4JBAA

Crystal structure of the oxidized form of marr from e.coli
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
138
structure length
134
Chain Sequence
b'LFNEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLSSIRSAASITPVELKKVLSVDLGALTRMLDRLVCKGWVERLPNPNVLVKLTTGGAAISEQSHQLVGQDLHQELTKNLTADEVATLEYLLKKVLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multiple antibiotic resistance protein MarR
publication title The multiple antibiotic resistance regulator MarR is a copper sensor in Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
total genus 44
structure length 134
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4jbaA00
2GQQA 3KP2A 2QQ9A 3HRUA 4MTEA 5D6FA 3B02A 4RGSA 4LLNA 5LBQA 4G8XA 2FOKA 3F8FA 1HSJA 1BC8C 3ELKA 2QLZA 3T5XA 5FD6A 3DF8A 2ZJ2A 3JSOA 2QVOA 4S04A 2Z99A 3ZMUA 5L3BA 3HTSB 4QLCU 4I01A 2VBWA 4YIFA 4L18B 4IRHA 2MD5A 5D6EA 3HRSA 3QRFF 5FO5A 3R0AA 1NHAA 4KIFA 3F23A 2DLLA 2VOOA 2HZTA 1ZARA 4IHSA 1FBQA 5BS6A 2F2EA 1XDSA 3DFGA 2RV8A 3GF2A 4CGZA 3FXQA 3ZP5A 3KLNA 5L3CA 1E17A 3ZMDA 3FM3A 5AIQA 1Y0UA 2ZFWA 1RUOA 3BY6A 2QYOA 1JE8A 4HF2A 1FT9A 3GFJA 2K4JA 2DO7A 4HDVA 3GZ5A 5LLQA 4KT5C 1SMTA 3KE2A 1IXRC 2AS5F 3CUQA 4JQFA 1J9IA 4GO1A 4HX4A 1YS6A 2MBFA 1YO5C 4U0VA 2V1DA 4Y13A 3IHUA 2F5FA 3PQKA 3HSFA 3KEOA 2ELHA 1ZRDA 1XN7A 4TV7A 2H6CA 5IT3A 1Z05A 1B1BA 1RUNA 2OZUA 2VC1A 1MJBA 4P5OA 2W25A 3RI4A 1TW3A 1G3SA 3WODF 5D5UB 5HOOA 1A04A 4LJZF 2ESHA 1IAWA 2STWA 3GEZA 1OYIA 1U2WA 5L3DA 2QBYB 3BJOA 1P4WA 5JR3A 4LLLA 1ULYA 2A61A 4Y15A 3QU6A 1FSEA 2UWMA 3KP4A 1D8KA 1P6RA 1TW2A 2GA2A 2HS5A 2OQRA 3RKXA 1J59A 3ZQ7A 5HS7A 2PQ8A 1S29A 2HR3A 3G73A 5D4RA 1GXPA 1KA8A 4OIQF 2KIFA 2QQBA 3P9IA 3CO7C 1TQPA 3PQJA 1BC7C 1ZAOA 3T0YA 2JRTA 1FYKA 2A3SA 2WTEA 1H0MA 1IRFA 4LFUA 3Q9SA 1ZN2A 4A12A 2HWVA 5DCMA 4RGXA 4BYYA 5CVVA 1QZYA 3H3ZA 3WTTC 1LDKB 2WV0A 1F5TA 2DBBA 4LK0F 2V9VA 4L9NA 3FWEA 5FD5A 1MJAA 3EDPA 5HDNA 1ON2A 5DCFA 4UNOA 2ZXJA 5A2QK 1FNNA 2IJLA 3TQNA 3RPUA 4KMUX 4WCGA 1IUYA 1R7JA 2ZNYA 4BXUA 2B0LA 2M87A 3EETA 4BHPA 3J80Z 2X4HA 1O3RA 1PUEE 4P96A 2YU3A 5JFRA 3IC7A 4LGWA 3F8NA 1G3WA 1Z9CA 2R3SA 1HQCA 3F8MA 2CGPA 3CUQB 2QQAA 5IT9Z 4KICA 2W84A 5E18F 1TLHB 1O57A 1BI2A 1R1TA 3EQLF 3T8TA 1PP7U 2HGCA 1K78A 5HLHA 1R58A 3TO6A 3FMRA 4WXDA 5ICGA 4I0AA 2RDPA 2DQRA 3ECHA 2HKOA 4HX7A 3K1NA 4KFCA 3CJNA 1P92A 1QBJA 4GYGA 4YIIA 2KIMA 4WXCA 5HLGA 2FMLA 2NYXA 5CVIA 2MA3A 3I58A 2UXXA 4KNYA 2A68F 4U0WA 3DV8A 3N4MA 2Y48A 5D8LB 2O03A 2ISZA 2GIVA 1UB9A 2LSOA 4KA4A 2HTSA 4PCQA 2XAFA 3RJPA 3U9GA 4I02A 1KYWA 3S2WA 3MZHA 3E6BA 3KCCA 2LKPA 1L3LA 2E7XA 3ROUA 4XSXF 1KU7A 4BAYA 1H9GA 2XIGA 2D2WA 2O8XA 2ADUA 3IWZA 3BWGA 5J8FA 4HOBA 4D0PA 4A0ZA 2G9WA 4M71A 5DCMB 2DAOA 4G94A 1ONVA 2EB7A 4L5IA 3DPLC 5DUIA 3P9KA 1I1GA 3TOBA 1MJ9A 4HZFA 5D5WB 1WSUA 2W57A 2STTA 1IRGA 3BPVA 3R6SA 1XSVA 5ED4A 3SZTA 4MNUA 2VBXA 2XUBA 1QO0D 1O7LA 3GFMA 4NB5A 4CZZA 4U7BA 3BROA 3WGGA 3MFKA 4P55A 5LGTA 3LA2A 3KEQA 3IRRA 3P9CA 4GCVA 2LF7A 3K1PA 5L3EA 3F3XA 3L00A 4G6QA 2K27A 5K5RA 5FFXA 4FHTA 3I4PA 5HDKA 3I59A 1K78B 1RNLA 2JPCA 3DPTA 3SZPA 3F6OA 3KP7A 2DW4A 2EWNA 2COMA 4EJWA 1IN5A 3OOPA 2Z3YA 3COAC 1U6GA 1ZGAA 1IN7A 2ZMEA 3VFZA 4CICA 4QWQA 3GYHX 5BQTA 1KQ9A 1SFEA 3I53A 1SFUA 2PG4A 4HYEA 3W6JB 2DU9A 2EA4A 5CVUA 5J8CA 3HYIA 3M8FA 5J6XA 2P4WA 4ENMA 1I5ZA 3G3ZA 3KLOA 2GA1A 1FSHA 3JTHA 2BEOA 3RKYA 1G3YA 1RI7A 2FSWA 3MZYA 3ERED 1UHMA 3IKVA 3BDDA 2UXNA 3FMSA 1WKMA 2KRFA 2IA1A 1QNTA 1R5HA 5CJ9A 5ILUA 2KIUA 1BIAA 2QBYA 4CO8A 2V1XA 4EJTA 2ISYA 2A5YB 4RB1A 2QWWA 4XRFA 3M1EA 5F64A 4LLGF 4UVCA 4OIPF 3GXOA 1D3YA 1S7OA 2V79A 2VE8A 2ESNA 4IPAA 3MQ0A 4XLPF 2A07F 1ODDA 4KMFA 2FXAA 3GO5A 2W24A 4A6EA 5HDGA 3ULQB 4LD5A 1ZRCA 4EVIA 5H20A 2XRNA 4YG2F 1TNSA 4HQEA 1XCVA 5FLXK 4M9ZA 3EYIA 5KVRA 4UXNA 3V4GA 3TDUC 4IF4A 1UHWA 2DQLA 2XASA 5KK1A 5JHUA 5E1WA 4HBLA 4Q4ZF 4R8HA 3QPHA 4L0ZB 2ETHA 4KIBA 4EJUA 3L9FA 1YYVA 1Q1HA 1B9NA 1T0FA 2VN2A 1J75A 3QAHA 2Q2EA 3HHHA 3I59B 1XB4A 5DDGA 3F72A 2BV6A 2BE5F 1JXSA 3M7GA 2FU4A 5DD4A 5D5VB 4HLYA 4RAYA 1CF7A 2QENA 3CDHA 1Z6RA 4GGGA 2P6TA 3BJAA 2ZMEB 3DEUA 4FX0A 1D8JA 4FX4A 1FP1D 4MQ9F 1LNWA 1T6SA 1LJ9A 4CYDA 4ESJA 1FY7A 1XSXA 2XV4S 2HQRA 5CLSA 1XGMA 2FNAA 5TJJA 3V7RA 4HAMA 4OMYA 2WWYA 2DK5A 2OZ6A 5H6RA 5DEQA 2VE9A 1P2FA 3QU3A 4ZZDA 4B8XA 4YFXF 1W5TA 4IJAA 2CSOA 4CDGA 4IRGA 4HDUA 4UHTA 4RGRA 1YW9A 3RKWA 1T2KA 5AIPA 1GVJA 4OINF 1RZ4A 2FQ3A 3ZMTA 1V3FA 1XGNA 2PBIA 3JSPA 1GXQA 3RYPA 5LHIA 4AWXB 2CWEA 3O2PE 4WK8F 2EFOA 2M5WA 1P4AA 1IZ1A 2O0YA 1FZPB 2HYGD 1BI3A 2NAZA 3EYYA 4ON0A 4KDPA 1WQ2A 5ERIA 2XVCA 4M74A 2MLGA 1CGPA 4DNCA 1PP8F 3KP6A 4L5JA 2YR2A 3PFIA 2F5DA 1FBSA 4B09A 3D0SA 3LAPA 2IRFG 3I54A 2IA0A 1KU2A 4K2EA 3RYRA 1IXCA 2IPQX 2CW0F 1QGPA 3J81Z 2DK8A 2HYFA 3LA3A 4HV6A 1AWCA 2OD5A 4BNCA 3NEUA 3HOTA 1U5TA 5K5QA 4EM1A 4G7OF 1EH8A 1BI0A 2PMUA 3D5LA 1D5VA 3KZYA 2GWRA 4ZYDA 3HIFA 5LEKA 4BH9A 1KGSA 4PGGA 5LHGA 2O3FA 3M9AA 3BPXA 3R61A 1SD6A 2P8TA 4A2UA 4RB3C 5K5OA 2V6CA 1CF7B 2WC2A 1K79A 1SMYF 4ASNA 4CXFA 3CTAA 1XCBA 5L3FA 1EH7A 3IL2A 2CG4A 1JHFA 3ISPA 4AIJA 3SQNA 1OPCA 2EFQA 4KN7X 3QP6A 4M9XA 3MAJA 4EV0A 3H92A 4OOIA 3E6MA 3CO6C 2PMHA 4HX8A 3TKYA 4ESFA 3L09A 3K0LA 3W6KB 2CO5A 2FBIA 2EV5A 2KJCA 4I7HA 2Y75A 4U88A 4EM0B 1AOYA 4UUVA 1KYZA 2Y0MA 2ZKZA 3K2ZA 1HXDA 3ZMZA 4Q48A 5FB2A 4WXHA 4RS8A 1OKRA 2O61A 3J80K 4N9IA 2VBZA 2PN6A 1QPMA 3K69A 4GXOA 2A69F 5DD8A 1U3EM 1J7KA 1G4DA 1G3TA 2P7VB 1FC3A 1XMAA 1KU9A 2R7DA 4IHTA 5IT9K 1XGSA 3WTSC 1HW2A 3U1DA 2ZNZA 4R79A 1GHCA 2DT5A 3FM5A 2VXZA 1IF1A 1MKMA 1XDUA 1E2XA 2C6YA 2G7UA 1Z91A 3LSTA 4RB0A 5D4SA 4CHUA 5BPDA 3V8KA 4EJVA 2EK5A 4WWCA 3WU1B 1REPC 3TGNA 2CFXA 2J5OA 4WX9A 2YX4A 3V8LA 4YFNF 4IXAA 3ML6A 4ZYGA 2QZ8A 3WTVC 3B73A 4XLNF 3CUOA 4IVNA 1U5TB 2LDUA 1XD7A 3I0TA 1S6LA 1O3QA 1ZHFA 2NRAC 2J5PA 5E8GA 3WTZA 2RQPA 4KN4X 3FMQA 1JHHA 2XAJA 2D1VA 3FF5A 3KFWX 4L0YB 2E1NA 2PEXA 5E20A 3QPTA 2DI3A 4ZYEA 2M45A 4M6XA 5K1YA 3CUQC 2A6EF 5E17F 1ZH5A 1ZLJA 3E5UA 1LDJA 3GFLA 4ESBA 3JAMZ 1WWXA 5ICCA 2VT2A 2P7CB 1U8RA 2P6SA 1T38A 4AIHA 3MWMA 3NRVA 3GFIA 2RNJA 3MCZA 1IN4A 4U0YA 4PZJA 3TDZC 1ZG5A 1K6OA 3F8BA 3ABUA 2NS0A 1OMIA 2H6BA 3ZN0A 2OAZA 3E97A 4Q5SF 4MEYF 5CVRA 2PJPA 4EGZA 3GZ6A 4KIGA 3CLOA 2G7HA 1YIOA 1R00A 2K86A 3IKTA 3LFKA 2VC0A 3GUDA 5LGUA 1H9TA 4JBAA 1W7PD 3Q5FA 2XAQA 4S05A 1RIOH 2O6GE 1B6AA 2BYVE 4Z2YA 3VB2A 2FA5A 3QOPA 2Q8KA 4OU0A 2Q0OA 5AONA 2EA2A 3FXUA 2CYYA 4P9UA 3P7NA 4DQ2A 1J2XA 4ZH4F 2V1UA 4LMYA 2EFWA 1X3UA 3RPQA 4A6DA 2PLYA 4A5MA 3GVAA 1SD7A 4HQMA 1SFXA 2L02A 1ZREA 1ZRFA 2YPRA 2RGVA 3O3KA 2IVMA 5HS8A 3F22A 4FT8A 2CQKA 4EM2A 1HKTA 4G7ZF 2MC3A 3HSEA 1W4MA 1ON1A 4ZYHA 4EJOA 2X0LA 3ECOA 1MGTA 2HKXA 2DFIA 4MGRA 2GXBA 2F5EA 2RVCA 1U5TC 1J0RA 1V4RA 4R1HA 3TOAA 3JW4A 3I71A 1QZZA 1B59A 4UVAA 2EFPA 2GZWA 3ZN1A 1FYLA 2IP2A 1R5GA 2PFBA 3HOSA 4AVPA 2K02A 2M1BA 1XMKA 2DPUA 1TNTA 1YW7A 1KQ8A 6PAXA 3HHGA 4N9HA 1KU3A 2OA4A 3KP3A 2L3DA 1IN6A 1BJAA 1R22A 4KYWA 3OV8A 3TO9A 3C3WA 4PGHA 5JVTA 4ENJA 2A6HF 1B9MA 2FMYA 3Q9VA 1FLIA 1T98A 1S7AA 1QQIA 1F9NA 1YQAA 4HA8A 2Z5UA 2XKOA 4JK1X 3ZPLA 4I98B 3J7AO 1HKSA 3QP5A 4F7ZA 3BJ6A 2YSRA 1R23A 2UZKA 5ILVA 1OYWA 2MH9A 3C7JA 1VTNC 2K4BA 2OBPA 4UV8A 5E8IA 1WRJA 3I64A 3IWFA 3L7WA 4LK1F 3WE3A 1B4AA 3WTXC 3ZMVA 2HFHA 1LQ1A 2FF4A 4MTDA 4BHBA 2XAHA 5BMZA 5L3GA 5H6QA 4LG0A 4E70A 5F6FA 2VT3A 1SD4A 1EV7A 3AAFA 2EV0A 1MDMA 4EGYA 1PDNC 2XKPA 4M72A 1OYYA 2ACJA 4RAZA 5F1RA 2M30A 4O6JA 4U7DA 3T1BA 1SD5A 1I6XA 4NHJA 2M8EA 2EV6A 4RB2C 3GX4X 3BOQA 4G7HF 1USTA 2OU2A 4MHGA 5LHHA 3DKWA 2IT0A 2FRHA 3HRMA 3WU0A 2GXGA 1USSA 1YFHA 4MQVA 1HKQA 2XHKA 3BP8A 1W7PB 3TO7A 3GWZA 2JTVA 1UFMA 1FPQA 3LA7A 1DPUA 5A2QZ 1OR7A 2RC4A 3SXYA 5ICEA 3ZMSA 1MZBA 1R36A 5DV5A 1TQMA 3WE2A 3WTYC 2XROA 5ICFA 2W85A 1IN8A 4NQWA 1IW7F 1LEBA 1FBUA 2HQNA 4EMSA 5DYMA 5HVQC 2KJBA 2D1HA 1FWZA 3WGIA 5BPIA 1YTYA 3T8RA 2HDCA 3HUGA 4HF1A 4LB6B 2TDXA 4XBFA 2FBHA 1DP7P 3E6CC 3F6VA 1BIBA 1YLFA 3R4KA 3NQOA 5BOXA 1HSTA 2GAUA 1Z6TA 2LF8A 2PI0A 1ZGJA 4L9JA 5HS9A 4HF0A 3REOA 2P5LC 4HW0A 3IRQA 1YG2A 1ZG3A 1XSDA 5LGNA 4L9VA 2EFNA 5DUKA 4GYIA 5CVJA 2EJRA 2KKOA 1L0OC 2D45A 4LB5A 3WTUC 2VOPA 1TTYA 1ZLKA 2IA2A 2DTRA 1DPRA 2E7WA 5LRSA 4RGUA 2HEOA 4WF2A 3DQVC 3GLXA 3H3UA 3SFZA 1DDNA 4N0BA 2FNPA 1Z7UA 1J5YA 1LDDA 3E6DA 3J81K 3C1DA 1BI1A 1HW5A 2JSCA 4LG0B 3E5QA 1LB2A 1SAXA 1MDMB 2LNBA 2P5VA 1WI9A 2ZBKA 1F4KA 4IRIA 3JTGA 4H0EA 5EEHA 4G9YA 1DUXC 2P5KA 4P9FA 2H09A 5FFZA 2VODA 1I27A 5D5XB 2VONA 4O3MA 1FOKA 1F1ZA 4HV5A 1IXSB 3HTUA 3M8EA 1S3JA 2DPDA 2H27A 4M6YA 3N97A 1Z1DA 1YS7A 2L01A 3SHFA 2HOEA 2OQGA 1UCRA 1G6NA 4AIKA 1FP2A 5LEJA 1O7FA 4OMZA 1HW1A 3V7SA 3O6BB 5E1XA 3WGHA 3C18A 3V7CA 2XAGA 4ENNA 1BBYA 1BM9A 1MD0A 4A5NA 4M9SA 2Z9OA 4I2OA 3EUHA 2YX7A 3LQRA 1R1VA 2HTJA 2Z33A 2MLKA 3F21A 4UVBA 3MEXA 3R0JA 3WTWC 3FX3A 1XGOA 2RN7A 4HLXA 3GW2A 2QUFA 3RTRA 4PDKA 4L9TA 4OIOF 3L2CA 1K7AA 3FZVA 5CYVA 3DP7A 3ABTA 1P4XA 1S8NA 3LWFA 2BGCA 3I5UA 2JT1A 3KZZA 5D8KB 2NNNA 2R7FA 1W5SA 1T39A 2AXLA 1LEAA 4ZZLA 4MEXF 3FXRA 2L54A 5EEGA 4UV9A 3WG9A 3HRTA 3R60A 3BZ6A 4KUMA 2XGXA 2MH2A 3HSRA 3F8CA 4BHCA 5TRDA 2VBYA 1HBXG 3E5XA 4EQQA 3VODA 2FEZA 5ILSA 3LAJA 4O5VA 4Q47A 1I1SA 3VEPA 3KETA 4XSZF 4A0YA 4I0BA 5HLIA 3K9TA 1TQIA 4M73A 1BOAA 2IW5A 3VOEA 4OIRF 4ENKA 1R1UA 4A0XA 3K1MA 2L4MA 4G6DA 5FGMA 1O3TA 4I09A 5LRRA 1BN5A 1LVAA 1U78A 3FHZA 2NNYA 1O3SA 3DXJF 3RDIA 4Y17A 1ZYRF 3JAMK 3E3VA 1JGSA 2E1CA 1C0WA 2F5CA 3V8JA 1STZA 5E1ZB 1FYMA 1FX7A 1ZG1A 2FE3A 3RIRA 1EH6A 3KP5A 5JI6A 2K7LA 5FLXZ 1YW8A 2JZYA 4ETSA 4YFKF 3LQQA 2ZO4A 1TBXA 2FBKA 2ZCWA 2H94A 2RKHA 1W7PA 2JPBA 4BQAA 2BBYA 2QM3A 3U2RA 1KQ0A 2L4AA 4AD9A
chains in the Genus database with same CATH superfamily
2O5RA 2HOTA 2GQQA 3KP2A 2QQ9A 3HRUA 1KONA 3S15J 2DJIA 2VQGA 4MTEA 5D6FA 3B02A 4YELA 4RGSA 4BQOA 4LLNA 1I50J 2X51A 2KISA 4QIWN 3GTMJ 5LBQA 4GDFA 2V1NA 4G8XA 2FOKA 3HGYA 1OISA 3F8FA 2LLKA 2L9SA 3NWTA 1IUFA 3A4CA 1HSJA 1BC8C 3Q0UA 3ELKA 3CCRI 3W2AA 3ZR8X 2QSFX 2QLZA 3T5XA 4XLAA 5FD6A 2DOAA 3DF8A 2ZJ2A 1APLC 3JSOA 5KAIC 2QVOA 4S04A 4BU2A 2Z99A 3ZMUA 3ONQA 5L3BA 3HTSB 4QLCU 4B48A 1SVMA 2DT6A 4I01A 3GTJJ 2F6CA 3RZOJ 2E19A 2VBWA 2KFDA 4I76A 4YIFA 4L18B 4Y33A 2DFEA 4IRHA 3ZQFA 4OAYA 2MD5A 3TL4X 2O8KA 5D6EA 3PO3J 5HNHA 3HRSA 3QRFF 5FO5A 2Z2SB 3R0AA 1NHAA 1POGA 4KIFA 3F23A 2DLLA 2G0EA 2WAQN 2VOOA 4BDZA 3OYHA 3CESA 3BC8A 2HZTA 1ZARA 2VQHA 2QCOA 4IHSA 3LOCA 3U1KA 1FBQA 3S3MA 1BR2A 5BS6A 2M7BA 2LREA 4B3AA 2F2EA 1XDSA 3DFGA 3M4OJ 2RV8A 3GF2A 2DOFA 2GOXB 1ZKGA 2L0KA 3BTCA 3GTQJ 2OUMA 5B3SH 2W4SA 1WGXA 4CGZA 2ID3A 3OYIA 1UELB 3FXQA 3ZP5A 3KLNA 2AQFA 3EUAA 5H2FC 5L3CA 4E7KA 4IHYA 1E17A 2KDZA 3ZMDA 2Y0SN 2DA3A 2JUCA 3FM3A 5AIQA 1Y0UA 4MFDA 2ZFWA 3FIWA 1RUOA 2HI3A 3BY6A 5CQEA 2QYOA 1JE8A 1OLTA 2VJIA 3MKLA 4AYBA 2VLAA 4HF2A 1FT9A 3GFJA 2K4JA 2ZB9A 2DO7A 1RKTA 4HDVA 2VL8A 3CF5F 3GZ5A 5LLQA 4KT5C 1SMTA 3HKZA 3KE2A 2IEKA 2WY7Q 4A3MJ 1D1AA 1IXRC 2OCCH 3OL3A 2BW3A 2QQ8A 2AS5F 3LMMA 3JCUC 2NOJB 3CUQA 4JQFA 4QPOA 1VQ5I 2Y31A 1J9IA 4GO1A 4HX4A 2L7MP 1YS6A 3H5NA 3HOUJ 1WFXA 2MBFA 1YO5C 4U0VA 2V1DA 4Y13A 4CZCA 3IHUA 3MMYB 3J7AY 2F5FA 2XRLA 4D9JA 3PQKA 1VQLI 1R49A 1MBHA 3HSFA 3KEOA 2ELHA 1ZRDA 1XN7A 2DMTA 4TV7A 2H6CA 5IT3A 1Z05A 1B1BA 5GPCA 1RUNA 1YJNI 1QU3A 4C3JJ 2AXTC 2OZUA 2VC1A 5F0FA 1MJBA 4P5OA 1H88C 2W25A 3RI4A 3BTLA 3FXLA 3HOXJ 1TW3A 3A0BC 4XLCA 1X4OA 3GTPJ 1G3SA 3WODF 2R0QC 4A3GJ 4XIDA 5D5UB 5HOOA 3TW6A 1A04A 4LJZF 2ESHA 1IAWA 2E1MB 2STWA 3FXJA 3GEZA 2DN0A 1OYIA 4XRMA 4Y7NJ 4NC6A 2K40A 1U2WA 1Z21A 2JK3A 5L3DA 1B8IA 1W1WE 2JWTA 3MKWB 2QBYB 1ETYA 1R71A 1LE8B 4UUTA 3BJOA 1P4WA 5JR3A 3EUHC 2MABA 1ULYA 4LLLA 2IS1A 2A61A 4Y15A 3QU6A 3AG1H 1H8AC 1FSEA 1XPXA 2UWMA 3BCAA 3KP4A 1D8KA 1P6RA 1TW2A 2GA2A 2HS5A 2OQRA 3OYLA 3HDDA 2LH9A 2OF7A 3ZQGA 2I5UA 3RKXA 1FIPA 1EF4A 3QYEA 2VUMJ 2IAIA 2N8GA 4CYCB 1J59A 3ZQ7A 3BTIA 5HS7A 4AC0A 1GV5A 2PQ8A 3A2KA 1S29A 2HR3A 2R7QA 3G73A 5D4RA 2OPTA 2LY1A 1GXPA 1KA8A 4OIQF 1XMXA 2M3AA 2KIFA 4Y52J 2QQBA 3P9IA 1WJCA 3CO7C 1XC5A 1TQPA 3PQJA 1BC7C 3K2AA 1ZAOA 2LY2A 3CCLI 3T0YA 3SEQA 2E2IJ 2JRTA 5GAEJ 1FYKA 4RLFA 2A3SA 3AKZA 2WA0A 2WTEA 3H9QA 3HEFA 1H0MA 1TWHJ 1Z3YA 4A3JJ 1IRFA 4JP0A 4LFUA 2MSYA 2WB1N 3Q9SA 4BGDA 1ZN2A 5EG0A 4ANJA 2BY1A 1N78A 4A12A 4NC8A 2NXNB 1JTXA 2HWVA 3KX2A 5DCMA 4B3XA 4RGXA 2FQ4A 4BYYA 5CVVA 1QZYA 5TISC 3CQZJ 3H3ZA 5GAGJ 2CUZA 5J1YA 1LDKB 3WTTC 2R7UA 2JRMA 2WV0A 1F5TA 1P9QC 1VQ4I 2DBBA 4LK0F 4BJTA 2V9VA 3IP4B 4L9NA 3FWEA 5FD5A 2H1LA 1MJAA 3EDPA 4C2TA 5HDNA 1ON2A 5DCFA 4UNOA 2ZXJA 5J1RA 5A2QK 2HXIA 4M3FA 1FNNA 2R7TA 2IJLA 3TQNA 4BEHA 2ZFUA 3RPUA 2M8GX 4KMUX 4WCGA 1IUYA 1R7JA 2ZNYA 4B43A 4BXUA 3CMMA 2B0LA 5E3OA 2M87A 1PJRA 4E4HA 4UY8I 2DMUA 3ZQIA 3EETA 1JT0A 2BHYA 4BHPA 3J80Z 5M5YJ 2X4HA 3KYDB 1O3RA 1ZR2A 3G6EI 1PUEE 4P96A 4RLQA 4D5CA 2YU3A 2YUSA 2MGQA 5JFRA 2E35A 1RKWA 4PJ0C 3CDIA 3IC7A 4LGWA 3F8NA 4FASD 1G3WA 2HQ5A 5FKNA 1Z9CA 2R3SA 1HQCA 2DA2A 1QHHD 3BCBA 3F8MA 4ITVA 2CGPA 3CUQB 2WAEA 2QQAA 2Y30A 5IT9Z 4DBQA 1QHGA 1XX5A 5GTHC 4KICA 2W84A 5E18F 2PJRA 1TLHB 1O57A 1BI2A 1JJ6C 3I56I 1R1TA 3EQLF 3T8TA 4NC7A 1PP7U 1BL0A 3OYEA 2HGCA 1K78A 2Z16A 3MN2A 1FTTA 5HLHA 3PJRA 2VB6A 1LVKA 4GFBA 1R58A 2V7FA 3TO6A 3FMRA 4WXDA 5ICGA 1ZTRA 4I0AA 2RDPA 1ETOA 2DQRA 3ECHA 2HKOA 4HX7A 2BXZA 3K1NA 4DGWB 4KFCA 5IYDJ 4AVZA 3FBNB 4RMNA 3CJNA 1P92A 2A6TA 1YX5A 4F3QA 1QBJA 4GYGA 4YIIA 2KIMA 4WXCA 5HLGA 3M3YJ 2FMLA 2NYXA 5CVIA 2MA3A 3I58A 3OIQA 1ETWA 2UXXA 4KNYA 2ICWG 2A68F 4U0WA 3HOYJ 3DV8A 3N4MA 3A1YA 2Y48A 3DLAA 5D8LB 2O03A 2ZXHA 1B8IB 2ISZA 2GIVA 2L9NA 1UB9A 2LSOA 2CQNA 1A6IA 1MIJA 4KA4A 2HTSA 3WHBA 5GPAA 2A05A 1QVUA 2MYSA 3ABMH 4PCQA 2XAFA 2X6OA 3KPHA 2VKHA 3RJPA 3U9GA 4I02A 4N4NB 3GCMA 3K70D 1KYWA 1SFKA 3Q3SA 3S2WA 1TWAJ 3MZHA 2LRDA 5F04A 3CLQA 4MIMA 3CMEI 3E6BA 5J1UA 3KCCA 2LKPA 3DBHB 4RM3A 1L3LA 1ETVA 3OYAA 2E7XA 3ROUA 2R7RA 4XSXF 1KU7A 2XF5A 5TGTA 5F0CA 4BAYA 1H9GA 2XIGA 1HF0A 2D2WA 2O8XA 2ADUA 3IWZA 4OWRB 3BWGA 5J8FA 2OTLI 4HOBA 4D0PA 4A0ZA 5EG0B 2G9WA 2JA7J 1A5JA 4M71A 1BJZA 2HXOA 5DCMB 2H8WA 2DAOA 1AA7A 4G94A 1ONVA 2EB7A 3MZ8A 4L5IA 1R9TJ 2Q1ZB 3DPLC 2W1OA 3HOWJ 5DUIA 3P9KA 1I1GA 3TOBA 3LSRA 3WG7H 3BT9A 1MJ9A 2RAEA 4HZFA 5D5WB 1WSUA 3X2QH 1TL8A 2W57A 2STTA 1R4NB 3BPVA 3BR0A 1IRGA 5IYBJ 3S1MJ 3R6SA 4BEHB 4CUGA 1XSVA 3GTGJ 2IGMA 5ED4A 1XG1A 1FOYA 3SZTA 4MNUA 3DCFA 3HC7A 2CFOA 2VBXA 3BR6A 5EZGA 5K7FA 2XUBA 1QO0D 1O7LA 4HNTA 4A3BJ 3GFMA 4NB5A 2IS6A 5K7HA 4CZZA 2JJ7A 4C9YA 4U7BA 3BROA 1GLNA 3GBGA 2Y9ZA 4AYBN 1X2NA 1X1AA 2BVMA 3WGGA 3W2VA 2DA4A 3MFKA 4P55A 5LGTA 4ZJZA 1VQKI 2ELKA 1XTAA 3KZIC 1OCZH 3KEQA 3LA2A 3HKZN 2EINH 3IRRA 1EJ9A 3P9CA 3CP2A 1SVLA 4GCVA 2LF7A 1MBJA 3K1PA 5L3EA 4HNUA 2R5YA 1WJBA 3F3XA 1S72I 3L00A 4G6QA 1DP3A 2K27A 2PJRB 1VZ0A 1I3AA 5K5RA 5FFXA 1W5CC 3E0JB 2CUJA 4E7ZA 4FHTA 1X2MA 3HL2A 3OYMA 3I4PA 2JQ7A 5HDKA 4DIQA 3I59A 4JX5A 5KAFC 4AUXA 1K78B 1RNLA 2JN6A 4CH7A 2JPCA 5CKTA 3DPTA 4D7NA 3SZPA 3F6OA 3KP7A 5M3FJ 5FKMA 1IDZA 2DW4A 2EWNA 4PUSA 2COMA 4EJWA 4C2UA 2DA1A 4LIVA 1IN5A 3OOPA 2Z3YA 3COAC 3L2UA 1U6GA 5B66C 1ZGAA 4ZDLA 1A35A 1IN7A 2ZMEA 4M3BA 3VFZA 1WCMJ 4CICA 4QWQA 3L1PA 2M4KA 2M9HA 4HNVA 4YRVA 4MLOA 1QZEA 3GYHX 5BQTA 2E60A 2XF7A 3CCMI 1KQ9A 3KIOA 1YI2I 1SFEA 3PL8A 3I53A 1DU6A 4IQ4A 1SFUA 2LYCA 2PG4A 4E6KG 4HYEA 3W6JB 4PFPA 2HZDA 2DU9A 2EA4A 4Y4RA 5CVUA 5EZHA 5J8CA 2JMWA 3HYIA 2BZTA 3M8FA 2HVSA 5J6XA 2P4WA 1OR7C 3C2HA 1E3PA 3C2BA 3HXLA 3N05A 4XR6A 3JREA 1I5ZA 1X1CA 3G3ZA 4ENMA 5EF6A 2EH3A 3KLOA 4BKXA 2GA1A 1FSHA 3JTHA 2BEOA 5IP9J 3RKYA 1G3YA 1RI7A 2FSWA 3MZYA 2JA8J 3DTIA 3ERED 1UHMA 3IKVA 4D5FA 1TWFJ 4A3CJ 2X6WA 3BDDA 3Q0WA 2UXNA 2E2JJ 3FMSA 1WKMA 2KRFA 1NG7A 2HOAA 3HG9A 2IA1A 1BW6A 4NUBA 1QNTA 1ACIA 1R5HA 3A02A 5CJ9A 5ILUA 2KIUA 1BIAA 3AG3H 3QODA 2QBYA 4D1QA 3CJRB 3SZGA 4CO8A 2V1XA 1IO2A 4CCJA 1LFBA 3BR5A 4EJTA 4XOPA 4ZC3A 2ISYA 2A5YB 5HLTA 1D1BA 2FOWA 4RB1A 3AG4H 2QWWA 4XRFA 1FIAA 3M1EA 1TT5B 1A6QA 5F64A 4CYCA 3JRBA 4CA0A 1DU0A 1I3QJ 2MC4A 4LLGF 4UVCA 2VASA 3GXOA 1ENHA 4OIPF 1TZLA 4XKWA 1S7OA 1D3YA 2KLOA 2V79A 2VE8A 2ESNA 1Y56A 4IPAA 3LFUA 3MQ0A 4XLPF 2A07F 3OIPA 2XPWA 3WHCA 2BHZA 3CCYA 3K6GA 5JVGF 1ODDA 4PK4A 4KMFA 2FXAA 5FLMJ 3GO5A 1YE9A 4IQJA 1VF9A 2W24A 4A6EA 3JR9A 4BQNA 2NVXJ 2R7SA 2TCTA 1IV6A 5HDGA 1V5FA 3ULQB 2CS3A 3I4MJ 4RAFA 4LD5A 1V5GA 3IH3A 5J3LA 4EVIA 1ZRCA 5H20A 2HDWA 3CMYA 2B9SA 1WVRA 2XRNA 4YG2F 1U8BA 5EEAA 3FKIJ 4BE0A 3MKZA 4DW6A 3CF2A 2LFBA 1T95A 1TNSA 5IOZA 1XCVA 4HQEA 5FLXK 4YIRX 4M9ZA 4BY7J 3EYIA 5KVRA 4UXNA 3V4GA 1Y8RB 1V55H 3TDUC 4CCMA 2M0MA 4IF4A 4M3EA 1AKHA 1UHWA 2DQLA 2XASA 4XMYA 5KK1A 3DU5A 5JHUA 5E1WA 4HBLA 1LUJB 4Q4ZF 2GLOA 4R8HA 3QPHA 4L0ZB 2ETHA 3H9GA 4KIBA 3VYRB 4EJUA 3L9FA 3CJTB 2R5YB 1MSEC 1YYVA 2NVYJ 1Q1HA 2XSDC 1B9NA 2VKVA 2XSJC 4FE7A 1T0FA 3AG2H 2VN2A 2P81A 2NVUB 2X6XA 2DJNA 1J75A 1X19A 3QAHA 1MH3A 2Q2EA 3HHHA 5M5WJ 3I59B 1XB4A 2ZXWH 1OFCX 1Y6IA 3W2WA 2DCEA 1QVTA 5DDGA 2F4OB 3F72A 4IHXA 4XL9A 3PNVA 2FJ1A 2V9KA 2A5WA 2BV6A 2BE5F 1MH4A 3BR1A 2V9PA 2FU4A 3M7GA 5DD4A 5D5VB 3OS1A 4HLYA 2NVQJ 1JXSA 5KHDA 4RAYA 2R7OA 1CF7A 4XLFA 2QENA 2H1KA 3CDHA 1Z6RA 4GGGA 2P6TA 3BJAA 2ZMEB 3DEUA 1FEXA 4FX0A 2K9QA 1D8JA 4FX4A 1FP1D 2KMUA 2YS9A 4MQ9F 1LNWA 1T6SA 1LJ9A 2NS8A 4BS9A 4CYDA 2CMPA 2DA5A 4ESJA 1FY7A 1XSXA 2XV4S 4HRIA 2P0WA 2IBDA 3D5SC 3DTKA 4ZTFA 4CCKA 5FKLA 2HQRA 3SDBA 5CLSA 1SEUA 1XGMA 2M34A 1FTZA 1NTCA 1I39A 2FNAA 2WADA 3MD2A 5TJJA 3V7RA 3VSLA 4HAMA 4OMYA 4NBQA 5J40A 4C3HJ 2WWYA 5FRNA 3H0GJ 2DK5A 2OZ6A 5HNFA 5H6RA 5DEQA 4XRSG 3TEDA 2VXDA 2VE9A 2JSPA 1P2FA 2BXYA 2EZLA 3QU3A 3FBIB 1K4SA 4ZZDA 2CH0A 4B8XA 4YFXF 4XLHA 1W5TA 4IJAA 2CSOA 4CDGA 3ZQLA 2B63J 4IRGA 4HDUA 4UHTA 4RGRA 1RRJA 1YW9A 3RKWA 1QA6A 1UG2A 1V54H 1T2KA 4H4KC 5AIPA 1GVJA 4OINF 2K9SA 5C44J 3PIPF 1RZ4A 3H3VK 2M0CA 2UUZA 2FQ3A 3CC7I 3TP0A 2L7ZA 3ZMTA 5FRMA 2E34A 1V3FA 2CW8A 1Z3XA 3DBRB 1XGNA 2PBIA 3JSPA 1GXQA 1OCTC 1PYVA 3RYPA 5LHIA 3AL0B 4AWXB 3RKQA 1ERDA 2E36A 2CWEA 4PSXA 2NOGA 3FHNA 3O2PE 4WK8F 1Z77A 2EFOA 2DXIA 3PUBA 4G6TB 2M5WA 1P4AA 1ORKA 1IZ1A 2O0YA 3QPLA 1FZPB 1NK2P 2DMPA 1O4XA 5FROA 2HYGD 1BI3A 3IH4A 3RQIA 1S9HA 2LTPA 2X6YA 2NAZA 1IDYA 2NS7A 3BQZA 1IJWC 3EYYA 4ON0A 4KDPA 1WQ2A 3P5JA 5ERIA 3S2DJ 2XVCA 1OCCH 4M74A 2MLGA 1CGPA 4DNCA 1PP8F 3LSGA 1ZR4A 3KP6A 4L5JA 4PJMA 3S14J 1S7EA 5DS9A 2YR2A 1LKXA 2AQEA 2WY8Q 3PFIA 2F5DA 1FBSA 4FE4A 4B09A 3D0SA 3LAPA 2IRFG 2LMDA 3I54A 2IA0A 1KU2A 4K2EA 4KISA 2MFZA 4XORA 1IV8A 3RYRA 4E7JA 3NARA 1IXCA 2IPQX 3TMOA 2CW0F 3QWLA 1QGPA 3J81Z 3BTJA 3MVPA 3M1CA 2X1DA 2XB0X 3VWBA 2DK8A 1AKHB 2HYFA 3LA3A 4HV6A 4JX4A 1AWCA 2OD5A 4BNCA 1MMDA 3NEUA 3HOTA 3W6VA 4PFOA 1U5TA 5K5QA 4EM1A 4G7OF 4HSRA 1EH8A 1BI0A 2PMUA 1X4PA 3D5LA 1W0TA 4ZDPA 1FMVA 1D5VA 4FCYA 3KYLA 3KZYA 2GWRA 1W36C 3B6CA 2Q2EB 3GTLJ 3PO2J 5JHFA 1X3ZB 4ZYDA 3S16J 3HIFA 5LEKA 2X1EA 4BH9A 2XF6A 3L2QA 4FQGA 1KGSA 4PGGA 5LHGA 2L2OA 2O3FA 3M9AA 3BPXA 3RSNA 1VFCA 1WJFA 3DWLE 1SD6A 2IGOA 3R61A 2P8TA 2ZJRF 3BG6A 4A2UA 4X1EA 4RB3C 5K5OA 1E3HA 2IGKA 4IO9F 3S3NA 2ME6A 2V6CA 1CF7B 1AHDP 2WC2A 4KT6A 1K79A 2HVRA 4IOAF 1SMYF 4ASNA 4J01A 4CXFA 4A3EJ 3CTAA 1XCBA 5L3FA 1EH7A 1ZELA 2ZMEC 3IL2A 2CG4A 3OYCA 1JKQC 1JHFA 1QPIA 3ISPA 1MBFA 4PJJA 4AU7A 5B1AH 4AIJA 3L2RA 1RESA 3SQNA 2YU9J 1OPCA 4S0HB 2ZXIA 3CZ6A 2EFQA 2R93J 4KN7X 4BE1A 4XRSA 3QP6A 4M9XA 4JYKA 1WI3A 3MAJA 2RNGA 1V5EA 2EPFA 1X1BA 4G12A 4EV0A 3LSPA 1JGGA 3H92A 4OOIA 1MBEA 4C3IJ 3E6MA 2DMQA 2ME0A 4CCOA 2HVQA 2PMHA 4HX8A 3W3CA 3TKYA 3JRHA 4ESFA 2R7XA 3BG9A 3K0LA 3L09A 2NVTJ 3W6KB 2CO5A 2FBIA 2CQQA 2EV5A 2KJCA 5KNLA 4I7HA 2DA7A 2Y75A 3FK7A 1NK3P 4U88A 4IX7A 3G1MA 1ZGWA 1M1EB 3OR1C 3S93A 3SEZA 4EM0B 4A3IJ 1QRYA 3DLLF 1ETXA 1AOYA 4UUVA 2Y9YA 5LD2C 1KYZA 2Y0MA 2ZKZA 3CMAI 1RC9A 3K2ZA 4XKVA 3CDLA 1HXDA 1HOMA 2DODA 2M4GA 4BACA 2R5ZB 4E7LA 3ZMZA 2V6EA 5EYRA 1FMWA 4Q48A 1P7JA 3ERMA 2BY3A 3ASOH 5FB2A 2E1MC 3LSKA 4WXHA 4RS8A 5HODA 2JVHA 1OKRA 2O61A 1WH7A 1JUMA 2CUEA 3J80K 1TP4A 2VBZA 4N9IA 2IGNA 1QPMA 2PN6A 3K69A 2A69F 4GXOA 5DD8A 3VYSB 3JRGA 3LSIA 1U3EM 2VQLA 1J7KA 4IL6C 1G4DA 3CC2I 1G3TA 4D7MA 2P7VB 1XS9A 3AL0C 1FC3A 1XMAA 1KU9A 1MW7A 2R7DA 4IHTA 1YRNB 5IT9K 1XGSA 3I3LA 2KRCA 4E7HA 3WTSC 3ABLH 1MSFC 4II2A 1HW2A 4QTRA 3U1DA 2ZNZA 4R79A 3ESWB 2DDAA 1R6RA 1GHCA 1NG6A 5IP6A 2DT5A 3FM5A 2VXZA 1IF1A 3H35A 2JA6J 1PVEA 1MKMA 1VQOI 1XDUA 3OYDA 1E2XA 2C6YA 3BZKA 2G7UA 1RR7A 3EUKL 3ZQQA 1D0YA 1ZQ3P 1SAUA 1ITYA 1Z91A 3LSTA 2V4JC 4RB0A 1PUFB 5D4SA 3Q0VA 4CHUA 3GLLA 4PJLA 1ETQA 1UZCA 1I6HJ 4NQWB 3V8KA 5BPDA 4EJVA 2EK5A 4WWCA 1LE8A 3OMYA 5JLWA 3WU1B 1REPC 1LFPA 3OL4A 2M2EA 4HEA2 3TGNA 4P1WA 4JOMA 4XKBA 3GTKJ 3HPHA 2K9NA 2CFXA 1HCRA 2J5OA 3BLYA 1OJLA 4XLEA 4WX9A 1TC3C 2YX4A 3LNQA 3V8LA 4YFNF 1MMSA 4IXAA 2ZSHB 3CCEI 3ML6A 4ZYGA 2QZ8A 2X9DA 3WTVC 3B73A 2HPIA 4XLNF 2WBMA 1VNDA 3CUOA 3UNGC 4IVNA 3DKYA 3PFYA 1VQ6I 4QSHA 3K4MA 1U5TB 2LDUA 4B47A 4BJ5C 2M7AA 4M3GA 1XD7A 3I0TA 2DYSH 1S6LA 5IYCJ 1T0FC 1O3QA 1ZHFA 2NRAC 4XM3A 2J5PA 5E8GA 3UR3C 4BXFA 3HJEA 3WTZA 2RQPA 1G8XA 4KN4X 3G4SI 1D5YA 3FMQA 4B1RA 1JHHA 3HZJA 3PNTA 5IPAA 4IKFA 3B6AA 3DEEA 2XAJA 2D1VA 3FF5A 3KFWX 2QEXI 4ABZA 1IC8A 3TW7A 2E1NA 4L0YB 2XGEA 2ELJA 2PEXA 5E20A 1HLVA 3QPTA 3ZCOA 2DI3A 3IAS2 3FISA 4ZYEA 1BOBA 2M45A 4A3FJ 1WZ2A 4M6XA 2EZIA 5K1YA 3CUQC 2A6EF 4A3DJ 4OAZA 3BG3A 1RETA 2XDVA 5E17F 1ZH5A 2UV1A 1ZLJA 1OCOH 3BR2A 3E5UA 1LDJA 1LFUP 9ANTA 3PSFA 3GFLA 3A01A 1VI0A 3OS0A 4ESBA 3G1LA 3JAMZ 4UUSA 1WWXA 4HPQA 5ICCA 2VT2A 2HQAA 3HOZJ 2P7CB 1U8RA 1KZHA 1G2HA 1WH5A 2P6SA 5F08A 4F55A 3CCSI 1JUSA 5GADJ 4AIHA 5E3NA 3HPGA 1T38A 3MWMA 3NRVA 3GFIA 2RNJA 1VQ9I 5B1BH 2F4MB 3MCZA 1IN4A 4U0YA 4IHVA 4PZJA 3TDZC 1ZG5A 1K6OA 3F8BA 3CP8A 5JLXA 3ABUA 4V2FA 2NS0A 1OMIA 2H6BA 2FD5A 3ZN0A 2OAZA 4II3A 2ZJQF 3E97A 4BQQA 5B5EC 4Q5SF 4MEYF 2KDOA 5CVRA 3K4JA 2VQCA 2PJPA 2RQQA 1T56A 5J4YA 3K4KA 4EGZA 3GZ6A 3I55I 4KIGA 4RDUA 1SC7A 3CLOA 2G7HA 1YIOA 1R00A 2K86A 3LSHA 2HDDA 3IKTA 3LFKA 2VC0A 3GUDA 4Y3OA 3RZDJ 5LGUA 3JRCA 1JKRC 1H9TA 1OQYA 2ID6A 4JBAA 3HGGA 3IUOA 4UB8C 1W7PD 3Q5FA 2XAQA 4S05A 2HNHA 5E79C 1RIOH 2O6GE 4A3LJ 2KQRA 1B6AA 2BYVE 4Z2YA 3IH2A 3VB2A 2EIJH 4N4OB 2FA5A 4ZDOA 3QOPA 5GP9A 2Q8KA 4OU0A 2VI6A 2Q0OA 3SFIA 5AONA 4F52A 2EA2A 3FXUA 2CYYA 4PSWA 4P9UA 3P7NA 2H8RA 4DQ2A 1J2XA 3KEYA 4ZH4F 2HPMA 1D0XA 3SYTA 4J19A 4PJNA 2B7EA 3ZOBA 4UB6C 2V1UA 3LSJA 3H5AA 4LMYA 2PMZA 2EFWA 1X3UA 3RPQA 4A6DA 2PLYA 4A5MA 2QF7A 2L9VA 3GVAA 4AM3A 4FETA 3S8PA 2COBA 2HOSA 1OCPA 1SD7A 4HQMA 2E1OA 2EZHA 1SFXA 2WV1A 2L02A 1ZREA 1ZRFA 2TRTA 1Q1VA 2YPRA 2RGVA 3O3KA 4IOCF 1X58A 2EZKA 2IVMA 5HS8A 3F22A 4FT8A 2R7ZJ 2CQKA 3ZXSA 4M6VA 5IY5H 2QGUA 2PX9A 4EM2A 1HKTA 2L9RA 4DBRA 4G7ZF 5C4XJ 3L2VA 3PNYA 2L7FP 1D0ZA 2MC3A 2W7NA 3HSEA 1W4MA 1WJ5A 1ON1A 2F48A 3BZCA 3AFHA 4ZYHA 4EJOA 2X0LA 1Y1VJ 1A31A 3ECOA 1MGTA 2HKXA 3KYCB 2DFIA 3ZQHA 2JVGA 2XPVA 2EBIA 4MGRA 1JKOC 2F5EA 2GXBA 5GTIC 2RVCA 1U5TC 1J0RA 2OJED 1V4RA 4R1HA 3TOAA 3JW4A 3I71A 1IRXA 1TWCJ 1QZZA 2QKMB 5KCMA 1YJWI 1B59A 4UVAA 2EIMH 2R7VA 3CCJI 2EFPA 2GZWA 3ZN1A 5C3EJ 1FYLA 4DZPA 2IP2A 3FKJA 1R5GA 2PFBA 3DEWA 1YHQI 1BR1A 4AVPA 3HOSA 2K02A 2M1BA 1XMKA 2DPUA 1TNTA 1YW7A 3D5RC 6PAXA 3S17J 2IS2A 1KQ8A 3V42A 4XOTA 4BL0B 3HHGA 3S1RJ 3I9V2 3OYFA 4N9HA 1KU3A 1SANA 1ZK8A 2OA4A 2GXAA 3KP3A 3M07A 1BR4A 2L3DA 2DMNA 1IN6A 1BJAA 1R22A 3NWSA 4KYWA 3BG7A 3OV8A 3DKXA 3TO9A 4BJ6C 4ZTJA 2I8DA 4XK4A 1GUUA 2MG4A 3C3WA 1U9OA 4RA2A 4FISA 1MMNA 4PGHA 3G2BA 1JTYA 5JVTA 3A01B 4ENJA 5F0HA 2A6HF 4UUSB 1B9MA 3ZRGA 2FMYA 1BA5A 3Q9VA 1DQUA 1FLIA 2XPUA 1T98A 1R5ID 2GBYA 1S7AA 1QQIA 1DGRM 1F9NA 3PM1A 4JX6A 1YQAA 4HA8A 1T8IA 4YEJA 2Z5UA 2DFHA 2XKOA 4JK1X 3ZPLA 4I98B 3J7AO 2CJJA 1R4MB 2CQXA 1HKSA 2VJ5A 3S1NJ 3QP5A 4F7ZA 3BJ6A 4BBSJ 2YSRA 1R23A 1VQ7I 4A69C 2UZKA 2F4IA 5ILVA 1OYWA 2MH9A 3C7JA 1VTNC 2K4BA 2OBPA 1K61A 4UV8A 1GT0C 5E8IA 1WRJA 3I64A 3IWFA 4J00A 3L7WA 4LK1F 3WE3A 1B4AA 1LPQA 2LK2A 3WTXC 4XICA 2K5CA 1UMQA 3ZMVA 2HFHA 1LQ1A 2R92J 2FF4A 4MTDA 1JT6A 2L7KA 4BHBA 2XAHA 5BMZA 4I99C 2E2HJ 5L3GA 3ASNH 5H6QA 4LG0A 4E70A 5F6FA 1IG7A 2VT3A 1SD4A 1EV7A 3OOUA 3AAFA 1ETKA 1T08B 2EV0A 3OYKA 1MDMA 4EGYA 4L5EA 1EKEA 2XGCA 2Y2ZA 1PDNC 2XKPA 1E3OC 4M72A 4ZYAA 1OYYA 2ACJA 4RAZA 1H89C 2E71A 4XN3A 2ZSIB 5F1RA 2M30A 2JA5J 2R5ZA 3G1OA 5J4VA 4C2MJ 3K7AJ 3QYFA 4O6JA 4KITB 4U7DA 3T1BA 2I10A 1SD5A 1UJ8A 2LD5A 1I6XA 3FXOA 1IRZA 3QQAA 1GVDA 2GM4A 4E7IA 1A36A 3FXKA 4NHJA 2M8EA 2EV6A 2KL4A 3VYUB 4RB2C 1YJ9I 3GX4X 3BOQA 4G7HF 1USTA 5EGOB 2OU2A 1EA3A 2JUGA 2Y69H 2QA4I 4MHGA 5LHHA 4A3KJ 3DKWA 4HG2A 2IT0A 2FRHA 3HRMA 3WU0A 2GXGA 1USSA 1YFHA 4MQVA 1HKQA 2XHKA 1Y0NA 3BP8A 2VPLA 1YRNA 2VKDA 2DFFA 1JUPA 2VJ4A 1W7PB 3FXMA 1HDDC 3TO7A 2BY2A 3GWZA 2JTVA 1T33A 1GDTA 4BUPA 3LL7A 1UFMA 2QKLB 1FPQA 3LA7A 4CCLA 2QSHX 1DPUA 5A2QZ 1OR7A 3A03A 2RC4A 2W00A 3SXYA 5ICEA 3ZMSA 3O8HA 2DTZA 4MO7A 1MZBA 1R36A 3K70C 5DV5A 1TQMA 1RR8C 5F27A 3HM5A 2ZC2A 4GRIA 1MBKA 1WJDA 3WE2A 3WTYC 2XROA 1PUFA 3VYTB 5ICFA 2W85A 1Z0XA 1FOWA 4EEFG 1IN8A 4DJAA 3OIOA 1WHUA 3DTEA 4NQWA 1IW7F 2LG4A 1FOXA 1LEBA 1NH3A 1Y8QB 4X6AJ 1FBUA 2HQNA 4BBRJ 4EMSA 2DA6A 3S32A 3RPUD 5DYMA 5HVQC 2KJBA 2ECBA 3HOVJ 2D1HA 2K9LA 2IS4A 4F93B 3ABKH 3CCVI 2F5VA 1FWZA 3WGIA 2CU7A 1D1CA 5BPIA 2CUFA 1X3WB 1YTYA 3T8RA 2HDCA 2O9LA 3H1CA 3HUGA 4HF1A 4LB6B 2TDXA 4XBFA 1TT0A 4V19K 2FBHA 1YIJI 1DP7P 3E6CC 3F6VA 4KJZA 1BIBA 1YLFA 2LP0A 3R4KA 5M5XJ 3NQOA 3MKYB 5BOXA 1TWGJ 1HSTA 2GAUA 1Z6TA 2LF8A 2PI0A 1OCRH 2VJJA 4LITA 3S2HJ 1ZGJA 1IGNA 4L9JA 3PSIA 1MNMC 5HS9A 4HF0A 2K3PA 3REOA 2P5LC 1FJLA 3TP3A 4HW0A 3IRQA 1YG2A 1ZG3A 4HSTA 4XONA 1XSDA 5LGNA 4L9VA 2EFNA 3CO6C 5DUKA 4GYIA 3K4NA 5CVJA 3JRDA 1VQ8I 2EJRA 3QOEA 4B4CA 2KKOA 1L0OC 2KPMA 3CD6I 2D45A 2WAQA 4LB5A 3WTUC 4Z6YA 2VOPA 1TTYA 1X1DA 1X1PA 3M8JA 2XC7A 3JRAA 1ZLKA 2IA2A 2DTRA 1DPRA 2E7WA 2KT0A 5LRSA 5BNGA 1YX3A 4RGUA 2HEOA 1GV2A 2BVLA 1CQTA 4WF2A 1AU7A 4XNFA 1K83J 2BW3B 1F43A 2LVSA 4IZZA 2Z1DA 3DQVC 3GLXA 3H3UA 3QYBA 3SFZA 1DDNA 4N0BA 2FNPA 1Z7UA 1J5YA 1LDDA 2CV1A 2LC2A 3L2WA 2E5ZA 3E6DA 3J81K 1VQPI 3OS2A 4XKCA 2AO9A 2L5QA 5IP7J 4V2GA 3C1DA 1BI1A 2DYRH 1HW5A 2JSCA 1MMAA 4LG0B 2KZVA 3E5QA 2Y0SA 1LB2A 3VSKA 2DDBA 1SAXA 3TBIA 3HB9A 3OYGA 1MDMB 1Z67A 2WAFA 2LNBA 2P5VA 2VPRA 2OC6A 3GZNB 1WI9A 2ZBKA 3FDYA 1F4KA 4IRIA 3BQYA 3EPZA 3JTGA 2CV2A 2OTJI 4H0EA 5EEHA 4G9YA 1DUXC 2P5KA 5CQGA 3H5RA 4P9FA 5DTDA 2H09A 2PMZN 1SFOJ 3RQ4A 1JKPC 5FFZA 1MNDA 3OYBA 2VODA 1I27A 2MD0A 5D5XB 2VONA 4LIUA 4MFEA 5EJCA 4O3MA 1FOKA 4RM2A 5M3MJ 1F1ZA 4LG3A 1B72A 4HV5A 4IEJA 4DZJA 4U87A 1N25A 1IXSB 3HTUA 3M8EA 1S3JA 2DPDA 1N75A 2H27A 4M6YA 2X48A 3JRFA 1S5LC 2AHQA 3OSGA 3N97A 1Z1DA 3ZGKA 1YS7A 2L01A 2LKXA 3SHFA 2HOEA 4E7SA 4AIDA 3K4LA 4QPQA 3J7YJ 2OQGA 4DYRA 1UCRA 1G6NA 4AIKA 2LBFA 2MW8A 3S1QJ 1FP2A 1K4TA 4BXXJ 1SVOA 2LKSA 1WJEA 2KRHA 5LEJA 1O7FA 4OMZA 2CQ7A 2K85A 1W0UA 1HW1A 2FX0A 2R4GA 3SDGA 3V7SA 3O6BB 3CCQI 3OSFA 3E1SA 5E1XA 3WGHA 3C18A 3V7CA 2XAGA 3ZQCA 4ENNA 1HC8A 1BBYA 2XGDA 1BM9A 1MD0A 4A5NA 4IHWA 2JA2A 4M9SA 2Z9OA 4I2OA 3EUHA 2DOEA 2YX7A 3LQRA 5LFAA 3VPRA 4NNJA 4W97A 4CCNA 3PIOF 4LOCA 1R1VA 2HTJA 2Z33A 5FKOA 2MLKA 3F21A 3HUGB 4UVBA 5E3LA 3GMEA 3MEXA 3R0JA 3WTWC 3FX3A 5DM7F 1XGOA 2RN7A 1JJ8C 4DYCA 4CSWA 4HLXA 3GW2A 1E0EA 3CCUI 2QUFA 3K4CA 3RTRA 3U21A 4PDKA 4L9TA 4OIOF 3L2CA 1P7IA 3HBLA 2LR8A 1F36A 1UHSA 1K7AA 1K6YA 2OV7A 3DPUA 3FZVA 5CYVA 3DP7A 3ABTA 1W36D 5F1JA 1P4XA 1S8NA 2W48A 3LWFA 2BGCA 4XQFA 3I5UA 2JT1A 4I6ZA 3KZZA 5D8KB 4DYQA 2NNNA 2V26A 2WB1A 3VDXA 3FK6A 1YOVB 4M3DA 2EIKH 2R7FA 3IV5A 2X1CA 3S3OA 3OYNA 1W5SA 1T39A 1U9NA 5IOYA 2AXLA 4C30A 2KHMA 1LEAA 4ZZLA 4MEXF 5K7ZA 1J09A 2K9MA 2L54A 3FXRA 4RBOA 1VQMI 5EEGA 2W82A 4UV9A 3WG9A 3HRTA 2FUG2 2QSGX 3I4NJ 2LY9A 2K3FA 4X0GA 3R60A 3BZ6A 4KUMA 3JRIA 2XGXA 2MH2A 1DGWY 2ECCA 3H9JA 1N77A 3PUFA 3HSRA 3F8CA 1BW5A 3E7LA 1UAAA 2BY0A 5CPRB 4BE2A 2IXSA 4BHCA 5FJ8J 5TRDA 4BDYA 2E5NA 2VBYA 3DU6A 1HDPA 1HBXG 1Y1WJ 3E5XA 4EQQA 2CW7A 3VODA 2FEZA 5ILSA 4DOZA 4F91B 3SJMA 5E3MA 2ZJPF 4F92B 4O5VA 3LAJA 3J7ZI 4Q47A 1I1SA 3VEPA 3KETA 4XSZF 3H0DA 2BOLA 3F0CA 3NAUA 3GTOJ 4A0YA 4I0BA 5HLIA 4RAGA 5GAHJ 2EQRA 1TQIA 2CRGA 2GIZA 2HYJA 3K9TA 3O8GA 3UKGA 3F9KA 4M73A 1BOAA 2IW5A 2VKEA 3VOEA 2LOOA 1WPKA 1U0JA 4OIRF 4ENKA 1R1UA 2HU9A 3WU2C 3BR3A 3K4BA 3D1NI 4A0XA 3K1MA 3RCOA 3OR2C 2XB5A 1UG0A 2L4MA 4G6DA 4W1UA 2CV0A 5DM6F 5FGMA 1B72B 1O3TA 4I09A 2KP6A 3IAM2 5LRRA 2O7OA 4BY1J 5C4JJ 5J47A 1BN5A 3OY9A 1VQNI 1LVAA 1Y39A 1U78A 1G59A 3FHZA 2NNYA 1O3SA 4A93J 2DT7B 3DXJF 3RDIA 2RREA 4Y17A 3OWTA 3C2GA 2KIQA 1JI8A 1YITI 1ZYRF 3JAMK 3E3VA 3QPSA 1JGSA 3G71I 4FTHA 1HA8A 1MBGA 2GOMA 2E1CA 1C0WA 4NDLA 2F5CA 3V8JA 1STZA 5E1ZB 1FYMA 2LBFB 3CC4I 5EDNA 1FX7A 1RPWA 2VIXA 3K10A 2D5VA 2EILH 1ZG1A 1MMGA 5EGOA 2FE3A 3OYJA 2OCEA 3A0HC 1EH6A 3RIRA 3KP5A 2XAUA 5JI6A 2K7LA 3CJQB 2R7WA 5FLXZ 5FKKA 1YW8A 2JZYA 4ETSA 4XN0A 3DBLB 4YFKF 3BG5A 3LQQA 4EATA 2ZO4A 4B44A 1TBXA 1MNEA 2FBKA 1Z7LA 2ZCWA 2H94A 2RKHA 3H36A 1W7PA 2JPBA 4BQAA 2BBYA 2QM3A 3U2RA 2X85A 5FLVA 1KQ0A 1WJAA 3LSMA 2L4AA 4AD9A 2KZGA
chains in the Genus database with same CATH topology
2GQQA 3KP2A 2QQ9A 3HRUA 4MTEA 5D6FA 3B02A 4RGSA 4LLNA 5LBQA 4G8XA 2FOKA 3F8FA 1HSJA 1BC8C 3ELKA 2QLZA 3T5XA 5FD6A 3DF8A 2ZJ2A 3JSOA 2QVOA 4S04A 2Z99A 3ZMUA 5L3BA 3HTSB 4QLCU 4I01A 2VBWA 4YIFA 4L18B 4IRHA 2MD5A 5D6EA 3HRSA 3QRFF 5FO5A 3R0AA 1NHAA 4KIFA 3F23A 2DLLA 2VOOA 2HZTA 1ZARA 4IHSA 1FBQA 5BS6A 2F2EA 1XDSA 3DFGA 2RV8A 3GF2A 4CGZA 3FXQA 3ZP5A 3KLNA 5L3CA 1E17A 3ZMDA 3FM3A 5AIQA 1Y0UA 2ZFWA 1RUOA 3BY6A 2QYOA 1JE8A 4HF2A 1FT9A 3GFJA 2K4JA 2DO7A 4HDVA 3GZ5A 5LLQA 4KT5C 1SMTA 3KE2A 1IXRC 2AS5F 3CUQA 4JQFA 1J9IA 4GO1A 4HX4A 1YS6A 2MBFA 1YO5C 4U0VA 2V1DA 4Y13A 3IHUA 2F5FA 3PQKA 3HSFA 3KEOA 2ELHA 1ZRDA 1XN7A 4TV7A 2H6CA 5IT3A 1Z05A 1B1BA 1RUNA 2OZUA 2VC1A 1MJBA 4P5OA 2W25A 3RI4A 1TW3A 1G3SA 3WODF 5D5UB 5HOOA 1A04A 4LJZF 2ESHA 1IAWA 2STWA 3GEZA 1OYIA 1U2WA 5L3DA 2QBYB 3BJOA 1P4WA 5JR3A 4LLLA 1ULYA 2A61A 4Y15A 3QU6A 1FSEA 2UWMA 3KP4A 1D8KA 1P6RA 1TW2A 2GA2A 2HS5A 2OQRA 3RKXA 1J59A 3ZQ7A 5HS7A 2PQ8A 1S29A 2HR3A 3G73A 5D4RA 1GXPA 1KA8A 4OIQF 2KIFA 2QQBA 3P9IA 3CO7C 1TQPA 3PQJA 1BC7C 1ZAOA 3T0YA 2JRTA 1FYKA 2A3SA 2WTEA 1H0MA 1IRFA 4LFUA 3Q9SA 1ZN2A 4A12A 2HWVA 5DCMA 4RGXA 4BYYA 5CVVA 1QZYA 3H3ZA 3WTTC 1LDKB 2WV0A 1F5TA 2DBBA 4LK0F 2V9VA 4L9NA 3FWEA 5FD5A 1MJAA 3EDPA 5HDNA 1ON2A 5DCFA 4UNOA 2ZXJA 5A2QK 1FNNA 2IJLA 3TQNA 3RPUA 4KMUX 4WCGA 1IUYA 1R7JA 2ZNYA 4BXUA 2B0LA 2M87A 3EETA 4BHPA 3J80Z 2X4HA 1O3RA 1PUEE 4P96A 2YU3A 5JFRA 3IC7A 4LGWA 3F8NA 1G3WA 1Z9CA 2R3SA 1HQCA 3F8MA 2CGPA 3CUQB 2QQAA 5IT9Z 4KICA 2W84A 5E18F 1TLHB 1O57A 1BI2A 1R1TA 3EQLF 3T8TA 1PP7U 2HGCA 1K78A 5HLHA 1R58A 3TO6A 3FMRA 4WXDA 5ICGA 4I0AA 2RDPA 2DQRA 3ECHA 2HKOA 4HX7A 3K1NA 4KFCA 3CJNA 1P92A 1QBJA 4GYGA 4YIIA 2KIMA 4WXCA 5HLGA 2FMLA 2NYXA 5CVIA 2MA3A 3I58A 2UXXA 4KNYA 2A68F 4U0WA 3DV8A 3N4MA 2Y48A 5D8LB 2O03A 2ISZA 2GIVA 1UB9A 2LSOA 4KA4A 2HTSA 4PCQA 2XAFA 3RJPA 3U9GA 4I02A 1KYWA 3S2WA 3MZHA 3E6BA 3KCCA 2LKPA 1L3LA 2E7XA 3ROUA 4XSXF 1KU7A 4BAYA 1H9GA 2XIGA 2D2WA 2O8XA 2ADUA 3IWZA 3BWGA 5J8FA 4HOBA 4D0PA 4A0ZA 2G9WA 4M71A 5DCMB 2DAOA 4G94A 1ONVA 2EB7A 4L5IA 3DPLC 5DUIA 3P9KA 1I1GA 3TOBA 1MJ9A 4HZFA 5D5WB 1WSUA 2W57A 2STTA 1IRGA 3BPVA 3R6SA 1XSVA 5ED4A 3SZTA 4MNUA 2VBXA 2XUBA 1QO0D 1O7LA 3GFMA 4NB5A 4CZZA 4U7BA 3BROA 3WGGA 3MFKA 4P55A 5LGTA 3LA2A 3KEQA 3IRRA 3P9CA 4GCVA 2LF7A 3K1PA 5L3EA 3F3XA 3L00A 4G6QA 2K27A 5K5RA 5FFXA 4FHTA 3I4PA 5HDKA 3I59A 1K78B 1RNLA 2JPCA 3DPTA 3SZPA 3F6OA 3KP7A 2DW4A 2EWNA 2COMA 4EJWA 1IN5A 3OOPA 2Z3YA 3COAC 1U6GA 1ZGAA 1IN7A 2ZMEA 3VFZA 4CICA 4QWQA 3GYHX 5BQTA 1KQ9A 1SFEA 3I53A 1SFUA 2PG4A 4HYEA 3W6JB 2DU9A 2EA4A 5CVUA 5J8CA 3HYIA 3M8FA 5J6XA 2P4WA 4ENMA 1I5ZA 3G3ZA 3KLOA 2GA1A 1FSHA 3JTHA 2BEOA 3RKYA 1G3YA 1RI7A 2FSWA 3MZYA 3ERED 1UHMA 3IKVA 3BDDA 2UXNA 3FMSA 1WKMA 2KRFA 2IA1A 1QNTA 1R5HA 5CJ9A 5ILUA 2KIUA 1BIAA 2QBYA 4CO8A 2V1XA 4EJTA 2ISYA 2A5YB 4RB1A 2QWWA 4XRFA 3M1EA 5F64A 4LLGF 4UVCA 4OIPF 3GXOA 1D3YA 1S7OA 2V79A 2VE8A 2ESNA 4IPAA 3MQ0A 4XLPF 2A07F 1ODDA 4KMFA 2FXAA 3GO5A 2W24A 4A6EA 5HDGA 3ULQB 4LD5A 1ZRCA 4EVIA 5H20A 2XRNA 4YG2F 1TNSA 4HQEA 1XCVA 5FLXK 4M9ZA 3EYIA 5KVRA 4UXNA 3V4GA 3TDUC 4IF4A 1UHWA 2DQLA 2XASA 5KK1A 5JHUA 5E1WA 4HBLA 4Q4ZF 4R8HA 3QPHA 4L0ZB 2ETHA 4KIBA 4EJUA 3L9FA 1YYVA 1Q1HA 1B9NA 1T0FA 2VN2A 1J75A 3QAHA 2Q2EA 3HHHA 3I59B 1XB4A 5DDGA 3F72A 2BV6A 2BE5F 1JXSA 3M7GA 2FU4A 5DD4A 5D5VB 4HLYA 4RAYA 1CF7A 2QENA 3CDHA 1Z6RA 4GGGA 2P6TA 3BJAA 2ZMEB 3DEUA 4FX0A 1D8JA 4FX4A 1FP1D 4MQ9F 1LNWA 1T6SA 1LJ9A 4CYDA 4ESJA 1FY7A 1XSXA 2XV4S 2HQRA 5CLSA 1XGMA 2FNAA 5TJJA 3V7RA 4HAMA 4OMYA 2WWYA 2DK5A 2OZ6A 5H6RA 5DEQA 2VE9A 1P2FA 3QU3A 4ZZDA 4B8XA 4YFXF 1W5TA 4IJAA 2CSOA 4CDGA 4IRGA 4HDUA 4UHTA 4RGRA 1YW9A 3RKWA 1T2KA 5AIPA 1GVJA 4OINF 1RZ4A 2FQ3A 3ZMTA 1V3FA 1XGNA 2PBIA 3JSPA 1GXQA 3RYPA 5LHIA 4AWXB 2CWEA 3O2PE 4WK8F 2EFOA 2M5WA 1P4AA 1IZ1A 2O0YA 1FZPB 2HYGD 1BI3A 2NAZA 3EYYA 4ON0A 4KDPA 1WQ2A 5ERIA 2XVCA 4M74A 2MLGA 1CGPA 4DNCA 1PP8F 3KP6A 4L5JA 2YR2A 3PFIA 2F5DA 1FBSA 4B09A 3D0SA 3LAPA 2IRFG 3I54A 2IA0A 1KU2A 4K2EA 3RYRA 1IXCA 2IPQX 2CW0F 1QGPA 3J81Z 2DK8A 2HYFA 3LA3A 4HV6A 1AWCA 2OD5A 4BNCA 3NEUA 3HOTA 1U5TA 5K5QA 4EM1A 4G7OF 1EH8A 1BI0A 2PMUA 3D5LA 1D5VA 3KZYA 2GWRA 4ZYDA 3HIFA 5LEKA 4BH9A 1KGSA 4PGGA 5LHGA 2O3FA 3M9AA 3BPXA 3R61A 1SD6A 2P8TA 4A2UA 4RB3C 5K5OA 2V6CA 1CF7B 2WC2A 1K79A 1SMYF 4ASNA 4CXFA 3CTAA 1XCBA 5L3FA 1EH7A 3IL2A 2CG4A 1JHFA 3ISPA 4AIJA 3SQNA 1OPCA 2EFQA 4KN7X 3QP6A 4M9XA 3MAJA 4EV0A 3H92A 4OOIA 3E6MA 3CO6C 2PMHA 4HX8A 3TKYA 4ESFA 3L09A 3K0LA 3W6KB 2CO5A 2FBIA 2EV5A 2KJCA 4I7HA 2Y75A 4U88A 4EM0B 1AOYA 4UUVA 1KYZA 2Y0MA 2ZKZA 3K2ZA 1HXDA 3ZMZA 4Q48A 5FB2A 4WXHA 4RS8A 1OKRA 2O61A 3J80K 4N9IA 2VBZA 2PN6A 1QPMA 3K69A 4GXOA 2A69F 5DD8A 1U3EM 1J7KA 1G4DA 1G3TA 2P7VB 1FC3A 1XMAA 1KU9A 2R7DA 4IHTA 5IT9K 1XGSA 3WTSC 1HW2A 3U1DA 2ZNZA 4R79A 1GHCA 2DT5A 3FM5A 2VXZA 1IF1A 1MKMA 1XDUA 1E2XA 2C6YA 2G7UA 1Z91A 3LSTA 4RB0A 5D4SA 4CHUA 5BPDA 3V8KA 4EJVA 2EK5A 4WWCA 3WU1B 1REPC 3TGNA 2CFXA 2J5OA 4WX9A 2YX4A 3V8LA 4YFNF 4IXAA 3ML6A 4ZYGA 2QZ8A 3WTVC 3B73A 4XLNF 3CUOA 4IVNA 1U5TB 2LDUA 1XD7A 3I0TA 1S6LA 1O3QA 1ZHFA 2NRAC 2J5PA 5E8GA 3WTZA 2RQPA 4KN4X 3FMQA 1JHHA 2XAJA 2D1VA 3FF5A 3KFWX 4L0YB 2E1NA 2PEXA 5E20A 3QPTA 2DI3A 4ZYEA 2M45A 4M6XA 5K1YA 3CUQC 2A6EF 5E17F 1ZH5A 1ZLJA 3E5UA 1LDJA 3GFLA 4ESBA 3JAMZ 1WWXA 5ICCA 2VT2A 2P7CB 1U8RA 2P6SA 1T38A 4AIHA 3MWMA 3NRVA 3GFIA 2RNJA 3MCZA 1IN4A 4U0YA 4PZJA 3TDZC 1ZG5A 1K6OA 3F8BA 3ABUA 2NS0A 1OMIA 2H6BA 3ZN0A 2OAZA 3E97A 4Q5SF 4MEYF 5CVRA 2PJPA 4EGZA 3GZ6A 4KIGA 3CLOA 2G7HA 1YIOA 1R00A 2K86A 3IKTA 3LFKA 2VC0A 3GUDA 5LGUA 1H9TA 4JBAA 1W7PD 3Q5FA 2XAQA 4S05A 1RIOH 2O6GE 1B6AA 2BYVE 4Z2YA 3VB2A 2FA5A 3QOPA 2Q8KA 4OU0A 2Q0OA 5AONA 2EA2A 3FXUA 2CYYA 4P9UA 3P7NA 4DQ2A 1J2XA 4ZH4F 2V1UA 4LMYA 2EFWA 1X3UA 3RPQA 4A6DA 2PLYA 4A5MA 3GVAA 1SD7A 4HQMA 1SFXA 2L02A 1ZREA 1ZRFA 2YPRA 2RGVA 3O3KA 2IVMA 5HS8A 3F22A 4FT8A 2CQKA 4EM2A 1HKTA 4G7ZF 2MC3A 3HSEA 1W4MA 1ON1A 4ZYHA 4EJOA 2X0LA 3ECOA 1MGTA 2HKXA 2DFIA 4MGRA 2GXBA 2F5EA 2RVCA 1U5TC 1J0RA 1V4RA 4R1HA 3TOAA 3JW4A 3I71A 1QZZA 1B59A 4UVAA 2EFPA 2GZWA 3ZN1A 1FYLA 2IP2A 1R5GA 2PFBA 3HOSA 4AVPA 2K02A 2M1BA 1XMKA 2DPUA 1TNTA 1YW7A 1KQ8A 6PAXA 3HHGA 4N9HA 1KU3A 2OA4A 3KP3A 2L3DA 1IN6A 1BJAA 1R22A 4KYWA 3OV8A 3TO9A 3C3WA 4PGHA 5JVTA 4ENJA 2A6HF 1B9MA 2FMYA 3Q9VA 1FLIA 1T98A 1S7AA 1QQIA 1F9NA 1YQAA 4HA8A 2Z5UA 2XKOA 4JK1X 3ZPLA 4I98B 3J7AO 1HKSA 3QP5A 4F7ZA 3BJ6A 2YSRA 1R23A 2UZKA 5ILVA 1OYWA 2MH9A 3C7JA 1VTNC 2K4BA 2OBPA 4UV8A 5E8IA 1WRJA 3I64A 3IWFA 3L7WA 4LK1F 3WE3A 1B4AA 3WTXC 3ZMVA 2HFHA 1LQ1A 2FF4A 4MTDA 4BHBA 2XAHA 5BMZA 5L3GA 5H6QA 4LG0A 4E70A 5F6FA 2VT3A 1SD4A 1EV7A 3AAFA 2EV0A 1MDMA 4EGYA 1PDNC 2XKPA 4M72A 1OYYA 2ACJA 4RAZA 5F1RA 2M30A 4O6JA 4U7DA 3T1BA 1SD5A 1I6XA 4NHJA 2M8EA 2EV6A 4RB2C 3GX4X 3BOQA 4G7HF 1USTA 2OU2A 4MHGA 5LHHA 3DKWA 2IT0A 2FRHA 3HRMA 3WU0A 2GXGA 1USSA 1YFHA 4MQVA 1HKQA 2XHKA 3BP8A 1W7PB 3TO7A 3GWZA 2JTVA 1UFMA 1FPQA 3LA7A 1DPUA 5A2QZ 1OR7A 2RC4A 3SXYA 5ICEA 3ZMSA 1MZBA 1R36A 5DV5A 1TQMA 3WE2A 3WTYC 2XROA 5ICFA 2W85A 1IN8A 4NQWA 1IW7F 1LEBA 1FBUA 2HQNA 4EMSA 5DYMA 5HVQC 2KJBA 2D1HA 1FWZA 3WGIA 5BPIA 1YTYA 3T8RA 2HDCA 3HUGA 4HF1A 4LB6B 2TDXA 4XBFA 2FBHA 1DP7P 3E6CC 3F6VA 1BIBA 1YLFA 3R4KA 3NQOA 5BOXA 1HSTA 2GAUA 1Z6TA 2LF8A 2PI0A 1ZGJA 4L9JA 5HS9A 4HF0A 3REOA 2P5LC 4HW0A 3IRQA 1YG2A 1ZG3A 1XSDA 5LGNA 4L9VA 2EFNA 5DUKA 4GYIA 5CVJA 2EJRA 2KKOA 1L0OC 2D45A 4LB5A 3WTUC 2VOPA 1TTYA 1ZLKA 2IA2A 2DTRA 1DPRA 2E7WA 5LRSA 4RGUA 2HEOA 4WF2A 3DQVC 3GLXA 3H3UA 3SFZA 1DDNA 4N0BA 2FNPA 1Z7UA 1J5YA 1LDDA 3E6DA 3J81K 3C1DA 1BI1A 1HW5A 2JSCA 4LG0B 3E5QA 1LB2A 1SAXA 1MDMB 2LNBA 2P5VA 1WI9A 2ZBKA 1F4KA 4IRIA 3JTGA 4H0EA 5EEHA 4G9YA 1DUXC 2P5KA 4P9FA 2H09A 5FFZA 2VODA 1I27A 5D5XB 2VONA 4O3MA 1FOKA 1F1ZA 4HV5A 1IXSB 3HTUA 3M8EA 1S3JA 2DPDA 2H27A 4M6YA 3N97A 1Z1DA 1YS7A 2L01A 3SHFA 2HOEA 2OQGA 1UCRA 1G6NA 4AIKA 1FP2A 5LEJA 1O7FA 4OMZA 1HW1A 3V7SA 3O6BB 5E1XA 3WGHA 3C18A 3V7CA 2XAGA 4ENNA 1BBYA 1BM9A 1MD0A 4A5NA 4M9SA 2Z9OA 4I2OA 3EUHA 2YX7A 3LQRA 1R1VA 2HTJA 2Z33A 2MLKA 3F21A 4UVBA 3MEXA 3R0JA 3WTWC 3FX3A 1XGOA 2RN7A 4HLXA 3GW2A 2QUFA 3RTRA 4PDKA 4L9TA 4OIOF 3L2CA 1K7AA 3FZVA 5CYVA 3DP7A 3ABTA 1P4XA 1S8NA 3LWFA 2BGCA 3I5UA 2JT1A 3KZZA 5D8KB 2NNNA 2R7FA 1W5SA 1T39A 2AXLA 1LEAA 4ZZLA 4MEXF 3FXRA 2L54A 5EEGA 4UV9A 3WG9A 3HRTA 3R60A 3BZ6A 4KUMA 2XGXA 2MH2A 3HSRA 3F8CA 4BHCA 5TRDA 2VBYA 1HBXG 3E5XA 4EQQA 3VODA 2FEZA 5ILSA 3LAJA 4O5VA 4Q47A 1I1SA 3VEPA 3KETA 4XSZF 4A0YA 4I0BA 5HLIA 3K9TA 1TQIA 4M73A 1BOAA 2IW5A 3VOEA 4OIRF 4ENKA 1R1UA 4A0XA 3K1MA 2L4MA 4G6DA 5FGMA 1O3TA 4I09A 5LRRA 1BN5A 1LVAA 1U78A 3FHZA 2NNYA 1O3SA 3DXJF 3RDIA 4Y17A 1ZYRF 3JAMK 3E3VA 1JGSA 2E1CA 1C0WA 2F5CA 3V8JA 1STZA 5E1ZB 1FYMA 1FX7A 1ZG1A 2FE3A 3RIRA 1EH6A 3KP5A 5JI6A 2K7LA 5FLXZ 1YW8A 2JZYA 4ETSA 4YFKF 3LQQA 2ZO4A 1TBXA 2FBKA 2ZCWA 2H94A 2RKHA 1W7PA 2JPBA 4BQAA 2BBYA 2QM3A 3U2RA 1KQ0A 2L4AA 4AD9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GQQ A;  3KP2 A;  2QQ9 A;  3HRU A;  4MTE A;  5D6F A;  3B02 A;  4RGS A;  4LLN A;  5LBQ A;  4G8X A;  2FOK A;  3F8F A;  1HSJ A;  1BC8 C;  3ELK A;  2QLZ A;  3T5X A;  5FD6 A;  3DF8 A;  2ZJ2 A;  3JSO A;  2QVO A;  4S04 A;  2Z99 A;  3ZMU A;  5L3B A;  3HTS B;  4QLC U;  4I01 A;  2VBW A;  4YIF A;  4L18 B;  4IRH A;  2MD5 A;  5D6E A;  3HRS A;  3QRF F;  5FO5 A;  3R0A A;  1NHA A;  4KIF A;  3F23 A;  2DLL A;  2VOO A;  2HZT A;  1ZAR A;  4IHS A;  1FBQ A;  5BS6 A;  2F2E A;  1XDS A;  3DFG A;  2RV8 A;  3GF2 A;  4CGZ A;  3FXQ A;  3ZP5 A;  3KLN A;  5L3C A;  1E17 A;  3ZMD A;  3FM3 A;  5AIQ A;  1Y0U A;  2ZFW A;  1RUO A;  3BY6 A;  2QYO A;  1JE8 A;  4HF2 A;  1FT9 A;  3GFJ A;  2K4J A;  2DO7 A;  4HDV A;  3GZ5 A;  5LLQ A;  4KT5 C;  1SMT A;  3KE2 A;  1IXR C;  2AS5 F;  3CUQ A;  4JQF A;  1J9I A;  4GO1 A;  4HX4 A;  1YS6 A;  2MBF A;  1YO5 C;  4U0V A;  2V1D A;  4Y13 A;  3IHU A;  2F5F A;  3PQK A;  3HSF A;  3KEO A;  2ELH A;  1ZRD A;  1XN7 A;  4TV7 A;  2H6C A;  5IT3 A;  1Z05 A;  1B1B A;  1RUN A;  2OZU A;  2VC1 A;  1MJB A;  4P5O A;  2W25 A;  3RI4 A;  1TW3 A;  1G3S A;  3WOD F;  5D5U B;  5HOO A;  1A04 A;  4LJZ F;  2ESH A;  1IAW A;  2STW A;  3GEZ A;  1OYI A;  1U2W A;  5L3D A;  2QBY B;  3BJO A;  1P4W A;  5JR3 A;  4LLL A;  1ULY A;  2A61 A;  4Y15 A;  3QU6 A;  1FSE A;  2UWM A;  3KP4 A;  1D8K A;  1P6R A;  1TW2 A;  2GA2 A;  2HS5 A;  2OQR A;  3RKX A;  1J59 A;  3ZQ7 A;  5HS7 A;  2PQ8 A;  1S29 A;  2HR3 A;  3G73 A;  5D4R A;  1GXP A;  1KA8 A;  4OIQ F;  2KIF A;  2QQB A;  3P9I A;  3CO7 C;  1TQP A;  3PQJ A;  1BC7 C;  1ZAO A;  3T0Y A;  2JRT A;  1FYK A;  2A3S A;  2WTE A;  1H0M A;  1IRF A;  4LFU A;  3Q9S A;  1ZN2 A;  4A12 A;  2HWV A;  5DCM A;  4RGX A;  4BYY A;  5CVV A;  1QZY A;  3H3Z A;  3WTT C;  1LDK B;  2WV0 A;  1F5T A;  2DBB A;  4LK0 F;  2V9V A;  4L9N A;  3FWE A;  5FD5 A;  1MJA A;  3EDP A;  5HDN A;  1ON2 A;  5DCF A;  4UNO A;  2ZXJ A;  5A2Q K;  1FNN A;  2IJL A;  3TQN A;  3RPU A;  4KMU X;  4WCG A;  1IUY A;  1R7J A;  2ZNY A;  4BXU A;  2B0L A;  2M87 A;  3EET A;  4BHP A;  3J80 Z;  2X4H A;  1O3R A;  1PUE E;  4P96 A;  2YU3 A;  5JFR A;  3IC7 A;  4LGW A;  3F8N A;  1G3W A;  1Z9C A;  2R3S A;  1HQC A;  3F8M A;  2CGP A;  3CUQ B;  2QQA A;  5IT9 Z;  4KIC A;  2W84 A;  5E18 F;  1TLH B;  1O57 A;  1BI2 A;  1R1T A;  3EQL F;  3T8T A;  1PP7 U;  2HGC A;  1K78 A;  5HLH A;  1R58 A;  3TO6 A;  3FMR A;  4WXD A;  5ICG A;  4I0A A;  2RDP A;  2DQR A;  3ECH A;  2HKO A;  4HX7 A;  3K1N A;  4KFC A;  3CJN A;  1P92 A;  1QBJ A;  4GYG A;  4YII A;  2KIM A;  4WXC A;  5HLG A;  2FML A;  2NYX A;  5CVI A;  2MA3 A;  3I58 A;  2UXX A;  4KNY A;  2A68 F;  4U0W A;  3DV8 A;  3N4M A;  2Y48 A;  5D8L B;  2O03 A;  2ISZ A;  2GIV A;  1UB9 A;  2LSO A;  4KA4 A;  2HTS A;  4PCQ A;  2XAF A;  3RJP A;  3U9G A;  4I02 A;  1KYW A;  3S2W A;  3MZH A;  3E6B A;  3KCC A;  2LKP A;  1L3L A;  2E7X A;  3ROU A;  4XSX F;  1KU7 A;  4BAY A;  1H9G A;  2XIG A;  2D2W A;  2O8X A;  2ADU A;  3IWZ A;  3BWG A;  5J8F A;  4HOB A;  4D0P A;  4A0Z A;  2G9W A;  4M71 A;  5DCM B;  2DAO A;  4G94 A;  1ONV A;  2EB7 A;  4L5I A;  3DPL C;  5DUI A;  3P9K A;  1I1G A;  3TOB A;  1MJ9 A;  4HZF A;  5D5W B;  1WSU A;  2W57 A;  2STT A;  1IRG A;  3BPV A;  3R6S A;  1XSV A;  5ED4 A;  3SZT A;  4MNU A;  2VBX A;  2XUB A;  1QO0 D;  1O7L A;  3GFM A;  4NB5 A;  4CZZ A;  4U7B A;  3BRO A;  3WGG A;  3MFK A;  4P55 A;  5LGT A;  3LA2 A;  3KEQ A;  3IRR A;  3P9C A;  4GCV A;  2LF7 A;  3K1P A;  5L3E A;  3F3X A;  3L00 A;  4G6Q A;  2K27 A;  5K5R A;  5FFX A;  4FHT A;  3I4P A;  5HDK A;  3I59 A;  1K78 B;  1RNL A;  2JPC A;  3DPT A;  3SZP A;  3F6O A;  3KP7 A;  2DW4 A;  2EWN A;  2COM A;  4EJW A;  1IN5 A;  3OOP A;  2Z3Y A;  3COA C;  1U6G A;  1ZGA A;  1IN7 A;  2ZME A;  3VFZ A;  4CIC A;  4QWQ A;  3GYH X;  5BQT A;  1KQ9 A;  1SFE A;  3I53 A;  1SFU A;  2PG4 A;  4HYE A;  3W6J B;  2DU9 A;  2EA4 A;  5CVU A;  5J8C A;  3HYI A;  3M8F A;  5J6X A;  2P4W A;  4ENM A;  1I5Z A;  3G3Z A;  3KLO A;  2GA1 A;  1FSH A;  3JTH A;  2BEO A;  3RKY A;  1G3Y A;  1RI7 A;  2FSW A;  3MZY A;  3ERE D;  1UHM A;  3IKV A;  3BDD A;  2UXN A;  3FMS A;  1WKM A;  2KRF A;  2IA1 A;  1QNT A;  1R5H A;  5CJ9 A;  5ILU A;  2KIU A;  1BIA A;  2QBY A;  4CO8 A;  2V1X A;  4EJT A;  2ISY A;  2A5Y B;  4RB1 A;  2QWW A;  4XRF A;  3M1E A;  5F64 A;  4LLG F;  4UVC A;  4OIP F;  3GXO A;  1D3Y A;  1S7O A;  2V79 A;  2VE8 A;  2ESN A;  4IPA A;  3MQ0 A;  4XLP F;  2A07 F;  1ODD A;  4KMF A;  2FXA A;  3GO5 A;  2W24 A;  4A6E A;  5HDG A;  3ULQ B;  4LD5 A;  1ZRC A;  4EVI A;  5H20 A;  2XRN A;  4YG2 F;  1TNS A;  4HQE A;  1XCV A;  5FLX K;  4M9Z A;  3EYI A;  5KVR A;  4UXN A;  3V4G A;  3TDU C;  4IF4 A;  1UHW A;  2DQL A;  2XAS A;  5KK1 A;  5JHU A;  5E1W A;  4HBL A;  4Q4Z F;  4R8H A;  3QPH A;  4L0Z B;  2ETH A;  4KIB A;  4EJU A;  3L9F A;  1YYV A;  1Q1H A;  1B9N A;  1T0F A;  2VN2 A;  1J75 A;  3QAH A;  2Q2E A;  3HHH A;  3I59 B;  1XB4 A;  5DDG A;  3F72 A;  2BV6 A;  2BE5 F;  1JXS A;  3M7G A;  2FU4 A;  5DD4 A;  5D5V B;  4HLY A;  4RAY A;  1CF7 A;  2QEN A;  3CDH A;  1Z6R A;  4GGG A;  2P6T A;  3BJA A;  2ZME B;  3DEU A;  4FX0 A;  1D8J A;  4FX4 A;  1FP1 D;  4MQ9 F;  1LNW A;  1T6S A;  1LJ9 A;  4CYD A;  4ESJ A;  1FY7 A;  1XSX A;  2XV4 S;  2HQR A;  5CLS A;  1XGM A;  2FNA A;  5TJJ A;  3V7R A;  4HAM A;  4OMY A;  2WWY A;  2DK5 A;  2OZ6 A;  5H6R A;  5DEQ A;  2VE9 A;  1P2F A;  3QU3 A;  4ZZD A;  4B8X A;  4YFX F;  1W5T A;  4IJA A;  2CSO A;  4CDG A;  4IRG A;  4HDU A;  4UHT A;  4RGR A;  1YW9 A;  3RKW A;  1T2K A;  5AIP A;  1GVJ A;  4OIN F;  1RZ4 A;  2FQ3 A;  3ZMT A;  1V3F A;  1XGN A;  2PBI A;  3JSP A;  1GXQ A;  3RYP A;  5LHI A;  4AWX B;  2CWE A;  3O2P E;  4WK8 F;  2EFO A;  2M5W A;  1P4A A;  1IZ1 A;  2O0Y A;  1FZP B;  2HYG D;  1BI3 A;  2NAZ A;  3EYY A;  4ON0 A;  4KDP A;  1WQ2 A;  5ERI A;  2XVC A;  4M74 A;  2MLG A;  1CGP A;  4DNC A;  1PP8 F;  3KP6 A;  4L5J A;  2YR2 A;  3PFI A;  2F5D A;  1FBS A;  4B09 A;  3D0S A;  3LAP A;  2IRF G;  3I54 A;  2IA0 A;  1KU2 A;  4K2E A;  3RYR A;  1IXC A;  2IPQ X;  2CW0 F;  1QGP A;  3J81 Z;  2DK8 A;  2HYF A;  3LA3 A;  4HV6 A;  1AWC A;  2OD5 A;  4BNC A;  3NEU A;  3HOT A;  1U5T A;  5K5Q A;  4EM1 A;  4G7O F;  1EH8 A;  1BI0 A;  2PMU A;  3D5L A;  1D5V A;  3KZY A;  2GWR A;  4ZYD A;  3HIF A;  5LEK A;  4BH9 A;  1KGS A;  4PGG A;  5LHG A;  2O3F A;  3M9A A;  3BPX A;  3R61 A;  1SD6 A;  2P8T A;  4A2U A;  4RB3 C;  5K5O A;  2V6C A;  1CF7 B;  2WC2 A;  1K79 A;  1SMY F;  4ASN A;  4CXF A;  3CTA A;  1XCB A;  5L3F A;  1EH7 A;  3IL2 A;  2CG4 A;  1JHF A;  3ISP A;  4AIJ A;  3SQN A;  1OPC A;  2EFQ A;  4KN7 X;  3QP6 A;  4M9X A;  3MAJ A;  4EV0 A;  3H92 A;  4OOI A;  3E6M A;  3CO6 C;  2PMH A;  4HX8 A;  3TKY A;  4ESF A;  3L09 A;  3K0L A;  3W6K B;  2CO5 A;  2FBI A;  2EV5 A;  2KJC A;  4I7H A;  2Y75 A;  4U88 A;  4EM0 B;  1AOY A;  4UUV A;  1KYZ A;  2Y0M A;  2ZKZ A;  3K2Z A;  1HXD A;  3ZMZ A;  4Q48 A;  5FB2 A;  4WXH A;  4RS8 A;  1OKR A;  2O61 A;  3J80 K;  4N9I A;  2VBZ A;  2PN6 A;  1QPM A;  3K69 A;  4GXO A;  2A69 F;  5DD8 A;  1U3E M;  1J7K A;  1G4D A;  1G3T A;  2P7V B;  1FC3 A;  1XMA A;  1KU9 A;  2R7D A;  4IHT A;  5IT9 K;  1XGS A;  3WTS C;  1HW2 A;  3U1D A;  2ZNZ A;  4R79 A;  1GHC A;  2DT5 A;  3FM5 A;  2VXZ A;  1IF1 A;  1MKM A;  1XDU A;  1E2X A;  2C6Y A;  2G7U A;  1Z91 A;  3LST A;  4RB0 A;  5D4S A;  4CHU A;  5BPD A;  3V8K A;  4EJV A;  2EK5 A;  4WWC A;  3WU1 B;  1REP C;  3TGN A;  2CFX A;  2J5O A;  4WX9 A;  2YX4 A;  3V8L A;  4YFN F;  4IXA A;  3ML6 A;  4ZYG A;  2QZ8 A;  3WTV C;  3B73 A;  4XLN F;  3CUO A;  4IVN A;  1U5T B;  2LDU A;  1XD7 A;  3I0T A;  1S6L A;  1O3Q A;  1ZHF A;  2NRA C;  2J5P A;  5E8G A;  3WTZ A;  2RQP A;  4KN4 X;  3FMQ A;  1JHH A;  2XAJ A;  2D1V A;  3FF5 A;  3KFW X;  4L0Y B;  2E1N A;  2PEX A;  5E20 A;  3QPT A;  2DI3 A;  4ZYE A;  2M45 A;  4M6X A;  5K1Y A;  3CUQ C;  2A6E F;  5E17 F;  1ZH5 A;  1ZLJ A;  3E5U A;  1LDJ A;  3GFL A;  4ESB A;  3JAM Z;  1WWX A;  5ICC A;  2VT2 A;  2P7C B;  1U8R A;  2P6S A;  1T38 A;  4AIH A;  3MWM A;  3NRV A;  3GFI A;  2RNJ A;  3MCZ A;  1IN4 A;  4U0Y A;  4PZJ A;  3TDZ C;  1ZG5 A;  1K6O A;  3F8B A;  3ABU A;  2NS0 A;  1OMI A;  2H6B A;  3ZN0 A;  2OAZ A;  3E97 A;  4Q5S F;  4MEY F;  5CVR A;  2PJP A;  4EGZ A;  3GZ6 A;  4KIG A;  3CLO A;  2G7H A;  1YIO A;  1R00 A;  2K86 A;  3IKT A;  3LFK A;  2VC0 A;  3GUD A;  5LGU A;  1H9T A;  4JBA A;  1W7P D;  3Q5F A;  2XAQ A;  4S05 A;  1RIO H;  2O6G E;  1B6A A;  2BYV E;  4Z2Y A;  3VB2 A;  2FA5 A;  3QOP A;  2Q8K A;  4OU0 A;  2Q0O A;  5AON A;  2EA2 A;  3FXU A;  2CYY A;  4P9U A;  3P7N A;  4DQ2 A;  1J2X A;  4ZH4 F;  2V1U A;  4LMY A;  2EFW A;  1X3U A;  3RPQ A;  4A6D A;  2PLY A;  4A5M A;  3GVA A;  1SD7 A;  4HQM A;  1SFX A;  2L02 A;  1ZRE A;  1ZRF A;  2YPR A;  2RGV A;  3O3K A;  2IVM A;  5HS8 A;  3F22 A;  4FT8 A;  2CQK A;  4EM2 A;  1HKT A;  4G7Z F;  2MC3 A;  3HSE A;  1W4M A;  1ON1 A;  4ZYH A;  4EJO A;  2X0L A;  3ECO A;  1MGT A;  2HKX A;  2DFI A;  4MGR A;  2GXB A;  2F5E A;  2RVC A;  1U5T C;  1J0R A;  1V4R A;  4R1H A;  3TOA A;  3JW4 A;  3I71 A;  1QZZ A;  1B59 A;  4UVA A;  2EFP A;  2GZW A;  3ZN1 A;  1FYL A;  2IP2 A;  1R5G A;  2PFB A;  3HOS A;  4AVP A;  2K02 A;  2M1B A;  1XMK A;  2DPU A;  1TNT A;  1YW7 A;  1KQ8 A;  6PAX A;  3HHG A;  4N9H A;  1KU3 A;  2OA4 A;  3KP3 A;  2L3D A;  1IN6 A;  1BJA A;  1R22 A;  4KYW A;  3OV8 A;  3TO9 A;  3C3W A;  4PGH A;  5JVT A;  4ENJ A;  2A6H F;  1B9M A;  2FMY A;  3Q9V A;  1FLI A;  1T98 A;  1S7A A;  1QQI A;  1F9N A;  1YQA A;  4HA8 A;  2Z5U A;  2XKO A;  4JK1 X;  3ZPL A;  4I98 B;  3J7A O;  1HKS A;  3QP5 A;  4F7Z A;  3BJ6 A;  2YSR A;  1R23 A;  2UZK A;  5ILV A;  1OYW A;  2MH9 A;  3C7J A;  1VTN C;  2K4B A;  2OBP A;  4UV8 A;  5E8I A;  1WRJ A;  3I64 A;  3IWF A;  3L7W A;  4LK1 F;  3WE3 A;  1B4A A;  3WTX C;  3ZMV A;  2HFH A;  1LQ1 A;  2FF4 A;  4MTD A;  4BHB A;  2XAH A;  5BMZ A;  5L3G A;  5H6Q A;  4LG0 A;  4E70 A;  5F6F A;  2VT3 A;  1SD4 A;  1EV7 A;  3AAF A;  2EV0 A;  1MDM A;  4EGY A;  1PDN C;  2XKP A;  4M72 A;  1OYY A;  2ACJ A;  4RAZ A;  5F1R A;  2M30 A;  4O6J A;  4U7D A;  3T1B A;  1SD5 A;  1I6X A;  4NHJ A;  2M8E A;  2EV6 A;  4RB2 C;  3GX4 X;  3BOQ A;  4G7H F;  1UST A;  2OU2 A;  4MHG A;  5LHH A;  3DKW A;  2IT0 A;  2FRH A;  3HRM A;  3WU0 A;  2GXG A;  1USS A;  1YFH A;  4MQV A;  1HKQ A;  2XHK A;  3BP8 A;  1W7P B;  3TO7 A;  3GWZ A;  2JTV A;  1UFM A;  1FPQ A;  3LA7 A;  1DPU A;  5A2Q Z;  1OR7 A;  2RC4 A;  3SXY A;  5ICE A;  3ZMS A;  1MZB A;  1R36 A;  5DV5 A;  1TQM A;  3WE2 A;  3WTY C;  2XRO A;  5ICF A;  2W85 A;  1IN8 A;  4NQW A;  1IW7 F;  1LEB A;  1FBU A;  2HQN A;  4EMS A;  5DYM A;  5HVQ C;  2KJB A;  2D1H A;  1FWZ A;  3WGI A;  5BPI A;  1YTY A;  3T8R A;  2HDC A;  3HUG A;  4HF1 A;  4LB6 B;  2TDX A;  4XBF A;  2FBH A;  1DP7 P;  3E6C C;  3F6V A;  1BIB A;  1YLF A;  3R4K A;  3NQO A;  5BOX A;  1HST A;  2GAU A;  1Z6T A;  2LF8 A;  2PI0 A;  1ZGJ A;  4L9J A;  5HS9 A;  4HF0 A;  3REO A;  2P5L C;  4HW0 A;  3IRQ A;  1YG2 A;  1ZG3 A;  1XSD A;  5LGN A;  4L9V A;  2EFN A;  5DUK A;  4GYI A;  5CVJ A;  2EJR A;  2KKO A;  1L0O C;  2D45 A;  4LB5 A;  3WTU C;  2VOP A;  1TTY A;  1ZLK A;  2IA2 A;  2DTR A;  1DPR A;  2E7W A;  5LRS A;  4RGU A;  2HEO A;  4WF2 A;  3DQV C;  3GLX A;  3H3U A;  3SFZ A;  1DDN A;  4N0B A;  2FNP A;  1Z7U A;  1J5Y A;  1LDD A;  3E6D A;  3J81 K;  3C1D A;  1BI1 A;  1HW5 A;  2JSC A;  4LG0 B;  3E5Q A;  1LB2 A;  1SAX A;  1MDM B;  2LNB A;  2P5V A;  1WI9 A;  2ZBK A;  1F4K A;  4IRI A;  3JTG A;  4H0E A;  5EEH A;  4G9Y A;  1DUX C;  2P5K A;  4P9F A;  2H09 A;  5FFZ A;  2VOD A;  1I27 A;  5D5X B;  2VON A;  4O3M A;  1FOK A;  1F1Z A;  4HV5 A;  1IXS B;  3HTU A;  3M8E A;  1S3J A;  2DPD A;  2H27 A;  4M6Y A;  3N97 A;  1Z1D A;  1YS7 A;  2L01 A;  3SHF A;  2HOE A;  2OQG A;  1UCR A;  1G6N A;  4AIK A;  1FP2 A;  5LEJ A;  1O7F A;  4OMZ A;  1HW1 A;  3V7S A;  3O6B B;  5E1X A;  3WGH A;  3C18 A;  3V7C A;  2XAG A;  4ENN A;  1BBY A;  1BM9 A;  1MD0 A;  4A5N A;  4M9S A;  2Z9O A;  4I2O A;  3EUH A;  2YX7 A;  3LQR A;  1R1V A;  2HTJ A;  2Z33 A;  2MLK A;  3F21 A;  4UVB A;  3MEX A;  3R0J A;  3WTW C;  3FX3 A;  1XGO A;  2RN7 A;  4HLX A;  3GW2 A;  2QUF A;  3RTR A;  4PDK A;  4L9T A;  4OIO F;  3L2C A;  1K7A A;  3FZV A;  5CYV A;  3DP7 A;  3ABT A;  1P4X A;  1S8N A;  3LWF A;  2BGC A;  3I5U A;  2JT1 A;  3KZZ A;  5D8K B;  2NNN A;  2R7F A;  1W5S A;  1T39 A;  2AXL A;  1LEA A;  4ZZL A;  4MEX F;  3FXR A;  2L54 A;  5EEG A;  4UV9 A;  3WG9 A;  3HRT A;  3R60 A;  3BZ6 A;  4KUM A;  2XGX A;  2MH2 A;  3HSR A;  3F8C A;  4BHC A;  5TRD A;  2VBY A;  1HBX G;  3E5X A;  4EQQ A;  3VOD A;  2FEZ A;  5ILS A;  3LAJ A;  4O5V A;  4Q47 A;  1I1S A;  3VEP A;  3KET A;  4XSZ F;  4A0Y A;  4I0B A;  5HLI A;  3K9T A;  1TQI A;  4M73 A;  1BOA A;  2IW5 A;  3VOE A;  4OIR F;  4ENK A;  1R1U A;  4A0X A;  3K1M A;  2L4M A;  4G6D A;  5FGM A;  1O3T A;  4I09 A;  5LRR A;  1BN5 A;  1LVA A;  1U78 A;  3FHZ A;  2NNY A;  1O3S A;  3DXJ F;  3RDI A;  4Y17 A;  1ZYR F;  3JAM K;  3E3V A;  1JGS A;  2E1C A;  1C0W A;  2F5C A;  3V8J A;  1STZ A;  5E1Z B;  1FYM A;  1FX7 A;  1ZG1 A;  2FE3 A;  3RIR A;  1EH6 A;  3KP5 A;  5JI6 A;  2K7L A;  5FLX Z;  1YW8 A;  2JZY A;  4ETS A;  4YFK F;  3LQQ A;  2ZO4 A;  1TBX A;  2FBK A;  2ZCW A;  2H94 A;  2RKH A;  1W7P A;  2JPB A;  4BQA A;  2BBY A;  2QM3 A;  3U2R A;  1KQ0 A;  2L4A A;  4AD9 A; 
#chains in the Genus database with same CATH topology
 2O5R A;  2HOT A;  2GQQ A;  3KP2 A;  2QQ9 A;  3HRU A;  1KON A;  3S15 J;  2DJI A;  2VQG A;  4MTE A;  5D6F A;  3B02 A;  4YEL A;  4RGS A;  4BQO A;  4LLN A;  1I50 J;  2X51 A;  2KIS A;  4QIW N;  3GTM J;  5LBQ A;  4GDF A;  2V1N A;  4G8X A;  2FOK A;  3HGY A;  1OIS A;  3F8F A;  2LLK A;  2L9S A;  3NWT A;  1IUF A;  3A4C A;  1HSJ A;  1BC8 C;  3Q0U A;  3ELK A;  3CCR I;  3W2A A;  3ZR8 X;  2QSF X;  2QLZ A;  3T5X A;  4XLA A;  5FD6 A;  2DOA A;  3DF8 A;  2ZJ2 A;  1APL C;  3JSO A;  5KAI C;  2QVO A;  4S04 A;  4BU2 A;  2Z99 A;  3ZMU A;  3ONQ A;  5L3B A;  3HTS B;  4QLC U;  4B48 A;  1SVM A;  2DT6 A;  4I01 A;  3GTJ J;  2F6C A;  3RZO J;  2E19 A;  2VBW A;  2KFD A;  4I76 A;  4YIF A;  4L18 B;  4Y33 A;  2DFE A;  4IRH A;  3ZQF A;  4OAY A;  2MD5 A;  3TL4 X;  2O8K A;  5D6E A;  3PO3 J;  5HNH A;  3HRS A;  3QRF F;  5FO5 A;  2Z2S B;  3R0A A;  1NHA A;  1POG A;  4KIF A;  3F23 A;  2DLL A;  2G0E A;  2WAQ N;  2VOO A;  4BDZ A;  3OYH A;  3CES A;  3BC8 A;  2HZT A;  1ZAR A;  2VQH A;  2QCO A;  4IHS A;  3LOC A;  3U1K A;  1FBQ A;  3S3M A;  1BR2 A;  5BS6 A;  2M7B A;  2LRE A;  4B3A A;  2F2E A;  1XDS A;  3DFG A;  3M4O J;  2RV8 A;  3GF2 A;  2DOF A;  2GOX B;  1ZKG A;  2L0K A;  3BTC A;  3GTQ J;  2OUM A;  5B3S H;  2W4S A;  1WGX A;  4CGZ A;  2ID3 A;  3OYI A;  1UEL B;  3FXQ A;  3ZP5 A;  3KLN A;  2AQF A;  3EUA A;  5H2F C;  5L3C A;  4E7K A;  4IHY A;  1E17 A;  2KDZ A;  3ZMD A;  2Y0S N;  2DA3 A;  2JUC A;  3FM3 A;  5AIQ A;  1Y0U A;  4MFD A;  2ZFW A;  3FIW A;  1RUO A;  2HI3 A;  3BY6 A;  5CQE A;  2QYO A;  1JE8 A;  1OLT A;  2VJI A;  3MKL A;  4AYB A;  2VLA A;  4HF2 A;  1FT9 A;  3GFJ A;  2K4J A;  2ZB9 A;  2DO7 A;  1RKT A;  4HDV A;  2VL8 A;  3CF5 F;  3GZ5 A;  5LLQ A;  4KT5 C;  1SMT A;  3HKZ A;  3KE2 A;  2IEK A;  2WY7 Q;  4A3M J;  1D1A A;  1IXR C;  2OCC H;  3OL3 A;  2BW3 A;  2QQ8 A;  2AS5 F;  3LMM A;  3JCU C;  2NOJ B;  3CUQ A;  4JQF A;  4QPO A;  1VQ5 I;  2Y31 A;  1J9I A;  4GO1 A;  4HX4 A;  2L7M P;  1YS6 A;  3H5N A;  3HOU J;  1WFX A;  2MBF A;  1YO5 C;  4U0V A;  2V1D A;  4Y13 A;  4CZC A;  3IHU A;  3MMY B;  3J7A Y;  2F5F A;  2XRL A;  4D9J A;  3PQK A;  1VQL I;  1R49 A;  1MBH A;  3HSF A;  3KEO A;  2ELH A;  1ZRD A;  1XN7 A;  2DMT A;  4TV7 A;  2H6C A;  5IT3 A;  1Z05 A;  1B1B A;  5GPC A;  1RUN A;  1YJN I;  1QU3 A;  4C3J J;  2AXT C;  2OZU A;  2VC1 A;  5F0F A;  1MJB A;  4P5O A;  1H88 C;  2W25 A;  3RI4 A;  3BTL A;  3FXL A;  3HOX J;  1TW3 A;  3A0B C;  4XLC A;  1X4O A;  3GTP J;  1G3S A;  3WOD F;  2R0Q C;  4A3G J;  4XID A;  5D5U B;  5HOO A;  3TW6 A;  1A04 A;  4LJZ F;  2ESH A;  1IAW A;  2E1M B;  2STW A;  3FXJ A;  3GEZ A;  2DN0 A;  1OYI A;  4XRM A;  4Y7N J;  4NC6 A;  2K40 A;  1U2W A;  1Z21 A;  2JK3 A;  5L3D A;  1B8I A;  1W1W E;  2JWT A;  3MKW B;  2QBY B;  1ETY A;  1R71 A;  1LE8 B;  4UUT A;  3BJO A;  1P4W A;  5JR3 A;  3EUH C;  2MAB A;  1ULY A;  4LLL A;  2IS1 A;  2A61 A;  4Y15 A;  3QU6 A;  3AG1 H;  1H8A C;  1FSE A;  1XPX A;  2UWM A;  3BCA A;  3KP4 A;  1D8K A;  1P6R A;  1TW2 A;  2GA2 A;  2HS5 A;  2OQR A;  3OYL A;  3HDD A;  2LH9 A;  2OF7 A;  3ZQG A;  2I5U A;  3RKX A;  1FIP A;  1EF4 A;  3QYE A;  2VUM J;  2IAI A;  2N8G A;  4CYC B;  1J59 A;  3ZQ7 A;  3BTI A;  5HS7 A;  4AC0 A;  1GV5 A;  2PQ8 A;  3A2K A;  1S29 A;  2HR3 A;  2R7Q A;  3G73 A;  5D4R A;  2OPT A;  2LY1 A;  1GXP A;  1KA8 A;  4OIQ F;  1XMX A;  2M3A A;  2KIF A;  4Y52 J;  2QQB A;  3P9I A;  1WJC A;  3CO7 C;  1XC5 A;  1TQP A;  3PQJ A;  1BC7 C;  3K2A A;  1ZAO A;  2LY2 A;  3CCL I;  3T0Y A;  3SEQ A;  2E2I J;  2JRT A;  5GAE J;  1FYK A;  4RLF A;  2A3S A;  3AKZ A;  2WA0 A;  2WTE A;  3H9Q A;  3HEF A;  1H0M A;  1TWH J;  1Z3Y A;  4A3J J;  1IRF A;  4JP0 A;  4LFU A;  2MSY A;  2WB1 N;  3Q9S A;  4BGD A;  1ZN2 A;  5EG0 A;  4ANJ A;  2BY1 A;  1N78 A;  4A12 A;  4NC8 A;  2NXN B;  1JTX A;  2HWV A;  3KX2 A;  5DCM A;  4B3X A;  4RGX A;  2FQ4 A;  4BYY A;  5CVV A;  1QZY A;  5TIS C;  3CQZ J;  3H3Z A;  5GAG J;  2CUZ A;  5J1Y A;  1LDK B;  3WTT C;  2R7U A;  2JRM A;  2WV0 A;  1F5T A;  1P9Q C;  1VQ4 I;  2DBB A;  4LK0 F;  4BJT A;  2V9V A;  3IP4 B;  4L9N A;  3FWE A;  5FD5 A;  2H1L A;  1MJA A;  3EDP A;  4C2T A;  5HDN A;  1ON2 A;  5DCF A;  4UNO A;  2ZXJ A;  5J1R A;  5A2Q K;  2HXI A;  4M3F A;  1FNN A;  2R7T A;  2IJL A;  3TQN A;  4BEH A;  2ZFU A;  3RPU A;  2M8G X;  4KMU X;  4WCG A;  1IUY A;  1R7J A;  2ZNY A;  4B43 A;  4BXU A;  3CMM A;  2B0L A;  5E3O A;  2M87 A;  1PJR A;  4E4H A;  4UY8 I;  2DMU A;  3ZQI A;  3EET A;  1JT0 A;  2BHY A;  4BHP A;  3J80 Z;  5M5Y J;  2X4H A;  3KYD B;  1O3R A;  1ZR2 A;  3G6E I;  1PUE E;  4P96 A;  4RLQ A;  4D5C A;  2YU3 A;  2YUS A;  2MGQ A;  5JFR A;  2E35 A;  1RKW A;  4PJ0 C;  3CDI A;  3IC7 A;  4LGW A;  3F8N A;  4FAS D;  1G3W A;  2HQ5 A;  5FKN A;  1Z9C A;  2R3S A;  1HQC A;  2DA2 A;  1QHH D;  3BCB A;  3F8M A;  4ITV A;  2CGP A;  3CUQ B;  2WAE A;  2QQA A;  2Y30 A;  5IT9 Z;  4DBQ A;  1QHG A;  1XX5 A;  5GTH C;  4KIC A;  2W84 A;  5E18 F;  2PJR A;  1TLH B;  1O57 A;  1BI2 A;  1JJ6 C;  3I56 I;  1R1T A;  3EQL F;  3T8T A;  4NC7 A;  1PP7 U;  1BL0 A;  3OYE A;  2HGC A;  1K78 A;  2Z16 A;  3MN2 A;  1FTT A;  5HLH A;  3PJR A;  2VB6 A;  1LVK A;  4GFB A;  1R58 A;  2V7F A;  3TO6 A;  3FMR A;  4WXD A;  5ICG A;  1ZTR A;  4I0A A;  2RDP A;  1ETO A;  2DQR A;  3ECH A;  2HKO A;  4HX7 A;  2BXZ A;  3K1N A;  4DGW B;  4KFC A;  5IYD J;  4AVZ A;  3FBN B;  4RMN A;  3CJN A;  1P92 A;  2A6T A;  1YX5 A;  4F3Q A;  1QBJ A;  4GYG A;  4YII A;  2KIM A;  4WXC A;  5HLG A;  3M3Y J;  2FML A;  2NYX A;  5CVI A;  2MA3 A;  3I58 A;  3OIQ A;  1ETW A;  2UXX A;  4KNY A;  2ICW G;  2A68 F;  4U0W A;  3HOY J;  3DV8 A;  3N4M A;  3A1Y A;  2Y48 A;  3DLA A;  5D8L B;  2O03 A;  2ZXH A;  1B8I B;  2ISZ A;  2GIV A;  2L9N A;  1UB9 A;  2LSO A;  2CQN A;  1A6I A;  1MIJ A;  4KA4 A;  2HTS A;  3WHB A;  5GPA A;  2A05 A;  1QVU A;  2MYS A;  3ABM H;  4PCQ A;  2XAF A;  2X6O A;  3KPH A;  2VKH A;  3RJP A;  3U9G A;  4I02 A;  4N4N B;  3GCM A;  3K70 D;  1KYW A;  1SFK A;  3Q3S A;  3S2W A;  1TWA J;  3MZH A;  2LRD A;  5F04 A;  3CLQ A;  4MIM A;  3CME I;  3E6B A;  5J1U A;  3KCC A;  2LKP A;  3DBH B;  4RM3 A;  1L3L A;  1ETV A;  3OYA A;  2E7X A;  3ROU A;  2R7R A;  4XSX F;  1KU7 A;  2XF5 A;  5TGT A;  5F0C A;  4BAY A;  1H9G A;  2XIG A;  1HF0 A;  2D2W A;  2O8X A;  2ADU A;  3IWZ A;  4OWR B;  3BWG A;  5J8F A;  2OTL I;  4HOB A;  4D0P A;  4A0Z A;  5EG0 B;  2G9W A;  2JA7 J;  1A5J A;  4M71 A;  1BJZ A;  2HXO A;  5DCM B;  2H8W A;  2DAO A;  1AA7 A;  4G94 A;  1ONV A;  2EB7 A;  3MZ8 A;  4L5I A;  1R9T J;  2Q1Z B;  3DPL C;  2W1O A;  3HOW J;  5DUI A;  3P9K A;  1I1G A;  3TOB A;  3LSR A;  3WG7 H;  3BT9 A;  1MJ9 A;  2RAE A;  4HZF A;  5D5W B;  1WSU A;  3X2Q H;  1TL8 A;  2W57 A;  2STT A;  1R4N B;  3BPV A;  3BR0 A;  1IRG A;  5IYB J;  3S1M J;  3R6S A;  4BEH B;  4CUG A;  1XSV A;  3GTG J;  2IGM A;  5ED4 A;  1XG1 A;  1FOY A;  3SZT A;  4MNU A;  3DCF A;  3HC7 A;  2CFO A;  2VBX A;  3BR6 A;  5EZG A;  5K7F A;  2XUB A;  1QO0 D;  1O7L A;  4HNT A;  4A3B J;  3GFM A;  4NB5 A;  2IS6 A;  5K7H A;  4CZZ A;  2JJ7 A;  4C9Y A;  4U7B A;  3BRO A;  1GLN A;  3GBG A;  2Y9Z A;  4AYB N;  1X2N A;  1X1A A;  2BVM A;  3WGG A;  3W2V A;  2DA4 A;  3MFK A;  4P55 A;  5LGT A;  4ZJZ A;  1VQK I;  2ELK A;  1XTA A;  3KZI C;  1OCZ H;  3KEQ A;  3LA2 A;  3HKZ N;  2EIN H;  3IRR A;  1EJ9 A;  3P9C A;  3CP2 A;  1SVL A;  4GCV A;  2LF7 A;  1MBJ A;  3K1P A;  5L3E A;  4HNU A;  2R5Y A;  1WJB A;  3F3X A;  1S72 I;  3L00 A;  4G6Q A;  1DP3 A;  2K27 A;  2PJR B;  1VZ0 A;  1I3A A;  5K5R A;  5FFX A;  1W5C C;  3E0J B;  2CUJ A;  4E7Z A;  4FHT A;  1X2M A;  3HL2 A;  3OYM A;  3I4P A;  2JQ7 A;  5HDK A;  4DIQ A;  3I59 A;  4JX5 A;  5KAF C;  4AUX A;  1K78 B;  1RNL A;  2JN6 A;  4CH7 A;  2JPC A;  5CKT A;  3DPT A;  4D7N A;  3SZP A;  3F6O A;  3KP7 A;  5M3F J;  5FKM A;  1IDZ A;  2DW4 A;  2EWN A;  4PUS A;  2COM A;  4EJW A;  4C2U A;  2DA1 A;  4LIV A;  1IN5 A;  3OOP A;  2Z3Y A;  3COA C;  3L2U A;  1U6G A;  5B66 C;  1ZGA A;  4ZDL A;  1A35 A;  1IN7 A;  2ZME A;  4M3B A;  3VFZ A;  1WCM J;  4CIC A;  4QWQ A;  3L1P A;  2M4K A;  2M9H A;  4HNV A;  4YRV A;  4MLO A;  1QZE A;  3GYH X;  5BQT A;  2E60 A;  2XF7 A;  3CCM I;  1KQ9 A;  3KIO A;  1YI2 I;  1SFE A;  3PL8 A;  3I53 A;  1DU6 A;  4IQ4 A;  1SFU A;  2LYC A;  2PG4 A;  4E6K G;  4HYE A;  3W6J B;  4PFP A;  2HZD A;  2DU9 A;  2EA4 A;  4Y4R A;  5CVU A;  5EZH A;  5J8C A;  2JMW A;  3HYI A;  2BZT A;  3M8F A;  2HVS A;  5J6X A;  2P4W A;  1OR7 C;  3C2H A;  1E3P A;  3C2B A;  3HXL A;  3N05 A;  4XR6 A;  3JRE A;  1I5Z A;  1X1C A;  3G3Z A;  4ENM A;  5EF6 A;  2EH3 A;  3KLO A;  4BKX A;  2GA1 A;  1FSH A;  3JTH A;  2BEO A;  5IP9 J;  3RKY A;  1G3Y A;  1RI7 A;  2FSW A;  3MZY A;  2JA8 J;  3DTI A;  3ERE D;  1UHM A;  3IKV A;  4D5F A;  1TWF J;  4A3C J;  2X6W A;  3BDD A;  3Q0W A;  2UXN A;  2E2J J;  3FMS A;  1WKM A;  2KRF A;  1NG7 A;  2HOA A;  3HG9 A;  2IA1 A;  1BW6 A;  4NUB A;  1QNT A;  1ACI A;  1R5H A;  3A02 A;  5CJ9 A;  5ILU A;  2KIU A;  1BIA A;  3AG3 H;  3QOD A;  2QBY A;  4D1Q A;  3CJR B;  3SZG A;  4CO8 A;  2V1X A;  1IO2 A;  4CCJ A;  1LFB A;  3BR5 A;  4EJT A;  4XOP A;  4ZC3 A;  2ISY A;  2A5Y B;  5HLT A;  1D1B A;  2FOW A;  4RB1 A;  3AG4 H;  2QWW A;  4XRF A;  1FIA A;  3M1E A;  1TT5 B;  1A6Q A;  5F64 A;  4CYC A;  3JRB A;  4CA0 A;  1DU0 A;  1I3Q J;  2MC4 A;  4LLG F;  4UVC A;  2VAS A;  3GXO A;  1ENH A;  4OIP F;  1TZL A;  4XKW A;  1S7O A;  1D3Y A;  2KLO A;  2V79 A;  2VE8 A;  2ESN A;  1Y56 A;  4IPA A;  3LFU A;  3MQ0 A;  4XLP F;  2A07 F;  3OIP A;  2XPW A;  3WHC A;  2BHZ A;  3CCY A;  3K6G A;  5JVG F;  1ODD A;  4PK4 A;  4KMF A;  2FXA A;  5FLM J;  3GO5 A;  1YE9 A;  4IQJ A;  1VF9 A;  2W24 A;  4A6E A;  3JR9 A;  4BQN A;  2NVX J;  2R7S A;  2TCT A;  1IV6 A;  5HDG A;  1V5F A;  3ULQ B;  2CS3 A;  3I4M J;  4RAF A;  4LD5 A;  1V5G A;  3IH3 A;  5J3L A;  4EVI A;  1ZRC A;  5H20 A;  2HDW A;  3CMY A;  2B9S A;  1WVR A;  2XRN A;  4YG2 F;  1U8B A;  5EEA A;  3FKI J;  4BE0 A;  3MKZ A;  4DW6 A;  3CF2 A;  2LFB A;  1T95 A;  1TNS A;  5IOZ A;  1XCV A;  4HQE A;  5FLX K;  4YIR X;  4M9Z A;  4BY7 J;  3EYI A;  5KVR A;  4UXN A;  3V4G A;  1Y8R B;  1V55 H;  3TDU C;  4CCM A;  2M0M A;  4IF4 A;  4M3E A;  1AKH A;  1UHW A;  2DQL A;  2XAS A;  4XMY A;  5KK1 A;  3DU5 A;  5JHU A;  5E1W A;  4HBL A;  1LUJ B;  4Q4Z F;  2GLO A;  4R8H A;  3QPH A;  4L0Z B;  2ETH A;  3H9G A;  4KIB A;  3VYR B;  4EJU A;  3L9F A;  3CJT B;  2R5Y B;  1MSE C;  1YYV A;  2NVY J;  1Q1H A;  2XSD C;  1B9N A;  2VKV A;  2XSJ C;  4FE7 A;  1T0F A;  3AG2 H;  2VN2 A;  2P81 A;  2NVU B;  2X6X A;  2DJN A;  1J75 A;  1X19 A;  3QAH A;  1MH3 A;  2Q2E A;  3HHH A;  5M5W J;  3I59 B;  1XB4 A;  2ZXW H;  1OFC X;  1Y6I A;  3W2W A;  2DCE A;  1QVT A;  5DDG A;  2F4O B;  3F72 A;  4IHX A;  4XL9 A;  3PNV A;  2FJ1 A;  2V9K A;  2A5W A;  2BV6 A;  2BE5 F;  1MH4 A;  3BR1 A;  2V9P A;  2FU4 A;  3M7G A;  5DD4 A;  5D5V B;  3OS1 A;  4HLY A;  2NVQ J;  1JXS A;  5KHD A;  4RAY A;  2R7O A;  1CF7 A;  4XLF A;  2QEN A;  2H1K A;  3CDH A;  1Z6R A;  4GGG A;  2P6T A;  3BJA A;  2ZME B;  3DEU A;  1FEX A;  4FX0 A;  2K9Q A;  1D8J A;  4FX4 A;  1FP1 D;  2KMU A;  2YS9 A;  4MQ9 F;  1LNW A;  1T6S A;  1LJ9 A;  2NS8 A;  4BS9 A;  4CYD A;  2CMP A;  2DA5 A;  4ESJ A;  1FY7 A;  1XSX A;  2XV4 S;  4HRI A;  2P0W A;  2IBD A;  3D5S C;  3DTK A;  4ZTF A;  4CCK A;  5FKL A;  2HQR A;  3SDB A;  5CLS A;  1SEU A;  1XGM A;  2M34 A;  1FTZ A;  1NTC A;  1I39 A;  2FNA A;  2WAD A;  3MD2 A;  5TJJ A;  3V7R A;  3VSL A;  4HAM A;  4OMY A;  4NBQ A;  5J40 A;  4C3H J;  2WWY A;  5FRN A;  3H0G J;  2DK5 A;  2OZ6 A;  5HNF A;  5H6R A;  5DEQ A;  4XRS G;  3TED A;  2VXD A;  2VE9 A;  2JSP A;  1P2F A;  2BXY A;  2EZL A;  3QU3 A;  3FBI B;  1K4S A;  4ZZD A;  2CH0 A;  4B8X A;  4YFX F;  4XLH A;  1W5T A;  4IJA A;  2CSO A;  4CDG A;  3ZQL A;  2B63 J;  4IRG A;  4HDU A;  4UHT A;  4RGR A;  1RRJ A;  1YW9 A;  3RKW A;  1QA6 A;  1UG2 A;  1V54 H;  1T2K A;  4H4K C;  5AIP A;  1GVJ A;  4OIN F;  2K9S A;  5C44 J;  3PIP F;  1RZ4 A;  3H3V K;  2M0C A;  2UUZ A;  2FQ3 A;  3CC7 I;  3TP0 A;  2L7Z A;  3ZMT A;  5FRM A;  2E34 A;  1V3F A;  2CW8 A;  1Z3X A;  3DBR B;  1XGN A;  2PBI A;  3JSP A;  1GXQ A;  1OCT C;  1PYV A;  3RYP A;  5LHI A;  3AL0 B;  4AWX B;  3RKQ A;  1ERD A;  2E36 A;  2CWE A;  4PSX A;  2NOG A;  3FHN A;  3O2P E;  4WK8 F;  1Z77 A;  2EFO A;  2DXI A;  3PUB A;  4G6T B;  2M5W A;  1P4A A;  1ORK A;  1IZ1 A;  2O0Y A;  3QPL A;  1FZP B;  1NK2 P;  2DMP A;  1O4X A;  5FRO A;  2HYG D;  1BI3 A;  3IH4 A;  3RQI A;  1S9H A;  2LTP A;  2X6Y A;  2NAZ A;  1IDY A;  2NS7 A;  3BQZ A;  1IJW C;  3EYY A;  4ON0 A;  4KDP A;  1WQ2 A;  3P5J A;  5ERI A;  3S2D J;  2XVC A;  1OCC H;  4M74 A;  2MLG A;  1CGP A;  4DNC A;  1PP8 F;  3LSG A;  1ZR4 A;  3KP6 A;  4L5J A;  4PJM A;  3S14 J;  1S7E A;  5DS9 A;  2YR2 A;  1LKX A;  2AQE A;  2WY8 Q;  3PFI A;  2F5D A;  1FBS A;  4FE4 A;  4B09 A;  3D0S A;  3LAP A;  2IRF G;  2LMD A;  3I54 A;  2IA0 A;  1KU2 A;  4K2E A;  4KIS A;  2MFZ A;  4XOR A;  1IV8 A;  3RYR A;  4E7J A;  3NAR A;  1IXC A;  2IPQ X;  3TMO A;  2CW0 F;  3QWL A;  1QGP A;  3J81 Z;  3BTJ A;  3MVP A;  3M1C A;  2X1D A;  2XB0 X;  3VWB A;  2DK8 A;  1AKH B;  2HYF A;  3LA3 A;  4HV6 A;  4JX4 A;  1AWC A;  2OD5 A;  4BNC A;  1MMD A;  3NEU A;  3HOT A;  3W6V A;  4PFO A;  1U5T A;  5K5Q A;  4EM1 A;  4G7O F;  4HSR A;  1EH8 A;  1BI0 A;  2PMU A;  1X4P A;  3D5L A;  1W0T A;  4ZDP A;  1FMV A;  1D5V A;  4FCY A;  3KYL A;  3KZY A;  2GWR A;  1W36 C;  3B6C A;  2Q2E B;  3GTL J;  3PO2 J;  5JHF A;  1X3Z B;  4ZYD A;  3S16 J;  3HIF A;  5LEK A;  2X1E A;  4BH9 A;  2XF6 A;  3L2Q A;  4FQG A;  1KGS A;  4PGG A;  5LHG A;  2L2O A;  2O3F A;  3M9A A;  3BPX A;  3RSN A;  1VFC A;  1WJF A;  3DWL E;  1SD6 A;  2IGO A;  3R61 A;  2P8T A;  2ZJR F;  3BG6 A;  4A2U A;  4X1E A;  4RB3 C;  5K5O A;  1E3H A;  2IGK A;  4IO9 F;  3S3N A;  2ME6 A;  2V6C A;  1CF7 B;  1AHD P;  2WC2 A;  4KT6 A;  1K79 A;  2HVR A;  4IOA F;  1SMY F;  4ASN A;  4J01 A;  4CXF A;  4A3E J;  3CTA A;  1XCB A;  5L3F A;  1EH7 A;  1ZEL A;  2ZME C;  3IL2 A;  2CG4 A;  3OYC A;  1JKQ C;  1JHF A;  1QPI A;  3ISP A;  1MBF A;  4PJJ A;  4AU7 A;  5B1A H;  4AIJ A;  3L2R A;  1RES A;  3SQN A;  2YU9 J;  1OPC A;  4S0H B;  2ZXI A;  3CZ6 A;  2EFQ A;  2R93 J;  4KN7 X;  4BE1 A;  4XRS A;  3QP6 A;  4M9X A;  4JYK A;  1WI3 A;  3MAJ A;  2RNG A;  1V5E A;  2EPF A;  1X1B A;  4G12 A;  4EV0 A;  3LSP A;  1JGG A;  3H92 A;  4OOI A;  1MBE A;  4C3I J;  3E6M A;  2DMQ A;  2ME0 A;  4CCO A;  2HVQ A;  2PMH A;  4HX8 A;  3W3C A;  3TKY A;  3JRH A;  4ESF A;  2R7X A;  3BG9 A;  3K0L A;  3L09 A;  2NVT J;  3W6K B;  2CO5 A;  2FBI A;  2CQQ A;  2EV5 A;  2KJC A;  5KNL A;  4I7H A;  2DA7 A;  2Y75 A;  3FK7 A;  1NK3 P;  4U88 A;  4IX7 A;  3G1M A;  1ZGW A;  1M1E B;  3OR1 C;  3S93 A;  3SEZ A;  4EM0 B;  4A3I J;  1QRY A;  3DLL F;  1ETX A;  1AOY A;  4UUV A;  2Y9Y A;  5LD2 C;  1KYZ A;  2Y0M A;  2ZKZ A;  3CMA I;  1RC9 A;  3K2Z A;  4XKV A;  3CDL A;  1HXD A;  1HOM A;  2DOD A;  2M4G A;  4BAC A;  2R5Z B;  4E7L A;  3ZMZ A;  2V6E A;  5EYR A;  1FMW A;  4Q48 A;  1P7J A;  3ERM A;  2BY3 A;  3ASO H;  5FB2 A;  2E1M C;  3LSK A;  4WXH A;  4RS8 A;  5HOD A;  2JVH A;  1OKR A;  2O61 A;  1WH7 A;  1JUM A;  2CUE A;  3J80 K;  1TP4 A;  2VBZ A;  4N9I A;  2IGN A;  1QPM A;  2PN6 A;  3K69 A;  2A69 F;  4GXO A;  5DD8 A;  3VYS B;  3JRG A;  3LSI A;  1U3E M;  2VQL A;  1J7K A;  4IL6 C;  1G4D A;  3CC2 I;  1G3T A;  4D7M A;  2P7V B;  1XS9 A;  3AL0 C;  1FC3 A;  1XMA A;  1KU9 A;  1MW7 A;  2R7D A;  4IHT A;  1YRN B;  5IT9 K;  1XGS A;  3I3L A;  2KRC A;  4E7H A;  3WTS C;  3ABL H;  1MSF C;  4II2 A;  1HW2 A;  4QTR A;  3U1D A;  2ZNZ A;  4R79 A;  3ESW B;  2DDA A;  1R6R A;  1GHC A;  1NG6 A;  5IP6 A;  2DT5 A;  3FM5 A;  2VXZ A;  1IF1 A;  3H35 A;  2JA6 J;  1PVE A;  1MKM A;  1VQO I;  1XDU A;  3OYD A;  1E2X A;  2C6Y A;  3BZK A;  2G7U A;  1RR7 A;  3EUK L;  3ZQQ A;  1D0Y A;  1ZQ3 P;  1SAU A;  1ITY A;  1Z91 A;  3LST A;  2V4J C;  4RB0 A;  1PUF B;  5D4S A;  3Q0V A;  4CHU A;  3GLL A;  4PJL A;  1ETQ A;  1UZC A;  1I6H J;  4NQW B;  3V8K A;  5BPD A;  4EJV A;  2EK5 A;  4WWC A;  1LE8 A;  3OMY A;  5JLW A;  3WU1 B;  1REP C;  1LFP A;  3OL4 A;  2M2E A;  4HEA 2;  3TGN A;  4P1W A;  4JOM A;  4XKB A;  3GTK J;  3HPH A;  2K9N A;  2CFX A;  1HCR A;  2J5O A;  3BLY A;  1OJL A;  4XLE A;  4WX9 A;  1TC3 C;  2YX4 A;  3LNQ A;  3V8L A;  4YFN F;  1MMS A;  4IXA A;  2ZSH B;  3CCE I;  3ML6 A;  4ZYG A;  2QZ8 A;  2X9D A;  3WTV C;  3B73 A;  2HPI A;  4XLN F;  2WBM A;  1VND A;  3CUO A;  3UNG C;  4IVN A;  3DKY A;  3PFY A;  1VQ6 I;  4QSH A;  3K4M A;  1U5T B;  2LDU A;  4B47 A;  4BJ5 C;  2M7A A;  4M3G A;  1XD7 A;  3I0T A;  2DYS H;  1S6L A;  5IYC J;  1T0F C;  1O3Q A;  1ZHF A;  2NRA C;  4XM3 A;  2J5P A;  5E8G A;  3UR3 C;  4BXF A;  3HJE A;  3WTZ A;  2RQP A;  1G8X A;  4KN4 X;  3G4S I;  1D5Y A;  3FMQ A;  4B1R A;  1JHH A;  3HZJ A;  3PNT A;  5IPA A;  4IKF A;  3B6A A;  3DEE A;  2XAJ A;  2D1V A;  3FF5 A;  3KFW X;  2QEX I;  4ABZ A;  1IC8 A;  3TW7 A;  2E1N A;  4L0Y B;  2XGE A;  2ELJ A;  2PEX A;  5E20 A;  1HLV A;  3QPT A;  3ZCO A;  2DI3 A;  3IAS 2;  3FIS A;  4ZYE A;  1BOB A;  2M45 A;  4A3F J;  1WZ2 A;  4M6X A;  2EZI A;  5K1Y A;  3CUQ C;  2A6E F;  4A3D J;  4OAZ A;  3BG3 A;  1RET A;  2XDV A;  5E17 F;  1ZH5 A;  2UV1 A;  1ZLJ A;  1OCO H;  3BR2 A;  3E5U A;  1LDJ A;  1LFU P;  9ANT A;  3PSF A;  3GFL A;  3A01 A;  1VI0 A;  3OS0 A;  4ESB A;  3G1L A;  3JAM Z;  4UUS A;  1WWX A;  4HPQ A;  5ICC A;  2VT2 A;  2HQA A;  3HOZ J;  2P7C B;  1U8R A;  1KZH A;  1G2H A;  1WH5 A;  2P6S A;  5F08 A;  4F55 A;  3CCS I;  1JUS A;  5GAD J;  4AIH A;  5E3N A;  3HPG A;  1T38 A;  3MWM A;  3NRV A;  3GFI A;  2RNJ A;  1VQ9 I;  5B1B H;  2F4M B;  3MCZ A;  1IN4 A;  4U0Y A;  4IHV A;  4PZJ A;  3TDZ C;  1ZG5 A;  1K6O A;  3F8B A;  3CP8 A;  5JLX A;  3ABU A;  4V2F A;  2NS0 A;  1OMI A;  2H6B A;  2FD5 A;  3ZN0 A;  2OAZ A;  4II3 A;  2ZJQ F;  3E97 A;  4BQQ A;  5B5E C;  4Q5S F;  4MEY F;  2KDO A;  5CVR A;  3K4J A;  2VQC A;  2PJP A;  2RQQ A;  1T56 A;  5J4Y A;  3K4K A;  4EGZ A;  3GZ6 A;  3I55 I;  4KIG A;  4RDU A;  1SC7 A;  3CLO A;  2G7H A;  1YIO A;  1R00 A;  2K86 A;  3LSH A;  2HDD A;  3IKT A;  3LFK A;  2VC0 A;  3GUD A;  4Y3O A;  3RZD J;  5LGU A;  3JRC A;  1JKR C;  1H9T A;  1OQY A;  2ID6 A;  4JBA A;  3HGG A;  3IUO A;  4UB8 C;  1W7P D;  3Q5F A;  2XAQ A;  4S05 A;  2HNH A;  5E79 C;  1RIO H;  2O6G E;  4A3L J;  2KQR A;  1B6A A;  2BYV E;  4Z2Y A;  3IH2 A;  3VB2 A;  2EIJ H;  4N4O B;  2FA5 A;  4ZDO A;  3QOP A;  5GP9 A;  2Q8K A;  4OU0 A;  2VI6 A;  2Q0O A;  3SFI A;  5AON A;  4F52 A;  2EA2 A;  3FXU A;  2CYY A;  4PSW A;  4P9U A;  3P7N A;  2H8R A;  4DQ2 A;  1J2X A;  3KEY A;  4ZH4 F;  2HPM A;  1D0X A;  3SYT A;  4J19 A;  4PJN A;  2B7E A;  3ZOB A;  4UB6 C;  2V1U A;  3LSJ A;  3H5A A;  4LMY A;  2PMZ A;  2EFW A;  1X3U A;  3RPQ A;  4A6D A;  2PLY A;  4A5M A;  2QF7 A;  2L9V A;  3GVA A;  4AM3 A;  4FET A;  3S8P A;  2COB A;  2HOS A;  1OCP A;  1SD7 A;  4HQM A;  2E1O A;  2EZH A;  1SFX A;  2WV1 A;  2L02 A;  1ZRE A;  1ZRF A;  2TRT A;  1Q1V A;  2YPR A;  2RGV A;  3O3K A;  4IOC F;  1X58 A;  2EZK A;  2IVM A;  5HS8 A;  3F22 A;  4FT8 A;  2R7Z J;  2CQK A;  3ZXS A;  4M6V A;  5IY5 H;  2QGU A;  2PX9 A;  4EM2 A;  1HKT A;  2L9R A;  4DBR A;  4G7Z F;  5C4X J;  3L2V A;  3PNY A;  2L7F P;  1D0Z A;  2MC3 A;  2W7N A;  3HSE A;  1W4M A;  1WJ5 A;  1ON1 A;  2F48 A;  3BZC A;  3AFH A;  4ZYH A;  4EJO A;  2X0L A;  1Y1V J;  1A31 A;  3ECO A;  1MGT A;  2HKX A;  3KYC B;  2DFI A;  3ZQH A;  2JVG A;  2XPV A;  2EBI A;  4MGR A;  1JKO C;  2F5E A;  2GXB A;  5GTI C;  2RVC A;  1U5T C;  1J0R A;  2OJE D;  1V4R A;  4R1H A;  3TOA A;  3JW4 A;  3I71 A;  1IRX A;  1TWC J;  1QZZ A;  2QKM B;  5KCM A;  1YJW I;  1B59 A;  4UVA A;  2EIM H;  2R7V A;  3CCJ I;  2EFP A;  2GZW A;  3ZN1 A;  5C3E J;  1FYL A;  4DZP A;  2IP2 A;  3FKJ A;  1R5G A;  2PFB A;  3DEW A;  1YHQ I;  1BR1 A;  4AVP A;  3HOS A;  2K02 A;  2M1B A;  1XMK A;  2DPU A;  1TNT A;  1YW7 A;  3D5R C;  6PAX A;  3S17 J;  2IS2 A;  1KQ8 A;  3V42 A;  4XOT A;  4BL0 B;  3HHG A;  3S1R J;  3I9V 2;  3OYF A;  4N9H A;  1KU3 A;  1SAN A;  1ZK8 A;  2OA4 A;  2GXA A;  3KP3 A;  3M07 A;  1BR4 A;  2L3D A;  2DMN A;  1IN6 A;  1BJA A;  1R22 A;  3NWS A;  4KYW A;  3BG7 A;  3OV8 A;  3DKX A;  3TO9 A;  4BJ6 C;  4ZTJ A;  2I8D A;  4XK4 A;  1GUU A;  2MG4 A;  3C3W A;  1U9O A;  4RA2 A;  4FIS A;  1MMN A;  4PGH A;  3G2B A;  1JTY A;  5JVT A;  3A01 B;  4ENJ A;  5F0H A;  2A6H F;  4UUS B;  1B9M A;  3ZRG A;  2FMY A;  1BA5 A;  3Q9V A;  1DQU A;  1FLI A;  2XPU A;  1T98 A;  1R5I D;  2GBY A;  1S7A A;  1QQI A;  1DGR M;  1F9N A;  3PM1 A;  4JX6 A;  1YQA A;  4HA8 A;  1T8I A;  4YEJ A;  2Z5U A;  2DFH A;  2XKO A;  4JK1 X;  3ZPL A;  4I98 B;  3J7A O;  2CJJ A;  1R4M B;  2CQX A;  1HKS A;  2VJ5 A;  3S1N J;  3QP5 A;  4F7Z A;  3BJ6 A;  4BBS J;  2YSR A;  1R23 A;  1VQ7 I;  4A69 C;  2UZK A;  2F4I A;  5ILV A;  1OYW A;  2MH9 A;  3C7J A;  1VTN C;  2K4B A;  2OBP A;  1K61 A;  4UV8 A;  1GT0 C;  5E8I A;  1WRJ A;  3I64 A;  3IWF A;  4J00 A;  3L7W A;  4LK1 F;  3WE3 A;  1B4A A;  1LPQ A;  2LK2 A;  3WTX C;  4XIC A;  2K5C A;  1UMQ A;  3ZMV A;  2HFH A;  1LQ1 A;  2R92 J;  2FF4 A;  4MTD A;  1JT6 A;  2L7K A;  4BHB A;  2XAH A;  5BMZ A;  4I99 C;  2E2H J;  5L3G A;  3ASN H;  5H6Q A;  4LG0 A;  4E70 A;  5F6F A;  1IG7 A;  2VT3 A;  1SD4 A;  1EV7 A;  3OOU A;  3AAF A;  1ETK A;  1T08 B;  2EV0 A;  3OYK A;  1MDM A;  4EGY A;  4L5E A;  1EKE A;  2XGC A;  2Y2Z A;  1PDN C;  2XKP A;  1E3O C;  4M72 A;  4ZYA A;  1OYY A;  2ACJ A;  4RAZ A;  1H89 C;  2E71 A;  4XN3 A;  2ZSI B;  5F1R A;  2M30 A;  2JA5 J;  2R5Z A;  3G1O A;  5J4V A;  4C2M J;  3K7A J;  3QYF A;  4O6J A;  4KIT B;  4U7D A;  3T1B A;  2I10 A;  1SD5 A;  1UJ8 A;  2LD5 A;  1I6X A;  3FXO A;  1IRZ A;  3QQA A;  1GVD A;  2GM4 A;  4E7I A;  1A36 A;  3FXK A;  4NHJ A;  2M8E A;  2EV6 A;  2KL4 A;  3VYU B;  4RB2 C;  1YJ9 I;  3GX4 X;  3BOQ A;  4G7H F;  1UST A;  5EGO B;  2OU2 A;  1EA3 A;  2JUG A;  2Y69 H;  2QA4 I;  4MHG A;  5LHH A;  4A3K J;  3DKW A;  4HG2 A;  2IT0 A;  2FRH A;  3HRM A;  3WU0 A;  2GXG A;  1USS A;  1YFH A;  4MQV A;  1HKQ A;  2XHK A;  1Y0N A;  3BP8 A;  2VPL A;  1YRN A;  2VKD A;  2DFF A;  1JUP A;  2VJ4 A;  1W7P B;  3FXM A;  1HDD C;  3TO7 A;  2BY2 A;  3GWZ A;  2JTV A;  1T33 A;  1GDT A;  4BUP A;  3LL7 A;  1UFM A;  2QKL B;  1FPQ A;  3LA7 A;  4CCL A;  2QSH X;  1DPU A;  5A2Q Z;  1OR7 A;  3A03 A;  2RC4 A;  2W00 A;  3SXY A;  5ICE A;  3ZMS A;  3O8H A;  2DTZ A;  4MO7 A;  1MZB A;  1R36 A;  3K70 C;  5DV5 A;  1TQM A;  1RR8 C;  5F27 A;  3HM5 A;  2ZC2 A;  4GRI A;  1MBK A;  1WJD A;  3WE2 A;  3WTY C;  2XRO A;  1PUF A;  3VYT B;  5ICF A;  2W85 A;  1Z0X A;  1FOW A;  4EEF G;  1IN8 A;  4DJA A;  3OIO A;  1WHU A;  3DTE A;  4NQW A;  1IW7 F;  2LG4 A;  1FOX A;  1LEB A;  1NH3 A;  1Y8Q B;  4X6A J;  1FBU A;  2HQN A;  4BBR J;  4EMS A;  2DA6 A;  3S32 A;  3RPU D;  5DYM A;  5HVQ C;  2KJB A;  2ECB A;  3HOV J;  2D1H A;  2K9L A;  2IS4 A;  4F93 B;  3ABK H;  3CCV I;  2F5V A;  1FWZ A;  3WGI A;  2CU7 A;  1D1C A;  5BPI A;  2CUF A;  1X3W B;  1YTY A;  3T8R A;  2HDC A;  2O9L A;  3H1C A;  3HUG A;  4HF1 A;  4LB6 B;  2TDX A;  4XBF A;  1TT0 A;  4V19 K;  2FBH A;  1YIJ I;  1DP7 P;  3E6C C;  3F6V A;  4KJZ A;  1BIB A;  1YLF A;  2LP0 A;  3R4K A;  5M5X J;  3NQO A;  3MKY B;  5BOX A;  1TWG J;  1HST A;  2GAU A;  1Z6T A;  2LF8 A;  2PI0 A;  1OCR H;  2VJJ A;  4LIT A;  3S2H J;  1ZGJ A;  1IGN A;  4L9J A;  3PSI A;  1MNM C;  5HS9 A;  4HF0 A;  2K3P A;  3REO A;  2P5L C;  1FJL A;  3TP3 A;  4HW0 A;  3IRQ A;  1YG2 A;  1ZG3 A;  4HST A;  4XON A;  1XSD A;  5LGN A;  4L9V A;  2EFN A;  3CO6 C;  5DUK A;  4GYI A;  3K4N A;  5CVJ A;  3JRD A;  1VQ8 I;  2EJR A;  3QOE A;  4B4C A;  2KKO A;  1L0O C;  2KPM A;  3CD6 I;  2D45 A;  2WAQ A;  4LB5 A;  3WTU C;  4Z6Y A;  2VOP A;  1TTY A;  1X1D A;  1X1P A;  3M8J A;  2XC7 A;  3JRA A;  1ZLK A;  2IA2 A;  2DTR A;  1DPR A;  2E7W A;  2KT0 A;  5LRS A;  5BNG A;  1YX3 A;  4RGU A;  2HEO A;  1GV2 A;  2BVL A;  1CQT A;  4WF2 A;  1AU7 A;  4XNF A;  1K83 J;  2BW3 B;  1F43 A;  2LVS A;  4IZZ A;  2Z1D A;  3DQV C;  3GLX A;  3H3U A;  3QYB A;  3SFZ A;  1DDN A;  4N0B A;  2FNP A;  1Z7U A;  1J5Y A;  1LDD A;  2CV1 A;  2LC2 A;  3L2W A;  2E5Z A;  3E6D A;  3J81 K;  1VQP I;  3OS2 A;  4XKC A;  2AO9 A;  2L5Q A;  5IP7 J;  4V2G A;  3C1D A;  1BI1 A;  2DYR H;  1HW5 A;  2JSC A;  1MMA A;  4LG0 B;  2KZV A;  3E5Q A;  2Y0S A;  1LB2 A;  3VSK A;  2DDB A;  1SAX A;  3TBI A;  3HB9 A;  3OYG A;  1MDM B;  1Z67 A;  2WAF A;  2LNB A;  2P5V A;  2VPR A;  2OC6 A;  3GZN B;  1WI9 A;  2ZBK A;  3FDY A;  1F4K A;  4IRI A;  3BQY A;  3EPZ A;  3JTG A;  2CV2 A;  2OTJ I;  4H0E A;  5EEH A;  4G9Y A;  1DUX C;  2P5K A;  5CQG A;  3H5R A;  4P9F A;  5DTD A;  2H09 A;  2PMZ N;  1SFO J;  3RQ4 A;  1JKP C;  5FFZ A;  1MND A;  3OYB A;  2VOD A;  1I27 A;  2MD0 A;  5D5X B;  2VON A;  4LIU A;  4MFE A;  5EJC A;  4O3M A;  1FOK A;  4RM2 A;  5M3M J;  1F1Z A;  4LG3 A;  1B72 A;  4HV5 A;  4IEJ A;  4DZJ A;  4U87 A;  1N25 A;  1IXS B;  3HTU A;  3M8E A;  1S3J A;  2DPD A;  1N75 A;  2H27 A;  4M6Y A;  2X48 A;  3JRF A;  1S5L C;  2AHQ A;  3OSG A;  3N97 A;  1Z1D A;  3ZGK A;  1YS7 A;  2L01 A;  2LKX A;  3SHF A;  2HOE A;  4E7S A;  4AID A;  3K4L A;  4QPQ A;  3J7Y J;  2OQG A;  4DYR A;  1UCR A;  1G6N A;  4AIK A;  2LBF A;  2MW8 A;  3S1Q J;  1FP2 A;  1K4T A;  4BXX J;  1SVO A;  2LKS A;  1WJE A;  2KRH A;  5LEJ A;  1O7F A;  4OMZ A;  2CQ7 A;  2K85 A;  1W0U A;  1HW1 A;  2FX0 A;  2R4G A;  3SDG A;  3V7S A;  3O6B B;  3CCQ I;  3OSF A;  3E1S A;  5E1X A;  3WGH A;  3C18 A;  3V7C A;  2XAG A;  3ZQC A;  4ENN A;  1HC8 A;  1BBY A;  2XGD A;  1BM9 A;  1MD0 A;  4A5N A;  4IHW A;  2JA2 A;  4M9S A;  2Z9O A;  4I2O A;  3EUH A;  2DOE A;  2YX7 A;  3LQR A;  5LFA A;  3VPR A;  4NNJ A;  4W97 A;  4CCN A;  3PIO F;  4LOC A;  1R1V A;  2HTJ A;  2Z33 A;  5FKO A;  2MLK A;  3F21 A;  3HUG B;  4UVB A;  5E3L A;  3GME A;  3MEX A;  3R0J A;  3WTW C;  3FX3 A;  5DM7 F;  1XGO A;  2RN7 A;  1JJ8 C;  4DYC A;  4CSW A;  4HLX A;  3GW2 A;  1E0E A;  3CCU I;  2QUF A;  3K4C A;  3RTR A;  3U21 A;  4PDK A;  4L9T A;  4OIO F;  3L2C A;  1P7I A;  3HBL A;  2LR8 A;  1F36 A;  1UHS A;  1K7A A;  1K6Y A;  2OV7 A;  3DPU A;  3FZV A;  5CYV A;  3DP7 A;  3ABT A;  1W36 D;  5F1J A;  1P4X A;  1S8N A;  2W48 A;  3LWF A;  2BGC A;  4XQF A;  3I5U A;  2JT1 A;  4I6Z A;  3KZZ A;  5D8K B;  4DYQ A;  2NNN A;  2V26 A;  2WB1 A;  3VDX A;  3FK6 A;  1YOV B;  4M3D A;  2EIK H;  2R7F A;  3IV5 A;  2X1C A;  3S3O A;  3OYN A;  1W5S A;  1T39 A;  1U9N A;  5IOY A;  2AXL A;  4C30 A;  2KHM A;  1LEA A;  4ZZL A;  4MEX F;  5K7Z A;  1J09 A;  2K9M A;  2L54 A;  3FXR A;  4RBO A;  1VQM I;  5EEG A;  2W82 A;  4UV9 A;  3WG9 A;  3HRT A;  2FUG 2;  2QSG X;  3I4N J;  2LY9 A;  2K3F A;  4X0G A;  3R60 A;  3BZ6 A;  4KUM A;  3JRI A;  2XGX A;  2MH2 A;  1DGW Y;  2ECC A;  3H9J A;  1N77 A;  3PUF A;  3HSR A;  3F8C A;  1BW5 A;  3E7L A;  1UAA A;  2BY0 A;  5CPR B;  4BE2 A;  2IXS A;  4BHC A;  5FJ8 J;  5TRD A;  4BDY A;  2E5N A;  2VBY A;  3DU6 A;  1HDP A;  1HBX G;  1Y1W J;  3E5X A;  4EQQ A;  2CW7 A;  3VOD A;  2FEZ A;  5ILS A;  4DOZ A;  4F91 B;  3SJM A;  5E3M A;  2ZJP F;  4F92 B;  4O5V A;  3LAJ A;  3J7Z I;  4Q47 A;  1I1S A;  3VEP A;  3KET A;  4XSZ F;  3H0D A;  2BOL A;  3F0C A;  3NAU A;  3GTO J;  4A0Y A;  4I0B A;  5HLI A;  4RAG A;  5GAH J;  2EQR A;  1TQI A;  2CRG A;  2GIZ A;  2HYJ A;  3K9T A;  3O8G A;  3UKG A;  3F9K A;  4M73 A;  1BOA A;  2IW5 A;  2VKE A;  3VOE A;  2LOO A;  1WPK A;  1U0J A;  4OIR F;  4ENK A;  1R1U A;  2HU9 A;  3WU2 C;  3BR3 A;  3K4B A;  3D1N I;  4A0X A;  3K1M A;  3RCO A;  3OR2 C;  2XB5 A;  1UG0 A;  2L4M A;  4G6D A;  4W1U A;  2CV0 A;  5DM6 F;  5FGM A;  1B72 B;  1O3T A;  4I09 A;  2KP6 A;  3IAM 2;  5LRR A;  2O7O A;  4BY1 J;  5C4J J;  5J47 A;  1BN5 A;  3OY9 A;  1VQN I;  1LVA A;  1Y39 A;  1U78 A;  1G59 A;  3FHZ A;  2NNY A;  1O3S A;  4A93 J;  2DT7 B;  3DXJ F;  3RDI A;  2RRE A;  4Y17 A;  3OWT A;  3C2G A;  2KIQ A;  1JI8 A;  1YIT I;  1ZYR F;  3JAM K;  3E3V A;  3QPS A;  1JGS A;  3G71 I;  4FTH A;  1HA8 A;  1MBG A;  2GOM A;  2E1C A;  1C0W A;  4NDL A;  2F5C A;  3V8J A;  1STZ A;  5E1Z B;  1FYM A;  2LBF B;  3CC4 I;  5EDN A;  1FX7 A;  1RPW A;  2VIX A;  3K10 A;  2D5V A;  2EIL H;  1ZG1 A;  1MMG A;  5EGO A;  2FE3 A;  3OYJ A;  2OCE A;  3A0H C;  1EH6 A;  3RIR A;  3KP5 A;  2XAU A;  5JI6 A;  2K7L A;  3CJQ B;  2R7W A;  5FLX Z;  5FKK A;  1YW8 A;  2JZY A;  4ETS A;  4XN0 A;  3DBL B;  4YFK F;  3BG5 A;  3LQQ A;  4EAT A;  2ZO4 A;  4B44 A;  1TBX A;  1MNE A;  2FBK A;  1Z7L A;  2ZCW A;  2H94 A;  2RKH A;  3H36 A;  1W7P A;  2JPB A;  4BQA A;  2BBY A;  2QM3 A;  3U2R A;  2X85 A;  5FLV A;  1KQ0 A;  1WJA A;  3LSM A;  2L4A A;  4AD9 A;  2KZG A; 
#chains in the Genus database with same CATH homology
 2GQQ A;  3KP2 A;  2QQ9 A;  3HRU A;  4MTE A;  5D6F A;  3B02 A;  4RGS A;  4LLN A;  5LBQ A;  4G8X A;  2FOK A;  3F8F A;  1HSJ A;  1BC8 C;  3ELK A;  2QLZ A;  3T5X A;  5FD6 A;  3DF8 A;  2ZJ2 A;  3JSO A;  2QVO A;  4S04 A;  2Z99 A;  3ZMU A;  5L3B A;  3HTS B;  4QLC U;  4I01 A;  2VBW A;  4YIF A;  4L18 B;  4IRH A;  2MD5 A;  5D6E A;  3HRS A;  3QRF F;  5FO5 A;  3R0A A;  1NHA A;  4KIF A;  3F23 A;  2DLL A;  2VOO A;  2HZT A;  1ZAR A;  4IHS A;  1FBQ A;  5BS6 A;  2F2E A;  1XDS A;  3DFG A;  2RV8 A;  3GF2 A;  4CGZ A;  3FXQ A;  3ZP5 A;  3KLN A;  5L3C A;  1E17 A;  3ZMD A;  3FM3 A;  5AIQ A;  1Y0U A;  2ZFW A;  1RUO A;  3BY6 A;  2QYO A;  1JE8 A;  4HF2 A;  1FT9 A;  3GFJ A;  2K4J A;  2DO7 A;  4HDV A;  3GZ5 A;  5LLQ A;  4KT5 C;  1SMT A;  3KE2 A;  1IXR C;  2AS5 F;  3CUQ A;  4JQF A;  1J9I A;  4GO1 A;  4HX4 A;  1YS6 A;  2MBF A;  1YO5 C;  4U0V A;  2V1D A;  4Y13 A;  3IHU A;  2F5F A;  3PQK A;  3HSF A;  3KEO A;  2ELH A;  1ZRD A;  1XN7 A;  4TV7 A;  2H6C A;  5IT3 A;  1Z05 A;  1B1B A;  1RUN A;  2OZU A;  2VC1 A;  1MJB A;  4P5O A;  2W25 A;  3RI4 A;  1TW3 A;  1G3S A;  3WOD F;  5D5U B;  5HOO A;  1A04 A;  4LJZ F;  2ESH A;  1IAW A;  2STW A;  3GEZ A;  1OYI A;  1U2W A;  5L3D A;  2QBY B;  3BJO A;  1P4W A;  5JR3 A;  4LLL A;  1ULY A;  2A61 A;  4Y15 A;  3QU6 A;  1FSE A;  2UWM A;  3KP4 A;  1D8K A;  1P6R A;  1TW2 A;  2GA2 A;  2HS5 A;  2OQR A;  3RKX A;  1J59 A;  3ZQ7 A;  5HS7 A;  2PQ8 A;  1S29 A;  2HR3 A;  3G73 A;  5D4R A;  1GXP A;  1KA8 A;  4OIQ F;  2KIF A;  2QQB A;  3P9I A;  3CO7 C;  1TQP A;  3PQJ A;  1BC7 C;  1ZAO A;  3T0Y A;  2JRT A;  1FYK A;  2A3S A;  2WTE A;  1H0M A;  1IRF A;  4LFU A;  3Q9S A;  1ZN2 A;  4A12 A;  2HWV A;  5DCM A;  4RGX A;  4BYY A;  5CVV A;  1QZY A;  3H3Z A;  3WTT C;  1LDK B;  2WV0 A;  1F5T A;  2DBB A;  4LK0 F;  2V9V A;  4L9N A;  3FWE A;  5FD5 A;  1MJA A;  3EDP A;  5HDN A;  1ON2 A;  5DCF A;  4UNO A;  2ZXJ A;  5A2Q K;  1FNN A;  2IJL A;  3TQN A;  3RPU A;  4KMU X;  4WCG A;  1IUY A;  1R7J A;  2ZNY A;  4BXU A;  2B0L A;  2M87 A;  3EET A;  4BHP A;  3J80 Z;  2X4H A;  1O3R A;  1PUE E;  4P96 A;  2YU3 A;  5JFR A;  3IC7 A;  4LGW A;  3F8N A;  1G3W A;  1Z9C A;  2R3S A;  1HQC A;  3F8M A;  2CGP A;  3CUQ B;  2QQA A;  5IT9 Z;  4KIC A;  2W84 A;  5E18 F;  1TLH B;  1O57 A;  1BI2 A;  1R1T A;  3EQL F;  3T8T A;  1PP7 U;  2HGC A;  1K78 A;  5HLH A;  1R58 A;  3TO6 A;  3FMR A;  4WXD A;  5ICG A;  4I0A A;  2RDP A;  2DQR A;  3ECH A;  2HKO A;  4HX7 A;  3K1N A;  4KFC A;  3CJN A;  1P92 A;  1QBJ A;  4GYG A;  4YII A;  2KIM A;  4WXC A;  5HLG A;  2FML A;  2NYX A;  5CVI A;  2MA3 A;  3I58 A;  2UXX A;  4KNY A;  2A68 F;  4U0W A;  3DV8 A;  3N4M A;  2Y48 A;  5D8L B;  2O03 A;  2ISZ A;  2GIV A;  1UB9 A;  2LSO A;  4KA4 A;  2HTS A;  4PCQ A;  2XAF A;  3RJP A;  3U9G A;  4I02 A;  1KYW A;  3S2W A;  3MZH A;  3E6B A;  3KCC A;  2LKP A;  1L3L A;  2E7X A;  3ROU A;  4XSX F;  1KU7 A;  4BAY A;  1H9G A;  2XIG A;  2D2W A;  2O8X A;  2ADU A;  3IWZ A;  3BWG A;  5J8F A;  4HOB A;  4D0P A;  4A0Z A;  2G9W A;  4M71 A;  5DCM B;  2DAO A;  4G94 A;  1ONV A;  2EB7 A;  4L5I A;  3DPL C;  5DUI A;  3P9K A;  1I1G A;  3TOB A;  1MJ9 A;  4HZF A;  5D5W B;  1WSU A;  2W57 A;  2STT A;  1IRG A;  3BPV A;  3R6S A;  1XSV A;  5ED4 A;  3SZT A;  4MNU A;  2VBX A;  2XUB A;  1QO0 D;  1O7L A;  3GFM A;  4NB5 A;  4CZZ A;  4U7B A;  3BRO A;  3WGG A;  3MFK A;  4P55 A;  5LGT A;  3LA2 A;  3KEQ A;  3IRR A;  3P9C A;  4GCV A;  2LF7 A;  3K1P A;  5L3E A;  3F3X A;  3L00 A;  4G6Q A;  2K27 A;  5K5R A;  5FFX A;  4FHT A;  3I4P A;  5HDK A;  3I59 A;  1K78 B;  1RNL A;  2JPC A;  3DPT A;  3SZP A;  3F6O A;  3KP7 A;  2DW4 A;  2EWN A;  2COM A;  4EJW A;  1IN5 A;  3OOP A;  2Z3Y A;  3COA C;  1U6G A;  1ZGA A;  1IN7 A;  2ZME A;  3VFZ A;  4CIC A;  4QWQ A;  3GYH X;  5BQT A;  1KQ9 A;  1SFE A;  3I53 A;  1SFU A;  2PG4 A;  4HYE A;  3W6J B;  2DU9 A;  2EA4 A;  5CVU A;  5J8C A;  3HYI A;  3M8F A;  5J6X A;  2P4W A;  4ENM A;  1I5Z A;  3G3Z A;  3KLO A;  2GA1 A;  1FSH A;  3JTH A;  2BEO A;  3RKY A;  1G3Y A;  1RI7 A;  2FSW A;  3MZY A;  3ERE D;  1UHM A;  3IKV A;  3BDD A;  2UXN A;  3FMS A;  1WKM A;  2KRF A;  2IA1 A;  1QNT A;  1R5H A;  5CJ9 A;  5ILU A;  2KIU A;  1BIA A;  2QBY A;  4CO8 A;  2V1X A;  4EJT A;  2ISY A;  2A5Y B;  4RB1 A;  2QWW A;  4XRF A;  3M1E A;  5F64 A;  4LLG F;  4UVC A;  4OIP F;  3GXO A;  1D3Y A;  1S7O A;  2V79 A;  2VE8 A;  2ESN A;  4IPA A;  3MQ0 A;  4XLP F;  2A07 F;  1ODD A;  4KMF A;  2FXA A;  3GO5 A;  2W24 A;  4A6E A;  5HDG A;  3ULQ B;  4LD5 A;  1ZRC A;  4EVI A;  5H20 A;  2XRN A;  4YG2 F;  1TNS A;  4HQE A;  1XCV A;  5FLX K;  4M9Z A;  3EYI A;  5KVR A;  4UXN A;  3V4G A;  3TDU C;  4IF4 A;  1UHW A;  2DQL A;  2XAS A;  5KK1 A;  5JHU A;  5E1W A;  4HBL A;  4Q4Z F;  4R8H A;  3QPH A;  4L0Z B;  2ETH A;  4KIB A;  4EJU A;  3L9F A;  1YYV A;  1Q1H A;  1B9N A;  1T0F A;  2VN2 A;  1J75 A;  3QAH A;  2Q2E A;  3HHH A;  3I59 B;  1XB4 A;  5DDG A;  3F72 A;  2BV6 A;  2BE5 F;  1JXS A;  3M7G A;  2FU4 A;  5DD4 A;  5D5V B;  4HLY A;  4RAY A;  1CF7 A;  2QEN A;  3CDH A;  1Z6R A;  4GGG A;  2P6T A;  3BJA A;  2ZME B;  3DEU A;  4FX0 A;  1D8J A;  4FX4 A;  1FP1 D;  4MQ9 F;  1LNW A;  1T6S A;  1LJ9 A;  4CYD A;  4ESJ A;  1FY7 A;  1XSX A;  2XV4 S;  2HQR A;  5CLS A;  1XGM A;  2FNA A;  5TJJ A;  3V7R A;  4HAM A;  4OMY A;  2WWY A;  2DK5 A;  2OZ6 A;  5H6R A;  5DEQ A;  2VE9 A;  1P2F A;  3QU3 A;  4ZZD A;  4B8X A;  4YFX F;  1W5T A;  4IJA A;  2CSO A;  4CDG A;  4IRG A;  4HDU A;  4UHT A;  4RGR A;  1YW9 A;  3RKW A;  1T2K A;  5AIP A;  1GVJ A;  4OIN F;  1RZ4 A;  2FQ3 A;  3ZMT A;  1V3F A;  1XGN A;  2PBI A;  3JSP A;  1GXQ A;  3RYP A;  5LHI A;  4AWX B;  2CWE A;  3O2P E;  4WK8 F;  2EFO A;  2M5W A;  1P4A A;  1IZ1 A;  2O0Y A;  1FZP B;  2HYG D;  1BI3 A;  2NAZ A;  3EYY A;  4ON0 A;  4KDP A;  1WQ2 A;  5ERI A;  2XVC A;  4M74 A;  2MLG A;  1CGP A;  4DNC A;  1PP8 F;  3KP6 A;  4L5J A;  2YR2 A;  3PFI A;  2F5D A;  1FBS A;  4B09 A;  3D0S A;  3LAP A;  2IRF G;  3I54 A;  2IA0 A;  1KU2 A;  4K2E A;  3RYR A;  1IXC A;  2IPQ X;  2CW0 F;  1QGP A;  3J81 Z;  2DK8 A;  2HYF A;  3LA3 A;  4HV6 A;  1AWC A;  2OD5 A;  4BNC A;  3NEU A;  3HOT A;  1U5T A;  5K5Q A;  4EM1 A;  4G7O F;  1EH8 A;  1BI0 A;  2PMU A;  3D5L A;  1D5V A;  3KZY A;  2GWR A;  4ZYD A;  3HIF A;  5LEK A;  4BH9 A;  1KGS A;  4PGG A;  5LHG A;  2O3F A;  3M9A A;  3BPX A;  3R61 A;  1SD6 A;  2P8T A;  4A2U A;  4RB3 C;  5K5O A;  2V6C A;  1CF7 B;  2WC2 A;  1K79 A;  1SMY F;  4ASN A;  4CXF A;  3CTA A;  1XCB A;  5L3F A;  1EH7 A;  3IL2 A;  2CG4 A;  1JHF A;  3ISP A;  4AIJ A;  3SQN A;  1OPC A;  2EFQ A;  4KN7 X;  3QP6 A;  4M9X A;  3MAJ A;  4EV0 A;  3H92 A;  4OOI A;  3E6M A;  3CO6 C;  2PMH A;  4HX8 A;  3TKY A;  4ESF A;  3L09 A;  3K0L A;  3W6K B;  2CO5 A;  2FBI A;  2EV5 A;  2KJC A;  4I7H A;  2Y75 A;  4U88 A;  4EM0 B;  1AOY A;  4UUV A;  1KYZ A;  2Y0M A;  2ZKZ A;  3K2Z A;  1HXD A;  3ZMZ A;  4Q48 A;  5FB2 A;  4WXH A;  4RS8 A;  1OKR A;  2O61 A;  3J80 K;  4N9I A;  2VBZ A;  2PN6 A;  1QPM A;  3K69 A;  4GXO A;  2A69 F;  5DD8 A;  1U3E M;  1J7K A;  1G4D A;  1G3T A;  2P7V B;  1FC3 A;  1XMA A;  1KU9 A;  2R7D A;  4IHT A;  5IT9 K;  1XGS A;  3WTS C;  1HW2 A;  3U1D A;  2ZNZ A;  4R79 A;  1GHC A;  2DT5 A;  3FM5 A;  2VXZ A;  1IF1 A;  1MKM A;  1XDU A;  1E2X A;  2C6Y A;  2G7U A;  1Z91 A;  3LST A;  4RB0 A;  5D4S A;  4CHU A;  5BPD A;  3V8K A;  4EJV A;  2EK5 A;  4WWC A;  3WU1 B;  1REP C;  3TGN A;  2CFX A;  2J5O A;  4WX9 A;  2YX4 A;  3V8L A;  4YFN F;  4IXA A;  3ML6 A;  4ZYG A;  2QZ8 A;  3WTV C;  3B73 A;  4XLN F;  3CUO A;  4IVN A;  1U5T B;  2LDU A;  1XD7 A;  3I0T A;  1S6L A;  1O3Q A;  1ZHF A;  2NRA C;  2J5P A;  5E8G A;  3WTZ A;  2RQP A;  4KN4 X;  3FMQ A;  1JHH A;  2XAJ A;  2D1V A;  3FF5 A;  3KFW X;  4L0Y B;  2E1N A;  2PEX A;  5E20 A;  3QPT A;  2DI3 A;  4ZYE A;  2M45 A;  4M6X A;  5K1Y A;  3CUQ C;  2A6E F;  5E17 F;  1ZH5 A;  1ZLJ A;  3E5U A;  1LDJ A;  3GFL A;  4ESB A;  3JAM Z;  1WWX A;  5ICC A;  2VT2 A;  2P7C B;  1U8R A;  2P6S A;  1T38 A;  4AIH A;  3MWM A;  3NRV A;  3GFI A;  2RNJ A;  3MCZ A;  1IN4 A;  4U0Y A;  4PZJ A;  3TDZ C;  1ZG5 A;  1K6O A;  3F8B A;  3ABU A;  2NS0 A;  1OMI A;  2H6B A;  3ZN0 A;  2OAZ A;  3E97 A;  4Q5S F;  4MEY F;  5CVR A;  2PJP A;  4EGZ A;  3GZ6 A;  4KIG A;  3CLO A;  2G7H A;  1YIO A;  1R00 A;  2K86 A;  3IKT A;  3LFK A;  2VC0 A;  3GUD A;  5LGU A;  1H9T A;  4JBA A;  1W7P D;  3Q5F A;  2XAQ A;  4S05 A;  1RIO H;  2O6G E;  1B6A A;  2BYV E;  4Z2Y A;  3VB2 A;  2FA5 A;  3QOP A;  2Q8K A;  4OU0 A;  2Q0O A;  5AON A;  2EA2 A;  3FXU A;  2CYY A;  4P9U A;  3P7N A;  4DQ2 A;  1J2X A;  4ZH4 F;  2V1U A;  4LMY A;  2EFW A;  1X3U A;  3RPQ A;  4A6D A;  2PLY A;  4A5M A;  3GVA A;  1SD7 A;  4HQM A;  1SFX A;  2L02 A;  1ZRE A;  1ZRF A;  2YPR A;  2RGV A;  3O3K A;  2IVM A;  5HS8 A;  3F22 A;  4FT8 A;  2CQK A;  4EM2 A;  1HKT A;  4G7Z F;  2MC3 A;  3HSE A;  1W4M A;  1ON1 A;  4ZYH A;  4EJO A;  2X0L A;  3ECO A;  1MGT A;  2HKX A;  2DFI A;  4MGR A;  2GXB A;  2F5E A;  2RVC A;  1U5T C;  1J0R A;  1V4R A;  4R1H A;  3TOA A;  3JW4 A;  3I71 A;  1QZZ A;  1B59 A;  4UVA A;  2EFP A;  2GZW A;  3ZN1 A;  1FYL A;  2IP2 A;  1R5G A;  2PFB A;  3HOS A;  4AVP A;  2K02 A;  2M1B A;  1XMK A;  2DPU A;  1TNT A;  1YW7 A;  1KQ8 A;  6PAX A;  3HHG A;  4N9H A;  1KU3 A;  2OA4 A;  3KP3 A;  2L3D A;  1IN6 A;  1BJA A;  1R22 A;  4KYW A;  3OV8 A;  3TO9 A;  3C3W A;  4PGH A;  5JVT A;  4ENJ A;  2A6H F;  1B9M A;  2FMY A;  3Q9V A;  1FLI A;  1T98 A;  1S7A A;  1QQI A;  1F9N A;  1YQA A;  4HA8 A;  2Z5U A;  2XKO A;  4JK1 X;  3ZPL A;  4I98 B;  3J7A O;  1HKS A;  3QP5 A;  4F7Z A;  3BJ6 A;  2YSR A;  1R23 A;  2UZK A;  5ILV A;  1OYW A;  2MH9 A;  3C7J A;  1VTN C;  2K4B A;  2OBP A;  4UV8 A;  5E8I A;  1WRJ A;  3I64 A;  3IWF A;  3L7W A;  4LK1 F;  3WE3 A;  1B4A A;  3WTX C;  3ZMV A;  2HFH A;  1LQ1 A;  2FF4 A;  4MTD A;  4BHB A;  2XAH A;  5BMZ A;  5L3G A;  5H6Q A;  4LG0 A;  4E70 A;  5F6F A;  2VT3 A;  1SD4 A;  1EV7 A;  3AAF A;  2EV0 A;  1MDM A;  4EGY A;  1PDN C;  2XKP A;  4M72 A;  1OYY A;  2ACJ A;  4RAZ A;  5F1R A;  2M30 A;  4O6J A;  4U7D A;  3T1B A;  1SD5 A;  1I6X A;  4NHJ A;  2M8E A;  2EV6 A;  4RB2 C;  3GX4 X;  3BOQ A;  4G7H F;  1UST A;  2OU2 A;  4MHG A;  5LHH A;  3DKW A;  2IT0 A;  2FRH A;  3HRM A;  3WU0 A;  2GXG A;  1USS A;  1YFH A;  4MQV A;  1HKQ A;  2XHK A;  3BP8 A;  1W7P B;  3TO7 A;  3GWZ A;  2JTV A;  1UFM A;  1FPQ A;  3LA7 A;  1DPU A;  5A2Q Z;  1OR7 A;  2RC4 A;  3SXY A;  5ICE A;  3ZMS A;  1MZB A;  1R36 A;  5DV5 A;  1TQM A;  3WE2 A;  3WTY C;  2XRO A;  5ICF A;  2W85 A;  1IN8 A;  4NQW A;  1IW7 F;  1LEB A;  1FBU A;  2HQN A;  4EMS A;  5DYM A;  5HVQ C;  2KJB A;  2D1H A;  1FWZ A;  3WGI A;  5BPI A;  1YTY A;  3T8R A;  2HDC A;  3HUG A;  4HF1 A;  4LB6 B;  2TDX A;  4XBF A;  2FBH A;  1DP7 P;  3E6C C;  3F6V A;  1BIB A;  1YLF A;  3R4K A;  3NQO A;  5BOX A;  1HST A;  2GAU A;  1Z6T A;  2LF8 A;  2PI0 A;  1ZGJ A;  4L9J A;  5HS9 A;  4HF0 A;  3REO A;  2P5L C;  4HW0 A;  3IRQ A;  1YG2 A;  1ZG3 A;  1XSD A;  5LGN A;  4L9V A;  2EFN A;  5DUK A;  4GYI A;  5CVJ A;  2EJR A;  2KKO A;  1L0O C;  2D45 A;  4LB5 A;  3WTU C;  2VOP A;  1TTY A;  1ZLK A;  2IA2 A;  2DTR A;  1DPR A;  2E7W A;  5LRS A;  4RGU A;  2HEO A;  4WF2 A;  3DQV C;  3GLX A;  3H3U A;  3SFZ A;  1DDN A;  4N0B A;  2FNP A;  1Z7U A;  1J5Y A;  1LDD A;  3E6D A;  3J81 K;  3C1D A;  1BI1 A;  1HW5 A;  2JSC A;  4LG0 B;  3E5Q A;  1LB2 A;  1SAX A;  1MDM B;  2LNB A;  2P5V A;  1WI9 A;  2ZBK A;  1F4K A;  4IRI A;  3JTG A;  4H0E A;  5EEH A;  4G9Y A;  1DUX C;  2P5K A;  4P9F A;  2H09 A;  5FFZ A;  2VOD A;  1I27 A;  5D5X B;  2VON A;  4O3M A;  1FOK A;  1F1Z A;  4HV5 A;  1IXS B;  3HTU A;  3M8E A;  1S3J A;  2DPD A;  2H27 A;  4M6Y A;  3N97 A;  1Z1D A;  1YS7 A;  2L01 A;  3SHF A;  2HOE A;  2OQG A;  1UCR A;  1G6N A;  4AIK A;  1FP2 A;  5LEJ A;  1O7F A;  4OMZ A;  1HW1 A;  3V7S A;  3O6B B;  5E1X A;  3WGH A;  3C18 A;  3V7C A;  2XAG A;  4ENN A;  1BBY A;  1BM9 A;  1MD0 A;  4A5N A;  4M9S A;  2Z9O A;  4I2O A;  3EUH A;  2YX7 A;  3LQR A;  1R1V A;  2HTJ A;  2Z33 A;  2MLK A;  3F21 A;  4UVB A;  3MEX A;  3R0J A;  3WTW C;  3FX3 A;  1XGO A;  2RN7 A;  4HLX A;  3GW2 A;  2QUF A;  3RTR A;  4PDK A;  4L9T A;  4OIO F;  3L2C A;  1K7A A;  3FZV A;  5CYV A;  3DP7 A;  3ABT A;  1P4X A;  1S8N A;  3LWF A;  2BGC A;  3I5U A;  2JT1 A;  3KZZ A;  5D8K B;  2NNN A;  2R7F A;  1W5S A;  1T39 A;  2AXL A;  1LEA A;  4ZZL A;  4MEX F;  3FXR A;  2L54 A;  5EEG A;  4UV9 A;  3WG9 A;  3HRT A;  3R60 A;  3BZ6 A;  4KUM A;  2XGX A;  2MH2 A;  3HSR A;  3F8C A;  4BHC A;  5TRD A;  2VBY A;  1HBX G;  3E5X A;  4EQQ A;  3VOD A;  2FEZ A;  5ILS A;  3LAJ A;  4O5V A;  4Q47 A;  1I1S A;  3VEP A;  3KET A;  4XSZ F;  4A0Y A;  4I0B A;  5HLI A;  3K9T A;  1TQI A;  4M73 A;  1BOA A;  2IW5 A;  3VOE A;  4OIR F;  4ENK A;  1R1U A;  4A0X A;  3K1M A;  2L4M A;  4G6D A;  5FGM A;  1O3T A;  4I09 A;  5LRR A;  1BN5 A;  1LVA A;  1U78 A;  3FHZ A;  2NNY A;  1O3S A;  3DXJ F;  3RDI A;  4Y17 A;  1ZYR F;  3JAM K;  3E3V A;  1JGS A;  2E1C A;  1C0W A;  2F5C A;  3V8J A;  1STZ A;  5E1Z B;  1FYM A;  1FX7 A;  1ZG1 A;  2FE3 A;  3RIR A;  1EH6 A;  3KP5 A;  5JI6 A;  2K7L A;  5FLX Z;  1YW8 A;  2JZY A;  4ETS A;  4YFK F;  3LQQ A;  2ZO4 A;  1TBX A;  2FBK A;  2ZCW A;  2H94 A;  2RKH A;  1W7P A;  2JPB A;  4BQA A;  2BBY A;  2QM3 A;  3U2R A;  1KQ0 A;  2L4A A;  4AD9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...