4S05A

Crystal structure of klebsiella pneumoniae pmra in complex with pmra box dna
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
219
structure length
219
Chain Sequence
MKILVIEDDALLLQGLILAMQSEGYVCDGVSTAHEAALSLASNHYSLIVLDLGLPDEDGLHFLSRMRREKMTQPVLILTARDTLEDRISGLDTGADDYLVKPFALEELNARIRALLRRHNNQGDNEISVGNLRLNVTRRLVWLGETALDLTPKEYALLSRLMMKAGSPVHREILYNDIYSGDNEPATNTLEVHIHNLREKIGKSRIRTVRGFGYMLANN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and dynamics of polymyxin-resistance-associated response regulator PmrA in complex with promoter DNA.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Transcription/dna
molecule keywords DNA-binding transcriptional regulator BasR
total genus 61
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4s05A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4s05A01
3FM5A 1JHHA 5CVJA 2HQRA 4MGRA 3HVRA 3CLOA 4L9VA 4A0XA 1KU3A 5DUKA 1IIBA 4KQ9A 3KLOA 4ZZLA 3LKVA 4E7PA 3EYIA 3L00A 5ICFA 1QNLA 1QGPA 5BQ3A 4HX8A 5J8CA 4HLXA 4NICA 2DT5A 2WB4A 1YFHA 2WTEA 1XHFA 1C0WA 3SY8A 4CO8A 5HLIA 1ZHHA 2QSJA 5EWLA 1Z26A 3NNDA 1I3CA 1ZDMA 3BRQA 7ABPA 1ZH5A 5HQJA 1FFWA 4HV5A 1PP7U 1IN8A 1T2KA 3TQNA 2STWA 1IF1A 5KWSA 1UHWA 3U2RA 1XMKA 2FW0A 1P4XA 3H75A 1YG2A 2CFXA 1W5TA 3R4KA 4NV3A 2XV4S 1R1VA 2FBHA 1F5TA 2IOYA 3V8LA 2PL1A 2GZWA 2PUGA 5TQJA 4MEYF 5D5XB 2WMYA 2NRAC 4ETIA 3E5QA 5DUIA 4G0ZA 4TN5A 4NQRA 4OLAA 1MKMA 5FWXB 3KTOA 5CNKA 4LLNA 4O1IA 4KUMA 2B0LA 2IT0A 1APBA 3F6OA 1KYWA 3LUFA 4MAAA 4GGGA 4L4UA 4M6YA 1A0OA 2E4UA 3RIRA 3I4PA 1MJBA 1D1QA 1B9MA 5ERIA 2PMHA 4LX8A 1P8AA 1F51E 2K86A 5HLGA 1DG9A 3I58A 3H5IA 4G0OA 2L2QA 2HGCA 3LA2A 2XGXA 5IC5A 1A04A 4LJZF 2EK5A 3RJPA 3QPTA 1FFGA 1LEAA 4MR8B 1EFAA 1VTNC 2FLKA 2YHAA 1R5HA 2XROA 1HW2A 5AIPA 1EH8A 4RK4A 3JW4A 2WC2A 2W24A 3QELA 3J80Z 3O2QB 1LJ9A 1R58A 3CG0A 2M45A 3FGZA 1MGTA 3LSTA 5B3JC 2HWVA 1LVAA 2JT1A 2D1VA 2YX4A 3LTEA 4RY0A 1USSA 4KK3A 4O3MA 3GZ5A 3KYJB 5JS1A 4Q7EA 1JDPA 2XASA 3BJAA 4FT8A 4QYWA 3ZMTA 3DXJF 1TW2A 1IN4A 3J7AO 1AB6A 1O3RA 4W5OA 5KQPA 5DD4A 4LLGF 3ZP5A 4MS4B 2PFBA 4RGRA 2KIUA 4UVCA 2AYZA 1KU7A 2WY2D 1NXXA 1ZY2A 4IJAA 2ZWMA 3F8MA 2JBAB 1NATA 4M9ZA 4BHPA 2GWRA 1B00A 1ZYRF 3L7WA 4Y13A 5JNUA 4UHTA 1I1GA 1Z6RA 4F7ZA 5LEJA 4RK0A 2XUBA 1J9IA 3FFWA 2RKHA 2HTSA 3ECOA 3EETA 3QX8A 1LBHA 2JK1A 1K6OA 5CVVA 3IKTA 4MR7B 3N4MA 4G0YA 3SFZA 3ECHA 2IW5A 3F6CA 3O2SB 2MLKA 5BPIA 2M87A 2Z99A 1HKQA 5HLHA 4WT7A 2HKXA 1ZGZA 3TGNA 1M2EA 1MVOA 5HDNA 5HS9A 4O6JA 4IMIB 5LGNA 1OYWA 3KKEA 3QAHA 5H6QA 1R5GA 1U8TA 3SAJA 2H27A 3KETA 2IP2A 3CJNA 1O3SA 4P9FA 3LUJA 2VUIB 3HRTA 3BRSA 2O6GE 2NUBA 5IEJA 4UVBA 3RYPA 2VUHB 4LB6B 1ZG1A 3E3VA 3RDIA 2W85A 1KU9A 5IX8A 1NXOA 3MFKA 3FWEA 2HQBA 1YQAA 2QVOA 3P7NA 2PE5A 4AIKA 1FBQA 2F5EA 4BHBA 2UXXA 2F5FA 4ZYGA 3C3WA 5LGUA 5DKFA 1G4DA 3KEQA 3H5LA 2KIFA 4H0EA 1YYVA 3LUHA 1L3LA 1CF7A 4PGGA 4JK1X 2FNAA 1ZESA 4PICA 2CW0F 1Z05A 1ZGJA 2LDUA 3K69A 1LDDA 2ZMEA 1MAVA 2MC3A 2ZKZA 3R0JA 4EJTA 3SZTA 3CUQA 4A5NA 1G3TA 1T6SA 1RZRD 3JPWA 3O74A 2XAHA 3L6UA 1OPCA 3GW2A 2L01A 1SFEA 4Z9AA 1SD7A 2FMHA 1F1ZA 4HNSA 3Q9SA 5LRRA 1W7PD 1KGSA 3QP5A 4ESJA 3MM4A 1PUEE 1BAPA 1QQBA 3KS9A 1IXRC 1XMAA 4ENNA 4XLNF 2JVKA 2NT3A 1B1BA 1LB2A 4I0BA 2A9QA 3FXRA 1LDKB 3NQOA 3WTYC 1GVJA 5EWLB 1TLHB 4EJUA 1BI2A 1JE8A 3KP6A 2PUCA 1ZAYA 2JPCA 1Z25A 1LNWA 2OQGA 4KN4X 5AIQA 2PQ8A 3H5WA 2A6HF 1D2AA 3QRFF 1I27A 2P4UA 5JS2A 4LRQA 3CZCA 2O03A 4RDCA 1JH9A 4K2EA 2FMIA 4Z4GA 5E17F 3HSYA 3F22A 3N0XA 1F4VA 3O21A 3H1GA 3F3XA 2D2WA 1XDUA 2J5OA 1TQIA 4N0BA 2ZNZA 4DN6A 3SXYA 1S3JA 4Z4IA 4I02A 1YVUA 3HSEA 3B73A 4A5MA 5HM6A 5HS8A 3GX4X 3B2NA 3QP6A 4AVPA 3BBLA 2RV8A 1FYKA 2P8TA 3DGFC 5BRJA 3MQ4A 4ETNA 5GQSA 2PAFA 2L02A 1CYEA 5TQ2A 4EJOA 3MMNA 1BC7C 1AWCA 2AXLA 3I5UA 3LUDA 3TO5A 3KHTA 2VT3A 4G8XA 1DBPA 5TQ0B 4EGZA 1TMYA 3T8TA 4HX7A 3ROFA 2ZCWA 3HTSB 5FBHA 2IPLA 2QR3A 4OMYA 5FD6A 2LP4Y 3Q15C 4BXUA 2NZVG 4M9XA 2MLGA 2IA0A 3EQLF 2KIMA 1DDNA 1LDJA 4FX0A 3J80K 3RKYA 5LEKA 4ETSA 4RSMA 4RGSA 4TV7A 1LBIA 1KMIY 2PJPA 1U8RA 4IHSA 2QZ8A 5DEQA 1XCVA 2DK8A 5EEGA 1PDNC 2FMFA 4N0QA 1ZN2A 5KK1A 4KFCA 1JFTA 5ICEA 3FZVA 4QYMA 1FSHA 5JNWA 3M6MD 2OA4A 4EJVA 1ZGAA 3MZHA 3E6CC 3C3MA 3OQMA 4WXCA 2HSGA 4G86A 1Z18A 3ZMUA 1SAXA 3GVAA 3HHHA 3W6KB 4WXHA 1Z13A 1Z17A 3R61A 2R48A 4MS3B 4MS4A 4EMSA 2AS5F 4EYOA 2W42A 5GOTA 2FBIA 2W84A 5CNJA 4HBLA 4P1ZA 4KA4A 4PZJA 3H5VA 1R7JA 2EFPA 3EDCA 4RKQA 2ID9A 4KT5C 4Z99A 4D0PA 4KIFA 4Q48A 2A6EF 1H9TA 3CNBA 2LNBA 1UB9A 1PP8F 1MB0A 3G73A 1C4WA 1XN7A 2Z33A 1MZBA 1ABEA 4HV6A 2QV0A 3U1DA 2K27A 1ZLJA 3CHYA 5E18F 4M88A 1TQMA 2ZAYA 2HFHA 3HUUA 4YIIA 1J0RA 2FEZA 1P6QA 3OO0A 1ZGGA 4PEVA 4WZZA 4LFUA 1ZRCA 3RVKA 2D45A 3BY6A 2F8TA 3FFTA 3GRCA 3O2JA 2OAZA 3NNNA 3HJFA 2HDCA 2P6TA 2DPDA 3CO6C 4ZH4F 4HDVA 3GWZA 1K79A 4Z4CA 2BYVE 5EWMA 1U0SY 4Z4EA 4XARA 3I53A 2YHBA 4EGSA 3RVJA 2N9UA 1Z12A 3TO6A 1VKRA 1VPWA 3MEXA 5BS6A 5TQ2B 2FQYA 1ONVA 5LHGA 4OTZA 2UZKA 3C18A 3A3KA 3GBPA 3WTVC 1SD5A 4HX4A 3KJXA 3QOPA 4ETMA 1BIBA 3GV0A 5BQTA 3LMKA 2Z9OA 2GBPA 4RB0A 1RNLA 5TPZA 2A9RA 3DEUA 3I54A 3FFXA 4P98A 4KIBA 3OLZA 1D8JA 3HO1A 3LUKA 2FMLA 3OO1A 3P9KA 3DZDA 3EQZA 3TMYA 1JYFA 4OINF 1BJAA 4RY8A 1TNSA 2V0NA 2P6SA 3WE3A 3C7JA 2M98A 3HZHA 2C6YA 4MPTA 4I7HA 1JDNA 3WTUC 3N0WA 2PG4A 2CD7A 3RVOA 2K4BA 2ZFWA 3HS3A 1YMUA 4OIPF 3O1HB 2ETHA 5EWJA 3QPHA 1QZZA 4HQMA 4N9IA 5TPZD 4ENKA 4UV9A 4MEXF 2QQ9A 3QLUC 3WU0A 1D3YA 2VONA 1QP4A 1ZVVA 4WXMA 3LWFA 5F64A 2G7UA 4IRIA 4PCQA 1XGNA 4E7OA 2DU9A 2X4HA 1DUXC 1E6MA 1QKKA 2FA5A 5BRAA 2VXZA 2CHEA 2MYNA 1QZYA 5LGTA 2B4AA 2HS5A 4EGYA 2E7XA 1FPQA 4L0ZB 6PAXA 1X3UA 2P7CB 3VODA 3A0RB 3JTHA 3NEUA 3V8KA 4W5NA 4EVSA 3F23A 1QPZA 3IPAA 5JI6A 3HYIA 3LAJA 1EWKA 8ABPA 3EYYA 3PFIA 4KZKA 3WE2A 3WG9A 3RPQA 3DF8A 2KKOA 1D8KA 1XCBA 1FP1D 1SD6A 3D02A 1K78B 1BN5A 1D1PA 3LUGA 3SNKA 3V7RA 2L4MA 5IULC 2QQAA 3I64A 5CHYA 3MWMA 4R1HA 3K9TA 4B8XA 4GO1A 4BAYA 4LDAA 4MQ9F 5BPDA 2V1UA 2UWMA 2HOEA 4HOBA 3WGGA 3Q7RA 2F2EA 3KP7A 3G85A 6CHYA 2GXBA 3KE2A 4OIQF 2PEXA 5LBQA 2AYXA 2ACJA 2E4YA 2IYNA 1HQCA 3FM3A 3HIFA 1FLIA 2RJOA 2V1DA 1TW3A 2FXIA 4RAYA 1FFSA 3V8JA 1QPMA 3TD9A 2OD5A 5L3CA 1M5TA 4CGZA 1YLFA 4W5QA 1BIAA 1DCFA 4N03A 1RI7A 4KVFA 1ISSA 4OBBA 3OV8A 1T38A 4EM0B 3GFIA 2PJUA 5I4CA 4KN7X 3IWFA 2CYYA 2PUFA 1YK1A 3EQ2A 4ASNA 2RN7A 2BGGA 2WJWA 1DCKA 4NB5A 1WSUA 4M74A 2VC1A 3BILA 3S99A 3T1BA 2NS0A 3GL9A 4RXTA 1BBYA 2P4WA 1I6XA 4A0ZA 1TLFA 4M9SA 5DCFA 2IKSA 4L18B 4KNYA 4U0WA 2H94A 1U3EM 1J59A 3ISPA 1FBSA 1REPC 4WXEA 1V4RA 2FTKE 2XIGA 3TKYA 4JP1A 1Z91A 5HOOA 2Z3YA 5KQLA 4MHGA 5JVTA 2ID7A 1EH6A 4ESFA 2QVGA 4GNRA 4YS6A 1DBQA 3OQNA 2OU2A 3HTUA 1KQ9A 4ZMSA 2L4AA 5IUKC 3OOPA 1PNTA 1YW9A 1TQPA 4YO7A 2Q8KA 1JHZA 3W6JB 2FBKA 1MD0A 2P5KA 4JB0A 2XKPA 1RXEA 3HXMA 4OOIA 3H3UA 3KYIB 4YWHA 5D5UB 3L49A 4Q4ZF 4R8HA 4LMYA 4F3TA 1USGA 3M7GA 1T34A 4ZJPA 4ENMA 1IXCA 4EVQA 3QLTA 3GFMA 2DTRA 1P4AA 1STZA 5FWYA 3TOBA 3CUOA 4TLLB 1T0FA 2JBAA 4MR7A 5DYMA 1U2QA 1PHRA 1BI0A 2I6FA 4Z2YA 4M72A 5D8LB 1B6AA 2IRFG 4DQ2A 4LD5A 2E4ZA 2XAQA 1O7FA 1G3YA 4PGHA 4F11A 2L3DA 5A2QK 5AONA 2M5WA 4LK1F 3F8NA 3DGEC 1R8JA 3RVNA 5PNTA 3HRUA 1T39A 2O8XA 4WK8F 5DTEA 1FY7A 5F1RA 2KYRA 4DQDA 5L3BA 3CKMA 3FMVA 3URMA 1KQ8A 1SFXA 1HW1A 1XDSA 3EGCA 3O75A 3JTEA 1U78A 1EWVA 2MH2A 1USKA 2F5DA 1W4MA 3RPUA 2B1JA 2VBWA 3LFKA 3CFYA 3O6BB 3TX6A 5HS7A 4KQCA 2E4XA 4EM2A 3JVIA 4XRFA 2OQRA 4HLYA 2K4JA 2QU7A 2ZBKA 3SG0A 2EJRA 5CVIA 3MCZA 2XRNA 4UNOA 2O3FA 2CWEA 3H5OA 1OXBB 4RZSA 2W57A 3MYYA 1XGSA 2Q5CA 1PEYA 4MS1B 1IN5A 2P5LC 2EA4A 2CWDA 4MLDA 1SMYF 2H6BA 1WI9A 1QMPA 3FXUA 2CO5A 4P55A 4I2OA 3CUQB 3LAPA 2M30A 1MDMB 5L3DA 2RQPA 4FE7A 4L9NA 1S8NA 4CBVA 4MQEB 2OBPA 2P5VA 2NAZA 5IT3A 2WWVD 1E6KA 4XLTA 2ESNA 2QBYB 4LZLA 2HEOA 2UXNA 1H0MA 2QBYA 4MS3A 4UHJA 4F8JA 3CZ5A 4TMYA 9ABPA 4LLLA 2ADUA 4HNQA 3KLNA 3LA7A 2FU4A 2M8EA 4RS3A 4ZYHA 1P6RA 3ILHA 4IGAA 5CJ9A 2LSOA 3T8YA 2VOPA 2HQOA 3GZ6A 2CHFA 4O5AA 4Z0NA 3CRNA 4MYRA 3KP5A 4XSZF 2PN6A 5A2QZ 2FF4A 2FOKA 1M2FA 1Y1LA 1ZG5A 4UXNA 3EULA 2VE9A 3F8FA 5CVRA 2LBPA 2GA1A 3CS3A 1KQ0A 1QQIA 1E2XA 1P2FA 4MQFB 4RV5A 4MTEA 3RKWA 3LUCA 2PI0A 3FX3A 2YR2A 5HVQC 4G0XA 1FQWA 3BP8A 1L0OC 1SFUA 2RGYA 1BDJA 4JAVC 2HZTA 5DCMA 4JASB 3I09A 3HSRA 3C3KA 2J5PA 3ABUA 3MAJA 2YPRA 2PBIA 3DFGA 1ZITA 1HKSA 4OIRF 2VBZA 3KCNA 2W25A 1QBJA 5E1XA 2R7FA 4MQFA 2Z5UA 3GYBA 3N75A 4CDGA 2VODA 3OM0A 5B3JA 5LHHA 3VNBA 4FB4A 3H3ZA 4QICA 3R0AA 3QELB 1JGSA 2HTJA 3EAFA 1DC7A 2BBYA 5ILUA 1EH7A 2RNJA 4L9JA 5JNRA 3A0UA 1IZ1A 3QX9A 2ELHA 4KYWA 4P5OA 2LF7A 1EAYA 3C6QA 3OLXA 1HSTA 2DI3A 2DQLA 2HJ9A 2ZMEB 5FFZA 5D2CA 5L3EA 4AIHA 2FEPA 5CYVA 4DADA 2PUDA 3N0RA 2F8SA 4YCSA 4WCGA 3P9IA 5BR1A 2QM3A 3GLXA 2PLNA 2MA3A 4L9TA 2R25B 2K02A 2JTVA 1R23A 3I5AA 5KQMA 4RK6A 4XLPF 1LJLA 5TPWB 1Y0UA 3KCCA 4Q6WA 4L85A 1GUBA 5LLQA 3TOAA 3M1EA 2EFQA 1V3FA 4RGXA 1YS7A 1IN7A 4A12A 1R36A 3PQJA 3D5LA 2IDMA 2FSPA 2GIVA 5E3JA 3NHMA 5L3GA 1CGPA 3BZ6A 1J75A 2E4VA 4UUVA 2Q2EA 1DPUA 1GUDA 1XGMA 3JS5A 1QNTA 1NXVA 3I59B 3M8FA 5CNMA 4RK5A 1O7LA 5JHUA 1BM9A 2CG4A 5K5OA 3NHZA 2ISYA 4AD9A 3LUAA 3TB6A 1RZ4A 4R79A 5K5RA 4ON0A 5CLSA 3GO5A 3H92A 3LA3A 4YFNF 3HUTA 2NNYA 4RWEA 1AOYA 3JAMZ 2IPAB 1RUOA 2DBBA 4KV7A 4D6YA 5D4SA 5T7BA 1W25A 3PQKA 5DCMB 2G7HA 4H3HB 1HKTA 3I0TA 2MSWA 3TDZC 3K1MA 3QEMA 1KU2A 2A61A 3V4GA 4KREA 1O3QA 4OIOF 4G7OF 2MBFA 2H09A 4G97A 3HOTA 3HM9A 3L09A 3RYRA 4EQQA 4BNCA 4EYKA 4U7BA 4GPAA 1P92A 1O57A 5IUNC 2QQBA 4WF2A 1ZARA 1ISRA 1YTUA 1FC3A 1JHFA 5JFRA 4BH9A 5DCLA 1NHAA 2MH9A 2WWYA 2TMYA 1GLGA 1HEYA 4YFKF 2EA2A 3GA5A 4IRGA 3T95A 5E8IA 3IRQA 1GCGA 2H3HA 3BPVA 2RDMA 4Z9BA 2JSCA 4QPJC 2P9HA 3RVQA 4A6DA 3M9XA 1ZRFA 1SXGA 3IP9A 3F73A 1FT9A 2LF8A 3CDHA 3H5TA 2GAUA 2QXYA 4N9HA 3REOA 3IDOA 4YG2F 5E1ZB 2KJCA 3CU5A 3QEKA 4UV8A 1RXIA 3D0SA 2K7LA 3HUGA 5E1WA 3RVRA 4RXUA 1BA2A 3K1NA 4JA2A 3NRVA 3HDVA 3UUGA 1OYYA 2HR3A 4N0PA 3LKBA 5LHIA 1NXTA 3E3MA 3DV8A 3GWGA 2OZ6A 1EWTA 3ABTA 4JBAA 4MNUA 4U0YA 1G3SA 4OG2A 3GF2A 1WKMA 3WTTC 1HBXG 4MRMA 2L19A 2VK2A 4WXDA 1Z2DA 3F72A 4NHJA 3M9WA 3IRRA 3U9GA 2DRIA 1JYEA 2MD5A 4I0AA 3ZN0A 1U2PA 4IVNA 2O0YA 4YFXF 2D1HA 3E61A 1E6LA 5TPWA 2PUBA 2H0AA 3RI4A 1W7PA 3NNSA 1D4ZA 4TLMB 5DDGA 3GXOA 3RKXA 4HF2A 3RVMA 2V1XA 1MIHA 4S04A 1UHMA 1D5VA 1DRKA 3GBVA 3DBIA 2EB7A 1I1SA 4RKRA 4JOQA 1J56A 5ABPA 3EDPA 5FLXK 1HSJA 1IUYA 1QO0D 2QUFA 5D4RA 5H6RA 2J48A 2EV0A 1FOKA 2FMKA 1K7AA 1XSVA 2YU3A 1Z15A 3IP6A 3WGHA 5JNVA 1R22A 2A5YB 3OMWA 2FMYA 4RAZA 3WTXC 1YS6A 4EYGA 2DK5A 3CLKA 2YX7A 3R6SA 3BROA 1B59A 2NNNA 1ON1A 1QP0A 3TO9A 4PE5B 3F8CA 4HDUA 3QLVC 3N6VA 1G3WA 4WX9A 3E6MA 1OYIA 1GCAA 5TRDA 3W9SA 3N97A 1H9CA 3H6HA 3GFJA 4EVRA 4KK4A 3JY6A 4LE0A 3FHZA 4PYRA 3HHGA 3ZMSA 1K66A 2MYTA 5D5VB 4XXHA 2KRFA 4O5VA 2JCGA 3MIZA 2COMA 4EVIA 1JF8A 2Q0OA 3ZN1A 2XHKA 5J6XA 5TE9A 3B02A 2OENG 5HDKA 4ML3A 4RB3C 2L54A 4GYIA 5HDGA 2XAGA 4KICA 2FEKA 2R7DA 2VBXA 3C1DA 1JX6A 5IT9Z 3MZYA 2PUEA 1NXWA 3N53A 2LPMA 4Y9TA 3QLVA 4RK1A 5IEBA 3KP3A 1NXSA 5K1YA 4A0YA 3FF5A 4W5RA 2HPHA 1Z9CA 1DC8A 5C5CA 2FSWA 1MB3A 1F9NA 1B4AA 3HV2A 3GUDA 1FYLA 3LQRA 3GFLA 1IXSB 2IVMA 4G6DA 5JNSA 4I01A 2IPQX 3RVSA 5ICCA 1R1UA 1USTA 3ULQB 1Q1HA 3CO7C 3P9CA 1FX7A 3EUHA 1WWXA 3KP4A 2HYGD 1SD4A 3CUQC 4YV7A 3IHUA 1WRJA 3OM1A 1DZ3A 2Y0MA 4EM1A 4KDPA 1QP7A 1U2WA 3GT7A 2H6CA 1YTYA 4IHTA 2FNPA 3BJ6A 1MJ9A 4FHTA 3E5XA 4U7DA 1OR7A 4EV0A 2DO7A 1BC8C 4HF1A 3G1WA 4LG0B 4EUKA 4NCBA 5D6FA 1QQAA 5FWXA 4XASA 2Y48A 3J81K 4HQEA 3VFZA 2YSRA 5KI6A 1OMIA 1LJUA 2R3SA 3JPYA 1A2OA 1ZLKA 1SRRA 3V7CA 2XKOA 3GEZA 5KVRA 1JLKA 3IL2A 4KMUX 3GYHX 1LK0A 2FKAA 1U5TB 3F6PA 3RVPA 4XBFA 2IPMA 3IP5A 4Q5SF 2LIVA 2V6CA 3I59A 2GKGA 5TQ0A 3T6KA 2CQKA 1FYMA 4CHUA 3RQIA 1I5ZA 3E6DA 2HQNA 2IPNA 4YR7A 5EWMB 3T0YA 1HXDA 4EJWA 3QEMB 4L5JA 1JXSA 1D5WA 3ZQ7A 3ERED 1VRVA 5KC8A 5E20A 4F06A 4E70A 1MJAA 3JSOA 4WUTA 4Y15A 4YGXB 2FXAA 2OZUA 4M71A 5H20A 3IP7A 4RS8A 4KMRA 4HF0A 4AIJA 4MR9A 3HK2A 3VOEA 1BI1A 4U88A 5DGCA 4OU0A 2IA1A 4LGWA 1FWZA 2STTA 3KZZA 2NZUG 2X0LA 2XVCA 1IW7F 1ZHFA 4ZMRA 3RH0A 3HRMA 2WJAA 3IC7A 2QVCA 3TDUC 3FMQA 1ZRDA 4LE2A 2QZJA 4Z4FA 4ESBA 5LRSA 1GXQA 1Z16A 2LKPA 3DPTA 2DAOA 2GXGA 2FRHA 3JSPA 4RK7A 3E97A 4P9UA 4ZYDA 2VN2A 1TNTA 1FP2A 3M8EA 3HDGA 3FXQA 4EYQA 2FQWA 3HOSA 1LQ1A 4G9YA 3Q9VA 1VLZA 2P7VB 1G6NA 2A69F 2NYXA 5EWJB 5K5QA 4N41A 1TTYA 1FSEA 5FD5A 1KRWA 3KFWX 4G7HF 3ILYA 1USIA 3ZPLA 3E6BA 1JFVA 5FBKA 1Z1DA 2MSKA 2XDYA 4QWQA 1L5YA 4IILA 3VNAA 5D8KB 5FLXZ 1XGOA 2VC0A 3DKWA 2R47A 3JVDA 1P6UA 1PEAA 5FWYB 4EY3A 2RGVA 3MQ0A 2A07F 3ZMVA 1L5ZA 5T3YA 1NTRA 3EODA 3ROTA 3J81Z 1DP7P 1J5YA 3H1EA 1JFSA 2JRLA 5C5EA 3BJOA 1RUNA 2JRTA 3O2PE 5FB2A 4BQAA 2R4QA 4IMJB 1W7PB 2E7WA 3A10A 4N76A 3KP2A 3BPXA 3DPLC 3SHFA 2BE5F 4A2UA 1W5SA 4CICA 1C0EA 2FEWB 5HSGA 2VYCA 3FMSA 3O1JC 4A6EA 4DNCA 1RIOH 2A9PA 4ENJA 3K1PA 4OLBA 2LUOA 2QW1A 1IRFA 1UDRA 3F21A 4L0YB 2O61A 1URPA 3DQVC 3COAC 4ZZDA 3D8UA 4QLCU 4F12A 4MQVA 4PZ0A 1XD7A 2A9OA 2FVYA 1K78A 3HRSA 1FNNA 3SQNA 2E1NA 3VEPA 2FN8A 3OLWA 1S7AA 1UFMA 3LFTA 2GA2A 4Y17A 1CEYA 5ILVA 1KYZA 2RDPA 2O20A 2MYUA 1FZPB 1AB5A 4HYEA 5CVUA 3ELKA 5JR3A 4ZYEA 1RPJA 1DJMA 1F4KA 3SM9A 5IUJC 2JB9A 1J7KA 3UK0A 2A68F 3JAMK 3WTSC 1KRXA 3IPCA 4JQFA 5DD8A 2VT2A 2QWWA 3L2CA 2QLZA 3LQQA 3I71A 4I09A 4H3KB 2PLYA 3MA0A 4LK0F 1EHCA 2V79A 1BDIA 4MTDA 1SMTA 4OMZA 2PMCA 3H1FA 2VBYA 1WETA 1YO5C 2L17A 1S29A 4IF4A 4ZYLA 2JZYA 3R60A 3QU3A 2IA2A 2EFNA 4G7ZF 1MDMA 3DLBA 4HZFA 3T8RA 4FX4A 5IT9K 4CZZA 1E17A 4B09A 1OXKB 4HA8A 1ZH4A 1KA8A 3KEOA 3K9CA 5ILSA 5FGMA 4NQWA 4UVAA 2L18A 3K4HA 1TVMA 4RGUA 3BWGA 5DV5A 4RY9A 3T38A 4HW0A 5HKOA 2DLLA 1BI3A 5BMZA 3BREA 3ML6A 4ZPJA 1XB4A 4KIGA 3AAFA 2IJLA 2M1BA 3WODF 2XAFA 4G0QA 1B9NA 5D5WB 1QO0A 3QLUA 3F7NA 3QK7A 2PL9A 4IXAA 3C97A 4YRZA 4G94A 1Z2EA 4YP9A 2GQQA 3NBMA 2EV5A 5DLEA 4N47A 3I42A 4LG0A 4LB5A 1ODDA 2HYFA 4D74A 2WRZA 3BDDA 4RB1A 2EWNA 2JVIA 1RZRA 3RVLA 5TJJA 2ZO4A 2A3SA 3G3ZA 3IKVA 4MRMB 1DRJA 4YIFA 2JVJA 1WQ2A 1PNRA 4Z4HA 3WU1B 1Z7UA 3L9FA 3LOPA 1CHNA 1XWWA 1XHEA 4G0PA 3SZPA 1JBEA 6ABPA 3CG4A 3O1IC 1O3TA 1JL3A 4MLCA 4H60A 1IAWA 1U04A 2VOOA 4Q6BA 5KQGA 2ZXJA 3M9AA 2DW4A 3WGIA 3JTGA 4LE1A 2QENA 4MR8A 2FLWA 5ICGA 4XFKA 4MR9B 4M73A 4XAQA 4RB2C 2BGCA 3OMXA 1CF7B 2GI4A 4RU1A 1K68A 3KG2A 4M6XA 1DCMA 3UKJA 1TJYA 2EFWA 4KPYA 5JNTA 2Y75A 2DFIA 1FSPA 1R00A 5BOXA 4UHKA 3HEBA 4GCVA 4HAMA 5J8FA 3FDFA 1YIOA 5L3FA 1DPRA 4CYDA 1OKRA 4S05A 3QU6A 1UCRA 3FMRA 3RTRA 2ISZA 3OLYA 2MYPA 1ZG3A 2RJNA 3N8IA 3ROUA 1LEBA 1M5UA 1PUXA 1YMVA 1ZAOA 3EJWA 2FQ3A 4XSXF 4CXFA 2V9VA 4D6XA 1R1TA 1P4WA 1YW7A 1W9HA 2DQRA 2HKOA 2ESHA 2F5CA 3F8BA 3ZMDA 1NXPA 3K2ZA 2QYOA 1ZH2A 4MQEA 1DBWA 1JWLA 1DP4A 5IBQA 4I98B 3P9YA 3HSFA 2BV6A 2G9WA 2MSLA 4PDKA 4IRHA 5ED4A 3KSMA 2PUAA 1EV7A 1GHCA 3VB2A 4BHCA 4U0VA 1YK0A 1ON2A 4P96A 3H6GA 3TO7A 4GYGA 4YLEA 1BDHA 2ZNYA 1T98A 2PMUA 4G6QA 4NCAA 2PKXA 1S7OA 2RVCA 4AWXB 2RC4A 2GX6A 2KJBA 4L5IA 2EV6A 4KMFA 3MF4A 2FQXA 1U5TA 1TBXA 1ULYA 2ZJ2A 4BYYA 3I45A 1H9GA 1TM2A 2CSOA 3OLVA 1E2BA 1ZREA 3IWZA 3CTPA 2EFOA 2FN9A 4WWHA 5E8GA 1SXHA 3S2WA 3V7SA 1U6GA 5CNIA 3ZMZA 2BEOA 4MGEA 3HCWA 2TDXA 4IRXA 4JB2A 4KRFA 2CGPA 2M1ZA 4W5TA 2X7XA 3T5XA 3Q41A 2E4WA 1GXPA 4HNRA 5F6FA 2FE3A 3Q7TA 4OATA 4O1HA 1S6LA 2XAJA 3Q5FA 3F6VA 1IRGA 1J2XA 2DPUA 1U5TC 2WV0A 3WTZA 2E1CA 3DLHA 4FE4A 2VE8A 1FBUA 3BOQA 5D6EA 3CTAA 1HW5A 4MS1A 1BVHA 1XSXA 3KZYA 3Q7SA 3WTWC 4IPAA 2JPBA 3O3KA 3E5UA 5FFXA 3K0LA 1YW8A 5KC9A 3DP7A 5EEHA 2NT4A 1Z6TA 4RXMA 4LDZA 4GXOA 1IN6A 1NY5A 4G0MA 4WWCA 5FO5A 1BOAA 3OQOA 1XSDA 1ABFA 4Q47A 1SXIA
chains in the Genus database with same CATH superfamily
4QPDA 5B2EA 1EP9A 1GNVA 1BMFD 5CVJA 1BTOA 3UNGC 1KP2A 2E1OA 1ES9A 1Z37A 2HQRA 1FLAA 1NSTA 1U8YA 1WTAA 3GT3A 4GX0A 5AHRA 5JAPA 2I9KA 1R0KA 2IUTA 4JC0A 3X1ZA 3MFQA 1UDAA 1YV9A 2Q2WA 1VMAA 3L0YA 4BLPA 5AM2A 1KU3A 3MILA 3F0TA 5DUKA 2ILVA 3OZXA 3PFWO 1QGUB 1X38A 4IMRA 4KQ9A 1E9CA 1RJ9A 3EVNA 4LZJA 5DP1A 4NS4A 4ZZLA 3UK2A 5A62A 1VA5A 1J1UA 2NSDA 3IH3A 1N1DA 3HCPA 3EYIA 1T5IA 1YJNI 2BGRA 4CLDA 3L00A 1QWSA 4JITA 3SHVA 1MAWA 1N6PA 1VHWA 2A0FA 2DCUA 2WU8A 4RJJA 1I3NA 2NO6A 3WI7A 3WFZA 4F9GA 3HYCA 5CPBA 5J8CA 1ZXLA 1QMGA 2JWTA 2QPOA 2DT5A 2WB4A 3DJYA 3F47A 1C7FA 2PV7A 3QKWA 1UJ4A 5JS7A 4BUZA 2NS7A 5F76A 4D2IA 3RIHA 1J23A 1TM7E 2Q3EA 4F9TA 4Z6YA 2J31A 5HLIA 2QSJA 3UA4A 4F6LA 1Z26A 3RF7A 3RFUA 3S7TA 3GLKA 1OWNA 1UBHS 4PHGA 2Y4OA 2VI5A 3RANA 3EUAA 1FFWA 2BV3A 3TYXA 3NYQA 3NETA 4JLPA 4AY6A 1F9EA 3V1YA 3NXKA 3ANTA 2EG5A 3BBPA 3LOQA 4WUVA 4BX0A 1E6EA 1M0WA 3DZGA 3D9QX 5CJJA 4E07A 1SVKA 5AW1A 3L1KA 1T13A 1E2DA 1YDGA 3OZBA 4LMBA 3A28A 3BK7A 1Y5RA 3LCRA 3RUAA 1P4XA 1YG2A 3UOGA 3DMYA 4LA4A 2FGKA 3WL5A 4M83A 1HPLA 1LI4A 3HWWA 2QJRA 4RD4A 2XV4S 2K5CA 3ZQIA 4YH1A 1DV2A 2FBHA 2GCPA 3IV6A 4TPKA 1ABBA 1OIVA 2EP8A 3TNDA 4K8RB 3W4IA 3KNZA 2GZAA 2GZWA 3PL1A 4LYDA 5CAEA 1P7VA 2P5UA 4BVLA 4PV7A 5D5XB 3GZ4A 3PF8A 4IRUB 4GDMA 1OBFO 4NFSA 3S1AA 1SPBS 3K4MA 1UXKA 2XSDC 2G80A 2FSHA 3STWA 4DMRA 4JUAA 1RKWA 4MCJA 2AG6A 4G0ZA 2BY1A 4GG1A 4F1JA 3ZK7A 5KAIC 2TMDA 1YX5A 2QMHA 1YNOA 4P3OA 4OVKA 4R9NA 2A5FA 2YFHA 1RKBA 1I5EA 3ESYA 1JEQA 3ISJA 3L7JA 3S2EA 6ADHA 3KQVA 2R7NA 3S8MA 1WW2A 1L1QA 5TT1A 3HB9A 3C14C 1M1YA 3LUFA 5F0CA 2WWTA 2GBLA 4KN6A 4M6YA 4D5FA 2Q4BA 4K9SA 4L4UA 4R01A 2H92A 4V0MA 5A5DA 1IZZA 4JBIA 3WNQA 4Q4AB 4V0NA 1GLVA 2E4UA 2ZEJA 4D4KA 4ZVUA 4CL2A 1OBOA 1CKEA 5JNLA 2NX2A 4LSWA 1CF2O 1T2EA 2VOEA 3IUNA 1U1GA 4WSOA 1E92A 2K86A 1RVV1 2BT4A 1F12A 5HLGA 2J41A 1U6JA 1DG9A 5CLQA 3T1QA 3U9TA 4OF4A 3I58A 3JRDA 1BHO1 2ASVA 3A8TA 4A69C 2L2QA 2HGCA 1LKZA 2VZLA 4LYYA 4NYMR 4UHFA 4NXMB 1G38A 1FIUA 2W2PA 5AW0A 3A1TA 2OUMA 3PI6A 4DLZA 1PT5A 2IYWA 4J0FA 1VI0A 3QPTA 2P2YA 1FFGA 2R8OA 1V3TA 2P0EA 3NP9A 4M7OA 4MWCA 3GJSA 2PWZA 5TT0A 1VTNC 2FLKA 3RFTA 5K8JB 4B4KA 2YHAA 2XECA 1CLEA 3RYIA 4QG3A 2VEOA 2JCVA 1P75A 2HDOA 3DA8A 1HW2A 5AIPA 3QBDA 3IO5A 4DZRA 1H0RA 4DR5B 2J0QA 3R6LA 4BIIA 1HDGO 2W24A 2PZEA 1KKUA 3QELA 2I4NA 1LJ9A 3M0EA 1P39A 1VCMA 4YCAA 2FG6C 4NFYA 4NBNA 4AICA 3GQBA 5AKLA 1FQJA 3GMEA 3WLJA 2IYSA 2HWVA 3I9V2 5FTLA 1AZWA 3SLGA 4XA8A 2GPYA 3LTEA 2WHRA 2PL3A 3D5TA 5F9MA 3ET5A 2NYRA 2ZJBA 4MP6A 3MZ8A 2OXCA 4KK3A 3KYLA 1S72I 1F60A 1G4UR 4MI1A 4UD2A 2DCEA 1UDCA 1V7CA 3UWDA 2DECA 1TZCA 4YRVA 1DPFA 1KKMA 2ZS9A 3DULA 4JLKA 1UBNA 2DX7A 4PZUA 2BKUA 4QYXA 3U39A 4E03A 3U16A 1XT6A 3C41J 4FT8A 4QYWA 5E2BA 3WKAA 4A6XA 3ZMTA 2QVBA 2WZCA 1CFZA 1M33A 2CCKA 2GO7A 1IN4A 3C6KA 3PFNA 4OIFA 1X7XA 3NIFB 2IUSA 1KZ7B 2WP8J 4GP9A 1MIJA 1DRVA 1XRNA 4IDDA 4BY7J 2WKWA 4FDAA 3FFBA 4HQ6A 4KACA 4C6RA 4F04A 1YKGA 4CM9A 1ILWA 3OQBA 4LLGF 1JDVA 1WMBA 3PEUA 3RUFA 3ZWMA 4MS4B 5KNCH 4QEZA 2A9VA 3QXHA 4FZ5A 2ZFUA 4RGRA 3SC3A 4EPRA 2KIUA 2AYZA 2WY2D 2X5XA 1P2SA 1NXXA 2XYPA 1I4LD 3LRPA 4QFDA 3R7LA 4ARSA 1MIOB 4BX8A 3GTJJ 2DQ4A 3OZAA 1ORWA 4BHPA 3HUGB 4Y13A 1NMEA 4ZQEA 1KONA 1LDNA 1Z7BA 4QTUB 3EDYA 1F8UA 2WDPA 2YWRA 1B73A 3MINB 1I5OA 1ZK2A 4F7ZA 5LEJA 3QHQA 2H4XA 4X20B 1IDYA 2IHNA 4PQRA 3A4CA 4BATA 3DWFA 5GZ1A 2RKHA 1JLRA 2HRRA 3AT1A 5D7NA 5IKXA 1S7GA 2IH2A 3DAGA 4S1NA 3VU1A 3QX8A 1U98A 4U6NA 1LBHA 4LIVA 1WY7A 3GZNB 2G1AA 4R1OA 1TVKA 4WNIA 5CVVA 2JC3A 4AZSA 1E63A 3JX9A 5ED0A 1I32A 2ZXWH 2C78A 2O3TA 5ICMA 2XAUA 2IW5A 3GNQA 3HEAA 3MD9A 3ZHTA 4BV9A 2YS9A 2ZUBA 2Q6LA 3PFBA 2JJ1D 1L5OA 1FJLA 5HLHA 2JKZA 1E2IA 1Q5PA 2AN4A 3L4BC 2I3BA 2ZROA 3S2UA 1WW3A 1H65A 2W5UA 4Y6OA 2OBXA 2EZLA 3TW7A 1NVUQ 3TGNA 1J24A 3UIEA 2BIFA 4HN2A 2GM9A 3NXSA 4EKNB 3PO2J 2PMWB 3DEFA 5EQFA 1S2IA 4ZXFA 3N58A 1KDPA 5HDNA 2F3QA 2Z8XA 5HS9A 3OCCA 5FKJA 1T8UA 1OYWA 3PFGA 5CHEA 3KKEA 2IBTA 2HAEA 3WSTA 5H6QA 3F5FA 2PGLA 1LLQA 4ZEVA 2JFVA 2PKQP 1QPGA 1TX4B 2H27A 1T9ZA 1ZXXA 3DL2A 2GEUA 3AR3A 4ND3A 4XM2A 3CCUI 2BOVA 2VAWA 3FLMA 4AKTA 4P9FA 5CFLA 1FP6A 3LUJA 4DMUB 4AWXA 1A5ZA 1E3JA 2VUIB 2BHLA 1BSVA 3D2CA 3I04M 3TR0A 1DEXA 3VPFA 1YIAA 3FOAA 2NUBA 2XW6A 3NAMA 5IEJA 1E6CA 4UVBA 2VUHB 2XSJC 1ZHOA 1KIAA 1Z5PA 1RYFA 4PNZA 3RBAA 2OZKA 5HIMA 1SVUA 3Q0UA 2IQ5A 1RRGA 2P75A 2IAIA 1J0DA 1Z8NA 1XZEA 3C4JA 3JQRA 3Q6MA 4XR9A 1X9GA 1GA4A 3QU4A 1VQ7I 4IFTA 1DIOB 2I6UA 4Q02A 3MFKA 3FSEA 3QH4A 3QZUA 3RC7A 3WLFA 4DR4B 3DE1X 5U4XA 3ZU5A 1SVLA 2PGAA 5JSQA 3P7NA 3LK6A 4CUGA 1X7WA 4RCZA 1QE0A 1KAHA 2W6CX 1G291 5B6JA 3A6PC 3ETLA 1O95C 3NONA 5KQLA 1OCRH 1C29B 1W1WA 4BVHA 3BPSA 3BDAA 4ZYGA 5LGUA 4Y9SA 1NN3A 4KO3S 1XKXA 2CJWB 1XKLA 3AINA 3CRVA 3LC0A 4MUBA 1SHLA 4O4JF 4EKEA 2EZKA 2DA5A 4PG7A 4LK2A 5THQA 3ZHOA 1M1EB 3RW9A 3BG7A 3DFUA 2POQX 3KEQA 1APLC 1WIWA 3KTAB 2RHHA 4XRRA 3PIDA 2TMGA 1J21A 1XRMA 3CZMA 2AZXA 3RU9A 4H0EA 1DU4A 3FPLA 3U60B 3AI1A 3O31A 2JATA 2PRKA 3WWZA 1YYVA 4YK7A 2AE1A 3SDZA 2R79A 4BNWA 1D2EA 4H4DA 3W04A 4MQ6A 2ZR9A 3GR6A 1PWYE 3UB3A 4CLEA 4ECAA 1NVDA 5LL6P 1BU8A 3DVAA 1Z05A 1M2WA 1E4VA 4JWTA 4DVGA 2LDUA 1C7RA 1EJBA 5BPHA 3K69A 1JJVA 2O2XA 1L2TA 4OHUA 3EXHC 3RLIA 4X1KB 1GXSB 2F62A 4OMUA 2D7JA 1UOEA 2EBHX 1R8SA 2BTQB 4EJTA 1RWQA 2VYNA 3ORSA 4MUMA 4UCQA 3SZTA 4ARZA 3OT1A 1YB6A 3E1KA 4I4TB 1U1FA 5LB2A 4DPLA 3CCEI 1XU4A 1PW7A 2QMZA 4PX5A 4ESOA 1V1RA 1T6SA 2F1OA 3D6FA 1UBGA 4XLCA 1V37A 2CFOA 4GVPA 3O74A 2V9ZA 4ZOBA 1VLQA 2HLNA 3V9PA 1I1HA 1T1IA 2C5LA 2DR3A 4COOA 4Z9AA 3H1TA 4ND2A 1SD7A 2Y0PA 2WA0A 1ZH6A 3IV9A 2K87A 4TYQA 1ORHA 5LRRA 3M5CA 4ESJA 1QYIA 2W2VA 1VLJA 4CNBA 4YMUA 3MJCA 1QQBA 3EHDA 2J67A 4W5JA 3KS9A 3S44A 1JWBB 2JVHA 3JYLA 4ENNA 2D8AA 5TGZA 1QVZA 1H2AS 1WZNA 2NT3A 2VDVE 3DBLA 1T8TA 4AG5A 3ZGKA 1AKRA 1V9LA 3SGLA 3TFWA 3FJOA 4LQCA 1P33A 3I4CA 4JC4A 1E3SA 3GEEA 4V24A 4XWAA 4W1UA 1H1LA 1HQDA 2OCCH 2ZBFA 1TLHB 4EJUA 4L9WA 4ARZB 4O2LA 1IM2A 3K70C 3PNOA 1JE8A 5JXIA 3KP6A 2CV1A 1DKQA 2HLDD 2PYZA 3MGBA 1BQ3A 4FYYA 3AU8A 3A05A 3PSIA 2FB9A 1AZSC 1PR3A 1HE8B 4MUJA 1GWNA 3PQCA 2XGCA 5EP1A 4WVFA 3DU5A 2ELKA 4YRRA 3WK6A 5AIQA 1E0DA 2QDXA 2C2BA 1R74A 3H5WA 1D2AA 1JQJC 5DN9A 2AFHE 4ZO6A 4DQVA 2A5LA 2I6GA 1ZOOA 4U6QA 2O03A 3HNRA 3LP5A 1M2HA 1XELA 4U7HA 4JFRA 2XSZA 4DOMA 1JH9A 1UC9A 2OFPA 4NNPA 4EHIA 3TQSA 4ZU1X 3OJ0A 4RVGA 1D1TA 2FPWA 3WHBA 1OTXA 2K2WA 3IAEA 3O21A 2E36A 5JHFA 1EB8A 3IAUA 3RKRA 3FH0A 2E6UX 3LGAA 1Q91A 1K7XB 4O33A 2EGUA 1Z8HA 2ZJOA 2J5OA 5J4VA 4WZ6A 1TQIA 1Q12A 3OY2A 3S1AB 1QG4A 2ZNZA 1KI7A 1T5OA 3QPDA 4ZTBA 5K1ZA 1II9A 4BKUA 3V4SA 3U7FB 4Z4IA 4O2AA 1YVUA 3HNPA 4A5MA 2BF7A 3DVLA 3GJ3A 2BN4A 4QQRA 1U3WA 3FPEA 4CGYA 1YOVA 4CCYB 3H8SA 1MH9A 3B2NA 4TVSA 2ZK7A 1WVMA 2Z09A 1XMOB 1P7PA 2FSUA 5KNDA 3BBLA 1KKLA 2RV8A 1XHLA 5BNGA 2ERYA 1K4YA 2QLJA 2Y05A 3DGFC 4JP2A 1LX7A 2GHIA 3TVDA 4FT2A 3VPRA 3R3ZA 4KEAA 4MUGA 5A7HA 2XRMA 2PAFA 1IN1A 2L02A 1PK8A 5TQ2A 3F9CA 3RZOJ 5LDGA 2QHXA 1UPXA 4ZCTA 5L4LA 4K6MA 4NDZA 1BC7C 1X2NA 3TI7A 2R8PA 2FV8A 1BH6A 3LUDA 2DT8A 1QHGA 3D3KA 3T5TA 5H4HA 1P31A 3STHA 3U7JA 3VC2A 4AP9A 2O8CB 2COBA 1GFSA 2HF9A 2C61A 1YHNA 2L9VA 2IIPA 1W96A 5KWJA 3IOYA 5ALTA 1GZDA 3TXAA 3LCJA 2ZCWA 3GGPA 4MRVA 4KX3A 3HTSB 1U28A 4BBZA 1NR5A 2IPLA 4RV9A 5LP1A 1C7JA 1R9NA 4MDYA 4OFWA 5A1JA 1PR5A 1ZIOA 2HC9A 2LP4Y 5FA8A 3DXZA 1EJ6A 1C1DA 1A9OA 2PPLA 4G5SA 1WL8A 4H2DA 4GMXA 1IV6A 3G88A 2CQNA 4G5OA 4WUTA 3EQLF 1W47A 1DDNA 4HLQB 1XK7A 2P9GA 3RKYA 2GN1A 2Q0QA 3ELDA 4GKAA 2JH9A 3ES9A 3I0NA 2G36A 4TV7A 1T36A 3ZHCA 1KMIY 4YJFB 2WI8A 4BP3A 1H5UA 4W7IA 3OWOA 4W1SA 1AUVA 1GQYA 1D1AA 4AJLA 5IKPA 4G1MB 2VQFB 4WJKB 3AVXA 2QZ8A 1JG3A 1PVOA 5IOZA 3I73A 2E5FA 1ZCAA 1GA1A 3NDRA 4ERNA 5BWLA 2DK8A 4XR4A 5F9FA 1V43A 1ZRNA 1PDNC 4N0QA 4B6FA 4Z3OA 3H2JA 3VDQA 2I22A 3D7NA 5KK1A 3GJTA 5AUNB 1FC0A 1SHZA 1U0HC 3MGKA 3QWFA 4RORA 1JFTA 5EJFA 2JMWA 1V8FA 1M8FA 1Z4NA 3LMMA 2ZJRF 4QM6A 4DNFA 3AVTA 1JHMA 4GIBA 5FCDA 3VPSA 3EZNA 4I1YA 2NM0A 5FWNA 5IOYA 5EXPA 2DKNA 2WAOA 1OX6A 2OA4A 1CE8A 1W5EA 2D2VA 2PIAA 4C6TA 1CP2A 4JEHA 2R2AA 4A8JA 1XDZA 3E6CC 1VLVA 1XN1A 2ADMA 4MO9A 2ZAGA 4WXCA 3PD7A 3C98A 2HU7A 4IJMA 4G86A 3S17J 3L06A 3RJ9A 3SSOA 2E48A 3GVAA 1A1VA 3IXQA 4IGEA 1OFUA 2NNWB 4KZPA 2BKVA 3UGTA 3HB4X 1UH5A 3RO7A 2QG9A 2PUHA 3DE0X 4HF7A 4NU0A 5D7BA 5EGOB 2R48A 3WS7A 3IVGA 4UDXX 3LC2O 4BVGA 3BMNB 3I0MA 4KC0A 5FTKA 4LTNA 2ZAMA 2LRDA 2Z30A 4FK8A 4OM7A 2IXGA 2W84A 1JQEA 2DFHA 2FCRA 2NYAA 2QP4A 3H1PA 5CNJA 5AKKA 4KA4A 1KA9H 1AA7A 1MA0A 2RG7A 1OMOA 2Z5FA 1QZXA 4I6EA 4O2BF 1HFJA 4PR0A 1LV8A 3PS9A 1A69A 4E33A 3REGA 2FWJA 4KRXA 1D5YA 2ID9A 3RASA 5L3QB 3IQHX 1IL0A 1XX5A 2PX5A 3PR2B 2JFXA 4D0PA 1N5OX 2G9RA 4RSGA 2ZRPA 1RJEA 3SFTA 5CUQA 3PEYA 2A6EF 4QDZA 3PR3A 4V0KA 3WXMA 3ADCA 4MARA 5MFPA 1UB9A 2MW8A 1PP8F 3TDKA 3R3WA 4YJHB 2B9SA 4F1KA 1C4WA 2F8MA 1XN7A 2Z33A 1Z0FA 5CP8A 4JI6B 1ABEA 1O4XA 3CHYA 1U6KA 3U1DA 2K27A 1YT5A 1YDWA 2L5QA 5DHPA 5DM1A 2M7AA 3PHBE 1G3IA 1YQXA 4RLQA 2HFHA 1PYOA 2UAGA 2X22A 4YIIA 1EQAA 3SLKA 2FEZA 5CB0A 1TC3C 3G59A 3M82A 2EF0A 3MJSA 5EFOA 3BZCA 3OS2A 3OO0A 4I3HA 1R9JA 1VQ1A 4B6OA 4LFUA 4YRPA 2CYAA 2OZEA 3NI2A 3F78A 5F12A 3BY6A 1N6LA 1QVRA 3U4MA 4RLFA 2DFTA 1HZJA 5E1BA 1JMKC 3UT5B 2BGMA 3NYIA 2X15A 4NPAA 2SHKA 2NZXA 5C4MA 4LZNA 4IH9A 4ZH4F 4HDVA 5B3KA 2ZPAA 3O7MA 3PPIA 3H04A 4ZO4A 4C03A 1DJQA 5FBQB 1YZYA 4J49A 3HABA 2ZU0C 2W71A 1UBCA 3X43A 1I7SB 2P4SA 3WXBA 3OIPA 1ECLA 3KB6A 4BIMA 1U0SY 4PHCA 1GKIA 3ZKAA 1V25A 3I53A 2GRUA 2KQRA 4JIGA 4EGSA 4Z4EA 3NJRA 2LYCA 2NU6B 2XH8A 3EQ7A 5FTNA 1J8FA 3BSSA 4LYGA 2ZVJA 5CMLA 4GFDA 3V42A 3MEXA 3ACDA 3GRKA 4N65A 2FQYA 1FMVA 1A8SA 2JLBA 4DQUA 1FLVA 5JARA 4MQBA 3X0DA 5JXGA 5HKKA 1JHRA 5A05A 3C18A 4EP1A 3BH7A 3EVGA 4G9GA 4E7JA 3BJZA 4HX4A 3F3KA 3PITA 4GPZA 1QAMA 5C5IA 2VJNA 2ZSHA 3DDUA 1EUQA 2YN4A 3PC8C 3VV3A 4ETMA 1YQQA 5KJEA 5BR8B 3G1OA 1E5QA 4FEYA 3AR6A 3QFTA 3HMKA 4JJFA 2EIJH 4C7VA 5BQTA 4FTWA 4MPDA 4ARIA 3LMKA 4NP6A 1KI6B 2WYIA 4P0PB 3HE3A 1G1MA 3SIPA 1ZWLA 3WBKA 3ERCA 2RK6A 4JR1A 2PCJA 5CT9A 5H9WA 2A9RA 3W8RA 5CIYA 3I54A 3RFCA 1ODKA 1QH1B 3S1NJ 2M4GA 3OLZA 1D8JA 2W8BA 3MT8A 4MKZA 4BP1A 1DP3A 3EC7A 3JZMA 5SY9A 2DPYA 3P9KA 3EQZA 3DT8A 1P2TA 1JYFA 1UDBA 2HK9A 4QJBA 1BJAA 1JW9B 1VYUA 4RY8A 4BYGA 3FGPA 4PJMA 2VDWB 4I55F 1X70A 3WE3A 1DIAA 5INTA 2C5GA 1I36A 3I9OA 5BSKA 2PSSA 2BE9A 2QP9X 1JDNA 2QPLA 5AW4A 3M34A 3CH7A 5TC4A 1OFTA 5DW3A 1RI5A 1IFXA 3ZRGA 3IBFA 1IK6A 5IDYA 1Q0HA 2VJQA 4OYHA 2ZFWA 2QY6A 2XCTB 2ISCA 4C7BA 2XUOA 1G21A 2C5FA 1EFKA 1GTG1 2C5AA 3OT4A 2O5VA 4ZRNA 2WWGA 5BN3B 2ZDQA 3EGXB 4HQOA 4NONA 3LHIA 4QJ4A 1OV4A 1VBMA 3E0JB 1ZD2P 2XGEA 4YUZA 3N2NA 2E4AA 3QLUC 1ZUHA 2VONA 3K4BA 4AC0A 4P7JA 1QP4A 1S1CA 3CC8A 4PN3A 1ZVVA 2NO4A 4IMPA 3LWFA 1TCCA 2ZIXB 2ZYHA 3AL3A 4GI3A 4H0NA 4WBXC 4DBRA 2X4GA 4ZCSA 4FOPA 3ZWBA 4DCJA 1UEXC 2ZSBA 4EBFA 2CMGA 2CGEA 1F2VA 3NBUA 2H2WA 4E7OA 3F0CA 5DHRA 2HNHA 1NRXA 1Q1GA 1Y6RA 3IBCA 3UH0A 4DIKA 3A36A 2NVUA 3OOEA 3Q2KA 2VXZA 2JAQA 3EFEA 2ZWVA 3NAUA 4D0NA 2Q3JA 1G20B 1F14A 3DB2A 2HS5A 4EGYA 2E7XA 2QMUA 1FPQA 1RQ7A 3QVTA 3V00A 3VZQA 9ATCA 1EBUA 4H1VA 2UYQA 6PAXA 5K7FA 1RTTA 2XE6A 3D8SA 4P31A 2P7CB 1Y6IA 2BTOA 4W5WA 4E3ZA 1XTZA 1Y34E 1T4CB 2ATVA 2G5TA 4BLOA 2ZJ8A 3K70D 3BHIA 3SYKA 1KI3A 3ZZUA 3A0RB 4ZOAA 2ZRMA 4N8EA 4RVNA 1RC1A 3BTCA 1QTNA 2CNBA 4FFBB 9MHTA 5DHQA 1H23A 5F7OA 1P45A 5LN1A 3FCYA 3FBNB 4MV9A 5CIQA 3CP2A 1QVVA 4MCHA 2GSWA 4UB8C 1E5LA 2XTNA 4LUCA 4R1LA 4EVSA 4W5NA 4Y2RA 4XD7D 3UK6A 2P35A 4Q4CA 3I83A 3HYIA 1MNAA 4HNAB 4OI1A 2ECPA 2QLBA 5HUJA 3N05A 3FWPA 3MJHA 2XNJA 2WBMA 4LJAA 4MPPA 2IU3A 1TF5A 3N0VA 4TZKA 3WJ7A 1T1JA 2ODWA 3RWOA 1NUSA 2YC4C 3PFIA 4F06A 4J3JA 4CW7A 1BR2A 1EFTA 3AEKA 4MW5A 3UO8B 2EINH 3AFOA 3U6KA 2CZCA 1ANKA 2AFHB 3Q8XB 4G5QA 1K7SN 2ZT5A 2C03A 3MTGA 2H9AA 4HB4A 3D02A 4LRSB 4MIEA 4PQGA 2PD6A 3LE8A 4FETA 3P4UA 2IYZA 3F9IA 1WHTA 1GRCA 1BWQA 1I4TD 3K4QA 5IANA 4U4AA 3OTOB 2YY6A 3DBHB 2FPXA 2LGJA 1X1BA 1R0ZA 1QM5A 2BFMA 3LF2A 5IULC 3LYLA 3I64A 1CVRA 3JQAB 4BRZA 1J5PA 3RCOA 3MWMA 1M2VA 5C8VA 1KDTA 2CFTA 2UUOA 4JROA 5M5WJ 3D31A 4L95C 5FYQA 2HIHA 3ZI0A 2UVQA 3JR9A 2A1IA 3C3AA 4LDAA 2VAVA 5CLGA 5BPDA 4C5CA 1L4NA 2ZVQX 3CPJB 2XTAA 3H2KA 3MCWA 4YN3A 3E5NA 4LF7B 2UUZA 2GEJA 1P9QC 3ORQA 2HOEA 2GEDA 3WGGA 4LKOA 4BNNA 2F2EA 1RBZA 4GX2A 4X65B 1Q3HA 1FSFA 6CHYA 3KQUA 3QTBA 1P72A 2PTGA 1T2VA 3L79A 2I7CA 5AKXA 3OTHA 3JARA 3THYA 4DHEA 2E4YA 4C0HA 2XUIA 3HIFA 1DUVG 2DODA 1M7BA 1XWFA 5DGHA 2V1DA 4UVGA 4GVXA 2FXIA 4ZREA 5BR4A 4NLLA 4RAYA 1FFSA 1KNQA 1G8KA 1TZBA 3L0PA 3V8JA 1QDUA 2RHTA 3P2EA 3TD9A 2IHTA 1NUPA 2OWEA 4FSXA 4LMRA 4X8OA 3OE4A 1ZRMA 5L3CA 2IS2A 4CGZA 3NKVA 2JK0A 1CQWA 3A1EA 3EMBA 2E2WA 3SR0A 4ALLA 4F46A 1JFSA 1BIAA 4N03A 2JLQA 2Q3LA 4F7WA 4KMSA 2VSOA 3VYUB 3NHKA 3PPYA 4QQNA 3LSPA 1MT3A 2PJUA 2Z95A 4HGPA 4G9EA 3GRPA 2K9LA 5CR9A 4XJTA 2QF7A 3QWHA 4WLVA 2PUFA 2XODA 1K27A 2KW5A 1J4AA 1VCOA 3EQ2A 4ASNA 3CISA 3M1IA 1KVRA 2G1KA 3DHEA 5BYBA 5KDOA 1DCKA 4GL2A 1T1SA 3GRRA 2YQ4A 1ISJA 1R1DA 4EB8A 3FNQA 5AH0A 3RU2A 3JYPA 2B20A 5FEUA 1SD2A 4G1UC 4DNXA 1RLTA 5D86A 2Y66A 5BVGA 5KDLA 2FMTA 4A0ZA 3E3NA 3H9UA 1EI9A 2M2EA 1TLFA 1YR6A 4X97A 3K09A 1TAGA 4ZZIA 3K71B 2NVXJ 1R9TJ 4HLDA 4LHSA 4RW0A 1EFPB 4U0WA 5C9ZA 3IHWA 4JP8A 3FRIA 5EXSA 1J59A 4KI7A 1PNOA 2W4IA 3UKDA 4V1CB 1FBSA 1UMCB 2BI7A 4WXEA 5EYPA 4FFBA 1F2UB 2WTNA 3G8YA 1LI5A 5IMBA 3TLJA 1E1KA 2XIGA 4XR6A 1QLWA 3HQ4O 3GHHA 4AROA 5TSDA 4BNLA 4UQOA 2DHEA 1Y9AA 3COYA 2Z3YA 1MBKA 1U1IA 2A86A 2YVUA 1OPRA 2QL5A 1YD7A 4MHGA 5JVTA 2O0KA 2YWGA 3EDOA 3NM4A 3SSAA 1E9FA 1XTIA 2HSEA 4GXTA 2DDAA 5BUZA 4GNRA 4K8OA 4I2VA 5D3ZA 5IK2D 1N2JA 4NCXA 2KMLA 5KINB 3WB9A 1HC8A 1XXHB 2JLSA 3BXHA 5L45A 2OU2A 3HTUA 1KQ9A 2CU7A 1KP3A 1XVVA 2AUTA 3F6RA 3L0DA 3X2SA 1L7NA 4F5ZA 5JDCC 1PNTA 5LDHA 3TZCA 1PR9A 2HU5A 4YO7A 2Q8KA 3QPWA 4GMDA 1YCFA 4J3FA 3R7NA 4FZJA 1KH2A 4JBLA 2FJ1A 4RUKA 2P5KA 4TTVA 4JB0A 4PZAA 5ESRA 4B4UA 4RX1A 2XKPA 3EEIA 1RZUA 2Y0SN 3PYXA 4HGOA 1HDCA 2C2OA 3KYIB 2OLEA 3EGEA 3WL7A 3O92A 4C0AC 2QIOA 3L49A 4HX2A 2DYRH 4Q4ZF 2BGUA 3Q7QA 4LMYA 4GC5A 1USGA 1Q0RA 1GPUA 5G40A 1T34A 4F3TA 1VMDA 5U1PA 4CA0A 4DA6A 5C32A 1E66A 2DU8A 2Y9MB 4P22A 3UAWA 4BTEA 4E94A 1R71A 1STZA 5FV4A 2JCBA 2ZWAA 4C7XA 1P3DA 2PKRA 4P4SA 5KAPA 1JUMA 3CUOA 1EZ4A 1UBUS 2FF7A 1JKPC 2WT9A 3COVA 3ZDZB 1DUIA 2ICAA 5HRAA 2W90A 2PX6A 3G0BA 3WYAA 3QYBA 4D7MA 3D6NB 1R5NA 2NVWA 3ZLTA 4A23A 1ZVMA 1QG0A 4C04A 3T06B 4NPHA 4BWGA 2R65A 5B30A 1RYNA 3T5CA 4DQ2A 2C7GA 1JNYA 2E4ZA 3WGKA 3U5TA 2B8TA 3PHCA 2IS4A 2Y0EA 4X20A 2F3RA 2KPOA 1EVEA 2R66A 3GT4A 3VKHA 3V4FA 5A2QK 2CLMB 3IX7A 4G65A 1HMYA 3MWFA 4NC8A 1DL5A 4UUNA 5B1IA 2FLVA 1T4GA 3GW8A 2QX6A 1A7KA 4HWOA 4L3VA 4A15A 2V58A 1A6IA 4LK1F 2AMVA 3D4LA 4G5RA 4HJXA 4YAJA 3F8NA 4C0KA 3DGEC 2XMQA 3P2MA 2LCFA 3HRUA 5PNTA 2I67A 2UZIR 3WGNA 2DFEA 2X14A 3CUEF 1AQUA 1U4OA 1ZNXA 5JWOA 1A8UA 3T9FA 3ZKWA 5DTEA 5CH5A 4GS5A 4E32A 1FY7A 3FZQA 1W19A 2BVMA 5LKAA 4IVRA 1FRQA 1DE0A 1FA9A 1L8OA 3URMA 3VOSA 1P91A 1X74A 2K2QB 1KQ8A 2R8YA 4EB0A 1NN1A 1IXKA 5KYYB 1WM1A 1C1HA 5ILQA 3FPBA 1T8IA 2FDCA 1I80A 3O75A 4DYDA 1UANA 3QXXA 1RYEA 4DXAA 2R8RA 2FUCA 3DYBA 2XB9A 4KPEC 2MH2A 3JQBA 3HL4A 1HDOA 1YXMA 3RPUA 2B1JA 2BEKA 2IYYA 1MF7A 2FHPA 2XCOA 4UDNA 3W6OA 2EU8A 3CFYA 4ZOLB 3O6BB 1JU4A 4R7GA 3TX6A 3CVUA 1GCOA 4PIMA 1FYEA 3PC2A 4YRGA 4ZA2A 1KR2A 2X40A 2AB0A 1NMQA 2FKNA 4NMXB 1BHQ1 4PFKA 4DPKA 1R0SA 3JAMA 1X7WB 3V6MA 2LY2A 1IEVA 4EJ0A 2O5CA 3OIOA 2HBZA 3OYKA 2PH5A 3A2KA 2W2KB 2ZWIA 3IUMA 3OCUA 2D6FA 1QKIA 3ZE7A 2R1TB 3UQYS 4C0QC 3ZWWA 3SG0A 4HGQA 3OZCA 1P60A 1RLIA 4C89A 3QXCA 1NUAA 3OIWA 2XRNA 5KNCD 1BA3A 4YCCA 4RENA 2DN0A 2C1XA 2KL4A 1UJ5A 2OCAA 4IZIA 1XDDA 3FY4A 3J7TA 2ATXA 4ZN6A 1JHAA 2GZRA 4BRWA 1ACLA 4REQB 5HJEA 1CJSA 1JAXA 1HUQA 1QCYA 3FUXA 2W57A 1RBQA 2COKA 4FYJA 2V54A 3GH1A 2ZUCA 3E2MA 4EJMA 2RCNA 1RRFA 1UAYA 4GE0A 5EPUA 2C04A 2FRVA 2EA4A 4PCAA 3ZBUA 5KWVA 2HMUA 2H6BA 4RCVA 5HS6A 3RKUA 3KB2A 2K85A 1QMPA 1ITYA 3FXUA 1A9XA 2VJIA 3RRXA 3UGKA 3OOSA 2GZ2A 3SVZA 5LU9A 1ODCA 2GCOA 3TS1A 2VPPA 1WCV1 2M30A 1T5HX 5H0IA 4LW8A 1LSUA 5K3OA 3T1YB 1ICEA 2FHSA 5I5EA 1U0JA 3II6X 1CUWA 4UBNA 3UAVA 1LBTA 3IJEB 4HDMA 1T2CA 2NSJA 3AESA 4HB3A 4MXDA 4GR5A 2HVQA 4EUSA 3F7MA 1GCUA 3RRFA 2VKEA 1V26A 4MQEB 5KNBH 2OBPA 3Q3IA 1YFKA 1ESDA 4H1UA 2NAZA 1NUUA 3R9XA 2C42A 4XLTA 3BR2A 4M87A 2I1QA 2Q62A 3Q7PA 2O1XA 4C3OB 1SXQA 3ZW8A 3ZD8A 4YJFA 1ZZEA 1GTJ1 3ILVA 1RM3A 1JDUA 4JI8B 2N1MA 1MPXA 2HT1A 2RONA 2JGMA 4MS3A 3H2SA 5H59A 1LKXA 5IH7A 4ZU6X 3QU2A 3KYCA 4OUKX 1B4DA 4TMYA 2GFHA 2RH8A 3KSRA 3P19A 4CIDA 4F8JA 4YRDA 1V95A 3AWIA 1HQKA 1NIPA 1ZNWA 1O2DA 4UM5A 5LLDA 3HCEA 2CVHA 3ASUA 4LLLA 4N3NA 3R5FA 3U49A 2O59A 3PFYA 3LA7A 4LDQA 3RU7A 1BE6A 4NRDA 1VTKA 2OHHA 3QHAA 1A97A 1YKSA 2ZYIA 1OCPA 1W0KD 4IGAA 2H63A 1XMXA 3T8YA 2VOPA 1R0XA 1KNXA 3K6GA 5F1JA 3OAAA 1L1FA 1NOKA 3ZI4A 1JNXX 1NBIA 4K28A 3D4IA 3ZS9A 2B3TA 1L7AA 1RQRA 2C4TA 2RGUA 3K0BA 5ALZA 3TZLA 4ND8B 3KIOA 1G3RA 2LDBA 2QUZA 3JQ6A 3FXKA 4RPGA 1UFQA 3FYCA 4KG7A 4TL6A 1Q1BA 3AZPA 1ZEJA 3DOCA 3DTVD 1E4OA 2V7TA 3PEFA 4WHMA 1S7CA 5D3MB 3TD6A 5K45A 5CD1A 4QU9A 1AS3A 2X9DA 1Y1LA 4UFPA 3PUJA 1A72A 1EK5A 1Q2XA 3OTWA 1ZG5A 2L42A 2VHVA 3DF9A 4G5HA 1VFNA 5F9HA 5CVRA 1GFZA 4BFUA 4NOJA 2W43A 3O2NA 4I5GA 2MCFA 4KTVE 4HZIA 1M2VB 3AI3A 1GL9B 1QJCA 3KD2A 4N40A 4N5LA 4I0WB 1UMDB 2WEKA 4A8TA 1KHHA 1KQ0A 3PIOF 2X8WA 1NDUA 2KDOA 1S7EA 1P2FA 2BXYA 5FJIA 3SIRA 1VQLI 2X6RA 3MBKA 4HUQB 3VGPA 3FTEA 4PSXA 1G0NA 3RKWA 4RJTA 1PYGA 1WSAA 5M2QA 5ALYA 3KKKA 2JLYA 3D7MA 1ZSNA 4P1WA 4MRRA 3DCYA 3MSXA 4AWBA 4B5LA 3BP8A 1H2HA 1FU8A 1L0OC 1SFUA 2WJZB 3GVXA 4BJ6A 1QZ3A 1DFGA 4TMZA 3S2IA 3VKFA 4MDFA 3L1VA 1IZYA 2C58A 4JAVC 4NR0A 1RRJA 4JASB 4OHRA 3BXXA 4Q1VA 1NU6A 2VSXA 2AOTB 5GPBA 3T5BA 1OX5A 2BRUA 1B74A 3MVEA 5CX1B 2FI1A 3ABUA 1F3LA 4R16A 1NA5A 2FOIA 1IY0A 3M6UA 3BCSA 3Q7IA 3I4MJ 4H17A 4QYIA 4RKEA 4EW6A 4DXHA 1HKSA 4FMCF 3ONVA 5IP9J 4JSYA 3TH5A 2ENWA 2O48X 4U8GA 1BVUA 1H3FA 3KCNA 4IEIA 5J1SB 3FVTA 4EHNA 1RDFA 3MHTA 4MQFA 4R2MA 1JG6A 2DLCX 1RR8C 2Z5UA 1Z83A 3C39A 3I1FA 3K5HA 3VNBA 1CX9B 4CDGA 3K4NA 3OM0A 4G84A 2R4TA 5LC1A 4N5DA 1SC7A 2CCJA 3FZYA 4MKHA 4FB4A 1IBLB 2V6GA 3CPHA 3H3ZA 4BBJA 4DIOA 2EIMH 2OCDA 1COZA 1W5FA 4QICA 1JGSA 3PGVA 4BLUA 2HTJA 2VB6A 1ZR4A 1Y9ZA 3M5PA 1YVPA 3K7AJ 2HDWA 4ZCPA 4HGRA 4WA8A 5BYJA 3EAFA 4EKYA 2QRVA 3GPIA 4XYLA 2QSFX 3B48A 5DRTA 4MSUA 2J9FB 3GVHA 1MMFB 5ENVA 2C3MA 3U7RA 4DSZA 3HXLA 4Y0AA 1C4OA 3N76A 4JYZA 1KBZA 4XZ3A 4E7HA 3VR4A 1VJ5A 3P9ZA 2JFNA 2EBWA 4WGFA 3RV4A 3S3MA 3UFXB 4K2HA 4QGAA 4P5OA 2RAEA 1WCMJ 1YRNB 2PD3A 3AI7A 3RREA 4EH1A 2NOJB 1QGUA 1GRRA 1BJTA 4AG3A 1VQOI 3C6QA 1N77A 1YCGA 3R3YA 5ER6A 5GONB 2DI3A 2Q2OA 3ELYA 3LTNC 1YONA 2I54A 4UBMA 1RPTA 5K4HA 5CYVA 2PUDA 1X6VA 2M6KA 3AF6A 4URFA 3RS0A 2PZAA 1H6AA 3IVCA 3T1TA 1XQXA 2J85A 3QIAA 4XIIA 5EVJA 2BHZA 1QNFA 1G55A 2E1RA 3GFGA 2VHTA 3X2EA 4B3SB 1XRPA 1WZEA 2Z2KA 2WTXA 2JGEA 5G0UA 3BEDA 1OBCA 2R25B 2JTVA 2AXPA 1IUPA 2ARKA 2W0SA 3HVUA 3I5AA 4FQ5A 1AK9A 4IIJB 2PDAA 3HLKA 1R0YA 1U7WA 2VDWA 2APJA 4IOMA 3V1LA 1Z4PX 4EFMA 5FL3A 2FWBA 4PJJA 1E5TA 5E9WA 1CLUA 2YXDA 3ZDQA 3NDBB 3OBBA 1VKOA 3MG9A 4Q0MA 4CMEA 4DDWA 3CN9A 2CLLB 3D6HA 4X84A 2P2SA 1VE7A 3H2BA 3WGUA 4DG5A 2DFFA 2JARA 3B1FA 3M6XA 3OMYA 2IIBA 4J16C 4M1EA 5I9MA 3SDSA 4YUXA 4CKZA 3SM3A 2W00A 9LDBA 4UVDA 2AX3A 2ZE5A 4TKUB 2IZ0A 4UZFA 4ZMBA 1QR2A 3ZQUA 4BUJA 2WYWA 1J49A 4RGXA 1IN7A 3IMKA 1OYOA 1S01A 3C4QA 4PLYA 2LRHA 2H1SA 3FNHA 4FNOA 1XRJA 4LSZA 4JBWA 1L7VC 1AU9A 1H5NA 2IDMA 4PIVA 4F1WA 4JWKA 2XCQA 1DRUA 2WNIA 2VZ8A 3KDSE 2A94A 3FTFA 1BCSB 1XRRA 1KAOA 2LR8A 1U2EA 2WWXA 4HFRA 3BA6A 1KDYA 3ADOA 2JA7J 4HNHA 3WHLA 3ZQ6A 1EHYA 5K6AC 5JSZB 1B2LA 3IE2A 3YASA 4UUVA 3H1CA 4CH7A 1V7PC 1DPUA 4F71A 4EM6A 2O8BB 2NVTJ 1QNTA 3ENKA 3D4OA 3LXRA 3CLTD 4J0GA 5F4BA 3R0XA 2ONZA 5LOVF 1HDXA 2J7KA 1CUAA 1KJYA 2EZHA 1N0HA 3BA1A 3ZPXA 1WV0A 4EUFA 1S4MA 1K5PA 3KZXA 1MMGA 4P32A 2ZWOA 5EL0A 5HM8A 1RZ4A 2J33A 5LMUB 3BIXA 1WUTA 4L1KA 1OA1A 3N8DA 1YB7A 4RWEA 4YFNF 3HUTA 2NNYA 1GQRA 1AOYA 1E79A 3LNQA 4HAWA 4IINA 3A1CA 4JODA 3S3NA 3CVJA 1GQSA 3V4VB 1IJFA 4KV7A 4FFDA 5F0FA 1P0PA 2G17A 2W82A 3VU3A 3W0LB 2QLTA 4XQ0A 1NW3A 3EZFA 1UBFA 4UAJA 1IUKA 3KHSA 3EZ2A 3OH8A 3QXSA 2WWHA 1C0PA 3WMGA 3FBWA 1Q14A 4INOA 1DAEA 4QO7A 5T7BA 1W25A 1KO1A 2IYUA 3THOA 4TYYA 4DIUA 1KH3A 3GJ0A 2I4IA 2H17A 3IT2A 4V19K 1PEKE 2JAPA 3QF4B 3QPAA 5FPKA 5JCPA 1U63A 2R2GA 3R5XA 3OKAA 1YE9A 2WFLA 4R69A 2B2CA 4AAYA 3CR7A 3KSAC 3K1MA 2QN6A 1DIGA 3FR8A 1D7OA 3G5MA 1EWRA 3LO8A 1B0ZA 4G7OF 1Y81A 2WYHA 2ZJQF 1HE3A 1JR3A 2ZUWA 1WV1A 3JYQA 4N6GA 4R7ZA 5JVDB 4DA7A 4DMCA 4HT3B 1A2QA 1E2KA 4P92A 2QT0A 3O6VA 1E7RA 4IUDS 4B80A 2R7OA 1L4YA 1SKAA 5FPSA 3MMSA 1YB5A 2EZTA 4RZ2A 3G0OA 3MLAA 2TRSB 4EYKA 2FFAA 3EA5A 4D3ZA 5KPDA 1NMYA 1XQ9A 2XTZA 2B21A 3C2QA 2ECFA 3DVSX 3OPVA 5E4FA 1ZUNB 2EHDA 2Q27A 3GMIA 1DRWA 4BJ1A 4WF2A 4EY4A 1ZARA 3FUWA 4CDMA 4O02B 1ISRA 2FFQA 3ZV5A 1XJQA 1FC3A 3VNSA 4IIFA 1DC4A 5JFRA 3WLQA 4BH9A 4C2MJ 1CDOA 3IOEA 5DCLA 4L6IA 4M38A 5DNWA 5G53C 5M3BA 3EW9A 3SICE 1IRIA 1OXSC 1UM9A 2A3RA 4PYQA 1WUIS 3KQQA 3UV3A 1VI5A 2TMYA 1GLGA 3V33A 1Y8AA 4L51A 1V11A 1XYYA 4YFKF 4DY6A 1A5BB 3LLMA 2EA2A 3WRVA 2D1SA 5F27A 3RFFA 3PRJA 4K88A 3IRQA 4XGRA 3BJEA 5JEDA 1SULA 3BJIC 3C8UA 3EAQA 1PFKA 2P9HA 2PZJA 3I3LA 3A14A 2BMJA 3DL7A 2OQ2A 3F96A 1S5PA 4A6DA 4MV6A 5FL7D 5LWHA 3M2TA 1SXGA 2X8LA 3IP9A 3F73A 5DU2A 3DPUA 2UVPA 2AZTA 2VNHA 4E12A 4I19A 1ZW1A 3SBEA 3FHNA 1GPLA 4BKOA 1E3WA 3VKWA 5KB3A 3SJZA 4G07A 1H2BA 3H2IA 3P32A 3RGGA 4TRJA 2IBSA 4NOLA 5ALPA 3F7OA 4MQ4A 2KJCA 2ORYA 4L2IA 1RXIA 1ZMOA 1B42A 4LCEA 1II8A 3CUWA 4EA9A 4H7PA 1N75A 2K7LA 3HUGA 2IHYA 5CA1A 4IVPA 1QGED 2CHQA 3LQKA 5EIHA 3RVRA 4MYDA 4X6AJ 2PMZA 1MRZA 2JI9A 2GXSA 1JEJA 3BMNA 4INAA 4KV9A 2HR3A 3OZWA 4N0PA 1XZKA 5LHIA 1ZSVA 2ZJ5A 1A9YA 4EFKA 1WEKA 3DV8A 1EVQA 3ZY4A 2VCYA 1DINA 4EUEA 5CDFE 4B6GA 3GWGA 3J81A 2E60A 4Q7MB 2OZ6A 3SIWA 2O8FA 4XX0A 3DDZX 3PPVA 2F64A 4ZQCB 5C35A 4JBAA 4B45A 5E8RA 4GKVA 1Y4UA 4BNDB 4U0YA 2VJYA 3G0CA 1WW8A 3BHJA 2Q1ZB 4IOKA 4JP5A 4HRIA 4JL5A 3SBXA 2OBFA 3VRHA 4U9UA 1U3DA 3GF2A 4A8JB 1GR0A 1WKMA 3IP1A 3WTTC 4DARA 3L2UA 1OI3A 1XE3A 2L19A 4UBJA 2QQEA 4YRBA 2GTHA 3AKZA 5EQTA 3GFOA 4PJNA 3HN2A 3F72A 4NHJA 2V6EA 3IMCA 4OOFA 5F04A 1YRYE 4IXDA 3I8OA 2PQ6A 5K0LA 3VZRA 2H8WA 4BO6A 4P80A 2MD5A 1QUFA 4WLEA 5HS4A 2XXAB 5ES3A 2XF6A 2D62A 4PR3A 1FIPA 4I0AA 1TZKA 4Q01A 5K8UA 4UNPA 2DOEA 2E34A 4B3JA 5KIAA 1WLSA 1Q1VA 4LCBA 3KLMX 4BYMA 1SUSA 5KYWA 4IVNA 2O0YA 3BQYA 1YKFA 2Y92A 1UKAA 4ENVA 4WRRA 4HI0E 2JF0A 2J5BA 3E61A 3E7PA 4XKVA 1SU4A 4U6SA 5TPWA 5B2FA 3L8YA 4O4JB 3D6AA 1ZNYA 2JFOA 5JQGA 2B8WA 3NNSA 1D4ZA 3MJDA 3GXOA 3RKXA 1M74A 2JZNA 4QRHA 5ALFA 5FLXA 2HYJA 2V1XA 1T3SA 1PBNA 4DLUA 4GQAA 4S12A 1N4DA 1NJ6A 5FULA 5B3SH 2BSXA 3MD0A 1P17A 4ANFA 1PWHA 5A9TA 4CYMA 2VQDA 3ERMA 3V4LA 3RI3A 1YB1A 5E95A 3S29A 5JASA 1G8HA 3LX4A 4E15A 1RCUA 5CFOA 4KBFA 4M3EA 3KC2A 2PRSA 5HNFA 5AXBA 3WRYA 4BRUA 3BC8A 2QD1A 1M6VA 1FTSA 2HGZA 5FLXK 4GXQA 3RC8A 3RG8A 3A4LA 1NQXA 3VFDA 3MZ0A 4AO7A 1E4YA 3S6JA 2C7QA 2HD4A 1N8KA 2F3TA 1IVSA 1RBYA 4ZK6A 3QWIA 1Q74A 1X8KA 5CGQB 3VR2A 4I4TF 1PSZA 5KTSA 4R81A 5MN4A 3S8PA 5KREA 5KVAA 2CS3A 1WPKA 1R0CA 1Y3CE 2B2XA 2XRFA 2Z83A 1XSVA 3LPMA 5A3RA 3VISA 5HTOA 1WOYA 1I10A 3DBVO 2NVBA 2W2TA 3UWKA 1SCUB 2A5WA 2BY2A 1SVNA 3GLSA 3TN7A 1Y1KE 2FMYA 4RAZA 1YS6A 1BX1A 4C1NA 4EYGA 3C85A 2YMPA 3Q3HA 3ABQB 1WY5A 4EHDA 3FOWA 1CR0A 3CLHA 4HDNB 2E2JJ 2IYEA 3UJ3X 1IIRA 4CUZA 2L7KA 1N2GA 3R5TA 1U9NA 1G6HA 4PTZA 1J0AA 4R4JA 4Z9YA 1BYIA 1FDIA 3HGMA 4XLEA 1G3WA 2O7SA 5E9AA 3T99A 3V6LA 4BN5A 1KY4A 4QTTB 4AKSA 2J0SA 3BH6A 4LAFA 2XBUA 1T9GR 3OG9A 4JLDA 3W9SA 2DMRA 4CV2A 2HZDA 3N97A 5L9AA 1H9CA 3UWMA 4KK4A 2EWVA 3DVAB 5KTRA 5JLAA 4G6ZA 2ECQA 1VYHA 2E87A 5KNBD 3VMMA 2W6QA 1CZKA 1ML4A 2IGMA 2F43A 3DFKA 3JZAA 4FX5A 4EBBA 1ZM9A 1U3VA 2ATEA 4EG0A 3HZJA 1UMKA 5COAA 3BAFA 1XFDA 1X19A 4ABZA 4FGLA 4UAGA 5EE3A 3JQFA 4Y2QA 4NZZA 4DGSA 4IJWA 1JSCA 2CDRA 1THTA 2VYND 6AT1A 2L54A 1LNSA 4GYIA 1MW9X 2FEKA 2Y99A 3A6GA 2CRGA 2R7DA 2PRYA 4LRXA 4RQTA 5IT9Z 4EF4A 2G9NA 2AEMA 3MZYA 3I5YA 4RLHA 5J2TA 1NXWA 2VKTA 2BYTA 1BJZA 1G1AA 1K3UB 1ODLA 4R41A 2P2LA 2ZSAA 1GNPA 2AMJA 5EJEA 4NFLA 2LPMA 5EIXA 1FOWA 3MELA 3W78A 3WL3A 2DA6A 1IQPA 1B0UA 2NVQJ 2MINA 3JQGA 4C14A 1UXHA 3ADBA 2A1TS 4HCJA 2VK1A 3MT9A 2JLZA 5K1YA 4A0YA 1KVTA 3EGXA 4BXOA 2AH5A 5IBRA 3FF5A 5BRNA 4YRNA 4W5RA 3PE6A 4GW3A 2MDTA 1P5ZB 4OBWA 1KJZA 3AHCA 1ZJJA 1ST3A 2OHOA 5K3SA 3WMWA 4WXYB 2ZZMA 2H11A 3HBFA 4R8LA 4LQLA 3D2AA 2O8FB 4BNHA 1F36A 3GUDA 1QHHD 3NANA 3INRA 5E3MA 2IWRA 1NW8A 1PT6A 2VQSA 4R2LA 4EF5A 1W30A 3CINA 1I8TA 1GPJA 3DM5A 1XEWX 3ZGNA 2LKXA 3DUFA 1P4SA 1IXSB 1ZCFA 4G6DA 4DGQA 4I01A 4O4IB 3RVSA 4L5CA 3O1LA 1J0EA 1CZUA 1USTA 3KVRA 2DSTA 4IAOA 1FX7A 4UJ5A 2GWHA 3RIMA 3VSCA 4L27A 4LI3X 4ILKA 4TWRA 4CFSA 3IIMA 5FA6A 1SD4A 3EIFA 3ND8A 4K46A 4QUHA 2VZ0A 2IHKA 1AKVA 2MYSA 3D5EA 5MF6A 3OD1A 1HKHA 2CXRA 3IR6A 4BMNA 4EM1A 1CNMA 3OOUA 2PAAA 3NYWA 5LA6B 5CDYA 5H4GA 2AJBA 5CA1F 3GT7A 1LVKA 1YTYA 2CQ7A 1RHKA 3E9QA 4RQAA 4IHTA 1IDOA 1GARA 1RRCA 1B15A 1MJ9A 3D5QA 3DE2X 4U02A 1ML3A 3LX5A 5DX1A 3UF0A 5JRJA 1I4EB 1US8A 3A3OA 3PCTA 1FU7A 2Q3DA 5KOIA 4XRGA 4U7DA 4DXDA 1Q57A 2F9FA 3OR2C 3E9ZA 5GV8A 1VXOA 1GOTA 4E2FA 1XC5A 5FWXA 5IM4A 1GTL1 1NM5A 3LCUA 4MEAA 1U9OA 4RPJA 2HIGA 3VFZA 2I3GA 3NHUA 1T9HA 1V0JA 3GLTA 4MMXB 5TR9A 2KM1A 1NP6A 2Y1LA 2GS9A 2AEEA 4CKBB 3OLCX 1J8VA 1QIGA 1T10A 3HFSA 2XKOA 5KVRA 3A4NA 3GJQA 3IL2A 4W9NA 5C3MA 3L5OA 3GYHX 3W05A 2H54A 4ZI2A 3DE7X 1LTHR 4FISA 1GIAA 1YRBA 2AQIA 2FWRA 4HDSB 3DNMA 4AF7A 4YPVA 5JD5A 3T7KA 1T4MA 5JQWA 4NC7A 4NH0A 5IJZA 2WKQA 1PFQA 4HDSA 1IWBB 2N0SA 3Q3GE 2GKOA 2XE7A 5JBQA 3RUPA 2ISQA 3L0OA 1E8NA