5EG0B

Hoxb13-meis1 heterodimer bound to dna
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
61
structure length
61
Chain Sequence
RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular basis of recognition of two distinct DNA sequences by a single transcription factor
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Homeobox protein Meis2
total genus 16
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2015-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5eg0B00
1SFOJ 4UUSA 1R9TJ 3K2AA 2P81A 5M3MJ 3HDDA 3BR0A 5EYRA 5DTDA 1WH5A 1DU0A 2K40A 2ECCA 1E3OC 3W6VA 1U8BA 2MGQA 3E7LA 4BY7J 1WI3A 2M8GX 2X9DA 1JJ6C 1G2HA 1CQTA 2DMNA 5IOZA 1T56A 3CCYA 2L7ZA 2Y9YA 5FLMJ 2LD5A 3Q0VA 3O8HA 5E3NA 4L5EA 5EZHA 3BTLA 1AHDP 4JX4A 1XC5A 1K61A 2VKEA 4QTRA 1TC3C 4HNVA 4A3MJ 3ZQLA 4D7MA 3LSJA 1Z0XA 2AHQA 2O9LA 2HOSA 2GM4A 5C3EJ 1AKHA 2CQXA 5C44J 5IP7J 3WHCA 1JUMA 2E2IJ 2X6OA 1I3QJ 4DZPA 3G1LA 4M3GA 3HBLA 1GT0C 2XRLA 4QIWN 3OSGA 3HOUJ 3PO2J 1U9OA 4BKXA 2CU7A 3S2HJ 3JRDA 1B72B 2DJNA 1VI0A 3S16J 3UKGA 2XSDC 2OPTA 3Q0UA 2XGEA 4CYCA 2M0CA 4W97A 1Y1WJ 2E2HJ 5FKKA 4IEJA 1SANA 4A93J 2XPUA 1X2MA 2QF7A 3GTJJ 3S14J 2HYJA 1NK3P 2I10A 3BTCA 1JJ8C 1TWCJ 3B6CA 4NDLA 4MIMA 1P7JA 5JLWA 2NVYJ 2HOTA 2EH3A 1B72A 1UMQA 1OFCX 4A3CJ 2XGCA 1IDYA 5IOYA 5K7ZA 4C3IJ 4BBRJ 3JREA 1GV2A 1IDZA 3S1NJ 4XIDA 2VI6A 2DA4A 2WV1A 2EZLA 3IH2A 3BR3A 4MFDA 5IYDJ 4B1RA 4I6ZA 5F0HA 2YS9A 4A3DJ 3BR2A 5FKOA 2H8RA 3BT9A 9ANTA 1ETOA 1LE8A 1MBHA 3G1OA 4D5CA 2EZIA 3S2DJ 2HXOA 1ETYA 1U78A 5GP9A 2DMPA 4M3BA 1LE8B 5M5WJ 2GBYA 2HXIA 3FK7A 4JYKA 3A03A 1IV6A 1VNDA 3B6AA 4FTHA 3CMYA 2TCTA 1TWFJ 4AC0A 4IHVA 4FISA 4XRSA 5M5XJ 2Y9ZA 1JT0A 5EDNA 4AYBN 1TWGJ 3PM1A 5M3FJ 2GLOA 5JLXA 2MG4A 3ZQIA 3HOWJ 2Y2ZA 1FIAA 3BR5A 1ZK8A 1HDDC 2E2JJ 1T33A 2R5YB 1WH7A 2LTPA 3ZQCA 1Q1VA 5IP9J 2IBDA 1WGXA 4QSHA 3FK6A 1ETKA 1RETA 3A01B 5J3LA 5BNGA 5J1YA 5M5YJ 2H1KA 2ZB9A 2K9QA 2Y30A 2MSYA 2IAIA 1HF0A 1FIPA 4CYCB 2HI3A 2IEKA 5IYBJ 1GDTA 1ENHA 1JUPA 1GV5A 2COBA 3GTOJ 1B8IB 1OCTC 2NS8A 2ID3A 4B3AA 3HKZN 1MNMC 1X2NA 4X6AJ 1A5JA 1JTYA 4D5FA 1ORKA 1A6IA 5GPCA 4MFEA 4S0HB 2CRGA 1H88C 3TW6A 3G1MA 4A3GJ 5IP6A 3SJMA 1XG1A 2XPVA 5FKNA 1AKHB 4MO7A 2JA6J 3M3YJ 1EF4A 4A3IJ 2DN0A 3K7AJ 3LSPA 1UG2A 1BJZA 2K9SA 3Q3SA 4UUTA 3H3VK 3HOVJ 4XICA 4X1EA 3M4OJ 4FE4A 4RDUA 2N8GA 1B8IA 3DCFA 1QVTA 1GVDA 4ABZA 3BG9A 1IG7A 2JA8J 1JGGA 1D5YA 3MVPA 1ETXA 2YUSA 2FX0A 3JRBA 5GPAA 1TWAJ 2L0KA 2VPRA 4C3HJ 1TWHJ 1FEXA 3IV5A 2ELKA 1POGA 3VPRA 4IHWA 1H8AC 4D7NA 4FCYA 4M6VA 5F0CA 4GFBA 2DMUA 2FQ4A 2Y0SN 2Y31A 1UHSA 1S7EA 3ZOBA 2ID6A 1ZR4A 3DEWA 1VFCA 5HODA 1YRNB 2M9HA 2XPWA 2R93J 3A02A 4B4CA 5J1RA 3BR1A 3QPLA 4A3LJ 3JRIA 2LK2A 2JK3A 2R5ZB 2JWTA 1RKTA 3RZDJ 1JUSA 1ZKGA 2HOAA 1Y1VJ 4JX6A 1O4XA 1MH3A 2G0EA 3BG3A 1ETQA 1MBKA 3L1PA 2LVSA 1JKPC 1BW6A 1BA5A 2EZKA 2EQRA 1IRZA 2K9NA 3BQYA 4BY1J 1JT6A 2VUMJ 2ME0A 2TRTA 3LNQA 1U9NA 4M3FA 2JA5J 2NS7A 5FKLA 3QQAA 3WHBA 2DA7A 5EGOA 4AUXA 5EF6A 3F0CA 3JRFA 3HB9A 1NTCA 2DA6A 1MBJA 4M3EA 2NVXJ 5J1UA 5F0FA 3S1RJ 1HCRA 3JRAA 3I4MJ 1P7IA 3S17J 2E19A 1MSEC 1RPWA 4JX5A 2JJ7A 1HDPA 1FTTA 3H0GJ 2LKXA 2XB0X 2CQQA 2R7ZJ 5F27A 3GTGJ 5EGOB 1OCPA 1JTXA 2WAQN 1OJLA 3FKIJ 4G12A 3HM5A 5IPAA 5K7FA 3OIOA 2O8KA 3NAUA 3A01A 3GTMJ 1PUFB 3HEFA 2YU9J 5EG0A 1Z77A 3IH3A 3JRCA 4Y52J 3MN2A 4DW6A 2RAEA 1JKRC 4EEFG 4A3EJ 4XRMA 1I50J 2LLKA 1FJLA 3TEDA 1FTZA 2LP0A 2X48A 3ZQGA 5EG0B 5FLVA 1HOMA 3BR6A 4UUSB 1NK2P 2HQ5A 3RQIA 3ZQHA 1MBGA 2NVQJ 2WB1N 3OOUA 1K83J 3HOZJ 3Q0WA 3BTIA 1IGNA 2R5ZA 1ZGWA 3GTPJ 3GTQJ 2EBIA 1F36A 5F04A 1IUFA 2M34A 5E3OA 2MW8A 2LY9A 4M3DA 1HLVA 2R5YA 5EZGA 5FKMA 2VKVA 2JMWA 1AU7A 2E1OA 1IJWC 1I6HJ 2DTZA 2M2EA 2XB5A 2XGDA 3BG5A 5F1JA 4A3FJ 4RBOA 3RKQA 4V2GA 1DU6A 2CJJA 1LFBA 1WCMJ 2QCOA 1ITYA 1BW5A 1GUUA 4XRSG 5FJ8J 2HDDA 3O8GA 3GBGA 1RKWA 3S15J 3TP0A 2NOGA 2KT0A 1YRNA 2DA2A 4BBSJ 2LR8A 2CUEA 2DMTA 3CQZJ 4W1UA 4A69C 1QRYA 4DZJA 1W0TA 1BL0A 3CDLA 3FIWA 3S1MJ 2R92J 2LFBA 3JR9A 2NVTJ 3NARA 3OSFA 1LFUP 2D5VA 4A3BJ 3D1NI 1MBFA 5K7HA 4MLOA 2CUFA 3HGGA 4C3JJ 4DYCA 2EZHA 2JA7J 4IHXA 5IYCJ 3JRHA 1QVUA 1JKOC 3HOXJ 2DMQA 4LOCA 2FD5A 2B63J 2W48A 4V2FA 1RESA 5C4JJ 3PO3J 3SDGA 4C2MJ 5EEAA 1APLC 3MKLA 2ME6A 4A3JJ 3BQZA 1W0UA 4BXXJ 3LSRA 5DS9A 3JRGA 4DYRA 1QPIA 4J19A 1MBEA 2FJ1A 3QPSA 2DA3A 2L7FP 3LSGA 1X58A 2JN6A 5E3LA 1ZR2A 1ETWA 3I4NJ 3BTJA 5F08A 3C2BA 4XK4A 4Y7NJ 1VF9A 3HOYJ 5C4XJ 3TP3A 3GTKJ 1JKQC 2KDZA 3GTLJ 2PMZN 1H89C 3RZOJ 1F43A 3FISA 1IC8A 1MSFC 4FE7A 2ECBA 1RR7A 1MH4A 4I76A 2OF7A 3TW7A 2L9RA 4A3KJ 2DA5A 3LOCA 2R0QC 1XS9A 1PUFA 4IHYA 4JP0A 3SFIA 5E3MA 2L7MP 2DA1A 1ZQ3P 1ETVA 4DYQA 3IH4A 1ZTRA 3HGYA 3ZQFA 1WPKA 2O7OA 3S1QJ 2AO9A
chains in the Genus database with same CATH superfamily
2BY1A 3J7ZI 4G7ZF 3K2AA 2P81A 3NEUA 3VYTB 3HDDA 2X0LA 1U0JA 3MCZA 2VT2A 1T08B 1WH5A 3H92A 4BACA 2L02A 2VE9A 1I27A 1I3AA 3KZYA 4BHBA 2L4MA 2MGQA 4XMYA 2XGXA 2F5DA 3E7LA 4XOTA 3PL8A 4NHJA 2KISA 3QAHA 2G9WA 3VSLA 1YG2A 2KRFA 2DT6A 3KP3A 1Y39A 4M72A 1LDJA 1JJ6C 1B9NA 4P55A 4HEA2 1G2HA 3ZQ7A 3DWLE 4E70A 3DPTA 4CCLA 4ZTFA 1UZCA 1QHGA 2Y9YA 3RQ4A 3KP4A 3E6MA 3V7SA 2QQBA 2A6HF 4NC8A 3EYIA 4BNCA 3O8HA 4ZC3A 4L5EA 5EZHA 4BXUA 4CICA 3BTLA 2NNYA 2XASA 3BLYA 4S05A 1NG7A 4I2OA 3ZQLA 1XX5A 4D7MA 2EA2A 3LSJA 3OYDA 4ENKA 1MDMA 3I0TA 4PCQA 3TO9A 2EWNA 4FX0A 4CZCA 3A2KA 1RIOH 5C3EJ 5E8IA 1LJ9A 3CUQA 2X6OA 4CCJA 3G1LA 4L9TA 1F9NA 4LG0A 1SMTA 4QIWN 3A4CA 5GAHJ 3R0AA 4Z6YA 3J80Z 1RNLA 4HOBA 2LBFB 4BKXA 2CU7A 3ZGKA 1PP7U 1VI0A 3ISPA 5FB2A 3ZN1A 3S16J 5JVGF 2OPTA 3M8JA 2ZXWH 3LAPA 4BQQA 4IEJA 4LIVA 4A12A 3T8TA 1SFEA 3S14J 2HVQA 4XL9A 4IKFA 5LRRA 2JVGA 2CO5A 2W84A 3BTCA 3BCAA 1YIJI 2LY2A 3B6CA 3QP6A 3I58A 2NVYJ 4CGZA 2XKPA 1OFCX 4A3CJ 4ENJA 1WVRA 2JT1A 1B59A 2IXSA 5JHFA 2V9PA 1IDZA 2KIUA 3HYIA 1I1SA 3RJPA 1X1DA 2DA4A 2VJIA 4IOAF 3BR3A 4A5NA 1EKEA 3L9FA 2XSJC 5HLHA 4L9VA 4LG3A 4BJTA 3ZP5A 5CQEA 1YS7A 4GYGA 2H8RA 3I59B 3L2WA 5D5XB 1X1CA 3K70C 1Z6TA 2V1XA 2HQNA 2JZYA 2CQ7A 2HXOA 1ZRDA 2CG4A 4EVIA 1KU7A 1QU3A 5M5WJ 4JYKA 4CYDA 1LVKA 5FFZA 4FTHA 4YIFA 2MD0A 3CMYA 1D0ZA 1MDMB 3G71I 4FHTA 4XLCA 4N9IA 2QBYB 2ZSHB 5M5XJ 5EDNA 4HNUA 1R1VA 2BW3B 3LSHA 5JFRA 2E1MC 3V8LA 1IAWA 1D0YA 2XAQA 2LG4A 2QENA 1A31A 1UG0A 2F5CA 4D9JA 2Y2ZA 1FIAA 1Y56A 1HDDC 3DBLB 3ABLH 4YG2F 2IW5A 2YX4A 2F5EA 2IS6A 4RLFA 2LTPA 3ZQCA 3J7YJ 1Q1VA 4XRFA 1OKRA 3KE2A 2IBDA 3HTSB 2EINH 3E6DA 4QSHA 4M6YA 1D1AA 1NH3A 1CGPA 1ETKA 4F92B 2OAZA 2DAOA 4KISA 2YR2A 1MMAA 4BE2A 2H1KA 2IPQX 2W82A 5EJCA 2MH2A 2BE5F 4TV7A 2EPFA 2IAIA 2MSYA 1XGMA 4WXHA 1T6SA 2H94A 2XIGA 4A0ZA 3L2RA 5KVRA 2FXAA 1GV5A 2COBA 3TDUC 1YJNI 2X1DA 3RTRA 2BY3A 3PUBA 1UJ8A 2LF8A 2V26A 4CZZA 5FD6A 3RKWA 1QZZA 2ID3A 3HKZN 4EGYA 3P9IA 2K86A 2OQRA 4X6AJ 1SVOA 4XSXF 4D5FA 4HG2A 1WSUA 2FMLA 3BP8A 3TW6A 4RGSA 5IP6A 1V3FA 1D8KA 3IUOA 3CCMI 2CW8A 3M3YJ 2HQRA 5E1XA 2W1OA 3FXJA 2K9SA 3LSMA 3H3VK 3F6VA 2W00A 4X1EA 3HTUA 2VQCA 2N8GA 2V4JC 1TW2A 1QVTA 4HZFA 1GVDA 2CW7A 2XKOA 4ABZA 2KIQA 1FP1D 2P7VB 2GXGA 2OCEA 4L5JA 3V8JA 4M9SA 4LLGF 2NS0A 3U2RA 3MVPA 2BHZA 1K4SA 1JGGA 1D5YA 3SXYA 3WGHA 1LUJB 2YUSA 2VLAA 2FOWA 2LNBA 2L0KA 2VPRA 4C3HJ 1W5SA 1DGWY 2RV8A 4YFXF 1POGA 3VPRA 4GDFA 4RMNA 4QWQA 4FCYA 4O5VA 1LPQA 4XONA 1PYVA 4GFBA 1LEAA 1OQYA 4B3XA 2A3SA 2OV7A 3R61A 4IRGA 3RDIA 1VQLI 2Y31A 3KZZA 4NBQA 2R7TA 5HLIA 3DEWA 1VFCA 2W4SA 1TQIA 1SMYF 1WQ2A 4A6EA 3J81Z 2R93J 1U8RA 2VT3A 5DD8A 2DT5A 2GA2A 3H9JA 2GXAA 5JHUA 4B47A 4I7HA 2K3PA 3OS0A 5BPDA 2V9KA 1RKTA 2K02A 2FBIA 3I3LA 4EJVA 2WTEA 1JUSA 2HOAA 3NWTA 1O4XA 2XF5A 1VQOI 2E1NA 2M3AA 1ETQA 1X3UA 2LVSA 4A0YA 3FKJA 4ZTJA 2DQLA 4HA8A 2EZKA 2HZTA 4WXDA 5CLSA 2JPBA 4N4NB 2E36A 2Q2EA 2K9NA 1IRZA 4IHSA 5LBQA 1L0OC 4BY1J 4V19K 4MTDA 1EV7A 3ZMTA 2PJPA 1J75A 4CUGA 5K5OA 3MKYB 1N78A 3LSKA 3OIQA 4U88A 2VODA 4B43A 1J09A 2DK8A 1OYYA 4AUXA 3OWTA 3F0CA 3W2WA 1NTCA 1MBJA 2L2OA 3K1MA 5J1UA 2Y75A 1HW2A 2DYRH 2LH9A 2XHKA 1KQ0A 2D1VA 2PQ8A 4XN3A 3S17J 4KIGA 3ZCOA 4BE1A 3OY9A 1FTTA 1Y8RB 3H0GJ 2LKXA 2FMYA 2JPCA 3F6OA 4KDPA 1XDUA 3EETA 2DDAA 3K0LA 4KMFA 3S3OA 4G12A 1OJLA 2O6GE 1MKMA 1IUYA 3RI4A 2O8KA 5CVVA 3A01A 3WTSC 4DBRA 3HEFA 2PMHA 2DO7A 2YU9J 1PJRA 5HS9A 5EG0A 1Z77A 2VXDA 4IQJA 4DW6A 3OR1C 5DV5A 3K1NA 4EEFG 4XRMA 1GXPA 2LLKA 2PI0A 2MYSA 2HPIA 2EV0A 3H3ZA 1VQPI 4HX4A 2VXZA 1OISA 4UUSB 1W7PD 2FBHA 2RGVA 3FBNB 5ERIA 4M9ZA 3RQIA 3ZQHA 1K83J 2E35A 2OZUA 3OIPA 4KN7X 5AIPA 3Q0WA 3HOZJ 2KJBA 2R5ZA 1MNDA 2YU3A 3I54A 1VQKI 3GTPJ 3GTQJ 2EBIA 1F36A 5HDGA 3HHGA 3FHNA 4M73A 5F04A 5E3OA 4M3DA 3S3MA 2PJRA 3EUHC 2R5YA 1D0XA 3DBRB 1R71A 4OU0A 1AU7A 1P4WA 2E1OA 1KYZA 2GOMA 1I6HJ 2GAUA 2LKSA 4FQGA 4N0BA 3CC7I 2R7FA 1Y6IA 2XB5A 3H5RA 2XGDA 4A3FJ 3K4BA 4RBOA 1YTYA 5B1AH 1Z67A 1QGPA 2MA3A 3N97A 1WCMJ 2HGCA 2VBWA 3PFIA 3L7WA 1Z7UA 4RGRA 4P5OA 1KU2A 2LF7A 1SAXA 3OYBA 4LLNA 2HR3A 4IOCF 3CO6C 2YPRA 1R5GA 3S93A 5BMZA 2WBMA 3S15J 2Q1ZB 2M0MA 4KUMA 3VYRB 2DA2A 5D5UB 2EB7A 2WC2A 5LHHA 3RPUA 1DP7P 1O3SA 2OZ6A 3A0HC 4RAFA 2JA2A 2VBYA 3BJAA 1VTNC 3OSFA 3CUQC 1LFUP 2D5VA 3D1NI 4A3BJ 4OWRB 5KNLA 5K7HA 1W36C 3HGGA 2HNHA 4LGWA 2A5YB 4IRHA 1YYVA 2DFFA 4IHXA 3E5QA 3ZMUA 1FC3A 3CCEI 4GO1A 1WHUA 4WX9A 3HOXJ 1DP3A 3ULQB 1RESA 3DU5A 5C4JJ 1Z1DA 2X1CA 3OMYA 3SDGA 5L3FA 4C2MJ 2EFOA 2RQPA 3MKLA 3BQZA 1X3WB 2LREA 4BJ6C 3F3XA 1DQUA 3JRGA 1XD7A 3EDPA 4ANJA 2FJ1A 3QPSA 4O6JA 2A69F 5DEQA 2MH9A 1A36A 4BEHA 5HNFA 3FXMA 1FBQA 1R00A 2K27A 5E3LA 3DQVC 2MBFA 1T95A 5F08A 5CVUA 4XK4A 4Y7NJ 1D5VA 1U5TA 2WA0A 4Q48A 2GWRA 2LY1A 2CWEA 1WI9A 1UHMA 4G6QA 1JKQC 1PVEA 2FSWA 1H89C 4LB5A 1IW7F 3OV8A 1ZGAA 2V6CA 4HYEA 3K2ZA 2OC6A 2DXIA 3KEQA 2JRTA 4XKCA 5KK1A 2L9RA 2H6CA 2WAQA 4ZH4F 4IHYA 1PUFA 5AIQA 3LFUA 2A5WA 3KYLA 1HKTA 1BR2A 4EM2A 5LEJA 1ZTRA 5CKTA 2DK5A 3UNGC 4PK4A 3BC8A 3BZCA 4ASNA 4DIQA 3CLQA 3K4NA 1SFOJ 3GEZA 4Q5SF 4UUSA 1R9TJ 3KEOA 4DQ2A 5JR3A 3C18A 5EYRA 2O61A 5TRDA 3PIPF 1DU0A 2H6BA 2K40A 2VBZA 2GXBA 2F4IA 3ESWB 4BYYA 1XMAA 1LEBA 5FRMA 3QRFF 3BG7A 4WF2A 1XDSA 4ENNA 1GLNA 1WI3A 2HPMA 4KIFA 1NHAA 1W4MA 1CQTA 2DMNA 2VQGA 2VL8A 4XN0A 2M45A 3M7GA 2FE3A 3Q0VA 4UV8A 3JTGA 2XUBA 2Z3YA 3CCQI 5E3NA 1AHDP 3F8BA 3AKZA 2UZKA 1FNNA 4LB6B 2DT7B 3D5LA 3WTZA 4II3A 2GM4A 4XLFA 1AKHA 4G6DA 4I99C 4XLPF 4O3MA 3OYAA 1HQCA 3CCLI 2P6SA 5LEKA 1Y0UA 1S72I 3HBLA 2UXNA 2XRLA 1XCBA 2WWYA 2F48A 3KP6A 2QKMB 2VIXA 2DQRA 3HOUJ 3PO2J 2EA4A 3K9TA 2MC4A 3ERED 2HVRA 1R4MB 2QBYA 2Q2EB 2KZVA 4CYCA 3DP7A 3EQLF 1YJ9I 1ONVA 1IXRC 3ML6A 5FKKA 2ISZA 2XPUA 3GTJJ 4AIJA 3BY6A 1EH6A 3PIOF 1XB4A 4PZJA 1ERDA 1T38A 3ZRGA 1NK3P 3H5AA 2E71A 3CCSI 3BOQA 5BQTA 1BJAA 3L00A 4J01A 2ESNA 1OCRH 4XKVA 2HOTA 2EH3A 2L3DA 1IN7A 2WADA 3CJRB 3Q5FA 2XGCA 1IDYA 1X1PA 4C3IJ 4ON0A 3AG1H 3FXUA 5H20A 3S1NJ 2KRCA 1FP2A 3DPUA 4HV6A 5IYDJ 2L9VA 2FA5A 4MTEA 1RRJA 4OAYA 4PJ0C 3L2VA 1ZAOA 2Z5UA 3V42A 1X1AA 4EJTA 4BS9A 1SEUA 1Z05A 2BY2A 2OD5A 1KU3A 2YS9A 1F4KA 3BR2A 2CV2A 2HWVA 3FBIB 2C6YA 2CV0A 2VBXA 2IA2A 4EM0B 2EZIA 2CQNA 3QYBA 4M3BA 1LE8B 3FK7A 3WU1B 3A03A 2BW3A 2R7OA 3JAMK 3OS1A 1WJCA 2TCTA 2I5UA 4AC0A 4IRIA 4IHVA 4FISA 2K4BA 1VQMI 2VPLA 1LQ1A 1JT0A 1P4XA 1MJAA 5M3FJ 2P5KA 5FROA 5JLXA 3FDYA 3HOWJ 5HLTA 1FOKA 4FASD 4BGDA 3ABTA 3M1EA 3MWMA 2ZO4A 2E2JJ 5TJJA 1T33A 3KLOA 3TDZC 2ZMEA 1XMKA 2R5YB 1WH7A 1MNEA 2PJRB 3EUHA 2DFIA 1WGXA 3FK6A 2QEXI 1OMIA 2VKHA 1HA8A 2FOKA 5J1YA 3L09A 3K4MA 5M5YJ 4OMYA 3OYKA 2E5NA 4CYCB 5D8LB 2ZNZA 1X19A 3BPXA 4I09A 5DUKA 1B8IB 4OAZA 1OCTC 3PSFA 3FF5A 2NS8A 1IN5A 2W7NA 4WCGA 4E7LA 2GQQA 3GZ5A 3BWGA 3DBHB 1Z6RA 3K4LA 2GZWA 3WU0A 1MNMC 2A68F 4LIUA 2BVMA 1X2NA 3LWFA 3J80K 3QWLA 2OTJI 4MQ9F 1GHCA 4OINF 3NQOA 5D5WB 3HSFA 1A6IA 3J81K 4MFEA 1N75A 5L3GA 4F91B 2STTA 1CF7A 3V8KA 4AVZA 5HDNA 2HTJA 4A3GJ 3SJMA 3MZ8A 2XPVA 1AKHB 1WJDA 4MO7A 2R4GA 3E0JB 2VOOA 1EF4A 3MKWB 2O0YA 3LSPA 4G7OF 1UG2A 3Q3SA 2P8TA 3F8NA 4FE4A 1UB9A 3KP5A 3X2QH 1B8IA 3DCFA 1E2XA 1ZGJA 2RDPA 2JA8J 1IN8A 4KT5C 1SFKA 1FBSA 4P9UA 3D5SC 2LDUA 2JVHA 3GMEA 1ETXA 1J5YA 2FX0A 2RKHA 5GPAA 3F23A 2QYOA 3GYHX 1WZ2A 3ABKH 3HOSA 3ASNH 4RM2A 3OYGA 4IHWA 4M6VA 5F0CA 4YELA 2KRHA 4G94A 1TNTA 2DMUA 2FQ4A 2OA4A 1ZYRF 5DYMA 5E1WA 4BJ5C 3OYJA 3ZOBA 3OS2A 2ID6A 1ZR4A 4U0YA 1YRNB 5K1YA 1YX3A 4XLNF 1RC9A 4ZYDA 1H9GA 5DDGA 5L3CA 4MGRA 4BDZA 3I56I 3GFLA 1QNTA 2V9VA 5BPIA 3O3KA 1ZN2A 3HRUA 1MH3A 1VQ4I 2G0EA 3QPTA 3ECOA 3MQ0A 1M1EB 4U0VA 1MBKA 1PP8F 1MGTA 2K3FA 3L1PA 4DJAA 2QSHX 6PAXA 5CVRA 2MD5A 1R22A 2F5VA 2VKDA 4LJZF 2M1BA 1FWZA 1SD5A 2M7AA 4HF2A 4PDKA 3C2HA 4N4OB 3QYFA 1G3YA 3MD2A 1HW1A 5ILUA 1O7LA 4LFUA 2NS7A 3KIOA 2WY8Q 5CYVA 1YOVB 2DW4A 2RREA 2QQ8A 4LG0B 3R0JA 1WRJA 5LHGA 2UWMA 3E3VA 2EILH 3C1DA 5EGOA 4C30A 4BL0B 3JRFA 2DA6A 2FRHA 1ZH5A 5D8KB 4M3EA 2XAGA 1BI2A 1QO0D 2A6TA 2YSRA 5F0FA 4GYIA 3MKZA 3JRAA 2IA1A 3I4MJ 1P7IA 1AA7A 2F4MB 2E19A 3GUDA 1T8IA 1RPWA 1AWCA 1MSEC 4CCNA 3T1BA 5LFAA 2F5FA 1W7PA 2XB0X 3K69A 3CCRI 4BQNA 3ZPLA 4E7KA 5EGOB 1OCPA 3HM5A 1JTXA 1OPCA 2CW0F 3FKIJ 3M1CA 3OIOA 3NAUA 3GTMJ 3K1PA 3LFKA 1F5TA 5J47A 4II2A 2JTVA 3BDDA 3IH3A 3CZ6A 2DDBA 3LA2A 4UNOA 5HNHA 2RAEA 1JKRC 2DODA 3TKYA 4A3EJ 1I50J 3CJNA 1K78B 3GLXA 1G4DA 3OYFA 4NQWB 4IF4A 1SD7A 2KFDA 1HOMA 4P9FA 3B73A 2KZGA 3OYNA 3BR6A 1IN6A 1REPC 1OCOH 1SD4A 5DCMA 4WK8F 2XV4S 3WTXC 1BM9A 3FWEA 2QKLB 1MBGA 1S6LA 1USSA 1ODDA 2WB1N 3GFMA 4EQQA 3AL0B 1XSDA 1YW9A 3HC7A 1ZGWA 1IUFA 1TZLA 2ZXIA 2DFEA 1OLTA 1Q1HA 3DKXA 2JMWA 3RPUD 3W2VA 1UHWA 4IPAA 2DTZA 3EUKL 5GADJ 1S7OA 1R5HA 3FXOA 2O3FA 2GOXB 3F8CA 2V1UA 3CMAI 2CUJA 1K79A 5A2QK 3SQNA 2DI3A 4IVNA 4XORA 3VWBA 4F7ZA 1ITYA 1V54H 1GUUA 4DNCA 2HDDA 3F9KA 3O8GA 2RVCA 3PFYA 2HZDA 2J5PA 2NOGA 2KT0A 2HDWA 2UXXA 2CUEA 3CQZJ 3DU6A 3R6SA 2B9SA 1QRYA 2DPDA 4DZJA 2AS5F 3I59A 2L9SA 1KQ8A 3FIWA 3S1MJ 2LRDA 3NARA 2XDVA 2Y0MA 5GTHC 3VFZA 2P5LC 2JA7J 2VASA 5IYCJ 3SZGA 1CF7B 1QVUA 3REOA 1YE9A 1WFXA 2CH0A 4MNUA 2NYXA 2ZKZA 3CP2A 1BIBA 5KAIC 4HW0A 4A3JJ 4BXXJ 4K2EA 2EIJH 2KIMA 3E6CC 4UHTA 4KFCA 3HG9A 3HRMA 1B1BA 5B66C 1S3JA 4J19A 1J9IA 5KHDA 4JBAA 2DA3A 4QPQA 2L7FP 3E97A 1OYIA 1X58A 3LSGA 2XVCA 1RR8C 4PSXA 4IZZA 3F8FA 2CYYA 1ZR2A 1IO2A 1LNWA 1S5LC 3TO6A 3I4NJ 3DEEA 3C2BA 1RI7A 1I39A 3QU3A 1TL8A 3MMYB 4GXOA 1YW8A 4BHCA 4I0BA 2LBFA 2PEXA 1UAAA 2KDZA 3DV8A 3LAJA 3RZOJ 3FISA 1IC8A 2YX7A 1QZYA 4BHPA 1XTAA 3VEPA 4AD9A 1Z91A 1P9QC 5L3DA 2R0QC 1YJWI 3MFKA 3K6GA 1W7PB 3SFIA 3G3ZA 3O6BB 1TBXA 1P2FA 1ZQ3P 4RB3C 1ETVA 3IH4A 3RYRA 3HGYA 1WPKA 4QLCU 4A6DA 1K6OA 2XF7A 4EM1A 3S1QJ 2EV5A 2D2WA 3ROUA 1G6NA 4UVAA 5HOOA 2QGUA 3HSEA 2F6CA 1HKSA 2IGKA 4HNTA 2ECCA 3E6BA 3W6VA 4HQEA 1U8BA 2GIVA 2CS3A 4YIIA 4L5IA 2ETHA 2M8GX 2X9DA 5DCMB 3AG2H 4E4HA 2GA1A 2P0WA 3ERMA 5ICCA 4EJUA 4YEJA 2D45A 4D1QA 2H27A 3GZ6A 1T56A 3CCYA 4N9HA 1XSVA 2L7ZA 4YRVA 1YS6A 5FLMJ 2Z99A 2KQRA 3QPHA 4XLHA 3CUOA 3KCCA 1L3LA 4RA2A 4JX4A 1XC5A 1K61A 1VQ7I 3WE2A 2VKEA 4QTRA 1TC3C 3CUQB 4HX8A 4A3MJ 3PNVA 1SD6A 3DLLF 2AHQA 1YHQI 2O9LA 1TW3A 2HOSA 2E7XA 2DBBA 3FMRA 2Q0OA 1JGSA 4H4KC 3K4CA 2ZJQF 3RCOA 1ZG5A 1GXQA 1HBXG 5C44J 4ENMA 5IP7J 4PJMA 3WHCA 4NNJA 3WE3A 2BXYA 5J6XA 4XQFA 3CC2I 4DZPA 3CF5F 1ZLKA 3C7JA 1B6AA 3E5XA 4M3GA 3IP4B 2FQ3A 3CDIA 4UV9A 3KFWX 4HSTA 3VSKA 1BR1A 1U9OA 3S2HJ 4B44A 1EH7A 2DJNA 2QQAA 5H6QA 4BE0A 3P9CA 2ELJA 4YIRX 3UKGA 2CFOA 4UY8I 2M0CA 4W97A 1Y1WJ 4QPOA 2EIKH 1BC7C 5J40A 2QF7A 1Y8QB 2UUZA 1YITI 2HYJA 4XKBA 4FX4A 4XOPA 1IV8A 2E7WA 3GO5A 3DEUA 1QPMA 4NDLA 4CSWA 4MIMA 1P7JA 4GCVA 3TO7A 1YX5A 1Z3YA 3ZR8X 1UMQA 2KHMA 2M30A 4HRIA 3BJ6A 5FGMA 5K7ZA 5IOYA 4ZYHA 1FYKA 1KYWA 4HPQA 4XR6A 4D0PA 2VI6A 1DGRM 2OQGA 4M9XA 2EZLA 3IH2A 2CMPA 1HSTA 1QQIA 3DPLC 3S3NA 4B1RA 3SYTA 4F52A 5IY5H 3ABUA 4Q4ZF 2NNNA 4LK0F 2MLKA 1B4AA 3QOPA 3ABMH 1WJAA 3AL0C 4KYWA 4A3DJ 1ZELA 1RUNA 2QM3A 4ZDPA 3HXLA 3OYLA 2Y0SA 4F93B 4UB8C 3W2AA 3M07A 3LL7A 1U78A 5GP9A 3CESA 1R49A 2VC1A 2M4GA 2DMPA 3LA3A 4JQFA 2K85A 1IV6A 1VNDA 3B6AA 2B0LA 1TLHB 3W6JB 2ZMEC 3QYEA 3CO7C 3OYHA 2QSGX 2B7EA 1RZ4A 4PFOA 2KDOA 1P6RA 1VQ6I 4XRSA 1USTA 3GCMA 3KP2A 2Y9ZA 3H9GA 1WJBA 4OIPF 2QSFX 1IRXA 1TWGJ 2ZJ2A 3SZPA 1J7KA 2GLOA 2IA0A 3ZQIA 2VJ4A 4E7ZA 5B3SH 3BR5A 4PJLA 1XCVA 5J4VA 1ZK8A 3QOEA 1BOBA 4DGWB 5IT9K 3H9QA 1D1BA 1D3YA 1FOWA 3KPHA 2Z1DA 1HC8A 3WG9A 5IT9Z 3K4KA 5IP9J 3IKTA 2H09A 2OUMA 1V5FA 2D1HA 3PSIA 4PJNA 3A01B 5J3LA 5BNGA 2E1CA 1OCZH 2G7HA 4OIQF 2DLLA 5H6RA 1DPRA 4A0XA 4OOIA 2ZB9A 2K9QA 1XMXA 2Y30A 2BV6A 1FIPA 5HLGA 5LLQA 2IEKA 3EUAA 2DJIA 4RM3A 3CDHA 1QBJA 5JVTA 2ESHA 3NRVA 2DCEA 3IHUA 3GTOJ 1IXSB 3DKYA 4AWXB 4L18B 4BH9A 4EMSA 2BEOA 2E1MB 4I98B 5FFXA 2P4WA 3HRTA 3RKYA 1SFUA 1KONA 5LRSA 2HS5A 1H9TA 3CJTB 1Z3XA 4ESFA 3JW4A 5GPCA 3J7AO 4S04A 2P5VA 5ICGA 2P6TA 3FM3A 4IQ4A 1YQAA 1XG1A 2JA6J 2AQEA 2BXZA 4XLAA 2DN0A 1FLIA 3ZMDA 2M4KA 3HOVJ 1LDDA 1MZBA 4XICA 2R7XA 3M4OJ 2LKPA 3DXJF 1ACIA 3COAC 3VYSB 5FLXK 1SAUA 4HV5A 1T98A 1ULYA 2RC4A 3SFZA 2PN6A 4HLXA 3V7RA 4XKWA 2ZJPF 4NB5A 3DF8A 3IAS2 2BVLA 3JRBA 1DDNA 1TWAJ 1UFMA 1V55H 1TWHJ 5CJ9A 3HSRA 3IV5A 2ELKA 3CCVI 3GZNB 4ZJZA 3BJOA 3RPQA 4E7IA 3IRRA 2TDXA 3LSIA 1MMDA 4AYBA 5HODA 2M9HA 3BZKA 3KZIC 5D6FA 3WU2C 3JSPA 2XPWA 2I8DA 2W25A 3H0DA 2WB1A 5ILSA 5J1RA 2XAUA 3BR1A 2V79A 3QPLA 4A3LJ 2A05A 2LK2A 1I6XA 2JK3A 3IWZA 2R5ZB 2JWTA 2RNJA 4EGZA 3RZDJ 3J7AY 2NOJB 3LA7A 1Y1VJ 2RQQA 2M87A 5D5VB 3CTAA 3H36A 4RAZA 2X6XA 3BROA 1JKPC 1TT0A 4E7SA 1BW6A 1Z9CA 1P4AA 2ZSIB 1BN5A 2EQRA 4EV0A 1QHHD 2VUMJ 4BAYA 1YI2I 2ME0A 2TRTA 5LGNA 2ZXHA 3MZHA 2E34A 3ELKA 3G2BA 2WAFA 5FKLA 3QQAA 4ZYGA 4JOMA 1MJ9A 1YIOA 1VQNI 2E5ZA 4U87A 1SC7A 5HDKA 5EF6A 1AOYA 3C2GA 4Y3OA 2IJLA 3HB9A 3TQNA 5TISC 1J0RA 2VC0A 4OIOF 2HKOA 1TP4A 3S1RJ 1HCRA 3HKZA 2XC7A 1Z21A 3HUGA 4JX5A 1MMGA 2JJ7A 1HDPA 3FZVA 3ZMSA 3AG3H 4UB6C 3GTGJ 2HU9A 1SVMA 4RB0A 5IPAA 2M8EA 1XGNA 2Y69H 4ZDLA 3ZN0A 2VJ5A 2Q8KA 3WGIA 1ZRCA 3RIRA 3S2WA 5BS6A 3MN2A 1K7AA 1E17A 1FTZA 3W3CA 3TOBA 4LK1F 4B09A 2STWA 1SVLA 1EJ9A 2CSOA 5FLVA 4KMUX 4HDUA 3DTKA 2CQKA 3CD6I 4HF1A 5F1RA 1NK2P 1TT5B 3TMOA 3WTTC 1VQ9I 1KQ9A 2HQ5A 2QQ9A 3OYIA 3IKVA 1OR7A 3W6KB 2VE8A 2NVQJ 3OOUA 1IRGA 2LYCA 5B5EC 3BTIA 1FMWA 1TQPA 3ZMVA 4G7HF 1HW5A 1JI8A 2R7UA 3DTEA 2M34A 4ESJA 2LY9A 2MW8A 1JXSA 1EH8A 2K5CA 5FKMA 4NC7A 1IXCA 3GVAA 1PUEE 2PMUA 5ICFA 1IJWC 4AIKA 4CCMA 1ON2A 2HTSA 4BU2A 4CDGA 1O57A 2Z16A 2WY7Q 3BG5A 4R1HA 5ICEA 4PFPA 3RKQA 4V2GA 3VODA 5J4YA 5L3EA 2CJJA 1LFBA 5DD4A 1BW5A 5FJ8J 1FSHA 3GFIA 2BBYA 2DOAA 1LDKB 4CHUA 3QP5A 3GBGA 4BBSJ 4WXCA 5CPRB 2EJRA 4A69C 2KKOA 3EPZA 1IF1A 3QU6A 3OYCA 4IJAA 3CDLA 4MQVA 2R7VA 3HJEA 3E5UA 3G6EI 1I1GA 2ZFWA 2AQFA 2RN7A 4CH7A 2LFBA 2Z33A 4HDVA 2NVTJ 2R92J 2V6EA 1U6GA 1U5TB 1MBFA 1MIJA 4KNYA 2IGNA 4MLOA 2W57A 2CUFA 2LSOA 5CVIA 2KP6A 2LC2A 4FT8A 2BOLA 3WG7H 4C3JJ 2EZHA 3T8RA 2ZCWA 4HQMA 5ILVA 2FD5A 2NAZA 2W48A 4V2FA 5HVQC 1HKQA 5GAEJ 3PO3J 1APLC 3LQRA 2ME6A 3O2PE 5FRNA 1WKMA 3LSRA 4ZZLA 2FU4A 2ZJRF 3KYCB 2X85A 1MBEA 2GIZA 3S8PA 4KICA 2JN6A 2DOFA 2X4HA 3F8MA 5TGTA 1YFHA 1WWXA 2W24A 5A2QZ 1VF9A 2L7KA 2M5WA 3GX4X 4BQAA 2VQLA 1G8XA 5C4XJ 3TP3A 3CP8A 5HS8A 2QZ8A 3HUGB 1V5EA 2WV0A 2PMZN 3P7NA 3CMMA 1IN4A 1F43A 2FNAA 4Y17A 4HLYA 3D5RC 3VDXA 2KMUA 4R79A 1MSFC 4HBLA 2PBIA 1RR7A 1MH4A 1I5ZA 1XN7A 2OF7A 3TW7A 4PSWA 4A3KJ 3LOCA 3N4MA 1XS9A 2KPMA 4JP0A 2VB6A 4LMYA 5E3MA 1G59A 2ICWG 2WAEA 2DA1A 2VOPA 5IT3A 1WJFA 1FOYA 5K5QA 4NUBA 3ZQFA 2OBPA 1F1ZA 4AVPA 2AO9A 2L4AA 1JHHA 3SDBA 1ZARA 1KZHA 3IC7A 5FO5A 4CXFA 4C2UA 1BI3A 2CGPA 3CCJI 5M3MJ 3BR0A 2P7CB 5DTDA 4L0ZB 2EV6A 1Y0NA 4M71A 5LD2C 2V1DA 4B48A 3K4JA 1E3OC 4ZZDA 1RUOA 1E0EA 1O3TA 3ONQA 3E1SA 3OR2C 2MLGA 4BY7J 3RYPA 1S8NA 1YW7A 3DTIA 4B8XA 5KCMA 5IOZA 5E18F 2QA4I 4DOZA 3HPHA 4EATA 4EJOA 3OYEA 1T0FA 2LD5A 4Y15A 1WJ5A 2QUFA 2OU2A 2FNPA 3DLAA 3GFJA 1X3ZB 4UUVA 3IWFA 3IAM2 3R60A 4HNVA 3F21A 1Z0XA 4KT6A 5B1BH 1T39A 2PG4A 3V4GA 1HXDA 3G73A 4IHTA 4MEYF 2CQXA 3MZYA 1BC8C 3L2UA 4XBFA 3KEYA 1JUMA 2E2IJ 4Y4RA 1I3QJ 1BR4A 1OYWA 4BEHB 4RB1A 1VQ8I 4BQOA 1GT0C 4NQWA 4MEXF 3C3WA 4UVBA 5LGTA 3OSGA 2PLYA 3CLOA 3JRDA 4ETSA 2MABA 1B72B 1N25A 1G3WA 1GVJA 4LD5A 2XSDC 1W1WE 3ZQQA 3Q0UA 2X6WA 2XGEA 2XROA 4G9YA 2XAFA 2E2HJ 1SANA 4A93J 1X2MA 4BUPA 1JE8A 1X4OA 2HEOA 2XF6A 2HFHA 1R1UA 2JSPA 1S7AA 2ZNYA 2I10A 4KA4A 1JJ8C 5CVJA 1TWCJ 1IRFA 5JLWA 2FBKA 4A2UA 1Z7LA 1B72A 1D1CA 2BHYA 2OCCH 3ZMZA 3DFGA 2AXTC 3I53A 4RAYA 1TTYA 3AAFA 2IS2A 4AM3A 4HX7A 4KJZA 4BBRJ 1GV2A 5DUIA 3JREA 3SZTA 1O3QA 1ZRFA 2IS1A 1YLFA 4XIDA 2WV1A 3GXOA 4MFDA 3TOAA 3U1DA 4RB2C 4FETA 4IO9F 1A35A 1FT9A 2W85A 4IL6C 2O8XA 1FY7A 3P9KA 4I6ZA 5F0HA 2X51A 5FKOA 3BT9A 9ANTA 1R23A 1ETOA 3T5XA 1LE8A 1MBHA 3G1OA 3NWSA 3HOTA 4D5CA 4Y33A 3S2DJ 1FZPB 1ETYA 1BIAA 4E7HA 2K9LA 3FXLA 3M8FA 1R4NB 1T0FC 4WWCA 2NRAC 2GBYA 2HXIA 3FXRA 1K78A 3N05A 1BOAA 3R4KA 3P5JA 4OMZA 2K9MA 3F22A 1TWFJ 3SEQA 2JSCA 2DTRA 1V4RA 2Z2SB 2ZBKA 4AYBN 1KA8A 3PM1A 2OJED 2EK5A 2MG4A 2IGOA 1EA3A 5DM6F 2VJJA 3OL3A 4PGHA 2R7DA 2XRNA 2MC3A 2BYVE 2DYSH 4ZYEA 2X6YA 4I02A 3ASOH 3U9GA 2CFXA 5D4SA 4L9JA 3JCUC 2PMZA 3OOPA 4G6TB 1X4PA 1RETA 3QODA 1STZA 4CCKA 1LB2A 1O3RA 5KAFC 3M9AA 2A07F 1BI0A 1HF0A 2HI3A 4ZYAA 4CCOA 3WTWC 4LITA 5IYBJ 1K4TA 1N77A 1ENHA 1JUPA 1GDTA 2BGCA 3Q9SA 2ACJA 3FM5A 5K5RA 1E3PA 1XSXA 2ZXJA 3JTHA 3L2QA 3K10A 2LOOA 4KITB 3WTUC 2ISYA 1KU9A 4B3AA 3PNTA 2A61A 2E60A 3KETA 1U3EM 1IZ1A 1A5JA 1JTYA 4M74A 1ORKA 2F4OB 3HRSA 2CUZA 1FYLA 4S0HB 2CRGA 3WTVC 4H0EA 1H88C 3G1MA 2J5OA 1JHFA 5DM7F 1ZREA 5FKNA 3A1YA 3FX3A 2K4JA 3KP7A 4A3IJ 3K7AJ 3IRQA 1D8JA 1R36A 2LMDA 4XM3A 1MJBA 1BJZA 4UUTA 1HSJA 5E1ZB 2HQAA 2KL4A 2QWWA 1LFPA 2PFBA 4RDUA 5HS7A 1R5ID 2HOEA 1B9MA 3BG9A 1IG7A 5EEGA 3PNYA 1MD0A 3I71A 2DFHA 2EIMH 3GWZA 4U0WA 1BBYA 4I01A 3MEXA 5EEHA 1FEXA 4Z2YA 5H2FC 1O7FA 1DPUA 1P92A 1A04A 3FMQA 3WODF 4D7NA 1H8AC 4C9YA 4U7DA 2JUCA 1A6QA 2Y0SN 2ZFUA 2ZMEB 1FYMA 1UHSA 2NVUB 1C0WA 1S7EA 1R6RA 4R8HA 5L3BA 1VZ0A 2HYFA 3HIFA 1MMNA 2XAJA 3LSTA 2NXNB 3F72A 3FHZA 3A02A 4P1WA 4B4CA 3BG6A 4Q47A 3G4SI 1XPXA 4CO8A 1XGSA 3JRIA 3I9V2 2R7WA 4E7JA 1S29A 1ZKGA 4JX6A 4OIRF 4GGGA 3BG3A 4J00A 4M6XA 4CA0A 4RGUA 3BCBA 1UCRA 1G3TA 1BA5A 3T0YA 3S32A 1FOXA 4DBQA 1W36D 3BQYA 5BOXA 2IRFG 1JT6A 2KJCA 4F3QA 1QA6A 3LNQA 3HL2A 4L9NA 2HDCA 1U9NA 1XGOA 2VQHA 4M3FA 2JA5J 2Z9OA 4GRIA 4YFKF 1R1TA 1R7JA 2X1EA 3H1CA 2DOEA 3Q9VA 4PGGA 3WHBA 2DA7A 2VONA 5CQGA 3K70D 4IX7A 2R7RA 3WGGA 2V7FA 1FSEA 1TQMA 2A6EF 1ZHFA 3AFHA 2NVXJ 3U1KA 1FMVA 1MW7A 3PUFA 3SHFA 1J2XA 4AIHA 3PQKA 3VOEA 4P96A 2M7BA 4KIBA 2KLOA 3UR3C 3FMSA 2EFPA 2CQQA 4LLLA 5F27A 2IP2A 3H3UA 3L2CA 1YO5C 2R7ZJ 2R3SA 3U21A 3ZXSA 2WAQN 1FBUA 5E8GA 5K7FA 2EFQA 2L54A 2L5QA 3B02A 2IT0A 1U2WA 1PUFB 2ELHA 4C2TA 3KYDB 2EFWA 1X1BA 2BY0A 3JRCA 1OR7C 1MMSA 2JRMA 4Y52J 4BXFA 5GTIC 2COMA 2PX9A 5FLXZ 4JK1X 1FJLA 2DPUA 3TBIA 3TEDA 2LP0A 2X48A 3ZQGA 4BDYA 5EG0B 1DUXC 3PJRA 2OTLI 3OL4A 2H8WA 3I5UA 3RSNA 4PJJA 1FX7A 4UVCA 1E3HA 1NG6A 1ZLJA 3CF2A 4HF0A 5AONA 4U7BA 3A0BC 3GLLA 4ZDOA 2JQ7A 2G7UA 3M8EA 5LGUA 5F6FA 4Y13A 4HSRA 2K7LA 3LQQA 3WTYC 5J8FA 1IGNA 1HLVA 4IXAA 5EZGA 2MFZA 2VKVA 3H5NA 1V5GA 2L9NA 5D6EA 4NC6A 3JAMZ 3I4PA 2IS4A 1ZG3A 2M2EA 5E20A 5GAGJ 3H35A 5F1JA 4E6KG 1H0MA 4L0YB 2XAHA 2FUG2 1DU6A 2R7QA 2QCOA 1UELB 2QVOA 4XNFA 3CCUI 3TL4X 4XRSG 2F2EA 1K6YA 5JI6A 5E17F 1RKWA 1SFXA 1BI1A 2R7SA 3TP0A 3BZ6A 3TGNA 1YRNA 3PQJA 2LR8A 1W5TA 2DMTA 2IVMA 1U5TC 5LHIA 2H1LA 3KLNA 4RGXA 4XSZF 5E79C 4YFNF 4W1UA 1W0TA 1PDNC 3BPVA 1LVAA 3I55I 1BL0A 5DCFA 3GF2A 4UXNA 3JR9A 3OYMA 4EJWA 4XLEA 2KIFA 4DYCA 4ITVA 2HVSA 3I64A 3JRHA 1JKOC 3CC4I 2DMQA 4LOCA 4PUSA 2VN2A 2B63J 5D4RA 3SEZA 5EEAA 5ED4A 2L01A 4RLQA 1W0UA 5DS9A 4MHGA 4DYRA 1R58A 3HHHA 4A5MA 1QPIA 1G3SA 2IGMA 4X0GA 1VQ5I 1FPQA 4HAMA 2BZTA 2CV1A 3VB2A 3HZJA 4RS8A 1QZEA 1W5CC 4AU7A 1ETWA 5F64A 2O5RA 3BTJA 4AIDA 1KGSA 2UV1A 3RKXA 3AG4H 3HOYJ 3LMMA 3V7CA 3CMEI 1T2KA 3GTKJ 3EYYA 2Y48A 2AXLA 4KN4X 1ZG1A 3GTLJ 2FEZA 3D0SA 1WJEA 1LKXA 2FF4A 4FE7A 2ECBA 2HYGD 2V1NA 5J8CA 3IL2A 3DKWA 3JSOA 2O03A 2QLZA 3FXKA 1TNSA 4I76A 1S9HA 3CJQB 2DA5A 2ZC2A 2ADUA 3FXQA 2JUGA 4ESBA 3GW2A 3MAJA 3VYUB 2EFNA 4F55A 4G8XA 2L7MP 1ON1A 5FD5A 2RNGA 4DYQA 2HKXA 3HPGA 4RAGA 1J59A 1OCCH 3KX2A 2O7OA 4I0AA 2DU9A 3ECHA
chains in the Genus database with same CATH topology
1SFOJ 4UUSA 1R9TJ 3K2AA 2P81A 5M3MJ 3HDDA 3BR0A 5EYRA 5DTDA 1WH5A 1DU0A 2K40A 2ECCA 1E3OC 3W6VA 1U8BA 2MGQA 3E7LA 4BY7J 1WI3A 2M8GX 2X9DA 1JJ6C 1G2HA 1CQTA 2DMNA 5IOZA 1T56A 3CCYA 2L7ZA 2Y9YA 5FLMJ 2LD5A 3Q0VA 3O8HA 5E3NA 4L5EA 5EZHA 3BTLA 1AHDP 4JX4A 1XC5A 1K61A 2VKEA 4QTRA 1TC3C 4HNVA 4A3MJ 3ZQLA 4D7MA 3LSJA 1Z0XA 2AHQA 2O9LA 2HOSA 2GM4A 5C3EJ 1AKHA 2CQXA 5C44J 5IP7J 3WHCA 1JUMA 2E2IJ 2X6OA 1I3QJ 4DZPA 3G1LA 4M3GA 3HBLA 1GT0C 2XRLA 4QIWN 3OSGA 3HOUJ 3PO2J 1U9OA 4BKXA 2CU7A 3S2HJ 3JRDA 1B72B 2DJNA 1VI0A 3S16J 3UKGA 2XSDC 2OPTA 3Q0UA 2XGEA 4CYCA 2M0CA 4W97A 1Y1WJ 2E2HJ 5FKKA 4IEJA 1SANA 4A93J 2XPUA 1X2MA 2QF7A 3GTJJ 3S14J 2HYJA 1NK3P 2I10A 3BTCA 1JJ8C 1TWCJ 3B6CA 4NDLA 4MIMA 1P7JA 5JLWA 2NVYJ 2HOTA 2EH3A 1B72A 1UMQA 1OFCX 4A3CJ 2XGCA 1IDYA 5IOYA 5K7ZA 4C3IJ 4BBRJ 3JREA 1GV2A 1IDZA 3S1NJ 4XIDA 2VI6A 2DA4A 2WV1A 2EZLA 3IH2A 3BR3A 4MFDA 5IYDJ 4B1RA 4I6ZA 5F0HA 2YS9A 4A3DJ 3BR2A 5FKOA 2H8RA 3BT9A 9ANTA 1ETOA 1LE8A 1MBHA 3G1OA 4D5CA 2EZIA 3S2DJ 2HXOA 1ETYA 1U78A 5GP9A 2DMPA 4M3BA 1LE8B 5M5WJ 2GBYA 2HXIA 3FK7A 4JYKA 3A03A 1IV6A 1VNDA 3B6AA 4FTHA 3CMYA 2TCTA 1TWFJ 4AC0A 4IHVA 4FISA 4XRSA 5M5XJ 2Y9ZA 1JT0A 5EDNA 4AYBN 1TWGJ 3PM1A 5M3FJ 2GLOA 5JLXA 2MG4A 3ZQIA 3HOWJ 2Y2ZA 1FIAA 3BR5A 1ZK8A 1HDDC 2E2JJ 1T33A 2R5YB 1WH7A 2LTPA 3ZQCA 1Q1VA 5IP9J 2IBDA 1WGXA 4QSHA 3FK6A 1ETKA 1RETA 3A01B 5J3LA 5BNGA 5J1YA 5M5YJ 2H1KA 2ZB9A 2K9QA 2Y30A 2MSYA 2IAIA 1HF0A 1FIPA 4CYCB 2HI3A 2IEKA 5IYBJ 1GDTA 1ENHA 1JUPA 1GV5A 2COBA 3GTOJ 1B8IB 1OCTC 2NS8A 2ID3A 4B3AA 3HKZN 1MNMC 1X2NA 4X6AJ 1A5JA 1JTYA 4D5FA 1ORKA 1A6IA 5GPCA 4MFEA 4S0HB 2CRGA 1H88C 3TW6A 3G1MA 4A3GJ 5IP6A 3SJMA 1XG1A 2XPVA 5FKNA 1AKHB 4MO7A 2JA6J 3M3YJ 1EF4A 4A3IJ 2DN0A 3K7AJ 3LSPA 1UG2A 1BJZA 2K9SA 3Q3SA 4UUTA 3H3VK 3HOVJ 4XICA 4X1EA 3M4OJ 4FE4A 4RDUA 2N8GA 1B8IA 3DCFA 1QVTA 1GVDA 4ABZA 3BG9A 1IG7A 2JA8J 1JGGA 1D5YA 3MVPA 1ETXA 2YUSA 2FX0A 3JRBA 5GPAA 1TWAJ 2L0KA 2VPRA 4C3HJ 1TWHJ 1FEXA 3IV5A 2ELKA 1POGA 3VPRA 4IHWA 1H8AC 4D7NA 4FCYA 4M6VA 5F0CA 4GFBA 2DMUA 2FQ4A 2Y0SN 2Y31A 1UHSA 1S7EA 3ZOBA 2ID6A 1ZR4A 3DEWA 1VFCA 5HODA 1YRNB 2M9HA 2XPWA 2R93J 3A02A 4B4CA 5J1RA 3BR1A 3QPLA 4A3LJ 3JRIA 2LK2A 2JK3A 2R5ZB 2JWTA 1RKTA 3RZDJ 1JUSA 1ZKGA 2HOAA 1Y1VJ 4JX6A 1O4XA 1MH3A 2G0EA 3BG3A 1ETQA 1MBKA 3L1PA 2LVSA 1JKPC 1BW6A 1BA5A 2EZKA 2EQRA 1IRZA 2K9NA 3BQYA 4BY1J 1JT6A 2VUMJ 2ME0A 2TRTA 3LNQA 1U9NA 4M3FA 2JA5J 2NS7A 5FKLA 3QQAA 3WHBA 2DA7A 5EGOA 4AUXA 5EF6A 3F0CA 3JRFA 3HB9A 1NTCA 2DA6A 1MBJA 4M3EA 2NVXJ 5J1UA 5F0FA 3S1RJ 1HCRA 3JRAA 3I4MJ 1P7IA 3S17J 2E19A 1MSEC 1RPWA 4JX5A 2JJ7A 1HDPA 1FTTA 3H0GJ 2LKXA 2XB0X 2CQQA 2R7ZJ 5F27A 3GTGJ 5EGOB 1OCPA 1JTXA 2WAQN 1OJLA 3FKIJ 4G12A 3HM5A 5IPAA 5K7FA 3OIOA 2O8KA 3NAUA 3A01A 3GTMJ 1PUFB 3HEFA 2YU9J 5EG0A 1Z77A 3IH3A 3JRCA 4Y52J 3MN2A 4DW6A 2RAEA 1JKRC 4EEFG 4A3EJ 4XRMA 1I50J 2LLKA 1FJLA 3TEDA 1FTZA 2LP0A 2X48A 3ZQGA 5EG0B 5FLVA 1HOMA 3BR6A 4UUSB 1NK2P 2HQ5A 3RQIA 3ZQHA 1MBGA 2NVQJ 2WB1N 3OOUA 1K83J 3HOZJ 3Q0WA 3BTIA 1IGNA 2R5ZA 1ZGWA 3GTPJ 3GTQJ 2EBIA 1F36A 5F04A 1IUFA 2M34A 5E3OA 2MW8A 2LY9A 4M3DA 1HLVA 2R5YA 5EZGA 5FKMA 2VKVA 2JMWA 1AU7A 2E1OA 1IJWC 1I6HJ 2DTZA 2M2EA 2XB5A 2XGDA 3BG5A 5F1JA 4A3FJ 4RBOA 3RKQA 4V2GA 1DU6A 2CJJA 1LFBA 1WCMJ 2QCOA 1ITYA 1BW5A 1GUUA 4XRSG 5FJ8J 2HDDA 3O8GA 3GBGA 1RKWA 3S15J 3TP0A 2NOGA 2KT0A 1YRNA 2DA2A 4BBSJ 2LR8A 2CUEA 2DMTA 3CQZJ 4W1UA 4A69C 1QRYA 4DZJA 1W0TA 1BL0A 3CDLA 3FIWA 3S1MJ 2R92J 2LFBA 3JR9A 2NVTJ 3NARA 3OSFA 1LFUP 2D5VA 4A3BJ 3D1NI 1MBFA 5K7HA 4MLOA 2CUFA 3HGGA 4C3JJ 4DYCA 2EZHA 2JA7J 4IHXA 5IYCJ 3JRHA 1QVUA 1JKOC 3HOXJ 2DMQA 4LOCA 2FD5A 2B63J 2W48A 4V2FA 1RESA 5C4JJ 3PO3J 3SDGA 4C2MJ 5EEAA 1APLC 3MKLA 2ME6A 4A3JJ 3BQZA 1W0UA 4BXXJ 3LSRA 5DS9A 3JRGA 4DYRA 1QPIA 4J19A 1MBEA 2FJ1A 3QPSA 2DA3A 2L7FP 3LSGA 1X58A 2JN6A 5E3LA 1ZR2A 1ETWA 3I4NJ 3BTJA 5F08A 3C2BA 4XK4A 4Y7NJ 1VF9A 3HOYJ 5C4XJ 3TP3A 3GTKJ 1JKQC 2KDZA 3GTLJ 2PMZN 1H89C 3RZOJ 1F43A 3FISA 1IC8A 1MSFC 4FE7A 2ECBA 1RR7A 1MH4A 4I76A 2OF7A 3TW7A 2L9RA 4A3KJ 2DA5A 3LOCA 2R0QC 1XS9A 1PUFA 4IHYA 4JP0A 3SFIA 5E3MA 2L7MP 2DA1A 1ZQ3P 1ETVA 4DYQA 3IH4A 1ZTRA 3HGYA 3ZQFA 1WPKA 2O7OA 3S1QJ 2AO9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SFO J;  4UUS A;  1R9T J;  3K2A A;  2P81 A;  5M3M J;  3HDD A;  3BR0 A;  5EYR A;  5DTD A;  1WH5 A;  1DU0 A;  2K40 A;  2ECC A;  1E3O C;  3W6V A;  1U8B A;  2MGQ A;  3E7L A;  4BY7 J;  1WI3 A;  2M8G X;  2X9D A;  1JJ6 C;  1G2H A;  1CQT A;  2DMN A;  5IOZ A;  1T56 A;  3CCY A;  2L7Z A;  2Y9Y A;  5FLM J;  2LD5 A;  3Q0V A;  3O8H A;  5E3N A;  4L5E A;  5EZH A;  3BTL A;  1AHD P;  4JX4 A;  1XC5 A;  1K61 A;  2VKE A;  4QTR A;  1TC3 C;  4HNV A;  4A3M J;  3ZQL A;  4D7M A;  3LSJ A;  1Z0X A;  2AHQ A;  2O9L A;  2HOS A;  2GM4 A;  5C3E J;  1AKH A;  2CQX A;  5C44 J;  5IP7 J;  3WHC A;  1JUM A;  2E2I J;  2X6O A;  1I3Q J;  4DZP A;  3G1L A;  4M3G A;  3HBL A;  1GT0 C;  2XRL A;  4QIW N;  3OSG A;  3HOU J;  3PO2 J;  1U9O A;  4BKX A;  2CU7 A;  3S2H J;  3JRD A;  1B72 B;  2DJN A;  1VI0 A;  3S16 J;  3UKG A;  2XSD C;  2OPT A;  3Q0U A;  2XGE A;  4CYC A;  2M0C A;  4W97 A;  1Y1W J;  2E2H J;  5FKK A;  4IEJ A;  1SAN A;  4A93 J;  2XPU A;  1X2M A;  2QF7 A;  3GTJ J;  3S14 J;  2HYJ A;  1NK3 P;  2I10 A;  3BTC A;  1JJ8 C;  1TWC J;  3B6C A;  4NDL A;  4MIM A;  1P7J A;  5JLW A;  2NVY J;  2HOT A;  2EH3 A;  1B72 A;  1UMQ A;  1OFC X;  4A3C J;  2XGC A;  1IDY A;  5IOY A;  5K7Z A;  4C3I J;  4BBR J;  3JRE A;  1GV2 A;  1IDZ A;  3S1N J;  4XID A;  2VI6 A;  2DA4 A;  2WV1 A;  2EZL A;  3IH2 A;  3BR3 A;  4MFD A;  5IYD J;  4B1R A;  4I6Z A;  5F0H A;  2YS9 A;  4A3D J;  3BR2 A;  5FKO A;  2H8R A;  3BT9 A;  9ANT A;  1ETO A;  1LE8 A;  1MBH A;  3G1O A;  4D5C A;  2EZI A;  3S2D J;  2HXO A;  1ETY A;  1U78 A;  5GP9 A;  2DMP A;  4M3B A;  1LE8 B;  5M5W J;  2GBY A;  2HXI A;  3FK7 A;  4JYK A;  3A03 A;  1IV6 A;  1VND A;  3B6A A;  4FTH A;  3CMY A;  2TCT A;  1TWF J;  4AC0 A;  4IHV A;  4FIS A;  4XRS A;  5M5X J;  2Y9Z A;  1JT0 A;  5EDN A;  4AYB N;  1TWG J;  3PM1 A;  5M3F J;  2GLO A;  5JLX A;  2MG4 A;  3ZQI A;  3HOW J;  2Y2Z A;  1FIA A;  3BR5 A;  1ZK8 A;  1HDD C;  2E2J J;  1T33 A;  2R5Y B;  1WH7 A;  2LTP A;  3ZQC A;  1Q1V A;  5IP9 J;  2IBD A;  1WGX A;  4QSH A;  3FK6 A;  1ETK A;  1RET A;  3A01 B;  5J3L A;  5BNG A;  5J1Y A;  5M5Y J;  2H1K A;  2ZB9 A;  2K9Q A;  2Y30 A;  2MSY A;  2IAI A;  1HF0 A;  1FIP A;  4CYC B;  2HI3 A;  2IEK A;  5IYB J;  1GDT A;  1ENH A;  1JUP A;  1GV5 A;  2COB A;  3GTO J;  1B8I B;  1OCT C;  2NS8 A;  2ID3 A;  4B3A A;  3HKZ N;  1MNM C;  1X2N A;  4X6A J;  1A5J A;  1JTY A;  4D5F A;  1ORK A;  1A6I A;  5GPC A;  4MFE A;  4S0H B;  2CRG A;  1H88 C;  3TW6 A;  3G1M A;  4A3G J;  5IP6 A;  3SJM A;  1XG1 A;  2XPV A;  5FKN A;  1AKH B;  4MO7 A;  2JA6 J;  3M3Y J;  1EF4 A;  4A3I J;  2DN0 A;  3K7A J;  3LSP A;  1UG2 A;  1BJZ A;  2K9S A;  3Q3S A;  4UUT A;  3H3V K;  3HOV J;  4XIC A;  4X1E A;  3M4O J;  4FE4 A;  4RDU A;  2N8G A;  1B8I A;  3DCF A;  1QVT A;  1GVD A;  4ABZ A;  3BG9 A;  1IG7 A;  2JA8 J;  1JGG A;  1D5Y A;  3MVP A;  1ETX A;  2YUS A;  2FX0 A;  3JRB A;  5GPA A;  1TWA J;  2L0K A;  2VPR A;  4C3H J;  1TWH J;  1FEX A;  3IV5 A;  2ELK A;  1POG A;  3VPR A;  4IHW A;  1H8A C;  4D7N A;  4FCY A;  4M6V A;  5F0C A;  4GFB A;  2DMU A;  2FQ4 A;  2Y0S N;  2Y31 A;  1UHS A;  1S7E A;  3ZOB A;  2ID6 A;  1ZR4 A;  3DEW A;  1VFC A;  5HOD A;  1YRN B;  2M9H A;  2XPW A;  2R93 J;  3A02 A;  4B4C A;  5J1R A;  3BR1 A;  3QPL A;  4A3L J;  3JRI A;  2LK2 A;  2JK3 A;  2R5Z B;  2JWT A;  1RKT A;  3RZD J;  1JUS A;  1ZKG A;  2HOA A;  1Y1V J;  4JX6 A;  1O4X A;  1MH3 A;  2G0E A;  3BG3 A;  1ETQ A;  1MBK A;  3L1P A;  2LVS A;  1JKP C;  1BW6 A;  1BA5 A;  2EZK A;  2EQR A;  1IRZ A;  2K9N A;  3BQY A;  4BY1 J;  1JT6 A;  2VUM J;  2ME0 A;  2TRT A;  3LNQ A;  1U9N A;  4M3F A;  2JA5 J;  2NS7 A;  5FKL A;  3QQA A;  3WHB A;  2DA7 A;  5EGO A;  4AUX A;  5EF6 A;  3F0C A;  3JRF A;  3HB9 A;  1NTC A;  2DA6 A;  1MBJ A;  4M3E A;  2NVX J;  5J1U A;  5F0F A;  3S1R J;  1HCR A;  3JRA A;  3I4M J;  1P7I A;  3S17 J;  2E19 A;  1MSE C;  1RPW A;  4JX5 A;  2JJ7 A;  1HDP A;  1FTT A;  3H0G J;  2LKX A;  2XB0 X;  2CQQ A;  2R7Z J;  5F27 A;  3GTG J;  5EGO B;  1OCP A;  1JTX A;  2WAQ N;  1OJL A;  3FKI J;  4G12 A;  3HM5 A;  5IPA A;  5K7F A;  3OIO A;  2O8K A;  3NAU A;  3A01 A;  3GTM J;  1PUF B;  3HEF A;  2YU9 J;  5EG0 A;  1Z77 A;  3IH3 A;  3JRC A;  4Y52 J;  3MN2 A;  4DW6 A;  2RAE A;  1JKR C;  4EEF G;  4A3E J;  4XRM A;  1I50 J;  2LLK A;  1FJL A;  3TED A;  1FTZ A;  2LP0 A;  2X48 A;  3ZQG A;  5EG0 B;  5FLV A;  1HOM A;  3BR6 A;  4UUS B;  1NK2 P;  2HQ5 A;  3RQI A;  3ZQH A;  1MBG A;  2NVQ J;  2WB1 N;  3OOU A;  1K83 J;  3HOZ J;  3Q0W A;  3BTI A;  1IGN A;  2R5Z A;  1ZGW A;  3GTP J;  3GTQ J;  2EBI A;  1F36 A;  5F04 A;  1IUF A;  2M34 A;  5E3O A;  2MW8 A;  2LY9 A;  4M3D A;  1HLV A;  2R5Y A;  5EZG A;  5FKM A;  2VKV A;  2JMW A;  1AU7 A;  2E1O A;  1IJW C;  1I6H J;  2DTZ A;  2M2E A;  2XB5 A;  2XGD A;  3BG5 A;  5F1J A;  4A3F J;  4RBO A;  3RKQ A;  4V2G A;  1DU6 A;  2CJJ A;  1LFB A;  1WCM J;  2QCO A;  1ITY A;  1BW5 A;  1GUU A;  4XRS G;  5FJ8 J;  2HDD A;  3O8G A;  3GBG A;  1RKW A;  3S15 J;  3TP0 A;  2NOG A;  2KT0 A;  1YRN A;  2DA2 A;  4BBS J;  2LR8 A;  2CUE A;  2DMT A;  3CQZ J;  4W1U A;  4A69 C;  1QRY A;  4DZJ A;  1W0T A;  1BL0 A;  3CDL A;  3FIW A;  3S1M J;  2R92 J;  2LFB A;  3JR9 A;  2NVT J;  3NAR A;  3OSF A;  1LFU P;  2D5V A;  4A3B J;  3D1N I;  1MBF A;  5K7H A;  4MLO A;  2CUF A;  3HGG A;  4C3J J;  4DYC A;  2EZH A;  2JA7 J;  4IHX A;  5IYC J;  3JRH A;  1QVU A;  1JKO C;  3HOX J;  2DMQ A;  4LOC A;  2FD5 A;  2B63 J;  2W48 A;  4V2F A;  1RES A;  5C4J J;  3PO3 J;  3SDG A;  4C2M J;  5EEA A;  1APL C;  3MKL A;  2ME6 A;  4A3J J;  3BQZ A;  1W0U A;  4BXX J;  3LSR A;  5DS9 A;  3JRG A;  4DYR A;  1QPI A;  4J19 A;  1MBE A;  2FJ1 A;  3QPS A;  2DA3 A;  2L7F P;  3LSG A;  1X58 A;  2JN6 A;  5E3L A;  1ZR2 A;  1ETW A;  3I4N J;  3BTJ A;  5F08 A;  3C2B A;  4XK4 A;  4Y7N J;  1VF9 A;  3HOY J;  5C4X J;  3TP3 A;  3GTK J;  1JKQ C;  2KDZ A;  3GTL J;  2PMZ N;  1H89 C;  3RZO J;  1F43 A;  3FIS A;  1IC8 A;  1MSF C;  4FE7 A;  2ECB A;  1RR7 A;  1MH4 A;  4I76 A;  2OF7 A;  3TW7 A;  2L9R A;  4A3K J;  2DA5 A;  3LOC A;  2R0Q C;  1XS9 A;  1PUF A;  4IHY A;  4JP0 A;  3SFI A;  5E3M A;  2L7M P;  2DA1 A;  1ZQ3 P;  1ETV A;  4DYQ A;  3IH4 A;  1ZTR A;  3HGY A;  3ZQF A;  1WPK A;  2O7O A;  3S1Q J;  2AO9 A; 
#chains in the Genus database with same CATH topology
 2BY1 A;  3J7Z I;  4G7Z F;  3K2A A;  2P81 A;  3NEU A;  3VYT B;  3HDD A;  2X0L A;  1U0J A;  3MCZ A;  2VT2 A;  1T08 B;  1WH5 A;  3H92 A;  4BAC A;  2L02 A;  2VE9 A;  1I27 A;  1I3A A;  3KZY A;  4BHB A;  2L4M A;  2MGQ A;  4XMY A;  2XGX A;  2F5D A;  3E7L A;  4XOT A;  3PL8 A;  4NHJ A;  2KIS A;  3QAH A;  2G9W A;  3VSL A;  1YG2 A;  2KRF A;  2DT6 A;  3KP3 A;  1Y39 A;  4M72 A;  1LDJ A;  1JJ6 C;  1B9N A;  4P55 A;  4HEA 2;  1G2H A;  3ZQ7 A;  3DWL E;  4E70 A;  3DPT A;  4CCL A;  4ZTF A;  1UZC A;  1QHG A;  2Y9Y A;  3RQ4 A;  3KP4 A;  3E6M A;  3V7S A;  2QQB A;  2A6H F;  4NC8 A;  3EYI A;  4BNC A;  3O8H A;  4ZC3 A;  4L5E A;  5EZH A;  4BXU A;  4CIC A;  3BTL A;  2NNY A;  2XAS A;  3BLY A;  4S05 A;  1NG7 A;  4I2O A;  3ZQL A;  1XX5 A;  4D7M A;  2EA2 A;  3LSJ A;  3OYD A;  4ENK A;  1MDM A;  3I0T A;  4PCQ A;  3TO9 A;  2EWN A;  4FX0 A;  4CZC A;  3A2K A;  1RIO H;  5C3E J;  5E8I A;  1LJ9 A;  3CUQ A;  2X6O A;  4CCJ A;  3G1L A;  4L9T A;  1F9N A;  4LG0 A;  1SMT A;  4QIW N;  3A4C A;  5GAH J;  3R0A A;  4Z6Y A;  3J80 Z;  1RNL A;  4HOB A;  2LBF B;  4BKX A;  2CU7 A;  3ZGK A;  1PP7 U;  1VI0 A;  3ISP A;  5FB2 A;  3ZN1 A;  3S16 J;  5JVG F;  2OPT A;  3M8J A;  2ZXW H;  3LAP A;  4BQQ A;  4IEJ A;  4LIV A;  4A12 A;  3T8T A;  1SFE A;  3S14 J;  2HVQ A;  4XL9 A;  4IKF A;  5LRR A;  2JVG A;  2CO5 A;  2W84 A;  3BTC A;  3BCA A;  1YIJ I;  2LY2 A;  3B6C A;  3QP6 A;  3I58 A;  2NVY J;  4CGZ A;  2XKP A;  1OFC X;  4A3C J;  4ENJ A;  1WVR A;  2JT1 A;  1B59 A;  2IXS A;  5JHF A;  2V9P A;  1IDZ A;  2KIU A;  3HYI A;  1I1S A;  3RJP A;  1X1D A;  2DA4 A;  2VJI A;  4IOA F;  3BR3 A;  4A5N A;  1EKE A;  3L9F A;  2XSJ C;  5HLH A;  4L9V A;  4LG3 A;  4BJT A;  3ZP5 A;  5CQE A;  1YS7 A;  4GYG A;  2H8R A;  3I59 B;  3L2W A;  5D5X B;  1X1C A;  3K70 C;  1Z6T A;  2V1X A;  2HQN A;  2JZY A;  2CQ7 A;  2HXO A;  1ZRD A;  2CG4 A;  4EVI A;  1KU7 A;  1QU3 A;  5M5W J;  4JYK A;  4CYD A;  1LVK A;  5FFZ A;  4FTH A;  4YIF A;  2MD0 A;  3CMY A;  1D0Z A;  1MDM B;  3G71 I;  4FHT A;  4XLC A;  4N9I A;  2QBY B;  2ZSH B;  5M5X J;  5EDN A;  4HNU A;  1R1V A;  2BW3 B;  3LSH A;  5JFR A;  2E1M C;  3V8L A;  1IAW A;  1D0Y A;  2XAQ A;  2LG4 A;  2QEN A;  1A31 A;  1UG0 A;  2F5C A;  4D9J A;  2Y2Z A;  1FIA A;  1Y56 A;  1HDD C;  3DBL B;  3ABL H;  4YG2 F;  2IW5 A;  2YX4 A;  2F5E A;  2IS6 A;  4RLF A;  2LTP A;  3ZQC A;  3J7Y J;  1Q1V A;  4XRF A;  1OKR A;  3KE2 A;  2IBD A;  3HTS B;  2EIN H;  3E6D A;  4QSH A;  4M6Y A;  1D1A A;  1NH3 A;  1CGP A;  1ETK A;  4F92 B;  2OAZ A;  2DAO A;  4KIS A;  2YR2 A;  1MMA A;  4BE2 A;  2H1K A;  2IPQ X;  2W82 A;  5EJC A;  2MH2 A;  2BE5 F;  4TV7 A;  2EPF A;  2IAI A;  2MSY A;  1XGM A;  4WXH A;  1T6S A;  2H94 A;  2XIG A;  4A0Z A;  3L2R A;  5KVR A;  2FXA A;  1GV5 A;  2COB A;  3TDU C;  1YJN I;  2X1D A;  3RTR A;  2BY3 A;  3PUB A;  1UJ8 A;  2LF8 A;  2V26 A;  4CZZ A;  5FD6 A;  3RKW A;  1QZZ A;  2ID3 A;  3HKZ N;  4EGY A;  3P9I A;  2K86 A;  2OQR A;  4X6A J;  1SVO A;  4XSX F;  4D5F A;  4HG2 A;  1WSU A;  2FML A;  3BP8 A;  3TW6 A;  4RGS A;  5IP6 A;  1V3F A;  1D8K A;  3IUO A;  3CCM I;  2CW8 A;  3M3Y J;  2HQR A;  5E1X A;  2W1O A;  3FXJ A;  2K9S A;  3LSM A;  3H3V K;  3F6V A;  2W00 A;  4X1E A;  3HTU A;  2VQC A;  2N8G A;  2V4J C;  1TW2 A;  1QVT A;  4HZF A;  1GVD A;  2CW7 A;  2XKO A;  4ABZ A;  2KIQ A;  1FP1 D;  2P7V B;  2GXG A;  2OCE A;  4L5J A;  3V8J A;  4M9S A;  4LLG F;  2NS0 A;  3U2R A;  3MVP A;  2BHZ A;  1K4S A;  1JGG A;  1D5Y A;  3SXY A;  3WGH A;  1LUJ B;  2YUS A;  2VLA A;  2FOW A;  2LNB A;  2L0K A;  2VPR A;  4C3H J;  1W5S A;  1DGW Y;  2RV8 A;  4YFX F;  1POG A;  3VPR A;  4GDF A;  4RMN A;  4QWQ A;  4FCY A;  4O5V A;  1LPQ A;  4XON A;  1PYV A;  4GFB A;  1LEA A;  1OQY A;  4B3X A;  2A3S A;  2OV7 A;  3R61 A;  4IRG A;  3RDI A;  1VQL I;  2Y31 A;  3KZZ A;  4NBQ A;  2R7T A;  5HLI A;  3DEW A;  1VFC A;  2W4S A;  1TQI A;  1SMY F;  1WQ2 A;  4A6E A;  3J81 Z;  2R93 J;  1U8R A;  2VT3 A;  5DD8 A;  2DT5 A;  2GA2 A;  3H9J A;  2GXA A;  5JHU A;  4B47 A;  4I7H A;  2K3P A;  3OS0 A;  5BPD A;  2V9K A;  1RKT A;  2K02 A;  2FBI A;  3I3L A;  4EJV A;  2WTE A;  1JUS A;  2HOA A;  3NWT A;  1O4X A;  2XF5 A;  1VQO I;  2E1N A;  2M3A A;  1ETQ A;  1X3U A;  2LVS A;  4A0Y A;  3FKJ A;  4ZTJ A;  2DQL A;  4HA8 A;  2EZK A;  2HZT A;  4WXD A;  5CLS A;  2JPB A;  4N4N B;  2E36 A;  2Q2E A;  2K9N A;  1IRZ A;  4IHS A;  5LBQ A;  1L0O C;  4BY1 J;  4V19 K;  4MTD A;  1EV7 A;  3ZMT A;  2PJP A;  1J75 A;  4CUG A;  5K5O A;  3MKY B;  1N78 A;  3LSK A;  3OIQ A;  4U88 A;  2VOD A;  4B43 A;  1J09 A;  2DK8 A;  1OYY A;  4AUX A;  3OWT A;  3F0C A;  3W2W A;  1NTC A;  1MBJ A;  2L2O A;  3K1M A;  5J1U A;  2Y75 A;  1HW2 A;  2DYR H;  2LH9 A;  2XHK A;  1KQ0 A;  2D1V A;  2PQ8 A;  4XN3 A;  3S17 J;  4KIG A;  3ZCO A;  4BE1 A;  3OY9 A;  1FTT A;  1Y8R B;  3H0G J;  2LKX A;  2FMY A;  2JPC A;  3F6O A;  4KDP A;  1XDU A;  3EET A;  2DDA A;  3K0L A;  4KMF A;  3S3O A;  4G12 A;  1OJL A;  2O6G E;  1MKM A;  1IUY A;  3RI4 A;  2O8K A;  5CVV A;  3A01 A;  3WTS C;  4DBR A;  3HEF A;  2PMH A;  2DO7 A;  2YU9 J;  1PJR A;  5HS9 A;  5EG0 A;  1Z77 A;  2VXD A;  4IQJ A;  4DW6 A;  3OR1 C;  5DV5 A;  3K1N A;  4EEF G;  4XRM A;  1GXP A;  2LLK A;  2PI0 A;  2MYS A;  2HPI A;  2EV0 A;  3H3Z A;  1VQP I;  4HX4 A;  2VXZ A;  1OIS A;  4UUS B;  1W7P D;  2FBH A;  2RGV A;  3FBN B;  5ERI A;  4M9Z A;  3RQI A;  3ZQH A;  1K83 J;  2E35 A;  2OZU A;  3OIP A;  4KN7 X;  5AIP A;  3Q0W A;  3HOZ J;  2KJB A;  2R5Z A;  1MND A;  2YU3 A;  3I54 A;  1VQK I;  3GTP J;  3GTQ J;  2EBI A;  1F36 A;  5HDG A;  3HHG A;  3FHN A;  4M73 A;  5F04 A;  5E3O A;  4M3D A;  3S3M A;  2PJR A;  3EUH C;  2R5Y A;  1D0X A;  3DBR B;  1R71 A;  4OU0 A;  1AU7 A;  1P4W A;  2E1O A;  1KYZ A;  2GOM A;  1I6H J;  2GAU A;  2LKS A;  4FQG A;  4N0B A;  3CC7 I;  2R7F A;  1Y6I A;  2XB5 A;  3H5R A;  2XGD A;  4A3F J;  3K4B A;  4RBO A;  1YTY A;  5B1A H;  1Z67 A;  1QGP A;  2MA3 A;  3N97 A;  1WCM J;  2HGC A;  2VBW A;  3PFI A;  3L7W A;  1Z7U A;  4RGR A;  4P5O A;  1KU2 A;  2LF7 A;  1SAX A;  3OYB A;  4LLN A;  2HR3 A;  4IOC F;  3CO6 C;  2YPR A;  1R5G A;  3S93 A;  5BMZ A;  2WBM A;  3S15 J;  2Q1Z B;  2M0M A;  4KUM A;  3VYR B;  2DA2 A;  5D5U B;  2EB7 A;  2WC2 A;  5LHH A;  3RPU A;  1DP7 P;  1O3S A;  2OZ6 A;  3A0H C;  4RAF A;  2JA2 A;  2VBY A;  3BJA A;  1VTN C;  3OSF A;  3CUQ C;  1LFU P;  2D5V A;  3D1N I;  4A3B J;  4OWR B;  5KNL A;  5K7H A;  1W36 C;  3HGG A;  2HNH A;  4LGW A;  2A5Y B;  4IRH A;  1YYV A;  2DFF A;  4IHX A;  3E5Q A;  3ZMU A;  1FC3 A;  3CCE I;  4GO1 A;  1WHU A;  4WX9 A;  3HOX J;  1DP3 A;  3ULQ B;  1RES A;  3DU5 A;  5C4J J;  1Z1D A;  2X1C A;  3OMY A;  3SDG A;  5L3F A;  4C2M J;  2EFO A;  2RQP A;  3MKL A;  3BQZ A;  1X3W B;  2LRE A;  4BJ6 C;  3F3X A;  1DQU A;  3JRG A;  1XD7 A;  3EDP A;  4ANJ A;  2FJ1 A;  3QPS A;  4O6J A;  2A69 F;  5DEQ A;  2MH9 A;  1A36 A;  4BEH A;  5HNF A;  3FXM A;  1FBQ A;  1R00 A;  2K27 A;  5E3L A;  3DQV C;  2MBF A;  1T95 A;  5F08 A;  5CVU A;  4XK4 A;  4Y7N J;  1D5V A;  1U5T A;  2WA0 A;  4Q48 A;  2GWR A;  2LY1 A;  2CWE A;  1WI9 A;  1UHM A;  4G6Q A;  1JKQ C;  1PVE A;  2FSW A;  1H89 C;  4LB5 A;  1IW7 F;  3OV8 A;  1ZGA A;  2V6C A;  4HYE A;  3K2Z A;  2OC6 A;  2DXI A;  3KEQ A;  2JRT A;  4XKC A;  5KK1 A;  2L9R A;  2H6C A;  2WAQ A;  4ZH4 F;  4IHY A;  1PUF A;  5AIQ A;  3LFU A;  2A5W A;  3KYL A;  1HKT A;  1BR2 A;  4EM2 A;  5LEJ A;  1ZTR A;  5CKT A;  2DK5 A;  3UNG C;  4PK4 A;  3BC8 A;  3BZC A;  4ASN A;  4DIQ A;  3CLQ A;  3K4N A;  1SFO J;  3GEZ A;  4Q5S F;  4UUS A;  1R9T J;  3KEO A;  4DQ2 A;  5JR3 A;  3C18 A;  5EYR A;  2O61 A;  5TRD A;  3PIP F;  1DU0 A;  2H6B A;  2K40 A;  2VBZ A;  2GXB A;  2F4I A;  3ESW B;  4BYY A;  1XMA A;  1LEB A;  5FRM A;  3QRF F;  3BG7 A;  4WF2 A;  1XDS A;  4ENN A;  1GLN A;  1WI3 A;  2HPM A;  4KIF A;  1NHA A;  1W4M A;  1CQT A;  2DMN A;  2VQG A;  2VL8 A;  4XN0 A;  2M45 A;  3M7G A;  2FE3 A;  3Q0V A;  4UV8 A;  3JTG A;  2XUB A;  2Z3Y A;  3CCQ I;  5E3N A;  1AHD P;  3F8B A;  3AKZ A;  2UZK A;  1FNN A;  4LB6 B;  2DT7 B;  3D5L A;  3WTZ A;  4II3 A;  2GM4 A;  4XLF A;  1AKH A;  4G6D A;  4I99 C;  4XLP F;  4O3M A;  3OYA A;  1HQC A;  3CCL I;  2P6S A;  5LEK A;  1Y0U A;  1S72 I;  3HBL A;  2UXN A;  2XRL A;  1XCB A;  2WWY A;  2F48 A;  3KP6 A;  2QKM B;  2VIX A;  2DQR A;  3HOU J;  3PO2 J;  2EA4 A;  3K9T A;  2MC4 A;  3ERE D;  2HVR A;  1R4M B;  2QBY A;  2Q2E B;  2KZV A;  4CYC A;  3DP7 A;  3EQL F;  1YJ9 I;  1ONV A;  1IXR C;  3ML6 A;  5FKK A;  2ISZ A;  2XPU A;  3GTJ J;  4AIJ A;  3BY6 A;  1EH6 A;  3PIO F;  1XB4 A;  4PZJ A;  1ERD A;  1T38 A;  3ZRG A;  1NK3 P;  3H5A A;  2E71 A;  3CCS I;  3BOQ A;  5BQT A;  1BJA A;  3L00 A;  4J01 A;  2ESN A;  1OCR H;  4XKV A;  2HOT A;  2EH3 A;  2L3D A;  1IN7 A;  2WAD A;  3CJR B;  3Q5F A;  2XGC A;  1IDY A;  1X1P A;  4C3I J;  4ON0 A;  3AG1 H;  3FXU A;  5H20 A;  3S1N J;  2KRC A;  1FP2 A;  3DPU A;  4HV6 A;  5IYD J;  2L9V A;  2FA5 A;  4MTE A;  1RRJ A;  4OAY A;  4PJ0 C;  3L2V A;  1ZAO A;  2Z5U A;  3V42 A;  1X1A A;  4EJT A;  4BS9 A;  1SEU A;  1Z05 A;  2BY2 A;  2OD5 A;  1KU3 A;  2YS9 A;  1F4K A;  3BR2 A;  2CV2 A;  2HWV A;  3FBI B;  2C6Y A;  2CV0 A;  2VBX A;  2IA2 A;  4EM0 B;  2EZI A;  2CQN A;  3QYB A;  4M3B A;  1LE8 B;  3FK7 A;  3WU1 B;  3A03 A;  2BW3 A;  2R7O A;  3JAM K;  3OS1 A;  1WJC A;  2TCT A;  2I5U A;  4AC0 A;  4IRI A;  4IHV A;  4FIS A;  2K4B A;  1VQM I;  2VPL A;  1LQ1 A;  1JT0 A;  1P4X A;  1MJA A;  5M3F J;  2P5K A;  5FRO A;  5JLX A;  3FDY A;  3HOW J;  5HLT A;  1FOK A;  4FAS D;  4BGD A;  3ABT A;  3M1E A;  3MWM A;  2ZO4 A;  2E2J J;  5TJJ A;  1T33 A;  3KLO A;  3TDZ C;  2ZME A;  1XMK A;  2R5Y B;  1WH7 A;  1MNE A;  2PJR B;  3EUH A;  2DFI A;  1WGX A;  3FK6 A;  2QEX I;  1OMI A;  2VKH A;  1HA8 A;  2FOK A;  5J1Y A;  3L09 A;  3K4M A;  5M5Y J;  4OMY A;  3OYK A;  2E5N A;  4CYC B;  5D8L B;  2ZNZ A;  1X19 A;  3BPX A;  4I09 A;  5DUK A;  1B8I B;  4OAZ A;  1OCT C;  3PSF A;  3FF5 A;  2NS8 A;  1IN5 A;  2W7N A;  4WCG A;  4E7L A;  2GQQ A;  3GZ5 A;  3BWG A;  3DBH B;  1Z6R A;  3K4L A;  2GZW A;  3WU0 A;  1MNM C;  2A68 F;  4LIU A;  2BVM A;  1X2N A;  3LWF A;  3J80 K;  3QWL A;  2OTJ I;  4MQ9 F;  1GHC A;  4OIN F;  3NQO A;  5D5W B;  3HSF A;  1A6I A;  3J81 K;  4MFE A;  1N75 A;  5L3G A;  4F91 B;  2STT A;  1CF7 A;  3V8K A;  4AVZ A;  5HDN A;  2HTJ A;  4A3G J;  3SJM A;  3MZ8 A;  2XPV A;  1AKH B;  1WJD A;  4MO7 A;  2R4G A;  3E0J B;  2VOO A;  1EF4 A;  3MKW B;  2O0Y A;  3LSP A;  4G7O F;  1UG2 A;  3Q3S A;  2P8T A;  3F8N A;  4FE4 A;  1UB9 A;  3KP5 A;  3X2Q H;  1B8I A;  3DCF A;  1E2X A;  1ZGJ A;  2RDP A;  2JA8 J;  1IN8 A;  4KT5 C;  1SFK A;  1FBS A;  4P9U A;  3D5S C;  2LDU A;  2JVH A;  3GME A;  1ETX A;  1J5Y A;  2FX0 A;  2RKH A;  5GPA A;  3F23 A;  2QYO A;  3GYH X;  1WZ2 A;  3ABK H;  3HOS A;  3ASN H;  4RM2 A;  3OYG A;  4IHW A;  4M6V A;  5F0C A;  4YEL A;  2KRH A;  4G94 A;  1TNT A;  2DMU A;  2FQ4 A;  2OA4 A;  1ZYR F;  5DYM A;  5E1W A;  4BJ5 C;  3OYJ A;  3ZOB A;  3OS2 A;  2ID6 A;  1ZR4 A;  4U0Y A;  1YRN B;  5K1Y A;  1YX3 A;  4XLN F;  1RC9 A;  4ZYD A;  1H9G A;  5DDG A;  5L3C A;  4MGR A;  4BDZ A;  3I56 I;  3GFL A;  1QNT A;  2V9V A;  5BPI A;  3O3K A;  1ZN2 A;  3HRU A;  1MH3 A;  1VQ4 I;  2G0E A;  3QPT A;  3ECO A;  3MQ0 A;  1M1E B;  4U0V A;  1MBK A;  1PP8 F;  1MGT A;  2K3F A;  3L1P A;  4DJA A;  2QSH X;  6PAX A;  5CVR A;  2MD5 A;  1R22 A;  2F5V A;  2VKD A;  4LJZ F;  2M1B A;  1FWZ A;  1SD5 A;  2M7A A;  4HF2 A;  4PDK A;  3C2H A;  4N4O B;  3QYF A;  1G3Y A;  3MD2 A;  1HW1 A;  5ILU A;  1O7L A;  4LFU A;  2NS7 A;  3KIO A;  2WY8 Q;  5CYV A;  1YOV B;  2DW4 A;  2RRE A;  2QQ8 A;  4LG0 B;  3R0J A;  1WRJ A;  5LHG A;  2UWM A;  3E3V A;  2EIL H;  3C1D A;  5EGO A;  4C30 A;  4BL0 B;  3JRF A;  2DA6 A;  2FRH A;  1ZH5 A;  5D8K B;  4M3E A;  2XAG A;  1BI2 A;  1QO0 D;  2A6T A;  2YSR A;  5F0F A;  4GYI A;  3MKZ A;  3JRA A;  2IA1 A;  3I4M J;  1P7I A;  1AA7 A;  2F4M B;  2E19 A;  3GUD A;  1T8I A;  1RPW A;  1AWC A;  1MSE C;  4CCN A;  3T1B A;  5LFA A;  2F5F A;  1W7P A;  2XB0 X;  3K69 A;  3CCR I;  4BQN A;  3ZPL A;  4E7K A;  5EGO B;  1OCP A;  3HM5 A;  1JTX A;  1OPC A;  2CW0 F;  3FKI J;  3M1C A;  3OIO A;  3NAU A;  3GTM J;  3K1P A;  3LFK A;  1F5T A;  5J47 A;  4II2 A;  2JTV A;  3BDD A;  3IH3 A;  3CZ6 A;  2DDB A;  3LA2 A;  4UNO A;  5HNH A;  2RAE A;  1JKR C;  2DOD A;  3TKY A;  4A3E J;  1I50 J;  3CJN A;  1K78 B;  3GLX A;  1G4D A;  3OYF A;  4NQW B;  4IF4 A;  1SD7 A;  2KFD A;  1HOM A;  4P9F A;  3B73 A;  2KZG A;  3OYN A;  3BR6 A;  1IN6 A;  1REP C;  1OCO H;  1SD4 A;  5DCM A;  4WK8 F;  2XV4 S;  3WTX C;  1BM9 A;  3FWE A;  2QKL B;  1MBG A;  1S6L A;  1USS A;  1ODD A;  2WB1 N;  3GFM A;  4EQQ A;  3AL0 B;  1XSD A;  1YW9 A;  3HC7 A;  1ZGW A;  1IUF A;  1TZL A;  2ZXI A;  2DFE A;  1OLT A;  1Q1H A;  3DKX A;  2JMW A;  3RPU D;  3W2V A;  1UHW A;  4IPA A;  2DTZ A;  3EUK L;  5GAD J;  1S7O A;  1R5H A;  3FXO A;  2O3F A;  2GOX B;  3F8C A;  2V1U A;  3CMA I;  2CUJ A;  1K79 A;  5A2Q K;  3SQN A;  2DI3 A;  4IVN A;  4XOR A;  3VWB A;  4F7Z A;  1ITY A;  1V54 H;  1GUU A;  4DNC A;  2HDD A;  3F9K A;  3O8G A;  2RVC A;  3PFY A;  2HZD A;  2J5P A;  2NOG A;  2KT0 A;  2HDW A;  2UXX A;  2CUE A;  3CQZ J;  3DU6 A;  3R6S A;  2B9S A;  1QRY A;  2DPD A;  4DZJ A;  2AS5 F;  3I59 A;  2L9S A;  1KQ8 A;  3FIW A;  3S1M J;  2LRD A;  3NAR A;  2XDV A;  2Y0M A;  5GTH C;  3VFZ A;  2P5L C;  2JA7 J;  2VAS A;  5IYC J;  3SZG A;  1CF7 B;  1QVU A;  3REO A;  1YE9 A;  1WFX A;  2CH0 A;  4MNU A;  2NYX A;  2ZKZ A;  3CP2 A;  1BIB A;  5KAI C;  4HW0 A;  4A3J J;  4BXX J;  4K2E A;  2EIJ H;  2KIM A;  3E6C C;  4UHT A;  4KFC A;  3HG9 A;  3HRM A;  1B1B A;  5B66 C;  1S3J A;  4J19 A;  1J9I A;  5KHD A;  4JBA A;  2DA3 A;  4QPQ A;  2L7F P;  3E97 A;  1OYI A;  1X58 A;  3LSG A;  2XVC A;  1RR8 C;  4PSX A;  4IZZ A;  3F8F A;  2CYY A;  1ZR2 A;  1IO2 A;  1LNW A;  1S5L C;  3TO6 A;  3I4N J;  3DEE A;  3C2B A;  1RI7 A;  1I39 A;  3QU3 A;  1TL8 A;  3MMY B;  4GXO A;  1YW8 A;  4BHC A;  4I0B A;  2LBF A;  2PEX A;  1UAA A;  2KDZ A;  3DV8 A;  3LAJ A;  3RZO J;  3FIS A;  1IC8 A;  2YX7 A;  1QZY A;  4BHP A;  1XTA A;  3VEP A;  4AD9 A;  1Z91 A;  1P9Q C;  5L3D A;  2R0Q C;  1YJW I;  3MFK A;  3K6G A;  1W7P B;  3SFI A;  3G3Z A;  3O6B B;  1TBX A;  1P2F A;  1ZQ3 P;  4RB3 C;  1ETV A;  3IH4 A;  3RYR A;  3HGY A;  1WPK A;  4QLC U;  4A6D A;  1K6O A;  2XF7 A;  4EM1 A;  3S1Q J;  2EV5 A;  2D2W A;  3ROU A;  1G6N A;  4UVA A;  5HOO A;  2QGU A;  3HSE A;  2F6C A;  1HKS A;  2IGK A;  4HNT A;  2ECC A;  3E6B A;  3W6V A;  4HQE A;  1U8B A;  2GIV A;  2CS3 A;  4YII A;  4L5I A;  2ETH A;  2M8G X;  2X9D A;  5DCM B;  3AG2 H;  4E4H A;  2GA1 A;  2P0W A;  3ERM A;  5ICC A;  4EJU A;  4YEJ A;  2D45 A;  4D1Q A;  2H27 A;  3GZ6 A;  1T56 A;  3CCY A;  4N9H A;  1XSV A;  2L7Z A;  4YRV A;  1YS6 A;  5FLM J;  2Z99 A;  2KQR A;  3QPH A;  4XLH A;  3CUO A;  3KCC A;  1L3L A;  4RA2 A;  4JX4 A;  1XC5 A;  1K61 A;  1VQ7 I;  3WE2 A;  2VKE A;  4QTR A;  1TC3 C;  3CUQ B;  4HX8 A;  4A3M J;  3PNV A;  1SD6 A;  3DLL F;  2AHQ A;  1YHQ I;  2O9L A;  1TW3 A;  2HOS A;  2E7X A;  2DBB A;  3FMR A;  2Q0O A;  1JGS A;  4H4K C;  3K4C A;  2ZJQ F;  3RCO A;  1ZG5 A;  1GXQ A;  1HBX G;  5C44 J;  4ENM A;  5IP7 J;  4PJM A;  3WHC A;  4NNJ A;  3WE3 A;  2BXY A;  5J6X A;  4XQF A;  3CC2 I;  4DZP A;  3CF5 F;  1ZLK A;  3C7J A;  1B6A A;  3E5X A;  4M3G A;  3IP4 B;  2FQ3 A;  3CDI A;  4UV9 A;  3KFW X;  4HST A;  3VSK A;  1BR1 A;  1U9O A;  3S2H J;  4B44 A;  1EH7 A;  2DJN A;  2QQA A;  5H6Q A;  4BE0 A;  3P9C A;  2ELJ A;  4YIR X;  3UKG A;  2CFO A;  4UY8 I;  2M0C A;  4W97 A;  1Y1W J;  4QPO A;  2EIK H;  1BC7 C;  5J40 A;  2QF7 A;  1Y8Q B;  2UUZ A;  1YIT I;  2HYJ A;  4XKB A;  4FX4 A;  4XOP A;  1IV8 A;  2E7W A;  3GO5 A;  3DEU A;  1QPM A;  4NDL A;  4CSW A;  4MIM A;  1P7J A;  4GCV A;  3TO7 A;  1YX5 A;  1Z3Y A;  3ZR8 X;  1UMQ A;  2KHM A;  2M30 A;  4HRI A;  3BJ6 A;  5FGM A;  5K7Z A;  5IOY A;  4ZYH A;  1FYK A;  1KYW A;  4HPQ A;  4XR6 A;  4D0P A;  2VI6 A;  1DGR M;  2OQG A;  4M9X A;  2EZL A;  3IH2 A;  2CMP A;  1HST A;  1QQI A;  3DPL C;  3S3N A;  4B1R A;  3SYT A;  4F52 A;  5IY5 H;  3ABU A;  4Q4Z F;  2NNN A;  4LK0 F;  2MLK A;  1B4A A;  3QOP A;  3ABM H;  1WJA A;  3AL0 C;  4KYW A;  4A3D J;  1ZEL A;  1RUN A;  2QM3 A;  4ZDP A;  3HXL A;  3OYL A;  2Y0S A;  4F93 B;  4UB8 C;  3W2A A;  3M07 A;  3LL7 A;  1U78 A;  5GP9 A;  3CES A;  1R49 A;  2VC1 A;  2M4G A;  2DMP A;  3LA3 A;  4JQF A;  2K85 A;  1IV6 A;  1VND A;  3B6A A;  2B0L A;  1TLH B;  3W6J B;  2ZME C;  3QYE A;  3CO7 C;  3OYH A;  2QSG X;  2B7E A;  1RZ4 A;  4PFO A;  2KDO A;  1P6R A;  1VQ6 I;  4XRS A;  1UST A;  3GCM A;  3KP2 A;  2Y9Z A;  3H9G A;  1WJB A;  4OIP F;  2QSF X;  1IRX A;  1TWG J;  2ZJ2 A;  3SZP A;  1J7K A;  2GLO A;  2IA0 A;  3ZQI A;  2VJ4 A;  4E7Z A;  5B3S H;  3BR5 A;  4PJL A;  1XCV A;  5J4V A;  1ZK8 A;  3QOE A;  1BOB A;  4DGW B;  5IT9 K;  3H9Q A;  1D1B A;  1D3Y A;  1FOW A;  3KPH A;  2Z1D A;  1HC8 A;  3WG9 A;  5IT9 Z;  3K4K A;  5IP9 J;  3IKT A;  2H09 A;  2OUM A;  1V5F A;  2D1H A;  3PSI A;  4PJN A;  3A01 B;  5J3L A;  5BNG A;  2E1C A;  1OCZ H;  2G7H A;  4OIQ F;  2DLL A;  5H6R A;  1DPR A;  4A0X A;  4OOI A;  2ZB9 A;  2K9Q A;  1XMX A;  2Y30 A;  2BV6 A;  1FIP A;  5HLG A;  5LLQ A;  2IEK A;  3EUA A;  2DJI A;  4RM3 A;  3CDH A;  1QBJ A;  5JVT A;  2ESH A;  3NRV A;  2DCE A;  3IHU A;  3GTO J;  1IXS B;  3DKY A;  4AWX B;  4L18 B;  4BH9 A;  4EMS A;  2BEO A;  2E1M B;  4I98 B;  5FFX A;  2P4W A;  3HRT A;  3RKY A;  1SFU A;  1KON A;  5LRS A;  2HS5 A;  1H9T A;  3CJT B;  1Z3X A;  4ESF A;  3JW4 A;  5GPC A;  3J7A O;  4S04 A;  2P5V A;  5ICG A;  2P6T A;  3FM3 A;  4IQ4 A;  1YQA A;  1XG1 A;  2JA6 J;  2AQE A;  2BXZ A;  4XLA A;  2DN0 A;  1FLI A;  3ZMD A;  2M4K A;  3HOV J;  1LDD A;  1MZB A;  4XIC A;  2R7X A;  3M4O J;  2LKP A;  3DXJ F;  1ACI A;  3COA C;  3VYS B;  5FLX K;  1SAU A;  4HV5 A;  1T98 A;  1ULY A;  2RC4 A;  3SFZ A;  2PN6 A;  4HLX A;  3V7R A;  4XKW A;  2ZJP F;  4NB5 A;  3DF8 A;  3IAS 2;  2BVL A;  3JRB A;  1DDN A;  1TWA J;  1UFM A;  1V55 H;  1TWH J;  5CJ9 A;  3HSR A;  3IV5 A;  2ELK A;  3CCV I;  3GZN B;  4ZJZ A;  3BJO A;  3RPQ A;  4E7I A;  3IRR A;  2TDX A;  3LSI A;  1MMD A;  4AYB A;  5HOD A;  2M9H A;  3BZK A;  3KZI C;  5D6F A;  3WU2 C;  3JSP A;  2XPW A;  2I8D A;  2W25 A;  3H0D A;  2WB1 A;  5ILS A;  5J1R A;  2XAU A;  3BR1 A;  2V79 A;  3QPL A;  4A3L J;  2A05 A;  2LK2 A;  1I6X A;  2JK3 A;  3IWZ A;  2R5Z B;  2JWT A;  2RNJ A;  4EGZ A;  3RZD J;  3J7A Y;  2NOJ B;  3LA7 A;  1Y1V J;  2RQQ A;  2M87 A;  5D5V B;  3CTA A;  3H36 A;  4RAZ A;  2X6X A;  3BRO A;  1JKP C;  1TT0 A;  4E7S A;  1BW6 A;  1Z9C A;  1P4A A;  2ZSI B;  1BN5 A;  2EQR A;  4EV0 A;  1QHH D;  2VUM J;  4BAY A;  1YI2 I;  2ME0 A;  2TRT A;  5LGN A;  2ZXH A;  3MZH A;  2E34 A;  3ELK A;  3G2B A;  2WAF A;  5FKL A;  3QQA A;  4ZYG A;  4JOM A;  1MJ9 A;  1YIO A;  1VQN I;  2E5Z A;  4U87 A;  1SC7 A;  5HDK A;  5EF6 A;  1AOY A;  3C2G A;  4Y3O A;  2IJL A;  3HB9 A;  3TQN A;  5TIS C;  1J0R A;  2VC0 A;  4OIO F;  2HKO A;  1TP4 A;  3S1R J;  1HCR A;  3HKZ A;  2XC7 A;  1Z21 A;  3HUG A;  4JX5 A;  1MMG A;  2JJ7 A;  1HDP A;  3FZV A;  3ZMS A;  3AG3 H;  4UB6 C;  3GTG J;  2HU9 A;  1SVM A;  4RB0 A;  5IPA A;  2M8E A;  1XGN A;  2Y69 H;  4ZDL A;  3ZN0 A;  2VJ5 A;  2Q8K A;  3WGI A;  1ZRC A;  3RIR A;  3S2W A;  5BS6 A;  3MN2 A;  1K7A A;  1E17 A;  1FTZ A;  3W3C A;  3TOB A;  4LK1 F;  4B09 A;  2STW A;  1SVL A;  1EJ9 A;  2CSO A;  5FLV A;  4KMU X;  4HDU A;  3DTK A;  2CQK A;  3CD6 I;  4HF1 A;  5F1R A;  1NK2 P;  1TT5 B;  3TMO A;  3WTT C;  1VQ9 I;  1KQ9 A;  2HQ5 A;  2QQ9 A;  3OYI A;  3IKV A;  1OR7 A;  3W6K B;  2VE8 A;  2NVQ J;  3OOU A;  1IRG A;  2LYC A;  5B5E C;  3BTI A;  1FMW A;  1TQP A;  3ZMV A;  4G7H F;  1HW5 A;  1JI8 A;  2R7U A;  3DTE A;  2M34 A;  4ESJ A;  2LY9 A;  2MW8 A;  1JXS A;  1EH8 A;  2K5C A;  5FKM A;  4NC7 A;  1IXC A;  3GVA A;  1PUE E;  2PMU A;  5ICF A;  1IJW C;  4AIK A;  4CCM A;  1ON2 A;  2HTS A;  4BU2 A;  4CDG A;  1O57 A;  2Z16 A;  2WY7 Q;  3BG5 A;  4R1H A;  5ICE A;  4PFP A;  3RKQ A;  4V2G A;  3VOD A;  5J4Y A;  5L3E A;  2CJJ A;  1LFB A;  5DD4 A;  1BW5 A;  5FJ8 J;  1FSH A;  3GFI A;  2BBY A;  2DOA A;  1LDK B;  4CHU A;  3QP5 A;  3GBG A;  4BBS J;  4WXC A;  5CPR B;  2EJR A;  4A69 C;  2KKO A;  3EPZ A;  1IF1 A;  3QU6 A;  3OYC A;  4IJA A;  3CDL A;  4MQV A;  2R7V A;  3HJE A;  3E5U A;  3G6E I;  1I1G A;  2ZFW A;  2AQF A;  2RN7 A;  4CH7 A;  2LFB A;  2Z33 A;  4HDV A;  2NVT J;  2R92 J;  2V6E A;  1U6G A;  1U5T B;  1MBF A;  1MIJ A;  4KNY A;  2IGN A;  4MLO A;  2W57 A;  2CUF A;  2LSO A;  5CVI A;  2KP6 A;  2LC2 A;  4FT8 A;  2BOL A;  3WG7 H;  4C3J J;  2EZH A;  3T8R A;  2ZCW A;  4HQM A;  5ILV A;  2FD5 A;  2NAZ A;  2W48 A;  4V2F A;  5HVQ C;  1HKQ A;  5GAE J;  3PO3 J;  1APL C;  3LQR A;  2ME6 A;  3O2P E;  5FRN A;  1WKM A;  3LSR A;  4ZZL A;  2FU4 A;  2ZJR F;  3KYC B;  2X85 A;  1MBE A;  2GIZ A;  3S8P A;  4KIC A;  2JN6 A;  2DOF A;  2X4H A;  3F8M A;  5TGT A;  1YFH A;  1WWX A;  2W24 A;  5A2Q Z;  1VF9 A;  2L7K A;  2M5W A;  3GX4 X;  4BQA A;  2VQL A;  1G8X A;  5C4X J;  3TP3 A;  3CP8 A;  5HS8 A;  2QZ8 A;  3HUG B;  1V5E A;  2WV0 A;  2PMZ N;  3P7N A;  3CMM A;  1IN4 A;  1F43 A;  2FNA A;  4Y17 A;  4HLY A;  3D5R C;  3VDX A;  2KMU A;  4R79 A;  1MSF C;  4HBL A;  2PBI A;  1RR7 A;  1MH4 A;  1I5Z A;  1XN7 A;  2OF7 A;  3TW7 A;  4PSW A;  4A3K J;  3LOC A;  3N4M A;  1XS9 A;  2KPM A;  4JP0 A;  2VB6 A;  4LMY A;  5E3M A;  1G59 A;  2ICW G;  2WAE A;  2DA1 A;  2VOP A;  5IT3 A;  1WJF A;  1FOY A;  5K5Q A;  4NUB A;  3ZQF A;  2OBP A;  1F1Z A;  4AVP A;  2AO9 A;  2L4A A;  1JHH A;  3SDB A;  1ZAR A;  1KZH A;  3IC7 A;  5FO5 A;  4CXF A;  4C2U A;  1BI3 A;  2CGP A;  3CCJ I;  5M3M J;  3BR0 A;  2P7C B;  5DTD A;  4L0Z B;  2EV6 A;  1Y0N A;  4M71 A;  5LD2 C;  2V1D A;  4B48 A;  3K4J A;  1E3O C;  4ZZD A;  1RUO A;  1E0E A;  1O3T A;  3ONQ A;  3E1S A;  3OR2 C;  2MLG A;  4BY7 J;  3RYP A;  1S8N A;  1YW7 A;  3DTI A;  4B8X A;  5KCM A;  5IOZ A;  5E18 F;  2QA4 I;  4DOZ A;  3HPH A;  4EAT A;  4EJO A;  3OYE A;  1T0F A;  2LD5 A;  4Y15 A;  1WJ5 A;  2QUF A;  2OU2 A;  2FNP A;  3DLA A;  3GFJ A;  1X3Z B;  4UUV A;  3IWF A;  3IAM 2;  3R60 A;  4HNV A;  3F21 A;  1Z0X A;  4KT6 A;  5B1B H;  1T39 A;  2PG4 A;  3V4G A;  1HXD A;  3G73 A;  4IHT A;  4MEY F;  2CQX A;  3MZY A;  1BC8 C;  3L2U A;  4XBF A;  3KEY A;  1JUM A;  2E2I J;  4Y4R A;  1I3Q J;  1BR4 A;  1OYW A;  4BEH B;  4RB1 A;  1VQ8 I;  4BQO A;  1GT0 C;  4NQW A;  4MEX F;  3C3W A;  4UVB A;  5LGT A;  3OSG A;  2PLY A;  3CLO A;  3JRD A;  4ETS A;  2MAB A;  1B72 B;  1N25 A;  1G3W A;  1GVJ A;  4LD5 A;  2XSD C;  1W1W E;  3ZQQ A;  3Q0U A;  2X6W A;  2XGE A;  2XRO A;  4G9Y A;  2XAF A;  2E2H J;  1SAN A;  4A93 J;  1X2M A;  4BUP A;  1JE8 A;  1X4O A;  2HEO A;  2XF6 A;  2HFH A;  1R1U A;  2JSP A;  1S7A A;  2ZNY A;  2I10 A;  4KA4 A;  1JJ8 C;  5CVJ A;  1TWC J;  1IRF A;  5JLW A;  2FBK A;  4A2U A;  1Z7L A;  1B72 A;  1D1C A;  2BHY A;  2OCC H;  3ZMZ A;  3DFG A;  2AXT C;  3I53 A;  4RAY A;  1TTY A;  3AAF A;  2IS2 A;  4AM3 A;  4HX7 A;  4KJZ A;  4BBR J;  1GV2 A;  5DUI A;  3JRE A;  3SZT A;  1O3Q A;  1ZRF A;  2IS1 A;  1YLF A;  4XID A;  2WV1 A;  3GXO A;  4MFD A;  3TOA A;  3U1D A;  4RB2 C;  4FET A;  4IO9 F;  1A35 A;  1FT9 A;  2W85 A;  4IL6 C;  2O8X A;  1FY7 A;  3P9K A;  4I6Z A;  5F0H A;  2X51 A;  5FKO A;  3BT9 A;  9ANT A;  1R23 A;  1ETO A;  3T5X A;  1LE8 A;  1MBH A;  3G1O A;  3NWS A;  3HOT A;  4D5C A;  4Y33 A;  3S2D J;  1FZP B;  1ETY A;  1BIA A;  4E7H A;  2K9L A;  3FXL A;  3M8F A;  1R4N B;  1T0F C;  4WWC A;  2NRA C;  2GBY A;  2HXI A;  3FXR A;  1K78 A;  3N05 A;  1BOA A;  3R4K A;  3P5J A;  4OMZ A;  2K9M A;  3F22 A;  1TWF J;  3SEQ A;  2JSC A;  2DTR A;  1V4R A;  2Z2S B;  2ZBK A;  4AYB N;  1KA8 A;  3PM1 A;  2OJE D;  2EK5 A;  2MG4 A;  2IGO A;  1EA3 A;  5DM6 F;  2VJJ A;  3OL3 A;  4PGH A;  2R7D A;  2XRN A;  2MC3 A;  2BYV E;  2DYS H;  4ZYE A;  2X6Y A;  4I02 A;  3ASO H;  3U9G A;  2CFX A;  5D4S A;  4L9J A;  3JCU C;  2PMZ A;  3OOP A;  4G6T B;  1X4P A;  1RET A;  3QOD A;  1STZ A;  4CCK A;  1LB2 A;  1O3R A;  5KAF C;  3M9A A;  2A07 F;  1BI0 A;  1HF0 A;  2HI3 A;  4ZYA A;  4CCO A;  3WTW C;  4LIT A;  5IYB J;  1K4T A;  1N77 A;  1ENH A;  1JUP A;  1GDT A;  2BGC A;  3Q9S A;  2ACJ A;  3FM5 A;  5K5R A;  1E3P A;  1XSX A;  2ZXJ A;  3JTH A;  3L2Q A;  3K10 A;  2LOO A;  4KIT B;  3WTU C;  2ISY A;  1KU9 A;  4B3A A;  3PNT A;  2A61 A;  2E60 A;  3KET A;  1U3E M;  1IZ1 A;  1A5J A;  1JTY A;  4M74 A;  1ORK A;  2F4O B;  3HRS A;  2CUZ A;  1FYL A;  4S0H B;  2CRG A;  3WTV C;  4H0E A;  1H88 C;  3G1M A;  2J5O A;  1JHF A;  5DM7 F;  1ZRE A;  5FKN A;  3A1Y A;  3FX3 A;  2K4J A;  3KP7 A;  4A3I J;  3K7A J;  3IRQ A;  1D8J A;  1R36 A;  2LMD A;  4XM3 A;  1MJB A;  1BJZ A;  4UUT A;  1HSJ A;  5E1Z B;  2HQA A;  2KL4 A;  2QWW A;  1LFP A;  2PFB A;  4RDU A;  5HS7 A;  1R5I D;  2HOE A;  1B9M A;  3BG9 A;  1IG7 A;  5EEG A;  3PNY A;  1MD0 A;  3I71 A;  2DFH A;  2EIM H;  3GWZ A;  4U0W A;  1BBY A;  4I01 A;  3MEX A;  5EEH A;  1FEX A;  4Z2Y A;  5H2F C;  1O7F A;  1DPU A;  1P92 A;  1A04 A;  3FMQ A;  3WOD F;  4D7N A;  1H8A C;  4C9Y A;  4U7D A;  2JUC A;  1A6Q A;  2Y0S N;  2ZFU A;  2ZME B;  1FYM A;  1UHS A;  2NVU B;  1C0W A;  1S7E A;  1R6R A;  4R8H A;  5L3B A;  1VZ0 A;  2HYF A;  3HIF A;  1MMN A;  2XAJ A;  3LST A;  2NXN B;  3F72 A;  3FHZ A;  3A02 A;  4P1W A;  4B4C A;  3BG6 A;  4Q47 A;  3G4S I;  1XPX A;  4CO8 A;  1XGS A;  3JRI A;  3I9V 2;  2R7W A;  4E7J A;  1S29 A;  1ZKG A;  4JX6 A;  4OIR F;  4GGG A;  3BG3 A;  4J00 A;  4M6X A;  4CA0 A;  4RGU A;  3BCB A;  1UCR A;  1G3T A;  1BA5 A;  3T0Y A;  3S32 A;  1FOX A;  4DBQ A;  1W36 D;  3BQY A;  5BOX A;  2IRF G;  1JT6 A;  2KJC A;  4F3Q A;  1QA6 A;  3LNQ A;  3HL2 A;  4L9N A;  2HDC A;  1U9N A;  1XGO A;  2VQH A;  4M3F A;  2JA5 J;  2Z9O A;  4GRI A;  4YFK F;  1R1T A;  1R7J A;  2X1E A;  3H1C A;  2DOE A;  3Q9V A;  4PGG A;  3WHB A;  2DA7 A;  2VON A;  5CQG A;  3K70 D;  4IX7 A;  2R7R A;  3WGG A;  2V7F A;  1FSE A;  1TQM A;  2A6E F;  1ZHF A;  3AFH A;  2NVX J;  3U1K A;  1FMV A;  1MW7 A;  3PUF A;  3SHF A;  1J2X A;  4AIH A;  3PQK A;  3VOE A;  4P96 A;  2M7B A;  4KIB A;  2KLO A;  3UR3 C;  3FMS A;  2EFP A;  2CQQ A;  4LLL A;  5F27 A;  2IP2 A;  3H3U A;  3L2C A;  1YO5 C;  2R7Z J;  2R3S A;  3U21 A;  3ZXS A;  2WAQ N;  1FBU A;  5E8G A;  5K7F A;  2EFQ A;  2L54 A;  2L5Q A;  3B02 A;  2IT0 A;  1U2W A;  1PUF B;  2ELH A;  4C2T A;  3KYD B;  2EFW A;  1X1B A;  2BY0 A;  3JRC A;  1OR7 C;  1MMS A;  2JRM A;  4Y52 J;  4BXF A;  5GTI C;  2COM A;  2PX9 A;  5FLX Z;  4JK1 X;  1FJL A;  2DPU A;  3TBI A;  3TED A;  2LP0 A;  2X48 A;  3ZQG A;  4BDY A;  5EG0 B;  1DUX C;  3PJR A;  2OTL I;  3OL4 A;  2H8W A;  3I5U A;  3RSN A;  4PJJ A;  1FX7 A;  4UVC A;  1E3H A;  1NG6 A;  1ZLJ A;  3CF2 A;  4HF0 A;  5AON A;  4U7B A;  3A0B C;  3GLL A;  4ZDO A;  2JQ7 A;  2G7U A;  3M8E A;  5LGU A;  5F6F A;  4Y13 A;  4HSR A;  2K7L A;  3LQQ A;  3WTY C;  5J8F A;  1IGN A;  1HLV A;  4IXA A;  5EZG A;  2MFZ A;  2VKV A;  3H5N A;  1V5G A;  2L9N A;  5D6E A;  4NC6 A;  3JAM Z;  3I4P A;  2IS4 A;  1ZG3 A;  2M2E A;  5E20 A;  5GAG J;  3H35 A;  5F1J A;  4E6K G;  1H0M A;  4L0Y B;  2XAH A;  2FUG 2;  1DU6 A;  2R7Q A;  2QCO A;  1UEL B;  2QVO A;  4XNF A;  3CCU I;  3TL4 X;  4XRS G;  2F2E A;  1K6Y A;  5JI6 A;  5E17 F;  1RKW A;  1SFX A;  1BI1 A;  2R7S A;  3TP0 A;  3BZ6 A;  3TGN A;  1YRN A;  3PQJ A;  2LR8 A;  1W5T A;  2DMT A;  2IVM A;  1U5T C;  5LHI A;  2H1L A;  3KLN A;  4RGX A;  4XSZ F;  5E79 C;  4YFN F;  4W1U A;  1W0T A;  1PDN C;  3BPV A;  1LVA A;  3I55 I;  1BL0 A;  5DCF A;  3GF2 A;  4UXN A;  3JR9 A;  3OYM A;  4EJW A;  4XLE A;  2KIF A;  4DYC A;  4ITV A;  2HVS A;  3I64 A;  3JRH A;  1JKO C;  3CC4 I;  2DMQ A;  4LOC A;  4PUS A;  2VN2 A;  2B63 J;  5D4R A;  3SEZ A;  5EEA A;  5ED4 A;  2L01 A;  4RLQ A;  1W0U A;  5DS9 A;  4MHG A;  4DYR A;  1R58 A;  3HHH A;  4A5M A;  1QPI A;  1G3S A;  2IGM A;  4X0G A;  1VQ5 I;  1FPQ A;  4HAM A;  2BZT A;  2CV1 A;  3VB2 A;  3HZJ A;  4RS8 A;  1QZE A;  1W5C C;  4AU7 A;  1ETW A;  5F64 A;  2O5R A;  3BTJ A;  4AID A;  1KGS A;  2UV1 A;  3RKX A;  3AG4 H;  3HOY J;  3LMM A;  3V7C A;  3CME I;  1T2K A;  3GTK J;  3EYY A;  2Y48 A;  2AXL A;  4KN4 X;  1ZG1 A;  3GTL J;  2FEZ A;  3D0S A;  1WJE A;  1LKX A;  2FF4 A;  4FE7 A;  2ECB A;  2HYG D;  2V1N A;  5J8C A;  3IL2 A;  3DKW A;  3JSO A;  2O03 A;  2QLZ A;  3FXK A;  1TNS A;  4I76 A;  1S9H A;  3CJQ B;  2DA5 A;  2ZC2 A;  2ADU A;  3FXQ A;  2JUG A;  4ESB A;  3GW2 A;  3MAJ A;  3VYU B;  2EFN A;  4F55 A;  4G8X A;  2L7M P;  1ON1 A;  5FD5 A;  2RNG A;  4DYQ A;  2HKX A;  3HPG A;  4RAG A;  1J59 A;  1OCC H;  3KX2 A;  2O7O A;  4I0A A;  2DU9 A;  3ECH A; 
#chains in the Genus database with same CATH homology
 1SFO J;  4UUS A;  1R9T J;  3K2A A;  2P81 A;  5M3M J;  3HDD A;  3BR0 A;  5EYR A;  5DTD A;  1WH5 A;  1DU0 A;  2K40 A;  2ECC A;  1E3O C;  3W6V A;  1U8B A;  2MGQ A;  3E7L A;  4BY7 J;  1WI3 A;  2M8G X;  2X9D A;  1JJ6 C;  1G2H A;  1CQT A;  2DMN A;  5IOZ A;  1T56 A;  3CCY A;  2L7Z A;  2Y9Y A;  5FLM J;  2LD5 A;  3Q0V A;  3O8H A;  5E3N A;  4L5E A;  5EZH A;  3BTL A;  1AHD P;  4JX4 A;  1XC5 A;  1K61 A;  2VKE A;  4QTR A;  1TC3 C;  4HNV A;  4A3M J;  3ZQL A;  4D7M A;  3LSJ A;  1Z0X A;  2AHQ A;  2O9L A;  2HOS A;  2GM4 A;  5C3E J;  1AKH A;  2CQX A;  5C44 J;  5IP7 J;  3WHC A;  1JUM A;  2E2I J;  2X6O A;  1I3Q J;  4DZP A;  3G1L A;  4M3G A;  3HBL A;  1GT0 C;  2XRL A;  4QIW N;  3OSG A;  3HOU J;  3PO2 J;  1U9O A;  4BKX A;  2CU7 A;  3S2H J;  3JRD A;  1B72 B;  2DJN A;  1VI0 A;  3S16 J;  3UKG A;  2XSD C;  2OPT A;  3Q0U A;  2XGE A;  4CYC A;  2M0C A;  4W97 A;  1Y1W J;  2E2H J;  5FKK A;  4IEJ A;  1SAN A;  4A93 J;  2XPU A;  1X2M A;  2QF7 A;  3GTJ J;  3S14 J;  2HYJ A;  1NK3 P;  2I10 A;  3BTC A;  1JJ8 C;  1TWC J;  3B6C A;  4NDL A;  4MIM A;  1P7J A;  5JLW A;  2NVY J;  2HOT A;  2EH3 A;  1B72 A;  1UMQ A;  1OFC X;  4A3C J;  2XGC A;  1IDY A;  5IOY A;  5K7Z A;  4C3I J;  4BBR J;  3JRE A;  1GV2 A;  1IDZ A;  3S1N J;  4XID A;  2VI6 A;  2DA4 A;  2WV1 A;  2EZL A;  3IH2 A;  3BR3 A;  4MFD A;  5IYD J;  4B1R A;  4I6Z A;  5F0H A;  2YS9 A;  4A3D J;  3BR2 A;  5FKO A;  2H8R A;  3BT9 A;  9ANT A;  1ETO A;  1LE8 A;  1MBH A;  3G1O A;  4D5C A;  2EZI A;  3S2D J;  2HXO A;  1ETY A;  1U78 A;  5GP9 A;  2DMP A;  4M3B A;  1LE8 B;  5M5W J;  2GBY A;  2HXI A;  3FK7 A;  4JYK A;  3A03 A;  1IV6 A;  1VND A;  3B6A A;  4FTH A;  3CMY A;  2TCT A;  1TWF J;  4AC0 A;  4IHV A;  4FIS A;  4XRS A;  5M5X J;  2Y9Z A;  1JT0 A;  5EDN A;  4AYB N;  1TWG J;  3PM1 A;  5M3F J;  2GLO A;  5JLX A;  2MG4 A;  3ZQI A;  3HOW J;  2Y2Z A;  1FIA A;  3BR5 A;  1ZK8 A;  1HDD C;  2E2J J;  1T33 A;  2R5Y B;  1WH7 A;  2LTP A;  3ZQC A;  1Q1V A;  5IP9 J;  2IBD A;  1WGX A;  4QSH A;  3FK6 A;  1ETK A;  1RET A;  3A01 B;  5J3L A;  5BNG A;  5J1Y A;  5M5Y J;  2H1K A;  2ZB9 A;  2K9Q A;  2Y30 A;  2MSY A;  2IAI A;  1HF0 A;  1FIP A;  4CYC B;  2HI3 A;  2IEK A;  5IYB J;  1GDT A;  1ENH A;  1JUP A;  1GV5 A;  2COB A;  3GTO J;  1B8I B;  1OCT C;  2NS8 A;  2ID3 A;  4B3A A;  3HKZ N;  1MNM C;  1X2N A;  4X6A J;  1A5J A;  1JTY A;  4D5F A;  1ORK A;  1A6I A;  5GPC A;  4MFE A;  4S0H B;  2CRG A;  1H88 C;  3TW6 A;  3G1M A;  4A3G J;  5IP6 A;  3SJM A;  1XG1 A;  2XPV A;  5FKN A;  1AKH B;  4MO7 A;  2JA6 J;  3M3Y J;  1EF4 A;  4A3I J;  2DN0 A;  3K7A J;  3LSP A;  1UG2 A;  1BJZ A;  2K9S A;  3Q3S A;  4UUT A;  3H3V K;  3HOV J;  4XIC A;  4X1E A;  3M4O J;  4FE4 A;  4RDU A;  2N8G A;  1B8I A;  3DCF A;  1QVT A;  1GVD A;  4ABZ A;  3BG9 A;  1IG7 A;  2JA8 J;  1JGG A;  1D5Y A;  3MVP A;  1ETX A;  2YUS A;  2FX0 A;  3JRB A;  5GPA A;  1TWA J;  2L0K A;  2VPR A;  4C3H J;  1TWH J;  1FEX A;  3IV5 A;  2ELK A;  1POG A;  3VPR A;  4IHW A;  1H8A C;  4D7N A;  4FCY A;  4M6V A;  5F0C A;  4GFB A;  2DMU A;  2FQ4 A;  2Y0S N;  2Y31 A;  1UHS A;  1S7E A;  3ZOB A;  2ID6 A;  1ZR4 A;  3DEW A;  1VFC A;  5HOD A;  1YRN B;  2M9H A;  2XPW A;  2R93 J;  3A02 A;  4B4C A;  5J1R A;  3BR1 A;  3QPL A;  4A3L J;  3JRI A;  2LK2 A;  2JK3 A;  2R5Z B;  2JWT A;  1RKT A;  3RZD J;  1JUS A;  1ZKG A;  2HOA A;  1Y1V J;  4JX6 A;  1O4X A;  1MH3 A;  2G0E A;  3BG3 A;  1ETQ A;  1MBK A;  3L1P A;  2LVS A;  1JKP C;  1BW6 A;  1BA5 A;  2EZK A;  2EQR A;  1IRZ A;  2K9N A;  3BQY A;  4BY1 J;  1JT6 A;  2VUM J;  2ME0 A;  2TRT A;  3LNQ A;  1U9N A;  4M3F A;  2JA5 J;  2NS7 A;  5FKL A;  3QQA A;  3WHB A;  2DA7 A;  5EGO A;  4AUX A;  5EF6 A;  3F0C A;  3JRF A;  3HB9 A;  1NTC A;  2DA6 A;  1MBJ A;  4M3E A;  2NVX J;  5J1U A;  5F0F A;  3S1R J;  1HCR A;  3JRA A;  3I4M J;  1P7I A;  3S17 J;  2E19 A;  1MSE C;  1RPW A;  4JX5 A;  2JJ7 A;  1HDP A;  1FTT A;  3H0G J;  2LKX A;  2XB0 X;  2CQQ A;  2R7Z J;  5F27 A;  3GTG J;  5EGO B;  1OCP A;  1JTX A;  2WAQ N;  1OJL A;  3FKI J;  4G12 A;  3HM5 A;  5IPA A;  5K7F A;  3OIO A;  2O8K A;  3NAU A;  3A01 A;  3GTM J;  1PUF B;  3HEF A;  2YU9 J;  5EG0 A;  1Z77 A;  3IH3 A;  3JRC A;  4Y52 J;  3MN2 A;  4DW6 A;  2RAE A;  1JKR C;  4EEF G;  4A3E J;  4XRM A;  1I50 J;  2LLK A;  1FJL A;  3TED A;  1FTZ A;  2LP0 A;  2X48 A;  3ZQG A;  5EG0 B;  5FLV A;  1HOM A;  3BR6 A;  4UUS B;  1NK2 P;  2HQ5 A;  3RQI A;  3ZQH A;  1MBG A;  2NVQ J;  2WB1 N;  3OOU A;  1K83 J;  3HOZ J;  3Q0W A;  3BTI A;  1IGN A;  2R5Z A;  1ZGW A;  3GTP J;  3GTQ J;  2EBI A;  1F36 A;  5F04 A;  1IUF A;  2M34 A;  5E3O A;  2MW8 A;  2LY9 A;  4M3D A;  1HLV A;  2R5Y A;  5EZG A;  5FKM A;  2VKV A;  2JMW A;  1AU7 A;  2E1O A;  1IJW C;  1I6H J;  2DTZ A;  2M2E A;  2XB5 A;  2XGD A;  3BG5 A;  5F1J A;  4A3F J;  4RBO A;  3RKQ A;  4V2G A;  1DU6 A;  2CJJ A;  1LFB A;  1WCM J;  2QCO A;  1ITY A;  1BW5 A;  1GUU A;  4XRS G;  5FJ8 J;  2HDD A;  3O8G A;  3GBG A;  1RKW A;  3S15 J;  3TP0 A;  2NOG A;  2KT0 A;  1YRN A;  2DA2 A;  4BBS J;  2LR8 A;  2CUE A;  2DMT A;  3CQZ J;  4W1U A;  4A69 C;  1QRY A;  4DZJ A;  1W0T A;  1BL0 A;  3CDL A;  3FIW A;  3S1M J;  2R92 J;  2LFB A;  3JR9 A;  2NVT J;  3NAR A;  3OSF A;  1LFU P;  2D5V A;  4A3B J;  3D1N I;  1MBF A;  5K7H A;  4MLO A;  2CUF A;  3HGG A;  4C3J J;  4DYC A;  2EZH A;  2JA7 J;  4IHX A;  5IYC J;  3JRH A;  1QVU A;  1JKO C;  3HOX J;  2DMQ A;  4LOC A;  2FD5 A;  2B63 J;  2W48 A;  4V2F A;  1RES A;  5C4J J;  3PO3 J;  3SDG A;  4C2M J;  5EEA A;  1APL C;  3MKL A;  2ME6 A;  4A3J J;  3BQZ A;  1W0U A;  4BXX J;  3LSR A;  5DS9 A;  3JRG A;  4DYR A;  1QPI A;  4J19 A;  1MBE A;  2FJ1 A;  3QPS A;  2DA3 A;  2L7F P;  3LSG A;  1X58 A;  2JN6 A;  5E3L A;  1ZR2 A;  1ETW A;  3I4N J;  3BTJ A;  5F08 A;  3C2B A;  4XK4 A;  4Y7N J;  1VF9 A;  3HOY J;  5C4X J;  3TP3 A;  3GTK J;  1JKQ C;  2KDZ A;  3GTL J;  2PMZ N;  1H89 C;  3RZO J;  1F43 A;  3FIS A;  1IC8 A;  1MSF C;  4FE7 A;  2ECB A;  1RR7 A;  1MH4 A;  4I76 A;  2OF7 A;  3TW7 A;  2L9R A;  4A3K J;  2DA5 A;  3LOC A;  2R0Q C;  1XS9 A;  1PUF A;  4IHY A;  4JP0 A;  3SFI A;  5E3M A;  2L7M P;  2DA1 A;  1ZQ3 P;  1ETV A;  4DYQ A;  3IH4 A;  1ZTR A;  3HGY A;  3ZQF A;  1WPK A;  2O7O A;  3S1Q J;  2AO9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...