2RREA

Structure and function of the n-terminal nucleolin binding domain of nuclear valocine containing protein like 2 (nvl2) harboring a nucleolar localization signal
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
74
structure length
74
Chain Sequence
MKPRPGVFVDRKLKQRVIQYLSSNRCGKYVDTGILASDLQRLYSVDYGRRKRNAFRIQVEKVFSIISSEKELKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear protein
molecule keywords Putative uncharacterized protein
publication title Structure and function of the N-terminal nucleolin binding domain of nuclear valosin-containing protein-like 2 (NVL2) harboring a nucleolar localization signal
pubmed doi rcsb
source organism Mus musculus
total genus 14
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16725 Nucleolin_bd Nucleolin binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2010 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2rreA00
2RREA
chains in the Genus database with same CATH superfamily
3LA3A 2D2WA 2L7FP 2Z1DA 3M1EA 3Q0UA 3DKYA 3CCQI 1GLNA 3T0YA 1HOMA 4U7DA 3AL0B 5ICCA 1QO0D 1T56A 4AIDA 3ML6A 1ULYA 3CJTB 4OIRF 4IRIA 2KISA 4L0YB 1D0ZA 4DYRA 1JHHA 3ECOA 4JYKA 2XAJA 1HC8A 1H9GA 2HXOA 5D4RA 2EB7A 2WADA 2WWYA 1T08B 3K1MA 1C0WA 3ASOH 3WGGA 3CJQB 2H6CA 4PJMA 2OF7A 3H9GA 1JT0A 2HU9A 1J09A 4DYCA 3LL7A 1PDNC 3O8GA 4ENJA 2HI3A 1Z9CA 3M7GA 3CJRB 4Y3OA 2RQQA 2XF5A 2DA3A 3DTEA 2NVUB 5IY5H 3PSFA 3HOXJ 4CCMA 2NXNB 4Z2YA 4L9VA 3SHFA 3C3WA 3VPRA 1QHGA 2CYYA 3MEXA 3IAM2 1IGNA 1OR7C 5LD2C 1OCOH 3IKTA 3ZP5A 2BY1A 1LQ1A 4QSHA 2JSPA 4D7NA 2PMZA 3CF5F 2XPWA 3JRGA 4XN0A 4IHYA 1TQIA 4HQEA 3K0LA 4Y15A 2DI3A 1R5GA 2DTZA 4XSZF 2MC4A 3Q5FA 5CVRA 1VZ0A 2FOWA 4QPOA 3W6JB 5IP9J 4A3JJ 2VODA 2IS1A 1YHQI 3SFIA 2F4OB 2Q2EB 3CLOA 4PSXA 1U6GA 1S7EA 3HL2A 2E2JJ 1T33A 1R4NB 2DYSH 2L01A 4YG2F 4PCQA 3GYHX 4M3BA 3CCMI 1HKQA 1I3QJ 5LRSA 1F43A 2CRGA 5J8CA 3LSJA 5CYVA 5JR3A 2Z5UA 2KRHA 5L3FA 3E6CC 2ECCA 5M5YJ 2CUFA 1P4WA 3BR6A 2NNNA 1Z7UA 2GA2A 3CZ6A 2PEXA 5LHHA 5E8IA 3M1CA 1VNDA 1YE9A 1Y1VJ 4I01A 3KIOA 3QYEA 4ABZA 2LKXA 4CCJA 2F4MB 1Z3YA 4R1HA 1ACIA 3GFIA 3KCCA 5HNFA 1U5TA 5B3SH 4CGZA 1VQ8I 2JQ7A 2ELHA 3EYIA 4IXAA 5JFRA 4LFUA 2F2EA 3M07A 4P55A 1NG7A 5DCFA 4MEYF 1B8IA 1V5GA 2UXNA 3TOAA 1SC7A 3GW2A 4A5MA 3GZNB 4N4NB 3S1QJ 1QVUA 2V1DA 5E3NA 1XDUA 5D5WB 4XN3A 1B72A 4KJZA 4EV0A 1HSTA 4IVNA 1OYYA 4CDGA 1EV7A 2BY3A 4F3QA 3C7JA 4LLGF 3GEZA 1W4MA 2JVGA 4XLAA 2PI0A 2X1EA 3SXYA 3MKYB 2Z2SB 2TCTA 4NQWB 3RPUD 1IO2A 2LNBA 2A6HF 4MO7A 4ZZLA 4ANJA 3CUQC 4C3IJ 2M45A 2VBYA 3FZVA 1U5TB 3ZQCA 2DMNA 1ZN2A 3FXKA 5D6FA 1IF1A 2TRTA 3K4KA 3ASNH 3OYKA 2L5QA 3JSPA 1G59A 2X4HA 2IVMA 2VB6A 2XV4S 1U8RA 2EV6A 4MTDA 2HTJA 2O3FA 4GYGA 4PJLA 4UVBA 3N97A 3PQKA 4G12A 3AAFA 1R5ID 2Y0MA 4RM3A 2F5EA 1X3UA 4UB8C 1B72B 3BZCA 3HHGA 1JKRC 3WE2A 1QVTA 2Y0SA 1TTYA 3CMAI 2V6CA 1D1CA 2RDPA 3PM1A 2R5YA 3H35A 2CV2A 2L9VA 3P5JA 5GAHJ 1E3HA 1YX5A 3H0GJ 4RB0A 5H20A 3HSEA 1TW2A 2B9SA 2ZJPF 1Y8RB 3U1KA 1XTAA 1Z6TA 5E17F 3EUAA 3CCRI 4RDUA 1X1CA 3FMSA 4JBAA 1ZQ3P 4XKBA 2D1VA 5JI6A 3L2WA 4HF2A 3K1NA 1FYLA 2EQRA 2Z33A 3WTZA 5K5QA 3I4NJ 4B8XA 3IRRA 2PN6A 1MW7A 3WG9A 1G8XA 1QZYA 3OYCA 3WTWC 1IZ1A 4K2EA 1XMKA 2RKHA 2G7HA 3P9IA 1ETQA 5FKLA 1MNMC 3I64A 3OYFA 2IAIA 3KEYA 4L9NA 1ZRDA 4NUBA 2ADUA 1UZCA 4G6QA 1MBEA 2NAZA 3V7RA 5BPIA 2CW7A 5HLHA 4HNVA 5JHFA 2BXYA 5KNLA 1TWHJ 3ZMVA 2CUJA 4ETSA 3ZRGA 3K70C 1O3RA 2VXZA 3FISA 3J80K 2AHQA 2BYVE 4I6ZA 2EZIA 2RREA 3GO5A 3DF8A 1ETKA 2DMTA 3IL2A 2M34A 4E6KG 4XLCA 5DEQA 4CZZA 2AS5F 4NDLA 4UY8I 4Y13A 1SD4A 3F8MA 5M3FJ 4BXFA 1QPIA 2AO9A 4I0BA 5AONA 4XQFA 2VQHA 3BZKA 3H0DA 4WK8F 3ZCOA 1OMIA 4BQNA 3E6BA 4ENMA 2KIUA 1IDZA 3DTKA 3FXQA 2FU4A 4HNUA 3AL0C 4FX4A 2H27A 3HRSA 2DCEA 3D5RC 2H94A 3AKZA 2XC7A 3KP6A 1XGSA 2VKHA 3E5UA 4R8HA 4A0ZA 5LFAA 5HVQC 5IT3A 3CCEI 3QOEA 4UVCA 3P9CA 3ZQQA 3V8LA 4OIQF 2MD5A 5M5WJ 2FQ4A 4QPQA 4OIOF 1A36A 3ZPLA 2VJ4A 1S7OA 4IZZA 3K1PA 3FDYA 1H89C 4BEHA 2FMLA 3CC7I 2BOLA 3F72A 5E1XA 3WODF 4OIPF 1FSEA 3JTGA 1PVEA 2K02A 2XAHA 3BQZA 1UMQA 4F91B 4EJUA 5A2QK 3MZ8A 1VQNI 3ESWB 3MD2A 1R7JA 5C44J 1JJ8C 3GTGJ 1J75A 4M71A 4BE1A 2LY2A 3BR5A 4NBQA 1YO5C 2VBXA 3AG2H 2FQ3A 2O9LA 3FK6A 5K1YA 2ZXWH 1S8NA 3LSHA 4EJOA 2EWNA 1JT6A 2KMUA 1YS7A 5F08A 2FNPA 4UXNA 2L4AA 4BY7J 3L7WA 5FLXZ 3M9AA 2UZKA 1DP7P 1ZK8A 2QLZA 4LMYA 5HLIA 2MFZA 5LRRA 4OINF 1UAAA 4CA0A 4ZYAA 3QRFF 2G7UA 1Z3XA 4YEJA 4DBRA 1BR1A 3L2RA 3BTJA 1V4RA 2IGOA 1DGRM 2EIJH 3ECHA 2M7BA 1WVRA 3Q0VA 5GPAA 5CVIA 3UR3C 2HKOA 3WG7H 4BH9A 2M30A 2XSJC 3QYBA 4AD9A 2VJIA 3PL8A 4AC0A 1OCCH 1FJLA 5IP7J 1WH7A 3DEUA 1K83J 2DA4A 3HRMA 2KIMA 2XHKA 3WU1B 3GTKJ 3FKJA 1IN6A 5HS9A 4Y17A 3LQQA 3OYMA 2B0LA 3E97A 1KYZA 1ETOA 3IHUA 4A6DA 3HOZJ 2FXAA 1VQMI 3MVPA 2O8KA 5FGMA 3GWZA 4B3XA 4J19A 2VPRA 3O2PE 2W4SA 1USTA 1LVAA 2YU3A 3L1PA 3WTUC 3K10A 3UKGA 3NWSA 2EINH 3O6BB 4XMYA 4CCLA 4OWRB 4DZPA 3OYLA 2NOGA 2K5CA 2QQ9A 1HDPA 1MMGA 2LC2A 4OAZA 2F5FA 4BE2A 3HRUA 2L9NA 1AKHB 1NG6A 2Z9OA 2E7WA 2X1CA 2YR2A 5F0FA 3T1BA 2Y9ZA 1SFOJ 4OMYA 3S3MA 4HEA2 4XLNF 1JUSA 2F5CA 1JUPA 2VKDA 3KZYA 2FBIA 2HZTA 2L54A 2DDBA 3B6CA 4QIWN 3SDBA 2L7MP 2P8TA 2OCCH 4QTRA 3OYHA 3CDIA 1MBGA 3SQNA 2H8RA 4BQQA 4KN4X 1IXCA 2PJRA 2ID3A 1XSXA 2FSWA 3PFIA 1PP8F 4HSRA 3I58A 4FTHA 1DDNA 2VKEA 1W36C 4XKWA 4LB5A 3WGHA 4BKXA 2VBWA 4FE4A 1OFCX 1ETWA 4W1UA 4GFBA 2R92J 4YFKF 3DKWA 3PNYA 1U9OA 3RIRA 2QQ8A 3BPVA 4LITA 1N77A 2J5PA 5E3LA 2NVTJ 1U5TC 2HQ5A 2E2IJ 1BIBA 2OJED 4DGWB 4Y7NJ 3LOCA 1D0XA 1MDMB 3GFLA 5CVUA 1YYVA 5FD5A 2MH2A 3IRQA 2GAUA 5F0CA 4U87A 2ECBA 2MSYA 5FLMJ 2YU9J 1UB9A 2IA0A 1SD7A 1ON1A 3CUQA 2NRAC 2NYXA 2FUG2 4G7HF 1TWGJ 2YX4A 2V9KA 1I6XA 1W7PD 2DTRA 3FM3A 3IV5A 4JK1X 1BC8C 2GLOA 1D5YA 3Q0WA 3DBRB 4YFNF 3QPSA 2HOTA 3HUGB 1ZGWA 3RI4A 1R22A 3M8EA 5B5EC 3JAMK 2FX0A 3QQAA 1JKPC 2TDXA 4A5NA 5E1WA 4A3FJ 3WTTC 1WFXA 2FD5A 2VC1A 4RGSA 3D5SC 3FF5A 1LPQA 3HPGA 2A5WA 2X0LA 5L3DA 5E3MA 2EZHA 1SFUA 1ZKGA 2R7DA 3NRVA 2ZKZA 3I71A 1Z21A 5J8FA 1TWCJ 2K40A 1ON2A 1JUMA 1O3QA 1R23A 4LK0F 4A69C 2A6EF 2LP0A 5L3GA 2V6EA 2HOEA 3KYCB 2IPQX 4A3CJ 4L0ZB 2Y0SN 3DLLF 1XCBA 4HBLA 1U9NA 1NK3P 2KFDA 4Y52J 2M9HA 2W85A 3TQNA 3V8KA 1BBYA 3ZMSA 3KYDB 2BV6A 3H5NA 1IC8A 3RZOJ 3GFMA 4YRVA 3F0CA 2EV5A 1QHHD 1ZHFA 2COBA 4NC6A 2M8EA 3BJ6A 3IH2A 1D1AA 4AIHA 3S17J 4GCVA 4D9JA 1BI1A 3OV8A 2MH9A 2ACJA 2BW3A 3GTQJ 3H9QA 1V54H 2MD0A 4KUMA 2FNAA 2I10A 1K6YA 3COAC 1BI2A 1WJEA 2IS6A 1N75A 4WXHA 3J81K 2ZSIB 3FWEA 3SZPA 5LEKA 3A2KA 2EV0A 1R1UA 2XGCA 4RLFA 1H88C 5BOXA 3HGGA 2ESHA 2FEZA 4I7HA 1X4PA 2I8DA 2IBDA 4CYCA 3GXOA 4BHPA 4WF2A 3K4BA 3JRAA 1X2NA 2IXSA 3HYIA 1BM9A 1ITYA 1QQIA 3MN2A 4ZH4F 2VIXA 3I0TA 4BHCA 1VQ4I 4MQ9F 3K4MA 2M0MA 1KZHA 1HCRA 1VQ6I 4PK4A 4EGYA 4KNYA 3GBGA 2KJBA 2WA0A 2OA4A 1WSUA 1E17A 3KLNA 3TO6A 3F22A 2W82A 4HDVA 2BW3B 4AVZA 1IN8A 2JPCA 2DN0A 5H2FC 2EFOA 1JI8A 3LWFA 3CCJI 1G4DA 4V19K 4DJAA 3A03A 4BAYA 3ZN0A 2ICWG 4HG2A 2DMPA 1QNTA 3T8TA 2JTVA 3HJEA 4BBSJ 5E79C 5DYMA 1HLVA 2BEOA 4KFCA 1WJAA 3ABUA 2XRNA 2K7LA 2KHMA 2RNJA 3K4LA 2WC2A 2EFNA 5EYRA 3V42A 2R0QC 3SJMA 2DQRA 2X48A 2V79A 2K9SA 4CYCB 1KU3A 1V5FA 4GYIA 4JX6A 3W3CA 1Y1WJ 1E0EA 3OIQA 2KT0A 4YIRX 3OS2A 5DTDA 1ZARA 1D8JA 2JT1A 2LD5A 4IHVA 1OLTA 5FRMA 1RETA 3DBHB 1T95A 2ESNA 3FXOA 3A01B 3CP2A 3BT9A 4EVIA 3BDDA 3TO7A 2JSCA 3GLXA 4O6JA 2L4MA 2N8GA 2HPIA 1H0MA 2MYSA 2JA6J 2R7VA 1FOXA 3BCBA 3K7AJ 3BC8A 3BR2A 2R5ZB 1A6QA 2FBKA 2XAQA 5M5XJ 2R4GA 1SAUA 3DV8A 4C2MJ 3BY6A 2NNYA 2WY8Q 1XPXA 3HOWJ 5EGOB 5EG0B 1BC7C 1R5HA 1EF4A 2RC4A 2XF6A 1KGSA 1K78B 2VC0A 3GFJA 1Y0NA 3HDDA 2JA7J 4RMNA 1FMVA 1EH7A 1ZG3A 2QKLB 1I1GA 2L0KA 2Y9YA 2BHZA 2LF7A 2Q2EA 5DM6F 3E6DA 2G0EA 4KIFA 2DA7A 3ZMDA 4B47A 2DXIA 1B1BA 4RAGA 1IJWC 1BJAA 3DFGA 4NC7A 4IOCF 4BACA 4LGWA 3HB9A 1ORKA 4IRGA 1BOBA 3KLOA 4X6AJ 2A6TA 4Z6YA 2E2HJ 1ZYRF 3BG7A 2YPRA 2K4BA 3JRIA 3HG9A 1I1SA 4DQ2A 1LEAA 2IP2A 2J5OA 2NS0A 3VSLA 3H92A 2RN7A 4ZC3A 4X1EA 2GBYA 3F9KA 2E1NA 1P9QC 4M9SA 5DCMB 3AG4H 2BHYA 2QENA 5D5XB 5BQTA 3L2QA 1QA6A 4EMSA 5H6QA 5L3EA 1DPRA 2HVSA 1EH6A 5C4JJ 4B1RA 1B6AA 5GADJ 5J40A 1P6RA 1SANA 1WGXA 1XGOA 4O3MA 4HA8A 2F5VA 3FXRA 3FXJA 4E7KA 1Z1DA 4BNCA 1UHWA 1FTZA 4A12A 1Z67A 5BS6A 5E8GA 1NH3A 1RI7A 3TP3A 3F6OA 2OQRA 3H3VK 1IRGA 2M87A 1WJFA 5EZHA 4A3BJ 3OR2C 5BNGA 3LSTA 3GZ5A 3F23A 2VBZA 4G9YA 1WJDA 1R1VA 4W97A 4NQWA 3ZOBA 2X6OA 1HW1A 2IW5A 3Q9VA 1ZLJA 1J0RA 1KU7A 1MZBA 3WTXC 4N4OB 3E5QA 1FWZA 4XLEA 2BY2A 5CJ9A 3F8NA 3VB2A 4E7ZA 3OYJA 2RQPA 3BR1A 2XAUA 2XPUA 2OZUA 1AOYA 4M72A 1J9IA 5FKMA 2JA5J 4NHJA 2VQCA 1IXSB 1SVMA 2ZXIA 3OSGA 4PUSA 4XLPF 2OD5A 4G7OF 5K5RA 3IWZA 2JVHA 2Y2ZA 3HSRA 3GCMA 2E5ZA 1SVLA 1QU3A 2LVSA 4ZDOA 4LIVA 4MHGA 1B4AA 1W7PA 2P0WA 2QZ8A 1MJBA 3CF2A 4M3FA 1FMWA 2GXBA 1P7JA 2JPBA 4G8XA 4BJ5C 2CO5A 2Q0OA 3BZ6A 1ZRFA 5IOYA 2CV0A 1B9NA 3BWGA 4HW0A 3PFYA 3EUHC 3JRCA 2LKSA 4UHTA 4F93B 4M74A 4XRSG 2QQBA 2VL8A 4KMFA 4CSWA 2AXTC 1FYMA 2ZNYA 1AU7A 1REPC 4R79A 1T38A 4E7JA 4AYBA 1Q1VA 4M6XA 5HS7A 2JA2A 1L0OC 3HKZN 4D7MA 2E71A 4RBOA 1B9MA 1ZGJA 2DO7A 4HOBA 2VOPA 3KZIC 4J01A 2R7FA 3H5RA 5HOOA 1TQPA 3SZTA 4A3KJ 1OQYA 2CQNA 2I5UA 1YJNI 3DPUA 2R7SA 5HLTA 4P1WA 2H8WA 1SMTA 2K9QA 1W7PB 2V1NA 4FT8A 1SVOA 4FQGA 5CQGA 2GXGA 5FFXA 1LUJB 4BJ6C 4KIGA 4BBRJ 2X6XA 2YUSA 4A93J 1JHFA 4BDYA 5HDKA 1W0UA 1RKWA 1I5ZA 2EA4A 3K69A 2LRDA 3ROUA 1MJ9A 3TMOA 3OY9A 3KEOA 1BI3A 2ZCWA 3B6AA 3E6MA 1T6SA 3V8JA 4J00A 1I6HJ 1POGA 2V4JC 1QBJA 4HYEA 5F0HA 4BHBA 4IOAF 1YW8A 2KZVA 2COMA 5FKKA 4M3EA 1SAXA 3I5UA 2HOSA 3HOYJ 2CG4A 2DJNA 2HQAA 3FX3A 4LD5A 1MD0A 1WJ5A 2E1MB 2P7VB 3DP7A 1BW6A 4MGRA 1LVKA 1BJZA 2JN6A 3SYTA 2Y48A 1FZPB 3NEUA 4ESFA 2DAOA 4DBQA 3QPHA 4ZZDA 5FJ8J 2ISZA 2R7OA 2IJLA 1FOYA 1N25A 3BR0A 3JTHA 2WAFA 2CFOA 4IHSA 2Y31A 1JJ6C 2ZB9A 4MFEA 4KT5C 2GOXB 2OCEA 1HDDC 3U1DA 4X0GA 4PFPA 3TW6A 3ZN1A 1XN7A 2HQNA 1DU6A 1GXPA 2DBBA 2LSOA 3H9JA 3KFWX 5LGTA 3SDGA 3EYYA 2RV8A 3HPHA 4FETA 4E7LA 1FPQA 1V3FA 3CLQA 2HEOA 3MZHA 3CDLA 2RAEA 4M6VA 4JX4A 1RUNA 2YX7A 2DU9A 1TT5B 3ZQGA 2L9RA 4RLQA 4IHWA 4IEJA 2JJ7A 4UVAA 2W24A 1STZA 1ODDA 1RNLA 4QWQA 4B43A 4MFDA 4DYQA 4IO9F 3BG9A 5AIQA 4IX7A 1YLFA 1QPMA 3S2HJ 3OS1A 3H1CA 4BJTA 3OYBA 5E18F 2D1HA 1RR8C 3DPLC 3RYRA 1LFUP 3H36A 5FB2A 4EM2A 1FP1D 1UELB 1ERDA 1IRXA 4EATA 1Y8QB 4CYDA 1KQ8A 3ELKA 4IQJA 3JRFA 1WHUA 4IJAA 3K4NA 2OQGA 2PMHA 4D5FA 2CUEA 3OOPA 3MWMA 2HNHA 1OCRH 2WAEA 3ZR8X 5IT9K 1RPWA 5TISC 5ED4A 4HX8A 3KP4A 3S16J 1YITI 1E3PA 2ZFWA 1R6RA 2PG4A 1Z91A 2KIFA 2QKMB 3NWTA 3G73A 3RPQA 2IA1A 2E36A 1ENHA 2QSGX 1SD5A 1R58A 3S15J 4EGZA 3LFKA 5ILSA 2HKXA 2W57A 3GLLA 3E3VA 4WXCA 2ZMEB 1BI0A 2PX9A 2X6WA 2A61A 1YX3A 1VI0A 1WH5A 4FHTA 5C3EJ 5J47A 6PAXA 1PJRA 3BCAA 5F04A 4S04A 4BDZA 1HW2A 4OAYA 2LOOA 3KP3A 3CP8A 1WJCA 2E7XA 2XSDC 2STTA 4PGHA 5IPAA 3BOQA 4LOCA 2XGEA 2K86A 4GDFA 3BG6A 1WPKA 4LK1F 1AKHA 2P5KA 4MIMA 2HYJA 1J59A 4A0YA 3QU6A 3QODA 2KL4A 3KE2A 3R61A 2DA1A 3D5LA 4I0AA 5IYBJ 4U88A 4AWXB 4BXXJ 5KCMA 2CQ7A 2GA1A 3VOEA 1T2KA 3BROA 1O57A 3K2AA 2DFHA 4LLNA 2Y30A 4ITVA 2WTEA 2MBFA 3ABTA 2LKPA 3WU2C 2KDZA 3CD6I 5J1YA 2CQKA 2HYFA 2QSFX 2VOOA 5KHDA 2KJCA 2QQAA 1YJ9I 3F8BA 4AU7A 4ASNA 5JLWA 4XLHA 4M3DA 2OU2A 4CZCA 3QYFA 3TDUC 5DD8A 2ZSHB 4I76A 3WTSC 3JW4A 4EJTA 2EFQA 2W48A 3C2HA 4B44A 5EJCA 1RUOA 1HQCA 3JRDA 1F1ZA 3KP2A 4CUGA 4U7BA 1PUFB 3JAMZ 5HODA 1IUYA 3GVAA 2FOKA 1MDMA 2GIVA 5GTHC 3QWLA 2ETHA 1D1BA 2A05A 1HKTA 1ZRCA 4A3GJ 1EH8A 1IRFA 3K4CA 2XDVA 2ZBKA 4PJJA 4I99C 4B48A 3LAJA 2QA4I 3OIPA 3TKYA 1FNNA 3G1LA 2X85A 2JK3A 1AA7A 4XORA 2PFBA 3UNGC 5ICGA 5J1UA 3G3ZA 2LREA 4HQMA 4PJ0C 3MAJA 4IHXA 1X19A 2O0YA 2Q1ZB 4F55A 1TT0A 3VYTB 2DLLA 2Z3YA 1I39A 2ME0A 3HUGA 2X6YA 1YRNA 4GGGA 3ZQFA 1LE8A 3Q9SA 5EDNA 2PQ8A 2OV7A 5FLXK 4Q47A 1QZZA 2XPVA 2R7WA 2QSHX 3IAS2 3TEDA 2YSRA 4UV9A 1I50J 2QBYA 4L9TA 1OPCA 1O7LA 1I27A 1J2XA 2EZLA 2G9WA 2O7OA 4HZFA 1B59A 3ZXSA 3U9GA 2C6YA 1HW5A 3CDHA 3HOUJ 3S14J 3J7AO 2ZXHA 3HGYA 2F4IA 4XRSA 2M0CA 3M8FA 2OC6A 4YFXF 3CCUI 2HVQA 2CQXA 2IA2A 3PO3J 2BVLA 2LBFB 1ZGAA 4IRHA 2HR3A 5JVGF 3RPUA 1XGMA 5B1AH 4CH7A 1A5JA 1XMAA 3OOUA 2DJIA 2KRCA 3MKZA 3EUHA 2BVMA 2FA5A 4I09A 3I53A 1X1AA 2GZWA 1ZG1A 2YS9A 2KPMA 3HKZA 2EBIA 2V1XA 3R0JA 3MKLA 1YRNB 1LE8B 1O7FA 3RKYA 2KDOA 3ZQHA 1A35A 1P4AA 4L18B 2VQGA 1MH4A 2IT0A 1OJLA 1D0YA 2LK2A 3HRTA 5ICEA 2QBYB 4BUPA 1Z77A 5EEAA 5DM7F 2VUMJ 2EJRA 3HHHA 1F4KA 3LA2A 4RGRA 3CJNA 2BY0A 2OBPA 4M9XA 4U0WA 4AYBN 1CF7A 3PUBA 2JMWA 4PDKA 5E20A 1FTTA 4ESBA 1E3OC 1MMSA 3IC7A 5FD6A 3DEEA 2GQQA 3WHCA 2FMYA 1HBXG 3A4CA 1EKEA 1BA5A 2DFIA 2V26A 3QU3A 3SEZA 3FXMA 3JRHA 5DDGA 3I3LA 4A3LJ 2UWMA 2P4WA 4DZJA 3BJAA 2H1KA 1O3TA 1FOKA 1H9TA 1S7AA 2K27A 4XR6A 1VF9A 3W2AA 1ETYA 4BQOA 3TL4X 3HEFA 2QWWA 3MFKA 2D45A 1R49A 5JHUA 1OYIA 3A1YA 4UUTA 2WBMA 3WU0A 1MNEA 1U2WA 2DA5A 2CV1A 3DKXA 4LLLA 4Q4ZF 2OTJI 2AQFA 1RZ4A 5ERIA 3B02A 2CGPA 3H3ZA 2BZTA 4XLFA 2L2OA 2ME6A 1MGTA 3CQZJ 4FASD 1SFKA 3RCOA 3SFZA 1JTXA 1CF7B 2K85A 1UHMA 1XB4A 4KN7X 1X1BA 1G3TA 3H3UA 3G6EI 4RS8A 2Y69H 1LJ9A 1UJ8A 3QP5A 5JVTA 2RVCA 1BR2A 2XAGA 1MMNA 5DUIA 3D0SA 1LNWA 1X1DA 4XL9A 2D5VA 5LGUA 1TBXA 2FF4A 3L2UA 2BGCA 4MNUA 2GM4A 5D8LB 2QGUA 2ZC2A 3FHNA 2AQEA 4CICA 4A2UA 1HXDA 3MMYB 3FMRA 3N05A 1U0JA 2R7XA 3H5AA 3RJPA 1IN4A 4JOMA 2MW8A 3RZDJ 5E3OA 5J4VA 1XCVA 3L9FA 3A01A 3IP4B 3BG5A 2DOFA 1FT9A 2OPTA 4AM3A 2FBHA 1X3WB 1FIAA 4CO8A 1U8BA 2BE5F 4XBFA 3T8RA 3E5XA 3KP5A 4CHUA 1JKOC 4XRFA 1TNTA 3HTSB 3S1MJ 1KYWA 5LHIA 1QZEA 5HLGA 2R5ZA 4EJVA 2LY1A 5D6EA 4C30A 2NVQJ 1DU0A 3KP7A 2KIQA 4E7HA 1MBFA 3FM5A 1PUEE 3AG1H 5EG0A 5EGOA 3BTCA 2L7KA 4M6YA 1YG2A 1ZR4A 3HIFA 1DGWY 3BJOA 2IEKA 3PQJA 5J1RA 2JRTA 2LF8A 4F52A 3DEWA 3F6VA 4HLYA 1Q1HA 1XG1A 4I2OA 4L9JA 1WI9A 1K4SA 5DD4A 3E7LA 1UCRA 2CH0A 3BQYA 4D0PA 3WTYC 2EH3A 2KZGA 2CFXA 4ESJA 5FKOA 1ONVA 4RM2A 1HKSA 1NK2P 1YIOA 3T5XA 3JSOA 1VQOI 1HSJA 2QEXI 2OTLI 5CKTA 1KQ9A 4Q48A 1YQAA 1GVDA 3L09A 3DU6A 3ISPA 1D3YA 2GIZA 1L3LA 4II2A 3LMMA 2MABA 3HTUA 2NS7A 1Y6IA 4BY1J 3JCUC 4DIQA 4XK4A 3CMMA 3FKIJ 2VI6A 3ZQLA 3C2BA 2Q8KA 1Z05A 5DUKA 1S9HA 1MNDA 1MMDA 2JUGA 1W5CC 1X58A 5DCMA 3R4KA 2R7ZJ 1FOWA 4ZJZA 4Q5SF 5B66C 3C2GA 1P4XA 2A69F 5ILUA 4S05A 2CUZA 3CMYA 2JUCA 1MBHA 5D5UB 2A07F 2PBIA 1IV8A 2P6SA 2WV0A 2O61A 4HV5A 2B63J 2LR8A 3IKVA 1JGSA 2QM3A 2XB5A 3PIPF 4CCOA 1WCMJ 3OYGA 1LDKB 1G2HA 1R4MB 1W1WE 4IPAA 1KU2A 1VQKI 1IXRC 3K4JA 4L5IA 4B3AA 4ON0A 4M9ZA 3I55I 3DWLE 4LG0B 1WI3A 3JR9A 1FYKA 4A6EA 1O4XA 1QRYA 9ANTA 4EEFG 3P9KA 5BMZA 4BS9A 3N4MA 2ELKA 2P7CB 3ZQ7A 2UV1A 2X1DA 3G4SI 2W25A 4PFOA 1BIAA 4GXOA 3OL4A 4I98B 5IYCJ 2CJJA 1OCZH 2UUZA 2XIGA 4HSTA 3KPHA 3WE3A 2QUFA 2PLYA 3VSKA 1W5SA 2GOMA 4M73A 2E1CA 2DMUA 3MCZA 2XKPA 1S72I 2HWVA 1YI2I 1ZELA 2EIKH 4UNOA 2DFEA 2OZ6A 3I4MJ 1WRJA 2NOJB 3RQIA 3TDZC 1LFBA 3CMEI 4QLCU 1KA8A 3B73A 1AWCA 4C2UA 3O8HA 4HAMA 4C9YA 2VPLA 1W5TA 3OYIA 3S93A 4PSWA 3D1NI 3CCLI 2VLAA 1H8AC 4LG3A 1X3ZB 5HS8A 1HF0A 1T8IA 3HOVJ 5C4XJ 3V4GA 1KU9A 2M5WA 3F21A 2XB0X 1Y56A 1ZTRA 2RGVA 3E0JB 3QP6A 3GTPJ 3DU5A 1R71A 3LSRA 1K4TA 2LY9A 2FJ1A 4E70A 3ULQB 3CO6C 1FX7A 1G3SA 3TBIA 4II3A 5K7ZA 2OUMA 3VEPA 2VKVA 1J7KA 3ZQIA 3GUDA 3HSFA 2DW4A 1FLIA 4MEXF 4HPQA 2R93J 1YW9A 5IYDJ 2HS5A 4L5JA 5H6RA 2E19A 2V9PA 5K7FA 2DK8A 3CCSI 1P2FA 2R7TA 4XOTA 5KAFC 4LJZF 4FX0A 2QCOA 4L5EA 4YIIA 2L02A 3LA7A 3J7YJ 2KP6A 4DW6A 2K9MA 5GAGJ 2X51A 2JRMA 5FLVA 4KISA 1FC3A 2EA2A 1A6IA 5K7HA 4RB1A 3IWFA 2HQRA 3ABLH 4BQAA 2VN2A 2Z16A 3W2VA 2KRFA 3I56I 4XSXF 2XAFA 5EEHA 2EFWA 4WCGA 1LEBA 2IS2A 3PNVA 1GUUA 1TLHB 3P7NA 5J3LA 3HOSA 4HNTA 2E35A 4RB2C 1CGPA 1LB2A 3OR1C 1G6NA 1S6LA 3J80Z 1BR4A 3V7CA 2H1LA 3QPLA 3PNTA 1YW7A 1R9TJ 4ZYDA 1F9NA 1DUXC 2WAQN 1X2MA 4H4KC 1OCPA 3OSFA 2HOAA 2CSOA 2R7QA 2EZKA 3LFUA 4E7SA 2EIMH 4AIJA 4HX7A 3TO9A 3BTIA 1RKTA 4UB6C 5GAEJ 1VQ7I 1B8IB 1IV6A 4A3EJ 2IGKA 2XROA 1ZG5A 4ENNA 2EK5A 2F48A 3SZGA 4XKVA 4WXDA 2VASA 2XVCA 1VFCA 3FIWA 4KMUX 3ZMUA 3GX4X 2JWTA 4RA2A 1VQ9I 3J7AY 2UXXA 1VQPI 1P7IA 1UG0A 2IGNA 3RDIA 2GXAA 3M3YJ 1TWFJ 3MQ0A 5EEGA 5IT9Z 3JREA 1FP2A 2NS8A 4A3DJ 2XUBA 1IAWA 3V7SA 1R1TA 2KLOA 4JP0A 5A2QZ 4UV8A 3VYSB 1MSFC 1BW5A 1MBKA 3HC7A 4RAZA 3HXLA 5J6XA 2WB1A 3DBLB 1EJ9A 1TP4A 2NVYJ 2HYGD 4PZJA 1X4OA 1GDTA 2FE3A 2DFFA 3HZJA 3CCVI 2M7AA 2R7RA 1R00A 2VONA 2MLKA 3G1MA 1SD6A 3J7ZI 2A68F 2VXDA 4A0XA 2M8GX 3OYDA 4XICA 3AG3H 5IP6A 2A5YB 4YELA 1KONA 3PIOF 1NTCA 2DT6A 4RGUA 2R5YB 5F6FA 3VODA 4HRIA 4HF0A 3OYNA 3M8JA 1JE8A 1XC5A 3CCYA 4U0YA 1SMYF 3PJRA 3I9V2 2CWEA 2K9NA 1K78A 1XD7A 3K70D 1D5VA 3ERED 4G6DA 5AIPA 2IS4A 2K4JA 5HDNA 1JTYA 3RKQA 3FXUA 2CMPA 2VT2A 5BPDA 2W1OA 3I54A 2ID6A 1P92A 1GHCA 3TP0A 2ZMEA 3OYAA 3DLAA 3CESA 2HPMA 5LBQA 2K3FA 4EQQA 5D4SA 1U78A 3PSIA 2DPUA 1IG7A 4ENKA 2P81A 2LMDA 1E2XA 1Y39A 2PJPA 2MLGA 2PMUA 2HVRA 3DXJF 1W0TA 3RKXA 2OAZA 4N0BA 3SEQA 2ZXJA 3AFHA 2L9SA 4DNCA 4AIKA 3CC4I 4EM0B 4XKCA 4JQFA 2XKOA 2K3PA 1K7AA 5GTIC 3VYRB 2E34A 2P5VA 4PGGA 2QVOA 4BU2A 3M4OJ 2JA8J 1Z7LA 3FXLA 3RSNA 1T0FC 3W2WA 2WY7Q 2DOEA 1O3SA 3I59A 2M3AA 3WTVC 1GV5A 2BBYA 1FY7A 2HTSA 1MSEC 4NC8A 4OU0A 4KT6A 4HF1A 3ONQA 2E1OA 4IKFA 4N9IA 1IRZA 3L2VA 4S0HB 1RIOH 2VJ5A 4KYWA 1F36A 5CPRB 4DOZA 5HNHA 5F64A 2MG4A 3OS0A 5TRDA 5HDGA 1RR7A 1AHDP 1TZLA 2VE9A 1LDJA 1XSDA 1OCTC 1IN5A 2O5RA 4BYYA 2NVXJ 2H09A 4H0EA 4IQ4A 3VYUB 1VTNC 4OMZA 3W6VA 5DS9A 3S2WA 4GRIA 3ERMA 2XF7A 2X9DA 4ZYEA 4XM3A 5CVVA 3L2CA 3TOBA 4FCYA 2DOAA 2O6GE 2KKOA 5M3MJ 2W7NA 1FSHA 1PUFA 3I59B 3REOA 4XRMA 4A3IJ 4F92B 4CCKA 1WKMA 4C3HJ 2IRFG 2Z99A 3LSIA 5IOZA 2HDDA 1N78A 2M1BA 4E4HA 3W6KB 2DDAA 1XMXA 3LAPA 3L00A 1JGGA 3FBIB 3ABMH 2DYRH 3RKWA 1LKXA 4ZTFA 4D5CA 1BOAA 4BEHB 2K9LA 2O8XA 3S32A 4FE7A 3LNQA 5L3CA 1VQLI 1ZAOA 3LQRA 3NAUA 2M4KA 2HDCA 3DPTA 4V2FA 2MGQA 1GXQA 1SFEA 2W84A 3GTLJ 1WQ2A 1FBSA 4JX5A 1XSVA 1OR7A 5EF6A 2HGCA 3CTAA 3KYLA 1GV2A 1WWXA 5CQEA 2E5NA 2W00A 3KEQA 4B4CA 1MJAA 2DK5A 1FBUA 5D8KB 4WWCA 1IUFA 5LGNA 1UFMA 2ZNZA 3R6SA 4BGDA 2KQRA 3S2DJ 4EJWA 2DT7B 3G2BA 4Y33A 4G94A 1Z6RA 2AXLA 3F3XA 4RAFA 1IW7F 3QPTA 1T98A 1S5LC 3MKWB 3PUFA 2LTPA 1ETXA 2PMZN 2LBFA 3RTRA 4UUVA 4F7ZA 2MC3A 1V5EA 5F27A 3HOTA 2LYCA 3PO2J 5CVJA 1TL8A 2LG4A 2LDUA 1G3WA 1JXSA 4P5OA 4C2TA 1YJWI 4G6TB 2ZFUA 2ZJ2A 4AVPA 1FBQA 1U3EM 5K5OA 1F5TA 2XASA 5LHGA 3TW7A 1A31A 3S1RJ 5LLQA 1MMAA 4KDPA 4IL6C 3FHZA 3HM5A 2V7FA 1W36D 1FEXA 2MA3A 3EQLF 2V9VA 1WZ2A 5CLSA 3EPZA 2LLKA 4WX9A 2FRHA 1MH3A 4LB6B 3A02A 5LEJA 3GTJJ 2HXIA 5E1ZB 1DP3A 1IDYA 3GF2A 2DMQA 1S29A 2R3SA 1XGNA 5JLXA 3FBNB 1ETVA 1OKRA 4CXFA 2XGDA 1USSA 3BLYA 1GT0C 1PP7U 1YIJI 3S1NJ 2XRLA 4G7ZF 4MTEA 3WGIA 1A04A 2VQLA 5KAIC 2DPDA 2HDWA 3I4PA 3IUOA 1YTYA 1DPUA 1YS6A 5FO5A 3BR3A 2M2EA 4NNJA 1FIPA 1M1EB 2CQQA 4P9UA 3GTOJ 4OOIA 3WHBA 4LIUA 3FMQA 3J81Z 1V55H 2A3SA 3LSGA 2PJRB 3VWBA 1ZH5A 3S8PA 4P96A 2WAQA 2Y75A 5D5VB 3IH3A 2DA6A 1GVJA 3LSKA 1CQTA 1SEUA 1LDDA 2H6BA 3K2ZA 3U2RA 3GMEA 4U0VA 1RRJA 1IN7A 2RNGA 2QYOA 4UUSA 2M4GA 1J5YA 1K61A 3S3NA 2ZO4A 3BG3A 2F6CA 2E1MC 3C1DA 1HA8A 5ILVA 5GP9A 4NB5A 2QF7A 4ZYGA 3R60A 1PYVA 2VJJA 4IF4A 1APLC 3R0AA 3BP8A 2CW8A 2XGXA 3HBLA 4HLXA 5TGTA 1S3JA 4D1QA 3G71I 4EM1A 1T39A 4KITB 2EILH 3NQOA 2IGMA 1R36A 4KIBA 3VFZA 3NARA 3CUQB 1XDSA 3CUOA 3KX2A 4HV6A 4C3JJ 2P5LC 4ZDPA 3K6GA 2CS3A 3DCFA 3DQVC 3F8FA 2L3DA 1TQMA 1UG2A 3E1SA 4XONA 2R7UA 2L7ZA 3EUKL 3GZ6A 2JZYA 3EDPA 5B1BH 4UUSB 1VQ5I 3GTMJ 2LFBA 4FISA 1BN5A 1MKMA 3FK7A 3G1OA 2ZJRF 2DQLA 3Q3SA 3DTIA 1NHAA 4P9FA 3RYPA 4HDUA 2LH9A 4I02A 4RB3C 1TC3C 1KQ0A 4RAYA 5FFZA 3OMYA 2HFHA 3CO7C 1TWAJ 1K6OA 3KZZA 1MIJA 2P6TA 4CCNA 1YOVB 2B7EA 4BXUA 2WB1N 2STWA 2ZJQF 1UHSA 4M3GA 3JRBA 3ZMTA 5FRNA 3K9TA 5F1JA 2V1UA 5GPCA 5TJJA 3RQ4A 2WV1A 1QGPA 1MBJA 3ABKH 1TW3A 4ZDLA 2VE8A 2DODA 1X1PA 1Y0UA 1OYWA 4V2GA 2O03A 3A0BC 4BE0A 2E60A 2GWRA 3IH4A 2EPFA 2HZDA 5ICFA 4IHTA 3ZMZA 4ZYHA 4O5VA 3F8CA 2VT3A 3OIOA 5L3BA 5J4YA 3OYEA 3TGNA 3LSPA 1YFHA 3A0HC 1OISA 4YIFA 1D8KA 2ELJA 1Z0XA 4Y4RA 3BTLA 4BL0B 1SFXA 3MZYA 2ZMEC 3OL3A 3QAHA 5EZGA 2ISYA 4PJNA 1RESA 1ZREA 1RC9A 2DA2A 1K79A 3U21A 1T0FA 3ZGKA 4RGXA 1TNSA 2CW0F 2F5DA 4GO1A 2DT5A 1LFPA 2CU7A 1DQUA 4HX4A 5KK1A 1EA3A 4B09A 4KICA 1I3AA 3EETA 3C18A 1ZR2A 3X2QH 4MLOA 5FKNA 1BL0A 5DV5A 3S3OA 4N9HA 3LSMA 5FROA 1JKQC 5F1RA 4MQVA 3CC2I 4TV7A 4XNFA 4XOPA 4AUXA 3BPXA 3QOPA 1WJBA 4ZTJA 3VDXA 2BXZA 1XX5A 3O3KA 1ZLKA 4LG0A 2EFPA 4XIDA 1G3YA 3KETA 4KA4A 5KVRA 4A3MJ 1XS9A 4E7IA 3OWTA
chains in the Genus database with same CATH topology
3HOSA 4HNTA 2Z1DA 3HUGB 2X6WA 3OR1C 1YX3A 3DKYA 1BR4A 1GLNA 1PJRA 3BCAA 4BDZA 3AL0B 4OAYA 2LOOA 3PNTA 3CP8A 1D0ZA 1WJCA 1WFXA 4H4KC 3D5SC 3HPGA 2R7QA 2A5WA 3LFUA 4E7SA 2WADA 3BG6A 3CJQB 4PJMA 1Z21A 2IGKA 3H9GA 2HU9A 1J09A 3LL7A 3QODA 3SZGA 2KL4A 4XKVA 2V6EA 2VASA 3CJRB 4Y3OA 2RQQA 2XF5A 3DTEA 3D5LA 3J7AY 5KCMA 3H5NA 3PSFA 4CCMA 1UG0A 2IGNA 4ITVA 4YRVA 1QHGA 3IAM2 1QHHD 5KHDA 1OR7C 2KLOA 5LD2C 4AU7A 1D1AA 4XLHA 3VYSB 3HC7A 4CZCA 2JSPA 3QYFA 3HXLA 4D9JA 2PMZA 2WB1A 2ZSHB 2BW3A 1X4OA 3H9QA 4XN0A 3C2HA 4B44A 2M7AA 2R7RA 2MD0A 2MC4A 4CUGA 1K6YA 1VZ0A 4QPOA 1WJEA 4U7BA 2IS1A 2IS6A 1N75A 2Q2EB 2VXDA 3OYDA 2ZSIB 4PSXA 4YELA 3A2KA 1KONA 1D1BA 2DT6A 4RLFA 3HL2A 4PJJA 3K4CA 2XDVA 4HRIA 4B48A 1X4PA 2I8DA 3OYNA 3M8JA 3OIPA 3PJRA 2X85A 3K4BA 3I9V2 2IXSA 3K70D 1AA7A 4XORA 3UNGC 2IS4A 2VIXA 2KRHA 2LREA 1X19A 3K4MA 2CMPA 2M0MA 3CZ6A 2Q1ZB 4F55A 2W1OA 4PK4A 3M1CA 1TT0A 3VYTB 3GBGA 1YE9A 2WA0A 2X6YA 3QYEA 4CCJA 3OYAA 3DLAA 2W82A 1Z3YA 3CESA 2BW3B 2HPMA 4AVZA 3PSIA 2OV7A 5HNFA 2R7WA 1JI8A 3IAS2 4DJAA 2HVRA 4HG2A 3SEQA 3AFHA 2L9SA 3ZXSA 4XKCA 1NG7A 4JQFA 2ZXHA 2K3PA 2F4IA 1WJAA 3VYRB 4BU2A 1V5GA 2KHMA 3K4LA 3V42A 2OC6A 4N4NB 1Z7LA 2HVQA 3RSNA 2BVLA 1V5FA 1T0FC 3W3CA 2LBFB 3W2WA 2WY7Q 4XN3A 2M3AA 1E0EA 3OIQA 4CH7A 3OOUA 4KJZA 2DJIA 2KRCA 3OS2A 3MKZA 4NC8A 2BVMA 4KT6A 3ONQA 4F3QA 1X1AA 4IKFA 1OLTA 3L2VA 5FRMA 2VJ5A 2JVGA 1T95A 4XLAA 2KPMA 5CPRB 4DOZA 5HNHA 2X1EA 3CP2A 3HKZA 3MKYB 2Z2SB 3OS0A 4NQWB 3RPUD 1TZLA 2KDOA 4ANJA 2HPIA 2MYSA 2R7VA 3BCBA 3BC8A 2VQGA 2O5RA 1D0YA 3K4KA 3OYKA 4IQ4A 2L5QA 3VYUB 2R4GA 1SAUA 4BUPA 1G59A 4GRIA 2WY8Q 2XF7A 2VB6A 4XM3A 2XF6A 2DOAA 3PUBA 4PJLA 4RMNA 1FMVA 2W7NA 3DEEA 4RM3A 2QKLB 4F92B 3A4CA 4CCKA 2V26A 2Y0SA 3SEZA 3LSIA 1N78A 3I3LA 4B47A 1D1CA 4E4HA 2DXIA 2UWMA 3H35A 4NC7A 4BACA 2CV2A 3FBIB 4XR6A 1YX5A 3W2AA 1LKXA 4ZTFA 4BQOA 1BOBA 3TL4X 4BEHB 2K9LA 3S32A 2A6TA 3A1YA 3EUAA 2WBMA 1MNEA 1X1CA 2M4KA 3DPTA 3BG7A 2CV1A 3DKXA 3HG9A 2AQFA 4XKBA 3L2WA 4XLFA 2L2OA 3VSLA 3KYLA 5CQEA 4FASD 1SFKA 4ZC3A 2E5NA 2W00A 3RCOA 1MW7A 3F9KA 1G8XA 1P9QC 3L2QA 3OYCA 4BGDA 2KQRA 1X1BA 2DT7B 3G2BA 2HVSA 4Y33A 3OYFA 1BR2A 3KEYA 1MMNA 4NUBA 2F5VA 3MKWB 1X1DA 4E7KA 4XL9A 3L2UA 2LBFA 2CW7A 3RTRA 5JHFA 1V5EA 2AQEA 3FHNA 3HOTA 5KNLA 2LYCA 3MMYB 1WJFA 2CUJA 2LG4A 1U0JA 3N05A 3OR2C 2R7XA 3H5AA 3ZRGA 3K70C 4P5OA 4C2TA 4JOMA 4G6TB 2VXZA 2ZFUA 3IP4B 1WJDA 2RREA 1MMAA 2V7FA 1W36D 4E6KG 4XLCA 4N4OB 3EPZA 4BXFA 4XLEA 2LY1A 4C30A 4XQFA 2VQHA 4E7ZA 3H0DA 4E7HA 3OYJA 1DP3A 3ZCOA 2L7KA 2XAUA 3FBNB 4BQNA 1DGWY 3BLYA 3DTKA 4HNUA 3AL0C 4F52A 2VQCA 2ZXIA 2DCEA 4PUSA 3D5RC 2VQLA 2HDWA 3IUOA 3AKZA 2XC7A 2JVHA 2VKHA 4NNJA 5LFAA 5HVQC 2E5ZA 3QOEA 3ZQQA 1QU3A 2CH0A 4ZDOA 4LIVA 4QPQA 2P0WA 4LIUA 2VJ4A 4RM2A 4IZZA 3CF2A 1FMWA 3FDYA 4BEHA 3LSGA 5CKTA 2PJRB 3VWBA 2BOLA 3S8PA 2WAQA 3DU6A 4BJ5C 2CV0A 4F91B 3LSKA 4II2A 3LMMA 2MABA 3EUHC 3PFYA 1Y6IA 3MD2A 4F93B 4DIQA 2VL8A 4CSWA 3CMMA 2LY2A 4BE1A 4R79A 4E7JA 4AYBA 1S9HA 2RNGA 2JA2A 1MNDA 1MMDA 2JUGA 3LSHA 2M4GA 2KMUA 4ZJZA 3S3NA 2F6CA 2E1MC 1HA8A 3C2GA 4J01A 5HOOA 3H5RA 2CUZA 1PYVA 2VJJA 3DPUA 2CW8A 5HLTA 2R7SA 2MFZA 4P1WA 5TGTA 4D1QA 1UAAA 4CA0A 4ZYAA 2V1NA 4CCOA 5CQGA 1Z3XA 4BJ6C 4YEJA 4KITB 1LDKB 3OYGA 2X6XA 2IGMA 4DBRA 1BR1A 4BDYA 3L2RA 3K4JA 3KX2A 2IGOA 1DGRM 3UR3C 2M7BA 2LRDA 3TMOA 3OY9A 4ZDPA 3DWLE 3QYBA 2XSJC 2CS3A 3DQVC 3K6GA 2VJIA 3PL8A 4J00A 3E1SA 4BS9A 2V4JC 2UV1A 2X1DA 4XONA 4PFOA 2R7UA 3OL4A 3FKJA 3EUKL 2KZVA 2UUZA 3OYMA 4HSTA 3VSKA 2HQAA 4B3XA 1WJ5A 2E1MB 2GOMA 2W4SA 3DTIA 1LVKA 2LH9A 3K10A 3NWSA 1ZELA 3SYTA 4XMYA 4CCLA 4OWRB 3OMYA 3OYLA 2K5CA 4DBQA 4CCNA 2NOJB 1MMGA 2LC2A 4OAZA 4BE2A 2L9NA 1NG6A 2R7OA 2X1CA 4C2UA 5FRNA 2WAFA 2CFOA 3S3MA 4C9YA 4HEA2 2VPLA 2GOXB 3OYIA 3S93A 2VKDA 4PSWA 3RQ4A 2VLAA 4X0GA 4PFPA 4LG3A 4ZDLA 3SDBA 3H9JA 3OYHA 4BE0A 2E60A 3HPHA 4FETA 4BQQA 4E7LA 2HZDA 1Y56A 3E0JB 2PJRA 3DU5A 4HSRA 3TBIA 4II3A 3OYEA 2OUMA 1W36C 4RLQA 2ELJA 4XKWA 4Y4RA 4HPQA 4B43A 4BL0B 3OL3A 4IX7A 4PJNA 3OS1A 3PNYA 4BJTA 3U21A 3OYBA 2R7TA 1N77A 4LITA 4XOTA 3DPLC 3ZGKA 1UELB 1ERDA 1IRXA 2KP6A 4EATA 1LFPA 1DQUA 2K9MA 4DGWB 1EA3A 4IQJA 1D0XA 2X51A 3K4NA 4MLOA 4KISA 2HNHA 2WAEA 3ZR8X 3S3OA 3LSMA 4U87A 5FROA 4XNFA 4XOPA 2QKMB 1R6RA 1WJBA 2FUG2 3NWTA 3VDXA 4ZTJA 2Z16A 3W2VA 2V9KA 4E7IA 2IS2A 3PNVA 3OWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RRE A; 
#chains in the Genus database with same CATH topology
 3LA3 A;  2D2W A;  2L7F P;  2Z1D A;  3M1E A;  3Q0U A;  3DKY A;  3CCQ I;  1GLN A;  3T0Y A;  1HOM A;  4U7D A;  3AL0 B;  5ICC A;  1QO0 D;  1T56 A;  4AID A;  3ML6 A;  1ULY A;  3CJT B;  4OIR F;  4IRI A;  2KIS A;  4L0Y B;  1D0Z A;  4DYR A;  1JHH A;  3ECO A;  4JYK A;  2XAJ A;  1HC8 A;  1H9G A;  2HXO A;  5D4R A;  2EB7 A;  2WAD A;  2WWY A;  1T08 B;  3K1M A;  1C0W A;  3ASO H;  3WGG A;  3CJQ B;  2H6C A;  4PJM A;  2OF7 A;  3H9G A;  1JT0 A;  2HU9 A;  1J09 A;  4DYC A;  3LL7 A;  1PDN C;  3O8G A;  4ENJ A;  2HI3 A;  1Z9C A;  3M7G A;  3CJR B;  4Y3O A;  2RQQ A;  2XF5 A;  2DA3 A;  3DTE A;  2NVU B;  5IY5 H;  3PSF A;  3HOX J;  4CCM A;  2NXN B;  4Z2Y A;  4L9V A;  3SHF A;  3C3W A;  3VPR A;  1QHG A;  2CYY A;  3MEX A;  3IAM 2;  1IGN A;  1OR7 C;  5LD2 C;  1OCO H;  3IKT A;  3ZP5 A;  2BY1 A;  1LQ1 A;  4QSH A;  2JSP A;  4D7N A;  2PMZ A;  3CF5 F;  2XPW A;  3JRG A;  4XN0 A;  4IHY A;  1TQI A;  4HQE A;  3K0L A;  4Y15 A;  2DI3 A;  1R5G A;  2DTZ A;  4XSZ F;  2MC4 A;  3Q5F A;  5CVR A;  1VZ0 A;  2FOW A;  4QPO A;  3W6J B;  5IP9 J;  4A3J J;  2VOD A;  2IS1 A;  1YHQ I;  3SFI A;  2F4O B;  2Q2E B;  3CLO A;  4PSX A;  1U6G A;  1S7E A;  3HL2 A;  2E2J J;  1T33 A;  1R4N B;  2DYS H;  2L01 A;  4YG2 F;  4PCQ A;  3GYH X;  4M3B A;  3CCM I;  1HKQ A;  1I3Q J;  5LRS A;  1F43 A;  2CRG A;  5J8C A;  3LSJ A;  5CYV A;  5JR3 A;  2Z5U A;  2KRH A;  5L3F A;  3E6C C;  2ECC A;  5M5Y J;  2CUF A;  1P4W A;  3BR6 A;  2NNN A;  1Z7U A;  2GA2 A;  3CZ6 A;  2PEX A;  5LHH A;  5E8I A;  3M1C A;  1VND A;  1YE9 A;  1Y1V J;  4I01 A;  3KIO A;  3QYE A;  4ABZ A;  2LKX A;  4CCJ A;  2F4M B;  1Z3Y A;  4R1H A;  1ACI A;  3GFI A;  3KCC A;  5HNF A;  1U5T A;  5B3S H;  4CGZ A;  1VQ8 I;  2JQ7 A;  2ELH A;  3EYI A;  4IXA A;  5JFR A;  4LFU A;  2F2E A;  3M07 A;  4P55 A;  1NG7 A;  5DCF A;  4MEY F;  1B8I A;  1V5G A;  2UXN A;  3TOA A;  1SC7 A;  3GW2 A;  4A5M A;  3GZN B;  4N4N B;  3S1Q J;  1QVU A;  2V1D A;  5E3N A;  1XDU A;  5D5W B;  4XN3 A;  1B72 A;  4KJZ A;  4EV0 A;  1HST A;  4IVN A;  1OYY A;  4CDG A;  1EV7 A;  2BY3 A;  4F3Q A;  3C7J A;  4LLG F;  3GEZ A;  1W4M A;  2JVG A;  4XLA A;  2PI0 A;  2X1E A;  3SXY A;  3MKY B;  2Z2S B;  2TCT A;  4NQW B;  3RPU D;  1IO2 A;  2LNB A;  2A6H F;  4MO7 A;  4ZZL A;  4ANJ A;  3CUQ C;  4C3I J;  2M45 A;  2VBY A;  3FZV A;  1U5T B;  3ZQC A;  2DMN A;  1ZN2 A;  3FXK A;  5D6F A;  1IF1 A;  2TRT A;  3K4K A;  3ASN H;  3OYK A;  2L5Q A;  3JSP A;  1G59 A;  2X4H A;  2IVM A;  2VB6 A;  2XV4 S;  1U8R A;  2EV6 A;  4MTD A;  2HTJ A;  2O3F A;  4GYG A;  4PJL A;  4UVB A;  3N97 A;  3PQK A;  4G12 A;  3AAF A;  1R5I D;  2Y0M A;  4RM3 A;  2F5E A;  1X3U A;  4UB8 C;  1B72 B;  3BZC A;  3HHG A;  1JKR C;  3WE2 A;  1QVT A;  2Y0S A;  1TTY A;  3CMA I;  2V6C A;  1D1C A;  2RDP A;  3PM1 A;  2R5Y A;  3H35 A;  2CV2 A;  2L9V A;  3P5J A;  5GAH J;  1E3H A;  1YX5 A;  3H0G J;  4RB0 A;  5H20 A;  3HSE A;  1TW2 A;  2B9S A;  2ZJP F;  1Y8R B;  3U1K A;  1XTA A;  1Z6T A;  5E17 F;  3EUA A;  3CCR I;  4RDU A;  1X1C A;  3FMS A;  4JBA A;  1ZQ3 P;  4XKB A;  2D1V A;  5JI6 A;  3L2W A;  4HF2 A;  3K1N A;  1FYL A;  2EQR A;  2Z33 A;  3WTZ A;  5K5Q A;  3I4N J;  4B8X A;  3IRR A;  2PN6 A;  1MW7 A;  3WG9 A;  1G8X A;  1QZY A;  3OYC A;  3WTW C;  1IZ1 A;  4K2E A;  1XMK A;  2RKH A;  2G7H A;  3P9I A;  1ETQ A;  5FKL A;  1MNM C;  3I64 A;  3OYF A;  2IAI A;  3KEY A;  4L9N A;  1ZRD A;  4NUB A;  2ADU A;  1UZC A;  4G6Q A;  1MBE A;  2NAZ A;  3V7R A;  5BPI A;  2CW7 A;  5HLH A;  4HNV A;  5JHF A;  2BXY A;  5KNL A;  1TWH J;  3ZMV A;  2CUJ A;  4ETS A;  3ZRG A;  3K70 C;  1O3R A;  2VXZ A;  3FIS A;  3J80 K;  2AHQ A;  2BYV E;  4I6Z A;  2EZI A;  2RRE A;  3GO5 A;  3DF8 A;  1ETK A;  2DMT A;  3IL2 A;  2M34 A;  4E6K G;  4XLC A;  5DEQ A;  4CZZ A;  2AS5 F;  4NDL A;  4UY8 I;  4Y13 A;  1SD4 A;  3F8M A;  5M3F J;  4BXF A;  1QPI A;  2AO9 A;  4I0B A;  5AON A;  4XQF A;  2VQH A;  3BZK A;  3H0D A;  4WK8 F;  3ZCO A;  1OMI A;  4BQN A;  3E6B A;  4ENM A;  2KIU A;  1IDZ A;  3DTK A;  3FXQ A;  2FU4 A;  4HNU A;  3AL0 C;  4FX4 A;  2H27 A;  3HRS A;  2DCE A;  3D5R C;  2H94 A;  3AKZ A;  2XC7 A;  3KP6 A;  1XGS A;  2VKH A;  3E5U A;  4R8H A;  4A0Z A;  5LFA A;  5HVQ C;  5IT3 A;  3CCE I;  3QOE A;  4UVC A;  3P9C A;  3ZQQ A;  3V8L A;  4OIQ F;  2MD5 A;  5M5W J;  2FQ4 A;  4QPQ A;  4OIO F;  1A36 A;  3ZPL A;  2VJ4 A;  1S7O A;  4IZZ A;  3K1P A;  3FDY A;  1H89 C;  4BEH A;  2FML A;  3CC7 I;  2BOL A;  3F72 A;  5E1X A;  3WOD F;  4OIP F;  1FSE A;  3JTG A;  1PVE A;  2K02 A;  2XAH A;  3BQZ A;  1UMQ A;  4F91 B;  4EJU A;  5A2Q K;  3MZ8 A;  1VQN I;  3ESW B;  3MD2 A;  1R7J A;  5C44 J;  1JJ8 C;  3GTG J;  1J75 A;  4M71 A;  4BE1 A;  2LY2 A;  3BR5 A;  4NBQ A;  1YO5 C;  2VBX A;  3AG2 H;  2FQ3 A;  2O9L A;  3FK6 A;  5K1Y A;  2ZXW H;  1S8N A;  3LSH A;  4EJO A;  2EWN A;  1JT6 A;  2KMU A;  1YS7 A;  5F08 A;  2FNP A;  4UXN A;  2L4A A;  4BY7 J;  3L7W A;  5FLX Z;  3M9A A;  2UZK A;  1DP7 P;  1ZK8 A;  2QLZ A;  4LMY A;  5HLI A;  2MFZ A;  5LRR A;  4OIN F;  1UAA A;  4CA0 A;  4ZYA A;  3QRF F;  2G7U A;  1Z3X A;  4YEJ A;  4DBR A;  1BR1 A;  3L2R A;  3BTJ A;  1V4R A;  2IGO A;  1DGR M;  2EIJ H;  3ECH A;  2M7B A;  1WVR A;  3Q0V A;  5GPA A;  5CVI A;  3UR3 C;  2HKO A;  3WG7 H;  4BH9 A;  2M30 A;  2XSJ C;  3QYB A;  4AD9 A;  2VJI A;  3PL8 A;  4AC0 A;  1OCC H;  1FJL A;  5IP7 J;  1WH7 A;  3DEU A;  1K83 J;  2DA4 A;  3HRM A;  2KIM A;  2XHK A;  3WU1 B;  3GTK J;  3FKJ A;  1IN6 A;  5HS9 A;  4Y17 A;  3LQQ A;  3OYM A;  2B0L A;  3E97 A;  1KYZ A;  1ETO A;  3IHU A;  4A6D A;  3HOZ J;  2FXA A;  1VQM I;  3MVP A;  2O8K A;  5FGM A;  3GWZ A;  4B3X A;  4J19 A;  2VPR A;  3O2P E;  2W4S A;  1UST A;  1LVA A;  2YU3 A;  3L1P A;  3WTU C;  3K10 A;  3UKG A;  3NWS A;  2EIN H;  3O6B B;  4XMY A;  4CCL A;  4OWR B;  4DZP A;  3OYL A;  2NOG A;  2K5C A;  2QQ9 A;  1HDP A;  1MMG A;  2LC2 A;  4OAZ A;  2F5F A;  4BE2 A;  3HRU A;  2L9N A;  1AKH B;  1NG6 A;  2Z9O A;  2E7W A;  2X1C A;  2YR2 A;  5F0F A;  3T1B A;  2Y9Z A;  1SFO J;  4OMY A;  3S3M A;  4HEA 2;  4XLN F;  1JUS A;  2F5C A;  1JUP A;  2VKD A;  3KZY A;  2FBI A;  2HZT A;  2L54 A;  2DDB A;  3B6C A;  4QIW N;  3SDB A;  2L7M P;  2P8T A;  2OCC H;  4QTR A;  3OYH A;  3CDI A;  1MBG A;  3SQN A;  2H8R A;  4BQQ A;  4KN4 X;  1IXC A;  2PJR A;  2ID3 A;  1XSX A;  2FSW A;  3PFI A;  1PP8 F;  4HSR A;  3I58 A;  4FTH A;  1DDN A;  2VKE A;  1W36 C;  4XKW A;  4LB5 A;  3WGH A;  4BKX A;  2VBW A;  4FE4 A;  1OFC X;  1ETW A;  4W1U A;  4GFB A;  2R92 J;  4YFK F;  3DKW A;  3PNY A;  1U9O A;  3RIR A;  2QQ8 A;  3BPV A;  4LIT A;  1N77 A;  2J5P A;  5E3L A;  2NVT J;  1U5T C;  2HQ5 A;  2E2I J;  1BIB A;  2OJE D;  4DGW B;  4Y7N J;  3LOC A;  1D0X A;  1MDM B;  3GFL A;  5CVU A;  1YYV A;  5FD5 A;  2MH2 A;  3IRQ A;  2GAU A;  5F0C A;  4U87 A;  2ECB A;  2MSY A;  5FLM J;  2YU9 J;  1UB9 A;  2IA0 A;  1SD7 A;  1ON1 A;  3CUQ A;  2NRA C;  2NYX A;  2FUG 2;  4G7H F;  1TWG J;  2YX4 A;  2V9K A;  1I6X A;  1W7P D;  2DTR A;  3FM3 A;  3IV5 A;  4JK1 X;  1BC8 C;  2GLO A;  1D5Y A;  3Q0W A;  3DBR B;  4YFN F;  3QPS A;  2HOT A;  3HUG B;  1ZGW A;  3RI4 A;  1R22 A;  3M8E A;  5B5E C;  3JAM K;  2FX0 A;  3QQA A;  1JKP C;  2TDX A;  4A5N A;  5E1W A;  4A3F J;  3WTT C;  1WFX A;  2FD5 A;  2VC1 A;  4RGS A;  3D5S C;  3FF5 A;  1LPQ A;  3HPG A;  2A5W A;  2X0L A;  5L3D A;  5E3M A;  2EZH A;  1SFU A;  1ZKG A;  2R7D A;  3NRV A;  2ZKZ A;  3I71 A;  1Z21 A;  5J8F A;  1TWC J;  2K40 A;  1ON2 A;  1JUM A;  1O3Q A;  1R23 A;  4LK0 F;  4A69 C;  2A6E F;  2LP0 A;  5L3G A;  2V6E A;  2HOE A;  3KYC B;  2IPQ X;  4A3C J;  4L0Z B;  2Y0S N;  3DLL F;  1XCB A;  4HBL A;  1U9N A;  1NK3 P;  2KFD A;  4Y52 J;  2M9H A;  2W85 A;  3TQN A;  3V8K A;  1BBY A;  3ZMS A;  3KYD B;  2BV6 A;  3H5N A;  1IC8 A;  3RZO J;  3GFM A;  4YRV A;  3F0C A;  2EV5 A;  1QHH D;  1ZHF A;  2COB A;  4NC6 A;  2M8E A;  3BJ6 A;  3IH2 A;  1D1A A;  4AIH A;  3S17 J;  4GCV A;  4D9J A;  1BI1 A;  3OV8 A;  2MH9 A;  2ACJ A;  2BW3 A;  3GTQ J;  3H9Q A;  1V54 H;  2MD0 A;  4KUM A;  2FNA A;  2I10 A;  1K6Y A;  3COA C;  1BI2 A;  1WJE A;  2IS6 A;  1N75 A;  4WXH A;  3J81 K;  2ZSI B;  3FWE A;  3SZP A;  5LEK A;  3A2K A;  2EV0 A;  1R1U A;  2XGC A;  4RLF A;  1H88 C;  5BOX A;  3HGG A;  2ESH A;  2FEZ A;  4I7H A;  1X4P A;  2I8D A;  2IBD A;  4CYC A;  3GXO A;  4BHP A;  4WF2 A;  3K4B A;  3JRA A;  1X2N A;  2IXS A;  3HYI A;  1BM9 A;  1ITY A;  1QQI A;  3MN2 A;  4ZH4 F;  2VIX A;  3I0T A;  4BHC A;  1VQ4 I;  4MQ9 F;  3K4M A;  2M0M A;  1KZH A;  1HCR A;  1VQ6 I;  4PK4 A;  4EGY A;  4KNY A;  3GBG A;  2KJB A;  2WA0 A;  2OA4 A;  1WSU A;  1E17 A;  3KLN A;  3TO6 A;  3F22 A;  2W82 A;  4HDV A;  2BW3 B;  4AVZ A;  1IN8 A;  2JPC A;  2DN0 A;  5H2F C;  2EFO A;  1JI8 A;  3LWF A;  3CCJ I;  1G4D A;  4V19 K;  4DJA A;  3A03 A;  4BAY A;  3ZN0 A;  2ICW G;  4HG2 A;  2DMP A;  1QNT A;  3T8T A;  2JTV A;  3HJE A;  4BBS J;  5E79 C;  5DYM A;  1HLV A;  2BEO A;  4KFC A;  1WJA A;  3ABU A;  2XRN A;  2K7L A;  2KHM A;  2RNJ A;  3K4L A;  2WC2 A;  2EFN A;  5EYR A;  3V42 A;  2R0Q C;  3SJM A;  2DQR A;  2X48 A;  2V79 A;  2K9S A;  4CYC B;  1KU3 A;  1V5F A;  4GYI A;  4JX6 A;  3W3C A;  1Y1W J;  1E0E A;  3OIQ A;  2KT0 A;  4YIR X;  3OS2 A;  5DTD A;  1ZAR A;  1D8J A;  2JT1 A;  2LD5 A;  4IHV A;  1OLT A;  5FRM A;  1RET A;  3DBH B;  1T95 A;  2ESN A;  3FXO A;  3A01 B;  3CP2 A;  3BT9 A;  4EVI A;  3BDD A;  3TO7 A;  2JSC A;  3GLX A;  4O6J A;  2L4M A;  2N8G A;  2HPI A;  1H0M A;  2MYS A;  2JA6 J;  2R7V A;  1FOX A;  3BCB A;  3K7A J;  3BC8 A;  3BR2 A;  2R5Z B;  1A6Q A;  2FBK A;  2XAQ A;  5M5X J;  2R4G A;  1SAU A;  3DV8 A;  4C2M J;  3BY6 A;  2NNY A;  2WY8 Q;  1XPX A;  3HOW J;  5EGO B;  5EG0 B;  1BC7 C;  1R5H A;  1EF4 A;  2RC4 A;  2XF6 A;  1KGS A;  1K78 B;  2VC0 A;  3GFJ A;  1Y0N A;  3HDD A;  2JA7 J;  4RMN A;  1FMV A;  1EH7 A;  1ZG3 A;  2QKL B;  1I1G A;  2L0K A;  2Y9Y A;  2BHZ A;  2LF7 A;  2Q2E A;  5DM6 F;  3E6D A;  2G0E A;  4KIF A;  2DA7 A;  3ZMD A;  4B47 A;  2DXI A;  1B1B A;  4RAG A;  1IJW C;  1BJA A;  3DFG A;  4NC7 A;  4IOC F;  4BAC A;  4LGW A;  3HB9 A;  1ORK A;  4IRG A;  1BOB A;  3KLO A;  4X6A J;  2A6T A;  4Z6Y A;  2E2H J;  1ZYR F;  3BG7 A;  2YPR A;  2K4B A;  3JRI A;  3HG9 A;  1I1S A;  4DQ2 A;  1LEA A;  2IP2 A;  2J5O A;  2NS0 A;  3VSL A;  3H92 A;  2RN7 A;  4ZC3 A;  4X1E A;  2GBY A;  3F9K A;  2E1N A;  1P9Q C;  4M9S A;  5DCM B;  3AG4 H;  2BHY A;  2QEN A;  5D5X B;  5BQT A;  3L2Q A;  1QA6 A;  4EMS A;  5H6Q A;  5L3E A;  1DPR A;  2HVS A;  1EH6 A;  5C4J J;  4B1R A;  1B6A A;  5GAD J;  5J40 A;  1P6R A;  1SAN A;  1WGX A;  1XGO A;  4O3M A;  4HA8 A;  2F5V A;  3FXR A;  3FXJ A;  4E7K A;  1Z1D A;  4BNC A;  1UHW A;  1FTZ A;  4A12 A;  1Z67 A;  5BS6 A;  5E8G A;  1NH3 A;  1RI7 A;  3TP3 A;  3F6O A;  2OQR A;  3H3V K;  1IRG A;  2M87 A;  1WJF A;  5EZH A;  4A3B J;  3OR2 C;  5BNG A;  3LST A;  3GZ5 A;  3F23 A;  2VBZ A;  4G9Y A;  1WJD A;  1R1V A;  4W97 A;  4NQW A;  3ZOB A;  2X6O A;  1HW1 A;  2IW5 A;  3Q9V A;  1ZLJ A;  1J0R A;  1KU7 A;  1MZB A;  3WTX C;  4N4O B;  3E5Q A;  1FWZ A;  4XLE A;  2BY2 A;  5CJ9 A;  3F8N A;  3VB2 A;  4E7Z A;  3OYJ A;  2RQP A;  3BR1 A;  2XAU A;  2XPU A;  2OZU A;  1AOY A;  4M72 A;  1J9I A;  5FKM A;  2JA5 J;  4NHJ A;  2VQC A;  1IXS B;  1SVM A;  2ZXI A;  3OSG A;  4PUS A;  4XLP F;  2OD5 A;  4G7O F;  5K5R A;  3IWZ A;  2JVH A;  2Y2Z A;  3HSR A;  3GCM A;  2E5Z A;  1SVL A;  1QU3 A;  2LVS A;  4ZDO A;  4LIV A;  4MHG A;  1B4A A;  1W7P A;  2P0W A;  2QZ8 A;  1MJB A;  3CF2 A;  4M3F A;  1FMW A;  2GXB A;  1P7J A;  2JPB A;  4G8X A;  4BJ5 C;  2CO5 A;  2Q0O A;  3BZ6 A;  1ZRF A;  5IOY A;  2CV0 A;  1B9N A;  3BWG A;  4HW0 A;  3PFY A;  3EUH C;  3JRC A;  2LKS A;  4UHT A;  4F93 B;  4M74 A;  4XRS G;  2QQB A;  2VL8 A;  4KMF A;  4CSW A;  2AXT C;  1FYM A;  2ZNY A;  1AU7 A;  1REP C;  4R79 A;  1T38 A;  4E7J A;  4AYB A;  1Q1V A;  4M6X A;  5HS7 A;  2JA2 A;  1L0O C;  3HKZ N;  4D7M A;  2E71 A;  4RBO A;  1B9M A;  1ZGJ A;  2DO7 A;  4HOB A;  2VOP A;  3KZI C;  4J01 A;  2R7F A;  3H5R A;  5HOO A;  1TQP A;  3SZT A;  4A3K J;  1OQY A;  2CQN A;  2I5U A;  1YJN I;  3DPU A;  2R7S A;  5HLT A;  4P1W A;  2H8W A;  1SMT A;  2K9Q A;  1W7P B;  2V1N A;  4FT8 A;  1SVO A;  4FQG A;  5CQG A;  2GXG A;  5FFX A;  1LUJ B;  4BJ6 C;  4KIG A;  4BBR J;  2X6X A;  2YUS A;  4A93 J;  1JHF A;  4BDY A;  5HDK A;  1W0U A;  1RKW A;  1I5Z A;  2EA4 A;  3K69 A;  2LRD A;  3ROU A;  1MJ9 A;  3TMO A;  3OY9 A;  3KEO A;  1BI3 A;  2ZCW A;  3B6A A;  3E6M A;  1T6S A;  3V8J A;  4J00 A;  1I6H J;  1POG A;  2V4J C;  1QBJ A;  4HYE A;  5F0H A;  4BHB A;  4IOA F;  1YW8 A;  2KZV A;  2COM A;  5FKK A;  4M3E A;  1SAX A;  3I5U A;  2HOS A;  3HOY J;  2CG4 A;  2DJN A;  2HQA A;  3FX3 A;  4LD5 A;  1MD0 A;  1WJ5 A;  2E1M B;  2P7V B;  3DP7 A;  1BW6 A;  4MGR A;  1LVK A;  1BJZ A;  2JN6 A;  3SYT A;  2Y48 A;  1FZP B;  3NEU A;  4ESF A;  2DAO A;  4DBQ A;  3QPH A;  4ZZD A;  5FJ8 J;  2ISZ A;  2R7O A;  2IJL A;  1FOY A;  1N25 A;  3BR0 A;  3JTH A;  2WAF A;  2CFO A;  4IHS A;  2Y31 A;  1JJ6 C;  2ZB9 A;  4MFE A;  4KT5 C;  2GOX B;  2OCE A;  1HDD C;  3U1D A;  4X0G A;  4PFP A;  3TW6 A;  3ZN1 A;  1XN7 A;  2HQN A;  1DU6 A;  1GXP A;  2DBB A;  2LSO A;  3H9J A;  3KFW X;  5LGT A;  3SDG A;  3EYY A;  2RV8 A;  3HPH A;  4FET A;  4E7L A;  1FPQ A;  1V3F A;  3CLQ A;  2HEO A;  3MZH A;  3CDL A;  2RAE A;  4M6V A;  4JX4 A;  1RUN A;  2YX7 A;  2DU9 A;  1TT5 B;  3ZQG A;  2L9R A;  4RLQ A;  4IHW A;  4IEJ A;  2JJ7 A;  4UVA A;  2W24 A;  1STZ A;  1ODD A;  1RNL A;  4QWQ A;  4B43 A;  4MFD A;  4DYQ A;  4IO9 F;  3BG9 A;  5AIQ A;  4IX7 A;  1YLF A;  1QPM A;  3S2H J;  3OS1 A;  3H1C A;  4BJT A;  3OYB A;  5E18 F;  2D1H A;  1RR8 C;  3DPL C;  3RYR A;  1LFU P;  3H36 A;  5FB2 A;  4EM2 A;  1FP1 D;  1UEL B;  1ERD A;  1IRX A;  4EAT A;  1Y8Q B;  4CYD A;  1KQ8 A;  3ELK A;  4IQJ A;  3JRF A;  1WHU A;  4IJA A;  3K4N A;  2OQG A;  2PMH A;  4D5F A;  2CUE A;  3OOP A;  3MWM A;  2HNH A;  1OCR H;  2WAE A;  3ZR8 X;  5IT9 K;  1RPW A;  5TIS C;  5ED4 A;  4HX8 A;  3KP4 A;  3S16 J;  1YIT I;  1E3P A;  2ZFW A;  1R6R A;  2PG4 A;  1Z91 A;  2KIF A;  2QKM B;  3NWT A;  3G73 A;  3RPQ A;  2IA1 A;  2E36 A;  1ENH A;  2QSG X;  1SD5 A;  1R58 A;  3S15 J;  4EGZ A;  3LFK A;  5ILS A;  2HKX A;  2W57 A;  3GLL A;  3E3V A;  4WXC A;  2ZME B;  1BI0 A;  2PX9 A;  2X6W A;  2A61 A;  1YX3 A;  1VI0 A;  1WH5 A;  4FHT A;  5C3E J;  5J47 A;  6PAX A;  1PJR A;  3BCA A;  5F04 A;  4S04 A;  4BDZ A;  1HW2 A;  4OAY A;  2LOO A;  3KP3 A;  3CP8 A;  1WJC A;  2E7X A;  2XSD C;  2STT A;  4PGH A;  5IPA A;  3BOQ A;  4LOC A;  2XGE A;  2K86 A;  4GDF A;  3BG6 A;  1WPK A;  4LK1 F;  1AKH A;  2P5K A;  4MIM A;  2HYJ A;  1J59 A;  4A0Y A;  3QU6 A;  3QOD A;  2KL4 A;  3KE2 A;  3R61 A;  2DA1 A;  3D5L A;  4I0A A;  5IYB J;  4U88 A;  4AWX B;  4BXX J;  5KCM A;  2CQ7 A;  2GA1 A;  3VOE A;  1T2K A;  3BRO A;  1O57 A;  3K2A A;  2DFH A;  4LLN A;  2Y30 A;  4ITV A;  2WTE A;  2MBF A;  3ABT A;  2LKP A;  3WU2 C;  2KDZ A;  3CD6 I;  5J1Y A;  2CQK A;  2HYF A;  2QSF X;  2VOO A;  5KHD A;  2KJC A;  2QQA A;  1YJ9 I;  3F8B A;  4AU7 A;  4ASN A;  5JLW A;  4XLH A;  4M3D A;  2OU2 A;  4CZC A;  3QYF A;  3TDU C;  5DD8 A;  2ZSH B;  4I76 A;  3WTS C;  3JW4 A;  4EJT A;  2EFQ A;  2W48 A;  3C2H A;  4B44 A;  5EJC A;  1RUO A;  1HQC A;  3JRD A;  1F1Z A;  3KP2 A;  4CUG A;  4U7B A;  1PUF B;  3JAM Z;  5HOD A;  1IUY A;  3GVA A;  2FOK A;  1MDM A;  2GIV A;  5GTH C;  3QWL A;  2ETH A;  1D1B A;  2A05 A;  1HKT A;  1ZRC A;  4A3G J;  1EH8 A;  1IRF A;  3K4C A;  2XDV A;  2ZBK A;  4PJJ A;  4I99 C;  4B48 A;  3LAJ A;  2QA4 I;  3OIP A;  3TKY A;  1FNN A;  3G1L A;  2X85 A;  2JK3 A;  1AA7 A;  4XOR A;  2PFB A;  3UNG C;  5ICG A;  5J1U A;  3G3Z A;  2LRE A;  4HQM A;  4PJ0 C;  3MAJ A;  4IHX A;  1X19 A;  2O0Y A;  2Q1Z B;  4F55 A;  1TT0 A;  3VYT B;  2DLL A;  2Z3Y A;  1I39 A;  2ME0 A;  3HUG A;  2X6Y A;  1YRN A;  4GGG A;  3ZQF A;  1LE8 A;  3Q9S A;  5EDN A;  2PQ8 A;  2OV7 A;  5FLX K;  4Q47 A;  1QZZ A;  2XPV A;  2R7W A;  2QSH X;  3IAS 2;  3TED A;  2YSR A;  4UV9 A;  1I50 J;  2QBY A;  4L9T A;  1OPC A;  1O7L A;  1I27 A;  1J2X A;  2EZL A;  2G9W A;  2O7O A;  4HZF A;  1B59 A;  3ZXS A;  3U9G A;  2C6Y A;  1HW5 A;  3CDH A;  3HOU J;  3S14 J;  3J7A O;  2ZXH A;  3HGY A;  2F4I A;  4XRS A;  2M0C A;  3M8F A;  2OC6 A;  4YFX F;  3CCU I;  2HVQ A;  2CQX A;  2IA2 A;  3PO3 J;  2BVL A;  2LBF B;  1ZGA A;  4IRH A;  2HR3 A;  5JVG F;  3RPU A;  1XGM A;  5B1A H;  4CH7 A;  1A5J A;  1XMA A;  3OOU A;  2DJI A;  2KRC A;  3MKZ A;  3EUH A;  2BVM A;  2FA5 A;  4I09 A;  3I53 A;  1X1A A;  2GZW A;  1ZG1 A;  2YS9 A;  2KPM A;  3HKZ A;  2EBI A;  2V1X A;  3R0J A;  3MKL A;  1YRN B;  1LE8 B;  1O7F A;  3RKY A;  2KDO A;  3ZQH A;  1A35 A;  1P4A A;  4L18 B;  2VQG A;  1MH4 A;  2IT0 A;  1OJL A;  1D0Y A;  2LK2 A;  3HRT A;  5ICE A;  2QBY B;  4BUP A;  1Z77 A;  5EEA A;  5DM7 F;  2VUM J;  2EJR A;  3HHH A;  1F4K A;  3LA2 A;  4RGR A;  3CJN A;  2BY0 A;  2OBP A;  4M9X A;  4U0W A;  4AYB N;  1CF7 A;  3PUB A;  2JMW A;  4PDK A;  5E20 A;  1FTT A;  4ESB A;  1E3O C;  1MMS A;  3IC7 A;  5FD6 A;  3DEE A;  2GQQ A;  3WHC A;  2FMY A;  1HBX G;  3A4C A;  1EKE A;  1BA5 A;  2DFI A;  2V26 A;  3QU3 A;  3SEZ A;  3FXM A;  3JRH A;  5DDG A;  3I3L A;  4A3L J;  2UWM A;  2P4W A;  4DZJ A;  3BJA A;  2H1K A;  1O3T A;  1FOK A;  1H9T A;  1S7A A;  2K27 A;  4XR6 A;  1VF9 A;  3W2A A;  1ETY A;  4BQO A;  3TL4 X;  3HEF A;  2QWW A;  3MFK A;  2D45 A;  1R49 A;  5JHU A;  1OYI A;  3A1Y A;  4UUT A;  2WBM A;  3WU0 A;  1MNE A;  1U2W A;  2DA5 A;  2CV1 A;  3DKX A;  4LLL A;  4Q4Z F;  2OTJ I;  2AQF A;  1RZ4 A;  5ERI A;  3B02 A;  2CGP A;  3H3Z A;  2BZT A;  4XLF A;  2L2O A;  2ME6 A;  1MGT A;  3CQZ J;  4FAS D;  1SFK A;  3RCO A;  3SFZ A;  1JTX A;  1CF7 B;  2K85 A;  1UHM A;  1XB4 A;  4KN7 X;  1X1B A;  1G3T A;  3H3U A;  3G6E I;  4RS8 A;  2Y69 H;  1LJ9 A;  1UJ8 A;  3QP5 A;  5JVT A;  2RVC A;  1BR2 A;  2XAG A;  1MMN A;  5DUI A;  3D0S A;  1LNW A;  1X1D A;  4XL9 A;  2D5V A;  5LGU A;  1TBX A;  2FF4 A;  3L2U A;  2BGC A;  4MNU A;  2GM4 A;  5D8L B;  2QGU A;  2ZC2 A;  3FHN A;  2AQE A;  4CIC A;  4A2U A;  1HXD A;  3MMY B;  3FMR A;  3N05 A;  1U0J A;  2R7X A;  3H5A A;  3RJP A;  1IN4 A;  4JOM A;  2MW8 A;  3RZD J;  5E3O A;  5J4V A;  1XCV A;  3L9F A;  3A01 A;  3IP4 B;  3BG5 A;  2DOF A;  1FT9 A;  2OPT A;  4AM3 A;  2FBH A;  1X3W B;  1FIA A;  4CO8 A;  1U8B A;  2BE5 F;  4XBF A;  3T8R A;  3E5X A;  3KP5 A;  4CHU A;  1JKO C;  4XRF A;  1TNT A;  3HTS B;  3S1M J;  1KYW A;  5LHI A;  1QZE A;  5HLG A;  2R5Z A;  4EJV A;  2LY1 A;  5D6E A;  4C30 A;  2NVQ J;  1DU0 A;  3KP7 A;  2KIQ A;  4E7H A;  1MBF A;  3FM5 A;  1PUE E;  3AG1 H;  5EG0 A;  5EGO A;  3BTC A;  2L7K A;  4M6Y A;  1YG2 A;  1ZR4 A;  3HIF A;  1DGW Y;  3BJO A;  2IEK A;  3PQJ A;  5J1R A;  2JRT A;  2LF8 A;  4F52 A;  3DEW A;  3F6V A;  4HLY A;  1Q1H A;  1XG1 A;  4I2O A;  4L9J A;  1WI9 A;  1K4S A;  5DD4 A;  3E7L A;  1UCR A;  2CH0 A;  3BQY A;  4D0P A;  3WTY C;  2EH3 A;  2KZG A;  2CFX A;  4ESJ A;  5FKO A;  1ONV A;  4RM2 A;  1HKS A;  1NK2 P;  1YIO A;  3T5X A;  3JSO A;  1VQO I;  1HSJ A;  2QEX I;  2OTL I;  5CKT A;  1KQ9 A;  4Q48 A;  1YQA A;  1GVD A;  3L09 A;  3DU6 A;  3ISP A;  1D3Y A;  2GIZ A;  1L3L A;  4II2 A;  3LMM A;  2MAB A;  3HTU A;  2NS7 A;  1Y6I A;  4BY1 J;  3JCU C;  4DIQ A;  4XK4 A;  3CMM A;  3FKI J;  2VI6 A;  3ZQL A;  3C2B A;  2Q8K A;  1Z05 A;  5DUK A;  1S9H A;  1MND A;  1MMD A;  2JUG A;  1W5C C;  1X58 A;  5DCM A;  3R4K A;  2R7Z J;  1FOW A;  4ZJZ A;  4Q5S F;  5B66 C;  3C2G A;  1P4X A;  2A69 F;  5ILU A;  4S05 A;  2CUZ A;  3CMY A;  2JUC A;  1MBH A;  5D5U B;  2A07 F;  2PBI A;  1IV8 A;  2P6S A;  2WV0 A;  2O61 A;  4HV5 A;  2B63 J;  2LR8 A;  3IKV A;  1JGS A;  2QM3 A;  2XB5 A;  3PIP F;  4CCO A;  1WCM J;  3OYG A;  1LDK B;  1G2H A;  1R4M B;  1W1W E;  4IPA A;  1KU2 A;  1VQK I;  1IXR C;  3K4J A;  4L5I A;  4B3A A;  4ON0 A;  4M9Z A;  3I55 I;  3DWL E;  4LG0 B;  1WI3 A;  3JR9 A;  1FYK A;  4A6E A;  1O4X A;  1QRY A;  9ANT A;  4EEF G;  3P9K A;  5BMZ A;  4BS9 A;  3N4M A;  2ELK A;  2P7C B;  3ZQ7 A;  2UV1 A;  2X1D A;  3G4S I;  2W25 A;  4PFO A;  1BIA A;  4GXO A;  3OL4 A;  4I98 B;  5IYC J;  2CJJ A;  1OCZ H;  2UUZ A;  2XIG A;  4HST A;  3KPH A;  3WE3 A;  2QUF A;  2PLY A;  3VSK A;  1W5S A;  2GOM A;  4M73 A;  2E1C A;  2DMU A;  3MCZ A;  2XKP A;  1S72 I;  2HWV A;  1YI2 I;  1ZEL A;  2EIK H;  4UNO A;  2DFE A;  2OZ6 A;  3I4M J;  1WRJ A;  2NOJ B;  3RQI A;  3TDZ C;  1LFB A;  3CME I;  4QLC U;  1KA8 A;  3B73 A;  1AWC A;  4C2U A;  3O8H A;  4HAM A;  4C9Y A;  2VPL A;  1W5T A;  3OYI A;  3S93 A;  4PSW A;  3D1N I;  3CCL I;  2VLA A;  1H8A C;  4LG3 A;  1X3Z B;  5HS8 A;  1HF0 A;  1T8I A;  3HOV J;  5C4X J;  3V4G A;  1KU9 A;  2M5W A;  3F21 A;  2XB0 X;  1Y56 A;  1ZTR A;  2RGV A;  3E0J B;  3QP6 A;  3GTP J;  3DU5 A;  1R71 A;  3LSR A;  1K4T A;  2LY9 A;  2FJ1 A;  4E70 A;  3ULQ B;  3CO6 C;  1FX7 A;  1G3S A;  3TBI A;  4II3 A;  5K7Z A;  2OUM A;  3VEP A;  2VKV A;  1J7K A;  3ZQI A;  3GUD A;  3HSF A;  2DW4 A;  1FLI A;  4MEX F;  4HPQ A;  2R93 J;  1YW9 A;  5IYD J;  2HS5 A;  4L5J A;  5H6R A;  2E19 A;  2V9P A;  5K7F A;  2DK8 A;  3CCS I;  1P2F A;  2R7T A;  4XOT A;  5KAF C;  4LJZ F;  4FX0 A;  2QCO A;  4L5E A;  4YII A;  2L02 A;  3LA7 A;  3J7Y J;  2KP6 A;  4DW6 A;  2K9M A;  5GAG J;  2X51 A;  2JRM A;  5FLV A;  4KIS A;  1FC3 A;  2EA2 A;  1A6I A;  5K7H A;  4RB1 A;  3IWF A;  2HQR A;  3ABL H;  4BQA A;  2VN2 A;  2Z16 A;  3W2V A;  2KRF A;  3I56 I;  4XSX F;  2XAF A;  5EEH A;  2EFW A;  4WCG A;  1LEB A;  2IS2 A;  3PNV A;  1GUU A;  1TLH B;  3P7N A;  5J3L A;  3HOS A;  4HNT A;  2E35 A;  4RB2 C;  1CGP A;  1LB2 A;  3OR1 C;  1G6N A;  1S6L A;  3J80 Z;  1BR4 A;  3V7C A;  2H1L A;  3QPL A;  3PNT A;  1YW7 A;  1R9T J;  4ZYD A;  1F9N A;  1DUX C;  2WAQ N;  1X2M A;  4H4K C;  1OCP A;  3OSF A;  2HOA A;  2CSO A;  2R7Q A;  2EZK A;  3LFU A;  4E7S A;  2EIM H;  4AIJ A;  4HX7 A;  3TO9 A;  3BTI A;  1RKT A;  4UB6 C;  5GAE J;  1VQ7 I;  1B8I B;  1IV6 A;  4A3E J;  2IGK A;  2XRO A;  1ZG5 A;  4ENN A;  2EK5 A;  2F48 A;  3SZG A;  4XKV A;  4WXD A;  2VAS A;  2XVC A;  1VFC A;  3FIW A;  4KMU X;  3ZMU A;  3GX4 X;  2JWT A;  4RA2 A;  1VQ9 I;  3J7A Y;  2UXX A;  1VQP I;  1P7I A;  1UG0 A;  2IGN A;  3RDI A;  2GXA A;  3M3Y J;  1TWF J;  3MQ0 A;  5EEG A;  5IT9 Z;  3JRE A;  1FP2 A;  2NS8 A;  4A3D J;  2XUB A;  1IAW A;  3V7S A;  1R1T A;  2KLO A;  4JP0 A;  5A2Q Z;  4UV8 A;  3VYS B;  1MSF C;  1BW5 A;  1MBK A;  3HC7 A;  4RAZ A;  3HXL A;  5J6X A;  2WB1 A;  3DBL B;  1EJ9 A;  1TP4 A;  2NVY J;  2HYG D;  4PZJ A;  1X4O A;  1GDT A;  2FE3 A;  2DFF A;  3HZJ A;  3CCV I;  2M7A A;  2R7R A;  1R00 A;  2VON A;  2MLK A;  3G1M A;  1SD6 A;  3J7Z I;  2A68 F;  2VXD A;  4A0X A;  2M8G X;  3OYD A;  4XIC A;  3AG3 H;  5IP6 A;  2A5Y B;  4YEL A;  1KON A;  3PIO F;  1NTC A;  2DT6 A;  4RGU A;  2R5Y B;  5F6F A;  3VOD A;  4HRI A;  4HF0 A;  3OYN A;  3M8J A;  1JE8 A;  1XC5 A;  3CCY A;  4U0Y A;  1SMY F;  3PJR A;  3I9V 2;  2CWE A;  2K9N A;  1K78 A;  1XD7 A;  3K70 D;  1D5V A;  3ERE D;  4G6D A;  5AIP A;  2IS4 A;  2K4J A;  5HDN A;  1JTY A;  3RKQ A;  3FXU A;  2CMP A;  2VT2 A;  5BPD A;  2W1O A;  3I54 A;  2ID6 A;  1P92 A;  1GHC A;  3TP0 A;  2ZME A;  3OYA A;  3DLA A;  3CES A;  2HPM A;  5LBQ A;  2K3F A;  4EQQ A;  5D4S A;  1U78 A;  3PSI A;  2DPU A;  1IG7 A;  4ENK A;  2P81 A;  2LMD A;  1E2X A;  1Y39 A;  2PJP A;  2MLG A;  2PMU A;  2HVR A;  3DXJ F;  1W0T A;  3RKX A;  2OAZ A;  4N0B A;  3SEQ A;  2ZXJ A;  3AFH A;  2L9S A;  4DNC A;  4AIK A;  3CC4 I;  4EM0 B;  4XKC A;  4JQF A;  2XKO A;  2K3P A;  1K7A A;  5GTI C;  3VYR B;  2E34 A;  2P5V A;  4PGG A;  2QVO A;  4BU2 A;  3M4O J;  2JA8 J;  1Z7L A;  3FXL A;  3RSN A;  1T0F C;  3W2W A;  2WY7 Q;  2DOE A;  1O3S A;  3I59 A;  2M3A A;  3WTV C;  1GV5 A;  2BBY A;  1FY7 A;  2HTS A;  1MSE C;  4NC8 A;  4OU0 A;  4KT6 A;  4HF1 A;  3ONQ A;  2E1O A;  4IKF A;  4N9I A;  1IRZ A;  3L2V A;  4S0H B;  1RIO H;  2VJ5 A;  4KYW A;  1F36 A;  5CPR B;  4DOZ A;  5HNH A;  5F64 A;  2MG4 A;  3OS0 A;  5TRD A;  5HDG A;  1RR7 A;  1AHD P;  1TZL A;  2VE9 A;  1LDJ A;  1XSD A;  1OCT C;  1IN5 A;  2O5R A;  4BYY A;  2NVX J;  2H09 A;  4H0E A;  4IQ4 A;  3VYU B;  1VTN C;  4OMZ A;  3W6V A;  5DS9 A;  3S2W A;  4GRI A;  3ERM A;  2XF7 A;  2X9D A;  4ZYE A;  4XM3 A;  5CVV A;  3L2C A;  3TOB A;  4FCY A;  2DOA A;  2O6G E;  2KKO A;  5M3M J;  2W7N A;  1FSH A;  1PUF A;  3I59 B;  3REO A;  4XRM A;  4A3I J;  4F92 B;  4CCK A;  1WKM A;  4C3H J;  2IRF G;  2Z99 A;  3LSI A;  5IOZ A;  2HDD A;  1N78 A;  2M1B A;  4E4H A;  3W6K B;  2DDA A;  1XMX A;  3LAP A;  3L00 A;  1JGG A;  3FBI B;  3ABM H;  2DYR H;  3RKW A;  1LKX A;  4ZTF A;  4D5C A;  1BOA A;  4BEH B;  2K9L A;  2O8X A;  3S32 A;  4FE7 A;  3LNQ A;  5L3C A;  1VQL I;  1ZAO A;  3LQR A;  3NAU A;  2M4K A;  2HDC A;  3DPT A;  4V2F A;  2MGQ A;  1GXQ A;  1SFE A;  2W84 A;  3GTL J;  1WQ2 A;  1FBS A;  4JX5 A;  1XSV A;  1OR7 A;  5EF6 A;  2HGC A;  3CTA A;  3KYL A;  1GV2 A;  1WWX A;  5CQE A;  2E5N A;  2W00 A;  3KEQ A;  4B4C A;  1MJA A;  2DK5 A;  1FBU A;  5D8K B;  4WWC A;  1IUF A;  5LGN A;  1UFM A;  2ZNZ A;  3R6S A;  4BGD A;  2KQR A;  3S2D J;  4EJW A;  2DT7 B;  3G2B A;  4Y33 A;  4G94 A;  1Z6R A;  2AXL A;  3F3X A;  4RAF A;  1IW7 F;  3QPT A;  1T98 A;  1S5L C;  3MKW B;  3PUF A;  2LTP A;  1ETX A;  2PMZ N;  2LBF A;  3RTR A;  4UUV A;  4F7Z A;  2MC3 A;  1V5E A;  5F27 A;  3HOT A;  2LYC A;  3PO2 J;  5CVJ A;  1TL8 A;  2LG4 A;  2LDU A;  1G3W A;  1JXS A;  4P5O A;  4C2T A;  1YJW I;  4G6T B;  2ZFU A;  2ZJ2 A;  4AVP A;  1FBQ A;  1U3E M;  5K5O A;  1F5T A;  2XAS A;  5LHG A;  3TW7 A;  1A31 A;  3S1R J;  5LLQ A;  1MMA A;  4KDP A;  4IL6 C;  3FHZ A;  3HM5 A;  2V7F A;  1W36 D;  1FEX A;  2MA3 A;  3EQL F;  2V9V A;  1WZ2 A;  5CLS A;  3EPZ A;  2LLK A;  4WX9 A;  2FRH A;  1MH3 A;  4LB6 B;  3A02 A;  5LEJ A;  3GTJ J;  2HXI A;  5E1Z B;  1DP3 A;  1IDY A;  3GF2 A;  2DMQ A;  1S29 A;  2R3S A;  1XGN A;  5JLX A;  3FBN B;  1ETV A;  1OKR A;  4CXF A;  2XGD A;  1USS A;  3BLY A;  1GT0 C;  1PP7 U;  1YIJ I;  3S1N J;  2XRL A;  4G7Z F;  4MTE A;  3WGI A;  1A04 A;  2VQL A;  5KAI C;  2DPD A;  2HDW A;  3I4P A;  3IUO A;  1YTY A;  1DPU A;  1YS6 A;  5FO5 A;  3BR3 A;  2M2E A;  4NNJ A;  1FIP A;  1M1E B;  2CQQ A;  4P9U A;  3GTO J;  4OOI A;  3WHB A;  4LIU A;  3FMQ A;  3J81 Z;  1V55 H;  2A3S A;  3LSG A;  2PJR B;  3VWB A;  1ZH5 A;  3S8P A;  4P96 A;  2WAQ A;  2Y75 A;  5D5V B;  3IH3 A;  2DA6 A;  1GVJ A;  3LSK A;  1CQT A;  1SEU A;  1LDD A;  2H6B A;  3K2Z A;  3U2R A;  3GME A;  4U0V A;  1RRJ A;  1IN7 A;  2RNG A;  2QYO A;  4UUS A;  2M4G A;  1J5Y A;  1K61 A;  3S3N A;  2ZO4 A;  3BG3 A;  2F6C A;  2E1M C;  3C1D A;  1HA8 A;  5ILV A;  5GP9 A;  4NB5 A;  2QF7 A;  4ZYG A;  3R60 A;  1PYV A;  2VJJ A;  4IF4 A;  1APL C;  3R0A A;  3BP8 A;  2CW8 A;  2XGX A;  3HBL A;  4HLX A;  5TGT A;  1S3J A;  4D1Q A;  3G71 I;  4EM1 A;  1T39 A;  4KIT B;  2EIL H;  3NQO A;  2IGM A;  1R36 A;  4KIB A;  3VFZ A;  3NAR A;  3CUQ B;  1XDS A;  3CUO A;  3KX2 A;  4HV6 A;  4C3J J;  2P5L C;  4ZDP A;  3K6G A;  2CS3 A;  3DCF A;  3DQV C;  3F8F A;  2L3D A;  1TQM A;  1UG2 A;  3E1S A;  4XON A;  2R7U A;  2L7Z A;  3EUK L;  3GZ6 A;  2JZY A;  3EDP A;  5B1B H;  4UUS B;  1VQ5 I;  3GTM J;  2LFB A;  4FIS A;  1BN5 A;  1MKM A;  3FK7 A;  3G1O A;  2ZJR F;  2DQL A;  3Q3S A;  3DTI A;  1NHA A;  4P9F A;  3RYP A;  4HDU A;  2LH9 A;  4I02 A;  4RB3 C;  1TC3 C;  1KQ0 A;  4RAY A;  5FFZ A;  3OMY A;  2HFH A;  3CO7 C;  1TWA J;  1K6O A;  3KZZ A;  1MIJ A;  2P6T A;  4CCN A;  1YOV B;  2B7E A;  4BXU A;  2WB1 N;  2STW A;  2ZJQ F;  1UHS A;  4M3G A;  3JRB A;  3ZMT A;  5FRN A;  3K9T A;  5F1J A;  2V1U A;  5GPC A;  5TJJ A;  3RQ4 A;  2WV1 A;  1QGP A;  1MBJ A;  3ABK H;  1TW3 A;  4ZDL A;  2VE8 A;  2DOD A;  1X1P A;  1Y0U A;  1OYW A;  4V2G A;  2O03 A;  3A0B C;  4BE0 A;  2E60 A;  2GWR A;  3IH4 A;  2EPF A;  2HZD A;  5ICF A;  4IHT A;  3ZMZ A;  4ZYH A;  4O5V A;  3F8C A;  2VT3 A;  3OIO A;  5L3B A;  5J4Y A;  3OYE A;  3TGN A;  3LSP A;  1YFH A;  3A0H C;  1OIS A;  4YIF A;  1D8K A;  2ELJ A;  1Z0X A;  4Y4R A;  3BTL A;  4BL0 B;  1SFX A;  3MZY A;  2ZME C;  3OL3 A;  3QAH A;  5EZG A;  2ISY A;  4PJN A;  1RES A;  1ZRE A;  1RC9 A;  2DA2 A;  1K79 A;  3U21 A;  1T0F A;  3ZGK A;  4RGX A;  1TNS A;  2CW0 F;  2F5D A;  4GO1 A;  2DT5 A;  1LFP A;  2CU7 A;  1DQU A;  4HX4 A;  5KK1 A;  1EA3 A;  4B09 A;  4KIC A;  1I3A A;  3EET A;  3C18 A;  1ZR2 A;  3X2Q H;  4MLO A;  5FKN A;  1BL0 A;  5DV5 A;  3S3O A;  4N9H A;  3LSM A;  5FRO A;  1JKQ C;  5F1R A;  4MQV A;  3CC2 I;  4TV7 A;  4XNF A;  4XOP A;  4AUX A;  3BPX A;  3QOP A;  1WJB A;  4ZTJ A;  3VDX A;  2BXZ A;  1XX5 A;  3O3K A;  1ZLK A;  4LG0 A;  2EFP A;  4XID A;  1G3Y A;  3KET A;  4KA4 A;  5KVR A;  4A3M J;  1XS9 A;  4E7I A;  3OWT A; 
#chains in the Genus database with same CATH homology
 3HOS A;  4HNT A;  2Z1D A;  3HUG B;  2X6W A;  3OR1 C;  1YX3 A;  3DKY A;  1BR4 A;  1GLN A;  1PJR A;  3BCA A;  4BDZ A;  3AL0 B;  4OAY A;  2LOO A;  3PNT A;  3CP8 A;  1D0Z A;  1WJC A;  1WFX A;  4H4K C;  3D5S C;  3HPG A;  2R7Q A;  2A5W A;  3LFU A;  4E7S A;  2WAD A;  3BG6 A;  3CJQ B;  4PJM A;  1Z21 A;  2IGK A;  3H9G A;  2HU9 A;  1J09 A;  3LL7 A;  3QOD A;  3SZG A;  2KL4 A;  4XKV A;  2V6E A;  2VAS A;  3CJR B;  4Y3O A;  2RQQ A;  2XF5 A;  3DTE A;  3D5L A;  3J7A Y;  5KCM A;  3H5N A;  3PSF A;  4CCM A;  1UG0 A;  2IGN A;  4ITV A;  4YRV A;  1QHG A;  3IAM 2;  1QHH D;  5KHD A;  1OR7 C;  2KLO A;  5LD2 C;  4AU7 A;  1D1A A;  4XLH A;  3VYS B;  3HC7 A;  4CZC A;  2JSP A;  3QYF A;  3HXL A;  4D9J A;  2PMZ A;  2WB1 A;  2ZSH B;  2BW3 A;  1X4O A;  3H9Q A;  4XN0 A;  3C2H A;  4B44 A;  2M7A A;  2R7R A;  2MD0 A;  2MC4 A;  4CUG A;  1K6Y A;  1VZ0 A;  4QPO A;  1WJE A;  4U7B A;  2IS1 A;  2IS6 A;  1N75 A;  2Q2E B;  2VXD A;  3OYD A;  2ZSI B;  4PSX A;  4YEL A;  3A2K A;  1KON A;  1D1B A;  2DT6 A;  4RLF A;  3HL2 A;  4PJJ A;  3K4C A;  2XDV A;  4HRI A;  4B48 A;  1X4P A;  2I8D A;  3OYN A;  3M8J A;  3OIP A;  3PJR A;  2X85 A;  3K4B A;  3I9V 2;  2IXS A;  3K70 D;  1AA7 A;  4XOR A;  3UNG C;  2IS4 A;  2VIX A;  2KRH A;  2LRE A;  1X19 A;  3K4M A;  2CMP A;  2M0M A;  3CZ6 A;  2Q1Z B;  4F55 A;  2W1O A;  4PK4 A;  3M1C A;  1TT0 A;  3VYT B;  3GBG A;  1YE9 A;  2WA0 A;  2X6Y A;  3QYE A;  4CCJ A;  3OYA A;  3DLA A;  2W82 A;  1Z3Y A;  3CES A;  2BW3 B;  2HPM A;  4AVZ A;  3PSI A;  2OV7 A;  5HNF A;  2R7W A;  1JI8 A;  3IAS 2;  4DJA A;  2HVR A;  4HG2 A;  3SEQ A;  3AFH A;  2L9S A;  3ZXS A;  4XKC A;  1NG7 A;  4JQF A;  2ZXH A;  2K3P A;  2F4I A;  1WJA A;  3VYR B;  4BU2 A;  1V5G A;  2KHM A;  3K4L A;  3V42 A;  2OC6 A;  4N4N B;  1Z7L A;  2HVQ A;  3RSN A;  2BVL A;  1V5F A;  1T0F C;  3W3C A;  2LBF B;  3W2W A;  2WY7 Q;  4XN3 A;  2M3A A;  1E0E A;  3OIQ A;  4CH7 A;  3OOU A;  4KJZ A;  2DJI A;  2KRC A;  3OS2 A;  3MKZ A;  4NC8 A;  2BVM A;  4KT6 A;  3ONQ A;  4F3Q A;  1X1A A;  4IKF A;  1OLT A;  3L2V A;  5FRM A;  2VJ5 A;  2JVG A;  1T95 A;  4XLA A;  2KPM A;  5CPR B;  4DOZ A;  5HNH A;  2X1E A;  3CP2 A;  3HKZ A;  3MKY B;  2Z2S B;  3OS0 A;  4NQW B;  3RPU D;  1TZL A;  2KDO A;  4ANJ A;  2HPI A;  2MYS A;  2R7V A;  3BCB A;  3BC8 A;  2VQG A;  2O5R A;  1D0Y A;  3K4K A;  3OYK A;  4IQ4 A;  2L5Q A;  3VYU B;  2R4G A;  1SAU A;  4BUP A;  1G59 A;  4GRI A;  2WY8 Q;  2XF7 A;  2VB6 A;  4XM3 A;  2XF6 A;  2DOA A;  3PUB A;  4PJL A;  4RMN A;  1FMV A;  2W7N A;  3DEE A;  4RM3 A;  2QKL B;  4F92 B;  3A4C A;  4CCK A;  2V26 A;  2Y0S A;  3SEZ A;  3LSI A;  1N78 A;  3I3L A;  4B47 A;  1D1C A;  4E4H A;  2DXI A;  2UWM A;  3H35 A;  4NC7 A;  4BAC A;  2CV2 A;  3FBI B;  4XR6 A;  1YX5 A;  3W2A A;  1LKX A;  4ZTF A;  4BQO A;  1BOB A;  3TL4 X;  4BEH B;  2K9L A;  3S32 A;  2A6T A;  3A1Y A;  3EUA A;  2WBM A;  1MNE A;  1X1C A;  2M4K A;  3DPT A;  3BG7 A;  2CV1 A;  3DKX A;  3HG9 A;  2AQF A;  4XKB A;  3L2W A;  4XLF A;  2L2O A;  3VSL A;  3KYL A;  5CQE A;  4FAS D;  1SFK A;  4ZC3 A;  2E5N A;  2W00 A;  3RCO A;  1MW7 A;  3F9K A;  1G8X A;  1P9Q C;  3L2Q A;  3OYC A;  4BGD A;  2KQR A;  1X1B A;  2DT7 B;  3G2B A;  2HVS A;  4Y33 A;  3OYF A;  1BR2 A;  3KEY A;  1MMN A;  4NUB A;  2F5V A;  3MKW B;  1X1D A;  4E7K A;  4XL9 A;  3L2U A;  2LBF A;  2CW7 A;  3RTR A;  5JHF A;  1V5E A;  2AQE A;  3FHN A;  3HOT A;  5KNL A;  2LYC A;  3MMY B;  1WJF A;  2CUJ A;  2LG4 A;  1U0J A;  3N05 A;  3OR2 C;  2R7X A;  3H5A A;  3ZRG A;  3K70 C;  4P5O A;  4C2T A;  4JOM A;  4G6T B;  2VXZ A;  2ZFU A;  3IP4 B;  1WJD A;  2RRE A;  1MMA A;  2V7F A;  1W36 D;  4E6K G;  4XLC A;  4N4O B;  3EPZ A;  4BXF A;  4XLE A;  2LY1 A;  4C30 A;  4XQF A;  2VQH A;  4E7Z A;  3H0D A;  4E7H A;  3OYJ A;  1DP3 A;  3ZCO A;  2L7K A;  2XAU A;  3FBN B;  4BQN A;  1DGW Y;  3BLY A;  3DTK A;  4HNU A;  3AL0 C;  4F52 A;  2VQC A;  2ZXI A;  2DCE A;  4PUS A;  3D5R C;  2VQL A;  2HDW A;  3IUO A;  3AKZ A;  2XC7 A;  2JVH A;  2VKH A;  4NNJ A;  5LFA A;  5HVQ C;  2E5Z A;  3QOE A;  3ZQQ A;  1QU3 A;  2CH0 A;  4ZDO A;  4LIV A;  4QPQ A;  2P0W A;  4LIU A;  2VJ4 A;  4RM2 A;  4IZZ A;  3CF2 A;  1FMW A;  3FDY A;  4BEH A;  3LSG A;  5CKT A;  2PJR B;  3VWB A;  2BOL A;  3S8P A;  2WAQ A;  3DU6 A;  4BJ5 C;  2CV0 A;  4F91 B;  3LSK A;  4II2 A;  3LMM A;  2MAB A;  3EUH C;  3PFY A;  1Y6I A;  3MD2 A;  4F93 B;  4DIQ A;  2VL8 A;  4CSW A;  3CMM A;  2LY2 A;  4BE1 A;  4R79 A;  4E7J A;  4AYB A;  1S9H A;  2RNG A;  2JA2 A;  1MND A;  1MMD A;  2JUG A;  3LSH A;  2M4G A;  2KMU A;  4ZJZ A;  3S3N A;  2F6C A;  2E1M C;  1HA8 A;  3C2G A;  4J01 A;  5HOO A;  3H5R A;  2CUZ A;  1PYV A;  2VJJ A;  3DPU A;  2CW8 A;  5HLT A;  2R7S A;  2MFZ A;  4P1W A;  5TGT A;  4D1Q A;  1UAA A;  4CA0 A;  4ZYA A;  2V1N A;  4CCO A;  5CQG A;  1Z3X A;  4BJ6 C;  4YEJ A;  4KIT B;  1LDK B;  3OYG A;  2X6X A;  2IGM A;  4DBR A;  1BR1 A;  4BDY A;  3L2R A;  3K4J A;  3KX2 A;  2IGO A;  1DGR M;  3UR3 C;  2M7B A;  2LRD A;  3TMO A;  3OY9 A;  4ZDP A;  3DWL E;  3QYB A;  2XSJ C;  2CS3 A;  3DQV C;  3K6G A;  2VJI A;  3PL8 A;  4J00 A;  3E1S A;  4BS9 A;  2V4J C;  2UV1 A;  2X1D A;  4XON A;  4PFO A;  2R7U A;  3OL4 A;  3FKJ A;  3EUK L;  2KZV A;  2UUZ A;  3OYM A;  4HST A;  3VSK A;  2HQA A;  4B3X A;  1WJ5 A;  2E1M B;  2GOM A;  2W4S A;  3DTI A;  1LVK A;  2LH9 A;  3K10 A;  3NWS A;  1ZEL A;  3SYT A;  4XMY A;  4CCL A;  4OWR B;  3OMY A;  3OYL A;  2K5C A;  4DBQ A;  4CCN A;  2NOJ B;  1MMG A;  2LC2 A;  4OAZ A;  4BE2 A;  2L9N A;  1NG6 A;  2R7O A;  2X1C A;  4C2U A;  5FRN A;  2WAF A;  2CFO A;  3S3M A;  4C9Y A;  4HEA 2;  2VPL A;  2GOX B;  3OYI A;  3S93 A;  2VKD A;  4PSW A;  3RQ4 A;  2VLA A;  4X0G A;  4PFP A;  4LG3 A;  4ZDL A;  3SDB A;  3H9J A;  3OYH A;  4BE0 A;  2E60 A;  3HPH A;  4FET A;  4BQQ A;  4E7L A;  2HZD A;  1Y56 A;  3E0J B;  2PJR A;  3DU5 A;  4HSR A;  3TBI A;  4II3 A;  3OYE A;  2OUM A;  1W36 C;  4RLQ A;  2ELJ A;  4XKW A;  4Y4R A;  4HPQ A;  4B43 A;  4BL0 B;  3OL3 A;  4IX7 A;  4PJN A;  3OS1 A;  3PNY A;  4BJT A;  3U21 A;  3OYB A;  2R7T A;  1N77 A;  4LIT A;  4XOT A;  3DPL C;  3ZGK A;  1UEL B;  1ERD A;  1IRX A;  2KP6 A;  4EAT A;  1LFP A;  1DQU A;  2K9M A;  4DGW B;  1EA3 A;  4IQJ A;  1D0X A;  2X51 A;  3K4N A;  4MLO A;  4KIS A;  2HNH A;  2WAE A;  3ZR8 X;  3S3O A;  3LSM A;  4U87 A;  5FRO A;  4XNF A;  4XOP A;  2QKM B;  1R6R A;  1WJB A;  2FUG 2;  3NWT A;  3VDX A;  4ZTJ A;  2Z16 A;  3W2V A;  2V9K A;  4E7I A;  2IS2 A;  3PNV A;  3OWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...