4UY8I

Molecular basis for the ribosome functioning as a l-tryptophan sensor - cryo-em structure of a tnac stalled e.coli ribosome
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
141
structure length
141
Chain Sequence
b'AKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEKGLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKISRAQLQEIAQTKAADMTGADIEAMTRSIEGTARSMGLVVED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S RIBOSOMAL PROTEIN L32
publication title Molecular Basis for the Ribosome Functioning as an L-Tryptophan Sensor.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 4uy8I02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 4uy8I01
3CCQI 3CC4I 5GADJ 3CC7I 2QEXI 1FOWA 1FOYA 4IO9F 1YIJI 4UY8I 3I56I 1YI2I 2H8WA 3CMEI 3CJRB 3CF5F 2FOWA 5DM6F 3CMAI 1VQLI 3J7ZI 2OTJI 1YJNI 2OTLI 3PIOF 1HC8A 2E36A 1S72I 4IOAF 3CJQB 1YJWI 3G4SI 1VQ7I 1VQNI 2K3FA 3CCUI 3CJSB 5GAHJ 1QA6A 1Y39A 2E34A 5DM7F 3CCSI 1YITI 3CCEI 3I55I 2ZJQF 2JQ7A 1WIBA 4V19K 3CCMI 3CCRI 2QA4I 1FOXA 1VQ4I 5GAEJ 3G71I 3CCLI 1VQ6I 1VQ5I 2NXNB 5GAGJ 2ZJRF 1ACIA 3CCJI 3PIPF 1YJ9I 3CCVI 3J7YJ 3CJTB 2E35A 3DLLF 2ZJPF 1YHQI 1VQMI 1MMSA 1VQ8I 3EGVB 1VQOI 1VQ9I 3CD6I 4IOCF 3G6EI 1VQKI 5JVGF 3CC2I 1VQPI
chains in the Genus database with same CATH superfamily
4EGYA 1R00A 2CW7A 3S32A 5GADJ 1IXRC 1ZR2A 3OYIA 3TO7A 1DQUA 2GIVA 2VQCA 2FD5A 1QVTA 2A05A 2CQXA 4XBFA 4HDUA 3CP8A 2IP2A 2M9HA 3I56I 2JJ7A 1YIJI 2GM4A 2QVOA 4A12A 2NYXA 2FA5A 2JVHA 1BI3A 5L3CA 2XC7A 3CJRB 3GCMA 3GTPJ 1QZZA 4XM3A 2LOOA 3K69A 4ZZLA 1KU9A 5J8FA 4PK4A 3S3MA 2DO7A 4NUBA 4KA4A 2FX0A 5JHFA 3RTRA 3ZN0A 3BWGA 6PAXA 1EKEA 3C3WA 2ESNA 3CMMA 4AC0A 4B47A 1VZ0A 3I0TA 4LIVA 5J47A 3GF2A 5ILUA 1QPMA 2E7XA 3DP7A 2CFXA 1NTCA 3J7ZI 2K3PA 3ASNH 5DUKA 2HZDA 1GXQA 1FT9A 3VYUB 1LB2A 3LA3A 2ADUA 3GTMJ 1AKHB 4CCLA 4E7HA 5ED4A 3FM3A 1OQYA 2XSDC 1NK3P 2W84A 1HBXG 5K7HA 3H5RA 2CQQA 1Z7LA 4X6AJ 3H3ZA 1B72A 3OY9A 1DGWY 2ZCWA 3I71A 1YJWI 2XPWA 4NC6A 2OZ6A 3K1PA 3OYGA 3E5UA 3H0GJ 5LFAA 3BROA 1IDYA 2XASA 3GWZA 2CUZA 2RAEA 3BG6A 3M1CA 1BIBA 1I6HJ 4RGUA 4BJTA 2GA2A 5E1WA 4B8XA 3KEOA 3CCEI 3QWLA 4JBAA 1BBYA 3FXKA 4QWQA 1WPKA 2A6EF 4D9JA 5F1JA 2DA4A 3HL2A 1HW1A 2DA5A 1IN7A 1GLNA 5FKKA 3FIWA 3ZQCA 1IDZA 3JSOA 2BVLA 5D4SA 1VQ4I 1A35A 2R0QC 1XN7A 3TEDA 1R6RA 3GLXA 3JTHA 5CVJA 4ZYAA 2ECCA 4A3MJ 1J7KA 2VE9A 1P4XA 2H6CA 2Y69H 1U5TA 2AQFA 2M0MA 1R1VA 3PNVA 3R61A 1V5FA 2BW3A 2PFBA 3GFMA 3W2WA 4LB6B 2CFOA 1JE8A 3IL2A 2STTA 3F8BA 2DDAA 2F6CA 1MNEA 3GTKJ 3OL3A 3EDPA 1ONVA 1OPCA 2FRHA 1OCOH 5E3OA 2DK8A 4XICA 1SVOA 3JRGA 2EFNA 2M3AA 5B3SH 1ON1A 3CD6I 3ZQ7A 1ZARA 3V42A 2Z5UA 3S2HJ 1V3FA 1Y1VJ 4E7JA 2L3DA 2OCCH 3BR0A 1FEXA 4LK0F 1FBUA 5F6FA 4XLPF 2LREA 3R0JA 3IAM2 3J7AO 2PI0A 4HEA2 1OFCX 2ZBKA 2M2EA 2AHQA 3BR1A 1X1CA 3HRSA 3DXJF 2QEXI 1FOWA 4BJ5C 5EJCA 4LB5A 3A0BC 2HYFA 5D8KB 3ZQLA 3OMYA 1W7PD 3GXOA 1J2XA 1YI2I 4Z6YA 2KFDA 3V7CA 2QQAA 1XGSA 3CF5F 3E5QA 3FXRA 5KNLA 3L2UA 1G2HA 3HGYA 2L02A 3TO6A 1UB9A 4XRMA 1FY7A 2TRTA 2O61A 4RAZA 3KP5A 5BQTA 4B43A 3EPZA 3DV8A 4FX4A 4DIQA 4L18B 3DPLC 1OCRH 3VWBA 1OCZH 5FKNA 2GXGA 3F0CA 3VFZA 1HW5A 1S7OA 1DP3A 2XDVA 1R5HA 5AIPA 3BQZA 3I59A 4CO8A 5E3NA 3FMRA 3W6JB 4JX6A 4U0VA 3PIOF 4PZJA 4I76A 3J7AY 2A5YB 3CP2A 1WJCA 1RRJA 3MKYB 4ESJA 3JRDA 3BJ6A 1PYVA 2EZLA 3D5SC 2ZXWH 2VQLA 1H9GA 4ASNA 2R7UA 5IPAA 1TWGJ 4KDPA 2L01A 3I53A 2V9KA 3IUOA 2ZJQF 1USTA 2NNNA 3Q0VA 1UHWA 4TV7A 4V19K 3G3ZA 5KAIC 1NG7A 3O2PE 2ME6A 1D1BA 5D5VB 1SD4A 2HQNA 3AG4H 1D1CA 2KMUA 3G71I 4W1UA 1ODDA 3K4NA 4OIQF 2Q2EA 4I99C 2LR8A 1RKTA 4I0AA 1E3PA 1XSVA 3FXMA 2E1MB 1FP2A 3IAS2 1ETWA 2E1MC 3HBLA 4MHGA 4B09A 2KLOA 1TTYA 2ZNZA 3BZKA 2OBPA 5BOXA 4FASD 3BCBA 3TMOA 4MEXF 1QZYA 2R7OA 3BP8A 1YHQI 2NVUB 3HGGA 1QNTA 1MJAA 1AA7A 1SFUA 2MYSA 2IA2A 4UB6C 3PJRA 2JRTA 5FO5A 5DTDA 2R5ZA 3H1CA 3H9QA 4IOCF 3E1SA 4M73A 5KVRA 2RV8A 3JRAA 1X3ZB 4A3DJ 3TW6A 3ZQHA 2KL4A 2W00A 1IO2A 3ERED 4EJTA 2DCEA 2KIUA 3E7LA 3X2QH 1TC3C 2BBYA 1K4TA 3CC4I 2QSFX 4I6ZA 1ETQA 1F5TA 2FU4A 2A6TA 2ESHA 5J3LA 1H0MA 5EZGA 4N4NB 1XGMA 3GEZA 1DPRA 1HDDC 1QVUA 4BY7J 1FP1D 5HLIA 1W36C 3MKLA 2AXLA 2R5YB 4E7LA 2AO9A 4HOBA 3K0LA 3OYKA 1HKSA 4ENKA 2PN6A 3C2HA 4XLEA 4KYWA 2A61A 3CQZJ 4HF0A 4BY1J 3HOWJ 3IH2A 1LFPA 4ETSA 2CUJA 1QQIA 2ZC2A 3M3YJ 4Q4ZF 1VQLI 3H92A 1BJAA 4M6VA 1DU0A 1MJ9A 1W5TA 3WU2C 5K7FA 3HOSA 2IBDA 1IRZA 5F0FA 2VUMJ 2EB7A 1BC8C 2OTLI 5H20A 4BBSJ 2E19A 1ZTRA 2IVMA 2HVSA 4XN0A 2YSRA 4KFCA 3AG2H 2F4OB 3W3CA 4XKWA 5E1ZB 1VQ7I 1XB4A 5CJ9A 5TRDA 3SEQA 3ABTA 1TP4A 3ZMUA 5K5OA 3SQNA 3NWSA 3HXLA 2DK5A 3VPRA 5LD2C 1IN4A 5HNFA 1JXSA 4Z2YA 2VBYA 4BACA 4DYRA 4CYCB 3IRRA 3T1BA 1B9MA 2VASA 1PP7U 3C18A 2RNGA 4EM0B 3GFJA 2DMUA 3HSRA 2JPCA 1IV8A 4HAMA 2ISYA 3CLQA 2DTRA 2F48A 2DBBA 3EUKL 5GAEJ 2LMDA 3HRMA 4IHSA 3FXUA 3JAMK 3M7GA 5FKMA 2AQEA 2HOAA 4R8HA 3QOEA 5F0CA 1G8XA 5H6RA 2E1CA 2QSGX 5GAGJ 3K70D 4R79A 2PMZA 1U5TB 4BEHB 4Y17A 4XKCA 4CCKA 2M1BA 2ZJPF 3GFIA 2L4MA 4LG0B 1TT0A 1DDNA 5E8IA 2LF7A 5FLXK 2M30A 4J01A 2VOPA 2HPIA 1KU2A 4ZDPA 4BHBA 2X6XA 4RB1A 3S16J 2LDUA 3T5XA 4C2TA 5M5XJ 3RZOJ 2MD5A 1W0TA 3QYBA 4WCGA 3DQVC 3HEFA 1TT5B 3U1KA 1AOYA 1A6IA 4XLCA 2KRHA 1Z6TA 3JSPA 3LSMA 3C1DA 3BPVA 3U21A 4MGRA 4YIIA 3SEZA 2HOEA 1XMKA 1KYZA 3I3LA 3FISA 3HOTA 2H8WA 5J1UA 4MNUA 2VONA 1K83J 2EA2A 2XUBA 2LKSA 4MQ9F 4UUTA 1REPC 2OC6A 1SFOJ 3RKWA 2B7EA 3IHUA 1Y6IA 2F4IA 3HPHA 2NVQJ 4II3A 4JP0A 3D5RC 4EJOA 2DA3A 2XKOA 2M5WA 2ZMEB 2BHZA 3L2CA 2CV1A 4Q5SF 2ZMEC 1BR1A 3K6GA 3S14J 1BA5A 3WHBA 2Z16A 4XRSG 1S8NA 2Z99A 3NWTA 4W97A 3BCAA 4LFUA 4BGDA 4DW6A 2DPUA 3I4MJ 3OYNA 4I0BA 1FTTA 4EJUA 4F91B 3ECOA 1S9HA 2FE3A 1X3UA 2LY2A 3NAUA 5CVVA 3PO2J 1J0RA 4PUSA 1QGPA 2XB5A 3RYPA 3CJQB 4NB5A 4IVNA 1RUNA 1WFXA 1Z9CA 3VDXA 3E97A 3G4SI 5ILSA 2AS5F 3PL8A 2MBFA 3MVPA 1IXCA 4BXFA 4HNUA 3E6BA 4B4CA 4A3EJ 1GXPA 3GUDA 1ZGAA 4ZDLA 2DLLA 2KDOA 3ZQQA 3BR5A 2CYYA 4EVIA 1AKHA 3WTUC 2XAFA 3L00A 2LY9A 2MC4A 2A69F 3RQIA 5EG0B 1G3SA 5FROA 2PX9A 2GXAA 2FJ1A 2COMA 1GVDA 1HQCA 3ONQA 2CO5A 2VKEA 4BQAA 5IY5H 3SZTA 3F8FA 1YIOA 2EH3A 2VBXA 2XAJA 2WA0A 3M8FA 3QAHA 2L0KA 2VKVA 3SFZA 2KZGA 4IRHA 4EJWA 3RYRA 2RC4A 2D2WA 2ELKA 4AYBA 3CDHA 1WH5A 3CO7C 4V2FA 1YX3A 1EH6A 2K9SA 4BYYA 5DDGA 5AIQA 1Z6RA 4QTRA 2K7LA 4O6JA 2BV6A 2QGUA 3AFHA 1A31A 1R1UA 2V4JC 4KIBA 2XF6A 1Z1DA 4IHTA 4YEJA 1O7LA 2BHYA 4L5IA 4CCMA 4E4HA 2JA7J 2ICWG 2DAOA 4XLNF 2KISA 1GV2A 2KP6A 4OAZA 3TBIA 5KK1A 4H0EA 2GLOA 3NQOA 2OA4A 3S15J 1N75A 1Z3YA 2VBWA 1E17A 1J09A 1R49A 2EFOA 4NBQA 2IA0A 1CGPA 1JKOC 2LKPA 1Y0UA 3L9FA 4UV9A 1VI0A 2M8GX 2XSJC 2M0CA 4G6QA 4B44A 4C3IJ 4CA0A 4EATA 4BHPA 1EH7A 1Y1WJ 5ERIA 1U3EM 4AIDA 3CMAI 4C2UA 4XLFA 4EJVA 4XORA 2VT2A 4P9UA 1IW7F 4ZJZA 2WY8Q 3LL7A 3WU1B 3KLNA 4WXDA 1YJNI 1DUXC 4BU2A 3FWEA 4AM3A 1WHUA 2FXAA 5E1XA 4BS9A 2LC2A 2K5CA 1F36A 1K79A 5A2QK 3IRQA 1B1BA 5FKLA 3K4JA 3OS0A 1V5GA 1G6NA 5JHUA 1K61A 1YOVB 1RR7A 3SZPA 3H5AA 3LSGA 5IYDJ 3E6MA 4CDGA 1MDMB 1ZQ3P 2HYGD 2DA7A 3BZ6A 1YITI 2X1DA 3VEPA 2FUG2 3I5UA 2GAUA 1SD7A 2VC1A 4PSXA 2OV7A 3LSHA 3MMYB 2I8DA 3KYLA 2IXSA 5C3EJ 1T2KA 2FBIA 1T0FC 2DU9A 1Y8QB 2HYJA 5B1AH 4AD9A 4RM3A 1QZEA 4IHXA 1BR2A 4IEJA 3F8CA 3IP4B 4HLXA 3F6VA 5EEHA 1KU7A 2E35A 5H6QA 4FT8A 3S8PA 5GPCA 1T39A 1O7FA 3KCCA 3M9AA 1MKMA 3FMQA 2QKMB 2XPVA 3BQYA 3R4KA 3FXLA 5M5WJ 3RI4A 3HSFA 4LLLA 2EZHA 2I10A 3HHGA 4M9SA 5B1BH 1WJBA 1F9NA 3UR3C 3LNQA 2CV2A 4WK8F 3K4LA 4KUMA 4ZTJA 3CUQB 1XPXA 3DTEA 2BE5F 3CUQC 3FX3A 1OLTA 2JA8J 4XIDA 1MW7A 3N05A 5K5QA 4S04A 3M1EA 1YE9A 5J4YA 1AWCA 3ZPLA 1I1GA 2M4GA 2FEZA 1YRNA 1IRGA 2LG4A 4I7HA 4E7SA 1FBQA 4LOCA 1MBJA 3F9KA 4AIJA 4DBRA 4YIRX 1UHSA 2VL8A 3BG9A 3P7NA 4H4KC 4RAYA 3L1PA 2X0LA 2KJCA 2R7FA 3FXQA 3PNTA 1V55H 3IKTA 3PFIA 1ZLJA 2EZIA 3WHCA 3GX4X 1MGTA 1HCRA 4NC7A 1O3SA 2OZUA 2JVGA 2XAHA 2K02A 4KJZA 3GTOJ 2OTJI 4F93B 2R5YA 1UHMA 1RKWA 3KLOA 4GO1A 5DCMA 1ERDA 3MCZA 5FB2A 2V1NA 4B3AA 3JRHA 5LEJA 2TDXA 1ZAOA 2JSPA 2H8RA 5LHGA 2QQBA 2EFQA 5BPIA 3PQJA 1O3QA 2RREA 4HW0A 4QSHA 3RIRA 1HOMA 4JOMA 2RN7A 4MFEA 2O5RA 3I58A 2JN6A 5E20A 2E34A 3FBIB 4CXFA 3ABMH 4HPQA 3MQ0A 2RKHA 3ULQB 2QUFA 3A0HC 1OCCH 3V4GA 1W36D 1KA8A 3WGHA 4AIKA 4UVBA 4Q48A 1GVJA 3HKZA 3DEWA 4NQWB 1Z21A 1ACIA 1JHFA 2ZSHB 4OMZA 3LA2A 1YJ9I 4CYCA 5H2FC 3J7YJ 3PFYA 4GRIA 3G73A 2FBHA 2X1EA 4LJZF 4YELA 4AU7A 1MMSA 2O0YA 5FRMA 3RKYA 2YU9J 2YU3A 3WTYC 4RLFA 2DTZA 2D1HA 4OIRF 2EK5A 4LG3A 1LE8B 2YS9A 3ZMSA 5E8GA 4C2MJ 4D1QA 4UHTA 3SZGA 2DN0A 2DFEA 4IQ4A 1G3YA 1JKRC 1FIAA 3CC2I 4A69C 2DMNA 3C2BA 1W4MA 1X58A 1UJ8A 3Q0WA 2XROA 4G12A 4BEHA 4OIOF 4Y52J 1XDSA 3CCQI 2HDCA 2HGCA 2L7ZA 2H6BA 2O3FA 3IWFA 4XKBA 1MD0A 3V7SA 4LG0A 3LOCA 4RLQA 1FYMA 2DT5A 4HQMA 2I5UA 2KRFA 2IS2A 2HS5A 3OOPA 2LY1A 2K85A 3BPXA 1HSJA 2KZVA 3OSFA 3FZVA 1FZPB 1IG7A 3D5LA 1ITYA 1FSEA 1ZG1A 4OIPF 2TCTA 2KQRA 1ETKA 2EIMH 2VPRA 4O5VA 1JJ8C 2ETHA 2A68F 2K9NA 5JLWA 1QHGA 5B66C 2BY2A 2KIFA 5DM6F 4FTHA 2UV1A 4GDFA 3FMSA 2L2OA 5J8CA 5HLGA 4OMYA 1X4PA 3KEYA 2J5OA 1WZ2A 1S3JA 2LRDA 3PSIA 2IPQX 1IN6A 2OJED 2WC2A 2KPMA 2XPUA 2LSOA 3K2AA 4C3JJ 1P4WA 2V79A 2ZFUA 1YW8A 3S17J 3A02A 1UZCA 1WQ2A 3COAC 3AG1H 2E36A 1HSTA 1YLFA 4XQFA 1OKRA 2G9WA 1I3QJ 4NNJA 2WWYA 3AL0B 4CZZA 2ZMEA 4RMNA 3AL0C 2VQHA 4LD5A 1J59A 1LEBA 5L3EA 3OSGA 3UKGA 2G7UA 4HV6A 2P7VB 5D8LB 1RC9A 2EIJH 5L3BA 4AVZA 3GW2A 3ZR8X 3I55I 2MA3A 3DKXA 4MTDA 1WIBA 2JUGA 1NG6A 3MZ8A 1ZREA 2ZXIA 4F7ZA 2RQPA 1UAAA 2XB0X 4HQEA 5EYRA 1ZR4A 4EMSA 4RB2C 4DJAA 1MNDA 1VQ5I 4K2EA 1T38A 3F6OA 4Y3OA 3RSNA 1ZRCA 1JGGA 1OCTC 2NVXJ 1W0UA 3HTSB 1YX5A 4BBRJ 3OYCA 5HDNA 3BZCA 1R5ID 4YFKF 1RNLA 5DS9A 2E2JJ 3OIQA 2O9LA 2G0EA 1F43A 4ESFA 2Z3YA 3FM5A 1EJ9A 5EG0A 2V7FA 1BR4A 4QPOA 2PEXA 2O03A 2XKPA 1G59A 3QPSA 3ZMTA 3BR2A 5HDGA 4A3BJ 4PJLA 2KHMA 2VODA 3O8HA 2EV5A 1LFUP 2XRLA 5JVGF 1ENHA 1K6OA 2P5LC 3HPGA 2EV0A 3EUHC 4CHUA 1K78B 2EWNA 1LDKB 1ZELA 5EF6A 1JTYA 2Y31A 2R7XA 2RVCA 1XS9A 1IN8A 1LDDA 1H8AC 5IT9Z 1Z0XA 2GWRA 2HDWA 1SVMA 1XG1A 3OYBA 1XGOA 1JJ6C 5CQGA 3FKIJ 2OD5A 2O8KA 1VNDA 2DJIA 3NRVA 1QPIA 2JSCA 2XGDA 4IRIA 1ZLKA 2M7AA 4A3GJ 1SFKA 2QQ9A 3P9CA 4A5MA 3W6KB 2MW8A 3GZ5A 5DCFA 4G6TB 1YYVA 2YUSA 4M71A 4EEFG 3DBHB 2PMHA 3SXYA 1P9QC 2XRNA 3J80Z 3N97A 3DWLE 1GDTA 4XRSA 1N78A 4ZYGA 1YRNB 2MH2A 3QOPA 2F4MB 2L7FP 4A3FJ 3GTGJ 2ZJ2A 4DZPA 2BOLA 2JTVA 2GOXB 2Y9YA 1DPUA 4YFXF 2IS1A 2CQNA 2W25A 5HODA 2E1NA 3GZ6A 3IV5A 4FE4A 4PJJA 1XC5A 3IH3A 3WU0A 1JUMA 3PM1A 4RAFA 1Q1HA 3BJAA 3ZQFA 3R60A 3KE2A 4WXHA 4XMYA 5E3LA 1BI2A 2VQGA 3B6CA 1D5YA 4U0WA 3CDLA 3AG3H 5DCMB 4A5NA 4ENMA 1RUOA 4MIMA 2QF7A 4UVCA 1IRXA 1YS6A 1LPQA 3HYIA 1FPQA 3REOA 2Y0SA 2Z33A 4L0ZB 2R93J 1FTZA 2X9DA 4A0XA 3FHZA 3S93A 2E2IJ 2CMPA 3FHNA 5TISC 1ETOA 3S1RJ 4GFBA 2K40A 4CICA 1Z7UA 3H9JA 5EGOB 4Y4RA 5FD5A 2X6WA 2DMQA 1WGXA 4UXNA 3JRFA 1FYKA 3LMMA 1ZGWA 1VQ6I 2F5CA 4LMYA 1SD6A 4RB0A 2CGPA 3PO3J 2A5WA 1U78A 1ZRDA 1XCBA 3TP3A 1TQIA 4S05A 1H9TA 1MDMA 2C6YA 2XHKA 1I5ZA 3FDYA 1Z05A 2HTSA 4KN7X 2DFFA 2BY1A 4NC8A 4LLGF 1S5LC 2FQ4A 3W6VA 2P4WA 2PBIA 1MMNA 5L3GA 1O4XA 2ELJA 3A2KA 3UNGC 3KZYA 2GOMA 4GXOA 2DA2A 3LSTA 3EUAA 4E6KG 2BEOA 3CF2A 4BJ6C 1UCRA 1T0FA 4HX7A 5LLQA 4HRIA 2N8GA 4FE7A 3KIOA 4ZC3A 1LQ1A 1R71A 3B6AA 2EZKA 4CCNA 2H27A 1ETVA 3DEEA 5BNGA 3TDUC 3OYFA 3IWZA 2D1VA 4XSZF 4AVPA 4P96A 1ETYA 2Y30A 3RCOA 2WB1A 2GIZA 3OIOA 5IT3A 1HXDA 2VKHA 2YX4A 1ZHFA 2ZNYA 4PCQA 1USSA 4KT5C 3ZCOA 4QLCU 4I01A 4I02A 3PQKA 2LTPA 1TQMA 5DD8A 2NAZA 4JX5A 2V9VA 3PUFA 3E6CC 3OWTA 3BR3A 4A2UA 3DKYA 4L5JA 5D5WB 4PSWA 3K9TA 5CKTA 1XMXA 4HX8A 9ANTA 2DI3A 4J00A 2WV0A 2IS4A 3CUQA 1W7PB 2E2HJ 4EM2A 3QPHA 3K10A 1KQ9A 3K2ZA 2A07F 4UUVA 2CW0F 3W2VA 3G2BA 3LQRA 4M9ZA 2PLYA 2EV6A 2PG4A 4HZFA 5F08A 2LYCA 1WKMA 3H3VK 2MLGA 4FX0A 4I09A 3QPTA 3JCUC 1HLVA 3G1MA 1FOKA 3I4NJ 5DUIA 2QZ8A 2DJNA 2NOGA 3RQ4A 3KETA 3VYTB 2IGMA 4IOAF 1J75A 4DQ2A 2CH0A 1TWCJ 2P7CB 3ZQIA 2RGVA 3CCUI 4ENJA 1D8JA 3H3UA 1MBGA 4A0ZA 1FIPA 3Q9SA 5GAHJ 4BQQA 4D0PA 3DTIA 3R6SA 2J5PA 1KQ0A 3OV8A 4J19A 4C9YA 1I50J 3CLOA 1HKTA 1ORKA 3SYTA 2HQAA 2XV4S 4Y33A 3GTJJ 1X19A 4Q47A 3N4MA 1NH3A 2P6TA 3VB2A 2HDDA 3F8NA 1R22A 3HIFA 5BMZA 3BR6A 2O7OA 1POGA 3FF5A 1WCMJ 1D0ZA 3TO9A 1APLC 1IGNA 4D5CA 4PDKA 2H1LA 2CV0A 2HKXA 2F5DA 3RPQA 3TOBA 3Q5FA 4IRGA 3WG7H 4HDVA 1LFBA 4ZZDA 4D7MA 4U7DA 2LH9A 4WF2A 4M9XA 4XNFA 1SAUA 2IA1A 1OJLA 3KZIC 1SFEA 3CZ6A 4D7NA 1O3RA 2IT0A 2QBYB 2HOSA 2R4GA 3SDBA 1IAWA 2ID3A 2DA6A 4IF4A 4RDUA 3K4MA 1VQPI 4NQWA 1JI8A 3HJEA 2W24A 5F1RA 1QHHD 2K9LA 2V26A 3VSKA 4O3MA 2DT6A 4A93J 1X4OA 3LFUA 2W85A 4A3IJ 3M8JA 4WWCA 1LVAA 1MBKA 2OUMA 2LK2A 1IXSB 1BI0A 2ZKZA 3FXOA 4ZH4F 1TW3A 4AIHA 3KYCB 1DGRM 2DXIA 1LE8A 2DFIA 3OIPA 3F8MA 2EINH 5LGNA 1SD5A 4XKVA 2NS0A 1TNSA 2V6EA 2FOWA 4KISA 1TQPA 1FSHA 1OCPA 4E7ZA 1J9IA 2IRFG 1P6RA 1TBXA 3BTIA 3DEUA 5CPRB 3A1YA 1MJBA 2YX7A 3OOUA 3K7AJ 3ECHA 4IHWA 4BXXJ 3WTTC 2CWEA 2PMZN 5FFXA 2MFZA 2WY7Q 1HF0A 3LSIA 1RETA 4PGHA 2W48A 3RPUA 3MKZA 4LLNA 2QKLB 5HLHA 1S72I 1MBEA 2WAFA 1L3LA 3G1LA 2O6GE 1X1DA 2VB6A 3HC7A 3LA7A 1UG2A 4LGWA 3KX2A 5CVUA 3CJSB 2UXNA 2E1OA 2FMYA 3WTVC 1D5VA 4RAGA 4FCYA 5JR3A 3LAJA 1U9NA 4JYKA 3CCRI 4IZZA 1S7EA 3GTLJ 1R1TA 2LP0A 2ZFWA 2IGOA 1PP8F 2DPDA 4HSTA 2JA6J 4KMFA 1TWAJ 3K4KA 4MQVA 4EGZA 3PUBA 1D1AA 3ZOBA 2D5VA 1X1BA 1IN5A 1ZKGA 4E70A 2CQKA 3U1DA 1V54H 3D0SA 3CCJI 5E17F 2JZYA 3PIPF 3AKZA 5BPDA 1E0EA 3P9KA 1MMDA 4XOTA 5AONA 1MMGA 3MFKA 3RPUD 1PUEE 5IP6A 4F55A 2HEOA 1RZ4A 2W82A 3T0YA 3W2AA 4M3DA 1VQOI 1Z91A 1IUYA 1HKQA 3Q3SA 1VQKI 4IJAA 4BHCA 3L2VA 2X51A 2HWVA 1R9TJ 1B4AA 3FXJA 4LITA 2Y2ZA 2MG4A 3CDIA 4IKFA 5KHDA 1XCVA 1XDUA 3BOQA 2STWA 1TNTA 2K27A 2VN2A 2GQQA 3RKQA 1RPWA 1A5JA 3C7JA 2HZTA 4I98B 1FOYA 1JT0A 4UY8I 2B63J 3FK6A 2M87A 2ZSIB 3DPUA 2VBZA 3EUHA 2CRGA 4HG2A 2CU7A 3T8TA 4HF1A 1K78A 1LJ9A 1MNMC 3EYIA 4MLOA 1KQ8A 1LKXA 5BS6A 2OAZA 2L5QA 5EZHA 1S7AA 3C2GA 1BW6A 2HVQA 2JA2A 1CF7A 3JTGA 1WI9A 1AU7A 1T98A 1IF1A 1TWFJ 3EQLF 1FJLA 2L9RA 1B59A 1EV7A 1FWZA 2ZB9A 1GUUA 2JPBA 4N9HA 3MWMA 2M45A 1S6LA 1Z77A 1LEAA 2K9MA 1E2XA 2L7KA 1K4SA 1IUFA 2CQ7A 4BXUA 5E79C 2MSYA 3O8GA 5FFZA 4AYBN 2LD5A 2F2EA 3NARA 4G6DA 4V2GA 4GYGA 4QIWN 3OYDA 1BL0A 2XAGA 2MLKA 4DZJA 5D5UB 3S3NA 1CQTA 1TW2A 5DM7F 3CCSI 2H94A 3WGIA 1H88C 3BG3A 3ABUA 2L9VA 2VJ4A 3QYFA 4L9NA 5FJ8J 5HS8A 4XSXF 2Y9ZA 3CO6C 2HKOA 1IC8A 2W4SA 5M3MJ 4JK1X 5FKOA 5K1YA 1W5CC 2CSOA 3JRIA 1ETXA 4BE2A 1I1SA 4JX4A 1X3WB 1P4AA 5FGMA 2QYOA 3VSLA 2EQRA 5ILVA 1KGSA 3IC7A 3JW4A 3I64A 2W57A 4FISA 3ZP5A 1JUPA 3TOAA 2MGQA 3CJTB 5FRNA 2UUZA 3HB9A 5EGOA 2R7ZJ 4XLAA 2COBA 5IP9J 3J81Z 1BOBA 1MBHA 2FF4A 5M3FJ 3EGVB 4FHTA 5CVIA 5CQEA 1AHDP 5FLMJ 1Z3XA 4E7IA 4CCJA 3L2WA 1YG2A 4P9FA 2VXZA 4Y15A 1BJZA 3KP7A 5FD6A 2L4AA 4UNOA 1ULYA 3ASOH 3SJMA 4N9IA 4AWXB 2HQ5A 3BLYA 3PNYA 2EFWA 3MZYA 4HBLA 1XSDA 1B8IB 1OYYA 2VJJA 3HUGA 3DPTA 3BG7A 4UVAA 2PJPA 3JREA 1X1PA 3E5XA 2P5KA 5C4JJ 2XF5A 2Z2SB 2KJBA 2MD0A 3GBGA 4BL0B 3ELKA 3HHHA 3V8LA 3CJNA 2V1UA 3ABLH 5JFRA 3SDGA 4OINF 3JR9A 1C0WA 1ZGJA 3P9IA 3Q0UA 2DQLA 3HOVJ 2IS6A 4L9VA 5CYVA 1PUFB 1QBJA 1GHCA 4BUPA 4NHJA 3E6DA 3Q9VA 4EM1A 2X1CA 1HA8A 4BNCA 4UB8C 4A3CJ 3DBLB 3EYYA 5LGTA 3S2WA 3HOYJ 4ON0A 2R7VA 3BJOA 5M5YJ 5ICGA 2GBYA 3BG5A 3M8EA 2BYVE 1OYIA 4BQOA 4BQNA 3A03A 4ESBA 5HDKA 3FK7A 1RESA 1HW2A 4PJMA 1ZN2A 3QPLA 2LLKA 1W7PA 1YO5C 2BXYA 2UWMA 3CCYA 1JT6A 4F52A 2M4KA 2RNJA 4BE1A 3L2QA 1VQNI 2HVRA 2H1KA 4G7OF 2HOTA 4A3KJ 1IJWC 2LKXA 1P2FA 1FX7A 1WI3A 2VLAA 1TLHB 1MBFA 3U9GA 3EETA 1XTAA 2OQGA 2LF8A 3WGGA 1SC7A 3QU3A 2DOFA 4HX4A 1R4MB 3CMYA 2VOOA 4XR6A 1BOAA 2WADA 3WTSC 1BIAA 4NDLA 4RA2A 3ML6A 4E7KA 1T56A 3M07A 1OYWA 2FQ3A 2Q0OA 4BKXA 3AAFA 1MMAA 3GO5A 5J1YA 1NHAA 1PVEA 4OU0A 1BC7C 4YRVA 2DYRH 2F5VA 3DCFA 4FETA 2R7WA 4BE0A 5C4XJ 1Y8RB 4UUSB 4XLHA 4HLYA 2DODA 1H89C 2KRCA 2B0LA 3HSEA 3TW7A 3QU6A 4B1RA 2JK3A 3KEQA 2VJ5A 3DLLF 1T33A 4C3HJ 4ZYDA 3OYJA 3LSPA 2EBIA 2EA4A 4GCVA 3TDZC 1VQMI 3KZZA 3ERMA 3SFIA 1LUJB 2WV1A 1VQ9I 1MH4A 2LFBA 5J4VA 4OAYA 2DOAA 3E0JB 1B9NA 3ZXSA 2NRAC 3LAPA 3K1NA 3S3OA 1JTXA 4PJNA 3JRBA 4CSWA 1U8BA 4A3JJ 3MEXA 3GLLA 2KKOA 4P55A 4S0HB 4CH7A 1WJ5A 2R7DA 2R7RA 1ZRFA 5LEKA 2FNAA 5IP7J 2QBYA 4FQGA 1I3AA 1B6AA 2V1DA 2ISZA 2HU9A 5IT9K 3L7WA 3FBNB 4PFPA 1Y0NA 3H9GA 2ACJA 3QRFF 1R23A 4UV8A 2LBFB 2QSHX 1WVRA 2VIXA 2NVTJ 1R4NB 1ZK8A 1BW5A 1K6YA 4MFDA 3KPHA 4M72A 2WAQA 4YFNF 3OS1A 1TZLA 4GYIA 4XRFA 2VXDA 4G7ZF 5L3FA 1G3TA 2CG4A 1DP7P 3J80K 2HTJA 2V1XA 1MSFC 4AUXA 3OYMA 1CF7B 2KIMA 3HKZN 3OL4A 4KIFA 2Y0MA 1XSXA 2KT0A 1FLIA 3T8RA 5TJJA 1JHHA 5ICEA 1YS7A 3KFWX 1IRFA 2ELHA 4CYDA 2OU2A 4DGWB 3R0AA 3S1MJ 1HC8A 2PQ8A 2XIGA 4G8XA 4M6XA 4KICA 3F23A 4ZDOA 1U0JA 2X6YA 5LRRA 1R36A 2K86A 3GFLA 2WAEA 2JUCA 3P5JA 3HOXJ 4MEYF 2EJRA 1EA3A 4HNVA 3MN2A 2D45A 1FNNA 3NEUA 4L9JA 1O3TA 2X4HA 1SMYF 4IXAA 4Y13A 2HFHA 2HR3A 2E71A 5F0HA 4BDZA 4I2OA 2QLZA 2PJRB 5CVRA 2JQ7A 3DBRB 3CCMI 4ITVA 5DEQA 3M4OJ 3HM5A 3ZGKA 4ZYHA 2G7HA 4YG2F 3VYSB 3CCLI 4HNTA 2X85A 2NXNB 1Y56A 1D8KA 1I6XA 2F5FA 2UXXA 4B3XA 5E3MA 1JKQC 4M3BA 4U0YA 4IHYA 1Z67A 2L54A 1OR7C 3ROUA 1R5GA 2WBMA 1PDNC 3PSFA 2CUEA 1STZA 2PMUA 2NOJB 2E7WA 2XAUA 2Z9OA 2GA1A 2DMTA 2UZKA 2P8TA 5IOZA 3ESWB 2QENA 4HSRA 3GYHX 1G4DA 2P81A 1ZG5A 3LSKA 1RIOH 2XGXA 2P5VA 4PJ0C 4DBQA 1KU3A 4XN3A 3F72A 1SFXA 5F04A 2VT3A 3OR2C 2VJIA 3DLAA 3LSRA 3LFKA 3S1NJ 4PFOA 2EFPA 1YTYA 3VODA 5KCMA 3V7RA 3HUGB 5CLSA 1MZBA 1YW7A 2XF7A 3HRTA 2L7MP 2XVCA 4X1EA 3F21A 5ICFA 3I54A 1B72B 3WE3A 5EEAA 5C44J 2DA1A 1YQAA 1OMIA 4JQFA 3MAJA 4IL6C 4CZCA 2EIKH 3LSJA 4WX9A 1WRJA 3VYRB 5J40A 2X48A 3JRCA 2IGNA 1A04A 1S29A 5IOYA 5JLXA 2VE8A 1FMVA 4MTEA 4Y7NJ 4YIFA 5J1RA 4RBOA 3OS2A 2V9PA 3I9V2 2K4BA 2QCOA 3MD2A 4RGXA 4G7HF 2CJJA 4A6EA 3RZDJ 1MSEC 1D0YA 1SAXA 2M34A 2E5NA 3WG9A 3HTUA 3HOUJ 4G9YA 4WXCA 4CCOA 2E60A 1WH7A 2FNPA 5KAFC 2O8XA 1U5TC 3G1OA 1QA6A 2DOEA 3ABKH 2MABA 2BW3B 3WE2A 3JAMZ 2WAQN 3A01A 3KYDB 4MO7A 4DNCA 3DU6A 2IJLA 4DYCA 3TP0A 3K1MA 1VF9A 2QA4I 4B48A 3GMEA 4A0YA 2BVMA 2RQQA 4X0GA 4IQJA 4L9TA 1A36A 2Y48A 2HQRA 2OF7A 2Z1DA 1E3OC 2NNYA 2XAQA 1WJFA 3IH4A 5D6FA 4LIUA 1X2NA 2R7SA 2FOKA 1G3WA 5FLXZ 3ISPA 3WTXC 3MKWB 1DU6A 3TGNA 3CCVI 3D1NI 4GGGA 5F27A 3QQAA 3ZQGA 3WODF 1SMTA 1X2MA 5GTHC 3OYEA 4KIGA 5LBQA 2X6OA 3TKYA 5DD4A 2R7QA 3O6BB 5EEGA 1XX5A 2FBKA 2Q8KA 3G6EI 4P1WA 2V6CA 5IYBJ 3TL4X 3RJPA 4XOPA 4R1HA 5DYMA 2KDZA 1I27A 4M6YA 2DQRA 3V8JA 5K7ZA 4BDYA 4DYQA 4ENNA 5FLVA 3OYHA 1XD7A 4KN4X 3QP6A 1Q1VA 3CUOA 2XGEA 5D6EA 4G94A 1T95A 1QO0D 2CS3A 5LRSA 2Y0SN 4IO9F 4KT6A 5HOOA 3DU5A 2DMPA 1MIJA 3IKVA 5HS9A 3LWFA 2H09A 1KONA 3WTWC 3F3XA 1RI7A 2EILH 5HNHA 1T8IA 3I59B 1WJEA 1K7AA 3BY6A 3CTAA 3B02A 4QPQA 4HF2A 4OOIA 2LNBA 3BC8A 5EDNA 2BXZA 2IAIA 4U87A 3QP5A 1F1ZA 4N0BA 5JVTA 1B8IA 2DYSH 2OPTA 3H35A 5L3DA 4EV0A 3E3VA 2VI6A 2FSWA 4IPAA 4U88A 1WWXA 3S2DJ 4L0YB 1N77A 2VC0A 4IX7A 1HDPA 1BI1A 3S1QJ 1PUFA 2WTEA 2OCEA 4IHVA 4II2A 1D0XA 4LK1F 2Q2EB 3KP3A 4HA8A 5GP9A 4M3EA 5DV5A 1QRYA 2ID6A 5LGUA 2R92J 1Y39A 2DFHA 3U2RA 1V5EA 3BDDA 1PJRA 3L09A 3I4PA 2EPFA 4RS8A 2ECBA 1D3YA 1WSUA 2WB1N 1V4RA 2BY3A 2R7TA 4RGSA 1ZG3A 1ZYRF 2R5ZB 2NS8A 4XL9A 4EQQA 1SEUA 4OWRB 4M74A 4A6DA 2A6HF 4HV5A 3L2RA 1WJDA 1UG0A 2FMLA 2KIQA 3RKXA 5TGTA 2YPRA 2P0WA 5GPAA 2K9QA 5LHIA 1YFHA 4P5OA 5HVQC 1IV6A 2QWWA 3H36A 5J6XA 3DTKA 5F64A 4BAYA 5GTIC 4N4OB 1XMAA 3OR1C 2HI3A 1F4KA 2ZO4A 3BTLA 4D5FA 1VQ8I 4BH9A 3HZJA 2BGCA 3VOEA 2IEKA 2YR2A 2OQRA 5D5XB 3V8KA 1TL8A 3H5NA 1M1EB 4RB3C 1W5SA 2AXTC 4UUSA 4A3LJ 2Y75A 2GZWA 2W1OA 3O3KA 3CESA 1KZHA 1FMWA 2MC3A 2GXBA 3K4CA 3CC7I 1ZH5A 2BY0A 2LVSA 4PGGA 1TWHJ 2HXIA 4ZYEA 2VKDA 3HOZJ 4CUGA 1W1WE 2JMWA 2L9SA 4L5EA 1U8RA 3KP6A 2JA5J 2DDBA 2QQ8A 2P6SA 2R3SA 1O57A 5HS7A 3CMEI 3QYEA 3K70C 2M7BA 1R58A 3KP2A 2NVYJ 2XGCA 3ZRGA 1L0OC 5B5EC 4KITB 4ZTFA 3GVAA 2JWTA 2IW5A 2VPLA 1ON2A 2A3SA 4M3FA 2ZXHA 1A6QA 1JUSA 1NK2P 1U9OA 3H0DA 2F5EA 1JGSA 4CGZA 2M8EA 3GZNB 1P7IA 3K4BA 3DKWA 3HG9A 1X1AA 3TQNA 5A2QZ 4ABZA 3BT9A 1GT0C 2HXOA 3BTCA 4HYEA 5HLTA 3LQQA 1UMQA 3DFGA 3GTQJ 1RR8C 4KMUX 1SVLA 2LBFA 1P92A 3ZN1A 1BN5A 5K5RA 2RDPA 1LNWA 2MH9A 1VTNC 2HNHA 3WTZA 3KP4A 1EF4A 3BTJA 1I39A 1MH3A 3B73A 3FKJA 2K3FA 5D4RA 1U6GA 1YW9A 2CW8A 4XONA 3QODA 1SANA 4ANJA 1XGNA 2IGKA 1E3HA 4M3GA 1VFCA 4F3QA 2NS7A 1U2WA 4F92B 3HDDA 1LVKA 1P7JA 1FOXA 3A01B 1UFMA 1WJAA 3F22A 1GV5A 2ME0A 1IZ1A 2DW4A 2W7NA 2CUFA 1QU3A 3MZHA 3OYAA 2ZJRF 5LHHA 2BZTA 2L9NA 5JI6A 2Q1ZB 2E5ZA 3A4CA 1R7JA 2PJRA 4RM2A 1T08B 2ZXJA 1FC3A 2JRMA 1LDJA 4DOZA 1KYWA 4KNYA 1EH8A 1BM9A 5IYCJ 3SHFA 1OISA 4RGRA 1J5YA 1UELB 3DF8A 2B9SA 2JT1A 1T6SA 1FYLA 2DT7B 2K4JA 1FBSA 4XK4A 2HPMA 3ZMDA 5E18F 3OYLA 3ZMZA 3ZMVA 4U7BA 1OR7A 1JKPC 4C30A 1N25A 3J81K 5ICCA 3RDIA 2QM3A 3HRUA
chains in the Genus database with same CATH topology
3CCQI 3CC4I 5GADJ 3CC7I 2QEXI 1FOWA 1FOYA 4IO9F 1YIJI 4UY8I 3I56I 1YI2I 2H8WA 3CMEI 3CJRB 3CF5F 2FOWA 5DM6F 3CMAI 1VQLI 3J7ZI 2OTJI 1YJNI 2OTLI 3PIOF 1HC8A 2E36A 1S72I 4IOAF 3CJQB 1YJWI 3G4SI 1VQ7I 1VQNI 2K3FA 3CCUI 3CJSB 5GAHJ 1QA6A 1Y39A 2E34A 5DM7F 3CCSI 1YITI 3CCEI 3I55I 2ZJQF 2JQ7A 1WIBA 4V19K 3CCMI 3CCRI 2QA4I 1FOXA 1VQ4I 5GAEJ 3G71I 3CCLI 1VQ6I 1VQ5I 2NXNB 5GAGJ 2ZJRF 1ACIA 3CCJI 3PIPF 1YJ9I 3CCVI 3J7YJ 3CJTB 2E35A 3DLLF 2ZJPF 1YHQI 1VQMI 1MMSA 1VQ8I 3EGVB 1VQOI 1VQ9I 3CD6I 4IOCF 3G6EI 1VQKI 5JVGF 3CC2I 1VQPI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCQ I;  3CC4 I;  5GAD J;  3CC7 I;  2QEX I;  1FOW A;  1FOY A;  4IO9 F;  1YIJ I;  4UY8 I;  3I56 I;  1YI2 I;  2H8W A;  3CME I;  3CJR B;  3CF5 F;  2FOW A;  5DM6 F;  3CMA I;  1VQL I;  3J7Z I;  2OTJ I;  1YJN I;  2OTL I;  3PIO F;  1HC8 A;  2E36 A;  1S72 I;  4IOA F;  3CJQ B;  1YJW I;  3G4S I;  1VQ7 I;  1VQN I;  2K3F A;  3CCU I;  3CJS B;  5GAH J;  1QA6 A;  1Y39 A;  2E34 A;  5DM7 F;  3CCS I;  1YIT I;  3CCE I;  3I55 I;  2ZJQ F;  2JQ7 A;  1WIB A;  4V19 K;  3CCM I;  3CCR I;  2QA4 I;  1FOX A;  1VQ4 I;  5GAE J;  3G71 I;  3CCL I;  1VQ6 I;  1VQ5 I;  2NXN B;  5GAG J;  2ZJR F;  1ACI A;  3CCJ I;  3PIP F;  1YJ9 I;  3CCV I;  3J7Y J;  3CJT B;  2E35 A;  3DLL F;  2ZJP F;  1YHQ I;  1VQM I;  1MMS A;  1VQ8 I;  3EGV B;  1VQO I;  1VQ9 I;  3CD6 I;  4IOC F;  3G6E I;  1VQK I;  5JVG F;  3CC2 I;  1VQP I; 
#chains in the Genus database with same CATH topology
 4EGY A;  1R00 A;  2CW7 A;  3S32 A;  5GAD J;  1IXR C;  1ZR2 A;  3OYI A;  3TO7 A;  1DQU A;  2GIV A;  2VQC A;  2FD5 A;  1QVT A;  2A05 A;  2CQX A;  4XBF A;  4HDU A;  3CP8 A;  2IP2 A;  2M9H A;  3I56 I;  2JJ7 A;  1YIJ I;  2GM4 A;  2QVO A;  4A12 A;  2NYX A;  2FA5 A;  2JVH A;  1BI3 A;  5L3C A;  2XC7 A;  3CJR B;  3GCM A;  3GTP J;  1QZZ A;  4XM3 A;  2LOO A;  3K69 A;  4ZZL A;  1KU9 A;  5J8F A;  4PK4 A;  3S3M A;  2DO7 A;  4NUB A;  4KA4 A;  2FX0 A;  5JHF A;  3RTR A;  3ZN0 A;  3BWG A;  6PAX A;  1EKE A;  3C3W A;  2ESN A;  3CMM A;  4AC0 A;  4B47 A;  1VZ0 A;  3I0T A;  4LIV A;  5J47 A;  3GF2 A;  5ILU A;  1QPM A;  2E7X A;  3DP7 A;  2CFX A;  1NTC A;  3J7Z I;  2K3P A;  3ASN H;  5DUK A;  2HZD A;  1GXQ A;  1FT9 A;  3VYU B;  1LB2 A;  3LA3 A;  2ADU A;  3GTM J;  1AKH B;  4CCL A;  4E7H A;  5ED4 A;  3FM3 A;  1OQY A;  2XSD C;  1NK3 P;  2W84 A;  1HBX G;  5K7H A;  3H5R A;  2CQQ A;  1Z7L A;  4X6A J;  3H3Z A;  1B72 A;  3OY9 A;  1DGW Y;  2ZCW A;  3I71 A;  1YJW I;  2XPW A;  4NC6 A;  2OZ6 A;  3K1P A;  3OYG A;  3E5U A;  3H0G J;  5LFA A;  3BRO A;  1IDY A;  2XAS A;  3GWZ A;  2CUZ A;  2RAE A;  3BG6 A;  3M1C A;  1BIB A;  1I6H J;  4RGU A;  4BJT A;  2GA2 A;  5E1W A;  4B8X A;  3KEO A;  3CCE I;  3QWL A;  4JBA A;  1BBY A;  3FXK A;  4QWQ A;  1WPK A;  2A6E F;  4D9J A;  5F1J A;  2DA4 A;  3HL2 A;  1HW1 A;  2DA5 A;  1IN7 A;  1GLN A;  5FKK A;  3FIW A;  3ZQC A;  1IDZ A;  3JSO A;  2BVL A;  5D4S A;  1VQ4 I;  1A35 A;  2R0Q C;  1XN7 A;  3TED A;  1R6R A;  3GLX A;  3JTH A;  5CVJ A;  4ZYA A;  2ECC A;  4A3M J;  1J7K A;  2VE9 A;  1P4X A;  2H6C A;  2Y69 H;  1U5T A;  2AQF A;  2M0M A;  1R1V A;  3PNV A;  3R61 A;  1V5F A;  2BW3 A;  2PFB A;  3GFM A;  3W2W A;  4LB6 B;  2CFO A;  1JE8 A;  3IL2 A;  2STT A;  3F8B A;  2DDA A;  2F6C A;  1MNE A;  3GTK J;  3OL3 A;  3EDP A;  1ONV A;  1OPC A;  2FRH A;  1OCO H;  5E3O A;  2DK8 A;  4XIC A;  1SVO A;  3JRG A;  2EFN A;  2M3A A;  5B3S H;  1ON1 A;  3CD6 I;  3ZQ7 A;  1ZAR A;  3V42 A;  2Z5U A;  3S2H J;  1V3F A;  1Y1V J;  4E7J A;  2L3D A;  2OCC H;  3BR0 A;  1FEX A;  4LK0 F;  1FBU A;  5F6F A;  4XLP F;  2LRE A;  3R0J A;  3IAM 2;  3J7A O;  2PI0 A;  4HEA 2;  1OFC X;  2ZBK A;  2M2E A;  2AHQ A;  3BR1 A;  1X1C A;  3HRS A;  3DXJ F;  2QEX I;  1FOW A;  4BJ5 C;  5EJC A;  4LB5 A;  3A0B C;  2HYF A;  5D8K B;  3ZQL A;  3OMY A;  1W7P D;  3GXO A;  1J2X A;  1YI2 I;  4Z6Y A;  2KFD A;  3V7C A;  2QQA A;  1XGS A;  3CF5 F;  3E5Q A;  3FXR A;  5KNL A;  3L2U A;  1G2H A;  3HGY A;  2L02 A;  3TO6 A;  1UB9 A;  4XRM A;  1FY7 A;  2TRT A;  2O61 A;  4RAZ A;  3KP5 A;  5BQT A;  4B43 A;  3EPZ A;  3DV8 A;  4FX4 A;  4DIQ A;  4L18 B;  3DPL C;  1OCR H;  3VWB A;  1OCZ H;  5FKN A;  2GXG A;  3F0C A;  3VFZ A;  1HW5 A;  1S7O A;  1DP3 A;  2XDV A;  1R5H A;  5AIP A;  3BQZ A;  3I59 A;  4CO8 A;  5E3N A;  3FMR A;  3W6J B;  4JX6 A;  4U0V A;  3PIO F;  4PZJ A;  4I76 A;  3J7A Y;  2A5Y B;  3CP2 A;  1WJC A;  1RRJ A;  3MKY B;  4ESJ A;  3JRD A;  3BJ6 A;  1PYV A;  2EZL A;  3D5S C;  2ZXW H;  2VQL A;  1H9G A;  4ASN A;  2R7U A;  5IPA A;  1TWG J;  4KDP A;  2L01 A;  3I53 A;  2V9K A;  3IUO A;  2ZJQ F;  1UST A;  2NNN A;  3Q0V A;  1UHW A;  4TV7 A;  4V19 K;  3G3Z A;  5KAI C;  1NG7 A;  3O2P E;  2ME6 A;  1D1B A;  5D5V B;  1SD4 A;  2HQN A;  3AG4 H;  1D1C A;  2KMU A;  3G71 I;  4W1U A;  1ODD A;  3K4N A;  4OIQ F;  2Q2E A;  4I99 C;  2LR8 A;  1RKT A;  4I0A A;  1E3P A;  1XSV A;  3FXM A;  2E1M B;  1FP2 A;  3IAS 2;  1ETW A;  2E1M C;  3HBL A;  4MHG A;  4B09 A;  2KLO A;  1TTY A;  2ZNZ A;  3BZK A;  2OBP A;  5BOX A;  4FAS D;  3BCB A;  3TMO A;  4MEX F;  1QZY A;  2R7O A;  3BP8 A;  1YHQ I;  2NVU B;  3HGG A;  1QNT A;  1MJA A;  1AA7 A;  1SFU A;  2MYS A;  2IA2 A;  4UB6 C;  3PJR A;  2JRT A;  5FO5 A;  5DTD A;  2R5Z A;  3H1C A;  3H9Q A;  4IOC F;  3E1S A;  4M73 A;  5KVR A;  2RV8 A;  3JRA A;  1X3Z B;  4A3D J;  3TW6 A;  3ZQH A;  2KL4 A;  2W00 A;  1IO2 A;  3ERE D;  4EJT A;  2DCE A;  2KIU A;  3E7L A;  3X2Q H;  1TC3 C;  2BBY A;  1K4T A;  3CC4 I;  2QSF X;  4I6Z A;  1ETQ A;  1F5T A;  2FU4 A;  2A6T A;  2ESH A;  5J3L A;  1H0M A;  5EZG A;  4N4N B;  1XGM A;  3GEZ A;  1DPR A;  1HDD C;  1QVU A;  4BY7 J;  1FP1 D;  5HLI A;  1W36 C;  3MKL A;  2AXL A;  2R5Y B;  4E7L A;  2AO9 A;  4HOB A;  3K0L A;  3OYK A;  1HKS A;  4ENK A;  2PN6 A;  3C2H A;  4XLE A;  4KYW A;  2A61 A;  3CQZ J;  4HF0 A;  4BY1 J;  3HOW J;  3IH2 A;  1LFP A;  4ETS A;  2CUJ A;  1QQI A;  2ZC2 A;  3M3Y J;  4Q4Z F;  1VQL I;  3H92 A;  1BJA A;  4M6V A;  1DU0 A;  1MJ9 A;  1W5T A;  3WU2 C;  5K7F A;  3HOS A;  2IBD A;  1IRZ A;  5F0F A;  2VUM J;  2EB7 A;  1BC8 C;  2OTL I;  5H20 A;  4BBS J;  2E19 A;  1ZTR A;  2IVM A;  2HVS A;  4XN0 A;  2YSR A;  4KFC A;  3AG2 H;  2F4O B;  3W3C A;  4XKW A;  5E1Z B;  1VQ7 I;  1XB4 A;  5CJ9 A;  5TRD A;  3SEQ A;  3ABT A;  1TP4 A;  3ZMU A;  5K5O A;  3SQN A;  3NWS A;  3HXL A;  2DK5 A;  3VPR A;  5LD2 C;  1IN4 A;  5HNF A;  1JXS A;  4Z2Y A;  2VBY A;  4BAC A;  4DYR A;  4CYC B;  3IRR A;  3T1B A;  1B9M A;  2VAS A;  1PP7 U;  3C18 A;  2RNG A;  4EM0 B;  3GFJ A;  2DMU A;  3HSR A;  2JPC A;  1IV8 A;  4HAM A;  2ISY A;  3CLQ A;  2DTR A;  2F48 A;  2DBB A;  3EUK L;  5GAE J;  2LMD A;  3HRM A;  4IHS A;  3FXU A;  3JAM K;  3M7G A;  5FKM A;  2AQE A;  2HOA A;  4R8H A;  3QOE A;  5F0C A;  1G8X A;  5H6R A;  2E1C A;  2QSG X;  5GAG J;  3K70 D;  4R79 A;  2PMZ A;  1U5T B;  4BEH B;  4Y17 A;  4XKC A;  4CCK A;  2M1B A;  2ZJP F;  3GFI A;  2L4M A;  4LG0 B;  1TT0 A;  1DDN A;  5E8I A;  2LF7 A;  5FLX K;  2M30 A;  4J01 A;  2VOP A;  2HPI A;  1KU2 A;  4ZDP A;  4BHB A;  2X6X A;  4RB1 A;  3S16 J;  2LDU A;  3T5X A;  4C2T A;  5M5X J;  3RZO J;  2MD5 A;  1W0T A;  3QYB A;  4WCG A;  3DQV C;  3HEF A;  1TT5 B;  3U1K A;  1AOY A;  1A6I A;  4XLC A;  2KRH A;  1Z6T A;  3JSP A;  3LSM A;  3C1D A;  3BPV A;  3U21 A;  4MGR A;  4YII A;  3SEZ A;  2HOE A;  1XMK A;  1KYZ A;  3I3L A;  3FIS A;  3HOT A;  2H8W A;  5J1U A;  4MNU A;  2VON A;  1K83 J;  2EA2 A;  2XUB A;  2LKS A;  4MQ9 F;  4UUT A;  1REP C;  2OC6 A;  1SFO J;  3RKW A;  2B7E A;  3IHU A;  1Y6I A;  2F4I A;  3HPH A;  2NVQ J;  4II3 A;  4JP0 A;  3D5R C;  4EJO A;  2DA3 A;  2XKO A;  2M5W A;  2ZME B;  2BHZ A;  3L2C A;  2CV1 A;  4Q5S F;  2ZME C;  1BR1 A;  3K6G A;  3S14 J;  1BA5 A;  3WHB A;  2Z16 A;  4XRS G;  1S8N A;  2Z99 A;  3NWT A;  4W97 A;  3BCA A;  4LFU A;  4BGD A;  4DW6 A;  2DPU A;  3I4M J;  3OYN A;  4I0B A;  1FTT A;  4EJU A;  4F91 B;  3ECO A;  1S9H A;  2FE3 A;  1X3U A;  2LY2 A;  3NAU A;  5CVV A;  3PO2 J;  1J0R A;  4PUS A;  1QGP A;  2XB5 A;  3RYP A;  3CJQ B;  4NB5 A;  4IVN A;  1RUN A;  1WFX A;  1Z9C A;  3VDX A;  3E97 A;  3G4S I;  5ILS A;  2AS5 F;  3PL8 A;  2MBF A;  3MVP A;  1IXC A;  4BXF A;  4HNU A;  3E6B A;  4B4C A;  4A3E J;  1GXP A;  3GUD A;  1ZGA A;  4ZDL A;  2DLL A;  2KDO A;  3ZQQ A;  3BR5 A;  2CYY A;  4EVI A;  1AKH A;  3WTU C;  2XAF A;  3L00 A;  2LY9 A;  2MC4 A;  2A69 F;  3RQI A;  5EG0 B;  1G3S A;  5FRO A;  2PX9 A;  2GXA A;  2FJ1 A;  2COM A;  1GVD A;  1HQC A;  3ONQ A;  2CO5 A;  2VKE A;  4BQA A;  5IY5 H;  3SZT A;  3F8F A;  1YIO A;  2EH3 A;  2VBX A;  2XAJ A;  2WA0 A;  3M8F A;  3QAH A;  2L0K A;  2VKV A;  3SFZ A;  2KZG A;  4IRH A;  4EJW A;  3RYR A;  2RC4 A;  2D2W A;  2ELK A;  4AYB A;  3CDH A;  1WH5 A;  3CO7 C;  4V2F A;  1YX3 A;  1EH6 A;  2K9S A;  4BYY A;  5DDG A;  5AIQ A;  1Z6R A;  4QTR A;  2K7L A;  4O6J A;  2BV6 A;  2QGU A;  3AFH A;  1A31 A;  1R1U A;  2V4J C;  4KIB A;  2XF6 A;  1Z1D A;  4IHT A;  4YEJ A;  1O7L A;  2BHY A;  4L5I A;  4CCM A;  4E4H A;  2JA7 J;  2ICW G;  2DAO A;  4XLN F;  2KIS A;  1GV2 A;  2KP6 A;  4OAZ A;  3TBI A;  5KK1 A;  4H0E A;  2GLO A;  3NQO A;  2OA4 A;  3S15 J;  1N75 A;  1Z3Y A;  2VBW A;  1E17 A;  1J09 A;  1R49 A;  2EFO A;  4NBQ A;  2IA0 A;  1CGP A;  1JKO C;  2LKP A;  1Y0U A;  3L9F A;  4UV9 A;  1VI0 A;  2M8G X;  2XSJ C;  2M0C A;  4G6Q A;  4B44 A;  4C3I J;  4CA0 A;  4EAT A;  4BHP A;  1EH7 A;  1Y1W J;  5ERI A;  1U3E M;  4AID A;  3CMA I;  4C2U A;  4XLF A;  4EJV A;  4XOR A;  2VT2 A;  4P9U A;  1IW7 F;  4ZJZ A;  2WY8 Q;  3LL7 A;  3WU1 B;  3KLN A;  4WXD A;  1YJN I;  1DUX C;  4BU2 A;  3FWE A;  4AM3 A;  1WHU A;  2FXA A;  5E1X A;  4BS9 A;  2LC2 A;  2K5C A;  1F36 A;  1K79 A;  5A2Q K;  3IRQ A;  1B1B A;  5FKL A;  3K4J A;  3OS0 A;  1V5G A;  1G6N A;  5JHU A;  1K61 A;  1YOV B;  1RR7 A;  3SZP A;  3H5A A;  3LSG A;  5IYD J;  3E6M A;  4CDG A;  1MDM B;  1ZQ3 P;  2HYG D;  2DA7 A;  3BZ6 A;  1YIT I;  2X1D A;  3VEP A;  2FUG 2;  3I5U A;  2GAU A;  1SD7 A;  2VC1 A;  4PSX A;  2OV7 A;  3LSH A;  3MMY B;  2I8D A;  3KYL A;  2IXS A;  5C3E J;  1T2K A;  2FBI A;  1T0F C;  2DU9 A;  1Y8Q B;  2HYJ A;  5B1A H;  4AD9 A;  4RM3 A;  1QZE A;  4IHX A;  1BR2 A;  4IEJ A;  3F8C A;  3IP4 B;  4HLX A;  3F6V A;  5EEH A;  1KU7 A;  2E35 A;  5H6Q A;  4FT8 A;  3S8P A;  5GPC A;  1T39 A;  1O7F A;  3KCC A;  3M9A A;  1MKM A;  3FMQ A;  2QKM B;  2XPV A;  3BQY A;  3R4K A;  3FXL A;  5M5W J;  3RI4 A;  3HSF A;  4LLL A;  2EZH A;  2I10 A;  3HHG A;  4M9S A;  5B1B H;  1WJB A;  1F9N A;  3UR3 C;  3LNQ A;  2CV2 A;  4WK8 F;  3K4L A;  4KUM A;  4ZTJ A;  3CUQ B;  1XPX A;  3DTE A;  2BE5 F;  3CUQ C;  3FX3 A;  1OLT A;  2JA8 J;  4XID A;  1MW7 A;  3N05 A;  5K5Q A;  4S04 A;  3M1E A;  1YE9 A;  5J4Y A;  1AWC A;  3ZPL A;  1I1G A;  2M4G A;  2FEZ A;  1YRN A;  1IRG A;  2LG4 A;  4I7H A;  4E7S A;  1FBQ A;  4LOC A;  1MBJ A;  3F9K A;  4AIJ A;  4DBR A;  4YIR X;  1UHS A;  2VL8 A;  3BG9 A;  3P7N A;  4H4K C;  4RAY A;  3L1P A;  2X0L A;  2KJC A;  2R7F A;  3FXQ A;  3PNT A;  1V55 H;  3IKT A;  3PFI A;  1ZLJ A;  2EZI A;  3WHC A;  3GX4 X;  1MGT A;  1HCR A;  4NC7 A;  1O3S A;  2OZU A;  2JVG A;  2XAH A;  2K02 A;  4KJZ A;  3GTO J;  2OTJ I;  4F93 B;  2R5Y A;  1UHM A;  1RKW A;  3KLO A;  4GO1 A;  5DCM A;  1ERD A;  3MCZ A;  5FB2 A;  2V1N A;  4B3A A;  3JRH A;  5LEJ A;  2TDX A;  1ZAO A;  2JSP A;  2H8R A;  5LHG A;  2QQB A;  2EFQ A;  5BPI A;  3PQJ A;  1O3Q A;  2RRE A;  4HW0 A;  4QSH A;  3RIR A;  1HOM A;  4JOM A;  2RN7 A;  4MFE A;  2O5R A;  3I58 A;  2JN6 A;  5E20 A;  2E34 A;  3FBI B;  4CXF A;  3ABM H;  4HPQ A;  3MQ0 A;  2RKH A;  3ULQ B;  2QUF A;  3A0H C;  1OCC H;  3V4G A;  1W36 D;  1KA8 A;  3WGH A;  4AIK A;  4UVB A;  4Q48 A;  1GVJ A;  3HKZ A;  3DEW A;  4NQW B;  1Z21 A;  1ACI A;  1JHF A;  2ZSH B;  4OMZ A;  3LA2 A;  1YJ9 I;  4CYC A;  5H2F C;  3J7Y J;  3PFY A;  4GRI A;  3G73 A;  2FBH A;  2X1E A;  4LJZ F;  4YEL A;  4AU7 A;  1MMS A;  2O0Y A;  5FRM A;  3RKY A;  2YU9 J;  2YU3 A;  3WTY C;  4RLF A;  2DTZ A;  2D1H A;  4OIR F;  2EK5 A;  4LG3 A;  1LE8 B;  2YS9 A;  3ZMS A;  5E8G A;  4C2M J;  4D1Q A;  4UHT A;  3SZG A;  2DN0 A;  2DFE A;  4IQ4 A;  1G3Y A;  1JKR C;  1FIA A;  3CC2 I;  4A69 C;  2DMN A;  3C2B A;  1W4M A;  1X58 A;  1UJ8 A;  3Q0W A;  2XRO A;  4G12 A;  4BEH A;  4OIO F;  4Y52 J;  1XDS A;  3CCQ I;  2HDC A;  2HGC A;  2L7Z A;  2H6B A;  2O3F A;  3IWF A;  4XKB A;  1MD0 A;  3V7S A;  4LG0 A;  3LOC A;  4RLQ A;  1FYM A;  2DT5 A;  4HQM A;  2I5U A;  2KRF A;  2IS2 A;  2HS5 A;  3OOP A;  2LY1 A;  2K85 A;  3BPX A;  1HSJ A;  2KZV A;  3OSF A;  3FZV A;  1FZP B;  1IG7 A;  3D5L A;  1ITY A;  1FSE A;  1ZG1 A;  4OIP F;  2TCT A;  2KQR A;  1ETK A;  2EIM H;  2VPR A;  4O5V A;  1JJ8 C;  2ETH A;  2A68 F;  2K9N A;  5JLW A;  1QHG A;  5B66 C;  2BY2 A;  2KIF A;  5DM6 F;  4FTH A;  2UV1 A;  4GDF A;  3FMS A;  2L2O A;  5J8C A;  5HLG A;  4OMY A;  1X4P A;  3KEY A;  2J5O A;  1WZ2 A;  1S3J A;  2LRD A;  3PSI A;  2IPQ X;  1IN6 A;  2OJE D;  2WC2 A;  2KPM A;  2XPU A;  2LSO A;  3K2A A;  4C3J J;  1P4W A;  2V79 A;  2ZFU A;  1YW8 A;  3S17 J;  3A02 A;  1UZC A;  1WQ2 A;  3COA C;  3AG1 H;  2E36 A;  1HST A;  1YLF A;  4XQF A;  1OKR A;  2G9W A;  1I3Q J;  4NNJ A;  2WWY A;  3AL0 B;  4CZZ A;  2ZME A;  4RMN A;  3AL0 C;  2VQH A;  4LD5 A;  1J59 A;  1LEB A;  5L3E A;  3OSG A;  3UKG A;  2G7U A;  4HV6 A;  2P7V B;  5D8L B;  1RC9 A;  2EIJ H;  5L3B A;  4AVZ A;  3GW2 A;  3ZR8 X;  3I55 I;  2MA3 A;  3DKX A;  4MTD A;  1WIB A;  2JUG A;  1NG6 A;  3MZ8 A;  1ZRE A;  2ZXI A;  4F7Z A;  2RQP A;  1UAA A;  2XB0 X;  4HQE A;  5EYR A;  1ZR4 A;  4EMS A;  4RB2 C;  4DJA A;  1MND A;  1VQ5 I;  4K2E A;  1T38 A;  3F6O A;  4Y3O A;  3RSN A;  1ZRC A;  1JGG A;  1OCT C;  2NVX J;  1W0U A;  3HTS B;  1YX5 A;  4BBR J;  3OYC A;  5HDN A;  3BZC A;  1R5I D;  4YFK F;  1RNL A;  5DS9 A;  2E2J J;  3OIQ A;  2O9L A;  2G0E A;  1F43 A;  4ESF A;  2Z3Y A;  3FM5 A;  1EJ9 A;  5EG0 A;  2V7F A;  1BR4 A;  4QPO A;  2PEX A;  2O03 A;  2XKP A;  1G59 A;  3QPS A;  3ZMT A;  3BR2 A;  5HDG A;  4A3B J;  4PJL A;  2KHM A;  2VOD A;  3O8H A;  2EV5 A;  1LFU P;  2XRL A;  5JVG F;  1ENH A;  1K6O A;  2P5L C;  3HPG A;  2EV0 A;  3EUH C;  4CHU A;  1K78 B;  2EWN A;  1LDK B;  1ZEL A;  5EF6 A;  1JTY A;  2Y31 A;  2R7X A;  2RVC A;  1XS9 A;  1IN8 A;  1LDD A;  1H8A C;  5IT9 Z;  1Z0X A;  2GWR A;  2HDW A;  1SVM A;  1XG1 A;  3OYB A;  1XGO A;  1JJ6 C;  5CQG A;  3FKI J;  2OD5 A;  2O8K A;  1VND A;  2DJI A;  3NRV A;  1QPI A;  2JSC A;  2XGD A;  4IRI A;  1ZLK A;  2M7A A;  4A3G J;  1SFK A;  2QQ9 A;  3P9C A;  4A5M A;  3W6K B;  2MW8 A;  3GZ5 A;  5DCF A;  4G6T B;  1YYV A;  2YUS A;  4M71 A;  4EEF G;  3DBH B;  2PMH A;  3SXY A;  1P9Q C;  2XRN A;  3J80 Z;  3N97 A;  3DWL E;  1GDT A;  4XRS A;  1N78 A;  4ZYG A;  1YRN B;  2MH2 A;  3QOP A;  2F4M B;  2L7F P;  4A3F J;  3GTG J;  2ZJ2 A;  4DZP A;  2BOL A;  2JTV A;  2GOX B;  2Y9Y A;  1DPU A;  4YFX F;  2IS1 A;  2CQN A;  2W25 A;  5HOD A;  2E1N A;  3GZ6 A;  3IV5 A;  4FE4 A;  4PJJ A;  1XC5 A;  3IH3 A;  3WU0 A;  1JUM A;  3PM1 A;  4RAF A;  1Q1H A;  3BJA A;  3ZQF A;  3R60 A;  3KE2 A;  4WXH A;  4XMY A;  5E3L A;  1BI2 A;  2VQG A;  3B6C A;  1D5Y A;  4U0W A;  3CDL A;  3AG3 H;  5DCM B;  4A5N A;  4ENM A;  1RUO A;  4MIM A;  2QF7 A;  4UVC A;  1IRX A;  1YS6 A;  1LPQ A;  3HYI A;  1FPQ A;  3REO A;  2Y0S A;  2Z33 A;  4L0Z B;  2R93 J;  1FTZ A;  2X9D A;  4A0X A;  3FHZ A;  3S93 A;  2E2I J;  2CMP A;  3FHN A;  5TIS C;  1ETO A;  3S1R J;  4GFB A;  2K40 A;  4CIC A;  1Z7U A;  3H9J A;  5EGO B;  4Y4R A;  5FD5 A;  2X6W A;  2DMQ A;  1WGX A;  4UXN A;  3JRF A;  1FYK A;  3LMM A;  1ZGW A;  1VQ6 I;  2F5C A;  4LMY A;  1SD6 A;  4RB0 A;  2CGP A;  3PO3 J;  2A5W A;  1U78 A;  1ZRD A;  1XCB A;  3TP3 A;  1TQI A;  4S05 A;  1H9T A;  1MDM A;  2C6Y A;  2XHK A;  1I5Z A;  3FDY A;  1Z05 A;  2HTS A;  4KN7 X;  2DFF A;  2BY1 A;  4NC8 A;  4LLG F;  1S5L C;  2FQ4 A;  3W6V A;  2P4W A;  2PBI A;  1MMN A;  5L3G A;  1O4X A;  2ELJ A;  3A2K A;  3UNG C;  3KZY A;  2GOM A;  4GXO A;  2DA2 A;  3LST A;  3EUA A;  4E6K G;  2BEO A;  3CF2 A;  4BJ6 C;  1UCR A;  1T0F A;  4HX7 A;  5LLQ A;  4HRI A;  2N8G A;  4FE7 A;  3KIO A;  4ZC3 A;  1LQ1 A;  1R71 A;  3B6A A;  2EZK A;  4CCN A;  2H27 A;  1ETV A;  3DEE A;  5BNG A;  3TDU C;  3OYF A;  3IWZ A;  2D1V A;  4XSZ F;  4AVP A;  4P96 A;  1ETY A;  2Y30 A;  3RCO A;  2WB1 A;  2GIZ A;  3OIO A;  5IT3 A;  1HXD A;  2VKH A;  2YX4 A;  1ZHF A;  2ZNY A;  4PCQ A;  1USS A;  4KT5 C;  3ZCO A;  4QLC U;  4I01 A;  4I02 A;  3PQK A;  2LTP A;  1TQM A;  5DD8 A;  2NAZ A;  4JX5 A;  2V9V A;  3PUF A;  3E6C C;  3OWT A;  3BR3 A;  4A2U A;  3DKY A;  4L5J A;  5D5W B;  4PSW A;  3K9T A;  5CKT A;  1XMX A;  4HX8 A;  9ANT A;  2DI3 A;  4J00 A;  2WV0 A;  2IS4 A;  3CUQ A;  1W7P B;  2E2H J;  4EM2 A;  3QPH A;  3K10 A;  1KQ9 A;  3K2Z A;  2A07 F;  4UUV A;  2CW0 F;  3W2V A;  3G2B A;  3LQR A;  4M9Z A;  2PLY A;  2EV6 A;  2PG4 A;  4HZF A;  5F08 A;  2LYC A;  1WKM A;  3H3V K;  2MLG A;  4FX0 A;  4I09 A;  3QPT A;  3JCU C;  1HLV A;  3G1M A;  1FOK A;  3I4N J;  5DUI A;  2QZ8 A;  2DJN A;  2NOG A;  3RQ4 A;  3KET A;  3VYT B;  2IGM A;  4IOA F;  1J75 A;  4DQ2 A;  2CH0 A;  1TWC J;  2P7C B;  3ZQI A;  2RGV A;  3CCU I;  4ENJ A;  1D8J A;  3H3U A;  1MBG A;  4A0Z A;  1FIP A;  3Q9S A;  5GAH J;  4BQQ A;  4D0P A;  3DTI A;  3R6S A;  2J5P A;  1KQ0 A;  3OV8 A;  4J19 A;  4C9Y A;  1I50 J;  3CLO A;  1HKT A;  1ORK A;  3SYT A;  2HQA A;  2XV4 S;  4Y33 A;  3GTJ J;  1X19 A;  4Q47 A;  3N4M A;  1NH3 A;  2P6T A;  3VB2 A;  2HDD A;  3F8N A;  1R22 A;  3HIF A;  5BMZ A;  3BR6 A;  2O7O A;  1POG A;  3FF5 A;  1WCM J;  1D0Z A;  3TO9 A;  1APL C;  1IGN A;  4D5C A;  4PDK A;  2H1L A;  2CV0 A;  2HKX A;  2F5D A;  3RPQ A;  3TOB A;  3Q5F A;  4IRG A;  3WG7 H;  4HDV A;  1LFB A;  4ZZD A;  4D7M A;  4U7D A;  2LH9 A;  4WF2 A;  4M9X A;  4XNF A;  1SAU A;  2IA1 A;  1OJL A;  3KZI C;  1SFE A;  3CZ6 A;  4D7N A;  1O3R A;  2IT0 A;  2QBY B;  2HOS A;  2R4G A;  3SDB A;  1IAW A;  2ID3 A;  2DA6 A;  4IF4 A;  4RDU A;  3K4M A;  1VQP I;  4NQW A;  1JI8 A;  3HJE A;  2W24 A;  5F1R A;  1QHH D;  2K9L A;  2V26 A;  3VSK A;  4O3M A;  2DT6 A;  4A93 J;  1X4O A;  3LFU A;  2W85 A;  4A3I J;  3M8J A;  4WWC A;  1LVA A;  1MBK A;  2OUM A;  2LK2 A;  1IXS B;  1BI0 A;  2ZKZ A;  3FXO A;  4ZH4 F;  1TW3 A;  4AIH A;  3KYC B;  1DGR M;  2DXI A;  1LE8 A;  2DFI A;  3OIP A;  3F8M A;  2EIN H;  5LGN A;  1SD5 A;  4XKV A;  2NS0 A;  1TNS A;  2V6E A;  2FOW A;  4KIS A;  1TQP A;  1FSH A;  1OCP A;  4E7Z A;  1J9I A;  2IRF G;  1P6R A;  1TBX A;  3BTI A;  3DEU A;  5CPR B;  3A1Y A;  1MJB A;  2YX7 A;  3OOU A;  3K7A J;  3ECH A;  4IHW A;  4BXX J;  3WTT C;  2CWE A;  2PMZ N;  5FFX A;  2MFZ A;  2WY7 Q;  1HF0 A;  3LSI A;  1RET A;  4PGH A;  2W48 A;  3RPU A;  3MKZ A;  4LLN A;  2QKL B;  5HLH A;  1S72 I;  1MBE A;  2WAF A;  1L3L A;  3G1L A;  2O6G E;  1X1D A;  2VB6 A;  3HC7 A;  3LA7 A;  1UG2 A;  4LGW A;  3KX2 A;  5CVU A;  3CJS B;  2UXN A;  2E1O A;  2FMY A;  3WTV C;  1D5V A;  4RAG A;  4FCY A;  5JR3 A;  3LAJ A;  1U9N A;  4JYK A;  3CCR I;  4IZZ A;  1S7E A;  3GTL J;  1R1T A;  2LP0 A;  2ZFW A;  2IGO A;  1PP8 F;  2DPD A;  4HST A;  2JA6 J;  4KMF A;  1TWA J;  3K4K A;  4MQV A;  4EGZ A;  3PUB A;  1D1A A;  3ZOB A;  2D5V A;  1X1B A;  1IN5 A;  1ZKG A;  4E70 A;  2CQK A;  3U1D A;  1V54 H;  3D0S A;  3CCJ I;  5E17 F;  2JZY A;  3PIP F;  3AKZ A;  5BPD A;  1E0E A;  3P9K A;  1MMD A;  4XOT A;  5AON A;  1MMG A;  3MFK A;  3RPU D;  1PUE E;  5IP6 A;  4F55 A;  2HEO A;  1RZ4 A;  2W82 A;  3T0Y A;  3W2A A;  4M3D A;  1VQO I;  1Z91 A;  1IUY A;  1HKQ A;  3Q3S A;  1VQK I;  4IJA A;  4BHC A;  3L2V A;  2X51 A;  2HWV A;  1R9T J;  1B4A A;  3FXJ A;  4LIT A;  2Y2Z A;  2MG4 A;  3CDI A;  4IKF A;  5KHD A;  1XCV A;  1XDU A;  3BOQ A;  2STW A;  1TNT A;  2K27 A;  2VN2 A;  2GQQ A;  3RKQ A;  1RPW A;  1A5J A;  3C7J A;  2HZT A;  4I98 B;  1FOY A;  1JT0 A;  4UY8 I;  2B63 J;  3FK6 A;  2M87 A;  2ZSI B;  3DPU A;  2VBZ A;  3EUH A;  2CRG A;  4HG2 A;  2CU7 A;  3T8T A;  4HF1 A;  1K78 A;  1LJ9 A;  1MNM C;  3EYI A;  4MLO A;  1KQ8 A;  1LKX A;  5BS6 A;  2OAZ A;  2L5Q A;  5EZH A;  1S7A A;  3C2G A;  1BW6 A;  2HVQ A;  2JA2 A;  1CF7 A;  3JTG A;  1WI9 A;  1AU7 A;  1T98 A;  1IF1 A;  1TWF J;  3EQL F;  1FJL A;  2L9R A;  1B59 A;  1EV7 A;  1FWZ A;  2ZB9 A;  1GUU A;  2JPB A;  4N9H A;  3MWM A;  2M45 A;  1S6L A;  1Z77 A;  1LEA A;  2K9M A;  1E2X A;  2L7K A;  1K4S A;  1IUF A;  2CQ7 A;  4BXU A;  5E79 C;  2MSY A;  3O8G A;  5FFZ A;  4AYB N;  2LD5 A;  2F2E A;  3NAR A;  4G6D A;  4V2G A;  4GYG A;  4QIW N;  3OYD A;  1BL0 A;  2XAG A;  2MLK A;  4DZJ A;  5D5U B;  3S3N A;  1CQT A;  1TW2 A;  5DM7 F;  3CCS I;  2H94 A;  3WGI A;  1H88 C;  3BG3 A;  3ABU A;  2L9V A;  2VJ4 A;  3QYF A;  4L9N A;  5FJ8 J;  5HS8 A;  4XSX F;  2Y9Z A;  3CO6 C;  2HKO A;  1IC8 A;  2W4S A;  5M3M J;  4JK1 X;  5FKO A;  5K1Y A;  1W5C C;  2CSO A;  3JRI A;  1ETX A;  4BE2 A;  1I1S A;  4JX4 A;  1X3W B;  1P4A A;  5FGM A;  2QYO A;  3VSL A;  2EQR A;  5ILV A;  1KGS A;  3IC7 A;  3JW4 A;  3I64 A;  2W57 A;  4FIS A;  3ZP5 A;  1JUP A;  3TOA A;  2MGQ A;  3CJT B;  5FRN A;  2UUZ A;  3HB9 A;  5EGO A;  2R7Z J;  4XLA A;  2COB A;  5IP9 J;  3J81 Z;  1BOB A;  1MBH A;  2FF4 A;  5M3F J;  3EGV B;  4FHT A;  5CVI A;  5CQE A;  1AHD P;  5FLM J;  1Z3X A;  4E7I A;  4CCJ A;  3L2W A;  1YG2 A;  4P9F A;  2VXZ A;  4Y15 A;  1BJZ A;  3KP7 A;  5FD6 A;  2L4A A;  4UNO A;  1ULY A;  3ASO H;  3SJM A;  4N9I A;  4AWX B;  2HQ5 A;  3BLY A;  3PNY A;  2EFW A;  3MZY A;  4HBL A;  1XSD A;  1B8I B;  1OYY A;  2VJJ A;  3HUG A;  3DPT A;  3BG7 A;  4UVA A;  2PJP A;  3JRE A;  1X1P A;  3E5X A;  2P5K A;  5C4J J;  2XF5 A;  2Z2S B;  2KJB A;  2MD0 A;  3GBG A;  4BL0 B;  3ELK A;  3HHH A;  3V8L A;  3CJN A;  2V1U A;  3ABL H;  5JFR A;  3SDG A;  4OIN F;  3JR9 A;  1C0W A;  1ZGJ A;  3P9I A;  3Q0U A;  2DQL A;  3HOV J;  2IS6 A;  4L9V A;  5CYV A;  1PUF B;  1QBJ A;  1GHC A;  4BUP A;  4NHJ A;  3E6D A;  3Q9V A;  4EM1 A;  2X1C A;  1HA8 A;  4BNC A;  4UB8 C;  4A3C J;  3DBL B;  3EYY A;  5LGT A;  3S2W A;  3HOY J;  4ON0 A;  2R7V A;  3BJO A;  5M5Y J;  5ICG A;  2GBY A;  3BG5 A;  3M8E A;  2BYV E;  1OYI A;  4BQO A;  4BQN A;  3A03 A;  4ESB A;  5HDK A;  3FK7 A;  1RES A;  1HW2 A;  4PJM A;  1ZN2 A;  3QPL A;  2LLK A;  1W7P A;  1YO5 C;  2BXY A;  2UWM A;  3CCY A;  1JT6 A;  4F52 A;  2M4K A;  2RNJ A;  4BE1 A;  3L2Q A;  1VQN I;  2HVR A;  2H1K A;  4G7O F;  2HOT A;  4A3K J;  1IJW C;  2LKX A;  1P2F A;  1FX7 A;  1WI3 A;  2VLA A;  1TLH B;  1MBF A;  3U9G A;  3EET A;  1XTA A;  2OQG A;  2LF8 A;  3WGG A;  1SC7 A;  3QU3 A;  2DOF A;  4HX4 A;  1R4M B;  3CMY A;  2VOO A;  4XR6 A;  1BOA A;  2WAD A;  3WTS C;  1BIA A;  4NDL A;  4RA2 A;  3ML6 A;  4E7K A;  1T56 A;  3M07 A;  1OYW A;  2FQ3 A;  2Q0O A;  4BKX A;  3AAF A;  1MMA A;  3GO5 A;  5J1Y A;  1NHA A;  1PVE A;  4OU0 A;  1BC7 C;  4YRV A;  2DYR H;  2F5V A;  3DCF A;  4FET A;  2R7W A;  4BE0 A;  5C4X J;  1Y8R B;  4UUS B;  4XLH A;  4HLY A;  2DOD A;  1H89 C;  2KRC A;  2B0L A;  3HSE A;  3TW7 A;  3QU6 A;  4B1R A;  2JK3 A;  3KEQ A;  2VJ5 A;  3DLL F;  1T33 A;  4C3H J;  4ZYD A;  3OYJ A;  3LSP A;  2EBI A;  2EA4 A;  4GCV A;  3TDZ C;  1VQM I;  3KZZ A;  3ERM A;  3SFI A;  1LUJ B;  2WV1 A;  1VQ9 I;  1MH4 A;  2LFB A;  5J4V A;  4OAY A;  2DOA A;  3E0J B;  1B9N A;  3ZXS A;  2NRA C;  3LAP A;  3K1N A;  3S3O A;  1JTX A;  4PJN A;  3JRB A;  4CSW A;  1U8B A;  4A3J J;  3MEX A;  3GLL A;  2KKO A;  4P55 A;  4S0H B;  4CH7 A;  1WJ5 A;  2R7D A;  2R7R A;  1ZRF A;  5LEK A;  2FNA A;  5IP7 J;  2QBY A;  4FQG A;  1I3A A;  1B6A A;  2V1D A;  2ISZ A;  2HU9 A;  5IT9 K;  3L7W A;  3FBN B;  4PFP A;  1Y0N A;  3H9G A;  2ACJ A;  3QRF F;  1R23 A;  4UV8 A;  2LBF B;  2QSH X;  1WVR A;  2VIX A;  2NVT J;  1R4N B;  1ZK8 A;  1BW5 A;  1K6Y A;  4MFD A;  3KPH A;  4M72 A;  2WAQ A;  4YFN F;  3OS1 A;  1TZL A;  4GYI A;  4XRF A;  2VXD A;  4G7Z F;  5L3F A;  1G3T A;  2CG4 A;  1DP7 P;  3J80 K;  2HTJ A;  2V1X A;  1MSF C;  4AUX A;  3OYM A;  1CF7 B;  2KIM A;  3HKZ N;  3OL4 A;  4KIF A;  2Y0M A;  1XSX A;  2KT0 A;  1FLI A;  3T8R A;  5TJJ A;  1JHH A;  5ICE A;  1YS7 A;  3KFW X;  1IRF A;  2ELH A;  4CYD A;  2OU2 A;  4DGW B;  3R0A A;  3S1M J;  1HC8 A;  2PQ8 A;  2XIG A;  4G8X A;  4M6X A;  4KIC A;  3F23 A;  4ZDO A;  1U0J A;  2X6Y A;  5LRR A;  1R36 A;  2K86 A;  3GFL A;  2WAE A;  2JUC A;  3P5J A;  3HOX J;  4MEY F;  2EJR A;  1EA3 A;  4HNV A;  3MN2 A;  2D45 A;  1FNN A;  3NEU A;  4L9J A;  1O3T A;  2X4H A;  1SMY F;  4IXA A;  4Y13 A;  2HFH A;  2HR3 A;  2E71 A;  5F0H A;  4BDZ A;  4I2O A;  2QLZ A;  2PJR B;  5CVR A;  2JQ7 A;  3DBR B;  3CCM I;  4ITV A;  5DEQ A;  3M4O J;  3HM5 A;  3ZGK A;  4ZYH A;  2G7H A;  4YG2 F;  3VYS B;  3CCL I;  4HNT A;  2X85 A;  2NXN B;  1Y56 A;  1D8K A;  1I6X A;  2F5F A;  2UXX A;  4B3X A;  5E3M A;  1JKQ C;  4M3B A;  4U0Y A;  4IHY A;  1Z67 A;  2L54 A;  1OR7 C;  3ROU A;  1R5G A;  2WBM A;  1PDN C;  3PSF A;  2CUE A;  1STZ A;  2PMU A;  2NOJ B;  2E7W A;  2XAU A;  2Z9O A;  2GA1 A;  2DMT A;  2UZK A;  2P8T A;  5IOZ A;  3ESW B;  2QEN A;  4HSR A;  3GYH X;  1G4D A;  2P81 A;  1ZG5 A;  3LSK A;  1RIO H;  2XGX A;  2P5V A;  4PJ0 C;  4DBQ A;  1KU3 A;  4XN3 A;  3F72 A;  1SFX A;  5F04 A;  2VT3 A;  3OR2 C;  2VJI A;  3DLA A;  3LSR A;  3LFK A;  3S1N J;  4PFO A;  2EFP A;  1YTY A;  3VOD A;  5KCM A;  3V7R A;  3HUG B;  5CLS A;  1MZB A;  1YW7 A;  2XF7 A;  3HRT A;  2L7M P;  2XVC A;  4X1E A;  3F21 A;  5ICF A;  3I54 A;  1B72 B;  3WE3 A;  5EEA A;  5C44 J;  2DA1 A;  1YQA A;  1OMI A;  4JQF A;  3MAJ A;  4IL6 C;  4CZC A;  2EIK H;  3LSJ A;  4WX9 A;  1WRJ A;  3VYR B;  5J40 A;  2X48 A;  3JRC A;  2IGN A;  1A04 A;  1S29 A;  5IOY A;  5JLX A;  2VE8 A;  1FMV A;  4MTE A;  4Y7N J;  4YIF A;  5J1R A;  4RBO A;  3OS2 A;  2V9P A;  3I9V 2;  2K4B A;  2QCO A;  3MD2 A;  4RGX A;  4G7H F;  2CJJ A;  4A6E A;  3RZD J;  1MSE C;  1D0Y A;  1SAX A;  2M34 A;  2E5N A;  3WG9 A;  3HTU A;  3HOU J;  4G9Y A;  4WXC A;  4CCO A;  2E60 A;  1WH7 A;  2FNP A;  5KAF C;  2O8X A;  1U5T C;  3G1O A;  1QA6 A;  2DOE A;  3ABK H;  2MAB A;  2BW3 B;  3WE2 A;  3JAM Z;  2WAQ N;  3A01 A;  3KYD B;  4MO7 A;  4DNC A;  3DU6 A;  2IJL A;  4DYC A;  3TP0 A;  3K1M A;  1VF9 A;  2QA4 I;  4B48 A;  3GME A;  4A0Y A;  2BVM A;  2RQQ A;  4X0G A;  4IQJ A;  4L9T A;  1A36 A;  2Y48 A;  2HQR A;  2OF7 A;  2Z1D A;  1E3O C;  2NNY A;  2XAQ A;  1WJF A;  3IH4 A;  5D6F A;  4LIU A;  1X2N A;  2R7S A;  2FOK A;  1G3W A;  5FLX Z;  3ISP A;  3WTX C;  3MKW B;  1DU6 A;  3TGN A;  3CCV I;  3D1N I;  4GGG A;  5F27 A;  3QQA A;  3ZQG A;  3WOD F;  1SMT A;  1X2M A;  5GTH C;  3OYE A;  4KIG A;  5LBQ A;  2X6O A;  3TKY A;  5DD4 A;  2R7Q A;  3O6B B;  5EEG A;  1XX5 A;  2FBK A;  2Q8K A;  3G6E I;  4P1W A;  2V6C A;  5IYB J;  3TL4 X;  3RJP A;  4XOP A;  4R1H A;  5DYM A;  2KDZ A;  1I27 A;  4M6Y A;  2DQR A;  3V8J A;  5K7Z A;  4BDY A;  4DYQ A;  4ENN A;  5FLV A;  3OYH A;  1XD7 A;  4KN4 X;  3QP6 A;  1Q1V A;  3CUO A;  2XGE A;  5D6E A;  4G94 A;  1T95 A;  1QO0 D;  2CS3 A;  5LRS A;  2Y0S N;  4IO9 F;  4KT6 A;  5HOO A;  3DU5 A;  2DMP A;  1MIJ A;  3IKV A;  5HS9 A;  3LWF A;  2H09 A;  1KON A;  3WTW C;  3F3X A;  1RI7 A;  2EIL H;  5HNH A;  1T8I A;  3I59 B;  1WJE A;  1K7A A;  3BY6 A;  3CTA A;  3B02 A;  4QPQ A;  4HF2 A;  4OOI A;  2LNB A;  3BC8 A;  5EDN A;  2BXZ A;  2IAI A;  4U87 A;  3QP5 A;  1F1Z A;  4N0B A;  5JVT A;  1B8I A;  2DYS H;  2OPT A;  3H35 A;  5L3D A;  4EV0 A;  3E3V A;  2VI6 A;  2FSW A;  4IPA A;  4U88 A;  1WWX A;  3S2D J;  4L0Y B;  1N77 A;  2VC0 A;  4IX7 A;  1HDP A;  1BI1 A;  3S1Q J;  1PUF A;  2WTE A;  2OCE A;  4IHV A;  4II2 A;  1D0X A;  4LK1 F;  2Q2E B;  3KP3 A;  4HA8 A;  5GP9 A;  4M3E A;  5DV5 A;  1QRY A;  2ID6 A;  5LGU A;  2R92 J;  1Y39 A;  2DFH A;  3U2R A;  1V5E A;  3BDD A;  1PJR A;  3L09 A;  3I4P A;  2EPF A;  4RS8 A;  2ECB A;  1D3Y A;  1WSU A;  2WB1 N;  1V4R A;  2BY3 A;  2R7T A;  4RGS A;  1ZG3 A;  1ZYR F;  2R5Z B;  2NS8 A;  4XL9 A;  4EQQ A;  1SEU A;  4OWR B;  4M74 A;  4A6D A;  2A6H F;  4HV5 A;  3L2R A;  1WJD A;  1UG0 A;  2FML A;  2KIQ A;  3RKX A;  5TGT A;  2YPR A;  2P0W A;  5GPA A;  2K9Q A;  5LHI A;  1YFH A;  4P5O A;  5HVQ C;  1IV6 A;  2QWW A;  3H36 A;  5J6X A;  3DTK A;  5F64 A;  4BAY A;  5GTI C;  4N4O B;  1XMA A;  3OR1 C;  2HI3 A;  1F4K A;  2ZO4 A;  3BTL A;  4D5F A;  1VQ8 I;  4BH9 A;  3HZJ A;  2BGC A;  3VOE A;  2IEK A;  2YR2 A;  2OQR A;  5D5X B;  3V8K A;  1TL8 A;  3H5N A;  1M1E B;  4RB3 C;  1W5S A;  2AXT C;  4UUS A;  4A3L J;  2Y75 A;  2GZW A;  2W1O A;  3O3K A;  3CES A;  1KZH A;  1FMW A;  2MC3 A;  2GXB A;  3K4C A;  3CC7 I;  1ZH5 A;  2BY0 A;  2LVS A;  4PGG A;  1TWH J;  2HXI A;  4ZYE A;  2VKD A;  3HOZ J;  4CUG A;  1W1W E;  2JMW A;  2L9S A;  4L5E A;  1U8R A;  3KP6 A;  2JA5 J;  2DDB A;  2QQ8 A;  2P6S A;  2R3S A;  1O57 A;  5HS7 A;  3CME I;  3QYE A;  3K70 C;  2M7B A;  1R58 A;  3KP2 A;  2NVY J;  2XGC A;  3ZRG A;  1L0O C;  5B5E C;  4KIT B;  4ZTF A;  3GVA A;  2JWT A;  2IW5 A;  2VPL A;  1ON2 A;  2A3S A;  4M3F A;  2ZXH A;  1A6Q A;  1JUS A;  1NK2 P;  1U9O A;  3H0D A;  2F5E A;  1JGS A;  4CGZ A;  2M8E A;  3GZN B;  1P7I A;  3K4B A;  3DKW A;  3HG9 A;  1X1A A;  3TQN A;  5A2Q Z;  4ABZ A;  3BT9 A;  1GT0 C;  2HXO A;  3BTC A;  4HYE A;  5HLT A;  3LQQ A;  1UMQ A;  3DFG A;  3GTQ J;  1RR8 C;  4KMU X;  1SVL A;  2LBF A;  1P92 A;  3ZN1 A;  1BN5 A;  5K5R A;  2RDP A;  1LNW A;  2MH9 A;  1VTN C;  2HNH A;  3WTZ A;  3KP4 A;  1EF4 A;  3BTJ A;  1I39 A;  1MH3 A;  3B73 A;  3FKJ A;  2K3F A;  5D4R A;  1U6G A;  1YW9 A;  2CW8 A;  4XON A;  3QOD A;  1SAN A;  4ANJ A;  1XGN A;  2IGK A;  1E3H A;  4M3G A;  1VFC A;  4F3Q A;  2NS7 A;  1U2W A;  4F92 B;  3HDD A;  1LVK A;  1P7J A;  1FOX A;  3A01 B;  1UFM A;  1WJA A;  3F22 A;  1GV5 A;  2ME0 A;  1IZ1 A;  2DW4 A;  2W7N A;  2CUF A;  1QU3 A;  3MZH A;  3OYA A;  2ZJR F;  5LHH A;  2BZT A;  2L9N A;  5JI6 A;  2Q1Z B;  2E5Z A;  3A4C A;  1R7J A;  2PJR A;  4RM2 A;  1T08 B;  2ZXJ A;  1FC3 A;  2JRM A;  1LDJ A;  4DOZ A;  1KYW A;  4KNY A;  1EH8 A;  1BM9 A;  5IYC J;  3SHF A;  1OIS A;  4RGR A;  1J5Y A;  1UEL B;  3DF8 A;  2B9S A;  2JT1 A;  1T6S A;  1FYL A;  2DT7 B;  2K4J A;  1FBS A;  4XK4 A;  2HPM A;  3ZMD A;  5E18 F;  3OYL A;  3ZMZ A;  3ZMV A;  4U7B A;  1OR7 A;  1JKP C;  4C30 A;  1N25 A;  3J81 K;  5ICC A;  3RDI A;  2QM3 A;  3HRU A; 
#chains in the Genus database with same CATH homology
 3CCQ I;  3CC4 I;  5GAD J;  3CC7 I;  2QEX I;  1FOW A;  1FOY A;  4IO9 F;  1YIJ I;  4UY8 I;  3I56 I;  1YI2 I;  2H8W A;  3CME I;  3CJR B;  3CF5 F;  2FOW A;  5DM6 F;  3CMA I;  1VQL I;  3J7Z I;  2OTJ I;  1YJN I;  2OTL I;  3PIO F;  1HC8 A;  2E36 A;  1S72 I;  4IOA F;  3CJQ B;  1YJW I;  3G4S I;  1VQ7 I;  1VQN I;  2K3F A;  3CCU I;  3CJS B;  5GAH J;  1QA6 A;  1Y39 A;  2E34 A;  5DM7 F;  3CCS I;  1YIT I;  3CCE I;  3I55 I;  2ZJQ F;  2JQ7 A;  1WIB A;  4V19 K;  3CCM I;  3CCR I;  2QA4 I;  1FOX A;  1VQ4 I;  5GAE J;  3G71 I;  3CCL I;  1VQ6 I;  1VQ5 I;  2NXN B;  5GAG J;  2ZJR F;  1ACI A;  3CCJ I;  3PIP F;  1YJ9 I;  3CCV I;  3J7Y J;  3CJT B;  2E35 A;  3DLL F;  2ZJP F;  1YHQ I;  1VQM I;  1MMS A;  1VQ8 I;  3EGV B;  1VQO I;  1VQ9 I;  3CD6 I;  4IOC F;  3G6E I;  1VQK I;  5JVG F;  3CC2 I;  1VQP I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...