4JBAA

Crystal structure of the oxidized form of marr from e.coli
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
138
structure length
134
Chain Sequence
LFNEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLSSIRSAASITPVELKKVLSVDLGALTRMLDRLVCKGWVERLPNPNVLVKLTTGGAAISEQSHQLVGQDLHQELTKNLTADEVATLEYLLKKVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Multiple antibiotic resistance protein MarR
publication title The multiple antibiotic resistance regulator MarR is a copper sensor in Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 44
structure length 134
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4jbaA00
3JSOA 3TOBA 4ESJA 3M1EA 5D8LB 5D5WB 5LGNA 5FLXZ 3F6OA 5DDGA 5FD6A 5K5OA 1Z1DA 1DPRA 3T0YA 1J7KA 3N97A 3VOEA 1HW2A 3P9CA 1LDKB 2LF8A 5CVRA 1GXQA 2DK5A 1U6GA 2M1BA 3K0LA 3V7RA 4MQ9F 1QQIA 3KZZA 2ISZA 3FWEA 2BE5F 5HVQC 4KNYA 1JGSA 1HKSA 1Z91A 5J8FA 1EH7A 3REOA 3DV8A 4KUMA 1C0WA 4A0XA 1YFHA 1LQ1A 3WTWC 4D0PA 4M9ZA 5F6FA 3F22A 2VT2A 1TW3A 4CDGA 3WGIA 2QQAA 5FGMA 5E1WA 3WGHA 3M9AA 4F7ZA 1F9NA 5FB2A 4XSZF 5D8KB 4ZYDA 3MZHA 5CYVA 1ZRCA 2OD5A 4HDUA 3PQKA 5A2QZ 2YSRA 3H92A 1BIBA 2PG4A 4HF2A 4HLYA 1FBUA 1WKMA 1OKRA 4LGWA 2LF7A 5LLQA 3RIRA 4UVCA 1CF7B 3C7JA 3MAJA 4P9FA 2DAOA 1U5TA 3NRVA 4EJOA 3MEXA 4QLCU 2XAGA 4U7DA 2DU9A 2HTJA 1BI0A 2XUBA 3OV8A 4UV9A 3ZQ7A 4GYGA 3CO6C 1J2XA 1KU2A 3RI4A 4KYWA 3CUQB 4AD9A 1SD6A 1P4XA 5TJJA 4AIKA 1R5HA 2A6EF 2HKXA 2ZMEA 4PZJA 3WU1B 2HYFA 2X4HA 4HV5A 1ON2A 4EM1A 2DFIA 2FXAA 1FP2A 3BDDA 3V7CA 3J80Z 2PN6A 4GCVA 1RZ4A 3BY6A 3WTVC 4U0VA 2FA5A 2A07F 5HLGA 3I59B 2BV6A 4WXCA 2XASA 1SD7A 1S7AA 1FOKA 3BWGA 5LGUA 2L4MA 2XIGA 1Z05A 1MJ9A 3MQ0A 2JPBA 1ZREA 4A5MA 3SFZA 3LSTA 1FYLA 4UUVA 3K69A 2CW0F 2BGCA 1XN7A 2PBIA 5FO5A 1FC3A 1KYWA 3R60A 3MZYA 2FU4A 2HS5A 1BI3A 2VN2A 2HYGD 2L54A 4KIGA 4U0WA 3ZMZA 4RGSA 3E5XA 4I01A 5ED4A 1R36A 5D5XB 3JAMK 1OYYA 4UHTA 4A2UA 2E7WA 1IN5A 5FD5A 1FBSA 2GA2A 2JT1A 4OIRF 4HQMA 1KQ8A 3EYYA 3ERED 4S04A 3ZPLA 5CVUA 2CG4A 4PDKA 1PDNC 4RB0A 3KZYA 2F5FA 3BPVA 3GUDA 4FX0A 3FMQA 1K7AA 3GXOA 2QQ9A 4EJVA 1WI9A 2RGVA 5J8CA 3N4MA 1LDDA 1B9MA 4CZZA 2NYXA 1BM9A 3DXJF 3CUOA 2Y48A 3GLXA 2VONA 2Q0OA 5DYMA 3H3ZA 1XDUA 5ICFA 5LBQA 5K5RA 3WGGA 4EJWA 3GWZA 4N0BA 4I2OA 2OBPA 2FNAA 2UZKA 4OIOF 1ZHFA 2ZNYA 3F8CA 3SQNA 2WC2A 4CHUA 1IN6A 2IRFG 5EEGA 2M30A 2HQNA 4EJTA 5A2QK 3KP4A 2DTRA 4ZH4F 1ZRDA 1O57A 4OIPF 4BXUA 2W25A 3HRSA 5DCMA 3RTRA 1EV7A 4M71A 2O0YA 3HRTA 3SXYA 3KE2A 3WU0A 1LEBA 1EH6A 2ZNZA 5FFXA 4RB2C 3C3WA 1XMKA 2JPCA 2Z33A 2QZ8A 3F23A 2ADUA 3RPUA 2VC0A 2FRHA 4EGZA 1SD4A 2LDUA 4K2EA 3TO6A 2UXNA 1PP7U 2NNNA 4I02A 2KKOA 1AWCA 4Z2YA 2KRFA 5BOXA 3QPTA 3GFIA 1XGSA 4IXAA 3LA2A 2W24A 3D5LA 4EMSA 5ICGA 5DUKA 4JBAA 2QBYA 2KIFA 5KK1A 1FBQA 3ZMVA 3T1BA 1RI7A 1YIOA 2V6CA 5JI6A 4MEXF 1T38A 3WTXC 5HS9A 3KLNA 2Y75A 2P5VA 2XAQA 2MD5A 3E5QA 4ENNA 5LHGA 2EFQA 1DDNA 3GF2A 3BROA 1U78A 2H27A 2K4JA 1DPUA 1QBJA 4I98B 4EM2A 1XCVA 4G7ZF 1XB4A 3FM5A 5AIPA 2D1HA 2STWA 3R6SA 3RYPA 2JZYA 2V1UA 1O7FA 5H6QA 1G3YA 3U1DA 3L9FA 3IRQA 1XSXA 2YX4A 1B6AA 3KP3A 2FQ3A 1GHCA 4BNCA 5DEQA 4U0YA 2ACJA 2QENA 2BEOA 2VBZA 2P7CB 4HX7A 1G3WA 2UXXA 5HDGA 4R1HA 3RKYA 4RB1A 5CLSA 2PMUA 3ECHA 3TKYA 1CF7A 4YG2F 2XKPA 3HTSB 2CSOA 1FLIA 2E7XA 2RV8A 2TDXA 1FYMA 2D1VA 3F8FA 2FBKA 3ZMTA 3K2ZA 3IHUA 3C1DA 2ZCWA 3NQOA 2OZUA 2ZBKA 4Y13A 1Z7UA 3CUQA 2YR2A 2H94A 3GYHX 2RVCA 2XROA 1PUEE 2IVMA 5CVIA 2GXBA 2P7VB 2EA2A 2ZFWA 3LA7A 2RKHA 3F72A 3F8MA 2A68F 4HOBA 2PEXA 1SAXA 5K5QA 2VOOA 2XVCA 4L5IA 5KVRA 1LEAA 1Q1HA 3E3VA 3GZ5A 4DNCA 3K1PA 4R8HA 3I59A 3CO7C 2GAUA 3E97A 4Y15A 3E6CC 4EQQA 1B9NA 2L4AA 1F5TA 1LVAA 5F1RA 4LMYA 1HBXG 1VTNC 2EFOA 4IPAA 3R4KA 4RGRA 4LLLA 3FHZA 3E6MA 2FMYA 3L00A 4U88A 4L18B 4ETSA 1DUXC 3IRRA 2MBFA 1JXSA 1W7PB 3QP6A 4YIFA 2GXGA 3GFJA 4KICA 1T2KA 5L3BA 4HBLA 3EUHA 3KP2A 3QP5A 4ESFA 1F1ZA 1KU3A 4MTDA 2YX7A 1EH8A 1KQ0A 1T39A 1D5VA 1ZYRF 4DQ2A 1T0FA 4PGHA 3L7WA 2V9VA 4LLNA 4LB6B 2DPUA 4G94A 1G4DA 2EFNA 2EWNA 3RYRA 3FX3A 2B0LA 5J6XA 3BZ6A 2G9WA 2GQQA 3WTTC 4HF1A 1ZG3A 4G8XA 1YW9A 1YLFA 4IRHA 2DO7A 4YFNF 1KYZA 4WX9A 1I27A 1FY7A 2HKOA 4KMFA 3KP6A 4EM0B 1V3FA 3HRMA 3VEPA 5H20A 5HDNA 2GIVA 3F6VA 2KIUA 4IRIA 1BOAA 5E20A 2W85A 3ZN0A 2MLKA 1T98A 4I7HA 5IT3A 4OIQF 4FX4A 1J75A 5AONA 4UNOA 2VT3A 3DKWA 1R58A 4EVIA 4MNUA 2V1DA 4AIHA 4HAMA 4NQWA 2HR3A 5D4SA 1ULYA 1YW7A 1K78B 1IXSB 2M87A 4BH9A 2AS5F 2R7DA 2M5WA 3S2WA 4KDPA 1BJAA 1BN5A 1JHFA 3ULQB 3I5UA 2DI3A 4OMYA 4O6JA 3TGNA 3EDPA 4HDVA 4OINF 4RGXA 1S7OA 4G9YA 2VBYA 1XGMA 1IRGA 4EJUA 1W5SA 1P92A 3MWMA 3I58A 4YIIA 3V4GA 1B1BA 1SMYF 4HZFA 3DFGA 3T8TA 2EV5A 5ILVA 4ZZDA 3HIFA 1USSA 3VB2A 3L2CA 5D5UB 4WF2A 1HSJA 3V8KA 2M45A 2KJCA 2IPQX 1L0OC 2Z9OA 2QM3A 1S8NA 4RAZA 2CFXA 1JE8A 1BI1A 4P55A 5JR3A 2EV6A 4A5NA 4G7HF 4G6DA 1K79A 3QU6A 1RNLA 4ZYGA 4LLGF 4YFKF 4KFCA 1R1UA 3KP5A 2VXZA 3RKWA 2K7LA 2NRAC 2FEZA 5E17F 2IA2A 3IWFA 3RDIA 3PQJA 1RUOA 4KIBA 1F4KA 4GGGA 1LDJA 1O7LA 6PAXA 1B59A 3P9KA 2E1CA 1K6OA 3HTUA 3E6DA 2ELHA 2DW4A 2OQRA 4BYYA 2RNJA 3IC7A 1R1TA 3BJAA 1SFUA 3G73A 2JRTA 4LG0B 1P6RA 1WQ2A 2ZKZA 1I1SA 1TNTA 5LHHA 2OA4A 1FP1D 2FNPA 1U5TB 1ONVA 1ODDA 5EEHA 4GXOA 4I0BA 3V7SA 3ZP5A 1OYWA 1YYVA 2OAZA 1IRFA 2W84A 2R3SA 4CGZA 4Q4ZF 3QRFF 3RKXA 1H0MA 3K9TA 1SFEA 1QZZA 2ZMEB 3ABTA 4AIJA 1R22A 1TW2A 1R00A 2F2EA 3DP7A 3CDHA 2COMA 1ZN2A 2GZWA 3Q9SA 1UHWA 2M8EA 2A3SA 4H0EA 1BC7C 3F8NA 3TQNA 3GO5A 3CTAA 1ZG5A 1TLHB 2VBXA 3DEUA 2IP2A 2E1NA 3IL2A 3WODF 3BP8A 1IXRC 3M8FA 2NNYA 4L9TA 4XSXF 3HSFA 4IHSA 4RGUA 2KIMA 4KN7X 1W7PD 3LQRA 2P5LC 3P9IA 2D45A 2DBBA 4KMUX 1REPC 3KEQA 3GEZA 5D5VB 1S6LA 3J81Z 5ILUA 2P4WA 2RDPA 5HDKA 2MC3A 4XLPF 2Z99A 3GFMA 5CVVA 3O2PE 4GYIA 1LB2A 1OMIA 2ETHA 5JVTA 2IA1A 1FSEA 3JTGA 5E8GA 4ASNA 2VE9A 1RIOH 2JTVA 2FE3A 1ZGJA 4LJZF 1D8JA 3DPTA 4ZYHA 3B73A 1IZ1A 3R0AA 2L3DA 4CO8A 1BC8C 5BQTA 2PI0A 4IVNA 1YQAA 5LEJA 2PMHA 2FBHA 5HS8A 4HYEA 1IUYA 1IN4A 1STZA 3LWFA 2STTA 4UXNA 3HHHA 2YU3A 5AIQA 3AAFA 4HF0A 3F3XA 3LQQA 3JSPA 1KQ9A 1G6NA 4O3MA 4L0ZB 1IN7A 2HOEA 2Q2EA 1W4MA 4MQVA 2EFWA 1WRJA 1U8RA 3IKTA 3QOPA 3FM3A 2QLZA 4HW0A 1ZLJA 1IW7F 5ERIA 4M73A 4ON0A 2LKPA 4N9IA 5IT9Z 3TDZC 2C6YA 2DLLA 3B02A 3KLOA 2DQRA 2G7UA 1HW1A 5DD8A 3SZTA 4A6DA 2MLGA 1ON1A 2HFHA 3HOTA 2RN7A 1U5TC 3FF5A 1KU9A 4Y17A 1I6XA 4NHJA 2D2WA 2FSWA 4WXDA 5ICCA 2VBWA 3ML6A 4MEYF 3WTSC 1S3JA 5DCMB 1FSHA 4L5JA 2XAFA 5HLHA 3DF8A 4LK1F 1DP7P 4A12A 1B4AA 2XGXA 1R1VA 5L3EA 3BJ6A 3HSRA 3TO7A 1HQCA 2XKOA 1XMAA 1XGNA 4XRFA 4IRGA 2EV0A 4M9XA 4AVPA 5D4RA 1K78A 3LFKA 1TQMA 2LNBA 3HHGA 1QPMA 3I64A 2FOKA 1IXCA 3KEOA 2FMLA 3F21A 4S05A 3WE3A 2Y0MA 2F5CA 4BHCA 3KFWX 1TTYA 1S29A 2HGCA 5DD4A 4B8XA 4R79A 4RS8A 3M8EA 5CVJA 3IWZA 4GO1A 3ELKA 1YW8A 1G3SA 4JK1X 3D0SA 4M9SA 4PGGA 4OMZA 2H6CA 5ILSA 2QBYB 1SFXA 1MDMB 3LAJA 4OU0A 5HS7A 2VOPA 2XRNA 4L0YB 2MH2A 3HOSA 2EA4A 5JHUA 4KN4X 1HSTA 5L3FA 3VODA 4CICA 3WTZA 2Z5UA 1CGPA 4HLXA 2EB7A 3IKVA 1Z6TA 4KT5C 3GW2A 5L3GA 3V8JA 3ZN1A 1RUNA 1I1GA 4UV8A 5ICEA 3J81K 3GX4X 2MH9A 1L3LA 4P5OA 4U7BA 2EK5A 5F64A 5LEKA 4L9JA 3W6JB 3KP7A 3JW4A 1TNSA 1WWXA 4P96A 1A04A 1USTA 3Q9VA 1BIAA 1Y0UA 2BBYA 4B09A 1P4AA 4OOIA 5H6RA 5DUIA 2ESNA 2A5YB 2CYYA 3HRUA 3FMRA 5BPDA 1SMTA 3PFIA 1MJBA 3CJNA 1UCRA 4EGYA 3E6BA 1KGSA 4LG0A 1ZRFA 2XAHA 2QWWA 2VC1A 2O6GE 3O6BB 3BOQA 1IF1A 3I4PA 1IN8A 4WWCA 1XD7A 1FT9A 4WK8F 3MFKA 2GWRA 3RJPA 4L9NA 3C18A 2DQLA 3FXUA 1AOYA 2YPRA 1ZARA 3FZVA 3TDUC 4LFUA 1FPQA 2XV4S 5HOOA 3QPHA 1XDSA 3ZMDA 4MTEA 3P7NA 1HKQA 1D3YA 1H9GA 4I09A 1FNNA 3GVAA 4M74A 3I54A 3WE2A 5LHIA 1U3EM 4BHBA 5IT9K 2GA1A 1XSDA 2IW5A 1QZYA 3FXQA 1ZGAA 1P4WA 1WSUA 1BBYA 2Z3YA 4CYDA 2IA0A 3F8BA 5FFZA 2WTEA 3U2RA 1ZAOA 4G6QA 3LA3A 3U9GA 4G7OF 2RQPA 5BMZA 2R7FA 1YS6A 4HA8A 4KA4A 3ZMUA 1UB9A 4E70A 5LGTA 2H6BA 1MD0A 2OU2A 1FYKA 1QNTA 2X0LA 4M72A 1HW5A 2QYOA 4A0YA 2Q8KA 1MGTA 4QWQA 3DPLC 2CWEA 2PLYA 3OOPA 2HWVA 1O3QA 5BPIA 2OZ6A 4UVBA 2P6SA 1FWZA 3VFZA 2L02A 3JTHA 2K4BA 2K02A 1FX7A 3EETA 4MHGA 2NAZA 1KA8A 2KJBA 4O5VA 5L3DA 5LRSA 4TV7A 2A6HF 2F5EA 3GFLA 4UVAA 1ZH5A 3I0TA 5E18F 3K1NA 3HUGA 5FLXK 4FT8A 1T6SA 1LJ9A 3LAPA 4YFXF 5CJ9A 2WV0A 4RB3C 4XLNF 5D6FA 2QQBA 1XGOA 2J5OA 3HYIA 2P5KA 4NB5A 4BQAA 2EFPA 1PP8F 1ZLKA 3Q5FA 3FMSA 3L09A 3ISPA 1R7JA 4BAYA 5TRDA 1BI2A 1QGPA 3GZ6A 1J5YA 3I53A 1XCBA 2WWYA 2BYVE 1H9TA 4LB5A 4HX4A 1TQIA 3V8LA 1U2WA 3R61A 2A69F 3H3UA 2VODA 2F5DA 3EYIA 1OPCA 5HLIA 1OR7A 2O8XA 4Q47A 1O3RA 3RPQA 3T8RA 2HEOA 4HX8A 4BHPA 2PJPA 2RC4A 4PCQA 1Z9CA 1I5ZA 4A6EA 2V1XA 2XAJA 4HV6A 2V79A 4N9HA 1J9IA 4I0AA 1SD5A 2UWMA 1G3TA 2ZO4A 3ECOA 3CUQC 2W57A 4A0ZA 4IF4A 1YS7A 4WXHA 1KU7A 2P8TA 3TO9A 4AWXB 1V4RA 3BJOA 4ENMA 3E5UA 1YG2A 4ENJA 3M7GA 4Q48A 2IT0A 3ROUA 4LD5A 5L3CA 3HSEA 1Z6RA 2O3FA 2JSCA 2O03A 2O61A 5D6EA 3TOAA 3SZPA 2CQKA 3DQVC 1X3UA 3ZMSA 3J80K 1OYIA 5DCFA 1NHAA 1QO0D 4ZZLA 1HKTA 2HZTA 1W5TA 2HQRA 4L9VA 1MDMA 3WG9A 4XBFA 1W7PA 3BPXA 5LRRA 2ESHA 2HTSA 2DT5A 1XSVA 3KETA 4M6XA 5E1XA 1YTYA 1HXDA 5DV5A 3NEUA 2P6TA 2EJRA 1E2XA 2IJLA 2PQ8A 2HDCA 1FZPB 1JHHA 3QU3A 2L01A 1GXPA 1MJAA 2XHKA 5K1YA 4LK0F 2NS0A 3I71A 1YO5C 3O3KA 4JQFA 3COAC 1LNWA 3T5XA 4FHTA 2VE8A 4ENKA 1MZBA 4ZYEA 1E17A 4RAYA 5E8IA 2K27A 3FXRA 3K1MA 2LSOA 1O3TA 1UFMA 2FF4A 3J7AO 2G7HA 2ISYA 4WCGA 1O3SA 3QAHA 4Q5SF 1GVJA 4KIFA 4P9UA 2FBIA 5E1ZB 2J5PA 3CLOA 2A61A 3MCZA 4M6YA 2DK8A 3WTYC 5JFRA 2DPDA 1IAWA 3SHFA 3G3ZA 2K86A 4EV0A 4ESBA 2PFBA 2QUFA 2ZJ2A 3ABUA 1ZG1A 5BS6A 1P2FA 2QVOA 1UHMA 2OQGA 4HQEA 4IHTA 1J0RA 3JAMZ 2MA3A 4MGRA 3KCCA 1J59A 1R23A 1MKMA 2AXLA 4IJAA 2ZXJA 3R0JA 1TBXA 3EQLF 3W6KB 1D8KA 2CGPA 3WTUC 2CO5A 1TQPA 4CXFA 2H09A 1R5GA
chains in the Genus database with same CATH superfamily
3PIPF 1XTAA 3JSOA 1K4TA 3TOBA 4ESJA 3M1EA 2CU7A 5D8LB 1E3PA 5D5WB 3LFUA 5LGNA 5FLXZ 3F6OA 5DDGA 5FD6A 3TMOA 5K5OA 1Z1DA 1DPRA 2RQQA 1HDDC 1Z3XA 3T0YA 1J7KA 3N97A 3VOEA 2Z16A 1HW2A 3P9CA 2VIXA 1LDKB 1M1EB 2LF8A 5CVRA 3PNVA 1GXQA 2IGMA 2DK5A 1U6GA 2DFEA 2ELKA 2M1BA 3K0LA 3V7RA 4MQ9F 4A3FJ 3ZQIA 1QQIA 3SDBA 4PJ0C 1F43A 3KZZA 2ISZA 3OYJA 4NBQA 5KHDA 5FJ8J 2TRTA 3FWEA 3AKZA 2BE5F 5HVQC 4IZZA 4KNYA 1JGSA 2V9PA 1QHHD 4RAFA 2M7AA 2XF5A 1HKSA 1T95A 1Z91A 5J8FA 1H89C 2COBA 1EH7A 1ZELA 3REOA 4CCNA 3DV8A 2K9NA 4KUMA 4LG3A 3H5AA 1C0WA 3BG3A 4J19A 1X19A 4A0XA 1W36D 1YFHA 3BT9A 3EUKL 3WTWC 1LQ1A 1ETWA 4D0PA 1VQLI 4M9ZA 5F6FA 3F22A 1UZCA 2D5VA 2VT2A 3LSPA 1LFPA 5H2FC 1YX5A 1TW3A 2HQAA 2Q2EB 2Y2ZA 4CDGA 3WGIA 2QQAA 5FGMA 5E1WA 3WGHA 5E3NA 3M9AA 4F7ZA 1F9NA 5LFAA 4I99C 4XSZF 5FB2A 5D8KB 4ZYDA 3MZHA 1AU7A 2GBYA 1BW5A 5CYVA 1ZRCA 2OD5A 4HDUA 3PQKA 3A1YA 2OCEA 5A2QZ 2YSRA 5EG0B 1GT0C 3H92A 2NVQJ 1BIBA 2PG4A 3QODA 3W2VA 3OYMA 1D0YA 4HF2A 4HLYA 1FBUA 1WKMA 3BC8A 3OSGA 3CCEI 1D1BA 3WU2C 5FKLA 1OKRA 4LGWA 4XLAA 4BBSJ 2K9SA 2K9MA 3QYBA 3J7AY 1ETOA 2LF7A 3BR2A 5EEAA 3H36A 5J3LA 5LLQA 3RIRA 4UVCA 3RZDJ 2O9LA 1CF7B 2R93J 2ZXIA 3C7JA 3MAJA 4P9FA 1K61A 5B66C 1Y1VJ 2DAOA 2X9DA 1U5TA 1NG7A 2JUGA 2LG4A 3CMMA 3NRVA 4DJAA 2QA4I 4EJOA 3MEXA 2DOAA 4QLCU 2B9SA 4FETA 2XAGA 4U7DA 1Z67A 2DU9A 2HTJA 1H88C 1BI0A 2V9KA 2BY3A 2XUBA 3OV8A 1S7EA 4UV9A 4GYGA 3ZQ7A 1J2XA 1KU2A 3CO6C 3RI4A 3CUQB 4AD9A 1SD6A 3DCFA 2LBFA 2R7SA 3WHBA 2O5RA 1P4XA 2LD5A 5TGTA 5TJJA 4AIKA 3OYAA 1R5HA 2A6EF 2HKXA 2ZMEA 4PZJA 3HOXJ 3GTLJ 4IL6C 3WU1B 4ZDOA 3H0DA 2HYFA 2X4HA 4HV5A 2DN0A 1ON2A 2LY9A 4EM1A 2DFIA 2FXAA 1FP2A 2BXYA 3BDDA 3V7CA 3J80Z 2VLAA 3RKQA 1IJWC 5CPRB 2PN6A 2GLOA 1EF4A 4GCVA 4LIUA 1FTTA 1RZ4A 3BY6A 3WTVC 4HNVA 1WPKA 4U0VA 3CP8A 2K3FA 2VXDA 2FA5A 2A07F 5HLGA 3I59B 4BEHA 2BV6A 1OFCX 4WXCA 2XASA 3FIWA 1SD7A 2OUMA 3ZRGA 3S8PA 2F48A 1S7AA 1FOKA 3BWGA 4XLFA 4BQQA 1ZKGA 5LGUA 2L4MA 2XIGA 1Z05A 1MW7A 1MJ9A 4S0HB 3MQ0A 2JPBA 4A3EJ 1ZREA 3K70C 1U8BA 1MBHA 3HKZN 4A5MA 3SFZA 1LE8A 3OS0A 3LSTA 1FYLA 4UUVA 1ZR4A 1MBJA 1WJFA 2CW0F 2BGCA 3K69A 3OR2C 5F27A 1XN7A 2HPMA 2PBIA 5FO5A 1FC3A 2WAQN 3VYRB 2MYSA 1KYWA 3IV5A 3R60A 3MZYA 3RSNA 2FU4A 2HS5A 1BI3A 2VN2A 2HYGD 2L54A 2N8GA 4KIGA 4U0WA 5GP9A 3ZMZA 2L9SA 4RGSA 4D5CA 1NK2P 1RC9A 3E5XA 4F93B 1JTXA 4I01A 2K9QA 1YX3A 1JUMA 5E3MA 1WGXA 1VFCA 1P9QC 1WZ2A 5ED4A 3AG3H 1X1CA 2NVYJ 3OYKA 1R36A 5D5XB 5GAGJ 3JAMK 3AL0B 1OYYA 4UHTA 1LKXA 4RM2A 2LH9A 4A2UA 2E7WA 4BQNA 5FROA 1IN5A 5FD5A 1FBSA 4A3DJ 3TL4X 4CH7A 2GA2A 4E7JA 1MIJA 3CCUI 1SANA 2JT1A 4OIRF 4HQMA 1KQ8A 3EYYA 3ERED 3CC4I 4S04A 3ZPLA 5CVUA 1Q1VA 2IS1A 4XLCA 2CG4A 9ANTA 4E4HA 4PDKA 4PJMA 1PDNC 2DA2A 4C9YA 4RB0A 3KZYA 3JRAA 2F5FA 1IV6A 3BPVA 1EJ9A 3GUDA 3VYSB 3M3YJ 4FX0A 3HOVJ 3FMQA 3GZNB 1IV8A 2JVHA 1N25A 1K7AA 3GXOA 3WHCA 1QU3A 2QQ9A 4EJVA 1QPIA 1WI9A 3HJEA 2RGVA 2HQ5A 1HF0A 1A5JA 5J8CA 3OYFA 3D1NI 1RETA 2ME0A 3CMAI 1LDDA 1B9MA 1RR7A 4CZZA 3N4MA 2YU9J 2NYXA 2WAQA 1BM9A 1PUFA 3DXJF 2IS6A 3CUOA 2KDZA 2Y48A 1VQ4I 3RQIA 3GLXA 2AHQA 3LSMA 2VONA 3CQZJ 4B47A 1TC3C 2Q0OA 3OS1A 3QYEA 4XN0A 5DYMA 3H3ZA 1B8IA 4XONA 1XDUA 4JYKA 5C4XJ 1R9TJ 1BW6A 5M5YJ 5ICFA 5LBQA 4F55A 4NQWB 5K5RA 2QEXI 3EUAA 2IXSA 2ZC2A 1ZTRA 1RPWA 1VQ5I 3BQZA 2E35A 4C2MJ 3WGGA 4EJWA 3GWZA 3DWLE 1JI8A 4N0BA 5EZGA 2DA4A 4GRIA 5JLWA 4I2OA 3D5RC 2OBPA 2FNAA 2UZKA 2MFZA 2KQRA 1TP4A 2EILH 4FE4A 2R7OA 4KITB 4OIOF 1ZHFA 2KLOA 4DYRA 2L7KA 2ZNYA 3F8CA 3SQNA 2WC2A 4CHUA 1IN6A 2DODA 1QVUA 2R7VA 4JOMA 5IP9J 2IRFG 1FIPA 1SAUA 1U0JA 2M30A 5EEGA 2HQNA 4EJTA 1MNMC 5A2QK 4J01A 3KP4A 2DTRA 4ZH4F 1ZRDA 4E7HA 1O57A 1XG1A 4OIPF 4BXUA 2W25A 3Q3SA 3HRSA 4N4NB 1BL0A 3DBLB 5DCMA 2R7UA 2EZKA 3RTRA 1EV7A 3I4MJ 4B4CA 1F36A 2M0CA 1ZGWA 1ZQ3P 4M71A 3K2AA 2O0YA 3S93A 2E5NA 3HRTA 3OYGA 2VPRA 3K4KA 3KE2A 3SXYA 3WU0A 3DLLF 1EH6A 2ZNZA 2R7ZJ 2ZB9A 1LEBA 5FFXA 4XK4A 1EA3A 2BVLA 4RB2C 3C3WA 3QOEA 1X1DA 1XMKA 2JPCA 4FISA 2QZ8A 2Z33A 3F23A 2ADUA 3RPUA 3S1RJ 2R5ZA 1TWHJ 2VC0A 4QPQA 2FRHA 3BTIA 2K85A 3S3OA 4EGZA 3GTMJ 1SD4A 2EZIA 4JX5A 2LDUA 4K2EA 3TO6A 4A3CJ 3OYEA 2UXNA 1PP7U 3OYDA 3HDDA 2EIKH 2NNNA 4I02A 2KIQA 2KKOA 3DEEA 1AWCA 3OOUA 4Z2YA 1D0XA 2XGEA 5CKTA 2HVQA 1XS9A 4M3DA 3LSRA 3CC2I 2KRFA 3HC7A 5BOXA 2DDAA 2F4OB 3QPTA 3GFIA 3DEWA 1XGSA 4IXAA 3LA2A 4XL9A 2W24A 4CYCB 3FISA 2OPTA 2MC4A 3JRGA 3D5LA 4EMSA 2QKMB 5ICGA 5DUKA 4I76A 4JBAA 2QBYA 2KIFA 2RNGA 2XGDA 1FBQA 5KK1A 3ZMVA 3V42A 3T1BA 1WJ5A 1RI7A 4IEJA 1YIOA 4B48A 2F6CA 2V6CA 3HOYJ 2LR8A 1TT0A 3CJRB 5JI6A 2KL4A 3MD2A 2G0EA 4MEXF 3ASNH 1T38A 1QRYA 3WTXC 5HS9A 3EUHC 3KLNA 1APLC 2Y75A 2KRCA 2P5VA 2XAQA 2NS7A 2MD5A 3E5QA 4ENNA 4BDYA 5LHGA 1K4SA 3CDLA 3GTGJ 2EFQA 1ITYA 1I3QJ 1DDNA 3GF2A 3BG9A 1JKOC 3BROA 1U78A 2CUEA 2H27A 2K4JA 1JKPC 1WJEA 1DPUA 1QBJA 4C3HJ 4I98B 4EM2A 3K4MA 1XCVA 4G7ZF 3AL0C 1MH4A 1X4OA 2NVTJ 1XB4A 2ZSHB 3FM5A 1HA8A 1GVDA 5AIPA 4C2TA 2D1HA 2STWA 2HDWA 3R6SA 3RYPA 2JZYA 1I50J 4UUSB 2V1UA 2H1LA 3BZCA 4ZJZA 4HPQA 3FXJA 3K6GA 3L2UA 1O7FA 3ZR8X 3Q0VA 5H6QA 1G3YA 3U1DA 3L9FA 3IRQA 4V2GA 3UKGA 1XSXA 2YX4A 1B6AA 3KP3A 2FQ3A 2M9HA 4M3FA 2M34A 1GHCA 3OYLA 1ACIA 2AO9A 2CUJA 1DGRM 1ETYA 4BNCA 2EQRA 2M4KA 1I3AA 5DEQA 4U0YA 2ACJA 2PJRA 1X1BA 2QENA 4NUBA 3CCSI 1JGGA 1FTZA 1OQYA 2BEOA 2VI6A 3O8HA 2VBZA 2R7TA 2P0WA 2P7CB 4HX7A 1G3WA 2UXXA 4IOAF 5HDGA 4R1HA 3RKYA 4BBRJ 3ESWB 4RB1A 3X2QH 5CLSA 3KEYA 3QPLA 2PMUA 3VWBA 3PL8A 2HZDA 4OAZA 2HOSA 3ECHA 3TKYA 1CF7A 3S2HJ 5GADJ 2XKPA 4YG2F 3HTSB 2CSOA 4BY7J 1MSEC 1FLIA 2AQEA 1IDZA 2E7XA 2RV8A 1D1AA 2TDXA 3PSIA 5EYRA 1FYMA 2D1VA 3F8FA 2FBKA 3ZMTA 2W7NA 2LC2A 3K2ZA 3IHUA 3C1DA 2ZCWA 3NQOA 2HVSA 2OZUA 3S3MA 3KYDB 2ZBKA 2PMZA 3TP0A 1T33A 2PX9A 4Y13A 1Z7UA 3HZJA 4XRSA 3CUQA 2YR2A 1JJ6C 3W6VA 3KZIC 2VKHA 4PJLA 1V5EA 2H94A 2Y69H 3GYHX 2JK3A 2RVCA 2XROA 1YIJI 5F04A 1PUEE 2ECCA 2IVMA 3K4CA 5CVIA 1UJ8A 2VJJA 2GXBA 2P7VB 2EA2A 3I4NJ 2ZFWA 3LA7A 4CUGA 2RKHA 3IH2A 3F72A 3F8MA 2A68F 3VDXA 2B63J 2WY8Q 4F52A 4HOBA 5K7FA 2PEXA 1VQKI 2CV0A 1SAXA 5K5QA 2VOOA 2JWTA 2XVCA 4L5IA 5KVRA 1OCCH 1LEAA 1Q1HA 3E3VA 3GZ5A 2KMUA 4DNCA 3OR1C 4XKBA 3ZQFA 2X51A 3K1PA 4R8HA 3I59A 3CO7C 2V6EA 3OL4A 3E0JB 2GAUA 3E97A 3HPGA 4Y15A 4EQQA 3E6CC 1B9NA 2L4AA 3LL7A 1F5TA 1LVAA 5F1RA 1Y56A 4LMYA 1HBXG 1VTNC 2EFOA 3BTJA 4IPAA 3R4KA 4RGRA 3PJRA 5EDNA 4LLLA 4AM3A 3FHZA 2DYRH 3E6MA 2FMYA 5F0HA 2WB1A 3L00A 4U88A 4L18B 4DIQA 4B3XA 4ETSA 1DUXC 3IRRA 1Z21A 2MBFA 5EGOB 1YHQI 2WBMA 4XRSG 4Y52J 2M3AA 3K7AJ 1JXSA 1W7PB 4AYBN 3QP6A 1D1CA 3KYCB 4YIFA 2GXGA 3GFJA 4KICA 1T2KA 1YJNI 5L3BA 3SDGA 4HBLA 1VQOI 4B3AA 3EUHA 3S1NJ 3KP2A 3QP5A 2R4GA 4ESFA 1F1ZA 1KU3A 4MTDA 2YX7A 3KYLA 1S72I 1EH8A 2ELJA 4X0GA 5JLXA 1KQ0A 3PNTA 1T39A 1D5VA 1ZYRF 2W1OA 4DQ2A 2VJIA 1T0FA 4PGHA 3L7WA 2ZJRF 3ZOBA 2V9VA 4LLNA 2MGQA 4LB6B 2E1MC 1UG0A 2DPUA 4G94A 1G4DA 1WJCA 1D0ZA 1PVEA 2EFNA 2L2OA 2NVXJ 2DCEA 2EWNA 1V55H 3RYRA 1R6RA 2NOJB 3FX3A 2B0LA 5J6XA 4HSRA 2E34A 3BZ6A 3ZCOA 4DZPA 4NC6A 2UV1A 1MBGA 1X4PA 2G9WA 2GQQA 3WTTC 2K3PA 4HF1A 1ZG3A 4G8XA 1R5ID 1YW9A 1YLFA 4IRHA 3IH4A 3RCOA 2B7EA 2DO7A 4YFNF 1KYZA 4WX9A 1TWCJ 1JJ8C 1XPXA 1I27A 1FY7A 2HKOA 4RBOA 4KMFA 3KP6A 5FKNA 4EM0B 1V3FA 3LSIA 2KDOA 5GTIC 5IOZA 4KJZA 2MSYA 3HRMA 3VEPA 2E60A 1AKHB 5H20A 5HDNA 4CZCA 3IUOA 2CV1A 2GIVA 3F6VA 4D1QA 2HI3A 2IGKA 2KZGA 2KIUA 3L2RA 4IRIA 1BOAA 5E20A 5EZHA 2XF7A 2W85A 4FE7A 3ZN0A 2MLKA 4DZJA 3FXOA 1T98A 4I7HA 1X1AA 2ECBA 5IT3A 2Z1DA 3K4LA 3O8GA 1JKQC 4OIQF 1A6QA 4FX4A 2E2IJ 2LY2A 1W5CC 1J75A 1T56A 5AONA 1SC7A 4UNOA 2VT3A 3DKWA 3GTOJ 1R58A 4EVIA 4MNUA 2R0QC 2EH3A 3F9KA 3IP4B 2VASA 1U9OA 2V1DA 4AIHA 4HAMA 4NQWA 2CRGA 2A5WA 2HR3A 5FKMA 2DMQA 3C2HA 1IDYA 5D4SA 1ULYA 1R71A 1YW7A 4BJTA 3E1SA 4AUXA 2BVMA 1K78B 3HOUJ 1IXSB 2M87A 4BH9A 2AS5F 2R7DA 2M5WA 1NG6A 3DU6A 3S2WA 4KDPA 1BJAA 1OR7C 2K9LA 1BN5A 1JKRC 1JHFA 3ULQB 1VF9A 2MG4A 4C2UA 3I5UA 2WA0A 1FMWA 2DI3A 4OMYA 3CCJI 4O6JA 3TGNA 1FEXA 3EDPA 2OV7A 1P7JA 3HL2A 5FRNA 4HDVA 3H1CA 4OINF 5DTDA 4RGXA 3U1KA 2RREA 1V5GA 3MMYB 1S7OA 4G9YA 2VBYA 3HGYA 2BXZA 1TWFJ 4A3GJ 3BG5A 1XGMA 3N05A 2QF7A 1IRGA 4EJUA 3LMMA 4E7SA 1W5SA 1P92A 3MWMA 3I58A 5FLMJ 1VZ0A 3CMYA 4PSXA 2XF6A 4YIIA 3V4GA 1B1BA 4BS9A 3K4NA 1SMYF 4HZFA 4BY1J 3DFGA 1WCMJ 5C44J 4BACA 3T8TA 1H8AC 2EV5A 4BKXA 3HOWJ 2P81A 1FOYA 3ZQGA 5ILVA 3BR6A 4ZZDA 1MNEA 3A03A 3HIFA 1USSA 2KRHA 1OISA 2ZXWH 3TW6A 3VB2A 1SEUA 2JVGA 3L2CA 1FOWA 5D5UB 4Y3OA 1R4NB 4WF2A 1X3WB 2E5ZA 1HSJA 3V8KA 2M45A 1EKEA 2OCCH 2KJCA 2IPQX 3EPZA 1L0OC 1JTYA 2Z9OA 2QM3A 1S8NA 3LSKA 4RAZA 2CFXA 1JE8A 5HNHA 4X1EA 1BI1A 4JP0A 4CCLA 4P55A 2XSDC 1YRNB 3ASOH 4NDLA 5JR3A 2EV6A 4A5NA 2ZFUA 2XPWA 2WY7Q 4E7ZA 3HPHA 4G7HF 3S1MJ 4G6DA 4QPOA 1K79A 3QU6A 1DP3A 1RNLA 2W48A 4ZYGA 4LLGF 4YFKF 2QSHX 3A2KA 4KFCA 1R1UA 1SVLA 2VQLA 3ERMA 3KP5A 1D5YA 3CDIA 2DA1A 3CF2A 2IS4A 2VXZA 4CYCA 4IHYA 4F91B 3RKWA 4CSWA 2K7LA 2NRAC 2FEZA 3ZQHA 5E17F 1GV2A 2IA2A 3IWFA 3RDIA 1TZLA 3PQJA 3SYTA 1B72A 2QKLB 2ZXHA 1RUOA 3CCMI 4IO9F 1SVOA 4HSTA 4KIBA 1F4KA 3RZOJ 4GGGA 2DFHA 1JT6A 1LDJA 2XRLA 1O7LA 6PAXA 1E3OC 2R92J 1B59A 3P9KA 4YELA 2E1CA 1ETQA 3HKZA 3HTUA 1K6OA 2EBIA 3OL3A 3E6DA 2YS9A 5C4JJ 3DLAA 2ELHA 2DW4A 2LYCA 2OQRA 1NTCA 4XICA 4BYYA 2DA3A 1BOBA 1DQUA 1G2HA 2RNJA 3IC7A 1FJLA 1R1TA 3BJAA 1SFUA 2JRTA 3OYBA 3G73A 1HOMA 2JUCA 4LG0B 2IBDA 1P6RA 1WQ2A 2ZKZA 3FXKA 4E7LA 4D7MA 2CW8A 3J7YJ 1I1SA 2LP0A 1TNTA 2OA4A 1FP1D 2FNPA 3ZXSA 5LHHA 1U5TB 3ONQA 3RQ4A 2VQHA 1ONVA 1ODDA 1A6IA 1YJ9I 5EEHA 2FQ4A 4GXOA 3ABKH 2X1CA 4I0BA 1Z77A 3V7SA 3K70D 2WV1A 3SEZA 3ZP5A 2XB5A 1OYWA 2F4MB 1YYVA 4M3EA 4E7KA 2OAZA 1ETVA 2L7MP 4OWRB 2A05A 1IRFA 2W84A 2R3SA 1VQ8I 4CGZA 3MVPA 2R7XA 5IYDJ 4Q4ZF 1E3HA 3QRFF 4AVZA 3RKXA 1I6HJ 1H0MA 3K9TA 1SFEA 2QSFX 1QZZA 2ZMEB 2XDVA 3PUFA 3M1CA 4IX7A 3ABTA 4AIJA 1R22A 4IHWA 1LVKA 2CQQA 1TW2A 5B5EC 4PUSA 1S5LC 4DBRA 1R00A 2F2EA 3HEFA 3DP7A 3CDHA 2COMA 2CQNA 1ZN2A 2GZWA 3Q9SA 4PK4A 3FDYA 1UHWA 2M8EA 2A3SA 4BXFA 5J4VA 4H0EA 1RR8C 1BC7C 3F8NA 3TQNA 2R5YB 4YEJA 1VQ7I 3GO5A 3CTAA 1FIAA 1QVTA 1ZG5A 2L9NA 3DTKA 4HG2A 1TLHB 2VBXA 4Y4RA 3DEUA 2IP2A 2E1NA 3IL2A 3WODF 1U9NA 2UUZA 1WH7A 3BR3A 3BP8A 4H4KC 1IXRC 1T08B 2CW7A 3M8FA 2M2EA 2NNYA 5GAHJ 3JRBA 2DJNA 2WAFA 4L9TA 3S1QJ 2DA6A 4XSXF 3ZQLA 1MMNA 3HSFA 4A3IJ 2WAEA 4XLEA 3A0BC 2X85A 4IHSA 3OYIA 4RGUA 1R4MB 2KIMA 2L5QA 3JR9A 4KN7X 2ZJPF 4IOCF 2JA7J 2K40A 1W7PD 3LQRA 5IYCJ 2P5LC 3P9IA 4IKFA 2D45A 2DBBA 4KMUX 3BR5A 1REPC 3H5RA 3TW7A 4A3KJ 1JUPA 3KEQA 4PJNA 2CS3A 3GEZA 5D5VB 3CCQI 4XORA 4HNUA 1S6LA 3L2QA 2LREA 3J81Z 5ILUA 2P4WA 2RDPA 4PFPA 2LKSA 2HOAA 5HDKA 4RLQA 3HXLA 2MC3A 4XLPF 2Z99A 3GFMA 2E1MB 5CVVA 2BW3B 3O2PE 4GYIA 1LB2A 1OMIA 2KT0A 1VI0A 2ETHA 5JVTA 1WHUA 2IA1A 1HCRA 1FSEA 1UHSA 2HU9A 3W3CA 3JTGA 1W0TA 5E8GA 4ZTFA 3JRCA 4ASNA 4IQJA 4CCJA 4PFOA 3BR0A 2VE9A 1RIOH 3MKLA 2JTVA 2FE3A 1ZGJA 3NARA 4LJZF 1D8JA 2F4IA 2VJ4A 4XOTA 3IH3A 3DPTA 2EZHA 1Y0NA 2X1EA 3G1MA 4ZYHA 3B73A 1IZ1A 3R0AA 3OIQA 5HNFA 4II2A 4BU2A 2L3DA 2FUG2 1QZEA 3SJMA 5EGOA 2ID3A 4CO8A 1BC8C 2BY2A 4NNJA 1BJZA 3OYCA 5BQTA 4XR6A 2PI0A 2F5VA 3HUGB 4IVNA 1YQAA 2W00A 2K5CA 5LEJA 1VNDA 2PMHA 4BE0A 2FBHA 5HS8A 4Z6YA 2DOEA 4HYEA 1IUYA 3BZKA 3M07A 2Y31A 2ZJQF 1IN4A 1STZA 3LWFA 4Y7NJ 3LOCA 4UUTA 2STTA 2L9RA 4M3GA 3CC7I 1G8XA 4UXNA 3HHHA 2YU3A 5AIQA 3AAFA 1JT0A 1VQ9I 4HF0A 3F3XA 1IO2A 3LQQA 3JSPA 1GDTA 1KQ9A 4XIDA 4V19K 1G6NA 4O3MA 4L0ZB 1IN7A 2HOEA 2Q2EA 3P5JA 1W4MA 2VB6A 5CQEA 4MQVA 2EFWA 3NAUA 1UAAA 4QSHA 1B8IB 1WRJA 4ABZA 1YI2I 1U8RA 3IKTA 1MMDA 3S3NA 2AQFA 2LK2A 5DM7F 2HNHA 2BOLA 3QOPA 4BL0B 3FM3A 5J1UA 5EG0A 3H9QA 2QLZA 4HW0A 3CJTB 2E1OA 1ZLJA 1IW7F 3OMYA 5ERIA 2IAIA 4M73A 4ON0A 2LKPA 4N9IA 5EF6A 1MMGA 2GXAA 3SZGA 5IT9Z 1W0UA 3TDZC 2C6YA 1P7IA 2BHYA 2DLLA 3HBLA 2DT7B 3B02A 2CUFA 3KLOA 2DQRA 4BXXJ 1WI3A 4DOZA 2G7UA 2JMWA 1HW1A 5DD8A 1J09A 3SZTA 3JCUC 4A6DA 4BDZA 2MLGA 3GBGA 3ZGKA 1AKHA 2V7FA 3DBHB 2LFBA 1ON1A 5F0FA 2HFHA 3HOTA 2EINH 1UG2A 4LIVA 3VYUB 3JRFA 1K6YA 2RN7A 3AG4H 1U5TC 3FF5A 3OIPA 3JRDA 1KU9A 1WVRA 2MD0A 3BR1A 1SFKA 4Y17A 1I6XA 4NHJA 2D2WA 2FSWA 4F3QA 4WXDA 3BQYA 5ICCA 2VBWA 3ML6A 4MEYF 3WTSC 1Y39A 1S3JA 5DCMB 2DMTA 1FSHA 4L5JA 2XAFA 5HLHA 3DF8A 4LK1F 1DP7P 4A12A 1B4AA 5FKKA 2XGXA 1R1VA 5L3EA 1X3ZB 3BJ6A 3CESA 3HSRA 5LD2C 2E36A 3OIOA 3DBRB 3TO7A 1HQCA 5DS9A 2XKOA 2V26A 3I55I 1XMAA 2XSJC 4RDUA 2ZMEC 2VKEA 5IOYA 1MMAA 1XGNA 3GCMA 3IAM2 3I9V2 4XRFA 3S2DJ 1K83J 4IRGA 3UNGC 2EV0A 2R5ZB 3GTPJ 4HEA2 4M9XA 3JRIA 1V5FA 4AVPA 5D4RA 2CUZA 1K78A 5HLTA 3LFKA 3LSGA 1TQMA 2LNBA 3HHGA 3GTKJ 3H3VK 1QPMA 3I64A 3IAS2 2FOKA 1IXCA 3KEOA 2FMLA 3F21A 1AHDP 2JRMA 3K10A 4S05A 1OJLA 2Y0MA 2F5CA 1AA7A 3WE3A 4BHCA 2LTPA 1WFXA 1ETXA 3KFWX 1TTYA 1S29A 4A3JJ 2HGCA 2L7ZA 3AG2H 5DD4A 4B8XA 4RS8A 2QGUA 3M8EA 4R79A 5JVGF 3UR3C 5CVJA 1Y8RB 4CCKA 1UMQA 3G6EI 3IWZA 2H8RA 3QWLA 3G2BA 4ZC3A 4GO1A 3K4BA 2E2JJ 1W1WE 3ELKA 1YW8A 1G3SA 4JK1X 3DPUA 3D0SA 3WG7H 4M9SA 4ITVA 4IQ4A 4PGGA 4DYQA 1ZR2A 1PJRA 2H6CA 4OMZA 5ILSA 2QBYB 1RKWA 1SFXA 4FCYA 2DMUA 2L7FP 3LAJA 1MDMB 4OU0A 5HS7A 5E3LA 2VOPA 2XRNA 4L0YB 2A6TA 2MH2A 3DKYA 3HOSA 2EA4A 1SFOJ 5JHUA 4KN4X 1OLTA 4J00A 4RMNA 2FOWA 1BR4A 3CCRI 1HSTA 5M3FJ 5L3FA 3VODA 4XLHA 4CICA 2AXTC 2KZVA 3WTZA 2Z5UA 1NK3P 2QQ8A 1CGPA 5FLVA 4HLXA 2EB7A 2WADA 3IKVA 1Z6TA 2ID6A 2LMDA 3BTLA 4KT5C 3GW2A 1YRNA 5L3GA 2Z2SB 3V8JA 2X48A 1RKTA 2LVSA 3ZN1A 1MBKA 2W4SA 1RUNA 1I1GA 4CCMA 3PIOF 4UV8A 3H9GA 3DU5A 4A3MJ 4MIMA 4ZTJA 5ICEA 3FHNA 2Q1ZB 2NXNB 4JX6A 3J81K 3GX4X 2BHZA 1MNDA 2MH9A 4MLOA 3A02A 2DT6A 1BA5A 1L3LA 4P5OA 5J40A 4U7BA 5E79C 2EK5A 5F64A 5LEKA 4L9JA 3W6JB 3PFYA 3KP7A 3JW4A 4MFEA 1TNSA 1WWXA 4P96A 1SVMA 1A04A 4RA2A 1USTA 3Q9VA 1BIAA 1Y0UA 2BBYA 3VYTB 2DJIA 3KPHA 4B09A 1X58A 1P4AA 4DGWB 4BGDA 2PJRB 4OOIA 5H6RA 5DUIA 4CCOA 2ESNA 1ETKA 2NS8A 2A5YB 2CYYA 3HRUA 5FKOA 2JA6J 3FMRA 5BPDA 4AYBA 1SMTA 3PFIA 4LOCA 2EIMH 5E3OA 1MJBA 1VQMI 2CQ7A 2EIJH 3CJNA 2DFFA 1UCRA 4EGYA 3E6BA 1KGSA 2W82A 4LG0A 4XOPA 5IY5H 1ZRFA 2ZSIB 2CMPA 1HDPA 2XAHA 2QWWA 1V54H 2VC1A 1YE9A 1IGNA 2Y0SN 2I8DA 2M0MA 2O6GE 2OF7A 4BJ5C 3O6BB 3GMEA 3S14J 4A3BJ 3BOQA 2XGCA 1IF1A 3BTCA 3I4PA 2GOXB 2XAUA 3S16J 1IN8A 4WWCA 2VKDA 1XD7A 2QSGX 1FT9A 4WK8F 3MFKA 2GWRA 3RJPA 5FRMA 4L9NA 3FXLA 4XNFA 3C18A 2DQLA 2BY0A 3FXUA 4XMYA 2YPRA 1N78A 1AOYA 1ZARA 3CP2A 3SFIA 3A01B 2KPMA 1IG7A 3FZVA 3TDUC 2CJJA 4KT6A 1Y1WJ 4LFUA 5J1RA 3NWSA 1FPQA 2OC6A 4IHVA 2XV4S 5HOOA 1WJDA 3OS2A 2VL8A 3QPHA 4CA0A 1XDSA 3ZMDA 4MTEA 3D5SC 3P7NA 1HKQA 2IGOA 1D3YA 5K7ZA 2VPLA 3B6AA 1H9GA 4ANJA 4ZYAA 3PUBA 4I09A 3G71I 3ABMH 2JA5J 4MFDA 2YUSA 4N4OB 2R5YA 1FNNA 4W97A 1VQNI 3GVAA 4M74A 4DW6A 3I54A 5K7HA 3WE2A 1Y8QB 2X6OA 4BHBA 5LHIA 1U3EM 5IT9K 5J47A 2GA1A 1XSDA 2IW5A 3H35A 1QZYA 3FXQA 3CMEI 2I10A 2L9VA 1ZGAA 1P4WA 1WSUA 1BBYA 3L2VA 3U21A 2HVRA 3CCLI 3GTQJ 1Z0XA 2Z3YA 4NC8A 4CYDA 2IA0A 3F8BA 5FFZA 4B43A 4EATA 2WTEA 1S9HA 3U2RA 1ZK8A 2Y0SA 3HG9A 3L1PA 1ZAOA 3A4CA 4G6QA 3LA3A 3U9GA 4G7OF 2IS2A 1POGA 4X6AJ 4MO7A 2CV2A 4EEFG 5C3EJ 2V1NA 4UB6C 2RQPA 5BMZA 3M4OJ 1MBEA 1X2NA 2R7FA 3E7LA 1YS6A 4HA8A 4KA4A 3ZMUA 2FD5A 1UB9A 4E70A 5LGTA 5IPAA 2H6BA 2M7BA 1IC8A 1MD0A 2OU2A 4RM3A 1FYKA 1TT5B 3L2WA 3OWTA 1QNTA 2X0LA 4M72A 4D5FA 5M3MJ 1HW5A 2QYOA 4A0YA 2Q8KA 5GPAA 1MGTA 4QWQA 2LOOA 2BW3A 4C3JJ 3PNYA 3DPLC 2CWEA 3FBIB 2PLYA 3OOPA 2XPVA 2HWVA 2LY1A 1LFBA 1O3QA 5BPIA 2OZ6A 4UVBA 5BNGA 3I3LA 2P6SA 3JRHA 1LFUP 1FWZA 3VFZA 3CD6I 2DXIA 4D7NA 2L02A 3MKZA 3JTHA 3FXMA 3ZQCA 2K4BA 2K02A 1FX7A 2L0KA 3FKIJ 4YRVA 4G12A 3BCBA 3EETA 4MHGA 2NAZA 4BJ6C 3OSFA 1ERDA 1KA8A 2KJBA 4O5VA 5L3DA 5LRSA 3LSHA 1MSFC 4TV7A 2A6HF 2F5EA 3GFLA 4UVAA 5KAIC 5JHFA 1ZH5A 3I0TA 1YITI 5E18F 2XPUA 3K1NA 3HUGA 1T8IA 5FLXK 5IYBJ 1ORKA 3CJQB 3LNQA 4FT8A 4XM3A 2EZLA 4BE2A 1T6SA 1LJ9A 3LAPA 4YFXF 3H0GJ 5CJ9A 2WV0A 4RB3C 4Y33A 4XLNF 1N75A 5D6FA 2QQBA 1XGOA 1UELB 1IRZA 2J5OA 3HYIA 3QYFA 2P5KA 4NB5A 3TBIA 4BQAA 2EFPA 1PP8F 1ZLKA 2KFDA 2DA7A 3Q5FA 3FMSA 2GM4A 2CQXA 2R7QA 3L09A 3W2AA 3DKXA 3ISPA 2I5UA 1IUFA 3HGGA 4NC7A 3BLYA 4B44A 4UUSA 1YJWI 1VQPI 3FBNB 1XMXA 1HLVA 2O7OA 5HODA 4E6KG 2LBFB 1R7JA 2KP6A 1OCPA 4BAYA 5TRDA 1BI2A 1TWGJ 3CCYA 1QGPA 2VUMJ 3GZ6A 3SEQA 4HRIA 4OAYA 1J5YA 3I53A 1XCBA 2DTZA 1LPQA 5IP6A 2BYVE 5IP7J 2WWYA 3RPUD 1H9TA 4PJJA 4LB5A 1BR2A 2OTLI 2CFOA 4HX4A 1TQIA 3V8LA 1Z7LA 1U2WA 1WJAA 1GUUA 2DOFA 2A69F 2LLKA 3R61A 3H3UA 5KAFC 1GLNA 2FX0A 1X2MA 2VODA 4AC0A 1XC5A 2F5DA 1HC8A 1XX5A 3EYIA 1OPCA 5HLIA 1OR7A 3CF5F 3FK7A 2O8XA 4Q47A 2MABA 3A0HC 1N77A 1O3RA 4ZDLA 3RPQA 4BEHB 4DBQA 3T8RA 4QIWN 2HEOA 4HX8A 5B1AH 3CLQA 4LITA 1A31A 1BR1A 4BHPA 2GOMA 3B6CA 4DYCA 1A36A 2PJPA 2RC4A 2Y30A 4F92B 3CZ6A 2DMNA 3FKJA 4PCQA 3F0CA 4XKCA 1G59A 1Z9CA 1I5ZA 3QPSA 4W1UA 4A69C 2V1XA 2XAJA 4HV6A 4G6TB 4A6EA 2JA8J 2DDBA 2V79A 4N9HA 4C3IJ 5B3SH 2JSPA 4RAGA 5M5XJ 2VQGA 4I0AA 1SD5A 3VPRA 1J9IA 1LE8B 2E71A 2HOTA 2UWMA 4B1RA 1G3TA 4GDFA 3OYHA 1KONA 2ZO4A 3ECOA 5GAEJ 3VSKA 4XQFA 5M5WJ 2KISA 3HOZJ 3OY9A 3CUQC 3H9JA 1ENHA 2W57A 4A0ZA 4XKVA 1X1PA 3ZQQA 4IF4A 1LUJB 1FOXA 2OJED 3AG1H 1YS7A 3S15J 3MN2A 1IRXA 2LRDA 2DA5A 1OCTC 5KCMA 3HM5A 4U87A 4XKWA 1RESA 4KYWA 1A35A 4WXHA 1KU7A 1OCZH 2P8TA 3OYNA 3TO9A 2EPFA 2H8WA 3VSLA 4AWXB 1V4RA 3BCAA 1DGWY 4UB8C 2O8KA 4M6VA 4L5EA 4JX4A 3BJOA 4ENMA 3E5UA 1YG2A 4ENJA 2E19A 3M7GA 4Q48A 2HPIA 2M8GX 1RRJA 2IT0A 3ROUA 4LD5A 1WJBA 4QTRA 5L3CA 3HSEA 3HB9A 3LSJA 2LKXA 1Z6RA 2O3FA 5DM6F 2JSCA 2O03A 2X6YA 2O61A 5GPCA 4C30A 5D6EA 3TOAA 3W2WA 3SZPA 2CQKA 3J7ZI 3MKYB 3DQVC 1X3UA 3ZMSA 4FQGA 3ABLH 3J80K 1OYIA 5DCFA 4UY8I 4D9JA 1NHAA 1CQTA 1QO0D 4ZZLA 5EJCA 1HKTA 2HZTA 1W5TA 2HQRA 4L9VA 1B72B 1MDMA 2HXIA 3WG9A 4XBFA 3M8JA 1W7PA 3BPXA 5LRRA 1DU6A 1TL8A 4M3BA 3G4SI 4FTHA 1QA6A 2Y9YA 2ESHA 2VJ5A 2HDDA 2HTSA 2DT5A 4AU7A 1XSVA 3KETA 2Y9ZA 4M6XA 5E1XA 1YTYA 1HXDA 2HXOA 5DV5A 2RAEA 3NEUA 3S32A 2P6TA 4FASD 2EJRA 1E2XA 1TWAJ 4BE1A 2TCTA 4P1WA 1PYVA 3DTEA 4E7IA 2NOGA 3H5NA 2IJLA 1PUFB 4I6ZA 2PQ8A 1T0FC 1VQ6I 2JN6A 2H1KA 2HDCA 1FZPB 1JHHA 3QU3A 2L01A 1I39A 1GXPA 1MH3A 1MJAA 4YIRX 2XHKA 2ICWG 2PMZN 3S17J 2X1DA 5F08A 3BG6A 5K1YA 4LK0F 2NS0A 3I71A 3CCVI 1YO5C 4V2FA 3O3KA 4A3LJ 4JQFA 2XC7A 3COAC 5TISC 4GFBA 1Z3YA 1LNWA 2FJ1A 1MMSA 3T5XA 4FHTA 1QHGA 2VE8A 4ENKA 1YOVB 1MZBA 4ZYEA 5J4YA 3PO2J 1E17A 4A93J 4RAYA 5E8IA 2K27A 3FXRA 3PSFA 3K1MA 2LSOA 2X6WA 2JA2A 1O3TA 1UFMA 2FF4A 3J7AO 5GTHC 2G7HA 5J1YA 4PSWA 2ISYA 4WCGA 5CQGA 3Q0WA 1O3SA 3QAHA 4Q5SF 1GVJA 4KIFA 4P9UA 2VKVA 2VQCA 2FBIA 2JJ7A 4IHXA 4XRMA 1MBFA 1NH3A 1OCOH 5E1ZB 2BZTA 2J5PA 3CLOA 3I56I 2A61A 3PO3J 3MCZA 3Q0UA 1KZHA 4M6YA 3C2GA 2JQ7A 3TEDA 2DK8A 3PM1A 3WTYC 2R7RA 1W36C 3C2BA 5JFRA 2DPDA 1IAWA 3SHFA 3BG7A 3DTIA 3G3ZA 1Y6IA 2K86A 4XN3A 2WB1N 5F1JA 5F0CA 4II3A 4EV0A 2BY1A 4ESBA 3NWTA 3G1LA 3GTJJ 1OCRH 2CH0A 3K4JA 2PFBA 2OTJI 4ZDPA 2QUFA 2ZJ2A 3ABUA 1JUSA 3GLLA 1ZG1A 4BQOA 5BS6A 2V4JC 1WH5A 1P2FA 2QVOA 2X6XA 1UHMA 4BUPA 5KNLA 3KIOA 2HYJA 2OQGA 4HQEA 4IHTA 1R49A 1J0RA 3JAMZ 4HNTA 2DMPA 2MA3A 5B1BH 4MGRA 3KCCA 1E0EA 1J59A 1R23A 2IGNA 3A01A 3JREA 2KHMA 1MKMA 2IEKA 3AFHA 2R7WA 2AXLA 4IJAA 2ZXJA 4RLFA 2NVUB 3QQAA 3R0JA 1TBXA 3EQLF 3W6KB 1DU0A 1D8KA 2MW8A 2CGPA 3MKWB 3FK6A 3WTUC 2CO5A 2XB0X 2ME6A 4KISA 2QCOA 1TQPA 3MZ8A 1O4XA 2GIZA 2DYSH 3TP3A 3G1OA 3KX2A 4CXFA 1FMVA 1GV5A 2M4GA 2H09A 1R5GA 4AIDA 2E2HJ
chains in the Genus database with same CATH topology
3JSOA 3TOBA 4ESJA 3M1EA 5D8LB 5D5WB 5LGNA 5FLXZ 3F6OA 5DDGA 5FD6A 5K5OA 1Z1DA 1DPRA 3T0YA 1J7KA 3N97A 3VOEA 1HW2A 3P9CA 1LDKB 2LF8A 5CVRA 1GXQA 2DK5A 1U6GA 2M1BA 3K0LA 3V7RA 4MQ9F 1QQIA 3KZZA 2ISZA 3FWEA 2BE5F 5HVQC 4KNYA 1JGSA 1HKSA 1Z91A 5J8FA 1EH7A 3REOA 3DV8A 4KUMA 1C0WA 4A0XA 1YFHA 1LQ1A 3WTWC 4D0PA 4M9ZA 5F6FA 3F22A 2VT2A 1TW3A 4CDGA 3WGIA 2QQAA 5FGMA 5E1WA 3WGHA 3M9AA 4F7ZA 1F9NA 5FB2A 4XSZF 5D8KB 4ZYDA 3MZHA 5CYVA 1ZRCA 2OD5A 4HDUA 3PQKA 5A2QZ 2YSRA 3H92A 1BIBA 2PG4A 4HF2A 4HLYA 1FBUA 1WKMA 1OKRA 4LGWA 2LF7A 5LLQA 3RIRA 4UVCA 1CF7B 3C7JA 3MAJA 4P9FA 2DAOA 1U5TA 3NRVA 4EJOA 3MEXA 4QLCU 2XAGA 4U7DA 2DU9A 2HTJA 1BI0A 2XUBA 3OV8A 4UV9A 3ZQ7A 4GYGA 3CO6C 1J2XA 1KU2A 3RI4A 4KYWA 3CUQB 4AD9A 1SD6A 1P4XA 5TJJA 4AIKA 1R5HA 2A6EF 2HKXA 2ZMEA 4PZJA 3WU1B 2HYFA 2X4HA 4HV5A 1ON2A 4EM1A 2DFIA 2FXAA 1FP2A 3BDDA 3V7CA 3J80Z 2PN6A 4GCVA 1RZ4A 3BY6A 3WTVC 4U0VA 2FA5A 2A07F 5HLGA 3I59B 2BV6A 4WXCA 2XASA 1SD7A 1S7AA 1FOKA 3BWGA 5LGUA 2L4MA 2XIGA 1Z05A 1MJ9A 3MQ0A 2JPBA 1ZREA 4A5MA 3SFZA 3LSTA 1FYLA 4UUVA 3K69A 2CW0F 2BGCA 1XN7A 2PBIA 5FO5A 1FC3A 1KYWA 3R60A 3MZYA 2FU4A 2HS5A 1BI3A 2VN2A 2HYGD 2L54A 4KIGA 4U0WA 3ZMZA 4RGSA 3E5XA 4I01A 5ED4A 1R36A 5D5XB 3JAMK 1OYYA 4UHTA 4A2UA 2E7WA 1IN5A 5FD5A 1FBSA 2GA2A 2JT1A 4OIRF 4HQMA 1KQ8A 3EYYA 3ERED 4S04A 3ZPLA 5CVUA 2CG4A 4PDKA 1PDNC 4RB0A 3KZYA 2F5FA 3BPVA 3GUDA 4FX0A 3FMQA 1K7AA 3GXOA 2QQ9A 4EJVA 1WI9A 2RGVA 5J8CA 3N4MA 1LDDA 1B9MA 4CZZA 2NYXA 1BM9A 3DXJF 3CUOA 2Y48A 3GLXA 2VONA 2Q0OA 5DYMA 3H3ZA 1XDUA 5ICFA 5LBQA 5K5RA 3WGGA 4EJWA 3GWZA 4N0BA 4I2OA 2OBPA 2FNAA 2UZKA 4OIOF 1ZHFA 2ZNYA 3F8CA 3SQNA 2WC2A 4CHUA 1IN6A 2IRFG 5EEGA 2M30A 2HQNA 4EJTA 5A2QK 3KP4A 2DTRA 4ZH4F 1ZRDA 1O57A 4OIPF 4BXUA 2W25A 3HRSA 5DCMA 3RTRA 1EV7A 4M71A 2O0YA 3HRTA 3SXYA 3KE2A 3WU0A 1LEBA 1EH6A 2ZNZA 5FFXA 4RB2C 3C3WA 1XMKA 2JPCA 2Z33A 2QZ8A 3F23A 2ADUA 3RPUA 2VC0A 2FRHA 4EGZA 1SD4A 2LDUA 4K2EA 3TO6A 2UXNA 1PP7U 2NNNA 4I02A 2KKOA 1AWCA 4Z2YA 2KRFA 5BOXA 3QPTA 3GFIA 1XGSA 4IXAA 3LA2A 2W24A 3D5LA 4EMSA 5ICGA 5DUKA 4JBAA 2QBYA 2KIFA 5KK1A 1FBQA 3ZMVA 3T1BA 1RI7A 1YIOA 2V6CA 5JI6A 4MEXF 1T38A 3WTXC 5HS9A 3KLNA 2Y75A 2P5VA 2XAQA 2MD5A 3E5QA 4ENNA 5LHGA 2EFQA 1DDNA 3GF2A 3BROA 1U78A 2H27A 2K4JA 1DPUA 1QBJA 4I98B 4EM2A 1XCVA 4G7ZF 1XB4A 3FM5A 5AIPA 2D1HA 2STWA 3R6SA 3RYPA 2JZYA 2V1UA 1O7FA 5H6QA 1G3YA 3U1DA 3L9FA 3IRQA 1XSXA 2YX4A 1B6AA 3KP3A 2FQ3A 1GHCA 4BNCA 5DEQA 4U0YA 2ACJA 2QENA 2BEOA 2VBZA 2P7CB 4HX7A 1G3WA 2UXXA 5HDGA 4R1HA 3RKYA 4RB1A 5CLSA 2PMUA 3ECHA 3TKYA 1CF7A 4YG2F 2XKPA 3HTSB 2CSOA 1FLIA 2E7XA 2RV8A 2TDXA 1FYMA 2D1VA 3F8FA 2FBKA 3ZMTA 3K2ZA 3IHUA 3C1DA 2ZCWA 3NQOA 2OZUA 2ZBKA 4Y13A 1Z7UA 3CUQA 2YR2A 2H94A 3GYHX 2RVCA 2XROA 1PUEE 2IVMA 5CVIA 2GXBA 2P7VB 2EA2A 2ZFWA 3LA7A 2RKHA 3F72A 3F8MA 2A68F 4HOBA 2PEXA 1SAXA 5K5QA 2VOOA 2XVCA 4L5IA 5KVRA 1LEAA 1Q1HA 3E3VA 3GZ5A 4DNCA 3K1PA 4R8HA 3I59A 3CO7C 2GAUA 3E97A 4Y15A 3E6CC 4EQQA 1B9NA 2L4AA 1F5TA 1LVAA 5F1RA 4LMYA 1HBXG 1VTNC 2EFOA 4IPAA 3R4KA 4RGRA 4LLLA 3FHZA 3E6MA 2FMYA 3L00A 4U88A 4L18B 4ETSA 1DUXC 3IRRA 2MBFA 1JXSA 1W7PB 3QP6A 4YIFA 2GXGA 3GFJA 4KICA 1T2KA 5L3BA 4HBLA 3EUHA 3KP2A 3QP5A 4ESFA 1F1ZA 1KU3A 4MTDA 2YX7A 1EH8A 1KQ0A 1T39A 1D5VA 1ZYRF 4DQ2A 1T0FA 4PGHA 3L7WA 2V9VA 4LLNA 4LB6B 2DPUA 4G94A 1G4DA 2EFNA 2EWNA 3RYRA 3FX3A 2B0LA 5J6XA 3BZ6A 2G9WA 2GQQA 3WTTC 4HF1A 1ZG3A 4G8XA 1YW9A 1YLFA 4IRHA 2DO7A 4YFNF 1KYZA 4WX9A 1I27A 1FY7A 2HKOA 4KMFA 3KP6A 4EM0B 1V3FA 3HRMA 3VEPA 5H20A 5HDNA 2GIVA 3F6VA 2KIUA 4IRIA 1BOAA 5E20A 2W85A 3ZN0A 2MLKA 1T98A 4I7HA 5IT3A 4OIQF 4FX4A 1J75A 5AONA 4UNOA 2VT3A 3DKWA 1R58A 4EVIA 4MNUA 2V1DA 4AIHA 4HAMA 4NQWA 2HR3A 5D4SA 1ULYA 1YW7A 1K78B 1IXSB 2M87A 4BH9A 2AS5F 2R7DA 2M5WA 3S2WA 4KDPA 1BJAA 1BN5A 1JHFA 3ULQB 3I5UA 2DI3A 4OMYA 4O6JA 3TGNA 3EDPA 4HDVA 4OINF 4RGXA 1S7OA 4G9YA 2VBYA 1XGMA 1IRGA 4EJUA 1W5SA 1P92A 3MWMA 3I58A 4YIIA 3V4GA 1B1BA 1SMYF 4HZFA 3DFGA 3T8TA 2EV5A 5ILVA 4ZZDA 3HIFA 1USSA 3VB2A 3L2CA 5D5UB 4WF2A 1HSJA 3V8KA 2M45A 2KJCA 2IPQX 1L0OC 2Z9OA 2QM3A 1S8NA 4RAZA 2CFXA 1JE8A 1BI1A 4P55A 5JR3A 2EV6A 4A5NA 4G7HF 4G6DA 1K79A 3QU6A 1RNLA 4ZYGA 4LLGF 4YFKF 4KFCA 1R1UA 3KP5A 2VXZA 3RKWA 2K7LA 2NRAC 2FEZA 5E17F 2IA2A 3IWFA 3RDIA 3PQJA 1RUOA 4KIBA 1F4KA 4GGGA 1LDJA 1O7LA 6PAXA 1B59A 3P9KA 2E1CA 1K6OA 3HTUA 3E6DA 2ELHA 2DW4A 2OQRA 4BYYA 2RNJA 3IC7A 1R1TA 3BJAA 1SFUA 3G73A 2JRTA 4LG0B 1P6RA 1WQ2A 2ZKZA 1I1SA 1TNTA 5LHHA 2OA4A 1FP1D 2FNPA 1U5TB 1ONVA 1ODDA 5EEHA 4GXOA 4I0BA 3V7SA 3ZP5A 1OYWA 1YYVA 2OAZA 1IRFA 2W84A 2R3SA 4CGZA 4Q4ZF 3QRFF 3RKXA 1H0MA 3K9TA 1SFEA 1QZZA 2ZMEB 3ABTA 4AIJA 1R22A 1TW2A 1R00A 2F2EA 3DP7A 3CDHA 2COMA 1ZN2A 2GZWA 3Q9SA 1UHWA 2M8EA 2A3SA 4H0EA 1BC7C 3F8NA 3TQNA 3GO5A 3CTAA 1ZG5A 1TLHB 2VBXA 3DEUA 2IP2A 2E1NA 3IL2A 3WODF 3BP8A 1IXRC 3M8FA 2NNYA 4L9TA 4XSXF 3HSFA 4IHSA 4RGUA 2KIMA 4KN7X 1W7PD 3LQRA 2P5LC 3P9IA 2D45A 2DBBA 4KMUX 1REPC 3KEQA 3GEZA 5D5VB 1S6LA 3J81Z 5ILUA 2P4WA 2RDPA 5HDKA 2MC3A 4XLPF 2Z99A 3GFMA 5CVVA 3O2PE 4GYIA 1LB2A 1OMIA 2ETHA 5JVTA 2IA1A 1FSEA 3JTGA 5E8GA 4ASNA 2VE9A 1RIOH 2JTVA 2FE3A 1ZGJA 4LJZF 1D8JA 3DPTA 4ZYHA 3B73A 1IZ1A 3R0AA 2L3DA 4CO8A 1BC8C 5BQTA 2PI0A 4IVNA 1YQAA 5LEJA 2PMHA 2FBHA 5HS8A 4HYEA 1IUYA 1IN4A 1STZA 3LWFA 2STTA 4UXNA 3HHHA 2YU3A 5AIQA 3AAFA 4HF0A 3F3XA 3LQQA 3JSPA 1KQ9A 1G6NA 4O3MA 4L0ZB 1IN7A 2HOEA 2Q2EA 1W4MA 4MQVA 2EFWA 1WRJA 1U8RA 3IKTA 3QOPA 3FM3A 2QLZA 4HW0A 1ZLJA 1IW7F 5ERIA 4M73A 4ON0A 2LKPA 4N9IA 5IT9Z 3TDZC 2C6YA 2DLLA 3B02A 3KLOA 2DQRA 2G7UA 1HW1A 5DD8A 3SZTA 4A6DA 2MLGA 1ON1A 2HFHA 3HOTA 2RN7A 1U5TC 3FF5A 1KU9A 4Y17A 1I6XA 4NHJA 2D2WA 2FSWA 4WXDA 5ICCA 2VBWA 3ML6A 4MEYF 3WTSC 1S3JA 5DCMB 1FSHA 4L5JA 2XAFA 5HLHA 3DF8A 4LK1F 1DP7P 4A12A 1B4AA 2XGXA 1R1VA 5L3EA 3BJ6A 3HSRA 3TO7A 1HQCA 2XKOA 1XMAA 1XGNA 4XRFA 4IRGA 2EV0A 4M9XA 4AVPA 5D4RA 1K78A 3LFKA 1TQMA 2LNBA 3HHGA 1QPMA 3I64A 2FOKA 1IXCA 3KEOA 2FMLA 3F21A 4S05A 3WE3A 2Y0MA 2F5CA 4BHCA 3KFWX 1TTYA 1S29A 2HGCA 5DD4A 4B8XA 4R79A 4RS8A 3M8EA 5CVJA 3IWZA 4GO1A 3ELKA 1YW8A 1G3SA 4JK1X 3D0SA 4M9SA 4PGGA 4OMZA 2H6CA 5ILSA 2QBYB 1SFXA 1MDMB 3LAJA 4OU0A 5HS7A 2VOPA 2XRNA 4L0YB 2MH2A 3HOSA 2EA4A 5JHUA 4KN4X 1HSTA 5L3FA 3VODA 4CICA 3WTZA 2Z5UA 1CGPA 4HLXA 2EB7A 3IKVA 1Z6TA 4KT5C 3GW2A 5L3GA 3V8JA 3ZN1A 1RUNA 1I1GA 4UV8A 5ICEA 3J81K 3GX4X 2MH9A 1L3LA 4P5OA 4U7BA 2EK5A 5F64A 5LEKA 4L9JA 3W6JB 3KP7A 3JW4A 1TNSA 1WWXA 4P96A 1A04A 1USTA 3Q9VA 1BIAA 1Y0UA 2BBYA 4B09A 1P4AA 4OOIA 5H6RA 5DUIA 2ESNA 2A5YB 2CYYA 3HRUA 3FMRA 5BPDA 1SMTA 3PFIA 1MJBA 3CJNA 1UCRA 4EGYA 3E6BA 1KGSA 4LG0A 1ZRFA 2XAHA 2QWWA 2VC1A 2O6GE 3O6BB 3BOQA 1IF1A 3I4PA 1IN8A 4WWCA 1XD7A 1FT9A 4WK8F 3MFKA 2GWRA 3RJPA 4L9NA 3C18A 2DQLA 3FXUA 1AOYA 2YPRA 1ZARA 3FZVA 3TDUC 4LFUA 1FPQA 2XV4S 5HOOA 3QPHA 1XDSA 3ZMDA 4MTEA 3P7NA 1HKQA 1D3YA 1H9GA 4I09A 1FNNA 3GVAA 4M74A 3I54A 3WE2A 5LHIA 1U3EM 4BHBA 5IT9K 2GA1A 1XSDA 2IW5A 1QZYA 3FXQA 1ZGAA 1P4WA 1WSUA 1BBYA 2Z3YA 4CYDA 2IA0A 3F8BA 5FFZA 2WTEA 3U2RA 1ZAOA 4G6QA 3LA3A 3U9GA 4G7OF 2RQPA 5BMZA 2R7FA 1YS6A 4HA8A 4KA4A 3ZMUA 1UB9A 4E70A 5LGTA 2H6BA 1MD0A 2OU2A 1FYKA 1QNTA 2X0LA 4M72A 1HW5A 2QYOA 4A0YA 2Q8KA 1MGTA 4QWQA 3DPLC 2CWEA 2PLYA 3OOPA 2HWVA 1O3QA 5BPIA 2OZ6A 4UVBA 2P6SA 1FWZA 3VFZA 2L02A 3JTHA 2K4BA 2K02A 1FX7A 3EETA 4MHGA 2NAZA 1KA8A 2KJBA 4O5VA 5L3DA 5LRSA 4TV7A 2A6HF 2F5EA 3GFLA 4UVAA 1ZH5A 3I0TA 5E18F 3K1NA 3HUGA 5FLXK 4FT8A 1T6SA 1LJ9A 3LAPA 4YFXF 5CJ9A 2WV0A 4RB3C 4XLNF 5D6FA 2QQBA 1XGOA 2J5OA 3HYIA 2P5KA 4NB5A 4BQAA 2EFPA 1PP8F 1ZLKA 3Q5FA 3FMSA 3L09A 3ISPA 1R7JA 4BAYA 5TRDA 1BI2A 1QGPA 3GZ6A 1J5YA 3I53A 1XCBA 2WWYA 2BYVE 1H9TA 4LB5A 4HX4A 1TQIA 3V8LA 1U2WA 3R61A 2A69F 3H3UA 2VODA 2F5DA 3EYIA 1OPCA 5HLIA 1OR7A 2O8XA 4Q47A 1O3RA 3RPQA 3T8RA 2HEOA 4HX8A 4BHPA 2PJPA 2RC4A 4PCQA 1Z9CA 1I5ZA 4A6EA 2V1XA 2XAJA 4HV6A 2V79A 4N9HA 1J9IA 4I0AA 1SD5A 2UWMA 1G3TA 2ZO4A 3ECOA 3CUQC 2W57A 4A0ZA 4IF4A 1YS7A 4WXHA 1KU7A 2P8TA 3TO9A 4AWXB 1V4RA 3BJOA 4ENMA 3E5UA 1YG2A 4ENJA 3M7GA 4Q48A 2IT0A 3ROUA 4LD5A 5L3CA 3HSEA 1Z6RA 2O3FA 2JSCA 2O03A 2O61A 5D6EA 3TOAA 3SZPA 2CQKA 3DQVC 1X3UA 3ZMSA 3J80K 1OYIA 5DCFA 1NHAA 1QO0D 4ZZLA 1HKTA 2HZTA 1W5TA 2HQRA 4L9VA 1MDMA 3WG9A 4XBFA 1W7PA 3BPXA 5LRRA 2ESHA 2HTSA 2DT5A 1XSVA 3KETA 4M6XA 5E1XA 1YTYA 1HXDA 5DV5A 3NEUA 2P6TA 2EJRA 1E2XA 2IJLA 2PQ8A 2HDCA 1FZPB 1JHHA 3QU3A 2L01A 1GXPA 1MJAA 2XHKA 5K1YA 4LK0F 2NS0A 3I71A 1YO5C 3O3KA 4JQFA 3COAC 1LNWA 3T5XA 4FHTA 2VE8A 4ENKA 1MZBA 4ZYEA 1E17A 4RAYA 5E8IA 2K27A 3FXRA 3K1MA 2LSOA 1O3TA 1UFMA 2FF4A 3J7AO 2G7HA 2ISYA 4WCGA 1O3SA 3QAHA 4Q5SF 1GVJA 4KIFA 4P9UA 2FBIA 5E1ZB 2J5PA 3CLOA 2A61A 3MCZA 4M6YA 2DK8A 3WTYC 5JFRA 2DPDA 1IAWA 3SHFA 3G3ZA 2K86A 4EV0A 4ESBA 2PFBA 2QUFA 2ZJ2A 3ABUA 1ZG1A 5BS6A 1P2FA 2QVOA 1UHMA 2OQGA 4HQEA 4IHTA 1J0RA 3JAMZ 2MA3A 4MGRA 3KCCA 1J59A 1R23A 1MKMA 2AXLA 4IJAA 2ZXJA 3R0JA 1TBXA 3EQLF 3W6KB 1D8KA 2CGPA 3WTUC 2CO5A 1TQPA 4CXFA 2H09A 1R5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JSO A;  3TOB A;  4ESJ A;  3M1E A;  5D8L B;  5D5W B;  5LGN A;  5FLX Z;  3F6O A;  5DDG A;  5FD6 A;  5K5O A;  1Z1D A;  1DPR A;  3T0Y A;  1J7K A;  3N97 A;  3VOE A;  1HW2 A;  3P9C A;  1LDK B;  2LF8 A;  5CVR A;  1GXQ A;  2DK5 A;  1U6G A;  2M1B A;  3K0L A;  3V7R A;  4MQ9 F;  1QQI A;  3KZZ A;  2ISZ A;  3FWE A;  2BE5 F;  5HVQ C;  4KNY A;  1JGS A;  1HKS A;  1Z91 A;  5J8F A;  1EH7 A;  3REO A;  3DV8 A;  4KUM A;  1C0W A;  4A0X A;  1YFH A;  1LQ1 A;  3WTW C;  4D0P A;  4M9Z A;  5F6F A;  3F22 A;  2VT2 A;  1TW3 A;  4CDG A;  3WGI A;  2QQA A;  5FGM A;  5E1W A;  3WGH A;  3M9A A;  4F7Z A;  1F9N A;  5FB2 A;  4XSZ F;  5D8K B;  4ZYD A;  3MZH A;  5CYV A;  1ZRC A;  2OD5 A;  4HDU A;  3PQK A;  5A2Q Z;  2YSR A;  3H92 A;  1BIB A;  2PG4 A;  4HF2 A;  4HLY A;  1FBU A;  1WKM A;  1OKR A;  4LGW A;  2LF7 A;  5LLQ A;  3RIR A;  4UVC A;  1CF7 B;  3C7J A;  3MAJ A;  4P9F A;  2DAO A;  1U5T A;  3NRV A;  4EJO A;  3MEX A;  4QLC U;  2XAG A;  4U7D A;  2DU9 A;  2HTJ A;  1BI0 A;  2XUB A;  3OV8 A;  4UV9 A;  3ZQ7 A;  4GYG A;  3CO6 C;  1J2X A;  1KU2 A;  3RI4 A;  4KYW A;  3CUQ B;  4AD9 A;  1SD6 A;  1P4X A;  5TJJ A;  4AIK A;  1R5H A;  2A6E F;  2HKX A;  2ZME A;  4PZJ A;  3WU1 B;  2HYF A;  2X4H A;  4HV5 A;  1ON2 A;  4EM1 A;  2DFI A;  2FXA A;  1FP2 A;  3BDD A;  3V7C A;  3J80 Z;  2PN6 A;  4GCV A;  1RZ4 A;  3BY6 A;  3WTV C;  4U0V A;  2FA5 A;  2A07 F;  5HLG A;  3I59 B;  2BV6 A;  4WXC A;  2XAS A;  1SD7 A;  1S7A A;  1FOK A;  3BWG A;  5LGU A;  2L4M A;  2XIG A;  1Z05 A;  1MJ9 A;  3MQ0 A;  2JPB A;  1ZRE A;  4A5M A;  3SFZ A;  3LST A;  1FYL A;  4UUV A;  3K69 A;  2CW0 F;  2BGC A;  1XN7 A;  2PBI A;  5FO5 A;  1FC3 A;  1KYW A;  3R60 A;  3MZY A;  2FU4 A;  2HS5 A;  1BI3 A;  2VN2 A;  2HYG D;  2L54 A;  4KIG A;  4U0W A;  3ZMZ A;  4RGS A;  3E5X A;  4I01 A;  5ED4 A;  1R36 A;  5D5X B;  3JAM K;  1OYY A;  4UHT A;  4A2U A;  2E7W A;  1IN5 A;  5FD5 A;  1FBS A;  2GA2 A;  2JT1 A;  4OIR F;  4HQM A;  1KQ8 A;  3EYY A;  3ERE D;  4S04 A;  3ZPL A;  5CVU A;  2CG4 A;  4PDK A;  1PDN C;  4RB0 A;  3KZY A;  2F5F A;  3BPV A;  3GUD A;  4FX0 A;  3FMQ A;  1K7A A;  3GXO A;  2QQ9 A;  4EJV A;  1WI9 A;  2RGV A;  5J8C A;  3N4M A;  1LDD A;  1B9M A;  4CZZ A;  2NYX A;  1BM9 A;  3DXJ F;  3CUO A;  2Y48 A;  3GLX A;  2VON A;  2Q0O A;  5DYM A;  3H3Z A;  1XDU A;  5ICF A;  5LBQ A;  5K5R A;  3WGG A;  4EJW A;  3GWZ A;  4N0B A;  4I2O A;  2OBP A;  2FNA A;  2UZK A;  4OIO F;  1ZHF A;  2ZNY A;  3F8C A;  3SQN A;  2WC2 A;  4CHU A;  1IN6 A;  2IRF G;  5EEG A;  2M30 A;  2HQN A;  4EJT A;  5A2Q K;  3KP4 A;  2DTR A;  4ZH4 F;  1ZRD A;  1O57 A;  4OIP F;  4BXU A;  2W25 A;  3HRS A;  5DCM A;  3RTR A;  1EV7 A;  4M71 A;  2O0Y A;  3HRT A;  3SXY A;  3KE2 A;  3WU0 A;  1LEB A;  1EH6 A;  2ZNZ A;  5FFX A;  4RB2 C;  3C3W A;  1XMK A;  2JPC A;  2Z33 A;  2QZ8 A;  3F23 A;  2ADU A;  3RPU A;  2VC0 A;  2FRH A;  4EGZ A;  1SD4 A;  2LDU A;  4K2E A;  3TO6 A;  2UXN A;  1PP7 U;  2NNN A;  4I02 A;  2KKO A;  1AWC A;  4Z2Y A;  2KRF A;  5BOX A;  3QPT A;  3GFI A;  1XGS A;  4IXA A;  3LA2 A;  2W24 A;  3D5L A;  4EMS A;  5ICG A;  5DUK A;  4JBA A;  2QBY A;  2KIF A;  5KK1 A;  1FBQ A;  3ZMV A;  3T1B A;  1RI7 A;  1YIO A;  2V6C A;  5JI6 A;  4MEX F;  1T38 A;  3WTX C;  5HS9 A;  3KLN A;  2Y75 A;  2P5V A;  2XAQ A;  2MD5 A;  3E5Q A;  4ENN A;  5LHG A;  2EFQ A;  1DDN A;  3GF2 A;  3BRO A;  1U78 A;  2H27 A;  2K4J A;  1DPU A;  1QBJ A;  4I98 B;  4EM2 A;  1XCV A;  4G7Z F;  1XB4 A;  3FM5 A;  5AIP A;  2D1H A;  2STW A;  3R6S A;  3RYP A;  2JZY A;  2V1U A;  1O7F A;  5H6Q A;  1G3Y A;  3U1D A;  3L9F A;  3IRQ A;  1XSX A;  2YX4 A;  1B6A A;  3KP3 A;  2FQ3 A;  1GHC A;  4BNC A;  5DEQ A;  4U0Y A;  2ACJ A;  2QEN A;  2BEO A;  2VBZ A;  2P7C B;  4HX7 A;  1G3W A;  2UXX A;  5HDG A;  4R1H A;  3RKY A;  4RB1 A;  5CLS A;  2PMU A;  3ECH A;  3TKY A;  1CF7 A;  4YG2 F;  2XKP A;  3HTS B;  2CSO A;  1FLI A;  2E7X A;  2RV8 A;  2TDX A;  1FYM A;  2D1V A;  3F8F A;  2FBK A;  3ZMT A;  3K2Z A;  3IHU A;  3C1D A;  2ZCW A;  3NQO A;  2OZU A;  2ZBK A;  4Y13 A;  1Z7U A;  3CUQ A;  2YR2 A;  2H94 A;  3GYH X;  2RVC A;  2XRO A;  1PUE E;  2IVM A;  5CVI A;  2GXB A;  2P7V B;  2EA2 A;  2ZFW A;  3LA7 A;  2RKH A;  3F72 A;  3F8M A;  2A68 F;  4HOB A;  2PEX A;  1SAX A;  5K5Q A;  2VOO A;  2XVC A;  4L5I A;  5KVR A;  1LEA A;  1Q1H A;  3E3V A;  3GZ5 A;  4DNC A;  3K1P A;  4R8H A;  3I59 A;  3CO7 C;  2GAU A;  3E97 A;  4Y15 A;  3E6C C;  4EQQ A;  1B9N A;  2L4A A;  1F5T A;  1LVA A;  5F1R A;  4LMY A;  1HBX G;  1VTN C;  2EFO A;  4IPA A;  3R4K A;  4RGR A;  4LLL A;  3FHZ A;  3E6M A;  2FMY A;  3L00 A;  4U88 A;  4L18 B;  4ETS A;  1DUX C;  3IRR A;  2MBF A;  1JXS A;  1W7P B;  3QP6 A;  4YIF A;  2GXG A;  3GFJ A;  4KIC A;  1T2K A;  5L3B A;  4HBL A;  3EUH A;  3KP2 A;  3QP5 A;  4ESF A;  1F1Z A;  1KU3 A;  4MTD A;  2YX7 A;  1EH8 A;  1KQ0 A;  1T39 A;  1D5V A;  1ZYR F;  4DQ2 A;  1T0F A;  4PGH A;  3L7W A;  2V9V A;  4LLN A;  4LB6 B;  2DPU A;  4G94 A;  1G4D A;  2EFN A;  2EWN A;  3RYR A;  3FX3 A;  2B0L A;  5J6X A;  3BZ6 A;  2G9W A;  2GQQ A;  3WTT C;  4HF1 A;  1ZG3 A;  4G8X A;  1YW9 A;  1YLF A;  4IRH A;  2DO7 A;  4YFN F;  1KYZ A;  4WX9 A;  1I27 A;  1FY7 A;  2HKO A;  4KMF A;  3KP6 A;  4EM0 B;  1V3F A;  3HRM A;  3VEP A;  5H20 A;  5HDN A;  2GIV A;  3F6V A;  2KIU A;  4IRI A;  1BOA A;  5E20 A;  2W85 A;  3ZN0 A;  2MLK A;  1T98 A;  4I7H A;  5IT3 A;  4OIQ F;  4FX4 A;  1J75 A;  5AON A;  4UNO A;  2VT3 A;  3DKW A;  1R58 A;  4EVI A;  4MNU A;  2V1D A;  4AIH A;  4HAM A;  4NQW A;  2HR3 A;  5D4S A;  1ULY A;  1YW7 A;  1K78 B;  1IXS B;  2M87 A;  4BH9 A;  2AS5 F;  2R7D A;  2M5W A;  3S2W A;  4KDP A;  1BJA A;  1BN5 A;  1JHF A;  3ULQ B;  3I5U A;  2DI3 A;  4OMY A;  4O6J A;  3TGN A;  3EDP A;  4HDV A;  4OIN F;  4RGX A;  1S7O A;  4G9Y A;  2VBY A;  1XGM A;  1IRG A;  4EJU A;  1W5S A;  1P92 A;  3MWM A;  3I58 A;  4YII A;  3V4G A;  1B1B A;  1SMY F;  4HZF A;  3DFG A;  3T8T A;  2EV5 A;  5ILV A;  4ZZD A;  3HIF A;  1USS A;  3VB2 A;  3L2C A;  5D5U B;  4WF2 A;  1HSJ A;  3V8K A;  2M45 A;  2KJC A;  2IPQ X;  1L0O C;  2Z9O A;  2QM3 A;  1S8N A;  4RAZ A;  2CFX A;  1JE8 A;  1BI1 A;  4P55 A;  5JR3 A;  2EV6 A;  4A5N A;  4G7H F;  4G6D A;  1K79 A;  3QU6 A;  1RNL A;  4ZYG A;  4LLG F;  4YFK F;  4KFC A;  1R1U A;  3KP5 A;  2VXZ A;  3RKW A;  2K7L A;  2NRA C;  2FEZ A;  5E17 F;  2IA2 A;  3IWF A;  3RDI A;  3PQJ A;  1RUO A;  4KIB A;  1F4K A;  4GGG A;  1LDJ A;  1O7L A;  6PAX A;  1B59 A;  3P9K A;  2E1C A;  1K6O A;  3HTU A;  3E6D A;  2ELH A;  2DW4 A;  2OQR A;  4BYY A;  2RNJ A;  3IC7 A;  1R1T A;  3BJA A;  1SFU A;  3G73 A;  2JRT A;  4LG0 B;  1P6R A;  1WQ2 A;  2ZKZ A;  1I1S A;  1TNT A;  5LHH A;  2OA4 A;  1FP1 D;  2FNP A;  1U5T B;  1ONV A;  1ODD A;  5EEH A;  4GXO A;  4I0B A;  3V7S A;  3ZP5 A;  1OYW A;  1YYV A;  2OAZ A;  1IRF A;  2W84 A;  2R3S A;  4CGZ A;  4Q4Z F;  3QRF F;  3RKX A;  1H0M A;  3K9T A;  1SFE A;  1QZZ A;  2ZME B;  3ABT A;  4AIJ A;  1R22 A;  1TW2 A;  1R00 A;  2F2E A;  3DP7 A;  3CDH A;  2COM A;  1ZN2 A;  2GZW A;  3Q9S A;  1UHW A;  2M8E A;  2A3S A;  4H0E A;  1BC7 C;  3F8N A;  3TQN A;  3GO5 A;  3CTA A;  1ZG5 A;  1TLH B;  2VBX A;  3DEU A;  2IP2 A;  2E1N A;  3IL2 A;  3WOD F;  3BP8 A;  1IXR C;  3M8F A;  2NNY A;  4L9T A;  4XSX F;  3HSF A;  4IHS A;  4RGU A;  2KIM A;  4KN7 X;  1W7P D;  3LQR A;  2P5L C;  3P9I A;  2D45 A;  2DBB A;  4KMU X;  1REP C;  3KEQ A;  3GEZ A;  5D5V B;  1S6L A;  3J81 Z;  5ILU A;  2P4W A;  2RDP A;  5HDK A;  2MC3 A;  4XLP F;  2Z99 A;  3GFM A;  5CVV A;  3O2P E;  4GYI A;  1LB2 A;  1OMI A;  2ETH A;  5JVT A;  2IA1 A;  1FSE A;  3JTG A;  5E8G A;  4ASN A;  2VE9 A;  1RIO H;  2JTV A;  2FE3 A;  1ZGJ A;  4LJZ F;  1D8J A;  3DPT A;  4ZYH A;  3B73 A;  1IZ1 A;  3R0A A;  2L3D A;  4CO8 A;  1BC8 C;  5BQT A;  2PI0 A;  4IVN A;  1YQA A;  5LEJ A;  2PMH A;  2FBH A;  5HS8 A;  4HYE A;  1IUY A;  1IN4 A;  1STZ A;  3LWF A;  2STT A;  4UXN A;  3HHH A;  2YU3 A;  5AIQ A;  3AAF A;  4HF0 A;  3F3X A;  3LQQ A;  3JSP A;  1KQ9 A;  1G6N A;  4O3M A;  4L0Z B;  1IN7 A;  2HOE A;  2Q2E A;  1W4M A;  4MQV A;  2EFW A;  1WRJ A;  1U8R A;  3IKT A;  3QOP A;  3FM3 A;  2QLZ A;  4HW0 A;  1ZLJ A;  1IW7 F;  5ERI A;  4M73 A;  4ON0 A;  2LKP A;  4N9I A;  5IT9 Z;  3TDZ C;  2C6Y A;  2DLL A;  3B02 A;  3KLO A;  2DQR A;  2G7U A;  1HW1 A;  5DD8 A;  3SZT A;  4A6D A;  2MLG A;  1ON1 A;  2HFH A;  3HOT A;  2RN7 A;  1U5T C;  3FF5 A;  1KU9 A;  4Y17 A;  1I6X A;  4NHJ A;  2D2W A;  2FSW A;  4WXD A;  5ICC A;  2VBW A;  3ML6 A;  4MEY F;  3WTS C;  1S3J A;  5DCM B;  1FSH A;  4L5J A;  2XAF A;  5HLH A;  3DF8 A;  4LK1 F;  1DP7 P;  4A12 A;  1B4A A;  2XGX A;  1R1V A;  5L3E A;  3BJ6 A;  3HSR A;  3TO7 A;  1HQC A;  2XKO A;  1XMA A;  1XGN A;  4XRF A;  4IRG A;  2EV0 A;  4M9X A;  4AVP A;  5D4R A;  1K78 A;  3LFK A;  1TQM A;  2LNB A;  3HHG A;  1QPM A;  3I64 A;  2FOK A;  1IXC A;  3KEO A;  2FML A;  3F21 A;  4S05 A;  3WE3 A;  2Y0M A;  2F5C A;  4BHC A;  3KFW X;  1TTY A;  1S29 A;  2HGC A;  5DD4 A;  4B8X A;  4R79 A;  4RS8 A;  3M8E A;  5CVJ A;  3IWZ A;  4GO1 A;  3ELK A;  1YW8 A;  1G3S A;  4JK1 X;  3D0S A;  4M9S A;  4PGG A;  4OMZ A;  2H6C A;  5ILS A;  2QBY B;  1SFX A;  1MDM B;  3LAJ A;  4OU0 A;  5HS7 A;  2VOP A;  2XRN A;  4L0Y B;  2MH2 A;  3HOS A;  2EA4 A;  5JHU A;  4KN4 X;  1HST A;  5L3F A;  3VOD A;  4CIC A;  3WTZ A;  2Z5U A;  1CGP A;  4HLX A;  2EB7 A;  3IKV A;  1Z6T A;  4KT5 C;  3GW2 A;  5L3G A;  3V8J A;  3ZN1 A;  1RUN A;  1I1G A;  4UV8 A;  5ICE A;  3J81 K;  3GX4 X;  2MH9 A;  1L3L A;  4P5O A;  4U7B A;  2EK5 A;  5F64 A;  5LEK A;  4L9J A;  3W6J B;  3KP7 A;  3JW4 A;  1TNS A;  1WWX A;  4P96 A;  1A04 A;  1UST A;  3Q9V A;  1BIA A;  1Y0U A;  2BBY A;  4B09 A;  1P4A A;  4OOI A;  5H6R A;  5DUI A;  2ESN A;  2A5Y B;  2CYY A;  3HRU A;  3FMR A;  5BPD A;  1SMT A;  3PFI A;  1MJB A;  3CJN A;  1UCR A;  4EGY A;  3E6B A;  1KGS A;  4LG0 A;  1ZRF A;  2XAH A;  2QWW A;  2VC1 A;  2O6G E;  3O6B B;  3BOQ A;  1IF1 A;  3I4P A;  1IN8 A;  4WWC A;  1XD7 A;  1FT9 A;  4WK8 F;  3MFK A;  2GWR A;  3RJP A;  4L9N A;  3C18 A;  2DQL A;  3FXU A;  1AOY A;  2YPR A;  1ZAR A;  3FZV A;  3TDU C;  4LFU A;  1FPQ A;  2XV4 S;  5HOO A;  3QPH A;  1XDS A;  3ZMD A;  4MTE A;  3P7N A;  1HKQ A;  1D3Y A;  1H9G A;  4I09 A;  1FNN A;  3GVA A;  4M74 A;  3I54 A;  3WE2 A;  5LHI A;  1U3E M;  4BHB A;  5IT9 K;  2GA1 A;  1XSD A;  2IW5 A;  1QZY A;  3FXQ A;  1ZGA A;  1P4W A;  1WSU A;  1BBY A;  2Z3Y A;  4CYD A;  2IA0 A;  3F8B A;  5FFZ A;  2WTE A;  3U2R A;  1ZAO A;  4G6Q A;  3LA3 A;  3U9G A;  4G7O F;  2RQP A;  5BMZ A;  2R7F A;  1YS6 A;  4HA8 A;  4KA4 A;  3ZMU A;  1UB9 A;  4E70 A;  5LGT A;  2H6B A;  1MD0 A;  2OU2 A;  1FYK A;  1QNT A;  2X0L A;  4M72 A;  1HW5 A;  2QYO A;  4A0Y A;  2Q8K A;  1MGT A;  4QWQ A;  3DPL C;  2CWE A;  2PLY A;  3OOP A;  2HWV A;  1O3Q A;  5BPI A;  2OZ6 A;  4UVB A;  2P6S A;  1FWZ A;  3VFZ A;  2L02 A;  3JTH A;  2K4B A;  2K02 A;  1FX7 A;  3EET A;  4MHG A;  2NAZ A;  1KA8 A;  2KJB A;  4O5V A;  5L3D A;  5LRS A;  4TV7 A;  2A6H F;  2F5E A;  3GFL A;  4UVA A;  1ZH5 A;  3I0T A;  5E18 F;  3K1N A;  3HUG A;  5FLX K;  4FT8 A;  1T6S A;  1LJ9 A;  3LAP A;  4YFX F;  5CJ9 A;  2WV0 A;  4RB3 C;  4XLN F;  5D6F A;  2QQB A;  1XGO A;  2J5O A;  3HYI A;  2P5K A;  4NB5 A;  4BQA A;  2EFP A;  1PP8 F;  1ZLK A;  3Q5F A;  3FMS A;  3L09 A;  3ISP A;  1R7J A;  4BAY A;  5TRD A;  1BI2 A;  1QGP A;  3GZ6 A;  1J5Y A;  3I53 A;  1XCB A;  2WWY A;  2BYV E;  1H9T A;  4LB5 A;  4HX4 A;  1TQI A;  3V8L A;  1U2W A;  3R61 A;  2A69 F;  3H3U A;  2VOD A;  2F5D A;  3EYI A;  1OPC A;  5HLI A;  1OR7 A;  2O8X A;  4Q47 A;  1O3R A;  3RPQ A;  3T8R A;  2HEO A;  4HX8 A;  4BHP A;  2PJP A;  2RC4 A;  4PCQ A;  1Z9C A;  1I5Z A;  4A6E A;  2V1X A;  2XAJ A;  4HV6 A;  2V79 A;  4N9H A;  1J9I A;  4I0A A;  1SD5 A;  2UWM A;  1G3T A;  2ZO4 A;  3ECO A;  3CUQ C;  2W57 A;  4A0Z A;  4IF4 A;  1YS7 A;  4WXH A;  1KU7 A;  2P8T A;  3TO9 A;  4AWX B;  1V4R A;  3BJO A;  4ENM A;  3E5U A;  1YG2 A;  4ENJ A;  3M7G A;  4Q48 A;  2IT0 A;  3ROU A;  4LD5 A;  5L3C A;  3HSE A;  1Z6R A;  2O3F A;  2JSC A;  2O03 A;  2O61 A;  5D6E A;  3TOA A;  3SZP A;  2CQK A;  3DQV C;  1X3U A;  3ZMS A;  3J80 K;  1OYI A;  5DCF A;  1NHA A;  1QO0 D;  4ZZL A;  1HKT A;  2HZT A;  1W5T A;  2HQR A;  4L9V A;  1MDM A;  3WG9 A;  4XBF A;  1W7P A;  3BPX A;  5LRR A;  2ESH A;  2HTS A;  2DT5 A;  1XSV A;  3KET A;  4M6X A;  5E1X A;  1YTY A;  1HXD A;  5DV5 A;  3NEU A;  2P6T A;  2EJR A;  1E2X A;  2IJL A;  2PQ8 A;  2HDC A;  1FZP B;  1JHH A;  3QU3 A;  2L01 A;  1GXP A;  1MJA A;  2XHK A;  5K1Y A;  4LK0 F;  2NS0 A;  3I71 A;  1YO5 C;  3O3K A;  4JQF A;  3COA C;  1LNW A;  3T5X A;  4FHT A;  2VE8 A;  4ENK A;  1MZB A;  4ZYE A;  1E17 A;  4RAY A;  5E8I A;  2K27 A;  3FXR A;  3K1M A;  2LSO A;  1O3T A;  1UFM A;  2FF4 A;  3J7A O;  2G7H A;  2ISY A;  4WCG A;  1O3S A;  3QAH A;  4Q5S F;  1GVJ A;  4KIF A;  4P9U A;  2FBI A;  5E1Z B;  2J5P A;  3CLO A;  2A61 A;  3MCZ A;  4M6Y A;  2DK8 A;  3WTY C;  5JFR A;  2DPD A;  1IAW A;  3SHF A;  3G3Z A;  2K86 A;  4EV0 A;  4ESB A;  2PFB A;  2QUF A;  2ZJ2 A;  3ABU A;  1ZG1 A;  5BS6 A;  1P2F A;  2QVO A;  1UHM A;  2OQG A;  4HQE A;  4IHT A;  1J0R A;  3JAM Z;  2MA3 A;  4MGR A;  3KCC A;  1J59 A;  1R23 A;  1MKM A;  2AXL A;  4IJA A;  2ZXJ A;  3R0J A;  1TBX A;  3EQL F;  3W6K B;  1D8K A;  2CGP A;  3WTU C;  2CO5 A;  1TQP A;  4CXF A;  2H09 A;  1R5G A; 
#chains in the Genus database with same CATH topology
 3PIP F;  1XTA A;  3JSO A;  1K4T A;  3TOB A;  4ESJ A;  3M1E A;  2CU7 A;  5D8L B;  1E3P A;  5D5W B;  3LFU A;  5LGN A;  5FLX Z;  3F6O A;  5DDG A;  5FD6 A;  3TMO A;  5K5O A;  1Z1D A;  1DPR A;  2RQQ A;  1HDD C;  1Z3X A;  3T0Y A;  1J7K A;  3N97 A;  3VOE A;  2Z16 A;  1HW2 A;  3P9C A;  2VIX A;  1LDK B;  1M1E B;  2LF8 A;  5CVR A;  3PNV A;  1GXQ A;  2IGM A;  2DK5 A;  1U6G A;  2DFE A;  2ELK A;  2M1B A;  3K0L A;  3V7R A;  4MQ9 F;  4A3F J;  3ZQI A;  1QQI A;  3SDB A;  4PJ0 C;  1F43 A;  3KZZ A;  2ISZ A;  3OYJ A;  4NBQ A;  5KHD A;  5FJ8 J;  2TRT A;  3FWE A;  3AKZ A;  2BE5 F;  5HVQ C;  4IZZ A;  4KNY A;  1JGS A;  2V9P A;  1QHH D;  4RAF A;  2M7A A;  2XF5 A;  1HKS A;  1T95 A;  1Z91 A;  5J8F A;  1H89 C;  2COB A;  1EH7 A;  1ZEL A;  3REO A;  4CCN A;  3DV8 A;  2K9N A;  4KUM A;  4LG3 A;  3H5A A;  1C0W A;  3BG3 A;  4J19 A;  1X19 A;  4A0X A;  1W36 D;  1YFH A;  3BT9 A;  3EUK L;  3WTW C;  1LQ1 A;  1ETW A;  4D0P A;  1VQL I;  4M9Z A;  5F6F A;  3F22 A;  1UZC A;  2D5V A;  2VT2 A;  3LSP A;  1LFP A;  5H2F C;  1YX5 A;  1TW3 A;  2HQA A;  2Q2E B;  2Y2Z A;  4CDG A;  3WGI A;  2QQA A;  5FGM A;  5E1W A;  3WGH A;  5E3N A;  3M9A A;  4F7Z A;  1F9N A;  5LFA A;  4I99 C;  4XSZ F;  5FB2 A;  5D8K B;  4ZYD A;  3MZH A;  1AU7 A;  2GBY A;  1BW5 A;  5CYV A;  1ZRC A;  2OD5 A;  4HDU A;  3PQK A;  3A1Y A;  2OCE A;  5A2Q Z;  2YSR A;  5EG0 B;  1GT0 C;  3H92 A;  2NVQ J;  1BIB A;  2PG4 A;  3QOD A;  3W2V A;  3OYM A;  1D0Y A;  4HF2 A;  4HLY A;  1FBU A;  1WKM A;  3BC8 A;  3OSG A;  3CCE I;  1D1B A;  3WU2 C;  5FKL A;  1OKR A;  4LGW A;  4XLA A;  4BBS J;  2K9S A;  2K9M A;  3QYB A;  3J7A Y;  1ETO A;  2LF7 A;  3BR2 A;  5EEA A;  3H36 A;  5J3L A;  5LLQ A;  3RIR A;  4UVC A;  3RZD J;  2O9L A;  1CF7 B;  2R93 J;  2ZXI A;  3C7J A;  3MAJ A;  4P9F A;  1K61 A;  5B66 C;  1Y1V J;  2DAO A;  2X9D A;  1U5T A;  1NG7 A;  2JUG A;  2LG4 A;  3CMM A;  3NRV A;  4DJA A;  2QA4 I;  4EJO A;  3MEX A;  2DOA A;  4QLC U;  2B9S A;  4FET A;  2XAG A;  4U7D A;  1Z67 A;  2DU9 A;  2HTJ A;  1H88 C;  1BI0 A;  2V9K A;  2BY3 A;  2XUB A;  3OV8 A;  1S7E A;  4UV9 A;  4GYG A;  3ZQ7 A;  1J2X A;  1KU2 A;  3CO6 C;  3RI4 A;  3CUQ B;  4AD9 A;  1SD6 A;  3DCF A;  2LBF A;  2R7S A;  3WHB A;  2O5R A;  1P4X A;  2LD5 A;  5TGT A;  5TJJ A;  4AIK A;  3OYA A;  1R5H A;  2A6E F;  2HKX A;  2ZME A;  4PZJ A;  3HOX J;  3GTL J;  4IL6 C;  3WU1 B;  4ZDO A;  3H0D A;  2HYF A;  2X4H A;  4HV5 A;  2DN0 A;  1ON2 A;  2LY9 A;  4EM1 A;  2DFI A;  2FXA A;  1FP2 A;  2BXY A;  3BDD A;  3V7C A;  3J80 Z;  2VLA A;  3RKQ A;  1IJW C;  5CPR B;  2PN6 A;  2GLO A;  1EF4 A;  4GCV A;  4LIU A;  1FTT A;  1RZ4 A;  3BY6 A;  3WTV C;  4HNV A;  1WPK A;  4U0V A;  3CP8 A;  2K3F A;  2VXD A;  2FA5 A;  2A07 F;  5HLG A;  3I59 B;  4BEH A;  2BV6 A;  1OFC X;  4WXC A;  2XAS A;  3FIW A;  1SD7 A;  2OUM A;  3ZRG A;  3S8P A;  2F48 A;  1S7A A;  1FOK A;  3BWG A;  4XLF A;  4BQQ A;  1ZKG A;  5LGU A;  2L4M A;  2XIG A;  1Z05 A;  1MW7 A;  1MJ9 A;  4S0H B;  3MQ0 A;  2JPB A;  4A3E J;  1ZRE A;  3K70 C;  1U8B A;  1MBH A;  3HKZ N;  4A5M A;  3SFZ A;  1LE8 A;  3OS0 A;  3LST A;  1FYL A;  4UUV A;  1ZR4 A;  1MBJ A;  1WJF A;  2CW0 F;  2BGC A;  3K69 A;  3OR2 C;  5F27 A;  1XN7 A;  2HPM A;  2PBI A;  5FO5 A;  1FC3 A;  2WAQ N;  3VYR B;  2MYS A;  1KYW A;  3IV5 A;  3R60 A;  3MZY A;  3RSN A;  2FU4 A;  2HS5 A;  1BI3 A;  2VN2 A;  2HYG D;  2L54 A;  2N8G A;  4KIG A;  4U0W A;  5GP9 A;  3ZMZ A;  2L9S A;  4RGS A;  4D5C A;  1NK2 P;  1RC9 A;  3E5X A;  4F93 B;  1JTX A;  4I01 A;  2K9Q A;  1YX3 A;  1JUM A;  5E3M A;  1WGX A;  1VFC A;  1P9Q C;  1WZ2 A;  5ED4 A;  3AG3 H;  1X1C A;  2NVY J;  3OYK A;  1R36 A;  5D5X B;  5GAG J;  3JAM K;  3AL0 B;  1OYY A;  4UHT A;  1LKX A;  4RM2 A;  2LH9 A;  4A2U A;  2E7W A;  4BQN A;  5FRO A;  1IN5 A;  5FD5 A;  1FBS A;  4A3D J;  3TL4 X;  4CH7 A;  2GA2 A;  4E7J A;  1MIJ A;  3CCU I;  1SAN A;  2JT1 A;  4OIR F;  4HQM A;  1KQ8 A;  3EYY A;  3ERE D;  3CC4 I;  4S04 A;  3ZPL A;  5CVU A;  1Q1V A;  2IS1 A;  4XLC A;  2CG4 A;  9ANT A;  4E4H A;  4PDK A;  4PJM A;  1PDN C;  2DA2 A;  4C9Y A;  4RB0 A;  3KZY A;  3JRA A;  2F5F A;  1IV6 A;  3BPV A;  1EJ9 A;  3GUD A;  3VYS B;  3M3Y J;  4FX0 A;  3HOV J;  3FMQ A;  3GZN B;  1IV8 A;  2JVH A;  1N25 A;  1K7A A;  3GXO A;  3WHC A;  1QU3 A;  2QQ9 A;  4EJV A;  1QPI A;  1WI9 A;  3HJE A;  2RGV A;  2HQ5 A;  1HF0 A;  1A5J A;  5J8C A;  3OYF A;  3D1N I;  1RET A;  2ME0 A;  3CMA I;  1LDD A;  1B9M A;  1RR7 A;  4CZZ A;  3N4M A;  2YU9 J;  2NYX A;  2WAQ A;  1BM9 A;  1PUF A;  3DXJ F;  2IS6 A;  3CUO A;  2KDZ A;  2Y48 A;  1VQ4 I;  3RQI A;  3GLX A;  2AHQ A;  3LSM A;  2VON A;  3CQZ J;  4B47 A;  1TC3 C;  2Q0O A;  3OS1 A;  3QYE A;  4XN0 A;  5DYM A;  3H3Z A;  1B8I A;  4XON A;  1XDU A;  4JYK A;  5C4X J;  1R9T J;  1BW6 A;  5M5Y J;  5ICF A;  5LBQ A;  4F55 A;  4NQW B;  5K5R A;  2QEX I;  3EUA A;  2IXS A;  2ZC2 A;  1ZTR A;  1RPW A;  1VQ5 I;  3BQZ A;  2E35 A;  4C2M J;  3WGG A;  4EJW A;  3GWZ A;  3DWL E;  1JI8 A;  4N0B A;  5EZG A;  2DA4 A;  4GRI A;  5JLW A;  4I2O A;  3D5R C;  2OBP A;  2FNA A;  2UZK A;  2MFZ A;  2KQR A;  1TP4 A;  2EIL H;  4FE4 A;  2R7O A;  4KIT B;  4OIO F;  1ZHF A;  2KLO A;  4DYR A;  2L7K A;  2ZNY A;  3F8C A;  3SQN A;  2WC2 A;  4CHU A;  1IN6 A;  2DOD A;  1QVU A;  2R7V A;  4JOM A;  5IP9 J;  2IRF G;  1FIP A;  1SAU A;  1U0J A;  2M30 A;  5EEG A;  2HQN A;  4EJT A;  1MNM C;  5A2Q K;  4J01 A;  3KP4 A;  2DTR A;  4ZH4 F;  1ZRD A;  4E7H A;  1O57 A;  1XG1 A;  4OIP F;  4BXU A;  2W25 A;  3Q3S A;  3HRS A;  4N4N B;  1BL0 A;  3DBL B;  5DCM A;  2R7U A;  2EZK A;  3RTR A;  1EV7 A;  3I4M J;  4B4C A;  1F36 A;  2M0C A;  1ZGW A;  1ZQ3 P;  4M71 A;  3K2A A;  2O0Y A;  3S93 A;  2E5N A;  3HRT A;  3OYG A;  2VPR A;  3K4K A;  3KE2 A;  3SXY A;  3WU0 A;  3DLL F;  1EH6 A;  2ZNZ A;  2R7Z J;  2ZB9 A;  1LEB A;  5FFX A;  4XK4 A;  1EA3 A;  2BVL A;  4RB2 C;  3C3W A;  3QOE A;  1X1D A;  1XMK A;  2JPC A;  4FIS A;  2QZ8 A;  2Z33 A;  3F23 A;  2ADU A;  3RPU A;  3S1R J;  2R5Z A;  1TWH J;  2VC0 A;  4QPQ A;  2FRH A;  3BTI A;  2K85 A;  3S3O A;  4EGZ A;  3GTM J;  1SD4 A;  2EZI A;  4JX5 A;  2LDU A;  4K2E A;  3TO6 A;  4A3C J;  3OYE A;  2UXN A;  1PP7 U;  3OYD A;  3HDD A;  2EIK H;  2NNN A;  4I02 A;  2KIQ A;  2KKO A;  3DEE A;  1AWC A;  3OOU A;  4Z2Y A;  1D0X A;  2XGE A;  5CKT A;  2HVQ A;  1XS9 A;  4M3D A;  3LSR A;  3CC2 I;  2KRF A;  3HC7 A;  5BOX A;  2DDA A;  2F4O B;  3QPT A;  3GFI A;  3DEW A;  1XGS A;  4IXA A;  3LA2 A;  4XL9 A;  2W24 A;  4CYC B;  3FIS A;  2OPT A;  2MC4 A;  3JRG A;  3D5L A;  4EMS A;  2QKM B;  5ICG A;  5DUK A;  4I76 A;  4JBA A;  2QBY A;  2KIF A;  2RNG A;  2XGD A;  1FBQ A;  5KK1 A;  3ZMV A;  3V42 A;  3T1B A;  1WJ5 A;  1RI7 A;  4IEJ A;  1YIO A;  4B48 A;  2F6C A;  2V6C A;  3HOY J;  2LR8 A;  1TT0 A;  3CJR B;  5JI6 A;  2KL4 A;  3MD2 A;  2G0E A;  4MEX F;  3ASN H;  1T38 A;  1QRY A;  3WTX C;  5HS9 A;  3EUH C;  3KLN A;  1APL C;  2Y75 A;  2KRC A;  2P5V A;  2XAQ A;  2NS7 A;  2MD5 A;  3E5Q A;  4ENN A;  4BDY A;  5LHG A;  1K4S A;  3CDL A;  3GTG J;  2EFQ A;  1ITY A;  1I3Q J;  1DDN A;  3GF2 A;  3BG9 A;  1JKO C;  3BRO A;  1U78 A;  2CUE A;  2H27 A;  2K4J A;  1JKP C;  1WJE A;  1DPU A;  1QBJ A;  4C3H J;  4I98 B;  4EM2 A;  3K4M A;  1XCV A;  4G7Z F;  3AL0 C;  1MH4 A;  1X4O A;  2NVT J;  1XB4 A;  2ZSH B;  3FM5 A;  1HA8 A;  1GVD A;  5AIP A;  4C2T A;  2D1H A;  2STW A;  2HDW A;  3R6S A;  3RYP A;  2JZY A;  1I50 J;  4UUS B;  2V1U A;  2H1L A;  3BZC A;  4ZJZ A;  4HPQ A;  3FXJ A;  3K6G A;  3L2U A;  1O7F A;  3ZR8 X;  3Q0V A;  5H6Q A;  1G3Y A;  3U1D A;  3L9F A;  3IRQ A;  4V2G A;  3UKG A;  1XSX A;  2YX4 A;  1B6A A;  3KP3 A;  2FQ3 A;  2M9H A;  4M3F A;  2M34 A;  1GHC A;  3OYL A;  1ACI A;  2AO9 A;  2CUJ A;  1DGR M;  1ETY A;  4BNC A;  2EQR A;  2M4K A;  1I3A A;  5DEQ A;  4U0Y A;  2ACJ A;  2PJR A;  1X1B A;  2QEN A;  4NUB A;  3CCS I;  1JGG A;  1FTZ A;  1OQY A;  2BEO A;  2VI6 A;  3O8H A;  2VBZ A;  2R7T A;  2P0W A;  2P7C B;  4HX7 A;  1G3W A;  2UXX A;  4IOA F;  5HDG A;  4R1H A;  3RKY A;  4BBR J;  3ESW B;  4RB1 A;  3X2Q H;  5CLS A;  3KEY A;  3QPL A;  2PMU A;  3VWB A;  3PL8 A;  2HZD A;  4OAZ A;  2HOS A;  3ECH A;  3TKY A;  1CF7 A;  3S2H J;  5GAD J;  2XKP A;  4YG2 F;  3HTS B;  2CSO A;  4BY7 J;  1MSE C;  1FLI A;  2AQE A;  1IDZ A;  2E7X A;  2RV8 A;  1D1A A;  2TDX A;  3PSI A;  5EYR A;  1FYM A;  2D1V A;  3F8F A;  2FBK A;  3ZMT A;  2W7N A;  2LC2 A;  3K2Z A;  3IHU A;  3C1D A;  2ZCW A;  3NQO A;  2HVS A;  2OZU A;  3S3M A;  3KYD B;  2ZBK A;  2PMZ A;  3TP0 A;  1T33 A;  2PX9 A;  4Y13 A;  1Z7U A;  3HZJ A;  4XRS A;  3CUQ A;  2YR2 A;  1JJ6 C;  3W6V A;  3KZI C;  2VKH A;  4PJL A;  1V5E A;  2H94 A;  2Y69 H;  3GYH X;  2JK3 A;  2RVC A;  2XRO A;  1YIJ I;  5F04 A;  1PUE E;  2ECC A;  2IVM A;  3K4C A;  5CVI A;  1UJ8 A;  2VJJ A;  2GXB A;  2P7V B;  2EA2 A;  3I4N J;  2ZFW A;  3LA7 A;  4CUG A;  2RKH A;  3IH2 A;  3F72 A;  3F8M A;  2A68 F;  3VDX A;  2B63 J;  2WY8 Q;  4F52 A;  4HOB A;  5K7F A;  2PEX A;  1VQK I;  2CV0 A;  1SAX A;  5K5Q A;  2VOO A;  2JWT A;  2XVC A;  4L5I A;  5KVR A;  1OCC H;  1LEA A;  1Q1H A;  3E3V A;  3GZ5 A;  2KMU A;  4DNC A;  3OR1 C;  4XKB A;  3ZQF A;  2X51 A;  3K1P A;  4R8H A;  3I59 A;  3CO7 C;  2V6E A;  3OL4 A;  3E0J B;  2GAU A;  3E97 A;  3HPG A;  4Y15 A;  4EQQ A;  3E6C C;  1B9N A;  2L4A A;  3LL7 A;  1F5T A;  1LVA A;  5F1R A;  1Y56 A;  4LMY A;  1HBX G;  1VTN C;  2EFO A;  3BTJ A;  4IPA A;  3R4K A;  4RGR A;  3PJR A;  5EDN A;  4LLL A;  4AM3 A;  3FHZ A;  2DYR H;  3E6M A;  2FMY A;  5F0H A;  2WB1 A;  3L00 A;  4U88 A;  4L18 B;  4DIQ A;  4B3X A;  4ETS A;  1DUX C;  3IRR A;  1Z21 A;  2MBF A;  5EGO B;  1YHQ I;  2WBM A;  4XRS G;  4Y52 J;  2M3A A;  3K7A J;  1JXS A;  1W7P B;  4AYB N;  3QP6 A;  1D1C A;  3KYC B;  4YIF A;  2GXG A;  3GFJ A;  4KIC A;  1T2K A;  1YJN I;  5L3B A;  3SDG A;  4HBL A;  1VQO I;  4B3A A;  3EUH A;  3S1N J;  3KP2 A;  3QP5 A;  2R4G A;  4ESF A;  1F1Z A;  1KU3 A;  4MTD A;  2YX7 A;  3KYL A;  1S72 I;  1EH8 A;  2ELJ A;  4X0G A;  5JLX A;  1KQ0 A;  3PNT A;  1T39 A;  1D5V A;  1ZYR F;  2W1O A;  4DQ2 A;  2VJI A;  1T0F A;  4PGH A;  3L7W A;  2ZJR F;  3ZOB A;  2V9V A;  4LLN A;  2MGQ A;  4LB6 B;  2E1M C;  1UG0 A;  2DPU A;  4G94 A;  1G4D A;  1WJC A;  1D0Z A;  1PVE A;  2EFN A;  2L2O A;  2NVX J;  2DCE A;  2EWN A;  1V55 H;  3RYR A;  1R6R A;  2NOJ B;  3FX3 A;  2B0L A;  5J6X A;  4HSR A;  2E34 A;  3BZ6 A;  3ZCO A;  4DZP A;  4NC6 A;  2UV1 A;  1MBG A;  1X4P A;  2G9W A;  2GQQ A;  3WTT C;  2K3P A;  4HF1 A;  1ZG3 A;  4G8X A;  1R5I D;  1YW9 A;  1YLF A;  4IRH A;  3IH4 A;  3RCO A;  2B7E A;  2DO7 A;  4YFN F;  1KYZ A;  4WX9 A;  1TWC J;  1JJ8 C;  1XPX A;  1I27 A;  1FY7 A;  2HKO A;  4RBO A;  4KMF A;  3KP6 A;  5FKN A;  4EM0 B;  1V3F A;  3LSI A;  2KDO A;  5GTI C;  5IOZ A;  4KJZ A;  2MSY A;  3HRM A;  3VEP A;  2E60 A;  1AKH B;  5H20 A;  5HDN A;  4CZC A;  3IUO A;  2CV1 A;  2GIV A;  3F6V A;  4D1Q A;  2HI3 A;  2IGK A;  2KZG A;  2KIU A;  3L2R A;  4IRI A;  1BOA A;  5E20 A;  5EZH A;  2XF7 A;  2W85 A;  4FE7 A;  3ZN0 A;  2MLK A;  4DZJ A;  3FXO A;  1T98 A;  4I7H A;  1X1A A;  2ECB A;  5IT3 A;  2Z1D A;  3K4L A;  3O8G A;  1JKQ C;  4OIQ F;  1A6Q A;  4FX4 A;  2E2I J;  2LY2 A;  1W5C C;  1J75 A;  1T56 A;  5AON A;  1SC7 A;  4UNO A;  2VT3 A;  3DKW A;  3GTO J;  1R58 A;  4EVI A;  4MNU A;  2R0Q C;  2EH3 A;  3F9K A;  3IP4 B;  2VAS A;  1U9O A;  2V1D A;  4AIH A;  4HAM A;  4NQW A;  2CRG A;  2A5W A;  2HR3 A;  5FKM A;  2DMQ A;  3C2H A;  1IDY A;  5D4S A;  1ULY A;  1R71 A;  1YW7 A;  4BJT A;  3E1S A;  4AUX A;  2BVM A;  1K78 B;  3HOU J;  1IXS B;  2M87 A;  4BH9 A;  2AS5 F;  2R7D A;  2M5W A;  1NG6 A;  3DU6 A;  3S2W A;  4KDP A;  1BJA A;  1OR7 C;  2K9L A;  1BN5 A;  1JKR C;  1JHF A;  3ULQ B;  1VF9 A;  2MG4 A;  4C2U A;  3I5U A;  2WA0 A;  1FMW A;  2DI3 A;  4OMY A;  3CCJ I;  4O6J A;  3TGN A;  1FEX A;  3EDP A;  2OV7 A;  1P7J A;  3HL2 A;  5FRN A;  4HDV A;  3H1C A;  4OIN F;  5DTD A;  4RGX A;  3U1K A;  2RRE A;  1V5G A;  3MMY B;  1S7O A;  4G9Y A;  2VBY A;  3HGY A;  2BXZ A;  1TWF J;  4A3G J;  3BG5 A;  1XGM A;  3N05 A;  2QF7 A;  1IRG A;  4EJU A;  3LMM A;  4E7S A;  1W5S A;  1P92 A;  3MWM A;  3I58 A;  5FLM J;  1VZ0 A;  3CMY A;  4PSX A;  2XF6 A;  4YII A;  3V4G A;  1B1B A;  4BS9 A;  3K4N A;  1SMY F;  4HZF A;  4BY1 J;  3DFG A;  1WCM J;  5C44 J;  4BAC A;  3T8T A;  1H8A C;  2EV5 A;  4BKX A;  3HOW J;  2P81 A;  1FOY A;  3ZQG A;  5ILV A;  3BR6 A;  4ZZD A;  1MNE A;  3A03 A;  3HIF A;  1USS A;  2KRH A;  1OIS A;  2ZXW H;  3TW6 A;  3VB2 A;  1SEU A;  2JVG A;  3L2C A;  1FOW A;  5D5U B;  4Y3O A;  1R4N B;  4WF2 A;  1X3W B;  2E5Z A;  1HSJ A;  3V8K A;  2M45 A;  1EKE A;  2OCC H;  2KJC A;  2IPQ X;  3EPZ A;  1L0O C;  1JTY A;  2Z9O A;  2QM3 A;  1S8N A;  3LSK A;  4RAZ A;  2CFX A;  1JE8 A;  5HNH A;  4X1E A;  1BI1 A;  4JP0 A;  4CCL A;  4P55 A;  2XSD C;  1YRN B;  3ASO H;  4NDL A;  5JR3 A;  2EV6 A;  4A5N A;  2ZFU A;  2XPW A;  2WY7 Q;  4E7Z A;  3HPH A;  4G7H F;  3S1M J;  4G6D A;  4QPO A;  1K79 A;  3QU6 A;  1DP3 A;  1RNL A;  2W48 A;  4ZYG A;  4LLG F;  4YFK F;  2QSH X;  3A2K A;  4KFC A;  1R1U A;  1SVL A;  2VQL A;  3ERM A;  3KP5 A;  1D5Y A;  3CDI A;  2DA1 A;  3CF2 A;  2IS4 A;  2VXZ A;  4CYC A;  4IHY A;  4F91 B;  3RKW A;  4CSW A;  2K7L A;  2NRA C;  2FEZ A;  3ZQH A;  5E17 F;  1GV2 A;  2IA2 A;  3IWF A;  3RDI A;  1TZL A;  3PQJ A;  3SYT A;  1B72 A;  2QKL B;  2ZXH A;  1RUO A;  3CCM I;  4IO9 F;  1SVO A;  4HST A;  4KIB A;  1F4K A;  3RZO J;  4GGG A;  2DFH A;  1JT6 A;  1LDJ A;  2XRL A;  1O7L A;  6PAX A;  1E3O C;  2R92 J;  1B59 A;  3P9K A;  4YEL A;  2E1C A;  1ETQ A;  3HKZ A;  3HTU A;  1K6O A;  2EBI A;  3OL3 A;  3E6D A;  2YS9 A;  5C4J J;  3DLA A;  2ELH A;  2DW4 A;  2LYC A;  2OQR A;  1NTC A;  4XIC A;  4BYY A;  2DA3 A;  1BOB A;  1DQU A;  1G2H A;  2RNJ A;  3IC7 A;  1FJL A;  1R1T A;  3BJA A;  1SFU A;  2JRT A;  3OYB A;  3G73 A;  1HOM A;  2JUC A;  4LG0 B;  2IBD A;  1P6R A;  1WQ2 A;  2ZKZ A;  3FXK A;  4E7L A;  4D7M A;  2CW8 A;  3J7Y J;  1I1S A;  2LP0 A;  1TNT A;  2OA4 A;  1FP1 D;  2FNP A;  3ZXS A;  5LHH A;  1U5T B;  3ONQ A;  3RQ4 A;  2VQH A;  1ONV A;  1ODD A;  1A6I A;  1YJ9 I;  5EEH A;  2FQ4 A;  4GXO A;  3ABK H;  2X1C A;  4I0B A;  1Z77 A;  3V7S A;  3K70 D;  2WV1 A;  3SEZ A;  3ZP5 A;  2XB5 A;  1OYW A;  2F4M B;  1YYV A;  4M3E A;  4E7K A;  2OAZ A;  1ETV A;  2L7M P;  4OWR B;  2A05 A;  1IRF A;  2W84 A;  2R3S A;  1VQ8 I;  4CGZ A;  3MVP A;  2R7X A;  5IYD J;  4Q4Z F;  1E3H A;  3QRF F;  4AVZ A;  3RKX A;  1I6H J;  1H0M A;  3K9T A;  1SFE A;  2QSF X;  1QZZ A;  2ZME B;  2XDV A;  3PUF A;  3M1C A;  4IX7 A;  3ABT A;  4AIJ A;  1R22 A;  4IHW A;  1LVK A;  2CQQ A;  1TW2 A;  5B5E C;  4PUS A;  1S5L C;  4DBR A;  1R00 A;  2F2E A;  3HEF A;  3DP7 A;  3CDH A;  2COM A;  2CQN A;  1ZN2 A;  2GZW A;  3Q9S A;  4PK4 A;  3FDY A;  1UHW A;  2M8E A;  2A3S A;  4BXF A;  5J4V A;  4H0E A;  1RR8 C;  1BC7 C;  3F8N A;  3TQN A;  2R5Y B;  4YEJ A;  1VQ7 I;  3GO5 A;  3CTA A;  1FIA A;  1QVT A;  1ZG5 A;  2L9N A;  3DTK A;  4HG2 A;  1TLH B;  2VBX A;  4Y4R A;  3DEU A;  2IP2 A;  2E1N A;  3IL2 A;  3WOD F;  1U9N A;  2UUZ A;  1WH7 A;  3BR3 A;  3BP8 A;  4H4K C;  1IXR C;  1T08 B;  2CW7 A;  3M8F A;  2M2E A;  2NNY A;  5GAH J;  3JRB A;  2DJN A;  2WAF A;  4L9T A;  3S1Q J;  2DA6 A;  4XSX F;  3ZQL A;  1MMN A;  3HSF A;  4A3I J;  2WAE A;  4XLE A;  3A0B C;  2X85 A;  4IHS A;  3OYI A;  4RGU A;  1R4M B;  2KIM A;  2L5Q A;  3JR9 A;  4KN7 X;  2ZJP F;  4IOC F;  2JA7 J;  2K40 A;  1W7P D;  3LQR A;  5IYC J;  2P5L C;  3P9I A;  4IKF A;  2D45 A;  2DBB A;  4KMU X;  3BR5 A;  1REP C;  3H5R A;  3TW7 A;  4A3K J;  1JUP A;  3KEQ A;  4PJN A;  2CS3 A;  3GEZ A;  5D5V B;  3CCQ I;  4XOR A;  4HNU A;  1S6L A;  3L2Q A;  2LRE A;  3J81 Z;  5ILU A;  2P4W A;  2RDP A;  4PFP A;  2LKS A;  2HOA A;  5HDK A;  4RLQ A;  3HXL A;  2MC3 A;  4XLP F;  2Z99 A;  3GFM A;  2E1M B;  5CVV A;  2BW3 B;  3O2P E;  4GYI A;  1LB2 A;  1OMI A;  2KT0 A;  1VI0 A;  2ETH A;  5JVT A;  1WHU A;  2IA1 A;  1HCR A;  1FSE A;  1UHS A;  2HU9 A;  3W3C A;  3JTG A;  1W0T A;  5E8G A;  4ZTF A;  3JRC A;  4ASN A;  4IQJ A;  4CCJ A;  4PFO A;  3BR0 A;  2VE9 A;  1RIO H;  3MKL A;  2JTV A;  2FE3 A;  1ZGJ A;  3NAR A;  4LJZ F;  1D8J A;  2F4I A;  2VJ4 A;  4XOT A;  3IH3 A;  3DPT A;  2EZH A;  1Y0N A;  2X1E A;  3G1M A;  4ZYH A;  3B73 A;  1IZ1 A;  3R0A A;  3OIQ A;  5HNF A;  4II2 A;  4BU2 A;  2L3D A;  2FUG 2;  1QZE A;  3SJM A;  5EGO A;  2ID3 A;  4CO8 A;  1BC8 C;  2BY2 A;  4NNJ A;  1BJZ A;  3OYC A;  5BQT A;  4XR6 A;  2PI0 A;  2F5V A;  3HUG B;  4IVN A;  1YQA A;  2W00 A;  2K5C A;  5LEJ A;  1VND A;  2PMH A;  4BE0 A;  2FBH A;  5HS8 A;  4Z6Y A;  2DOE A;  4HYE A;  1IUY A;  3BZK A;  3M07 A;  2Y31 A;  2ZJQ F;  1IN4 A;  1STZ A;  3LWF A;  4Y7N J;  3LOC A;  4UUT A;  2STT A;  2L9R A;  4M3G A;  3CC7 I;  1G8X A;  4UXN A;  3HHH A;  2YU3 A;  5AIQ A;  3AAF A;  1JT0 A;  1VQ9 I;  4HF0 A;  3F3X A;  1IO2 A;  3LQQ A;  3JSP A;  1GDT A;  1KQ9 A;  4XID A;  4V19 K;  1G6N A;  4O3M A;  4L0Z B;  1IN7 A;  2HOE A;  2Q2E A;  3P5J A;  1W4M A;  2VB6 A;  5CQE A;  4MQV A;  2EFW A;  3NAU A;  1UAA A;  4QSH A;  1B8I B;  1WRJ A;  4ABZ A;  1YI2 I;  1U8R A;  3IKT A;  1MMD A;  3S3N A;  2AQF A;  2LK2 A;  5DM7 F;  2HNH A;  2BOL A;  3QOP A;  4BL0 B;  3FM3 A;  5J1U A;  5EG0 A;  3H9Q A;  2QLZ A;  4HW0 A;  3CJT B;  2E1O A;  1ZLJ A;  1IW7 F;  3OMY A;  5ERI A;  2IAI A;  4M73 A;  4ON0 A;  2LKP A;  4N9I A;  5EF6 A;  1MMG A;  2GXA A;  3SZG A;  5IT9 Z;  1W0U A;  3TDZ C;  2C6Y A;  1P7I A;  2BHY A;  2DLL A;  3HBL A;  2DT7 B;  3B02 A;  2CUF A;  3KLO A;  2DQR A;  4BXX J;  1WI3 A;  4DOZ A;  2G7U A;  2JMW A;  1HW1 A;  5DD8 A;  1J09 A;  3SZT A;  3JCU C;  4A6D A;  4BDZ A;  2MLG A;  3GBG A;  3ZGK A;  1AKH A;  2V7F A;  3DBH B;  2LFB A;  1ON1 A;  5F0F A;  2HFH A;  3HOT A;  2EIN H;  1UG2 A;  4LIV A;  3VYU B;  3JRF A;  1K6Y A;  2RN7 A;  3AG4 H;  1U5T C;  3FF5 A;  3OIP A;  3JRD A;  1KU9 A;  1WVR A;  2MD0 A;  3BR1 A;  1SFK A;  4Y17 A;  1I6X A;  4NHJ A;  2D2W A;  2FSW A;  4F3Q A;  4WXD A;  3BQY A;  5ICC A;  2VBW A;  3ML6 A;  4MEY F;  3WTS C;  1Y39 A;  1S3J A;  5DCM B;  2DMT A;  1FSH A;  4L5J A;  2XAF A;  5HLH A;  3DF8 A;  4LK1 F;  1DP7 P;  4A12 A;  1B4A A;  5FKK A;  2XGX A;  1R1V A;  5L3E A;  1X3Z B;  3BJ6 A;  3CES A;  3HSR A;  5LD2 C;  2E36 A;  3OIO A;  3DBR B;  3TO7 A;  1HQC A;  5DS9 A;  2XKO A;  2V26 A;  3I55 I;  1XMA A;  2XSJ C;  4RDU A;  2ZME C;  2VKE A;  5IOY A;  1MMA A;  1XGN A;  3GCM A;  3IAM 2;  3I9V 2;  4XRF A;  3S2D J;  1K83 J;  4IRG A;  3UNG C;  2EV0 A;  2R5Z B;  3GTP J;  4HEA 2;  4M9X A;  3JRI A;  1V5F A;  4AVP A;  5D4R A;  2CUZ A;  1K78 A;  5HLT A;  3LFK A;  3LSG A;  1TQM A;  2LNB A;  3HHG A;  3GTK J;  3H3V K;  1QPM A;  3I64 A;  3IAS 2;  2FOK A;  1IXC A;  3KEO A;  2FML A;  3F21 A;  1AHD P;  2JRM A;  3K10 A;  4S05 A;  1OJL A;  2Y0M A;  2F5C A;  1AA7 A;  3WE3 A;  4BHC A;  2LTP A;  1WFX A;  1ETX A;  3KFW X;  1TTY A;  1S29 A;  4A3J J;  2HGC A;  2L7Z A;  3AG2 H;  5DD4 A;  4B8X A;  4RS8 A;  2QGU A;  3M8E A;  4R79 A;  5JVG F;  3UR3 C;  5CVJ A;  1Y8R B;  4CCK A;  1UMQ A;  3G6E I;  3IWZ A;  2H8R A;  3QWL A;  3G2B A;  4ZC3 A;  4GO1 A;  3K4B A;  2E2J J;  1W1W E;  3ELK A;  1YW8 A;  1G3S A;  4JK1 X;  3DPU A;  3D0S A;  3WG7 H;  4M9S A;  4ITV A;  4IQ4 A;  4PGG A;  4DYQ A;  1ZR2 A;  1PJR A;  2H6C A;  4OMZ A;  5ILS A;  2QBY B;  1RKW A;  1SFX A;  4FCY A;  2DMU A;  2L7F P;  3LAJ A;  1MDM B;  4OU0 A;  5HS7 A;  5E3L A;  2VOP A;  2XRN A;  4L0Y B;  2A6T A;  2MH2 A;  3DKY A;  3HOS A;  2EA4 A;  1SFO J;  5JHU A;  4KN4 X;  1OLT A;  4J00 A;  4RMN A;  2FOW A;  1BR4 A;  3CCR I;  1HST A;  5M3F J;  5L3F A;  3VOD A;  4XLH A;  4CIC A;  2AXT C;  2KZV A;  3WTZ A;  2Z5U A;  1NK3 P;  2QQ8 A;  1CGP A;  5FLV A;  4HLX A;  2EB7 A;  2WAD A;  3IKV A;  1Z6T A;  2ID6 A;  2LMD A;  3BTL A;  4KT5 C;  3GW2 A;  1YRN A;  5L3G A;  2Z2S B;  3V8J A;  2X48 A;  1RKT A;  2LVS A;  3ZN1 A;  1MBK A;  2W4S A;  1RUN A;  1I1G A;  4CCM A;  3PIO F;  4UV8 A;  3H9G A;  3DU5 A;  4A3M J;  4MIM A;  4ZTJ A;  5ICE A;  3FHN A;  2Q1Z B;  2NXN B;  4JX6 A;  3J81 K;  3GX4 X;  2BHZ A;  1MND A;  2MH9 A;  4MLO A;  3A02 A;  2DT6 A;  1BA5 A;  1L3L A;  4P5O A;  5J40 A;  4U7B A;  5E79 C;  2EK5 A;  5F64 A;  5LEK A;  4L9J A;  3W6J B;  3PFY A;  3KP7 A;  3JW4 A;  4MFE A;  1TNS A;  1WWX A;  4P96 A;  1SVM A;  1A04 A;  4RA2 A;  1UST A;  3Q9V A;  1BIA A;  1Y0U A;  2BBY A;  3VYT B;  2DJI A;  3KPH A;  4B09 A;  1X58 A;  1P4A A;  4DGW B;  4BGD A;  2PJR B;  4OOI A;  5H6R A;  5DUI A;  4CCO A;  2ESN A;  1ETK A;  2NS8 A;  2A5Y B;  2CYY A;  3HRU A;  5FKO A;  2JA6 J;  3FMR A;  5BPD A;  4AYB A;  1SMT A;  3PFI A;  4LOC A;  2EIM H;  5E3O A;  1MJB A;  1VQM I;  2CQ7 A;  2EIJ H;  3CJN A;  2DFF A;  1UCR A;  4EGY A;  3E6B A;  1KGS A;  2W82 A;  4LG0 A;  4XOP A;  5IY5 H;  1ZRF A;  2ZSI B;  2CMP A;  1HDP A;  2XAH A;  2QWW A;  1V54 H;  2VC1 A;  1YE9 A;  1IGN A;  2Y0S N;  2I8D A;  2M0M A;  2O6G E;  2OF7 A;  4BJ5 C;  3O6B B;  3GME A;  3S14 J;  4A3B J;  3BOQ A;  2XGC A;  1IF1 A;  3BTC A;  3I4P A;  2GOX B;  2XAU A;  3S16 J;  1IN8 A;  4WWC A;  2VKD A;  1XD7 A;  2QSG X;  1FT9 A;  4WK8 F;  3MFK A;  2GWR A;  3RJP A;  5FRM A;  4L9N A;  3FXL A;  4XNF A;  3C18 A;  2DQL A;  2BY0 A;  3FXU A;  4XMY A;  2YPR A;  1N78 A;  1AOY A;  1ZAR A;  3CP2 A;  3SFI A;  3A01 B;  2KPM A;  1IG7 A;  3FZV A;  3TDU C;  2CJJ A;  4KT6 A;  1Y1W J;  4LFU A;  5J1R A;  3NWS A;  1FPQ A;  2OC6 A;  4IHV A;  2XV4 S;  5HOO A;  1WJD A;  3OS2 A;  2VL8 A;  3QPH A;  4CA0 A;  1XDS A;  3ZMD A;  4MTE A;  3D5S C;  3P7N A;  1HKQ A;  2IGO A;  1D3Y A;  5K7Z A;  2VPL A;  3B6A A;  1H9G A;  4ANJ A;  4ZYA A;  3PUB A;  4I09 A;  3G71 I;  3ABM H;  2JA5 J;  4MFD A;  2YUS A;  4N4O B;  2R5Y A;  1FNN A;  4W97 A;  1VQN I;  3GVA A;  4M74 A;  4DW6 A;  3I54 A;  5K7H A;  3WE2 A;  1Y8Q B;  2X6O A;  4BHB A;  5LHI A;  1U3E M;  5IT9 K;  5J47 A;  2GA1 A;  1XSD A;  2IW5 A;  3H35 A;  1QZY A;  3FXQ A;  3CME I;  2I10 A;  2L9V A;  1ZGA A;  1P4W A;  1WSU A;  1BBY A;  3L2V A;  3U21 A;  2HVR A;  3CCL I;  3GTQ J;  1Z0X A;  2Z3Y A;  4NC8 A;  4CYD A;  2IA0 A;  3F8B A;  5FFZ A;  4B43 A;  4EAT A;  2WTE A;  1S9H A;  3U2R A;  1ZK8 A;  2Y0S A;  3HG9 A;  3L1P A;  1ZAO A;  3A4C A;  4G6Q A;  3LA3 A;  3U9G A;  4G7O F;  2IS2 A;  1POG A;  4X6A J;  4MO7 A;  2CV2 A;  4EEF G;  5C3E J;  2V1N A;  4UB6 C;  2RQP A;  5BMZ A;  3M4O J;  1MBE A;  1X2N A;  2R7F A;  3E7L A;  1YS6 A;  4HA8 A;  4KA4 A;  3ZMU A;  2FD5 A;  1UB9 A;  4E70 A;  5LGT A;  5IPA A;  2H6B A;  2M7B A;  1IC8 A;  1MD0 A;  2OU2 A;  4RM3 A;  1FYK A;  1TT5 B;  3L2W A;  3OWT A;  1QNT A;  2X0L A;  4M72 A;  4D5F A;  5M3M J;  1HW5 A;  2QYO A;  4A0Y A;  2Q8K A;  5GPA A;  1MGT A;  4QWQ A;  2LOO A;  2BW3 A;  4C3J J;  3PNY A;  3DPL C;  2CWE A;  3FBI B;  2PLY A;  3OOP A;  2XPV A;  2HWV A;  2LY1 A;  1LFB A;  1O3Q A;  5BPI A;  2OZ6 A;  4UVB A;  5BNG A;  3I3L A;  2P6S A;  3JRH A;  1LFU P;  1FWZ A;  3VFZ A;  3CD6 I;  2DXI A;  4D7N A;  2L02 A;  3MKZ A;  3JTH A;  3FXM A;  3ZQC A;  2K4B A;  2K02 A;  1FX7 A;  2L0K A;  3FKI J;  4YRV A;  4G12 A;  3BCB A;  3EET A;  4MHG A;  2NAZ A;  4BJ6 C;  3OSF A;  1ERD A;  1KA8 A;  2KJB A;  4O5V A;  5L3D A;  5LRS A;  3LSH A;  1MSF C;  4TV7 A;  2A6H F;  2F5E A;  3GFL A;  4UVA A;  5KAI C;  5JHF A;  1ZH5 A;  3I0T A;  1YIT I;  5E18 F;  2XPU A;  3K1N A;  3HUG A;  1T8I A;  5FLX K;  5IYB J;  1ORK A;  3CJQ B;  3LNQ A;  4FT8 A;  4XM3 A;  2EZL A;  4BE2 A;  1T6S A;  1LJ9 A;  3LAP A;  4YFX F;  3H0G J;  5CJ9 A;  2WV0 A;  4RB3 C;  4Y33 A;  4XLN F;  1N75 A;  5D6F A;  2QQB A;  1XGO A;  1UEL B;  1IRZ A;  2J5O A;  3HYI A;  3QYF A;  2P5K A;  4NB5 A;  3TBI A;  4BQA A;  2EFP A;  1PP8 F;  1ZLK A;  2KFD A;  2DA7 A;  3Q5F A;  3FMS A;  2GM4 A;  2CQX A;  2R7Q A;  3L09 A;  3W2A A;  3DKX A;  3ISP A;  2I5U A;  1IUF A;  3HGG A;  4NC7 A;  3BLY A;  4B44 A;  4UUS A;  1YJW I;  1VQP I;  3FBN B;  1XMX A;  1HLV A;  2O7O A;  5HOD A;  4E6K G;  2LBF B;  1R7J A;  2KP6 A;  1OCP A;  4BAY A;  5TRD A;  1BI2 A;  1TWG J;  3CCY A;  1QGP A;  2VUM J;  3GZ6 A;  3SEQ A;  4HRI A;  4OAY A;  1J5Y A;  3I53 A;  1XCB A;  2DTZ A;  1LPQ A;  5IP6 A;  2BYV E;  5IP7 J;  2WWY A;  3RPU D;  1H9T A;  4PJJ A;  4LB5 A;  1BR2 A;  2OTL I;  2CFO A;  4HX4 A;  1TQI A;  3V8L A;  1Z7L A;  1U2W A;  1WJA A;  1GUU A;  2DOF A;  2A69 F;  2LLK A;  3R61 A;  3H3U A;  5KAF C;  1GLN A;  2FX0 A;  1X2M A;  2VOD A;  4AC0 A;  1XC5 A;  2F5D A;  1HC8 A;  1XX5 A;  3EYI A;  1OPC A;  5HLI A;  1OR7 A;  3CF5 F;  3FK7 A;  2O8X A;  4Q47 A;  2MAB A;  3A0H C;  1N77 A;  1O3R A;  4ZDL A;  3RPQ A;  4BEH B;  4DBQ A;  3T8R A;  4QIW N;  2HEO A;  4HX8 A;  5B1A H;  3CLQ A;  4LIT A;  1A31 A;  1BR1 A;  4BHP A;  2GOM A;  3B6C A;  4DYC A;  1A36 A;  2PJP A;  2RC4 A;  2Y30 A;  4F92 B;  3CZ6 A;  2DMN A;  3FKJ A;  4PCQ A;  3F0C A;  4XKC A;  1G59 A;  1Z9C A;  1I5Z A;  3QPS A;  4W1U A;  4A69 C;  2V1X A;  2XAJ A;  4HV6 A;  4G6T B;  4A6E A;  2JA8 J;  2DDB A;  2V79 A;  4N9H A;  4C3I J;  5B3S H;  2JSP A;  4RAG A;  5M5X J;  2VQG A;  4I0A A;  1SD5 A;  3VPR A;  1J9I A;  1LE8 B;  2E71 A;  2HOT A;  2UWM A;  4B1R A;  1G3T A;  4GDF A;  3OYH A;  1KON A;  2ZO4 A;  3ECO A;  5GAE J;  3VSK A;  4XQF A;  5M5W J;  2KIS A;  3HOZ J;  3OY9 A;  3CUQ C;  3H9J A;  1ENH A;  2W57 A;  4A0Z A;  4XKV A;  1X1P A;  3ZQQ A;  4IF4 A;  1LUJ B;  1FOX A;  2OJE D;  3AG1 H;  1YS7 A;  3S15 J;  3MN2 A;  1IRX A;  2LRD A;  2DA5 A;  1OCT C;  5KCM A;  3HM5 A;  4U87 A;  4XKW A;  1RES A;  4KYW A;  1A35 A;  4WXH A;  1KU7 A;  1OCZ H;  2P8T A;  3OYN A;  3TO9 A;  2EPF A;  2H8W A;  3VSL A;  4AWX B;  1V4R A;  3BCA A;  1DGW Y;  4UB8 C;  2O8K A;  4M6V A;  4L5E A;  4JX4 A;  3BJO A;  4ENM A;  3E5U A;  1YG2 A;  4ENJ A;  2E19 A;  3M7G A;  4Q48 A;  2HPI A;  2M8G X;  1RRJ A;  2IT0 A;  3ROU A;  4LD5 A;  1WJB A;  4QTR A;  5L3C A;  3HSE A;  3HB9 A;  3LSJ A;  2LKX A;  1Z6R A;  2O3F A;  5DM6 F;  2JSC A;  2O03 A;  2X6Y A;  2O61 A;  5GPC A;  4C30 A;  5D6E A;  3TOA A;  3W2W A;  3SZP A;  2CQK A;  3J7Z I;  3MKY B;  3DQV C;  1X3U A;  3ZMS A;  4FQG A;  3ABL H;  3J80 K;  1OYI A;  5DCF A;  4UY8 I;  4D9J A;  1NHA A;  1CQT A;  1QO0 D;  4ZZL A;  5EJC A;  1HKT A;  2HZT A;  1W5T A;  2HQR A;  4L9V A;  1B72 B;  1MDM A;  2HXI A;  3WG9 A;  4XBF A;  3M8J A;  1W7P A;  3BPX A;  5LRR A;  1DU6 A;  1TL8 A;  4M3B A;  3G4S I;  4FTH A;  1QA6 A;  2Y9Y A;  2ESH A;  2VJ5 A;  2HDD A;  2HTS A;  2DT5 A;  4AU7 A;  1XSV A;  3KET A;  2Y9Z A;  4M6X A;  5E1X A;  1YTY A;  1HXD A;  2HXO A;  5DV5 A;  2RAE A;  3NEU A;  3S32 A;  2P6T A;  4FAS D;  2EJR A;  1E2X A;  1TWA J;  4BE1 A;  2TCT A;  4P1W A;  1PYV A;  3DTE A;  4E7I A;  2NOG A;  3H5N A;  2IJL A;  1PUF B;  4I6Z A;  2PQ8 A;  1T0F C;  1VQ6 I;  2JN6 A;  2H1K A;  2HDC A;  1FZP B;  1JHH A;  3QU3 A;  2L01 A;  1I39 A;  1GXP A;  1MH3 A;  1MJA A;  4YIR X;  2XHK A;  2ICW G;  2PMZ N;  3S17 J;  2X1D A;  5F08 A;  3BG6 A;  5K1Y A;  4LK0 F;  2NS0 A;  3I71 A;  3CCV I;  1YO5 C;  4V2F A;  3O3K A;  4A3L J;  4JQF A;  2XC7 A;  3COA C;  5TIS C;  4GFB A;  1Z3Y A;  1LNW A;  2FJ1 A;  1MMS A;  3T5X A;  4FHT A;  1QHG A;  2VE8 A;  4ENK A;  1YOV B;  1MZB A;  4ZYE A;  5J4Y A;  3PO2 J;  1E17 A;  4A93 J;  4RAY A;  5E8I A;  2K27 A;  3FXR A;  3PSF A;  3K1M A;  2LSO A;  2X6W A;  2JA2 A;  1O3T A;  1UFM A;  2FF4 A;  3J7A O;  5GTH C;  2G7H A;  5J1Y A;  4PSW A;  2ISY A;  4WCG A;  5CQG A;  3Q0W A;  1O3S A;  3QAH A;  4Q5S F;  1GVJ A;  4KIF A;  4P9U A;  2VKV A;  2VQC A;  2FBI A;  2JJ7 A;  4IHX A;  4XRM A;  1MBF A;  1NH3 A;  1OCO H;  5E1Z B;  2BZT A;  2J5P A;  3CLO A;  3I56 I;  2A61 A;  3PO3 J;  3MCZ A;  3Q0U A;  1KZH A;  4M6Y A;  3C2G A;  2JQ7 A;  3TED A;  2DK8 A;  3PM1 A;  3WTY C;  2R7R A;  1W36 C;  3C2B A;  5JFR A;  2DPD A;  1IAW A;  3SHF A;  3BG7 A;  3DTI A;  3G3Z A;  1Y6I A;  2K86 A;  4XN3 A;  2WB1 N;  5F1J A;  5F0C A;  4II3 A;  4EV0 A;  2BY1 A;  4ESB A;  3NWT A;  3G1L A;  3GTJ J;  1OCR H;  2CH0 A;  3K4J A;  2PFB A;  2OTJ I;  4ZDP A;  2QUF A;  2ZJ2 A;  3ABU A;  1JUS A;  3GLL A;  1ZG1 A;  4BQO A;  5BS6 A;  2V4J C;  1WH5 A;  1P2F A;  2QVO A;  2X6X A;  1UHM A;  4BUP A;  5KNL A;  3KIO A;  2HYJ A;  2OQG A;  4HQE A;  4IHT A;  1R49 A;  1J0R A;  3JAM Z;  4HNT A;  2DMP A;  2MA3 A;  5B1B H;  4MGR A;  3KCC A;  1E0E A;  1J59 A;  1R23 A;  2IGN A;  3A01 A;  3JRE A;  2KHM A;  1MKM A;  2IEK A;  3AFH A;  2R7W A;  2AXL A;  4IJA A;  2ZXJ A;  4RLF A;  2NVU B;  3QQA A;  3R0J A;  1TBX A;  3EQL F;  3W6K B;  1DU0 A;  1D8K A;  2MW8 A;  2CGP A;  3MKW B;  3FK6 A;  3WTU C;  2CO5 A;  2XB0 X;  2ME6 A;  4KIS A;  2QCO A;  1TQP A;  3MZ8 A;  1O4X A;  2GIZ A;  2DYS H;  3TP3 A;  3G1O A;  3KX2 A;  4CXF A;  1FMV A;  1GV5 A;  2M4G A;  2H09 A;  1R5G A;  4AID A;  2E2H J; 
#chains in the Genus database with same CATH homology
 3JSO A;  3TOB A;  4ESJ A;  3M1E A;  5D8L B;  5D5W B;  5LGN A;  5FLX Z;  3F6O A;  5DDG A;  5FD6 A;  5K5O A;  1Z1D A;  1DPR A;  3T0Y A;  1J7K A;  3N97 A;  3VOE A;  1HW2 A;  3P9C A;  1LDK B;  2LF8 A;  5CVR A;  1GXQ A;  2DK5 A;  1U6G A;  2M1B A;  3K0L A;  3V7R A;  4MQ9 F;  1QQI A;  3KZZ A;  2ISZ A;  3FWE A;  2BE5 F;  5HVQ C;  4KNY A;  1JGS A;  1HKS A;  1Z91 A;  5J8F A;  1EH7 A;  3REO A;  3DV8 A;  4KUM A;  1C0W A;  4A0X A;  1YFH A;  1LQ1 A;  3WTW C;  4D0P A;  4M9Z A;  5F6F A;  3F22 A;  2VT2 A;  1TW3 A;  4CDG A;  3WGI A;  2QQA A;  5FGM A;  5E1W A;  3WGH A;  3M9A A;  4F7Z A;  1F9N A;  5FB2 A;  4XSZ F;  5D8K B;  4ZYD A;  3MZH A;  5CYV A;  1ZRC A;  2OD5 A;  4HDU A;  3PQK A;  5A2Q Z;  2YSR A;  3H92 A;  1BIB A;  2PG4 A;  4HF2 A;  4HLY A;  1FBU A;  1WKM A;  1OKR A;  4LGW A;  2LF7 A;  5LLQ A;  3RIR A;  4UVC A;  1CF7 B;  3C7J A;  3MAJ A;  4P9F A;  2DAO A;  1U5T A;  3NRV A;  4EJO A;  3MEX A;  4QLC U;  2XAG A;  4U7D A;  2DU9 A;  2HTJ A;  1BI0 A;  2XUB A;  3OV8 A;  4UV9 A;  3ZQ7 A;  4GYG A;  3CO6 C;  1J2X A;  1KU2 A;  3RI4 A;  4KYW A;  3CUQ B;  4AD9 A;  1SD6 A;  1P4X A;  5TJJ A;  4AIK A;  1R5H A;  2A6E F;  2HKX A;  2ZME A;  4PZJ A;  3WU1 B;  2HYF A;  2X4H A;  4HV5 A;  1ON2 A;  4EM1 A;  2DFI A;  2FXA A;  1FP2 A;  3BDD A;  3V7C A;  3J80 Z;  2PN6 A;  4GCV A;  1RZ4 A;  3BY6 A;  3WTV C;  4U0V A;  2FA5 A;  2A07 F;  5HLG A;  3I59 B;  2BV6 A;  4WXC A;  2XAS A;  1SD7 A;  1S7A A;  1FOK A;  3BWG A;  5LGU A;  2L4M A;  2XIG A;  1Z05 A;  1MJ9 A;  3MQ0 A;  2JPB A;  1ZRE A;  4A5M A;  3SFZ A;  3LST A;  1FYL A;  4UUV A;  3K69 A;  2CW0 F;  2BGC A;  1XN7 A;  2PBI A;  5FO5 A;  1FC3 A;  1KYW A;  3R60 A;  3MZY A;  2FU4 A;  2HS5 A;  1BI3 A;  2VN2 A;  2HYG D;  2L54 A;  4KIG A;  4U0W A;  3ZMZ A;  4RGS A;  3E5X A;  4I01 A;  5ED4 A;  1R36 A;  5D5X B;  3JAM K;  1OYY A;  4UHT A;  4A2U A;  2E7W A;  1IN5 A;  5FD5 A;  1FBS A;  2GA2 A;  2JT1 A;  4OIR F;  4HQM A;  1KQ8 A;  3EYY A;  3ERE D;  4S04 A;  3ZPL A;  5CVU A;  2CG4 A;  4PDK A;  1PDN C;  4RB0 A;  3KZY A;  2F5F A;  3BPV A;  3GUD A;  4FX0 A;  3FMQ A;  1K7A A;  3GXO A;  2QQ9 A;  4EJV A;  1WI9 A;  2RGV A;  5J8C A;  3N4M A;  1LDD A;  1B9M A;  4CZZ A;  2NYX A;  1BM9 A;  3DXJ F;  3CUO A;  2Y48 A;  3GLX A;  2VON A;  2Q0O A;  5DYM A;  3H3Z A;  1XDU A;  5ICF A;  5LBQ A;  5K5R A;  3WGG A;  4EJW A;  3GWZ A;  4N0B A;  4I2O A;  2OBP A;  2FNA A;  2UZK A;  4OIO F;  1ZHF A;  2ZNY A;  3F8C A;  3SQN A;  2WC2 A;  4CHU A;  1IN6 A;  2IRF G;  5EEG A;  2M30 A;  2HQN A;  4EJT A;  5A2Q K;  3KP4 A;  2DTR A;  4ZH4 F;  1ZRD A;  1O57 A;  4OIP F;  4BXU A;  2W25 A;  3HRS A;  5DCM A;  3RTR A;  1EV7 A;  4M71 A;  2O0Y A;  3HRT A;  3SXY A;  3KE2 A;  3WU0 A;  1LEB A;  1EH6 A;  2ZNZ A;  5FFX A;  4RB2 C;  3C3W A;  1XMK A;  2JPC A;  2Z33 A;  2QZ8 A;  3F23 A;  2ADU A;  3RPU A;  2VC0 A;  2FRH A;  4EGZ A;  1SD4 A;  2LDU A;  4K2E A;  3TO6 A;  2UXN A;  1PP7 U;  2NNN A;  4I02 A;  2KKO A;  1AWC A;  4Z2Y A;  2KRF A;  5BOX A;  3QPT A;  3GFI A;  1XGS A;  4IXA A;  3LA2 A;  2W24 A;  3D5L A;  4EMS A;  5ICG A;  5DUK A;  4JBA A;  2QBY A;  2KIF A;  5KK1 A;  1FBQ A;  3ZMV A;  3T1B A;  1RI7 A;  1YIO A;  2V6C A;  5JI6 A;  4MEX F;  1T38 A;  3WTX C;  5HS9 A;  3KLN A;  2Y75 A;  2P5V A;  2XAQ A;  2MD5 A;  3E5Q A;  4ENN A;  5LHG A;  2EFQ A;  1DDN A;  3GF2 A;  3BRO A;  1U78 A;  2H27 A;  2K4J A;  1DPU A;  1QBJ A;  4I98 B;  4EM2 A;  1XCV A;  4G7Z F;  1XB4 A;  3FM5 A;  5AIP A;  2D1H A;  2STW A;  3R6S A;  3RYP A;  2JZY A;  2V1U A;  1O7F A;  5H6Q A;  1G3Y A;  3U1D A;  3L9F A;  3IRQ A;  1XSX A;  2YX4 A;  1B6A A;  3KP3 A;  2FQ3 A;  1GHC A;  4BNC A;  5DEQ A;  4U0Y A;  2ACJ A;  2QEN A;  2BEO A;  2VBZ A;  2P7C B;  4HX7 A;  1G3W A;  2UXX A;  5HDG A;  4R1H A;  3RKY A;  4RB1 A;  5CLS A;  2PMU A;  3ECH A;  3TKY A;  1CF7 A;  4YG2 F;  2XKP A;  3HTS B;  2CSO A;  1FLI A;  2E7X A;  2RV8 A;  2TDX A;  1FYM A;  2D1V A;  3F8F A;  2FBK A;  3ZMT A;  3K2Z A;  3IHU A;  3C1D A;  2ZCW A;  3NQO A;  2OZU A;  2ZBK A;  4Y13 A;  1Z7U A;  3CUQ A;  2YR2 A;  2H94 A;  3GYH X;  2RVC A;  2XRO A;  1PUE E;  2IVM A;  5CVI A;  2GXB A;  2P7V B;  2EA2 A;  2ZFW A;  3LA7 A;  2RKH A;  3F72 A;  3F8M A;  2A68 F;  4HOB A;  2PEX A;  1SAX A;  5K5Q A;  2VOO A;  2XVC A;  4L5I A;  5KVR A;  1LEA A;  1Q1H A;  3E3V A;  3GZ5 A;  4DNC A;  3K1P A;  4R8H A;  3I59 A;  3CO7 C;  2GAU A;  3E97 A;  4Y15 A;  3E6C C;  4EQQ A;  1B9N A;  2L4A A;  1F5T A;  1LVA A;  5F1R A;  4LMY A;  1HBX G;  1VTN C;  2EFO A;  4IPA A;  3R4K A;  4RGR A;  4LLL A;  3FHZ A;  3E6M A;  2FMY A;  3L00 A;  4U88 A;  4L18 B;  4ETS A;  1DUX C;  3IRR A;  2MBF A;  1JXS A;  1W7P B;  3QP6 A;  4YIF A;  2GXG A;  3GFJ A;  4KIC A;  1T2K A;  5L3B A;  4HBL A;  3EUH A;  3KP2 A;  3QP5 A;  4ESF A;  1F1Z A;  1KU3 A;  4MTD A;  2YX7 A;  1EH8 A;  1KQ0 A;  1T39 A;  1D5V A;  1ZYR F;  4DQ2 A;  1T0F A;  4PGH A;  3L7W A;  2V9V A;  4LLN A;  4LB6 B;  2DPU A;  4G94 A;  1G4D A;  2EFN A;  2EWN A;  3RYR A;  3FX3 A;  2B0L A;  5J6X A;  3BZ6 A;  2G9W A;  2GQQ A;  3WTT C;  4HF1 A;  1ZG3 A;  4G8X A;  1YW9 A;  1YLF A;  4IRH A;  2DO7 A;  4YFN F;  1KYZ A;  4WX9 A;  1I27 A;  1FY7 A;  2HKO A;  4KMF A;  3KP6 A;  4EM0 B;  1V3F A;  3HRM A;  3VEP A;  5H20 A;  5HDN A;  2GIV A;  3F6V A;  2KIU A;  4IRI A;  1BOA A;  5E20 A;  2W85 A;  3ZN0 A;  2MLK A;  1T98 A;  4I7H A;  5IT3 A;  4OIQ F;  4FX4 A;  1J75 A;  5AON A;  4UNO A;  2VT3 A;  3DKW A;  1R58 A;  4EVI A;  4MNU A;  2V1D A;  4AIH A;  4HAM A;  4NQW A;  2HR3 A;  5D4S A;  1ULY A;  1YW7 A;  1K78 B;  1IXS B;  2M87 A;  4BH9 A;  2AS5 F;  2R7D A;  2M5W A;  3S2W A;  4KDP A;  1BJA A;  1BN5 A;  1JHF A;  3ULQ B;  3I5U A;  2DI3 A;  4OMY A;  4O6J A;  3TGN A;  3EDP A;  4HDV A;  4OIN F;  4RGX A;  1S7O A;  4G9Y A;  2VBY A;  1XGM A;  1IRG A;  4EJU A;  1W5S A;  1P92 A;  3MWM A;  3I58 A;  4YII A;  3V4G A;  1B1B A;  1SMY F;  4HZF A;  3DFG A;  3T8T A;  2EV5 A;  5ILV A;  4ZZD A;  3HIF A;  1USS A;  3VB2 A;  3L2C A;  5D5U B;  4WF2 A;  1HSJ A;  3V8K A;  2M45 A;  2KJC A;  2IPQ X;  1L0O C;  2Z9O A;  2QM3 A;  1S8N A;  4RAZ A;  2CFX A;  1JE8 A;  1BI1 A;  4P55 A;  5JR3 A;  2EV6 A;  4A5N A;  4G7H F;  4G6D A;  1K79 A;  3QU6 A;  1RNL A;  4ZYG A;  4LLG F;  4YFK F;  4KFC A;  1R1U A;  3KP5 A;  2VXZ A;  3RKW A;  2K7L A;  2NRA C;  2FEZ A;  5E17 F;  2IA2 A;  3IWF A;  3RDI A;  3PQJ A;  1RUO A;  4KIB A;  1F4K A;  4GGG A;  1LDJ A;  1O7L A;  6PAX A;  1B59 A;  3P9K A;  2E1C A;  1K6O A;  3HTU A;  3E6D A;  2ELH A;  2DW4 A;  2OQR A;  4BYY A;  2RNJ A;  3IC7 A;  1R1T A;  3BJA A;  1SFU A;  3G73 A;  2JRT A;  4LG0 B;  1P6R A;  1WQ2 A;  2ZKZ A;  1I1S A;  1TNT A;  5LHH A;  2OA4 A;  1FP1 D;  2FNP A;  1U5T B;  1ONV A;  1ODD A;  5EEH A;  4GXO A;  4I0B A;  3V7S A;  3ZP5 A;  1OYW A;  1YYV A;  2OAZ A;  1IRF A;  2W84 A;  2R3S A;  4CGZ A;  4Q4Z F;  3QRF F;  3RKX A;  1H0M A;  3K9T A;  1SFE A;  1QZZ A;  2ZME B;  3ABT A;  4AIJ A;  1R22 A;  1TW2 A;  1R00 A;  2F2E A;  3DP7 A;  3CDH A;  2COM A;  1ZN2 A;  2GZW A;  3Q9S A;  1UHW A;  2M8E A;  2A3S A;  4H0E A;  1BC7 C;  3F8N A;  3TQN A;  3GO5 A;  3CTA A;  1ZG5 A;  1TLH B;  2VBX A;  3DEU A;  2IP2 A;  2E1N A;  3IL2 A;  3WOD F;  3BP8 A;  1IXR C;  3M8F A;  2NNY A;  4L9T A;  4XSX F;  3HSF A;  4IHS A;  4RGU A;  2KIM A;  4KN7 X;  1W7P D;  3LQR A;  2P5L C;  3P9I A;  2D45 A;  2DBB A;  4KMU X;  1REP C;  3KEQ A;  3GEZ A;  5D5V B;  1S6L A;  3J81 Z;  5ILU A;  2P4W A;  2RDP A;  5HDK A;  2MC3 A;  4XLP F;  2Z99 A;  3GFM A;  5CVV A;  3O2P E;  4GYI A;  1LB2 A;  1OMI A;  2ETH A;  5JVT A;  2IA1 A;  1FSE A;  3JTG A;  5E8G A;  4ASN A;  2VE9 A;  1RIO H;  2JTV A;  2FE3 A;  1ZGJ A;  4LJZ F;  1D8J A;  3DPT A;  4ZYH A;  3B73 A;  1IZ1 A;  3R0A A;  2L3D A;  4CO8 A;  1BC8 C;  5BQT A;  2PI0 A;  4IVN A;  1YQA A;  5LEJ A;  2PMH A;  2FBH A;  5HS8 A;  4HYE A;  1IUY A;  1IN4 A;  1STZ A;  3LWF A;  2STT A;  4UXN A;  3HHH A;  2YU3 A;  5AIQ A;  3AAF A;  4HF0 A;  3F3X A;  3LQQ A;  3JSP A;  1KQ9 A;  1G6N A;  4O3M A;  4L0Z B;  1IN7 A;  2HOE A;  2Q2E A;  1W4M A;  4MQV A;  2EFW A;  1WRJ A;  1U8R A;  3IKT A;  3QOP A;  3FM3 A;  2QLZ A;  4HW0 A;  1ZLJ A;  1IW7 F;  5ERI A;  4M73 A;  4ON0 A;  2LKP A;  4N9I A;  5IT9 Z;  3TDZ C;  2C6Y A;  2DLL A;  3B02 A;  3KLO A;  2DQR A;  2G7U A;  1HW1 A;  5DD8 A;  3SZT A;  4A6D A;  2MLG A;  1ON1 A;  2HFH A;  3HOT A;  2RN7 A;  1U5T C;  3FF5 A;  1KU9 A;  4Y17 A;  1I6X A;  4NHJ A;  2D2W A;  2FSW A;  4WXD A;  5ICC A;  2VBW A;  3ML6 A;  4MEY F;  3WTS C;  1S3J A;  5DCM B;  1FSH A;  4L5J A;  2XAF A;  5HLH A;  3DF8 A;  4LK1 F;  1DP7 P;  4A12 A;  1B4A A;  2XGX A;  1R1V A;  5L3E A;  3BJ6 A;  3HSR A;  3TO7 A;  1HQC A;  2XKO A;  1XMA A;  1XGN A;  4XRF A;  4IRG A;  2EV0 A;  4M9X A;  4AVP A;  5D4R A;  1K78 A;  3LFK A;  1TQM A;  2LNB A;  3HHG A;  1QPM A;  3I64 A;  2FOK A;  1IXC A;  3KEO A;  2FML A;  3F21 A;  4S05 A;  3WE3 A;  2Y0M A;  2F5C A;  4BHC A;  3KFW X;  1TTY A;  1S29 A;  2HGC A;  5DD4 A;  4B8X A;  4R79 A;  4RS8 A;  3M8E A;  5CVJ A;  3IWZ A;  4GO1 A;  3ELK A;  1YW8 A;  1G3S A;  4JK1 X;  3D0S A;  4M9S A;  4PGG A;  4OMZ A;  2H6C A;  5ILS A;  2QBY B;  1SFX A;  1MDM B;  3LAJ A;  4OU0 A;  5HS7 A;  2VOP A;  2XRN A;  4L0Y B;  2MH2 A;  3HOS A;  2EA4 A;  5JHU A;  4KN4 X;  1HST A;  5L3F A;  3VOD A;  4CIC A;  3WTZ A;  2Z5U A;  1CGP A;  4HLX A;  2EB7 A;  3IKV A;  1Z6T A;  4KT5 C;  3GW2 A;  5L3G A;  3V8J A;  3ZN1 A;  1RUN A;  1I1G A;  4UV8 A;  5ICE A;  3J81 K;  3GX4 X;  2MH9 A;  1L3L A;  4P5O A;  4U7B A;  2EK5 A;  5F64 A;  5LEK A;  4L9J A;  3W6J B;  3KP7 A;  3JW4 A;  1TNS A;  1WWX A;  4P96 A;  1A04 A;  1UST A;  3Q9V A;  1BIA A;  1Y0U A;  2BBY A;  4B09 A;  1P4A A;  4OOI A;  5H6R A;  5DUI A;  2ESN A;  2A5Y B;  2CYY A;  3HRU A;  3FMR A;  5BPD A;  1SMT A;  3PFI A;  1MJB A;  3CJN A;  1UCR A;  4EGY A;  3E6B A;  1KGS A;  4LG0 A;  1ZRF A;  2XAH A;  2QWW A;  2VC1 A;  2O6G E;  3O6B B;  3BOQ A;  1IF1 A;  3I4P A;  1IN8 A;  4WWC A;  1XD7 A;  1FT9 A;  4WK8 F;  3MFK A;  2GWR A;  3RJP A;  4L9N A;  3C18 A;  2DQL A;  3FXU A;  1AOY A;  2YPR A;  1ZAR A;  3FZV A;  3TDU C;  4LFU A;  1FPQ A;  2XV4 S;  5HOO A;  3QPH A;  1XDS A;  3ZMD A;  4MTE A;  3P7N A;  1HKQ A;  1D3Y A;  1H9G A;  4I09 A;  1FNN A;  3GVA A;  4M74 A;  3I54 A;  3WE2 A;  5LHI A;  1U3E M;  4BHB A;  5IT9 K;  2GA1 A;  1XSD A;  2IW5 A;  1QZY A;  3FXQ A;  1ZGA A;  1P4W A;  1WSU A;  1BBY A;  2Z3Y A;  4CYD A;  2IA0 A;  3F8B A;  5FFZ A;  2WTE A;  3U2R A;  1ZAO A;  4G6Q A;  3LA3 A;  3U9G A;  4G7O F;  2RQP A;  5BMZ A;  2R7F A;  1YS6 A;  4HA8 A;  4KA4 A;  3ZMU A;  1UB9 A;  4E70 A;  5LGT A;  2H6B A;  1MD0 A;  2OU2 A;  1FYK A;  1QNT A;  2X0L A;  4M72 A;  1HW5 A;  2QYO A;  4A0Y A;  2Q8K A;  1MGT A;  4QWQ A;  3DPL C;  2CWE A;  2PLY A;  3OOP A;  2HWV A;  1O3Q A;  5BPI A;  2OZ6 A;  4UVB A;  2P6S A;  1FWZ A;  3VFZ A;  2L02 A;  3JTH A;  2K4B A;  2K02 A;  1FX7 A;  3EET A;  4MHG A;  2NAZ A;  1KA8 A;  2KJB A;  4O5V A;  5L3D A;  5LRS A;  4TV7 A;  2A6H F;  2F5E A;  3GFL A;  4UVA A;  1ZH5 A;  3I0T A;  5E18 F;  3K1N A;  3HUG A;  5FLX K;  4FT8 A;  1T6S A;  1LJ9 A;  3LAP A;  4YFX F;  5CJ9 A;  2WV0 A;  4RB3 C;  4XLN F;  5D6F A;  2QQB A;  1XGO A;  2J5O A;  3HYI A;  2P5K A;  4NB5 A;  4BQA A;  2EFP A;  1PP8 F;  1ZLK A;  3Q5F A;  3FMS A;  3L09 A;  3ISP A;  1R7J A;  4BAY A;  5TRD A;  1BI2 A;  1QGP A;  3GZ6 A;  1J5Y A;  3I53 A;  1XCB A;  2WWY A;  2BYV E;  1H9T A;  4LB5 A;  4HX4 A;  1TQI A;  3V8L A;  1U2W A;  3R61 A;  2A69 F;  3H3U A;  2VOD A;  2F5D A;  3EYI A;  1OPC A;  5HLI A;  1OR7 A;  2O8X A;  4Q47 A;  1O3R A;  3RPQ A;  3T8R A;  2HEO A;  4HX8 A;  4BHP A;  2PJP A;  2RC4 A;  4PCQ A;  1Z9C A;  1I5Z A;  4A6E A;  2V1X A;  2XAJ A;  4HV6 A;  2V79 A;  4N9H A;  1J9I A;  4I0A A;  1SD5 A;  2UWM A;  1G3T A;  2ZO4 A;  3ECO A;  3CUQ C;  2W57 A;  4A0Z A;  4IF4 A;  1YS7 A;  4WXH A;  1KU7 A;  2P8T A;  3TO9 A;  4AWX B;  1V4R A;  3BJO A;  4ENM A;  3E5U A;  1YG2 A;  4ENJ A;  3M7G A;  4Q48 A;  2IT0 A;  3ROU A;  4LD5 A;  5L3C A;  3HSE A;  1Z6R A;  2O3F A;  2JSC A;  2O03 A;  2O61 A;  5D6E A;  3TOA A;  3SZP A;  2CQK A;  3DQV C;  1X3U A;  3ZMS A;  3J80 K;  1OYI A;  5DCF A;  1NHA A;  1QO0 D;  4ZZL A;  1HKT A;  2HZT A;  1W5T A;  2HQR A;  4L9V A;  1MDM A;  3WG9 A;  4XBF A;  1W7P A;  3BPX A;  5LRR A;  2ESH A;  2HTS A;  2DT5 A;  1XSV A;  3KET A;  4M6X A;  5E1X A;  1YTY A;  1HXD A;  5DV5 A;  3NEU A;  2P6T A;  2EJR A;  1E2X A;  2IJL A;  2PQ8 A;  2HDC A;  1FZP B;  1JHH A;  3QU3 A;  2L01 A;  1GXP A;  1MJA A;  2XHK A;  5K1Y A;  4LK0 F;  2NS0 A;  3I71 A;  1YO5 C;  3O3K A;  4JQF A;  3COA C;  1LNW A;  3T5X A;  4FHT A;  2VE8 A;  4ENK A;  1MZB A;  4ZYE A;  1E17 A;  4RAY A;  5E8I A;  2K27 A;  3FXR A;  3K1M A;  2LSO A;  1O3T A;  1UFM A;  2FF4 A;  3J7A O;  2G7H A;  2ISY A;  4WCG A;  1O3S A;  3QAH A;  4Q5S F;  1GVJ A;  4KIF A;  4P9U A;  2FBI A;  5E1Z B;  2J5P A;  3CLO A;  2A61 A;  3MCZ A;  4M6Y A;  2DK8 A;  3WTY C;  5JFR A;  2DPD A;  1IAW A;  3SHF A;  3G3Z A;  2K86 A;  4EV0 A;  4ESB A;  2PFB A;  2QUF A;  2ZJ2 A;  3ABU A;  1ZG1 A;  5BS6 A;  1P2F A;  2QVO A;  1UHM A;  2OQG A;  4HQE A;  4IHT A;  1J0R A;  3JAM Z;  2MA3 A;  4MGR A;  3KCC A;  1J59 A;  1R23 A;  1MKM A;  2AXL A;  4IJA A;  2ZXJ A;  3R0J A;  1TBX A;  3EQL F;  3W6K B;  1D8K A;  2CGP A;  3WTU C;  2CO5 A;  1TQP A;  4CXF A;  2H09 A;  1R5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...