2ZSHB

Structural basis of gibberellin(ga3)-induced della recognition by the gibberellin receptor
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
66
structure length
59
Chain Sequence
GMDELLAVLGYKVRSSEMADVAQKLEQLEVMMSNVLATETVHYNPAELYTWLDSMLTDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable gibberellin receptor GID1L1
publication title Gibberellin-induced DELLA recognition by the gibberellin receptor GID1
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hormone receptor
total genus 20
structure length 59
sequence length 66
ec nomenclature
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12041 DELLA Transcriptional regulator DELLA protein N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1290 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2zshB00
2ZSIB 2ZSHB
chains in the Genus database with same CATH superfamily
2LG4A 3WU1B 5L3BA 3T0YA 2W48A 5EZGA 5DM7F 5J4VA 2E2HJ 4XLFA 3DF8A 1Q1HA 2L2OA 1PP7U 4B3XA 2XROA 5CVVA 3BZKA 4N4NB 3ZQFA 2A5WA 2K9MA 5B66C 1VQNI 3GXOA 5J3LA 1X4OA 1TL8A 2E2JJ 3EYIA 4LG0B 5CVRA 5DEQA 3B73A 4MLOA 3RPUA 5LBQA 5ILUA 2AQFA 2DK5A 4IXAA 1Z0XA 4EJWA 4G9YA 1PUFB 2W1OA 5E3OA 4Y33A 2WAQN 1FIAA 2FE3A 3MKWB 4YEJA 2DOFA 3PUFA 4XIDA 2MH2A 3I9V2 2KIFA 1UHWA 3F9KA 1Y1VJ 3HG9A 1ODDA 4M6YA 3RJPA 5HDGA 3S3NA 4ITVA 3O8GA 1KU2A 1JKPC 2OTJI 1VQ8I 2ZMEA 1WGXA 1VTNC 5HDNA 3A0BC 2DDBA 3R6SA 4CCJA 5KHDA 1QPMA 2XRLA 5E79C 3ASNH 4IEJA 2FA5A 1Z1DA 1A6QA 2NVYJ 1X3WB 2QYOA 2ZNYA 4HX4A 3TOAA 4HF2A 2EFWA 1OPCA 2Q2EB 1W5TA 2HDDA 4RAFA 1USSA 3HRSA 1TWAJ 2L3DA 2DDAA 3OIPA 1FY7A 2M8EA 1E17A 5IYDJ 3CMAI 3M07A 4OMZA 2GXAA 3F8NA 4MQVA 1NK3P 2D1VA 4ENJA 3RIRA 2M2EA 1IXSB 4BE0A 2DJIA 1TC3C 4J19A 3L09A 3IUOA 4F93B 3PL8A 2JTVA 4FQGA 1IC8A 4U0VA 3QWLA 4IJAA 3SQNA 4ZDOA 4PK4A 3K4CA 3C2GA 3DWLE 4UUSB 3ZMDA 2K27A 2ZJ2A 1P4XA 2HDCA 3LQQA 1F4KA 3KP5A 3P9CA 4D5CA 2ME6A 4V19K 1Y8RB 2BW3B 2LMDA 1K6OA 5D8KB 2DPDA 2O6GE 3WTWC 1JI8A 1UG0A 4RGSA 1MZBA 1K78B 3ASOH 1BJZA 1RESA 3HTSB 5F6FA 4A3GJ 2EFQA 2HVQA 2PFBA 1FPQA 5DS9A 3CCLI 1H0MA 3GTPJ 4M3EA 4RBOA 2HEOA 1R1VA 4AIKA 1OCZH 3BQYA 2VN2A 4P55A 4DZJA 3QPSA 3VWBA 5BPIA 4CZCA 1Y0NA 4RAZA 3HOYJ 2E1NA 2GAUA 5ED4A 3L7WA 3U1DA 2OUMA 2A6TA 4I7HA 1J5YA 1T33A 2XB5A 4L9TA 3P7NA 1R7JA 2P4WA 4OAZA 5AONA 2XDVA 3QYBA 3K70D 1WJAA 4PJLA 1FYLA 3H5NA 3DBRB 5LD2C 3LA3A 3RKYA 2DFIA 1PJRA 2DA2A 4HLXA 1TBXA 3CDLA 4NNJA 5C4JJ 3I5UA 4ENMA 4AVPA 1YS7A 3GEZA 4CGZA 1GV5A 2DMUA 1K79A 2HKOA 2LF8A 2KRHA 1XSDA 3FX3A 2OD5A 1R00A 3HZJA 3HL2A 1D8JA 3ZQ7A 4X0GA 2V1XA 4E6KG 2FX0A 1QA6A 5E8IA 4M9XA 1PVEA 3OOUA 2UUZA 3FXOA 2KRCA 3WTXC 2VBYA 3CCYA 4IHYA 1HKTA 2ELKA 3HUGB 2L54A 1ZHFA 4E7SA 4H4KC 2CYYA 3U2RA 1F43A 3RPUD 1O7LA 4AWXB 1IO2A 3MD2A 2DQRA 4KN4X 2ZJQF 3FF5A 2OZUA 4GXOA 1Z77A 4LOCA 3ZMSA 2BVMA 5ILSA 5KNLA 4F55A 4F7ZA 3QYFA 2L4AA 2LBFB 1A35A 2JJ7A 2HWVA 2F4MB 4IZZA 3OL4A 5BQTA 1S5LC 5ICEA 3HOWJ 1FLIA 2G0EA 1E3HA 3HM5A 4ZYGA 2UWMA 2Z16A 5EG0A 3S14J 3BR3A 5BPDA 5EYRA 2DA1A 4JP0A 2KISA 5F08A 3F8FA 1ENHA 1RETA 4BJ5C 2B0LA 3GBGA 5F27A 1B4AA 1J7KA 1STZA 3WG9A 1SANA 4FTHA 5GPCA 2XUBA 4CHUA 1YRNA 2DOAA 1BI0A 1SD6A 3IAS2 5HLIA 2GA2A 2G7UA 2OV7A 4B47A 4ESJA 2VT3A 4I0BA 4ANJA 1VZ0A 4EM2A 4I01A 1E2XA 4XLCA 4WXCA 1POGA 2WY8Q 3LSIA 1V5GA 2EBIA 2FBHA 5FKKA 3GX4X 3HHHA 2OCCH 2XGDA 3CUQC 4RB1A 4L5JA 4JOMA 3E1SA 2DU9A 4YIRX 1OFCX 1U5TB 1OCTC 3MVPA 2KIMA 3A01A 1YW9A 2VOOA 2LTPA 2IT0A 1W1WE 2V6EA 4JX6A 3OYHA 2FF4A 3ABKH 3DBHB 3MN2A 4XLAA 4KIFA 5CJ9A 2CUEA 4KT6A 4R79A 1X2MA 1X19A 4PSXA 3RZOJ 3ABUA 2DBBA 1VFCA 5E3NA 4A0XA 5FD5A 5L3DA 4I98B 2QEXI 1XGMA 2R5YB 4L0ZB 1SD4A 5E3MA 1IXRC 2HYJA 2QM3A 1YJ9I 2EZKA 2ZO4A 4G7HF 1WI9A 1FNNA 1ZQ3P 2QVOA 3CLOA 1BM9A 2F2EA 4BY1J 1YS6A 3E3VA 5F0FA 1SVOA 3FBNB 2JRMA 3BR5A 2PN6A 2QSFX 3B6AA 3COAC 4MHGA 1V54H 2ESHA 2VOPA 1W5SA 2XAFA 4YIFA 5D5WB 2ZJRF 4IX7A 1TT5B 1FIPA 5J47A 2QQAA 2FOKA 2H1LA 2BY1A 1K61A 1BIBA 1U8BA 1ETXA 2VC1A 3ZQQA 2XGXA 2ZC2A 2MC3A 5IY5H 1YI2I 3HC7A 3KEOA 2LRDA 4N4OB 3WGIA 3Q0WA 2Q8KA 5C4XJ 3TL4X 2KIQA 1QPIA 2ELHA 2ESNA 3BR6A 1GT0C 2JUGA 4BH9A 5IYCJ 4P9FA 4HNUA 3EUAA 2A07F 3SZTA 2ADUA 3LSHA 3KIOA 4B8XA 2AHQA 3ZMTA 2CQ7A 2LP0A 3J7AO 2BY2A 3JTGA 1NTCA 3F0CA 2IA1A 1HBXG 3CCSI 2K9QA 2BY3A 2M45A 4HBLA 1YG2A 4HV5A 2DMNA 4R1HA 3OYIA 4M73A 2XC7A 2L7KA 1JGGA 3ECHA 1G4DA 1ZREA 4W97A 2EA4A 1IGNA 2BHYA 5KVRA 1AKHB 4GFBA 1M1EB 2JWTA 1B8IB 2RDPA 4M9ZA 4AIHA 3MCZA 3LNQA 4M3GA 2W25A 2ZKZA 2G7HA 4CH7A 1I3AA 2WB1A 3R60A 3BR1A 3FMQA 3TBIA 2K40A 1UELB 2KZVA 2X6XA 4HSRA 4EJOA 2O3FA 4RB0A 2D5VA 5HLGA 5FRMA 2L7MP 2RKHA 4KIGA 1LDDA 2CQNA 4WX9A 1YJNI 3QYEA 2IPQX 1J0RA 3AG1H 5D6EA 4KDPA 4PDKA 1IV8A 1NG7A 3PIPF 2KHMA 3GF2A 2DA6A 2DAOA 3SXYA 3V8JA 5DDGA 3DBLB 2J5OA 2QBYB 4CCLA 4E7JA 3WGHA 3HOZJ 1MMSA 4F91B 1MMAA 2JN6A 2YU3A 2PX9A 4CZZA 1MBFA 1YIOA 2P7CB 2M1BA 3SEQA 2CMPA 4EVIA 1S7AA 2K4JA 4LB6B 4BBRJ 4C2UA 1YX3A 5E18F 1ZG5A 3CUOA 3E6MA 5M3MJ 4ZDPA 1H88C 2F4IA 2HXIA 2ZFUA 3DV8A 1X1AA 5F1JA 3PO2J 3VYRB 1KU9A 3GZNB 2FSWA 3JREA 5F64A 2ELJA 3ZMUA 5DCMB 3QP5A 1KYWA 1TTYA 2HQAA 4RAYA 3SFIA 3FDYA 2O0YA 2WAFA 3OYDA 2HXOA 2MC4A 5DD4A 4BE2A 3CO6C 3LFUA 4NUBA 4UY8I 3CJTB 3V4GA 3OYEA 1WZ2A 4HEA2 1MNMC 2DO7A 3ZMZA 3OYFA 4A3DJ 1W0TA 1ORKA 3S17J 4RB2C 1YHQI 2FEZA 1OLTA 4XN0A 2FRHA 1OCOH 2GXGA 1D0YA 3JW4A 3QODA 4M9SA 2LOOA 1WJFA 2VQLA 3A02A 5JVGF 1V4RA 5FGMA 3E6CC 5GTHC 3W2AA 3BZCA 2NRAC 4Y52J 2OF7A 4P96A 1JJ8C 2E19A 5HNFA 2CJJA 1KU3A 1V5EA 1XCVA 3GMEA 3HSEA 1MJ9A 2M34A 1MBJA 3HOVJ 2GXBA 4DQ2A 1HSTA 2VBWA 5CYVA 3HRUA 1ZRFA 3LSKA 3DPUA 1UFMA 4MNUA 2LKSA 4DNCA 3ZQLA 2WA0A 5M5YJ 2V9KA 4Z2YA 3NRVA 4LMYA 3OSFA 4PZJA 3G6EI 4BXUA 2RGVA 4HW0A 3DCFA 3DLAA 2LKXA 3DEEA 2L4MA 3DTIA 4V2GA 5L3EA 2YU9J 2IGNA 2DFHA 1USTA 3H3UA 2V9PA 1LB2A 2UZKA 2OC6A 4GCVA 1XDSA 2XKPA 2W82A 3CLQA 3CQZJ 3HDDA 3FHNA 2ZB9A 3FM3A 3WTVC 4Y13A 1JTYA 2O8XA 4U87A 2ZFWA 3V7RA 1I5ZA 2DA4A 2QQ8A 2R5ZB 1OCRH 4Q5SF 3JSPA 2JMWA 4HSTA 2Y9ZA 1KYZA 3FXQA 1K4SA 4FE4A 4YIIA 3VB2A 4CSWA 1UB9A 4IHSA 4DYCA 5EZHA 3I58A 2L9NA 1HW5A 2HDWA 3IRRA 2FMYA 1ZN2A 5EEHA 2XHKA 4WK8F 2E1OA 4FT8A 2DCEA 2ZXJA 3EUKL 2K02A 3PQJA 4AYBA 5EEAA 4NHJA 2R93J 1A04A 1SEUA 5H6RA 1BI3A 2QLZA 2D45A 2FXAA 1KQ8A 3CJQB 5K7ZA 5J8CA 1Q1VA 2WC2A 2O61A 1ZTRA 1G2HA 4F52A 1H9TA 1EF4A 3HOSA 3ZN1A 1FZPB 2O7OA 1R5HA 1XN7A 2I5UA 1RNLA 4KYWA 4YFKF 2R0QC 3HYIA 5DM6F 2MH9A 5E1XA 2DA3A 1YX5A 4II3A 3S2DJ 4HA8A 3TOBA 1FBSA 2X85A 2QCOA 1U0JA 2L0KA 2Y75A 2HTJA 3O3KA 3VDXA 4LJZF 4E4HA 2JT1A 1Z3XA 3ZOBA 1CF7A 2EINH 3ESWB 5GPAA 2RC4A 2CW8A 2MG4A 4A3IJ 2Q1ZB 1ITYA 3J7ZI 3DPLC 4D7NA 2M4GA 3H5RA 2Y30A 2KP6A 4BEHB 2XSJC 1IRXA 1ZELA 2M7AA 1YQAA 1LNWA 2CW7A 5AIPA 2JPCA 1P7IA 4UNOA 3S1RJ 3CF5F 1D8KA 1X2NA 1FTTA 1OKRA 1F5TA 3I4PA 4G7OF 3CUQA 2E34A 1VI0A 4PJNA 2Y2ZA 2LY9A 1B72A 2XVCA 4LLNA 2OBPA 3TDZC 4NC7A 4OIRF 1JJ6C 4XSZF 1XMXA 4JBAA 3Q5FA 4FISA 2Y9YA 4MFDA 3QAHA 2FUG2 2V1DA 1BIAA 2L02A 4OIOF 2EIKH 5D6FA 2ZMEB 2HPIA 1Y1WJ 1R22A 3VODA 2WWYA 5B5EC 5DUIA 3W6JB 4ESBA 4IVNA 4UVCA 1FYMA 5ILVA 1LE8A 4A3EJ 5F04A 3RQIA 2VJ4A 2YUSA 5CKTA 3WTTC 4KNYA 3M4OJ 3EQLF 2EV0A 5EDNA 2E5NA 2CFXA 2Y0SA 4G6QA 5H2FC 1U3EM 4IO9F 2H27A 1IN6A 2M4KA 3TDUC 3TQNA 1JUSA 2JRTA 3K1PA 4M6VA 4OU0A 1T56A 5K1YA 3KZIC 3K1MA 3C1DA 4Y15A 2CQXA 4HNVA 5E17F 1X58A 5CQEA 3S2HJ 1U5TC 1V55H 4IKFA 2XAGA 4XNFA 3X2QH 1TT0A 2ID6A 3KP3A 4XQFA 3BTJA 2R7TA 3G73A 3DKYA 3GFMA 2ISZA 3BTLA 2ZXIA 1SFXA 3C3WA 1ETKA 2EJRA 2V9VA 1EH6A 1LUJB 4EQQA 3GTJJ 3A03A 4LIVA 3AG3H 3HSRA 4BY7J 3WU0A 4AUXA 2FJ1A 1SAUA 3D1NI 2A6EF 2O8KA 1A6IA 2IS2A 1E0EA 2NVXJ 4XSXF 5IT3A 5D5VB 2PJRA 4EGYA 1I50J 3U9GA 2IEKA 3K7AJ 2IA2A 2QSHX 1G3WA 2FBIA 3FMRA 2Y69H 3K4KA 4P9UA 1DU0A 1L3LA 4IPAA 2K3FA 4CDGA 1R23A 4M74A 3GWZA 3FKIJ 3K69A 3IKTA 3IHUA 5CVUA 4FX4A 1SFEA 4XKCA 3G1LA 4JX4A 5LGNA 3FXJA 4KN7X 1WJCA 2QWWA 2L9RA 3K4NA 3LA2A 2GIZA 2WV1A 3JRDA 1HXDA 2IGOA 1MDMA 1BR4A 3CTAA 3FHZA 5CVIA 3CCVI 2JA2A 5JLWA 2DW4A 4XRSG 2AXTC 1QU3A 4D7MA 2CUZA 2ZXHA 2DXIA 4CUGA 1HA8A 3O6BB 2V1UA 1AA7A 3DKWA 4CYCA 1Z91A 2EFOA 2EFPA 1RKWA 3M8EA 2CFOA 3LSGA 1SVLA 4XICA 5FD6A 1W0UA 4F92B 3BQZA 3BT9A 3G1OA 2OAZA 3IP4B 4YELA 1VQOI 1W5CC 1N25A 3ABLH 3HKZN 1EV7A 2STWA 1OISA 4Q47A 4BXFA 2K9SA 1JXSA 2LC2A 3HRMA 3IC7A 3K6GA 1N77A 2CGPA 4U88A 1ACIA 3FXRA 2V6CA 2PMZN 2K7LA 1VNDA 3KZZA 1HCRA 3RYRA 2X0LA 1YIJI 1S29A 3LA7A 2VKDA 2ZBKA 2LF7A 1MNEA 5BNGA 2NYXA 3KEQA 3KPHA 3B02A 4LG0A 4KISA 4GO1A 3SFZA 2A05A 2R7XA 2CUJA 1PUFA 5DTDA 3QPTA 3JRIA 4RM2A 2TCTA 2L01A 5M5XJ 1U9NA 1S7EA 4GYIA 4QSHA 3AL0B 1XMKA 2VXZA 1OYYA 2LKPA 2W00A 3NQOA 2IXSA 4XM3A 1IRFA 3HPGA 3TMOA 4C2MJ 3IWFA 2A68F 3GTKJ 5ICFA 3WTUC 2LY1A 2E7WA 2OTLI 3VOEA 1F36A 5LGUA 5GAEJ 4O6JA 1MJAA 1YW7A 4NB5A 4XORA 4AIDA 4IOCF 4JK1X 2KQRA 2M0MA 2M3AA 2AO9A 2L5QA 1S72I 1YRNB 2VQHA 2ID3A 5D4SA 3H0DA 5DV5A 4D5FA 4BHBA 4CYDA 1QNTA 1GVJA 4ZYDA 1D1BA 3QRFF 3TW6A 1DUXC 4PUSA 3E5UA 2XGEA 2Q2EA 1U8RA 3K4LA 1HKSA 2A61A 1H9GA 2H09A 2EB7A 1ZLJA 4PGGA 2VB6A 4KJZA 1X4PA 4YFXF 3ABTA 2ISYA 3IV5A 4HF0A 2HQ5A 2P0WA 2IBDA 4QTRA 1VQ7I 1DGRM 3OIOA 1ETYA 3L2CA 3K4MA 5FJ8J 4CO8A 2DI3A 2D2WA 1Z21A 1BR2A 3GFIA 1MSFC 2FOWA 3TO7A 4XMYA 3Q0VA 4X6AJ 4UUSA 1MD0A 5J40A 3PSIA 3ZRGA 5HDKA 5DD8A 4A3JJ 2FNPA 1FWZA 1RIOH 2EILH 1RR7A 2BW3A 3GCMA 4CCMA 1G3TA 1LVKA 2LFBA 2CO5A 4I99C 3A1YA 2WAQA 5J6XA 1IUFA 3LAJA 1WVRA 3FK6A 4KMUX 1VQ5I 3A4CA 2KPMA 1K78A 5IOYA 1H89C 3F72A 5HS9A 3LSRA 2P5KA 2IRFG 3CD6I 2XB0X 1I3QJ 3CCJI 1T2KA 4G8XA 2XIGA 1DDNA 3K2AA 4HQMA 2OCEA 1AOYA 2PMUA 3IRQA 1R49A 3J80K 4ZDLA 1JHHA 1P2FA 3CC4I 4PFOA 2CQKA 3MZYA 4XLEA 2MA3A 4RDUA 3K9TA 2BOLA 2F5FA 1ETQA 4BHCA 1ZR2A 2BVLA 2KL4A 2H8RA 1U78A 3I4MJ 3F8CA 3R61A 1X3UA 3RCOA 2W4SA 2BHZA 2Z2SB 1MBHA 3FXMA 1QZEA 2DK8A 2DODA 2NAZA 3MEXA 4ZZLA 5ICCA 1T08B 2QGUA 1YITI 4LGWA 5FLVA 3CJRB 3OYCA 3IH3A 2R7ZJ 4C3HJ 4UB6C 5F0CA 2GWRA 4OOIA 1A5JA 1WFXA 2EZHA 3G71I 2DT6A 2JSPA 4LB5A 5LRRA 4CXFA 4EMSA 4XR6A 4W1UA 2G9WA 2CH0A 3I4NJ 2BEOA 2JVHA 1J75A 2XPWA 2EA2A 4JYKA 1HLVA 4DBQA 1O3QA 4LD5A 2MFZA 2CWEA 3OR2C 1O3SA 5F1RA 1ZGWA 3F6OA 1QHGA 2MBFA 3HUGA 4BGDA 4XOTA 1BI2A 5IP6A 3F8BA 1Z7UA 3LFKA 1BL0A 2DYRH 3KYLA 3ABMH 4JQFA 4U7DA 2EIJH 1K7AA 1Z6TA 3ELKA 2NVTJ 1W7PB 3UR3C 3HSFA 1D5YA 2BGCA 2FD5A 3ZXSA 3ZPLA 2DTZA 2LBFA 1RPWA 4MIMA 2ECBA 3BJAA 5TGTA 2DMPA 1HSJA 4UV9A 4CICA 1BOBA 2KIUA 3HIFA 1JKQC 1SFUA 2E1MB 1N75A 2NS0A 3DKXA 2IS6A 5GTIC 1TZLA 3I0TA 1W36C 1FMVA 3OS0A 1P92A 4ZYAA 1XSVA 2K85A 2E7XA 5EGOB 4FCYA 1GXQA 3AKZA 3E5XA 5K7FA 4YRVA 4HZFA 2GLOA 3HGYA 2F48A 3VFZA 3BG6A 3BPXA 1I6XA 4AIJA 1QGPA 2M8GX 3OWTA 2IA0A 4L9JA 1D1CA 5HLTA 3SEZA 1ETWA 4A3CJ 1SMTA 1QHHD 1GLNA 1ZAOA 5J1YA 2LNBA 2BV6A 2DQLA 4M3DA 2RVCA 5E3LA 4UUTA 2PQ8A 3PNTA 2EPFA 2WY7Q 2Z99A 2NOJB 1XX5A 1HDDC 4MEYF 1MGTA 3C2BA 4BNCA 1ZRDA 2HQRA 3OR1C 1IDYA 5M3FJ 4BU2A 2W7NA 3F3XA 3FK7A 2WV0A 4IF4A 3TGNA 3HPHA 3F22A 1OR7C 1IRZA 2EZIA 1GUUA 2ZMEC 3ZGKA 1R6RA 1NH3A 4BUPA 1GVDA 3E6BA 3CCQI 4A0ZA 2A3SA 1F9NA 3SHFA 3OS2A 4UVAA 3J80Z 2R5YA 1WH7A 1XGOA 2KJCA 4Y17A 1I6HJ 1FOKA 1MW7A 3KE2A 3R4KA 3QOEA 3K2ZA 4EJVA 1ZLKA 2X6OA 4OAYA 1JUMA 3LOCA 2F5EA 2VUMJ 4ZTFA 1UAAA 2KDZA 3P9IA 5F0HA 3J7YJ 3G4SI 2HU9A 1D3YA 1Z7LA 3PQKA 1XB4A 2CS3A 1R5GA 2BYVE 2HFHA 3HOXJ 4A3BJ 1YYVA 2K5CA 1QQIA 1ZGJA 2M9HA 5FB2A 1T95A 1FMWA 1XS9A 4MGRA 2AXLA 2W84A 1WKMA 1B1BA 2ZCWA 2DT5A 2UXNA 3F23A 4EATA 4ZC3A 4FETA 2RQPA 2QKLB 3E7LA 1Y0UA 4BL0B 3CJNA 3I59B 1G59A 5J1UA 1IRGA 2XASA 4EJTA 2MLGA 4B1RA 2HVSA 2LK2A 4M3BA 1AU7A 4NQWB 5GP9A 3PNVA 3HGGA 3Q3SA 1OMIA 4HV6A 3LAPA 5FKMA 1EH7A 3JAMK 5DCFA 3KP2A 3OYKA 2M5WA 1TNTA 5E1ZB 4CCOA 2QKMB 1MIJA 2XSDC 2LVSA 1S7OA 3FISA 4IQJA 1FBQA 1A31A 1HW2A 3KP6A 5JHUA 5FLXK 4HX8A 4BJTA 2Z1DA 1SMYF 1AKHA 1B8IA 3MMYB 4L9NA 1ZKGA 5HNHA 4XRSA 3H9JA 3ZCOA 2ZJPF 1TLHB 3I64A 4B3AA 3CMMA 1K6YA 1JT6A 4II2A 1YLFA 3RTRA 1S9HA 2KZGA 1D1AA 1WCMJ 2MSYA 2XKOA 3N97A 1TQIA 5LEKA 1P9QC 1Z6RA 5IOZA 4I09A 2D1HA 4BYYA 5H20A 4M3FA 4WF2A 4LIUA 4BDYA 3CESA 4B09A 3S1NJ 3GTOJ 3L2UA 5D4RA 2QQBA 2GA1A 2W57A 2QBYA 2XF6A 1HQCA 1LDJA 3CP2A 1C0WA 2XAQA 4WCGA 2R4GA 2GBYA 2NOGA 4RS8A 5CVJA 4BXXJ 2IJLA 3BG3A 4FASD 2R7SA 4K2EA 2VC0A 5ICGA 3AG2H 1JE8A 3M1EA 2HTSA 3KEYA 5C44J 3L1PA 1LFUP 1YTYA 4XN3A 2NXNB 1YFHA 2QSGX 1MMGA 4I76A 2XF5A 5DCMA 4XONA 3TKYA 4HDUA 2VBXA 2OQRA 1GHCA 3HEFA 5A2QK 1VQKI 3DP7A 3RKQA 5AIQA 4FE7A 3TO9A 3FXUA 1DP7P 3I55I 4R8HA 3AL0C 3WGGA 1RC9A 3CCMI 3EDPA 2H6CA 2DA7A 3BJOA 1APLC 4P5OA 1TNSA 1BW5A 1S3JA 4A12A 1VQMI 4KT5C 3WTSC 4C9YA 4I2OA 2VBZA 4L9VA 5L3FA 1IZ1A 1F1ZA 4S04A 2BZTA 4H0EA 4GGGA 1UHMA 3MQ0A 2NNYA 2ECCA 5HVQC 4I0AA 2QZ8A 1BI1A 4LG3A 5TISC 3S93A 4HPQA 3QPLA 3S3MA 4IL6C 5FO5A 4BBSJ 2K9LA 3FXKA 3JTHA 3MKZA 1XMAA 3MAJA 4BQNA 2B9SA 2YS9A 4O3MA 5TRDA 2DJNA 1LKXA 4B48A 3ERMA 5GAGJ 2H6BA 1IN7A 3KYDB 4XL9A 3BR2A 3NAUA 1LPQA 3BPVA 3KYCB 4E7LA 4OIPF 2VI6A 4Z6YA 3BLYA 4CCNA 1V3FA 3OYMA 5B1BH 1SD5A 4LITA 4TV7A 2L9SA 4ENNA 4LK1F 2TRTA 4RAGA 3E6DA 2LD5A 3KETA 3BG5A 4KICA 3GVAA 3K1NA 2RNJA 2GM4A 3OYNA 5BOXA 1T39A 1WI3A 4A3FJ 3EUHC 4XK4A 5IPAA 2STTA 3H3ZA 2VONA 4DBRA 1ERDA 1UHSA 3JAMZ 2VKEA 1X3ZB 2F5CA 1FJLA 4MQ9F 2VIXA 5FFXA 3L00A 5D5XB 2HKXA 2N8GA 2VJJA 3SDBA 2PJRB 3H36A 5LHIA 3BWGA 5FLXZ 1I27A 2HS5A 3ECOA 2IAIA 5FRNA 1TW2A 2XPVA 3L2WA 1VQLI 1N78A 4BHPA 4IOAF 2OU2A 4S0HB 2EH3A 2WTEA 3VSLA 4G12A 5EF6A 3CMEI 3MWMA 1UCRA 1TQMA 3R0AA 4A6DA 1Z3YA 1OQYA 1XGSA 2VKVA 1BBYA 3FMSA 4M72A 1E3PA 2GIVA 5JLXA 3KZYA 4XRFA 1MSEC 4ON0A 3S16J 3JRGA 1QVTA 4A3MJ 4C3JJ 1D0XA 4I02A 3BCBA 1IAWA 1HW1A 1L0OC 1TWCJ 1YJWI 1EA3A 4LFUA 4ZH4F 3WTYC 2C6YA 1X1PA 3F8MA 3IH4A 3OYBA 2NVQJ 2BE5F 3PIOF 1XSXA 2EQRA 2F5DA 1LVAA 1VQ9I 4PJJA 2HOAA 4WXHA 2R7UA 4L5IA 4E7ZA 1FOYA 2CV2A 2PMHA 3BG7A 1IV6A 1CGPA 5CPRB 3H92A 4X1EA 3FWEA 3CC7I 4ZTJA 1XCBA 3S1QJ 5LRSA 2XGCA 2LSOA 2CV0A 1SAXA 3W3CA 4RMNA 4G6TB 5A2QZ 2HI3A 5FLMJ 1JUPA 2CW0F 1P6RA 2K3PA 1FYKA 3S15J 4BQQA 2GOMA 1PYVA 5CLSA 3F6VA 4IRIA 2Q0OA 3GTLJ 1WPKA 3GYHX 2FMLA 2QUFA 4BEHA 4ENKA 2HVRA 3L2RA 3I53A 1NK2P 2CQQA 3S2WA 2ACJA 1P4AA 4N9IA 2DPUA 4DW6A 3GTMJ 2FNAA 4UUVA 3W6VA 2VASA 3DU6A 3BTIA 1B6AA 1I1GA 4EM0B 2CG4A 2L7ZA 5HS7A 4D9JA 1Z9CA 4DYQA 3H9QA 1X1BA 4Y3OA 4B44A 2E1MC 2A69F 2HOEA 3BC8A 1IN5A 3T8TA 2AS5F 4QWQA 4MFEA 3HB9A 1RRJA 4EM1A 1UG2A 3K4JA 2E2IJ 1BC8C 2VE8A 5CQGA 3H35A 2UXXA 3I54A 4E7KA 4RB3C 1QZYA 1OR7A 2DFFA 1KU7A 3H3VK 1LJ9A 5K5OA 1FC3A 3IKVA 1TWGJ 2QA4I 3W2VA 2YSRA 3IWZA 5JR3A 5GADJ 2DTRA 3H5AA 3JR9A 1JKOC 4XLNF 1RR8C 3MKLA 3JRBA 2Y31A 4AM3A 2R7WA 2DYSH 5IT9K 2MABA 3RSNA 1EKEA 2V4JC 2W85A 1RUOA 1SC7A 2MD0A 1B9NA 4WXDA 1Y6IA 1NHAA 3D0SA 4MTDA 2L9VA 5M5WJ 5EJCA 1DPUA 1XD7A 3LQRA 4EV0A 3D5RC 1J59A 4NC6A 3H0GJ 1MBKA 2EFNA 3OS1A 3ZQGA 3EPZA 2Z9OA 1ON2A 1ZARA 3L2QA 3V7SA 2V1NA 4IHWA 1R5ID 2VQCA 4BJ6C 5E8GA 2P7VB 4ETSA 2OA4A 2XF7A 3V8LA 1U6GA 2VE9A 2OZ6A 4B43A 2JQ7A 2K4BA 2COMA 5EG0B 3DLLF 4M71A 3EETA 4UHTA 2X9DA 1WH5A 2RREA 3CZ6A 4GYGA 3FXLA 2PLYA 2MGQA 3GUDA 2LY2A 3CCRI 1REPC 6PAXA 2FU4A 2JZYA 2Z3YA 4B4CA 5BS6A 2XRNA 1I39A 5IP9J 3BP8A 1FOWA 3JSOA 1TWFJ 2IW5A 1LDKB 3SZGA 3OYJA 2ZSIB 3ROUA 4EEFG 2KKOA 3CC2I 1ZG3A 2K86A 3JRFA 2XAUA 3T8RA 3E5QA 1SFKA 2HPMA 1GV2A 1MH3A 2R7VA 4RGRA 4KFCA 2H8WA 2ME0A 3D5LA 4ZYHA 4E70A 3E0JB 5LHGA 3A01B 2Z33A 2YR2A 1WQ2A 3GZ5A 2E60A 1MJBA 1W36D 4LK0F 3U1KA 1ZR4A 3ERED 1FEXA 3G2BA 2L7FP 3M3YJ 5KAFC 4HYEA 5IYBJ 3N05A 2JA8J 2RAEA 2I10A 1ZRCA 1MKMA 3LWFA 1QVUA 4GDFA 2PEXA 1FT9A 2LH9A 1VQ4I 2WB1N 3VSKA 2FQ4A 4XRMA 3QQAA 3J7AY 4XLPF 1MH4A 2R92J 2P5LC 3GFJA 3K0LA 1Z05A 3L2VA 4J00A 2PI0A 2Y0MA 4E7HA 2WAEA 2V26A 3VYTB 4HOBA 1T98A 4BQOA 2DT7B 2XAHA 1BW6A 3DFGA 3Q0UA 2F4OB 2HR3A 3F21A 2IS1A 2BY0A 3CMYA 1DP3A 4J01A 2IP2A 2R7OA 2RN7A 3MZHA 2YX4A 4XKBA 1IN4A 2VJ5A 3V7CA 1FX7A 1J09A 2VJIA 3BJ6A 1R4MB 1ZYRF 3ZR8X 3MZ8A 4WWCA 5C3EJ 4MTEA 5IT9Z 4M6XA 3V8KA 1R1UA 2GZWA 3NEUA 1VF9A 5LFAA 2WADA 5FKOA 1RUNA 2HGCA 3HXLA 1UJ8A 1PUEE 3TW7A 4N0BA 3PM1A 3DU5A 2E35A 3DQVC 2VLAA 3PO3J 3DPTA 5DUKA 3HBLA 3P9KA 1ZG1A 5LEJA 2JA5J 2VL8A 2X6WA 2X51A 1W4MA 3HKZA 1P7JA 4FX0A 4AU7A 3D5SC 2BXYA 1HOMA 3C18A 3CDHA 3N4MA 2HOTA 2X1DA 4N9HA 1DQUA 3DEUA 4BACA 1QO0D 1FBUA 3UNGC 3BTCA 1TW3A 1HF0A 4YG2F 1BC7C 1XG1A 3TP0A 2WBMA 4UVBA 1SFOJ 3ZQIA 2JPBA 1IDZA 2ZXWH 1ZH5A 1T0FC 2PMZA 3GZ6A 4XLHA 3LL7A 3AFHA 1R9TJ 4KIBA 4MO7A 1KONA 1R1TA 1YOVB 2A5YB 2QF7A 3I3LA 1WSUA 5LHHA 3W6KB 4U0WA 3JCUC 4S05A 5FFZA 3UKGA 2R7QA 4JX5A 1XGNA 3SDGA 3EUHA 4ZZDA 1R71A 2KDOA 3WE2A 3K70C 2BXZA 2DFEA 2P5VA 3NARA 2DN0A 4NC8A 3VPRA 2O9LA 2B63J 2VQGA 3QU3A 3C2HA 4A3LJ 1KGSA 3J81K 3BY6A 5EEGA 2E36A 5D5UB 5JHFA 2VPRA 2DA5A 4RLFA 3DEWA 3HHGA 2KLOA 2PBIA 3K4BA 1KZHA 2DOEA 1OYWA 3TP3A 1XTAA 4A69C 3LSTA 2IGKA 3KLNA 3HJEA 4EJUA 1HDPA 3RI4A 2RV8A 1Y8QB 2V7FA 2X1CA 2JVGA 3G3ZA 3P5JA 1OJLA 4A3KJ 2MD5A 2F5VA 3HOTA 3FZVA 5L3CA 1WJ5A 2HYGD 4XBFA 2P6SA 3GTQJ 2XAJA 3BR0A 4NBQA 1XDUA 5HS8A 2LDUA 1AWCA 4A5MA 5IP7J 3I71A 2H1KA 1ZGAA 1U2WA 1WRJA 4IHTA 1O3RA 4I6ZA 2QQ9A 3GTGJ 1SD7A 3VYUB 1ULYA 1J2XA 3OL3A 3M9AA 3IAM2 3QOPA 5HLHA 3KP4A 5J8FA 3M7GA 5KCMA 3A2KA 3LSPA 3KX2A 3RYPA 2DLLA 4DGWB 4IHXA 3S8PA 1E3OC 4E7IA 3RPQA 1BOAA 1U5TA 4BKXA 3RDIA 1WJBA 3ZN0A 1YE9A 5J1RA 1B9MA 2X1EA 4RGUA 4F3QA 3DTEA 1O57A 4LLGF 3L9FA 4XKVA 1B59A 1MBGA 4AVZA 4G7ZF 1RKTA 3KCCA 3WG7H 2CV1A 4AYBN 2XV4S 1BA5A 1DPRA 3PUBA 3VYSB 4QPQA 2CUFA 4OINF 1T6SA 2EWNA 1TP4A 1EH8A 4BE1A 4L5EA 1PDNC 2NS8A 3RQ4A 2TDXA 2PG4A 3I56I 5E1WA 3FIWA 4PJ0C 4A5NA 1LQ1A 3CP8A 5D8LB 2JA7J 3REOA 3GLLA 1MMNA 3OMYA 1FOXA 1W7PA 1S6LA 2FQ3A 2IGMA 3OY9A 3WODF 3V42A 2M0CA 3GFLA 3S32A 1V5FA 3M8JA 1R36A 2XPUA 3EYYA 5KAIC 4ZYEA 3IL2A 1X1CA 2HQNA 3CO7C 2MYSA 1WWXA 2EV6A 1MMDA 1MBEA 3G1MA 1HC8A 2LYCA 4A93J 1PP8F 4HNTA 2Z5UA 1Y39A 2NVUB 1RZ4A 1HKQA 2CU7A 3E97A 1IW7F 3TO6A 1IG7A 4C3IJ 5EGOA 3BROA 1D5VA 3WHCA 3Q9SA 1QRYA 3RZDJ 2OQGA 4XKWA 5DYMA 3BOQA 2MLKA 1JHFA 1KQ9A 1LFBA 3CCUI 1VQPI 2EZLA 2DMTA 3K10A 2BBYA 2P81A 5E20A 5TJJA 5HODA 4Q4ZF 4C2TA 2JA6J 1O4XA 1WJEA 2F6CA 3T1BA 2ICWG 3BDDA 1FP2A 5L3GA 2O5RA 3BZ6A 4RA2A 2PJPA 1T38A 1JTXA 2VT2A 1ETOA 3JRCA 3CF2A 2FBKA 3QP6A 1KA8A 1MNDA 3OV8A 1VQ6I 3WE3A 3H9GA 4MEXF 1AHDP 4OMYA 1Y56A 3J81Z 1G3YA 3FKJA 3PFIA 3B6CA 3U21A 5ERIA 2E71A 5LGTA 2LR8A 3O8HA 1BN5A 3M1CA 2A6HF 1X1DA 3O2PE 3HOUJ 2JK3A 4DIQA 2P6TA 4KA4A 3VEPA 3PNYA 2AQEA 4IQ4A 2I8DA 3MFKA 2X4HA 1IJWC 3DXJF 3KLOA 2HNHA 3M8FA 5B3SH 1WHUA 2Y0SN 1JT0A 4XOPA 2LREA 4UB8C 3OYLA 3ZQHA 4P1WA 4KITB 1LEBA 5JFRA 5FKLA 3ISPA 2VKHA 4RGXA 3WU2C 1O3TA 1GDTA 1QBJA 1CF7B 3ONQA 2M7BA 2JSCA 2R7RA 4RM3A 1O7FA 2RQQA 4A2UA 4IRGA 1JKRC 4PSWA 2Y48A 3S3OA 1BJAA 2LLKA 3PSFA 3OIQA 1OCPA 3GLXA 1KQ0A 1J9IA 2K9NA 2X48A 2EV5A 4DYRA 1RI7A 3SZPA 2HOSA 1G6NA 3WHBA 5GAHJ 1BR1A 4IRHA 1FP1D 4Y7NJ 3OSGA 3ZMVA 1NG6A 4U0YA 4HLYA 4DJAA 2CRGA 3A0HC 1G8XA 3IH2A 3KP7A 4NDLA 4ASNA 2B7EA 2KT0A 2HYFA 3DTKA 1R58A 1YO5C 1G3SA 2M87A 3JRHA 1S8NA 1XPXA 5B1AH 4U7BA 3CUQB 3OYGA 3I59A 4IHVA 3H1CA 1WJDA 3OYAA 4RLQA 3SJMA 1B72B 4A6EA 1GXPA 2EIMH 2OJED 3GO5A 2HZDA 1TQPA 3ZP5A 4QIWN 1I1SA 1A36A 2ZSHB 4O5VA 2O03A 1H8AC 4NQWA 2IVMA 2RNGA 9ANTA 4KMFA 4OIQF 4V2FA 2VODA 4BAYA 2E1CA 4AC0A 3S1MJ 4HRIA 4PCQA 3ML6A 3HTUA 3CDIA 2UV1A 1LE8B 2CSOA 3LSMA 3CCEI 2DMQA 2P8TA 5JVTA 3SYTA 4HDVA 3ZQCA 4ABZA 1OYIA 1W7PD 4A0YA 3LMMA 4L0YB 1LEAA 4HX7A 1R4NB 1U9OA 5FROA 3W2WA 3PJRA 3OOPA 1FSEA 2NNNA 1ZK8A 4DZPA 1IF1A 4D0PA 2COBA 3R0JA 4UV8A 1CQTA 1K83J 2HZTA 4HQEA 1DU6A 4Q48A 1IXCA 4KUMA 1K4TA 4ESFA 1UMQA 4CA0A 2OPTA 1FTZA 2ETHA 4HG2A 4OWRB 3BCAA 4EGZA 2J5PA 4HAMA 4L18B 3LSJA 2R5ZA 1ONVA 2YX7A 2KRFA 5K5RA 3WTZA 5JI6A 5KK1A 5J4YA 3HRTA 4AD9A 3PFYA 1DGWY 2X6YA 2KMUA 4BQAA 1Z67A 4ZJZA 2KFDA 5HOOA 2KJBA 2M30A 1LFPA 3RKWA 4CCKA 4C30A 5H6QA 2EK5A 3KFWX 1IUYA 1EJ9A 2GQQA 1UZCA 3T5XA 4G94A 1D0ZA 4G6DA 3MKYB 2GOXB 3QPHA 1P4WA 3BG9A 3NWTA 2R7DA 5BMZA 4YFNF 1MDMB 5FKNA 1ETVA 2VXDA 3FBIB 4QLCU 3NWSA 1T8IA 2JUCA 4HF1A 3AAFA 5LLQA 1T0FA 4FHTA 2V79A 4PJMA 1TWHJ 2W24A 2R3SA 4UXNA 5K5QA 2E5ZA 1QZZA 1OCCH 1FSHA 3Q9VA 4CYCB 3RKXA 4PGHA 2H94A 1IN8A 1JGSA 2NS7A 2IS4A 4Y4RA 1YW8A 2QENA 2R7FA 4BDZA 5K7HA 4PFPA 3FM5A 2MW8A 1XC5A 4BS9A 1SVMA 4GRIA 2VPLA 4LLLA 2ZNZA 4QPOA 1ON1A 3JRAA 3GW2A 3ULQB 3C7JA 3TEDA 2YPRA 4D1QA 3AG4H 4DOZA 3QU6A
chains in the Genus database with same CATH topology
2LG4A 4U87A 2E60A 1W36D 4HSTA 4XLFA 3PNTA 2L2OA 3G2BA 4B3XA 2WY7Q 4N4NB 2NOJB 4CSWA 2A5WA 2K9MA 1X4OA 3N05A 4MLOA 3OR1C 2L9NA 2HDWA 2AQFA 4BU2A 2W7NA 2W1OA 3HPHA 1OR7C 2LH9A 4Y33A 3VSKA 3J7AY 2DCEA 3ZGKA 3MKWB 4YEJA 1R6RA 3EUKL 4AYBA 3I9V2 4J00A 4BUPA 3L2VA 3F9KA 3HG9A 4E7HA 2WAEA 2V26A 3S3NA 4ITVA 3VYTB 3CJQB 4BQOA 3OS2A 4F52A 2DT7B 1MW7A 3HOSA 2IS1A 3QOEA 1DP3A 4CCJA 5KHDA 4J01A 2R7OA 4OAYA 4XKBA 2VJ5A 4ZTFA 1UAAA 1J09A 1YX5A 2VJIA 4II3A 3ZR8X 2HU9A 2Q2EB 1Z7LA 2CS3A 2K5CA 2X85A 3OIPA 1U0JA 5LFAA 1T95A 2WADA 1FMWA 3VDXA 3HXLA 4E4HA 1Z3XA 3DU5A 3DQVC 2VLAA 3DPTA 4EATA 4ZC3A 2CW8A 2DJIA 2VL8A 2X6WA 2Q1ZB 2QKLB 2X51A 4FETA 4BE0A 3DPLC 3HKZA 4AU7A 2M4GA 3D5SC 3H5RA 3IUOA 4BL0B 4F93B 3PL8A 2KP6A 2X1DA 2XSJC 4BEHB 1IRXA 4ZDOA 1DQUA 1ZELA 4BACA 4PK4A 1G59A 2M7AA 3K4CA 3UNGC 3C2GA 3DWLE 2CW7A 2HVSA 2WBMA 4NQWB 3PNVA 2BW3B 1T0FC 2PMZA 4XLHA 3LL7A 3AFHA 3OYKA 1KONA 3I3LA 4CCOA 2QKMB 2R7QA 1JI8A 4PJNA 1UG0A 4IQJA 2KDOA 4BJTA 4NC7A 3K70C 2Z1DA 3MMYB 4NC8A 2HVQA 5HNHA 3H9JA 2FUG2 2VQGA 3ZCOA 3C2HA 2HPIA 3CMMA 1K6YA 3VWBA 4II2A 3RTRA 1S9HA 4CZCA 5JHFA 1D1AA 4RLFA 2KLOA 3K4BA 2CV2A 2OUMA 2VJ4A 5CKTA 1P9QC 2A6TA 2IGKA 4OAZA 2E5NA 4LIUA 2XDVA 3QYBA 4BDYA 3CESA 2Y0SA 2V7FA 2X1CA 1WJAA 2JVGA 4PJLA 3L2UA 3K70D 2M4KA 2F5VA 2XF6A 3H5NA 3HOTA 1WJ5A 5LD2C 3CP2A 1PJRA 2R4GA 5CQEA 4NNJA 4IKFA 4FASD 4XNFA 4XQFA 1TT0A 2R7SA 3VYUB 2R7TA 3OL3A 3IAM2 3DKYA 2ZXIA 3KEYA 2KRHA 5KCMA 3A2KA 4XN3A 3KX2A 3HL2A 4DGWB 4LIVA 1MMGA 3S8PA 4X0GA 4E7IA 4E6KG 2XF5A 4XONA 1SAUA 1WJBA 1YE9A 3OOUA 2UUZA 2KRCA 2X1EA 2IS2A 3HUGB 1E0EA 4F3QA 3DTEA 4E7SA 2PJRA 4H4KC 4XKVA 3AL0C 3RPUD 4AVZA 2CV1A 3MD2A 3K4KA 4P5OA 3PUBA 3VYSB 4QPQA 2BVMA 4C9YA 5KNLA 4F55A 3QYFA 2LBFB 4BE1A 4XKCA 3RQ4A 4IZZA 3OL4A 5HVQC 4LG3A 3S93A 4HPQA 1WJCA 3S3MA 3CP8A 2UWMA 2Z16A 3K4NA 2K9LA 1MMNA 3OMYA 3MKZA 4BQNA 2IGMA 2IGOA 3OY9A 1BR4A 4BJ5C 3V42A 1LKXA 4B48A 3GBGA 2JA2A 3S32A 4XL9A 1QU3A 1V5FA 4E7LA 2CUZA 2ZXHA 3M8JA 2DXIA 4CUGA 1HA8A 2DOAA 3BLYA 3IAS2 4CCNA 1X1CA 3OYMA 1AA7A 2MYSA 4LITA 1MMDA 2OV7A 4B47A 4ANJA 2L9SA 2LYCA 1VZ0A 4HNTA 2CFOA 3LSGA 4XLCA 4F92B 3IP4B 2WY8Q 4YELA 3LSIA 1V5GA 3OYNA 4BXFA 4XKWA 3EUHC 2LC2A 3K6GA 4JOMA 3E1SA 1N77A 4DBRA 1ERDA 3K10A 2VIXA 4C2TA 2V6EA 2VJJA 1WJEA 3SDBA 2F6CA 3OYHA 2PJRB 4XLAA 2O5RA 4KT6A 3CF2A 2VKDA 4R79A 1X19A 5FRNA 1MNDA 4PSXA 1MNEA 3L2WA 1N78A 3H9GA 4KISA 3VSLA 1Y56A 3FKJA 1Z3YA 2CUJA 2R7XA 3U21A 4RM2A 3AL0B 2VXZA 2W00A 2IXSA 3M1CA 4XM3A 1D0XA 1X1DA 3BCBA 3HPGA 3TMOA 1EA3A 4DIQA 3PNYA 3FBNB 2AQEA 4IQ4A 3OYBA 2I8DA 2LY1A 2HNHA 4XOPA 2LREA 4XORA 3OYLA 4PJJA 4P1WA 4KITB 2KQRA 2M0MA 2M3AA 4IX7A 2VKHA 2R7UA 2L5QA 2VQHA 3H0DA 4E7ZA 3BG7A 3ONQA 2M7BA 1D1BA 2R7RA 4RM3A 5CPRB 3ZQQA 2RQQA 4PUSA 4ZTJA 3K4LA 4PSWA 3HC7A 3S3OA 2LRDA 3PSFA 4N4OB 3OIQA 2CV0A 3W3CA 4RMNA 4G6TB 3TL4X 2VB6A 4KJZA 1X4PA 1BR1A 2K3PA 2JUGA 1NG6A 4HNUA 4BQQA 3EUAA 2GOMA 4DJAA 1G8XA 1PYVA 1QHHD 3LSHA 2P0WA 3DTKA 1DGRM 3K4MA 4BEHA 4U7BA 3OYGA 2HVRA 1Z21A 3L2RA 1BR2A 3OYIA 4XMYA 1WJDA 3OYAA 4RLQA 2L7KA 2XC7A 2HZDA 3PSIA 3ZRGA 2VASA 2ZSHB 3DU6A 2RNGA 2BW3A 4CCMA 4D9JA 1LVKA 4CH7A 3H9QA 1X1BA 4Y3OA 2WB1A 4B44A 3A1YA 2E1MC 2WAQA 3TBIA 4HRIA 1UELB 2KZVA 2X6XA 3BC8A 4HSRA 2UV1A 3A4CA 2KPMA 5FRMA 3LSMA 3K4JA 3QYEA 3SYTA 5CQGA 1NG7A 2KHMA 3H35A 4E7KA 4CCLA 4E7JA 4ZDLA 3LMMA 4F91B 1MMAA 4PFOA 4XLEA 5FROA 3W2VA 3SEQA 3W2WA 2CMPA 3PJRA 2BOLA 4C2UA 1YX3A 2BVLA 2KL4A 4ZDPA 3H5AA 2F4IA 3RCOA 2W4SA 2Z2SB 2ZFUA 1X1AA 2R7WA 3VYRB 4CA0A 2MABA 3RSNA 2ELJA 4HG2A 3CJRB 3OYCA 2V4JC 4OWRB 3BCAA 2MD0A 2HQAA 3FDYA 1WFXA 2WAFA 2MC4A 3OYDA 2DT6A 1Y6IA 4BE2A 2JSPA 3LFUA 4NUBA 4XR6A 3OYEA 2CH0A 2JVHA 4HEA2 4DBQA 3PFYA 2MFZA 3D5RC 1DGWY 2X6YA 2KMUA 3OR2C 3OYFA 4ZJZA 1OLTA 3OS1A 1QHGA 3EPZA 4XN0A 4BGDA 4XOTA 5HOOA 1D0YA 3L2QA 1LFPA 2V1NA 3QODA 2LOOA 2VQCA 4BJ6C 1WJFA 4C30A 4CCKA 2VQLA 3KYLA 2XF7A 3W2AA 4JQFA 4B43A 1D0ZA 3MKYB 2GOXB 5HNFA 3NWTA 3UR3C 1V5EA 3ZXSA 2VXDA 2RREA 3FBIB 2LBFA 3NWSA 3CZ6A 5TGTA 4PJMA 1BOBA 2LY2A 2E5ZA 2E1MB 3LSKA 3DPUA 1N75A 3DKXA 2IS6A 1TZLA 2WA0A 2V9KA 1W36C 1FMVA 1LDKB 3SZGA 3OS0A 2IS4A 3OYJA 4Y4RA 2ZSIB 4ZYAA 3DLAA 3DEEA 3DTIA 4BDZA 4PFPA 3AKZA 2IGNA 4YRVA 2XAUA 3BG6A 4BS9A 1SFKA 4GRIA 2OC6A 3OWTA 2HPMA 2VPLA 4QPOA 2W82A 2R7VA 1D1CA 5HLTA 3FHNA 3SEZA 3D5LA 4D1QA 3E0JB 4DOZA 1GLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZSI B;  2ZSH B; 
#chains in the Genus database with same CATH topology
 2LG4 A;  3WU1 B;  5L3B A;  3T0Y A;  2W48 A;  5EZG A;  5DM7 F;  5J4V A;  2E2H J;  4XLF A;  3DF8 A;  1Q1H A;  2L2O A;  1PP7 U;  4B3X A;  2XRO A;  5CVV A;  3BZK A;  4N4N B;  3ZQF A;  2A5W A;  2K9M A;  5B66 C;  1VQN I;  3GXO A;  5J3L A;  1X4O A;  1TL8 A;  2E2J J;  3EYI A;  4LG0 B;  5CVR A;  5DEQ A;  3B73 A;  4MLO A;  3RPU A;  5LBQ A;  5ILU A;  2AQF A;  2DK5 A;  4IXA A;  1Z0X A;  4EJW A;  4G9Y A;  1PUF B;  2W1O A;  5E3O A;  4Y33 A;  2WAQ N;  1FIA A;  2FE3 A;  3MKW B;  4YEJ A;  2DOF A;  3PUF A;  4XID A;  2MH2 A;  3I9V 2;  2KIF A;  1UHW A;  3F9K A;  1Y1V J;  3HG9 A;  1ODD A;  4M6Y A;  3RJP A;  5HDG A;  3S3N A;  4ITV A;  3O8G A;  1KU2 A;  1JKP C;  2OTJ I;  1VQ8 I;  2ZME A;  1WGX A;  1VTN C;  5HDN A;  3A0B C;  2DDB A;  3R6S A;  4CCJ A;  5KHD A;  1QPM A;  2XRL A;  5E79 C;  3ASN H;  4IEJ A;  2FA5 A;  1Z1D A;  1A6Q A;  2NVY J;  1X3W B;  2QYO A;  2ZNY A;  4HX4 A;  3TOA A;  4HF2 A;  2EFW A;  1OPC A;  2Q2E B;  1W5T A;  2HDD A;  4RAF A;  1USS A;  3HRS A;  1TWA J;  2L3D A;  2DDA A;  3OIP A;  1FY7 A;  2M8E A;  1E17 A;  5IYD J;  3CMA I;  3M07 A;  4OMZ A;  2GXA A;  3F8N A;  4MQV A;  1NK3 P;  2D1V A;  4ENJ A;  3RIR A;  2M2E A;  1IXS B;  4BE0 A;  2DJI A;  1TC3 C;  4J19 A;  3L09 A;  3IUO A;  4F93 B;  3PL8 A;  2JTV A;  4FQG A;  1IC8 A;  4U0V A;  3QWL A;  4IJA A;  3SQN A;  4ZDO A;  4PK4 A;  3K4C A;  3C2G A;  3DWL E;  4UUS B;  3ZMD A;  2K27 A;  2ZJ2 A;  1P4X A;  2HDC A;  3LQQ A;  1F4K A;  3KP5 A;  3P9C A;  4D5C A;  2ME6 A;  4V19 K;  1Y8R B;  2BW3 B;  2LMD A;  1K6O A;  5D8K B;  2DPD A;  2O6G E;  3WTW C;  1JI8 A;  1UG0 A;  4RGS A;  1MZB A;  1K78 B;  3ASO H;  1BJZ A;  1RES A;  3HTS B;  5F6F A;  4A3G J;  2EFQ A;  2HVQ A;  2PFB A;  1FPQ A;  5DS9 A;  3CCL I;  1H0M A;  3GTP J;  4M3E A;  4RBO A;  2HEO A;  1R1V A;  4AIK A;  1OCZ H;  3BQY A;  2VN2 A;  4P55 A;  4DZJ A;  3QPS A;  3VWB A;  5BPI A;  4CZC A;  1Y0N A;  4RAZ A;  3HOY J;  2E1N A;  2GAU A;  5ED4 A;  3L7W A;  3U1D A;  2OUM A;  2A6T A;  4I7H A;  1J5Y A;  1T33 A;  2XB5 A;  4L9T A;  3P7N A;  1R7J A;  2P4W A;  4OAZ A;  5AON A;  2XDV A;  3QYB A;  3K70 D;  1WJA A;  4PJL A;  1FYL A;  3H5N A;  3DBR B;  5LD2 C;  3LA3 A;  3RKY A;  2DFI A;  1PJR A;  2DA2 A;  4HLX A;  1TBX A;  3CDL A;  4NNJ A;  5C4J J;  3I5U A;  4ENM A;  4AVP A;  1YS7 A;  3GEZ A;  4CGZ A;  1GV5 A;  2DMU A;  1K79 A;  2HKO A;  2LF8 A;  2KRH A;  1XSD A;  3FX3 A;  2OD5 A;  1R00 A;  3HZJ A;  3HL2 A;  1D8J A;  3ZQ7 A;  4X0G A;  2V1X A;  4E6K G;  2FX0 A;  1QA6 A;  5E8I A;  4M9X A;  1PVE A;  3OOU A;  2UUZ A;  3FXO A;  2KRC A;  3WTX C;  2VBY A;  3CCY A;  4IHY A;  1HKT A;  2ELK A;  3HUG B;  2L54 A;  1ZHF A;  4E7S A;  4H4K C;  2CYY A;  3U2R A;  1F43 A;  3RPU D;  1O7L A;  4AWX B;  1IO2 A;  3MD2 A;  2DQR A;  4KN4 X;  2ZJQ F;  3FF5 A;  2OZU A;  4GXO A;  1Z77 A;  4LOC A;  3ZMS A;  2BVM A;  5ILS A;  5KNL A;  4F55 A;  4F7Z A;  3QYF A;  2L4A A;  2LBF B;  1A35 A;  2JJ7 A;  2HWV A;  2F4M B;  4IZZ A;  3OL4 A;  5BQT A;  1S5L C;  5ICE A;  3HOW J;  1FLI A;  2G0E A;  1E3H A;  3HM5 A;  4ZYG A;  2UWM A;  2Z16 A;  5EG0 A;  3S14 J;  3BR3 A;  5BPD A;  5EYR A;  2DA1 A;  4JP0 A;  2KIS A;  5F08 A;  3F8F A;  1ENH A;  1RET A;  4BJ5 C;  2B0L A;  3GBG A;  5F27 A;  1B4A A;  1J7K A;  1STZ A;  3WG9 A;  1SAN A;  4FTH A;  5GPC A;  2XUB A;  4CHU A;  1YRN A;  2DOA A;  1BI0 A;  1SD6 A;  3IAS 2;  5HLI A;  2GA2 A;  2G7U A;  2OV7 A;  4B47 A;  4ESJ A;  2VT3 A;  4I0B A;  4ANJ A;  1VZ0 A;  4EM2 A;  4I01 A;  1E2X A;  4XLC A;  4WXC A;  1POG A;  2WY8 Q;  3LSI A;  1V5G A;  2EBI A;  2FBH A;  5FKK A;  3GX4 X;  3HHH A;  2OCC H;  2XGD A;  3CUQ C;  4RB1 A;  4L5J A;  4JOM A;  3E1S A;  2DU9 A;  4YIR X;  1OFC X;  1U5T B;  1OCT C;  3MVP A;  2KIM A;  3A01 A;  1YW9 A;  2VOO A;  2LTP A;  2IT0 A;  1W1W E;  2V6E A;  4JX6 A;  3OYH A;  2FF4 A;  3ABK H;  3DBH B;  3MN2 A;  4XLA A;  4KIF A;  5CJ9 A;  2CUE A;  4KT6 A;  4R79 A;  1X2M A;  1X19 A;  4PSX A;  3RZO J;  3ABU A;  2DBB A;  1VFC A;  5E3N A;  4A0X A;  5FD5 A;  5L3D A;  4I98 B;  2QEX I;  1XGM A;  2R5Y B;  4L0Z B;  1SD4 A;  5E3M A;  1IXR C;  2HYJ A;  2QM3 A;  1YJ9 I;  2EZK A;  2ZO4 A;  4G7H F;  1WI9 A;  1FNN A;  1ZQ3 P;  2QVO A;  3CLO A;  1BM9 A;  2F2E A;  4BY1 J;  1YS6 A;  3E3V A;  5F0F A;  1SVO A;  3FBN B;  2JRM A;  3BR5 A;  2PN6 A;  2QSF X;  3B6A A;  3COA C;  4MHG A;  1V54 H;  2ESH A;  2VOP A;  1W5S A;  2XAF A;  4YIF A;  5D5W B;  2ZJR F;  4IX7 A;  1TT5 B;  1FIP A;  5J47 A;  2QQA A;  2FOK A;  2H1L A;  2BY1 A;  1K61 A;  1BIB A;  1U8B A;  1ETX A;  2VC1 A;  3ZQQ A;  2XGX A;  2ZC2 A;  2MC3 A;  5IY5 H;  1YI2 I;  3HC7 A;  3KEO A;  2LRD A;  4N4O B;  3WGI A;  3Q0W A;  2Q8K A;  5C4X J;  3TL4 X;  2KIQ A;  1QPI A;  2ELH A;  2ESN A;  3BR6 A;  1GT0 C;  2JUG A;  4BH9 A;  5IYC J;  4P9F A;  4HNU A;  3EUA A;  2A07 F;  3SZT A;  2ADU A;  3LSH A;  3KIO A;  4B8X A;  2AHQ A;  3ZMT A;  2CQ7 A;  2LP0 A;  3J7A O;  2BY2 A;  3JTG A;  1NTC A;  3F0C A;  2IA1 A;  1HBX G;  3CCS I;  2K9Q A;  2BY3 A;  2M45 A;  4HBL A;  1YG2 A;  4HV5 A;  2DMN A;  4R1H A;  3OYI A;  4M73 A;  2XC7 A;  2L7K A;  1JGG A;  3ECH A;  1G4D A;  1ZRE A;  4W97 A;  2EA4 A;  1IGN A;  2BHY A;  5KVR A;  1AKH B;  4GFB A;  1M1E B;  2JWT A;  1B8I B;  2RDP A;  4M9Z A;  4AIH A;  3MCZ A;  3LNQ A;  4M3G A;  2W25 A;  2ZKZ A;  2G7H A;  4CH7 A;  1I3A A;  2WB1 A;  3R60 A;  3BR1 A;  3FMQ A;  3TBI A;  2K40 A;  1UEL B;  2KZV A;  2X6X A;  4HSR A;  4EJO A;  2O3F A;  4RB0 A;  2D5V A;  5HLG A;  5FRM A;  2L7M P;  2RKH A;  4KIG A;  1LDD A;  2CQN A;  4WX9 A;  1YJN I;  3QYE A;  2IPQ X;  1J0R A;  3AG1 H;  5D6E A;  4KDP A;  4PDK A;  1IV8 A;  1NG7 A;  3PIP F;  2KHM A;  3GF2 A;  2DA6 A;  2DAO A;  3SXY A;  3V8J A;  5DDG A;  3DBL B;  2J5O A;  2QBY B;  4CCL A;  4E7J A;  3WGH A;  3HOZ J;  1MMS A;  4F91 B;  1MMA A;  2JN6 A;  2YU3 A;  2PX9 A;  4CZZ A;  1MBF A;  1YIO A;  2P7C B;  2M1B A;  3SEQ A;  2CMP A;  4EVI A;  1S7A A;  2K4J A;  4LB6 B;  4BBR J;  4C2U A;  1YX3 A;  5E18 F;  1ZG5 A;  3CUO A;  3E6M A;  5M3M J;  4ZDP A;  1H88 C;  2F4I A;  2HXI A;  2ZFU A;  3DV8 A;  1X1A A;  5F1J A;  3PO2 J;  3VYR B;  1KU9 A;  3GZN B;  2FSW A;  3JRE A;  5F64 A;  2ELJ A;  3ZMU A;  5DCM B;  3QP5 A;  1KYW A;  1TTY A;  2HQA A;  4RAY A;  3SFI A;  3FDY A;  2O0Y A;  2WAF A;  3OYD A;  2HXO A;  2MC4 A;  5DD4 A;  4BE2 A;  3CO6 C;  3LFU A;  4NUB A;  4UY8 I;  3CJT B;  3V4G A;  3OYE A;  1WZ2 A;  4HEA 2;  1MNM C;  2DO7 A;  3ZMZ A;  3OYF A;  4A3D J;  1W0T A;  1ORK A;  3S17 J;  4RB2 C;  1YHQ I;  2FEZ A;  1OLT A;  4XN0 A;  2FRH A;  1OCO H;  2GXG A;  1D0Y A;  3JW4 A;  3QOD A;  4M9S A;  2LOO A;  1WJF A;  2VQL A;  3A02 A;  5JVG F;  1V4R A;  5FGM A;  3E6C C;  5GTH C;  3W2A A;  3BZC A;  2NRA C;  4Y52 J;  2OF7 A;  4P96 A;  1JJ8 C;  2E19 A;  5HNF A;  2CJJ A;  1KU3 A;  1V5E A;  1XCV A;  3GME A;  3HSE A;  1MJ9 A;  2M34 A;  1MBJ A;  3HOV J;  2GXB A;  4DQ2 A;  1HST A;  2VBW A;  5CYV A;  3HRU A;  1ZRF A;  3LSK A;  3DPU A;  1UFM A;  4MNU A;  2LKS A;  4DNC A;  3ZQL A;  2WA0 A;  5M5Y J;  2V9K A;  4Z2Y A;  3NRV A;  4LMY A;  3OSF A;  4PZJ A;  3G6E I;  4BXU A;  2RGV A;  4HW0 A;  3DCF A;  3DLA A;  2LKX A;  3DEE A;  2L4M A;  3DTI A;  4V2G A;  5L3E A;  2YU9 J;  2IGN A;  2DFH A;  1UST A;  3H3U A;  2V9P A;  1LB2 A;  2UZK A;  2OC6 A;  4GCV A;  1XDS A;  2XKP A;  2W82 A;  3CLQ A;  3CQZ J;  3HDD A;  3FHN A;  2ZB9 A;  3FM3 A;  3WTV C;  4Y13 A;  1JTY A;  2O8X A;  4U87 A;  2ZFW A;  3V7R A;  1I5Z A;  2DA4 A;  2QQ8 A;  2R5Z B;  1OCR H;  4Q5S F;  3JSP A;  2JMW A;  4HST A;  2Y9Z A;  1KYZ A;  3FXQ A;  1K4S A;  4FE4 A;  4YII A;  3VB2 A;  4CSW A;  1UB9 A;  4IHS A;  4DYC A;  5EZH A;  3I58 A;  2L9N A;  1HW5 A;  2HDW A;  3IRR A;  2FMY A;  1ZN2 A;  5EEH A;  2XHK A;  4WK8 F;  2E1O A;  4FT8 A;  2DCE A;  2ZXJ A;  3EUK L;  2K02 A;  3PQJ A;  4AYB A;  5EEA A;  4NHJ A;  2R93 J;  1A04 A;  1SEU A;  5H6R A;  1BI3 A;  2QLZ A;  2D45 A;  2FXA A;  1KQ8 A;  3CJQ B;  5K7Z A;  5J8C A;  1Q1V A;  2WC2 A;  2O61 A;  1ZTR A;  1G2H A;  4F52 A;  1H9T A;  1EF4 A;  3HOS A;  3ZN1 A;  1FZP B;  2O7O A;  1R5H A;  1XN7 A;  2I5U A;  1RNL A;  4KYW A;  4YFK F;  2R0Q C;  3HYI A;  5DM6 F;  2MH9 A;  5E1X A;  2DA3 A;  1YX5 A;  4II3 A;  3S2D J;  4HA8 A;  3TOB A;  1FBS A;  2X85 A;  2QCO A;  1U0J A;  2L0K A;  2Y75 A;  2HTJ A;  3O3K A;  3VDX A;  4LJZ F;  4E4H A;  2JT1 A;  1Z3X A;  3ZOB A;  1CF7 A;  2EIN H;  3ESW B;  5GPA A;  2RC4 A;  2CW8 A;  2MG4 A;  4A3I J;  2Q1Z B;  1ITY A;  3J7Z I;  3DPL C;  4D7N A;  2M4G A;  3H5R A;  2Y30 A;  2KP6 A;  4BEH B;  2XSJ C;  1IRX A;  1ZEL A;  2M7A A;  1YQA A;  1LNW A;  2CW7 A;  5AIP A;  2JPC A;  1P7I A;  4UNO A;  3S1R J;  3CF5 F;  1D8K A;  1X2N A;  1FTT A;  1OKR A;  1F5T A;  3I4P A;  4G7O F;  3CUQ A;  2E34 A;  1VI0 A;  4PJN A;  2Y2Z A;  2LY9 A;  1B72 A;  2XVC A;  4LLN A;  2OBP A;  3TDZ C;  4NC7 A;  4OIR F;  1JJ6 C;  4XSZ F;  1XMX A;  4JBA A;  3Q5F A;  4FIS A;  2Y9Y A;  4MFD A;  3QAH A;  2FUG 2;  2V1D A;  1BIA A;  2L02 A;  4OIO F;  2EIK H;  5D6F A;  2ZME B;  2HPI A;  1Y1W J;  1R22 A;  3VOD A;  2WWY A;  5B5E C;  5DUI A;  3W6J B;  4ESB A;  4IVN A;  4UVC A;  1FYM A;  5ILV A;  1LE8 A;  4A3E J;  5F04 A;  3RQI A;  2VJ4 A;  2YUS A;  5CKT A;  3WTT C;  4KNY A;  3M4O J;  3EQL F;  2EV0 A;  5EDN A;  2E5N A;  2CFX A;  2Y0S A;  4G6Q A;  5H2F C;  1U3E M;  4IO9 F;  2H27 A;  1IN6 A;  2M4K A;  3TDU C;  3TQN A;  1JUS A;  2JRT A;  3K1P A;  4M6V A;  4OU0 A;  1T56 A;  5K1Y A;  3KZI C;  3K1M A;  3C1D A;  4Y15 A;  2CQX A;  4HNV A;  5E17 F;  1X58 A;  5CQE A;  3S2H J;  1U5T C;  1V55 H;  4IKF A;  2XAG A;  4XNF A;  3X2Q H;  1TT0 A;  2ID6 A;  3KP3 A;  4XQF A;  3BTJ A;  2R7T A;  3G73 A;  3DKY A;  3GFM A;  2ISZ A;  3BTL A;  2ZXI A;  1SFX A;  3C3W A;  1ETK A;  2EJR A;  2V9V A;  1EH6 A;  1LUJ B;  4EQQ A;  3GTJ J;  3A03 A;  4LIV A;  3AG3 H;  3HSR A;  4BY7 J;  3WU0 A;  4AUX A;  2FJ1 A;  1SAU A;  3D1N I;  2A6E F;  2O8K A;  1A6I A;  2IS2 A;  1E0E A;  2NVX J;  4XSX F;  5IT3 A;  5D5V B;  2PJR A;  4EGY A;  1I50 J;  3U9G A;  2IEK A;  3K7A J;  2IA2 A;  2QSH X;  1G3W A;  2FBI A;  3FMR A;  2Y69 H;  3K4K A;  4P9U A;  1DU0 A;  1L3L A;  4IPA A;  2K3F A;  4CDG A;  1R23 A;  4M74 A;  3GWZ A;  3FKI J;  3K69 A;  3IKT A;  3IHU A;  5CVU A;  4FX4 A;  1SFE A;  4XKC A;  3G1L A;  4JX4 A;  5LGN A;  3FXJ A;  4KN7 X;  1WJC A;  2QWW A;  2L9R A;  3K4N A;  3LA2 A;  2GIZ A;  2WV1 A;  3JRD A;  1HXD A;  2IGO A;  1MDM A;  1BR4 A;  3CTA A;  3FHZ A;  5CVI A;  3CCV I;  2JA2 A;  5JLW A;  2DW4 A;  4XRS G;  2AXT C;  1QU3 A;  4D7M A;  2CUZ A;  2ZXH A;  2DXI A;  4CUG A;  1HA8 A;  3O6B B;  2V1U A;  1AA7 A;  3DKW A;  4CYC A;  1Z91 A;  2EFO A;  2EFP A;  1RKW A;  3M8E A;  2CFO A;  3LSG A;  1SVL A;  4XIC A;  5FD6 A;  1W0U A;  4F92 B;  3BQZ A;  3BT9 A;  3G1O A;  2OAZ A;  3IP4 B;  4YEL A;  1VQO I;  1W5C C;  1N25 A;  3ABL H;  3HKZ N;  1EV7 A;  2STW A;  1OIS A;  4Q47 A;  4BXF A;  2K9S A;  1JXS A;  2LC2 A;  3HRM A;  3IC7 A;  3K6G A;  1N77 A;  2CGP A;  4U88 A;  1ACI A;  3FXR A;  2V6C A;  2PMZ N;  2K7L A;  1VND A;  3KZZ A;  1HCR A;  3RYR A;  2X0L A;  1YIJ I;  1S29 A;  3LA7 A;  2VKD A;  2ZBK A;  2LF7 A;  1MNE A;  5BNG A;  2NYX A;  3KEQ A;  3KPH A;  3B02 A;  4LG0 A;  4KIS A;  4GO1 A;  3SFZ A;  2A05 A;  2R7X A;  2CUJ A;  1PUF A;  5DTD A;  3QPT A;  3JRI A;  4RM2 A;  2TCT A;  2L01 A;  5M5X J;  1U9N A;  1S7E A;  4GYI A;  4QSH A;  3AL0 B;  1XMK A;  2VXZ A;  1OYY A;  2LKP A;  2W00 A;  3NQO A;  2IXS A;  4XM3 A;  1IRF A;  3HPG A;  3TMO A;  4C2M J;  3IWF A;  2A68 F;  3GTK J;  5ICF A;  3WTU C;  2LY1 A;  2E7W A;  2OTL I;  3VOE A;  1F36 A;  5LGU A;  5GAE J;  4O6J A;  1MJA A;  1YW7 A;  4NB5 A;  4XOR A;  4AID A;  4IOC F;  4JK1 X;  2KQR A;  2M0M A;  2M3A A;  2AO9 A;  2L5Q A;  1S72 I;  1YRN B;  2VQH A;  2ID3 A;  5D4S A;  3H0D A;  5DV5 A;  4D5F A;  4BHB A;  4CYD A;  1QNT A;  1GVJ A;  4ZYD A;  1D1B A;  3QRF F;  3TW6 A;  1DUX C;  4PUS A;  3E5U A;  2XGE A;  2Q2E A;  1U8R A;  3K4L A;  1HKS A;  2A61 A;  1H9G A;  2H09 A;  2EB7 A;  1ZLJ A;  4PGG A;  2VB6 A;  4KJZ A;  1X4P A;  4YFX F;  3ABT A;  2ISY A;  3IV5 A;  4HF0 A;  2HQ5 A;  2P0W A;  2IBD A;  4QTR A;  1VQ7 I;  1DGR M;  3OIO A;  1ETY A;  3L2C A;  3K4M A;  5FJ8 J;  4CO8 A;  2DI3 A;  2D2W A;  1Z21 A;  1BR2 A;  3GFI A;  1MSF C;  2FOW A;  3TO7 A;  4XMY A;  3Q0V A;  4X6A J;  4UUS A;  1MD0 A;  5J40 A;  3PSI A;  3ZRG A;  5HDK A;  5DD8 A;  4A3J J;  2FNP A;  1FWZ A;  1RIO H;  2EIL H;  1RR7 A;  2BW3 A;  3GCM A;  4CCM A;  1G3T A;  1LVK A;  2LFB A;  2CO5 A;  4I99 C;  3A1Y A;  2WAQ A;  5J6X A;  1IUF A;  3LAJ A;  1WVR A;  3FK6 A;  4KMU X;  1VQ5 I;  3A4C A;  2KPM A;  1K78 A;  5IOY A;  1H89 C;  3F72 A;  5HS9 A;  3LSR A;  2P5K A;  2IRF G;  3CD6 I;  2XB0 X;  1I3Q J;  3CCJ I;  1T2K A;  4G8X A;  2XIG A;  1DDN A;  3K2A A;  4HQM A;  2OCE A;  1AOY A;  2PMU A;  3IRQ A;  1R49 A;  3J80 K;  4ZDL A;  1JHH A;  1P2F A;  3CC4 I;  4PFO A;  2CQK A;  3MZY A;  4XLE A;  2MA3 A;  4RDU A;  3K9T A;  2BOL A;  2F5F A;  1ETQ A;  4BHC A;  1ZR2 A;  2BVL A;  2KL4 A;  2H8R A;  1U78 A;  3I4M J;  3F8C A;  3R61 A;  1X3U A;  3RCO A;  2W4S A;  2BHZ A;  2Z2S B;  1MBH A;  3FXM A;  1QZE A;  2DK8 A;  2DOD A;  2NAZ A;  3MEX A;  4ZZL A;  5ICC A;  1T08 B;  2QGU A;  1YIT I;  4LGW A;  5FLV A;  3CJR B;  3OYC A;  3IH3 A;  2R7Z J;  4C3H J;  4UB6 C;  5F0C A;  2GWR A;  4OOI A;  1A5J A;  1WFX A;  2EZH A;  3G71 I;  2DT6 A;  2JSP A;  4LB5 A;  5LRR A;  4CXF A;  4EMS A;  4XR6 A;  4W1U A;  2G9W A;  2CH0 A;  3I4N J;  2BEO A;  2JVH A;  1J75 A;  2XPW A;  2EA2 A;  4JYK A;  1HLV A;  4DBQ A;  1O3Q A;  4LD5 A;  2MFZ A;  2CWE A;  3OR2 C;  1O3S A;  5F1R A;  1ZGW A;  3F6O A;  1QHG A;  2MBF A;  3HUG A;  4BGD A;  4XOT A;  1BI2 A;  5IP6 A;  3F8B A;  1Z7U A;  3LFK A;  1BL0 A;  2DYR H;  3KYL A;  3ABM H;  4JQF A;  4U7D A;  2EIJ H;  1K7A A;  1Z6T A;  3ELK A;  2NVT J;  1W7P B;  3UR3 C;  3HSF A;  1D5Y A;  2BGC A;  2FD5 A;  3ZXS A;  3ZPL A;  2DTZ A;  2LBF A;  1RPW A;  4MIM A;  2ECB A;  3BJA A;  5TGT A;  2DMP A;  1HSJ A;  4UV9 A;  4CIC A;  1BOB A;  2KIU A;  3HIF A;  1JKQ C;  1SFU A;  2E1M B;  1N75 A;  2NS0 A;  3DKX A;  2IS6 A;  5GTI C;  1TZL A;  3I0T A;  1W36 C;  1FMV A;  3OS0 A;  1P92 A;  4ZYA A;  1XSV A;  2K85 A;  2E7X A;  5EGO B;  4FCY A;  1GXQ A;  3AKZ A;  3E5X A;  5K7F A;  4YRV A;  4HZF A;  2GLO A;  3HGY A;  2F48 A;  3VFZ A;  3BG6 A;  3BPX A;  1I6X A;  4AIJ A;  1QGP A;  2M8G X;  3OWT A;  2IA0 A;  4L9J A;  1D1C A;  5HLT A;  3SEZ A;  1ETW A;  4A3C J;  1SMT A;  1QHH D;  1GLN A;  1ZAO A;  5J1Y A;  2LNB A;  2BV6 A;  2DQL A;  4M3D A;  2RVC A;  5E3L A;  4UUT A;  2PQ8 A;  3PNT A;  2EPF A;  2WY7 Q;  2Z99 A;  2NOJ B;  1XX5 A;  1HDD C;  4MEY F;  1MGT A;  3C2B A;  4BNC A;  1ZRD A;  2HQR A;  3OR1 C;  1IDY A;  5M3F J;  4BU2 A;  2W7N A;  3F3X A;  3FK7 A;  2WV0 A;  4IF4 A;  3TGN A;  3HPH A;  3F22 A;  1OR7 C;  1IRZ A;  2EZI A;  1GUU A;  2ZME C;  3ZGK A;  1R6R A;  1NH3 A;  4BUP A;  1GVD A;  3E6B A;  3CCQ I;  4A0Z A;  2A3S A;  1F9N A;  3SHF A;  3OS2 A;  4UVA A;  3J80 Z;  2R5Y A;  1WH7 A;  1XGO A;  2KJC A;  4Y17 A;  1I6H J;  1FOK A;  1MW7 A;  3KE2 A;  3R4K A;  3QOE A;  3K2Z A;  4EJV A;  1ZLK A;  2X6O A;  4OAY A;  1JUM A;  3LOC A;  2F5E A;  2VUM J;  4ZTF A;  1UAA A;  2KDZ A;  3P9I A;  5F0H A;  3J7Y J;  3G4S I;  2HU9 A;  1D3Y A;  1Z7L A;  3PQK A;  1XB4 A;  2CS3 A;  1R5G A;  2BYV E;  2HFH A;  3HOX J;  4A3B J;  1YYV A;  2K5C A;  1QQI A;  1ZGJ A;  2M9H A;  5FB2 A;  1T95 A;  1FMW A;  1XS9 A;  4MGR A;  2AXL A;  2W84 A;  1WKM A;  1B1B A;  2ZCW A;  2DT5 A;  2UXN A;  3F23 A;  4EAT A;  4ZC3 A;  4FET A;  2RQP A;  2QKL B;  3E7L A;  1Y0U A;  4BL0 B;  3CJN A;  3I59 B;  1G59 A;  5J1U A;  1IRG A;  2XAS A;  4EJT A;  2MLG A;  4B1R A;  2HVS A;  2LK2 A;  4M3B A;  1AU7 A;  4NQW B;  5GP9 A;  3PNV A;  3HGG A;  3Q3S A;  1OMI A;  4HV6 A;  3LAP A;  5FKM A;  1EH7 A;  3JAM K;  5DCF A;  3KP2 A;  3OYK A;  2M5W A;  1TNT A;  5E1Z B;  4CCO A;  2QKM B;  1MIJ A;  2XSD C;  2LVS A;  1S7O A;  3FIS A;  4IQJ A;  1FBQ A;  1A31 A;  1HW2 A;  3KP6 A;  5JHU A;  5FLX K;  4HX8 A;  4BJT A;  2Z1D A;  1SMY F;  1AKH A;  1B8I A;  3MMY B;  4L9N A;  1ZKG A;  5HNH A;  4XRS A;  3H9J A;  3ZCO A;  2ZJP F;  1TLH B;  3I64 A;  4B3A A;  3CMM A;  1K6Y A;  1JT6 A;  4II2 A;  1YLF A;  3RTR A;  1S9H A;  2KZG A;  1D1A A;  1WCM J;  2MSY A;  2XKO A;  3N97 A;  1TQI A;  5LEK A;  1P9Q C;  1Z6R A;  5IOZ A;  4I09 A;  2D1H A;  4BYY A;  5H20 A;  4M3F A;  4WF2 A;  4LIU A;  4BDY A;  3CES A;  4B09 A;  3S1N J;  3GTO J;  3L2U A;  5D4R A;  2QQB A;  2GA1 A;  2W57 A;  2QBY A;  2XF6 A;  1HQC A;  1LDJ A;  3CP2 A;  1C0W A;  2XAQ A;  4WCG A;  2R4G A;  2GBY A;  2NOG A;  4RS8 A;  5CVJ A;  4BXX J;  2IJL A;  3BG3 A;  4FAS D;  2R7S A;  4K2E A;  2VC0 A;  5ICG A;  3AG2 H;  1JE8 A;  3M1E A;  2HTS A;  3KEY A;  5C44 J;  3L1P A;  1LFU P;  1YTY A;  4XN3 A;  2NXN B;  1YFH A;  2QSG X;  1MMG A;  4I76 A;  2XF5 A;  5DCM A;  4XON A;  3TKY A;  4HDU A;  2VBX A;  2OQR A;  1GHC A;  3HEF A;  5A2Q K;  1VQK I;  3DP7 A;  3RKQ A;  5AIQ A;  4FE7 A;  3TO9 A;  3FXU A;  1DP7 P;  3I55 I;  4R8H A;  3AL0 C;  3WGG A;  1RC9 A;  3CCM I;  3EDP A;  2H6C A;  2DA7 A;  3BJO A;  1APL C;  4P5O A;  1TNS A;  1BW5 A;  1S3J A;  4A12 A;  1VQM I;  4KT5 C;  3WTS C;  4C9Y A;  4I2O A;  2VBZ A;  4L9V A;  5L3F A;  1IZ1 A;  1F1Z A;  4S04 A;  2BZT A;  4H0E A;  4GGG A;  1UHM A;  3MQ0 A;  2NNY A;  2ECC A;  5HVQ C;  4I0A A;  2QZ8 A;  1BI1 A;  4LG3 A;  5TIS C;  3S93 A;  4HPQ A;  3QPL A;  3S3M A;  4IL6 C;  5FO5 A;  4BBS J;  2K9L A;  3FXK A;  3JTH A;  3MKZ A;  1XMA A;  3MAJ A;  4BQN A;  2B9S A;  2YS9 A;  4O3M A;  5TRD A;  2DJN A;  1LKX A;  4B48 A;  3ERM A;  5GAG J;  2H6B A;  1IN7 A;  3KYD B;  4XL9 A;  3BR2 A;  3NAU A;  1LPQ A;  3BPV A;  3KYC B;  4E7L A;  4OIP F;  2VI6 A;  4Z6Y A;  3BLY A;  4CCN A;  1V3F A;  3OYM A;  5B1B H;  1SD5 A;  4LIT A;  4TV7 A;  2L9S A;  4ENN A;  4LK1 F;  2TRT A;  4RAG A;  3E6D A;  2LD5 A;  3KET A;  3BG5 A;  4KIC A;  3GVA A;  3K1N A;  2RNJ A;  2GM4 A;  3OYN A;  5BOX A;  1T39 A;  1WI3 A;  4A3F J;  3EUH C;  4XK4 A;  5IPA A;  2STT A;  3H3Z A;  2VON A;  4DBR A;  1ERD A;  1UHS A;  3JAM Z;  2VKE A;  1X3Z B;  2F5C A;  1FJL A;  4MQ9 F;  2VIX A;  5FFX A;  3L00 A;  5D5X B;  2HKX A;  2N8G A;  2VJJ A;  3SDB A;  2PJR B;  3H36 A;  5LHI A;  3BWG A;  5FLX Z;  1I27 A;  2HS5 A;  3ECO A;  2IAI A;  5FRN A;  1TW2 A;  2XPV A;  3L2W A;  1VQL I;  1N78 A;  4BHP A;  4IOA F;  2OU2 A;  4S0H B;  2EH3 A;  2WTE A;  3VSL A;  4G12 A;  5EF6 A;  3CME I;  3MWM A;  1UCR A;  1TQM A;  3R0A A;  4A6D A;  1Z3Y A;  1OQY A;  1XGS A;  2VKV A;  1BBY A;  3FMS A;  4M72 A;  1E3P A;  2GIV A;  5JLX A;  3KZY A;  4XRF A;  1MSE C;  4ON0 A;  3S16 J;  3JRG A;  1QVT A;  4A3M J;  4C3J J;  1D0X A;  4I02 A;  3BCB A;  1IAW A;  1HW1 A;  1L0O C;  1TWC J;  1YJW I;  1EA3 A;  4LFU A;  4ZH4 F;  3WTY C;  2C6Y A;  1X1P A;  3F8M A;  3IH4 A;  3OYB A;  2NVQ J;  2BE5 F;  3PIO F;  1XSX A;  2EQR A;  2F5D A;  1LVA A;  1VQ9 I;  4PJJ A;  2HOA A;  4WXH A;  2R7U A;  4L5I A;  4E7Z A;  1FOY A;  2CV2 A;  2PMH A;  3BG7 A;  1IV6 A;  1CGP A;  5CPR B;  3H92 A;  4X1E A;  3FWE A;  3CC7 I;  4ZTJ A;  1XCB A;  3S1Q J;  5LRS A;  2XGC A;  2LSO A;  2CV0 A;  1SAX A;  3W3C A;  4RMN A;  4G6T B;  5A2Q Z;  2HI3 A;  5FLM J;  1JUP A;  2CW0 F;  1P6R A;  2K3P A;  1FYK A;  3S15 J;  4BQQ A;  2GOM A;  1PYV A;  5CLS A;  3F6V A;  4IRI A;  2Q0O A;  3GTL J;  1WPK A;  3GYH X;  2FML A;  2QUF A;  4BEH A;  4ENK A;  2HVR A;  3L2R A;  3I53 A;  1NK2 P;  2CQQ A;  3S2W A;  2ACJ A;  1P4A A;  4N9I A;  2DPU A;  4DW6 A;  3GTM J;  2FNA A;  4UUV A;  3W6V A;  2VAS A;  3DU6 A;  3BTI A;  1B6A A;  1I1G A;  4EM0 B;  2CG4 A;  2L7Z A;  5HS7 A;  4D9J A;  1Z9C A;  4DYQ A;  3H9Q A;  1X1B A;  4Y3O A;  4B44 A;  2E1M C;  2A69 F;  2HOE A;  3BC8 A;  1IN5 A;  3T8T A;  2AS5 F;  4QWQ A;  4MFE A;  3HB9 A;  1RRJ A;  4EM1 A;  1UG2 A;  3K4J A;  2E2I J;  1BC8 C;  2VE8 A;  5CQG A;  3H35 A;  2UXX A;  3I54 A;  4E7K A;  4RB3 C;  1QZY A;  1OR7 A;  2DFF A;  1KU7 A;  3H3V K;  1LJ9 A;  5K5O A;  1FC3 A;  3IKV A;  1TWG J;  2QA4 I;  3W2V A;  2YSR A;  3IWZ A;  5JR3 A;  5GAD J;  2DTR A;  3H5A A;  3JR9 A;  1JKO C;  4XLN F;  1RR8 C;  3MKL A;  3JRB A;  2Y31 A;  4AM3 A;  2R7W A;  2DYS H;  5IT9 K;  2MAB A;  3RSN A;  1EKE A;  2V4J C;  2W85 A;  1RUO A;  1SC7 A;  2MD0 A;  1B9N A;  4WXD A;  1Y6I A;  1NHA A;  3D0S A;  4MTD A;  2L9V A;  5M5W J;  5EJC A;  1DPU A;  1XD7 A;  3LQR A;  4EV0 A;  3D5R C;  1J59 A;  4NC6 A;  3H0G J;  1MBK A;  2EFN A;  3OS1 A;  3ZQG A;  3EPZ A;  2Z9O A;  1ON2 A;  1ZAR A;  3L2Q A;  3V7S A;  2V1N A;  4IHW A;  1R5I D;  2VQC A;  4BJ6 C;  5E8G A;  2P7V B;  4ETS A;  2OA4 A;  2XF7 A;  3V8L A;  1U6G A;  2VE9 A;  2OZ6 A;  4B43 A;  2JQ7 A;  2K4B A;  2COM A;  5EG0 B;  3DLL F;  4M71 A;  3EET A;  4UHT A;  2X9D A;  1WH5 A;  2RRE A;  3CZ6 A;  4GYG A;  3FXL A;  2PLY A;  2MGQ A;  3GUD A;  2LY2 A;  3CCR I;  1REP C;  6PAX A;  2FU4 A;  2JZY A;  2Z3Y A;  4B4C A;  5BS6 A;  2XRN A;  1I39 A;  5IP9 J;  3BP8 A;  1FOW A;  3JSO A;  1TWF J;  2IW5 A;  1LDK B;  3SZG A;  3OYJ A;  2ZSI B;  3ROU A;  4EEF G;  2KKO A;  3CC2 I;  1ZG3 A;  2K86 A;  3JRF A;  2XAU A;  3T8R A;  3E5Q A;  1SFK A;  2HPM A;  1GV2 A;  1MH3 A;  2R7V A;  4RGR A;  4KFC A;  2H8W A;  2ME0 A;  3D5L A;  4ZYH A;  4E70 A;  3E0J B;  5LHG A;  3A01 B;  2Z33 A;  2YR2 A;  1WQ2 A;  3GZ5 A;  2E60 A;  1MJB A;  1W36 D;  4LK0 F;  3U1K A;  1ZR4 A;  3ERE D;  1FEX A;  3G2B A;  2L7F P;  3M3Y J;  5KAF C;  4HYE A;  5IYB J;  3N05 A;  2JA8 J;  2RAE A;  2I10 A;  1ZRC A;  1MKM A;  3LWF A;  1QVU A;  4GDF A;  2PEX A;  1FT9 A;  2LH9 A;  1VQ4 I;  2WB1 N;  3VSK A;  2FQ4 A;  4XRM A;  3QQA A;  3J7A Y;  4XLP F;  1MH4 A;  2R92 J;  2P5L C;  3GFJ A;  3K0L A;  1Z05 A;  3L2V A;  4J00 A;  2PI0 A;  2Y0M A;  4E7H A;  2WAE A;  2V26 A;  3VYT B;  4HOB A;  1T98 A;  4BQO A;  2DT7 B;  2XAH A;  1BW6 A;  3DFG A;  3Q0U A;  2F4O B;  2HR3 A;  3F21 A;  2IS1 A;  2BY0 A;  3CMY A;  1DP3 A;  4J01 A;  2IP2 A;  2R7O A;  2RN7 A;  3MZH A;  2YX4 A;  4XKB A;  1IN4 A;  2VJ5 A;  3V7C A;  1FX7 A;  1J09 A;  2VJI A;  3BJ6 A;  1R4M B;  1ZYR F;  3ZR8 X;  3MZ8 A;  4WWC A;  5C3E J;  4MTE A;  5IT9 Z;  4M6X A;  3V8K A;  1R1U A;  2GZW A;  3NEU A;  1VF9 A;  5LFA A;  2WAD A;  5FKO A;  1RUN A;  2HGC A;  3HXL A;  1UJ8 A;  1PUE E;  3TW7 A;  4N0B A;  3PM1 A;  3DU5 A;  2E35 A;  3DQV C;  2VLA A;  3PO3 J;  3DPT A;  5DUK A;  3HBL A;  3P9K A;  1ZG1 A;  5LEJ A;  2JA5 J;  2VL8 A;  2X6W A;  2X51 A;  1W4M A;  3HKZ A;  1P7J A;  4FX0 A;  4AU7 A;  3D5S C;  2BXY A;  1HOM A;  3C18 A;  3CDH A;  3N4M A;  2HOT A;  2X1D A;  4N9H A;  1DQU A;  3DEU A;  4BAC A;  1QO0 D;  1FBU A;  3UNG C;  3BTC A;  1TW3 A;  1HF0 A;  4YG2 F;  1BC7 C;  1XG1 A;  3TP0 A;  2WBM A;  4UVB A;  1SFO J;  3ZQI A;  2JPB A;  1IDZ A;  2ZXW H;  1ZH5 A;  1T0F C;  2PMZ A;  3GZ6 A;  4XLH A;  3LL7 A;  3AFH A;  1R9T J;  4KIB A;  4MO7 A;  1KON A;  1R1T A;  1YOV B;  2A5Y B;  2QF7 A;  3I3L A;  1WSU A;  5LHH A;  3W6K B;  4U0W A;  3JCU C;  4S05 A;  5FFZ A;  3UKG A;  2R7Q A;  4JX5 A;  1XGN A;  3SDG A;  3EUH A;  4ZZD A;  1R71 A;  2KDO A;  3WE2 A;  3K70 C;  2BXZ A;  2DFE A;  2P5V A;  3NAR A;  2DN0 A;  4NC8 A;  3VPR A;  2O9L A;  2B63 J;  2VQG A;  3QU3 A;  3C2H A;  4A3L J;  1KGS A;  3J81 K;  3BY6 A;  5EEG A;  2E36 A;  5D5U B;  5JHF A;  2VPR A;  2DA5 A;  4RLF A;  3DEW A;  3HHG A;  2KLO A;  2PBI A;  3K4B A;  1KZH A;  2DOE A;  1OYW A;  3TP3 A;  1XTA A;  4A69 C;  3LST A;  2IGK A;  3KLN A;  3HJE A;  4EJU A;  1HDP A;  3RI4 A;  2RV8 A;  1Y8Q B;  2V7F A;  2X1C A;  2JVG A;  3G3Z A;  3P5J A;  1OJL A;  4A3K J;  2MD5 A;  2F5V A;  3HOT A;  3FZV A;  5L3C A;  1WJ5 A;  2HYG D;  4XBF A;  2P6S A;  3GTQ J;  2XAJ A;  3BR0 A;  4NBQ A;  1XDU A;  5HS8 A;  2LDU A;  1AWC A;  4A5M A;  5IP7 J;  3I71 A;  2H1K A;  1ZGA A;  1U2W A;  1WRJ A;  4IHT A;  1O3R A;  4I6Z A;  2QQ9 A;  3GTG J;  1SD7 A;  3VYU B;  1ULY A;  1J2X A;  3OL3 A;  3M9A A;  3IAM 2;  3QOP A;  5HLH A;  3KP4 A;  5J8F A;  3M7G A;  5KCM A;  3A2K A;  3LSP A;  3KX2 A;  3RYP A;  2DLL A;  4DGW B;  4IHX A;  3S8P A;  1E3O C;  4E7I A;  3RPQ A;  1BOA A;  1U5T A;  4BKX A;  3RDI A;  1WJB A;  3ZN0 A;  1YE9 A;  5J1R A;  1B9M A;  2X1E A;  4RGU A;  4F3Q A;  3DTE A;  1O57 A;  4LLG F;  3L9F A;  4XKV A;  1B59 A;  1MBG A;  4AVZ A;  4G7Z F;  1RKT A;  3KCC A;  3WG7 H;  2CV1 A;  4AYB N;  2XV4 S;  1BA5 A;  1DPR A;  3PUB A;  3VYS B;  4QPQ A;  2CUF A;  4OIN F;  1T6S A;  2EWN A;  1TP4 A;  1EH8 A;  4BE1 A;  4L5E A;  1PDN C;  2NS8 A;  3RQ4 A;  2TDX A;  2PG4 A;  3I56 I;  5E1W A;  3FIW A;  4PJ0 C;  4A5N A;  1LQ1 A;  3CP8 A;  5D8L B;  2JA7 J;  3REO A;  3GLL A;  1MMN A;  3OMY A;  1FOX A;  1W7P A;  1S6L A;  2FQ3 A;  2IGM A;  3OY9 A;  3WOD F;  3V42 A;  2M0C A;  3GFL A;  3S32 A;  1V5F A;  3M8J A;  1R36 A;  2XPU A;  3EYY A;  5KAI C;  4ZYE A;  3IL2 A;  1X1C A;  2HQN A;  3CO7 C;  2MYS A;  1WWX A;  2EV6 A;  1MMD A;  1MBE A;  3G1M A;  1HC8 A;  2LYC A;  4A93 J;  1PP8 F;  4HNT A;  2Z5U A;  1Y39 A;  2NVU B;  1RZ4 A;  1HKQ A;  2CU7 A;  3E97 A;  1IW7 F;  3TO6 A;  1IG7 A;  4C3I J;  5EGO A;  3BRO A;  1D5V A;  3WHC A;  3Q9S A;  1QRY A;  3RZD J;  2OQG A;  4XKW A;  5DYM A;  3BOQ A;  2MLK A;  1JHF A;  1KQ9 A;  1LFB A;  3CCU I;  1VQP I;  2EZL A;  2DMT A;  3K10 A;  2BBY A;  2P81 A;  5E20 A;  5TJJ A;  5HOD A;  4Q4Z F;  4C2T A;  2JA6 J;  1O4X A;  1WJE A;  2F6C A;  3T1B A;  2ICW G;  3BDD A;  1FP2 A;  5L3G A;  2O5R A;  3BZ6 A;  4RA2 A;  2PJP A;  1T38 A;  1JTX A;  2VT2 A;  1ETO A;  3JRC A;  3CF2 A;  2FBK A;  3QP6 A;  1KA8 A;  1MND A;  3OV8 A;  1VQ6 I;  3WE3 A;  3H9G A;  4MEX F;  1AHD P;  4OMY A;  1Y56 A;  3J81 Z;  1G3Y A;  3FKJ A;  3PFI A;  3B6C A;  3U21 A;  5ERI A;  2E71 A;  5LGT A;  2LR8 A;  3O8H A;  1BN5 A;  3M1C A;  2A6H F;  1X1D A;  3O2P E;  3HOU J;  2JK3 A;  4DIQ A;  2P6T A;  4KA4 A;  3VEP A;  3PNY A;  2AQE A;  4IQ4 A;  2I8D A;  3MFK A;  2X4H A;  1IJW C;  3DXJ F;  3KLO A;  2HNH A;  3M8F A;  5B3S H;  1WHU A;  2Y0S N;  1JT0 A;  4XOP A;  2LRE A;  4UB8 C;  3OYL A;  3ZQH A;  4P1W A;  4KIT B;  1LEB A;  5JFR A;  5FKL A;  3ISP A;  2VKH A;  4RGX A;  3WU2 C;  1O3T A;  1GDT A;  1QBJ A;  1CF7 B;  3ONQ A;  2M7B A;  2JSC A;  2R7R A;  4RM3 A;  1O7F A;  2RQQ A;  4A2U A;  4IRG A;  1JKR C;  4PSW A;  2Y48 A;  3S3O A;  1BJA A;  2LLK A;  3PSF A;  3OIQ A;  1OCP A;  3GLX A;  1KQ0 A;  1J9I A;  2K9N A;  2X48 A;  2EV5 A;  4DYR A;  1RI7 A;  3SZP A;  2HOS A;  1G6N A;  3WHB A;  5GAH J;  1BR1 A;  4IRH A;  1FP1 D;  4Y7N J;  3OSG A;  3ZMV A;  1NG6 A;  4U0Y A;  4HLY A;  4DJA A;  2CRG A;  3A0H C;  1G8X A;  3IH2 A;  3KP7 A;  4NDL A;  4ASN A;  2B7E A;  2KT0 A;  2HYF A;  3DTK A;  1R58 A;  1YO5 C;  1G3S A;  2M87 A;  3JRH A;  1S8N A;  1XPX A;  5B1A H;  4U7B A;  3CUQ B;  3OYG A;  3I59 A;  4IHV A;  3H1C A;  1WJD A;  3OYA A;  4RLQ A;  3SJM A;  1B72 B;  4A6E A;  1GXP A;  2EIM H;  2OJE D;  3GO5 A;  2HZD A;  1TQP A;  3ZP5 A;  4QIW N;  1I1S A;  1A36 A;  2ZSH B;  4O5V A;  2O03 A;  1H8A C;  4NQW A;  2IVM A;  2RNG A;  9ANT A;  4KMF A;  4OIQ F;  4V2F A;  2VOD A;  4BAY A;  2E1C A;  4AC0 A;  3S1M J;  4HRI A;  4PCQ A;  3ML6 A;  3HTU A;  3CDI A;  2UV1 A;  1LE8 B;  2CSO A;  3LSM A;  3CCE I;  2DMQ A;  2P8T A;  5JVT A;  3SYT A;  4HDV A;  3ZQC A;  4ABZ A;  1OYI A;  1W7P D;  4A0Y A;  3LMM A;  4L0Y B;  1LEA A;  4HX7 A;  1R4N B;  1U9O A;  5FRO A;  3W2W A;  3PJR A;  3OOP A;  1FSE A;  2NNN A;  1ZK8 A;  4DZP A;  1IF1 A;  4D0P A;  2COB A;  3R0J A;  4UV8 A;  1CQT A;  1K83 J;  2HZT A;  4HQE A;  1DU6 A;  4Q48 A;  1IXC A;  4KUM A;  1K4T A;  4ESF A;  1UMQ A;  4CA0 A;  2OPT A;  1FTZ A;  2ETH A;  4HG2 A;  4OWR B;  3BCA A;  4EGZ A;  2J5P A;  4HAM A;  4L18 B;  3LSJ A;  2R5Z A;  1ONV A;  2YX7 A;  2KRF A;  5K5R A;  3WTZ A;  5JI6 A;  5KK1 A;  5J4Y A;  3HRT A;  4AD9 A;  3PFY A;  1DGW Y;  2X6Y A;  2KMU A;  4BQA A;  1Z67 A;  4ZJZ A;  2KFD A;  5HOO A;  2KJB A;  2M30 A;  1LFP A;  3RKW A;  4CCK A;  4C30 A;  5H6Q A;  2EK5 A;  3KFW X;  1IUY A;  1EJ9 A;  2GQQ A;  1UZC A;  3T5X A;  4G94 A;  1D0Z A;  4G6D A;  3MKY B;  2GOX B;  3QPH A;  1P4W A;  3BG9 A;  3NWT A;  2R7D A;  5BMZ A;  4YFN F;  1MDM B;  5FKN A;  1ETV A;  2VXD A;  3FBI B;  4QLC U;  3NWS A;  1T8I A;  2JUC A;  4HF1 A;  3AAF A;  5LLQ A;  1T0F A;  4FHT A;  2V79 A;  4PJM A;  1TWH J;  2W24 A;  2R3S A;  4UXN A;  5K5Q A;  2E5Z A;  1QZZ A;  1OCC H;  1FSH A;  3Q9V A;  4CYC B;  3RKX A;  4PGH A;  2H94 A;  1IN8 A;  1JGS A;  2NS7 A;  2IS4 A;  4Y4R A;  1YW8 A;  2QEN A;  2R7F A;  4BDZ A;  5K7H A;  4PFP A;  3FM5 A;  2MW8 A;  1XC5 A;  4BS9 A;  1SVM A;  4GRI A;  2VPL A;  4LLL A;  2ZNZ A;  4QPO A;  1ON1 A;  3JRA A;  3GW2 A;  3ULQ B;  3C7J A;  3TED A;  2YPR A;  4D1Q A;  3AG4 H;  4DOZ A;  3QU6 A; 
#chains in the Genus database with same CATH homology
 2LG4 A;  4U87 A;  2E60 A;  1W36 D;  4HST A;  4XLF A;  3PNT A;  2L2O A;  3G2B A;  4B3X A;  2WY7 Q;  4N4N B;  2NOJ B;  4CSW A;  2A5W A;  2K9M A;  1X4O A;  3N05 A;  4MLO A;  3OR1 C;  2L9N A;  2HDW A;  2AQF A;  4BU2 A;  2W7N A;  2W1O A;  3HPH A;  1OR7 C;  2LH9 A;  4Y33 A;  3VSK A;  3J7A Y;  2DCE A;  3ZGK A;  3MKW B;  4YEJ A;  1R6R A;  3EUK L;  4AYB A;  3I9V 2;  4J00 A;  4BUP A;  3L2V A;  3F9K A;  3HG9 A;  4E7H A;  2WAE A;  2V26 A;  3S3N A;  4ITV A;  3VYT B;  3CJQ B;  4BQO A;  3OS2 A;  4F52 A;  2DT7 B;  1MW7 A;  3HOS A;  2IS1 A;  3QOE A;  1DP3 A;  4CCJ A;  5KHD A;  4J01 A;  2R7O A;  4OAY A;  4XKB A;  2VJ5 A;  4ZTF A;  1UAA A;  1J09 A;  1YX5 A;  2VJI A;  4II3 A;  3ZR8 X;  2HU9 A;  2Q2E B;  1Z7L A;  2CS3 A;  2K5C A;  2X85 A;  3OIP A;  1U0J A;  5LFA A;  1T95 A;  2WAD A;  1FMW A;  3VDX A;  3HXL A;  4E4H A;  1Z3X A;  3DU5 A;  3DQV C;  2VLA A;  3DPT A;  4EAT A;  4ZC3 A;  2CW8 A;  2DJI A;  2VL8 A;  2X6W A;  2Q1Z B;  2QKL B;  2X51 A;  4FET A;  4BE0 A;  3DPL C;  3HKZ A;  4AU7 A;  2M4G A;  3D5S C;  3H5R A;  3IUO A;  4BL0 B;  4F93 B;  3PL8 A;  2KP6 A;  2X1D A;  2XSJ C;  4BEH B;  1IRX A;  4ZDO A;  1DQU A;  1ZEL A;  4BAC A;  4PK4 A;  1G59 A;  2M7A A;  3K4C A;  3UNG C;  3C2G A;  3DWL E;  2CW7 A;  2HVS A;  2WBM A;  4NQW B;  3PNV A;  2BW3 B;  1T0F C;  2PMZ A;  4XLH A;  3LL7 A;  3AFH A;  3OYK A;  1KON A;  3I3L A;  4CCO A;  2QKM B;  2R7Q A;  1JI8 A;  4PJN A;  1UG0 A;  4IQJ A;  2KDO A;  4BJT A;  4NC7 A;  3K70 C;  2Z1D A;  3MMY B;  4NC8 A;  2HVQ A;  5HNH A;  3H9J A;  2FUG 2;  2VQG A;  3ZCO A;  3C2H A;  2HPI A;  3CMM A;  1K6Y A;  3VWB A;  4II2 A;  3RTR A;  1S9H A;  4CZC A;  5JHF A;  1D1A A;  4RLF A;  2KLO A;  3K4B A;  2CV2 A;  2OUM A;  2VJ4 A;  5CKT A;  1P9Q C;  2A6T A;  2IGK A;  4OAZ A;  2E5N A;  4LIU A;  2XDV A;  3QYB A;  4BDY A;  3CES A;  2Y0S A;  2V7F A;  2X1C A;  1WJA A;  2JVG A;  4PJL A;  3L2U A;  3K70 D;  2M4K A;  2F5V A;  2XF6 A;  3H5N A;  3HOT A;  1WJ5 A;  5LD2 C;  3CP2 A;  1PJR A;  2R4G A;  5CQE A;  4NNJ A;  4IKF A;  4FAS D;  4XNF A;  4XQF A;  1TT0 A;  2R7S A;  3VYU B;  2R7T A;  3OL3 A;  3IAM 2;  3DKY A;  2ZXI A;  3KEY A;  2KRH A;  5KCM A;  3A2K A;  4XN3 A;  3KX2 A;  3HL2 A;  4DGW B;  4LIV A;  1MMG A;  3S8P A;  4X0G A;  4E7I A;  4E6K G;  2XF5 A;  4XON A;  1SAU A;  1WJB A;  1YE9 A;  3OOU A;  2UUZ A;  2KRC A;  2X1E A;  2IS2 A;  3HUG B;  1E0E A;  4F3Q A;  3DTE A;  4E7S A;  2PJR A;  4H4K C;  4XKV A;  3AL0 C;  3RPU D;  4AVZ A;  2CV1 A;  3MD2 A;  3K4K A;  4P5O A;  3PUB A;  3VYS B;  4QPQ A;  2BVM A;  4C9Y A;  5KNL A;  4F55 A;  3QYF A;  2LBF B;  4BE1 A;  4XKC A;  3RQ4 A;  4IZZ A;  3OL4 A;  5HVQ C;  4LG3 A;  3S93 A;  4HPQ A;  1WJC A;  3S3M A;  3CP8 A;  2UWM A;  2Z16 A;  3K4N A;  2K9L A;  1MMN A;  3OMY A;  3MKZ A;  4BQN A;  2IGM A;  2IGO A;  3OY9 A;  1BR4 A;  4BJ5 C;  3V42 A;  1LKX A;  4B48 A;  3GBG A;  2JA2 A;  3S32 A;  4XL9 A;  1QU3 A;  1V5F A;  4E7L A;  2CUZ A;  2ZXH A;  3M8J A;  2DXI A;  4CUG A;  1HA8 A;  2DOA A;  3BLY A;  3IAS 2;  4CCN A;  1X1C A;  3OYM A;  1AA7 A;  2MYS A;  4LIT A;  1MMD A;  2OV7 A;  4B47 A;  4ANJ A;  2L9S A;  2LYC A;  1VZ0 A;  4HNT A;  2CFO A;  3LSG A;  4XLC A;  4F92 B;  3IP4 B;  2WY8 Q;  4YEL A;  3LSI A;  1V5G A;  3OYN A;  4BXF A;  4XKW A;  3EUH C;  2LC2 A;  3K6G A;  4JOM A;  3E1S A;  1N77 A;  4DBR A;  1ERD A;  3K10 A;  2VIX A;  4C2T A;  2V6E A;  2VJJ A;  1WJE A;  3SDB A;  2F6C A;  3OYH A;  2PJR B;  4XLA A;  2O5R A;  4KT6 A;  3CF2 A;  2VKD A;  4R79 A;  1X19 A;  5FRN A;  1MND A;  4PSX A;  1MNE A;  3L2W A;  1N78 A;  3H9G A;  4KIS A;  3VSL A;  1Y56 A;  3FKJ A;  1Z3Y A;  2CUJ A;  2R7X A;  3U21 A;  4RM2 A;  3AL0 B;  2VXZ A;  2W00 A;  2IXS A;  3M1C A;  4XM3 A;  1D0X A;  1X1D A;  3BCB A;  3HPG A;  3TMO A;  1EA3 A;  4DIQ A;  3PNY A;  3FBN B;  2AQE A;  4IQ4 A;  3OYB A;  2I8D A;  2LY1 A;  2HNH A;  4XOP A;  2LRE A;  4XOR A;  3OYL A;  4PJJ A;  4P1W A;  4KIT B;  2KQR A;  2M0M A;  2M3A A;  4IX7 A;  2VKH A;  2R7U A;  2L5Q A;  2VQH A;  3H0D A;  4E7Z A;  3BG7 A;  3ONQ A;  2M7B A;  1D1B A;  2R7R A;  4RM3 A;  5CPR B;  3ZQQ A;  2RQQ A;  4PUS A;  4ZTJ A;  3K4L A;  4PSW A;  3HC7 A;  3S3O A;  2LRD A;  3PSF A;  4N4O B;  3OIQ A;  2CV0 A;  3W3C A;  4RMN A;  4G6T B;  3TL4 X;  2VB6 A;  4KJZ A;  1X4P A;  1BR1 A;  2K3P A;  2JUG A;  1NG6 A;  4HNU A;  4BQQ A;  3EUA A;  2GOM A;  4DJA A;  1G8X A;  1PYV A;  1QHH D;  3LSH A;  2P0W A;  3DTK A;  1DGR M;  3K4M A;  4BEH A;  4U7B A;  3OYG A;  2HVR A;  1Z21 A;  3L2R A;  1BR2 A;  3OYI A;  4XMY A;  1WJD A;  3OYA A;  4RLQ A;  2L7K A;  2XC7 A;  2HZD A;  3PSI A;  3ZRG A;  2VAS A;  2ZSH B;  3DU6 A;  2RNG A;  2BW3 A;  4CCM A;  4D9J A;  1LVK A;  4CH7 A;  3H9Q A;  1X1B A;  4Y3O A;  2WB1 A;  4B44 A;  3A1Y A;  2E1M C;  2WAQ A;  3TBI A;  4HRI A;  1UEL B;  2KZV A;  2X6X A;  3BC8 A;  4HSR A;  2UV1 A;  3A4C A;  2KPM A;  5FRM A;  3LSM A;  3K4J A;  3QYE A;  3SYT A;  5CQG A;  1NG7 A;  2KHM A;  3H35 A;  4E7K A;  4CCL A;  4E7J A;  4ZDL A;  3LMM A;  4F91 B;  1MMA A;  4PFO A;  4XLE A;  5FRO A;  3W2V A;  3SEQ A;  3W2W A;  2CMP A;  3PJR A;  2BOL A;  4C2U A;  1YX3 A;  2BVL A;  2KL4 A;  4ZDP A;  3H5A A;  2F4I A;  3RCO A;  2W4S A;  2Z2S B;  2ZFU A;  1X1A A;  2R7W A;  3VYR B;  4CA0 A;  2MAB A;  3RSN A;  2ELJ A;  4HG2 A;  3CJR B;  3OYC A;  2V4J C;  4OWR B;  3BCA A;  2MD0 A;  2HQA A;  3FDY A;  1WFX A;  2WAF A;  2MC4 A;  3OYD A;  2DT6 A;  1Y6I A;  4BE2 A;  2JSP A;  3LFU A;  4NUB A;  4XR6 A;  3OYE A;  2CH0 A;  2JVH A;  4HEA 2;  4DBQ A;  3PFY A;  2MFZ A;  3D5R C;  1DGW Y;  2X6Y A;  2KMU A;  3OR2 C;  3OYF A;  4ZJZ A;  1OLT A;  3OS1 A;  1QHG A;  3EPZ A;  4XN0 A;  4BGD A;  4XOT A;  5HOO A;  1D0Y A;  3L2Q A;  1LFP A;  2V1N A;  3QOD A;  2LOO A;  2VQC A;  4BJ6 C;  1WJF A;  4C30 A;  4CCK A;  2VQL A;  3KYL A;  2XF7 A;  3W2A A;  4JQF A;  4B43 A;  1D0Z A;  3MKY B;  2GOX B;  5HNF A;  3NWT A;  3UR3 C;  1V5E A;  3ZXS A;  2VXD A;  2RRE A;  3FBI B;  2LBF A;  3NWS A;  3CZ6 A;  5TGT A;  4PJM A;  1BOB A;  2LY2 A;  2E5Z A;  2E1M B;  3LSK A;  3DPU A;  1N75 A;  3DKX A;  2IS6 A;  1TZL A;  2WA0 A;  2V9K A;  1W36 C;  1FMV A;  1LDK B;  3SZG A;  3OS0 A;  2IS4 A;  3OYJ A;  4Y4R A;  2ZSI B;  4ZYA A;  3DLA A;  3DEE A;  3DTI A;  4BDZ A;  4PFP A;  3AKZ A;  2IGN A;  4YRV A;  2XAU A;  3BG6 A;  4BS9 A;  1SFK A;  4GRI A;  2OC6 A;  3OWT A;  2HPM A;  2VPL A;  4QPO A;  2W82 A;  2R7V A;  1D1C A;  5HLT A;  3FHN A;  3SEZ A;  3D5L A;  4D1Q A;  3E0J B;  4DOZ A;  1GLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...