4S05A

Crystal structure of klebsiella pneumoniae pmra in complex with pmra box dna
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
219
structure length
219
Chain Sequence
b'MKILVIEDDALLLQGLILAMQSEGYVCDGVSTAHEAALSLASNHYSLIVLDLGLPDEDGLHFLSRMRREKMTQPVLILTARDTLEDRISGLDTGADDYLVKPFALEELNARIRALLRRHNNQGDNEISVGNLRLNVTRRLVWLGETALDLTPKEYALLSRLMMKAGSPVHREILYNDIYSGDNEPATNTLEVHIHNLREKIGKSRIRTVRGFGYMLANN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-binding transcriptional regulator BasR
publication title Structure and dynamics of polymyxin-resistance-associated response regulator PmrA in complex with promoter DNA.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Transcription/dna
total genus 61
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4s05A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4s05A01
2OBPA 3BBLA 1USGA 5F1RA 4EJUA 5BRAA 5HS7A 5H6QA 4OIRF 1LK0A 2RJOA 4RAYA 2QVOA 2R3SA 1I6XA 1GVJA 1S7AA 5J8CA 5ICGA 2QQAA 4YIIA 2M1BA 2VC1A 4QYMA 2PAFA 4OTZA 1KA8A 3ZMVA 2GAUA 5HDNA 2BGCA 4Z0NA 3KP7A 3RDIA 3WE3A 3HTUA 1QNTA 4OLBA 1R1UA 4XSXF 5TPZA 4EYOA 4G0OA 3GWZA 1JL3A 2ZO4A 2ID7A 5DV5A 2VE8A 4HF1A 1O7FA 4I02A 1ZREA 4RKRA 1V4RA 4KN7X 3LOPA 1HW1A 4A0XA 2JPCA 1SFEA 3FMVA 3TX6A 1GCAA 1ZAYA 1RXIA 3VNAA 5A2QZ 4MGRA 2E7XA 3UK0A 2HYFA 3KLOA 1U8RA 4RK6A 4HYEA 1GXPA 4G0YA 3HIFA 2E4WA 2MSKA 5AIPA 3ECOA 4XASA 2XVCA 1XGOA 3MYYA 1ZLJA 4BH9A 3KZYA 4HBLA 3WTVC 4AIKA 2P7VB 4KMRA 1XDUA 2XAHA 1SXGA 4LMYA 4EMSA 3H5WA 3T8YA 4I98B 4HLYA 1WQ2A 1PEYA 3F72A 3ERED 2HEOA 2FEWB 2L54A 1NXOA 4G86A 4MR9B 1FYLA 3ROTA 4Z4CA 3O75A 2P5KA 2V1UA 1FSPA 1X3UA 3GFLA 4U88A 4UV9A 5LHGA 3J7AO 1FBUA 3I42A 3ELKA 3CKMA 3R0JA 4G97A 3O1JC 1YS7A 2IA2A 4F12A 2O61A 4LG0B 1JHZA 3GO5A 1P6QA 2LKPA 1O3RA 2V0NA 3CNBA 1MZBA 3L6UA 2PQ8A 5FWYA 2XAFA 2VBXA 3HXMA 2BEOA 3KP3A 2CO5A 1D1PA 4MYRA 3FMQA 1XHFA 3HRUA 4RSMA 4A5NA 4ETNA 4RS3A 2HDCA 3HSYA 2W85A 1ZVVA 1TM2A 2JTVA 1MJ9A 3LUDA 2ELHA 1L3LA 5E17F 3T6KA 4A0ZA 2A61A 2QVGA 3CG4A 1P2FA 1R22A 3QPHA 3EDPA 5D4RA 1RZ4A 2DO7A 4M9XA 1QPMA 3BOQA 1KQ8A 2E4ZA 3ECHA 5HKOA 4LRQA 4FX0A 5LHHA 2PMHA 5TQ0B 1KQ9A 4XLNF 1T39A 3K1NA 4ESJA 2NZUG 2R7DA 4KV7A 4PYRA 1QZYA 2FTKE 3GF2A 5JNRA 4AIJA 2JSCA 4RGUA 3MFKA 3RI4A 2L4AA 2WJWA 4HQEA 3H75A 3L7WA 1D5WA 1BJAA 5ILVA 1CHNA 5HS8A 3SNKA 1DBWA 3RVLA 1W7PB 3RVSA 3MWMA 2VOOA 3REOA 1I1GA 1Z12A 2DBBA 2Z5UA 3WTSC 4MQEA 1STZA 2E4XA 1YLFA 4WXDA 1BVHA 3I59A 2FEKA 2R7FA 4Q5SF 2NT3A 1ON1A 2JRTA 2LBPA 4Z9AA 1QZZA 4HDVA 2ZWMA 3F6CA 4IMJB 2K86A 1O7LA 2QSJA 3E3VA 1A2OA 4MHGA 3DFGA 3I71A 5DKFA 5LGTA 4HQMA 3CTPA 2NZVG 1IN6A 4M9SA 1IRGA 1WI9A 4BAYA 3QAHA 3FDFA 3AAFA 4JK1X 1NXTA 2XKOA 3GXOA 3EYIA 2IA0A 2HQNA 3OLWA 3ZP5A 2PUBA 3ABUA 2UZKA 2FLKA 5JI6A 3DPTA 1LEAA 3F3XA 3CG0A 2HFHA 1JBEA 1W7PD 4GO1A 4N47A 3F73A 4UNOA 3LFTA 3DXJF 2FQXA 2P6SA 2M87A 4G6QA 1LJLA 5KK1A 2FVYA 1J2XA 1PNTA 5FWXA 4A2UA 3E6MA 1F5TA 4MAAA 2L01A 2LDUA 2EFOA 3HM9A 4ENMA 4N0PA 4MS3B 1S29A 2B1JA 5L3CA 2EJRA 4XXHA 1ZGAA 3FGZA 2VBYA 3FXRA 3FM3A 3RKXA 4G7ZF 3DBIA 1D8KA 1JFSA 3TDUC 1EH8A 4KA4A 5AONA 4MQ9F 2M8EA 3BREA 2F8SA 4FE4A 1RPJA 2RGVA 4RB3C 1U6GA 4Z4EA 1W25A 3S99A 1DPUA 1PEAA 1Z2DA 5DDGA 3NRVA 1K7AA 1LDJA 3M9WA 2XHKA 3O2PE 2QYOA 2F5FA 5HOOA 4YO7A 2PLYA 3KFWX 5FGMA 3LAJA 4FHTA 1XD7A 2P5VA 3SZTA 4U0VA 2RVCA 1FWZA 3N53A 3LMKA 4MTDA 5DCMA 2VONA 2IPMA 3K2ZA 1Y0UA 1TW2A 3IWFA 3TMYA 3F8MA 4GYGA 1IN8A 3ZQ7A 4D0PA 3I5AA 1Z18A 4XLPF 4HF2A 1JGSA 1DUXC 4G9YA 1R58A 2FBKA 4Q48A 4EVQA 2W24A 4LX8A 4KMUX 4WCGA 4H3HB 3EQZA 1PP8F 1LDKB 3V4GA 1MVOA 1MDMA 2O6GE 1ZGJA 1T34A 1IXCA 1BIAA 5D5UB 2WV0A 3M9AA 4PCQA 3ILHA 1Z15A 1MD0A 1ON2A 3L9FA 4RU1A 2FA5A 3T8TA 3M7GA 2RJNA 3DGFC 1IN4A 1JX6A 2EFQA 2N9UA 2K27A 3KJXA 3O2QB 3GRCA 3JTGA 1VPWA 1ZG1A 1LJ9A 4YG2F 2JK1A 3FF5A 1XMKA 4ZYHA 3HDGA 1XSXA 2K7LA 2LP4Y 2OQRA 4A0YA 4O6JA 3EETA 3RKWA 3F22A 1KGSA 4E7OA 2R48A 3NHZA 1XGMA 1REPC 1DBPA 1K6OA 5FD6A 3FWEA 3QEMB 2PUCA 3Q7SA 4KQCA 5KQGA 1DCKA 3OQOA 3QOPA 2PMCA 4UV8A 1EWVA 3GWGA 2VBZA 3F8CA 1JDPA 3B2NA 4WXEA 4UHTA 1TQPA 3U2RA 1HKSA 3LQRA 1B9MA 5D5WB 3RVOA 4O5VA 5HSGA 3OLXA 1NHAA 3C1DA 2CW0F 3ULQB 1P4WA 5K5OA 2P5LC 5KC8A 3KTOA 1BDJA 5TQ2A 1XCVA 1PNRA 1YYVA 3T8RA 1R5GA 2H3HA 3TGNA 4EY3A 4EM0B 2MH2A 4ESBA 2VUHB 4JQFA 3EULA 4O5AA 3HOSA 4NB5A 4I01A 4UHJA 3F23A 2X0LA 3EJWA 4H3KB 1SFUA 2EFWA 1SAXA 1TLFA 4HNRA 3IKTA 3EQLF 2M98A 1FFSA 3LA2A 1WRJA 5IX8A 1GXQA 3H5LA 1YTYA 4RB2C 5EEHA 2MLKA 3V7CA 3T0YA 2LSOA 3WTUC 1OR7A 2GX6A 1U0SY 4HA8A 5LEKA 3DKWA 1J56A 4HNQA 5FBKA 3JTEA 5LGUA 3QEKA 4ZYLA 1BAPA 3HUGA 3P9KA 5E1WA 5KI6A 4O1HA 1HKQA 3N0WA 4NCBA 4PZ0A 2TDXA 1E6KA 1U78A 2LNBA 1M5UA 2DRIA 4WXMA 1JH9A 1DCFA 5GQSA 3FXQA 3I5UA 4XAQA 3JSPA 3E6CC 2HPHA 4BQAA 4TV7A 2VC0A 1ZAOA 1V3FA 4CDGA 4EM2A 2GXBA 1DRKA 1ZH4A 3WGHA 2IKSA 4YS6A 1FYKA 1ZESA 4LLLA 5C5EA 5T3YA 1ZITA 4YFKF 5HLHA 3GFMA 4OIOF 2XROA 2A9PA 2FSPA 3BY6A 3KP6A 5D6EA 2G9WA 2GWRA 3QP6A 1R23A 1JDNA 1U5TA 2XAQA 3VB2A 3ZPLA 1USIA 2HTSA 4L9JA 4H0EA 4G0ZA 2QLZA 2CWEA 4Q6BA 4RGRA 5JVTA 4RXMA 3N0RA 2STTA 4OMZA 4FX4A 1DP4A 3F6PA 3NEUA 4R79A 3OM0A 2CYYA 2P6TA 4OINF 4I09A 1HSJA 3O1HB 5TPZD 1T98A 2O20A 2HQRA 4KDPA 2GA1A 3QLVA 4P1ZA 3D02A 1MB3A 4OOIA 4KREA 5IEJA 4YWHA 3KHTA 4Z9BA 1ZG3A 3QU6A 5IBQA 2F2EA 1XHEA 2ZNZA 2DPDA 3GLXA 4XBFA 1L5YA 3BZ6A 1MJAA 2UXNA 4LD5A 5LLQA 2GZWA 1IN7A 2L02A 3FZVA 1VLZA 2R25B 2J5PA 1LB2A 2Z33A 5LEJA 2O03A 2OA4A 2PUEA 3R4KA 2RKHA 4LDAA 2JCGA 4IHTA 2QZJA 2L4MA 3E6DA 3Q7RA 3I0TA 1URPA 1FC3A 3E6BA 4YIFA 4P9UA 1PHRA 3GA5A 2A9RA 4L5IA 4KT5C 5CVVA 1QNLA 2WJAA 3C6QA 1K78A 1FYMA 5LGNA 2BE5F 3HOTA 1QKKA 3BP8A 1UDRA 2FMHA 4DADA 3D0SA 4RZSA 1DPRA 3OMXA 3HYIA 3KP2A 2ZMEA 4ESFA 3QX8A 2QU7A 4U0YA 8ABPA 4LK1F 3ZMUA 4DQDA 4IRGA 1Z6RA 1MGTA 3TQNA 2DFIA 3EAFA 2HKOA 2ISZA 4I7HA 2MSLA 4EYGA 2V79A 2DTRA 3DF8A 4KNYA 2R47A 1U2WA 3HDVA 3KEQA 2FN9A 4G94A 2ETHA 2FNPA 3WTWC 4G7HF 3O2JA 4CHUA 2DU9A 2DW4A 2YHAA 4G0QA 4M6XA 3RIRA 2PLNA 1G3SA 4RXTA 2IRFG 2CD7A 2RDMA 3E3MA 2V1XA 4L9VA 3E97A 4RY9A 4L18B 3QLTA 4MR7A 1TNSA 4LJZF 3CO7C 4ZYDA 3LUFA 1QMPA 5EWMA 5DUIA 2PL1A 4KUMA 1U2QA 5HS9A 3DQVC 6CHYA 1FFWA 5CYVA 1AB6A 2ZAYA 2FMFA 2PN6A 3W6KB 1CGPA 4F8JA 1YMUA 1XDSA 4YV7A 2E1NA 2LF7A 2HSGA 4F06A 3V7RA 3KLNA 1DP7P 2KIUA 5CVRA 3J81Z 2TMYA 2FBIA 2MA3A 1K79A 1F9NA 3HV2A 2FF4A 3RYPA 1IRFA 3COAC 3QLUA 3C97A 3C7JA 1IN5A 3FM5A 2Y75A 2IP2A 2Y0MA 1JHFA 3H3ZA 1WETA 3JVIA 5FWXB 2EA4A 3E5XA 4JOQA 1TBXA 1ZARA 5BOXA 1R00A 2IOYA 1ZN2A 1HEYA 3GBVA 1U8TA 1I1SA 4WF2A 3CTAA 2QBYB 1YVUA 2STWA 1C4WA 3TOBA 3I45A 1PUXA 4MEYF 3KYJB 3CUOA 1OXBB 4HX4A 2DK8A 3GV0A 3GT7A 1VRVA 4Q47A 4KN4X 3JAMK 4D74A 2HWVA 5FLXK 4D6XA 5J8FA 2WB4A 4MS4A 5HLIA 1ZH2A 4MS1A 4IPAA 1QPZA 3IP5A 2ZJ2A 1RIOH 3P7NA 3EQ2A 3K1MA 1L5ZA 2P4WA 2HR3A 2FMKA 4HNSA 2ACJA 2FEPA 1R5HA 4RK0A 4MGEA 4HV5A 3CJNA 2A07F 1IZ1A 3Q41A 2NRAC 5DCMB 1XCBA 5BPDA 3HZHA 1QP7A 3DP7A 1Z26A 2QXYA 2L18A 5B3JA 1Z6TA 4HV6A 5FBHA 3Q5FA 5FD5A 3N0XA 4KQ9A 2ZKZA 3TO5A 1B6AA 2DLLA 1M2EA 4RWEA 3SHFA 2WWYA 3QPTA 4YRZA 1OMIA 2P8TA 1MDMB 2FN8A 3JTHA 2O3FA 3FHZA 3FFXA 5TE9A 3IHUA 4KIFA 5HM6A 3N6VA 3IWZA 4KYWA 4PDKA 5HQJA 2GQQA 2KJCA 5ILSA 1TQMA 2A9QA 4ZJPA 4XSZF 2BV6A 3A0UA 3CRNA 3CZCA 4ZH4F 1GUBA 2MYTA 3F7NA 1FSEA 4PE5B 3SM9A 3JAMZ 3LA3A 5CVJA 1TQIA 1J7KA 3KG2A 4W5TA 2OQGA 4HLXA 1KQ0A 3BROA 3LTEA 3P9CA 2XAGA 4KZKA 2QENA 3TD9A 4EGZA 3LSTA 3QX9A 1E6MA 4NICA 4JA2A 5JR3A 2QUFA 1Z1DA 4IF4A 3HUTA 1Z91A 1CF7A 3IPCA 4UHKA 4I0BA 3RVRA 2HGCA 1YTUA 4G8XA 5JS1A 4LK0F 4TLLB 3KCCA 1T38A 2J48A 3KKEA 3B02A 4QLCU 1UCRA 4LB5A 2OENG 4EV0A 2L17A 3TO7A 1ISRA 3RKYA 2JVJA 4N41A 3A0RB 1P92A 4JBAA 3HHGA 1WSUA 1YW9A 2YHBA 3H5OA 3EUHA 3T5XA 3LUHA 1EWTA 4IRXA 4Y9TA 5TPWA 2XDYA 1YK0A 1K68A 2FXIA 4U7DA 3FMSA 4MQVA 1W9HA 2IJLA 2C6YA 1IXRC 3HEBA 5JHUA 4KIBA 2P9HA 3RVKA 5KQPA 5D6FA 1DDNA 3RYRA 1L0OC 1SD5A 2V1DA 2FQWA 1U2PA 4QICA 1QP4A 4IRHA 1ZGGA 4ZZDA 1YQAA 4Y17A 4LG0A 1LVAA 3BPVA 1E17A 2R4QA 2CSOA 4S04A 2RGYA 5ICFA 1S3JA 3H1FA 3HSRA 1ZY2A 2E4UA 4U0WA 4RAZA 3MZYA 1RZRA 5CVUA 3E61A 2GKGA 5JNSA 3I54A 4JB2A 3WG9A 2PFBA 5JNWA 4Z4FA 3IL2A 3B73A 3G73A 2O8XA 2QQBA 4HW0A 2JVKA 2PG4A 2JBAB 4ZMRA 3KCNA 3SZPA 3NQOA 3O1IC 2ZFWA 3CLKA 5CNJA 2X4HA 2W42A 3QELA 1B4AA 2W25A 1E2XA 2HQBA 3N8IA 3O3KA 4JAVC 1CEYA 4EGYA 4WUTA 3ROFA 3U9GA 4ZMSA 2DK5A 5CLSA 2QWWA 2B0LA 4RK5A 4BXUA 1OXKB 1BI1A 1G4DA 3GW2A 5TQ0A 5KWSA 1Z7UA 3LKBA 1OYWA 3IP9A 1BI3A 1G6NA 1Z2EA 1U5TC 2ZCWA 3F8NA 4DNCA 3WU1B 2EV6A 3ILYA 1DG9A 2E4VA 2FQ3A 3BRQA 2PUGA 1HXDA 1TTYA 3HK2A 3JPWA 1RUNA 3HSFA 4IHSA 1T0FA 4P55A 1NATA 3HO1A 4UVCA 5LRRA 3IKVA 3RVNA 3T95A 2CQKA 4OLAA 2ID9A 3RVQA 1TLHB 1JF8A 3W6JB 3QLVC 1BI0A 1OPCA 3IDOA 4RV5A 4OG2A 2XKPA 4RK4A 4EVRA 5IEBA 1M5TA 3DEUA 5TQJA 3SY8A 3JY6A 3F8BA 3A3KA 4ENKA 2HJ9A 3M1EA 2F5DA 3RTRA 1AOYA 3MEXA 1SRRA 3FMRA 1JXSA 5BQTA 2D1VA 4YFNF 2A9OA 3D5LA 4HAMA 5TRDA 3GFIA 2JPBA 4ENJA 3GYHX 3WGGA 5DCLA 1YW7A 1Z25A 4MLDA 2ZMEB 2PUDA 3HCWA 3R6SA 2CG4A 1IXSB 1G3TA 1R8JA 1Z17A 3CFYA 4K2EA 1YS6A 2XGXA 2HS5A 4LZLA 1B9NA 4MS3A 4OIPF 2MLGA 1GCGA 4CBVA 3K9CA 4DN6A 3IPAA 3RQIA 1C0WA 2FQYA 4EUKA 1B59A 5DYMA 3V8LA 3GBPA 3DLBA 1MKMA 3TO9A 1RUOA 2BYVE 1OYIA 2MD5A 1T6SA 3MMNA 3KP5A 5ABPA 1LNWA 4GXOA 1WKMA 4MNUA 1O3SA 4MR7B 4P96A 4IMIB 2PI0A 3FX3A 2M5WA 5EWMB 2H27A 2H0AA 2PE5A 3U1DA 1ZHFA 5FB2A 1T2KA 1ZYRF 1EFAA 5EWJA 2PJUA 1SXIA 2XIGA 3ML6A 1W5SA 3N4MA 4S05A 1QP0A 3ZN1A 4ENNA 3ZMTA 1PDNC 1XGSA 3GEZA 2QR3A 3CLOA 4GCVA 1U3EM 4LE2A 3O74A 2EFNA 5H20A 1FP1D 2Q8KA 4TN5A 4ETSA 2IVMA 2WWVD 4LE0A 3OO0A 4XARA 3Q15C 3TKYA 5DEQA 2WTEA 1FX7A 2W57A 3H5IA 5JNUA 1FY7A 2G7HA 3OM1A 4HF0A 3DZDA 1QBJA 3Q7TA 4M72A 2AYZA 4Y13A 2WY2D 1LDDA 1SXHA 2VT2A 3EGCA 4QYWA 5BPIA 1FP2A 1EAYA 2NUBA 5D4SA 1VKRA 2RN7A 2FW0A 5CJ9A 4P9FA 1NXSA 2HZTA 4FE7A 5DD8A 3WTTC 5KC9A 1XWWA 1F1ZA 1ZHHA 3QLUC 2J5OA 3H6HA 4Z2YA 4GNRA 1QQAA 3ABTA 5E18F 4M6YA 3EDCA 1HQCA 1UHWA 5AIQA 1J75A 5F6FA 2OU2A 5PNTA 1BDHA 1ZDMA 2IA1A 3K4HA 2FEZA 1UHMA 4MRMA 1P6RA 5FWYB 4UXNA 4W5NA 2ESNA 3R60A 5ICEA 1DCMA 1GLGA 3G85A 4WK8F 3FXUA 4MS4B 2DQLA 4WT7A 1USTA 2LUOA 4EVSA 1KYZA 1SD7A 1SMTA 3WTZA 4MS1B 1ZGZA 3LFKA 2A3SA 1MIHA 1R36A 6ABPA 4KRFA 5JNTA 4OMYA 3EODA 1FBQA 1YFHA 3JPYA 2QZ8A 3ZN0A 5LRSA 3MQ0A 1ABFA 2BGGA 2RDPA 2IPQX 1D4ZA 1C0EA 4GYIA 1DBQA 1XSVA 3F6OA 1S6LA 4AD9A 2K4BA 1ZRCA 1JLKA 5EWLA 2IYNA 1QO0A 3KS9A 1QQIA 4JB0A 5J6XA 4AVPA 1Q1HA 1FNNA 3NNSA 1OKRA 1P4AA 1O3TA 4F3TA 3F8FA 4RB1A 3CUQA 5HVQC 1JYEA 5B3JC 4RXUA 4Q7EA 2E1CA 3KP4A 2KIFA 1O3QA 4E70A 4XLTA 2PMUA 4HX7A 5D5XB 2IPNA 3BJOA 1HBXG 1F4KA 2COMA 5ERIA 2FXAA 4MQEB 3I59B 2E4YA 3HS3A 5D5VB 4Q4ZF 4N0QA 2YU3A 5JFRA 2EV5A 4IXAA 3CDHA 1XB4A 3T38A 2AS5F 2FMIA 1IIBA 2D1HA 2CGPA 2M45A 1IW7F 4UUVA 4RS8A 1YIOA 2K02A 3K1PA 2KRFA 3OLZA 4BHBA 2QVCA 3OQNA 1D2AA 4WWCA 4F7ZA 1TVMA 3C3WA 1JFTA 2MBFA 2DI3A 1FFGA 3O6BB 3QRFF 3ISPA 1ZH5A 5E8GA 4RKQA 5FO5A 4CO8A 2A5YB 1XGNA 3I53A 4MR8A 3NBMA 2KKOA 5EEGA 1ZG5A 1CF7B 1NXWA 2B4AA 2NNNA 2FBHA 2FMYA 2P4UA 2FRHA 1EV7A 3DGEC 5JNVA 2HTJA 1FBSA 3KYIB 3OOPA 2VYCA 2ESHA 1USKA 3C3MA 3LUGA 2OZ6A 5IUNC 5DLEA 3HUUA 4LDZA 3KEOA 1NXXA 5DCFA 1F4VA 1I3CA 2OZUA 3Q9SA 3MF4A 2MYUA 1IF1A 4EGSA 3V8KA 3FFTA 3GZ5A 1YMVA 2JZYA 1FZPB 4CICA 1USSA 5ILUA 4L4UA 3RVPA 5L3EA 3M8EA 5TPWB 3K0LA 3NNNA 1HSTA 3VEPA 3ZMZA 2EB7A 3JSOA 1DC7A 1KU9A 5K5RA 4CZZA 3OLVA 4YP9A 4L0ZB 1S8NA 3OV8A 1P8AA 2O0YA 3WTYC 4MQFA 5IT9K 1OYYA 3KSMA 4N0BA 3H5VA 4HDUA 4A6DA 3E5QA 4WXHA 1F51E 3C3KA 3QP5A 4P5OA 4YLEA 2JRLA 4EYKA 3I4PA 4P98A 3VODA 3J80K 3L2CA 2IDMA 4L85A 5IT3A 4CGZA 1VTNC 2VOPA 3MIZA 5CVIA 1R1VA 4KK3A 4KPYA 3GUDA 1P4XA 4JASB 4WX9A 3H1GA 5IULC 4YGXB 1YG2A 1ODDA 3QELB 2H6BA 1MAVA 3HRTA 2Y48A 6PAXA 4F11A 1KRWA 2PUAA 4L9TA 2CWDA 3TO6A 4KMFA 2MYPA 2GA2A 4FT8A 1G3YA 5K1YA 1BOAA 1Y1LA 2CFXA 5CNIA 2XRNA 1TW3A 2XV4S 3A10A 4PGHA 3QK7A 3LUJA 4ZYEA 5L3DA 4RY8A 2CHEA 4ZPJA 4Y15A 2RV8A 4OU0A 1J0RA 4G6DA 4LE1A 1YW8A 3I58A 1LJUA 1BIBA 2H6CA 5BS6A 2FMLA 5DUKA 1RZRD 3I64A 3FFWA 2P7CB 5E20A 2HOEA 3WTXC 5DTEA 3WE2A 4I0AA 2D2WA 5CNMA 4RK7A 3BWGA 1BC8C 5T7BA 5CNKA 3MA0A 1BI2A 3TOAA 3CZ5A 3RJPA 1QGPA 1W5TA 2PBIA 5GOTA 3LUAA 5FLXZ 7ABPA 1YO5C 3LUCA 2AXLA 3BPXA 5IT9Z 3QU3A 1NY5A 2FE3A 4BHPA 2V9VA 2YX7A 1PUEE 1XN7A 2RQPA 2UXXA 4O1IA 1LEBA 3HRSA 1FOKA 2FOKA 2HYGD 2X7XA 2IW5A 1BC7C 1JWLA 3HHHA 1R1TA 4O3MA 4NQRA 2H09A 3J80Z 5TQ2B 1HKTA 4U7BA 3GL9A 4B09A 3OMWA 2FNAA 4Z4GA 2MSWA 3KETA 4XFKA 5E3JA 2EA2A 4ETIA 1QQBA 2QW1A 2F5CA 5H6RA 1ZRFA 5IUKC 1MJBA 2A6EF 3F21A 3ROUA 5I4CA 1Z13A 2VN2A 4D6YA 4OATA 4EJTA 3Q9VA 4MR9A 2A69F 4W5RA 4M73A 2OD5A 4WWHA 2PJPA 1Z9CA 1APBA 2JT1A 5D8LB 4NQWA 1H0MA 1A04A 2QBYA 5DGCA 1W4MA 3V7SA 3NNDA 3UUGA 5BQ3A 2GI4A 4E7PA 4TLMB 2ZNYA 2YX4A 5L3BA 3W9SA 1NXPA 2WMYA 1H9TA 3G1WA 1DJMA 1GUDA 1BM9A 4I2OA 2FKAA 4GGGA 1I5ZA 3RPUA 1XSDA 3G3ZA 4QPJC 3H5TA 4PEVA 2UWMA 2NAZA 4A12A 1JFVA 4JP1A 2VK2A 1G3WA 4MEXF 1LBHA 4N76A 4B8XA 3GX4X 2RNJA 1JHHA 1KU3A 5LBQA 4KFCA 3L09A 1KU7A 3C18A 2LPMA 3P9YA 5BMZA 4L9NA 4ON0A 3K9TA 2PEXA 4IGAA 5EWJB 1LQ1A 4RGSA 1IAWA 1WWXA 2W84A 5IC5A 4RB0A 2KYRA 4M88A 3VFZA 1U5TB 1J59A 2HKXA 2F5EA 1ISSA 5FFXA 2ZBKA 1HW5A 1MB0A 1SFXA 1Z05A 3KZZA 4HX8A 3K69A 2XUBA 4N9HA 1ABEA 4LB6B 2Q2EA 3BDDA 2FSWA 2PKXA 3P9IA 2WRZA 3BRSA 1ZRDA 1DZ3A 4LLGF 4RGXA 2NYXA 3PQKA 4M71A 3SG0A 1SMYF 1D1QA 2EV0A 4EM1A 4H60A 3OO1A 1H9CA 5LHIA 4YR7A 1SD4A 3WODF 5KQMA 1W7PA 4R8HA 3GYBA 2MYNA 1BA2A 3SFZA 1JE8A 5KVRA 2DAOA 3R0AA 2DPUA 3BJAA 2FU4A 1UB9A 3WU0A 3HJFA 1D3YA 3LAPA 3N97A 2QV0A 1J9IA 1RI7A 2GBPA 3HSEA 5JS2A 5ICCA 3N75A 4AIHA 9ABPA 3LQQA 3TB6A 3WGIA 3JVDA 2ADUA 3OLYA 4ZZLA 4MRMB 2FLWA 2I6FA 3DV8A 1ONVA 5L3GA 4AWXB 3IRRA 4BHCA 2IPLA 4R1HA 5HDGA 2ISYA 2VODA 4L5JA 4EQQA 1EWKA 3EYYA 1FSHA 4PICA 4Z4IA 1U04A 1B1BA 5HLGA 2V6CA 3H3UA 3V8JA 4G0PA 1ULYA 2DQRA 1IUYA 5ED4A 3PFIA 1K78B 1KU2A 3M9XA 5C5CA 4NV3A 2YR2A 5IUJC 4PGGA 4LGWA 2M1ZA 1EHCA 5E1XA 1PP7U 2BBYA 2XAJA 4UVAA 3L49A 1P6UA 2Z9OA 1D5VA 1YK1A 5EWLB 4Z4HA 4G0MA 1HW2A 1CYEA 3RVJA 1R7JA 3SXYA 2KJBA 4UVBA 5E8IA 4EJWA 4RK1A 2VT3A 1FT9A 4NCAA 2MH9A 5CHYA 3O21A 1RNLA 2Q0OA 3CUQB 2VUIB 2JVIA 3IRQA 5TJJA 2EK5A 5KQLA 2F8TA 2QQ9A 2L19A 3IP6A 5D2CA 2GXGA 5D8KB 4N03A 1DRJA 2OAZA 3HRMA 4ASNA 3KE2A 3DPLC 1EH7A 4OBBA 3CUQC 3HVRA 3ZMSA 2GIVA 2RC4A 1UFMA 2KIMA 3MAJA 3E5UA 4CXFA 3LUKA 1JYFA 1TMYA 2YPRA 4DQ2A 1J5YA 1GHCA 4ZYGA 4KIGA 5FFZA 3CU5A 4RDCA 2AYXA 4QWQA 4PZJA 2WC2A 3HTSB 1AWCA 4RY0A 4A6EA 3LKVA 4IJAA 3LWFA 3VOEA 4KK4A 4FB4A 2Z99A 1I27A 2EWNA 4A5MA 1BBYA 1QO0D 4G0XA 4EYQA 3ZMDA 5K5QA 3M6MD 1S7OA 3GVAA 4MTEA 3TDZC 3F6VA 2JBAA 4Q6WA 4LLNA 4LFUA 3DLHA 3IP7A 4XRFA 3SAJA 2Z3YA 2ZXJA 3CO6C 2Q5CA 3JS5A 4GPAA 3D8UA 4MR8B 4M74A 3GFJA 3S2WA 4IRIA 4IVNA 1AB5A 5HDKA 3RVMA 1BN5A 3OQMA 2XASA 1TNTA 2A6HF 2K4JA 2HQOA 4NHJA 4KICA 1E2BA 4HOBA 5DD4A 4ETMA 4KVFA 4MLCA 3T1BA 3BILA 4W5QA 4IILA 2L3DA 1TJYA 1XMAA 4W5OA 3CHYA 4N9IA 3RPQA 1E6LA 1M2FA 4WZZA 4L0YB 4M9ZA 4EJOA 1LBIA 2VE9A 2G7UA 1FQWA 2PL9A 2YSRA 2LIVA 2VXZA 2QM3A 3LA7A 4EVIA 4EJVA 4ML3A 4MPTA 1O57A 3UKJA 3URMA 1DC8A 2NT4A 2H94A 3VNBA 4MQFB 3R61A 5BRJA 1SD6A 2JB9A 3MZHA 4HZFA 3QEMA 1FPQA 3MM4A 3PQJA 3NHMA 4BYYA 3MCZA 4WXCA 4TMYA 1H9GA 5A2QK 3H1EA 3RH0A 5BR1A 2IT0A 1D8JA 3O2SB 4CYDA 3I09A 1A0OA 2L2QA 3H6GA 3BJ6A 1KYWA 3GZ6A 2MC3A 2EFPA 2LF8A 2PUFA 5F64A 3L00A 3JW4A 1KRXA 3J81K 3H92A 1RXEA 1ZLKA 3SQNA 1NXVA 1NTRA 4YCSA 2DT5A 1K66A 4Z99A 1BDIA 4YFXF 5L3FA 3IC7A 2A68F 2VBWA 2NS0A 5E1ZB 1EH6A 1Z16A 3CS3A 4OIQF 1B00A 2D45A 2IPAB 4G7OF 2NNYA 2E7WA 1KMIY 2CHFA 4BNCA 3M8FA 1FLIA 2M30A 3MQ4A
chains in the Genus database with same CATH superfamily
2ODTX 1L5KA 5AFSA 2P9EA 1NV8A 2FSUA 3KJGA 4RIIA 3QTLA 2ZVQX 1Z4IA 1JLLB 5F7ZA 2OQ2A 3R3HA 2BGCA 3WE3A 1AHHA 1YRNA 4TZ0A 3WYAA 4GOJA 1NN1A 4PO8A 3EF3A 2RGDA 3IEPA 4PQGA 3EH1A 4I02A 2WIDA 3GROA 4XCQA 3LOPA 3FAZA 1MJHA 4DLAA 4V2GA 3DC2A 4GBMA 3G13A 1XCOA 1QF6A 1KERA 3TGWA 3R09A 4OI1A 3S2EA 1XZHA 4M49A 2DFPA 1W5FA 3TCNA 1VIVA 4MR9B 3RCOA 3W6NA 1IRZA 3AIKA 2P5KA 3QA9A 2GAOA 4ZJYA 3BH7A 1NUSA 2YHIB 4ZYUA 4KLNA 3O8CA 4Q4HA 4MW4A 3M5PA 1FNMA 3Q3EA 3C8MA 1QYDA 3EBPA 3FR8A 2XT6A 4DV5B 5IK2D 1GADO 1XHFA 4RSMA 3UWMA 1OKKA 3C70A 1VMKA 3EYWA 4RS3A 1B1CA 1VJ0A 1TM2A 4JMPA 2I8DA 1UP4A 4R40A 1MJ9A 3LUDA 1L3LA 1I4LD 3T6KA 1TTTA 5SYAA 1NVXQ 4R16A 2DO7A 2CDRA 1HRKA 1R6TA 3URKA 1JMVA 3C4JA 1GPNA 2CYCA 1V16B 4FIZA 4KXVA 4ZKEA 1ZM9A 5EMHA 1G38A 3VKHA 1CS4C 4BB9A 1M2VA 3BGWA 2GEFA 3H75A 3QV1A 1BJAA 2PH7A 1IRXA 3REOA 5KYVA 2OQIA 1WPRA 3AKCA 2QTTA 4NS1A 2HF2A 2R7FA 1LV8A 1XYYA 2NT3A 3CN9A 4GGPA 4TYNA 3UJAA 5HJEA 2WV7A 2BVNA 2XSDC 4HQMA 2GXUA 3R5FA 1OOEA 3TRKA 2NWQA 1NXTA 2OBFA 1G7TA 4YPVA 1VP3A 2FOLA 2EJWA 3A4CA 1ZINA 5ERYA 4UNOA 1T25A 3RBXA 1CCWA 3L4KA 3PNKA 1DCTA 4MCIA 1LJLA 3Q8MA 1L7DA 4E32A 1QYXA 1M66A 2EIJH 3LKZA 2DX7A 5CCEA 1P0MA 2FWNA 1B0PA 5JROA 4XXHA 1F5SA 3KUDA 4FFLA 4NONA 1SC7A 4XW2A 4DMGA 2ZB8A 2DFHA 5BQPA 2D06A 5FYDA 4JX8A 2BDUA 2IUSA 1VCMA 2RNGA 4TZTA 3LAJA 4I7EA 1GGMA 4QASA 4CKBA 4QTZA 2EP8A 4NE9A 2C59A 1PGJA 3CZQA 4RHEA 3HWRA 1J5XA 4BZPA 3ZX5A 1N2OA 1T8UA 5JISA 1GG2A 1ESZA 2ANCA 2FZCA 2L7KA 3GTMJ 5D86A 5HJ7A 5EERA 2EPFA 2CL6X 1V8FA 1HT0A 3MK31 3KDPA 2WDZA 3RK4A 1V9LA 3FVRA 1F4PA 4H6WA 3KJXA 5BNZA 1RAIA 1X6VA 4B3IA 1L5RA 2XC7A 3V1MA 2V6JA 1YZUA 4A0YA 3OTQA 1JDVA 1KGSA 1KS2A 4LDJA 2ACVA 3BB1A 3KKKA 2HCRA 4GYKA 3VTZA 2O23A 2ZBVA 5FD6A 4JENA 2OO5A 1YR1A 2GBLA 3GWGA 3B2NA 1UBLS 4WXEA 1X7YB 2DFVA 2EWMA 1ZD8A 3R24A 4CKEA 4O5VA 3GLUA 2WIAA 3ULQB 3PDIA 4JJZA 2DQ4A 4MRAA 3DOJA 3V3KA 5TQVA 8ATCA 5DEOA 2YMPA 2VWPA 1QAQA 3H0KA 4NCNA 4B9EA 1N32B 4M55A 2VUHB 4OYHA 3GFRA 3G2KA 2EFWA 1XZQA 2ZRCA 2H8WA 4RL6A 1TC2A 3RFFA 4ARAA 4R84A 1U9ZA 2XQJA 3Q0VA 5DHPA 3R4VA 1V8PA 4U4AA 3KB6A 1E4OA 2JLWA 4LVUA 3CDLA 2DOKA 4PW0A 3N0WA 4L07A 2R84A 5D1NA 3S27A 2IEAA 3FRHA 2HU2A 4GZ6A 5HQ3A 4U2EA 2YV5A 2HPHA 4BQAA 1ZAOA 3RRMA 1RAFA 1NM5A 1N6KA 3RNLA 1TADA 2CS3A 2EQRA 1R23A 1U5TA 1XWFA 1JDJA 1CZHA 5FBLB 4FN4A 4R6WA 5JVTA 3LWZA 2IVFA 4OMZA 3RWMB 4KGZA 4Q9JA 4OINF 1MA0A 2AOUB 1X94A 2AOWA 3D02A 1KI6B 3SLRA 5FUVA 2HLDA 5EFZA 4MDEA 4EAQA 1TQ2A 3L7MA 1PR0A 4NG4A 3X43A 3A9TA 3DWIA 4QOEA 3FZVA 2J5PA 4KO4S 3H2JA 4QQ8A 3X1WA 4ZT5A 1KE2A 1SKQA 4CL8A 4JJKA 2PKQP 4OOFA 1XRJA 1FC3A 3QVGA 1PUFA 3ADOA 4HTFB 1DELA 1PHRA 3CD6I 2AW5A 1Y7HA 1QKKA 3DMPA 4X1KA 4RZSA 2G76A 3ICPA 3KP2A 1ULAA 4ESFA 1MGTA 2BY1A 3VNSA 1UMBB 4WD3A 3DF8A 2X5NA 2O7QA 3BMOA 3I9V6 4GPBA 5F73A 4OB6A 1RYBA 2FNPA 4PSKA 3T1OA 4WK4B 4CHUA 3CIFA 3H17A 2DW4A 2AOXA 1OKKD 4RDUA 4R2IA 1XT6A 2DWUA 1KKUA 1L1QA 4I4CA 3KUKA 5FBWB 4C4ZA 2JD1A 3UHFA 1TNSA 4A15A 1MOZA 2A4KA 4NCJA 1IU9A 1AKNA 2PDAA 2OEPA 3DUFA 1EM8B 5JAHA 3AG3H 1EVZA 1HETA 1U2GA 2HA7A 5EIBD 3MRVA 4HH1A 2AHOA 4MJ7A 3QQPA 3N5CA 2TMYA 1USVA 1U63A 2OUKA 3HV2A 5CDSA 2NG1A 4IAOA 4EJSC 4QQRA 1JHFA 3THRA 4B6SA 2X6YA 3ZBPA 2OTLI 1FLAA 2Z2JA 1ZAKA 3WLSA 2V7UA 3LZ6A 5IP5A 5KO2A 1UPBA 4DC0A 3LSKA 3F7MA 4B7ZA 4W7SA 2ECOA 1DGRM 1QCCA 4C2MJ 4BB0A 3N2KA 2GCNA 4UB8C 1PN3A 5B3SH 3DLCA 3ZVMA 4PPYA 1Q6YA 3IT1A 1ECFA 1P77A 4LFAB 3PJFA 3K53A 3KOOA 4IOAF 5DHAA 4PCLA 1JG3A 1XCBA 4YBZA 5L3QA 3ELDA 4O8CA 4AS2A 1GJRA 2ZRBA 3TO5A 1B6AA 5BV0A 3GPDG 4E13A 2HA2A 2WJPA 2X4LA 1U9IA 1ZUIA 4OXYA 3K71B 2Q1SA 3PFWO 4CZ2A 4DYDA 4EG7A 2ZJ3A 2FI1A 3WWEA 3WOHA 6LDHA 3OY7A 2H4ZA 2KJCA 1D6MA 4OHYA 4BUZA 3FWZA 2YJZA 2RI0A 1ZSYA 3RC8A 3N76A 3PHLA 3CZCA 1P4RA 2VF2A 4AJJA 1TAGA 3WYBA 3E8SA 3CYFA 3MS2A 1RXCA 3ZZTA 3REFA 5EJ8A 2X1HA 1TQIA 2ZBQA 4W5TA 2OYRA 1Y8RB 2BOLA 2Z6VA 4JP2A 5C4MA 1M2JA 3KWFA 2UYQA 1MHTA 3FDIA 4EHHA 2J6BA 3JV7A 1YDHA 4LJ4A 3VO9A 3EPZA 1TU3A 2VAWA 1ZJ4A 4EV0A 1ISRA 5J40A 3JALB 3SVZA 2E36A 1WPXA 1EX7A 5EHXA 5GP9A 4I50A 3HHGA 4OXQA 3UKOA 2XGMA 2VKVA 3TOXA 1FCJA 1WV1A 3KDAA 3FMSA 2QI9F 2Z56A 4GVLA 4JB8A 2P9HA 4V0MA 1CG6A 1XTPA 2NZ2A 4PAQA 3RC2A 4CKYA 5ICMA 1LK5A 1U31A 4XB2A 3HVIA 5JECA 1Q15A 1ETUA 3TUZC 3TSYA 4Y17A 1VPVA 4B7UA 3BERA 3ZD9A 2QLNA 3TLBA 4UEWA 4LZJA 2GKGA 3D64A 4ACBA 2XZPA 2RGBA 4O2RA 4Z4FA 1U4NA 1BJKA 4JSRA 5T5QA 2JBAB 1AKEA 5KSZA 3WJ7A 3NAGA 1B4AA 3HRHA 2WU3A 2R2GA 3BMCA 4AL4A 2DPYA 4N3AA 4I1YA 3ROFA 1QJCA 2NOAA 4KT6A 2REBA 1G3QA 2PU7A 5T57A 4A0QA 4XRSA 4ER3A 4FFVA 2WAOA 2FE1A 5CDHA 4FBMA 4GUAA 4I4TB 3CNOA 4PLVA 2JLXA 3TEJA 4HSRA 3BGOS 3PC4A 4N49A 3WJAA 2ES4A 3K32A 4UVCA 1Q57A 3TSWA 4PG6A 1I7PA 4Y52J 2VDOB 5AK4A 3OQPA 2PL5A 4LMRA 1EFHA 1CNFA 3BH0A 3QX3A 2PR7A 4IQGA 3M1EA 4ZIRA 1AUVA 1XVTA 4QUKA 1PT7A 3V3TA 3MGKA 2GJAA 2CXPA 1X2NA 3ET4A 3KAJA 3N39C 1K8ZB 5JLJA 2HLDD 4ZVOA 1JLSA 1S5LC 2CG4A 4Y2SA 5JQGA 3NM6B 4G9GA 1ICEA 4HYQA 5CGZA 3IIIA 2XBMA 3K9CA 5FUMA 1ZKGA 2X23A 4RPHA 3GBPA 4EYEA 3GA0A 1MNDA 2WWRA 4N8EA 2O0HA 4HXEB 4ZQHA 4R2KA 1OREA 4DBRA 5EIAA 7REQA 3IMFA 2EG5A 2H0AA 4U6SA 3K72B 1YKFA 1LPNA 3MFQA 5FB2A 3A6EA 1M8PA 2JEYA 2Q3DA 4S05A 1Q7EA 1KJ8A 5EZYA 4L75A 1G5PA 2DPLA 3RRXA 4IKEA 3AHGA 2Q8KA 4GZ5A 4BBJA 1LF0A 4DRZA 1T4MA 4HNGA 2PLRA 3EXEB 3DAHA 1DIBA 4AKIA 1HRDA 1VTKA 1QP8A 3V80A 4A8JC 1A31A 1VGQA 2RN7A 1DIGA 3GZJA 3QU4A 1L7PA 5CA0A 2HZTA 4LJRA 5THXA 3WGYA 1JQKA 5H82A 3H6HA 4PXYA 1FSGA 3IV7A 1SUFA 1Z0FA 1XROA 5F6FA 4RDIA 5D3MA 5FWYB 3R3VA 2E2HJ 2ESNA 4NFYA 1B42A 1GLGA 3NWPA 4RZUA 4G5QA 2OFPA 2P4HX 3OA0A 1ZM2A 4INZA 3WNBA 3H11B 3O9ZA 4NYMR 3LA8A 1P39A 5BN5B 2ISQA 2O8VA 1A71A 3PYXA 1E3TA 1T3SA 1SOWA 2AMJA 3ZW9A 1MVNA 3I3OA 3MYRA 3J80A 3P52A 2UVQA 2QA4I 2W2PA 1PYDA 4PHHA 2B1QA 3AIOA 3TLXA 1SH7A 3MILA 4JLBA 5AJYA 4ER7A 4TN1A 3MLAA 4N0QA 3DB1A 3OSGA 3LQ2A 4UULA 4JX9A 5BWOA 4RS8A 2R96A 2DFTA 1GDDA 4YFVA 3QW4B 3E7WA 5J5AA 4PG4A 4F4UA 1G9SA 1A8QA 1TJ5A 1FMTA 1FFGA 1NIJA 1UL1X 3G2NA 1CNEA 2JN6A 3PFBA 3O8QB 4M6WB 4PSCA 4H6PA 5KB3A 4R71A 1IE3A 4ZI3A 1WCWA 1BRMA 2HU9A 3TVYA 5E3OA 3JRDA 3JAKB 5AKEA 4C7XA 3LDHA 1HNZB 2J5BA 2YR0A 3ICVA 4KN6A 5L45A 2WFLA 4YRNA 4XOTA 3K8QA 4I76A 5IVHA 3KTDA 3EPKA 1A9XA 5DWVA 3OKPA 1YCGA 1Y1RA 3FGNA 3RTDA 2LR0A 2RH8A 4A3DJ 4G5GA 1SWVA 1JEYB 3EVNA 3E5QA 4Y9UA 2H1FA 4OLHA 4CQNA 4EELA 2VOPA 1R71A 4KK3A 2IYLD 2CJFA 1YZHA 2OM6A 2O48X 2Z2SB 1DX6A 5I3CA 1M8KA 4B3JA 1VG9B 5AP9A 3RYFB 4OH1A 4MUJA 3UMBA 3IDAA 3ASVA 4RYDA 5BQFA 1NZJA 3HC7A 4AW9A 4GZLA 4CL0A 2IBSA 2H5IA 4G6DA 4IEFB 1B73A 1P18A 3COSA 1GCUA 2TRSB 4ZV9A 2ZS8A 3OEWA 2WNSA 4PYNA 3OYKA 3MPOA 4M89A 4BX3A 1BI2A 1A9ZA 3BOSA 3SC6A 5EQDA 2QX7A 1KMQA 1KXJA 1JSCA 4D8WA 8GPBA 2B4KA 2G5PA 1PUEE 3WBBA 1J21A 1QZEA 4GH5A 4P53A 4X85A 3QUAA 5H16A 3DT9A 2B8EA 2CNWA 2LREA 2PZBA 4HPWA 3KETA 2QVBA 3BSWA 2ZWIA 3QVTA 2L9SA 3DXYA 3DPUA 4OATA 4EJTA 5CD9A 3UB3A 1GAQA 4NESA 3IR7A 5LP6C 2B34A 1AKVA 4P7GA 3ND9A 4CLHA 1P72A 4CM8B 1MMDA 4UHDA 5BQ3A 1Z08A 2FW1A 2B9EA 3FDXA 2DY1A 1GUDA 4I2OA 1WW3A 1JNXX 1F06A 5FORA 4Q82A 4Z1OA 2DMPA 2VK2A 1E4VA 4J00A 2RNJA 3C18A 1I1QB 1UANA 2Q3MA 2X5KO 4C4AA 4EB6A 2KYRA 2VJ4A 4CEIA 2BZGA 3PM1A 4H15A 5JJ5A 2VHXA 1XJ5A 3E18A 1BCSA 3GHYA 3P20A 2MW8A 1K2WA 5A6SB 1KDOA 3K2AA 2NPOA 1RJGA 1G18A 1I6WA 1OHHA 3JAWA 5A62A 2XF8A 2FG5A 4BO0A 2ZGVA 3BJIC 1JU9A 2JFPA 3V6LA 5DJ5A 1O58A 1PEDA 2X19A 1W7PA 3BXHA 4I1SA 4TMKA 3WHLA 1N7IA 2YWEA 3R0AA 4QD3A 2QMZA 3LAPA 5FA6A 2Y69H 1J9IA 9ABPA 4L02A 4TL6A 2ADUA 4Z3KA 3HCRA 4ZZLA 3TS1A 1ONVA 1T8TA 4JJ4A 1JAXA 4BHCA 3A02A 2P41A 1Q22A 4GYJA 2V6CA 2Q41A 3NJ8A 2P6PA 3R2JA 3QKWA 4JH0A 4JUFA 3PFIA 1R6DA 5DWQA 5KZMB 3N7AA 1NBMA 4F45A 5TF4A 1PEKE 1P6UA 2UZ1A 1D5VA 1M67A 2QT9A 1PVDA 5IW8A 1THGA 2QWXA 1HOMA 3WLJA 3CVJA 1VPTA 1ZH8A 5MGNA 4JC8A 3MMXA 1QLHA 2XA9A 5FTWA 4C7BA 4C1NA 2F8TA 1DLJA 3HRMA 4EKIA 1PR4A 3UV7A 1XRRA 1RWKA 4OBBA 1NVKA 3ZMSA 3C8UA 4HDAA 3ST7A 3OIVA 1Q5PA 3KSAC 5FFZA 1R12A 1YD7A 4RDCA 4J9VA 2ZUFA 2BVMA 4QRDA 3I5XA 5M3BA 2H08A 1YFJA 2QL5A 1J1UA 2AEEA 1WUHS 3L0CA 2H1OA 5K5QA 3HKDB 2XB6A 1JR6A 5FKKA 3W8RA 3LLCA 2WFAA 2FFRA 1KJZA 3D8UA 1NYTA 3FYHA 3F4BA 1YB4A 2GEBA 1UPXA 4XEUA 3D2CA 2QV7A 3L8EA 5K0JA 1MDFA 8ADHA 4MLCA 2L3DA 1GHTA 4W5OA 3H83A 1M2FA 2ZYDA 1JPVA 4D98A 1L3BA 3CZAA 2V7BA 4OEHA 3W90A 2BGLA 1UJ2A 4UMFA 3SP1A 3ZK7A 2QM3A 2NW6A 1QE0A 1RRVA 4CT0A 4BEWA 3P71T 1O57A 2WKRA 2G04A 2ILVA 3D5EA 5FULA 4S35A 3HVJA 3MZHA 4MUMA 1E1CA 5LUAA 3LQ1A 1DADA 3U9LA 1MZPA 4Y33A 2Z5FA 4LZWA 4AIDA 1JAZA 4X60A 1AQ6A 2RAUA 3FROA 2EFPA 1VHTA 4NR0A 5AWFC 4Q1FA 1RJEA 2P6RA 1Y3FE 1MV5A 5TS2A 3CS3A 1I9CA 1IHDA 3PO3J 2FGKA 5IVKA 4X61A 3W4KA 2M7BA 1T2NA 5DK6A 3AEKB 2OBPA 4XJSA 5JANA 3JZMA 1AQUA 1KS9A 3LCJA 4C4SA 4UM5A 2R3SA 4BCBA 2HV8A 3ZWAA 5IKPA 2XT0A 4OTZA 2NADA 1X13A 2NUAA 1JL3A 3HZZA 4B81A 5H7XA 3RRBA 4UQPA 3D7RA 2CMPA 1NUHA 5EIXA 4A0XA 2JPCA 1II0A 3A9VA 1GCAA 4TL7A 2EKPA 2P2ZA 1OXMA 5DLDA 2IEZA 2H17A 4B4UA 3A11A 1CUIA 1V55H 4TV9F 3QPAA 2ORWA 3KXKA 4A8JA 2XWSA 2EOAA 3N70A 1W35A 1PEYA 1K8XB 1JBKA 4NPAA 3IRVA 3DCJA 1H23A 4KSBA 5C1BA 4U88A 2R6ZA 1G8HA 1IZ0A 1YFKA 3TMKA 5IDXA 5FPKA 2LCFA 3BQNB 1YOVB 3NHYA 2CNWD 2R6R1 3JQBA 1NF9A 1Y3AA 3R5SA 2NPIA 1E77A 4ZHQF 4GOLD 2FWRA 1SJ9A 3Q1LA 3MSCA 4BUCA 2XUDA 4WZ6A 2A61A 2QM8A 1XLVA 3D8SA 1QPMA 3NEJA 2A1IA 3DTKA 3Q72A 4NH4A 4XLNF 2NZUG 5FJJA 3GRFA 3RUEA 4PS1A 4D7MA 3WTCA 2CUKA 2YXPX 3EWNA 3I1FA 3RI4A 3ND5A 1ZK2A 1E9CA 3WS7A 1DEOA 1G8PA 3F3SA 3KPVA 1OSNA 1BVHA 1P7YA 1IV8A 1UKYA 3CZMA 3JYPA 4L4ZA 5HXAA 2B92A 3PUYA 4XLFA 4B6FA 2ZSEA 4RD6A 1U1GA 3F6CA 1S5PA 3RREA 1MC5A 2QSJA 3I71A 3CTPA 2XNCA 4LHZA 1OHHD 4TWZA 4MGKR 2F8MA 2IOFK 4UJ5A 3ZP5A 2UZKA 3JYNA 2RH9B 4C01A 3CMAI 4YUXA 3VKVA 1JBEA 1W7PD 4FU0A 5DHRA 3M6XA 1J6UA 2NO4A 1XLWA 1E0JA 1F5TA 3R6WA 2C3OA 3PKIA 4DBLC 4R9SA 4K9DA 2HHJA 1KYYA 4G56A 2EBIA 1IOZA 3C1TA 3NTUA 4LSWA 3L5OA 5AONA 1SRQA 4MQ9F 2M8EA 3CP2A 1VSVA 3LCCA 4TMXA 3DWGA 1OLTA 1ODIA 2C4UA 3O2PE 5AYVA 3WRXC 3C74A 1NBMD 3JQ6A 4WN9B 1J90A 1JR3A 1Q0HA 4AMZA 4QZVA 4HFJA 4D0PA 1Z4QA 2P2YA 2FBKA 3ZVNA 3ZGNA 1KGDA 4LX8A 4BNNA 4KMUX 2ASEA 5AM1A 2QRNA 1I6KA 1SG6A 2B37A 1RYMA 1ZD3A 4KJXA 1XEWX 4GZMA 4HDMA 4YEJA 4BTVA 1HUQA 4RTNA 4KQIA 3HGYA 2OC9A 3HJCA 1NTCA 1Z6GA 5JVDF 1ON2A 1ZP6A 2LG4A 1Y48E 3ETJA 2EGUA 2CZCA 1VSBA 3ANSA 2LCIA 2PWAA 3ZY6A 4O6JA 3P26A 3U44B 1KSGA 1EXNA 2VNSA 5HNHA 2PMCA 5HZMA 1NNSA 4MB6A 5JQWA 4BEJA 1RWOA 1ORDA 3TL6A 4FMCF 3LYUA 2AK3A 2X58A 1M7GA 2YYSA 4DT1B 2HLNA 3TGNA 4EM0B 5LXTA 4NPHA 3LP6A 5JZSA 4MSUA 2Y68A 1KMCA 2H1KA 3TMAA 2H4FA 2YQ4A 3CKYA 5WRFA 4DV1B 2Z04A 2LSOA 1DMRA 3WTUC 3C0KA 2XH8A 1U0BB 2JUGA 5LDHA 5D6OA 2JJ8A 4C7MA 1Z47A 2Y0SA 4TV9B 2BGMA 1JJFA 5U4XA 4MA0A 1VDZA 4R8KA 2TDXA 2Q3JA 1QPBA 2L0XA 4WXMA 4NVRA 2SCUA 4KP7A 2WHRA 1ZTRA 2IZ6A 2VC0A 3O8DA 2FF5A 2JHGA 2IKSA 5EAIA 4LLLA 2M0CA 3TVTA 2ZRQA 4OIOF 2GWRA 4DBZA 3KQUA 3EZNA 5ALSA 4Y2XA 1IEXA 2YOFA 3FWKA 4M1WA 5CEJA 3AJEA 3G9ZA 4CGYA 2CXTA 1DDGA 4L6AA 4WNIA 5BV7A 4QSHA 1QFZA 2J5XA 2X2PA 1QH1A 1ITZA 3T1YB 4DR7B 4P1ZA 4COOA 3WL4A 5F7XA 4C20A 1E1LA 4ZHQB 2QN6A 2E35A 3FZYA 3OE4A 3WHCA 2WB1N 1G4HA 2HJRA 2DPDA 2PZEA 1J39A 3R20A 4XBFA 1IN7A 2B9VA 2R25B 2RFLA 2IY9A 4IOMA 3EVZA 1W48A 3ZBUA 3SE0A 5IBCA 3P7MA 2A1UB 4FZ5A 3VR1A 2A9RA 5I8WA 4LJAA 1XRMA 2X0RA 1QH8B 2FD5A 4L8GA 3OMXA 1LX6A 5EPEA 1KEEA 1JQAA 3IP8A 4F84A 3CNHA 2VKHA 4FUTA 4EYGA 3OZ7A 2R47A 1AHIA 1LDNA 4MX8A 1W1WE 1DC6A 5A0TA 2I7XA 2AEMA 4NC8A 2VJJA 2ZAIA 3PEWA 4KBGA 4IIXA 2REQB 5FO1A 5EIBC 4M6XA 4OHUA 3EAQA 3RIHA 1G3SA 2CD7A 1CQXA 1G2QA 5BPHA 4Q3NA 4XYBA 1WVMA 1EUCA 1O5OA 1X3LA 4HS9A 4ETWA 3HKEA 4CWAA 1T8YA 3Q7PA 2VC2B 4NCXA 4R2XA 1QTNA 4H1HA 1QKJA 3O9MA 2Z9BA 5T64A 3WGNA 3ZQKA 4EA8A 3AI1A 5F3DA 3KLNA 4UAGA 1OV6A 4WGFA 3ED5A 1ENHA 2PUWA 3R3WA 1OB2A 2DPMA 4ERXA 4IV5A 3O4GA 1TRKA 4KJZA 2ZBPA 3KPWA 4FONA 1TBXA 5H83A 3PX2A 1NK3P 4P5DA 1G60A 1U8TA 1YVUA 4ZAXA 4M0EA 4WCFB 1PLLA 2AC4A 4HZUB 4DLLA 3GT7A 1ZD9A 5FLXK 1H05A 2ZUUA 1ZH2A 5FF9A 3RRJA 1KI7A 4RH0A 4EABA 4M99A 2JIDA 4HV4A 4WLOA 4OJMX 4RK0A 4IDDA 1UOEA 5JVDB 3ZJTA 3CJNA 2I1WA 1U2RA 4ZC1A 1XEXB 3ELUA 2XRYA 5FI1B 3B5IA 3BN3A 4XGIA 1JT0A 2DLLA 1WEHA 1M2EA 2BHSA 4K2AA 2WWYA 3RW9A 2I2AA 5CP8A 1YUNA 2WYOA 1TFUA 3NTXA 2HOQA 5H3HA 1FTYA 4MVYA 1U0NA 1FXSA 2G9RA 3S2HJ 1WDMA 3TRHA 4XSZF 4FMCB 1JR3D 3UAGA 2HVQA 2VPZA 4NMHA 4U0JA 3NV7A 4FTHA 2CFSA 1RXYA 4AF6A 3ZCSA 4Q21A 3LNQA 2QM7A 1IHOA 3D2BA 1ZCZA 1ACJA 3OJOA 4UNQA 1B41A 3PRKE 2OZEA 3AF1A 2QCOA 4H16A 4NYJQ 3N58A 2W2OA 3T1TA 1JUPA 2OO5C 2GBLC 1UCRA 1BHSA 2DYSH 2L17A 4MKGA 1PR1A 3AY0A 4JI3B 1EFLA 3M1AA 1P92A 3N7TA 4A2QA 2ZB9A 4CMIB 4AT1A 3ZNQA 5FOVA 4EMUA 2XGJA 4AY6A 2I2DA 1YK0A 4LZNA 4U7DA 2IJLA 1CQIA 1OYOA 5HTKA 3IKMB 1CBUA 3LOQA 2I6GA 2JLVA 3WDSA 1KI8A 1E7MA 2E2JJ 5GOZA 1W0KA 4DE5A 4NOLA 1H2BA 1OASA 3EVFA 1GTSA 3CLSD 3EXG2 3EIHA 2GKSA 1TQHA 4OQDA 3FZEA 1RYNA 2OCBA 3PQ6A 3ZNNA 4LXIA 2R8RA 1V5WA 1CERA 5AI8A 4C9BA 3NHKA 2ZJ1A 2LY1A 2JVKA 3G7NA 1GSHA 2BUAA 4D96A 5BW4A 4DC9A 1WB4A 1Q74A 1SVMA 3Q0IA 3HCBA 4BV2A 3W5BA 4Q4CA 1CDDA 2A78A 4NECA 1E8NA 1E66A 2ZBDA 3D6AA 1T5IA 3TW6A 3WICA 4HBGA 5K0CA 5K3BA 4FFMA 1U5TC 2C2BA 4HGOA 2ZT6A 4N6OA 2FQ3A 1MF7A 5SY4A 5IASA 2OZVA 3JPWA 1JALA 2CZGA 3LC0A 1ZQ3P 3OYDA 5AKZA 4P55A 4N18A 3W7BA 1NATA 3HO1A 4J94A 2FUG1 4RMJA 1XF1A 1DL5A 1JIIA 3W6JB 2I4IA 4EI8A 4ENKA 1TCAA 2ZWPA 3JVVA 1ETVA 4D81A 2R7VA 4J76A 4TS1A 4MVJH 3D5LA 5LBTA 1DX9A 3GYHX 4JLUA 3J7AY 2CNBA 3HB7A 4PZDA 2ID8A 2OV4A 3A6JA 5KJ6A 3M1CA 4XUCA 3FTEA 2HS5A 4ECAA 2X76A 4YASA 3K9WA 4YRIA 4MFEA 4FLMA 3RS7A 2MD5A 4IZHA 3DKYA 3E53A 1XO1A 4UDYX 1GQYA 4U7TB 2ODQA 1NHWA 1WZUA 1XN4A 3NAUA 3VJLA 2ZRAA 4JV5B 2D00A 4OGGA 3VR3A 1W5SA 3PU6A 4FDLA 2VHQA 1DGWY 1L4NA 2ICWG 4C6RA 4R2WA 5H20A 3V4FA 1R66A 3BCAA 4KOAA 1U2GC 4MVXA 5IKMA 3TQFA 1W49A 2WHPA 4ZP1A 2A0WA 3EWIA 3UAOA 4MH0R 3P9SA 5JBQA 3OQ6A 3MJFA 3SIRA 1VKRA 5DXAA 1VJCA 3MS4A 4DLBA 4UHBA 2W70A 1U3GA 2M9MA 4E4RA 4A27A 2FDCA 1QQAA 5E18F 2ZJQF 1ZDMA 3PFFA 3WVNA 2IA1A 4ZT6A 1MIOA 4WBNA 1T35A 5MN5A 3R60A 2XV1A 5FLXA 4MS4B 4ABTA 2DQLA 3STYA 5ALPA 2NAFA 3SR4A 2QTAA 2PD6A 4HX9A 4XWKA 1J24A 2BGGA 3LVRE 3SJ7A 4ZI7A 2VQ6A 4OAOA 2GN0A 1EF4A 2IC5A 1ZRCA 2IYNA 1Y4UA 1UBCA 1Z6XA 2O57A 3PZBA 3TNYA 3OIFA 1B8NA 2A8YA 5GVRA 2PUHA 1I1HA 2ZSIA 2AVNA 3K6KA 3BWBA 4O2LA 3ZLVA 3DHVA 3OTIA 2I91A 4RGVA 4MROA 4N9QA 5JPIA 1U9IC 1RI4A 3IE0A 3DKIA 3PTZA 3FYSA 4RVCA 2JZCA 2BHYA 4NYIR 4GPTA 3LNTA 1VLQA 1B1AA 3S40A 4RFSA 2Q0QA 1T15A 1B2RA 2E3JA 3PE4A 1XVAA 4P80A 2CXQA 3TLJA 1BMQA 2EYQA 1CF7B 5JCPA 1GZ7A 3GVPA 4W9MC 1JPUA 1WXIA 1E7QA 3LUGA 4AZ3A 1XK6A 5LN1A 3LQKA 1E2FA 3OUUA 3GZ5A 2JZYA 1CB0A 1USSA 4IQ8A 2NN3C 1BYIA 2GF2A 2UUBB 1YTLA 3TM5A 1Y7LA 1HSTA 1KWKA 4TMZA 4GXQA 3UXMA 3OHMA 1LSSA 4Z6KA 4JSTA 3OLVA 5C4GB 5B6PA 3K6JA 5CYGA 1P9NA 4CCAA 4D9EA 4EG1A 4C7OA 3UGQA 3K94A 3RWBA 4IV0A 4TXJA 1GNPA 3MUOA 3CW2A 3RTGA 3NH6A 4OK3A 4URXR 1WHTA 4J0DA 5ELLA 3SBXA 3I4PA 3BTSA 4DWVA 1P3Y1 4AJNA 1TGVA 2F9FA 1R1VA 4M53A 2EKDA 5KYGA 3QELB 1MAVA 4PQEA 3HO6A 2WWWA 4G3XA 6REQA 1Y6FA 4DMMA 4GP6A 3ZKAA 1TW3A 3COZA 4R51A 1W0KD 2CU7A 1U6KA 4AIRA 1KPHA 3TE6A 1CRQA 4Y15A 4FMBB 3COWA 2FMLA 3CWCA 1JW9B 1R4MB 4Q3BA 3RRYA 5E1OA 4LHVA 1CJVC 4DUGA 1Z6QA 5A4DA 3D54D 4RK7A 3FKJA 4UXIA 2JGKA 3BMXA 1CUJA 1CXZA 2JFWA 2QMEA 2W2XA 5H59A 4MKXA 2F3UA 1FA9A 3FJOA 3B6ZA 2FE3A 5AI9A 2MSNA 4UVGA 2FH5B 1L4YA 1FOKA 4GICA 5KAPA 3A3YA 3LSJA 4U7BA 3G0IA 3GL9A 3R9KA 1U99A 2OOSA 1NW7A 2HHCA 2YHUA 3OE1A 1P75A 3IAS2 2G8NA 5JAIA 2P2DA 4HDKA 2EAUA 1PVOA 5DYYA 3H9JA 5HZGA 2X14A 4LQDA 4XORA 3SJUA 4IRMA 3HU2A 1H0MA 2E34A 1X1SA 3WTBA 4HSGA 4E7PA 1D4AA 3IOCA 3SZUA 1NXPA 1H9TA 3UICA 2O2XA 4P4NA 4MWBA 3HTXA 2AQKA 4ZOQI 1SCIA 3PD1A 3V8VA 2A9JA 3V7NA 4L3VA 5C7OO 2BUCA 1IOVA 1ID1A 4XICA 1MNQA 2PEXA 1PS8A 1FX0B 2F3RA 1R18A 4OA5A 1KFKB 1MC8A 4P5PA 1F0KA 1Z0JA 1J59A 3SZGA 3QKSA 2H1VA 2JAPA 1Z3IX 1GV1A 2BEVA 1HW5A 4LJ9A 4DY4A 1L5QA 4HX8A 2F1KA 1QS0A 3PVSA 1GPYA 3TRIA 1XZLA 1KDYA 5CFPA 5DU2A 4NZPA 4BU1A 4R8HA 5BORA 3JVUA 1BA2A 1DDOA 1Q1ZA 3EC7A 3N2GB 2VKTA 4NSNA 3VR3D 3D1LA 4PZCA 3DLAA 1N8NA 1C0LA 4AM3A 4TKVB 2DTEA 3QPCA 3CB4A 1V5EA 3PEVA 2DU8A 2H0QA 3EEQA 5BQXA 1EWKA 4Z4IA 4Z4QA 1YS4A 5KOHB 4BEVA 5IAEA 5SZHB 4WHMA 3AR7A 2YZKA 1UWKA 1W73A 5IUJC 2Z57A 2GFHA 1WJCA 1J2YA 3VC7A 4YUAA 2Q50A 1Y6GA 4Z4HA 4C0XA 1FYDA 4XE5A 2HK7A 4EJWA 1B72A 2HLHA 4HAVA 1KQ3A 5KNBH 2H0RA 2EZ9A 2POCA 4Q03A 2OXTA 1DQUA 5D8KB 3OTGA 2GCGA 3DPLC 3FPFA 2VBIA 4BZWA 4KO8A 3PJGA 1GHCA 2QLTA 3CU5A 2OESA 1ECPA 3TP3A 1PZFA 1JEQA 3GI1A 3RC1A 1Z3XA 1NX6A 2HPVA 2K4MA 3BK1A 1EMDA 4GC9A 4RTKA 1FSSA 2QPTA 5J1RA 1LNSA 3N2LA 4D9FA 5I7EA 3JU3A 4GPAA 4C7JA 5FFFA 4NBWA 1G2PA 4IRIA 1GILA 1KYQA 4LCJA 1KI3A 3DD5A 2BZ1A 2FN7A 4H7KA 1L8AA 4WV3A 2QTVA 1XCMA 2IIVA 5LNK1 4XVCA 1FRNA 4EEXA 2XZLA 2LIVA 3MZ0A 1QM5A 3TQOA 4QBFA 4NRDA 4BLTA 3VX3A 1KORA 4KEAA 2AN9A 3UKJA 3TYXA 3URMA 4EWLA 3TSCA 1Z74A 2EQBA 3QUQA 3RG8A 5L3VA 3MM4A 2HK6A 1QB8A 3ZZMA 1F38A 3Q3VA 1NUQA 4Q7LA 2A9FA 4DR4B 2XUIA 1ODJA 5G0VA 3T0FA 2K87A 2WAQA 4C3ZA 1QO7A 4U6NA 2WUDA 1Z16A 3KV3O 2C99A 2J9RA 2D45A 3ER6A 1C9YA 1PTJA 4B2PA 1GPKA 1IBLB 3M8FA 5B30A 2VLIA 3FNHA 3VDRA 2O7VA 2GOYA 3BBLA 5DGIA 3BXZA 4LGYA 4IYJA 4AU1A 4TLCA 4LV5B 4L0QA 4GS5A 5DBEX 4Y2JA 4MOWA 4AUMA 3ZGLA 1F1BA 2VE8A 3FYTA 3NVDA 4O1MA 2FLVA 3DKPA 3HKBA 5FI0B 4E94A 5K0FA 1C1XB 4IS3A 2E49A 2ZJAA 2ADMA 2AQHA 3CUSA 3QXSA 3HIFA 1YHYA 5AIPA 3EF0A 3GEHA 4UTPA 1V43A 1LLFA 3D6TB 3OFSA 1XQ9A 1P80A 4EMSA 3F5SA 2J3DA 3B8EA 4YJ3F 4OBXA 4DUGD 2LK2A 2PMZN 2F3TA 2FP3A 3ERED 4JWKA 2TRTA 3BGVA 3QH4A 1NXOA 2IHZA 2OCIA 3O75A 2GWHA 1FSPA 2E1MC 3D0OA 3CESA 3KOXA 2BHRA 3I42A 5C37A 3TI7A 3N8NA 4GRAA 3QHQA 5J63A 4JJ6A 4LG0B 2X1VA 1KMNA 3A28A 2XAFA 2G40A 2PO5A 4WH0A 2XUOA 1P5HA 2EH3A 2F5VA 3EF1A 4NU0A 5K0LA 2JD2A 4EPRA 2R65A 2RBKA 1C3JA 2D0DA 2XMRA 2QW0X 3OVMA 2FSIA 3GAAA 2IITA 4HCJA 4M9XA 4O4LA 4G07A 5KYNA 3ZKWA 5BNFA 3I4NJ 2AMLA 2JGMA 2RGEA 1L7VC 4KIJA 2R7DA 3OZDA 3ECSA 3RYIB 2YV3A 1P45A 2FX3A 1H2HA 2JHCA 1R8QA 3KPHA 3PV0A 3DZIA 3MFKA 3MRSA 1XMXA 3CMCO 1VE9A 1KY5A 4DDUA 2FWPA 1Z12A 4UNNA 4WJKB 3SIWA 2COBA 2CEAA 3R76A 1FU7A 1R88A 5G3ZA 1JHUA 1X80A 1TT7A 2LD4A 4DCSA 1JHYA 4TTJA 1VI2A 3RANA 3WQBA 2EFGA 4G25A 1ZOPA 5HKBA 1GCIA 4Q4DA 1IRGA 3TINA 4JK1X 1C7FA 3BZWA 1MBFA 4BP9A 1LE8A 1DKLA 2QORA 4OGKA 2M6KA 3UT5B 3B3QA 1N6PA 3TX2A 1ZMXA 5B36A 4YRAA 5EJGA 4XLCA 3S32A 1FTWA 4YAFA 1I4WA 3JZFA 4ENMA 1Y8QB 2HQAA 3M6WA 3GXBA 1I80A 3FGZA 2VBYA 3WLLA 4FE4A 4WPGA 3EISA 4ZGGA 2QL6A 3L7JA 4CDMA 1IZ9A 3QLJA 3DFZA 2GN2A 4IGKA 1MEOA 2IS1A 4ARZB 4EB0A 1G1AA 4TXHA 3B12A 2HRCA 4MTDA 1JDUA 4L9SA 4NARA 4K6HA 5IHXA 3CVXA 1Z18A 4XLPF 3B38A 4DA9A 3G9XA 3RJMA 3ZWDA 1CZUA 3GUCA 1T2UA 1S7EA 4JVNA 2XZTA 1YR3A 1BJRE 2GBYA 3I9FA 4YRMA 1XU7A 4K86A 1P0FA 1ZOIA 4MAFA 2FA5A 3AHHA 3BR0A 2Y6UA 2O8BA 2OE2A 4C5BA 1DKUA 1A6IA 5DM2A 2WPNA 4C6SA 1MQSA 2XJ9A 3NDBB 4BNIA 4OK5A 3HH8A 4UMEA 1PWEA 3KQSA 1Q2UA 1R5NA 4V03A 4I1RA 4NY1A 1CY8A 1G7SA 1P4GA 3ZLTA 5DTJA 1DCKA 2QQEA 1EWVA 5HCIA 1SU6A 3RKSA 1R0RE 5HSGA 1XZKA 2CW0F 3SYRA 1OIXA 1P4WA 3TZKA 1X7DA 3X1KA 1VJ1A 1WSWA 2VA8A 3R3JA 3GYGA 3BLYA 2XCSB 1RXSA 5LYYA 5JLAA 5CH3A 1M5RA 3KHUA 1MEEA 4A0RA 2EZHA 2I7CA 4PSVA 1IZZA 4HUJA 3T0YA 4KQWA 3MUFA 3ZE7A 2PQMA 5FBKA 3WLEA 3H3XA 1AC5A 3E81A 5UKDA 4C89A 3UV6A 3H3VK 2C9ZA 4KH1A 3Q6MA 2ZDQA 3DZFA 2DOEA 1VL0A 3EE6A 4H08A 2NVTJ 2FZVA 4X6XA 3IIMA 4YJ3B 4GSYA 1PK8A 1V3FA 1WXQA 4HG2A 4OHCA 1V47A 1ZH4A 1Z67A 5E2BA 1E3DA 2FEOA 2AQEA 1QFXA 2FSPA 4II7A 5ALQA 1OX4A 2IDKA 3FOWA 1DS6A 2JIPA 5KINB 1GGHA 1QMGA 4DIOA 1FBNA 4OF4A 3DOOA 5DBFA 2MTBA 4Q6BA 3NRCA 4XDYA 4ZJUA 1ORIA 2HAEA 3EK2A 3FNIA 2M4KA 1RC0A 1NUUA 1DIHA 5E3IA 3A1DA 1YHZA 3ABSB 3O2NA 1NBHA 4KDPA 4HKTA 3DJFA 1MB3A 2P65A 1YB6A 1E9FA 5AXAA 5LLSA 4WZBE 5ALMA 3QBDA 1XHEA 3H7IA 1SCAA 3GLXA 1X1PA 1L7AA 4R8RA 4WDRA 4CCYA 4JOCA 3HP1A 2IPOA 3RBVA 1UINA 4RSGA 3RLFA 3C15C 4EUHA 3BMNB 2RKHA 4F2WA 3L4BA 3IRUA 3MCTA 1DJOA 2OB1A 1UKBA 3JQBC 4ER0A 1GFSA 1QTRA 3QKRA 3QX8A 3UH0A 2IGNA 3CJTA 3LFHA 4IRGA 4QU0A 1OIWA 2HKOA 4JBHA 4NS4A 4JEHA 1AGRA 1LDBA 3JQEA 2KHZA 2F4IA 5C8ZA 4AJHA 2L42A 4R83A 2XI4A 3T9FA 1QRUA 5HNKA 4XUDA 2QQ5A 2YW2A 1YS2X 5CFLA 1P73A 4EKNB 1RABA 2PD3A 2WR8A 3AM4A 3HL2A 3T3HA 2FW9A 1T24A 3VWBA 2O50A 1A6QA 2FZWA 3IERA 5A4FS 2ZOSA 3ZGYA 3UTDA 4L78A 4U8HA 3DJYA 4IL6C 2XRMA 1IN5A 1ENOA 1E3QA 3AF3A 4A4DA 2PH3A 5EZQA 1NSTA 1NOKA 4MO2A 4PYLA 4CCSA 4IDQA 2Y3IA 1QTIA 3I45A 4KR2A 4DEXA 3D6JA 3U0VA 1E69A 2CVPA 1O08A 2D1RA 1DBSA 2D2EA 1VRVA 2H4HA 2KMUA 2IZZA 5T4FA 4D74A 2OY0A 2G82A 2HBYA 5ES4B 5IZ4A 2ID6A 1QPZA 2OCLA 3RABA 4BLRA 1KPGA 4B46A 4O0MA 2W2KB 3PQEA 2FMKA 3B1FA 2PZJA 1YZNA 2NRAC 3AUSA 5BPDA 5A1TA 1RAGA 1Z26A 3UMCA 1KSFX 3RUAA 2JA5J 3PUJA 4GX5A 1H0SA 4LZOA 1KR2A 1U7OA 1KY2A 5BUQA 4UTZA 1TTHA 2A86A 4BO6A 1WXXA 1DRUA 1A96A 2R62A 1SUIA 2X8LA 1G0NA 4LS3A 1XPUA 3S7ZA 4R1UA 2I34A 1EGQA 4S1NA 4X1IB 4AFNA 2EBWA 3HXPA 3VR4A 1AUXA 2BV6A 1RM3A 4GL4A 3LK7A 2ZB4A 1YHNA 3HFGA 3OPNA 3NC1C 5CVDA 1PW5A 4RSHA 3ZGVA 4XKJA 5I5GA 4ZO8A 4FQ5A 3A4NA 4FMDF 1E3PA 4KACA 2Z4RA 1DDIA 3P9CA 3DL2A 4M0LA 2QENA 4AY4A 4RACA 4EGZA 4ILEA 5B4VA 1TCVA 3E22B 2ZSFA 1YR9A 2WAAA 4NJMA 4BWYA 4L95C 4YXFA 2J85A 3KCCA 2GJ8A 2R1VA 4ZCIA 3U80A 1LUJB 4PFOA 3AVUA 4JBAA 1XU4A 1KSHA 3CLSC 2OGUA 2Y71A 1EWTA 4G84A 4LF9B 3FISA 5TPWA 1Z82A 4BTLA 1XRQA 5JH7F 1X2EA 1THMA 2YVLA 1GITA 3EB9A 3F3MA 3RYRA 1TL8A 4QICA 5LMCA 3I73A 4ZZDA 1BX0A 1L4UA 1OCZH 5AW2A 5CX1B 5JYCA 1FDOA 4GKAA 4KR7A 3M1LA 3IL2A 3B73A 5I4KA 1BXGA 5AJTA 1JHOA 1YUMA 1PD1A 4E7KA 2IW1A 4GP7A 2GPJA 1WP4A 1QIGA 4KVGA 4QU8A 5ESXA 1I14A 3B6AA 1JHAA 1R4ZA 1DP3A 1OXKB 1BI1A 1VMAA 4PZLA 2C84A 3REGA 1ITYA 4XLZA 1OYWA 2IELA 3RS5A 4FDVA 1R9TJ 2DFDA 3ZI0A 1XLTA 1SEPA 1BH6A 1XQXA 2C2MA 1QHIA 3FTFA 1H42A 4Z3OA 3ZIAA 3V32A 2MIIA 2OG1A 4MIKA 2D5LA 3GK3A 1JF8A 1RFGE 1L3IA 3EWSA 1OWLA 3OS0A 5IMSA 3U4QA 2A14A 4KAFA 2HMYB 2WHQA 5JSKA 2C7QA 3E5RA 1QH0A 2QX6A 3KAQA 5AW9A 2EXXA 5KWIA 2VJMB 1VPLA 4N5MA 1J9GA 4LY9A 2QOEA 5BQTA 5JRZA 4YACA 2ZVPX 5JCXA 1Z4NA 4HAMA 3B1YA 1JZSA 2AFIA 1DAKA 1AN9A 3DMTA 4JJFA 3VYWA 2VUSA 3L77A 3LUPA 5EYPB 1GRQA 2JARA 1VHJA 1M7BA 2LNDA 2NS8A 4P4LA 2XW6A 1P17A 3HFJA 4ZVLA 3HJAA 3UQYS 1OLXB 3RQIA 5FQNA 4ZC8A 1IG0A 3BJMA 1GVNB 3D0KA 1B59A 4IPTA 1OI7A 3D3WB 5AI6A 4X97A 3KNZA 4R1MA 4IMIB 1HGXA 4DIFA 3R6LA 3QNMA 2Z0MA 1T2KA 5KYYB 2DA4A 2I9KA 1SVWA 5ULLA 4MHSA 1EFVB 2H29A 3SHQA 2HM7A 3C3YA 2IEIA 1FP1D 3MMPA 5I51A 1EXWA 3Q3IA 1FRZA 2WWVD 3AUJB 1FUIA 3AF4A 4RHYA 3HR7A 1GTVA 3RDPA 1SBTA 1UKVY 4HLNA 3REQA 2R7QA 1ZRNA 1M0WA 4RH3A 4Y13A 5LC1A 4BVHA 2WY2D 4WI1A 4MA5A 3UK2A 1NYQA 3NVMB 4J43A 4A0FA 1J97A 1NXSA 2OZLB 3MT8A 3BCUA 3A1CA 3U4AA 4UOZA 1UHWA 2WKPA 4XLAA 3LSGA 5PNTA 3OTOB 4HEQA 3U7IA 1UHMA 1P6RA 5H0IA 2Q5OA 4IHAA 4B31A 3G85A 2A5FA 2WUVA 2KIQA 3LFKA 4KU4A 4Y7CA 6ABPA 2Q1UA 4CTNA 3THOA 5K8CA 4WA8A 1ZISA 1RPTA 2ZI4A 3IVRA 1GZ3A 5BN4B 1IO2A 4FW8A 5CLFA 3F6OA 1O89A 1Z4MA 1VIYA 3W6VA 4GSKA 5IYZF 4DTCA 5E1DA 1F2VA 3KEYA 3OQIA 5J6XA 2XDAA 5JRDS 4GMFA 4HC4A 1H93A 4JEIA 1E18A 3AOEA 2WZCA 2QR2A 4PZEA 4D5EA 3AUKA 2E1CA 4FMDB 1ZL2A 2H2DA 2PGNA 3RADC 4BE2A 1F4KA 4GPIB 2PXAA 2IVZA 2WU8A 3AI2A 5JRJA 3HS3A 2QGFA 5LQRA 2ZIUB 4LV8B 4OHMA 5D5VB 3M83A 4RJLA 1IIBA 4CEJB 2BFAA 4WSOA 1BS9A 3IEXA 1ABBA 5EUBA 3RO7A 3C3WA 3H1AA 2MBFA 3QRFF 1PJAA 3U1TA 1VQ9I 2CNKA 5JH7B 1O03A 3L6CA 2R9VA 1XZCA 2QY6A 2B4AA 2NNNA 2FMYA 2RMKA 4OJKA 3PIPF 4BRWA 2EEZA 3S8EA 4IHJF 1R74A 2XQIA 1TIPA 2ESHA 3VR4D 1QC5A 1GY8A 1FRVA 2PQ6A 1NXXA 5DCFA 2B0JA 1D2NA 2OZUA 1GSIA 1IF1A 5TSDA 4CU2A 1UFKA 2VDKB 4I2VA 3EVAA 2FW6A 4MLZA 5BSVA 3LX6A 1R4NA 5BV1A 3AKZA 1V1MA 2I29A 4NC6A 3F5FA 2R7LA 3JQGB 4ABYA 2GAAA 1XPRA 1W75A 3SF0A 5K0GA 2NSDA 4HATA 5BSFA 4ND7A 4XUGB 1WV0A 4PYQA 3G6WA 2G06A 4RBOA 2R7SA 1Y5MA 4O63O 4HWSA 4I5FA 2BTOA 4ZDWA 3QIAA 4JITA 4WTOA 4AZVA 4EY4A 4GYYA 3P5SA 5JSFA 5CNIA 2R66A 3A6DA 3NHRA 4LN1A 3M8JA 2M3AA 2W6MA 1CETA 3HJNA 4YECA 1LJUA 1BFKA 1GL7A 4QQFA 1X1BA 4IP0A 5LP1A 3C6MA 5JMPA 4CM9A 4AVYA 2V54A 2Y1OA 5EYRA 1M8GA 5T7BA 3THWB 1W5TA 2PBIA 1ZX1A 1HLGA 1I2MA 4BEBA 5HOEA 5KTOA 4YAIA 2AMFA 3ND8A 3GCZA 2FPIB 2X4GA 5LDDC 1G6OA 1ZUNA 3NHPA 1EH5A 1YX3A 4FDAA 3PP8A 2J3EA 4QHSA 4PLFA 3KL2A 4PTLA 4V2FA 5DTRA 1J33A 2WBLC 1NONA 4RAGA 4B09A 3OMWA 4Z4GA 3TD6A 1RKXA 1F8YA 4H18A 4LJYA 5E3JA 4P92A 4M83A 3RPEA 1AKTA 5KSOA 1ZRFA 4EP1A 2EEPA 2XRFA 2VN2A 4D6YA 3ZIAD 2OD5A 2R5YA 1A5BB 4HQKA 4H7FA 2H57A 5EXSA 4ZI5A 2XKAA 4HNUA 2P68A 3LLUA 2QDXA 5J4KA 4WW0A 4Y7DA 1H1LB 5G53C 2QD3A 2NGRA 2I4NA 2NVUA 2ATVA 2RARA 3OCCA 1DAOA 4F9EA 4PSDA 5IJWA 1M10A 5CKTA 1PAUA 3GX4X 3R3SA 3QWIA 2GS9A 4KQGA 2GDZA 1BR4A 4G5SA 1D4FA 3G23A 4Q4AB 4D41A 4ZAYA 4QT4A 4DCOA 2B2NA 4Y2RA 4YP0A 1MPXA 1XX5A 1PUIA 4NBTA 4FWBA 3UJDA 5HK8A 2ICAA 4WVLA 2HKXA 5HHTA 2YWBA 1C3OA 3HR8A 3OTHA 4OFZA 2CNDA 2I6TA 1IPEA 4YQZA 4N9HA 2FSWA 5BW5A 3W6ZA 3OPYA 4EF5A 1Z5PA 2NYXA 3V1KA 1SMYF 1CE8B 2EHDA 2XA1A 2IX9A 4OVKA 4EGJA 4JT4A 2QNIA 1PYOA 1Y9DA 3N1UA 4DG5A 1JE8A 5K3SA 1UB9A 2E0IA 4QBGB 5IYZB 1Q1NA 4LNUA 2I6FA 3DV8A 1IDZA 1TIBA 4HQ6A 3NPMA 2V5VA 4PICA 1T36B 4KQJA 1W46A 2PJRB 1G1MA 3KVOA 5FPYA 3CXRA 3AR2A 1ULYA 3F96A 4I36A 2W7NA 4AKGA 2EZLA 2Z2XA 2IKQA 3E7XA 1AJEA 1L8QA 4HGPA 4TLEA 3WMEA 2GNOA 5HWSA 5EUMA 4MNTA 1RR6A 1AKWA 2G5GX 4PR3A 3ZYCA 1ZZEA 1TNDA 5I45A 3L2QA 3NEYA 5KJ1A 1KDTA 2PX5A 4ACAA 2BH9A 1ETXA 2RC4A 2FWJA 3E5UA 4KIGA 1SB9A 2GLXA 4IHJB 5HR5A 1Z2CA 4FTWA 4MJXA 1MEJA 3W5CA 3U1BA 4G0XA 2ONYA 4LDPA 5GZ3A 5KVVA 1XZAA 1KP3A 3MGCA 4A93J 4D82A 2OLEA 4M74A 3ZWXA 2G88A 1A8SA 3AYXB 1UJNA 1NR5A 1H8ED 3F7TA 2X8JB 5B1IA 1E2BA 3LWNA 4B6JA 4WZZA 4KX3A 2VE9A 3G1UA 2KFDA 1SBYA 2ZJRF 1N5JA 1KO1A 2PXHA 4O4IF 4TUYA 5IVIA 2W0SA 2XPWA 4YMIA 4K9QA 1P2TA 2WF6A 4GGMX 5DWDA 1SD6A 4ZODA 3VRHA 1SKMA 2ZIGA 2C2HA 1ZI9A