4S05A

Crystal structure of klebsiella pneumoniae pmra in complex with pmra box dna
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
219
structure length
219
Chain Sequence
MKILVIEDDALLLQGLILAMQSEGYVCDGVSTAHEAALSLASNHYSLIVLDLGLPDEDGLHFLSRMRREKMTQPVLILTARDTLEDRISGLDTGADDYLVKPFALEELNARIRALLRRHNNQGDNEISVGNLRLNVTRRLVWLGETALDLTPKEYALLSRLMMKAGSPVHREILYNDIYSGDNEPATNTLEVHIHNLREKIGKSRIRTVRGFGYMLANN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords DNA-binding transcriptional regulator BasR
publication title Structure and dynamics of polymyxin-resistance-associated response regulator PmrA in complex with promoter DNA.
pubmed doi rcsb
source organism Klebsiella pneumoniae
total genus 61
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4s05A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4s05A01
1R8JA 2O61A 5KQMA 4KQ9A 1I3CA 5LGUA 2N9UA 4RAYA 1PNTA 4WXCA 4R79A 4AD9A 2QENA 3CZ5A 5A2QZ 1DPUA 3DV8A 1YYVA 2FEPA 3C3MA 3COAC 4IRXA 5D5WB 1TJYA 3BRQA 3D02A 4WXMA 3RJPA 3VFZA 2LPMA 1JGSA 4WX9A 1NXXA 3LKVA 3J80K 3KJXA 2GI4A 4KMFA 1AOYA 2NZVG 4EYGA 4EMSA 3EYYA 1B9MA 4R8HA 1ON1A 2NYXA 1P4AA 4YP9A 3KLOA 4BQAA 2G7HA 3ZMVA 4MQVA 1J2XA 4LG0B 3T6KA 4ZH4F 4I02A 4KVFA 4OLBA 2A9PA 2VT3A 4KNYA 4IRHA 2WTEA 1J7KA 2TMYA 1L3LA 2HS5A 3R6SA 3HHHA 4HOBA 4YFKF 3EAFA 3H3ZA 2GBPA 1VLZA 5KQGA 3DP7A 2FEKA 2L3DA 5LRSA 4KYWA 2KJCA 2FLWA 4OG2A 1SFXA 3H5TA 4WCGA 2E1CA 5L3BA 1YIOA 4ESBA 1M5TA 4MQFB 3BBLA 3WTYC 2Z33A 5FLXK 3FHZA 1Y1LA 3O2PE 2L19A 4DNCA 3ZMTA 4EJOA 4UNOA 3N0RA 1QP0A 3IRRA 6CHYA 3E6BA 3DZDA 4RXMA 2MD5A 3C3KA 4KUMA 1SD7A 4U0YA 3IPCA 3FMVA 2O6GE 5IUNC 4HQMA 5K5OA 2PJPA 4EUKA 4P9UA 2EB7A 5JI6A 2FEZA 5FO5A 1TQMA 2Z9OA 1OMIA 1EH7A 5BQTA 1OYWA 3WU0A 1JH9A 2CQKA 5IX8A 1USIA 1F9NA 1OYIA 3TGNA 5HS9A 2DT5A 1QMPA 5IT9K 2XAGA 1PP8F 3VNAA 4O1IA 4MYRA 1IN7A 3HCWA 4KPYA 4E70A 4IVNA 1ZESA 1TQPA 4UV8A 1K78A 2CW0F 3D5LA 4WF2A 3MM4A 1JHHA 3U2RA 3L9FA 2AYXA 3IWFA 4RY8A 1RZ4A 1USSA 1EH8A 3OLXA 4CXFA 1APBA 3O75A 2ESHA 4GNRA 3QLUC 3KCCA 1IN8A 1B1BA 3RYRA 2O3FA 3DQVC 4PGHA 3JSOA 4P55A 1JDNA 3NHMA 4P5OA 2P5KA 4EJWA 3V4GA 3BPXA 1FFGA 2LKPA 1FX7A 1TNTA 4Q4ZF 5CVJA 1KYWA 2OBPA 5TQ0A 1R00A 3OM1A 1NXPA 5IEBA 1SXHA 2HQRA 1EWVA 3UKJA 1SD6A 1B59A 1ZH5A 3H5IA 1B00A 2FNAA 1FY7A 3KG2A 4P98A 1HKTA 1MJAA 4O1HA 1S7OA 3J81Z 1CF7B 1J56A 5F64A 2A9RA 3ABUA 3PQKA 4UHTA 3OO0A 2O8XA 2QZ8A 2ZXJA 2AYZA 1J5YA 3L2CA 3URMA 4NHJA 4KN7X 4RB2C 2R7DA 3TO7A 5KC9A 3ABTA 2R47A 2PFBA 2CG4A 3GUDA 1S3JA 2PG4A 2FU4A 1U2QA 3LA2A 5FFXA 3LFTA 2UWMA 4MS4B 3MZHA 1O57A 3CLKA 4MRMB 4L5IA 3FMRA 3KZZA 3GF2A 1B9NA 3NNSA 5IEJA 3HO1A 4E7PA 1PNRA 1IAWA 4W5QA 4HA8A 2VUIB 1DPRA 4KIBA 3KP3A 4KN4X 3F73A 5EEHA 4L18B 3RVMA 2VYCA 4QPJC 5L3FA 2X0LA 4L0YB 2GWRA 4HF0A 4P1ZA 1FBSA 3NEUA 3CTAA 1USTA 4Q7EA 3P9KA 3HOSA 3IP9A 1NXTA 2F8SA 4HDVA 1T0FA 3QX9A 3FZVA 1JF8A 3PFIA 3GL9A 4Z4CA 1DBQA 3VNBA 3S99A 2QW1A 1LBIA 2EJRA 2BGCA 4F12A 5EEGA 3BOQA 3WTVC 2QVCA 2H09A 5ICFA 4IJAA 3I54A 2W57A 3DF8A 4G9YA 5CHYA 2ISYA 5L3GA 3EULA 4MR9B 3KSMA 2O0YA 3JVIA 4Q47A 3LTEA 4G7OF 3CFYA 5I4CA 1ZGGA 4ZMSA 4EM2A 2QVOA 3TO6A 4FB4A 4HQEA 3D8UA 2Q5CA 2OU2A 3TOBA 3DGFC 2KYRA 4IF4A 1F5TA 4KV7A 3RPUA 1ZARA 2P8TA 1OR7A 5BOXA 1SFUA 4OINF 4LLNA 3TB6A 1O7LA 2WY2D 2O03A 3K69A 3O6BB 3N0XA 5L3EA 4A2UA 2OQGA 1LJUA 1UCRA 5ABPA 1FSEA 2YX7A 3RDIA 2Q8KA 1JYFA 1K68A 4RB1A 5E1WA 2QU7A 2ZMEA 4HLYA 2VBZA 3F8NA 3SNKA 2WMYA 3O2QB 5CNIA 4UXNA 1ISRA 2YHBA 2E4UA 2OQRA 4LRQA 5ICGA 3IRQA 2JVJA 2J48A 3B73A 3IL2A 1R7JA 1ZREA 4UHJA 1X3UA 2MC3A 5FD6A 1YK1A 4A6DA 4LLLA 4P96A 3LOPA 3CS3A 1ISSA 1TM2A 4PZJA 2VBYA 3C1DA 1HQCA 2F5DA 2JB9A 2MLGA 2CFXA 2HTJA 4G0OA 2RNJA 2K27A 2R48A 1EWKA 2HR3A 2VC0A 3REOA 2UZKA 3ZPLA 1R5GA 2CYYA 1Z16A 1IRFA 2DTRA 3CUOA 3DXJF 5HS7A 3N8IA 1IN6A 4QLCU 4EJUA 4G0XA 2COMA 3TKYA 2FXIA 1G3TA 2C6YA 4YIFA 3MQ4A 4N9IA 1OXBB 3Q9SA 3EODA 4LZLA 3EDPA 1NHAA 5KK1A 4KK3A 2XROA 3QEMA 4ETIA 2PI0A 2STWA 3CO7C 4ETMA 4M73A 3FM5A 2QLZA 4OLAA 2QBYA 3CNBA 3QLVC 3FFTA 1YTYA 2OENG 3E5QA 4ESFA 5FWYA 3FGZA 3N53A 1BI0A 4IRGA 5E8IA 3I09A 5D6EA 4AVPA 6ABPA 5LGTA 2R4QA 1Z2EA 1BOAA 2EFOA 4LD5A 3R0AA 2ESNA 2ZWMA 3O21A 2HQNA 4IPAA 1S29A 2YSRA 4N76A 3FXRA 4OBBA 4NCAA 1UHMA 5HLHA 4UHKA 4HV5A 4RV5A 4RK5A 2FW0A 4I2OA 4LDAA 4N0PA 2MH9A 3I58A 5ED4A 3DPTA 3MMNA 4B09A 2ACJA 3ECOA 2FMIA 1D5WA 3O1IC 1LEBA 4EGYA 2NS0A 1E6MA 4LE2A 2YX4A 2R7FA 2EFPA 2YU3A 3ECHA 1XGMA 3LUAA 5CVRA 3HSEA 3Q5FA 3JVDA 1WSUA 5JHUA 3HJFA 1RPJA 2LIVA 3KP4A 1GUBA 5L3DA 3NQOA 3KETA 2EV6A 2VK2A 4YFNF 3T8TA 3TD9A 4YIIA 3C3WA 3E61A 3GXOA 3R61A 1XCVA 4NV3A 4XFKA 2V9VA 4LFUA 3EJWA 3LQQA 4IILA 5K1YA 3JTHA 1FLIA 3I42A 3AAFA 5FWXA 2H6BA 2QYOA 3N6VA 5HLIA 4H3HB 4PCQA 3Q15C 2NAZA 1IXSB 4RKQA 4GYGA 4LK1F 1EWTA 2UXXA 3QK7A 3NRVA 5HQJA 2NRAC 4PGGA 2PE5A 5AIQA 2IJLA 2FBKA 2MSLA 3C18A 3GWGA 2FVYA 4GYIA 1WETA 2E7WA 4KRFA 3RQIA 4PZ0A 2OAZA 4W5TA 2V79A 5AONA 1BM9A 1H9TA 1TBXA 1K78B 3O2SB 3HXMA 2LSOA 5B3JA 5ILSA 2H3HA 3HSYA 3F8MA 3VODA 2V1XA 3OM0A 1XDUA 3IKVA 1QNLA 3V8JA 4QYWA 5IT3A 2FSPA 4W5NA 3MF4A 2HOEA 3U1DA 2PEXA 2D2WA 2L01A 4W5OA 4XASA 2M45A 4GO1A 4MR8A 4O3MA 1FZPB 1F4VA 3C7JA 4OU0A 3HRSA 1SXGA 1ZGAA 1AWCA 3IWZA 4ZYGA 2FSWA 5TQ0B 1A2OA 4I0AA 1U04A 1DCMA 2W85A 3OQMA 5LGNA 2A61A 2PLYA 4HAMA 5DCFA 3CLOA 3FF5A 3RVPA 2IOYA 1P92A 3RH0A 3O1JC 4G0MA 3DKWA 3Q41A 2XIGA 2BE5F 3HVRA 4M72A 2A07F 4EYOA 2RKHA 2IP2A 2JRLA 2PQ8A 3LA3A 1UHWA 4JA2A 1OYYA 2RGYA 1TW2A 1U8RA 3Q9VA 4O5AA 4DQ2A 3JS5A 7ABPA 3TDZC 1K7AA 3P9CA 1T34A 4Z4FA 4PYRA 2JPCA 4IRIA 3BDDA 2PJUA 2BGGA 2DAOA 3H5VA 3IC7A 1WKMA 2XV4S 3SFZA 3CTPA 2Z3YA 3BY6A 3LUDA 1P6RA 3GA5A 1JDPA 1M2EA 2PUDA 2W42A 3KP7A 5DEQA 3I64A 4K2EA 1XHEA 2AS5F 2PBIA 3H6HA 3QX8A 5T7BA 1Z15A 2M87A 4LK0F 2QR3A 4R1HA 3WU1B 4BHBA 1K79A 3I5UA 2QWWA 5HDKA 1T98A 5DKFA 4M88A 4RGSA 6PAXA 1CEYA 4MLDA 4RXTA 2FRHA 3IPAA 3QAHA 4HW0A 3LAJA 3WGIA 1RI7A 1M5UA 2EV5A 2LUOA 4JK1X 4NQWA 3HEBA 3GO5A 1BI2A 1ZYRF 2JVIA 2L02A 2M1BA 3SAJA 3OV8A 3NHZA 3F72A 1ZY2A 1ABEA 2X7XA 3H5OA 1FC3A 4UVBA 1KU9A 4F8JA 5DD4A 2IPQX 1GVJA 1U8TA 1QZZA 1HBXG 3ZP5A 1L0OC 1ZRDA 1JFTA 1DJMA 3BROA 4YCSA 1E2BA 2BEOA 5IUJC 1EFAA 3RVSA 4N47A 1YMVA 4AWXB 3LKBA 4HNQA 2PN6A 2ISZA 5JS2A 4EYQA 2E4XA 4NCBA 2Q0OA 5L3CA 4MAAA 4YV7A 5D5VB 1QQAA 1YW8A 3I59A 4OMZA 3G85A 2GA1A 5BPDA 2FBIA 3GFJA 4WXHA 5GOTA 3IP5A 2CGPA 4IMIB 1W7PA 2FNPA 1FBUA 3ISPA 2FTKE 3FDFA 3WTUC 4S05A 4O6JA 1I27A 2OZUA 4XAQA 5CVIA 2FQWA 3VB2A 4PEVA 5EWLA 2PUCA 2P9HA 2HTSA 3WE3A 2H27A 4Z9AA 1QO0A 2ZMEB 2CWDA 3CU5A 2XAFA 5D4RA 1JE8A 2VT2A 1LDJA 1ZAOA 4A0YA 1FYKA 4A6EA 1OXKB 2ID9A 4GXOA 1PUXA 3JAMZ 3GYBA 5C5CA 3KP6A 3P7NA 5ICCA 5ILUA 2L4MA 1JLKA 1EAYA 1MIHA 2NZUG 1JBEA 1J0RA 1HW2A 4G8XA 1FQWA 3JTGA 1D8JA 3JW4A 3HS3A 1F4KA 2RJOA 5D4SA 5LEJA 4RU1A 3F8BA 3O74A 1U5TA 1ZRFA 4JQFA 2RC4A 3WTTC 3V7CA 2FMKA 3E5UA 2FMLA 2BV6A 1JXSA 4L9VA 1D4ZA 4RS8A 2ZJ2A 1SRRA 4DADA 4G0QA 2DK5A 2ID7A 2PLNA 3LUJA 2MBFA 5AIPA 3W6KB 5J6XA 1U5TC 2QVGA 4RAZA 1YTUA 4G6QA 4RB0A 1ZH4A 4RWEA 4XBFA 1VKRA 1Z91A 4OIOF 4HF1A 2JRTA 2M8EA 3QEMB 3JY6A 1XB4A 1GCGA 3DEUA 1J9IA 4RK0A 1QQIA 1BIBA 2LF7A 3D0SA 5HVQC 4XSXF 1R36A 3EYIA 2QBYB 1YVUA 3WGGA 3LUFA 1NY5A 3HUTA 5FWYB 3RKYA 1PUEE 2P6SA 3HDGA 5D6FA 4H3KB 1XMAA 3LUHA 1RXEA 5IBQA 2EK5A 1DZ3A 2WRZA 3UK0A 3A10A 1QPMA 3MCZA 1G6NA 5ERIA 5JFRA 5DCMA 1DP4A 2CWEA 3HSRA 1EHCA 2RGVA 3F6CA 3RYPA 2KIMA 5CLSA 1ZG3A 1MJ9A 3T1BA 1FP2A 5HSGA 1T39A 2P7VB 2P6TA 1JWLA 2DQRA 1QZYA 1SD5A 5JNSA 4JB2A 1TLFA 8ABPA 4KZKA 2DW4A 4LE1A 3VOEA 2G7UA 5F1RA 2B0LA 2BBYA 2WJWA 1KMIY 1TW3A 1MAVA 3F6VA 2QUFA 4U7DA 5DLEA 1G3WA 4KMRA 3RTRA 5K5QA 3K1NA 2LF8A 2VONA 2WWYA 4MR7A 2QQ9A 5DYMA 3NNNA 2IW5A 5HDNA 1JHZA 1TVMA 2XKPA 3TMYA 3MQ0A 3RVJA 1TLHB 2P4UA 2ADUA 3HTUA 1W9HA 1IUYA 4D0PA 5CVVA 3T5XA 3GZ5A 4KIFA 5FWXB 4Y15A 1RZRA 5DUKA 1NXWA 3J80Z 4EJVA 5JVTA 3QP6A 1Z12A 1HKQA 2Q2EA 5BPIA 3L00A 2Y75A 4MS3A 2GXGA 3A3KA 2DFIA 1SXIA 1WRJA 3EDCA 1RNLA 3K9TA 1PHRA 4W5RA 4RKRA 4M71A 4ETSA 2MYTA 4RK6A 2OZ6A 3KS9A 1ABFA 2GIVA 1XGOA 2GX6A 2M1ZA 3TOAA 2KRFA 3GT7A 3GFLA 3O3KA 2AXLA 4IGAA 2H0AA 4OTZA 1HSJA 4OIQF 3A0RB 1KU2A 4HX4A 3N75A 1BA2A 2WC2A 3GLXA 3HIFA 4YLEA 1TNSA 1HW1A 2MYNA 4IMJB 2JK1A 4FE7A 3QOPA 5TPZD 5E1ZB 5FLXZ 1FFSA 1MZBA 3LWFA 2VN2A 3M8EA 5KQLA 4MR8B 1ZGZA 2K86A 5DD8A 3BPVA 1H0MA 1LQ1A 3U9GA 3HOTA 4CHUA 5D8LB 1IW7F 4XLTA 4G97A 2PMHA 3ZMDA 4HBLA 3SZPA 1UFMA 2DBBA 4Z4EA 5T3YA 1BN5A 4HZFA 1MKMA 2PL1A 1ZN2A 2MA3A 2EFNA 1RXIA 1NXSA 1L5YA 4F06A 1VPWA 2MSWA 4Q5SF 1ZITA 1ZVVA 1VTNC 4AIHA 5IT9Z 5E18F 3WGHA 4ZZLA 1MD0A 2RDPA 1XN7A 2W84A 4I0BA 5TPWA 3K1PA 5FBKA 2F2EA 1VRVA 1P8AA 5BQ3A 3KP2A 4Z4GA 3TO9A 4TLLB 3LFKA 2IA0A 1USGA 2DPDA 4Z99A 4IHSA 3L6UA 5TQ2A 1JYEA 5A2QK 3CG4A 4I7HA 3LAPA 4WWHA 1G3SA 4N03A 1G3YA 4CDGA 4OIPF 3HUUA 4YS6A 4JB0A 4CICA 4AIJA 2FN8A 4D6XA 4YO7A 2QZJA 4ENMA 4KICA 4OIRF 1P4WA 3C6QA 1Z9CA 2CHEA 4F7ZA 1LDKB 4EYKA 1IN5A 2EA2A 1QP4A 2P5VA 2F8TA 3CDHA 3RVLA 1Z7UA 2PMUA 2PUGA 2F5EA 1KU7A 1BDJA 3W6JB 4MLCA 3I5AA 4HNSA 4BHPA 1XHFA 2WB4A 4S04A 1F1ZA 1C0WA 5LEKA 2H94A 3RVKA 1D5VA 2Y48A 5JNTA 3WTWC 5HLGA 2HYFA 3H92A 1FFWA 1TQIA 3T8RA 3IP7A 4L9TA 4G0YA 1WWXA 4EJTA 3T95A 1Z05A 1QNTA 3OMWA 3IKTA 2HDCA 2RJNA 3H6GA 3GW2A 4ZYHA 4WK8F 5F6FA 4ESJA 2KKOA 4Z2YA 1KYZA 5DV5A 3FMSA 2HZTA 3T8YA 2HKOA 4LLGF 2FMYA 2FBHA 1XCBA 1HKSA 3SZTA 4UVCA 4XRFA 5FB2A 3DLBA 3GZ6A 4YG2F 1FYLA 2IDMA 1P4XA 4FX0A 3I59B 3F7NA 2PUAA 2JSCA 1Y0UA 1KQ9A 1W7PB 3EUHA 2FEWB 5DCLA 2KIFA 4IXAA 3WTSC 3WODF 4G0ZA 1WQ2A 3F23A 4HLXA 1ZLKA 2FLKA 2IYNA 1ZHHA 3LUCA 1A0OA 2DPUA 5EWLB 1Z18A 3CKMA 4BNCA 1W7PD 3HM9A 4WZZA 5KVRA 4EGZA 4YRZA 3EQ2A 2ETHA 2FQ3A 3V7RA 2XAQA 3I0TA 3F6PA 2V0NA 2DU9A 2DRIA 3RVQA 4M6XA 2L17A 1QO0D 4RZSA 4OATA 2F5FA 2K4BA 2E4WA 4N9HA 5CNMA 3CRNA 2E4YA 1E17A 4LDZA 1R23A 4BAYA 4H0EA 1ONVA 3MIZA 3G73A 3SG0A 2QXYA 3HYIA 2V1DA 2JT1A 1MJBA 1U5TB 1QKKA 1MVOA 5JR3A 2VE9A 4AIKA 2IPAB 4LGWA 4OMYA 5B3JC 3HTSB 1MB0A 5H6RA 3F6OA 4HDUA 3KKEA 4ENNA 2YR2A 3RPQA 1D1QA 4L9JA 2VBXA 3TDUC 3J81K 2A5YB 3OLVA 3WE2A 3I53A 1URPA 1S7AA 3ZMUA 4U88A 5DTEA 3P9YA 1MB3A 1E6KA 3RIRA 4A12A 5BR1A 1IZ1A 2IPLA 1LJLA 4ZPJA 2WJAA 4XLNF 1SD4A 1REPC 4BHCA 3K1MA 4P9FA 5E17F 3FMQA 1R1VA 3R4KA 5TJJA 1NTRA 3ILHA 2P7CB 2VXZA 2CO5A 1SFEA 4RGUA 1MDMA 3RKXA 3KYIB 1IRGA 2XASA 3WTXC 5DGCA 4B8XA 1PEAA 4JAVC 3QLTA 4I01A 1FOKA 3G1WA 3K9CA 3TO5A 3N4MA 1JFVA 4RS3A 2ZO4A 3WG9A 2OD5A 5DCMB 1XWWA 3H1EA 3RVRA 2HPHA 4JP1A 2JBAA 4RK1A 2O20A 4RB3C 1S8NA 3M6MD 1YW7A 4ZJPA 5BMZA 1CGPA 2L54A 4A5NA 1RUNA 3BJ6A 4M6YA 1LB2A 4UVAA 4RGRA 1DCKA 3ERED 1JL3A 3M9AA 4FE4A 5LLQA 1DUXC 3BJAA 3GEZA 3MYYA 3QPTA 3GBPA 2FA5A 1LEAA 2QV0A 2DLLA 4DQDA 1LJ9A 3GYHX 3DBIA 4NICA 2K7LA 1I5ZA 4A0ZA 5LHGA 1HW5A 3O1HB 3E6CC 2P5LC 2PMCA 1LK0A 1U0SY 3T0YA 4MQ9F 3BREA 4MQEA 3NBMA 4TLMB 4MR7B 3M9XA 2L4AA 2VE8A 4Q6BA 3DPLC 2B1JA 2D45A 1KRXA 3QRFF 3E3MA 3EQZA 2HJ9A 2XDYA 4CO8A 3J7AO 4I98B 1W5SA 1YS7A 1U78A 3MA0A 1Z25A 3OMXA 2GZWA 1XSVA 1UB9A 1GHCA 4O5VA 3H5LA 1LDDA 3H3UA 1P6QA 2BYVE 4BXUA 3OLWA 3ROTA 2D1VA 2HQBA 1O3QA 2XVCA 2QSJA 4E7OA 3LA7A 1JFSA 5TRDA 4RK4A 4HX8A 1FNNA 4MS3B 3GFMA 1RZRD 4WXDA 2EV0A 2A9OA 2WWVD 1GXQA 3KE2A 1I1SA 5FD5A 2HGCA 2FMHA 1SMYF 2GXBA 2NT3A 3RVOA 4MGRA 4OOIA 2VUHB 1V4RA 1KRWA 1XD7A 1JX6A 3CUQB 2XAJA 3RI4A 2NT4A 1ZDMA 2V6CA 2XHKA 1ZAYA 4F3TA 4ZMRA 4PE5B 4EQQA 2R3SA 3GBVA 2UXNA 4G6DA 4LB5A 4MPTA 4ASNA 4QYMA 3ZN0A 1T38A 4EVSA 1BI3A 1DBWA 1ZH2A 3SXYA 5IC5A 1Q1HA 2H6CA 1ULYA 3C97A 1XSDA 3GFIA 2M30A 3ZQ7A 3LUKA 5H20A 4ON0A 2A69F 1FPQA 2IVMA 1T6SA 5CYVA 1A04A 1BDIA 3JPYA 2IA1A 2K02A 2B4AA 3UUGA 1I1GA 3FM3A 1KU3A 3QPHA 2NNYA 1J59A 1G4DA 3QLUA 1QP7A 1FP1D 1FSPA 2KIUA 3F22A 4FX4A 3QELA 2HEOA 3V8KA 1BVHA 9ABPA 1GUDA 3EGCA 3MWMA 5E1XA 3KCNA 3SY8A 5HOOA 5HM6A 2HYGD 3OQNA 2GQQA 4WWCA 3TQNA 3CG0A 1ZG1A 2RV8A 5K5RA 4RDCA 2CD7A 5TPWB 2RN7A 1SMTA 2ZNZA 1CHNA 4Z4IA 1R1TA 1BBYA 1J75A 3I4PA 4KIGA 3M8FA 4WT7A 4M74A 5CJ9A 3E6DA 4KK4A 5TQ2B 4EVQA 1GCAA 3OO1A 3M7GA 3MEXA 3A0UA 3IP6A 3F8FA 4MS1A 2E7XA 1FBQA 4ZZDA 4EV0A 2DK8A 4JASB 5EWMA 1QGPA 3T38A 5FGMA 4NB5A 4PDKA 1HSTA 1Z1DA 3O2JA 1R22A 4KMUX 4KREA 4KA4A 5LHIA 4Q48A 1LBHA 3BRSA 1H9GA 4LE0A 1Z6TA 4U0WA 3PQJA 1F51E 2M5WA 1V3FA 4ENJA 3ZMSA 5EWJA 3BZ6A 2PAFA 3LQRA 3FWEA 4L9NA 3GV0A 2I6FA 3HRUA 4HF2A 2FN9A 4N0QA 2QQAA 3ML6A 2YHAA 3QEKA 1TMYA 5E8GA 2J5PA 4ENKA 1TTYA 4HV6A 3H1FA 3QU6A 2E1NA 3FX3A 2DO7A 2ZNYA 3DLHA 5DDGA 2FKAA 4ZYLA 1RUOA 5ILVA 1P6UA 3H5WA 2XKOA 2FQYA 1OPCA 5BS6A 3HSFA 1YG2A 3KYJB 4JOQA 4M9SA 1K66A 4Z9BA 1IF1A 2MYPA 1ZLJA 4G0PA 4IHTA 4TN5A 4RGXA 5LBQA 4QWQA 3M1EA 4CGZA 5H6QA 2M98A 1W4MA 3Q7TA 1KQ0A 4DN6A 5PNTA 1BDHA 3BJOA 2LDUA 2K4JA 4KT5C 3K2ZA 3RVNA 3BP8A 2ZKZA 1O3SA 4L0ZB 2J5OA 5FFZA 2VOOA 1BAPA 2RDMA 1XSXA 3OQOA 4Z4HA 2A3SA 1XDSA 3L09A 4LG0A 3GWZA 2FF4A 3L49A 2PUEA 4XSZF 4N41A 5D5XB 1YMUA 1BC7C 4N0BA 2X4HA 1AB6A 3E3VA 1GXPA 4RXUA 3LMKA 3V8LA 5BRAA 3MFKA 3DFGA 2IA2A 4Y13A 3K0LA 2FE3A 4F11A 2GAUA 1C4WA 1H9CA 1STZA 1YFHA 4XXHA 3CUQA 3ILYA 2PUFA 3I45A 1FT9A 1D3YA 2XGXA 3MZYA 3LUGA 4MNUA 4MQFA 1JHFA 5IUKC 1L5ZA 1WI9A 5DUIA 4G7HF 1NATA 3CJNA 1ZGJA 1MGTA 1ON2A 3K4HA 2IPMA 3FXQA 2PKXA 2ELHA 3IDOA 3CO6C 2XRNA 3CUQC 3OOPA 1Z17A 3EETA 1DC8A 2JPBA 1T2KA 2W25A 4YGXB 5KQPA 3SQNA 1NXOA 4CZZA 2VOPA 2R25B 2A68F 4FT8A 5JNVA 4YR7A 3OLYA 1O7FA 2XAHA 1YQAA 3R0JA 1FYMA 2EWNA 4D74A 4G94A 3I71A 3TX6A 2CSOA 3H1GA 3Q7SA 5LHHA 5TQJA 1YS6A 2JZYA 4Y17A 3HUGA 1ZHFA 2V1UA 3ULQB 1KQ8A 5C5EA 1ZG5A 3KTOA 4G7ZF 1AB5A 3JPWA 2Z5UA 4Y9TA 4ETNA 2PUBA 2IPNA 2W24A 2JTVA 4ML3A 5HDGA 3ELKA 4MTDA 1MDMB 1D2AA 1K6OA 4BYYA 3FXUA 3LSTA 3FFXA 2XUBA 3KHTA 4Q6WA 1BJAA 2HFHA 4YFXF 2IT0A 3M9WA 5J8FA 4UUVA 4EM0B 1GLGA 4FHTA 3E5XA 2ZBKA 4A0XA 2FXAA 1YW9A 1USKA 3HRTA 4TV7A 3QLVA 2JBAB 2HQOA 4RK7A 3QU3A 1ODDA 3H75A 1CF7A 1IN4A 4U0VA 5FBHA 1U6GA 2MYUA 3N0WA 4ZYEA 1I6XA 1EH6A 2RVCA 1FSHA 3FFWA 5GQSA 1NXVA 3CZCA 1IXCA 1D8KA 2L2QA 1KA8A 2DQLA 4RY9A 1W25A 3VEPA 2A6EF 5IULC 3F21A 4MEXF 4NQRA 3Q7RA 4GPAA 1YO5C 2NNNA 1BC8C 4GGGA 2E4VA 3HRMA 4MQEB 5CNKA 3F3XA 3ROFA 1FWZA 1LNWA 1B4AA 4L4UA 4MGEA 3W9SA 2E4ZA 2VC1A 2EA4A 5D8KB 4MS4A 3ZN1A 4MRMA 1B6AA 4WUTA 2D1HA 3HDVA 4LX8A 5TE9A 4L5JA 3DGEC 1YK0A 2GA2A 3GRCA 4MHGA 3SM9A 2OA4A 2Y0MA 5E3JA 1Z6RA 1U3EM 2CHFA 2ZAYA 4RSMA 3EQLF 1DCFA 2JCGA 2MLKA 5KI6A 5LRRA 3F8CA 3GVAA 2STTA 4Z0NA 1DRJA 4EM1A 1O3RA 1P2FA 5KWSA 4QICA 2HSGA 1YLFA 2ZFWA 5D2CA 4BH9A 1HEYA 1Z2DA 2ZCWA 1U2WA 2A9QA 5KC8A 2F5CA 4GCVA 5JNRA 4TMYA 3KZYA 1ZRCA 1QQBA 4D6YA 2A6HF 2MH2A 1DP7P 2VODA 1QPZA 1E6LA 4RY0A 4MEYF 3SHFA 1E2XA 1XMKA 3HK2A 2HKXA 4I09A 3IHUA 4LB6B 3B2NA 1CYEA 2MSKA 2DI3A 1IXRC 3JAMK 3OLZA 4MR9A 2JVKA 3ROUA 5JS1A 5JNWA 2FQXA 2GKGA 1UDRA 1LVAA 4MTEA 4UV9A 5CNJA 1KGSA 3MAJA 3E97A 1PDNC 4WXEA 2RQPA 1S6LA 3L7WA 4H60A 1R58A 3HV2A 2YPRA 1QBJA 1RIOH 3KLNA 1BI1A 5CVUA 1DBPA 5HS8A 4KFCA 3ZMZA 4G86A 3WTZA 1DC7A 4EVRA 2EFQA 2LNBA 2TDXA 3QELB 3N97A 3GX4X 2WV0A 5TPZA 4JBAA 3V7SA 3E6MA 1DG9A 1OKRA 4ZYDA 1D1PA 4KQCA 2FOKA 3KEOA 1HXDA 4YWHA 4EGSA 4XARA 2KJBA 5E20A 3NNDA 2EFWA 2Z99A 4LMYA 5JNUA 3HZHA 3RKWA 3G3ZA 2NUBA 3KP5A 4CBVA 1R1UA 4A5MA 1XGSA 3JTEA 1U2PA 5ICEA 4M9ZA 1Z13A 4XLPF 1R5HA 3KEQA 2IRFG 1XGNA 3R60A 4CYDA 3P9IA 3QP5A 2HWVA 4MS1B 4HX7A 4U7BA 5EWMB 1DDNA 1M2FA 1PEYA 4EY3A 1W5TA 1C0EA 2QQBA 3KFWX 4M9XA 1Z26A 4HNRA 1DRKA 2P4WA 1SAXA 4EVIA 3S2WA 2LBPA 1EV7A 2QM3A 1O3TA 4L85A 5D5UB 4KDPA 2LP4Y 4HYEA 5J8CA 1PP7U 3B02A 2FMFA 5EWJB 3JSPA 2VBWA 3BWGA 5HKOA 4LJZF 1IIBA 2PL9A 2L18A 1BIAA 3BILA 2G9WA 4PICA 3CHYA 3HHGA 2IKSA 5BRJA
chains in the Genus database with same CATH superfamily
2BTQA 2W71A 2J5QA 2FW8A 1XRRA 3KPWA 2QUBA 1AXRA 2EJWA 4DR5B 1JILA 1E2UA 3KPVA 2FUCA 2N0SA 5JEEA 4PZCA 5GONF 3K1AB 2V3VA 2G70A 3JR3A 4KMFA 5CVEA 1E2PA 3TPZA 4D46A 4P8RA 4OYLA 1G18A 4JMPA 1UPAA 2V6BA 4YP9A 3GP5A 4PTZA 3ZMVA 2WB1A 1HMPA 3T6KA 3MUOA 1G291 3CH4B 1IOLA 3QGMA 4HDSA 4IRHA 3F3MA 4FCVA 2NZJA 4DAOA 1EU1A 4GZ5A 2R4TA 3EPZA 3WSTA 3GGJA 3PPIA 2HJRA 3MUFA 1JLLA 2PSDA 2X6OA 3L6BA 4MQFB 3THOA 3OTGA 1H42A 4DEYA 1QJ4A 5B36A 1LLCA 4OV6B 5EJ7A 1ZCJA 3S5JA 3W77A 3RO7A 2I6TA 1C30B 3T7RA 1Z5GA 2WAAA 4Q9KA 5FO5A 5CB4F 3P0FA 4UCQA 2Z9OA 3WU0A 4A4DA 5IWCA 1USIA 1SC3A 5CPFA 3VNAA 1MABA 3HCWA 2XF5A 4ZKEA 1M7HA 4UV8A 1MD9A 1BMTA 3MM4A 1I8TA 2AXNA 4WZAB 3EXHB 3EZNA 4BNDB 1WUKS 4ZYYA 5DB4A 1ZUIA 1VLHA 3LOQA 3FWYA 4P5OA 1GZ7A 3JQ7B 3EGEA 3ZWPA 4BQNA 2VJBA 5F2OA 4PWZA 1YI1A 3EVEA 2DX7A 1QIHA 3ZDRA 5IEBA 5KNCA 5CITA 2RBGA 4J0FA 3SEAA 4RX1A 3LRXA 1CF7B 4C0BA 2JKVA 1CUSA 3R5TA 2VXYA 1LZLA 1EXVA 4HLUA 3AIIA 3ZCRA 3G17A 4GLLA 3CP2A 3HJHA 1GN8A 1ZJWA 5HS6A 1VBNA 3R20A 3M5PA 1B72A 3GMTA 3ETGA 3GF2A 4YI3A 1GXSB 2HTFA 3HO1A 5J47A 4K1LA 1LBQA 1GEGA 4JP5A 4YASA 2VYCA 1GAQA 2PJRB 1XQ9A 4E5YA 1II8B 2PV0A 2O2ZA 4N3AA 3A4NA 2TCTA 3QU4A 3WIEA 5E95A 3C87A 4PANA 3S99A 1GQ2A 3OPXA 1N3LA 3VR4A 1QCZA 4DM3A 4IV5A 4Y2XA 3B36A 2WJ4A 1ODKA 5IMSA 5DOVA 2BSXA 4I2NA 3JW8A 1W35A 4HQEA 5AW1A 3HFGA 2BP7B 3USES 3TOBA 1XA3A 3DGFC 2HLNA 3ORYA 3ET5A 2NSJA 2GVZC 1UMKA 3U7GA 4MUAA 5ER9A 3O91A 4RGBA 2OQGA 3VR2D 4FIDA 1WJDA 1OR7C 2QSHX 2O4UX 3AKYA 4PS1A 2X8JA 3IRQA 3P94A 2RFLA 2LKDA 2VP4A 4YNBA 2R7AA 4A6DA 3E7LA 1SOWA 1NAHA 1ISSA 1YR8A 4B1RA 2R65A 2DTEA 5CW2A 1J2TA 2A0XA 5D7NA 1PKXA 4BQFA 2VEOA 1TMGE 3W0LB 5CG2A 4YDQA 2OTCA 1VLMA 3RIYA 4MWTA 4DV4B 1TQ2A 1UH5A 5ITVA 1Y7PA 1H6BA 3WLAA 4CUZA 4ZAWA 1Y3DE 1R5NA 1GAWA 2P79A 2OQ2A 3DEWA 1FQKA 3KJZA 4K03A 2C0CA 3L4BC 2DC1A 2Z6UA 1V7CA 2ESNA 2EFDB 1TWCJ 2ZUTA 2C5AA 4F1WA 1P2BA 2MH9A 4IHYA 5FKKA 4J0GA 3VZQA 2FY8A 3MMNA 1WPRA 3NC4A 4B33A 5KTKA 1NQWA 2OAQ1 4DARA 1U2EA 4D02A 2JDID 5F9FA 2JJ7A 1XELA 1KS2A 2N8GA 4UU1A 4UVHA 5AM4A 4FMCF 3U19A 3F7MA 3FISA 1YRNA 3C3WA 4B6EA 4BLSA 1OHHA 2IPOA 2C7QA 2Z6AA 1Z67A 4CI9A 3BXHA 4JROA 1N6KA 3TLAA 3TW6A 1WZCA 5EZGA 1ZMRA 3KJNA 4FB5A 3W2HA 4DNXA 4UAGA 2ORED 2Y66A 4AS2A 2CF5A 3HPQA 1K78B 3O2SB 4WY2A 3HXMA 5B3JA 4A3MJ 3DZCA 1RI4A 3PUHA 3BVPA 3L8EA 4W5NA 1QTNA 3U7HB 4WBNF 5TMPA 3GK3A 4FOPA 3L8HA 5KOJA 3SKVA 1UAYA 3A6KA 3WLPA 5AVTA 2NXJA 3OS1A 2YY5A 2JUGA 1U3FA 3FF5A 5JXWA 2X2FA 4R84A 1AKYA 3ZQKA 5DZSA 1AKQA 1P75A 2PSHA 4D7MA 1PJSA 5FTKA 2VPIA 4J0HA 3PRJA 2E49A 4WIAA 3HP1A 1GL7A 4EA9A 5IDVA 3DE4X 3TDZC 3SQDA 3O8CA 2JPCA 4D9BA 1V5GA 1NRXA 4WAUA 3FPBA 2A0FA 4BB9A 5E9WA 4ZYUA 1WZUA 4F1JA 3ZDEA 3S1QJ 4KO3S 2ZYTX 3OIWA 1QMGA 1XTSA 1C41A 3OT4A 4AUXA 2FW7A 5IZCA 4M88A 2I6XA 3QAHA 3H8JA 4HBGA 2FDCA 4TWRA 3PFKA 3GJRA 1D5CA 4XB6B 1D2GA 1T8UA 5DCUA 3GOQA 2QNIA 3GVCA 4KYUA 1Z6GA 4N5NA 3T9CA 3E23A 1ESNA 4AZWA 1ZRDA 4PZAA 3WXMA 2PUVA 3HSKA 1K7CA 3THSA 1E2BA 4GWLA 3JAKB 1COZA 3F0TA 1YSCA 4LRSB 2EZTA 4M53A 2ZU6A 3NALA 2ZJ8A 4HDAA 3U3JA 5L3CA 2E37A 3KTDA 4EO4A 4YEDA 2HHLA 4DB2A 3I4NJ 4DYRA 3GFJA 2OYCA 1L4UA 3OIYA 2J6BA 2QVZX 2XGSA 2YWFA 2OGTA 4CKWB 2OZUA 4X1YA 4MULA 2Q2VA 4B4OA 3OETA 4ETWA 5TV2A 3BB4A 4GX5A 2Y1GA 5CLQA 1VJDA 1EA5A 4PSUA 5C5CA 4F9TA 3OCCA 3IOBA 1CV2A 4L2IA 4AJ1A 1RI3A 4PRZA 5ESDA 1ZK2A 1JNXX 4PQRA 2FMLA 1THMA 1ESEA 2PKCA 1YQ9A 1SHKA 3GLQA 2NVWA 3A1TA 4IKEA 2SCUA 2I99A 1IDN1 5DBOA 3WGZA 3ZWYA 4IHAA 1LKZA 3TW0A 5AIPA 5FTMA 3ADCA 5J6XA 4DQXA 5AK0A 2QOEA 3T15A 3H1CA 1C1XB 4OIOF 3AUAA 3A1VA 1IWPB 2PUHA 4KPFC 4RK0A 3RJTA 4S12A 3M82A 2FUG1 4WADA 5FWYB 2FN7A 1MW7A 1PUEE 2XB8A 2O8KA 5TS2A 4MROA 4ON9A 3OFKA 3UK0A 1RR8C 1NK3P 5JCZA 1EM8B 3MCZA 3PYXA 1F0YA 3QUTA 1NFQA 5G4KA 1KOFA 3RSSA 5BP7A 1T39A 2WHQA 1ZEMA 1R9GA 3RSZA 2P7VB 3IQDB 3T5DA 1G7RA 3S4YA 1T0IA 4KZKA 1C8BA 5F1RA 4CTMA 4DCNA 4DBQA 1YOVB 4KMRA 4P81A 4EG7A 3HU3A 5TT0A 1XT6A 4WOCA 1JHZA 3KSZO 3GFBA 1XCJA 3MLBA 2A88A 3H42B 3MWEB 2I71A 2IUFA 4I8IA 3QPCA 4TWZA 1CY7A 5CT4A 4UB8C 1I14A 1GZSA 3MD9A 2HB6A 4UUAA 1Q16A 2XADA 4D79A 4ZI7B 3FPLA 4UEOA 5CDFA 5CU7A 3RZOJ 2FSGA 1QKIA 2C7GA 4BX2A 4CIAA 3R9XA 2IEKA 4ETSA 5EDNA 2XPVA 1BYIA 3QH4A 5ALHA 1ZSYA 4HJXA 2MINA 5JXHA 3F5QA 4PLFA 1PGQA 2IBDA 3M4XA 2HY7A 1TNSA 3S93A 3SHQA 4FPXA 5JRZA 4P2GA 3BH6A 4XGQA 1WMAA 2OC6A 2C5FA 4D4LA 4LHZA 2O8CA 4JBLA 3IAEA 1H0MA 3F9KA 1QGZA 4OFXA 3J7AC 2DUWA 5EP1A 2DBBA 4ZOAA 1V16B 4F06A 2MSWA 1ZITA 4B3FX 4RDXA 4ZCQA 2UYGA 1TVEA 4QDXA 5J59A 3I1IA 1XZBA 1F6WA 4BMXA 1PW7A 1PZFA 3KP2A 5C52B 1USGA 1SOVA 1SWVA 2XLCA 4N4NB 2G67A 1US8A 2VDOB 1SCKA 4CDGA 3HUUA 3O4GA 1N7GA 4YS6A 5REQB 4F3QA 2VH5R 4WGFA 4PYNA 4NCJA 4RVCA 1G8MA 1P4WA 2Z4SA 2CHEA 2D7CA 3DL4A 1QVWA 4FHZA 5C8VA 4MVJM 5JANA 2ZIVB 2X1HA 1SCQA 5IP9J 1OYVA 4QG7A 1A1SA 3MUNA 4QTRA 5IJWA 1E4YA 3N2YA 3OTWA 4LJ9A 3QVSA 3BGSA 3PWTA 4ZO6A 4QFCA 3IKTA 2LDXA 3C85A 3NPAA 1U1DA 3AVQA 1EUYA 1WB5A 1KYZA 3ABIA 5ICSA 3HKEB 2EV9A 2FMYA 2QL9A 3G2KA 4R41A 3Q6NA 3RREA 1RXWA 1ZL2A 1LBTA 1EBUA 3DLBA 3W2IA 4F8EA 1PG5A 3L0SA 3O90A 2AFIA 3RK1A 4WTOA 3NOOA 5BMVA 4JWKA 4TXNA 3QYEA 1WABA 1VQPI 4O4LF 3IIIA 3WODF 4G0ZA 4I99A 2AOUA 2BD0A 2VTEA 4YRRA 5KAFC 4MQLA 3UKGA 3HBMA 1MJFA 2IS1A 1SHZA 1U7WA 2DRIA 5KYUB 4ZDLA 1BH6A 2HPIA 4RZ3A 2F5FA 2I66A 4Q3EA 1HYHA 4XB2A 4EEZA 3IGFA 1WVIA 3DG9A 1MVOA 4AIKA 2Y92A 1CRLA 1RHUA 4Z0PA 2ZSHA 4PBRA 1Z0XA 3LVFO 3OLVA 4ZODA 1P77A 1URPA 2C5HA 4OHMA 1ZSNA 4PC7A 4B3JA 3QPLA 1F43A 3FNBA 1JG1A 3PGLA 1O95A 2WF6A 2QE6A 4ITRC 1NTRA 2P7CB 4OJMX 2CDCA 4DR1B 4H1VA 1ICIA 4MQBA 3ZV3A 5ELMA 3ZWNA 1T6ZA 3EZXA 1PL8A 3V2IA 2FUEA 3EVNA 2HQ5A 1NK2P 3RAJA 2G1UA 2W6OA 2G5CA 2GTIA 3DCIA 4TSFA 2ZJ7A 4RK1A 4JEMA 3HKCB 1V43A 2DOFA 1FVXA 2WDZA 4PCUA 4RGRA 3ERED 5AK5A 5FIUA 3GEZA 3KLBA 5IH3A 4KQFA 3PVCA 3KL4A 2R2AA 3N5KA 4EJ6A 1X7YA 2C4VA 4RC9A 3T0YA 1ML3A 1OXUA 13PKA 1OU4A 1DG1G 2JJ1A 4YJKA 5DHQA 3ROQA 1G2PA 2ZXHA 1PVOA 3CMYA 3CISA 1NE2A 5A7HA 3E7WA 1B16A 1GHCA 3SYKA 3GEMA 1G8AA 2PJZA 4NV1A 3UYKA 4Y1RA 5FTLA 2QSJA 1M8KA 4FFBB 1LCIA 1U80A 2L7MP 4HX8A 1DQUA 4YT5A 5L4LA 2HDWA 3BJEA 4EQ6B 5EUQB 3EXFA 3WIBA 3HBNA 1ZLXA 3WMGA 5EOVA 2C9MA 3IAAA 2AF3C 3BE6A 4JYAB 4X7MA 3QKWA 2IZ7A 2WR8A 4QU0A 1J2UA 2MMCA 5E4TA 2QL6A 1OAKA 1VE9A 3ACBA 4ON0A 4I4TB 1U0EA 3SS9X 2PLFA 3K4LA 4ZCTA 1WJCA 4JYMA 4BL5A 5JG7A 1TO6A 3GVHA 3FM3A 1QX4A 5B1YA 1KU3A 2NNYA 1Z3IX 1UP4A 1TNDA 1QP7A 4IO9F 2F55A 5CLJA 1MH3A 3V8KA 3T34A 2P9EA 3J7AY 3IT3A 3OQNA 1ORKA 2V9ZA 1A69A 4BB6A 4HYYA 3UMYA 3FKQA 2PMDA 3RYTC 1H9BA 2OD2A 1FVOA 2FFBA 4KK4A 4EVQA 5DTMA 2FH5B 3I9OA 4F84A 2A14A 5J4HA 4N48A 1OGIA 1QBKC 4YRVA 4HNHA 3AFIA 3LCMA 2CCKA 4N9QA 4LE0A 3WVNA 1HA8A 4BNYA 4CLEA 5LQNA 2FEAA 1LF0A 3O4HA 3BL5A 4US0R 3ZDYB 3I6MA 2LD5A 2LBFB 2FPSA 1YE9A 4M0KA 3E2MA 1JU4A 3CE6A 1SIOA 2QSGX 3CF6R 1KK3A 2ZNYA 3U6BA 5K8CA 1P6UA 2P9CA 2VHWA 4QTXA 1K6JA 1E58A 3TINA 3CF2A 5A05A 2YWXA 1XP8A 1NVAA 3ETEA 4INOA 2X3UA 4U00A 1B8OA 1K6XA 5JQGB 1VGRA 5FEMA 1OTYA 4Z7OB 1BAPA 5KSZA 1BVRA 2VQ3A 2XRYA 1A5TA 1DO2A 2F3PA 2FF4A 3L49A 5HCUA 4XDZA 3RYCB 2TS1A 1ZO8A 1WL8A 2BKEA 2AVNA 5J63A 1WCIA 4F11A 3M2TA 1NHWA 1LUJB 4MUKA 1N92A 4PWYA 1EK2A 4IEEA 1OTXA 4Q9AA 3H5NA 1IJEA 2BDEA 2GYVA 1PJ3A 1EG2A 1JQDA 1ZGJA 3H3VK 5LBTA 5JRDS 4IHXA 4QATA 1Z17A 3I72A 2SKCA 3H16A 3I55I 1XQXA 5LWQA 1X42A 2NO4A 2H65A 3EPKA 2EWNA 2CBXA 5CH3A 3Q7SA 3K7AJ 1VIAA 4DR3B 2E5ZA 2V7FA 3ASOH 2EC5A 2QD3A 2Z3VA 4JWTA 1TWFJ 2G7MC 1Y1WJ 1ESMA 3UCFA 2JVHA 1IHDA 1ONSA 5EQFA 2B5OA 3ELKA 2CUZA 4DRXA 3W2TA 1HDGO 4QQRA 3RARA 2PBLA 4LDNA 4QPPA 2HFHA 4QUHA 3K6KA 2EINH 3D9QX 4PZ9A 1GLGA 4CFSA 1UBNA 1X9HA 3LYLA 3K1YA 2I54A 3FUXA 3J7YJ 5J2UA 3GMEA 4P92A 2VSXA 2CS3A 4OSOA 2K3FA 5TR9A 3AG3H 3FFWA 2XSJC 4ZDPA 2XKAA 3ELBA 4RF5A 2O2JA 4MJ3A 4NQRA 1YJQA 2E4VA 1NXQA 3BE5A 1BJZA 2EBIA 4MGEA 5U4XA 1H23A 2FPWA 2L42A 4NESA 1NKTA 2E4ZA 3IS3A 3UXYA 4OB8A 4MS4A 5LYJB 4TS9A 4YXWA 4M4SA 4FR5A 5TE9A 1ZM4A 3EIHA 3AG2H 2XUKA 3NT2A 5AVRA 4EK9A 2W4IA 4DUGA 4AKTA 2WUWE 1OBFO 4A3LJ 3EQLF 4XJTA 3T5TA 5BWLA 2ZSDA 3G2PA 2J7KA 4C89A 5DWQA 1EFPA 3GUCA 4HH1A 4BH9A 4OO3A 1VG8A 3ZCUA 2B1IA 2Y6UA 2F5CA 2FDRA 2YJNA 2VFAA 1MH4A 2HKXA 2J3MA 4Y7NJ 3EHEA 4YBRA 3WK4A 3RKSA 3ROUA 5JS1A 1X1RA 5J1YA 3DEIA 2R0QC 1IV8A 1LVAA 3MAJA 1NQUA 3BR0A 2OZKA 4UD2A 4RHFA 2VB6A 3C16C 3HWSA 1MEOA 3IUNA 5ALQA 4J00A 4JT9A 2YPRA 3DXFA 1BI1A 5HS8A 1E77A 1AS3A 1R0YA 1DC7A 3FBGA 1W29A 2VNKA 2TDXA 3MZ0A 3WLHA 3TOZA 1MC1A 2IGMA 4OY3A 2DBZA 3THWB 5H02A 4ZVRA 2HJVA 2KJBA 1Y81A 4D4GA 2CJWB 3RKWA 1E1RA 3I8SA 4ZTZB 2R92J 4M9ZA 1C3VA 3FLMA 4K5QA 4CYDA 1EE1A 3U0BA 3TGWA 5JCJA 3NRBA 4M8SA 4W9NA 1M2FA 3PEEA 5IJAA 3QYBA 1EZ4A 3EZ2A 3S7ZA 2YUSA 3PD1A 1PI3A 2VT6A 3DBHB 3VNSA 5EAIA 4LZWA 4KUGA 4GMXA 1X7HA 1TYZA 2CNWA 4UE2A 3Q8WA 4BVEA 4XLZA 1L9KA 5BRJA 4PCVA 5IAEA 3PDJA 3AL3A 3KO8A 4CIVA 5EINA 1AD2A 2P3LA 3UVEA 1KI1A 2VI6A 5JZ9A 4DA9A 3VJMA 3A14A 2EZLA 1BXRB 4WZBA 1YL5A 4IRXA 2QVXX 3BRQA 3D02A 4GLFA 3NB0A 2B3TA 3SR0A 5EVCA 4F3CA 1LQTA 2NZVG 5HNKA 1SG0A 1ZCZA 3EOZA 4XUGB 4BQAA 4MRNA 1J2XA 3K2AA 3LPLA 2SNIE 1WMBA 4B0PA 1B0AA 4M55A 3PPXA 4WDRA 4X66B 3CRVA 4HDOB 3H3ZA 2O9LA 1MOQA 2Z2KA 2AC7A 1L7QA 5DNDA 4YRKA 5EHZA 1M5TA 4GLBA 3PJFA 2QSFX 1A2KC 1NTOA 3JRGA 2IGTA 5KVAA 3V7WA 2X8BA 2IZZA 2VSNA 4KUMA 4ZOEA 2V96A 2W83A 5AKIA 4XQ9A 3HVKA 4J2HA 2IDJA 4PAMA 4E33A 1KQNA 2ARKA 5EKTA 2CQKA 3D1LA 3J81A 1X7DA 4CQLB 3PQ2A 3BR1A 2IHTA 1DJOA 1S6YA 3RIHA 3UGTA 2M2EA 1UEIA 1BHSA 3F47A 4QODA 3AM4A 2Q5EA 1RHKA 2VCHA 1ITZA 3COWA 3UXHA 1I39A 3REQB 4ND1A 3L7DA 1MMAA 4M9CA 2FP3A 5JO9A 1NVVQ 4JD5A 5FB3A 3VDRA 1GG5A 2Q1WA 3UKJA 2QUHA 3HNOA 1Q0TA 2H18A 2J1LA 4XNFA 2QUAA 4MVJF 4Z51A 1JG3A 4FHDA 4WFIA 5K45A 2AYZA 1TQ6A 3L2CA 1EUDB 3BJMA 3LW7A 3BR6A 1E7WA 4JY7A 5KC9A 4XIJA 1MUUA 1S2MA 3IAS1 4IW3B 2YYYA 3IMCA 4G2TA 4BQPA 3A7EA 1S3JA 3NG1A 3H9CA 4MNTA 3T7IA 1T2CA 4DHEA 1E3MA 3F49S 3P71T 3ZKWA 2NU8B 4IHQA 1HM5A 3NHPA 5GTHC 1L7NA 5LB2A 1MCZA 3RVMA 4HF0A 5T6MA 1DSSG 2G71A 3PJEA 2QD1A 4H7DA 2A0UA 3VVCA 4Q7EA 2OQVA 3WNDA 1WM1A 3OTHA 3FZVA 1POWA 2RHBA 3PFIA 2BL4A 2OHJA 5E79C 2YZGA 3NEYA 2BFCB 1P60A 4P0TA 3GLFA 4X60A 1Z6YA 4ZD6A 3PQ6A 1EUQA 3VPFA 2B99A 1AX9A 1A7UA 3I2FA 5HNHA 4I9NA 3QVGB 1PV2A 4D4MA 1Y9ZA 1AKWA 2DFVA 5B3SH 2ATEA 4DMHA 2H63A 1OR7A 2IXGA 2EW2A 4K9NA 3OX3A 2YZKA 2FMTA 1FA9A 1O89A 3WV4A 4YV2A 4RGYA 4G4SO 2IITA 2AHQA 4HLYA 4BVBA 4QXQA 4ARIA 3IAM6 1RI5A 2ZRHA 4HEJA 4TXJA 5AHOA 2DF8A 4DCJA 5BSEA 2MC3A 5KTSA 2WG1A 5IXYA 5JDCC 2RNJA 5K3CA 1EWKA 1PFGA 2EHJA 1SKAA 1VQ8I 5LA6B 4YMHA 1VG1A 2VCEA 1GQYA 3AT1A 2DTRA 3DEHA 2NO1A 4J9UE 4Q37A 5SYAA 1VZ2A 4DIKA 4TL8A 4EF4A 2BYTA 1WUJS 1XBTA 5I7UA 3OH8A 2HMVA 2E19A 3CF0A 2XROA 3MJRA 3L4BA 3W2VA 4ZK6A 2E0IA 2FPRA 1DAMA 4Q4HA 1V2GA 1CVRA 3IQXA 2XV1A 4XUCA 4FSHA 1E9SA 1XRPA 1GARA 4BPBA 5FPQA 3RSCA 1RQNA 1U0LA 3OM8A 1UHMA 2XMPA 4RV5A 4RK5A 1MC5A 2YC4C 4B09A 3B6IA 3GGPA 4JKIA 3UM9A 4LMAA 2ZYGA 2J3EA 1E6MA 3DM9B 4FFVA 3KAJA 3NWPA 2OMKA 4YJFB 1RXYA 1Z0UA 2F1KA 5DISB 3JQQA 1Z0AA 2XXAB 1PV1A 2VDNB 2I3DA 1P0FA 1Y4UA 2A4KA 2Y1OA 4BV9A 2Q45A 2EV6A 1TAQA 2HJWA 3GJ6A 5GPCA 4DSZA 2HXSA 3JTHA 1XZFA 3INTA 4GSLA 1I33A 2OILA 4CF5A 3LT2A 2QKMB 2SECE 1D0ZA 2PE5A 3PEUA 3GWGA 3L7BA 1MW9X 2E7WA 3SJZA 3SF0A 3GOHA 4ZYXA 3ZE7A 3LZCA 1H9TA 3UW3A 4AKEA 4KN6A 2DUNA 4JHLA 4BQRA 3EA4A 1GLVA 3CZMA 1CW2B 1UMQA 4G9GA 3WLMA 1O5OA 1J9GA 5L3QB 1XTBA 1NLZA 2VPWA 1TX4B 3FETA 4KQMA 3O8LA 2HA5A 1F4VA 3FGPA 4WA7A 1ZJ6A 4NE2A 1GGMA 4YMWA 5TQ0B 3GNLA 5K0JA 2E5WA 3MCTA 4L0CA 4DUPA 2Z2ZA 4AC0A 3O1LA 2PLYA 2VPZA 3S81A 1KJZA 4PGFA 4XKVA 3W2AA 4F97A 3U3OA 2XHEA 2J09A 5LU8A 1KDTA 4JA2A 2BGUA 3NVAA 1RE0A 5GGXA 1Z4MA 4EHBA 4Z4FA 1VE7A 3CN7A 2Y2VA 1XEXB 4LJ4A 4JT2A 5F0CA 5HK8A 1C7FA 2ZW9A 3AEYA 1L5SA 3G2QA 3N86A 2WD8A 5ALDA 1YAHA 3G7UA 3ZCQA 3VPCA 2XGCA 2B3DA 4EG3A 1RWVA 2EQ5A 3NTUA 5HDKA 4PIMA 1JHRA 5D6NA 5F5LA 1WULS 4UFPA 1RYYA 4IEJA 4XD7A 1EGVB 2I6QA 3HEBA 2ZTHA 4PX2A 4L3OA 4O4JF 3ZE1B 5FQOA 1OLUB 2X22A 4UMFA 3RB8A 5DD4A 5JBNA 4OX9B 1T9BA 3DXYA 3AHGA 3PE6A 1X7GA 4OFWA 2D3WA 4REOA 1AZLA 2I03A 4EDHA 2QTBA 3ZXXA 3DVQX 2X1DA 2H7CA 1QORA 3AR8A 5KYYA 1S9DA 1P73A 2UXDB 2ISZA 3L79A 3M4YA 1Q3TA 5K6RA 2M6SA 3UMSA 2COUA 1CJUC 4B5LA 2JAHA 2J30A 3E2IA 3OPYB 2HRBA 2HDNB 1BXZA 2CGPA 4EHFA 2ZJOA 1E3PA 4OQEA 2BFOA 3CR7A 3DMHA 3DULA 4NDZA 2QB5A 4PEVA 3NIWA 2P9HA 1O9HA 1CUWA 5GONA 4QFBA 2VDWA 2Z1NA 4E4HA 4ENTA 2F5VA 1I51A 1DARA 5A9RA 3L1IA 1QH0A 4LISA 2OHGA 3DTYA 3N87A 3WTTC 4CV0A 4OUDB 1NBWB 4LYJA 1V25A 1B42A 4G0QA 2ID7A 3BKXA 4YO8A 2DEUA 3P9SA 1A27A 2ON6A 3H0KA 3MMYB 2MBFA 3U7QA 1CDDA 4XEHA 5K6AA 4U9HS 3W6KB 3FB1A 4FWIB 4RCVA 2QVGA 5A06A 3IAXA 4F6CA 2DKOA 1JSLA 2E36A 3AB7A 5KQRA 3K1TA 2QZ9A 2VQDA 3ADBA 1O4XA 2VBCA 2LF7A 1GT6A 1R36A 1OCPA 4ZVLA 3HUTA 4OHWA 3LI2A 4FISA 5I45A 4H3KB 4QXMA 5IBQA 2CXNA 5CB4A 3S3NA 5GMOA 4HATA 3TCKA 1GGVA 2B2CA 3WLEA 3BAZA 3JVUA 4LJ8A 3Q1LA 1EQ2A 3GLVA 3SMQA 2IYZA 1MJ9A 1FP2A 2ODPA 1KVQA 8ABPA 2VDQB 2QJWA 3FOZA 2WJWA 4GSKA 1KMIY 2QN9A 3WNBA 5HR5A 2LF8A 3F3SA 4BV2A 2VKDA 5CCBA 5DYMA 4AECA 4UVGA 1NTCA 3AZOA 3SCZA 4FDTA 4TMKA 3SFVA 1DBIA 5AH0A 3N8GA 3X1DA 3ZV5A 4EJVA 2DTDA 2KRHA 2FCAA 4TLEA 5JAMA 1RD4A 2GXGA 1SXIA 4CF6A 1JECA 2FCRA 2W6JA 3OOYA 4M71A 3VZDA 1B6TA 5ELLA 1EX7A 2QY9A 4CG0A 2PRZA 2YHSA 4BE7B 1SU7A 1BROA 4Q00A 2HPAA 3WK6A 4IO0A 3CN9A 2WC2A 2GTHA 1NSYA 3GROA 4AJOA 1F2VA 1NVVR 1IJKA 5AOBA 2BXZA 4CDMA 3LWFA 3DQQA 4MR8B 5DD8A 4BE0A 2BZ1A 4XLTA 4F6RA 2PKQP 1UJNA 1ZOLA 4GI2A 4HZFA 3X2FA 1QVUA 2EFNA 4D81A 1NXSA 2ODBA 1VPWA 4I2VA 3ZD6A 5KYKA 3TGLA 4IKOA 3E9ZA 4H6WA 4M1SA 2H4HA 3DNPA 3N2NA 4L9AA 4OYHA 4QU9A 4L9SA 1DLJA 5BQ3A 3U1KA 3JRIA 4EG5A 2XF2A 4I7HA 3OHPA 3B2EA 1B74A 1F5SA 2JLSA 2GJSA 4RA9B 3D64A 1WWKA 4H7HA 1SK9A 1TD1A 1VLVA 3PA8A 4ENMA 1PFVA 1S8OA 1JQLB 3D5RC 3ABOB 4LBWA 1XZQA 3UPDA 1HNNA 2CW5A 3M6IA 4XR4A 3FWHA 2HYDA 3K9NA 3F7TA 4AP9A 4JUDX 4B2YA 2CVPA 1R0RE 3I5AA 1XHFA 3CV3A 2X6TA 3TMOA 5EY5B 1M83A 3RVKA 4Q1EA 3SIRA 1TQIA 2EKZA 1SVKA 3NONA 4UTZA 3ITDA 1RYDA 5JBQA 1ESZA 4ESJA 4BMYA 4MH0R 3ENVA 5HNFA 5DV5A 5TB5A 4HWRA 2R8BA 4L28A 3UAXA 3VAYA 4BMVA 4IAOA 1NMEA 2CXQA 4R1TA 4MMZB 4IZOA 1ZRMA 2G5GX 1R0CA 2ZU0C 3RBAA 3OY7A 4LNHA 5EZHA 2P2LA 3O26A 4RELA 3HOWJ 1JEQB 4Q7QA 2NQ2C 4WLOA 3K4CA 5AI5A 4YRMA 4YP0A 1NDQA 3MRSA 1WSDA 4OBEA 1JJ6C 4NRDA 4RTKA 3AKDA 3CRNA 1NG9A 2ONYA 2X0RA 3NCTA 3AFMA 2JT1A 3NH6A 1WBDA 4L15A 2GK3A 4N0MA 1FMVA 1J2JA 4RKWA 4HWSA 4KXYA 4URXR 1BGVA 3ZMUA 2J9XB 3DEEA 3OR1C 3BGWA 3AXSA 1CP2A 3X44A 1MB3A 4OXQA 3MFYA 5KYWA 4OEHA 3T5PA 3VWBA 4QOJA 4GBMA 1XVTA 1SD4A 2X48A 2BTOA 2AWNA 1V6AA 4EZBA 1MA0A 2HXGA 5BVHB 2IOFK 3WTXC 4ZHSA 4PLYA 4J1SA 4LQ4A 3G1WA 3K9CA 3VPGA 4CLRA 2NSHA 4QU8A 1ZKMA 3BJZA 2G1AA 1UELB 3KZVA 2BW3A 3BBPA 4OK5A 2W90A 3FHTA 4Q4AB 4BP9A 1V4BA 1KI4A 3GW8A 4XOTA 4UVAA 1DCKA 5LOVF 4BQOA 1O0SA 5D3KA 3RFUA 2R8PA 2VH2A 2UYOA 1SO8A 4WBNA 5DHPA 4HXGA 1W52X 4ER7A 3IXQA 1WPQA 4E5MA 4I7EA 2RB4A 4J76A 3R2JA 3D6FA 3M6VA 2HJ9A 4J0CA 3I12A 3KUXA 4CTKA 5D5PA 4ALIA 3A02A 5F4ZA 1Y8QB 1CQXA 1H88C 2QP4A 3PWZA 1AMOA 3H5LA 3NP7A 5ALJA 1O3QA 3COZA 5K05A 1ZNZA 3LPNA 3T4UA 4V2IA 2QUIA 3AVUA 2EV0A 5M04A 4ZU1X 5FL3A 5G40A 4FWTA 2R4GA 2OVFA 1I1SA 3JTMA 5LIRA 4QDTA 1TGYA 3RVOA 3AETB 2ZRAA 3JU3A 5CLLA 4MIEA 4DA0A 3MTJA 1JX6A 2H0QA 1Y1KE 4PE5B 2ICWG 1T8WA 2MD0A 1XL0A 4LB5A 4MPTA 5GZ3A 1R6XA 1E1KA 3ZN0A 4CVNA 1UZLA 3HYNA 3CLHA 3IQWA 1XNRB 5AW0A 1JKJA 4DR6B 5CXUA 2XYGA 1NMQA 5H16A 3BF7A 4OHZA 5IJ9B 1T2AA 4QPDA 1XZHA 2QJOA 2B92A 2XR1A 3FPFA 4TTPA 2GHRA 4FX4A 3RSQA 1XAHA 2F4OB 2PVPA 4FSDA 1M3SA 1VZ3A 3M3HA 1YI2I 1P5ZB 4L16A 3E9YA 3L93A 2GQQA 1D8AA 4P4SB 2B8NA 4DUYB 2ZNZA 1R1TA 2IOFA 3PLNA 1ZUWA 1Y1PA 2YJ5A 1ZAKA 1CZHA 3CUWA 3M7GA 4GEKA 3U0VA 4L0DA 3I2GA 1UEJA 1JR3E 1HOTA 2P27A 3IA7A 1KK2A 4ZVSA 2YJGA 2EBHX 1LBHA 2PO5A 2ZYWX 5ER6A 2M5WA 2FW6A 3THYB 4PLWA 1OZHA 5DULA 4WUVA 1OU0A 3U2QA 5IDWA 4BFTA 1KAMA 4ID3A 4LRXA 4RENA 3H1AA 2WFAA 3TRJA 4EG8A 4HV6A 3H1FA 3WO1A 3QWHA 2D4HA 4ZYLA 3I1FA 3B1KA 1VB5A 3I6YA 3AP1A 3N8HA 4JH0A 1K3UB 3R6WA 2FPIA 1ZLJA 1LWOA 5LBQA 4KQHA 3JRNA 2PDAA 5JVDB 1VQNI 4KT5C 4DA7A 4OQDA 1IQRA 2K2QB 3ZTWA 3UUFA 3PNOA 4FFSA 1HYGA 3CKKA 4Z7NB 4YONB 1CUEA 1S89A 6AT1A 5D5XB 4IOAF 1U9ZA 5AW5A 2NU6B 2K5UA 1I7SB 2BCGY 1ZW1A 1G9SA 3GNTA 1LF5A 2PWBA 1QQTA 1KBZA 4DYVA 2H57A 4RVGA 3V4OA 3Q7IA 1YFHA 3TRHA 4KLAA 3GELA 2PUFA 4LV6A 5IUKC 3AO0B 2GFIA 3PUVA 5KJ1A 3EH1A 2WZDA 1VP3A 4BB5A 2GB4A 4HH4A 4JQYA 5HRUA 5JZBA 1BWRA 1YV9A 3TXXA 1D2HA 4KYTA 1NXOA 4RTOA 2HF8A 1FYMA 1T36A 1XXHA 4WVLA 3EC7A 4O2LA 1UXOA 2YIJA 2PPLA 1IVYA 4Z9FA 4UASA 1LPAB 1MKYA 3O9VA 4G5YA 4G7ZF 5I9BA 4Y9TA 2XUFA 5CX4A 1C7JA 3IQHX 3D3WA 1T25A 4X3PA 3C8MA 4M1ZA 4PR0A 2EGUA 2FRDC 4ZT5A 3RGGA 4DLBA 2OXFA 4ABTA 4CM9A 3G8BA 1OI7A 4C7BA 5LCXA 2O52A 2J08A 4YH1A 2JBAB 3WGNA 3PNVA 3N28A 7REQA 2LTPA 2PX5A 4ALMA 1YDWA 2BFWA 1TA9A 1Y5NA 9MHTA 3VEPA 3RNLA 4P3XA 3JATB 1EBBA 2P6MA 3QLJA 3EEYA 4IGEA 3GLUA 4KL8S 4U6NA 1SOMA 5GAJA 1MC8A 5D8KB 1XZ8A 4MVCA 1TU0A 2EEPA 4KACA 4RHUA 1PVDA 4FOTA 1T8YA 2JEYA 5KWSA 2JCXA 1AQYA 2XRLA 3IQIX 3W5UA 3ZU4A 3ADOA 4GCVA 2IUSA 3HFSA 1MLDA 1OAOC 2BFMA 4XWGA 4LB6B 5EQDA 5CLGA 1JSXA 3CVXA 4XLEA 4EA7A 3WGLA 4UV9A 5EFOA 5IRCD 3TDMA 3NKVA 4MW9A 4H60A 1RIOH 1G7SA 1MW8X 3C5HA 3I61A 5ALWA 3B13B 1M2NA 2C54A 4OOFA 2D1YA 4U7PB 3FUCA 4HTAA 3BMCA 3UC9A 1U6JA 3RCOA 3K96A 2IYUA 4XX1A 2AXTC 2Z9DA 3CCBA 2YHIA 3FTQA 2CCGA 4DV0B 3JARB 3RKRA 4A8PA 1CUAA 2YXNA 4NZNA 4AT1A 3F2IA 1V8ZA 2FFAA 3K2BA 2QM7A 1X38A 5ALTA 2KRCA 2HWVA 4MS1B 2RGNC 4O4LA 3K72B 3KQNA 4EVIA 3SE0A 3G3EA 3TTSA 4EATA 2CUTA 4IRMA 2VP0A 3BGDA 2C9OA 4WKOA 4LJZF 1DIOB 1IIBA 4C9BA 3WL7A 4PC1A 4TMWA 2ZZMA 1Z5VA 2BEUB 4RD4A 5JD3A 3ROEA 3C48A 3LTNC 2JA7J 1ODJA 1RQ7A 2Q0XA 4RAYA 3NTOA 2ZYUX 4WXYB 5E6RB 4R79A 4TV9B 3RRYA 1Q21A 1F20A 4G0WA 2ERYA 3W1WA 3KTFA 3QNMA 3WOVA 3BHIA 2LY2A 5L8VA 2GZMA 1FDTA 2UDPA 1OQYA 4L0MA 4BHTA 3A1FA 4IIDA 1P4AA 3U56A 5CJJA 3KLOA 3HYTA 3GPLA 4B4KA 1XTJA 5B64A 4CN8A 4QYSA 1G20A 3D1JA 4KNYA 1UF9A 3R6SA 1LX6A 1WZIA 2I1VB 1WJGA 1J4AA 2Y1KA 5F23A 1Y1LA 3AEQA 1JFFB 5K3BA 1A1VA 3DZDA 2WP8J 2R8YA 1XDBA 2CFCA 1WO8A 1S3GA 1HLGA 1BU5A 2ADFA 4RAFA 1OMIA 2XB5A 3LYUA 1FMCA 3NI2A 3TNDA 5HS9A 4BJTA 1HC8A 1BSVA 4DJJA 1I80A 5L7WA 2AYXA 2YDYA 4BMNA 1E92A 4W99A 1AQJA 5LSAA 4P55A 4FDMA 4Q18A 2KBFA 1A5AB 5B1AH 2P8JA 1FX1A 5CA0F 3MTEA 3GNQA 3IELA 2F4IA 3OM1A 4MV4A 1Y4ZA 1DUIA 2C9ZA 1J2EA 3BCSA 2CBZA 4RHEA 1GKIA 2FNAA 4KNVA 1VMDA 3TOXA 3T61A 1GP2A 3OJXA 3ZTTA 5ERGB 4UHTA 1NLFA 1U7UA 1V3QE 1PDVA 5CDGA 1Z83A 2XUAA 3HB9A 1JPUA 4XM3A 2ZUCA 3KL2A 1T33A 1AO0A 4NHJA 3FYSA 2QX4A 1X8JA 5LMNB 3ZS8A 1Z2OX 2G04A 3BJRA 1KO1A 3FHOA 1BHJA 1BA5A 3CQZJ 4WH0A 4R31A 3MZHA 4L5IA 3KZZA 3HO6A 1ZHOA 2IXFA 1LTQA 7AT1A 3QV1A 3HACA 3BWMA 4F3KA 1U9CA 1W48A 4BLWA 3EXIA 3HP7A 4EHLA 4MEAA 1GFSA 5E7JA 4HDVA 3JQAD 2HHHB 2J6HA 1WX1A 3FXJA 1RFGE 2C20A 3M8KA 3HDJA 3VNBA 3M83A 2MT9A 3QE9Y 2BGCA 3E70C 1R6RA 1G8PA 3OE4A 4R9UC 4MR9B 3K9QO 3CLSC 5I4CA 4AWXA 3BE8A 5THQA 1Q14A 5DCYA 4F4UA 1WLYA 1UODA 3X1XA 4TYWA 4ABZA 5ICMA 4XGRA 2Y1CA 3ZGXA 2YY7A 4Y33A 4XW2A 3CLUC 4QD3A 2O03A 3RC1A 3K69A 4QFDA 2KI5A 4A2CA 5IAAA 3BZKA 4P58A 3RDIA 2Q8KA 2WD7A 2QS9A 3O2QB 2OGWA 4KPEC 1L3BA 2OBMA 1TRKA 4AWBA 4DDUA 3IODA 1ZELA 1VE6A 1XEWX 1X7WB 3HJRA 4YROA 3NHUA 4EL5A 2QX7A 4CKBA 1TM2A 2R8RA 1A8UA 4CIBA 3KKKA 2HTJA 3QXJA 1RRPA 4CCWA 3I4CA 3BCAA 1HL7A 4RV4A 5DWDA 4RVUA 4YJGA 3KXPA 4JI8B 4G0XA 1WXFA 2FXIA 2C31A 3EODA 2Y69H 3IPLA 2IUUA 1TOAA 4D8UA 3RTCA 3VR6D 3QEMA 3MGKA 4X62B 3IURA 3FUVA 2FSVA 3OZCA 3A6GA 5A4JA 4WFJA 3CZAA 3GRAA 7YASA 4R7ZA 5B2FA 4C0QC 2NYVA 3C1TA 3I09A 3ASNH 3PFBA 1UZCA 1QRUA 2QYHA 2O05A 1Z2EA 5DYYA 2NTNA 4WZ6A 5M7EA 1X1AA 2WV9A 5HZHA 1BKSB 4WXPA 3RS5A 4IPAA 1S29A 1B4DA 4QUJA 3H18A 2H54A 1U98A 2G1PA 2WJ6A 4X64B 1XQWA 1XRMA 4J03A 4JB3A 3CZ6A 3OIFA 1RRCA 3ECOA 2FR0A 1A71A 3R0QA 3OI7A 1GV2A 3HL4A 2KX7A 4HDKA 1XLUA 4US2R 4IJUA 4B6FA 1MBFA 4NG5A 3HSEA 1BTOA 1N0HA 4NBVA 1UWCA 4RMIA 3KETA 2ZR7A 4YPVA 4CCJA 3WNZA 1O2DA 1L0BA 2WQ7A 4X85A 4B3SB 3LSRA 4HLCA 4FGSA 2J0EA 2FE1A 2XMCA 3AV0B 1JMKC 5HLIA 1YB6A 4JYPA 2AOTB 2BVLA 4XKBA 10MHA 3W8EA 4X5OA 4PGGA 3GA0A 2ICAA 3KP1A 3RDPA 5EIAA 2MSLA 1YZLA 3O03A 5KEIA 2FZLA 3SXPA 3A4YA 4BVLA 4KXQA 3PFGA 4DQVA 3JRCA 2FW1A 1X4OA 5AJWA 4RJTA 3WLNA 1IBSA 4K8OA 2W2LA 4RL6A 4AJ9A 2AXEA 2DA2A 4MI1A 4OU0A 1BFDA 1G2OA 3LHKA 2RAPA 4OMUA 3IT1A 5IVDA 1ZLYA 3WK9A 3IP1A 4KE7A 4RPJA 4D0LB 3K9GA 5ITSA 4UBKA 3G2LA 1P92A 1ZD2P 4NZPA 4BMSA 3DKWA 3I3OA 4O4IF 3RQSA 5LD2B 2A07F 5F0HA 3MHTA 4LZNA 4HEQA 1XROA 2C5LA 3Q9VA 3ONEA 3M1IA 1VHDA 1ZUNB 2HXIA 3OCJA 4HRYA 4KXVA 3SK0A 2PWZA 4YJ3F 3HRHA 2DAOA 1L3IA 3KJGA 5GJBA 2IH4A 1A4XA 5DRTA 3CVYA 2XV4S 3CTPA 3MWDB 5HOQA 4CWAA 2QK4A 3NWBA 1CJTC 3BOSA 1NM5A 2IXSA 2W6IA 4QVGA 2FV8A 5D5QA 1X1SA 1D1BA 2VI5A 1G5QA 1T98A 4F56A 1R4NB 4B82A 4RXTA 4J49A 4LKRA 2I2WA 4K9LA 1IH8A 4TT3D 1PYDA 4KXUA 2BFFB 3LY7A 1E7QA 1N0IA 3AX6A 1FC3A 5ALKA 1OASA 1Q15A 2JAPA 1X86B 5EHNA 2XB2A 2B9EA 2W7TA 2AOVA 1SXJA 1DJLA 4H7KA 2AWOA 4MB2A 3SOPA 1VSTA 1ND6A 3ZRGA 2RGUA 3S1AA 4PBSA 1OH5A 5AW7A 2VRNA 4ZOLF 3DVAB 3SU8A 1B43A 3ZHCA 4AUKA 1R8XA 1ODIA 1X4PA 5CM2Z 1SUDA 2IUYA 3QX7A 2I7XA 3OFND 4UKDA 1Q1BA 2JLRA 5HUHA 4AF8A 3D3JA 3WWCA 4ENSA 1BD4A 1XZMA 1MV8A 3WRWA 5K0LA 4NEQA 2I6UA 4WNCA 4JC4A 2D0PB 4KIUA 1WEKA 3FSJX 2VAVA 4BBJA 3VR5A 1PGJA 4RU1A 3FYDA 1ZRFA 2RC4A 3LM8A 2XCQA 3CR8A 3IH4A 2BV6A 3B9BA 3W8DA 2RC6A 2QVYX 1U11A 4Q1VA 4M0EA 1TK2A 1GTRA 5JCOC 1RC0A 1U5TC 4V03A 1ZH4A 2CNNA 2BKUA 2VSFA 4HNTA 1MPXA 3AI7A 1T9ZA 2QT1A 4MUIA 1OCTC 1S5LC 5CJ2A 4KGVA 3JQ6A 5HLTA 3V4RA 1JT9A 4A0RA 3RKYA 1BR2A 3AERB 1V9LA 4AKIA 1Y4SA 1DKUA 2QAGB 4XUDA 3HSRA 3B1ZA 2CLKB 3HDTA 3TBFA 3HH8A 3C6MA 1ZG3A 4OL9A 3Q3VA 2DP4E 3M6XA 4J75A 4XKJA 1FFXA 1J9ZA 1M1NA 3MGBA 2G0TA 4UXHA 1TLFA 4OAOA 1Y6GA 1DWUA 1QTRA 3TTUA 2G25A 1RI2A 2DSNA 1I5RA 2I4MA 1A7JA 2XGOA 1LPNA 1E69A 3GC6A 1YD7A 2H52A 4NONA 2X9QA 4N7MA 4ANFA 1V41E 1U7OA 4BX0A 5K0TA 1ZJ4A 1DJQA 3B82A 2WP0A 1IUYA 3MC1A 3VMMA 3EC2A 1I30A 4Y15A 1G5RA 2PXCA 1U2DA 3QP6A 4MVJA 4NL4H 2Z58A 1LI4A 2VYVA 4I14A 5TSDA 4NC7A 4J7UA 2VWGA 1QE0A 1RQLA 4WOKA 4AY4A 1W581 1ZC3A 1GGFA 1EFKA 2R62A 3GRZA 3OEEA 1N9ZA 1KU2A 1MJNA 3RRXA 1MZPA 2A84A 1L6RA 3E9RA 4FN4A 4GYJA 1H6AA 3NKLA 2GUGA 3QVJA 2V1NA 3VYTB 1QRTA 5IF3A 1EX6A 4RIEA 3RWBA 2VYND 1GUFA 5GVRA 2H1WA 3NR2A 5TS3A 1M6VB 4LTNA 4PSKA 4AQ7A 3Q8LA 1VI2A 3SX4A 1A8SA 1ZN2A 1WTAA 1JAXA 1ABBA 3ZI0A 4Q5SF 4LG3A 2J3HA 5ISMA 4EG6A 1CX9B 5EZSA 4JVMA 2O8DB 3HPHA 3CWCA 3NFRA 5ALNA 4N5LA 4V0RA 2C7PA 3SC4A 1TT5A 3HA5A 1Z4LA 1EDOA 1ECBA 5A1JA 5T6BA 4NNPA 4BRSA 4B6RA 1L1RA 1OBOA 4ZFNA 2ZRCA 2FZKA 3OBBA 2C84A 2FN8A 1J06A 2HADA 1XI2A 2IGKA 4DIBA 7GPBA 1UBFA 4ZYZA 3WTCA 4NCIA 4CG1A 5KAPA 4CF4A 1JQJC 3OYDA 2ZVPX 3U9LA 4DJFC 2P2DA 3ED5A 3RU3A 3GTKJ 4KG7A 1P1RA 1R8YA 2HKIA 5IKPA 4IQFA 2XYHA 3CM0A 1KC3A 1PX0A 3CO0S 1FFWA 3CJRA 4G9BA 2VP6A 1G8XA 2Z8ZA 1QNTA 5IHXA 2RJNA 1KA9H 4WK8F 1E3WA 4HGPA 3VHRA 3ORQA 5HFNA 3V32A 4QIWN 3MKWB 4C7OB 3HA2A 3R7WB 4HVLA 4C04A 2YWBA 1XDWA 2FJPA 3GJ8A 3T12A 2GPJA 4EPTA 3C5EA 2HC9A 1B8VA 1EP2B 3G1MA 3CLRD 5C0OE 4KO1S 1LNSA 3OYKA 721PA 5CCEA 2WJZB 4QDUA 1H1LA 4YRZA 5K03A 2I6SA 1VE1A 1EE9A 2I1LA 1E17A 4K2AA 3ZGLA 3WKCA 1JDSA 3HYIA 1DFIA 5J9FA 3ZGKA 5FADA 1V26A 2WSSD 4BVKA 2Q0QA 1Z68A 2PUWA 1GGNA 4ENNA 2VL7A 3VGJA 3J81K 1GFIA 4UM9D 1H1DA 3UPTA 3OJEA 5C1BA 3P9YA 2AEFA 2ZWIA 1T9KA 1Y4DE 3DMFA 3G6WA 4GX1A 4OFZA 1FOWA 1NW7A 5AQEA 1QO9A 1BVUA 2FWJA 2CV1A 1SQGA 2VLIA 1FYVA 1U94A 4NH4A 1HORA 5DGCA 2KM1A 4A73A 1FOKA 3HMKA 2BKXA 1MIOB 4FDVA 2O8FA 2YZNA 4RBOA 4BLVA 1TJ5A 4PFJA 1J5PA 3ZD8A 2QTVA 4Y0AA 1E2KA 1PHPA 4G8BA 4DJAA 3BHJA 1Z3XA 2QVLA 3KJQA 2Z9BA 4PO3X 4I3HA 3D59A 1T4MA 3ZI7A 3U13A 2VDRB 4NF2A 4YRPA 4UQLA 2O2YA 1VJ5A 1P0CA 4QA9A 4HLNA 4NICA 1LI5A 3WYAA 3JD3A 2P5LC 1T3SA 2V65A 4HKTA 2VE8A 1BC5A 3VZCA 4FNOA 4X45A 1UOEA 1MIJA 1THZA 2XDYA 4C0AC 1L5VA 3J7AO 3B53X 1QLJA 3ACCA 3ZGZA 2RG1A 4Y52J 1MFPA 1Z25A 4AN0A 1PFYA 5I9IA 3E7XA 4QU5A 4L5BA 4BIIA 1WH5A 1O97C 4I4CA 2B1GA 4E7OA 1DAHA 5TRDA 1YBHA 4PRYA 2Z3WA 2DQKA 3JWHA 3RS9A 4MGRA 1HWYA 3HU5A 3VH4A 3DUFA 2VZEA 1E6EA 4B87A 3CUQB 4IJMA 1Q17A 4X1EA 5DMXA 3RWOA 1D2CA 2R3SA 1AZWA 4TZKA 4OHPA 4Q1BA 5K0SA 2K85A 2X1LA 3AHFA 4IUBS 5IC5A 2QRJA 4PINA 4ERNA 2OXEA 1KFKB 4BWYA 1ULYA 5KNDA 2P78A 3GFIA 1Y7IA 1SVLA 1SPXA 4RIHA 1UMCB 3S16J 3UFBA 2AO9A 1PSWA 4RETA 1T24A 3GZTB 2QJRA 3EEFA 4O4JA 4AYBN 3DEJA 4AL4A 4B8ZA 1UDCA 5EE5B 1YOBA 1MJ5A 2R8XA 2H06A 5B53A 5JXIA 1QRDA 1M2WA 2RV8A 4DWJA 4R69A 5JPDA 5FQNA 5K0FA 1HG1A 1N0VC 3FZGA 4EHHA 4Z4IA 4H6PA 3GFSA 3KV1A 3D6NB 1SUIA 5CW1A 1Q0QA 3K2IA 1F8GA 5CFZA 1UBEA 2ILVA 1GCAA 2OD9A 3OO1A 1NJGA 3IP6A 2CLCX 2WOJA 1PL0A 3QTLA 4PDKA 1WNFA 2VC2B 3GCDA 4KREA 4GQIA 1E5LA 1DP3A 1VFNA 1CERA 1YNSA 4MVJG 4A8HA 5CM8B 2FI1A 3VKVA 4EY7A 4QYIA 3OZDA 4LOAA 4CN9A 4UEWA 4GP9A 1NN0A 3CKYA 2WJVA 2RH8A 2Q9CA 2K40A 1VECA 3UT5B 3CF4A 1E1NA 2PZ8A 4KB5A 1E9AA 5EIFA 1T91A 4FKMA 1G5HA 2AGVA 2XKOA 4B75A 5D8DA 1LKXA 4RVOA 2F4MB 4Z9BA 2BLLA 4IHWA 4NJMB 4LBYA 3NVKI 2WWGA 1Y0BA 1PEKE 4CHGA 5DK6A 3FYUB 3FZYA 1IM2A 3JQ9C 1MQAA 3OWXA 1XSXA 4BV8A 4XIIA 3E7PA 1U3TA 4IDDA 3O3MB 3SQOA 4H1WA 3EDQA 3E3VA 3QW4B 5WRFA 4CKXA 3B9RA 3G2HA 4JEHA 4YDSA 2B36A 3N2ZB 3DFGA 4OQLA 2IYVA 4OVKA 1PD1A 2GAUA 4OQZA 3WL5A 6ADHA 4F7WA 5T4FA 2X0EA 4F4FA 1UP6A 1DFGA 3T7JA 1FT9A 5KNCH 1X58A 1BH2A 2Y0PA 4GC5A 3CXRA 1NATA 1XZKA 1OPXA 3WP0A 3IDOA 3OZ7A 4H77A 4BFUA 2ZBQA 1ETHA 3KZCA 5AW8A 5JW6A 3HI6A 4BNJA 1F36A 1RAAA 1MXFA 1X7XB 5JNVA 1I6WA 1O7FA 5C9ZA 4IBOA 5K8TA 3WWPA 3NBFA 2XWSA 1IB0A 4Y17A 3FBNB 4OREX 2KP6A 3QQ5A 1K86A 4AU1A 2VJMA 3G8YA 3ICVA 3K8OE 3ABMH 1U65A 3FFXA 1XVVA 1LBSA 4TWIA 5B66C 2XSZA 4ZRMA 3N8DA 1CQIB 1HA3A 4OQMA 1S2LA 1GTJ1 1SKUA 5TJHA 3PCRB 2A0WA 4P7KA