5EG0B

Hoxb13-meis1 heterodimer bound to dna
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
61
structure length
61
Chain Sequence
RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Homeobox protein Meis2
publication title Molecular basis of recognition of two distinct DNA sequences by a single transcription factor
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 16
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2015-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5eg0B00
1WI3A 2JMWA 3Q0WA 4AUXA 4FTHA 3S1RJ 2LFBA 5J3LA 4A3JJ 2L0KA 2X6OA 4QTRA 2WAQN 1TWAJ 1U9OA 3I4NJ 3IH2A 1XS9A 2LTPA 1ZTRA 2ID3A 5K7ZA 1R9TJ 1K61A 2NVXJ 2MGQA 1ZR2A 4CYCB 3LNQA 4A69C 5EZGA 1Y1VJ 3BT9A 2FX0A 3VPRA 3M3YJ 4XRSA 2XGDA 4Y7NJ 1S7EA 2R5ZA 1MBHA 4B4CA 4FE4A 1UMQA 1W0UA 1MSEC 1GV5A 1HLVA 4LOCA 1VNDA 3K7AJ 4I6ZA 2CUEA 5F0FA 5JLXA 3HBLA 2VPRA 3S16J 3DCFA 3W6VA 2TRTA 3GTOJ 3S14J 4AYBN 1ETYA 3TP3A 3L1PA 4AC0A 2YUSA 3HOVJ 2IAIA 2DTZA 1JUPA 2VKEA 3SFIA 4X1EA 4XICA 2HI3A 3Q3SA 3GTGJ 4C3JJ 4M3GA 2EH3A 2XSDC 1JT0A 5J1UA 1WCMJ 3BG9A 4A3KJ 5GPAA 2CQXA 2I10A 3JRGA 4A3IJ 1P7IA 1H89C 1GUUA 2E1OA 2X48A 2Y0SN 1JTXA 3HOZJ 3S15J 4FISA 2L7FP 4W1UA 2EBIA 4A93J 3OOUA 2DJNA 1ZK8A 3IH3A 1JKQC 1APLC 2LY9A 5EG0B 2PMZN 1H88C 1YRNA 3HM5A 4JP0A 4G12A 4DZPA 5DTDA 3JRCA 1B8IB 5GP9A 3HB9A 2Y30A 5JLWA 4C3IJ 2QCOA 5J1RA 1RKTA 2K9SA 2LVSA 1F36A 5F27A 2EZHA 5HODA 3PO3J 2WV1A 2M9HA 2MSYA 4IHVA 3GTKJ 4A3CJ 2FQ4A 2DMNA 2IEKA 3BR1A 4NDLA 3ZQGA 3HDDA 2DMQA 2HOTA 3S2DJ 5FKLA 1U78A 4MLOA 5EYRA 3D1NI 2DA5A 4V2FA 1ORKA 2X9DA 4MFDA 2JA5J 4S0HB 4BXXJ 3TEDA 1TC3C 3HGGA 4JX4A 1ITYA 4MIMA 5EF6A 2DA7A 2R92J 1POGA 2WB1N 5GPCA 5BNGA 1PUFA 2M2EA 1UG2A 2XGEA 3GTLJ 2KDZA 1JUMA 1GV2A 1A6IA 2LD5A 2E2JJ 5IP6A 1RR7A 5E3OA 3NARA 3DEWA 2YS9A 4IEJA 5M3FJ 1U9NA 3CCYA 1GT0C 3JRDA 1BW5A 3CDLA 2L7ZA 2COBA 1JTYA 5F0HA 1B8IA 4XRSG 2R5YB 5EGOB 1WH7A 1QPIA 3JRIA 4V2GA 1JUSA 4GFBA 2G0EA 3BQYA 1IDYA 2JJ7A 3HGYA 2EQRA 5M3MJ 2CRGA 3MN2A 2VUMJ 1SANA 3BTJA 3HOYJ 3GTPJ 2XGCA 2LK2A 3BR3A 3RKQA 3G1LA 4UUTA 2JA6J 2GM4A 5IPAA 1X2NA 5EEAA 4MO7A 3A01B 4FCYA 3FK7A 3QPLA 2B63J 5EDNA 2XPWA 3CQZJ 3BTIA 3JRFA 1HDPA 3G1MA 2VKVA 4D7MA 1IG7A 4XRMA 3RZOJ 1XG1A 1RKWA 3BTCA 1FTZA 4D7NA 3LSJA 3A03A 4QSHA 3OIOA 1JJ6C 1LFBA 2DA4A 4BKXA 3O8HA 2N8GA 3SDGA 4BBRJ 2H8RA 5M5XJ 3O8GA 1X2MA 3OSFA 3SJMA 1ETVA 3F0CA 4XIDA 5E3NA 4A3EJ 4BY7J 1Z0XA 3ZQHA 3QQAA 5FKKA 2L7MP 4B1RA 5K7HA 3M4OJ 1HF0A 2ID6A 3GTJJ 4DYRA 1MBJA 1ETOA 4M3DA 1DU0A 1E3OC 2XB5A 3LSGA 1IDZA 3JR9A 4C2MJ 2GBYA 1TWFJ 2IBDA 2E2HJ 4BY1J 4MFEA 2L9RA 1MBFA 2JN6A 2NVTJ 4L5EA 4Y52J 1TWCJ 1IV6A 2DMTA 1AKHB 2XB0X 9ANTA 5IP9J 1QVTA 2TCTA 4A3MJ 2DN0A 1K83J 2XPVA 5FLMJ 4CYCA 4B3AA 4XK4A 3HOUJ 1HDDC 4D5FA 3ZQLA 4I76A 1LE8B 4UUSB 3BG3A 2CQQA 1D5YA 4M3FA 1AU7A 2XRLA 1ETWA 4D5CA 3CMYA 3GBGA 2DMPA 2FD5A 2Y9ZA 2CUFA 5FKOA 3FKIJ 3S1QJ 3Q0UA 2HQ5A 4J19A 1FTTA 4A3GJ 1MNMC 2NS7A 2NOGA 3RQIA 3IV5A 1AHDP 1OCPA 1ETXA 1FJLA 4IHXA 3FIWA 4JYKA 1NK3P 5FLVA 5IOYA 4JX6A 1F43A 2ELKA 2R5ZB 3BR5A 1B72B 4A3BJ 4BBSJ 1BA5A 3I4MJ 2AO9A 2QF7A 1WH5A 1OFCX 5F0CA 1ETQA 4EEFG 2YU9J 2H1KA 2ME6A 5FJ8J 1JGGA 4W97A 5EG0A 2MW8A 5FKNA 1MBKA 2DA6A 4A3LJ 5IYDJ 1TWGJ 3B6CA 1O4XA 3E7LA 5IP7J 1IRZA 2K9QA 2ZB9A 4A3DJ 4ABZA 4QIWN 5F1JA 2EZLA 1NK2P 2LKXA 3ZQIA 2LR8A 1QRYA 1EF4A 3H3VK 3JRBA 1U8BA 3B6AA 1XC5A 2M0CA 1JJ8C 1DU6A 1CQTA 1GDTA 3MVPA 4X6AJ 2MG4A 3ZQFA 1ETKA 3TP0A 3ZOBA 1OCTC 2HOAA 1T56A 1BJZA 1Z77A 2XPUA 3WHCA 1ZGWA 2DA3A 1YRNB 2O9LA 3A02A 2E2IJ 2R93J 3BR2A 2W48A 1WPKA 1ZKGA 3NAUA 2HOSA 2M8GX 1FEXA 2D5VA 1MBGA 5IOZA 2EZKA 4RBOA 3H0GJ 1BL0A 2E19A 4M6VA 2JA8J 1T33A 2JWTA 3BG5A 2DMUA 1B72A 1BW6A 2HYJA 3Q0VA 2NVQJ 2NVYJ 5EZHA 3BTLA 3JRHA 3S1NJ 4IHYA 1RESA 1NTCA 3K2AA 2DA2A 3HEFA 4M3EA 2Y31A 1MSFC 2JK3A 5M5WJ 1JT6A 2OPTA 3GTMJ 3IH4A 3BR0A 2RAEA 2R5YA 5EGOA 2R0QC 2GLOA 2CJJA 1PUFB 1IC8A 1ZQ3P 3UKGA 3TW6A 3S1MJ 2HXOA 4DW6A 2K9NA 5FKMA 1W0TA 3BQZA 1Y1WJ 1FIAA 1A5JA 5IYBJ 3LSPA 3ZQCA 2HDDA 3LSRA 1OJLA 3GTQJ 4DYCA 1HOMA 3QPSA 5C4XJ 1HCRA 1JKOC 5DS9A 3RZDJ 3A01A 5E3LA 5F08A 3FK6A 4DYQA 1JKRC 2ECCA 4A3FJ 2M34A 1IGNA 3LOCA 4HNVA 2Y9YA 1RETA 1G2HA 3S17J 5C44J 1IUFA 1FIPA 4FE7A 1VFCA 2KT0A 2LP0A 2R7ZJ 2P81A 3BR6A 5IYCJ 5F04A 1H8AC 1P7JA 2K40A 1I3QJ 2DA1A 1Q1VA 1UHSA 1MH3A 1QVUA 3PM1A 1IJWC 3FISA 1ENHA 1MBEA 2FJ1A 1SFOJ 2OF7A 5E3MA 5C4JJ 2NS8A 2CU7A 2ECBA 1VF9A 2O7OA 2AHQA 3G1OA 3S2HJ 3WHBA 1MH4A 5J1YA 3HOWJ 3C2BA 1LFUP 2JA7J 2EZIA 3HOXJ 2O8KA 1TWHJ 1VI0A 3MKLA 1WGXA 1RPWA 2HXIA 2ME0A 2VI6A 5C3EJ 1AKHA 4IHWA 4M3BA 4C3HJ 1I6HJ 5K7FA 2Y2ZA 4JX5A 4RDUA 3JREA 1JKPC 1X58A 4DZJA 1ZR4A 3OSGA 3HKZN 3JRAA 3PO2J 5M5YJ 1GVDA 2LLKA 1LE8A 1I50J 4UUSA 3TW7A
chains in the Genus database with same CATH superfamily
2WWYA 4AUXA 3BG7A 4ENNA 1VQ8I 3L09A 4QTRA 3LQRA 2OTLI 2EFWA 4IZZA 1EJ9A 2GIZA 1YOVB 4G7HF 2LRDA 3IH2A 4LGWA 2LTPA 4RAZA 2CQKA 4IXAA 2BGCA 1TT0A 2ID3A 5CPRB 1ZG3A 5CYVA 3G4SI 2JRMA 1TW3A 1R1TA 2B0LA 2F5CA 1IXSB 4CYCB 4A69C 5EZGA 1QQIA 1Y1VJ 3BT9A 2L3DA 4XRSA 5E20A 2R5ZA 4BHPA 4DJAA 4AIJA 1LVKA 4E7HA 1MSEC 3K7AJ 1TQIA 2EPFA 3U1DA 2QM3A 5F0FA 4ESFA 3S16J 2DFHA 2VPRA 1IRXA 2ZSIB 5J8CA 3G73A 3S14J 4BACA 2XAQA 5H2FC 1R5HA 2YUSA 4BH9A 2HYFA 2Z5UA 1FMVA 2DTZA 4YFXF 1JHFA 1JUPA 4XQFA 3L9FA 4C3JJ 1HKSA 1OCRH 2EH3A 3LSKA 5KAIC 1JT0A 2DTRA 3CJRB 1WCMJ 2ZFUA 2EA4A 4HAMA 2E1MC 5GPAA 2CQXA 1O7LA 3NRVA 2A5YB 4NNJA 1P7IA 3K70C 2FOKA 4HA8A 4OMYA 2Y0SN 3DEEA 1PP8F 3KP4A 2IRFG 3S15J 2VC1A 1KYZA 2O0YA 1W7PA 1ZN2A 4GYGA 1JKQC 2LY9A 5EG0B 2PMZN 3W6JB 3DPTA 1YRNA 1IUYA 4G12A 2H6CA 4DZPA 3JRCA 2LSOA 5GP9A 2DXIA 4ZH4F 4AIHA 2F5DA 2VT2A 4OAZA 1RKTA 2KJCA 1ZGAA 3C2HA 1E3PA 3LSTA 1F36A 2EILH 2UV1A 5F27A 2RN7A 1BC7C 4G94A 3H9GA 1O3QA 2V1UA 2E1NA 2XRNA 3TKYA 1OYIA 5LHIA 2FUG2 4IHSA 3PL8A 4N9IA 5E17F 3G6EI 1A6QA 3K2ZA 3TDZC 1F5TA 4XSXF 3BR1A 4NDLA 4WCGA 3BP8A 1VQ5I 5FKLA 3DF8A 4V2FA 4LD5A 2XVCA 4QPQA 1LEAA 4MGRA 4RB3C 2HWVA 4MIMA 3BPXA 1HSTA 2DA7A 1QZEA 1FY7A 1WKMA 3A0HC 4GGGA 1Z1DA 1N77A 1GHCA 2WB1N 3OIQA 5B1BH 2DAOA 5BNGA 1UG2A 1FP2A 4WF2A 1JUMA 3AG4H 3EQLF 1FC3A 5IP6A 4IQ4A 1MKMA 1S29A 5E3OA 3DEWA 1MJ9A 5M3FJ 3H0DA 4HZFA 1HSJA 2CH0A 5J40A 2E34A 2DPDA 4IPAA 4PSWA 5FB2A 3PNVA 3LQQA 2DDBA 2COBA 1Y39A 3KYCB 1E17A 2IJLA 1TBXA 4U88A 2VE9A 4B09A 2BW3A 2FOWA 1XX5A 3ASNH 4XOPA 2Z9OA 2QQBA 3ABLH 2JJ7A 3JTHA 1VQMI 5IT9Z 2CRGA 3MN2A 3BTJA 3K10A 3DBHB 3ZMUA 2E7XA 1X19A 2C6YA 2QSHX 2WAQA 5IPAA 2DT5A 4Q4ZF 3A01B 1HDPA 3CCEI 2CV1A 2VKVA 3WTUC 2QSGX 3FM5A 1FWZA 4RAFA 1XG1A 1QA6A 3WTWC 1FTZA 1ULYA 4D7NA 1U0JA 3HSFA 4XLHA 2XASA 4BKXA 5D8KB 1MIJA 1LB2A 1V3FA 1YO5C 4HRIA 3E6BA 5GADJ 1ETVA 5JR3A 3F0CA 1UHMA 4XIDA 2CW8A 2XSJC 1T0FA 1R36A 3DBLB 3LA3A 3KZIC 4BY7J 1K78B 2BY1A 4WXCA 4NB5A 3OR2C 5FD5A 5FKKA 1N75A 4B1RA 2DO7A 5K7HA 3OYEA 3M4OJ 1HF0A 3GTJJ 1IZ1A 3OWTA 1Z3YA 5D5VB 2D1VA 1IN5A 1ETOA 4M3DA 1DU0A 2BV6A 4LK0F 3CJTB 4CCNA 4AIKA 2G7UA 3SDBA 3JR9A 1XDSA 3FXUA 5TGTA 3PUBA 2L9RA 1Y0UA 2W4SA 3H5AA 3PQJA 4Y52J 3K4LA 2RDPA 2JPCA 1U5TC 1ZLJA 1AKHB 9ANTA 4M9XA 1QVTA 1D8KA 3RCOA 4A3MJ 4I0BA 1IRFA 2W25A 3HRUA 3ZXSA 2HZDA 4PZJA 1JGSA 3HOUJ 3ERMA 3HPHA 5TRDA 2RQQA 4XLCA 2OJED 3CDHA 1J7KA 2HYGD 1V5EA 3CESA 1HXDA 2VBYA 4RAYA 3DU5A 1AU7A 4TV7A 2WA0A 2A07F 2GQQA 1YW7A 4PFOA 3FDYA 3B73A 2B9SA 1GLNA 4D5CA 3CMYA 1SFUA 2COMA 2DMPA 5BPIA 2FD5A 3QAHA 1KU7A 2CUFA 3ZRGA 1MNDA 3SEQA 1CF7B 4J19A 2W85A 4A3GJ 3T8RA 2NXNB 2HFHA 4A2UA 1NH3A 4IHXA 2QZ8A 1BOBA 4JYKA 1NK3P 3I3LA 2ZJRF 2X1CA 5IOYA 4JX6A 4L0YB 2A61A 3FXOA 1KU2A 3MKZA 2K3PA 1UCRA 1B72B 4BBSJ 1BA5A 3KYDB 3ZPLA 1USTA 4QPOA 1MZBA 5F0CA 1ETQA 2V26A 3N4MA 2Q2EB 5D5WB 1G4DA 3CUQA 4BDZA 2CV0A 1AA7A 4UV8A 4GDFA 1R1VA 3OYJA 3ZQ7A 2AS5F 5ICGA 2XC7A 2XF5A 3ZMSA 1WJBA 2CQNA 5IYDJ 1TLHB 2MA3A 5ILSA 4N9HA 1ZRCA 2IA2A 2DFIA 4XKBA 4ABZA 2GOMA 5F1JA 3HKZA 2QWWA 4L5IA 2KKOA 4NBQA 2YSRA 4ENJA 3H3VK 1RUOA 1O57A 4O5VA 3CF5F 3DKYA 1XN7A 3B6AA 1JJ8C 2FBKA 3BZ6A 3LSMA 1CQTA 1YTYA 5DD4A 3KZYA 5HLTA 1YYVA 3GMEA 2MG4A 3F8CA 1ETKA 3TP0A 1S9HA 1X3UA 5EJCA 5HS9A 2CV2A 2XKOA 3GLLA 2XPUA 1EKEA 2DA3A 2RNGA 1R4MB 4G8XA 3LFKA 2W48A 5LGNA 3COAC 1VQOI 1DP7P 3IWZA 5HDKA 1UB9A 2HQAA 4EJTA 1MBGA 3W3CA 4XONA 4LITA 1XGSA 3GO5A 2X0LA 4HOBA 1BL0A 3GFJA 4M6VA 3J7AY 4QWQA 1T33A 2BXYA 1JHHA 4II2A 3C2GA 3BG5A 1EH6A 2IPQX 1KYWA 3KX2A 5KVRA 3M7GA 4OAYA 5BPDA 1ZG1A 2GXAA 1X4PA 3S1NJ 1BR4A 2L9SA 3AL0C 2ESNA 3VDXA 5D5UB 1MMNA 2XROA 3FXLA 4I09A 2Y31A 2O61A 1BI1A 2GA2A 4HV5A 5L3EA 2R5YA 1R5ID 2Q0OA 2XF7A 3FKJA 3B02A 3MMYB 5EGOA 1P92A 1KQ9A 3M1EA 3CCJI 3CP8A 1SFKA 4UVBA 4EGYA 3LA7A 3ML6A 1ZQ3P 1G3WA 4QLCU 3PUFA 3R0JA 3K4MA 4EMSA 4XLEA 2QBYB 5K5RA 1IXRC 5FKMA 1W0TA 3BQZA 3NWTA 3K69A 5IYBJ 2Q1ZB 4L5JA 5HOOA 5JHUA 1X4OA 1OJLA 4G7ZF 3V7RA 3KZZA 3QPSA 4BS9A 5DUIA 1P4AA 1FOWA 2QQ9A 2LG4A 1Q1HA 1W4MA 5E3LA 3GUDA 2ECCA 1IGNA 1FT9A 4L9NA 2XAFA 2Y9YA 2QQ8A 3FF5A 1RETA 3Q9SA 4NQWA 2LMDA 4ZJZA 1F9NA 2LYCA 3IRRA 2LP0A 3VODA 3JCUC 3F23A 2P81A 2R7ZJ 2W24A 5IYCJ 3OYDA 4UB8C 5L3BA 1I3QJ 1Q1VA 3ERED 2DYSH 4XN3A 1IJWC 3FISA 3DU6A 3GZ5A 1ENHA 2EB7A 1LNWA 4RA2A 3JAMZ 3K4JA 3GYHX 2KIMA 2V6CA 2JT1A 2NNNA 3HZJA 2BHYA 2EINH 4CZCA 2E36A 1MH4A 4OU0A 4Y15A 2VL8A 2WB1A 1FSHA 2VLAA 4FX4A 1RI7A 2EZIA 2VQGA 2RREA 4CICA 1D1BA 1TWHJ 3MKLA 1X3WB 1NHAA 1WI9A 1WGXA 3GEZA 4GCVA 3KETA 2HXIA 1FX7A 3L2RA 5C3EJ 4U87A 1L3LA 2Z3YA 2F5FA 2NS0A 3BOQA 3CCSI 3VFZA 2V79A 4JX5A 3JREA 4RDUA 1RC9A 2KPMA 4A0ZA 2M8EA 4IX7A 3V42A 2K85A 3JRAA 1T6SA 5M5YJ 2RGVA 1GVDA 2X1DA 3WGHA 4UUSA 4D0PA 2P7CB 1WI3A 4KT5C 2JMWA 3S1RJ 4IKFA 2LFBA 4XORA 1YQAA 3EUAA 4A3JJ 3F9KA 2R4GA 2WAQN 2DBBA 3BPVA 3I4NJ 4NUBA 3FMRA 4F91B 1VQPI 1DQUA 3BG6A 1K61A 3I59A 1LEBA 2FMLA 3RYRA 2F4MB 1W5CC 3K70D 4HF0A 3VPRA 3BWGA 2XGDA 4Y7NJ 2UWMA 1S7EA 2QKMB 2PJRA 1O3RA 1SD6A 1L0OC 2Z99A 5E8GA 3KLOA 1IN8A 2JZYA 4LOCA 1WJDA 5LFAA 3J81K 4PJLA 1FLIA 2ICWG 3HBLA 3CCQI 3CD6I 2VT3A 2XHKA 2M4KA 1ETYA 3MEXA 2PFBA 5DEQA 3TP3A 5D8LB 3L1PA 1A35A 2ESHA 2IAIA 4BXUA 5E1XA 3HOVJ 1LJ9A 1OCCH 3ESWB 4J00A 3SFIA 4X1EA 3GXOA 2BVLA 2IGMA 4ENKA 1O7FA 4M9ZA 3BG9A 2DOEA 4ZZLA 5L3CA 2E60A 3V8KA 1RIOH 4B3XA 2HVRA 1T95A 2EIMH 2D45A 2R7OA 1I5ZA 4A3IJ 3KP6A 2OQRA 1GUUA 2E1OA 1S7AA 1OISA 3E5XA 2X48A 2RV8A 4YIRX 4I01A 1BM9A 2BVMA 3AFHA 2HKOA 2O3FA 4A93J 1STZA 3OOUA 3IH3A 2R7DA 3TO6A 3VOEA 2QYOA 2W57A 1K6OA 3QP6A 2JRTA 1H88C 3HM5A 4JP0A 4CCKA 5DTDA 3JTGA 3CZ6A 2DK5A 3L2VA 2ZO4A 4S04A 2Y30A 4YFKF 5A2QK 2I8DA 5J1RA 1FBUA 1J2XA 2K9SA 1WJ5A 3OOPA 4EVIA 2BZTA 3F8FA 3HSEA 3IAM2 2EZHA 1SAXA 4MHGA 1DGWY 2Y69H 4U7DA 3PO3J 3HHHA 3MKYB 4GXOA 2HVQA 3R6SA 1ON1A 1QHGA 2JSCA 4IHVA 3GTKJ 1G6NA 2CFXA 4IRIA 3C3WA 2VXZA 1VQNI 4HX8A 2FBIA 4A3CJ 5AONA 3CO7C 3HDDA 3S2DJ 2HOTA 1U78A 4MLOA 2DA5A 3SZPA 5F64A 3WG7H 4D1QA 4S0HB 3IC7A 3MQ0A 1ZLKA 3TEDA 5H6RA 3HGGA 3JW4A 4Y4RA 5EF6A 4XRFA 1KU9A 1FP1D 5FGMA 3DTEA 2ZJQF 4PUSA 2FQ3A 6PAXA 3D5LA 1BN5A 1XGOA 2DQRA 3RQ4A 4BE1A 1PUFA 1Y8RB 2XGEA 1HW5A 3RJPA 2KDZA 1WJAA 4XLNF 3I9V2 2LD5A 1J9IA 1ZREA 2KIQA 2VIXA 1PYVA 1W36C 1I1SA 3CCLI 3GZ6A 3E5QA 4RM3A 4IHTA 5DCMA 2STWA 1EH8A 5JHFA 3CCYA 2O03A 1KU3A 2ZC2A 4BJ6C 4X0GA 3EUKL 4YRVA 2KZGA 2FEZA 4L9TA 3C18A 2RQPA 4BJTA 4LB5A 1P6RA 3G71I 2ADUA 2CFOA 3JRIA 2R7FA 1R6RA 4UHTA 4GFBA 2LBFB 1IDYA 3L2WA 2VBXA 4CDGA 3ZR8X 2VUMJ 3SXYA 3HOYJ 3RTRA 2XGCA 4BQQA 2V1NA 2DFFA 2F4IA 3OYLA 1TTYA 2GA1A 3IHUA 5K5OA 2JA6J 1ZELA 4MO7A 2CO5A 4FCYA 1EA3A 3QPLA 1JI8A 3BTIA 2K7LA 5E79C 4CCOA 3TOBA 1IG7A 2IS6A 2DI3A 4LB6B 3H9JA 1X1BA 2OV7A 4G6TB 3ZMTA 4QSHA 3J80Z 4LG0B 4HG2A 1FYMA 2ZCWA 4E7KA 5JI6A 1V5FA 1UELB 4EATA 1LQ1A 2DK8A 2EWNA 4LLGF 2N8GA 1WJEA 1KQ0A 4KIGA 4BBRJ 5M5XJ 5KCMA 2VQLA 1X2MA 1D3YA 1Z67A 3O8GA 2A6TA 4IL6C 2UUZA 3Q5FA 3T8TA 2QVOA 3QQAA 4Q47A 4A6DA 3BCAA 2CS3A 1OMIA 1MJAA 3U9GA 2E1CA 2HTJA 2MD0A 4DBQA 2VE8A 1J09A 2JTVA 2HU9A 2QUFA 1HC8A 1IDZA 2GBYA 2ZMEB 2LF7A 4BY1J 2VONA 2JN6A 2M45A 5HDNA 4L5EA 1SVLA 2PG4A 3LMMA 1E3HA 1XCBA 2H09A 3OYAA 5CQGA 2TCTA 1FZPB 3WTZA 4EGZA 1B1BA 1BI0A 2DN0A 2JUCA 1K83J 2AXLA 4Z2YA 2KRCA 2P8TA 3HRMA 1S72I 1I1GA 1Z7UA 3S3MA 5DYMA 4PJMA 1OLTA 2IS4A 1YLFA 4BAYA 1G3TA 1XB4A 3VWBA 2BHZA 1YFHA 5DD8A 2CGPA 3H9QA 4M72A 1R71A 3TDUC 2STTA 4C9YA 2DYRH 2FF4A 1ETWA 2L9VA 2XDVA 4RB0A 4C2TA 5B5EC 2EA2A 3GBGA 2DPUA 3KEYA 3Q0UA 2QGUA 3M8FA 4XKCA 3RQIA 4CO8A 1DUXC 1AWCA 5LD2C 1ETXA 2XV4S 2EFNA 1D1CA 4HLYA 1W5SA 3QYBA 4HQMA 3LSHA 2ELKA 2R5ZB 3ZMDA 4BE2A 5L3DA 2PLYA 2ZNZA 2QF7A 3WE3A 3CCVI 3K4KA 1QZYA 4BYYA 1WH5A 4UVCA 4HF2A 3ZQQA 3RIRA 2H1KA 2F5EA 2YX7A 5ICEA 5FJ8J 2Z16A 5KHDA 5F1RA 3WGGA 2NNYA 1LDKB 2JSPA 5FKNA 3CC2I 2X6YA 3H3UA 1U5TA 4RGXA 2TDXA 3FXRA 3R60A 1QGPA 5B3SH 5IP7J 2IA0A 1IRZA 2KL4A 1HBXG 1P4XA 4R79A 2OZUA 4G9YA 2CW0F 4HW0A 3ZQIA 3T5XA 3GZNB 2VASA 1XPXA 1EF4A 1R1UA 2DLLA 5IT3A 3L2UA 2M1BA 3CCUI 1OR7A 1DU6A 4XNFA 5LEKA 4HPQA 4BHCA 1W7PB 4X6AJ 4PSXA 4ZZDA 3TBIA 1OCTC 2VBWA 3ABKH 1YRNB 1BJZA 4BGDA 2ISYA 3WE2A 2KRHA 2JUGA 5D4SA 4YFNF 3FBNB 2J5OA 1QNTA 1ZKGA 2WADA 1RR8C 2IS1A 1FEXA 2FNAA 1FYLA 4GRIA 3H5RA 1VQ6I 4XKWA 4HV6A 3ZN0A 3SYTA 4UUVA 1WWXA 1Z91A 1J5YA 1P2FA 1Z6RA 2KQRA 2CQ7A 2R7RA 2JWTA 2KRFA 3DQVC 4RB2C 1B72A 1BW6A 2K3FA 3K4BA 2R7UA 1ZGJA 1IV8A 4EJVA 1DDNA 4KN4X 1K4SA 4M71A 1HW1A 2Q2EA 2VJJA 2PX9A 5EEGA 2ZXWH 5J8FA 1R49A 1ACIA 3F6VA 4HLXA 3HEFA 1I3AA 4M3EA 1VQKI 3L2CA 3KE2A 3PSFA 1UFMA 1VQLI 2XUBA 1JT6A 3F8MA 3GW2A 3W6KB 1G59A 3GTMJ 1XDUA 4PGHA 4A6EA 2KP6A 1V5GA 1QZZA 1E0EA 3WTTC 4E7ZA 4BQNA 5TISC 1G8XA 1VQ7I 1PDNC 4HX7A 1SD4A 2X85A 3K0LA 3F8BA 5GAEJ 4AM3A 2WTEA 3DBRB 4DW6A 4IRGA 1EV7A 1FSEA 1Y1WJ 2OZ6A 1FIAA 1T39A 4XBFA 3FM3A 1ON2A 3O3KA 2V1XA 3FXQA 3LSRA 1S5LC 1YHQI 1TT5B 4IRHA 4A5NA 1HCRA 2OBPA 5C4XJ 2PMUA 1OR7C 2HS5A 2QA4I 1K7AA 2P5KA 2VC0A 1JKRC 1J0RA 2M34A 3LOCA 5HNFA 3S17J 5C44J 2M4GA 2BW3B 5LHHA 3E0JB 2XKPA 3OS2A 3H35A 3R0AA 4OOIA 1B9MA 4Y3OA 5F04A 2Z33A 5B66C 1H8AC 1BC8C 2A68F 1UHSA 2AXTC 4S05A 4IJAA 4BQOA 3QWLA 3FXKA 1LDJA 4XL9A 2MLGA 1KGSA 4ENMA 3X2QH 2M30A 5C4JJ 4NC8A 4WXDA 4LIVA 2WY8Q 4CH7A 4BU2A 2ECBA 3RSNA 2P5LC 1VF9A 2O7OA 2AHQA 2OUMA 3HYIA 5J1YA 1UZCA 5D6FA 4CHUA 5FFXA 4PJ0C 3HOWJ 1OKRA 2O8KA 1VI0A 2DOAA 2KMUA 3FMSA 3HG9A 1XMKA 1ERDA 1EH7A 3WGIA 4BEHA 1RPWA 4HEA2 2GIVA 3MZHA 3VSKA 4JQFA 4G7OF 2YX4A 4P9FA 4ZTJA 3GFIA 2DFEA 4HX4A 1WHUA 4ZDLA 4M3BA 4IHWA 5K7FA 3CDIA 4HYEA 1JKPC 1I39A 3LL7A 4DZJA 4PCQA 3EPZA 5KNLA 5CVUA 1SFEA 2BY2A 2FNPA 2ETHA 1O3TA 4KNYA 3HOTA 3V8JA 1LE8A 1I50J 4OIRF 3TW7A 4N0BA 5H20A 1XGNA 5IY5H 3AG2H 3GWZA 1SVOA 3C1DA 4BXFA 1TWAJ 3CLQA 4UVAA 4Y33A 3OYHA 2FRHA 3F21A 1XS9A 2K5CA 5BS6A 1T38A 5KK1A 4H4KC 3ROUA 3KPHA 1ZR2A 2M3AA 3OV8A 1R00A 3D0SA 4CYDA 3MKWB 2R7VA 3C7JA 1XMAA 2MYSA 4MEXF 3UNGC 3DKWA 1TZLA 4A0YA 1MBHA 1RRJA 4FE4A 5FFZA 3TMOA 4EQQA 3F6OA 1UMQA 3FMQA 1W0UA 1B9NA 2OA4A 1VNDA 5GTIC 4MNUA 4I6ZA 3S93A 2CUEA 2IW5A 3BJOA 3E97A 3W6VA 2TRTA 3GTOJ 2NAZA 3KYLA 3CCMI 1YITI 1SD5A 4PK4A 4LLNA 2VKEA 2HI3A 1SAUA 2PQ8A 3Q3SA 3QYEA 3OYGA 2HTSA 5HDGA 5BQTA 2XSDC 5LRSA 3DLAA 4CGZA 4AWXB 4ZYEA 4IF4A 5FROA 3F22A 1Y0NA 1O3SA 3P9IA 2LDUA 4PGGA 1XCVA 3NWSA 2V7FA 3BLYA 1YJWI 2MC4A 4FQGA 1DPRA 3CF2A 2ZBKA 3CP2A 2L7FP 3CUQB 4W1UA 5CVRA 3GFLA 3HUGA 1X1AA 1B8IB 2UZKA 3HB9A 3WU1B 4MQ9F 1K79A 3IL2A 5JLWA 4C3IJ 2ZXIA 3LFUA 1IF1A 1YS7A 3SQNA 2VKDA 2IVMA 4BUPA 2W7NA 1FBQA 1X3ZB 2EV5A 5HODA 2A6EF 1D8JA 5DUKA 4RM2A 4G6DA 1UJ8A 2WV1A 1W36D 5CLSA 4F3QA 3DFGA 1B59A 2FQ4A 2BY3A 2IEKA 4ANJA 5D6EA 2DMQA 3K6GA 1H9GA 4L9JA 5EYRA 1KONA 2X9DA 2E71A 1JXSA 3PFIA 1J59A 5FO5A 4BXXJ 3U2RA 4JX4A 5ED4A 2IGNA 5F6FA 2LNBA 2KJBA 5E1WA 3H1CA 1B4AA 1LPQA 4KUMA 3DKXA 3V7CA 2R92J 1POGA 1X1CA 5GPCA 3BCBA 2MABA 4ZDOA 2CSOA 2M2EA 3ASOH 4MTEA 4ZYHA 3KP2A 3L7WA 1GV2A 4F7ZA 4KYWA 1A6IA 1TQMA 3ULQB 1XSVA 1RR7A 3NARA 4FT8A 5LBQA 5FLXK 2VQCA 1U9NA 2DW4A 5DM6F 3J7ZI 1GT0C 4KN7X 4AIDA 3JRDA 2HEOA 1BW5A 3I58A 1P9QC 4IO9F 3I53A 1U2WA 5F0HA 2HR3A 2F5VA 3CC7I 2FMYA 2R5YB 5HLGA 3GCMA 5EGOB 1XSDA 1I6XA 1MW7A 3E3VA 3DP7A 1T2KA 2PEXA 3MZYA 2G0EA 3BQYA 4YIFA 1U8RA 4M6YA 1DP3A 5H6QA 3HGYA 1RZ4A 2X4HA 2EQRA 1DGRM 1TNSA 4BE0A 5M3MJ 1BOAA 2OU2A 3TO7A 4P96A 3PFYA 3HJEA 3GTPJ 3TL4X 1T8IA 2LK2A 2GM4A 1Z21A 4XMYA 2VJIA 2OC6A 1IN4A 2K9LA 5EDNA 2B63J 2XPWA 3CQZJ 2V9VA 3MWMA 4D7MA 5GAGJ 3LAPA 4XRMA 3M9AA 3BTCA 1RKWA 4NQWB 4EM0B 3A0BC 1PJRA 3WU2C 1F4KA 5TJJA 3LSJA 3A03A 4E7SA 3I54A 3O2PE 5J4YA 1JJ6C 1ZAOA 1LFBA 2DA4A 1WFXA 2ELHA 5E1ZB 3O8HA 3SDGA 5ICFA 3OYIA 3HRSA 3W2VA 2H8RA 2W82A 5ICCA 1YIJI 3FWEA 4HDVA 3OSFA 3P9CA 2ZJPF 3SEZA 4HNTA 1JE8A 5E3NA 1RUNA 2M7BA 5ILUA 1D0ZA 4AYBA 1OQYA 2MLKA 3DWLE 3ZQHA 4V19K 1MDMB 2L7MP 1YW9A 2LREA 2ID6A 4DOZA 3LAJA 2V1DA 3LSGA 2V6EA 4WK8F 4P55A 3V4GA 1BBYA 2IBDA 2E2HJ 3QYFA 3BJAA 5CJ9A 4UV9A 2NVTJ 2X1EA 5EEHA 2PMHA 1TWCJ 2LBFA 1S8NA 2BXZA 2VOOA 5IP9J 3IKTA 3OL4A 2VQHA 1MJBA 1YW8A 5L3FA 3OS0A 3E6MA 2O6GE 4EJOA 4KFCA 2NYXA 4CYCA 2L02A 1R5GA 4RS8A 2E7WA 4D5FA 2JQ7A 3LA2A 1B6AA 3OR1C 1UAAA 4K2EA 2DU9A 4BJ5C 4UUSB 3CJNA 2ZKZA 2WAEA 2F4OB 1U6GA 2XRLA 4KJZA 2CUJA 4DGWB 3RKXA 4UNOA 2GOXB 2MH2A 4DBRA 3S32A 2Y9ZA 3CC4I 1IN7A 4ASNA 3S1QJ 4IOAF 2PN6A 4Y13A 2R7TA 4ETSA 3I59B 3TOAA 1MNMC 4B48A 3MAJA 3IV5A 1AHDP 1TP4A 1FJLA 3E1SA 3FIWA 1KQ8A 1LUJB 2CYYA 5FLVA 3DTKA 3AKZA 2K4JA 5CVJA 4ESJA 1S7OA 1IXCA 1Z9CA 4RGSA 4EEFG 3OYNA 4KISA 2X6WA 1YIOA 3M8JA 4BL0B 5FRNA 2Y48A 2EV0A 3OL3A 4KICA 2V9PA 4F92B 2ZMEA 5EG0A 1MD0A 4E70A 1MBKA 1MMGA 1XMXA 2FBHA 4ON0A 3QODA 3B6CA 3E7LA 2MC3A 2ZB9A 1XSXA 4A3DJ 4QIWN 3N05A 1NK2P 2FA5A 2LKXA 1DPUA 2KZVA 1QRYA 1QHHD 2JA2A 3DEUA 1X1DA 2H8WA 4HQEA 3G3ZA 1U8BA 2EK5A 1T98A 4Z6YA 1LKXA 4CZZA 1MMSA 4I99C 3J81Z 4NC6A 4XM3A 1GDTA 4CUGA 3MVPA 3ZMVA 3CMAI 1Y8QB 2VJ5A 1MGTA 2P7VB 3ZQFA 1SEUA 2HOAA 3FXMA 1T56A 4OIQF 3WHCA 3EDPA 1ZGWA 2MD5A 4CCMA 2E2IJ 3R4KA 2R93J 2LKPA 1WPKA 3NAUA 3ONQA 2HOSA 3TQNA 2M8GX 2EFPA 1BR2A 3WTXC 2D5VA 4O3MA 5IOZA 3H0GJ 3AG1H 3I0TA 4AD9A 1V55H 1VQ4I 2D2WA 1FNNA 5GTHC 4BDYA 4U0VA 2RVCA 5IT9K 2CW7A 2K9MA 3ZN1A 3JRHA 3IWFA 4IHYA 1BR1A 4KT6A 3K2AA 2DA2A 1YJ9I 4I02A 1Y56A 2KLOA 3A2KA 5A2QZ 2EV6A 2F6CA 4WX9A 1MSFC 4D9JA 2JK3A 1BI3A 5M5WJ 3V8LA 3PJRA 5FRMA 3HTUA 3PNYA 4E7LA 3IH4A 2ZNYA 2ZMEC 3RPQA 2IS2A 2W00A 2R0QC 2GLOA 4IOCF 2CJJA 1WJFA 2R7WA 2GXBA 1AOYA 2E1MB 1PUFB 1Z3XA 4MTDA 1C0WA 4GYIA 1PP7U 3ZCOA 4EV0A 1FOYA 3EYYA 3MD2A 1Y6IA 2L9NA 3TW6A 3S1MJ 2RC4A 4M6XA 3KLNA 4A0XA 2K9NA 5DCMB 3LSPA 1ZHFA 2JVHA 1QU3A 4M9SA 1QBJA 3IP4B 3VB2A 3GTQJ 3PIPF 3H3ZA 3QP5A 3FHZA 2HNHA 2VOPA 4XOTA 1YS6A 1D1AA 2HQRA 3WTYC 3RZDJ 3A01A 1K4TA 3CUOA 2DDAA 1LDDA 2IXSA 4DYQA 4H0EA 4A3FJ 3HTSB 4HNVA 5KAFC 2ACJA 4LMYA 1VFCA 1ZARA 2KT0A 1IAWA 2ZJ2A 3FBIB 2PI0A 3CO6C 2DQLA 1P7JA 3F3XA 4UXNA 1F1ZA 2K40A 2QLZA 3OMYA 3PM1A 1QVUA 4LK1F 1NG6A 1ZRFA 2K02A 2CMPA 2VBZA 3HPGA 3I71A 1MBEA 2FJ1A 3N97A 2VODA 2FU4A 4A5MA 1K78A 4KMUX 5CVIA 2NS8A 3K1PA 2FXAA 1CGPA 2A6HF 4XLPF 2Y75A 2LC2A 3S2HJ 1XD7A 3HRTA 3E6CC 1WZ2A 2KIFA 1FMWA 3P7NA 2JA7J 2HGCA 1ONVA 4IQJA 5CVVA 1HKTA 4JK1X 4KIFA 4WXHA 2ME0A 2VI6A 5E18F 1AKHA 1ZRDA 2XIGA 3FZVA 4ZYAA 1I6HJ 3EYIA 5B1AH 2Y2ZA 3BY6A 4Y17A 3WTVC 1ZR4A 2EIJH 3OYMA 3V7SA 3OSGA 2H1LA 4WWCA 3P9KA 3PO2J 4CXFA 3REOA 2H27A 3RPUD 3PQKA 1TQPA 3S8PA 3WTSC 3Q0WA 4FTHA 5J3LA 4FETA 3ECHA 2L0KA 2X6OA 3MZ8A 4ZYDA 1HW2A 4RGUA 2Z1DA 1YJNI 3HOSA 1U9OA 3SHFA 2LF8A 2V9KA 3IRQA 1REPC 1ZTRA 2M0MA 1CF7A 1R9TJ 5K7ZA 1R23A 2NVXJ 2MGQA 4J01A 4HBLA 3GFMA 2HPIA 3ISPA 3LNQA 3PSIA 4YG2F 2FX0A 3M3YJ 1H9TA 3DPLC 1N78A 1WSUA 3KFWX 2NRAC 4B4CA 3KCCA 4E7JA 1GXQA 1ZYRF 1GV5A 1HLVA 2VXDA 1R7JA 5HLIA 2RNJA 2A05A 3TGNA 2P6TA 5JLXA 2X6XA 1IO2A 3DCFA 4KIBA 4R1HA 4AYBN 4AC0A 4PDKA 3LSIA 1SFXA 3W2WA 4OMZA 2WC2A 4XICA 3J7AO 3GTGJ 2VJ4A 1BJAA 4M3GA 2L01A 5J1UA 3A4CA 4F55A 3WU0A 5ERIA 2LY2A 4A3KJ 3JRGA 2I10A 1BIBA 2GAUA 1S6LA 2H94A 1TL8A 1H89C 2GZWA 4OIPF 1Z05A 3M07A 1HQCA 2HQNA 1A04A 1JTXA 2W1OA 3EETA 4U0WA 2AQEA 3HOZJ 4FISA 2HPMA 2EBIA 2G9WA 3DLLF 2DJNA 1ZK8A 4U0YA 1OYYA 5JFRA 1APLC 1IRGA 1D0YA 2K86A 4LIUA 3DXJF 2K27A 1ZG5A 2YPRA 4DIQA 1U5TB 3CCRI 4M74A 1YI2I 1MNEA 1V54H 2KHMA 3SZTA 4E4HA 4ZTFA 2QCOA 2M7AA 2BE5F 3CMMA 2FSWA 2RKHA 2LVSA 2LKSA 1NG7A 2XGXA 3P5JA 2MBFA 2M9HA 4CCJA 2MSYA 1USSA 5LGTA 2F2EA 4RMNA 1WRJA 2E5ZA 4MEYF 1BIAA 2L4AA 4BNCA 2L5QA 3GF2A 2DMNA 2WV0A 4RGRA 3ZQGA 3RPUA 4AU7A 3D1NI 4FHTA 1ORKA 4MFDA 1SC7A 2JA5J 2K4BA 4P5OA 5LGUA 1TC3C 4UB6C 3R61A 1ITYA 2PBIA 4HDUA 1SMYF 2XAHA 5DM7F 3S3OA 4DQ2A 2CWEA 3FHNA 3K1MA 3OIPA 3DTIA 3GTLJ 1YX3A 3M1CA 3FX3A 2QBYA 3NQOA 2E2JJ 5HVQC 1OCOH 2ZSHB 5BOXA 3D5RC 1SMTA 3T0YA 2OD5A 1T0FC 2YS9A 4IEJA 1QPMA 4PFPA 4XLFA 3E6DA 4CA0A 3K4NA 4UY8I 4A12A 2KISA 3OS1A 2DT7B 3CDLA 2L7ZA 1H0MA 3JAMK 3JSOA 2P5VA 1JTYA 2DJIA 3OYBA 4R8HA 1ZH5A 4ZYGA 1B8IA 2R7SA 2OTJI 1G3SA 4XRSG 3I5UA 3QOPA 1WH7A 1QPIA 4FASD 2P0WA 3TO9A 4V2GA 1JUSA 3Q9VA 4L0ZB 3KP5A 4NC7A 4HSTA 3KEQA 3OYKA 1TW2A 1RNLA 2HVSA 4N4OB 3ECOA 3H36A 4Q48A 1OCZH 4HF1A 1SANA 2UXXA 2R7QA 3BR3A 3RKQA 3G1LA 4UUTA 3QPTA 1T08B 5E8IA 2DT6A 1X2NA 3BZCA 5EEAA 3CLOA 4I7HA 3FK7A 2EFQA 2DODA 3IUOA 2H6BA 3VYTB 2XAGA 2ELJA 3HSRA 3QU3A 1S3JA 3J7YJ 3JRFA 3G1MA 2G7HA 3RZOJ 2GWRA 2IA1A 1E2XA 2QENA 4P9UA 4EM1A 2A3SA 3ZMZA 3BROA 3A1YA 1PVEA 3WG9A 3OIOA 3BJ6A 4JOMA 4XKVA 1W5TA 2BEOA 4AVZA 4CSWA 3I64A 2VPLA 2IGKA 2D1HA 1KZHA 4HNUA 2X51A 4B43A 3AAFA 3SJMA 5AIQA 5K5QA 4LJZF 5AIPA 2EJRA 3AL0B 4A3EJ 1Z0XA 2LY1A 3CTAA 3U1KA 3NEUA 4I0AA 3IKVA 1G3YA 3EUHA 1HA8A 2BYVE 1X1PA 1MBJA 4DYRA 2ISZA 1E3OC 3UR3C 2XB5A 2JPBA 1FOXA 3CUQC 3G2BA 2MH9A 4C2MJ 1TWFJ 3L2QA 3SZGA 4MFEA 1MBFA 3KEOA 4XR6A 3MCZA 4BEHB 4KITB 1I27A 5LEJA 1XTAA 1IV6A 4RB1A 2DMTA 2OAZA 2XB0X 2Y0SA 4NHJA 1R58A 1Z7LA 2XPVA 2OCEA 3MFKA 5FLMJ 1YG2A 3E5UA 4B47A 4B3AA 4XK4A 2PMZA 2O8XA 3RKYA 1HDDC 4ESBA 3ZQLA 4II3A 3SFZA 2LH9A 4I76A 2R3SA 1LE8B 2EFOA 5JVGF 3BG3A 4YEJA 4L9VA 2CQQA 1WQ2A 3ZP5A 2J5PA 3VYUB 1D5YA 3ABMH 3ABUA 1HKQA 4JBAA 4M3FA 2LOOA 1ODDA 1SD7A 3CMEI 4B8XA 3OYFA 2M87A 4RLQA 4BHBA 2XAJA 4XSZF 3HC7A 3VYRB 5FKOA 2W84A 3FKIJ 3QRFF 2HOEA 3H5NA 2HQ5A 1FTTA 2NS7A 2YR2A 4EJWA 3H92A 1WJCA 2NOGA 3AG3H 2A5WA 1OCPA 3DV8A 1A36A 4G6QA 2HZTA 5LLQA 4YELA 5JVTA 1F43A 3KIOA 3IAS2 3BR5A 3RKWA 4A3BJ 4YIIA 3I4MJ 1GVJA 2VN2A 2AO9A 1IW7F 2I5UA 1MDMA 1BI2A 3GVAA 5J47A 1OFCX 3S2WA 2MFZA 2YU9J 2YU3A 2ME6A 4I98B 2Q8KA 3GX4X 1A31A 1JGGA 1W1WE 4W97A 2UXNA 3QPHA 2OCCH 3EUHC 5HLHA 1SVMA 2HKXA 1OPCA 2MW8A 5J6XA 2ZXJA 2F48A 2DCEA 3U21A 2DA6A 1TNTA 4A3LJ 4O6JA 1TWGJ 1O4XA 2BY0A 3GLXA 2K9QA 5D4RA 2EZLA 2LR8A 3BDDA 2V4JC 3JRBA 4OWRB 3QOEA 2XF6A 5GAHJ 4EJUA 1Z6TA 4CCLA 1XC5A 2M0CA 2L54A 5HS7A 4OIOF 2A69F 3FXJA 4MQVA 4KDPA 2M5WA 2P4WA 3VSLA 5CKTA 1M1EB 1U3EM 2CUZA 5DDGA 3ZOBA 3HUGB 1Z77A 2DOFA 1VQ9I 2O9LA 3HXLA 4I2OA 2L2OA 3A02A 3BR2A 1YE9A 5ILVA 3VYSB 2Y0MA 2P6SA 4ZC3A 2L4MA 4LLLA 2BBYA 2BOLA 1D0XA 2WAFA 3F8NA 4LG3A 3K4CA 3L00A 4E7IA 1LVAA 2EZKA 4RBOA 2IT0A 1MMAA 2CG4A 4P1WA 1UHWA 2E19A 3OYCA 2JA8J 4XN0A 5K1YA 4LFUA 2ZXHA 2L7KA 3BC8A 3KP3A 1WVRA 4F93B 1YX5A 1D5VA 2DMUA 2NVUB 5CQEA 2HYJA 3BZKA 3Q0VA 4PJNA 3RDIA 2NVQJ 3I4PA 2NVYJ 5EZHA 3BTLA 4C2UA 1RESA 1NTCA 5HS8A 2QQAA 2EIKH 1FYKA 2O5RA 2VKHA 2R7XA 3T1BA 3W2AA 3I55I 1R4NB 4F52A 1PUEE 2OPTA 5HNHA 3HIFA 1QO0D 2KDOA 3PIOF 3BR0A 2RAEA 1P4WA 2IP2A 5LHGA 2WBMA 5L3GA 1IC8A 4IVNA 5DV5A 1J75A 4OINF 3D5SC 3J80K 3K1NA 3UKGA 4U7BA 2HXOA 3KP7A 1A5JA 2ZFWA 4ZDPA 3HL2A 1GXPA 3ZQCA 2HDDA 3QU6A 1VZ0A 5FD6A 4DYCA 2AQFA 4KMFA 1HOMA 2QSFX 1JKOC 1UG0A 5DS9A 5BMZA 2IGOA 5F08A 3FK6A 4EM2A 3RI4A 5J4VA 3F72A 3O6BB 1G2HA 3ABTA 1IUFA 3M8EA 2HDCA 3DPUA 1FIPA 1KA8A 5LRRA 1V4RA 3I56I 2QKLB 4FE7A 4L18B 2JVGA 4AVPA 2WY7Q 4LG0A 3BR6A 3S3NA 1LFPA 5DCFA 1N25A 2KFDA 5FLXZ 4M73A 2DA1A 2Z2SB 2FE3A 1MH3A 4PJJA 2NOJB 4C30A 3LWFA 3ELKA 1FOKA 2E5NA 3RYPA 1VTNC 5D5XB 1SFOJ 2OF7A 5E3MA 2PJRB 3PNTA 2CU7A 2HDWA 3HHGA 1W7PD 4DNCA 3G1OA 3WHBA 1K6YA 4RLFA 3ZGKA 2OQGA 3C2BA 1IN6A 1LFUP 3HOXJ 3CJQB 2KIUA 2QEXI 1R22A 4XLAA 1MMDA 4RAGA 4Q5SF 4KA4A 2XAUA 4E6KG 2B7EA 4HSRA 3JSPA 4C3HJ 3OY9A 1X58A 1XGMA 4N4NB 2PJPA 1FBSA 3K9TA 4FX0A 3HKZN 2VB6A 2GXGA 3VEPA 2E35A 1FPQA 4B44A 3WODF 2LLKA 4BQAA 1OYWA 4ITVA 4GO1A
chains in the Genus database with same CATH topology
1WI3A 2JMWA 3Q0WA 4AUXA 4FTHA 3S1RJ 2LFBA 5J3LA 4A3JJ 2L0KA 2X6OA 4QTRA 2WAQN 1TWAJ 1U9OA 3I4NJ 3IH2A 1XS9A 2LTPA 1ZTRA 2ID3A 5K7ZA 1R9TJ 1K61A 2NVXJ 2MGQA 1ZR2A 4CYCB 3LNQA 4A69C 5EZGA 1Y1VJ 3BT9A 2FX0A 3VPRA 3M3YJ 4XRSA 2XGDA 4Y7NJ 1S7EA 2R5ZA 1MBHA 4B4CA 4FE4A 1UMQA 1W0UA 1MSEC 1GV5A 1HLVA 4LOCA 1VNDA 3K7AJ 4I6ZA 2CUEA 5F0FA 5JLXA 3HBLA 2VPRA 3S16J 3DCFA 3W6VA 2TRTA 3GTOJ 3S14J 4AYBN 1ETYA 3TP3A 3L1PA 4AC0A 2YUSA 3HOVJ 2IAIA 2DTZA 1JUPA 2VKEA 3SFIA 4X1EA 4XICA 2HI3A 3Q3SA 3GTGJ 4C3JJ 4M3GA 2EH3A 2XSDC 1JT0A 5J1UA 1WCMJ 3BG9A 4A3KJ 5GPAA 2CQXA 2I10A 3JRGA 4A3IJ 1P7IA 1H89C 1GUUA 2E1OA 2X48A 2Y0SN 1JTXA 3HOZJ 3S15J 4FISA 2L7FP 4W1UA 2EBIA 4A93J 3OOUA 2DJNA 1ZK8A 3IH3A 1JKQC 1APLC 2LY9A 5EG0B 2PMZN 1H88C 1YRNA 3HM5A 4JP0A 4G12A 4DZPA 5DTDA 3JRCA 1B8IB 5GP9A 3HB9A 2Y30A 5JLWA 4C3IJ 2QCOA 5J1RA 1RKTA 2K9SA 2LVSA 1F36A 5F27A 2EZHA 5HODA 3PO3J 2WV1A 2M9HA 2MSYA 4IHVA 3GTKJ 4A3CJ 2FQ4A 2DMNA 2IEKA 3BR1A 4NDLA 3ZQGA 3HDDA 2DMQA 2HOTA 3S2DJ 5FKLA 1U78A 4MLOA 5EYRA 3D1NI 2DA5A 4V2FA 1ORKA 2X9DA 4MFDA 2JA5J 4S0HB 4BXXJ 3TEDA 1TC3C 3HGGA 4JX4A 1ITYA 4MIMA 5EF6A 2DA7A 2R92J 1POGA 2WB1N 5GPCA 5BNGA 1PUFA 2M2EA 1UG2A 2XGEA 3GTLJ 2KDZA 1JUMA 1GV2A 1A6IA 2LD5A 2E2JJ 5IP6A 1RR7A 5E3OA 3NARA 3DEWA 2YS9A 4IEJA 5M3FJ 1U9NA 3CCYA 1GT0C 3JRDA 1BW5A 3CDLA 2L7ZA 2COBA 1JTYA 5F0HA 1B8IA 4XRSG 2R5YB 5EGOB 1WH7A 1QPIA 3JRIA 4V2GA 1JUSA 4GFBA 2G0EA 3BQYA 1IDYA 2JJ7A 3HGYA 2EQRA 5M3MJ 2CRGA 3MN2A 2VUMJ 1SANA 3BTJA 3HOYJ 3GTPJ 2XGCA 2LK2A 3BR3A 3RKQA 3G1LA 4UUTA 2JA6J 2GM4A 5IPAA 1X2NA 5EEAA 4MO7A 3A01B 4FCYA 3FK7A 3QPLA 2B63J 5EDNA 2XPWA 3CQZJ 3BTIA 3JRFA 1HDPA 3G1MA 2VKVA 4D7MA 1IG7A 4XRMA 3RZOJ 1XG1A 1RKWA 3BTCA 1FTZA 4D7NA 3LSJA 3A03A 4QSHA 3OIOA 1JJ6C 1LFBA 2DA4A 4BKXA 3O8HA 2N8GA 3SDGA 4BBRJ 2H8RA 5M5XJ 3O8GA 1X2MA 3OSFA 3SJMA 1ETVA 3F0CA 4XIDA 5E3NA 4A3EJ 4BY7J 1Z0XA 3ZQHA 3QQAA 5FKKA 2L7MP 4B1RA 5K7HA 3M4OJ 1HF0A 2ID6A 3GTJJ 4DYRA 1MBJA 1ETOA 4M3DA 1DU0A 1E3OC 2XB5A 3LSGA 1IDZA 3JR9A 4C2MJ 2GBYA 1TWFJ 2IBDA 2E2HJ 4BY1J 4MFEA 2L9RA 1MBFA 2JN6A 2NVTJ 4L5EA 4Y52J 1TWCJ 1IV6A 2DMTA 1AKHB 2XB0X 9ANTA 5IP9J 1QVTA 2TCTA 4A3MJ 2DN0A 1K83J 2XPVA 5FLMJ 4CYCA 4B3AA 4XK4A 3HOUJ 1HDDC 4D5FA 3ZQLA 4I76A 1LE8B 4UUSB 3BG3A 2CQQA 1D5YA 4M3FA 1AU7A 2XRLA 1ETWA 4D5CA 3CMYA 3GBGA 2DMPA 2FD5A 2Y9ZA 2CUFA 5FKOA 3FKIJ 3S1QJ 3Q0UA 2HQ5A 4J19A 1FTTA 4A3GJ 1MNMC 2NS7A 2NOGA 3RQIA 3IV5A 1AHDP 1OCPA 1ETXA 1FJLA 4IHXA 3FIWA 4JYKA 1NK3P 5FLVA 5IOYA 4JX6A 1F43A 2ELKA 2R5ZB 3BR5A 1B72B 4A3BJ 4BBSJ 1BA5A 3I4MJ 2AO9A 2QF7A 1WH5A 1OFCX 5F0CA 1ETQA 4EEFG 2YU9J 2H1KA 2ME6A 5FJ8J 1JGGA 4W97A 5EG0A 2MW8A 5FKNA 1MBKA 2DA6A 4A3LJ 5IYDJ 1TWGJ 3B6CA 1O4XA 3E7LA 5IP7J 1IRZA 2K9QA 2ZB9A 4A3DJ 4ABZA 4QIWN 5F1JA 2EZLA 1NK2P 2LKXA 3ZQIA 2LR8A 1QRYA 1EF4A 3H3VK 3JRBA 1U8BA 3B6AA 1XC5A 2M0CA 1JJ8C 1DU6A 1CQTA 1GDTA 3MVPA 4X6AJ 2MG4A 3ZQFA 1ETKA 3TP0A 3ZOBA 1OCTC 2HOAA 1T56A 1BJZA 1Z77A 2XPUA 3WHCA 1ZGWA 2DA3A 1YRNB 2O9LA 3A02A 2E2IJ 2R93J 3BR2A 2W48A 1WPKA 1ZKGA 3NAUA 2HOSA 2M8GX 1FEXA 2D5VA 1MBGA 5IOZA 2EZKA 4RBOA 3H0GJ 1BL0A 2E19A 4M6VA 2JA8J 1T33A 2JWTA 3BG5A 2DMUA 1B72A 1BW6A 2HYJA 3Q0VA 2NVQJ 2NVYJ 5EZHA 3BTLA 3JRHA 3S1NJ 4IHYA 1RESA 1NTCA 3K2AA 2DA2A 3HEFA 4M3EA 2Y31A 1MSFC 2JK3A 5M5WJ 1JT6A 2OPTA 3GTMJ 3IH4A 3BR0A 2RAEA 2R5YA 5EGOA 2R0QC 2GLOA 2CJJA 1PUFB 1IC8A 1ZQ3P 3UKGA 3TW6A 3S1MJ 2HXOA 4DW6A 2K9NA 5FKMA 1W0TA 3BQZA 1Y1WJ 1FIAA 1A5JA 5IYBJ 3LSPA 3ZQCA 2HDDA 3LSRA 1OJLA 3GTQJ 4DYCA 1HOMA 3QPSA 5C4XJ 1HCRA 1JKOC 5DS9A 3RZDJ 3A01A 5E3LA 5F08A 3FK6A 4DYQA 1JKRC 2ECCA 4A3FJ 2M34A 1IGNA 3LOCA 4HNVA 2Y9YA 1RETA 1G2HA 3S17J 5C44J 1IUFA 1FIPA 4FE7A 1VFCA 2KT0A 2LP0A 2R7ZJ 2P81A 3BR6A 5IYCJ 5F04A 1H8AC 1P7JA 2K40A 1I3QJ 2DA1A 1Q1VA 1UHSA 1MH3A 1QVUA 3PM1A 1IJWC 3FISA 1ENHA 1MBEA 2FJ1A 1SFOJ 2OF7A 5E3MA 5C4JJ 2NS8A 2CU7A 2ECBA 1VF9A 2O7OA 2AHQA 3G1OA 3S2HJ 3WHBA 1MH4A 5J1YA 3HOWJ 3C2BA 1LFUP 2JA7J 2EZIA 3HOXJ 2O8KA 1TWHJ 1VI0A 3MKLA 1WGXA 1RPWA 2HXIA 2ME0A 2VI6A 5C3EJ 1AKHA 4IHWA 4M3BA 4C3HJ 1I6HJ 5K7FA 2Y2ZA 4JX5A 4RDUA 3JREA 1JKPC 1X58A 4DZJA 1ZR4A 3OSGA 3HKZN 3JRAA 3PO2J 5M5YJ 1GVDA 2LLKA 1LE8A 1I50J 4UUSA 3TW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WI3 A;  2JMW A;  3Q0W A;  4AUX A;  4FTH A;  3S1R J;  2LFB A;  5J3L A;  4A3J J;  2L0K A;  2X6O A;  4QTR A;  2WAQ N;  1TWA J;  1U9O A;  3I4N J;  3IH2 A;  1XS9 A;  2LTP A;  1ZTR A;  2ID3 A;  5K7Z A;  1R9T J;  1K61 A;  2NVX J;  2MGQ A;  1ZR2 A;  4CYC B;  3LNQ A;  4A69 C;  5EZG A;  1Y1V J;  3BT9 A;  2FX0 A;  3VPR A;  3M3Y J;  4XRS A;  2XGD A;  4Y7N J;  1S7E A;  2R5Z A;  1MBH A;  4B4C A;  4FE4 A;  1UMQ A;  1W0U A;  1MSE C;  1GV5 A;  1HLV A;  4LOC A;  1VND A;  3K7A J;  4I6Z A;  2CUE A;  5F0F A;  5JLX A;  3HBL A;  2VPR A;  3S16 J;  3DCF A;  3W6V A;  2TRT A;  3GTO J;  3S14 J;  4AYB N;  1ETY A;  3TP3 A;  3L1P A;  4AC0 A;  2YUS A;  3HOV J;  2IAI A;  2DTZ A;  1JUP A;  2VKE A;  3SFI A;  4X1E A;  4XIC A;  2HI3 A;  3Q3S A;  3GTG J;  4C3J J;  4M3G A;  2EH3 A;  2XSD C;  1JT0 A;  5J1U A;  1WCM J;  3BG9 A;  4A3K J;  5GPA A;  2CQX A;  2I10 A;  3JRG A;  4A3I J;  1P7I A;  1H89 C;  1GUU A;  2E1O A;  2X48 A;  2Y0S N;  1JTX A;  3HOZ J;  3S15 J;  4FIS A;  2L7F P;  4W1U A;  2EBI A;  4A93 J;  3OOU A;  2DJN A;  1ZK8 A;  3IH3 A;  1JKQ C;  1APL C;  2LY9 A;  5EG0 B;  2PMZ N;  1H88 C;  1YRN A;  3HM5 A;  4JP0 A;  4G12 A;  4DZP A;  5DTD A;  3JRC A;  1B8I B;  5GP9 A;  3HB9 A;  2Y30 A;  5JLW A;  4C3I J;  2QCO A;  5J1R A;  1RKT A;  2K9S A;  2LVS A;  1F36 A;  5F27 A;  2EZH A;  5HOD A;  3PO3 J;  2WV1 A;  2M9H A;  2MSY A;  4IHV A;  3GTK J;  4A3C J;  2FQ4 A;  2DMN A;  2IEK A;  3BR1 A;  4NDL A;  3ZQG A;  3HDD A;  2DMQ A;  2HOT A;  3S2D J;  5FKL A;  1U78 A;  4MLO A;  5EYR A;  3D1N I;  2DA5 A;  4V2F A;  1ORK A;  2X9D A;  4MFD A;  2JA5 J;  4S0H B;  4BXX J;  3TED A;  1TC3 C;  3HGG A;  4JX4 A;  1ITY A;  4MIM A;  5EF6 A;  2DA7 A;  2R92 J;  1POG A;  2WB1 N;  5GPC A;  5BNG A;  1PUF A;  2M2E A;  1UG2 A;  2XGE A;  3GTL J;  2KDZ A;  1JUM A;  1GV2 A;  1A6I A;  2LD5 A;  2E2J J;  5IP6 A;  1RR7 A;  5E3O A;  3NAR A;  3DEW A;  2YS9 A;  4IEJ A;  5M3F J;  1U9N A;  3CCY A;  1GT0 C;  3JRD A;  1BW5 A;  3CDL A;  2L7Z A;  2COB A;  1JTY A;  5F0H A;  1B8I A;  4XRS G;  2R5Y B;  5EGO B;  1WH7 A;  1QPI A;  3JRI A;  4V2G A;  1JUS A;  4GFB A;  2G0E A;  3BQY A;  1IDY A;  2JJ7 A;  3HGY A;  2EQR A;  5M3M J;  2CRG A;  3MN2 A;  2VUM J;  1SAN A;  3BTJ A;  3HOY J;  3GTP J;  2XGC A;  2LK2 A;  3BR3 A;  3RKQ A;  3G1L A;  4UUT A;  2JA6 J;  2GM4 A;  5IPA A;  1X2N A;  5EEA A;  4MO7 A;  3A01 B;  4FCY A;  3FK7 A;  3QPL A;  2B63 J;  5EDN A;  2XPW A;  3CQZ J;  3BTI A;  3JRF A;  1HDP A;  3G1M A;  2VKV A;  4D7M A;  1IG7 A;  4XRM A;  3RZO J;  1XG1 A;  1RKW A;  3BTC A;  1FTZ A;  4D7N A;  3LSJ A;  3A03 A;  4QSH A;  3OIO A;  1JJ6 C;  1LFB A;  2DA4 A;  4BKX A;  3O8H A;  2N8G A;  3SDG A;  4BBR J;  2H8R A;  5M5X J;  3O8G A;  1X2M A;  3OSF A;  3SJM A;  1ETV A;  3F0C A;  4XID A;  5E3N A;  4A3E J;  4BY7 J;  1Z0X A;  3ZQH A;  3QQA A;  5FKK A;  2L7M P;  4B1R A;  5K7H A;  3M4O J;  1HF0 A;  2ID6 A;  3GTJ J;  4DYR A;  1MBJ A;  1ETO A;  4M3D A;  1DU0 A;  1E3O C;  2XB5 A;  3LSG A;  1IDZ A;  3JR9 A;  4C2M J;  2GBY A;  1TWF J;  2IBD A;  2E2H J;  4BY1 J;  4MFE A;  2L9R A;  1MBF A;  2JN6 A;  2NVT J;  4L5E A;  4Y52 J;  1TWC J;  1IV6 A;  2DMT A;  1AKH B;  2XB0 X;  9ANT A;  5IP9 J;  1QVT A;  2TCT A;  4A3M J;  2DN0 A;  1K83 J;  2XPV A;  5FLM J;  4CYC A;  4B3A A;  4XK4 A;  3HOU J;  1HDD C;  4D5F A;  3ZQL A;  4I76 A;  1LE8 B;  4UUS B;  3BG3 A;  2CQQ A;  1D5Y A;  4M3F A;  1AU7 A;  2XRL A;  1ETW A;  4D5C A;  3CMY A;  3GBG A;  2DMP A;  2FD5 A;  2Y9Z A;  2CUF A;  5FKO A;  3FKI J;  3S1Q J;  3Q0U A;  2HQ5 A;  4J19 A;  1FTT A;  4A3G J;  1MNM C;  2NS7 A;  2NOG A;  3RQI A;  3IV5 A;  1AHD P;  1OCP A;  1ETX A;  1FJL A;  4IHX A;  3FIW A;  4JYK A;  1NK3 P;  5FLV A;  5IOY A;  4JX6 A;  1F43 A;  2ELK A;  2R5Z B;  3BR5 A;  1B72 B;  4A3B J;  4BBS J;  1BA5 A;  3I4M J;  2AO9 A;  2QF7 A;  1WH5 A;  1OFC X;  5F0C A;  1ETQ A;  4EEF G;  2YU9 J;  2H1K A;  2ME6 A;  5FJ8 J;  1JGG A;  4W97 A;  5EG0 A;  2MW8 A;  5FKN A;  1MBK A;  2DA6 A;  4A3L J;  5IYD J;  1TWG J;  3B6C A;  1O4X A;  3E7L A;  5IP7 J;  1IRZ A;  2K9Q A;  2ZB9 A;  4A3D J;  4ABZ A;  4QIW N;  5F1J A;  2EZL A;  1NK2 P;  2LKX A;  3ZQI A;  2LR8 A;  1QRY A;  1EF4 A;  3H3V K;  3JRB A;  1U8B A;  3B6A A;  1XC5 A;  2M0C A;  1JJ8 C;  1DU6 A;  1CQT A;  1GDT A;  3MVP A;  4X6A J;  2MG4 A;  3ZQF A;  1ETK A;  3TP0 A;  3ZOB A;  1OCT C;  2HOA A;  1T56 A;  1BJZ A;  1Z77 A;  2XPU A;  3WHC A;  1ZGW A;  2DA3 A;  1YRN B;  2O9L A;  3A02 A;  2E2I J;  2R93 J;  3BR2 A;  2W48 A;  1WPK A;  1ZKG A;  3NAU A;  2HOS A;  2M8G X;  1FEX A;  2D5V A;  1MBG A;  5IOZ A;  2EZK A;  4RBO A;  3H0G J;  1BL0 A;  2E19 A;  4M6V A;  2JA8 J;  1T33 A;  2JWT A;  3BG5 A;  2DMU A;  1B72 A;  1BW6 A;  2HYJ A;  3Q0V A;  2NVQ J;  2NVY J;  5EZH A;  3BTL A;  3JRH A;  3S1N J;  4IHY A;  1RES A;  1NTC A;  3K2A A;  2DA2 A;  3HEF A;  4M3E A;  2Y31 A;  1MSF C;  2JK3 A;  5M5W J;  1JT6 A;  2OPT A;  3GTM J;  3IH4 A;  3BR0 A;  2RAE A;  2R5Y A;  5EGO A;  2R0Q C;  2GLO A;  2CJJ A;  1PUF B;  1IC8 A;  1ZQ3 P;  3UKG A;  3TW6 A;  3S1M J;  2HXO A;  4DW6 A;  2K9N A;  5FKM A;  1W0T A;  3BQZ A;  1Y1W J;  1FIA A;  1A5J A;  5IYB J;  3LSP A;  3ZQC A;  2HDD A;  3LSR A;  1OJL A;  3GTQ J;  4DYC A;  1HOM A;  3QPS A;  5C4X J;  1HCR A;  1JKO C;  5DS9 A;  3RZD J;  3A01 A;  5E3L A;  5F08 A;  3FK6 A;  4DYQ A;  1JKR C;  2ECC A;  4A3F J;  2M34 A;  1IGN A;  3LOC A;  4HNV A;  2Y9Y A;  1RET A;  1G2H A;  3S17 J;  5C44 J;  1IUF A;  1FIP A;  4FE7 A;  1VFC A;  2KT0 A;  2LP0 A;  2R7Z J;  2P81 A;  3BR6 A;  5IYC J;  5F04 A;  1H8A C;  1P7J A;  2K40 A;  1I3Q J;  2DA1 A;  1Q1V A;  1UHS A;  1MH3 A;  1QVU A;  3PM1 A;  1IJW C;  3FIS A;  1ENH A;  1MBE A;  2FJ1 A;  1SFO J;  2OF7 A;  5E3M A;  5C4J J;  2NS8 A;  2CU7 A;  2ECB A;  1VF9 A;  2O7O A;  2AHQ A;  3G1O A;  3S2H J;  3WHB A;  1MH4 A;  5J1Y A;  3HOW J;  3C2B A;  1LFU P;  2JA7 J;  2EZI A;  3HOX J;  2O8K A;  1TWH J;  1VI0 A;  3MKL A;  1WGX A;  1RPW A;  2HXI A;  2ME0 A;  2VI6 A;  5C3E J;  1AKH A;  4IHW A;  4M3B A;  4C3H J;  1I6H J;  5K7F A;  2Y2Z A;  4JX5 A;  4RDU A;  3JRE A;  1JKP C;  1X58 A;  4DZJ A;  1ZR4 A;  3OSG A;  3HKZ N;  3JRA A;  3PO2 J;  5M5Y J;  1GVD A;  2LLK A;  1LE8 A;  1I50 J;  4UUS A;  3TW7 A; 
#chains in the Genus database with same CATH topology
 2WWY A;  4AUX A;  3BG7 A;  4ENN A;  1VQ8 I;  3L09 A;  4QTR A;  3LQR A;  2OTL I;  2EFW A;  4IZZ A;  1EJ9 A;  2GIZ A;  1YOV B;  4G7H F;  2LRD A;  3IH2 A;  4LGW A;  2LTP A;  4RAZ A;  2CQK A;  4IXA A;  2BGC A;  1TT0 A;  2ID3 A;  5CPR B;  1ZG3 A;  5CYV A;  3G4S I;  2JRM A;  1TW3 A;  1R1T A;  2B0L A;  2F5C A;  1IXS B;  4CYC B;  4A69 C;  5EZG A;  1QQI A;  1Y1V J;  3BT9 A;  2L3D A;  4XRS A;  5E20 A;  2R5Z A;  4BHP A;  4DJA A;  4AIJ A;  1LVK A;  4E7H A;  1MSE C;  3K7A J;  1TQI A;  2EPF A;  3U1D A;  2QM3 A;  5F0F A;  4ESF A;  3S16 J;  2DFH A;  2VPR A;  1IRX A;  2ZSI B;  5J8C A;  3G73 A;  3S14 J;  4BAC A;  2XAQ A;  5H2F C;  1R5H A;  2YUS A;  4BH9 A;  2HYF A;  2Z5U A;  1FMV A;  2DTZ A;  4YFX F;  1JHF A;  1JUP A;  4XQF A;  3L9F A;  4C3J J;  1HKS A;  1OCR H;  2EH3 A;  3LSK A;  5KAI C;  1JT0 A;  2DTR A;  3CJR B;  1WCM J;  2ZFU A;  2EA4 A;  4HAM A;  2E1M C;  5GPA A;  2CQX A;  1O7L A;  3NRV A;  2A5Y B;  4NNJ A;  1P7I A;  3K70 C;  2FOK A;  4HA8 A;  4OMY A;  2Y0S N;  3DEE A;  1PP8 F;  3KP4 A;  2IRF G;  3S15 J;  2VC1 A;  1KYZ A;  2O0Y A;  1W7P A;  1ZN2 A;  4GYG A;  1JKQ C;  2LY9 A;  5EG0 B;  2PMZ N;  3W6J B;  3DPT A;  1YRN A;  1IUY A;  4G12 A;  2H6C A;  4DZP A;  3JRC A;  2LSO A;  5GP9 A;  2DXI A;  4ZH4 F;  4AIH A;  2F5D A;  2VT2 A;  4OAZ A;  1RKT A;  2KJC A;  1ZGA A;  3C2H A;  1E3P A;  3LST A;  1F36 A;  2EIL H;  2UV1 A;  5F27 A;  2RN7 A;  1BC7 C;  4G94 A;  3H9G A;  1O3Q A;  2V1U A;  2E1N A;  2XRN A;  3TKY A;  1OYI A;  5LHI A;  2FUG 2;  4IHS A;  3PL8 A;  4N9I A;  5E17 F;  3G6E I;  1A6Q A;  3K2Z A;  3TDZ C;  1F5T A;  4XSX F;  3BR1 A;  4NDL A;  4WCG A;  3BP8 A;  1VQ5 I;  5FKL A;  3DF8 A;  4V2F A;  4LD5 A;  2XVC A;  4QPQ A;  1LEA A;  4MGR A;  4RB3 C;  2HWV A;  4MIM A;  3BPX A;  1HST A;  2DA7 A;  1QZE A;  1FY7 A;  1WKM A;  3A0H C;  4GGG A;  1Z1D A;  1N77 A;  1GHC A;  2WB1 N;  3OIQ A;  5B1B H;  2DAO A;  5BNG A;  1UG2 A;  1FP2 A;  4WF2 A;  1JUM A;  3AG4 H;  3EQL F;  1FC3 A;  5IP6 A;  4IQ4 A;  1MKM A;  1S29 A;  5E3O A;  3DEW A;  1MJ9 A;  5M3F J;  3H0D A;  4HZF A;  1HSJ A;  2CH0 A;  5J40 A;  2E34 A;  2DPD A;  4IPA A;  4PSW A;  5FB2 A;  3PNV A;  3LQQ A;  2DDB A;  2COB A;  1Y39 A;  3KYC B;  1E17 A;  2IJL A;  1TBX A;  4U88 A;  2VE9 A;  4B09 A;  2BW3 A;  2FOW A;  1XX5 A;  3ASN H;  4XOP A;  2Z9O A;  2QQB A;  3ABL H;  2JJ7 A;  3JTH A;  1VQM I;  5IT9 Z;  2CRG A;  3MN2 A;  3BTJ A;  3K10 A;  3DBH B;  3ZMU A;  2E7X A;  1X19 A;  2C6Y A;  2QSH X;  2WAQ A;  5IPA A;  2DT5 A;  4Q4Z F;  3A01 B;  1HDP A;  3CCE I;  2CV1 A;  2VKV A;  3WTU C;  2QSG X;  3FM5 A;  1FWZ A;  4RAF A;  1XG1 A;  1QA6 A;  3WTW C;  1FTZ A;  1ULY A;  4D7N A;  1U0J A;  3HSF A;  4XLH A;  2XAS A;  4BKX A;  5D8K B;  1MIJ A;  1LB2 A;  1V3F A;  1YO5 C;  4HRI A;  3E6B A;  5GAD J;  1ETV A;  5JR3 A;  3F0C A;  1UHM A;  4XID A;  2CW8 A;  2XSJ C;  1T0F A;  1R36 A;  3DBL B;  3LA3 A;  3KZI C;  4BY7 J;  1K78 B;  2BY1 A;  4WXC A;  4NB5 A;  3OR2 C;  5FD5 A;  5FKK A;  1N75 A;  4B1R A;  2DO7 A;  5K7H A;  3OYE A;  3M4O J;  1HF0 A;  3GTJ J;  1IZ1 A;  3OWT A;  1Z3Y A;  5D5V B;  2D1V A;  1IN5 A;  1ETO A;  4M3D A;  1DU0 A;  2BV6 A;  4LK0 F;  3CJT B;  4CCN A;  4AIK A;  2G7U A;  3SDB A;  3JR9 A;  1XDS A;  3FXU A;  5TGT A;  3PUB A;  2L9R A;  1Y0U A;  2W4S A;  3H5A A;  3PQJ A;  4Y52 J;  3K4L A;  2RDP A;  2JPC A;  1U5T C;  1ZLJ A;  1AKH B;  9ANT A;  4M9X A;  1QVT A;  1D8K A;  3RCO A;  4A3M J;  4I0B A;  1IRF A;  2W25 A;  3HRU A;  3ZXS A;  2HZD A;  4PZJ A;  1JGS A;  3HOU J;  3ERM A;  3HPH A;  5TRD A;  2RQQ A;  4XLC A;  2OJE D;  3CDH A;  1J7K A;  2HYG D;  1V5E A;  3CES A;  1HXD A;  2VBY A;  4RAY A;  3DU5 A;  1AU7 A;  4TV7 A;  2WA0 A;  2A07 F;  2GQQ A;  1YW7 A;  4PFO A;  3FDY A;  3B73 A;  2B9S A;  1GLN A;  4D5C A;  3CMY A;  1SFU A;  2COM A;  2DMP A;  5BPI A;  2FD5 A;  3QAH A;  1KU7 A;  2CUF A;  3ZRG A;  1MND A;  3SEQ A;  1CF7 B;  4J19 A;  2W85 A;  4A3G J;  3T8R A;  2NXN B;  2HFH A;  4A2U A;  1NH3 A;  4IHX A;  2QZ8 A;  1BOB A;  4JYK A;  1NK3 P;  3I3L A;  2ZJR F;  2X1C A;  5IOY A;  4JX6 A;  4L0Y B;  2A61 A;  3FXO A;  1KU2 A;  3MKZ A;  2K3P A;  1UCR A;  1B72 B;  4BBS J;  1BA5 A;  3KYD B;  3ZPL A;  1UST A;  4QPO A;  1MZB A;  5F0C A;  1ETQ A;  2V26 A;  3N4M A;  2Q2E B;  5D5W B;  1G4D A;  3CUQ A;  4BDZ A;  2CV0 A;  1AA7 A;  4UV8 A;  4GDF A;  1R1V A;  3OYJ A;  3ZQ7 A;  2AS5 F;  5ICG A;  2XC7 A;  2XF5 A;  3ZMS A;  1WJB A;  2CQN A;  5IYD J;  1TLH B;  2MA3 A;  5ILS A;  4N9H A;  1ZRC A;  2IA2 A;  2DFI A;  4XKB A;  4ABZ A;  2GOM A;  5F1J A;  3HKZ A;  2QWW A;  4L5I A;  2KKO A;  4NBQ A;  2YSR A;  4ENJ A;  3H3V K;  1RUO A;  1O57 A;  4O5V A;  3CF5 F;  3DKY A;  1XN7 A;  3B6A A;  1JJ8 C;  2FBK A;  3BZ6 A;  3LSM A;  1CQT A;  1YTY A;  5DD4 A;  3KZY A;  5HLT A;  1YYV A;  3GME A;  2MG4 A;  3F8C A;  1ETK A;  3TP0 A;  1S9H A;  1X3U A;  5EJC A;  5HS9 A;  2CV2 A;  2XKO A;  3GLL A;  2XPU A;  1EKE A;  2DA3 A;  2RNG A;  1R4M B;  4G8X A;  3LFK A;  2W48 A;  5LGN A;  3COA C;  1VQO I;  1DP7 P;  3IWZ A;  5HDK A;  1UB9 A;  2HQA A;  4EJT A;  1MBG A;  3W3C A;  4XON A;  4LIT A;  1XGS A;  3GO5 A;  2X0L A;  4HOB A;  1BL0 A;  3GFJ A;  4M6V A;  3J7A Y;  4QWQ A;  1T33 A;  2BXY A;  1JHH A;  4II2 A;  3C2G A;  3BG5 A;  1EH6 A;  2IPQ X;  1KYW A;  3KX2 A;  5KVR A;  3M7G A;  4OAY A;  5BPD A;  1ZG1 A;  2GXA A;  1X4P A;  3S1N J;  1BR4 A;  2L9S A;  3AL0 C;  2ESN A;  3VDX A;  5D5U B;  1MMN A;  2XRO A;  3FXL A;  4I09 A;  2Y31 A;  2O61 A;  1BI1 A;  2GA2 A;  4HV5 A;  5L3E A;  2R5Y A;  1R5I D;  2Q0O A;  2XF7 A;  3FKJ A;  3B02 A;  3MMY B;  5EGO A;  1P92 A;  1KQ9 A;  3M1E A;  3CCJ I;  3CP8 A;  1SFK A;  4UVB A;  4EGY A;  3LA7 A;  3ML6 A;  1ZQ3 P;  1G3W A;  4QLC U;  3PUF A;  3R0J A;  3K4M A;  4EMS A;  4XLE A;  2QBY B;  5K5R A;  1IXR C;  5FKM A;  1W0T A;  3BQZ A;  3NWT A;  3K69 A;  5IYB J;  2Q1Z B;  4L5J A;  5HOO A;  5JHU A;  1X4O A;  1OJL A;  4G7Z F;  3V7R A;  3KZZ A;  3QPS A;  4BS9 A;  5DUI A;  1P4A A;  1FOW A;  2QQ9 A;  2LG4 A;  1Q1H A;  1W4M A;  5E3L A;  3GUD A;  2ECC A;  1IGN A;  1FT9 A;  4L9N A;  2XAF A;  2Y9Y A;  2QQ8 A;  3FF5 A;  1RET A;  3Q9S A;  4NQW A;  2LMD A;  4ZJZ A;  1F9N A;  2LYC A;  3IRR A;  2LP0 A;  3VOD A;  3JCU C;  3F23 A;  2P81 A;  2R7Z J;  2W24 A;  5IYC J;  3OYD A;  4UB8 C;  5L3B A;  1I3Q J;  1Q1V A;  3ERE D;  2DYS H;  4XN3 A;  1IJW C;  3FIS A;  3DU6 A;  3GZ5 A;  1ENH A;  2EB7 A;  1LNW A;  4RA2 A;  3JAM Z;  3K4J A;  3GYH X;  2KIM A;  2V6C A;  2JT1 A;  2NNN A;  3HZJ A;  2BHY A;  2EIN H;  4CZC A;  2E36 A;  1MH4 A;  4OU0 A;  4Y15 A;  2VL8 A;  2WB1 A;  1FSH A;  2VLA A;  4FX4 A;  1RI7 A;  2EZI A;  2VQG A;  2RRE A;  4CIC A;  1D1B A;  1TWH J;  3MKL A;  1X3W B;  1NHA A;  1WI9 A;  1WGX A;  3GEZ A;  4GCV A;  3KET A;  2HXI A;  1FX7 A;  3L2R A;  5C3E J;  4U87 A;  1L3L A;  2Z3Y A;  2F5F A;  2NS0 A;  3BOQ A;  3CCS I;  3VFZ A;  2V79 A;  4JX5 A;  3JRE A;  4RDU A;  1RC9 A;  2KPM A;  4A0Z A;  2M8E A;  4IX7 A;  3V42 A;  2K85 A;  3JRA A;  1T6S A;  5M5Y J;  2RGV A;  1GVD A;  2X1D A;  3WGH A;  4UUS A;  4D0P A;  2P7C B;  1WI3 A;  4KT5 C;  2JMW A;  3S1R J;  4IKF A;  2LFB A;  4XOR A;  1YQA A;  3EUA A;  4A3J J;  3F9K A;  2R4G A;  2WAQ N;  2DBB A;  3BPV A;  3I4N J;  4NUB A;  3FMR A;  4F91 B;  1VQP I;  1DQU A;  3BG6 A;  1K61 A;  3I59 A;  1LEB A;  2FML A;  3RYR A;  2F4M B;  1W5C C;  3K70 D;  4HF0 A;  3VPR A;  3BWG A;  2XGD A;  4Y7N J;  2UWM A;  1S7E A;  2QKM B;  2PJR A;  1O3R A;  1SD6 A;  1L0O C;  2Z99 A;  5E8G A;  3KLO A;  1IN8 A;  2JZY A;  4LOC A;  1WJD A;  5LFA A;  3J81 K;  4PJL A;  1FLI A;  2ICW G;  3HBL A;  3CCQ I;  3CD6 I;  2VT3 A;  2XHK A;  2M4K A;  1ETY A;  3MEX A;  2PFB A;  5DEQ A;  3TP3 A;  5D8L B;  3L1P A;  1A35 A;  2ESH A;  2IAI A;  4BXU A;  5E1X A;  3HOV J;  1LJ9 A;  1OCC H;  3ESW B;  4J00 A;  3SFI A;  4X1E A;  3GXO A;  2BVL A;  2IGM A;  4ENK A;  1O7F A;  4M9Z A;  3BG9 A;  2DOE A;  4ZZL A;  5L3C A;  2E60 A;  3V8K A;  1RIO H;  4B3X A;  2HVR A;  1T95 A;  2EIM H;  2D45 A;  2R7O A;  1I5Z A;  4A3I J;  3KP6 A;  2OQR A;  1GUU A;  2E1O A;  1S7A A;  1OIS A;  3E5X A;  2X48 A;  2RV8 A;  4YIR X;  4I01 A;  1BM9 A;  2BVM A;  3AFH A;  2HKO A;  2O3F A;  4A93 J;  1STZ A;  3OOU A;  3IH3 A;  2R7D A;  3TO6 A;  3VOE A;  2QYO A;  2W57 A;  1K6O A;  3QP6 A;  2JRT A;  1H88 C;  3HM5 A;  4JP0 A;  4CCK A;  5DTD A;  3JTG A;  3CZ6 A;  2DK5 A;  3L2V A;  2ZO4 A;  4S04 A;  2Y30 A;  4YFK F;  5A2Q K;  2I8D A;  5J1R A;  1FBU A;  1J2X A;  2K9S A;  1WJ5 A;  3OOP A;  4EVI A;  2BZT A;  3F8F A;  3HSE A;  3IAM 2;  2EZH A;  1SAX A;  4MHG A;  1DGW Y;  2Y69 H;  4U7D A;  3PO3 J;  3HHH A;  3MKY B;  4GXO A;  2HVQ A;  3R6S A;  1ON1 A;  1QHG A;  2JSC A;  4IHV A;  3GTK J;  1G6N A;  2CFX A;  4IRI A;  3C3W A;  2VXZ A;  1VQN I;  4HX8 A;  2FBI A;  4A3C J;  5AON A;  3CO7 C;  3HDD A;  3S2D J;  2HOT A;  1U78 A;  4MLO A;  2DA5 A;  3SZP A;  5F64 A;  3WG7 H;  4D1Q A;  4S0H B;  3IC7 A;  3MQ0 A;  1ZLK A;  3TED A;  5H6R A;  3HGG A;  3JW4 A;  4Y4R A;  5EF6 A;  4XRF A;  1KU9 A;  1FP1 D;  5FGM A;  3DTE A;  2ZJQ F;  4PUS A;  2FQ3 A;  6PAX A;  3D5L A;  1BN5 A;  1XGO A;  2DQR A;  3RQ4 A;  4BE1 A;  1PUF A;  1Y8R B;  2XGE A;  1HW5 A;  3RJP A;  2KDZ A;  1WJA A;  4XLN F;  3I9V 2;  2LD5 A;  1J9I A;  1ZRE A;  2KIQ A;  2VIX A;  1PYV A;  1W36 C;  1I1S A;  3CCL I;  3GZ6 A;  3E5Q A;  4RM3 A;  4IHT A;  5DCM A;  2STW A;  1EH8 A;  5JHF A;  3CCY A;  2O03 A;  1KU3 A;  2ZC2 A;  4BJ6 C;  4X0G A;  3EUK L;  4YRV A;  2KZG A;  2FEZ A;  4L9T A;  3C18 A;  2RQP A;  4BJT A;  4LB5 A;  1P6R A;  3G71 I;  2ADU A;  2CFO A;  3JRI A;  2R7F A;  1R6R A;  4UHT A;  4GFB A;  2LBF B;  1IDY A;  3L2W A;  2VBX A;  4CDG A;  3ZR8 X;  2VUM J;  3SXY A;  3HOY J;  3RTR A;  2XGC A;  4BQQ A;  2V1N A;  2DFF A;  2F4I A;  3OYL A;  1TTY A;  2GA1 A;  3IHU A;  5K5O A;  2JA6 J;  1ZEL A;  4MO7 A;  2CO5 A;  4FCY A;  1EA3 A;  3QPL A;  1JI8 A;  3BTI A;  2K7L A;  5E79 C;  4CCO A;  3TOB A;  1IG7 A;  2IS6 A;  2DI3 A;  4LB6 B;  3H9J A;  1X1B A;  2OV7 A;  4G6T B;  3ZMT A;  4QSH A;  3J80 Z;  4LG0 B;  4HG2 A;  1FYM A;  2ZCW A;  4E7K A;  5JI6 A;  1V5F A;  1UEL B;  4EAT A;  1LQ1 A;  2DK8 A;  2EWN A;  4LLG F;  2N8G A;  1WJE A;  1KQ0 A;  4KIG A;  4BBR J;  5M5X J;  5KCM A;  2VQL A;  1X2M A;  1D3Y A;  1Z67 A;  3O8G A;  2A6T A;  4IL6 C;  2UUZ A;  3Q5F A;  3T8T A;  2QVO A;  3QQA A;  4Q47 A;  4A6D A;  3BCA A;  2CS3 A;  1OMI A;  1MJA A;  3U9G A;  2E1C A;  2HTJ A;  2MD0 A;  4DBQ A;  2VE8 A;  1J09 A;  2JTV A;  2HU9 A;  2QUF A;  1HC8 A;  1IDZ A;  2GBY A;  2ZME B;  2LF7 A;  4BY1 J;  2VON A;  2JN6 A;  2M45 A;  5HDN A;  4L5E A;  1SVL A;  2PG4 A;  3LMM A;  1E3H A;  1XCB A;  2H09 A;  3OYA A;  5CQG A;  2TCT A;  1FZP B;  3WTZ A;  4EGZ A;  1B1B A;  1BI0 A;  2DN0 A;  2JUC A;  1K83 J;  2AXL A;  4Z2Y A;  2KRC A;  2P8T A;  3HRM A;  1S72 I;  1I1G A;  1Z7U A;  3S3M A;  5DYM A;  4PJM A;  1OLT A;  2IS4 A;  1YLF A;  4BAY A;  1G3T A;  1XB4 A;  3VWB A;  2BHZ A;  1YFH A;  5DD8 A;  2CGP A;  3H9Q A;  4M72 A;  1R71 A;  3TDU C;  2STT A;  4C9Y A;  2DYR H;  2FF4 A;  1ETW A;  2L9V A;  2XDV A;  4RB0 A;  4C2T A;  5B5E C;  2EA2 A;  3GBG A;  2DPU A;  3KEY A;  3Q0U A;  2QGU A;  3M8F A;  4XKC A;  3RQI A;  4CO8 A;  1DUX C;  1AWC A;  5LD2 C;  1ETX A;  2XV4 S;  2EFN A;  1D1C A;  4HLY A;  1W5S A;  3QYB A;  4HQM A;  3LSH A;  2ELK A;  2R5Z B;  3ZMD A;  4BE2 A;  5L3D A;  2PLY A;  2ZNZ A;  2QF7 A;  3WE3 A;  3CCV I;  3K4K A;  1QZY A;  4BYY A;  1WH5 A;  4UVC A;  4HF2 A;  3ZQQ A;  3RIR A;  2H1K A;  2F5E A;  2YX7 A;  5ICE A;  5FJ8 J;  2Z16 A;  5KHD A;  5F1R A;  3WGG A;  2NNY A;  1LDK B;  2JSP A;  5FKN A;  3CC2 I;  2X6Y A;  3H3U A;  1U5T A;  4RGX A;  2TDX A;  3FXR A;  3R60 A;  1QGP A;  5B3S H;  5IP7 J;  2IA0 A;  1IRZ A;  2KL4 A;  1HBX G;  1P4X A;  4R79 A;  2OZU A;  4G9Y A;  2CW0 F;  4HW0 A;  3ZQI A;  3T5X A;  3GZN B;  2VAS A;  1XPX A;  1EF4 A;  1R1U A;  2DLL A;  5IT3 A;  3L2U A;  2M1B A;  3CCU I;  1OR7 A;  1DU6 A;  4XNF A;  5LEK A;  4HPQ A;  4BHC A;  1W7P B;  4X6A J;  4PSX A;  4ZZD A;  3TBI A;  1OCT C;  2VBW A;  3ABK H;  1YRN B;  1BJZ A;  4BGD A;  2ISY A;  3WE2 A;  2KRH A;  2JUG A;  5D4S A;  4YFN F;  3FBN B;  2J5O A;  1QNT A;  1ZKG A;  2WAD A;  1RR8 C;  2IS1 A;  1FEX A;  2FNA A;  1FYL A;  4GRI A;  3H5R A;  1VQ6 I;  4XKW A;  4HV6 A;  3ZN0 A;  3SYT A;  4UUV A;  1WWX A;  1Z91 A;  1J5Y A;  1P2F A;  1Z6R A;  2KQR A;  2CQ7 A;  2R7R A;  2JWT A;  2KRF A;  3DQV C;  4RB2 C;  1B72 A;  1BW6 A;  2K3F A;  3K4B A;  2R7U A;  1ZGJ A;  1IV8 A;  4EJV A;  1DDN A;  4KN4 X;  1K4S A;  4M71 A;  1HW1 A;  2Q2E A;  2VJJ A;  2PX9 A;  5EEG A;  2ZXW H;  5J8F A;  1R49 A;  1ACI A;  3F6V A;  4HLX A;  3HEF A;  1I3A A;  4M3E A;  1VQK I;  3L2C A;  3KE2 A;  3PSF A;  1UFM A;  1VQL I;  2XUB A;  1JT6 A;  3F8M A;  3GW2 A;  3W6K B;  1G59 A;  3GTM J;  1XDU A;  4PGH A;  4A6E A;  2KP6 A;  1V5G A;  1QZZ A;  1E0E A;  3WTT C;  4E7Z A;  4BQN A;  5TIS C;  1G8X A;  1VQ7 I;  1PDN C;  4HX7 A;  1SD4 A;  2X85 A;  3K0L A;  3F8B A;  5GAE J;  4AM3 A;  2WTE A;  3DBR B;  4DW6 A;  4IRG A;  1EV7 A;  1FSE A;  1Y1W J;  2OZ6 A;  1FIA A;  1T39 A;  4XBF A;  3FM3 A;  1ON2 A;  3O3K A;  2V1X A;  3FXQ A;  3LSR A;  1S5L C;  1YHQ I;  1TT5 B;  4IRH A;  4A5N A;  1HCR A;  2OBP A;  5C4X J;  2PMU A;  1OR7 C;  2HS5 A;  2QA4 I;  1K7A A;  2P5K A;  2VC0 A;  1JKR C;  1J0R A;  2M34 A;  3LOC A;  5HNF A;  3S17 J;  5C44 J;  2M4G A;  2BW3 B;  5LHH A;  3E0J B;  2XKP A;  3OS2 A;  3H35 A;  3R0A A;  4OOI A;  1B9M A;  4Y3O A;  5F04 A;  2Z33 A;  5B66 C;  1H8A C;  1BC8 C;  2A68 F;  1UHS A;  2AXT C;  4S05 A;  4IJA A;  4BQO A;  3QWL A;  3FXK A;  1LDJ A;  4XL9 A;  2MLG A;  1KGS A;  4ENM A;  3X2Q H;  2M30 A;  5C4J J;  4NC8 A;  4WXD A;  4LIV A;  2WY8 Q;  4CH7 A;  4BU2 A;  2ECB A;  3RSN A;  2P5L C;  1VF9 A;  2O7O A;  2AHQ A;  2OUM A;  3HYI A;  5J1Y A;  1UZC A;  5D6F A;  4CHU A;  5FFX A;  4PJ0 C;  3HOW J;  1OKR A;  2O8K A;  1VI0 A;  2DOA A;  2KMU A;  3FMS A;  3HG9 A;  1XMK A;  1ERD A;  1EH7 A;  3WGI A;  4BEH A;  1RPW A;  4HEA 2;  2GIV A;  3MZH A;  3VSK A;  4JQF A;  4G7O F;  2YX4 A;  4P9F A;  4ZTJ A;  3GFI A;  2DFE A;  4HX4 A;  1WHU A;  4ZDL A;  4M3B A;  4IHW A;  5K7F A;  3CDI A;  4HYE A;  1JKP C;  1I39 A;  3LL7 A;  4DZJ A;  4PCQ A;  3EPZ A;  5KNL A;  5CVU A;  1SFE A;  2BY2 A;  2FNP A;  2ETH A;  1O3T A;  4KNY A;  3HOT A;  3V8J A;  1LE8 A;  1I50 J;  4OIR F;  3TW7 A;  4N0B A;  5H20 A;  1XGN A;  5IY5 H;  3AG2 H;  3GWZ A;  1SVO A;  3C1D A;  4BXF A;  1TWA J;  3CLQ A;  4UVA A;  4Y33 A;  3OYH A;  2FRH A;  3F21 A;  1XS9 A;  2K5C A;  5BS6 A;  1T38 A;  5KK1 A;  4H4K C;  3ROU A;  3KPH A;  1ZR2 A;  2M3A A;  3OV8 A;  1R00 A;  3D0S A;  4CYD A;  3MKW B;  2R7V A;  3C7J A;  1XMA A;  2MYS A;  4MEX F;  3UNG C;  3DKW A;  1TZL A;  4A0Y A;  1MBH A;  1RRJ A;  4FE4 A;  5FFZ A;  3TMO A;  4EQQ A;  3F6O A;  1UMQ A;  3FMQ A;  1W0U A;  1B9N A;  2OA4 A;  1VND A;  5GTI C;  4MNU A;  4I6Z A;  3S93 A;  2CUE A;  2IW5 A;  3BJO A;  3E97 A;  3W6V A;  2TRT A;  3GTO J;  2NAZ A;  3KYL A;  3CCM I;  1YIT I;  1SD5 A;  4PK4 A;  4LLN A;  2VKE A;  2HI3 A;  1SAU A;  2PQ8 A;  3Q3S A;  3QYE A;  3OYG A;  2HTS A;  5HDG A;  5BQT A;  2XSD C;  5LRS A;  3DLA A;  4CGZ A;  4AWX B;  4ZYE A;  4IF4 A;  5FRO A;  3F22 A;  1Y0N A;  1O3S A;  3P9I A;  2LDU A;  4PGG A;  1XCV A;  3NWS A;  2V7F A;  3BLY A;  1YJW I;  2MC4 A;  4FQG A;  1DPR A;  3CF2 A;  2ZBK A;  3CP2 A;  2L7F P;  3CUQ B;  4W1U A;  5CVR A;  3GFL A;  3HUG A;  1X1A A;  1B8I B;  2UZK A;  3HB9 A;  3WU1 B;  4MQ9 F;  1K79 A;  3IL2 A;  5JLW A;  4C3I J;  2ZXI A;  3LFU A;  1IF1 A;  1YS7 A;  3SQN A;  2VKD A;  2IVM A;  4BUP A;  2W7N A;  1FBQ A;  1X3Z B;  2EV5 A;  5HOD A;  2A6E F;  1D8J A;  5DUK A;  4RM2 A;  4G6D A;  1UJ8 A;  2WV1 A;  1W36 D;  5CLS A;  4F3Q A;  3DFG A;  1B59 A;  2FQ4 A;  2BY3 A;  2IEK A;  4ANJ A;  5D6E A;  2DMQ A;  3K6G A;  1H9G A;  4L9J A;  5EYR A;  1KON A;  2X9D A;  2E71 A;  1JXS A;  3PFI A;  1J59 A;  5FO5 A;  4BXX J;  3U2R A;  4JX4 A;  5ED4 A;  2IGN A;  5F6F A;  2LNB A;  2KJB A;  5E1W A;  3H1C A;  1B4A A;  1LPQ A;  4KUM A;  3DKX A;  3V7C A;  2R92 J;  1POG A;  1X1C A;  5GPC A;  3BCB A;  2MAB A;  4ZDO A;  2CSO A;  2M2E A;  3ASO H;  4MTE A;  4ZYH A;  3KP2 A;  3L7W A;  1GV2 A;  4F7Z A;  4KYW A;  1A6I A;  1TQM A;  3ULQ B;  1XSV A;  1RR7 A;  3NAR A;  4FT8 A;  5LBQ A;  5FLX K;  2VQC A;  1U9N A;  2DW4 A;  5DM6 F;  3J7Z I;  1GT0 C;  4KN7 X;  4AID A;  3JRD A;  2HEO A;  1BW5 A;  3I58 A;  1P9Q C;  4IO9 F;  3I53 A;  1U2W A;  5F0H A;  2HR3 A;  2F5V A;  3CC7 I;  2FMY A;  2R5Y B;  5HLG A;  3GCM A;  5EGO B;  1XSD A;  1I6X A;  1MW7 A;  3E3V A;  3DP7 A;  1T2K A;  2PEX A;  3MZY A;  2G0E A;  3BQY A;  4YIF A;  1U8R A;  4M6Y A;  1DP3 A;  5H6Q A;  3HGY A;  1RZ4 A;  2X4H A;  2EQR A;  1DGR M;  1TNS A;  4BE0 A;  5M3M J;  1BOA A;  2OU2 A;  3TO7 A;  4P96 A;  3PFY A;  3HJE A;  3GTP J;  3TL4 X;  1T8I A;  2LK2 A;  2GM4 A;  1Z21 A;  4XMY A;  2VJI A;  2OC6 A;  1IN4 A;  2K9L A;  5EDN A;  2B63 J;  2XPW A;  3CQZ J;  2V9V A;  3MWM A;  4D7M A;  5GAG J;  3LAP A;  4XRM A;  3M9A A;  3BTC A;  1RKW A;  4NQW B;  4EM0 B;  3A0B C;  1PJR A;  3WU2 C;  1F4K A;  5TJJ A;  3LSJ A;  3A03 A;  4E7S A;  3I54 A;  3O2P E;  5J4Y A;  1JJ6 C;  1ZAO A;  1LFB A;  2DA4 A;  1WFX A;  2ELH A;  5E1Z B;  3O8H A;  3SDG A;  5ICF A;  3OYI A;  3HRS A;  3W2V A;  2H8R A;  2W82 A;  5ICC A;  1YIJ I;  3FWE A;  4HDV A;  3OSF A;  3P9C A;  2ZJP F;  3SEZ A;  4HNT A;  1JE8 A;  5E3N A;  1RUN A;  2M7B A;  5ILU A;  1D0Z A;  4AYB A;  1OQY A;  2MLK A;  3DWL E;  3ZQH A;  4V19 K;  1MDM B;  2L7M P;  1YW9 A;  2LRE A;  2ID6 A;  4DOZ A;  3LAJ A;  2V1D A;  3LSG A;  2V6E A;  4WK8 F;  4P55 A;  3V4G A;  1BBY A;  2IBD A;  2E2H J;  3QYF A;  3BJA A;  5CJ9 A;  4UV9 A;  2NVT J;  2X1E A;  5EEH A;  2PMH A;  1TWC J;  2LBF A;  1S8N A;  2BXZ A;  2VOO A;  5IP9 J;  3IKT A;  3OL4 A;  2VQH A;  1MJB A;  1YW8 A;  5L3F A;  3OS0 A;  3E6M A;  2O6G E;  4EJO A;  4KFC A;  2NYX A;  4CYC A;  2L02 A;  1R5G A;  4RS8 A;  2E7W A;  4D5F A;  2JQ7 A;  3LA2 A;  1B6A A;  3OR1 C;  1UAA A;  4K2E A;  2DU9 A;  4BJ5 C;  4UUS B;  3CJN A;  2ZKZ A;  2WAE A;  2F4O B;  1U6G A;  2XRL A;  4KJZ A;  2CUJ A;  4DGW B;  3RKX A;  4UNO A;  2GOX B;  2MH2 A;  4DBR A;  3S32 A;  2Y9Z A;  3CC4 I;  1IN7 A;  4ASN A;  3S1Q J;  4IOA F;  2PN6 A;  4Y13 A;  2R7T A;  4ETS A;  3I59 B;  3TOA A;  1MNM C;  4B48 A;  3MAJ A;  3IV5 A;  1AHD P;  1TP4 A;  1FJL A;  3E1S A;  3FIW A;  1KQ8 A;  1LUJ B;  2CYY A;  5FLV A;  3DTK A;  3AKZ A;  2K4J A;  5CVJ A;  4ESJ A;  1S7O A;  1IXC A;  1Z9C A;  4RGS A;  4EEF G;  3OYN A;  4KIS A;  2X6W A;  1YIO A;  3M8J A;  4BL0 B;  5FRN A;  2Y48 A;  2EV0 A;  3OL3 A;  4KIC A;  2V9P A;  4F92 B;  2ZME A;  5EG0 A;  1MD0 A;  4E70 A;  1MBK A;  1MMG A;  1XMX A;  2FBH A;  4ON0 A;  3QOD A;  3B6C A;  3E7L A;  2MC3 A;  2ZB9 A;  1XSX A;  4A3D J;  4QIW N;  3N05 A;  1NK2 P;  2FA5 A;  2LKX A;  1DPU A;  2KZV A;  1QRY A;  1QHH D;  2JA2 A;  3DEU A;  1X1D A;  2H8W A;  4HQE A;  3G3Z A;  1U8B A;  2EK5 A;  1T98 A;  4Z6Y A;  1LKX A;  4CZZ A;  1MMS A;  4I99 C;  3J81 Z;  4NC6 A;  4XM3 A;  1GDT A;  4CUG A;  3MVP A;  3ZMV A;  3CMA I;  1Y8Q B;  2VJ5 A;  1MGT A;  2P7V B;  3ZQF A;  1SEU A;  2HOA A;  3FXM A;  1T56 A;  4OIQ F;  3WHC A;  3EDP A;  1ZGW A;  2MD5 A;  4CCM A;  2E2I J;  3R4K A;  2R93 J;  2LKP A;  1WPK A;  3NAU A;  3ONQ A;  2HOS A;  3TQN A;  2M8G X;  2EFP A;  1BR2 A;  3WTX C;  2D5V A;  4O3M A;  5IOZ A;  3H0G J;  3AG1 H;  3I0T A;  4AD9 A;  1V55 H;  1VQ4 I;  2D2W A;  1FNN A;  5GTH C;  4BDY A;  4U0V A;  2RVC A;  5IT9 K;  2CW7 A;  2K9M A;  3ZN1 A;  3JRH A;  3IWF A;  4IHY A;  1BR1 A;  4KT6 A;  3K2A A;  2DA2 A;  1YJ9 I;  4I02 A;  1Y56 A;  2KLO A;  3A2K A;  5A2Q Z;  2EV6 A;  2F6C A;  4WX9 A;  1MSF C;  4D9J A;  2JK3 A;  1BI3 A;  5M5W J;  3V8L A;  3PJR A;  5FRM A;  3HTU A;  3PNY A;  4E7L A;  3IH4 A;  2ZNY A;  2ZME C;  3RPQ A;  2IS2 A;  2W00 A;  2R0Q C;  2GLO A;  4IOC F;  2CJJ A;  1WJF A;  2R7W A;  2GXB A;  1AOY A;  2E1M B;  1PUF B;  1Z3X A;  4MTD A;  1C0W A;  4GYI A;  1PP7 U;  3ZCO A;  4EV0 A;  1FOY A;  3EYY A;  3MD2 A;  1Y6I A;  2L9N A;  3TW6 A;  3S1M J;  2RC4 A;  4M6X A;  3KLN A;  4A0X A;  2K9N A;  5DCM B;  3LSP A;  1ZHF A;  2JVH A;  1QU3 A;  4M9S A;  1QBJ A;  3IP4 B;  3VB2 A;  3GTQ J;  3PIP F;  3H3Z A;  3QP5 A;  3FHZ A;  2HNH A;  2VOP A;  4XOT A;  1YS6 A;  1D1A A;  2HQR A;  3WTY C;  3RZD J;  3A01 A;  1K4T A;  3CUO A;  2DDA A;  1LDD A;  2IXS A;  4DYQ A;  4H0E A;  4A3F J;  3HTS B;  4HNV A;  5KAF C;  2ACJ A;  4LMY A;  1VFC A;  1ZAR A;  2KT0 A;  1IAW A;  2ZJ2 A;  3FBI B;  2PI0 A;  3CO6 C;  2DQL A;  1P7J A;  3F3X A;  4UXN A;  1F1Z A;  2K40 A;  2QLZ A;  3OMY A;  3PM1 A;  1QVU A;  4LK1 F;  1NG6 A;  1ZRF A;  2K02 A;  2CMP A;  2VBZ A;  3HPG A;  3I71 A;  1MBE A;  2FJ1 A;  3N97 A;  2VOD A;  2FU4 A;  4A5M A;  1K78 A;  4KMU X;  5CVI A;  2NS8 A;  3K1P A;  2FXA A;  1CGP A;  2A6H F;  4XLP F;  2Y75 A;  2LC2 A;  3S2H J;  1XD7 A;  3HRT A;  3E6C C;  1WZ2 A;  2KIF A;  1FMW A;  3P7N A;  2JA7 J;  2HGC A;  1ONV A;  4IQJ A;  5CVV A;  1HKT A;  4JK1 X;  4KIF A;  4WXH A;  2ME0 A;  2VI6 A;  5E18 F;  1AKH A;  1ZRD A;  2XIG A;  3FZV A;  4ZYA A;  1I6H J;  3EYI A;  5B1A H;  2Y2Z A;  3BY6 A;  4Y17 A;  3WTV C;  1ZR4 A;  2EIJ H;  3OYM A;  3V7S A;  3OSG A;  2H1L A;  4WWC A;  3P9K A;  3PO2 J;  4CXF A;  3REO A;  2H27 A;  3RPU D;  3PQK A;  1TQP A;  3S8P A;  3WTS C;  3Q0W A;  4FTH A;  5J3L A;  4FET A;  3ECH A;  2L0K A;  2X6O A;  3MZ8 A;  4ZYD A;  1HW2 A;  4RGU A;  2Z1D A;  1YJN I;  3HOS A;  1U9O A;  3SHF A;  2LF8 A;  2V9K A;  3IRQ A;  1REP C;  1ZTR A;  2M0M A;  1CF7 A;  1R9T J;  5K7Z A;  1R23 A;  2NVX J;  2MGQ A;  4J01 A;  4HBL A;  3GFM A;  2HPI A;  3ISP A;  3LNQ A;  3PSI A;  4YG2 F;  2FX0 A;  3M3Y J;  1H9T A;  3DPL C;  1N78 A;  1WSU A;  3KFW X;  2NRA C;  4B4C A;  3KCC A;  4E7J A;  1GXQ A;  1ZYR F;  1GV5 A;  1HLV A;  2VXD A;  1R7J A;  5HLI A;  2RNJ A;  2A05 A;  3TGN A;  2P6T A;  5JLX A;  2X6X A;  1IO2 A;  3DCF A;  4KIB A;  4R1H A;  4AYB N;  4AC0 A;  4PDK A;  3LSI A;  1SFX A;  3W2W A;  4OMZ A;  2WC2 A;  4XIC A;  3J7A O;  3GTG J;  2VJ4 A;  1BJA A;  4M3G A;  2L01 A;  5J1U A;  3A4C A;  4F55 A;  3WU0 A;  5ERI A;  2LY2 A;  4A3K J;  3JRG A;  2I10 A;  1BIB A;  2GAU A;  1S6L A;  2H94 A;  1TL8 A;  1H89 C;  2GZW A;  4OIP F;  1Z05 A;  3M07 A;  1HQC A;  2HQN A;  1A04 A;  1JTX A;  2W1O A;  3EET A;  4U0W A;  2AQE A;  3HOZ J;  4FIS A;  2HPM A;  2EBI A;  2G9W A;  3DLL F;  2DJN A;  1ZK8 A;  4U0Y A;  1OYY A;  5JFR A;  1APL C;  1IRG A;  1D0Y A;  2K86 A;  4LIU A;  3DXJ F;  2K27 A;  1ZG5 A;  2YPR A;  4DIQ A;  1U5T B;  3CCR I;  4M74 A;  1YI2 I;  1MNE A;  1V54 H;  2KHM A;  3SZT A;  4E4H A;  4ZTF A;  2QCO A;  2M7A A;  2BE5 F;  3CMM A;  2FSW A;  2RKH A;  2LVS A;  2LKS A;  1NG7 A;  2XGX A;  3P5J A;  2MBF A;  2M9H A;  4CCJ A;  2MSY A;  1USS A;  5LGT A;  2F2E A;  4RMN A;  1WRJ A;  2E5Z A;  4MEY F;  1BIA A;  2L4A A;  4BNC A;  2L5Q A;  3GF2 A;  2DMN A;  2WV0 A;  4RGR A;  3ZQG A;  3RPU A;  4AU7 A;  3D1N I;  4FHT A;  1ORK A;  4MFD A;  1SC7 A;  2JA5 J;  2K4B A;  4P5O A;  5LGU A;  1TC3 C;  4UB6 C;  3R61 A;  1ITY A;  2PBI A;  4HDU A;  1SMY F;  2XAH A;  5DM7 F;  3S3O A;  4DQ2 A;  2CWE A;  3FHN A;  3K1M A;  3OIP A;  3DTI A;  3GTL J;  1YX3 A;  3M1C A;  3FX3 A;  2QBY A;  3NQO A;  2E2J J;  5HVQ C;  1OCO H;  2ZSH B;  5BOX A;  3D5R C;  1SMT A;  3T0Y A;  2OD5 A;  1T0F C;  2YS9 A;  4IEJ A;  1QPM A;  4PFP A;  4XLF A;  3E6D A;  4CA0 A;  3K4N A;  4UY8 I;  4A12 A;  2KIS A;  3OS1 A;  2DT7 B;  3CDL A;  2L7Z A;  1H0M A;  3JAM K;  3JSO A;  2P5V A;  1JTY A;  2DJI A;  3OYB A;  4R8H A;  1ZH5 A;  4ZYG A;  1B8I A;  2R7S A;  2OTJ I;  1G3S A;  4XRS G;  3I5U A;  3QOP A;  1WH7 A;  1QPI A;  4FAS D;  2P0W A;  3TO9 A;  4V2G A;  1JUS A;  3Q9V A;  4L0Z B;  3KP5 A;  4NC7 A;  4HST A;  3KEQ A;  3OYK A;  1TW2 A;  1RNL A;  2HVS A;  4N4O B;  3ECO A;  3H36 A;  4Q48 A;  1OCZ H;  4HF1 A;  1SAN A;  2UXX A;  2R7Q A;  3BR3 A;  3RKQ A;  3G1L A;  4UUT A;  3QPT A;  1T08 B;  5E8I A;  2DT6 A;  1X2N A;  3BZC A;  5EEA A;  3CLO A;  4I7H A;  3FK7 A;  2EFQ A;  2DOD A;  3IUO A;  2H6B A;  3VYT B;  2XAG A;  2ELJ A;  3HSR A;  3QU3 A;  1S3J A;  3J7Y J;  3JRF A;  3G1M A;  2G7H A;  3RZO J;  2GWR A;  2IA1 A;  1E2X A;  2QEN A;  4P9U A;  4EM1 A;  2A3S A;  3ZMZ A;  3BRO A;  3A1Y A;  1PVE A;  3WG9 A;  3OIO A;  3BJ6 A;  4JOM A;  4XKV A;  1W5T A;  2BEO A;  4AVZ A;  4CSW A;  3I64 A;  2VPL A;  2IGK A;  2D1H A;  1KZH A;  4HNU A;  2X51 A;  4B43 A;  3AAF A;  3SJM A;  5AIQ A;  5K5Q A;  4LJZ F;  5AIP A;  2EJR A;  3AL0 B;  4A3E J;  1Z0X A;  2LY1 A;  3CTA A;  3U1K A;  3NEU A;  4I0A A;  3IKV A;  1G3Y A;  3EUH A;  1HA8 A;  2BYV E;  1X1P A;  1MBJ A;  4DYR A;  2ISZ A;  1E3O C;  3UR3 C;  2XB5 A;  2JPB A;  1FOX A;  3CUQ C;  3G2B A;  2MH9 A;  4C2M J;  1TWF J;  3L2Q A;  3SZG A;  4MFE A;  1MBF A;  3KEO A;  4XR6 A;  3MCZ A;  4BEH B;  4KIT B;  1I27 A;  5LEJ A;  1XTA A;  1IV6 A;  4RB1 A;  2DMT A;  2OAZ A;  2XB0 X;  2Y0S A;  4NHJ A;  1R58 A;  1Z7L A;  2XPV A;  2OCE A;  3MFK A;  5FLM J;  1YG2 A;  3E5U A;  4B47 A;  4B3A A;  4XK4 A;  2PMZ A;  2O8X A;  3RKY A;  1HDD C;  4ESB A;  3ZQL A;  4II3 A;  3SFZ A;  2LH9 A;  4I76 A;  2R3S A;  1LE8 B;  2EFO A;  5JVG F;  3BG3 A;  4YEJ A;  4L9V A;  2CQQ A;  1WQ2 A;  3ZP5 A;  2J5P A;  3VYU B;  1D5Y A;  3ABM H;  3ABU A;  1HKQ A;  4JBA A;  4M3F A;  2LOO A;  1ODD A;  1SD7 A;  3CME I;  4B8X A;  3OYF A;  2M87 A;  4RLQ A;  4BHB A;  2XAJ A;  4XSZ F;  3HC7 A;  3VYR B;  5FKO A;  2W84 A;  3FKI J;  3QRF F;  2HOE A;  3H5N A;  2HQ5 A;  1FTT A;  2NS7 A;  2YR2 A;  4EJW A;  3H92 A;  1WJC A;  2NOG A;  3AG3 H;  2A5W A;  1OCP A;  3DV8 A;  1A36 A;  4G6Q A;  2HZT A;  5LLQ A;  4YEL A;  5JVT A;  1F43 A;  3KIO A;  3IAS 2;  3BR5 A;  3RKW A;  4A3B J;  4YII A;  3I4M J;  1GVJ A;  2VN2 A;  2AO9 A;  1IW7 F;  2I5U A;  1MDM A;  1BI2 A;  3GVA A;  5J47 A;  1OFC X;  3S2W A;  2MFZ A;  2YU9 J;  2YU3 A;  2ME6 A;  4I98 B;  2Q8K A;  3GX4 X;  1A31 A;  1JGG A;  1W1W E;  4W97 A;  2UXN A;  3QPH A;  2OCC H;  3EUH C;  5HLH A;  1SVM A;  2HKX A;  1OPC A;  2MW8 A;  5J6X A;  2ZXJ A;  2F48 A;  2DCE A;  3U21 A;  2DA6 A;  1TNT A;  4A3L J;  4O6J A;  1TWG J;  1O4X A;  2BY0 A;  3GLX A;  2K9Q A;  5D4R A;  2EZL A;  2LR8 A;  3BDD A;  2V4J C;  3JRB A;  4OWR B;  3QOE A;  2XF6 A;  5GAH J;  4EJU A;  1Z6T A;  4CCL A;  1XC5 A;  2M0C A;  2L54 A;  5HS7 A;  4OIO F;  2A69 F;  3FXJ A;  4MQV A;  4KDP A;  2M5W A;  2P4W A;  3VSL A;  5CKT A;  1M1E B;  1U3E M;  2CUZ A;  5DDG A;  3ZOB A;  3HUG B;  1Z77 A;  2DOF A;  1VQ9 I;  2O9L A;  3HXL A;  4I2O A;  2L2O A;  3A02 A;  3BR2 A;  1YE9 A;  5ILV A;  3VYS B;  2Y0M A;  2P6S A;  4ZC3 A;  2L4M A;  4LLL A;  2BBY A;  2BOL A;  1D0X A;  2WAF A;  3F8N A;  4LG3 A;  3K4C A;  3L00 A;  4E7I A;  1LVA A;  2EZK A;  4RBO A;  2IT0 A;  1MMA A;  2CG4 A;  4P1W A;  1UHW A;  2E19 A;  3OYC A;  2JA8 J;  4XN0 A;  5K1Y A;  4LFU A;  2ZXH A;  2L7K A;  3BC8 A;  3KP3 A;  1WVR A;  4F93 B;  1YX5 A;  1D5V A;  2DMU A;  2NVU B;  5CQE A;  2HYJ A;  3BZK A;  3Q0V A;  4PJN A;  3RDI A;  2NVQ J;  3I4P A;  2NVY J;  5EZH A;  3BTL A;  4C2U A;  1RES A;  1NTC A;  5HS8 A;  2QQA A;  2EIK H;  1FYK A;  2O5R A;  2VKH A;  2R7X A;  3T1B A;  3W2A A;  3I55 I;  1R4N B;  4F52 A;  1PUE E;  2OPT A;  5HNH A;  3HIF A;  1QO0 D;  2KDO A;  3PIO F;  3BR0 A;  2RAE A;  1P4W A;  2IP2 A;  5LHG A;  2WBM A;  5L3G A;  1IC8 A;  4IVN A;  5DV5 A;  1J75 A;  4OIN F;  3D5S C;  3J80 K;  3K1N A;  3UKG A;  4U7B A;  2HXO A;  3KP7 A;  1A5J A;  2ZFW A;  4ZDP A;  3HL2 A;  1GXP A;  3ZQC A;  2HDD A;  3QU6 A;  1VZ0 A;  5FD6 A;  4DYC A;  2AQF A;  4KMF A;  1HOM A;  2QSF X;  1JKO C;  1UG0 A;  5DS9 A;  5BMZ A;  2IGO A;  5F08 A;  3FK6 A;  4EM2 A;  3RI4 A;  5J4V A;  3F72 A;  3O6B B;  1G2H A;  3ABT A;  1IUF A;  3M8E A;  2HDC A;  3DPU A;  1FIP A;  1KA8 A;  5LRR A;  1V4R A;  3I56 I;  2QKL B;  4FE7 A;  4L18 B;  2JVG A;  4AVP A;  2WY7 Q;  4LG0 A;  3BR6 A;  3S3N A;  1LFP A;  5DCF A;  1N25 A;  2KFD A;  5FLX Z;  4M73 A;  2DA1 A;  2Z2S B;  2FE3 A;  1MH3 A;  4PJJ A;  2NOJ B;  4C30 A;  3LWF A;  3ELK A;  1FOK A;  2E5N A;  3RYP A;  1VTN C;  5D5X B;  1SFO J;  2OF7 A;  5E3M A;  2PJR B;  3PNT A;  2CU7 A;  2HDW A;  3HHG A;  1W7P D;  4DNC A;  3G1O A;  3WHB A;  1K6Y A;  4RLF A;  3ZGK A;  2OQG A;  3C2B A;  1IN6 A;  1LFU P;  3HOX J;  3CJQ B;  2KIU A;  2QEX I;  1R22 A;  4XLA A;  1MMD A;  4RAG A;  4Q5S F;  4KA4 A;  2XAU A;  4E6K G;  2B7E A;  4HSR A;  3JSP A;  4C3H J;  3OY9 A;  1X58 A;  1XGM A;  4N4N B;  2PJP A;  1FBS A;  3K9T A;  4FX0 A;  3HKZ N;  2VB6 A;  2GXG A;  3VEP A;  2E35 A;  1FPQ A;  4B44 A;  3WOD F;  2LLK A;  4BQA A;  1OYW A;  4ITV A;  4GO1 A; 
#chains in the Genus database with same CATH homology
 1WI3 A;  2JMW A;  3Q0W A;  4AUX A;  4FTH A;  3S1R J;  2LFB A;  5J3L A;  4A3J J;  2L0K A;  2X6O A;  4QTR A;  2WAQ N;  1TWA J;  1U9O A;  3I4N J;  3IH2 A;  1XS9 A;  2LTP A;  1ZTR A;  2ID3 A;  5K7Z A;  1R9T J;  1K61 A;  2NVX J;  2MGQ A;  1ZR2 A;  4CYC B;  3LNQ A;  4A69 C;  5EZG A;  1Y1V J;  3BT9 A;  2FX0 A;  3VPR A;  3M3Y J;  4XRS A;  2XGD A;  4Y7N J;  1S7E A;  2R5Z A;  1MBH A;  4B4C A;  4FE4 A;  1UMQ A;  1W0U A;  1MSE C;  1GV5 A;  1HLV A;  4LOC A;  1VND A;  3K7A J;  4I6Z A;  2CUE A;  5F0F A;  5JLX A;  3HBL A;  2VPR A;  3S16 J;  3DCF A;  3W6V A;  2TRT A;  3GTO J;  3S14 J;  4AYB N;  1ETY A;  3TP3 A;  3L1P A;  4AC0 A;  2YUS A;  3HOV J;  2IAI A;  2DTZ A;  1JUP A;  2VKE A;  3SFI A;  4X1E A;  4XIC A;  2HI3 A;  3Q3S A;  3GTG J;  4C3J J;  4M3G A;  2EH3 A;  2XSD C;  1JT0 A;  5J1U A;  1WCM J;  3BG9 A;  4A3K J;  5GPA A;  2CQX A;  2I10 A;  3JRG A;  4A3I J;  1P7I A;  1H89 C;  1GUU A;  2E1O A;  2X48 A;  2Y0S N;  1JTX A;  3HOZ J;  3S15 J;  4FIS A;  2L7F P;  4W1U A;  2EBI A;  4A93 J;  3OOU A;  2DJN A;  1ZK8 A;  3IH3 A;  1JKQ C;  1APL C;  2LY9 A;  5EG0 B;  2PMZ N;  1H88 C;  1YRN A;  3HM5 A;  4JP0 A;  4G12 A;  4DZP A;  5DTD A;  3JRC A;  1B8I B;  5GP9 A;  3HB9 A;  2Y30 A;  5JLW A;  4C3I J;  2QCO A;  5J1R A;  1RKT A;  2K9S A;  2LVS A;  1F36 A;  5F27 A;  2EZH A;  5HOD A;  3PO3 J;  2WV1 A;  2M9H A;  2MSY A;  4IHV A;  3GTK J;  4A3C J;  2FQ4 A;  2DMN A;  2IEK A;  3BR1 A;  4NDL A;  3ZQG A;  3HDD A;  2DMQ A;  2HOT A;  3S2D J;  5FKL A;  1U78 A;  4MLO A;  5EYR A;  3D1N I;  2DA5 A;  4V2F A;  1ORK A;  2X9D A;  4MFD A;  2JA5 J;  4S0H B;  4BXX J;  3TED A;  1TC3 C;  3HGG A;  4JX4 A;  1ITY A;  4MIM A;  5EF6 A;  2DA7 A;  2R92 J;  1POG A;  2WB1 N;  5GPC A;  5BNG A;  1PUF A;  2M2E A;  1UG2 A;  2XGE A;  3GTL J;  2KDZ A;  1JUM A;  1GV2 A;  1A6I A;  2LD5 A;  2E2J J;  5IP6 A;  1RR7 A;  5E3O A;  3NAR A;  3DEW A;  2YS9 A;  4IEJ A;  5M3F J;  1U9N A;  3CCY A;  1GT0 C;  3JRD A;  1BW5 A;  3CDL A;  2L7Z A;  2COB A;  1JTY A;  5F0H A;  1B8I A;  4XRS G;  2R5Y B;  5EGO B;  1WH7 A;  1QPI A;  3JRI A;  4V2G A;  1JUS A;  4GFB A;  2G0E A;  3BQY A;  1IDY A;  2JJ7 A;  3HGY A;  2EQR A;  5M3M J;  2CRG A;  3MN2 A;  2VUM J;  1SAN A;  3BTJ A;  3HOY J;  3GTP J;  2XGC A;  2LK2 A;  3BR3 A;  3RKQ A;  3G1L A;  4UUT A;  2JA6 J;  2GM4 A;  5IPA A;  1X2N A;  5EEA A;  4MO7 A;  3A01 B;  4FCY A;  3FK7 A;  3QPL A;  2B63 J;  5EDN A;  2XPW A;  3CQZ J;  3BTI A;  3JRF A;  1HDP A;  3G1M A;  2VKV A;  4D7M A;  1IG7 A;  4XRM A;  3RZO J;  1XG1 A;  1RKW A;  3BTC A;  1FTZ A;  4D7N A;  3LSJ A;  3A03 A;  4QSH A;  3OIO A;  1JJ6 C;  1LFB A;  2DA4 A;  4BKX A;  3O8H A;  2N8G A;  3SDG A;  4BBR J;  2H8R A;  5M5X J;  3O8G A;  1X2M A;  3OSF A;  3SJM A;  1ETV A;  3F0C A;  4XID A;  5E3N A;  4A3E J;  4BY7 J;  1Z0X A;  3ZQH A;  3QQA A;  5FKK A;  2L7M P;  4B1R A;  5K7H A;  3M4O J;  1HF0 A;  2ID6 A;  3GTJ J;  4DYR A;  1MBJ A;  1ETO A;  4M3D A;  1DU0 A;  1E3O C;  2XB5 A;  3LSG A;  1IDZ A;  3JR9 A;  4C2M J;  2GBY A;  1TWF J;  2IBD A;  2E2H J;  4BY1 J;  4MFE A;  2L9R A;  1MBF A;  2JN6 A;  2NVT J;  4L5E A;  4Y52 J;  1TWC J;  1IV6 A;  2DMT A;  1AKH B;  2XB0 X;  9ANT A;  5IP9 J;  1QVT A;  2TCT A;  4A3M J;  2DN0 A;  1K83 J;  2XPV A;  5FLM J;  4CYC A;  4B3A A;  4XK4 A;  3HOU J;  1HDD C;  4D5F A;  3ZQL A;  4I76 A;  1LE8 B;  4UUS B;  3BG3 A;  2CQQ A;  1D5Y A;  4M3F A;  1AU7 A;  2XRL A;  1ETW A;  4D5C A;  3CMY A;  3GBG A;  2DMP A;  2FD5 A;  2Y9Z A;  2CUF A;  5FKO A;  3FKI J;  3S1Q J;  3Q0U A;  2HQ5 A;  4J19 A;  1FTT A;  4A3G J;  1MNM C;  2NS7 A;  2NOG A;  3RQI A;  3IV5 A;  1AHD P;  1OCP A;  1ETX A;  1FJL A;  4IHX A;  3FIW A;  4JYK A;  1NK3 P;  5FLV A;  5IOY A;  4JX6 A;  1F43 A;  2ELK A;  2R5Z B;  3BR5 A;  1B72 B;  4A3B J;  4BBS J;  1BA5 A;  3I4M J;  2AO9 A;  2QF7 A;  1WH5 A;  1OFC X;  5F0C A;  1ETQ A;  4EEF G;  2YU9 J;  2H1K A;  2ME6 A;  5FJ8 J;  1JGG A;  4W97 A;  5EG0 A;  2MW8 A;  5FKN A;  1MBK A;  2DA6 A;  4A3L J;  5IYD J;  1TWG J;  3B6C A;  1O4X A;  3E7L A;  5IP7 J;  1IRZ A;  2K9Q A;  2ZB9 A;  4A3D J;  4ABZ A;  4QIW N;  5F1J A;  2EZL A;  1NK2 P;  2LKX A;  3ZQI A;  2LR8 A;  1QRY A;  1EF4 A;  3H3V K;  3JRB A;  1U8B A;  3B6A A;  1XC5 A;  2M0C A;  1JJ8 C;  1DU6 A;  1CQT A;  1GDT A;  3MVP A;  4X6A J;  2MG4 A;  3ZQF A;  1ETK A;  3TP0 A;  3ZOB A;  1OCT C;  2HOA A;  1T56 A;  1BJZ A;  1Z77 A;  2XPU A;  3WHC A;  1ZGW A;  2DA3 A;  1YRN B;  2O9L A;  3A02 A;  2E2I J;  2R93 J;  3BR2 A;  2W48 A;  1WPK A;  1ZKG A;  3NAU A;  2HOS A;  2M8G X;  1FEX A;  2D5V A;  1MBG A;  5IOZ A;  2EZK A;  4RBO A;  3H0G J;  1BL0 A;  2E19 A;  4M6V A;  2JA8 J;  1T33 A;  2JWT A;  3BG5 A;  2DMU A;  1B72 A;  1BW6 A;  2HYJ A;  3Q0V A;  2NVQ J;  2NVY J;  5EZH A;  3BTL A;  3JRH A;  3S1N J;  4IHY A;  1RES A;  1NTC A;  3K2A A;  2DA2 A;  3HEF A;  4M3E A;  2Y31 A;  1MSF C;  2JK3 A;  5M5W J;  1JT6 A;  2OPT A;  3GTM J;  3IH4 A;  3BR0 A;  2RAE A;  2R5Y A;  5EGO A;  2R0Q C;  2GLO A;  2CJJ A;  1PUF B;  1IC8 A;  1ZQ3 P;  3UKG A;  3TW6 A;  3S1M J;  2HXO A;  4DW6 A;  2K9N A;  5FKM A;  1W0T A;  3BQZ A;  1Y1W J;  1FIA A;  1A5J A;  5IYB J;  3LSP A;  3ZQC A;  2HDD A;  3LSR A;  1OJL A;  3GTQ J;  4DYC A;  1HOM A;  3QPS A;  5C4X J;  1HCR A;  1JKO C;  5DS9 A;  3RZD J;  3A01 A;  5E3L A;  5F08 A;  3FK6 A;  4DYQ A;  1JKR C;  2ECC A;  4A3F J;  2M34 A;  1IGN A;  3LOC A;  4HNV A;  2Y9Y A;  1RET A;  1G2H A;  3S17 J;  5C44 J;  1IUF A;  1FIP A;  4FE7 A;  1VFC A;  2KT0 A;  2LP0 A;  2R7Z J;  2P81 A;  3BR6 A;  5IYC J;  5F04 A;  1H8A C;  1P7J A;  2K40 A;  1I3Q J;  2DA1 A;  1Q1V A;  1UHS A;  1MH3 A;  1QVU A;  3PM1 A;  1IJW C;  3FIS A;  1ENH A;  1MBE A;  2FJ1 A;  1SFO J;  2OF7 A;  5E3M A;  5C4J J;  2NS8 A;  2CU7 A;  2ECB A;  1VF9 A;  2O7O A;  2AHQ A;  3G1O A;  3S2H J;  3WHB A;  1MH4 A;  5J1Y A;  3HOW J;  3C2B A;  1LFU P;  2JA7 J;  2EZI A;  3HOX J;  2O8K A;  1TWH J;  1VI0 A;  3MKL A;  1WGX A;  1RPW A;  2HXI A;  2ME0 A;  2VI6 A;  5C3E J;  1AKH A;  4IHW A;  4M3B A;  4C3H J;  1I6H J;  5K7F A;  2Y2Z A;  4JX5 A;  4RDU A;  3JRE A;  1JKP C;  1X58 A;  4DZJ A;  1ZR4 A;  3OSG A;  3HKZ N;  3JRA A;  3PO2 J;  5M5Y J;  1GVD A;  2LLK A;  1LE8 A;  1I50 J;  4UUS A;  3TW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...