM1 A;  3KEQ A;  4G7H F;  2L4M A;  2YSR A;  3ZMT A;  2ZBK A;  4I0B A;  5H6Q A;  1Z91 A;  3DQV C;  5JFR A;  2V6C A;  2JRT A;  1IXR C;  2VC0 A;  1ON2 A;  4UUV A;  1REP C;  1U5T A;  1PP7 U;  3PQK A;  2IP2 A;  4FT8 A;  1DPU A;  1QZZ A;  2OU2 A;  1U8R A;  2F5F A;  4RGX A;  2EA2 A;  5KVR A;  2Q2E A;  2VT3 A;  3QPH A;  3BRO A;  2DK5 A;  1ON1 A;  3FXU A;  3IHU A;  1IXS B;  2HR3 A;  1YW8 A;  1R7J A;  1JHF A;  5ICF A;  3WTY C;  5E8I A;  5LGT A;  3WTX C;  3MZH A;  4HLY A;  4NB5 A;  3COA C;  5A2Q K;  3HSF A;  2FNA A;  3DV8 A;  2XAJ A;  4ZYG A;  3RTR A;  1HW5 A;  1R36 A;  3SQN A;  4KFC A;  3SXY A;  3HOS A;  1MZB A;  1FBS A;  1HKS A;  4EM0 B;  1F4K A;  2XRN A;  4LLG F;  5D6E A;  4CO8 A;  2DAO A;  3QP6 A;  2H09 A;  2VON A;  5LGN A;  5FLX K;  1G3W A;  3M8F A;  3R0J A;  4CGZ A;  4OMY A;  1K78 B;  1UFM A;  2M45 A;  4O6J A;  2NAZ A;  2PLY A;  1UHM A;  1IUY A;  4OIN F;  1J5Y A;  3R6S A;  1ZAR A;  2R7D A;  4Q47 A;  1HW1 A;  2RN7 A;  4A5M A;  1PP8 F;  2JPC A;  2IRF G;  3P9K A;  1ZG1 A;  2DBB A;  3L2C A;  1R23 A;  2IT0 A;  5BMZ A;  3RKY A;  3EUH A;  2HQR A;  1KU9 A;  2RVC A;  4EJT A;  5D5V B;  3RKW A;  4ZYH A;  2L54 A;  4R8H A;  1TQP A;  1MKM A;  5BPI A;  2GZW A;  3NQO A;  3E5U A;  1GHC A;  3ZPL A;  4UVB A;  4I09 A;  2P7V B;  2GIV A;  2W85 A;  2PN6 A;  2CO5 A;  3I59 A;  3FM5 A;  3HOT A;  3PFI A;  5LEJ A;  2XRO A;  3LAJ A;  3CO6 C;  1HXD A;  4OMZ A;  1J75 A;  1FP1 D;  3HYI A;  1W7P A;  1BBY A;  1RZ4 A;  2HZT A;  2PEX A;  4L0Y B;  1XDS A;  1XGS A;  4PGH A;  1SD7 A;  1J7K A;  4ZYE A;  1FBQ A;  1IAW A;  3DF8 A;  4LD5 A;  1WWX A;  1MGT A;  2QWW A;  3EET A;  3BDD A;  1FYL A;  2XVC A;  4YFK F;  3SZT A;  5FGM A;  3L09 A;  4WK8 F;  1FZP B;  5K5R A;  1FSE A;  1YW7 A;  5ERI A;  2P4W A;  5D4S A;  3REO A;  4ZZL A;  5D6F A;  1T2K A;  4R79 A;  1OKR A;  3HRM A;  3E6M A;  4OIO F;  4S04 A;  3CJN A;  5EEG A;  5D8L B;  1XSV A;  3KLN A;  4N9I A;  2VOD A;  3FXR A;  4HX4 A;  2OZU A;  1YIO A;  1D5V A;  3JAM K;  3M8E A;  2BEO A;  2EJR A;  4ESF A;  5ILV A;  2HTS A;  4HX8 A;  1W7P D;  4XSZ F;  4KN7 X;  2HQN A;  5AON A;  3CTA A;  5BS6 A;  3IKV A;  1PDN C;  3C1D A;  5L3C A;  2W24 A;  1J59 A;  2H27 A;  2MLK A;  2ISZ A;  3I71 A;  5L3G A;  5E8G A;  2OA4 A;  2AXL A;  1B9N A;  4MGR A;  1ZGJ A;  2A69 F;  2HGC A;  3ELK A;  4ZH4 F;  3V8J A;  1X3U A;  2K27 A;  3CLO A;  3E3V A;  3PQJ A;  5E18 F;  5L3F A;  2P6T A;  2GXB A;  1FOK A;  2RV8 A;  4G7O F;  2UXX A;  4GYI A;  4TV7 A;  1JGS A;  2MD5 A;  2VE9 A;  1ZG3 A;  5J8F A;  4Q4Z F;  2KJC A;  5LEK A;  1LVA A;  5H20 A;  1R22 A;  4KT5 C;  3GFM A;  4CXF A;  1HSJ A;  2DI3 A;  1G3T A;  2L3D A;  5LLQ A;  2GA2 A;  1GVJ A;  5HS8 A;  4I7H A;  5DCM B;  1GXQ A;  1XMA A;  4ENJ A;  2EV0 A;  5DCF A;  1G6N A;  5D5X B;  1AWC A;  2P5K A;  3F72 A;  5L3D A;  1EH7 A;  4P55 A;  2ESH A;  2NYX A;  3U9G A;  1RNL A;  4MTD A;  1HST A;  1IN4 A;  4EGZ A;  3KP6 A;  1SD5 A;  4YII A;  1ZRC A;  2JSC A;  2MH2 A;  3F3X A;  2QQA A;  1XDU A;  3V7R A;  4L9T A;  1LJ9 A;  1FSH A;  2V1D A;  2CGP A;  2R7F A;  3EDP A;  4U7D A;  3J7A O;  2NS0 A;  1G3Y A;  2L02 A;  1YLF A;  4LLL A;  4HF2 A;  1BI2 A;  2DK8 A;  3L7W A;  2XUB A;  2QM3 A;  1XMK A;  2VBW A;  5LRS A;  5TRD A;  1P4X A;  2OAZ A;  5E1Z B;  5ICC A;  4A5N A;  2A07 F;  1FLI A;  1MD0 A;  1JHH A;  1IN5 A;  2W25 A;  3FHZ A;  3GLX A;  3LQQ A;  2VC1 A;  2E1N A;  4KIF A;  3KP2 A;  4M9S A;  4N9H A;  4O5V A;  2JT1 A;  5IT9 Z;  1NHA A;  2G7U A;  2WTE A;  1QBJ A;  1EH8 A;  1WQ2 A;  2M1B A;  4RB2 C;  1SFU A;  2D45 A;  3RPU A;  1MDM B;  4R1H A;  2KIM A;  1ZLJ A;  3CUO A;  4G8X A;  3W6J B;  3GVA A;  1QGP A;  2M87 A;  2D1H A;  3TO9 A;  2MA3 A;  2STT A;  3DXJ F;  3WGH A;  3IL2 A;  1R1V A;  3KET A;  3QP5 A;  1Z6R A;  3L00 A;  2XV4 S;  3KE2 A;  4KYW A;  3CO7 C;  2COM A;  5ICG A;  1BIB A;  2PMH A;  4O3M A;  1T39 A;  1K7A A;  2BBY A;  2UXN A;  1DP7 P;  4WCG A;  1UCR A;  3Q5F A;  3HSR A;  2HOE A;  3IRR A;  5LRR A;  2GAU A;  1S8N A;  3WTZ A;  2E7W A;  1K79 A;  3ECH A;  3EYY A;  3WTT C;  3GZ6 A;  5DUI A;  5DDG A;  3FF5 A;  3M9A A;  1S29 A;  4OIP F;  2WV0 A;  4OU0 A;  4EQQ A;  5D8K B;  4UVC A;  1USS A;  3DPL C;  4PZJ A;  4P9U A;  2FQ3 A;  3E6C C;  2UWM A;  4L9N A;  3C7J A;  3WU1 B;  3J80 K;  1OMI A;  1R1T A;  4WX9 A;  2ZKZ A;  2FML A;  3GX4 X;  3GXO A;  2ZXJ A;  2E1C A;  4KN4 X;  1U5T C;  3OV8 A;  5F64 A;  3F8M A;  4ESJ A;  1TNS A;  3ZMD A;  3I58 A;  3RDI A;  3VB2 A;  2M5W A;  2OBP A;  2KIF A;  2ESN A;  3RPQ A;  4EM2 A;  1R1U A;  3WE3 A;  2K86 A;  5TJJ A;  2MH9 A;  1IW7 F;  4LK0 F;  3JTG A;  4ZZD A;  2K4J A;  3HHG A;  5JVT A;  3MQ0 A;  3E5X A;  2HEO A;  2A3S A;  1KYZ A;  3VFZ A;  3BZ6 A;  1W5T A;  1EV7 A;  1BJA A;  3TO6 A;  4G7Z F;  3QAH A;  3J81 Z;  1OR7 A;  1SD4 A;  3EYI A;  1FYK A;  2DO7 A;  3N4M A;  3SFZ A;  4M6Y A;  4AIJ A;  3WGI A;  3B02 A;  4KDP A;  2VOP A;  1WSU A;  2A61 A;  2PI0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...