4JBAA

Crystal structure of the oxidized form of marr from e.coli
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
138
structure length
134
Chain Sequence
LFNEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLSSIRSAASITPVELKKVLSVDLGALTRMLDRLVCKGWVERLPNPNVLVKLTTGGAAISEQSHQLVGQDLHQELTKNLTADEVATLEYLLKKVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multiple antibiotic resistance protein MarR
publication title The multiple antibiotic resistance regulator MarR is a copper sensor in Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
total genus 44
structure length 134
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4jbaA00
2VOPA 1TQPA 1FYLA 2HKXA 4O5VA 1U5TB 1MJBA 2TDXA 5L3CA 3HTUA 1FX7A 3RDIA 2IPQX 1XDUA 2QENA 1ODDA 1FBQA 2PBIA 3MWMA 3V7SA 2OZUA 5K5OA 2ESHA 1ZRDA 3F72A 2QVOA 2GAUA 4AVPA 5FLXK 1T39A 5LHHA 3ERED 1JE8A 5HDKA 1D3YA 3ZMUA 2PJPA 5FFXA 3HOTA 4HV5A 2RC4A 4LMYA 3F6VA 2MH2A 1CF7B 2CQKA 4M9XA 4KIBA 3V7CA 1XCVA 4M73A 2XASA 5HDGA 2C6YA 2FSWA 5ILVA 1BBYA 3BP8A 4H0EA 1YG2A 1ONVA 2O03A 3LQQA 4EJWA 5FD5A 3MFKA 4HYEA 4M72A 2CGPA 3HYIA 3H3ZA 2X4HA 3BJAA 3RI4A 2MLKA 2Z3YA 3ABUA 2YR2A 2A61A 1W5TA 4OU0A 1GHCA 1HQCA 1XSDA 1J2XA 1E2XA 4CYDA 2E1NA 1RIOH 2IA1A 3HSRA 3R6SA 1Z6RA 1XGOA 3HRTA 3TKYA 2FBKA 2XGXA 4UV8A 3C3WA 2GXBA 3BPXA 2YX4A 1H0MA 2L3DA 3VB2A 1P4AA 2JPCA 2FRHA 4ENMA 2YU3A 4WCGA 3HIFA 1B4AA 4K2EA 3F22A 1P92A 1EH8A 1MD0A 2DK8A 2YX7A 3ZMTA 2EFOA 2Z9OA 3GFIA 1LDKB 4IVNA 4EVIA 3GO5A 4KUMA 2KIUA 3RKYA 4LG0B 3WODF 1MGTA 4EM1A 1S7AA 1D8JA 5D5UB 4A0YA 1XMKA 2HWVA 4L9JA 4OINF 1PP7U 3QU3A 2VODA 1IF1A 1B1BA 3T5XA 3FHZA 1B59A 4Q47A 2DPUA 2BE5F 1YW7A 2FMLA 1IXRC 2DPDA 2F5EA 2LF7A 3K1NA 4KDPA 4CICA 1DDNA 1OYWA 4R8HA 5LRSA 1DPUA 5CYVA 4HF0A 3E6DA 5F64A 5ICFA 4DQ2A 4FX4A 1IXSB 3D5LA 2GA1A 3GW2A 2L02A 4EGZA 4QLCU 1G4DA 4S05A 1IRFA 5HS8A 2YSRA 3KP2A 2DU9A 3VEPA 3ZN0A 1HKTA 1WKMA 3HSEA 5EEHA 1ZG3A 2JT1A 1WQ2A 2ZBKA 1G3YA 1FPQA 1HW5A 1TBXA 2FQ3A 3CUQB 1FSHA 2G7HA 2M45A 3BROA 1S29A 1ZN2A 1R5GA 2WWYA 2M5WA 5L3DA 2M87A 1ON1A 2D1HA 2RN7A 2NRAC 2KRFA 4ENJA 1OKRA 3BDDA 4XSXF 1H9GA 4YIIA 1U6GA 5HOOA 2QQBA 4R79A 1FC3A 3T1BA 1RNLA 1G3TA 1SD7A 4HF2A 2XAFA 2ZMEB 2P7VB 3WU1B 4YG2F 4LLLA 1MDMA 4JQFA 1DPRA 4G94A 4ZYEA 2M1BA 2XUBA 1KU7A 5DEQA 1DUXC 2M30A 2HEOA 4BAYA 2LNBA 2HTSA 4TV7A 2MA3A 4L0ZB 2DFIA 2HR3A 2EWNA 2RKHA 1IAWA 3GZ6A 2QM3A 4Q5SF 1BC8C 2PMHA 3V4GA 1NHAA 2VBYA 3I0TA 4OIRF 1XGMA 1FYMA 5DCMB 1I6XA 5HLIA 3HHGA 1I1SA 1R00A 3GXOA 2WV0A 3DFGA 4U7DA 2A6EF 3FXUA 2FE3A 4YFKF 2GXGA 1W5SA 4OIQF 3ZN1A 5ED4A 1Q1HA 2QZ8A 3I59B 4AWXB 1HXDA 1J7KA 3GYHX 4Q4ZF 1HSJA 5D5WB 1UFMA 5E1WA 5TJJA 1BIAA 4KMFA 1Z1DA 3SFZA 4FX0A 2W24A 2XKPA 4IRIA 2NAZA 1MJ9A 2GIVA 1VTNC 1FBSA 3QAHA 1AWCA 2BGCA 4XBFA 1BIBA 3MQ0A 3WTYC 1D8KA 2MC3A 2JRTA 4PDKA 2VONA 3ZMSA 5E1ZB 4Y15A 2PI0A 3NRVA 5LRRA 4EJTA 2L54A 2V79A 2A3SA 1YS6A 4BH9A 1OMIA 4F7ZA 4U0YA 2LDUA 3M8FA 4P9UA 2ISZA 5CVVA 2Q8KA 3V8KA 1FNNA 4UUVA 4I98B 3RYRA 4A6EA 1K78B 1Z7UA 3P9IA 4LB5A 3VODA 3SZPA 1W7PB 4MQ9F 3FXQA 2H09A 4OMYA 3LA7A 1XN7A 3WTVC 4DNCA 3C18A 5DYMA 1IN6A 2VC0A 3U1DA 1RZ4A 1YO5C 5CVIA 4S04A 1WI9A 2HFHA 1KGSA 2V9VA 2HKOA 1T98A 3KLNA 3IRQA 3ABTA 5HS9A 1JHFA 4GYIA 4U7BA 4N9IA 4Y13A 3FF5A 2L4MA 2LKPA 2XVCA 5BPIA 4MEYF 2VBXA 1UHMA 2ZJ2A 2P5LC 4AIKA 3ZPLA 4HA8A 5D6EA 3COAC 3M8EA 1E17A 2R7FA 5LGTA 3IWZA 2EFPA 5LEJA 2Q0OA 5E20A 2X0LA 1LJ9A 1O3RA 1UB9A 1TTYA 3R0JA 1BN5A 4BHCA 5HDNA 3K1MA 2MLGA 3PQKA 2BYVE 2JPBA 1ON2A 3NQOA 2UXNA 4EGYA 1ZLKA 4YFNF 4LK0F 2QBYB 2VBZA 1R1UA 1V3FA 5F6FA 3IHUA 3WGGA 1J9IA 3L2CA 3FZVA 4EJVA 3QP6A 3J81K 2W84A 4HX8A 1PP8F 2O61A 1FP2A 4HQEA 1SD6A 2L01A 4A5NA 5LBQA 4I0AA 1P4WA 1B6AA 1Z9CA 3BJOA 2JSCA 2DK5A 3KCCA 5JI6A 3P9CA 3ELKA 5K1YA 1F5TA 2EV6A 5TRDA 4L9NA 5ERIA 2FNPA 4WX9A 2BBYA 1D5VA 2QQ9A 2CFXA 3GZ5A 1Z05A 4L5IA 1R5HA 2FBIA 3B02A 3LAJA 4HBLA 2P4WA 5IT9Z 3EYYA 1ZGAA 4BQAA 3DEUA 3GF2A 1FY7A 2IJLA 4IRGA 4GXOA 2OZ6A 4HDVA 3MZHA 2HYGD 2XAQA 4LLNA 2PLYA 4ESJA 2VN2A 1QBJA 3MCZA 1YYVA 1A04A 4CZZA 2O8XA 3KETA 2Y0MA 1HBXG 1LVAA 4N0BA 3F23A 4KYWA 1L0OC 4CGZA 4P96A 3KZZA 5DD8A 1QNTA 3DXJF 4EM0B 4I2OA 2YPRA 5BS6A 1S7OA 3FM3A 5DUKA 1IN7A 1IN5A 1O3SA 5E8GA 3QU6A 2EA4A 3I54A 3LWFA 4ASNA 2JTVA 1G3SA 3F8MA 2K7LA 1USSA 2HDCA 1EH6A 5DCFA 1FWZA 2QUFA 4IPAA 1R23A 4JBAA 3JAMZ 4I01A 3L7WA 1KYWA 2DAOA 3WTUC 4ESBA 3C7JA 4BNCA 1XGSA 3WU0A 4AIJA 4LLGF 5H6RA 3IWFA 3G73A 2CYYA 1MKMA 5LHIA 4RGXA 1K6OA 3T8RA 4OOIA 1USTA 2DBBA 4GYGA 3IKTA 1QQIA 4RB3C 1I5ZA 3DF8A 1O57A 1J0RA 4UVCA 5LLQA 3ML6A 3BWGA 4G7ZF 1TQMA 4L0YB 1SFXA 1YQAA 1J5YA 4FHTA 1JXSA 3GVAA 2VXZA 3ZMDA 4HLXA 2V1UA 1U5TC 3K69A 4P55A 2R7DA 5CVRA 4KNYA 4XLPF 5LGUA 3I64A 5CLSA 3TOBA 4E70A 1TQIA 4Z2YA 2DQLA 1R22A 1QPMA 4RAYA 5HLHA 1UCRA 2XAGA 2CG4A 5L3FA 4M6YA 2DLLA 3QPTA 3F21A 3TOAA 4U0WA 4WXHA 4JK1X 3MAJA 4CXFA 4FT8A 3E5QA 3O2PE 3ISPA 5A2QZ 3SXYA 3IL2A 2PMUA 2RDPA 1ZAOA 3RKWA 3HSFA 2IVMA 4OMZA 5L3EA 3F8NA 3JAMK 2PG4A 1JGSA 2KJCA 2W85A 5EEGA 4M9ZA 3QPHA 1L3LA 3M7GA 4EV0A 4IRHA 2H27A 1HW1A 1ZG1A 3WG9A 4KMUX 4A0ZA 2HGCA 3ECOA 1KYZA 4EJOA 3RTRA 4KN4X 3R61A 1XSXA 2P6TA 1FT9A 3KP3A 2WC2A 1WSUA 2K02A 1G3WA 2P6SA 1OR7A 4RGUA 1ZLJA 1ZYRF 3BPVA 4NB5A 3EYIA 5CVJA 2OD5A 3WGHA 2MBFA 2D45A 1O3TA 2HOEA 3W6JB 5FD6A 5KK1A 4UVAA 2A6HF 1HW2A 5D4RA 3VOEA 4WXDA 3RIRA 4I7HA 5CVUA 4MTDA 4LJZF 4U88A 3WE2A 1SAXA 4HW0A 1MDMB 4L5JA 4IHSA 2L4AA 1HKSA 1W7PD 2STWA 1DP7P 3B73A 3TO9A 3G3ZA 2P5KA 1RUNA 5AIQA 4B09A 3KFWX 1ZARA 3V8JA 2KIMA 3EDPA 3JSPA 4ESFA 4P5OA 2ZO4A 3ROUA 3U2RA 2H94A 5CJ9A 3V7RA 4LB6B 3DP7A 5DD4A 5HS7A 4PGHA 2GWRA 4LD5A 1S8NA 1LNWA 2E1CA 3FWEA 5E1XA 1WRJA 3HOSA 3HRUA 2VE8A 3FM5A 1O7LA 1KU2A 1BJAA 3GLXA 2AXLA 2BV6A 2NNNA 4A6DA 4ZYHA 3I53A 2P7CB 2IA2A 3LSTA 2Y48A 5FGMA 2IA0A 4ENNA 3F6OA 1F9NA 4KA4A 1YTYA 2NS0A 1SD4A 3ZMVA 1BOAA 2FA5A 2KJBA 2DW4A 2Z99A 1REPC 2DQRA 2UWMA 2HTJA 2VT2A 4A2UA 3L9FA 3RKXA 3PFIA 4EMSA 1ZH5A 2EV5A 3DPLC 5L3BA 3GWZA 2RV8A 3DKWA 1FSEA 5DDGA 1U78A 2QYOA 4KN7X 3CDHA 1KA8A 3RPUA 4BYYA 1TNSA 3KEQA 5D8LB 1FOKA 1SFUA 4MTEA 1XDSA 5D5XB 4UHTA 3RJPA 3ECHA 2XAHA 4WF2A 2ISYA 1ZG5A 1HSTA 2EB7A 4GO1A 1OYIA 5DV5A 3SHFA 1R1TA 5JFRA 2WTEA 4G8XA 5AIPA 5K5RA 2Z33A 2JZYA 5JVTA 5JR3A 3KP5A 4HZFA 1U5TA 2K86A 4G9YA 5KVRA 1LB2A 3PQJA 3JTHA 1AOYA 3RPQA 2F5CA 3E6MA 3JSOA 1O7FA 2F5DA 1U3EM 5ILSA 3BOQA 2CW0F 3S2WA 2O3FA 3WTZA 3GX4X 4LGWA 1S3JA 3FXRA 3T0YA 2VT3A 2IRFG 1QO0D 3HUGA 1LDDA 2UXXA 4HV6A 4HQMA 2EFNA 2QWWA 1TW2A 1QZYA 1S6LA 1YFHA 1CF7A 1YIOA 3HRSA 1ZGJA 1XD7A 3E97A 4BHPA 3F8BA 4AIHA 4UVBA 2ELHA 3GUDA 3O3KA 2EA2A 1XSVA 5D6FA 3F8CA 4UXNA 4NQWA 1R36A 1W4MA 3L00A 4IHTA 4I09A 4RB0A 2XROA 4BXUA 5J8FA 3H92A 3AAFA 2OA4A 5BPDA 1B9MA 2Z5UA 4CHUA 2FMYA 4RS8A 1BI3A 5ICEA 4M74A 2CWEA 3V8LA 1QGPA 5E18F 4M6XA 5IT3A 1SFEA 2ZCWA 5LHGA 5E17F 2ESNA 1XGNA 5H20A 2O0YA 1TLHB 3GFLA 5DUIA 4EQQA 3TGNA 2A5YB 3IKVA 2ACJA 1I27A 3FMQA 1RUOA 3U9GA 6PAXA 2LSOA 2R3SA 3EQLF 4PGGA 3JTGA 4WK8F 5J8CA 4PZJA 3LQRA 4KT5C 1V4RA 4XSZF 1FBUA 3I58A 1XMAA 2F2EA 4MNUA 1BC7C 2MH9A 2RQPA 3J7AO 4L18B 4HLYA 4I0BA 4PCQA 2COMA 4M71A 4B8XA 3KLOA 3HHHA 4N9HA 2QQAA 1T0FA 4KICA 4ZH4F 4IF4A 1SD5A 3E5UA 3ZMZA 3MZYA 1ZRFA 4ENKA 4Q48A 1MZBA 4G7OF 3CTAA 3NEUA 1EH7A 4LG0A 1Z91A 3SQNA 5ICGA 1FP1D 5BMZA 1KQ8A 1WWXA 2K27A 2ZNZA 3F8FA 3KEOA 1P2FA 1ZHFA 3DPTA 1CGPA 5BOXA 1O3QA 4XLNF 1J59A 2XRNA 3TO7A 2EJRA 4HX7A 3M1EA 2V1XA 1JHHA 3WGIA 3IRRA 5ILUA 2EK5A 4OIPF 1ZRCA 4AD9A 3GEZA 2G7UA 4P9FA 5IT9K 2GQQA 3E6CC 3P9KA 3T8TA 3WTWC 4QWQA 4UV9A 1RI7A 2V1DA 4Y17A 2DO7A 4G7HF 1BI2A 2NNYA 1K79A 4L9TA 1R58A 3K0LA 3TDZC 1T6SA 2W57A 3I4PA 3ULQB 4HF1A 1TW3A 2OQRA 1BI0A 4A5MA 5BQTA 3OOPA 3E3VA 4RGRA 2KKOA 3N97A 5J6XA 4YFXF 1KU3A 3CUQA 3WTSC 4ON0A 2VC1A 3R60A 2AS5F 4ETSA 4HOBA 2PN6A 3QP5A 3HTSB 3F3XA 1XCBA 4WWCA 3I5UA 1R1VA 1PDNC 2PQ8A 2D2WA 4UNOA 3EUHA 1LEBA 2H6BA 5L3GA 3DQVC 1ULYA 1IN4A 1ZREA 5E8IA 2BEOA 2OU2A 4CDGA 3BY6A 1GXPA 3RYPA 3TDUC 2FU4A 4R1HA 1IW7F 3KP4A 3TO6A 3LAPA 3WTXC 5K5QA 1EV7A 2ZMEA 2K4BA 2DI3A 3BJ6A 4CO8A 3ZP5A 3QOPA 3GFJA 2M8EA 5FFZA 3Q9SA 1PUEE 2V6CA 3LFKA 4RGSA 3BZ6A 1P6RA 3REOA 4LFUA 4EM2A 3KE2A 1R7JA 5D5VB 3H3UA 2ZFWA 3D0SA 2VBWA 1K7AA 4ZZLA 3JW4A 5LEKA 1UHWA 4EJUA 5DCMA 3DV8A 5FO5A 1F4KA 3J80Z 4RAZA 3FX3A 1LEAA 5HVQC 1GVJA 3CO7C 4MEXF 2ADUA 2DT5A 2VE9A 5LGNA 3CJNA 2HS5A 3Q5FA 5JHUA 2G9WA 3I59A 3I71A 5ICCA 3CO6C 2K4JA 1X3UA 4IXAA 3R4KA 4KIFA 1B9NA 3EETA 5D4SA 2RVCA 3TQNA 2XIGA 2ZXJA 2QLZA 2PEXA 4BHBA 2HZTA 2UZKA 4IJAA 3Q9VA 2XHKA 4A0XA 3KP7A 5H6QA 3KP6A 2OBPA 1U2WA 1G6NA 1YLFA 2CO5A 3K1PA 3O6BB 5A2QK 1IZ1A 1Z6TA 2DTRA 4I02A 1KU9A 1YW8A 4MGRA 4RB2C 3FMRA 2IW5A 2NYXA 2ETHA 1GXQA 4GCVA 3SZTA 4NHJA 2A68F 1H9TA 2FNAA 1K78A 5F1RA 1STZA 1F1ZA 4ZYGA 2Q2EA 2W25A 1W7PA 3P7NA 3CLOA 4YIFA 1C0WA 3M9AA 3ZQ7A 2ZKZA 2D1VA 4G6DA 4HX4A 2FXAA 2RGVA 4G6QA 2FOKA 2GZWA 3J80K 1QZZA 4KFCA 1OPCA 3R0AA 3K9TA 2VOOA 2KIFA 1YS7A 2FEZA 2FF4A 4ZYDA 2FBHA 3VFZA 2F5FA 2Y75A 2P8TA 2HQRA 1T2KA 2E7WA 3L09A 1TNTA 3E5XA 2MD5A 4GGGA 2H6CA 3N4MA 1SMTA 1FZPB 2ZNYA 3W6KB 2LF8A 2P5VA 2OQGA 4OIOF 1HKQA 3K2ZA 1Y0UA 1SMYF 1KQ9A 3CUQC 1MJAA 4ZZDA 2O6GE 2EFWA 2CSOA 2GA2A 1IUYA 3WE3A 4WXCA 5FLXZ 4HAMA 2A69F 3J81Z 4KIGA 1LQ1A 2RNJA 3OV8A 2XKOA 2HYFA 3GFMA 1T38A 2PFBA 4O6JA 4RB1A 1FYKA 1OYYA 2J5PA 3FMSA 2J5OA 4MQVA 4MHGA 2OAZA 4A12A 4HDUA 4LK1F 3LA3A 1IXCA 1I1GA 4D0PA 2XAJA 2QBYA 1YW9A 2B0LA 5HLGA 4O3MA 2A07F 4U0VA 1U8RA 2HQNA 1IRGA 2IP2A 3E6BA 2STTA 1BI1A 3HRMA 5AONA 3QRFF 3KZYA 3CUOA 3MEXA 1P4XA 1LDJA 4M9SA 5D8KB 1IN8A 1BM9A 3C1DA 1KQ0A 2IT0A 1XB4A 5FB2A 1FLIA 3IC7A 4L9VA 4XRFA 2EV0A 2E7XA 3LA2A 1J75A 3WTTC 2EFQA 2XV4S
chains in the Genus database with same CATH superfamily
3BR1A 2M7AA 1FEXA 3I4MJ 2WB1A 4RM3A 1ETWA 3S16J 4RDUA 2VOPA 1TQPA 1FYLA 2HKXA 4O5VA 2N8GA 4XN3A 1U5TB 4RLFA 1MJBA 2TDXA 4HNVA 3HTUA 5L3CA 1AKHB 1FX7A 3RDIA 2IPQX 4DW6A 3W3CA 3AG2H 1XDUA 1SC7A 2QENA 1ODDA 1FBQA 4CSWA 1DGRM 1LVKA 2PBIA 3QYEA 3MWMA 3G1LA 2OZUA 3V7SA 2ESHA 5K5OA 1YX5A 1ZRDA 3F72A 2QVOA 4ZTJA 2GAUA 2PMZA 2V7FA 4AVPA 1P7JA 3FIWA 4YELA 3S1RJ 5FLXK 1T39A 3V42A 1E3OC 2L7ZA 1WI3A 5LHHA 5F0HA 2QGUA 2WV1A 3ERED 3KYDB 4UUTA 4XKBA 1JE8A 4W97A 5HDKA 1NK3P 1R4MB 1D3YA 3BR0A 5E79C 2XB5A 3ZMUA 2PJPA 5FFXA 3HOTA 2M34A 3HUGB 4HV5A 2RC4A 2OTJI 4LMYA 1RKWA 4UY8I 3F6VA 2MH2A 2HU9A 4DJAA 3GCMA 1CF7B 2Y30A 2FOWA 3CCQI 2KFDA 1E3PA 2CQKA 1ETKA 4M9XA 2VIXA 2CQQA 4KIBA 3V7CA 1XCVA 4M73A 1R6RA 2XASA 5HDGA 2C6YA 4XOTA 2FSWA 4ZDPA 1DU6A 2L0KA 4HRIA 5ILVA 4NQWB 1BBYA 1UG0A 1LFBA 3BP8A 4H0EA 4A3CJ 1YG2A 3S3NA 2M3AA 1ONVA 3DTIA 2O03A 3VSKA 3LQQA 3S93A 4DZPA 4EJWA 2LREA 2ELKA 1ZQ3P 5FD5A 3PIPF 3MFKA 4HYEA 4M72A 2CGPA 3HYIA 1TL8A 3U1KA 1M1EB 3H3ZA 3W6VA 5CKTA 2X4HA 1RC9A 4XKVA 5TISC 1MMNA 3BJAA 2JN6A 2O8KA 3G4SI 3RI4A 2MLKA 2JJ7A 2Z3YA 3KPHA 3ABUA 5GPCA 3S8PA 4FTHA 1Y39A 1IDZA 2YR2A 1XTAA 2AXTC 2IS6A 2A61A 1W5TA 4OU0A 1GHCA 1HQCA 1XSDA 3ABLH 1LFUP 1J2XA 1E2XA 5EYRA 3CMMA 4W1UA 4V2GA 1YJNI 4PSWA 3K10A 5GTIC 4CYDA 2DJNA 2E1NA 3VYSB 1RIOH 4HSRA 2IA1A 3KZIC 1WH5A 3HSRA 4HNUA 3R6SA 1Z6RA 3DPUA 3A2KA 1XGOA 3HRTA 3TKYA 3CC2I 2FBKA 2XGXA 3LSKA 2XB0X 3OIQA 4UV8A 4E7HA 3C3WA 2GXBA 2E1MC 3BPXA 3ZGKA 4D7NA 2YX4A 4BBRJ 3H9JA 4ZYAA 1H0MA 2L3DA 2K9NA 2L7FP 3VB2A 4XMYA 1X1AA 1P4AA 2JPCA 1W0UA 2FRHA 4ENMA 3UKGA 1A36A 2YU3A 4HNTA 4DBRA 1EKEA 1OCCH 3RCOA 2BHZA 1HDPA 4KT6A 1O4XA 1I39A 4WCGA 3OYJA 3HIFA 4BJ5C 2GOXB 1B4AA 3FISA 4K2EA 2R7SA 4C2MJ 3S2HJ 3F22A 1P92A 1R4NB 2I5UA 1IRZA 1EH8A 3GTQJ 1MD0A 1Q1VA 2DK8A 2R0QC 3BG3A 3LMMA 1F43A 2YX7A 3ZMTA 2EFOA 2L7MP 3BG6A 3JRBA 2Z9OA 3GFIA 1LDKB 4IVNA 2CV0A 3AG3H 3PM1A 1Z3YA 4EVIA 3GO5A 5J1YA 2ECCA 4KUMA 2KIUA 3RKYA 5IP7J 4LG0B 3WODF 1MGTA 4EM1A 1S7AA 2LVSA 2R93J 3HEFA 2VJ5A 3BG9A 2KLOA 1D8JA 5D5UB 1H88C 1XMKA 2B7EA 1J09A 2L9SA 2HWVA 4A0YA 4L9JA 4OINF 3S1NJ 1PP7U 3QU3A 2VODA 2H8RA 1JT6A 1IF1A 5M5XJ 1B1BA 3T5XA 3FHZA 1B59A 2XGCA 4Q47A 3E7LA 1WFXA 2DPUA 2LFBA 3JRCA 1WGXA 2NVUB 2BE5F 4XKCA 1YW7A 2FMLA 1ETVA 1IXRC 1D0YA 2F4OB 4A3IJ 3L1PA 2DPDA 1TWGJ 1OISA 2F5EA 2LF7A 3OL3A 3K1NA 2DA5A 2V9PA 5IP6A 4KDPA 4E7JA 4CICA 1DDNA 1OYWA 4R8HA 2WAQN 2ZFUA 2ZJPF 5LRSA 1DPUA 5CYVA 4HF0A 3E6DA 5F64A 1OLTA 5ICFA 4DQ2A 2UV1A 2TCTA 3WHCA 4FX4A 1IXSB 1MIJA 2R7QA 3D5LA 4L5EA 2GA1A 3H9QA 4F55A 1JJ8C 2AQEA 2NS8A 2VB6A 3GW2A 2NOGA 2E60A 3NARA 2L02A 3FXJA 3G1MA 4EGZA 4QLCU 4NC7A 1G4DA 4S05A 5IYDJ 2WADA 1IRFA 2AO9A 2YSRA 5HS8A 3ERMA 1SAUA 3KP2A 2DU9A 3VEPA 2HXIA 3ZN0A 1HKTA 1WKMA 3HSEA 1RR7A 5EEHA 3C2HA 3Q0VA 3HOVJ 1ZG3A 2JT1A 1U9OA 1WQ2A 2ZBKA 1G3YA 1FPQA 1HW5A 4F3QA 5EZGA 4UUSA 1TBXA 1NH3A 2FQ3A 4CCKA 2VJIA 1MMAA 3CUQB 1ETXA 1FSHA 2O5RA 1JTXA 5K7HA 3I4NJ 2G7HA 2M45A 4IX7A 3BROA 1S29A 1ZN2A 2M0MA 1BW5A 4IO9F 5FKLA 1R5GA 2WWYA 2M5WA 5L3DA 2M87A 1ON1A 2D1HA 4QIWN 2RN7A 2ZC2A 2NRAC 2L5QA 1WJEA 1T56A 2KRFA 4ENJA 2DA2A 4BE2A 1OKRA 3BDDA 2R92J 4XSXF 1H9GA 4YIIA 4PSXA 1U6GA 4II2A 2X9DA 5HOOA 2QQBA 1H8AC 3L2VA 4R79A 1FC3A 3T1BA 1RNLA 1QA6A 2E35A 1G3TA 5GADJ 1SD7A 2DDAA 4LIVA 3CMAI 4X0GA 2LTPA 4HF2A 2ZMEB 2XAFA 2P7VB 5M3FJ 3WU1B 4YG2F 4LLLA 4J01A 1MDMA 3ZR8X 1DP3A 2EH3A 4P1WA 4JQFA 1DPRA 1X2NA 4G94A 5EGOA 3JRAA 4ZYEA 2M1BA 2XUBA 1KU7A 1B8IA 5DEQA 1DUXC 3MKLA 1FTZA 1HCRA 1GVDA 2JVHA 3DEWA 5FRNA 2M30A 2HEOA 2NVXJ 1MNEA 5JHFA 4BAYA 4M3FA 2K3PA 2LNBA 2HTSA 4TV7A 3K4MA 3A01B 2W82A 5LD2C 2MA3A 4F91B 4L0ZB 2KHMA 2DFIA 1X1PA 2HR3A 2EWNA 2RKHA 3JRDA 1DGWY 2X6YA 4A3DJ 1IAWA 3GZ6A 2QM3A 4Q5SF 1BC8C 2PMHA 3V4GA 1NHAA 5EG0A 3CCMI 3CCLI 2IS1A 2VBYA 3I0TA 1MBFA 4OIRF 1XGMA 3QODA 4A3LJ 2A05A 1FYMA 5DCMB 3DTEA 1I6XA 3HBLA 5HLIA 3HHGA 1I1SA 2HNHA 1R00A 3GXOA 1MMDA 2WV0A 3CDIA 3DFGA 5HNHA 4U7DA 1ZTRA 2HVQA 2A6EF 3FXUA 3TBIA 2L2OA 2FE3A 4YFKF 2ZJQF 2GXGA 1W5SA 2E2IJ 4OIQF 1TC3C 3ZN1A 1RR8C 2JA8J 5ED4A 1SFOJ 1Q1HA 2QZ8A 2JVGA 3I59B 4AWXB 4BGDA 1HXDA 4A3KJ 1J7KA 3GYHX 1FTTA 2DA7A 5FKOA 4Q4ZF 2EPFA 2HI3A 2IEKA 1HSJA 1H89C 5D5WB 1UFMA 1RPWA 3HGGA 5E1WA 1FOXA 5TJJA 1BIAA 4KMFA 2X6WA 4V19K 1Z1DA 1BJZA 2H1KA 5FKMA 3SFZA 4A69C 2R5ZA 1YJ9I 3MVPA 4FX0A 2Z1DA 2W24A 2XKPA 1K4TA 1YRNB 1XG1A 3OYEA 4CCNA 4IRIA 2NAZA 1D1AA 1MJ9A 2GIVA 1VTNC 1FBSA 3QAHA 1AWCA 2BGCA 4XBFA 1BIBA 3MQ0A 3WTYC 2YU9J 3CC7I 1D8KA 3LSMA 2MC3A 3CQZJ 1VQKI 2JRTA 4PDKA 2VONA 3ZMSA 5E1ZB 3SYTA 1T08B 3PNYA 3IH4A 4Y15A 2PI0A 3NRVA 1IGNA 5LRRA 4EJTA 4C2TA 3S1MJ 2L54A 2V79A 1NG6A 3BR3A 2A3SA 2LKXA 1YS6A 1A35A 4BH9A 1WJDA 2BY0A 2DFEA 3ASOH 1OMIA 5J47A 1N25A 3OS1A 2YS9A 4F7ZA 4U0YA 2DYRH 1LKXA 2LDUA 3M8FA 4P9UA 2ISZA 2CUFA 3CMYA 5CVVA 2Q8KA 3RPUD 4G6TB 3V8KA 1FNNA 3ZCOA 4UUVA 3SEQA 2JRMA 4I98B 3RYRA 2R7OA 3A0HC 4A6EA 1X58A 2K5CA 1WJ5A 1K78B 1Z7UA 2CUJA 1APLC 3D1NI 2ZXWH 2M7BA 3P9IA 4IHVA 1T8IA 3GMEA 2Q2EB 2QSGX 4NUBA 5CPRB 4LB5A 1VQ6I 3CCSI 2L9RA 3E0JB 3VODA 3SZPA 1W7PB 3VYTB 4MQ9F 3FXQA 2H09A 4OMYA 3BG7A 3DKXA 1GV2A 1XPXA 3LA7A 1XN7A 3WTVC 2O9LA 4DNCA 3C18A 3H1CA 1MSEC 2VQGA 5DYMA 3G71I 1IN6A 2Z16A 2LR8A 1FJLA 2DT7B 2VC0A 3U1DA 1RZ4A 2DFHA 5CVIA 2HDWA 4BKXA 1YO5C 4S04A 2CQXA 3BR5A 1WI9A 1BA5A 2HFHA 2H8WA 1KGSA 2LBFB 1QHHD 4XLAA 2V9VA 4XRSG 4DIQA 5H2FC 2HKOA 2LY9A 2KZGA 4B3AA 1T98A 4OWRB 2E1MB 2W48A 4BY7J 3KLNA 3IRQA 1X2MA 3ABTA 5HS9A 3MKWB 1JHFA 4GYIA 3IAS2 4U7BA 4A3GJ 4N9IA 4Y13A 1X3ZB 5E3LA 3FF5A 4BBSJ 1TWAJ 4ITVA 1G8XA 2L4MA 1OQYA 1WCMJ 5HODA 2LKPA 2CJJA 2XVCA 5BPIA 4MEYF 1X1DA 2Y9ZA 2VBXA 2X85A 1YHQI 1UHMA 2NS7A 2VXDA 3VDXA 2ZJ2A 2P5LC 4AIKA 3OYDA 3ZPLA 1WPKA 4M3DA 4HA8A 5CQGA 2M0CA 5D6EA 5BNGA 3COAC 4PJLA 3S1QJ 5DTDA 3M8EA 2QKLB 3DLAA 3HM5A 3MKYB 1E17A 2R7FA 3TEDA 5LGTA 3IWZA 2VUMJ 2LOOA 2EFPA 2R7RA 2K85A 4XLEA 5LEJA 2XC7A 1BR1A 2Q0OA 5E20A 3H35A 2X0LA 3TL4X 3HG9A 5LFAA 3EUKL 4MFDA 1LJ9A 1O3RA 1UB9A 5KAFC 1TTYA 3H5AA 3R0JA 1BN5A 3BTJA 3FK7A 4B43A 4YEJA 4BHCA 2VJ4A 1W36D 2OJED 5HDNA 4D5FA 3K1MA 2OC6A 3PIOF 4BACA 2MLGA 1V55H 3PQKA 1V5FA 1OFCX 1D1CA 3ABMH 1VQPI 2XDVA 2B9SA 2AQFA 3B6AA 2LRDA 4E7KA 2IS4A 2BYVE 2JPBA 5JLXA 1ON2A 1VQ7I 2DMNA 1WHUA 3NQOA 2UXNA 4EGYA 1IRXA 1ZELA 1ZLKA 2H1LA 1Y56A 4LK0F 4YFNF 2QBYB 2VBZA 4UB6C 1R1UA 2CV2A 2BHYA 1V3FA 5F6FA 3VPRA 3IHUA 3AL0C 4DOZA 4CCMA 2OPTA 3WGGA 4IHWA 5J4YA 3C2GA 1J9IA 3L2CA 4BE1A 4XLHA 3FZVA 4EJVA 3K4KA 4RLQA 3QP6A 3J81K 2DDBA 2LC2A 2W84A 3LFUA 4HX8A 4PFPA 1PP8F 4EEFG 2O61A 1FP2A 2O7OA 4HQEA 1SD6A 2EINH 2L01A 4A5NA 5LBQA 4I0AA 1P4WA 4XL9A 1B6AA 1TWFJ 1SVLA 2Y9YA 1Z9CA 3FXLA 3BJOA 1N77A 2JSCA 2XGDA 5GAGJ 1N75A 2DK5A 4JX4A 3KCCA 3H36A 2EZKA 5JI6A 1Y8RB 3P9CA 3H0GJ 3ELKA 5K1YA 2KIQA 2XF5A 3PNVA 1F5TA 2R7TA 3IH3A 2EV6A 2X1DA 1MBKA 1WJAA 5TRDA 4L9NA 5ERIA 2FNPA 5GPAA 4WX9A 2BBYA 5EZHA 1VQ5I 1D5VA 2QQ9A 2K9QA 2ZSHB 3HGYA 4HPQA 2CFXA 3GZ5A 1Z05A 4E7ZA 4L5IA 1R5HA 2FBIA 3B02A 4BDZA 4U87A 3W2AA 3BTCA 1D0XA 1X19A 1TT0A 4XQFA 3GTPJ 3LAJA 3SDBA 4HBLA 2P4WA 5IT9Z 3EYYA 1ZGAA 4BQAA 2WAQA 3DEUA 3GF2A 1HA8A 1SVMA 1SEUA 1FY7A 5IY5H 4IL6C 2V26A 2WAEA 2IJLA 5C4XJ 2X51A 3ONQA 4IRGA 4GXOA 2OZ6A 4LG3A 1IV6A 4HDVA 3MZHA 2HYGD 1OCZH 3MZ8A 1WZ2A 3GTMJ 2KRCA 4XLFA 3TW7A 1MH3A 2XAQA 4ZTFA 4LLNA 2WBMA 2PLYA 4ESJA 1I3AA 2VN2A 3QPLA 4KISA 1QBJA 2Y69H 3MCZA 1YYVA 1KONA 1A04A 2E19A 4CZZA 4J19A 2O8XA 2CFOA 3KETA 2Y0MA 1MW7A 1OCTC 2A5WA 3ZXSA 2BY1A 1UAAA 3VWBA 1HBXG 2QSHX 1LVAA 4N0BA 3F23A 2FQ4A 4KYWA 2I10A 1L0OC 3CJTB 4CGZA 4P96A 1ETYA 1PVEA 1WVRA 3H5NA 2E34A 3SDGA 1TZLA 3KZZA 4D5CA 5DD8A 1QNTA 3DXJF 3F0CA 4B47A 4EM0B 4I2OA 2YPRA 3NWTA 1YX3A 2IGKA 5TGTA 3KEYA 5BS6A 1Z7LA 1S7OA 3FM3A 5DUKA 3M4OJ 4HSTA 1IN7A 1IN5A 1O3SA 5E8GA 3QU6A 2EA4A 3I54A 3LWFA 2JUGA 4ASNA 2QA4I 2JTVA 1G3SA 2GBYA 3F8MA 2F4IA 2K7LA 2E2JJ 2E1OA 4FASD 3K70D 1USSA 1G59A 3NWSA 4CZCA 3K4NA 4I76A 5J1UA 2HDCA 1S72I 1EH6A 3C2BA 5C3EJ 5DCFA 1G2HA 2CUEA 1FWZA 2QUFA 3DTKA 1ERDA 2XRLA 4FQGA 1JT0A 2QF7A 4IPAA 4S0HB 2M8GX 3CD6I 4M3BA 1UG2A 1EA3A 1R23A 4JBAA 3JAMZ 3AG4H 4I01A 1UELB 3L7WA 1Z67A 4OAYA 3S17J 1KYWA 2DAOA 4DYQA 2KDOA 3WTUC 4ESBA 3Q3SA 1XC5A 2ZXHA 3C7JA 4BNCA 1XGSA 3WU0A 4AIJA 2X48A 4LLGF 5H6RA 3D5RC 3IWFA 2CYYA 1MKMA 3G73A 1PYVA 3IV5A 5LHIA 4RGXA 1K6OA 1AHDP 1ZGWA 1LPQA 2OF7A 1YOVB 3T8RA 4OOIA 1VI0A 3H0DA 4IHYA 1USTA 2BVMA 2DBBA 4GYGA 5DS9A 4MFEA 3BCBA 2LKSA 1QQIA 3IKTA 4RB3C 1I5ZA 5IOYA 3DF8A 1O57A 1VQ8I 1ETOA 1W1WE 1J0RA 4BY1J 4UVCA 5LLQA 3ML6A 3BWGA 1Z0XA 2V9KA 4G7ZF 1TQMA 4L0YB 4FISA 5GTHC 3SJMA 1A6QA 1SFXA 4BU2A 2RQQA 1YQAA 3SFIA 1J5YA 4FHTA 3HOWJ 2M4GA 1JXSA 1U9NA 3GVAA 2VXZA 3ZMDA 4HLXA 5IYCJ 2V1UA 3LOCA 1U5TC 3K69A 4P55A 2R7DA 4ZC3A 5CVRA 2EIMH 2ELJA 4M6VA 5LGUA 4XLPF 4KNYA 3PO3J 3I64A 5CLSA 3TOBA 4E70A 5E3NA 1IUFA 3ESWB 1SVOA 1TQIA 2DQLA 4Z2YA 1R22A 2XPWA 1QPMA 4RAYA 3ABKH 3JCUC 5HLHA 1UCRA 5J1RA 2XAGA 2CG4A 5L3FA 4M6YA 2DLLA 2JA2A 4RA2A 2R5YA 3QPTA 3CP2A 4A3EJ 2KDZA 5EJCA 1FMWA 4LITA 4J00A 2BY3A 1YI2I 3F21A 2CS3A 3TOAA 4LOCA 4U0WA 1D0ZA 1P9QC 4WXHA 3TMOA 4AYBA 4JK1X 1K4SA 3BZCA 2B63J 1V5GA 3I3LA 3MAJA 4CXFA 2BVLA 4FT8A 4M3EA 3E5QA 2M4KA 3O2PE 3ISPA 4BXFA 2PMUA 2RDPA 1ZAOA 1MH4A 3RKWA 3SXYA 3HSFA 5A2QZ 3IL2A 1A6IA 1MNDA 2IVMA 4OMZA 5L3EA 1GLNA 3CCVI 3F8NA 2GM4A 2OUMA 4GRIA 2HQAA 2CV1A 1W36C 3JAMK 2PG4A 3O8GA 1MMSA 1JGSA 2KJCA 2W85A 5EEGA 5IP9J 4ZDLA 2OCEA 4M9ZA 1VQLI 2NVTJ 2IS2A 3QPHA 3HDDA 1L3LA 3VYRB 3M7GA 5KAIC 4JX5A 2LY1A 2HZDA 4EV0A 4IRHA 2V4JC 2H27A 5FROA 4XRMA 2XAUA 1HW1A 1XMXA 1ZG1A 3CCJI 3WG9A 4KMUX 4A0ZA 3N05A 2HGCA 4II3A 2HVSA 3ECOA 1KYZA 4EJOA 5J40A 3RTRA 4HEA2 2COBA 4KN4X 4BEHA 3R61A 1XSXA 2P6TA 1FT9A 3KP3A 2WC2A 4UUSB 2MGQA 1AA7A 2KT0A 2BY2A 3MD2A 1WSUA 2K02A 2BOLA 1FOYA 4JYKA 1VQOI 4CCJA 3ZRGA 3HC7A 5E3MA 1G3WA 3MMYB 3W2WA 2EZIA 1MBEA 2P6SA 4AIDA 1ZR2A 2EILH 4B1RA 1OR7A 3BQYA 4RGUA 4AU7A 3I56I 4C3HJ 4H4KC 1ZLJA 1ZYRF 2MD0A 1MBHA 5GAHJ 3BPVA 4NB5A 5IOZA 2P0WA 3EYIA 5CVJA 2OD5A 3WGHA 2MBFA 5EEAA 2D45A 1O3TA 3ZQFA 3LL7A 5JVGF 3CF2A 3JRHA 2ZJRF 2HOEA 3W6JB 4CYCA 3OSFA 5FD6A 2DA3A 2BXYA 5KK1A 4UVAA 3BQZA 2A6HF 2KRHA 3GTOJ 1HW2A 4QPQA 1JKPC 5HLTA 5D4RA 3VOEA 4IQ4A 4WXDA 3RIRA 3OYCA 2MG4A 4I7HA 1QZEA 5CVUA 1HF0A 4NC8A 4MTDA 2MC4A 2CU7A 4LJZF 4U88A 3WE2A 2XSJC 4RAFA 1SAXA 2EZLA 4XN0A 4NDLA 4HW0A 2FD5A 2XPUA 1MDMB 4L5JA 3OSGA 4IHSA 4JOMA 3AL0B 1RRJA 2L4AA 3AKZA 5EGOB 4BQOA 1QVTA 1HKSA 1W7PD 4IKFA 1B8IB 2FUG2 2STWA 1DP7P 4XK4A 3M8JA 3EUAA 3B73A 4NNJA 3TO9A 3G3ZA 2P5KA 1RUNA 5AIQA 4B09A 2ID3A 3KFWX 1ZARA 3S32A 1B72A 3ZQQA 3V8JA 2DODA 2DYSH 2KIMA 3EDPA 4BQNA 4ESFA 1D1BA 3JSPA 3K7AJ 4P5OA 2ZO4A 3ROUA 2HOSA 3U2RA 4AYBN 2H94A 3BR2A 1OCOH 5CJ9A 3V7RA 4B4CA 2NVQJ 4IZZA 4B48A 5EG0B 2RAEA 4LB6B 3DP7A 5K7FA 2ICWG 5DD4A 1NG7A 3PSFA 4PGHA 5HS7A 2GWRA 4XICA 1CQTA 4XRSA 1D5YA 4LD5A 2RREA 1S8NA 1LNWA 5F1JA 2MSYA 3G1OA 2E1CA 3FWEA 5E1XA 3QYBA 1BOBA 1WRJA 3HOSA 3HRUA 1QU3A 2VE8A 3FM5A 3ZOBA 3LSPA 1O7LA 1KU2A 1BJAA 3GLXA 1YITI 2XF6A 3MN2A 2KL4A 3UR3C 4LIUA 1FIAA 4G12A 2AXLA 2DN0A 3LSJA 2BV6A 1UMQA 2NNNA 4A6DA 5B1BH 4A3FJ 3K6GA 4ZYHA 3I53A 4RBOA 2VASA 2P7CB 3DLLF 2I8DA 2KPMA 1R71A 4JP0A 2IA2A 3LSTA 2Y48A 4XNFA 5FGMA 2WY7Q 2LK2A 2IA0A 4ENNA 4RM2A 2CW8A 3K70C 2WA0A 3F6OA 2R5ZB 1F9NA 4ANJA 4KA4A 1YTYA 3DBHB 2NS0A 4X1EA 5FKKA 1SD4A 3ZMVA 1BOAA 1BR2A 2FA5A 4AVZA 2KJBA 5B5EC 2DW4A 2Z99A 2FJ1A 1REPC 2DQRA 2UWMA 2HTJA 2E71A 2CW7A 2Q1ZB 4BUPA 3OR1C 3OYKA 4Y7NJ 1ITYA 2VT2A 1ORKA 4A2UA 3L9FA 3K4CA 2DJIA 3RKXA 3PFIA 4EMSA 1ZH5A 2BW3A 3M3YJ 2EV5A 1LE8A 3O8HA 2WAFA 3DPLC 3HKZA 3LNQA 5L3BA 3K4BA 3GWZA 2RV8A 3DKWA 4AM3A 3HXLA 1FSEA 5DDGA 1U78A 5IPAA 1OCRH 2QYOA 5M5WJ 1ZR4A 4KN7X 3CDHA 2Y0SN 2PJRA 1KA8A 3LSGA 3HZJA 3RPUA 4BYYA 4QPOA 3RKQA 1TNSA 5FLMJ 2X1CA 3CDLA 3KEQA 5D8LB 1FOKA 1JTYA 1R9TJ 1SFUA 1HDDC 2KISA 3DCFA 3FXKA 1NK2P 4MTEA 1XDSA 5D5XB 3H9GA 4UHTA 3W2VA 4CCLA 1GT0C 3RJPA 1MBJA 4C2UA 1IV8A 3ECHA 2XAHA 4WF2A 3ZQLA 2ISYA 3J7AY 1T33A 5EF6A 3G6EI 1ZG5A 5B3SH 1HSTA 1PUFA 2EB7A 4GO1A 1OYIA 3GTLJ 3S2DJ 3OYHA 5DV5A 3DWLE 5F08A 4OAZA 3SHFA 2DOEA 4AC0A 3G2BA 1R1TA 3ASNH 5JFRA 4XORA 1A5JA 2WTEA 2P81A 1I3QJ 3RZOJ 1VQNI 4G8XA 5AIPA 5K5RA 1S7EA 3OMYA 2Z33A 2JZYA 5JVTA 3GZNB 4D1QA 5JR3A 3KP5A 3QOEA 2K40A 4HZFA 1UZCA 1RKTA 3CP8A 4CH7A 1EJ9A 3FXMA 1U5TA 2BW3B 2L9NA 2K9MA 4PJJA 3UNGC 2K86A 3M07A 1AKHA 1TWHJ 4G9YA 5KVRA 1LB2A 3BZKA 1VF9A 3AFHA 3WHBA 5JLWA 3FKJA 3PQJA 3JTHA 2M2EA 1AOYA 3MKZA 3RPQA 2CQNA 2F5CA 3E6MA 3JSOA 1O7FA 2F5DA 2IAIA 4MO7A 2EIKH 2NVYJ 1U3EM 1BR4A 3KIOA 3OS0A 3PUBA 2DOFA 5ILSA 1S5LC 3BOQA 2CW0F 3S2WA 2O3FA 2ME0A 2OV7A 3WTZA 4PJNA 1ACIA 1X4OA 5FKNA 3OOUA 2JUCA 2KMUA 4PFOA 4XR6A 3GX4X 4LGWA 2GXAA 1S3JA 3SEZA 4ZJZA 3FXRA 2DT6A 4IEJA 3T0YA 2VT3A 2IRFG 1QO0D 3EPZA 3HUGA 1LDDA 5M3MJ 2R4GA 4KJZA 2UXXA 5KNLA 4HV6A 4HQMA 2EFNA 3LSRA 2QWWA 4PK4A 1TW2A 1QZYA 1QHGA 2F6CA 1S6LA 1YFHA 4C9YA 2LG4A 3CESA 1CF7A 2HPMA 1YIOA 3HRSA 1OR7C 1ZGJA 1XD7A 3E97A 3IUOA 4BHPA 3F8BA 1JGGA 2E36A 3L2WA 4AIHA 3S3OA 2DMUA 4UVBA 2ELHA 2IGNA 3Q0WA 3FK6A 3X2QH 3HB9A 3GUDA 4F93B 3O3KA 2EA2A 1XSVA 5D6FA 2QQ8A 3F8CA 4UXNA 4NQWA 3K4LA 2R7UA 1TT5B 1IDYA 1R36A 1W4MA 1Y0NA 3L00A 4IHTA 4I09A 1R49A 1GUUA 2W4SA 1Z21A 4RB0A 4UB8C 4PUSA 2XROA 4BXUA 5J8FA 3H92A 3AAFA 2OA4A 5BPDA 1B9MA 2Z5UA 3FXOA 1JKRC 2GOMA 4CHUA 4MIMA 3HKZN 1DQUA 3QQAA 2V6EA 2FMYA 4RS8A 1BI3A 3A1YA 5ICEA 2CMPA 4M74A 3QYFA 1IG7A 2CWEA 3V8LA 1QGPA 1S9HA 5E18F 4M6XA 5IT3A 4IHXA 1SFEA 2ZCWA 5LHGA 5E17F 2ESNA 4NC6A 3HPGA 1XGNA 5F0CA 5H20A 3RQ4A 3QWLA 2O0YA 4FETA 3AG1H 1TLHB 3GFLA 5DUIA 2W00A 4EQQA 1TWCJ 1I50J 3TGNA 2R7XA 2GIZA 1Y8QB 2A5YB 3IKVA 4QTRA 2ACJA 1I27A 4YIRX 5M5YJ 3FMQA 1RUOA 3J7ZI 2DA4A 3U9GA 1ETQA 6PAXA 1X1CA 3P5JA 2LSOA 2R3SA 2OCCH 3EQLF 3KX2A 3J7YJ 4PGGA 4AUXA 2LMDA 3JTGA 4WK8F 2DMTA 2RNGA 4DYCA 5J8CA 1IO2A 1VQMI 4PZJA 1VFCA 2LP0A 3HOYJ 3GTKJ 3LQRA 4KT5C 3TP0A 1VNDA 4KITB 3TW6A 5F04A 2XF7A 1V4RA 4XSZF 2MYSA 3PJRA 4I99C 1MNMC 1FBUA 3HPHA 3I58A 1XMAA 3IH2A 5K7ZA 3S15J 2F2EA 1LUJB 3CJQB 3OYIA 1MSFC 4MNUA 1MBGA 1BC7C 2VQLA 2MH9A 2RQPA 3LSIA 1DU0A 1TP4A 3J7AO 2MW8A 4L18B 4HLYA 3CCYA 2QCOA 4FE4A 4I0BA 4PCQA 2COMA 4M71A 4B8XA 3KLOA 1FOWA 3HHHA 5DM7F 5IYBJ 3KYCB 4N9HA 2QQAA 3RZDJ 4IOCF 2X6XA 4E7SA 1T0FA 4KICA 2UUZA 4ZH4F 4IF4A 1Z3XA 1SD5A 3E5UA 3ZMZA 2JQ7A 3MZYA 1ZRFA 3L2UA 4ENKA 4Q48A 3FBNB 1MZBA 2MFZA 4A3MJ 2X6OA 3CTAA 3NEUA 4G7OF 3JR9A 3ZQIA 2LY2A 1EH7A 1SANA 4LG0A 4DBQA 3DBLB 1Z91A 3SQNA 2YUSA 5ICGA 1FP1D 5BMZA 1KQ8A 1WWXA 4GFBA 2K27A 1ZK8A 3JRFA 2ZNZA 2W7NA 3F8FA 3KEOA 1P2FA 1ZHFA 1I6HJ 2WB1N 2IBDA 1VQ4I 3DPTA 1CGPA 2EZHA 5BOXA 4XONA 1O3QA 1VQ9I 4XLNF 1J59A 2XRNA 3TO7A 4V2FA 2EJRA 3DKYA 2QEXI 4HX7A 3FKIJ 3A4CA 2ME6A 3TP3A 4Y3OA 3M1EA 2A6TA 1RESA 2V1XA 2LH9A 1JHHA 2PMZN 3WGIA 3IRRA 5ILUA 1QVUA 2R7ZJ 2EK5A 4OIPF 1ZRCA 2HDDA 4AD9A 3GEZA 2KZVA 2G7UA 5GAEJ 2TRTA 4P9FA 2ID6A 1X4PA 5IT9K 2GQQA 3E6CC 3P9KA 3T8TA 3WTWC 4QWQA 3BC8A 4UV9A 1RI7A 2V1DA 1POGA 4XOPA 4Y17A 5E3OA 4HG2A 2DO7A 4G7HF 4XM3A 1VZ0A 2V1NA 1AU7A 1BI2A 2NNYA 2L9VA 1K79A 2F5VA 4L9TA 1R58A 2KQRA 3K0LA 4A3JJ 3OYFA 3E1SA 3PNTA 3TDZC 1T6SA 2W57A 3I4PA 3ULQB 2CH0A 4HF1A 1TW3A 1JKQC 2OQRA 2CQ7A 1EF4A 1BI0A 2WY8Q 2CUZA 4A5MA 5BQTA 3OOPA 2GLOA 4DZJA 3E3VA 4RGRA 2KKOA 2IGOA 3GTJJ 3N97A 5J6XA 1Z77A 3QPSA 1P7IA 2HOAA 2VL8A 4YFXF 3CCRI 1KU3A 3BTIA 4BE0A 3CUQA 3WTSC 1Y1WJ 2QKMB 4ON0A 2VC1A 3R60A 2AS5F 2HOTA 4ETSA 4HOBA 2PN6A 3QP5A 4D9JA 4DYRA 1BW6A 1RETA 3F3XA 3HTSB 1XCBA 4WWCA 3I5UA 1R1VA 1PDNC 2PQ8A 2D2WA 3BCAA 4UNOA 2XPVA 3M1CA 3EUHA 1NTCA 1JUPA 1LEBA 1XS9A 2H6BA 2JA6J 5L3GA 3DQVC 1ULYA 2F48A 4XIDA 1IN4A 4Z6YA 1ZREA 1YIJI 3GBGA 2ZXIA 2ZSIB 4XKWA 5E8IA 3K2AA 2BEOA 2OU2A 4CDGA 2VKVA 1YE9A 3BY6A 1GXPA 3RYPA 1GV5A 3DEEA 2HPIA 3TDUC 2FU4A 4R1HA 1IW7F 3HOUJ 1PJRA 3KP4A 3TO6A 3LAPA 3HL2A 3CJRB 3WTXC 5K5QA 1EV7A 2F4MB 2K4BA 2ZMEA 3S14J 1IC8A 2DI3A 3JRGA 4CCOA 1JJ6C 3BJ6A 4CO8A 3ZP5A 2LYCA 3F9KA 1UJ8A 2DOAA 4ZDOA 3QOPA 3GFJA 2HYJA 2M8EA 3FDYA 5FFZA 1HC8A 3HJEA 4N4OB 2ECBA 3Q9SA 3RSNA 1PUEE 3GLLA 1HOMA 3IAM2 2V6CA 3OR2C 4C3JJ 2K3FA 3LFKA 4NBQA 4RGSA 5F27A 3CMEI 3BZ6A 2CRGA 1K83J 4CA0A 3A02A 2K9LA 1P6RA 3REOA 3A01A 4LFUA 1QPIA 2ZB9A 4EM2A 3KE2A 1R7JA 3CLQA 2VKHA 2W1OA 5D5VB 2R5YB 3H3UA 2ZFWA 3D0SA 1T95A 2JWTA 2VBWA 1K7AA 9ANTA 2BZTA 3LSHA 2HVRA 5B1AH 3VYUB 4ZZLA 3JW4A 5LEKA 1UHWA 4EJUA 5DCMA 3CCEI 3DV8A 5FO5A 1IJWC 3ZQGA 1F4KA 3J80Z 4RAZA 3FX3A 4E7IA 3CC4I 1LEAA 4BXXJ 5HVQC 1Y1VJ 1GVJA 3CO7C 4MEXF 1UHSA 3H3VK 2ADUA 2DT5A 2E5NA 2VE9A 5LGNA 3OYBA 5KCMA 3CJNA 2HS5A 2K9SA 4BJTA 3Q5FA 1MMGA 5JHUA 5FJ8J 2G9WA 3I59A 3CF5F 3NAUA 3I71A 5ICCA 3CO6C 2K4JA 1X3UA 4IXAA 3R4KA 4KIFA 3GTGJ 2Y0SA 1B9NA 3EETA 5D4SA 2RVCA 4A3BJ 3TQNA 2XIGA 2ZXJA 2QLZA 3OYMA 5C44J 2PEXA 4BHBA 3H5RA 1E0EA 2DA1A 2EQRA 2HZTA 1W0TA 2UZKA 3BT9A 4IJAA 3Q9VA 4FE7A 2XHKA 3FBIB 4A0XA 3KP7A 5H6QA 2DMPA 3KP6A 3PUFA 2OBPA 3IP4B 3CCUI 1U2WA 1G6NA 3BG5A 1OCPA 1YLFA 1YRNA 2CO5A 3K1PA 3O6BB 4BEHB 1OJLA 4X6AJ 1XX5A 3OYGA 5A2QK 1IZ1A 1Z6TA 3OL4A 3I55I 2DTRA 2FX0A 4I02A 1BL0A 1KU9A 1WH7A 1T0FC 1YW8A 2DCEA 2IGMA 4MGRA 4RB2C 3FMRA 2VQHA 2IW5A 4C30A 2KP6A 4Y33A 2NYXA 3OS2A 2LLKA 2ETHA 1LFPA 3BR6A 1V54H 1GXQA 5B66C 4GCVA 4CYCB 4CUGA 4C3IJ 5DM6F 5C4JJ 3SZTA 3OIOA 3PFYA 4NHJA 4JX6A 1QRYA 1SFKA 2A68F 4E7LA 5GP9A 2VI6A 1H9TA 2FNAA 3HOXJ 1K78A 5FRMA 5F1RA 1N78A 4EATA 2Z2SB 1STZA 1F1ZA 1F36A 2NXNB 4ZYGA 4Y52J 2DXIA 2Q2EA 2W25A 1V5EA 2PX9A 2EBIA 3FHNA 3WG7H 1W7PA 3P7NA 3L2QA 3CLOA 3PL8A 4YIFA 1C0WA 3M9AA 3OYNA 3CZ6A 3ZQ7A 2ZKZA 1WJCA 2D1VA 4G6DA 5HNFA 4HX4A 2MABA 2FXAA 4B3XA 2RGVA 4G6QA 2AHQA 2EIJH 2FOKA 2GZWA 3J80K 4PJMA 1QZZA 2HXOA 4KFCA 3Q0UA 2XSDC 1OPCA 3R0AA 4BL0B 2E2HJ 4IOAF 3K9TA 2L7KA 2VOOA 4YRVA 3L2RA 4FCYA 3DBRB 2KIFA 1YS7A 3A0BC 1B72B 3OWTA 4GDFA 4RMNA 4A93J 2LBFA 2FEZA 2R7VA 2FF4A 4F52A 4ZYDA 3JREA 2FBHA 2LD5A 3VFZA 2F5FA 4M3GA 1ZKGA 2Y75A 2D5VA 2DTZA 2P8TA 3PO2J 2HQRA 2VJJA 1T2KA 2E7WA 3L09A 2G0EA 3DU6A 3BTLA 1TNTA 3E5XA 2HQ5A 2MD5A 4GGGA 1E3HA 2H6CA 3N4MA 4F92B 1SMTA 1FZPB 3WU2C 4E6KG 4IQJA 2XGEA 2M9HA 3I9V2 3VSLA 2ZNYA 3W6KB 4ABZA 3JRIA 2LF8A 2P5VA 1JUMA 4BDYA 2OQGA 4OIOF 1HKQA 3K2ZA 1Y0UA 1SMYF 1KQ9A 5F0FA 1JKOC 4RAGA 3CUQC 1MJAA 4ZZDA 2R7WA 2O6GE 2JK3A 2JMWA 2EFWA 4I6ZA 2CSOA 3S3MA 1U8BA 2E5ZA 2GA2A 1YJWI 1K61A 1X1BA 1IUYA 3WE3A 4WXCA 5FLXZ 2VKDA 3SZGA 4HAMA 2A69F 5J3LA 4DGWB 3J81Z 3EUHC 4KIGA 1LQ1A 2RNJA 4Y4RA 3OV8A 1W5CC 2XKOA 2JSPA 1FMVA 2HYFA 3GFMA 4B44A 1T38A 2PFBA 4O6JA 4RB1A 3OYLA 2Y31A 1OYYA 1FYKA 2J5PA 1JUSA 3FMSA 2J5OA 1ENHA 2OTLI 3OIPA 4MQVA 4MHGA 2OAZA 3RQIA 4A12A 2DA6A 1R5ID 1Y6IA 4HDUA 2JA5J 2NOJB 1U0JA 3DU5A 4LK1F 3LA3A 2Y2ZA 1IXCA 2BXZA 2JA7J 4E4HA 5FLVA 2QSFX 1I1GA 2IXSA 2ZMEC 4D0PA 2XAJA 2QBYA 1A31A 1YW9A 2B0LA 5HLGA 1LE8B 4O3MA 2A07F 4U0VA 2VPLA 1X3WB 3HOZJ 2VPRA 1U8RA 3K4JA 2HQNA 2X1EA 1IRGA 4QSHA 3D5SC 2IP2A 3A03A 2PJRB 3E6BA 4PJ0C 5J4VA 1WJBA 2STTA 5KHDA 4MLOA 1HLVA 1BI1A 2DFFA 2DMQA 1K6YA 3KYLA 3ZQCA 3HRMA 5AONA 4BS9A 2VLAA 3QRFF 4BQQA 3BLYA 3KZYA 1WJFA 2VKEA 5EDNA 3CUOA 3MEXA 3U21A 1P4XA 1LDJA 3OY9A 4M9SA 4N4NB 5D8KB 1KZHA 4BJ6C 1IN8A 1PUFB 1BM9A 1GDTA 3C1DA 4XLCA 3ZQHA 3PSIA 1KQ0A 2IT0A 1XB4A 4D7MA 5FB2A 3B6CA 3OYAA 1FLIA 3IC7A 4L9VA 4XRFA 2VQCA 5CQEA 1FIPA 2EV0A 1JI8A 2E7XA 3LA2A 1J75A 3WTTC 2EFQA 2XV4S
chains in the Genus database with same CATH topology
2VOPA 1TQPA 1FYLA 2HKXA 4O5VA 1U5TB 1MJBA 2TDXA 5L3CA 3HTUA 1FX7A 3RDIA 2IPQX 1XDUA 2QENA 1ODDA 1FBQA 2PBIA 3MWMA 3V7SA 2OZUA 5K5OA 2ESHA 1ZRDA 3F72A 2QVOA 2GAUA 4AVPA 5FLXK 1T39A 5LHHA 3ERED 1JE8A 5HDKA 1D3YA 3ZMUA 2PJPA 5FFXA 3HOTA 4HV5A 2RC4A 4LMYA 3F6VA 2MH2A 1CF7B 2CQKA 4M9XA 4KIBA 3V7CA 1XCVA 4M73A 2XASA 5HDGA 2C6YA 2FSWA 5ILVA 1BBYA 3BP8A 4H0EA 1YG2A 1ONVA 2O03A 3LQQA 4EJWA 5FD5A 3MFKA 4HYEA 4M72A 2CGPA 3HYIA 3H3ZA 2X4HA 3BJAA 3RI4A 2MLKA 2Z3YA 3ABUA 2YR2A 2A61A 1W5TA 4OU0A 1GHCA 1HQCA 1XSDA 1J2XA 1E2XA 4CYDA 2E1NA 1RIOH 2IA1A 3HSRA 3R6SA 1Z6RA 1XGOA 3HRTA 3TKYA 2FBKA 2XGXA 4UV8A 3C3WA 2GXBA 3BPXA 2YX4A 1H0MA 2L3DA 3VB2A 1P4AA 2JPCA 2FRHA 4ENMA 2YU3A 4WCGA 3HIFA 1B4AA 4K2EA 3F22A 1P92A 1EH8A 1MD0A 2DK8A 2YX7A 3ZMTA 2EFOA 2Z9OA 3GFIA 1LDKB 4IVNA 4EVIA 3GO5A 4KUMA 2KIUA 3RKYA 4LG0B 3WODF 1MGTA 4EM1A 1S7AA 1D8JA 5D5UB 4A0YA 1XMKA 2HWVA 4L9JA 4OINF 1PP7U 3QU3A 2VODA 1IF1A 1B1BA 3T5XA 3FHZA 1B59A 4Q47A 2DPUA 2BE5F 1YW7A 2FMLA 1IXRC 2DPDA 2F5EA 2LF7A 3K1NA 4KDPA 4CICA 1DDNA 1OYWA 4R8HA 5LRSA 1DPUA 5CYVA 4HF0A 3E6DA 5F64A 5ICFA 4DQ2A 4FX4A 1IXSB 3D5LA 2GA1A 3GW2A 2L02A 4EGZA 4QLCU 1G4DA 4S05A 1IRFA 5HS8A 2YSRA 3KP2A 2DU9A 3VEPA 3ZN0A 1HKTA 1WKMA 3HSEA 5EEHA 1ZG3A 2JT1A 1WQ2A 2ZBKA 1G3YA 1FPQA 1HW5A 1TBXA 2FQ3A 3CUQB 1FSHA 2G7HA 2M45A 3BROA 1S29A 1ZN2A 1R5GA 2WWYA 2M5WA 5L3DA 2M87A 1ON1A 2D1HA 2RN7A 2NRAC 2KRFA 4ENJA 1OKRA 3BDDA 4XSXF 1H9GA 4YIIA 1U6GA 5HOOA 2QQBA 4R79A 1FC3A 3T1BA 1RNLA 1G3TA 1SD7A 4HF2A 2XAFA 2ZMEB 2P7VB 3WU1B 4YG2F 4LLLA 1MDMA 4JQFA 1DPRA 4G94A 4ZYEA 2M1BA 2XUBA 1KU7A 5DEQA 1DUXC 2M30A 2HEOA 4BAYA 2LNBA 2HTSA 4TV7A 2MA3A 4L0ZB 2DFIA 2HR3A 2EWNA 2RKHA 1IAWA 3GZ6A 2QM3A 4Q5SF 1BC8C 2PMHA 3V4GA 1NHAA 2VBYA 3I0TA 4OIRF 1XGMA 1FYMA 5DCMB 1I6XA 5HLIA 3HHGA 1I1SA 1R00A 3GXOA 2WV0A 3DFGA 4U7DA 2A6EF 3FXUA 2FE3A 4YFKF 2GXGA 1W5SA 4OIQF 3ZN1A 5ED4A 1Q1HA 2QZ8A 3I59B 4AWXB 1HXDA 1J7KA 3GYHX 4Q4ZF 1HSJA 5D5WB 1UFMA 5E1WA 5TJJA 1BIAA 4KMFA 1Z1DA 3SFZA 4FX0A 2W24A 2XKPA 4IRIA 2NAZA 1MJ9A 2GIVA 1VTNC 1FBSA 3QAHA 1AWCA 2BGCA 4XBFA 1BIBA 3MQ0A 3WTYC 1D8KA 2MC3A 2JRTA 4PDKA 2VONA 3ZMSA 5E1ZB 4Y15A 2PI0A 3NRVA 5LRRA 4EJTA 2L54A 2V79A 2A3SA 1YS6A 4BH9A 1OMIA 4F7ZA 4U0YA 2LDUA 3M8FA 4P9UA 2ISZA 5CVVA 2Q8KA 3V8KA 1FNNA 4UUVA 4I98B 3RYRA 4A6EA 1K78B 1Z7UA 3P9IA 4LB5A 3VODA 3SZPA 1W7PB 4MQ9F 3FXQA 2H09A 4OMYA 3LA7A 1XN7A 3WTVC 4DNCA 3C18A 5DYMA 1IN6A 2VC0A 3U1DA 1RZ4A 1YO5C 5CVIA 4S04A 1WI9A 2HFHA 1KGSA 2V9VA 2HKOA 1T98A 3KLNA 3IRQA 3ABTA 5HS9A 1JHFA 4GYIA 4U7BA 4N9IA 4Y13A 3FF5A 2L4MA 2LKPA 2XVCA 5BPIA 4MEYF 2VBXA 1UHMA 2ZJ2A 2P5LC 4AIKA 3ZPLA 4HA8A 5D6EA 3COAC 3M8EA 1E17A 2R7FA 5LGTA 3IWZA 2EFPA 5LEJA 2Q0OA 5E20A 2X0LA 1LJ9A 1O3RA 1UB9A 1TTYA 3R0JA 1BN5A 4BHCA 5HDNA 3K1MA 2MLGA 3PQKA 2BYVE 2JPBA 1ON2A 3NQOA 2UXNA 4EGYA 1ZLKA 4YFNF 4LK0F 2QBYB 2VBZA 1R1UA 1V3FA 5F6FA 3IHUA 3WGGA 1J9IA 3L2CA 3FZVA 4EJVA 3QP6A 3J81K 2W84A 4HX8A 1PP8F 2O61A 1FP2A 4HQEA 1SD6A 2L01A 4A5NA 5LBQA 4I0AA 1P4WA 1B6AA 1Z9CA 3BJOA 2JSCA 2DK5A 3KCCA 5JI6A 3P9CA 3ELKA 5K1YA 1F5TA 2EV6A 5TRDA 4L9NA 5ERIA 2FNPA 4WX9A 2BBYA 1D5VA 2QQ9A 2CFXA 3GZ5A 1Z05A 4L5IA 1R5HA 2FBIA 3B02A 3LAJA 4HBLA 2P4WA 5IT9Z 3EYYA 1ZGAA 4BQAA 3DEUA 3GF2A 1FY7A 2IJLA 4IRGA 4GXOA 2OZ6A 4HDVA 3MZHA 2HYGD 2XAQA 4LLNA 2PLYA 4ESJA 2VN2A 1QBJA 3MCZA 1YYVA 1A04A 4CZZA 2O8XA 3KETA 2Y0MA 1HBXG 1LVAA 4N0BA 3F23A 4KYWA 1L0OC 4CGZA 4P96A 3KZZA 5DD8A 1QNTA 3DXJF 4EM0B 4I2OA 2YPRA 5BS6A 1S7OA 3FM3A 5DUKA 1IN7A 1IN5A 1O3SA 5E8GA 3QU6A 2EA4A 3I54A 3LWFA 4ASNA 2JTVA 1G3SA 3F8MA 2K7LA 1USSA 2HDCA 1EH6A 5DCFA 1FWZA 2QUFA 4IPAA 1R23A 4JBAA 3JAMZ 4I01A 3L7WA 1KYWA 2DAOA 3WTUC 4ESBA 3C7JA 4BNCA 1XGSA 3WU0A 4AIJA 4LLGF 5H6RA 3IWFA 3G73A 2CYYA 1MKMA 5LHIA 4RGXA 1K6OA 3T8RA 4OOIA 1USTA 2DBBA 4GYGA 3IKTA 1QQIA 4RB3C 1I5ZA 3DF8A 1O57A 1J0RA 4UVCA 5LLQA 3ML6A 3BWGA 4G7ZF 1TQMA 4L0YB 1SFXA 1YQAA 1J5YA 4FHTA 1JXSA 3GVAA 2VXZA 3ZMDA 4HLXA 2V1UA 1U5TC 3K69A 4P55A 2R7DA 5CVRA 4KNYA 4XLPF 5LGUA 3I64A 5CLSA 3TOBA 4E70A 1TQIA 4Z2YA 2DQLA 1R22A 1QPMA 4RAYA 5HLHA 1UCRA 2XAGA 2CG4A 5L3FA 4M6YA 2DLLA 3QPTA 3F21A 3TOAA 4U0WA 4WXHA 4JK1X 3MAJA 4CXFA 4FT8A 3E5QA 3O2PE 3ISPA 5A2QZ 3SXYA 3IL2A 2PMUA 2RDPA 1ZAOA 3RKWA 3HSFA 2IVMA 4OMZA 5L3EA 3F8NA 3JAMK 2PG4A 1JGSA 2KJCA 2W85A 5EEGA 4M9ZA 3QPHA 1L3LA 3M7GA 4EV0A 4IRHA 2H27A 1HW1A 1ZG1A 3WG9A 4KMUX 4A0ZA 2HGCA 3ECOA 1KYZA 4EJOA 3RTRA 4KN4X 3R61A 1XSXA 2P6TA 1FT9A 3KP3A 2WC2A 1WSUA 2K02A 1G3WA 2P6SA 1OR7A 4RGUA 1ZLJA 1ZYRF 3BPVA 4NB5A 3EYIA 5CVJA 2OD5A 3WGHA 2MBFA 2D45A 1O3TA 2HOEA 3W6JB 5FD6A 5KK1A 4UVAA 2A6HF 1HW2A 5D4RA 3VOEA 4WXDA 3RIRA 4I7HA 5CVUA 4MTDA 4LJZF 4U88A 3WE2A 1SAXA 4HW0A 1MDMB 4L5JA 4IHSA 2L4AA 1HKSA 1W7PD 2STWA 1DP7P 3B73A 3TO9A 3G3ZA 2P5KA 1RUNA 5AIQA 4B09A 3KFWX 1ZARA 3V8JA 2KIMA 3EDPA 3JSPA 4ESFA 4P5OA 2ZO4A 3ROUA 3U2RA 2H94A 5CJ9A 3V7RA 4LB6B 3DP7A 5DD4A 5HS7A 4PGHA 2GWRA 4LD5A 1S8NA 1LNWA 2E1CA 3FWEA 5E1XA 1WRJA 3HOSA 3HRUA 2VE8A 3FM5A 1O7LA 1KU2A 1BJAA 3GLXA 2AXLA 2BV6A 2NNNA 4A6DA 4ZYHA 3I53A 2P7CB 2IA2A 3LSTA 2Y48A 5FGMA 2IA0A 4ENNA 3F6OA 1F9NA 4KA4A 1YTYA 2NS0A 1SD4A 3ZMVA 1BOAA 2FA5A 2KJBA 2DW4A 2Z99A 1REPC 2DQRA 2UWMA 2HTJA 2VT2A 4A2UA 3L9FA 3RKXA 3PFIA 4EMSA 1ZH5A 2EV5A 3DPLC 5L3BA 3GWZA 2RV8A 3DKWA 1FSEA 5DDGA 1U78A 2QYOA 4KN7X 3CDHA 1KA8A 3RPUA 4BYYA 1TNSA 3KEQA 5D8LB 1FOKA 1SFUA 4MTEA 1XDSA 5D5XB 4UHTA 3RJPA 3ECHA 2XAHA 4WF2A 2ISYA 1ZG5A 1HSTA 2EB7A 4GO1A 1OYIA 5DV5A 3SHFA 1R1TA 5JFRA 2WTEA 4G8XA 5AIPA 5K5RA 2Z33A 2JZYA 5JVTA 5JR3A 3KP5A 4HZFA 1U5TA 2K86A 4G9YA 5KVRA 1LB2A 3PQJA 3JTHA 1AOYA 3RPQA 2F5CA 3E6MA 3JSOA 1O7FA 2F5DA 1U3EM 5ILSA 3BOQA 2CW0F 3S2WA 2O3FA 3WTZA 3GX4X 4LGWA 1S3JA 3FXRA 3T0YA 2VT3A 2IRFG 1QO0D 3HUGA 1LDDA 2UXXA 4HV6A 4HQMA 2EFNA 2QWWA 1TW2A 1QZYA 1S6LA 1YFHA 1CF7A 1YIOA 3HRSA 1ZGJA 1XD7A 3E97A 4BHPA 3F8BA 4AIHA 4UVBA 2ELHA 3GUDA 3O3KA 2EA2A 1XSVA 5D6FA 3F8CA 4UXNA 4NQWA 1R36A 1W4MA 3L00A 4IHTA 4I09A 4RB0A 2XROA 4BXUA 5J8FA 3H92A 3AAFA 2OA4A 5BPDA 1B9MA 2Z5UA 4CHUA 2FMYA 4RS8A 1BI3A 5ICEA 4M74A 2CWEA 3V8LA 1QGPA 5E18F 4M6XA 5IT3A 1SFEA 2ZCWA 5LHGA 5E17F 2ESNA 1XGNA 5H20A 2O0YA 1TLHB 3GFLA 5DUIA 4EQQA 3TGNA 2A5YB 3IKVA 2ACJA 1I27A 3FMQA 1RUOA 3U9GA 6PAXA 2LSOA 2R3SA 3EQLF 4PGGA 3JTGA 4WK8F 5J8CA 4PZJA 3LQRA 4KT5C 1V4RA 4XSZF 1FBUA 3I58A 1XMAA 2F2EA 4MNUA 1BC7C 2MH9A 2RQPA 3J7AO 4L18B 4HLYA 4I0BA 4PCQA 2COMA 4M71A 4B8XA 3KLOA 3HHHA 4N9HA 2QQAA 1T0FA 4KICA 4ZH4F 4IF4A 1SD5A 3E5UA 3ZMZA 3MZYA 1ZRFA 4ENKA 4Q48A 1MZBA 4G7OF 3CTAA 3NEUA 1EH7A 4LG0A 1Z91A 3SQNA 5ICGA 1FP1D 5BMZA 1KQ8A 1WWXA 2K27A 2ZNZA 3F8FA 3KEOA 1P2FA 1ZHFA 3DPTA 1CGPA 5BOXA 1O3QA 4XLNF 1J59A 2XRNA 3TO7A 2EJRA 4HX7A 3M1EA 2V1XA 1JHHA 3WGIA 3IRRA 5ILUA 2EK5A 4OIPF 1ZRCA 4AD9A 3GEZA 2G7UA 4P9FA 5IT9K 2GQQA 3E6CC 3P9KA 3T8TA 3WTWC 4QWQA 4UV9A 1RI7A 2V1DA 4Y17A 2DO7A 4G7HF 1BI2A 2NNYA 1K79A 4L9TA 1R58A 3K0LA 3TDZC 1T6SA 2W57A 3I4PA 3ULQB 4HF1A 1TW3A 2OQRA 1BI0A 4A5MA 5BQTA 3OOPA 3E3VA 4RGRA 2KKOA 3N97A 5J6XA 4YFXF 1KU3A 3CUQA 3WTSC 4ON0A 2VC1A 3R60A 2AS5F 4ETSA 4HOBA 2PN6A 3QP5A 3HTSB 3F3XA 1XCBA 4WWCA 3I5UA 1R1VA 1PDNC 2PQ8A 2D2WA 4UNOA 3EUHA 1LEBA 2H6BA 5L3GA 3DQVC 1ULYA 1IN4A 1ZREA 5E8IA 2BEOA 2OU2A 4CDGA 3BY6A 1GXPA 3RYPA 3TDUC 2FU4A 4R1HA 1IW7F 3KP4A 3TO6A 3LAPA 3WTXC 5K5QA 1EV7A 2ZMEA 2K4BA 2DI3A 3BJ6A 4CO8A 3ZP5A 3QOPA 3GFJA 2M8EA 5FFZA 3Q9SA 1PUEE 2V6CA 3LFKA 4RGSA 3BZ6A 1P6RA 3REOA 4LFUA 4EM2A 3KE2A 1R7JA 5D5VB 3H3UA 2ZFWA 3D0SA 2VBWA 1K7AA 4ZZLA 3JW4A 5LEKA 1UHWA 4EJUA 5DCMA 3DV8A 5FO5A 1F4KA 3J80Z 4RAZA 3FX3A 1LEAA 5HVQC 1GVJA 3CO7C 4MEXF 2ADUA 2DT5A 2VE9A 5LGNA 3CJNA 2HS5A 3Q5FA 5JHUA 2G9WA 3I59A 3I71A 5ICCA 3CO6C 2K4JA 1X3UA 4IXAA 3R4KA 4KIFA 1B9NA 3EETA 5D4SA 2RVCA 3TQNA 2XIGA 2ZXJA 2QLZA 2PEXA 4BHBA 2HZTA 2UZKA 4IJAA 3Q9VA 2XHKA 4A0XA 3KP7A 5H6QA 3KP6A 2OBPA 1U2WA 1G6NA 1YLFA 2CO5A 3K1PA 3O6BB 5A2QK 1IZ1A 1Z6TA 2DTRA 4I02A 1KU9A 1YW8A 4MGRA 4RB2C 3FMRA 2IW5A 2NYXA 2ETHA 1GXQA 4GCVA 3SZTA 4NHJA 2A68F 1H9TA 2FNAA 1K78A 5F1RA 1STZA 1F1ZA 4ZYGA 2Q2EA 2W25A 1W7PA 3P7NA 3CLOA 4YIFA 1C0WA 3M9AA 3ZQ7A 2ZKZA 2D1VA 4G6DA 4HX4A 2FXAA 2RGVA 4G6QA 2FOKA 2GZWA 3J80K 1QZZA 4KFCA 1OPCA 3R0AA 3K9TA 2VOOA 2KIFA 1YS7A 2FEZA 2FF4A 4ZYDA 2FBHA 3VFZA 2F5FA 2Y75A 2P8TA 2HQRA 1T2KA 2E7WA 3L09A 1TNTA 3E5XA 2MD5A 4GGGA 2H6CA 3N4MA 1SMTA 1FZPB 2ZNYA 3W6KB 2LF8A 2P5VA 2OQGA 4OIOF 1HKQA 3K2ZA 1Y0UA 1SMYF 1KQ9A 3CUQC 1MJAA 4ZZDA 2O6GE 2EFWA 2CSOA 2GA2A 1IUYA 3WE3A 4WXCA 5FLXZ 4HAMA 2A69F 3J81Z 4KIGA 1LQ1A 2RNJA 3OV8A 2XKOA 2HYFA 3GFMA 1T38A 2PFBA 4O6JA 4RB1A 1FYKA 1OYYA 2J5PA 3FMSA 2J5OA 4MQVA 4MHGA 2OAZA 4A12A 4HDUA 4LK1F 3LA3A 1IXCA 1I1GA 4D0PA 2XAJA 2QBYA 1YW9A 2B0LA 5HLGA 4O3MA 2A07F 4U0VA 1U8RA 2HQNA 1IRGA 2IP2A 3E6BA 2STTA 1BI1A 3HRMA 5AONA 3QRFF 3KZYA 3CUOA 3MEXA 1P4XA 1LDJA 4M9SA 5D8KB 1IN8A 1BM9A 3C1DA 1KQ0A 2IT0A 1XB4A 5FB2A 1FLIA 3IC7A 4L9VA 4XRFA 2EV0A 2E7XA 3LA2A 1J75A 3WTTC 2EFQA 2XV4S
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VOP A;  1TQP A;  1FYL A;  2HKX A;  4O5V A;  1U5T B;  1MJB A;  2TDX A;  5L3C A;  3HTU A;  1FX7 A;  3RDI A;  2IPQ X;  1XDU A;  2QEN A;  1ODD A;  1FBQ A;  2PBI A;  3MWM A;  3V7S A;  2OZU A;  5K5O A;  2ESH A;  1ZRD A;  3F72 A;  2QVO A;  2GAU A;  4AVP A;  5FLX K;  1T39 A;  5LHH A;  3ERE D;  1JE8 A;  5HDK A;  1D3Y A;  3ZMU A;  2PJP A;  5FFX A;  3HOT A;  4HV5 A;  2RC4 A;  4LMY A;  3F6V A;  2MH2 A;  1CF7 B;  2CQK A;  4M9X A;  4KIB A;  3V7C A;  1XCV A;  4M73 A;  2XAS A;  5HDG A;  2C6Y A;  2FSW A;  5ILV A;  1BBY A;  3BP8 A;  4H0E A;  1YG2 A;  1ONV A;  2O03 A;  3LQQ A;  4EJW A;  5FD5 A;  3MFK A;  4HYE A;  4M72 A;  2CGP A;  3HYI A;  3H3Z A;  2X4H A;  3BJA A;  3RI4 A;  2MLK A;  2Z3Y A;  3ABU A;  2YR2 A;  2A61 A;  1W5T A;  4OU0 A;  1GHC A;  1HQC A;  1XSD A;  1J2X A;  1E2X A;  4CYD A;  2E1N A;  1RIO H;  2IA1 A;  3HSR A;  3R6S A;  1Z6R A;  1XGO A;  3HRT A;  3TKY A;  2FBK A;  2XGX A;  4UV8 A;  3C3W A;  2GXB A;  3BPX A;  2YX4 A;  1H0M A;  2L3D A;  3VB2 A;  1P4A A;  2JPC A;  2FRH A;  4ENM A;  2YU3 A;  4WCG A;  3HIF A;  1B4A A;  4K2E A;  3F22 A;  1P92 A;  1EH8 A;  1MD0 A;  2DK8 A;  2YX7 A;  3ZMT A;  2EFO A;  2Z9O A;  3GFI A;  1LDK B;  4IVN A;  4EVI A;  3GO5 A;  4KUM A;  2KIU A;  3RKY A;  4LG0 B;  3WOD F;  1MGT A;  4EM1 A;  1S7A A;  1D8J A;  5D5U B;  4A0Y A;  1XMK A;  2HWV A;  4L9J A;  4OIN F;  1PP7 U;  3QU3 A;  2VOD A;  1IF1 A;  1B1B A;  3T5X A;  3FHZ A;  1B59 A;  4Q47 A;  2DPU A;  2BE5 F;  1YW7 A;  2FML A;  1IXR C;  2DPD A;  2F5E A;  2LF7 A;  3K1N A;  4KDP A;  4CIC A;  1DDN A;  1OYW A;  4R8H A;  5LRS A;  1DPU A;  5CYV A;  4HF0 A;  3E6D A;  5F64 A;  5ICF A;  4DQ2 A;  4FX4 A;  1IXS B;  3D5L A;  2GA1 A;  3GW2 A;  2L02 A;  4EGZ A;  4QLC U;  1G4D A;  4S05 A;  1IRF A;  5HS8 A;  2YSR A;  3KP2 A;  2DU9 A;  3VEP A;  3ZN0 A;  1HKT A;  1WKM A;  3HSE A;  5EEH A;  1ZG3 A;  2JT1 A;  1WQ2 A;  2ZBK A;  1G3Y A;  1FPQ A;  1HW5 A;  1TBX A;  2FQ3 A;  3CUQ B;  1FSH A;  2G7H A;  2M45 A;  3BRO A;  1S29 A;  1ZN2 A;  1R5G A;  2WWY A;  2M5W A;  5L3D A;  2M87 A;  1ON1 A;  2D1H A;  2RN7 A;  2NRA C;  2KRF A;  4ENJ A;  1OKR A;  3BDD A;  4XSX F;  1H9G A;  4YII A;  1U6G A;  5HOO A;  2QQB A;  4R79 A;  1FC3 A;  3T1B A;  1RNL A;  1G3T A;  1SD7 A;  4HF2 A;  2XAF A;  2ZME B;  2P7V B;  3WU1 B;  4YG2 F;  4LLL A;  1MDM A;  4JQF A;  1DPR A;  4G94 A;  4ZYE A;  2M1B A;  2XUB A;  1KU7 A;  5DEQ A;  1DUX C;  2M30 A;  2HEO A;  4BAY A;  2LNB A;  2HTS A;  4TV7 A;  2MA3 A;  4L0Z B;  2DFI A;  2HR3 A;  2EWN A;  2RKH A;  1IAW A;  3GZ6 A;  2QM3 A;  4Q5S F;  1BC8 C;  2PMH A;  3V4G A;  1NHA A;  2VBY A;  3I0T A;  4OIR F;  1XGM A;  1FYM A;  5DCM B;  1I6X A;  5HLI A;  3HHG A;  1I1S A;  1R00 A;  3GXO A;  2WV0 A;  3DFG A;  4U7D A;  2A6E F;  3FXU A;  2FE3 A;  4YFK F;  2GXG A;  1W5S A;  4OIQ F;  3ZN1 A;  5ED4 A;  1Q1H A;  2QZ8 A;  3I59 B;  4AWX B;  1HXD A;  1J7K A;  3GYH X;  4Q4Z F;  1HSJ A;  5D5W B;  1UFM A;  5E1W A;  5TJJ A;  1BIA A;  4KMF A;  1Z1D A;  3SFZ A;  4FX0 A;  2W24 A;  2XKP A;  4IRI A;  2NAZ A;  1MJ9 A;  2GIV A;  1VTN C;  1FBS A;  3QAH A;  1AWC A;  2BGC A;  4XBF A;  1BIB A;  3MQ0 A;  3WTY C;  1D8K A;  2MC3 A;  2JRT A;  4PDK A;  2VON A;  3ZMS A;  5E1Z B;  4Y15 A;  2PI0 A;  3NRV A;  5LRR A;  4EJT A;  2L54 A;  2V79 A;  2A3S A;  1YS6 A;  4BH9 A;  1OMI A;  4F7Z A;  4U0Y A;  2LDU A;  3M8F A;  4P9U A;  2ISZ A;  5CVV A;  2Q8K A;  3V8K A;  1FNN A;  4UUV A;  4I98 B;  3RYR A;  4A6E A;  1K78 B;  1Z7U A;  3P9I A;  4LB5 A;  3VOD A;  3SZP A;  1W7P B;  4MQ9 F;  3FXQ A;  2H09 A;  4OMY A;  3LA7 A;  1XN7 A;  3WTV C;  4DNC A;  3C18 A;  5DYM A;  1IN6 A;  2VC0 A;  3U1D A;  1RZ4 A;  1YO5 C;  5CVI A;  4S04 A;  1WI9 A;  2HFH A;  1KGS A;  2V9V A;  2HKO A;  1T98 A;  3KLN A;  3IRQ A;  3ABT A;  5HS9 A;  1JHF A;  4GYI A;  4U7B A;  4N9I A;  4Y13 A;  3FF5 A;  2L4M A;  2LKP A;  2XVC A;  5BPI A;  4MEY F;  2VBX A;  1UHM A;  2ZJ2 A;  2P5L C;  4AIK A;  3ZPL A;  4HA8 A;  5D6E A;  3COA C;  3M8E A;  1E17 A;  2R7F A;  5LGT A;  3IWZ A;  2EFP A;  5LEJ A;  2Q0O A;  5E20 A;  2X0L A;  1LJ9 A;  1O3R A;  1UB9 A;  1TTY A;  3R0J A;  1BN5 A;  4BHC A;  5HDN A;  3K1M A;  2MLG A;  3PQK A;  2BYV E;  2JPB A;  1ON2 A;  3NQO A;  2UXN A;  4EGY A;  1ZLK A;  4YFN F;  4LK0 F;  2QBY B;  2VBZ A;  1R1U A;  1V3F A;  5F6F A;  3IHU A;  3WGG A;  1J9I A;  3L2C A;  3FZV A;  4EJV A;  3QP6 A;  3J81 K;  2W84 A;  4HX8 A;  1PP8 F;  2O61 A;  1FP2 A;  4HQE A;  1SD6 A;  2L01 A;  4A5N A;  5LBQ A;  4I0A A;  1P4W A;  1B6A A;  1Z9C A;  3BJO A;  2JSC A;  2DK5 A;  3KCC A;  5JI6 A;  3P9C A;  3ELK A;  5K1Y A;  1F5T A;  2EV6 A;  5TRD A;  4L9N A;  5ERI A;  2FNP A;  4WX9 A;  2BBY A;  1D5V A;  2QQ9 A;  2CFX A;  3GZ5 A;  1Z05 A;  4L5I A;  1R5H A;  2FBI A;  3B02 A;  3LAJ A;  4HBL A;  2P4W A;  5IT9 Z;  3EYY A;  1ZGA A;  4BQA A;  3DEU A;  3GF2 A;  1FY7 A;  2IJL A;  4IRG A;  4GXO A;  2OZ6 A;  4HDV A;  3MZH A;  2HYG D;  2XAQ A;  4LLN A;  2PLY A;  4ESJ A;  2VN2 A;  1QBJ A;  3MCZ A;  1YYV A;  1A04 A;  4CZZ A;  2O8X A;  3KET A;  2Y0M A;  1HBX G;  1LVA A;  4N0B A;  3F23 A;  4KYW A;  1L0O C;  4CGZ A;  4P96 A;  3KZZ A;  5DD8 A;  1QNT A;  3DXJ F;  4EM0 B;  4I2O A;  2YPR A;  5BS6 A;  1S7O A;  3FM3 A;  5DUK A;  1IN7 A;  1IN5 A;  1O3S A;  5E8G A;  3QU6 A;  2EA4 A;  3I54 A;  3LWF A;  4ASN A;  2JTV A;  1G3S A;  3F8M A;  2K7L A;  1USS A;  2HDC A;  1EH6 A;  5DCF A;  1FWZ A;  2QUF A;  4IPA A;  1R23 A;  4JBA A;  3JAM Z;  4I01 A;  3L7W A;  1KYW A;  2DAO A;  3WTU C;  4ESB A;  3C7J A;  4BNC A;  1XGS A;  3WU0 A;  4AIJ A;  4LLG F;  5H6R A;  3IWF A;  3G73 A;  2CYY A;  1MKM A;  5LHI A;  4RGX A;  1K6O A;  3T8R A;  4OOI A;  1UST A;  2DBB A;  4GYG A;  3IKT A;  1QQI A;  4RB3 C;  1I5Z A;  3DF8 A;  1O57 A;  1J0R A;  4UVC A;  5LLQ A;  3ML6 A;  3BWG A;  4G7Z F;  1TQM A;  4L0Y B;  1SFX A;  1YQA A;  1J5Y A;  4FHT A;  1JXS A;  3GVA A;  2VXZ A;  3ZMD A;  4HLX A;  2V1U A;  1U5T C;  3K69 A;  4P55 A;  2R7D A;  5CVR A;  4KNY A;  4XLP F;  5LGU A;  3I64 A;  5CLS A;  3TOB A;  4E70 A;  1TQI A;  4Z2Y A;  2DQL A;  1R22 A;  1QPM A;  4RAY A;  5HLH A;  1UCR A;  2XAG A;  2CG4 A;  5L3F A;  4M6Y A;  2DLL A;  3QPT A;  3F21 A;  3TOA A;  4U0W A;  4WXH A;  4JK1 X;  3MAJ A;  4CXF A;  4FT8 A;  3E5Q A;  3O2P E;  3ISP A;  5A2Q Z;  3SXY A;  3IL2 A;  2PMU A;  2RDP A;  1ZAO A;  3RKW A;  3HSF A;  2IVM A;  4OMZ A;  5L3E A;  3F8N A;  3JAM K;  2PG4 A;  1JGS A;  2KJC A;  2W85 A;  5EEG A;  4M9Z A;  3QPH A;  1L3L A;  3M7G A;  4EV0 A;  4IRH A;  2H27 A;  1HW1 A;  1ZG1 A;  3WG9 A;  4KMU X;  4A0Z A;  2HGC A;  3ECO A;  1KYZ A;  4EJO A;  3RTR A;  4KN4 X;  3R61 A;  1XSX A;  2P6T A;  1FT9 A;  3KP3 A;  2WC2 A;  1WSU A;  2K02 A;  1G3W A;  2P6S A;  1OR7 A;  4RGU A;  1ZLJ A;  1ZYR F;  3BPV A;  4NB5 A;  3EYI A;  5CVJ A;  2OD5 A;  3WGH A;  2MBF A;  2D45 A;  1O3T A;  2HOE A;  3W6J B;  5FD6 A;  5KK1 A;  4UVA A;  2A6H F;  1HW2 A;  5D4R A;  3VOE A;  4WXD A;  3RIR A;  4I7H A;  5CVU A;  4MTD A;  4LJZ F;  4U88 A;  3WE2 A;  1SAX A;  4HW0 A;  1MDM B;  4L5J A;  4IHS A;  2L4A A;  1HKS A;  1W7P D;  2STW A;  1DP7 P;  3B73 A;  3TO9 A;  3G3Z A;  2P5K A;  1RUN A;  5AIQ A;  4B09 A;  3KFW X;  1ZAR A;  3V8J A;  2KIM A;  3EDP A;  3JSP A;  4ESF A;  4P5O A;  2ZO4 A;  3ROU A;  3U2R A;  2H94 A;  5CJ9 A;  3V7R A;  4LB6 B;  3DP7 A;  5DD4 A;  5HS7 A;  4PGH A;  2GWR A;  4LD5 A;  1S8N A;  1LNW A;  2E1C A;  3FWE A;  5E1X A;  1WRJ A;  3HOS A;  3HRU A;  2VE8 A;  3FM5 A;  1O7L A;  1KU2 A;  1BJA A;  3GLX A;  2AXL A;  2BV6 A;  2NNN A;  4A6D A;  4ZYH A;  3I53 A;  2P7C B;  2IA2 A;  3LST A;  2Y48 A;  5FGM A;  2IA0 A;  4ENN A;  3F6O A;  1F9N A;  4KA4 A;  1YTY A;  2NS0 A;  1SD4 A;  3ZMV A;  1BOA A;  2FA5 A;  2KJB A;  2DW4 A;  2Z99 A;  1REP C;  2DQR A;  2UWM A;  2HTJ A;  2VT2 A;  4A2U A;  3L9F A;  3RKX A;  3PFI A;  4EMS A;  1ZH5 A;  2EV5 A;  3DPL C;  5L3B A;  3GWZ A;  2RV8 A;  3DKW A;  1FSE A;  5DDG A;  1U78 A;  2QYO A;  4KN7 X;  3CDH A;  1KA8 A;  3RPU A;  4BYY A;  1TNS A;  3KEQ A;  5D8L B;  1FOK A;  1SFU A;  4MTE A;  1XDS A;  5D5X B;  4UHT A;  3RJP A;  3ECH A;  2XAH A;  4WF2 A;  2ISY A;  1ZG5 A;  1HST A;  2EB7 A;  4GO1 A;  1OYI A;  5DV5 A;  3SHF A;  1R1T A;  5JFR A;  2WTE A;  4G8X A;  5AIP A;  5K5R A;  2Z33 A;  2JZY A;  5JVT A;  5JR3 A;  3KP5 A;  4HZF A;  1U5T A;  2K86 A;  4G9Y A;  5KVR A;  1LB2 A;  3PQJ A;  3JTH A;  1AOY A;  3RPQ A;  2F5C A;  3E6M A;  3JSO A;  1O7F A;  2F5D A;  1U3E M;  5ILS A;  3BOQ A;  2CW0 F;  3S2W A;  2O3F A;  3WTZ A;  3GX4 X;  4LGW A;  1S3J A;  3FXR A;  3T0Y A;  2VT3 A;  2IRF G;  1QO0 D;  3HUG A;  1LDD A;  2UXX A;  4HV6 A;  4HQM A;  2EFN A;  2QWW A;  1TW2 A;  1QZY A;  1S6L A;  1YFH A;  1CF7 A;  1YIO A;  3HRS A;  1ZGJ A;  1XD7 A;  3E97 A;  4BHP A;  3F8B A;  4AIH A;  4UVB A;  2ELH A;  3GUD A;  3O3K A;  2EA2 A;  1XSV A;  5D6F A;  3F8C A;  4UXN A;  4NQW A;  1R36 A;  1W4M A;  3L00 A;  4IHT A;  4I09 A;  4RB0 A;  2XRO A;  4BXU A;  5J8F A;  3H92 A;  3AAF A;  2OA4 A;  5BPD A;  1B9M A;  2Z5U A;  4CHU A;  2FMY A;  4RS8 A;  1BI3 A;  5ICE A;  4M74 A;  2CWE A;  3V8L A;  1QGP A;  5E18 F;  4M6X A;  5IT3 A;  1SFE A;  2ZCW A;  5LHG A;  5E17 F;  2ESN A;  1XGN A;  5H20 A;  2O0Y A;  1TLH B;  3GFL A;  5DUI A;  4EQQ A;  3TGN A;  2A5Y B;  3IKV A;  2ACJ A;  1I27 A;  3FMQ A;  1RUO A;  3U9G A;  6PAX A;  2LSO A;  2R3S A;  3EQL F;  4PGG A;  3JTG A;  4WK8 F;  5J8C A;  4PZJ A;  3LQR A;  4KT5 C;  1V4R A;  4XSZ F;  1FBU A;  3I58 A;  1XMA A;  2F2E A;  4MNU A;  1BC7 C;  2MH9 A;  2RQP A;  3J7A O;  4L18 B;  4HLY A;  4I0B A;  4PCQ A;  2COM A;  4M71 A;  4B8X A;  3KLO A;  3HHH A;  4N9H A;  2QQA A;  1T0F A;  4KIC A;  4ZH4 F;  4IF4 A;  1SD5 A;  3E5U A;  3ZMZ A;  3MZY A;  1ZRF A;  4ENK A;  4Q48 A;  1MZB A;  4G7O F;  3CTA A;  3NEU A;  1EH7 A;  4LG0 A;  1Z91 A;  3SQN A;  5ICG A;  1FP1 D;  5BMZ A;  1KQ8 A;  1WWX A;  2K27 A;  2ZNZ A;  3F8F A;  3KEO A;  1P2F A;  1ZHF A;  3DPT A;  1CGP A;  5BOX A;  1O3Q A;  4XLN F;  1J59 A;  2XRN A;  3TO7 A;  2EJR A;  4HX7 A;  3M1E A;  2V1X A;  1JHH A;  3WGI A;  3IRR A;  5ILU A;  2EK5 A;  4OIP F;  1ZRC A;  4AD9 A;  3GEZ A;  2G7U A;  4P9F A;  5IT9 K;  2GQQ A;  3E6C C;  3P9K A;  3T8T A;  3WTW C;  4QWQ A;  4UV9 A;  1RI7 A;  2V1D A;  4Y17 A;  2DO7 A;  4G7H F;  1BI2 A;  2NNY A;  1K79 A;  4L9T A;  1R58 A;  3K0L A;  3TDZ C;  1T6S A;  2W57 A;  3I4P A;  3ULQ B;  4HF1 A;  1TW3 A;  2OQR A;  1BI0 A;  4A5M A;  5BQT A;  3OOP A;  3E3V A;  4RGR A;  2KKO A;  3N97 A;  5J6X A;  4YFX F;  1KU3 A;  3CUQ A;  3WTS C;  4ON0 A;  2VC1 A;  3R60 A;  2AS5 F;  4ETS A;  4HOB A;  2PN6 A;  3QP5 A;  3HTS B;  3F3X A;  1XCB A;  4WWC A;  3I5U A;  1R1V A;  1PDN C;  2PQ8 A;  2D2W A;  4UNO A;  3EUH A;  1LEB A;  2H6B A;  5L3G A;  3DQV C;  1ULY A;  1IN4 A;  1ZRE A;  5E8I A;  2BEO A;  2OU2 A;  4CDG A;  3BY6 A;  1GXP A;  3RYP A;  3TDU C;  2FU4 A;  4R1H A;  1IW7 F;  3KP4 A;  3TO6 A;  3LAP A;  3WTX C;  5K5Q A;  1EV7 A;  2ZME A;  2K4B A;  2DI3 A;  3BJ6 A;  4CO8 A;  3ZP5 A;  3QOP A;  3GFJ A;  2M8E A;  5FFZ A;  3Q9S A;  1PUE E;  2V6C A;  3LFK A;  4RGS A;  3BZ6 A;  1P6R A;  3REO A;  4LFU A;  4EM2 A;  3KE2 A;  1R7J A;  5D5V B;  3H3U A;  2ZFW A;  3D0S A;  2VBW A;  1K7A A;  4ZZL A;  3JW4 A;  5LEK A;  1UHW A;  4EJU A;  5DCM A;  3DV8 A;  5FO5 A;  1F4K A;  3J80 Z;  4RAZ A;  3FX3 A;  1LEA A;  5HVQ C;  1GVJ A;  3CO7 C;  4MEX F;  2ADU A;  2DT5 A;  2VE9 A;  5LGN A;  3CJN A;  2HS5 A;  3Q5F A;  5JHU A;  2G9W A;  3I59 A;  3I71 A;  5ICC A;  3CO6 C;  2K4J A;  1X3U A;  4IXA A;  3R4K A;  4KIF A;  1B9N A;  3EET A;  5D4S A;  2RVC A;  3TQN A;  2XIG A;  2ZXJ A;  2QLZ A;  2PEX A;  4BHB A;  2HZT A;  2UZK A;  4IJA A;  3Q9V A;  2XHK A;  4A0X A;  3KP7 A;  5H6Q A;  3KP6 A;  2OBP A;  1U2W A;  1G6N A;  1YLF A;  2CO5 A;  3K1P A;  3O6B B;  5A2Q K;  1IZ1 A;  1Z6T A;  2DTR A;  4I02 A;  1KU9 A;  1YW8 A;  4MGR A;  4RB2 C;  3FMR A;  2IW5 A;  2NYX A;  2ETH A;  1GXQ A;  4GCV A;  3SZT A;  4NHJ A;  2A68 F;  1H9T A;  2FNA A;  1K78 A;  5F1R A;  1STZ A;  1F1Z A;  4ZYG A;  2Q2E A;  2W25 A;  1W7P A;  3P7N A;  3CLO A;  4YIF A;  1C0W A;  3M9A A;  3ZQ7 A;  2ZKZ A;  2D1V A;  4G6D A;  4HX4 A;  2FXA A;  2RGV A;  4G6Q A;  2FOK A;  2GZW A;  3J80 K;  1QZZ A;  4KFC A;  1OPC A;  3R0A A;  3K9T A;  2VOO A;  2KIF A;  1YS7 A;  2FEZ A;  2FF4 A;  4ZYD A;  2FBH A;  3VFZ A;  2F5F A;  2Y75 A;  2P8T A;  2HQR A;  1T2K A;  2E7W A;  3L09 A;  1TNT A;  3E5X A;  2MD5 A;  4GGG A;  2H6C A;  3N4M A;  1SMT A;  1FZP B;  2ZNY A;  3W6K B;  2LF8 A;  2P5V A;  2OQG A;  4OIO F;  1HKQ A;  3K2Z A;  1Y0U A;  1SMY F;  1KQ9 A;  3CUQ C;  1MJA A;  4ZZD A;  2O6G E;  2EFW A;  2CSO A;  2GA2 A;  1IUY A;  3WE3 A;  4WXC A;  5FLX Z;  4HAM A;  2A69 F;  3J81 Z;  4KIG A;  1LQ1 A;  2RNJ A;  3OV8 A;  2XKO A;  2HYF A;  3GFM A;  1T38 A;  2PFB A;  4O6J A;  4RB1 A;  1FYK A;  1OYY A;  2J5P A;  3FMS A;  2J5O A;  4MQV A;  4MHG A;  2OAZ A;  4A12 A;  4HDU A;  4LK1 F;  3LA3 A;  1IXC A;  1I1G A;  4D0P A;  2XAJ A;  2QBY A;  1YW9 A;  2B0L A;  5HLG A;  4O3M A;  2A07 F;  4U0V A;  1U8R A;  2HQN A;  1IRG A;  2IP2 A;  3E6B A;  2STT A;  1BI1 A;  3HRM A;  5AON A;  3QRF F;  3KZY A;  3CUO A;  3MEX A;  1P4X A;  1LDJ A;  4M9S A;  5D8K B;  1IN8 A;  1BM9 A;  3C1D A;  1KQ0 A;  2IT0 A;  1XB4 A;  5FB2 A;  1FLI A;  3IC7 A;  4L9V A;  4XRF A;  2EV0 A;  2E7X A;  3LA2 A;  1J75 A;  3WTT C;  2EFQ A;  2XV4 S; 
#chains in the Genus database with same CATH topology
 3BR1 A;  2M7A A;  1FEX A;  3I4M J;  2WB1 A;  4RM3 A;  1ETW A;  3S16 J;  4RDU A;  2VOP A;  1TQP A;  1FYL A;  2HKX A;  4O5V A;  2N8G A;  4XN3 A;  1U5T B;  4RLF A;  1MJB A;  2TDX A;  4HNV A;  3HTU A;  5L3C A;  1AKH B;  1FX7 A;  3RDI A;  2IPQ X;  4DW6 A;  3W3C A;  3AG2 H;  1XDU A;  1SC7 A;  2QEN A;  1ODD A;  1FBQ A;  4CSW A;  1DGR M;  1LVK A;  2PBI A;  3QYE A;  3MWM A;  3G1L A;  2OZU A;  3V7S A;  2ESH A;  5K5O A;  1YX5 A;  1ZRD A;  3F72 A;  2QVO A;  4ZTJ A;  2GAU A;  2PMZ A;  2V7F A;  4AVP A;  1P7J A;  3FIW A;  4YEL A;  3S1R J;  5FLX K;  1T39 A;  3V42 A;  1E3O C;  2L7Z A;  1WI3 A;  5LHH A;  5F0H A;  2QGU A;  2WV1 A;  3ERE D;  3KYD B;  4UUT A;  4XKB A;  1JE8 A;  4W97 A;  5HDK A;  1NK3 P;  1R4M B;  1D3Y A;  3BR0 A;  5E79 C;  2XB5 A;  3ZMU A;  2PJP A;  5FFX A;  3HOT A;  2M34 A;  3HUG B;  4HV5 A;  2RC4 A;  2OTJ I;  4LMY A;  1RKW A;  4UY8 I;  3F6V A;  2MH2 A;  2HU9 A;  4DJA A;  3GCM A;  1CF7 B;  2Y30 A;  2FOW A;  3CCQ I;  2KFD A;  1E3P A;  2CQK A;  1ETK A;  4M9X A;  2VIX A;  2CQQ A;  4KIB A;  3V7C A;  1XCV A;  4M73 A;  1R6R A;  2XAS A;  5HDG A;  2C6Y A;  4XOT A;  2FSW A;  4ZDP A;  1DU6 A;  2L0K A;  4HRI A;  5ILV A;  4NQW B;  1BBY A;  1UG0 A;  1LFB A;  3BP8 A;  4H0E A;  4A3C J;  1YG2 A;  3S3N A;  2M3A A;  1ONV A;  3DTI A;  2O03 A;  3VSK A;  3LQQ A;  3S93 A;  4DZP A;  4EJW A;  2LRE A;  2ELK A;  1ZQ3 P;  5FD5 A;  3PIP F;  3MFK A;  4HYE A;  4M72 A;  2CGP A;  3HYI A;  1TL8 A;  3U1K A;  1M1E B;  3H3Z A;  3W6V A;  5CKT A;  2X4H A;  1RC9 A;  4XKV A;  5TIS C;  1MMN A;  3BJA A;  2JN6 A;  2O8K A;  3G4S I;  3RI4 A;  2MLK A;  2JJ7 A;  2Z3Y A;  3KPH A;  3ABU A;  5GPC A;  3S8P A;  4FTH A;  1Y39 A;  1IDZ A;  2YR2 A;  1XTA A;  2AXT C;  2IS6 A;  2A61 A;  1W5T A;  4OU0 A;  1GHC A;  1HQC A;  1XSD A;  3ABL H;  1LFU P;  1J2X A;  1E2X A;  5EYR A;  3CMM A;  4W1U A;  4V2G A;  1YJN I;  4PSW A;  3K10 A;  5GTI C;  4CYD A;  2DJN A;  2E1N A;  3VYS B;  1RIO H;  4HSR A;  2IA1 A;  3KZI C;  1WH5 A;  3HSR A;  4HNU A;  3R6S A;  1Z6R A;  3DPU A;  3A2K A;  1XGO A;  3HRT A;  3TKY A;  3CC2 I;  2FBK A;  2XGX A;  3LSK A;  2XB0 X;  3OIQ A;  4UV8 A;  4E7H A;  3C3W A;  2GXB A;  2E1M C;  3BPX A;  3ZGK A;  4D7N A;  2YX4 A;  4BBR J;  3H9J A;  4ZYA A;  1H0M A;  2L3D A;  2K9N A;  2L7F P;  3VB2 A;  4XMY A;  1X1A A;  1P4A A;  2JPC A;  1W0U A;  2FRH A;  4ENM A;  3UKG A;  1A36 A;  2YU3 A;  4HNT A;  4DBR A;  1EKE A;  1OCC H;  3RCO A;  2BHZ A;  1HDP A;  4KT6 A;  1O4X A;  1I39 A;  4WCG A;  3OYJ A;  3HIF A;  4BJ5 C;  2GOX B;  1B4A A;  3FIS A;  4K2E A;  2R7S A;  4C2M J;  3S2H J;  3F22 A;  1P92 A;  1R4N B;  2I5U A;  1IRZ A;  1EH8 A;  3GTQ J;  1MD0 A;  1Q1V A;  2DK8 A;  2R0Q C;  3BG3 A;  3LMM A;  1F43 A;  2YX7 A;  3ZMT A;  2EFO A;  2L7M P;  3BG6 A;  3JRB A;  2Z9O A;  3GFI A;  1LDK B;  4IVN A;  2CV0 A;  3AG3 H;  3PM1 A;  1Z3Y A;  4EVI A;  3GO5 A;  5J1Y A;  2ECC A;  4KUM A;  2KIU A;  3RKY A;  5IP7 J;  4LG0 B;  3WOD F;  1MGT A;  4EM1 A;  1S7A A;  2LVS A;  2R93 J;  3HEF A;  2VJ5 A;  3BG9 A;  2KLO A;  1D8J A;  5D5U B;  1H88 C;  1XMK A;  2B7E A;  1J09 A;  2L9S A;  2HWV A;  4A0Y A;  4L9J A;  4OIN F;  3S1N J;  1PP7 U;  3QU3 A;  2VOD A;  2H8R A;  1JT6 A;  1IF1 A;  5M5X J;  1B1B A;  3T5X A;  3FHZ A;  1B59 A;  2XGC A;  4Q47 A;  3E7L A;  1WFX A;  2DPU A;  2LFB A;  3JRC A;  1WGX A;  2NVU B;  2BE5 F;  4XKC A;  1YW7 A;  2FML A;  1ETV A;  1IXR C;  1D0Y A;  2F4O B;  4A3I J;  3L1P A;  2DPD A;  1TWG J;  1OIS A;  2F5E A;  2LF7 A;  3OL3 A;  3K1N A;  2DA5 A;  2V9P A;  5IP6 A;  4KDP A;  4E7J A;  4CIC A;  1DDN A;  1OYW A;  4R8H A;  2WAQ N;  2ZFU A;  2ZJP F;  5LRS A;  1DPU A;  5CYV A;  4HF0 A;  3E6D A;  5F64 A;  1OLT A;  5ICF A;  4DQ2 A;  2UV1 A;  2TCT A;  3WHC A;  4FX4 A;  1IXS B;  1MIJ A;  2R7Q A;  3D5L A;  4L5E A;  2GA1 A;  3H9Q A;  4F55 A;  1JJ8 C;  2AQE A;  2NS8 A;  2VB6 A;  3GW2 A;  2NOG A;  2E60 A;  3NAR A;  2L02 A;  3FXJ A;  3G1M A;  4EGZ A;  4QLC U;  4NC7 A;  1G4D A;  4S05 A;  5IYD J;  2WAD A;  1IRF A;  2AO9 A;  2YSR A;  5HS8 A;  3ERM A;  1SAU A;  3KP2 A;  2DU9 A;  3VEP A;  2HXI A;  3ZN0 A;  1HKT A;  1WKM A;  3HSE A;  1RR7 A;  5EEH A;  3C2H A;  3Q0V A;  3HOV J;  1ZG3 A;  2JT1 A;  1U9O A;  1WQ2 A;  2ZBK A;  1G3Y A;  1FPQ A;  1HW5 A;  4F3Q A;  5EZG A;  4UUS A;  1TBX A;  1NH3 A;  2FQ3 A;  4CCK A;  2VJI A;  1MMA A;  3CUQ B;  1ETX A;  1FSH A;  2O5R A;  1JTX A;  5K7H A;  3I4N J;  2G7H A;  2M45 A;  4IX7 A;  3BRO A;  1S29 A;  1ZN2 A;  2M0M A;  1BW5 A;  4IO9 F;  5FKL A;  1R5G A;  2WWY A;  2M5W A;  5L3D A;  2M87 A;  1ON1 A;  2D1H A;  4QIW N;  2RN7 A;  2ZC2 A;  2NRA C;  2L5Q A;  1WJE A;  1T56 A;  2KRF A;  4ENJ A;  2DA2 A;  4BE2 A;  1OKR A;  3BDD A;  2R92 J;  4XSX F;  1H9G A;  4YII A;  4PSX A;  1U6G A;  4II2 A;  2X9D A;  5HOO A;  2QQB A;  1H8A C;  3L2V A;  4R79 A;  1FC3 A;  3T1B A;  1RNL A;  1QA6 A;  2E35 A;  1G3T A;  5GAD J;  1SD7 A;  2DDA A;  4LIV A;  3CMA I;  4X0G A;  2LTP A;  4HF2 A;  2ZME B;  2XAF A;  2P7V B;  5M3F J;  3WU1 B;  4YG2 F;  4LLL A;  4J01 A;  1MDM A;  3ZR8 X;  1DP3 A;  2EH3 A;  4P1W A;  4JQF A;  1DPR A;  1X2N A;  4G94 A;  5EGO A;  3JRA A;  4ZYE A;  2M1B A;  2XUB A;  1KU7 A;  1B8I A;  5DEQ A;  1DUX C;  3MKL A;  1FTZ A;  1HCR A;  1GVD A;  2JVH A;  3DEW A;  5FRN A;  2M30 A;  2HEO A;  2NVX J;  1MNE A;  5JHF A;  4BAY A;  4M3F A;  2K3P A;  2LNB A;  2HTS A;  4TV7 A;  3K4M A;  3A01 B;  2W82 A;  5LD2 C;  2MA3 A;  4F91 B;  4L0Z B;  2KHM A;  2DFI A;  1X1P A;  2HR3 A;  2EWN A;  2RKH A;  3JRD A;  1DGW Y;  2X6Y A;  4A3D J;  1IAW A;  3GZ6 A;  2QM3 A;  4Q5S F;  1BC8 C;  2PMH A;  3V4G A;  1NHA A;  5EG0 A;  3CCM I;  3CCL I;  2IS1 A;  2VBY A;  3I0T A;  1MBF A;  4OIR F;  1XGM A;  3QOD A;  4A3L J;  2A05 A;  1FYM A;  5DCM B;  3DTE A;  1I6X A;  3HBL A;  5HLI A;  3HHG A;  1I1S A;  2HNH A;  1R00 A;  3GXO A;  1MMD A;  2WV0 A;  3CDI A;  3DFG A;  5HNH A;  4U7D A;  1ZTR A;  2HVQ A;  2A6E F;  3FXU A;  3TBI A;  2L2O A;  2FE3 A;  4YFK F;  2ZJQ F;  2GXG A;  1W5S A;  2E2I J;  4OIQ F;  1TC3 C;  3ZN1 A;  1RR8 C;  2JA8 J;  5ED4 A;  1SFO J;  1Q1H A;  2QZ8 A;  2JVG A;  3I59 B;  4AWX B;  4BGD A;  1HXD A;  4A3K J;  1J7K A;  3GYH X;  1FTT A;  2DA7 A;  5FKO A;  4Q4Z F;  2EPF A;  2HI3 A;  2IEK A;  1HSJ A;  1H89 C;  5D5W B;  1UFM A;  1RPW A;  3HGG A;  5E1W A;  1FOX A;  5TJJ A;  1BIA A;  4KMF A;  2X6W A;  4V19 K;  1Z1D A;  1BJZ A;  2H1K A;  5FKM A;  3SFZ A;  4A69 C;  2R5Z A;  1YJ9 I;  3MVP A;  4FX0 A;  2Z1D A;  2W24 A;  2XKP A;  1K4T A;  1YRN B;  1XG1 A;  3OYE A;  4CCN A;  4IRI A;  2NAZ A;  1D1A A;  1MJ9 A;  2GIV A;  1VTN C;  1FBS A;  3QAH A;  1AWC A;  2BGC A;  4XBF A;  1BIB A;  3MQ0 A;  3WTY C;  2YU9 J;  3CC7 I;  1D8K A;  3LSM A;  2MC3 A;  3CQZ J;  1VQK I;  2JRT A;  4PDK A;  2VON A;  3ZMS A;  5E1Z B;  3SYT A;  1T08 B;  3PNY A;  3IH4 A;  4Y15 A;  2PI0 A;  3NRV A;  1IGN A;  5LRR A;  4EJT A;  4C2T A;  3S1M J;  2L54 A;  2V79 A;  1NG6 A;  3BR3 A;  2A3S A;  2LKX A;  1YS6 A;  1A35 A;  4BH9 A;  1WJD A;  2BY0 A;  2DFE A;  3ASO H;  1OMI A;  5J47 A;  1N25 A;  3OS1 A;  2YS9 A;  4F7Z A;  4U0Y A;  2DYR H;  1LKX A;  2LDU A;  3M8F A;  4P9U A;  2ISZ A;  2CUF A;  3CMY A;  5CVV A;  2Q8K A;  3RPU D;  4G6T B;  3V8K A;  1FNN A;  3ZCO A;  4UUV A;  3SEQ A;  2JRM A;  4I98 B;  3RYR A;  2R7O A;  3A0H C;  4A6E A;  1X58 A;  2K5C A;  1WJ5 A;  1K78 B;  1Z7U A;  2CUJ A;  1APL C;  3D1N I;  2ZXW H;  2M7B A;  3P9I A;  4IHV A;  1T8I A;  3GME A;  2Q2E B;  2QSG X;  4NUB A;  5CPR B;  4LB5 A;  1VQ6 I;  3CCS I;  2L9R A;  3E0J B;  3VOD A;  3SZP A;  1W7P B;  3VYT B;  4MQ9 F;  3FXQ A;  2H09 A;  4OMY A;  3BG7 A;  3DKX A;  1GV2 A;  1XPX A;  3LA7 A;  1XN7 A;  3WTV C;  2O9L A;  4DNC A;  3C18 A;  3H1C A;  1MSE C;  2VQG A;  5DYM A;  3G71 I;  1IN6 A;  2Z16 A;  2LR8 A;  1FJL A;  2DT7 B;  2VC0 A;  3U1D A;  1RZ4 A;  2DFH A;  5CVI A;  2HDW A;  4BKX A;  1YO5 C;  4S04 A;  2CQX A;  3BR5 A;  1WI9 A;  1BA5 A;  2HFH A;  2H8W A;  1KGS A;  2LBF B;  1QHH D;  4XLA A;  2V9V A;  4XRS G;  4DIQ A;  5H2F C;  2HKO A;  2LY9 A;  2KZG A;  4B3A A;  1T98 A;  4OWR B;  2E1M B;  2W48 A;  4BY7 J;  3KLN A;  3IRQ A;  1X2M A;  3ABT A;  5HS9 A;  3MKW B;  1JHF A;  4GYI A;  3IAS 2;  4U7B A;  4A3G J;  4N9I A;  4Y13 A;  1X3Z B;  5E3L A;  3FF5 A;  4BBS J;  1TWA J;  4ITV A;  1G8X A;  2L4M A;  1OQY A;  1WCM J;  5HOD A;  2LKP A;  2CJJ A;  2XVC A;  5BPI A;  4MEY F;  1X1D A;  2Y9Z A;  2VBX A;  2X85 A;  1YHQ I;  1UHM A;  2NS7 A;  2VXD A;  3VDX A;  2ZJ2 A;  2P5L C;  4AIK A;  3OYD A;  3ZPL A;  1WPK A;  4M3D A;  4HA8 A;  5CQG A;  2M0C A;  5D6E A;  5BNG A;  3COA C;  4PJL A;  3S1Q J;  5DTD A;  3M8E A;  2QKL B;  3DLA A;  3HM5 A;  3MKY B;  1E17 A;  2R7F A;  3TED A;  5LGT A;  3IWZ A;  2VUM J;  2LOO A;  2EFP A;  2R7R A;  2K85 A;  4XLE A;  5LEJ A;  2XC7 A;  1BR1 A;  2Q0O A;  5E20 A;  3H35 A;  2X0L A;  3TL4 X;  3HG9 A;  5LFA A;  3EUK L;  4MFD A;  1LJ9 A;  1O3R A;  1UB9 A;  5KAF C;  1TTY A;  3H5A A;  3R0J A;  1BN5 A;  3BTJ A;  3FK7 A;  4B43 A;  4YEJ A;  4BHC A;  2VJ4 A;  1W36 D;  2OJE D;  5HDN A;  4D5F A;  3K1M A;  2OC6 A;  3PIO F;  4BAC A;  2MLG A;  1V55 H;  3PQK A;  1V5F A;  1OFC X;  1D1C A;  3ABM H;  1VQP I;  2XDV A;  2B9S A;  2AQF A;  3B6A A;  2LRD A;  4E7K A;  2IS4 A;  2BYV E;  2JPB A;  5JLX A;  1ON2 A;  1VQ7 I;  2DMN A;  1WHU A;  3NQO A;  2UXN A;  4EGY A;  1IRX A;  1ZEL A;  1ZLK A;  2H1L A;  1Y56 A;  4LK0 F;  4YFN F;  2QBY B;  2VBZ A;  4UB6 C;  1R1U A;  2CV2 A;  2BHY A;  1V3F A;  5F6F A;  3VPR A;  3IHU A;  3AL0 C;  4DOZ A;  4CCM A;  2OPT A;  3WGG A;  4IHW A;  5J4Y A;  3C2G A;  1J9I A;  3L2C A;  4BE1 A;  4XLH A;  3FZV A;  4EJV A;  3K4K A;  4RLQ A;  3QP6 A;  3J81 K;  2DDB A;  2LC2 A;  2W84 A;  3LFU A;  4HX8 A;  4PFP A;  1PP8 F;  4EEF G;  2O61 A;  1FP2 A;  2O7O A;  4HQE A;  1SD6 A;  2EIN H;  2L01 A;  4A5N A;  5LBQ A;  4I0A A;  1P4W A;  4XL9 A;  1B6A A;  1TWF J;  1SVL A;  2Y9Y A;  1Z9C A;  3FXL A;  3BJO A;  1N77 A;  2JSC A;  2XGD A;  5GAG J;  1N75 A;  2DK5 A;  4JX4 A;  3KCC A;  3H36 A;  2EZK A;  5JI6 A;  1Y8R B;  3P9C A;  3H0G J;  3ELK A;  5K1Y A;  2KIQ A;  2XF5 A;  3PNV A;  1F5T A;  2R7T A;  3IH3 A;  2EV6 A;  2X1D A;  1MBK A;  1WJA A;  5TRD A;  4L9N A;  5ERI A;  2FNP A;  5GPA A;  4WX9 A;  2BBY A;  5EZH A;  1VQ5 I;  1D5V A;  2QQ9 A;  2K9Q A;  2ZSH B;  3HGY A;  4HPQ A;  2CFX A;  3GZ5 A;  1Z05 A;  4E7Z A;  4L5I A;  1R5H A;  2FBI A;  3B02 A;  4BDZ A;  4U87 A;  3W2A A;  3BTC A;  1D0X A;  1X19 A;  1TT0 A;  4XQF A;  3GTP J;  3LAJ A;  3SDB A;  4HBL A;  2P4W A;  5IT9 Z;  3EYY A;  1ZGA A;  4BQA A;  2WAQ A;  3DEU A;  3GF2 A;  1HA8 A;  1SVM A;  1SEU A;  1FY7 A;  5IY5 H;  4IL6 C;  2V26 A;  2WAE A;  2IJL A;  5C4X J;  2X51 A;  3ONQ A;  4IRG A;  4GXO A;  2OZ6 A;  4LG3 A;  1IV6 A;  4HDV A;  3MZH A;  2HYG D;  1OCZ H;  3MZ8 A;  1WZ2 A;  3GTM J;  2KRC A;  4XLF A;  3TW7 A;  1MH3 A;  2XAQ A;  4ZTF A;  4LLN A;  2WBM A;  2PLY A;  4ESJ A;  1I3A A;  2VN2 A;  3QPL A;  4KIS A;  1QBJ A;  2Y69 H;  3MCZ A;  1YYV A;  1KON A;  1A04 A;  2E19 A;  4CZZ A;  4J19 A;  2O8X A;  2CFO A;  3KET A;  2Y0M A;  1MW7 A;  1OCT C;  2A5W A;  3ZXS A;  2BY1 A;  1UAA A;  3VWB A;  1HBX G;  2QSH X;  1LVA A;  4N0B A;  3F23 A;  2FQ4 A;  4KYW A;  2I10 A;  1L0O C;  3CJT B;  4CGZ A;  4P96 A;  1ETY A;  1PVE A;  1WVR A;  3H5N A;  2E34 A;  3SDG A;  1TZL A;  3KZZ A;  4D5C A;  5DD8 A;  1QNT A;  3DXJ F;  3F0C A;  4B47 A;  4EM0 B;  4I2O A;  2YPR A;  3NWT A;  1YX3 A;  2IGK A;  5TGT A;  3KEY A;  5BS6 A;  1Z7L A;  1S7O A;  3FM3 A;  5DUK A;  3M4O J;  4HST A;  1IN7 A;  1IN5 A;  1O3S A;  5E8G A;  3QU6 A;  2EA4 A;  3I54 A;  3LWF A;  2JUG A;  4ASN A;  2QA4 I;  2JTV A;  1G3S A;  2GBY A;  3F8M A;  2F4I A;  2K7L A;  2E2J J;  2E1O A;  4FAS D;  3K70 D;  1USS A;  1G59 A;  3NWS A;  4CZC A;  3K4N A;  4I76 A;  5J1U A;  2HDC A;  1S72 I;  1EH6 A;  3C2B A;  5C3E J;  5DCF A;  1G2H A;  2CUE A;  1FWZ A;  2QUF A;  3DTK A;  1ERD A;  2XRL A;  4FQG A;  1JT0 A;  2QF7 A;  4IPA A;  4S0H B;  2M8G X;  3CD6 I;  4M3B A;  1UG2 A;  1EA3 A;  1R23 A;  4JBA A;  3JAM Z;  3AG4 H;  4I01 A;  1UEL B;  3L7W A;  1Z67 A;  4OAY A;  3S17 J;  1KYW A;  2DAO A;  4DYQ A;  2KDO A;  3WTU C;  4ESB A;  3Q3S A;  1XC5 A;  2ZXH A;  3C7J A;  4BNC A;  1XGS A;  3WU0 A;  4AIJ A;  2X48 A;  4LLG F;  5H6R A;  3D5R C;  3IWF A;  2CYY A;  1MKM A;  3G73 A;  1PYV A;  3IV5 A;  5LHI A;  4RGX A;  1K6O A;  1AHD P;  1ZGW A;  1LPQ A;  2OF7 A;  1YOV B;  3T8R A;  4OOI A;  1VI0 A;  3H0D A;  4IHY A;  1UST A;  2BVM A;  2DBB A;  4GYG A;  5DS9 A;  4MFE A;  3BCB A;  2LKS A;  1QQI A;  3IKT A;  4RB3 C;  1I5Z A;  5IOY A;  3DF8 A;  1O57 A;  1VQ8 I;  1ETO A;  1W1W E;  1J0R A;  4BY1 J;  4UVC A;  5LLQ A;  3ML6 A;  3BWG A;  1Z0X A;  2V9K A;  4G7Z F;  1TQM A;  4L0Y B;  4FIS A;  5GTH C;  3SJM A;  1A6Q A;  1SFX A;  4BU2 A;  2RQQ A;  1YQA A;  3SFI A;  1J5Y A;  4FHT A;  3HOW J;  2M4G A;  1JXS A;  1U9N A;  3GVA A;  2VXZ A;  3ZMD A;  4HLX A;  5IYC J;  2V1U A;  3LOC A;  1U5T C;  3K69 A;  4P55 A;  2R7D A;  4ZC3 A;  5CVR A;  2EIM H;  2ELJ A;  4M6V A;  5LGU A;  4XLP F;  4KNY A;  3PO3 J;  3I64 A;  5CLS A;  3TOB A;  4E70 A;  5E3N A;  1IUF A;  3ESW B;  1SVO A;  1TQI A;  2DQL A;  4Z2Y A;  1R22 A;  2XPW A;  1QPM A;  4RAY A;  3ABK H;  3JCU C;  5HLH A;  1UCR A;  5J1R A;  2XAG A;  2CG4 A;  5L3F A;  4M6Y A;  2DLL A;  2JA2 A;  4RA2 A;  2R5Y A;  3QPT A;  3CP2 A;  4A3E J;  2KDZ A;  5EJC A;  1FMW A;  4LIT A;  4J00 A;  2BY3 A;  1YI2 I;  3F21 A;  2CS3 A;  3TOA A;  4LOC A;  4U0W A;  1D0Z A;  1P9Q C;  4WXH A;  3TMO A;  4AYB A;  4JK1 X;  1K4S A;  3BZC A;  2B63 J;  1V5G A;  3I3L A;  3MAJ A;  4CXF A;  2BVL A;  4FT8 A;  4M3E A;  3E5Q A;  2M4K A;  3O2P E;  3ISP A;  4BXF A;  2PMU A;  2RDP A;  1ZAO A;  1MH4 A;  3RKW A;  3SXY A;  3HSF A;  5A2Q Z;  3IL2 A;  1A6I A;  1MND A;  2IVM A;  4OMZ A;  5L3E A;  1GLN A;  3CCV I;  3F8N A;  2GM4 A;  2OUM A;  4GRI A;  2HQA A;  2CV1 A;  1W36 C;  3JAM K;  2PG4 A;  3O8G A;  1MMS A;  1JGS A;  2KJC A;  2W85 A;  5EEG A;  5IP9 J;  4ZDL A;  2OCE A;  4M9Z A;  1VQL I;  2NVT J;  2IS2 A;  3QPH A;  3HDD A;  1L3L A;  3VYR B;  3M7G A;  5KAI C;  4JX5 A;  2LY1 A;  2HZD A;  4EV0 A;  4IRH A;  2V4J C;  2H27 A;  5FRO A;  4XRM A;  2XAU A;  1HW1 A;  1XMX A;  1ZG1 A;  3CCJ I;  3WG9 A;  4KMU X;  4A0Z A;  3N05 A;  2HGC A;  4II3 A;  2HVS A;  3ECO A;  1KYZ A;  4EJO A;  5J40 A;  3RTR A;  4HEA 2;  2COB A;  4KN4 X;  4BEH A;  3R61 A;  1XSX A;  2P6T A;  1FT9 A;  3KP3 A;  2WC2 A;  4UUS B;  2MGQ A;  1AA7 A;  2KT0 A;  2BY2 A;  3MD2 A;  1WSU A;  2K02 A;  2BOL A;  1FOY A;  4JYK A;  1VQO I;  4CCJ A;  3ZRG A;  3HC7 A;  5E3M A;  1G3W A;  3MMY B;  3W2W A;  2EZI A;  1MBE A;  2P6S A;  4AID A;  1ZR2 A;  2EIL H;  4B1R A;  1OR7 A;  3BQY A;  4RGU A;  4AU7 A;  3I56 I;  4C3H J;  4H4K C;  1ZLJ A;  1ZYR F;  2MD0 A;  1MBH A;  5GAH J;  3BPV A;  4NB5 A;  5IOZ A;  2P0W A;  3EYI A;  5CVJ A;  2OD5 A;  3WGH A;  2MBF A;  5EEA A;  2D45 A;  1O3T A;  3ZQF A;  3LL7 A;  5JVG F;  3CF2 A;  3JRH A;  2ZJR F;  2HOE A;  3W6J B;  4CYC A;  3OSF A;  5FD6 A;  2DA3 A;  2BXY A;  5KK1 A;  4UVA A;  3BQZ A;  2A6H F;  2KRH A;  3GTO J;  1HW2 A;  4QPQ A;  1JKP C;  5HLT A;  5D4R A;  3VOE A;  4IQ4 A;  4WXD A;  3RIR A;  3OYC A;  2MG4 A;  4I7H A;  1QZE A;  5CVU A;  1HF0 A;  4NC8 A;  4MTD A;  2MC4 A;  2CU7 A;  4LJZ F;  4U88 A;  3WE2 A;  2XSJ C;  4RAF A;  1SAX A;  2EZL A;  4XN0 A;  4NDL A;  4HW0 A;  2FD5 A;  2XPU A;  1MDM B;  4L5J A;  3OSG A;  4IHS A;  4JOM A;  3AL0 B;  1RRJ A;  2L4A A;  3AKZ A;  5EGO B;  4BQO A;  1QVT A;  1HKS A;  1W7P D;  4IKF A;  1B8I B;  2FUG 2;  2STW A;  1DP7 P;  4XK4 A;  3M8J A;  3EUA A;  3B73 A;  4NNJ A;  3TO9 A;  3G3Z A;  2P5K A;  1RUN A;  5AIQ A;  4B09 A;  2ID3 A;  3KFW X;  1ZAR A;  3S32 A;  1B72 A;  3ZQQ A;  3V8J A;  2DOD A;  2DYS H;  2KIM A;  3EDP A;  4BQN A;  4ESF A;  1D1B A;  3JSP A;  3K7A J;  4P5O A;  2ZO4 A;  3ROU A;  2HOS A;  3U2R A;  4AYB N;  2H94 A;  3BR2 A;  1OCO H;  5CJ9 A;  3V7R A;  4B4C A;  2NVQ J;  4IZZ A;  4B48 A;  5EG0 B;  2RAE A;  4LB6 B;  3DP7 A;  5K7F A;  2ICW G;  5DD4 A;  1NG7 A;  3PSF A;  4PGH A;  5HS7 A;  2GWR A;  4XIC A;  1CQT A;  4XRS A;  1D5Y A;  4LD5 A;  2RRE A;  1S8N A;  1LNW A;  5F1J A;  2MSY A;  3G1O A;  2E1C A;  3FWE A;  5E1X A;  3QYB A;  1BOB A;  1WRJ A;  3HOS A;  3HRU A;  1QU3 A;  2VE8 A;  3FM5 A;  3ZOB A;  3LSP A;  1O7L A;  1KU2 A;  1BJA A;  3GLX A;  1YIT I;  2XF6 A;  3MN2 A;  2KL4 A;  3UR3 C;  4LIU A;  1FIA A;  4G12 A;  2AXL A;  2DN0 A;  3LSJ A;  2BV6 A;  1UMQ A;  2NNN A;  4A6D A;  5B1B H;  4A3F J;  3K6G A;  4ZYH A;  3I53 A;  4RBO A;  2VAS A;  2P7C B;  3DLL F;  2I8D A;  2KPM A;  1R71 A;  4JP0 A;  2IA2 A;  3LST A;  2Y48 A;  4XNF A;  5FGM A;  2WY7 Q;  2LK2 A;  2IA0 A;  4ENN A;  4RM2 A;  2CW8 A;  3K70 C;  2WA0 A;  3F6O A;  2R5Z B;  1F9N A;  4ANJ A;  4KA4 A;  1YTY A;  3DBH B;  2NS0 A;  4X1E A;  5FKK A;  1SD4 A;  3ZMV A;  1BOA A;  1BR2 A;  2FA5 A;  4AVZ A;  2KJB A;  5B5E C;  2DW4 A;  2Z99 A;  2FJ1 A;  1REP C;  2DQR A;  2UWM A;  2HTJ A;  2E71 A;  2CW7 A;  2Q1Z B;  4BUP A;  3OR1 C;  3OYK A;  4Y7N J;  1ITY A;  2VT2 A;  1ORK A;  4A2U A;  3L9F A;  3K4C A;  2DJI A;  3RKX A;  3PFI A;  4EMS A;  1ZH5 A;  2BW3 A;  3M3Y J;  2EV5 A;  1LE8 A;  3O8H A;  2WAF A;  3DPL C;  3HKZ A;  3LNQ A;  5L3B A;  3K4B A;  3GWZ A;  2RV8 A;  3DKW A;  4AM3 A;  3HXL A;  1FSE A;  5DDG A;  1U78 A;  5IPA A;  1OCR H;  2QYO A;  5M5W J;  1ZR4 A;  4KN7 X;  3CDH A;  2Y0S N;  2PJR A;  1KA8 A;  3LSG A;  3HZJ A;  3RPU A;  4BYY A;  4QPO A;  3RKQ A;  1TNS A;  5FLM J;  2X1C A;  3CDL A;  3KEQ A;  5D8L B;  1FOK A;  1JTY A;  1R9T J;  1SFU A;  1HDD C;  2KIS A;  3DCF A;  3FXK A;  1NK2 P;  4MTE A;  1XDS A;  5D5X B;  3H9G A;  4UHT A;  3W2V A;  4CCL A;  1GT0 C;  3RJP A;  1MBJ A;  4C2U A;  1IV8 A;  3ECH A;  2XAH A;  4WF2 A;  3ZQL A;  2ISY A;  3J7A Y;  1T33 A;  5EF6 A;  3G6E I;  1ZG5 A;  5B3S H;  1HST A;  1PUF A;  2EB7 A;  4GO1 A;  1OYI A;  3GTL J;  3S2D J;  3OYH A;  5DV5 A;  3DWL E;  5F08 A;  4OAZ A;  3SHF A;  2DOE A;  4AC0 A;  3G2B A;  1R1T A;  3ASN H;  5JFR A;  4XOR A;  1A5J A;  2WTE A;  2P81 A;  1I3Q J;  3RZO J;  1VQN I;  4G8X A;  5AIP A;  5K5R A;  1S7E A;  3OMY A;  2Z33 A;  2JZY A;  5JVT A;  3GZN B;  4D1Q A;  5JR3 A;  3KP5 A;  3QOE A;  2K40 A;  4HZF A;  1UZC A;  1RKT A;  3CP8 A;  4CH7 A;  1EJ9 A;  3FXM A;  1U5T A;  2BW3 B;  2L9N A;  2K9M A;  4PJJ A;  3UNG C;  2K86 A;  3M07 A;  1AKH A;  1TWH J;  4G9Y A;  5KVR A;  1LB2 A;  3BZK A;  1VF9 A;  3AFH A;  3WHB A;  5JLW A;  3FKJ A;  3PQJ A;  3JTH A;  2M2E A;  1AOY A;  3MKZ A;  3RPQ A;  2CQN A;  2F5C A;  3E6M A;  3JSO A;  1O7F A;  2F5D A;  2IAI A;  4MO7 A;  2EIK H;  2NVY J;  1U3E M;  1BR4 A;  3KIO A;  3OS0 A;  3PUB A;  2DOF A;  5ILS A;  1S5L C;  3BOQ A;  2CW0 F;  3S2W A;  2O3F A;  2ME0 A;  2OV7 A;  3WTZ A;  4PJN A;  1ACI A;  1X4O A;  5FKN A;  3OOU A;  2JUC A;  2KMU A;  4PFO A;  4XR6 A;  3GX4 X;  4LGW A;  2GXA A;  1S3J A;  3SEZ A;  4ZJZ A;  3FXR A;  2DT6 A;  4IEJ A;  3T0Y A;  2VT3 A;  2IRF G;  1QO0 D;  3EPZ A;  3HUG A;  1LDD A;  5M3M J;  2R4G A;  4KJZ A;  2UXX A;  5KNL A;  4HV6 A;  4HQM A;  2EFN A;  3LSR A;  2QWW A;  4PK4 A;  1TW2 A;  1QZY A;  1QHG A;  2F6C A;  1S6L A;  1YFH A;  4C9Y A;  2LG4 A;  3CES A;  1CF7 A;  2HPM A;  1YIO A;  3HRS A;  1OR7 C;  1ZGJ A;  1XD7 A;  3E97 A;  3IUO A;  4BHP A;  3F8B A;  1JGG A;  2E36 A;  3L2W A;  4AIH A;  3S3O A;  2DMU A;  4UVB A;  2ELH A;  2IGN A;  3Q0W A;  3FK6 A;  3X2Q H;  3HB9 A;  3GUD A;  4F93 B;  3O3K A;  2EA2 A;  1XSV A;  5D6F A;  2QQ8 A;  3F8C A;  4UXN A;  4NQW A;  3K4L A;  2R7U A;  1TT5 B;  1IDY A;  1R36 A;  1W4M A;  1Y0N A;  3L00 A;  4IHT A;  4I09 A;  1R49 A;  1GUU A;  2W4S A;  1Z21 A;  4RB0 A;  4UB8 C;  4PUS A;  2XRO A;  4BXU A;  5J8F A;  3H92 A;  3AAF A;  2OA4 A;  5BPD A;  1B9M A;  2Z5U A;  3FXO A;  1JKR C;  2GOM A;  4CHU A;  4MIM A;  3HKZ N;  1DQU A;  3QQA A;  2V6E A;  2FMY A;  4RS8 A;  1BI3 A;  3A1Y A;  5ICE A;  2CMP A;  4M74 A;  3QYF A;  1IG7 A;  2CWE A;  3V8L A;  1QGP A;  1S9H A;  5E18 F;  4M6X A;  5IT3 A;  4IHX A;  1SFE A;  2ZCW A;  5LHG A;  5E17 F;  2ESN A;  4NC6 A;  3HPG A;  1XGN A;  5F0C A;  5H20 A;  3RQ4 A;  3QWL A;  2O0Y A;  4FET A;  3AG1 H;  1TLH B;  3GFL A;  5DUI A;  2W00 A;  4EQQ A;  1TWC J;  1I50 J;  3TGN A;  2R7X A;  2GIZ A;  1Y8Q B;  2A5Y B;  3IKV A;  4QTR A;  2ACJ A;  1I27 A;  4YIR X;  5M5Y J;  3FMQ A;  1RUO A;  3J7Z I;  2DA4 A;  3U9G A;  1ETQ A;  6PAX A;  1X1C A;  3P5J A;  2LSO A;  2R3S A;  2OCC H;  3EQL F;  3KX2 A;  3J7Y J;  4PGG A;  4AUX A;  2LMD A;  3JTG A;  4WK8 F;  2DMT A;  2RNG A;  4DYC A;  5J8C A;  1IO2 A;  1VQM I;  4PZJ A;  1VFC A;  2LP0 A;  3HOY J;  3GTK J;  3LQR A;  4KT5 C;  3TP0 A;  1VND A;  4KIT B;  3TW6 A;  5F04 A;  2XF7 A;  1V4R A;  4XSZ F;  2MYS A;  3PJR A;  4I99 C;  1MNM C;  1FBU A;  3HPH A;  3I58 A;  1XMA A;  3IH2 A;  5K7Z A;  3S15 J;  2F2E A;  1LUJ B;  3CJQ B;  3OYI A;  1MSF C;  4MNU A;  1MBG A;  1BC7 C;  2VQL A;  2MH9 A;  2RQP A;  3LSI A;  1DU0 A;  1TP4 A;  3J7A O;  2MW8 A;  4L18 B;  4HLY A;  3CCY A;  2QCO A;  4FE4 A;  4I0B A;  4PCQ A;  2COM A;  4M71 A;  4B8X A;  3KLO A;  1FOW A;  3HHH A;  5DM7 F;  5IYB J;  3KYC B;  4N9H A;  2QQA A;  3RZD J;  4IOC F;  2X6X A;  4E7S A;  1T0F A;  4KIC A;  2UUZ A;  4ZH4 F;  4IF4 A;  1Z3X A;  1SD5 A;  3E5U A;  3ZMZ A;  2JQ7 A;  3MZY A;  1ZRF A;  3L2U A;  4ENK A;  4Q48 A;  3FBN B;  1MZB A;  2MFZ A;  4A3M J;  2X6O A;  3CTA A;  3NEU A;  4G7O F;  3JR9 A;  3ZQI A;  2LY2 A;  1EH7 A;  1SAN A;  4LG0 A;  4DBQ A;  3DBL B;  1Z91 A;  3SQN A;  2YUS A;  5ICG A;  1FP1 D;  5BMZ A;  1KQ8 A;  1WWX A;  4GFB A;  2K27 A;  1ZK8 A;  3JRF A;  2ZNZ A;  2W7N A;  3F8F A;  3KEO A;  1P2F A;  1ZHF A;  1I6H J;  2WB1 N;  2IBD A;  1VQ4 I;  3DPT A;  1CGP A;  2EZH A;  5BOX A;  4XON A;  1O3Q A;  1VQ9 I;  4XLN F;  1J59 A;  2XRN A;  3TO7 A;  4V2F A;  2EJR A;  3DKY A;  2QEX I;  4HX7 A;  3FKI J;  3A4C A;  2ME6 A;  3TP3 A;  4Y3O A;  3M1E A;  2A6T A;  1RES A;  2V1X A;  2LH9 A;  1JHH A;  2PMZ N;  3WGI A;  3IRR A;  5ILU A;  1QVU A;  2R7Z J;  2EK5 A;  4OIP F;  1ZRC A;  2HDD A;  4AD9 A;  3GEZ A;  2KZV A;  2G7U A;  5GAE J;  2TRT A;  4P9F A;  2ID6 A;  1X4P A;  5IT9 K;  2GQQ A;  3E6C C;  3P9K A;  3T8T A;  3WTW C;  4QWQ A;  3BC8 A;  4UV9 A;  1RI7 A;  2V1D A;  1POG A;  4XOP A;  4Y17 A;  5E3O A;  4HG2 A;  2DO7 A;  4G7H F;  4XM3 A;  1VZ0 A;  2V1N A;  1AU7 A;  1BI2 A;  2NNY A;  2L9V A;  1K79 A;  2F5V A;  4L9T A;  1R58 A;  2KQR A;  3K0L A;  4A3J J;  3OYF A;  3E1S A;  3PNT A;  3TDZ C;  1T6S A;  2W57 A;  3I4P A;  3ULQ B;  2CH0 A;  4HF1 A;  1TW3 A;  1JKQ C;  2OQR A;  2CQ7 A;  1EF4 A;  1BI0 A;  2WY8 Q;  2CUZ A;  4A5M A;  5BQT A;  3OOP A;  2GLO A;  4DZJ A;  3E3V A;  4RGR A;  2KKO A;  2IGO A;  3GTJ J;  3N97 A;  5J6X A;  1Z77 A;  3QPS A;  1P7I A;  2HOA A;  2VL8 A;  4YFX F;  3CCR I;  1KU3 A;  3BTI A;  4BE0 A;  3CUQ A;  3WTS C;  1Y1W J;  2QKM B;  4ON0 A;  2VC1 A;  3R60 A;  2AS5 F;  2HOT A;  4ETS A;  4HOB A;  2PN6 A;  3QP5 A;  4D9J A;  4DYR A;  1BW6 A;  1RET A;  3F3X A;  3HTS B;  1XCB A;  4WWC A;  3I5U A;  1R1V A;  1PDN C;  2PQ8 A;  2D2W A;  3BCA A;  4UNO A;  2XPV A;  3M1C A;  3EUH A;  1NTC A;  1JUP A;  1LEB A;  1XS9 A;  2H6B A;  2JA6 J;  5L3G A;  3DQV C;  1ULY A;  2F48 A;  4XID A;  1IN4 A;  4Z6Y A;  1ZRE A;  1YIJ I;  3GBG A;  2ZXI A;  2ZSI B;  4XKW A;  5E8I A;  3K2A A;  2BEO A;  2OU2 A;  4CDG A;  2VKV A;  1YE9 A;  3BY6 A;  1GXP A;  3RYP A;  1GV5 A;  3DEE A;  2HPI A;  3TDU C;  2FU4 A;  4R1H A;  1IW7 F;  3HOU J;  1PJR A;  3KP4 A;  3TO6 A;  3LAP A;  3HL2 A;  3CJR B;  3WTX C;  5K5Q A;  1EV7 A;  2F4M B;  2K4B A;  2ZME A;  3S14 J;  1IC8 A;  2DI3 A;  3JRG A;  4CCO A;  1JJ6 C;  3BJ6 A;  4CO8 A;  3ZP5 A;  2LYC A;  3F9K A;  1UJ8 A;  2DOA A;  4ZDO A;  3QOP A;  3GFJ A;  2HYJ A;  2M8E A;  3FDY A;  5FFZ A;  1HC8 A;  3HJE A;  4N4O B;  2ECB A;  3Q9S A;  3RSN A;  1PUE E;  3GLL A;  1HOM A;  3IAM 2;  2V6C A;  3OR2 C;  4C3J J;  2K3F A;  3LFK A;  4NBQ A;  4RGS A;  5F27 A;  3CME I;  3BZ6 A;  2CRG A;  1K83 J;  4CA0 A;  3A02 A;  2K9L A;  1P6R A;  3REO A;  3A01 A;  4LFU A;  1QPI A;  2ZB9 A;  4EM2 A;  3KE2 A;  1R7J A;  3CLQ A;  2VKH A;  2W1O A;  5D5V B;  2R5Y B;  3H3U A;  2ZFW A;  3D0S A;  1T95 A;  2JWT A;  2VBW A;  1K7A A;  9ANT A;  2BZT A;  3LSH A;  2HVR A;  5B1A H;  3VYU B;  4ZZL A;  3JW4 A;  5LEK A;  1UHW A;  4EJU A;  5DCM A;  3CCE I;  3DV8 A;  5FO5 A;  1IJW C;  3ZQG A;  1F4K A;  3J80 Z;  4RAZ A;  3FX3 A;  4E7I A;  3CC4 I;  1LEA A;  4BXX J;  5HVQ C;  1Y1V J;  1GVJ A;  3CO7 C;  4MEX F;  1UHS A;  3H3V K;  2ADU A;  2DT5 A;  2E5N A;  2VE9 A;  5LGN A;  3OYB A;  5KCM A;  3CJN A;  2HS5 A;  2K9S A;  4BJT A;  3Q5F A;  1MMG A;  5JHU A;  5FJ8 J;  2G9W A;  3I59 A;  3CF5 F;  3NAU A;  3I71 A;  5ICC A;  3CO6 C;  2K4J A;  1X3U A;  4IXA A;  3R4K A;  4KIF A;  3GTG J;  2Y0S A;  1B9N A;  3EET A;  5D4S A;  2RVC A;  4A3B J;  3TQN A;  2XIG A;  2ZXJ A;  2QLZ A;  3OYM A;  5C44 J;  2PEX A;  4BHB A;  3H5R A;  1E0E A;  2DA1 A;  2EQR A;  2HZT A;  1W0T A;  2UZK A;  3BT9 A;  4IJA A;  3Q9V A;  4FE7 A;  2XHK A;  3FBI B;  4A0X A;  3KP7 A;  5H6Q A;  2DMP A;  3KP6 A;  3PUF A;  2OBP A;  3IP4 B;  3CCU I;  1U2W A;  1G6N A;  3BG5 A;  1OCP A;  1YLF A;  1YRN A;  2CO5 A;  3K1P A;  3O6B B;  4BEH B;  1OJL A;  4X6A J;  1XX5 A;  3OYG A;  5A2Q K;  1IZ1 A;  1Z6T A;  3OL4 A;  3I55 I;  2DTR A;  2FX0 A;  4I02 A;  1BL0 A;  1KU9 A;  1WH7 A;  1T0F C;  1YW8 A;  2DCE A;  2IGM A;  4MGR A;  4RB2 C;  3FMR A;  2VQH A;  2IW5 A;  4C30 A;  2KP6 A;  4Y33 A;  2NYX A;  3OS2 A;  2LLK A;  2ETH A;  1LFP A;  3BR6 A;  1V54 H;  1GXQ A;  5B66 C;  4GCV A;  4CYC B;  4CUG A;  4C3I J;  5DM6 F;  5C4J J;  3SZT A;  3OIO A;  3PFY A;  4NHJ A;  4JX6 A;  1QRY A;  1SFK A;  2A68 F;  4E7L A;  5GP9 A;  2VI6 A;  1H9T A;  2FNA A;  3HOX J;  1K78 A;  5FRM A;  5F1R A;  1N78 A;  4EAT A;  2Z2S B;  1STZ A;  1F1Z A;  1F36 A;  2NXN B;  4ZYG A;  4Y52 J;  2DXI A;  2Q2E A;  2W25 A;  1V5E A;  2PX9 A;  2EBI A;  3FHN A;  3WG7 H;  1W7P A;  3P7N A;  3L2Q A;  3CLO A;  3PL8 A;  4YIF A;  1C0W A;  3M9A A;  3OYN A;  3CZ6 A;  3ZQ7 A;  2ZKZ A;  1WJC A;  2D1V A;  4G6D A;  5HNF A;  4HX4 A;  2MAB A;  2FXA A;  4B3X A;  2RGV A;  4G6Q A;  2AHQ A;  2EIJ H;  2FOK A;  2GZW A;  3J80 K;  4PJM A;  1QZZ A;  2HXO A;  4KFC A;  3Q0U A;  2XSD C;  1OPC A;  3R0A A;  4BL0 B;  2E2H J;  4IOA F;  3K9T A;  2L7K A;  2VOO A;  4YRV A;  3L2R A;  4FCY A;  3DBR B;  2KIF A;  1YS7 A;  3A0B C;  1B72 B;  3OWT A;  4GDF A;  4RMN A;  4A93 J;  2LBF A;  2FEZ A;  2R7V A;  2FF4 A;  4F52 A;  4ZYD A;  3JRE A;  2FBH A;  2LD5 A;  3VFZ A;  2F5F A;  4M3G A;  1ZKG A;  2Y75 A;  2D5V A;  2DTZ A;  2P8T A;  3PO2 J;  2HQR A;  2VJJ A;  1T2K A;  2E7W A;  3L09 A;  2G0E A;  3DU6 A;  3BTL A;  1TNT A;  3E5X A;  2HQ5 A;  2MD5 A;  4GGG A;  1E3H A;  2H6C A;  3N4M A;  4F92 B;  1SMT A;  1FZP B;  3WU2 C;  4E6K G;  4IQJ A;  2XGE A;  2M9H A;  3I9V 2;  3VSL A;  2ZNY A;  3W6K B;  4ABZ A;  3JRI A;  2LF8 A;  2P5V A;  1JUM A;  4BDY A;  2OQG A;  4OIO F;  1HKQ A;  3K2Z A;  1Y0U A;  1SMY F;  1KQ9 A;  5F0F A;  1JKO C;  4RAG A;  3CUQ C;  1MJA A;  4ZZD A;  2R7W A;  2O6G E;  2JK3 A;  2JMW A;  2EFW A;  4I6Z A;  2CSO A;  3S3M A;  1U8B A;  2E5Z A;  2GA2 A;  1YJW I;  1K61 A;  1X1B A;  1IUY A;  3WE3 A;  4WXC A;  5FLX Z;  2VKD A;  3SZG A;  4HAM A;  2A69 F;  5J3L A;  4DGW B;  3J81 Z;  3EUH C;  4KIG A;  1LQ1 A;  2RNJ A;  4Y4R A;  3OV8 A;  1W5C C;  2XKO A;  2JSP A;  1FMV A;  2HYF A;  3GFM A;  4B44 A;  1T38 A;  2PFB A;  4O6J A;  4RB1 A;  3OYL A;  2Y31 A;  1OYY A;  1FYK A;  2J5P A;  1JUS A;  3FMS A;  2J5O A;  1ENH A;  2OTL I;  3OIP A;  4MQV A;  4MHG A;  2OAZ A;  3RQI A;  4A12 A;  2DA6 A;  1R5I D;  1Y6I A;  4HDU A;  2JA5 J;  2NOJ B;  1U0J A;  3DU5 A;  4LK1 F;  3LA3 A;  2Y2Z A;  1IXC A;  2BXZ A;  2JA7 J;  4E4H A;  5FLV A;  2QSF X;  1I1G A;  2IXS A;  2ZME C;  4D0P A;  2XAJ A;  2QBY A;  1A31 A;  1YW9 A;  2B0L A;  5HLG A;  1LE8 B;  4O3M A;  2A07 F;  4U0V A;  2VPL A;  1X3W B;  3HOZ J;  2VPR A;  1U8R A;  3K4J A;  2HQN A;  2X1E A;  1IRG A;  4QSH A;  3D5S C;  2IP2 A;  3A03 A;  2PJR B;  3E6B A;  4PJ0 C;  5J4V A;  1WJB A;  2STT A;  5KHD A;  4MLO A;  1HLV A;  1BI1 A;  2DFF A;  2DMQ A;  1K6Y A;  3KYL A;  3ZQC A;  3HRM A;  5AON A;  4BS9 A;  2VLA A;  3QRF F;  4BQQ A;  3BLY A;  3KZY A;  1WJF A;  2VKE A;  5EDN A;  3CUO A;  3MEX A;  3U21 A;  1P4X A;  1LDJ A;  3OY9 A;  4M9S A;  4N4N B;  5D8K B;  1KZH A;  4BJ6 C;  1IN8 A;  1PUF B;  1BM9 A;  1GDT A;  3C1D A;  4XLC A;  3ZQH A;  3PSI A;  1KQ0 A;  2IT0 A;  1XB4 A;  4D7M A;  5FB2 A;  3B6C A;  3OYA A;  1FLI A;  3IC7 A;  4L9V A;  4XRF A;  2VQC A;  5CQE A;  1FIP A;  2EV0 A;  1JI8 A;  2E7X A;  3LA2 A;  1J75 A;  3WTT C;  2EFQ A;  2XV4 S; 
#chains in the Genus database with same CATH homology
 2VOP A;  1TQP A;  1FYL A;  2HKX A;  4O5V A;  1U5T B;  1MJB A;  2TDX A;  5L3C A;  3HTU A;  1FX7 A;  3RDI A;  2IPQ X;  1XDU A;  2QEN A;  1ODD A;  1FBQ A;  2PBI A;  3MWM A;  3V7S A;  2OZU A;  5K5O A;  2ESH A;  1ZRD A;  3F72 A;  2QVO A;  2GAU A;  4AVP A;  5FLX K;  1T39 A;  5LHH A;  3ERE D;  1JE8 A;  5HDK A;  1D3Y A;  3ZMU A;  2PJP A;  5FFX A;  3HOT A;  4HV5 A;  2RC4 A;  4LMY A;  3F6V A;  2MH2 A;  1CF7 B;  2CQK A;  4M9X A;  4KIB A;  3V7C A;  1XCV A;  4M73 A;  2XAS A;  5HDG A;  2C6Y A;  2FSW A;  5ILV A;  1BBY A;  3BP8 A;  4H0E A;  1YG2 A;  1ONV A;  2O03 A;  3LQQ A;  4EJW A;  5FD5 A;  3MFK A;  4HYE A;  4M72 A;  2CGP A;  3HYI A;  3H3Z A;  2X4H A;  3BJA A;  3RI4 A;  2MLK A;  2Z3Y A;  3ABU A;  2YR2 A;  2A61 A;  1W5T A;  4OU0 A;  1GHC A;  1HQC A;  1XSD A;  1J2X A;  1E2X A;  4CYD A;  2E1N A;  1RIO H;  2IA1 A;  3HSR A;  3R6S A;  1Z6R A;  1XGO A;  3HRT A;  3TKY A;  2FBK A;  2XGX A;  4UV8 A;  3C3W A;  2GXB A;  3BPX A;  2YX4 A;  1H0M A;  2L3D A;  3VB2 A;  1P4A A;  2JPC A;  2FRH A;  4ENM A;  2YU3 A;  4WCG A;  3HIF A;  1B4A A;  4K2E A;  3F22 A;  1P92 A;  1EH8 A;  1MD0 A;  2DK8 A;  2YX7 A;  3ZMT A;  2EFO A;  2Z9O A;  3GFI A;  1LDK B;  4IVN A;  4EVI A;  3GO5 A;  4KUM A;  2KIU A;  3RKY A;  4LG0 B;  3WOD F;  1MGT A;  4EM1 A;  1S7A A;  1D8J A;  5D5U B;  4A0Y A;  1XMK A;  2HWV A;  4L9J A;  4OIN F;  1PP7 U;  3QU3 A;  2VOD A;  1IF1 A;  1B1B A;  3T5X A;  3FHZ A;  1B59 A;  4Q47 A;  2DPU A;  2BE5 F;  1YW7 A;  2FML A;  1IXR C;  2DPD A;  2F5E A;  2LF7 A;  3K1N A;  4KDP A;  4CIC A;  1DDN A;  1OYW A;  4R8H A;  5LRS A;  1DPU A;  5CYV A;  4HF0 A;  3E6D A;  5F64 A;  5ICF A;  4DQ2 A;  4FX4 A;  1IXS B;  3D5L A;  2GA1 A;  3GW2 A;  2L02 A;  4EGZ A;  4QLC U;  1G4D A;  4S05 A;  1IRF A;  5HS8 A;  2YSR A;  3KP2 A;  2DU9 A;  3VEP A;  3ZN0 A;  1HKT A;  1WKM A;  3HSE A;  5EEH A;  1ZG3 A;  2JT1 A;  1WQ2 A;  2ZBK A;  1G3Y A;  1FPQ A;  1HW5 A;  1TBX A;  2FQ3 A;  3CUQ B;  1FSH A;  2G7H A;  2M45 A;  3BRO A;  1S29 A;  1ZN2 A;  1R5G A;  2WWY A;  2M5W A;  5L3D A;  2M87 A;  1ON1 A;  2D1H A;  2RN7 A;  2NRA C;  2KRF A;  4ENJ A;  1OKR A;  3BDD A;  4XSX F;  1H9G A;  4YII A;  1U6G A;  5HOO A;  2QQB A;  4R79 A;  1FC3 A;  3T1B A;  1RNL A;  1G3T A;  1SD7 A;  4HF2 A;  2XAF A;  2ZME B;  2P7V B;  3WU1 B;  4YG2 F;  4LLL A;  1MDM A;  4JQF A;  1DPR A;  4G94 A;  4ZYE A;  2M1B A;  2XUB A;  1KU7 A;  5DEQ A;  1DUX C;  2M30 A;  2HEO A;  4BAY A;  2LNB A;  2HTS A;  4TV7 A;  2MA3 A;  4L0Z B;  2DFI A;  2HR3 A;  2EWN A;  2RKH A;  1IAW A;  3GZ6 A;  2QM3 A;  4Q5S F;  1BC8 C;  2PMH A;  3V4G A;  1NHA A;  2VBY A;  3I0T A;  4OIR F;  1XGM A;  1FYM A;  5DCM B;  1I6X A;  5HLI A;  3HHG A;  1I1S A;  1R00 A;  3GXO A;  2WV0 A;  3DFG A;  4U7D A;  2A6E F;  3FXU A;  2FE3 A;  4YFK F;  2GXG A;  1W5S A;  4OIQ F;  3ZN1 A;  5ED4 A;  1Q1H A;  2QZ8 A;  3I59 B;  4AWX B;  1HXD A;  1J7K A;  3GYH X;  4Q4Z F;  1HSJ A;  5D5W B;  1UFM A;  5E1W A;  5TJJ A;  1BIA A;  4KMF A;  1Z1D A;  3SFZ A;  4FX0 A;  2W24 A;  2XKP A;  4IRI A;  2NAZ A;  1MJ9 A;  2GIV A;  1VTN C;  1FBS A;  3QAH A;  1AWC A;  2BGC A;  4XBF A;  1BIB A;  3MQ0 A;  3WTY C;  1D8K A;  2MC3 A;  2JRT A;  4PDK A;  2VON A;  3ZMS A;  5E1Z B;  4Y15 A;  2PI0 A;  3NRV A;  5LRR A;  4EJT A;  2L54 A;  2V79 A;  2A3S A;  1YS6 A;  4BH9 A;  1OMI A;  4F7Z A;  4U0Y A;  2LDU A;  3M8F A;  4P9U A;  2ISZ A;  5CVV A;  2Q8K A;  3V8K A;  1FNN A;  4UUV A;  4I98 B;  3RYR A;  4A6E A;  1K78 B;  1Z7U A;  3P9I A;  4LB5 A;  3VOD A;  3SZP A;  1W7P B;  4MQ9 F;  3FXQ A;  2H09 A;  4OMY A;  3LA7 A;  1XN7 A;  3WTV C;  4DNC A;  3C18 A;  5DYM A;  1IN6 A;  2VC0 A;  3U1D A;  1RZ4 A;  1YO5 C;  5CVI A;  4S04 A;  1WI9 A;  2HFH A;  1KGS A;  2V9V A;  2HKO A;  1T98 A;  3KLN A;  3IRQ A;  3ABT A;  5HS9 A;  1JHF A;  4GYI A;  4U7B A;  4N9I A;  4Y13 A;  3FF5 A;  2L4M A;  2LKP A;  2XVC A;  5BPI A;  4MEY F;  2VBX A;  1UHM A;  2ZJ2 A;  2P5L C;  4AIK A;  3ZPL A;  4HA8 A;  5D6E A;  3COA C;  3M8E A;  1E17 A;  2R7F A;  5LGT A;  3IWZ A;  2EFP A;  5LEJ A;  2Q0O A;  5E20 A;  2X0L A;  1LJ9 A;  1O3R A;  1UB9 A;  1TTY A;  3R0J A;  1BN5 A;  4BHC A;  5HDN A;  3K1M A;  2MLG A;  3PQK A;  2BYV E;  2JPB A;  1ON2 A;  3NQO A;  2UXN A;  4EGY A;  1ZLK A;  4YFN F;  4LK0 F;  2QBY B;  2VBZ A;  1R1U A;  1V3F A;  5F6F A;  3IHU A;  3WGG A;  1J9I A;  3L2C A;  3FZV A;  4EJV A;  3QP6 A;  3J81 K;  2W84 A;  4HX8 A;  1PP8 F;  2O61 A;  1FP2 A;  4HQE A;  1SD6 A;  2L01 A;  4A5N A;  5LBQ A;  4I0A A;  1P4W A;  1B6A A;  1Z9C A;  3BJO A;  2JSC A;  2DK5 A;  3KCC A;  5JI6 A;  3P9C A;  3ELK A;  5K1Y A;  1F5T A;  2EV6 A;  5TRD A;  4L9N A;  5ERI A;  2FNP A;  4WX9 A;  2BBY A;  1D5V A;  2QQ9 A;  2CFX A;  3GZ5 A;  1Z05 A;  4L5I A;  1R5H A;  2FBI A;  3B02 A;  3LAJ A;  4HBL A;  2P4W A;  5IT9 Z;  3EYY A;  1ZGA A;  4BQA A;  3DEU A;  3GF2 A;  1FY7 A;  2IJL A;  4IRG A;  4GXO A;  2OZ6 A;  4HDV A;  3MZH A;  2HYG D;  2XAQ A;  4LLN A;  2PLY A;  4ESJ A;  2VN2 A;  1QBJ A;  3MCZ A;  1YYV A;  1A04 A;  4CZZ A;  2O8X A;  3KET A;  2Y0M A;  1HBX G;  1LVA A;  4N0B A;  3F23 A;  4KYW A;  1L0O C;  4CGZ A;  4P96 A;  3KZZ A;  5DD8 A;  1QNT A;  3DXJ F;  4EM0 B;  4I2O A;  2YPR A;  5BS6 A;  1S7O A;  3FM3 A;  5DUK A;  1IN7 A;  1IN5 A;  1O3S A;  5E8G A;  3QU6 A;  2EA4 A;  3I54 A;  3LWF A;  4ASN A;  2JTV A;  1G3S A;  3F8M A;  2K7L A;  1USS A;  2HDC A;  1EH6 A;  5DCF A;  1FWZ A;  2QUF A;  4IPA A;  1R23 A;  4JBA A;  3JAM Z;  4I01 A;  3L7W A;  1KYW A;  2DAO A;  3WTU C;  4ESB A;  3C7J A;  4BNC A;  1XGS A;  3WU0 A;  4AIJ A;  4LLG F;  5H6R A;  3IWF A;  3G73 A;  2CYY A;  1MKM A;  5LHI A;  4RGX A;  1K6O A;  3T8R A;  4OOI A;  1UST A;  2DBB A;  4GYG A;  3IKT A;  1QQI A;  4RB3 C;  1I5Z A;  3DF8 A;  1O57 A;  1J0R A;  4UVC A;  5LLQ A;  3ML6 A;  3BWG A;  4G7Z F;  1TQM A;  4L0Y B;  1SFX A;  1YQA A;  1J5Y A;  4FHT A;  1JXS A;  3GVA A;  2VXZ A;  3ZMD A;  4HLX A;  2V1U A;  1U5T C;  3K69 A;  4P55 A;  2R7D A;  5CVR A;  4KNY A;  4XLP F;  5LGU A;  3I64 A;  5CLS A;  3TOB A;  4E70 A;  1TQI A;  4Z2Y A;  2DQL A;  1R22 A;  1QPM A;  4RAY A;  5HLH A;  1UCR A;  2XAG A;  2CG4 A;  5L3F A;  4M6Y A;  2DLL A;  3QPT A;  3F21 A;  3TOA A;  4U0W A;  4WXH A;  4JK1 X;  3MAJ A;  4CXF A;  4FT8 A;  3E5Q A;  3O2P E;  3ISP A;  5A2Q Z;  3SXY A;  3IL2 A;  2PMU A;  2RDP A;  1ZAO A;  3RKW A;  3HSF A;  2IVM A;  4OMZ A;  5L3E A;  3F8N A;  3JAM K;  2PG4 A;  1JGS A;  2KJC A;  2W85 A;  5EEG A;  4M9Z A;  3QPH A;  1L3L A;  3M7G A;  4EV0 A;  4IRH A;  2H27 A;  1HW1 A;  1ZG1 A;  3WG9 A;  4KMU X;  4A0Z A;  2HGC A;  3ECO A;  1KYZ A;  4EJO A;  3RTR A;  4KN4 X;  3R61 A;  1XSX A;  2P6T A;  1FT9 A;  3KP3 A;  2WC2 A;  1WSU A;  2K02 A;  1G3W A;  2P6S A;  1OR7 A;  4RGU A;  1ZLJ A;  1ZYR F;  3BPV A;  4NB5 A;  3EYI A;  5CVJ A;  2OD5 A;  3WGH A;  2MBF A;  2D45 A;  1O3T A;  2HOE A;  3W6J B;  5FD6 A;  5KK1 A;  4UVA A;  2A6H F;  1HW2 A;  5D4R A;  3VOE A;  4WXD A;  3RIR A;  4I7H A;  5CVU A;  4MTD A;  4LJZ F;  4U88 A;  3WE2 A;  1SAX A;  4HW0 A;  1MDM B;  4L5J A;  4IHS A;  2L4A A;  1HKS A;  1W7P D;  2STW A;  1DP7 P;  3B73 A;  3TO9 A;  3G3Z A;  2P5K A;  1RUN A;  5AIQ A;  4B09 A;  3KFW X;  1ZAR A;  3V8J A;  2KIM A;  3EDP A;  3JSP A;  4ESF A;  4P5O A;  2ZO4 A;  3ROU A;  3U2R A;  2H94 A;  5CJ9 A;  3V7R A;  4LB6 B;  3DP7 A;  5DD4 A;  5HS7 A;  4PGH A;  2GWR A;  4LD5 A;  1S8N A;  1LNW A;  2E1C A;  3FWE A;  5E1X A;  1WRJ A;  3HOS A;  3HRU A;  2VE8 A;  3FM5 A;  1O7L A;  1KU2 A;  1BJA A;  3GLX A;  2AXL A;  2BV6 A;  2NNN A;  4A6D A;  4ZYH A;  3I53 A;  2P7C B;  2IA2 A;  3LST A;  2Y48 A;  5FGM A;  2IA0 A;  4ENN A;  3F6O A;  1F9N A;  4KA4 A;  1YTY A;  2NS0 A;  1SD4 A;  3ZMV A;  1BOA A;  2FA5 A;  2KJB A;  2DW4 A;  2Z99 A;  1REP C;  2DQR A;  2UWM A;  2HTJ A;  2VT2 A;  4A2U A;  3L9F A;  3RKX A;  3PFI A;  4EMS A;  1ZH5 A;  2EV5 A;  3DPL C;  5L3B A;  3GWZ A;  2RV8 A;  3DKW A;  1FSE A;  5DDG A;  1U78 A;  2QYO A;  4KN7 X;  3CDH A;  1KA8 A;  3RPU A;  4BYY A;  1TNS A;  3KEQ A;  5D8L B;  1FOK A;  1SFU A;  4MTE A;  1XDS A;  5D5X B;  4UHT A;  3RJP A;  3ECH A;  2XAH A;  4WF2 A;  2ISY A;  1ZG5 A;  1HST A;  2EB7 A;  4GO1 A;  1OYI A;  5DV5 A;  3SHF A;  1R1T A;  5JFR A;  2WTE A;  4G8X A;  5AIP A;  5K5R A;  2Z33 A;  2JZY A;  5JVT A;  5JR3 A;  3KP5 A;  4HZF A;  1U5T A;  2K86 A;  4G9Y A;  5KVR A;  1LB2 A;  3PQJ A;  3JTH A;  1AOY A;  3RPQ A;  2F5C A;  3E6M A;  3JSO A;  1O7F A;  2F5D A;  1U3E M;  5ILS A;  3BOQ A;  2CW0 F;  3S2W A;  2O3F A;  3WTZ A;  3GX4 X;  4LGW A;  1S3J A;  3FXR A;  3T0Y A;  2VT3 A;  2IRF G;  1QO0 D;  3HUG A;  1LDD A;  2UXX A;  4HV6 A;  4HQM A;  2EFN A;  2QWW A;  1TW2 A;  1QZY A;  1S6L A;  1YFH A;  1CF7 A;  1YIO A;  3HRS A;  1ZGJ A;  1XD7 A;  3E97 A;  4BHP A;  3F8B A;  4AIH A;  4UVB A;  2ELH A;  3GUD A;  3O3K A;  2EA2 A;  1XSV A;  5D6F A;  3F8C A;  4UXN A;  4NQW A;  1R36 A;  1W4M A;  3L00 A;  4IHT A;  4I09 A;  4RB0 A;  2XRO A;  4BXU A;  5J8F A;  3H92 A;  3AAF A;  2OA4 A;  5BPD A;  1B9M A;  2Z5U A;  4CHU A;  2FMY A;  4RS8 A;  1BI3 A;  5ICE A;  4M74 A;  2CWE A;  3V8L A;  1QGP A;  5E18 F;  4M6X A;  5IT3 A;  1SFE A;  2ZCW A;  5LHG A;  5E17 F;  2ESN A;  1XGN A;  5H20 A;  2O0Y A;  1TLH B;  3GFL A;  5DUI A;  4EQQ A;  3TGN A;  2A5Y B;  3IKV A;  2ACJ A;  1I27 A;  3FMQ A;  1RUO A;  3U9G A;  6PAX A;  2LSO A;  2R3S A;  3EQL F;  4PGG A;  3JTG A;  4WK8 F;  5J8C A;  4PZJ A;  3LQR A;  4KT5 C;  1V4R A;  4XSZ F;  1FBU A;  3I58 A;  1XMA A;  2F2E A;  4MNU A;  1BC7 C;  2MH9 A;  2RQP A;  3J7A O;  4L18 B;  4HLY A;  4I0B A;  4PCQ A;  2COM A;  4M71 A;  4B8X A;  3KLO A;  3HHH A;  4N9H A;  2QQA A;  1T0F A;  4KIC A;  4ZH4 F;  4IF4 A;  1SD5 A;  3E5U A;  3ZMZ A;  3MZY A;  1ZRF A;  4ENK A;  4Q48 A;  1MZB A;  4G7O F;  3CTA A;  3NEU A;  1EH7 A;  4LG0 A;  1Z91 A;  3SQN A;  5ICG A;  1FP1 D;  5BMZ A;  1KQ8 A;  1WWX A;  2K27 A;  2ZNZ A;  3F8F A;  3KEO A;  1P2F A;  1ZHF A;  3DPT A;  1CGP A;  5BOX A;  1O3Q A;  4XLN F;  1J59 A;  2XRN A;  3TO7 A;  2EJR A;  4HX7 A;  3M1E A;  2V1X A;  1JHH A;  3WGI A;  3IRR A;  5ILU A;  2EK5 A;  4OIP F;  1ZRC A;  4AD9 A;  3GEZ A;  2G7U A;  4P9F A;  5IT9 K;  2GQQ A;  3E6C C;  3P9K A;  3T8T A;  3WTW C;  4QWQ A;  4UV9 A;  1RI7 A;  2V1D A;  4Y17 A;  2DO7 A;  4G7H F;  1BI2 A;  2NNY A;  1K79 A;  4L9T A;  1R58 A;  3K0L A;  3TDZ C;  1T6S A;  2W57 A;  3I4P A;  3ULQ B;  4HF1 A;  1TW3 A;  2OQR A;  1BI0 A;  4A5M A;  5BQT A;  3OOP A;  3E3V A;  4RGR A;  2KKO A;  3N97 A;  5J6X A;  4YFX F;  1KU3 A;  3CUQ A;  3WTS C;  4ON0 A;  2VC1 A;  3R60 A;  2AS5 F;  4ETS A;  4HOB A;  2PN6 A;  3QP5 A;  3HTS B;  3F3X A;  1XCB A;  4WWC A;  3I5U A;  1R1V A;  1PDN C;  2PQ8 A;  2D2W A;  4UNO A;  3EUH A;  1LEB A;  2H6B A;  5L3G A;  3DQV C;  1ULY A;  1IN4 A;  1ZRE A;  5E8I A;  2BEO A;  2OU2 A;  4CDG A;  3BY6 A;  1GXP A;  3RYP A;  3TDU C;  2FU4 A;  4R1H A;  1IW7 F;  3KP4 A;  3TO6 A;  3LAP A;  3WTX C;  5K5Q A;  1EV7 A;  2ZME A;  2K4B A;  2DI3 A;  3BJ6 A;  4CO8 A;  3ZP5 A;  3QOP A;  3GFJ A;  2M8E A;  5FFZ A;  3Q9S A;  1PUE E;  2V6C A;  3LFK A;  4RGS A;  3BZ6 A;  1P6R A;  3REO A;  4LFU A;  4EM2 A;  3KE2 A;  1R7J A;  5D5V B;  3H3U A;  2ZFW A;  3D0S A;  2VBW A;  1K7A A;  4ZZL A;  3JW4 A;  5LEK A;  1UHW A;  4EJU A;  5DCM A;  3DV8 A;  5FO5 A;  1F4K A;  3J80 Z;  4RAZ A;  3FX3 A;  1LEA A;  5HVQ C;  1GVJ A;  3CO7 C;  4MEX F;  2ADU A;  2DT5 A;  2VE9 A;  5LGN A;  3CJN A;  2HS5 A;  3Q5F A;  5JHU A;  2G9W A;  3I59 A;  3I71 A;  5ICC A;  3CO6 C;  2K4J A;  1X3U A;  4IXA A;  3R4K A;  4KIF A;  1B9N A;  3EET A;  5D4S A;  2RVC A;  3TQN A;  2XIG A;  2ZXJ A;  2QLZ A;  2PEX A;  4BHB A;  2HZT A;  2UZK A;  4IJA A;  3Q9V A;  2XHK A;  4A0X A;  3KP7 A;  5H6Q A;  3KP6 A;  2OBP A;  1U2W A;  1G6N A;  1YLF A;  2CO5 A;  3K1P A;  3O6B B;  5A2Q K;  1IZ1 A;  1Z6T A;  2DTR A;  4I02 A;  1KU9 A;  1YW8 A;  4MGR A;  4RB2 C;  3FMR A;  2IW5 A;  2NYX A;  2ETH A;  1GXQ A;  4GCV A;  3SZT A;  4NHJ A;  2A68 F;  1H9T A;  2FNA A;  1K78 A;  5F1R A;  1STZ A;  1F1Z A;  4ZYG A;  2Q2E A;  2W25 A;  1W7P A;  3P7N A;  3CLO A;  4YIF A;  1C0W A;  3M9A A;  3ZQ7 A;  2ZKZ A;  2D1V A;  4G6D A;  4HX4 A;  2FXA A;  2RGV A;  4G6Q A;  2FOK A;  2GZW A;  3J80 K;  1QZZ A;  4KFC A;  1OPC A;  3R0A A;  3K9T A;  2VOO A;  2KIF A;  1YS7 A;  2FEZ A;  2FF4 A;  4ZYD A;  2FBH A;  3VFZ A;  2F5F A;  2Y75 A;  2P8T A;  2HQR A;  1T2K A;  2E7W A;  3L09 A;  1TNT A;  3E5X A;  2MD5 A;  4GGG A;  2H6C A;  3N4M A;  1SMT A;  1FZP B;  2ZNY A;  3W6K B;  2LF8 A;  2P5V A;  2OQG A;  4OIO F;  1HKQ A;  3K2Z A;  1Y0U A;  1SMY F;  1KQ9 A;  3CUQ C;  1MJA A;  4ZZD A;  2O6G E;  2EFW A;  2CSO A;  2GA2 A;  1IUY A;  3WE3 A;  4WXC A;  5FLX Z;  4HAM A;  2A69 F;  3J81 Z;  4KIG A;  1LQ1 A;  2RNJ A;  3OV8 A;  2XKO A;  2HYF A;  3GFM A;  1T38 A;  2PFB A;  4O6J A;  4RB1 A;  1FYK A;  1OYY A;  2J5P A;  3FMS A;  2J5O A;  4MQV A;  4MHG A;  2OAZ A;  4A12 A;  4HDU A;  4LK1 F;  3LA3 A;  1IXC A;  1I1G A;  4D0P A;  2XAJ A;  2QBY A;  1YW9 A;  2B0L A;  5HLG A;  4O3M A;  2A07 F;  4U0V A;  1U8R A;  2HQN A;  1IRG A;  2IP2 A;  3E6B A;  2STT A;  1BI1 A;  3HRM A;  5AON A;  3QRF F;  3KZY A;  3CUO A;  3MEX A;  1P4X A;  1LDJ A;  4M9S A;  5D8K B;  1IN8 A;  1BM9 A;  3C1D A;  1KQ0 A;  2IT0 A;  1XB4 A;  5FB2 A;  1FLI A;  3IC7 A;  4L9V A;  4XRF A;  2EV0 A;  2E7X A;  3LA2 A;  1J75 A;  3WTT C;  2EFQ A;  2XV4 S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...