4UY8I

Molecular basis for the ribosome functioning as a l-tryptophan sensor - cryo-em structure of a tnac stalled e.coli ribosome
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
141
structure length
141
Chain Sequence
AKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEKGLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKISRAQLQEIAQTKAADMTGADIEAMTRSIEGTARSMGLVVED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S RIBOSOMAL PROTEIN L32
publication title Molecular Basis for the Ribosome Functioning as an L-Tryptophan Sensor.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 4uy8I02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 4uy8I01
3G71I 3CJRB 3CJQB 1VQ6I 3PIPF 1YJNI 5GAHJ 2ZJPF 3CCUI 4IO9F 1VQOI 3CJTB 1VQPI 2ZJQF 3CJSB 3EGVB 2OTLI 1YHQI 4UY8I 1Y39A 3I55I 4V19K 5DM6F 2E36A 1S72I 2NXNB 2FOWA 3CCLI 3DLLF 3CC2I 3J7YJ 5JVGF 1VQMI 5GAGJ 3I56I 2H8WA 2QEXI 3CF5F 1VQKI 1VQ4I 3CD6I 1VQNI 2JQ7A 1YIJI 3CCEI 1MMSA 5DM7F 3PIOF 5GADJ 3CMAI 3CCMI 1WIBA 4IOAF 1ACIA 2E35A 3CMEI 1VQ8I 5GAEJ 3CCRI 3G6EI 2ZJRF 1YITI 3CC4I 1YI2I 1VQ7I 1QA6A 3CCQI 2E34A 3CCJI 1FOWA 2QA4I 1FOYA 2K3FA 1YJ9I 1HC8A 1VQ9I 2OTJI 3CC7I 3G4SI 1YJWI 4IOCF 1FOXA 3J7ZI 3CCVI 1VQLI 1VQ5I 3CCSI
chains in the Genus database with same CATH superfamily
3BTJA 3RPQA 3G71I 4M3DA 2CG4A 2OCEA 4OAZA 1DQUA 4OOIA 3PO3J 1SVLA 1X19A 2VIXA 1MD0A 2B0LA 1S7OA 2CV0A 1UELB 3M07A 3X2QH 4YFXF 3KYDB 5FD5A 2EB7A 2MABA 3UNGC 1T0FC 2BXYA 5D5XB 4CA0A 1P2FA 3UR3C 4A3IJ 2HEOA 3CJTB 4FX4A 2IS6A 4I09A 1WH5A 2OJED 4ZZDA 1BI0A 2M0CA 2KPMA 4I02A 2ICWG 4M3BA 4RB3C 1LE8A 1MNDA 2EA4A 2UXNA 2XF5A 4A3KJ 2O8XA 1BIBA 3REOA 4RA2A 3ZMTA 1V54H 3M9AA 2KDZA 1OCZH 1TWHJ 1BL0A 2IA0A 5ILSA 5J4VA 2E19A 3CZ6A 3MN2A 3R0JA 2E2IJ 1OYYA 4RGRA 2JRTA 1VFCA 3ROUA 4V19K 1B72B 4NNJA 3HUGB 2L0KA 1UHSA 2Z2SB 2K40A 4M6VA 3LL7A 1MDMA 3CC2I 1USTA 2WB1N 4DYQA 2F5FA 1XDUA 4L9VA 1VQMI 5CPRB 2YS9A 3I56I 1QVUA 1BA5A 1KGSA 3Q0WA 1BM9A 4IZZA 1VQ4I 3RPUA 3J81K 4KIFA 3CCEI 3OIPA 1O57A 4EGYA 4GCVA 5M5XJ 4OU0A 2CUJA 2COMA 3SFZA 3ZQLA 3L7WA 1AU7A 3OYGA 2R7OA 3L9FA 3G1LA 3DPLC 3E6DA 1EF4A 1P7IA 4N9HA 3CP8A 3QAHA 3FIWA 3P9KA 5EJCA 3G6EI 2KIFA 4A93J 1HQCA 3SYTA 3SHFA 1YI2I 2XF6A 2FBKA 3H0GJ 2Z9OA 3CMYA 3S15J 5K7ZA 3M8JA 2K9LA 3MKLA 5DV5A 2BV6A 1U6GA 3LSKA 5IY5H 4QPQA 3BTCA 3WG9A 4KIGA 4P96A 4N9IA 4IHWA 6PAXA 1Y1VJ 5L3BA 2K9QA 2LDUA 2QQBA 1B1BA 1MMAA 1VZ0A 3MKZA 3WTWC 2LRDA 4HQMA 4S05A 1SFOJ 3KP3A 2EFPA 4XIDA 1NG6A 2PG4A 3KYCB 3OYCA 3EUKL 3GTMJ 2R7FA 3L00A 1IN5A 1IN4A 4XOTA 4CCOA 5ED4A 4IRHA 2DA4A 4UXNA 1BJAA 2GIZA 3BLYA 1X1DA 1UFMA 4CYCA 1FZPB 5FLVA 4X1EA 2CW8A 2WB1A 1YJNI 4RMNA 4LIVA 1ZAOA 4CZZA 2CUZA 1N78A 2PX9A 1NG7A 1BI3A 3TBIA 1JKQC 2VODA 1FIAA 3HRUA 3KP2A 4IF4A 2HOAA 3EUHA 3C2BA 3A1YA 1KQ8A 4FX0A 2E1CA 4IJAA 2PJRA 2PN6A 4UUSB 2FXAA 2RNJA 3BTLA 1D5VA 3TL4X 3OSFA 2BHZA 2E71A 2DFFA 3D5RC 5EZGA 2KQRA 3SEQA 2PJPA 3K0LA 3G3ZA 3HRSA 2OTLI 1YOVB 2BY1A 4ZH4F 2VJ5A 4R1HA 4PGHA 1WZ2A 1SAUA 4E4HA 5F0HA 3ZN0A 4M9SA 3BTIA 1J5YA 2OD5A 5LGTA 1ITYA 1R1TA 2A6TA 2IA1A 4QPOA 1E3PA 3SZPA 2IS4A 2XPUA 4A3GJ 2KMUA 3LOCA 1R5GA 2WC2A 3H35A 4PZJA 1AKHA 3I9V2 5KAFC 4TV7A 1GT0C 3HM5A 1G6NA 1W1WE 2W4SA 5F08A 4LJZF 1X3WB 5GADJ 1DP3A 3BPVA 1OPCA 1IV6A 3EYYA 1IRXA 5TJJA 3PJRA 3OIQA 1BR4A 2DDBA 3TDUC 2R5YB 4KISA 2EPFA 3S2HJ 1U2WA 1ZRFA 2F5EA 3ZRGA 2JMWA 3GFIA 1ZELA 4ESFA 3JAMZ 2LBFA 1IG7A 2IXSA 5HLTA 1JKRC 4RAZA 1R1VA 1L0OC 3MZ8A 1B9NA 1U0JA 4B43A 3WTXC 5M3FJ 2BOLA 5LLQA 2A5WA 2HXOA 4GXOA 4DJAA 2DBBA 4HX4A 2GOMA 3SEZA 2BY0A 4Z2YA 3L1PA 5CYVA 2OTJI 4G7HF 1FPQA 1FLIA 1I27A 2IBDA 3GBGA 3H3ZA 4C3JJ 5F27A 3A01A 4BACA 2XKOA 2GXAA 2HQRA 1EV7A 5E20A 4U0WA 4LLNA 1R1UA 3IHUA 4L0YB 2E1OA 1IXRC 2VBWA 5J8CA 3SZTA 3OOUA 4B44A 2ZKZA 4AM3A 2KHMA 2D5VA 2NRAC 1YRNB 1MW7A 5LEJA 5DTDA 5DUIA 3F22A 2V1NA 3ESWB 3O3KA 1Q1HA 2M0MA 1WH7A 3T8TA 2EFOA 1A6IA 3A0HC 4MO7A 2WV1A 2UXXA 5TISC 1PP7U 5LGUA 2QSGX 2BBYA 5IOYA 3LAPA 3F8FA 1Z0XA 1GUUA 2ZFWA 3EUHC 4F93B 5J47A 3V8JA 3GZ6A 3WG7H 1LPQA 2CFXA 2OAZA 1SC7A 3I4MJ 4RB1A 3ZQGA 3OY9A 2R92J 3BJOA 3M7GA 1OR7A 2NS7A 1SD7A 2WWYA 1TTYA 1SFEA 1LB2A 1FSEA 1FP1D 1G3WA 4JX6A 4Y33A 1JHFA 1YW8A 2XVCA 2X0LA 2E36A 3MFKA 2ZNYA 3CCLI 2ECCA 3DKXA 1WJDA 2VKEA 2ZSIB 2HVQA 3JSOA 1J59A 4UVAA 5CLSA 3BG3A 2HKOA 2OC6A 1CGPA 3FXQA 2HVSA 2HFHA 2JA5J 1USSA 2ELKA 2Y0SA 2HKXA 2E2JJ 2KRCA 2OUMA 4I99C 1RNLA 2LF8A 2R0QC 4KN7X 4RAGA 4EJTA 1W36D 2A61A 3BR6A 1MH3A 2OZ6A 3QPSA 1TT0A 2Q1ZB 4Q47A 2XAUA 2K02A 4F92B 2XAJA 3J7AO 1RI7A 4G94A 3K4JA 5D6FA 3RKWA 3GTKJ 4BBRJ 3CC4I 1LUJB 3GYHX 3KFWX 2D45A 2LK2A 4CO8A 4RDUA 3A4CA 4QIWN 5KHDA 1W0UA 1I6XA 1F5TA 5CVUA 1R4NB 2XROA 4JYKA 2M87A 2WTEA 2Y69H 4EV0A 1DP7P 4KFCA 2X4HA 2E1MC 3HIFA 3R61A 1RETA 2GIVA 4N4OB 3CC7I 2VOOA 4B48A 3RTRA 4A3CJ 3OMYA 1TP4A 3MZYA 4BXFA 3SDBA 5E1ZB 4BKXA 5HDKA 1ZLKA 2R7ZJ 1TW2A 1RRJA 4Q4ZF 2EIMH 4NB5A 3F21A 3IRQA 5GPAA 2I10A 4YG2F 4WK8F 2WAEA 3GX4X 3WGIA 2JWTA 2EWNA 4RAFA 4Q48A 3DWLE 2XRNA 3HRMA 1VI0A 1FBQA 2VQLA 3D0SA 3DBHB 2VOPA 3IC7A 1FX7A 3L2WA 2R93J 2LKSA 1SANA 1QPIA 1RC9A 5E3MA 3OYHA 4UB6C 1ZTRA 4L9NA 3SQNA 4CHUA 1R7JA 4IQJA 3WODF 2RKHA 3PUBA 2KT0A 4D5FA 3JREA 4DBQA 1ETWA 2XSDC 4HA8A 3BJ6A 4IXAA 1N77A 2DFEA 5JLWA 3NAUA 4JX4A 2DFHA 1OR7C 4U7BA 3WE2A 1SD5A 5HS8A 4KICA 1LFUP 5IT3A 3RKQA 1WJ5A 4LB5A 5EZHA 5DM6F 3BG6A 3LQRA 2QQ9A 4U7DA 1SAXA 2EFWA 3LAJA 1QRYA 4CXFA 2DMUA 3Q9VA 4HEA2 3M3YJ 3PO2J 2WBMA 1P4WA 1R36A 3KCCA 2QLZA 3FXUA 1K4TA 3MD2A 3GFJA 4FISA 4F7ZA 2M9HA 2O61A 2H09A 1NTCA 3BP8A 2P7CB 3GLXA 4UVCA 3KP6A 5M5YJ 4MTDA 4MFEA 1W7PD 3H3VK 2F48A 4JBAA 2FF4A 1XN7A 1ZRCA 1R5ID 3E7LA 1MMSA 5DM7F 4HG2A 2X1EA 3RYPA 4FASD 4A12A 2WADA 4RGSA 1ACIA 2Z16A 3DQVC 3CMEI 5GAEJ 2H1LA 1KYZA 2MD5A 5D8LB 5HDGA 2VBXA 3SXYA 4D0PA 2Z99A 3PUFA 1TNSA 2VONA 1UB9A 1BIAA 3U2RA 1Y0UA 3BCAA 4BUPA 2MSYA 4RM3A 3DTKA 2OQGA 2DA2A 3O8GA 2M4GA 3I4NJ 1JGGA 1S8NA 4E6KG 1R4MB 4Y7NJ 1APLC 1VTNC 5AIPA 5H6RA 5DEQA 3ZQCA 2LG4A 3RJPA 1QQIA 4IHVA 2VBZA 1BBYA 3ZMDA 4OMYA 3CTAA 4LLLA 4P9FA 1QBJA 5KNLA 2DQLA 5J3LA 3TP0A 5K5QA 4YRVA 3KLNA 4LK0F 3BG9A 1ERDA 2XAQA 3FWEA 5J1UA 4RLQA 2AQEA 3DXJF 3ISPA 5HS7A 3N4MA 1F9NA 1W0TA 1HW5A 2ISZA 3MEXA 5IP9J 1K6YA 5IYDJ 2GZWA 3CLQA 2TDXA 2OV7A 4BQNA 3R4KA 3FXLA 3IH2A 2EK5A 4O6JA 1RUOA 3K4BA 1ON2A 4E7KA 3ML6A 2DOFA 2W82A 4WX9A 1UAAA 2UZKA 5EF6A 1FTZA 2XAGA 4CSWA 4EM2A 5LHHA 1IO2A 1N25A 3S1MJ 3CJSB 2VQHA 2KL4A 5BMZA 1FTTA 4PSXA 1XCBA 1TQMA 2FEZA 1E17A 3WU1B 1HA8A 3AKZA 5KVRA 3Q5FA 1YHQI 2H94A 5HLHA 4HPQA 2HNHA 2FNPA 5DUKA 3I4PA 4ZYAA 3QQAA 3WU2C 4HSTA 1QZZA 1G59A 5KK1A 1B8IA 4A0ZA 4NC6A 1Z7LA 2XC7A 5JI6A 5FFXA 1Z7UA 2F4IA 3CUQB 1S29A 1IXSB 4A6DA 5IP6A 4Q5SF 1XGSA 2LVSA 2YPRA 3A03A 1VQKI 2NNYA 3B73A 2F4OB 5L3FA 3LSRA 3KP5A 5K1YA 1W4MA 5D5VB 2UWMA 4V2FA 4IKFA 3OYMA 5ILUA 2DAOA 3HRTA 4IX7A 3ZPLA 1WJEA 2ELJA 2NS0A 2KIUA 2MFZA 3P7NA 3GEZA 3ABMH 4GGGA 3TKYA 2J5PA 4DIQA 2A3SA 3I64A 1LVKA 3GVAA 5DD4A 2HZTA 3IV5A 3ZMUA 1J09A 2EIJH 4I7HA 1L3LA 4FTHA 3GZ5A 1CF7B 1IN7A 1GHCA 2K9SA 4BXXJ 1DUXC 1TLHB 4AWXB 1MMDA 2F2EA 4LFUA 4B8XA 3AG2H 4IHXA 1QNTA 2E60A 2MLGA 1BI2A 1FY7A 2DMQA 3HPGA 1Y1WJ 2O03A 4MTEA 2K86A 4FE4A 1DGWY 1BR2A 2AXLA 2P0WA 1WVRA 1JUPA 2K7LA 3PFIA 1ETYA 2CGPA 1IV8A 3F6OA 3LSGA 1MBKA 3CJRB 5FJ8J 2HVRA 2O0YA 3PQJA 3QU3A 4DW6A 3GW2A 2W85A 3AFHA 3PNTA 1VQ6I 4XORA 2JPCA 4A5NA 2IAIA 1KU7A 1MSEC 4KNYA 3CP2A 4ZC3A 4BS9A 4AC0A 4CICA 1EH8A 2Y9ZA 2L3DA 3JRCA 1JJ6C 3S8PA 2KLOA 3ZCOA 1G2HA 3K7AJ 4J01A 2K5CA 2H6BA 2XGDA 1B4AA 4C3IJ 4L5IA 2A05A 3DV8A 5J6XA 4DQ2A 2KFDA 4EGZA 3EGVB 2JK3A 5CVVA 3G1OA 4JX5A 2M1BA 5D4SA 4HNTA 3MKWB 1XMXA 1ETVA 1U9NA 4GFBA 2CUFA 1BJZA 3DLLF 2FNAA 4C2UA 3F72A 4GRIA 5E79C 2HYGD 1WI3A 3HJEA 3HBLA 2XAHA 3HKZN 1R9TJ 1HDDC 3FKJA 4XM3A 4HNVA 1ETQA 2ZNZA 3EETA 3JRGA 1TWCJ 1Z6RA 3FBIB 4IVNA 4ZYGA 3RIRA 1NH3A 3BR2A 5BNGA 1YW7A 1T98A 2XRLA 1WIBA 2V1UA 2W48A 1IJWC 3VYTB 1GXQA 1U5TB 2ZJRF 1PUFB 4CGZA 3G1MA 3IP4B 1YX3A 3HGGA 3OL4A 5LHGA 3GTQJ 3S2DJ 2QCOA 2RREA 1IZ1A 3BC8A 2FD5A 2E7XA 1UG2A 1Z67A 5IPAA 3RZDJ 1I50J 1WKMA 3E6MA 2LY1A 2MC3A 2X6OA 2QA4I 1FOYA 2K3FA 3LNQA 5EG0B 1VNDA 5LGNA 4WXCA 4XLCA 3FXKA 1HC8A 3W2VA 1R00A 4PJLA 1XMKA 4EJUA 1HDPA 2ZXHA 3MMYB 2LREA 1ZG3A 1KZHA 5ICEA 1K83J 4XN3A 2R5ZB 4KITB 1J9IA 1MSFC 2JA6J 1ZRDA 1WHUA 2XDVA 3QYEA 3HSEA 3WTYC 3PFYA 3DU6A 3TOBA 1BR1A 1J2XA 4UV8A 3CUQA 3TQNA 2ZB9A 3NARA 3C2GA 4LMYA 3BG7A 1JJ8C 3K1MA 1S3JA 3HKZA 3K4KA 1X1BA 1RPWA 2WV0A 2LF7A 3BR3A 3CESA 5B3SH 2JA2A 3HOTA 2HTSA 2D1VA 3PSFA 4XNFA 5FFZA 5HLIA 4CDGA 1X3UA 4DYRA 1NHAA 3VODA 2DDAA 5BQTA 1IRGA 3BZ6A 3DP7A 3FK6A 5E3OA 4C2TA 1X1AA 2FRHA 2LKPA 4G7ZF 1U8BA 4XQFA 1QZEA 4AYBN 4RGXA 2JT1A 1K4SA 3NWSA 1FP2A 1SD6A 1HKQA 2ME0A 4E70A 3P5JA 3JRBA 4K2EA 1BW5A 4G9YA 3E0JB 1PDNC 3GTLJ 3DU5A 5CJ9A 2VC0A 3DKWA 3JRAA 3J7YJ 4AD9A 3ERMA 2EIKH 3W6KB 4B3AA 3S1NJ 2B63J 3ZR8X 4A5MA 4I6ZA 5FB2A 5FLXZ 1PUEE 3E3VA 1HW2A 2BY3A 1JXSA 2HYJA 2HZDA 3DFGA 1Q1VA 2DYSH 3QOEA 5DCMB 2CJJA 2VE8A 4M3FA 4XMYA 1E2XA 2FOKA 2QM3A 1RUNA 2KKOA 3RI4A 4HF2A 3CMAI 4R79A 1MJAA 5JR3A 3CCMI 5E17F 1YQAA 1X2MA 2E35A 2P6SA 2F5DA 2JTVA 3I54A 2HTJA 3CCRI 4EQQA 1S7AA 4EM1A 1Z91A 2STTA 1XX5A 1ZG5A 4A69C 2IRFG 2LY2A 4BQAA 1SVMA 2VXDA 3TW6A 5L3GA 2QZ8A 2VT3A 2E2HJ 3VSLA 3CO7C 2W1OA 2BVMA 4OIOF 2KZVA 3MCZA 5EEGA 2L2OA 3KEYA 4RLFA 4JOMA 1Z77A 4JK1X 1OKRA 2L9VA 2KRHA 2XB5A 4S0HB 3HOSA 2R7QA 1P9QC 1H88C 3W6VA 3QP6A 4O5VA 1ZHFA 2MH2A 3K70D 3DCFA 3FDYA 3FMQA 2VKVA 3J7ZI 3CCVI 2K9NA 2IVMA 1ORKA 4AYBA 2L5QA 2UUZA 4BBSJ 3AG4H 1XSVA 1GV5A 4BE0A 4XKCA 2FJ1A 2LKXA 2CW7A 1O7FA 3E97A 4QSHA 5EGOB 3WE3A 2D1HA 2HYFA 2OCCH 4FE7A 4XLHA 5HLGA 2IEKA 4PCQA 3K4LA 4XLNF 2CMPA 5DCFA 3TMOA 2JA7J 4BEHB 3CUQC 3U9GA 4L5JA 2UV1A 4H4KC 2Y0SN 2HDWA 3B02A 5H6QA 4E7IA 2QYOA 3M8EA 1RR7A 2DA5A 3BZKA 5FD6A 4ZDOA 3A2KA 2DMTA 4UB8C 3SDGA 2A5YB 1T08B 1P92A 3AG1H 1ETOA 1HLVA 1O3QA 4GDFA 2M5WA 1STZA 3MWMA 4KT6A 1UZCA 3FHNA 2W57A 4LD5A 5E8IA 1UHWA 3VSKA 1B72A 1MZBA 5FGMA 3HUGA 2VJ4A 2HXIA 4PUSA 2KJCA 2XPWA 2M4KA 4P55A 2ZFUA 3J7AY 4Y17A 4ZTJA 3GTOJ 2JN6A 2M3AA 2NXNB 2P4WA 4XLEA 2DJIA 3HG9A 4BY1J 5H2FC 4M6YA 1TT5B 1EKEA 5JVGF 3ONQA 5JHUA 3WTVC 2BW3B 2K4JA 2H8WA 5CVJA 2P5LC 1FEXA 1T95A 3M8FA 4ESJA 3HHHA 5HNHA 2DQRA 5D8KB 5FKNA 5K5RA 2ZXJA 1E3OC 1PYVA 1B6AA 4MEXF 2MGQA 1U9OA 4W1UA 2YUSA 3CDHA 1ZGWA 3RQIA 3JRIA 4M9XA 3JW4A 3BROA 1Z21A 1V4RA 2BE5F 2HOEA 1F43A 3KETA 1HSJA 1LQ1A 4L9TA 2RDPA 2V9KA 2MA3A 3TEDA 1BOAA 5ILVA 2IPQX 1B9MA 5K7FA 2QUFA 3VEPA 1O4XA 3T8RA 1I6HJ 1IDZA 2LSOA 5EDNA 3K1NA 3H5AA 2YU3A 1QO0D 4M74A 5KAIC 1YFHA 4BNCA 2Q0OA 2X48A 1S9HA 3CCJI 3BG5A 3GUDA 3OOPA 4XLAA 3I59B 5JHFA 2IW5A 3J81Z 1X3ZB 1EH6A 3ZGKA 3ZMZA 1VQ9I 1YW9A 2MD0A 1I5ZA 1A36A 4EJWA 4ZYEA 5D5UB 5E18F 3CDIA 4WWCA 3R6SA 4XRSA 4G8XA 1YYVA 3NWTA 2QSFX 2YX4A 2Q2EB 4D7NA 3IH4A 5K5OA 2ZMEB 3DTIA 5D4RA 3OSGA 1BI1A 4IL6C 5C44J 1BOBA 2RQQA 2DODA 2PFBA 2CQXA 2MH9A 2KIQA 2CUEA 5A2QZ 3N97A 3PIPF 3OYKA 5LRSA 5CQGA 2DA1A 1SMYF 3CLOA 2BVLA 4KIBA 1H89C 2Y75A 4UUSA 2WA0A 3CCUI 3HTUA 3HEFA 2NAZA 2L54A 2FQ4A 1LDJA 1D1BA 4BJ6C 2VKHA 3JCUC 1VQOI 2R7TA 2L9SA 3TDZC 3LSMA 2A6HF 1JTYA 1HOMA 4M3GA 1POGA 5C3EJ 4UVBA 5L3EA 2QGUA 1S5LC 1P4AA 3FKIJ 2GM4A 5IOZA 1TW3A 3FXRA 3S14J 3NRVA 4D5CA 4U0VA 2OBPA 4WXHA 5CQEA 5B1AH 3OYFA 3H92A 1V3FA 1FOKA 1FNNA 3GXOA 3A0BC 3PL8A 4KA4A 1TQIA 2ESHA 1WSUA 5EYRA 3OR1C 5F1JA 5CVRA 1O3TA 2EA2A 2F5VA 2XGEA 4HYEA 3BDDA 3WGHA 3DEUA 3D1NI 2L7ZA 1IUFA 1KU2A 2MW8A 2GA2A 1J75A 3RDIA 3KZYA 2R5YA 4ZTFA 9ANTA 2L02A 4IRGA 2E1NA 3JRDA 2QBYB 4MIMA 1W7PB 2Y2ZA 3PIOF 2LYCA 2XKPA 2O9LA 3C3WA 5D5WB 4XOPA 4ON0A 2EZIA 3S1QJ 2NVXJ 1Z1DA 1HF0A 2IGMA 1AHDP 4XK4A 4OWRB 4WCGA 2R4GA 3FM3A 2R7XA 4HF0A 5C4XJ 2YX7A 4A3EJ 1YLFA 4XKVA 1H9TA 2ECBA 4HQEA 3S32A 1SVOA 2LH9A 5EEAA 2DT6A 2QQ8A 3EQLF 3ZMSA 4RAYA 3T0YA 2AHQA 5E1XA 4KN4X 3H36A 2CS3A 1V5GA 3IAS2 1BW6A 3N05A 4II3A 2VL8A 3IWFA 4P5OA 2L7MP 2CSOA 4XSZF 4BHPA 2V79A 3W3CA 4HLYA 3BR0A 1D0XA 1T6SA 5DYMA 3HL2A 3HPHA 1YRNA 2WY7Q 3FX3A 1JT6A 2BY2A 4HNUA 3VWBA 1OISA 1XGNA 3ZXSA 2TRTA 2CV2A 4X0GA 1XDSA 4CCKA 4BE1A 3DLAA 5TGTA 3I0TA 2Z3YA 4G12A 4I0AA 4BXUA 4ZDLA 2M45A 2P6TA 3F8MA 2RVCA 3QU6A 1B59A 2JPBA 1KU9A 3ULQB 3K70C 5GAHJ 2H1KA 2L4MA 3DEEA 4DZJA 1IUYA 3S3NA 5GTIC 2N8GA 4L5EA 2O8KA 2XPVA 4A2UA 3L2VA 2H8RA 3FXMA 2LR8A 3COAC 3OYNA 4A3LJ 2JJ7A 2VQGA 4G6TB 4BL0B 1HKTA 5JLXA 1SEUA 1HXDA 4M3EA 2Q8KA 2A68F 4PDKA 2JZYA 4C9YA 3HOXJ 5BOXA 1LE8B 1I1SA 4BHBA 3CF2A 3GZNB 4HSRA 1A35A 4FETA 2EH3A 3CQZJ 3UKGA 5L3CA 2FA5A 2ME6A 3TP3A 3K6GA 4I2OA 1HSTA 2WY8Q 3T5XA 2M8GX 1KA8A 2FU4A 2PMZN 3U1KA 3J80Z 2IT0A 5CVIA 1HKSA 4NDLA 4MHGA 1LFBA 3TW7A 2R7RA 1Z6TA 4N4NB 1QGPA 2VPRA 4ENJA 2P81A 2JQ7A 2IA2A 1IN8A 4XICA 1MMGA 1XMAA 4DOZA 4OMZA 4XBFA 1IF1A 4CCMA 2G7UA 2CQNA 1JGSA 4RBOA 1DGRM 3ABKH 3BJAA 1ZG1A 1RIOH 4RM2A 1YX5A 3HOUJ 3HOWJ 2L9NA 4KMFA 4Z6YA 1IXCA 4M9ZA 4HAMA 3MVPA 3AL0B 2KZGA 3VYRB 4CCNA 1JT0A 4QWQA 2RV8A 4U88A 1IW7F 4YEJA 1UCRA 5FKLA 2BYVE 3E5QA 3CCQI 4F55A 1W5SA 3OYJA 3TOAA 2GOXB 2F5CA 1K79A 3KEOA 5F0CA 3EPZA 1YJ9I 2CQKA 3M1CA 1R23A 1WGXA 3VDXA 3ELKA 4P9UA 4U87A 3DKYA 2HU9A 5FLXK 3QPHA 3L2QA 4PFOA 4N0BA 1QPMA 1I1GA 3ZQIA 2LFBA 4HLXA 1FSHA 1E0EA 3CDLA 2EV5A 4DNCA 1WI9A 1ETKA 2XIGA 3L2RA 3ZN1A 4CYDA 1V5FA 3ZQ7A 2DA6A 2Y31A 4ETSA 2DMPA 1IRZA 4ANJA 2FBIA 2JUGA 1QHGA 1WJAA 4EM0B 2NVYJ 2PMZA 4LG0B 2RGVA 4BGDA 2L4AA 2VASA 3BCBA 1BC8C 3K2AA 3JTHA 3JRHA 2RC4A 2XASA 4LITA 4CYCB 2HDDA 3RSNA 4ASNA 2OA4A 3FK7A 4YIFA 1RR8C 2DK8A 3KEQA 4YFKF 3EUAA 2ZJQF 3DEWA 3VPRA 4OIPF 5J4YA 2PMHA 1MNEA 3OS0A 2HQ5A 2FMLA 1ZR2A 3G2BA 4LOCA 2EV0A 2PJRB 2AO9A 1S7EA 3T1BA 5FKOA 3DBRB 3S1RJ 3JAMK 1QZYA 1IC8A 1ZQ3P 3AAFA 3FMRA 1TZLA 4BAYA 2V7FA 1RKTA 3K9TA 2X9DA 2BEOA 4BQOA 4MLOA 2V6EA 5DDGA 2K4BA 2PEXA 3HSRA 5GAGJ 1K78B 5K7HA 2D2WA 4AU7A 2OQRA 1UG0A 3WGGA 2PBIA 1RZ4A 2GAUA 3S16J 2NS8A 1TQPA 1G8XA 2ID3A 2GXBA 1AA7A 1WJBA 2DW4A 2GXGA 1AKHB 2C6YA 3ZP5A 2ZXWH 4FCYA 1KU3A 4XKBA 3LSJA 2EFQA 2ZMEC 2VC1A 2LMDA 3KIOA 3QRFF 4PK4A 4ENMA 3V4GA 2EFNA 4ABZA 4BJ5C 3K10A 3LWFA 3I53A 3ASNH 4MGRA 1KONA 1E3HA 4A3MJ 2AS5F 1FWZA 5LD2C 2NYXA 3P9CA 1YTYA 3ASOH 3M1EA 1JUMA 1ZARA 5ICGA 4O3MA 4FT8A 2NNNA 3GTPJ 2V6CA 1OCRH 3H3UA 4OAYA 4A3JJ 1DU0A 3JTGA 4RB0A 1YE9A 1LDKB 1YO5C 2LBFB 2O5RA 5ERIA 1V55H 2EILH 2XSJC 3F6VA 2FQ3A 3Q3SA 1XSXA 2VPLA 1N75A 1T33A 2JSCA 1T39A 1C0WA 4IOCF 4X6AJ 2BZTA 2RNGA 3W2WA 5IT9Z 1SD4A 4RB2C 4IRIA 2QF7A 5E8GA 4HDVA 3BOQA 4YIIA 2QKLB 2E1MB 4MQVA 2R7UA 2JSPA 2DT5A 2QQAA 2EZKA 4D9JA 5B5EC 3A01B 2BHYA 1MKMA 2GLOA 3SJMA 2W00A 1MNMC 1WCMJ 2KP6A 2JA8J 2ZO4A 4UUVA 4MNUA 5ICCA 1LJ9A 1SFKA 3H9JA 3I3LA 3HZJA 2P5KA 4IQ4A 2DPUA 5GTHC 3EYIA 4ENKA 4B3XA 4II2A 2V4JC 3QWLA 1W5TA 4XN0A 5HS9A 2EV6A 2HGCA 1R6RA 2K27A 4GYGA 3TO6A 4B47A 4XSXF 2PLYA 2XGCA 3BPXA 4CZCA 1H9GA 3MAJA 3O6BB 2VQCA 1X1CA 2Y0MA 4UY8I 3FZVA 5F64A 4E7SA 2Y30A 4BDYA 5CKTA 3AG3H 3FM5A 5DS9A 4OINF 5J8FA 3FHZA 1UJ8A 4Y4RA 5M5WJ 1LFPA 3VFZA 4HV5A 1ZR4A 5GPCA 1FBSA 1D0YA 2IGKA 4RGUA 3DF8A 1X58A 2OPTA 2J5OA 3CJNA 2DT7B 2MG4A 4KJZA 5A2QK 3I58A 1T2KA 2Y9YA 2H27A 1MJBA 3CD6I 4ZJZA 4AVPA 1JTXA 2XV4S 4BU2A 2O7OA 4J19A 4EATA 2XB0X 3OWTA 2V9PA 1R5HA 1HBXG 4HW0A 3D5LA 5FO5A 2H6CA 4IOAF 3B6AA 4A0YA 2DA7A 3VYSB 5J1YA 3QYFA 1IGNA 2F4MB 2XF7A 4UNOA 1CF7A 3HGYA 3LMMA 3QOPA 2NVUB 3FF5A 4LG0A 1LEBA 2WAQN 5HNFA 1TWGJ 3F8BA 1WWXA 3MZHA 5BPIA 4PGGA 5LBQA 1VQ7I 5AIQA 3IAM2 2L9RA 3PQKA 4NUBA 5HDNA 4QLCU 3H9GA 3HSFA 2E5ZA 5FROA 3OV8A 4Y3OA 1JUSA 2X6XA 4XRMA 1T56A 2DOAA 1RKWA 2XHKA 2HPIA 4V2GA 1Y8RB 4GO1A 4MFDA 1P7JA 3L2CA 1YJWI 1FMVA 1WJCA 3ZMVA 4U0YA 1Y8QB 2XGXA 5BS6A 1PJRA 1RESA 5FLMJ 1VQ5I 2P5VA 3WU0A 3CCSI 1D0ZA 1ZH5A 4NC8A 1XCVA 5HVQC 2L01A 1X4OA 2KRFA 3O8HA 4KMUX 5D6EA 4DGWB 5J40A 2G9WA 5FRMA 3QYBA 2Z5UA 1K78A 3K2ZA 4CCLA 3K4CA 1FJLA 2VXZA 1D1CA 2G0EA 3V42A 3RKYA 4HX7A 4MEYF 4S04A 2PQ8A 3K4NA 1XPXA 2BXZA 4HX8A 1VQPI 4BYYA 4XONA 3ZQHA 2W24A 4EEFG 1YS7A 2ZCWA 2JVHA 2DXIA 3HB9A 4AIDA 3H5NA 4HV6A 4D7MA 2P8TA 4OIRF 2R7VA 2ACJA 3AL0C 2HDCA 4XL9A 2DYRH 1X1PA 2RN7A 1DU6A 3V7SA 2IS1A 2Y48A 3TO7A 2CFOA 3E5XA 2CQ7A 2WAQA 3JSPA 4F91B 2VKDA 5F04A 1S72I 4HOBA 5HOOA 4IHYA 1CQTA 5DD8A 2YU9J 1X4PA 3HC7A 5C4JJ 4LB6B 3F9KA 2DFIA 2OZUA 4XLPF 4BE2A 1O3RA 1AOYA 4P1WA 3S3MA 2LD5A 2AXTC 3F0CA 2LC2A 1SFXA 4HRIA 3LA3A 4BDZA 2LP0A 4XRFA 1VQNI 2X6YA 1BN5A 2DU9A 3I5UA 4E7JA 3CCYA 3HOYJ 1TNTA 1D8KA 4BJTA 3OYIA 1U5TA 1ZGJA 4AIJA 1PUFA 4XLFA 3M4OJ 1XG1A 3W2AA 2P7VB 2X85A 2GA1A 4NHJA 1GLNA 2X51A 2MBFA 1FIPA 2AQFA 1JKOC 2E5NA 1A6QA 1OYWA 2R7DA 2TCTA 3ZQQA 1WRJA 1XB4A 3FMSA 5EG0A 2IP2A 5F1RA 3OS2A 1ODDA 1MBGA 3OR2C 1Z05A 3DPTA 1TL8A 1BC7C 3IRRA 2O6GE 4L0ZB 1EA3A 3L09A 3F8CA 1ENHA 3KZIC 2E34A 2LLKA 4B1RA 4D1QA 5E1WA 1SFUA 4G7OF 3GF2A 3J80K 2DPDA 2NVQJ 5KCMA 2R7WA 4ZZLA 3ECOA 2E7WA 1XD7A 2R5ZA 1MBEA 3QPTA 3LA7A 3ABTA 1FOXA 3BR1A 2KJBA 3JRFA 4DZPA 3RQ4A 1XC5A 2CV1A 2M8EA 3KE2A 1Z3XA 1QVTA 4NC7A 4WF2A 1XGOA 2ZJ2A 5TRDA 1FC3A 4M73A 4PSWA 3H9QA 2Z33A 3CJQB 2X6WA 1AWCA 2M7BA 2ZXIA 4OIQF 3BQYA 1NK3P 2HI3A 2FUG2 2DN0A 5LEKA 2VN2A 4H0EA 1S6LA 4HF1A 1JI8A 4KDPA 4G6QA 3RZOJ 1D3YA 2M2EA 4BQQA 3ABUA 4I01A 2EBIA 3GWZA 1D5YA 5AONA 1ULYA 3R60A 2DTZA 2CW0F 4BY7J 2VLAA 4XR6A 3WHBA 1XTAA 3LA2A 4KT5C 4KYWA 4AVZA 3BZCA 3GFLA 1FMWA 2I8DA 2DTRA 3CO6C 4HDUA 3B6CA 1REPC 1Y39A 1NK2P 2FE3A 3BQZA 3KYLA 4Y52J 4FQGA 4B09A 4PFPA 3G73A 1LVAA 1G3SA 4IHTA 3OYDA 2VI6A 4NQWB 3E6BA 4UUTA 5DCMA 1UHMA 4C3HJ 1TWAJ 2HQAA 4XKWA 2ISYA 5E3LA 4ZYDA 1B8IB 1MH4A 2Z1DA 3S17J 2W25A 2CRGA 5IYCJ 5IYBJ 4DYCA 1OFCX 2VT2A 1I3QJ 1U8RA 3ZQFA 2NOJB 1T38A 1R58A 1TBXA 1R49A 1LEAA 1U5TC 3IWZA 3HDDA 4RS8A 4AIHA 1PVEA 3IL2A 3HYIA 3SZGA 1T8IA 1O7LA 3MQ0A 2OU2A 3GMEA 3BT9A 3HXLA 3H1CA 4PJJA 2FSWA 1VQ8I 4YIRX 4A3DJ 2XAFA 2GQQA 2IGNA 3FISA 3F23A 1OCCH 3RYRA 3GLLA 3K69A 3L2UA 4C2MJ 2MYSA 1P4XA 4Y13A 4M71A 1VF9A 4IEJA 3RKXA 1Y0NA 4M6XA 2EINH 5LHIA 4JQFA 4CCJA 1JE8A 4E7LA 3GFMA 4F3QA 2ZSHB 4F52A 1Z9CA 1Y56A 4KUMA 3V8LA 1IRFA 2DMNA 4I0BA 4PJMA 2A6EF 2B7EA 3QODA 5EGOA 5H20A 5B66C 2W7NA 4HBLA 3WTZA 2L7KA 3WTSC 2G7HA 3E5UA 3PM1A 3OIOA 5L3DA 3OYAA 2PI0A 2LOOA 4BEHA 3TO9A 4ZDPA 1ETXA 2KIMA 3CMMA 4CUGA 2HS5A 3LSTA 1J0RA 1ZGAA 5M3MJ 1FYMA 3OL3A 2ETHA 1K6OA 1OJLA 3IH3A 3EDPA 2NOGA 3FXOA 3BR5A 4YELA 2V1XA 2O3FA 1QU3A 4IO9F 2V1DA 2W84A 4ITVA 1MGTA 2ADUA 3C18A 1OCTC 4L18B 4AIKA 1JHHA 1OMIA 4NBQA 2R7SA 3LSHA 4L9JA 2K85A 3LFKA 1FBUA 2VBYA 3RCOA 1DPRA 2ID6A 3Q0VA 2BGCA 4I98B 3P9IA 1V5EA 2RAEA 3V7CA 3W6JB 5JFRA 1P6RA 2B9SA 3R0AA 4A0XA 5IT9K 1GVDA 3BWGA 2YSRA 2LNBA 2V26A 4I76A 2HOSA 1DPUA 2BW3A 1KQ9A 2EZLA 1A31A 1ZLJA 3BY6A 2FOWA 3O2PE 3U21A 3OYLA 4E7ZA 1G3TA 2ZC2A 3S93A 3GTJJ 1TWFJ 1M1EB 2V9VA 4EVIA 2STWA 3C2HA 4B4CA 3CF5F 4C30A 3K1PA 1IN6A 1HW1A 2X1CA 4UHTA 3QP5A 1G3YA 2HOTA 1WFXA 2LTPA 1YIJI 1LKXA 1D8JA 3GCMA 1MBHA 2VE9A 1G4DA 1A04A 3IKVA 1F4KA 1W5CC 3PNVA 5LFAA 1K7AA 2QWWA 3C7JA 1KQ0A 3HOVJ 4UV9A 5FKMA 1FYLA 4QTRA 2HWVA 2GBYA 1XSDA 1FYKA 3KP4A 2QSHX 1MBFA 4G6DA 1I39A 1ZKGA 2CQQA 2GWRA 3LQQA 3E1SA 1YITI 1IAWA 1R71A 3VB2A 3KP7A 1R22A 1GV2A 2CO5A 3I59A 4W97A 3GTGJ 4A3BJ 1WPKA 4LK1F 4A6EA 4PJ0C 4YFNF 3OYEA 1K61A 2XUBA 2NVTJ 3PNYA 1LDDA 1MDMB 4Y15A 1DDNA 3WHCA 5E3NA 2FBHA 1XGMA 4J00A 2HR3A 1Z3YA 2PMUA 1H8AC 2DJNA 1JKPC 2IGOA 2Q2EA 1LNWA 1OQYA 3D5SC 5BPDA 2VUMJ 2ZMEA 2VB6A 4HZFA 4LLGF 3G4SI 2EQRA 1ON1A 3DPUA 3GO5A 3LFUA 2L7FP 3IUOA 4ESBA 1UMQA 1X2NA 3KPHA 2HQNA 1WQ2A 2K9MA 2FX0A 2K3PA 1D1AA 2DCEA 2JRMA 4IPAA 5LRRA 3HHGA 1MMNA 2COBA 2JUCA 4A3FJ 3IKTA 1TC3C 3F3XA 1EJ9A 4NQWA 1KYWA 2YR2A 2WAFA 3NQOA 2ZBKA 4ENNA 4E7HA 3LSPA 2ZJPF 3VYUB 5HODA 1GDTA 4BH9A 1T0FA 3V7RA 2DO7A 3KZZA 2R3SA 4PJNA 3A02A 1FT9A 2I5UA 3I71A 4M72A 4LGWA 3V8KA 3Q9SA 3MKYB 1OCPA 2MLKA 1ZK8A 4MQ9F 4LG3A 3U1DA 2EJRA 2ESNA 1OCOH 2DK5A 5B1BH 4WXDA 5J1RA 2M30A 3RPUD 3JR9A 3S3OA 2FMYA 1ZREA 3ECHA 3ZOBA 3QPLA 2KISA 1O3SA 2KDOA 1Y6IA 2IS2A 3I55I 2A07F 3K4MA 5F6FA 3PSIA 4ZYHA 2IJLA 3C1DA 4XRSG 4AUXA 1F1ZA 5IP7J 2MC4A 1F36A 2A69F 3NEUA 4LIUA 3HOZJ 2M7AA 4EMSA 3E6CC 3DBLB 3WTTC 3OYBA 2QEXI 2QBYA 1W7PA 1QHHD 4R8HA 1PP8F 3LSIA 3ERED 1H0MA 2RQPA 4DBRA 1W36C 4GYIA 1HCRA 3SFIA 1OYIA 2LY9A 3H5RA 2ELHA 3H0DA 1GXPA 1MJ9A 3KX2A 3DTEA 5EEHA 3WTUC 3Q0UA 3FXJA 3HTSB 5FKKA 3VOEA 1ONVA 4EJVA 1MBJA 2HPMA 4IHSA 5GP9A 3KLOA 4FHTA 2OF7A 2CU7A 1MIJA 4BHCA 2DLLA 2EZHA 1U78A 2X1DA 2DA3A 2F6CA 3FBNB 5F0FA 1QA6A 3OS1A 5JVTA 1ZYRF 5ICFA 1YS6A 1IDYA 3TGNA 1A5JA 1FOWA 1OLTA 3CUOA 3S2WA 1YIOA 2CYYA 2VJJA 1I3AA 4EJOA 1WJFA 2QENA 1EH7A 1XS9A 1YG2A 4CH7A 3F8NA 1J7KA 2M34A 1SMTA 3ABLH 2CWEA 2DI3A 2QKMB 1GVJA 1ZN2A 2VJIA 1VQLI 2QVOA 2CH0A 4JP0A 2DOEA 1U3EM 2JVGA 5FRNA
chains in the Genus database with same CATH topology
3G71I 3CJRB 3CJQB 1VQ6I 3PIPF 1YJNI 5GAHJ 2ZJPF 3CCUI 4IO9F 1VQOI 3CJTB 1VQPI 2ZJQF 3CJSB 3EGVB 2OTLI 1YHQI 4UY8I 1Y39A 3I55I 4V19K 5DM6F 2E36A 1S72I 2NXNB 2FOWA 3CCLI 3DLLF 3CC2I 3J7YJ 5JVGF 1VQMI 5GAGJ 3I56I 2H8WA 2QEXI 3CF5F 1VQKI 1VQ4I 3CD6I 1VQNI 2JQ7A 1YIJI 3CCEI 1MMSA 5DM7F 3PIOF 5GADJ 3CMAI 3CCMI 1WIBA 4IOAF 1ACIA 2E35A 3CMEI 1VQ8I 5GAEJ 3CCRI 3G6EI 2ZJRF 1YITI 3CC4I 1YI2I 1VQ7I 1QA6A 3CCQI 2E34A 3CCJI 1FOWA 2QA4I 1FOYA 2K3FA 1YJ9I 1HC8A 1VQ9I 2OTJI 3CC7I 3G4SI 1YJWI 4IOCF 1FOXA 3J7ZI 3CCVI 1VQLI 1VQ5I 3CCSI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G71 I;  3CJR B;  3CJQ B;  1VQ6 I;  3PIP F;  1YJN I;  5GAH J;  2ZJP F;  3CCU I;  4IO9 F;  1VQO I;  3CJT B;  1VQP I;  2ZJQ F;  3CJS B;  3EGV B;  2OTL I;  1YHQ I;  4UY8 I;  1Y39 A;  3I55 I;  4V19 K;  5DM6 F;  2E36 A;  1S72 I;  2NXN B;  2FOW A;  3CCL I;  3DLL F;  3CC2 I;  3J7Y J;  5JVG F;  1VQM I;  5GAG J;  3I56 I;  2H8W A;  2QEX I;  3CF5 F;  1VQK I;  1VQ4 I;  3CD6 I;  1VQN I;  2JQ7 A;  1YIJ I;  3CCE I;  1MMS A;  5DM7 F;  3PIO F;  5GAD J;  3CMA I;  3CCM I;  1WIB A;  4IOA F;  1ACI A;  2E35 A;  3CME I;  1VQ8 I;  5GAE J;  3CCR I;  3G6E I;  2ZJR F;  1YIT I;  3CC4 I;  1YI2 I;  1VQ7 I;  1QA6 A;  3CCQ I;  2E34 A;  3CCJ I;  1FOW A;  2QA4 I;  1FOY A;  2K3F A;  1YJ9 I;  1HC8 A;  1VQ9 I;  2OTJ I;  3CC7 I;  3G4S I;  1YJW I;  4IOC F;  1FOX A;  3J7Z I;  3CCV I;  1VQL I;  1VQ5 I;  3CCS I; 
#chains in the Genus database with same CATH topology
 3BTJ A;  3RPQ A;  3G71 I;  4M3D A;  2CG4 A;  2OCE A;  4OAZ A;  1DQU A;  4OOI A;  3PO3 J;  1SVL A;  1X19 A;  2VIX A;  1MD0 A;  2B0L A;  1S7O A;  2CV0 A;  1UEL B;  3M07 A;  3X2Q H;  4YFX F;  3KYD B;  5FD5 A;  2EB7 A;  2MAB A;  3UNG C;  1T0F C;  2BXY A;  5D5X B;  4CA0 A;  1P2F A;  3UR3 C;  4A3I J;  2HEO A;  3CJT B;  4FX4 A;  2IS6 A;  4I09 A;  1WH5 A;  2OJE D;  4ZZD A;  1BI0 A;  2M0C A;  2KPM A;  4I02 A;  2ICW G;  4M3B A;  4RB3 C;  1LE8 A;  1MND A;  2EA4 A;  2UXN A;  2XF5 A;  4A3K J;  2O8X A;  1BIB A;  3REO A;  4RA2 A;  3ZMT A;  1V54 H;  3M9A A;  2KDZ A;  1OCZ H;  1TWH J;  1BL0 A;  2IA0 A;  5ILS A;  5J4V A;  2E19 A;  3CZ6 A;  3MN2 A;  3R0J A;  2E2I J;  1OYY A;  4RGR A;  2JRT A;  1VFC A;  3ROU A;  4V19 K;  1B72 B;  4NNJ A;  3HUG B;  2L0K A;  1UHS A;  2Z2S B;  2K40 A;  4M6V A;  3LL7 A;  1MDM A;  3CC2 I;  1UST A;  2WB1 N;  4DYQ A;  2F5F A;  1XDU A;  4L9V A;  1VQM I;  5CPR B;  2YS9 A;  3I56 I;  1QVU A;  1BA5 A;  1KGS A;  3Q0W A;  1BM9 A;  4IZZ A;  1VQ4 I;  3RPU A;  3J81 K;  4KIF A;  3CCE I;  3OIP A;  1O57 A;  4EGY A;  4GCV A;  5M5X J;  4OU0 A;  2CUJ A;  2COM A;  3SFZ A;  3ZQL A;  3L7W A;  1AU7 A;  3OYG A;  2R7O A;  3L9F A;  3G1L A;  3DPL C;  3E6D A;  1EF4 A;  1P7I A;  4N9H A;  3CP8 A;  3QAH A;  3FIW A;  3P9K A;  5EJC A;  3G6E I;  2KIF A;  4A93 J;  1HQC A;  3SYT A;  3SHF A;  1YI2 I;  2XF6 A;  2FBK A;  3H0G J;  2Z9O A;  3CMY A;  3S15 J;  5K7Z A;  3M8J A;  2K9L A;  3MKL A;  5DV5 A;  2BV6 A;  1U6G A;  3LSK A;  5IY5 H;  4QPQ A;  3BTC A;  3WG9 A;  4KIG A;  4P96 A;  4N9I A;  4IHW A;  6PAX A;  1Y1V J;  5L3B A;  2K9Q A;  2LDU A;  2QQB A;  1B1B A;  1MMA A;  1VZ0 A;  3MKZ A;  3WTW C;  2LRD A;  4HQM A;  4S05 A;  1SFO J;  3KP3 A;  2EFP A;  4XID A;  1NG6 A;  2PG4 A;  3KYC B;  3OYC A;  3EUK L;  3GTM J;  2R7F A;  3L00 A;  1IN5 A;  1IN4 A;  4XOT A;  4CCO A;  5ED4 A;  4IRH A;  2DA4 A;  4UXN A;  1BJA A;  2GIZ A;  3BLY A;  1X1D A;  1UFM A;  4CYC A;  1FZP B;  5FLV A;  4X1E A;  2CW8 A;  2WB1 A;  1YJN I;  4RMN A;  4LIV A;  1ZAO A;  4CZZ A;  2CUZ A;  1N78 A;  2PX9 A;  1NG7 A;  1BI3 A;  3TBI A;  1JKQ C;  2VOD A;  1FIA A;  3HRU A;  3KP2 A;  4IF4 A;  2HOA A;  3EUH A;  3C2B A;  3A1Y A;  1KQ8 A;  4FX0 A;  2E1C A;  4IJA A;  2PJR A;  2PN6 A;  4UUS B;  2FXA A;  2RNJ A;  3BTL A;  1D5V A;  3TL4 X;  3OSF A;  2BHZ A;  2E71 A;  2DFF A;  3D5R C;  5EZG A;  2KQR A;  3SEQ A;  2PJP A;  3K0L A;  3G3Z A;  3HRS A;  2OTL I;  1YOV B;  2BY1 A;  4ZH4 F;  2VJ5 A;  4R1H A;  4PGH A;  1WZ2 A;  1SAU A;  4E4H A;  5F0H A;  3ZN0 A;  4M9S A;  3BTI A;  1J5Y A;  2OD5 A;  5LGT A;  1ITY A;  1R1T A;  2A6T A;  2IA1 A;  4QPO A;  1E3P A;  3SZP A;  2IS4 A;  2XPU A;  4A3G J;  2KMU A;  3LOC A;  1R5G A;  2WC2 A;  3H35 A;  4PZJ A;  1AKH A;  3I9V 2;  5KAF C;  4TV7 A;  1GT0 C;  3HM5 A;  1G6N A;  1W1W E;  2W4S A;  5F08 A;  4LJZ F;  1X3W B;  5GAD J;  1DP3 A;  3BPV A;  1OPC A;  1IV6 A;  3EYY A;  1IRX A;  5TJJ A;  3PJR A;  3OIQ A;  1BR4 A;  2DDB A;  3TDU C;  2R5Y B;  4KIS A;  2EPF A;  3S2H J;  1U2W A;  1ZRF A;  2F5E A;  3ZRG A;  2JMW A;  3GFI A;  1ZEL A;  4ESF A;  3JAM Z;  2LBF A;  1IG7 A;  2IXS A;  5HLT A;  1JKR C;  4RAZ A;  1R1V A;  1L0O C;  3MZ8 A;  1B9N A;  1U0J A;  4B43 A;  3WTX C;  5M3F J;  2BOL A;  5LLQ A;  2A5W A;  2HXO A;  4GXO A;  4DJA A;  2DBB A;  4HX4 A;  2GOM A;  3SEZ A;  2BY0 A;  4Z2Y A;  3L1P A;  5CYV A;  2OTJ I;  4G7H F;  1FPQ A;  1FLI A;  1I27 A;  2IBD A;  3GBG A;  3H3Z A;  4C3J J;  5F27 A;  3A01 A;  4BAC A;  2XKO A;  2GXA A;  2HQR A;  1EV7 A;  5E20 A;  4U0W A;  4LLN A;  1R1U A;  3IHU A;  4L0Y B;  2E1O A;  1IXR C;  2VBW A;  5J8C A;  3SZT A;  3OOU A;  4B44 A;  2ZKZ A;  4AM3 A;  2KHM A;  2D5V A;  2NRA C;  1YRN B;  1MW7 A;  5LEJ A;  5DTD A;  5DUI A;  3F22 A;  2V1N A;  3ESW B;  3O3K A;  1Q1H A;  2M0M A;  1WH7 A;  3T8T A;  2EFO A;  1A6I A;  3A0H C;  4MO7 A;  2WV1 A;  2UXX A;  5TIS C;  1PP7 U;  5LGU A;  2QSG X;  2BBY A;  5IOY A;  3LAP A;  3F8F A;  1Z0X A;  1GUU A;  2ZFW A;  3EUH C;  4F93 B;  5J47 A;  3V8J A;  3GZ6 A;  3WG7 H;  1LPQ A;  2CFX A;  2OAZ A;  1SC7 A;  3I4M J;  4RB1 A;  3ZQG A;  3OY9 A;  2R92 J;  3BJO A;  3M7G A;  1OR7 A;  2NS7 A;  1SD7 A;  2WWY A;  1TTY A;  1SFE A;  1LB2 A;  1FSE A;  1FP1 D;  1G3W A;  4JX6 A;  4Y33 A;  1JHF A;  1YW8 A;  2XVC A;  2X0L A;  2E36 A;  3MFK A;  2ZNY A;  3CCL I;  2ECC A;  3DKX A;  1WJD A;  2VKE A;  2ZSI B;  2HVQ A;  3JSO A;  1J59 A;  4UVA A;  5CLS A;  3BG3 A;  2HKO A;  2OC6 A;  1CGP A;  3FXQ A;  2HVS A;  2HFH A;  2JA5 J;  1USS A;  2ELK A;  2Y0S A;  2HKX A;  2E2J J;  2KRC A;  2OUM A;  4I99 C;  1RNL A;  2LF8 A;  2R0Q C;  4KN7 X;  4RAG A;  4EJT A;  1W36 D;  2A61 A;  3BR6 A;  1MH3 A;  2OZ6 A;  3QPS A;  1TT0 A;  2Q1Z B;  4Q47 A;  2XAU A;  2K02 A;  4F92 B;  2XAJ A;  3J7A O;  1RI7 A;  4G94 A;  3K4J A;  5D6F A;  3RKW A;  3GTK J;  4BBR J;  3CC4 I;  1LUJ B;  3GYH X;  3KFW X;  2D45 A;  2LK2 A;  4CO8 A;  4RDU A;  3A4C A;  4QIW N;  5KHD A;  1W0U A;  1I6X A;  1F5T A;  5CVU A;  1R4N B;  2XRO A;  4JYK A;  2M87 A;  2WTE A;  2Y69 H;  4EV0 A;  1DP7 P;  4KFC A;  2X4H A;  2E1M C;  3HIF A;  3R61 A;  1RET A;  2GIV A;  4N4O B;  3CC7 I;  2VOO A;  4B48 A;  3RTR A;  4A3C J;  3OMY A;  1TP4 A;  3MZY A;  4BXF A;  3SDB A;  5E1Z B;  4BKX A;  5HDK A;  1ZLK A;  2R7Z J;  1TW2 A;  1RRJ A;  4Q4Z F;  2EIM H;  4NB5 A;  3F21 A;  3IRQ A;  5GPA A;  2I10 A;  4YG2 F;  4WK8 F;  2WAE A;  3GX4 X;  3WGI A;  2JWT A;  2EWN A;  4RAF A;  4Q48 A;  3DWL E;  2XRN A;  3HRM A;  1VI0 A;  1FBQ A;  2VQL A;  3D0S A;  3DBH B;  2VOP A;  3IC7 A;  1FX7 A;  3L2W A;  2R93 J;  2LKS A;  1SAN A;  1QPI A;  1RC9 A;  5E3M A;  3OYH A;  4UB6 C;  1ZTR A;  4L9N A;  3SQN A;  4CHU A;  1R7J A;  4IQJ A;  3WOD F;  2RKH A;  3PUB A;  2KT0 A;  4D5F A;  3JRE A;  4DBQ A;  1ETW A;  2XSD C;  4HA8 A;  3BJ6 A;  4IXA A;  1N77 A;  2DFE A;  5JLW A;  3NAU A;  4JX4 A;  2DFH A;  1OR7 C;  4U7B A;  3WE2 A;  1SD5 A;  5HS8 A;  4KIC A;  1LFU P;  5IT3 A;  3RKQ A;  1WJ5 A;  4LB5 A;  5EZH A;  5DM6 F;  3BG6 A;  3LQR A;  2QQ9 A;  4U7D A;  1SAX A;  2EFW A;  3LAJ A;  1QRY A;  4CXF A;  2DMU A;  3Q9V A;  4HEA 2;  3M3Y J;  3PO2 J;  2WBM A;  1P4W A;  1R36 A;  3KCC A;  2QLZ A;  3FXU A;  1K4T A;  3MD2 A;  3GFJ A;  4FIS A;  4F7Z A;  2M9H A;  2O61 A;  2H09 A;  1NTC A;  3BP8 A;  2P7C B;  3GLX A;  4UVC A;  3KP6 A;  5M5Y J;  4MTD A;  4MFE A;  1W7P D;  3H3V K;  2F48 A;  4JBA A;  2FF4 A;  1XN7 A;  1ZRC A;  1R5I D;  3E7L A;  1MMS A;  5DM7 F;  4HG2 A;  2X1E A;  3RYP A;  4FAS D;  4A12 A;  2WAD A;  4RGS A;  1ACI A;  2Z16 A;  3DQV C;  3CME I;  5GAE J;  2H1L A;  1KYZ A;  2MD5 A;  5D8L B;  5HDG A;  2VBX A;  3SXY A;  4D0P A;  2Z99 A;  3PUF A;  1TNS A;  2VON A;  1UB9 A;  1BIA A;  3U2R A;  1Y0U A;  3BCA A;  4BUP A;  2MSY A;  4RM3 A;  3DTK A;  2OQG A;  2DA2 A;  3O8G A;  2M4G A;  3I4N J;  1JGG A;  1S8N A;  4E6K G;  1R4M B;  4Y7N J;  1APL C;  1VTN C;  5AIP A;  5H6R A;  5DEQ A;  3ZQC A;  2LG4 A;  3RJP A;  1QQI A;  4IHV A;  2VBZ A;  1BBY A;  3ZMD A;  4OMY A;  3CTA A;  4LLL A;  4P9F A;  1QBJ A;  5KNL A;  2DQL A;  5J3L A;  3TP0 A;  5K5Q A;  4YRV A;  3KLN A;  4LK0 F;  3BG9 A;  1ERD A;  2XAQ A;  3FWE A;  5J1U A;  4RLQ A;  2AQE A;  3DXJ F;  3ISP A;  5HS7 A;  3N4M A;  1F9N A;  1W0T A;  1HW5 A;  2ISZ A;  3MEX A;  5IP9 J;  1K6Y A;  5IYD J;  2GZW A;  3CLQ A;  2TDX A;  2OV7 A;  4BQN A;  3R4K A;  3FXL A;  3IH2 A;  2EK5 A;  4O6J A;  1RUO A;  3K4B A;  1ON2 A;  4E7K A;  3ML6 A;  2DOF A;  2W82 A;  4WX9 A;  1UAA A;  2UZK A;  5EF6 A;  1FTZ A;  2XAG A;  4CSW A;  4EM2 A;  5LHH A;  1IO2 A;  1N25 A;  3S1M J;  3CJS B;  2VQH A;  2KL4 A;  5BMZ A;  1FTT A;  4PSX A;  1XCB A;  1TQM A;  2FEZ A;  1E17 A;  3WU1 B;  1HA8 A;  3AKZ A;  5KVR A;  3Q5F A;  1YHQ I;  2H94 A;  5HLH A;  4HPQ A;  2HNH A;  2FNP A;  5DUK A;  3I4P A;  4ZYA A;  3QQA A;  3WU2 C;  4HST A;  1QZZ A;  1G59 A;  5KK1 A;  1B8I A;  4A0Z A;  4NC6 A;  1Z7L A;  2XC7 A;  5JI6 A;  5FFX A;  1Z7U A;  2F4I A;  3CUQ B;  1S29 A;  1IXS B;  4A6D A;  5IP6 A;  4Q5S F;  1XGS A;  2LVS A;  2YPR A;  3A03 A;  1VQK I;  2NNY A;  3B73 A;  2F4O B;  5L3F A;  3LSR A;  3KP5 A;  5K1Y A;  1W4M A;  5D5V B;  2UWM A;  4V2F A;  4IKF A;  3OYM A;  5ILU A;  2DAO A;  3HRT A;  4IX7 A;  3ZPL A;  1WJE A;  2ELJ A;  2NS0 A;  2KIU A;  2MFZ A;  3P7N A;  3GEZ A;  3ABM H;  4GGG A;  3TKY A;  2J5P A;  4DIQ A;  2A3S A;  3I64 A;  1LVK A;  3GVA A;  5DD4 A;  2HZT A;  3IV5 A;  3ZMU A;  1J09 A;  2EIJ H;  4I7H A;  1L3L A;  4FTH A;  3GZ5 A;  1CF7 B;  1IN7 A;  1GHC A;  2K9S A;  4BXX J;  1DUX C;  1TLH B;  4AWX B;  1MMD A;  2F2E A;  4LFU A;  4B8X A;  3AG2 H;  4IHX A;  1QNT A;  2E60 A;  2MLG A;  1BI2 A;  1FY7 A;  2DMQ A;  3HPG A;  1Y1W J;  2O03 A;  4MTE A;  2K86 A;  4FE4 A;  1DGW Y;  1BR2 A;  2AXL A;  2P0W A;  1WVR A;  1JUP A;  2K7L A;  3PFI A;  1ETY A;  2CGP A;  1IV8 A;  3F6O A;  3LSG A;  1MBK A;  3CJR B;  5FJ8 J;  2HVR A;  2O0Y A;  3PQJ A;  3QU3 A;  4DW6 A;  3GW2 A;  2W85 A;  3AFH A;  3PNT A;  1VQ6 I;  4XOR A;  2JPC A;  4A5N A;  2IAI A;  1KU7 A;  1MSE C;  4KNY A;  3CP2 A;  4ZC3 A;  4BS9 A;  4AC0 A;  4CIC A;  1EH8 A;  2Y9Z A;  2L3D A;  3JRC A;  1JJ6 C;  3S8P A;  2KLO A;  3ZCO A;  1G2H A;  3K7A J;  4J01 A;  2K5C A;  2H6B A;  2XGD A;  1B4A A;  4C3I J;  4L5I A;  2A05 A;  3DV8 A;  5J6X A;  4DQ2 A;  2KFD A;  4EGZ A;  3EGV B;  2JK3 A;  5CVV A;  3G1O A;  4JX5 A;  2M1B A;  5D4S A;  4HNT A;  3MKW B;  1XMX A;  1ETV A;  1U9N A;  4GFB A;  2CUF A;  1BJZ A;  3DLL F;  2FNA A;  4C2U A;  3F72 A;  4GRI A;  5E79 C;  2HYG D;  1WI3 A;  3HJE A;  3HBL A;  2XAH A;  3HKZ N;  1R9T J;  1HDD C;  3FKJ A;  4XM3 A;  4HNV A;  1ETQ A;  2ZNZ A;  3EET A;  3JRG A;  1TWC J;  1Z6R A;  3FBI B;  4IVN A;  4ZYG A;  3RIR A;  1NH3 A;  3BR2 A;  5BNG A;  1YW7 A;  1T98 A;  2XRL A;  1WIB A;  2V1U A;  2W48 A;  1IJW C;  3VYT B;  1GXQ A;  1U5T B;  2ZJR F;  1PUF B;  4CGZ A;  3G1M A;  3IP4 B;  1YX3 A;  3HGG A;  3OL4 A;  5LHG A;  3GTQ J;  3S2D J;  2QCO A;  2RRE A;  1IZ1 A;  3BC8 A;  2FD5 A;  2E7X A;  1UG2 A;  1Z67 A;  5IPA A;  3RZD J;  1I50 J;  1WKM A;  3E6M A;  2LY1 A;  2MC3 A;  2X6O A;  2QA4 I;  1FOY A;  2K3F A;  3LNQ A;  5EG0 B;  1VND A;  5LGN A;  4WXC A;  4XLC A;  3FXK A;  1HC8 A;  3W2V A;  1R00 A;  4PJL A;  1XMK A;  4EJU A;  1HDP A;  2ZXH A;  3MMY B;  2LRE A;  1ZG3 A;  1KZH A;  5ICE A;  1K83 J;  4XN3 A;  2R5Z B;  4KIT B;  1J9I A;  1MSF C;  2JA6 J;  1ZRD A;  1WHU A;  2XDV A;  3QYE A;  3HSE A;  3WTY C;  3PFY A;  3DU6 A;  3TOB A;  1BR1 A;  1J2X A;  4UV8 A;  3CUQ A;  3TQN A;  2ZB9 A;  3NAR A;  3C2G A;  4LMY A;  3BG7 A;  1JJ8 C;  3K1M A;  1S3J A;  3HKZ A;  3K4K A;  1X1B A;  1RPW A;  2WV0 A;  2LF7 A;  3BR3 A;  3CES A;  5B3S H;  2JA2 A;  3HOT A;  2HTS A;  2D1V A;  3PSF A;  4XNF A;  5FFZ A;  5HLI A;  4CDG A;  1X3U A;  4DYR A;  1NHA A;  3VOD A;  2DDA A;  5BQT A;  1IRG A;  3BZ6 A;  3DP7 A;  3FK6 A;  5E3O A;  4C2T A;  1X1A A;  2FRH A;  2LKP A;  4G7Z F;  1U8B A;  4XQF A;  1QZE A;  4AYB N;  4RGX A;  2JT1 A;  1K4S A;  3NWS A;  1FP2 A;  1SD6 A;  1HKQ A;  2ME0 A;  4E70 A;  3P5J A;  3JRB A;  4K2E A;  1BW5 A;  4G9Y A;  3E0J B;  1PDN C;  3GTL J;  3DU5 A;  5CJ9 A;  2VC0 A;  3DKW A;  3JRA A;  3J7Y J;  4AD9 A;  3ERM A;  2EIK H;  3W6K B;  4B3A A;  3S1N J;  2B63 J;  3ZR8 X;  4A5M A;  4I6Z A;  5FB2 A;  5FLX Z;  1PUE E;  3E3V A;  1HW2 A;  2BY3 A;  1JXS A;  2HYJ A;  2HZD A;  3DFG A;  1Q1V A;  2DYS H;  3QOE A;  5DCM B;  2CJJ A;  2VE8 A;  4M3F A;  4XMY A;  1E2X A;  2FOK A;  2QM3 A;  1RUN A;  2KKO A;  3RI4 A;  4HF2 A;  3CMA I;  4R79 A;  1MJA A;  5JR3 A;  3CCM I;  5E17 F;  1YQA A;  1X2M A;  2E35 A;  2P6S A;  2F5D A;  2JTV A;  3I54 A;  2HTJ A;  3CCR I;  4EQQ A;  1S7A A;  4EM1 A;  1Z91 A;  2STT A;  1XX5 A;  1ZG5 A;  4A69 C;  2IRF G;  2LY2 A;  4BQA A;  1SVM A;  2VXD A;  3TW6 A;  5L3G A;  2QZ8 A;  2VT3 A;  2E2H J;  3VSL A;  3CO7 C;  2W1O A;  2BVM A;  4OIO F;  2KZV A;  3MCZ A;  5EEG A;  2L2O A;  3KEY A;  4RLF A;  4JOM A;  1Z77 A;  4JK1 X;  1OKR A;  2L9V A;  2KRH A;  2XB5 A;  4S0H B;  3HOS A;  2R7Q A;  1P9Q C;  1H88 C;  3W6V A;  3QP6 A;  4O5V A;  1ZHF A;  2MH2 A;  3K70 D;  3DCF A;  3FDY A;  3FMQ A;  2VKV A;  3J7Z I;  3CCV I;  2K9N A;  2IVM A;  1ORK A;  4AYB A;  2L5Q A;  2UUZ A;  4BBS J;  3AG4 H;  1XSV A;  1GV5 A;  4BE0 A;  4XKC A;  2FJ1 A;  2LKX A;  2CW7 A;  1O7F A;  3E97 A;  4QSH A;  5EGO B;  3WE3 A;  2D1H A;  2HYF A;  2OCC H;  4FE7 A;  4XLH A;  5HLG A;  2IEK A;  4PCQ A;  3K4L A;  4XLN F;  2CMP A;  5DCF A;  3TMO A;  2JA7 J;  4BEH B;  3CUQ C;  3U9G A;  4L5J A;  2UV1 A;  4H4K C;  2Y0S N;  2HDW A;  3B02 A;  5H6Q A;  4E7I A;  2QYO A;  3M8E A;  1RR7 A;  2DA5 A;  3BZK A;  5FD6 A;  4ZDO A;  3A2K A;  2DMT A;  4UB8 C;  3SDG A;  2A5Y B;  1T08 B;  1P92 A;  3AG1 H;  1ETO A;  1HLV A;  1O3Q A;  4GDF A;  2M5W A;  1STZ A;  3MWM A;  4KT6 A;  1UZC A;  3FHN A;  2W57 A;  4LD5 A;  5E8I A;  1UHW A;  3VSK A;  1B72 A;  1MZB A;  5FGM A;  3HUG A;  2VJ4 A;  2HXI A;  4PUS A;  2KJC A;  2XPW A;  2M4K A;  4P55 A;  2ZFU A;  3J7A Y;  4Y17 A;  4ZTJ A;  3GTO J;  2JN6 A;  2M3A A;  2NXN B;  2P4W A;  4XLE A;  2DJI A;  3HG9 A;  4BY1 J;  5H2F C;  4M6Y A;  1TT5 B;  1EKE A;  5JVG F;  3ONQ A;  5JHU A;  3WTV C;  2BW3 B;  2K4J A;  2H8W A;  5CVJ A;  2P5L C;  1FEX A;  1T95 A;  3M8F A;  4ESJ A;  3HHH A;  5HNH A;  2DQR A;  5D8K B;  5FKN A;  5K5R A;  2ZXJ A;  1E3O C;  1PYV A;  1B6A A;  4MEX F;  2MGQ A;  1U9O A;  4W1U A;  2YUS A;  3CDH A;  1ZGW A;  3RQI A;  3JRI A;  4M9X A;  3JW4 A;  3BRO A;  1Z21 A;  1V4R A;  2BE5 F;  2HOE A;  1F43 A;  3KET A;  1HSJ A;  1LQ1 A;  4L9T A;  2RDP A;  2V9K A;  2MA3 A;  3TED A;  1BOA A;  5ILV A;  2IPQ X;  1B9M A;  5K7F A;  2QUF A;  3VEP A;  1O4X A;  3T8R A;  1I6H J;  1IDZ A;  2LSO A;  5EDN A;  3K1N A;  3H5A A;  2YU3 A;  1QO0 D;  4M74 A;  5KAI C;  1YFH A;  4BNC A;  2Q0O A;  2X48 A;  1S9H A;  3CCJ I;  3BG5 A;  3GUD A;  3OOP A;  4XLA A;  3I59 B;  5JHF A;  2IW5 A;  3J81 Z;  1X3Z B;  1EH6 A;  3ZGK A;  3ZMZ A;  1VQ9 I;  1YW9 A;  2MD0 A;  1I5Z A;  1A36 A;  4EJW A;  4ZYE A;  5D5U B;  5E18 F;  3CDI A;  4WWC A;  3R6S A;  4XRS A;  4G8X A;  1YYV A;  3NWT A;  2QSF X;  2YX4 A;  2Q2E B;  4D7N A;  3IH4 A;  5K5O A;  2ZME B;  3DTI A;  5D4R A;  3OSG A;  1BI1 A;  4IL6 C;  5C44 J;  1BOB A;  2RQQ A;  2DOD A;  2PFB A;  2CQX A;  2MH9 A;  2KIQ A;  2CUE A;  5A2Q Z;  3N97 A;  3PIP F;  3OYK A;  5LRS A;  5CQG A;  2DA1 A;  1SMY F;  3CLO A;  2BVL A;  4KIB A;  1H89 C;  2Y75 A;  4UUS A;  2WA0 A;  3CCU I;  3HTU A;  3HEF A;  2NAZ A;  2L54 A;  2FQ4 A;  1LDJ A;  1D1B A;  4BJ6 C;  2VKH A;  3JCU C;  1VQO I;  2R7T A;  2L9S A;  3TDZ C;  3LSM A;  2A6H F;  1JTY A;  1HOM A;  4M3G A;  1POG A;  5C3E J;  4UVB A;  5L3E A;  2QGU A;  1S5L C;  1P4A A;  3FKI J;  2GM4 A;  5IOZ A;  1TW3 A;  3FXR A;  3S14 J;  3NRV A;  4D5C A;  4U0V A;  2OBP A;  4WXH A;  5CQE A;  5B1A H;  3OYF A;  3H92 A;  1V3F A;  1FOK A;  1FNN A;  3GXO A;  3A0B C;  3PL8 A;  4KA4 A;  1TQI A;  2ESH A;  1WSU A;  5EYR A;  3OR1 C;  5F1J A;  5CVR A;  1O3T A;  2EA2 A;  2F5V A;  2XGE A;  4HYE A;  3BDD A;  3WGH A;  3DEU A;  3D1N I;  2L7Z A;  1IUF A;  1KU2 A;  2MW8 A;  2GA2 A;  1J75 A;  3RDI A;  3KZY A;  2R5Y A;  4ZTF A;  9ANT A;  2L02 A;  4IRG A;  2E1N A;  3JRD A;  2QBY B;  4MIM A;  1W7P B;  2Y2Z A;  3PIO F;  2LYC A;  2XKP A;  2O9L A;  3C3W A;  5D5W B;  4XOP A;  4ON0 A;  2EZI A;  3S1Q J;  2NVX J;  1Z1D A;  1HF0 A;  2IGM A;  1AHD P;  4XK4 A;  4OWR B;  4WCG A;  2R4G A;  3FM3 A;  2R7X A;  4HF0 A;  5C4X J;  2YX7 A;  4A3E J;  1YLF A;  4XKV A;  1H9T A;  2ECB A;  4HQE A;  3S32 A;  1SVO A;  2LH9 A;  5EEA A;  2DT6 A;  2QQ8 A;  3EQL F;  3ZMS A;  4RAY A;  3T0Y A;  2AHQ A;  5E1X A;  4KN4 X;  3H36 A;  2CS3 A;  1V5G A;  3IAS 2;  1BW6 A;  3N05 A;  4II3 A;  2VL8 A;  3IWF A;  4P5O A;  2L7M P;  2CSO A;  4XSZ F;  4BHP A;  2V79 A;  3W3C A;  4HLY A;  3BR0 A;  1D0X A;  1T6S A;  5DYM A;  3HL2 A;  3HPH A;  1YRN A;  2WY7 Q;  3FX3 A;  1JT6 A;  2BY2 A;  4HNU A;  3VWB A;  1OIS A;  1XGN A;  3ZXS A;  2TRT A;  2CV2 A;  4X0G A;  1XDS A;  4CCK A;  4BE1 A;  3DLA A;  5TGT A;  3I0T A;  2Z3Y A;  4G12 A;  4I0A A;  4BXU A;  4ZDL A;  2M45 A;  2P6T A;  3F8M A;  2RVC A;  3QU6 A;  1B59 A;  2JPB A;  1KU9 A;  3ULQ B;  3K70 C;  5GAH J;  2H1K A;  2L4M A;  3DEE A;  4DZJ A;  1IUY A;  3S3N A;  5GTI C;  2N8G A;  4L5E A;  2O8K A;  2XPV A;  4A2U A;  3L2V A;  2H8R A;  3FXM A;  2LR8 A;  3COA C;  3OYN A;  4A3L J;  2JJ7 A;  2VQG A;  4G6T B;  4BL0 B;  1HKT A;  5JLX A;  1SEU A;  1HXD A;  4M3E A;  2Q8K A;  2A68 F;  4PDK A;  2JZY A;  4C9Y A;  3HOX J;  5BOX A;  1LE8 B;  1I1S A;  4BHB A;  3CF2 A;  3GZN B;  4HSR A;  1A35 A;  4FET A;  2EH3 A;  3CQZ J;  3UKG A;  5L3C A;  2FA5 A;  2ME6 A;  3TP3 A;  3K6G A;  4I2O A;  1HST A;  2WY8 Q;  3T5X A;  2M8G X;  1KA8 A;  2FU4 A;  2PMZ N;  3U1K A;  3J80 Z;  2IT0 A;  5CVI A;  1HKS A;  4NDL A;  4MHG A;  1LFB A;  3TW7 A;  2R7R A;  1Z6T A;  4N4N B;  1QGP A;  2VPR A;  4ENJ A;  2P81 A;  2JQ7 A;  2IA2 A;  1IN8 A;  4XIC A;  1MMG A;  1XMA A;  4DOZ A;  4OMZ A;  4XBF A;  1IF1 A;  4CCM A;  2G7U A;  2CQN A;  1JGS A;  4RBO A;  1DGR M;  3ABK H;  3BJA A;  1ZG1 A;  1RIO H;  4RM2 A;  1YX5 A;  3HOU J;  3HOW J;  2L9N A;  4KMF A;  4Z6Y A;  1IXC A;  4M9Z A;  4HAM A;  3MVP A;  3AL0 B;  2KZG A;  3VYR B;  4CCN A;  1JT0 A;  4QWQ A;  2RV8 A;  4U88 A;  1IW7 F;  4YEJ A;  1UCR A;  5FKL A;  2BYV E;  3E5Q A;  3CCQ I;  4F55 A;  1W5S A;  3OYJ A;  3TOA A;  2GOX B;  2F5C A;  1K79 A;  3KEO A;  5F0C A;  3EPZ A;  1YJ9 I;  2CQK A;  3M1C A;  1R23 A;  1WGX A;  3VDX A;  3ELK A;  4P9U A;  4U87 A;  3DKY A;  2HU9 A;  5FLX K;  3QPH A;  3L2Q A;  4PFO A;  4N0B A;  1QPM A;  1I1G A;  3ZQI A;  2LFB A;  4HLX A;  1FSH A;  1E0E A;  3CDL A;  2EV5 A;  4DNC A;  1WI9 A;  1ETK A;  2XIG A;  3L2R A;  3ZN1 A;  4CYD A;  1V5F A;  3ZQ7 A;  2DA6 A;  2Y31 A;  4ETS A;  2DMP A;  1IRZ A;  4ANJ A;  2FBI A;  2JUG A;  1QHG A;  1WJA A;  4EM0 B;  2NVY J;  2PMZ A;  4LG0 B;  2RGV A;  4BGD A;  2L4A A;  2VAS A;  3BCB A;  1BC8 C;  3K2A A;  3JTH A;  3JRH A;  2RC4 A;  2XAS A;  4LIT A;  4CYC B;  2HDD A;  3RSN A;  4ASN A;  2OA4 A;  3FK7 A;  4YIF A;  1RR8 C;  2DK8 A;  3KEQ A;  4YFK F;  3EUA A;  2ZJQ F;  3DEW A;  3VPR A;  4OIP F;  5J4Y A;  2PMH A;  1MNE A;  3OS0 A;  2HQ5 A;  2FML A;  1ZR2 A;  3G2B A;  4LOC A;  2EV0 A;  2PJR B;  2AO9 A;  1S7E A;  3T1B A;  5FKO A;  3DBR B;  3S1R J;  3JAM K;  1QZY A;  1IC8 A;  1ZQ3 P;  3AAF A;  3FMR A;  1TZL A;  4BAY A;  2V7F A;  1RKT A;  3K9T A;  2X9D A;  2BEO A;  4BQO A;  4MLO A;  2V6E A;  5DDG A;  2K4B A;  2PEX A;  3HSR A;  5GAG J;  1K78 B;  5K7H A;  2D2W A;  4AU7 A;  2OQR A;  1UG0 A;  3WGG A;  2PBI A;  1RZ4 A;  2GAU A;  3S16 J;  2NS8 A;  1TQP A;  1G8X A;  2ID3 A;  2GXB A;  1AA7 A;  1WJB A;  2DW4 A;  2GXG A;  1AKH B;  2C6Y A;  3ZP5 A;  2ZXW H;  4FCY A;  1KU3 A;  4XKB A;  3LSJ A;  2EFQ A;  2ZME C;  2VC1 A;  2LMD A;  3KIO A;  3QRF F;  4PK4 A;  4ENM A;  3V4G A;  2EFN A;  4ABZ A;  4BJ5 C;  3K10 A;  3LWF A;  3I53 A;  3ASN H;  4MGR A;  1KON A;  1E3H A;  4A3M J;  2AS5 F;  1FWZ A;  5LD2 C;  2NYX A;  3P9C A;  1YTY A;  3ASO H;  3M1E A;  1JUM A;  1ZAR A;  5ICG A;  4O3M A;  4FT8 A;  2NNN A;  3GTP J;  2V6C A;  1OCR H;  3H3U A;  4OAY A;  4A3J J;  1DU0 A;  3JTG A;  4RB0 A;  1YE9 A;  1LDK B;  1YO5 C;  2LBF B;  2O5R A;  5ERI A;  1V55 H;  2EIL H;  2XSJ C;  3F6V A;  2FQ3 A;  3Q3S A;  1XSX A;  2VPL A;  1N75 A;  1T33 A;  2JSC A;  1T39 A;  1C0W A;  4IOC F;  4X6A J;  2BZT A;  2RNG A;  3W2W A;  5IT9 Z;  1SD4 A;  4RB2 C;  4IRI A;  2QF7 A;  5E8G A;  4HDV A;  3BOQ A;  4YII A;  2QKL B;  2E1M B;  4MQV A;  2R7U A;  2JSP A;  2DT5 A;  2QQA A;  2EZK A;  4D9J A;  5B5E C;  3A01 B;  2BHY A;  1MKM A;  2GLO A;  3SJM A;  2W00 A;  1MNM C;  1WCM J;  2KP6 A;  2JA8 J;  2ZO4 A;  4UUV A;  4MNU A;  5ICC A;  1LJ9 A;  1SFK A;  3H9J A;  3I3L A;  3HZJ A;  2P5K A;  4IQ4 A;  2DPU A;  5GTH C;  3EYI A;  4ENK A;  4B3X A;  4II2 A;  2V4J C;  3QWL A;  1W5T A;  4XN0 A;  5HS9 A;  2EV6 A;  2HGC A;  1R6R A;  2K27 A;  4GYG A;  3TO6 A;  4B47 A;  4XSX F;  2PLY A;  2XGC A;  3BPX A;  4CZC A;  1H9G A;  3MAJ A;  3O6B B;  2VQC A;  1X1C A;  2Y0M A;  4UY8 I;  3FZV A;  5F64 A;  4E7S A;  2Y30 A;  4BDY A;  5CKT A;  3AG3 H;  3FM5 A;  5DS9 A;  4OIN F;  5J8F A;  3FHZ A;  1UJ8 A;  4Y4R A;  5M5W J;  1LFP A;  3VFZ A;  4HV5 A;  1ZR4 A;  5GPC A;  1FBS A;  1D0Y A;  2IGK A;  4RGU A;  3DF8 A;  1X58 A;  2OPT A;  2J5O A;  3CJN A;  2DT7 B;  2MG4 A;  4KJZ A;  5A2Q K;  3I58 A;  1T2K A;  2Y9Y A;  2H27 A;  1MJB A;  3CD6 I;  4ZJZ A;  4AVP A;  1JTX A;  2XV4 S;  4BU2 A;  2O7O A;  4J19 A;  4EAT A;  2XB0 X;  3OWT A;  2V9P A;  1R5H A;  1HBX G;  4HW0 A;  3D5L A;  5FO5 A;  2H6C A;  4IOA F;  3B6A A;  4A0Y A;  2DA7 A;  3VYS B;  5J1Y A;  3QYF A;  1IGN A;  2F4M B;  2XF7 A;  4UNO A;  1CF7 A;  3HGY A;  3LMM A;  3QOP A;  2NVU B;  3FF5 A;  4LG0 A;  1LEB A;  2WAQ N;  5HNF A;  1TWG J;  3F8B A;  1WWX A;  3MZH A;  5BPI A;  4PGG A;  5LBQ A;  1VQ7 I;  5AIQ A;  3IAM 2;  2L9R A;  3PQK A;  4NUB A;  5HDN A;  4QLC U;  3H9G A;  3HSF A;  2E5Z A;  5FRO A;  3OV8 A;  4Y3O A;  1JUS A;  2X6X A;  4XRM A;  1T56 A;  2DOA A;  1RKW A;  2XHK A;  2HPI A;  4V2G A;  1Y8R B;  4GO1 A;  4MFD A;  1P7J A;  3L2C A;  1YJW I;  1FMV A;  1WJC A;  3ZMV A;  4U0Y A;  1Y8Q B;  2XGX A;  5BS6 A;  1PJR A;  1RES A;  5FLM J;  1VQ5 I;  2P5V A;  3WU0 A;  3CCS I;  1D0Z A;  1ZH5 A;  4NC8 A;  1XCV A;  5HVQ C;  2L01 A;  1X4O A;  2KRF A;  3O8H A;  4KMU X;  5D6E A;  4DGW B;  5J40 A;  2G9W A;  5FRM A;  3QYB A;  2Z5U A;  1K78 A;  3K2Z A;  4CCL A;  3K4C A;  1FJL A;  2VXZ A;  1D1C A;  2G0E A;  3V42 A;  3RKY A;  4HX7 A;  4MEY F;  4S04 A;  2PQ8 A;  3K4N A;  1XPX A;  2BXZ A;  4HX8 A;  1VQP I;  4BYY A;  4XON A;  3ZQH A;  2W24 A;  4EEF G;  1YS7 A;  2ZCW A;  2JVH A;  2DXI A;  3HB9 A;  4AID A;  3H5N A;  4HV6 A;  4D7M A;  2P8T A;  4OIR F;  2R7V A;  2ACJ A;  3AL0 C;  2HDC A;  4XL9 A;  2DYR H;  1X1P A;  2RN7 A;  1DU6 A;  3V7S A;  2IS1 A;  2Y48 A;  3TO7 A;  2CFO A;  3E5X A;  2CQ7 A;  2WAQ A;  3JSP A;  4F91 B;  2VKD A;  5F04 A;  1S72 I;  4HOB A;  5HOO A;  4IHY A;  1CQT A;  5DD8 A;  2YU9 J;  1X4P A;  3HC7 A;  5C4J J;  4LB6 B;  3F9K A;  2DFI A;  2OZU A;  4XLP F;  4BE2 A;  1O3R A;  1AOY A;  4P1W A;  3S3M A;  2LD5 A;  2AXT C;  3F0C A;  2LC2 A;  1SFX A;  4HRI A;  3LA3 A;  4BDZ A;  2LP0 A;  4XRF A;  1VQN I;  2X6Y A;  1BN5 A;  2DU9 A;  3I5U A;  4E7J A;  3CCY A;  3HOY J;  1TNT A;  1D8K A;  4BJT A;  3OYI A;  1U5T A;  1ZGJ A;  4AIJ A;  1PUF A;  4XLF A;  3M4O J;  1XG1 A;  3W2A A;  2P7V B;  2X85 A;  2GA1 A;  4NHJ A;  1GLN A;  2X51 A;  2MBF A;  1FIP A;  2AQF A;  1JKO C;  2E5N A;  1A6Q A;  1OYW A;  2R7D A;  2TCT A;  3ZQQ A;  1WRJ A;  1XB4 A;  3FMS A;  5EG0 A;  2IP2 A;  5F1R A;  3OS2 A;  1ODD A;  1MBG A;  3OR2 C;  1Z05 A;  3DPT A;  1TL8 A;  1BC7 C;  3IRR A;  2O6G E;  4L0Z B;  1EA3 A;  3L09 A;  3F8C A;  1ENH A;  3KZI C;  2E34 A;  2LLK A;  4B1R A;  4D1Q A;  5E1W A;  1SFU A;  4G7O F;  3GF2 A;  3J80 K;  2DPD A;  2NVQ J;  5KCM A;  2R7W A;  4ZZL A;  3ECO A;  2E7W A;  1XD7 A;  2R5Z A;  1MBE A;  3QPT A;  3LA7 A;  3ABT A;  1FOX A;  3BR1 A;  2KJB A;  3JRF A;  4DZP A;  3RQ4 A;  1XC5 A;  2CV1 A;  2M8E A;  3KE2 A;  1Z3X A;  1QVT A;  4NC7 A;  4WF2 A;  1XGO A;  2ZJ2 A;  5TRD A;  1FC3 A;  4M73 A;  4PSW A;  3H9Q A;  2Z33 A;  3CJQ B;  2X6W A;  1AWC A;  2M7B A;  2ZXI A;  4OIQ F;  3BQY A;  1NK3 P;  2HI3 A;  2FUG 2;  2DN0 A;  5LEK A;  2VN2 A;  4H0E A;  1S6L A;  4HF1 A;  1JI8 A;  4KDP A;  4G6Q A;  3RZO J;  1D3Y A;  2M2E A;  4BQQ A;  3ABU A;  4I01 A;  2EBI A;  3GWZ A;  1D5Y A;  5AON A;  1ULY A;  3R60 A;  2DTZ A;  2CW0 F;  4BY7 J;  2VLA A;  4XR6 A;  3WHB A;  1XTA A;  3LA2 A;  4KT5 C;  4KYW A;  4AVZ A;  3BZC A;  3GFL A;  1FMW A;  2I8D A;  2DTR A;  3CO6 C;  4HDU A;  3B6C A;  1REP C;  1Y39 A;  1NK2 P;  2FE3 A;  3BQZ A;  3KYL A;  4Y52 J;  4FQG A;  4B09 A;  4PFP A;  3G73 A;  1LVA A;  1G3S A;  4IHT A;  3OYD A;  2VI6 A;  4NQW B;  3E6B A;  4UUT A;  5DCM A;  1UHM A;  4C3H J;  1TWA J;  2HQA A;  4XKW A;  2ISY A;  5E3L A;  4ZYD A;  1B8I B;  1MH4 A;  2Z1D A;  3S17 J;  2W25 A;  2CRG A;  5IYC J;  5IYB J;  4DYC A;  1OFC X;  2VT2 A;  1I3Q J;  1U8R A;  3ZQF A;  2NOJ B;  1T38 A;  1R58 A;  1TBX A;  1R49 A;  1LEA A;  1U5T C;  3IWZ A;  3HDD A;  4RS8 A;  4AIH A;  1PVE A;  3IL2 A;  3HYI A;  3SZG A;  1T8I A;  1O7L A;  3MQ0 A;  2OU2 A;  3GME A;  3BT9 A;  3HXL A;  3H1C A;  4PJJ A;  2FSW A;  1VQ8 I;  4YIR X;  4A3D J;  2XAF A;  2GQQ A;  2IGN A;  3FIS A;  3F23 A;  1OCC H;  3RYR A;  3GLL A;  3K69 A;  3L2U A;  4C2M J;  2MYS A;  1P4X A;  4Y13 A;  4M71 A;  1VF9 A;  4IEJ A;  3RKX A;  1Y0N A;  4M6X A;  2EIN H;  5LHI A;  4JQF A;  4CCJ A;  1JE8 A;  4E7L A;  3GFM A;  4F3Q A;  2ZSH B;  4F52 A;  1Z9C A;  1Y56 A;  4KUM A;  3V8L A;  1IRF A;  2DMN A;  4I0B A;  4PJM A;  2A6E F;  2B7E A;  3QOD A;  5EGO A;  5H20 A;  5B66 C;  2W7N A;  4HBL A;  3WTZ A;  2L7K A;  3WTS C;  2G7H A;  3E5U A;  3PM1 A;  3OIO A;  5L3D A;  3OYA A;  2PI0 A;  2LOO A;  4BEH A;  3TO9 A;  4ZDP A;  1ETX A;  2KIM A;  3CMM A;  4CUG A;  2HS5 A;  3LST A;  1J0R A;  1ZGA A;  5M3M J;  1FYM A;  3OL3 A;  2ETH A;  1K6O A;  1OJL A;  3IH3 A;  3EDP A;  2NOG A;  3FXO A;  3BR5 A;  4YEL A;  2V1X A;  2O3F A;  1QU3 A;  4IO9 F;  2V1D A;  2W84 A;  4ITV A;  1MGT A;  2ADU A;  3C18 A;  1OCT C;  4L18 B;  4AIK A;  1JHH A;  1OMI A;  4NBQ A;  2R7S A;  3LSH A;  4L9J A;  2K85 A;  3LFK A;  1FBU A;  2VBY A;  3RCO A;  1DPR A;  2ID6 A;  3Q0V A;  2BGC A;  4I98 B;  3P9I A;  1V5E A;  2RAE A;  3V7C A;  3W6J B;  5JFR A;  1P6R A;  2B9S A;  3R0A A;  4A0X A;  5IT9 K;  1GVD A;  3BWG A;  2YSR A;  2LNB A;  2V26 A;  4I76 A;  2HOS A;  1DPU A;  2BW3 A;  1KQ9 A;  2EZL A;  1A31 A;  1ZLJ A;  3BY6 A;  2FOW A;  3O2P E;  3U21 A;  3OYL A;  4E7Z A;  1G3T A;  2ZC2 A;  3S93 A;  3GTJ J;  1TWF J;  1M1E B;  2V9V A;  4EVI A;  2STW A;  3C2H A;  4B4C A;  3CF5 F;  4C30 A;  3K1P A;  1IN6 A;  1HW1 A;  2X1C A;  4UHT A;  3QP5 A;  1G3Y A;  2HOT A;  1WFX A;  2LTP A;  1YIJ I;  1LKX A;  1D8J A;  3GCM A;  1MBH A;  2VE9 A;  1G4D A;  1A04 A;  3IKV A;  1F4K A;  1W5C C;  3PNV A;  5LFA A;  1K7A A;  2QWW A;  3C7J A;  1KQ0 A;  3HOV J;  4UV9 A;  5FKM A;  1FYL A;  4QTR A;  2HWV A;  2GBY A;  1XSD A;  1FYK A;  3KP4 A;  2QSH X;  1MBF A;  4G6D A;  1I39 A;  1ZKG A;  2CQQ A;  2GWR A;  3LQQ A;  3E1S A;  1YIT I;  1IAW A;  1R71 A;  3VB2 A;  3KP7 A;  1R22 A;  1GV2 A;  2CO5 A;  3I59 A;  4W97 A;  3GTG J;  4A3B J;  1WPK A;  4LK1 F;  4A6E A;  4PJ0 C;  4YFN F;  3OYE A;  1K61 A;  2XUB A;  2NVT J;  3PNY A;  1LDD A;  1MDM B;  4Y15 A;  1DDN A;  3WHC A;  5E3N A;  2FBH A;  1XGM A;  4J00 A;  2HR3 A;  1Z3Y A;  2PMU A;  1H8A C;  2DJN A;  1JKP C;  2IGO A;  2Q2E A;  1LNW A;  1OQY A;  3D5S C;  5BPD A;  2VUM J;  2ZME A;  2VB6 A;  4HZF A;  4LLG F;  3G4S I;  2EQR A;  1ON1 A;  3DPU A;  3GO5 A;  3LFU A;  2L7F P;  3IUO A;  4ESB A;  1UMQ A;  1X2N A;  3KPH A;  2HQN A;  1WQ2 A;  2K9M A;  2FX0 A;  2K3P A;  1D1A A;  2DCE A;  2JRM A;  4IPA A;  5LRR A;  3HHG A;  1MMN A;  2COB A;  2JUC A;  4A3F J;  3IKT A;  1TC3 C;  3F3X A;  1EJ9 A;  4NQW A;  1KYW A;  2YR2 A;  2WAF A;  3NQO A;  2ZBK A;  4ENN A;  4E7H A;  3LSP A;  2ZJP F;  3VYU B;  5HOD A;  1GDT A;  4BH9 A;  1T0F A;  3V7R A;  2DO7 A;  3KZZ A;  2R3S A;  4PJN A;  3A02 A;  1FT9 A;  2I5U A;  3I71 A;  4M72 A;  4LGW A;  3V8K A;  3Q9S A;  3MKY B;  1OCP A;  2MLK A;  1ZK8 A;  4MQ9 F;  4LG3 A;  3U1D A;  2EJR A;  2ESN A;  1OCO H;  2DK5 A;  5B1B H;  4WXD A;  5J1R A;  2M30 A;  3RPU D;  3JR9 A;  3S3O A;  2FMY A;  1ZRE A;  3ECH A;  3ZOB A;  3QPL A;  2KIS A;  1O3S A;  2KDO A;  1Y6I A;  2IS2 A;  3I55 I;  2A07 F;  3K4M A;  5F6F A;  3PSI A;  4ZYH A;  2IJL A;  3C1D A;  4XRS G;  4AUX A;  1F1Z A;  5IP7 J;  2MC4 A;  1F36 A;  2A69 F;  3NEU A;  4LIU A;  3HOZ J;  2M7A A;  4EMS A;  3E6C C;  3DBL B;  3WTT C;  3OYB A;  2QEX I;  2QBY A;  1W7P A;  1QHH D;  4R8H A;  1PP8 F;  3LSI A;  3ERE D;  1H0M A;  2RQP A;  4DBR A;  1W36 C;  4GYI A;  1HCR A;  3SFI A;  1OYI A;  2LY9 A;  3H5R A;  2ELH A;  3H0D A;  1GXP A;  1MJ9 A;  3KX2 A;  3DTE A;  5EEH A;  3WTU C;  3Q0U A;  3FXJ A;  3HTS B;  5FKK A;  3VOE A;  1ONV A;  4EJV A;  1MBJ A;  2HPM A;  4IHS A;  5GP9 A;  3KLO A;  4FHT A;  2OF7 A;  2CU7 A;  1MIJ A;  4BHC A;  2DLL A;  2EZH A;  1U78 A;  2X1D A;  2DA3 A;  2F6C A;  3FBN B;  5F0F A;  1QA6 A;  3OS1 A;  5JVT A;  1ZYR F;  5ICF A;  1YS6 A;  1IDY A;  3TGN A;  1A5J A;  1FOW A;  1OLT A;  3CUO A;  3S2W A;  1YIO A;  2CYY A;  2VJJ A;  1I3A A;  4EJO A;  1WJF A;  2QEN A;  1EH7 A;  1XS9 A;  1YG2 A;  4CH7 A;  3F8N A;  1J7K A;  2M34 A;  1SMT A;  3ABL H;  2CWE A;  2DI3 A;  2QKM B;  1GVJ A;  1ZN2 A;  2VJI A;  1VQL I;  2QVO A;  2CH0 A;  4JP0 A;  2DOE A;  1U3E M;  2JVG A;  5FRN A; 
#chains in the Genus database with same CATH homology
 3G71 I;  3CJR B;  3CJQ B;  1VQ6 I;  3PIP F;  1YJN I;  5GAH J;  2ZJP F;  3CCU I;  4IO9 F;  1VQO I;  3CJT B;  1VQP I;  2ZJQ F;  3CJS B;  3EGV B;  2OTL I;  1YHQ I;  4UY8 I;  1Y39 A;  3I55 I;  4V19 K;  5DM6 F;  2E36 A;  1S72 I;  2NXN B;  2FOW A;  3CCL I;  3DLL F;  3CC2 I;  3J7Y J;  5JVG F;  1VQM I;  5GAG J;  3I56 I;  2H8W A;  2QEX I;  3CF5 F;  1VQK I;  1VQ4 I;  3CD6 I;  1VQN I;  2JQ7 A;  1YIJ I;  3CCE I;  1MMS A;  5DM7 F;  3PIO F;  5GAD J;  3CMA I;  3CCM I;  1WIB A;  4IOA F;  1ACI A;  2E35 A;  3CME I;  1VQ8 I;  5GAE J;  3CCR I;  3G6E I;  2ZJR F;  1YIT I;  3CC4 I;  1YI2 I;  1VQ7 I;  1QA6 A;  3CCQ I;  2E34 A;  3CCJ I;  1FOW A;  2QA4 I;  1FOY A;  2K3F A;  1YJ9 I;  1HC8 A;  1VQ9 I;  2OTJ I;  3CC7 I;  3G4S I;  1YJW I;  4IOC F;  1FOX A;  3J7Z I;  3CCV I;  1VQL I;  1VQ5 I;  3CCS I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...