5EG0B

Hoxb13-meis1 heterodimer bound to dna
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
61
structure length
61
Chain Sequence
RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Homeobox protein Meis2
publication title Molecular basis of recognition of two distinct DNA sequences by a single transcription factor
rcsb
source organism Homo sapiens
total genus 16
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2015-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5eg0B00
2X9DA 3HGYA 1H8AC 1MBEA 2HI3A 2HDDA 2ID3A 3BR0A 1YRNB 2VUMJ 3ZQCA 1JTXA 1WH5A 2DN0A 1TC3C 2LVSA 4C3JJ 3ZQHA 2DA4A 2Y30A 4C3HJ 4A3JJ 1IRZA 1IDYA 3LNQA 2FX0A 3PO3J 2R5ZA 3HOVJ 5F08A 1POGA 3DEWA 2VKEA 1GV2A 4MFDA 4XRMA 4B1RA 1ORKA 1Y1WJ 1X58A 4V2GA 3CCYA 1Y1VJ 2EZKA 1U78A 1B72B 1U9OA 4ABZA 3F0CA 4BKXA 1UG2A 5EZHA 3G1OA 3HOUJ 1W0TA 2LTPA 1W0UA 2JN6A 3HOZJ 2LP0A 2DA2A 3I4NJ 5JLXA 4B3AA 2E2HJ 3BR2A 5F0HA 1AU7A 2OPTA 1VFCA 4A3LJ 4J19A 3A02A 4DYCA 2H1KA 3NAUA 1QRYA 4BY7J 3GTQJ 1X2MA 4DZPA 1WI3A 1FJLA 3G1LA 3GTKJ 1IGNA 1JT6A 2KDZA 1RKWA 3TP0A 2E1OA 2R5YA 2XB5A 3TW7A 1EF4A 4D5CA 5F1JA 3C2BA 4DZJA 2WV1A 3BG3A 4QTRA 1MNMC 5M5XJ 1GVDA 1JGGA 2L7ZA 1D5YA 2MG4A 1JKRC 1GUUA 1IV6A 2FQ4A 4BY1J 1WH7A 3DCFA 3PM1A 5EG0B 4A3DJ 4FE4A 3MKLA 4Y52J 1JUSA 3RKQA 1WPKA 4M3FA 1ZGWA 5F27A 1S7EA 2EZLA 2GBYA 3BT9A 3S15J 3BQYA 2DMUA 2MGQA 1NK2P 2R92J 3OOUA 4DYQA 2DTZA 3BTIA 1ZR4A 5E3MA 1AKHB 1U8BA 2JK3A 5EGOB 1MBGA 4A69C 3HBLA 4UUSB 4DYRA 3CDLA 1ETKA 4JX5A 1U9NA 5J1UA 5J1RA 2IAIA 5M5YJ 2GLOA 5C3EJ 1WGXA 4MO7A 3PO2J 3BTLA 4MLOA 2NS7A 3SFIA 2XPUA 2QCOA 3GTMJ 3B6AA 2DMPA 3VPRA 5BNGA 3ZQFA 1CQTA 5C4JJ 5FKOA 4RBOA 5EZGA 1VNDA 1ZTRA 2XGDA 2H8RA 2IEKA 4A3IJ 3JRGA 2M2EA 2XGEA 3MVPA 2L7MP 1QPIA 5J3LA 2JA8J 4D5FA 3Q0WA 1TWAJ 2JWTA 4M3DA 2R0QC 5GPCA 3JRBA 2WAQN 5EDNA 4A3FJ 5JLWA 3BR5A 4G12A 1HOMA 1RESA 2DA3A 2EBIA 3FK6A 3CQZJ 2P81A 1I50J 2DA7A 2O8KA 3S16J 1UHSA 2DA1A 1LFUP 5IYDJ 4XICA 2CQXA 3S1QJ 3QPLA 5EF6A 2EZIA 1QVUA 1MH4A 1FIAA 1FTZA 1AHDP 1FIPA 2YUSA 3HEFA 2JA6J 1SANA 3QPSA 1ZQ3P 1I6HJ 2HQ5A 5FLVA 4B4CA 1RPWA 3GBGA 2R5ZB 1G2HA 3LOCA 3FIWA 4X6AJ 2VI6A 3O8HA 2NVTJ 2X6OA 1WCMJ 2CU7A 1IDZA 1XG1A 2RAEA 2CQQA 2LFBA 3JRDA 1LE8A 1ETYA 5F0FA 5E3OA 4FTHA 3BQZA 2NVQJ 4XK4A 1HDDC 4A93J 3WHBA 5IP7J 3RQIA 2B63J 3S2DJ 2XRLA 5FJ8J 2DMTA 1I3QJ 2VKVA 2YS9A 4QSHA 4QIWN 5GP9A 2EQRA 2Y31A 3A01A 5M3FJ 3M4OJ 2XB0X 3GTPJ 1JJ8C 1TWFJ 1JT0A 1ZK8A 4JX4A 1ETWA 3K2AA 1FTTA 1BJZA 3GTGJ 5M3MJ 5IOZA 3CMYA 3ZOBA 5J1YA 2JJ7A 3ZQIA 1HLVA 1H88C 1B8IA 5FKKA 2MSYA 4AUXA 2YU9J 2R5YB 1MH3A 3BR3A 2K9NA 3JREA 1R9TJ 1GV5A 3S2HJ 2NS8A 1JTYA 1T56A 1VI0A 2O9LA 3ZQLA 3B6CA 2R93J 4JP0A 2LKXA 1ETQA 1MBKA 2XPVA 2TCTA 3HM5A 1APLC 4M3GA 3HOYJ 1OCPA 1ITYA 3A03A 1O4XA 1F36A 2JA5J 3FK7A 4IHXA 1FEXA 4CYCB 1A6IA 5K7ZA 3RZDJ 1PUFA 4UUTA 3GTOJ 2D5VA 5HODA 3W6VA 4M3EA 1LFBA 1IUFA 3IH2A 1JKPC 1BL0A 3Q0VA 1TWCJ 3SJMA 3Q3SA 4IHVA 3ZQGA 2Y2ZA 1ENHA 2E19A 5EGOA 1SFOJ 5IP6A 2E2JJ 4C2MJ 4UUSA 4I76A 3SDGA 4D7MA 3LSPA 2DJNA 4AC0A 2I10A 5FLMJ 2ECCA 4L5EA 2Y9ZA 4FE7A 1OCTC 3E7LA 5K7FA 3S1RJ 2M34A 2COBA 3JRIA 2CRGA 2XGCA 1UMQA 2HOSA 4RDUA 1Z0XA 2LD5A 2FD5A 4A3MJ 4XIDA 3JR9A 4A3GJ 2ME6A 2HXIA 3GTJJ 1Q1VA 2O7OA 2QF7A 1HF0A 5F04A 5E3LA 4FCYA 3Q0UA 2IBDA 3JRFA 2NOGA 3LSGA 4W1UA 4A3KJ 3JRAA 3L1PA 2JA7J 4W97A 5FKMA 3BR6A 2XPWA 3K7AJ 5IPAA 9ANTA 2ID6A 1RETA 4LOCA 1YRNA 4BBRJ 2NVYJ 3S17J 1XS9A 3BG5A 1RR7A 2HOTA 4A3BJ 2E2IJ 2LLKA 2G0EA 5IYBJ 2LR8A 1DU6A 1MBJA 2K9SA 4HNVA 1P7IA 3S1NJ 1MBHA 1OFCX 1IG7A 2L9RA 4DW6A 2XSDC 4JYKA 4IEJA 5E3NA 5F0CA 1DU0A 3IH3A 3RZOJ 1Z77A 5M5WJ 4NDLA 1LE8B 1GDTA 3IV5A 2HYJA 5C4XJ 1ETOA 2Y0SN 1P7JA 4S0HB 1B72A 2DMNA 5C44J 3BTJA 2EZHA 2FJ1A 3JRCA 4C3IJ 3A01B 2M0CA 4M3BA 4X1EA 3HOXJ 3HDDA 1IC8A 2AHQA 2TRTA 1T33A 5FKLA 5FKNA 2ME0A 2GM4A 1ETXA 3TEDA 4M6VA 5IP9J 1B8IB 5K7HA 2AO9A 3OSGA 3H3VK 2HXOA 1A5JA 3G1MA 4GFBA 2DMQA 3D1NI 1RKTA 2M9HA 4AYBN 1OJLA 2PMZN 1TWGJ 1X2NA 2ELKA 3O8GA 3TW6A 3H0GJ 2LY9A 2ZB9A 2KT0A 2R7ZJ 2ECBA 2N8GA 1TWHJ 1QVTA 1ETVA 2EH3A 3UKGA 4XRSG 3BR1A 5EG0A 3S14J 4IHWA 4A3EJ 3FISA 2MW8A 4IHYA 2HOAA 2LK2A 3TP3A 3BTCA 4I6ZA 1HCRA 3I4MJ 1JUPA 4BXXJ 1MSEC 1NK3P 1PUFB 5IOYA 2DA6A 1ZKGA 2M8GX 3WHCA 3HGGA 4D7NA 3QQAA 1JKOC 3BG9A 1H89C 3HB9A 2CJJA 1AKHA 2L0KA 2CUFA 3MN2A 4CYCA 1K61A 2X48A 1E3OC 5IYCJ 4Y7NJ 1BA5A 1BW6A 1BW5A 2DA5A 1MSFC 4EEFG 4FISA 3IH4A 4A3CJ 2CUEA 2WB1N 2VPRA 2NVXJ 2OF7A 1NTCA 3JRHA 1K83J 5DS9A 4BBSJ 1F43A 1VF9A 3NARA 5DTDA 3OSFA 3M3YJ 1JKQC 2JMWA 1IJWC 2Y9YA 4MIMA 1MBFA 4V2FA 4JX6A 2W48A 2K40A 4MFEA 4XRSA 3S1MJ 3GTLJ 1XC5A 3HOWJ 5GPAA 2L7FP 3FKIJ 3HKZN 5EYRA 3LSRA 1ZR2A 1JJ6C 1HDPA 1GT0C 2K9QA 3LSJA 1JUMA 5EEAA 3OIOA
chains in the Genus database with same CATH superfamily
3CUQB 1W36C 2I8DA 1JE8A 4EQQA 4Y4RA 1QO0D 4S05A 1PUEE 4CH7A 3RPQA 1JTXA 1X3UA 1WH5A 3QWLA 4FX4A 1FSHA 3ZQHA 4HDUA 4HDVA 4Y15A 1W36D 4BQAA 4BJ5C 1D8KA 3M1CA 1IRZA 1IDYA 2Q2EB 3LNQA 5H6RA 4RLQA 2R5ZA 2VB6A 3LL7A 1SFKA 3HOVJ 4AIJA 5TISC 5FROA 3PFYA 2DT6A 2QKLB 3KE2A 4WF2A 2VKEA 3H3ZA 3U2RA 4MFDA 4A6DA 4B1RA 2KKOA 3KETA 1Z6RA 2XAGA 4YFNF 3H5AA 2A05A 1Y1VJ 1YLFA 5HLIA 2QA4I 1KA8A 1KQ9A 3DKYA 4BKXA 1W5TA 3HPHA 3HYIA 5EZHA 1VZ0A 4BXFA 3HOUJ 4LMYA 3ECHA 4AD9A 1I27A 2LP0A 1ZGJA 2DA2A 1LDJA 2FQ3A 4Y33A 3F8NA 3HSEA 3VDXA 4IXAA 5DM7F 2YX4A 2IT0A 4ZYHA 3J7AY 4IHSA 1XGOA 1S3JA 3DTIA 3VFZA 4I98B 4KYWA 5J8CA 3A02A 4U0WA 4BJTA 2NVUB 4UV9A 1U5TC 4I2OA 1YX3A 1VQ4I 3G1LA 3GTKJ 1WQ2A 3ZMSA 4ZZDA 1B6AA 1BM9A 1JT6A 2JSPA 2BE5F 3T1BA 4U87A 2ZFWA 1YG2A 4AU7A 2HDCA 2HQAA 1PP7U 2PJRA 2UUZA 4KICA 3L2CA 1UAAA 2MG4A 2W24A 3LSKA 4NUBA 2L5QA 3RKQA 5AIPA 4RGUA 4PFPA 1K79A 3H5NA 2R7FA 1F4KA 2PEXA 3BT9A 3CP8A 4DIQA 3BJOA 1Y0UA 3BQYA 1O3RA 5GTHC 2DMUA 3PFIA 1P6RA 2ETHA 5EEHA 2E1NA 4HLYA 1QHGA 1U8BA 3RKXA 4WK8F 3KP5A 4A69C 4UUSB 3P5JA 5GADJ 2VODA 5J1UA 1TL8A 3OYHA 1U6GA 1H0MA 1MDMA 2B9SA 4QLCU 2G7UA 4BE0A 1ZGAA 4LLNA 4OOIA 3BPXA 5LRSA 1XSXA 2AXTC 4HV5A 3KP6A 3WE3A 3VPRA 5BNGA 3KLOA 1R4MB 2KMUA 2KP6A 4LB6B 3MCZA 3TO7A 4F92B 2MC3A 4ZTJA 3RDIA 4XLCA 1STZA 2L7MP 5FB2A 4D5FA 2JUCA 5CVUA 1KONA 1CF7B 4M9ZA 1QNTA 2WAFA 2WAQN 2A6TA 4YIIA 3RPUD 3BR5A 4A3FJ 1A04A 3OS0A 1XX5A 2DA3A 4KN7X 3VYSB 3BPVA 4IRGA 1I50J 3I59B 2O8KA 1F9NA 2Y48A 3RKYA 3S16J 1UHSA 3KP7A 3OS1A 4G7HF 2RKHA 4BQQA 2YU3A 1OCCH 1IXSB 3CCMI 4XICA 4KMUX 4L0ZB 3S1QJ 2VQLA 1J0RA 2GXAA 2PMUA 3ZCOA 4PJ0C 2P7CB 2J5OA 2EZIA 5KHDA 2R7WA 2CW8A 1FTZA 2FRHA 4XBFA 5CVJA 3BG6A 5HS8A 4AIHA 2YUSA 4FHTA 3BZCA 2JA6J 4KA4A 2HYFA 3SXYA 3BDDA 3CCQI 1ODDA 4B4CA 4A0XA 4DJAA 1LEBA 5E18F 1LFPA 4HX7A 3AL0C 2XUBA 3LSHA 5JI6A 1P4XA 1X1BA 4GGGA 2QQ9A 3FM3A 2CU7A 2PLYA 1XG1A 4L5JA 1MNEA 3NWTA 2CQQA 2QWWA 2WAEA 2BVMA 1ETYA 2NYXA 4IF4A 2NVQJ 5CVRA 1MKMA 2FBIA 4LK1F 4O5VA 5IP7J 1EV7A 2VXZA 5KCMA 3CMEI 1Q1HA 3IAS2 2PJPA 1SVLA 2ZNZA 3WGHA 1VQMI 1I3QJ 1DP7P 2IS2A 1FP2A 3R0AA 3DTEA 2R7DA 4XN0A 3ULQB 2VE8A 2X4HA 3Q5FA 4BXUA 2EFQA 3A01A 3E97A 2HS5A 3M4OJ 1TW2A 3ZMTA 3GVAA 3QU6A 2JVGA 3DPLC 1JT0A 4IQJA 1ZK8A 3SFZA 1H9GA 2X1EA 1ETWA 5HDNA 1R22A 1XGNA 5IT9K 4RA2A 1T8IA 1U0JA 2ZKZA 4UHTA 3WTZA 2PBIA 2LBFA 3QP5A 1HLVA 1B8IA 2BVLA 2DAOA 2P6TA 4HNUA 5FKKA 1S5LC 4AUXA 3RCOA 3FKJA 1R9TJ 2LC2A 4CYDA 1VI0A 3B6CA 3PIOF 1S8NA 2VJ5A 3V8LA 2XSJC 2TCTA 2X6WA 3ZXSA 1ON2A 2HKOA 3LAJA 3R61A 1PDNC 1H9TA 4HW0A 4RGSA 6PAXA 1ITYA 1O4XA 4PDKA 3OYNA 1F36A 1R23A 4A0ZA 4IHXA 1FEXA 2CV2A 4KIGA 4L5IA 1KYWA 1MMAA 3CCJI 4EGYA 5L3BA 3DU6A 4ZJZA 3PIPF 3J7ZI 3GW2A 4BE2A 2RREA 3FHNA 5B1BH 3EUHC 4BE1A 3SJMA 1QZYA 4KFCA 1R71A 2XAHA 3M8JA 2F4MB 3ZQGA 2K9LA 2Y2ZA 1ENHA 2E19A 4M6XA 3OYFA 4LITA 4BGDA 5ED4A 3KYLA 4CO8A 5CVVA 3SDGA 4D7MA 3MKWB 4AC0A 5FLMJ 2ECCA 1FOWA 5ILVA 1OCTC 3E7LA 3I9V2 5K7FA 2CYYA 2COBA 2BY3A 4IJAA 1I39A 1YS7A 1BI2A 3DQVC 1DGWY 2KLOA 1LVKA 3N05A 3W3CA 2M87A 3CTAA 2VASA 3UNGC 2X51A 4A2UA 2IXSA 2GOMA 2JPCA 3BJ6A 3FHZA 1VQ5I 2LH9A 2PX9A 4A3GJ 1VQOI 3F8CA 2QF7A 1HF0A 2K3FA 3GF2A 4BACA 2IBDA 3Q0UA 4A3KJ 3CD6I 4W97A 5BQTA 5FKMA 1FBQA 3I55I 5FFXA 9ANTA 4F55A 2IS4A 1RETA 2FA5A 4XNFA 1YRNA 1B9MA 3OYDA 2E1CA 3S17J 4MEYF 4RS8A 1RR7A 4U0YA 3M8EA 3OYCA 2HOTA 3C18A 3KZYA 4A3BJ 1Z21A 3S3OA 3RSNA 1UZCA 1J2XA 2P4WA 2LR8A 1HC8A 1MBJA 1MJBA 1HSJA 1V4RA 2K9SA 4F3QA 4HNVA 4DGWB 5GTIC 2H1LA 3OYKA 4JYKA 1QGPA 1TNSA 4IEJA 2XC7A 3LSTA 3RZOJ 2CH0A 5M5WJ 2HQRA 4OAZA 1LE8B 2QUFA 1X3ZB 4HEA2 4NQWA 1SEUA 1TP4A 2NAZA 4LIUA 3G71I 3V7RA 2HZTA 4B48A 2GIVA 2FBHA 5LRRA 2DJIA 1LVAA 1RC9A 3GO5A 4ZYGA 3WTWC 1T95A 2A5YB 3FM5A 2M0CA 2F2EA 1G59A 4X1EA 3HDDA 2IA1A 4IL6C 1N75A 1TT5B 1W4MA 2JRMA 4FQGA 3OY9A 1IC8A 2ZMEA 5HNHA 2TRTA 3CF5F 3RI4A 1WJEA 1V5EA 2YX7A 4DOZA 1OR7C 3OR1C 3NEUA 1K7AA 1TQPA 4ZDPA 3TEDA 3G4SI 2QLZA 3K4MA 4II2A 3G1MA 4BS9A 4GFBA 1WJFA 1RKTA 4AYBN 1AWCA 1LPQA 4XSXF 1ERDA 3DXJF 4JK1X 3F6OA 2ZB9A 3O3KA 3TDUC 5KAIC 3IUOA 2LYCA 1E3HA 3WU1B 3ECOA 4LLLA 1T08B 3BR1A 2VKHA 3CP2A 2V6CA 2QSGX 2DOFA 2MW8A 2HOAA 3TP3A 4I6ZA 1OCRH 1HCRA 4BNCA 4BXXJ 4KT6A 2BY2A 2JSCA 2XVCA 3SZTA 1PUFB 4NB5A 5BS6A 1LEAA 3RQ4A 2OUMA 1JHHA 1SD6A 1YW7A 3BG9A 1I1SA 1H89C 2CJJA 1AKHA 5TGTA 3MN2A 2CUFA 5D4RA 1TTYA 1USTA 3E6DA 4TV7A 5LBQA 3KP3A 2KIQA 1BA5A 1O7FA 2BEOA 3TQNA 3HIFA 2H09A 2KIUA 1J59A 4ANJA 3HRUA 1X4PA 2DTRA 2V1NA 4EJWA 2WB1N 3OR2C 2O61A 1NTCA 1D1BA 4Y3OA 4KIFA 5DS9A 4A0YA 1VF9A 2WADA 2ZXIA 4RAGA 1NG6A 3NARA 4XKCA 5DTDA 4AVPA 1FSEA 2JMWA 3K10A 2EIMH 4V2FA 3VWBA 3HHGA 4MFEA 5KNLA 3GTLJ 3CJTB 1EA3A 2CQKA 1IRXA 4B43A 4HAMA 1AA7A 3F9KA 3QOPA 2PI0A 1IZ1A 3FMQA 2V79A 1QA6A 2F5DA 5D8KB 3M9AA 4G8XA 3FMRA 2HI3A 3PQKA 4EM2A 3CMMA 4PCQA 2WBMA 1KU2A 3WTSC 4P5OA 3JAMK 2VOPA 4HF2A 2Z3YA 2DN0A 1Z3XA 1TC3C 2UWMA 2OA4A 2LVSA 3C2HA 1X1AA 2DA4A 2Y30A 4C3HJ 4HYEA 2E34A 3P9IA 4XORA 3PO3J 2VJ4A 2P6SA 4HQMA 1IV8A 3OOPA 3DP7A 3GFMA 4HNTA 2FNAA 2R4GA 4KJZA 4AM3A 2I5UA 4MQ9F 4CCKA 1YITI 3TKYA 5HOOA 1DPRA 4L9JA 1E17A 3I3LA 1NG7A 4EM1A 2EZKA 2XASA 3GMEA 1B72B 1U9OA 4ABZA 4EV0A 1MJAA 3DKWA 4XM3A 5TRDA 2R7TA 2IP2A 4DQ2A 3HRSA 1W0TA 3QP6A 3V7CA 4I0BA 1PVEA 4B3AA 2E2HJ 4YEJA 2MC4A 1ONVA 2CSOA 3BR2A 3E6MA 4M72A 5HLHA 2M4GA 2E1MC 1LDDA 2EV5A 3H35A 1Z6TA 2PG4A 5ICFA 4J19A 2QZ8A 1J75A 2O6GE 3NAUA 3L00A 4BY7J 3OIPA 1UB9A 1X2MA 4ITVA 4ZYDA 3GX4X 4ETSA 3KEOA 1WFXA 3JSPA 1BC7C 1B1BA 1HKQA 3H3UA 2VN2A 5CJ9A 1F5TA 2BZTA 3PL8A 4OWRB 2KDZA 2L9SA 1RKWA 2Z33A 2E1OA 2X0LA 2X85A 3TW7A 2PQ8A 1EF4A 2RC4A 1K4SA 5F1JA 2E7WA 3OYIA 2F6CA 4IQ4A 3BG3A 3DBHB 4ON0A 1GVDA 1QBJA 1QHHD 3G2BA 1IV6A 2DQRA 2JVHA 2EPFA 5J4VA 2V1XA 1WH7A 1SD7A 3I64A 4KNYA 4A3DJ 3ZPLA 4Y52J 1JUSA 1OCOH 1YJWI 1WPKA 5F27A 1S7EA 1SMTA 2EZLA 1IO2A 3DFGA 4AVZA 3PUBA 3BROA 3F6VA 2MGQA 1NK2P 2IVMA 1WWXA 3FXRA 4WXHA 3CCEI 2R92J 3BTIA 4PJJA 3I56I 3AG2H 2BY1A 3CUQC 1VQ9I 1MBGA 4MEXF 4DYRA 2FOKA 1QPMA 1ETKA 2HTSA 1AOYA 1U9NA 5J1RA 4E4HA 2WAQA 3H92A 5IT9Z 2E36A 3I54A 3S3NA 3W2AA 3BTLA 2HOEA 3SFIA 2XDVA 4UVBA 4XQFA 1ZG3A 3EQLF 3SEQA 1CQTA 2DMPA 3ZQFA 3FXMA 1OYYA 3QPHA 5C4JJ 4RBOA 5EZGA 1VNDA 4XLPF 4HOBA 2XGDA 2H8RA 2IEKA 2DI3A 3UR3C 3BLYA 4A3IJ 3TGNA 3JRGA 3HXLA 3MVPA 1EJ9A 2KZVA 2M3AA 2QSHX 3JRBA 5JLWA 4G12A 1HOMA 2VQGA 1S9HA 2A61A 3CLOA 2KZGA 1RESA 5D8LB 1G3TA 1BI3A 2X1DA 1LB2A 3E5UA 1BBYA 2R3SA 4ZYAA 3Q9VA 4IOCF 4PUSA 3MEXA 4PSWA 2B7EA 4ZDOA 2DA1A 2VQCA 1I5ZA 3QPLA 4NNJA 5EF6A 4XOPA 4F91B 3P7NA 3JTHA 3TL4X 1YW8A 1QVUA 2BV6A 3C7JA 4XMYA 1IAWA 3BP8A 4V19K 1FIAA 3CESA 1AHDP 2KJCA 3HEFA 4AIDA 3CZ6A 5FLVA 1VQ8I 2BHZA 4E7SA 4EJOA 1RPWA 3GBGA 4R79A 2Y0SA 2R5ZB 2NNYA 2DYRH 1G4DA 3FIWA 4UB6C 2VI6A 2VOOA 1IRGA 4ZH4F 1OPCA 2VIXA 2WY8Q 3GEZA 1IDZA 3ZN1A 2Z9OA 1G8XA 2RAEA 1YQAA 4OMYA 5F0FA 1OYIA 3BQZA 4KIBA 3AFHA 3A0BC 3RQIA 2O8XA 3S2DJ 3HHHA 3BZ6A 2DMTA 2FOWA 4QSHA 3DKXA 1OQYA 1J5YA 3O6BB 1A31A 2RGVA 4QIWN 2V1UA 1FWZA 4F7ZA 4Q4ZF 2K4JA 3SHFA 1KGSA 3E5QA 3GTPJ 2XRNA 2EJRA 2V9VA 3LWFA 5J8FA 4P1WA 1Z05A 4CCJA 3CCRI 2BOLA 2VPLA 4ESJA 1FTTA 2NNNA 3KX2A 5EJCA 1BJZA 3PNVA 3P9KA 5FRNA 2MH9A 3X2QH 5M3MJ 3H1CA 5IOZA 3CMYA 1XDSA 3CC4I 2JJ7A 2G9WA 4YRVA 4EJUA 1RUOA 3S2HJ 4PZJA 2VE9A 1GV5A 4NHJA 5JR3A 1HW2A 1O3TA 3T0YA 2PJRB 3IWFA 3RTRA 4JP0A 4M73A 4IZZA 2LKXA 2FE3A 5H20A 3CJNA 3HM5A 4M3GA 3HOYJ 2X6XA 1OCPA 3GLXA 2QBYA 1BI0A 2OD5A 3K1MA 2ESNA 2L54A 1HW5A 3K70C 3QYFA 1YTYA 2F5CA 1R1TA 4CSWA 3RZDJ 3ABMH 4S04A 1FOXA 3GWZA 3MKYB 4WXDA 3GTOJ 4HX8A 4BDZA 2D5VA 2MBFA 3K70D 2Q0OA 3ZP5A 2E5ZA 2HNHA 3LA7A 4BEHA 1TWCJ 2BW3B 1U5TA 4OIOF 1MDMB 2E71A 3W6JB 5IP6A 2E2JJ 1Y6IA 1X1PA 4UUSA 4E70A 1P92A 5B66C 3MAJA 2DJNA 4RB0A 3OYAA 1BI1A 4F93B 2M7BA 5ILSA 5K5QA 3S1RJ 2M34A 2XAUA 4U88A 3F8BA 1IN5A 2CRGA 1UG0A 4RDUA 3O2PE 2M4KA 3LSIA 1O7LA 5HDKA 3IRRA 4E7HA 3LQRA 2GZWA 1L3LA 2GXGA 2A68F 4YFXF 3W6KB 2ME6A 4KUMA 3GTJJ 2O7OA 4M71A 1ZRFA 5F04A 5E3LA 1XCBA 3BY6A 3JRAA 2JA7J 2QYOA 4HSTA 3CC2I 4CA0A 3HL2A 5LEKA 1QZZA 1X1DA 2Z2SB 4ENMA 4UVAA 3G3ZA 1RNLA 2P8TA 3ZQ7A 5HLGA 1S72I 4BBRJ 3VOEA 1N77A 3OS2A 1BOBA 3LAPA 1ZAOA 2VT3A 2E2IJ 1ZN2A 2EILH 1D0YA 5IYBJ 3R0JA 2R7OA 2EV0A 1P7IA 1ON1A 1MBHA 1OFCX 2EFPA 3U21A 4BJ6C 2L9RA 3LA2A 3U1KA 4DW6A 1IG7A 4UB8C 4XKBA 1S7OA 1N78A 1VQKI 5ILUA 3A0HC 5F0CA 1DU0A 2ISZA 3CJRB 5HLTA 3J7YJ 2Y75A 1XCVA 4HZFA 2HYJA 1YW9A 1MJ9A 1SMYF 2XAFA 2Y0SN 1P7JA 3HSFA 2DMNA 2DODA 5F64A 4MNUA 2EZHA 3E0JB 4AYBA 1UJ8A 1NH3A 2FBKA 2FJ1A 2WA0A 3A01B 4EMSA 1BR1A 1G3WA 3KPHA 2PMHA 2EV6A 3HOXJ 3VB2A 2UV1A 1BN5A 2OQRA 4A6EA 3HUGA 1R1VA 2GAUA 2K27A 4XSZF 4D1QA 1UHWA 4OINF 4M74A 4GCVA 3FXUA 2GM4A 2Z5UA 2VBZA 2YR2A 2ICWG 3LQQA 4XKVA 2LBFB 5IP9J 2GQQA 3L2RA 3JAMZ 1B8IB 1FY7A 4ENKA 5CLSA 3CLQA 4A5MA 1P9QC 3HTSB 4IVNA 5LHGA 3MKZA 2F4IA 2M30A 1OJLA 2PMZN 5LHHA 4BUPA 1BIAA 3TMOA 2O3FA 3KZIC 2KT0A 1A6QA 4ZTFA 3FBNB 2MABA 3VSKA 4WCGA 1TWHJ 3HSRA 2H94A 1ETVA 1XGSA 4LD5A 2KJBA 5EEGA 5EG0A 4IHWA 4AWXB 4A3EJ 2KRFA 3E1SA 4NC8A 4BHCA 5JHFA 3L9FA 4GXOA 1R49A 4BAYA 4LK0F 3I4MJ 2WB1A 1MSEC 3ZGKA 1NK3P 1SVOA 4L0YB 3B02A 2V9PA 3JCUC 1ZKGA 2J5PA 2M8GX 4XRFA 3WHCA 4D7NA 4DBRA 3PNTA 3U1DA 4N9IA 4R1HA 3QRFF 4RGRA 2BXZA 2VBYA 4PFOA 4ENNA 1E3OC 1Z7UA 3RIRA 4KN4X 1E0EA 3M1EA 2HVRA 1MSFC 4EEFG 4FISA 4UV8A 4Z2YA 3CDHA 4BHPA 2FU4A 1YIOA 4XOTA 4BBSJ 1F43A 2BYVE 2JRTA 3IRQA 4OIPF 2RVCA 5D5WB 3B73A 2CWEA 2MLKA 4HV6A 3E5XA 1MMDA 2LDUA 2KL4A 4MIMA 5BOXA 3K1PA 3WG7H 2K40A 4QPQA 1LUJB 2LY1A 3S1MJ 1FBUA 5GPAA 2ZJRF 3LFUA 2K7LA 2V4JC 5EYRA 1JJ6C 4XR6A 3ELKA 5AIQA 2X6YA 5JVGF 2K9QA 3ERMA 5LFAA 1EH8A 3RYRA 4UUVA 2BBYA 5FD5A 1SFUA 2OTJI 2M5WA 2TDXA 5E20A 5J6XA 2ZCWA 5EEAA 2FEZA 2F5FA 5J47A 2X9DA 1H8AC 4ESBA 1MBEA 2HDDA 3V42A 2CV1A 1YRNB 2VUMJ 1YJNI 2KQRA 2D45A 2A6EF 2MD5A 3AG1H 3RYPA 2H27A 4XLHA 4L9TA 3DTKA 2ZMEC 5DD4A 2ZJQF 2DOAA 2HU9A 3ERED 1KYZA 4C2TA 4HG2A 2FX0A 3QYEA 5IT3A 2F5EA 1KU7A 5F08A 1ZRCA 1POGA 2VJIA 2IS6A 4RB2C 5FO5A 3DEWA 2CQNA 4HLXA 1U2WA 1Z91A 4XRMA 5DCFA 1Y1WJ 3I58A 5LEJA 1X58A 4NQWB 5ERIA 4V2GA 3CCYA 4YELA 4PJMA 1A35A 3F22A 4CCMA 2QQAA 1FP1D 2D1HA 1U78A 1UG2A 3G1OA 3DLLF 1UFMA 3QOEA 2QQBA 2LTPA 1W0UA 2JN6A 1T6SA 3HOZJ 3I4NJ 2H6CA 1ACIA 1UCRA 4FT8A 4BH9A 2V1DA 5F0HA 2VC0A 3BWGA 2JZYA 2ZMEB 3BG7A 1VFCA 1IRFA 3H9JA 4A3LJ 2H1KA 2VLAA 2MLGA 3GTQJ 4B44A 3K4NA 3J80Z 1WI3A 1WJ5A 4XLNF 4XLFA 1MZBA 4J01A 1T0FC 1V55H 2X1CA 2Q1ZB 3TP0A 3D5LA 2R5YA 2VQHA 3WTUC 3QPTA 1TQMA 5H2FC 3C2BA 4DZJA 1RR8C 3GLLA 1MNMC 1VQLI 4J00A 1D5YA 1JKRC 2FQ4A 2V9KA 3WODF 3PM1A 4FE4A 1A36A 3TO9A 5AONA 3S32A 2UXXA 2XF6A 1V5FA 2O5RA 3KIOA 1FPQA 4M3FA 1ZGWA 2PFBA 3S15J 1XMAA 4N4OB 3OYLA 1B9NA 2Q8KA 4KMFA 2ZXWH 3KP2A 1SFXA 1IF1A 3OOUA 4DYQA 2DTZA 4FX0A 2DFEA 1HSTA 1ZR4A 2ZXJA 3F8MA 1AKHB 1HQCA 1EKEA 5EGOB 3ZMVA 3LA3A 4KT5C 1OR7A 2MYSA 3DV8A 2UXNA 1OCZH 1Z7LA 2CW7A 4CZZA 2A07F 3FXOA 4JX5A 3ZMZA 3CCVI 5HNFA 3ABLH 2DYSH 2O0YA 2Z1DA 5D4SA 1YJ9I 2GLOA 4Q48A 5E17F 1WGXA 5BPDA 1S6LA 3F72A 3PO2J 2AQFA 3H36A 4MLOA 4UXNA 2NS7A 2XPUA 4XL9A 5FLXZ 2QCOA 2Z99A 2Y69H 3B6AA 4JBAA 5L3EA 4IRIA 3FWEA 3GTMJ 3K2ZA 5CKTA 5JFRA 3J81Z 3HTUA 1ZTRA 4RMNA 1R6RA 1KU9A 2KPMA 1WJDA 5FFZA 3JW4A 2IPQX 5GAEJ 5E79C 4N0BA 2JA8J 2K85A 2CG4A 4M3DA 2M0MA 5DM6F 5GPCA 3J7AO 2EBIA 3MZ8A 3FK6A 4PK4A 4C30A 3CCUI 2P81A 4GRIA 3SZPA 3TOAA 4N4NB 1FOKA 2JA2A 1K6OA 4HA8A 4Q47A 2STWA 3DBRB 2CQXA 3JSOA 4PGGA 2QGUA 1BIBA 1MH4A 1FIPA 3H9GA 2DFHA 2HKXA 1K6YA 4JQFA 3QPSA 2OCCH 1O3QA 1C0WA 1ZQ3P 2HQ5A 3REOA 1ZREA 2NOJB 3AAFA 2VXDA 3T8RA 1DGRM 1LJ9A 3LOCA 4X6AJ 4O3MA 3O8HA 2CV0A 2YSRA 3I0TA 2NS0A 2P5VA 4UVCA 2XROA 1R00A 2NVTJ 2ELJA 4MTDA 1W5CC 1MGTA 2BXYA 1JHFA 2AXLA 1FYLA 2LFBA 3K4JA 1N25A 1BOAA 4CZCA 5FGMA 3JRDA 4FTHA 1HXDA 4XK4A 3HZJA 1HDDC 2AQEA 2XAJA 3WHBA 3D5SC 1RZ4A 2MFZA 3PSFA 1IW7F 4N9HA 2F48A 3L2WA 3A2KA 2XRLA 2VKVA 3HG9A 1W7PA 1J7KA 5M3FJ 1W1WE 4XLEA 4GDFA 4XKWA 2XB0X 1ZARA 2UZKA 1YYVA 5D5UB 2IGOA 4H0EA 2JTVA 1GXPA 4Q5SF 5K1YA 2CGPA 3K2AA 3COAC 2ZJPF 3C3WA 3KEQA 3KP4A 2PN6A 2K86A 5DV5A 3GCMA 3H5RA 3GTGJ 3ISPA 2XGXA 3ZQIA 4ZZLA 1WHUA 4GO1A 2MSYA 1FOYA 2KIFA 4R8HA 2YU9J 3VYUB 2M1BA 4U7DA 1WRJA 1MNDA 3MQ0A 2F5VA 3KFWX 4OIRF 3WTTC 1J9IA 2NS8A 1T56A 3AG3H 2O9LA 5LGNA 2BY0A 4G94A 2ZBKA 2R93J 1EH6A 2LSOA 3IHUA 1ETQA 1MBKA 3ZN0A 1ZG1A 2QVOA 2JQ7A 3ZR8X 3S3MA 1LQ1A 2W57A 4NBQA 2FNPA 3CUOA 2QKMB 2WV0A 3A03A 2KRCA 1SAUA 5A2QZ 1Z3YA 4G7ZF 4A12A 1UELB 2Z16A 1W5SA 3V8KA 4CYCB 1LDKB 5K7ZA 3H0DA 2R7RA 4RGXA 3LFKA 4BQOA 4E7IA 4UUTA 2HVQA 3MMYB 3MWMA 5J40A 5L3CA 3ZMDA 5HODA 4ASNA 3W6VA 4YIRX 3F21A 4P55A 1LFBA 3IH2A 1JKPC 2L9VA 1BL0A 3Q0VA 5GAGJ 3Q3SA 4IHVA 2L9NA 2CFOA 2LNBA 1T38A 3QAHA 4C2MJ 2V7FA 4Y13A 2CUJA 1XSDA 1X1CA 2I10A 3DPUA 2AS5F 2Y9ZA 5L3FA 3KEYA 4D0PA 4BL0B 2A69F 3JRIA 3PNYA 3S8PA 2XGCA 1R1UA 1UMQA 2KHMA 2HOSA 2HPIA 2HVSA 2IJLA 1Z0XA 5HS9A 2H8WA 5J4YA 2K4BA 4LG0A 3BCBA 2LKSA 4A3MJ 4XIDA 3JR9A 2W1OA 2HXIA 4I0AA 3HC7A 2OC6A 3K1NA 1Q1VA 5DCMA 3TBIA 4FCYA 1X19A 2NOGA 2XF5A 3LSGA 4W1UA 1K78A 3L1PA 2R7UA 2OZUA 3ABKH 3BR6A 3J80K 3JTGA 3EUAA 2D2WA 4HQEA 4B47A 1P2FA 2DK8A 3CUQA 2DO7A 2DT5A 2CW0F 3LSMA 3VYTB 4X0GA 4CHUA 2L4AA 4LOCA 4E7LA 1IXRC 2FXAA 2KIMA 2NVYJ 1XS9A 3QU3A 3D0SA 4HRIA 3K4KA 3CC7I 3I53A 2EA4A 3K69A 2Q2EA 3S1NJ 1HKSA 2ELHA 2XSDC 2W00A 3EUKL 3BOQA 5E3NA 2DPUA 3IH3A 4NDLA 3WU2C 3ABTA 1FLIA 4JOMA 3IV5A 5C4XJ 1TT0A 1VQ7I 2EA2A 4S0HB 1GLNA 2FUG2 2ZSHB 4HSRA 3JRCA 2PMZA 3BJAA 4C3IJ 2V26A 4M3BA 1EH7A 3DWLE 2QEXI 3NWSA 1R58A 2OU2A 1V5GA 1QZEA 5FLXK 2L2OA 4IOAF 5FKLA 2FF4A 1T33A 3I4PA 5D5VB 4LB5A 2ME0A 4II3A 3J81K 5CYVA 4YIFA 2H6BA 5K7HA 3OSGA 2HXOA 1A5JA 5JVTA 1KZHA 3E3VA 4HPQA 1HW1A 1TWGJ 1R7JA 2ZXHA 2ELKA 3AKZA 4DNCA 4L9NA 2EINH 2LY9A 3MFKA 5B3SH 2VKDA 1FBSA 2ECBA 4XONA 4RLFA 1ZELA 2RN7A 1TBXA 2QBYB 1JGSA 3S14J 3CJQB 1MMGA 4EM0B 4IHYA 3OYJA 2LK2A 2Y0MA 3BTCA 4U0VA 2ZC2A 1ZLKA 2QM3A 3K0LA 1LKXA 2CO5A 2DA6A 4G6TB 3HGGA 1QU3A 3CCSI 4PJNA 1JKOC 1IXCA 2EFOA 3HB9A 3WTYC 2K02A 2L0KA 3FXQA 3N97A 2WWYA 4UY8I 1KQ8A 1K61A 2X48A 3QODA 1M1EB 3DF8A 4CCOA 4E7ZA 4BEHB 1YS6A 1U5TB 2LMDA 5KK1A 4Y7NJ 2NXNB 5LGTA 3HRTA 2LF7A 1WSUA 1FYKA 1HA8A 3OYBA 5D6FA 4A3CJ 2CUEA 2MA3A 1OKRA 2VPRA 3OWTA 2BW3A 3FZVA 1E3PA 3R6SA 3VSLA 1HBXG 2NVXJ 2VONA 2CS3A 2XAQA 3KLNA 3OYEA 2OZ6A 1T39A 1PYVA 1YI2I 1RUNA 2R7QA 1WI9A 3KYDB 1JKQC 2ZFUA 2W4SA 4XN3A 2Y9YA 1IJWC 4JX6A 1VQ6I 2W25A 3I71A 4XRSA 1ULYA 2GA1A 1Z1DA 3GZNB 3CMAI 1HKTA 4C2UA 1G3SA 3HOWJ 1CF7A 1D1CA 2OBPA 4YG2F 3HKZN 4IO9F 2QSFX 3LSRA 1ZR2A 1KU3A 2ZJ2A 2XF7A 1HDPA 3DEUA 3I59A 2D1VA 1SFEA 2HGCA 2KFDA 2JUGA 1D0XA 1V3FA 3FXJA 5GAHJ 1R5GA 2RNJA 3VYRB 4RAFA 4BDYA 3EYYA 3HGYA 4B09A 2ID3A 3BR0A 4WWCA 3ZQCA 1SD5A 3GFLA 5ICGA 4EATA 4B8XA 3U9GA 1RRJA 2IRFG 5HDGA 4UNOA 3SYTA 4C3JJ 1BJAA 4RAYA 1SC7A 3RPUA 1YOVB 3IKTA 2LKPA 2HQNA 3CDIA 3RJPA 1IN4A 4A3JJ 2YPRA 3M8FA 1XB4A 3WGIA 2LREA 5A2QK 3H9QA 2WY7Q 2ADUA 4CXFA 3V4GA 2COMA 3FMSA 1GV2A 4OIQF 4LJZF 1SVMA 3S93A 1XMXA 4F52A 2XV4S 3EYIA 1ORKA 1GVJA 2P0WA 3DBLB 1MIJA 3F3XA 3F8FA 4FETA 4KISA 4QPOA 3F0CA 3OMYA 2DW4A 3TO6A 2W7NA 3C1DA 3L7WA 1U3EM 3E6CC 1V54H 5JLXA 1Y39A 2XHKA 3HUGB 1DQUA 2QENA 1AU7A 3ZMUA 2V6EA 1O57A 2OPTA 1CGPA 2A6HF 4IX7A 1OMIA 1XSVA 2K9MA 3SEZA 1J09A 4C9YA 4DYCA 1WJAA 2W85A 2HPMA 1QRYA 4HBLA 2E5NA 4DZPA 1MMSA 2KRHA 2BHYA 3OYGA 3ONQA 1FJLA 1FMWA 3KYCB 4PGHA 4IHTA 1IGNA 4CGZA 4M9XA 2BGCA 1QQIA 4LIVA 3AL0B 4A5NA 2XB5A 5E1WA 1YE9A 1OISA 4D5CA 3DLAA 1OYWA 4RB1A 2WV1A 4QTRA 3OYMA 5M5XJ 2HEOA 1JGGA 2L7ZA 3HJEA 3W2WA 1GUUA 4BY1J 3DCFA 5EG0B 4G6DA 3MKLA 2HZDA 2ESHA 2GBYA 4CDGA 5HVQC 5L3DA 1YIJI 2DFIA 3DEEA 1XPXA 1XTAA 1F1ZA 5D5XB 1P4WA 5E3MA 2DXIA 2JK3A 4E6KG 2NRAC 2OV7A 3HBLA 3ROUA 3CDLA 4NC7A 3I5UA 1BR2A 3T8TA 1FMVA 1WVRA 4L18B 2IAIA 5M5YJ 1MW7A 4OU0A 3E6BA 4E7KA 5C3EJ 2L02A 4LFUA 2WC2A 2WTEA 4MO7A 5LD2C 1ZLJA 3SZGA 2DU9A 4E7JA 3L09A 5FKOA 2K3PA 2EB7A 4LG3A 3R4KA 4OMZA 3HOSA 4EJVA 2RQPA 3PJRA 3IL2A 2VBXA 1DP3A 4O6JA 2M2EA 2XGEA 2R7XA 1QPIA 5J3LA 3MZYA 3Q0WA 1TWAJ 2JWTA 5DYMA 2R0QC 1DUXC 5EDNA 2DQLA 3SQNA 5H6QA 1Z9CA 1Y8RB 3S2WA 3CQZJ 2ISYA 2DA7A 3IP4B 4BQNA 1UHMA 1S7AA 2DOEA 4ESFA 2EIKH 3EUHA 2GA2A 1ZRDA 2IA2A 3SDBA 1LFUP 1D3YA 2EFWA 2CFXA 5IYDJ 5E1XA 5E8IA 5L3GA 1E2XA 2E35A 1WJCA 3OL3A 2JT1A 4HF0A 5CQEA 3MD2A 2GWRA 4NC6A 4IKFA 3GUDA 2HWVA 2VC1A 3HOTA 2DK5A 1SANA 1MMNA 4Y17A 1I6HJ 2DDAA 3NRVA 1G2HA 2IW5A 2FMYA 3FXKA 2ZNYA 3D5RC 4MHGA 3ASOH 4U7BA 1YHQI 3QYBA 1B59A 2X6OA 1R5ID 1WCMJ 5K5RA 5B1AH 1DDNA 1LE8A 5E3OA 3WGGA 1REPC 4A93J 3G73A 4CCNA 5CPRB 1FX7A 2B63J 2L3DA 2R7VA 5FJ8J 1JXSA 2YS9A 4L9VA 1WJBA 2XKPA 1KQ0A 2L7KA 4CICA 1RI7A 5GP9A 2EQRA 2Y31A 3KZZA 3P9CA 2LRDA 2M7AA 2L01A 1JJ8C 1TWFJ 3MZHA 4JX4A 2HR3A 2XKOA 1RIOH 2OQGA 2LY2A 2EFNA 3CO7C 3ZOBA 5J1YA 3HPGA 1H88C 4G6QA 3A4CA 4I09A 3CO6C 3CF2A 3AG4H 5TJJA 3Q9SA 3TDZC 2R5YB 2DFFA 1MH3A 2QQ8A 3BR3A 1SD4A 4EGZA 2K9NA 3WU0A 3JREA 1JTYA 2K5CA 3R60A 3ZQLA 2GIZA 1FYMA 2XPVA 2GOXB 3K4CA 1APLC 3HRMA 2HTJA 2A3SA 1K4TA 4I02A 2EK5A 1Y8QB 4QWQA 1S29A 4GYGA 4MTEA 3F23A 2JA5J 1X3WB 4D9JA 4XLAA 3FK7A 5DD8A 2STTA 1TLHB 2CMPA 3LMMA 2IGNA 1IN8A 1BR4A 1A6IA 1FC3A 1PUFA 2JPBA 4HF1A 1IN7A 3DPTA 3GYHX 3OL4A 2KISA 4H4KC 3ABUA 3FF5A 1D0ZA 4M3EA 2W84A 5FRMA 1IUFA 1LNWA 2OJED 4P9UA 5DUIA 2R7SA 5EGOA 1SFOJ 5D6EA 5FD6A 4I76A 3LSPA 1TW3A 4CCLA 1T0FA 2ZO4A 1X4OA 1ZYRF 4L5EA 3VODA 4FE7A 3WTXC 4EVIA 3BZKA 2DLLA 1O3SA 1TZLA 1D5VA 3BC8A 3PUFA 4AIKA 4YFKF 4LGWA 1IUYA 3RKWA 2LG4A 2OCEA 2LD5A 2DPDA 2FD5A 2IGMA 3K4LA 2DDBA 3WE2A 5E1ZB 3G6EI 5BMZA 5DUKA 1MD0A 3K6GA 1GXQA 3TOBA 5K5OA 4BU2A 2FSWA 3ML6A 5KVRA 3GFJA 3FDYA 1SAXA 3JRFA 1FT9A 2DCEA 2HYGD 2FMLA 2CUZA 4ENJA 5LLQA 4G9YA 2RDPA 2XPWA 1T98A 3K7AJ 5HS7A 5IPAA 2ID6A 1T2KA 5F1RA 5JHUA 3PQJA 4KITB 1D1AA 3WTVC 3BG5A 3NQOA 5F6FA 4RB3C 3GXOA 2LLKA 2VBWA 2G0EA 3PSIA 5LHIA 1DU6A 1W7PD 1XN7A 2ZSIB 4M6YA 4P96A 2ACJA 1WKMA 1ZH5A 2E60A 2OAZA 1FZPB 1YX5A 2DBBA 4OAYA 1Z77A 2XIGA 2MH2A 3M07A 2F4OB 1GDTA 1P4AA 1WZ2A 1G6NA 1ETOA 1YO5C 4WX9A 1U8RA 2IA0A 2RNGA 3EETA 3VEPA 1YFHA 1B72A 4MGRA 4I99C 3ASNH 4ZC3A 5C44J 3ZRGA 3BTJA 1FNNA 1W7PB 3L2UA 4P9FA 2RV8A 2OTLI 3ZQQA 2LOOA 1BC8C 2MD0A 5ICEA 1GHCA 5KAFC 3DU5A 3ESWB 1XGMA 2IGKA 2LF8A 3IKVA 1VTNC 4MQVA 2GXBA 3GZ5A 3GFIA 5BPIA 5DDGA 3IAM2 4ZYEA 4IRHA 2DT7B 5CVIA 4I7HA 1I1GA 2AHQA 5FKNA 4FASD 1ZG5A 1DPUA 2O03A 1ETXA 1D8JA 1OLTA 4M6VA 3L2QA 3FXLA 2L4MA 2AO9A 3H3VK 1L0OC 1G3YA 3OV8A 2DMQA 3D1NI 2M9HA 3K4BA 3CCLI 1X2NA 4RM2A 3O8GA 3FBIB 5CQGA 5ICCA 4Z6YA 3TW6A 5B5EC 1B4AA 3A1YA 3H0GJ 3EDPA 2R7ZJ 3GZ6A 2P5KA 2KDOA 2N8GA 1VQNI 1QVTA 3N4MA 5IY5H 2EH3A 3OIQA 4XRSG 4ZDLA 2CQ7A 3UKGA 1Z67A 2HDWA 4M9SA 3FISA 4EJTA 4KDPA 3WG9A 2VJJA 3L2VA 3V7SA 1Y56A 2M45A 1JUPA 1PJRA 2B0LA 2E7XA 5IOYA 3K9TA 3V8JA 3FX3A 2VT2A 3EPZA 1XDUA 4K2EA 4CUGA 4B3XA 3QQAA 1Y0NA 2E1MB 4GYIA 4PSXA 1XMKA 3KCCA 2A5WA 1R4NB 4CYCA 1PP8F 1NHAA 2W82A 5IYCJ 1ZHFA 1BW6A 3HKZA 3IWZA 5E8GA 1BW5A 1IN6A 2DA5A 2P5LC 2P7VB 3IH4A 1JI8A 1I6XA 2OF7A 4BHBA 4G7OF 1TNTA 3JRHA 1K83J 4RAZA 2HFHA 2EWNA 3C2GA 3M7GA 3OSFA 3M3YJ 1TQIA 4WXCA 2IS1A 1MBFA 4HX4A 4LG0B 2W48A 5LGUA 3BCAA 2C6YA 4BYYA 2VL8A 4RM3A 1R36A 1VQPI 5DEQA 1XC5A 1XD7A 2RQQA 2L7FP 3FKIJ 5DCMB 4PJLA 3W2VA 4DBQA 3T5XA 1R5HA 2EIJH 2M8EA 1GT0C 3LSJA 1K78B 4LLGF 1I3AA 1JUMA 1USSA 3IC7A 4I01A 2G7HA 3OIOA 4IPAA
chains in the Genus database with same CATH topology
2X9DA 3HGYA 1H8AC 1MBEA 2HI3A 2HDDA 2ID3A 3BR0A 1YRNB 2VUMJ 3ZQCA 1JTXA 1WH5A 2DN0A 1TC3C 2LVSA 4C3JJ 3ZQHA 2DA4A 2Y30A 4C3HJ 4A3JJ 1IRZA 1IDYA 3LNQA 2FX0A 3PO3J 2R5ZA 3HOVJ 5F08A 1POGA 3DEWA 2VKEA 1GV2A 4MFDA 4XRMA 4B1RA 1ORKA 1Y1WJ 1X58A 4V2GA 3CCYA 1Y1VJ 2EZKA 1U78A 1B72B 1U9OA 4ABZA 3F0CA 4BKXA 1UG2A 5EZHA 3G1OA 3HOUJ 1W0TA 2LTPA 1W0UA 2JN6A 3HOZJ 2LP0A 2DA2A 3I4NJ 5JLXA 4B3AA 2E2HJ 3BR2A 5F0HA 1AU7A 2OPTA 1VFCA 4A3LJ 4J19A 3A02A 4DYCA 2H1KA 3NAUA 1QRYA 4BY7J 3GTQJ 1X2MA 4DZPA 1WI3A 1FJLA 3G1LA 3GTKJ 1IGNA 1JT6A 2KDZA 1RKWA 3TP0A 2E1OA 2R5YA 2XB5A 3TW7A 1EF4A 4D5CA 5F1JA 3C2BA 4DZJA 2WV1A 3BG3A 4QTRA 1MNMC 5M5XJ 1GVDA 1JGGA 2L7ZA 1D5YA 2MG4A 1JKRC 1GUUA 1IV6A 2FQ4A 4BY1J 1WH7A 3DCFA 3PM1A 5EG0B 4A3DJ 4FE4A 3MKLA 4Y52J 1JUSA 3RKQA 1WPKA 4M3FA 1ZGWA 5F27A 1S7EA 2EZLA 2GBYA 3BT9A 3S15J 3BQYA 2DMUA 2MGQA 1NK2P 2R92J 3OOUA 4DYQA 2DTZA 3BTIA 1ZR4A 5E3MA 1AKHB 1U8BA 2JK3A 5EGOB 1MBGA 4A69C 3HBLA 4UUSB 4DYRA 3CDLA 1ETKA 4JX5A 1U9NA 5J1UA 5J1RA 2IAIA 5M5YJ 2GLOA 5C3EJ 1WGXA 4MO7A 3PO2J 3BTLA 4MLOA 2NS7A 3SFIA 2XPUA 2QCOA 3GTMJ 3B6AA 2DMPA 3VPRA 5BNGA 3ZQFA 1CQTA 5C4JJ 5FKOA 4RBOA 5EZGA 1VNDA 1ZTRA 2XGDA 2H8RA 2IEKA 4A3IJ 3JRGA 2M2EA 2XGEA 3MVPA 2L7MP 1QPIA 5J3LA 2JA8J 4D5FA 3Q0WA 1TWAJ 2JWTA 4M3DA 2R0QC 5GPCA 3JRBA 2WAQN 5EDNA 4A3FJ 5JLWA 3BR5A 4G12A 1HOMA 1RESA 2DA3A 2EBIA 3FK6A 3CQZJ 2P81A 1I50J 2DA7A 2O8KA 3S16J 1UHSA 2DA1A 1LFUP 5IYDJ 4XICA 2CQXA 3S1QJ 3QPLA 5EF6A 2EZIA 1QVUA 1MH4A 1FIAA 1FTZA 1AHDP 1FIPA 2YUSA 3HEFA 2JA6J 1SANA 3QPSA 1ZQ3P 1I6HJ 2HQ5A 5FLVA 4B4CA 1RPWA 3GBGA 2R5ZB 1G2HA 3LOCA 3FIWA 4X6AJ 2VI6A 3O8HA 2NVTJ 2X6OA 1WCMJ 2CU7A 1IDZA 1XG1A 2RAEA 2CQQA 2LFBA 3JRDA 1LE8A 1ETYA 5F0FA 5E3OA 4FTHA 3BQZA 2NVQJ 4XK4A 1HDDC 4A93J 3WHBA 5IP7J 3RQIA 2B63J 3S2DJ 2XRLA 5FJ8J 2DMTA 1I3QJ 2VKVA 2YS9A 4QSHA 4QIWN 5GP9A 2EQRA 2Y31A 3A01A 5M3FJ 3M4OJ 2XB0X 3GTPJ 1JJ8C 1TWFJ 1JT0A 1ZK8A 4JX4A 1ETWA 3K2AA 1FTTA 1BJZA 3GTGJ 5M3MJ 5IOZA 3CMYA 3ZOBA 5J1YA 2JJ7A 3ZQIA 1HLVA 1H88C 1B8IA 5FKKA 2MSYA 4AUXA 2YU9J 2R5YB 1MH3A 3BR3A 2K9NA 3JREA 1R9TJ 1GV5A 3S2HJ 2NS8A 1JTYA 1T56A 1VI0A 2O9LA 3ZQLA 3B6CA 2R93J 4JP0A 2LKXA 1ETQA 1MBKA 2XPVA 2TCTA 3HM5A 1APLC 4M3GA 3HOYJ 1OCPA 1ITYA 3A03A 1O4XA 1F36A 2JA5J 3FK7A 4IHXA 1FEXA 4CYCB 1A6IA 5K7ZA 3RZDJ 1PUFA 4UUTA 3GTOJ 2D5VA 5HODA 3W6VA 4M3EA 1LFBA 1IUFA 3IH2A 1JKPC 1BL0A 3Q0VA 1TWCJ 3SJMA 3Q3SA 4IHVA 3ZQGA 2Y2ZA 1ENHA 2E19A 5EGOA 1SFOJ 5IP6A 2E2JJ 4C2MJ 4UUSA 4I76A 3SDGA 4D7MA 3LSPA 2DJNA 4AC0A 2I10A 5FLMJ 2ECCA 4L5EA 2Y9ZA 4FE7A 1OCTC 3E7LA 5K7FA 3S1RJ 2M34A 2COBA 3JRIA 2CRGA 2XGCA 1UMQA 2HOSA 4RDUA 1Z0XA 2LD5A 2FD5A 4A3MJ 4XIDA 3JR9A 4A3GJ 2ME6A 2HXIA 3GTJJ 1Q1VA 2O7OA 2QF7A 1HF0A 5F04A 5E3LA 4FCYA 3Q0UA 2IBDA 3JRFA 2NOGA 3LSGA 4W1UA 4A3KJ 3JRAA 3L1PA 2JA7J 4W97A 5FKMA 3BR6A 2XPWA 3K7AJ 5IPAA 9ANTA 2ID6A 1RETA 4LOCA 1YRNA 4BBRJ 2NVYJ 3S17J 1XS9A 3BG5A 1RR7A 2HOTA 4A3BJ 2E2IJ 2LLKA 2G0EA 5IYBJ 2LR8A 1DU6A 1MBJA 2K9SA 4HNVA 1P7IA 3S1NJ 1MBHA 1OFCX 1IG7A 2L9RA 4DW6A 2XSDC 4JYKA 4IEJA 5E3NA 5F0CA 1DU0A 3IH3A 3RZOJ 1Z77A 5M5WJ 4NDLA 1LE8B 1GDTA 3IV5A 2HYJA 5C4XJ 1ETOA 2Y0SN 1P7JA 4S0HB 1B72A 2DMNA 5C44J 3BTJA 2EZHA 2FJ1A 3JRCA 4C3IJ 3A01B 2M0CA 4M3BA 4X1EA 3HOXJ 3HDDA 1IC8A 2AHQA 2TRTA 1T33A 5FKLA 5FKNA 2ME0A 2GM4A 1ETXA 3TEDA 4M6VA 5IP9J 1B8IB 5K7HA 2AO9A 3OSGA 3H3VK 2HXOA 1A5JA 3G1MA 4GFBA 2DMQA 3D1NI 1RKTA 2M9HA 4AYBN 1OJLA 2PMZN 1TWGJ 1X2NA 2ELKA 3O8GA 3TW6A 3H0GJ 2LY9A 2ZB9A 2KT0A 2R7ZJ 2ECBA 2N8GA 1TWHJ 1QVTA 1ETVA 2EH3A 3UKGA 4XRSG 3BR1A 5EG0A 3S14J 4IHWA 4A3EJ 3FISA 2MW8A 4IHYA 2HOAA 2LK2A 3TP3A 3BTCA 4I6ZA 1HCRA 3I4MJ 1JUPA 4BXXJ 1MSEC 1NK3P 1PUFB 5IOYA 2DA6A 1ZKGA 2M8GX 3WHCA 3HGGA 4D7NA 3QQAA 1JKOC 3BG9A 1H89C 3HB9A 2CJJA 1AKHA 2L0KA 2CUFA 3MN2A 4CYCA 1K61A 2X48A 1E3OC 5IYCJ 4Y7NJ 1BA5A 1BW6A 1BW5A 2DA5A 1MSFC 4EEFG 4FISA 3IH4A 4A3CJ 2CUEA 2WB1N 2VPRA 2NVXJ 2OF7A 1NTCA 3JRHA 1K83J 5DS9A 4BBSJ 1F43A 1VF9A 3NARA 5DTDA 3OSFA 3M3YJ 1JKQC 2JMWA 1IJWC 2Y9YA 4MIMA 1MBFA 4V2FA 4JX6A 2W48A 2K40A 4MFEA 4XRSA 3S1MJ 3GTLJ 1XC5A 3HOWJ 5GPAA 2L7FP 3FKIJ 3HKZN 5EYRA 3LSRA 1ZR2A 1JJ6C 1HDPA 1GT0C 2K9QA 3LSJA 1JUMA 5EEAA 3OIOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X9D A;  3HGY A;  1H8A C;  1MBE A;  2HI3 A;  2HDD A;  2ID3 A;  3BR0 A;  1YRN B;  2VUM J;  3ZQC A;  1JTX A;  1WH5 A;  2DN0 A;  1TC3 C;  2LVS A;  4C3J J;  3ZQH A;  2DA4 A;  2Y30 A;  4C3H J;  4A3J J;  1IRZ A;  1IDY A;  3LNQ A;  2FX0 A;  3PO3 J;  2R5Z A;  3HOV J;  5F08 A;  1POG A;  3DEW A;  2VKE A;  1GV2 A;  4MFD A;  4XRM A;  4B1R A;  1ORK A;  1Y1W J;  1X58 A;  4V2G A;  3CCY A;  1Y1V J;  2EZK A;  1U78 A;  1B72 B;  1U9O A;  4ABZ A;  3F0C A;  4BKX A;  1UG2 A;  5EZH A;  3G1O A;  3HOU J;  1W0T A;  2LTP A;  1W0U A;  2JN6 A;  3HOZ J;  2LP0 A;  2DA2 A;  3I4N J;  5JLX A;  4B3A A;  2E2H J;  3BR2 A;  5F0H A;  1AU7 A;  2OPT A;  1VFC A;  4A3L J;  4J19 A;  3A02 A;  4DYC A;  2H1K A;  3NAU A;  1QRY A;  4BY7 J;  3GTQ J;  1X2M A;  4DZP A;  1WI3 A;  1FJL A;  3G1L A;  3GTK J;  1IGN A;  1JT6 A;  2KDZ A;  1RKW A;  3TP0 A;  2E1O A;  2R5Y A;  2XB5 A;  3TW7 A;  1EF4 A;  4D5C A;  5F1J A;  3C2B A;  4DZJ A;  2WV1 A;  3BG3 A;  4QTR A;  1MNM C;  5M5X J;  1GVD A;  1JGG A;  2L7Z A;  1D5Y A;  2MG4 A;  1JKR C;  1GUU A;  1IV6 A;  2FQ4 A;  4BY1 J;  1WH7 A;  3DCF A;  3PM1 A;  5EG0 B;  4A3D J;  4FE4 A;  3MKL A;  4Y52 J;  1JUS A;  3RKQ A;  1WPK A;  4M3F A;  1ZGW A;  5F27 A;  1S7E A;  2EZL A;  2GBY A;  3BT9 A;  3S15 J;  3BQY A;  2DMU A;  2MGQ A;  1NK2 P;  2R92 J;  3OOU A;  4DYQ A;  2DTZ A;  3BTI A;  1ZR4 A;  5E3M A;  1AKH B;  1U8B A;  2JK3 A;  5EGO B;  1MBG A;  4A69 C;  3HBL A;  4UUS B;  4DYR A;  3CDL A;  1ETK A;  4JX5 A;  1U9N A;  5J1U A;  5J1R A;  2IAI A;  5M5Y J;  2GLO A;  5C3E J;  1WGX A;  4MO7 A;  3PO2 J;  3BTL A;  4MLO A;  2NS7 A;  3SFI A;  2XPU A;  2QCO A;  3GTM J;  3B6A A;  2DMP A;  3VPR A;  5BNG A;  3ZQF A;  1CQT A;  5C4J J;  5FKO A;  4RBO A;  5EZG A;  1VND A;  1ZTR A;  2XGD A;  2H8R A;  2IEK A;  4A3I J;  3JRG A;  2M2E A;  2XGE A;  3MVP A;  2L7M P;  1QPI A;  5J3L A;  2JA8 J;  4D5F A;  3Q0W A;  1TWA J;  2JWT A;  4M3D A;  2R0Q C;  5GPC A;  3JRB A;  2WAQ N;  5EDN A;  4A3F J;  5JLW A;  3BR5 A;  4G12 A;  1HOM A;  1RES A;  2DA3 A;  2EBI A;  3FK6 A;  3CQZ J;  2P81 A;  1I50 J;  2DA7 A;  2O8K A;  3S16 J;  1UHS A;  2DA1 A;  1LFU P;  5IYD J;  4XIC A;  2CQX A;  3S1Q J;  3QPL A;  5EF6 A;  2EZI A;  1QVU A;  1MH4 A;  1FIA A;  1FTZ A;  1AHD P;  1FIP A;  2YUS A;  3HEF A;  2JA6 J;  1SAN A;  3QPS A;  1ZQ3 P;  1I6H J;  2HQ5 A;  5FLV A;  4B4C A;  1RPW A;  3GBG A;  2R5Z B;  1G2H A;  3LOC A;  3FIW A;  4X6A J;  2VI6 A;  3O8H A;  2NVT J;  2X6O A;  1WCM J;  2CU7 A;  1IDZ A;  1XG1 A;  2RAE A;  2CQQ A;  2LFB A;  3JRD A;  1LE8 A;  1ETY A;  5F0F A;  5E3O A;  4FTH A;  3BQZ A;  2NVQ J;  4XK4 A;  1HDD C;  4A93 J;  3WHB A;  5IP7 J;  3RQI A;  2B63 J;  3S2D J;  2XRL A;  5FJ8 J;  2DMT A;  1I3Q J;  2VKV A;  2YS9 A;  4QSH A;  4QIW N;  5GP9 A;  2EQR A;  2Y31 A;  3A01 A;  5M3F J;  3M4O J;  2XB0 X;  3GTP J;  1JJ8 C;  1TWF J;  1JT0 A;  1ZK8 A;  4JX4 A;  1ETW A;  3K2A A;  1FTT A;  1BJZ A;  3GTG J;  5M3M J;  5IOZ A;  3CMY A;  3ZOB A;  5J1Y A;  2JJ7 A;  3ZQI A;  1HLV A;  1H88 C;  1B8I A;  5FKK A;  2MSY A;  4AUX A;  2YU9 J;  2R5Y B;  1MH3 A;  3BR3 A;  2K9N A;  3JRE A;  1R9T J;  1GV5 A;  3S2H J;  2NS8 A;  1JTY A;  1T56 A;  1VI0 A;  2O9L A;  3ZQL A;  3B6C A;  2R93 J;  4JP0 A;  2LKX A;  1ETQ A;  1MBK A;  2XPV A;  2TCT A;  3HM5 A;  1APL C;  4M3G A;  3HOY J;  1OCP A;  1ITY A;  3A03 A;  1O4X A;  1F36 A;  2JA5 J;  3FK7 A;  4IHX A;  1FEX A;  4CYC B;  1A6I A;  5K7Z A;  3RZD J;  1PUF A;  4UUT A;  3GTO J;  2D5V A;  5HOD A;  3W6V A;  4M3E A;  1LFB A;  1IUF A;  3IH2 A;  1JKP C;  1BL0 A;  3Q0V A;  1TWC J;  3SJM A;  3Q3S A;  4IHV A;  3ZQG A;  2Y2Z A;  1ENH A;  2E19 A;  5EGO A;  1SFO J;  5IP6 A;  2E2J J;  4C2M J;  4UUS A;  4I76 A;  3SDG A;  4D7M A;  3LSP A;  2DJN A;  4AC0 A;  2I10 A;  5FLM J;  2ECC A;  4L5E A;  2Y9Z A;  4FE7 A;  1OCT C;  3E7L A;  5K7F A;  3S1R J;  2M34 A;  2COB A;  3JRI A;  2CRG A;  2XGC A;  1UMQ A;  2HOS A;  4RDU A;  1Z0X A;  2LD5 A;  2FD5 A;  4A3M J;  4XID A;  3JR9 A;  4A3G J;  2ME6 A;  2HXI A;  3GTJ J;  1Q1V A;  2O7O A;  2QF7 A;  1HF0 A;  5F04 A;  5E3L A;  4FCY A;  3Q0U A;  2IBD A;  3JRF A;  2NOG A;  3LSG A;  4W1U A;  4A3K J;  3JRA A;  3L1P A;  2JA7 J;  4W97 A;  5FKM A;  3BR6 A;  2XPW A;  3K7A J;  5IPA A;  9ANT A;  2ID6 A;  1RET A;  4LOC A;  1YRN A;  4BBR J;  2NVY J;  3S17 J;  1XS9 A;  3BG5 A;  1RR7 A;  2HOT A;  4A3B J;  2E2I J;  2LLK A;  2G0E A;  5IYB J;  2LR8 A;  1DU6 A;  1MBJ A;  2K9S A;  4HNV A;  1P7I A;  3S1N J;  1MBH A;  1OFC X;  1IG7 A;  2L9R A;  4DW6 A;  2XSD C;  4JYK A;  4IEJ A;  5E3N A;  5F0C A;  1DU0 A;  3IH3 A;  3RZO J;  1Z77 A;  5M5W J;  4NDL A;  1LE8 B;  1GDT A;  3IV5 A;  2HYJ A;  5C4X J;  1ETO A;  2Y0S N;  1P7J A;  4S0H B;  1B72 A;  2DMN A;  5C44 J;  3BTJ A;  2EZH A;  2FJ1 A;  3JRC A;  4C3I J;  3A01 B;  2M0C A;  4M3B A;  4X1E A;  3HOX J;  3HDD A;  1IC8 A;  2AHQ A;  2TRT A;  1T33 A;  5FKL A;  5FKN A;  2ME0 A;  2GM4 A;  1ETX A;  3TED A;  4M6V A;  5IP9 J;  1B8I B;  5K7H A;  2AO9 A;  3OSG A;  3H3V K;  2HXO A;  1A5J A;  3G1M A;  4GFB A;  2DMQ A;  3D1N I;  1RKT A;  2M9H A;  4AYB N;  1OJL A;  2PMZ N;  1TWG J;  1X2N A;  2ELK A;  3O8G A;  3TW6 A;  3H0G J;  2LY9 A;  2ZB9 A;  2KT0 A;  2R7Z J;  2ECB A;  2N8G A;  1TWH J;  1QVT A;  1ETV A;  2EH3 A;  3UKG A;  4XRS G;  3BR1 A;  5EG0 A;  3S14 J;  4IHW A;  4A3E J;  3FIS A;  2MW8 A;  4IHY A;  2HOA A;  2LK2 A;  3TP3 A;  3BTC A;  4I6Z A;  1HCR A;  3I4M J;  1JUP A;  4BXX J;  1MSE C;  1NK3 P;  1PUF B;  5IOY A;  2DA6 A;  1ZKG A;  2M8G X;  3WHC A;  3HGG A;  4D7N A;  3QQA A;  1JKO C;  3BG9 A;  1H89 C;  3HB9 A;  2CJJ A;  1AKH A;  2L0K A;  2CUF A;  3MN2 A;  4CYC A;  1K61 A;  2X48 A;  1E3O C;  5IYC J;  4Y7N J;  1BA5 A;  1BW6 A;  1BW5 A;  2DA5 A;  1MSF C;  4EEF G;  4FIS A;  3IH4 A;  4A3C J;  2CUE A;  2WB1 N;  2VPR A;  2NVX J;  2OF7 A;  1NTC A;  3JRH A;  1K83 J;  5DS9 A;  4BBS J;  1F43 A;  1VF9 A;  3NAR A;  5DTD A;  3OSF A;  3M3Y J;  1JKQ C;  2JMW A;  1IJW C;  2Y9Y A;  4MIM A;  1MBF A;  4V2F A;  4JX6 A;  2W48 A;  2K40 A;  4MFE A;  4XRS A;  3S1M J;  3GTL J;  1XC5 A;  3HOW J;  5GPA A;  2L7F P;  3FKI J;  3HKZ N;  5EYR A;  3LSR A;  1ZR2 A;  1JJ6 C;  1HDP A;  1GT0 C;  2K9Q A;  3LSJ A;  1JUM A;  5EEA A;  3OIO A; 
#chains in the Genus database with same CATH topology
 3CUQ B;  1W36 C;  2I8D A;  1JE8 A;  4EQQ A;  4Y4R A;  1QO0 D;  4S05 A;  1PUE E;  4CH7 A;  3RPQ A;  1JTX A;  1X3U A;  1WH5 A;  3QWL A;  4FX4 A;  1FSH A;  3ZQH A;  4HDU A;  4HDV A;  4Y15 A;  1W36 D;  4BQA A;  4BJ5 C;  1D8K A;  3M1C A;  1IRZ A;  1IDY A;  2Q2E B;  3LNQ A;  5H6R A;  4RLQ A;  2R5Z A;  2VB6 A;  3LL7 A;  1SFK A;  3HOV J;  4AIJ A;  5TIS C;  5FRO A;  3PFY A;  2DT6 A;  2QKL B;  3KE2 A;  4WF2 A;  2VKE A;  3H3Z A;  3U2R A;  4MFD A;  4A6D A;  4B1R A;  2KKO A;  3KET A;  1Z6R A;  2XAG A;  4YFN F;  3H5A A;  2A05 A;  1Y1V J;  1YLF A;  5HLI A;  2QA4 I;  1KA8 A;  1KQ9 A;  3DKY A;  4BKX A;  1W5T A;  3HPH A;  3HYI A;  5EZH A;  1VZ0 A;  4BXF A;  3HOU J;  4LMY A;  3ECH A;  4AD9 A;  1I27 A;  2LP0 A;  1ZGJ A;  2DA2 A;  1LDJ A;  2FQ3 A;  4Y33 A;  3F8N A;  3HSE A;  3VDX A;  4IXA A;  5DM7 F;  2YX4 A;  2IT0 A;  4ZYH A;  3J7A Y;  4IHS A;  1XGO A;  1S3J A;  3DTI A;  3VFZ A;  4I98 B;  4KYW A;  5J8C A;  3A02 A;  4U0W A;  4BJT A;  2NVU B;  4UV9 A;  1U5T C;  4I2O A;  1YX3 A;  1VQ4 I;  3G1L A;  3GTK J;  1WQ2 A;  3ZMS A;  4ZZD A;  1B6A A;  1BM9 A;  1JT6 A;  2JSP A;  2BE5 F;  3T1B A;  4U87 A;  2ZFW A;  1YG2 A;  4AU7 A;  2HDC A;  2HQA A;  1PP7 U;  2PJR A;  2UUZ A;  4KIC A;  3L2C A;  1UAA A;  2MG4 A;  2W24 A;  3LSK A;  4NUB A;  2L5Q A;  3RKQ A;  5AIP A;  4RGU A;  4PFP A;  1K79 A;  3H5N A;  2R7F A;  1F4K A;  2PEX A;  3BT9 A;  3CP8 A;  4DIQ A;  3BJO A;  1Y0U A;  3BQY A;  1O3R A;  5GTH C;  2DMU A;  3PFI A;  1P6R A;  2ETH A;  5EEH A;  2E1N A;  4HLY A;  1QHG A;  1U8B A;  3RKX A;  4WK8 F;  3KP5 A;  4A69 C;  4UUS B;  3P5J A;  5GAD J;  2VOD A;  5J1U A;  1TL8 A;  3OYH A;  1U6G A;  1H0M A;  1MDM A;  2B9S A;  4QLC U;  2G7U A;  4BE0 A;  1ZGA A;  4LLN A;  4OOI A;  3BPX A;  5LRS A;  1XSX A;  2AXT C;  4HV5 A;  3KP6 A;  3WE3 A;  3VPR A;  5BNG A;  3KLO A;  1R4M B;  2KMU A;  2KP6 A;  4LB6 B;  3MCZ A;  3TO7 A;  4F92 B;  2MC3 A;  4ZTJ A;  3RDI A;  4XLC A;  1STZ A;  2L7M P;  5FB2 A;  4D5F A;  2JUC A;  5CVU A;  1KON A;  1CF7 B;  4M9Z A;  1QNT A;  2WAF A;  2WAQ N;  2A6T A;  4YII A;  3RPU D;  3BR5 A;  4A3F J;  1A04 A;  3OS0 A;  1XX5 A;  2DA3 A;  4KN7 X;  3VYS B;  3BPV A;  4IRG A;  1I50 J;  3I59 B;  2O8K A;  1F9N A;  2Y48 A;  3RKY A;  3S16 J;  1UHS A;  3KP7 A;  3OS1 A;  4G7H F;  2RKH A;  4BQQ A;  2YU3 A;  1OCC H;  1IXS B;  3CCM I;  4XIC A;  4KMU X;  4L0Z B;  3S1Q J;  2VQL A;  1J0R A;  2GXA A;  2PMU A;  3ZCO A;  4PJ0 C;  2P7C B;  2J5O A;  2EZI A;  5KHD A;  2R7W A;  2CW8 A;  1FTZ A;  2FRH A;  4XBF A;  5CVJ A;  3BG6 A;  5HS8 A;  4AIH A;  2YUS A;  4FHT A;  3BZC A;  2JA6 J;  4KA4 A;  2HYF A;  3SXY A;  3BDD A;  3CCQ I;  1ODD A;  4B4C A;  4A0X A;  4DJA A;  1LEB A;  5E18 F;  1LFP A;  4HX7 A;  3AL0 C;  2XUB A;  3LSH A;  5JI6 A;  1P4X A;  1X1B A;  4GGG A;  2QQ9 A;  3FM3 A;  2CU7 A;  2PLY A;  1XG1 A;  4L5J A;  1MNE A;  3NWT A;  2CQQ A;  2QWW A;  2WAE A;  2BVM A;  1ETY A;  2NYX A;  4IF4 A;  2NVQ J;  5CVR A;  1MKM A;  2FBI A;  4LK1 F;  4O5V A;  5IP7 J;  1EV7 A;  2VXZ A;  5KCM A;  3CME I;  1Q1H A;  3IAS 2;  2PJP A;  1SVL A;  2ZNZ A;  3WGH A;  1VQM I;  1I3Q J;  1DP7 P;  2IS2 A;  1FP2 A;  3R0A A;  3DTE A;  2R7D A;  4XN0 A;  3ULQ B;  2VE8 A;  2X4H A;  3Q5F A;  4BXU A;  2EFQ A;  3A01 A;  3E97 A;  2HS5 A;  3M4O J;  1TW2 A;  3ZMT A;  3GVA A;  3QU6 A;  2JVG A;  3DPL C;  1JT0 A;  4IQJ A;  1ZK8 A;  3SFZ A;  1H9G A;  2X1E A;  1ETW A;  5HDN A;  1R22 A;  1XGN A;  5IT9 K;  4RA2 A;  1T8I A;  1U0J A;  2ZKZ A;  4UHT A;  3WTZ A;  2PBI A;  2LBF A;  3QP5 A;  1HLV A;  1B8I A;  2BVL A;  2DAO A;  2P6T A;  4HNU A;  5FKK A;  1S5L C;  4AUX A;  3RCO A;  3FKJ A;  1R9T J;  2LC2 A;  4CYD A;  1VI0 A;  3B6C A;  3PIO F;  1S8N A;  2VJ5 A;  3V8L A;  2XSJ C;  2TCT A;  2X6W A;  3ZXS A;  1ON2 A;  2HKO A;  3LAJ A;  3R61 A;  1PDN C;  1H9T A;  4HW0 A;  4RGS A;  6PAX A;  1ITY A;  1O4X A;  4PDK A;  3OYN A;  1F36 A;  1R23 A;  4A0Z A;  4IHX A;  1FEX A;  2CV2 A;  4KIG A;  4L5I A;  1KYW A;  1MMA A;  3CCJ I;  4EGY A;  5L3B A;  3DU6 A;  4ZJZ A;  3PIP F;  3J7Z I;  3GW2 A;  4BE2 A;  2RRE A;  3FHN A;  5B1B H;  3EUH C;  4BE1 A;  3SJM A;  1QZY A;  4KFC A;  1R71 A;  2XAH A;  3M8J A;  2F4M B;  3ZQG A;  2K9L A;  2Y2Z A;  1ENH A;  2E19 A;  4M6X A;  3OYF A;  4LIT A;  4BGD A;  5ED4 A;  3KYL A;  4CO8 A;  5CVV A;  3SDG A;  4D7M A;  3MKW B;  4AC0 A;  5FLM J;  2ECC A;  1FOW A;  5ILV A;  1OCT C;  3E7L A;  3I9V 2;  5K7F A;  2CYY A;  2COB A;  2BY3 A;  4IJA A;  1I39 A;  1YS7 A;  1BI2 A;  3DQV C;  1DGW Y;  2KLO A;  1LVK A;  3N05 A;  3W3C A;  2M87 A;  3CTA A;  2VAS A;  3UNG C;  2X51 A;  4A2U A;  2IXS A;  2GOM A;  2JPC A;  3BJ6 A;  3FHZ A;  1VQ5 I;  2LH9 A;  2PX9 A;  4A3G J;  1VQO I;  3F8C A;  2QF7 A;  1HF0 A;  2K3F A;  3GF2 A;  4BAC A;  2IBD A;  3Q0U A;  4A3K J;  3CD6 I;  4W97 A;  5BQT A;  5FKM A;  1FBQ A;  3I55 I;  5FFX A;  9ANT A;  4F55 A;  2IS4 A;  1RET A;  2FA5 A;  4XNF A;  1YRN A;  1B9M A;  3OYD A;  2E1C A;  3S17 J;  4MEY F;  4RS8 A;  1RR7 A;  4U0Y A;  3M8E A;  3OYC A;  2HOT A;  3C18 A;  3KZY A;  4A3B J;  1Z21 A;  3S3O A;  3RSN A;  1UZC A;  1J2X A;  2P4W A;  2LR8 A;  1HC8 A;  1MBJ A;  1MJB A;  1HSJ A;  1V4R A;  2K9S A;  4F3Q A;  4HNV A;  4DGW B;  5GTI C;  2H1L A;  3OYK A;  4JYK A;  1QGP A;  1TNS A;  4IEJ A;  2XC7 A;  3LST A;  3RZO J;  2CH0 A;  5M5W J;  2HQR A;  4OAZ A;  1LE8 B;  2QUF A;  1X3Z B;  4HEA 2;  4NQW A;  1SEU A;  1TP4 A;  2NAZ A;  4LIU A;  3G71 I;  3V7R A;  2HZT A;  4B48 A;  2GIV A;  2FBH A;  5LRR A;  2DJI A;  1LVA A;  1RC9 A;  3GO5 A;  4ZYG A;  3WTW C;  1T95 A;  2A5Y B;  3FM5 A;  2M0C A;  2F2E A;  1G59 A;  4X1E A;  3HDD A;  2IA1 A;  4IL6 C;  1N75 A;  1TT5 B;  1W4M A;  2JRM A;  4FQG A;  3OY9 A;  1IC8 A;  2ZME A;  5HNH A;  2TRT A;  3CF5 F;  3RI4 A;  1WJE A;  1V5E A;  2YX7 A;  4DOZ A;  1OR7 C;  3OR1 C;  3NEU A;  1K7A A;  1TQP A;  4ZDP A;  3TED A;  3G4S I;  2QLZ A;  3K4M A;  4II2 A;  3G1M A;  4BS9 A;  4GFB A;  1WJF A;  1RKT A;  4AYB N;  1AWC A;  1LPQ A;  4XSX F;  1ERD A;  3DXJ F;  4JK1 X;  3F6O A;  2ZB9 A;  3O3K A;  3TDU C;  5KAI C;  3IUO A;  2LYC A;  1E3H A;  3WU1 B;  3ECO A;  4LLL A;  1T08 B;  3BR1 A;  2VKH A;  3CP2 A;  2V6C A;  2QSG X;  2DOF A;  2MW8 A;  2HOA A;  3TP3 A;  4I6Z A;  1OCR H;  1HCR A;  4BNC A;  4BXX J;  4KT6 A;  2BY2 A;  2JSC A;  2XVC A;  3SZT A;  1PUF B;  4NB5 A;  5BS6 A;  1LEA A;  3RQ4 A;  2OUM A;  1JHH A;  1SD6 A;  1YW7 A;  3BG9 A;  1I1S A;  1H89 C;  2CJJ A;  1AKH A;  5TGT A;  3MN2 A;  2CUF A;  5D4R A;  1TTY A;  1UST A;  3E6D A;  4TV7 A;  5LBQ A;  3KP3 A;  2KIQ A;  1BA5 A;  1O7F A;  2BEO A;  3TQN A;  3HIF A;  2H09 A;  2KIU A;  1J59 A;  4ANJ A;  3HRU A;  1X4P A;  2DTR A;  2V1N A;  4EJW A;  2WB1 N;  3OR2 C;  2O61 A;  1NTC A;  1D1B A;  4Y3O A;  4KIF A;  5DS9 A;  4A0Y A;  1VF9 A;  2WAD A;  2ZXI A;  4RAG A;  1NG6 A;  3NAR A;  4XKC A;  5DTD A;  4AVP A;  1FSE A;  2JMW A;  3K10 A;  2EIM H;  4V2F A;  3VWB A;  3HHG A;  4MFE A;  5KNL A;  3GTL J;  3CJT B;  1EA3 A;  2CQK A;  1IRX A;  4B43 A;  4HAM A;  1AA7 A;  3F9K A;  3QOP A;  2PI0 A;  1IZ1 A;  3FMQ A;  2V79 A;  1QA6 A;  2F5D A;  5D8K B;  3M9A A;  4G8X A;  3FMR A;  2HI3 A;  3PQK A;  4EM2 A;  3CMM A;  4PCQ A;  2WBM A;  1KU2 A;  3WTS C;  4P5O A;  3JAM K;  2VOP A;  4HF2 A;  2Z3Y A;  2DN0 A;  1Z3X A;  1TC3 C;  2UWM A;  2OA4 A;  2LVS A;  3C2H A;  1X1A A;  2DA4 A;  2Y30 A;  4C3H J;  4HYE A;  2E34 A;  3P9I A;  4XOR A;  3PO3 J;  2VJ4 A;  2P6S A;  4HQM A;  1IV8 A;  3OOP A;  3DP7 A;  3GFM A;  4HNT A;  2FNA A;  2R4G A;  4KJZ A;  4AM3 A;  2I5U A;  4MQ9 F;  4CCK A;  1YIT I;  3TKY A;  5HOO A;  1DPR A;  4L9J A;  1E17 A;  3I3L A;  1NG7 A;  4EM1 A;  2EZK A;  2XAS A;  3GME A;  1B72 B;  1U9O A;  4ABZ A;  4EV0 A;  1MJA A;  3DKW A;  4XM3 A;  5TRD A;  2R7T A;  2IP2 A;  4DQ2 A;  3HRS A;  1W0T A;  3QP6 A;  3V7C A;  4I0B A;  1PVE A;  4B3A A;  2E2H J;  4YEJ A;  2MC4 A;  1ONV A;  2CSO A;  3BR2 A;  3E6M A;  4M72 A;  5HLH A;  2M4G A;  2E1M C;  1LDD A;  2EV5 A;  3H35 A;  1Z6T A;  2PG4 A;  5ICF A;  4J19 A;  2QZ8 A;  1J75 A;  2O6G E;  3NAU A;  3L00 A;  4BY7 J;  3OIP A;  1UB9 A;  1X2M A;  4ITV A;  4ZYD A;  3GX4 X;  4ETS A;  3KEO A;  1WFX A;  3JSP A;  1BC7 C;  1B1B A;  1HKQ A;  3H3U A;  2VN2 A;  5CJ9 A;  1F5T A;  2BZT A;  3PL8 A;  4OWR B;  2KDZ A;  2L9S A;  1RKW A;  2Z33 A;  2E1O A;  2X0L A;  2X85 A;  3TW7 A;  2PQ8 A;  1EF4 A;  2RC4 A;  1K4S A;  5F1J A;  2E7W A;  3OYI A;  2F6C A;  4IQ4 A;  3BG3 A;  3DBH B;  4ON0 A;  1GVD A;  1QBJ A;  1QHH D;  3G2B A;  1IV6 A;  2DQR A;  2JVH A;  2EPF A;  5J4V A;  2V1X A;  1WH7 A;  1SD7 A;  3I64 A;  4KNY A;  4A3D J;  3ZPL A;  4Y52 J;  1JUS A;  1OCO H;  1YJW I;  1WPK A;  5F27 A;  1S7E A;  1SMT A;  2EZL A;  1IO2 A;  3DFG A;  4AVZ A;  3PUB A;  3BRO A;  3F6V A;  2MGQ A;  1NK2 P;  2IVM A;  1WWX A;  3FXR A;  4WXH A;  3CCE I;  2R92 J;  3BTI A;  4PJJ A;  3I56 I;  3AG2 H;  2BY1 A;  3CUQ C;  1VQ9 I;  1MBG A;  4MEX F;  4DYR A;  2FOK A;  1QPM A;  1ETK A;  2HTS A;  1AOY A;  1U9N A;  5J1R A;  4E4H A;  2WAQ A;  3H92 A;  5IT9 Z;  2E36 A;  3I54 A;  3S3N A;  3W2A A;  3BTL A;  2HOE A;  3SFI A;  2XDV A;  4UVB A;  4XQF A;  1ZG3 A;  3EQL F;  3SEQ A;  1CQT A;  2DMP A;  3ZQF A;  3FXM A;  1OYY A;  3QPH A;  5C4J J;  4RBO A;  5EZG A;  1VND A;  4XLP F;  4HOB A;  2XGD A;  2H8R A;  2IEK A;  2DI3 A;  3UR3 C;  3BLY A;  4A3I J;  3TGN A;  3JRG A;  3HXL A;  3MVP A;  1EJ9 A;  2KZV A;  2M3A A;  2QSH X;  3JRB A;  5JLW A;  4G12 A;  1HOM A;  2VQG A;  1S9H A;  2A61 A;  3CLO A;  2KZG A;  1RES A;  5D8L B;  1G3T A;  1BI3 A;  2X1D A;  1LB2 A;  3E5U A;  1BBY A;  2R3S A;  4ZYA A;  3Q9V A;  4IOC F;  4PUS A;  3MEX A;  4PSW A;  2B7E A;  4ZDO A;  2DA1 A;  2VQC A;  1I5Z A;  3QPL A;  4NNJ A;  5EF6 A;  4XOP A;  4F91 B;  3P7N A;  3JTH A;  3TL4 X;  1YW8 A;  1QVU A;  2BV6 A;  3C7J A;  4XMY A;  1IAW A;  3BP8 A;  4V19 K;  1FIA A;  3CES A;  1AHD P;  2KJC A;  3HEF A;  4AID A;  3CZ6 A;  5FLV A;  1VQ8 I;  2BHZ A;  4E7S A;  4EJO A;  1RPW A;  3GBG A;  4R79 A;  2Y0S A;  2R5Z B;  2NNY A;  2DYR H;  1G4D A;  3FIW A;  4UB6 C;  2VI6 A;  2VOO A;  1IRG A;  4ZH4 F;  1OPC A;  2VIX A;  2WY8 Q;  3GEZ A;  1IDZ A;  3ZN1 A;  2Z9O A;  1G8X A;  2RAE A;  1YQA A;  4OMY A;  5F0F A;  1OYI A;  3BQZ A;  4KIB A;  3AFH A;  3A0B C;  3RQI A;  2O8X A;  3S2D J;  3HHH A;  3BZ6 A;  2DMT A;  2FOW A;  4QSH A;  3DKX A;  1OQY A;  1J5Y A;  3O6B B;  1A31 A;  2RGV A;  4QIW N;  2V1U A;  1FWZ A;  4F7Z A;  4Q4Z F;  2K4J A;  3SHF A;  1KGS A;  3E5Q A;  3GTP J;  2XRN A;  2EJR A;  2V9V A;  3LWF A;  5J8F A;  4P1W A;  1Z05 A;  4CCJ A;  3CCR I;  2BOL A;  2VPL A;  4ESJ A;  1FTT A;  2NNN A;  3KX2 A;  5EJC A;  1BJZ A;  3PNV A;  3P9K A;  5FRN A;  2MH9 A;  3X2Q H;  5M3M J;  3H1C A;  5IOZ A;  3CMY A;  1XDS A;  3CC4 I;  2JJ7 A;  2G9W A;  4YRV A;  4EJU A;  1RUO A;  3S2H J;  4PZJ A;  2VE9 A;  1GV5 A;  4NHJ A;  5JR3 A;  1HW2 A;  1O3T A;  3T0Y A;  2PJR B;  3IWF A;  3RTR A;  4JP0 A;  4M73 A;  4IZZ A;  2LKX A;  2FE3 A;  5H20 A;  3CJN A;  3HM5 A;  4M3G A;  3HOY J;  2X6X A;  1OCP A;  3GLX A;  2QBY A;  1BI0 A;  2OD5 A;  3K1M A;  2ESN A;  2L54 A;  1HW5 A;  3K70 C;  3QYF A;  1YTY A;  2F5C A;  1R1T A;  4CSW A;  3RZD J;  3ABM H;  4S04 A;  1FOX A;  3GWZ A;  3MKY B;  4WXD A;  3GTO J;  4HX8 A;  4BDZ A;  2D5V A;  2MBF A;  3K70 D;  2Q0O A;  3ZP5 A;  2E5Z A;  2HNH A;  3LA7 A;  4BEH A;  1TWC J;  2BW3 B;  1U5T A;  4OIO F;  1MDM B;  2E71 A;  3W6J B;  5IP6 A;  2E2J J;  1Y6I A;  1X1P A;  4UUS A;  4E70 A;  1P92 A;  5B66 C;  3MAJ A;  2DJN A;  4RB0 A;  3OYA A;  1BI1 A;  4F93 B;  2M7B A;  5ILS A;  5K5Q A;  3S1R J;  2M34 A;  2XAU A;  4U88 A;  3F8B A;  1IN5 A;  2CRG A;  1UG0 A;  4RDU A;  3O2P E;  2M4K A;  3LSI A;  1O7L A;  5HDK A;  3IRR A;  4E7H A;  3LQR A;  2GZW A;  1L3L A;  2GXG A;  2A68 F;  4YFX F;  3W6K B;  2ME6 A;  4KUM A;  3GTJ J;  2O7O A;  4M71 A;  1ZRF A;  5F04 A;  5E3L A;  1XCB A;  3BY6 A;  3JRA A;  2JA7 J;  2QYO A;  4HST A;  3CC2 I;  4CA0 A;  3HL2 A;  5LEK A;  1QZZ A;  1X1D A;  2Z2S B;  4ENM A;  4UVA A;  3G3Z A;  1RNL A;  2P8T A;  3ZQ7 A;  5HLG A;  1S72 I;  4BBR J;  3VOE A;  1N77 A;  3OS2 A;  1BOB A;  3LAP A;  1ZAO A;  2VT3 A;  2E2I J;  1ZN2 A;  2EIL H;  1D0Y A;  5IYB J;  3R0J A;  2R7O A;  2EV0 A;  1P7I A;  1ON1 A;  1MBH A;  1OFC X;  2EFP A;  3U21 A;  4BJ6 C;  2L9R A;  3LA2 A;  3U1K A;  4DW6 A;  1IG7 A;  4UB8 C;  4XKB A;  1S7O A;  1N78 A;  1VQK I;  5ILU A;  3A0H C;  5F0C A;  1DU0 A;  2ISZ A;  3CJR B;  5HLT A;  3J7Y J;  2Y75 A;  1XCV A;  4HZF A;  2HYJ A;  1YW9 A;  1MJ9 A;  1SMY F;  2XAF A;  2Y0S N;  1P7J A;  3HSF A;  2DMN A;  2DOD A;  5F64 A;  4MNU A;  2EZH A;  3E0J B;  4AYB A;  1UJ8 A;  1NH3 A;  2FBK A;  2FJ1 A;  2WA0 A;  3A01 B;  4EMS A;  1BR1 A;  1G3W A;  3KPH A;  2PMH A;  2EV6 A;  3HOX J;  3VB2 A;  2UV1 A;  1BN5 A;  2OQR A;  4A6E A;  3HUG A;  1R1V A;  2GAU A;  2K27 A;  4XSZ F;  4D1Q A;  1UHW A;  4OIN F;  4M74 A;  4GCV A;  3FXU A;  2GM4 A;  2Z5U A;  2VBZ A;  2YR2 A;  2ICW G;  3LQQ A;  4XKV A;  2LBF B;  5IP9 J;  2GQQ A;  3L2R A;  3JAM Z;  1B8I B;  1FY7 A;  4ENK A;  5CLS A;  3CLQ A;  4A5M A;  1P9Q C;  3HTS B;  4IVN A;  5LHG A;  3MKZ A;  2F4I A;  2M30 A;  1OJL A;  2PMZ N;  5LHH A;  4BUP A;  1BIA A;  3TMO A;  2O3F A;  3KZI C;  2KT0 A;  1A6Q A;  4ZTF A;  3FBN B;  2MAB A;  3VSK A;  4WCG A;  1TWH J;  3HSR A;  2H94 A;  1ETV A;  1XGS A;  4LD5 A;  2KJB A;  5EEG A;  5EG0 A;  4IHW A;  4AWX B;  4A3E J;  2KRF A;  3E1S A;  4NC8 A;  4BHC A;  5JHF A;  3L9F A;  4GXO A;  1R49 A;  4BAY A;  4LK0 F;  3I4M J;  2WB1 A;  1MSE C;  3ZGK A;  1NK3 P;  1SVO A;  4L0Y B;  3B02 A;  2V9P A;  3JCU C;  1ZKG A;  2J5P A;  2M8G X;  4XRF A;  3WHC A;  4D7N A;  4DBR A;  3PNT A;  3U1D A;  4N9I A;  4R1H A;  3QRF F;  4RGR A;  2BXZ A;  2VBY A;  4PFO A;  4ENN A;  1E3O C;  1Z7U A;  3RIR A;  4KN4 X;  1E0E A;  3M1E A;  2HVR A;  1MSF C;  4EEF G;  4FIS A;  4UV8 A;  4Z2Y A;  3CDH A;  4BHP A;  2FU4 A;  1YIO A;  4XOT A;  4BBS J;  1F43 A;  2BYV E;  2JRT A;  3IRQ A;  4OIP F;  2RVC A;  5D5W B;  3B73 A;  2CWE A;  2MLK A;  4HV6 A;  3E5X A;  1MMD A;  2LDU A;  2KL4 A;  4MIM A;  5BOX A;  3K1P A;  3WG7 H;  2K40 A;  4QPQ A;  1LUJ B;  2LY1 A;  3S1M J;  1FBU A;  5GPA A;  2ZJR F;  3LFU A;  2K7L A;  2V4J C;  5EYR A;  1JJ6 C;  4XR6 A;  3ELK A;  5AIQ A;  2X6Y A;  5JVG F;  2K9Q A;  3ERM A;  5LFA A;  1EH8 A;  3RYR A;  4UUV A;  2BBY A;  5FD5 A;  1SFU A;  2OTJ I;  2M5W A;  2TDX A;  5E20 A;  5J6X A;  2ZCW A;  5EEA A;  2FEZ A;  2F5F A;  5J47 A;  2X9D A;  1H8A C;  4ESB A;  1MBE A;  2HDD A;  3V42 A;  2CV1 A;  1YRN B;  2VUM J;  1YJN I;  2KQR A;  2D45 A;  2A6E F;  2MD5 A;  3AG1 H;  3RYP A;  2H27 A;  4XLH A;  4L9T A;  3DTK A;  2ZME C;  5DD4 A;  2ZJQ F;  2DOA A;  2HU9 A;  3ERE D;  1KYZ A;  4C2T A;  4HG2 A;  2FX0 A;  3QYE A;  5IT3 A;  2F5E A;  1KU7 A;  5F08 A;  1ZRC A;  1POG A;  2VJI A;  2IS6 A;  4RB2 C;  5FO5 A;  3DEW A;  2CQN A;  4HLX A;  1U2W A;  1Z91 A;  4XRM A;  5DCF A;  1Y1W J;  3I58 A;  5LEJ A;  1X58 A;  4NQW B;  5ERI A;  4V2G A;  3CCY A;  4YEL A;  4PJM A;  1A35 A;  3F22 A;  4CCM A;  2QQA A;  1FP1 D;  2D1H A;  1U78 A;  1UG2 A;  3G1O A;  3DLL F;  1UFM A;  3QOE A;  2QQB A;  2LTP A;  1W0U A;  2JN6 A;  1T6S A;  3HOZ J;  3I4N J;  2H6C A;  1ACI A;  1UCR A;  4FT8 A;  4BH9 A;  2V1D A;  5F0H A;  2VC0 A;  3BWG A;  2JZY A;  2ZME B;  3BG7 A;  1VFC A;  1IRF A;  3H9J A;  4A3L J;  2H1K A;  2VLA A;  2MLG A;  3GTQ J;  4B44 A;  3K4N A;  3J80 Z;  1WI3 A;  1WJ5 A;  4XLN F;  4XLF A;  1MZB A;  4J01 A;  1T0F C;  1V55 H;  2X1C A;  2Q1Z B;  3TP0 A;  3D5L A;  2R5Y A;  2VQH A;  3WTU C;  3QPT A;  1TQM A;  5H2F C;  3C2B A;  4DZJ A;  1RR8 C;  3GLL A;  1MNM C;  1VQL I;  4J00 A;  1D5Y A;  1JKR C;  2FQ4 A;  2V9K A;  3WOD F;  3PM1 A;  4FE4 A;  1A36 A;  3TO9 A;  5AON A;  3S32 A;  2UXX A;  2XF6 A;  1V5F A;  2O5R A;  3KIO A;  1FPQ A;  4M3F A;  1ZGW A;  2PFB A;  3S15 J;  1XMA A;  4N4O B;  3OYL A;  1B9N A;  2Q8K A;  4KMF A;  2ZXW H;  3KP2 A;  1SFX A;  1IF1 A;  3OOU A;  4DYQ A;  2DTZ A;  4FX0 A;  2DFE A;  1HST A;  1ZR4 A;  2ZXJ A;  3F8M A;  1AKH B;  1HQC A;  1EKE A;  5EGO B;  3ZMV A;  3LA3 A;  4KT5 C;  1OR7 A;  2MYS A;  3DV8 A;  2UXN A;  1OCZ H;  1Z7L A;  2CW7 A;  4CZZ A;  2A07 F;  3FXO A;  4JX5 A;  3ZMZ A;  3CCV I;  5HNF A;  3ABL H;  2DYS H;  2O0Y A;  2Z1D A;  5D4S A;  1YJ9 I;  2GLO A;  4Q48 A;  5E17 F;  1WGX A;  5BPD A;  1S6L A;  3F72 A;  3PO2 J;  2AQF A;  3H36 A;  4MLO A;  4UXN A;  2NS7 A;  2XPU A;  4XL9 A;  5FLX Z;  2QCO A;  2Z99 A;  2Y69 H;  3B6A A;  4JBA A;  5L3E A;  4IRI A;  3FWE A;  3GTM J;  3K2Z A;  5CKT A;  5JFR A;  3J81 Z;  3HTU A;  1ZTR A;  4RMN A;  1R6R A;  1KU9 A;  2KPM A;  1WJD A;  5FFZ A;  3JW4 A;  2IPQ X;  5GAE J;  5E79 C;  4N0B A;  2JA8 J;  2K85 A;  2CG4 A;  4M3D A;  2M0M A;  5DM6 F;  5GPC A;  3J7A O;  2EBI A;  3MZ8 A;  3FK6 A;  4PK4 A;  4C30 A;  3CCU I;  2P81 A;  4GRI A;  3SZP A;  3TOA A;  4N4N B;  1FOK A;  2JA2 A;  1K6O A;  4HA8 A;  4Q47 A;  2STW A;  3DBR B;  2CQX A;  3JSO A;  4PGG A;  2QGU A;  1BIB A;  1MH4 A;  1FIP A;  3H9G A;  2DFH A;  2HKX A;  1K6Y A;  4JQF A;  3QPS A;  2OCC H;  1O3Q A;  1C0W A;  1ZQ3 P;  2HQ5 A;  3REO A;  1ZRE A;  2NOJ B;  3AAF A;  2VXD A;  3T8R A;  1DGR M;  1LJ9 A;  3LOC A;  4X6A J;  4O3M A;  3O8H A;  2CV0 A;  2YSR A;  3I0T A;  2NS0 A;  2P5V A;  4UVC A;  2XRO A;  1R00 A;  2NVT J;  2ELJ A;  4MTD A;  1W5C C;  1MGT A;  2BXY A;  1JHF A;  2AXL A;  1FYL A;  2LFB A;  3K4J A;  1N25 A;  1BOA A;  4CZC A;  5FGM A;  3JRD A;  4FTH A;  1HXD A;  4XK4 A;  3HZJ A;  1HDD C;  2AQE A;  2XAJ A;  3WHB A;  3D5S C;  1RZ4 A;  2MFZ A;  3PSF A;  1IW7 F;  4N9H A;  2F48 A;  3L2W A;  3A2K A;  2XRL A;  2VKV A;  3HG9 A;  1W7P A;  1J7K A;  5M3F J;  1W1W E;  4XLE A;  4GDF A;  4XKW A;  2XB0 X;  1ZAR A;  2UZK A;  1YYV A;  5D5U B;  2IGO A;  4H0E A;  2JTV A;  1GXP A;  4Q5S F;  5K1Y A;  2CGP A;  3K2A A;  3COA C;  2ZJP F;  3C3W A;  3KEQ A;  3KP4 A;  2PN6 A;  2K86 A;  5DV5 A;  3GCM A;  3H5R A;  3GTG J;  3ISP A;  2XGX A;  3ZQI A;  4ZZL A;  1WHU A;  4GO1 A;  2MSY A;  1FOY A;  2KIF A;  4R8H A;  2YU9 J;  3VYU B;  2M1B A;  4U7D A;  1WRJ A;  1MND A;  3MQ0 A;  2F5V A;  3KFW X;  4OIR F;  3WTT C;  1J9I A;  2NS8 A;  1T56 A;  3AG3 H;  2O9L A;  5LGN A;  2BY0 A;  4G94 A;  2ZBK A;  2R93 J;  1EH6 A;  2LSO A;  3IHU A;  1ETQ A;  1MBK A;  3ZN0 A;  1ZG1 A;  2QVO A;  2JQ7 A;  3ZR8 X;  3S3M A;  1LQ1 A;  2W57 A;  4NBQ A;  2FNP A;  3CUO A;  2QKM B;  2WV0 A;  3A03 A;  2KRC A;  1SAU A;  5A2Q Z;  1Z3Y A;  4G7Z F;  4A12 A;  1UEL B;  2Z16 A;  1W5S A;  3V8K A;  4CYC B;  1LDK B;  5K7Z A;  3H0D A;  2R7R A;  4RGX A;  3LFK A;  4BQO A;  4E7I A;  4UUT A;  2HVQ A;  3MMY B;  3MWM A;  5J40 A;  5L3C A;  3ZMD A;  5HOD A;  4ASN A;  3W6V A;  4YIR X;  3F21 A;  4P55 A;  1LFB A;  3IH2 A;  1JKP C;  2L9V A;  1BL0 A;  3Q0V A;  5GAG J;  3Q3S A;  4IHV A;  2L9N A;  2CFO A;  2LNB A;  1T38 A;  3QAH A;  4C2M J;  2V7F A;  4Y13 A;  2CUJ A;  1XSD A;  1X1C A;  2I10 A;  3DPU A;  2AS5 F;  2Y9Z A;  5L3F A;  3KEY A;  4D0P A;  4BL0 B;  2A69 F;  3JRI A;  3PNY A;  3S8P A;  2XGC A;  1R1U A;  1UMQ A;  2KHM A;  2HOS A;  2HPI A;  2HVS A;  2IJL A;  1Z0X A;  5HS9 A;  2H8W A;  5J4Y A;  2K4B A;  4LG0 A;  3BCB A;  2LKS A;  4A3M J;  4XID A;  3JR9 A;  2W1O A;  2HXI A;  4I0A A;  3HC7 A;  2OC6 A;  3K1N A;  1Q1V A;  5DCM A;  3TBI A;  4FCY A;  1X19 A;  2NOG A;  2XF5 A;  3LSG A;  4W1U A;  1K78 A;  3L1P A;  2R7U A;  2OZU A;  3ABK H;  3BR6 A;  3J80 K;  3JTG A;  3EUA A;  2D2W A;  4HQE A;  4B47 A;  1P2F A;  2DK8 A;  3CUQ A;  2DO7 A;  2DT5 A;  2CW0 F;  3LSM A;  3VYT B;  4X0G A;  4CHU A;  2L4A A;  4LOC A;  4E7L A;  1IXR C;  2FXA A;  2KIM A;  2NVY J;  1XS9 A;  3QU3 A;  3D0S A;  4HRI A;  3K4K A;  3CC7 I;  3I53 A;  2EA4 A;  3K69 A;  2Q2E A;  3S1N J;  1HKS A;  2ELH A;  2XSD C;  2W00 A;  3EUK L;  3BOQ A;  5E3N A;  2DPU A;  3IH3 A;  4NDL A;  3WU2 C;  3ABT A;  1FLI A;  4JOM A;  3IV5 A;  5C4X J;  1TT0 A;  1VQ7 I;  2EA2 A;  4S0H B;  1GLN A;  2FUG 2;  2ZSH B;  4HSR A;  3JRC A;  2PMZ A;  3BJA A;  4C3I J;  2V26 A;  4M3B A;  1EH7 A;  3DWL E;  2QEX I;  3NWS A;  1R58 A;  2OU2 A;  1V5G A;  1QZE A;  5FLX K;  2L2O A;  4IOA F;  5FKL A;  2FF4 A;  1T33 A;  3I4P A;  5D5V B;  4LB5 A;  2ME0 A;  4II3 A;  3J81 K;  5CYV A;  4YIF A;  2H6B A;  5K7H A;  3OSG A;  2HXO A;  1A5J A;  5JVT A;  1KZH A;  3E3V A;  4HPQ A;  1HW1 A;  1TWG J;  1R7J A;  2ZXH A;  2ELK A;  3AKZ A;  4DNC A;  4L9N A;  2EIN H;  2LY9 A;  3MFK A;  5B3S H;  2VKD A;  1FBS A;  2ECB A;  4XON A;  4RLF A;  1ZEL A;  2RN7 A;  1TBX A;  2QBY B;  1JGS A;  3S14 J;  3CJQ B;  1MMG A;  4EM0 B;  4IHY A;  3OYJ A;  2LK2 A;  2Y0M A;  3BTC A;  4U0V A;  2ZC2 A;  1ZLK A;  2QM3 A;  3K0L A;  1LKX A;  2CO5 A;  2DA6 A;  4G6T B;  3HGG A;  1QU3 A;  3CCS I;  4PJN A;  1JKO C;  1IXC A;  2EFO A;  3HB9 A;  3WTY C;  2K02 A;  2L0K A;  3FXQ A;  3N97 A;  2WWY A;  4UY8 I;  1KQ8 A;  1K61 A;  2X48 A;  3QOD A;  1M1E B;  3DF8 A;  4CCO A;  4E7Z A;  4BEH B;  1YS6 A;  1U5T B;  2LMD A;  5KK1 A;  4Y7N J;  2NXN B;  5LGT A;  3HRT A;  2LF7 A;  1WSU A;  1FYK A;  1HA8 A;  3OYB A;  5D6F A;  4A3C J;  2CUE A;  2MA3 A;  1OKR A;  2VPR A;  3OWT A;  2BW3 A;  3FZV A;  1E3P A;  3R6S A;  3VSL A;  1HBX G;  2NVX J;  2VON A;  2CS3 A;  2XAQ A;  3KLN A;  3OYE A;  2OZ6 A;  1T39 A;  1PYV A;  1YI2 I;  1RUN A;  2R7Q A;  1WI9 A;  3KYD B;  1JKQ C;  2ZFU A;  2W4S A;  4XN3 A;  2Y9Y A;  1IJW C;  4JX6 A;  1VQ6 I;  2W25 A;  3I71 A;  4XRS A;  1ULY A;  2GA1 A;  1Z1D A;  3GZN B;  3CMA I;  1HKT A;  4C2U A;  1G3S A;  3HOW J;  1CF7 A;  1D1C A;  2OBP A;  4YG2 F;  3HKZ N;  4IO9 F;  2QSF X;  3LSR A;  1ZR2 A;  1KU3 A;  2ZJ2 A;  2XF7 A;  1HDP A;  3DEU A;  3I59 A;  2D1V A;  1SFE A;  2HGC A;  2KFD A;  2JUG A;  1D0X A;  1V3F A;  3FXJ A;  5GAH J;  1R5G A;  2RNJ A;  3VYR B;  4RAF A;  4BDY A;  3EYY A;  3HGY A;  4B09 A;  2ID3 A;  3BR0 A;  4WWC A;  3ZQC A;  1SD5 A;  3GFL A;  5ICG A;  4EAT A;  4B8X A;  3U9G A;  1RRJ A;  2IRF G;  5HDG A;  4UNO A;  3SYT A;  4C3J J;  1BJA A;  4RAY A;  1SC7 A;  3RPU A;  1YOV B;  3IKT A;  2LKP A;  2HQN A;  3CDI A;  3RJP A;  1IN4 A;  4A3J J;  2YPR A;  3M8F A;  1XB4 A;  3WGI A;  2LRE A;  5A2Q K;  3H9Q A;  2WY7 Q;  2ADU A;  4CXF A;  3V4G A;  2COM A;  3FMS A;  1GV2 A;  4OIQ F;  4LJZ F;  1SVM A;  3S93 A;  1XMX A;  4F52 A;  2XV4 S;  3EYI A;  1ORK A;  1GVJ A;  2P0W A;  3DBL B;  1MIJ A;  3F3X A;  3F8F A;  4FET A;  4KIS A;  4QPO A;  3F0C A;  3OMY A;  2DW4 A;  3TO6 A;  2W7N A;  3C1D A;  3L7W A;  1U3E M;  3E6C C;  1V54 H;  5JLX A;  1Y39 A;  2XHK A;  3HUG B;  1DQU A;  2QEN A;  1AU7 A;  3ZMU A;  2V6E A;  1O57 A;  2OPT A;  1CGP A;  2A6H F;  4IX7 A;  1OMI A;  1XSV A;  2K9M A;  3SEZ A;  1J09 A;  4C9Y A;  4DYC A;  1WJA A;  2W85 A;  2HPM A;  1QRY A;  4HBL A;  2E5N A;  4DZP A;  1MMS A;  2KRH A;  2BHY A;  3OYG A;  3ONQ A;  1FJL A;  1FMW A;  3KYC B;  4PGH A;  4IHT A;  1IGN A;  4CGZ A;  4M9X A;  2BGC A;  1QQI A;  4LIV A;  3AL0 B;  4A5N A;  2XB5 A;  5E1W A;  1YE9 A;  1OIS A;  4D5C A;  3DLA A;  1OYW A;  4RB1 A;  2WV1 A;  4QTR A;  3OYM A;  5M5X J;  2HEO A;  1JGG A;  2L7Z A;  3HJE A;  3W2W A;  1GUU A;  4BY1 J;  3DCF A;  5EG0 B;  4G6D A;  3MKL A;  2HZD A;  2ESH A;  2GBY A;  4CDG A;  5HVQ C;  5L3D A;  1YIJ I;  2DFI A;  3DEE A;  1XPX A;  1XTA A;  1F1Z A;  5D5X B;  1P4W A;  5E3M A;  2DXI A;  2JK3 A;  4E6K G;  2NRA C;  2OV7 A;  3HBL A;  3ROU A;  3CDL A;  4NC7 A;  3I5U A;  1BR2 A;  3T8T A;  1FMV A;  1WVR A;  4L18 B;  2IAI A;  5M5Y J;  1MW7 A;  4OU0 A;  3E6B A;  4E7K A;  5C3E J;  2L02 A;  4LFU A;  2WC2 A;  2WTE A;  4MO7 A;  5LD2 C;  1ZLJ A;  3SZG A;  2DU9 A;  4E7J A;  3L09 A;  5FKO A;  2K3P A;  2EB7 A;  4LG3 A;  3R4K A;  4OMZ A;  3HOS A;  4EJV A;  2RQP A;  3PJR A;  3IL2 A;  2VBX A;  1DP3 A;  4O6J A;  2M2E A;  2XGE A;  2R7X A;  1QPI A;  5J3L A;  3MZY A;  3Q0W A;  1TWA J;  2JWT A;  5DYM A;  2R0Q C;  1DUX C;  5EDN A;  2DQL A;  3SQN A;  5H6Q A;  1Z9C A;  1Y8R B;  3S2W A;  3CQZ J;  2ISY A;  2DA7 A;  3IP4 B;  4BQN A;  1UHM A;  1S7A A;  2DOE A;  4ESF A;  2EIK H;  3EUH A;  2GA2 A;  1ZRD A;  2IA2 A;  3SDB A;  1LFU P;  1D3Y A;  2EFW A;  2CFX A;  5IYD J;  5E1X A;  5E8I A;  5L3G A;  1E2X A;  2E35 A;  1WJC A;  3OL3 A;  2JT1 A;  4HF0 A;  5CQE A;  3MD2 A;  2GWR A;  4NC6 A;  4IKF A;  3GUD A;  2HWV A;  2VC1 A;  3HOT A;  2DK5 A;  1SAN A;  1MMN A;  4Y17 A;  1I6H J;  2DDA A;  3NRV A;  1G2H A;  2IW5 A;  2FMY A;  3FXK A;  2ZNY A;  3D5R C;  4MHG A;  3ASO H;  4U7B A;  1YHQ I;  3QYB A;  1B59 A;  2X6O A;  1R5I D;  1WCM J;  5K5R A;  5B1A H;  1DDN A;  1LE8 A;  5E3O A;  3WGG A;  1REP C;  4A93 J;  3G73 A;  4CCN A;  5CPR B;  1FX7 A;  2B63 J;  2L3D A;  2R7V A;  5FJ8 J;  1JXS A;  2YS9 A;  4L9V A;  1WJB A;  2XKP A;  1KQ0 A;  2L7K A;  4CIC A;  1RI7 A;  5GP9 A;  2EQR A;  2Y31 A;  3KZZ A;  3P9C A;  2LRD A;  2M7A A;  2L01 A;  1JJ8 C;  1TWF J;  3MZH A;  4JX4 A;  2HR3 A;  2XKO A;  1RIO H;  2OQG A;  2LY2 A;  2EFN A;  3CO7 C;  3ZOB A;  5J1Y A;  3HPG A;  1H88 C;  4G6Q A;  3A4C A;  4I09 A;  3CO6 C;  3CF2 A;  3AG4 H;  5TJJ A;  3Q9S A;  3TDZ C;  2R5Y B;  2DFF A;  1MH3 A;  2QQ8 A;  3BR3 A;  1SD4 A;  4EGZ A;  2K9N A;  3WU0 A;  3JRE A;  1JTY A;  2K5C A;  3R60 A;  3ZQL A;  2GIZ A;  1FYM A;  2XPV A;  2GOX B;  3K4C A;  1APL C;  3HRM A;  2HTJ A;  2A3S A;  1K4T A;  4I02 A;  2EK5 A;  1Y8Q B;  4QWQ A;  1S29 A;  4GYG A;  4MTE A;  3F23 A;  2JA5 J;  1X3W B;  4D9J A;  4XLA A;  3FK7 A;  5DD8 A;  2STT A;  1TLH B;  2CMP A;  3LMM A;  2IGN A;  1IN8 A;  1BR4 A;  1A6I A;  1FC3 A;  1PUF A;  2JPB A;  4HF1 A;  1IN7 A;  3DPT A;  3GYH X;  3OL4 A;  2KIS A;  4H4K C;  3ABU A;  3FF5 A;  1D0Z A;  4M3E A;  2W84 A;  5FRM A;  1IUF A;  1LNW A;  2OJE D;  4P9U A;  5DUI A;  2R7S A;  5EGO A;  1SFO J;  5D6E A;  5FD6 A;  4I76 A;  3LSP A;  1TW3 A;  4CCL A;  1T0F A;  2ZO4 A;  1X4O A;  1ZYR F;  4L5E A;  3VOD A;  4FE7 A;  3WTX C;  4EVI A;  3BZK A;  2DLL A;  1O3S A;  1TZL A;  1D5V A;  3BC8 A;  3PUF A;  4AIK A;  4YFK F;  4LGW A;  1IUY A;  3RKW A;  2LG4 A;  2OCE A;  2LD5 A;  2DPD A;  2FD5 A;  2IGM A;  3K4L A;  2DDB A;  3WE2 A;  5E1Z B;  3G6E I;  5BMZ A;  5DUK A;  1MD0 A;  3K6G A;  1GXQ A;  3TOB A;  5K5O A;  4BU2 A;  2FSW A;  3ML6 A;  5KVR A;  3GFJ A;  3FDY A;  1SAX A;  3JRF A;  1FT9 A;  2DCE A;  2HYG D;  2FML A;  2CUZ A;  4ENJ A;  5LLQ A;  4G9Y A;  2RDP A;  2XPW A;  1T98 A;  3K7A J;  5HS7 A;  5IPA A;  2ID6 A;  1T2K A;  5F1R A;  5JHU A;  3PQJ A;  4KIT B;  1D1A A;  3WTV C;  3BG5 A;  3NQO A;  5F6F A;  4RB3 C;  3GXO A;  2LLK A;  2VBW A;  2G0E A;  3PSI A;  5LHI A;  1DU6 A;  1W7P D;  1XN7 A;  2ZSI B;  4M6Y A;  4P96 A;  2ACJ A;  1WKM A;  1ZH5 A;  2E60 A;  2OAZ A;  1FZP B;  1YX5 A;  2DBB A;  4OAY A;  1Z77 A;  2XIG A;  2MH2 A;  3M07 A;  2F4O B;  1GDT A;  1P4A A;  1WZ2 A;  1G6N A;  1ETO A;  1YO5 C;  4WX9 A;  1U8R A;  2IA0 A;  2RNG A;  3EET A;  3VEP A;  1YFH A;  1B72 A;  4MGR A;  4I99 C;  3ASN H;  4ZC3 A;  5C44 J;  3ZRG A;  3BTJ A;  1FNN A;  1W7P B;  3L2U A;  4P9F A;  2RV8 A;  2OTL I;  3ZQQ A;  2LOO A;  1BC8 C;  2MD0 A;  5ICE A;  1GHC A;  5KAF C;  3DU5 A;  3ESW B;  1XGM A;  2IGK A;  2LF8 A;  3IKV A;  1VTN C;  4MQV A;  2GXB A;  3GZ5 A;  3GFI A;  5BPI A;  5DDG A;  3IAM 2;  4ZYE A;  4IRH A;  2DT7 B;  5CVI A;  4I7H A;  1I1G A;  2AHQ A;  5FKN A;  4FAS D;  1ZG5 A;  1DPU A;  2O03 A;  1ETX A;  1D8J A;  1OLT A;  4M6V A;  3L2Q A;  3FXL A;  2L4M A;  2AO9 A;  3H3V K;  1L0O C;  1G3Y A;  3OV8 A;  2DMQ A;  3D1N I;  2M9H A;  3K4B A;  3CCL I;  1X2N A;  4RM2 A;  3O8G A;  3FBI B;  5CQG A;  5ICC A;  4Z6Y A;  3TW6 A;  5B5E C;  1B4A A;  3A1Y A;  3H0G J;  3EDP A;  2R7Z J;  3GZ6 A;  2P5K A;  2KDO A;  2N8G A;  1VQN I;  1QVT A;  3N4M A;  5IY5 H;  2EH3 A;  3OIQ A;  4XRS G;  4ZDL A;  2CQ7 A;  3UKG A;  1Z67 A;  2HDW A;  4M9S A;  3FIS A;  4EJT A;  4KDP A;  3WG9 A;  2VJJ A;  3L2V A;  3V7S A;  1Y56 A;  2M45 A;  1JUP A;  1PJR A;  2B0L A;  2E7X A;  5IOY A;  3K9T A;  3V8J A;  3FX3 A;  2VT2 A;  3EPZ A;  1XDU A;  4K2E A;  4CUG A;  4B3X A;  3QQA A;  1Y0N A;  2E1M B;  4GYI A;  4PSX A;  1XMK A;  3KCC A;  2A5W A;  1R4N B;  4CYC A;  1PP8 F;  1NHA A;  2W82 A;  5IYC J;  1ZHF A;  1BW6 A;  3HKZ A;  3IWZ A;  5E8G A;  1BW5 A;  1IN6 A;  2DA5 A;  2P5L C;  2P7V B;  3IH4 A;  1JI8 A;  1I6X A;  2OF7 A;  4BHB A;  4G7O F;  1TNT A;  3JRH A;  1K83 J;  4RAZ A;  2HFH A;  2EWN A;  3C2G A;  3M7G A;  3OSF A;  3M3Y J;  1TQI A;  4WXC A;  2IS1 A;  1MBF A;  4HX4 A;  4LG0 B;  2W48 A;  5LGU A;  3BCA A;  2C6Y A;  4BYY A;  2VL8 A;  4RM3 A;  1R36 A;  1VQP I;  5DEQ A;  1XC5 A;  1XD7 A;  2RQQ A;  2L7F P;  3FKI J;  5DCM B;  4PJL A;  3W2V A;  4DBQ A;  3T5X A;  1R5H A;  2EIJ H;  2M8E A;  1GT0 C;  3LSJ A;  1K78 B;  4LLG F;  1I3A A;  1JUM A;  1USS A;  3IC7 A;  4I01 A;  2G7H A;  3OIO A;  4IPA A; 
#chains in the Genus database with same CATH homology
 2X9D A;  3HGY A;  1H8A C;  1MBE A;  2HI3 A;  2HDD A;  2ID3 A;  3BR0 A;  1YRN B;  2VUM J;  3ZQC A;  1JTX A;  1WH5 A;  2DN0 A;  1TC3 C;  2LVS A;  4C3J J;  3ZQH A;  2DA4 A;  2Y30 A;  4C3H J;  4A3J J;  1IRZ A;  1IDY A;  3LNQ A;  2FX0 A;  3PO3 J;  2R5Z A;  3HOV J;  5F08 A;  1POG A;  3DEW A;  2VKE A;  1GV2 A;  4MFD A;  4XRM A;  4B1R A;  1ORK A;  1Y1W J;  1X58 A;  4V2G A;  3CCY A;  1Y1V J;  2EZK A;  1U78 A;  1B72 B;  1U9O A;  4ABZ A;  3F0C A;  4BKX A;  1UG2 A;  5EZH A;  3G1O A;  3HOU J;  1W0T A;  2LTP A;  1W0U A;  2JN6 A;  3HOZ J;  2LP0 A;  2DA2 A;  3I4N J;  5JLX A;  4B3A A;  2E2H J;  3BR2 A;  5F0H A;  1AU7 A;  2OPT A;  1VFC A;  4A3L J;  4J19 A;  3A02 A;  4DYC A;  2H1K A;  3NAU A;  1QRY A;  4BY7 J;  3GTQ J;  1X2M A;  4DZP A;  1WI3 A;  1FJL A;  3G1L A;  3GTK J;  1IGN A;  1JT6 A;  2KDZ A;  1RKW A;  3TP0 A;  2E1O A;  2R5Y A;  2XB5 A;  3TW7 A;  1EF4 A;  4D5C A;  5F1J A;  3C2B A;  4DZJ A;  2WV1 A;  3BG3 A;  4QTR A;  1MNM C;  5M5X J;  1GVD A;  1JGG A;  2L7Z A;  1D5Y A;  2MG4 A;  1JKR C;  1GUU A;  1IV6 A;  2FQ4 A;  4BY1 J;  1WH7 A;  3DCF A;  3PM1 A;  5EG0 B;  4A3D J;  4FE4 A;  3MKL A;  4Y52 J;  1JUS A;  3RKQ A;  1WPK A;  4M3F A;  1ZGW A;  5F27 A;  1S7E A;  2EZL A;  2GBY A;  3BT9 A;  3S15 J;  3BQY A;  2DMU A;  2MGQ A;  1NK2 P;  2R92 J;  3OOU A;  4DYQ A;  2DTZ A;  3BTI A;  1ZR4 A;  5E3M A;  1AKH B;  1U8B A;  2JK3 A;  5EGO B;  1MBG A;  4A69 C;  3HBL A;  4UUS B;  4DYR A;  3CDL A;  1ETK A;  4JX5 A;  1U9N A;  5J1U A;  5J1R A;  2IAI A;  5M5Y J;  2GLO A;  5C3E J;  1WGX A;  4MO7 A;  3PO2 J;  3BTL A;  4MLO A;  2NS7 A;  3SFI A;  2XPU A;  2QCO A;  3GTM J;  3B6A A;  2DMP A;  3VPR A;  5BNG A;  3ZQF A;  1CQT A;  5C4J J;  5FKO A;  4RBO A;  5EZG A;  1VND A;  1ZTR A;  2XGD A;  2H8R A;  2IEK A;  4A3I J;  3JRG A;  2M2E A;  2XGE A;  3MVP A;  2L7M P;  1QPI A;  5J3L A;  2JA8 J;  4D5F A;  3Q0W A;  1TWA J;  2JWT A;  4M3D A;  2R0Q C;  5GPC A;  3JRB A;  2WAQ N;  5EDN A;  4A3F J;  5JLW A;  3BR5 A;  4G12 A;  1HOM A;  1RES A;  2DA3 A;  2EBI A;  3FK6 A;  3CQZ J;  2P81 A;  1I50 J;  2DA7 A;  2O8K A;  3S16 J;  1UHS A;  2DA1 A;  1LFU P;  5IYD J;  4XIC A;  2CQX A;  3S1Q J;  3QPL A;  5EF6 A;  2EZI A;  1QVU A;  1MH4 A;  1FIA A;  1FTZ A;  1AHD P;  1FIP A;  2YUS A;  3HEF A;  2JA6 J;  1SAN A;  3QPS A;  1ZQ3 P;  1I6H J;  2HQ5 A;  5FLV A;  4B4C A;  1RPW A;  3GBG A;  2R5Z B;  1G2H A;  3LOC A;  3FIW A;  4X6A J;  2VI6 A;  3O8H A;  2NVT J;  2X6O A;  1WCM J;  2CU7 A;  1IDZ A;  1XG1 A;  2RAE A;  2CQQ A;  2LFB A;  3JRD A;  1LE8 A;  1ETY A;  5F0F A;  5E3O A;  4FTH A;  3BQZ A;  2NVQ J;  4XK4 A;  1HDD C;  4A93 J;  3WHB A;  5IP7 J;  3RQI A;  2B63 J;  3S2D J;  2XRL A;  5FJ8 J;  2DMT A;  1I3Q J;  2VKV A;  2YS9 A;  4QSH A;  4QIW N;  5GP9 A;  2EQR A;  2Y31 A;  3A01 A;  5M3F J;  3M4O J;  2XB0 X;  3GTP J;  1JJ8 C;  1TWF J;  1JT0 A;  1ZK8 A;  4JX4 A;  1ETW A;  3K2A A;  1FTT A;  1BJZ A;  3GTG J;  5M3M J;  5IOZ A;  3CMY A;  3ZOB A;  5J1Y A;  2JJ7 A;  3ZQI A;  1HLV A;  1H88 C;  1B8I A;  5FKK A;  2MSY A;  4AUX A;  2YU9 J;  2R5Y B;  1MH3 A;  3BR3 A;  2K9N A;  3JRE A;  1R9T J;  1GV5 A;  3S2H J;  2NS8 A;  1JTY A;  1T56 A;  1VI0 A;  2O9L A;  3ZQL A;  3B6C A;  2R93 J;  4JP0 A;  2LKX A;  1ETQ A;  1MBK A;  2XPV A;  2TCT A;  3HM5 A;  1APL C;  4M3G A;  3HOY J;  1OCP A;  1ITY A;  3A03 A;  1O4X A;  1F36 A;  2JA5 J;  3FK7 A;  4IHX A;  1FEX A;  4CYC B;  1A6I A;  5K7Z A;  3RZD J;  1PUF A;  4UUT A;  3GTO J;  2D5V A;  5HOD A;  3W6V A;  4M3E A;  1LFB A;  1IUF A;  3IH2 A;  1JKP C;  1BL0 A;  3Q0V A;  1TWC J;  3SJM A;  3Q3S A;  4IHV A;  3ZQG A;  2Y2Z A;  1ENH A;  2E19 A;  5EGO A;  1SFO J;  5IP6 A;  2E2J J;  4C2M J;  4UUS A;  4I76 A;  3SDG A;  4D7M A;  3LSP A;  2DJN A;  4AC0 A;  2I10 A;  5FLM J;  2ECC A;  4L5E A;  2Y9Z A;  4FE7 A;  1OCT C;  3E7L A;  5K7F A;  3S1R J;  2M34 A;  2COB A;  3JRI A;  2CRG A;  2XGC A;  1UMQ A;  2HOS A;  4RDU A;  1Z0X A;  2LD5 A;  2FD5 A;  4A3M J;  4XID A;  3JR9 A;  4A3G J;  2ME6 A;  2HXI A;  3GTJ J;  1Q1V A;  2O7O A;  2QF7 A;  1HF0 A;  5F04 A;  5E3L A;  4FCY A;  3Q0U A;  2IBD A;  3JRF A;  2NOG A;  3LSG A;  4W1U A;  4A3K J;  3JRA A;  3L1P A;  2JA7 J;  4W97 A;  5FKM A;  3BR6 A;  2XPW A;  3K7A J;  5IPA A;  9ANT A;  2ID6 A;  1RET A;  4LOC A;  1YRN A;  4BBR J;  2NVY J;  3S17 J;  1XS9 A;  3BG5 A;  1RR7 A;  2HOT A;  4A3B J;  2E2I J;  2LLK A;  2G0E A;  5IYB J;  2LR8 A;  1DU6 A;  1MBJ A;  2K9S A;  4HNV A;  1P7I A;  3S1N J;  1MBH A;  1OFC X;  1IG7 A;  2L9R A;  4DW6 A;  2XSD C;  4JYK A;  4IEJ A;  5E3N A;  5F0C A;  1DU0 A;  3IH3 A;  3RZO J;  1Z77 A;  5M5W J;  4NDL A;  1LE8 B;  1GDT A;  3IV5 A;  2HYJ A;  5C4X J;  1ETO A;  2Y0S N;  1P7J A;  4S0H B;  1B72 A;  2DMN A;  5C44 J;  3BTJ A;  2EZH A;  2FJ1 A;  3JRC A;  4C3I J;  3A01 B;  2M0C A;  4M3B A;  4X1E A;  3HOX J;  3HDD A;  1IC8 A;  2AHQ A;  2TRT A;  1T33 A;  5FKL A;  5FKN A;  2ME0 A;  2GM4 A;  1ETX A;  3TED A;  4M6V A;  5IP9 J;  1B8I B;  5K7H A;  2AO9 A;  3OSG A;  3H3V K;  2HXO A;  1A5J A;  3G1M A;  4GFB A;  2DMQ A;  3D1N I;  1RKT A;  2M9H A;  4AYB N;  1OJL A;  2PMZ N;  1TWG J;  1X2N A;  2ELK A;  3O8G A;  3TW6 A;  3H0G J;  2LY9 A;  2ZB9 A;  2KT0 A;  2R7Z J;  2ECB A;  2N8G A;  1TWH J;  1QVT A;  1ETV A;  2EH3 A;  3UKG A;  4XRS G;  3BR1 A;  5EG0 A;  3S14 J;  4IHW A;  4A3E J;  3FIS A;  2MW8 A;  4IHY A;  2HOA A;  2LK2 A;  3TP3 A;  3BTC A;  4I6Z A;  1HCR A;  3I4M J;  1JUP A;  4BXX J;  1MSE C;  1NK3 P;  1PUF B;  5IOY A;  2DA6 A;  1ZKG A;  2M8G X;  3WHC A;  3HGG A;  4D7N A;  3QQA A;  1JKO C;  3BG9 A;  1H89 C;  3HB9 A;  2CJJ A;  1AKH A;  2L0K A;  2CUF A;  3MN2 A;  4CYC A;  1K61 A;  2X48 A;  1E3O C;  5IYC J;  4Y7N J;  1BA5 A;  1BW6 A;  1BW5 A;  2DA5 A;  1MSF C;  4EEF G;  4FIS A;  3IH4 A;  4A3C J;  2CUE A;  2WB1 N;  2VPR A;  2NVX J;  2OF7 A;  1NTC A;  3JRH A;  1K83 J;  5DS9 A;  4BBS J;  1F43 A;  1VF9 A;  3NAR A;  5DTD A;  3OSF A;  3M3Y J;  1JKQ C;  2JMW A;  1IJW C;  2Y9Y A;  4MIM A;  1MBF A;  4V2F A;  4JX6 A;  2W48 A;  2K40 A;  4MFE A;  4XRS A;  3S1M J;  3GTL J;  1XC5 A;  3HOW J;  5GPA A;  2L7F P;  3FKI J;  3HKZ N;  5EYR A;  3LSR A;  1ZR2 A;  1JJ6 C;  1HDP A;  1GT0 C;  2K9Q A;  3LSJ A;  1JUM A;  5EEA A;  3OIO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...