4S05A

Crystal structure of klebsiella pneumoniae pmra in complex with pmra box dna
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
219
structure length
219
Chain Sequence
MKILVIEDDALLLQGLILAMQSEGYVCDGVSTAHEAALSLASNHYSLIVLDLGLPDEDGLHFLSRMRREKMTQPVLILTARDTLEDRISGLDTGADDYLVKPFALEELNARIRALLRRHNNQGDNEISVGNLRLNVTRRLVWLGETALDLTPKEYALLSRLMMKAGSPVHREILYNDIYSGDNEPATNTLEVHIHNLREKIGKSRIRTVRGFGYMLANN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and dynamics of polymyxin-resistance-associated response regulator PmrA in complex with promoter DNA.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Transcription/dna
molecule keywords DNA-binding transcriptional regulator BasR
total genus 61
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4s05A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4s05A01
4HV6A 1VLZA 3CZCA 3KG2A 2ZCWA 3K2ZA 4I98B 3KS9A 2PLYA 3N0RA 2MA3A 3I5AA 1D5VA 3RPQA 2HR3A 4MRMB 1JE8A 3H5OA 1P4XA 4A12A 2UWMA 2WY2D 3LUFA 3I59B 3I09A 1XSXA 3GBVA 3H92A 2RN7A 1R1UA 3JPYA 2NZUG 1MJAA 5HSGA 4L85A 4IRHA 1K79A 3DZDA 1XB4A 1YFHA 4RB2C 1GLGA 5L3DA 5BPIA 4FE4A 1K78B 2DLLA 3QLUA 5TQ0A 2VOOA 1NXWA 3O2JA 1KYZA 4KNYA 3LUCA 3HHHA 4KICA 1G3SA 5L3BA 1QP0A 3MMNA 2HQNA 3RYPA 1NXVA 2VUIB 3GO5A 1LBHA 3ZQ7A 2IOYA 2EWNA 2DW4A 1O3RA 1KQ9A 3H6GA 1JGSA 1IXRC 2Q2EA 4LDAA 4MNUA 2XASA 4IRIA 1SAXA 2PI0A 5TE9A 3O2SB 4CYDA 1B4AA 3REOA 4S04A 5HVQC 4RK1A 2QLZA 2HEOA 1I1SA 5HDGA 2VBYA 5E20A 4RGXA 2MYNA 1LJLA 1CF7A 2A61A 5D5XB 3E6DA 2TDXA 1QBJA 3FMSA 3L2CA 2LF8A 1XN7A 3OOPA 4HNRA 6PAXA 1G3TA 2H3HA 2Y48A 3H1GA 1KRWA 5KQPA 1DDNA 4MAAA 2DU9A 3CKMA 3QLUC 3H1EA 3Q9SA 3DGEC 4KRFA 3KP5A 2M5WA 1M2EA 2YX4A 3IC7A 1OPCA 1FFGA 2CWEA 2PUDA 1LB2A 2K4JA 4MS4A 1QPMA 5J8CA 2V1XA 4RK7A 3ISPA 3QP6A 5E17F 4BQAA 5L3CA 3LA3A 4MLDA 2PFBA 1EAYA 1AB5A 1XCVA 1IAWA 1EWKA 2ID7A 3WTWC 5ABPA 3W6KB 2MSKA 2E1NA 4LMYA 4KA4A 3TX6A 1Y1LA 1MGTA 3MM4A 3NHMA 3Q15C 4TMYA 3DV8A 4ZYEA 1BDIA 3BJOA 4KIBA 5CLSA 2R25B 2VBWA 4ZMRA 4MEXF 4XLNF 3FWEA 4LK1F 1J59A 1JBEA 2JZYA 5D4RA 1C0EA 1QO0A 3QX8A 4WWCA 5TQ0B 1D2AA 1H0MA 4MS4B 4P9FA 4I09A 1Y0UA 4UHTA 1B6AA 4F8JA 1ZITA 3DP7A 2CHFA 2EK5A 2WTEA 1EHCA 3IPCA 1FT9A 2NNNA 5DYMA 3WE3A 1ABFA 1BJAA 3IKVA 4YFKF 1JFVA 3QRFF 2MYUA 2HQBA 5KQGA 4GYIA 3C3KA 2EA4A 4RDCA 4MRMA 1J7KA 1R7JA 4PZJA 1G3WA 1GCAA 4ZPJA 2M98A 2GX6A 4HDUA 1SXHA 2QU7A 1ONVA 1JYEA 4EJWA 3KP2A 4A5MA 5EWMA 4H0EA 1OXKB 5T7BA 3QPHA 4QYMA 3J81K 3R4KA 5LEKA 3A0RB 3N53A 5K5QA 1TW3A 1DRJA 2OBPA 3FMQA 1ZYRF 3EJWA 1R23A 1FSHA 2DK5A 1IN8A 2M8EA 2F2EA 3LUGA 5J6XA 1FBQA 1JX6A 2P7CB 2E4WA 3O1JC 4EYKA 5LBQA 1OXBB 2EV0A 2FLKA 4JB2A 4RK0A 3EQ2A 5CNJA 1KQ8A 3KCCA 3VODA 4U7BA 3WTUC 1LDKB 4G8XA 4I01A 5HLGA 3KP3A 2QBYA 2DI3A 5LGUA 4RB3C 1XSVA 1AWCA 5HLIA 2XVCA 4EM2A 2E7XA 1IN4A 2RVCA 2XRNA 5TRDA 1OKRA 5EEGA 2VE9A 3WODF 3C97A 3D8UA 3MAJA 3ZPLA 4RV5A 3I53A 3TOBA 5HDKA 1XGSA 3VB2A 1LJUA 3N75A 4DQDA 4A5NA 2PUFA 1RUNA 2GIVA 2H6BA 2E4XA 2PUAA 2MH2A 2PUGA 2LBPA 3ROUA 3TOAA 3WE2A 2FMYA 5CVRA 5IUJC 2FNPA 1DG9A 1H9TA 2F5EA 2QV0A 4OOIA 4YLEA 3H5TA 4L0YB 1REPC 3GW2A 1B1BA 3DF8A 1Z1DA 1FLIA 3T1BA 3DLHA 1IRGA 1XDSA 3T5XA 2RGVA 1LEAA 4KT5C 3ILHA 5DEQA 3IKTA 1IW7F 3QEKA 3UKJA 3F6OA 4AIKA 3K0LA 1J56A 1JHHA 4L9TA 1XHFA 2XV4S 2CW0F 3HRUA 3IP7A 2F8SA 1Q1HA 5HS9A 4ZYGA 2RC4A 3O75A 1YTYA 3LA7A 2CGPA 4JK1X 5CNMA 5J8FA 2GWRA 4PCQA 4F3TA 4MQEA 3P7NA 4D6XA 3OO1A 2AS5F 4N76A 4ESBA 2HZTA 3HSFA 1D3YA 1USGA 3EODA 4MTDA 4HX4A 1NATA 4JP1A 3W6JB 3I64A 1GVJA 3K9CA 1Z17A 4MS1B 2UZKA 5HKOA 2VOPA 4EGSA 3J80Z 1EWVA 1UB9A 1SD4A 4R1HA 3HSEA 3MZYA 3O74A 1GUBA 4UV9A 1MB0A 1BDJA 4NICA 1B59A 2BEOA 1FZPB 3GUDA 5JR3A 1BIBA 2PBIA 4D0PA 2IVMA 2IPMA 3HM9A 3ZN0A 3HSRA 3O1IC 3LTEA 2KIMA 1YTUA 5LEJA 4LLNA 3LSTA 1ISSA 1IXSB 4MQFA 2DQRA 4YFNF 3KYJB 3F22A 4RXTA 1RZRA 3BRSA 1APBA 2JK1A 1DCFA 4GGGA 5JI6A 3V8LA 4RS3A 3F8NA 4G9YA 2IW5A 4MLCA 4WZZA 1DBPA 3L6UA 1W7PD 1NXXA 5PNTA 5IT9Z 5ERIA 1YMVA 2JRLA 1W7PA 1ZN2A 4IF4A 3IP9A 2R3SA 3CTAA 3H5IA 1LNWA 2FMKA 2JVIA 1S29A 1R5HA 2V9VA 4U0YA 1K6OA 2V6CA 3MA0A 1V3FA 2QQ9A 4FE7A 1GCGA 1A0OA 2HJ9A 3GYHX 2EJRA 3CUQB 3E6MA 4L0ZB 1E6LA 9ABPA 4G7HF 4G6DA 3E6CC 2PL9A 3WU1B 1U3EM 2GI4A 5KC8A 3DPTA 1OYWA 1NXTA 2AYZA 3HV2A 1TVMA 1XSDA 4OIQF 4E7PA 3Q7SA 2K7LA 1MIHA 2PE5A 5JNSA 2ESNA 2DQLA 2QZJA 2MYPA 4MS3A 3V7SA 2FBKA 2JTVA 4A0XA 1FFSA 4Z4CA 1D8KA 4EUKA 2FXIA 4HNSA 4AIJA 4EJUA 3F6VA 3LUHA 4ENNA 1YW7A 2XAJA 4WWHA 5ED4A 1DCKA 1YG2A 6ABPA 2G9WA 3MYYA 4G7ZF 1ZREA 1E2BA 4JB0A 3JW4A 2YSRA 4MS3B 3B73A 4MYRA 1YW8A 2FEKA 5FD6A 1P6RA 3K9TA 3E3VA 4KDPA 2IRFG 4UHKA 1F1ZA 1D8JA 5T3YA 4S05A 2P5KA 2E1CA 1XHEA 4WCGA 2FQYA 3JY6A 4F7ZA 1HSJA 3PQKA 3WGHA 4TLLB 3NRVA 5L3FA 3J7AO 2M87A 2OENG 3V8KA 1ZRCA 4Q48A 1SMYF 2ZXJA 3NNDA 2ACJA 2HFHA 3QPTA 3ECHA 3R0JA 3QU3A 4RB1A 1G3YA 2FTKE 3DLBA 2RDPA 3LAJA 3DKWA 5ILUA 4KMFA 3M9XA 3MWMA 3SXYA 2ZJ2A 4KYWA 3NBMA 1TLHB 3OMWA 3TDUC 1MDMA 2DK8A 3L00A 1U5TA 3IDOA 3WTVC 3CS3A 2PEXA 3M8FA 3E6BA 2EB7A 2EFPA 2OQRA 3QU6A 3R6SA 5E3JA 2K27A 2HDCA 4LB5A 2ZBKA 3RKWA 1J2XA 2FNAA 5B3JC 1K7AA 3EQLF 2PMCA 2DAOA 3BOQA 2BV6A 2DO7A 2NT3A 2IT0A 1D1QA 1KGSA 2W85A 4HA8A 4LDZA 1WWXA 3FM3A 2MSLA 2A9RA 1RXEA 3BPXA 2NT4A 1QGPA 4XSZF 2IP2A 1FX7A 1QP7A 4O5AA 1GXQA 2XAFA 2E4UA 3GFJA 4D6YA 1FYKA 1FP2A 1MKMA 4XSXF 1BM9A 2EA2A 2L02A 2FF4A 2P9HA 3I4PA 1T34A 3V7RA 3WTTC 1W25A 2JRTA 1PP8F 5IUNC 3WTZA 2PJUA 3KEOA 4NB5A 1MDMB 4XFKA 2PG4A 3DFGA 3ELKA 3TO6A 2KJCA 3ZN1A 1SFXA 4XLPF 1P4AA 5F1RA 1MAVA 3H5VA 1MVOA 4AIHA 4WXMA 5ILVA 5TPWB 1XMAA 2VE8A 4ZZDA 5FFZA 4M9XA 1I1GA 1G4DA 4RKQA 4DN6A 2H94A 4EMSA 2KIUA 3HIFA 5D6FA 1UHMA 3RTRA 1DRKA 4N0QA 1FY7A 1DP7P 1ZRDA 1ZGAA 3V8JA 1I3CA 1RZ4A 2ELHA 4XLTA 1WI9A 3BJ6A 3F8FA 2W25A 1TM2A 3HDGA 3K1PA 3ULQB 2WWVD 1ZLKA 2FE3A 2QWWA 4FHTA 4G86A 4Z4HA 1VKRA 3DQVC 2XAGA 3ABUA 1R36A 2LF7A 1XGOA 3UUGA 2ETHA 3WG9A 1WRJA 4WXDA 4EM0B 3QAHA 3ZMZA 1O3TA 1T6SA 2DBBA 1UHWA 4W5QA 1I27A 2OZ6A 4CZZA 4GPAA 1H9GA 4MR7B 2PQ8A 4WX9A 3JPWA 2ZMEA 2Z33A 3TB6A 5KI6A 1FBUA 1ZARA 1B00A 3TQNA 2JSCA 2L18A 1LDDA 5BRJA 5H6RA 3MF4A 1U5TB 1ZDMA 5ICEA 3HOTA 2R48A 4PGGA 1OMIA 1U2WA 3T0YA 4M72A 1SXGA 4ZMSA 3SG0A 4P55A 5JFRA 5E1XA 3SHFA 3A10A 3ZMVA 4KZKA 3M9AA 3KYIB 1RPJA 1TLFA 2LUOA 5FGMA 4W5TA 2BGGA 3TKYA 3E97A 1WKMA 2FN9A 1ZHFA 5F64A 1Z91A 1U78A 1V4RA 1JDPA 2Z5UA 5DCMB 4KPYA 3HRTA 1O3QA 5H20A 4RZSA 1D1PA 2NYXA 3QOPA 2M30A 3FX3A 3KETA 2Q5CA 2L2QA 1BI0A 2K02A 2ZWMA 2FSWA 2IJLA 5E1WA 1MB3A 2HS5A 3GYBA 3EGCA 2CFXA 2VODA 1O7LA 3GX4X 3KKEA 2Y75A 2JVKA 2KKOA 4ETMA 4EJTA 1MJBA 4M6XA 4K2EA 3HTUA 4R8HA 3AAFA 3LUJA 1L5YA 3EDPA 5HQJA 1UFMA 3JAMZ 3GT7A 4E7OA 4XARA 3WGGA 4AD9A 1S8NA 1DZ3A 3FXQA 3H75A 2FEWB 5CYVA 4RY8A 4KQ9A 3F23A 4O1HA 1ZGJA 1UDRA 1HW1A 3HUGA 1CYEA 3HUTA 5C5EA 1DC7A 2FN8A 1OR7A 4IRXA 2JB9A 3NNSA 3NNNA 1Z13A 1J0RA 3I0TA 5FB2A 3RIRA 1QO0D 1QQBA 2RV8A 2OD5A 2O6GE 4W5NA 4OINF 3BJAA 2O0YA 4HLYA 2K4BA 3SM9A 5FO5A 1NXSA 3E3MA 4GNRA 1XGNA 4MHGA 2D1VA 5FBHA 4QLCU 5FWXA 1JWLA 4RGRA 2O03A 2FXAA 4I0BA 2XUBA 5IEBA 2OA4A 2H6CA 2MLGA 2X7XA 1PNTA 3RVSA 4IRGA 1IZ1A 1FYMA 2H09A 4O6JA 1D4ZA 5TPZD 4IHTA 5IC5A 1RNLA 4G0ZA 4LD5A 1USKA 2HSGA 4N0PA 3OQOA 1USIA 3JAMK 1SD6A 2P6TA 4KUMA 3CJNA 1HKTA 5TQ2A 3M1EA 3NEUA 3QLVA 2L3DA 2UXXA 3U2RA 5CVUA 5BQTA 3GA5A 2VUHB 3COAC 3E5QA 4EGZA 1ZESA 4IGAA 1ZLJA 4UXNA 1HW2A 4Q4ZF 4YS6A 2VYCA 2WJAA 4KV7A 4OIPF 2QQBA 4A6DA 4BAYA 1F4VA 1PEAA 2HQOA 4Y15A 4B8XA 2D2WA 3I71A 4EVSA 3CUQA 2QSJA 3HTSB 3RKXA 2EFOA 3RVNA 2VBXA 1LQ1A 2FQXA 3TGNA 1HXDA 1XCBA 2FMLA 3IRQA 4GCVA 1NTRA 3KP7A 1W7PB 1L3LA 2FBIA 2PMHA 3KP6A 3T8TA 4L5JA 1DJMA 5LRRA 2FVYA 2MSWA 1PDNC 1P92A 4G0YA 4MS1A 1FFWA 4RK5A 1STZA 3Q7TA 1TNSA 4YWHA 2GA1A 1J9IA 5KVRA 1W9HA 3HS3A 3JTEA 4MR9A 3G1WA 4HOBA 4JBAA 2QR3A 3URMA 2HGCA 4KK3A 3Q9VA 4EM1A 5F6FA 2J5PA 4EVQA 3PFIA 4W5RA 1W4MA 1Z2EA 3GZ6A 3BZ6A 4AVPA 4LJZF 1A2OA 2IA0A 4WT7A 2H0AA 1RXIA 4UVAA 4MR9B 3KP4A 1ZG5A 2ZNYA 4PDKA 1F5TA 4P5OA 2MBFA 2L01A 4O5VA 1R8JA 2EV5A 4WXCA 3C7JA 4KN4X 2EFNA 3WGIA 1EH7A 1QZYA 1FQWA 2IA2A 4B09A 4NHJA 5JNTA 4N03A 1Z16A 3GFMA 2WJWA 4A2UA 2IPNA 1HEYA 1R5GA 3OLWA 2D45A 3G73A 5FD5A 3QP5A 4CGZA 2E4VA 4M88A 4LLGF 2IA1A 4LE1A 3MEXA 3GRCA 3GXOA 2DRIA 3RI4A 1LJ9A 3CHYA 4XAQA 3M6MD 4BXUA 4F06A 4BH9A 1NXOA 1I6XA 5D5UB 4LB6B 4LG0B 4HF2A 3LMKA 5E18F 4HAMA 4NCAA 1F9NA 5IT3A 2ESHA 4H60A 1BI3A 1AB6A 5AIQA 1SD7A 1FC3A 3FXRA 1ZH5A 2D1HA 3LWFA 2NUBA 2QBYB 3HJFA 2ADUA 2F5CA 3JSOA 3F21A 1M5UA 3GZ5A 2ISYA 2QQAA 2JVJA 4XRFA 3N0WA 3H1FA 1LK0A 1TQIA 2J5OA 4LFUA 4M9SA 1QNTA 1P2FA 2GZWA 1RUOA 2FQ3A 5I4CA 1P4WA 3F7NA 5D6EA 6CHYA 3ZP5A 3UK0A 1BC8C 2BE5F 2FOKA 2HKXA 5JHUA 1BOAA 4F11A 1PUXA 4LZLA 3ZMSA 3N4MA 4UVBA 5JVTA 1B9MA 4KMUX 2NZVG 5CVJA 4HNQA 3FFTA 4WXEA 1EH6A 4RXUA 5HM6A 4I02A 2XKOA 3SFZA 3IPAA 2QM3A 4EVRA 1ZRFA 5CVVA 5FWYB 4PGHA 5EWMB 2UXNA 3N6VA 2JBAB 5DLEA 5E1ZB 3U9GA 1S7AA 1DUXC 4HF1A 1S6LA 1BI1A 2Y0MA 1G6NA 2BGCA 3CLOA 3VNAA 1U6GA 2MC3A 2RKHA 3N97A 4MQEB 4RAYA 1XDUA 2A68F 2W24A 1M2FA 3IP5A 3FFWA 4DNCA 2HKOA 3U1DA 2NAZA 2P4UA 3S2WA 4U0WA 2ID9A 1I5ZA 1OYIA 2JT1A 3TO9A 4FB4A 2PKXA 5KWSA 1USTA 4CO8A 3HSYA 4MEYF 2XKPA 1LBIA 1A04A 3Q41A 2KRFA 2M1BA 4RY9A 5FFXA 2E4YA 1TMYA 1MD0A 1ZG3A 2P5VA 4DQ2A 1ZH2A 3J81Z 3RVLA 2Z9OA 2QVGA 3H5LA 7ABPA 3R61A 4EYQA 4IMJB 1YQAA 5K5OA 3CFYA 5DCLA 3T8RA 2GBPA 2A07F 3EUHA 1VPWA 3SY8A 2LP4Y 4UNOA 5A2QZ 4GO1A 1EH8A 1FSPA 5CNIA 1LDJA 3H3ZA 3LAPA 1L0OC 4IJAA 2FKAA 3MIZA 3LFKA 2OQGA 5KC9A 3RDIA 1DBWA 1SMTA 4A0YA 2PUEA 1BC7C 1K66A 1JFSA 1SD5A 2CQKA 3FZVA 1F51E 3EAFA 4Z4IA 1Z18A 4EQQA 4G94A 3F6PA 1PUEE 4N9IA 1ISRA 4FX0A 4M9ZA 3WU0A 3TDZC 3E5XA 1JDNA 4RWEA 3DGFC 1KYWA 3JTGA 1AOYA 4ZZLA 2Z3YA 2VC0A 4QPJC 4HLXA 1MJ9A 3T38A 3HOSA 1ZHHA 3JVDA 3LUKA 5L3EA 3RH0A 2Q8KA 5HLHA 1KU3A 3HXMA 3K1MA 3QLVC 3ZMDA 5FLXZ 3K1NA 3MZHA 3CUOA 4U0VA 4PEVA 4L9NA 3GF2A 4LK0F 1O57A 2G7UA 4WK8F 1CF7B 4PICA 3HO1A 5FWYA 2IYNA 4QWQA 3OO0A 2CG4A 1B9NA 3SAJA 1E17A 4EV0A 4OMYA 2FEPA 3RYRA 3VFZA 1YMUA 5HS8A 1HQCA 5D8KB 3A3KA 2EFWA 4TN5A 3DXJF 3FM5A 5BRAA 3HHGA 3IWFA 1BI2A 1BAPA 2W57A 1T0FA 4Y13A 2FRHA 1SFUA 1CGPA 5IT9K 3HYIA 1FPQA 4I0AA 4G6QA 4LLLA 4TLMB 5AONA 4RGSA 3ILYA 3H3UA 3T95A 1ON2A 4OG2A 2LPMA 3GFIA 1BIAA 2A9PA 1C0WA 4LE2A 1TTYA 2GA2A 3P9CA 3GL9A 3FFXA 5L3GA 4G0MA 2JBAA 2A9OA 4JASB 2CHEA 1IXCA 2MD5A 3JVIA 2OAZA 3BROA 2G7HA 1T2KA 3BY6A 4ZJPA 5KQMA 1O3SA 2ZMEB 3QX9A 3FMRA 2HQRA 2QUFA 5BMZA 5LGTA 3OQNA 2PAFA 4MR7A 5E8GA 1QNLA 1R1TA 4I7HA 3V4GA 3CZ5A 3BP8A 1UCRA 1KA8A 3HRSA 3VNBA 1IRFA 1DPRA 4M71A 3O2QB 1FOKA 1NHAA 1TW2A 4HV5A 5BS6A 2FSPA 2B4AA 4RXMA 3N0XA 4L9VA 2HTJA 1QP4A 5CHYA 3GV0A 3QEMB 2QYOA 1KU2A 1Z25A 3BBLA 4KIGA 3ROFA 2IPAB 1K78A 5GQSA 3ERED 1P6QA 5KK1A 5TQJA 4N0BA 4OMZA 3R60A 4CHUA 4KIFA 3M8EA 2HWVA 5TQ2B 3EYIA 5BQ3A 5HDNA 2I6FA 4RY0A 3W9SA 1ZAYA 1DC8A 4DADA 3P9KA 1YLFA 4Z9AA 1KMIY 1PHRA 4LG0A 1DBQA 3SNKA 4XXHA 4O3MA 1IN7A 4BHPA 3CNBA 3IRRA 1E6MA 1XWWA 1IIBA 3OLZA 1DP4A 1LVAA 5IBQA 2R7DA 1TBXA 1JL3A 4W5OA 4H3KB 3OM1A 1JXSA 1IF1A 5CVIA 4P9UA 1QZZA 1IUYA 3O3KA 1C4WA 4ETIA 3G3ZA 2GQQA 4KREA 4YIFA 2IPQX 2YU3A 4R79A 2O20A 1ZAOA 1E2XA 3F6CA 3F72A 4Z9BA 4MQ9F 5GOTA 1YYVA 5TJJA 2M1ZA 3CG4A 4OU0A 1Z6TA 2GXGA 1ODDA 4D74A 3TD9A 3D0SA 3DBIA 1EFAA 2W42A 2L19A 3TO5A 3E5UA 1HKSA 1YK1A 1EV7A 2KJBA 2P5LC 4UVCA 4M6YA 1PEYA 3HVRA 4IHSA 5FBKA 4ETSA 4N9HA 4JAVC 1ZY2A 4MGRA 3Q5FA 3RQIA 2RGYA 2LNBA 2X4HA 1U04A 4HX7A 5ILSA 2HYGD 4IPAA 1SXIA 5IUKC 3JTHA 3I42A 5LRSA 2P6SA 2F5FA 2V79A 1GXPA 2H27A 3BRQA 2PL1A 2DT5A 2YPRA 3CDHA 5D4SA 2NS0A 4LGWA 3ZMUA 2AXLA 1P8AA 4ASNA 2VC1A 1FYLA 3ML6A 5C5CA 2A9QA 3HCWA 3TMYA 3OMXA 4YR7A 4U88A 2A69F 1QMPA 2WMYA 3C3MA 3EYYA 5DCMA 4EJVA 2DTRA 3G85A 1U8TA 5DGCA 5DKFA 4EGYA 3CTPA 1Z7UA 3C3WA 4KQCA 3O2PE 2XHKA 4EYGA 1USSA 2CSOA 1ULYA 2PLNA 4HQMA 4Q5SF 4MR8B 2V1DA 1P6UA 4ZYDA 1H9CA 2EV6A 5D8LB 1DCMA 4L5IA 1PNRA 1IN6A 3K69A 3FGZA 5DTEA 4OIOF 3KSMA 1YVUA 1S3JA 4NQWA 3ABTA 3I54A 2QENA 2YR2A 2HTSA 5EWLA 2PJPA 4OATA 3CO7C 2RNJA 2COMA 1ZVVA 4RSMA 4YV7A 4MQVA 4U7DA 2B0LA 2WC2A 3PQJA 5DD8A 4PZ0A 1O7FA 3LKBA 2QW1A 1BDHA 1NXPA 2C6YA 3RJPA 5LLQA 3NQOA 1IN5A 3OLYA 4GXOA 2VT3A 2P7VB 1Z05A 4G97A 4P1ZA 4NQRA 4WF2A 4HX8A 4EVIA 2JCGA 3BWGA 5DCFA 3B2NA 1BBYA 3D02A 2NNYA 1F4KA 3FHZA 3TO7A 5EEHA 5JS2A 2LIVA 1YO5C 3EULA 1K68A 2R4QA 5DDGA 1MZBA 1R00A 3RVQA 1R1VA 3BREA 2O61A 2RJOA 2HOEA 5CNKA 1QPZA 1VRVA 2O8XA 3LOPA 4IMIB 2O3FA 3F8BA 3I5UA 3KLNA 2PN6A 4A6EA 4ON0A 2PUBA 5TPWA 2E4ZA 1U2QA 4WXHA 5ICCA 2IKSA 2R7FA 3P9YA 4EJOA 2IDMA 3OLXA 2V1UA 3S99A 2FQWA 3KHTA 3FF5A 2XAQA 3GVAA 2HPHA 4IXAA 2F5DA 4Z2YA 2JPCA 4XASA 3CUQC 2QXYA 3SQNA 4KVFA 4CICA 1YS7A 4TV7A 2FBHA 1J5YA 3GFLA 3QEMA 3RPUA 5DV5A 3SZPA 5JS1A 4ML3A 4YP9A 4MQFB 1Z26A 3N8IA 5H6QA 4OLAA 3CLKA 2WWYA 1YIOA 4O1IA 2QVCA 3F3XA 3J80K 5FWXB 2ZNZA 1M5TA 5LHHA 1NY5A 2J48A 3P9IA 2STWA 3B02A 2YX7A 5KQLA 4HW0A 4QICA 4NCBA 2VBZA 2A6HF 1RIOH 5JNRA 3KFWX 4G0PA 1GUDA 1Z15A 4CXFA 4UHJA 3MQ4A 5TPZA 2DPDA 4CDGA 3MQ0A 5BR1A 2LSOA 2Z99A 2DPUA 4JQFA 3FDFA 4QYWA 1TNTA 5ICFA 2VK2A 4H3HB 1TQMA 2L54A 3LKVA 4YRZA 5IULC 1TQPA 2VXZA 3KZYA 3VOEA 1JHZA 3E61A 4G0OA 3M9WA 3MCZA 1HW5A 4RGUA 5JNWA 3OLVA 1FSEA 3O6BB 5EWJA 3LQRA 1FWZA 3LQQA 4RAZA 2PMUA 1WSUA 5D5WB 4CBVA 3DEUA 3VEPA 2FLWA 2L4MA 2XDYA 3ECOA 3QELB 1URPA 4HZFA 1SRRA 5DUIA 2PUCA 5IEJA 2DFIA 4PE5B 3L7WA 1SFEA 5DD4A 4BNCA 1XD7A 3L49A 3F8CA 1WETA 1U8RA 3L9FA 2WB4A 3RVMA 2ISZA 2P4WA 1HKQA 4KMRA 2STTA 3OQMA 3M7GA 2CWDA 4N47A 2XIGA 4RU1A 2L17A 4ESFA 3GBPA 4HQEA 2EFQA 2VN2A 3O1HB 4Z4FA 3DPLC 3I45A 4YO7A 2WRZA 4YIIA 3IWZA 2CO5A 3I58A 4WUTA 3JSPA 5K1YA 3L09A 1T39A 2MYTA 2M45A 2L4AA 2FMHA 4I2OA 3GLXA 1R22A 3KCNA 3KJXA 4MTEA 1U0SY 3EETA 4OTZA 2VONA 2BBYA 3LA2A 5LHGA 4Y9TA 4G7OF 2LKPA 3JS5A 4RS8A 1JH9A 4MR8A 3BILA 3I59A 1CEYA 5IX8A 4XBFA 3WTSC 4Q6BA 3GWZA 1JHFA 1KU7A 5DUKA 4EYOA 2MLKA 2K86A 3CU5A 4FT8A 2NRAC 2GKGA 2XROA 3F8MA 1ZG1A 8ABPA 1KQ0A 3RVRA 4ZYLA 2VT2A 4P98A 2FA5A 4NV3A 3HUUA 1HBXG 2FW0A 1PP7U 3HRMA 2QVOA 2ZAYA 4L18B 4JOQA 3KEQA 4Z4GA 4KFCA 1E6KA 2FU4A 3NHZA 4N41A 2XAHA 1BN5A 3QELA 4AWXB 1Z2DA 4KN7X 1XMKA 2WV0A 3T8YA 3SZTA 1ON1A 1Z6RA 3QK7A 2AYXA 5EWJB 1ZH4A 4LX8A 4YCSA 2F8TA 4ZYHA 2OZUA 3LFTA 4ESJA 1D5WA 4A0ZA 1BA2A 2ZO4A 5LGNA 1X3UA 2B1JA 3EDCA 1S7OA 3BPVA 1YK0A 1JFTA 5LHIA 5EWLB 2P8TA 3EQZA 1FBSA 1VTNC 5D2CA 4BHBA 1BVHA 3RVOA 4ENMA 1T38A 2GXBA 1RZRD 3O21A 4HYEA 4BHCA 2FEZA 4OBBA 4RK4A 3KE2A 1QQIA 3D5LA 3RVKA 4FX4A 3IHUA 3LUAA 4YGXB 2RQPA 1FP1D 2RJNA 4MGEA 3IP6A 5D5VB 3ROTA 1JF8A 4M74A 5E8IA 4Q47A 1W5TA 4YG2F 2A3SA 4Q6WA 5A2QK 5BOXA 3HK2A 5AIPA 4Q7EA 4F12A 3C6QA 2X0LA 5ICGA 4PYRA 1QKKA 3LUDA 2RDMA 5FLXK 3RVJA 2E7WA 3CG0A 2V0NA 1U2PA 2FMFA 4Z0NA 2KIFA 3H5WA 2A6EF 3ZMTA 5BPDA 5HS7A 2YHBA 2IPLA 1HSTA 4YFXF 1QQAA 3C1DA 4M73A 1CHNA 1L5ZA 1ABEA 5JNUA 3CO6C 3HDVA 3H6HA 2MH9A 2OU2A 1LEBA 4G0XA 3V7CA 1EWTA 4UUVA 4UV8A 4G0QA 2N9UA 4RB0A 4HF0A 3QLTA 4HDVA 1KU9A 4ENKA 1DPUA 1T98A 4RKRA 4Y17A 1JYFA 3GEZA 3HZHA 1GHCA 4Z4EA 4EY3A 1W5SA 1ZGGA 2HYFA 1R58A 5K5RA 2KYRA 4IVNA 4MPTA 3OV8A 2FMIA 2ZKZA 2LDUA 1J75A 1TJYA 1Z12A 2Q0OA 2GAUA 4OIRF 2XGXA 3FMVA 4BYYA 4IILA 2BYVE 3K4HA 4P96A 3RKYA 4LE0A 3HEBA 1Z9CA 4ZH4F 3WTYC 3R0AA 1YS6A 4LRQA 4RK6A 1U5TC 4HBLA 4KK4A 3KZZA 4L4UA 1OYYA 3KLOA 3BDDA 3C18A 3IL2A 4ENJA 2R47A 5B3JA 1FNNA 3MFKA 1ZGZA 1WQ2A 4E70A 2JPBA 3FXUA 3T6KA 4L9JA 5JNVA 1KRXA 4JA2A 2QZ8A 3RVPA 1RI7A 1JLKA 3A0UA 4OLBA 5HOOA 3CRNA 3GWGA 2CD7A 3KTOA 4GYGA 3Q7RA 1YW9A 1XGMA 2W84A 2CYYA 3F73A 2YHAA 4ETNA 3WTXC 4Z99A 2ZFWA 2TMYA 3OM0A 5CJ9A 2A5YB
chains in the Genus database with same CATH superfamily
4ZXPA 1Z5GA 4KRXA 3LXUX 1QC5B 1ZGWA 4GP6A 2ZCWA 2VYFA 2GXSA 4N0MA 4XIJA 5AQ1A 3DP9A 3K2ZA 3KS9A 5I51A 1DOZA 3ENWA 3FPGA 4XX0A 3V4VB 1KU0A 4R7TA 5LWQA 3BF7A 3RPQA 4M53A 4RUKA 3RODA 1NW7A 2PO5A 3AKZA 4GPZA 3AJAA 4WKBA 4MRMB 3NM5A 4ZI7F 1KWKA 2O8FA 1CVLA 2Q3MA 1P4XA 2BBSA 2WU1A 4IOKA 2IVZA 1ODSA 2IGBA 3L1JA 1LRKA 3TQRA 4UZFA 1HTWA 4WOCA 1KYQA 1NBOA 1DT5A 2BVLA 4KMSA 4PLTA 4EUSA 1W34A 2KJQA 4O25A 1W5EA 3H92A 4RMJA 2E19A 3L1IA 1R1UA 4DYCA 1DOHA 1GN9A 3WL7A 4ZYWA 1KH1A 3IVMA 5ALNA 1K92A 3E5NA 3FOCA 2NZUG 3Q88A 1G38A 1NYTA 4EJSC 4L85A 4IRHA 4F38A 3DZDA 1N5OX 1I5RA 2Y0SN 1Q22A 4REMA 3QOWA 1GLGA 3MWLA 3IT2A 3N3AC 4DYRA 1GTL1 2BEUA 4FQ5A 5EVCA 3RVDA 3IDFA 4KMMA 3ST7A 4HZUB 9GPBA 4K2AA 3ND6A 5KSOA 3JATB 4KNYA 1TU3A 3HZJA 2C1EA 3AGPA 2OGTA 3T7EA 5L3BA 2X86A 2VSXA 2ZKIA 1Y1QA 3AJEA 1QP0A 3KT8A 3KOZA 1ZNQO 2HQNA 1NXVA 2R79A 4KVZA 2VUIB 4YH1A 3A6ZA 4KAAA 1N6OA 2HCJB 2VPXA 4PGAA 1Y8ZA 4L8YA 3ADBA 1WW3A 3DEEA 1YRNB 5FUQA 2FYTA 3A1DA 3ZQ7A 3E58A 4UOQA 1BJZA 1POGA 2B0JA 5JMWA 5JZ9A 4LDNA 5EYRA 1P1KA 4PLGA 4WNCA 1SIUA 1KQ9A 5FOWA 3RSFA 1N33B 3Q87B 3Q8XB 3RV4A 1JGSA 1IXRC 4TTSA 3G2HA 4JZYA 1CERA 2W2NA 4BPRA 1VKOA 1A7JA 5EXEA 2HGSA 1UBOS 5HJEA 4D26A 1X3LA 2PI0A 1WHTA 4O8CA 4OSPA 4P35A 2IELA 4AN4A 4BNDB 4QA9A 2FWJA 4IIYA 2O19A 2JLAA 2KLHA 5HPYB 5K9ZA 4KHZA 5KOJB 5CIQA 2ZRBA 3QUSA 1FIPA 5JI2E 3KTAB 4CI9A 4XCXA 1JEYB 2PD3A 3DBRA 2OHGA 2A9JA 3U56A 3OHMA 1VQ5I 2EYQA 2NX2A 1O03A 1NLFA 3PLAE 3SZMA 1WXWA 5E20A 1Z5PA 1EA3A 1W47A 1J4AA 4RGXA 3ICVA 4H3VA 5D5HA 3ZTWA 4DRYA 3HZRA 2IHUA 2XVMA 3CLUD 3ZU5A 1JFSA 3GG9A 2A61A 3A2KA 5A03A 4F1KA 2H17A 2PCJA 3LXMA 1CUVA 1L4GA 3AEUB 4GOXA 4QLOA 4JMPA 4UTZA 1XN7A 5AWFC 3U4DA 3ZPXA 3FTPA 6PAXA 3D6VA 2HI0A 3OQIB 3EQ6A 1NOKA 5J4LA 1DBVO 4RPIA 4CMIA 3WYAA 1DDNA 2E5NA 1U7UA 2YNMD 2R5YB 4D45A 1ZCAA 1U11A 1K8ZB 2JI8A 5FUMA 4HHEA 2VT7A 1P2SA 4BP8A 1O6CA 2W0SA 3BTUA 4WLFA 2AKAB 3PWZA 5LZ5A 3OQIA 1E79D 4U02A 2HOSA 1OHHD 1BJKA 3IB6A 4ZEXA 4EFKA 4OK6A 1H9CA 3P52A 3IAS2 1U5AA 4GMHA 3KSAC 4GUDA 2VHJA 4QPPA 4RJLA 1Y3BE 1NUUA 5KDLA 1JMKC 1M2EA 1R15A 4B87A 3V7NA 2ZBUA 2VXYA 3T1YB 3FXKA 3FX2A 3U4GA 4QUHA 3T52A 3OJWA 1U0BB 3SOPA 2PUDA 2C95A 1D1CA 2CLOB 1B6GA 3OD5A 1UJ2A 4HJRA 2AH5A 2HBRA 2J3DA 5DW3A 5FLKA 3DAOA 2F90A 5IJXA 2C7QA 4FMPA 4BO5A 1XA3A 4RK7A 2PJRA 3BMNA 3ISPA 1P19A 5IAGA 2VF5X 1VE5A 3QP6A 3ELDA 5E17F 1KI8A 2AYYA 3CUKA 1LDYA 4OEHA 3WLIA 4V0MA 2NUTA 4LF8B 5AKLA 1EAYA 1AB5A 3QPAA 2ZE5A 2AD5A 4LIPD 1N25A 1IAWA 3HDJA 4V2GA 2Q3FA 2ZDHA 1BXRB 1T0UA 2B92A 3B1FA 5J1TB 3SJAA 3VR0A 3WTWC 3PQ5A 1WA5A 1RKVA 2VAWA 1ND5A 1FA9A 2MSKA 3JCZA 4KA4A 4OUDA 4AG6A 4EABA 3VA7A 4IHAA 2KDOA 3PSAA 4OA8A 5E4YA 2D8MA 3D0QA 5L4NA 4CLOA 1MGTA 1NJGA 2KBFA 3Q15C 3REGA 3TQSA 3CVUA 2B5OA 3TXAA 5B3LA 3MMZA 3PNYA 1A9QA 1G5FA 3O8DA 5CPRB 1Q0UA 3M5DA 4NU6A 3THSA 2AG6A 2JJQA 2R25B 2UUAB 3Q7PA 1KH2A 1KFJB 1Z56C 1KVUA 2C2GA 3U1BA 3AY6A 4XLNF 1F5NA 1KBQA 1KMQA 4LK1F 4NYIQ 3W2FA 4HSGA 3HFSA 4LC1A 1GGMA 4R1LA 1CR2A 4EX7A 4HMOA 4BLOA 4HGNA 1G8FA 3PPWA 4LN1A 2JZYA 1KEVA 4CMAA 2V4MA 5EE1A 1QGUB 2WD9A 1J06A 4O63O 1EP2B 2OAGA 4BXOB 1RI1A 2COBA 4KQ6A 3GXBA 3ME5A 4YA6A 5EZ5A 1YCGA 1H89C 3S4YA 3K0KA 3FI9A 4MS4B 3AM3A 1DX6A 2WTNA 4KLCA 1FB5A 1T29A 4MVJF 4BIIA 1IUOA 1QUFA 2Q5HA 2ZJAA 1JEYA 1TPYA 9MHTA 4MUYA 4RLSA 2VYVA 3X1DA 4MTLA 2DBYA 4YFVA 1JG3A 4F2HA 4NBWA 1HOXA 1EHCA 1ZD3A 3HXLA 2GN4A 1FT9A 4F2PA 5JIBA 1KETA 4P36A 3GLLA 5ED0A 5FTKA 2OVBA 4YTEA 4MKXA 2B6NA 3BR3A 3WE3A 1MAAA 2R7NA 2EW8A 4D8YA 3HOUJ 2V45A 1UBFA 1GRNA 5CA0F 3H35A 4EA7A 4JYZA 1IXKA 3LSJA 1OHHA 1TYEB 1YFKA 1S0UA 3E4DA 3MEQA 4MJXA 1J7KA 1OLUA 4LJ9A 5EJIA 3ZBTA 3ZLVA 2OXFA 3LVRE 3DT9A 1EB8A 4P0PB 1Y4AE 3WA6A 2BMVA 3H8WA 1XTBA 2VPWA 4MVJI 4BLRA 5EESA 3WKCA 2ZE7A 2BEWB 1R0CA 1VJRA 2CFTA 2OBFA 3FISA 3EASA 5AKZA 1WXHA 4C20A 4D4LA 1C30A 3UMJA 5D3KA 1RM3A 2XNDD 5JRZA 4GKKB 4KGZA 4URYR 2CNBA 4W1RA 4DGWB 1SFKA 1DEXA 1NRWA 2IEAA 3L8MA 3DR5A 4ZREA 4QPDA 5EWMA 1FUKA 4FYKA 1G21A 4G85A 5JPDA 2CL0X 1EX6A 5DP2A 3FBWA 2ZB3A 3U9TA 2XRFA 3QPLA 1QGYA 3IIIA 1F2UA 1O6GA 4D8WA 4P93A 1GRCA 1A5JA 2V3WA 3HU3A 3MGCA 1G59A 3Q3GE 3SBOA 3A3YA 1G20A 5LEKA 4Q7MB 2XGMA 3N53A 4MZXA 3QYBA 3WHIA 5KOJA 4FCWA 2V9KA 3AXTA 1TQDA 3RJ5A 2OBPA 3FMQA 3OQHA 4TOIA 2ZBQA 1CKEA 1HLVA 1Z2NX 3HKEA 4CKEA 5K99A 1CZNA 4R98A 3N05A 5ELXA 4GPBA 1J07A 1R23A 1NWCA 4WK6A 2WABA 1FRZA 3EXG2 5TF4A 1C8KA 4G6ZA 3ZYZA 5IJ9B 1L7BA 2YZGA 4ZI3A 1Y6IA 1G21E 2RNGA 3JYQA 3ZHYA 1X70A 1RLUA 1Z67A 2F2EA 2X23A 3IERA 1Z37A 3LDFA 3MLBA 4P54A 2R5ZA 5J6XA 1JX6A 1XRQA 4WOJA 2VLAA 1T24A 1BA3A 1EUDB 1WV1A 4DYVA 1YA8A 4D9JA 3PNVA 3K9QO 3O1JC 2BKAA 1VGRA 4DSAA 2EV0A 4XA8A 3PWKA 4DMHA 2FZWA 2PIDA 3TL3A 3C2HA 1KZ7B 3HBJA 4LOJA 4JB2A 5K3AA 3IKMB 1HE3A 4AVYA 2AG5A 3G9XA 2OG1A 4Q66C 2L82A 1TTTA 1E1QA 4AF7A 2O05A 2IYEA 3CUWA 3KCCA 1G9SA 2C4HA 1Y80A 3UV7A 3WO1A 3IHKA 2IYLD 3LF2A 4MVWA 4OLHA 4Q4LA 4DCSA 4I01A 4BATA 3IOEA 1DPFA 4LF6B 1XMOB 2QBYA 2A88A 3D5QA 1XSVA 3R9XA 3I9V2 2VOEA 1R4MB 2ASEA 2H2DA 2ZYTX 4J7XA 4LNUA 2VJOA 3WFIA 5HLIA 2XGOA 5CB6A 2XVCA 3U21A 4EM2A 1P3JA 2NUAA 2E7XA 3KEYA 3INTA 1A77A 4NZ9A 4Q1DA 4UTXA 3IQHX 3RUFA 3WMXA 4YMTA 5F33A 2KIQA 3UB2A 1EBBA 4LXYA 1IAQA 3X1YA 3FG9A 2W8BA 2IZOA 4FISA 3I53A 2CJPA 3BG3A 2VNSA 3BH0A 2OVFA 3HA5A 5TVGA 5C5DA 4BV8A 4B6OA 3VYTB 1YQ9A 4RIIA 4UXIA 5EIEA 1X7WB 2WIKA 4NK4A 2DULA 2H6BA 2XAAA 4OXIA 4YJ2F 5J43A 3WGMA 4PNZA 1T43A 1ACMA 5FO0A 1DQZA 1RJEA 2I6SA 2DUJA 1VNDA 2YXNA 2F64A 2BMFA 3GJYA 3IAXA 4C5CA 2LKXA 1O9BA 2O2CA 3ZU6A 1A5BB 3PPXA 2F5EA 4RA9B 2QV0A 4Y9RA 1TMOA 2BMDA 5SZKB 3JWEA 3VNVA 2PQ6A 1LSJA 1REPC 3OYNA 3GEEA 1A71A 2M4GA 1DQSA 2WW8A 3L46A 1YRYE 2Q41A 5LBUA 3U80A 3VKHA 2XF7A 5DB4A 3BJZA 3BRWA 4DLTA 3HDHA 3L07A 3P96A 3O8QB 2PZ8A 2VSFA 3E9ZA 3PHGA 3ZE6A 1OI2A 3Q2KA 4FPXA 3T5XA 1I3MA 1IN1A 5M5WJ 5IOZA 1X9HA 1IG7A 3C6KA 2Y1EA 3RRNA 3G82C 5DEQA 3GLIB 1T9AA 4QUEA 2BTEA 1SXJA 5J47A 1AS2A 1RPNA 1VMAA 1Z06A 2CNDA 3NHFA 3QEKA 4UU0A 1ODIA 3B5EA 3UKJA 2TS1A 5JANA 4RANA 1ISHA 2W7TA 3A1SA 3K0LA 2ZJPF 1Q44A 2ATVA 4QEDA 5AI4A 1XHFA 3FB1A 4HUJA 2H59A 3IP7A 3KIOA 1Z7WA 4B3HA 4Q4CA 1P80A 3QPDA 4IXTA 1D5CA 5HS9A 1KI2A 4H6XA 4Q19A 3L0BA 1KAOA 3O75A 4LRYA 4N82A 1DGRM 1Y1WJ 1WEKA 2Z58A 2COEA 4MZDA 4HPQA 5EOVA 1YZKA 4CIAA 3O92A 4JK1X 3A37A 5AXDA 1C7FA 5JJKA 5DO9A 5J8FA 4PCQA 1AQYA 3KQWA 3QVKA 3LT0A 4MQEA 3P7NA 2CF5A 1KSFX 4NK5A 1C80A 3RR2A 3F46A 1EEXB 3R20A 3N0TA 4FS8A 5P8WA 1MO6A 4EG0A 1TAUA 1JU3A 3A4CA 5LB4A 2OFPA 2QEQA 1WP9A 2Y68A 3F6RA 1RWMA 4D25A 2OAEA 3QNMA 3EODA 1MW8X 2PKYX 1KBOA 1A9XB 1GVJA 2ZIXA 4UTOA 3BD7A 3K9CA 1IV8A 4YRQA 3KJHA 3AZOA 5A9SB 3UV6A 3VHLB 2YMLA 1GNTA 2QQ8A 2H1FA 3JQGB 2UXDB 2JEOA 3GQBA 2J9FB 3L7NA 2EP7A 1CJCA 4HI0E 3H0CA 3HB7A 1Y1SA 4WKOA 1XROA 1SVMA 1NMEA 2FVXA 2V7QA 4US1R 1UB9A 4C05A 4RBOA 2GLUA 2JI4A 4Q4AA 3BICA 4K6HA 4X95A 5ALKA 3EMVA 2ZJ8A 4GRAA 4QFMA 1FUUA 2EZIA 4U8HA 1MO5A 2JCBA 2WJ6A 3OT1A 4BNDA 3SWWA 1MB0A 2ZAGA 3MINA 5AKJA 4D9MA 3CF5F 3GAZA 2BEOA 2FFQA 3MAAC 4LXXA 2B6HA 5JR3A 1SUEA 2HHLA 2EEZA 2EJWA 1YS4A 2L9VA 3H1AA 6REQA 2ZBDA 3ZY6A 3DKVA 5E3HA 2IVMA 1Z88A 4RPHA 2DERA 4C1NA 3HM9A 5F9HA 1RC0A 5TB5A 1A7KA 1K97A 1PGJA 1IUPA 4C3ZA 2NXCA 2VP3A 1XQWA 5HMMA 5DLYA 2KZGA 1QV7A 3IURA 3LSTA 3JX9A 3PFWO 4LJAA 3NR2A 1IXSB 2GEUA 1G42A 4W7IA 5AJWA 4B6PA 2BRUA 2KHZA 4YFNF 3KYJB 3F22A 1RM4A 4ECEA 4AO8A 2PX5A 1D0IA 3UY4A 3FHCB 1RVV1 4DOZA 3VR2D 1MRZA 3RFXA 1AKUA 5JPIA 3RFUA 3ZEAA 4OHVA 2ZMEC 1ADYA 1EZZA 1GZSA 1XYYA 4BN0A 4J0DA 3L6UA 3KBBA 4KQMA 2V26A 1L4FA 1NXXA 4FHDA 4J0QA 4O3FA 1UK7A 4RZ3A 3QKWA 2OP1A 3WKEA 1FJHA 3TEDA 3SSAA 4MCAA 4K9LA 2PGIA 3M82A 3TNDA 3PUIA 3U26A 4AMZA 4XJVA 2JRLA 2BGTA 2CNNA 2I4LA 2QN8A 3DU5A 3BTIA 2HCFA 1A7UA 1EGMB 1W7PA 2PDAA 1DKOA 2I29A 1MRNA 2XUIA 3GDGA 1CR0A 1GZ7A 3AVOA 3MXTA 4MV1A 3CB2A 4EZBA 1LNWA 1VE6A 1MQ8B 3L2VA 2JVIA 3K35A 3P4YA 1LKXA 1S1MA 1R5HA 4QFCA 5AXAA 4PHGA 1CEEA 4U0YA 1K6OA 3UT6A 1XPJA 2VLBA 1OZGA 2NYUA 4Q93A 4E32A 1BCRA 4U6QA 3TVDA 1KYIA 4I46A 4OKIA 4PYNA 1PNOA 3O4HA 3IBSA 4HTFB 2HJ9A 1GRVA 1IXZA 4GOKA 5GM2A 1U9YA 4PYKA 4MMXB 5CFMA 1WF6A 2BM1A 3E6MA 3DOOA 4B5LA 5C1OA 3OM8A 1U1IA 2OZVA 2QRGA 4Y2JA 5FAXA 2G28A 4A92A 1G16A 4PLVA 3WGUA 5L7YA 4RZIA 1G8PA 5G0WA 3CP8A 2I6GA 4I0WB 1PR1A 1Q16A 1XU9A 3WU1B 3BK1A 1BWQA 3ZCUA 1U2ZA 2G1UA 1K6IA 2RHTA 2FSHA 3LE8A 3PXXA 4OHCA 1OLUB 2CXHA 4HX9A 4FFLA 1N4AA 3H9GA 1N2GA 1Z5UA 3RWMB 2GI4A 3FI0A 1V55H 5T41A 5LSAA 3RU2A 1DIRA 1OYWA 1X1DA 3A14A 3R4VA 1ZJYA 1LWNA 2ELKA 2PRZA 2O8BB 3OD1A 5L53A 3SDGA 1XC7A 2WG2A 1WMEA 4OIQF 3TFOA 2OSVA 2DBQA 3J7TA 1ZIXA 3TOSA 4DIKA 2CXPA 4DR3B 3I3OA 2OO3A 2K7LA 2C0CA 1MIHA 4RD1A 4QUBA 1TQ4A 3N5CA 2WJHA 4UOEA 1N6IA 2AXPA 2O2HA 4XWGA 1FSGA 1SBYA 1IOVA 2PYZA 1LY1A 2JTVA 1DWQA 1P45A 3L8ZA 4X1IA 3MT8A 2WQ6A 1CJKC 3ESXA 2B4QA 3FTQA 2PN1A 4U3JA 4J1QA 4YCLA 2Z6UA 2FWNA 1QRSA 1Q15A 4GC5A 2B5VA 2R5WA 2YW2A 3TM4A 2G70A 3N2LA 1PJSA 4X6XA 2QL9A 4C0HA 4AAYA 2YCLA 4AIJA 4LZJA 5C1BA 3DTEA 3F6VA 2OLJA 5CCDA 3UK1A 4MHTA 1MSEC 2RGUA 1YZNA 4ENNA 2ZRCA 1YW7A 2EBWA 2QTVA 2ME6A 4XQEA 5F1OA 2XB8A 2HXYA 1HFKA 2OO5A 2P2NA 4YCDA 2QGNA 5ADHA 3K4PA 4X85A 2QNIA 4JB0A 3JW4A 2I8CA 4BGUA 4BBJA 1P5ZB 2CK3A 3O90A 2YSRA 1B8UA 4MS3B 1SUAA 2FEKA 3L0CA 1Q3KA 1T0JB 4NP6A 1OQYA 4A3EJ 3KPYA 3WNCA 2JA7J 4D9FA 3E3VA 2ECBA 3PE6A 3GPLA 3GEHA 1U0GA 2K5CA 2VHCA 1F1ZA 4AJNA 2ARKA 2YVKA 1JN0A 3HXTA 1J09A 4S05A 3H9UA 4RQTA 4XD7D 1OWPA 4ZVOA 4AECA 4DB4A 1HG0A 1M7HA 2J3KA 1EZ4A 1TM4E 1IRZA 1NVKA 1WOMA 1QHYA 1ZONA 3JQGA 4JLWA 5A1TA 2Q1WA 5G4KA 1CY4A 1DIAA 4H1UA 3ANMA 3E5HA 1G21B 3WGHA 2F43B 4QOHA 1ZKGA 1GV1A 3P9ZA 1V41E 5L3FA 1T8RA 3HUGB 3J7AO 1LBTA 1TGYA 4J1TA 2YOFA 3TCXB 1VJCA 3A9WA 4C76A 3H5AA 1IQ0A 1BDMA 5E3NA 3EEIA 2VPQA 1XL0A 3ZOZA 4CZ2A 1T6BY 4Q48A 3A1UA 3FXOA 1YE3A 2NO4A 4O4JF 2X7HA 1VQ9I 2FX2A 3NNDA 2ACJA 3BHIA 3QPTA 2YXPX 3R0JA 1GAQA 4QTUB 4B17A 4BKUA 1ADGA 2IOHA 2X8WA 3GLGB 3EG5A 2DFKB 2Q4EA 3IO5A 4AY5A 1G3YA 3UBTA 1HV8A 2RDPA 1P7JA 2OCDA 5FPYA 3ZK8A 1ZOOA 3GLHB 3MILA 5HLTA 5ILUA 1UEXC 3H65A 1ZFNA 5BYKA 2W00A 1LE8A 2PL3A 2SKEA 5F7XA 4AS2A 3KALA 1J97A 4Z7NB 2XCRB 2WT8A 3SXYA 3C4VA 2B61A 1W76A 4PSCA 5I8ZA 1JEAA 1TWGJ 5E9WA 3TDUC 3IUBA 1F6DA 2DK8A 1YZQA 3OPXA 5EKTA 2ZUCA 2W1OA 5LA6F 2AGVA 3QFTA 2HU9A 2ANCA 3WMGA 4OIFA 1YZ3A 1N8KA 1NX9A 3I0MA 3QU6A 2D1TA 3R6SA 3HUEA 3CRRA 1OAAA 3T94A 1JSLA 3WISA 2QAJA 4FYVA 4IGEA 3TZQA 2AMYA 4TWIA 5B36A 1PJQA 1MJHA 1CY8A 4BUCA 1I14A 2PMCA 2YBEA 4UJ5A 4DR1B 2CLCX 1VXRA 5I01A 1AU9A 3BOQA 1JVBA 2XSDC 2DO7A 5H4GA 3L4KA 2ZAMA 3FUVA 2D59A 4DIEA 5CJ2A 2O5EA 2W85A 3RS5A 4I6EA 5F73A 3FM3A 2MSLA 4HEHA 3UPDA 4G8CA 3OX4A 1F4LA 1I2MA 4FW8A 2Q5EA 4NH4A 4D02A 2ZRMA 4C0LA 4PJJA 3DDZX 3G2BA 4LZZA 3K4QA 3M3DA 2QEXI 3K4KA 1Z6XA 4E13A 1K2WA 1AKRA 5JDIA 3OKFA 3WYCA 3DMPA 3BPXA 2Q7XA 1MBJA 3FBIB 3OYFA 1YE8A 2F7SA 3QU4A 4QBFA 1FX7A 5EKUA 4ZHQF 5EGSA 4AUKA 1QP7A 1C9MA 4O5AA 4EJSB 3OYCA 3MTGA 2HW8A 1AUXA 3EGVA 3I52A 4HT3B 1YUMA 1GUYA 3HFRA 2GETA 4PG7A 1X1AA 3GFJA 4D6YA 3H4VA 1Z0DA 1FYKA 3Q9UA 4E88A 4P84A 5KOHB 3HRIA 5IKPA 1MKMA 4OQYA 4TSRA 5DNEA 4R69A 2FF4A 3I4PA 1OOEA 1ORWA 2DDBA 3M89A 4LNUB 5J4VA 3HBNA 5BWBA 1PBNA 2XCTB 2PEYA 4LK2A 3AUYA 2JRTA 3OPNA 4RTPA 3QITA 1Q74A 2DLDA 4LIUA 1MEOA 1NBIA 5DT2A 3CQZJ 4O4IB 4J4TA 4YJHA 5AW9A 3ZDCA 3HVHA 1MDMB 2FJPA 2PT7A 2YHUA 4FFMA 4RZQA 1XLTA 2HYDA 4UEWA 4XFKA 5CJJA 4YJKA 5EUMA 1TWFJ 4AZVA 1HGXA 5F1RA 1H4QA 4D3YA 3V6LA 3C14C 2A0WA 2W2XA 1X19A 1MVOA 1RQ7A 1VKHA 3BRCA 4NBRA 4OH1A 3LC1O 1CQZA 5ILVA 3GPBA 3NIWA 3NB0A 1EUDA 1JU4A 4Y7NJ 4AC0A 3H0EA 4LCEA 1FDRA 5JZSA 3KFLA 4J75A 1FOWA 3UH1A 1TT7A 2Q0HA 2VE8A 2R2AA 4ZZDA 1Y1TA 3PDIB 1BW9B 2I54A 1KQGA 3J80A 4ER5A 3THYA 1U0TA 1Z4JA 2I7XA 1DJQA 4D9BA 4KDFA 2I7DA 1QC5A 3I23A 4RHTA 3VXKA 1X94A 3G6KA 4QATA 3ZHTA 4EB6A 4DV3B 1CX9B 2JA1A 5CGQB 3HIFA 5D6FA 1UHMA 3RTRA 3E18A 4Q9HA 3HCFA 1UDWA 1I7NA 3I1FA 3PL5A 5ILQA 5A02A 3K6KA 2EXXA 2OOSA 3GW8A 3V8JA 1RZ4A 4OJKA 4R1PA 1JQDA 1HFJA 3AKYA 3E48A 3MHPA 3LSGA 1X7XA 3L1VA 2QRMA 3DV0B 4NC9A 3HB9A 2QK4A 4JBHA 3P0HA 5LM3A 1GN8A 2XAGA 2Z6QA 3ABUA 1DAMA 2ZJ0A 1G6OA 4M0MA 1QHIA 1R88A 3L7OA 2WICA 1XGOA 1D04A 3CUUA 3CC8A 1ELOA 2ETHA 1TAHA 3FHOA 1R0XA 2AV6A 3V8VA 3W4IA 4LWQA 4WXDA 2K2WA 4EM0B 3SJMA 3KDAA 5K0LA 3T0IA 4UNNA 3E7XA 2ZU0C 1JSXA 4F46A 1ZM3A 1PJCA 1RMTA 3TCNA 4P58A 4RV4A 4MUFA 3BWDD 1T6XA 4X90A 3TTSA 5FL7A 1DFIA 3BR5A 3DUWA 3MWDA 2GAIA 1RAEA 3GJ5A 2YUTA 2ZYUX 3WLEA 4K03A 1VG8A 4ZYZA 1BFDA 1I27A 4CZZA 4IJQA 4JSYA 4QYTA 4RH1A 1H9GA 3EY4A 4P4NA 2FPGA 5CVEA 5DNVA 3UG7A 1XZEA 5JUWA 2RAEA 1LPPA 4KUHA 1USUA 2VZ8A 3U40A 1Q50A 1B7GO 3JPWA 4CMHA 2ZMEA 2CBXA 2VKTA 3M6UA 4Z0HO 2F9LA 3QZUA 4O2LA 1XZKA 4UVHA 1BEZA 3ZCTA 4CL2A 1B00A 2P3QA 4O4IA 4OD0A 4QRIA 4YJHB 4TQ9A 2JSCA 3P9QA 5LIPA 5JCOA 3HJUA 4GZ3A 1KDRA 4DBLC 1JR3D 5FOTA 4BGIA 2OAQ1 3EDRA 2GCEA 2JD0A 2QQ0A 5IYZB 1PGQA 4CKCB 1NUTA 4B2PA 1C0KA 3VR2A 1Q6ZA 1S4MA 1Y3DE 4G0WA 1ZQ3P 4J16A 4GX2A 1TJ4A 4TL9A 3WLRA 4XRMA 3SG0A 3JAWB 3I8SA 4PZAA 4UPDA 4OI1A 4EFDA 4YRAA 4N6OA 4BMSA 5LMNB 3R9WA 2VP6A 1RPJA 3ZGXA 1MC8A 1R8SA 1VDZA 2IUYA 4LIVA 2DCEA 2O7SA 4A3LJ 2EKLA 4NENA 3LFHA 1E1QD 5HRUA 2NVUB 1D1BA 3DMFA 3RRZA 4CIXA 1YKGA 3PEWA 2NVXJ 3E97A 2GVNA 1WKMA 2FN9A 2XUPA 3VVCA 3EUAA 4PSUA 5EMJA 4AJ9A 3UTDA 1WO8A 3CZQA 1W0JA 3HRTA 2ZT8A 4WLVA 2VQDA 3C7TA 5H20A 4CCLA 4KJZA 2AQFA 1D1PA 3IQGX 4RZSA 2NYXA 4ABZA 2YNMA 3SOZA 2O8NA 4CMJA 3KETA 1P7VA 3LT4A 2O8DB 3D1JA 1FX0A 5F5LA 1M1EB 1RLMA 2FSWA 2CK3D 2X5NA 2Y1DA 3M0EA 1VQOI 2OORA 2XNJA 4HN9A 4BLWA 3GYBA 4C4OA 4XQFA 5ALYA 4YEJA 3EGCA 4MHOA 3K2AA 2VODA 1O7LA 4IRMA 2DJIA 1G8KA 1LLCA 3A9RA 2BAGA 4HFMA 2Y75A 2LY9A 1XTQA 1ORVA 5E6UA 4KGXA 3E8SA 1MQ9A 2KKOA 3DDNA 3JVUA 4HB0A 1MJBA 4ETMA 3V42A 5TNXA 2VP9A 1VL0A 1YIDA 3I2GA 5KKNB 4MQBA 1H2XA 3CF6R 4MEBA 5FD8A 3LUJA 2XIJA 3QE0A 1SC9A 2IOFK 3DTTA 4LHSA 1SUWA 1TFUA 4CUGA 1W581 4K28A 5FXMA 5ALDA 4AP6A 3L7MA 1T5BA 5AUOB 2BT4A 5T64A 2R7QA 1JDBC 2GQ0A 3MUEA 4C4AA 5T4FA 3GT7A 3A01B 3CF4A 3PIDA 1APLC 5AKIA 2AN9A 2PKCA 1QDLB 4E7OA 2K4MA 4RD6A 3GGSA 1QRTA 3ZN2A 5KOYA 3WRWA 4ZK6A 3MTBA 3H75A 5EG0B 4ASUA 4ARZB 1T0HB 3M5WA 1FZQA 4GR5A 3S32A 4MGKR 5F2NA 4KQ9A 2D4HA 4MW4A 2VJPA 2JFHA 2JHCA 2XQFA 3F23A 4BMZA 2GZMA 5EA2A 3B20A 3JAMA 2HNAA 5DNUA 3RS0A 2WY8Q 2XTNA 3K70D 1COZA 1HDYA 1J0CA 5HIJA 1OH8A 2G7ZA 5DCLA 1NQUA 2FN8A 1OR7A 1ZK8A 1L5HB 3OIUA 4NJEA 3BWMA 4W1UA 1A7AA 4L5CA 1ZUIA 4G37A 3I2JA 3GJ8A 3K6GA 5BN1A 4LSMA 2FR8C 4E3ZA 3IEUA 1V7ZA 2PV0A 4BN5A 3HKBA 1U90A 3QF7A 3AF0A 4JB3A 4L75A 3ZGNA 2OD5A 3OYAA 1OFHA 1ANKA 1R6BX 4OINF 2JFGA 3FMPB 2VHQA 4UNPA 4DG8A 5I9LA 4W5NA 2YICA 1VPVA 1E4EA 3QVUA 3SJ7A 4ZDJA 4HLYA 2Q29A 3IBYA 3M1LA 4BFVA 1B0AA 5FO5A 2XXBA 4F2GA 2ZEJA 4OATA 4Y2VA 3FOAA 5FBHA 1XZNA 1MNMC 1P39A 3ONVA 5FWXA 5AXBA 4BAGA 4QYXA 2ZXWH 4NEHB 2RH4A 2CW5A 2QTVB 4I08A 4I55B 2H6CA 2EVWX 5E1MA 3KU4A 3M5PA 4EG7A 3Q3CA 1W7AA 4EEXA 3JAKB 1PNTA 4P4SB 2E7ZA 4JL5A 2PKRA 2F4MB 1NFRA 5ECGC 1U2TA 4B6QA 3UIEA 1U9IA 4UKDA 4O6JA 4HGPA 5ALZA 5TPZD 5LU8A 3F4LA 4OXNA 4AKEA 4DY6A 4LY9A 4ZI7A 2TMGA 1USKA 3PQ2A 4HWTA 3BXGA 4BLVA 2DFTA 5IF3A 5GONF 1USIA 3MCTA 1Z3IX 3GYGA 1TYDE 2QLTA 1JLMA 2OP0A 3W2TA 1A6QA 1QX3A 1MMGA 2ET6A 3L77A 1M54A 1UFVA 4I2VA 2W2PA 1BX1A 1HKTA 2ZPUA 4WZ6A 3F98A 5C7YA 1XPUA 2JGDB 3QYJA 3HZOA 3PEUA 3ZYCA 3NEUA 3IH2A 1MIJA 3QLVA 1PVOA 2UXXA 3U2RA 5BQTA 1RT9A 1H4VB 1LE8B 2VUHB 1YOVA 2ZB8A 3COAC 4IOMA 4U2BA 3VZDA 4TS4A 3PRKE 3AHFA 2TYSB 1Y37A 4UXNA 3AESB 3IBFA 1A6IA 3LBHA 4M8KA 4QDOA 5A3VA 4YS6A 2QIPA 4WGFA 2EKZA 2VH1A 4EUEA 4UPVA 1XZAA 1W1UA 3BXFA 2C3YA 4DJAA 1EFPA 2VJBA 3EMBA 1LQUA 3QJGA 4A6DA 2Y66A 1YZGA 4YDQA 4YIHA 4QREA 2ZS9A 1F4VA 4JT9A 1VQPI 2BPOA 4KWEA 5IJZA 1DG3A 1IPEA 4RVNA 1CD5A 2HM7A 1IE3A 2O57A 4R9UC 1Y7IA 4TKVB 4HBZA 2NOJB 2IBMA 5IZ4A 3I71A 1IG3A 3I62A 3SCZA 5A7GA 2QVZX 1BS9A 2WKRA 1ZA1A 4EVSA 3CUQA 2VDLB 4P3NA 3VJLA 1ZK1A 4V0ME 4DQLA 2GSDA 1F9AA 5DYIA 1L8OA 1ZJJA 1CE8B 1BDIA 3GZNB 4FBMA 5A9TA 4Y30A 3P97A 4DJTA 1XNQB 2D5CA 3BEOA 2G8LA 2EILH 1A4XA 2C4NA 3UUWA 3VC2A 3DE3X 3JYHA 5THQA 3VAYA 4BV2A 4WBNF 4AK9A 1RM5A 3W0LB 1NHWA 4GCVA 1EVZA 3MTJA 1MBZA 3VVLA 1AF4A 5EC8A 2PLRA 4F5DA 4YRVA 1K83J 1D1SA 2BE9A 4W63A 1RLOA 2BMJA 4E4RA 1WCYA 2FBIA 4L5JA 2PMHA 2PANA 2XTMA 2G0EA 3OCWA 1U8BA 1PDNC 1P92A 1VQNI 5EIWA 1FFWA 4RK5A 4UTRA 1HFEL 1NNI1 2ZJ4A 4BRUA 2HCTA 2QUHA 4IM7A 1VHJA 3F6SA 4YWHA 4MKGA 1YSCA 2CFSA 2R1VB 5KVRA 2W5UA 3HS3A 4R8KA 1WQ1R 1EK1A 2PVSA 3FRIA 2EGUA 2MHCA 3LF1A 4IL6C 1D2RA 1E9CA 3OA0A 4E30A 1IRXA 2Q6TA 3Q6NA 1VIVA 4IDOA 4RHEA 2J5PA 1JJ6C 2FE1A 2XWBF 4BQPA 1VSQA 3EXG1 5JY6A 5TQVA 2P2ZA 4NCIA 1VCOA 2ZZNA 1WKVA 3S17J 5FHQA 1P8JA 2O0JA 3EXIB 4EJ6A 1T6ZA 5C1DA 4TYWA 3K96A 2BD0A 1KFCB 1UMCB 3C3XA 4Z7JA 2P6PA 1XTKA 1I7DA 4WT7A 1TRHA 2H0AA 3CWQA 3EIUA 4MQ4A 1RXIA 1SJ9A 1C8BA 1Z0UA 2R4UA 4UVAA 4MR9B 4R9VA 1OGYA 4X66B 6REQB 4NBKA 1KMNA 2E48A 4C4ZA 4NVRA 1Q0TA 1X7YA 1HZZA 4H7HA 4O5VA 1YJBA 3BZWA 4LZWA 5FNVA 4RSHA 2ADFA 4NG5A 1ZH0A 1NJ2A 2WSMA 4AP9A 3PDUA 1M2OB 3KB8A 4F3RA 4X93A 1BH2A 1W52X 2BEVA 1DGWY 3OCZA 3OZAA 4YDRA 4L07A 4MYSA 5JI3E 1WZNA 4Y9DA 1FF9A 4C6HA 4JOMA 1EH7A 2W90A 1IDZA 1FQWA 3ZY5A 2L9SA 1Y33E 4BEJA 1IBSA 4B09A 1EDZA 2IHVA 2WFMA 5B3SH 3C3AA 1EFTA 2L9RA 3DDCA 1Z16A 2QHXA 3GFMA 3D3WB 5IAOA 5KNBH 2WJWA 3UXEA 3D2CA 4UXJA 4HDRA 1CR4A 1HEYA 3PHHA 3OLWA 2IF2A 3REQB 3ZQFA 3TGWA 2E35A 3G73A 5FD5A 3FDZA 3ABMH 3P4XA 1ARZA 4UVDA 5KKAA 4DSZA 4QG7A 2LKCA 1OIVA 1WSDA 4UDYX 5E4FA 2WM8A 3IAFA 5HKBA 7REQA 4CG2A 3HWSA 1MBKA 1PO7A 5HE8A 3RPUD 3EXEB 1BVYF 3PUJA 3CRZA 4IO0A 3NOXA 5AIAA 4N5IX 3ABZA 2DRIA 3RI4A 2GNAA 2JIOA 3PKJA 1TWCJ 2R8XA 5F1YA 4PHHA 2QE6A 1CHDA 3SFVA 1FIUA 3DM5A 1UXJA 1EP1B 2ZXIA 4W82A 4F06A 1GUAA 5B1EA 3QPSA 3MWFA 3U39A 5JADA 2VSOA 1LDNA 1H6DA 4PFKA 3T1NA 4LB6B 1G5QA 1NFFA 1ZU5A 2ODBA 3K53A 4HAXA 4EY4A 4HV4A 5IFKA 3HGYA 3EFHA 1YHZA 3LMKA 1P2VA 2X9DA 2KLBA 2R96A 1NPYA 1F9NA 1U0FA 4D99A 4OBEA 2PMZN 3ZU4A 2DT6A 1CRLA 1N1EA 1UUFA 2M34A 1NR7A 4H60A 1N1GA 1T8PA 1JKXA 1WUKS 2VXDA 1JKJA 5AIQA 1M1NB 2HOAA 1MC4A 1FC3A 3KOMA 1VI5A 2D1HA 2IZ7A 3KZMA 3AM5A 1VJGA 3HJFA 2ADUA 5IT5A 2AOTA 2O2SA 1KP2A 4PCUA 2EQBA 2DPXA 1KJJA 4PS0A 1JLLB 1DADA 2W6IA 3TECE 1XD2B 2CXXA 2HREA 2JVJA 2OR3A 3EHDA 3KJNA 4ITRC 3DFIA 3FWZA 3G8DA 2ATCA 3OTHA 3TSOA 3KQUA 4R83A 2MU1A 5FRMA 3H1FA 4PJLA 3A9UA 3D5SC 3CXUA 3TEJA 2BGGA 3F47A 4WA7A 3ZW8A 1E5TA 2MG4A 4WJZA 4ZT7A 3R7AA 4M9SA 4XWYA 1P2FA 2NQ2C 2GZWA 3ABQB 3QOYA 5EAIA 3RJ9A 4EG5A 1NZFA 3CR7A 1RRFA 2OFOA 5M29A 3UPUA 2EIKH 4I5IA 4K9NA 1EFRA 4G0UA 2P8SA 4B33A 5GJBA 2ONZA 1E0EA 3KV3O 1UC4B 2P27A 4PYLA 4ESHA 1RJFA 1PUIA 1ZH6A 4A2QA 1R6VA 1ZGCA 3UK0A 2FZLA 1DEAA 5CDSA 1BC8C 2XF5A 1DP3A 1TO2E 5DCUA 3ONFA 4IIJB 2OGZA 2CDCA 2HKXA 1R6XA 2ZIAA 3T1VA 3A4VA 1IHUA 3K0SA 3ZMSA 1AF7A 2XF8A 5HCNA 3N4MA 3IDZA 5B3KA 5JVTA 2I67A 3AH8A 1V8FA 4KMUX 2WJYA 1YWGO 1EM6A 2AUMA 2NZVG 3BTVA 3KOYA 4QGAA 4F92B 4ZT2A 2QM0A 2NXNA 3FFTA 4RHYA 1WF3A 1CUYA 4WXEA 3QPWA 2O3UA 1V2HE 2DHEA 3MD9A 3W5AA 4I02A 3SFZA 3LSMA 4B43A 1BN7A 1TK9A 1U28C 1WPXA 3C1UA 3EH1A 3IPAA 2VASA 1ZK2A 1J25A 3KFXA 3N28A 4TV8F 3RIMA 2DJNA 1ZNZA 3Q5EA 3HOXJ 5H3CA 4EVRA 1KR2A 1ZRFA 3Q9NA 1AOXA 4QYSA 5ALIA 3W9UA 1YQUA 4MW9A 5JALA 1CDZA 2FN7A 2POQX 3C5CA 3KTDA 1YJWI 4FFWA 1Q0QA 3NAMA 5E1ZB 3EIQA 2BFDB 1F2DA 5DLEA 1NF9A 2BZ1A 1DUXC 2Q8PA 2WKPA 4MEAA 3ZHSA 4M9RA 1V2GA 3DFFA 3QNUA 2J0VA 1AO0A 5FTNA 2UXBB 3GO4A 2OQVA 4FFNA 2XNKA 1GWNA 1T4DA 4ID3A 1SUCA 4MV9A 3GVHA 5BW6B 4LJ4A 1U5BA 4RAYA 2GKSA 1EX9A 3CINA 5JQGA 3C3CA 2JGIA 1ODFA 4NFHA 1SQ6A 1VCIA 1Y0BA 1YJXA 2WWRA 1P7IA 4DNCA 3AKDA 2JUCA 3KR1A 4QL3A 4YASA 4DWOA 4CEHA 5ARBA 2HRRA 3L6OO 4NCKA 1XKLA 2KW5A 1FFBA 4WJLA 3K2EA 1M1ZA 2NAZA 1QRDA 2CE2X 1LI5A 2WZDA 2ZDGA 1W94A 3DE0X 4U0WA 1D0SA 3R5HA 1ICIA 1CV2A 4LTDA 1SVOA 1TP4A 1E5QA 2VQ6A 3MNFA 3TO9A 3L6BA 5AW8A 4ER0A 3OPYA 5K3FA 2QNRA 4POOA 3RLIA 1GDHA 2WWIA 5DM6F 1X0VA 1NR1A 2VP2A 1K4KA 1B2RA 3BGIA 2GJ4A 4JP5A 4NE7A 4EFMA 5K01A 3VSAA 2X4IA 4P92A 4MEYF 2F43A 4FVTA 1WGXA 5LC1A 3RU3A 3L4BC 1LBIA 3T5DA 2BZTA 1Q1EA 2O7NA 4EPWA 1QGOA 2QN9A 4FR5A 1ZSVA 2GLXA 3H87A 2E4YA 3DVQX 2QTRA 1E3MA 3V3KA 2JK3A 4ZOEA 1G60A 3OQ6A 1IM8A 5KWIA 2F48A 4KR3A 1TU0A 4EQ6B 1KSJA 3H5LA 3U17A 3TQTA 1O97C 1FTQA 1U4OA 3R61A 3T9AA 4IMJB 4BEWA 5K5OA 4OYYA 5CXQA 1CULC 4L4YA 3S15J 1ENZA 3TXXA 1Z82A 3C5WP 2DYKA 3S8YA 1VPWA 2AOWA 1F38A 4OWRB 2LP4Y 4QPZA 5B37A 3KZNA 5M04A 4QUIA 3NATA 4GO1A 2HPIA 1WU8A 2PFSA 4QHTA 3WZMA 1FSPA 3FSEA 4MW2A 2IXDA 3VPAA 3WB0A 2P6RA 3QG1A 2ABWA 2OXCA 1SULA 5A5VA 1BE1A 1M0WA 1S2MA 5TR9A 1TZKA 1W0KD 1IMJA 3GTGJ 1IBRA 1C14A 1C3XA 2C59A 1L0OC 2UYGA 2FPXA 1Z2PX 3F90A 4RMNA 4J9UE 4EEKA 5B12A 4HC4A 3SQMA 1X2BA 3OZSA 4XKWA 4OFXA 5CB4A 2QT1A 1C9YA 4PFJA 4UCXA 1G6KA 1KEWA 4JJZA 7YASA 2A1UA 1T91A 4J3FA 1O9GA 1B8NA 3WP0A 2L9NA 3M4YA 1DBWA 2JGKA 1SMTA 3COJA 3VX3A 2BY4A 3VDMA 5C44J 3CEJA 1SD5A 5J1UA 3FZVA 3EAFA 1F8FA 1HLDA 2QMEA 1L5HA 3TNJA 3DYIA 1M6VB 3A26A 3NHSA 5D84A 1PUEE 2JDID 4HX5A 1KPHA 3R9XB 4FSHA 1OWMA 1VQ7I 2C5AA 2LLKA 1BU5A 1YV9A 3E5XA 1E94E 1N2XA 2XMZA 4EKGA 4BXOA 3ICQB 1KYWA 2BKXA 3JTGA 5SZJA 5JRDS 3PUBA 1FRQA 2GR9A 2Z3YA 4A2WA 1T0IA 2ZSEA 3PEEA 5SYAA 1UKYA 2XDAA 1Z2OX 3BGSA 3DBVO 1MJ9A 4JX4A 1C1DA 1R6UA 3MCWA 4FXOA 3JVDA 3DV2A 2DR3A 3FK6A 4DDKA 4RABA 2FP4B 3MS2A 4BMOB 4XVRA 4BTEA 1EWRA 3MRVA 3LYLA 5I7EA 3CV3A 5HLHA 1I3OA 3W5SA 2XI4A 3HXMA 3QLVC 1DIGA 5G40A 3ZMDA 3HEAA 3MZHA 4XNFA 1QIIA 4JI3B 4U0VA 1EK6A 1F48A 3MRTA 5AHRA 1V1RB 4KXNA 3E27A 1TYAE 4OMFG 5IYDJ 3TAUA 4C3UA 1X2NA 2N1BA 3SR3A 3GJ0A 4C0XA 2HZDA 1TM7E 2EDCA 2JD1A 3PI7A 2G67A 3DTYA 1C9JA 2JGFA 3P94A 2A5JA 1JQEA 1KJWA 2K87A 3BWVA 1JKOC 1SCBA 1T6YA 2QYTA 3PQFA 4GZLA 4IP0A 1D2EA 3CZ9A 3DDHA 3TZHA 3REQA 4EQ6A 1GGNA 2YN0A 3W6ZA 4CF4A 5FLXA 3EEFA 3IDAA 1BTOA 1HRDA 2CUTA 1JIKA 3EPPA 4JFAA 5FWYA 4PANA 5J5AA 2QTMA 2HTFA 1RPZA 2QP4A 1A9YA 3W1VA 2K9QA 2EZUA 4EV0A 2B63J 1F43A 5LP6B 2F1OA 4TV8B 5I45A 2RH5A 3HUDA 1ZW1A 3FPSA 4PYOA 5F35A 3GJ3A 3OE7D 4DC9A 1D1AA 2G88A 3FR7A 2UUCB 2P1ZA 3FPBA 2QRUA 2M0MA 3HPHA 2XMSA 3I76A 1HE1C 4WERA 1RXCA 4XGQA 4CM1A 3VO1A 3E9RA 3DEAA 4ZOLF 3TIXB 5BRAA 5FKOA 1HO3A 1EJ6A 3IWFA 5EUQB 4EB0A 3QP9A 3ADDA 3HR7A 2W57A 1FSSA 2NVUA 3WOVA 1RPWA 2F55A 4HQLA 3CBGA 2FRHA 1KDTA 3JD3A 1BL0A 1CGPA 3EYWA 3LCUA 4FS3A 5TMBA 1QFMA 4FMDF 2WVGA 2R7KA 4M0LA 3HYIA 4OUKX 4B7XA 1FPQA 4UHEA 5LR6A 4QELA 4LLLA 4TLMB 1GKLA 2OWDA 1YZYA 2QYHA 1PEDA 1G41A 2PNJA 5JQGB 2LTPA 2VI5A 4BY7J 3MWJA 4OG2A 2LPMA 3E7FA 2JJ8A 1N77A 4ZV9A 4Y4RA 1Q1AA 4ZOQI 1TTPB 4J1NA 3NBZC 4XVCA 3GNLA 1PS0A 3FF1A 5AJUA 3P9CA 1CUDA 1X8KA 1MB9A 2YWDA 3ID6C 3KR2A 2GZAA 1EKEA 2EJCA 4HGOA 3HL4A 1XR3A 4ISBA 1BGXT 4U2CA 4QTYA 2QY9A 1NJSA 4ZO6A 4QOFA 3JREA 2JBAA 2PYIA 2JFOA 2O2ZA 3S1QJ 3G2MA 5EKXA 4FMCF 1PW7A 3K3PA 3RJZA 1OGJA 1N5DA 2VNAA 4IXNA 4R5MA 5AKYA 4X8LA 3S2FA 3BROA 4TVKA 4F4IA 2F4OB 2W2KB 5KQMA 2O2GA 1ECJA 1EIZA 2ZMEB 3QX9A 4GICA 5GGXA 3FMRA 2HQRA 2QUFA 1EDEA 4I5FA 4TTJA 4BP3A 4DXDA 3K6JA 4PRZA 2XB0X 3AG1H 2X9QA 3ABOB 2FPGB 4QULA 5E8GA 5G41A 3MKLA 3RJMA 4DZPA 4R0MA 2IZZA 2QUJA 2I9KA 3JRDA 2ZRQA 4I7HA 2WA1A 3V4GA 4Q12A 1M6YA 3KVVA 5HJ5A 3VNBA 3GGDA 1B93A 2IC5A 1VJTA 1YR7A 4DLYA 4XJSA 3RNLA 1QU3A 4CLOB 3W2WA 1FOKA 4JNCA 4PLZA 1KQ3A 3BBPA 4ZOLB 4B6RA 4NCHA 2WIFA 2IXFA 4AQDA 4EEZA 1UELB 1SUDA 1YJQA 1NIPA 4FHCA 3H0GJ 5G4LA 2GEKA 4QFBA 5GADJ 2WV1A 3BE6A 1ZD4A 5FI1B 4IIVA 3VU9A 2ATEA 4IJ5A 4X3CA 3GV0A 3W4JA 2FZCA 3QEMB 3R2JA 2UZ0A 4JJ7A 1J24A 5AVWA 5F1JA 2QYOA 1KU2A 3EF3A 1EQAA 2DLNA 1G3QA 1PWXA 3IILA 4R9SA 2QGUA 3J7AC 4XR4A 4BBAA 5FP0A 3NANA 4PLWA 5ALQA 5DX0A 4N0BA 2R0QC 2WKQA 4OMZA 1PT8A 3CCYA 3HOVJ 2FF7A 3G88A 3R60A 1CZKA 3PQ7A 2JJ2D 3HCDA 3OICA 1NVMB 1PQ4A 2PUWA 5TQ2B 2H65A 2J9YB 4ZQFA 3V8PA 2CNOA 2Q4TA 2Y0EA 5EL0A 4BJ5C 4B6EA 1DC8A 4NU8X 5I4BA 1DKRA 1BJRE 2Y0CA 1JFFB 1FNDA 2Q5OA 3B6MA 1G63A 4KLNA 4LCJA 1V54H 1NDUA 5GAGJ 1KMIY 1ZMTA 3JD0A 4HVLA 2X13A 1UBTS 4G81A 4MW1A 2E71A 1I80A 4EIWA 4XXHA 4O3MA 3DTIA 1IN7A 1IIBA 4QIWN 1T35A 3RABA 4B79A 1NJ5A 3D5EA 5A4JA 1A1VA 3A0HC 1B8PA 5BV8A 2VF7A 1JL3A 2HLNA 3GJQA 1YUBA 2X6YA 2VJCA 3HYRA 3PFNA 2ZOSA 4H3KB 4LK3A 4OFBA 3OZXA 2KPOA 5HZMA 5MGBA 3ICPA 5EF6A 5HYVA 1CPYA 1WCV1 1BRMA 1U8ZA 1EHYA 1FYXA 1LF5A 4P9UA 1QZZA 1Q1BA 3RBVA 3TSWA 2R11A 3AB7A 4IH4A 2VSQA 4J0CA 2AJBA 1N6RA 3H86A 2O1SA 4JL8A 4P8RA 3V2IA 2RGNA 4OJMX 1ICEA 2YU3A 2EFEB 4KQXA 1I1OA 5K0FA 2BFCB 1WG8A 3LPNA 3HG7A 2VBFA 4BX9A 1DEHA 1LRJA 4PHCA 4JLUA 3ZG6A 5I8WA 1RWVA 3F6CA 3MINB 5J4YA 3GT4A 3Q1KA 4PGFA 3HTXA 5B66C 1PGNA 1FYDA 5DLDA 2C00A 2HUPA 5FOSA 3DOUA 3EX7C 3H4IA 1EESA 2A2ZA 1K7FB 2H7VA 3B1WA 3DFUA 4HSEA 3MFQA 3CEMA 4TS1A 2F2TA 5F7OA 1JHAA 3GTLJ 1N0IA 4OU0A 4RIEA 4FWTA 4RM3A 4HJXA 1UOOA 2GS9A 4KQHA 2GM5A 1WMAA 3ZGOA 2H3EA 2EARA 2GZRA 3GH1A 5FI5A 4L9RA 5I48A 5L3QB 1NTCA 2HF9A 5JECA 4IIJA 4HUQB 1AGYA 1QE3A 1KARA 1E7MA 3IOYA 2UV8A 4ARIA 3BOSA 1SKBA 1JUSA 2L19A 3HBMA 3PRJA 4K9PA 5ES3A 3E5UA 4UBNA 3TO5A 2PFGA 4Q1EA 1R66A 3VJKA 3KCQA 1AKYA 4F9TA 1CP3A 3H4MA 5FKKA 2R1UA 2QYSA 1EV7A 1T3GA 1ZK0A 4IV5A 3W3ZB 4CNBA 4BBZA 4L0MA 3C1TA 3RIHA 1W73A 1KWGA 1M1XB 3HVRA 4FFRA 5FBKA 3H7AA 3PP8A 3COVA 5EZ6B 1MC5A 2HJGA 3LOUA 3GEGA 4QQRA 2A5GA 4RZHA 5AW6A 4JAVC 1ZY2A 2PH1A 3ORSA 5BVHB 1KS2A 3RQIA 2I3ZA 1U04A 1DIHA 2QD3A 3B82A 5ILSA 4MA0A 4U5QA 5EQTA 4J91A 1X3WB 1FXSA 3AZPA 3T15A 2QE7D 2E1MB 2FJ0A 3PFGA 1Y8QB 5FKLA 2ZJRF 1OREA 5HJ2A 5KX5B 3IP8A 5IUKC 2ZVJA 3QX3A 4M8IA 3F8SA 4AM8A 2H9YA 1II8B 4YPOA 4Z51A 1KJYA 4H7PA 4OGKA 2H1KA 4B3GA 4TSKA 1GDTA 2WVAA 1HDGO 4OLJA 5BT9A 3WQRA 1X14A 3KJZA 4FD2A 2H27A 3BRQA 1QR6A 1V8OA 1UPBA 1XAIA 4PUSA 1Y8AA 3CDHA 2PL1A 2NYRA 1TCAA 3LBYA 2NS0A 2XNSA 3UYLA 1P8AA 5MN5A 3ZV4A 1KI6A 3ZC3A 1X42A 1QNFA 4FONA 1A88A 3A3PA 1SVSA 2VC1A 1U3TA 5BPFA 1R6DA 1FYLA 1P0IA 1UZNA 2JCSA 4L7QA 4PPFA 3WGJA 2YJ5A 2EERA 3TMYA 1NAIA 1RBQA