5EG0B

Hoxb13-meis1 heterodimer bound to dna
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
61
structure length
61
Chain Sequence
RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Homeobox protein Meis2
publication title Molecular basis of recognition of two distinct DNA sequences by a single transcription factor
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 16
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2015-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5eg0B00
1FJLA 2DMTA 2RAEA 4UUSA 3JR9A 3UKGA 3O8HA 4MFDA 4GFBA 4XRSA 4I76A 3K7AJ 5M5WJ 3PO2J 4A3EJ 2E2JJ 4S0HB 3ZOBA 5IYBJ 2XGEA 1AKHB 2M2EA 2QCOA 1JGGA 2VKEA 4DYQA 4B3AA 2NVXJ 1A5JA 2EZIA 3K2AA 5IPAA 4A3IJ 1BW5A 2M34A 2L7ZA 2DN0A 3HOVJ 3CMYA 3S17J 1ETQA 5C4XJ 5E3LA 3FKIJ 1FTZA 1B72A 1ETYA 1MBHA 2K9QA 1JUSA 2LR8A 2WAQN 1D5YA 4C2MJ 3PM1A 2JJ7A 2LKXA 1APLC 2HYJA 1WI3A 1H89C 5J1UA 2WB1N 4IHXA 1GVDA 4BKXA 2NS7A 1JKQC 1U78A 4DZPA 3GTMJ 1LE8A 1ETWA 1I50J 1MSFC 3LSRA 5IYDJ 1AHDP 4ABZA 3JRDA 1B8IB 2O8KA 5E3MA 4MFEA 3BR1A 4BBRJ 2YS9A 1JJ6C 1POGA 2I10A 3IH4A 1E3OC 4IHVA 3GTOJ 1IV6A 1JTXA 4RDUA 4A3JJ 2DA1A 3GTJJ 1H88C 2R93J 2NS8A 2JWTA 2CJJA 4J19A 1F36A 5EF6A 3JRFA 2VUMJ 1ZGWA 1ZQ3P 2GBYA 5EZGA 3A02A 3RZOJ 1U8BA 2E19A 2M0CA 4DYCA 5E3NA 5DTDA 2E2HJ 2R5YB 4A3KJ 1JKPC 3BG5A 3B6CA 5FKKA 3JRGA 1PUFB 2Y2ZA 3GTPJ 3JRIA 3ZQFA 4A3LJ 2FD5A 2LP0A 2P81A 1UHSA 1O4XA 3BQZA 2DA7A 1HLVA 5C3EJ 1X58A 1JKOC 5IP6A 1WGXA 2MGQA 3HGGA 4X1EA 1CQTA 5EG0B 1IG7A 1QRYA 1DU6A 1MH4A 1ETOA 2ID6A 4M3EA 4W97A 4DYRA 3GBGA 3HBLA 4UUSB 2LTPA 3QQAA 3Q0UA 1RETA 4B4CA 1MBJA 3FISA 4FE4A 5DS9A 3SJMA 2K9NA 4XK4A 4DZJA 4EEFG 1BW6A 2HOSA 2HXOA 2WV1A 3BTJA 4M3BA 5EEAA 2FJ1A 2KDZA 2HXIA 4A3FJ 4IEJA 1QVUA 1TWGJ 1VF9A 5FLVA 1HDDC 2IEKA 3A03A 3OSGA 1VFCA 2HOTA 3LOCA 3GTKJ 4LOCA 5GP9A 1ZKGA 1B72B 3I4NJ 1MBFA 1Y1WJ 4AC0A 2N8GA 1GV5A 3BQYA 2XGDA 2NVYJ 3BR6A 2DJNA 1Y1VJ 3BTLA 2CRGA 4JP0A 1T56A 2DA4A 2B63J 5F08A 4XRSG 3BTIA 1Z77A 5JLXA 2AHQA 2Y30A 4X6AJ 4D5CA 1LFUP 1JJ8C 1LE8B 2M9HA 2PMZN 2D5VA 2NOGA 3HGYA 3CDLA 5FJ8J 2JK3A 2ECCA 3M4OJ 4IHWA 5FKMA 3S1QJ 3RQIA 4C3JJ 4B1RA 1ETKA 2LLKA 4M3FA 2CQQA 1XC5A 2M8GX 2LD5A 3MKLA 3S15J 2VPRA 5M3MJ 2DMPA 3TW6A 3A01A 2CQXA 3BG9A 2HOAA 1WH7A 2XB5A 3CQZJ 4C3HJ 1WH5A 3JRHA 3B6AA 2NVQJ 1I6HJ 3OOUA 1BL0A 3HOWJ 1X2MA 2MW8A 4FISA 1U9OA 3ZQHA 1ZTRA 2R7ZJ 1QVTA 5FKOA 3I4MJ 4BY1J 5IP7J 3JREA 1NK3P 3HOZJ 2CUEA 2E1OA 2XRLA 4MIMA 5J1RA 1ENHA 4D7NA 4A3MJ 1NK2P 5F27A 2MSYA 1YRNB 1FEXA 5GPAA 3L1PA 1DU0A 4A69C 3NARA 1JKRC 3W6VA 3TP0A 4XIDA 1AKHA 2Y31A 3IH2A 3GTQJ 3BR5A 2Y0SN 1TWHJ 4JX5A 2LFBA 5C4JJ 1XS9A 4CYCB 5F04A 3M3YJ 1MH3A 2OF7A 1ZK8A 1Q1VA 2DA2A 4FCYA 5BNGA 1SFOJ 3GTGJ 1HCRA 2ZB9A 2H8RA 3HOUJ 2ID3A 2QF7A 4IHYA 1OFCX 3WHCA 4BXXJ 2EZKA 2VKVA 4BY7J 1TC3C 2JA8J 4V2FA 2XPWA 3LSJA 2LY9A 4MLOA 2R5ZA 5IOYA 2H1KA 3C2BA 1G2HA 1AU7A 2CU7A 5M5XJ 3BT9A 1GT0C 2K9SA 2ME6A 3HOXJ 1Z0XA 4QSHA 2XSDC 5K7FA 3RZDJ 3S2DJ 5F1JA 1JUMA 3RKQA 3O8GA 1ZR4A 5EDNA 4Y52J 3H0GJ 4JX6A 3BG3A 3HOYJ 1OCTC 4A3CJ 3WHBA 4A3BJ 2GM4A 1X2NA 2DMQA 5IOZA 2DMNA 3HKZN 3BTCA 2JMWA 2JA7J 3CCYA 1BA5A 4Y7NJ 2ELKA 2JN6A 1ZR2A 3GTLJ 3NAUA 1RESA 3A01B 5EYRA 1ITYA 1MBEA 5FLMJ 1HF0A 3BR3A 5F0CA 1F43A 4QTRA 2LVSA 1OCPA 2ECBA 2ME0A 2X48A 3PO3J 4XICA 3S2HJ 4DW6A 2MG4A 1RKWA 1MNMC 5K7ZA 2EZHA 2W48A 5F0FA 4M3DA 4JYKA 2E2IJ 2LK2A 2EZLA 2O9LA 3JRAA 5M5YJ 1FIAA 2G0EA 3G1LA 4UUTA 3TW7A 4M6VA 5J1YA 3QPLA 4W1UA 3E7LA 3S1RJ 3LNQA 1ORKA 1GV2A 1NTCA 2DA5A 5EZHA 1P7JA 2DA3A 5M3FJ 1FTTA 1OJLA 1SANA 4D5FA 3HEFA 2FQ4A 5IYCJ 4V2GA 1P7IA 3VPRA 2Y9YA 2YUSA 5K7HA 1U9NA 1RKTA 3DCFA 1K61A 3S14J 3ZQCA 4L5EA 4QIWN 4I6ZA 1JT6A 1S7EA 3Q0VA 4RBOA 3G1OA 3IH3A 1IGNA 2R92J 3LSGA 5EGOA 4AYBN 4FTHA 5E3OA 1W0TA 1R9TJ 2DA6A 4A93J 2JA6J 1T33A 3HDDA 2R5ZB 1JT0A 1IRZA 2JA5J 1VI0A 3ZQGA 3G1MA 2XB0X 3FK6A 4G12A 1UMQA 3Q0WA 5IP9J 5HODA 3Q3SA 1HDPA 2DMUA 3TEDA 4JX4A 3S16J 1HOMA 2K40A 2AO9A 1XG1A 1WCMJ 1IC8A 4HNVA 2R0QC 1ETVA 2EBIA 3LSPA 3IV5A 2EH3A 2XPUA 1VNDA 2TCTA 1RR7A 4A3DJ 2HDDA 5J3LA 1UG2A 2HQ5A 3BR2A 2NVTJ 1QPIA 1RPWA 2HI3A 2OPTA 1JUPA 1IJWC 2KT0A 2X6OA 2L9RA 1TWFJ 3FK7A 3OSFA 2L7FP 1TWCJ 4FE7A 1W0UA 1MBGA 4MO7A 2TRTA 2IAIA 1IDZA 4C3IJ 1GUUA 2COBA 4NDLA 2GLOA 2Y9ZA 2L0KA 1B8IA 2XGCA 3SDGA 5C44J 1H8AC 4AUXA 1LFBA 3F0CA 1YRNA 4BBSJ 2DTZA 2YU9J 4A3GJ 3QPSA 3BR0A 1MSEC 3JRCA 5F0HA 5JLWA 2O7OA 1IDYA 1ETXA 2FX0A 4M3GA 3DEWA 1A6IA 9ANTA 3MVPA 5FKNA 2IBDA 2VI6A 4CYCA 3JRBA 1JTYA 1IUFA 2X9DA 1K83J 2L7MP 2R5YA 5FKLA 3SFIA 2CUFA 4D7MA 1I3QJ 1BJZA 3ZQIA 1GDTA 1PUFA 1EF4A 2EQRA 3FIWA 2XPVA 3OIOA 1MBKA 3TP3A 3D1NI 1FIPA 3MN2A 5GPCA 5EG0A 3H3VK 3S1MJ 4XRMA 3ZQLA 5EGOB 1WPKA 3S1NJ 3HM5A 3HB9A 1TWAJ
chains in the Genus database with same CATH superfamily
2RAEA 4UUSA 3OYNA 3FBNB 4PSXA 2DDBA 2IJLA 4MFDA 4UV9A 3UKGA 5M5WJ 3CD6I 4WCGA 2ZNZA 4S05A 2EPFA 2DK5A 3ERMA 3FZVA 4O6JA 1HW2A 4IX7A 3W3CA 4IHTA 1A5JA 2OTLI 4A3IJ 2VONA 2DN0A 1XN7A 1U5TB 1F9NA 3FXJA 1GHCA 2DO7A 3E5XA 1I6XA 3DP7A 4NQWB 3KEYA 2HYGD 2COMA 2Z5UA 1B72A 3VYSB 2HEOA 1ETYA 2LR8A 2M0MA 1D5YA 3CCEI 1T38A 2MH2A 2LKXA 3IAM2 3WTXC 2RREA 2IGNA 3BLYA 5HS9A 1LDKB 2QUFA 1LUJB 1QQIA 1QHGA 2VPLA 3CO6C 3IAS2 2VBZA 4CDGA 4BE2A 1IN6A 1U8RA 4CCLA 4BYYA 3F6VA 4KDPA 3GTMJ 3LSMA 5EEHA 5K1YA 2ZBKA 2QZ8A 3LSRA 5IYDJ 1TNSA 1AHDP 2EJRA 3A0HC 3HPGA 4LG3A 3KX2A 3I55I 3E6MA 4HF0A 1USTA 1R00A 2B0LA 4BBRJ 3IH4A 4IHVA 3IP4B 4HDUA 2XV4S 1D0XA 1L0OC 2H09A 2H6CA 1ZLJA 3IHUA 4F55A 4A3JJ 2R7FA 4IO9F 3GTJJ 3K4BA 2MC4A 1YW7A 2V79A 3LAJA 2ADUA 2ZXJA 2IGOA 2OV7A 5TJJA 2VUMJ 3AAFA 4C9YA 2ZJ2A 4NBQA 3A02A 4IOAF 3RZOJ 2XAJA 3C3WA 2LBFB 2D1VA 2ZCWA 2E19A 1OQYA 1R5HA 2ZSIB 2OAZA 5DTDA 4HSTA 2WAEA 1XPXA 2DU9A 2R3SA 5L3BA 4HQEA 3K4CA 5AONA 4EM2A 4LB5A 4A5MA 4KMUX 5FKKA 1I27A 3GTPJ 2D2WA 3F3XA 2LREA 3ZQFA 4IRHA 2LP0A 1UHSA 3MAJA 4EM0B 4I98B 1K4SA 4DGWB 2HKOA 1X58A 3BJOA 2QBYB 4LJZF 3OR2C 3WGHA 1QRYA 3BROA 4RA2A 3ZMUA 1OYWA 1MH4A 1ETOA 2HFHA 2DI3A 1KZHA 4KYWA 3O6BB 4M3EA 1W36C 3GBGA 3HBLA 5CKTA 1YI2I 2L02A 3OYDA 1SD7A 2LTPA 3QQAA 1X1PA 1MBJA 3FISA 1HKSA 1X4OA 2AXLA 3MD2A 1PVEA 4WXCA 4OIRF 2K9NA 4DZJA 5L3FA 2TDXA 4JOMA 3OIQA 3F23A 1ACIA 2DYRH 5BMZA 2KJCA 1UHMA 3OS2A 5E18F 5FFZA 2KDZA 2LF8A 3LFKA 4MEXF 2W85A 2HZDA 3HIFA 1VF9A 1R1TA 1D1AA 2IW5A 3A03A 3OSGA 1YHQI 5GAHJ 2PBIA 1UJ8A 2M5WA 2WAQA 3H3UA 1ZKGA 3E6DA 2VT3A 1MBFA 4BQQA 4UB8C 3FXKA 3J7YJ 3ASOH 2KZVA 3WTZA 2XGDA 3V7SA 2WB1A 3PUBA 4YFKF 4XMYA 3Q5FA 3ROUA 1YO5C 4JP0A 2HQRA 3L7WA 4R79A 2QENA 3BTIA 4Q5SF 1Z77A 2RVCA 2RNJA 3TGNA 2R7TA 3IWZA 4X6AJ 4E7IA 2X1CA 4KA4A 2O8XA 2BXZA 3CF5F 2HKXA 3WTYC 2D5VA 3RYRA 2XAQA 2KKOA 1R7JA 1HQCA 4G94A 3RQIA 1KONA 4C3JJ 1ETKA 2FEZA 2QKMB 4NNJA 1FNNA 2LLKA 2PJRA 2GA2A 2MBFA 4ESFA 4IPAA 3SEQA 4BHPA 4EJOA 1FYMA 4G7HF 1O7LA 2NVQJ 1I6HJ 1P6RA 3E6BA 2DFEA 3HOWJ 4FISA 4CA0A 3K9TA 3ZQHA 1KQ9A 1QVTA 2EIKH 3JTHA 4ZDLA 1SEUA 3E1SA 1DQUA 5FKOA 3I4MJ 4BY1J 3IWFA 3KP4A 3ISPA 2XAGA 1LEBA 1NK3P 3HOZJ 4AVZA 2KHMA 2WTEA 2JRMA 5F27A 2MSYA 3I9V2 3CMAI 4KN4X 3NARA 5JHFA 2L2OA 4ZH4F 3W6VA 2A07F 4LB6B 3KP3A 3HSFA 2Y31A 3IH2A 3GTQJ 5JI6A 1HC8A 4HSRA 3EYYA 5D5WB 4I09A 1XS9A 1IXSB 5F04A 3M3YJ 5B1BH 1J75A 3EETA 3C7JA 1ZK8A 1U5TA 1BBYA 2OF7A 1X1AA 2DA2A 4BAYA 4ZYDA 5LLQA 2F5EA 5BNGA 1SFOJ 3PJRA 3GTGJ 2ZB9A 2EV5A 2ID3A 5HDNA 2KIQA 1U2WA 3PNTA 2JA8J 2HNHA 1WZ2A 1A35A 2VQLA 1VQMI 2X4HA 3MZHA 4MLOA 2M45A 2R5ZA 2W7NA 5LFAA 1G2HA 4IXAA 4QPOA 1VQKI 1AU7A 3AG1H 2CU7A 1H9GA 2ZSHB 3L2CA 3HOXJ 5D8KB 1Z0XA 3FDYA 1HXDA 3DPTA 1I3AA 5F1JA 3HHHA 2Z9OA 1LDDA 3RKQA 1FOWA 2DFIA 1W7PB 3O8GA 4I7HA 2PEXA 3H0GJ 2PMZA 4H4KC 5LGUA 1XGNA 2R7OA 1O3TA 2VLAA 2OBPA 3VSLA 1JHFA 3OV8A 1IF1A 2JA7J 4IOCF 2KIUA 2GXBA 5H6RA 1REPC 3DXJF 1D1BA 2JN6A 2ZJRF 3GTLJ 4N4OB 2JSCA 1RZ4A 1RESA 1WJEA 2ZXHA 1K6OA 5DM6F 2PI0A 1B1BA 1DUXC 1MBEA 5FLMJ 4ENKA 2HDWA 3DPLC 5F0CA 3GYHX 2LVSA 2GWRA 3AL0C 3F8BA 2EINH 4FETA 2P4WA 1MNMC 2EV6A 4EJWA 4M9XA 1T08B 2EZHA 2W48A 2X1DA 5DM7F 5BOXA 3GUDA 3FXLA 3KYDB 1XSVA 4AVPA 2W24A 4L5IA 2Y0SA 2BBYA 3DBRB 1ZGJA 1R1VA 2E7XA 2V9PA 3E7LA 1DPRA 4XN3A 5EZHA 4CCKA 1SANA 3GZ6A 1NG6A 1T0FC 3ABMH 4ZYHA 1P7IA 4HOBA 5E1ZB 5E8GA 5E17F 1K61A 4IKFA 4BJ6C 3LFUA 1SAXA 4I6ZA 4RBOA 2QSFX 1KGSA 1HKTA 1ZH5A 3K1MA 4OAYA 1IGNA 2CGPA 3A4CA 4A6EA 2D1HA 3LSGA 4FTHA 1XTAA 1W0TA 2UWMA 2BVLA 2VJIA 3GFJA 2V1UA 4A93J 5BPDA 1MD0A 1T33A 3GMEA 1R71A 1WJDA 1JHHA 2CFOA 3LL7A 3ZR8X 1GVJA 1IXCA 5CVIA 2ZJQF 1VI0A 3ZQGA 1EA3A 3SHFA 1BOBA 3FK6A 4F91B 1SD6A 2MABA 3Q0WA 3F9KA 2K02A 5HODA 3Q3SA 1HDPA 2CQ7A 1HW5A 2A6HF 1RR8C 2Z3YA 3TO9A 2E60A 2K40A 3GZNB 3HRTA 1EH8A 2RDPA 3HOTA 5ICCA 1VQOI 4HNVA 2EWNA 2VJ4A 2Z33A 4CH7A 2EBIA 1RNLA 2VC1A 2EH3A 2ICWG 2PJPA 2HDDA 2LKPA 1UG2A 2NVTJ 3ULQB 1RPWA 1AWCA 1RUNA 2HI3A 4WWCA 2AQEA 1MZBA 2KIMA 2L54A 3MQ0A 4CXFA 3VFZA 2W00A 5CQGA 1IJWC 2X6OA 3WTUC 1K6YA 3WTWC 3OSFA 2JTVA 3DU5A 4FE7A 3SQNA 1W0UA 2E71A 4HEA2 4YFXF 5K5RA 2IAIA 2C6YA 1I1SA 4E70A 3CC2I 2IS1A 2COBA 2GLOA 2L0KA 2VODA 2XGCA 1QPMA 2M30A 5C44J 4AUXA 1OCZH 3HSEA 5GTIC 4A3GJ 5GAGJ 3CO7C 1EJ9A 2CV2A 2YU9J 5IT9K 3BR0A 3OYKA 5HOOA 2OCEA 5FLXZ 5F0HA 5JLWA 1T0FA 1IDYA 3LSIA 4L18B 1R1UA 1ETXA 4KN7X 2H1LA 2D45A 1A6IA 1TP4A 3FM3A 2XKPA 2B7EA 2IBDA 2OUMA 2VI6A 4RS8A 2NXNB 2DPUA 3EUHC 2YU3A 3M9AA 5J4VA 4E7KA 2STWA 3CTAA 4BE0A 2DJIA 2O03A 4GO1A 5FKLA 3SFIA 3QPTA 4XBFA 4M9ZA 4Z6YA 3V4GA 3DTIA 2HGCA 1EF4A 2FBIA 4XQFA 3K10A 3WU0A 5DEQA 3MMYB 5D4SA 2EQRA 4WXHA 1ZRDA 2XPVA 2FA5A 3I59B 3OIOA 2A05A 3CUQB 1FIPA 5EG0A 1Y0UA 3CJNA 3S1MJ 1LJ9A 4CSWA 4XRMA 1K78B 2FU4A 3DWLE 5EGOB 3DBHB 4KIGA 4PGHA 1FJLA 2WWYA 2O5RA 4GFBA 3QYFA 2Q0OA 4DOZA 4BHBA 3PO2J 1YW9A 4A3EJ 2BY1A 1IN7A 4MQ9F 5IYBJ 3HC7A 1JXSA 3I53A 3K4MA 3KP6A 1JGGA 3A0BC 1K79A 2NVXJ 3LSTA 4GCVA 4BEHA 2EZIA 2BW3B 1X3WB 2P6SA 1BW5A 3QRFF 4AIDA 1X1CA 3V8LA 2K3PA 1BC8C 3S17J 2BY3A 1ON1A 1XMXA 1ETQA 5C4XJ 2VKDA 1FTZA 1V54H 3KFWX 2X0LA 4MGRA 4XLNF 4BQNA 4C2MJ 4OMYA 2G7UA 3BY6A 5EJCA 1XGSA 1R5ID 1WI3A 5J1UA 1Q1HA 3DU6A 1FPQA 2V4JC 5JHUA 3MCZA 2KPMA 3DKXA 3L2RA 3BJAA 4Y15A 4AU7A 3H9QA 4BKXA 2NS7A 1U78A 1F4KA 3E0JB 4Y3OA 4KT6A 4DZPA 1G3SA 1D8KA 1LE8A 5KHDA 1ETWA 4MTDA 3DQVC 4AD9A 2GAUA 3GWZA 3LQRA 3JRDA 1B8IB 4MFEA 1O3QA 3DEUA 1SFUA 4L5JA 3ZN1A 1J09A 1MDMB 1JJ6C 1CGPA 3ECHA 1VQNI 4P1WA 4O3MA 5L3DA 3D5SC 4HNTA 1IV6A 1JTXA 2CO5A 2STTA 2R93J 4I02A 5H6QA 4NC6A 2A61A 4J01A 2LRDA 1FOXA 4J19A 2L4AA 1LNWA 2L9NA 4LGWA 3G71I 1ZQ3P 2ZMEC 2E5NA 4KMFA 2QA4I 5EZGA 3L09A 2M0CA 1IW7F 1LEAA 1BIBA 1J5YA 2LY1A 2Z2SB 2E2HJ 2R5YB 5F6FA 4LITA 5FB2A 4LG0B 3JRGA 1PUFB 2Y2ZA 3JRIA 1FBSA 2FD5A 2P81A 4B8XA 3I58A 3BQZA 3CF2A 2JRTA 5C3EJ 1CQTA 1JE8A 1IRXA 4PZJA 3TMOA 1R22A 2ISZA 2ESHA 2YPRA 1ULYA 2NOJB 2ID6A 4W97A 4CCMA 5CVRA 1Z91A 4QPQA 4B09A 2PQ8A 3W6KB 3QP5A 4FE4A 1V55H 5DS9A 4PCQA 2OQRA 2ELJA 1M1EB 1PYVA 1WI9A 2P5VA 2CV0A 2EFOA 3I71A 4O5VA 4UVAA 4IZZA 4HF1A 2IRFG 4XLEA 2V6CA 2X1EA 3BG6A 1TWGJ 1SFKA 3ZCOA 5FLVA 2HVSA 4PUSA 3L9FA 2XHKA 1VFCA 3LOCA 3GTKJ 4LOCA 4U88A 1XB4A 3VYUB 3J7AO 2VC0A 3FX3A 4JBAA 4WK8F 1S7AA 4PJMA 1XGOA 2UV1A 4AC0A 4E6KG 2N8GA 3CUOA 2E35A 3BR6A 4A6DA 5LEJA 4DIQA 2CRGA 2Y69H 1JGSA 3HXLA 2QEXI 2DA4A 1OCCH 1X1DA 2BXYA 2W82A 5F08A 3DKYA 2LDUA 1HBXG 5JLXA 2KL4A 2PFBA 2FBHA 4PFPA 2VIXA 3QP6A 2F4OB 1TL8A 3ZN0A 1FYKA 1JJ8C 2NOGA 4XSXF 3MFKA 3CDLA 4XORA 1N25A 1FBQA 3M4OJ 3OIPA 4IHWA 2ZMEA 3H9JA 1T98A 3OL4A 2O3FA 3CCLI 3E5QA 4M3FA 5LHHA 2YX4A 2CQQA 1XC5A 2M8GX 4LK1F 2LD5A 2AS5F 1E3PA 2VPRA 5M3MJ 3FMSA 4HLYA 4BXFA 4II2A 2XF6A 2HOAA 2OU2A 2HDCA 2XB5A 3CQZJ 5HS8A 1BI1A 2E36A 1V4RA 3OS1A 3OOUA 1ON2A 2W1OA 1X2MA 4BL0B 1X3UA 3K69A 5KK1A 5DCFA 4FX0A 3ASNH 1R58A 3BPVA 3HRUA 1OLTA 5J40A 4CO8A 4PJ0C 3T5XA 4KIBA 1WHUA 3OYBA 4ZTJA 5IP7J 2RQPA 4ZZDA 2LSOA 4MIMA 2JA2A 4ENJA 1TQPA 4B43A 1F1ZA 2OZ6A 3QU6A 3L2QA 3HHGA 2Y0MA 4FT8A 4BQOA 1HSJA 5GPAA 4CCNA 3CP2A 3TL4X 4A69C 2XAFA 3L1PA 2O6GE 5L3GA 3OYGA 3TP0A 4ZJZA 3K70D 3MKWB 1W7PD 2KIFA 3ELKA 3S3MA 4II3A 1QBJA 3KCCA 2A6EF 2LFBA 4IRGA 2UXXA 3MZYA 5L3EA 4BJ5C 5J4YA 3LMMA 3UR3C 4DJAA 1MH3A 2QLZA 1HA8A 3VOEA 1R49A 2LYCA 2E1MB 4IHYA 1P4XA 3GZ5A 2BV6A 3WHCA 1CF7B 3H5AA 4HX8A 1O7FA 4LK0F 1TC3C 3NQOA 1FP2A 2M87A 1A31A 3VYTB 2K27A 5B5EC 5HLHA 1VQ5I 1DGRM 2BHZA 2LY9A 2XC7A 2K7LA 1IAWA 5IOYA 4RM3A 1MJAA 2JPBA 3ZP5A 2DDAA 2P5LC 1GT0C 2IGMA 1GXQA 3OYEA 1U6GA 3EQLF 5K7FA 1XCBA 1WJCA 2PMHA 1OISA 2A68F 4IQ4A 5EDNA 3CZ6A 1YW8A 3AG4H 1OCTC 1SMTA 3WHBA 4RGXA 3ZQQA 2GM4A 1BI3A 2FRHA 1PUEE 4HF2A 1D0ZA 4D9JA 2G9WA 1B9MA 3FXUA 2H8WA 3BTCA 3HKZN 3LA2A 3CCYA 2V1DA 2XIGA 4UNOA 4Y7NJ 3H9GA 3OOPA 3E3VA 3LA7A 3MKZA 2O61A 4KITB 2UUZA 5J47A 1H0MA 1U5TC 4AIJA 3A01B 3V8KA 5EYRA 1E0EA 1IRGA 4RB2C 1ITYA 2YR2A 1UCRA 2IPQX 4LG0A 3H0DA 5DD8A 4QTRA 4OMZA 1YX5A 1QGPA 2MA3A 4YIFA 2ECBA 1QZZA 3LSHA 1J7KA 1X19A 4XICA 1UB9A 3AG3H 2MG4A 1BR1A 1TQMA 1UELB 2ZJPF 4RAGA 5K7ZA 2ZFUA 5K5OA 3ML6A 5LRRA 4KICA 4BE1A 3WE2A 3QYBA 2MYSA 4MNUA 2E2IJ 1T95A 4KT5C 3CDIA 1Z05A 2LK2A 4ITVA 3G3ZA 5GAEJ 3JRAA 3DV8A 1S72I 2K85A 2G0EA 1WFXA 3G1LA 3I4PA 4UUTA 2V7FA 3ONQA 4LD5A 1Y8QB 3S1RJ 3H1CA 1ZELA 1ORKA 1XX5A 4UUVA 3W6JB 5HDGA 2DA3A 5M3FJ 3RCOA 4D5FA 5D5UB 4KNYA 3K0LA 2Z99A 2YUSA 3P9KA 1MMAA 5JR3A 3DCFA 1U9NA 1RKTA 3U9GA 3S14J 2ZFWA 2K86A 3D5LA 1OPCA 4OIPF 3T0YA 4QIWN 2DLLA 2M4GA 4Q4ZF 1S7EA 3Q0VA 3GFIA 1SD4A 1W5TA 3P9IA 2CH0A 3H36A 3OYJA 5DUKA 1YYVA 2H94A 3BPXA 3CP8A 4AYBN 2NAZA 4S04A 2DA6A 3S32A 3DTKA 2A69F 1MJ9A 1I5ZA 4QWQA 4YFNF 4G6DA 5BPIA 3H92A 1RRJA 5CVJA 3SZPA 1E3HA 4XKCA 4G12A 1UMQA 2DPDA 1Z1DA 3KETA 2OCCH 1T2KA 2DMUA 4WX9A 3SFZA 4G9YA 1XDSA 4NQWA 2GIZA 5D4RA 4Y4RA 2F48A 2OQGA 4EV0A 1IC8A 2W25A 3F8FA 2XF7A 3HL2A 1XGMA 5LBQA 2R0QC 3F6OA 1D3YA 3D0SA 1FP1D 3IV5A 2XPUA 3ZMDA 1VNDA 1TT5B 4I99C 5ICEA 2DBBA 2IA1A 2X6WA 1JUPA 2L9RA 1LVKA 3FK7A 2L7FP 1TWCJ 4LIUA 2HYFA 5ICGA 2WADA 1VTNC 3TBIA 4PGGA 1YTYA 1YOVB 2HTJA 4NDLA 1L3LA 4RLQA 4BS9A 3CMMA 1G8XA 1NH3A 3ABLH 3M8JA 3QPSA 1X3ZB 2AXTC 3WTSC 1J59A 1R4NB 3M07A 3DEWA 2FSWA 1OYYA 3RIRA 1B59A 2H27A 3OR1C 4ZDOA 1VQ9I 3JRBA 4M9SA 2P5KA 1X1BA 1USSA 3DFGA 2LBFA 1HW1A 1S5LC 3N97A 4UXNA 2EV0A 2L3DA 2IP2A 3E97A 2CW8A 1GDTA 1CF7A 1TLHB 3EYIA 5HLTA 3FIWA 1MGTA 3X2QH 1MBKA 2FQ3A 3OMYA 4JK1X 4PFOA 3D1NI 3SEZA 2QBYA 4L9NA 2ETHA 5LGNA 2R7RA 1FMWA 3ZQLA 3ZXSA 3U1DA 1WPKA 3IKVA 2LMDA 2Q2EB 4U87A 4N0BA 4XLFA 3T1BA 2DMTA 3JR9A 5CPRB 1SD5A 1Z3YA 2PMUA 2XVCA 3O8HA 3K1NA 1D5VA 5LHIA 2KMUA 2QWWA 4XRSA 1MW7A 2FE3A 5TGTA 3K7AJ 4E7JA 3F8NA 3J7ZI 4S0HB 4UB6C 3ZOBA 2BE5F 2R7UA 3DLAA 5E1WA 2QCOA 5HNFA 2K9LA 5D6EA 3CJTB 2QSGX 2VKEA 4DYQA 1VQ6I 5E1XA 1XMKA 1G6NA 2XUBA 4NC8A 2BHYA 2L7KA 3O2PE 1G3WA 3TQNA 5IPAA 1T39A 5FGMA 3CMYA 3CCJI 1TW2A 1F5TA 3L2VA 2J5OA 3FKIJ 1B4AA 1MBHA 2K9QA 1JUSA 2KZGA 2WAQN 3ABUA 2VXZA 3KP7A 3OYAA 3CC7I 3PM1A 3ZMSA 2OJED 2VXDA 1A36A 2F4IA 3ECOA 2IXSA 3J81Z 2HYJA 2BVMA 3E5UA 1D0YA 1H89C 4XL9A 2WB1N 2BYVE 4ENMA 4IHXA 2ZKZA 1GVDA 3CCSI 1JKQC 4L9JA 2FMYA 2HZTA 4OAZA 3LWFA 4X0GA 2R4GA 1I50J 3OYLA 1MSFC 3PUFA 1ZGAA 3H5RA 1UAAA 4ABZA 1O57A 3DF8A 2W4SA 5E3MA 2O8KA 2E5ZA 3BR1A 2HQAA 2R7XA 1IN4A 5CQEA 3BJ6A 3K70C 2A3SA 4F52A 4RDUA 3QWLA 4C2UA 1H88C 1YITI 5KNLA 2K9MA 1XSDA 1OR7A 3V7RA 4HX7A 1Y6IA 2JWTA 1N78A 3HSRA 2CJJA 4I0BA 1F36A 4EJUA 2L9SA 2X6YA 5EF6A 3JRFA 5FD6A 4ZTFA 1J2XA 3BP8A 4A12A 2ZC2A 2PX9A 2ZXIA 4F3QA 4BGDA 2NNYA 3CLOA 1YJWI 3SZTA 4MTEA 1FLIA 4A3KJ 2Y48A 3J80K 2DT7B 3BG5A 3FHZA 3NWTA 4UHTA 5DD4A 2F2EA 4RLFA 5DCMB 2A6TA 1JKOC 3RPQA 1WGXA 5IP6A 4X1EA 1IG7A 3CJRB 1W5SA 1NHAA 1EH6A 1DU6A 5FLXK 2OTJI 2X51A 1JI8A 2KRHA 2IA2A 4PK4A 2E1CA 4XN0A 3M1EA 4UUSB 1W36D 3B73A 3Q0UA 5FFXA 4B4CA 3QPHA 3TO7A 1WWXA 3OY9A 1KU9A 2RC4A 3SJMA 2H6BA 4XR6A 1OKRA 2ZXWH 3QOEA 4EEFG 2GOXB 1FYLA 1DDNA 1BW6A 1Y39A 1FY7A 2CSOA 3KZYA 2HXOA 2WV1A 1H9TA 1A04A 2FJ1A 1TZLA 2M4KA 2I5UA 5IT9Z 2HXIA 2WY8Q 4EM1A 1QVUA 2DQRA 1D1CA 2DFFA 4B44A 2HOTA 2M1BA 1I39A 1AA7A 2WBMA 3KIOA 5GP9A 1B72B 5DUIA 1Y1WJ 1N77A 3ZPLA 1VQLI 2DJNA 3VDXA 2GIVA 4OWRB 5JVGF 1GXPA 1T56A 2B63J 5GADJ 3PNYA 1HSTA 1YS7A 1W7PA 2LG4A 2MH9A 5LRSA 4Q47A 2AHQA 5AIQA 2DK8A 2M9HA 2PMZN 1XD7A 3N4MA 1WQ2A 2V9KA 4D1QA 2W84A 2JK3A 3JAMZ 5FKMA 4UVCA 3S1QJ 4CGZA 3F72A 2QM3A 1PP7U 3GCMA 3DLLF 2M8EA 3FKJA 3S15J 2M3AA 1EH7A 1SFEA 2KRFA 2DMPA 4HZFA 4BNCA 3TW6A 5HLGA 2NRAC 1FOKA 1W1WE 4IQJA 2VJJA 3Q9SA 1PDNC 1WH7A 1X4PA 3C2GA 3K6GA 2QQ9A 1R36A 2VQHA 3JSPA 2IS6A 2MW8A 2CW0F 3R0JA 1IV8A 5HNHA 4EJVA 1OYIA 3GVAA 3RJPA 3JTGA 2DT6A 2EIJH 3PSFA 1IZ1A 1BIAA 1RIOH 3H35A 4B3XA 1ZN2A 3MEXA 3JREA 4HRIA 3P5JA 3G2BA 2EK5A 3EUAA 2CUEA 2E1OA 5BS6A 2K4BA 4XKVA 3FXQA 5J1RA 3CCRI 2Q2EA 4B47A 4D7NA 3FMRA 4A3MJ 3WGIA 1NK2P 2Q1ZB 1YRNB 1FEXA 2XASA 1DU0A 1UG0A 2F4MB 3D5RC 1S6LA 1JKRC 3R0AA 3K1PA 4J00A 2HOEA 3T8TA 4HG2A 4WF2A 2Y0SN 5DYMA 1TWHJ 3L2WA 5C4JJ 2CS3A 4UV8A 4NHJA 1QU3A 5CLSA 4CYDA 4ETSA 1Q1VA 1T8IA 4FCYA 2OA4A 3ZGKA 1Y0NA 3CLQA 5B3SH 2P6TA 3HOUJ 1TW3A 1Z7UA 2VBXA 2UXNA 1OFCX 2EZKA 2BY0A 2ELHA 4U0WA 4BY7J 4V19K 3B02A 5HVQC 1XMAA 4V2FA 2HWVA 2LKSA 4A0ZA 3TDUC 1IN8A 4MEYF 1Z7LA 3CCUI 4Y13A 4UY8I 3K4JA 1W5CC 4A5NA 1FSHA 3C2BA 2E34A 4LFUA 3CUQC 2V1NA 3GFMA 4YIRX 4XM3A 3TOAA 1XDUA 3WE3A 1FZPB 4L0YB 5M5XJ 3BT9A 2K9SA 2ME6A 1QHHD 3DPUA 4N4NB 4QSHA 4U7DA 2NVUB 2XSDC 3RZDJ 2EFQA 1ODDA 5J8CA 3I56I 3BCBA 1ZR4A 4Y52J 5A2QK 3I5UA 4ZC3A 4JX6A 4XLAA 3HOYJ 3W2WA 1GLNA 1Z3XA 1J9IA 5JFRA 2DMQA 5EEGA 4OINF 3GO5A 1PJRA 2OD5A 3WU2C 4Y17A 2JMWA 1DPUA 2PN6A 2MLGA 1ZR2A 3NAUA 2PJRB 4RAFA 4EGYA 1TTYA 4NB5A 3SZGA 3LAPA 2HVQA 3QAHA 4PSWA 2FF4A 1HF0A 1IXRC 1FC3A 1MNDA 1WJ5A 2KJBA 1YS6A 3N05A 1KYWA 3ZRGA 3C1DA 2ME0A 4R1HA 1KA8A 2X48A 5FO5A 4BQAA 2IT0A 4U0VA 5DCMA 3TOBA 3S2HJ 5TISC 3GF2A 1RKWA 2DFHA 2FMLA 3A1YA 4M6XA 4M6YA 2VB6A 2VE8A 1SAUA 1C0WA 4I01A 1TBXA 4TV7A 2GXGA 4IF4A 2XF5A 2NYXA 5ILSA 3JCUC 5J8FA 4EGZA 3WGGA 4BJTA 3L00A 2EZLA 2P8TA 2O9LA 3KPHA 1FIAA 5D5VB 4XOPA 5ERIA 3R6SA 4KIFA 4M6VA 1IN5A 3QPLA 1QO0D 2R7VA 3BDDA 1BC7C 2QSHX 3LNQA 4YG2F 2DA5A 1IRFA 1P7JA 1VZ0A 1OJLA 1FSEA 5LHGA 4BDZA 1UZCA 1G59A 3ZMTA 2NS0A 2FQ4A 4G7ZF 5IYCJ 4IVNA 4N9HA 3VWBA 5GTHC 1FBUA 3AFHA 4YEJA 2VN2A 2R7QA 5K7HA 3I59A 2I8DA 1MNEA 1TNTA 3CUQA 3LSKA 3ZQCA 4L5EA 3R4KA 1JT6A 2BY2A 3KE2A 3HOSA 3S8PA 3G1OA 3PFIA 2R92J 4AIKA 1K78A 2WC2A 2CWEA 5EGOA 1KYZA 2O0YA 4HX4A 1R9TJ 1YIOA 2JA6J 2KLOA 3ABTA 3HDDA 3HZJA 1YX3A 2R5ZB 5CYVA 4B48A 2BZTA 1IRZA 2PLYA 2JA5J 2JVGA 2FBKA 3KEOA 3CESA 4HDVA 3W2AA 1S9HA 3G1MA 3ZMVA 2XB0X 3GEZA 4RAYA 5ILUA 1DGWY 2BW3A 1QA6A 3TKYA 5KVRA 3TEDA 4A2UA 3J7AY 2GZWA 4RMNA 3MKYB 3S16J 2AO9A 4HYEA 2CW7A 2DTRA 2L9VA 2KP6A 1BR2A 1UHWA 1YLFA 1WJAA 4G6TB 3H5NA 2TCTA 1RR7A 4A3DJ 3BR2A 4U7BA 2JZYA 3FBIB 4RB0A 4C30A 1A6QA 3QYEA 3OL3A 1MBGA 4MO7A 2TRTA 5H2FC 1SVOA 4GYGA 1OCRH 3KP2A 1SMYF 2BGCA 4Y33A 1D8JA 2R7WA 2VOOA 4A0YA 1B8IA 5KCMA 3SDGA 4ZYAA 1H8AC 4BUPA 1E17A 2VJ5A 4ESBA 4LMYA 1YRNA 4CZZA 1MDMA 2HR3A 2FUG2 4RM2A 3KEQA 1V3FA 1FOYA 4ZZLA 4M74A 2GOMA 1YJ9I 1MSEC 1WJFA 3RKWA 4EATA 2MC3A 2DT5A 3GFLA 3IC7A 3P7NA 3SXYA 4M3GA 4YRVA 4CCOA 3HG9A 1RC9A 4ZDPA 1HKQA 2VL8A 5HDKA 3PFYA 3PNVA 1MKMA 1MMSA 1EKEA 3AKZA 3RPUD 1JTYA 2DAOA 2JVHA 2F5VA 3RQ4A 1WKMA 2V6EA 2BOLA 2R5YA 3EUKL 3BCAA 1BJZA 2XSJC 3ZQIA 1PUFA 4IJAA 3RKXA 1ZG5A 3EPZA 3H3ZA 2E1NA 3PL8A 2JQ7A 3BZKA 5GPCA 5CJ9A 3MWMA 3S1NJ 4AWXB 3GX4X 3HB9A 4HPQA 2V26A 2DXIA 1SC7A 5E79C 4I76A 4OU0A 3F8CA 4E7HA 2P0WA 2E2JJ 2RKHA 1AKHB 2XGEA 2M2EA 4G7OF 4G6QA 4ENNA 1KQ8A 2XROA 5DV5A 4C2TA 5HS7A 4B3AA 3ERED 3ESWB 2VT2A 3K2AA 2M34A 2L7ZA 1LQ1A 4E7SA 3HOVJ 3WTVC 1K7AA 5F1RA 5E3LA 3RSNA 4UVBA 2LF7A 2E1MC 3KLNA 2M7BA 2P7VB 2XGXA 3OYMA 4P9UA 4F93B 1G4DA 3AL0B 2JJ7A 4I2OA 1APLC 5FROA 5JVTA 1KU3A 3BWGA 3WG9A 3FXOA 2VQGA 2JUCA 2LOOA 1ZG3A 4N9IA 2DOFA 2FOWA 5IY5H 2FNPA 2ZNYA 4EQQA 1ZRCA 4XSZF 3TDZC 3VSKA 1B9NA 3W2VA 4QLCU 1P9QC 2PG4A 2QQ8A 2VBWA 3FF5A 3VODA 2P7CB 1P4AA 2WY7Q 4HQMA 3KYCB 3U21A 3M1CA 2A5YB 3PIOF 1DP7P 4M71A 2YS9A 1E3OC 1POGA 2I10A 4A0XA 2F5CA 4OIOF 3OYCA 3GTOJ 2EFNA 2GQQA 4AM3A 1U0JA 2DA1A 4RGSA 2M7AA 2NS8A 3ZMZA 3RI4A 1U3EM 3M8EA 2JUGA 1ZGWA 2GBYA 1Y56A 2EA2A 1U8BA 3FMQA 5E3NA 4DYCA 4H0EA 4FHTA 3NEUA 1JKPC 3CCMI 3B6CA 1SVLA 1ERDA 2B9SA 1V5EA 4A3LJ 1O4XA 1SVMA 2DA7A 1HLVA 1OMIA 4WXDA 2DYSH 2MGQA 3HGGA 1YFHA 4HV5A 5FRMA 5EG0B 4ZYGA 3RYPA 2K5CA 4CZCA 3CCVI 2R7SA 2DOAA 1G3YA 4BXUA 3K4KA 1LVAA 3CCQI 4DYRA 4XLCA 1QNTA 1KQ0A 4Z2YA 4ASNA 1RETA 4CUGA 2L01A 4XK4A 1R5GA 2RV8A 2IVMA 5D8LB 4D0PA 2HOSA 1KU7A 3BTJA 4M3BA 3ABKH 5EEAA 5AIPA 3FWEA 3VEPA 3IUOA 3P9CA 2G7HA 3C18A 1J0RA 1T6SA 2K4JA 1V5GA 1YIJI 1OR7C 6PAXA 4A3FJ 4IEJA 4BEHB 1ZYRF 1BM9A 4XONA 1HDDC 2IEKA 1BR4A 4ON0A 5HLIA 1BOAA 3RTRA 5CVUA 4LLLA 3RDIA 1FX7A 2DQLA 3I4NJ 4MHGA 5ED4A 3KYLA 1S29A 3BQYA 1GV5A 2HU9A 2KFDA 1ZRFA 5DDGA 4HLXA 2NVYJ 2CUZA 2GA1A 2VQCA 4CHUA 3R60A 1Y1VJ 4F7ZA 1YQAA 3BTLA 2RNGA 2KISA 3GXOA 5L3CA 3I0TA 1RUOA 1FWZA 4XRSG 5B1AH 4DNCA 1Z9CA 4CICA 2Y30A 3HUGB 4HNUA 4BDYA 4D5CA 4GGGA 3M7GA 1LFUP 1MMDA 1MIJA 4Q48A 1LE8B 2RGVA 2ZO4A 3K2ZA 1Z6TA 3HGYA 2EFWA 3OWTA 4FX4A 4KUMA 2HS5A 5FJ8J 1BI0A 2ECCA 4B1RA 1W4MA 5E20A 5LD2C 3FM5A 5FD5A 3MKLA 1QZEA 2V9VA 4E4HA 3A01A 2CQXA 4KISA 3BG9A 1YG2A 2R7DA 3JW4A 3J81K 1LDJA 4C3HJ 3QOPA 1WH5A 3JRHA 2E7WA 3B6AA 4HA8A 3DKWA 2DODA 2FXAA 1PP8F 1I1GA 1BL0A 3C2HA 3BZCA 2QQBA 1YE9A 2LC2A 4P55A 1G3TA 4R8HA 2KRCA 3OS0A 1U9OA 3SYTA 4IL6C 1ZTRA 2R7ZJ 3CDHA 3CMEI 1TQIA 3FXMA 3L2UA 1EV7A 4XOTA 3FXRA 4XRFA 5D6FA 2XRLA 3BC8A 4KFCA 2ISYA 1ENHA 4L9TA 1LB2A 1XCVA 3NWSA 2KQRA 1XSXA 4OIQF 4M72A 1ZLKA 2JT1A 3V8JA 4XIDA 2JPCA 4HBLA 4M73A 3S3OA 1AKHA 3BR5A 4EVIA 3IKTA 3I3LA 2Z16A 1IO2A 4BH9A 4JX5A 4NUBA 2FNAA 1ZHFA 1KU2A 1V5FA 4HAMA 4XLPF 3V7CA 4CYCB 2ESNA 5B66C 3COAC 2UZKA 4DBQA 4IHSA 2EFPA 1HCRA 2H8RA 5LEKA 1P92A 2QF7A 2HVRA 4BXXJ 1R6RA 2VKVA 4PDKA 4EMSA 1TT0A 1BN5A 3M8FA 1P4WA 3Q9VA 1RI7A 2VBYA 1E2XA 2CFXA 2XPWA 3MZ8A 4GYIA 3LSJA 1ZREA 5KAIC 1MMGA 3DBLB 4ANJA 2H1KA 2MD0A 2OC6A 4PJNA 5ICFA 3A2KA 2WAFA 2J5PA 5H20A 3V42A 5KAFC 1VQ7I 3KZIC 2VE9A 3R61A 4YELA 1Z6RA 3J80Z 3S2DJ 4AIHA 2VASA 1WVRA 1BJAA 1JUMA 1VQPI 1BI2A 4KJZA 4YIIA 1R23A 3BG3A 3G6EI 2QYOA 4A3CJ 2X6XA 4A3BJ 3TO6A 2VKHA 2IS4A 2EA4A 4GDFA 2CQNA 1X2NA 4RGUA 5IOZA 2JSPA 3CJQB 4XKBA 2DMNA 2EB7A 4HW0A 1ZARA 2ZMEB 1R4MB 2ACJA 1BA5A 2ELKA 3KP5A 1WSUA 3KLOA 1O3RA 5J6XA 5ILVA 1Z67A 1AOYA 1WJBA 1Y8RB 3WODF 2DOEA 4HV6A 2QQAA 2AQFA 4DBRA 2WA0A 2X85A 3VB2A 2XRNA 2OZUA 2HQNA 2EILH 2CMPA 2IS2A 4XNFA 3BR3A 1F43A 5IT3A 4E7LA 1P2FA 3UNGC 1OCPA 1OCOH 3PSIA 3PO3J 3BZ6A 4P9FA 5LGTA 2IGKA 4DW6A 3HTUA 2V1XA 2L4MA 4XLHA 2W57A 3K4LA 2NNNA 5F0FA 3VYRB 3JAMK 3T8RA 3I64A 3S3NA 4M3DA 4JYKA 2MLKA 2LNBA 4CCJA 3HJEA 3U1KA 4E7ZA 5M5YJ 3F21A 3TW7A 2CQKA 1QZYA 5J1YA 4W1UA 1GV2A 4LIVA 1NTCA 1FTTA 4BU2A 1O3SA 2F5FA 4PJJA 4PJLA 3IRQA 3HEFA 4G8XA 4LLNA 4V2GA 2CUJA 3VPRA 2Y9YA 3G73A 3PIPF 4P5OA 2LH9A 4NC7A 4MQVA 3RKYA 4ZYEA 3QU3A 2CV1A 2CG4A 2MD5A 5BQTA 5FRNA 2XAUA 2WV0A 4IRIA 3IH3A 2HTSA 3GLLA 2Y75A 3IL2A 1UFMA 1LKXA 4I0AA 1STZA 5E3OA 2Z1DA 3WTTC 3PQJA 3CC4I 3EDPA 3S93A 3OYHA 5E8IA 2YSRA 1JT0A 3F8MA 3S2WA 1ONVA 2FOKA 3LA3A 3KZZA 3HUGA 4ESJA 3JSOA 2XDVA 3AG2H 3NRVA 4DQ2A 2F6CA 5F64A 4RGRA 4L0ZB 4JQFA 2KDOA 5IP9J 3O3KA 3WG7H 3RPUA 4BHCA 1LFPA 1VQ8I 1IUYA 3EUHA 4JX4A 2K3FA 4K2EA 1ZG1A 1HOMA 3BOQA 2Q8KA 2CYYA 1XG1A 2MFZA 1WCMJ 5CVVA 3HKZA 4GXOA 1S3JA 1S8NA 1LPQA 3IRRA 4OOIA 4GRIA 1DP3A 1ETVA 4L9VA 1ZAOA 3LSPA 3ZQ7A 2XKOA 3HPHA 5J3LA 2HQ5A 1QPIA 5D5XB 2DCEA 3QODA 2BEOA 1WRJA 1YJNI 1VQ4I 2OPTA 1MMNA 3HTSB 5TRDA 2KT0A 3PQKA 2RN7A 2HPIA 3G4SI 1TWFJ 1SFXA 2RQQA 3WU1B 1FT9A 2L5QA 3HYIA 4P96A 1IDZA 3I54A 2QVOA 4C3IJ 2YX7A 1GUUA 1S7OA 3HRSA 4FASD 2Y9ZA 3GW2A 3DTEA 3E6CC 2A5WA 1LFBA 3F0CA 2GXAA 4BBSJ 2DTZA 3DEEA 4RB3C 3HRMA 2DW4A 3JRCA 2EIMH 2O7OA 2HPMA 3F22A 2FX0A 3BG7A 9ANTA 5K5QA 3MVPA 5FKNA 3OYFA 3SDBA 3REOA 4CYCA 2F5DA 2XAHA 3U2RA 4RAZA 2X9DA 1IUFA 4XKWA 4FQGA 3GLXA 1K83J 5A2QZ 2L7MP 1MJBA 1NG7A 4BACA 1B6AA 3FHNA 2VOPA 2CUFA 4D7MA 1I3QJ 4RB1A 4EJTA 1N75A 1FMVA 3LQQA 4U0YA 2IA0A 3K4NA 3TP3A 4LLGF 4F92B 2QGUA 3MN2A 1K4TA 3H3VK 2LY2A 4AYBA 1Z21A 3OYIA 3HM5A 1TWAJ 2QKLB
chains in the Genus database with same CATH topology
1FJLA 2DMTA 2RAEA 4UUSA 3JR9A 3UKGA 3O8HA 4MFDA 4GFBA 4XRSA 4I76A 3K7AJ 5M5WJ 3PO2J 4A3EJ 2E2JJ 4S0HB 3ZOBA 5IYBJ 2XGEA 1AKHB 2M2EA 2QCOA 1JGGA 2VKEA 4DYQA 4B3AA 2NVXJ 1A5JA 2EZIA 3K2AA 5IPAA 4A3IJ 1BW5A 2M34A 2L7ZA 2DN0A 3HOVJ 3CMYA 3S17J 1ETQA 5C4XJ 5E3LA 3FKIJ 1FTZA 1B72A 1ETYA 1MBHA 2K9QA 1JUSA 2LR8A 2WAQN 1D5YA 4C2MJ 3PM1A 2JJ7A 2LKXA 1APLC 2HYJA 1WI3A 1H89C 5J1UA 2WB1N 4IHXA 1GVDA 4BKXA 2NS7A 1JKQC 1U78A 4DZPA 3GTMJ 1LE8A 1ETWA 1I50J 1MSFC 3LSRA 5IYDJ 1AHDP 4ABZA 3JRDA 1B8IB 2O8KA 5E3MA 4MFEA 3BR1A 4BBRJ 2YS9A 1JJ6C 1POGA 2I10A 3IH4A 1E3OC 4IHVA 3GTOJ 1IV6A 1JTXA 4RDUA 4A3JJ 2DA1A 3GTJJ 1H88C 2R93J 2NS8A 2JWTA 2CJJA 4J19A 1F36A 5EF6A 3JRFA 2VUMJ 1ZGWA 1ZQ3P 2GBYA 5EZGA 3A02A 3RZOJ 1U8BA 2E19A 2M0CA 4DYCA 5E3NA 5DTDA 2E2HJ 2R5YB 4A3KJ 1JKPC 3BG5A 3B6CA 5FKKA 3JRGA 1PUFB 2Y2ZA 3GTPJ 3JRIA 3ZQFA 4A3LJ 2FD5A 2LP0A 2P81A 1UHSA 1O4XA 3BQZA 2DA7A 1HLVA 5C3EJ 1X58A 1JKOC 5IP6A 1WGXA 2MGQA 3HGGA 4X1EA 1CQTA 5EG0B 1IG7A 1QRYA 1DU6A 1MH4A 1ETOA 2ID6A 4M3EA 4W97A 4DYRA 3GBGA 3HBLA 4UUSB 2LTPA 3QQAA 3Q0UA 1RETA 4B4CA 1MBJA 3FISA 4FE4A 5DS9A 3SJMA 2K9NA 4XK4A 4DZJA 4EEFG 1BW6A 2HOSA 2HXOA 2WV1A 3BTJA 4M3BA 5EEAA 2FJ1A 2KDZA 2HXIA 4A3FJ 4IEJA 1QVUA 1TWGJ 1VF9A 5FLVA 1HDDC 2IEKA 3A03A 3OSGA 1VFCA 2HOTA 3LOCA 3GTKJ 4LOCA 5GP9A 1ZKGA 1B72B 3I4NJ 1MBFA 1Y1WJ 4AC0A 2N8GA 1GV5A 3BQYA 2XGDA 2NVYJ 3BR6A 2DJNA 1Y1VJ 3BTLA 2CRGA 4JP0A 1T56A 2DA4A 2B63J 5F08A 4XRSG 3BTIA 1Z77A 5JLXA 2AHQA 2Y30A 4X6AJ 4D5CA 1LFUP 1JJ8C 1LE8B 2M9HA 2PMZN 2D5VA 2NOGA 3HGYA 3CDLA 5FJ8J 2JK3A 2ECCA 3M4OJ 4IHWA 5FKMA 3S1QJ 3RQIA 4C3JJ 4B1RA 1ETKA 2LLKA 4M3FA 2CQQA 1XC5A 2M8GX 2LD5A 3MKLA 3S15J 2VPRA 5M3MJ 2DMPA 3TW6A 3A01A 2CQXA 3BG9A 2HOAA 1WH7A 2XB5A 3CQZJ 4C3HJ 1WH5A 3JRHA 3B6AA 2NVQJ 1I6HJ 3OOUA 1BL0A 3HOWJ 1X2MA 2MW8A 4FISA 1U9OA 3ZQHA 1ZTRA 2R7ZJ 1QVTA 5FKOA 3I4MJ 4BY1J 5IP7J 3JREA 1NK3P 3HOZJ 2CUEA 2E1OA 2XRLA 4MIMA 5J1RA 1ENHA 4D7NA 4A3MJ 1NK2P 5F27A 2MSYA 1YRNB 1FEXA 5GPAA 3L1PA 1DU0A 4A69C 3NARA 1JKRC 3W6VA 3TP0A 4XIDA 1AKHA 2Y31A 3IH2A 3GTQJ 3BR5A 2Y0SN 1TWHJ 4JX5A 2LFBA 5C4JJ 1XS9A 4CYCB 5F04A 3M3YJ 1MH3A 2OF7A 1ZK8A 1Q1VA 2DA2A 4FCYA 5BNGA 1SFOJ 3GTGJ 1HCRA 2ZB9A 2H8RA 3HOUJ 2ID3A 2QF7A 4IHYA 1OFCX 3WHCA 4BXXJ 2EZKA 2VKVA 4BY7J 1TC3C 2JA8J 4V2FA 2XPWA 3LSJA 2LY9A 4MLOA 2R5ZA 5IOYA 2H1KA 3C2BA 1G2HA 1AU7A 2CU7A 5M5XJ 3BT9A 1GT0C 2K9SA 2ME6A 3HOXJ 1Z0XA 4QSHA 2XSDC 5K7FA 3RZDJ 3S2DJ 5F1JA 1JUMA 3RKQA 3O8GA 1ZR4A 5EDNA 4Y52J 3H0GJ 4JX6A 3BG3A 3HOYJ 1OCTC 4A3CJ 3WHBA 4A3BJ 2GM4A 1X2NA 2DMQA 5IOZA 2DMNA 3HKZN 3BTCA 2JMWA 2JA7J 3CCYA 1BA5A 4Y7NJ 2ELKA 2JN6A 1ZR2A 3GTLJ 3NAUA 1RESA 3A01B 5EYRA 1ITYA 1MBEA 5FLMJ 1HF0A 3BR3A 5F0CA 1F43A 4QTRA 2LVSA 1OCPA 2ECBA 2ME0A 2X48A 3PO3J 4XICA 3S2HJ 4DW6A 2MG4A 1RKWA 1MNMC 5K7ZA 2EZHA 2W48A 5F0FA 4M3DA 4JYKA 2E2IJ 2LK2A 2EZLA 2O9LA 3JRAA 5M5YJ 1FIAA 2G0EA 3G1LA 4UUTA 3TW7A 4M6VA 5J1YA 3QPLA 4W1UA 3E7LA 3S1RJ 3LNQA 1ORKA 1GV2A 1NTCA 2DA5A 5EZHA 1P7JA 2DA3A 5M3FJ 1FTTA 1OJLA 1SANA 4D5FA 3HEFA 2FQ4A 5IYCJ 4V2GA 1P7IA 3VPRA 2Y9YA 2YUSA 5K7HA 1U9NA 1RKTA 3DCFA 1K61A 3S14J 3ZQCA 4L5EA 4QIWN 4I6ZA 1JT6A 1S7EA 3Q0VA 4RBOA 3G1OA 3IH3A 1IGNA 2R92J 3LSGA 5EGOA 4AYBN 4FTHA 5E3OA 1W0TA 1R9TJ 2DA6A 4A93J 2JA6J 1T33A 3HDDA 2R5ZB 1JT0A 1IRZA 2JA5J 1VI0A 3ZQGA 3G1MA 2XB0X 3FK6A 4G12A 1UMQA 3Q0WA 5IP9J 5HODA 3Q3SA 1HDPA 2DMUA 3TEDA 4JX4A 3S16J 1HOMA 2K40A 2AO9A 1XG1A 1WCMJ 1IC8A 4HNVA 2R0QC 1ETVA 2EBIA 3LSPA 3IV5A 2EH3A 2XPUA 1VNDA 2TCTA 1RR7A 4A3DJ 2HDDA 5J3LA 1UG2A 2HQ5A 3BR2A 2NVTJ 1QPIA 1RPWA 2HI3A 2OPTA 1JUPA 1IJWC 2KT0A 2X6OA 2L9RA 1TWFJ 3FK7A 3OSFA 2L7FP 1TWCJ 4FE7A 1W0UA 1MBGA 4MO7A 2TRTA 2IAIA 1IDZA 4C3IJ 1GUUA 2COBA 4NDLA 2GLOA 2Y9ZA 2L0KA 1B8IA 2XGCA 3SDGA 5C44J 1H8AC 4AUXA 1LFBA 3F0CA 1YRNA 4BBSJ 2DTZA 2YU9J 4A3GJ 3QPSA 3BR0A 1MSEC 3JRCA 5F0HA 5JLWA 2O7OA 1IDYA 1ETXA 2FX0A 4M3GA 3DEWA 1A6IA 9ANTA 3MVPA 5FKNA 2IBDA 2VI6A 4CYCA 3JRBA 1JTYA 1IUFA 2X9DA 1K83J 2L7MP 2R5YA 5FKLA 3SFIA 2CUFA 4D7MA 1I3QJ 1BJZA 3ZQIA 1GDTA 1PUFA 1EF4A 2EQRA 3FIWA 2XPVA 3OIOA 1MBKA 3TP3A 3D1NI 1FIPA 3MN2A 5GPCA 5EG0A 3H3VK 3S1MJ 4XRMA 3ZQLA 5EGOB 1WPKA 3S1NJ 3HM5A 3HB9A 1TWAJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FJL A;  2DMT A;  2RAE A;  4UUS A;  3JR9 A;  3UKG A;  3O8H A;  4MFD A;  4GFB A;  4XRS A;  4I76 A;  3K7A J;  5M5W J;  3PO2 J;  4A3E J;  2E2J J;  4S0H B;  3ZOB A;  5IYB J;  2XGE A;  1AKH B;  2M2E A;  2QCO A;  1JGG A;  2VKE A;  4DYQ A;  4B3A A;  2NVX J;  1A5J A;  2EZI A;  3K2A A;  5IPA A;  4A3I J;  1BW5 A;  2M34 A;  2L7Z A;  2DN0 A;  3HOV J;  3CMY A;  3S17 J;  1ETQ A;  5C4X J;  5E3L A;  3FKI J;  1FTZ A;  1B72 A;  1ETY A;  1MBH A;  2K9Q A;  1JUS A;  2LR8 A;  2WAQ N;  1D5Y A;  4C2M J;  3PM1 A;  2JJ7 A;  2LKX A;  1APL C;  2HYJ A;  1WI3 A;  1H89 C;  5J1U A;  2WB1 N;  4IHX A;  1GVD A;  4BKX A;  2NS7 A;  1JKQ C;  1U78 A;  4DZP A;  3GTM J;  1LE8 A;  1ETW A;  1I50 J;  1MSF C;  3LSR A;  5IYD J;  1AHD P;  4ABZ A;  3JRD A;  1B8I B;  2O8K A;  5E3M A;  4MFE A;  3BR1 A;  4BBR J;  2YS9 A;  1JJ6 C;  1POG A;  2I10 A;  3IH4 A;  1E3O C;  4IHV A;  3GTO J;  1IV6 A;  1JTX A;  4RDU A;  4A3J J;  2DA1 A;  3GTJ J;  1H88 C;  2R93 J;  2NS8 A;  2JWT A;  2CJJ A;  4J19 A;  1F36 A;  5EF6 A;  3JRF A;  2VUM J;  1ZGW A;  1ZQ3 P;  2GBY A;  5EZG A;  3A02 A;  3RZO J;  1U8B A;  2E19 A;  2M0C A;  4DYC A;  5E3N A;  5DTD A;  2E2H J;  2R5Y B;  4A3K J;  1JKP C;  3BG5 A;  3B6C A;  5FKK A;  3JRG A;  1PUF B;  2Y2Z A;  3GTP J;  3JRI A;  3ZQF A;  4A3L J;  2FD5 A;  2LP0 A;  2P81 A;  1UHS A;  1O4X A;  3BQZ A;  2DA7 A;  1HLV A;  5C3E J;  1X58 A;  1JKO C;  5IP6 A;  1WGX A;  2MGQ A;  3HGG A;  4X1E A;  1CQT A;  5EG0 B;  1IG7 A;  1QRY A;  1DU6 A;  1MH4 A;  1ETO A;  2ID6 A;  4M3E A;  4W97 A;  4DYR A;  3GBG A;  3HBL A;  4UUS B;  2LTP A;  3QQA A;  3Q0U A;  1RET A;  4B4C A;  1MBJ A;  3FIS A;  4FE4 A;  5DS9 A;  3SJM A;  2K9N A;  4XK4 A;  4DZJ A;  4EEF G;  1BW6 A;  2HOS A;  2HXO A;  2WV1 A;  3BTJ A;  4M3B A;  5EEA A;  2FJ1 A;  2KDZ A;  2HXI A;  4A3F J;  4IEJ A;  1QVU A;  1TWG J;  1VF9 A;  5FLV A;  1HDD C;  2IEK A;  3A03 A;  3OSG A;  1VFC A;  2HOT A;  3LOC A;  3GTK J;  4LOC A;  5GP9 A;  1ZKG A;  1B72 B;  3I4N J;  1MBF A;  1Y1W J;  4AC0 A;  2N8G A;  1GV5 A;  3BQY A;  2XGD A;  2NVY J;  3BR6 A;  2DJN A;  1Y1V J;  3BTL A;  2CRG A;  4JP0 A;  1T56 A;  2DA4 A;  2B63 J;  5F08 A;  4XRS G;  3BTI A;  1Z77 A;  5JLX A;  2AHQ A;  2Y30 A;  4X6A J;  4D5C A;  1LFU P;  1JJ8 C;  1LE8 B;  2M9H A;  2PMZ N;  2D5V A;  2NOG A;  3HGY A;  3CDL A;  5FJ8 J;  2JK3 A;  2ECC A;  3M4O J;  4IHW A;  5FKM A;  3S1Q J;  3RQI A;  4C3J J;  4B1R A;  1ETK A;  2LLK A;  4M3F A;  2CQQ A;  1XC5 A;  2M8G X;  2LD5 A;  3MKL A;  3S15 J;  2VPR A;  5M3M J;  2DMP A;  3TW6 A;  3A01 A;  2CQX A;  3BG9 A;  2HOA A;  1WH7 A;  2XB5 A;  3CQZ J;  4C3H J;  1WH5 A;  3JRH A;  3B6A A;  2NVQ J;  1I6H J;  3OOU A;  1BL0 A;  3HOW J;  1X2M A;  2MW8 A;  4FIS A;  1U9O A;  3ZQH A;  1ZTR A;  2R7Z J;  1QVT A;  5FKO A;  3I4M J;  4BY1 J;  5IP7 J;  3JRE A;  1NK3 P;  3HOZ J;  2CUE A;  2E1O A;  2XRL A;  4MIM A;  5J1R A;  1ENH A;  4D7N A;  4A3M J;  1NK2 P;  5F27 A;  2MSY A;  1YRN B;  1FEX A;  5GPA A;  3L1P A;  1DU0 A;  4A69 C;  3NAR A;  1JKR C;  3W6V A;  3TP0 A;  4XID A;  1AKH A;  2Y31 A;  3IH2 A;  3GTQ J;  3BR5 A;  2Y0S N;  1TWH J;  4JX5 A;  2LFB A;  5C4J J;  1XS9 A;  4CYC B;  5F04 A;  3M3Y J;  1MH3 A;  2OF7 A;  1ZK8 A;  1Q1V A;  2DA2 A;  4FCY A;  5BNG A;  1SFO J;  3GTG J;  1HCR A;  2ZB9 A;  2H8R A;  3HOU J;  2ID3 A;  2QF7 A;  4IHY A;  1OFC X;  3WHC A;  4BXX J;  2EZK A;  2VKV A;  4BY7 J;  1TC3 C;  2JA8 J;  4V2F A;  2XPW A;  3LSJ A;  2LY9 A;  4MLO A;  2R5Z A;  5IOY A;  2H1K A;  3C2B A;  1G2H A;  1AU7 A;  2CU7 A;  5M5X J;  3BT9 A;  1GT0 C;  2K9S A;  2ME6 A;  3HOX J;  1Z0X A;  4QSH A;  2XSD C;  5K7F A;  3RZD J;  3S2D J;  5F1J A;  1JUM A;  3RKQ A;  3O8G A;  1ZR4 A;  5EDN A;  4Y52 J;  3H0G J;  4JX6 A;  3BG3 A;  3HOY J;  1OCT C;  4A3C J;  3WHB A;  4A3B J;  2GM4 A;  1X2N A;  2DMQ A;  5IOZ A;  2DMN A;  3HKZ N;  3BTC A;  2JMW A;  2JA7 J;  3CCY A;  1BA5 A;  4Y7N J;  2ELK A;  2JN6 A;  1ZR2 A;  3GTL J;  3NAU A;  1RES A;  3A01 B;  5EYR A;  1ITY A;  1MBE A;  5FLM J;  1HF0 A;  3BR3 A;  5F0C A;  1F43 A;  4QTR A;  2LVS A;  1OCP A;  2ECB A;  2ME0 A;  2X48 A;  3PO3 J;  4XIC A;  3S2H J;  4DW6 A;  2MG4 A;  1RKW A;  1MNM C;  5K7Z A;  2EZH A;  2W48 A;  5F0F A;  4M3D A;  4JYK A;  2E2I J;  2LK2 A;  2EZL A;  2O9L A;  3JRA A;  5M5Y J;  1FIA A;  2G0E A;  3G1L A;  4UUT A;  3TW7 A;  4M6V A;  5J1Y A;  3QPL A;  4W1U A;  3E7L A;  3S1R J;  3LNQ A;  1ORK A;  1GV2 A;  1NTC A;  2DA5 A;  5EZH A;  1P7J A;  2DA3 A;  5M3F J;  1FTT A;  1OJL A;  1SAN A;  4D5F A;  3HEF A;  2FQ4 A;  5IYC J;  4V2G A;  1P7I A;  3VPR A;  2Y9Y A;  2YUS A;  5K7H A;  1U9N A;  1RKT A;  3DCF A;  1K61 A;  3S14 J;  3ZQC A;  4L5E A;  4QIW N;  4I6Z A;  1JT6 A;  1S7E A;  3Q0V A;  4RBO A;  3G1O A;  3IH3 A;  1IGN A;  2R92 J;  3LSG A;  5EGO A;  4AYB N;  4FTH A;  5E3O A;  1W0T A;  1R9T J;  2DA6 A;  4A93 J;  2JA6 J;  1T33 A;  3HDD A;  2R5Z B;  1JT0 A;  1IRZ A;  2JA5 J;  1VI0 A;  3ZQG A;  3G1M A;  2XB0 X;  3FK6 A;  4G12 A;  1UMQ A;  3Q0W A;  5IP9 J;  5HOD A;  3Q3S A;  1HDP A;  2DMU A;  3TED A;  4JX4 A;  3S16 J;  1HOM A;  2K40 A;  2AO9 A;  1XG1 A;  1WCM J;  1IC8 A;  4HNV A;  2R0Q C;  1ETV A;  2EBI A;  3LSP A;  3IV5 A;  2EH3 A;  2XPU A;  1VND A;  2TCT A;  1RR7 A;  4A3D J;  2HDD A;  5J3L A;  1UG2 A;  2HQ5 A;  3BR2 A;  2NVT J;  1QPI A;  1RPW A;  2HI3 A;  2OPT A;  1JUP A;  1IJW C;  2KT0 A;  2X6O A;  2L9R A;  1TWF J;  3FK7 A;  3OSF A;  2L7F P;  1TWC J;  4FE7 A;  1W0U A;  1MBG A;  4MO7 A;  2TRT A;  2IAI A;  1IDZ A;  4C3I J;  1GUU A;  2COB A;  4NDL A;  2GLO A;  2Y9Z A;  2L0K A;  1B8I A;  2XGC A;  3SDG A;  5C44 J;  1H8A C;  4AUX A;  1LFB A;  3F0C A;  1YRN A;  4BBS J;  2DTZ A;  2YU9 J;  4A3G J;  3QPS A;  3BR0 A;  1MSE C;  3JRC A;  5F0H A;  5JLW A;  2O7O A;  1IDY A;  1ETX A;  2FX0 A;  4M3G A;  3DEW A;  1A6I A;  9ANT A;  3MVP A;  5FKN A;  2IBD A;  2VI6 A;  4CYC A;  3JRB A;  1JTY A;  1IUF A;  2X9D A;  1K83 J;  2L7M P;  2R5Y A;  5FKL A;  3SFI A;  2CUF A;  4D7M A;  1I3Q J;  1BJZ A;  3ZQI A;  1GDT A;  1PUF A;  1EF4 A;  2EQR A;  3FIW A;  2XPV A;  3OIO A;  1MBK A;  3TP3 A;  3D1N I;  1FIP A;  3MN2 A;  5GPC A;  5EG0 A;  3H3V K;  3S1M J;  4XRM A;  3ZQL A;  5EGO B;  1WPK A;  3S1N J;  3HM5 A;  3HB9 A;  1TWA J; 
#chains in the Genus database with same CATH topology
 2RAE A;  4UUS A;  3OYN A;  3FBN B;  4PSX A;  2DDB A;  2IJL A;  4MFD A;  4UV9 A;  3UKG A;  5M5W J;  3CD6 I;  4WCG A;  2ZNZ A;  4S05 A;  2EPF A;  2DK5 A;  3ERM A;  3FZV A;  4O6J A;  1HW2 A;  4IX7 A;  3W3C A;  4IHT A;  1A5J A;  2OTL I;  4A3I J;  2VON A;  2DN0 A;  1XN7 A;  1U5T B;  1F9N A;  3FXJ A;  1GHC A;  2DO7 A;  3E5X A;  1I6X A;  3DP7 A;  4NQW B;  3KEY A;  2HYG D;  2COM A;  2Z5U A;  1B72 A;  3VYS B;  2HEO A;  1ETY A;  2LR8 A;  2M0M A;  1D5Y A;  3CCE I;  1T38 A;  2MH2 A;  2LKX A;  3IAM 2;  3WTX C;  2RRE A;  2IGN A;  3BLY A;  5HS9 A;  1LDK B;  2QUF A;  1LUJ B;  1QQI A;  1QHG A;  2VPL A;  3CO6 C;  3IAS 2;  2VBZ A;  4CDG A;  4BE2 A;  1IN6 A;  1U8R A;  4CCL A;  4BYY A;  3F6V A;  4KDP A;  3GTM J;  3LSM A;  5EEH A;  5K1Y A;  2ZBK A;  2QZ8 A;  3LSR A;  5IYD J;  1TNS A;  1AHD P;  2EJR A;  3A0H C;  3HPG A;  4LG3 A;  3KX2 A;  3I55 I;  3E6M A;  4HF0 A;  1UST A;  1R00 A;  2B0L A;  4BBR J;  3IH4 A;  4IHV A;  3IP4 B;  4HDU A;  2XV4 S;  1D0X A;  1L0O C;  2H09 A;  2H6C A;  1ZLJ A;  3IHU A;  4F55 A;  4A3J J;  2R7F A;  4IO9 F;  3GTJ J;  3K4B A;  2MC4 A;  1YW7 A;  2V79 A;  3LAJ A;  2ADU A;  2ZXJ A;  2IGO A;  2OV7 A;  5TJJ A;  2VUM J;  3AAF A;  4C9Y A;  2ZJ2 A;  4NBQ A;  3A02 A;  4IOA F;  3RZO J;  2XAJ A;  3C3W A;  2LBF B;  2D1V A;  2ZCW A;  2E19 A;  1OQY A;  1R5H A;  2ZSI B;  2OAZ A;  5DTD A;  4HST A;  2WAE A;  1XPX A;  2DU9 A;  2R3S A;  5L3B A;  4HQE A;  3K4C A;  5AON A;  4EM2 A;  4LB5 A;  4A5M A;  4KMU X;  5FKK A;  1I27 A;  3GTP J;  2D2W A;  3F3X A;  2LRE A;  3ZQF A;  4IRH A;  2LP0 A;  1UHS A;  3MAJ A;  4EM0 B;  4I98 B;  1K4S A;  4DGW B;  2HKO A;  1X58 A;  3BJO A;  2QBY B;  4LJZ F;  3OR2 C;  3WGH A;  1QRY A;  3BRO A;  4RA2 A;  3ZMU A;  1OYW A;  1MH4 A;  1ETO A;  2HFH A;  2DI3 A;  1KZH A;  4KYW A;  3O6B B;  4M3E A;  1W36 C;  3GBG A;  3HBL A;  5CKT A;  1YI2 I;  2L02 A;  3OYD A;  1SD7 A;  2LTP A;  3QQA A;  1X1P A;  1MBJ A;  3FIS A;  1HKS A;  1X4O A;  2AXL A;  3MD2 A;  1PVE A;  4WXC A;  4OIR F;  2K9N A;  4DZJ A;  5L3F A;  2TDX A;  4JOM A;  3OIQ A;  3F23 A;  1ACI A;  2DYR H;  5BMZ A;  2KJC A;  1UHM A;  3OS2 A;  5E18 F;  5FFZ A;  2KDZ A;  2LF8 A;  3LFK A;  4MEX F;  2W85 A;  2HZD A;  3HIF A;  1VF9 A;  1R1T A;  1D1A A;  2IW5 A;  3A03 A;  3OSG A;  1YHQ I;  5GAH J;  2PBI A;  1UJ8 A;  2M5W A;  2WAQ A;  3H3U A;  1ZKG A;  3E6D A;  2VT3 A;  1MBF A;  4BQQ A;  4UB8 C;  3FXK A;  3J7Y J;  3ASO H;  2KZV A;  3WTZ A;  2XGD A;  3V7S A;  2WB1 A;  3PUB A;  4YFK F;  4XMY A;  3Q5F A;  3ROU A;  1YO5 C;  4JP0 A;  2HQR A;  3L7W A;  4R79 A;  2QEN A;  3BTI A;  4Q5S F;  1Z77 A;  2RVC A;  2RNJ A;  3TGN A;  2R7T A;  3IWZ A;  4X6A J;  4E7I A;  2X1C A;  4KA4 A;  2O8X A;  2BXZ A;  3CF5 F;  2HKX A;  3WTY C;  2D5V A;  3RYR A;  2XAQ A;  2KKO A;  1R7J A;  1HQC A;  4G94 A;  3RQI A;  1KON A;  4C3J J;  1ETK A;  2FEZ A;  2QKM B;  4NNJ A;  1FNN A;  2LLK A;  2PJR A;  2GA2 A;  2MBF A;  4ESF A;  4IPA A;  3SEQ A;  4BHP A;  4EJO A;  1FYM A;  4G7H F;  1O7L A;  2NVQ J;  1I6H J;  1P6R A;  3E6B A;  2DFE A;  3HOW J;  4FIS A;  4CA0 A;  3K9T A;  3ZQH A;  1KQ9 A;  1QVT A;  2EIK H;  3JTH A;  4ZDL A;  1SEU A;  3E1S A;  1DQU A;  5FKO A;  3I4M J;  4BY1 J;  3IWF A;  3KP4 A;  3ISP A;  2XAG A;  1LEB A;  1NK3 P;  3HOZ J;  4AVZ A;  2KHM A;  2WTE A;  2JRM A;  5F27 A;  2MSY A;  3I9V 2;  3CMA I;  4KN4 X;  3NAR A;  5JHF A;  2L2O A;  4ZH4 F;  3W6V A;  2A07 F;  4LB6 B;  3KP3 A;  3HSF A;  2Y31 A;  3IH2 A;  3GTQ J;  5JI6 A;  1HC8 A;  4HSR A;  3EYY A;  5D5W B;  4I09 A;  1XS9 A;  1IXS B;  5F04 A;  3M3Y J;  5B1B H;  1J75 A;  3EET A;  3C7J A;  1ZK8 A;  1U5T A;  1BBY A;  2OF7 A;  1X1A A;  2DA2 A;  4BAY A;  4ZYD A;  5LLQ A;  2F5E A;  5BNG A;  1SFO J;  3PJR A;  3GTG J;  2ZB9 A;  2EV5 A;  2ID3 A;  5HDN A;  2KIQ A;  1U2W A;  3PNT A;  2JA8 J;  2HNH A;  1WZ2 A;  1A35 A;  2VQL A;  1VQM I;  2X4H A;  3MZH A;  4MLO A;  2M45 A;  2R5Z A;  2W7N A;  5LFA A;  1G2H A;  4IXA A;  4QPO A;  1VQK I;  1AU7 A;  3AG1 H;  2CU7 A;  1H9G A;  2ZSH B;  3L2C A;  3HOX J;  5D8K B;  1Z0X A;  3FDY A;  1HXD A;  3DPT A;  1I3A A;  5F1J A;  3HHH A;  2Z9O A;  1LDD A;  3RKQ A;  1FOW A;  2DFI A;  1W7P B;  3O8G A;  4I7H A;  2PEX A;  3H0G J;  2PMZ A;  4H4K C;  5LGU A;  1XGN A;  2R7O A;  1O3T A;  2VLA A;  2OBP A;  3VSL A;  1JHF A;  3OV8 A;  1IF1 A;  2JA7 J;  4IOC F;  2KIU A;  2GXB A;  5H6R A;  1REP C;  3DXJ F;  1D1B A;  2JN6 A;  2ZJR F;  3GTL J;  4N4O B;  2JSC A;  1RZ4 A;  1RES A;  1WJE A;  2ZXH A;  1K6O A;  5DM6 F;  2PI0 A;  1B1B A;  1DUX C;  1MBE A;  5FLM J;  4ENK A;  2HDW A;  3DPL C;  5F0C A;  3GYH X;  2LVS A;  2GWR A;  3AL0 C;  3F8B A;  2EIN H;  4FET A;  2P4W A;  1MNM C;  2EV6 A;  4EJW A;  4M9X A;  1T08 B;  2EZH A;  2W48 A;  2X1D A;  5DM7 F;  5BOX A;  3GUD A;  3FXL A;  3KYD B;  1XSV A;  4AVP A;  2W24 A;  4L5I A;  2Y0S A;  2BBY A;  3DBR B;  1ZGJ A;  1R1V A;  2E7X A;  2V9P A;  3E7L A;  1DPR A;  4XN3 A;  5EZH A;  4CCK A;  1SAN A;  3GZ6 A;  1NG6 A;  1T0F C;  3ABM H;  4ZYH A;  1P7I A;  4HOB A;  5E1Z B;  5E8G A;  5E17 F;  1K61 A;  4IKF A;  4BJ6 C;  3LFU A;  1SAX A;  4I6Z A;  4RBO A;  2QSF X;  1KGS A;  1HKT A;  1ZH5 A;  3K1M A;  4OAY A;  1IGN A;  2CGP A;  3A4C A;  4A6E A;  2D1H A;  3LSG A;  4FTH A;  1XTA A;  1W0T A;  2UWM A;  2BVL A;  2VJI A;  3GFJ A;  2V1U A;  4A93 J;  5BPD A;  1MD0 A;  1T33 A;  3GME A;  1R71 A;  1WJD A;  1JHH A;  2CFO A;  3LL7 A;  3ZR8 X;  1GVJ A;  1IXC A;  5CVI A;  2ZJQ F;  1VI0 A;  3ZQG A;  1EA3 A;  3SHF A;  1BOB A;  3FK6 A;  4F91 B;  1SD6 A;  2MAB A;  3Q0W A;  3F9K A;  2K02 A;  5HOD A;  3Q3S A;  1HDP A;  2CQ7 A;  1HW5 A;  2A6H F;  1RR8 C;  2Z3Y A;  3TO9 A;  2E60 A;  2K40 A;  3GZN B;  3HRT A;  1EH8 A;  2RDP A;  3HOT A;  5ICC A;  1VQO I;  4HNV A;  2EWN A;  2VJ4 A;  2Z33 A;  4CH7 A;  2EBI A;  1RNL A;  2VC1 A;  2EH3 A;  2ICW G;  2PJP A;  2HDD A;  2LKP A;  1UG2 A;  2NVT J;  3ULQ B;  1RPW A;  1AWC A;  1RUN A;  2HI3 A;  4WWC A;  2AQE A;  1MZB A;  2KIM A;  2L54 A;  3MQ0 A;  4CXF A;  3VFZ A;  2W00 A;  5CQG A;  1IJW C;  2X6O A;  3WTU C;  1K6Y A;  3WTW C;  3OSF A;  2JTV A;  3DU5 A;  4FE7 A;  3SQN A;  1W0U A;  2E71 A;  4HEA 2;  4YFX F;  5K5R A;  2IAI A;  2C6Y A;  1I1S A;  4E70 A;  3CC2 I;  2IS1 A;  2COB A;  2GLO A;  2L0K A;  2VOD A;  2XGC A;  1QPM A;  2M30 A;  5C44 J;  4AUX A;  1OCZ H;  3HSE A;  5GTI C;  4A3G J;  5GAG J;  3CO7 C;  1EJ9 A;  2CV2 A;  2YU9 J;  5IT9 K;  3BR0 A;  3OYK A;  5HOO A;  2OCE A;  5FLX Z;  5F0H A;  5JLW A;  1T0F A;  1IDY A;  3LSI A;  4L18 B;  1R1U A;  1ETX A;  4KN7 X;  2H1L A;  2D45 A;  1A6I A;  1TP4 A;  3FM3 A;  2XKP A;  2B7E A;  2IBD A;  2OUM A;  2VI6 A;  4RS8 A;  2NXN B;  2DPU A;  3EUH C;  2YU3 A;  3M9A A;  5J4V A;  4E7K A;  2STW A;  3CTA A;  4BE0 A;  2DJI A;  2O03 A;  4GO1 A;  5FKL A;  3SFI A;  3QPT A;  4XBF A;  4M9Z A;  4Z6Y A;  3V4G A;  3DTI A;  2HGC A;  1EF4 A;  2FBI A;  4XQF A;  3K10 A;  3WU0 A;  5DEQ A;  3MMY B;  5D4S A;  2EQR A;  4WXH A;  1ZRD A;  2XPV A;  2FA5 A;  3I59 B;  3OIO A;  2A05 A;  3CUQ B;  1FIP A;  5EG0 A;  1Y0U A;  3CJN A;  3S1M J;  1LJ9 A;  4CSW A;  4XRM A;  1K78 B;  2FU4 A;  3DWL E;  5EGO B;  3DBH B;  4KIG A;  4PGH A;  1FJL A;  2WWY A;  2O5R A;  4GFB A;  3QYF A;  2Q0O A;  4DOZ A;  4BHB A;  3PO2 J;  1YW9 A;  4A3E J;  2BY1 A;  1IN7 A;  4MQ9 F;  5IYB J;  3HC7 A;  1JXS A;  3I53 A;  3K4M A;  3KP6 A;  1JGG A;  3A0B C;  1K79 A;  2NVX J;  3LST A;  4GCV A;  4BEH A;  2EZI A;  2BW3 B;  1X3W B;  2P6S A;  1BW5 A;  3QRF F;  4AID A;  1X1C A;  3V8L A;  2K3P A;  1BC8 C;  3S17 J;  2BY3 A;  1ON1 A;  1XMX A;  1ETQ A;  5C4X J;  2VKD A;  1FTZ A;  1V54 H;  3KFW X;  2X0L A;  4MGR A;  4XLN F;  4BQN A;  4C2M J;  4OMY A;  2G7U A;  3BY6 A;  5EJC A;  1XGS A;  1R5I D;  1WI3 A;  5J1U A;  1Q1H A;  3DU6 A;  1FPQ A;  2V4J C;  5JHU A;  3MCZ A;  2KPM A;  3DKX A;  3L2R A;  3BJA A;  4Y15 A;  4AU7 A;  3H9Q A;  4BKX A;  2NS7 A;  1U78 A;  1F4K A;  3E0J B;  4Y3O A;  4KT6 A;  4DZP A;  1G3S A;  1D8K A;  1LE8 A;  5KHD A;  1ETW A;  4MTD A;  3DQV C;  4AD9 A;  2GAU A;  3GWZ A;  3LQR A;  3JRD A;  1B8I B;  4MFE A;  1O3Q A;  3DEU A;  1SFU A;  4L5J A;  3ZN1 A;  1J09 A;  1MDM B;  1JJ6 C;  1CGP A;  3ECH A;  1VQN I;  4P1W A;  4O3M A;  5L3D A;  3D5S C;  4HNT A;  1IV6 A;  1JTX A;  2CO5 A;  2STT A;  2R93 J;  4I02 A;  5H6Q A;  4NC6 A;  2A61 A;  4J01 A;  2LRD A;  1FOX A;  4J19 A;  2L4A A;  1LNW A;  2L9N A;  4LGW A;  3G71 I;  1ZQ3 P;  2ZME C;  2E5N A;  4KMF A;  2QA4 I;  5EZG A;  3L09 A;  2M0C A;  1IW7 F;  1LEA A;  1BIB A;  1J5Y A;  2LY1 A;  2Z2S B;  2E2H J;  2R5Y B;  5F6F A;  4LIT A;  5FB2 A;  4LG0 B;  3JRG A;  1PUF B;  2Y2Z A;  3JRI A;  1FBS A;  2FD5 A;  2P81 A;  4B8X A;  3I58 A;  3BQZ A;  3CF2 A;  2JRT A;  5C3E J;  1CQT A;  1JE8 A;  1IRX A;  4PZJ A;  3TMO A;  1R22 A;  2ISZ A;  2ESH A;  2YPR A;  1ULY A;  2NOJ B;  2ID6 A;  4W97 A;  4CCM A;  5CVR A;  1Z91 A;  4QPQ A;  4B09 A;  2PQ8 A;  3W6K B;  3QP5 A;  4FE4 A;  1V55 H;  5DS9 A;  4PCQ A;  2OQR A;  2ELJ A;  1M1E B;  1PYV A;  1WI9 A;  2P5V A;  2CV0 A;  2EFO A;  3I71 A;  4O5V A;  4UVA A;  4IZZ A;  4HF1 A;  2IRF G;  4XLE A;  2V6C A;  2X1E A;  3BG6 A;  1TWG J;  1SFK A;  3ZCO A;  5FLV A;  2HVS A;  4PUS A;  3L9F A;  2XHK A;  1VFC A;  3LOC A;  3GTK J;  4LOC A;  4U88 A;  1XB4 A;  3VYU B;  3J7A O;  2VC0 A;  3FX3 A;  4JBA A;  4WK8 F;  1S7A A;  4PJM A;  1XGO A;  2UV1 A;  4AC0 A;  4E6K G;  2N8G A;  3CUO A;  2E35 A;  3BR6 A;  4A6D A;  5LEJ A;  4DIQ A;  2CRG A;  2Y69 H;  1JGS A;  3HXL A;  2QEX I;  2DA4 A;  1OCC H;  1X1D A;  2BXY A;  2W82 A;  5F08 A;  3DKY A;  2LDU A;  1HBX G;  5JLX A;  2KL4 A;  2PFB A;  2FBH A;  4PFP A;  2VIX A;  3QP6 A;  2F4O B;  1TL8 A;  3ZN0 A;  1FYK A;  1JJ8 C;  2NOG A;  4XSX F;  3MFK A;  3CDL A;  4XOR A;  1N25 A;  1FBQ A;  3M4O J;  3OIP A;  4IHW A;  2ZME A;  3H9J A;  1T98 A;  3OL4 A;  2O3F A;  3CCL I;  3E5Q A;  4M3F A;  5LHH A;  2YX4 A;  2CQQ A;  1XC5 A;  2M8G X;  4LK1 F;  2LD5 A;  2AS5 F;  1E3P A;  2VPR A;  5M3M J;  3FMS A;  4HLY A;  4BXF A;  4II2 A;  2XF6 A;  2HOA A;  2OU2 A;  2HDC A;  2XB5 A;  3CQZ J;  5HS8 A;  1BI1 A;  2E36 A;  1V4R A;  3OS1 A;  3OOU A;  1ON2 A;  2W1O A;  1X2M A;  4BL0 B;  1X3U A;  3K69 A;  5KK1 A;  5DCF A;  4FX0 A;  3ASN H;  1R58 A;  3BPV A;  3HRU A;  1OLT A;  5J40 A;  4CO8 A;  4PJ0 C;  3T5X A;  4KIB A;  1WHU A;  3OYB A;  4ZTJ A;  5IP7 J;  2RQP A;  4ZZD A;  2LSO A;  4MIM A;  2JA2 A;  4ENJ A;  1TQP A;  4B43 A;  1F1Z A;  2OZ6 A;  3QU6 A;  3L2Q A;  3HHG A;  2Y0M A;  4FT8 A;  4BQO A;  1HSJ A;  5GPA A;  4CCN A;  3CP2 A;  3TL4 X;  4A69 C;  2XAF A;  3L1P A;  2O6G E;  5L3G A;  3OYG A;  3TP0 A;  4ZJZ A;  3K70 D;  3MKW B;  1W7P D;  2KIF A;  3ELK A;  3S3M A;  4II3 A;  1QBJ A;  3KCC A;  2A6E F;  2LFB A;  4IRG A;  2UXX A;  3MZY A;  5L3E A;  4BJ5 C;  5J4Y A;  3LMM A;  3UR3 C;  4DJA A;  1MH3 A;  2QLZ A;  1HA8 A;  3VOE A;  1R49 A;  2LYC A;  2E1M B;  4IHY A;  1P4X A;  3GZ5 A;  2BV6 A;  3WHC A;  1CF7 B;  3H5A A;  4HX8 A;  1O7F A;  4LK0 F;  1TC3 C;  3NQO A;  1FP2 A;  2M87 A;  1A31 A;  3VYT B;  2K27 A;  5B5E C;  5HLH A;  1VQ5 I;  1DGR M;  2BHZ A;  2LY9 A;  2XC7 A;  2K7L A;  1IAW A;  5IOY A;  4RM3 A;  1MJA A;  2JPB A;  3ZP5 A;  2DDA A;  2P5L C;  1GT0 C;  2IGM A;  1GXQ A;  3OYE A;  1U6G A;  3EQL F;  5K7F A;  1XCB A;  1WJC A;  2PMH A;  1OIS A;  2A68 F;  4IQ4 A;  5EDN A;  3CZ6 A;  1YW8 A;  3AG4 H;  1OCT C;  1SMT A;  3WHB A;  4RGX A;  3ZQQ A;  2GM4 A;  1BI3 A;  2FRH A;  1PUE E;  4HF2 A;  1D0Z A;  4D9J A;  2G9W A;  1B9M A;  3FXU A;  2H8W A;  3BTC A;  3HKZ N;  3LA2 A;  3CCY A;  2V1D A;  2XIG A;  4UNO A;  4Y7N J;  3H9G A;  3OOP A;  3E3V A;  3LA7 A;  3MKZ A;  2O61 A;  4KIT B;  2UUZ A;  5J47 A;  1H0M A;  1U5T C;  4AIJ A;  3A01 B;  3V8K A;  5EYR A;  1E0E A;  1IRG A;  4RB2 C;  1ITY A;  2YR2 A;  1UCR A;  2IPQ X;  4LG0 A;  3H0D A;  5DD8 A;  4QTR A;  4OMZ A;  1YX5 A;  1QGP A;  2MA3 A;  4YIF A;  2ECB A;  1QZZ A;  3LSH A;  1J7K A;  1X19 A;  4XIC A;  1UB9 A;  3AG3 H;  2MG4 A;  1BR1 A;  1TQM A;  1UEL B;  2ZJP F;  4RAG A;  5K7Z A;  2ZFU A;  5K5O A;  3ML6 A;  5LRR A;  4KIC A;  4BE1 A;  3WE2 A;  3QYB A;  2MYS A;  4MNU A;  2E2I J;  1T95 A;  4KT5 C;  3CDI A;  1Z05 A;  2LK2 A;  4ITV A;  3G3Z A;  5GAE J;  3JRA A;  3DV8 A;  1S72 I;  2K85 A;  2G0E A;  1WFX A;  3G1L A;  3I4P A;  4UUT A;  2V7F A;  3ONQ A;  4LD5 A;  1Y8Q B;  3S1R J;  3H1C A;  1ZEL A;  1ORK A;  1XX5 A;  4UUV A;  3W6J B;  5HDG A;  2DA3 A;  5M3F J;  3RCO A;  4D5F A;  5D5U B;  4KNY A;  3K0L A;  2Z99 A;  2YUS A;  3P9K A;  1MMA A;  5JR3 A;  3DCF A;  1U9N A;  1RKT A;  3U9G A;  3S14 J;  2ZFW A;  2K86 A;  3D5L A;  1OPC A;  4OIP F;  3T0Y A;  4QIW N;  2DLL A;  2M4G A;  4Q4Z F;  1S7E A;  3Q0V A;  3GFI A;  1SD4 A;  1W5T A;  3P9I A;  2CH0 A;  3H36 A;  3OYJ A;  5DUK A;  1YYV A;  2H94 A;  3BPX A;  3CP8 A;  4AYB N;  2NAZ A;  4S04 A;  2DA6 A;  3S32 A;  3DTK A;  2A69 F;  1MJ9 A;  1I5Z A;  4QWQ A;  4YFN F;  4G6D A;  5BPI A;  3H92 A;  1RRJ A;  5CVJ A;  3SZP A;  1E3H A;  4XKC A;  4G12 A;  1UMQ A;  2DPD A;  1Z1D A;  3KET A;  2OCC H;  1T2K A;  2DMU A;  4WX9 A;  3SFZ A;  4G9Y A;  1XDS A;  4NQW A;  2GIZ A;  5D4R A;  4Y4R A;  2F48 A;  2OQG A;  4EV0 A;  1IC8 A;  2W25 A;  3F8F A;  2XF7 A;  3HL2 A;  1XGM A;  5LBQ A;  2R0Q C;  3F6O A;  1D3Y A;  3D0S A;  1FP1 D;  3IV5 A;  2XPU A;  3ZMD A;  1VND A;  1TT5 B;  4I99 C;  5ICE A;  2DBB A;  2IA1 A;  2X6W A;  1JUP A;  2L9R A;  1LVK A;  3FK7 A;  2L7F P;  1TWC J;  4LIU A;  2HYF A;  5ICG A;  2WAD A;  1VTN C;  3TBI A;  4PGG A;  1YTY A;  1YOV B;  2HTJ A;  4NDL A;  1L3L A;  4RLQ A;  4BS9 A;  3CMM A;  1G8X A;  1NH3 A;  3ABL H;  3M8J A;  3QPS A;  1X3Z B;  2AXT C;  3WTS C;  1J59 A;  1R4N B;  3M07 A;  3DEW A;  2FSW A;  1OYY A;  3RIR A;  1B59 A;  2H27 A;  3OR1 C;  4ZDO A;  1VQ9 I;  3JRB A;  4M9S A;  2P5K A;  1X1B A;  1USS A;  3DFG A;  2LBF A;  1HW1 A;  1S5L C;  3N97 A;  4UXN A;  2EV0 A;  2L3D A;  2IP2 A;  3E97 A;  2CW8 A;  1GDT A;  1CF7 A;  1TLH B;  3EYI A;  5HLT A;  3FIW A;  1MGT A;  3X2Q H;  1MBK A;  2FQ3 A;  3OMY A;  4JK1 X;  4PFO A;  3D1N I;  3SEZ A;  2QBY A;  4L9N A;  2ETH A;  5LGN A;  2R7R A;  1FMW A;  3ZQL A;  3ZXS A;  3U1D A;  1WPK A;  3IKV A;  2LMD A;  2Q2E B;  4U87 A;  4N0B A;  4XLF A;  3T1B A;  2DMT A;  3JR9 A;  5CPR B;  1SD5 A;  1Z3Y A;  2PMU A;  2XVC A;  3O8H A;  3K1N A;  1D5V A;  5LHI A;  2KMU A;  2QWW A;  4XRS A;  1MW7 A;  2FE3 A;  5TGT A;  3K7A J;  4E7J A;  3F8N A;  3J7Z I;  4S0H B;  4UB6 C;  3ZOB A;  2BE5 F;  2R7U A;  3DLA A;  5E1W A;  2QCO A;  5HNF A;  2K9L A;  5D6E A;  3CJT B;  2QSG X;  2VKE A;  4DYQ A;  1VQ6 I;  5E1X A;  1XMK A;  1G6N A;  2XUB A;  4NC8 A;  2BHY A;  2L7K A;  3O2P E;  1G3W A;  3TQN A;  5IPA A;  1T39 A;  5FGM A;  3CMY A;  3CCJ I;  1TW2 A;  1F5T A;  3L2V A;  2J5O A;  3FKI J;  1B4A A;  1MBH A;  2K9Q A;  1JUS A;  2KZG A;  2WAQ N;  3ABU A;  2VXZ A;  3KP7 A;  3OYA A;  3CC7 I;  3PM1 A;  3ZMS A;  2OJE D;  2VXD A;  1A36 A;  2F4I A;  3ECO A;  2IXS A;  3J81 Z;  2HYJ A;  2BVM A;  3E5U A;  1D0Y A;  1H89 C;  4XL9 A;  2WB1 N;  2BYV E;  4ENM A;  4IHX A;  2ZKZ A;  1GVD A;  3CCS I;  1JKQ C;  4L9J A;  2FMY A;  2HZT A;  4OAZ A;  3LWF A;  4X0G A;  2R4G A;  1I50 J;  3OYL A;  1MSF C;  3PUF A;  1ZGA A;  3H5R A;  1UAA A;  4ABZ A;  1O57 A;  3DF8 A;  2W4S A;  5E3M A;  2O8K A;  2E5Z A;  3BR1 A;  2HQA A;  2R7X A;  1IN4 A;  5CQE A;  3BJ6 A;  3K70 C;  2A3S A;  4F52 A;  4RDU A;  3QWL A;  4C2U A;  1H88 C;  1YIT I;  5KNL A;  2K9M A;  1XSD A;  1OR7 A;  3V7R A;  4HX7 A;  1Y6I A;  2JWT A;  1N78 A;  3HSR A;  2CJJ A;  4I0B A;  1F36 A;  4EJU A;  2L9S A;  2X6Y A;  5EF6 A;  3JRF A;  5FD6 A;  4ZTF A;  1J2X A;  3BP8 A;  4A12 A;  2ZC2 A;  2PX9 A;  2ZXI A;  4F3Q A;  4BGD A;  2NNY A;  3CLO A;  1YJW I;  3SZT A;  4MTE A;  1FLI A;  4A3K J;  2Y48 A;  3J80 K;  2DT7 B;  3BG5 A;  3FHZ A;  3NWT A;  4UHT A;  5DD4 A;  2F2E A;  4RLF A;  5DCM B;  2A6T A;  1JKO C;  3RPQ A;  1WGX A;  5IP6 A;  4X1E A;  1IG7 A;  3CJR B;  1W5S A;  1NHA A;  1EH6 A;  1DU6 A;  5FLX K;  2OTJ I;  2X51 A;  1JI8 A;  2KRH A;  2IA2 A;  4PK4 A;  2E1C A;  4XN0 A;  3M1E A;  4UUS B;  1W36 D;  3B73 A;  3Q0U A;  5FFX A;  4B4C A;  3QPH A;  3TO7 A;  1WWX A;  3OY9 A;  1KU9 A;  2RC4 A;  3SJM A;  2H6B A;  4XR6 A;  1OKR A;  2ZXW H;  3QOE A;  4EEF G;  2GOX B;  1FYL A;  1DDN A;  1BW6 A;  1Y39 A;  1FY7 A;  2CSO A;  3KZY A;  2HXO A;  2WV1 A;  1H9T A;  1A04 A;  2FJ1 A;  1TZL A;  2M4K A;  2I5U A;  5IT9 Z;  2HXI A;  2WY8 Q;  4EM1 A;  1QVU A;  2DQR A;  1D1C A;  2DFF A;  4B44 A;  2HOT A;  2M1B A;  1I39 A;  1AA7 A;  2WBM A;  3KIO A;  5GP9 A;  1B72 B;  5DUI A;  1Y1W J;  1N77 A;  3ZPL A;  1VQL I;  2DJN A;  3VDX A;  2GIV A;  4OWR B;  5JVG F;  1GXP A;  1T56 A;  2B63 J;  5GAD J;  3PNY A;  1HST A;  1YS7 A;  1W7P A;  2LG4 A;  2MH9 A;  5LRS A;  4Q47 A;  2AHQ A;  5AIQ A;  2DK8 A;  2M9H A;  2PMZ N;  1XD7 A;  3N4M A;  1WQ2 A;  2V9K A;  4D1Q A;  2W84 A;  2JK3 A;  3JAM Z;  5FKM A;  4UVC A;  3S1Q J;  4CGZ A;  3F72 A;  2QM3 A;  1PP7 U;  3GCM A;  3DLL F;  2M8E A;  3FKJ A;  3S15 J;  2M3A A;  1EH7 A;  1SFE A;  2KRF A;  2DMP A;  4HZF A;  4BNC A;  3TW6 A;  5HLG A;  2NRA C;  1FOK A;  1W1W E;  4IQJ A;  2VJJ A;  3Q9S A;  1PDN C;  1WH7 A;  1X4P A;  3C2G A;  3K6G A;  2QQ9 A;  1R36 A;  2VQH A;  3JSP A;  2IS6 A;  2MW8 A;  2CW0 F;  3R0J A;  1IV8 A;  5HNH A;  4EJV A;  1OYI A;  3GVA A;  3RJP A;  3JTG A;  2DT6 A;  2EIJ H;  3PSF A;  1IZ1 A;  1BIA A;  1RIO H;  3H35 A;  4B3X A;  1ZN2 A;  3MEX A;  3JRE A;  4HRI A;  3P5J A;  3G2B A;  2EK5 A;  3EUA A;  2CUE A;  2E1O A;  5BS6 A;  2K4B A;  4XKV A;  3FXQ A;  5J1R A;  3CCR I;  2Q2E A;  4B47 A;  4D7N A;  3FMR A;  4A3M J;  3WGI A;  1NK2 P;  2Q1Z B;  1YRN B;  1FEX A;  2XAS A;  1DU0 A;  1UG0 A;  2F4M B;  3D5R C;  1S6L A;  1JKR C;  3R0A A;  3K1P A;  4J00 A;  2HOE A;  3T8T A;  4HG2 A;  4WF2 A;  2Y0S N;  5DYM A;  1TWH J;  3L2W A;  5C4J J;  2CS3 A;  4UV8 A;  4NHJ A;  1QU3 A;  5CLS A;  4CYD A;  4ETS A;  1Q1V A;  1T8I A;  4FCY A;  2OA4 A;  3ZGK A;  1Y0N A;  3CLQ A;  5B3S H;  2P6T A;  3HOU J;  1TW3 A;  1Z7U A;  2VBX A;  2UXN A;  1OFC X;  2EZK A;  2BY0 A;  2ELH A;  4U0W A;  4BY7 J;  4V19 K;  3B02 A;  5HVQ C;  1XMA A;  4V2F A;  2HWV A;  2LKS A;  4A0Z A;  3TDU C;  1IN8 A;  4MEY F;  1Z7L A;  3CCU I;  4Y13 A;  4UY8 I;  3K4J A;  1W5C C;  4A5N A;  1FSH A;  3C2B A;  2E34 A;  4LFU A;  3CUQ C;  2V1N A;  3GFM A;  4YIR X;  4XM3 A;  3TOA A;  1XDU A;  3WE3 A;  1FZP B;  4L0Y B;  5M5X J;  3BT9 A;  2K9S A;  2ME6 A;  1QHH D;  3DPU A;  4N4N B;  4QSH A;  4U7D A;  2NVU B;  2XSD C;  3RZD J;  2EFQ A;  1ODD A;  5J8C A;  3I56 I;  3BCB A;  1ZR4 A;  4Y52 J;  5A2Q K;  3I5U A;  4ZC3 A;  4JX6 A;  4XLA A;  3HOY J;  3W2W A;  1GLN A;  1Z3X A;  1J9I A;  5JFR A;  2DMQ A;  5EEG A;  4OIN F;  3GO5 A;  1PJR A;  2OD5 A;  3WU2 C;  4Y17 A;  2JMW A;  1DPU A;  2PN6 A;  2MLG A;  1ZR2 A;  3NAU A;  2PJR B;  4RAF A;  4EGY A;  1TTY A;  4NB5 A;  3SZG A;  3LAP A;  2HVQ A;  3QAH A;  4PSW A;  2FF4 A;  1HF0 A;  1IXR C;  1FC3 A;  1MND A;  1WJ5 A;  2KJB A;  1YS6 A;  3N05 A;  1KYW A;  3ZRG A;  3C1D A;  2ME0 A;  4R1H A;  1KA8 A;  2X48 A;  5FO5 A;  4BQA A;  2IT0 A;  4U0V A;  5DCM A;  3TOB A;  3S2H J;  5TIS C;  3GF2 A;  1RKW A;  2DFH A;  2FML A;  3A1Y A;  4M6X A;  4M6Y A;  2VB6 A;  2VE8 A;  1SAU A;  1C0W A;  4I01 A;  1TBX A;  4TV7 A;  2GXG A;  4IF4 A;  2XF5 A;  2NYX A;  5ILS A;  3JCU C;  5J8F A;  4EGZ A;  3WGG A;  4BJT A;  3L00 A;  2EZL A;  2P8T A;  2O9L A;  3KPH A;  1FIA A;  5D5V B;  4XOP A;  5ERI A;  3R6S A;  4KIF A;  4M6V A;  1IN5 A;  3QPL A;  1QO0 D;  2R7V A;  3BDD A;  1BC7 C;  2QSH X;  3LNQ A;  4YG2 F;  2DA5 A;  1IRF A;  1P7J A;  1VZ0 A;  1OJL A;  1FSE A;  5LHG A;  4BDZ A;  1UZC A;  1G59 A;  3ZMT A;  2NS0 A;  2FQ4 A;  4G7Z F;  5IYC J;  4IVN A;  4N9H A;  3VWB A;  5GTH C;  1FBU A;  3AFH A;  4YEJ A;  2VN2 A;  2R7Q A;  5K7H A;  3I59 A;  2I8D A;  1MNE A;  1TNT A;  3CUQ A;  3LSK A;  3ZQC A;  4L5E A;  3R4K A;  1JT6 A;  2BY2 A;  3KE2 A;  3HOS A;  3S8P A;  3G1O A;  3PFI A;  2R92 J;  4AIK A;  1K78 A;  2WC2 A;  2CWE A;  5EGO A;  1KYZ A;  2O0Y A;  4HX4 A;  1R9T J;  1YIO A;  2JA6 J;  2KLO A;  3ABT A;  3HDD A;  3HZJ A;  1YX3 A;  2R5Z B;  5CYV A;  4B48 A;  2BZT A;  1IRZ A;  2PLY A;  2JA5 J;  2JVG A;  2FBK A;  3KEO A;  3CES A;  4HDV A;  3W2A A;  1S9H A;  3G1M A;  3ZMV A;  2XB0 X;  3GEZ A;  4RAY A;  5ILU A;  1DGW Y;  2BW3 A;  1QA6 A;  3TKY A;  5KVR A;  3TED A;  4A2U A;  3J7A Y;  2GZW A;  4RMN A;  3MKY B;  3S16 J;  2AO9 A;  4HYE A;  2CW7 A;  2DTR A;  2L9V A;  2KP6 A;  1BR2 A;  1UHW A;  1YLF A;  1WJA A;  4G6T B;  3H5N A;  2TCT A;  1RR7 A;  4A3D J;  3BR2 A;  4U7B A;  2JZY A;  3FBI B;  4RB0 A;  4C30 A;  1A6Q A;  3QYE A;  3OL3 A;  1MBG A;  4MO7 A;  2TRT A;  5H2F C;  1SVO A;  4GYG A;  1OCR H;  3KP2 A;  1SMY F;  2BGC A;  4Y33 A;  1D8J A;  2R7W A;  2VOO A;  4A0Y A;  1B8I A;  5KCM A;  3SDG A;  4ZYA A;  1H8A C;  4BUP A;  1E17 A;  2VJ5 A;  4ESB A;  4LMY A;  1YRN A;  4CZZ A;  1MDM A;  2HR3 A;  2FUG 2;  4RM2 A;  3KEQ A;  1V3F A;  1FOY A;  4ZZL A;  4M74 A;  2GOM A;  1YJ9 I;  1MSE C;  1WJF A;  3RKW A;  4EAT A;  2MC3 A;  2DT5 A;  3GFL A;  3IC7 A;  3P7N A;  3SXY A;  4M3G A;  4YRV A;  4CCO A;  3HG9 A;  1RC9 A;  4ZDP A;  1HKQ A;  2VL8 A;  5HDK A;  3PFY A;  3PNV A;  1MKM A;  1MMS A;  1EKE A;  3AKZ A;  3RPU D;  1JTY A;  2DAO A;  2JVH A;  2F5V A;  3RQ4 A;  1WKM A;  2V6E A;  2BOL A;  2R5Y A;  3EUK L;  3BCA A;  1BJZ A;  2XSJ C;  3ZQI A;  1PUF A;  4IJA A;  3RKX A;  1ZG5 A;  3EPZ A;  3H3Z A;  2E1N A;  3PL8 A;  2JQ7 A;  3BZK A;  5GPC A;  5CJ9 A;  3MWM A;  3S1N J;  4AWX B;  3GX4 X;  3HB9 A;  4HPQ A;  2V26 A;  2DXI A;  1SC7 A;  5E79 C;  4I76 A;  4OU0 A;  3F8C A;  4E7H A;  2P0W A;  2E2J J;  2RKH A;  1AKH B;  2XGE A;  2M2E A;  4G7O F;  4G6Q A;  4ENN A;  1KQ8 A;  2XRO A;  5DV5 A;  4C2T A;  5HS7 A;  4B3A A;  3ERE D;  3ESW B;  2VT2 A;  3K2A A;  2M34 A;  2L7Z A;  1LQ1 A;  4E7S A;  3HOV J;  3WTV C;  1K7A A;  5F1R A;  5E3L A;  3RSN A;  4UVB A;  2LF7 A;  2E1M C;  3KLN A;  2M7B A;  2P7V B;  2XGX A;  3OYM A;  4P9U A;  4F93 B;  1G4D A;  3AL0 B;  2JJ7 A;  4I2O A;  1APL C;  5FRO A;  5JVT A;  1KU3 A;  3BWG A;  3WG9 A;  3FXO A;  2VQG A;  2JUC A;  2LOO A;  1ZG3 A;  4N9I A;  2DOF A;  2FOW A;  5IY5 H;  2FNP A;  2ZNY A;  4EQQ A;  1ZRC A;  4XSZ F;  3TDZ C;  3VSK A;  1B9N A;  3W2V A;  4QLC U;  1P9Q C;  2PG4 A;  2QQ8 A;  2VBW A;  3FF5 A;  3VOD A;  2P7C B;  1P4A A;  2WY7 Q;  4HQM A;  3KYC B;  3U21 A;  3M1C A;  2A5Y B;  3PIO F;  1DP7 P;  4M71 A;  2YS9 A;  1E3O C;  1POG A;  2I10 A;  4A0X A;  2F5C A;  4OIO F;  3OYC A;  3GTO J;  2EFN A;  2GQQ A;  4AM3 A;  1U0J A;  2DA1 A;  4RGS A;  2M7A A;  2NS8 A;  3ZMZ A;  3RI4 A;  1U3E M;  3M8E A;  2JUG A;  1ZGW A;  2GBY A;  1Y56 A;  2EA2 A;  1U8B A;  3FMQ A;  5E3N A;  4DYC A;  4H0E A;  4FHT A;  3NEU A;  1JKP C;  3CCM I;  3B6C A;  1SVL A;  1ERD A;  2B9S A;  1V5E A;  4A3L J;  1O4X A;  1SVM A;  2DA7 A;  1HLV A;  1OMI A;  4WXD A;  2DYS H;  2MGQ A;  3HGG A;  1YFH A;  4HV5 A;  5FRM A;  5EG0 B;  4ZYG A;  3RYP A;  2K5C A;  4CZC A;  3CCV I;  2R7S A;  2DOA A;  1G3Y A;  4BXU A;  3K4K A;  1LVA A;  3CCQ I;  4DYR A;  4XLC A;  1QNT A;  1KQ0 A;  4Z2Y A;  4ASN A;  1RET A;  4CUG A;  2L01 A;  4XK4 A;  1R5G A;  2RV8 A;  2IVM A;  5D8L B;  4D0P A;  2HOS A;  1KU7 A;  3BTJ A;  4M3B A;  3ABK H;  5EEA A;  5AIP A;  3FWE A;  3VEP A;  3IUO A;  3P9C A;  2G7H A;  3C18 A;  1J0R A;  1T6S A;  2K4J A;  1V5G A;  1YIJ I;  1OR7 C;  6PAX A;  4A3F J;  4IEJ A;  4BEH B;  1ZYR F;  1BM9 A;  4XON A;  1HDD C;  2IEK A;  1BR4 A;  4ON0 A;  5HLI A;  1BOA A;  3RTR A;  5CVU A;  4LLL A;  3RDI A;  1FX7 A;  2DQL A;  3I4N J;  4MHG A;  5ED4 A;  3KYL A;  1S29 A;  3BQY A;  1GV5 A;  2HU9 A;  2KFD A;  1ZRF A;  5DDG A;  4HLX A;  2NVY J;  2CUZ A;  2GA1 A;  2VQC A;  4CHU A;  3R60 A;  1Y1V J;  4F7Z A;  1YQA A;  3BTL A;  2RNG A;  2KIS A;  3GXO A;  5L3C A;  3I0T A;  1RUO A;  1FWZ A;  4XRS G;  5B1A H;  4DNC A;  1Z9C A;  4CIC A;  2Y30 A;  3HUG B;  4HNU A;  4BDY A;  4D5C A;  4GGG A;  3M7G A;  1LFU P;  1MMD A;  1MIJ A;  4Q48 A;  1LE8 B;  2RGV A;  2ZO4 A;  3K2Z A;  1Z6T A;  3HGY A;  2EFW A;  3OWT A;  4FX4 A;  4KUM A;  2HS5 A;  5FJ8 J;  1BI0 A;  2ECC A;  4B1R A;  1W4M A;  5E20 A;  5LD2 C;  3FM5 A;  5FD5 A;  3MKL A;  1QZE A;  2V9V A;  4E4H A;  3A01 A;  2CQX A;  4KIS A;  3BG9 A;  1YG2 A;  2R7D A;  3JW4 A;  3J81 K;  1LDJ A;  4C3H J;  3QOP A;  1WH5 A;  3JRH A;  2E7W A;  3B6A A;  4HA8 A;  3DKW A;  2DOD A;  2FXA A;  1PP8 F;  1I1G A;  1BL0 A;  3C2H A;  3BZC A;  2QQB A;  1YE9 A;  2LC2 A;  4P55 A;  1G3T A;  4R8H A;  2KRC A;  3OS0 A;  1U9O A;  3SYT A;  4IL6 C;  1ZTR A;  2R7Z J;  3CDH A;  3CME I;  1TQI A;  3FXM A;  3L2U A;  1EV7 A;  4XOT A;  3FXR A;  4XRF A;  5D6F A;  2XRL A;  3BC8 A;  4KFC A;  2ISY A;  1ENH A;  4L9T A;  1LB2 A;  1XCV A;  3NWS A;  2KQR A;  1XSX A;  4OIQ F;  4M72 A;  1ZLK A;  2JT1 A;  3V8J A;  4XID A;  2JPC A;  4HBL A;  4M73 A;  3S3O A;  1AKH A;  3BR5 A;  4EVI A;  3IKT A;  3I3L A;  2Z16 A;  1IO2 A;  4BH9 A;  4JX5 A;  4NUB A;  2FNA A;  1ZHF A;  1KU2 A;  1V5F A;  4HAM A;  4XLP F;  3V7C A;  4CYC B;  2ESN A;  5B66 C;  3COA C;  2UZK A;  4DBQ A;  4IHS A;  2EFP A;  1HCR A;  2H8R A;  5LEK A;  1P92 A;  2QF7 A;  2HVR A;  4BXX J;  1R6R A;  2VKV A;  4PDK A;  4EMS A;  1TT0 A;  1BN5 A;  3M8F A;  1P4W A;  3Q9V A;  1RI7 A;  2VBY A;  1E2X A;  2CFX A;  2XPW A;  3MZ8 A;  4GYI A;  3LSJ A;  1ZRE A;  5KAI C;  1MMG A;  3DBL B;  4ANJ A;  2H1K A;  2MD0 A;  2OC6 A;  4PJN A;  5ICF A;  3A2K A;  2WAF A;  2J5P A;  5H20 A;  3V42 A;  5KAF C;  1VQ7 I;  3KZI C;  2VE9 A;  3R61 A;  4YEL A;  1Z6R A;  3J80 Z;  3S2D J;  4AIH A;  2VAS A;  1WVR A;  1BJA A;  1JUM A;  1VQP I;  1BI2 A;  4KJZ A;  4YII A;  1R23 A;  3BG3 A;  3G6E I;  2QYO A;  4A3C J;  2X6X A;  4A3B J;  3TO6 A;  2VKH A;  2IS4 A;  2EA4 A;  4GDF A;  2CQN A;  1X2N A;  4RGU A;  5IOZ A;  2JSP A;  3CJQ B;  4XKB A;  2DMN A;  2EB7 A;  4HW0 A;  1ZAR A;  2ZME B;  1R4M B;  2ACJ A;  1BA5 A;  2ELK A;  3KP5 A;  1WSU A;  3KLO A;  1O3R A;  5J6X A;  5ILV A;  1Z67 A;  1AOY A;  1WJB A;  1Y8R B;  3WOD F;  2DOE A;  4HV6 A;  2QQA A;  2AQF A;  4DBR A;  2WA0 A;  2X85 A;  3VB2 A;  2XRN A;  2OZU A;  2HQN A;  2EIL H;  2CMP A;  2IS2 A;  4XNF A;  3BR3 A;  1F43 A;  5IT3 A;  4E7L A;  1P2F A;  3UNG C;  1OCP A;  1OCO H;  3PSI A;  3PO3 J;  3BZ6 A;  4P9F A;  5LGT A;  2IGK A;  4DW6 A;  3HTU A;  2V1X A;  2L4M A;  4XLH A;  2W57 A;  3K4L A;  2NNN A;  5F0F A;  3VYR B;  3JAM K;  3T8R A;  3I64 A;  3S3N A;  4M3D A;  4JYK A;  2MLK A;  2LNB A;  4CCJ A;  3HJE A;  3U1K A;  4E7Z A;  5M5Y J;  3F21 A;  3TW7 A;  2CQK A;  1QZY A;  5J1Y A;  4W1U A;  1GV2 A;  4LIV A;  1NTC A;  1FTT A;  4BU2 A;  1O3S A;  2F5F A;  4PJJ A;  4PJL A;  3IRQ A;  3HEF A;  4G8X A;  4LLN A;  4V2G A;  2CUJ A;  3VPR A;  2Y9Y A;  3G73 A;  3PIP F;  4P5O A;  2LH9 A;  4NC7 A;  4MQV A;  3RKY A;  4ZYE A;  3QU3 A;  2CV1 A;  2CG4 A;  2MD5 A;  5BQT A;  5FRN A;  2XAU A;  2WV0 A;  4IRI A;  3IH3 A;  2HTS A;  3GLL A;  2Y75 A;  3IL2 A;  1UFM A;  1LKX A;  4I0A A;  1STZ A;  5E3O A;  2Z1D A;  3WTT C;  3PQJ A;  3CC4 I;  3EDP A;  3S93 A;  3OYH A;  5E8I A;  2YSR A;  1JT0 A;  3F8M A;  3S2W A;  1ONV A;  2FOK A;  3LA3 A;  3KZZ A;  3HUG A;  4ESJ A;  3JSO A;  2XDV A;  3AG2 H;  3NRV A;  4DQ2 A;  2F6C A;  5F64 A;  4RGR A;  4L0Z B;  4JQF A;  2KDO A;  5IP9 J;  3O3K A;  3WG7 H;  3RPU A;  4BHC A;  1LFP A;  1VQ8 I;  1IUY A;  3EUH A;  4JX4 A;  2K3F A;  4K2E A;  1ZG1 A;  1HOM A;  3BOQ A;  2Q8K A;  2CYY A;  1XG1 A;  2MFZ A;  1WCM J;  5CVV A;  3HKZ A;  4GXO A;  1S3J A;  1S8N A;  1LPQ A;  3IRR A;  4OOI A;  4GRI A;  1DP3 A;  1ETV A;  4L9V A;  1ZAO A;  3LSP A;  3ZQ7 A;  2XKO A;  3HPH A;  5J3L A;  2HQ5 A;  1QPI A;  5D5X B;  2DCE A;  3QOD A;  2BEO A;  1WRJ A;  1YJN I;  1VQ4 I;  2OPT A;  1MMN A;  3HTS B;  5TRD A;  2KT0 A;  3PQK A;  2RN7 A;  2HPI A;  3G4S I;  1TWF J;  1SFX A;  2RQQ A;  3WU1 B;  1FT9 A;  2L5Q A;  3HYI A;  4P96 A;  1IDZ A;  3I54 A;  2QVO A;  4C3I J;  2YX7 A;  1GUU A;  1S7O A;  3HRS A;  4FAS D;  2Y9Z A;  3GW2 A;  3DTE A;  3E6C C;  2A5W A;  1LFB A;  3F0C A;  2GXA A;  4BBS J;  2DTZ A;  3DEE A;  4RB3 C;  3HRM A;  2DW4 A;  3JRC A;  2EIM H;  2O7O A;  2HPM A;  3F22 A;  2FX0 A;  3BG7 A;  9ANT A;  5K5Q A;  3MVP A;  5FKN A;  3OYF A;  3SDB A;  3REO A;  4CYC A;  2F5D A;  2XAH A;  3U2R A;  4RAZ A;  2X9D A;  1IUF A;  4XKW A;  4FQG A;  3GLX A;  1K83 J;  5A2Q Z;  2L7M P;  1MJB A;  1NG7 A;  4BAC A;  1B6A A;  3FHN A;  2VOP A;  2CUF A;  4D7M A;  1I3Q J;  4RB1 A;  4EJT A;  1N75 A;  1FMV A;  3LQQ A;  4U0Y A;  2IA0 A;  3K4N A;  3TP3 A;  4LLG F;  4F92 B;  2QGU A;  3MN2 A;  1K4T A;  3H3V K;  2LY2 A;  4AYB A;  1Z21 A;  3OYI A;  3HM5 A;  1TWA J;  2QKL B; 
#chains in the Genus database with same CATH homology
 1FJL A;  2DMT A;  2RAE A;  4UUS A;  3JR9 A;  3UKG A;  3O8H A;  4MFD A;  4GFB A;  4XRS A;  4I76 A;  3K7A J;  5M5W J;  3PO2 J;  4A3E J;  2E2J J;  4S0H B;  3ZOB A;  5IYB J;  2XGE A;  1AKH B;  2M2E A;  2QCO A;  1JGG A;  2VKE A;  4DYQ A;  4B3A A;  2NVX J;  1A5J A;  2EZI A;  3K2A A;  5IPA A;  4A3I J;  1BW5 A;  2M34 A;  2L7Z A;  2DN0 A;  3HOV J;  3CMY A;  3S17 J;  1ETQ A;  5C4X J;  5E3L A;  3FKI J;  1FTZ A;  1B72 A;  1ETY A;  1MBH A;  2K9Q A;  1JUS A;  2LR8 A;  2WAQ N;  1D5Y A;  4C2M J;  3PM1 A;  2JJ7 A;  2LKX A;  1APL C;  2HYJ A;  1WI3 A;  1H89 C;  5J1U A;  2WB1 N;  4IHX A;  1GVD A;  4BKX A;  2NS7 A;  1JKQ C;  1U78 A;  4DZP A;  3GTM J;  1LE8 A;  1ETW A;  1I50 J;  1MSF C;  3LSR A;  5IYD J;  1AHD P;  4ABZ A;  3JRD A;  1B8I B;  2O8K A;  5E3M A;  4MFE A;  3BR1 A;  4BBR J;  2YS9 A;  1JJ6 C;  1POG A;  2I10 A;  3IH4 A;  1E3O C;  4IHV A;  3GTO J;  1IV6 A;  1JTX A;  4RDU A;  4A3J J;  2DA1 A;  3GTJ J;  1H88 C;  2R93 J;  2NS8 A;  2JWT A;  2CJJ A;  4J19 A;  1F36 A;  5EF6 A;  3JRF A;  2VUM J;  1ZGW A;  1ZQ3 P;  2GBY A;  5EZG A;  3A02 A;  3RZO J;  1U8B A;  2E19 A;  2M0C A;  4DYC A;  5E3N A;  5DTD A;  2E2H J;  2R5Y B;  4A3K J;  1JKP C;  3BG5 A;  3B6C A;  5FKK A;  3JRG A;  1PUF B;  2Y2Z A;  3GTP J;  3JRI A;  3ZQF A;  4A3L J;  2FD5 A;  2LP0 A;  2P81 A;  1UHS A;  1O4X A;  3BQZ A;  2DA7 A;  1HLV A;  5C3E J;  1X58 A;  1JKO C;  5IP6 A;  1WGX A;  2MGQ A;  3HGG A;  4X1E A;  1CQT A;  5EG0 B;  1IG7 A;  1QRY A;  1DU6 A;  1MH4 A;  1ETO A;  2ID6 A;  4M3E A;  4W97 A;  4DYR A;  3GBG A;  3HBL A;  4UUS B;  2LTP A;  3QQA A;  3Q0U A;  1RET A;  4B4C A;  1MBJ A;  3FIS A;  4FE4 A;  5DS9 A;  3SJM A;  2K9N A;  4XK4 A;  4DZJ A;  4EEF G;  1BW6 A;  2HOS A;  2HXO A;  2WV1 A;  3BTJ A;  4M3B A;  5EEA A;  2FJ1 A;  2KDZ A;  2HXI A;  4A3F J;  4IEJ A;  1QVU A;  1TWG J;  1VF9 A;  5FLV A;  1HDD C;  2IEK A;  3A03 A;  3OSG A;  1VFC A;  2HOT A;  3LOC A;  3GTK J;  4LOC A;  5GP9 A;  1ZKG A;  1B72 B;  3I4N J;  1MBF A;  1Y1W J;  4AC0 A;  2N8G A;  1GV5 A;  3BQY A;  2XGD A;  2NVY J;  3BR6 A;  2DJN A;  1Y1V J;  3BTL A;  2CRG A;  4JP0 A;  1T56 A;  2DA4 A;  2B63 J;  5F08 A;  4XRS G;  3BTI A;  1Z77 A;  5JLX A;  2AHQ A;  2Y30 A;  4X6A J;  4D5C A;  1LFU P;  1JJ8 C;  1LE8 B;  2M9H A;  2PMZ N;  2D5V A;  2NOG A;  3HGY A;  3CDL A;  5FJ8 J;  2JK3 A;  2ECC A;  3M4O J;  4IHW A;  5FKM A;  3S1Q J;  3RQI A;  4C3J J;  4B1R A;  1ETK A;  2LLK A;  4M3F A;  2CQQ A;  1XC5 A;  2M8G X;  2LD5 A;  3MKL A;  3S15 J;  2VPR A;  5M3M J;  2DMP A;  3TW6 A;  3A01 A;  2CQX A;  3BG9 A;  2HOA A;  1WH7 A;  2XB5 A;  3CQZ J;  4C3H J;  1WH5 A;  3JRH A;  3B6A A;  2NVQ J;  1I6H J;  3OOU A;  1BL0 A;  3HOW J;  1X2M A;  2MW8 A;  4FIS A;  1U9O A;  3ZQH A;  1ZTR A;  2R7Z J;  1QVT A;  5FKO A;  3I4M J;  4BY1 J;  5IP7 J;  3JRE A;  1NK3 P;  3HOZ J;  2CUE A;  2E1O A;  2XRL A;  4MIM A;  5J1R A;  1ENH A;  4D7N A;  4A3M J;  1NK2 P;  5F27 A;  2MSY A;  1YRN B;  1FEX A;  5GPA A;  3L1P A;  1DU0 A;  4A69 C;  3NAR A;  1JKR C;  3W6V A;  3TP0 A;  4XID A;  1AKH A;  2Y31 A;  3IH2 A;  3GTQ J;  3BR5 A;  2Y0S N;  1TWH J;  4JX5 A;  2LFB A;  5C4J J;  1XS9 A;  4CYC B;  5F04 A;  3M3Y J;  1MH3 A;  2OF7 A;  1ZK8 A;  1Q1V A;  2DA2 A;  4FCY A;  5BNG A;  1SFO J;  3GTG J;  1HCR A;  2ZB9 A;  2H8R A;  3HOU J;  2ID3 A;  2QF7 A;  4IHY A;  1OFC X;  3WHC A;  4BXX J;  2EZK A;  2VKV A;  4BY7 J;  1TC3 C;  2JA8 J;  4V2F A;  2XPW A;  3LSJ A;  2LY9 A;  4MLO A;  2R5Z A;  5IOY A;  2H1K A;  3C2B A;  1G2H A;  1AU7 A;  2CU7 A;  5M5X J;  3BT9 A;  1GT0 C;  2K9S A;  2ME6 A;  3HOX J;  1Z0X A;  4QSH A;  2XSD C;  5K7F A;  3RZD J;  3S2D J;  5F1J A;  1JUM A;  3RKQ A;  3O8G A;  1ZR4 A;  5EDN A;  4Y52 J;  3H0G J;  4JX6 A;  3BG3 A;  3HOY J;  1OCT C;  4A3C J;  3WHB A;  4A3B J;  2GM4 A;  1X2N A;  2DMQ A;  5IOZ A;  2DMN A;  3HKZ N;  3BTC A;  2JMW A;  2JA7 J;  3CCY A;  1BA5 A;  4Y7N J;  2ELK A;  2JN6 A;  1ZR2 A;  3GTL J;  3NAU A;  1RES A;  3A01 B;  5EYR A;  1ITY A;  1MBE A;  5FLM J;  1HF0 A;  3BR3 A;  5F0C A;  1F43 A;  4QTR A;  2LVS A;  1OCP A;  2ECB A;  2ME0 A;  2X48 A;  3PO3 J;  4XIC A;  3S2H J;  4DW6 A;  2MG4 A;  1RKW A;  1MNM C;  5K7Z A;  2EZH A;  2W48 A;  5F0F A;  4M3D A;  4JYK A;  2E2I J;  2LK2 A;  2EZL A;  2O9L A;  3JRA A;  5M5Y J;  1FIA A;  2G0E A;  3G1L A;  4UUT A;  3TW7 A;  4M6V A;  5J1Y A;  3QPL A;  4W1U A;  3E7L A;  3S1R J;  3LNQ A;  1ORK A;  1GV2 A;  1NTC A;  2DA5 A;  5EZH A;  1P7J A;  2DA3 A;  5M3F J;  1FTT A;  1OJL A;  1SAN A;  4D5F A;  3HEF A;  2FQ4 A;  5IYC J;  4V2G A;  1P7I A;  3VPR A;  2Y9Y A;  2YUS A;  5K7H A;  1U9N A;  1RKT A;  3DCF A;  1K61 A;  3S14 J;  3ZQC A;  4L5E A;  4QIW N;  4I6Z A;  1JT6 A;  1S7E A;  3Q0V A;  4RBO A;  3G1O A;  3IH3 A;  1IGN A;  2R92 J;  3LSG A;  5EGO A;  4AYB N;  4FTH A;  5E3O A;  1W0T A;  1R9T J;  2DA6 A;  4A93 J;  2JA6 J;  1T33 A;  3HDD A;  2R5Z B;  1JT0 A;  1IRZ A;  2JA5 J;  1VI0 A;  3ZQG A;  3G1M A;  2XB0 X;  3FK6 A;  4G12 A;  1UMQ A;  3Q0W A;  5IP9 J;  5HOD A;  3Q3S A;  1HDP A;  2DMU A;  3TED A;  4JX4 A;  3S16 J;  1HOM A;  2K40 A;  2AO9 A;  1XG1 A;  1WCM J;  1IC8 A;  4HNV A;  2R0Q C;  1ETV A;  2EBI A;  3LSP A;  3IV5 A;  2EH3 A;  2XPU A;  1VND A;  2TCT A;  1RR7 A;  4A3D J;  2HDD A;  5J3L A;  1UG2 A;  2HQ5 A;  3BR2 A;  2NVT J;  1QPI A;  1RPW A;  2HI3 A;  2OPT A;  1JUP A;  1IJW C;  2KT0 A;  2X6O A;  2L9R A;  1TWF J;  3FK7 A;  3OSF A;  2L7F P;  1TWC J;  4FE7 A;  1W0U A;  1MBG A;  4MO7 A;  2TRT A;  2IAI A;  1IDZ A;  4C3I J;  1GUU A;  2COB A;  4NDL A;  2GLO A;  2Y9Z A;  2L0K A;  1B8I A;  2XGC A;  3SDG A;  5C44 J;  1H8A C;  4AUX A;  1LFB A;  3F0C A;  1YRN A;  4BBS J;  2DTZ A;  2YU9 J;  4A3G J;  3QPS A;  3BR0 A;  1MSE C;  3JRC A;  5F0H A;  5JLW A;  2O7O A;  1IDY A;  1ETX A;  2FX0 A;  4M3G A;  3DEW A;  1A6I A;  9ANT A;  3MVP A;  5FKN A;  2IBD A;  2VI6 A;  4CYC A;  3JRB A;  1JTY A;  1IUF A;  2X9D A;  1K83 J;  2L7M P;  2R5Y A;  5FKL A;  3SFI A;  2CUF A;  4D7M A;  1I3Q J;  1BJZ A;  3ZQI A;  1GDT A;  1PUF A;  1EF4 A;  2EQR A;  3FIW A;  2XPV A;  3OIO A;  1MBK A;  3TP3 A;  3D1N I;  1FIP A;  3MN2 A;  5GPC A;  5EG0 A;  3H3V K;  3S1M J;  4XRM A;  3ZQL A;  5EGO B;  1WPK A;  3S1N J;  3HM5 A;  3HB9 A;  1TWA J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...