4UY8I

Molecular basis for the ribosome functioning as a l-tryptophan sensor - cryo-em structure of a tnac stalled e.coli ribosome
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
141
structure length
141
Chain Sequence
AKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEKGLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKISRAQLQEIAQTKAADMTGADIEAMTRSIEGTARSMGLVVED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S RIBOSOMAL PROTEIN L32
publication title Molecular Basis for the Ribosome Functioning as an L-Tryptophan Sensor.
pubmed doi rcsb
total genus 17
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 4uy8I02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 4uy8I01
1Y39A 1VQPI 2QEXI 1VQ7I 2ZJPF 3PIOF 3I56I 4IOCF 1VQLI 2JQ7A 1YHQI 5DM7F 1VQKI 3CC4I 4IOAF 2H8WA 3CCVI 3CC2I 5GAEJ 1YI2I 2E35A 1WIBA 3CJRB 3G4SI 3J7YJ 3CCUI 2NXNB 3J7ZI 1VQMI 1VQ8I 1YJNI 3G71I 5JVGF 3CCRI 1S72I 3CCEI 3CCJI 3CJQB 2K3FA 3CCMI 1HC8A 3CJSB 1VQ5I 1VQ9I 4V19K 1MMSA 3CCLI 3CMEI 3CCQI 3CJTB 1FOXA 3CCSI 2E34A 2ZJRF 1VQ6I 1QA6A 2OTLI 1YITI 1YJ9I 2OTJI 2ZJQF 3CF5F 3I55I 3CMAI 5GAHJ 2E36A 3DLLF 1VQ4I 4IO9F 1YIJI 1YJWI 3CC7I 1VQNI 5GADJ 2QA4I 4UY8I 1VQOI 5DM6F 1ACIA 5GAGJ 3PIPF 3G6EI 3CD6I 3EGVB 1FOYA 2FOWA 1FOWA
chains in the Genus database with same CATH superfamily
1EV7A 4CICA 4M3FA 2MABA 3QP5A 1FBSA 1SD6A 3L00A 2ELJA 1X4PA 3H1CA 3WTUC 3CMYA 4OAZA 1P7JA 3F21A 1RPWA 2D1HA 2R5ZB 1U8RA 1YRNA 5DD8A 1MSEC 2M0CA 2E7WA 5H2FC 1IXSB 2OA4A 3I58A 5J1UA 4IOCF 4II3A 4JP0A 1HF0A 2HVSA 5IY5H 2PI0A 3HDDA 1E3OC 1YX3A 3KX2A 5JHUA 1FLIA 2DK8A 2BEOA 1R23A 1B9NA 3ABLH 1X19A 3OYKA 4C2UA 2TRTA 4XKCA 4IOAF 2MA3A 3VYTB 3CC2I 2HOAA 4FT8A 2O8XA 4CDGA 2DYRH 1GV5A 3FKJA 1K7AA 2M2EA 2A61A 2GXBA 1WH5A 4KIGA 1OR7A 3R60A 2NXNB 1IZ1A 1TP4A 2ZXHA 2P4WA 4NUBA 4GRIA 1ETOA 3B02A 2MGQA 2LKSA 6PAXA 1D0XA 3GBGA 1ZGJA 1FIPA 4QPQA 3HGGA 3G2BA 2OUMA 3K4BA 4F93B 5DS9A 3W3CA 5LD2C 4FCYA 1RETA 1W36C 2MLKA 1XGMA 4FISA 3QP6A 4A5MA 5EZHA 5M5YJ 4MQVA 3ZN1A 4EJTA 3HHHA 2KRCA 3M1CA 2ISZA 2EFPA 2Z3YA 1OYIA 2L9NA 3DEEA 3VYSB 5LHGA 3SFZA 3H0DA 3K2AA 2DOFA 2FNPA 2K02A 3RKWA 1E2XA 2KRFA 4IHWA 2ETHA 2Z16A 1USTA 5F64A 4QPOA 3WGGA 3NWSA 4BU2A 4E7KA 1YYVA 1W7PB 2DT7B 4XRSG 3TKYA 1XTAA 2BW3B 2HQNA 4A3GJ 1V4RA 2XRLA 1N75A 3GWZA 4BJ6C 4LLLA 2HEOA 1O3RA 2OCEA 3KYCB 4FX0A 1J7KA 3HZJA 2RDPA 1UG0A 1R9TJ 3OL3A 2N8GA 4HX4A 3FM5A 3AL0C 4HLYA 1O3QA 4PFOA 1B6AA 3ZQHA 1FOWA 1WQ2A 3ISPA 2AS5F 4U0VA 4H0EA 5LLQA 1K78B 3GXOA 3K69A 1DP3A 3S14J 4RDUA 1JGGA 2XB5A 4UUSA 4S04A 4LMYA 1XPXA 3BJAA 5E3OA 2DOEA 3CMMA 1VQLI 2WAQA 2E1NA 1U5TC 9ANTA 2Q2EB 1AHDP 1R7JA 3DTEA 4V2GA 2BHZA 5D6FA 3L2CA 3C2HA 1B8IB 3TL4X 4EM2A 3QOPA 1QZEA 5HS9A 1FYLA 1STZA 3NAUA 1PP8F 2K40A 2QWWA 5K5OA 1B4AA 4OIRF 2QENA 2JVHA 1RESA 5JHFA 2K9QA 4M9SA 3SEQA 3UR3C 2K27A 1UMQA 3A02A 4B4CA 2L0KA 2VJIA 2A3SA 3IC7A 2COMA 3Q3SA 2ZB9A 2K3FA 2F5VA 2CYYA 4KN7X 3T0YA 4E70A 1ZR4A 3OYDA 1HC8A 4IQ4A 2EPFA 3O6BB 1IO2A 5AONA 3ZP5A 1G59A 4M3BA 3A1YA 4RBOA 2NVTJ 3CP8A 4L9NA 1J75A 2PMZN 2EB7A 1GVDA 3KP3A 1T38A 2L7MP 1V54H 3DKXA 2E2IJ 3BCAA 2L7ZA 1UB9A 3GTOJ 1UHSA 3F8FA 3I5UA 1SC7A 1ORKA 5L3BA 4DNCA 3LSMA 2ISYA 2M5WA 2NVYJ 2BZTA 5C3EJ 2HDDA 3LWFA 5ILSA 1MIJA 2YPRA 3FDYA 4EJWA 3EQLF 4BHPA 4B48A 1VQNI 1VZ0A 2JJ7A 2EV6A 2XUBA 4XLEA 2CQNA 1UAAA 2F2EA 4WXDA 3S3NA 3H9JA 3B6CA 1Y0UA 2GAUA 3VPRA 3ZXSA 5GAGJ 1LFPA 2ZCWA 2G9WA 3BTIA 2DMTA 2WB1A 3H3ZA 1AKHA 3FK6A 2CV1A 2NNNA 3W2AA 3H5AA 1FX7A 2Z99A 2R4GA 4KDPA 3KP5A 2CV0A 2VI6A 1SANA 1X1PA 4C3HJ 3HL2A 3HKZA 4N0BA 1SAXA 2IBDA 4HNVA 1A31A 2MD0A 5HLHA 4KIFA 1FYKA 2ME0A 2L9RA 3M8FA 5E1ZB 2CW7A 1AWCA 1Y56A 2DFIA 2DYSH 2W82A 4A3BJ 2LREA 1MJ9A 4ENNA 2XF5A 3J80Z 5J4VA 3DP7A 2M45A 3HOYJ 2R7OA 4Y13A 3QYFA 1K6YA 4IVNA 2P8TA 1TLHB 3IH2A 3HC7A 1CF7A 5FROA 3GEZA 2W00A 4JBAA 4I09A 5J6XA 5HDNA 2XDVA 1Z05A 3WTZA 2DCEA 2A69F 2R7VA 2V9PA 5C4JJ 4C3JJ 1LKXA 4G6DA 2VKEA 2YX4A 3PNYA 1FMWA 2FRHA 4XKBA 5JVTA 1HA8A 1JTXA 1MNDA 3ZGKA 1XDSA 3FHNA 1OFCX 2EV0A 5IYCJ 1WZ2A 1OCTC 3IWFA 2KRHA 1SMTA 1MNMC 2FU4A 3JSPA 4EQQA 2D45A 4PJ0C 3LSTA 3VODA 1H89C 3KP7A 4Y3OA 4G94A 1W1WE 3KYLA 2XPVA 3CCYA 5J40A 1QRYA 2R92J 1O57A 2JRMA 4BY7J 3ZPLA 3SJMA 1OR7C 1MKMA 2OPTA 2X6OA 4L9TA 2BXYA 3I4MJ 4E7JA 2FUG2 3M07A 2H8RA 4Q5SF 3K7AJ 4UUVA 3FXOA 4FE4A 1R49A 3PO2J 2DTRA 1T08B 2F4OB 2YUSA 2WWYA 1FEXA 2QLZA 1Y8QB 4CCKA 2YU3A 5HS7A 3UKGA 4J19A 3GTQJ 1G3WA 5KK1A 1I5ZA 2CQXA 3DU5A 3JAMZ 4WX9A 5D4SA 3VEPA 2CS3A 4ANJA 1QBJA 3CC7I 3TW6A 2VE8A 3CLQA 3Q9SA 3ZQIA 5FJ8J 3VWBA 4XORA 2QA4I 4XL9A 1DU6A 2FD5A 4UVCA 4ZDLA 5D4RA 1ETXA 3ABMH 4ZZDA 4Y52J 4WWCA 4F7ZA 2D5VA 4HQEA 2MH9A 3WHCA 2JTVA 1IV6A 1FWZA 2GLOA 4OAYA 1LVKA 2V9KA 1U9NA 2R3SA 3JRAA 2FOWA 3TDUC 3DU6A 4XONA 1JT6A 3ZCOA 1RUNA 2Q1ZB 4D5FA 2KJCA 1SFXA 4PGGA 2OQGA 4OIPF 4CGZA 2UZKA 3S3OA 2WY7Q 1WJCA 3GVAA 2CG4A 2VC1A 2Y0MA 3ASOH 2XB0X 2Y30A 1FJLA 1GDTA 4Q47A 3GYHX 1TBXA 3G1LA 2HPMA 3QYEA 5FFXA 2IGOA 3OIQA 4GYGA 1CGPA 2RVCA 4B3AA 2M9HA 1DP7P 3CDHA 1QVUA 4JQFA 5E17F 4BKXA 3F8NA 2ELKA 3HJEA 2ZMEA 4EJUA 1VQKI 1XGNA 2A5WA 2HQRA 2QF7A 2DBBA 2Y9YA 4CXFA 2QBYB 4QIWN 3WU2C 3SQNA 2EH3A 1T0FA 3A0HC 2W1OA 1IV8A 2HTSA 3RCOA 1GV2A 4PSWA 2WAFA 2HGCA 4UV9A 2L4AA 3D5LA 2NS7A 1XX5A 3RYRA 4ASNA 3NRVA 2W48A 1WPKA 2QQ9A 4E6KG 2MG4A 3CO6C 3K1NA 2GIVA 4FHTA 2HVRA 2V1DA 4DQ2A 5EEAA 2X6WA 3GZ5A 4IF4A 4A0ZA 3DWLE 2STWA 1X1BA 1A04A 3I64A 3KEOA 4A2UA 5DUKA 5CJ9A 4BH9A 4KJZA 3TQNA 5K7HA 4ABZA 2VT3A 2LC2A 3LA3A 4QSHA 5LHHA 3MZYA 2CQQA 2EA4A 1KYZA 5JR3A 3T5XA 5F08A 2A07F 4UUTA 3ZQLA 2R93J 1D3YA 5DCMB 5FD6A 1LE8A 2IP2A 3CF5F 2XSJC 3WU0A 4OU0A 3K70D 2R7WA 3E5XA 4NBQA 5GAHJ 3GW2A 3GZNB 3F6OA 4HQMA 5L3EA 1FT9A 4OMYA 3BG6A 2R7SA 3WGIA 3K1MA 3M3YJ 4M6VA 3LSKA 3OL4A 1ETQA 1I39A 3BOQA 5BQTA 1PYVA 3G1MA 1F4KA 5H6RA 4Z6YA 4RB0A 4IQJA 3S2DJ 3S93A 1MNEA 1Z21A 3JRHA 3V7SA 4Q48A 1EF4A 4UV8A 1XSVA 2VN2A 3CESA 3PJRA 3I71A 2X9DA 3D0SA 3RPUA 2B63J 2HTJA 5F0HA 4PGHA 3GF2A 1HDDC 2DMUA 3DLAA 5K5QA 2VBXA 1P9QC 2E5ZA 4FETA 1V3FA 1NHAA 2GWRA 2MSYA 3H9GA 2XAFA 5HLIA 5J1RA 4AYBA 5DV5A 1V5EA 4FE7A 1F5TA 4BNCA 4QLCU 1BIBA 1FPQA 4AUXA 2CU7A 1G8XA 3S2WA 4BYYA 2V6EA 3I56I 2BY3A 3CUQA 3MZHA 1WI3A 5GTIC 1MBKA 2R7DA 1LFUP 5GPCA 2XAHA 1Z7UA 4M71A 3H5NA 2V1NA 5M5WJ 4HF2A 4BE0A 1LEAA 2BHYA 1DGWY 2DAOA 2HYFA 4PZJA 5IP6A 2VIXA 1OLTA 4OIOF 3I53A 1U2WA 5BPIA 4YFKF 2ZXIA 2O3FA 1NG7A 3SHFA 2LNBA 2IS4A 1W0UA 2IA2A 3KIOA 3HOXJ 4GYIA 2XAJA 5FKMA 4HG2A 1R5ID 2PFBA 1YJNI 4EGZA 3RDIA 3CZ6A 1YO5C 4EV0A 2QZ8A 4BAYA 2NVUB 2RV8A 2X85A 1KQ0A 2QQBA 5EEHA 4XLNF 2W85A 3F8CA 3A01B 3F23A 2QYOA 2VQLA 4A93J 4F3QA 4BGDA 5EYRA 3CJSB 3PQJA 3S16J 2IEKA 2LKPA 3K6GA 2OC6A 3OYJA 2LBFB 1BL0A 1VQ9I 3CQZJ 3U21A 2M87A 1ZH5A 3PQKA 2K9SA 2L02A 4C2TA 1ZYRF 3HB9A 2XSDC 2DI3A 4LG0B 2WAQN 3CCSI 2L4MA 4NQWB 5EG0B 3WTYC 3I59A 3MKYB 3AL0B 3PNTA 1REPC 2RN7A 2ZKZA 4WCGA 1SVLA 1FP2A 5FGMA 4CCOA 2XGEA 2AQEA 1QVTA 1FZPB 1SVOA 4LLGF 3ELKA 2K4JA 5AIPA 1IRGA 2BV6A 3O2PE 4A3CJ 4B44A 3OYNA 3F9KA 1A6QA 3BC8A 5K5RA 4HV6A 1FIAA 2MLGA 4LB6B 2HPIA 4DYCA 4ZDOA 5D5UB 3W6JB 3RKYA 1U5TB 2F6CA 1USSA 4G7ZF 3VSLA 4UB8C 5H20A 3QQAA 4RMNA 5ED4A 1T6SA 2OF7A 2K4BA 3S32A 1IDYA 1XN7A 2PEXA 2KDZA 1TL8A 2HOEA 2LG4A 2LF8A 2VJ5A 4AIKA 4BHCA 2HXOA 2HWVA 4BL0B 5KVRA 1WFXA 4M3EA 5F0FA 2A5YB 4P1WA 1DQUA 1ZN2A 3RI4A 3MN2A 3CJNA 1NH3A 3HOVJ 3QPSA 4HW0A 3OYMA 4E7HA 3HRUA 3J81K 1IXCA 3QRFF 2OV7A 1IW7F 3G3ZA 4KT6A 1NK3P 1P4AA 2L01A 5HODA 4BQOA 1N78A 5BMZA 1SFEA 1GT0C 4RLQA 2DODA 1IUYA 3K10A 2BYVE 4R79A 3ZQ7A 4G8XA 2J5PA 4CCLA 3FXKA 4IHXA 1MJAA 2PX9A 5E3NA 1BBYA 4LOCA 4KYWA 1O4XA 1IN8A 4RAYA 1JE8A 4AD9A 2VXZA 3TGNA 2H94A 3GUDA 3IRQA 4PDKA 2WB1N 4RGRA 1KYWA 1T95A 3M9AA 3HRSA 1ZGWA 2COBA 2KFDA 2GBYA 2NS8A 2VQHA 3WODF 1ZQ3P 1U9OA 1TT0A 1Z67A 2F5DA 5DD4A 5EGOA 5E3LA 3ULQB 3HKZN 5J3LA 1B72B 1SD5A 5IOZA 3S1QJ 2VBZA 5LGTA 2Y2ZA 1UZCA 3K4CA 1Z77A 2GA1A 1WJBA 3LAPA 1KA8A 4LD5A 3PNVA 5F1RA 3QPTA 4CCMA 2ZMEC 3IUOA 1TW3A 3A4CA 4HNTA 2KLOA 2VXDA 3HTSB 1VQ5I 2QVOA 3ERED 1IF1A 4XN0A 3C2GA 3CJTB 1X2MA 1JUMA 4PJNA 1FOXA 4LFUA 1TQIA 4HZFA 1MJBA 5D6EA 1DDNA 2ZJRF 4XK4A 1BC8C 2P5LC 1W7PA 2M7BA 2GXGA 5IOYA 5FLXK 4JX6A 4RM2A 3AG2H 3RKQA 2KZVA 4MEXF 2CFXA 1FSEA 4DYQA 1A36A 2TCTA 3LA7A 2FQ4A 4M6YA 2Y9ZA 1YIJI 2AHQA 2JPBA 3WE2A 3DF8A 4CZZA 1RNLA 3WTTC 2EA2A 2NVQJ 4BEHB 3IHUA 1ZRDA 1VQOI 4IEJA 1OKRA 2IAIA 4A3MJ 2D1VA 5FB2A 2DA1A 4YELA 3TDZC 5L3DA 3PSIA 2X6XA 2OD5A 1T56A 4XOTA 5GP9A 1WHUA 3GFJA 2DA6A 1J0RA 5EDNA 1HDPA 4I7HA 1S7OA 1S7AA 1X3ZB 4JX5A 1R71A 1U0JA 3PM1A 4HPQA 1BC7C 1SVMA 2A05A 4IKFA 4ZYHA 1XSXA 1YQAA 4H4KC 3RPQA 3EYYA 1FBQA 3N05A 5J8FA 2CW8A 2Q2EA 4EATA 2FEZA 1ULYA 2DDBA 4XQFA 1QNTA 1XCVA 3F8MA 4F52A 2DK5A 1BI2A 3IAS2 2R7RA 1TZLA 2BVMA 3PIOF 5DYMA 3AKZA 3L2QA 2ZO4A 1B8IA 1K4TA 5B1BH 3WTWC 1ZR2A 3IKVA 2L9VA 3RPUD 3H3UA 4MGRA 1ODDA 3ZMTA 3PFIA 4HF1A 5JLWA 3AFHA 2X1DA 3GTJJ 2Z9OA 1BI3A 4KT5C 2XF6A 3ASNH 3PL8A 4HEA2 2W57A 3OS2A 3ECHA 3GTGJ 1MDMA 1IDZA 3DFGA 2M1BA 3WE3A 3ZMVA 3OV8A 1VQ8I 4M9ZA 4NC6A 2WY8Q 1BR2A 3BDDA 3BT9A 1WI9A 2V9VA 1BA5A 1Y0NA 3EUAA 3HUGB 3BJ6A 2O9LA 3BROA 2R7QA 5D5XB 1S9HA 2XF7A 1OCOH 1JXSA 2LFBA 3CDIA 2CW0F 3KZZA 5LEJA 3PUBA 4KMUX 5DUIA 1HCRA 1W0TA 4P9UA 2DFFA 4AU7A 4FX4A 3E97A 2KT0A 4DJAA 1D1AA 1WJDA 1DU0A 2KPMA 1ZRCA 1UHMA 2FXAA 4I76A 5FD5A 3BJOA 3LSPA 2BY0A 4BJ5C 2DJNA 2E34A 4O5VA 3SZTA 5M3MJ 4I02A 4FTHA 4RB2C 4YIRX 1VQ6I 4IRIA 4ITVA 2R5YA 2DT6A 1KGSA 3JR9A 4E7SA 3FIWA 3HHGA 1VNDA 2RQPA 3HIFA 4C30A 5D8LB 1F1ZA 5LHIA 3JRDA 2E36A 4Q4ZF 5FKLA 1Y1WJ 3HPHA 4GCVA 4E7ZA 1JHFA 2K9LA 5F04A 1YW9A 2EWNA 1OMIA 1JUSA 4BQQA 2E7XA 2P5KA 4L9JA 2OJED 4BUPA 3GFLA 2H1KA 3FWEA 2X48A 2XRNA 1JGSA 1XDUA 2DA3A 3OIOA 1GXQA 2LSOA 2X6YA 2OBPA 2LH9A 5CQEA 1T2KA 4AM3A 1IXRC 1OYWA 1AU7A 4CZCA 1BW6A 1XMKA 5TRDA 1J09A 1PP7U 3F3XA 2NRAC 5BS6A 3U2RA 2UWMA 3C7JA 1W5SA 1TC3C 1XMAA 4BXXJ 4TV7A 5IT9Z 1D1BA 4G7OF 2LP0A 2LRDA 2MYSA 1R58A 2E19A 2DA7A 2BE5F 1ON2A 1IGNA 1LDJA 3F8BA 3GO5A 4AC0A 1LB2A 1ZG1A 3OYLA 3IWZA 3L2RA 3OYAA 2VB6A 2QM3A 1MZBA 4E4HA 3KP2A 4XIDA 4F91B 3BG7A 3V8LA 2YS9A 2XGCA 3AG4H 3OYHA 4AVPA 5HLTA 1ZGAA 3DCFA 3E1SA 5B5EC 4KITB 3Q0VA 2B9SA 1MMDA 4ZH4F 4DOZA 1HLVA 2V1XA 5EJCA 4MTDA 3ZMSA 4XLPF 2XKPA 4ENMA 4A3IJ 1I6XA 5KHDA 4KMFA 1VQMI 2RC4A 3BR6A 2K3PA 4C2MJ 1ZELA 4UVBA 3OYIA 4CYCB 3OYEA 4K2EA 4QTRA 1YS7A 3T8RA 2CFOA 5M5XJ 5E1WA 1R36A 4PK4A 4AYBN 5L3FA 5B1AH 1HW5A 3LA2A 1L3LA 3HSFA 4XLFA 1Q1HA 4HBLA 3UNGC 4BHBA 2UXNA 4LGWA 2K7LA 3ZQCA 5C44J 1H0MA 2HKXA 2EIMH 2IT0A 1RKWA 2F5FA 4WK8F 1FSHA 4D7NA 4LITA 3E6MA 4ESBA 2V26A 4FASD 1QGPA 5B3SH 2HNHA 1D0YA 3P9CA 3O8HA 2OTJI 3KYDB 3HXLA 2ZJQF 3CO7C 2B0LA 3BG3A 4N4OB 1M1EB 4Y7NJ 4BDZA 2LY1A 1PUFA 1RRJA 3TO9A 4ZDPA 1WJEA 3HGYA 5CVVA 2XIGA 3E5UA 2VASA 2PJPA 3HOUJ 3MD2A 4XRSA 4Y17A 1JUPA 1D0ZA 1ENHA 4PJJA 1BIAA 2GXAA 1DUXC 1W7PD 3TOBA 2R7ZJ 2FF4A 3V7RA 5FFZA 5J47A 2ZSIB 2AO9A 2K85A 3TO6A 2JMWA 4Y15A 5DTDA 2LYCA 2ZFUA 3R6SA 1I27A 2ICWG 2Q0OA 4GGGA 1UJ8A 1OCCH 1L0OC 5ICEA 4MIMA 1X4OA 2GIZA 1JT0A 1MBHA 3MKZA 1CF7B 2R7FA 4XN3A 5E18F 1PVEA 3N97A 2ZJ2A 1ZHFA 3H0GJ 1U8BA 2NVXJ 2IPQX 3V7CA 3H3VK 3KLOA 1QQIA 2CO5A 1SFKA 2KIMA 1FY7A 4KNYA 1A6IA 4PFPA 2UXXA 1P92A 2O0YA 3KE2A 1NK2P 3S3MA 1T33A 2DXIA 3GTLJ 5BNGA 2DPDA 1WCMJ 1HBXG 3M7GA 3Q0WA 3K2ZA 3ROUA 4XNFA 5DDGA 2NYXA 1N25A 5GAEJ 3FHZA 5IT9K 5E79C 4ZYDA 1JHHA 1MBFA 2IVMA 3F6VA 4BQNA 4UNOA 3GTMJ 3D5RC 2PJRB 1R5HA 3G71I 1G2HA 2QKLB 3ESWB 1HSTA 2FJ1A 1KU7A 4A3JJ 4IHYA 3CCEI 3FXJA 1LNWA 4M72A 4A3FJ 3H5RA 5F6FA 2XPWA 1JKQC 4NHJA 3FXRA 3CCMI 1HOMA 1Z0XA 5M3FJ 3C3WA 3OIPA 2CRGA 4B43A 1YTYA 2WV0A 4I98B 2CSOA 1TT5B 4CHUA 5E8GA 1J2XA 3CDLA 2HQ5A 1BW5A 3TP3A 2JZYA 3CP2A 2P5VA 1WJ5A 3BPXA 2H1LA 4KN4X 1J5YA 4YFNF 2IXSA 4I01A 2L2OA 1QU3A 5GTHC 3L09A 1QA6A 4ZYGA 1POGA 3LSHA 2M8GX 3TBIA 1OCPA 4DZJA 5ILVA 3HOTA 5TJJA 1SFOJ 2DMQA 2PBIA 3LQRA 1HSJA 2O5RA 3ABUA 3D1NI 4LLNA 4MQ9F 3E5QA 2WC2A 1RR7A 1BJAA 3S15J 2L3DA 1J9IA 1PDNC 4L9VA 2KHMA 3F0CA 5DM6F 1R1UA 3A2KA 4L0YB 3LOCA 3TEDA 5B66C 4S0HB 2HDCA 4M73A 4EGYA 3FKIJ 2QSHX 4HX7A 3EGVB 1UCRA 2FBHA 3S1NJ 3HSEA 3A03A 2I8DA 1ETWA 5D8KB 1BOAA 3AAFA 3Q5FA 1XC5A 3L9FA 3K70C 5F1JA 3RKXA 2JA5J 4XMYA 3J81Z 2WV1A 3B73A 3ZQQA 1X1DA 2DFEA 2P7VB 2JUGA 4ENJA 3DBRB 4BBSJ 3J7AY 3VSKA 2ZMEB 4PUSA 1RC9A 2JK3A 2M4KA 4W97A 2BVLA 2DQLA 1S6LA 4WXHA 2CUEA 5K7FA 1TW2A 4C3IJ 1MBGA 1XMXA 3TP0A 4AWXB 2G7HA 4OINF 5A2QK 3OYGA 2D2WA 4HYEA 2DU9A 1ITYA 4I6ZA 4L5IA 3CC4I 1HKQA 3CLOA 3TO7A 1W4MA 4KIBA 1WKMA 4G12A 2O6GE 3GTKJ 2XVCA 4Y4RA 2E35A 2QCOA 4QWQA 5ILUA 3OYBA 1O3TA 4EJVA 1SAUA 1T98A 1ZK8A 3B6AA 5DEQA 3RSNA 2PMHA 4RAZA 1YW7A 2HZDA 3MKLA 3PSFA 4C9YA 1F9NA 5CPRB 5JVGF 2IJLA 3CCRI 4G6QA 1RKTA 2KZGA 2LMDA 2EFNA 2Z2SB 4NQWA 2ESHA 4R1HA 4U7DA 3KPHA 1E3PA 1Y6IA 5FKNA 1PJRA 1Q1VA 2PN6A 4JOMA 2I5UA 2Y75A 1BJZA 3Q0UA 1S7EA 2Z33A 1LE8B 4BJTA 1FMVA 3EUKL 1FYMA 3FF5A 4ZYEA 1U3EM 2DDAA 2H27A 2GA2A 5FLXZ 4AIHA 2M0MA 3MVPA 3D5SC 2P7CB 2M4GA 3IKTA 1U5TA 2RNGA 2CJJA 2E5NA 3K0LA 4NDLA 2OCCH 1IN7A 4XRFA 2CQ7A 4DZPA 2O61A 2ID3A 4HSRA 4NC8A 1KU9A 2DOAA 4XLCA 3LQQA 2FBIA 4L5JA 3OR2C 4ZTJA 4PJLA 1VF9A 3JTHA 1W5CC 4DBRA 1K79A 2KIUA 3BCBA 3DV8A 2RQQA 1K4SA 3GTPJ 2FOKA 4IXAA 1XS9A 2LTPA 1OYYA 4ZTFA 4G6TB 4BXUA 1ACIA 3F72A 1G3SA 3EPZA 3K4NA 3W2WA 2H09A 3DBLB 2XKOA 4DYRA 1YFHA 1S3JA 2RREA 2VT2A 3E6BA 2YX7A 2NS0A 4A3KJ 3ZMZA 2EZHA 3L2UA 2LF7A 2DA2A 3BR0A 2R7UA 1YLFA 2A6EF 5HS8A 3N4MA 1Y39A 1R5GA 1IG7A 3QOEA 4BACA 4BY1J 3BPVA 1VQ7I 3BG9A 3OOPA 2G7UA 4E7IA 4AVZA 5LBQA 2W24A 4RB3C 2JWTA 4LIVA 1RIOH 3K4LA 3ABKH 3TOAA 3HOWJ 3O8GA 2H6CA 4XOPA 2HVQA 3OS0A 1JTYA 2F4MB 4E7LA 2X4HA 5LRRA 2R5ZA 1E17A 2JPCA 3VFZA 1B72A 2LVSA 5HOOA 3IH3A 3NQOA 4Z2YA 1WIBA 1EH6A 1ZLJA 1BR4A 2DPUA 3J7YJ 2ZBKA 3CCUI 4RM3A 4B47A 1WSUA 1V55H 3WG7H 1JKRC 1CQTA 1ZTRA 2KJBA 5LRSA 2R0QC 3ZR8X 1S72I 2EINH 4YG2F 5HVQC 1V5FA 4DIQA 4A12A 2JSCA 1LUJB 2LK2A 2XV4S 3EUHA 3OSGA 4IPAA 4EVIA 4HOBA 2TDXA 2UV1A 5EEGA 2A6HF 2XGDA 4HX8A 1D8JA 2VC0A 3LSGA 2P81A 1FP1D 1KONA 1Z3XA 2XAGA 3I59B 3ZN0A 1MGTA 1HW1A 2ECBA 4MFDA 2FBKA 4HV5A 2E1CA 1FOKA 1GLNA 4OWRB 2PG4A 1UFMA 1E3HA 1DPUA 3E6DA 3RQ4A 3FXMA 1HKSA 2VODA 2NOGA 3IV5A 2HKOA 4X0GA 4PJMA 2H6BA 5FO5A 4V2FA 2VUMJ 3OYCA 4WF2A 3KP4A 2FMYA 3MMYB 4KISA 1WJAA 3QU6A 1I1SA 1Z7LA 4PSXA 4U7BA 1I50J 3J7AO 3DLLF 1IRFA 3JW4A 2K9NA 1T8IA 2V79A 4I2OA 2FA5A 1LPQA 3KEQA 1SFUA 4D7MA 1S29A 4NB5A 4CA0A 5K7ZA 5IYDJ 2M7AA 1T0FC 2VQGA 3WHBA 1H8AC 2EIJH 2VBWA 2FQ3A 4J01A 2DQRA 2KMUA 3DTKA 3IH4A 1OPCA 1VI0A 3FBNB 3V8JA 3PIPF 2P6SA 4HLXA 4O6JA 2W84A 3BG5A 2LKXA 2BW3A 3ZMDA 2GOMA 2OQRA 5LGNA 3QPHA 2X1EA 4HDUA 1G6NA 2DLLA 4IHTA 1S8NA 3L2VA 2VLAA 4M6XA 1VQPI 4CCJA 3RZDJ 2VKDA 4GXOA 4MLOA 1R4NB 3NARA 4P96A 4M74A 1GUUA 5GPAA 2ID6A 2VKHA 3HBLA 4U0WA 2LR8A 1X3UA 1MBJA 4CYDA 2DA4A 2BY2A 1P4XA 3W6VA 4KICA 1BI1A 2VJJA 2ZNYA 4WXCA 1K78A 1YOVB 3BWGA 1OJLA 5FKKA 1APLC 1EKEA 1LJ9A 1B9MA 5EGOB 1W36D 1YRNB 2E1MC 4CUGA 1YIOA 2OAZA 1IN4A 1QHHD 3HUGA 3JSOA 4EJOA 3VOEA 1MH3A 4G7HF 4D9JA 3L7WA 5KNLA 1HQCA 1YS6A 4S05A 3J7ZI 4XKWA 4BBRJ 4GDFA 3DXJF 1RR8C 3I4NJ 3ZOBA 2ADUA 3QAHA 3PUFA 4RGXA 2LD5A 2BBYA 1TNTA 4XBFA 2AXTC 2KIQA 2VJ4A 3HRTA 4RAFA 2VPRA 4LG3A 3AG1H 4EM0B 2R7XA 3VYUB 2C6YA 2NNYA 2ZXJA 1UELB 2PMUA 2MFZA 5IPAA 2W7NA 3CCQI 4EEFG 4D0PA 4XR6A 2F48A 3OMYA 2ZSHB 2DTZA 4IZZA 4XRMA 3DKYA 3BR1A 4B09A 2VE9A 3DTIA 5C4XJ 3PO3J 3CUQC 2F4IA 3SYTA 4A0YA 4JYKA 4AIDA 1UG2A 4BS9A 5JI6A 1YJ9I 1JI8A 2J5OA 3TMOA 1TWHJ 3V4GA 2YU9J 4I0BA 4GFBA 3C2BA 3ZRGA 3LMMA 1MMAA 1VQ4I 1ETYA 2QKMB 3MEXA 1R00A 1OCZH 1WRJA 3I9V2 3O3KA 3TW7A 2Q8KA 1D5YA 2RGVA 1NTCA 2QQ8A 2E60A 3CF2A 1EA3A 1O7FA 1IN6A 2XGXA 3VYRB 3W6KB 3P7NA 1ZRFA 4NC7A 4HAMA 1IJWC 3HG9A 2E2HJ 3VDXA 4A3EJ 4BDYA 1T39A 4A3LJ 1KU3A 2JA8J 3QYBA 2RAEA 2WA0A 1R1VA 3K9TA 4PCQA 3I54A 4CH7A 3L1PA 2V1UA 5HDGA 3T8TA 3H35A 3HM5A 2QSGX 4MO7A 2IA1A 2KP6A 2L7KA 4A69C 3JCUC 4MEYF 3S1MJ 3GFMA 3KEYA 5ERIA 2RKHA 2Y0SA 3S8PA 2B7EA 1AOYA 3FK7A 1O7LA 4I0AA 2O03A 2Z5UA 1VFCA 2NAZA 5BPDA 1EH7A 1K6OA 2ZFWA 5ICFA 2HR3A 4UXNA 2WAEA 3EYIA 2EFOA 1MDMB 1MBEA 2E1OA 3ML6A 1KU2A 2DW4A 3COAC 3WGHA 2XPUA 4BQAA 4EMSA 1XGSA 1D1CA 3QODA 3CUOA 4CYCA 4UUSB 2H8WA 4RB1A 4LK0F 4ZJZA 3FMSA 2HOSA 1IN5A 3KCCA 3K4KA 2VOOA 3LSJA 2IA0A 4BXFA 2DA5A 5IT3A 1ERDA 4XICA 5IP9J 4M9XA 2JA7J 3FX3A 2IGMA 1YG2A 5AIQA 1P7IA 5L3CA 3BR5A 5D5VB 2CUZA 2BXZA 3HPGA 3CCJI 1BR1A 5HLGA 1BM9A 3BZ6A 4YRVA 1C0WA 5FKOA 3RTRA 3W2VA 2HS5A 5JLXA 3QWLA 4P5OA 2MBFA 3E3VA 3BR2A 4XKVA 1WH7A 4CCNA 2XAUA 1JJ6C 1KQ9A 2QGUA 2Z1DA 3BZKA 4IHSA 3CCLI 5IP7J 3U9GA 2R5YB 3BZCA 3KLNA 4XLAA 3CMEI 2KKOA 1V5GA 1MMNA 2P6TA 5LEKA 2XC7A 3FXUA 1Z3YA 3KETA 2IS2A 1RUOA 1WVRA 1EH8A 5K1YA 3OWTA 2OTLI 3U1DA 2VL8A 3EUHC 1P6RA 3I55I 1TWAJ 3H36A 4L0ZB 4X1EA 2QSFX 4ZYAA 2HYJA 1Z6RA 3LSIA 3X2QH 2DN0A 1NG6A 3HYIA 3LAJA 3V8KA 1YJWI 4G9YA 3WU1B 2EBIA 1WWXA 5FLMJ 3HOZJ 3LFUA 1I6HJ 4HNUA 1HXDA 1W5TA 1G4DA 1K61A 3IL2A 1E0EA 3MWMA 5CQGA 4B3XA 2XAQA 4CO8A 3I0TA 5FLVA 5LFAA 4HRIA 3G6EI 1ETVA 3MAJA 2KDOA 2PQ8A 3BQZA 2EK5A 1R4MB 2K86A 2CUFA 2E2JJ 3BLYA 3FXLA 2VKVA 3BTJA 4YIIA 3SFIA 1D5VA 2LOOA 2L9SA 5DCFA 1AKHB 3S1RJ 1TQMA 4RGUA 3MZ8A 1I3QJ 2XHKA 3DBHB 3DEUA 3A0BC 3PFYA 2K9MA 3DPUA 2BY1A 5CVUA 1XD7A 1Y1VJ 1YX5A 4LJZF 4RGSA 1ZG5A 4U88A 3HOSA 2HZTA 2P0WA 4B1RA 2JUCA 2UUZA 5A2QZ 2V7FA 5ICCA 2JQ7A 1R22A 1HW2A 2PJRA 1U6GA 3DEWA 3BTCA 2EV5A 2MC3A 3FM3A 2M34A 1GHCA 3DPLC 2IS1A 5CYVA 4R8HA 3OS1A 1KQ8A 4YIFA 2OU2A 1YI2I 3L2WA 3G4SI 4UB6C 1MD0A 1H9TA 3OR1C 4OMZA 5JFRA 3RYPA 2AQFA 2L54A 4IHVA 1BI0A 1FTTA 4D1QA 1Z91A 2QBYA 1JJ8C 3H92A 1FC3A 2NOJB 4ESFA 4J00A 1Z1DA 3FISA 3WTXC 4MNUA 3MFKA 1R1TA 5IYBJ 3REOA 1Z6TA 1MW7A 5EZGA 2HQAA 4XSXF 3SEZA 5FRNA 2DMNA 4F55A 1X1CA 1MMSA 2V6CA 4HDVA 1Z9CA 3BP8A 1B59A 1QZYA 2DO7A 5HNHA 3GX4X 1LDDA 4IRGA 2ZC2A 5FRMA 1PUFB 1LQ1A 2CGPA 4XLHA 3FZVA 3SZPA 1OQYA 3R61A 3FMQA 2KL4A 3NWTA 5E20A 1YW8A 2KIFA 2VPLA 3GMEA 3VB2A 2GM4A 3FMRA 5KCMA 3HSRA 1IRXA 5CLSA 3ERMA 3LNQA 1LVAA 1O3SA 5DCMA 1G3TA 4RLFA 3K4MA 3ABTA 1LFBA 3HTUA 4A6EA 2R7TA 4FQGA 4B8XA 4ETSA 4A5NA 1RI7A 2HDWA 3I4PA 2YR2A 4U87A 3S17J 2EJRA 1TWCJ 2BOLA 4JK1X 3LSRA 5CVJA 3GCMA 3M1EA 3WTVC 2X0LA 5F27A 3MKWB 1ZREA 4U0YA 1FOYA 3BY6A 2A68F 4IRHA 4ESJA 4N9IA 2IRFG 2JRTA 2ACJA 1A35A 2XASA 3E6CC 4L18B 1ONVA 3QU3A 2Y31A 3EDPA 2WADA 3RIRA 3OY9A 1VTNC 4MTEA 4IL6C 5E1XA 3MQ0A 2GQQA 3GLLA 2QEXI 4MFEA 3RJPA 3JRGA 2I10A 2M3AA 3J80K 1IAWA 3SZGA 2PMZA 3GFIA 3C18A 2OZUA 1ZKGA 1UHWA 2VONA 1TTYA 2L5QA 5D5WB 1AA7A 1H88C 1YHQI 1R6RA 1LEBA 1N77A 2ZXWH 3CCVI 3WTSC 3FXQA 4YFXF 2MC4A 2A6TA 3KFWX 1DPRA 2LDUA 3CJRB 3R0JA 1WJFA 2EZLA 3QPLA 4X6AJ 5J4YA 1SMYF 2LLKA 3C1DA 1RZ4A 2CMPA 2ESNA 3U1KA 4HF0A 1TWGJ 2G0EA 4AIJA 2JSPA 4LIUA 1OISA 3K1PA 3R0AA 2Y69H 4O3MA 1TNSA 3DPTA 3CJQB 2O8KA 5CVRA 2EQRA 1MMGA 1YE9A 3IP4B 1IUFA 4EM1A 1B1BA 2IS6A 2STTA 1DGRM 1ZARA 1ZG3A 1XGOA 2EZKA 4F92B 4BE2A 4V19K 4ENKA 1FTZA 3A01A 4M3GA 1X58A 4II2A 1J59A 2HU9A 2IGKA 4KUMA 1SEUA 2EILH 2LBFA 3JRFA 3KP6A 2IW5A 3SDBA 2HYGD 5HDKA 1QHGA 3GLXA 2E71A 5KAFC 4LG0A 4OIQF 1LDKB 3KZIC 4ZC3A 3CMAI 3E7LA 3K4JA 4BE1A 3HRMA 5EG0A 1U78A 4UHTA 3P9KA 5LGUA 1D8KA 2KQRA 3JAMK 4L5EA 5GADJ 5E8IA 3JTGA 3G1OA 2MW8A 2KISA 3F22A 1P2FA 1S5LC 3HEFA 5J8CA 3JRIA 4UY8I 2VBYA 1I1GA 3G73A 2V4JC 5J1YA 1PUEE 2F5EA 2FNAA 2AXLA 3AG3H 2CV2A 1Y8RB 2QQAA 1K83J 4KA4A 2ME6A 2E1MB 3M8JA 2QUFA 1XG1A 2X1CA 3EETA 3CTAA 2JT1A 2CUJA 3BQYA 2L7FP 1BOBA 2Y48A 4MHGA 2XROA 2YSRA 4XSZF 5BOXA 4YEJA 3S2HJ 1X2NA 4RAGA 2X51A 2CH0A 1KZHA 1HKTA 1OCRH 5CKTA 2DT5A 2FX0A 5H6QA 3P9IA 1SD7A 3GZ6A 2DJIA 3BTLA 3H9QA 2ZJPF 1BN5A 3SXYA 1IRZA 4LB5A 5HNFA 4KFCA 3M4OJ 1QZZA 4XM3A 2BGCA 2LY2A 3BR3A 3MCZA 4RA2A 4NNJA 5DM7F 4A0XA 2GZWA 2FMLA 3V42A 3LFKA 5KAIC 3CUQB 3P5JA 4GO1A 3FBIB 4A3DJ 4P55A 1TWFJ 3KZYA 2O7OA 1IC8A 5ICGA 1XSDA 1FNNA 1ZAOA 1A5JA 2WTEA 1FBUA 4I99C 4N9HA 4CSWA 3DQVC 1H9GA 2GOXB 2HI3A 2M8EA 2WBMA 1X3WB 3WG9A 3T1BA 2DMPA 1GVJA 5TGTA 1ETKA 2Y0SN 4P9FA 5E3MA 2EZIA 3M8EA 2PLYA 5EF6A 4LK1F 1JKPC 1ZLKA 4OOIA 3ECOA 2VOPA 2EFQA 3RZOJ 4D5CA 1P4WA 1QPMA 4HSTA 5L3GA 2CQKA 1TQPA 4M3DA 3ZQGA 2CWEA 2IGNA 2M30A 4W1UA 3JREA 1G3YA 2JN6A 3OOUA 4HA8A 2HXIA 1XB4A 2W4SA 4ON0A 3ZMUA 3Q9VA 2ECCA 4IJAA 3R4KA 1X1AA 2F5CA 2DFHA 4ZZLA 2VQCA 1YITI 3JRCA 3OSFA 1I3AA 1MH4A 2RNJA 3ONQA 5CVIA 3NEUA 2MD5A 1QPIA 3OYFA 1ON1A 4DW6A 3ZQFA 2FE3A 2FSWA 3E0JB 1F36A 4RS8A 4IO9F 2LY9A 3DKWA 1F43A 4Y33A 4A6DA 4IX7A 1JKOC 3LL7A 2EIKH 4DBQA 5TISC 3RQIA 4UVAA 2ELHA 2HFHA 4JX4A 3JRBA 3IAM2 1GXPA 2ZNZA 3I3LA 5F0CA 2JVGA 3CD6I 2W25A 1EJ9A 3SDGA 1MSFC 2JA6J 1QO0D 2JA2A 4N4NB 1XCBA 4BEHA 4DGWB 2EFWA 2K5CA 3IRRA 1WGXA 2HOTA 2MH2A 2OZ6A 1SD4A
chains in the Genus database with same CATH topology
1Y39A 1VQPI 2QEXI 1VQ7I 2ZJPF 3PIOF 3I56I 4IOCF 1VQLI 2JQ7A 1YHQI 5DM7F 1VQKI 3CC4I 4IOAF 2H8WA 3CCVI 3CC2I 5GAEJ 1YI2I 2E35A 1WIBA 3CJRB 3G4SI 3J7YJ 3CCUI 2NXNB 3J7ZI 1VQMI 1VQ8I 1YJNI 3G71I 5JVGF 3CCRI 1S72I 3CCEI 3CCJI 3CJQB 2K3FA 3CCMI 1HC8A 3CJSB 1VQ5I 1VQ9I 4V19K 1MMSA 3CCLI 3CMEI 3CCQI 3CJTB 1FOXA 3CCSI 2E34A 2ZJRF 1VQ6I 1QA6A 2OTLI 1YITI 1YJ9I 2OTJI 2ZJQF 3CF5F 3I55I 3CMAI 5GAHJ 2E36A 3DLLF 1VQ4I 4IO9F 1YIJI 1YJWI 3CC7I 1VQNI 5GADJ 2QA4I 4UY8I 1VQOI 5DM6F 1ACIA 5GAGJ 3PIPF 3G6EI 3CD6I 3EGVB 1FOYA 2FOWA 1FOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y39 A;  1VQP I;  2QEX I;  1VQ7 I;  2ZJP F;  3PIO F;  3I56 I;  4IOC F;  1VQL I;  2JQ7 A;  1YHQ I;  5DM7 F;  1VQK I;  3CC4 I;  4IOA F;  2H8W A;  3CCV I;  3CC2 I;  5GAE J;  1YI2 I;  2E35 A;  1WIB A;  3CJR B;  3G4S I;  3J7Y J;  3CCU I;  2NXN B;  3J7Z I;  1VQM I;  1VQ8 I;  1YJN I;  3G71 I;  5JVG F;  3CCR I;  1S72 I;  3CCE I;  3CCJ I;  3CJQ B;  2K3F A;  3CCM I;  1HC8 A;  3CJS B;  1VQ5 I;  1VQ9 I;  4V19 K;  1MMS A;  3CCL I;  3CME I;  3CCQ I;  3CJT B;  1FOX A;  3CCS I;  2E34 A;  2ZJR F;  1VQ6 I;  1QA6 A;  2OTL I;  1YIT I;  1YJ9 I;  2OTJ I;  2ZJQ F;  3CF5 F;  3I55 I;  3CMA I;  5GAH J;  2E36 A;  3DLL F;  1VQ4 I;  4IO9 F;  1YIJ I;  1YJW I;  3CC7 I;  1VQN I;  5GAD J;  2QA4 I;  4UY8 I;  1VQO I;  5DM6 F;  1ACI A;  5GAG J;  3PIP F;  3G6E I;  3CD6 I;  3EGV B;  1FOY A;  2FOW A;  1FOW A; 
#chains in the Genus database with same CATH topology
 1EV7 A;  4CIC A;  4M3F A;  2MAB A;  3QP5 A;  1FBS A;  1SD6 A;  3L00 A;  2ELJ A;  1X4P A;  3H1C A;  3WTU C;  3CMY A;  4OAZ A;  1P7J A;  3F21 A;  1RPW A;  2D1H A;  2R5Z B;  1U8R A;  1YRN A;  5DD8 A;  1MSE C;  2M0C A;  2E7W A;  5H2F C;  1IXS B;  2OA4 A;  3I58 A;  5J1U A;  4IOC F;  4II3 A;  4JP0 A;  1HF0 A;  2HVS A;  5IY5 H;  2PI0 A;  3HDD A;  1E3O C;  1YX3 A;  3KX2 A;  5JHU A;  1FLI A;  2DK8 A;  2BEO A;  1R23 A;  1B9N A;  3ABL H;  1X19 A;  3OYK A;  4C2U A;  2TRT A;  4XKC A;  4IOA F;  2MA3 A;  3VYT B;  3CC2 I;  2HOA A;  4FT8 A;  2O8X A;  4CDG A;  2DYR H;  1GV5 A;  3FKJ A;  1K7A A;  2M2E A;  2A61 A;  2GXB A;  1WH5 A;  4KIG A;  1OR7 A;  3R60 A;  2NXN B;  1IZ1 A;  1TP4 A;  2ZXH A;  2P4W A;  4NUB A;  4GRI A;  1ETO A;  3B02 A;  2MGQ A;  2LKS A;  6PAX A;  1D0X A;  3GBG A;  1ZGJ A;  1FIP A;  4QPQ A;  3HGG A;  3G2B A;  2OUM A;  3K4B A;  4F93 B;  5DS9 A;  3W3C A;  5LD2 C;  4FCY A;  1RET A;  1W36 C;  2MLK A;  1XGM A;  4FIS A;  3QP6 A;  4A5M A;  5EZH A;  5M5Y J;  4MQV A;  3ZN1 A;  4EJT A;  3HHH A;  2KRC A;  3M1C A;  2ISZ A;  2EFP A;  2Z3Y A;  1OYI A;  2L9N A;  3DEE A;  3VYS B;  5LHG A;  3SFZ A;  3H0D A;  3K2A A;  2DOF A;  2FNP A;  2K02 A;  3RKW A;  1E2X A;  2KRF A;  4IHW A;  2ETH A;  2Z16 A;  1UST A;  5F64 A;  4QPO A;  3WGG A;  3NWS A;  4BU2 A;  4E7K A;  1YYV A;  1W7P B;  2DT7 B;  4XRS G;  3TKY A;  1XTA A;  2BW3 B;  2HQN A;  4A3G J;  1V4R A;  2XRL A;  1N75 A;  3GWZ A;  4BJ6 C;  4LLL A;  2HEO A;  1O3R A;  2OCE A;  3KYC B;  4FX0 A;  1J7K A;  3HZJ A;  2RDP A;  1UG0 A;  1R9T J;  3OL3 A;  2N8G A;  4HX4 A;  3FM5 A;  3AL0 C;  4HLY A;  1O3Q A;  4PFO A;  1B6A A;  3ZQH A;  1FOW A;  1WQ2 A;  3ISP A;  2AS5 F;  4U0V A;  4H0E A;  5LLQ A;  1K78 B;  3GXO A;  3K69 A;  1DP3 A;  3S14 J;  4RDU A;  1JGG A;  2XB5 A;  4UUS A;  4S04 A;  4LMY A;  1XPX A;  3BJA A;  5E3O A;  2DOE A;  3CMM A;  1VQL I;  2WAQ A;  2E1N A;  1U5T C;  9ANT A;  2Q2E B;  1AHD P;  1R7J A;  3DTE A;  4V2G A;  2BHZ A;  5D6F A;  3L2C A;  3C2H A;  1B8I B;  3TL4 X;  4EM2 A;  3QOP A;  1QZE A;  5HS9 A;  1FYL A;  1STZ A;  3NAU A;  1PP8 F;  2K40 A;  2QWW A;  5K5O A;  1B4A A;  4OIR F;  2QEN A;  2JVH A;  1RES A;  5JHF A;  2K9Q A;  4M9S A;  3SEQ A;  3UR3 C;  2K27 A;  1UMQ A;  3A02 A;  4B4C A;  2L0K A;  2VJI A;  2A3S A;  3IC7 A;  2COM A;  3Q3S A;  2ZB9 A;  2K3F A;  2F5V A;  2CYY A;  4KN7 X;  3T0Y A;  4E70 A;  1ZR4 A;  3OYD A;  1HC8 A;  4IQ4 A;  2EPF A;  3O6B B;  1IO2 A;  5AON A;  3ZP5 A;  1G59 A;  4M3B A;  3A1Y A;  4RBO A;  2NVT J;  3CP8 A;  4L9N A;  1J75 A;  2PMZ N;  2EB7 A;  1GVD A;  3KP3 A;  1T38 A;  2L7M P;  1V54 H;  3DKX A;  2E2I J;  3BCA A;  2L7Z A;  1UB9 A;  3GTO J;  1UHS A;  3F8F A;  3I5U A;  1SC7 A;  1ORK A;  5L3B A;  4DNC A;  3LSM A;  2ISY A;  2M5W A;  2NVY J;  2BZT A;  5C3E J;  2HDD A;  3LWF A;  5ILS A;  1MIJ A;  2YPR A;  3FDY A;  4EJW A;  3EQL F;  4BHP A;  4B48 A;  1VQN I;  1VZ0 A;  2JJ7 A;  2EV6 A;  2XUB A;  4XLE A;  2CQN A;  1UAA A;  2F2E A;  4WXD A;  3S3N A;  3H9J A;  3B6C A;  1Y0U A;  2GAU A;  3VPR A;  3ZXS A;  5GAG J;  1LFP A;  2ZCW A;  2G9W A;  3BTI A;  2DMT A;  2WB1 A;  3H3Z A;  1AKH A;  3FK6 A;  2CV1 A;  2NNN A;  3W2A A;  3H5A A;  1FX7 A;  2Z99 A;  2R4G A;  4KDP A;  3KP5 A;  2CV0 A;  2VI6 A;  1SAN A;  1X1P A;  4C3H J;  3HL2 A;  3HKZ A;  4N0B A;  1SAX A;  2IBD A;  4HNV A;  1A31 A;  2MD0 A;  5HLH A;  4KIF A;  1FYK A;  2ME0 A;  2L9R A;  3M8F A;  5E1Z B;  2CW7 A;  1AWC A;  1Y56 A;  2DFI A;  2DYS H;  2W82 A;  4A3B J;  2LRE A;  1MJ9 A;  4ENN A;  2XF5 A;  3J80 Z;  5J4V A;  3DP7 A;  2M45 A;  3HOY J;  2R7O A;  4Y13 A;  3QYF A;  1K6Y A;  4IVN A;  2P8T A;  1TLH B;  3IH2 A;  3HC7 A;  1CF7 A;  5FRO A;  3GEZ A;  2W00 A;  4JBA A;  4I09 A;  5J6X A;  5HDN A;  2XDV A;  1Z05 A;  3WTZ A;  2DCE A;  2A69 F;  2R7V A;  2V9P A;  5C4J J;  4C3J J;  1LKX A;  4G6D A;  2VKE A;  2YX4 A;  3PNY A;  1FMW A;  2FRH A;  4XKB A;  5JVT A;  1HA8 A;  1JTX A;  1MND A;  3ZGK A;  1XDS A;  3FHN A;  1OFC X;  2EV0 A;  5IYC J;  1WZ2 A;  1OCT C;  3IWF A;  2KRH A;  1SMT A;  1MNM C;  2FU4 A;  3JSP A;  4EQQ A;  2D45 A;  4PJ0 C;  3LST A;  3VOD A;  1H89 C;  3KP7 A;  4Y3O A;  4G94 A;  1W1W E;  3KYL A;  2XPV A;  3CCY A;  5J40 A;  1QRY A;  2R92 J;  1O57 A;  2JRM A;  4BY7 J;  3ZPL A;  3SJM A;  1OR7 C;  1MKM A;  2OPT A;  2X6O A;  4L9T A;  2BXY A;  3I4M J;  4E7J A;  2FUG 2;  3M07 A;  2H8R A;  4Q5S F;  3K7A J;  4UUV A;  3FXO A;  4FE4 A;  1R49 A;  3PO2 J;  2DTR A;  1T08 B;  2F4O B;  2YUS A;  2WWY A;  1FEX A;  2QLZ A;  1Y8Q B;  4CCK A;  2YU3 A;  5HS7 A;  3UKG A;  4J19 A;  3GTQ J;  1G3W A;  5KK1 A;  1I5Z A;  2CQX A;  3DU5 A;  3JAM Z;  4WX9 A;  5D4S A;  3VEP A;  2CS3 A;  4ANJ A;  1QBJ A;  3CC7 I;  3TW6 A;  2VE8 A;  3CLQ A;  3Q9S A;  3ZQI A;  5FJ8 J;  3VWB A;  4XOR A;  2QA4 I;  4XL9 A;  1DU6 A;  2FD5 A;  4UVC A;  4ZDL A;  5D4R A;  1ETX A;  3ABM H;  4ZZD A;  4Y52 J;  4WWC A;  4F7Z A;  2D5V A;  4HQE A;  2MH9 A;  3WHC A;  2JTV A;  1IV6 A;  1FWZ A;  2GLO A;  4OAY A;  1LVK A;  2V9K A;  1U9N A;  2R3S A;  3JRA A;  2FOW A;  3TDU C;  3DU6 A;  4XON A;  1JT6 A;  3ZCO A;  1RUN A;  2Q1Z B;  4D5F A;  2KJC A;  1SFX A;  4PGG A;  2OQG A;  4OIP F;  4CGZ A;  2UZK A;  3S3O A;  2WY7 Q;  1WJC A;  3GVA A;  2CG4 A;  2VC1 A;  2Y0M A;  3ASO H;  2XB0 X;  2Y30 A;  1FJL A;  1GDT A;  4Q47 A;  3GYH X;  1TBX A;  3G1L A;  2HPM A;  3QYE A;  5FFX A;  2IGO A;  3OIQ A;  4GYG A;  1CGP A;  2RVC A;  4B3A A;  2M9H A;  1DP7 P;  3CDH A;  1QVU A;  4JQF A;  5E17 F;  4BKX A;  3F8N A;  2ELK A;  3HJE A;  2ZME A;  4EJU A;  1VQK I;  1XGN A;  2A5W A;  2HQR A;  2QF7 A;  2DBB A;  2Y9Y A;  4CXF A;  2QBY B;  4QIW N;  3WU2 C;  3SQN A;  2EH3 A;  1T0F A;  3A0H C;  2W1O A;  1IV8 A;  2HTS A;  3RCO A;  1GV2 A;  4PSW A;  2WAF A;  2HGC A;  4UV9 A;  2L4A A;  3D5L A;  2NS7 A;  1XX5 A;  3RYR A;  4ASN A;  3NRV A;  2W48 A;  1WPK A;  2QQ9 A;  4E6K G;  2MG4 A;  3CO6 C;  3K1N A;  2GIV A;  4FHT A;  2HVR A;  2V1D A;  4DQ2 A;  5EEA A;  2X6W A;  3GZ5 A;  4IF4 A;  4A0Z A;  3DWL E;  2STW A;  1X1B A;  1A04 A;  3I64 A;  3KEO A;  4A2U A;  5DUK A;  5CJ9 A;  4BH9 A;  4KJZ A;  3TQN A;  5K7H A;  4ABZ A;  2VT3 A;  2LC2 A;  3LA3 A;  4QSH A;  5LHH A;  3MZY A;  2CQQ A;  2EA4 A;  1KYZ A;  5JR3 A;  3T5X A;  5F08 A;  2A07 F;  4UUT A;  3ZQL A;  2R93 J;  1D3Y A;  5DCM B;  5FD6 A;  1LE8 A;  2IP2 A;  3CF5 F;  2XSJ C;  3WU0 A;  4OU0 A;  3K70 D;  2R7W A;  3E5X A;  4NBQ A;  5GAH J;  3GW2 A;  3GZN B;  3F6O A;  4HQM A;  5L3E A;  1FT9 A;  4OMY A;  3BG6 A;  2R7S A;  3WGI A;  3K1M A;  3M3Y J;  4M6V A;  3LSK A;  3OL4 A;  1ETQ A;  1I39 A;  3BOQ A;  5BQT A;  1PYV A;  3G1M A;  1F4K A;  5H6R A;  4Z6Y A;  4RB0 A;  4IQJ A;  3S2D J;  3S93 A;  1MNE A;  1Z21 A;  3JRH A;  3V7S A;  4Q48 A;  1EF4 A;  4UV8 A;  1XSV A;  2VN2 A;  3CES A;  3PJR A;  3I71 A;  2X9D A;  3D0S A;  3RPU A;  2B63 J;  2HTJ A;  5F0H A;  4PGH A;  3GF2 A;  1HDD C;  2DMU A;  3DLA A;  5K5Q A;  2VBX A;  1P9Q C;  2E5Z A;  4FET A;  1V3F A;  1NHA A;  2GWR A;  2MSY A;  3H9G A;  2XAF A;  5HLI A;  5J1R A;  4AYB A;  5DV5 A;  1V5E A;  4FE7 A;  1F5T A;  4BNC A;  4QLC U;  1BIB A;  1FPQ A;  4AUX A;  2CU7 A;  1G8X A;  3S2W A;  4BYY A;  2V6E A;  3I56 I;  2BY3 A;  3CUQ A;  3MZH A;  1WI3 A;  5GTI C;  1MBK A;  2R7D A;  1LFU P;  5GPC A;  2XAH A;  1Z7U A;  4M71 A;  3H5N A;  2V1N A;  5M5W J;  4HF2 A;  4BE0 A;  1LEA A;  2BHY A;  1DGW Y;  2DAO A;  2HYF A;  4PZJ A;  5IP6 A;  2VIX A;  1OLT A;  4OIO F;  3I53 A;  1U2W A;  5BPI A;  4YFK F;  2ZXI A;  2O3F A;  1NG7 A;  3SHF A;  2LNB A;  2IS4 A;  1W0U A;  2IA2 A;  3KIO A;  3HOX J;  4GYI A;  2XAJ A;  5FKM A;  4HG2 A;  1R5I D;  2PFB A;  1YJN I;  4EGZ A;  3RDI A;  3CZ6 A;  1YO5 C;  4EV0 A;  2QZ8 A;  4BAY A;  2NVU B;  2RV8 A;  2X85 A;  1KQ0 A;  2QQB A;  5EEH A;  4XLN F;  2W85 A;  3F8C A;  3A01 B;  3F23 A;  2QYO A;  2VQL A;  4A93 J;  4F3Q A;  4BGD A;  5EYR A;  3CJS B;  3PQJ A;  3S16 J;  2IEK A;  2LKP A;  3K6G A;  2OC6 A;  3OYJ A;  2LBF B;  1BL0 A;  1VQ9 I;  3CQZ J;  3U21 A;  2M87 A;  1ZH5 A;  3PQK A;  2K9S A;  2L02 A;  4C2T A;  1ZYR F;  3HB9 A;  2XSD C;  2DI3 A;  4LG0 B;  2WAQ N;  3CCS I;  2L4M A;  4NQW B;  5EG0 B;  3WTY C;  3I59 A;  3MKY B;  3AL0 B;  3PNT A;  1REP C;  2RN7 A;  2ZKZ A;  4WCG A;  1SVL A;  1FP2 A;  5FGM A;  4CCO A;  2XGE A;  2AQE A;  1QVT A;  1FZP B;  1SVO A;  4LLG F;  3ELK A;  2K4J A;  5AIP A;  1IRG A;  2BV6 A;  3O2P E;  4A3C J;  4B44 A;  3OYN A;  3F9K A;  1A6Q A;  3BC8 A;  5K5R A;  4HV6 A;  1FIA A;  2MLG A;  4LB6 B;  2HPI A;  4DYC A;  4ZDO A;  5D5U B;  3W6J B;  3RKY A;  1U5T B;  2F6C A;  1USS A;  4G7Z F;  3VSL A;  4UB8 C;  5H20 A;  3QQA A;  4RMN A;  5ED4 A;  1T6S A;  2OF7 A;  2K4B A;  3S32 A;  1IDY A;  1XN7 A;  2PEX A;  2KDZ A;  1TL8 A;  2HOE A;  2LG4 A;  2LF8 A;  2VJ5 A;  4AIK A;  4BHC A;  2HXO A;  2HWV A;  4BL0 B;  5KVR A;  1WFX A;  4M3E A;  5F0F A;  2A5Y B;  4P1W A;  1DQU A;  1ZN2 A;  3RI4 A;  3MN2 A;  3CJN A;  1NH3 A;  3HOV J;  3QPS A;  4HW0 A;  3OYM A;  4E7H A;  3HRU A;  3J81 K;  1IXC A;  3QRF F;  2OV7 A;  1IW7 F;  3G3Z A;  4KT6 A;  1NK3 P;  1P4A A;  2L01 A;  5HOD A;  4BQO A;  1N78 A;  5BMZ A;  1SFE A;  1GT0 C;  4RLQ A;  2DOD A;  1IUY A;  3K10 A;  2BYV E;  4R79 A;  3ZQ7 A;  4G8X A;  2J5P A;  4CCL A;  3FXK A;  4IHX A;  1MJA A;  2PX9 A;  5E3N A;  1BBY A;  4LOC A;  4KYW A;  1O4X A;  1IN8 A;  4RAY A;  1JE8 A;  4AD9 A;  2VXZ A;  3TGN A;  2H94 A;  3GUD A;  3IRQ A;  4PDK A;  2WB1 N;  4RGR A;  1KYW A;  1T95 A;  3M9A A;  3HRS A;  1ZGW A;  2COB A;  2KFD A;  2GBY A;  2NS8 A;  2VQH A;  3WOD F;  1ZQ3 P;  1U9O A;  1TT0 A;  1Z67 A;  2F5D A;  5DD4 A;  5EGO A;  5E3L A;  3ULQ B;  3HKZ N;  5J3L A;  1B72 B;  1SD5 A;  5IOZ A;  3S1Q J;  2VBZ A;  5LGT A;  2Y2Z A;  1UZC A;  3K4C A;  1Z77 A;  2GA1 A;  1WJB A;  3LAP A;  1KA8 A;  4LD5 A;  3PNV A;  5F1R A;  3QPT A;  4CCM A;  2ZME C;  3IUO A;  1TW3 A;  3A4C A;  4HNT A;  2KLO A;  2VXD A;  3HTS B;  1VQ5 I;  2QVO A;  3ERE D;  1IF1 A;  4XN0 A;  3C2G A;  3CJT B;  1X2M A;  1JUM A;  4PJN A;  1FOX A;  4LFU A;  1TQI A;  4HZF A;  1MJB A;  5D6E A;  1DDN A;  2ZJR F;  4XK4 A;  1BC8 C;  2P5L C;  1W7P A;  2M7B A;  2GXG A;  5IOY A;  5FLX K;  4JX6 A;  4RM2 A;  3AG2 H;  3RKQ A;  2KZV A;  4MEX F;  2CFX A;  1FSE A;  4DYQ A;  1A36 A;  2TCT A;  3LA7 A;  2FQ4 A;  4M6Y A;  2Y9Z A;  1YIJ I;  2AHQ A;  2JPB A;  3WE2 A;  3DF8 A;  4CZZ A;  1RNL A;  3WTT C;  2EA2 A;  2NVQ J;  4BEH B;  3IHU A;  1ZRD A;  1VQO I;  4IEJ A;  1OKR A;  2IAI A;  4A3M J;  2D1V A;  5FB2 A;  2DA1 A;  4YEL A;  3TDZ C;  5L3D A;  3PSI A;  2X6X A;  2OD5 A;  1T56 A;  4XOT A;  5GP9 A;  1WHU A;  3GFJ A;  2DA6 A;  1J0R A;  5EDN A;  1HDP A;  4I7H A;  1S7O A;  1S7A A;  1X3Z B;  4JX5 A;  1R71 A;  1U0J A;  3PM1 A;  4HPQ A;  1BC7 C;  1SVM A;  2A05 A;  4IKF A;  4ZYH A;  1XSX A;  1YQA A;  4H4K C;  3RPQ A;  3EYY A;  1FBQ A;  3N05 A;  5J8F A;  2CW8 A;  2Q2E A;  4EAT A;  2FEZ A;  1ULY A;  2DDB A;  4XQF A;  1QNT A;  1XCV A;  3F8M A;  4F52 A;  2DK5 A;  1BI2 A;  3IAS 2;  2R7R A;  1TZL A;  2BVM A;  3PIO F;  5DYM A;  3AKZ A;  3L2Q A;  2ZO4 A;  1B8I A;  1K4T A;  5B1B H;  3WTW C;  1ZR2 A;  3IKV A;  2L9V A;  3RPU D;  3H3U A;  4MGR A;  1ODD A;  3ZMT A;  3PFI A;  4HF1 A;  5JLW A;  3AFH A;  2X1D A;  3GTJ J;  2Z9O A;  1BI3 A;  4KT5 C;  2XF6 A;  3ASN H;  3PL8 A;  4HEA 2;  2W57 A;  3OS2 A;  3ECH A;  3GTG J;  1MDM A;  1IDZ A;  3DFG A;  2M1B A;  3WE3 A;  3ZMV A;  3OV8 A;  1VQ8 I;  4M9Z A;  4NC6 A;  2WY8 Q;  1BR2 A;  3BDD A;  3BT9 A;  1WI9 A;  2V9V A;  1BA5 A;  1Y0N A;  3EUA A;  3HUG B;  3BJ6 A;  2O9L A;  3BRO A;  2R7Q A;  5D5X B;  1S9H A;  2XF7 A;  1OCO H;  1JXS A;  2LFB A;  3CDI A;  2CW0 F;  3KZZ A;  5LEJ A;  3PUB A;  4KMU X;  5DUI A;  1HCR A;  1W0T A;  4P9U A;  2DFF A;  4AU7 A;  4FX4 A;  3E97 A;  2KT0 A;  4DJA A;  1D1A A;  1WJD A;  1DU0 A;  2KPM A;  1ZRC A;  1UHM A;  2FXA A;  4I76 A;  5FD5 A;  3BJO A;  3LSP A;  2BY0 A;  4BJ5 C;  2DJN A;  2E34 A;  4O5V A;  3SZT A;  5M3M J;  4I02 A;  4FTH A;  4RB2 C;  4YIR X;  1VQ6 I;  4IRI A;  4ITV A;  2R5Y A;  2DT6 A;  1KGS A;  3JR9 A;  4E7S A;  3FIW A;  3HHG A;  1VND A;  2RQP A;  3HIF A;  4C30 A;  5D8L B;  1F1Z A;  5LHI A;  3JRD A;  2E36 A;  4Q4Z F;  5FKL A;  1Y1W J;  3HPH A;  4GCV A;  4E7Z A;  1JHF A;  2K9L A;  5F04 A;  1YW9 A;  2EWN A;  1OMI A;  1JUS A;  4BQQ A;  2E7X A;  2P5K A;  4L9J A;  2OJE D;  4BUP A;  3GFL A;  2H1K A;  3FWE A;  2X48 A;  2XRN A;  1JGS A;  1XDU A;  2DA3 A;  3OIO A;  1GXQ A;  2LSO A;  2X6Y A;  2OBP A;  2LH9 A;  5CQE A;  1T2K A;  4AM3 A;  1IXR C;  1OYW A;  1AU7 A;  4CZC A;  1BW6 A;  1XMK A;  5TRD A;  1J09 A;  1PP7 U;  3F3X A;  2NRA C;  5BS6 A;  3U2R A;  2UWM A;  3C7J A;  1W5S A;  1TC3 C;  1XMA A;  4BXX J;  4TV7 A;  5IT9 Z;  1D1B A;  4G7O F;  2LP0 A;  2LRD A;  2MYS A;  1R58 A;  2E19 A;  2DA7 A;  2BE5 F;  1ON2 A;  1IGN A;  1LDJ A;  3F8B A;  3GO5 A;  4AC0 A;  1LB2 A;  1ZG1 A;  3OYL A;  3IWZ A;  3L2R A;  3OYA A;  2VB6 A;  2QM3 A;  1MZB A;  4E4H A;  3KP2 A;  4XID A;  4F91 B;  3BG7 A;  3V8L A;  2YS9 A;  2XGC A;  3AG4 H;  3OYH A;  4AVP A;  5HLT A;  1ZGA A;  3DCF A;  3E1S A;  5B5E C;  4KIT B;  3Q0V A;  2B9S A;  1MMD A;  4ZH4 F;  4DOZ A;  1HLV A;  2V1X A;  5EJC A;  4MTD A;  3ZMS A;  4XLP F;  2XKP A;  4ENM A;  4A3I J;  1I6X A;  5KHD A;  4KMF A;  1VQM I;  2RC4 A;  3BR6 A;  2K3P A;  4C2M J;  1ZEL A;  4UVB A;  3OYI A;  4CYC B;  3OYE A;  4K2E A;  4QTR A;  1YS7 A;  3T8R A;  2CFO A;  5M5X J;  5E1W A;  1R36 A;  4PK4 A;  4AYB N;  5L3F A;  5B1A H;  1HW5 A;  3LA2 A;  1L3L A;  3HSF A;  4XLF A;  1Q1H A;  4HBL A;  3UNG C;  4BHB A;  2UXN A;  4LGW A;  2K7L A;  3ZQC A;  5C44 J;  1H0M A;  2HKX A;  2EIM H;  2IT0 A;  1RKW A;  2F5F A;  4WK8 F;  1FSH A;  4D7N A;  4LIT A;  3E6M A;  4ESB A;  2V26 A;  4FAS D;  1QGP A;  5B3S H;  2HNH A;  1D0Y A;  3P9C A;  3O8H A;  2OTJ I;  3KYD B;  3HXL A;  2ZJQ F;  3CO7 C;  2B0L A;  3BG3 A;  4N4O B;  1M1E B;  4Y7N J;  4BDZ A;  2LY1 A;  1PUF A;  1RRJ A;  3TO9 A;  4ZDP A;  1WJE A;  3HGY A;  5CVV A;  2XIG A;  3E5U A;  2VAS A;  2PJP A;  3HOU J;  3MD2 A;  4XRS A;  4Y17 A;  1JUP A;  1D0Z A;  1ENH A;  4PJJ A;  1BIA A;  2GXA A;  1DUX C;  1W7P D;  3TOB A;  2R7Z J;  2FF4 A;  3V7R A;  5FFZ A;  5J47 A;  2ZSI B;  2AO9 A;  2K85 A;  3TO6 A;  2JMW A;  4Y15 A;  5DTD A;  2LYC A;  2ZFU A;  3R6S A;  1I27 A;  2ICW G;  2Q0O A;  4GGG A;  1UJ8 A;  1OCC H;  1L0O C;  5ICE A;  4MIM A;  1X4O A;  2GIZ A;  1JT0 A;  1MBH A;  3MKZ A;  1CF7 B;  2R7F A;  4XN3 A;  5E18 F;  1PVE A;  3N97 A;  2ZJ2 A;  1ZHF A;  3H0G J;  1U8B A;  2NVX J;  2IPQ X;  3V7C A;  3H3V K;  3KLO A;  1QQI A;  2CO5 A;  1SFK A;  2KIM A;  1FY7 A;  4KNY A;  1A6I A;  4PFP A;  2UXX A;  1P92 A;  2O0Y A;  3KE2 A;  1NK2 P;  3S3M A;  1T33 A;  2DXI A;  3GTL J;  5BNG A;  2DPD A;  1WCM J;  1HBX G;  3M7G A;  3Q0W A;  3K2Z A;  3ROU A;  4XNF A;  5DDG A;  2NYX A;  1N25 A;  5GAE J;  3FHZ A;  5IT9 K;  5E79 C;  4ZYD A;  1JHH A;  1MBF A;  2IVM A;  3F6V A;  4BQN A;  4UNO A;  3GTM J;  3D5R C;  2PJR B;  1R5H A;  3G71 I;  1G2H A;  2QKL B;  3ESW B;  1HST A;  2FJ1 A;  1KU7 A;  4A3J J;  4IHY A;  3CCE I;  3FXJ A;  1LNW A;  4M72 A;  4A3F J;  3H5R A;  5F6F A;  2XPW A;  1JKQ C;  4NHJ A;  3FXR A;  3CCM I;  1HOM A;  1Z0X A;  5M3F J;  3C3W A;  3OIP A;  2CRG A;  4B43 A;  1YTY A;  2WV0 A;  4I98 B;  2CSO A;  1TT5 B;  4CHU A;  5E8G A;  1J2X A;  3CDL A;  2HQ5 A;  1BW5 A;  3TP3 A;  2JZY A;  3CP2 A;  2P5V A;  1WJ5 A;  3BPX A;  2H1L A;  4KN4 X;  1J5Y A;  4YFN F;  2IXS A;  4I01 A;  2L2O A;  1QU3 A;  5GTH C;  3L09 A;  1QA6 A;  4ZYG A;  1POG A;  3LSH A;  2M8G X;  3TBI A;  1OCP A;  4DZJ A;  5ILV A;  3HOT A;  5TJJ A;  1SFO J;  2DMQ A;  2PBI A;  3LQR A;  1HSJ A;  2O5R A;  3ABU A;  3D1N I;  4LLN A;  4MQ9 F;  3E5Q A;  2WC2 A;  1RR7 A;  1BJA A;  3S15 J;  2L3D A;  1J9I A;  1PDN C;  4L9V A;  2KHM A;  3F0C A;  5DM6 F;  1R1U A;  3A2K A;  4L0Y B;  3LOC A;  3TED A;  5B66 C;  4S0H B;  2HDC A;  4M73 A;  4EGY A;  3FKI J;  2QSH X;  4HX7 A;  3EGV B;  1UCR A;  2FBH A;  3S1N J;  3HSE A;  3A03 A;  2I8D A;  1ETW A;  5D8K B;  1BOA A;  3AAF A;  3Q5F A;  1XC5 A;  3L9F A;  3K70 C;  5F1J A;  3RKX A;  2JA5 J;  4XMY A;  3J81 Z;  2WV1 A;  3B73 A;  3ZQQ A;  1X1D A;  2DFE A;  2P7V B;  2JUG A;  4ENJ A;  3DBR B;  4BBS J;  3J7A Y;  3VSK A;  2ZME B;  4PUS A;  1RC9 A;  2JK3 A;  2M4K A;  4W97 A;  2BVL A;  2DQL A;  1S6L A;  4WXH A;  2CUE A;  5K7F A;  1TW2 A;  4C3I J;  1MBG A;  1XMX A;  3TP0 A;  4AWX B;  2G7H A;  4OIN F;  5A2Q K;  3OYG A;  2D2W A;  4HYE A;  2DU9 A;  1ITY A;  4I6Z A;  4L5I A;  3CC4 I;  1HKQ A;  3CLO A;  3TO7 A;  1W4M A;  4KIB A;  1WKM A;  4G12 A;  2O6G E;  3GTK J;  2XVC A;  4Y4R A;  2E35 A;  2QCO A;  4QWQ A;  5ILU A;  3OYB A;  1O3T A;  4EJV A;  1SAU A;  1T98 A;  1ZK8 A;  3B6A A;  5DEQ A;  3RSN A;  2PMH A;  4RAZ A;  1YW7 A;  2HZD A;  3MKL A;  3PSF A;  4C9Y A;  1F9N A;  5CPR B;  5JVG F;  2IJL A;  3CCR I;  4G6Q A;  1RKT A;  2KZG A;  2LMD A;  2EFN A;  2Z2S B;  4NQW A;  2ESH A;  4R1H A;  4U7D A;  3KPH A;  1E3P A;  1Y6I A;  5FKN A;  1PJR A;  1Q1V A;  2PN6 A;  4JOM A;  2I5U A;  2Y75 A;  1BJZ A;  3Q0U A;  1S7E A;  2Z33 A;  1LE8 B;  4BJT A;  1FMV A;  3EUK L;  1FYM A;  3FF5 A;  4ZYE A;  1U3E M;  2DDA A;  2H27 A;  2GA2 A;  5FLX Z;  4AIH A;  2M0M A;  3MVP A;  3D5S C;  2P7C B;  2M4G A;  3IKT A;  1U5T A;  2RNG A;  2CJJ A;  2E5N A;  3K0L A;  4NDL A;  2OCC H;  1IN7 A;  4XRF A;  2CQ7 A;  4DZP A;  2O61 A;  2ID3 A;  4HSR A;  4NC8 A;  1KU9 A;  2DOA A;  4XLC A;  3LQQ A;  2FBI A;  4L5J A;  3OR2 C;  4ZTJ A;  4PJL A;  1VF9 A;  3JTH A;  1W5C C;  4DBR A;  1K79 A;  2KIU A;  3BCB A;  3DV8 A;  2RQQ A;  1K4S A;  3GTP J;  2FOK A;  4IXA A;  1XS9 A;  2LTP A;  1OYY A;  4ZTF A;  4G6T B;  4BXU A;  1ACI A;  3F72 A;  1G3S A;  3EPZ A;  3K4N A;  3W2W A;  2H09 A;  3DBL B;  2XKO A;  4DYR A;  1YFH A;  1S3J A;  2RRE A;  2VT2 A;  3E6B A;  2YX7 A;  2NS0 A;  4A3K J;  3ZMZ A;  2EZH A;  3L2U A;  2LF7 A;  2DA2 A;  3BR0 A;  2R7U A;  1YLF A;  2A6E F;  5HS8 A;  3N4M A;  1Y39 A;  1R5G A;  1IG7 A;  3QOE A;  4BAC A;  4BY1 J;  3BPV A;  1VQ7 I;  3BG9 A;  3OOP A;  2G7U A;  4E7I A;  4AVZ A;  5LBQ A;  2W24 A;  4RB3 C;  2JWT A;  4LIV A;  1RIO H;  3K4L A;  3ABK H;  3TOA A;  3HOW J;  3O8G A;  2H6C A;  4XOP A;  2HVQ A;  3OS0 A;  1JTY A;  2F4M B;  4E7L A;  2X4H A;  5LRR A;  2R5Z A;  1E17 A;  2JPC A;  3VFZ A;  1B72 A;  2LVS A;  5HOO A;  3IH3 A;  3NQO A;  4Z2Y A;  1WIB A;  1EH6 A;  1ZLJ A;  1BR4 A;  2DPU A;  3J7Y J;  2ZBK A;  3CCU I;  4RM3 A;  4B47 A;  1WSU A;  1V55 H;  3WG7 H;  1JKR C;  1CQT A;  1ZTR A;  2KJB A;  5LRS A;  2R0Q C;  3ZR8 X;  1S72 I;  2EIN H;  4YG2 F;  5HVQ C;  1V5F A;  4DIQ A;  4A12 A;  2JSC A;  1LUJ B;  2LK2 A;  2XV4 S;  3EUH A;  3OSG A;  4IPA A;  4EVI A;  4HOB A;  2TDX A;  2UV1 A;  5EEG A;  2A6H F;  2XGD A;  4HX8 A;  1D8J A;  2VC0 A;  3LSG A;  2P81 A;  1FP1 D;  1KON A;  1Z3X A;  2XAG A;  3I59 B;  3ZN0 A;  1MGT A;  1HW1 A;  2ECB A;  4MFD A;  2FBK A;  4HV5 A;  2E1C A;  1FOK A;  1GLN A;  4OWR B;  2PG4 A;  1UFM A;  1E3H A;  1DPU A;  3E6D A;  3RQ4 A;  3FXM A;  1HKS A;  2VOD A;  2NOG A;  3IV5 A;  2HKO A;  4X0G A;  4PJM A;  2H6B A;  5FO5 A;  4V2F A;  2VUM J;  3OYC A;  4WF2 A;  3KP4 A;  2FMY A;  3MMY B;  4KIS A;  1WJA A;  3QU6 A;  1I1S A;  1Z7L A;  4PSX A;  4U7B A;  1I50 J;  3J7A O;  3DLL F;  1IRF A;  3JW4 A;  2K9N A;  1T8I A;  2V79 A;  4I2O A;  2FA5 A;  1LPQ A;  3KEQ A;  1SFU A;  4D7M A;  1S29 A;  4NB5 A;  4CA0 A;  5K7Z A;  5IYD J;  2M7A A;  1T0F C;  2VQG A;  3WHB A;  1H8A C;  2EIJ H;  2VBW A;  2FQ3 A;  4J01 A;  2DQR A;  2KMU A;  3DTK A;  3IH4 A;  1OPC A;  1VI0 A;  3FBN B;  3V8J A;  3PIP F;  2P6S A;  4HLX A;  4O6J A;  2W84 A;  3BG5 A;  2LKX A;  2BW3 A;  3ZMD A;  2GOM A;  2OQR A;  5LGN A;  3QPH A;  2X1E A;  4HDU A;  1G6N A;  2DLL A;  4IHT A;  1S8N A;  3L2V A;  2VLA A;  4M6X A;  1VQP I;  4CCJ A;  3RZD J;  2VKD A;  4GXO A;  4MLO A;  1R4N B;  3NAR A;  4P96 A;  4M74 A;  1GUU A;  5GPA A;  2ID6 A;  2VKH A;  3HBL A;  4U0W A;  2LR8 A;  1X3U A;  1MBJ A;  4CYD A;  2DA4 A;  2BY2 A;  1P4X A;  3W6V A;  4KIC A;  1BI1 A;  2VJJ A;  2ZNY A;  4WXC A;  1K78 A;  1YOV B;  3BWG A;  1OJL A;  5FKK A;  1APL C;  1EKE A;  1LJ9 A;  1B9M A;  5EGO B;  1W36 D;  1YRN B;  2E1M C;  4CUG A;  1YIO A;  2OAZ A;  1IN4 A;  1QHH D;  3HUG A;  3JSO A;  4EJO A;  3VOE A;  1MH3 A;  4G7H F;  4D9J A;  3L7W A;  5KNL A;  1HQC A;  1YS6 A;  4S05 A;  3J7Z I;  4XKW A;  4BBR J;  4GDF A;  3DXJ F;  1RR8 C;  3I4N J;  3ZOB A;  2ADU A;  3QAH A;  3PUF A;  4RGX A;  2LD5 A;  2BBY A;  1TNT A;  4XBF A;  2AXT C;  2KIQ A;  2VJ4 A;  3HRT A;  4RAF A;  2VPR A;  4LG3 A;  3AG1 H;  4EM0 B;  2R7X A;  3VYU B;  2C6Y A;  2NNY A;  2ZXJ A;  1UEL B;  2PMU A;  2MFZ A;  5IPA A;  2W7N A;  3CCQ I;  4EEF G;  4D0P A;  4XR6 A;  2F48 A;  3OMY A;  2ZSH B;  2DTZ A;  4IZZ A;  4XRM A;  3DKY A;  3BR1 A;  4B09 A;  2VE9 A;  3DTI A;  5C4X J;  3PO3 J;  3CUQ C;  2F4I A;  3SYT A;  4A0Y A;  4JYK A;  4AID A;  1UG2 A;  4BS9 A;  5JI6 A;  1YJ9 I;  1JI8 A;  2J5O A;  3TMO A;  1TWH J;  3V4G A;  2YU9 J;  4I0B A;  4GFB A;  3C2B A;  3ZRG A;  3LMM A;  1MMA A;  1VQ4 I;  1ETY A;  2QKM B;  3MEX A;  1R00 A;  1OCZ H;  1WRJ A;  3I9V 2;  3O3K A;  3TW7 A;  2Q8K A;  1D5Y A;  2RGV A;  1NTC A;  2QQ8 A;  2E60 A;  3CF2 A;  1EA3 A;  1O7F A;  1IN6 A;  2XGX A;  3VYR B;  3W6K B;  3P7N A;  1ZRF A;  4NC7 A;  4HAM A;  1IJW C;  3HG9 A;  2E2H J;  3VDX A;  4A3E J;  4BDY A;  1T39 A;  4A3L J;  1KU3 A;  2JA8 J;  3QYB A;  2RAE A;  2WA0 A;  1R1V A;  3K9T A;  4PCQ A;  3I54 A;  4CH7 A;  3L1P A;  2V1U A;  5HDG A;  3T8T A;  3H35 A;  3HM5 A;  2QSG X;  4MO7 A;  2IA1 A;  2KP6 A;  2L7K A;  4A69 C;  3JCU C;  4MEY F;  3S1M J;  3GFM A;  3KEY A;  5ERI A;  2RKH A;  2Y0S A;  3S8P A;  2B7E A;  1AOY A;  3FK7 A;  1O7L A;  4I0A A;  2O03 A;  2Z5U A;  1VFC A;  2NAZ A;  5BPD A;  1EH7 A;  1K6O A;  2ZFW A;  5ICF A;  2HR3 A;  4UXN A;  2WAE A;  3EYI A;  2EFO A;  1MDM B;  1MBE A;  2E1O A;  3ML6 A;  1KU2 A;  2DW4 A;  3COA C;  3WGH A;  2XPU A;  4BQA A;  4EMS A;  1XGS A;  1D1C A;  3QOD A;  3CUO A;  4CYC A;  4UUS B;  2H8W A;  4RB1 A;  4LK0 F;  4ZJZ A;  3FMS A;  2HOS A;  1IN5 A;  3KCC A;  3K4K A;  2VOO A;  3LSJ A;  2IA0 A;  4BXF A;  2DA5 A;  5IT3 A;  1ERD A;  4XIC A;  5IP9 J;  4M9X A;  2JA7 J;  3FX3 A;  2IGM A;  1YG2 A;  5AIQ A;  1P7I A;  5L3C A;  3BR5 A;  5D5V B;  2CUZ A;  2BXZ A;  3HPG A;  3CCJ I;  1BR1 A;  5HLG A;  1BM9 A;  3BZ6 A;  4YRV A;  1C0W A;  5FKO A;  3RTR A;  3W2V A;  2HS5 A;  5JLX A;  3QWL A;  4P5O A;  2MBF A;  3E3V A;  3BR2 A;  4XKV A;  1WH7 A;  4CCN A;  2XAU A;  1JJ6 C;  1KQ9 A;  2QGU A;  2Z1D A;  3BZK A;  4IHS A;  3CCL I;  5IP7 J;  3U9G A;  2R5Y B;  3BZC A;  3KLN A;  4XLA A;  3CME I;  2KKO A;  1V5G A;  1MMN A;  2P6T A;  5LEK A;  2XC7 A;  3FXU A;  1Z3Y A;  3KET A;  2IS2 A;  1RUO A;  1WVR A;  1EH8 A;  5K1Y A;  3OWT A;  2OTL I;  3U1D A;  2VL8 A;  3EUH C;  1P6R A;  3I55 I;  1TWA J;  3H36 A;  4L0Z B;  4X1E A;  2QSF X;  4ZYA A;  2HYJ A;  1Z6R A;  3LSI A;  3X2Q H;  2DN0 A;  1NG6 A;  3HYI A;  3LAJ A;  3V8K A;  1YJW I;  4G9Y A;  3WU1 B;  2EBI A;  1WWX A;  5FLM J;  3HOZ J;  3LFU A;  1I6H J;  4HNU A;  1HXD A;  1W5T A;  1G4D A;  1K61 A;  3IL2 A;  1E0E A;  3MWM A;  5CQG A;  4B3X A;  2XAQ A;  4CO8 A;  3I0T A;  5FLV A;  5LFA A;  4HRI A;  3G6E I;  1ETV A;  3MAJ A;  2KDO A;  2PQ8 A;  3BQZ A;  2EK5 A;  1R4M B;  2K86 A;  2CUF A;  2E2J J;  3BLY A;  3FXL A;  2VKV A;  3BTJ A;  4YII A;  3SFI A;  1D5V A;  2LOO A;  2L9S A;  5DCF A;  1AKH B;  3S1R J;  1TQM A;  4RGU A;  3MZ8 A;  1I3Q J;  2XHK A;  3DBH B;  3DEU A;  3A0B C;  3PFY A;  2K9M A;  3DPU A;  2BY1 A;  5CVU A;  1XD7 A;  1Y1V J;  1YX5 A;  4LJZ F;  4RGS A;  1ZG5 A;  4U88 A;  3HOS A;  2HZT A;  2P0W A;  4B1R A;  2JUC A;  2UUZ A;  5A2Q Z;  2V7F A;  5ICC A;  2JQ7 A;  1R22 A;  1HW2 A;  2PJR A;  1U6G A;  3DEW A;  3BTC A;  2EV5 A;  2MC3 A;  3FM3 A;  2M34 A;  1GHC A;  3DPL C;  2IS1 A;  5CYV A;  4R8H A;  3OS1 A;  1KQ8 A;  4YIF A;  2OU2 A;  1YI2 I;  3L2W A;  3G4S I;  4UB6 C;  1MD0 A;  1H9T A;  3OR1 C;  4OMZ A;  5JFR A;  3RYP A;  2AQF A;  2L54 A;  4IHV A;  1BI0 A;  1FTT A;  4D1Q A;  1Z91 A;  2QBY A;  1JJ8 C;  3H92 A;  1FC3 A;  2NOJ B;  4ESF A;  4J00 A;  1Z1D A;  3FIS A;  3WTX C;  4MNU A;  3MFK A;  1R1T A;  5IYB J;  3REO A;  1Z6T A;  1MW7 A;  5EZG A;  2HQA A;  4XSX F;  3SEZ A;  5FRN A;  2DMN A;  4F55 A;  1X1C A;  1MMS A;  2V6C A;  4HDV A;  1Z9C A;  3BP8 A;  1B59 A;  1QZY A;  2DO7 A;  5HNH A;  3GX4 X;  1LDD A;  4IRG A;  2ZC2 A;  5FRM A;  1PUF B;  1LQ1 A;  2CGP A;  4XLH A;  3FZV A;  3SZP A;  1OQY A;  3R61 A;  3FMQ A;  2KL4 A;  3NWT A;  5E20 A;  1YW8 A;  2KIF A;  2VPL A;  3GME A;  3VB2 A;  2GM4 A;  3FMR A;  5KCM A;  3HSR A;  1IRX A;  5CLS A;  3ERM A;  3LNQ A;  1LVA A;  1O3S A;  5DCM A;  1G3T A;  4RLF A;  3K4M A;  3ABT A;  1LFB A;  3HTU A;  4A6E A;  2R7T A;  4FQG A;  4B8X A;  4ETS A;  4A5N A;  1RI7 A;  2HDW A;  3I4P A;  2YR2 A;  4U87 A;  3S17 J;  2EJR A;  1TWC J;  2BOL A;  4JK1 X;  3LSR A;  5CVJ A;  3GCM A;  3M1E A;  3WTV C;  2X0L A;  5F27 A;  3MKW B;  1ZRE A;  4U0Y A;  1FOY A;  3BY6 A;  2A68 F;  4IRH A;  4ESJ A;  4N9I A;  2IRF G;  2JRT A;  2ACJ A;  1A35 A;  2XAS A;  3E6C C;  4L18 B;  1ONV A;  3QU3 A;  2Y31 A;  3EDP A;  2WAD A;  3RIR A;  3OY9 A;  1VTN C;  4MTE A;  4IL6 C;  5E1X A;  3MQ0 A;  2GQQ A;  3GLL A;  2QEX I;  4MFE A;  3RJP A;  3JRG A;  2I10 A;  2M3A A;  3J80 K;  1IAW A;  3SZG A;  2PMZ A;  3GFI A;  3C18 A;  2OZU A;  1ZKG A;  1UHW A;  2VON A;  1TTY A;  2L5Q A;  5D5W B;  1AA7 A;  1H88 C;  1YHQ I;  1R6R A;  1LEB A;  1N77 A;  2ZXW H;  3CCV I;  3WTS C;  3FXQ A;  4YFX F;  2MC4 A;  2A6T A;  3KFW X;  1DPR A;  2LDU A;  3CJR B;  3R0J A;  1WJF A;  2EZL A;  3QPL A;  4X6A J;  5J4Y A;  1SMY F;  2LLK A;  3C1D A;  1RZ4 A;  2CMP A;  2ESN A;  3U1K A;  4HF0 A;  1TWG J;  2G0E A;  4AIJ A;  2JSP A;  4LIU A;  1OIS A;  3K1P A;  3R0A A;  2Y69 H;  4O3M A;  1TNS A;  3DPT A;  3CJQ B;  2O8K A;  5CVR A;  2EQR A;  1MMG A;  1YE9 A;  3IP4 B;  1IUF A;  4EM1 A;  1B1B A;  2IS6 A;  2STT A;  1DGR M;  1ZAR A;  1ZG3 A;  1XGO A;  2EZK A;  4F92 B;  4BE2 A;  4V19 K;  4ENK A;  1FTZ A;  3A01 A;  4M3G A;  1X58 A;  4II2 A;  1J59 A;  2HU9 A;  2IGK A;  4KUM A;  1SEU A;  2EIL H;  2LBF A;  3JRF A;  3KP6 A;  2IW5 A;  3SDB A;  2HYG D;  5HDK A;  1QHG A;  3GLX A;  2E71 A;  5KAF C;  4LG0 A;  4OIQ F;  1LDK B;  3KZI C;  4ZC3 A;  3CMA I;  3E7L A;  3K4J A;  4BE1 A;  3HRM A;  5EG0 A;  1U78 A;  4UHT A;  3P9K A;  5LGU A;  1D8K A;  2KQR A;  3JAM K;  4L5E A;  5GAD J;  5E8I A;  3JTG A;  3G1O A;  2MW8 A;  2KIS A;  3F22 A;  1P2F A;  1S5L C;  3HEF A;  5J8C A;  3JRI A;  4UY8 I;  2VBY A;  1I1G A;  3G73 A;  2V4J C;  5J1Y A;  1PUE E;  2F5E A;  2FNA A;  2AXL A;  3AG3 H;  2CV2 A;  1Y8R B;  2QQA A;  1K83 J;  4KA4 A;  2ME6 A;  2E1M B;  3M8J A;  2QUF A;  1XG1 A;  2X1C A;  3EET A;  3CTA A;  2JT1 A;  2CUJ A;  3BQY A;  2L7F P;  1BOB A;  2Y48 A;  4MHG A;  2XRO A;  2YSR A;  4XSZ F;  5BOX A;  4YEJ A;  3S2H J;  1X2N A;  4RAG A;  2X51 A;  2CH0 A;  1KZH A;  1HKT A;  1OCR H;  5CKT A;  2DT5 A;  2FX0 A;  5H6Q A;  3P9I A;  1SD7 A;  3GZ6 A;  2DJI A;  3BTL A;  3H9Q A;  2ZJP F;  1BN5 A;  3SXY A;  1IRZ A;  4LB5 A;  5HNF A;  4KFC A;  3M4O J;  1QZZ A;  4XM3 A;  2BGC A;  2LY2 A;  3BR3 A;  3MCZ A;  4RA2 A;  4NNJ A;  5DM7 F;  4A0X A;  2GZW A;  2FML A;  3V42 A;  3LFK A;  5KAI C;  3CUQ B;  3P5J A;  4GO1 A;  3FBI B;  4A3D J;  4P55 A;  1TWF J;  3KZY A;  2O7O A;  1IC8 A;  5ICG A;  1XSD A;  1FNN A;  1ZAO A;  1A5J A;  2WTE A;  1FBU A;  4I99 C;  4N9H A;  4CSW A;  3DQV C;  1H9G A;  2GOX B;  2HI3 A;  2M8E A;  2WBM A;  1X3W B;  3WG9 A;  3T1B A;  2DMP A;  1GVJ A;  5TGT A;  1ETK A;  2Y0S N;  4P9F A;  5E3M A;  2EZI A;  3M8E A;  2PLY A;  5EF6 A;  4LK1 F;  1JKP C;  1ZLK A;  4OOI A;  3ECO A;  2VOP A;  2EFQ A;  3RZO J;  4D5C A;  1P4W A;  1QPM A;  4HST A;  5L3G A;  2CQK A;  1TQP A;  4M3D A;  3ZQG A;  2CWE A;  2IGN A;  2M30 A;  4W1U A;  3JRE A;  1G3Y A;  2JN6 A;  3OOU A;  4HA8 A;  2HXI A;  1XB4 A;  2W4S A;  4ON0 A;  3ZMU A;  3Q9V A;  2ECC A;  4IJA A;  3R4K A;  1X1A A;  2F5C A;  2DFH A;  4ZZL A;  2VQC A;  1YIT I;  3JRC A;  3OSF A;  1I3A A;  1MH4 A;  2RNJ A;  3ONQ A;  5CVI A;  3NEU A;  2MD5 A;  1QPI A;  3OYF A;  1ON1 A;  4DW6 A;  3ZQF A;  2FE3 A;  2FSW A;  3E0J B;  1F36 A;  4RS8 A;  4IO9 F;  2LY9 A;  3DKW A;  1F43 A;  4Y33 A;  4A6D A;  4IX7 A;  1JKO C;  3LL7 A;  2EIK H;  4DBQ A;  5TIS C;  3RQI A;  4UVA A;  2ELH A;  2HFH A;  4JX4 A;  3JRB A;  3IAM 2;  1GXP A;  2ZNZ A;  3I3L A;  5F0C A;  2JVG A;  3CD6 I;  2W25 A;  1EJ9 A;  3SDG A;  1MSF C;  2JA6 J;  1QO0 D;  2JA2 A;  4N4N B;  1XCB A;  4BEH A;  4DGW B;  2EFW A;  2K5C A;  3IRR A;  1WGX A;  2HOT A;  2MH2 A;  2OZ6 A;  1SD4 A; 
#chains in the Genus database with same CATH homology
 1Y39 A;  1VQP I;  2QEX I;  1VQ7 I;  2ZJP F;  3PIO F;  3I56 I;  4IOC F;  1VQL I;  2JQ7 A;  1YHQ I;  5DM7 F;  1VQK I;  3CC4 I;  4IOA F;  2H8W A;  3CCV I;  3CC2 I;  5GAE J;  1YI2 I;  2E35 A;  1WIB A;  3CJR B;  3G4S I;  3J7Y J;  3CCU I;  2NXN B;  3J7Z I;  1VQM I;  1VQ8 I;  1YJN I;  3G71 I;  5JVG F;  3CCR I;  1S72 I;  3CCE I;  3CCJ I;  3CJQ B;  2K3F A;  3CCM I;  1HC8 A;  3CJS B;  1VQ5 I;  1VQ9 I;  4V19 K;  1MMS A;  3CCL I;  3CME I;  3CCQ I;  3CJT B;  1FOX A;  3CCS I;  2E34 A;  2ZJR F;  1VQ6 I;  1QA6 A;  2OTL I;  1YIT I;  1YJ9 I;  2OTJ I;  2ZJQ F;  3CF5 F;  3I55 I;  3CMA I;  5GAH J;  2E36 A;  3DLL F;  1VQ4 I;  4IO9 F;  1YIJ I;  1YJW I;  3CC7 I;  1VQN I;  5GAD J;  2QA4 I;  4UY8 I;  1VQO I;  5DM6 F;  1ACI A;  5GAG J;  3PIP F;  3G6E I;  3CD6 I;  3EGV B;  1FOY A;  2FOW A;  1FOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...