4JBAA

Crystal structure of the oxidized form of marr from e.coli
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
138
structure length
134
Chain Sequence
LFNEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLSSIRSAASITPVELKKVLSVDLGALTRMLDRLVCKGWVERLPNPNVLVKLTTGGAAISEQSHQLVGQDLHQELTKNLTADEVATLEYLLKKVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The multiple antibiotic resistance regulator MarR is a copper sensor in Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
molecule keywords Multiple antibiotic resistance protein MarR
total genus 44
structure length 134
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4jbaA00
1QGPA 4NQWA 1GXQA 2EV6A 2P7CB 4IF4A 3MZHA 4HF1A 2ZO4A 1JHHA 3WTVC 1EH8A 3BJOA 4UHTA 1CGPA 4KMUX 1S6LA 4FT8A 3BROA 1F9NA 3RKWA 2GQQA 4N9IA 3J81K 4M9XA 2XAQA 2DW4A 3T5XA 3QP5A 1T6SA 1BI2A 4N9HA 3TO9A 1TQIA 2E7XA 1JGSA 5E1ZB 1KU3A 5JHUA 1J5YA 2G7UA 5FFXA 3LQQA 4KMFA 3E6BA 2F2EA 3R4KA 5L3CA 4WWCA 4I09A 3ML6A 4WXDA 2XAGA 4Y15A 1TQMA 2HTSA 1G4DA 3M1EA 2FA5A 3C1DA 3GW2A 2LF8A 3J81Z 2BEOA 4RAZA 1J59A 1P6RA 2W25A 3I58A 4OINF 5A2QK 1K78A 2XAJA 3SQNA 3BJ6A 3P9CA 3DV8A 2W24A 5E18F 2VT3A 1DPRA 1BC7C 4HLYA 1RI7A 2KRFA 2P5LC 3WTYC 3LA2A 4AIKA 5DUKA 4AIJA 3KFWX 3B02A 2PMUA 3GO5A 4HQMA 3SZTA 3F6OA 1W5TA 4R1HA 3G73A 5EEGA 5DUIA 1BI1A 3KLOA 2NNNA 4IHTA 4L9JA 3TGNA 2PFBA 4U0VA 1V3FA 4UV8A 1KU7A 3NEUA 2XKPA 3EETA 4DNCA 3WU0A 1F4KA 1R1VA 2L54A 3F8NA 1XGOA 3IRRA 3E6DA 4P9UA 2CW0F 1MDMB 5H6QA 6PAXA 4FX4A 1PP8F 5D6FA 4M6YA 4KYWA 4Q48A 3EUHA 4RB2C 2IP2A 5CLSA 2HR3A 3WTXC 1BI0A 3T1BA 3D0SA 1T39A 3E5XA 2P8TA 3LQRA 4I01A 3ZMUA 1H9GA 4ENKA 3WG9A 2YX7A 2A68F 1J75A 4EM1A 3IL2A 4G7OF 4WK8F 1QPMA 5LHGA 3F21A 4HYEA 1S29A 2ZKZA 4K2EA 1W4MA 2DPUA 2HOEA 2GAUA 1ZH5A 1ZYRF 5FO5A 5E8GA 2CSOA 4MHGA 2NYXA 2P6SA 1FX7A 1MJBA 1LDKB 5CVIA 2JPBA 1T38A 4UNOA 4IXAA 2V79A 4MQ9F 5LRRA 2HQRA 4HDVA 3LA3A 3BDDA 1WI9A 4PZJA 1O57A 1FSHA 3FMQA 5HS7A 2FMLA 3IKTA 3DEUA 4GXOA 2L02A 4EM0B 1O3QA 3TOBA 2V6CA 5DEQA 3ZMSA 4S05A 3CDHA 1FPQA 1OR7A 1WKMA 4PCQA 3GXOA 1SD4A 5DV5A 5D8KB 2XGXA 2QWWA 4PGGA 5F6FA 5BOXA 2CYYA 4U0WA 4OU0A 4OOIA 1QZZA 1GHCA 1P92A 4XSXF 1BI3A 3GWZA 3PQJA 4A12A 3F22A 2CWEA 2DI3A 2RC4A 2UXNA 4N0BA 1SAXA 2OZ6A 3JSPA 1KQ0A 2A6HF 1KQ8A 4M74A 2A07F 4GO1A 3KP5A 3VOEA 2W84A 3BP8A 1B9MA 2STTA 5ERIA 1REPC 5E1WA 1Q1HA 4XSZF 1U2WA 5CVUA 1XMAA 4P96A 2RKHA 1HXDA 4KIFA 3HOTA 2UWMA 2MLGA 4P9FA 3U9GA 4HX7A 2Y48A 1H0MA 3VFZA 2JT1A 1G6NA 1NHAA 1YW7A 4LB6B 2NNYA 4HBLA 1DUXC 1Z05A 5LBQA 1YIOA 1U8RA 2JPCA 1I1GA 1RIOH 2YSRA 2DAOA 3REOA 2MA3A 1FYKA 2HFHA 2F5EA 3P9IA 5BPIA 3C7JA 4EMSA 4WX9A 5IT3A 4KUMA 5HOOA 3GFMA 4BYYA 2HEOA 1U5TC 4I2OA 2X0LA 3HSFA 2QLZA 1WRJA 1HBXG 4EGYA 4ZYHA 3WTWC 4RGUA 5E1XA 3IKVA 5LRSA 5F64A 1SD6A 1QBJA 4OIRF 1FZPB 1XDSA 2DPDA 3MAJA 1D8JA 2QBYA 3KZZA 3I0TA 3E97A 3T0YA 2OBPA 2YX4A 3FXQA 1KYZA 3ZPLA 3JSOA 2EA4A 4BHCA 4L9NA 4XLPF 3ELKA 1D5VA 3F23A 2D1HA 4U0YA 3RKYA 3KZYA 3FX3A 2FOKA 3HRTA 2HYGD 4EM2A 4EJUA 2K4JA 1IW7F 2DBBA 3DF8A 4JBAA 4I7HA 4I98B 4B09A 3F8FA 1BN5A 4G6QA 2HTJA 4CICA 3F6VA 1Z1DA 3L2CA 1ZRDA 5LLQA 3ISPA 1O3SA 3KP7A 3MEXA 3C3WA 3FHZA 3FWEA 5K5RA 4ESJA 1X3UA 2GZWA 4HZFA 1BJAA 4EJTA 1HQCA 4LMYA 3LWFA 3FMSA 2O61A 5H20A 3ZMVA 4ZYEA 2VE8A 1FOKA 2G9WA 2HWVA 2CQKA 2COMA 2D1VA 3I54A 4G94A 2YPRA 4G8XA 4MEYF 3WE2A 1IF1A 2FU4A 2P5KA 2PMHA 3OOPA 4HF0A 4EVIA 3ECHA 3L00A 1LB2A 5K5OA 1ZHFA 3WGIA 1BC8C 3SHFA 2KIMA 3L09A 3Q5FA 4A5NA 2C6YA 4L9TA 4L0YB 4KFCA 4PDKA 1V4RA 3WTSC 2PI0A 5JI6A 4L5JA 2IA0A 3E6MA 2FMYA 2K27A 2ZFWA 1USSA 2W85A 1FYMA 1DPUA 1O3RA 1TBXA 1JXSA 1Z6TA 5FGMA 1B4AA 5LHIA 4KIBA 4GCVA 2P5VA 2XHKA 3WODF 1R58A 2VBXA 1XMKA 4CXFA 2XASA 1TNTA 5L3GA 5CVJA 1GVJA 1B9NA 2MC3A 2J5OA 2CFXA 3HHHA 3T8RA 2M1BA 4LLLA 4R79A 1HW1A 2ZMEA 1K79A 2L4MA 1DP7P 3QPTA 2PLYA 2VXZA 1PDNC 2L4AA 4A6EA 4EQQA 2IJLA 3HIFA 3I59A 3LAPA 4XBFA 2Z9OA 3CLOA 3KP2A 4I0BA 1PP7U 3V8JA 2DK8A 1G3TA 1U6GA 3CUOA 2STWA 3ABUA 2OD5A 1HW5A 2H6CA 2VBZA 5IT9Z 5FB2A 4KNYA 3M7GA 2IRFG 4BXUA 2LF7A 2GXBA 2VBWA 2MLKA 1FLIA 4RAYA 3GX4X 1MGTA 3TKYA 1R22A 3QU3A 1W7PD 3M8FA 5DCMB 1YS6A 2GA1A 4OIOF 3RDIA 1LEAA 3GFLA 2TDXA 3I71A 3LSTA 2PEXA 3MZYA 2LKPA 2K02A 1SFXA 2ADUA 1ZLKA 3HTSB 3ERED 3K1PA 4M6XA 1ZARA 5KVRA 4IRGA 1OYIA 1MJAA 3J80K 2FXAA 3KLNA 3WTUC 2XKOA 3ZMZA 4L0ZB 1HKTA 1F1ZA 1KU9A 2HKOA 2OA4A 4A0XA 3JTHA 2OZUA 2HDCA 2WV0A 1P4WA 2O03A 5J8CA 1IAWA 4ZH4F 2M45A 4O3MA 1KGSA 3I53A 4ZYGA 3COAC 4EJVA 5BPDA 1ODDA 3I59B 4NHJA 2HS5A 2ZBKA 1R00A 3RPQA 4WF2A 4MTDA 2EJRA 2NS0A 1U5TA 4Q5SF 1ZRCA 2EWNA 5D5UB 1AWCA 4JQFA 3QRFF 1ON2A 1SD5A 3I5UA 3J7AO 3HTUA 1XSDA 1LQ1A 1LNWA 3IRQA 1IXRC 1A04A 3Q9VA 3EQLF 3H3UA 1K6OA 4U7DA 3JAMK 4G6DA 4BNCA 2JTVA 4ESBA 1BM9A 3F72A 2PQ8A 2Z99A 4BQAA 3H92A 1HSJA 4WXHA 2KJBA 2CO5A 5FD5A 1D3YA 5HVQC 3CUQC 4G7HF 5L3FA 4L18B 1YO5C 1CF7B 2RVCA 4A2UA 1I1SA 2XAHA 2FRHA 2MH2A 4XLNF 2G7HA 2VC0A 2M30A 4EV0A 2L3DA 3KP3A 4KN4X 1I6XA 3F8MA 2CGPA 3O3KA 2B0LA 2AXLA 1T2KA 1S3JA 2ETHA 1ULYA 2XROA 1R7JA 2QQBA 2IVMA 4IHSA 2KIFA 3L7WA 1ZGAA 1B6AA 2UZKA 2V1XA 3NRVA 2ZNYA 3SXYA 5D5WB 2WTEA 2RNJA 1XB4A 2O3FA 2F5CA 3EYYA 2RV8A 4DQ2A 2YR2A 3N97A 3VODA 4KT5C 3DQVC 2DQLA 3P9KA 3V8KA 2K4BA 2GXGA 4IJAA 1Z9CA 1IUYA 1U5TB 3K0LA 2LNBA 5CYVA 4UVCA 4UUVA 3TO6A 2KKOA 2O8XA 2D2WA 5ED4A 3LA7A 4UXNA 2FBHA 4GYGA 3K69A 1EV7A 3M8EA 2W57A 1XD7A 3K2ZA 3QOPA 3MQ0A 1LEBA 1QQIA 4GGGA 1S8NA 1FT9A 4E70A 1MKMA 4RS8A 4O5VA 2J5PA 2Z33A 4U7BA 2XRNA 4LGWA 3V7SA 5JFRA 2DFIA 5J8FA 2EFWA 2MD5A 5DD4A 1TNSA 3ECOA 4LB5A 3RYPA 4WCGA 3BOQA 1MD0A 2R3SA 5BMZA 1XDUA 3E5UA 4AD9A 1USTA 5FLXZ 3DPTA 4OMYA 3C18A 1UFMA 2O6GE 2M87A 4AVPA 4MTEA 1W5SA 4AIHA 4ENNA 1ZLJA 5D8LB 3AAFA 2QQ9A 1FBUA 1STZA 1OPCA 1ONVA 4Y17A 2XAFA 3RTRA 3HYIA 2H94A 4HAMA 2DO7A 5HS8A 5HLIA 4A5MA 2GA2A 4TV7A 3LAJA 2M5WA 4MNUA 3RKXA 4RGSA 1QNTA 5CVRA 1LVAA 3GZ5A 3DPLC 4UVAA 1MJ9A 2FSWA 2MBFA 4AWXB 2FNPA 2WC2A 1UB9A 3GFJA 2VBYA 4HQEA 1IN8A 3WGHA 3RI4A 2DU9A 2RN7A 1YQAA 4HX8A 3WE3A 3HRUA 3R61A 2QZ8A 3HRMA 1XGNA 2A5YB 1K78B 1R1TA 3D5LA 2QVOA 2ISYA 3JW4A 2PN6A 2NAZA 1G3YA 2FBKA 5LGNA 2BGCA 3PFIA 3NQOA 4XRFA 2VT2A 1XSVA 1T0FA 1SD7A 1TTYA 1W7PB 4YIFA 3QP6A 2ISZA 4HOBA 4LK1F 2JRTA 3H3ZA 2DTRA 3IWFA 4UV9A 2QM3A 3GLXA 4A6DA 3CUQA 4OIPF 3BPVA 1T98A 2UXXA 5BS6A 3GEZA 1ZG3A 2JSCA 3I64A 4M73A 4KICA 3TOAA 4ZZDA 1LJ9A 4O6JA 2P4WA 1R5GA 2HGCA 1MDMA 2QUFA 2EB7A 2GWRA 3HHGA 3R0JA 1XGSA 4CYDA 1XCBA 4ON0A 3ABTA 3GF2A 4ENJA 4Q47A 1KQ9A 1OYYA 3ZN1A 5ICFA 2EFQA 2K7LA 2EK5A 3J80Z 1K7AA 4RB0A 3QAHA 3U2RA 1D8KA 1G3WA 1IN5A 2IT0A 2Q0OA 5ICCA 2QENA 5F1RA 2V1DA 4FX0A 1UCRA 3EYIA 4H0EA 2FE3A 1BOAA 3WTZA 3V7RA 2A3SA 3M9AA 1KU2A 3DFGA 1IN6A 1BIAA 2AS5F 1FP2A 1QO0D 5D6EA 5AIQA 5DYMA 4HDUA 2EV0A 2HQNA 2E1NA 2R7FA 1IZ1A 5E8IA 3BZ6A 5HDKA 3IC7A 3HSRA 4IRHA 3W6KB 1ZG5A 4CDGA 2IA1A 2FF4A 5ILSA 2KJCA 5ICEA 4QLCU 4EGZA 4LD5A 1IRGA 1BIBA 4LG0A 1YG2A 4R8HA 2Y0MA 4IPAA 3GZ6A 1W7PA 4ZYDA 3DKWA 4L9VA 3PQKA 1KYWA 1ON1A 4P5OA 5FLXK 3CUQB 2EFOA 1PUEE 1VTNC 2VONA 3ZN0A 1BBYA 3FXRA 4CZZA 5D4RA 3CO6C 1SMTA 1I27A 4ZZLA 5A2QZ 2QBYB 1MZBA 3E3VA 4ENMA 2ZJ2A 3KP4A 3V8LA 2P6TA 4M9SA 5HS9A 5E20A 2K86A 2OAZA 4L5IA 4PGHA 2ZXJA 1FBQA 3KCCA 4Z2YA 1R23A 1WSUA 2E7WA 1JHFA 3MWMA 1FBSA 3O6BB 1O3TA 1FY7A 3F3XA 3S2WA 2OQGA 2P7VB 4A0ZA 5D4SA 3TQNA 3RJPA 2XV4S 3F8BA 5ICGA 1B1BA 4MEXF 3RYRA 1ZN2A 2HYFA 2H6BA 5L3DA 5LHHA 1UHWA 1HW2A 5LEJA 1J7KA 1R5HA 2LDUA 4IVNA 2VN2A 3EDPA 3TDUC 4IRIA 2VE9A 1RUOA 3CO7C 3KETA 3TO7A 2EFPA 2EFNA 1O7LA 2IW5A 1SFUA 1YTYA 4LG0B 4GYIA 5K1YA 1I5ZA 1R1UA 4RB3C 3DP7A 4LFUA 2ELHA 2PBIA 3WGGA 1RUNA 2DK5A 2BBYA 2WWYA 5LEKA 3K1MA 4JK1X 3T8TA 3MCZA 3R6SA 2H27A 1YW8A 4LK0F 3KEQA 3FM3A 2X4HA 4LJZF 3ROUA 2A6EF 5JVTA 2ESNA 4B8XA 2DLLA 2CG4A 2DQRA 1S7AA 3FM5A 1R36A 2FBIA 3JAMZ 4HF2A 2V1UA 4Y13A 3DXJF 1IXCA 5D5VB 4YIIA 5BQTA 3TDZC 4M71A 3CTAA 1YYVA 4OMZA 1S7OA 3HOSA 1HKQA 2F5DA 3FMRA 2BV6A 4QWQA 5HLGA 3KEOA 5EEHA 3E5QA 2EA2A 4FHTA 3ZP5A 1L0OC 2GIVA 1GXPA 1XSXA 1QZYA 3FZVA 4MQVA 3ZMTA 1IRFA 1JE8A 2OQRA 4P55A 4UVBA 1E2XA 4LLNA 1TW2A 3E6CC 3N4MA 5LGUA 2DT5A 1OYWA 4A0YA 1EH6A 3KP6A 3FXUA 3V4GA 1RNLA 4I0AA 4BHBA 2OU2A 3B73A 3VB2A 1FP1D 1XN7A 3OV8A 5CVVA 4RGRA 1SMYF 5ILUA 2ZNZA 2FNAA 1P4AA 1YLFA 2RDPA 3ZQ7A 3BPXA 2A69F 2M8EA 1ZRFA 1FC3A 4HLXA 1LDJA 1Y0UA 1YS7A 1FSEA 2XVCA 4I02A 4BAYA 2ACJA 2RQPA 4Q4ZF 2EV5A 5HDGA 1Z91A 1ZG1A 2O0YA 5DCMA 1E17A 1ZGJA 5TJJA 4YFNF 3V7CA 3HSEA 5DCFA 4ESFA 3LFKA 1P4XA 4HV6A 3GYHX 2IPQX 3WU1B 3QPHA 2JZYA 1AOYA 2Q8KA 1J0RA 1J9IA 1TW3A 3KE2A 3BWGA 5J6XA 2YU3A 4HA8A 4RGXA 3QU6A 1IXSB 3ZMDA 3SFZA 1TQPA 4YFKF 1UHMA 5AONA 3GFIA 3U1DA 5H6RA 2LSOA 3WTTC 2FEZA 4NB5A 2VOOA 4BH9A 4S04A 1FYLA 5CJ9A 1ZREA 4U88A 3BJAA 5TRDA 3JTGA 1IN4A 1O7FA 2VODA 4KN7X 2HKXA 1EH7A 4KDPA 3FF5A 5ILVA 4MGRA 3P7NA 2NRAC 2ZMEB 1WWXA 4ETSA 1FWZA 4CGZA 1SFEA 1H9TA 1HSTA 3MFKA 3R60A 4CHUA 3R0AA 3O2PE 3IWZA 1LDDA 3SZPA 3CJNA 5JR3A 5FFZA 4BHPA 5K5QA 2F5FA 2H09A 4YG2F 5HDNA 3ULQB 4G9YA 4WXCA 3HUGA 5IT9K 3G3ZA 5E17F 4CO8A 1Z7UA 1OKRA 2PG4A 2A61A 2FQ3A 3W6JB 1C0WA 1KA8A 4F7ZA 2Z5UA 3BY6A 5LGTA 2R7DA 5HLHA 3GVAA 2RGVA 2XIGA 2PJPA 2KIUA 3K9TA 5DD8A 5FD6A 1FNNA 2ZCWA 1U3EM 3RIRA 1CF7A 4M9ZA 5L3EA 3VEPA 3F8CA 4RB1A 4ASNA 3L9FA 1Z6RA 1G3SA 1OMIA 4G7ZF 2HZTA 3GUDA 4YFXF 1TLHB 5L3BA 2IA2A 3IHUA 4HW0A 1HKSA 2MH9A 5DDGA 2Y75A 4OIQF 1YW9A 3HRSA 2XUBA 4HX4A 5D5XB 2V9VA 2Q2EA 3I4PA 3K1NA 2D45A 1F5TA 2VOPA 5KK1A 2QYOA 3RPUA 1XGMA 2E1CA 2QQAA 1L3LA 5AIPA 4HV5A 2VC1A 2BYVE 4D0PA 4KA4A 2Z3YA 4KIGA 2ESHA 1P2FA 1IN7A 1XCVA 1DDNA 1U78A 1YFHA 1J2XA 1ZAOA 4EJWA 4EJOA 3Q9SA 1RZ4A 4M72A 2BE5F 4LLGF 1B59A 1WQ2A 2L01A
chains in the Genus database with same CATH superfamily
3BR2A 2XGCA 4IHYA 1QGPA 2LP0A 2KHMA 3RZDJ 2ZFUA 4NQWA 1GXQA 2EV6A 3HUGB 1T95A 2P7CB 4XK4A 4IF4A 4OAYA 4UUSB 1PUFA 1X1DA 2KISA 2ME0A 3MZHA 4HF1A 1HA8A 2R7XA 5GADJ 1WGXA 1JHHA 2ZO4A 3WTVC 5JLWA 1EH8A 3BJOA 2E60A 4UHTA 5EG0B 1CGPA 1R6RA 3LSHA 4KMUX 1N77A 1S6LA 4FT8A 3BROA 1F9NA 4PK4A 3RKWA 4ZYAA 1S72I 4NC6A 2GQQA 4N9IA 2M34A 5LFAA 2JQ7A 3CMMA 3J81K 4M9XA 3H1CA 2XAQA 2DW4A 2V1NA 2LFBA 3PJRA 3T5XA 3QP5A 1T6SA 1BI2A 1Z0XA 4N9HA 3TO9A 4XRMA 1QA6A 1TQIA 2E7XA 4BACA 1JGSA 5E1ZB 1KU3A 1BW5A 5JHUA 2WAEA 2R7VA 1J5YA 1D0YA 1YOVB 1TZLA 1ZR2A 2G7UA 3VSLA 1VQ6I 5FFXA 2ZC2A 1BR1A 3LQQA 1RPWA 2BY1A 3MKZA 3VPRA 4KMFA 4IO9F 3E6BA 3IAM2 1TWFJ 2F2EA 2XB5A 3KYLA 2IS1A 4XICA 3R4KA 5L3CA 4WWCA 4AYBN 4JX6A 4I09A 4PSXA 1HF0A 3K7AJ 1UELB 3ML6A 3JRDA 2ZJQF 4WXDA 1XG1A 2XAGA 2VQLA 4Y15A 1LKXA 5FRMA 2JA2A 4G6TB 4BE1A 3CCJI 2GIZA 5GAEJ 1TQMA 2HTSA 3H36A 1G4DA 2OV7A 2AQFA 3M1EA 1X2NA 2FA5A 3C1DA 3GW2A 2L7MP 4FQGA 2LF8A 3K4KA 3J81Z 1TWAJ 2BEOA 4RAZA 1J59A 1P6RA 2W25A 1SAUA 2E35A 1T33A 4BEHB 4CUGA 5F0HA 2CUFA 3I58A 4OINF 1HDDC 5A2QK 2Y0SN 1K78A 2XAJA 5HLTA 3SQNA 3BJ6A 3CCLI 3C2GA 2EINH 2MD0A 2I10A 3W2VA 3P9CA 3DV8A 3CMYA 4IKFA 1X1CA 2W24A 3B6CA 1FEXA 2ZB9A 3OYDA 5E18F 2L0KA 2VT3A 1DPRA 3C2HA 1BC7C 2E2IJ 4ANJA 1RI7A 4HLYA 3W6VA 2KRFA 4AM3A 2P5LC 3WTYC 4HPQA 4E7ZA 3S3MA 1K61A 3OYHA 3LA2A 4AIKA 4M6VA 5DUKA 4AIJA 1IUFA 5J47A 3KFWX 2COBA 3B02A 2PMUA 3GO5A 4HQMA 4BL0B 3SZTA 3F6OA 1W5TA 4R1HA 3G73A 3ERMA 5EEGA 2LKSA 5DUIA 1BI1A 3KLOA 1ZELA 2JVHA 5K7HA 1D1BA 2NNNA 3BTJA 4IHTA 3CCSI 4L9JA 3TGNA 1E3HA 2PFBA 4D1QA 2IS4A 1MH3A 1TL8A 1WPKA 2K3FA 4U0VA 3CF2A 4IEJA 1Y6IA 1V3FA 4UV8A 1KU7A 2BW3B 2XB0X 2DA3A 3NEUA 2XKPA 2CU7A 3GTPJ 3EETA 4DNCA 3WU0A 1F4KA 1R1VA 3RKQA 1VQOI 4XL9A 1XX5A 2L54A 3F8NA 3EPZA 2MC4A 1XGOA 3S14J 3IRRA 3E6DA 4P9UA 2CW0F 4Y52J 2AXTC 3A02A 1WJDA 3LNQA 1MDMB 1B72A 5H6QA 1Y0NA 4A3BJ 4A93J 6PAXA 4FX4A 2OUMA 3FK6A 4C2UA 4GFBA 3KEYA 1YX5A 3JR9A 1PP8F 5D6FA 4M6YA 2JA6J 4KYWA 1X3WB 2DA5A 3CF5F 4Q48A 3EUHA 2IP2A 4RB2C 5CLSA 4F91B 2HR3A 3WTXC 1BI0A 1VQ8I 4XLCA 3T1BA 4ZTJA 1LFBA 3D0SA 3JRAA 1T39A 3E5XA 2P8TA 3LQRA 4I01A 4V2FA 3ZMUA 1JI8A 2MABA 1H9GA 5J3LA 3WG9A 4ENKA 1HDPA 2YX7A 2A68F 1J75A 4EM1A 3IL2A 4G7OF 2VQHA 4WK8F 3UR3C 1LFUP 3ZQIA 2RNGA 1QPMA 5LHGA 2X6XA 3F21A 1SANA 3HDDA 3G71I 4HYEA 2M8GX 1S29A 1P7JA 2ZKZA 3RZOJ 3TBIA 4K2EA 1W4MA 4E7KA 5FKKA 5M5WJ 4JOMA 3FXOA 2R7UA 2DPUA 5HODA 2ZXIA 1VNDA 2HOEA 1MMNA 4FISA 1S7EA 2GAUA 1ZH5A 1ZYRF 1ZTRA 5FO5A 2R5YB 3S2DJ 5E8GA 4FASD 2CSOA 3M07A 4MHGA 2OCEA 3EUHC 3OYCA 2NYXA 2P6SA 5EZGA 3Q3SA 4D7NA 1FX7A 4A3KJ 1MJBA 1LDKB 5CVIA 2JPBA 1T38A 3O8HA 3PSFA 3DWLE 2ECCA 1SVLA 4UNOA 4IXAA 2IGOA 1AHDP 2V79A 3PIOF 4MQ9F 2I8DA 2Y0SA 1SFKA 5LRRA 2HQRA 4HDVA 4XQFA 3LA3A 2O7OA 3CMEI 3S2HJ 2IEKA 1UJ8A 3BDDA 1WI9A 2LYCA 5EJCA 4QTRA 4HNTA 2I5UA 4PZJA 3HL2A 1O57A 3E0JB 1FSHA 2ZMEC 3FMQA 2ID6A 2LMDA 2HU9A 1R5ID 2AQEA 5HS7A 2FMLA 3IKTA 1IV8A 3DEUA 4GXOA 1QVUA 1YRNA 1S9HA 1Z7LA 4EATA 2KLOA 2L02A 5GAHJ 4EM0B 1O3QA 3TOBA 2V6CA 1D0ZA 1DQUA 5DEQA 3ZMSA 3VYTB 4S05A 3CDHA 3HOVJ 3CQZJ 3ZQLA 1FPQA 1OR7A 2GBYA 2KP6A 1WKMA 3A4CA 4PCQA 1LPQA 3GXOA 1SD4A 5DV5A 4A3GJ 5D8KB 5CKTA 3FXKA 5J1UA 2XGXA 1NG7A 2QWWA 4PGGA 2X1CA 5F6FA 2CYYA 3MZ8A 4U0WA 5BOXA 3DBRB 5FKLA 4OU0A 4OOIA 5TGTA 1QZZA 1GHCA 1JTYA 4A3EJ 4A69C 1MMAA 2HOAA 1ETYA 1P92A 5IP6A 4XSXF 4ITVA 1BL0A 2MFZA 1BI3A 3GWZA 1A31A 3ASOH 3PQJA 4A12A 3F22A 2L9NA 2CWEA 2DI3A 2RC4A 2UXNA 3QYEA 4X6AJ 1NTCA 2LY2A 4N0BA 1SAXA 2OZ6A 3JSPA 1FIPA 1KQ0A 1QU3A 2A6HF 1KQ8A 1Z3YA 4M74A 1K4SA 2A07F 4F52A 1RKTA 4GO1A 3KP5A 4C3HJ 2O9LA 3VOEA 2ZXWH 2W84A 2M3AA 3BP8A 1HLVA 5IYDJ 1B9MA 2Y9ZA 2STTA 4RBOA 5ERIA 4RM3A 1REPC 5E1WA 2FX0A 1Q1HA 4XSZF 1U2WA 3CCUI 5CVUA 1XMAA 4P96A 3MD2A 2BVLA 4CCJA 2RKHA 1HXDA 4KIFA 1X2MA 3HOTA 2UWMA 2MLGA 1GVDA 4P9FA 3U9GA 3K10A 3I55I 4HX7A 3BG7A 2IGNA 2Y48A 5C4JJ 4BE2A 1H0MA 3VFZA 1DU0A 2JT1A 4DZPA 4AU7A 1G6NA 5IYBJ 3OYNA 1NHAA 2ELJA 2EZKA 3NARA 4IOCF 1Z21A 1YW7A 3OYFA 4LB6B 4M3EA 2VI6A 1WJCA 2DCEA 2HDWA 4P1WA 2M4KA 2NNYA 4HBLA 1DUXC 1Z05A 5LBQA 1ZQ3P 3GTLJ 1YIOA 5FLMJ 4G12A 3BZCA 1K6YA 2NOGA 1X4PA 2JPCA 4BEHA 5IYCJ 1U8RA 1I1GA 1RIOH 3AL0C 5J4VA 2YSRA 4D5FA 2DAOA 3REOA 1RR8C 2MA3A 3CZ6A 1FYKA 2HFHA 2F5EA 3HZJA 3P9IA 3MKWB 5BPIA 1D0XA 2LG4A 5K7ZA 2E2JJ 3C7JA 4EMSA 5DM6F 4WX9A 4CCLA 5IT3A 2FQ4A 4KUMA 5BNGA 5HOOA 3GFMA 2NS8A 4M3BA 4XKVA 4BYYA 2HEOA 1U5TC 4I2OA 4XM3A 2X0LA 1OCCH 3HSFA 2QLZA 5FKNA 2CMPA 1YJWI 1WRJA 2XPUA 3LMMA 2ME6A 2HZDA 3BZKA 3SDBA 3HC7A 5GPCA 4YELA 1HBXG 4EGYA 4XLHA 2VIXA 1X19A 4B1RA 1I3QJ 5KCMA 1R49A 4ZYHA 3WTWC 4RGUA 3IKVA 1Y8QB 2E71A 1BJZA 1OCOH 3HBLA 5E1XA 4J01A 5FROA 5LRSA 4XOPA 4FETA 4C30A 1YIJI 2RREA 5F64A 1SD6A 1QBJA 1TC3C 4W97A 4OIRF 5FKMA 1XDSA 3VYSB 1FZPB 3LSGA 2VLAA 1FTTA 4Z6YA 2DPDA 1IRZA 3MAJA 1AU7A 2HDDA 3JRFA 3L2RA 1D8JA 2QBYA 3AL0B 3KZZA 1RRJA 2BXZA 3H5NA 3I0TA 2R7OA 3E97A 3T0YA 4BQNA 2DMNA 2OBPA 2YX4A 4DBRA 3FXQA 1KYZA 2XF6A 4DIQA 3ZPLA 4E6KG 3JSOA 1EF4A 3OYEA 1KONA 2L7ZA 1WCMJ 1YI2I 2EA4A 1HC8A 3CCVI 4B44A 3S17J 4BHCA 4L9NA 4XLPF 3ELKA 1U8BA 1D5VA 2HXIA 3F23A 2D1HA 1LVKA 3H9JA 4U0YA 2KQRA 3RKYA 3A0BC 3FX3A 2FOKA 3KZYA 2LKXA 1NK3P 2DYRH 3HRTA 2HYGD 4N4NB 4EM2A 2K4JA 4EJUA 1IW7F 1JTXA 2DBBA 3DF8A 2KZGA 4JBAA 4I7HA 3Q0UA 4I98B 3B6AA 2K9SA 1LE8B 2K3PA 2R5ZB 1H88C 4B09A 3F8FA 2O8KA 1BN5A 2HQAA 2A05A 4G6QA 2HTJA 4CICA 3F6VA 2UUZA 1VQKI 1Z1DA 2X6YA 3HG9A 3L2CA 1ZRDA 2GM4A 1IGNA 3ABLH 1MW7A 2CW8A 2KMUA 5LLQA 3ISPA 1O3SA 4U87A 1FMVA 2L7KA 3KP7A 3MEXA 3H5AA 1A5JA 3C3WA 2R7QA 4IHWA 3FHZA 3FWEA 5K5RA 3A2KA 4ESJA 1X3UA 2GZWA 4BJTA 2VQGA 3S3NA 1WZ2A 4HZFA 1BJAA 4EJTA 3C2BA 1HQCA 4LMYA 2VJ4A 3LWFA 3FMSA 2O61A 2QEXI 5B1BH 5H20A 3ZMVA 1UHSA 4ZYEA 2VE8A 3BTIA 2EIJH 1FOKA 5IOZA 1P9QC 3W2WA 2E1MC 2G9WA 2HWVA 1V54H 2CQKA 5B1AH 4BUPA 2COMA 1G2HA 2D1VA 1MMDA 1IJWC 4BBRJ 3I54A 4G94A 2OF7A 3BR3A 3SEZA 3VDXA 2ICWG 3LSPA 1VQ7I 2QSHX 5J4YA 2YPRA 4G8XA 4MEYF 3WE2A 1IF1A 2WB1A 2FU4A 2P5KA 2PMHA 4B3XA 3OOPA 3DBHB 3OIOA 4HF0A 2JN6A 3H35A 4EVIA 3ECHA 3L00A 1JJ6C 1LB2A 5K5OA 3OYIA 1ZHFA 1MNDA 2GOMA 2IBDA 4OWRB 4UB6C 1YRNB 4DYCA 3WGIA 2F4OB 2CUEA 2X1EA 3LSRA 1BC8C 3HGYA 3SHFA 3CMAI 3DKYA 2KIMA 3BR6A 2JK3A 3L09A 3Q5FA 5M5XJ 4A5NA 1A36A 2C6YA 4L9TA 3FIWA 4L0YB 4KFCA 4PDKA 1JKOC 2E1OA 1V4RA 1Z77A 3WTSC 2PI0A 4N4OB 5JI6A 4L5JA 1VQ5I 3G1LA 2LR8A 3N05A 2JA5J 4B3AA 2IA0A 4CH7A 3OIPA 3E6MA 4YRVA 3JRHA 1S5LC 2FMYA 3OR2C 2K27A 3IV5A 1ETOA 3S3OA 5DS9A 5FJ8J 3HOWJ 2W7NA 2MW8A 2M7AA 3GTGJ 2ZFWA 3HKZN 3JCUC 1ETQA 1USSA 2W85A 3KYCB 1VQPI 2QQ8A 4UB8C 1FYMA 4ZDOA 4L5EA 4CCNA 3BG9A 4MO7A 1DPUA 3OSFA 1O3RA 2P81A 3ABMH 1TBXA 1JXSA 4XKCA 1QRYA 1Z6TA 2DMUA 2KDOA 3CC2I 3CDLA 4W1UA 1NH3A 5FGMA 1LE8A 1AA7A 1G8XA 1B4AA 1VZ0A 3RPUD 5LHIA 2R5ZA 2R7WA 4BBSJ 2Y30A 4KIBA 4GCVA 2P5VA 2XHKA 3WODF 2MG4A 1FMWA 2F4MB 5GP9A 1TP4A 1R58A 1UG2A 2VBXA 1MBKA 1XMKA 2XASA 1TNTA 2FOWA 4CA0A 5L3GA 4CXFA 3CCRI 5CVJA 1GVJA 1B9NA 3CDIA 1QHHD 2MC3A 4F92B 3JRIA 2J5OA 2CFXA 3IH2A 3HHHA 3GTOJ 3T8RA 4FTHA 2M1BA 1MBGA 4LLLA 2VJIA 1HW1A 2ZMEA 3BT9A 2EILH 2L4MA 1D1AA 4R79A 1K79A 5B5EC 1JGGA 2YU9J 1LUJB 3FBIB 2JVGA 1DP7P 4QIWN 3QPTA 3K4NA 2PLYA 2VXZA 1EKEA 3ONQA 3ESWB 3OOUA 1PDNC 4XOTA 2L4AA 2K9MA 4A6EA 2QKLB 2LBFB 4EQQA 2IJLA 3HIFA 4HRIA 3I59A 3LAPA 4JYKA 3U1KA 4XBFA 1JT6A 2H1KA 2Z9OA 4II3A 3CLOA 3KP2A 5C3EJ 4I0BA 1PP7U 4A3CJ 3V8JA 2DK8A 4RAGA 1G3TA 1U6GA 3H9GA 3CUOA 5J1YA 3TL4X 2STWA 5C4XJ 3ABUA 2QGUA 3W2AA 2OD5A 2Q1ZB 2CH0A 1HW5A 2BY3A 2H6CA 2VBZA 2DT6A 3EUAA 3CD6I 5FLVA 4HNVA 1X4OA 2R7ZJ 5IT9Z 3FK7A 5FB2A 2RAEA 4KNYA 3M7GA 2IRFG 2DFHA 2TCTA 4GRIA 4BXUA 2DMPA 1H8AC 5JLXA 4Y7NJ 2LF7A 3ZCOA 1OCTC 2GXBA 2CFOA 2K5CA 5E3OA 2VBWA 2MLKA 1FLIA 4RAYA 3F0CA 3GX4X 5C44J 4RLFA 1MGTA 2EZHA 3TKYA 1R22A 2KT0A 2WY8Q 3QU3A 3L2QA 1W7PD 3HKZA 1K83J 2X1DA 3K2AA 2NVTJ 3M8FA 2AHQA 5DCMB 1YS6A 2GA1A 4B4CA 4OIOF 3RDIA 1LEAA 2CQNA 2TDXA 3GFLA 3I71A 2PEXA 3LSTA 3S16J 3ZQFA 1YJNI 3MZYA 3EUKL 2LKPA 2K02A 3LSKA 1SFXA 2ADUA 1ZLKA 3HTSB 3ERED 3K1PA 3UNGC 3OL4A 4M6XA 1ZARA 1GUUA 5KVRA 4IRGA 1N25A 1OYIA 2A6TA 1MJAA 1U0JA 3J80K 2KRHA 1W5CC 2FXAA 3A0HC 2HI3A 3KLNA 4DYQA 3J7YJ 3WTUC 4BDYA 2K40A 2XKOA 3ZMZA 3GMEA 4L0ZB 2X9DA 1HKTA 1JT0A 1F1ZA 4B43A 4QPQA 1KU9A 2HKOA 2OA4A 3NWSA 4A0XA 1ERDA 2E19A 3VSKA 1UAAA 3DKXA 3JTHA 3IAS2 2OZUA 2PJRB 2HDCA 2WV0A 1P4WA 2PMZN 5F1JA 3L1PA 2O03A 1XS9A 4RM2A 5J8CA 1IAWA 3L2WA 1B8IA 2F48A 4PJNA 4ZH4F 2M45A 4O3MA 4XMYA 2H8WA 2EPFA 1VQLI 2LY9A 3DEEA 3K70C 2DOFA 1KGSA 3I53A 4ZYGA 1NK2P 3COAC 4EJVA 5BPDA 1ODDA 2YS9A 1H89C 3I59B 2HS5A 2ZBKA 4NHJA 1R00A 3RPQA 3A01A 4WF2A 3OWTA 4MTDA 1MH4A 2EJRA 2NS0A 1U5TA 2FD5A 3K4LA 2VKVA 1N75A 4Q5SF 1ZRCA 2EWNA 5D5UB 5EGOA 1VQ9I 4BGDA 1AWCA 4JQFA 2EBIA 3QPSA 3QRFF 2LK2A 1ON2A 5FKOA 1SD5A 3I5UA 3PUFA 3J7AO 3M3YJ 3HTUA 1XSDA 1LQ1A 2VL8A 1LNWA 3IRQA 2VPRA 1IXRC 1A04A 3Q9VA 5EG0A 5M3FJ 3EQLF 1NG6A 2V9KA 3H3UA 1K6OA 1J09A 4U7DA 2WADA 2B63J 3JAMK 4G6DA 4BNCA 2JTVA 3DTIA 5DM7F 4ESBA 1HOMA 1Z3XA 2K9QA 1BM9A 3BQYA 3F72A 3KPHA 2VPLA 2NVUB 3PO3J 2PQ8A 2Z99A 2W48A 1HSJA 3H92A 4WXHA 2XF7A 2KJBA 4BQAA 2CO5A 5FD5A 1D3YA 3A03A 3L2VA 4HNUA 5HVQC 3JRBA 3CUQC 4G7HF 3MMYB 1ACIA 4KISA 4PFPA 5L3FA 4D7MA 4L18B 4LITA 2EIMH 2Y31A 3KZIC 4CCOA 3HJEA 2VKHA 4DGWB 1YO5C 1WJEA 3VWBA 1CF7B 3CCYA 2RVCA 4A2UA 1I1SA 2XAHA 3PUBA 2FRHA 3FKIJ 4BE0A 2MH2A 1OLTA 2G7HA 2VC0A 4XLNF 4DOZA 4NUBA 2M30A 4EV0A 2ID3A 2L3DA 3KP3A 1QPIA 4KN4X 1I6XA 3F8MA 2CGPA 3O3KA 5B3SH 2B0LA 1IC8A 2AXLA 2NS7A 1T2KA 1S3JA 2ETHA 1ULYA 2XROA 3CLQA 3GTMJ 1R7JA 2QQBA 4FE4A 2OJED 2IVMA 3D5SC 3H9QA 4IHSA 2KIFA 3L7WA 2R92J 1ZGAA 2DDAA 1B6AA 2UZKA 2HQ5A 2CQ7A 1ETWA 2V1XA 3NRVA 2ZNYA 3SXYA 2DODA 3E7LA 1WFXA 5D5WB 2WTEA 2RNJA 4NC8A 1XB4A 2O3FA 2F5CA 3VYUB 4F3QA 4E7SA 4KT6A 1B8IB 4IZZA 2XAUA 3EYYA 3DU6A 1I50J 4PJJA 4ZC3A 2ZJPF 3Q0VA 3IUOA 2RV8A 3HB9A 4DQ2A 2YR2A 3N97A 2BVMA 1WJAA 3BQZA 1SFOJ 1V55H 3VODA 3HOUJ 4KT5C 3DQVC 2DQLA 2Q2EB 2TRTA 3P9KA 2QCOA 3SEQA 1OCZH 1D1CA 2MSYA 3V8KA 3S1QJ 2K4BA 2GXGA 4ZJZA 3QODA 4IJAA 1Z9CA 3HEFA 1IUYA 1U5TB 4E7JA 2L2OA 3K0LA 2LNBA 3CC4I 5CYVA 4UVCA 3OSGA 3TO6A 4UUVA 2KKOA 2O8XA 2D2WA 1WH5A 3FISA 5ED4A 3LA7A 2VQCA 4UXNA 2FBHA 4GYGA 4IHVA 3K69A 2M7BA 5CQEA 1EV7A 3M8EA 2EQRA 2W57A 1XD7A 3K2ZA 4PJLA 3QOPA 5JHFA 3MQ0A 5J1RA 1MIJA 1LEBA 1MSEC 3ZQHA 1PYVA 1QQIA 4GGGA 3LOCA 1S8NA 2BY0A 1WJ5A 2ZSIB 2LBFA 1FT9A 4HSTA 5E3LA 4E70A 1T8IA 1MKMA 1GDTA 4RS8A 4O5VA 2J5PA 2Z33A 2DT7B 3GCMA 4BKXA 1RETA 4U7BA 2XRNA 3AG2H 5CPRB 5E3MA 4LGWA 1VI0A 1A6IA 3V7SA 2VKDA 5JFRA 2DFIA 1F43A 2M9HA 5IOYA 4E7LA 5J8FA 2EFWA 2MD5A 2KZVA 5DD4A 1TNSA 2XGDA 1R71A 3F9KA 3PFYA 3ECOA 4Y33A 4LB5A 3RYPA 2M4GA 3AG3H 3G4SI 3PNVA 4I99C 4WCGA 1MBFA 2DA4A 3BOQA 1MD0A 2R3SA 5BMZA 1XDUA 3E5UA 2B9SA 4AD9A 1USTA 5FLXZ 2EIKH 4IL6C 3DPTA 2E1MB 4OMYA 1W1WE 3G2BA 1XC5A 1MNEA 3C18A 1UFMA 2WBMA 2O6GE 2M87A 4AVPA 4MTEA 1W5SA 4AIHA 3ZOBA 1RC9A 4XLEA 2PMZA 4ENNA 1ZLJA 1V5FA 1I39A 1FIAA 1OFCX 2P0WA 5D8LB 3AAFA 4V19K 2QQ9A 1FBUA 3PM1A 1STZA 3S15J 1OPCA 3OYAA 5J40A 3AG4H 1SC7A 1ONVA 4Y17A 2EZLA 2XAFA 3RTRA 3HYIA 2CQQA 2H94A 4HAMA 2DO7A 2F5VA 5HS8A 1UG0A 5HLIA 4A5MA 4H4KC 4MFDA 1OJLA 2GA2A 4TV7A 3LAJA 2M5WA 4MNUA 1X1BA 3RKXA 3O8GA 4RGSA 1QNTA 5CVRA 1LVAA 3GZ5A 3DPLC 4UVAA 1MJ9A 2FSWA 2MBFA 3DCFA 1OR7C 2HNHA 4IOAF 2DYSH 2NVYJ 4AWXB 1K4TA 2CV2A 2FNPA 2WC2A 4XRSA 2WB1N 3CP2A 1E3OC 1UB9A 3GFJA 1WI3A 1A6QA 2CW7A 2VBYA 4HQEA 5CQGA 1FOYA 3K4CA 2DXIA 5HNHA 1Y39A 1IN8A 4LOCA 3WGHA 3P5JA 3RI4A 4C2MJ 1T0FC 2DU9A 2RN7A 1YQAA 4HX8A 3WE3A 3HRUA 1BOBA 4CSWA 3FHNA 3R61A 2QZ8A 3HRMA 3WU2C 1XGNA 2A5YB 2KIQA 2DFFA 4S0HB 1GT0C 1K78B 4I76A 3Q0WA 1R1TA 3D5LA 2QVOA 1DGRM 2ISYA 2DMQA 1OQYA 5KNLA 3JW4A 1XPXA 2PN6A 2DFEA 2NAZA 1G3YA 2FBKA 3A01B 5LGNA 2BGCA 3PFIA 3NQOA 4XRFA 1WH7A 1OCPA 2VT2A 1XSVA 5IP7J 1T0FA 1SD7A 5M3MJ 1IV6A 3M1CA 1TTYA 1W7PB 4YIFA 3QP6A 3MKYB 2ISZA 4HOBA 4LK1F 2JRTA 3OYGA 4E7HA 2XSJC 3H3ZA 2DTRA 3IWFA 4UV9A 2QM3A 3GLXA 2BW3A 1MBHA 4A6DA 5EGOB 3CUQA 3J7ZI 4OIPF 3BPVA 3OMYA 5GPAA 4J00A 3JRCA 1T98A 2UXXA 1ETKA 5BS6A 3GEZA 1ZG3A 2JSCA 3I64A 3IP4B 4M73A 1KZHA 4A3FJ 1SVMA 4KICA 3TOAA 2DMTA 4ZZDA 1LJ9A 1PVEA 3SYTA 4O6JA 1QVTA 3OR1C 2P4WA 2X51A 5M5YJ 4DBQA 1R5GA 2HGCA 2RQQA 1MDMA 4FCYA 2QUFA 1B72B 2EB7A 2GWRA 3HHGA 2W1OA 2HPMA 2ELKA 1ETVA 1LFPA 3R0JA 1XGSA 4CYDA 1XCBA 4ON0A 4A3JJ 3ABTA 4XONA 4AUXA 4A3IJ 1W36C 3DTKA 3GF2A 2VB6A 3I4NJ 2DJIA 3FBNB 4ENJA 2R93J 4Q47A 3ABKH 1KQ9A 1OYYA 3ZN1A 2FUG2 1QZEA 5EZHA 5ICFA 2EFQA 2LD5A 1R4MB 2K7LA 2KFDA 2EK5A 3J80Z 1K7AA 4RB0A 3QAHA 3U2RA 1D8KA 1G3WA 1IN5A 2IT0A 2Q0OA 1TT0A 1GV5A 5ICCA 2QENA 5F1RA 1V5EA 1F36A 4IQ4A 2V1DA 4FX0A 3BTLA 5H2FC 2CRGA 1O4XA 1UCRA 3EYIA 1U9OA 4H0EA 1DP3A 2XF5A 4C3JJ 2FE3A 2LRDA 3GLLA 1BOAA 2FJ1A 3QOEA 4C2TA 1HCRA 3WTZA 3L2UA 3V7RA 1WHUA 2L7FP 3OL3A 2A3SA 2GOXB 3M9AA 4JX5A 1MSFC 2HXOA 1KU2A 3DFGA 1E0EA 1X58A 4RLQA 4BQOA 3J7AY 2IAIA 1IN6A 4EEFG 1BIAA 1ZGWA 2AS5F 3QYFA 1FP2A 2XSDC 1QO0D 2JUCA 1R4NB 2B7EA 5D6EA 5AIQA 5DYMA 4D9JA 1IRXA 3I56I 5LD2C 4HDUA 2CUZA 3H0GJ 2EV0A 2HQNA 3OIQA 3OYBA 1JJ8C 3BG6A 2E1NA 2K85A 2R7FA 1IZ1A 1FJLA 5E8IA 3BZ6A 3OYLA 4PJ0C 5HDKA 3OYMA 4DJAA 3IC7A 3SZGA 2R7RA 2L9VA 3G1OA 3HSRA 3AG1H 4LG3A 5F0FA 4HEA2 1UMQA 4IRHA 1TWHJ 3W6KB 1ZG5A 5F0CA 1BA5A 4CDGA 2IA1A 2FF4A 3LSIA 3AKZA 2G0EA 2HYJA 1ORKA 5ILSA 2KJCA 5ICEA 4QLCU 4EGZA 4LD5A 3SFIA 4RAFA 2QSGX 2E36A 3CCMI 1IRGA 1BIBA 3ZXSA 4LG0A 1YG2A 4R8HA 1U9NA 2Y0MA 4XN0A 3PNTA 1XMXA 4IPAA 4BJ6C 1W7PA 4F55A 5B66C 3GZ6A 2N8GA 2GXAA 4ZYDA 3DKWA 4L9VA 3OYJA 3PQKA 1KYWA 4LIUA 1ON1A 4AIDA 4P5OA 5FLXK 1ZKGA 2LY1A 2WAFA 3CUQB 4MFEA 3BG3A 2LREA 2EFOA 1PUEE 4MLOA 4DYRA 1VTNC 2E2HJ 2VONA 3HXLA 3ZN0A 1ZR4A 1BBYA 3FXRA 4CZZA 5D4RA 3CO6C 1SMTA 4ZDLA 1I27A 2OCCH 4ZZLA 2DA7A 5A2QZ 2QBYB 1MZBA 2IGKA 3E3VA 3HPGA 4ENMA 2ZJ2A 3IH3A 1MMSA 3KP4A 1V5GA 4BS9A 1D5YA 3V8LA 2P6TA 4M9SA 5HS9A 5E20A 1E3PA 2K86A 2OAZA 3GZNB 3I9V2 3KIOA 4RA2A 4L5IA 4PGHA 2V4JC 2X85A 2E5ZA 2IGMA 5TISC 2ZXJA 1FBQA 1I3AA 3KCCA 4Z2YA 1R23A 1WSUA 2E7WA 3BLYA 1JHFA 3MWMA 4XKWA 2DN0A 1FBSA 2LLKA 3GTJJ 2ZXHA 3CESA 1GLNA 2CJJA 3O6BB 2L9SA 2WAQN 4Y4RA 1O3TA 1FY7A 3F3XA 3QQAA 3S2WA 4IHXA 4QSHA 2OQGA 2P7VB 5E79C 4A0ZA 2VJJA 1BR2A 5D4SA 2IS2A 1SVOA 3TQNA 2NVQJ 2DJNA 3RJPA 5EF6A 3CCQI 3M8JA 4ZDPA 2XV4S 3DPUA 3F8BA 2HVSA 2X6OA 5ICGA 1OCRH 2DDBA 1B1BA 3AFHA 5IP9J 4MEXF 2EH3A 3RYRA 1ZN2A 2HYFA 2H6BA 1VQMI 4XKBA 5L3DA 5LHHA 1Q1VA 2VASA 2ECBA 1IO2A 1UHWA 1HW2A 5LEJA 3TMOA 1J7KA 2XDVA 1BR4A 2WV1A 1AKHB 4MIMA 1R5HA 2LDUA 3QPLA 1Z67A 4IVNA 2D5VA 1OISA 4M3FA 2VN2A 3EDPA 3TDUC 4IRIA 2JWTA 5IPAA 2VE9A 1RUOA 3CO7C 2JMWA 4A3MJ 1RR7A 2BOLA 3KETA 3OS1A 3TO7A 1A35A 2QKMB 2EFPA 2EFNA 1O7LA 2M2EA 3HOZJ 2IW5A 4PUSA 1SFUA 1ITYA 1ENHA 1WVRA 4DW6A 4M3GA 3S1MJ 5DTDA 2CV1A 1YTYA 4LG0B 3CJQB 4DZJA 4GYIA 1Y1WJ 2XPWA 3KX2A 5K1YA 1I5ZA 1R1UA 2DOEA 3CC7I 4RB3C 3DP7A 4LFUA 2R7SA 2ELHA 1MMGA 2PBIA 3WGGA 1RUNA 2CV0A 3TEDA 2DK5A 1WJBA 2BBYA 2V6EA 2WWYA 3S32A 4XN3A 3ASNH 5LEKA 2KRCA 3K1MA 3HGGA 4JK1X 1Y56A 3T8TA 3UKGA 1YE9A 2E5NA 3MCZA 3R6SA 3W3CA 2X48A 2NXNB 4CZCA 2H27A 2HPIA 3BR1A 1EA3A 3I4MJ 1YW8A 4LK0F 3KEQA 3ZQQA 5KAFC 4E7IA 3FM3A 2X4HA 4LJZF 3ROUA 2A6EF 1VF9A 3SDGA 5JVTA 2ESNA 4B8XA 2DLLA 2CG4A 3MVPA 2DQRA 3CCEI 1S7AA 3FM5A 1R36A 2FBIA 2NVXJ 3PO2J 3KYDB 3JAMZ 4HF2A 2V26A 3RQ4A 3TW7A 4RMNA 2V1UA 3D1NI 4Y13A 4PJMA 3DXJF 5GAGJ 1DGWY 1IXCA 5D5VB 4YIIA 2HOTA 5BQTA 2R0QC 2IS6A 2WY7Q 3TDZC 1JUSA 1EJ9A 2K9NA 3X2QH 2ZJRF 3BR0A 4M71A 2M0CA 3CTAA 2V9PA 1YYVA 1MNMC 4OMZA 1S7OA 3HOSA 1HKQA 2F5DA 3FMRA 2BV6A 4HG2A 2YUSA 1QHGA 3BR5A 3KEOA 4QWQA 5HLGA 2GLOA 1JKQC 2W82A 5EEHA 3E5QA 5FRNA 3BTCA 2Z1DA 3K4JA 2EA2A 5F08A 4FHTA 4JP0A 1L0OC 4CCMA 3ZP5A 4I6ZA 3JRGA 2OTLI 1N78A 3OYKA 2GIVA 4UUTA 4BQQA 4YEJA 1XSXA 3QWLA 1QZYA 3FZVA 1GXPA 1Y8RB 4F93B 3HOYJ 4BDZA 4MQVA 4BU2A 3ZMTA 4BXXJ 9ANTA 4YIRX 1IRFA 2QSFX 1AKHA 1JE8A 2OQRA 3BCAA 5GTHC 2JSPA 3LSMA 3JREA 3DLLF 4P55A 4UVBA 1TWCJ 1E2XA 4LLNA 3DTEA 1TW2A 3E6CC 3N4MA 5LGUA 3RSNA 2DT5A 1OYWA 1ZK8A 4A0YA 1EH6A 4C3IJ 3KP6A 3FXUA 2W4SA 3V4GA 1X1AA 1RNLA 4I0AA 2HVQA 2LOOA 2WAQA 2OPTA 4BHBA 3CJRB 4ZTFA 3E1SA 2BY2A 3S8PA 4IQJA 2OU2A 3B73A 3VB2A 1FP1D 1XN7A 4UUSA 3OV8A 5CVVA 5KHDA 2JA7J 2WA0A 4RGRA 5E3NA 1SMYF 2LH9A 1FOWA 5ILUA 2ZNZA 5F04A 2FNAA 1P4AA 4B47A 4CYCA 1YLFA 2RDPA 3ZQ7A 4UY8I 3H3VK 4V2GA 3BPXA 2A69F 2M8EA 3FKJA 3SJMA 3ZQCA 1ZRFA 4FE7A 1FC3A 4HLXA 1LDJA 1Y0UA 2Z16A 1YS7A 1FSEA 2XVCA 4I02A 4NBQA 4QPOA 4BAYA 2QA4I 2ACJA 2RQPA 4Q4ZF 2EV5A 5HDGA 1YJ9I 1GV2A 1Z91A 1X3ZB 5K7FA 2O0YA 1ZG1A 3DLAA 4XLAA 5DCMA 1E17A 1ZGJA 1MBJA 2BXYA 5TJJA 3WG7H 4YFNF 3HOXJ 3V7CA 2X6WA 4JX4A 4B48A 2MYSA 3HSEA 5DCFA 5GTIC 5EYRA 4ESFA 1XTAA 3LFKA 1P4XA 3CJTB 4HV6A 3GYHX 2IPQX 2PX9A 2Y2ZA 4PFOA 1UZCA 3WU1B 3QPHA 2OTJI 3M4OJ 2JZYA 3BG5A 3FXLA 1RKWA 1AOYA 1DU6A 2Q8KA 3BCBA 1M1EB 1J0RA 5EEAA 2O5RA 3NAUA 1J9IA 2JA8J 1TW3A 3KE2A 4NNJA 3FXMA 1I6HJ 3NWTA 3QYBA 3BWGA 3V42A 3K4BA 3HM5A 3OY9A 5J6XA 3ZR8X 2Y9YA 2YU3A 4HA8A 4RGXA 3DEWA 3QU6A 1IXSB 3ZMDA 1RESA 3SFZA 1SEUA 1TQPA 4C9YA 2L5QA 4YFKF 1UHMA 3LL7A 1MBEA 2DTZA 5AONA 3VYRB 3GFIA 3U1DA 3H5RA 2LSOA 5H6RA 4A3LJ 2HVRA 3LSJA 1W0UA 4XIDA 3WTTC 2FEZA 2EZIA 2BHZA 3OS0A 2KDZA 4NB5A 2DA2A 4X0GA 3K70D 2VOOA 4BH9A 4S04A 2NOJB 5EDNA 4XR6A 4J19A 1FYLA 2CUJA 5CJ9A 1ZREA 3DBLB 4U88A 3BJAA 5TRDA 3JTGA 4AYBA 1IN4A 4NC7A 1O7FA 2Z2SB 3U21A 2VODA 4KN7X 1YX3A 3S1NJ 2V7FA 2LVSA 2HKXA 2OC6A 2XPVA 3G1MA 3GBGA 4BY1J 1W36D 1EH7A 4KDPA 3PSIA 4D5CA 5IY5H 3FF5A 1T08B 2F4IA 5ILVA 2E34A 2JRMA 4MGRA 3TP3A 1TT5B 3P7NA 2NRAC 3K6GA 2AO9A 2ZMEB 1POGA 3I3LA 4GDFA 4CCKA 1WWXA 4ETSA 1FWZA 2CQXA 4CGZA 2LTPA 1SFEA 1H9TA 1HSTA 4Y3OA 4XNFA 3MFKA 1JUPA 3ZQGA 3R60A 2F6CA 2VXDA 4RDUA 4CHUA 4CYCB 1JKPC 3R0AA 3O2PE 4X1EA 5HNFA 3IWZA 1LDDA 3RCOA 3SZPA 3CJNA 3DU5A 5JR3A 5FFZA 4BHPA 4ABZA 4XLFA 2JUGA 5K5QA 1VQ4I 2F5FA 4M3DA 4A3DJ 3TP0A 2H8RA 2JJ7A 2H09A 2R4GA 4YG2F 2M0MA 5HDNA 2LC2A 3ULQB 3PIPF 4G9YA 1JKRC 4WXCA 4NQWB 3HUGA 3S1RJ 1PUFB 3G3ZA 5IT9K 5E17F 1IDZA 4CO8A 2DOAA 1Z7UA 3OS2A 2VUMJ 1OKRA 2PG4A 4OAZA 2A61A 3G6EI 2FQ3A 3W6JB 1C0WA 1KA8A 4F7ZA 2Z5UA 3BY6A 2QF7A 5LGTA 1W0TA 2R7DA 5HLHA 3H0DA 3GVAA 2RGVA 2XC7A 4KJZA 3FDYA 2VKEA 2XIGA 1Y1VJ 2PJPA 2KIUA 1YITI 2Y69H 3K9TA 2KL4A 5DD8A 3A1YA 5FD6A 1FNNA 1BW6A 2ZCWA 3RIRA 4XRSG 1YHQI 1U3EM 1CF7A 3D5RC 3BC8A 4M9ZA 3VEPA 5L3EA 2BZTA 3FXJA 3F8CA 2DA1A 4RB1A 4NDLA 4ASNA 5JVGF 2UV1A 3L9FA 1Z6RA 1VFCA 1G59A 4E4HA 1G3SA 1OMIA 2VJ5A 2HZTA 3GUDA 4YFXF 1TLHB 4G7ZF 1FOXA 5L3BA 2IA2A 4LIVA 3IHUA 3MN2A 4HW0A 1IG7A 2MGQA 3RQIA 1HKSA 2MH9A 4AC0A 4BJ5C 3WHCA 5DDGA 2Y75A 1T56A 2A5WA 4AVZA 4OIQF 2XGEA 1YW9A 2HOSA 3HRSA 2XUBA 2CS3A 1X1PA 2L9RA 4IX7A 3WHBA 2R5YA 1CQTA 4HX4A 5D5XB 2V9VA 1ETXA 2DA6A 2Q2EA 1R9TJ 3HPHA 4PSWA 2K9LA 4XORA 3I4PA 3K1NA 2D45A 1F5TA 2VOPA 5KK1A 2QYOA 2ZSHB 1XGMA 3RPUA 3S93A 1TWGJ 1VQNI 2E1CA 2QQAA 3TW6A 1JUMA 5KAIC 1L3LA 1APLC 4BXFA 5AIPA 4HV5A 2VC1A 1PJRA 3PNYA 1IDYA 3IH4A 2R7TA 2BYVE 4BY7J 4D0PA 2BHYA 1WJFA 4KA4A 2Z3YA 4KIGA 2ESHA 1P2FA 3ZGKA 1IN7A 1XCVA 1DDNA 2PJRA 1U78A 1YFHA 1J2XA 3LFUA 1ZAOA 3ZRGA 4II2A 4EJWA 3PL8A 4EJOA 2IXSA 3K4MA 3Q9SA 4KITB 1RZ4A 3GTKJ 2XRLA 4M72A 3GTQJ 3MKLA 1P7IA 2BE5F 2W00A 4HSRA 1FTZA 4LLGF 2H1LA 1B59A 2KPMA 1WQ2A 2L01A 5F27A 3CP8A
chains in the Genus database with same CATH topology
1QGPA 4NQWA 1GXQA 2EV6A 2P7CB 4IF4A 3MZHA 4HF1A 2ZO4A 1JHHA 3WTVC 1EH8A 3BJOA 4UHTA 1CGPA 4KMUX 1S6LA 4FT8A 3BROA 1F9NA 3RKWA 2GQQA 4N9IA 3J81K 4M9XA 2XAQA 2DW4A 3T5XA 3QP5A 1T6SA 1BI2A 4N9HA 3TO9A 1TQIA 2E7XA 1JGSA 5E1ZB 1KU3A 5JHUA 1J5YA 2G7UA 5FFXA 3LQQA 4KMFA 3E6BA 2F2EA 3R4KA 5L3CA 4WWCA 4I09A 3ML6A 4WXDA 2XAGA 4Y15A 1TQMA 2HTSA 1G4DA 3M1EA 2FA5A 3C1DA 3GW2A 2LF8A 3J81Z 2BEOA 4RAZA 1J59A 1P6RA 2W25A 3I58A 4OINF 5A2QK 1K78A 2XAJA 3SQNA 3BJ6A 3P9CA 3DV8A 2W24A 5E18F 2VT3A 1DPRA 1BC7C 4HLYA 1RI7A 2KRFA 2P5LC 3WTYC 3LA2A 4AIKA 5DUKA 4AIJA 3KFWX 3B02A 2PMUA 3GO5A 4HQMA 3SZTA 3F6OA 1W5TA 4R1HA 3G73A 5EEGA 5DUIA 1BI1A 3KLOA 2NNNA 4IHTA 4L9JA 3TGNA 2PFBA 4U0VA 1V3FA 4UV8A 1KU7A 3NEUA 2XKPA 3EETA 4DNCA 3WU0A 1F4KA 1R1VA 2L54A 3F8NA 1XGOA 3IRRA 3E6DA 4P9UA 2CW0F 1MDMB 5H6QA 6PAXA 4FX4A 1PP8F 5D6FA 4M6YA 4KYWA 4Q48A 3EUHA 4RB2C 2IP2A 5CLSA 2HR3A 3WTXC 1BI0A 3T1BA 3D0SA 1T39A 3E5XA 2P8TA 3LQRA 4I01A 3ZMUA 1H9GA 4ENKA 3WG9A 2YX7A 2A68F 1J75A 4EM1A 3IL2A 4G7OF 4WK8F 1QPMA 5LHGA 3F21A 4HYEA 1S29A 2ZKZA 4K2EA 1W4MA 2DPUA 2HOEA 2GAUA 1ZH5A 1ZYRF 5FO5A 5E8GA 2CSOA 4MHGA 2NYXA 2P6SA 1FX7A 1MJBA 1LDKB 5CVIA 2JPBA 1T38A 4UNOA 4IXAA 2V79A 4MQ9F 5LRRA 2HQRA 4HDVA 3LA3A 3BDDA 1WI9A 4PZJA 1O57A 1FSHA 3FMQA 5HS7A 2FMLA 3IKTA 3DEUA 4GXOA 2L02A 4EM0B 1O3QA 3TOBA 2V6CA 5DEQA 3ZMSA 4S05A 3CDHA 1FPQA 1OR7A 1WKMA 4PCQA 3GXOA 1SD4A 5DV5A 5D8KB 2XGXA 2QWWA 4PGGA 5F6FA 5BOXA 2CYYA 4U0WA 4OU0A 4OOIA 1QZZA 1GHCA 1P92A 4XSXF 1BI3A 3GWZA 3PQJA 4A12A 3F22A 2CWEA 2DI3A 2RC4A 2UXNA 4N0BA 1SAXA 2OZ6A 3JSPA 1KQ0A 2A6HF 1KQ8A 4M74A 2A07F 4GO1A 3KP5A 3VOEA 2W84A 3BP8A 1B9MA 2STTA 5ERIA 1REPC 5E1WA 1Q1HA 4XSZF 1U2WA 5CVUA 1XMAA 4P96A 2RKHA 1HXDA 4KIFA 3HOTA 2UWMA 2MLGA 4P9FA 3U9GA 4HX7A 2Y48A 1H0MA 3VFZA 2JT1A 1G6NA 1NHAA 1YW7A 4LB6B 2NNYA 4HBLA 1DUXC 1Z05A 5LBQA 1YIOA 1U8RA 2JPCA 1I1GA 1RIOH 2YSRA 2DAOA 3REOA 2MA3A 1FYKA 2HFHA 2F5EA 3P9IA 5BPIA 3C7JA 4EMSA 4WX9A 5IT3A 4KUMA 5HOOA 3GFMA 4BYYA 2HEOA 1U5TC 4I2OA 2X0LA 3HSFA 2QLZA 1WRJA 1HBXG 4EGYA 4ZYHA 3WTWC 4RGUA 5E1XA 3IKVA 5LRSA 5F64A 1SD6A 1QBJA 4OIRF 1FZPB 1XDSA 2DPDA 3MAJA 1D8JA 2QBYA 3KZZA 3I0TA 3E97A 3T0YA 2OBPA 2YX4A 3FXQA 1KYZA 3ZPLA 3JSOA 2EA4A 4BHCA 4L9NA 4XLPF 3ELKA 1D5VA 3F23A 2D1HA 4U0YA 3RKYA 3KZYA 3FX3A 2FOKA 3HRTA 2HYGD 4EM2A 4EJUA 2K4JA 1IW7F 2DBBA 3DF8A 4JBAA 4I7HA 4I98B 4B09A 3F8FA 1BN5A 4G6QA 2HTJA 4CICA 3F6VA 1Z1DA 3L2CA 1ZRDA 5LLQA 3ISPA 1O3SA 3KP7A 3MEXA 3C3WA 3FHZA 3FWEA 5K5RA 4ESJA 1X3UA 2GZWA 4HZFA 1BJAA 4EJTA 1HQCA 4LMYA 3LWFA 3FMSA 2O61A 5H20A 3ZMVA 4ZYEA 2VE8A 1FOKA 2G9WA 2HWVA 2CQKA 2COMA 2D1VA 3I54A 4G94A 2YPRA 4G8XA 4MEYF 3WE2A 1IF1A 2FU4A 2P5KA 2PMHA 3OOPA 4HF0A 4EVIA 3ECHA 3L00A 1LB2A 5K5OA 1ZHFA 3WGIA 1BC8C 3SHFA 2KIMA 3L09A 3Q5FA 4A5NA 2C6YA 4L9TA 4L0YB 4KFCA 4PDKA 1V4RA 3WTSC 2PI0A 5JI6A 4L5JA 2IA0A 3E6MA 2FMYA 2K27A 2ZFWA 1USSA 2W85A 1FYMA 1DPUA 1O3RA 1TBXA 1JXSA 1Z6TA 5FGMA 1B4AA 5LHIA 4KIBA 4GCVA 2P5VA 2XHKA 3WODF 1R58A 2VBXA 1XMKA 4CXFA 2XASA 1TNTA 5L3GA 5CVJA 1GVJA 1B9NA 2MC3A 2J5OA 2CFXA 3HHHA 3T8RA 2M1BA 4LLLA 4R79A 1HW1A 2ZMEA 1K79A 2L4MA 1DP7P 3QPTA 2PLYA 2VXZA 1PDNC 2L4AA 4A6EA 4EQQA 2IJLA 3HIFA 3I59A 3LAPA 4XBFA 2Z9OA 3CLOA 3KP2A 4I0BA 1PP7U 3V8JA 2DK8A 1G3TA 1U6GA 3CUOA 2STWA 3ABUA 2OD5A 1HW5A 2H6CA 2VBZA 5IT9Z 5FB2A 4KNYA 3M7GA 2IRFG 4BXUA 2LF7A 2GXBA 2VBWA 2MLKA 1FLIA 4RAYA 3GX4X 1MGTA 3TKYA 1R22A 3QU3A 1W7PD 3M8FA 5DCMB 1YS6A 2GA1A 4OIOF 3RDIA 1LEAA 3GFLA 2TDXA 3I71A 3LSTA 2PEXA 3MZYA 2LKPA 2K02A 1SFXA 2ADUA 1ZLKA 3HTSB 3ERED 3K1PA 4M6XA 1ZARA 5KVRA 4IRGA 1OYIA 1MJAA 3J80K 2FXAA 3KLNA 3WTUC 2XKOA 3ZMZA 4L0ZB 1HKTA 1F1ZA 1KU9A 2HKOA 2OA4A 4A0XA 3JTHA 2OZUA 2HDCA 2WV0A 1P4WA 2O03A 5J8CA 1IAWA 4ZH4F 2M45A 4O3MA 1KGSA 3I53A 4ZYGA 3COAC 4EJVA 5BPDA 1ODDA 3I59B 4NHJA 2HS5A 2ZBKA 1R00A 3RPQA 4WF2A 4MTDA 2EJRA 2NS0A 1U5TA 4Q5SF 1ZRCA 2EWNA 5D5UB 1AWCA 4JQFA 3QRFF 1ON2A 1SD5A 3I5UA 3J7AO 3HTUA 1XSDA 1LQ1A 1LNWA 3IRQA 1IXRC 1A04A 3Q9VA 3EQLF 3H3UA 1K6OA 4U7DA 3JAMK 4G6DA 4BNCA 2JTVA 4ESBA 1BM9A 3F72A 2PQ8A 2Z99A 4BQAA 3H92A 1HSJA 4WXHA 2KJBA 2CO5A 5FD5A 1D3YA 5HVQC 3CUQC 4G7HF 5L3FA 4L18B 1YO5C 1CF7B 2RVCA 4A2UA 1I1SA 2XAHA 2FRHA 2MH2A 4XLNF 2G7HA 2VC0A 2M30A 4EV0A 2L3DA 3KP3A 4KN4X 1I6XA 3F8MA 2CGPA 3O3KA 2B0LA 2AXLA 1T2KA 1S3JA 2ETHA 1ULYA 2XROA 1R7JA 2QQBA 2IVMA 4IHSA 2KIFA 3L7WA 1ZGAA 1B6AA 2UZKA 2V1XA 3NRVA 2ZNYA 3SXYA 5D5WB 2WTEA 2RNJA 1XB4A 2O3FA 2F5CA 3EYYA 2RV8A 4DQ2A 2YR2A 3N97A 3VODA 4KT5C 3DQVC 2DQLA 3P9KA 3V8KA 2K4BA 2GXGA 4IJAA 1Z9CA 1IUYA 1U5TB 3K0LA 2LNBA 5CYVA 4UVCA 4UUVA 3TO6A 2KKOA 2O8XA 2D2WA 5ED4A 3LA7A 4UXNA 2FBHA 4GYGA 3K69A 1EV7A 3M8EA 2W57A 1XD7A 3K2ZA 3QOPA 3MQ0A 1LEBA 1QQIA 4GGGA 1S8NA 1FT9A 4E70A 1MKMA 4RS8A 4O5VA 2J5PA 2Z33A 4U7BA 2XRNA 4LGWA 3V7SA 5JFRA 2DFIA 5J8FA 2EFWA 2MD5A 5DD4A 1TNSA 3ECOA 4LB5A 3RYPA 4WCGA 3BOQA 1MD0A 2R3SA 5BMZA 1XDUA 3E5UA 4AD9A 1USTA 5FLXZ 3DPTA 4OMYA 3C18A 1UFMA 2O6GE 2M87A 4AVPA 4MTEA 1W5SA 4AIHA 4ENNA 1ZLJA 5D8LB 3AAFA 2QQ9A 1FBUA 1STZA 1OPCA 1ONVA 4Y17A 2XAFA 3RTRA 3HYIA 2H94A 4HAMA 2DO7A 5HS8A 5HLIA 4A5MA 2GA2A 4TV7A 3LAJA 2M5WA 4MNUA 3RKXA 4RGSA 1QNTA 5CVRA 1LVAA 3GZ5A 3DPLC 4UVAA 1MJ9A 2FSWA 2MBFA 4AWXB 2FNPA 2WC2A 1UB9A 3GFJA 2VBYA 4HQEA 1IN8A 3WGHA 3RI4A 2DU9A 2RN7A 1YQAA 4HX8A 3WE3A 3HRUA 3R61A 2QZ8A 3HRMA 1XGNA 2A5YB 1K78B 1R1TA 3D5LA 2QVOA 2ISYA 3JW4A 2PN6A 2NAZA 1G3YA 2FBKA 5LGNA 2BGCA 3PFIA 3NQOA 4XRFA 2VT2A 1XSVA 1T0FA 1SD7A 1TTYA 1W7PB 4YIFA 3QP6A 2ISZA 4HOBA 4LK1F 2JRTA 3H3ZA 2DTRA 3IWFA 4UV9A 2QM3A 3GLXA 4A6DA 3CUQA 4OIPF 3BPVA 1T98A 2UXXA 5BS6A 3GEZA 1ZG3A 2JSCA 3I64A 4M73A 4KICA 3TOAA 4ZZDA 1LJ9A 4O6JA 2P4WA 1R5GA 2HGCA 1MDMA 2QUFA 2EB7A 2GWRA 3HHGA 3R0JA 1XGSA 4CYDA 1XCBA 4ON0A 3ABTA 3GF2A 4ENJA 4Q47A 1KQ9A 1OYYA 3ZN1A 5ICFA 2EFQA 2K7LA 2EK5A 3J80Z 1K7AA 4RB0A 3QAHA 3U2RA 1D8KA 1G3WA 1IN5A 2IT0A 2Q0OA 5ICCA 2QENA 5F1RA 2V1DA 4FX0A 1UCRA 3EYIA 4H0EA 2FE3A 1BOAA 3WTZA 3V7RA 2A3SA 3M9AA 1KU2A 3DFGA 1IN6A 1BIAA 2AS5F 1FP2A 1QO0D 5D6EA 5AIQA 5DYMA 4HDUA 2EV0A 2HQNA 2E1NA 2R7FA 1IZ1A 5E8IA 3BZ6A 5HDKA 3IC7A 3HSRA 4IRHA 3W6KB 1ZG5A 4CDGA 2IA1A 2FF4A 5ILSA 2KJCA 5ICEA 4QLCU 4EGZA 4LD5A 1IRGA 1BIBA 4LG0A 1YG2A 4R8HA 2Y0MA 4IPAA 3GZ6A 1W7PA 4ZYDA 3DKWA 4L9VA 3PQKA 1KYWA 1ON1A 4P5OA 5FLXK 3CUQB 2EFOA 1PUEE 1VTNC 2VONA 3ZN0A 1BBYA 3FXRA 4CZZA 5D4RA 3CO6C 1SMTA 1I27A 4ZZLA 5A2QZ 2QBYB 1MZBA 3E3VA 4ENMA 2ZJ2A 3KP4A 3V8LA 2P6TA 4M9SA 5HS9A 5E20A 2K86A 2OAZA 4L5IA 4PGHA 2ZXJA 1FBQA 3KCCA 4Z2YA 1R23A 1WSUA 2E7WA 1JHFA 3MWMA 1FBSA 3O6BB 1O3TA 1FY7A 3F3XA 3S2WA 2OQGA 2P7VB 4A0ZA 5D4SA 3TQNA 3RJPA 2XV4S 3F8BA 5ICGA 1B1BA 4MEXF 3RYRA 1ZN2A 2HYFA 2H6BA 5L3DA 5LHHA 1UHWA 1HW2A 5LEJA 1J7KA 1R5HA 2LDUA 4IVNA 2VN2A 3EDPA 3TDUC 4IRIA 2VE9A 1RUOA 3CO7C 3KETA 3TO7A 2EFPA 2EFNA 1O7LA 2IW5A 1SFUA 1YTYA 4LG0B 4GYIA 5K1YA 1I5ZA 1R1UA 4RB3C 3DP7A 4LFUA 2ELHA 2PBIA 3WGGA 1RUNA 2DK5A 2BBYA 2WWYA 5LEKA 3K1MA 4JK1X 3T8TA 3MCZA 3R6SA 2H27A 1YW8A 4LK0F 3KEQA 3FM3A 2X4HA 4LJZF 3ROUA 2A6EF 5JVTA 2ESNA 4B8XA 2DLLA 2CG4A 2DQRA 1S7AA 3FM5A 1R36A 2FBIA 3JAMZ 4HF2A 2V1UA 4Y13A 3DXJF 1IXCA 5D5VB 4YIIA 5BQTA 3TDZC 4M71A 3CTAA 1YYVA 4OMZA 1S7OA 3HOSA 1HKQA 2F5DA 3FMRA 2BV6A 4QWQA 5HLGA 3KEOA 5EEHA 3E5QA 2EA2A 4FHTA 3ZP5A 1L0OC 2GIVA 1GXPA 1XSXA 1QZYA 3FZVA 4MQVA 3ZMTA 1IRFA 1JE8A 2OQRA 4P55A 4UVBA 1E2XA 4LLNA 1TW2A 3E6CC 3N4MA 5LGUA 2DT5A 1OYWA 4A0YA 1EH6A 3KP6A 3FXUA 3V4GA 1RNLA 4I0AA 4BHBA 2OU2A 3B73A 3VB2A 1FP1D 1XN7A 3OV8A 5CVVA 4RGRA 1SMYF 5ILUA 2ZNZA 2FNAA 1P4AA 1YLFA 2RDPA 3ZQ7A 3BPXA 2A69F 2M8EA 1ZRFA 1FC3A 4HLXA 1LDJA 1Y0UA 1YS7A 1FSEA 2XVCA 4I02A 4BAYA 2ACJA 2RQPA 4Q4ZF 2EV5A 5HDGA 1Z91A 1ZG1A 2O0YA 5DCMA 1E17A 1ZGJA 5TJJA 4YFNF 3V7CA 3HSEA 5DCFA 4ESFA 3LFKA 1P4XA 4HV6A 3GYHX 2IPQX 3WU1B 3QPHA 2JZYA 1AOYA 2Q8KA 1J0RA 1J9IA 1TW3A 3KE2A 3BWGA 5J6XA 2YU3A 4HA8A 4RGXA 3QU6A 1IXSB 3ZMDA 3SFZA 1TQPA 4YFKF 1UHMA 5AONA 3GFIA 3U1DA 5H6RA 2LSOA 3WTTC 2FEZA 4NB5A 2VOOA 4BH9A 4S04A 1FYLA 5CJ9A 1ZREA 4U88A 3BJAA 5TRDA 3JTGA 1IN4A 1O7FA 2VODA 4KN7X 2HKXA 1EH7A 4KDPA 3FF5A 5ILVA 4MGRA 3P7NA 2NRAC 2ZMEB 1WWXA 4ETSA 1FWZA 4CGZA 1SFEA 1H9TA 1HSTA 3MFKA 3R60A 4CHUA 3R0AA 3O2PE 3IWZA 1LDDA 3SZPA 3CJNA 5JR3A 5FFZA 4BHPA 5K5QA 2F5FA 2H09A 4YG2F 5HDNA 3ULQB 4G9YA 4WXCA 3HUGA 5IT9K 3G3ZA 5E17F 4CO8A 1Z7UA 1OKRA 2PG4A 2A61A 2FQ3A 3W6JB 1C0WA 1KA8A 4F7ZA 2Z5UA 3BY6A 5LGTA 2R7DA 5HLHA 3GVAA 2RGVA 2XIGA 2PJPA 2KIUA 3K9TA 5DD8A 5FD6A 1FNNA 2ZCWA 1U3EM 3RIRA 1CF7A 4M9ZA 5L3EA 3VEPA 3F8CA 4RB1A 4ASNA 3L9FA 1Z6RA 1G3SA 1OMIA 4G7ZF 2HZTA 3GUDA 4YFXF 1TLHB 5L3BA 2IA2A 3IHUA 4HW0A 1HKSA 2MH9A 5DDGA 2Y75A 4OIQF 1YW9A 3HRSA 2XUBA 4HX4A 5D5XB 2V9VA 2Q2EA 3I4PA 3K1NA 2D45A 1F5TA 2VOPA 5KK1A 2QYOA 3RPUA 1XGMA 2E1CA 2QQAA 1L3LA 5AIPA 4HV5A 2VC1A 2BYVE 4D0PA 4KA4A 2Z3YA 4KIGA 2ESHA 1P2FA 1IN7A 1XCVA 1DDNA 1U78A 1YFHA 1J2XA 1ZAOA 4EJWA 4EJOA 3Q9SA 1RZ4A 4M72A 2BE5F 4LLGF 1B59A 1WQ2A 2L01A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QGP A;  4NQW A;  1GXQ A;  2EV6 A;  2P7C B;  4IF4 A;  3MZH A;  4HF1 A;  2ZO4 A;  1JHH A;  3WTV C;  1EH8 A;  3BJO A;  4UHT A;  1CGP A;  4KMU X;  1S6L A;  4FT8 A;  3BRO A;  1F9N A;  3RKW A;  2GQQ A;  4N9I A;  3J81 K;  4M9X A;  2XAQ A;  2DW4 A;  3T5X A;  3QP5 A;  1T6S A;  1BI2 A;  4N9H A;  3TO9 A;  1TQI A;  2E7X A;  1JGS A;  5E1Z B;  1KU3 A;  5JHU A;  1J5Y A;  2G7U A;  5FFX A;  3LQQ A;  4KMF A;  3E6B A;  2F2E A;  3R4K A;  5L3C A;  4WWC A;  4I09 A;  3ML6 A;  4WXD A;  2XAG A;  4Y15 A;  1TQM A;  2HTS A;  1G4D A;  3M1E A;  2FA5 A;  3C1D A;  3GW2 A;  2LF8 A;  3J81 Z;  2BEO A;  4RAZ A;  1J59 A;  1P6R A;  2W25 A;  3I58 A;  4OIN F;  5A2Q K;  1K78 A;  2XAJ A;  3SQN A;  3BJ6 A;  3P9C A;  3DV8 A;  2W24 A;  5E18 F;  2VT3 A;  1DPR A;  1BC7 C;  4HLY A;  1RI7 A;  2KRF A;  2P5L C;  3WTY C;  3LA2 A;  4AIK A;  5DUK A;  4AIJ A;  3KFW X;  3B02 A;  2PMU A;  3GO5 A;  4HQM A;  3SZT A;  3F6O A;  1W5T A;  4R1H A;  3G73 A;  5EEG A;  5DUI A;  1BI1 A;  3KLO A;  2NNN A;  4IHT A;  4L9J A;  3TGN A;  2PFB A;  4U0V A;  1V3F A;  4UV8 A;  1KU7 A;  3NEU A;  2XKP A;  3EET A;  4DNC A;  3WU0 A;  1F4K A;  1R1V A;  2L54 A;  3F8N A;  1XGO A;  3IRR A;  3E6D A;  4P9U A;  2CW0 F;  1MDM B;  5H6Q A;  6PAX A;  4FX4 A;  1PP8 F;  5D6F A;  4M6Y A;  4KYW A;  4Q48 A;  3EUH A;  4RB2 C;  2IP2 A;  5CLS A;  2HR3 A;  3WTX C;  1BI0 A;  3T1B A;  3D0S A;  1T39 A;  3E5X A;  2P8T A;  3LQR A;  4I01 A;  3ZMU A;  1H9G A;  4ENK A;  3WG9 A;  2YX7 A;  2A68 F;  1J75 A;  4EM1 A;  3IL2 A;  4G7O F;  4WK8 F;  1QPM A;  5LHG A;  3F21 A;  4HYE A;  1S29 A;  2ZKZ A;  4K2E A;  1W4M A;  2DPU A;  2HOE A;  2GAU A;  1ZH5 A;  1ZYR F;  5FO5 A;  5E8G A;  2CSO A;  4MHG A;  2NYX A;  2P6S A;  1FX7 A;  1MJB A;  1LDK B;  5CVI A;  2JPB A;  1T38 A;  4UNO A;  4IXA A;  2V79 A;  4MQ9 F;  5LRR A;  2HQR A;  4HDV A;  3LA3 A;  3BDD A;  1WI9 A;  4PZJ A;  1O57 A;  1FSH A;  3FMQ A;  5HS7 A;  2FML A;  3IKT A;  3DEU A;  4GXO A;  2L02 A;  4EM0 B;  1O3Q A;  3TOB A;  2V6C A;  5DEQ A;  3ZMS A;  4S05 A;  3CDH A;  1FPQ A;  1OR7 A;  1WKM A;  4PCQ A;  3GXO A;  1SD4 A;  5DV5 A;  5D8K B;  2XGX A;  2QWW A;  4PGG A;  5F6F A;  5BOX A;  2CYY A;  4U0W A;  4OU0 A;  4OOI A;  1QZZ A;  1GHC A;  1P92 A;  4XSX F;  1BI3 A;  3GWZ A;  3PQJ A;  4A12 A;  3F22 A;  2CWE A;  2DI3 A;  2RC4 A;  2UXN A;  4N0B A;  1SAX A;  2OZ6 A;  3JSP A;  1KQ0 A;  2A6H F;  1KQ8 A;  4M74 A;  2A07 F;  4GO1 A;  3KP5 A;  3VOE A;  2W84 A;  3BP8 A;  1B9M A;  2STT A;  5ERI A;  1REP C;  5E1W A;  1Q1H A;  4XSZ F;  1U2W A;  5CVU A;  1XMA A;  4P96 A;  2RKH A;  1HXD A;  4KIF A;  3HOT A;  2UWM A;  2MLG A;  4P9F A;  3U9G A;  4HX7 A;  2Y48 A;  1H0M A;  3VFZ A;  2JT1 A;  1G6N A;  1NHA A;  1YW7 A;  4LB6 B;  2NNY A;  4HBL A;  1DUX C;  1Z05 A;  5LBQ A;  1YIO A;  1U8R A;  2JPC A;  1I1G A;  1RIO H;  2YSR A;  2DAO A;  3REO A;  2MA3 A;  1FYK A;  2HFH A;  2F5E A;  3P9I A;  5BPI A;  3C7J A;  4EMS A;  4WX9 A;  5IT3 A;  4KUM A;  5HOO A;  3GFM A;  4BYY A;  2HEO A;  1U5T C;  4I2O A;  2X0L A;  3HSF A;  2QLZ A;  1WRJ A;  1HBX G;  4EGY A;  4ZYH A;  3WTW C;  4RGU A;  5E1X A;  3IKV A;  5LRS A;  5F64 A;  1SD6 A;  1QBJ A;  4OIR F;  1FZP B;  1XDS A;  2DPD A;  3MAJ A;  1D8J A;  2QBY A;  3KZZ A;  3I0T A;  3E97 A;  3T0Y A;  2OBP A;  2YX4 A;  3FXQ A;  1KYZ A;  3ZPL A;  3JSO A;  2EA4 A;  4BHC A;  4L9N A;  4XLP F;  3ELK A;  1D5V A;  3F23 A;  2D1H A;  4U0Y A;  3RKY A;  3KZY A;  3FX3 A;  2FOK A;  3HRT A;  2HYG D;  4EM2 A;  4EJU A;  2K4J A;  1IW7 F;  2DBB A;  3DF8 A;  4JBA A;  4I7H A;  4I98 B;  4B09 A;  3F8F A;  1BN5 A;  4G6Q A;  2HTJ A;  4CIC A;  3F6V A;  1Z1D A;  3L2C A;  1ZRD A;  5LLQ A;  3ISP A;  1O3S A;  3KP7 A;  3MEX A;  3C3W A;  3FHZ A;  3FWE A;  5K5R A;  4ESJ A;  1X3U A;  2GZW A;  4HZF A;  1BJA A;  4EJT A;  1HQC A;  4LMY A;  3LWF A;  3FMS A;  2O61 A;  5H20 A;  3ZMV A;  4ZYE A;  2VE8 A;  1FOK A;  2G9W A;  2HWV A;  2CQK A;  2COM A;  2D1V A;  3I54 A;  4G94 A;  2YPR A;  4G8X A;  4MEY F;  3WE2 A;  1IF1 A;  2FU4 A;  2P5K A;  2PMH A;  3OOP A;  4HF0 A;  4EVI A;  3ECH A;  3L00 A;  1LB2 A;  5K5O A;  1ZHF A;  3WGI A;  1BC8 C;  3SHF A;  2KIM A;  3L09 A;  3Q5F A;  4A5N A;  2C6Y A;  4L9T A;  4L0Y B;  4KFC A;  4PDK A;  1V4R A;  3WTS C;  2PI0 A;  5JI6 A;  4L5J A;  2IA0 A;  3E6M A;  2FMY A;  2K27 A;  2ZFW A;  1USS A;  2W85 A;  1FYM A;  1DPU A;  1O3R A;  1TBX A;  1JXS A;  1Z6T A;  5FGM A;  1B4A A;  5LHI A;  4KIB A;  4GCV A;  2P5V A;  2XHK A;  3WOD F;  1R58 A;  2VBX A;  1XMK A;  4CXF A;  2XAS A;  1TNT A;  5L3G A;  5CVJ A;  1GVJ A;  1B9N A;  2MC3 A;  2J5O A;  2CFX A;  3HHH A;  3T8R A;  2M1B A;  4LLL A;  4R79 A;  1HW1 A;  2ZME A;  1K79 A;  2L4M A;  1DP7 P;  3QPT A;  2PLY A;  2VXZ A;  1PDN C;  2L4A A;  4A6E A;  4EQQ A;  2IJL A;  3HIF A;  3I59 A;  3LAP A;  4XBF A;  2Z9O A;  3CLO A;  3KP2 A;  4I0B A;  1PP7 U;  3V8J A;  2DK8 A;  1G3T A;  1U6G A;  3CUO A;  2STW A;  3ABU A;  2OD5 A;  1HW5 A;  2H6C A;  2VBZ A;  5IT9 Z;  5FB2 A;  4KNY A;  3M7G A;  2IRF G;  4BXU A;  2LF7 A;  2GXB A;  2VBW A;  2MLK A;  1FLI A;  4RAY A;  3GX4 X;  1MGT A;  3TKY A;  1R22 A;  3QU3 A;  1W7P D;  3M8F A;  5DCM B;  1YS6 A;  2GA1 A;  4OIO F;  3RDI A;  1LEA A;  3GFL A;  2TDX A;  3I71 A;  3LST A;  2PEX A;  3MZY A;  2LKP A;  2K02 A;  1SFX A;  2ADU A;  1ZLK A;  3HTS B;  3ERE D;  3K1P A;  4M6X A;  1ZAR A;  5KVR A;  4IRG A;  1OYI A;  1MJA A;  3J80 K;  2FXA A;  3KLN A;  3WTU C;  2XKO A;  3ZMZ A;  4L0Z B;  1HKT A;  1F1Z A;  1KU9 A;  2HKO A;  2OA4 A;  4A0X A;  3JTH A;  2OZU A;  2HDC A;  2WV0 A;  1P4W A;  2O03 A;  5J8C A;  1IAW A;  4ZH4 F;  2M45 A;  4O3M A;  1KGS A;  3I53 A;  4ZYG A;  3COA C;  4EJV A;  5BPD A;  1ODD A;  3I59 B;  4NHJ A;  2HS5 A;  2ZBK A;  1R00 A;  3RPQ A;  4WF2 A;  4MTD A;  2EJR A;  2NS0 A;  1U5T A;  4Q5S F;  1ZRC A;  2EWN A;  5D5U B;  1AWC A;  4JQF A;  3QRF F;  1ON2 A;  1SD5 A;  3I5U A;  3J7A O;  3HTU A;  1XSD A;  1LQ1 A;  1LNW A;  3IRQ A;  1IXR C;  1A04 A;  3Q9V A;  3EQL F;  3H3U A;  1K6O A;  4U7D A;  3JAM K;  4G6D A;  4BNC A;  2JTV A;  4ESB A;  1BM9 A;  3F72 A;  2PQ8 A;  2Z99 A;  4BQA A;  3H92 A;  1HSJ A;  4WXH A;  2KJB A;  2CO5 A;  5FD5 A;  1D3Y A;  5HVQ C;  3CUQ C;  4G7H F;  5L3F A;  4L18 B;  1YO5 C;  1CF7 B;  2RVC A;  4A2U A;  1I1S A;  2XAH A;  2FRH A;  2MH2 A;  4XLN F;  2G7H A;  2VC0 A;  2M30 A;  4EV0 A;  2L3D A;  3KP3 A;  4KN4 X;  1I6X A;  3F8M A;  2CGP A;  3O3K A;  2B0L A;  2AXL A;  1T2K A;  1S3J A;  2ETH A;  1ULY A;  2XRO A;  1R7J A;  2QQB A;  2IVM A;  4IHS A;  2KIF A;  3L7W A;  1ZGA A;  1B6A A;  2UZK A;  2V1X A;  3NRV A;  2ZNY A;  3SXY A;  5D5W B;  2WTE A;  2RNJ A;  1XB4 A;  2O3F A;  2F5C A;  3EYY A;  2RV8 A;  4DQ2 A;  2YR2 A;  3N97 A;  3VOD A;  4KT5 C;  3DQV C;  2DQL A;  3P9K A;  3V8K A;  2K4B A;  2GXG A;  4IJA A;  1Z9C A;  1IUY A;  1U5T B;  3K0L A;  2LNB A;  5CYV A;  4UVC A;  4UUV A;  3TO6 A;  2KKO A;  2O8X A;  2D2W A;  5ED4 A;  3LA7 A;  4UXN A;  2FBH A;  4GYG A;  3K69 A;  1EV7 A;  3M8E A;  2W57 A;  1XD7 A;  3K2Z A;  3QOP A;  3MQ0 A;  1LEB A;  1QQI A;  4GGG A;  1S8N A;  1FT9 A;  4E70 A;  1MKM A;  4RS8 A;  4O5V A;  2J5P A;  2Z33 A;  4U7B A;  2XRN A;  4LGW A;  3V7S A;  5JFR A;  2DFI A;  5J8F A;  2EFW A;  2MD5 A;  5DD4 A;  1TNS A;  3ECO A;  4LB5 A;  3RYP A;  4WCG A;  3BOQ A;  1MD0 A;  2R3S A;  5BMZ A;  1XDU A;  3E5U A;  4AD9 A;  1UST A;  5FLX Z;  3DPT A;  4OMY A;  3C18 A;  1UFM A;  2O6G E;  2M87 A;  4AVP A;  4MTE A;  1W5S A;  4AIH A;  4ENN A;  1ZLJ A;  5D8L B;  3AAF A;  2QQ9 A;  1FBU A;  1STZ A;  1OPC A;  1ONV A;  4Y17 A;  2XAF A;  3RTR A;  3HYI A;  2H94 A;  4HAM A;  2DO7 A;  5HS8 A;  5HLI A;  4A5M A;  2GA2 A;  4TV7 A;  3LAJ A;  2M5W A;  4MNU A;  3RKX A;  4RGS A;  1QNT A;  5CVR A;  1LVA A;  3GZ5 A;  3DPL C;  4UVA A;  1MJ9 A;  2FSW A;  2MBF A;  4AWX B;  2FNP A;  2WC2 A;  1UB9 A;  3GFJ A;  2VBY A;  4HQE A;  1IN8 A;  3WGH A;  3RI4 A;  2DU9 A;  2RN7 A;  1YQA A;  4HX8 A;  3WE3 A;  3HRU A;  3R61 A;  2QZ8 A;  3HRM A;  1XGN A;  2A5Y B;  1K78 B;  1R1T A;  3D5L A;  2QVO A;  2ISY A;  3JW4 A;  2PN6 A;  2NAZ A;  1G3Y A;  2FBK A;  5LGN A;  2BGC A;  3PFI A;  3NQO A;  4XRF A;  2VT2 A;  1XSV A;  1T0F A;  1SD7 A;  1TTY A;  1W7P B;  4YIF A;  3QP6 A;  2ISZ A;  4HOB A;  4LK1 F;  2JRT A;  3H3Z A;  2DTR A;  3IWF A;  4UV9 A;  2QM3 A;  3GLX A;  4A6D A;  3CUQ A;  4OIP F;  3BPV A;  1T98 A;  2UXX A;  5BS6 A;  3GEZ A;  1ZG3 A;  2JSC A;  3I64 A;  4M73 A;  4KIC A;  3TOA A;  4ZZD A;  1LJ9 A;  4O6J A;  2P4W A;  1R5G A;  2HGC A;  1MDM A;  2QUF A;  2EB7 A;  2GWR A;  3HHG A;  3R0J A;  1XGS A;  4CYD A;  1XCB A;  4ON0 A;  3ABT A;  3GF2 A;  4ENJ A;  4Q47 A;  1KQ9 A;  1OYY A;  3ZN1 A;  5ICF A;  2EFQ A;  2K7L A;  2EK5 A;  3J80 Z;  1K7A A;  4RB0 A;  3QAH A;  3U2R A;  1D8K A;  1G3W A;  1IN5 A;  2IT0 A;  2Q0O A;  5ICC A;  2QEN A;  5F1R A;  2V1D A;  4FX0 A;  1UCR A;  3EYI A;  4H0E A;  2FE3 A;  1BOA A;  3WTZ A;  3V7R A;  2A3S A;  3M9A A;  1KU2 A;  3DFG A;  1IN6 A;  1BIA A;  2AS5 F;  1FP2 A;  1QO0 D;  5D6E A;  5AIQ A;  5DYM A;  4HDU A;  2EV0 A;  2HQN A;  2E1N A;  2R7F A;  1IZ1 A;  5E8I A;  3BZ6 A;  5HDK A;  3IC7 A;  3HSR A;  4IRH A;  3W6K B;  1ZG5 A;  4CDG A;  2IA1 A;  2FF4 A;  5ILS A;  2KJC A;  5ICE A;  4QLC U;  4EGZ A;  4LD5 A;  1IRG A;  1BIB A;  4LG0 A;  1YG2 A;  4R8H A;  2Y0M A;  4IPA A;  3GZ6 A;  1W7P A;  4ZYD A;  3DKW A;  4L9V A;  3PQK A;  1KYW A;  1ON1 A;  4P5O A;  5FLX K;  3CUQ B;  2EFO A;  1PUE E;  1VTN C;  2VON A;  3ZN0 A;  1BBY A;  3FXR A;  4CZZ A;  5D4R A;  3CO6 C;  1SMT A;  1I27 A;  4ZZL A;  5A2Q Z;  2QBY B;  1MZB A;  3E3V A;  4ENM A;  2ZJ2 A;  3KP4 A;  3V8L A;  2P6T A;  4M9S A;  5HS9 A;  5E20 A;  2K86 A;  2OAZ A;  4L5I A;  4PGH A;  2ZXJ A;  1FBQ A;  3KCC A;  4Z2Y A;  1R23 A;  1WSU A;  2E7W A;  1JHF A;  3MWM A;  1FBS A;  3O6B B;  1O3T A;  1FY7 A;  3F3X A;  3S2W A;  2OQG A;  2P7V B;  4A0Z A;  5D4S A;  3TQN A;  3RJP A;  2XV4 S;  3F8B A;  5ICG A;  1B1B A;  4MEX F;  3RYR A;  1ZN2 A;  2HYF A;  2H6B A;  5L3D A;  5LHH A;  1UHW A;  1HW2 A;  5LEJ A;  1J7K A;  1R5H A;  2LDU A;  4IVN A;  2VN2 A;  3EDP A;  3TDU C;  4IRI A;  2VE9 A;  1RUO A;  3CO7 C;  3KET A;  3TO7 A;  2EFP A;  2EFN A;  1O7L A;  2IW5 A;  1SFU A;  1YTY A;  4LG0 B;  4GYI A;  5K1Y A;  1I5Z A;  1R1U A;  4RB3 C;  3DP7 A;  4LFU A;  2ELH A;  2PBI A;  3WGG A;  1RUN A;  2DK5 A;  2BBY A;  2WWY A;  5LEK A;  3K1M A;  4JK1 X;  3T8T A;  3MCZ A;  3R6S A;  2H27 A;  1YW8 A;  4LK0 F;  3KEQ A;  3FM3 A;  2X4H A;  4LJZ F;  3ROU A;  2A6E F;  5JVT A;  2ESN A;  4B8X A;  2DLL A;  2CG4 A;  2DQR A;  1S7A A;  3FM5 A;  1R36 A;  2FBI A;  3JAM Z;  4HF2 A;  2V1U A;  4Y13 A;  3DXJ F;  1IXC A;  5D5V B;  4YII A;  5BQT A;  3TDZ C;  4M71 A;  3CTA A;  1YYV A;  4OMZ A;  1S7O A;  3HOS A;  1HKQ A;  2F5D A;  3FMR A;  2BV6 A;  4QWQ A;  5HLG A;  3KEO A;  5EEH A;  3E5Q A;  2EA2 A;  4FHT A;  3ZP5 A;  1L0O C;  2GIV A;  1GXP A;  1XSX A;  1QZY A;  3FZV A;  4MQV A;  3ZMT A;  1IRF A;  1JE8 A;  2OQR A;  4P55 A;  4UVB A;  1E2X A;  4LLN A;  1TW2 A;  3E6C C;  3N4M A;  5LGU A;  2DT5 A;  1OYW A;  4A0Y A;  1EH6 A;  3KP6 A;  3FXU A;  3V4G A;  1RNL A;  4I0A A;  4BHB A;  2OU2 A;  3B73 A;  3VB2 A;  1FP1 D;  1XN7 A;  3OV8 A;  5CVV A;  4RGR A;  1SMY F;  5ILU A;  2ZNZ A;  2FNA A;  1P4A A;  1YLF A;  2RDP A;  3ZQ7 A;  3BPX A;  2A69 F;  2M8E A;  1ZRF A;  1FC3 A;  4HLX A;  1LDJ A;  1Y0U A;  1YS7 A;  1FSE A;  2XVC A;  4I02 A;  4BAY A;  2ACJ A;  2RQP A;  4Q4Z F;  2EV5 A;  5HDG A;  1Z91 A;  1ZG1 A;  2O0Y A;  5DCM A;  1E17 A;  1ZGJ A;  5TJJ A;  4YFN F;  3V7C A;  3HSE A;  5DCF A;  4ESF A;  3LFK A;  1P4X A;  4HV6 A;  3GYH X;  2IPQ X;  3WU1 B;  3QPH A;  2JZY A;  1AOY A;  2Q8K A;  1J0R A;  1J9I A;  1TW3 A;  3KE2 A;  3BWG A;  5J6X A;  2YU3 A;  4HA8 A;  4RGX A;  3QU6 A;  1IXS B;  3ZMD A;  3SFZ A;  1TQP A;  4YFK F;  1UHM A;  5AON A;  3GFI A;  3U1D A;  5H6R A;  2LSO A;  3WTT C;  2FEZ A;  4NB5 A;  2VOO A;  4BH9 A;  4S04 A;  1FYL A;  5CJ9 A;  1ZRE A;  4U88 A;  3BJA A;  5TRD A;  3JTG A;  1IN4 A;  1O7F A;  2VOD A;  4KN7 X;  2HKX A;  1EH7 A;  4KDP A;  3FF5 A;  5ILV A;  4MGR A;  3P7N A;  2NRA C;  2ZME B;  1WWX A;  4ETS A;  1FWZ A;  4CGZ A;  1SFE A;  1H9T A;  1HST A;  3MFK A;  3R60 A;  4CHU A;  3R0A A;  3O2P E;  3IWZ A;  1LDD A;  3SZP A;  3CJN A;  5JR3 A;  5FFZ A;  4BHP A;  5K5Q A;  2F5F A;  2H09 A;  4YG2 F;  5HDN A;  3ULQ B;  4G9Y A;  4WXC A;  3HUG A;  5IT9 K;  3G3Z A;  5E17 F;  4CO8 A;  1Z7U A;  1OKR A;  2PG4 A;  2A61 A;  2FQ3 A;  3W6J B;  1C0W A;  1KA8 A;  4F7Z A;  2Z5U A;  3BY6 A;  5LGT A;  2R7D A;  5HLH A;  3GVA A;  2RGV A;  2XIG A;  2PJP A;  2KIU A;  3K9T A;  5DD8 A;  5FD6 A;  1FNN A;  2ZCW A;  1U3E M;  3RIR A;  1CF7 A;  4M9Z A;  5L3E A;  3VEP A;  3F8C A;  4RB1 A;  4ASN A;  3L9F A;  1Z6R A;  1G3S A;  1OMI A;  4G7Z F;  2HZT A;  3GUD A;  4YFX F;  1TLH B;  5L3B A;  2IA2 A;  3IHU A;  4HW0 A;  1HKS A;  2MH9 A;  5DDG A;  2Y75 A;  4OIQ F;  1YW9 A;  3HRS A;  2XUB A;  4HX4 A;  5D5X B;  2V9V A;  2Q2E A;  3I4P A;  3K1N A;  2D45 A;  1F5T A;  2VOP A;  5KK1 A;  2QYO A;  3RPU A;  1XGM A;  2E1C A;  2QQA A;  1L3L A;  5AIP A;  4HV5 A;  2VC1 A;  2BYV E;  4D0P A;  4KA4 A;  2Z3Y A;  4KIG A;  2ESH A;  1P2F A;  1IN7 A;  1XCV A;  1DDN A;  1U78 A;  1YFH A;  1J2X A;  1ZAO A;  4EJW A;  4EJO A;  3Q9S A;  1RZ4 A;  4M72 A;  2BE5 F;  4LLG F;  1B59 A;  1WQ2 A;  2L01 A; 
#chains in the Genus database with same CATH topology
 3BR2 A;  2XGC A;  4IHY A;  1QGP A;  2LP0 A;  2KHM A;  3RZD J;  2ZFU A;  4NQW A;  1GXQ A;  2EV6 A;  3HUG B;  1T95 A;  2P7C B;  4XK4 A;  4IF4 A;  4OAY A;  4UUS B;  1PUF A;  1X1D A;  2KIS A;  2ME0 A;  3MZH A;  4HF1 A;  1HA8 A;  2R7X A;  5GAD J;  1WGX A;  1JHH A;  2ZO4 A;  3WTV C;  5JLW A;  1EH8 A;  3BJO A;  2E60 A;  4UHT A;  5EG0 B;  1CGP A;  1R6R A;  3LSH A;  4KMU X;  1N77 A;  1S6L A;  4FT8 A;  3BRO A;  1F9N A;  4PK4 A;  3RKW A;  4ZYA A;  1S72 I;  4NC6 A;  2GQQ A;  4N9I A;  2M34 A;  5LFA A;  2JQ7 A;  3CMM A;  3J81 K;  4M9X A;  3H1C A;  2XAQ A;  2DW4 A;  2V1N A;  2LFB A;  3PJR A;  3T5X A;  3QP5 A;  1T6S A;  1BI2 A;  1Z0X A;  4N9H A;  3TO9 A;  4XRM A;  1QA6 A;  1TQI A;  2E7X A;  4BAC A;  1JGS A;  5E1Z B;  1KU3 A;  1BW5 A;  5JHU A;  2WAE A;  2R7V A;  1J5Y A;  1D0Y A;  1YOV B;  1TZL A;  1ZR2 A;  2G7U A;  3VSL A;  1VQ6 I;  5FFX A;  2ZC2 A;  1BR1 A;  3LQQ A;  1RPW A;  2BY1 A;  3MKZ A;  3VPR A;  4KMF A;  4IO9 F;  3E6B A;  3IAM 2;  1TWF J;  2F2E A;  2XB5 A;  3KYL A;  2IS1 A;  4XIC A;  3R4K A;  5L3C A;  4WWC A;  4AYB N;  4JX6 A;  4I09 A;  4PSX A;  1HF0 A;  3K7A J;  1UEL B;  3ML6 A;  3JRD A;  2ZJQ F;  4WXD A;  1XG1 A;  2XAG A;  2VQL A;  4Y15 A;  1LKX A;  5FRM A;  2JA2 A;  4G6T B;  4BE1 A;  3CCJ I;  2GIZ A;  5GAE J;  1TQM A;  2HTS A;  3H36 A;  1G4D A;  2OV7 A;  2AQF A;  3M1E A;  1X2N A;  2FA5 A;  3C1D A;  3GW2 A;  2L7M P;  4FQG A;  2LF8 A;  3K4K A;  3J81 Z;  1TWA J;  2BEO A;  4RAZ A;  1J59 A;  1P6R A;  2W25 A;  1SAU A;  2E35 A;  1T33 A;  4BEH B;  4CUG A;  5F0H A;  2CUF A;  3I58 A;  4OIN F;  1HDD C;  5A2Q K;  2Y0S N;  1K78 A;  2XAJ A;  5HLT A;  3SQN A;  3BJ6 A;  3CCL I;  3C2G A;  2EIN H;  2MD0 A;  2I10 A;  3W2V A;  3P9C A;  3DV8 A;  3CMY A;  4IKF A;  1X1C A;  2W24 A;  3B6C A;  1FEX A;  2ZB9 A;  3OYD A;  5E18 F;  2L0K A;  2VT3 A;  1DPR A;  3C2H A;  1BC7 C;  2E2I J;  4ANJ A;  1RI7 A;  4HLY A;  3W6V A;  2KRF A;  4AM3 A;  2P5L C;  3WTY C;  4HPQ A;  4E7Z A;  3S3M A;  1K61 A;  3OYH A;  3LA2 A;  4AIK A;  4M6V A;  5DUK A;  4AIJ A;  1IUF A;  5J47 A;  3KFW X;  2COB A;  3B02 A;  2PMU A;  3GO5 A;  4HQM A;  4BL0 B;  3SZT A;  3F6O A;  1W5T A;  4R1H A;  3G73 A;  3ERM A;  5EEG A;  2LKS A;  5DUI A;  1BI1 A;  3KLO A;  1ZEL A;  2JVH A;  5K7H A;  1D1B A;  2NNN A;  3BTJ A;  4IHT A;  3CCS I;  4L9J A;  3TGN A;  1E3H A;  2PFB A;  4D1Q A;  2IS4 A;  1MH3 A;  1TL8 A;  1WPK A;  2K3F A;  4U0V A;  3CF2 A;  4IEJ A;  1Y6I A;  1V3F A;  4UV8 A;  1KU7 A;  2BW3 B;  2XB0 X;  2DA3 A;  3NEU A;  2XKP A;  2CU7 A;  3GTP J;  3EET A;  4DNC A;  3WU0 A;  1F4K A;  1R1V A;  3RKQ A;  1VQO I;  4XL9 A;  1XX5 A;  2L54 A;  3F8N A;  3EPZ A;  2MC4 A;  1XGO A;  3S14 J;  3IRR A;  3E6D A;  4P9U A;  2CW0 F;  4Y52 J;  2AXT C;  3A02 A;  1WJD A;  3LNQ A;  1MDM B;  1B72 A;  5H6Q A;  1Y0N A;  4A3B J;  4A93 J;  6PAX A;  4FX4 A;  2OUM A;  3FK6 A;  4C2U A;  4GFB A;  3KEY A;  1YX5 A;  3JR9 A;  1PP8 F;  5D6F A;  4M6Y A;  2JA6 J;  4KYW A;  1X3W B;  2DA5 A;  3CF5 F;  4Q48 A;  3EUH A;  2IP2 A;  4RB2 C;  5CLS A;  4F91 B;  2HR3 A;  3WTX C;  1BI0 A;  1VQ8 I;  4XLC A;  3T1B A;  4ZTJ A;  1LFB A;  3D0S A;  3JRA A;  1T39 A;  3E5X A;  2P8T A;  3LQR A;  4I01 A;  4V2F A;  3ZMU A;  1JI8 A;  2MAB A;  1H9G A;  5J3L A;  3WG9 A;  4ENK A;  1HDP A;  2YX7 A;  2A68 F;  1J75 A;  4EM1 A;  3IL2 A;  4G7O F;  2VQH A;  4WK8 F;  3UR3 C;  1LFU P;  3ZQI A;  2RNG A;  1QPM A;  5LHG A;  2X6X A;  3F21 A;  1SAN A;  3HDD A;  3G71 I;  4HYE A;  2M8G X;  1S29 A;  1P7J A;  2ZKZ A;  3RZO J;  3TBI A;  4K2E A;  1W4M A;  4E7K A;  5FKK A;  5M5W J;  4JOM A;  3FXO A;  2R7U A;  2DPU A;  5HOD A;  2ZXI A;  1VND A;  2HOE A;  1MMN A;  4FIS A;  1S7E A;  2GAU A;  1ZH5 A;  1ZYR F;  1ZTR A;  5FO5 A;  2R5Y B;  3S2D J;  5E8G A;  4FAS D;  2CSO A;  3M07 A;  4MHG A;  2OCE A;  3EUH C;  3OYC A;  2NYX A;  2P6S A;  5EZG A;  3Q3S A;  4D7N A;  1FX7 A;  4A3K J;  1MJB A;  1LDK B;  5CVI A;  2JPB A;  1T38 A;  3O8H A;  3PSF A;  3DWL E;  2ECC A;  1SVL A;  4UNO A;  4IXA A;  2IGO A;  1AHD P;  2V79 A;  3PIO F;  4MQ9 F;  2I8D A;  2Y0S A;  1SFK A;  5LRR A;  2HQR A;  4HDV A;  4XQF A;  3LA3 A;  2O7O A;  3CME I;  3S2H J;  2IEK A;  1UJ8 A;  3BDD A;  1WI9 A;  2LYC A;  5EJC A;  4QTR A;  4HNT A;  2I5U A;  4PZJ A;  3HL2 A;  1O57 A;  3E0J B;  1FSH A;  2ZME C;  3FMQ A;  2ID6 A;  2LMD A;  2HU9 A;  1R5I D;  2AQE A;  5HS7 A;  2FML A;  3IKT A;  1IV8 A;  3DEU A;  4GXO A;  1QVU A;  1YRN A;  1S9H A;  1Z7L A;  4EAT A;  2KLO A;  2L02 A;  5GAH J;  4EM0 B;  1O3Q A;  3TOB A;  2V6C A;  1D0Z A;  1DQU A;  5DEQ A;  3ZMS A;  3VYT B;  4S05 A;  3CDH A;  3HOV J;  3CQZ J;  3ZQL A;  1FPQ A;  1OR7 A;  2GBY A;  2KP6 A;  1WKM A;  3A4C A;  4PCQ A;  1LPQ A;  3GXO A;  1SD4 A;  5DV5 A;  4A3G J;  5D8K B;  5CKT A;  3FXK A;  5J1U A;  2XGX A;  1NG7 A;  2QWW A;  4PGG A;  2X1C A;  5F6F A;  2CYY A;  3MZ8 A;  4U0W A;  5BOX A;  3DBR B;  5FKL A;  4OU0 A;  4OOI A;  5TGT A;  1QZZ A;  1GHC A;  1JTY A;  4A3E J;  4A69 C;  1MMA A;  2HOA A;  1ETY A;  1P92 A;  5IP6 A;  4XSX F;  4ITV A;  1BL0 A;  2MFZ A;  1BI3 A;  3GWZ A;  1A31 A;  3ASO H;  3PQJ A;  4A12 A;  3F22 A;  2L9N A;  2CWE A;  2DI3 A;  2RC4 A;  2UXN A;  3QYE A;  4X6A J;  1NTC A;  2LY2 A;  4N0B A;  1SAX A;  2OZ6 A;  3JSP A;  1FIP A;  1KQ0 A;  1QU3 A;  2A6H F;  1KQ8 A;  1Z3Y A;  4M74 A;  1K4S A;  2A07 F;  4F52 A;  1RKT A;  4GO1 A;  3KP5 A;  4C3H J;  2O9L A;  3VOE A;  2ZXW H;  2W84 A;  2M3A A;  3BP8 A;  1HLV A;  5IYD J;  1B9M A;  2Y9Z A;  2STT A;  4RBO A;  5ERI A;  4RM3 A;  1REP C;  5E1W A;  2FX0 A;  1Q1H A;  4XSZ F;  1U2W A;  3CCU I;  5CVU A;  1XMA A;  4P96 A;  3MD2 A;  2BVL A;  4CCJ A;  2RKH A;  1HXD A;  4KIF A;  1X2M A;  3HOT A;  2UWM A;  2MLG A;  1GVD A;  4P9F A;  3U9G A;  3K10 A;  3I55 I;  4HX7 A;  3BG7 A;  2IGN A;  2Y48 A;  5C4J J;  4BE2 A;  1H0M A;  3VFZ A;  1DU0 A;  2JT1 A;  4DZP A;  4AU7 A;  1G6N A;  5IYB J;  3OYN A;  1NHA A;  2ELJ A;  2EZK A;  3NAR A;  4IOC F;  1Z21 A;  1YW7 A;  3OYF A;  4LB6 B;  4M3E A;  2VI6 A;  1WJC A;  2DCE A;  2HDW A;  4P1W A;  2M4K A;  2NNY A;  4HBL A;  1DUX C;  1Z05 A;  5LBQ A;  1ZQ3 P;  3GTL J;  1YIO A;  5FLM J;  4G12 A;  3BZC A;  1K6Y A;  2NOG A;  1X4P A;  2JPC A;  4BEH A;  5IYC J;  1U8R A;  1I1G A;  1RIO H;  3AL0 C;  5J4V A;  2YSR A;  4D5F A;  2DAO A;  3REO A;  1RR8 C;  2MA3 A;  3CZ6 A;  1FYK A;  2HFH A;  2F5E A;  3HZJ A;  3P9I A;  3MKW B;  5BPI A;  1D0X A;  2LG4 A;  5K7Z A;  2E2J J;  3C7J A;  4EMS A;  5DM6 F;  4WX9 A;  4CCL A;  5IT3 A;  2FQ4 A;  4KUM A;  5BNG A;  5HOO A;  3GFM A;  2NS8 A;  4M3B A;  4XKV A;  4BYY A;  2HEO A;  1U5T C;  4I2O A;  4XM3 A;  2X0L A;  1OCC H;  3HSF A;  2QLZ A;  5FKN A;  2CMP A;  1YJW I;  1WRJ A;  2XPU A;  3LMM A;  2ME6 A;  2HZD A;  3BZK A;  3SDB A;  3HC7 A;  5GPC A;  4YEL A;  1HBX G;  4EGY A;  4XLH A;  2VIX A;  1X19 A;  4B1R A;  1I3Q J;  5KCM A;  1R49 A;  4ZYH A;  3WTW C;  4RGU A;  3IKV A;  1Y8Q B;  2E71 A;  1BJZ A;  1OCO H;  3HBL A;  5E1X A;  4J01 A;  5FRO A;  5LRS A;  4XOP A;  4FET A;  4C30 A;  1YIJ I;  2RRE A;  5F64 A;  1SD6 A;  1QBJ A;  1TC3 C;  4W97 A;  4OIR F;  5FKM A;  1XDS A;  3VYS B;  1FZP B;  3LSG A;  2VLA A;  1FTT A;  4Z6Y A;  2DPD A;  1IRZ A;  3MAJ A;  1AU7 A;  2HDD A;  3JRF A;  3L2R A;  1D8J A;  2QBY A;  3AL0 B;  3KZZ A;  1RRJ A;  2BXZ A;  3H5N A;  3I0T A;  2R7O A;  3E97 A;  3T0Y A;  4BQN A;  2DMN A;  2OBP A;  2YX4 A;  4DBR A;  3FXQ A;  1KYZ A;  2XF6 A;  4DIQ A;  3ZPL A;  4E6K G;  3JSO A;  1EF4 A;  3OYE A;  1KON A;  2L7Z A;  1WCM J;  1YI2 I;  2EA4 A;  1HC8 A;  3CCV I;  4B44 A;  3S17 J;  4BHC A;  4L9N A;  4XLP F;  3ELK A;  1U8B A;  1D5V A;  2HXI A;  3F23 A;  2D1H A;  1LVK A;  3H9J A;  4U0Y A;  2KQR A;  3RKY A;  3A0B C;  3FX3 A;  2FOK A;  3KZY A;  2LKX A;  1NK3 P;  2DYR H;  3HRT A;  2HYG D;  4N4N B;  4EM2 A;  2K4J A;  4EJU A;  1IW7 F;  1JTX A;  2DBB A;  3DF8 A;  2KZG A;  4JBA A;  4I7H A;  3Q0U A;  4I98 B;  3B6A A;  2K9S A;  1LE8 B;  2K3P A;  2R5Z B;  1H88 C;  4B09 A;  3F8F A;  2O8K A;  1BN5 A;  2HQA A;  2A05 A;  4G6Q A;  2HTJ A;  4CIC A;  3F6V A;  2UUZ A;  1VQK I;  1Z1D A;  2X6Y A;  3HG9 A;  3L2C A;  1ZRD A;  2GM4 A;  1IGN A;  3ABL H;  1MW7 A;  2CW8 A;  2KMU A;  5LLQ A;  3ISP A;  1O3S A;  4U87 A;  1FMV A;  2L7K A;  3KP7 A;  3MEX A;  3H5A A;  1A5J A;  3C3W A;  2R7Q A;  4IHW A;  3FHZ A;  3FWE A;  5K5R A;  3A2K A;  4ESJ A;  1X3U A;  2GZW A;  4BJT A;  2VQG A;  3S3N A;  1WZ2 A;  4HZF A;  1BJA A;  4EJT A;  3C2B A;  1HQC A;  4LMY A;  2VJ4 A;  3LWF A;  3FMS A;  2O61 A;  2QEX I;  5B1B H;  5H20 A;  3ZMV A;  1UHS A;  4ZYE A;  2VE8 A;  3BTI A;  2EIJ H;  1FOK A;  5IOZ A;  1P9Q C;  3W2W A;  2E1M C;  2G9W A;  2HWV A;  1V54 H;  2CQK A;  5B1A H;  4BUP A;  2COM A;  1G2H A;  2D1V A;  1MMD A;  1IJW C;  4BBR J;  3I54 A;  4G94 A;  2OF7 A;  3BR3 A;  3SEZ A;  3VDX A;  2ICW G;  3LSP A;  1VQ7 I;  2QSH X;  5J4Y A;  2YPR A;  4G8X A;  4MEY F;  3WE2 A;  1IF1 A;  2WB1 A;  2FU4 A;  2P5K A;  2PMH A;  4B3X A;  3OOP A;  3DBH B;  3OIO A;  4HF0 A;  2JN6 A;  3H35 A;  4EVI A;  3ECH A;  3L00 A;  1JJ6 C;  1LB2 A;  5K5O A;  3OYI A;  1ZHF A;  1MND A;  2GOM A;  2IBD A;  4OWR B;  4UB6 C;  1YRN B;  4DYC A;  3WGI A;  2F4O B;  2CUE A;  2X1E A;  3LSR A;  1BC8 C;  3HGY A;  3SHF A;  3CMA I;  3DKY A;  2KIM A;  3BR6 A;  2JK3 A;  3L09 A;  3Q5F A;  5M5X J;  4A5N A;  1A36 A;  2C6Y A;  4L9T A;  3FIW A;  4L0Y B;  4KFC A;  4PDK A;  1JKO C;  2E1O A;  1V4R A;  1Z77 A;  3WTS C;  2PI0 A;  4N4O B;  5JI6 A;  4L5J A;  1VQ5 I;  3G1L A;  2LR8 A;  3N05 A;  2JA5 J;  4B3A A;  2IA0 A;  4CH7 A;  3OIP A;  3E6M A;  4YRV A;  3JRH A;  1S5L C;  2FMY A;  3OR2 C;  2K27 A;  3IV5 A;  1ETO A;  3S3O A;  5DS9 A;  5FJ8 J;  3HOW J;  2W7N A;  2MW8 A;  2M7A A;  3GTG J;  2ZFW A;  3HKZ N;  3JCU C;  1ETQ A;  1USS A;  2W85 A;  3KYC B;  1VQP I;  2QQ8 A;  4UB8 C;  1FYM A;  4ZDO A;  4L5E A;  4CCN A;  3BG9 A;  4MO7 A;  1DPU A;  3OSF A;  1O3R A;  2P81 A;  3ABM H;  1TBX A;  1JXS A;  4XKC A;  1QRY A;  1Z6T A;  2DMU A;  2KDO A;  3CC2 I;  3CDL A;  4W1U A;  1NH3 A;  5FGM A;  1LE8 A;  1AA7 A;  1G8X A;  1B4A A;  1VZ0 A;  3RPU D;  5LHI A;  2R5Z A;  2R7W A;  4BBS J;  2Y30 A;  4KIB A;  4GCV A;  2P5V A;  2XHK A;  3WOD F;  2MG4 A;  1FMW A;  2F4M B;  5GP9 A;  1TP4 A;  1R58 A;  1UG2 A;  2VBX A;  1MBK A;  1XMK A;  2XAS A;  1TNT A;  2FOW A;  4CA0 A;  5L3G A;  4CXF A;  3CCR I;  5CVJ A;  1GVJ A;  1B9N A;  3CDI A;  1QHH D;  2MC3 A;  4F92 B;  3JRI A;  2J5O A;  2CFX A;  3IH2 A;  3HHH A;  3GTO J;  3T8R A;  4FTH A;  2M1B A;  1MBG A;  4LLL A;  2VJI A;  1HW1 A;  2ZME A;  3BT9 A;  2EIL H;  2L4M A;  1D1A A;  4R79 A;  1K79 A;  5B5E C;  1JGG A;  2YU9 J;  1LUJ B;  3FBI B;  2JVG A;  1DP7 P;  4QIW N;  3QPT A;  3K4N A;  2PLY A;  2VXZ A;  1EKE A;  3ONQ A;  3ESW B;  3OOU A;  1PDN C;  4XOT A;  2L4A A;  2K9M A;  4A6E A;  2QKL B;  2LBF B;  4EQQ A;  2IJL A;  3HIF A;  4HRI A;  3I59 A;  3LAP A;  4JYK A;  3U1K A;  4XBF A;  1JT6 A;  2H1K A;  2Z9O A;  4II3 A;  3CLO A;  3KP2 A;  5C3E J;  4I0B A;  1PP7 U;  4A3C J;  3V8J A;  2DK8 A;  4RAG A;  1G3T A;  1U6G A;  3H9G A;  3CUO A;  5J1Y A;  3TL4 X;  2STW A;  5C4X J;  3ABU A;  2QGU A;  3W2A A;  2OD5 A;  2Q1Z B;  2CH0 A;  1HW5 A;  2BY3 A;  2H6C A;  2VBZ A;  2DT6 A;  3EUA A;  3CD6 I;  5FLV A;  4HNV A;  1X4O A;  2R7Z J;  5IT9 Z;  3FK7 A;  5FB2 A;  2RAE A;  4KNY A;  3M7G A;  2IRF G;  2DFH A;  2TCT A;  4GRI A;  4BXU A;  2DMP A;  1H8A C;  5JLX A;  4Y7N J;  2LF7 A;  3ZCO A;  1OCT C;  2GXB A;  2CFO A;  2K5C A;  5E3O A;  2VBW A;  2MLK A;  1FLI A;  4RAY A;  3F0C A;  3GX4 X;  5C44 J;  4RLF A;  1MGT A;  2EZH A;  3TKY A;  1R22 A;  2KT0 A;  2WY8 Q;  3QU3 A;  3L2Q A;  1W7P D;  3HKZ A;  1K83 J;  2X1D A;  3K2A A;  2NVT J;  3M8F A;  2AHQ A;  5DCM B;  1YS6 A;  2GA1 A;  4B4C A;  4OIO F;  3RDI A;  1LEA A;  2CQN A;  2TDX A;  3GFL A;  3I71 A;  2PEX A;  3LST A;  3S16 J;  3ZQF A;  1YJN I;  3MZY A;  3EUK L;  2LKP A;  2K02 A;  3LSK A;  1SFX A;  2ADU A;  1ZLK A;  3HTS B;  3ERE D;  3K1P A;  3UNG C;  3OL4 A;  4M6X A;  1ZAR A;  1GUU A;  5KVR A;  4IRG A;  1N25 A;  1OYI A;  2A6T A;  1MJA A;  1U0J A;  3J80 K;  2KRH A;  1W5C C;  2FXA A;  3A0H C;  2HI3 A;  3KLN A;  4DYQ A;  3J7Y J;  3WTU C;  4BDY A;  2K40 A;  2XKO A;  3ZMZ A;  3GME A;  4L0Z B;  2X9D A;  1HKT A;  1JT0 A;  1F1Z A;  4B43 A;  4QPQ A;  1KU9 A;  2HKO A;  2OA4 A;  3NWS A;  4A0X A;  1ERD A;  2E19 A;  3VSK A;  1UAA A;  3DKX A;  3JTH A;  3IAS 2;  2OZU A;  2PJR B;  2HDC A;  2WV0 A;  1P4W A;  2PMZ N;  5F1J A;  3L1P A;  2O03 A;  1XS9 A;  4RM2 A;  5J8C A;  1IAW A;  3L2W A;  1B8I A;  2F48 A;  4PJN A;  4ZH4 F;  2M45 A;  4O3M A;  4XMY A;  2H8W A;  2EPF A;  1VQL I;  2LY9 A;  3DEE A;  3K70 C;  2DOF A;  1KGS A;  3I53 A;  4ZYG A;  1NK2 P;  3COA C;  4EJV A;  5BPD A;  1ODD A;  2YS9 A;  1H89 C;  3I59 B;  2HS5 A;  2ZBK A;  4NHJ A;  1R00 A;  3RPQ A;  3A01 A;  4WF2 A;  3OWT A;  4MTD A;  1MH4 A;  2EJR A;  2NS0 A;  1U5T A;  2FD5 A;  3K4L A;  2VKV A;  1N75 A;  4Q5S F;  1ZRC A;  2EWN A;  5D5U B;  5EGO A;  1VQ9 I;  4BGD A;  1AWC A;  4JQF A;  2EBI A;  3QPS A;  3QRF F;  2LK2 A;  1ON2 A;  5FKO A;  1SD5 A;  3I5U A;  3PUF A;  3J7A O;  3M3Y J;  3HTU A;  1XSD A;  1LQ1 A;  2VL8 A;  1LNW A;  3IRQ A;  2VPR A;  1IXR C;  1A04 A;  3Q9V A;  5EG0 A;  5M3F J;  3EQL F;  1NG6 A;  2V9K A;  3H3U A;  1K6O A;  1J09 A;  4U7D A;  2WAD A;  2B63 J;  3JAM K;  4G6D A;  4BNC A;  2JTV A;  3DTI A;  5DM7 F;  4ESB A;  1HOM A;  1Z3X A;  2K9Q A;  1BM9 A;  3BQY A;  3F72 A;  3KPH A;  2VPL A;  2NVU B;  3PO3 J;  2PQ8 A;  2Z99 A;  2W48 A;  1HSJ A;  3H92 A;  4WXH A;  2XF7 A;  2KJB A;  4BQA A;  2CO5 A;  5FD5 A;  1D3Y A;  3A03 A;  3L2V A;  4HNU A;  5HVQ C;  3JRB A;  3CUQ C;  4G7H F;  3MMY B;  1ACI A;  4KIS A;  4PFP A;  5L3F A;  4D7M A;  4L18 B;  4LIT A;  2EIM H;  2Y31 A;  3KZI C;  4CCO A;  3HJE A;  2VKH A;  4DGW B;  1YO5 C;  1WJE A;  3VWB A;  1CF7 B;  3CCY A;  2RVC A;  4A2U A;  1I1S A;  2XAH A;  3PUB A;  2FRH A;  3FKI J;  4BE0 A;  2MH2 A;  1OLT A;  2G7H A;  2VC0 A;  4XLN F;  4DOZ A;  4NUB A;  2M30 A;  4EV0 A;  2ID3 A;  2L3D A;  3KP3 A;  1QPI A;  4KN4 X;  1I6X A;  3F8M A;  2CGP A;  3O3K A;  5B3S H;  2B0L A;  1IC8 A;  2AXL A;  2NS7 A;  1T2K A;  1S3J A;  2ETH A;  1ULY A;  2XRO A;  3CLQ A;  3GTM J;  1R7J A;  2QQB A;  4FE4 A;  2OJE D;  2IVM A;  3D5S C;  3H9Q A;  4IHS A;  2KIF A;  3L7W A;  2R92 J;  1ZGA A;  2DDA A;  1B6A A;  2UZK A;  2HQ5 A;  2CQ7 A;  1ETW A;  2V1X A;  3NRV A;  2ZNY A;  3SXY A;  2DOD A;  3E7L A;  1WFX A;  5D5W B;  2WTE A;  2RNJ A;  4NC8 A;  1XB4 A;  2O3F A;  2F5C A;  3VYU B;  4F3Q A;  4E7S A;  4KT6 A;  1B8I B;  4IZZ A;  2XAU A;  3EYY A;  3DU6 A;  1I50 J;  4PJJ A;  4ZC3 A;  2ZJP F;  3Q0V A;  3IUO A;  2RV8 A;  3HB9 A;  4DQ2 A;  2YR2 A;  3N97 A;  2BVM A;  1WJA A;  3BQZ A;  1SFO J;  1V55 H;  3VOD A;  3HOU J;  4KT5 C;  3DQV C;  2DQL A;  2Q2E B;  2TRT A;  3P9K A;  2QCO A;  3SEQ A;  1OCZ H;  1D1C A;  2MSY A;  3V8K A;  3S1Q J;  2K4B A;  2GXG A;  4ZJZ A;  3QOD A;  4IJA A;  1Z9C A;  3HEF A;  1IUY A;  1U5T B;  4E7J A;  2L2O A;  3K0L A;  2LNB A;  3CC4 I;  5CYV A;  4UVC A;  3OSG A;  3TO6 A;  4UUV A;  2KKO A;  2O8X A;  2D2W A;  1WH5 A;  3FIS A;  5ED4 A;  3LA7 A;  2VQC A;  4UXN A;  2FBH A;  4GYG A;  4IHV A;  3K69 A;  2M7B A;  5CQE A;  1EV7 A;  3M8E A;  2EQR A;  2W57 A;  1XD7 A;  3K2Z A;  4PJL A;  3QOP A;  5JHF A;  3MQ0 A;  5J1R A;  1MIJ A;  1LEB A;  1MSE C;  3ZQH A;  1PYV A;  1QQI A;  4GGG A;  3LOC A;  1S8N A;  2BY0 A;  1WJ5 A;  2ZSI B;  2LBF A;  1FT9 A;  4HST A;  5E3L A;  4E70 A;  1T8I A;  1MKM A;  1GDT A;  4RS8 A;  4O5V A;  2J5P A;  2Z33 A;  2DT7 B;  3GCM A;  4BKX A;  1RET A;  4U7B A;  2XRN A;  3AG2 H;  5CPR B;  5E3M A;  4LGW A;  1VI0 A;  1A6I A;  3V7S A;  2VKD A;  5JFR A;  2DFI A;  1F43 A;  2M9H A;  5IOY A;  4E7L A;  5J8F A;  2EFW A;  2MD5 A;  2KZV A;  5DD4 A;  1TNS A;  2XGD A;  1R71 A;  3F9K A;  3PFY A;  3ECO A;  4Y33 A;  4LB5 A;  3RYP A;  2M4G A;  3AG3 H;  3G4S I;  3PNV A;  4I99 C;  4WCG A;  1MBF A;  2DA4 A;  3BOQ A;  1MD0 A;  2R3S A;  5BMZ A;  1XDU A;  3E5U A;  2B9S A;  4AD9 A;  1UST A;  5FLX Z;  2EIK H;  4IL6 C;  3DPT A;  2E1M B;  4OMY A;  1W1W E;  3G2B A;  1XC5 A;  1MNE A;  3C18 A;  1UFM A;  2WBM A;  2O6G E;  2M87 A;  4AVP A;  4MTE A;  1W5S A;  4AIH A;  3ZOB A;  1RC9 A;  4XLE A;  2PMZ A;  4ENN A;  1ZLJ A;  1V5F A;  1I39 A;  1FIA A;  1OFC X;  2P0W A;  5D8L B;  3AAF A;  4V19 K;  2QQ9 A;  1FBU A;  3PM1 A;  1STZ A;  3S15 J;  1OPC A;  3OYA A;  5J40 A;  3AG4 H;  1SC7 A;  1ONV A;  4Y17 A;  2EZL A;  2XAF A;  3RTR A;  3HYI A;  2CQQ A;  2H94 A;  4HAM A;  2DO7 A;  2F5V A;  5HS8 A;  1UG0 A;  5HLI A;  4A5M A;  4H4K C;  4MFD A;  1OJL A;  2GA2 A;  4TV7 A;  3LAJ A;  2M5W A;  4MNU A;  1X1B A;  3RKX A;  3O8G A;  4RGS A;  1QNT A;  5CVR A;  1LVA A;  3GZ5 A;  3DPL C;  4UVA A;  1MJ9 A;  2FSW A;  2MBF A;  3DCF A;  1OR7 C;  2HNH A;  4IOA F;  2DYS H;  2NVY J;  4AWX B;  1K4T A;  2CV2 A;  2FNP A;  2WC2 A;  4XRS A;  2WB1 N;  3CP2 A;  1E3O C;  1UB9 A;  3GFJ A;  1WI3 A;  1A6Q A;  2CW7 A;  2VBY A;  4HQE A;  5CQG A;  1FOY A;  3K4C A;  2DXI A;  5HNH A;  1Y39 A;  1IN8 A;  4LOC A;  3WGH A;  3P5J A;  3RI4 A;  4C2M J;  1T0F C;  2DU9 A;  2RN7 A;  1YQA A;  4HX8 A;  3WE3 A;  3HRU A;  1BOB A;  4CSW A;  3FHN A;  3R61 A;  2QZ8 A;  3HRM A;  3WU2 C;  1XGN A;  2A5Y B;  2KIQ A;  2DFF A;  4S0H B;  1GT0 C;  1K78 B;  4I76 A;  3Q0W A;  1R1T A;  3D5L A;  2QVO A;  1DGR M;  2ISY A;  2DMQ A;  1OQY A;  5KNL A;  3JW4 A;  1XPX A;  2PN6 A;  2DFE A;  2NAZ A;  1G3Y A;  2FBK A;  3A01 B;  5LGN A;  2BGC A;  3PFI A;  3NQO A;  4XRF A;  1WH7 A;  1OCP A;  2VT2 A;  1XSV A;  5IP7 J;  1T0F A;  1SD7 A;  5M3M J;  1IV6 A;  3M1C A;  1TTY A;  1W7P B;  4YIF A;  3QP6 A;  3MKY B;  2ISZ A;  4HOB A;  4LK1 F;  2JRT A;  3OYG A;  4E7H A;  2XSJ C;  3H3Z A;  2DTR A;  3IWF A;  4UV9 A;  2QM3 A;  3GLX A;  2BW3 A;  1MBH A;  4A6D A;  5EGO B;  3CUQ A;  3J7Z I;  4OIP F;  3BPV A;  3OMY A;  5GPA A;  4J00 A;  3JRC A;  1T98 A;  2UXX A;  1ETK A;  5BS6 A;  3GEZ A;  1ZG3 A;  2JSC A;  3I64 A;  3IP4 B;  4M73 A;  1KZH A;  4A3F J;  1SVM A;  4KIC A;  3TOA A;  2DMT A;  4ZZD A;  1LJ9 A;  1PVE A;  3SYT A;  4O6J A;  1QVT A;  3OR1 C;  2P4W A;  2X51 A;  5M5Y J;  4DBQ A;  1R5G A;  2HGC A;  2RQQ A;  1MDM A;  4FCY A;  2QUF A;  1B72 B;  2EB7 A;  2GWR A;  3HHG A;  2W1O A;  2HPM A;  2ELK A;  1ETV A;  1LFP A;  3R0J A;  1XGS A;  4CYD A;  1XCB A;  4ON0 A;  4A3J J;  3ABT A;  4XON A;  4AUX A;  4A3I J;  1W36 C;  3DTK A;  3GF2 A;  2VB6 A;  3I4N J;  2DJI A;  3FBN B;  4ENJ A;  2R93 J;  4Q47 A;  3ABK H;  1KQ9 A;  1OYY A;  3ZN1 A;  2FUG 2;  1QZE A;  5EZH A;  5ICF A;  2EFQ A;  2LD5 A;  1R4M B;  2K7L A;  2KFD A;  2EK5 A;  3J80 Z;  1K7A A;  4RB0 A;  3QAH A;  3U2R A;  1D8K A;  1G3W A;  1IN5 A;  2IT0 A;  2Q0O A;  1TT0 A;  1GV5 A;  5ICC A;  2QEN A;  5F1R A;  1V5E A;  1F36 A;  4IQ4 A;  2V1D A;  4FX0 A;  3BTL A;  5H2F C;  2CRG A;  1O4X A;  1UCR A;  3EYI A;  1U9O A;  4H0E A;  1DP3 A;  2XF5 A;  4C3J J;  2FE3 A;  2LRD A;  3GLL A;  1BOA A;  2FJ1 A;  3QOE A;  4C2T A;  1HCR A;  3WTZ A;  3L2U A;  3V7R A;  1WHU A;  2L7F P;  3OL3 A;  2A3S A;  2GOX B;  3M9A A;  4JX5 A;  1MSF C;  2HXO A;  1KU2 A;  3DFG A;  1E0E A;  1X58 A;  4RLQ A;  4BQO A;  3J7A Y;  2IAI A;  1IN6 A;  4EEF G;  1BIA A;  1ZGW A;  2AS5 F;  3QYF A;  1FP2 A;  2XSD C;  1QO0 D;  2JUC A;  1R4N B;  2B7E A;  5D6E A;  5AIQ A;  5DYM A;  4D9J A;  1IRX A;  3I56 I;  5LD2 C;  4HDU A;  2CUZ A;  3H0G J;  2EV0 A;  2HQN A;  3OIQ A;  3OYB A;  1JJ8 C;  3BG6 A;  2E1N A;  2K85 A;  2R7F A;  1IZ1 A;  1FJL A;  5E8I A;  3BZ6 A;  3OYL A;  4PJ0 C;  5HDK A;  3OYM A;  4DJA A;  3IC7 A;  3SZG A;  2R7R A;  2L9V A;  3G1O A;  3HSR A;  3AG1 H;  4LG3 A;  5F0F A;  4HEA 2;  1UMQ A;  4IRH A;  1TWH J;  3W6K B;  1ZG5 A;  5F0C A;  1BA5 A;  4CDG A;  2IA1 A;  2FF4 A;  3LSI A;  3AKZ A;  2G0E A;  2HYJ A;  1ORK A;  5ILS A;  2KJC A;  5ICE A;  4QLC U;  4EGZ A;  4LD5 A;  3SFI A;  4RAF A;  2QSG X;  2E36 A;  3CCM I;  1IRG A;  1BIB A;  3ZXS A;  4LG0 A;  1YG2 A;  4R8H A;  1U9N A;  2Y0M A;  4XN0 A;  3PNT A;  1XMX A;  4IPA A;  4BJ6 C;  1W7P A;  4F55 A;  5B66 C;  3GZ6 A;  2N8G A;  2GXA A;  4ZYD A;  3DKW A;  4L9V A;  3OYJ A;  3PQK A;  1KYW A;  4LIU A;  1ON1 A;  4AID A;  4P5O A;  5FLX K;  1ZKG A;  2LY1 A;  2WAF A;  3CUQ B;  4MFE A;  3BG3 A;  2LRE A;  2EFO A;  1PUE E;  4MLO A;  4DYR A;  1VTN C;  2E2H J;  2VON A;  3HXL A;  3ZN0 A;  1ZR4 A;  1BBY A;  3FXR A;  4CZZ A;  5D4R A;  3CO6 C;  1SMT A;  4ZDL A;  1I27 A;  2OCC H;  4ZZL A;  2DA7 A;  5A2Q Z;  2QBY B;  1MZB A;  2IGK A;  3E3V A;  3HPG A;  4ENM A;  2ZJ2 A;  3IH3 A;  1MMS A;  3KP4 A;  1V5G A;  4BS9 A;  1D5Y A;  3V8L A;  2P6T A;  4M9S A;  5HS9 A;  5E20 A;  1E3P A;  2K86 A;  2OAZ A;  3GZN B;  3I9V 2;  3KIO A;  4RA2 A;  4L5I A;  4PGH A;  2V4J C;  2X85 A;  2E5Z A;  2IGM A;  5TIS C;  2ZXJ A;  1FBQ A;  1I3A A;  3KCC A;  4Z2Y A;  1R23 A;  1WSU A;  2E7W A;  3BLY A;  1JHF A;  3MWM A;  4XKW A;  2DN0 A;  1FBS A;  2LLK A;  3GTJ J;  2ZXH A;  3CES A;  1GLN A;  2CJJ A;  3O6B B;  2L9S A;  2WAQ N;  4Y4R A;  1O3T A;  1FY7 A;  3F3X A;  3QQA A;  3S2W A;  4IHX A;  4QSH A;  2OQG A;  2P7V B;  5E79 C;  4A0Z A;  2VJJ A;  1BR2 A;  5D4S A;  2IS2 A;  1SVO A;  3TQN A;  2NVQ J;  2DJN A;  3RJP A;  5EF6 A;  3CCQ I;  3M8J A;  4ZDP A;  2XV4 S;  3DPU A;  3F8B A;  2HVS A;  2X6O A;  5ICG A;  1OCR H;  2DDB A;  1B1B A;  3AFH A;  5IP9 J;  4MEX F;  2EH3 A;  3RYR A;  1ZN2 A;  2HYF A;  2H6B A;  1VQM I;  4XKB A;  5L3D A;  5LHH A;  1Q1V A;  2VAS A;  2ECB A;  1IO2 A;  1UHW A;  1HW2 A;  5LEJ A;  3TMO A;  1J7K A;  2XDV A;  1BR4 A;  2WV1 A;  1AKH B;  4MIM A;  1R5H A;  2LDU A;  3QPL A;  1Z67 A;  4IVN A;  2D5V A;  1OIS A;  4M3F A;  2VN2 A;  3EDP A;  3TDU C;  4IRI A;  2JWT A;  5IPA A;  2VE9 A;  1RUO A;  3CO7 C;  2JMW A;  4A3M J;  1RR7 A;  2BOL A;  3KET A;  3OS1 A;  3TO7 A;  1A35 A;  2QKM B;  2EFP A;  2EFN A;  1O7L A;  2M2E A;  3HOZ J;  2IW5 A;  4PUS A;  1SFU A;  1ITY A;  1ENH A;  1WVR A;  4DW6 A;  4M3G A;  3S1M J;  5DTD A;  2CV1 A;  1YTY A;  4LG0 B;  3CJQ B;  4DZJ A;  4GYI A;  1Y1W J;  2XPW A;  3KX2 A;  5K1Y A;  1I5Z A;  1R1U A;  2DOE A;  3CC7 I;  4RB3 C;  3DP7 A;  4LFU A;  2R7S A;  2ELH A;  1MMG A;  2PBI A;  3WGG A;  1RUN A;  2CV0 A;  3TED A;  2DK5 A;  1WJB A;  2BBY A;  2V6E A;  2WWY A;  3S32 A;  4XN3 A;  3ASN H;  5LEK A;  2KRC A;  3K1M A;  3HGG A;  4JK1 X;  1Y56 A;  3T8T A;  3UKG A;  1YE9 A;  2E5N A;  3MCZ A;  3R6S A;  3W3C A;  2X48 A;  2NXN B;  4CZC A;  2H27 A;  2HPI A;  3BR1 A;  1EA3 A;  3I4M J;  1YW8 A;  4LK0 F;  3KEQ A;  3ZQQ A;  5KAF C;  4E7I A;  3FM3 A;  2X4H A;  4LJZ F;  3ROU A;  2A6E F;  1VF9 A;  3SDG A;  5JVT A;  2ESN A;  4B8X A;  2DLL A;  2CG4 A;  3MVP A;  2DQR A;  3CCE I;  1S7A A;  3FM5 A;  1R36 A;  2FBI A;  2NVX J;  3PO2 J;  3KYD B;  3JAM Z;  4HF2 A;  2V26 A;  3RQ4 A;  3TW7 A;  4RMN A;  2V1U A;  3D1N I;  4Y13 A;  4PJM A;  3DXJ F;  5GAG J;  1DGW Y;  1IXC A;  5D5V B;  4YII A;  2HOT A;  5BQT A;  2R0Q C;  2IS6 A;  2WY7 Q;  3TDZ C;  1JUS A;  1EJ9 A;  2K9N A;  3X2Q H;  2ZJR F;  3BR0 A;  4M71 A;  2M0C A;  3CTA A;  2V9P A;  1YYV A;  1MNM C;  4OMZ A;  1S7O A;  3HOS A;  1HKQ A;  2F5D A;  3FMR A;  2BV6 A;  4HG2 A;  2YUS A;  1QHG A;  3BR5 A;  3KEO A;  4QWQ A;  5HLG A;  2GLO A;  1JKQ C;  2W82 A;  5EEH A;  3E5Q A;  5FRN A;  3BTC A;  2Z1D A;  3K4J A;  2EA2 A;  5F08 A;  4FHT A;  4JP0 A;  1L0O C;  4CCM A;  3ZP5 A;  4I6Z A;  3JRG A;  2OTL I;  1N78 A;  3OYK A;  2GIV A;  4UUT A;  4BQQ A;  4YEJ A;  1XSX A;  3QWL A;  1QZY A;  3FZV A;  1GXP A;  1Y8R B;  4F93 B;  3HOY J;  4BDZ A;  4MQV A;  4BU2 A;  3ZMT A;  4BXX J;  9ANT A;  4YIR X;  1IRF A;  2QSF X;  1AKH A;  1JE8 A;  2OQR A;  3BCA A;  5GTH C;  2JSP A;  3LSM A;  3JRE A;  3DLL F;  4P55 A;  4UVB A;  1TWC J;  1E2X A;  4LLN A;  3DTE A;  1TW2 A;  3E6C C;  3N4M A;  5LGU A;  3RSN A;  2DT5 A;  1OYW A;  1ZK8 A;  4A0Y A;  1EH6 A;  4C3I J;  3KP6 A;  3FXU A;  2W4S A;  3V4G A;  1X1A A;  1RNL A;  4I0A A;  2HVQ A;  2LOO A;  2WAQ A;  2OPT A;  4BHB A;  3CJR B;  4ZTF A;  3E1S A;  2BY2 A;  3S8P A;  4IQJ A;  2OU2 A;  3B73 A;  3VB2 A;  1FP1 D;  1XN7 A;  4UUS A;  3OV8 A;  5CVV A;  5KHD A;  2JA7 J;  2WA0 A;  4RGR A;  5E3N A;  1SMY F;  2LH9 A;  1FOW A;  5ILU A;  2ZNZ A;  5F04 A;  2FNA A;  1P4A A;  4B47 A;  4CYC A;  1YLF A;  2RDP A;  3ZQ7 A;  4UY8 I;  3H3V K;  4V2G A;  3BPX A;  2A69 F;  2M8E A;  3FKJ A;  3SJM A;  3ZQC A;  1ZRF A;  4FE7 A;  1FC3 A;  4HLX A;  1LDJ A;  1Y0U A;  2Z16 A;  1YS7 A;  1FSE A;  2XVC A;  4I02 A;  4NBQ A;  4QPO A;  4BAY A;  2QA4 I;  2ACJ A;  2RQP A;  4Q4Z F;  2EV5 A;  5HDG A;  1YJ9 I;  1GV2 A;  1Z91 A;  1X3Z B;  5K7F A;  2O0Y A;  1ZG1 A;  3DLA A;  4XLA A;  5DCM A;  1E17 A;  1ZGJ A;  1MBJ A;  2BXY A;  5TJJ A;  3WG7 H;  4YFN F;  3HOX J;  3V7C A;  2X6W A;  4JX4 A;  4B48 A;  2MYS A;  3HSE A;  5DCF A;  5GTI C;  5EYR A;  4ESF A;  1XTA A;  3LFK A;  1P4X A;  3CJT B;  4HV6 A;  3GYH X;  2IPQ X;  2PX9 A;  2Y2Z A;  4PFO A;  1UZC A;  3WU1 B;  3QPH A;  2OTJ I;  3M4O J;  2JZY A;  3BG5 A;  3FXL A;  1RKW A;  1AOY A;  1DU6 A;  2Q8K A;  3BCB A;  1M1E B;  1J0R A;  5EEA A;  2O5R A;  3NAU A;  1J9I A;  2JA8 J;  1TW3 A;  3KE2 A;  4NNJ A;  3FXM A;  1I6H J;  3NWT A;  3QYB A;  3BWG A;  3V42 A;  3K4B A;  3HM5 A;  3OY9 A;  5J6X A;  3ZR8 X;  2Y9Y A;  2YU3 A;  4HA8 A;  4RGX A;  3DEW A;  3QU6 A;  1IXS B;  3ZMD A;  1RES A;  3SFZ A;  1SEU A;  1TQP A;  4C9Y A;  2L5Q A;  4YFK F;  1UHM A;  3LL7 A;  1MBE A;  2DTZ A;  5AON A;  3VYR B;  3GFI A;  3U1D A;  3H5R A;  2LSO A;  5H6R A;  4A3L J;  2HVR A;  3LSJ A;  1W0U A;  4XID A;  3WTT C;  2FEZ A;  2EZI A;  2BHZ A;  3OS0 A;  2KDZ A;  4NB5 A;  2DA2 A;  4X0G A;  3K70 D;  2VOO A;  4BH9 A;  4S04 A;  2NOJ B;  5EDN A;  4XR6 A;  4J19 A;  1FYL A;  2CUJ A;  5CJ9 A;  1ZRE A;  3DBL B;  4U88 A;  3BJA A;  5TRD A;  3JTG A;  4AYB A;  1IN4 A;  4NC7 A;  1O7F A;  2Z2S B;  3U21 A;  2VOD A;  4KN7 X;  1YX3 A;  3S1N J;  2V7F A;  2LVS A;  2HKX A;  2OC6 A;  2XPV A;  3G1M A;  3GBG A;  4BY1 J;  1W36 D;  1EH7 A;  4KDP A;  3PSI A;  4D5C A;  5IY5 H;  3FF5 A;  1T08 B;  2F4I A;  5ILV A;  2E34 A;  2JRM A;  4MGR A;  3TP3 A;  1TT5 B;  3P7N A;  2NRA C;  3K6G A;  2AO9 A;  2ZME B;  1POG A;  3I3L A;  4GDF A;  4CCK A;  1WWX A;  4ETS A;  1FWZ A;  2CQX A;  4CGZ A;  2LTP A;  1SFE A;  1H9T A;  1HST A;  4Y3O A;  4XNF A;  3MFK A;  1JUP A;  3ZQG A;  3R60 A;  2F6C A;  2VXD A;  4RDU A;  4CHU A;  4CYC B;  1JKP C;  3R0A A;  3O2P E;  4X1E A;  5HNF A;  3IWZ A;  1LDD A;  3RCO A;  3SZP A;  3CJN A;  3DU5 A;  5JR3 A;  5FFZ A;  4BHP A;  4ABZ A;  4XLF A;  2JUG A;  5K5Q A;  1VQ4 I;  2F5F A;  4M3D A;  4A3D J;  3TP0 A;  2H8R A;  2JJ7 A;  2H09 A;  2R4G A;  4YG2 F;  2M0M A;  5HDN A;  2LC2 A;  3ULQ B;  3PIP F;  4G9Y A;  1JKR C;  4WXC A;  4NQW B;  3HUG A;  3S1R J;  1PUF B;  3G3Z A;  5IT9 K;  5E17 F;  1IDZ A;  4CO8 A;  2DOA A;  1Z7U A;  3OS2 A;  2VUM J;  1OKR A;  2PG4 A;  4OAZ A;  2A61 A;  3G6E I;  2FQ3 A;  3W6J B;  1C0W A;  1KA8 A;  4F7Z A;  2Z5U A;  3BY6 A;  2QF7 A;  5LGT A;  1W0T A;  2R7D A;  5HLH A;  3H0D A;  3GVA A;  2RGV A;  2XC7 A;  4KJZ A;  3FDY A;  2VKE A;  2XIG A;  1Y1V J;  2PJP A;  2KIU A;  1YIT I;  2Y69 H;  3K9T A;  2KL4 A;  5DD8 A;  3A1Y A;  5FD6 A;  1FNN A;  1BW6 A;  2ZCW A;  3RIR A;  4XRS G;  1YHQ I;  1U3E M;  1CF7 A;  3D5R C;  3BC8 A;  4M9Z A;  3VEP A;  5L3E A;  2BZT A;  3FXJ A;  3F8C A;  2DA1 A;  4RB1 A;  4NDL A;  4ASN A;  5JVG F;  2UV1 A;  3L9F A;  1Z6R A;  1VFC A;  1G59 A;  4E4H A;  1G3S A;  1OMI A;  2VJ5 A;  2HZT A;  3GUD A;  4YFX F;  1TLH B;  4G7Z F;  1FOX A;  5L3B A;  2IA2 A;  4LIV A;  3IHU A;  3MN2 A;  4HW0 A;  1IG7 A;  2MGQ A;  3RQI A;  1HKS A;  2MH9 A;  4AC0 A;  4BJ5 C;  3WHC A;  5DDG A;  2Y75 A;  1T56 A;  2A5W A;  4AVZ A;  4OIQ F;  2XGE A;  1YW9 A;  2HOS A;  3HRS A;  2XUB A;  2CS3 A;  1X1P A;  2L9R A;  4IX7 A;  3WHB A;  2R5Y A;  1CQT A;  4HX4 A;  5D5X B;  2V9V A;  1ETX A;  2DA6 A;  2Q2E A;  1R9T J;  3HPH A;  4PSW A;  2K9L A;  4XOR A;  3I4P A;  3K1N A;  2D45 A;  1F5T A;  2VOP A;  5KK1 A;  2QYO A;  2ZSH B;  1XGM A;  3RPU A;  3S93 A;  1TWG J;  1VQN I;  2E1C A;  2QQA A;  3TW6 A;  1JUM A;  5KAI C;  1L3L A;  1APL C;  4BXF A;  5AIP A;  4HV5 A;  2VC1 A;  1PJR A;  3PNY A;  1IDY A;  3IH4 A;  2R7T A;  2BYV E;  4BY7 J;  4D0P A;  2BHY A;  1WJF A;  4KA4 A;  2Z3Y A;  4KIG A;  2ESH A;  1P2F A;  3ZGK A;  1IN7 A;  1XCV A;  1DDN A;  2PJR A;  1U78 A;  1YFH A;  1J2X A;  3LFU A;  1ZAO A;  3ZRG A;  4II2 A;  4EJW A;  3PL8 A;  4EJO A;  2IXS A;  3K4M A;  3Q9S A;  4KIT B;  1RZ4 A;  3GTK J;  2XRL A;  4M72 A;  3GTQ J;  3MKL A;  1P7I A;  2BE5 F;  2W00 A;  4HSR A;  1FTZ A;  4LLG F;  2H1L A;  1B59 A;  2KPM A;  1WQ2 A;  2L01 A;  5F27 A;  3CP8 A; 
#chains in the Genus database with same CATH homology
 1QGP A;  4NQW A;  1GXQ A;  2EV6 A;  2P7C B;  4IF4 A;  3MZH A;  4HF1 A;  2ZO4 A;  1JHH A;  3WTV C;  1EH8 A;  3BJO A;  4UHT A;  1CGP A;  4KMU X;  1S6L A;  4FT8 A;  3BRO A;  1F9N A;  3RKW A;  2GQQ A;  4N9I A;  3J81 K;  4M9X A;  2XAQ A;  2DW4 A;  3T5X A;  3QP5 A;  1T6S A;  1BI2 A;  4N9H A;  3TO9 A;  1TQI A;  2E7X A;  1JGS A;  5E1Z B;  1KU3 A;  5JHU A;  1J5Y A;  2G7U A;  5FFX A;  3LQQ A;  4KMF A;  3E6B A;  2F2E A;  3R4K A;  5L3C A;  4WWC A;  4I09 A;  3ML6 A;  4WXD A;  2XAG A;  4Y15 A;  1TQM A;  2HTS A;  1G4D A;  3M1E A;  2FA5 A;  3C1D A;  3GW2 A;  2LF8 A;  3J81 Z;  2BEO A;  4RAZ A;  1J59 A;  1P6R A;  2W25 A;  3I58 A;  4OIN F;  5A2Q K;  1K78 A;  2XAJ A;  3SQN A;  3BJ6 A;  3P9C A;  3DV8 A;  2W24 A;  5E18 F;  2VT3 A;  1DPR A;  1BC7 C;  4HLY A;  1RI7 A;  2KRF A;  2P5L C;  3WTY C;  3LA2 A;  4AIK A;  5DUK A;  4AIJ A;  3KFW X;  3B02 A;  2PMU A;  3GO5 A;  4HQM A;  3SZT A;  3F6O A;  1W5T A;  4R1H A;  3G73 A;  5EEG A;  5DUI A;  1BI1 A;  3KLO A;  2NNN A;  4IHT A;  4L9J A;  3TGN A;  2PFB A;  4U0V A;  1V3F A;  4UV8 A;  1KU7 A;  3NEU A;  2XKP A;  3EET A;  4DNC A;  3WU0 A;  1F4K A;  1R1V A;  2L54 A;  3F8N A;  1XGO A;  3IRR A;  3E6D A;  4P9U A;  2CW0 F;  1MDM B;  5H6Q A;  6PAX A;  4FX4 A;  1PP8 F;  5D6F A;  4M6Y A;  4KYW A;  4Q48 A;  3EUH A;  4RB2 C;  2IP2 A;  5CLS A;  2HR3 A;  3WTX C;  1BI0 A;  3T1B A;  3D0S A;  1T39 A;  3E5X A;  2P8T A;  3LQR A;  4I01 A;  3ZMU A;  1H9G A;  4ENK A;  3WG9 A;  2YX7 A;  2A68 F;  1J75 A;  4EM1 A;  3IL2 A;  4G7O F;  4WK8 F;  1QPM A;  5LHG A;  3F21 A;  4HYE A;  1S29 A;  2ZKZ A;  4K2E A;  1W4M A;  2DPU A;  2HOE A;  2GAU A;  1ZH5 A;  1ZYR F;  5FO5 A;  5E8G A;  2CSO A;  4MHG A;  2NYX A;  2P6S A;  1FX7 A;  1MJB A;  1LDK B;  5CVI A;  2JPB A;  1T38 A;  4UNO A;  4IXA A;  2V79 A;  4MQ9 F;  5LRR A;  2HQR A;  4HDV A;  3LA3 A;  3BDD A;  1WI9 A;  4PZJ A;  1O57 A;  1FSH A;  3FMQ A;  5HS7 A;  2FML A;  3IKT A;  3DEU A;  4GXO A;  2L02 A;  4EM0 B;  1O3Q A;  3TOB A;  2V6C A;  5DEQ A;  3ZMS A;  4S05 A;  3CDH A;  1FPQ A;  1OR7 A;  1WKM A;  4PCQ A;  3GXO A;  1SD4 A;  5DV5 A;  5D8K B;  2XGX A;  2QWW A;  4PGG A;  5F6F A;  5BOX A;  2CYY A;  4U0W A;  4OU0 A;  4OOI A;  1QZZ A;  1GHC A;  1P92 A;  4XSX F;  1BI3 A;  3GWZ A;  3PQJ A;  4A12 A;  3F22 A;  2CWE A;  2DI3 A;  2RC4 A;  2UXN A;  4N0B A;  1SAX A;  2OZ6 A;  3JSP A;  1KQ0 A;  2A6H F;  1KQ8 A;  4M74 A;  2A07 F;  4GO1 A;  3KP5 A;  3VOE A;  2W84 A;  3BP8 A;  1B9M A;  2STT A;  5ERI A;  1REP C;  5E1W A;  1Q1H A;  4XSZ F;  1U2W A;  5CVU A;  1XMA A;  4P96 A;  2RKH A;  1HXD A;  4KIF A;  3HOT A;  2UWM A;  2MLG A;  4P9F A;  3U9G A;  4HX7 A;  2Y48 A;  1H0M A;  3VFZ A;  2JT1 A;  1G6N A;  1NHA A;  1YW7 A;  4LB6 B;  2NNY A;  4HBL A;  1DUX C;  1Z05 A;  5LBQ A;  1YIO A;  1U8R A;  2JPC A;  1I1G A;  1RIO H;  2YSR A;  2DAO A;  3REO A;  2MA3 A;  1FYK A;  2HFH A;  2F5E A;  3P9I A;  5BPI A;  3C7J A;  4EMS A;  4WX9 A;  5IT3 A;  4KUM A;  5HOO A;  3GFM A;  4BYY A;  2HEO A;  1U5T C;  4I2O A;  2X0L A;  3HSF A;  2QLZ A;  1WRJ A;  1HBX G;  4EGY A;  4ZYH A;  3WTW C;  4RGU A;  5E1X A;  3IKV A;  5LRS A;  5F64 A;  1SD6 A;  1QBJ A;  4OIR F;  1FZP B;  1XDS A;  2DPD A;  3MAJ A;  1D8J A;  2QBY A;  3KZZ A;  3I0T A;  3E97 A;  3T0Y A;  2OBP A;  2YX4 A;  3FXQ A;  1KYZ A;  3ZPL A;  3JSO A;  2EA4 A;  4BHC A;  4L9N A;  4XLP F;  3ELK A;  1D5V A;  3F23 A;  2D1H A;  4U0Y A;  3RKY A;  3KZY A;  3FX3 A;  2FOK A;  3HRT A;  2HYG D;  4EM2 A;  4EJU A;  2K4J A;  1IW7 F;  2DBB A;  3DF8 A;  4JBA A;  4I7H A;  4I98 B;  4B09 A;  3F8F A;  1BN5 A;  4G6Q A;  2HTJ A;  4CIC A;  3F6V A;  1Z1D A;  3L2C A;  1ZRD A;  5LLQ A;  3ISP A;  1O3S A;  3KP7 A;  3MEX A;  3C3W A;  3FHZ A;  3FWE A;  5K5R A;  4ESJ A;  1X3U A;  2GZW A;  4HZF A;  1BJA A;  4EJT A;  1HQC A;  4LMY A;  3LWF A;  3FMS A;  2O61 A;  5H20 A;  3ZMV A;  4ZYE A;  2VE8 A;  1FOK A;  2G9W A;  2HWV A;  2CQK A;  2COM A;  2D1V A;  3I54 A;  4G94 A;  2YPR A;  4G8X A;  4MEY F;  3WE2 A;  1IF1 A;  2FU4 A;  2P5K A;  2PMH A;  3OOP A;  4HF0 A;  4EVI A;  3ECH A;  3L00 A;  1LB2 A;  5K5O A;  1ZHF A;  3WGI A;  1BC8 C;  3SHF A;  2KIM A;  3L09 A;  3Q5F A;  4A5N A;  2C6Y A;  4L9T A;  4L0Y B;  4KFC A;  4PDK A;  1V4R A;  3WTS C;  2PI0 A;  5JI6 A;  4L5J A;  2IA0 A;  3E6M A;  2FMY A;  2K27 A;  2ZFW A;  1USS A;  2W85 A;  1FYM A;  1DPU A;  1O3R A;  1TBX A;  1JXS A;  1Z6T A;  5FGM A;  1B4A A;  5LHI A;  4KIB A;  4GCV A;  2P5V A;  2XHK A;  3WOD F;  1R58 A;  2VBX A;  1XMK A;  4CXF A;  2XAS A;  1TNT A;  5L3G A;  5CVJ A;  1GVJ A;  1B9N A;  2MC3 A;  2J5O A;  2CFX A;  3HHH A;  3T8R A;  2M1B A;  4LLL A;  4R79 A;  1HW1 A;  2ZME A;  1K79 A;  2L4M A;  1DP7 P;  3QPT A;  2PLY A;  2VXZ A;  1PDN C;  2L4A A;  4A6E A;  4EQQ A;  2IJL A;  3HIF A;  3I59 A;  3LAP A;  4XBF A;  2Z9O A;  3CLO A;  3KP2 A;  4I0B A;  1PP7 U;  3V8J A;  2DK8 A;  1G3T A;  1U6G A;  3CUO A;  2STW A;  3ABU A;  2OD5 A;  1HW5 A;  2H6C A;  2VBZ A;  5IT9 Z;  5FB2 A;  4KNY A;  3M7G A;  2IRF G;  4BXU A;  2LF7 A;  2GXB A;  2VBW A;  2MLK A;  1FLI A;  4RAY A;  3GX4 X;  1MGT A;  3TKY A;  1R22 A;  3QU3 A;  1W7P D;  3M8F A;  5DCM B;  1YS6 A;  2GA1 A;  4OIO F;  3RDI A;  1LEA A;  3GFL A;  2TDX A;  3I71 A;  3LST A;  2PEX A;  3MZY A;  2LKP A;  2K02 A;  1SFX A;  2ADU A;  1ZLK A;  3HTS B;  3ERE D;  3K1P A;  4M6X A;  1ZAR A;  5KVR A;  4IRG A;  1OYI A;  1MJA A;  3J80 K;  2FXA A;  3KLN A;  3WTU C;  2XKO A;  3ZMZ A;  4L0Z B;  1HKT A;  1F1Z A;  1KU9 A;  2HKO A;  2OA4 A;  4A0X A;  3JTH A;  2OZU A;  2HDC A;  2WV0 A;  1P4W A;  2O03 A;  5J8C A;  1IAW A;  4ZH4 F;  2M45 A;  4O3M A;  1KGS A;  3I53 A;  4ZYG A;  3COA C;  4EJV A;  5BPD A;  1ODD A;  3I59 B;  4NHJ A;  2HS5 A;  2ZBK A;  1R00 A;  3RPQ A;  4WF2 A;  4MTD A;  2EJR A;  2NS0 A;  1U5T A;  4Q5S F;  1ZRC A;  2EWN A;  5D5U B;  1AWC A;  4JQF A;  3QRF F;  1ON2 A;  1SD5 A;  3I5U A;  3J7A O;  3HTU A;  1XSD A;  1LQ1 A;  1LNW A;  3IRQ A;  1IXR C;  1A04 A;  3Q9V A;  3EQL F;  3H3U A;  1K6O A;  4U7D A;  3JAM K;  4G6D A;  4BNC A;  2JTV A;  4ESB A;  1BM9 A;  3F72 A;  2PQ8 A;  2Z99 A;  4BQA A;  3H92 A;  1HSJ A;  4WXH A;  2KJB A;  2CO5 A;  5FD5 A;  1D3Y A;  5HVQ C;  3CUQ C;  4G7H F;  5L3F A;  4L18 B;  1YO5 C;  1CF7 B;  2RVC A;  4A2U A;  1I1S A;  2XAH A;  2FRH A;  2MH2 A;  4XLN F;  2G7H A;  2VC0 A;  2M30 A;  4EV0 A;  2L3D A;  3KP3 A;  4KN4 X;  1I6X A;  3F8M A;  2CGP A;  3O3K A;  2B0L A;  2AXL A;  1T2K A;  1S3J A;  2ETH A;  1ULY A;  2XRO A;  1R7J A;  2QQB A;  2IVM A;  4IHS A;  2KIF A;  3L7W A;  1ZGA A;  1B6A A;  2UZK A;  2V1X A;  3NRV A;  2ZNY A;  3SXY A;  5D5W B;  2WTE A;  2RNJ A;  1XB4 A;  2O3F A;  2F5C A;  3EYY A;  2RV8 A;  4DQ2 A;  2YR2 A;  3N97 A;  3VOD A;  4KT5 C;  3DQV C;  2DQL A;  3P9K A;  3V8K A;  2K4B A;  2GXG A;  4IJA A;  1Z9C A;  1IUY A;  1U5T B;  3K0L A;  2LNB A;  5CYV A;  4UVC A;  4UUV A;  3TO6 A;  2KKO A;  2O8X A;  2D2W A;  5ED4 A;  3LA7 A;  4UXN A;  2FBH A;  4GYG A;  3K69 A;  1EV7 A;  3M8E A;  2W57 A;  1XD7 A;  3K2Z A;  3QOP A;  3MQ0 A;  1LEB A;  1QQI A;  4GGG A;  1S8N A;  1FT9 A;  4E70 A;  1MKM A;  4RS8 A;  4O5V A;  2J5P A;  2Z33 A;  4U7B A;  2XRN A;  4LGW A;  3V7S A;  5JFR A;  2DFI A;  5J8F A;  2EFW A;  2MD5 A;  5DD4 A;  1TNS A;  3ECO A;  4LB5 A;  3RYP A;  4WCG A;  3BOQ A;  1MD0 A;  2R3S A;  5BMZ A;  1XDU A;  3E5U A;  4AD9 A;  1UST A;  5FLX Z;  3DPT A;  4OMY A;  3C18 A;  1UFM A;  2O6G E;  2M87 A;  4AVP A;  4MTE A;  1W5S A;  4AIH A;  4ENN A;  1ZLJ A;  5D8L B;  3AAF A;  2QQ9 A;  1FBU A;  1STZ A;  1OPC A;  1ONV A;  4Y17 A;  2XAF A;  3RTR A;  3HYI A;  2H94 A;  4HAM A;  2DO7 A;  5HS8 A;  5HLI A;  4A5M A;  2GA2 A;  4TV7 A;  3LAJ A;  2M5W A;  4MNU A;  3RKX A;  4RGS A;  1QNT A;  5CVR A;  1LVA A;  3GZ5 A;  3DPL C;  4UVA A;  1MJ9 A;  2FSW A;  2MBF A;  4AWX B;  2FNP A;  2WC2 A;  1UB9 A;  3GFJ A;  2VBY A;  4HQE A;  1IN8 A;  3WGH A;  3RI4 A;  2DU9 A;  2RN7 A;  1YQA A;  4HX8 A;  3WE3 A;  3HRU A;  3R61 A;  2QZ8 A;  3HRM A;  1XGN A;  2A5Y B;  1K78 B;  1R1T A;  3D5L A;  2QVO A;  2ISY A;  3JW4 A;  2PN6 A;  2NAZ A;  1G3Y A;  2FBK A;  5LGN A;  2BGC A;  3PFI A;  3NQO A;  4XRF A;  2VT2 A;  1XSV A;  1T0F A;  1SD7 A;  1TTY A;  1W7P B;  4YIF A;  3QP6 A;  2ISZ A;  4HOB A;  4LK1 F;  2JRT A;  3H3Z A;  2DTR A;  3IWF A;  4UV9 A;  2QM3 A;  3GLX A;  4A6D A;  3CUQ A;  4OIP F;  3BPV A;  1T98 A;  2UXX A;  5BS6 A;  3GEZ A;  1ZG3 A;  2JSC A;  3I64 A;  4M73 A;  4KIC A;  3TOA A;  4ZZD A;  1LJ9 A;  4O6J A;  2P4W A;  1R5G A;  2HGC A;  1MDM A;  2QUF A;  2EB7 A;  2GWR A;  3HHG A;  3R0J A;  1XGS A;  4CYD A;  1XCB A;  4ON0 A;  3ABT A;  3GF2 A;  4ENJ A;  4Q47 A;  1KQ9 A;  1OYY A;  3ZN1 A;  5ICF A;  2EFQ A;  2K7L A;  2EK5 A;  3J80 Z;  1K7A A;  4RB0 A;  3QAH A;  3U2R A;  1D8K A;  1G3W A;  1IN5 A;  2IT0 A;  2Q0O A;  5ICC A;  2QEN A;  5F1R A;  2V1D A;  4FX0 A;  1UCR A;  3EYI A;  4H0E A;  2FE3 A;  1BOA A;  3WTZ A;  3V7R A;  2A3S A;  3M9A A;  1KU2 A;  3DFG A;  1IN6 A;  1BIA A;  2AS5 F;  1FP2 A;  1QO0 D;  5D6E A;  5AIQ A;  5DYM A;  4HDU A;  2EV0 A;  2HQN A;  2E1N A;  2R7F A;  1IZ1 A;  5E8I A;  3BZ6 A;  5HDK A;  3IC7 A;  3HSR A;  4IRH A;  3W6K B;  1ZG5 A;  4CDG A;  2IA1 A;  2FF4 A;  5ILS A;  2KJC A;  5ICE A;  4QLC U;  4EGZ A;  4LD5 A;  1IRG A;  1BIB A;  4LG0 A;  1YG2 A;  4R8H A;  2Y0M A;  4IPA A;  3GZ6 A;  1W7P A;  4ZYD A;  3DKW A;  4L9V A;  3PQK A;  1KYW A;  1ON1 A;  4P5O A;  5FLX K;  3CUQ B;  2EFO A;  1PUE E;  1VTN C;  2VON A;  3ZN0 A;  1BBY A;  3FXR A;  4CZZ A;  5D4R A;  3CO6 C;  1SMT A;  1I27 A;  4ZZL A;  5A2Q Z;  2QBY B;  1MZB A;  3E3V A;  4ENM A;  2ZJ2 A;  3KP4 A;  3V8L A;  2P6T A;  4M9S A;  5HS9 A;  5E20 A;  2K86 A;  2OAZ A;  4L5I A;  4PGH A;  2ZXJ A;  1FBQ A;  3KCC A;  4Z2Y A;  1R23 A;  1WSU A;  2E7W A;  1JHF A;  3MWM A;  1FBS A;  3O6B B;  1O3T A;  1FY7 A;  3F3X A;  3S2W A;  2OQG A;  2P7V B;  4A0Z A;  5D4S A;  3TQN A;  3RJP A;  2XV4 S;  3F8B A;  5ICG A;  1B1B A;  4MEX F;  3RYR A;  1ZN2 A;  2HYF A;  2H6B A;  5L3D A;  5LHH A;  1UHW A;  1HW2 A;  5LEJ A;  1J7K A;  1R5H A;  2LDU A;  4IVN A;  2VN2 A;  3EDP A;  3TDU C;  4IRI A;  2VE9 A;  1RUO A;  3CO7 C;  3KET A;  3TO7 A;  2EFP A;  2EFN A;  1O7L A;  2IW5 A;  1SFU A;  1YTY A;  4LG0 B;  4GYI A;  5K1Y A;  1I5Z A;  1R1U A;  4RB3 C;  3DP7 A;  4LFU A;  2ELH A;  2PBI A;  3WGG A;  1RUN A;  2DK5 A;  2BBY A;  2WWY A;  5LEK A;  3K1M A;  4JK1 X;  3T8T A;  3MCZ A;  3R6S A;  2H27 A;  1YW8 A;  4LK0 F;  3KEQ A;  3FM3 A;  2X4H A;  4LJZ F;  3ROU A;  2A6E F;  5JVT A;  2ESN A;  4B8X A;  2DLL A;  2CG4 A;  2DQR A;  1S7A A;  3FM5 A;  1R36 A;  2FBI A;  3JAM Z;  4HF2 A;  2V1U A;  4Y13 A;  3DXJ F;  1IXC A;  5D5V B;  4YII A;  5BQT A;  3TDZ C;  4M71 A;  3CTA A;  1YYV A;  4OMZ A;  1S7O A;  3HOS A;  1HKQ A;  2F5D A;  3FMR A;  2BV6 A;  4QWQ A;  5HLG A;  3KEO A;  5EEH A;  3E5Q A;  2EA2 A;  4FHT A;  3ZP5 A;  1L0O C;  2GIV A;  1GXP A;  1XSX A;  1QZY A;  3FZV A;  4MQV A;  3ZMT A;  1IRF A;  1JE8 A;  2OQR A;  4P55 A;  4UVB A;  1E2X A;  4LLN A;  1TW2 A;  3E6C C;  3N4M A;  5LGU A;  2DT5 A;  1OYW A;  4A0Y A;  1EH6 A;  3KP6 A;  3FXU A;  3V4G A;  1RNL A;  4I0A A;  4BHB A;  2OU2 A;  3B73 A;  3VB2 A;  1FP1 D;  1XN7 A;  3OV8 A;  5CVV A;  4RGR A;  1SMY F;  5ILU A;  2ZNZ A;  2FNA A;  1P4A A;  1YLF A;  2RDP A;  3ZQ7 A;  3BPX A;  2A69 F;  2M8E A;  1ZRF A;  1FC3 A;  4HLX A;  1LDJ A;  1Y0U A;  1YS7 A;  1FSE A;  2XVC A;  4I02 A;  4BAY A;  2ACJ A;  2RQP A;  4Q4Z F;  2EV5 A;  5HDG A;  1Z91 A;  1ZG1 A;  2O0Y A;  5DCM A;  1E17 A;  1ZGJ A;  5TJJ A;  4YFN F;  3V7C A;  3HSE A;  5DCF A;  4ESF A;  3LFK A;  1P4X A;  4HV6 A;  3GYH X;  2IPQ X;  3WU1 B;  3QPH A;  2JZY A;  1AOY A;  2Q8K A;  1J0R A;  1J9I A;  1TW3 A;  3KE2 A;  3BWG A;  5J6X A;  2YU3 A;  4HA8 A;  4RGX A;  3QU6 A;  1IXS B;  3ZMD A;  3SFZ A;  1TQP A;  4YFK F;  1UHM A;  5AON A;  3GFI A;  3U1D A;  5H6R A;  2LSO A;  3WTT C;  2FEZ A;  4NB5 A;  2VOO A;  4BH9 A;  4S04 A;  1FYL A;  5CJ9 A;  1ZRE A;  4U88 A;  3BJA A;  5TRD A;  3JTG A;  1IN4 A;  1O7F A;  2VOD A;  4KN7 X;  2HKX A;  1EH7 A;  4KDP A;  3FF5 A;  5ILV A;  4MGR A;  3P7N A;  2NRA C;  2ZME B;  1WWX A;  4ETS A;  1FWZ A;  4CGZ A;  1SFE A;  1H9T A;  1HST A;  3MFK A;  3R60 A;  4CHU A;  3R0A A;  3O2P E;  3IWZ A;  1LDD A;  3SZP A;  3CJN A;  5JR3 A;  5FFZ A;  4BHP A;  5K5Q A;  2F5F A;  2H09 A;  4YG2 F;  5HDN A;  3ULQ B;  4G9Y A;  4WXC A;  3HUG A;  5IT9 K;  3G3Z A;  5E17 F;  4CO8 A;  1Z7U A;  1OKR A;  2PG4 A;  2A61 A;  2FQ3 A;  3W6J B;  1C0W A;  1KA8 A;  4F7Z A;  2Z5U A;  3BY6 A;  5LGT A;  2R7D A;  5HLH A;  3GVA A;  2RGV A;  2XIG A;  2PJP A;  2KIU A;  3K9T A;  5DD8 A;  5FD6 A;  1FNN A;  2ZCW A;  1U3E M;  3RIR A;  1CF7 A;  4M9Z A;  5L3E A;  3VEP A;  3F8C A;  4RB1 A;  4ASN A;  3L9F A;  1Z6R A;  1G3S A;  1OMI A;  4G7Z F;  2HZT A;  3GUD A;  4YFX F;  1TLH B;  5L3B A;  2IA2 A;  3IHU A;  4HW0 A;  1HKS A;  2MH9 A;  5DDG A;  2Y75 A;  4OIQ F;  1YW9 A;  3HRS A;  2XUB A;  4HX4 A;  5D5X B;  2V9V A;  2Q2E A;  3I4P A;  3K1N A;  2D45 A;  1F5T A;  2VOP A;  5KK1 A;  2QYO A;  3RPU A;  1XGM A;  2E1C A;  2QQA A;  1L3L A;  5AIP A;  4HV5 A;  2VC1 A;  2BYV E;  4D0P A;  4KA4 A;  2Z3Y A;  4KIG A;  2ESH A;  1P2F A;  1IN7 A;  1XCV A;  1DDN A;  1U78 A;  1YFH A;  1J2X A;  1ZAO A;  4EJW A;  4EJO A;  3Q9S A;  1RZ4 A;  4M72 A;  2BE5 F;  4LLG F;  1B59 A;  1WQ2 A;  2L01 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...