4S05A

Crystal structure of klebsiella pneumoniae pmra in complex with pmra box dna
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
219
structure length
219
Chain Sequence
MKILVIEDDALLLQGLILAMQSEGYVCDGVSTAHEAALSLASNHYSLIVLDLGLPDEDGLHFLSRMRREKMTQPVLILTARDTLEDRISGLDTGADDYLVKPFALEELNARIRALLRRHNNQGDNEISVGNLRLNVTRRLVWLGETALDLTPKEYALLSRLMMKAGSPVHREILYNDIYSGDNEPATNTLEVHIHNLREKIGKSRIRTVRGFGYMLANN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-binding transcriptional regulator BasR
publication title Structure and dynamics of polymyxin-resistance-associated response regulator PmrA in complex with promoter DNA.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Transcription/dna
total genus 61
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4s05A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4s05A01
4MS3A 3V8KA 3WTVC 3Q7RA 1QPMA 1MJBA 3HXMA 3R0AA 4HDVA 4EJUA 4LE0A 2HR3A 4KMRA 4WXMA 4LZLA 3TX6A 1BC7C 2X4HA 3C18A 1NXTA 2HQOA 3IKTA 4G6DA 1FQWA 3ECHA 2E7XA 3A10A 2CQKA 3ELKA 1U5TA 4KDPA 3DLBA 1FPQA 2V1DA 1SXHA 4WXEA 2CW0F 1G3YA 1CF7A 4H60A 3KZYA 5BR1A 4HA8A 3J7AO 2GXBA 4PCQA 4UV9A 2V0NA 2HSGA 5EWLA 4ON0A 2E7WA 1ZITA 1MKMA 3M7GA 5ILVA 5JS2A 1R58A 4O5AA 4GNRA 4Y13A 4OINF 4G94A 4IGAA 5FWXA 1BM9A 3FF5A 1XGOA 1Z2EA 1YQAA 3F6OA 3I54A 2V9VA 2QXYA 4U7BA 8ABPA 2PMUA 3IP6A 4Q5SF 4G0PA 2O3FA 3QLVC 3TB6A 2FVYA 3SFZA 2QW1A 1R5HA 2CSOA 4G7ZF 5TRDA 3LKVA 5B3JC 3KSMA 2DK8A 2CG4A 1FT9A 5BOXA 1RZ4A 1SD4A 5LEKA 3KKEA 1XD7A 2QSJA 5HQJA 3JSPA 3K4HA 5F64A 1ZG3A 1MB0A 3KCNA 5DV5A 4MS1A 1ABEA 2VK2A 1KRWA 2JZYA 4RK7A 4MYRA 4UHJA 2IA1A 5D5XB 4O3MA 2PL9A 2GZWA 3BDDA 4F7ZA 4BXUA 4EV0A 2LKPA 3MZYA 3ZPLA 3WG9A 2O61A 3HUTA 3HRTA 1U8TA 5D5WB 3NBMA 1P2FA 3T8TA 1JHZA 1T98A 4LG0B 2G7HA 1GVJA 1J75A 2JRLA 4HV5A 1PUEE 4RK0A 3RVJA 3KG2A 1R5GA 2FBKA 5KK1A 3DBIA 2HOEA 3QELB 4CYDA 3BREA 1CEYA 1BJAA 1B59A 3E5QA 3NNNA 5DYMA 4NCBA 1SMTA 1KU2A 2OD5A 4BHPA 2WJAA 2IDMA 4W5TA 2V1XA 1ON1A 1FYMA 1ZH4A 5TJJA 5E1WA 4CGZA 3H92A 3JY6A 4JBAA 3KP3A 5DCMB 1FY7A 3D0SA 4YO7A 2FTKE 1TTYA 1HW2A 3CNBA 1XCBA 4MQEB 1RXEA 2IPLA 3CTAA 5TQ0B 1LBHA 4Z4FA 2IPQX 2HGCA 2FMIA 2JRTA 1XN7A 2K4BA 1R1TA 1USIA 1EV7A 3D02A 1W7PA 3IP7A 4Q48A 3HZHA 3HRMA 4WZZA 2PFBA 3K2ZA 1QZYA 4ENMA 3T8YA 2WB4A 3I59B 2E4YA 1Z6RA 4E7OA 1GUDA 3MMNA 1R8JA 1P4AA 3P9KA 1IZ1A 4ETNA 4RK4A 2FA5A 2DAOA 1FZPB 2FN8A 3IDOA 2MD5A 3JPYA 3KE2A 4TLLB 2M1ZA 1ZARA 1U8RA 4K2EA 5HS7A 3B73A 1ZG5A 2PJUA 4LE2A 3P7NA 1D8KA 2A3SA 3ZMVA 1G4DA 1E6MA 2RV8A 4IHSA 3BBLA 4MR7B 1ABFA 4D6XA 5HDKA 2FEPA 1WKMA 1USTA 2NYXA 5LRSA 1R23A 3DZDA 2ZNYA 2DQRA 4XRFA 4LB5A 2E4VA 3UKJA 3QP5A 5DCFA 4HQMA 3QX8A 1DJMA 4L85A 1TW3A 2XHKA 5ICGA 4L9NA 4Q47A 5IUJC 1YS7A 5BPDA 4LFUA 5E17F 3RKWA 4ZH4F 1VRVA 5JNVA 2EA2A 2MSWA 2Q5CA 2LUOA 1CYEA 4R8HA 4GGGA 4OBBA 2FN9A 1IN4A 1RPJA 5CNJA 3EJWA 1OPCA 1RXIA 3BRQA 2A9QA 4RB1A 4XARA 4HF1A 5JS1A 1FFGA 1U5TC 4OIPF 3COAC 2EB7A 3DFGA 1PP8F 4YFKF 3LUJA 3G73A 2ACJA 3HOSA 4UUVA 3MEXA 4DQDA 4KVFA 4MRMB 2BBYA 3R60A 4IPAA 2W84A 1Z25A 3H5VA 4KQ9A 2VT3A 2E4ZA 1T0FA 4RWEA 2PMHA 1K68A 3JPWA 3LUAA 2G9WA 1JHHA 4YFXF 1HQCA 3O6BB 1G3SA 3F72A 2HFHA 2ZO4A 3L7WA 4HV6A 2NNNA 3NRVA 5IBQA 2R47A 3K0LA 2CYYA 2HZTA 2A69F 3GUDA 5L3DA 2P5VA 3KCCA 1K78B 2L17A 1J7KA 3H75A 3O2QB 1OYIA 3BJOA 3EUHA 1E2XA 2QM3A 3FWEA 4M6YA 1BDJA 1T6SA 4BH9A 4FT8A 1QNLA 5K5OA 2M98A 4RXTA 2YHBA 3DV8A 4N47A 3L00A 2FNAA 1RZRA 4CO8A 4JP1A 5HSGA 1L5ZA 2YX4A 4OOIA 4Z4GA 2GX6A 3LA3A 1M5UA 3GA5A 1PEAA 1U2PA 4A0ZA 5D6EA 2F5FA 3E5XA 2LNBA 3DXJF 3LQQA 2Z99A 4IRGA 3BILA 3UUGA 5JNRA 1JHFA 1B1BA 1JBEA 3HSFA 1HXDA 2H6BA 3A3KA 2FBHA 1XGSA 5D6FA 4EM1A 2PQ8A 1JFVA 5ICFA 3ZMTA 1ISRA 3C6QA 4QPJC 3TMYA 1R1UA 5LRRA 4XSZF 2GA1A 4EJWA 4CICA 2XDYA 2AS5F 3RVRA 4ESBA 5TPWB 4ZPJA 5IEBA 2VE8A 4WX9A 3WE3A 1EH8A 3HRSA 4M88A 3URMA 1LDDA 1TLHB 3L9FA 4DADA 1F9NA 4G0YA 1R36A 6PAXA 1U2WA 2OENG 1MAVA 3HVRA 5L3CA 2JK1A 2F2EA 3S2WA 1O7LA 4HOBA 5HDGA 3MA0A 2F8SA 2VE9A 2UXXA 2HDCA 5TE9A 3KP7A 2ESNA 1L3LA 4R1HA 4PYRA 3ILYA 4G97A 1SD7A 1TMYA 5D4RA 4A2UA 4G0ZA 2KYRA 2IRFG 2ISZA 2IPAB 2LIVA 2BV6A 5CHYA 2LF7A 2V6CA 3T38A 1ZRFA 1UHWA 3QU6A 1R1VA 1D4ZA 1SD6A 4XASA 1MIHA 1BN5A 2GA2A 3GL9A 3OO0A 3MWMA 4HF0A 1IXCA 2XAQA 2JPCA 1F4KA 2C6YA 2KIFA 4HQEA 2O03A 3QEMA 5E3JA 5JNUA 4M9SA 1KMIY 4EJOA 3K1NA 2JVKA 2JBAA 5FFZA 3GBPA 1Z18A 1F5TA 4N9IA 2L4AA 2ADUA 3B02A 2MLGA 3RJPA 4ETIA 3OM0A 4KIBA 4Y17A 1R00A 3V8JA 2ZNZA 5ICCA 3J80K 4TN5A 1NATA 2FE3A 1D5VA 2L4MA 3KP6A 1ZVVA 2A9PA 3DF8A 3ULQB 2P8TA 1YK1A 1IF1A 4OMYA 4OLAA 2HTJA 2UWMA 1Z7UA 3ZMSA 2CWEA 4ZMRA 2KIMA 1DPUA 5D5UB 1DDNA 1MJAA 2R3SA 4KNYA 3F8BA 3RDIA 2K4JA 2ZXJA 3T5XA 4EGYA 5DLEA 3T1BA 2QENA 1S29A 3TOBA 3IRRA 1MZBA 2FMLA 2YU3A 2NZUG 2A6EF 5HDNA 3DKWA 4W5OA 4KFCA 1JGSA 4N0BA 1BAPA 2V1UA 4LLLA 3OLYA 1OR7A 1BI0A 3I0TA 2GWRA 3N97A 4AIKA 3F3XA 5BPIA 5FWYA 4IF4A 5J8CA 2A68F 2QV0A 2OZ6A 1DUXC 4PGGA 2OBPA 5E8IA 5LGUA 3GWGA 1JE8A 1YTYA 3HEBA 1KGSA 3M9XA 4KIGA 2FLWA 3J80Z 2WJWA 1KU7A 3RH0A 4P9UA 7ABPA 1NTRA 1DC7A 4WT7A 5DD8A 5FB2A 3JVDA 3E6BA 1EAYA 2QBYB 3WTWC 3FM5A 4OLBA 2MH9A 2XAHA 3HHGA 4OMZA 4QICA 1USSA 4Z4IA 1I6XA 4CZZA 1GHCA 1HKSA 2B1JA 5CLSA 1D2AA 5TQ2A 4RXUA 2ZMEA 4RXMA 3CUQA 4LK1F 2XVCA 3RVKA 2HEOA 4P55A 3CHYA 3GZ6A 4NQWA 1ZAYA 4MTDA 4KREA 1EWKA 3N8IA 4ETSA 2BGCA 5CVUA 3LUGA 3LUCA 1MDMA 1WI9A 2IJLA 4EJTA 2FMKA 3FXRA 3EULA 1EH6A 4GO1A 3LA2A 3CZCA 1I27A 1FSEA 3WGHA 3KTOA 1HW5A 4ZYGA 3WTZA 3U2RA 2OQGA 1YVUA 3BWGA 3RQIA 4G7OF 1W7PB 2PKXA 1YG2A 3KEOA 3HTUA 5LHIA 3WTSC 2CD7A 3O1IC 2RVCA 5CNIA 2XAFA 3M9AA 3H3UA 4EVSA 2E1NA 1NY5A 5LHGA 2MLKA 5EEGA 4YIFA 2DO7A 1FSHA 4WXCA 2EFPA 3FMQA 5LGNA 3IRQA 3J81K 5KWSA 3HSYA 4IILA 1GCAA 2HQBA 2QZ8A 4RV5A 1KRXA 4MR8B 2FBIA 2Q0OA 4RB0A 1JX6A 2FQXA 2W42A 3DPTA 1L0OC 4A5NA 1W7PD 3R4KA 1TBXA 1XWWA 2VUIB 2D2WA 4EQQA 3H5TA 3WU0A 3SXYA 4N9HA 2JCGA 3E5UA 4HNSA 1XHEA 2HYFA 2BE5F 2K02A 1RIOH 1DZ3A 1IRFA 3L6UA 1NXXA 2Z3YA 5DEQA 4OIOF 1Z2DA 2M1BA 3IKVA 2JSCA 1JFTA 3FM3A 5K5QA 4KIFA 1APBA 3RVMA 3EQ2A 2GKGA 2VBWA 2A61A 4AVPA 3GF2A 5BS6A 1HEYA 2DBBA 2IYNA 4KZKA 2RJNA 2J5OA 1B4AA 3HSEA 3JVIA 3REOA 3N6VA 2H09A 5ICEA 1SFXA 4MGEA 4RK1A 5BRJA 5GQSA 2VODA 2EJRA 4KT5C 4UVCA 4YIIA 4OIRF 3RYPA 3EQLF 3I5UA 4IRXA 1RNLA 3O1JC 1HW1A 4Q4ZF 3WGIA 3F22A 3E3MA 4Y15A 3J81Z 1DBQA 2QVGA 2GXGA 1U6GA 3P9CA 5IX8A 4JQFA 1C0WA 4IRHA 3GFJA 3TO6A 3O1HB 2MSKA 3NHZA 3QRFF 5D5VB 1MJ9A 5HS9A 4E70A 4B09A 4XXHA 4RDCA 3MZHA 4BYYA 3OQMA 1KYWA 5EWJB 2HYGD 4A0XA 3TD9A 4KYWA 2PLYA 2QYOA 1EWTA 3QK7A 2FKAA 5KQPA 3RVLA 5FD6A 3IC7A 3RPQA 1BIBA 3C3WA 1NXWA 2WTEA 5LGTA 4FE4A 2DQLA 4UNOA 4WCGA 1SMYF 1TQIA 3F21A 2B4AA 2ID7A 1SFUA 1J59A 3Q15C 3QX9A 2Y0MA 2L19A 1UCRA 4GYIA 4Z4CA 3ZMUA 4MR9A 1F1ZA 4LJZF 4D0PA 2ZCWA 5L3FA 3R6SA 4MEXF 1YK0A 4RY0A 4EUKA 1T38A 2R7FA 2XKPA 3IWFA 3TKYA 1M5TA 4LB6B 4OIQF 4YLEA 1KU9A 3M9WA 5TPZD 2NT4A 4ZZDA 2CGPA 2CHFA 2L3DA 4LDZA 2FSPA 4W5NA 2XAGA 1ULYA 1O3TA 2PUBA 3D5LA 4HBLA 5IT9K 4U88A 3WE2A 1NXSA 1ZREA 2PAFA 3TGNA 4YCSA 4P96A 3W6JB 4F12A 2QU7A 4HX4A 1OXKB 1LEAA 3IHUA 3QAHA 4ZYHA 1QQBA 1P92A 2W57A 2L2QA 1ZAOA 2XAJA 4U0YA 4RKQA 1UFMA 4L5JA 5IULC 4G0MA 2FEWB 3FXUA 4NB5A 5FBHA 1Z6TA 4E7PA 3SHFA 1PP7U 2L18A 3FGZA 4N03A 2M30A 4XLTA 4KK3A 4MHGA 4ENNA 1YYVA 2K7LA 4WUTA 1CGPA 2DRIA 4EYGA 3R61A 3NNSA 2QQ9A 4Z4HA 1I3CA 1RZRD 3F8NA 1TNTA 1MB3A 3E6DA 3CUQC 2FU4A 4OTZA 1FLIA 3C97A 1W5SA 4LK0F 5L3EA 1TNSA 3TO5A 1I1GA 1YIOA 6ABPA 4W5RA 4ZYEA 2XGXA 1LDJA 5BMZA 2VUHB 2R7DA 3WTTC 3UK0A 3O3KA 2EK5A 4Q7EA 3KHTA 2CFXA 3QEKA 5IT9Z 4ETMA 1XMAA 3CDHA 5E1XA 1DRKA 1RI7A 1JFSA 1XDUA 4N41A 5DUKA 3EYIA 1Z16A 1XSVA 3CG4A 3CFYA 4ASNA 1Z9CA 1VKRA 4P98A 3RVOA 1QQAA 2DLLA 3F6VA 1Z13A 1ZLJA 3N0XA 3LUHA 1D3YA 1U78A 1P4XA 3GBVA 2KKOA 5DCLA 4O5VA 3T0YA 4L9TA 3ZMZA 3G85A 1IW7F 2YR2A 1BI3A 4UHKA 2P7VB 1USGA 1NXPA 4N0PA 1I1SA 3IL2A 3V4GA 1DPRA 4MQFB 1TJYA 3HUGA 3O2JA 3BOQA 4AIJA 5IUNC 5BQTA 3SZTA 2H94A 3IPCA 3QPHA 1WWXA 2MBFA 4ML3A 1HBXG 2VOOA 1ZGZA 3H5LA 1XGNA 1UDRA 4EVQA 3OQOA 4MQ9F 4TMYA 3W9SA 4Y9TA 4A6EA 5K1YA 4BNCA 4CHUA 3LUFA 5ABPA 2EFNA 2JBAB 5TQJA 2MH2A 3HIFA 4LG0A 5D8LB 4A6DA 2JB9A 2HQNA 4WXHA 4QLCU 4U0WA 2EV6A 4MGRA 4JK1X 5EWMB 1EHCA 3HCWA 1TLFA 4HAMA 3KS9A 5FO5A 3OLVA 3QELA 4YR7A 3PFIA 3QOPA 1J2XA 2GAUA 4MAAA 2PBIA 5IEJA 2PUGA 3KP2A 4XLPF 1U2QA 4FX0A 1ONVA 3G3ZA 3MIZA 1Z05A 1O3SA 1IAWA 5LEJA 1FYLA 4JASB 3F6CA 5DCMA 3I09A 5CVVA 4QYWA 3KFWX 1S7OA 3L09A 4Q6WA 1U3EM 2J5PA 1B00A 4MQEA 5DD4A 2GQQA 2IPMA 5TQ0A 4EYQA 4WWHA 1O3RA 3O2SB 2DPUA 2O0YA 1YW7A 3FMRA 5D4SA 5FFXA 5EEHA 3GEZA 2LBPA 4KA4A 3OMWA 3L2CA 5K5RA 5AIQA 3I59A 3DQVC 5HLGA 2ESHA 3LUDA 3N0RA 4IMIB 3GZ5A 4Q6BA 4EGSA 3WTYC 5KI6A 4RB3C 4QYMA 2NS0A 3LWFA 3LKBA 2OQRA 1XSXA 2Q8KA 4XFKA 4CDGA 3VOEA 2F8TA 1AB6A 1QO0D 2DT5A 2WWVD 3MCZA 4UXNA 2PUCA 3OLZA 1ZH2A 3OO1A 2E1CA 2ZWMA 5LBQA 3LA7A 5F6FA 4DNCA 4MS4B 4MEYF 4GXOA 1B9MA 2PUFA 4M72A 4NHJA 4YGXB 2FQYA 4N0QA 4LLNA 4MR7A 1KQ9A 3C3KA 3NNDA 1LVAA 2XROA 2HJ9A 5E1ZB 3HTSB 2GI4A 3VODA 3H5WA 3C3MA 2VBYA 3HK2A 2VBZA 1Y1LA 4EM0B 3BJAA 2IVMA 4PZ0A 3TO7A 3SM9A 4LGWA 1KU3A 3I71A 3EDCA 4PEVA 3LSTA 3HOTA 1HKTA 1HSTA 3DP7A 1FBSA 3BZ6A 1QBJA 2MYNA 2YSRA 2AYXA 1HKQA 1AB5A 2IA0A 1XDSA 5D8KB 4NV3A 3OOPA 1K66A 3AAFA 4G6QA 1S3JA 1C0EA 4ZYLA 4KK4A 4I98B 4H0EA 4M9XA 1IN6A 2O20A 1YW9A 4MS3B 3RVNA 3SG0A 2L01A 5JHUA 1EWVA 1SAXA 4R79A 5IC5A 2MYTA 3K9CA 4RKRA 4IRIA 2RQPA 2FOKA 3QLUA 5HKOA 1OMIA 4JB2A 4MRMA 5HM6A 1QZZA 5J8FA 1D8JA 1FFSA 3IPAA 4XAQA 3ECOA 3SZPA 2FXAA 1OKRA 4Z99A 4EVRA 3M8EA 4RS8A 3I5AA 1U5TB 3Q9VA 4A12A 3H1GA 2MYUA 3M6MD 5A2QK 1CF7B 1USKA 1QGPA 5ED4A 3D8UA 1DP4A 1IN8A 2RN7A 5EWLB 2YPRA 2DI3A 3GFLA 2JPBA 4RK5A 1OXBB 4YP9A 2W85A 1DC8A 2WRZA 1Z12A 1K78A 2X7XA 5FWXB 1GXPA 1OYWA 2DK5A 4YG2F 3KP4A 2EV5A 1LB2A 3N0WA 4EYOA 1FX7A 2Y48A 1D5WA 3KYIB 4FB4A 2YHAA 3FMSA 2OAZA 4I7HA 1A2OA 3EGCA 1IXRC 3RI4A 1QQIA 3IP9A 5FLXK 1J9IA 2F5DA 1XB4A 1Z17A 2COMA 2E4UA 4PGHA 2PI0A 3CG0A 2PJPA 2UXNA 3LTEA 4LE1A 2DU9A 4FHTA 2XIGA 2XRNA 2VN2A 4QWQA 3QU3A 1R7JA 3RYRA 2FMYA 4ENKA 2I6FA 3K69A 1H9GA 2QLZA 5KC9A 1ZGGA 3LOPA 4MS1B 3MAJA 5DTEA 2M8EA 2FMFA 2JVJA 3CO7C 2JTVA 4EMSA 4HNRA 3I4PA 1PNTA 3BPVA 3VB2A 4BHBA 1JLKA 2ZFWA 4XLNF 5A2QZ 3FXQA 2P5LC 1E6LA 2A5YB 5FD5A 1Z91A 3VFZA 4JAVC 4D6YA 3SAJA 4Z4EA 5TPWA 3GV0A 1FYKA 4HW0A 4MTEA 3P9IA 3HDVA 5KQGA 2ZBKA 3JAMK 4LDAA 3BRSA 2IP2A 2PUDA 3QLTA 2ISYA 5BQ3A 3H6HA 4UVAA 1Z1DA 1FBUA 4NCAA 2DW4A 4KMFA 1GUBA 2PMCA 3GX4X 4O1HA 2RDMA 2PL1A 1KQ8A 3ABTA 1LNWA 2G7UA 5KC8A 3E97A 4DQ2A 1V3FA 1E2BA 2VC0A 4RB2C 2FW0A 5FLXZ 3ISPA 3GXOA 4HX8A 1LJLA 6CHYA 1A04A 1BI1A 4RAZA 3CLOA 4G0XA 4WF2A 2ZAYA 4LLGF 3VNBA 4A5MA 3EODA 4KUMA 4KN7X 2WMYA 5E18F 2STWA 1JYEA 2NAZA 4RZSA 2D45A 4KN4X 4M9ZA 3OQNA 2QR3A 3RKXA 3F8CA 5LLQA 5L3GA 2P4UA 1QNTA 3HSRA 3F8MA 5CVRA 2LSOA 1YMUA 3CS3A 3ZN0A 1ISSA 2E4XA 3Q5FA 2OA4A 3KLNA 3BPXA 4L5IA 3ILHA 3W6KB 1ODDA 5H20A 2HKOA 2QQAA 1JXSA 4D74A 4G0OA 3VEPA 2ZJ2A 2NRAC 1IN5A 3QPTA 4HLXA 3RVQA 4UVBA 3LUKA 1SRRA 4G86A 4HX7A 4W5QA 3RKYA 1ZRDA 1KYZA 2VC1A 3JAMZ 3WTXC 4RK6A 1J0RA 2WC2A 5DUIA 2JVIA 4IHTA 4HZFA 1WQ2A 2BGGA 3I58A 4OATA 3U1DA 1LEBA 4KV7A 2QVOA 2IA2A 1P6UA 1XHFA 1ZYRF 4BQAA 2Q2EA 2AYZA 3MF4A 2FRHA 3FFTA 3BY6A 5CVJA 2FF4A 3GW2A 4NICA 3JTEA 3E61A 1NXOA 2FXIA 4IJAA 1QP4A 3JSOA 3FMVA 1ZGJA 5H6QA 5C5EA 1GXQA 2F5EA 2D1VA 4BHCA 2R4QA 2A9OA 2HWVA 2B0LA 1YTUA 2FEZA 3HO1A 2H0AA 1C4WA 2NUBA 3FZVA 3CTPA 3KJXA 4F3TA 3TDUC 1FBQA 1JF8A 3M1EA 1P8AA 4EM2A 1M2FA 2EWNA 5J6XA 3QLUC 1X3UA 3E3VA 4UHTA 4LX8A 4MPTA 4XSXF 3F73A 1D1PA 4ZMSA 5CJ9A 4L9JA 3GO5A 2STTA 1QPZA 2FLKA 2W24A 4EVIA 5HVQC 1BVHA 4AIHA 4B8XA 4O6JA 4YS6A 2EA4A 3WODF 3CRNA 2XKOA 2IPNA 3RTRA 1NXVA 1DCKA 3HJFA 3B2NA 1WSUA 1TVMA 4G9YA 4RY8A 2Z33A 1RUOA 4CXFA 4EJVA 4S05A 1BC8C 2NNYA 1FSPA 2UZKA 2FMHA 4I01A 1EFAA 2ID9A 2QBYA 3V7CA 4DN6A 3TO9A 3KLOA 5BRAA 3NEUA 1PNRA 2K86A 1BI2A 1M2EA 4M73A 3OLXA 3BJ6A 4MQVA 2H3HA 3ROUA 1JL3A 2IW5A 2H6CA 3H1EA 5JNTA 2DTRA 3QP6A 5IUKC 3LAPA 1L5YA 4H3HB 2QUFA 2EFWA 4A0YA 4KMUX 3E6CC 5DKFA 4Z9AA 2ELHA 4PZJA 3TDZC 4M74A 3ABUA 1FFWA 2CWDA 3EQZA 2VOPA 4BAYA 2QQBA 1ZHHA 3K1PA 4WXDA 2FEKA 3GWZA 1GCGA 2IOYA 1WRJA 1ZESA 2P6SA 2VBXA 1KQ0A 2MA3A 4YFNF 1H9TA 4L18B 3OV8A 4P9FA 5JNSA 1JDPA 1SXIA 1FNNA 4GYGA 3WU1B 4G8XA 3F23A 3DEUA 5L3BA 2ETHA 3R0JA 3H1FA 1T34A 3JTHA 1A0OA 4MR8A 2VT2A 5AONA 3T8RA 2Z5UA 3HDGA 4RGSA 2Z9OA 3H3ZA 1P6QA 2RDPA 1Z26A 4OG2A 4TV7A 2PEXA 2GBPA 3F7NA 2EV0A 2P4WA 2XV4S 3MYYA 2QVCA 3DGFC 5F1RA 3L49A 1B9NA 3VNAA 4RAYA 3TOAA 4HYEA 3HM9A 3M8FA 2RC4A 2P7CB 1K7AA 3TQNA 1H9CA 4PICA 3V7RA 3F6PA 3MQ4A 3GRCA 1BIAA 2CHEA 3ZP5A 3OMXA 4KICA 3GFIA 1P6RA 1ZN2A 2VXZA 4L4UA 1O3QA 4LRQA 4KRFA 3JTGA 1S8NA 4F06A 3GFMA 2K27A 4I09A 1PUXA 2RGYA 5ILSA 3GYBA 3EYYA 2QWWA 2TDXA 1E17A 2D1HA 3QEMB 3DLHA 1K6OA 3KETA 5HLHA 4U0VA 5EWJA 1P4WA 5TPZA 3ML6A 4RSMA 2LP4Y 1DP7P 2PUAA 1AWCA 4M6XA 3NQOA 3N4MA 4ESFA 1YO5C 4EY3A 3N75A 1PHRA 1STZA 4LD5A 4UV8A 2HTSA 2QZJA 1G6NA 3ERED 3V8LA 3T6KA 1W9HA 2TMYA 5FBKA 1KA8A 1JH9A 2IKSA 2WWYA 3EAFA 4TLMB 1FP2A 2HS5A 2GIVA 3KZZA 3HV2A 5HLIA 3H5IA 2FNPA 4EYKA 2N9UA 4RGRA 4I02A 3Q9SA 1ZH5A 1D1QA 1TW2A 1FWZA 1BDIA 1S7AA 1NHAA 5KVRA 2YX7A 2P9HA 2PUEA 4MNUA 4F8JA 1R22A 4GCVA 2L54A 3Q7TA 1LDKB 3LFKA 3O75A 3FX3A 2PN6A 5E8GA 3LFTA 5FWYB 4RGUA 2PG4A 3O21A 3DGEC 2RKHA 5FGMA 5D2CA 1IIBA 1YMVA 3KP5A 5C5CA 1MVOA 1TQPA 3Q7SA 2O8XA 2VONA 4HNQA 2X0LA 4KPYA 1SD5A 3MQ0A 1TM2A 3BP8A 3IWZA 4RGXA 5KQLA 3CU5A 2HPHA 5JFRA 2VYCA 5T7BA 2M5WA 3MM4A 3IP5A 1LQ1A 3ROFA 4YRZA 3CZ5A 2EFQA 5IT3A 1WETA 2JT1A 2LPMA 3CKMA 3Q41A 2HKXA 3HUUA 4RU1A 3FFWA 4G7HF 2M45A 5TQ2B 4HLYA 4P1ZA 2ZMEB 1F51E 3CUQB 1ZLKA 4HDUA 5T3YA 4IVNA 3HYIA 5JR3A 1O7FA 1DBPA 1FP1D 3HS3A 3I64A 1O57A 2Y75A 1HSJA 2XUBA 3LAJA 1DRJA 2MC3A 1J5YA 2AXLA 1Q1HA 1I5ZA 1MDMB 2LDUA 1YW8A 4XBFA 1B6AA 4FE7A 1IXSB 3H5OA 5I4CA 4WK8F 2W25A 4IMJB 4L9VA 4Z9BA 1Y0UA 2DPDA 4MLDA 3I45A 2V79A 2ZKZA 1E6KA 1QMPA 1F4VA 3ROTA 3N53A 1G3WA 3QLVA 1XSDA 5KQMA 5CYVA 4ZZLA 1QKKA 5HOOA 2MSLA 1XMKA 2IT0A 3CJNA 4ESJA 4MQFA 5B3JA 1BBYA 5CNMA 3I53A 4I0BA 1JWLA 2M87A 4U7DA 1RUNA 1EH7A 3RVPA 1UB9A 4G0QA 3PQKA 4GPAA 3NHMA 1JYFA 4KQCA 3DPLC 1W25A 9ABPA 4OU0A 1T39A 4S04A 2O6GE 3A0RB 2OU2A 3E6MA 2XASA 1V4RA 3CLKA 3K1MA 3T95A 5HS8A 1LJ9A 2FQ3A 2RNJA 4N76A 1ZY2A 4O1IA 2EFOA 5EWMA 3S99A 1TQMA 2HQRA 4ZJPA 1ON2A 4JA2A 1VPWA 3KEQA 5ERIA 3KYJB 1H0MA 3CO6C 1T2KA 1URPA 1MGTA 1JDNA 1ZDMA 3G1WA 3SQNA 2L02A 4M71A 3U9GA 3SNKA 3C1DA 1YFHA 1SFEA 4LMYA 3FHZA 1S6LA 3FDFA 2F5CA 1XCVA 1IRGA 1DCFA 4PE5B 1CHNA 1XGMA 4JOQA 2RJOA 3F8FA 3WTUC 3LMKA 4JB0A 1DCMA 1DBWA 4L0YB 1GLGA 4EGZA 3EETA 2FSWA 3I42A 2J48A 1ZHFA 3RIRA 4HF2A 1QO0A 4Z2YA 1J56A 2A6HF 4MLCA 1YS6A 4YV7A 3RVSA 1BOAA 3MFKA 2KJBA 3P9YA 2KRFA 5AIPA 1IN7A 1QP7A 1K79A 3ZMDA 3O2PE 4CBVA 2R48A 3V7SA 3A0UA 3O74A 3CUOA 1ZRCA 3K9TA 1OYYA 3HRUA 3EDPA 1SXGA 3JS5A 5H6RA 5GOTA 3GLXA 5ILUA 1ZG1A 1LK0A 3LQRA 2CO5A 1VTNC 1PDNC 5JI6A 4IXAA 4F11A 1BA2A 2R25B 4MS4A 2NZVG 4AWXB 3BROA 2RGVA 4RY9A 4PDKA 4ZYDA 3SY8A 3RPUA 2BEOA 3H6GA 4H3KB 5DGCA 3JW4A 3GYHX 2MYPA 4ENJA 1UHMA 2DFIA 3GVAA 1W4MA 4Z0NA 5E20A 2PLNA 1IUYA 3OM1A 2A9RA 4YWHA 4NQRA 2P6TA 4WWCA 5PNTA 2KJCA 2PE5A 4MR9B 1MD0A 3PQJA 2NT3A 5JVTA 1DG9A 3FFXA 3OLWA 5DDGA 2WV0A 3C7JA 2A07F 1FOKA 2WY2D 1BDHA 2P5KA 3WGGA 3GT7A 1PEYA 1QP0A 1FC3A 4I2OA 5CNKA 1ZGAA 1U0SY 5LHHA 2FQWA 1Z15A 5JNWA 4I0AA 4AD9A 3ZN1A 4FX4A 1W5TA 2H27A 2KIUA 1LJUA 1YLFA 2LF8A 1U04A 5CVIA 1G3TA 1VLZA 2E4WA 1REPC 1LBIA 4L0ZB 3HHHA 3ZQ7A 1AOYA 2BYVE 4RS3A 4P5OA 2OZUA
chains in the Genus database with same CATH superfamily
2CVQA 4TTQA 3CSSA 4MVJP 2P9JA 4E7IA 2PX6A 4B5KA 3TX6A 2V0CA 2X4HA 1AK9A 4HWOA 4RY2A 4G6DA 2ZBQA 5J4VA 1PWXA 1PR6A 1D7AA 1QVUA 2AMLA 3T15A 2CMFA 4LJLA 3B89A 2V7PA 3H0CA 4RHCA 2X40A 5IZCA 2XHEA 4FN5A 4UEJA 4B3DA 2M4GA 1XQ9A 1YB1A 3UT5B 3U60B 2G6BA 4H59A 3VDNB 1TQDA 4FHFA 2PAAA 4RVNA 3DE1X 3UXYA 4KP7A 5TRDA 1DKLA 2Q5FA 3NTUA 3KSMA 5FRNA 1XD7A 5CUQA 4BJ1A 2I6UA 1ZG3A 4CG3A 2VJJA 3JCUC 2VK2A 5B66C 2B20A 1BN6A 3Q0TA 2LKPA 4HX2A 4BN4A 2OXFA 4PINA 4YXWD 3T7IA 3L4JA 3T8TA 1U02A 4QDZA 5DF1A 3COWA 3K9GA 4DNXA 4RCYA 2JRLA 4FGJA 3WYNA 3GZJA 3DKVA 4EJSA 3MELA 1OX4A 3K2BA 3MTIA 3BREA 3M6XA 2NSYA 3IH3A 1JWAB 3V4ZA 4PC7A 1ZONA 4ZT5A 5FEMA 5HFJA 4CGZA 1J2UA 2EERA 2VHQA 4Q3BA 5KTPA 3ACCA 2FDXA 1UJ8A 4ISCA 3D6HA 3JD0A 1WMBA 4EIWA 2FA9A 1R1TA 2XAAA 3CDLA 1ORVA 1TK3A 5LB2A 4LRYA 3PFBA 2PS3A 3CH6A 3KAQA 3ER6A 2Q45A 1R8JA 2HA6A 1MB9A 4N18A 3UTDA 4TROA 4OQFA 2FX2A 1FYVA 1BE0A 1ISIA 3LC7O 4A2PA 4RDUA 4JITA 3QGMA 1PHPA 5IWAB 4BFXA 2VDNB 5TVKA 1A77A 3DNFA 2YZNA 2LLKA 3ETJA 4TRNA 4D7AA 3EFEA 2RHMA 3CR7A 3RNOA 3F9KA 2ZTUA 3L0OA 3HCCA 3TH5A 4QBIA 1B42A 1M8KA 2ZRHA 4M36A 4AF6A 2I2XB 2Q5IA 1AKHB 3NDRA 5DYTA 4RD1A 1RJ9A 3MMYB 4FMDF 3ZR8X 3FTPA 1HZZA 3ESWB 2H8RA 4G5GA 1BJZA 3A01B 1U5TC 1S2OA 3N2YA 1UDBA 3HOSA 3HPRA 4NZMA 5F33A 1Q0SA 2LD5A 1IATA 2P2YA 3I4MJ 1XP5A 1KOLA 4QOIA 3THXB 4B71A 3RCBA 4RWEA 2HW8A 4YFXF 3O6BB 4J0JA 2QVBA 1ST3A 4TYWA 1HKHA 4UFPA 1AD2A 4REQB 1HL3A 3U62A 5J5AA 5IF9A 1F0NA 1NK2P 1OVMA 4NHOA 4Q9KA 3GUDA 3QFRA 1V7QA 1WBBA 1DMSA 4L4ZA 3TPFA 4B2LA 2ZSDA 3C24A 4R8LA 4Y2TA 4XLZA 1ENPA 1PYGA 3WHKA 4W6QA 3I4LA 4E2WA 1S5PA 5M2QA 3WLPA 4A1FA 3GG9A 5CDGA 5T6MA 1Q2XA 3DEWA 5C46F 4YCAA 1M5UA 2O50A 1U28A 5B55A 2KIQA 4IRGA 1BCSA 1ONBA 3FKIJ 3K4JA 3S1QJ 2XNDA 3HSFA 2H6BA 3HA3A 3L6BA 3EC2A 1Z67A 3I30X 3OZIA 4IIBA 5F4ZA 3GELA 1FS4A 3T1HB 3QHPA 2V55B 1CY4A 2PWAA 4Q3OA 5M34A 3SOZA 3KKKA 1N77A 4C7BA 3WE3A 3V5NA 1MBHA 3HRSA 3T5MA 2VIXA 1EFCA 3EEIA 3KFLA 2XPUA 1TTPB 3DKRA 4X8OA 4X61A 1V54H 2EW2A 5FOTA 3N8HA 1NTOA 3H83A 3O93A 1Y3FE 3IVRA 3Q5GA 1MAHA 4R1HA 2CLHB 3QP9A 4RVFA 2ZIXA 3ESRA 2IPAB 2HHHB 3T9BA 3T38A 1ZRFA 4NYJR 3GMIA 3TCNA 2VDMB 3PKIA 5G02A 3QEMA 4YIRX 1CQTA 4EJOA 1QQ5A 5CFOA 4GOMD 3UJ8A 2J5XA 4EX7A 4MB6A 1DVRA 4L5CA 4PUSA 1VB5A 4XFDA 1QDEA 1H93A 1KQNA 1E0SA 1D5VA 2HCJB 1XPRA 3C2QA 4MYCA 2QW8A 1CJVC 3DJYA 4OXQA 3RS3A 1M5RA 5JFTA 4QOEA 3HLKA 2I2CA 2JEZA 2A6EF 5CT9A 1P2DA 1XT6A 3ZBQA 2P2SA 1BAPA 2V1UA 3RLIA 3RU2A 1OR7A 4Y6RA 3S27A 4CM9D 1OXUA 4IF4A 4X92A 2WYHA 1P1FA 2IS6A 5E8IA 1U0RA 1M0WA 2J0SA 5DD8A 4RMHA 4E0BA 1A9PA 3R0ZA 3FM5A 5JCPA 4DR1B 2R97A 3RUHA 2R7WA 5HJEA 4JLJA 2OHVA 5LQMA 3PENA 1L4MA 4RF4A 2VJAA 3M1LA 3ZI7A 3FRHA 3RBVA 5IJ9B 2CJJA 2AOTB 3RVKA 3K3PA 1L1RA 4PBSA 3A05A 2BGCA 4Z9YA 3TD2A 2WVHA 2OK8A 3PXAA 2JD1A 5I9NA 1ZHOA 4CQMB 1C7FA 1I27A 3ESDA 3KVNA 3NVAA 1Y5MA 1W9MA 2A1UB 1ZJ4A 1VHDA 4L5YA 1NOIA 3KEOA 4MW6A 5DTJA 3Q72A 4ASUD 5K2MA 5CTJA 1Z5WA 4ZVUA 1FSHA 5MFZA 3VQTA 2ON6A 4MGIR 4WV3A 1ZWKA 4G41A 3IOBA 4RV5A 4MQLA 5TB5A 2IHVA 4BQRA 3DL2A 2FQXA 2LKDA 3NHLA 3DPTA 3CLVA 2WHRA 2D2WA 4OKIA 4Q9JA 4WZAA 2DG2A 4DMKA 2ZIGA 3NI2A 5AVSA 1LV7A 1KO5A 2AV6A 1KR2A 1L4UA 3T3DA 3U4QB 1JG3A 1QWSA 2WICA 1E32A 2H09A 2HMWA 1YBMA 2IGNA 1XMSA 3D64A 4GPD1 1OIWA 3DTNA 1UMQA 3O1JC 4I46A 1HW1A 1RXVA 2A0UA 1TYDE 2QUAA 4P84A 3COPA 2P65A 2WIJA 5TLSA 3ADPA 4RLHA 5BQXA 5JS8A 4UASA 3PHHA 5D5VB 1WDWB 2JIMA 3P2IA 2C2ZA 4LISA 4PAOA 3QXXA 1I4DD 4TL6A 5FD6A 1M1YE 1UMBA 4JENA 4DYCA 3OWHA 1GPUA 2GD1O 4LV6A 1JUPA 3F9RA 4E22A 4B3JA 5EIBC 3R5HA 4R2HA 3AH8A 2L19A 3OG9A 3HN6A 4XCVA 3BT7A 4KLNA 5IMSA 4MR9A 1TCAA 2Q4TA 1WEKA 5HKKD 5AH0A 2R7UA 3GK3A 1MOPA 4PYOA 4LZNA 1N6RA 3S1AA 3HYLA 1JYSA 3CM0A 3GC6A 1MB2A 4ZVTA 2B2NA 1WCWA 1Q95A 2OV1A 3HKDA 3OY9A 4W7IA 5EY5B 3WISA 1P92A 4HZUB 3HY4A 2QSUA 2E34A 5FFFA 3FXUA 3OPYA 3GFTA 3UNGC 4IKEA 2DQZA 4L28A 2AX4A 3OHPA 2KLBA 3O8CA 4YONB 3S5UA 3AI3A 1I4LD 1M2NA 4GYYA 3S8MA 3TL3A 5BSTA 4QDXA 5KJ1A 4MO9A 1S02A 4WW0A 2C94A 2VOJA 3P0RA 3AKZA 4DIBA 4CH7A 3CDHA 3PFYA 4BQPA 1QS0B 1Z13A 3Q3VA 2ANBA 3PEVA 5KMGB 1QTRA 4Z6KA 3GGDA 2OYSA 1A4RA 1V48A 3PGJA 1H5QA 3QPDA 2GIZA 3SYNA 3HUGA 3O2JA 1VMIA 4UBIA 3A9CA 1HNXB 4JGIA 1FL9A 2IBDA 3KPJA 4X8HA 3WRXA 5HM8A 1RYFA 2Y2ZA 2MH2A 3L7MA 4LG0A 3CX7A 3GARA 4HAMA 1R88A 1MO3A 2ZR7A 3L1PA 2V45A 4UPEA 2GF2A 1GA4A 1A95A 2B6HA 1JEQA 3H9BA 1KEZA 3L04A 1J0EA 4A03A 3K5HA 4JBIA 3NBKA 2IPMA 4NBQA 3THWB 4TLBA 4WWHA 4NBVA 4QJ4A 2DJNA 2ICWG 3SZMA 3C3XA 3L2CA 3L46A 3KB8A 3J7AC 4R3WA 4UAUA 4JX9A 4IMIB 1WV1A 2JJ7A 1CQIA 3S44A 1U7TA 3ZOZA 4EFDA 2Q8KA 1XZPA 1AB6A 1TXGA 3A3YA 2JA5J 3PYXA 2JDID 1J1ZA 4QU9A 2B25A 3CVYA 3AL0C 3RHFA 1NU6A 1UBCA 1NNLA 4H7HA 2H9AA 2XODA 4N0QA 3UV6A 2O0HA 4E1AA 4LLNA 1PFYA 2XROA 4C5AA 3ZDEA 3MUOA 2XVYA 4EM0B 3A58B 4OQDA 1YDFA 1Q21A 2AFIB 5DGXA 3OR2C 1FBSA 1QBJA 2QLLA 2R5FA 3VR6D 2FSGA 2HXYA 3PF9A 1AJEA 2I22A 2V4UA 2RI0A 3K10A 4OHUA 4XIIA 4DYHA 2DBRA 5JYEA 1EWVA 1KBQA 5EP2A 5KNLA 4YUYA 2RQPA 3N3BC 3SJ7A 3WR5A 4DMLA 3FX2A 2PX0A 2HAEA 4QSMA 4XAQA 3IGFA 3HPQA 5UKDA 3I9FA 1G9XA 3ODPA 4DRYA 5I9IA 1PZHA 3RTAA 1QRYA 4F5YA 3EVFA 2PEZA 1R9TJ 1DP4A 3P9ZA 1H2XA 1T9ZA 4LSMA 1HDGO 1QRDA 5IARA 1F2TB 3UPDA 1DIGA 3DFMA 5FWXB 2P4SA 3GW8A 4EI9A 2RHOA 3RHSA 3KYIB 4LJ6A 3P2OA 2YHAA 5FLXK 4NFSA 5DX1A 2UXNA 5KDOA 2DU9A 1PO7A 2JW5A 5FWAA 1MENA 3TKAA 1B8OA 2PL3A 3CPSA 1QAMA 4YACA 1AQJA 1JLKA 1E3WA 1JI3A 2P5LC 2AQEA 2IYAA 2AFVA 5K3BA 1Z47A 1T0HB 5DM1A 3G5AA 4U9HS 4JAVC 3GRVA 2CNNA 4F3CA 3T7RA 3TJMA 3ZW9A 2HWWA 3U17A 4QDJA 2IP2A 2JIZD 1KI3A 3WGYA 2IHYA 1Z1DA 2ID4A 3F3YA 3DR3A 4N4AA 1YONA 3AI7A 3PDWA 1ADCA 1V3FA 1A3CA 4YCLA 4RKEA 4YAKA 3VNSA 4X60A 3WNVA 1BROA 1HA3A 1EK1A 2WR8A 4ZHQF 1TM3E 3TW4A 4HFJA 3QE9Y 1QCYA 2PRKA 4OMFG 1MTOA 3ADCA 2OHFA 3F8MA 5CVRA 1E4VA 3W5CA 4O4JA 3PHJA 2OCIA 1ZICA 4YJHB 3L2OB 4JYZA 3C2BA 4HLXA 1RBYA 1M2HA 3TVYA 3OQBA 5HMLA 1JSZA 3HCNA 2JAOA 1B6GA 1KYZA 4JP8A 3ZCPA 1GDHA 1KK0A 1W85B 3ABIA 5B64A 5LZ8A 2JVIA 4MP3A 4HZFA 5G0UA 4F5DA 2HJVA 2B34A 1SN7A 3C3CA 3SBEA 2GCNA 1TAUA 4DLUA 4Q39A 2FVXA 2WJPA 3HUDA 2F5VA 4ODIA 4ENSA 2A4MA 3ONEA 3JTEA 1SFOJ 3E61A 1I3KA 1ADJA 5KYYB 3FMVA 5KX5F 1GQQA 1T15A 2QX7A 4V2GA 5KX5B 3DMRA 4HTAA 5I9LA 4XKWA 4I55B 3GJTA 4F9EA 2P7HA 1GNLA 2CFSA 4BJ6A 4HLDA 1DINA 2BFEB 4OXKA 3RG8A 1D6JA 2DAPA 2P0AA 3VAAA 5KPJA 3IBTA 3LWNA 3AERB 4RMIA 4B8WA 4GL4A 1R74A 3F74A 4XVHA 3STHA 5BW6B 2GM3A 5JD3A 1JDUA 5HUJA 1JFFA 4M3EA 2ZRNA 1ZKMA 4HDKB 1L1QA 1SXJC 1M2EA 3AMVA 2H3HA 3H2SA 3H13A 3K2IA 3L3BA 2QUFA 2EFWA 4HAYA 3DT8A 3HM5A 1JDTA 2DWQA 1G3UA 3HCFA 3W2AA 4Z9AA 1G2OA 4FYIA 1DQNA 4Z53A 5A5VA 4J00A 2QQBA 3M70A 2OV8A 4A3JJ 4HDSB 3A1TA 4BMYA 1ZUNA 4XRGA 1FE8A 1N7JA 5DM60 3JRCA 3DV9A 2JLAA 2AJBA 3BR3A 1MNQA 1JLLB 4WCVA 4AIRA 2IX9A 5INTA 1K7YA 3W7BA 3HACA 5AONA 3UAGA 2P78A 4P32A 3KZ1E 4Y18A 3U37A 1W4CA 4AUKA 1SC4A 4URVR 1ZTRA 1UC9A 1H5NA 4QJ3A 3NHJA 3BSYA 2JCBA 4XM3A 8LDHA 1RHKA 1FLDA 1NUPA 1BWQA 1A8SA 1V4BA 2BGJA 4ZEOA 3FIWA 4FZJA 2EGGA 2RREA 5JBNA 3MQ4A 1JEOA 1NVVR 5F1JA 4X97A 5EVJA 5AT1A 3OTGA 2PGNA 4M76B 3H5AA 2WNHA 2WYOA 1BE6A 4L4UA 3JQEA 3KQYA 4HNTA 4P3OA 4OXNA 1YQXA 2WIGA 4G4JA 2JJ1A 1EX1A 1U5AA 4D0SA 4MW1A 4BP1A 2Y1GA 4AJEA 3DLHA 3L2RA 3ZWKA 4AMYA 3A14A 2ZBGA 3I5MA 5EWJA 5K0TA 3ENKA 1FRNA 4RVGA 2ZSHA 1DP7P 2PUAA 1QF7A 2KMLA 1FP7A 4OP3A 3EDMA 3R8XA 2QZJA 3DO5A 1S4QA 1YWGO 1R8XA 3T6KA 4F4DA 5AW4A 5IRCD 1Y6QA 3LVQE 2Z09A 4IDOA 4DA4A 1UFOA 1FDSA 2QGUA 3DUFA 2ZXWH 821PA 1ZAKA 2BFAA 3N5KA 2EZ4A 2LKCA 4OQPA 4F8YA 2IH2A 3LFTA 2G72A 3ICPA 3QVMA 1GTJ1 2TMDA 1TQPA 1QJ4A 1HDCA 1JQLB 3AG1H 3ZWMA 2P9TA 3E53A 5AQEA 3T54A 4DDTA 3G82C 2PLWA 2C4WA 4GKJB 5HF5A 4KGDA 2GHTA 4I9UA 2BGKA 5JFRA 3GDHA 3ZD6A 3STYA 3MM4A 3IUOA 5AVTA 3W3AH 1FUUA 2EXXA 3HP1A 3HE3A 1U2TA 3WGTA 1M73E 1C0LA 3CLTC 1ORRA 1FLVA 2QUZA 3D7KA 2XA1A 4N6OA 3OY7A 2OCAA 1J5YA 3TW6A 4LWQA 2WB2A 2X0DA 2V8OA 3VTKA 2ZDQA 4TT3A 5D6OA 3WLNA 4EAQA 2XMQA 1E6KA 3ZW7A 1US8A 4CM4B 4FETA 3TIVA 5E4FA 2HJWA 5A6SB 1DWUA 5CFQA 2R6ZA 4LKOA 2F6CA 3NM6B 4C4TA 1UWCA 1UB9A 3F2VA 5L9AA 4DOMA 4XUGB 1JHVA 2Q5JA 3F4KA 1R4NA 1W76A 4V2FA 4WKBA 4TWAA 1QUEA 2FQ3A 4Y2HA 4XA8A 1ZY2A 3KEQA 3OX2A 3QOFA 1JKJB 2XOXA 4I1YA 4LVUA 1HQYE 3IAS6 3G1WA 3JR9A 4UVHA 1TIKA 5KAMA 2MSYA 3KSUA 2NS8A 2VSYA 1LV8A 2DERA 3K5WA 4L0YB 1UJ5A 3RJ5A 5F9HA 5JTTA 3H17A 2A6HF 3LCUA 1R4MA 5JUWA 5CDFA 3QA3E 1EE1A 2PGAA 2KRFA 4DIUA 1EGHA 2AFHE 2B9VA 1Y4SA 4LG1A 1OSNA 5I7HA 2XPWA 3LOUA 1P74A 1E4OA 2IGKA 2NO4A 2FJUA 4FIDA 4WNYA 3CZQA 1RE0A 4QGHA 3RPUA 2Z2JA 4PG5A 3DHVA 4YGYA 3JV7A 3B3GA 1E3TA 3TLCA 3ZQ6A 4NQRA 4FKMA 3PQJA 2NT3A 3H3JA 2W6ZA 3UWSA 1ZIYA 3QHQA 4ND3A 2A07F 4NY1A 4ABZA 4HGRA 1ZGAA 1TZJA 2B82A 5JNWA 3CUWA 3NIBA 3PSIA 1ZQ1A 2KIUA 1LJUA 2LF8A 3CGWA 2OSBA 5F35A 4RTRA 2XD9A 1Y39A 4BRZA 2CHUA 2GDZA 3MTGA 1H8ED 3NOXA 1V1RB 4G1FA 4QNMA 4DR2B 4E5VA 5DNWA 3R4VA 3RODA 3JQFC 5LYJA 1G8GA 1FPQA 2CW0F 3UFBA 4DXAA 4MTCA 2HSGA 2CBZA 3A4NA 2ENWA 1GZ6A 3H87A 5G4KA 4YUZA 3R0IA 1Q92A 2PMEA 4MULA 3FKSD 4YIHA 1WH5A 2QXYA 1GADO 8ABPA 3KELA 4IUBS 4HSGA 1J33A 3D3EA 2DK8A 3KYDB 1VLLA 3BSFA 3VU0A 2JLXA 5AM0A 1RZ4A 3JSPA 1E7YA 2WJJA 3I1JA 1RRJA 3SZGA 1OF1A 2X7JA 1QONA 3BDDA 2L5QA 1JHOA 1YRQA 2FZKA 1MH9A 3Q12A 3WG9A 3IHTA 3TCKA 3T12A 2CLEB 1E5QA 2WVJA 1YRWA 4AJKA 4WGFA 3MB5A 2BFBA 2GT1A 1GFIA 3KG2A 1F8XA 1BNCA 4CYDA 3PIOF 4AXXA 1W75A 1KU2A 1JR3E 1RM0A 1ORWA 4QXAA 1E4EB 4YRQA 3U3DA 2K7FA 3ITDA 4KGVA 5JI2E 3KQWA 2M3AA 1EP3B 5EJ4A 1EFHA 4MV9A 1EK5A 1U5BA 3MPOA 3GTLJ 4WVLA 1N2BA 4Z9FA 2H07A 2XRLA 1MXFA 2WG0A 1U2ZA 4XKBA 1FXWF 1XRRA 1SPBS 3IHLA 2JFFA 2H1SA 1DELA 1HFJA 3GLGB 2PKRA 4ARVA 1WCIA 2PJUA 4L8FA 5FX2A 2GPSA 5TMBA 2WSMA 3UH0A 3Q11A 2DKOA 2OG1A 5FBVB 5AW0A 4Q3AA 4HN9A 3DDZX 1AOXA 1IRXA 5EE1A 4LRSB 1WKMA 3QM1A 1QSGA 4G1EB 4GD3Q 4KBYA 2PA3A 5A0TA 2D5IA 3PWSA 4FGUA 4HDRB 4Q47A 2Y0SN 2WKPA 3RZDJ 2YDYA 3LY8A 4WCFB 1JAYA 1C9DB 2J6IA 5AW7A 1ZSYA 3RF7A 5AW5A 4GGGA 2J59A 4D80A 2C7BA 4RKFA 4YRLA 3JWPA 1WVIA 3KHKA 3D3WA 3G49A 1C4OA 1DRVA 2R86A 5GIPE 3TRIA 1W1IA 4DCMA 4E4YA 5L7WA 2QTNA 4OGFA 2MINA 4Q3DA 2QUBA 3JPWA 3R8CA 1BR1A 3OJLA 1WZNA 3JW8A 1ORIA 3EH1A 2FPGA 3NRVA 2R47A 2VK8A 1EG2A 3ZI4A 2CVFA 2PS9A 1J7KA 1K98A 3WKBA 5E2IA 4UB6C 4LFCB 1I3MA 1ZH0A 1T6SA 4BH9A 5CAEB 2M98A 2QQEA 3L00A 2FQQA 5FXMA 4JR0A 5C2JB 1Z5NA 3GA5A 2Q9BA 3EPRA 3JU3A 4BNGA 2LNBA 3DXJF 3BILA 1B1BA 4JBHA 5ICFA 3W34A 2COUA 1DB3A 1NQ5A 3TMYA 3UKGA 2V6MA 3PEEA 5IU6A 1KI1A 3FSGA 4J1TC 5D3KA 4I9GA 3AR2A 2R5WA 4JVSB 4KXXA 5LU9A 2NVYJ 2MOKA 1XG5A 1NHWA 1KYIA 1MAVA 1GNVA 1QYWA 1SU6A 4ZI7A 3S2WA 1IHPA 2P6PA 3TRHA 4BLTA 4O29A 4B3XA 2B69A 4LZWA 2XUIA 1C3VA 1NSTA 4U3JB 4A2UA 3S6JA 1LFUP 3G0BA 3IELA 4YBRA 5CCXA 3IP3A 5I8WA 1EP1B 1LEHA 4L15A 4O4IF 3OO0A 2VJIA 2HHAA 1Z36A 3EZFA 4O4IB 1G6Q1 4R8MA 2C6YA 3MNFA 2X5JO 4E2YA 2JBAA 5FFZA 3G9ZA 3GBPA 2ZIEA 3O91A 3RJPA 2GOXB 3QIAA 2EWVA 1LS1A 1GA1A 3NJ4A 3F98A 3B9BA 4OMYA 4JVMA 3GRAA 3PEYA 1W29A 1UZCA 5JBIA 3AOEC 1DJQA 3U7HB 2JGEA 3G8AA 1ID8A 1G5PA 3NEPX 2JA7J 3QFTA 3MWGA 1IO2A 4DF3A 2JMWA 4JKYA 3ZY3A 1U8EA 5J8CA 1J99A 1X7DA 2J5QA 2VAXA 4MVJA 1NQUA 2ID6A 3ILVA 1JJ7A 4J0KA 4CLRB 1YA6A 3J80Z 5LYYA 4ND4A 3ZU3A 3CSDA 2YHIB 3LCMA 3KQUA 2FZCA 3B6AA 1XVAA 4HMQA 4Q4HB 1HKSA 3TLGA 3HR8A 4YVFA 2ZMEA 4NARA 1UOEA 4HB4A 4COKA 4TXNA 2WJ6A 2OLKA 3T0GA 3CHYA 1J2JA 1OH8A 5F1PA 3K31A 5JZMA 3RTDA 1YQQA 1YU6A 1WI9A 2ADFA 1P3JA 3GJSA 3BK7A 1ACJA 5IVIA 3VC7A 2IIPA 3QVSA 3KEYA 1OW3B 2C9DA 2D2XA 4HEA2 5LHIA 3C3PA 4ZKDA 4RSRA 3H97A 5I5EA 3H3UA 4YIFA 5B58C 1PK8A 1R5BA 1RXSA 2O4CA 1L8XA 3KVYA 4NJMA 1XZGA 2ANCA 1HSZA 4ABTA 4DYQA 3DW1X 2XPCA 4AQ7A 3SOPA 2ILTA 3AIMA 3GU3A 4NECA 1XHEA 2YV4A 3L6UA 1IRFA 2UYCA 1F6DA 4FLEA 1BQ3A 3FM3A 2DA1A 2EKLA 4N0EA 1L9KA 3GJ7A 2A61A 3M83A 2X42A 4NESA 3PXGA 5FRDA 5FPYA 4QNNA 1NP7A 3EF3A 3SSAA 2LMDA 3CH5A 5ICEA 3QKRA 4UEOA 1XLWA 2WMOB 1U8CB 5I51A 1CUBA 2VJPA 3DFZA 4I3HA 2HA0A 1LS6A 1A36A 3HSKA 3BHMA 2FSHA 4QUBA 1WABA 4MB0A 2W2XA 1QAOA 5KINB 3INTA 3TE6A 1EWTA 4ZYUA 5BPFA 1FF9A 1BIBA 1GUFA 1PT9A 4JHLA 2I6QA 5LGTA 4WCGA 2ID7A 3LGXA 5CJJA 2Z30A 5BVGA 3H5RA 4XLEA 5CK4A 4D4MA 4DMMA 4JU9A 4KTVE 5AYVA 5T8KA 3DQQA 4W5NA 3CF4A 5IYDJ 3D5LA 1LKZA 4GR4A 5BN1A 5TMPA 1BRTA 1VLMA 1LEAA 2CJXA 1COWD 2W5UA 2L2QA 2O3TA 4AF7A 2IE0A 3O8QB 4TL7A 5TT0A 1IHDA 4C4AA 1NFFA 1PP7U 1WZ2A 3CMCO 2Z2YA 2PN1A 1P2SA 2W58A 3RKSA 3O38A 4AZTA 2HB6A 3FPBA 1PFGA 1TNTA 3OOYA 2QQ5A 3ZWPA 1QO9A 4BFCA 4P33A 3SP1A 1EK2A 3FK6A 3QXCA 2XIQA 1J8MF 1T0BA 4CMHA 4KVGA 3I1IA 5IT9Z 1XNHA 1XAHA 3KD3A 2OQIA 4MVJI 5IT4A 4G8JA 5AFSA 2H4FA 1TECE 4LHXA 4JUAA 4JJAA 4XZ3A 4BJ5C 3JQBA 1S6YA 3BK1A 2ZJAA 3IKLA 1U78A 4XDZA 3NH6A 1PJ8A 3AV0B 2HC9A 2PANA 3VGJA 1E1RA 1I24A 2ZGVA 1N6PA 4L8LA 2ZTLA 5E6SB 5F21A 1RAGA 1T3GA 1IHYA 3BXHA 2P5TB 2H7CA 4TMYA 4IHWA 2AOWA 3CZRA 1N2SA 3E3AA 3QMVA 2JUCA 1EHCA 4J7CA 1Y3BE 2IA5A 1YB5A 5HXAA 4FYWA 3FF4A 3KWFA 5K20A 3GPLA 1WA5A 5AP9A 3D8BA 3K8YA 2KHZA 4B40A 5HNHA 3PV0A 3AR5A 2PD4A 1S7OA 4RPGA 4X95A 4RD4A 3ZLJA 1P9RA 4BNXA 3C6ZA 3VRHA 3GJ6A 2DHDA 2GCEA 5D4SA 3MLBA 3P4YA 4MVJM 4R4JA 3OMWA 2H2AA 1A5AB 3AOGA 4NATA 2KZGA 4WNIA 1C2YA 2WF9A 4UXJA 4CR6A 2DT5A 4Y6SA 2QAGA 4DIOA 5EVCA 4Q9IA 3AVXA 1Z8NA 3G0CA 2K85A 2AUNA 3NBZC 4G2NA 3OPNA 2IZZA 3OCYA 4FOTA 1C0KA 4LGWA 4QE3A 4J2TA 3HL2A 3M8KA 1HETA 4WLEA 5F7XA 2HI0A 4NV3A 2Y9PB 1BXRB 5KWIA 4UBJA 4I3FA 1F1JA 2ZVJA 4MS3B 4IFIA 4CG1A 4GKKB 2DR0A 1KJIA 5IJXA 4RKRA 4WOJA 5HKOA 1O96A 3RVBA 3AJ9A 2PH7A 3VVLA 3TECE 3M6MD 4MUNA 3HWSA 1KK3A 4IHYA 4BQQA 1E20A 4L27A 3DNMA 3ROKA 2JA6J 5LDDC 1Z12A 5K3AA 3PTLA 2X7XA 1ONOA 3KP4A 4XRRA 5CJ2A 2VG8A 1U5CA 1MV5A 2XUKA 5E79C 3EFOA 1Z17A 2XMZA 3WQBA 3UW3A 2E5LB 1CXZA 4HAZA 3I0NA 4N5MA 4ZYYA 4B85A 4IVRA 1YRBA 1U0LA 4BHBA 2O9LA 2ZIWB 3R44A 1MZVA 2B4YA 1R0BA 3OFKA 4V02A 4PLGA 3DDNA 4D6YA 2GYUA 4CF3A 5A9SA 1IJKA 3HDVA 4RYDA 1B8UA 2NU8B 4MRVA 1U7HA 4F2WA 2ISYA 1TAHA 2REQB 3DE6X 3IQIX 1O97D 2OBMA 2V6IA 4X1YA 1GUBA 4OV6B 3ABTA 2G7UA 1JR6A 4H3VA 3RRZA 4RB2C 1HPLA 1NK3P 3BIJA 2JAXA 1L3CA 3UGKA 2WMYA 1L7NA 4XK4A 1VIDA 2P3QA 1WUKS 3M6UA 1GV1A 2P9GA 2QN6A 3BA1A 2I3AA 4EZBA 1S9HA 2PUJA 2LY9A 3CS3A 3W2GA 5AK3A 1GFSA 1LPOA 2R6R1 3DEJA 4RAFA 3DOIA 1RQ2A 2Y67A 3ZCXA 3UOGA 2GHQA 3TIFA 2RK4A 4UUBA 5JAMA 2O2YA 3BCUA 1IEXA 5M5BA 2XB4A 3HZRA 1ZXBA 3B70A 5F9FA 1RFLA 1BE8A 1DXHA 3TTVA 2OWEA 5FD8A 4OATA 4KV7A 4Z0PA 1ZYRF 1NJ1A 2IY9A 5C81A 3IJEB 1J9GA 4BUPA 1G7CA 3BCBA 2LR8A 4CEHA 4B44A 1UZMA 1LTHR 3S7TA 2HO5A 5LOVF 3L4SO 3K0CA 3FB1A 1ZGJA 5LOVB 3SHOA 4BV9A 4C6RA 3C0KA 1YKSA 2G4VA 2VKDA 3CTPA 3WB1A 1MJNA 5H1YA 4DIKA 2EWNA 1UBGA 3DMFA 2J3IA 1WW3A 3G2OA 5E1BA 2STTA 2VTKA 3HRKA 4OIMA 2YV5A 3C7KA 1H6BA 3RTRA 1U0TA 1K5GA 3DZIA 3W77A 3TINA 1OZ0A 1GXSB 3PKJA 2V74B 1IHOA 4D4JA 4OEHA 4MQVA 3KQOA 3ROUA 3HOYJ 1F9AA 4H6WA 3ZVKA 3B1JA 3KCQA 4E5UA 5IUKC 3JWHA 1GLNA 2HSJA 1E18A 5LLDA 2V6JA 3ZHSA 2DJIA 1L5HB 5DGHA 5AVVA 1Q7TA 4X1KB 3CF2A 4DSZA 3IVXA 4NAHA 3OIGA 2XDAA 3GWZA 4BB0A 4QZVA 4YA6A 2WWIA 1QR2A 3BH0A 4R31A 2J3QA 3M5CA 3WMEA 2F9MA 2IOHA 3V32A 4G8XA 3K6SB 4DW8A 1ZN9A 4JUDX 1E2MA 5B3SH 3E5HA 1S3GA 3DEUA 3ABZA 3NFRA 1PS0A 4WADA 2GS9A 3JTHA 5LLSA 3L6CA 3KKQA 1EJ2A 2CHGA 2Z9OA 4XFJA 1Q6ZA 4MUXA 1Z26A 2WF5A 1R71A 1X7XB 4JUCA 2P4WA 2JLCA 1B9NA 3QF4B 5K6RA 5KOJB 5CBPB 4UDNA 2JI6A 2ZIAA 2CLIB 3P9QA 5AD1A 3GRCA 4XW2A 5DHQA 4ZCRA 5A4JA 2XXAA 4BP9A 4CPDA 3BN3A 2VXZA 4CM1A 1G19A 2H16A 4KRFA 2Q3MA 1S8NA 2KRHA 2ZRAA 1FSFA 2G71A 4FMDB 1TKBA 2XKBA 4LJYA 4W4TA 2PZAA 1B3RA 5CFRA 3KQPA 5CM9C 4WA7A 3ML6A 1WY7A 1GU7A 4R81A 4DLYA 3VKVA 5E9WA 1VA5A 4UV8A 1ZEMA 1NRJB 5IYBJ 4AIDA 1TKCA 2V5UA 1SFRA 2ZS8A 1QXSA 3ZNOA 1OZAA 4WDQA 3BJRA 1T0IA 1ZH5A 1TW2A 1YOVA 1HV8A 3I3OA 5DIFA 3W5SA 1T56A 2VUUA 3JQ9C 3AF3A 1NHAA 1I2ZA 5KVRA 2Z4RA 3EMVA 1R2QA 2XUFA 2XRFA 4HBGA 3G6EI 2PN6A 5IP7J 1ML4A 2EBIA 1U2DA 2DFLA 4FYPA 4I19A 5EQTA 5BV7A 5EDNA 1JWBB 3LPCA 3C5WP 3UICA 4KPYA 4C22A 4RW0A 1UKVY 13PKA 2AZMA 3MXTA 3NAQA 5TF4A 2AXTC 3KFXA 3PJDA 3F67A 3P5BA 3IP5A 4NPHA 2VHZA 1AUVA 3OT4A 2C8JA 1RAIA 2CJYA 3L82B 5I47A 4FSHA 2X9VA 1VPVA 2YZ7A 3RROA 3MK31 2Y75A 5FYQA 3DL4A 4UOZA 1WX1A 5JVDA 4XQFA 4BO1A 5FFNA 2AEEA 3CLQA 4L9VA 4Z9BA 2PFKA 2ZUCA 2XRYA 1N6OA 2ZKZA 2QDKA 4NULA 1F4VA 3R9IA 5KQMA 4Y9SA 3N2NA 1JGTA 4FXPA 3G5TA 1PJAA 1BDBA 3DZFA 4I0BA 1KZGB 2WTBA 1ZK8A 1EH7A 3ONDA 5F2NA 1JYFA 2HVSA 4FZ5A 4MJXA 4OU0A 2NN3C 1V4RA 1UIRA 2A84A 2E6KA 3ZNNA 2R1UA 5EIOA 1V96A 1QG0A 3DLAA 3ZKWB 1L5GB 2HOSA 1IB6A 3TRFA 1ZD5A 3OE7A 1TMKA 1T2KA 1NVAA 5EMHA 4LITA 4DLBA 4N5DA 1TA9A 1DDIA 1E3LA 1DCFA 4NOKA 1ESNA 2RJOA 1VPTA 4FYVA 1B1CA 3SX2A 2QK4A 3DOFA 1X7ZA 3A70A 2GAJA 5ALGA 3MJSA 2OC6A 2VSNA 1YR6A 5G41A 4F4CA 2KJBA 4LDJA 2CGEA 2ZJZA 4ARAA 2R48A 3CUOA 1I3QJ 3OOEA 2P7IA 4IXNA 3PCRB 1ZG1A 1ZOPA 2R7KA 1BA2A 1KBOA 1L7RA 2OAP1 4Q15A 2H92A 2DR2A 4MTLA 1KPGA 2EZKA 2Q3CA 2NU7A 4B6RA 1A2QA 2PE5A 3MTAA 3C7JA 4DBRA 3U7RA 3ZWYA 1T4CB 1EEXB 1B2LA 1BOOA 2X5KO 2O05A 5FBQB 3DL7A 1Q1BA 2JSPA 1YQGA 4KB5A 4OOEA 5EGOA 4R40A 1KI9A 2WKRA 2Y2VA 1HTBA 5ADHA 2Q2VA 2CRGA 4LK3A 1T2AA 5JQGA 5CB4F 3GCWA 1N3LA 4H0CA 1FDVA 5CB4B 2QG6A 1O94A 3PEUA 4IJ5A 5LJLA 3RBXA 4KOEC 2YC2C 2V1DA 4WXEA 1QA6A 5FWNA 3J7AO 3S16J 5D5PA 1QIIA 2IGTA 5ILVA 4QOGA 5ALWA 2CUTA 4MV0A 2E5NA 5LM3A 4ACAA 1LBQA 1R9JA 1D6MA 4E4TA 3RFTA 3NHWA 5HQ3B 4U7BA 3RK0A 2PMUA 3SFZA 2I2AA 1E61A 2CSOA 4NG5A 3FNBA 5G2OA 5FUBA 1D0XA 4LXUA 2IT1A 2CMGA 5LU8A 4JC0A 5FTJA 2VS1A 2IV3A 2YN2A 2VZ9A 2OAGA 4BWGA 2E87A 5EKTA 3UHJA 3BWMA 5AM4A 4ZA2A 5ITVA 3O7MA 4HBZA 2NU9B 2VLBA 4RZ3A 4D25A 4IO1A 3WLLA 5CITA 5FORA 1YKGA 4BBRJ 4D3ZA 4TKVA 4I6JA 1YFKA 4LN1A 3CEJA 4HV5A 2A14A 1MKYA 4RK0A 1C2TA 3T3NA 1HO3A 2OD5A 5ALYA 3ZK9A 2IDMA 1G6KA 5TJJA 2R6GA 1BHO1 1B6TA 3D7RA 5C34B 4L95C 5LXTF 3PS9A 3DM9B 4GUAA 4URUR 4XPZA 3L1VA 2HA4A 3AWIA 2B9EA 5IWCA 4K05A 4IDBA 4QEKA 6PFKA 4UEKA 4MLOA 4JX4A 4FD2A 1BHSA 3T8YA 3DTVB 3UFXA 4LY0A 1DXQA 2XNCA 4IM7A 2P9EA 2G0AA 1FFDA 4NFLA 5I4KA 1KQGA 2NVBA 3DCYA 3FVQA 4G9BA 4J6EA 1C9MA 5D3ZA 2G9NA 2CZQA 3IVCA 1P0IA 1UJBA 4PCAA 5BPHA 4E3WA 2QZPA 4R05A 3GZTB 4RENA 2A0FA 4D6XA 1B6RA 2FEPA 1DAHA 4C4XA 4NCNA 3WB2A 5FUQA 3DZDA 2DQRA 1P3Y1 4XYMA 1WQ4A 1OCZH 4HQMA 1ZINA 4XM1A 1M67A 2JARA 3ONQA 1DGQA 3S1MJ 3H1AA 2DKNA 5IUJC 4Q4AA 2Q5CA 3TD6A 4QUIA 2WSSD 3JXEA 5CNJA 5FKOA 4KITB 1H3EA 1ZFNA 4A10A 5ALSA 2ZRGA 5DYGA 1RWBA 4GMKA 4D4HA 1Y6JA 5B1YA 1Y1SA 1WXQA 2LRHA 5FRMA 1T0FA 3GEIA 2PIAA 4YRPA 4Q05A 3K70B 3SSOA 2PUWA 2GNPA 4Z7QB 2NNNA 5U9CA 4PHCA 5L3DA 5E9QA 4H1WA 2QTWB 1XA3A 3TP3A 2IEBA 1YZ3A 2Z9BA 3EUHA 4YAGA 2DPHA 1JDVA 3FWEA 1CIVA 2C0PA 2R0QC 2ZJBA 2MWMA 2FEXA 3GN1A 4JLAA 3OZ7A 1ZD9A 2D4HA 2V1NA 2DT6A 3FB4A 2IQ5A 3LA3A 4JI4B 3GT0A 5A62A 1QGZA 4MV1A 3ZGKA 3FIJA 1NYTA 2NZ8A 4HRXA 4G1UC 3WLMA 5H70A 5BWOA 1NJ8A 1AUQA 4BQIA 1IMOA 3ZMTA 4LVNA 2D74A 4YP7A 5MF6A 1WL8A 2UZ0A 5EZ5A 3BCAA 4FFWA 1P45A 4A73A 2OTCA 3L8GA 5BNZA 4ESBA 4C3OB 3L5OA 1FBTA 2OUKA 3SZRA 1KK1A 3RSQA 5CA0F 3H16A 2VDPB 2O2ZA 3TQTA 3OZSA 4HWGA 1HF0A 5CA0B 4DCPA 1YZHA 4ZN6A 4MW9A 2GAFA 4YRRA 4TSFA 5L3CA 1HT0A 2YJ4A 3EXIB 4N5IX 3MA0A 1WMAA 2A86A 1JE0A 1T9DA 3P4UA 4AJ1A 4QDOA 1J1UA 1SD7A 1YVDA 1FJ2A 5AR1A 2VWHA 1F2UB 1NT2A 2IU3A 4EGJA 4RF2A 1YUBA 4UY8I 3EZLA 3BMNA 3ROPA 1PJLA 3DDHA 3UUWA 4YCDA 2AGVA 5B6IA 4IH1A 1ORTA 2XDVA 2XTJA 1KFEB 3L40A 1LLUA 4PXSA 3RKUA 2MFZA 2BDEA 4ZQBA 4M9SA 2H0RA 2QJOA 3K1NA 4F72A 1SBZA 2PUVA 1XOIA 3RU9A 5A4DA 2ZRJA 2MABA 1Z4MA 1QKJA 4CL3A 2IPOA 1T6NA 2MDTA 3VR2A 1MDFA 4EI7A 1BJTA 4ZQEA 1XTSA 3DF8A 1YK1A 2PKYX 5EFOA 3BE8A 1KIFA 1PUFB 4CV0A 3D8NA 1QO7A 4F1WA 2EFDB 5G3ZA 3WU2C 3U56A 4JYAB 1IAVA 2EZ9A 3ZOBA 3QVKA 3G8BA 3T5XA 4H7DA 1PUIA 4TKMA 3EZGA 5ITZB 2GEVA 3TL4X 3NC1C 2EL7A 3WHBA 5BPIA 2K9NA 1KVSA 3PHGA 3ZIAA 3HWWA 4F91B 1G1AA 2P9QA 1RZUA 4EEZA 2ZBFA 4R68A 1E8MA 1FRQA 1KDZA 5KTMA 4D5EA 4J7UA 3OP1A 1E1YA 3E9ZA 3L7KA 3E6BA 2QBYB 2WLSA 1USUA 4OLBA 3ZE8A 3C4QA 3HL0A 4UU0A 1ODJA 2VHWA 4W1QA 4PHGA 3SXUA 3UW1A 4KXLA 4B6FA 2HUNA 1D2AA 1F0YA 2NO5A 3CUQA 2HEOA 4C7OB 2HADA 5L4SA 1ZAYA 4YMUA 4ETSA 4RZHA 3AY7A 2VAMA 5J5CA 1N9KA 1EZZA 1GAJA 3VU9B 4PCLA 4BKXA 3G8CA 3CZCA 4G24A 4DBZA 1T36A 2QEXI 4PPGA 1SB9A 4C1NA 4HPQA 4ZHQB 3HTUA 1A5BB 4NFYA 3OEED 1CSEE 1SZDA 4RWZA 3M9AA 1N2JA 3H2ZA 4BO0A 3EZXA 2NO1A 4B87A 3CT6A 5LGNA 1IOVA 3OYEA 3HSYA 2UZ3A 2MHCA 4D92A 4QASA 1WKVA 5F2EA 1QFSA 1CDOA 3RQSA 4EQQA 5KSWB 5C80A 1NVWQ 3I2GA 3R0VA 2R6AA 1Z2DA 3NWPA 4FK8A 1MD9A 3EZ9A 1QIJA 4G37A 3EOZA 4EY6A 1Z2CA 3ZD8A 4P81A 3BCRA 3PB3A 2QW0X 4Q34A 4POAA 5BRJA 3RIHA 3EQLF 3I5UA 1TDJA 1YJCA 3STXA 1WXEA 2BMEA 4GLJA 1G9SA 2PCLA 4XJSA 1YVRA 2NVWA 1C0WA 1MEOA 3NHZA 2CNWD 2P2LA 3IUSA 2BFNA 3ZZTA 3PC2A 3K32A 2WMDA 1QH1B 1XVUA 4CKBA 2QHXA 3PGXA 1J07A 4ZVLA 2JH3A 3UAVA 1OIXA 5K51A 3AFHA 3R6SA 5AVWA 1O0SA 3TSOA 5AKXA 4YT5A 5TPZD 3UC9A 4OBEA 2CGPA 4LDZA 2C1ZA 4LQ4A 5AHOA 4BE0A 4U88A 4NZ9A 5HUHA 2Q3HA 2VHXA 3NBYC 3ITKA 2C84A 2B99A 2QU7A 2IX3A 3E0QA 2IW3A 2CJPA 1M8GA 4E94A 3FVWA 1UFMA 4DBVO 1HE4A 4GHWA 2EVWX 1ECJA 4RX1A 5L51A 2GN8A 2QQ9A 3FYHA 1NF9A 3H84A 3E6DA 2ZI9A 4I1PA 3S2YA 2ZYRA 4ZQFA 5E7IA 4FWIB 1W36D 2AW5A 3A6KA 2C58A 3O8BA 1UC4B 2VQ6A 2I76A 4P0QB 1CRPA 4R7ZA 1HL7A 1SKMA 2BN4A 2NVOA 4Z4QA 2C59A 4P22A 4CM8A 1CJTC 4LQLA 1K5DA 1C3EA 4BQNA 1F8YA 1D3YA 3CZPA 1ZMRA 5DCLA 1A71A 3LHIA 3T0YA 3G0IA 3DMDA 4XGNA 4XD7D 4OK5A 4EI8A 2P7VB 1USGA 1E1QA 3OH8A 4QPNA 5C7IO 1BCRB 3S3TA 4U2GA 1X1TA 3SZTA 2JFBA 5ANRB 4HR7A 2XV1A 4G5FA 5K1YA 4BNCA 4CHUA 5DGTA 3JWIA 4R2MA 1Q19A 5HTKA 4B7UA 4NBWA 1TLFA 2JH8A 3L2UA 2YIMA 2IHNA 3JQQA 1LWNA 1VQ4I 2HQAA 1O08A 2QJWA 2RHBA 4M86A 2HK9A 1X2BA 4FMCF 3NGXA 2BEJA 4K0RA 2P0YA 2E2JJ 3PQ7A 1FW8A 1L4GA 4V0RA 1ACMA 4N5NA 5FFXA 2YASA 2O2CA 2CB9A 1JAHA 3TAHA 3EGVA 4M7RA 2E2WA 2C8LA 1Z6PA 3N6RA 3DM5A 1HBJA 2N47A 3AQIA 3CLUD 4D9GA 3MINA 2PWYA 4EITA 3B7WA 1D1AA 1JEYB 2WWVD 3MCZA 4KSYA 4KCGA 2BF4A 1OBCA 1U6IA 4UOQA 3ZDZB 4JIMA 1LF0A 4CCWA 3IEXA 3J81k 1UAYA 4NSNA 2Q6KA 3EXEA 3KPYA 1WTCA 3NALA 3JQAB 4MR7A 5LKRA 3OD5A 4P3KA 5E1ZB 4AJIA 1IV6A 5DN9A 2D4AA 5DT9A 3EDCA 5AW9A 2VSFA 3TSAA 2HIMA 3FMFA 2ZZKA 3F5QA 2TECE 5IAJA 4GE3A 3W2IA 4HWTA 4KI7A 4R1UA 2DZDA 3CN9A 5ALKA 4JVNA 3GQBA 2L0KA 4C7VA 4G6ZA 2HFKA 2O20A 3FLEA 2PKCA 1PV4A 3TGLA 3CUEF 5IDQA 2MYTA 2KRCA 3UTCA 1W4LA 5JECA 3FHNA 4WXRA 2FXAA 5HKBA 1VBNA 3KQKA 1EVQA 1BOFA 3BGIA 1YZKA 1Z39A 2QMZA 2YXPX 2KFDA 3T52A 1YJBA 3CIFA 1M2GA 5ELMA 1N5OX 2WKQA 4DMHA 2GKSA 2LREA 2A9KA 5TEVA 3N0WA 1YX3A 2OCBA 3CONA 3WI7A 4F9TA 3I73A 3QIVA 2A3NA 1IXRC 1IPHA 1O54A 3PEWA 2C9ZA 3HNPA 5AXAA 3AIKA 4XJTA 1Q77A 1ZU4A 3SC2A 2PVPA 1DEAA 1ZGGA 3FSJX 4YN3A 1XD2A 4J4HA 1E2NA 3BB1A 4QJBA 1NQWA 5JLAA 4IOLA 3OIUA 1H0HA 4YV0A 3QBVA 3ACDA 4CCOA 1XVTA 3OL3A 4R83A 4ENTA 3ET5A 1IBSA 1QHFA 1RYDA 5B57C 4Z2AA 5G1NA 3D3KA 3GV0A 5C5DA 1FYKA 2ILVA 3P2KA 3H36A 2BR3A 1TEXA 4HI0E 4EJSB 1OX4B 1CJCA 5A4FS 2Y1OA 4KPGA 1EXDA 2PL1A 2Q3JA 5FLXZ 1WPRA 3CLOA 5A5GA 3BWEA 1L5SA 1JUDA 1T6YA 2IBSA 4I4NA 5LLQA 5FFMA 4AVZA 2JK3A 1WB4A 2R92J 4WZBE 3W6KB 3WZMA 3U4IA 2QQAA 2HBQA 1JXSA 3DVRX 4L3WA 1KZ4A 2CCGA 1QK3A 5JC1A 4Q3EA 1KK2A 4JL5A 3EVTA 4G86A 2PTHA 5JSFA 3IV6A 3DB1A 4XNFA 2YJGA 4D9FA 3CNNA 2G1KA 4KTTE 2IOFA 4DNQA 4M2LA 2W43A 2QLFA 2OT3B 3PSFA 2QVOA 2CHVA 5A4IS 4WOPA 4QECA 1DOAA 4HUQA 1KVUA 5CVJA 3GW2A 4WCFC 2W37A 2FOLA 2YWXA 1J2EA 5IP5A 2J87A 2EEZA 4PC2A 3DHWC 3I2JA 4BHCA 2A9OA 2FEZA 3D3QA 3UQZA 5IABA 1SOAA 3CVXA 2WMNB 1IXKA 2E2HJ 2NXNA 2QL5A 2EG9A 1RJ9B 1M1EB 4MPTA 2DDAA 2GHIA 4Y6PA 4CRWB 3VU3A 3A1VA 2W24A 4FQ7A 3C5CA 2HH9A 1PR1A 5DW3A 3LRPA 4KJXA 1F6BA 3TGPA 1DAGA 4KQHA 2BZTA 1UG2A 4FYJA 4BC0A 1RLJA 3DZ8A 2X0RA 4CXFA 3LCRA 4AURA 2X0KA 4ES6A 3DVAA 3NEUA 4ZXFA 2LGJA 2VWGA 4M3BA 1G8HA 1FMLA 1V1MB 4ZVMA 3CMEI 2X14A 1BWPA 3KHUA 3NIDB 4GL2A 4X7BA 1HDPA 4BCBA 5GZ1A 3BF8A 5IFLA 5GV8A 1PZNA 1KTIA 2VOPA 3L8CA 3OYCA 2DFEA 3EIUA 2AXPA 6Q21A 3IBSA 2M0MA 3A31A 3L0IB 1BYIA 1OGJA 4K8RB 2G7MC 1KQ0A 3DOEA 1R6VA 1BCSB 4L18B 3EJ6A 4ECEA 1JDPA 2HQ5A 4YMVA 2PXCA 5EYPA 1R5OA 5CEJA 3OBBA 1FVFA 1W5AA 1F2DA 4OREX 1RMQA 3T0IA 4UM5A 4YUXA 3BGWA 3T8RA 3H86A 3WAKA 3VSDA 4BZXA 3NHKA 3UMGA 9MHTA 1NBME 4ZV7A 3AUTA 5T4BA 1P31A 2CZGA 3TEJA 2F4NA 3RIMA 5CYPA 1UBLS 721PA 1GU1A 1OJLA 3ZK7A 1K7AA 1I13A 3V7RA 2GJ9A 3UWOA 1PT8A 4CM7A 1WLYA 4I5DA 2R60A 2ZIXB 5K4HA 4C7MA 1P6RA 1JMYA 1IBMB 3UPTA 3IR7A 5DNAA 1O3QA 3H8WA 3A6GA 3BJEA 1HK7A 2CXXA 1A9OA 2I7VA 2TDXA 4K9RA 3QEMB 2R7XA 4FMPA 1CJKC 1YVEI 4ZGWA 4NS1A 4BKPA 4AO6A 2C61A 4JX8A 2RGNA 2VYND 2H1OA 5CB0A 4QL3A 1IUFA 3UJBA 4QTUB 4B45A 3KAJA 3ERED 3DE5X 4YAOA 2PGLA 4RVCA 4A8PA 1HFKA 4R5HA 2JGMA 1UBRS 2GA9A 4LNHA 4TVKA 3E23A 4MHOA 1XVVA 1IZ0A 2CMDA 5K6AC 3Q9SA 1MW7A 1MMNA 3SJAA 3D2BA 2P9HA 2Y76A 2PUEA 4CF6A 3N2GA 3GLIA 3HFJA 4BUJA 2J32A 1EGQA 4JC4A 2IYTA 3KXPA 4F6CA 5AM2A 4CEJA 1BKDR 1CY6A 1MRNA 3E3NA 4B3IA 5ALOA 1SD5A 3G2KA 3NUGA 1QGDA 2VLAA 4JSYA 2PMZA 1UJ4A 3ND9A 3OIPA 3D1NI 3F9CA 3CU5A 4RVHA 1M2KA 1PR0A 3QWFA 4GX1A 2AE1A 1EMDA 3I1FA 3PC7A 3GN2A 4MKHA 3VOSA 4DNOA 5CVDA 4AM8A 2LPMA 5IK2A 3B1KA 4V0SA 2QQFA 2G70A 4HLYA 4IVNA 3S70A 4HL6A 1SANA 1XZ8A 2R44A 5DRYA 2VP2A 3L7BA 4L1KA 2G40A 4YAJA 3QX3A 1SIOA 2I4LA 2VVTA 4YJGA 1Y0UA 2WV1A 4JQZA 4ZAFA 5I7RA 2JJ2A 3ONWA 1KP3A 5CYVA 4W63A 3H1BA 5HOOA 4PFOA 1XMKA 1Z0DA 1HUQA 3R6LA 4H7KA 5B3JA 2DN0A 2OORA 3HQ4O 2EZLA 3A2KA 1E7MA 1BMFA 1WUHS 3A0RB 5FHQA 2XASA 4O1IA 3UCEA 3LGSA 3ZV3A 4WZAB 1FX1A 4JA2A 3NORA 2P6NA 1JR4A 3R5SA 1JU3A 1URPA 4JOBA 3KUKA 2WU3A 3E2PA 4EQ6B 4JKIA 3U9GA 5AXBA 3FDFA 1ODTC 3FUCA 3FPKA 4AKIA 5LZ4A 3LMKA 4ZCLA 1Q17A 1P61B 3U7GA 2V7VA 2OILA 3ICCA 2HF8A 2LTAA 3CESA 1NC3A 1N0VC 4DILA 3O74A 221PA 3SS7X 3ORFA 1LK0A 1EJBA 1QF9A 4IXAA 1HWYA 1EB9A 1Z45A 3OPVA 2HSDA 1TMGE 3TZKA 3CBGA 4GVLA 4F60A 2XOEA 3A1EA 1UMBB 4ZU6X 5JDCA 3H2KA 1IUYA 1CVLA 4Y52J 1AN9A 4CMGA 3AIIA 4MR9B 3K09C 4CYCA 2O3JA 1K6YA 3S1AB 5FL7D 5CNKA 1PR3A 4ARI