2ZSHB

Structural basis of gibberellin(ga3)-induced della recognition by the gibberellin receptor
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
66
structure length
59
Chain Sequence
GMDELLAVLGYKVRSSEMADVAQKLEQLEVMMSNVLATETVHYNPAELYTWLDSMLTDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Gibberellin-induced DELLA recognition by the gibberellin receptor GID1
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hormone receptor
molecule keywords Probable gibberellin receptor GID1L1
total genus 20
structure length 59
sequence length 66
ec nomenclature
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12041 DELLA Transcriptional regulator DELLA protein N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1290 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2zshB00
2ZSHB 2ZSIB
chains in the Genus database with same CATH superfamily
3K4JA 3ZQIA 1CF7A 1VF9A 3F72A 3TO6A 1S29A 1V3FA 3ERMA 2GBYA 5KCMA 1K7AA 3Q3SA 1IC8A 3H9JA 2KFDA 2XPUA 4D5CA 1U8RA 5EG0A 3I58A 4HX4A 3ZP5A 4RS8A 5DUKA 3FXMA 1ZR4A 3VDXA 5KNLA 3MMYB 1SFEA 2NAZA 3ELKA 3OL3A 3QU6A 4XKVA 4EJUA 3COAC 1LEBA 1KU2A 4HF1A 1WCMJ 1ZRCA 4LG3A 2A3SA 2VBYA 2XB0X 3FKJA 5TISC 2XGCA 2DMNA 2CQXA 2D2WA 2ME6A 2HYFA 4PUSA 4HYEA 2X1DA 3K0LA 4BUPA 4CZCA 4UY8I 2L4AA 4QWQA 3CMEI 1MZBA 2VJ5A 3AG4H 2M3AA 3HUGB 1MJBA 2VI6A 5IP7J 2R7FA 4X6AJ 1XN7A 5DDGA 3P5JA 3F8CA 3HPGA 3K4CA 1VQ7I 4A5NA 3KLOA 3S3MA 2AXTC 4C3IJ 4XICA 2LBFB 2JRMA 3WHBA 1PYVA 4YFNF 1S7OA 2F5DA 2CMPA 3HM5A 3OSFA 4DZPA 1A04A 3IRRA 2Y9YA 2HGCA 1W5SA 2L3DA 2PX9A 3U21A 3A0HC 5F08A 2WC2A 5E1XA 5FB2A 1TW3A 1HOMA 2IS4A 4BQNA 3BOQA 3QPHA 4GRIA 2E1OA 4PGHA 3RIRA 2E1MC 3FF5A 5JLWA 4XN3A 2MLKA 3JR9A 3ESWB 5D6EA 3WU2C 1SFXA 1VI0A 1T8IA 5DTDA 4A6DA 3ONQA 3LNQA 3KP6A 2DMQA 5LLQA 2VKHA 4O3MA 2M87A 5CVJA 2QQ9A 5K1YA 3QOEA 4NC6A 3CCJI 1RUOA 2L9SA 2H8RA 2LRDA 1P2FA 2JPBA 1R5ID 1XC5A 3M1EA 4KA4A 4OOIA 1B8IA 2K85A 1X19A 4KICA 3MEXA 2M0MA 1W7PD 3ABUA 1MJAA 1JKRC 2E5ZA 3J81Z 2QKMB 2JPCA 1X1BA 5M3MJ 4BQQA 1P4WA 1V5EA 4FX4A 4CYDA 1EH7A 4XQFA 4PJLA 4UB8C 1WKMA 4XLCA 1EH6A 1TW2A 1LVAA 2XKOA 4RM3A 1K6OA 1YO5C 5HLIA 2DA3A 1GVJA 5FKKA 2L9NA 2H94A 1YOVB 1X1PA 1WGXA 5CQGA 4N9IA 3HTSB 2ECBA 3VSLA 5BPIA 1D5YA 4WX9A 1IGNA 4F3QA 3BTIA 5E3LA 3DTIA 4KYWA 3OYAA 2FXAA 4ZZDA 2XGDA 1QNTA 1G3WA 3IC7A 2CW8A 3SJMA 1YJ9I 5HNHA 3E5UA 5E8IA 4RMNA 1MNEA 4G6QA 2DOEA 2B9SA 4BHPA 3HB9A 4FX0A 2CQKA 3JSPA 1XMXA 2JK3A 1MW7A 3A01A 2ID6A 1W5CC 2RKHA 2DDBA 2CJJA 2XPWA 1R1UA 3KP5A 2Z33A 2LLKA 5DYMA 2GXGA 1UJ8A 1ACIA 2BBYA 1D1CA 4BJ6C 2Y31A 4YELA 2UWMA 1RZ4A 2ZJRF 5C4XJ 4C2TA 1G59A 5KAIC 4DGWB 1HF0A 3DLAA 1BA5A 2WY7Q 2ZKZA 1QZYA 3TBIA 1YRNA 5DD4A 3ECOA 2ZFUA 1R36A 2OA4A 2FX0A 2DPDA 1MNMC 3G3ZA 3RPUD 3GTOJ 3BDDA 5LGTA 3A4CA 1P7IA 3D5LA 3M8EA 1X4PA 2DTZA 2DBBA 3QWLA 2PQ8A 1I1SA 3CLQA 1VQ8I 3A2KA 4RLQA 2M4KA 4LLLA 3ABLH 1NG6A 3CUQC 3RKWA 4E7KA 4DJAA 2VLAA 2OC6A 2VOOA 1JTXA 5FKNA 4AC0A 1QPIA 2OCCH 2K3FA 2LTPA 4LGWA 4BBRJ 3KEYA 2R7TA 2DW4A 4A93J 4JBAA 1VQNI 4MQVA 1QGPA 3K1PA 4RAZA 5JVTA 3MCZA 1I1GA 1UHWA 1X1DA 2FA5A 2L5QA 1X4OA 4LMYA 4Z6YA 3B73A 2P0WA 4LK1F 1Z6TA 3BC8A 1Z1DA 2ZSHB 3IHUA 5J8FA 1W5TA 1FOXA 2GXBA 3BR3A 3A03A 3VOEA 3HRSA 1QQIA 3HG9A 5FFZA 2KRCA 3HJEA 2EFOA 4MLOA 5IT9K 3KLNA 2XAHA 2R93J 1FYMA 4LB5A 3TEDA 3GFLA 3BQYA 3LSGA 3G73A 2DJIA 2WB1N 1WJ5A 2R7WA 3O8HA 2EIMH 1LUJB 3FMSA 2IXSA 2NNNA 4DBRA 1IRGA 4XOTA 3M07A 3K4KA 3BJOA 2CH0A 1YI2I 1D1BA 5D4RA 1B4AA 3NEUA 1IN7A 2I8DA 3TGNA 5D8LB 5DS9A 1B9NA 2DFIA 3S1NJ 2DT7B 4A3DJ 2TCTA 2JA6J 3BCBA 2E19A 4KJZA 3K6GA 2GIZA 1Z9CA 3MWMA 1J75A 1RR7A 1UG0A 4AM3A 1FPQA 2ELJA 5H2FC 1OYIA 4RB2C 2DMPA 3K69A 3RPUA 1P7JA 2EFNA 2HS5A 1A31A 4I2OA 4KMFA 3BT9A 1WJCA 2JA5J 3GX4X 5FRNA 5GPAA 2OCEA 3KP4A 2E7XA 1X3ZB 3N05A 4XLAA 3ZRGA 5HDKA 4PDKA 2WV1A 1BIBA 3O6BB 4OIRF 2OZ6A 3JRAA 1LFBA 2PG4A 1BI0A 4V2FA 4CCKA 3S17J 2OV7A 4G6DA 2LKSA 1BJAA 2EV6A 3KYDB 2KKOA 2DDAA 2KIQA 2DU9A 1BC7C 3RQIA 2R5YA 3ZMZA 1K78A 2VOPA 4FE7A 4P55A 3CCQI 4D1QA 4BE0A 4BDZA 4IO9F 2V4JC 1SD4A 5AONA 1VQOI 3GTPJ 1Z67A 5K7HA 2L9RA 5JR3A 1D8JA 4LIUA 2VC1A 3WTYC 1S9HA 3E6DA 4DYCA 2X48A 2CW0F 2J5OA 2MC4A 4D9JA 2E2HJ 4CZZA 4KN4X 4A3IJ 4KFCA 3V42A 2Z99A 5HS8A 3HPHA 2NNYA 3CCRI 5ILVA 2A5WA 5KVRA 5ICGA 5TRDA 1WSUA 2V6CA 4HAMA 2V9PA 3I55I 2C6YA 4AIHA 4KNYA 1SMYF 3M9AA 3HUGA 2LKXA 4GFBA 2UV1A 3S2DJ 2JSCA 3GTKJ 2UZKA 3J81K 2W1OA 1ZG1A 2OZUA 4R8HA 5GAGJ 3RPQA 2HXIA 1HQCA 5IP9J 4G7ZF 5B1BH 3F22A 1OYWA 3VYSB 3ASNH 3RDIA 1Z3XA 1ETWA 1FEXA 1T56A 3Q0UA 2PLYA 3D0SA 4QTRA 1HKTA 2WBMA 3I71A 4Y13A 4UUSB 4JX6A 1T98A 3BROA 3ZCOA 3RCOA 2CW7A 2E60A 2EK5A 3WE2A 3BTJA 2V9KA 1ZRFA 4KITB 3WTUC 2X6XA 5EF6A 3I56I 1IZ1A 4AVPA 2E2JJ 3P7NA 3MKZA 2MYSA 4I7HA 1WJEA 1ZGAA 2M9HA 3RQ4A 2Z5UA 3ZR8X 4ZC3A 2HQAA 3I0TA 1BI1A 2QQBA 3U1DA 5C3EJ 1O4XA 1Z0XA 3SZPA 1HXDA 4ZDPA 2EIJH 2JTVA 3HBLA 2BW3A 1HW2A 1TC3C 3SFIA 2HFHA 2LK2A 2LH9A 2WAEA 3G2BA 1ERDA 3MKLA 3ZMDA 2L7FP 3AG2H 4F91B 2EJRA 2O3FA 4C9YA 1FWZA 2MFZA 5EGOB 3U9GA 3G1MA 2NS0A 2OD5A 4RGXA 3BCAA 5DM7F 2R7XA 3QP5A 1SVMA 3GLLA 2XUBA 1FBUA 1W7PB 4J01A 5EZGA 3AAFA 3OYIA 2XASA 1A6IA 3SZGA 5E3MA 1N77A 1ENHA 4NNJA 4BNCA 3CC2I 3FXJA 4E70A 1IUYA 1HDPA 1O3TA 3LWFA 2QEXI 4A5MA 3AG1H 3FXOA 2YPRA 3PQJA 2R7QA 2P5KA 3GEZA 3F9KA 1IDYA 2M4GA 2WA0A 3ZXSA 4BYYA 1R1VA 2JUGA 4CO8A 5HODA 5EG0B 4JK1X 4A3FJ 3S3OA 2VJ4A 2A07F 2H27A 1GV5A 2DODA 1WRJA 1F43A 4L9JA 2PMHA 4FHTA 4HSTA 5LGUA 1ZLKA 5CVRA 4ON0A 4KIFA 1I6HJ 1QPMA 1XG1A 3D5RC 2VXDA 2AQEA 4LG0A 3HRUA 3HOUJ 2NS8A 3L09A 2WWYA 2CV0A 4I98B 4PCQA 3DEWA 3DEEA 5AIPA 2TRTA 3OYDA 3FK6A 4E4HA 1UMQA 5D6FA 5LEJA 2GZWA 5FLMJ 1J09A 4DW6A 5LGNA 2LVSA 2O0YA 5KAFC 2L02A 3ZN1A 1I27A 2NVUB 5DUIA 5M5YJ 1OMIA 3RYRA 1HLVA 2XAUA 2V9VA 2TDXA 1ITYA 1ZARA 3BTCA 4WXCA 1LQ1A 1W36C 4RLFA 1R5HA 1S7AA 4IXAA 4U88A 2XDVA 1IJWC 5H20A 4AIJA 1H0MA 4FCYA 5F6FA 4F93B 2F6CA 1T38A 3LAJA 2CG4A 4KN7X 1JKQC 4BJ5C 3K2AA 3U2RA 2CWEA 1RRJA 2VKVA 3L1PA 3GLXA 2K02A 2VE9A 2WAFA 4RGUA 4XRFA 4ZDLA 2BE5F 2EZIA 4YEJA 4BY7J 3WHCA 4BEHA 4N0BA 4M74A 2BY2A 1YYVA 3DP7A 1U5TA 4EJWA 3CESA 3LFKA 3DBLB 2FQ4A 4HG2A 4DYQA 3NARA 1F9NA 3JAMK 2XGEA 2GQQA 2R7RA 2IVMA 4IX7A 1MMDA 2NVQJ 1GV2A 1Q1HA 4BEHB 5JFRA 1IXCA 1JGSA 3TW7A 3K7AJ 3JRDA 3CJQB 2XRLA 2FF4A 4QSHA 2P6TA 4OIOF 3V8LA 2B0LA 2KJBA 3O2PE 1KYWA 2PJPA 3BG6A 3LA7A 1X3UA 1KU7A 2FBKA 4AWXB 3KP2A 2IT0A 3NAUA 3GTLJ 1YFHA 3T0YA 4W97A 4A0YA 2BZTA 4BL0B 5HOOA 3L9FA 3EUAA 3C18A 3I3LA 2BOLA 4OAYA 1MBHA 3K1NA 5ILUA 1F1ZA 3T8RA 1XCVA 3V8KA 3HC7A 3H0DA 3GFJA 3FXKA 5ERIA 4ZZLA 4KUMA 2ZB9A 2ECCA 4A6EA 4L18B 2Q2EA 2EV5A 4WCGA 4XRSG 2R7ZJ 2CU7A 5HLTA 1IXSB 4B3XA 2FJ1A 2M45A 4B48A 3WTZA 5FJ8J 2KIFA 4ENMA 4M73A 4XLHA 1JTYA 5DM6F 1OR7C 2M7BA 3EUHA 4IZZA 1PVEA 2EB7A 2Z16A 3FBNB 2B7EA 2M7AA 1FMWA 2Y30A 3F8NA 3AKZA 3MN2A 4LB6B 3GO5A 5E3NA 1ONVA 2QA4I 5D5XB 1YW7A 2PMZA 1EJ9A 4KIGA 4HA8A 2W84A 4HV5A 1GVDA 2GA1A 2M5WA 3SEZA 4EJTA 2LSOA 5LFAA 2KQRA 2WB1A 3AFHA 5H6RA 2Q8KA 3HEFA 4C3HJ 1B1BA 4ABZA 3JRBA 1YITI 3SZTA 5L3EA 3F6VA 2V1UA 1P4AA 2FOKA 2HTJA 1HKSA 4O5VA 5J8CA 2VJJA 2UXXA 1YE9A 5D8KB 3ZQCA 3EQLF 3ZQ7A 4NC8A 4NB5A 2R4GA 5J3LA 5GTIC 4HOBA 4B47A 5GPCA 2HNHA 3A0BC 1Y39A 1NK3P 4CCLA 3B6AA 5D5WB 1JJ6C 3NWTA 3BZ6A 1H8AC 3OYNA 2NRAC 3K4BA 2XAFA 1ZQ3P 4DYRA 1S72I 2BGCA 3QYBA 2UUZA 5FFXA 2HVSA 1T6SA 4ETSA 3RJPA 4S04A 4CGZA 4G9YA 1WI3A 2EH3A 2JZYA 4E7SA 1PJRA 3K4MA 1Z6RA 2CS3A 1N78A 2V1NA 4FETA 2BHYA 5LHGA 1A6QA 4Y4RA 2LG4A 3VFZA 1XX5A 2Y9ZA 3T5XA 4HZFA 1R71A 4JX4A 3GXOA 1TNSA 3PFIA 3ISPA 1AHDP 1RESA 1U6GA 1TBXA 1ZHFA 4NUBA 4UUVA 1QZEA 2B63J 1G3YA 4XORA 5ED4A 4OINF 4RB1A 3OSGA 1KA8A 2GLOA 3PNTA 1ULYA 1D0YA 3HSFA 1NG7A 3DWLE 3H3VK 4IRIA 2YX4A 3FBIB 4UVCA 5KHDA 2XVCA 4L9NA 2DO7A 3C2GA 4HX8A 1AA7A 4NDLA 2V1DA 2RVCA 2PBIA 4ZH4F 4E7JA 4IHVA 5FO5A 1D0ZA 3CMMA 1JXSA 1DP3A 4UUTA 2F4OB 3H9GA 1LVKA 2EPFA 2XPVA 3FMQA 5J6XA 4OMZA 4LJZF 5KK1A 1PUFA 2M0CA 3HOZJ 3PNVA 2N8GA 1RI7A 4ASNA 1IN6A 1T39A 2P7VB 1DQUA 1STZA 4B43A 2G9WA 5C4JJ 3HOVJ 5EEGA 4HEA2 5F27A 4L5IA 4QIWN 4BS9A 1BIAA 3KP3A 4V2GA 4WK8F 1E2XA 1JHFA 2QQAA 3S16J 1OCRH 1LDKB 1WJBA 4GCVA 3T8TA 2CQ7A 3TP3A 1ZG5A 2MG4A 4YFXF 3ZQQA 2A6HF 3BR0A 2OTLI 1O57A 4BBSJ 4IHTA 3A1YA 2EFQA 1EKEA 4BXXJ 1GLNA 4XIDA 3OR1C 2GOXB 3A02A 2QQ8A 1R6RA 2KZGA 4C30A 2DQRA 5BQTA 3OYFA 1SMTA 2KDZA 2XAJA 3OYGA 1PP8F 1MBKA 3QU3A 3EUKL 4ENNA 1FX7A 2K9MA 4E7HA 4A0ZA 1PUEE 3GYHX 3BG7A 2R7SA 3M8JA 1MDMB 1U8BA 3E0JB 2FMYA 1PUFB 1KU3A 3SQNA 5GP9A 1K78B 1MGTA 1T0FC 1IO2A 3OMYA 5DCMA 2D1HA 1CQTA 2R3SA 2EV0A 4YRVA 3DCFA 2EQRA 1H89C 2D45A 2L7MP 4EGYA 4EJOA 2VPLA 1GXPA 4G7OF 1ZLJA 2V1XA 4C3JJ 3S2WA 2CFXA 2K7LA 3FWEA 2Z1DA 5F64A 1ODDA 3RYPA 5ICEA 1S3JA 4BHCA 4HRIA 5HNFA 5M5WJ 2DA5A 2P81A 3FK7A 4B44A 1LDJA 5A2QK 3TKYA 2HU9A 2NOGA 2DMUA 2HWVA 2M2EA 4AYBA 1HW1A 1RIOH 2HZTA 4IPAA 3J80Z 5BMZA 4EQQA 3CO6C 3K70C 5D5UB 2L01A 1O7LA 2QLZA 3CDIA 4M6YA 5J40A 1U3EM 3Q9VA 1AWCA 4U7BA 1BJZA 2J5PA 1ORKA 4UV8A 3P9CA 1G6NA 3WU0A 1VQKI 3OYCA 4GYIA 2COMA 2EA2A 1FYKA 2HQRA 1BC8C 3BPVA 4HNTA 4K2EA 1FSEA 4CSWA 4ESBA 4RGSA 4FT8A 2FNAA 3V7SA 3DBRB 3VEPA 2GIVA 4IVNA 3E5QA 2AHQA 4Q48A 3KZZA 1JHHA 3G71I 1RNLA 1YRNB 1SVOA 2LF8A 4FTHA 5DCMB 2Z3YA 2O9LA 3H36A 4U0VA 2LMDA 2R92J 1S6LA 4ITVA 1XGSA 2DPUA 3LOCA 2ELHA 3PO2J 1D5VA 1IW7F 1J9IA 2F48A 1RKWA 1ETVA 3CCLI 4G8XA 1K4SA 1JE8A 1B6AA 1W4MA 4XK4A 2A5YB 1MSFC 1IDZA 3CF2A 2DXIA 1R49A 4FISA 2A6TA 2P7CB 3NRVA 1F5TA 1R5GA 2YX7A 3KE2A 3O8GA 1IUFA 2O8KA 3MFKA 3HOXJ 3ZPLA 4A3CJ 2JRTA 3BWGA 1Y0UA 1GDTA 1S5LC 3OR2C 4DBQA 2G7UA 1HC8A 3I64A 4HV6A 1NH3A 2IBDA 3PL8A 3LSJA 1ZREA 2E1CA 2ZFWA 1UELB 3I59A 3OYLA 3I5UA 5CKTA 4BKXA 2AO9A 3PSIA 2EILH 2A6EF 4JP0A 2XIGA 2LREA 4LITA 1ZELA 3O3KA 2HOAA 5LRRA 5CVIA 2L9VA 3E97A 3IH3A 4JX5A 1OKRA 3JCUC 1JI8A 2KLOA 4FE4A 5LBQA 1REPC 5DD8A 4Y7NJ 4I99C 1FP2A 3A01B 4ENKA 3D5SC 4UXNA 3TDZC 2R5YB 4XRMA 4UNOA 1TWHJ 4JQFA 3R6SA 2IS6A 2X9DA 4IJAA 4BGDA 4HSRA 3FKIJ 1SAXA 4DIQA 1N75A 4EM1A 2HVQA 1DGRM 2RV8A 2YSRA 3KETA 5J4YA 1QBJA 4OMYA 4BAYA 4RB3C 2HQNA 1IN8A 3TP0A 1BOAA 2RC4A 2LKPA 3KZIC 3GCMA 5M3FJ 2W57A 2QYOA 2ZJ2A 5HLGA 3PJRA 4BE2A 1OPCA 3CMYA 4A12A 4MTEA 4M3EA 4MGRA 1OCOH 4BJTA 1MBGA 1TQMA 5ICCA 3JTGA 3CP2A 3QQAA 4ZDOA 1G2HA 4C2MJ 3IAM2 3M8FA 2A69F 4KISA 2ADUA 4IQ4A 5BS6A 3L2WA 2HDDA 4M71A 4FQGA 3OV8A 2IGNA 2KP6A 3CJNA 2DAOA 2QSFX 3UR3C 2P8TA 2X85A 4CDGA 1SANA 4WXDA 2D1VA 1T33A 2HOTA 2RNJA 1HDDC 4AD9A 3ASOH 2FRHA 2K5CA 3FDYA 3LSKA 5E1WA 5IT9Z 3HHGA 3MZHA 3KX2A 3MKWB 2V79A 1DDNA 3CCYA 3C2HA 2QENA 2LBFA 2Z9OA 3RZDJ 3OIOA 3VYTB 3ZMSA 3W6KB 1R1TA 1IRXA 5FGMA 3SYTA 1QVTA 2W82A 5LD2C 3BR1A 4E7IA 1IV8A 1XS9A 1OR7A 2FQ3A 5HS9A 3TDUC 1M1EB 2I5UA 3FXLA 4NQWA 3WTXC 3Q9SA 2VUMJ 3OIPA 2JA8J 3BR6A 1SEUA 3LSTA 4ZTFA 3L2UA 2LY2A 2MD0A 1IN4A 2EZHA 1KONA 4LFUA 4CA0A 1RKTA 2EIKH 4DQ2A 5LHHA 2ACJA 2EZLA 3ZN0A 4XRSA 1U9NA 3E6BA 1I39A 3E5XA 2HR3A 4S0HB 1D1AA 2K9NA 2W7NA 2QBYA 2VQCA 4IKFA 3CD6I 3K4NA 1P9QC 1E17A 4GO1A 1TP4A 3HGGA 2M1BA 3GWZA 4ESJA 1RETA 1TWAJ 5F0FA 2Q0OA 1APLC 2IS2A 3ZMUA 3ZMTA 5LRSA 1IAWA 3G6EI 1FT9A 4HLYA 1MD0A 2XGXA 2O61A 1ZGJA 2OTJI 1YIJI 4Q4ZF 3HOTA 2P6SA 1HKQA 3WGGA 2P4WA 4E7ZA 2L4MA 4B3AA 1XSVA 1J2XA 1WHUA 2K4JA 3HKZA 1FIAA 1Z77A 2ME0A 2E2IJ 2KT0A 2FBHA 4HF0A 3QAHA 1OISA 3SEQA 2JJ7A 3PO3J 3PNYA 3I9V2 1JKOC 3OS0A 1MMSA 4BQAA 3S1MJ 2K9QA 2AXLA 2QCOA 4EVIA 1I3AA 5TGTA 4I0AA 2IAIA 2DFFA 1BBYA 1O3QA 1BW6A 3WTTC 3F8BA 3JRFA 5FLXK 2MW8A 3QP6A 2NOJB 3V4GA 2VC0A 4UVAA 2LOOA 2OPTA 2YU3A 4Y3OA 1BL0A 2IPQX 4AU7A 3OYBA 1SD6A 1POGA 1ZH5A 1VQLI 1JUSA 1UFMA 2O8XA 1O3RA 1BI3A 1G3TA 1YS7A 1R4NB 2ZNZA 4XM3A 5E8GA 2EWNA 2M8GX 1IRZA 3KFWX 1ETQA 5D4SA 3S93A 3DV8A 3WGIA 2LC2A 4ANJA 1P6RA 2ETHA 2O03A 2ISZA 1OFCX 3CMAI 2BXZA 2OU2A 2VQHA 1Q1VA 1QRYA 3KEOA 3DXJF 4IRHA 3BG9A 1TWGJ 2PMUA 3JRIA 2HEOA 1FBQA 3F0CA 3DTKA 1IG7A 1WFXA 2VL8A 4RB0A 4UHTA 4LLGF 4CICA 3HOYJ 2OQRA 3L2RA 4V19K 3CO7C 2G7HA 4XN0A 1C0WA 4PSWA 1H9TA 3K10A 3GMEA 1YIOA 4WWCA 5EDNA 2KZVA 2HI3A 1TQPA 2Y2ZA 5E18F 4J00A 5ILSA 3R4KA 1Z3YA 4ESFA 1VQMI 1ZK8A 2LY9A 4M6VA 1VQPI 3ZQGA 1LKXA 1MMGA 4EATA 3RKXA 3X2QH 2QSHX 3BY6A 5K7ZA 4HF2A 2IA0A 1O7FA 2HYGD 4OAZA 3VWBA 1QO0D 2Y0SA 3HOSA 3QRFF 3OYJA 2W24A 1E0EA 2DI3A 5JVGF 4I76A 1B72B 3C3WA 3WU1B 1AKHA 1D0XA 3DQVC 4TV7A 5J1YA 4CH7A 2Y0MA 1TT5B 4XSXF 2L7KA 2W85A 4I01A 3DF8A 4E6KG 3JRGA 3J7AY 2FMLA 3VPRA 1P92A 3IWFA 2M30A 1RUNA 2R5ZB 2GA2A 4A3EJ 4XMYA 3C7JA 3CCMI 1X1AA 4R1HA 2L0KA 2MC3A 4BY1J 4F55A 1U5TC 4EM2A 3OYHA 4AVZA 1MKMA 5FD6A 3CUQB 1XTAA 1FTZA 3LQQA 1W7PA 2BY0A 2UXNA 3FM5A 1YW9A 2OQGA 2X4HA 1KZHA 2JT1A 4N9HA 3HSRA 6PAXA 3PM1A 4F52A 5EGOA 3S32A 3H5NA 5E3OA 1A5JA 2DYRH 1YJWI 4M9SA 3SXYA 1VNDA 5IP6A 3KPHA 5EEHA 1UAAA 3ECHA 1DPRA 1WJAA 2XRNA 4II3A 4OIPF 3F23A 2H8WA 1ZKGA 4HQEA 2KPMA 3IP4B 5B1AH 1DUXC 3BJ6A 2COBA 1Z05A 1BI2A 4KIBA 3CF5F 2ZC2A 3FXQA 3M4OJ 1BW5A 1K83J 4CCNA 3ROUA 1W0UA 1JT0A 1FSHA 1FTTA 4S05A 2Q2EB 4A3KJ 2QF7A 3TO7A 1NK2P 1I5ZA 1MMNA 3LA2A 2DFEA 5DEQA 4Y52J 3H3UA 4M72A 1UHSA 4CCJA 5J4VA 5BPDA 1TQIA 4ZJZA 2CV2A 4HNUA 4AIDA 1YJNI 2FNPA 3CDHA 2EBIA 4RDUA 1VQ5I 2GWRA 4MEXF 4W1UA 3LSPA 3CCSI 2WV0A 3K70D 1W1WE 5CQEA 2STTA 3JAMZ 1R9TJ 2AS5F 4UV9A 2MSYA 1T08B 1ZN2A 2ZSIB 3QOPA 1FOWA 2F4IA 3ZQHA 5JHFA 2BEOA 1ZGWA 1OCCH 4RA2A 1Y6IA 3LMMA 4L0ZB 2RQPA 2Y0SN 1R4MB 1MBFA 4XOPA 1ZYRF 2X6YA 4XR6A 5A2QZ 1IF1A 5GTHC 3HIFA 3W2VA 1BOBA 2W00A 3VYRB 2JQ7A 1LB2A 1KQ0A 2BHZA 3BLYA 1FOKA 1BN5A 2CYYA 4KT5C 3SDGA 2ZJQF 1TT0A 1YQAA 1YTYA 2DK5A 3WODF 4DOZA 3W2AA 1PDNC 2KIUA 4IHSA 4XLEA 3CJTB 2CV1A 1TTYA 2E34A 2VASA 1OLTA 2LY1A 3JTHA 2ZO4A 2QZ8A 4I0BA 4U87A 2KISA 4Y33A 2DT6A 2CRGA 1RR8C 3CQZJ 5HLHA 4HNVA 4A69C 2ZCWA 3HZJA 3QPSA 1XSXA 2QVOA 3K9TA 1SAUA 3GTJJ 3H3ZA 3R0JA 2MA3A 1Z7UA 3UKGA 4L0YB 4D7NA 1KU9A 3AG3H 3RKQA 3IV5A 1FNNA 4II2A 3TQNA 2XHKA 4XNFA 2CGPA 3VB2A 3BQZA 3DU5A 1AOYA 2CUZA 1HW5A 4P9UA 4KMUX 5CJ9A 2WAQA 4M6XA 1LE8A 4M3GA 4HPQA 3M3YJ 2E5NA 3LQRA 2E1NA 1MSEC 3F8FA 4EEFG 3REOA 1NHAA 1GHCA 3IH2A 4AYBN 4OWRB 3MAJA 2VN2A 2VB6A 1FIPA 3HRTA 1O3SA 5J1UA 1J59A 1FMVA 3I53A 4PGGA 2ESHA 1ON2A 3MQ0A 2IEKA 3IH4A 1WZ2A 1GUUA 3GW2A 2XAQA 4XKBA 2BXYA 4IOAF 2AQFA 2JA7J 1XMAA 3OL4A 2VXZA 3BJAA 4ZYHA 4YG2F 4IQJA 1WPKA 1K61A 2JA2A 2XROA 1N25A 1D8KA 3F3XA 1T0FA 1H88C 1B8IB 2EFPA 2FE3A 5HDGA 2DTRA 4RAYA 1HSTA 1J5YA 3NWSA 5JHUA 1TZLA 4CXFA 4M3BA 2PEXA 1V4RA 4ZTJA 3BPXA 3V7RA 3CC4I 1FYLA 3KIOA 1HCRA 1YHQI 4L5EA 2CSOA 2HOEA 4H0EA 1SFKA 2JSPA 1JT6A 2O5RA 1VQ9I 1V5GA 3NQOA 5AIQA 2MGQA 2VBWA 5B5EC 2JVGA 5IOZA 1WQ2A 2A05A 1Z91A 2DA6A 2VQGA 3WG9A 2DFHA 3H92A 2X1CA 2BW3B 2NVYJ 3HL2A 3CCVI 2K9SA 2KL4A 1SC7A 2G0EA 3OYMA 3DPUA 2DA4A 1GXQA 1R23A 1XDSA 1XGOA 2CQQA 3DTEA 3L2QA 2R7VA 2Y69H 2XC7A 3PUFA 5B3SH 2GAUA 2ZNYA 3LAPA 2DQLA 3V8JA 3DLLF 1R00A 1JGGA 3OWTA 2LF7A 4EJVA 2VIXA 2CUEA 4BDYA 3U1KA 4HW0A 2XKPA 1FBSA 4AUXA 2QBYB 1WI9A 3G1OA 3GF2A 2EFWA 1TLHB 1MJ9A 3DPTA 3E3VA 1XPXA 2MH9A 1Y8RB 3OIQA 5L3FA 3MZYA 3H5RA 3K4LA 1J0RA 1MNDA 3DEUA 4XLPF 1B9MA 1USTA 2LR8A 5LHIA 4IEJA 1BR2A 2P5LC 4MIMA 1U78A 2PJRB 2MD5A 2ZMEC 4NQWB 3I54A 4LOCA 4H4KC 3N97A 1HBXG 2PJRA 1DGWY 2ZXJA 3W3CA 3DKWA 4UB6C 4CHUA 1YX5A 2NVTJ 2DOFA 4MNUA 4QLCU 5F1RA 5EZHA 3QODA 1VQ6I 4PJMA 2R0QC 2RAEA 4XLFA 4UUSA 3MD2A 4XSZF 2OBPA 3ZQFA 2V26A 4A3LJ 3KP7A 1TWCJ 1Y1VJ 3CJRB 1OCTC 4G94A 4N4NB 3R0AA 2HDWA 4D7MA 3HTUA 1Z21A 2OAZA 4ZYAA 4I09A 2DK8A 2XAGA 1PP7U 4MFEA 3M7GA 1FP1D 5EEAA 4LK0F 3GTQJ 4IF4A 4MEYF 3DFGA 2VBZA 1QZZA 2E71A 3H1CA 2QWWA 4BU2A 2KMUA 2HOSA 1B59A 1I50J 2EINH 2X51A 4QPOA 3L00A 4U7DA 1K4TA 2FEZA 3RKYA 2CFOA 2QGUA 1T2KA 3JRCA 1UB9A 4DZJA 4A3BJ 3WG7H 1WH5A 3BZCA 1SFOJ 1H9GA 2Q1ZB 3HXLA 1DU6A 1LPQA 2ID3A 3MVPA 2RN7A 1X2MA 3PQKA 3JSOA 3TOAA 5GADJ 1FLIA 3WE3A 3DBHB 3E6MA 2DT5A 3OS1A 3BR5A 5L3CA 4B09A 5HDNA 5K5OA 3EPZA 5FRMA 1OCZH 3LL7A 5F0CA 2MLGA 3K2ZA 2LYCA 3ML6A 2IP2A 3PSFA 2ZMEB 4HQMA 3WTVC 3J7ZI 2RREA 2FBIA 4XL9A 4EMSA 3AL0C 4P5OA 1ZG3A 2HPIA 1TWFJ 1ETOA 5M5XJ 2K86A 4IHYA 3PFYA 4PJNA 4F92B 2HPMA 2PFBA 4P1WA 5D5VB 3ABKH 4RAGA 2O6GE 2KHMA 5C44J 3IRQA 4LLNA 5JLXA 3GBGA 4Q47A 5J47A 2BY1A 4M3DA 1A35A 4U0YA 4HLXA 5IY5H 1MH3A 5EYRA 3JRHA 1WJFA 5IPAA 1HA8A 3T1BA 3W6JB 1UG2A 3KZYA 3ZQLA 3C2BA 1TNTA 3CTAA 2V7FA 3TOBA 2RNGA 1X2NA 4Q5SF 2IRFG 5HVQC 3HKZN 4PZJA 4R79A 3IUOA 2HQ5A 3J80K 1L3LA 4E7LA 3G1LA 5FD5A 4QPQA 2ZMEA 5BOXA 1ZAOA 4MO7A 3ZOBA 2IW5A 2KIMA 1Y56A 4Y15A 2F4MB 4BXUA 2FU4A 3L2VA 4U0WA 1BR1A 2X1EA 3IAS2 5K5RA 1GT0C 3BG3A 2XF6A 4GDFA 3GTMJ 2LDUA 3I59B 3QYFA 4HDVA 2JN6A 3QPTA 1G8XA 5DV5A 2NVXJ 1MBJA 5BNGA 3KYLA 4ZYGA 2YU9J 2X6WA 4PFOA 2EA4A 5CYVA 1OJLA 3HOWJ 1RC9A 2XSJC 1R58A 4GXOA 1CF7B 2Y48A 5CLSA 2H1KA 1XB4A 3QPLA 3S14J 3GTGJ 2MBFA 4UVBA 3LA3A 5TJJA 1DP7P 3GZNB 3CCEI 4G6TB 1SD5A 1W0TA 3IKVA 5J1RA 1XSDA 3CCUI 3OYEA 3WGHA 1OYYA 4PJJA 1EH8A 3JREA 2PMZN 1V55H 1QVUA 1LFPA 1YS6A 2VJIA 3W6VA 1T95A 3DPLC 4X0GA 5CVUA 1ETYA 4DNCA 2WAQN 2CUFA 5FKLA 1LJ9A 3IKTA 2NS7A 4L9VA 2K27A 3EYYA 2CQNA 1XDUA 2LNBA 2W4SA 4CYCA 3S1QJ 1Y8QB 2K4BA 5JI6A 1I6XA 2OJED 1D3YA 3HHHA 2VKEA 3HSEA 3E6CC 1USSA 4HX7A 1FZPB 1U2WA 4O6JA 3DU6A 2A61A 1YW8A 4Z2YA 3GUDA 1LDDA 3S8PA 5HS7A 4G12A 5IT3A 1WVRA 1X3WB 1EA3A 3VODA 3S1RJ 2X0LA 3R61A 2IGOA 5E1ZB 2D5VA 3AL0B 5B66C 2IA1A 2HZDA 3DKYA 4G7HF 2ZXIA 1W36D 3SDBA 4C2UA 2QM3A 3FMRA 1IXRC 3VSKA 2F5VA 5CVVA 3WTWC 5F04A 3SHFA 3TW6A 2VT2A 4HDUA 1SFUA 4A0XA 5DCFA 2LP0A 3HYIA 5F0HA 4BXFA 3L2CA 2R5ZA 3BR2A 2K3PA 3MZ8A 3P9KA 5E20A 4J19A 1G4DA 2MABA 3LSIA 2E35A 4KDPA 2CUJA 2DN0A 1IN5A 3IWZA 4B8XA 1X1CA 3H9QA 3P9IA 5IYBJ 1MDMA 5LEKA 2FSWA 2XF5A 4WXHA 2WADA 2W25A 2XV4S 1YG2A 2ZXHA 3UNGC 1BR4A 2JVHA 1ZTRA 1XGMA 4WF2A 2FUG2 2H09A 2L7ZA 1LE8B 4EGZA 4X1EA 2CO5A 5CPRB 1Z7LA 2HKXA 3KYCB 4ZYEA 2GXAA 2FD5A 3F6OA 1ZR2A 1FC3A 2I10A 4IHXA 2H6BA 4RAFA 3BZKA 2VPRA 1EV7A 1ON1A 3I4PA 4PJ0C 1G3SA 4B4CA 4PK4A 2XB5A 4BHBA 1AKHB 3R60A 2RGVA 1FOYA 1Y1WJ 2RDPA 3JW4A 4A3JJ 1KYZA 1UHMA 2DOAA 2IGKA 2H6CA 3E7LA 2K40A 5E79C 2R7UA 1KGSA 4IHWA 3LSHA 1LNWA 3OY9A 3M1CA 3H35A 2F5CA 5IOYA 1R7JA 2JWTA 4HBLA 2HXOA 4LG0B 1UZCA 4N4OB 3CDLA 1IV6A 3BTLA 4RGRA 3H5AA 1VTNC 1U9OA 4M3FA 4Y17A 2R7OA 4ZYDA 1WWXA 2WY8Q 4B1RA 3CUOA 4EM0B 3DKXA 2E36A 1DU0A 4PFPA 2LFBA 4MTDA 1LFUP 9ANTA 2EZKA 4A3MJ 1K79A 4I02A 1ETXA 1XCBA 4ENJA 3VYUB 1NTCA 3J7AO 2ISYA 3L7WA 1QHHD 5L3BA 4L5JA 4XLNF 2DA1A 1JUMA 1S7EA 2VODA 2XF7A 3SFZA 3EYIA 5K5QA 5GAHJ 1SD7A 5FKMA 5IYCJ 1X58A 4RM2A 5EJCA 3F21A 1I3QJ 3RZOJ 1E3HA 1R22A 2BVLA 5H6QA 1ETKA 2X6OA 5FROA 2STWA 4IL6C 1JUPA 3TMOA 3FHZA 1OQYA 5L3DA 2KDOA 3FHNA 1F36A 2GOMA 5FLXZ 1K6YA 1FY7A 3ABTA 2R7DA 3C1DA 4P96A 1S8NA 1LEAA 1XD7A 4CYCB 3S2HJ 1DPUA 4CCOA 3KEQA 2M8EA 4XBFA 3FX3A 3ABMH 3PIPF 3FM3A 2Y75A 1CGPA 1WJDA 2KRFA 3ULQB 2DYSH 1JKPC 4YIIA 3RTRA 2QSGX 3GFIA 1MIJA 2BYVE 2Z2SB 1TL8A 3ZGKA 3GZ5A 1SVLA 1KQ9A 4GGGA 1IRFA 2YR2A 2W48A 4YFKF 1HSJA 3Q0VA 3BP8A 2F5EA 3LSRA 1VQ4I 1Y0NA 2IJLA 4M9XA 3FIWA 2WTEA 4OIQF 1E3OC 3I4NJ 3E1SA 2BVMA 2F5FA 3F8MA 4MQ9F 3TO9A 2V6EA 2QKLB 3IL2A 2HKOA 4CUGA 4MFDA 3GFMA 3FISA 2HTSA 2L54A 1UCRA 2ICWG 3ZMVA 1BM9A 4YIRX 2FOWA 4LIVA 4GYGA 2IS1A 4P9FA 2KRHA 1QU3A 3TL4X 3HGYA 2DCEA 4KT6A 3RSNA 4BE1A 3LFUA 3CLOA 3ERED 2E1MB 2K9LA 1A36A 2MH2A 4XKCA 2RQQA 1MBEA 2VT3A 4IOCF 3GVAA 1U5TB 2HVRA 1YX3A 1B72A 2ZBKA 2JUCA 2DJNA 3Q5FA 1F4KA 3CC7I 4XKWA 4A2UA 3OS2A 2XSDC 2A68F 3MKYB 4JOMA 3CUQA 1MMAA 3FXRA 1E3PA 2H1LA 1P4XA 3CZ6A 2OF7A 3N4MA 2IA2A 1U0JA 1MH4A 5GAEJ 2HDCA 4IRGA 2VONA 5F1JA 2P5VA 1QHGA 3BG5A 3OOPA 2ZJPF 2PI0A 4M9ZA 4LD5A 4BQOA 2IGMA 2O7OA 2VBXA 2ZXWH 3J7YJ 5E17F 4MHGA 3OYKA 5FLVA 3HRMA 3H0GJ 3LSMA 4YIFA 2L2OA 5K7FA 2VKDA 2M34A 3D1NI 5IYDJ 2YUSA 1KQ8A 3EETA 4D0PA 3W2WA 2VQLA 2NYXA 3FZVA 3WTSC 3B02A 3K1MA 4BACA 3PUBA 2VE8A 2HYJA 2DLLA 2BV6A 3HDDA 4L9TA 1XGNA 3G4SI 1RPWA 1OCPA 2QUFA 1JJ8C 1VFCA 4F7ZA 1ZRDA 2F2EA 4JYKA 1V54H 1QA6A 1EF4A 1YLFA 3OOUA 4NC7A 2BY3A 4XONA 2ESNA 3Q0WA 5L3GA 4AIKA 3FXUA 2DA2A 3GZ6A 4A3GJ 3B6CA 1WH7A 5ICFA 4OU0A 2JMWA 3EUHC 1V5FA 4D5FA 2GM4A 3V7CA 2OUMA 2NXNB 1XMKA 1L0OC 3S15J 2DMTA 2LD5A 4CCMA 1FJLA 4BH9A 1J7KA 4PSXA 5FKOA 4I6ZA 2YS9A 4NHJA 3I4MJ 4FASD 4EV0A 3PIOF 2ELKA 3S3NA 2PN6A 3CP8A 3KCCA 1AU7A 3EDPA 2E7WA 3QYEA 4RBOA 2KJCA 3RI4A 2DA7A 1VZ0A 4NBQA
chains in the Genus database with same CATH topology
3K4JA 3EPZA 5FRMA 3LL7A 2LYCA 2WAFA 4ZDLA 4BEHA 2IS2A 4YEJA 3PSFA 5KCMA 3H9JA 2RREA 4XL9A 3AL0C 4P5OA 2HPIA 3CESA 3HOTA 4HG2A 3VDXA 5KNLA 4E7ZA 3MMYB 3PFYA 4PJNA 4F92B 2HPMA 2R7RA 3OL3A 4P1WA 4IX7A 4XKVA 1MMDA 3HKZA 4BEHB 2KHMA 3GBGA 4LG3A 3FKJA 3CJQB 4PUSA 3SEQA 3PNYA 2X1DA 3BG6A 3I9V2 3OS0A 4BUPA 4CZCA 1WJFA 1HA8A 2VJ5A 2M3AA 3HUGB 5TGTA 2V7FA 2RNGA 4BL0B 5HOOA 3EUAA 5HVQC 2NOJB 3I3LA 2BOLA 4OAYA 3HPGA 3K4CA 4R79A 2LOOA 3S3MA 3IUOA 4Y3OA 4E7LA 2LBFB 1PYVA 3HC7A 3H0DA 4QPQA 4AU7A 3OYBA 2CMPA 1Y56A 3U21A 4XM3A 5HLTA 3L2VA 4B3XA 1BR1A 2X1EA 3IAS2 2IS4A 4BQNA 2XF6A 4GRIA 4B48A 3S93A 3QYFA 2LC2A 4XLHA 1G8XA 1OR7C 2E1MC 4ANJA 2M7BA 2VQHA 4IZZA 3KYLA 2Z16A 3FBNB 4XN3A 2M7AA 2X6WA 1FMWA 4PFOA 3AKZA 2XSJC 3ONQA 3DTKA 2PMZA 1WFXA 2VL8A 2VKHA 3SEZA 5LFAA 2KQRA 2WB1A 3QOEA 2L9SA 3AFHA 3L2RA 2LRDA 4G6TB 4XN0A 3OYEA 4PSWA 3K10A 1X19A 4PJJA 2M0MA 2KZVA 2VJJA 2E5ZA 2QKMB 1YE9A 1LFPA 2VJIA 1X1BA 4NC8A 4J00A 2R4GA 4BQQA 1T95A 3DPLC 4X0GA 1Z3YA 1V5EA 4B47A 2HNHA 4XQFA 4PJLA 4XLCA 1LKXA 4CCLA 1MMGA 3NWTA 4EATA 4RM3A 3OYNA 2W4SA 2L9NA 3K4BA 3QYBA 2UUZA 4OAZA 3HOSA 2Y0SA 2HVSA 3VWBA 5CQGA 3OYJA 1E0EA 4E7SA 1PJRA 3K4MA 3VSLA 3DU6A 1D0XA 2CS3A 4F3QA 2V1NA 3DQVC 1N78A 4FETA 4CH7A 3S8PA 3DTIA 2L7KA 4E6KG 4Y4RA 3OYAA 2LG4A 3J7AY 1EA3A 2CW8A 5HNHA 2IGOA 3AL0B 4XMYA 4RMNA 1MNEA 2HZDA 4NUBA 3DKYA 1X1AA 4XORA 2ZXIA 4F55A 3SDBA 1W36D 4C2UA 3OYHA 4AVZA 3VSKA 2F5VA 1MW7A 3PNTA 1D0YA 1NG7A 3DWLE 4F52A 3S32A 1D1CA 3H5NA 3FBIB 4BJ6C 4BXFA 5KHDA 4YELA 2K3PA 2UWMA 1G59A 3C2GA 4DGWB 1AA7A 3DLAA 4E7JA 2WY7Q 1UAAA 3TBIA 1WJAA 2MABA 3LSIA 1D0ZA 3CMMA 4II3A 1DP3A 2ZFUA 2CUJA 3H9GA 1LVKA 2KPMA 3RPUD 1X1CA 3H9QA 3IP4B 3A4CA 3D5LA 1X4PA 3PNVA 2XF5A 2WADA 2ZXHA 3UNGC 3A2KA 1BR4A 2M4KA 4RLQA 2JVHA 4CCNA 1DQUA 1NG6A 4B43A 4E7KA 4DJAA 2VLAA 2OC6A 4HEA2 2Q2EB 2FUG2 4BS9A 1MMNA 3KEYA 5CPRB 2R7TA 1Z7LA 1LDKB 1WJBA 4CCJA 4C2TA 4ZJZA 2CV2A 1X1DA 2L5QA 4HNUA 1X4OA 3ZQQA 2P0WA 3BC8A 2ZSHB 3A1YA 1GLNA 3OR1C 2GOXB 4PK4A 3K70D 5CQEA 1R6RA 4C30A 3HG9A 2KRCA 3OYFA 4MLOA 2DOAA 2IGKA 2R7UA 2ZSIB 3OYGA 3LSHA 2F4IA 3EUKL 5JHFA 3OY9A 3M1CA 2K9MA 3H35A 4E7HA 1Y6IA 3LMMA 3LSGA 2DJIA 1WJ5A 2R7WA 3BG7A 4XOPA 2X6YA 4XR6A 4N4OB 3M8JA 2IXSA 2R7SA 4DBRA 3E0JB 4XOTA 3W2VA 3K4KA 2CH0A 1BOBA 2W00A 1D1BA 3H5AA 3VYRB 1T0FC 3BLYA 3OMYA 2R7OA 1TT0A 2I8DA 2WY8Q 4YRVA 2DT7B 3DKXA 4DOZA 3W2AA 2VPLA 3BCBA 4PFPA 4KJZA 4XLEA 2CV1A 3K6GA 2VASA 1OLTA 1UG0A 2LY1A 4U87A 2ELJA 2Z1DA 4Y33A 3VYUB 2DT6A 4HRIA 1QHHD 1WJCA 5HNFA 5FRNA 1SAUA 4B44A 2XF7A 3N05A 2HU9A 4XLAA 3ZRGA 4AYBA 4II2A 4RM2A 4XNFA 3DU5A 4CCKA 3K70C 2CUZA 2OV7A 2BVLA 2WAQA 5FROA 4HPQA 2E5NA 3TMOA 4U7BA 2KDOA 3FHNA 2GOMA 3OYCA 1K6YA 4OWRB 4D1QA 4BE0A 4BDZA 4HNTA 2V4JC 2VB6A 4CSWA 1FMVA 4CCOA 4LIUA 1WJDA 1S9HA 4XKBA 3RTRA 2AQFA 3OL4A 2Z2SB 3ZGKA 2MC4A 2VXZA 4D9JA 4IQJA 4ITVA 3V42A 2JA2A 3HPHA 2A5WA 3E1SA 2BVMA 3NWSA 1TZLA 2V6EA 2QKLB 2UV1A 3CF2A 2DXIA 4ZTJA 4CUGA 2A6TA 2W1OA 4LIVA 2IS1A 2KRHA 1QU3A 3TL4X 1SFKA 2JSPA 3OR2C 4DBQA 2DCEA 2O5RA 1V5GA 4KT6A 3RSNA 3VYSB 3PL8A 1Z3XA 4BE1A 3LFUA 2JVGA 2E1MB 2K9LA 2VQGA 1UELB 2WBMA 3OYLA 4XKCA 5CKTA 3PSIA 2X1CA 2BW3B 2RQQA 3HL2A 2LREA 2KL4A 4LITA 3ZCOA 1ZELA 3OYMA 3DPUA 3RCOA 2CW7A 2E60A 1YX3A 2HVRA 2R7VA 3DTEA 2V9KA 3L2QA 2XC7A 4KITB 2X6XA 1JI8A 2KLOA 4XKWA 3OS2A 3MKZA 2MYSA 3OWTA 3D5SC 1WJEA 2VIXA 3MKYB 4JOMA 3RQ4A 3ZR8X 4ZC3A 4BDYA 2HQAA 4JQFA 2IS6A 1MMAA 3CZ6A 4BGDA 4ZDPA 4HSRA 4DIQA 3DPTA 1U0JA 2BW3A 1N75A 2HVQA 1DGRM 3OIQA 2LH9A 2WAEA 3G2BA 1ERDA 1QHGA 4F91B 3H5RA 3K4LA 1MNDA 4C9YA 2MFZA 4BQOA 2IGMA 3BCAA 1BR2A 2R7XA 2PJRB 3OYKA 4NQWB 4J01A 3PJRA 3LSMA 3OYIA 2L2OA 4BE2A 4H4KC 3SZGA 2VKDA 2PJRA 1DGWY 3W3CA 4BJTA 1N77A 4NNJA 1YX5A 3CP2A 3W2WA 4ZDOA 2VQLA 3IAM2 3QODA 4KISA 4PJMA 4IQ4A 4BACA 3L2WA 2R7QA 3PUBA 3F9KA 2M4GA 2WA0A 3ZXSA 2JUGA 3S3OA 2IGNA 2KP6A 4XLFA 2VJ4A 3UR3C 3MD2A 2X85A 2V26A 3CJRB 4HSTA 4N4NB 2HDWA 2K5CA 3FDYA 1Z21A 3LSKA 4ZYAA 3D5RC 2VXDA 3KX2A 2AQEA 3MKWB 3C2HA 2LBFA 2CV0A 4NC7A 3OOUA 4XONA 3DEEA 3VYTB 3OYDA 4E4HA 1IRXA 3SYTA 4BU2A 1J09A 2KMUA 2W82A 5LD2C 3EUHC 4E7IA 1V5FA 2OUMA 2X51A 4QPOA 2CFOA 2XAUA 4CCMA 4PSXA 3OIPA 2Q1ZB 3HXLA 4FASD 3L2UA 4ZTFA 2LY2A 2MD0A 4RLFA 1W36C 1KONA 3S3NA 2XDVA 3CP8A 4CA0A 3QYEA 4F93B 2F6CA 4BJ5C 3OS1A 2W7NA 1D1AA 4IKFA 2VQCA 3K4NA 1VZ0A 1P9QC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZSH B;  2ZSI B; 
#chains in the Genus database with same CATH topology
 3K4J A;  3ZQI A;  1CF7 A;  1VF9 A;  3F72 A;  3TO6 A;  1S29 A;  1V3F A;  3ERM A;  2GBY A;  5KCM A;  1K7A A;  3Q3S A;  1IC8 A;  3H9J A;  2KFD A;  2XPU A;  4D5C A;  1U8R A;  5EG0 A;  3I58 A;  4HX4 A;  3ZP5 A;  4RS8 A;  5DUK A;  3FXM A;  1ZR4 A;  3VDX A;  5KNL A;  3MMY B;  1SFE A;  2NAZ A;  3ELK A;  3OL3 A;  3QU6 A;  4XKV A;  4EJU A;  3COA C;  1LEB A;  1KU2 A;  4HF1 A;  1WCM J;  1ZRC A;  4LG3 A;  2A3S A;  2VBY A;  2XB0 X;  3FKJ A;  5TIS C;  2XGC A;  2DMN A;  2CQX A;  2D2W A;  2ME6 A;  2HYF A;  4PUS A;  4HYE A;  2X1D A;  3K0L A;  4BUP A;  4CZC A;  4UY8 I;  2L4A A;  4QWQ A;  3CME I;  1MZB A;  2VJ5 A;  3AG4 H;  2M3A A;  3HUG B;  1MJB A;  2VI6 A;  5IP7 J;  2R7F A;  4X6A J;  1XN7 A;  5DDG A;  3P5J A;  3F8C A;  3HPG A;  3K4C A;  1VQ7 I;  4A5N A;  3KLO A;  3S3M A;  2AXT C;  4C3I J;  4XIC A;  2LBF B;  2JRM A;  3WHB A;  1PYV A;  4YFN F;  1S7O A;  2F5D A;  2CMP A;  3HM5 A;  3OSF A;  4DZP A;  1A04 A;  3IRR A;  2Y9Y A;  2HGC A;  1W5S A;  2L3D A;  2PX9 A;  3U21 A;  3A0H C;  5F08 A;  2WC2 A;  5E1X A;  5FB2 A;  1TW3 A;  1HOM A;  2IS4 A;  4BQN A;  3BOQ A;  3QPH A;  4GRI A;  2E1O A;  4PGH A;  3RIR A;  2E1M C;  3FF5 A;  5JLW A;  4XN3 A;  2MLK A;  3JR9 A;  3ESW B;  5D6E A;  3WU2 C;  1SFX A;  1VI0 A;  1T8I A;  5DTD A;  4A6D A;  3ONQ A;  3LNQ A;  3KP6 A;  2DMQ A;  5LLQ A;  2VKH A;  4O3M A;  2M87 A;  5CVJ A;  2QQ9 A;  5K1Y A;  3QOE A;  4NC6 A;  3CCJ I;  1RUO A;  2L9S A;  2H8R A;  2LRD A;  1P2F A;  2JPB A;  1R5I D;  1XC5 A;  3M1E A;  4KA4 A;  4OOI A;  1B8I A;  2K85 A;  1X19 A;  4KIC A;  3MEX A;  2M0M A;  1W7P D;  3ABU A;  1MJA A;  1JKR C;  2E5Z A;  3J81 Z;  2QKM B;  2JPC A;  1X1B A;  5M3M J;  4BQQ A;  1P4W A;  1V5E A;  4FX4 A;  4CYD A;  1EH7 A;  4XQF A;  4PJL A;  4UB8 C;  1WKM A;  4XLC A;  1EH6 A;  1TW2 A;  1LVA A;  2XKO A;  4RM3 A;  1K6O A;  1YO5 C;  5HLI A;  2DA3 A;  1GVJ A;  5FKK A;  2L9N A;  2H94 A;  1YOV B;  1X1P A;  1WGX A;  5CQG A;  4N9I A;  3HTS B;  2ECB A;  3VSL A;  5BPI A;  1D5Y A;  4WX9 A;  1IGN A;  4F3Q A;  3BTI A;  5E3L A;  3DTI A;  4KYW A;  3OYA A;  2FXA A;  4ZZD A;  2XGD A;  1QNT A;  1G3W A;  3IC7 A;  2CW8 A;  3SJM A;  1YJ9 I;  5HNH A;  3E5U A;  5E8I A;  4RMN A;  1MNE A;  4G6Q A;  2DOE A;  2B9S A;  4BHP A;  3HB9 A;  4FX0 A;  2CQK A;  3JSP A;  1XMX A;  2JK3 A;  1MW7 A;  3A01 A;  2ID6 A;  1W5C C;  2RKH A;  2DDB A;  2CJJ A;  2XPW A;  1R1U A;  3KP5 A;  2Z33 A;  2LLK A;  5DYM A;  2GXG A;  1UJ8 A;  1ACI A;  2BBY A;  1D1C A;  4BJ6 C;  2Y31 A;  4YEL A;  2UWM A;  1RZ4 A;  2ZJR F;  5C4X J;  4C2T A;  1G59 A;  5KAI C;  4DGW B;  1HF0 A;  3DLA A;  1BA5 A;  2WY7 Q;  2ZKZ A;  1QZY A;  3TBI A;  1YRN A;  5DD4 A;  3ECO A;  2ZFU A;  1R36 A;  2OA4 A;  2FX0 A;  2DPD A;  1MNM C;  3G3Z A;  3RPU D;  3GTO J;  3BDD A;  5LGT A;  3A4C A;  1P7I A;  3D5L A;  3M8E A;  1X4P A;  2DTZ A;  2DBB A;  3QWL A;  2PQ8 A;  1I1S A;  3CLQ A;  1VQ8 I;  3A2K A;  4RLQ A;  2M4K A;  4LLL A;  3ABL H;  1NG6 A;  3CUQ C;  3RKW A;  4E7K A;  4DJA A;  2VLA A;  2OC6 A;  2VOO A;  1JTX A;  5FKN A;  4AC0 A;  1QPI A;  2OCC H;  2K3F A;  2LTP A;  4LGW A;  4BBR J;  3KEY A;  2R7T A;  2DW4 A;  4A93 J;  4JBA A;  1VQN I;  4MQV A;  1QGP A;  3K1P A;  4RAZ A;  5JVT A;  3MCZ A;  1I1G A;  1UHW A;  1X1D A;  2FA5 A;  2L5Q A;  1X4O A;  4LMY A;  4Z6Y A;  3B73 A;  2P0W A;  4LK1 F;  1Z6T A;  3BC8 A;  1Z1D A;  2ZSH B;  3IHU A;  5J8F A;  1W5T A;  1FOX A;  2GXB A;  3BR3 A;  3A03 A;  3VOE A;  3HRS A;  1QQI A;  3HG9 A;  5FFZ A;  2KRC A;  3HJE A;  2EFO A;  4MLO A;  5IT9 K;  3KLN A;  2XAH A;  2R93 J;  1FYM A;  4LB5 A;  3TED A;  3GFL A;  3BQY A;  3LSG A;  3G73 A;  2DJI A;  2WB1 N;  1WJ5 A;  2R7W A;  3O8H A;  2EIM H;  1LUJ B;  3FMS A;  2IXS A;  2NNN A;  4DBR A;  1IRG A;  4XOT A;  3M07 A;  3K4K A;  3BJO A;  2CH0 A;  1YI2 I;  1D1B A;  5D4R A;  1B4A A;  3NEU A;  1IN7 A;  2I8D A;  3TGN A;  5D8L B;  5DS9 A;  1B9N A;  2DFI A;  3S1N J;  2DT7 B;  4A3D J;  2TCT A;  2JA6 J;  3BCB A;  2E19 A;  4KJZ A;  3K6G A;  2GIZ A;  1Z9C A;  3MWM A;  1J75 A;  1RR7 A;  1UG0 A;  4AM3 A;  1FPQ A;  2ELJ A;  5H2F C;  1OYI A;  4RB2 C;  2DMP A;  3K69 A;  3RPU A;  1P7J A;  2EFN A;  2HS5 A;  1A31 A;  4I2O A;  4KMF A;  3BT9 A;  1WJC A;  2JA5 J;  3GX4 X;  5FRN A;  5GPA A;  2OCE A;  3KP4 A;  2E7X A;  1X3Z B;  3N05 A;  4XLA A;  3ZRG A;  5HDK A;  4PDK A;  2WV1 A;  1BIB A;  3O6B B;  4OIR F;  2OZ6 A;  3JRA A;  1LFB A;  2PG4 A;  1BI0 A;  4V2F A;  4CCK A;  3S17 J;  2OV7 A;  4G6D A;  2LKS A;  1BJA A;  2EV6 A;  3KYD B;  2KKO A;  2DDA A;  2KIQ A;  2DU9 A;  1BC7 C;  3RQI A;  2R5Y A;  3ZMZ A;  1K78 A;  2VOP A;  4FE7 A;  4P55 A;  3CCQ I;  4D1Q A;  4BE0 A;  4BDZ A;  4IO9 F;  2V4J C;  1SD4 A;  5AON A;  1VQO I;  3GTP J;  1Z67 A;  5K7H A;  2L9R A;  5JR3 A;  1D8J A;  4LIU A;  2VC1 A;  3WTY C;  1S9H A;  3E6D A;  4DYC A;  2X48 A;  2CW0 F;  2J5O A;  2MC4 A;  4D9J A;  2E2H J;  4CZZ A;  4KN4 X;  4A3I J;  4KFC A;  3V42 A;  2Z99 A;  5HS8 A;  3HPH A;  2NNY A;  3CCR I;  5ILV A;  2A5W A;  5KVR A;  5ICG A;  5TRD A;  1WSU A;  2V6C A;  4HAM A;  2V9P A;  3I55 I;  2C6Y A;  4AIH A;  4KNY A;  1SMY F;  3M9A A;  3HUG A;  2LKX A;  4GFB A;  2UV1 A;  3S2D J;  2JSC A;  3GTK J;  2UZK A;  3J81 K;  2W1O A;  1ZG1 A;  2OZU A;  4R8H A;  5GAG J;  3RPQ A;  2HXI A;  1HQC A;  5IP9 J;  4G7Z F;  5B1B H;  3F22 A;  1OYW A;  3VYS B;  3ASN H;  3RDI A;  1Z3X A;  1ETW A;  1FEX A;  1T56 A;  3Q0U A;  2PLY A;  3D0S A;  4QTR A;  1HKT A;  2WBM A;  3I71 A;  4Y13 A;  4UUS B;  4JX6 A;  1T98 A;  3BRO A;  3ZCO A;  3RCO A;  2CW7 A;  2E60 A;  2EK5 A;  3WE2 A;  3BTJ A;  2V9K A;  1ZRF A;  4KIT B;  3WTU C;  2X6X A;  5EF6 A;  3I56 I;  1IZ1 A;  4AVP A;  2E2J J;  3P7N A;  3MKZ A;  2MYS A;  4I7H A;  1WJE A;  1ZGA A;  2M9H A;  3RQ4 A;  2Z5U A;  3ZR8 X;  4ZC3 A;  2HQA A;  3I0T A;  1BI1 A;  2QQB A;  3U1D A;  5C3E J;  1O4X A;  1Z0X A;  3SZP A;  1HXD A;  4ZDP A;  2EIJ H;  2JTV A;  3HBL A;  2BW3 A;  1HW2 A;  1TC3 C;  3SFI A;  2HFH A;  2LK2 A;  2LH9 A;  2WAE A;  3G2B A;  1ERD A;  3MKL A;  3ZMD A;  2L7F P;  3AG2 H;  4F91 B;  2EJR A;  2O3F A;  4C9Y A;  1FWZ A;  2MFZ A;  5EGO B;  3U9G A;  3G1M A;  2NS0 A;  2OD5 A;  4RGX A;  3BCA A;  5DM7 F;  2R7X A;  3QP5 A;  1SVM A;  3GLL A;  2XUB A;  1FBU A;  1W7P B;  4J01 A;  5EZG A;  3AAF A;  3OYI A;  2XAS A;  1A6I A;  3SZG A;  5E3M A;  1N77 A;  1ENH A;  4NNJ A;  4BNC A;  3CC2 I;  3FXJ A;  4E70 A;  1IUY A;  1HDP A;  1O3T A;  3LWF A;  2QEX I;  4A5M A;  3AG1 H;  3FXO A;  2YPR A;  3PQJ A;  2R7Q A;  2P5K A;  3GEZ A;  3F9K A;  1IDY A;  2M4G A;  2WA0 A;  3ZXS A;  4BYY A;  1R1V A;  2JUG A;  4CO8 A;  5HOD A;  5EG0 B;  4JK1 X;  4A3F J;  3S3O A;  2VJ4 A;  2A07 F;  2H27 A;  1GV5 A;  2DOD A;  1WRJ A;  1F43 A;  4L9J A;  2PMH A;  4FHT A;  4HST A;  5LGU A;  1ZLK A;  5CVR A;  4ON0 A;  4KIF A;  1I6H J;  1QPM A;  1XG1 A;  3D5R C;  2VXD A;  2AQE A;  4LG0 A;  3HRU A;  3HOU J;  2NS8 A;  3L09 A;  2WWY A;  2CV0 A;  4I98 B;  4PCQ A;  3DEW A;  3DEE A;  5AIP A;  2TRT A;  3OYD A;  3FK6 A;  4E4H A;  1UMQ A;  5D6F A;  5LEJ A;  2GZW A;  5FLM J;  1J09 A;  4DW6 A;  5LGN A;  2LVS A;  2O0Y A;  5KAF C;  2L02 A;  3ZN1 A;  1I27 A;  2NVU B;  5DUI A;  5M5Y J;  1OMI A;  3RYR A;  1HLV A;  2XAU A;  2V9V A;  2TDX A;  1ITY A;  1ZAR A;  3BTC A;  4WXC A;  1LQ1 A;  1W36 C;  4RLF A;  1R5H A;  1S7A A;  4IXA A;  4U88 A;  2XDV A;  1IJW C;  5H20 A;  4AIJ A;  1H0M A;  4FCY A;  5F6F A;  4F93 B;  2F6C A;  1T38 A;  3LAJ A;  2CG4 A;  4KN7 X;  1JKQ C;  4BJ5 C;  3K2A A;  3U2R A;  2CWE A;  1RRJ A;  2VKV A;  3L1P A;  3GLX A;  2K02 A;  2VE9 A;  2WAF A;  4RGU A;  4XRF A;  4ZDL A;  2BE5 F;  2EZI A;  4YEJ A;  4BY7 J;  3WHC A;  4BEH A;  4N0B A;  4M74 A;  2BY2 A;  1YYV A;  3DP7 A;  1U5T A;  4EJW A;  3CES A;  3LFK A;  3DBL B;  2FQ4 A;  4HG2 A;  4DYQ A;  3NAR A;  1F9N A;  3JAM K;  2XGE A;  2GQQ A;  2R7R A;  2IVM A;  4IX7 A;  1MMD A;  2NVQ J;  1GV2 A;  1Q1H A;  4BEH B;  5JFR A;  1IXC A;  1JGS A;  3TW7 A;  3K7A J;  3JRD A;  3CJQ B;  2XRL A;  2FF4 A;  4QSH A;  2P6T A;  4OIO F;  3V8L A;  2B0L A;  2KJB A;  3O2P E;  1KYW A;  2PJP A;  3BG6 A;  3LA7 A;  1X3U A;  1KU7 A;  2FBK A;  4AWX B;  3KP2 A;  2IT0 A;  3NAU A;  3GTL J;  1YFH A;  3T0Y A;  4W97 A;  4A0Y A;  2BZT A;  4BL0 B;  5HOO A;  3L9F A;  3EUA A;  3C18 A;  3I3L A;  2BOL A;  4OAY A;  1MBH A;  3K1N A;  5ILU A;  1F1Z A;  3T8R A;  1XCV A;  3V8K A;  3HC7 A;  3H0D A;  3GFJ A;  3FXK A;  5ERI A;  4ZZL A;  4KUM A;  2ZB9 A;  2ECC A;  4A6E A;  4L18 B;  2Q2E A;  2EV5 A;  4WCG A;  4XRS G;  2R7Z J;  2CU7 A;  5HLT A;  1IXS B;  4B3X A;  2FJ1 A;  2M45 A;  4B48 A;  3WTZ A;  5FJ8 J;  2KIF A;  4ENM A;  4M73 A;  4XLH A;  1JTY A;  5DM6 F;  1OR7 C;  2M7B A;  3EUH A;  4IZZ A;  1PVE A;  2EB7 A;  2Z16 A;  3FBN B;  2B7E A;  2M7A A;  1FMW A;  2Y30 A;  3F8N A;  3AKZ A;  3MN2 A;  4LB6 B;  3GO5 A;  5E3N A;  1ONV A;  2QA4 I;  5D5X B;  1YW7 A;  2PMZ A;  1EJ9 A;  4KIG A;  4HA8 A;  2W84 A;  4HV5 A;  1GVD A;  2GA1 A;  2M5W A;  3SEZ A;  4EJT A;  2LSO A;  5LFA A;  2KQR A;  2WB1 A;  3AFH A;  5H6R A;  2Q8K A;  3HEF A;  4C3H J;  1B1B A;  4ABZ A;  3JRB A;  1YIT I;  3SZT A;  5L3E A;  3F6V A;  2V1U A;  1P4A A;  2FOK A;  2HTJ A;  1HKS A;  4O5V A;  5J8C A;  2VJJ A;  2UXX A;  1YE9 A;  5D8K B;  3ZQC A;  3EQL F;  3ZQ7 A;  4NC8 A;  4NB5 A;  2R4G A;  5J3L A;  5GTI C;  4HOB A;  4B47 A;  5GPC A;  2HNH A;  3A0B C;  1Y39 A;  1NK3 P;  4CCL A;  3B6A A;  5D5W B;  1JJ6 C;  3NWT A;  3BZ6 A;  1H8A C;  3OYN A;  2NRA C;  3K4B A;  2XAF A;  1ZQ3 P;  4DYR A;  1S72 I;  2BGC A;  3QYB A;  2UUZ A;  5FFX A;  2HVS A;  1T6S A;  4ETS A;  3RJP A;  4S04 A;  4CGZ A;  4G9Y A;  1WI3 A;  2EH3 A;  2JZY A;  4E7S A;  1PJR A;  3K4M A;  1Z6R A;  2CS3 A;  1N78 A;  2V1N A;  4FET A;  2BHY A;  5LHG A;  1A6Q A;  4Y4R A;  2LG4 A;  3VFZ A;  1XX5 A;  2Y9Z A;  3T5X A;  4HZF A;  1R71 A;  4JX4 A;  3GXO A;  1TNS A;  3PFI A;  3ISP A;  1AHD P;  1RES A;  1U6G A;  1TBX A;  1ZHF A;  4NUB A;  4UUV A;  1QZE A;  2B63 J;  1G3Y A;  4XOR A;  5ED4 A;  4OIN F;  4RB1 A;  3OSG A;  1KA8 A;  2GLO A;  3PNT A;  1ULY A;  1D0Y A;  3HSF A;  1NG7 A;  3DWL E;  3H3V K;  4IRI A;  2YX4 A;  3FBI B;  4UVC A;  5KHD A;  2XVC A;  4L9N A;  2DO7 A;  3C2G A;  4HX8 A;  1AA7 A;  4NDL A;  2V1D A;  2RVC A;  2PBI A;  4ZH4 F;  4E7J A;  4IHV A;  5FO5 A;  1D0Z A;  3CMM A;  1JXS A;  1DP3 A;  4UUT A;  2F4O B;  3H9G A;  1LVK A;  2EPF A;  2XPV A;  3FMQ A;  5J6X A;  4OMZ A;  4LJZ F;  5KK1 A;  1PUF A;  2M0C A;  3HOZ J;  3PNV A;  2N8G A;  1RI7 A;  4ASN A;  1IN6 A;  1T39 A;  2P7V B;  1DQU A;  1STZ A;  4B43 A;  2G9W A;  5C4J J;  3HOV J;  5EEG A;  4HEA 2;  5F27 A;  4L5I A;  4QIW N;  4BS9 A;  1BIA A;  3KP3 A;  4V2G A;  4WK8 F;  1E2X A;  1JHF A;  2QQA A;  3S16 J;  1OCR H;  1LDK B;  1WJB A;  4GCV A;  3T8T A;  2CQ7 A;  3TP3 A;  1ZG5 A;  2MG4 A;  4YFX F;  3ZQQ A;  2A6H F;  3BR0 A;  2OTL I;  1O57 A;  4BBS J;  4IHT A;  3A1Y A;  2EFQ A;  1EKE A;  4BXX J;  1GLN A;  4XID A;  3OR1 C;  2GOX B;  3A02 A;  2QQ8 A;  1R6R A;  2KZG A;  4C30 A;  2DQR A;  5BQT A;  3OYF A;  1SMT A;  2KDZ A;  2XAJ A;  3OYG A;  1PP8 F;  1MBK A;  3QU3 A;  3EUK L;  4ENN A;  1FX7 A;  2K9M A;  4E7H A;  4A0Z A;  1PUE E;  3GYH X;  3BG7 A;  2R7S A;  3M8J A;  1MDM B;  1U8B A;  3E0J B;  2FMY A;  1PUF B;  1KU3 A;  3SQN A;  5GP9 A;  1K78 B;  1MGT A;  1T0F C;  1IO2 A;  3OMY A;  5DCM A;  2D1H A;  1CQT A;  2R3S A;  2EV0 A;  4YRV A;  3DCF A;  2EQR A;  1H89 C;  2D45 A;  2L7M P;  4EGY A;  4EJO A;  2VPL A;  1GXP A;  4G7O F;  1ZLJ A;  2V1X A;  4C3J J;  3S2W A;  2CFX A;  2K7L A;  3FWE A;  2Z1D A;  5F64 A;  1ODD A;  3RYP A;  5ICE A;  1S3J A;  4BHC A;  4HRI A;  5HNF A;  5M5W J;  2DA5 A;  2P81 A;  3FK7 A;  4B44 A;  1LDJ A;  5A2Q K;  3TKY A;  2HU9 A;  2NOG A;  2DMU A;  2HWV A;  2M2E A;  4AYB A;  1HW1 A;  1RIO H;  2HZT A;  4IPA A;  3J80 Z;  5BMZ A;  4EQQ A;  3CO6 C;  3K70 C;  5D5U B;  2L01 A;  1O7L A;  2QLZ A;  3CDI A;  4M6Y A;  5J40 A;  1U3E M;  3Q9V A;  1AWC A;  4U7B A;  1BJZ A;  2J5P A;  1ORK A;  4UV8 A;  3P9C A;  1G6N A;  3WU0 A;  1VQK I;  3OYC A;  4GYI A;  2COM A;  2EA2 A;  1FYK A;  2HQR A;  1BC8 C;  3BPV A;  4HNT A;  4K2E A;  1FSE A;  4CSW A;  4ESB A;  4RGS A;  4FT8 A;  2FNA A;  3V7S A;  3DBR B;  3VEP A;  2GIV A;  4IVN A;  3E5Q A;  2AHQ A;  4Q48 A;  3KZZ A;  1JHH A;  3G71 I;  1RNL A;  1YRN B;  1SVO A;  2LF8 A;  4FTH A;  5DCM B;  2Z3Y A;  2O9L A;  3H36 A;  4U0V A;  2LMD A;  2R92 J;  1S6L A;  4ITV A;  1XGS A;  2DPU A;  3LOC A;  2ELH A;  3PO2 J;  1D5V A;  1IW7 F;  1J9I A;  2F48 A;  1RKW A;  1ETV A;  3CCL I;  4G8X A;  1K4S A;  1JE8 A;  1B6A A;  1W4M A;  4XK4 A;  2A5Y B;  1MSF C;  1IDZ A;  3CF2 A;  2DXI A;  1R49 A;  4FIS A;  2A6T A;  2P7C B;  3NRV A;  1F5T A;  1R5G A;  2YX7 A;  3KE2 A;  3O8G A;  1IUF A;  2O8K A;  3MFK A;  3HOX J;  3ZPL A;  4A3C J;  2JRT A;  3BWG A;  1Y0U A;  1GDT A;  1S5L C;  3OR2 C;  4DBQ A;  2G7U A;  1HC8 A;  3I64 A;  4HV6 A;  1NH3 A;  2IBD A;  3PL8 A;  3LSJ A;  1ZRE A;  2E1C A;  2ZFW A;  1UEL B;  3I59 A;  3OYL A;  3I5U A;  5CKT A;  4BKX A;  2AO9 A;  3PSI A;  2EIL H;  2A6E F;  4JP0 A;  2XIG A;  2LRE A;  4LIT A;  1ZEL A;  3O3K A;  2HOA A;  5LRR A;  5CVI A;  2L9V A;  3E97 A;  3IH3 A;  4JX5 A;  1OKR A;  3JCU C;  1JI8 A;  2KLO A;  4FE4 A;  5LBQ A;  1REP C;  5DD8 A;  4Y7N J;  4I99 C;  1FP2 A;  3A01 B;  4ENK A;  3D5S C;  4UXN A;  3TDZ C;  2R5Y B;  4XRM A;  4UNO A;  1TWH J;  4JQF A;  3R6S A;  2IS6 A;  2X9D A;  4IJA A;  4BGD A;  4HSR A;  3FKI J;  1SAX A;  4DIQ A;  1N75 A;  4EM1 A;  2HVQ A;  1DGR M;  2RV8 A;  2YSR A;  3KET A;  5J4Y A;  1QBJ A;  4OMY A;  4BAY A;  4RB3 C;  2HQN A;  1IN8 A;  3TP0 A;  1BOA A;  2RC4 A;  2LKP A;  3KZI C;  3GCM A;  5M3F J;  2W57 A;  2QYO A;  2ZJ2 A;  5HLG A;  3PJR A;  4BE2 A;  1OPC A;  3CMY A;  4A12 A;  4MTE A;  4M3E A;  4MGR A;  1OCO H;  4BJT A;  1MBG A;  1TQM A;  5ICC A;  3JTG A;  3CP2 A;  3QQA A;  4ZDO A;  1G2H A;  4C2M J;  3IAM 2;  3M8F A;  2A69 F;  4KIS A;  2ADU A;  4IQ4 A;  5BS6 A;  3L2W A;  2HDD A;  4M71 A;  4FQG A;  3OV8 A;  2IGN A;  2KP6 A;  3CJN A;  2DAO A;  2QSF X;  3UR3 C;  2P8T A;  2X85 A;  4CDG A;  1SAN A;  4WXD A;  2D1V A;  1T33 A;  2HOT A;  2RNJ A;  1HDD C;  4AD9 A;  3ASO H;  2FRH A;  2K5C A;  3FDY A;  3LSK A;  5E1W A;  5IT9 Z;  3HHG A;  3MZH A;  3KX2 A;  3MKW B;  2V79 A;  1DDN A;  3CCY A;  3C2H A;  2QEN A;  2LBF A;  2Z9O A;  3RZD J;  3OIO A;  3VYT B;  3ZMS A;  3W6K B;  1R1T A;  1IRX A;  5FGM A;  3SYT A;  1QVT A;  2W82 A;  5LD2 C;  3BR1 A;  4E7I A;  1IV8 A;  1XS9 A;  1OR7 A;  2FQ3 A;  5HS9 A;  3TDU C;  1M1E B;  2I5U A;  3FXL A;  4NQW A;  3WTX C;  3Q9S A;  2VUM J;  3OIP A;  2JA8 J;  3BR6 A;  1SEU A;  3LST A;  4ZTF A;  3L2U A;  2LY2 A;  2MD0 A;  1IN4 A;  2EZH A;  1KON A;  4LFU A;  4CA0 A;  1RKT A;  2EIK H;  4DQ2 A;  5LHH A;  2ACJ A;  2EZL A;  3ZN0 A;  4XRS A;  1U9N A;  3E6B A;  1I39 A;  3E5X A;  2HR3 A;  4S0H B;  1D1A A;  2K9N A;  2W7N A;  2QBY A;  2VQC A;  4IKF A;  3CD6 I;  3K4N A;  1P9Q C;  1E17 A;  4GO1 A;  1TP4 A;  3HGG A;  2M1B A;  3GWZ A;  4ESJ A;  1RET A;  1TWA J;  5F0F A;  2Q0O A;  1APL C;  2IS2 A;  3ZMU A;  3ZMT A;  5LRS A;  1IAW A;  3G6E I;  1FT9 A;  4HLY A;  1MD0 A;  2XGX A;  2O61 A;  1ZGJ A;  2OTJ I;  1YIJ I;  4Q4Z F;  3HOT A;  2P6S A;  1HKQ A;  3WGG A;  2P4W A;  4E7Z A;  2L4M A;  4B3A A;  1XSV A;  1J2X A;  1WHU A;  2K4J A;  3HKZ A;  1FIA A;  1Z77 A;  2ME0 A;  2E2I J;  2KT0 A;  2FBH A;  4HF0 A;  3QAH A;  1OIS A;  3SEQ A;  2JJ7 A;  3PO3 J;  3PNY A;  3I9V 2;  1JKO C;  3OS0 A;  1MMS A;  4BQA A;  3S1M J;  2K9Q A;  2AXL A;  2QCO A;  4EVI A;  1I3A A;  5TGT A;  4I0A A;  2IAI A;  2DFF A;  1BBY A;  1O3Q A;  1BW6 A;  3WTT C;  3F8B A;  3JRF A;  5FLX K;  2MW8 A;  3QP6 A;  2NOJ B;  3V4G A;  2VC0 A;  4UVA A;  2LOO A;  2OPT A;  2YU3 A;  4Y3O A;  1BL0 A;  2IPQ X;  4AU7 A;  3OYB A;  1SD6 A;  1POG A;  1ZH5 A;  1VQL I;  1JUS A;  1UFM A;  2O8X A;  1O3R A;  1BI3 A;  1G3T A;  1YS7 A;  1R4N B;  2ZNZ A;  4XM3 A;  5E8G A;  2EWN A;  2M8G X;  1IRZ A;  3KFW X;  1ETQ A;  5D4S A;  3S93 A;  3DV8 A;  3WGI A;  2LC2 A;  4ANJ A;  1P6R A;  2ETH A;  2O03 A;  2ISZ A;  1OFC X;  3CMA I;  2BXZ A;  2OU2 A;  2VQH A;  1Q1V A;  1QRY A;  3KEO A;  3DXJ F;  4IRH A;  3BG9 A;  1TWG J;  2PMU A;  3JRI A;  2HEO A;  1FBQ A;  3F0C A;  3DTK A;  1IG7 A;  1WFX A;  2VL8 A;  4RB0 A;  4UHT A;  4LLG F;  4CIC A;  3HOY J;  2OQR A;  3L2R A;  4V19 K;  3CO7 C;  2G7H A;  4XN0 A;  1C0W A;  4PSW A;  1H9T A;  3K10 A;  3GME A;  1YIO A;  4WWC A;  5EDN A;  2KZV A;  2HI3 A;  1TQP A;  2Y2Z A;  5E18 F;  4J00 A;  5ILS A;  3R4K A;  1Z3Y A;  4ESF A;  1VQM I;  1ZK8 A;  2LY9 A;  4M6V A;  1VQP I;  3ZQG A;  1LKX A;  1MMG A;  4EAT A;  3RKX A;  3X2Q H;  2QSH X;  3BY6 A;  5K7Z A;  4HF2 A;  2IA0 A;  1O7F A;  2HYG D;  4OAZ A;  3VWB A;  1QO0 D;  2Y0S A;  3HOS A;  3QRF F;  3OYJ A;  2W24 A;  1E0E A;  2DI3 A;  5JVG F;  4I76 A;  1B72 B;  3C3W A;  3WU1 B;  1AKH A;  1D0X A;  3DQV C;  4TV7 A;  5J1Y A;  4CH7 A;  2Y0M A;  1TT5 B;  4XSX F;  2L7K A;  2W85 A;  4I01 A;  3DF8 A;  4E6K G;  3JRG A;  3J7A Y;  2FML A;  3VPR A;  1P92 A;  3IWF A;  2M30 A;  1RUN A;  2R5Z B;  2GA2 A;  4A3E J;  4XMY A;  3C7J A;  3CCM I;  1X1A A;  4R1H A;  2L0K A;  2MC3 A;  4BY1 J;  4F55 A;  1U5T C;  4EM2 A;  3OYH A;  4AVZ A;  1MKM A;  5FD6 A;  3CUQ B;  1XTA A;  1FTZ A;  3LQQ A;  1W7P A;  2BY0 A;  2UXN A;  3FM5 A;  1YW9 A;  2OQG A;  2X4H A;  1KZH A;  2JT1 A;  4N9H A;  3HSR A;  6PAX A;  3PM1 A;  4F52 A;  5EGO A;  3S32 A;  3H5N A;  5E3O A;  1A5J A;  2DYR H;  1YJW I;  4M9S A;  3SXY A;  1VND A;  5IP6 A;  3KPH A;  5EEH A;  1UAA A;  3ECH A;  1DPR A;  1WJA A;  2XRN A;  4II3 A;  4OIP F;  3F23 A;  2H8W A;  1ZKG A;  4HQE A;  2KPM A;  3IP4 B;  5B1A H;  1DUX C;  3BJ6 A;  2COB A;  1Z05 A;  1BI2 A;  4KIB A;  3CF5 F;  2ZC2 A;  3FXQ A;  3M4O J;  1BW5 A;  1K83 J;  4CCN A;  3ROU A;  1W0U A;  1JT0 A;  1FSH A;  1FTT A;  4S05 A;  2Q2E B;  4A3K J;  2QF7 A;  3TO7 A;  1NK2 P;  1I5Z A;  1MMN A;  3LA2 A;  2DFE A;  5DEQ A;  4Y52 J;  3H3U A;  4M72 A;  1UHS A;  4CCJ A;  5J4V A;  5BPD A;  1TQI A;  4ZJZ A;  2CV2 A;  4HNU A;  4AID A;  1YJN I;  2FNP A;  3CDH A;  2EBI A;  4RDU A;  1VQ5 I;  2GWR A;  4MEX F;  4W1U A;  3LSP A;  3CCS I;  2WV0 A;  3K70 D;  1W1W E;  5CQE A;  2STT A;  3JAM Z;  1R9T J;  2AS5 F;  4UV9 A;  2MSY A;  1T08 B;  1ZN2 A;  2ZSI B;  3QOP A;  1FOW A;  2F4I A;  3ZQH A;  5JHF A;  2BEO A;  1ZGW A;  1OCC H;  4RA2 A;  1Y6I A;  3LMM A;  4L0Z B;  2RQP A;  2Y0S N;  1R4M B;  1MBF A;  4XOP A;  1ZYR F;  2X6Y A;  4XR6 A;  5A2Q Z;  1IF1 A;  5GTH C;  3HIF A;  3W2V A;  1BOB A;  2W00 A;  3VYR B;  2JQ7 A;  1LB2 A;  1KQ0 A;  2BHZ A;  3BLY A;  1FOK A;  1BN5 A;  2CYY A;  4KT5 C;  3SDG A;  2ZJQ F;  1TT0 A;  1YQA A;  1YTY A;  2DK5 A;  3WOD F;  4DOZ A;  3W2A A;  1PDN C;  2KIU A;  4IHS A;  4XLE A;  3CJT B;  2CV1 A;  1TTY A;  2E34 A;  2VAS A;  1OLT A;  2LY1 A;  3JTH A;  2ZO4 A;  2QZ8 A;  4I0B A;  4U87 A;  2KIS A;  4Y33 A;  2DT6 A;  2CRG A;  1RR8 C;  3CQZ J;  5HLH A;  4HNV A;  4A69 C;  2ZCW A;  3HZJ A;  3QPS A;  1XSX A;  2QVO A;  3K9T A;  1SAU A;  3GTJ J;  3H3Z A;  3R0J A;  2MA3 A;  1Z7U A;  3UKG A;  4L0Y B;  4D7N A;  1KU9 A;  3AG3 H;  3RKQ A;  3IV5 A;  1FNN A;  4II2 A;  3TQN A;  2XHK A;  4XNF A;  2CGP A;  3VB2 A;  3BQZ A;  3DU5 A;  1AOY A;  2CUZ A;  1HW5 A;  4P9U A;  4KMU X;  5CJ9 A;  2WAQ A;  4M6X A;  1LE8 A;  4M3G A;  4HPQ A;  3M3Y J;  2E5N A;  3LQR A;  2E1N A;  1MSE C;  3F8F A;  4EEF G;  3REO A;  1NHA A;  1GHC A;  3IH2 A;  4AYB N;  4OWR B;  3MAJ A;  2VN2 A;  2VB6 A;  1FIP A;  3HRT A;  1O3S A;  5J1U A;  1J59 A;  1FMV A;  3I53 A;  4PGG A;  2ESH A;  1ON2 A;  3MQ0 A;  2IEK A;  3IH4 A;  1WZ2 A;  1GUU A;  3GW2 A;  2XAQ A;  4XKB A;  2BXY A;  4IOA F;  2AQF A;  2JA7 J;  1XMA A;  3OL4 A;  2VXZ A;  3BJA A;  4ZYH A;  4YG2 F;  4IQJ A;  1WPK A;  1K61 A;  2JA2 A;  2XRO A;  1N25 A;  1D8K A;  3F3X A;  1T0F A;  1H88 C;  1B8I B;  2EFP A;  2FE3 A;  5HDG A;  2DTR A;  4RAY A;  1HST A;  1J5Y A;  3NWS A;  5JHU A;  1TZL A;  4CXF A;  4M3B A;  2PEX A;  1V4R A;  4ZTJ A;  3BPX A;  3V7R A;  3CC4 I;  1FYL A;  3KIO A;  1HCR A;  1YHQ I;  4L5E A;  2CSO A;  2HOE A;  4H0E A;  1SFK A;  2JSP A;  1JT6 A;  2O5R A;  1VQ9 I;  1V5G A;  3NQO A;  5AIQ A;  2MGQ A;  2VBW A;  5B5E C;  2JVG A;  5IOZ A;  1WQ2 A;  2A05 A;  1Z91 A;  2DA6 A;  2VQG A;  3WG9 A;  2DFH A;  3H92 A;  2X1C A;  2BW3 B;  2NVY J;  3HL2 A;  3CCV I;  2K9S A;  2KL4 A;  1SC7 A;  2G0E A;  3OYM A;  3DPU A;  2DA4 A;  1GXQ A;  1R23 A;  1XDS A;  1XGO A;  2CQQ A;  3DTE A;  3L2Q A;  2R7V A;  2Y69 H;  2XC7 A;  3PUF A;  5B3S H;  2GAU A;  2ZNY A;  3LAP A;  2DQL A;  3V8J A;  3DLL F;  1R00 A;  1JGG A;  3OWT A;  2LF7 A;  4EJV A;  2VIX A;  2CUE A;  4BDY A;  3U1K A;  4HW0 A;  2XKP A;  1FBS A;  4AUX A;  2QBY B;  1WI9 A;  3G1O A;  3GF2 A;  2EFW A;  1TLH B;  1MJ9 A;  3DPT A;  3E3V A;  1XPX A;  2MH9 A;  1Y8R B;  3OIQ A;  5L3F A;  3MZY A;  3H5R A;  3K4L A;  1J0R A;  1MND A;  3DEU A;  4XLP F;  1B9M A;  1UST A;  2LR8 A;  5LHI A;  4IEJ A;  1BR2 A;  2P5L C;  4MIM A;  1U78 A;  2PJR B;  2MD5 A;  2ZME C;  4NQW B;  3I54 A;  4LOC A;  4H4K C;  3N97 A;  1HBX G;  2PJR A;  1DGW Y;  2ZXJ A;  3W3C A;  3DKW A;  4UB6 C;  4CHU A;  1YX5 A;  2NVT J;  2DOF A;  4MNU A;  4QLC U;  5F1R A;  5EZH A;  3QOD A;  1VQ6 I;  4PJM A;  2R0Q C;  2RAE A;  4XLF A;  4UUS A;  3MD2 A;  4XSZ F;  2OBP A;  3ZQF A;  2V26 A;  4A3L J;  3KP7 A;  1TWC J;  1Y1V J;  3CJR B;  1OCT C;  4G94 A;  4N4N B;  3R0A A;  2HDW A;  4D7M A;  3HTU A;  1Z21 A;  2OAZ A;  4ZYA A;  4I09 A;  2DK8 A;  2XAG A;  1PP7 U;  4MFE A;  3M7G A;  1FP1 D;  5EEA A;  4LK0 F;  3GTQ J;  4IF4 A;  4MEY F;  3DFG A;  2VBZ A;  1QZZ A;  2E71 A;  3H1C A;  2QWW A;  4BU2 A;  2KMU A;  2HOS A;  1B59 A;  1I50 J;  2EIN H;  2X51 A;  4QPO A;  3L00 A;  4U7D A;  1K4T A;  2FEZ A;  3RKY A;  2CFO A;  2QGU A;  1T2K A;  3JRC A;  1UB9 A;  4DZJ A;  4A3B J;  3WG7 H;  1WH5 A;  3BZC A;  1SFO J;  1H9G A;  2Q1Z B;  3HXL A;  1DU6 A;  1LPQ A;  2ID3 A;  3MVP A;  2RN7 A;  1X2M A;  3PQK A;  3JSO A;  3TOA A;  5GAD J;  1FLI A;  3WE3 A;  3DBH B;  3E6M A;  2DT5 A;  3OS1 A;  3BR5 A;  5L3C A;  4B09 A;  5HDN A;  5K5O A;  3EPZ A;  5FRM A;  1OCZ H;  3LL7 A;  5F0C A;  2MLG A;  3K2Z A;  2LYC A;  3ML6 A;  2IP2 A;  3PSF A;  2ZME B;  4HQM A;  3WTV C;  3J7Z I;  2RRE A;  2FBI A;  4XL9 A;  4EMS A;  3AL0 C;  4P5O A;  1ZG3 A;  2HPI A;  1TWF J;  1ETO A;  5M5X J;  2K86 A;  4IHY A;  3PFY A;  4PJN A;  4F92 B;  2HPM A;  2PFB A;  4P1W A;  5D5V B;  3ABK H;  4RAG A;  2O6G E;  2KHM A;  5C44 J;  3IRQ A;  4LLN A;  5JLX A;  3GBG A;  4Q47 A;  5J47 A;  2BY1 A;  4M3D A;  1A35 A;  4U0Y A;  4HLX A;  5IY5 H;  1MH3 A;  5EYR A;  3JRH A;  1WJF A;  5IPA A;  1HA8 A;  3T1B A;  3W6J B;  1UG2 A;  3KZY A;  3ZQL A;  3C2B A;  1TNT A;  3CTA A;  2V7F A;  3TOB A;  2RNG A;  1X2N A;  4Q5S F;  2IRF G;  5HVQ C;  3HKZ N;  4PZJ A;  4R79 A;  3IUO A;  2HQ5 A;  3J80 K;  1L3L A;  4E7L A;  3G1L A;  5FD5 A;  4QPQ A;  2ZME A;  5BOX A;  1ZAO A;  4MO7 A;  3ZOB A;  2IW5 A;  2KIM A;  1Y56 A;  4Y15 A;  2F4M B;  4BXU A;  2FU4 A;  3L2V A;  4U0W A;  1BR1 A;  2X1E A;  3IAS 2;  5K5R A;  1GT0 C;  3BG3 A;  2XF6 A;  4GDF A;  3GTM J;  2LDU A;  3I59 B;  3QYF A;  4HDV A;  2JN6 A;  3QPT A;  1G8X A;  5DV5 A;  2NVX J;  1MBJ A;  5BNG A;  3KYL A;  4ZYG A;  2YU9 J;  2X6W A;  4PFO A;  2EA4 A;  5CYV A;  1OJL A;  3HOW J;  1RC9 A;  2XSJ C;  1R58 A;  4GXO A;  1CF7 B;  2Y48 A;  5CLS A;  2H1K A;  1XB4 A;  3QPL A;  3S14 J;  3GTG J;  2MBF A;  4UVB A;  3LA3 A;  5TJJ A;  1DP7 P;  3GZN B;  3CCE I;  4G6T B;  1SD5 A;  1W0T A;  3IKV A;  5J1R A;  1XSD A;  3CCU I;  3OYE A;  3WGH A;  1OYY A;  4PJJ A;  1EH8 A;  3JRE A;  2PMZ N;  1V55 H;  1QVU A;  1LFP A;  1YS6 A;  2VJI A;  3W6V A;  1T95 A;  3DPL C;  4X0G A;  5CVU A;  1ETY A;  4DNC A;  2WAQ N;  2CUF A;  5FKL A;  1LJ9 A;  3IKT A;  2NS7 A;  4L9V A;  2K27 A;  3EYY A;  2CQN A;  1XDU A;  2LNB A;  2W4S A;  4CYC A;  3S1Q J;  1Y8Q B;  2K4B A;  5JI6 A;  1I6X A;  2OJE D;  1D3Y A;  3HHH A;  2VKE A;  3HSE A;  3E6C C;  1USS A;  4HX7 A;  1FZP B;  1U2W A;  4O6J A;  3DU6 A;  2A61 A;  1YW8 A;  4Z2Y A;  3GUD A;  1LDD A;  3S8P A;  5HS7 A;  4G12 A;  5IT3 A;  1WVR A;  1X3W B;  1EA3 A;  3VOD A;  3S1R J;  2X0L A;  3R61 A;  2IGO A;  5E1Z B;  2D5V A;  3AL0 B;  5B66 C;  2IA1 A;  2HZD A;  3DKY A;  4G7H F;  2ZXI A;  1W36 D;  3SDB A;  4C2U A;  2QM3 A;  3FMR A;  1IXR C;  3VSK A;  2F5V A;  5CVV A;  3WTW C;  5F04 A;  3SHF A;  3TW6 A;  2VT2 A;  4HDU A;  1SFU A;  4A0X A;  5DCF A;  2LP0 A;  3HYI A;  5F0H A;  4BXF A;  3L2C A;  2R5Z A;  3BR2 A;  2K3P A;  3MZ8 A;  3P9K A;  5E20 A;  4J19 A;  1G4D A;  2MAB A;  3LSI A;  2E35 A;  4KDP A;  2CUJ A;  2DN0 A;  1IN5 A;  3IWZ A;  4B8X A;  1X1C A;  3H9Q A;  3P9I A;  5IYB J;  1MDM A;  5LEK A;  2FSW A;  2XF5 A;  4WXH A;  2WAD A;  2W25 A;  2XV4 S;  1YG2 A;  2ZXH A;  3UNG C;  1BR4 A;  2JVH A;  1ZTR A;  1XGM A;  4WF2 A;  2FUG 2;  2H09 A;  2L7Z A;  1LE8 B;  4EGZ A;  4X1E A;  2CO5 A;  5CPR B;  1Z7L A;  2HKX A;  3KYC B;  4ZYE A;  2GXA A;  2FD5 A;  3F6O A;  1ZR2 A;  1FC3 A;  2I10 A;  4IHX A;  2H6B A;  4RAF A;  3BZK A;  2VPR A;  1EV7 A;  1ON1 A;  3I4P A;  4PJ0 C;  1G3S A;  4B4C A;  4PK4 A;  2XB5 A;  4BHB A;  1AKH B;  3R60 A;  2RGV A;  1FOY A;  1Y1W J;  2RDP A;  3JW4 A;  4A3J J;  1KYZ A;  1UHM A;  2DOA A;  2IGK A;  2H6C A;  3E7L A;  2K40 A;  5E79 C;  2R7U A;  1KGS A;  4IHW A;  3LSH A;  1LNW A;  3OY9 A;  3M1C A;  3H35 A;  2F5C A;  5IOY A;  1R7J A;  2JWT A;  4HBL A;  2HXO A;  4LG0 B;  1UZC A;  4N4O B;  3CDL A;  1IV6 A;  3BTL A;  4RGR A;  3H5A A;  1VTN C;  1U9O A;  4M3F A;  4Y17 A;  2R7O A;  4ZYD A;  1WWX A;  2WY8 Q;  4B1R A;  3CUO A;  4EM0 B;  3DKX A;  2E36 A;  1DU0 A;  4PFP A;  2LFB A;  4MTD A;  1LFU P;  9ANT A;  2EZK A;  4A3M J;  1K79 A;  4I02 A;  1ETX A;  1XCB A;  4ENJ A;  3VYU B;  1NTC A;  3J7A O;  2ISY A;  3L7W A;  1QHH D;  5L3B A;  4L5J A;  4XLN F;  2DA1 A;  1JUM A;  1S7E A;  2VOD A;  2XF7 A;  3SFZ A;  3EYI A;  5K5Q A;  5GAH J;  1SD7 A;  5FKM A;  5IYC J;  1X58 A;  4RM2 A;  5EJC A;  3F21 A;  1I3Q J;  3RZO J;  1E3H A;  1R22 A;  2BVL A;  5H6Q A;  1ETK A;  2X6O A;  5FRO A;  2STW A;  4IL6 C;  1JUP A;  3TMO A;  3FHZ A;  1OQY A;  5L3D A;  2KDO A;  3FHN A;  1F36 A;  2GOM A;  5FLX Z;  1K6Y A;  1FY7 A;  3ABT A;  2R7D A;  3C1D A;  4P96 A;  1S8N A;  1LEA A;  1XD7 A;  4CYC B;  3S2H J;  1DPU A;  4CCO A;  3KEQ A;  2M8E A;  4XBF A;  3FX3 A;  3ABM H;  3PIP F;  3FM3 A;  2Y75 A;  1CGP A;  1WJD A;  2KRF A;  3ULQ B;  2DYS H;  1JKP C;  4YII A;  3RTR A;  2QSG X;  3GFI A;  1MIJ A;  2BYV E;  2Z2S B;  1TL8 A;  3ZGK A;  3GZ5 A;  1SVL A;  1KQ9 A;  4GGG A;  1IRF A;  2YR2 A;  2W48 A;  4YFK F;  1HSJ A;  3Q0V A;  3BP8 A;  2F5E A;  3LSR A;  1VQ4 I;  1Y0N A;  2IJL A;  4M9X A;  3FIW A;  2WTE A;  4OIQ F;  1E3O C;  3I4N J;  3E1S A;  2BVM A;  2F5F A;  3F8M A;  4MQ9 F;  3TO9 A;  2V6E A;  2QKL B;  3IL2 A;  2HKO A;  4CUG A;  4MFD A;  3GFM A;  3FIS A;  2HTS A;  2L54 A;  1UCR A;  2ICW G;  3ZMV A;  1BM9 A;  4YIR X;  2FOW A;  4LIV A;  4GYG A;  2IS1 A;  4P9F A;  2KRH A;  1QU3 A;  3TL4 X;  3HGY A;  2DCE A;  4KT6 A;  3RSN A;  4BE1 A;  3LFU A;  3CLO A;  3ERE D;  2E1M B;  2K9L A;  1A36 A;  2MH2 A;  4XKC A;  2RQQ A;  1MBE A;  2VT3 A;  4IOC F;  3GVA A;  1U5T B;  2HVR A;  1YX3 A;  1B72 A;  2ZBK A;  2JUC A;  2DJN A;  3Q5F A;  1F4K A;  3CC7 I;  4XKW A;  4A2U A;  3OS2 A;  2XSD C;  2A68 F;  3MKY B;  4JOM A;  3CUQ A;  1MMA A;  3FXR A;  1E3P A;  2H1L A;  1P4X A;  3CZ6 A;  2OF7 A;  3N4M A;  2IA2 A;  1U0J A;  1MH4 A;  5GAE J;  2HDC A;  4IRG A;  2VON A;  5F1J A;  2P5V A;  1QHG A;  3BG5 A;  3OOP A;  2ZJP F;  2PI0 A;  4M9Z A;  4LD5 A;  4BQO A;  2IGM A;  2O7O A;  2VBX A;  2ZXW H;  3J7Y J;  5E17 F;  4MHG A;  3OYK A;  5FLV A;  3HRM A;  3H0G J;  3LSM A;  4YIF A;  2L2O A;  5K7F A;  2VKD A;  2M34 A;  3D1N I;  5IYD J;  2YUS A;  1KQ8 A;  3EET A;  4D0P A;  3W2W A;  2VQL A;  2NYX A;  3FZV A;  3WTS C;  3B02 A;  3K1M A;  4BAC A;  3PUB A;  2VE8 A;  2HYJ A;  2DLL A;  2BV6 A;  3HDD A;  4L9T A;  1XGN A;  3G4S I;  1RPW A;  1OCP A;  2QUF A;  1JJ8 C;  1VFC A;  4F7Z A;  1ZRD A;  2F2E A;  4JYK A;  1V54 H;  1QA6 A;  1EF4 A;  1YLF A;  3OOU A;  4NC7 A;  2BY3 A;  4XON A;  2ESN A;  3Q0W A;  5L3G A;  4AIK A;  3FXU A;  2DA2 A;  3GZ6 A;  4A3G J;  3B6C A;  1WH7 A;  5ICF A;  4OU0 A;  2JMW A;  3EUH C;  1V5F A;  4D5F A;  2GM4 A;  3V7C A;  2OUM A;  2NXN B;  1XMK A;  1L0O C;  3S15 J;  2DMT A;  2LD5 A;  4CCM A;  1FJL A;  4BH9 A;  1J7K A;  4PSX A;  5FKO A;  4I6Z A;  2YS9 A;  4NHJ A;  3I4M J;  4FAS D;  4EV0 A;  3PIO F;  2ELK A;  3S3N A;  2PN6 A;  3CP8 A;  3KCC A;  1AU7 A;  3EDP A;  2E7W A;  3QYE A;  4RBO A;  2KJC A;  3RI4 A;  2DA7 A;  1VZ0 A;  4NBQ A; 
#chains in the Genus database with same CATH homology
 3K4J A;  3EPZ A;  5FRM A;  3LL7 A;  2LYC A;  2WAF A;  4ZDL A;  4BEH A;  2IS2 A;  4YEJ A;  3PSF A;  5KCM A;  3H9J A;  2RRE A;  4XL9 A;  3AL0 C;  4P5O A;  2HPI A;  3CES A;  3HOT A;  4HG2 A;  3VDX A;  5KNL A;  4E7Z A;  3MMY B;  3PFY A;  4PJN A;  4F92 B;  2HPM A;  2R7R A;  3OL3 A;  4P1W A;  4IX7 A;  4XKV A;  1MMD A;  3HKZ A;  4BEH B;  2KHM A;  3GBG A;  4LG3 A;  3FKJ A;  3CJQ B;  4PUS A;  3SEQ A;  3PNY A;  2X1D A;  3BG6 A;  3I9V 2;  3OS0 A;  4BUP A;  4CZC A;  1WJF A;  1HA8 A;  2VJ5 A;  2M3A A;  3HUG B;  5TGT A;  2V7F A;  2RNG A;  4BL0 B;  5HOO A;  3EUA A;  5HVQ C;  2NOJ B;  3I3L A;  2BOL A;  4OAY A;  3HPG A;  3K4C A;  4R79 A;  2LOO A;  3S3M A;  3IUO A;  4Y3O A;  4E7L A;  2LBF B;  1PYV A;  3HC7 A;  3H0D A;  4QPQ A;  4AU7 A;  3OYB A;  2CMP A;  1Y56 A;  3U21 A;  4XM3 A;  5HLT A;  3L2V A;  4B3X A;  1BR1 A;  2X1E A;  3IAS 2;  2IS4 A;  4BQN A;  2XF6 A;  4GRI A;  4B48 A;  3S93 A;  3QYF A;  2LC2 A;  4XLH A;  1G8X A;  1OR7 C;  2E1M C;  4ANJ A;  2M7B A;  2VQH A;  4IZZ A;  3KYL A;  2Z16 A;  3FBN B;  4XN3 A;  2M7A A;  2X6W A;  1FMW A;  4PFO A;  3AKZ A;  2XSJ C;  3ONQ A;  3DTK A;  2PMZ A;  1WFX A;  2VL8 A;  2VKH A;  3SEZ A;  5LFA A;  2KQR A;  2WB1 A;  3QOE A;  2L9S A;  3AFH A;  3L2R A;  2LRD A;  4G6T B;  4XN0 A;  3OYE A;  4PSW A;  3K10 A;  1X19 A;  4PJJ A;  2M0M A;  2KZV A;  2VJJ A;  2E5Z A;  2QKM B;  1YE9 A;  1LFP A;  2VJI A;  1X1B A;  4NC8 A;  4J00 A;  2R4G A;  4BQQ A;  1T95 A;  3DPL C;  4X0G A;  1Z3Y A;  1V5E A;  4B47 A;  2HNH A;  4XQF A;  4PJL A;  4XLC A;  1LKX A;  4CCL A;  1MMG A;  3NWT A;  4EAT A;  4RM3 A;  3OYN A;  2W4S A;  2L9N A;  3K4B A;  3QYB A;  2UUZ A;  4OAZ A;  3HOS A;  2Y0S A;  2HVS A;  3VWB A;  5CQG A;  3OYJ A;  1E0E A;  4E7S A;  1PJR A;  3K4M A;  3VSL A;  3DU6 A;  1D0X A;  2CS3 A;  4F3Q A;  2V1N A;  3DQV C;  1N78 A;  4FET A;  4CH7 A;  3S8P A;  3DTI A;  2L7K A;  4E6K G;  4Y4R A;  3OYA A;  2LG4 A;  3J7A Y;  1EA3 A;  2CW8 A;  5HNH A;  2IGO A;  3AL0 B;  4XMY A;  4RMN A;  1MNE A;  2HZD A;  4NUB A;  3DKY A;  1X1A A;  4XOR A;  2ZXI A;  4F55 A;  3SDB A;  1W36 D;  4C2U A;  3OYH A;  4AVZ A;  3VSK A;  2F5V A;  1MW7 A;  3PNT A;  1D0Y A;  1NG7 A;  3DWL E;  4F52 A;  3S32 A;  1D1C A;  3H5N A;  3FBI B;  4BJ6 C;  4BXF A;  5KHD A;  4YEL A;  2K3P A;  2UWM A;  1G59 A;  3C2G A;  4DGW B;  1AA7 A;  3DLA A;  4E7J A;  2WY7 Q;  1UAA A;  3TBI A;  1WJA A;  2MAB A;  3LSI A;  1D0Z A;  3CMM A;  4II3 A;  1DP3 A;  2ZFU A;  2CUJ A;  3H9G A;  1LVK A;  2KPM A;  3RPU D;  1X1C A;  3H9Q A;  3IP4 B;  3A4C A;  3D5L A;  1X4P A;  3PNV A;  2XF5 A;  2WAD A;  2ZXH A;  3UNG C;  3A2K A;  1BR4 A;  2M4K A;  4RLQ A;  2JVH A;  4CCN A;  1DQU A;  1NG6 A;  4B43 A;  4E7K A;  4DJA A;  2VLA A;  2OC6 A;  4HEA 2;  2Q2E B;  2FUG 2;  4BS9 A;  1MMN A;  3KEY A;  5CPR B;  2R7T A;  1Z7L A;  1LDK B;  1WJB A;  4CCJ A;  4C2T A;  4ZJZ A;  2CV2 A;  1X1D A;  2L5Q A;  4HNU A;  1X4O A;  3ZQQ A;  2P0W A;  3BC8 A;  2ZSH B;  3A1Y A;  1GLN A;  3OR1 C;  2GOX B;  4PK4 A;  3K70 D;  5CQE A;  1R6R A;  4C30 A;  3HG9 A;  2KRC A;  3OYF A;  4MLO A;  2DOA A;  2IGK A;  2R7U A;  2ZSI B;  3OYG A;  3LSH A;  2F4I A;  3EUK L;  5JHF A;  3OY9 A;  3M1C A;  2K9M A;  3H35 A;  4E7H A;  1Y6I A;  3LMM A;  3LSG A;  2DJI A;  1WJ5 A;  2R7W A;  3BG7 A;  4XOP A;  2X6Y A;  4XR6 A;  4N4O B;  3M8J A;  2IXS A;  2R7S A;  4DBR A;  3E0J B;  4XOT A;  3W2V A;  3K4K A;  2CH0 A;  1BOB A;  2W00 A;  1D1B A;  3H5A A;  3VYR B;  1T0F C;  3BLY A;  3OMY A;  2R7O A;  1TT0 A;  2I8D A;  2WY8 Q;  4YRV A;  2DT7 B;  3DKX A;  4DOZ A;  3W2A A;  2VPL A;  3BCB A;  4PFP A;  4KJZ A;  4XLE A;  2CV1 A;  3K6G A;  2VAS A;  1OLT A;  1UG0 A;  2LY1 A;  4U87 A;  2ELJ A;  2Z1D A;  4Y33 A;  3VYU B;  2DT6 A;  4HRI A;  1QHH D;  1WJC A;  5HNF A;  5FRN A;  1SAU A;  4B44 A;  2XF7 A;  3N05 A;  2HU9 A;  4XLA A;  3ZRG A;  4AYB A;  4II2 A;  4RM2 A;  4XNF A;  3DU5 A;  4CCK A;  3K70 C;  2CUZ A;  2OV7 A;  2BVL A;  2WAQ A;  5FRO A;  4HPQ A;  2E5N A;  3TMO A;  4U7B A;  2KDO A;  3FHN A;  2GOM A;  3OYC A;  1K6Y A;  4OWR B;  4D1Q A;  4BE0 A;  4BDZ A;  4HNT A;  2V4J C;  2VB6 A;  4CSW A;  1FMV A;  4CCO A;  4LIU A;  1WJD A;  1S9H A;  4XKB A;  3RTR A;  2AQF A;  3OL4 A;  2Z2S B;  3ZGK A;  2MC4 A;  2VXZ A;  4D9J A;  4IQJ A;  4ITV A;  3V42 A;  2JA2 A;  3HPH A;  2A5W A;  3E1S A;  2BVM A;  3NWS A;  1TZL A;  2V6E A;  2QKL B;  2UV1 A;  3CF2 A;  2DXI A;  4ZTJ A;  4CUG A;  2A6T A;  2W1O A;  4LIV A;  2IS1 A;  2KRH A;  1QU3 A;  3TL4 X;  1SFK A;  2JSP A;  3OR2 C;  4DBQ A;  2DCE A;  2O5R A;  1V5G A;  4KT6 A;  3RSN A;  3VYS B;  3PL8 A;  1Z3X A;  4BE1 A;  3LFU A;  2JVG A;  2E1M B;  2K9L A;  2VQG A;  1UEL B;  2WBM A;  3OYL A;  4XKC A;  5CKT A;  3PSI A;  2X1C A;  2BW3 B;  2RQQ A;  3HL2 A;  2LRE A;  2KL4 A;  4LIT A;  3ZCO A;  1ZEL A;  3OYM A;  3DPU A;  3RCO A;  2CW7 A;  2E60 A;  1YX3 A;  2HVR A;  2R7V A;  3DTE A;  2V9K A;  3L2Q A;  2XC7 A;  4KIT B;  2X6X A;  1JI8 A;  2KLO A;  4XKW A;  3OS2 A;  3MKZ A;  2MYS A;  3OWT A;  3D5S C;  1WJE A;  2VIX A;  3MKY B;  4JOM A;  3RQ4 A;  3ZR8 X;  4ZC3 A;  4BDY A;  2HQA A;  4JQF A;  2IS6 A;  1MMA A;  3CZ6 A;  4BGD A;  4ZDP A;  4HSR A;  4DIQ A;  3DPT A;  1U0J A;  2BW3 A;  1N75 A;  2HVQ A;  1DGR M;  3OIQ A;  2LH9 A;  2WAE A;  3G2B A;  1ERD A;  1QHG A;  4F91 B;  3H5R A;  3K4L A;  1MND A;  4C9Y A;  2MFZ A;  4BQO A;  2IGM A;  3BCA A;  1BR2 A;  2R7X A;  2PJR B;  3OYK A;  4NQW B;  4J01 A;  3PJR A;  3LSM A;  3OYI A;  2L2O A;  4BE2 A;  4H4K C;  3SZG A;  2VKD A;  2PJR A;  1DGW Y;  3W3C A;  4BJT A;  1N77 A;  4NNJ A;  1YX5 A;  3CP2 A;  3W2W A;  4ZDO A;  2VQL A;  3IAM 2;  3QOD A;  4KIS A;  4PJM A;  4IQ4 A;  4BAC A;  3L2W A;  2R7Q A;  3PUB A;  3F9K A;  2M4G A;  2WA0 A;  3ZXS A;  2JUG A;  3S3O A;  2IGN A;  2KP6 A;  4XLF A;  2VJ4 A;  3UR3 C;  3MD2 A;  2X85 A;  2V26 A;  3CJR B;  4HST A;  4N4N B;  2HDW A;  2K5C A;  3FDY A;  1Z21 A;  3LSK A;  4ZYA A;  3D5R C;  2VXD A;  3KX2 A;  2AQE A;  3MKW B;  3C2H A;  2LBF A;  2CV0 A;  4NC7 A;  3OOU A;  4XON A;  3DEE A;  3VYT B;  3OYD A;  4E4H A;  1IRX A;  3SYT A;  4BU2 A;  1J09 A;  2KMU A;  2W82 A;  5LD2 C;  3EUH C;  4E7I A;  1V5F A;  2OUM A;  2X51 A;  4QPO A;  2CFO A;  2XAU A;  4CCM A;  4PSX A;  3OIP A;  2Q1Z B;  3HXL A;  4FAS D;  3L2U A;  4ZTF A;  2LY2 A;  2MD0 A;  4RLF A;  1W36 C;  1KON A;  3S3N A;  2XDV A;  3CP8 A;  4CA0 A;  3QYE A;  4F93 B;  2F6C A;  4BJ5 C;  3OS1 A;  2W7N A;  1D1A A;  4IKF A;  2VQC A;  3K4N A;  1VZ0 A;  1P9Q C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...