5EG0B

Hoxb13-meis1 heterodimer bound to dna
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
61
structure length
61
Chain Sequence
RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular basis of recognition of two distinct DNA sequences by a single transcription factor
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Homeobox protein Meis2
total genus 16
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2015-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5eg0B00
2ECBA 4QSHA 4DYCA 1ENHA 3NAUA 5EYRA 5M5WJ 4MFEA 1IDYA 3HM5A 1GV2A 2LY9A 3QQAA 4MIMA 1H89C 3FIWA 1G2HA 2DMNA 3GTQJ 1UMQA 2X6OA 2DA3A 2R5YA 1IRZA 1WH7A 1RKWA 3FKIJ 2M0CA 5IYDJ 3QPLA 1MBKA 4JX6A 4IHYA 3QPSA 1FTZA 2NS7A 1U9NA 1HDPA 3I4NJ 2MG4A 3UKGA 1XS9A 1JUPA 1JKQC 3BG5A 1TWCJ 1RKTA 4I6ZA 1Y1WJ 1QRYA 2YS9A 3HOVJ 4DYQA 4A3CJ 1X2NA 2VKEA 2JWTA 1B72B 1BW6A 3FISA 3HOYJ 4FE4A 1MBGA 1IDZA 4A3KJ 3K7AJ 3BG9A 5GPAA 2L7ZA 1LFUP 1HDDC 5J1RA 3H3VK 3E7LA 5C4JJ 4C3JJ 2MW8A 5E3OA 2JMWA 2HXIA 4I76A 1ORKA 2HOSA 3JRHA 3BT9A 1ZK8A 4DZPA 3PO3J 4M3DA 3GTMJ 5EEAA 1K61A 2EZKA 3RQIA 1ZGWA 5F08A 2XB5A 1MH4A 4IHWA 1ZR4A 4A93J 1GUUA 2K40A 1U78A 2B63J 3OSFA 5EGOB 3FK6A 4A3BJ 1ZTRA 3WHBA 1TC3C 1ETKA 1BA5A 4A3EJ 2XB0X 3HGGA 4J19A 2R0QC 2DA2A 2FJ1A 4M3FA 3BR2A 1JJ8C 3K2AA 5IYBJ 4MFDA 5DTDA 5EG0A 2LK2A 1NK2P 3A03A 3ZQHA 2L7MP 1ETQA 3BTLA 4X6AJ 1P7JA 1VI0A 1AKHB 1OFCX 3OIOA 2M34A 4X1EA 1H8AC 5FJ8J 3A01A 1WI3A 4RBOA 1I6HJ 4B4CA 1WPKA 1IC8A 2CQXA 2DMTA 5EGOA 2XPWA 1ZR2A 2JJ7A 4IHVA 4B1RA 5JLXA 3BTCA 4A3FJ 5IP9J 3S1QJ 3JR9A 3O8GA 3MVPA 1W0UA 1GT0C 2EZHA 5IYCJ 3IH3A 1FIPA 4EEFG 5IOZA 2IBDA 4M3BA 1XC5A 3Q0UA 1JUMA 1Y1VJ 4QTRA 1QVUA 1QVTA 5IP6A 1HOMA 4BY1J 3LSRA 2G0EA 3IV5A 5F1JA 3S14J 4B3AA 5E3NA 4XICA 2MGQA 1F36A 2TCTA 3JRIA 2XRLA 2VUMJ 3DEWA 3H0GJ 1JKPC 3BQZA 1U9OA 2DJNA 4XK4A 1JGGA 4MO7A 1F43A 4AC0A 1ETOA 3RZDJ 2I10A 2WV1A 3I4MJ 3F0CA 3TP0A 5EDNA 2ID6A 3HOWJ 4M6VA 1SANA 3GTLJ 1ETXA 3SJMA 4FE7A 2ME0A 3M4OJ 4MLOA 2Y9YA 5F0HA 1JTXA 3JRDA 4FTHA 3MN2A 3BTJA 1PUFB 2LKXA 3Q0WA 5F04A 2YU9J 2FX0A 3ZQCA 3BTIA 2DA1A 2NVYJ 2O8KA 1IJWC 3LOCA 2M2EA 3B6AA 1EF4A 3CCYA 4XRMA 3HBLA 1JJ6C 4IEJA 1JTYA 1T33A 3BR0A 4XRSG 1IGNA 2DMUA 5M3MJ 5BNGA 2K9SA 2OPTA 2CRGA 1WGXA 1U8BA 1RESA 2NOGA 2IEKA 4JX4A 2Y30A 4BKXA 5EG0B 3G1OA 4C2MJ 1VFCA 2GLOA 2X9DA 3M3YJ 5M5XJ 1B8IA 3IH4A 3TW6A 1GV5A 2CUFA 3HOZJ 2R5ZB 1D5YA 1UG2A 3GTPJ 5K7ZA 3S1NJ 1JKOC 1O4XA 1E3OC 1T56A 3PO2J 2N8GA 5JLWA 1TWHJ 3HB9A 2CUEA 5IPAA 2NVTJ 3S2HJ 2XGCA 1POGA 1MBJA 1CQTA 4JYKA 5GPCA 2YUSA 5IP7J 4C3HJ 2LLKA 2GBYA 4Y52J 4S0HB 3BR6A 2LTPA 5C4XJ 4JX5A 4L5EA 2XPUA 2LD5A 1JT0A 1XG1A 1A5JA 3IH2A 1FTTA 1SFOJ 1RPWA 2ID3A 4BBRJ 3BR3A 2HYJA 1S7EA 1VNDA 5EZGA 5GP9A 3D1NI 1X2MA 1QPIA 1ETWA 4DW6A 5FKOA 1MSEC 1OCPA 2FD5A 4A69C 1IG7A 3PM1A 1PUFA 2LP0A 3GTGJ 4CYCB 2OF7A 2PMZN 4W97A 2AHQA 3B6CA 3CMYA 2ECCA 2X48A 3G1LA 2R92J 3MKLA 2LVSA 3CDLA 5F27A 1HLVA 5FLVA 2EBIA 1DU6A 2VKVA 1A6IA 4IHXA 2DA7A 2E2HJ 3HKZN 4RDUA 4DYRA 3GTKJ 2E2JJ 3G1MA 2EQRA 2DMQA 2CU7A 5K7HA 1BJZA 5J1YA 3HGYA 1ETVA 3GTOJ 3BG3A 1YRNB 1ZKGA 5E3LA 1IV6A 3HEFA 1Z77A 5IOYA 3SDGA 5FKNA 2R93J 2DTZA 4AUXA 2MSYA 2AO9A 1H88C 1I3QJ 4A3DJ 4G12A 1B72A 3S15J 2L9RA 1ITYA 4BY7J 2O7OA 3HOXJ 2Y9ZA 2P81A 2EZIA 2JK3A 5EZHA 4UUTA 1AKHA 2E2IJ 2M8GX 3S1MJ 3OSGA 4LOCA 3TW7A 2COBA 2EH3A 2W48A 5HODA 4A3LJ 1MH3A 3TEDA 3S1RJ 3JRCA 1TWFJ 2K9QA 2WAQN 1X58A 4C3IJ 2LR8A 3GTJJ 1WH5A 1MSFC 2GM4A 1GDTA 3JRFA 5J3LA 2XGDA 5J1UA 2JA8J 4JP0A 1BL0A 2FQ4A 1MBEA 4FCYA 2CQQA 5K7FA 4GFBA 4A3GJ 3JRGA 2R5YB 1ZQ3P 1WCMJ 3LSJA 4NDLA 4UUSB 2RAEA 1TWGJ 1FJLA 2EZLA 5FLMJ 1RETA 3OOUA 3LNQA 1JT6A 3LSPA 3HOUJ 1B8IB 1LFBA 5C44J 1R9TJ 4D7MA 1Z0XA 4UUSA 4A3MJ 1RR7A 2E1OA 1ETYA 2ZB9A 3GBGA 2DMPA 2ME6A 2IAIA 2HQ5A 1K83J 4Y7NJ 5C3EJ 4V2FA 2HI3A 2JA6J 2Y0SN 2WB1N 2HXOA 3JREA 1AHDP 3Q3SA 1IUFA 2HOTA 1JUSA 3RZOJ 3O8HA 1JKRC 1UHSA 4W1UA 1MBFA 3S2DJ 4BXXJ 3Q0VA 3TP3A 2XSDC 2XGEA 4BBSJ 3BQYA 2E19A 2JN6A 2NS8A 1I50J 2HOAA 2Y31A 2VI6A 2NVQJ 4A3JJ 5F0FA 3A02A 4FISA 4M3EA 4D5CA 4A3IJ 1LE8A 3NARA 3L1PA 2LFBA 3CQZJ 4CYCA 3JRBA 2ELKA 1Q1VA 2M9HA 2H8RA 3WHCA 2D5VA 5E3MA 1DU0A 4D7NA 2JA7J 1P7IA 5FKKA 3ZQFA 2KT0A 2VPRA 5F0CA 1NK3P 1HCRA 3JRAA 2DN0A 3DCFA 4V2GA 1MBHA 1LE8B 4D5FA 3ZQLA 3A01B 1YRNA 2JA5J 2CJJA 1MNMC 2O9LA 2L0KA 3VPRA 3S17J 3W6VA 2DA6A 1OCTC 3FK7A 5M5YJ 1VF9A 4DZJA 3RKQA 4HNVA 1GVDA 4QIWN 2L7FP 4AYBN 1FIAA 5FKMA 5M3FJ 4ABZA 2NVXJ 5EF6A 2H1KA 2XPVA 1TWAJ 2HDDA 3HDDA 3SFIA 1W0TA 2Y2ZA 1OJLA 3ZOBA 2QF7A 2DA5A 1HF0A 5FKLA 3ZQIA 4XRSA 3BR1A 2DA4A 3LSGA 2K9NA 1AU7A 4XIDA 2KDZA 3C2BA 4M3GA 1APLC 5DS9A 3S16J 9ANTA 2R7ZJ 2R5ZA 1NTCA 2QCOA 3ZQGA 1BW5A 3BR5A 2TRTA 1FEXA
chains in the Genus database with same CATH superfamily
1HXDA 3DPUA 1YJNI 1YI2I 1HW5A 5LFAA 3OL4A 1ZN2A 5J4YA 5EYRA 3OOPA 4EJTA 1KYZA 4PJNA 4RGUA 4EGYA 3K70D 2EV6A 1D8JA 4MIMA 3V8JA 2JA2A 4BH9A 5HNHA 2DMNA 1WH7A 5IT3A 1P2FA 1PJRA 2V9PA 1U5TB 4IHYA 3FF5A 1FTZA 5HVQC 1BI2A 5D8KB 5F1RA 1HDPA 1ODDA 4YEJA 3J80Z 3I4NJ 4UB6C 5D4SA 5BOXA 3CJQB 2V6EA 2XIGA 5AIQA 4CZZA 2NNNA 3ZMVA 4ENKA 2QLZA 1RKTA 1QZYA 2VOPA 3ECOA 1BI0A 5HLHA 1B72B 3OS0A 3S3MA 4I0BA 3EPZA 3J81Z 3FHZA 4ZDOA 2IVMA 2VBWA 2LYCA 1ZHFA 2CMPA 3G4SI 1WJBA 3H3VK 5C4JJ 4G7OF 1TW3A 3WTTC 1T0FA 1VQ6I 2MW8A 1X1DA 2JMWA 2HXIA 3JRHA 3BT9A 1ZK8A 4M3DA 1GHCA 5EEAA 2MH9A 3RQIA 3J80K 5LEJA 1V4RA 2EIKH 3AG1H 1ZR4A 1GUUA 2E1CA 2B63J 2W7NA 3OSFA 3FK6A 1ZRDA 4A3BJ 3WHBA 4M74A 1TC3C 3H3ZA 2LOOA 1R00A 3MD2A 1WVRA 5FRMA 5J4VA 2DDAA 1XGSA 3CUQC 1BA5A 1OYYA 3ROUA 1LDDA 3L2QA 2R0QC 2WY8Q 3E1SA 2WB1A 2HKOA 4NUBA 3SEZA 1S5LC 2VQCA 5IYBJ 5DTDA 2LK2A 2RNGA 2E5ZA 4E6KG 4KIFA 3A03A 5AONA 3ZQHA 5H6QA 2LF8A 2HFHA 3I9V2 4XBFA 3OIOA 3K4CA 1H8AC 5FJ8J 2M87A 4NBQA 4KDPA 4B4CA 3RYRA 1WPKA 3PFIA 4GXOA 4L0ZB 2DMTA 1MNEA 3DKWA 1E3PA 1XPXA 3L2UA 1I1GA 4A3FJ 1Z7LA 3JR9A 1V54H 1CF7A 2HTSA 1W0UA 1GT0C 1B6AA 1HKTA 4LIVA 2VN2A 3P7NA 1S7OA 5LBQA 2JSCA 4RS8A 4GYGA 3C7JA 1Y1VJ 4CCNA 2OBPA 2Z2SB 1HOMA 3QYBA 1MMGA 1XDUA 3H5NA 4IPAA 5DUIA 2DCEA 5B1AH 3K69A 2TCTA 3S2WA 3L2CA 3HTSB 4RA2A 3JRIA 2XRLA 1ZRCA 3ZGKA 3H0GJ 5ED4A 3VFZA 2FOWA 3DPTA 1JKPC 4OINF 4OMYA 2YU3A 1MW7A 2DJNA 2MYSA 1BC7C 3CD6I 2V1UA 1SD4A 2UWMA 4CCKA 2QGUA 5E8IA 1OR7A 4Q4ZF 2C6YA 2ISZA 3TP0A 4ZZLA 2Z5UA 3CCLI 1K78A 3N05A 1J7KA 1ETXA 3GTLJ 3BJ6A 2Q2EB 2VBXA 3N97A 2ZXJA 5F0HA 1JTXA 5CQEA 5JVTA 4FTHA 3BTJA 1V55H 2RGVA 4ENJA 1YW8A 1N78A 4IRHA 1UG0A 2R7SA 2A69F 4HQEA 4G6DA 2O8KA 3H5AA 2PMZA 3W2AA 2M2EA 4XONA 3KYDB 4KN7X 1VQ9I 4XRMA 2A07F 1JJ6C 2E60A 1STZA 1O57A 2HYGD 4GRIA 3J7YJ 2DAOA 2A6EF 5M3MJ 1QZZA 4EJWA 1BI1A 3CUQA 2BW3A 1IN7A 3HPHA 1WGXA 2M0MA 3L00A 1BR2A 4RGRA 2IEKA 4JX4A 2PMHA 4BKXA 4G6QA 1ZYRF 1TTYA 3G1OA 2Z33A 2ZO4A 1HC8A 4E4HA 1SMYF 5M5XJ 1B8IA 3GF2A 4AWXB 3HOZJ 2R5ZB 3S8PA 1XGNA 3JW4A 1FX7A 2X1DA 3GTPJ 1Z6RA 1S72I 4O5VA 2N8GA 1TWHJ 3HB9A 2XF5A 5L3BA 3JSOA 5CPRB 2GOXB 1Z05A 2V1NA 4L5IA 3WTUC 4E7LA 4JYKA 2R7OA 2XF6A 2Y69H 3ESWB 2GBYA 3MWMA 4Y52J 5C4XJ 2CV2A 1XSVA 2OCCH 3QAHA 2FBKA 4IQ4A 5D6EA 4ENMA 4WXDA 3ABTA 4AIJA 2E1MC 2ID3A 2H94A 3BR3A 2PI0A 5EZGA 1B9NA 2FBIA 2JZYA 3EYYA 3MFKA 1TP4A 1OCPA 4FT8A 2DOEA 1X3ZB 1G3SA 2W84A 2H27A 1PUFA 3PUFA 4RB0A 1TT0A 1YITI 4CYCB 3PIOF 4RAZA 4W97A 1YLFA 1TNSA 3CMYA 1RNLA 2E71A 4E7HA 2LKPA 4BACA 5FLVA 3NWSA 3IP4B 4BE2A 5FO5A 1EKEA 3FWEA 2OCEA 2VKVA 3S32A 5JI6A 4Q5SF 4ETSA 2PX9A 5FFZA 1ZG5A 2E2HJ 3DP7A 2W4SA 4KFCA 1F5TA 1S29A 2D1HA 1WJFA 2FRHA 3OYHA 2CU7A 2E7XA 5K7HA 1IF1A 1FOXA 2DJIA 1BJZA 1NH3A 3COAC 3HGYA 4CYDA 1ETVA 1VQMI 2L54A 2LY1A 1ZKGA 3CCJI 3HSFA 3P9KA 3QYEA 2COMA 3T5XA 3LSHA 1RC9A 1Z77A 2HNHA 3D5SC 5IOYA 2HDCA 2GIVA 3K4NA 3MKZA 3FMQA 1FBQA 2R93J 2BXZA 2QQ8A 2FU4A 4LK1F 3ERMA 1H88C 3KCCA 2ZXHA 2OD5A 4A3DJ 2XAFA 2R7UA 3ZCOA 2RDPA 4AIHA 5GADJ 1C0WA 2FF4A 1DP3A 1T95A 2OV7A 3OYGA 3S3OA 1PDNC 1K78B 2P81A 4LFUA 1T2KA 4OMZA 1R23A 4HQMA 4XN0A 3OSGA 1I39A 1J5YA 3TW7A 4D9JA 3IC7A 3L9FA 5JHUA 4JOMA 5HODA 4II3A 2BE5F 3LSTA 4L9NA 2Y48A 2VT2A 3J7AO 3E3VA 4MNUA 3QYFA 5FROA 1V3FA 2LR8A 4XSXF 2ADUA 4R8HA 1MSFC 2K4BA 2ZJPF 3CUOA 2J5OA 1IXRC 1S7AA 5J3LA 5J1UA 2JA8J 3JTGA 3WTSC 3U21A 2A05A 2K7LA 2FSWA 1D1AA 4U0VA 2R7TA 3DQVC 5LGUA 2CS3A 4Y15A 1VQNI 1FOKA 4NC7A 4A0YA 1LNWA 2BOLA 2R7DA 4AVZA 3ASOH 5FLMJ 1JT6A 2IW5A 1FOYA 3HZJA 3PNTA 5C44J 3OYEA 4D7MA 2W1OA 4L9JA 2E1OA 4HX7A 5GAHJ 1ETYA 3GBGA 2ME6A 3EUHC 1GVJA 3W2VA 2R7RA 4PFPA 2HI3A 2JA6J 4EM2A 4WCGA 3PFYA 4FX0A 1AHDP 1J2XA 3N4MA 3OS2A 2IXSA 2A68F 1LFPA 4LB5A 2ACJA 1JKRC 1UHSA 3GFLA 4W1UA 4RAYA 3S2DJ 5E1ZB 1WHUA 1YG2A 3MQ0A 4EGZA 2EB7A 3ZN0A 5ICCA 3WGIA 3BQYA 2DFHA 2LDUA 4Y3OA 1O7LA 1IN8A 3D5RC 4RLFA 1EJ9A 3FXQA 4A3JJ 5F0FA 4FISA 2JUCA 2NS0A 3BZKA 4A3IJ 3E6CC 4LG3A 3I0TA 2LREA 3M1EA 3CQZJ 2VQLA 1TNTA 4CYCA 5D5UB 3JRBA 5K5QA 2L4AA 4MHGA 1AOYA 1FSHA 3FXMA 1DU0A 3PQJA 4D7NA 4L5JA 2JA7J 1J09A 2W25A 4M6XA 4U7BA 1LPQA 1EV7A 2HZDA 3CDHA 4DIQA 2DXIA 2DQRA 3KZZA 1AWCA 1YX5A 3WGHA 3ZQLA 1YRNA 3F6VA 5DM7F 2CJJA 4WF2A 1MNMC 3VPRA 3W6VA 2K3FA 3BWGA 2X4HA 5LGNA 1W1WE 4D1QA 3IRQA 3DEUA 3C3WA 1Z21A 5M3FJ 2MLGA 4FHTA 1KZHA 2Z9OA 4HLXA 3HDDA 4XKWA 3DF8A 4LGWA 2YX4A 1SVLA 2P4WA 3PUBA 3SXYA 5LEKA 2KIUA 5FKLA 5J6XA 3ZQIA 4XRSA 3LSGA 4FASD 2GXBA 3C2BA 4NQWA 1MMNA 1UHWA 1W5SA 1LEAA 2WA0A 1FZPB 2R7ZJ 9ANTA 1FOWA 2F4MB 1SVMA 4AYBA 2TRTA 1FEXA 4BU2A 5B1BH 1Y39A 2P0WA 1FYLA 1XMXA 1OCZH 1A35A 1ZLJA 1TZLA 2QBYA 5FLXZ 1X3UA 4YFKF 3FMSA 3IWFA 1CF7B 2KRFA 4ESFA 4MFEA 5TJJA 4YIFA 3EQLF 4KNYA 3QQAA 4I7HA 3FIWA 2OUMA 3SFZA 5D8LB 5JR3A 4HEA2 5DD4A 3AG3H 1Y0NA 3VYUB 1RZ4A 2M0CA 3K4MA 5IYDJ 3F3XA 2NS7A 1VQ4I 2MG4A 5GAGJ 1XS9A 4XKBA 1JUPA 4Z6YA 3WTWC 3CZ6A 1UELB 1P4WA 1R5HA 2D1VA 4I01A 2IA2A 1X1AA 3HYIA 4FETA 1QRYA 3DKYA 2YS9A 3QRFF 2IP2A 3VDXA 4DYQA 5DDGA 4A3CJ 2JWTA 2IS2A 2JRMA 2M1BA 4LJZF 3FISA 3HOYJ 3I71A 1IDZA 4CCLA 2HZTA 4XLNF 3QPTA 2OZ6A 3BG9A 2HOEA 2X6YA 2CUZA 1MZBA 3CLQA 2K27A 2NAZA 3E7LA 4YG2F 3PNVA 5A2QK 1MMSA 3FXJA 5K5RA 1XCVA 2LBFA 3OYJA 3GTMJ 1XGOA 5F6FA 1ZGWA 4D0PA 1MH4A 4IHWA 1WKMA 3F8CA 4ESBA 2DFEA 1MJ9A 2DO7A 3AL0B 3CESA 5EGOB 3ECHA 1QPMA 1P4XA 4G94A 1CGPA 2WAFA 1ETKA 1NG7A 3P5JA 3K10A 1GLNA 1ULYA 1D0YA 2LG4A 4KMFA 1IO2A 4E70A 4IRIA 3EYIA 1SEUA 1Q1HA 3QP6A 3BDDA 2D45A 3DBLB 3JCUC 3K1PA 2CGPA 1KU9A 4MFDA 5EG0A 4LK0F 1LB2A 1NK2P 5L3DA 1D8KA 1F9NA 3WGGA 3DLAA 3L09A 4UVCA 1DQUA 1IRFA 1UJ8A 2VPLA 4X6AJ 3BCAA 2HGCA 1OFCX 4P5OA 4YRVA 3A01A 4L9VA 1WI3A 1I6HJ 1FBUA 2M8EA 4NC6A 3H92A 1YJWI 1IC8A 2DYRH 1YTYA 2LF7A 2WBMA 2VL8A 2JJ7A 1DGWY 1V5FA 4B1RA 1ZR2A 2HPMA 4IHVA 3TO6A 5JLXA 2VB6A 2W82A 3S1QJ 1KU3A 3MVPA 3IH3A 3O3KA 1FIPA 2FUG2 1K6OA 2KZVA 4M3BA 3WE2A 2P6SA 3HSEA 1XC5A 2DOAA 4LIUA 5CLSA 2L9SA 3UR3C 5DYMA 4QTRA 4XLCA 4ZYDA 3H0DA 3LAPA 5IP6A 4PJLA 1OCOH 1BIAA 5L3GA 1SFEA 2YR2A 1R71A 4UV9A 3BOQA 3KP5A 4HPQA 2DPUA 3FZVA 5F1JA 2QVOA 3CDIA 1YE9A 4XICA 4KA4A 2MGQA 1F36A 2RQPA 2W85A 1V5EA 2X6XA 3P9CA 1P9QC 1MDMB 1W4MA 2A6TA 2BV6A 3CP8A 4MO7A 1JGGA 1F43A 4AC0A 2WV1A 2PJRA 3I4MJ 2QQBA 3KEYA 3LSMA 3V42A 3F0CA 3GEZA 5EDNA 4U7DA 2ID6A 2W24A 1VQ8I 5LD2C 2KRCA 4FE7A 4MLOA 2Y9YA 4NC8A 1FYMA 3BZ6A 2F48A 1PUFB 3ASNH 3FXOA 2CSOA 2JRTA 5F04A 1KQ9A 3JSPA 3DFGA 4PZJA 3ZQCA 1Y8RB 4KIBA 2KQRA 3TOAA 1GXQA 3HOSA 1QZEA 2FBHA 2X0LA 5ILVA 2JVGA 1EF4A 3F9KA 3GLLA 1FNNA 3OYMA 4PFOA 1KA8A 4Y17A 3VYRB 4RAGA 1IGNA 2DFIA 2GOMA 3H35A 4HYEA 5BNGA 5L3CA 4HBLA 2EK5A 1D5VA 1BM9A 3KE2A 1RESA 3HOTA 3G71I 4V19K 1W5TA 4KN4X 2BEOA 3OYKA 3RKWA 5CJ9A 2X9DA 1K79A 4OWRB 2F4IA 4MTEA 3MEXA 4B8XA 2L3DA 1D5YA 3T0YA 5GTHC 1UG2A 3DEEA 4IX7A 1AA7A 4DGWB 3S1NJ 1EH7A 3VYTB 4M71A 1T56A 1QO0D 2CUEA 1UCRA 1X1PA 1FC3A 4MEXF 1JGSA 1MBJA 1MJAA 1CQTA 4RMNA 5GPCA 1PYVA 2YUSA 2XKOA 5IP7J 3CUQB 1Z67A 4KUMA 5DEQA 2GA1A 3BR6A 4XKVA 4OIOF 4P9UA 1J9IA 2QA4I 3OYAA 3CJRB 4L5EA 2XPUA 1M1EB 2LD5A 4WX9A 3J7AY 1MGTA 1X1CA 1SFOJ 1P92A 1S7EA 2CYYA 4HLYA 4DW6A 2F5EA 1SAXA 5FKOA 3GYHX 3KYLA 2FD5A 1QBJA 5HDGA 2ZFWA 2CWEA 4IZZA 3GTGJ 2HYFA 5FFXA 4HDUA 5CVJA 4HOBA 1VQ5I 2HVRA 2OF7A 3B6CA 2R92J 3KP3A 2PLYA 2MH2A 2EFOA 3FXRA 1R5GA 2LVSA 3CDLA 3CC4I 4ZJZA 1BI3A 3ABKH 3SZTA 1ZG1A 1T6SA 1A6IA 4U0WA 5EJCA 4AU7A 1QGPA 3R61A 3MZ8A 3OYLA 3HKZN 4E7SA 3PJRA 2K86A 2JQ7A 2E34A 3GTKJ 2E2JJ 2RNJA 2DMQA 3ZN1A 2DT5A 3DU5A 3M8FA 3OYDA 4EQQA 2VKDA 1S3JA 3X2QH 2K85A 2VE8A 3GMEA 4UHTA 4BJ5C 2F2EA 4CCOA 3ELKA 4IHSA 1IV6A 3FHNA 3CCUI 5HDKA 2O5RA 3HUGB 1IV8A 3WTZA 4CH7A 3R4KA 2RREA 1MDMA 4U88A 3EDPA 2MA3A 1P6RA 4CZCA 5B66C 4RB2C 3KP6A 3S15J 1B72A 2IA0A 2HVQA 2L02A 3F6OA 1BR1A 1ZGJA 4XORA 2D2WA 3RSNA 1N75A 1R1UA 4BY7J 4MTDA 2Y75A 4E7JA 3CO7C 1MNDA 2PJPA 2LMDA 2E2IJ 2M8GX 2R4GA 2VC0A 3A0BC 2OQGA 3AFHA 1O3SA 3KPHA 2HTJA 1D1BA 4LOCA 4ZYAA 2EH3A 3U2RA 3TEDA 3VODA 2ZKZA 4I98B 1TWFJ 4HSTA 4EJUA 1E3HA 1YW7A 4F3QA 4BE1A 1WJCA 5CVIA 3GTJJ 5DCMB 2VJIA 4ASNA 1TT5B 3CTAA 3JRFA 5DV5A 2BVMA 2XGDA 4IQJA 2XAUA 1BL0A 2FXAA 4KIGA 1KU2A 5K7FA 5D5VB 4GFBA 1LKXA 4A3GJ 3JRGA 1R58A 1NHAA 2KL4A 1WCMJ 2OC6A 1SFUA 4E7IA 1TWGJ 2BBYA 2ZSHB 1ZELA 1ZARA 1BN5A 3OYFA 4G6TB 2QKLB 3LSPA 2VE9A 1YOVB 4JQFA 3HOUJ 1IXSB 5J47A 3QODA 1Z1DA 2IJLA 1MMDA 3A4CA 1IW7F 2Z16A 2ZB9A 1MMAA 4ON0A 4OOIA 1QHHD 2ICWG 3HXLA 2FNPA 1Z3XA 3LQQA 3C1DA 3KYCB 2ELHA 5FD6A 2HXOA 2XF7A 3L2RA 3GZ6A 5LGTA 5HDNA 2HOTA 4LITA 3RZOJ 3CF2A 4NNJA 4XLPF 2DOFA 1ZLKA 3TKYA 2M4KA 1DDNA 2AQEA 5HS9A 1H0MA 2DLLA 4HF0A 4BBSJ 2E19A 3EETA 2HOAA 2RC4A 3CC7I 5BQTA 3IAM2 4L18B 1T98A 4YELA 3A02A 4M3EA 2YPRA 1WSUA 1LE8A 2GAUA 1JI8A 2TDXA 1USSA 4A5NA 3NARA 3TGNA 1TL8A 1T39A 1D0ZA 1B4AA 1OKRA 4AM3A 5CVUA 2M9HA 2H8RA 1H9GA 5ICFA 2CFOA 2JTVA 4A6EA 5E3MA 2M7BA 3CMEI 1P7IA 5FKKA 4NHJA 1X3WB 2EJRA 2HR3A 3SZGA 3JRAA 5HLGA 4N9IA 1R4NB 2HS5A 3E6BA 3DCFA 4V2GA 3J7ZI 1OISA 4HF1A 3LWFA 4OAYA 1OLTA 4XLEA 1A6QA 2CV0A 2BY1A 1FYKA 1IUYA 4PUSA 4BDZA 2O9LA 4O6JA 2L0KA 1S6LA 3S17J 1L3LA 4KISA 1OCTC 1TQIA 3FK7A 3OS1A 1S8NA 1VF9A 3RKQA 2EV5A 4IRGA 3CF5F 1N77A 4QIWN 4XSZF 3RQ4A 4AYBN 3ERED 5FKMA 2FOKA 4I2OA 5BPIA 1RI7A 5EF6A 2H1KA 3B73A 3KEOA 2KDOA 3HG9A 1TWAJ 1N25A 1U0JA 2HDDA 3SFIA 3ZR8X 1MIJA 2ZMEA 4DQ2A 2NXNB 3RIRA 3K4LA 3VSKA 2H1LA 2QF7A 2DA5A 2PG4A 1DPUA 2EFPA 3KLNA 2DA4A 1D3YA 3QWLA 1FBSA 2KDZA 4BHCA 5DS9A 2Z1DA 2R5ZA 1A04A 1FP1D 2QCOA 4IVNA 4KICA 3W2WA 3ZQGA 4B44A 2G7HA 1VZ0A 5D6FA 4YIIA 4QLCU 2B9SA 2ECBA 4QSHA 5JVGF 4BE0A 3IAS2 4DYCA 3NAUA 5AIPA 4DBRA 3GZNB 3ISPA 3LFUA 2GXGA 4RB3C 1SC7A 1PP8F 1O3TA 2CFXA 2M3AA 1YW9A 1TQMA 1G2HA 3V4GA 1IRZA 2KPMA 3FKIJ 2AQFA 3R0AA 1RRJA 4HRIA 3QPLA 4JX6A 4II2A 4O3MA 3NWTA 2IS6A 3QPSA 4BS9A 2G7UA 4C2UA 1D1CA 1U9NA 1Z9CA 2DK8A 2VC1A 1W7PA 3V7SA 4L0YB 2L7KA 2QWWA 2V26A 3DV8A 1F1ZA 2RKHA 2ZXIA 1QNTA 1IRXA 3DU6A 1WFXA 3MMYB 1Y1WJ 2H6BA 3HOVJ 3TQNA 3BPVA 2X6WA 4PGHA 5L3EA 1BW6A 3CCRI 2VIXA 2W57A 5DCFA 2HEOA 1SFXA 4FE4A 2STTA 5GPAA 1DP7P 1IN5A 1WWXA 1R6RA 5E3OA 1VQLI 4N0BA 4I76A 1ORKA 2HOSA 4DZPA 3PO3J 1H9TA 1TBXA 2ETHA 3HTUA 5D5XB 5F08A 4CHUA 4Y33A 3T8RA 4BJ6C 2K40A 3MCZA 1SVOA 3I3LA 2RV8A 5ILUA 4AIKA 2STWA 1XD7A 3WU1B 2M4GA 2FMLA 2ZMEC 1X4PA 2MD5A 5H6RA 3HGGA 5TGTA 4J19A 2DFFA 5LRRA 4C9YA 1EH6A 2BY3A 2VQGA 3RJPA 1VQOI 2UUZA 4M3FA 1D0XA 1NG6A 3BR2A 3BG6A 2WAQA 2Q8KA 3I53A 2WADA 2V6CA 4XKCA 3QOEA 2OU2A 3BTLA 2BHZA 1AKHB 4X1EA 2DW4A 2ZJ2A 3DWLE 2E7WA 4ZYEA 3KP2A 2XPWA 4EVIA 3FBIB 3HHHA 1Z7UA 4G7ZF 4RLQA 3BTCA 4XQFA 1OR7C 4HX4A 1HA8A 3MAJA 2EZHA 5IYCJ 3SHFA 4EEFG 5IOZA 4S05A 2IBDA 3MKWB 2E36A 5A2QZ 4AIDA 1QQIA 2OTLI 4F7ZA 2CQNA 2J5PA 2KIFA 2KKOA 2JT1A 4BYYA 3OYNA 3PQKA 1U3EM 2VBYA 5CKTA 1UHMA 3NRVA 1T8IA 3HL2A 2MLKA 3LSRA 4B47A 4N4OB 3QP5A 1YJ9I 4M73A 3IV5A 1ZH5A 2R3SA 2KJBA 4B3AA 4IJAA 2DTRA 1I6XA 1WJ5A 3DBRB 4A12A 1TLHB 2VUMJ 4WWCA 3V8LA 2M5WA 3BQZA 1U9OA 3CCEI 2OJED 3RZDJ 3VWBA 1GXPA 2X1EA 1B59A 2LKSA 3BPXA 4CDGA 4BEHB 3GX4X 2WC2A 2BW3B 1DPRA 2CQ7A 1R36A 3HOWJ 2BZTA 3AL0C 2XGXA 4HG2A 2MD0A 3SJMA 2UXNA 1XMKA 4FX4A 1R7JA 1R22A 3M4OJ 2FA5A 1FMWA 4L9TA 5KNLA 2YX7A 3E5XA 3U1KA 2LKXA 3V7CA 2BGCA 3Q0WA 2YU9J 4QWQA 4HNUA 2PN6A 1FT9A 2DA1A 5DD8A 2NVYJ 1JE8A 4DBQA 3E97A 3BG7A 1B9MA 1REPC 1B1BA 2MBFA 2QENA 3B6AA 3F8FA 2PBIA 2XV4S 2OZUA 3HBLA 1JTYA 2Q2EA 4XRSG 4BJTA 2K5CA 4A6DA 4BEHA 3A0HC 4XN3A 2IS4A 1KONA 3HRSA 1U8BA 2NOGA 2L01A 4BQOA 2K4JA 3KIOA 3EUKL 4C2MJ 3SZPA 5EG0B 3AAFA 2LRDA 1VQPI 1MKMA 2ZSIB 3M3YJ 4G9YA 4Y13A 1GV5A 3F22A 3WU0A 2HQNA 3KEQA 3O6BB 2PEXA 4IF4A 4JBAA 1OCRH 3LAJA 4BHPA 4KYWA 3E6DA 3RKXA 1KYWA 3A1YA 4M6YA 1T0FC 2O8XA 3ULQB 1JKOC 2CW7A 5JLWA 3HSRA 2KP6A 1G6NA 1J59A 2GIZA 2XGCA 2QSFX 1POGA 2ZNZA 4BQNA 1G3WA 1XDSA 2FQ3A 2AXTC 5E17F 3JAMK 2LLKA 2LSOA 4S0HB 2CH0A 1R49A 4JX5A 3GWZA 3L2VA 3TMOA 5FGMA 1XG1A 3FMRA 1R5ID 5J8CA 1A5JA 3IH2A 3T8TA 2CO5A 1FTTA 4RM3A 1RPWA 4BBRJ 2HYJA 5GP9A 3GZ5A 1X2MA 1QPIA 1ETWA 4S04A 1WJAA 3GFMA 1MSEC 1P4AA 3E6MA 3DPLC 3QPHA 4A69C 5BS6A 3HHGA 4P9FA 1RR8C 4H4KC 4UVBA 1XB4A 3GO5A 3Q5FA 5L3FA 5DCMA 4JK1X 1HW1A 2PMZN 1FPQA 2P5VA 3G1LA 2X48A 1FWZA 2P5KA 3L2WA 4J00A 1ZG3A 5F27A 1HLVA 2EBIA 1DU6A 4XOTA 2K02A 4EM0B 1HW2A 2DK5A 2QYOA 2DA7A 2QBYB 1BBYA 2OAZA 3R6SA 5LRSA 3K4KA 2A6HF 4E7KA 4DYRA 2QSHX 4F55A 4XR6A 3G1MA 1E17A 2F5FA 3J81K 5J1YA 1G3YA 1BR4A 1UFMA 2KLOA 1L0OC 3HKZA 5BMZA 3H9QA 3BG3A 1YRNB 1TW2A 4MQVA 3DTKA 2V9VA 4J01A 3I58A 1SD5A 3HEFA 3CO6C 3AG4H 1W36C 3SDGA 3CCVI 2FEZA 5FKNA 3IHUA 2DDBA 2WTEA 1IRGA 3BC8A 2MSYA 5D4RA 3WU2C 2AO9A 1ERDA 1FMVA 2NVUB 1I3QJ 1DGRM 5LHHA 3OIQA 3TDZC 2RN7A 4BXFA 2QEXI 2K9LA 2QKMB 4LG0A 2KIQA 5FB2A 3TOBA 1ITYA 2KIMA 3CCQI 3FM3A 3WTVC 2BHYA 3LQRA 5E18F 1BC8C 2KHMA 3HOXJ 2PQ8A 2Y9ZA 1XTAA 2EZIA 4LLGF 1Y56A 2X85A 1AKHA 1LUJB 4UUTA 2MC3A 3S1MJ 3BJAA 2COBA 3VOEA 2W48A 5IY5H 1I3AA 1T08B 1ZRFA 1HKQA 3S1RJ 2ZJQF 2E1MB 3JRCA 3BY6A 4Z2YA 3MKYB 2AXLA 1X58A 4KITB 3LMMA 2GM4A 3SDBA 3TO7A 2ZNYA 4Q48A 1X19A 4JP0A 2VLAA 2FQ4A 1MBEA 1G3TA 1U8RA 2CQQA 4XRFA 1WZ2A 3UNGC 2G9WA 5EEHA 5K5OA 1HKSA 1ZQ3P 2L9NA 4IXAA 4XLFA 3LSJA 5JHFA 1Y8QB 4CA0A 5HS7A 1RETA 2GZWA 3OOUA 3PSFA 3LNQA 4OIQF 3R60A 1B8IB 1LFBA 1PP7U 3QU3A 1R9TJ 4OIPF 1Z0XA 2KFDA 4ZC3A 2WAEA 4A3MJ 2ZFUA 5TISC 3HUGA 3NQOA 1RR7A 3WTXC 2E35A 3H1CA 2PMUA 2DMPA 1FP2A 1YYVA 2IAIA 1K83J 3M8JA 2NNYA 2NOJB 2JSPA 2OA4A 2Y0SN 1FLIA 2WB1N 3F8NA 4CGZA 2LH9A 2OQRA 2XUBA 4I0AA 1JUSA 1W5CC 1R1TA 1LQ1A 3O8HA 4NB5A 1O3QA 2EFWA 3HRUA 4HSRA 3G6EI 4BXXJ 4EATA 2R7XA 4U0YA 4BHBA 5E79C 2JN6A 3E0JB 1I50J 1XX5A 2R7WA 3E5QA 3OYCA 3FX3A 2K9MA 3GLXA 3IRRA 3A2KA 1U5TA 5E20A 1WQ2A 2EFQA 1W36D 5IT9K 1JHFA 5B5EC 3L1PA 3ZMDA 2LFBA 4UV8A 2ELKA 1Q1VA 4CO8A 2L9VA 4BNCA 3CP2A 4K2EA 1A36A 2PJRB 1LDJA 3ZQFA 2JPCA 2KT0A 1SD6A 2DBBA 4HF2A 5F0CA 1HCRA 2R7VA 5KAFC 3FM5A 5DUKA 4EMSA 2DN0A 5TRDA 5DM6F 2VJ4A 1MBHA 2DYSH 4MGRA 3A01B 4G7HF 2JA5J 5D5WB 4CUGA 2VASA 1QHGA 4DOZA 3PNYA 2F5VA 3H9JA 5CQGA 4Y4RA 2DA6A 5FLXK 1ON2A 4LMYA 1HSTA 4WXCA 4DZJA 3I64A 3S93A 1GVDA 1XSDA 1R1VA 4KT6A 5H2FC 4XLHA 2P8TA 3ZMZA 3SQNA 2NVXJ 3H36A 2VODA 2VJJA 1RUOA 2XPVA 2BY2A 5HNFA 4XMYA 1W0TA 2XASA 4XNFA 3ZOBA 3IL2A 3OR2C 2E5NA 3SEQA 2EIMH 3G3ZA 3BR1A 3OYBA 3OYIA 4ZH4F 1O3RA 1Z91A 3KX2A 3WE3A 3RI4A 4M3GA 2WY7Q 1LVAA 1NTCA 1OCCH 5K1YA 2CQKA 2XVCA 4IO9F 3BR5A 3RTRA 1QU3A 5FRNA 1ONVA 2F6CA 1ENHA 3W6KB 3JAMZ 4I02A 3AKZA 3KETA 2EA2A 3W3CA 2VONA 2F5CA 5E1WA 1IN6A 1OPCA 5M5WJ 1YQAA 2O03A 1IDYA 3BP8A 2IGMA 2V79A 3HM5A 1GV2A 1JHHA 2O61A 2LY9A 1USTA 4RM2A 1H89C 4XM3A 2W00A 3RDIA 3GTQJ 2XAGA 1UMQA 2X6OA 2DA3A 3I54A 2R5YA 2QM3A 5BPDA 1UAAA 1RKWA 1MBKA 4ANJA 3CMAI 1ON1A 2LBFB 2P6TA 3UKGA 1JKQC 1BJAA 2GQQA 2KRHA 1G8XA 3BG5A 1KQ8A 4PGGA 1TWCJ 4A2UA 4I6ZA 5LHIA 1RIOH 4B3XA 4GYIA 4TV7A 2H8WA 5B3SH 4PJMA 1SAUA 2HWVA 1X2NA 2VKEA 4LG0B 1BW5A 2HQRA 1MBGA 4A3KJ 2AS5F 4UY8I 3K7AJ 4N9HA 5E8GA 4AD9A 3IWZA 2L7ZA 1LFUP 1HDDC 3OWTA 4GO1A 5J1RA 1VQKI 4C30A 4C3JJ 2MC4A 2L4MA 2XDVA 1XGMA 5J8FA 3BLYA 2UZKA 2EZKA 1K61A 3FKJA 4IKFA 2XB5A 2OTJI 2Q0OA 2HU9A 4A93J 2DQLA 2X1CA 3I59B 1U78A 3CJTB 3I4PA 2XAHA 1ZTRA 1IAWA 1O7FA 3FDYA 4FQGA 4HV6A 4IOAF 3OV8A 1YIOA 2BY0A 3K9TA 5E1XA 4QPOA 1I27A 1S9HA 2XB0X 5HLIA 4A3EJ 1YX3A 1F4KA 3DKXA 3I56I 3MZHA 3LA3A 2DA2A 2FJ1A 3GCMA 1K6YA 4HA8A 2HPIA 1JJ8C 3K2AA 3REOA 3CC2I 4ZDPA 3LA7A 3OL3A 2M30A 2Q1ZB 1PVEA 2DPDA 2XRNA 3TDUC 1ACIA 1KQ0A 2L5QA 2L7MP 1ETQA 1P7JA 1VI0A 4BAYA 2JUGA 3LA2A 2UXXA 4KT5C 2M34A 4ZZDA 1XSXA 3W6JB 4RBOA 3PIPF 3RYPA 2CQXA 4U87A 3I59A 3U1DA 4B09A 5EGOA 1EA3A 1G4DA 2KZGA 3OMYA 2VJ5A 5IP9J 2RQQA 5KAIC 3H3UA 4IOCF 3O8GA 2YSRA 4R79A 2VT3A 2QUFA 4EM1A 3I55I 2XHKA 3NEUA 2CW0F 2B0LA 3Q0UA 1JUMA 2BVLA 1QVUA 1QVTA 2EPFA 3WG9A 1ZREA 4HW0A 3G73A 1SMTA 3ABLH 4CCMA 4BY1J 3BROA 2G0EA 2A61A 2R7QA 3S3NA 3S14J 1YS7A 4YFXF 3HC7A 4IHTA 5E3NA 2I8DA 3WODF 1IN4A 3L7WA 2O0YA 2IA1A 3ABMH 2IGOA 3DTIA 2MFZA 4E7ZA 3DEWA 4PSXA 2PFBA 2EIJH 4KMUX 4XK4A 1ETOA 2Y0SA 3FXUA 2I10A 2MABA 3VSLA 4BQQA 4LLLA 4CXFA 1YHQI 1XMAA 3ZMSA 3HJEA 2NRAC 3BJOA 4RGXA 5H20A 4YIRX 4M6VA 1UZCA 2ELJA 4OU0A 1SANA 3EUHA 2ME0A 3ABUA 3JRDA 1LEBA 6PAXA 3OY9A 1LDKB 2KISA 3MN2A 3F8BA 3KZYA 2F4OB 4HNTA 3LL7A 2IT0A 3RPUD 3DLLF 2FX0A 3BTIA 3DXJF 1HSJA 4PJJA 5CVVA 1YO5C 2BXYA 2A5WA 3BCBA 1IZ1A 3HPGA 1J0RA 1IJWC 2O3FA 3LOCA 4EJVA 4ENNA 3CCYA 4Q47A 1A31A 2A3SA 2IGKA 2I5UA 4IEJA 2DT7B 1T33A 3BR0A 2DMUA 2V1DA 3K6GA 4LB6B 1YS6A 2K9SA 2OPTA 2L2OA 4WK8F 4XOPA 2CRGA 3TL4X 3IKTA 2ISYA 3CJNA 1YIJI 4P55A 2HKXA 3U9GA 4ZTFA 2FE3A 2Y30A 1U2WA 1VFCA 2GLOA 2ESHA 2K3PA 5KHDA 3IH4A 3TW6A 2XKPA 3RKYA 2CUFA 4A5MA 2DU9A 5ICGA 4P96A 4ITVA 5K7ZA 2V4JC 4MQ9F 4M9ZA 1O4XA 1E3OC 3PO2J 2QZ8A 1W7PD 4N4NB 3K1NA 4PDKA 5IPAA 4LLNA 2NVTJ 2RVCA 1RUNA 5HS8A 3S2HJ 2Z3YA 3FBNB 3ZQQA 1XCBA 1WRJA 4C3HJ 2GA2A 4GCVA 4XLAA 2P5LC 2CUJA 3D5LA 2LTPA 4UVAA 3IKVA 4I99C 4ZTJA 1JXSA 3LSKA 1JT0A 3ZP5A 2DT6A 1VNDA 3D1NI 4F92B 3CMMA 4P1WA 1WJEA 3HRTA 3Q9SA 2XAQA 4QPQA 3E5UA 3CCMI 1IG7A 3PM1A 2LP0A 3GVAA 4M9XA 3ZRGA 1I1SA 3GW2A 3SYTA 1EH8A 1VQ7I 4UB8C 2VXDA 5F64A 4HAMA 2AHQA 4PSWA 2X51A 2ECCA 3TBIA 4EJOA 1BOAA 4CCJA 3MKLA 3ZPLA 2O6GE 2ZJRF 1E2XA 1YFHA 2VXZA 2EILH 4IHXA 1UB9A 1X1BA 1OYIA 4RDUA 3K2ZA 3K4BA 2ZXWH 2DI3A 3BZCA 1OYWA 1BOBA 2EQRA 4RAFA 4BQAA 1HBXG 3WG7H 2B7EA 3K0LA 2ZC2A 4BUPA 5ICEA 3C2GA 1K4TA 3KFWX 3GTOJ 1OQYA 2IGNA 5E3LA 3H5RA 1LJ9A 4ZDLA 2A5YB 3F23A 3DBHB 3KLOA 2IS1A 4EV0A 3VYSB 2DTZA 4AUXA 2CV1A 4C2TA 4HX8A 3ZQ7A 4UXNA 4BXUA 3C2HA 3I5UA 3OR1C 3RCOA 3EUAA 3OIPA 4G12A 3WTYC 1MJBA 1U6GA 2L9RA 3KZIC 4IL6C 3LSIA 4MEYF 2V1XA 2XC7A 2V7FA 2EWNA 3AG2H 2UV1A 4R1HA 3V7RA 4HZFA 2O7OA 4F52A 2H6CA 3P9IA 4UNOA 2JK3A 5EZHA 5FD5A 3ZMTA 1W7PB 1KGSA 5LHGA 4AVPA 1DUXC 1Z3YA 4A3LJ 1QA6A 1MH3A 2LC2A 1XN7A 2EINH 3Q9VA 4CICA 1J75A 2K9QA 2WAQN 4C3IJ 3HIFA 4RB1A 1WH5A 1GDTA 4XL9A 4ZYHA 4LD5A 4DJAA 4G8XA 1SFKA 4PK4A 4FCYA 4BL0B 1LVKA 5CYVA 2R5YB 2DODA 1U5TC 4NDLA 3QOPA 4UUSB 2RAEA 2GWRA 1FJLA 2CG4A 2EA4A 2EZLA 3CLOA 4M72A 3ZMUA 5GTIC 4HV5A 1R4MB 1Z6TA 4NQWB 1V5GA 1ZAOA 4RGSA 2V9KA 2ZCWA 1Y0UA 2GXAA 2QSGX 4OIRF 1BIBA 4ZYGA 4UUSA 1TQPA 3GFIA 2IRFG 3CCSI 3G2BA 2Y0MA 3DTEA 3GFJA 3JTHA 2HQ5A 3D0SA 4Y7NJ 3M07A 5C3EJ 4V2FA 4HDVA 3PL8A 1MD0A 2EFNA 2P7VB 3Q3SA 3JREA 1IUFA 3HRMA 3O2PE 2IPQX 2VKHA 2VQHA 1VTNC 2NYXA 1FY7A 1MBFA 2ESNA 2LY2A 3K70C 1T38A 1K7AA 3Q0VA 3TP3A 3FXLA 2XSDC 2XGEA 2KMUA 5KK1A 4A0ZA 2NS8A 3C18A 2F5DA 4X0GA 3K4JA 2Y31A 2VI6A 1FSEA 3F72A 2NVQJ 1PUEE 2XROA 4D5CA 2KJCA 4F93B 4BGDA 4I09A 2Z99A 3FXKA 4M9SA 2CW8A 2BYVE 2M7AA 3WHCA 1X4OA 4KJZA 2D5VA 2JVHA 3MZYA 1KU7A 4UUVA 2XAJA 3KP7A 2QQ9A 4CSWA 1WJDA 1HQCA 2VOOA 5JFRA 4WXHA 2VPRA 3V8KA 1NK3P 3F8MA 2QQAA 3M7GA 5GAEJ 3LFKA 4YFNF 1I5ZA 2XSJC 4OAZA 3H9GA 5J40A 1LE8B 4D5FA 2HVSA 5LLQA 3RPQA 2M45A 5KCMA 2H09A 3ZXSA 3ML6A 1G59A 2HQAA 3M8EA 4F91B 3PSIA 1Y6IA 3M1CA 5M5YJ 5EEGA 1WI9A 2E1NA 4DNCA 4ESJA 1OMIA 4HNVA 2L7FP 2WWYA 1FIAA 3KP4A 3QU6A 5HLTA 1IXCA 3GUDA 4ABZA 1SD7A 4PCQA 3TO9A 2LNBA 2EV0A 2P7CB 5KVRA 2VBZA 2Y2ZA 1OJLA 2WV0A 3M9AA 2HDWA 4H0EA 5CVRA 3F21A 1ZGAA 1HF0A 1K4SA 2JPBA 5HOOA 4BDYA 1E0EA 2R7FA 4PJ0C 3GXOA 2K9NA 5ILSA 4A0XA 3K1MA 2FMYA 5ERIA 3VB2A 4B43A 4XIDA 1AU7A 2ZMEB 3R0JA 3VEPA 1APLC 4GGGA 2ZBKA 3B02A 3S16J 5IT9Z 3ONQA 3RPUA 3T1BA 4B48A 4GDFA 3IUOA 2FNAA
chains in the Genus database with same CATH topology
2ECBA 4QSHA 4DYCA 1ENHA 3NAUA 5EYRA 5M5WJ 4MFEA 1IDYA 3HM5A 1GV2A 2LY9A 3QQAA 4MIMA 1H89C 3FIWA 1G2HA 2DMNA 3GTQJ 1UMQA 2X6OA 2DA3A 2R5YA 1IRZA 1WH7A 1RKWA 3FKIJ 2M0CA 5IYDJ 3QPLA 1MBKA 4JX6A 4IHYA 3QPSA 1FTZA 2NS7A 1U9NA 1HDPA 3I4NJ 2MG4A 3UKGA 1XS9A 1JUPA 1JKQC 3BG5A 1TWCJ 1RKTA 4I6ZA 1Y1WJ 1QRYA 2YS9A 3HOVJ 4DYQA 4A3CJ 1X2NA 2VKEA 2JWTA 1B72B 1BW6A 3FISA 3HOYJ 4FE4A 1MBGA 1IDZA 4A3KJ 3K7AJ 3BG9A 5GPAA 2L7ZA 1LFUP 1HDDC 5J1RA 3H3VK 3E7LA 5C4JJ 4C3JJ 2MW8A 5E3OA 2JMWA 2HXIA 4I76A 1ORKA 2HOSA 3JRHA 3BT9A 1ZK8A 4DZPA 3PO3J 4M3DA 3GTMJ 5EEAA 1K61A 2EZKA 3RQIA 1ZGWA 5F08A 2XB5A 1MH4A 4IHWA 1ZR4A 4A93J 1GUUA 2K40A 1U78A 2B63J 3OSFA 5EGOB 3FK6A 4A3BJ 1ZTRA 3WHBA 1TC3C 1ETKA 1BA5A 4A3EJ 2XB0X 3HGGA 4J19A 2R0QC 2DA2A 2FJ1A 4M3FA 3BR2A 1JJ8C 3K2AA 5IYBJ 4MFDA 5DTDA 5EG0A 2LK2A 1NK2P 3A03A 3ZQHA 2L7MP 1ETQA 3BTLA 4X6AJ 1P7JA 1VI0A 1AKHB 1OFCX 3OIOA 2M34A 4X1EA 1H8AC 5FJ8J 3A01A 1WI3A 4RBOA 1I6HJ 4B4CA 1WPKA 1IC8A 2CQXA 2DMTA 5EGOA 2XPWA 1ZR2A 2JJ7A 4IHVA 4B1RA 5JLXA 3BTCA 4A3FJ 5IP9J 3S1QJ 3JR9A 3O8GA 3MVPA 1W0UA 1GT0C 2EZHA 5IYCJ 3IH3A 1FIPA 4EEFG 5IOZA 2IBDA 4M3BA 1XC5A 3Q0UA 1JUMA 1Y1VJ 4QTRA 1QVUA 1QVTA 5IP6A 1HOMA 4BY1J 3LSRA 2G0EA 3IV5A 5F1JA 3S14J 4B3AA 5E3NA 4XICA 2MGQA 1F36A 2TCTA 3JRIA 2XRLA 2VUMJ 3DEWA 3H0GJ 1JKPC 3BQZA 1U9OA 2DJNA 4XK4A 1JGGA 4MO7A 1F43A 4AC0A 1ETOA 3RZDJ 2I10A 2WV1A 3I4MJ 3F0CA 3TP0A 5EDNA 2ID6A 3HOWJ 4M6VA 1SANA 3GTLJ 1ETXA 3SJMA 4FE7A 2ME0A 3M4OJ 4MLOA 2Y9YA 5F0HA 1JTXA 3JRDA 4FTHA 3MN2A 3BTJA 1PUFB 2LKXA 3Q0WA 5F04A 2YU9J 2FX0A 3ZQCA 3BTIA 2DA1A 2NVYJ 2O8KA 1IJWC 3LOCA 2M2EA 3B6AA 1EF4A 3CCYA 4XRMA 3HBLA 1JJ6C 4IEJA 1JTYA 1T33A 3BR0A 4XRSG 1IGNA 2DMUA 5M3MJ 5BNGA 2K9SA 2OPTA 2CRGA 1WGXA 1U8BA 1RESA 2NOGA 2IEKA 4JX4A 2Y30A 4BKXA 5EG0B 3G1OA 4C2MJ 1VFCA 2GLOA 2X9DA 3M3YJ 5M5XJ 1B8IA 3IH4A 3TW6A 1GV5A 2CUFA 3HOZJ 2R5ZB 1D5YA 1UG2A 3GTPJ 5K7ZA 3S1NJ 1JKOC 1O4XA 1E3OC 1T56A 3PO2J 2N8GA 5JLWA 1TWHJ 3HB9A 2CUEA 5IPAA 2NVTJ 3S2HJ 2XGCA 1POGA 1MBJA 1CQTA 4JYKA 5GPCA 2YUSA 5IP7J 4C3HJ 2LLKA 2GBYA 4Y52J 4S0HB 3BR6A 2LTPA 5C4XJ 4JX5A 4L5EA 2XPUA 2LD5A 1JT0A 1XG1A 1A5JA 3IH2A 1FTTA 1SFOJ 1RPWA 2ID3A 4BBRJ 3BR3A 2HYJA 1S7EA 1VNDA 5EZGA 5GP9A 3D1NI 1X2MA 1QPIA 1ETWA 4DW6A 5FKOA 1MSEC 1OCPA 2FD5A 4A69C 1IG7A 3PM1A 1PUFA 2LP0A 3GTGJ 4CYCB 2OF7A 2PMZN 4W97A 2AHQA 3B6CA 3CMYA 2ECCA 2X48A 3G1LA 2R92J 3MKLA 2LVSA 3CDLA 5F27A 1HLVA 5FLVA 2EBIA 1DU6A 2VKVA 1A6IA 4IHXA 2DA7A 2E2HJ 3HKZN 4RDUA 4DYRA 3GTKJ 2E2JJ 3G1MA 2EQRA 2DMQA 2CU7A 5K7HA 1BJZA 5J1YA 3HGYA 1ETVA 3GTOJ 3BG3A 1YRNB 1ZKGA 5E3LA 1IV6A 3HEFA 1Z77A 5IOYA 3SDGA 5FKNA 2R93J 2DTZA 4AUXA 2MSYA 2AO9A 1H88C 1I3QJ 4A3DJ 4G12A 1B72A 3S15J 2L9RA 1ITYA 4BY7J 2O7OA 3HOXJ 2Y9ZA 2P81A 2EZIA 2JK3A 5EZHA 4UUTA 1AKHA 2E2IJ 2M8GX 3S1MJ 3OSGA 4LOCA 3TW7A 2COBA 2EH3A 2W48A 5HODA 4A3LJ 1MH3A 3TEDA 3S1RJ 3JRCA 1TWFJ 2K9QA 2WAQN 1X58A 4C3IJ 2LR8A 3GTJJ 1WH5A 1MSFC 2GM4A 1GDTA 3JRFA 5J3LA 2XGDA 5J1UA 2JA8J 4JP0A 1BL0A 2FQ4A 1MBEA 4FCYA 2CQQA 5K7FA 4GFBA 4A3GJ 3JRGA 2R5YB 1ZQ3P 1WCMJ 3LSJA 4NDLA 4UUSB 2RAEA 1TWGJ 1FJLA 2EZLA 5FLMJ 1RETA 3OOUA 3LNQA 1JT6A 3LSPA 3HOUJ 1B8IB 1LFBA 5C44J 1R9TJ 4D7MA 1Z0XA 4UUSA 4A3MJ 1RR7A 2E1OA 1ETYA 2ZB9A 3GBGA 2DMPA 2ME6A 2IAIA 2HQ5A 1K83J 4Y7NJ 5C3EJ 4V2FA 2HI3A 2JA6J 2Y0SN 2WB1N 2HXOA 3JREA 1AHDP 3Q3SA 1IUFA 2HOTA 1JUSA 3RZOJ 3O8HA 1JKRC 1UHSA 4W1UA 1MBFA 3S2DJ 4BXXJ 3Q0VA 3TP3A 2XSDC 2XGEA 4BBSJ 3BQYA 2E19A 2JN6A 2NS8A 1I50J 2HOAA 2Y31A 2VI6A 2NVQJ 4A3JJ 5F0FA 3A02A 4FISA 4M3EA 4D5CA 4A3IJ 1LE8A 3NARA 3L1PA 2LFBA 3CQZJ 4CYCA 3JRBA 2ELKA 1Q1VA 2M9HA 2H8RA 3WHCA 2D5VA 5E3MA 1DU0A 4D7NA 2JA7J 1P7IA 5FKKA 3ZQFA 2KT0A 2VPRA 5F0CA 1NK3P 1HCRA 3JRAA 2DN0A 3DCFA 4V2GA 1MBHA 1LE8B 4D5FA 3ZQLA 3A01B 1YRNA 2JA5J 2CJJA 1MNMC 2O9LA 2L0KA 3VPRA 3S17J 3W6VA 2DA6A 1OCTC 3FK7A 5M5YJ 1VF9A 4DZJA 3RKQA 4HNVA 1GVDA 4QIWN 2L7FP 4AYBN 1FIAA 5FKMA 5M3FJ 4ABZA 2NVXJ 5EF6A 2H1KA 2XPVA 1TWAJ 2HDDA 3HDDA 3SFIA 1W0TA 2Y2ZA 1OJLA 3ZOBA 2QF7A 2DA5A 1HF0A 5FKLA 3ZQIA 4XRSA 3BR1A 2DA4A 3LSGA 2K9NA 1AU7A 4XIDA 2KDZA 3C2BA 4M3GA 1APLC 5DS9A 3S16J 9ANTA 2R7ZJ 2R5ZA 1NTCA 2QCOA 3ZQGA 1BW5A 3BR5A 2TRTA 1FEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ECB A;  4QSH A;  4DYC A;  1ENH A;  3NAU A;  5EYR A;  5M5W J;  4MFE A;  1IDY A;  3HM5 A;  1GV2 A;  2LY9 A;  3QQA A;  4MIM A;  1H89 C;  3FIW A;  1G2H A;  2DMN A;  3GTQ J;  1UMQ A;  2X6O A;  2DA3 A;  2R5Y A;  1IRZ A;  1WH7 A;  1RKW A;  3FKI J;  2M0C A;  5IYD J;  3QPL A;  1MBK A;  4JX6 A;  4IHY A;  3QPS A;  1FTZ A;  2NS7 A;  1U9N A;  1HDP A;  3I4N J;  2MG4 A;  3UKG A;  1XS9 A;  1JUP A;  1JKQ C;  3BG5 A;  1TWC J;  1RKT A;  4I6Z A;  1Y1W J;  1QRY A;  2YS9 A;  3HOV J;  4DYQ A;  4A3C J;  1X2N A;  2VKE A;  2JWT A;  1B72 B;  1BW6 A;  3FIS A;  3HOY J;  4FE4 A;  1MBG A;  1IDZ A;  4A3K J;  3K7A J;  3BG9 A;  5GPA A;  2L7Z A;  1LFU P;  1HDD C;  5J1R A;  3H3V K;  3E7L A;  5C4J J;  4C3J J;  2MW8 A;  5E3O A;  2JMW A;  2HXI A;  4I76 A;  1ORK A;  2HOS A;  3JRH A;  3BT9 A;  1ZK8 A;  4DZP A;  3PO3 J;  4M3D A;  3GTM J;  5EEA A;  1K61 A;  2EZK A;  3RQI A;  1ZGW A;  5F08 A;  2XB5 A;  1MH4 A;  4IHW A;  1ZR4 A;  4A93 J;  1GUU A;  2K40 A;  1U78 A;  2B63 J;  3OSF A;  5EGO B;  3FK6 A;  4A3B J;  1ZTR A;  3WHB A;  1TC3 C;  1ETK A;  1BA5 A;  4A3E J;  2XB0 X;  3HGG A;  4J19 A;  2R0Q C;  2DA2 A;  2FJ1 A;  4M3F A;  3BR2 A;  1JJ8 C;  3K2A A;  5IYB J;  4MFD A;  5DTD A;  5EG0 A;  2LK2 A;  1NK2 P;  3A03 A;  3ZQH A;  2L7M P;  1ETQ A;  3BTL A;  4X6A J;  1P7J A;  1VI0 A;  1AKH B;  1OFC X;  3OIO A;  2M34 A;  4X1E A;  1H8A C;  5FJ8 J;  3A01 A;  1WI3 A;  4RBO A;  1I6H J;  4B4C A;  1WPK A;  1IC8 A;  2CQX A;  2DMT A;  5EGO A;  2XPW A;  1ZR2 A;  2JJ7 A;  4IHV A;  4B1R A;  5JLX A;  3BTC A;  4A3F J;  5IP9 J;  3S1Q J;  3JR9 A;  3O8G A;  3MVP A;  1W0U A;  1GT0 C;  2EZH A;  5IYC J;  3IH3 A;  1FIP A;  4EEF G;  5IOZ A;  2IBD A;  4M3B A;  1XC5 A;  3Q0U A;  1JUM A;  1Y1V J;  4QTR A;  1QVU A;  1QVT A;  5IP6 A;  1HOM A;  4BY1 J;  3LSR A;  2G0E A;  3IV5 A;  5F1J A;  3S14 J;  4B3A A;  5E3N A;  4XIC A;  2MGQ A;  1F36 A;  2TCT A;  3JRI A;  2XRL A;  2VUM J;  3DEW A;  3H0G J;  1JKP C;  3BQZ A;  1U9O A;  2DJN A;  4XK4 A;  1JGG A;  4MO7 A;  1F43 A;  4AC0 A;  1ETO A;  3RZD J;  2I10 A;  2WV1 A;  3I4M J;  3F0C A;  3TP0 A;  5EDN A;  2ID6 A;  3HOW J;  4M6V A;  1SAN A;  3GTL J;  1ETX A;  3SJM A;  4FE7 A;  2ME0 A;  3M4O J;  4MLO A;  2Y9Y A;  5F0H A;  1JTX A;  3JRD A;  4FTH A;  3MN2 A;  3BTJ A;  1PUF B;  2LKX A;  3Q0W A;  5F04 A;  2YU9 J;  2FX0 A;  3ZQC A;  3BTI A;  2DA1 A;  2NVY J;  2O8K A;  1IJW C;  3LOC A;  2M2E A;  3B6A A;  1EF4 A;  3CCY A;  4XRM A;  3HBL A;  1JJ6 C;  4IEJ A;  1JTY A;  1T33 A;  3BR0 A;  4XRS G;  1IGN A;  2DMU A;  5M3M J;  5BNG A;  2K9S A;  2OPT A;  2CRG A;  1WGX A;  1U8B A;  1RES A;  2NOG A;  2IEK A;  4JX4 A;  2Y30 A;  4BKX A;  5EG0 B;  3G1O A;  4C2M J;  1VFC A;  2GLO A;  2X9D A;  3M3Y J;  5M5X J;  1B8I A;  3IH4 A;  3TW6 A;  1GV5 A;  2CUF A;  3HOZ J;  2R5Z B;  1D5Y A;  1UG2 A;  3GTP J;  5K7Z A;  3S1N J;  1JKO C;  1O4X A;  1E3O C;  1T56 A;  3PO2 J;  2N8G A;  5JLW A;  1TWH J;  3HB9 A;  2CUE A;  5IPA A;  2NVT J;  3S2H J;  2XGC A;  1POG A;  1MBJ A;  1CQT A;  4JYK A;  5GPC A;  2YUS A;  5IP7 J;  4C3H J;  2LLK A;  2GBY A;  4Y52 J;  4S0H B;  3BR6 A;  2LTP A;  5C4X J;  4JX5 A;  4L5E A;  2XPU A;  2LD5 A;  1JT0 A;  1XG1 A;  1A5J A;  3IH2 A;  1FTT A;  1SFO J;  1RPW A;  2ID3 A;  4BBR J;  3BR3 A;  2HYJ A;  1S7E A;  1VND A;  5EZG A;  5GP9 A;  3D1N I;  1X2M A;  1QPI A;  1ETW A;  4DW6 A;  5FKO A;  1MSE C;  1OCP A;  2FD5 A;  4A69 C;  1IG7 A;  3PM1 A;  1PUF A;  2LP0 A;  3GTG J;  4CYC B;  2OF7 A;  2PMZ N;  4W97 A;  2AHQ A;  3B6C A;  3CMY A;  2ECC A;  2X48 A;  3G1L A;  2R92 J;  3MKL A;  2LVS A;  3CDL A;  5F27 A;  1HLV A;  5FLV A;  2EBI A;  1DU6 A;  2VKV A;  1A6I A;  4IHX A;  2DA7 A;  2E2H J;  3HKZ N;  4RDU A;  4DYR A;  3GTK J;  2E2J J;  3G1M A;  2EQR A;  2DMQ A;  2CU7 A;  5K7H A;  1BJZ A;  5J1Y A;  3HGY A;  1ETV A;  3GTO J;  3BG3 A;  1YRN B;  1ZKG A;  5E3L A;  1IV6 A;  3HEF A;  1Z77 A;  5IOY A;  3SDG A;  5FKN A;  2R93 J;  2DTZ A;  4AUX A;  2MSY A;  2AO9 A;  1H88 C;  1I3Q J;  4A3D J;  4G12 A;  1B72 A;  3S15 J;  2L9R A;  1ITY A;  4BY7 J;  2O7O A;  3HOX J;  2Y9Z A;  2P81 A;  2EZI A;  2JK3 A;  5EZH A;  4UUT A;  1AKH A;  2E2I J;  2M8G X;  3S1M J;  3OSG A;  4LOC A;  3TW7 A;  2COB A;  2EH3 A;  2W48 A;  5HOD A;  4A3L J;  1MH3 A;  3TED A;  3S1R J;  3JRC A;  1TWF J;  2K9Q A;  2WAQ N;  1X58 A;  4C3I J;  2LR8 A;  3GTJ J;  1WH5 A;  1MSF C;  2GM4 A;  1GDT A;  3JRF A;  5J3L A;  2XGD A;  5J1U A;  2JA8 J;  4JP0 A;  1BL0 A;  2FQ4 A;  1MBE A;  4FCY A;  2CQQ A;  5K7F A;  4GFB A;  4A3G J;  3JRG A;  2R5Y B;  1ZQ3 P;  1WCM J;  3LSJ A;  4NDL A;  4UUS B;  2RAE A;  1TWG J;  1FJL A;  2EZL A;  5FLM J;  1RET A;  3OOU A;  3LNQ A;  1JT6 A;  3LSP A;  3HOU J;  1B8I B;  1LFB A;  5C44 J;  1R9T J;  4D7M A;  1Z0X A;  4UUS A;  4A3M J;  1RR7 A;  2E1O A;  1ETY A;  2ZB9 A;  3GBG A;  2DMP A;  2ME6 A;  2IAI A;  2HQ5 A;  1K83 J;  4Y7N J;  5C3E J;  4V2F A;  2HI3 A;  2JA6 J;  2Y0S N;  2WB1 N;  2HXO A;  3JRE A;  1AHD P;  3Q3S A;  1IUF A;  2HOT A;  1JUS A;  3RZO J;  3O8H A;  1JKR C;  1UHS A;  4W1U A;  1MBF A;  3S2D J;  4BXX J;  3Q0V A;  3TP3 A;  2XSD C;  2XGE A;  4BBS J;  3BQY A;  2E19 A;  2JN6 A;  2NS8 A;  1I50 J;  2HOA A;  2Y31 A;  2VI6 A;  2NVQ J;  4A3J J;  5F0F A;  3A02 A;  4FIS A;  4M3E A;  4D5C A;  4A3I J;  1LE8 A;  3NAR A;  3L1P A;  2LFB A;  3CQZ J;  4CYC A;  3JRB A;  2ELK A;  1Q1V A;  2M9H A;  2H8R A;  3WHC A;  2D5V A;  5E3M A;  1DU0 A;  4D7N A;  2JA7 J;  1P7I A;  5FKK A;  3ZQF A;  2KT0 A;  2VPR A;  5F0C A;  1NK3 P;  1HCR A;  3JRA A;  2DN0 A;  3DCF A;  4V2G A;  1MBH A;  1LE8 B;  4D5F A;  3ZQL A;  3A01 B;  1YRN A;  2JA5 J;  2CJJ A;  1MNM C;  2O9L A;  2L0K A;  3VPR A;  3S17 J;  3W6V A;  2DA6 A;  1OCT C;  3FK7 A;  5M5Y J;  1VF9 A;  4DZJ A;  3RKQ A;  4HNV A;  1GVD A;  4QIW N;  2L7F P;  4AYB N;  1FIA A;  5FKM A;  5M3F J;  4ABZ A;  2NVX J;  5EF6 A;  2H1K A;  2XPV A;  1TWA J;  2HDD A;  3HDD A;  3SFI A;  1W0T A;  2Y2Z A;  1OJL A;  3ZOB A;  2QF7 A;  2DA5 A;  1HF0 A;  5FKL A;  3ZQI A;  4XRS A;  3BR1 A;  2DA4 A;  3LSG A;  2K9N A;  1AU7 A;  4XID A;  2KDZ A;  3C2B A;  4M3G A;  1APL C;  5DS9 A;  3S16 J;  9ANT A;  2R7Z J;  2R5Z A;  1NTC A;  2QCO A;  3ZQG A;  1BW5 A;  3BR5 A;  2TRT A;  1FEX A; 
#chains in the Genus database with same CATH topology
 1HXD A;  3DPU A;  1YJN I;  1YI2 I;  1HW5 A;  5LFA A;  3OL4 A;  1ZN2 A;  5J4Y A;  5EYR A;  3OOP A;  4EJT A;  1KYZ A;  4PJN A;  4RGU A;  4EGY A;  3K70 D;  2EV6 A;  1D8J A;  4MIM A;  3V8J A;  2JA2 A;  4BH9 A;  5HNH A;  2DMN A;  1WH7 A;  5IT3 A;  1P2F A;  1PJR A;  2V9P A;  1U5T B;  4IHY A;  3FF5 A;  1FTZ A;  5HVQ C;  1BI2 A;  5D8K B;  5F1R A;  1HDP A;  1ODD A;  4YEJ A;  3J80 Z;  3I4N J;  4UB6 C;  5D4S A;  5BOX A;  3CJQ B;  2V6E A;  2XIG A;  5AIQ A;  4CZZ A;  2NNN A;  3ZMV A;  4ENK A;  2QLZ A;  1RKT A;  1QZY A;  2VOP A;  3ECO A;  1BI0 A;  5HLH A;  1B72 B;  3OS0 A;  3S3M A;  4I0B A;  3EPZ A;  3J81 Z;  3FHZ A;  4ZDO A;  2IVM A;  2VBW A;  2LYC A;  1ZHF A;  2CMP A;  3G4S I;  1WJB A;  3H3V K;  5C4J J;  4G7O F;  1TW3 A;  3WTT C;  1T0F A;  1VQ6 I;  2MW8 A;  1X1D A;  2JMW A;  2HXI A;  3JRH A;  3BT9 A;  1ZK8 A;  4M3D A;  1GHC A;  5EEA A;  2MH9 A;  3RQI A;  3J80 K;  5LEJ A;  1V4R A;  2EIK H;  3AG1 H;  1ZR4 A;  1GUU A;  2E1C A;  2B63 J;  2W7N A;  3OSF A;  3FK6 A;  1ZRD A;  4A3B J;  3WHB A;  4M74 A;  1TC3 C;  3H3Z A;  2LOO A;  1R00 A;  3MD2 A;  1WVR A;  5FRM A;  5J4V A;  2DDA A;  1XGS A;  3CUQ C;  1BA5 A;  1OYY A;  3ROU A;  1LDD A;  3L2Q A;  2R0Q C;  2WY8 Q;  3E1S A;  2WB1 A;  2HKO A;  4NUB A;  3SEZ A;  1S5L C;  2VQC A;  5IYB J;  5DTD A;  2LK2 A;  2RNG A;  2E5Z A;  4E6K G;  4KIF A;  3A03 A;  5AON A;  3ZQH A;  5H6Q A;  2LF8 A;  2HFH A;  3I9V 2;  4XBF A;  3OIO A;  3K4C A;  1H8A C;  5FJ8 J;  2M87 A;  4NBQ A;  4KDP A;  4B4C A;  3RYR A;  1WPK A;  3PFI A;  4GXO A;  4L0Z B;  2DMT A;  1MNE A;  3DKW A;  1E3P A;  1XPX A;  3L2U A;  1I1G A;  4A3F J;  1Z7L A;  3JR9 A;  1V54 H;  1CF7 A;  2HTS A;  1W0U A;  1GT0 C;  1B6A A;  1HKT A;  4LIV A;  2VN2 A;  3P7N A;  1S7O A;  5LBQ A;  2JSC A;  4RS8 A;  4GYG A;  3C7J A;  1Y1V J;  4CCN A;  2OBP A;  2Z2S B;  1HOM A;  3QYB A;  1MMG A;  1XDU A;  3H5N A;  4IPA A;  5DUI A;  2DCE A;  5B1A H;  3K69 A;  2TCT A;  3S2W A;  3L2C A;  3HTS B;  4RA2 A;  3JRI A;  2XRL A;  1ZRC A;  3ZGK A;  3H0G J;  5ED4 A;  3VFZ A;  2FOW A;  3DPT A;  1JKP C;  4OIN F;  4OMY A;  2YU3 A;  1MW7 A;  2DJN A;  2MYS A;  1BC7 C;  3CD6 I;  2V1U A;  1SD4 A;  2UWM A;  4CCK A;  2QGU A;  5E8I A;  1OR7 A;  4Q4Z F;  2C6Y A;  2ISZ A;  3TP0 A;  4ZZL A;  2Z5U A;  3CCL I;  1K78 A;  3N05 A;  1J7K A;  1ETX A;  3GTL J;  3BJ6 A;  2Q2E B;  2VBX A;  3N97 A;  2ZXJ A;  5F0H A;  1JTX A;  5CQE A;  5JVT A;  4FTH A;  3BTJ A;  1V55 H;  2RGV A;  4ENJ A;  1YW8 A;  1N78 A;  4IRH A;  1UG0 A;  2R7S A;  2A69 F;  4HQE A;  4G6D A;  2O8K A;  3H5A A;  2PMZ A;  3W2A A;  2M2E A;  4XON A;  3KYD B;  4KN7 X;  1VQ9 I;  4XRM A;  2A07 F;  1JJ6 C;  2E60 A;  1STZ A;  1O57 A;  2HYG D;  4GRI A;  3J7Y J;  2DAO A;  2A6E F;  5M3M J;  1QZZ A;  4EJW A;  1BI1 A;  3CUQ A;  2BW3 A;  1IN7 A;  3HPH A;  1WGX A;  2M0M A;  3L00 A;  1BR2 A;  4RGR A;  2IEK A;  4JX4 A;  2PMH A;  4BKX A;  4G6Q A;  1ZYR F;  1TTY A;  3G1O A;  2Z33 A;  2ZO4 A;  1HC8 A;  4E4H A;  1SMY F;  5M5X J;  1B8I A;  3GF2 A;  4AWX B;  3HOZ J;  2R5Z B;  3S8P A;  1XGN A;  3JW4 A;  1FX7 A;  2X1D A;  3GTP J;  1Z6R A;  1S72 I;  4O5V A;  2N8G A;  1TWH J;  3HB9 A;  2XF5 A;  5L3B A;  3JSO A;  5CPR B;  2GOX B;  1Z05 A;  2V1N A;  4L5I A;  3WTU C;  4E7L A;  4JYK A;  2R7O A;  2XF6 A;  2Y69 H;  3ESW B;  2GBY A;  3MWM A;  4Y52 J;  5C4X J;  2CV2 A;  1XSV A;  2OCC H;  3QAH A;  2FBK A;  4IQ4 A;  5D6E A;  4ENM A;  4WXD A;  3ABT A;  4AIJ A;  2E1M C;  2ID3 A;  2H94 A;  3BR3 A;  2PI0 A;  5EZG A;  1B9N A;  2FBI A;  2JZY A;  3EYY A;  3MFK A;  1TP4 A;  1OCP A;  4FT8 A;  2DOE A;  1X3Z B;  1G3S A;  2W84 A;  2H27 A;  1PUF A;  3PUF A;  4RB0 A;  1TT0 A;  1YIT I;  4CYC B;  3PIO F;  4RAZ A;  4W97 A;  1YLF A;  1TNS A;  3CMY A;  1RNL A;  2E71 A;  4E7H A;  2LKP A;  4BAC A;  5FLV A;  3NWS A;  3IP4 B;  4BE2 A;  5FO5 A;  1EKE A;  3FWE A;  2OCE A;  2VKV A;  3S32 A;  5JI6 A;  4Q5S F;  4ETS A;  2PX9 A;  5FFZ A;  1ZG5 A;  2E2H J;  3DP7 A;  2W4S A;  4KFC A;  1F5T A;  1S29 A;  2D1H A;  1WJF A;  2FRH A;  3OYH A;  2CU7 A;  2E7X A;  5K7H A;  1IF1 A;  1FOX A;  2DJI A;  1BJZ A;  1NH3 A;  3COA C;  3HGY A;  4CYD A;  1ETV A;  1VQM I;  2L54 A;  2LY1 A;  1ZKG A;  3CCJ I;  3HSF A;  3P9K A;  3QYE A;  2COM A;  3T5X A;  3LSH A;  1RC9 A;  1Z77 A;  2HNH A;  3D5S C;  5IOY A;  2HDC A;  2GIV A;  3K4N A;  3MKZ A;  3FMQ A;  1FBQ A;  2R93 J;  2BXZ A;  2QQ8 A;  2FU4 A;  4LK1 F;  3ERM A;  1H88 C;  3KCC A;  2ZXH A;  2OD5 A;  4A3D J;  2XAF A;  2R7U A;  3ZCO A;  2RDP A;  4AIH A;  5GAD J;  1C0W A;  2FF4 A;  1DP3 A;  1T95 A;  2OV7 A;  3OYG A;  3S3O A;  1PDN C;  1K78 B;  2P81 A;  4LFU A;  1T2K A;  4OMZ A;  1R23 A;  4HQM A;  4XN0 A;  3OSG A;  1I39 A;  1J5Y A;  3TW7 A;  4D9J A;  3IC7 A;  3L9F A;  5JHU A;  4JOM A;  5HOD A;  4II3 A;  2BE5 F;  3LST A;  4L9N A;  2Y48 A;  2VT2 A;  3J7A O;  3E3V A;  4MNU A;  3QYF A;  5FRO A;  1V3F A;  2LR8 A;  4XSX F;  2ADU A;  4R8H A;  1MSF C;  2K4B A;  2ZJP F;  3CUO A;  2J5O A;  1IXR C;  1S7A A;  5J3L A;  5J1U A;  2JA8 J;  3JTG A;  3WTS C;  3U21 A;  2A05 A;  2K7L A;  2FSW A;  1D1A A;  4U0V A;  2R7T A;  3DQV C;  5LGU A;  2CS3 A;  4Y15 A;  1VQN I;  1FOK A;  4NC7 A;  4A0Y A;  1LNW A;  2BOL A;  2R7D A;  4AVZ A;  3ASO H;  5FLM J;  1JT6 A;  2IW5 A;  1FOY A;  3HZJ A;  3PNT A;  5C44 J;  3OYE A;  4D7M A;  2W1O A;  4L9J A;  2E1O A;  4HX7 A;  5GAH J;  1ETY A;  3GBG A;  2ME6 A;  3EUH C;  1GVJ A;  3W2V A;  2R7R A;  4PFP A;  2HI3 A;  2JA6 J;  4EM2 A;  4WCG A;  3PFY A;  4FX0 A;  1AHD P;  1J2X A;  3N4M A;  3OS2 A;  2IXS A;  2A68 F;  1LFP A;  4LB5 A;  2ACJ A;  1JKR C;  1UHS A;  3GFL A;  4W1U A;  4RAY A;  3S2D J;  5E1Z B;  1WHU A;  1YG2 A;  3MQ0 A;  4EGZ A;  2EB7 A;  3ZN0 A;  5ICC A;  3WGI A;  3BQY A;  2DFH A;  2LDU A;  4Y3O A;  1O7L A;  1IN8 A;  3D5R C;  4RLF A;  1EJ9 A;  3FXQ A;  4A3J J;  5F0F A;  4FIS A;  2JUC A;  2NS0 A;  3BZK A;  4A3I J;  3E6C C;  4LG3 A;  3I0T A;  2LRE A;  3M1E A;  3CQZ J;  2VQL A;  1TNT A;  4CYC A;  5D5U B;  3JRB A;  5K5Q A;  2L4A A;  4MHG A;  1AOY A;  1FSH A;  3FXM A;  1DU0 A;  3PQJ A;  4D7N A;  4L5J A;  2JA7 J;  1J09 A;  2W25 A;  4M6X A;  4U7B A;  1LPQ A;  1EV7 A;  2HZD A;  3CDH A;  4DIQ A;  2DXI A;  2DQR A;  3KZZ A;  1AWC A;  1YX5 A;  3WGH A;  3ZQL A;  1YRN A;  3F6V A;  5DM7 F;  2CJJ A;  4WF2 A;  1MNM C;  3VPR A;  3W6V A;  2K3F A;  3BWG A;  2X4H A;  5LGN A;  1W1W E;  4D1Q A;  3IRQ A;  3DEU A;  3C3W A;  1Z21 A;  5M3F J;  2MLG A;  4FHT A;  1KZH A;  2Z9O A;  4HLX A;  3HDD A;  4XKW A;  3DF8 A;  4LGW A;  2YX4 A;  1SVL A;  2P4W A;  3PUB A;  3SXY A;  5LEK A;  2KIU A;  5FKL A;  5J6X A;  3ZQI A;  4XRS A;  3LSG A;  4FAS D;  2GXB A;  3C2B A;  4NQW A;  1MMN A;  1UHW A;  1W5S A;  1LEA A;  2WA0 A;  1FZP B;  2R7Z J;  9ANT A;  1FOW A;  2F4M B;  1SVM A;  4AYB A;  2TRT A;  1FEX A;  4BU2 A;  5B1B H;  1Y39 A;  2P0W A;  1FYL A;  1XMX A;  1OCZ H;  1A35 A;  1ZLJ A;  1TZL A;  2QBY A;  5FLX Z;  1X3U A;  4YFK F;  3FMS A;  3IWF A;  1CF7 B;  2KRF A;  4ESF A;  4MFE A;  5TJJ A;  4YIF A;  3EQL F;  4KNY A;  3QQA A;  4I7H A;  3FIW A;  2OUM A;  3SFZ A;  5D8L B;  5JR3 A;  4HEA 2;  5DD4 A;  3AG3 H;  1Y0N A;  3VYU B;  1RZ4 A;  2M0C A;  3K4M A;  5IYD J;  3F3X A;  2NS7 A;  1VQ4 I;  2MG4 A;  5GAG J;  1XS9 A;  4XKB A;  1JUP A;  4Z6Y A;  3WTW C;  3CZ6 A;  1UEL B;  1P4W A;  1R5H A;  2D1V A;  4I01 A;  2IA2 A;  1X1A A;  3HYI A;  4FET A;  1QRY A;  3DKY A;  2YS9 A;  3QRF F;  2IP2 A;  3VDX A;  4DYQ A;  5DDG A;  4A3C J;  2JWT A;  2IS2 A;  2JRM A;  2M1B A;  4LJZ F;  3FIS A;  3HOY J;  3I71 A;  1IDZ A;  4CCL A;  2HZT A;  4XLN F;  3QPT A;  2OZ6 A;  3BG9 A;  2HOE A;  2X6Y A;  2CUZ A;  1MZB A;  3CLQ A;  2K27 A;  2NAZ A;  3E7L A;  4YG2 F;  3PNV A;  5A2Q K;  1MMS A;  3FXJ A;  5K5R A;  1XCV A;  2LBF A;  3OYJ A;  3GTM J;  1XGO A;  5F6F A;  1ZGW A;  4D0P A;  1MH4 A;  4IHW A;  1WKM A;  3F8C A;  4ESB A;  2DFE A;  1MJ9 A;  2DO7 A;  3AL0 B;  3CES A;  5EGO B;  3ECH A;  1QPM A;  1P4X A;  4G94 A;  1CGP A;  2WAF A;  1ETK A;  1NG7 A;  3P5J A;  3K10 A;  1GLN A;  1ULY A;  1D0Y A;  2LG4 A;  4KMF A;  1IO2 A;  4E70 A;  4IRI A;  3EYI A;  1SEU A;  1Q1H A;  3QP6 A;  3BDD A;  2D45 A;  3DBL B;  3JCU C;  3K1P A;  2CGP A;  1KU9 A;  4MFD A;  5EG0 A;  4LK0 F;  1LB2 A;  1NK2 P;  5L3D A;  1D8K A;  1F9N A;  3WGG A;  3DLA A;  3L09 A;  4UVC A;  1DQU A;  1IRF A;  1UJ8 A;  2VPL A;  4X6A J;  3BCA A;  2HGC A;  1OFC X;  4P5O A;  4YRV A;  3A01 A;  4L9V A;  1WI3 A;  1I6H J;  1FBU A;  2M8E A;  4NC6 A;  3H92 A;  1YJW I;  1IC8 A;  2DYR H;  1YTY A;  2LF7 A;  2WBM A;  2VL8 A;  2JJ7 A;  1DGW Y;  1V5F A;  4B1R A;  1ZR2 A;  2HPM A;  4IHV A;  3TO6 A;  5JLX A;  2VB6 A;  2W82 A;  3S1Q J;  1KU3 A;  3MVP A;  3IH3 A;  3O3K A;  1FIP A;  2FUG 2;  1K6O A;  2KZV A;  4M3B A;  3WE2 A;  2P6S A;  3HSE A;  1XC5 A;  2DOA A;  4LIU A;  5CLS A;  2L9S A;  3UR3 C;  5DYM A;  4QTR A;  4XLC A;  4ZYD A;  3H0D A;  3LAP A;  5IP6 A;  4PJL A;  1OCO H;  1BIA A;  5L3G A;  1SFE A;  2YR2 A;  1R71 A;  4UV9 A;  3BOQ A;  3KP5 A;  4HPQ A;  2DPU A;  3FZV A;  5F1J A;  2QVO A;  3CDI A;  1YE9 A;  4XIC A;  4KA4 A;  2MGQ A;  1F36 A;  2RQP A;  2W85 A;  1V5E A;  2X6X A;  3P9C A;  1P9Q C;  1MDM B;  1W4M A;  2A6T A;  2BV6 A;  3CP8 A;  4MO7 A;  1JGG A;  1F43 A;  4AC0 A;  2WV1 A;  2PJR A;  3I4M J;  2QQB A;  3KEY A;  3LSM A;  3V42 A;  3F0C A;  3GEZ A;  5EDN A;  4U7D A;  2ID6 A;  2W24 A;  1VQ8 I;  5LD2 C;  2KRC A;  4FE7 A;  4MLO A;  2Y9Y A;  4NC8 A;  1FYM A;  3BZ6 A;  2F48 A;  1PUF B;  3ASN H;  3FXO A;  2CSO A;  2JRT A;  5F04 A;  1KQ9 A;  3JSP A;  3DFG A;  4PZJ A;  3ZQC A;  1Y8R B;  4KIB A;  2KQR A;  3TOA A;  1GXQ A;  3HOS A;  1QZE A;  2FBH A;  2X0L A;  5ILV A;  2JVG A;  1EF4 A;  3F9K A;  3GLL A;  1FNN A;  3OYM A;  4PFO A;  1KA8 A;  4Y17 A;  3VYR B;  4RAG A;  1IGN A;  2DFI A;  2GOM A;  3H35 A;  4HYE A;  5BNG A;  5L3C A;  4HBL A;  2EK5 A;  1D5V A;  1BM9 A;  3KE2 A;  1RES A;  3HOT A;  3G71 I;  4V19 K;  1W5T A;  4KN4 X;  2BEO A;  3OYK A;  3RKW A;  5CJ9 A;  2X9D A;  1K79 A;  4OWR B;  2F4I A;  4MTE A;  3MEX A;  4B8X A;  2L3D A;  1D5Y A;  3T0Y A;  5GTH C;  1UG2 A;  3DEE A;  4IX7 A;  1AA7 A;  4DGW B;  3S1N J;  1EH7 A;  3VYT B;  4M71 A;  1T56 A;  1QO0 D;  2CUE A;  1UCR A;  1X1P A;  1FC3 A;  4MEX F;  1JGS A;  1MBJ A;  1MJA A;  1CQT A;  4RMN A;  5GPC A;  1PYV A;  2YUS A;  2XKO A;  5IP7 J;  3CUQ B;  1Z67 A;  4KUM A;  5DEQ A;  2GA1 A;  3BR6 A;  4XKV A;  4OIO F;  4P9U A;  1J9I A;  2QA4 I;  3OYA A;  3CJR B;  4L5E A;  2XPU A;  1M1E B;  2LD5 A;  4WX9 A;  3J7A Y;  1MGT A;  1X1C A;  1SFO J;  1P92 A;  1S7E A;  2CYY A;  4HLY A;  4DW6 A;  2F5E A;  1SAX A;  5FKO A;  3GYH X;  3KYL A;  2FD5 A;  1QBJ A;  5HDG A;  2ZFW A;  2CWE A;  4IZZ A;  3GTG J;  2HYF A;  5FFX A;  4HDU A;  5CVJ A;  4HOB A;  1VQ5 I;  2HVR A;  2OF7 A;  3B6C A;  2R92 J;  3KP3 A;  2PLY A;  2MH2 A;  2EFO A;  3FXR A;  1R5G A;  2LVS A;  3CDL A;  3CC4 I;  4ZJZ A;  1BI3 A;  3ABK H;  3SZT A;  1ZG1 A;  1T6S A;  1A6I A;  4U0W A;  5EJC A;  4AU7 A;  1QGP A;  3R61 A;  3MZ8 A;  3OYL A;  3HKZ N;  4E7S A;  3PJR A;  2K86 A;  2JQ7 A;  2E34 A;  3GTK J;  2E2J J;  2RNJ A;  2DMQ A;  3ZN1 A;  2DT5 A;  3DU5 A;  3M8F A;  3OYD A;  4EQQ A;  2VKD A;  1S3J A;  3X2Q H;  2K85 A;  2VE8 A;  3GME A;  4UHT A;  4BJ5 C;  2F2E A;  4CCO A;  3ELK A;  4IHS A;  1IV6 A;  3FHN A;  3CCU I;  5HDK A;  2O5R A;  3HUG B;  1IV8 A;  3WTZ A;  4CH7 A;  3R4K A;  2RRE A;  1MDM A;  4U88 A;  3EDP A;  2MA3 A;  1P6R A;  4CZC A;  5B66 C;  4RB2 C;  3KP6 A;  3S15 J;  1B72 A;  2IA0 A;  2HVQ A;  2L02 A;  3F6O A;  1BR1 A;  1ZGJ A;  4XOR A;  2D2W A;  3RSN A;  1N75 A;  1R1U A;  4BY7 J;  4MTD A;  2Y75 A;  4E7J A;  3CO7 C;  1MND A;  2PJP A;  2LMD A;  2E2I J;  2M8G X;  2R4G A;  2VC0 A;  3A0B C;  2OQG A;  3AFH A;  1O3S A;  3KPH A;  2HTJ A;  1D1B A;  4LOC A;  4ZYA A;  2EH3 A;  3U2R A;  3TED A;  3VOD A;  2ZKZ A;  4I98 B;  1TWF J;  4HST A;  4EJU A;  1E3H A;  1YW7 A;  4F3Q A;  4BE1 A;  1WJC A;  5CVI A;  3GTJ J;  5DCM B;  2VJI A;  4ASN A;  1TT5 B;  3CTA A;  3JRF A;  5DV5 A;  2BVM A;  2XGD A;  4IQJ A;  2XAU A;  1BL0 A;  2FXA A;  4KIG A;  1KU2 A;  5K7F A;  5D5V B;  4GFB A;  1LKX A;  4A3G J;  3JRG A;  1R58 A;  1NHA A;  2KL4 A;  1WCM J;  2OC6 A;  1SFU A;  4E7I A;  1TWG J;  2BBY A;  2ZSH B;  1ZEL A;  1ZAR A;  1BN5 A;  3OYF A;  4G6T B;  2QKL B;  3LSP A;  2VE9 A;  1YOV B;  4JQF A;  3HOU J;  1IXS B;  5J47 A;  3QOD A;  1Z1D A;  2IJL A;  1MMD A;  3A4C A;  1IW7 F;  2Z16 A;  2ZB9 A;  1MMA A;  4ON0 A;  4OOI A;  1QHH D;  2ICW G;  3HXL A;  2FNP A;  1Z3X A;  3LQQ A;  3C1D A;  3KYC B;  2ELH A;  5FD6 A;  2HXO A;  2XF7 A;  3L2R A;  3GZ6 A;  5LGT A;  5HDN A;  2HOT A;  4LIT A;  3RZO J;  3CF2 A;  4NNJ A;  4XLP F;  2DOF A;  1ZLK A;  3TKY A;  2M4K A;  1DDN A;  2AQE A;  5HS9 A;  1H0M A;  2DLL A;  4HF0 A;  4BBS J;  2E19 A;  3EET A;  2HOA A;  2RC4 A;  3CC7 I;  5BQT A;  3IAM 2;  4L18 B;  1T98 A;  4YEL A;  3A02 A;  4M3E A;  2YPR A;  1WSU A;  1LE8 A;  2GAU A;  1JI8 A;  2TDX A;  1USS A;  4A5N A;  3NAR A;  3TGN A;  1TL8 A;  1T39 A;  1D0Z A;  1B4A A;  1OKR A;  4AM3 A;  5CVU A;  2M9H A;  2H8R A;  1H9G A;  5ICF A;  2CFO A;  2JTV A;  4A6E A;  5E3M A;  2M7B A;  3CME I;  1P7I A;  5FKK A;  4NHJ A;  1X3W B;  2EJR A;  2HR3 A;  3SZG A;  3JRA A;  5HLG A;  4N9I A;  1R4N B;  2HS5 A;  3E6B A;  3DCF A;  4V2G A;  3J7Z I;  1OIS A;  4HF1 A;  3LWF A;  4OAY A;  1OLT A;  4XLE A;  1A6Q A;  2CV0 A;  2BY1 A;  1FYK A;  1IUY A;  4PUS A;  4BDZ A;  2O9L A;  4O6J A;  2L0K A;  1S6L A;  3S17 J;  1L3L A;  4KIS A;  1OCT C;  1TQI A;  3FK7 A;  3OS1 A;  1S8N A;  1VF9 A;  3RKQ A;  2EV5 A;  4IRG A;  3CF5 F;  1N77 A;  4QIW N;  4XSZ F;  3RQ4 A;  4AYB N;  3ERE D;  5FKM A;  2FOK A;  4I2O A;  5BPI A;  1RI7 A;  5EF6 A;  2H1K A;  3B73 A;  3KEO A;  2KDO A;  3HG9 A;  1TWA J;  1N25 A;  1U0J A;  2HDD A;  3SFI A;  3ZR8 X;  1MIJ A;  2ZME A;  4DQ2 A;  2NXN B;  3RIR A;  3K4L A;  3VSK A;  2H1L A;  2QF7 A;  2DA5 A;  2PG4 A;  1DPU A;  2EFP A;  3KLN A;  2DA4 A;  1D3Y A;  3QWL A;  1FBS A;  2KDZ A;  4BHC A;  5DS9 A;  2Z1D A;  2R5Z A;  1A04 A;  1FP1 D;  2QCO A;  4IVN A;  4KIC A;  3W2W A;  3ZQG A;  4B44 A;  2G7H A;  1VZ0 A;  5D6F A;  4YII A;  4QLC U;  2B9S A;  2ECB A;  4QSH A;  5JVG F;  4BE0 A;  3IAS 2;  4DYC A;  3NAU A;  5AIP A;  4DBR A;  3GZN B;  3ISP A;  3LFU A;  2GXG A;  4RB3 C;  1SC7 A;  1PP8 F;  1O3T A;  2CFX A;  2M3A A;  1YW9 A;  1TQM A;  1G2H A;  3V4G A;  1IRZ A;  2KPM A;  3FKI J;  2AQF A;  3R0A A;  1RRJ A;  4HRI A;  3QPL A;  4JX6 A;  4II2 A;  4O3M A;  3NWT A;  2IS6 A;  3QPS A;  4BS9 A;  2G7U A;  4C2U A;  1D1C A;  1U9N A;  1Z9C A;  2DK8 A;  2VC1 A;  1W7P A;  3V7S A;  4L0Y B;  2L7K A;  2QWW A;  2V26 A;  3DV8 A;  1F1Z A;  2RKH A;  2ZXI A;  1QNT A;  1IRX A;  3DU6 A;  1WFX A;  3MMY B;  1Y1W J;  2H6B A;  3HOV J;  3TQN A;  3BPV A;  2X6W A;  4PGH A;  5L3E A;  1BW6 A;  3CCR I;  2VIX A;  2W57 A;  5DCF A;  2HEO A;  1SFX A;  4FE4 A;  2STT A;  5GPA A;  1DP7 P;  1IN5 A;  1WWX A;  1R6R A;  5E3O A;  1VQL I;  4N0B A;  4I76 A;  1ORK A;  2HOS A;  4DZP A;  3PO3 J;  1H9T A;  1TBX A;  2ETH A;  3HTU A;  5D5X B;  5F08 A;  4CHU A;  4Y33 A;  3T8R A;  4BJ6 C;  2K40 A;  3MCZ A;  1SVO A;  3I3L A;  2RV8 A;  5ILU A;  4AIK A;  2STW A;  1XD7 A;  3WU1 B;  2M4G A;  2FML A;  2ZME C;  1X4P A;  2MD5 A;  5H6R A;  3HGG A;  5TGT A;  4J19 A;  2DFF A;  5LRR A;  4C9Y A;  1EH6 A;  2BY3 A;  2VQG A;  3RJP A;  1VQO I;  2UUZ A;  4M3F A;  1D0X A;  1NG6 A;  3BR2 A;  3BG6 A;  2WAQ A;  2Q8K A;  3I53 A;  2WAD A;  2V6C A;  4XKC A;  3QOE A;  2OU2 A;  3BTL A;  2BHZ A;  1AKH B;  4X1E A;  2DW4 A;  2ZJ2 A;  3DWL E;  2E7W A;  4ZYE A;  3KP2 A;  2XPW A;  4EVI A;  3FBI B;  3HHH A;  1Z7U A;  4G7Z F;  4RLQ A;  3BTC A;  4XQF A;  1OR7 C;  4HX4 A;  1HA8 A;  3MAJ A;  2EZH A;  5IYC J;  3SHF A;  4EEF G;  5IOZ A;  4S05 A;  2IBD A;  3MKW B;  2E36 A;  5A2Q Z;  4AID A;  1QQI A;  2OTL I;  4F7Z A;  2CQN A;  2J5P A;  2KIF A;  2KKO A;  2JT1 A;  4BYY A;  3OYN A;  3PQK A;  1U3E M;  2VBY A;  5CKT A;  1UHM A;  3NRV A;  1T8I A;  3HL2 A;  2MLK A;  3LSR A;  4B47 A;  4N4O B;  3QP5 A;  1YJ9 I;  4M73 A;  3IV5 A;  1ZH5 A;  2R3S A;  2KJB A;  4B3A A;  4IJA A;  2DTR A;  1I6X A;  1WJ5 A;  3DBR B;  4A12 A;  1TLH B;  2VUM J;  4WWC A;  3V8L A;  2M5W A;  3BQZ A;  1U9O A;  3CCE I;  2OJE D;  3RZD J;  3VWB A;  1GXP A;  2X1E A;  1B59 A;  2LKS A;  3BPX A;  4CDG A;  4BEH B;  3GX4 X;  2WC2 A;  2BW3 B;  1DPR A;  2CQ7 A;  1R36 A;  3HOW J;  2BZT A;  3AL0 C;  2XGX A;  4HG2 A;  2MD0 A;  3SJM A;  2UXN A;  1XMK A;  4FX4 A;  1R7J A;  1R22 A;  3M4O J;  2FA5 A;  1FMW A;  4L9T A;  5KNL A;  2YX7 A;  3E5X A;  3U1K A;  2LKX A;  3V7C A;  2BGC A;  3Q0W A;  2YU9 J;  4QWQ A;  4HNU A;  2PN6 A;  1FT9 A;  2DA1 A;  5DD8 A;  2NVY J;  1JE8 A;  4DBQ A;  3E97 A;  3BG7 A;  1B9M A;  1REP C;  1B1B A;  2MBF A;  2QEN A;  3B6A A;  3F8F A;  2PBI A;  2XV4 S;  2OZU A;  3HBL A;  1JTY A;  2Q2E A;  4XRS G;  4BJT A;  2K5C A;  4A6D A;  4BEH A;  3A0H C;  4XN3 A;  2IS4 A;  1KON A;  3HRS A;  1U8B A;  2NOG A;  2L01 A;  4BQO A;  2K4J A;  3KIO A;  3EUK L;  4C2M J;  3SZP A;  5EG0 B;  3AAF A;  2LRD A;  1VQP I;  1MKM A;  2ZSI B;  3M3Y J;  4G9Y A;  4Y13 A;  1GV5 A;  3F22 A;  3WU0 A;  2HQN A;  3KEQ A;  3O6B B;  2PEX A;  4IF4 A;  4JBA A;  1OCR H;  3LAJ A;  4BHP A;  4KYW A;  3E6D A;  3RKX A;  1KYW A;  3A1Y A;  4M6Y A;  1T0F C;  2O8X A;  3ULQ B;  1JKO C;  2CW7 A;  5JLW A;  3HSR A;  2KP6 A;  1G6N A;  1J59 A;  2GIZ A;  2XGC A;  2QSF X;  1POG A;  2ZNZ A;  4BQN A;  1G3W A;  1XDS A;  2FQ3 A;  2AXT C;  5E17 F;  3JAM K;  2LLK A;  2LSO A;  4S0H B;  2CH0 A;  1R49 A;  4JX5 A;  3GWZ A;  3L2V A;  3TMO A;  5FGM A;  1XG1 A;  3FMR A;  1R5I D;  5J8C A;  1A5J A;  3IH2 A;  3T8T A;  2CO5 A;  1FTT A;  4RM3 A;  1RPW A;  4BBR J;  2HYJ A;  5GP9 A;  3GZ5 A;  1X2M A;  1QPI A;  1ETW A;  4S04 A;  1WJA A;  3GFM A;  1MSE C;  1P4A A;  3E6M A;  3DPL C;  3QPH A;  4A69 C;  5BS6 A;  3HHG A;  4P9F A;  1RR8 C;  4H4K C;  4UVB A;  1XB4 A;  3GO5 A;  3Q5F A;  5L3F A;  5DCM A;  4JK1 X;  1HW1 A;  2PMZ N;  1FPQ A;  2P5V A;  3G1L A;  2X48 A;  1FWZ A;  2P5K A;  3L2W A;  4J00 A;  1ZG3 A;  5F27 A;  1HLV A;  2EBI A;  1DU6 A;  4XOT A;  2K02 A;  4EM0 B;  1HW2 A;  2DK5 A;  2QYO A;  2DA7 A;  2QBY B;  1BBY A;  2OAZ A;  3R6S A;  5LRS A;  3K4K A;  2A6H F;  4E7K A;  4DYR A;  2QSH X;  4F55 A;  4XR6 A;  3G1M A;  1E17 A;  2F5F A;  3J81 K;  5J1Y A;  1G3Y A;  1BR4 A;  1UFM A;  2KLO A;  1L0O C;  3HKZ A;  5BMZ A;  3H9Q A;  3BG3 A;  1YRN B;  1TW2 A;  4MQV A;  3DTK A;  2V9V A;  4J01 A;  3I58 A;  1SD5 A;  3HEF A;  3CO6 C;  3AG4 H;  1W36 C;  3SDG A;  3CCV I;  2FEZ A;  5FKN A;  3IHU A;  2DDB A;  2WTE A;  1IRG A;  3BC8 A;  2MSY A;  5D4R A;  3WU2 C;  2AO9 A;  1ERD A;  1FMV A;  2NVU B;  1I3Q J;  1DGR M;  5LHH A;  3OIQ A;  3TDZ C;  2RN7 A;  4BXF A;  2QEX I;  2K9L A;  2QKM B;  4LG0 A;  2KIQ A;  5FB2 A;  3TOB A;  1ITY A;  2KIM A;  3CCQ I;  3FM3 A;  3WTV C;  2BHY A;  3LQR A;  5E18 F;  1BC8 C;  2KHM A;  3HOX J;  2PQ8 A;  2Y9Z A;  1XTA A;  2EZI A;  4LLG F;  1Y56 A;  2X85 A;  1AKH A;  1LUJ B;  4UUT A;  2MC3 A;  3S1M J;  3BJA A;  2COB A;  3VOE A;  2W48 A;  5IY5 H;  1I3A A;  1T08 B;  1ZRF A;  1HKQ A;  3S1R J;  2ZJQ F;  2E1M B;  3JRC A;  3BY6 A;  4Z2Y A;  3MKY B;  2AXL A;  1X58 A;  4KIT B;  3LMM A;  2GM4 A;  3SDB A;  3TO7 A;  2ZNY A;  4Q48 A;  1X19 A;  4JP0 A;  2VLA A;  2FQ4 A;  1MBE A;  1G3T A;  1U8R A;  2CQQ A;  4XRF A;  1WZ2 A;  3UNG C;  2G9W A;  5EEH A;  5K5O A;  1HKS A;  1ZQ3 P;  2L9N A;  4IXA A;  4XLF A;  3LSJ A;  5JHF A;  1Y8Q B;  4CA0 A;  5HS7 A;  1RET A;  2GZW A;  3OOU A;  3PSF A;  3LNQ A;  4OIQ F;  3R60 A;  1B8I B;  1LFB A;  1PP7 U;  3QU3 A;  1R9T J;  4OIP F;  1Z0X A;  2KFD A;  4ZC3 A;  2WAE A;  4A3M J;  2ZFU A;  5TIS C;  3HUG A;  3NQO A;  1RR7 A;  3WTX C;  2E35 A;  3H1C A;  2PMU A;  2DMP A;  1FP2 A;  1YYV A;  2IAI A;  1K83 J;  3M8J A;  2NNY A;  2NOJ B;  2JSP A;  2OA4 A;  2Y0S N;  1FLI A;  2WB1 N;  3F8N A;  4CGZ A;  2LH9 A;  2OQR A;  2XUB A;  4I0A A;  1JUS A;  1W5C C;  1R1T A;  1LQ1 A;  3O8H A;  4NB5 A;  1O3Q A;  2EFW A;  3HRU A;  4HSR A;  3G6E I;  4BXX J;  4EAT A;  2R7X A;  4U0Y A;  4BHB A;  5E79 C;  2JN6 A;  3E0J B;  1I50 J;  1XX5 A;  2R7W A;  3E5Q A;  3OYC A;  3FX3 A;  2K9M A;  3GLX A;  3IRR A;  3A2K A;  1U5T A;  5E20 A;  1WQ2 A;  2EFQ A;  1W36 D;  5IT9 K;  1JHF A;  5B5E C;  3L1P A;  3ZMD A;  2LFB A;  4UV8 A;  2ELK A;  1Q1V A;  4CO8 A;  2L9V A;  4BNC A;  3CP2 A;  4K2E A;  1A36 A;  2PJR B;  1LDJ A;  3ZQF A;  2JPC A;  2KT0 A;  1SD6 A;  2DBB A;  4HF2 A;  5F0C A;  1HCR A;  2R7V A;  5KAF C;  3FM5 A;  5DUK A;  4EMS A;  2DN0 A;  5TRD A;  5DM6 F;  2VJ4 A;  1MBH A;  2DYS H;  4MGR A;  3A01 B;  4G7H F;  2JA5 J;  5D5W B;  4CUG A;  2VAS A;  1QHG A;  4DOZ A;  3PNY A;  2F5V A;  3H9J A;  5CQG A;  4Y4R A;  2DA6 A;  5FLX K;  1ON2 A;  4LMY A;  1HST A;  4WXC A;  4DZJ A;  3I64 A;  3S93 A;  1GVD A;  1XSD A;  1R1V A;  4KT6 A;  5H2F C;  4XLH A;  2P8T A;  3ZMZ A;  3SQN A;  2NVX J;  3H36 A;  2VOD A;  2VJJ A;  1RUO A;  2XPV A;  2BY2 A;  5HNF A;  4XMY A;  1W0T A;  2XAS A;  4XNF A;  3ZOB A;  3IL2 A;  3OR2 C;  2E5N A;  3SEQ A;  2EIM H;  3G3Z A;  3BR1 A;  3OYB A;  3OYI A;  4ZH4 F;  1O3R A;  1Z91 A;  3KX2 A;  3WE3 A;  3RI4 A;  4M3G A;  2WY7 Q;  1LVA A;  1NTC A;  1OCC H;  5K1Y A;  2CQK A;  2XVC A;  4IO9 F;  3BR5 A;  3RTR A;  1QU3 A;  5FRN A;  1ONV A;  2F6C A;  1ENH A;  3W6K B;  3JAM Z;  4I02 A;  3AKZ A;  3KET A;  2EA2 A;  3W3C A;  2VON A;  2F5C A;  5E1W A;  1IN6 A;  1OPC A;  5M5W J;  1YQA A;  2O03 A;  1IDY A;  3BP8 A;  2IGM A;  2V79 A;  3HM5 A;  1GV2 A;  1JHH A;  2O61 A;  2LY9 A;  1UST A;  4RM2 A;  1H89 C;  4XM3 A;  2W00 A;  3RDI A;  3GTQ J;  2XAG A;  1UMQ A;  2X6O A;  2DA3 A;  3I54 A;  2R5Y A;  2QM3 A;  5BPD A;  1UAA A;  1RKW A;  1MBK A;  4ANJ A;  3CMA I;  1ON1 A;  2LBF B;  2P6T A;  3UKG A;  1JKQ C;  1BJA A;  2GQQ A;  2KRH A;  1G8X A;  3BG5 A;  1KQ8 A;  4PGG A;  1TWC J;  4A2U A;  4I6Z A;  5LHI A;  1RIO H;  4B3X A;  4GYI A;  4TV7 A;  2H8W A;  5B3S H;  4PJM A;  1SAU A;  2HWV A;  1X2N A;  2VKE A;  4LG0 B;  1BW5 A;  2HQR A;  1MBG A;  4A3K J;  2AS5 F;  4UY8 I;  3K7A J;  4N9H A;  5E8G A;  4AD9 A;  3IWZ A;  2L7Z A;  1LFU P;  1HDD C;  3OWT A;  4GO1 A;  5J1R A;  1VQK I;  4C30 A;  4C3J J;  2MC4 A;  2L4M A;  2XDV A;  1XGM A;  5J8F A;  3BLY A;  2UZK A;  2EZK A;  1K61 A;  3FKJ A;  4IKF A;  2XB5 A;  2OTJ I;  2Q0O A;  2HU9 A;  4A93 J;  2DQL A;  2X1C A;  3I59 B;  1U78 A;  3CJT B;  3I4P A;  2XAH A;  1ZTR A;  1IAW A;  1O7F A;  3FDY A;  4FQG A;  4HV6 A;  4IOA F;  3OV8 A;  1YIO A;  2BY0 A;  3K9T A;  5E1X A;  4QPO A;  1I27 A;  1S9H A;  2XB0 X;  5HLI A;  4A3E J;  1YX3 A;  1F4K A;  3DKX A;  3I56 I;  3MZH A;  3LA3 A;  2DA2 A;  2FJ1 A;  3GCM A;  1K6Y A;  4HA8 A;  2HPI A;  1JJ8 C;  3K2A A;  3REO A;  3CC2 I;  4ZDP A;  3LA7 A;  3OL3 A;  2M30 A;  2Q1Z B;  1PVE A;  2DPD A;  2XRN A;  3TDU C;  1ACI A;  1KQ0 A;  2L5Q A;  2L7M P;  1ETQ A;  1P7J A;  1VI0 A;  4BAY A;  2JUG A;  3LA2 A;  2UXX A;  4KT5 C;  2M34 A;  4ZZD A;  1XSX A;  3W6J B;  4RBO A;  3PIP F;  3RYP A;  2CQX A;  4U87 A;  3I59 A;  3U1D A;  4B09 A;  5EGO A;  1EA3 A;  1G4D A;  2KZG A;  3OMY A;  2VJ5 A;  5IP9 J;  2RQQ A;  5KAI C;  3H3U A;  4IOC F;  3O8G A;  2YSR A;  4R79 A;  2VT3 A;  2QUF A;  4EM1 A;  3I55 I;  2XHK A;  3NEU A;  2CW0 F;  2B0L A;  3Q0U A;  1JUM A;  2BVL A;  1QVU A;  1QVT A;  2EPF A;  3WG9 A;  1ZRE A;  4HW0 A;  3G73 A;  1SMT A;  3ABL H;  4CCM A;  4BY1 J;  3BRO A;  2G0E A;  2A61 A;  2R7Q A;  3S3N A;  3S14 J;  1YS7 A;  4YFX F;  3HC7 A;  4IHT A;  5E3N A;  2I8D A;  3WOD F;  1IN4 A;  3L7W A;  2O0Y A;  2IA1 A;  3ABM H;  2IGO A;  3DTI A;  2MFZ A;  4E7Z A;  3DEW A;  4PSX A;  2PFB A;  2EIJ H;  4KMU X;  4XK4 A;  1ETO A;  2Y0S A;  3FXU A;  2I10 A;  2MAB A;  3VSL A;  4BQQ A;  4LLL A;  4CXF A;  1YHQ I;  1XMA A;  3ZMS A;  3HJE A;  2NRA C;  3BJO A;  4RGX A;  5H20 A;  4YIR X;  4M6V A;  1UZC A;  2ELJ A;  4OU0 A;  1SAN A;  3EUH A;  2ME0 A;  3ABU A;  3JRD A;  1LEB A;  6PAX A;  3OY9 A;  1LDK B;  2KIS A;  3MN2 A;  3F8B A;  3KZY A;  2F4O B;  4HNT A;  3LL7 A;  2IT0 A;  3RPU D;  3DLL F;  2FX0 A;  3BTI A;  3DXJ F;  1HSJ A;  4PJJ A;  5CVV A;  1YO5 C;  2BXY A;  2A5W A;  3BCB A;  1IZ1 A;  3HPG A;  1J0R A;  1IJW C;  2O3F A;  3LOC A;  4EJV A;  4ENN A;  3CCY A;  4Q47 A;  1A31 A;  2A3S A;  2IGK A;  2I5U A;  4IEJ A;  2DT7 B;  1T33 A;  3BR0 A;  2DMU A;  2V1D A;  3K6G A;  4LB6 B;  1YS6 A;  2K9S A;  2OPT A;  2L2O A;  4WK8 F;  4XOP A;  2CRG A;  3TL4 X;  3IKT A;  2ISY A;  3CJN A;  1YIJ I;  4P55 A;  2HKX A;  3U9G A;  4ZTF A;  2FE3 A;  2Y30 A;  1U2W A;  1VFC A;  2GLO A;  2ESH A;  2K3P A;  5KHD A;  3IH4 A;  3TW6 A;  2XKP A;  3RKY A;  2CUF A;  4A5M A;  2DU9 A;  5ICG A;  4P96 A;  4ITV A;  5K7Z A;  2V4J C;  4MQ9 F;  4M9Z A;  1O4X A;  1E3O C;  3PO2 J;  2QZ8 A;  1W7P D;  4N4N B;  3K1N A;  4PDK A;  5IPA A;  4LLN A;  2NVT J;  2RVC A;  1RUN A;  5HS8 A;  3S2H J;  2Z3Y A;  3FBN B;  3ZQQ A;  1XCB A;  1WRJ A;  4C3H J;  2GA2 A;  4GCV A;  4XLA A;  2P5L C;  2CUJ A;  3D5L A;  2LTP A;  4UVA A;  3IKV A;  4I99 C;  4ZTJ A;  1JXS A;  3LSK A;  1JT0 A;  3ZP5 A;  2DT6 A;  1VND A;  3D1N I;  4F92 B;  3CMM A;  4P1W A;  1WJE A;  3HRT A;  3Q9S A;  2XAQ A;  4QPQ A;  3E5U A;  3CCM I;  1IG7 A;  3PM1 A;  2LP0 A;  3GVA A;  4M9X A;  3ZRG A;  1I1S A;  3GW2 A;  3SYT A;  1EH8 A;  1VQ7 I;  4UB8 C;  2VXD A;  5F64 A;  4HAM A;  2AHQ A;  4PSW A;  2X51 A;  2ECC A;  3TBI A;  4EJO A;  1BOA A;  4CCJ A;  3MKL A;  3ZPL A;  2O6G E;  2ZJR F;  1E2X A;  1YFH A;  2VXZ A;  2EIL H;  4IHX A;  1UB9 A;  1X1B A;  1OYI A;  4RDU A;  3K2Z A;  3K4B A;  2ZXW H;  2DI3 A;  3BZC A;  1OYW A;  1BOB A;  2EQR A;  4RAF A;  4BQA A;  1HBX G;  3WG7 H;  2B7E A;  3K0L A;  2ZC2 A;  4BUP A;  5ICE A;  3C2G A;  1K4T A;  3KFW X;  3GTO J;  1OQY A;  2IGN A;  5E3L A;  3H5R A;  1LJ9 A;  4ZDL A;  2A5Y B;  3F23 A;  3DBH B;  3KLO A;  2IS1 A;  4EV0 A;  3VYS B;  2DTZ A;  4AUX A;  2CV1 A;  4C2T A;  4HX8 A;  3ZQ7 A;  4UXN A;  4BXU A;  3C2H A;  3I5U A;  3OR1 C;  3RCO A;  3EUA A;  3OIP A;  4G12 A;  3WTY C;  1MJB A;  1U6G A;  2L9R A;  3KZI C;  4IL6 C;  3LSI A;  4MEY F;  2V1X A;  2XC7 A;  2V7F A;  2EWN A;  3AG2 H;  2UV1 A;  4R1H A;  3V7R A;  4HZF A;  2O7O A;  4F52 A;  2H6C A;  3P9I A;  4UNO A;  2JK3 A;  5EZH A;  5FD5 A;  3ZMT A;  1W7P B;  1KGS A;  5LHG A;  4AVP A;  1DUX C;  1Z3Y A;  4A3L J;  1QA6 A;  1MH3 A;  2LC2 A;  1XN7 A;  2EIN H;  3Q9V A;  4CIC A;  1J75 A;  2K9Q A;  2WAQ N;  4C3I J;  3HIF A;  4RB1 A;  1WH5 A;  1GDT A;  4XL9 A;  4ZYH A;  4LD5 A;  4DJA A;  4G8X A;  1SFK A;  4PK4 A;  4FCY A;  4BL0 B;  1LVK A;  5CYV A;  2R5Y B;  2DOD A;  1U5T C;  4NDL A;  3QOP A;  4UUS B;  2RAE A;  2GWR A;  1FJL A;  2CG4 A;  2EA4 A;  2EZL A;  3CLO A;  4M72 A;  3ZMU A;  5GTI C;  4HV5 A;  1R4M B;  1Z6T A;  4NQW B;  1V5G A;  1ZAO A;  4RGS A;  2V9K A;  2ZCW A;  1Y0U A;  2GXA A;  2QSG X;  4OIR F;  1BIB A;  4ZYG A;  4UUS A;  1TQP A;  3GFI A;  2IRF G;  3CCS I;  3G2B A;  2Y0M A;  3DTE A;  3GFJ A;  3JTH A;  2HQ5 A;  3D0S A;  4Y7N J;  3M07 A;  5C3E J;  4V2F A;  4HDV A;  3PL8 A;  1MD0 A;  2EFN A;  2P7V B;  3Q3S A;  3JRE A;  1IUF A;  3HRM A;  3O2P E;  2IPQ X;  2VKH A;  2VQH A;  1VTN C;  2NYX A;  1FY7 A;  1MBF A;  2ESN A;  2LY2 A;  3K70 C;  1T38 A;  1K7A A;  3Q0V A;  3TP3 A;  3FXL A;  2XSD C;  2XGE A;  2KMU A;  5KK1 A;  4A0Z A;  2NS8 A;  3C18 A;  2F5D A;  4X0G A;  3K4J A;  2Y31 A;  2VI6 A;  1FSE A;  3F72 A;  2NVQ J;  1PUE E;  2XRO A;  4D5C A;  2KJC A;  4F93 B;  4BGD A;  4I09 A;  2Z99 A;  3FXK A;  4M9S A;  2CW8 A;  2BYV E;  2M7A A;  3WHC A;  1X4O A;  4KJZ A;  2D5V A;  2JVH A;  3MZY A;  1KU7 A;  4UUV A;  2XAJ A;  3KP7 A;  2QQ9 A;  4CSW A;  1WJD A;  1HQC A;  2VOO A;  5JFR A;  4WXH A;  2VPR A;  3V8K A;  1NK3 P;  3F8M A;  2QQA A;  3M7G A;  5GAE J;  3LFK A;  4YFN F;  1I5Z A;  2XSJ C;  4OAZ A;  3H9G A;  5J40 A;  1LE8 B;  4D5F A;  2HVS A;  5LLQ A;  3RPQ A;  2M45 A;  5KCM A;  2H09 A;  3ZXS A;  3ML6 A;  1G59 A;  2HQA A;  3M8E A;  4F91 B;  3PSI A;  1Y6I A;  3M1C A;  5M5Y J;  5EEG A;  1WI9 A;  2E1N A;  4DNC A;  4ESJ A;  1OMI A;  4HNV A;  2L7F P;  2WWY A;  1FIA A;  3KP4 A;  3QU6 A;  5HLT A;  1IXC A;  3GUD A;  4ABZ A;  1SD7 A;  4PCQ A;  3TO9 A;  2LNB A;  2EV0 A;  2P7C B;  5KVR A;  2VBZ A;  2Y2Z A;  1OJL A;  2WV0 A;  3M9A A;  2HDW A;  4H0E A;  5CVR A;  3F21 A;  1ZGA A;  1HF0 A;  1K4S A;  2JPB A;  5HOO A;  4BDY A;  1E0E A;  2R7F A;  4PJ0 C;  3GXO A;  2K9N A;  5ILS A;  4A0X A;  3K1M A;  2FMY A;  5ERI A;  3VB2 A;  4B43 A;  4XID A;  1AU7 A;  2ZME B;  3R0J A;  3VEP A;  1APL C;  4GGG A;  2ZBK A;  3B02 A;  3S16 J;  5IT9 Z;  3ONQ A;  3RPU A;  3T1B A;  4B48 A;  4GDF A;  3IUO A;  2FNA A; 
#chains in the Genus database with same CATH homology
 2ECB A;  4QSH A;  4DYC A;  1ENH A;  3NAU A;  5EYR A;  5M5W J;  4MFE A;  1IDY A;  3HM5 A;  1GV2 A;  2LY9 A;  3QQA A;  4MIM A;  1H89 C;  3FIW A;  1G2H A;  2DMN A;  3GTQ J;  1UMQ A;  2X6O A;  2DA3 A;  2R5Y A;  1IRZ A;  1WH7 A;  1RKW A;  3FKI J;  2M0C A;  5IYD J;  3QPL A;  1MBK A;  4JX6 A;  4IHY A;  3QPS A;  1FTZ A;  2NS7 A;  1U9N A;  1HDP A;  3I4N J;  2MG4 A;  3UKG A;  1XS9 A;  1JUP A;  1JKQ C;  3BG5 A;  1TWC J;  1RKT A;  4I6Z A;  1Y1W J;  1QRY A;  2YS9 A;  3HOV J;  4DYQ A;  4A3C J;  1X2N A;  2VKE A;  2JWT A;  1B72 B;  1BW6 A;  3FIS A;  3HOY J;  4FE4 A;  1MBG A;  1IDZ A;  4A3K J;  3K7A J;  3BG9 A;  5GPA A;  2L7Z A;  1LFU P;  1HDD C;  5J1R A;  3H3V K;  3E7L A;  5C4J J;  4C3J J;  2MW8 A;  5E3O A;  2JMW A;  2HXI A;  4I76 A;  1ORK A;  2HOS A;  3JRH A;  3BT9 A;  1ZK8 A;  4DZP A;  3PO3 J;  4M3D A;  3GTM J;  5EEA A;  1K61 A;  2EZK A;  3RQI A;  1ZGW A;  5F08 A;  2XB5 A;  1MH4 A;  4IHW A;  1ZR4 A;  4A93 J;  1GUU A;  2K40 A;  1U78 A;  2B63 J;  3OSF A;  5EGO B;  3FK6 A;  4A3B J;  1ZTR A;  3WHB A;  1TC3 C;  1ETK A;  1BA5 A;  4A3E J;  2XB0 X;  3HGG A;  4J19 A;  2R0Q C;  2DA2 A;  2FJ1 A;  4M3F A;  3BR2 A;  1JJ8 C;  3K2A A;  5IYB J;  4MFD A;  5DTD A;  5EG0 A;  2LK2 A;  1NK2 P;  3A03 A;  3ZQH A;  2L7M P;  1ETQ A;  3BTL A;  4X6A J;  1P7J A;  1VI0 A;  1AKH B;  1OFC X;  3OIO A;  2M34 A;  4X1E A;  1H8A C;  5FJ8 J;  3A01 A;  1WI3 A;  4RBO A;  1I6H J;  4B4C A;  1WPK A;  1IC8 A;  2CQX A;  2DMT A;  5EGO A;  2XPW A;  1ZR2 A;  2JJ7 A;  4IHV A;  4B1R A;  5JLX A;  3BTC A;  4A3F J;  5IP9 J;  3S1Q J;  3JR9 A;  3O8G A;  3MVP A;  1W0U A;  1GT0 C;  2EZH A;  5IYC J;  3IH3 A;  1FIP A;  4EEF G;  5IOZ A;  2IBD A;  4M3B A;  1XC5 A;  3Q0U A;  1JUM A;  1Y1V J;  4QTR A;  1QVU A;  1QVT A;  5IP6 A;  1HOM A;  4BY1 J;  3LSR A;  2G0E A;  3IV5 A;  5F1J A;  3S14 J;  4B3A A;  5E3N A;  4XIC A;  2MGQ A;  1F36 A;  2TCT A;  3JRI A;  2XRL A;  2VUM J;  3DEW A;  3H0G J;  1JKP C;  3BQZ A;  1U9O A;  2DJN A;  4XK4 A;  1JGG A;  4MO7 A;  1F43 A;  4AC0 A;  1ETO A;  3RZD J;  2I10 A;  2WV1 A;  3I4M J;  3F0C A;  3TP0 A;  5EDN A;  2ID6 A;  3HOW J;  4M6V A;  1SAN A;  3GTL J;  1ETX A;  3SJM A;  4FE7 A;  2ME0 A;  3M4O J;  4MLO A;  2Y9Y A;  5F0H A;  1JTX A;  3JRD A;  4FTH A;  3MN2 A;  3BTJ A;  1PUF B;  2LKX A;  3Q0W A;  5F04 A;  2YU9 J;  2FX0 A;  3ZQC A;  3BTI A;  2DA1 A;  2NVY J;  2O8K A;  1IJW C;  3LOC A;  2M2E A;  3B6A A;  1EF4 A;  3CCY A;  4XRM A;  3HBL A;  1JJ6 C;  4IEJ A;  1JTY A;  1T33 A;  3BR0 A;  4XRS G;  1IGN A;  2DMU A;  5M3M J;  5BNG A;  2K9S A;  2OPT A;  2CRG A;  1WGX A;  1U8B A;  1RES A;  2NOG A;  2IEK A;  4JX4 A;  2Y30 A;  4BKX A;  5EG0 B;  3G1O A;  4C2M J;  1VFC A;  2GLO A;  2X9D A;  3M3Y J;  5M5X J;  1B8I A;  3IH4 A;  3TW6 A;  1GV5 A;  2CUF A;  3HOZ J;  2R5Z B;  1D5Y A;  1UG2 A;  3GTP J;  5K7Z A;  3S1N J;  1JKO C;  1O4X A;  1E3O C;  1T56 A;  3PO2 J;  2N8G A;  5JLW A;  1TWH J;  3HB9 A;  2CUE A;  5IPA A;  2NVT J;  3S2H J;  2XGC A;  1POG A;  1MBJ A;  1CQT A;  4JYK A;  5GPC A;  2YUS A;  5IP7 J;  4C3H J;  2LLK A;  2GBY A;  4Y52 J;  4S0H B;  3BR6 A;  2LTP A;  5C4X J;  4JX5 A;  4L5E A;  2XPU A;  2LD5 A;  1JT0 A;  1XG1 A;  1A5J A;  3IH2 A;  1FTT A;  1SFO J;  1RPW A;  2ID3 A;  4BBR J;  3BR3 A;  2HYJ A;  1S7E A;  1VND A;  5EZG A;  5GP9 A;  3D1N I;  1X2M A;  1QPI A;  1ETW A;  4DW6 A;  5FKO A;  1MSE C;  1OCP A;  2FD5 A;  4A69 C;  1IG7 A;  3PM1 A;  1PUF A;  2LP0 A;  3GTG J;  4CYC B;  2OF7 A;  2PMZ N;  4W97 A;  2AHQ A;  3B6C A;  3CMY A;  2ECC A;  2X48 A;  3G1L A;  2R92 J;  3MKL A;  2LVS A;  3CDL A;  5F27 A;  1HLV A;  5FLV A;  2EBI A;  1DU6 A;  2VKV A;  1A6I A;  4IHX A;  2DA7 A;  2E2H J;  3HKZ N;  4RDU A;  4DYR A;  3GTK J;  2E2J J;  3G1M A;  2EQR A;  2DMQ A;  2CU7 A;  5K7H A;  1BJZ A;  5J1Y A;  3HGY A;  1ETV A;  3GTO J;  3BG3 A;  1YRN B;  1ZKG A;  5E3L A;  1IV6 A;  3HEF A;  1Z77 A;  5IOY A;  3SDG A;  5FKN A;  2R93 J;  2DTZ A;  4AUX A;  2MSY A;  2AO9 A;  1H88 C;  1I3Q J;  4A3D J;  4G12 A;  1B72 A;  3S15 J;  2L9R A;  1ITY A;  4BY7 J;  2O7O A;  3HOX J;  2Y9Z A;  2P81 A;  2EZI A;  2JK3 A;  5EZH A;  4UUT A;  1AKH A;  2E2I J;  2M8G X;  3S1M J;  3OSG A;  4LOC A;  3TW7 A;  2COB A;  2EH3 A;  2W48 A;  5HOD A;  4A3L J;  1MH3 A;  3TED A;  3S1R J;  3JRC A;  1TWF J;  2K9Q A;  2WAQ N;  1X58 A;  4C3I J;  2LR8 A;  3GTJ J;  1WH5 A;  1MSF C;  2GM4 A;  1GDT A;  3JRF A;  5J3L A;  2XGD A;  5J1U A;  2JA8 J;  4JP0 A;  1BL0 A;  2FQ4 A;  1MBE A;  4FCY A;  2CQQ A;  5K7F A;  4GFB A;  4A3G J;  3JRG A;  2R5Y B;  1ZQ3 P;  1WCM J;  3LSJ A;  4NDL A;  4UUS B;  2RAE A;  1TWG J;  1FJL A;  2EZL A;  5FLM J;  1RET A;  3OOU A;  3LNQ A;  1JT6 A;  3LSP A;  3HOU J;  1B8I B;  1LFB A;  5C44 J;  1R9T J;  4D7M A;  1Z0X A;  4UUS A;  4A3M J;  1RR7 A;  2E1O A;  1ETY A;  2ZB9 A;  3GBG A;  2DMP A;  2ME6 A;  2IAI A;  2HQ5 A;  1K83 J;  4Y7N J;  5C3E J;  4V2F A;  2HI3 A;  2JA6 J;  2Y0S N;  2WB1 N;  2HXO A;  3JRE A;  1AHD P;  3Q3S A;  1IUF A;  2HOT A;  1JUS A;  3RZO J;  3O8H A;  1JKR C;  1UHS A;  4W1U A;  1MBF A;  3S2D J;  4BXX J;  3Q0V A;  3TP3 A;  2XSD C;  2XGE A;  4BBS J;  3BQY A;  2E19 A;  2JN6 A;  2NS8 A;  1I50 J;  2HOA A;  2Y31 A;  2VI6 A;  2NVQ J;  4A3J J;  5F0F A;  3A02 A;  4FIS A;  4M3E A;  4D5C A;  4A3I J;  1LE8 A;  3NAR A;  3L1P A;  2LFB A;  3CQZ J;  4CYC A;  3JRB A;  2ELK A;  1Q1V A;  2M9H A;  2H8R A;  3WHC A;  2D5V A;  5E3M A;  1DU0 A;  4D7N A;  2JA7 J;  1P7I A;  5FKK A;  3ZQF A;  2KT0 A;  2VPR A;  5F0C A;  1NK3 P;  1HCR A;  3JRA A;  2DN0 A;  3DCF A;  4V2G A;  1MBH A;  1LE8 B;  4D5F A;  3ZQL A;  3A01 B;  1YRN A;  2JA5 J;  2CJJ A;  1MNM C;  2O9L A;  2L0K A;  3VPR A;  3S17 J;  3W6V A;  2DA6 A;  1OCT C;  3FK7 A;  5M5Y J;  1VF9 A;  4DZJ A;  3RKQ A;  4HNV A;  1GVD A;  4QIW N;  2L7F P;  4AYB N;  1FIA A;  5FKM A;  5M3F J;  4ABZ A;  2NVX J;  5EF6 A;  2H1K A;  2XPV A;  1TWA J;  2HDD A;  3HDD A;  3SFI A;  1W0T A;  2Y2Z A;  1OJL A;  3ZOB A;  2QF7 A;  2DA5 A;  1HF0 A;  5FKL A;  3ZQI A;  4XRS A;  3BR1 A;  2DA4 A;  3LSG A;  2K9N A;  1AU7 A;  4XID A;  2KDZ A;  3C2B A;  4M3G A;  1APL C;  5DS9 A;  3S16 J;  9ANT A;  2R7Z J;  2R5Z A;  1NTC A;  2QCO A;  3ZQG A;  1BW5 A;  3BR5 A;  2TRT A;  1FEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...