2RREA

Structure and function of the n-terminal nucleolin binding domain of nuclear valocine containing protein like 2 (nvl2) harboring a nucleolar localization signal
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
74
structure length
74
Chain Sequence
MKPRPGVFVDRKLKQRVIQYLSSNRCGKYVDTGILASDLQRLYSVDYGRRKRNAFRIQVEKVFSIISSEKELKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Structure and function of the N-terminal nucleolin binding domain of nuclear valosin-containing protein-like 2 (NVL2) harboring a nucleolar localization signal
pubmed doi rcsb
source organism Mus musculus
molecule tags Nuclear protein
total genus 14
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16725 Nucleolin_bd Nucleolin binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2010 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2rreA00
2RREA
chains in the Genus database with same CATH superfamily
4FX0A 2VPRA 5EF6A 2ZMEC 1S3JA 5AONA 3KYCB 2DT7B 2HXIA 2M3AA 1QPIA 3K4LA 1HDPA 4XORA 5F1RA 4XRMA 4FCYA 4UB8C 4BBRJ 2IP2A 1W36C 3SDBA 3CCJI 3LOCA 2JT1A 3CESA 1ZRCA 2DPDA 2GM4A 4HLXA 3IC7A 2EFNA 1VQMI 2VLAA 4I0AA 4KN4X 2LH9A 2VBWA 5DM7F 4FQGA 4XL9A 4B3XA 1ZYRF 3DWLE 5DEQA 3LQRA 2VONA 3LSMA 2M45A 2BBYA 1TLHB 3LSGA 3WTSC 2F48A 2EFQA 4XRSG 3WU0A 3W6VA 3WGGA 3E6DA 3JTGA 3IAS2 1JHHA 1WQ2A 2XB0X 3QAHA 1LEBA 1B72A 2E1NA 3FIWA 4B1RA 4YRVA 1HW2A 2FQ4A 2MSYA 4JK1X 4EMSA 1X3WB 2LKSA 2YX7A 3K2ZA 1YJ9I 1TNTA 2O03A 2BW3A 3VPRA 4XLHA 5GAGJ 1JT0A 1Z9CA 2BV6A 2OF7A 3DFGA 4PK4A 5GP9A 1KA8A 4NNJA 1N77A 2BEOA 5ICFA 3I4MJ 4W1UA 4EGYA 1ITYA 4GYIA 1DPRA 4HSRA 1BIAA 2XV4S 2FNAA 4O6JA 5IP6A 2HDCA 3WG9A 3ZQQA 3HJEA 3AKZA 1K79A 1ZAOA 2LNBA 5IY5H 1TC3C 2MH2A 3H9QA 3MKZA 1GXQA 3K1PA 4RB2C 2GZWA 2XC7A 1R71A 4LIUA 2OTJI 1Y6IA 1NG6A 3M3YJ 2DOAA 3BR3A 1PP7U 3CLOA 5FKOA 2DMTA 4QSHA 2Z3YA 2VXZA 2LMDA 2R5ZA 3GTGJ 3E3VA 2XGEA 1SEUA 3B02A 1WH7A 2KIQA 2XAHA 2EH3A 2OAZA 3OYFA 2XASA 4BY7J 2RQQA 2R93J 2QGUA 4KMUX 4XSXF 1VQ9I 3CP8A 2K4BA 3H5RA 4J19A 2DA7A 3Q9SA 2LBFA 1DDNA 4F91B 2IA0A 2B0LA 1XCBA 2OU2A 1B72B 5FLVA 3QYFA 1Z21A 4EATA 3TBIA 1POGA 2ME0A 2VKDA 5EEAA 5E1XA 4I76A 2KLOA 2VKVA 2O8XA 2BW3B 1D3YA 3HUGA 2AQFA 3U1DA 1G4DA 2DA5A 3DLLF 2K3FA 1KU7A 2XF6A 2D45A 3S1QJ 4E6KG 1OJLA 2QUFA 4XLCA 2VUMJ 2GIZA 1Y8QB 2LR8A 5KVRA 1FOXA 2X51A 3GLLA 4D9JA 1W4MA 3K1NA 2D1VA 2OPTA 3GTOJ 1J7KA 4OWRB 2W48A 3RZDJ 1QZZA 2HFHA 3FDYA 1R22A 3SZGA 3HB9A 4R1HA 1O4XA 5ILVA 2K9MA 3RSNA 1MBFA 5B3SH 3ZRGA 4B4CA 4N4OB 3FM5A 1R23A 4M71A 2HQAA 1A35A 2H8RA 1LVAA 2FOKA 3AG4H 4I09A 2X9DA 5F0HA 1W5TA 3BR0A 2TRTA 5B66C 1IXCA 3V4GA 2R5ZB 4XOPA 4OIOF 1OCPA 1HC8A 2BYVE 3ZMDA 4LD5A 5FKLA 1T38A 2TDXA 4CCNA 4EQQA 2R7TA 1MMNA 1MSFC 3OYEA 4EJTA 1FMVA 1X3ZB 4HYEA 3FBNB 1FBSA 4EV0A 3BTCA 1U5TA 2VE8A 1D1CA 3E0JB 3GLXA 4BJ5C 1R7JA 1JHFA 2LKPA 3BQZA 3J81K 3M8FA 5IYCJ 2BHYA 5LFAA 2EWNA 2LBFB 3N97A 3MFKA 3NEUA 4HNVA 3CTAA 4GFBA 2L7KA 4C30A 4RGUA 2KL4A 5B5EC 2BY2A 4HX7A 1IUFA 4N9IA 5HDKA 5IT9K 2JUCA 3M8JA 3KP2A 5CJ9A 1AA7A 3BZ6A 1SC7A 3TL4X 2KP6A 3S93A 3GTQJ 1N78A 1E17A 4C3JJ 3DCFA 2DT5A 3HUGB 5J1UA 4CUGA 1XGOA 2OQRA 4BGDA 3MEXA 5K5OA 1J0RA 3L00A 4BHCA 2HYJA 2EK5A 1ZGJA 5HODA 3CJNA 1FNNA 3MZ8A 1UMQA 2XB5A 1FBUA 1YOVB 1RKTA 3HPGA 1OCRH 2Z16A 5A2QZ 2X6YA 4OAZA 5FLXZ 2UV1A 2OZ6A 2P5VA 2M2EA 4RAFA 3C2GA 2ZSHB 1I6XA 2Y0SN 3QOPA 4HAMA 1OCZH 5FKKA 1TP4A 1ENHA 3BDDA 2LG4A 3IV5A 5LEJA 2IS6A 3EUHC 2IGKA 1VTNC 4UVBA 5H6QA 4HDUA 3GTLJ 3TQNA 3S2WA 3SDGA 1GV5A 1A31A 1EKEA 4IF4A 4BDYA 3KP4A 1B6AA 4RA2A 3LAJA 4NC8A 4V19K 4KMFA 3O2PE 4B44A 1U5TB 3MWMA 5J8CA 3L2RA 4UUVA 3ZXSA 3DPLC 2CUZA 3TDUC 4BKXA 2OQGA 4XLEA 5F1JA 1W7PD 4I0BA 3C18A 4L0YB 3P9CA 2K5CA 3WGIA 1JKPC 1J5YA 2VQLA 1OYYA 2AO9A 3SEZA 4ETSA 3DBHB 2MD5A 3SZPA 2KJBA 2ECCA 3U2RA 4YELA 3DU5A 4AIHA 2HZTA 3HRTA 3KZYA 3OYBA 5LRRA 2ESNA 5L3EA 3LSIA 4BDZA 1DP7P 1XDUA 3WTUC 2J5OA 5H6RA 5KAFC 3RKYA 3BWGA 2EZLA 3WTWC 2M4KA 4HBLA 1ZG3A 4YFKF 1R58A 2Y30A 3RKQA 5KK1A 1YW7A 3V8JA 1O7FA 4Q47A 2RDPA 4NB5A 3ZMUA 1WJEA 1IGNA 5TRDA 3FXQA 3HRMA 2QSGX 2F4MB 2K86A 2LTPA 3K4KA 3Q3SA 5FRMA 1SVLA 2EV0A 4M6XA 3ZOBA 4WXHA 4IOCF 2VOPA 4MNUA 1BA5A 1OYWA 2QQ9A 5E1WA 3SEQA 3F72A 1QU3A 3I64A 2ESHA 2UXNA 3WGHA 3DTKA 2VKEA 4CHUA 1XMXA 5KAIC 3I53A 3FBIB 2JJ7A 4FISA 4IO9F 3RQIA 1NK3P 1BR1A 2DTRA 3CJQB 4L5JA 4GCVA 2R7XA 3BT9A 2PN6A 4FE4A 1KQ8A 2LF8A 4IXAA 3FMSA 4LLGF 1BJZA 2X1EA 3IHUA 2E36A 4BS9A 3ZQCA 3F8MA 1XN7A 4KITB 2Y31A 2NAZA 4CO8A 1LPQA 2L7MP 3JRDA 2XSDC 1ZH5A 3LSHA 2L4MA 3LA7A 2VI6A 2ZJRF 1DU0A 1JT6A 2R7VA 5L3CA 2Q1ZB 3MQ0A 1W36D 4F52A 2RNJA 3ERED 1JJ8C 5J6XA 3BJOA 1GVJA 3ABMH 3KCCA 2E5NA 4L9NA 4DW6A 5E20A 3HL2A 4KICA 3KZZA 3DPTA 3CMAI 5B1AH 5CVJA 5C4XJ 4LGWA 2W84A 1F5TA 1B59A 3J80Z 2HZDA 4I98B 4C3HJ 2IT0A 4AIDA 2ZMEA 2H6BA 2HPIA 3B6CA 4A3JJ 1VQ4I 2V26A 2O0YA 3BOQA 1E3PA 3PFIA 4PFPA 4JOMA 3CCLI 2VQCA 5LRSA 4IHWA 4ZYHA 1V5FA 3V8KA 2XAGA 3VB2A 2A6EF 4AIKA 2HEOA 1K6YA 3F8BA 2VC0A 2I10A 2QM3A 3DQVC 3E6MA 3ZR8X 1JE8A 2DLLA 3EETA 1QQIA 5DCMA 5GAEJ 5ILSA 2Q0OA 1L3LA 2WAFA 3OR1C 2JN6A 4LB5A 5DV5A 3OV8A 2DJIA 3R61A 3HOZJ 1WKMA 3OS2A 2ZKZA 4PJMA 3Q0WA 4D7MA 1MNEA 2Z5UA 2BXYA 5LHIA 4B8XA 5E3NA 3T5XA 2FF4A 1BR2A 4A3CJ 4PCQA 3IRQA 5CLSA 4YFXF 1IXSB 5M3FJ 3G1OA 3HOVJ 2D5VA 1IO2A 2QQBA 4UV9A 2HU9A 3VYTB 2K9NA 2ZJPF 3N4MA 3SJMA 3BR2A 3L1PA 2B9SA 2E1CA 2Y75A 4O5VA 4BAYA 5IOYA 1XMKA 3KPHA 1O57A 1P92A 3LMMA 1TQIA 2DQLA 4QLCU 3ULQB 1YYVA 2W7NA 3E6BA 1H9GA 2V9KA 4MTDA 1LB2A 5EEGA 1UG2A 3QYEA 1DUXC 1TT0A 2A61A 2QYOA 2IVMA 1B9MA 2STTA 3H36A 2XF5A 2QA4I 4G6TB 5E1ZB 2V1XA 3T8RA 2EV6A 4M72A 5CQGA 3HHHA 2WAQN 4CDGA 3CD6I 4BJTA 2COBA 2JRTA 2V4JC 1KYZA 2DQRA 2G9WA 3I58A 4UVAA 4XBFA 1EF4A 4L9TA 3RQ4A 2ZMEB 2P0WA 2HVRA 1MKMA 4RB3C 3ZGKA 3HOUJ 1IUYA 2IGOA 3NWSA 3IKTA 1A5JA 1T2KA 2CUJA 2Q2EA 3S1NJ 4DYQA 2QZ8A 1MSEC 5K5RA 1XDSA 4U87A 2GIVA 2K27A 3TW7A 1R5GA 1LNWA 5DCMB 1OCCH 4XLAA 1U5TC 2L4AA 1ZGWA 2HR3A 4YIFA 3BP8A 3CDLA 1DP3A 4NBQA 1QZYA 1LE8A 2P7VB 4PDKA 3F3XA 3J7ZI 1S8NA 3DTEA 5CVIA 3L2UA 2LOOA 1O7LA 3E97A 4F7ZA 1A6QA 2V1DA 5D5XB 2CSOA 4CXFA 1T56A 4AYBN 4YFNF 3GZ6A 3JRGA 1OLTA 1S29A 2ZFUA 3K1MA 3OYMA 3CO6C 1MH3A 3CCYA 1JTXA 2OCEA 3MKYB 2L9SA 1QBJA 1K6OA 3TO7A 2PI0A 1Z1DA 3CCEI 4XSZF 5HS9A 2X85A 3OYGA 2NRAC 2KZGA 5EZGA 4ESFA 2JA7J 4HG2A 3AL0C 1DU6A 3REOA 2IPQX 3GX4X 3VYRB 2DDBA 4LIVA 4NHJA 1V54H 4P96A 4AM3A 4XICA 3PUFA 3BLYA 1S7OA 3O8GA 1ETVA 1MJBA 3GZNB 1WPKA 1IN5A 3CC7I 4UVCA 1MBJA 1R5HA 1MW7A 3IKVA 1FSHA 3SHFA 3DBRB 1LVKA 4B43A 5HLGA 4IQ4A 1YG2A 3MCZA 1YI2I 1LDDA 2LRDA 1XMAA 3GZ5A 3SXYA 3C2HA 1VFCA 2LY1A 2XIGA 1X3UA 1Y39A 1XB4A 2Q2EB 4IZZA 4H0EA 5LGNA 2MBFA 1ULYA 1FC3A 4PJLA 3HRSA 5DD4A 3KIOA 1HKTA 3HEFA 1VQOI 2BXZA 5KCMA 3OIQA 2CRGA 5DTDA 2ISYA 1LE8B 3G73A 5FD6A 3F21A 1ODDA 3IWFA 1R5ID 1GUUA 3C1DA 2E71A 4JP0A 2V1NA 4R79A 4P5OA 4WCGA 4HX8A 2M7BA 4DGWB 5GPCA 1V3FA 1P4WA 2IRFG 2GOXB 2B63J 3GW2A 1CGPA 2D2WA 4PGGA 2QBYA 3Q9VA 2EZHA 2P8TA 3IP4B 1FYMA 4I01A 2DXIA 1JI8A 3V7CA 2XVCA 4M74A 2GXAA 1UCRA 2D1HA 1AU7A 1KU2A 2IGNA 2E1MB 2WB1A 1WJ5A 3DP7A 2V9PA 2ZB9A 2RKHA 3BJAA 3VODA 3WODF 2L2OA 2V9VA 4BE2A 2VBZA 4GXOA 4E7HA 2DBBA 3BG3A 3EQLF 4NUBA 4QPQA 1QRYA 3D0SA 2W24A 1ON1A 1NH3A 3MAJA 2MW8A 1XSXA 3VYSB 1YJWI 2CGPA 3RPQA 1MJAA 4ZYDA 1DGWY 2PLYA 2ZJQF 5EG0A 2EIJH 4F55A 1YQAA 2QSFX 5CPRB 5LBQA 4PJNA 1ZR2A 1K78A 3C2BA 1ZR4A 4D7NA 1TZLA 3BG7A 4IHSA 2LF7A 3I3LA 4XONA 2NOGA 4WX9A 4L9VA 1V5GA 3GXOA 1FTZA 1BN5A 2HOAA 4DQ2A 3P9IA 1C0WA 2IS4A 4X6AJ 1XC5A 1HKQA 1MBGA 2PMUA 3S15J 1ZKGA 1X2NA 2CUFA 5L3DA 4E7KA 4NC7A 4QPOA 1E0EA 4BYYA 2VT2A 2ISZA 3I59A 1JKRC 2NOJB 4BQNA 3EUKL 2QBYB 1ZGAA 1NG7A 5D6EA 1JUSA 4ZTJA 2H94A 2MGQA 4IOAF 3TO6A 2VASA 1Z0XA 3G71I 4A3LJ 3CUOA 2PQ8A 4OINF 3ZP5A 1R49A 4ITVA 5CQEA 4RBOA 3K69A 1FT9A 4KDPA 4WK8F 2XGXA 3JTHA 1QO0D 1QHHD 2FQ3A 4BQAA 3OSFA 2MFZA 2R7ZJ 5BPDA 4M3FA 3S32A 1P7JA 2PG4A 3ZQIA 2F4OB 2RVCA 4EEFG 4ZZDA 1ETYA 3Q0UA 4IRIA 2FXAA 5E17F 2LK2A 2VBYA 5ICGA 4KT6A 4BQOA 1IN4A 5AIPA 3K10A 4OU0A 3TP3A 5IP9J 3CQZJ 1ZELA 5EZHA 5HNHA 2CUEA 5F64A 2VL8A 2DW4A 2LFBA 1KGSA 3KZIC 5JLXA 4M73A 2XAQA 3TKYA 4XLNF 1GV2A 3HBLA 5EG0B 4RB1A 4QWQA 5DD8A 2KFDA 2Z2SB 2R7SA 4M3EA 1K78B 1X1CA 3K4CA 4M3DA 5TJJA 4LOCA 1ERDA 2E35A 3CMYA 4AIJA 2LC2A 3VOEA 4HNTA 3HDDA 4P9FA 1K7AA 1Z67A 3QPTA 1CF7A 3F22A 2FJ1A 2KDOA 2E19A 3IUOA 2KZVA 3RYRA 4LITA 1FP2A 2RN7A 1BC7C 2K9QA 3I59B 1A6IA 5D5VB 2E60A 1U78A 2XAUA 1XCVA 3PM1A 2AS5F 3FXKA 1VF9A 1IJWC 1FYLA 2BZTA 4CZZA 4ZTFA 2Y0MA 1OPCA 2WY7Q 2VODA 1IDZA 4GYGA 5LLQA 4BBSJ 2COMA 2O9LA 4ESJA 2JQ7A 1Z3YA 5EJCA 5KNLA 3HRUA 5E3MA 1E3HA 4L9JA 4AD9A 1H88C 4U7BA 2AHQA 4PFOA 4U0VA 1MJ9A 1PVEA 3FZVA 2XDVA 4ZDOA 4EJUA 3K4JA 2JVGA 3PNTA 2DCEA 3R6SA 1P6RA 2XPWA 1AKHA 2NNYA 1G2HA 2IA1A 2CV0A 4UUTA 1RUOA 3H1CA 1OCTC 3PSIA 1TWGJ 4XN0A 3BPXA 1JGSA 2IS2A 1F43A 1KYWA 2CW8A 2MC3A 5GAHJ 1ZG1A 1Q1HA 3ISPA 1RR8C 3GTPJ 2JZYA 3F6OA 1RIOH 4XRFA 3QYBA 2TCTA 2EA2A 3V7SA 1SFKA 3D5RC 3OYHA 1MMAA 2OA4A 1MGTA 4I7HA 3LFKA 4L5EA 4U88A 3ABUA 2FNPA 3S2DJ 2UUZA 1SD5A 3HC7A 2ETHA 4XIDA 3MVPA 5D4RA 3CUQC 4HOBA 2E1MC 3EYIA 1RUNA 5FB2A 4XLPF 1MZBA 1ORKA 4BE0A 1CF7B 2VOOA 3ECHA 4AVPA 3CF5F 3K2AA 2YUSA 5F04A 1IRGA 4GO1A 2ZXHA 2G0EA 4LJZF 2GA1A 1D1BA 5AIQA 4MFEA 3W2VA 2GAUA 4Y17A 3A01A 1ETXA 1BW6A 3VWBA 2XRNA 3A02A 5M5WJ 1T0FA 4U0YA 3S3NA 4C2MJ 1G3YA 2E7XA 3BZKA 4KNYA 1X1PA 2GOMA 1IW7F 1YFHA 2MLKA 1H89C 2P7CB 2X4HA 5CVRA 3LSPA 1EH7A 2EZIA 2G7UA 1QNTA 4G6QA 2ELHA 3KETA 4E4HA 2J5PA 1TQMA 4RGRA 1SD7A 3I0TA 3AAFA 5CVVA 2R7FA 4ZH4F 1BI3A 2GLOA 1BM9A 1AKHB 1PYVA 4HV5A 1YJNI 3BCAA 4LG0A 3OYAA 4CGZA 4G7OF 2X48A 3BPVA 4LLLA 3HOXJ 1TWCJ 2NVYJ 2O7OA 4HRIA 1F36A 1JGGA 4BY1J 3K4BA 3V7RA 1FOYA 3FHNA 1LKXA 5LHHA 5J8FA 1RI7A 2L3DA 1XSVA 2EPFA 4ZC3A 2QQ8A 2QVOA 2W00A 4JX6A 5E79C 4GGGA 1IRZA 3MZYA 2WAEA 1QVTA 1VNDA 3OYLA 4Y4RA 1DGRM 3BR5A 3BG6A 3T8TA 1MIJA 2BHZA 3DKWA 1YIJI 4MLOA 3DKXA 4MGRA 9ANTA 3DEEA 1U3EM 3C3WA 1TL8A 1LFUP 4Q48A 5LGTA 1HW1A 3A01B 2E2HJ 3SQNA 5BNGA 2FUG2 2HTSA 3HXLA 3KLOA 2ACJA 3R0JA 1YW9A 5CVUA 5K7ZA 1QZEA 1V5EA 2JRMA 5DUKA 2RAEA 1Z6TA 1WJAA 3KYDB 5F27A 5JHFA 2ZXJA 3H5AA 4B3AA 1FLIA 5EYRA 3OWTA 2WADA 2DAOA 4D0PA 4AWXB 1SFEA 2H1LA 1RC9A 2WY8Q 3FXRA 2EBIA 4FT8A 1T6SA 4NC6A 3OOUA 5JLWA 3LAPA 1XTAA 2LREA 2R7OA 4KIFA 3R4KA 4WWCA 1I50J 4AUXA 4E7SA 1X4PA 2K7LA 3FXMA 4LG0B 1ZLJA 1YTYA 3E6CC 1Y1WJ 4K2EA 2UXXA 2N8GA 2RQPA 2Z33A 4RMNA 3W3CA 4XKVA 3F8FA 5GTIC 4XR6A 4V2GA 3VDXA 2KKOA 1B9NA 2M5WA 5GTHC 5J4VA 5K5QA 2QQAA 4FE7A 2RNGA 3AL0B 2NVUB 1YS7A 4S0HB 2H09A 4C2TA 3A1YA 3RCOA 2GQQA 3OS1A 4MEXF 3S1RJ 1HSJA 5ED4A 4ENNA 4LB6B 5DYMA 3F6VA 3AFHA 3SFIA 4XQFA 2PJPA 3OL3A 4FTHA 1I39A 2DK8A 3BR6A 4N9HA 2O8KA 3ZN1A 3ABLH 3LSTA 4ZYEA 5GADJ 2DYRH 3NARA 1LQ1A 4LFUA 2EQRA 3MN2A 3ABTA 3OIOA 1SMYF 4CCKA 5KHDA 1SMTA 3H0DA 2HQNA 4MFDA 1O3SA 3DF8A 3OR2C 4RAGA 1UJ8A 4OAYA 3RDIA 3IRRA 3OYDA 1SD6A 3FM3A 4BL0B 1WZ2A 5TGTA 2F5DA 2RREA 4IX7A 4BACA 4CZCA 1TWFJ 2ZSIB 1BJAA 3RJPA 5ILUA 4Y52J 4IRHA 4PGHA 2NVXJ 2L7ZA 1APLC 1F4KA 1IN6A 2HDDA 3GFIA 2LVSA 3QPSA 2E2IJ 1LFPA 2EIMH 3ML6A 4HPQA 2V6CA 1R00A 1T95A 4V2FA 2A3SA 1R4MB 3FKJA 1J59A 2R92J 3F9KA 4CCMA 4G7HF 3U21A 1I6HJ 1DPUA 4RGSA 2XGDA 4ZZLA 5F0FA 1SFUA 2AXLA 2NXNB 3G3ZA 1P4XA 2DMUA 1BI1A 2M1BA 2E5ZA 3M8EA 1WHUA 2HGCA 5DDGA 5ICEA 2CWEA 1IV6A 1WCMJ 3S14J 4KUMA 1U9OA 1X1AA 3H3ZA 5E3LA 4CCOA 2PJRB 2MC4A 4PJ0C 2ZXWH 2M0MA 4XKWA 2H1KA 4Z2YA 3KE2A 3N05A 2OUMA 2L9VA 2R3SA 3H35A 4UHTA 2OTLI 3P5JA 3TP0A 4EVIA 1Z7LA 3E5UA 1UHWA 1U0JA 2I8DA 1KQ9A 1OFCX 3DV8A 1IRFA 1RETA 4AC0A 2HYFA 5F0CA 2LYCA 3VSLA 1XGMA 1HBXG 4RAYA 2QWWA 2RGVA 4MHGA 1EH8A 5IT3A 3FK7A 2VJ5A 4BXFA 3SFZA 2DU9A 1HCRA 1GDTA 1M1EB 2YR2A 3WG7H 3HKZA 3RKXA 1XSDA 4I99C 4C2UA 4IKFA 4OIPF 2AQEA 2GBYA 4XK4A 4A3IJ 2PMZA 1KQ0A 2F4IA 4HNUA 1D0YA 3LA2A 4CYCA 1TT5B 2M9HA 1S5LC 2KJCA 4EJOA 2VIXA 3S3MA 1EA3A 1E2XA 2Z99A 3FX3A 1R1VA 3GFJA 1MH4A 2HWVA 1HLVA 1IC8A 4HF2A 5F6FA 1T0FC 4HA8A 1O3RA 2OD5A 4M9SA 2P81A 3KEYA 1ZHFA 4PUSA 5FO5A 1BBYA 3RIRA 1G3SA 4IHXA 5L3GA 2CV1A 5IOZA 3WHCA 2MLGA 2KPMA 4M6YA 5FKMA 5HS7A 1YITI 1I3QJ 1HDDC 3KX2A 2FX0A 1MBHA 1WJBA 4Y15A 2WAQA 2L54A 3GMEA 2Y69H 1JXSA 3D5SC 3F23A 1ZRFA 2KQRA 1RZ4A 2YX4A 5E18F 2M7AA 2VB6A 1S72I 2LDUA 2OJED 1XGNA 3JSOA 2V6EA 3KEOA 4P9UA 3QU3A 1K4TA 1D0ZA 4UY8I 1T8IA 2ID6A 2HKXA 5FD5A 5FKNA 2KRHA 4OOIA 3QPLA 3G6EI 2JTVA 2DK5A 4QIWN 2R0QC 4EJWA 4BUPA 2HOEA 3TW6A 3PO3J 2ZFWA 2MG4A 1P2FA 3I5UA 3CUQA 2RC4A 4M9ZA 4CYCB 3M1CA 4UB6C 4HZFA 3GTJJ 3HG9A 2EINH 3TOAA 2PEXA 2VJ4A 2VJJA 3WU2C 3IH4A 3O6BB 2NS7A 2LY9A 2DA2A 3LNQA 3BZCA 4KA4A 1WJFA 1IXRC 1IZ1A 3HGGA 3C7JA 1WWXA 3GUDA 1Q1VA 4Q4ZF 3ZPLA 2E7WA 4ZYGA 3GTMJ 1HSTA 1E3OC 2BVLA 1QA6A 3PNVA 4M3BA 1KONA 2CG4A 1TWAJ 2R7WA 2ID3A 2VT3A 4IRGA 3J81Z 3MKWB 2YU9J 1JUMA 4U7DA 3MD2A 1T33A 2CQNA 1GXPA 3LQQA 5FGMA 2DFFA 3KP5A 2LY2A 5JVGF 3G1LA 3CC2I 3BTLA 1FIAA 2ELKA 3MKLA 1BL0A 4YIRX 3M7GA 3ZQFA 1Z6RA 3HHGA 4M6VA 2VQHA 5A2QK 2GXGA 2YU3A 5FLXK 2WV1A 1VQ5I 1S6LA 4IEJA 3HGYA 4UNOA 3L2QA 3KYLA 5M3MJ 4KJZA 1TNSA 1VQNI 3ELKA 1WGXA 1OQYA 1WI9A 3EUAA 5HDNA 1FX7A 3VEPA 5HVQC 2EFWA 3HSEA 3GBGA 3RPUA 5B1BH 2FE3A 1EJ9A 1AOYA 4BNCA 5C44J 4UXNA 3T0YA 1GLNA 2K02A 4BHPA 5C4JJ 5E8GA 2M8GX 3ZMSA 3I4NJ 5CYVA 1ZTRA 1WRJA 3J7YJ 2XHKA 4IVNA 2CU7A 3NRVA 2DA6A 3DPUA 3QOEA 3HOYJ 5D4SA 3DTIA 2OZUA 3CUQB 3Q5FA 3PNYA 3ZMTA 2DTZA 2KIFA 5GPAA 1T39A 4G12A 2PMHA 3A0HC 4DYCA 5LEKA 1OCOH 4KFCA 3M1EA 3HTSB 2K85A 2HOTA 1H9TA 4RLQA 3S8PA 3FMRA 4BEHA 3J7AO 3HTUA 3UKGA 2DA4A 2JPCA 3DLAA 1KU9A 1WFXA 5L3FA 2JK3A 1J75A 2FD5A 3K70C 2FU4A 2H8WA 1J2XA 4ZYAA 3BTJA 1IF1A 3BCBA 3TO9A 1YRNA 2CFXA 2F5CA 2CQXA 3H3UA 3JRHA 3GYHX 2F6CA 1F9NA 2IJLA 2JMWA 4RAZA 3ESWB 2A05A 4OMYA 2W57A 3H9JA 4XKBA 3HOTA 4ESBA 4BU2A 5DM6F 2YPRA 1KU3A 1L0OC 1QPMA 3X2QH 3L9FA 3VSKA 2XRLA 4W97A 5CKTA 1D0XA 1FOWA 1YX5A 3ERMA 3AG1H 2MD0A 1QVUA 4DYRA 1OKRA 1ZREA 3WTZA 1MMSA 3NWTA 1DQUA 3OIPA 2DN0A 4A5NA 1ZK8A 3WTXC 2XKOA 3HM5A 2DFIA 4ZDPA 3KP7A 3JRBA 2NS8A 3FXUA 3BG5A 3ZQHA 5D6FA 4MIMA 4DOZA 4IHTA 4S05A 4D1QA 3R60A 4B47A 1UHMA 2JPBA 4KIBA 1U8BA 2JA2A 5E8IA 1W5SA 1K83J 2XF7A 1T08B 1T98A 4IJAA 2R7QA 2NVQJ 5FFZA 2HI3A 3FHZA 5H2FC 2RV8A 3GFLA 1U9NA 2EV5A 4RDUA 1HF0A 4A6DA 2UWMA 4CICA 2DOFA 2NS0A 2JUGA 2WBMA 3J80K 1FZPB 2EB7A 1XS9A 1SAUA 4DNCA 5J47A 2VC1A 4BEHB 2M34A 3F8NA 3P7NA 1V55H 3FWEA 4F93B 2DFEA 4HF1A 4KISA 3FKIJ 2DMNA 1YRNB 2HOSA 2LP0A 4M9XA 3ZMZA 1D8KA 3CCQI 3CP2A 2HQRA 3GWZA 3TEDA 4KYWA 2DOEA 2BGCA 3CO7C 4XM3A 2LLKA 3OS0A 2GA2A 4XNFA 4G8XA 5HLIA 2FA5A 1NHAA 3IH2A 1BR4A 4BJ6C 1Y0NA 4P1WA 2CW0F 3CDIA 3G4SI 1EV7A 2K9SA 2X6WA 4LG3A 1K61A 2BY0A 2A6HF 4MQVA 2VBXA 4X0GA 2BVMA 2ADUA 1P4AA 1TWHJ 4Y33A 3RI4A 1R6RA 3WTVC 3WHBA 2MH9A 2QF7A 5M5XJ 1SANA 3IAM2 4HW0A 4HX4A 4JX4A 1VQKI 2FRHA 2JSCA 2M4GA 4OIRF 2P5LC 4A3MJ 3FXOA 2HQ5A 5C3EJ 3V8LA 5BMZA 2EJRA 1YW8A 4E7IA 4L5IA 3HYIA 3ABKH 3GO5A 2R7UA 4LK0F 2B7EA 2K9LA 2HPMA 1AWCA 4LLNA 2QENA 1MMDA 4A6EA 1D1AA 2KMUA 4ANJA 3IL2A 1B4AA 1SVOA 2K40A 5BQTA 2HVSA 3A2KA 1VQ8I 1J09A 2O5RA 2QKLB 1MDMA 3I4PA 2WA0A 2XPUA 2Y2ZA 3ROUA 4OIQF 4YG2F 4PSWA 4JYKA 1ZG5A 1MNMC 3WTYC 3K0LA 2KT0A 4XN3A 4I6ZA 1BOBA 3G1MA 1CQTA 3DXJF 2V79A 2PBIA 3TMOA 3HOSA 2BY1A 3W6JB 1OR7A 2F5EA 3FK6A 3KLNA 3OY9A 5EGOA 1PDNC 4GDFA 2A5YB 4WXCA 2X0LA 2HVQA 4N0BA 3DKYA 2DI3A 1J9IA 4EM2A 1PUFA 2W82A 5JI6A 3JRIA 1N75A 1G59A 1JTYA 2JSPA 2Y48A 3BJ6A 4DBRA 4G94A 1X1DA 2XPVA 2X1DA 3GEZA 3L2CA 2CYYA 2QEXI 1BC8C 3L09A 1A04A 4I2OA 2DODA 2GXBA 1G3WA 1LUJB 2A07F 2DMPA 5J1YA 1UHSA 1FSEA 3OOPA 4RB0A 3OYJA 1FY7A 1NK2P 1ON2A 2ZO4A 4WF2A 4IL6C 3S17J 4ZDLA 4RM2A 5K1YA 4BE1A 2CQQA 4NDLA 3JRAA 5HDGA 1JJ6C 2HKOA 4E7LA 4OMZA 1BIBA 3BROA 2YS9A 1VZ0A 2NYXA 1SFXA 2XAJA 4UUSA 3B73A 4A3EJ 3OYIA 4A3KJ 4II2A 1REPC 4XOTA 2HS5A 4YIIA 4FASD 4DJAA 1OMIA 2EZKA 1VQ7I 1WJCA 1AHDP 2CFOA 1FP1D 3F0CA 4A93J 1USTA 2DFHA 4G6DA 3BY6A 1MDMB 3E5QA 1S7AA 3CJRB 3WE3A 3WTTC 3TDZC 4QTRA 1W5CC 5BPIA 1S9HA 1XG1A 4ENJA 2L9NA 1QGPA 2QCOA 1B8IA 3CMMA 4G7ZF 1HW5A 1HKSA 1YE9A 3H92A 5EGOB 4HQMA 5J3LA 2FBIA 5JHUA 1FEXA 2A69F 3CCMI 1PUFB 1ZN2A 2XSJC 1Z05A 5JVTA 2ZNZA 4U0WA 2XGCA 2FEZA 1MMGA 1TQPA 4CSWA 2O6GE 4A2UA 1ETWA 3AG3H 2FSWA 3PFYA 3K4MA 4AVZA 1UZCA 2VN2A 3OYCA 2OV7A 2WV0A 3OMYA 4CCJA 3LSJA 4DIQA 2EIKH 3ZMVA 2H27A 5J1RA 4YEJA 1BI0A 2LSOA 4IPAA 2P4WA 4B48A 1ZQ3P 1MNDA 2JVHA 3CJTB 2XUBA 3QQAA 4H4KC 4C3IJ 1UB9A 4L0ZB 3HZJA 3LSRA 1ONVA 3CMEI 3H9GA 3GVAA 1Z3XA 2IW5A 2W25A 4CH7A 5HNFA 1I5ZA 2W85A 5DS9A 4CYDA 1ZRDA 4DBQA 4PZJA 3RKWA 4FETA 1VQ6I 4UUSB 3A4CA 4BXXJ 2KISA 3LL7A 1ETOA 1Y1VJ 2IXSA 4NQWA 1TBXA 2Z1DA 3FF5A 3PL8A 2FMLA 1RNLA 2FMYA 1O3QA 4HEA2 2Y0SA 2KDZA 3BR1A 4EM1A 2OBPA 2KHMA 3M4OJ 5M5YJ 3JR9A 1U8RA 2EFPA 3I55I 1IN8A 2WC2A 4MEYF 1H8AC 4MTEA 3EYYA 1JKQC 3W6KB 2Z9OA 3ECOA 2JA8J 5D5WB 3JREA 1R4NB 1R9TJ 1Y0UA 1B8IB 2OCCH 4KT5C 2CV2A 3ZQ7A 3UR3C 1XPXA 1D5YA 1HOMA 3CZ6A 1FIPA 1GT0C 2JA6J 2V7FA 3NAUA 3JAMZ 3K70D 4D5CA 5J4YA 3ASNH 2R5YA 2IAIA 4A3BJ 3PIOF 1FTTA 2PJRA 2WTEA 3OL4A 2XROA 2L01A 2R4GA 2W1OA 3ZCOA 2DA1A 1D5VA 2P6TA 3CF2A 2KIUA 3PJRA 3GFMA 2HTJA 1KZHA 4TV7A 3I54A 2KRFA 4Z6YA 2LKXA 2MYSA 3I56I 3QRFF 1FWZA 1BW5A 3O3KA 1BOAA 3A0BC 2DYSH 2DO7A 4ASNA 5K7FA 1W7PA 3TGNA 2F5VA 4IHVA 4HQEA 1ETQA 4BHBA 2R7DA 4D5FA 5DUIA 5EDNA 4XLFA 1SVMA 2FBHA 4P55A 4BXUA 3M9AA 1I27A 1OISA 4MO7A 2O3FA 3JRFA 3RZOJ 4I02A 4A5MA 1HXDA 3O8HA 2CQ7A 2IA2A 2ME6A 5FFXA 3PIPF 5H20A 2JA5J 2JWTA 4NQWB 4MQ9F 2NNNA 1NTCA 2X6OA 2L0KA 4E7JA 1PJRA 3S3OA 4JBAA 3M07A 3E5XA 1LJ9A 2IGMA 3K9TA 3H0GJ 3QODA 4B09A 3L2WA 2E34A 1WI3A 5J40A 4PSXA 4EGZA 2PX9A 2ZBKA 2ZCWA 3UNGC 2IS1A 2F2EA 1RKWA 2ZJ2A 4JQFA 4FHTA 3FXLA 3OSGA 1FPQA 4G9YA 1S7EA 1TW3A 2I5UA 3HPHA 5FLMJ 3OYKA 4Q5SF 1G3TA 5FROA 2ICWG 3W2WA 3JSPA 1Z7UA 2R5YB 3L2VA 3K6GA 4XKCA 3HOWJ 5BS6A 4IHYA 2F5FA 2ELJA 4JX5A 1LFBA 3QP6A 1QHGA 1TTYA 2L5QA 4RM3A 3I9V2 1P7IA 4ABZA 1ACIA 1SFOJ 3ZQGA 5DCFA 1FOKA 4L18B 1FMWA 1HA8A 3T1BA 3AG2H 5BOXA 2VQGA 4ZJZA 3JRCA 1W7PB 2M8EA 4WXDA 2PFBA 3HKZN 1GHCA 3VYUB 1OR7C 4EJVA 2GWRA 2PMZN 2Q8KA 3BC8A 1F1ZA 1RESA 3DEUA 1ETKA 1LDJA 4EM0B 3HIFA 5HOOA 3FXJA 2DJNA 2HXOA 2ZNYA 2P5KA 2VJIA 3B6AA 3K7AJ 1H0MA 3PQJA 5LHGA 4A3DJ 3LA3A 3BQYA 3QWLA 4RLFA 5EEHA 2VXDA 3TOBA 3I71A 2C6YA 2NVTJ 1SD4A 1U6GA 2CW7A 2DA3A 5HLTA 1K4SA 6PAXA 1YHQI 2VKHA 5TISC 3D5LA 4GRIA 2L9RA 4DZJA 1LEAA 1UFMA 4KN7X 1IG7A 4ENMA 3CDHA 2VPLA 1PP8F 2BE5F 2Y9ZA 2ZC2A 1RRJA 1W1WE 1Z77A 4M3GA 3RYPA 3LWFA 3CCVI 1IDYA 3JCUC 3PQKA 4N4NB 2WWYA 4A0YA 1V4RA 4CCLA 4HDVA 3CLQA 4XRSA 4X1EA 2BOLA 3GF2A 3CC4I 1X19A 1O3TA 2M87A 2G7HA 4A3GJ 1G8XA 2E1OA 5LGUA 1JKOC 3S1MJ 1Y56A 3SYTA 5L3BA 1WSUA 3RTRA 1IV8A 1OYIA 3KEQA 4A0ZA 1WH5A 5D8LB 4ON0A 2L02A 3LSKA 3IWZA 3K4NA 4XMYA 2O61A 3BTIA 4IQJA 4LK1F 3U1KA 1Z91A 1I3AA 2K3PA 1U2WA 1USSA 5JR3A 1UELB 1XGSA 1ZARA 1A36A 3DU6A 4O3MA 5D8KB 2R7RA 3V42A 3CCRI 4AYBA 5LD2C 1STZA 4CA0A 4A12A 2IEKA 2LD5A 3Q0VA 1SAXA 3WE2A 1N25A 2V1UA 2CMPA 1R1TA 1XD7A 2CQKA 4A0XA 1HQCA 2Y9YA 1WVRA 2EILH 4Y7NJ 1LDKB 4HLYA 1X58A 3ZN0A 2MA3A 4F3QA 4J01A 3RPUD 2STWA 4C9YA 5JFRA 2M0CA 1X2MA 2YSRA 1I1SA 3F8CA 3QPHA 3E1SA 1X4OA 1EH6A 5IT9Z 2KRCA 2ZXIA 5E3OA 2HDWA 3VFZA 2CH0A 2BY3A 2M30A 1UG0A 4F92B 2H6CA 4BH9A 3PUBA 1RR7A 1ZLKA 1D8JA 3WU1B 1IAWA 3S16J 4HV6A 5D5UB 3GTKJ 3ASOH 1MBEA 1B1BA 1MD0A 2ECBA 2DPUA 2HYGD 4PJJA 1UAAA 5IP7J 2VE9A 1VI0A 3CCSI 5ERIA 2WB1N 3EPZA 2A5WA 3ZQLA 3FMQA 5IPAA 5FJ8J 4BQQA 1YX3A 2MABA 4HF0A 2QLZA 5ICCA 3MZHA 4E7ZA 5HS8A 3J7AY 1YS6A 1YO5C 3PO2J 1X1BA 2FBKA 4R8HA 3CCUI 3IH3A 2P6SA 3L7WA 2DDAA 2XAFA 3MMYB 4Y13A 2OC6A 3JW4A 3QU6A 3COAC 1YIOA 1Y8RB 3FISA 2KIMA 3EDPA 5K7HA 3G2BA 4Y3OA 3S2HJ 1IN7A 2L7FP 5F08A 2IBDA 3HSRA 2QKMB 2EA4A 5FRNA 5IYBJ 3QP5A 1VQPI 3W2AA 3KP6A 4S04A 2EFOA 2AXTC 3ONQA 1XX5A 1TW2A 1P9QC 1JUPA 1R1UA 2K4JA 1G6NA 2X6XA 2CS3A 4RS8A 4AU7A 3JAMK 4ENKA 2CO5A 2FOWA 3A03A 2DT6A 4HSTA 1R36A 1W0UA 2QSHX 2A68F 3EUHA 5HLHA 2HNHA 4UV8A 2UZKA 1YLFA 1FBQA 3DEWA 1PUEE 3GCMA 3OYNA 3KFWX 3P9KA 3PSFA 1MBKA 5IYDJ 3KP3A 1IRXA 3H5NA 2XKPA 4A3FJ 3U9GA 3R0AA 2CJJA 1BI2A 3NQOA 4II3A 4LMYA 4KIGA 1GVDA 3D1NI 1I1GA 2W4SA 3BG9A 4E70A 1VQLI 3SZTA 1W0TA 4DZPA 4A69C 2A6TA 2X1CA 3DBLB 4RGXA 4J00A 1WJDA 3HSFA 1FJLA 4FX4A 3H3VK 2E2JJ 1RPWA 3E7LA 1FYKA 2DMQA 3LFUA
chains in the Genus database with same CATH topology
2L9SA 2DT7B 2M3AA 5KHDA 4CCKA 4II2A 3OYIA 3K4LA 3H0DA 4XORA 4XOTA 4FASD 4DJAA 2X85A 3OR2C 3OYGA 1W36C 1WJCA 3SDBA 4OAYA 3CESA 4HG2A 3AL0C 3OYDA 2CFOA 3VYRB 4LIVA 4BL0B 5TGTA 2VLAA 2RREA 4IX7A 4BACA 4CZCA 2LH9A 2ZSIB 3CJRB 3BLYA 4XL9A 4B3XA 1MW7A 3DWLE 1S9HA 2L9NA 1LVKA 4B43A 3LSMA 4IQ4A 1LFPA 3CMMA 4HPQA 3LSGA 1T95A 2LRDA 3C2HA 1YE9A 3FKJA 3IAS2 2LY1A 3F9KA 4CCMA 3U21A 2Q2EB 4IZZA 4YRVA 2E5ZA 2XSJC 1X1AA 2BW3A 4PJLA 1MMGA 4XLHA 4CCOA 2MC4A 4CSWA 2PJRB 2M0MA 4AVZA 3PFYA 3K4MA 4XKWA 4PK4A 3OYCA 2OV7A 3N05A 3OMYA 4NNJA 5KCMA 3H35A 2OUMA 3OIQA 4CCJA 4DIQA 1N77A 4HSRA 4YEJA 4B48A 1MNDA 2JVHA 3ZQQA 3AKZA 1Z7LA 1U0JA 4H4KC 2I8DA 3H9QA 3MKZA 3H9GA 2V1NA 1Z3XA 2LYCA 3VSLA 4CH7A 5HNFA 4R79A 4P5OA 2XC7A 2M7BA 4LIUA 4DBQA 4DGWB 1Y6IA 4FETA 1NG6A 2DOAA 3A4CA 2GOXB 2VJ5A 4BXFA 3LL7A 2VXZA 3IP4B 2IXSA 4IKFA 3HKZA 2Z1DA 3PL8A 4C2UA 2DXIA 1JI8A 2AQEA 4HEA2 2PMZA 2Y0SA 2F4IA 4HNUA 1D0YA 2KHMA 3OYFA 2VIXA 2RQQA 2IGNA 3S3MA 2E1MB 1EA3A 2WB1A 1WJ5A 2L2OA 3CP8A 3H5RA 4BE2A 4E7HA 4NUBA 4QPQA 2CV2A 2LBFA 3UR3C 1T0FC 4F91B 3CZ6A 3QYFA 1Z21A 3KEYA 4EATA 2V7FA 3TBIA 3VYSB 3K70D 4PUSA 2VKDA 1DGWY 2PJRA 2CV1A 2KLOA 3OL4A 2R4GA 2W1OA 3ZCOA 2BW3B 2KPMA 2AQFA 4F55A 5CPRB 3CF2A 4PJNA 3KX2A 3PJRA 1TZLA 2XF6A 3BG7A 4E6KG 1WJBA 4XLCA 2WAQA 3I3LA 2MYSA 4XONA 2X51A 4D9JA 1V5GA 3D5SC 4OWRB 2KQRA 2IS4A 2M7AA 2VB6A 3FDYA 3SZGA 2F5VA 2V6EA 2K9MA 3RSNA 1D0ZA 4E7KA 4NC7A 4QPOA 3ZRGA 1E0EA 4XLFA 4N4OB 2KRHA 2HQAA 2NOJB 4BQNA 3EUKL 1NG7A 4ZTJA 4XOPA 4NQWB 2VASA 4BUPA 4ITVA 5CQEA 4CCNA 1PJRA 3M1CA 4E7JA 3S3OA 2R7TA 1MMNA 3HG9A 3OYEA 1FMVA 1QHHD 2VJ4A 2VJJA 2IGMA 3FBNB 2MFZA 3QODA 3L2WA 3S32A 1D1CA 3E0JB 4PSXA 4BJ5C 3UNGC 2IS1A 1WJFA 4JQFA 5LFAA 2LBFB 4KT6A 4BQOA 3HPHA 3OYKA 2L7KA 4C30A 3K10A 2KL4A 5FROA 2BVLA 3PNVA 3W2WA 1KONA 2R7WA 3MKWB 1ZELA 5HNHA 3M8JA 3MD2A 3L2VA 1AA7A 3K6GA 4XKCA 2VL8A 3TL4X 2KP6A 2LY2A 3S93A 2ELJA 1N78A 3HUGB 1QHGA 2Z2SB 2L5QA 4RM3A 4CUGA 2R7SA 4BGDA 3I9V2 1X1CA 3K4CA 1ERDA 2VQHA 2LC2A 4HNTA 1FMWA 1HA8A 3L2QA 3KYLA 2VQGA 4KJZA 4ZJZA 2KDOA 3HPGA 2Z16A 3IUOA 2X6YA 3EUAA 4OAZA 5HVQC 2KZVA 2UV1A 3VYUB 1OR7C 3GBGA 4LITA 3C2GA 2ZSHB 3BC8A 2E60A 1GLNA 2XAUA 2LG4A 5HOOA 2IS6A 3EUHC 2IGKA 2VJIA 4ZTFA 2WY7Q 3DPUA 3QOEA 1Z3YA 5KNLA 3DTIA 4RLFA 4BDYA 2VXDA 3PNYA 4U7BA 4NC8A 4PFOA 2CW7A 5HLTA 4B44A 2XDVA 2VKHA 4ZDOA 3K4JA 3L2RA 3D5LA 3ZXSA 4GRIA 2JVGA 3PNTA 2DCEA 3DPLC 2CUZA 4XLEA 4RLQA 3S8PA 2VPLA 4BEHA 2K5CA 2CV0A 3DLAA 1WFXA 3PSIA 4XN0A 2VQLA 3K70C 3SEZA 2IS2A 4ZYAA 2CW8A 3BCBA 4YELA 3DU5A 4N4NB 3QYBA 3OYBA 4CCLA 1SFKA 3D5RC 3OYHA 3LSIA 1MMAA 2BOLA 2F6CA 4BDZA 2UUZA 3HC7A 2M4KA 3H9JA 1X19A 4XKBA 3HOTA 4BU2A 2E1MC 1WJEA 1G8XA 3VSKA 4BE0A 5CKTA 3K4KA 1D0XA 1Y56A 5FRMA 1YX5A 3SYTA 3RTRA 2MD0A 3SEQA 2ZXHA 1QU3A 3NWTA 1DQUA 3OIPA 1D1BA 3DTKA 3LSKA 3W2VA 3K4NA 3FBIB 4XMYA 3VWBA 4IQJA 4ZDPA 1BR1A 3CJQB 2R7XA 3S3NA 2K3PA 4DOZA 4D1QA 2X1EA 4B47A 4BS9A 1UELB 2GOMA 2JA2A 4KITB 3DU6A 2R7RA 2XF7A 3V42A 4AYBA 5LD2C 2R7QA 3LSHA 4CA0A 2R7VA 2Q1ZB 1W36D 4F52A 2CMPA 4E4HA 2UWMA 2WBMA 2JUGA 1SAUA 2E5NA 1LDKB 1PYVA 4BEHB 3HL2A 3BCAA 3DPTA 3OYAA 4F3QA 4J01A 3RPUD 4F93B 2HZDA 4HRIA 4KISA 4C9YA 3CP2A 3K4BA 2HPIA 3FHNA 2V26A 3E1SA 4XM3A 1LKXA 1X4OA 3OS0A 4XNFA 4ZC3A 2KRCA 2ZXIA 4JOMA 4PFPA 2VQCA 2W00A 2HDWA 1BR4A 1V5FA 4BJ6C 2CH0A 2WAEA 4P1WA 1UG0A 4F92B 3OYLA 4Y4RA 1DGRM 1K6YA 2X6WA 3DQVC 4LG3A 3PUBA 3ZR8X 4X0GA 3BG6A 2BVMA 2WAFA 3OR1C 4Y33A 1R6RA 4MLOA 3DKXA 2DJIA 3DEEA 3OS2A 3IAM2 4PJJA 1UAAA 4PJMA 2M4GA 1MNEA 3EPZA 2FUG2 2A5WA 3HXLA 1BR2A 4BQQA 1V5EA 1YX3A 4E7IA 2MABA 2R7UA 1WJAA 5JHFA 2HU9A 2K9LA 4E7ZA 3VYTB 2HPMA 3J7AY 3H5AA 1MMDA 1X1BA 3OWTA 1D1AA 2WADA 2KMUA 3MMYB 3LMMA 2OC6A 4ANJA 2HVSA 2WY8Q 3G2BA 2W7NA 4Y3OA 2V9KA 3A2KA 1J09A 3QYEA 2O5RA 1TT0A 2QKLB 2QKMB 3OOUA 2WA0A 5FRNA 2LREA 2R7OA 4PSWA 2XF5A 3W2AA 4G6TB 4XN3A 1BOBA 4E7SA 1X4PA 5CQGA 3ONQA 1P9QC 3TMOA 2V4JC 4BJTA 3HOSA 2X6XA 2CS3A 4RMNA 3RQ4A 4AU7A 2P0WA 4XKVA 3W3CA 2HVRA 2DT6A 4HSTA 3ZGKA 3OY9A 4XR6A 3VDXA 2IGOA 2HVQA 3NWSA 2CUJA 3DKYA 2W82A 2HNHA 2RNGA 1N75A 1G59A 3AL0B 2JSPA 4DBRA 3OYNA 4U87A 3PSFA 4C2TA 1IRXA 1X1DA 3A1YA 2X1DA 3H5NA 4XLAA 3RCOA 3OS1A 4II3A 1DP3A 2W4SA 4XQFA 3AFHA 3DTEA 3L2UA 2LOOA 3OL3A 3OYJA 2A6TA 2X1CA 4ZDLA 4RM2A 4J00A 1OLTA 1WJDA 4BE1A 2ZFUA 3OYMA 4E7LA 3LFUA 3MKYB 1VZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RRE A; 
#chains in the Genus database with same CATH topology
 4FX0 A;  2VPR A;  5EF6 A;  2ZME C;  1S3J A;  5AON A;  3KYC B;  2DT7 B;  2HXI A;  2M3A A;  1QPI A;  3K4L A;  1HDP A;  4XOR A;  5F1R A;  4XRM A;  4FCY A;  4UB8 C;  4BBR J;  2IP2 A;  1W36 C;  3SDB A;  3CCJ I;  3LOC A;  2JT1 A;  3CES A;  1ZRC A;  2DPD A;  2GM4 A;  4HLX A;  3IC7 A;  2EFN A;  1VQM I;  2VLA A;  4I0A A;  4KN4 X;  2LH9 A;  2VBW A;  5DM7 F;  4FQG A;  4XL9 A;  4B3X A;  1ZYR F;  3DWL E;  5DEQ A;  3LQR A;  2VON A;  3LSM A;  2M45 A;  2BBY A;  1TLH B;  3LSG A;  3WTS C;  2F48 A;  2EFQ A;  4XRS G;  3WU0 A;  3W6V A;  3WGG A;  3E6D A;  3JTG A;  3IAS 2;  1JHH A;  1WQ2 A;  2XB0 X;  3QAH A;  1LEB A;  1B72 A;  2E1N A;  3FIW A;  4B1R A;  4YRV A;  1HW2 A;  2FQ4 A;  2MSY A;  4JK1 X;  4EMS A;  1X3W B;  2LKS A;  2YX7 A;  3K2Z A;  1YJ9 I;  1TNT A;  2O03 A;  2BW3 A;  3VPR A;  4XLH A;  5GAG J;  1JT0 A;  1Z9C A;  2BV6 A;  2OF7 A;  3DFG A;  4PK4 A;  5GP9 A;  1KA8 A;  4NNJ A;  1N77 A;  2BEO A;  5ICF A;  3I4M J;  4W1U A;  4EGY A;  1ITY A;  4GYI A;  1DPR A;  4HSR A;  1BIA A;  2XV4 S;  2FNA A;  4O6J A;  5IP6 A;  2HDC A;  3WG9 A;  3ZQQ A;  3HJE A;  3AKZ A;  1K79 A;  1ZAO A;  2LNB A;  5IY5 H;  1TC3 C;  2MH2 A;  3H9Q A;  3MKZ A;  1GXQ A;  3K1P A;  4RB2 C;  2GZW A;  2XC7 A;  1R71 A;  4LIU A;  2OTJ I;  1Y6I A;  1NG6 A;  3M3Y J;  2DOA A;  3BR3 A;  1PP7 U;  3CLO A;  5FKO A;  2DMT A;  4QSH A;  2Z3Y A;  2VXZ A;  2LMD A;  2R5Z A;  3GTG J;  3E3V A;  2XGE A;  1SEU A;  3B02 A;  1WH7 A;  2KIQ A;  2XAH A;  2EH3 A;  2OAZ A;  3OYF A;  2XAS A;  4BY7 J;  2RQQ A;  2R93 J;  2QGU A;  4KMU X;  4XSX F;  1VQ9 I;  3CP8 A;  2K4B A;  3H5R A;  4J19 A;  2DA7 A;  3Q9S A;  2LBF A;  1DDN A;  4F91 B;  2IA0 A;  2B0L A;  1XCB A;  2OU2 A;  1B72 B;  5FLV A;  3QYF A;  1Z21 A;  4EAT A;  3TBI A;  1POG A;  2ME0 A;  2VKD A;  5EEA A;  5E1X A;  4I76 A;  2KLO A;  2VKV A;  2O8X A;  2BW3 B;  1D3Y A;  3HUG A;  2AQF A;  3U1D A;  1G4D A;  2DA5 A;  3DLL F;  2K3F A;  1KU7 A;  2XF6 A;  2D45 A;  3S1Q J;  4E6K G;  1OJL A;  2QUF A;  4XLC A;  2VUM J;  2GIZ A;  1Y8Q B;  2LR8 A;  5KVR A;  1FOX A;  2X51 A;  3GLL A;  4D9J A;  1W4M A;  3K1N A;  2D1V A;  2OPT A;  3GTO J;  1J7K A;  4OWR B;  2W48 A;  3RZD J;  1QZZ A;  2HFH A;  3FDY A;  1R22 A;  3SZG A;  3HB9 A;  4R1H A;  1O4X A;  5ILV A;  2K9M A;  3RSN A;  1MBF A;  5B3S H;  3ZRG A;  4B4C A;  4N4O B;  3FM5 A;  1R23 A;  4M71 A;  2HQA A;  1A35 A;  2H8R A;  1LVA A;  2FOK A;  3AG4 H;  4I09 A;  2X9D A;  5F0H A;  1W5T A;  3BR0 A;  2TRT A;  5B66 C;  1IXC A;  3V4G A;  2R5Z B;  4XOP A;  4OIO F;  1OCP A;  1HC8 A;  2BYV E;  3ZMD A;  4LD5 A;  5FKL A;  1T38 A;  2TDX A;  4CCN A;  4EQQ A;  2R7T A;  1MMN A;  1MSF C;  3OYE A;  4EJT A;  1FMV A;  1X3Z B;  4HYE A;  3FBN B;  1FBS A;  4EV0 A;  3BTC A;  1U5T A;  2VE8 A;  1D1C A;  3E0J B;  3GLX A;  4BJ5 C;  1R7J A;  1JHF A;  2LKP A;  3BQZ A;  3J81 K;  3M8F A;  5IYC J;  2BHY A;  5LFA A;  2EWN A;  2LBF B;  3N97 A;  3MFK A;  3NEU A;  4HNV A;  3CTA A;  4GFB A;  2L7K A;  4C30 A;  4RGU A;  2KL4 A;  5B5E C;  2BY2 A;  4HX7 A;  1IUF A;  4N9I A;  5HDK A;  5IT9 K;  2JUC A;  3M8J A;  3KP2 A;  5CJ9 A;  1AA7 A;  3BZ6 A;  1SC7 A;  3TL4 X;  2KP6 A;  3S93 A;  3GTQ J;  1N78 A;  1E17 A;  4C3J J;  3DCF A;  2DT5 A;  3HUG B;  5J1U A;  4CUG A;  1XGO A;  2OQR A;  4BGD A;  3MEX A;  5K5O A;  1J0R A;  3L00 A;  4BHC A;  2HYJ A;  2EK5 A;  1ZGJ A;  5HOD A;  3CJN A;  1FNN A;  3MZ8 A;  1UMQ A;  2XB5 A;  1FBU A;  1YOV B;  1RKT A;  3HPG A;  1OCR H;  2Z16 A;  5A2Q Z;  2X6Y A;  4OAZ A;  5FLX Z;  2UV1 A;  2OZ6 A;  2P5V A;  2M2E A;  4RAF A;  3C2G A;  2ZSH B;  1I6X A;  2Y0S N;  3QOP A;  4HAM A;  1OCZ H;  5FKK A;  1TP4 A;  1ENH A;  3BDD A;  2LG4 A;  3IV5 A;  5LEJ A;  2IS6 A;  3EUH C;  2IGK A;  1VTN C;  4UVB A;  5H6Q A;  4HDU A;  3GTL J;  3TQN A;  3S2W A;  3SDG A;  1GV5 A;  1A31 A;  1EKE A;  4IF4 A;  4BDY A;  3KP4 A;  1B6A A;  4RA2 A;  3LAJ A;  4NC8 A;  4V19 K;  4KMF A;  3O2P E;  4B44 A;  1U5T B;  3MWM A;  5J8C A;  3L2R A;  4UUV A;  3ZXS A;  3DPL C;  2CUZ A;  3TDU C;  4BKX A;  2OQG A;  4XLE A;  5F1J A;  1W7P D;  4I0B A;  3C18 A;  4L0Y B;  3P9C A;  2K5C A;  3WGI A;  1JKP C;  1J5Y A;  2VQL A;  1OYY A;  2AO9 A;  3SEZ A;  4ETS A;  3DBH B;  2MD5 A;  3SZP A;  2KJB A;  2ECC A;  3U2R A;  4YEL A;  3DU5 A;  4AIH A;  2HZT A;  3HRT A;  3KZY A;  3OYB A;  5LRR A;  2ESN A;  5L3E A;  3LSI A;  4BDZ A;  1DP7 P;  1XDU A;  3WTU C;  2J5O A;  5H6R A;  5KAF C;  3RKY A;  3BWG A;  2EZL A;  3WTW C;  2M4K A;  4HBL A;  1ZG3 A;  4YFK F;  1R58 A;  2Y30 A;  3RKQ A;  5KK1 A;  1YW7 A;  3V8J A;  1O7F A;  4Q47 A;  2RDP A;  4NB5 A;  3ZMU A;  1WJE A;  1IGN A;  5TRD A;  3FXQ A;  3HRM A;  2QSG X;  2F4M B;  2K86 A;  2LTP A;  3K4K A;  3Q3S A;  5FRM A;  1SVL A;  2EV0 A;  4M6X A;  3ZOB A;  4WXH A;  4IOC F;  2VOP A;  4MNU A;  1BA5 A;  1OYW A;  2QQ9 A;  5E1W A;  3SEQ A;  3F72 A;  1QU3 A;  3I64 A;  2ESH A;  2UXN A;  3WGH A;  3DTK A;  2VKE A;  4CHU A;  1XMX A;  5KAI C;  3I53 A;  3FBI B;  2JJ7 A;  4FIS A;  4IO9 F;  3RQI A;  1NK3 P;  1BR1 A;  2DTR A;  3CJQ B;  4L5J A;  4GCV A;  2R7X A;  3BT9 A;  2PN6 A;  4FE4 A;  1KQ8 A;  2LF8 A;  4IXA A;  3FMS A;  4LLG F;  1BJZ A;  2X1E A;  3IHU A;  2E36 A;  4BS9 A;  3ZQC A;  3F8M A;  1XN7 A;  4KIT B;  2Y31 A;  2NAZ A;  4CO8 A;  1LPQ A;  2L7M P;  3JRD A;  2XSD C;  1ZH5 A;  3LSH A;  2L4M A;  3LA7 A;  2VI6 A;  2ZJR F;  1DU0 A;  1JT6 A;  2R7V A;  5L3C A;  2Q1Z B;  3MQ0 A;  1W36 D;  4F52 A;  2RNJ A;  3ERE D;  1JJ8 C;  5J6X A;  3BJO A;  1GVJ A;  3ABM H;  3KCC A;  2E5N A;  4L9N A;  4DW6 A;  5E20 A;  3HL2 A;  4KIC A;  3KZZ A;  3DPT A;  3CMA I;  5B1A H;  5CVJ A;  5C4X J;  4LGW A;  2W84 A;  1F5T A;  1B59 A;  3J80 Z;  2HZD A;  4I98 B;  4C3H J;  2IT0 A;  4AID A;  2ZME A;  2H6B A;  2HPI A;  3B6C A;  4A3J J;  1VQ4 I;  2V26 A;  2O0Y A;  3BOQ A;  1E3P A;  3PFI A;  4PFP A;  4JOM A;  3CCL I;  2VQC A;  5LRS A;  4IHW A;  4ZYH A;  1V5F A;  3V8K A;  2XAG A;  3VB2 A;  2A6E F;  4AIK A;  2HEO A;  1K6Y A;  3F8B A;  2VC0 A;  2I10 A;  2QM3 A;  3DQV C;  3E6M A;  3ZR8 X;  1JE8 A;  2DLL A;  3EET A;  1QQI A;  5DCM A;  5GAE J;  5ILS A;  2Q0O A;  1L3L A;  2WAF A;  3OR1 C;  2JN6 A;  4LB5 A;  5DV5 A;  3OV8 A;  2DJI A;  3R61 A;  3HOZ J;  1WKM A;  3OS2 A;  2ZKZ A;  4PJM A;  3Q0W A;  4D7M A;  1MNE A;  2Z5U A;  2BXY A;  5LHI A;  4B8X A;  5E3N A;  3T5X A;  2FF4 A;  1BR2 A;  4A3C J;  4PCQ A;  3IRQ A;  5CLS A;  4YFX F;  1IXS B;  5M3F J;  3G1O A;  3HOV J;  2D5V A;  1IO2 A;  2QQB A;  4UV9 A;  2HU9 A;  3VYT B;  2K9N A;  2ZJP F;  3N4M A;  3SJM A;  3BR2 A;  3L1P A;  2B9S A;  2E1C A;  2Y75 A;  4O5V A;  4BAY A;  5IOY A;  1XMK A;  3KPH A;  1O57 A;  1P92 A;  3LMM A;  1TQI A;  2DQL A;  4QLC U;  3ULQ B;  1YYV A;  2W7N A;  3E6B A;  1H9G A;  2V9K A;  4MTD A;  1LB2 A;  5EEG A;  1UG2 A;  3QYE A;  1DUX C;  1TT0 A;  2A61 A;  2QYO A;  2IVM A;  1B9M A;  2STT A;  3H36 A;  2XF5 A;  2QA4 I;  4G6T B;  5E1Z B;  2V1X A;  3T8R A;  2EV6 A;  4M72 A;  5CQG A;  3HHH A;  2WAQ N;  4CDG A;  3CD6 I;  4BJT A;  2COB A;  2JRT A;  2V4J C;  1KYZ A;  2DQR A;  2G9W A;  3I58 A;  4UVA A;  4XBF A;  1EF4 A;  4L9T A;  3RQ4 A;  2ZME B;  2P0W A;  2HVR A;  1MKM A;  4RB3 C;  3ZGK A;  3HOU J;  1IUY A;  2IGO A;  3NWS A;  3IKT A;  1A5J A;  1T2K A;  2CUJ A;  2Q2E A;  3S1N J;  4DYQ A;  2QZ8 A;  1MSE C;  5K5R A;  1XDS A;  4U87 A;  2GIV A;  2K27 A;  3TW7 A;  1R5G A;  1LNW A;  5DCM B;  1OCC H;  4XLA A;  1U5T C;  2L4A A;  1ZGW A;  2HR3 A;  4YIF A;  3BP8 A;  3CDL A;  1DP3 A;  4NBQ A;  1QZY A;  1LE8 A;  2P7V B;  4PDK A;  3F3X A;  3J7Z I;  1S8N A;  3DTE A;  5CVI A;  3L2U A;  2LOO A;  1O7L A;  3E97 A;  4F7Z A;  1A6Q A;  2V1D A;  5D5X B;  2CSO A;  4CXF A;  1T56 A;  4AYB N;  4YFN F;  3GZ6 A;  3JRG A;  1OLT A;  1S29 A;  2ZFU A;  3K1M A;  3OYM A;  3CO6 C;  1MH3 A;  3CCY A;  1JTX A;  2OCE A;  3MKY B;  2L9S A;  1QBJ A;  1K6O A;  3TO7 A;  2PI0 A;  1Z1D A;  3CCE I;  4XSZ F;  5HS9 A;  2X85 A;  3OYG A;  2NRA C;  2KZG A;  5EZG A;  4ESF A;  2JA7 J;  4HG2 A;  3AL0 C;  1DU6 A;  3REO A;  2IPQ X;  3GX4 X;  3VYR B;  2DDB A;  4LIV A;  4NHJ A;  1V54 H;  4P96 A;  4AM3 A;  4XIC A;  3PUF A;  3BLY A;  1S7O A;  3O8G A;  1ETV A;  1MJB A;  3GZN B;  1WPK A;  1IN5 A;  3CC7 I;  4UVC A;  1MBJ A;  1R5H A;  1MW7 A;  3IKV A;  1FSH A;  3SHF A;  3DBR B;  1LVK A;  4B43 A;  5HLG A;  4IQ4 A;  1YG2 A;  3MCZ A;  1YI2 I;  1LDD A;  2LRD A;  1XMA A;  3GZ5 A;  3SXY A;  3C2H A;  1VFC A;  2LY1 A;  2XIG A;  1X3U A;  1Y39 A;  1XB4 A;  2Q2E B;  4IZZ A;  4H0E A;  5LGN A;  2MBF A;  1ULY A;  1FC3 A;  4PJL A;  3HRS A;  5DD4 A;  3KIO A;  1HKT A;  3HEF A;  1VQO I;  2BXZ A;  5KCM A;  3OIQ A;  2CRG A;  5DTD A;  2ISY A;  1LE8 B;  3G73 A;  5FD6 A;  3F21 A;  1ODD A;  3IWF A;  1R5I D;  1GUU A;  3C1D A;  2E71 A;  4JP0 A;  2V1N A;  4R79 A;  4P5O A;  4WCG A;  4HX8 A;  2M7B A;  4DGW B;  5GPC A;  1V3F A;  1P4W A;  2IRF G;  2GOX B;  2B63 J;  3GW2 A;  1CGP A;  2D2W A;  4PGG A;  2QBY A;  3Q9V A;  2EZH A;  2P8T A;  3IP4 B;  1FYM A;  4I01 A;  2DXI A;  1JI8 A;  3V7C A;  2XVC A;  4M74 A;  2GXA A;  1UCR A;  2D1H A;  1AU7 A;  1KU2 A;  2IGN A;  2E1M B;  2WB1 A;  1WJ5 A;  3DP7 A;  2V9P A;  2ZB9 A;  2RKH A;  3BJA A;  3VOD A;  3WOD F;  2L2O A;  2V9V A;  4BE2 A;  2VBZ A;  4GXO A;  4E7H A;  2DBB A;  3BG3 A;  3EQL F;  4NUB A;  4QPQ A;  1QRY A;  3D0S A;  2W24 A;  1ON1 A;  1NH3 A;  3MAJ A;  2MW8 A;  1XSX A;  3VYS B;  1YJW I;  2CGP A;  3RPQ A;  1MJA A;  4ZYD A;  1DGW Y;  2PLY A;  2ZJQ F;  5EG0 A;  2EIJ H;  4F55 A;  1YQA A;  2QSF X;  5CPR B;  5LBQ A;  4PJN A;  1ZR2 A;  1K78 A;  3C2B A;  1ZR4 A;  4D7N A;  1TZL A;  3BG7 A;  4IHS A;  2LF7 A;  3I3L A;  4XON A;  2NOG A;  4WX9 A;  4L9V A;  1V5G A;  3GXO A;  1FTZ A;  1BN5 A;  2HOA A;  4DQ2 A;  3P9I A;  1C0W A;  2IS4 A;  4X6A J;  1XC5 A;  1HKQ A;  1MBG A;  2PMU A;  3S15 J;  1ZKG A;  1X2N A;  2CUF A;  5L3D A;  4E7K A;  4NC7 A;  4QPO A;  1E0E A;  4BYY A;  2VT2 A;  2ISZ A;  3I59 A;  1JKR C;  2NOJ B;  4BQN A;  3EUK L;  2QBY B;  1ZGA A;  1NG7 A;  5D6E A;  1JUS A;  4ZTJ A;  2H94 A;  2MGQ A;  4IOA F;  3TO6 A;  2VAS A;  1Z0X A;  3G71 I;  4A3L J;  3CUO A;  2PQ8 A;  4OIN F;  3ZP5 A;  1R49 A;  4ITV A;  5CQE A;  4RBO A;  3K69 A;  1FT9 A;  4KDP A;  4WK8 F;  2XGX A;  3JTH A;  1QO0 D;  1QHH D;  2FQ3 A;  4BQA A;  3OSF A;  2MFZ A;  2R7Z J;  5BPD A;  4M3F A;  3S32 A;  1P7J A;  2PG4 A;  3ZQI A;  2F4O B;  2RVC A;  4EEF G;  4ZZD A;  1ETY A;  3Q0U A;  4IRI A;  2FXA A;  5E17 F;  2LK2 A;  2VBY A;  5ICG A;  4KT6 A;  4BQO A;  1IN4 A;  5AIP A;  3K10 A;  4OU0 A;  3TP3 A;  5IP9 J;  3CQZ J;  1ZEL A;  5EZH A;  5HNH A;  2CUE A;  5F64 A;  2VL8 A;  2DW4 A;  2LFB A;  1KGS A;  3KZI C;  5JLX A;  4M73 A;  2XAQ A;  3TKY A;  4XLN F;  1GV2 A;  3HBL A;  5EG0 B;  4RB1 A;  4QWQ A;  5DD8 A;  2KFD A;  2Z2S B;  2R7S A;  4M3E A;  1K78 B;  1X1C A;  3K4C A;  4M3D A;  5TJJ A;  4LOC A;  1ERD A;  2E35 A;  3CMY A;  4AIJ A;  2LC2 A;  3VOE A;  4HNT A;  3HDD A;  4P9F A;  1K7A A;  1Z67 A;  3QPT A;  1CF7 A;  3F22 A;  2FJ1 A;  2KDO A;  2E19 A;  3IUO A;  2KZV A;  3RYR A;  4LIT A;  1FP2 A;  2RN7 A;  1BC7 C;  2K9Q A;  3I59 B;  1A6I A;  5D5V B;  2E60 A;  1U78 A;  2XAU A;  1XCV A;  3PM1 A;  2AS5 F;  3FXK A;  1VF9 A;  1IJW C;  1FYL A;  2BZT A;  4CZZ A;  4ZTF A;  2Y0M A;  1OPC A;  2WY7 Q;  2VOD A;  1IDZ A;  4GYG A;  5LLQ A;  4BBS J;  2COM A;  2O9L A;  4ESJ A;  2JQ7 A;  1Z3Y A;  5EJC A;  5KNL A;  3HRU A;  5E3M A;  1E3H A;  4L9J A;  4AD9 A;  1H88 C;  4U7B A;  2AHQ A;  4PFO A;  4U0V A;  1MJ9 A;  1PVE A;  3FZV A;  2XDV A;  4ZDO A;  4EJU A;  3K4J A;  2JVG A;  3PNT A;  2DCE A;  3R6S A;  1P6R A;  2XPW A;  1AKH A;  2NNY A;  1G2H A;  2IA1 A;  2CV0 A;  4UUT A;  1RUO A;  3H1C A;  1OCT C;  3PSI A;  1TWG J;  4XN0 A;  3BPX A;  1JGS A;  2IS2 A;  1F43 A;  1KYW A;  2CW8 A;  2MC3 A;  5GAH J;  1ZG1 A;  1Q1H A;  3ISP A;  1RR8 C;  3GTP J;  2JZY A;  3F6O A;  1RIO H;  4XRF A;  3QYB A;  2TCT A;  2EA2 A;  3V7S A;  1SFK A;  3D5R C;  3OYH A;  1MMA A;  2OA4 A;  1MGT A;  4I7H A;  3LFK A;  4L5E A;  4U88 A;  3ABU A;  2FNP A;  3S2D J;  2UUZ A;  1SD5 A;  3HC7 A;  2ETH A;  4XID A;  3MVP A;  5D4R A;  3CUQ C;  4HOB A;  2E1M C;  3EYI A;  1RUN A;  5FB2 A;  4XLP F;  1MZB A;  1ORK A;  4BE0 A;  1CF7 B;  2VOO A;  3ECH A;  4AVP A;  3CF5 F;  3K2A A;  2YUS A;  5F04 A;  1IRG A;  4GO1 A;  2ZXH A;  2G0E A;  4LJZ F;  2GA1 A;  1D1B A;  5AIQ A;  4MFE A;  3W2V A;  2GAU A;  4Y17 A;  3A01 A;  1ETX A;  1BW6 A;  3VWB A;  2XRN A;  3A02 A;  5M5W J;  1T0F A;  4U0Y A;  3S3N A;  4C2M J;  1G3Y A;  2E7X A;  3BZK A;  4KNY A;  1X1P A;  2GOM A;  1IW7 F;  1YFH A;  2MLK A;  1H89 C;  2P7C B;  2X4H A;  5CVR A;  3LSP A;  1EH7 A;  2EZI A;  2G7U A;  1QNT A;  4G6Q A;  2ELH A;  3KET A;  4E4H A;  2J5P A;  1TQM A;  4RGR A;  1SD7 A;  3I0T A;  3AAF A;  5CVV A;  2R7F A;  4ZH4 F;  1BI3 A;  2GLO A;  1BM9 A;  1AKH B;  1PYV A;  4HV5 A;  1YJN I;  3BCA A;  4LG0 A;  3OYA A;  4CGZ A;  4G7O F;  2X48 A;  3BPV A;  4LLL A;  3HOX J;  1TWC J;  2NVY J;  2O7O A;  4HRI A;  1F36 A;  1JGG A;  4BY1 J;  3K4B A;  3V7R A;  1FOY A;  3FHN A;  1LKX A;  5LHH A;  5J8F A;  1RI7 A;  2L3D A;  1XSV A;  2EPF A;  4ZC3 A;  2QQ8 A;  2QVO A;  2W00 A;  4JX6 A;  5E79 C;  4GGG A;  1IRZ A;  3MZY A;  2WAE A;  1QVT A;  1VND A;  3OYL A;  4Y4R A;  1DGR M;  3BR5 A;  3BG6 A;  3T8T A;  1MIJ A;  2BHZ A;  3DKW A;  1YIJ I;  4MLO A;  3DKX A;  4MGR A;  9ANT A;  3DEE A;  1U3E M;  3C3W A;  1TL8 A;  1LFU P;  4Q48 A;  5LGT A;  1HW1 A;  3A01 B;  2E2H J;  3SQN A;  5BNG A;  2FUG 2;  2HTS A;  3HXL A;  3KLO A;  2ACJ A;  3R0J A;  1YW9 A;  5CVU A;  5K7Z A;  1QZE A;  1V5E A;  2JRM A;  5DUK A;  2RAE A;  1Z6T A;  1WJA A;  3KYD B;  5F27 A;  5JHF A;  2ZXJ A;  3H5A A;  4B3A A;  1FLI A;  5EYR A;  3OWT A;  2WAD A;  2DAO A;  4D0P A;  4AWX B;  1SFE A;  2H1L A;  1RC9 A;  2WY8 Q;  3FXR A;  2EBI A;  4FT8 A;  1T6S A;  4NC6 A;  3OOU A;  5JLW A;  3LAP A;  1XTA A;  2LRE A;  2R7O A;  4KIF A;  3R4K A;  4WWC A;  1I50 J;  4AUX A;  4E7S A;  1X4P A;  2K7L A;  3FXM A;  4LG0 B;  1ZLJ A;  1YTY A;  3E6C C;  1Y1W J;  4K2E A;  2UXX A;  2N8G A;  2RQP A;  2Z33 A;  4RMN A;  3W3C A;  4XKV A;  3F8F A;  5GTI C;  4XR6 A;  4V2G A;  3VDX A;  2KKO A;  1B9N A;  2M5W A;  5GTH C;  5J4V A;  5K5Q A;  2QQA A;  4FE7 A;  2RNG A;  3AL0 B;  2NVU B;  1YS7 A;  4S0H B;  2H09 A;  4C2T A;  3A1Y A;  3RCO A;  2GQQ A;  3OS1 A;  4MEX F;  3S1R J;  1HSJ A;  5ED4 A;  4ENN A;  4LB6 B;  5DYM A;  3F6V A;  3AFH A;  3SFI A;  4XQF A;  2PJP A;  3OL3 A;  4FTH A;  1I39 A;  2DK8 A;  3BR6 A;  4N9H A;  2O8K A;  3ZN1 A;  3ABL H;  3LST A;  4ZYE A;  5GAD J;  2DYR H;  3NAR A;  1LQ1 A;  4LFU A;  2EQR A;  3MN2 A;  3ABT A;  3OIO A;  1SMY F;  4CCK A;  5KHD A;  1SMT A;  3H0D A;  2HQN A;  4MFD A;  1O3S A;  3DF8 A;  3OR2 C;  4RAG A;  1UJ8 A;  4OAY A;  3RDI A;  3IRR A;  3OYD A;  1SD6 A;  3FM3 A;  4BL0 B;  1WZ2 A;  5TGT A;  2F5D A;  2RRE A;  4IX7 A;  4BAC A;  4CZC A;  1TWF J;  2ZSI B;  1BJA A;  3RJP A;  5ILU A;  4Y52 J;  4IRH A;  4PGH A;  2NVX J;  2L7Z A;  1APL C;  1F4K A;  1IN6 A;  2HDD A;  3GFI A;  2LVS A;  3QPS A;  2E2I J;  1LFP A;  2EIM H;  3ML6 A;  4HPQ A;  2V6C A;  1R00 A;  1T95 A;  4V2F A;  2A3S A;  1R4M B;  3FKJ A;  1J59 A;  2R92 J;  3F9K A;  4CCM A;  4G7H F;  3U21 A;  1I6H J;  1DPU A;  4RGS A;  2XGD A;  4ZZL A;  5F0F A;  1SFU A;  2AXL A;  2NXN B;  3G3Z A;  1P4X A;  2DMU A;  1BI1 A;  2M1B A;  2E5Z A;  3M8E A;  1WHU A;  2HGC A;  5DDG A;  5ICE A;  2CWE A;  1IV6 A;  1WCM J;  3S14 J;  4KUM A;  1U9O A;  1X1A A;  3H3Z A;  5E3L A;  4CCO A;  2PJR B;  2MC4 A;  4PJ0 C;  2ZXW H;  2M0M A;  4XKW A;  2H1K A;  4Z2Y A;  3KE2 A;  3N05 A;  2OUM A;  2L9V A;  2R3S A;  3H35 A;  4UHT A;  2OTL I;  3P5J A;  3TP0 A;  4EVI A;  1Z7L A;  3E5U A;  1UHW A;  1U0J A;  2I8D A;  1KQ9 A;  1OFC X;  3DV8 A;  1IRF A;  1RET A;  4AC0 A;  2HYF A;  5F0C A;  2LYC A;  3VSL A;  1XGM A;  1HBX G;  4RAY A;  2QWW A;  2RGV A;  4MHG A;  1EH8 A;  5IT3 A;  3FK7 A;  2VJ5 A;  4BXF A;  3SFZ A;  2DU9 A;  1HCR A;  1GDT A;  1M1E B;  2YR2 A;  3WG7 H;  3HKZ A;  3RKX A;  1XSD A;  4I99 C;  4C2U A;  4IKF A;  4OIP F;  2AQE A;  2GBY A;  4XK4 A;  4A3I J;  2PMZ A;  1KQ0 A;  2F4I A;  4HNU A;  1D0Y A;  3LA2 A;  4CYC A;  1TT5 B;  2M9H A;  1S5L C;  2KJC A;  4EJO A;  2VIX A;  3S3M A;  1EA3 A;  1E2X A;  2Z99 A;  3FX3 A;  1R1V A;  3GFJ A;  1MH4 A;  2HWV A;  1HLV A;  1IC8 A;  4HF2 A;  5F6F A;  1T0F C;  4HA8 A;  1O3R A;  2OD5 A;  4M9S A;  2P81 A;  3KEY A;  1ZHF A;  4PUS A;  5FO5 A;  1BBY A;  3RIR A;  1G3S A;  4IHX A;  5L3G A;  2CV1 A;  5IOZ A;  3WHC A;  2MLG A;  2KPM A;  4M6Y A;  5FKM A;  5HS7 A;  1YIT I;  1I3Q J;  1HDD C;  3KX2 A;  2FX0 A;  1MBH A;  1WJB A;  4Y15 A;  2WAQ A;  2L54 A;  3GME A;  2Y69 H;  1JXS A;  3D5S C;  3F23 A;  1ZRF A;  2KQR A;  1RZ4 A;  2YX4 A;  5E18 F;  2M7A A;  2VB6 A;  1S72 I;  2LDU A;  2OJE D;  1XGN A;  3JSO A;  2V6E A;  3KEO A;  4P9U A;  3QU3 A;  1K4T A;  1D0Z A;  4UY8 I;  1T8I A;  2ID6 A;  2HKX A;  5FD5 A;  5FKN A;  2KRH A;  4OOI A;  3QPL A;  3G6E I;  2JTV A;  2DK5 A;  4QIW N;  2R0Q C;  4EJW A;  4BUP A;  2HOE A;  3TW6 A;  3PO3 J;  2ZFW A;  2MG4 A;  1P2F A;  3I5U A;  3CUQ A;  2RC4 A;  4M9Z A;  4CYC B;  3M1C A;  4UB6 C;  4HZF A;  3GTJ J;  3HG9 A;  2EIN H;  3TOA A;  2PEX A;  2VJ4 A;  2VJJ A;  3WU2 C;  3IH4 A;  3O6B B;  2NS7 A;  2LY9 A;  2DA2 A;  3LNQ A;  3BZC A;  4KA4 A;  1WJF A;  1IXR C;  1IZ1 A;  3HGG A;  3C7J A;  1WWX A;  3GUD A;  1Q1V A;  4Q4Z F;  3ZPL A;  2E7W A;  4ZYG A;  3GTM J;  1HST A;  1E3O C;  2BVL A;  1QA6 A;  3PNV A;  4M3B A;  1KON A;  2CG4 A;  1TWA J;  2R7W A;  2ID3 A;  2VT3 A;  4IRG A;  3J81 Z;  3MKW B;  2YU9 J;  1JUM A;  4U7D A;  3MD2 A;  1T33 A;  2CQN A;  1GXP A;  3LQQ A;  5FGM A;  2DFF A;  3KP5 A;  2LY2 A;  5JVG F;  3G1L A;  3CC2 I;  3BTL A;  1FIA A;  2ELK A;  3MKL A;  1BL0 A;  4YIR X;  3M7G A;  3ZQF A;  1Z6R A;  3HHG A;  4M6V A;  2VQH A;  5A2Q K;  2GXG A;  2YU3 A;  5FLX K;  2WV1 A;  1VQ5 I;  1S6L A;  4IEJ A;  3HGY A;  4UNO A;  3L2Q A;  3KYL A;  5M3M J;  4KJZ A;  1TNS A;  1VQN I;  3ELK A;  1WGX A;  1OQY A;  1WI9 A;  3EUA A;  5HDN A;  1FX7 A;  3VEP A;  5HVQ C;  2EFW A;  3HSE A;  3GBG A;  3RPU A;  5B1B H;  2FE3 A;  1EJ9 A;  1AOY A;  4BNC A;  5C44 J;  4UXN A;  3T0Y A;  1GLN A;  2K02 A;  4BHP A;  5C4J J;  5E8G A;  2M8G X;  3ZMS A;  3I4N J;  5CYV A;  1ZTR A;  1WRJ A;  3J7Y J;  2XHK A;  4IVN A;  2CU7 A;  3NRV A;  2DA6 A;  3DPU A;  3QOE A;  3HOY J;  5D4S A;  3DTI A;  2OZU A;  3CUQ B;  3Q5F A;  3PNY A;  3ZMT A;  2DTZ A;  2KIF A;  5GPA A;  1T39 A;  4G12 A;  2PMH A;  3A0H C;  4DYC A;  5LEK A;  1OCO H;  4KFC A;  3M1E A;  3HTS B;  2K85 A;  2HOT A;  1H9T A;  4RLQ A;  3S8P A;  3FMR A;  4BEH A;  3J7A O;  3HTU A;  3UKG A;  2DA4 A;  2JPC A;  3DLA A;  1KU9 A;  1WFX A;  5L3F A;  2JK3 A;  1J75 A;  2FD5 A;  3K70 C;  2FU4 A;  2H8W A;  1J2X A;  4ZYA A;  3BTJ A;  1IF1 A;  3BCB A;  3TO9 A;  1YRN A;  2CFX A;  2F5C A;  2CQX A;  3H3U A;  3JRH A;  3GYH X;  2F6C A;  1F9N A;  2IJL A;  2JMW A;  4RAZ A;  3ESW B;  2A05 A;  4OMY A;  2W57 A;  3H9J A;  4XKB A;  3HOT A;  4ESB A;  4BU2 A;  5DM6 F;  2YPR A;  1KU3 A;  1L0O C;  1QPM A;  3X2Q H;  3L9F A;  3VSK A;  2XRL A;  4W97 A;  5CKT A;  1D0X A;  1FOW A;  1YX5 A;  3ERM A;  3AG1 H;  2MD0 A;  1QVU A;  4DYR A;  1OKR A;  1ZRE A;  3WTZ A;  1MMS A;  3NWT A;  1DQU A;  3OIP A;  2DN0 A;  4A5N A;  1ZK8 A;  3WTX C;  2XKO A;  3HM5 A;  2DFI A;  4ZDP A;  3KP7 A;  3JRB A;  2NS8 A;  3FXU A;  3BG5 A;  3ZQH A;  5D6F A;  4MIM A;  4DOZ A;  4IHT A;  4S05 A;  4D1Q A;  3R60 A;  4B47 A;  1UHM A;  2JPB A;  4KIB A;  1U8B A;  2JA2 A;  5E8I A;  1W5S A;  1K83 J;  2XF7 A;  1T08 B;  1T98 A;  4IJA A;  2R7Q A;  2NVQ J;  5FFZ A;  2HI3 A;  3FHZ A;  5H2F C;  2RV8 A;  3GFL A;  1U9N A;  2EV5 A;  4RDU A;  1HF0 A;  4A6D A;  2UWM A;  4CIC A;  2DOF A;  2NS0 A;  2JUG A;  2WBM A;  3J80 K;  1FZP B;  2EB7 A;  1XS9 A;  1SAU A;  4DNC A;  5J47 A;  2VC1 A;  4BEH B;  2M34 A;  3F8N A;  3P7N A;  1V55 H;  3FWE A;  4F93 B;  2DFE A;  4HF1 A;  4KIS A;  3FKI J;  2DMN A;  1YRN B;  2HOS A;  2LP0 A;  4M9X A;  3ZMZ A;  1D8K A;  3CCQ I;  3CP2 A;  2HQR A;  3GWZ A;  3TED A;  4KYW A;  2DOE A;  2BGC A;  3CO7 C;  4XM3 A;  2LLK A;  3OS0 A;  2GA2 A;  4XNF A;  4G8X A;  5HLI A;  2FA5 A;  1NHA A;  3IH2 A;  1BR4 A;  4BJ6 C;  1Y0N A;  4P1W A;  2CW0 F;  3CDI A;  3G4S I;  1EV7 A;  2K9S A;  2X6W A;  4LG3 A;  1K61 A;  2BY0 A;  2A6H F;  4MQV A;  2VBX A;  4X0G A;  2BVM A;  2ADU A;  1P4A A;  1TWH J;  4Y33 A;  3RI4 A;  1R6R A;  3WTV C;  3WHB A;  2MH9 A;  2QF7 A;  5M5X J;  1SAN A;  3IAM 2;  4HW0 A;  4HX4 A;  4JX4 A;  1VQK I;  2FRH A;  2JSC A;  2M4G A;  4OIR F;  2P5L C;  4A3M J;  3FXO A;  2HQ5 A;  5C3E J;  3V8L A;  5BMZ A;  2EJR A;  1YW8 A;  4E7I A;  4L5I A;  3HYI A;  3ABK H;  3GO5 A;  2R7U A;  4LK0 F;  2B7E A;  2K9L A;  2HPM A;  1AWC A;  4LLN A;  2QEN A;  1MMD A;  4A6E A;  1D1A A;  2KMU A;  4ANJ A;  3IL2 A;  1B4A A;  1SVO A;  2K40 A;  5BQT A;  2HVS A;  3A2K A;  1VQ8 I;  1J09 A;  2O5R A;  2QKL B;  1MDM A;  3I4P A;  2WA0 A;  2XPU A;  2Y2Z A;  3ROU A;  4OIQ F;  4YG2 F;  4PSW A;  4JYK A;  1ZG5 A;  1MNM C;  3WTY C;  3K0L A;  2KT0 A;  4XN3 A;  4I6Z A;  1BOB A;  3G1M A;  1CQT A;  3DXJ F;  2V79 A;  2PBI A;  3TMO A;  3HOS A;  2BY1 A;  3W6J B;  1OR7 A;  2F5E A;  3FK6 A;  3KLN A;  3OY9 A;  5EGO A;  1PDN C;  4GDF A;  2A5Y B;  4WXC A;  2X0L A;  2HVQ A;  4N0B A;  3DKY A;  2DI3 A;  1J9I A;  4EM2 A;  1PUF A;  2W82 A;  5JI6 A;  3JRI A;  1N75 A;  1G59 A;  1JTY A;  2JSP A;  2Y48 A;  3BJ6 A;  4DBR A;  4G94 A;  1X1D A;  2XPV A;  2X1D A;  3GEZ A;  3L2C A;  2CYY A;  2QEX I;  1BC8 C;  3L09 A;  1A04 A;  4I2O A;  2DOD A;  2GXB A;  1G3W A;  1LUJ B;  2A07 F;  2DMP A;  5J1Y A;  1UHS A;  1FSE A;  3OOP A;  4RB0 A;  3OYJ A;  1FY7 A;  1NK2 P;  1ON2 A;  2ZO4 A;  4WF2 A;  4IL6 C;  3S17 J;  4ZDL A;  4RM2 A;  5K1Y A;  4BE1 A;  2CQQ A;  4NDL A;  3JRA A;  5HDG A;  1JJ6 C;  2HKO A;  4E7L A;  4OMZ A;  1BIB A;  3BRO A;  2YS9 A;  1VZ0 A;  2NYX A;  1SFX A;  2XAJ A;  4UUS A;  3B73 A;  4A3E J;  3OYI A;  4A3K J;  4II2 A;  1REP C;  4XOT A;  2HS5 A;  4YII A;  4FAS D;  4DJA A;  1OMI A;  2EZK A;  1VQ7 I;  1WJC A;  1AHD P;  2CFO A;  1FP1 D;  3F0C A;  4A93 J;  1UST A;  2DFH A;  4G6D A;  3BY6 A;  1MDM B;  3E5Q A;  1S7A A;  3CJR B;  3WE3 A;  3WTT C;  3TDZ C;  4QTR A;  1W5C C;  5BPI A;  1S9H A;  1XG1 A;  4ENJ A;  2L9N A;  1QGP A;  2QCO A;  1B8I A;  3CMM A;  4G7Z F;  1HW5 A;  1HKS A;  1YE9 A;  3H92 A;  5EGO B;  4HQM A;  5J3L A;  2FBI A;  5JHU A;  1FEX A;  2A69 F;  3CCM I;  1PUF B;  1ZN2 A;  2XSJ C;  1Z05 A;  5JVT A;  2ZNZ A;  4U0W A;  2XGC A;  2FEZ A;  1MMG A;  1TQP A;  4CSW A;  2O6G E;  4A2U A;  1ETW A;  3AG3 H;  2FSW A;  3PFY A;  3K4M A;  4AVZ A;  1UZC A;  2VN2 A;  3OYC A;  2OV7 A;  2WV0 A;  3OMY A;  4CCJ A;  3LSJ A;  4DIQ A;  2EIK H;  3ZMV A;  2H27 A;  5J1R A;  4YEJ A;  1BI0 A;  2LSO A;  4IPA A;  2P4W A;  4B48 A;  1ZQ3 P;  1MND A;  2JVH A;  3CJT B;  2XUB A;  3QQA A;  4H4K C;  4C3I J;  1UB9 A;  4L0Z B;  3HZJ A;  3LSR A;  1ONV A;  3CME I;  3H9G A;  3GVA A;  1Z3X A;  2IW5 A;  2W25 A;  4CH7 A;  5HNF A;  1I5Z A;  2W85 A;  5DS9 A;  4CYD A;  1ZRD A;  4DBQ A;  4PZJ A;  3RKW A;  4FET A;  1VQ6 I;  4UUS B;  3A4C A;  4BXX J;  2KIS A;  3LL7 A;  1ETO A;  1Y1V J;  2IXS A;  4NQW A;  1TBX A;  2Z1D A;  3FF5 A;  3PL8 A;  2FML A;  1RNL A;  2FMY A;  1O3Q A;  4HEA 2;  2Y0S A;  2KDZ A;  3BR1 A;  4EM1 A;  2OBP A;  2KHM A;  3M4O J;  5M5Y J;  3JR9 A;  1U8R A;  2EFP A;  3I55 I;  1IN8 A;  2WC2 A;  4MEY F;  1H8A C;  4MTE A;  3EYY A;  1JKQ C;  3W6K B;  2Z9O A;  3ECO A;  2JA8 J;  5D5W B;  3JRE A;  1R4N B;  1R9T J;  1Y0U A;  1B8I B;  2OCC H;  4KT5 C;  2CV2 A;  3ZQ7 A;  3UR3 C;  1XPX A;  1D5Y A;  1HOM A;  3CZ6 A;  1FIP A;  1GT0 C;  2JA6 J;  2V7F A;  3NAU A;  3JAM Z;  3K70 D;  4D5C A;  5J4Y A;  3ASN H;  2R5Y A;  2IAI A;  4A3B J;  3PIO F;  1FTT A;  2PJR A;  2WTE A;  3OL4 A;  2XRO A;  2L01 A;  2R4G A;  2W1O A;  3ZCO A;  2DA1 A;  1D5V A;  2P6T A;  3CF2 A;  2KIU A;  3PJR A;  3GFM A;  2HTJ A;  1KZH A;  4TV7 A;  3I54 A;  2KRF A;  4Z6Y A;  2LKX A;  2MYS A;  3I56 I;  3QRF F;  1FWZ A;  1BW5 A;  3O3K A;  1BOA A;  3A0B C;  2DYS H;  2DO7 A;  4ASN A;  5K7F A;  1W7P A;  3TGN A;  2F5V A;  4IHV A;  4HQE A;  1ETQ A;  4BHB A;  2R7D A;  4D5F A;  5DUI A;  5EDN A;  4XLF A;  1SVM A;  2FBH A;  4P55 A;  4BXU A;  3M9A A;  1I27 A;  1OIS A;  4MO7 A;  2O3F A;  3JRF A;  3RZO J;  4I02 A;  4A5M A;  1HXD A;  3O8H A;  2CQ7 A;  2IA2 A;  2ME6 A;  5FFX A;  3PIP F;  5H20 A;  2JA5 J;  2JWT A;  4NQW B;  4MQ9 F;  2NNN A;  1NTC A;  2X6O A;  2L0K A;  4E7J A;  1PJR A;  3S3O A;  4JBA A;  3M07 A;  3E5X A;  1LJ9 A;  2IGM A;  3K9T A;  3H0G J;  3QOD A;  4B09 A;  3L2W A;  2E34 A;  1WI3 A;  5J40 A;  4PSX A;  4EGZ A;  2PX9 A;  2ZBK A;  2ZCW A;  3UNG C;  2IS1 A;  2F2E A;  1RKW A;  2ZJ2 A;  4JQF A;  4FHT A;  3FXL A;  3OSG A;  1FPQ A;  4G9Y A;  1S7E A;  1TW3 A;  2I5U A;  3HPH A;  5FLM J;  3OYK A;  4Q5S F;  1G3T A;  5FRO A;  2ICW G;  3W2W A;  3JSP A;  1Z7U A;  2R5Y B;  3L2V A;  3K6G A;  4XKC A;  3HOW J;  5BS6 A;  4IHY A;  2F5F A;  2ELJ A;  4JX5 A;  1LFB A;  3QP6 A;  1QHG A;  1TTY A;  2L5Q A;  4RM3 A;  3I9V 2;  1P7I A;  4ABZ A;  1ACI A;  1SFO J;  3ZQG A;  5DCF A;  1FOK A;  4L18 B;  1FMW A;  1HA8 A;  3T1B A;  3AG2 H;  5BOX A;  2VQG A;  4ZJZ A;  3JRC A;  1W7P B;  2M8E A;  4WXD A;  2PFB A;  3HKZ N;  1GHC A;  3VYU B;  1OR7 C;  4EJV A;  2GWR A;  2PMZ N;  2Q8K A;  3BC8 A;  1F1Z A;  1RES A;  3DEU A;  1ETK A;  1LDJ A;  4EM0 B;  3HIF A;  5HOO A;  3FXJ A;  2DJN A;  2HXO A;  2ZNY A;  2P5K A;  2VJI A;  3B6A A;  3K7A J;  1H0M A;  3PQJ A;  5LHG A;  4A3D J;  3LA3 A;  3BQY A;  3QWL A;  4RLF A;  5EEH A;  2VXD A;  3TOB A;  3I71 A;  2C6Y A;  2NVT J;  1SD4 A;  1U6G A;  2CW7 A;  2DA3 A;  5HLT A;  1K4S A;  6PAX A;  1YHQ I;  2VKH A;  5TIS C;  3D5L A;  4GRI A;  2L9R A;  4DZJ A;  1LEA A;  1UFM A;  4KN7 X;  1IG7 A;  4ENM A;  3CDH A;  2VPL A;  1PP8 F;  2BE5 F;  2Y9Z A;  2ZC2 A;  1RRJ A;  1W1W E;  1Z77 A;  4M3G A;  3RYP A;  3LWF A;  3CCV I;  1IDY A;  3JCU C;  3PQK A;  4N4N B;  2WWY A;  4A0Y A;  1V4R A;  4CCL A;  4HDV A;  3CLQ A;  4XRS A;  4X1E A;  2BOL A;  3GF2 A;  3CC4 I;  1X19 A;  1O3T A;  2M87 A;  2G7H A;  4A3G J;  1G8X A;  2E1O A;  5LGU A;  1JKO C;  3S1M J;  1Y56 A;  3SYT A;  5L3B A;  1WSU A;  3RTR A;  1IV8 A;  1OYI A;  3KEQ A;  4A0Z A;  1WH5 A;  5D8L B;  4ON0 A;  2L02 A;  3LSK A;  3IWZ A;  3K4N A;  4XMY A;  2O61 A;  3BTI A;  4IQJ A;  4LK1 F;  3U1K A;  1Z91 A;  1I3A A;  2K3P A;  1U2W A;  1USS A;  5JR3 A;  1UEL B;  1XGS A;  1ZAR A;  1A36 A;  3DU6 A;  4O3M A;  5D8K B;  2R7R A;  3V42 A;  3CCR I;  4AYB A;  5LD2 C;  1STZ A;  4CA0 A;  4A12 A;  2IEK A;  2LD5 A;  3Q0V A;  1SAX A;  3WE2 A;  1N25 A;  2V1U A;  2CMP A;  1R1T A;  1XD7 A;  2CQK A;  4A0X A;  1HQC A;  2Y9Y A;  1WVR A;  2EIL H;  4Y7N J;  1LDK B;  4HLY A;  1X58 A;  3ZN0 A;  2MA3 A;  4F3Q A;  4J01 A;  3RPU D;  2STW A;  4C9Y A;  5JFR A;  2M0C A;  1X2M A;  2YSR A;  1I1S A;  3F8C A;  3QPH A;  3E1S A;  1X4O A;  1EH6 A;  5IT9 Z;  2KRC A;  2ZXI A;  5E3O A;  2HDW A;  3VFZ A;  2CH0 A;  2BY3 A;  2M30 A;  1UG0 A;  4F92 B;  2H6C A;  4BH9 A;  3PUB A;  1RR7 A;  1ZLK A;  1D8J A;  3WU1 B;  1IAW A;  3S16 J;  4HV6 A;  5D5U B;  3GTK J;  3ASO H;  1MBE A;  1B1B A;  1MD0 A;  2ECB A;  2DPU A;  2HYG D;  4PJJ A;  1UAA A;  5IP7 J;  2VE9 A;  1VI0 A;  3CCS I;  5ERI A;  2WB1 N;  3EPZ A;  2A5W A;  3ZQL A;  3FMQ A;  5IPA A;  5FJ8 J;  4BQQ A;  1YX3 A;  2MAB A;  4HF0 A;  2QLZ A;  5ICC A;  3MZH A;  4E7Z A;  5HS8 A;  3J7A Y;  1YS6 A;  1YO5 C;  3PO2 J;  1X1B A;  2FBK A;  4R8H A;  3CCU I;  3IH3 A;  2P6S A;  3L7W A;  2DDA A;  2XAF A;  3MMY B;  4Y13 A;  2OC6 A;  3JW4 A;  3QU6 A;  3COA C;  1YIO A;  1Y8R B;  3FIS A;  2KIM A;  3EDP A;  5K7H A;  3G2B A;  4Y3O A;  3S2H J;  1IN7 A;  2L7F P;  5F08 A;  2IBD A;  3HSR A;  2QKM B;  2EA4 A;  5FRN A;  5IYB J;  3QP5 A;  1VQP I;  3W2A A;  3KP6 A;  4S04 A;  2EFO A;  2AXT C;  3ONQ A;  1XX5 A;  1TW2 A;  1P9Q C;  1JUP A;  1R1U A;  2K4J A;  1G6N A;  2X6X A;  2CS3 A;  4RS8 A;  4AU7 A;  3JAM K;  4ENK A;  2CO5 A;  2FOW A;  3A03 A;  2DT6 A;  4HST A;  1R36 A;  1W0U A;  2QSH X;  2A68 F;  3EUH A;  5HLH A;  2HNH A;  4UV8 A;  2UZK A;  1YLF A;  1FBQ A;  3DEW A;  1PUE E;  3GCM A;  3OYN A;  3KFW X;  3P9K A;  3PSF A;  1MBK A;  5IYD J;  3KP3 A;  1IRX A;  3H5N A;  2XKP A;  4A3F J;  3U9G A;  3R0A A;  2CJJ A;  1BI2 A;  3NQO A;  4II3 A;  4LMY A;  4KIG A;  1GVD A;  3D1N I;  1I1G A;  2W4S A;  3BG9 A;  4E70 A;  1VQL I;  3SZT A;  1W0T A;  4DZP A;  4A69 C;  2A6T A;  2X1C A;  3DBL B;  4RGX A;  4J00 A;  1WJD A;  3HSF A;  1FJL A;  4FX4 A;  3H3V K;  2E2J J;  1RPW A;  3E7L A;  1FYK A;  2DMQ A;  3LFU A; 
#chains in the Genus database with same CATH homology
 2L9S A;  2DT7 B;  2M3A A;  5KHD A;  4CCK A;  4II2 A;  3OYI A;  3K4L A;  3H0D A;  4XOR A;  4XOT A;  4FAS D;  4DJA A;  2X85 A;  3OR2 C;  3OYG A;  1W36 C;  1WJC A;  3SDB A;  4OAY A;  3CES A;  4HG2 A;  3AL0 C;  3OYD A;  2CFO A;  3VYR B;  4LIV A;  4BL0 B;  5TGT A;  2VLA A;  2RRE A;  4IX7 A;  4BAC A;  4CZC A;  2LH9 A;  2ZSI B;  3CJR B;  3BLY A;  4XL9 A;  4B3X A;  1MW7 A;  3DWL E;  1S9H A;  2L9N A;  1LVK A;  4B43 A;  3LSM A;  4IQ4 A;  1LFP A;  3CMM A;  4HPQ A;  3LSG A;  1T95 A;  2LRD A;  3C2H A;  1YE9 A;  3FKJ A;  3IAS 2;  2LY1 A;  3F9K A;  4CCM A;  3U21 A;  2Q2E B;  4IZZ A;  4YRV A;  2E5Z A;  2XSJ C;  1X1A A;  2BW3 A;  4PJL A;  1MMG A;  4XLH A;  4CCO A;  2MC4 A;  4CSW A;  2PJR B;  2M0M A;  4AVZ A;  3PFY A;  3K4M A;  4XKW A;  4PK4 A;  3OYC A;  2OV7 A;  3N05 A;  3OMY A;  4NNJ A;  5KCM A;  3H35 A;  2OUM A;  3OIQ A;  4CCJ A;  4DIQ A;  1N77 A;  4HSR A;  4YEJ A;  4B48 A;  1MND A;  2JVH A;  3ZQQ A;  3AKZ A;  1Z7L A;  1U0J A;  4H4K C;  2I8D A;  3H9Q A;  3MKZ A;  3H9G A;  2V1N A;  1Z3X A;  2LYC A;  3VSL A;  4CH7 A;  5HNF A;  4R79 A;  4P5O A;  2XC7 A;  2M7B A;  4LIU A;  4DBQ A;  4DGW B;  1Y6I A;  4FET A;  1NG6 A;  2DOA A;  3A4C A;  2GOX B;  2VJ5 A;  4BXF A;  3LL7 A;  2VXZ A;  3IP4 B;  2IXS A;  4IKF A;  3HKZ A;  2Z1D A;  3PL8 A;  4C2U A;  2DXI A;  1JI8 A;  2AQE A;  4HEA 2;  2PMZ A;  2Y0S A;  2F4I A;  4HNU A;  1D0Y A;  2KHM A;  3OYF A;  2VIX A;  2RQQ A;  2IGN A;  3S3M A;  2E1M B;  1EA3 A;  2WB1 A;  1WJ5 A;  2L2O A;  3CP8 A;  3H5R A;  4BE2 A;  4E7H A;  4NUB A;  4QPQ A;  2CV2 A;  2LBF A;  3UR3 C;  1T0F C;  4F91 B;  3CZ6 A;  3QYF A;  1Z21 A;  3KEY A;  4EAT A;  2V7F A;  3TBI A;  3VYS B;  3K70 D;  4PUS A;  2VKD A;  1DGW Y;  2PJR A;  2CV1 A;  2KLO A;  3OL4 A;  2R4G A;  2W1O A;  3ZCO A;  2BW3 B;  2KPM A;  2AQF A;  4F55 A;  5CPR B;  3CF2 A;  4PJN A;  3KX2 A;  3PJR A;  1TZL A;  2XF6 A;  3BG7 A;  4E6K G;  1WJB A;  4XLC A;  2WAQ A;  3I3L A;  2MYS A;  4XON A;  2X51 A;  4D9J A;  1V5G A;  3D5S C;  4OWR B;  2KQR A;  2IS4 A;  2M7A A;  2VB6 A;  3FDY A;  3SZG A;  2F5V A;  2V6E A;  2K9M A;  3RSN A;  1D0Z A;  4E7K A;  4NC7 A;  4QPO A;  3ZRG A;  1E0E A;  4XLF A;  4N4O B;  2KRH A;  2HQA A;  2NOJ B;  4BQN A;  3EUK L;  1NG7 A;  4ZTJ A;  4XOP A;  4NQW B;  2VAS A;  4BUP A;  4ITV A;  5CQE A;  4CCN A;  1PJR A;  3M1C A;  4E7J A;  3S3O A;  2R7T A;  1MMN A;  3HG9 A;  3OYE A;  1FMV A;  1QHH D;  2VJ4 A;  2VJJ A;  2IGM A;  3FBN B;  2MFZ A;  3QOD A;  3L2W A;  3S32 A;  1D1C A;  3E0J B;  4PSX A;  4BJ5 C;  3UNG C;  2IS1 A;  1WJF A;  4JQF A;  5LFA A;  2LBF B;  4KT6 A;  4BQO A;  3HPH A;  3OYK A;  2L7K A;  4C30 A;  3K10 A;  2KL4 A;  5FRO A;  2BVL A;  3PNV A;  3W2W A;  1KON A;  2R7W A;  3MKW B;  1ZEL A;  5HNH A;  3M8J A;  3MD2 A;  3L2V A;  1AA7 A;  3K6G A;  4XKC A;  2VL8 A;  3TL4 X;  2KP6 A;  2LY2 A;  3S93 A;  2ELJ A;  1N78 A;  3HUG B;  1QHG A;  2Z2S B;  2L5Q A;  4RM3 A;  4CUG A;  2R7S A;  4BGD A;  3I9V 2;  1X1C A;  3K4C A;  1ERD A;  2VQH A;  2LC2 A;  4HNT A;  1FMW A;  1HA8 A;  3L2Q A;  3KYL A;  2VQG A;  4KJZ A;  4ZJZ A;  2KDO A;  3HPG A;  2Z16 A;  3IUO A;  2X6Y A;  3EUA A;  4OAZ A;  5HVQ C;  2KZV A;  2UV1 A;  3VYU B;  1OR7 C;  3GBG A;  4LIT A;  3C2G A;  2ZSH B;  3BC8 A;  2E60 A;  1GLN A;  2XAU A;  2LG4 A;  5HOO A;  2IS6 A;  3EUH C;  2IGK A;  2VJI A;  4ZTF A;  2WY7 Q;  3DPU A;  3QOE A;  1Z3Y A;  5KNL A;  3DTI A;  4RLF A;  4BDY A;  2VXD A;  3PNY A;  4U7B A;  4NC8 A;  4PFO A;  2CW7 A;  5HLT A;  4B44 A;  2XDV A;  2VKH A;  4ZDO A;  3K4J A;  3L2R A;  3D5L A;  3ZXS A;  4GRI A;  2JVG A;  3PNT A;  2DCE A;  3DPL C;  2CUZ A;  4XLE A;  4RLQ A;  3S8P A;  2VPL A;  4BEH A;  2K5C A;  2CV0 A;  3DLA A;  1WFX A;  3PSI A;  4XN0 A;  2VQL A;  3K70 C;  3SEZ A;  2IS2 A;  4ZYA A;  2CW8 A;  3BCB A;  4YEL A;  3DU5 A;  4N4N B;  3QYB A;  3OYB A;  4CCL A;  1SFK A;  3D5R C;  3OYH A;  3LSI A;  1MMA A;  2BOL A;  2F6C A;  4BDZ A;  2UUZ A;  3HC7 A;  2M4K A;  3H9J A;  1X19 A;  4XKB A;  3HOT A;  4BU2 A;  2E1M C;  1WJE A;  1G8X A;  3VSK A;  4BE0 A;  5CKT A;  3K4K A;  1D0X A;  1Y56 A;  5FRM A;  1YX5 A;  3SYT A;  3RTR A;  2MD0 A;  3SEQ A;  2ZXH A;  1QU3 A;  3NWT A;  1DQU A;  3OIP A;  1D1B A;  3DTK A;  3LSK A;  3W2V A;  3K4N A;  3FBI B;  4XMY A;  3VWB A;  4IQJ A;  4ZDP A;  1BR1 A;  3CJQ B;  2R7X A;  3S3N A;  2K3P A;  4DOZ A;  4D1Q A;  2X1E A;  4B47 A;  4BS9 A;  1UEL B;  2GOM A;  2JA2 A;  4KIT B;  3DU6 A;  2R7R A;  2XF7 A;  3V42 A;  4AYB A;  5LD2 C;  2R7Q A;  3LSH A;  4CA0 A;  2R7V A;  2Q1Z B;  1W36 D;  4F52 A;  2CMP A;  4E4H A;  2UWM A;  2WBM A;  2JUG A;  1SAU A;  2E5N A;  1LDK B;  1PYV A;  4BEH B;  3HL2 A;  3BCA A;  3DPT A;  3OYA A;  4F3Q A;  4J01 A;  3RPU D;  4F93 B;  2HZD A;  4HRI A;  4KIS A;  4C9Y A;  3CP2 A;  3K4B A;  2HPI A;  3FHN A;  2V26 A;  3E1S A;  4XM3 A;  1LKX A;  1X4O A;  3OS0 A;  4XNF A;  4ZC3 A;  2KRC A;  2ZXI A;  4JOM A;  4PFP A;  2VQC A;  2W00 A;  2HDW A;  1BR4 A;  1V5F A;  4BJ6 C;  2CH0 A;  2WAE A;  4P1W A;  1UG0 A;  4F92 B;  3OYL A;  4Y4R A;  1DGR M;  1K6Y A;  2X6W A;  3DQV C;  4LG3 A;  3PUB A;  3ZR8 X;  4X0G A;  3BG6 A;  2BVM A;  2WAF A;  3OR1 C;  4Y33 A;  1R6R A;  4MLO A;  3DKX A;  2DJI A;  3DEE A;  3OS2 A;  3IAM 2;  4PJJ A;  1UAA A;  4PJM A;  2M4G A;  1MNE A;  3EPZ A;  2FUG 2;  2A5W A;  3HXL A;  1BR2 A;  4BQQ A;  1V5E A;  1YX3 A;  4E7I A;  2MAB A;  2R7U A;  1WJA A;  5JHF A;  2HU9 A;  2K9L A;  4E7Z A;  3VYT B;  2HPM A;  3J7A Y;  3H5A A;  1MMD A;  1X1B A;  3OWT A;  1D1A A;  2WAD A;  2KMU A;  3MMY B;  3LMM A;  2OC6 A;  4ANJ A;  2HVS A;  2WY8 Q;  3G2B A;  2W7N A;  4Y3O A;  2V9K A;  3A2K A;  1J09 A;  3QYE A;  2O5R A;  1TT0 A;  2QKL B;  2QKM B;  3OOU A;  2WA0 A;  5FRN A;  2LRE A;  2R7O A;  4PSW A;  2XF5 A;  3W2A A;  4G6T B;  4XN3 A;  1BOB A;  4E7S A;  1X4P A;  5CQG A;  3ONQ A;  1P9Q C;  3TMO A;  2V4J C;  4BJT A;  3HOS A;  2X6X A;  2CS3 A;  4RMN A;  3RQ4 A;  4AU7 A;  2P0W A;  4XKV A;  3W3C A;  2HVR A;  2DT6 A;  4HST A;  3ZGK A;  3OY9 A;  4XR6 A;  3VDX A;  2IGO A;  2HVQ A;  3NWS A;  2CUJ A;  3DKY A;  2W82 A;  2HNH A;  2RNG A;  1N75 A;  1G59 A;  3AL0 B;  2JSP A;  4DBR A;  3OYN A;  4U87 A;  3PSF A;  4C2T A;  1IRX A;  1X1D A;  3A1Y A;  2X1D A;  3H5N A;  4XLA A;  3RCO A;  3OS1 A;  4II3 A;  1DP3 A;  2W4S A;  4XQF A;  3AFH A;  3DTE A;  3L2U A;  2LOO A;  3OL3 A;  3OYJ A;  2A6T A;  2X1C A;  4ZDL A;  4RM2 A;  4J00 A;  1OLT A;  1WJD A;  4BE1 A;  2ZFU A;  3OYM A;  4E7L A;  3LFU A;  3MKY B;  1VZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...