2RREA

Structure and function of the n-terminal nucleolin binding domain of nuclear valocine containing protein like 2 (nvl2) harboring a nucleolar localization signal
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
74
structure length
74
Chain Sequence
b'MKPRPGVFVDRKLKQRVIQYLSSNRCGKYVDTGILASDLQRLYSVDYGRRKRNAFRIQVEKVFSIISSEKELKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Structure and function of the N-terminal nucleolin binding domain of nuclear valosin-containing protein-like 2 (NVL2) harboring a nucleolar localization signal
pubmed doi rcsb
source organism Mus musculus
molecule tags Nuclear protein
total genus 14
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16725 Nucleolin_bd Nucleolin binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2010 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2rreA00
2RREA
chains in the Genus database with same CATH superfamily
2LRDA 2XSDC 2BHZA 2OQRA 2WY8Q 4CYCB 1FNNA 4LITA 2HTJA 5IP9J 2XHKA 4ZYAA 3B6AA 1JI8A 4IZZA 5E20A 1GDTA 4NC8A 2OTLI 3VSKA 2HOSA 2VOPA 2OUMA 1VZ0A 1EA3A 2JRMA 4XKVA 5B66C 1UELB 4PZJA 3PNYA 2W57A 1OCZH 3E7LA 2WB1A 3TDUC 2X6YA 2XKPA 3UR3C 4FTHA 1U0JA 2IA0A 2O0YA 1UZCA 2OF7A 2CWEA 1BBYA 1QGPA 3OL3A 1FJLA 4KJZA 2HOEA 2P6SA 3ELKA 3KIOA 2GXAA 3RPUD 2R5YB 1HKTA 2CU7A 3TEDA 4ENNA 1QPIA 2PMZN 1JKPC 3DEEA 4HSRA 4WXDA 5L3DA 4V2FA 1T0FC 4BKXA 4OINF 1BI0A 3DBLB 2BHYA 2LD5A 1BIBA 1QNTA 1IN8A 4BQNA 4Q4ZF 1B9MA 2DTZA 3SJMA 4UUVA 3FZVA 5CKTA 3IRQA 4F93B 5ICCA 4CGZA 1SAXA 2FRHA 2EILH 2MD0A 3K0LA 3HOTA 3HOYJ 1WQ2A 1U8BA 4AUXA 3PIOF 1IJWC 3ZPLA 4HZFA 3H0GJ 2DOEA 2EPFA 3WG9A 3U1DA 1XDUA 1RIOH 2E71A 3ZRGA 5LGTA 5JR3A 1S8NA 5E3NA 1UAAA 2VT2A 4OWRB 2VONA 3OYLA 3IH3A 2WTEA 2X6WA 1VQPI 4M9XA 2EIKH 3V4GA 3MZ8A 1B8IA 3TP0A 3M4OJ 5AONA 2LC2A 2JZYA 3GBGA 1F43A 3SHFA 2MH9A 2DA1A 4QPQA 4NQWA 4RB0A 4PJMA 2LF8A 4ZZDA 4HX8A 1JT0A 3D5SC 3Q0UA 4B1RA 5M5YJ 2OZ6A 2RNGA 3CF2A 1Y0UA 2LR8A 4O5VA 3TW6A 3IP4B 1HA8A 2DMQA 4MGRA 1U5TB 4HNTA 2ZFWA 1D0YA 4CICA 1G4DA 2L7MP 2CW8A 1X58A 1W0TA 2XGEA 2G7UA 3HIFA 3BTIA 3I59B 1W0UA 2G7HA 1FIPA 5IOYA 2Y30A 1F5TA 5LEKA 2NOGA 3J80Z 2K85A 2BY0A 2GLOA 3R0JA 1ZG3A 1W5CC 2EZIA 1B6AA 2RAEA 3MKWB 1H9TA 4IRGA 1BOBA 4FHTA 3ZQGA 3FKIJ 1ZK8A 3G1OA 4G12A 1XGNA 1USSA 1EJ9A 3GTQJ 4B4CA 5KHDA 3N4MA 1X3ZB 2W24A 4DZJA 2DJNA 3BR5A 5EZHA 3TO9A 4EV0A 4WK8F 4CCLA 2BVLA 1ETYA 2LY1A 3ASNH 4EJUA 1YO5C 4N4NB 1BR2A 4XR6A 4BAYA 4E7SA 2E1CA 1UHSA 5BPIA 1LFBA 4AIDA 3GW2A 3AL0B 2PMZA 1MMAA 2GQQA 2CUZA 4KDPA 1G2HA 3RSNA 3BJOA 4BQOA 2R7TA 4BL0B 1WJFA 3ECOA 3CMMA 1WWXA 2QVOA 2FBIA 2JTVA 2ZC2A 3SDBA 1PP7U 1E0EA 1H9GA 3LWFA 4AWXB 4GYIA 3ZQCA 1NK2P 3CJTB 1P4AA 4JX4A 3CCUI 3RYPA 1VQ4I 2A61A 3GTMJ 3HGYA 3MWMA 4U0VA 4EVIA 3ZR8X 2OZUA 2CW7A 4BY1J 2F5VA 3U9GA 3ISPA 4L5EA 1FWZA 3G1LA 4KIFA 2M0MA 2BEOA 5FFXA 2VUMJ 3E0JB 3OYCA 2X48A 1DU6A 4W1UA 4X0GA 3I4NJ 4L5JA 5TGTA 3LA7A 1WJAA 4RMNA 5FKKA 4AD9A 1ODDA 4IKFA 3OR2C 4JYKA 1UG2A 1W7PB 4P1WA 3BQYA 3C7JA 1TWHJ 3OWTA 2MD5A 1D8JA 1HC8A 3I58A 2JA6J 3HOSA 2AXTC 1SEUA 3DKYA 4GO1A 4ABZA 4CH7A 3WTWC 2A6HF 3FMSA 4ESJA 5D5XB 1XGSA 4IXAA 1SFUA 2V79A 1R49A 4CCMA 3NQOA 5CVRA 1T08B 4WX9A 4RBOA 4AVZA 4XMYA 3ZMUA 1I39A 3G71I 3LSMA 2IJLA 2QLZA 4P96A 3JRGA 1S5LC 2IXSA 2R7RA 4KMFA 3COAC 2FEZA 3WGHA 2V1DA 1OISA 3VYSB 4M3BA 1O3TA 4XLFA 3ZQLA 2IGOA 2YX7A 4P9UA 5JFRA 4FISA 3S14J 5M5WJ 2XF6A 1MDMB 1YYVA 2HYJA 2V9PA 2R3SA 5LHHA 1UCRA 2MLGA 5TRDA 3QP5A 4E70A 3ZMDA 3J81K 1BA5A 2JA8J 2WAFA 2WV1A 2JSCA 2W25A 1X4PA 1Z3XA 3MFKA 1JTXA 2AQFA 2ISZA 4MEYF 2VXDA 2VODA 3HC7A 3N97A 2IW5A 4HRIA 3K6GA 4UVCA 1I27A 2DFIA 3BTLA 5HLGA 3OYHA 3PQJA 4HG2A 1VQ7I 3DU5A 6PAXA 1EKEA 1PYVA 3VYRB 4N9HA 3HHHA 4ZDLA 2VKVA 1LB2A 2WADA 3DKXA 4CCOA 3WGIA 4A3KJ 2J5OA 2D2WA 2EK5A 1X4OA 1MMSA 1OYYA 4JK1X 2L3DA 2RN7A 2KIFA 1SFKA 3S1MJ 2A05A 2AHQA 3CP2A 3KLOA 2QYOA 3ONQA 1CF7B 3BZKA 4BXXJ 3S15J 1YJ9I 2YX4A 1WJ5A 2M34A 2UUZA 5HNHA 2C6YA 1WSUA 2QZ8A 2ECBA 2LREA 2ZO4A 4WXCA 3SZPA 3BG5A 1NH3A 2L02A 1FBUA 1YG2A 5J47A 3HSFA 2LBFA 1LKXA 3DV8A 1A35A 3ZMZA 3HTUA 2Y69H 2ZMEB 3PFIA 1KONA 2A3SA 3CMEI 4BE0A 1JKQC 3ML6A 3DLLF 1XTAA 5KAFC 2O3FA 4WXHA 2E19A 3I56I 3K7AJ 4DZPA 4D5FA 4NHJA 3O8GA 5C44J 3AAFA 1E3OC 4QTRA 1MH4A 1B59A 4I6ZA 2GIZA 1CGPA 3RTRA 3ABTA 4A2UA 2CS3A 2KP6A 4ON0A 4I99C 2X51A 5LHIA 1T6SA 2Q2EB 1U5TC 2DYRH 5EEAA 4O6JA 2KHMA 1XG1A 5D5UB 1ON2A 2VQLA 4HPQA 4A69C 4DJAA 1YW9A 2LY2A 3F8NA 2ZJ2A 2ECCA 1KGSA 4NC7A 2EFOA 1ZLJA 2VBZA 3M7GA 5CJ9A 1XX5A 5CQEA 2H8WA 3AKZA 2R7SA 1D1BA 1ZN2A 3HSEA 1G6NA 3PQKA 3B6CA 3HM5A 4RS8A 2BVMA 3CCJI 2E5ZA 4AYBA 3L1PA 4A3EJ 3WGGA 3LSPA 4M9ZA 2Y48A 3BG6A 5J1RA 2IS6A 4FT8A 3BTJA 1NK3P 2V26A 2M45A 3D5LA 5FRNA 1YHQI 3BR2A 3MQ0A 1W1WE 1POGA 1BJZA 1JUSA 2HYGD 1MNDA 2ZFUA 4M6VA 2G0EA 3KP2A 3K69A 2MFZA 3AG1H 2Y75A 3F23A 1IN5A 1DPUA 2KKOA 2HFHA 1EH8A 3HUGB 4KA4A 1GVDA 1DU0A 1P92A 1R00A 2VL8A 1BI2A 3MVPA 4PSWA 4HOBA 5FFZA 4LK1F 3AL0C 2R7DA 3J81Z 1IV8A 5LBQA 1V5FA 1ZELA 5HOOA 1JKOC 2CUJA 4E7JA 4A6DA 3VFZA 4RB3C 1JXSA 2DI3A 1Z6RA 9ANTA 2MW8A 2QKLB 3CCSI 1LE8B 5KAIC 4GGGA 3WODF 3ESWB 3Q5FA 3BY6A 1Q1VA 4NDLA 2VJIA 2Y0MA 2ZB9A 4BHCA 1LPQA 2Y2ZA 2ME0A 4F92B 2QA4I 1LVAA 5LLQA 4UVAA 2EV6A 2O03A 1B1BA 4E6KG 4M72A 4HAMA 5FRMA 2HR3A 3HKZA 4XN0A 3QOEA 4J01A 1K6OA 4HV6A 1J2XA 3GCMA 4UUTA 2QBYB 3HJEA 4V2GA 2PJRB 2JSPA 2NNNA 3NEUA 1U3EM 4A12A 1FZPB 2EZHA 1Y8RB 2D45A 3I3LA 1K4SA 3C2GA 2XUBA 3O2PE 4UVBA 2ME6A 3H3VK 3W3CA 5FLXK 3K2AA 4MQ9F 1VF9A 3M1CA 2EH3A 2HKXA 3E5XA 5B3SH 1SVMA 3WTVC 4BEHA 3E97A 4L0ZB 4BJTA 3P5JA 2QSGX 1QVUA 3PSIA 3GZ6A 3RQIA 1D5YA 2H94A 2EA4A 2FMYA 4HV5A 4DYCA 2DT7B 1ZGWA 4XK4A 4GYGA 4D1QA 4L9JA 3K9TA 4EEFG 2OQGA 2DO7A 3EUHC 3HSRA 3OYDA 2PLYA 2FXAA 3SZGA 4CHUA 5IP7J 1X1PA 2IS1A 4MO7A 3A03A 3K4KA 5FLMJ 3L2CA 2XAQA 3QYBA 1ETWA 2L7ZA 4A3CJ 4KICA 4LK0F 3G3ZA 4G9YA 2VLAA 1T95A 2Z16A 3C18A 2BGCA 4IQ4A 2COMA 3K1PA 2UZKA 2JVHA 2VJJA 3HBLA 2ELJA 3IKVA 4EJWA 5J4YA 1ZRFA 1K78B 3HOVJ 1Z3YA 1I3QJ 1HQCA 3M1EA 3KLNA 3HHGA 2DA6A 2PMHA 1YRNA 1D0XA 3OS1A 1V3FA 4G8XA 2VJ4A 2E1MB 1U6GA 3C2HA 1WRJA 5F04A 2HYFA 2W82A 1FOWA 2CFXA 4L9NA 2KT0A 2BE5F 4JX5A 3V8KA 3OYJA 1YIJI 1JUMA 1KU2A 1Z6TA 2DU9A 2XRNA 3DQVC 3FXRA 1I1SA 2JN6A 3G2BA 2MBFA 3OIQA 1BIAA 4CO8A 1FPQA 2E7XA 3CJQB 5DYMA 3LSTA 2VBWA 2P8TA 1D1AA 2WC2A 3VYUB 2GXGA 2TRTA 3CLQA 1MNMC 2H8RA 2FX0A 1NG7A 3ZGKA 1U9OA 3G1MA 4EJTA 1K83J 1JTYA 1KQ9A 1SFXA 5ED4A 3AG3H 2NVQJ 3LOCA 2VQHA 3BROA 4EGYA 5H6RA 1I6XA 3TBIA 1SFOJ 4XLPF 3I4PA 1DUXC 1TL8A 1OCPA 3PNVA 2Z5UA 2KISA 5E18F 1TWCJ 2ZBKA 5F0HA 3K70D 2JWTA 1T2KA 3DP7A 3QP6A 2ID3A 2ID6A 3JREA 3H35A 3PUFA 1O57A 1CQTA 1S7OA 4HF2A 1YW7A 4AM3A 3FXOA 5HLIA 3MZYA 4KYWA 2LDUA 2YS9A 3CC4I 1TZLA 2XROA 3L2RA 1B8IB 3P9IA 2VOOA 4BHPA 4N0BA 4JOMA 3RKXA 3RIRA 4BU2A 3CDLA 2QQ8A 1T0FA 5HS8A 5J1YA 2QQ9A 2XPWA 4NQWB 4D7NA 4EM0B 3QPHA 2FOKA 2ZKZA 2QWWA 4LG0A 1KZHA 1SFEA 2BZTA 4P9FA 4F55A 3KYCB 4G7ZF 3DXJF 1JHFA 1P4XA 1FYLA 1YS6A 1R5ID 5FLXZ 3CDIA 3CUQC 3MN2A 2R7QA 2E60A 3OV8A 3S1NJ 2TDXA 1SAUA 5GTIC 1U2WA 2EFPA 2L7KA 2DJIA 5FO5A 2D1HA 3OYKA 2I5UA 5DM6F 3F72A 3S2WA 3OOUA 1XSXA 3PFYA 1UJ8A 2DFEA 3F0CA 2HNHA 1SC7A 5HODA 2MABA 3UKGA 4PK4A 5GADJ 1HCRA 5CPRB 2UV1A 5LGNA 2F5CA 4AU7A 4ENKA 3BP8A 1GHCA 2LG4A 3TO6A 3EUKL 2YSRA 1R36A 3EDPA 5E3OA 1JUPA 4XLEA 2F2EA 3W2WA 4QSHA 2HI3A 3LSHA 5JLXA 2R93J 3ABLH 3HGGA 2L2OA 1ZKGA 4BE1A 3FF5A 2LOOA 4ANJA 2FNAA 3GTLJ 2HZTA 4XOTA 4MIMA 4G7HF 1IRZA 3OR1C 2R7WA 3JRCA 4R1HA 2JJ7A 2PMUA 1S29A 2LTPA 4XIDA 2FA5A 2L7FP 3WG7H 5F08A 2KL4A 3KFWX 3DEWA 3R4KA 3O3KA 1S9HA 2L9RA 2CQXA 1BC8C 2AQEA 1ZREA 2MH2A 1VQ5I 3BR3A 2Y31A 1F1ZA 2DFFA 3RQ4A 4KN4X 4A93J 4IO9F 1JGSA 4HYEA 1FSEA 2K3PA 3JRDA 2BV6A 1O3SA 5KK1A 2VIXA 3HRSA 5FKOA 1SVLA 4ZDPA 3WU0A 1MH3A 3DPTA 3RKQA 3ROUA 3CF5F 4UV9A 1KU7A 4XRSG 4LMYA 1S6LA 1U8RA 4EMSA 1DP3A 4RA2A 1MBEA 1FP1D 1PUFA 3H9JA 5TISC 1FOXA 3PIPF 3BJ6A 4XLNF 3L2QA 3M8FA 3KYDB 2A6TA 4ZH4F 2GZWA 5ERIA 2K40A 1IO2A 3LSIA 3CCQI 3ABMH 3K4BA 3CZ6A 2CUFA 2WV0A 1FP2A 1FX7A 1LEBA 1RKWA 1P9QC 2Z3YA 1Z7UA 3IWFA 3S3NA 1XSDA 1TP4A 2XDVA 4U7DA 4WWCA 3JRHA 4DYQA 3VDXA 1O4XA 1PJRA 5JVGF 1LDDA 2MC4A 3QYEA 5E1XA 3L7WA 1N25A 3GX4X 2OTJI 3DTEA 5J3LA 5FB2A 2QUFA 5ICEA 5E3MA 1QHGA 3ERED 2MG4A 3F6VA 1X1BA 2FU4A 3OSGA 2OJED 2XB0X 3H9GA 1ZLKA 4XSXF 5K5QA 2HOAA 2OU2A 4Y3OA 3CCMI 2GA2A 5J40A 1ZRCA 3HPGA 2ZSHB 3SEZA 4RB2C 3M07A 1AWCA 4WF2A 2O8KA 2VT3A 4Y17A 1XMKA 3B73A 1F36A 1I6HJ 3S32A 2H6CA 4V19K 1R4MB 2X85A 2DODA 4Y7NJ 3T0YA 1ETVA 2ZSIB 3KP6A 5DV5A 2E1MC 2E35A 5BPDA 4HBLA 5LD2C 1GUUA 2HQAA 1R6RA 4C2MJ 1WH5A 2X6XA 3WTXC 4LOCA 5F6FA 2Q8KA 1HDDC 3WHCA 3CO7C 4M3GA 1ZH5A 3NWTA 2DK8A 1XS9A 1IXCA 2W4SA 1FSHA 5LRRA 4I09A 4BHBA 1ZGJA 1YQAA 3BCAA 2L9VA 2ZJRF 2EIMH 1D5VA 4RB1A 4L5IA 1OCRH 5BQTA 2CUEA 1G3TA 1W5TA 1B72A 1EH7A 5IYBJ 2O6GE 4L0YB 4WCGA 1LVKA 4OIRF 1YI2I 1IRXA 4HDVA 5K5OA 3TW7A 2P5LC 2XV4S 3TP3A 2NXNB 3RI4A 1E17A 5CYVA 5D4RA 2IAIA 2Z2SB 5DUIA 5BS6A 1G8XA 2STTA 2LKSA 3M8JA 3S93A 4HX4A 2M4KA 1SMTA 1IUFA 3LL7A 2CV1A 2IP2A 2HVQA 2W00A 4FASD 4NBQA 2F48A 2LBFB 4CSWA 3WHBA 2STWA 3FXJA 1IXRC 1TTYA 4FE4A 4BQAA 2A69F 4IRIA 3CJNA 1Z77A 3QPSA 2PFBA 3AG4H 4XRSA 4LLGF 1Z05A 3H3ZA 5EEGA 1BOAA 1TT5B 2K9NA 3WTTC 2LVSA 1YS7A 3KP5A 2LNBA 5FD5A 3HRTA 4ZDOA 1BR1A 4HNUA 4XSZF 4A3IJ 2XF5A 2FF4A 1IXSB 3KPHA 3DEUA 5H20A 2CQQA 1FBSA 1UHWA 1XDSA 2PQ8A 3SEQA 3O6BB 1T8IA 5GPAA 4A0XA 2XAFA 2YU3A 2IS4A 2BW3A 5CVVA 3RYRA 3OYIA 1SD7A 2A5YB 2KDOA 4FCYA 1DDNA 2GBYA 3GMEA 1BI3A 3H5RA 4W97A 2OA4A 3QODA 1YX3A 1LFPA 5HVQC 1RUNA 1P7JA 3DCFA 2CO5A 1ETQA 3ABKH 1WJCA 2AO9A 1J5YA 2K9MA 4G94A 4BQQA 3WTZA 3IRRA 5M3MJ 3FWEA 3QYFA 1FYMA 3TKYA 3M3YJ 3G6EI 2JA5J 1Y1WJ 4J00A 3OL4A 3GFLA 4XKCA 4H0EA 2DFHA 1ZG5A 2XSJC 1O3RA 3OSFA 1DGRM 2OCEA 4PJJA 4X1EA 1YX5A 2AXLA 2DCEA 1XCBA 1KQ8A 5F0CA 5M3FJ 3GEZA 4UHTA 1IZ1A 1IRFA 2HZDA 2E1OA 1K6YA 1TQIA 3ZXSA 4YFNF 5B5EC 2FQ4A 1MSEC 2WA0A 2FNPA 3RKWA 2VKEA 3W6KB 3ZCOA 3VYTB 4IOCF 3ZQFA 4AYBN 2R7XA 1U5TA 3TOBA 2H1LA 2BXYA 3FXQA 2M8EA 1ERDA 3KX2A 3FM3A 3K4MA 1KQ0A 1H89C 2VBXA 1NHAA 4LB6B 4A5NA 1VTNC 4GFBA 4UV8A 1O7LA 3K1NA 3GZ5A 4TV7A 3QQAA 5HS7A 2A6EF 3BZCA 3MAJA 3CJRB 4C2UA 2K02A 3S16J 3H0DA 1X3UA 2HVRA 3MEXA 1HOMA 1ZQ3P 2XVCA 2CRGA 3KEQA 5DEQA 5D4SA 3KZYA 3A01A 4IHSA 4QPOA 1OYIA 3RZDJ 1VQLI 1RETA 2CQNA 3ECHA 1W36C 3W2AA 1GT0C 3EYYA 1XGMA 2HQNA 3V8JA 3CUOA 2XAHA 2F5FA 3C3WA 5DCFA 4K2EA 4E7HA 1A6QA 2F6CA 1R23A 5H6QA 2VQGA 1TQMA 5CVUA 2ZNZA 2XRLA 4PGHA 5E79C 3T5XA 3HDDA 5DD8A 1GVJA 2LMDA 3HKZN 1O3QA 2NVTJ 2OD5A 3ULQB 3FHZA 3PM1A 2JK3A 4MQVA 3VSLA 3KEYA 1MJ9A 3T8TA 4ZZLA 1IDZA 5J4VA 3DU6A 1J59A 1X1DA 5F0FA 5CQGA 2FBHA 2VE9A 2VB6A 4DW6A 2JQ7A 1FY7A 2JUCA 4KT5C 4II2A 2UWMA 5GAGJ 2JPBA 2RV8A 4J19A 1C0WA 1A36A 2DOFA 1MIJA 1BW5A 2V1NA 2LY9A 3S3MA 1I3AA 2RGVA 2W48A 1I5ZA 2CW0F 2BY1A 1ZGAA 3BG3A 5K7FA 4CYDA 1BW6A 1R22A 2LK2A 4YFKF 2EINH 3S17J 4UB6C 4XQFA 5GP9A 5EDNA 4O3MA 3ABUA 1W7PA 3LFUA 1HW2A 4FQGA 1REPC 3U2RA 1BR4A 2BYVE 1J9IA 5HLHA 4YELA 4BY7J 3LA3A 1H0MA 1YRNB 3BTCA 3CLOA 3H1CA 1A04A 4ENJA 2O9LA 2P7CB 2HWVA 1XSVA 3EUHA 1T33A 1IN4A 3K1MA 3J7AY 1RI7A 2NAZA 2DA3A 2CQKA 3D0SA 2A5WA 3FM5A 3RKYA 2L0KA 3GTPJ 2HQ5A 1MDMA 2HOTA 2KIUA 2IS2A 1ON1A 3V7SA 2IEKA 1Y56A 5KVRA 3JRFA 5IPAA 2VXZA 5E1WA 1OJLA 2NNYA 1PP8F 1MBFA 3X2QH 1DGWY 3D5RC 3HYIA 4I01A 4LLNA 5L3FA 1LNWA 2JT1A 3OIOA 3V42A 2GXBA 1QVTA 3T8RA 5JLWA 2M9HA 1MBKA 5EG0A 1MBHA 2EQRA 4IHXA 4Y52J 5IYDJ 1W7PD 2XGCA 3JTGA 2V1XA 5HDGA 1R1VA 2I8DA 2IGMA 2Z33A 2DAOA 4I2OA 1VQOI 1ZR2A 1R4NB 2OV7A 4HSTA 3F22A 4Q47A 4L18B 1FC3A 1J0RA 4IEJA 4G7OF 2JA7J 3IC7A 3Q9SA 5DS9A 2V4JC 2KJCA 3U1KA 4KT6A 3BPVA 2K5CA 3FBIB 3KE2A 4NC6A 4N9IA 4RAZA 2QGUA 3FDYA 1ZG1A 1ZRDA 4M71A 3GUDA 5IT9K 3HOUJ 1YOVB 2AS5F 2FD5A 2DT6A 2ELHA 3JSPA 3H3UA 1V5EA 2PG4A 2R5ZA 3SYTA 3K4LA 2XKOA 2EBIA 4S0HB 1WZ2A 4F91B 2R7ZJ 4A3BJ 5J8FA 1SD4A 1HF0A 2FJ1A 2QKMB 5D5VB 3WTUC 2EFQA 2QQAA 3C2BA 4LG0B 3HOZJ 1D3YA 1ENHA 2L54A 4LFUA 2ZXIA 4A5MA 2LFBA 3VPRA 3ZMTA 2W1OA 4ZTFA 1A6IA 1APLC 4B48A 3E5UA 2P5KA 3ZQQA 4PCQA 5LGUA 3JRBA 3R61A 4LLLA 4EJVA 4EATA 2E5NA 4XL9A 2XASA 3WE3A 3BZ6A 2V6CA 2FSWA 5D6EA 1GXQA 2LKXA 2XAJA 2WAQN 2F4MB 1BN5A 3IH4A 2QF7A 2MSYA 5E8GA 3GLLA 1K4TA 1S3JA 2VPRA 1BC7C 2ZJQF 4I7HA 2Q0OA 2DLLA 2CV0A 4PJNA 1HDPA 2JUGA 1K7AA 5C3EJ 2HVSA 3JR9A 3TMOA 1A5JA 1OR7C 1Z21A 2KIMA 4U88A 1B9NA 3A0BC 3OYEA 1GLNA 4OAYA 3A2KA 5DTDA 4M3DA 3CUQA 2P5VA 3OYAA 3OYMA 2B9SA 2OBPA 1MSFC 4OIQF 3KYLA 1HBXG 5E1ZB 1LQ1A 1VI0A 2GM4A 2KFDA 4EQQA 1ACIA 1LJ9A 1R5HA 1QA6A 1TWFJ 5EYRA 2K9SA 1R9TJ 2P4WA 1IGNA 2HDCA 2P7VB 2LYCA 2DPDA 4RM2A 4KNYA 1TNTA 2OPTA 3FK7A 3BC8A 3E3VA 2ESHA 1YIOA 2B0LA 3BOQA 2FUG2 3FX3A 1R71A 4GRIA 1HKSA 2BY2A 1PUEE 4IPAA 2VASA 5J1UA 1KA8A 1AOYA 3L2UA 2VPLA 1FT9A 4ESFA 4BDZA 1YLFA 4XLCA 4BXFA 2ZMEC 4ENMA 4A3FJ 1OPCA 4IQJA 2P6TA 4BXUA 3GLXA 1GV5A 2DMTA 4C9YA 4I98B 3LA2A 1V4RA 3SZTA 4EM2A 4FX4A 3HOWJ 5GPCA 1YFHA 3EPZA 4XICA 1LE8A 2X6OA 1IDYA 3TDZC 3GFJA 1OQYA 2V9KA 4BUPA 5EGOA 3P7NA 3F8BA 3IUOA 2MLKA 4G6QA 2GAUA 4XM3A 3IWZA 3HB9A 3DBRB 2KRCA 2HTSA 4A3LJ 3GTJJ 3LSKA 5EJCA 2E2JJ 3PUBA 5DCMA 3CQZJ 1ETXA 4M9SA 3MKYB 2NOJB 3E6MA 3F8CA 4ETSA 2UXXA 1FYKA 4HW0A 4HEA2 4PDKA 1OCOH 5TJJA 5C4JJ 3L9FA 3WTYC 3OS2A 3QRFF 3BT9A 3K10A 5B1BH 5IT9Z 1LFUP 3PO2J 3FBNB 3I4MJ 2ZCWA 2Y9ZA 2WAQA 3SFZA 1QRYA 1RR7A 3KEOA 4D7MA 3C1DA 3GZNB 1IW7F 2W85A 2Y0SA 3F8MA 3OOPA 4ZYGA 2RVCA 3P9KA 4UXNA 5JVTA 3FHNA 1HXDA 2G9WA 1ZTRA 1Y0NA 5F27A 5LEJA 2BXZA 1XC5A 2NS8A 1XN7A 4MLOA 4MTEA 2M5WA 4YEJA 3J7AO 1DQUA 5ILSA 2LP0A 1Y6IA 2Y9YA 5L3CA 2MA3A 4AIKA 2IA2A 1HW1A 3CCVI 1MJBA 3S1RJ 2RQPA 2KQRA 1GV2A 5H2FC 1IRGA 4A3MJ 1F4KA 4A0YA 4RLQA 1JE8A 2R92J 2D1VA 1XPXA 1OCTC 4XKWA 3CD6I 3GVAA 1N77A 4B09A 4BGDA 2ZJPF 3GFMA 2EV0A 4F3QA 4FE7A 4NUBA 1G3WA 3KP7A 2HPMA 3V7RA 3DF8A 4HLYA 1MBJA 2L01A 5DM7F 1H88C 2ACJA 3I0TA 2QSHX 1X1CA 5AIQA 1B72B 1FOYA 2ELKA 2EZKA 3FKJA 1Q1HA 2PEXA 3BWGA 1IUYA 3CDHA 1LEAA 1RPWA 1ZYRF 3GFIA 2X1DA 1L3LA 3HL2A 1LUJB 1WJBA 2R7VA 2FQ3A 4XRFA 1YE9A 3L2WA 3JAMK 2QENA 1RC9A 2CQ7A 4IL6C 2H27A 4UNOA 2HDWA 2Z1DA 2CV2A 5JHUA 4C3HJ 1UHMA 3CCYA 3QPLA 4UUSA 5HDNA 2HEOA 3OMYA 1QPMA 1M1EB 4I0AA 2FOWA 4XKBA 2KZVA 1FTTA 2KRHA 3K2ZA 5M5XJ 3MKLA 4L9TA 3Q9VA 4LG3A 3W6JB 2NVYJ 4MFDA 1MKMA 4BYYA 3NAUA 1AKHA 4A6EA 3VEPA 2EA2A 5IT3A 4IHYA 5HNFA 2X1CA 2EFWA 1ZARA 1JJ8C 3HZJA 3HRUA 2EZLA 4E7IA 4I0BA 2RREA 1E3HA 5JHFA 5HS9A 3V8LA 2XF7A 3ZOBA 1HLVA 4UY8I 1KU3A 2HXOA 4OIPF 3GTGJ 2BW3B 1HKQA 4PGGA 3LFKA 3LSGA 1S7EA 1MJAA 5FKLA 3KCCA 1KYWA 2GA1A 2ESNA 2W7NA 3MZHA 3GXOA 1BJAA 5J6XA 4DGWB 1RRJA 4HA8A 4I76A 1J7KA 2YUSA 4IHVA 1Y39A 2ETHA 4A3GJ 4E7KA 3HTSB 4YIRX 2X4HA 1FLIA 4XN3A 3Q0VA 1RR8C 2K7LA 3CC7I 1WJEA 1OFCX 2K3FA 2XPVA 4JBAA 2M4GA 2L4AA 1YJNI 4IVNA 2DBBA 4CUGA 3J7ZI 4HNVA 1J09A 4E7LA 2RNJA 2P81A 5ILUA 3OYBA 2CFOA 4BJ5C 2CMPA 4F7ZA 2FBKA 3PO3J 3WU1B 4Y33A 2R0QC 2DN0A 1Z1DA 1PDNC 4RLFA 2ZXWH 3LSRA 1WI9A 2DA5A 2PX9A 3M8EA 2M7AA 4KN7X 3BR6A 3MCZA 4QLCU 4HX7A 4XONA 2R7OA 3HEFA 4PFOA 4B3AA 4HDUA 4IJAA 4II3A 1VQNI 3R0AA 1HW5A 4MEXF 1MMDA 3CESA 1YITI 3IL2A 1VQ6I 2L9NA 4G6DA 3A01B 4N4OB 2KZGA 3CCRI 4YRVA 3WTSC 3DPUA 4CYCA 3MD2A 1T56A 5DD4A 2W84A 3JTHA 1XD7A 5D8LB 5ICGA 2DXIA 2IT0A 4IOAF 2MC3A 2CYYA 4ZTJA 3CO6C 5BNGA 2JVGA 2JA2A 3L00A 1VFCA 3JW4A 2KJBA 4S05A 1RNLA 3AG2H 4AC0A 1GXPA 2DA7A 4YFXF 2L4MA 3F21A 2LSOA 5K7ZA 1R1TA 2K9QA 3BG7A 4MNUA 3IHUA 3NARA 2HDDA 3GTOJ 2XC7A 1W5SA 3A02A 4ASNA 4CXFA 5CLSA 1G59A 3RCOA 1WVRA 1ITYA 3JAMZ 2XB5A 2R5YA 1YJWI 1UFMA 3S2DJ 3IAS2 1UMQA 4E7ZA 4RGUA 3E5QA 3I54A 4M3FA 4GXOA 5LFAA 5E17F 1LDKB 4EM1A 5J8CA 2IA1A 4YIFA 2NVXJ 2E2HJ 1ETOA 2HU9A 4NB5A 4QIWN 1VQ8I 4XOPA 2IRFG 3LSJA 2GOMA 3S2HJ 4BBSJ 3J7YJ 3TO7A 3K4CA 1STZA 3VB2A 2K4JA 3R6SA 2NVUB 2OC6A 4B47A 4M6YA 1B4AA 2A07F 2IGNA 1F9NA 1IC8A 4MFEA 1JHHA 4OOIA 3F9KA 3D1NI 1TLHB 3LAJA 1XMAA 1TW3A 4C3IJ 3JCUC 4RAFA 4D5CA 4HLXA 3LMMA 1R5GA 4PJ0C 1PVEA 2COBA 2H09A 2PBIA 1P4WA 1K79A 3RZOJ 3BCBA 3K4JA 3L2VA 1OKRA 3ZQHA 1T38A 2CGPA 5HLTA 2V9VA 3ZP5A 3EQLF 4PSXA 3L09A 3T1BA 1I50J 1D8KA 4Z6YA 4BNCA 3H5AA 1XCVA 4RGSA 2L5QA 3I59A 5AIPA 3ZQIA 1W36D 1XGOA 1WKMA 1UB9A 5GTHC 1FOKA 2QSFX 3SXYA 3VODA 1FIAA 4QWQA 2HS5A 1ZR4A 2M3AA 1FMWA 1X1AA 4R79A 2I10A 1ZHFA 1T39A 4ZYHA 3G4SI 1QBJA 4RAYA 4A0ZA 2VI6A 1QU3A 5IY5H 3FIWA 4XLAA 5D5WB 2KRFA 5FROA 3OS0A 4Q5SF 2WBMA 4D0PA 5JI6A 3F6OA 2BY3A 5D6FA 3WE2A 3DTIA 5HDKA 5EG0B 1TC3C 3LQRA 4M74A 2KIQA 3TGNA 2DW4A 1G3YA 2JPCA 1J75A 5ILVA 2XPUA 3GWZA 2F4IA 4YIIA 2R7UA 2K9LA 2F5DA 2M7BA 1ETKA 2QQBA 3CP8A 2DDAA 3BR1A 5FKNA 5F1JA 4B8XA 2DT5A 4Q48A 3DWLE 3MKZA 3PJRA 4JX6A 2NS7A 2DMNA 4C3JJ 1IN6A 2UXNA 4LD5A 4U7BA 4LB5A 2PN6A 3QPTA 4OMZA 1WFXA 2X1EA 3BQZA 5CVIA 3GO5A 4A3JJ 2BBYA 3BJAA 4DBRA 1P6RA 2QM3A 3M9AA 3R60A 3EYIA 4BEHB 2M8GX 5EEHA 3N05A 2R5ZB 2DMUA 2Z99A 1OYWA 3QOPA 1E2XA 1Z7LA 4HF1A 1MMNA 1WH7A 3QWLA 3QAHA 2XIGA 1WHUA 2JMWA 1ULYA 5GAEJ 1O7FA 2GWRA 4Y13A 1RZ4A 5FKMA 1MW7A 3H36A 4GCVA 4F52A 1XB4A 2LH9A 3HOXJ 3FXUA 4C2TA 3FMRA 4KITB 2O8XA 2OAZA 2DA2A 1XMXA 2GIVA 3HXLA 3IV5A 2E1NA 4KIGA 3FK6A 2HQRA 4DIQA 4B3XA 3I71A 3GF2A 2ZXHA 2E7WA 3F3XA 2VJ5A 3SQNA 2QEXI 5IP6A 1Z0XA 1IF1A 3GYHX 2EJRA 3A1YA 1SD6A 3FISA 5E3LA 3RDIA 2E34A 2HXIA 3JRAA 4H4KC 1QHHD 1MMGA 2RKHA 2KDZA 2H1KA 2O61A 2K27A 4YG2F 5A2QK 1VQKI 2ZNYA 3E6BA 2M2EA 4M3EA 1P7IA 2DOAA 3FMQA 2D5VA 2DK5A 2ADUA 5CVJA 5KCMA 2FE3A 1D1CA 4B44A 2X9DA 3CUQB 3E6DA 4MTDA 3ZMSA 4BS9A 2L9SA 4DBQA 2MYSA 3Q0WA 3NWSA 1IV6A 5DDGA 3I55I 2F4OB 2YPRA 3QU3A 1UG0A 3V7CA 3H9QA 2V7FA 3I53A 4XORA 1OLTA 3QU6A 2VC1A 2NS0A 2XAGA 4CCJA 4PFPA 4P55A 4MHGA 1TW2A 2WY7Q 1OCCH 1HSJA 2O7OA 4G6TB 4KISA 4I02A 1U9NA 1R1UA 4XNFA 4NNJA 5FD6A 3EUAA 4X6AJ 1Z67A 1QZYA 4LIVA 3DPLC 1DP7P 1OR7A 2R7FA 3DLAA 4IF4A 5FLVA 2X0LA 1E3PA 1U78A 4XLHA 4U0YA 2RQQA 2GOXB 4OAZA 1A31A 4KUMA 1JGGA 3HPHA 4DNCA 4U87A 2DPUA 3VWBA 2KLOA 5C4XJ 3HG9A 2EFNA 3LQQA 1SVOA 4JQFA 4HQMA 1RKTA 1TQPA 4FETA 5E8IA 2B7EA 2PI0A 3ERMA 1OMIA 5EGOB 4OIOF 2YU9J 1JKRC 1CF7A 2ICWG 5FJ8J 4LGWA 1MGTA 1R58A 4JP0A 2E36A 3OYNA 3W6VA 1G3SA 4ZYDA 3LAPA 5KNLA 5DCMB 1VNDA 4Y4RA 2LLKA 3DFGA 4OU0A 3FXLA 3CMAI 2HKOA 4CCNA 3S1QJ 3IKTA 4S04A 1MNEA 2OCCH 2ZMEA 4M73A 4Z2YA 2VN2A 4BBRJ 4HQEA 3CC2I 2EB7A 5FGMA 4BDYA 2CH0A 1YW8A 3GTKJ 5F1RA 2RC4A 1I1GA 4AVPA 4ZC3A 1BI1A 2M1BA 2YR2A 5K5RA 5L3EA 4KFCA 1TBXA 3ZN0A 3BPXA 4CZCA 1ORKA 1W4MA 1T98A 2EWNA 4P5OA 2TCTA 4XRMA 3OIPA 3Q3SA 5L3GA 3WU2C 3OYFA 1Z9CA 3NRVA 3ZN1A 1K61A 3REOA 2A68F 2XGDA 3IAM2 4ITVA 2Y0SN 3TOAA 2Q2EA 1JJ6C 3KETA 3SDGA 2O5RA 1WGXA 3DBHB 2CSOA 2CJJA 2KMUA 3RJPA 1Y8QB 2K86A 3AFHA 2DQRA 2IPQX 1S7AA 3IH2A 1P2FA 1V55H 3CMYA 1H8AC 5BMZA 1EV7A 4PJLA 4U0WA 3BDDA 3CTAA 1Z91A 4Y15A 5D8KB 2QCOA 4B43A 1X2MA 3SFIA 5EZGA 3KZIC 2EIJH 2J5PA 4EGZA 2DTRA 1YTYA 3O8HA 1L0OC 1SD5A 2CG4A 2VBYA 4OMYA 2R4GA 1QQIA 3KZZA 3CCLI 1TWGJ 5A2QZ 2VKHA 1IG7A 5IOZA 3E1SA 5B1AH 3BR0A 3S8PA 1SMYF 4GDFA 4C30A 3ZMVA 1WPKA 3VOEA 1AHDP 4DQ2A 5EF6A 2NRAC 1FEXA 4LJZF 2F5EA 2ISYA 4DYRA 1IAWA 3HUGA 1TNSA 3TQNA 1N75A 2VQCA 2M87A 3DTKA 1MZBA 2HPIA 4CA0A 1MD0A 3PSFA 4UUSB 3B02A 2VC0A 4CZZA 2Z9OA 1FBQA 3H5NA 4RGRA 4RDUA 2MGQA 2LKPA 1EH6A 2HGCA 1VQ9I 2XAUA 3I64A 3BG9A 4RAGA 5ICFA 2V6EA 1PUFB 1QZEA 2PJPA 1USTA 1KYZA 4IX7A 5IYCJ 1LDJA 3TL4X 1X19A 2DQLA 1AKHB 2IVMA 2K4BA 1S72I 3ASOH 2WB1N 2H6BA 3FXMA 1HSTA 3JSOA 2WWYA 2RDPA 2XGXA 1R7JA 1MBGA 4BH9A 3G73A 3E6CC 1NG6A 1FTZA 2V1UA 4D9JA 2Q1ZB 4BE2A 3I9V2 4E4HA 2DMPA 5LHGA 5DUKA 1VQMI 2QBYA 3A4CA 1AA7A 1ONVA 4RGXA 4XBFA 4DOZA 5K1YA 3ZQ7A 2M30A 4ESBA 2PJRA 3LNQA 2E2IJ 3PL8A 3HRMA 2FMLA 1X3WB 1IN7A 4FX0A 4ZYEA 4AIJA 3MMYB 3CCEI 1X2NA 1BM9A 3P9CA 4A3DJ 1ZAOA 2DYSH 1QO0D 2ZXJA 1Y1VJ 3A0HC 3U21A 1RUOA 3FXKA 4AIHA 1EF4A 4LIUA 3JRIA 2N8GA 4BJ6C 1BL0A 4EJOA 2B63J 1WI3A 1NTCA 2NYXA 3PNTA 5F64A 1TWAJ 2JRTA 3UNGC 4KMUX 2VE8A 1JT6A 2EV5A 4RM3A 3J80K 1V54H 5BOXA 2BOLA 4PUSA 4ZJZA 3W2VA 3K70C 1AU7A 3K4NA 3OY9A 3H92A 4BACA 1D0ZA 3BLYA 4M6XA 2WAEA 3S3OA 1V5GA 4UB8C 3RPQA 2M0CA 1RESA 1WJDA 3EETA 4R8HA 4CCKA 3KP3A 5GAHJ 3RPUA 5LRSA 1TT0A 2VKDA 3KP4A 3OYGA 1DPRA 2DA4A 3F8FA 2DDBA 2IBDA 2LF7A 2P0WA 1KU9A 5K7HA 5L3BA 4IRHA 3DKWA 1FMVA 4HF0A 2KPMA 4IHTA 1SANA 4KIBA 4L9VA 1WCMJ 1QZZA 3I5UA 4CDGA 4IHWA 1K78A 2IGKA 1N78A
chains in the Genus database with same CATH topology
2VB6A 2IS1A 3K4KA 2LRDA 4II2A 2UWMA 2WY8Q 3QYBA 4LITA 4ZYAA 1JI8A 4IZZA 4NC8A 3BG7A 2VLAA 3VSKA 1T95A 2V1NA 2Z16A 2XC7A 3S3MA 1G59A 4IQ4A 3RCOA 2OUMA 2JVHA 2VJJA 1VZ0A 1EA3A 2ELJA 3IAS2 4XKVA 4E7ZA 1Z3YA 1UELB 3PNYA 5LFAA 1D0XA 3OS1A 4XQFA 1LDKB 2WB1A 2X6YA 3UR3C 1U0JA 2VJ4A 3LFUA 2E1MB 2HU9A 3C2HA 3OL3A 2W82A 4KJZA 4XOPA 3RPUD 2GOMA 1BR4A 4YELA 3K4CA 3OYJA 3DEEA 4HSRA 1T0FC 2OC6A 4B47A 3DQVC 3G2BA 3OIQA 4BQNA 2IGNA 3CJQB 5CKTA 3F9KA 1D1AA 3VYUB 4F93B 3J7AY 3LMMA 3HOTA 2MD0A 1NG7A 2A5WA 3ZGKA 3BCBA 3K4JA 3L2VA 2IS2A 5HLTA 1Y56A 3ZRGA 1UAAA 4OWRB 2VXZA 2VQHA 3OYLA 2X6WA 1DGWY 3D5RC 4PSXA 3TBIA 3V42A 3H5AA 2LC2A 3PNVA 3GBGA 2L5QA 1W36D 3K70D 4QPQA 4PJMA 3H35A 2I8DA 2IGMA 3D5SC 2M3AA 1FMWA 1X1AA 2RNGA 3CF2A 4R79A 3IP4B 2OV7A 1HA8A 4HNTA 4HSTA 1D0YA 1QU3A 1TZLA 3L2RA 4JOMA 2V4JC 2CW8A 4XLAA 3OS0A 4KT6A 3FBIB 2K5CA 5FROA 2WBMA 4BU2A 3DTIA 3FDYA 4NQWB 2F4IA 2R7UA 4F55A 2K9LA 2M7BA 3MKWB 2DT6A 3CP8A 1BOBA 2R7QA 2E60A 1SAUA 1V5EA 2L7KA 3SYTA 3K4LA 2DJIA 4F91B 3OYKA 3OOUA 3PFYA 3DWLE 3MKZA 2QKMB 3PJRA 2HNHA 5KHDA 2MABA 4PK4A 2ZXIA 4U7BA 5CPRB 2UV1A 2W1OA 1WFXA 2BVLA 2X1EA 2LY1A 4CCLA 4ZTFA 4AU7A 4N4NB 1BR2A 2LG4A 4XR6A 4B48A 4DBRA 3ZQQA 4E7SA 3EUKL 4BEHB 3N05A 4XLEA 4EATA 2E5NA 4XL9A 3W2WA 3LSHA 1Z7LA 3AL0B 1MMNA 2PMZA 1MMAA 2CUZA 2L2OA 3RSNA 4BQOA 4BE1A 2R7TA 4BL0B 1WJFA 2LOOA 3CMMA 4ANJA 4F52A 1E0EA 1MW7A 3SDBA 2LH9A 4XOTA 3OR1C 2R7WA 4C2TA 4KITB 3HXLA 2CV0A 4PJNA 2JUGA 2KL4A 2HVSA 3TMOA 1OR7C 1Z21A 3ZR8X 4B3XA 4DIQA 1S9HA 2ZXHA 2CW7A 2AQEA 2F5VA 2VJ5A 3OYEA 1GLNA 4OAYA 3A2KA 3RQ4A 3A1YA 2M0MA 3OYMA 3OYAA 3KYLA 2K3PA 3E0JB 3OYCA 4H4KC 4X0GA 1QHHD 1MMGA 5TGTA 1WJAA 4RMNA 2VIXA 4ZDPA 4IKFA 3OR2C 3DPTA 2DOAA 2LYCA 4P1WA 5KCMA 3OWTA 4RM2A 1DP3A 1D1CA 4B44A 3BC8A 3H9JA 3HOSA 3DKYA 3L2QA 2FUG2 4BS9A 4GRIA 2A6TA 4CH7A 2L9SA 4DBQA 2MYSA 3LSIA 2VASA 3NWSA 3K4BA 3CZ6A 4CCMA 3L2UA 2VPLA 1UG0A 3H9QA 2V7FA 1P9QC 4XORA 4AVZA 1OLTA 4CCJA 4XMYA 4XLCA 4BDZA 4BXFA 3LSMA 4PFPA 4IQJA 3S3NA 2WY7Q 4C9YA 2IXSA 2XDVA 4G6TB 4XNFA 2R7RA 4KISA 4NNJA 3EUAA 3VDXA 3VYSB 1PJRA 2MC4A 3QYEA 4XLFA 3EPZA 4LIVA 2IGOA 3DPLC 3DTEA 2V9KA 4BUPA 3DLAA 1QHGA 2XF6A 3IUOA 4XLHA 1X1BA 2RQQA 2GOXB 3H9GA 4OAZA 4XM3A 3HPHA 4Y3OA 2WAFA 2KRCA 1X4PA 4U87A 3LSKA 3VWBA 1Z3XA 3HPGA 2AQFA 2KLOA 2ZSHB 3HG9A 3PUBA 3SEZA 2VXDA 3HC7A 4JQFA 3MKYB 2NOJB 4HRIA 3K6GA 4FETA 3OYHA 4HEA2 4HG2A 3OS2A 3S32A 3DU5A 3VYRB 1PYVA 2X85A 3K10A 4ZDLA 2WADA 3DKXA 4CCOA 3OYNA 3FBNB 2ZSIB 2E1MC 2WAQA 1X4OA 5LD2C 2Y0SA 2HQAA 1R6RA 2X6XA 5KNLA 4Y4RA 3FHNA 3NWTA 4CCNA 2W4SA 1SFKA 1MNEA 3CP2A 3ONQA 4MLOA 4BDYA 2CH0A 1WJ5A 3BCAA 2UUZA 4YEJA 5HNHA 1DQUA 1Y6IA 2LREA 4ZC3A 2KQRA 1LVKA 2LBFA 4CZCA 1LKXA 1IRXA 4P5OA 4RLQA 3OIPA 4XKWA 1N77A 3OYFA 4BE0A 4BGDA 1KONA 4F3QA 3IAM2 4ITVA 4NUBA 2Z2SB 2HPMA 1G8XA 2O5RA 3M8JA 3S93A 2KMUA 2M4KA 1X1CA 3LL7A 2CV1A 2HVQA 3AFHA 3FKJA 2W00A 4FASD 2LBFB 4CSWA 3RTRA 2CS3A 2KP6A 4PJLA 2X1DA 2X51A 3HL2A 2Q2EB 1WJBA 2R7VA 4B43A 2KHMA 1YE9A 3L2WA 2VQLA 4HPQA 4DJAA 4ZDOA 2HDWA 1BR1A 2Z1DA 2R4GA 4HNUA 2LY2A 2CV2A 2XF5A 2VKHA 3OMYA 4NC7A 3E1SA 4XKBA 2KZVA 2KRHA 3S8PA 5CQEA 3SEQA 3AKZA 2R7SA 1D1BA 4C30A 4LG3A 2BVMA 2IS4A 2BW3A 2E5ZA 4AYBA 3OYIA 2KDOA 3BG6A 5HNFA 2X1CA 1N75A 2VQCA 2IS6A 3DTKA 3H5RA 2V26A 2HPIA 4CA0A 5FRNA 3D5LA 4E7IA 3PSFA 3QODA 1YX3A 1LFPA 5HVQC 3H5NA 2RREA 1MNDA 1WJCA 5JHFA 2ZFUA 2K9MA 2XAUA 4BQQA 2V6EA 2MFZA 2XF7A 3QYFA 4IX7A 4J00A 3OL4A 2BW3B 4XKCA 3TL4X 1X19A 2XSJC 3LSGA 1DGRM 4PJJA 3HUGB 1YX5A 2DCEA 2VL8A 4PSWA 2HZDA 2W7NA 1K6YA 3ZXSA 3AL0C 2WA0A 3ZCOA 3VYTB 4DGWB 2R7XA 1NG6A 1V5FA 1ZELA 5HOOA 2CUJA 4D9JA 4E7JA 1ERDA 3KX2A 3K4MA 2Q1ZB 4BE2A 3I9V2 4E4HA 4E7KA 2QKLB 3A4CA 1AA7A 4DOZA 2PJRA 4XN3A 2VJIA 1WJEA 3PL8A 2M4GA 4F92B 3MMYB 4CUGA 1J09A 4E7LA 4E6KG 3CJRB 4C2UA 3OYBA 3H0DA 2HVRA 3U21A 5FRMA 2CFOA 3HKZA 2CMPA 3QOEA 4XN0A 4BJ5C 4J01A 4LIUA 4Y33A 4QPOA 4BJ6C 2PJRB 2JSPA 3PNTA 4RLFA 3UNGC 2M7AA 4RM3A 2BOLA 1W36C 4PUSA 4ZJZA 3W2VA 3I3LA 3K70C 3W2AA 3C2GA 3K4NA 5CQGA 3OY9A 4BACA 4XONA 2R7OA 1D0ZA 3BLYA 4PFOA 3W3CA 2WAEA 4II3A 1V5GA 3S3OA 3M1CA 1MMDA 3CESA 4BEHA 2L9NA 4BJTA 4E7HA 1WJDA 2F6CA 4N4OB 4CCKA 2VQGA 3PSIA 4YRVA 3DPUA 3MD2A 1TT0A 2VKDA 3OYGA 2P0WA 2DT7B 1FMVA 2KPMA 2DXIA 4D1QA 3VSLA 3KEYA 4ZTJA 2JVGA 3EUHC 3DU6A 2JA2A 1X1DA 3OYDA 3SZGA 2IGKA 1N78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RRE A; 
#chains in the Genus database with same CATH topology
 2LRD A;  2XSD C;  2BHZ A;  2OQR A;  2WY8 Q;  4CYC B;  1FNN A;  4LIT A;  2HTJ A;  5IP9 J;  2XHK A;  4ZYA A;  3B6A A;  1JI8 A;  4IZZ A;  5E20 A;  1GDT A;  4NC8 A;  2OTL I;  3VSK A;  2HOS A;  2VOP A;  2OUM A;  1VZ0 A;  1EA3 A;  2JRM A;  4XKV A;  5B66 C;  1UEL B;  4PZJ A;  3PNY A;  2W57 A;  1OCZ H;  3E7L A;  2WB1 A;  3TDU C;  2X6Y A;  2XKP A;  3UR3 C;  4FTH A;  1U0J A;  2IA0 A;  2O0Y A;  1UZC A;  2OF7 A;  2CWE A;  1BBY A;  1QGP A;  3OL3 A;  1FJL A;  4KJZ A;  2HOE A;  2P6S A;  3ELK A;  3KIO A;  2GXA A;  3RPU D;  2R5Y B;  1HKT A;  2CU7 A;  3TED A;  4ENN A;  1QPI A;  2PMZ N;  1JKP C;  3DEE A;  4HSR A;  4WXD A;  5L3D A;  4V2F A;  1T0F C;  4BKX A;  4OIN F;  1BI0 A;  3DBL B;  2BHY A;  2LD5 A;  1BIB A;  1QNT A;  1IN8 A;  4BQN A;  4Q4Z F;  1B9M A;  2DTZ A;  3SJM A;  4UUV A;  3FZV A;  5CKT A;  3IRQ A;  4F93 B;  5ICC A;  4CGZ A;  1SAX A;  2FRH A;  2EIL H;  2MD0 A;  3K0L A;  3HOT A;  3HOY J;  1WQ2 A;  1U8B A;  4AUX A;  3PIO F;  1IJW C;  3ZPL A;  4HZF A;  3H0G J;  2DOE A;  2EPF A;  3WG9 A;  3U1D A;  1XDU A;  1RIO H;  2E71 A;  3ZRG A;  5LGT A;  5JR3 A;  1S8N A;  5E3N A;  1UAA A;  2VT2 A;  4OWR B;  2VON A;  3OYL A;  3IH3 A;  2WTE A;  2X6W A;  1VQP I;  4M9X A;  2EIK H;  3V4G A;  3MZ8 A;  1B8I A;  3TP0 A;  3M4O J;  5AON A;  2LC2 A;  2JZY A;  3GBG A;  1F43 A;  3SHF A;  2MH9 A;  2DA1 A;  4QPQ A;  4NQW A;  4RB0 A;  4PJM A;  2LF8 A;  4ZZD A;  4HX8 A;  1JT0 A;  3D5S C;  3Q0U A;  4B1R A;  5M5Y J;  2OZ6 A;  2RNG A;  3CF2 A;  1Y0U A;  2LR8 A;  4O5V A;  3TW6 A;  3IP4 B;  1HA8 A;  2DMQ A;  4MGR A;  1U5T B;  4HNT A;  2ZFW A;  1D0Y A;  4CIC A;  1G4D A;  2L7M P;  2CW8 A;  1X58 A;  1W0T A;  2XGE A;  2G7U A;  3HIF A;  3BTI A;  3I59 B;  1W0U A;  2G7H A;  1FIP A;  5IOY A;  2Y30 A;  1F5T A;  5LEK A;  2NOG A;  3J80 Z;  2K85 A;  2BY0 A;  2GLO A;  3R0J A;  1ZG3 A;  1W5C C;  2EZI A;  1B6A A;  2RAE A;  3MKW B;  1H9T A;  4IRG A;  1BOB A;  4FHT A;  3ZQG A;  3FKI J;  1ZK8 A;  3G1O A;  4G12 A;  1XGN A;  1USS A;  1EJ9 A;  3GTQ J;  4B4C A;  5KHD A;  3N4M A;  1X3Z B;  2W24 A;  4DZJ A;  2DJN A;  3BR5 A;  5EZH A;  3TO9 A;  4EV0 A;  4WK8 F;  4CCL A;  2BVL A;  1ETY A;  2LY1 A;  3ASN H;  4EJU A;  1YO5 C;  4N4N B;  1BR2 A;  4XR6 A;  4BAY A;  4E7S A;  2E1C A;  1UHS A;  5BPI A;  1LFB A;  4AID A;  3GW2 A;  3AL0 B;  2PMZ A;  1MMA A;  2GQQ A;  2CUZ A;  4KDP A;  1G2H A;  3RSN A;  3BJO A;  4BQO A;  2R7T A;  4BL0 B;  1WJF A;  3ECO A;  3CMM A;  1WWX A;  2QVO A;  2FBI A;  2JTV A;  2ZC2 A;  3SDB A;  1PP7 U;  1E0E A;  1H9G A;  3LWF A;  4AWX B;  4GYI A;  3ZQC A;  1NK2 P;  3CJT B;  1P4A A;  4JX4 A;  3CCU I;  3RYP A;  1VQ4 I;  2A61 A;  3GTM J;  3HGY A;  3MWM A;  4U0V A;  4EVI A;  3ZR8 X;  2OZU A;  2CW7 A;  4BY1 J;  2F5V A;  3U9G A;  3ISP A;  4L5E A;  1FWZ A;  3G1L A;  4KIF A;  2M0M A;  2BEO A;  5FFX A;  2VUM J;  3E0J B;  3OYC A;  2X48 A;  1DU6 A;  4W1U A;  4X0G A;  3I4N J;  4L5J A;  5TGT A;  3LA7 A;  1WJA A;  4RMN A;  5FKK A;  4AD9 A;  1ODD A;  4IKF A;  3OR2 C;  4JYK A;  1UG2 A;  1W7P B;  4P1W A;  3BQY A;  3C7J A;  1TWH J;  3OWT A;  2MD5 A;  1D8J A;  1HC8 A;  3I58 A;  2JA6 J;  3HOS A;  2AXT C;  1SEU A;  3DKY A;  4GO1 A;  4ABZ A;  4CH7 A;  3WTW C;  2A6H F;  3FMS A;  4ESJ A;  5D5X B;  1XGS A;  4IXA A;  1SFU A;  2V79 A;  1R49 A;  4CCM A;  3NQO A;  5CVR A;  1T08 B;  4WX9 A;  4RBO A;  4AVZ A;  4XMY A;  3ZMU A;  1I39 A;  3G71 I;  3LSM A;  2IJL A;  2QLZ A;  4P96 A;  3JRG A;  1S5L C;  2IXS A;  2R7R A;  4KMF A;  3COA C;  2FEZ A;  3WGH A;  2V1D A;  1OIS A;  3VYS B;  4M3B A;  1O3T A;  4XLF A;  3ZQL A;  2IGO A;  2YX7 A;  4P9U A;  5JFR A;  4FIS A;  3S14 J;  5M5W J;  2XF6 A;  1MDM B;  1YYV A;  2HYJ A;  2V9P A;  2R3S A;  5LHH A;  1UCR A;  2MLG A;  5TRD A;  3QP5 A;  4E70 A;  3ZMD A;  3J81 K;  1BA5 A;  2JA8 J;  2WAF A;  2WV1 A;  2JSC A;  2W25 A;  1X4P A;  1Z3X A;  3MFK A;  1JTX A;  2AQF A;  2ISZ A;  4MEY F;  2VXD A;  2VOD A;  3HC7 A;  3N97 A;  2IW5 A;  4HRI A;  3K6G A;  4UVC A;  1I27 A;  2DFI A;  3BTL A;  5HLG A;  3OYH A;  3PQJ A;  4HG2 A;  1VQ7 I;  3DU5 A;  6PAX A;  1EKE A;  1PYV A;  3VYR B;  4N9H A;  3HHH A;  4ZDL A;  2VKV A;  1LB2 A;  2WAD A;  3DKX A;  4CCO A;  3WGI A;  4A3K J;  2J5O A;  2D2W A;  2EK5 A;  1X4O A;  1MMS A;  1OYY A;  4JK1 X;  2L3D A;  2RN7 A;  2KIF A;  1SFK A;  3S1M J;  2A05 A;  2AHQ A;  3CP2 A;  3KLO A;  2QYO A;  3ONQ A;  1CF7 B;  3BZK A;  4BXX J;  3S15 J;  1YJ9 I;  2YX4 A;  1WJ5 A;  2M34 A;  2UUZ A;  5HNH A;  2C6Y A;  1WSU A;  2QZ8 A;  2ECB A;  2LRE A;  2ZO4 A;  4WXC A;  3SZP A;  3BG5 A;  1NH3 A;  2L02 A;  1FBU A;  1YG2 A;  5J47 A;  3HSF A;  2LBF A;  1LKX A;  3DV8 A;  1A35 A;  3ZMZ A;  3HTU A;  2Y69 H;  2ZME B;  3PFI A;  1KON A;  2A3S A;  3CME I;  4BE0 A;  1JKQ C;  3ML6 A;  3DLL F;  1XTA A;  5KAF C;  2O3F A;  4WXH A;  2E19 A;  3I56 I;  3K7A J;  4DZP A;  4D5F A;  4NHJ A;  3O8G A;  5C44 J;  3AAF A;  1E3O C;  4QTR A;  1MH4 A;  1B59 A;  4I6Z A;  2GIZ A;  1CGP A;  3RTR A;  3ABT A;  4A2U A;  2CS3 A;  2KP6 A;  4ON0 A;  4I99 C;  2X51 A;  5LHI A;  1T6S A;  2Q2E B;  1U5T C;  2DYR H;  5EEA A;  4O6J A;  2KHM A;  1XG1 A;  5D5U B;  1ON2 A;  2VQL A;  4HPQ A;  4A69 C;  4DJA A;  1YW9 A;  2LY2 A;  3F8N A;  2ZJ2 A;  2ECC A;  1KGS A;  4NC7 A;  2EFO A;  1ZLJ A;  2VBZ A;  3M7G A;  5CJ9 A;  1XX5 A;  5CQE A;  2H8W A;  3AKZ A;  2R7S A;  1D1B A;  1ZN2 A;  3HSE A;  1G6N A;  3PQK A;  3B6C A;  3HM5 A;  4RS8 A;  2BVM A;  3CCJ I;  2E5Z A;  4AYB A;  3L1P A;  4A3E J;  3WGG A;  3LSP A;  4M9Z A;  2Y48 A;  3BG6 A;  5J1R A;  2IS6 A;  4FT8 A;  3BTJ A;  1NK3 P;  2V26 A;  2M45 A;  3D5L A;  5FRN A;  1YHQ I;  3BR2 A;  3MQ0 A;  1W1W E;  1POG A;  1BJZ A;  1JUS A;  2HYG D;  1MND A;  2ZFU A;  4M6V A;  2G0E A;  3KP2 A;  3K69 A;  2MFZ A;  3AG1 H;  2Y75 A;  3F23 A;  1IN5 A;  1DPU A;  2KKO A;  2HFH A;  1EH8 A;  3HUG B;  4KA4 A;  1GVD A;  1DU0 A;  1P92 A;  1R00 A;  2VL8 A;  1BI2 A;  3MVP A;  4PSW A;  4HOB A;  5FFZ A;  4LK1 F;  3AL0 C;  2R7D A;  3J81 Z;  1IV8 A;  5LBQ A;  1V5F A;  1ZEL A;  5HOO A;  1JKO C;  2CUJ A;  4E7J A;  4A6D A;  3VFZ A;  4RB3 C;  1JXS A;  2DI3 A;  1Z6R A;  9ANT A;  2MW8 A;  2QKL B;  3CCS I;  1LE8 B;  5KAI C;  4GGG A;  3WOD F;  3ESW B;  3Q5F A;  3BY6 A;  1Q1V A;  4NDL A;  2VJI A;  2Y0M A;  2ZB9 A;  4BHC A;  1LPQ A;  2Y2Z A;  2ME0 A;  4F92 B;  2QA4 I;  1LVA A;  5LLQ A;  4UVA A;  2EV6 A;  2O03 A;  1B1B A;  4E6K G;  4M72 A;  4HAM A;  5FRM A;  2HR3 A;  3HKZ A;  4XN0 A;  3QOE A;  4J01 A;  1K6O A;  4HV6 A;  1J2X A;  3GCM A;  4UUT A;  2QBY B;  3HJE A;  4V2G A;  2PJR B;  2JSP A;  2NNN A;  3NEU A;  1U3E M;  4A12 A;  1FZP B;  2EZH A;  1Y8R B;  2D45 A;  3I3L A;  1K4S A;  3C2G A;  2XUB A;  3O2P E;  4UVB A;  2ME6 A;  3H3V K;  3W3C A;  5FLX K;  3K2A A;  4MQ9 F;  1VF9 A;  3M1C A;  2EH3 A;  2HKX A;  3E5X A;  5B3S H;  1SVM A;  3WTV C;  4BEH A;  3E97 A;  4L0Z B;  4BJT A;  3P5J A;  2QSG X;  1QVU A;  3PSI A;  3GZ6 A;  3RQI A;  1D5Y A;  2H94 A;  2EA4 A;  2FMY A;  4HV5 A;  4DYC A;  2DT7 B;  1ZGW A;  4XK4 A;  4GYG A;  4D1Q A;  4L9J A;  3K9T A;  4EEF G;  2OQG A;  2DO7 A;  3EUH C;  3HSR A;  3OYD A;  2PLY A;  2FXA A;  3SZG A;  4CHU A;  5IP7 J;  1X1P A;  2IS1 A;  4MO7 A;  3A03 A;  3K4K A;  5FLM J;  3L2C A;  2XAQ A;  3QYB A;  1ETW A;  2L7Z A;  4A3C J;  4KIC A;  4LK0 F;  3G3Z A;  4G9Y A;  2VLA A;  1T95 A;  2Z16 A;  3C18 A;  2BGC A;  4IQ4 A;  2COM A;  3K1P A;  2UZK A;  2JVH A;  2VJJ A;  3HBL A;  2ELJ A;  3IKV A;  4EJW A;  5J4Y A;  1ZRF A;  1K78 B;  3HOV J;  1Z3Y A;  1I3Q J;  1HQC A;  3M1E A;  3KLN A;  3HHG A;  2DA6 A;  2PMH A;  1YRN A;  1D0X A;  3OS1 A;  1V3F A;  4G8X A;  2VJ4 A;  2E1M B;  1U6G A;  3C2H A;  1WRJ A;  5F04 A;  2HYF A;  2W82 A;  1FOW A;  2CFX A;  4L9N A;  2KT0 A;  2BE5 F;  4JX5 A;  3V8K A;  3OYJ A;  1YIJ I;  1JUM A;  1KU2 A;  1Z6T A;  2DU9 A;  2XRN A;  3DQV C;  3FXR A;  1I1S A;  2JN6 A;  3G2B A;  2MBF A;  3OIQ A;  1BIA A;  4CO8 A;  1FPQ A;  2E7X A;  3CJQ B;  5DYM A;  3LST A;  2VBW A;  2P8T A;  1D1A A;  2WC2 A;  3VYU B;  2GXG A;  2TRT A;  3CLQ A;  1MNM C;  2H8R A;  2FX0 A;  1NG7 A;  3ZGK A;  1U9O A;  3G1M A;  4EJT A;  1K83 J;  1JTY A;  1KQ9 A;  1SFX A;  5ED4 A;  3AG3 H;  2NVQ J;  3LOC A;  2VQH A;  3BRO A;  4EGY A;  5H6R A;  1I6X A;  3TBI A;  1SFO J;  4XLP F;  3I4P A;  1DUX C;  1TL8 A;  1OCP A;  3PNV A;  2Z5U A;  2KIS A;  5E18 F;  1TWC J;  2ZBK A;  5F0H A;  3K70 D;  2JWT A;  1T2K A;  3DP7 A;  3QP6 A;  2ID3 A;  2ID6 A;  3JRE A;  3H35 A;  3PUF A;  1O57 A;  1CQT A;  1S7O A;  4HF2 A;  1YW7 A;  4AM3 A;  3FXO A;  5HLI A;  3MZY A;  4KYW A;  2LDU A;  2YS9 A;  3CC4 I;  1TZL A;  2XRO A;  3L2R A;  1B8I B;  3P9I A;  2VOO A;  4BHP A;  4N0B A;  4JOM A;  3RKX A;  3RIR A;  4BU2 A;  3CDL A;  2QQ8 A;  1T0F A;  5HS8 A;  5J1Y A;  2QQ9 A;  2XPW A;  4NQW B;  4D7N A;  4EM0 B;  3QPH A;  2FOK A;  2ZKZ A;  2QWW A;  4LG0 A;  1KZH A;  1SFE A;  2BZT A;  4P9F A;  4F55 A;  3KYC B;  4G7Z F;  3DXJ F;  1JHF A;  1P4X A;  1FYL A;  1YS6 A;  1R5I D;  5FLX Z;  3CDI A;  3CUQ C;  3MN2 A;  2R7Q A;  2E60 A;  3OV8 A;  3S1N J;  2TDX A;  1SAU A;  5GTI C;  1U2W A;  2EFP A;  2L7K A;  2DJI A;  5FO5 A;  2D1H A;  3OYK A;  2I5U A;  5DM6 F;  3F72 A;  3S2W A;  3OOU A;  1XSX A;  3PFY A;  1UJ8 A;  2DFE A;  3F0C A;  2HNH A;  1SC7 A;  5HOD A;  2MAB A;  3UKG A;  4PK4 A;  5GAD J;  1HCR A;  5CPR B;  2UV1 A;  5LGN A;  2F5C A;  4AU7 A;  4ENK A;  3BP8 A;  1GHC A;  2LG4 A;  3TO6 A;  3EUK L;  2YSR A;  1R36 A;  3EDP A;  5E3O A;  1JUP A;  4XLE A;  2F2E A;  3W2W A;  4QSH A;  2HI3 A;  3LSH A;  5JLX A;  2R93 J;  3ABL H;  3HGG A;  2L2O A;  1ZKG A;  4BE1 A;  3FF5 A;  2LOO A;  4ANJ A;  2FNA A;  3GTL J;  2HZT A;  4XOT A;  4MIM A;  4G7H F;  1IRZ A;  3OR1 C;  2R7W A;  3JRC A;  4R1H A;  2JJ7 A;  2PMU A;  1S29 A;  2LTP A;  4XID A;  2FA5 A;  2L7F P;  3WG7 H;  5F08 A;  2KL4 A;  3KFW X;  3DEW A;  3R4K A;  3O3K A;  1S9H A;  2L9R A;  2CQX A;  1BC8 C;  2AQE A;  1ZRE A;  2MH2 A;  1VQ5 I;  3BR3 A;  2Y31 A;  1F1Z A;  2DFF A;  3RQ4 A;  4KN4 X;  4A93 J;  4IO9 F;  1JGS A;  4HYE A;  1FSE A;  2K3P A;  3JRD A;  2BV6 A;  1O3S A;  5KK1 A;  2VIX A;  3HRS A;  5FKO A;  1SVL A;  4ZDP A;  3WU0 A;  1MH3 A;  3DPT A;  3RKQ A;  3ROU A;  3CF5 F;  4UV9 A;  1KU7 A;  4XRS G;  4LMY A;  1S6L A;  1U8R A;  4EMS A;  1DP3 A;  4RA2 A;  1MBE A;  1FP1 D;  1PUF A;  3H9J A;  5TIS C;  1FOX A;  3PIP F;  3BJ6 A;  4XLN F;  3L2Q A;  3M8F A;  3KYD B;  2A6T A;  4ZH4 F;  2GZW A;  5ERI A;  2K40 A;  1IO2 A;  3LSI A;  3CCQ I;  3ABM H;  3K4B A;  3CZ6 A;  2CUF A;  2WV0 A;  1FP2 A;  1FX7 A;  1LEB A;  1RKW A;  1P9Q C;  2Z3Y A;  1Z7U A;  3IWF A;  3S3N A;  1XSD A;  1TP4 A;  2XDV A;  4U7D A;  4WWC A;  3JRH A;  4DYQ A;  3VDX A;  1O4X A;  1PJR A;  5JVG F;  1LDD A;  2MC4 A;  3QYE A;  5E1X A;  3L7W A;  1N25 A;  3GX4 X;  2OTJ I;  3DTE A;  5J3L A;  5FB2 A;  2QUF A;  5ICE A;  5E3M A;  1QHG A;  3ERE D;  2MG4 A;  3F6V A;  1X1B A;  2FU4 A;  3OSG A;  2OJE D;  2XB0 X;  3H9G A;  1ZLK A;  4XSX F;  5K5Q A;  2HOA A;  2OU2 A;  4Y3O A;  3CCM I;  2GA2 A;  5J40 A;  1ZRC A;  3HPG A;  2ZSH B;  3SEZ A;  4RB2 C;  3M07 A;  1AWC A;  4WF2 A;  2O8K A;  2VT3 A;  4Y17 A;  1XMK A;  3B73 A;  1F36 A;  1I6H J;  3S32 A;  2H6C A;  4V19 K;  1R4M B;  2X85 A;  2DOD A;  4Y7N J;  3T0Y A;  1ETV A;  2ZSI B;  3KP6 A;  5DV5 A;  2E1M C;  2E35 A;  5BPD A;  4HBL A;  5LD2 C;  1GUU A;  2HQA A;  1R6R A;  4C2M J;  1WH5 A;  2X6X A;  3WTX C;  4LOC A;  5F6F A;  2Q8K A;  1HDD C;  3WHC A;  3CO7 C;  4M3G A;  1ZH5 A;  3NWT A;  2DK8 A;  1XS9 A;  1IXC A;  2W4S A;  1FSH A;  5LRR A;  4I09 A;  4BHB A;  1ZGJ A;  1YQA A;  3BCA A;  2L9V A;  2ZJR F;  2EIM H;  1D5V A;  4RB1 A;  4L5I A;  1OCR H;  5BQT A;  2CUE A;  1G3T A;  1W5T A;  1B72 A;  1EH7 A;  5IYB J;  2O6G E;  4L0Y B;  4WCG A;  1LVK A;  4OIR F;  1YI2 I;  1IRX A;  4HDV A;  5K5O A;  3TW7 A;  2P5L C;  2XV4 S;  3TP3 A;  2NXN B;  3RI4 A;  1E17 A;  5CYV A;  5D4R A;  2IAI A;  2Z2S B;  5DUI A;  5BS6 A;  1G8X A;  2STT A;  2LKS A;  3M8J A;  3S93 A;  4HX4 A;  2M4K A;  1SMT A;  1IUF A;  3LL7 A;  2CV1 A;  2IP2 A;  2HVQ A;  2W00 A;  4FAS D;  4NBQ A;  2F48 A;  2LBF B;  4CSW A;  3WHB A;  2STW A;  3FXJ A;  1IXR C;  1TTY A;  4FE4 A;  4BQA A;  2A69 F;  4IRI A;  3CJN A;  1Z77 A;  3QPS A;  2PFB A;  3AG4 H;  4XRS A;  4LLG F;  1Z05 A;  3H3Z A;  5EEG A;  1BOA A;  1TT5 B;  2K9N A;  3WTT C;  2LVS A;  1YS7 A;  3KP5 A;  2LNB A;  5FD5 A;  3HRT A;  4ZDO A;  1BR1 A;  4HNU A;  4XSZ F;  4A3I J;  2XF5 A;  2FF4 A;  1IXS B;  3KPH A;  3DEU A;  5H20 A;  2CQQ A;  1FBS A;  1UHW A;  1XDS A;  2PQ8 A;  3SEQ A;  3O6B B;  1T8I A;  5GPA A;  4A0X A;  2XAF A;  2YU3 A;  2IS4 A;  2BW3 A;  5CVV A;  3RYR A;  3OYI A;  1SD7 A;  2A5Y B;  2KDO A;  4FCY A;  1DDN A;  2GBY A;  3GME A;  1BI3 A;  3H5R A;  4W97 A;  2OA4 A;  3QOD A;  1YX3 A;  1LFP A;  5HVQ C;  1RUN A;  1P7J A;  3DCF A;  2CO5 A;  1ETQ A;  3ABK H;  1WJC A;  2AO9 A;  1J5Y A;  2K9M A;  4G94 A;  4BQQ A;  3WTZ A;  3IRR A;  5M3M J;  3FWE A;  3QYF A;  1FYM A;  3TKY A;  3M3Y J;  3G6E I;  2JA5 J;  1Y1W J;  4J00 A;  3OL4 A;  3GFL A;  4XKC A;  4H0E A;  2DFH A;  1ZG5 A;  2XSJ C;  1O3R A;  3OSF A;  1DGR M;  2OCE A;  4PJJ A;  4X1E A;  1YX5 A;  2AXL A;  2DCE A;  1XCB A;  1KQ8 A;  5F0C A;  5M3F J;  3GEZ A;  4UHT A;  1IZ1 A;  1IRF A;  2HZD A;  2E1O A;  1K6Y A;  1TQI A;  3ZXS A;  4YFN F;  5B5E C;  2FQ4 A;  1MSE C;  2WA0 A;  2FNP A;  3RKW A;  2VKE A;  3W6K B;  3ZCO A;  3VYT B;  4IOC F;  3ZQF A;  4AYB N;  2R7X A;  1U5T A;  3TOB A;  2H1L A;  2BXY A;  3FXQ A;  2M8E A;  1ERD A;  3KX2 A;  3FM3 A;  3K4M A;  1KQ0 A;  1H89 C;  2VBX A;  1NHA A;  4LB6 B;  4A5N A;  1VTN C;  4GFB A;  4UV8 A;  1O7L A;  3K1N A;  3GZ5 A;  4TV7 A;  3QQA A;  5HS7 A;  2A6E F;  3BZC A;  3MAJ A;  3CJR B;  4C2U A;  2K02 A;  3S16 J;  3H0D A;  1X3U A;  2HVR A;  3MEX A;  1HOM A;  1ZQ3 P;  2XVC A;  2CRG A;  3KEQ A;  5DEQ A;  5D4S A;  3KZY A;  3A01 A;  4IHS A;  4QPO A;  1OYI A;  3RZD J;  1VQL I;  1RET A;  2CQN A;  3ECH A;  1W36 C;  3W2A A;  1GT0 C;  3EYY A;  1XGM A;  2HQN A;  3V8J A;  3CUO A;  2XAH A;  2F5F A;  3C3W A;  5DCF A;  4K2E A;  4E7H A;  1A6Q A;  2F6C A;  1R23 A;  5H6Q A;  2VQG A;  1TQM A;  5CVU A;  2ZNZ A;  2XRL A;  4PGH A;  5E79 C;  3T5X A;  3HDD A;  5DD8 A;  1GVJ A;  2LMD A;  3HKZ N;  1O3Q A;  2NVT J;  2OD5 A;  3ULQ B;  3FHZ A;  3PM1 A;  2JK3 A;  4MQV A;  3VSL A;  3KEY A;  1MJ9 A;  3T8T A;  4ZZL A;  1IDZ A;  5J4V A;  3DU6 A;  1J59 A;  1X1D A;  5F0F A;  5CQG A;  2FBH A;  2VE9 A;  2VB6 A;  4DW6 A;  2JQ7 A;  1FY7 A;  2JUC A;  4KT5 C;  4II2 A;  2UWM A;  5GAG J;  2JPB A;  2RV8 A;  4J19 A;  1C0W A;  1A36 A;  2DOF A;  1MIJ A;  1BW5 A;  2V1N A;  2LY9 A;  3S3M A;  1I3A A;  2RGV A;  2W48 A;  1I5Z A;  2CW0 F;  2BY1 A;  1ZGA A;  3BG3 A;  5K7F A;  4CYD A;  1BW6 A;  1R22 A;  2LK2 A;  4YFK F;  2EIN H;  3S17 J;  4UB6 C;  4XQF A;  5GP9 A;  5EDN A;  4O3M A;  3ABU A;  1W7P A;  3LFU A;  1HW2 A;  4FQG A;  1REP C;  3U2R A;  1BR4 A;  2BYV E;  1J9I A;  5HLH A;  4YEL A;  4BY7 J;  3LA3 A;  1H0M A;  1YRN B;  3BTC A;  3CLO A;  3H1C A;  1A04 A;  4ENJ A;  2O9L A;  2P7C B;  2HWV A;  1XSV A;  3EUH A;  1T33 A;  1IN4 A;  3K1M A;  3J7A Y;  1RI7 A;  2NAZ A;  2DA3 A;  2CQK A;  3D0S A;  2A5W A;  3FM5 A;  3RKY A;  2L0K A;  3GTP J;  2HQ5 A;  1MDM A;  2HOT A;  2KIU A;  2IS2 A;  1ON1 A;  3V7S A;  2IEK A;  1Y56 A;  5KVR A;  3JRF A;  5IPA A;  2VXZ A;  5E1W A;  1OJL A;  2NNY A;  1PP8 F;  1MBF A;  3X2Q H;  1DGW Y;  3D5R C;  3HYI A;  4I01 A;  4LLN A;  5L3F A;  1LNW A;  2JT1 A;  3OIO A;  3V42 A;  2GXB A;  1QVT A;  3T8R A;  5JLW A;  2M9H A;  1MBK A;  5EG0 A;  1MBH A;  2EQR A;  4IHX A;  4Y52 J;  5IYD J;  1W7P D;  2XGC A;  3JTG A;  2V1X A;  5HDG A;  1R1V A;  2I8D A;  2IGM A;  2Z33 A;  2DAO A;  4I2O A;  1VQO I;  1ZR2 A;  1R4N B;  2OV7 A;  4HST A;  3F22 A;  4Q47 A;  4L18 B;  1FC3 A;  1J0R A;  4IEJ A;  4G7O F;  2JA7 J;  3IC7 A;  3Q9S A;  5DS9 A;  2V4J C;  2KJC A;  3U1K A;  4KT6 A;  3BPV A;  2K5C A;  3FBI B;  3KE2 A;  4NC6 A;  4N9I A;  4RAZ A;  2QGU A;  3FDY A;  1ZG1 A;  1ZRD A;  4M71 A;  3GUD A;  5IT9 K;  3HOU J;  1YOV B;  2AS5 F;  2FD5 A;  2DT6 A;  2ELH A;  3JSP A;  3H3U A;  1V5E A;  2PG4 A;  2R5Z A;  3SYT A;  3K4L A;  2XKO A;  2EBI A;  4S0H B;  1WZ2 A;  4F91 B;  2R7Z J;  4A3B J;  5J8F A;  1SD4 A;  1HF0 A;  2FJ1 A;  2QKM B;  5D5V B;  3WTU C;  2EFQ A;  2QQA A;  3C2B A;  4LG0 B;  3HOZ J;  1D3Y A;  1ENH A;  2L54 A;  4LFU A;  2ZXI A;  4A5M A;  2LFB A;  3VPR A;  3ZMT A;  2W1O A;  4ZTF A;  1A6I A;  1APL C;  4B48 A;  3E5U A;  2P5K A;  3ZQQ A;  4PCQ A;  5LGU A;  3JRB A;  3R61 A;  4LLL A;  4EJV A;  4EAT A;  2E5N A;  4XL9 A;  2XAS A;  3WE3 A;  3BZ6 A;  2V6C A;  2FSW A;  5D6E A;  1GXQ A;  2LKX A;  2XAJ A;  2WAQ N;  2F4M B;  1BN5 A;  3IH4 A;  2QF7 A;  2MSY A;  5E8G A;  3GLL A;  1K4T A;  1S3J A;  2VPR A;  1BC7 C;  2ZJQ F;  4I7H A;  2Q0O A;  2DLL A;  2CV0 A;  4PJN A;  1HDP A;  2JUG A;  1K7A A;  5C3E J;  2HVS A;  3JR9 A;  3TMO A;  1A5J A;  1OR7 C;  1Z21 A;  2KIM A;  4U88 A;  1B9N A;  3A0B C;  3OYE A;  1GLN A;  4OAY A;  3A2K A;  5DTD A;  4M3D A;  3CUQ A;  2P5V A;  3OYA A;  3OYM A;  2B9S A;  2OBP A;  1MSF C;  4OIQ F;  3KYL A;  1HBX G;  5E1Z B;  1LQ1 A;  1VI0 A;  2GM4 A;  2KFD A;  4EQQ A;  1ACI A;  1LJ9 A;  1R5H A;  1QA6 A;  1TWF J;  5EYR A;  2K9S A;  1R9T J;  2P4W A;  1IGN A;  2HDC A;  2P7V B;  2LYC A;  2DPD A;  4RM2 A;  4KNY A;  1TNT A;  2OPT A;  3FK7 A;  3BC8 A;  3E3V A;  2ESH A;  1YIO A;  2B0L A;  3BOQ A;  2FUG 2;  3FX3 A;  1R71 A;  4GRI A;  1HKS A;  2BY2 A;  1PUE E;  4IPA A;  2VAS A;  5J1U A;  1KA8 A;  1AOY A;  3L2U A;  2VPL A;  1FT9 A;  4ESF A;  4BDZ A;  1YLF A;  4XLC A;  4BXF A;  2ZME C;  4ENM A;  4A3F J;  1OPC A;  4IQJ A;  2P6T A;  4BXU A;  3GLX A;  1GV5 A;  2DMT A;  4C9Y A;  4I98 B;  3LA2 A;  1V4R A;  3SZT A;  4EM2 A;  4FX4 A;  3HOW J;  5GPC A;  1YFH A;  3EPZ A;  4XIC A;  1LE8 A;  2X6O A;  1IDY A;  3TDZ C;  3GFJ A;  1OQY A;  2V9K A;  4BUP A;  5EGO A;  3P7N A;  3F8B A;  3IUO A;  2MLK A;  4G6Q A;  2GAU A;  4XM3 A;  3IWZ A;  3HB9 A;  3DBR B;  2KRC A;  2HTS A;  4A3L J;  3GTJ J;  3LSK A;  5EJC A;  2E2J J;  3PUB A;  5DCM A;  3CQZ J;  1ETX A;  4M9S A;  3MKY B;  2NOJ B;  3E6M A;  3F8C A;  4ETS A;  2UXX A;  1FYK A;  4HW0 A;  4HEA 2;  4PDK A;  1OCO H;  5TJJ A;  5C4J J;  3L9F A;  3WTY C;  3OS2 A;  3QRF F;  3BT9 A;  3K10 A;  5B1B H;  5IT9 Z;  1LFU P;  3PO2 J;  3FBN B;  3I4M J;  2ZCW A;  2Y9Z A;  2WAQ A;  3SFZ A;  1QRY A;  1RR7 A;  3KEO A;  4D7M A;  3C1D A;  3GZN B;  1IW7 F;  2W85 A;  2Y0S A;  3F8M A;  3OOP A;  4ZYG A;  2RVC A;  3P9K A;  4UXN A;  5JVT A;  3FHN A;  1HXD A;  2G9W A;  1ZTR A;  1Y0N A;  5F27 A;  5LEJ A;  2BXZ A;  1XC5 A;  2NS8 A;  1XN7 A;  4MLO A;  4MTE A;  2M5W A;  4YEJ A;  3J7A O;  1DQU A;  5ILS A;  2LP0 A;  1Y6I A;  2Y9Y A;  5L3C A;  2MA3 A;  4AIK A;  2IA2 A;  1HW1 A;  3CCV I;  1MJB A;  3S1R J;  2RQP A;  2KQR A;  1GV2 A;  5H2F C;  1IRG A;  4A3M J;  1F4K A;  4A0Y A;  4RLQ A;  1JE8 A;  2R92 J;  2D1V A;  1XPX A;  1OCT C;  4XKW A;  3CD6 I;  3GVA A;  1N77 A;  4B09 A;  4BGD A;  2ZJP F;  3GFM A;  2EV0 A;  4F3Q A;  4FE7 A;  4NUB A;  1G3W A;  3KP7 A;  2HPM A;  3V7R A;  3DF8 A;  4HLY A;  1MBJ A;  2L01 A;  5DM7 F;  1H88 C;  2ACJ A;  3I0T A;  2QSH X;  1X1C A;  5AIQ A;  1B72 B;  1FOY A;  2ELK A;  2EZK A;  3FKJ A;  1Q1H A;  2PEX A;  3BWG A;  1IUY A;  3CDH A;  1LEA A;  1RPW A;  1ZYR F;  3GFI A;  2X1D A;  1L3L A;  3HL2 A;  1LUJ B;  1WJB A;  2R7V A;  2FQ3 A;  4XRF A;  1YE9 A;  3L2W A;  3JAM K;  2QEN A;  1RC9 A;  2CQ7 A;  4IL6 C;  2H27 A;  4UNO A;  2HDW A;  2Z1D A;  2CV2 A;  5JHU A;  4C3H J;  1UHM A;  3CCY A;  3QPL A;  4UUS A;  5HDN A;  2HEO A;  3OMY A;  1QPM A;  1M1E B;  4I0A A;  2FOW A;  4XKB A;  2KZV A;  1FTT A;  2KRH A;  3K2Z A;  5M5X J;  3MKL A;  4L9T A;  3Q9V A;  4LG3 A;  3W6J B;  2NVY J;  4MFD A;  1MKM A;  4BYY A;  3NAU A;  1AKH A;  4A6E A;  3VEP A;  2EA2 A;  5IT3 A;  4IHY A;  5HNF A;  2X1C A;  2EFW A;  1ZAR A;  1JJ8 C;  3HZJ A;  3HRU A;  2EZL A;  4E7I A;  4I0B A;  2RRE A;  1E3H A;  5JHF A;  5HS9 A;  3V8L A;  2XF7 A;  3ZOB A;  1HLV A;  4UY8 I;  1KU3 A;  2HXO A;  4OIP F;  3GTG J;  2BW3 B;  1HKQ A;  4PGG A;  3LFK A;  3LSG A;  1S7E A;  1MJA A;  5FKL A;  3KCC A;  1KYW A;  2GA1 A;  2ESN A;  2W7N A;  3MZH A;  3GXO A;  1BJA A;  5J6X A;  4DGW B;  1RRJ A;  4HA8 A;  4I76 A;  1J7K A;  2YUS A;  4IHV A;  1Y39 A;  2ETH A;  4A3G J;  4E7K A;  3HTS B;  4YIR X;  2X4H A;  1FLI A;  4XN3 A;  3Q0V A;  1RR8 C;  2K7L A;  3CC7 I;  1WJE A;  1OFC X;  2K3F A;  2XPV A;  4JBA A;  2M4G A;  2L4A A;  1YJN I;  4IVN A;  2DBB A;  4CUG A;  3J7Z I;  4HNV A;  1J09 A;  4E7L A;  2RNJ A;  2P81 A;  5ILU A;  3OYB A;  2CFO A;  4BJ5 C;  2CMP A;  4F7Z A;  2FBK A;  3PO3 J;  3WU1 B;  4Y33 A;  2R0Q C;  2DN0 A;  1Z1D A;  1PDN C;  4RLF A;  2ZXW H;  3LSR A;  1WI9 A;  2DA5 A;  2PX9 A;  3M8E A;  2M7A A;  4KN7 X;  3BR6 A;  3MCZ A;  4QLC U;  4HX7 A;  4XON A;  2R7O A;  3HEF A;  4PFO A;  4B3A A;  4HDU A;  4IJA A;  4II3 A;  1VQN I;  3R0A A;  1HW5 A;  4MEX F;  1MMD A;  3CES A;  1YIT I;  3IL2 A;  1VQ6 I;  2L9N A;  4G6D A;  3A01 B;  4N4O B;  2KZG A;  3CCR I;  4YRV A;  3WTS C;  3DPU A;  4CYC A;  3MD2 A;  1T56 A;  5DD4 A;  2W84 A;  3JTH A;  1XD7 A;  5D8L B;  5ICG A;  2DXI A;  2IT0 A;  4IOA F;  2MC3 A;  2CYY A;  4ZTJ A;  3CO6 C;  5BNG A;  2JVG A;  2JA2 A;  3L00 A;  1VFC A;  3JW4 A;  2KJB A;  4S05 A;  1RNL A;  3AG2 H;  4AC0 A;  1GXP A;  2DA7 A;  4YFX F;  2L4M A;  3F21 A;  2LSO A;  5K7Z A;  1R1T A;  2K9Q A;  3BG7 A;  4MNU A;  3IHU A;  3NAR A;  2HDD A;  3GTO J;  2XC7 A;  1W5S A;  3A02 A;  4ASN A;  4CXF A;  5CLS A;  1G59 A;  3RCO A;  1WVR A;  1ITY A;  3JAM Z;  2XB5 A;  2R5Y A;  1YJW I;  1UFM A;  3S2D J;  3IAS 2;  1UMQ A;  4E7Z A;  4RGU A;  3E5Q A;  3I54 A;  4M3F A;  4GXO A;  5LFA A;  5E17 F;  1LDK B;  4EM1 A;  5J8C A;  2IA1 A;  4YIF A;  2NVX J;  2E2H J;  1ETO A;  2HU9 A;  4NB5 A;  4QIW N;  1VQ8 I;  4XOP A;  2IRF G;  3LSJ A;  2GOM A;  3S2H J;  4BBS J;  3J7Y J;  3TO7 A;  3K4C A;  1STZ A;  3VB2 A;  2K4J A;  3R6S A;  2NVU B;  2OC6 A;  4B47 A;  4M6Y A;  1B4A A;  2A07 F;  2IGN A;  1F9N A;  1IC8 A;  4MFE A;  1JHH A;  4OOI A;  3F9K A;  3D1N I;  1TLH B;  3LAJ A;  1XMA A;  1TW3 A;  4C3I J;  3JCU C;  4RAF A;  4D5C A;  4HLX A;  3LMM A;  1R5G A;  4PJ0 C;  1PVE A;  2COB A;  2H09 A;  2PBI A;  1P4W A;  1K79 A;  3RZO J;  3BCB A;  3K4J A;  3L2V A;  1OKR A;  3ZQH A;  1T38 A;  2CGP A;  5HLT A;  2V9V A;  3ZP5 A;  3EQL F;  4PSX A;  3L09 A;  3T1B A;  1I50 J;  1D8K A;  4Z6Y A;  4BNC A;  3H5A A;  1XCV A;  4RGS A;  2L5Q A;  3I59 A;  5AIP A;  3ZQI A;  1W36 D;  1XGO A;  1WKM A;  1UB9 A;  5GTH C;  1FOK A;  2QSF X;  3SXY A;  3VOD A;  1FIA A;  4QWQ A;  2HS5 A;  1ZR4 A;  2M3A A;  1FMW A;  1X1A A;  4R79 A;  2I10 A;  1ZHF A;  1T39 A;  4ZYH A;  3G4S I;  1QBJ A;  4RAY A;  4A0Z A;  2VI6 A;  1QU3 A;  5IY5 H;  3FIW A;  4XLA A;  5D5W B;  2KRF A;  5FRO A;  3OS0 A;  4Q5S F;  2WBM A;  4D0P A;  5JI6 A;  3F6O A;  2BY3 A;  5D6F A;  3WE2 A;  3DTI A;  5HDK A;  5EG0 B;  1TC3 C;  3LQR A;  4M74 A;  2KIQ A;  3TGN A;  2DW4 A;  1G3Y A;  2JPC A;  1J75 A;  5ILV A;  2XPU A;  3GWZ A;  2F4I A;  4YII A;  2R7U A;  2K9L A;  2F5D A;  2M7B A;  1ETK A;  2QQB A;  3CP8 A;  2DDA A;  3BR1 A;  5FKN A;  5F1J A;  4B8X A;  2DT5 A;  4Q48 A;  3DWL E;  3MKZ A;  3PJR A;  4JX6 A;  2NS7 A;  2DMN A;  4C3J J;  1IN6 A;  2UXN A;  4LD5 A;  4U7B A;  4LB5 A;  2PN6 A;  3QPT A;  4OMZ A;  1WFX A;  2X1E A;  3BQZ A;  5CVI A;  3GO5 A;  4A3J J;  2BBY A;  3BJA A;  4DBR A;  1P6R A;  2QM3 A;  3M9A A;  3R60 A;  3EYI A;  4BEH B;  2M8G X;  5EEH A;  3N05 A;  2R5Z B;  2DMU A;  2Z99 A;  1OYW A;  3QOP A;  1E2X A;  1Z7L A;  4HF1 A;  1MMN A;  1WH7 A;  3QWL A;  3QAH A;  2XIG A;  1WHU A;  2JMW A;  1ULY A;  5GAE J;  1O7F A;  2GWR A;  4Y13 A;  1RZ4 A;  5FKM A;  1MW7 A;  3H36 A;  4GCV A;  4F52 A;  1XB4 A;  2LH9 A;  3HOX J;  3FXU A;  4C2T A;  3FMR A;  4KIT B;  2O8X A;  2OAZ A;  2DA2 A;  1XMX A;  2GIV A;  3HXL A;  3IV5 A;  2E1N A;  4KIG A;  3FK6 A;  2HQR A;  4DIQ A;  4B3X A;  3I71 A;  3GF2 A;  2ZXH A;  2E7W A;  3F3X A;  2VJ5 A;  3SQN A;  2QEX I;  5IP6 A;  1Z0X A;  1IF1 A;  3GYH X;  2EJR A;  3A1Y A;  1SD6 A;  3FIS A;  5E3L A;  3RDI A;  2E34 A;  2HXI A;  3JRA A;  4H4K C;  1QHH D;  1MMG A;  2RKH A;  2KDZ A;  2H1K A;  2O61 A;  2K27 A;  4YG2 F;  5A2Q K;  1VQK I;  2ZNY A;  3E6B A;  2M2E A;  4M3E A;  1P7I A;  2DOA A;  3FMQ A;  2D5V A;  2DK5 A;  2ADU A;  5CVJ A;  5KCM A;  2FE3 A;  1D1C A;  4B44 A;  2X9D A;  3CUQ B;  3E6D A;  4MTD A;  3ZMS A;  4BS9 A;  2L9S A;  4DBQ A;  2MYS A;  3Q0W A;  3NWS A;  1IV6 A;  5DDG A;  3I55 I;  2F4O B;  2YPR A;  3QU3 A;  1UG0 A;  3V7C A;  3H9Q A;  2V7F A;  3I53 A;  4XOR A;  1OLT A;  3QU6 A;  2VC1 A;  2NS0 A;  2XAG A;  4CCJ A;  4PFP A;  4P55 A;  4MHG A;  1TW2 A;  2WY7 Q;  1OCC H;  1HSJ A;  2O7O A;  4G6T B;  4KIS A;  4I02 A;  1U9N A;  1R1U A;  4XNF A;  4NNJ A;  5FD6 A;  3EUA A;  4X6A J;  1Z67 A;  1QZY A;  4LIV A;  3DPL C;  1DP7 P;  1OR7 A;  2R7F A;  3DLA A;  4IF4 A;  5FLV A;  2X0L A;  1E3P A;  1U78 A;  4XLH A;  4U0Y A;  2RQQ A;  2GOX B;  4OAZ A;  1A31 A;  4KUM A;  1JGG A;  3HPH A;  4DNC A;  4U87 A;  2DPU A;  3VWB A;  2KLO A;  5C4X J;  3HG9 A;  2EFN A;  3LQQ A;  1SVO A;  4JQF A;  4HQM A;  1RKT A;  1TQP A;  4FET A;  5E8I A;  2B7E A;  2PI0 A;  3ERM A;  1OMI A;  5EGO B;  4OIO F;  2YU9 J;  1JKR C;  1CF7 A;  2ICW G;  5FJ8 J;  4LGW A;  1MGT A;  1R58 A;  4JP0 A;  2E36 A;  3OYN A;  3W6V A;  1G3S A;  4ZYD A;  3LAP A;  5KNL A;  5DCM B;  1VND A;  4Y4R A;  2LLK A;  3DFG A;  4OU0 A;  3FXL A;  3CMA I;  2HKO A;  4CCN A;  3S1Q J;  3IKT A;  4S04 A;  1MNE A;  2OCC H;  2ZME A;  4M73 A;  4Z2Y A;  2VN2 A;  4BBR J;  4HQE A;  3CC2 I;  2EB7 A;  5FGM A;  4BDY A;  2CH0 A;  1YW8 A;  3GTK J;  5F1R A;  2RC4 A;  1I1G A;  4AVP A;  4ZC3 A;  1BI1 A;  2M1B A;  2YR2 A;  5K5R A;  5L3E A;  4KFC A;  1TBX A;  3ZN0 A;  3BPX A;  4CZC A;  1ORK A;  1W4M A;  1T98 A;  2EWN A;  4P5O A;  2TCT A;  4XRM A;  3OIP A;  3Q3S A;  5L3G A;  3WU2 C;  3OYF A;  1Z9C A;  3NRV A;  3ZN1 A;  1K61 A;  3REO A;  2A68 F;  2XGD A;  3IAM 2;  4ITV A;  2Y0S N;  3TOA A;  2Q2E A;  1JJ6 C;  3KET A;  3SDG A;  2O5R A;  1WGX A;  3DBH B;  2CSO A;  2CJJ A;  2KMU A;  3RJP A;  1Y8Q B;  2K86 A;  3AFH A;  2DQR A;  2IPQ X;  1S7A A;  3IH2 A;  1P2F A;  1V55 H;  3CMY A;  1H8A C;  5BMZ A;  1EV7 A;  4PJL A;  4U0W A;  3BDD A;  3CTA A;  1Z91 A;  4Y15 A;  5D8K B;  2QCO A;  4B43 A;  1X2M A;  3SFI A;  5EZG A;  3KZI C;  2EIJ H;  2J5P A;  4EGZ A;  2DTR A;  1YTY A;  3O8H A;  1L0O C;  1SD5 A;  2CG4 A;  2VBY A;  4OMY A;  2R4G A;  1QQI A;  3KZZ A;  3CCL I;  1TWG J;  5A2Q Z;  2VKH A;  1IG7 A;  5IOZ A;  3E1S A;  5B1A H;  3BR0 A;  3S8P A;  1SMY F;  4GDF A;  4C30 A;  3ZMV A;  1WPK A;  3VOE A;  1AHD P;  4DQ2 A;  5EF6 A;  2NRA C;  1FEX A;  4LJZ F;  2F5E A;  2ISY A;  4DYR A;  1IAW A;  3HUG A;  1TNS A;  3TQN A;  1N75 A;  2VQC A;  2M87 A;  3DTK A;  1MZB A;  2HPI A;  4CA0 A;  1MD0 A;  3PSF A;  4UUS B;  3B02 A;  2VC0 A;  4CZZ A;  2Z9O A;  1FBQ A;  3H5N A;  4RGR A;  4RDU A;  2MGQ A;  2LKP A;  1EH6 A;  2HGC A;  1VQ9 I;  2XAU A;  3I64 A;  3BG9 A;  4RAG A;  5ICF A;  2V6E A;  1PUF B;  1QZE A;  2PJP A;  1UST A;  1KYZ A;  4IX7 A;  5IYC J;  1LDJ A;  3TL4 X;  1X19 A;  2DQL A;  1AKH B;  2IVM A;  2K4B A;  1S72 I;  3ASO H;  2WB1 N;  2H6B A;  3FXM A;  1HST A;  3JSO A;  2WWY A;  2RDP A;  2XGX A;  1R7J A;  1MBG A;  4BH9 A;  3G73 A;  3E6C C;  1NG6 A;  1FTZ A;  2V1U A;  4D9J A;  2Q1Z B;  4BE2 A;  3I9V 2;  4E4H A;  2DMP A;  5LHG A;  5DUK A;  1VQM I;  2QBY A;  3A4C A;  1AA7 A;  1ONV A;  4RGX A;  4XBF A;  4DOZ A;  5K1Y A;  3ZQ7 A;  2M30 A;  4ESB A;  2PJR A;  3LNQ A;  2E2I J;  3PL8 A;  3HRM A;  2FML A;  1X3W B;  1IN7 A;  4FX0 A;  4ZYE A;  4AIJ A;  3MMY B;  3CCE I;  1X2N A;  1BM9 A;  3P9C A;  4A3D J;  1ZAO A;  2DYS H;  1QO0 D;  2ZXJ A;  1Y1V J;  3A0H C;  3U21 A;  1RUO A;  3FXK A;  4AIH A;  1EF4 A;  4LIU A;  3JRI A;  2N8G A;  4BJ6 C;  1BL0 A;  4EJO A;  2B63 J;  1WI3 A;  1NTC A;  2NYX A;  3PNT A;  5F64 A;  1TWA J;  2JRT A;  3UNG C;  4KMU X;  2VE8 A;  1JT6 A;  2EV5 A;  4RM3 A;  3J80 K;  1V54 H;  5BOX A;  2BOL A;  4PUS A;  4ZJZ A;  3W2V A;  3K70 C;  1AU7 A;  3K4N A;  3OY9 A;  3H92 A;  4BAC A;  1D0Z A;  3BLY A;  4M6X A;  2WAE A;  3S3O A;  1V5G A;  4UB8 C;  3RPQ A;  2M0C A;  1RES A;  1WJD A;  3EET A;  4R8H A;  4CCK A;  3KP3 A;  5GAH J;  3RPU A;  5LRS A;  1TT0 A;  2VKD A;  3KP4 A;  3OYG A;  1DPR A;  2DA4 A;  3F8F A;  2DDB A;  2IBD A;  2LF7 A;  2P0W A;  1KU9 A;  5K7H A;  5L3B A;  4IRH A;  3DKW A;  1FMV A;  4HF0 A;  2KPM A;  4IHT A;  1SAN A;  4KIB A;  4L9V A;  1WCM J;  1QZZ A;  3I5U A;  4CDG A;  4IHW A;  1K78 A;  2IGK A;  1N78 A; 
#chains in the Genus database with same CATH homology
 2VB6 A;  2IS1 A;  3K4K A;  2LRD A;  4II2 A;  2UWM A;  2WY8 Q;  3QYB A;  4LIT A;  4ZYA A;  1JI8 A;  4IZZ A;  4NC8 A;  3BG7 A;  2VLA A;  3VSK A;  1T95 A;  2V1N A;  2Z16 A;  2XC7 A;  3S3M A;  1G59 A;  4IQ4 A;  3RCO A;  2OUM A;  2JVH A;  2VJJ A;  1VZ0 A;  1EA3 A;  2ELJ A;  3IAS 2;  4XKV A;  4E7Z A;  1Z3Y A;  1UEL B;  3PNY A;  5LFA A;  1D0X A;  3OS1 A;  4XQF A;  1LDK B;  2WB1 A;  2X6Y A;  3UR3 C;  1U0J A;  2VJ4 A;  3LFU A;  2E1M B;  2HU9 A;  3C2H A;  3OL3 A;  2W82 A;  4KJZ A;  4XOP A;  3RPU D;  2GOM A;  1BR4 A;  4YEL A;  3K4C A;  3OYJ A;  3DEE A;  4HSR A;  1T0F C;  2OC6 A;  4B47 A;  3DQV C;  3G2B A;  3OIQ A;  4BQN A;  2IGN A;  3CJQ B;  5CKT A;  3F9K A;  1D1A A;  3VYU B;  4F93 B;  3J7A Y;  3LMM A;  3HOT A;  2MD0 A;  1NG7 A;  2A5W A;  3ZGK A;  3BCB A;  3K4J A;  3L2V A;  2IS2 A;  5HLT A;  1Y56 A;  3ZRG A;  1UAA A;  4OWR B;  2VXZ A;  2VQH A;  3OYL A;  2X6W A;  1DGW Y;  3D5R C;  4PSX A;  3TBI A;  3V42 A;  3H5A A;  2LC2 A;  3PNV A;  3GBG A;  2L5Q A;  1W36 D;  3K70 D;  4QPQ A;  4PJM A;  3H35 A;  2I8D A;  2IGM A;  3D5S C;  2M3A A;  1FMW A;  1X1A A;  2RNG A;  3CF2 A;  4R79 A;  3IP4 B;  2OV7 A;  1HA8 A;  4HNT A;  4HST A;  1D0Y A;  1QU3 A;  1TZL A;  3L2R A;  4JOM A;  2V4J C;  2CW8 A;  4XLA A;  3OS0 A;  4KT6 A;  3FBI B;  2K5C A;  5FRO A;  2WBM A;  4BU2 A;  3DTI A;  3FDY A;  4NQW B;  2F4I A;  2R7U A;  4F55 A;  2K9L A;  2M7B A;  3MKW B;  2DT6 A;  3CP8 A;  1BOB A;  2R7Q A;  2E60 A;  1SAU A;  1V5E A;  2L7K A;  3SYT A;  3K4L A;  2DJI A;  4F91 B;  3OYK A;  3OOU A;  3PFY A;  3DWL E;  3MKZ A;  2QKM B;  3PJR A;  2HNH A;  5KHD A;  2MAB A;  4PK4 A;  2ZXI A;  4U7B A;  5CPR B;  2UV1 A;  2W1O A;  1WFX A;  2BVL A;  2X1E A;  2LY1 A;  4CCL A;  4ZTF A;  4AU7 A;  4N4N B;  1BR2 A;  2LG4 A;  4XR6 A;  4B48 A;  4DBR A;  3ZQQ A;  4E7S A;  3EUK L;  4BEH B;  3N05 A;  4XLE A;  4EAT A;  2E5N A;  4XL9 A;  3W2W A;  3LSH A;  1Z7L A;  3AL0 B;  1MMN A;  2PMZ A;  1MMA A;  2CUZ A;  2L2O A;  3RSN A;  4BQO A;  4BE1 A;  2R7T A;  4BL0 B;  1WJF A;  2LOO A;  3CMM A;  4ANJ A;  4F52 A;  1E0E A;  1MW7 A;  3SDB A;  2LH9 A;  4XOT A;  3OR1 C;  2R7W A;  4C2T A;  4KIT B;  3HXL A;  2CV0 A;  4PJN A;  2JUG A;  2KL4 A;  2HVS A;  3TMO A;  1OR7 C;  1Z21 A;  3ZR8 X;  4B3X A;  4DIQ A;  1S9H A;  2ZXH A;  2CW7 A;  2AQE A;  2F5V A;  2VJ5 A;  3OYE A;  1GLN A;  4OAY A;  3A2K A;  3RQ4 A;  3A1Y A;  2M0M A;  3OYM A;  3OYA A;  3KYL A;  2K3P A;  3E0J B;  3OYC A;  4H4K C;  4X0G A;  1QHH D;  1MMG A;  5TGT A;  1WJA A;  4RMN A;  2VIX A;  4ZDP A;  4IKF A;  3OR2 C;  3DPT A;  2DOA A;  2LYC A;  4P1W A;  5KCM A;  3OWT A;  4RM2 A;  1DP3 A;  1D1C A;  4B44 A;  3BC8 A;  3H9J A;  3HOS A;  3DKY A;  3L2Q A;  2FUG 2;  4BS9 A;  4GRI A;  2A6T A;  4CH7 A;  2L9S A;  4DBQ A;  2MYS A;  3LSI A;  2VAS A;  3NWS A;  3K4B A;  3CZ6 A;  4CCM A;  3L2U A;  2VPL A;  1UG0 A;  3H9Q A;  2V7F A;  1P9Q C;  4XOR A;  4AVZ A;  1OLT A;  4CCJ A;  4XMY A;  4XLC A;  4BDZ A;  4BXF A;  3LSM A;  4PFP A;  4IQJ A;  3S3N A;  2WY7 Q;  4C9Y A;  2IXS A;  2XDV A;  4G6T B;  4XNF A;  2R7R A;  4KIS A;  4NNJ A;  3EUA A;  3VDX A;  3VYS B;  1PJR A;  2MC4 A;  3QYE A;  4XLF A;  3EPZ A;  4LIV A;  2IGO A;  3DPL C;  3DTE A;  2V9K A;  4BUP A;  3DLA A;  1QHG A;  2XF6 A;  3IUO A;  4XLH A;  1X1B A;  2RQQ A;  2GOX B;  3H9G A;  4OAZ A;  4XM3 A;  3HPH A;  4Y3O A;  2WAF A;  2KRC A;  1X4P A;  4U87 A;  3LSK A;  3VWB A;  1Z3X A;  3HPG A;  2AQF A;  2KLO A;  2ZSH B;  3HG9 A;  3PUB A;  3SEZ A;  2VXD A;  3HC7 A;  4JQF A;  3MKY B;  2NOJ B;  4HRI A;  3K6G A;  4FET A;  3OYH A;  4HEA 2;  4HG2 A;  3OS2 A;  3S32 A;  3DU5 A;  3VYR B;  1PYV A;  2X85 A;  3K10 A;  4ZDL A;  2WAD A;  3DKX A;  4CCO A;  3OYN A;  3FBN B;  2ZSI B;  2E1M C;  2WAQ A;  1X4O A;  5LD2 C;  2Y0S A;  2HQA A;  1R6R A;  2X6X A;  5KNL A;  4Y4R A;  3FHN A;  3NWT A;  4CCN A;  2W4S A;  1SFK A;  1MNE A;  3CP2 A;  3ONQ A;  4MLO A;  4BDY A;  2CH0 A;  1WJ5 A;  3BCA A;  2UUZ A;  4YEJ A;  5HNH A;  1DQU A;  1Y6I A;  2LRE A;  4ZC3 A;  2KQR A;  1LVK A;  2LBF A;  4CZC A;  1LKX A;  1IRX A;  4P5O A;  4RLQ A;  3OIP A;  4XKW A;  1N77 A;  3OYF A;  4BE0 A;  4BGD A;  1KON A;  4F3Q A;  3IAM 2;  4ITV A;  4NUB A;  2Z2S B;  2HPM A;  1G8X A;  2O5R A;  3M8J A;  3S93 A;  2KMU A;  2M4K A;  1X1C A;  3LL7 A;  2CV1 A;  2HVQ A;  3AFH A;  3FKJ A;  2W00 A;  4FAS D;  2LBF B;  4CSW A;  3RTR A;  2CS3 A;  2KP6 A;  4PJL A;  2X1D A;  2X51 A;  3HL2 A;  2Q2E B;  1WJB A;  2R7V A;  4B43 A;  2KHM A;  1YE9 A;  3L2W A;  2VQL A;  4HPQ A;  4DJA A;  4ZDO A;  2HDW A;  1BR1 A;  2Z1D A;  2R4G A;  4HNU A;  2LY2 A;  2CV2 A;  2XF5 A;  2VKH A;  3OMY A;  4NC7 A;  3E1S A;  4XKB A;  2KZV A;  2KRH A;  3S8P A;  5CQE A;  3SEQ A;  3AKZ A;  2R7S A;  1D1B A;  4C30 A;  4LG3 A;  2BVM A;  2IS4 A;  2BW3 A;  2E5Z A;  4AYB A;  3OYI A;  2KDO A;  3BG6 A;  5HNF A;  2X1C A;  1N75 A;  2VQC A;  2IS6 A;  3DTK A;  3H5R A;  2V26 A;  2HPI A;  4CA0 A;  5FRN A;  3D5L A;  4E7I A;  3PSF A;  3QOD A;  1YX3 A;  1LFP A;  5HVQ C;  3H5N A;  2RRE A;  1MND A;  1WJC A;  5JHF A;  2ZFU A;  2K9M A;  2XAU A;  4BQQ A;  2V6E A;  2MFZ A;  2XF7 A;  3QYF A;  4IX7 A;  4J00 A;  3OL4 A;  2BW3 B;  4XKC A;  3TL4 X;  1X19 A;  2XSJ C;  3LSG A;  1DGR M;  4PJJ A;  3HUG B;  1YX5 A;  2DCE A;  2VL8 A;  4PSW A;  2HZD A;  2W7N A;  1K6Y A;  3ZXS A;  3AL0 C;  2WA0 A;  3ZCO A;  3VYT B;  4DGW B;  2R7X A;  1NG6 A;  1V5F A;  1ZEL A;  5HOO A;  2CUJ A;  4D9J A;  4E7J A;  1ERD A;  3KX2 A;  3K4M A;  2Q1Z B;  4BE2 A;  3I9V 2;  4E4H A;  4E7K A;  2QKL B;  3A4C A;  1AA7 A;  4DOZ A;  2PJR A;  4XN3 A;  2VJI A;  1WJE A;  3PL8 A;  2M4G A;  4F92 B;  3MMY B;  4CUG A;  1J09 A;  4E7L A;  4E6K G;  3CJR B;  4C2U A;  3OYB A;  3H0D A;  2HVR A;  3U21 A;  5FRM A;  2CFO A;  3HKZ A;  2CMP A;  3QOE A;  4XN0 A;  4BJ5 C;  4J01 A;  4LIU A;  4Y33 A;  4QPO A;  4BJ6 C;  2PJR B;  2JSP A;  3PNT A;  4RLF A;  3UNG C;  2M7A A;  4RM3 A;  2BOL A;  1W36 C;  4PUS A;  4ZJZ A;  3W2V A;  3I3L A;  3K70 C;  3W2A A;  3C2G A;  3K4N A;  5CQG A;  3OY9 A;  4BAC A;  4XON A;  2R7O A;  1D0Z A;  3BLY A;  4PFO A;  3W3C A;  2WAE A;  4II3 A;  1V5G A;  3S3O A;  3M1C A;  1MMD A;  3CES A;  4BEH A;  2L9N A;  4BJT A;  4E7H A;  1WJD A;  2F6C A;  4N4O B;  4CCK A;  2VQG A;  3PSI A;  4YRV A;  3DPU A;  3MD2 A;  1TT0 A;  2VKD A;  3OYG A;  2P0W A;  2DT7 B;  1FMV A;  2KPM A;  2DXI A;  4D1Q A;  3VSL A;  3KEY A;  4ZTJ A;  2JVG A;  3EUH C;  3DU6 A;  2JA2 A;  1X1D A;  3OYD A;  3SZG A;  2IGK A;  1N78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...