2ZSHB

Structural basis of gibberellin(ga3)-induced della recognition by the gibberellin receptor
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
66
structure length
59
Chain Sequence
b'GMDELLAVLGYKVRSSEMADVAQKLEQLEVMMSNVLATETVHYNPAELYTWLDSMLTDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable gibberellin receptor GID1L1
publication title Gibberellin-induced DELLA recognition by the gibberellin receptor GID1
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hormone receptor
total genus 20
structure length 59
sequence length 66
ec nomenclature
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12041 DELLA Transcriptional regulator DELLA protein N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1290 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2zshB00
2ZSHB 2ZSIB
chains in the Genus database with same CATH superfamily
3RYPA 3A2KA 4G6DA 3R61A 3OR2C 2D1VA 1RETA 2F4MB 4Y4RA 4AIDA 2COBA 4RLQA 1A6IA 1QZZA 2DQLA 5EEAA 1RUNA 2P7VB 1BBYA 2P6SA 1STZA 3GLXA 2R7FA 3HL2A 5L3EA 3JRHA 3L2QA 1K78A 3GTMJ 2UWMA 2Z3YA 2GM4A 2NOGA 1XDUA 2OC6A 4IHTA 1WVRA 1XD7A 5GPCA 5E3LA 5IT9K 4PJLA 2FU4A 3F6VA 3SFIA 2E1NA 4EMSA 1K79A 3EETA 4LG3A 2GXBA 1W0TA 2IS2A 5IP7J 4CDGA 5GADJ 1USSA 4S05A 2KP6A 4HNTA 2MD0A 3H9QA 2R93J 1BN5A 2H27A 1I5ZA 1RIOH 5EG0A 2OA4A 1Y0UA 2XGCA 2VE9A 9ANTA 3S1NJ 1VQNI 2DW4A 3HSRA 2HQAA 5TISC 4X1EA 1LVAA 1X1DA 3M8FA 2QQ9A 2HVQA 4MEYF 3HRUA 1JUSA 2V1XA 1FLIA 5FD5A 2PJRA 3HOUJ 2TRTA 1AKHB 3C7JA 3HOTA 3LSHA 3GTJJ 3HUGA 2LD5A 3PQJA 3DF8A 3LSIA 3WTZA 4AUXA 3S3OA 3DBLB 3KEYA 2DMUA 4RAFA 2DBBA 2K9NA 1Y8QB 4E7JA 2R7UA 5GTIC 2I8DA 3TKYA 4ESBA 1Z7LA 1YRNA 4HNVA 1K6YA 4L5JA 2RQQA 3OL3A 1LUJB 3GTKJ 3BTJA 2ELHA 2H6CA 4PSXA 1UHWA 2X6YA 2VOPA 1MBEA 1KYWA 4HV6A 1ZRFA 4G6QA 2JZYA 5F1RA 3K69A 1MSFC 2CU7A 1CF7B 2K4JA 4OIRF 2HKXA 3FKIJ 3CCQI 1B9NA 3VDXA 3HPGA 4FT8A 3UKGA 5IOZA 3TP0A 3AFHA 2IGNA 5FLXZ 2DA7A 4G8XA 5H20A 2ZB9A 3WU2C 1QVTA 2O5RA 2KKOA 1VZ0A 3KIOA 5JVTA 2A69F 4A3IJ 4AIKA 1S5LC 1MJAA 4XLNF 4D5FA 3LL7A 1ONVA 1P4AA 5JFRA 1WSUA 2V7FA 1LFUP 2JA5J 3KPHA 5ILVA 1JKPC 3O6BB 3H3ZA 4DZPA 4WF2A 5EGOA 2WAFA 5HDNA 4RM2A 2E1MC 5DM6F 4BHPA 1LFPA 3WTVC 1K61A 1SFEA 3DBRB 2L7KA 5J47A 4O3MA 2DMQA 3DLAA 1FTTA 3GLLA 3BJOA 4PJNA 3RPQA 2M0CA 5F1JA 4YG2F 3H5RA 3U1DA 1B72A 2L54A 1I3QJ 3OSGA 3I59B 1ZLKA 4YEJA 2XRNA 2GA1A 1FBSA 2XAUA 3U21A 1TC3C 1FOKA 3E7LA 3ASNH 1FBQA 3IRRA 2EINH 2E7XA 5DTDA 1W5CC 1G6NA 2X9DA 4HSTA 1W36C 3OIPA 2FMLA 4KNYA 2K9SA 3HSFA 2JT1A 2ADUA 4JX6A 1XGMA 1T0FC 2ZXJA 2KDZA 3KYCB 2VBYA 1VFCA 2IPQX 2WADA 3JRAA 1TWFJ 3KZZA 2Z1DA 4CZCA 4ABZA 3ZN1A 2ETHA 2M34A 4XLPF 1R5GA 2VC0A 2M8EA 1LKXA 1V5EA 3ABLH 3WE3A 2M2EA 5B3SH 4MO7A 4F93B 5K7HA 2XF7A 1IXRC 4C3JJ 2DMTA 4XQFA 1YS7A 4UB6C 2KIMA 5ILUA 1BC8C 3JR9A 3QOEA 1VI0A 2DDAA 5CYVA 4M6YA 3PNVA 4DNCA 1DUXC 1SVLA 4HF1A 3VYRB 4N4OB 2VN2A 5F64A 2IJLA 2W48A 1K78B 2RDPA 5TGTA 2VQCA 1BA5A 2X6OA 4I76A 3OS1A 2BV6A 3R4KA 4Z6YA 2P5KA 5FJ8J 3C2HA 4IHYA 2ICWG 1A6QA 4FE7A 5D8KB 1X2NA 3T1BA 3SEQA 2BYVE 3PFIA 3KP6A 4ZC3A 3WG9A 4B3AA 4MTEA 1XCBA 2OD5A 5EG0B 1TTYA 3GFIA 4HNUA 1VQMI 1K83J 2MW8A 1ZH5A 4ZYHA 1E0EA 2IA2A 2ID6A 3FISA 3PNYA 3W3CA 4XBFA 4RB3C 3IWFA 4HYEA 3SFZA 4QIWN 2PJRB 1E3OC 3SEZA 4Q5SF 3GTOJ 2RVCA 2CWEA 3FBIB 1W36D 2VKEA 4K2EA 3W6VA 3ONQA 4ESFA 1ETXA 3HUGB 4D1QA 1SFXA 3PIOF 1W7PD 5FROA 5E79C 3M3YJ 1SD7A 2G7HA 4RB2C 2JQ7A 2VONA 1FP2A 2QLZA 3E6MA 1GVDA 4WXCA 5L3FA 4HLYA 1SD6A 1Y1VJ 5BNGA 4DYCA 2QBYA 4RAZA 1YRNB 4IHWA 5HVQC 3LNQA 4PCQA 2KIQA 4XKBA 3GFMA 2W24A 4YFNF 5IP6A 3CCMI 3S17J 2ESHA 4EJTA 3BR5A 4L5IA 2Y0SA 2V9VA 2EB7A 5FFXA 4G12A 2OV7A 3HRTA 3A4CA 3ZGKA 3LSKA 2HWVA 2XAQA 3ECHA 2L9RA 2JPBA 3OSFA 3O8HA 4P9FA 4OWRB 5J1YA 3L00A 2NRAC 5F08A 1AU7A 4E7SA 2LNBA 1JE8A 2F2EA 1XG1A 2EPFA 4I7HA 2EIMH 1ZK8A 3F9KA 2JPCA 2CQQA 1OKRA 2JTVA 3T8TA 1Y6IA 4O5VA 3CCLI 1YI2I 1XGSA 3MWMA 1QO0D 1I27A 2V9KA 3R60A 1U8BA 2OTLI 3S8PA 4CYDA 5E1XA 1YJWI 5EGOB 2TCTA 2ZKZA 1DGRM 3SZPA 1T39A 1J75A 5BOXA 4RGUA 3GTGJ 4UUTA 3I56I 2CMPA 3EPZA 1RPWA 1HKQA 1Z67A 1T38A 2LK2A 2CV0A 3ZXSA 1HF0A 1B72B 3IH2A 1IZ1A 5CVUA 1A35A 2XV4S 5B5EC 2XROA 2RNGA 4L0ZB 2OF7A 3OYDA 1UG0A 2DK5A 2EJRA 1S7OA 2IS1A 4BQOA 4HQMA 4V2GA 4EJVA 1WJCA 4OIOF 3W6JB 2VIXA 1U8RA 4HAMA 3F8FA 5FB2A 3TW7A 4M3BA 3C3WA 1N77A 1TQPA 4A3LJ 2XPWA 2FBKA 5JI6A 1S8NA 2M4KA 5D5VB 1MMNA 3AG2H 2QSGX 4ENMA 3O3KA 3EUAA 3LOCA 5KVRA 3DPLC 1ETKA 2H1KA 3B02A 1ETOA 4Y33A 2AO9A 1VQ5I 2P7CB 2P5VA 5BQTA 3CDHA 2DO7A 4KFCA 1DGWY 4L9JA 3H0DA 4GDFA 4LB6B 3BG5A 5IT3A 2PBIA 4RA2A 5IYDJ 3TEDA 1G4DA 2O7OA 1BOBA 3J80K 1MNMC 3IKTA 3BCAA 3M1CA 4AYBA 4UV9A 5FKOA 4U7DA 3WU1B 2JA6J 5BMZA 4G6TB 2VQGA 3QPHA 2UXXA 5HS7A 2NS8A 3AL0B 5LFAA 2LYCA 3H3VK 3V4GA 1IJWC 1FX7A 3LA7A 4E4HA 1AWCA 4MFEA 4JQFA 3QODA 4IEJA 3G73A 3GCMA 1RRJA 2XB5A 1WWXA 3MZYA 3GMEA 1OLTA 1MBJA 1DPUA 3LSGA 2R4GA 3S14J 3CCJI 3GYHX 2GWRA 2CW8A 3HZJA 2HQ5A 2DAOA 1Z9CA 1MH4A 3IL2A 5M3MJ 4LMYA 4S0HB 2YS9A 3RCOA 3OYMA 2X1CA 2X6XA 2QGUA 3NWSA 4XOPA 4BACA 1NH3A 2O8KA 1MMSA 3I9V2 1GLNA 4MGRA 5GP9A 4XRSG 1U9OA 2HDDA 3K1MA 1FY7A 4A3BJ 2PI0A 4A0ZA 4KDPA 2YR2A 1LE8A 1DP7P 1ETQA 1X3UA 3M07A 5DDGA 2L0KA 3MAJA 4EEFG 4C2UA 4V19K 5D8LB 4Y7NJ 4M3DA 4BS9A 1SMYF 2A61A 2QBYB 2XKPA 2HEOA 2ZSHB 5F6FA 3B6CA 4HF0A 2HPIA 4QPQA 4XL9A 1HKSA 1L3LA 1A04A 2CQXA 4OIPF 2ZXWH 2JRTA 2HTSA 1HSTA 1F43A 2NVUB 3IKVA 4L9TA 3TGNA 1LDKB 3BG3A 4F91B 1T33A 5JHFA 2W4SA 1RC9A 3E6DA 4BE2A 4P9UA 2E2JJ 1YX5A 2IGMA 2Y48A 3BQZA 1UELB 2H6BA 4EVIA 2O61A 4F55A 4A3DJ 4CO8A 4G7OF 2ZBKA 2IEKA 3J7AO 2HNHA 2COMA 3J81K 2L2OA 1HDDC 2WTEA 2QQAA 1IRGA 2A68F 1T0FA 1W7PA 2E35A 3T8RA 1POGA 1S7EA 4LK0F 1Z05A 1A5JA 3I53A 1LFBA 1PUFB 1IGNA 2E71A 2B0LA 2AS5F 2P4WA 3GO5A 1PVEA 3SHFA 3TMOA 2QYOA 2VOOA 1GXQA 1NTCA 2GA2A 2R7WA 2EZHA 2DTRA 3CCYA 2YU9J 4IQJA 2VI6A 1WGXA 1I39A 3GF2A 5F0HA 1FTZA 2WV0A 2X48A 5HS9A 4A3EJ 3H35A 4NDLA 5F0CA 3HOXJ 3LA3A 1IC8A 5JR3A 3RKWA 3EYYA 2O6GE 2PX9A 3PNTA 2ZO4A 1TWGJ 3FDYA 1VQ4I 3CJRB 4PGHA 4FASD 2CG4A 4J00A 2A6EF 5FRMA 1LVKA 3LFUA 4GRIA 5L3GA 3KETA 4Y3OA 1WJ5A 2N8GA 4ZYEA 1W5TA 4CH7A 5HS8A 4IL6C 4OU0A 5DYMA 1O4XA 1AKHA 4CICA 3RZDJ 3KX2A 1AHDP 3MCZA 1I3AA 2V6CA 1UAAA 1QZYA 1WCMJ 1Y8RB 2E19A 2EZLA 4IF4A 4V2FA 4L0YB 3Q0WA 1IDZA 2DT7B 2QUFA 1V54H 1WQ2A 4CHUA 3AL0C 1J09A 4BL0B 5TRDA 5JHUA 2DFEA 4CSWA 4HDUA 1P7JA 3ABTA 1RI7A 2K9LA 2XAGA 3L09A 2A07F 1S29A 4IVNA 1ZYRF 4W1UA 2FNPA 3MN2A 4OAYA 3OYBA 4M3FA 1XGNA 1ZR4A 2YSRA 4UXNA 2DJNA 4ENKA 2HDWA 1OCRH 1BIAA 4D0PA 1CF7A 3HHGA 2FNAA 2HYGD 2X0LA 5CVJA 5K1YA 2MG4A 3GZNB 4IXAA 4A3CJ 1RZ4A 4IRGA 2HKOA 2K3FA 3BR6A 4LJZF 4F7ZA 1O3RA 4IRIA 2OCCH 2LDUA 3LSRA 2ZJ2A 2M87A 2ZXIA 4A5NA 1VQ9I 2DFFA 1SAUA 3S32A 3J81Z 3VSLA 3RJPA 1Z6TA 2H1LA 4BAYA 2DT6A 1REPC 5GTHC 3A01A 2HOTA 5E8IA 1P7IA 3A03A 5B1BH 1LEAA 1G59A 2AQFA 1JT6A 4F52A 1VQ7I 5HNHA 1UHMA 5HDKA 2XPUA 3QU6A 1LE8B 5EYRA 2IT0A 3NRVA 5HLGA 3RZOJ 1D5YA 5DCFA 2F5DA 3NWTA 2ZFWA 2W00A 1IW7F 2F5EA 3DCFA 2Z99A 2MBFA 4JK1X 5LEJA 4ZDLA 4UNOA 1PP7U 2FD5A 2PG4A 5LBQA 2E1MB 1D1CA 2XDVA 1OYIA 3IAS2 4B1RA 4AYBN 2BOLA 3WTTC 1X4PA 3BC8A 3F22A 3OOUA 4UY8I 4PGGA 1D1BA 1VQKI 4DW6A 1MD0A 5AIPA 2PQ8A 2KJBA 1BI0A 2XHKA 4KN4X 1UZCA 3H3UA 2LY2A 2RV8A 1XDSA 4FX4A 1FNNA 1W7PB 3QPSA 3HXLA 2X1EA 3CLQA 3K4NA 3PO2J 1MZBA 2DCEA 1JI8A 1B6AA 2VB6A 4BQNA 4PJJA 4DBQA 3HEFA 1J59A 1BC7C 3ABKH 5C4JJ 1OYYA 3CTAA 2R7TA 4WWCA 5BPIA 1ZELA 1Y0NA 1JHFA 3CF5F 2RREA 4KJZA 4LLGF 1JUMA 4QTRA 1M1EB 4CCNA 2ZJQF 5M5WJ 1HSJA 6PAXA 1CGPA 3FXMA 1KONA 2XF5A 2VKVA 2ISYA 1TW2A 2DA4A 3H92A 5E1ZB 3S93A 3S1RJ 4ZYGA 2EFOA 3C1DA 4MFDA 2STWA 2CSOA 4TV7A 2YPRA 1R71A 2IS4A 2M45A 1EKEA 2FJ1A 2P8TA 3OY9A 2CFXA 3DEUA 3ZQGA 4EGZA 4FETA 1QPMA 4RB1A 5KNLA 2XAJA 4HF2A 2PFBA 2KZVA 2DJIA 2XKOA 4U87A 1YIJI 2DXIA 5FRNA 3QYFA 1SFUA 1DU0A 4XR6A 4II3A 3CD6I 2HXIA 3K10A 4HG2A 3LA2A 2L7FP 4OIQF 2LFBA 2M7AA 5IYCJ 3HG9A 1DPRA 5IP9J 3WTWC 4E7KA 1ZR2A 3MQ0A 4E70A 3MKWB 1X2MA 3BR3A 5HOOA 2K27A 2KRCA 1Q1VA 4CCOA 3N97A 4P5OA 5J8FA 1SEUA 1TWCJ 3S1QJ 2EZKA 2J5PA 2V26A 1QHGA 2BY3A 1QZEA 1UHSA 4XLHA 3BPVA 2KDOA 3D1NI 4I2OA 2Z2SB 3PL8A 1BL0A 5J1UA 2JSPA 3DEEA 1HBXG 2DU9A 3JSOA 2OU2A 1B9MA 1BIBA 3FM5A 1XSXA 4XK4A 1B59A 3QU3A 1ERDA 4KIBA 1VNDA 3ERED 3G1OA 2OQRA 3OIOA 3CC2I 4M71A 1WJAA 2JUGA 1KZHA 4MNUA 3VODA 3A01B 3HIFA 3VYUB 3FXOA 4UUSB 3ESWB 3DLLF 2HDCA 3G3ZA 4FTHA 3H9GA 3P7NA 1MBKA 3DEWA 3PIPF 2LC2A 1KQ9A 2VQLA 1JJ6C 1R36A 1TWAJ 2DTZA 2GBYA 5E20A 5B1AH 3CMAI 3JW4A 4YIIA 4C2TA 2DA2A 4HQEA 3WTXC 2IA0A 2DYRH 3GFJA 5IT9Z 3S3MA 3D5LA 3ZMSA 3K2ZA 3MZ8A 1G3SA 3REOA 5EDNA 2VJIA 4BY1J 1FC3A 1ULYA 3QOPA 1FYMA 1XN7A 2FOWA 2EIJH 5IYBJ 4B43A 2V6EA 3B73A 3FXUA 2JJ7A 1TP4A 3S16J 3ERMA 3N4MA 2Y75A 4RGXA 1XMKA 4KT6A 1IXSB 2R7ZJ 1OMIA 2ELKA 2R0QC 2F6CA 5ILSA 3G4SI 3VSKA 2CV1A 5J1RA 1X4OA 4PFOA 3JRDA 2FE3A 4DGWB 1D8JA 1Y39A 2MC4A 1E2XA 2WB1A 3CC4I 3MFKA 3TL4X 1EJ9A 1P92A 2GQQA 4EM0B 4LFUA 4B09A 4F92B 4ZYDA 2VKHA 3GTPJ 1Z77A 4BJ5C 3LSTA 1MGTA 3BJAA 2HGCA 1YTYA 3S2HJ 4RS8A 2F5VA 2D2WA 5C3EJ 1O7LA 1PYVA 3GWZA 3ZMDA 3CLOA 5ED4A 2EFNA 2F4OB 3ML6A 2M0MA 1FZPB 3MD2A 2HQRA 3PQKA 1H0MA 1FT9A 4KN7X 3HDDA 3SXYA 3VB2A 1IAWA 1EH6A 4EQQA 1Y1WJ 5DCMA 3BZKA 4YELA 4P55A 3KLOA 3QYEA 4CCKA 5K5RA 3I0TA 1XGOA 2NVTJ 3JRIA 3W2WA 2PEXA 4HEA2 2DOAA 4JYKA 3BG6A 4JP0A 2M3AA 2ME6A 1Z3YA 1FPQA 1ETVA 3AG3H 2OTJI 3K4MA 4ZDOA 2MH2A 2IXSA 1W4MA 5IPAA 4G9YA 2EFWA 2JWTA 1J0RA 5A2QK 1IRFA 1TQIA 5D5UB 4IOAF 2MLKA 3CCUI 2CUJA 4XLFA 3HC7A 4I09A 2X1DA 2GIVA 2NS0A 2O03A 2YX7A 1HQCA 2HXOA 5K5QA 2OPTA 3HBLA 2XGEA 3V7SA 1IN6A 4U7BA 2HPMA 2EV5A 5L3CA 3I4NJ 4H0EA 1BR1A 1V5FA 3HM5A 4CGZA 2VUMJ 4CXFA 1XMXA 1XB4A 3TOAA 4FHTA 4M9SA 4D7NA 1BI2A 2UV1A 4ZTFA 2Y0MA 1WI3A 2R7QA 2PN6A 2RGVA 3ELKA 2XVCA 3F3XA 1YG2A 3KZYA 2R7RA 1JTYA 2K3PA 4II2A 3SJMA 4KIFA 3OYHA 5L3DA 2BBYA 3RPUA 3WG7H 1SAXA 2CYYA 3F0CA 3R6SA 5JLXA 1AOYA 1V4RA 3S2DJ 3NARA 2XC7A 3K1NA 3VYTB 4A5MA 2NVYJ 5FKKA 3L2CA 1QQIA 3GTLJ 2I5UA 4LIUA 3DKXA 3IUOA 1ZRCA 3CJNA 1N25A 4JOMA 4M74A 2NYXA 2C6YA 3CQZJ 3I71A 4DJAA 2WC2A 1SFKA 4AM3A 1ZHFA 3UR3C 1LPQA 4GCVA 4A6EA 3GVAA 4A12A 1V3FA 3Q5FA 1XSDA 1PUFA 1QPIA 1G2HA 3BZ6A 3JRCA 4BNCA 2G9WA 4C9YA 4IOCF 3O2PE 1UCRA 2E60A 5LHGA 1MDMA 2R7XA 3CF2A 3FIWA 3BP8A 5LHHA 3JRFA 4BHBA 1OISA 3WTUC 3K9TA 4FQGA 4XRFA 4AVZA 4XICA 1ZLJA 1JHHA 5DUKA 4F3QA 2F5FA 1FIPA 4B47A 3A0HC 2NXNB 5FFZA 2WY7Q 3BZCA 2R92J 2PJPA 2UUZA 2BY0A 3S1MJ 1XC5A 1GUUA 2PMZA 3JREA 1YYVA 3OR1C 5DEQA 1FSHA 2A6TA 3HYIA 4QWQA 3RQ4A 5K7FA 5JLWA 1R6RA 3WTSC 1H89C 3KEOA 4DQ2A 1PUEE 3EUHC 2ZSIB 1AA7A 4Y17A 1BJAA 1KQ8A 2M9HA 3M4OJ 3VYSB 3ZMUA 2M8GX 2Z33A 3H5NA 2XF6A 2EIKH 1HXDA 2KZGA 3E1SA 1IN7A 4P1WA 1VQOI 3IH4A 2LF8A 3W6KB 4BYYA 1C0WA 4J19A 1BW6A 1YX3A 3RKXA 2X4HA 4DOZA 2KISA 2HS5A 2F4IA 4M72A 2Y9ZA 2VBWA 5K7ZA 1T08B 1T8IA 3OYAA 3P9KA 2Y9YA 5EZGA 3PM1A 1JUPA 2Y2ZA 1IN8A 2DMNA 1LNWA 1WZ2A 4M3GA 5H6QA 3TOBA 3LSJA 1ZAOA 2JA7J 3KFWX 3RIRA 2K9MA 1QBJA 5IY5H 3R0JA 5GAHJ 5DCMB 4LK1F 3CP8A 4B44A 2FOKA 3LWFA 3L2RA 1YE9A 4NQWB 2K86A 1WI9A 3LQRA 4EJWA 1E17A 3CO6C 2B9SA 5D6FA 5F04A 1R00A 2Q0OA 5LEKA 3K4BA 4M6XA 3M8JA 1CQTA 3C18A 3G71I 1BJZA 4FE4A 1SVOA 2HFHA 2H8RA 4R1HA 3RYRA 2BY2A 2OZUA 3CESA 3EDPA 1SMTA 3U1KA 3CMEI 4AD9A 2H09A 2L9NA 3I64A 2MYSA 5AIQA 1N78A 5J4VA 2HOEA 1ORKA 2YU3A 2X85A 4BDYA 2CFOA 3HTSB 4XN3A 2E5ZA 3K2AA 3K1PA 3WGHA 1EV7A 2Z9OA 2MGQA 1S72I 3ECOA 3F8MA 3FBNB 4NC6A 1YS6A 2NS7A 4PUSA 3ASOH 1WFXA 1HC8A 1HCRA 5ICCA 1Z1DA 1OCCH 3OMYA 4N9IA 2V1DA 2AXTC 5LGTA 3FXLA 1HW2A 5IOYA 4MHGA 3ZRGA 1JXSA 3K70C 3BROA 4BJTA 4A0YA 1JT0A 4BH9A 1QVUA 2XRLA 4DYQA 4BXXJ 1R4NB 3K4LA 3ZQLA 3M8EA 2B63J 5J4YA 1ZGJA 3HRMA 1QRYA 1S7AA 1X1CA 4AVPA 4Y15A 1DU6A 3DPTA 2VLAA 2GLOA 3KP5A 4RAGA 1NK3P 2QSHX 2VBZA 4HOBA 2LKSA 1U0JA 3BCBA 3GX4X 4U0YA 3M9AA 2P5LC 4IRHA 3VPRA 5CVRA 2O9LA 1R58A 2F48A 3OV8A 2XIGA 3GEZA 2QKLB 2XSJC 3QP6A 1TQMA 2PMHA 1FMWA 1ACIA 5LLQA 3PSFA 3CJTB 1BI3A 4YRVA 3J80Z 1RR7A 2QKMB 1HOMA 1H9GA 1FEXA 4GGGA 1MDMB 1TWHJ 4U88A 3DWLE 2QCOA 1LJ9A 1BR2A 2EFPA 5CPRB 3VFZA 2CQNA 4DIQA 2P81A 2V9PA 3ZQQA 2V1UA 3BY6A 3JAMK 1QHHD 2R5ZA 4I6ZA 4Y13A 1VQ6I 2HI3A 2IGOA 3F21A 3BDDA 3HB9A 2IAIA 5E1WA 1R4MB 1P4WA 1X3WB 1B4AA 1W1WE 3KP7A 4XLEA 4BXUA 1HW1A 4KUMA 3SQNA 4MTDA 4IKFA 1RNLA 3RTRA 4KICA 4O6JA 2GIZA 3K4CA 2DPDA 2VJ5A 3E5UA 4KIGA 4PSWA 4XMYA 2Y0SN 3K70D 1I6XA 2EV6A 4N0BA 2IGKA 2OUMA 5KAFC 5HDGA 4E7HA 2D1HA 3HRSA 1YW9A 4IJAA 4XSZF 2OCEA 2VJ4A 2MSYA 2L4AA 2FRHA 1WKMA 1TT5B 1ZREA 3HKZA 2FF4A 2KIFA 3ZMTA 3L1PA 2L4MA 5EEGA 3H36A 4UUVA 2CRGA 3FM3A 2EZIA 3CDIA 3DU5A 3OL4A 2W82A 2Z5UA 2RQPA 2KHMA 4CUGA 3L9FA 1LEBA 5EJCA 3L2VA 3RKYA 4GYIA 3I55I 4AC0A 3IAM2 3PUFA 2ME0A 4XONA 1N75A 2XASA 2J5OA 4ZYAA 5J6XA 2AQEA 2CW0F 3WHCA 4CCJA 3SZGA 4CZZA 1I1GA 1R7JA 3EUKL 2RAEA 2CV2A 2JSCA 4GYGA 3S2WA 1F1ZA 1IV8A 3J7ZI 1OCTC 3HPHA 4Q4ZF 3NEUA 4EJUA 2ZXHA 1K6OA 2F5CA 1MW7A 1JKRC 1L0OC 1V5GA 1B8IA 3KP2A 4IX7A 2QWWA 2Y31A 3ZN0A 3F8NA 3QPTA 1ZG5A 4ENNA 1SFOJ 4IPAA 4A3MJ 2PMZN 2L3DA 5H2FC 5TJJA 2DQRA 1RESA 4Z2YA 2O0YA 1Z3XA 4KYWA 5HNFA 4LB5A 1D1AA 4XNFA 2DDBA 2JRMA 3BR1A 4UUSA 3DBHB 1ENHA 2L7MP 4ASNA 2RNJA 1JKOC 1SD5A 1Z6RA 3V8LA 1R1VA 5M5XJ 1U78A 1DQUA 3HOYJ 2GAUA 3DKYA 1QGPA 4ENJA 2EA4A 3DXJF 3WGGA 5LGUA 4XKCA 4BDZA 1XX5A 2HU9A 2HQNA 2MFZA 1O3SA 2LBFA 2OQGA 3VEPA 2BEOA 2FBIA 2X6WA 4E7IA 2AXLA 4HDVA 1NHAA 2BHYA 3OOPA 2VQHA 3COAC 1ZG3A 4HLXA 3KYLA 3RI4A 3CCVI 2LMDA 3SDBA 2K5CA 4MEXF 4IZZA 1VTNC 3MVPA 1G8XA 1R22A 4CCLA 4BKXA 2JMWA 3LQQA 2R3SA 3DTEA 1IRZA 1WJBA 1SVMA 1JTXA 2CJJA 2E7WA 4WX9A 1VQ8I 4BGDA 3EUHA 3HOWJ 1ZG1A 3HSEA 3U2RA 3IV5A 3FF5A 2P6TA 1HA8A 2WBMA 2VC1A 1U9NA 4IO9F 3L2WA 4G7ZF 2FBHA 3H1CA 2QF7A 3E6BA 3JCUC 4M73A 4OMZA 4WXDA 4GO1A 2DA6A 1FMVA 3F23A 1JGGA 2E2IJ 2OBPA 2M30A 1R49A 2EV0A 1F5TA 3PO3J 4X6AJ 2ZNZA 2IBDA 2UZKA 1XS9A 2ZMEA 3LAPA 2CUFA 1GV5A 1X1BA 2KPMA 3T0YA 5ICEA 1YJNI 1MNEA 2ECBA 1U5TA 2A5WA 3I4PA 4OAZA 4D5CA 3QQAA 5KHDA 4G94A 2R5ZB 4ETSA 2BZTA 2EWNA 4BQQA 4XLAA 4N4NB 1RR8C 2VODA 3ZQCA 2V1NA 2A6HF 2XGXA 2DN0A 4A3KJ 2L9VA 5J40A 3PJRA 1KA8A 3V42A 3RPUD 1IN4A 2KQRA 2E2HJ 5FKMA 3DTKA 1GXPA 1GV2A 1SC7A 3AG1H 1GHCA 3OS2A 1TBXA 2G7UA 2LTPA 1MNDA 1XPXA 2Z16A 4ESJA 2ELJA 4XN0A 4HRIA 2RN7A 4N9HA 1P2FA 1RKTA 1VF9A 1IRXA 2R7OA 2Q2EA 2A3SA 4G7HF 2W85A 4OMYA 3LAJA 1Z7UA 3IWZA 4LIVA 2BY1A 3CCSI 4ZH4F 2XPVA 1I6HJ 3CC7I 3DU6A 4KITB 2ZJPF 2LY1A 3I54A 4A3FJ 5HODA 2D5VA 4LITA 4DYRA 1T6SA 1TT0A 1ZRDA 3CP2A 3ABUA 3DPUA 5FLMJ 3OYGA 3JTHA 3CZ6A 3F8BA 4RGRA 3WE2A 1IUYA 1WJEA 4ITVA 4PZJA 2QQ8A 3F6OA 3I58A 2HTJA 3KZIC 2BW3B 2L01A 1WH5A 2OAZA 4XSXF 3V7RA 2CQ7A 3HGYA 1XMAA 1FBUA 3FK7A 4XKWA 2JVHA 2NNNA 1ON2A 2MLGA 1TNSA 1XTAA 2L5QA 3A1YA 2XGDA 2CQKA 1B8IB 3GUDA 3IH3A 1IXCA 4HW0A 1R23A 3TO7A 2VPRA 2QZ8A 1X3ZB 2MC3A 1WPKA 3FK6A 4KMFA 3FZVA 1V55H 4A2UA 1HW5A 1QA6A 1OFCX 4DZJA 4EM1A 4BEHA 4R79A 2FMYA 1F4KA 1H9TA 2DYSH 3VWBA 2KL4A 5D5WB 5D4SA 1ZQ3P 2KRFA 5FD6A 5J8CA 1FSEA 4RDUA 3KLNA 4S04A 2BVLA 5FKNA 2QA4I 3ZMZA 1EF4A 1BR4A 3SYTA 4M6VA 3QAHA 2Y30A 3CUQA 2ACJA 3OIQA 5BPDA 3V7CA 4FX0A 4ON0A 2BXYA 3JSPA 2ZNYA 4B8XA 3HKZN 2D45A 2GXGA 2LBFB 4LLNA 3TW6A 2KRHA 2BGCA 3H0GJ 4I98B 2MD5A 1ZGWA 2K4BA 2KIUA 1U6GA 3K4KA 5L3BA 3G1MA 1D3YA 3I3LA 1WJDA 2EH3A 2CUEA 3U9GA 4XRMA 4BBSJ 2P0WA 3E5XA 3ZQ7A 5H6RA 2DK8A 3TO6A 5FGMA 2M5WA 3PFYA 2BHZA 5ERIA 1MMGA 1MBFA 4UHTA 3RDIA 3MZHA 3DKWA 1T56A 1D5VA 3SZTA 1TW3A 3I4MJ 3CCRI 3F72A 3J7YJ 4IHXA 5E17F 1IF1A 2VT3A 3ZQFA 2NVXJ 1UJ8A 1T95A 3CO7C 1IDYA 4RLFA 3OYLA 4EATA 3BTCA 3MMYB 1OR7C 3KE2A 3C2BA 1TNTA 2CW7A 3BG7A 4GFBA 1WH7A 5HLIA 1NG7A 3K0LA 2LLKA 5CVVA 2TDXA 2ZMEB 3K6GA 3WODF 4BY7J 1EH8A 2LREA 1K7AA 2DLLA 3BT9A 1U5TB 4R8HA 2RC4A 3BR2A 1R1TA 1XSVA 2VKDA 1JJ8C 4NQWA 3GW2A 3ZQIA 3A02A 4UV8A 4NC7A 4I0AA 1HKTA 3OYNA 4YIRX 2K85A 1YO5C 2LH9A 1MBHA 5DM7F 3BTLA 2LSOA 5F0FA 2CS3A 3SDGA 1J5YA 1K4SA 3ZR8X 2LKXA 2Q8KA 3K7AJ 4QSHA 1ETYA 5ICGA 3LSMA 4B4CA 2KMUA 2Q2EB 1BW5A 2K7LA 1O3TA 4AWXB 4HX7A 1MSEC 4RBOA 3HHHA 1GVJA 1OPCA 3ZQHA 4YFKF 5E18F 1T98A 3TDUC 4HV5A 3TP3A 4HX4A 1ITYA 1MH3A 2W57A 1J2XA 2FQ4A 1U3EM 2L9SA 4XKVA 3OYCA 3V8JA 3CCEI 4U0WA 3H9JA 1WHUA 2A05A 5E3OA 3A0BC 2DPUA 5E8GA 4PJMA 4YFXF 2R5YA 1D0ZA 1G3TA 2IW5A 3LFKA 1R9TJ 1KU3A 2E36A 2A5YB 1LDJA 1ZKGA 2YX4A 2GXAA 3Q3SA 4RMNA 3WHBA 2VE8A 2QM3A 2UXNA 4UVAA 2LY9A 1O3QA 2HZDA 2OJED 5GAGJ 3ZPLA 3RSNA 2GOMA 3R0AA 2EILH 3OYFA 1SD4A 5FLVA 3D5SC 4ZZDA 3PSIA 2GZWA 2JUCA 4BEHB 1S3JA 4D9JA 5F27A 1O7FA 3CMMA 4C3HJ 1ZARA 1X1AA 4C2MJ 1JGSA 1J7KA 4J01A 4HSRA 1LB2A 3E3VA 5E3NA 3MKYB 3NAUA 5K5OA 3HOZJ 4RGSA 4AIJA 3CUQB 4QLCU 3E5QA 4MQVA 2PMUA 1Z21A 3MEXA 1GT0C 5KAIC 2GOXB 2O8XA 4BQAA 1APLC 2WAQA 3S3NA 3DP7A 3ULQB 1MJ9A 1YLFA 2DT5A 1MJBA 1E3PA 1LQ1A 4PFPA 1DDNA 3H5AA 1A36A 1KU9A 2V4JC 3KYDB 4HPQA 1D8KA 2MH9A 1UG2A 1GDTA 2ZC2A 5C4XJ 1D0XA 1KQ0A 2Y69H 1QU3A 5HLHA 1ETWA 2VASA 3QWLA 3W2VA 3Q0UA 2QQBA 4IHVA 3HOSA 3OYIA 1K4TA 4A69C 3DTIA 5A2QZ 4IHSA 2DFIA 2BXZA 2LG4A 2R7DA 4EGYA 2DI3A 2O3FA 2VT2A 3ISPA 3F8CA 3ZP5A 5CQEA 5J3LA 4CA0A 2FSWA 2ZMEC 2NNYA 3E97A 5JVGF 1P9QC 3IHUA 2CGPA 3HOVJ 4EM2A 3GZ5A 3AKZA 1ZN2A 4BUPA 4EJOA 1U5TC 5LD2C 1IV6A 4U0VA 2ZJRF 1FP1D 1OCOH 3DFGA 2E5NA 2R7VA 1FYKA 1P6RA 4ZZLA 4B3XA 5D4RA 4BBRJ 2ISZA 1HDPA 5LGNA 1F36A 4XM3A 1A31A 1PJRA 1J9IA 2XAHA 2L02A 2R7SA 5KK1A 2NAZA 2QENA 3GXOA 2IRFG 2VBXA 3Q0VA 1E3HA 2FEZA 1B1BA 1SANA 4L9VA 3FHNA 1F9NA 1DP3A 1S6LA 2ESNA 1R5ID 2XUBA 5FKLA 3WTYC 1KYZA 3L2UA 1ZGAA 3QYBA 3JRGA 2JK3A 2WWYA 4FISA 2ZFUA 4M9ZA 2LR8A 2WY8Q 1YOVB 4XIDA 4CYCA 2YUSA 2E1CA 2NVQJ 5CLSA 3NQOA 5EEHA 3G1LA 2CUZA 2W7NA 2WA0A 1LDDA 2HYJA 3T5XA 2HR3A 2VJJA 1H8AC 4QPOA 1X58A 4Q48A 1W5SA 2LRDA 2IP2A 5DD8A 4Q47A 2IA1A 2DOFA 3DV8A 2V79A 1MIJA 4I99C 5D6EA 4BU2A 4ANJA 3RQIA 4UVCA 3BQYA 3FXQA 2K02A 1USTA 2WB1N 2CH0A 3BJ6A 4NUBA 5LRSA 1YHQI 5M3FJ 4NNJA 1Z91A 4RB0A 4W97A 1Q1HA 2EK5A 2HOSA 1OQYA 4AU7A 4BE0A 1NK2P 4L18B 2QVOA 1ZTRA 1BOAA 2R5YB 5CJ9A 3HGGA 4BHCA 1YITI 3WGIA 4OOIA 1RKWA 2H8WA 3D0SA 3FMQA 3RKQA 4PJ0C 1OYWA 4KA4A 3DQVC 1IG7A 3ABMH 3BPXA 4LOCA 3IC7A 1IN5A 3V8KA 2CO5A 1WRJA 3TDZC 4HBLA 4LLLA 2VXDA 2X51A 3FX3A 5FO5A 4HA8A 3TQNA 1G3WA 1MMDA 1HLVA 4XOTA 5GAEJ 1H88C 3CUQC 3M7GA 3L7WA 2HVRA 4UB8C 1R1UA 5AONA 3O8GA 4I01A 4P96A 1UMQA 5EF6A 4OINF 2XSDC 2HVSA 2W25A 4MIMA 1NG6A 3J7AY 2QSFX 4E7LA 2KFDA 1OJLA 1P4XA 2LF7A 3QRFF 2L7ZA 1I50J 3ZOBA 4GXOA 4LG0A 3MKZA 4E7ZA 1FOYA 3JRBA 2KLOA 1W0UA 3IRQA 3S15J 2M4GA 1OR7A 4XORA 4LD5A 1R5HA 3GFLA 4UVBA 1VQPI 1TL8A 5CVIA 2AHQA 1YW7A 1YIOA 3FWEA 1MBGA 2EFQA 1FIAA 3M1EA 1JKQC 2E34A 2ECCA 4L5EA 4D7MA 4HX8A 2EA2A 3CDLA 3GBGA 2HYFA 3B6AA 3KCCA 4KMUX 1G3YA 3BR0A 2M7BA 5LRRA 1T2KA 2KJCA 2EQRA 4PK4A 3LSPA 2NOJB 2DA1A 5HLTA 3GZ6A 3WU0A 2FXAA 3EQLF 3X2QH 1XCVA 4BJ6C 4NB5A 4LGWA 2JA2A 1KU7A 3BTIA 4BXFA 4XLCA 2LVSA 4JX5A 4PDKA 3VOEA 3QPLA 2QEXI 4MLOA 1OCPA 3OWTA 1WJFA 4B48A 2WV1A 5B66C 2ID3A 3JTGA 2W1OA 4RAYA 4NHJA 4EV0A 4ZJZA 3TO9A 1FOWA 2Q1ZB 1IO2A 4KISA 3LMMA 1I1SA 3FKJA 2WAEA 4I02A 5BS6A 2STTA 2VPLA 2KT0A 5CQGA 4A3JJ 3AG4H 3BG9A 3CUOA 1Y56A 3KP3A 3ROUA 3OYJA 1D0YA 3IP4B 2DA5A 2RKHA 2FUG2 3EYIA 2BW3A 2I10A 1X1PA 2HOAA 1X19A 3G2BA 2LKPA 4DBRA 4JBAA 5C44J 1BM9A 3BLYA 5ICFA 1EA3A 5DD4A 2LOOA 4ZDPA 2FA5A 3MKLA 3FMRA 3G6EI 2VXZA 2K40A 5EZHA 5M5YJ 1IUFA 3I5UA 1YFHA 4A93J 2DOEA 2WAQN 4A6DA 1EH7A 3CMYA 3HJEA 2E1OA 2EBIA 4A0XA 2MABA 2ZCWA 4CYCB 4A3GJ 4CCMA 2HZTA 2DMPA 3FXJA 3Q9VA 2IVMA 2JN6A 4C30A 3KEQA 4I0BA 1PDNC 1FJLA 3FHZA 4ZTJA 3CJQB 1OCZH 3P5JA 4NC8A 2LP0A 5E3MA 4WXHA 3TBIA 2PLYA 2DA3A 4C3IJ 2IS6A 2FQ3A 2OZ6A 2BE5F 2XB0X 2MA3A 4IQ4A 5CKTA 4FCYA 1ON1A 4E6KG 2JVGA 4MQ9F 3OYEA 5DV5A 3JAMZ 3QP5A 3HTUA 2B7EA 3E6CC 1ODDA 3BWGA 4RM3A 1MKMA 3FXKA 3Q9SA 3PUBA 3BOQA 1S9HA 1FYLA 2H94A 4X0GA 1TZLA 2DFHA 5D5XB 1YQAA 2G0EA 3AAFA 1FWZA 4KT5C 2VL8A 1KU2A 3P9IA 2DODA 3UNGC 4L9NA 3GTQJ 3I59A 1Z0XA 5DS9A 4NBQA 1QNTA 4WK8F 2BVMA 3K4JA 1YJ9I 4AIHA 1RUOA 1BI1A 1FOXA 2K9QA 1YW8A 3ZCOA 5DUIA 3ZMVA 5LHIA 4H4KC 3W2AA 4XRSA 4Y52J 4M3EA 4WCGA 3E0JB 3C2GA 3D5RC 4BE1A 1UFMA 1UB9A 4M9XA 3FXRA 3OS0A 1VQLI 1PP8F 2W84A 1KGSA 3FMSA 5FLXK 5GPAA 1MMAA 4YIFA 2XAFA 2FX0A 2JA8J 3P9CA 3N05A 4JX4A 1TLHB 1U2WA 3KP4A 1O57A 4HZFA 2M1BA 4LG0B 3OYKA 5KCMA
chains in the Genus database with same CATH topology
1AA7A 1T95A 3A2KA 3OYLA 4RLFA 4EATA 3H35A 3OR2C 3VYSB 3MMYB 1OR7C 4Y4RA 4RLQA 2CW7A 3BG7A 3H5NA 2XF6A 4P1WA 1NG7A 3E1SA 3PNTA 3HL2A 3K6GA 3FDYA 3L2QA 2LREA 3CJRB 4FASD 1YX3A 2UWMA 4J00A 4DOZA 5FRMA 1LVKA 2OC6A 2F4IA 4PJLA 2VKDA 3LFUA 4GRIA 3OYAA 4Y3OA 1WJ5A 4LG3A 2IS2A 4NC7A 4CH7A 2KP6A 3KX2A 4HNTA 2MD0A 3H9QA 3OYNA 1UAAA 2LH9A 2DT7B 2K9MA 3AL0C 1J09A 2CS3A 3CP8A 4B44A 4BL0B 3ZR8X 4CSWA 3L2RA 1YE9A 2HQAA 4NQWB 1X1DA 2K9LA 3LSMA 2HVQA 2KMUA 2Q2EB 2PJRA 3K4BA 3M8JA 3HOTA 3LSHA 4OAYA 3OYBA 3LSIA 3S3OA 3KEYA 2HDWA 3CESA 4E7JA 2R7UA 2I8DA 2L9NA 2L9SA 2MYSA 4XKVA 1Z7LA 3OYCA 1K6YA 1N78A 2RQQA 3H9JA 3OL3A 2X85A 4BDYA 2CFOA 4XN3A 2E5ZA 4PSXA 4PJMA 1D0ZA 2X6YA 2ZXIA 3FBNB 1SAUA 3S32A 4PUSA 3VSLA 1WFXA 2DT6A 4RMNA 3HPGA 3VDXA 3OMYA 3AFHA 1G59A 2AQFA 4F52A 5HNHA 2IGNA 3ZRGA 2HZDA 3K70C 4BJTA 2O5RA 2GOMA 3RSNA 3OYFA 1VZ0A 3D5SC 3K4LA 3PSIA 3NWTA 2W00A 4BEHB 4D9JA 1X1CA 3LL7A 3CMMA 2V7FA 4ZDLA 3DPTA 1X1AA 2VLAA 2E1MB 1D1CA 2XDVA 2WAFA 4HSRA 4J01A 3IAS2 1U0JA 3BCBA 4RM2A 2E1MC 1LFPA 2BOLA 3MKYB 1X4PA 3BC8A 2L7KA 3OOUA 3DLAA 2QKLB 1D1BA 2XSJC 4PJNA 1Z21A 1FMWA 3PSFA 2GOXB 3H5RA 4YRVA 2QKMB 2WAQA 3S3NA 4YEJA 3DWLE 4PFPA 2XAUA 3H5AA 1BR2A 3U21A 2V4JC 4HPQA 5CPRB 2LY2A 4DIQA 1D0XA 3ZQQA 4HSTA 1W36C 3OIPA 1QU3A 2VASA 3W2VA 1QHHD 3HOSA 3OYIA 2IGOA 3HXLA 2X1EA 3DTIA 1T0FC 3K4NA 1JI8A 2DCEA 2WADA 2VB6A 4XLEA 2LG4A 4BQNA 4IKFA 2Z1DA 4CZCA 4PJJA 3RTRA 4DBQA 5CQEA 4CA0A 1LKXA 3K4CA 1P9QC 1V5EA 2VJ5A 2R7TA 1ZELA 3AKZA 5LD2C 4BUPA 4PSWA 4XMYA 3K70D 4F93B 2XF7A 2E5NA 2R7VA 2RREA 4KJZA 2IGKA 2OUMA 4B3XA 4XQFA 4CCNA 3QOEA 4E7HA 4XM3A 1PJRA 3PNVA 1KONA 2XF5A 2VJ4A 4N4OB 3VYRB 3S93A 2R7SA 3HKZA 5TGTA 2IS4A 2VQCA 3FHNA 3DU5A 3OL4A 2W82A 1DP3A 3OS1A 2KHMA 3OY9A 4CUGA 3C2HA 3L2UA 3QYBA 3L2VA 4FETA 5KNLA 2ZFUA 3IAM2 3SEQA 2KZVA 2DJIA 2WY8Q 1N75A 4XONA 4U87A 4ZYAA 2DXIA 2AQEA 5FRNA 4CCJA 4ZC3A 3SZGA 2CUZA 3QYFA 2W7NA 3EUKL 2WA0A 2CV2A 4XR6A 4II3A 4HNUA 3HPHA 2VJJA 3K10A 4HG2A 1E0EA 4QPOA 2ZXHA 2LRDA 3PNYA 3W3CA 2M7AA 3HG9A 1MW7A 1V5GA 2PJRB 3SEZA 4IX7A 4E7KA 3FBIB 3MKWB 1W36D 5HOOA 2KRCA 3ONQA 4BU2A 4ANJA 4CCOA 3HUGB 4D1QA 4P5OA 5FROA 2CH0A 4NUBA 1Z3XA 5HNFA 2V26A 1D1AA 1QHGA 4NNJA 4XNFA 4XLHA 5HVQC 2KDOA 2Z2SB 3PL8A 4AU7A 4BE0A 4XKBA 2JSPA 3DEEA 1DQUA 2Y0SA 3DKYA 2OV7A 3A4CA 4XKCA 3ZGKA 3LSKA 1ERDA 4BDZA 2HU9A 3DQVC 2MFZA 1WJAA 2JUGA 4OWRB 2LBFA 3VYUB 4E7SA 2X6WA 2VXDA 2X51A 4E7IA 3H9GA 3F9KA 1MMDA 2LC2A 2VQHA 4XOTA 3KYLA 2VQLA 1Y6IA 3SDBA 2K5CA 4IZZA 4C2TA 2HVRA 1G8XA 4CCLA 2V9KA 3D5LA 3S3MA 2HVSA 2VJIA 3DTEA 3S8PA 1NG6A 3J7AY 1WJBA 4E7LA 4B43A 1DGRM 2V6EA 4BGDA 3MKZA 4KT6A 4E7ZA 2KLOA 2CMPA 3EPZA 1HA8A 2WBMA 2M4GA 2F6CA 3L2WA 3VSKA 4XORA 2CV0A 3ZXSA 2CV1A 1X4OA 4PFOA 2RNGA 1FMVA 3OYDA 1UG0A 4DGWB 2IS1A 4BQOA 2MC4A 2WB1A 1WJCA 1X1BA 2KPMA 2VIXA 1MNEA 3TL4X 1N77A 3GBGA 2A5WA 4OAZA 2M7BA 4F92B 5KHDA 2M4KA 2VKHA 4PK4A 1MMNA 2NOJB 4BJ5C 3EUAA 5HLTA 4BQQA 3DPLC 4N4NB 4XLAA 2V1NA 2F5VA 4BJ6C 2JA2A 3PJRA 3V42A 4BXFA 4XLCA 1PYVA 4Y33A 3RPUD 2KQRA 2M0MA 3MD2A 1DGWY 3DTKA 4MLOA 3H0DA 3OWTA 3OS2A 1WJFA 4B48A 1MNDA 2Z16A 4YELA 1BOBA 2ELJA 2W1OA 3QYEA 4XN0A 4CCKA 4HRIA 4ZJZA 2Q1ZB 4KISA 3BCAA 3LMMA 3M1CA 4AYBA 2R7OA 1IRXA 3FKJA 2WAEA 4HEA2 3W2WA 2VPLA 2DOAA 5CQGA 4G6TB 2VQGA 3BG6A 1Y56A 4LIVA 3OYJA 1D0YA 2M3AA 3IP4B 1Z3YA 3AL0B 2FUG2 2BW3A 3K4MA 4ZDOA 2IXSA 3DU6A 2LYCA 2LY1A 4KITB 5LFAA 1X19A 3G2BA 4DBRA 4E4HA 4LITA 3BLYA 1EA3A 4JQFA 2LOOA 3QODA 4ZDPA 1TT0A 3CP2A 2VXZA 1OLTA 3LSGA 3DPUA 2R4GA 2CUJA 4XLFA 3HC7A 2CW8A 3CZ6A 2X1DA 3OYGA 1WJEA 4ITVA 2MABA 4CCMA 2BW3B 3RCOA 4U7BA 2HPMA 3OYMA 2X1CA 2X6XA 3NWSA 4XOPA 4BACA 3I9V2 1GLNA 4XKWA 2JVHA 1BR1A 1V5FA 4C30A 2L5QA 3A1YA 2UV1A 4ZTFA 4ZTJA 3CJQB 2R7QA 4NC8A 3TBIA 2IS6A 2R7RA 2K3PA 4II2A 3OYHA 4IQ4A 5CKTA 4C2UA 4E6KG 4BEHA 2JVGA 4R79A 3OYEA 4BS9A 3VWBA 2KL4A 2ZSHB 2XC7A 4QPQA 2HPIA 3VYTB 4XL9A 4RM3A 3PUBA 1S9HA 4X0GA 1TZLA 2BVLA 3DKXA 4LIUA 3IUOA 1BR4A 3SYTA 4JOMA 1LDKB 3OIQA 4DJAA 4F91B 1SFKA 5JHFA 2W4SA 2VL8A 3UR3C 4BE2A 2LBFB 1YX5A 3UNGC 2IGMA 4C9YA 1UELB 2KRHA 2E60A 4F55A 2R7XA 3CF2A 2BVMA 3K4JA 3K4KA 2HNHA 3I3LA 1WJDA 3ZCOA 4AVZA 4F3QA 2P0WA 4H4KC 3W2AA 2L2OA 3E0JB 3C2GA 3D5RC 4B47A 4BE1A 3PFYA 2WY7Q 3OS0A 1MMGA 2UUZA 1MMAA 2PMZA 3TMOA 3N05A 3OR1C 2A6TA 3RQ4A 2R7WA 1R6RA 4IQJA 3OYKA 5KCMA 3EUHC 2ZSIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZSH B;  2ZSI B; 
#chains in the Genus database with same CATH topology
 3RYP A;  3A2K A;  4G6D A;  3R61 A;  3OR2 C;  2D1V A;  1RET A;  2F4M B;  4Y4R A;  4AID A;  2COB A;  4RLQ A;  1A6I A;  1QZZ A;  2DQL A;  5EEA A;  1RUN A;  2P7V B;  1BBY A;  2P6S A;  1STZ A;  3GLX A;  2R7F A;  3HL2 A;  5L3E A;  3JRH A;  3L2Q A;  1K78 A;  3GTM J;  2UWM A;  2Z3Y A;  2GM4 A;  2NOG A;  1XDU A;  2OC6 A;  4IHT A;  1WVR A;  1XD7 A;  5GPC A;  5E3L A;  5IT9 K;  4PJL A;  2FU4 A;  3F6V A;  3SFI A;  2E1N A;  4EMS A;  1K79 A;  3EET A;  4LG3 A;  2GXB A;  1W0T A;  2IS2 A;  5IP7 J;  4CDG A;  5GAD J;  1USS A;  4S05 A;  2KP6 A;  4HNT A;  2MD0 A;  3H9Q A;  2R93 J;  1BN5 A;  2H27 A;  1I5Z A;  1RIO H;  5EG0 A;  2OA4 A;  1Y0U A;  2XGC A;  2VE9 A;  9ANT A;  3S1N J;  1VQN I;  2DW4 A;  3HSR A;  2HQA A;  5TIS C;  4X1E A;  1LVA A;  1X1D A;  3M8F A;  2QQ9 A;  2HVQ A;  4MEY F;  3HRU A;  1JUS A;  2V1X A;  1FLI A;  5FD5 A;  2PJR A;  3HOU J;  2TRT A;  1AKH B;  3C7J A;  3HOT A;  3LSH A;  3GTJ J;  3HUG A;  2LD5 A;  3PQJ A;  3DF8 A;  3LSI A;  3WTZ A;  4AUX A;  3S3O A;  3DBL B;  3KEY A;  2DMU A;  4RAF A;  2DBB A;  2K9N A;  1Y8Q B;  4E7J A;  2R7U A;  5GTI C;  2I8D A;  3TKY A;  4ESB A;  1Z7L A;  1YRN A;  4HNV A;  1K6Y A;  4L5J A;  2RQQ A;  3OL3 A;  1LUJ B;  3GTK J;  3BTJ A;  2ELH A;  2H6C A;  4PSX A;  1UHW A;  2X6Y A;  2VOP A;  1MBE A;  1KYW A;  4HV6 A;  1ZRF A;  4G6Q A;  2JZY A;  5F1R A;  3K69 A;  1MSF C;  2CU7 A;  1CF7 B;  2K4J A;  4OIR F;  2HKX A;  3FKI J;  3CCQ I;  1B9N A;  3VDX A;  3HPG A;  4FT8 A;  3UKG A;  5IOZ A;  3TP0 A;  3AFH A;  2IGN A;  5FLX Z;  2DA7 A;  4G8X A;  5H20 A;  2ZB9 A;  3WU2 C;  1QVT A;  2O5R A;  2KKO A;  1VZ0 A;  3KIO A;  5JVT A;  2A69 F;  4A3I J;  4AIK A;  1S5L C;  1MJA A;  4XLN F;  4D5F A;  3LL7 A;  1ONV A;  1P4A A;  5JFR A;  1WSU A;  2V7F A;  1LFU P;  2JA5 J;  3KPH A;  5ILV A;  1JKP C;  3O6B B;  3H3Z A;  4DZP A;  4WF2 A;  5EGO A;  2WAF A;  5HDN A;  4RM2 A;  2E1M C;  5DM6 F;  4BHP A;  1LFP A;  3WTV C;  1K61 A;  1SFE A;  3DBR B;  2L7K A;  5J47 A;  4O3M A;  2DMQ A;  3DLA A;  1FTT A;  3GLL A;  3BJO A;  4PJN A;  3RPQ A;  2M0C A;  5F1J A;  4YG2 F;  3H5R A;  3U1D A;  1B72 A;  2L54 A;  1I3Q J;  3OSG A;  3I59 B;  1ZLK A;  4YEJ A;  2XRN A;  2GA1 A;  1FBS A;  2XAU A;  3U21 A;  1TC3 C;  1FOK A;  3E7L A;  3ASN H;  1FBQ A;  3IRR A;  2EIN H;  2E7X A;  5DTD A;  1W5C C;  1G6N A;  2X9D A;  4HST A;  1W36 C;  3OIP A;  2FML A;  4KNY A;  2K9S A;  3HSF A;  2JT1 A;  2ADU A;  4JX6 A;  1XGM A;  1T0F C;  2ZXJ A;  2KDZ A;  3KYC B;  2VBY A;  1VFC A;  2IPQ X;  2WAD A;  3JRA A;  1TWF J;  3KZZ A;  2Z1D A;  4CZC A;  4ABZ A;  3ZN1 A;  2ETH A;  2M34 A;  4XLP F;  1R5G A;  2VC0 A;  2M8E A;  1LKX A;  1V5E A;  3ABL H;  3WE3 A;  2M2E A;  5B3S H;  4MO7 A;  4F93 B;  5K7H A;  2XF7 A;  1IXR C;  4C3J J;  2DMT A;  4XQF A;  1YS7 A;  4UB6 C;  2KIM A;  5ILU A;  1BC8 C;  3JR9 A;  3QOE A;  1VI0 A;  2DDA A;  5CYV A;  4M6Y A;  3PNV A;  4DNC A;  1DUX C;  1SVL A;  4HF1 A;  3VYR B;  4N4O B;  2VN2 A;  5F64 A;  2IJL A;  2W48 A;  1K78 B;  2RDP A;  5TGT A;  2VQC A;  1BA5 A;  2X6O A;  4I76 A;  3OS1 A;  2BV6 A;  3R4K A;  4Z6Y A;  2P5K A;  5FJ8 J;  3C2H A;  4IHY A;  2ICW G;  1A6Q A;  4FE7 A;  5D8K B;  1X2N A;  3T1B A;  3SEQ A;  2BYV E;  3PFI A;  3KP6 A;  4ZC3 A;  3WG9 A;  4B3A A;  4MTE A;  1XCB A;  2OD5 A;  5EG0 B;  1TTY A;  3GFI A;  4HNU A;  1VQM I;  1K83 J;  2MW8 A;  1ZH5 A;  4ZYH A;  1E0E A;  2IA2 A;  2ID6 A;  3FIS A;  3PNY A;  3W3C A;  4XBF A;  4RB3 C;  3IWF A;  4HYE A;  3SFZ A;  4QIW N;  2PJR B;  1E3O C;  3SEZ A;  4Q5S F;  3GTO J;  2RVC A;  2CWE A;  3FBI B;  1W36 D;  2VKE A;  4K2E A;  3W6V A;  3ONQ A;  4ESF A;  1ETX A;  3HUG B;  4D1Q A;  1SFX A;  3PIO F;  1W7P D;  5FRO A;  5E79 C;  3M3Y J;  1SD7 A;  2G7H A;  4RB2 C;  2JQ7 A;  2VON A;  1FP2 A;  2QLZ A;  3E6M A;  1GVD A;  4WXC A;  5L3F A;  4HLY A;  1SD6 A;  1Y1V J;  5BNG A;  4DYC A;  2QBY A;  4RAZ A;  1YRN B;  4IHW A;  5HVQ C;  3LNQ A;  4PCQ A;  2KIQ A;  4XKB A;  3GFM A;  2W24 A;  4YFN F;  5IP6 A;  3CCM I;  3S17 J;  2ESH A;  4EJT A;  3BR5 A;  4L5I A;  2Y0S A;  2V9V A;  2EB7 A;  5FFX A;  4G12 A;  2OV7 A;  3HRT A;  3A4C A;  3ZGK A;  3LSK A;  2HWV A;  2XAQ A;  3ECH A;  2L9R A;  2JPB A;  3OSF A;  3O8H A;  4P9F A;  4OWR B;  5J1Y A;  3L00 A;  2NRA C;  5F08 A;  1AU7 A;  4E7S A;  2LNB A;  1JE8 A;  2F2E A;  1XG1 A;  2EPF A;  4I7H A;  2EIM H;  1ZK8 A;  3F9K A;  2JPC A;  2CQQ A;  1OKR A;  2JTV A;  3T8T A;  1Y6I A;  4O5V A;  3CCL I;  1YI2 I;  1XGS A;  3MWM A;  1QO0 D;  1I27 A;  2V9K A;  3R60 A;  1U8B A;  2OTL I;  3S8P A;  4CYD A;  5E1X A;  1YJW I;  5EGO B;  2TCT A;  2ZKZ A;  1DGR M;  3SZP A;  1T39 A;  1J75 A;  5BOX A;  4RGU A;  3GTG J;  4UUT A;  3I56 I;  2CMP A;  3EPZ A;  1RPW A;  1HKQ A;  1Z67 A;  1T38 A;  2LK2 A;  2CV0 A;  3ZXS A;  1HF0 A;  1B72 B;  3IH2 A;  1IZ1 A;  5CVU A;  1A35 A;  2XV4 S;  5B5E C;  2XRO A;  2RNG A;  4L0Z B;  2OF7 A;  3OYD A;  1UG0 A;  2DK5 A;  2EJR A;  1S7O A;  2IS1 A;  4BQO A;  4HQM A;  4V2G A;  4EJV A;  1WJC A;  4OIO F;  3W6J B;  2VIX A;  1U8R A;  4HAM A;  3F8F A;  5FB2 A;  3TW7 A;  4M3B A;  3C3W A;  1N77 A;  1TQP A;  4A3L J;  2XPW A;  2FBK A;  5JI6 A;  1S8N A;  2M4K A;  5D5V B;  1MMN A;  3AG2 H;  2QSG X;  4ENM A;  3O3K A;  3EUA A;  3LOC A;  5KVR A;  3DPL C;  1ETK A;  2H1K A;  3B02 A;  1ETO A;  4Y33 A;  2AO9 A;  1VQ5 I;  2P7C B;  2P5V A;  5BQT A;  3CDH A;  2DO7 A;  4KFC A;  1DGW Y;  4L9J A;  3H0D A;  4GDF A;  4LB6 B;  3BG5 A;  5IT3 A;  2PBI A;  4RA2 A;  5IYD J;  3TED A;  1G4D A;  2O7O A;  1BOB A;  3J80 K;  1MNM C;  3IKT A;  3BCA A;  3M1C A;  4AYB A;  4UV9 A;  5FKO A;  4U7D A;  3WU1 B;  2JA6 J;  5BMZ A;  4G6T B;  2VQG A;  3QPH A;  2UXX A;  5HS7 A;  2NS8 A;  3AL0 B;  5LFA A;  2LYC A;  3H3V K;  3V4G A;  1IJW C;  1FX7 A;  3LA7 A;  4E4H A;  1AWC A;  4MFE A;  4JQF A;  3QOD A;  4IEJ A;  3G73 A;  3GCM A;  1RRJ A;  2XB5 A;  1WWX A;  3MZY A;  3GME A;  1OLT A;  1MBJ A;  1DPU A;  3LSG A;  2R4G A;  3S14 J;  3CCJ I;  3GYH X;  2GWR A;  2CW8 A;  3HZJ A;  2HQ5 A;  2DAO A;  1Z9C A;  1MH4 A;  3IL2 A;  5M3M J;  4LMY A;  4S0H B;  2YS9 A;  3RCO A;  3OYM A;  2X1C A;  2X6X A;  2QGU A;  3NWS A;  4XOP A;  4BAC A;  1NH3 A;  2O8K A;  1MMS A;  3I9V 2;  1GLN A;  4MGR A;  5GP9 A;  4XRS G;  1U9O A;  2HDD A;  3K1M A;  1FY7 A;  4A3B J;  2PI0 A;  4A0Z A;  4KDP A;  2YR2 A;  1LE8 A;  1DP7 P;  1ETQ A;  1X3U A;  3M07 A;  5DDG A;  2L0K A;  3MAJ A;  4EEF G;  4C2U A;  4V19 K;  5D8L B;  4Y7N J;  4M3D A;  4BS9 A;  1SMY F;  2A61 A;  2QBY B;  2XKP A;  2HEO A;  2ZSH B;  5F6F A;  3B6C A;  4HF0 A;  2HPI A;  4QPQ A;  4XL9 A;  1HKS A;  1L3L A;  1A04 A;  2CQX A;  4OIP F;  2ZXW H;  2JRT A;  2HTS A;  1HST A;  1F43 A;  2NVU B;  3IKV A;  4L9T A;  3TGN A;  1LDK B;  3BG3 A;  4F91 B;  1T33 A;  5JHF A;  2W4S A;  1RC9 A;  3E6D A;  4BE2 A;  4P9U A;  2E2J J;  1YX5 A;  2IGM A;  2Y48 A;  3BQZ A;  1UEL B;  2H6B A;  4EVI A;  2O61 A;  4F55 A;  4A3D J;  4CO8 A;  4G7O F;  2ZBK A;  2IEK A;  3J7A O;  2HNH A;  2COM A;  3J81 K;  2L2O A;  1HDD C;  2WTE A;  2QQA A;  1IRG A;  2A68 F;  1T0F A;  1W7P A;  2E35 A;  3T8R A;  1POG A;  1S7E A;  4LK0 F;  1Z05 A;  1A5J A;  3I53 A;  1LFB A;  1PUF B;  1IGN A;  2E71 A;  2B0L A;  2AS5 F;  2P4W A;  3GO5 A;  1PVE A;  3SHF A;  3TMO A;  2QYO A;  2VOO A;  1GXQ A;  1NTC A;  2GA2 A;  2R7W A;  2EZH A;  2DTR A;  3CCY A;  2YU9 J;  4IQJ A;  2VI6 A;  1WGX A;  1I39 A;  3GF2 A;  5F0H A;  1FTZ A;  2WV0 A;  2X48 A;  5HS9 A;  4A3E J;  3H35 A;  4NDL A;  5F0C A;  3HOX J;  3LA3 A;  1IC8 A;  5JR3 A;  3RKW A;  3EYY A;  2O6G E;  2PX9 A;  3PNT A;  2ZO4 A;  1TWG J;  3FDY A;  1VQ4 I;  3CJR B;  4PGH A;  4FAS D;  2CG4 A;  4J00 A;  2A6E F;  5FRM A;  1LVK A;  3LFU A;  4GRI A;  5L3G A;  3KET A;  4Y3O A;  1WJ5 A;  2N8G A;  4ZYE A;  1W5T A;  4CH7 A;  5HS8 A;  4IL6 C;  4OU0 A;  5DYM A;  1O4X A;  1AKH A;  4CIC A;  3RZD J;  3KX2 A;  1AHD P;  3MCZ A;  1I3A A;  2V6C A;  1UAA A;  1QZY A;  1WCM J;  1Y8R B;  2E19 A;  2EZL A;  4IF4 A;  4V2F A;  4L0Y B;  3Q0W A;  1IDZ A;  2DT7 B;  2QUF A;  1V54 H;  1WQ2 A;  4CHU A;  3AL0 C;  1J09 A;  4BL0 B;  5TRD A;  5JHU A;  2DFE A;  4CSW A;  4HDU A;  1P7J A;  3ABT A;  1RI7 A;  2K9L A;  2XAG A;  3L09 A;  2A07 F;  1S29 A;  4IVN A;  1ZYR F;  4W1U A;  2FNP A;  3MN2 A;  4OAY A;  3OYB A;  4M3F A;  1XGN A;  1ZR4 A;  2YSR A;  4UXN A;  2DJN A;  4ENK A;  2HDW A;  1OCR H;  1BIA A;  4D0P A;  1CF7 A;  3HHG A;  2FNA A;  2HYG D;  2X0L A;  5CVJ A;  5K1Y A;  2MG4 A;  3GZN B;  4IXA A;  4A3C J;  1RZ4 A;  4IRG A;  2HKO A;  2K3F A;  3BR6 A;  4LJZ F;  4F7Z A;  1O3R A;  4IRI A;  2OCC H;  2LDU A;  3LSR A;  2ZJ2 A;  2M87 A;  2ZXI A;  4A5N A;  1VQ9 I;  2DFF A;  1SAU A;  3S32 A;  3J81 Z;  3VSL A;  3RJP A;  1Z6T A;  2H1L A;  4BAY A;  2DT6 A;  1REP C;  5GTH C;  3A01 A;  2HOT A;  5E8I A;  1P7I A;  3A03 A;  5B1B H;  1LEA A;  1G59 A;  2AQF A;  1JT6 A;  4F52 A;  1VQ7 I;  5HNH A;  1UHM A;  5HDK A;  2XPU A;  3QU6 A;  1LE8 B;  5EYR A;  2IT0 A;  3NRV A;  5HLG A;  3RZO J;  1D5Y A;  5DCF A;  2F5D A;  3NWT A;  2ZFW A;  2W00 A;  1IW7 F;  2F5E A;  3DCF A;  2Z99 A;  2MBF A;  4JK1 X;  5LEJ A;  4ZDL A;  4UNO A;  1PP7 U;  2FD5 A;  2PG4 A;  5LBQ A;  2E1M B;  1D1C A;  2XDV A;  1OYI A;  3IAS 2;  4B1R A;  4AYB N;  2BOL A;  3WTT C;  1X4P A;  3BC8 A;  3F22 A;  3OOU A;  4UY8 I;  4PGG A;  1D1B A;  1VQK I;  4DW6 A;  1MD0 A;  5AIP A;  2PQ8 A;  2KJB A;  1BI0 A;  2XHK A;  4KN4 X;  1UZC A;  3H3U A;  2LY2 A;  2RV8 A;  1XDS A;  4FX4 A;  1FNN A;  1W7P B;  3QPS A;  3HXL A;  2X1E A;  3CLQ A;  3K4N A;  3PO2 J;  1MZB A;  2DCE A;  1JI8 A;  1B6A A;  2VB6 A;  4BQN A;  4PJJ A;  4DBQ A;  3HEF A;  1J59 A;  1BC7 C;  3ABK H;  5C4J J;  1OYY A;  3CTA A;  2R7T A;  4WWC A;  5BPI A;  1ZEL A;  1Y0N A;  1JHF A;  3CF5 F;  2RRE A;  4KJZ A;  4LLG F;  1JUM A;  4QTR A;  1M1E B;  4CCN A;  2ZJQ F;  5M5W J;  1HSJ A;  6PAX A;  1CGP A;  3FXM A;  1KON A;  2XF5 A;  2VKV A;  2ISY A;  1TW2 A;  2DA4 A;  3H92 A;  5E1Z B;  3S93 A;  3S1R J;  4ZYG A;  2EFO A;  3C1D A;  4MFD A;  2STW A;  2CSO A;  4TV7 A;  2YPR A;  1R71 A;  2IS4 A;  2M45 A;  1EKE A;  2FJ1 A;  2P8T A;  3OY9 A;  2CFX A;  3DEU A;  3ZQG A;  4EGZ A;  4FET A;  1QPM A;  4RB1 A;  5KNL A;  2XAJ A;  4HF2 A;  2PFB A;  2KZV A;  2DJI A;  2XKO A;  4U87 A;  1YIJ I;  2DXI A;  5FRN A;  3QYF A;  1SFU A;  1DU0 A;  4XR6 A;  4II3 A;  3CD6 I;  2HXI A;  3K10 A;  4HG2 A;  3LA2 A;  2L7F P;  4OIQ F;  2LFB A;  2M7A A;  5IYC J;  3HG9 A;  1DPR A;  5IP9 J;  3WTW C;  4E7K A;  1ZR2 A;  3MQ0 A;  4E70 A;  3MKW B;  1X2M A;  3BR3 A;  5HOO A;  2K27 A;  2KRC A;  1Q1V A;  4CCO A;  3N97 A;  4P5O A;  5J8F A;  1SEU A;  1TWC J;  3S1Q J;  2EZK A;  2J5P A;  2V26 A;  1QHG A;  2BY3 A;  1QZE A;  1UHS A;  4XLH A;  3BPV A;  2KDO A;  3D1N I;  4I2O A;  2Z2S B;  3PL8 A;  1BL0 A;  5J1U A;  2JSP A;  3DEE A;  1HBX G;  2DU9 A;  3JSO A;  2OU2 A;  1B9M A;  1BIB A;  3FM5 A;  1XSX A;  4XK4 A;  1B59 A;  3QU3 A;  1ERD A;  4KIB A;  1VND A;  3ERE D;  3G1O A;  2OQR A;  3OIO A;  3CC2 I;  4M71 A;  1WJA A;  2JUG A;  1KZH A;  4MNU A;  3VOD A;  3A01 B;  3HIF A;  3VYU B;  3FXO A;  4UUS B;  3ESW B;  3DLL F;  2HDC A;  3G3Z A;  4FTH A;  3H9G A;  3P7N A;  1MBK A;  3DEW A;  3PIP F;  2LC2 A;  1KQ9 A;  2VQL A;  1JJ6 C;  1R36 A;  1TWA J;  2DTZ A;  2GBY A;  5E20 A;  5B1A H;  3CMA I;  3JW4 A;  4YII A;  4C2T A;  2DA2 A;  4HQE A;  3WTX C;  2IA0 A;  2DYR H;  3GFJ A;  5IT9 Z;  3S3M A;  3D5L A;  3ZMS A;  3K2Z A;  3MZ8 A;  1G3S A;  3REO A;  5EDN A;  2VJI A;  4BY1 J;  1FC3 A;  1ULY A;  3QOP A;  1FYM A;  1XN7 A;  2FOW A;  2EIJ H;  5IYB J;  4B43 A;  2V6E A;  3B73 A;  3FXU A;  2JJ7 A;  1TP4 A;  3S16 J;  3ERM A;  3N4M A;  2Y75 A;  4RGX A;  1XMK A;  4KT6 A;  1IXS B;  2R7Z J;  1OMI A;  2ELK A;  2R0Q C;  2F6C A;  5ILS A;  3G4S I;  3VSK A;  2CV1 A;  5J1R A;  1X4O A;  4PFO A;  3JRD A;  2FE3 A;  4DGW B;  1D8J A;  1Y39 A;  2MC4 A;  1E2X A;  2WB1 A;  3CC4 I;  3MFK A;  3TL4 X;  1EJ9 A;  1P92 A;  2GQQ A;  4EM0 B;  4LFU A;  4B09 A;  4F92 B;  4ZYD A;  2VKH A;  3GTP J;  1Z77 A;  4BJ5 C;  3LST A;  1MGT A;  3BJA A;  2HGC A;  1YTY A;  3S2H J;  4RS8 A;  2F5V A;  2D2W A;  5C3E J;  1O7L A;  1PYV A;  3GWZ A;  3ZMD A;  3CLO A;  5ED4 A;  2EFN A;  2F4O B;  3ML6 A;  2M0M A;  1FZP B;  3MD2 A;  2HQR A;  3PQK A;  1H0M A;  1FT9 A;  4KN7 X;  3HDD A;  3SXY A;  3VB2 A;  1IAW A;  1EH6 A;  4EQQ A;  1Y1W J;  5DCM A;  3BZK A;  4YEL A;  4P55 A;  3KLO A;  3QYE A;  4CCK A;  5K5R A;  3I0T A;  1XGO A;  2NVT J;  3JRI A;  3W2W A;  2PEX A;  4HEA 2;  2DOA A;  4JYK A;  3BG6 A;  4JP0 A;  2M3A A;  2ME6 A;  1Z3Y A;  1FPQ A;  1ETV A;  3AG3 H;  2OTJ I;  3K4M A;  4ZDO A;  2MH2 A;  2IXS A;  1W4M A;  5IPA A;  4G9Y A;  2EFW A;  2JWT A;  1J0R A;  5A2Q K;  1IRF A;  1TQI A;  5D5U B;  4IOA F;  2MLK A;  3CCU I;  2CUJ A;  4XLF A;  3HC7 A;  4I09 A;  2X1D A;  2GIV A;  2NS0 A;  2O03 A;  2YX7 A;  1HQC A;  2HXO A;  5K5Q A;  2OPT A;  3HBL A;  2XGE A;  3V7S A;  1IN6 A;  4U7B A;  2HPM A;  2EV5 A;  5L3C A;  3I4N J;  4H0E A;  1BR1 A;  1V5F A;  3HM5 A;  4CGZ A;  2VUM J;  4CXF A;  1XMX A;  1XB4 A;  3TOA A;  4FHT A;  4M9S A;  4D7N A;  1BI2 A;  2UV1 A;  4ZTF A;  2Y0M A;  1WI3 A;  2R7Q A;  2PN6 A;  2RGV A;  3ELK A;  2XVC A;  3F3X A;  1YG2 A;  3KZY A;  2R7R A;  1JTY A;  2K3P A;  4II2 A;  3SJM A;  4KIF A;  3OYH A;  5L3D A;  2BBY A;  3RPU A;  3WG7 H;  1SAX A;  2CYY A;  3F0C A;  3R6S A;  5JLX A;  1AOY A;  1V4R A;  3S2D J;  3NAR A;  2XC7 A;  3K1N A;  3VYT B;  4A5M A;  2NVY J;  5FKK A;  3L2C A;  1QQI A;  3GTL J;  2I5U A;  4LIU A;  3DKX A;  3IUO A;  1ZRC A;  3CJN A;  1N25 A;  4JOM A;  4M74 A;  2NYX A;  2C6Y A;  3CQZ J;  3I71 A;  4DJA A;  2WC2 A;  1SFK A;  4AM3 A;  1ZHF A;  3UR3 C;  1LPQ A;  4GCV A;  4A6E A;  3GVA A;  4A12 A;  1V3F A;  3Q5F A;  1XSD A;  1PUF A;  1QPI A;  1G2H A;  3BZ6 A;  3JRC A;  4BNC A;  2G9W A;  4C9Y A;  4IOC F;  3O2P E;  1UCR A;  2E60 A;  5LHG A;  1MDM A;  2R7X A;  3CF2 A;  3FIW A;  3BP8 A;  5LHH A;  3JRF A;  4BHB A;  1OIS A;  3WTU C;  3K9T A;  4FQG A;  4XRF A;  4AVZ A;  4XIC A;  1ZLJ A;  1JHH A;  5DUK A;  4F3Q A;  2F5F A;  1FIP A;  4B47 A;  3A0H C;  2NXN B;  5FFZ A;  2WY7 Q;  3BZC A;  2R92 J;  2PJP A;  2UUZ A;  2BY0 A;  3S1M J;  1XC5 A;  1GUU A;  2PMZ A;  3JRE A;  1YYV A;  3OR1 C;  5DEQ A;  1FSH A;  2A6T A;  3HYI A;  4QWQ A;  3RQ4 A;  5K7F A;  5JLW A;  1R6R A;  3WTS C;  1H89 C;  3KEO A;  4DQ2 A;  1PUE E;  3EUH C;  2ZSI B;  1AA7 A;  4Y17 A;  1BJA A;  1KQ8 A;  2M9H A;  3M4O J;  3VYS B;  3ZMU A;  2M8G X;  2Z33 A;  3H5N A;  2XF6 A;  2EIK H;  1HXD A;  2KZG A;  3E1S A;  1IN7 A;  4P1W A;  1VQO I;  3IH4 A;  2LF8 A;  3W6K B;  4BYY A;  1C0W A;  4J19 A;  1BW6 A;  1YX3 A;  3RKX A;  2X4H A;  4DOZ A;  2KIS A;  2HS5 A;  2F4I A;  4M72 A;  2Y9Z A;  2VBW A;  5K7Z A;  1T08 B;  1T8I A;  3OYA A;  3P9K A;  2Y9Y A;  5EZG A;  3PM1 A;  1JUP A;  2Y2Z A;  1IN8 A;  2DMN A;  1LNW A;  1WZ2 A;  4M3G A;  5H6Q A;  3TOB A;  3LSJ A;  1ZAO A;  2JA7 J;  3KFW X;  3RIR A;  2K9M A;  1QBJ A;  5IY5 H;  3R0J A;  5GAH J;  5DCM B;  4LK1 F;  3CP8 A;  4B44 A;  2FOK A;  3LWF A;  3L2R A;  1YE9 A;  4NQW B;  2K86 A;  1WI9 A;  3LQR A;  4EJW A;  1E17 A;  3CO6 C;  2B9S A;  5D6F A;  5F04 A;  1R00 A;  2Q0O A;  5LEK A;  3K4B A;  4M6X A;  3M8J A;  1CQT A;  3C18 A;  3G71 I;  1BJZ A;  4FE4 A;  1SVO A;  2HFH A;  2H8R A;  4R1H A;  3RYR A;  2BY2 A;  2OZU A;  3CES A;  3EDP A;  1SMT A;  3U1K A;  3CME I;  4AD9 A;  2H09 A;  2L9N A;  3I64 A;  2MYS A;  5AIQ A;  1N78 A;  5J4V A;  2HOE A;  1ORK A;  2YU3 A;  2X85 A;  4BDY A;  2CFO A;  3HTS B;  4XN3 A;  2E5Z A;  3K2A A;  3K1P A;  3WGH A;  1EV7 A;  2Z9O A;  2MGQ A;  1S72 I;  3ECO A;  3F8M A;  3FBN B;  4NC6 A;  1YS6 A;  2NS7 A;  4PUS A;  3ASO H;  1WFX A;  1HC8 A;  1HCR A;  5ICC A;  1Z1D A;  1OCC H;  3OMY A;  4N9I A;  2V1D A;  2AXT C;  5LGT A;  3FXL A;  1HW2 A;  5IOY A;  4MHG A;  3ZRG A;  1JXS A;  3K70 C;  3BRO A;  4BJT A;  4A0Y A;  1JT0 A;  4BH9 A;  1QVU A;  2XRL A;  4DYQ A;  4BXX J;  1R4N B;  3K4L A;  3ZQL A;  3M8E A;  2B63 J;  5J4Y A;  1ZGJ A;  3HRM A;  1QRY A;  1S7A A;  1X1C A;  4AVP A;  4Y15 A;  1DU6 A;  3DPT A;  2VLA A;  2GLO A;  3KP5 A;  4RAG A;  1NK3 P;  2QSH X;  2VBZ A;  4HOB A;  2LKS A;  1U0J A;  3BCB A;  3GX4 X;  4U0Y A;  3M9A A;  2P5L C;  4IRH A;  3VPR A;  5CVR A;  2O9L A;  1R58 A;  2F48 A;  3OV8 A;  2XIG A;  3GEZ A;  2QKL B;  2XSJ C;  3QP6 A;  1TQM A;  2PMH A;  1FMW A;  1ACI A;  5LLQ A;  3PSF A;  3CJT B;  1BI3 A;  4YRV A;  3J80 Z;  1RR7 A;  2QKM B;  1HOM A;  1H9G A;  1FEX A;  4GGG A;  1MDM B;  1TWH J;  4U88 A;  3DWL E;  2QCO A;  1LJ9 A;  1BR2 A;  2EFP A;  5CPR B;  3VFZ A;  2CQN A;  4DIQ A;  2P81 A;  2V9P A;  3ZQQ A;  2V1U A;  3BY6 A;  3JAM K;  1QHH D;  2R5Z A;  4I6Z A;  4Y13 A;  1VQ6 I;  2HI3 A;  2IGO A;  3F21 A;  3BDD A;  3HB9 A;  2IAI A;  5E1W A;  1R4M B;  1P4W A;  1X3W B;  1B4A A;  1W1W E;  3KP7 A;  4XLE A;  4BXU A;  1HW1 A;  4KUM A;  3SQN A;  4MTD A;  4IKF A;  1RNL A;  3RTR A;  4KIC A;  4O6J A;  2GIZ A;  3K4C A;  2DPD A;  2VJ5 A;  3E5U A;  4KIG A;  4PSW A;  4XMY A;  2Y0S N;  3K70 D;  1I6X A;  2EV6 A;  4N0B A;  2IGK A;  2OUM A;  5KAF C;  5HDG A;  4E7H A;  2D1H A;  3HRS A;  1YW9 A;  4IJA A;  4XSZ F;  2OCE A;  2VJ4 A;  2MSY A;  2L4A A;  2FRH A;  1WKM A;  1TT5 B;  1ZRE A;  3HKZ A;  2FF4 A;  2KIF A;  3ZMT A;  3L1P A;  2L4M A;  5EEG A;  3H36 A;  4UUV A;  2CRG A;  3FM3 A;  2EZI A;  3CDI A;  3DU5 A;  3OL4 A;  2W82 A;  2Z5U A;  2RQP A;  2KHM A;  4CUG A;  3L9F A;  1LEB A;  5EJC A;  3L2V A;  3RKY A;  4GYI A;  3I55 I;  4AC0 A;  3IAM 2;  3PUF A;  2ME0 A;  4XON A;  1N75 A;  2XAS A;  2J5O A;  4ZYA A;  5J6X A;  2AQE A;  2CW0 F;  3WHC A;  4CCJ A;  3SZG A;  4CZZ A;  1I1G A;  1R7J A;  3EUK L;  2RAE A;  2CV2 A;  2JSC A;  4GYG A;  3S2W A;  1F1Z A;  1IV8 A;  3J7Z I;  1OCT C;  3HPH A;  4Q4Z F;  3NEU A;  4EJU A;  2ZXH A;  1K6O A;  2F5C A;  1MW7 A;  1JKR C;  1L0O C;  1V5G A;  1B8I A;  3KP2 A;  4IX7 A;  2QWW A;  2Y31 A;  3ZN0 A;  3F8N A;  3QPT A;  1ZG5 A;  4ENN A;  1SFO J;  4IPA A;  4A3M J;  2PMZ N;  2L3D A;  5H2F C;  5TJJ A;  2DQR A;  1RES A;  4Z2Y A;  2O0Y A;  1Z3X A;  4KYW A;  5HNF A;  4LB5 A;  1D1A A;  4XNF A;  2DDB A;  2JRM A;  3BR1 A;  4UUS A;  3DBH B;  1ENH A;  2L7M P;  4ASN A;  2RNJ A;  1JKO C;  1SD5 A;  1Z6R A;  3V8L A;  1R1V A;  5M5X J;  1U78 A;  1DQU A;  3HOY J;  2GAU A;  3DKY A;  1QGP A;  4ENJ A;  2EA4 A;  3DXJ F;  3WGG A;  5LGU A;  4XKC A;  4BDZ A;  1XX5 A;  2HU9 A;  2HQN A;  2MFZ A;  1O3S A;  2LBF A;  2OQG A;  3VEP A;  2BEO A;  2FBI A;  2X6W A;  4E7I A;  2AXL A;  4HDV A;  1NHA A;  2BHY A;  3OOP A;  2VQH A;  3COA C;  1ZG3 A;  4HLX A;  3KYL A;  3RI4 A;  3CCV I;  2LMD A;  3SDB A;  2K5C A;  4MEX F;  4IZZ A;  1VTN C;  3MVP A;  1G8X A;  1R22 A;  4CCL A;  4BKX A;  2JMW A;  3LQQ A;  2R3S A;  3DTE A;  1IRZ A;  1WJB A;  1SVM A;  1JTX A;  2CJJ A;  2E7W A;  4WX9 A;  1VQ8 I;  4BGD A;  3EUH A;  3HOW J;  1ZG1 A;  3HSE A;  3U2R A;  3IV5 A;  3FF5 A;  2P6T A;  1HA8 A;  2WBM A;  2VC1 A;  1U9N A;  4IO9 F;  3L2W A;  4G7Z F;  2FBH A;  3H1C A;  2QF7 A;  3E6B A;  3JCU C;  4M73 A;  4OMZ A;  4WXD A;  4GO1 A;  2DA6 A;  1FMV A;  3F23 A;  1JGG A;  2E2I J;  2OBP A;  2M30 A;  1R49 A;  2EV0 A;  1F5T A;  3PO3 J;  4X6A J;  2ZNZ A;  2IBD A;  2UZK A;  1XS9 A;  2ZME A;  3LAP A;  2CUF A;  1GV5 A;  1X1B A;  2KPM A;  3T0Y A;  5ICE A;  1YJN I;  1MNE A;  2ECB A;  1U5T A;  2A5W A;  3I4P A;  4OAZ A;  4D5C A;  3QQA A;  5KHD A;  4G94 A;  2R5Z B;  4ETS A;  2BZT A;  2EWN A;  4BQQ A;  4XLA A;  4N4N B;  1RR8 C;  2VOD A;  3ZQC A;  2V1N A;  2A6H F;  2XGX A;  2DN0 A;  4A3K J;  2L9V A;  5J40 A;  3PJR A;  1KA8 A;  3V42 A;  3RPU D;  1IN4 A;  2KQR A;  2E2H J;  5FKM A;  3DTK A;  1GXP A;  1GV2 A;  1SC7 A;  3AG1 H;  1GHC A;  3OS2 A;  1TBX A;  2G7U A;  2LTP A;  1MND A;  1XPX A;  2Z16 A;  4ESJ A;  2ELJ A;  4XN0 A;  4HRI A;  2RN7 A;  4N9H A;  1P2F A;  1RKT A;  1VF9 A;  1IRX A;  2R7O A;  2Q2E A;  2A3S A;  4G7H F;  2W85 A;  4OMY A;  3LAJ A;  1Z7U A;  3IWZ A;  4LIV A;  2BY1 A;  3CCS I;  4ZH4 F;  2XPV A;  1I6H J;  3CC7 I;  3DU6 A;  4KIT B;  2ZJP F;  2LY1 A;  3I54 A;  4A3F J;  5HOD A;  2D5V A;  4LIT A;  4DYR A;  1T6S A;  1TT0 A;  1ZRD A;  3CP2 A;  3ABU A;  3DPU A;  5FLM J;  3OYG A;  3JTH A;  3CZ6 A;  3F8B A;  4RGR A;  3WE2 A;  1IUY A;  1WJE A;  4ITV A;  4PZJ A;  2QQ8 A;  3F6O A;  3I58 A;  2HTJ A;  3KZI C;  2BW3 B;  2L01 A;  1WH5 A;  2OAZ A;  4XSX F;  3V7R A;  2CQ7 A;  3HGY A;  1XMA A;  1FBU A;  3FK7 A;  4XKW A;  2JVH A;  2NNN A;  1ON2 A;  2MLG A;  1TNS A;  1XTA A;  2L5Q A;  3A1Y A;  2XGD A;  2CQK A;  1B8I B;  3GUD A;  3IH3 A;  1IXC A;  4HW0 A;  1R23 A;  3TO7 A;  2VPR A;  2QZ8 A;  1X3Z B;  2MC3 A;  1WPK A;  3FK6 A;  4KMF A;  3FZV A;  1V55 H;  4A2U A;  1HW5 A;  1QA6 A;  1OFC X;  4DZJ A;  4EM1 A;  4BEH A;  4R79 A;  2FMY A;  1F4K A;  1H9T A;  2DYS H;  3VWB A;  2KL4 A;  5D5W B;  5D4S A;  1ZQ3 P;  2KRF A;  5FD6 A;  5J8C A;  1FSE A;  4RDU A;  3KLN A;  4S04 A;  2BVL A;  5FKN A;  2QA4 I;  3ZMZ A;  1EF4 A;  1BR4 A;  3SYT A;  4M6V A;  3QAH A;  2Y30 A;  3CUQ A;  2ACJ A;  3OIQ A;  5BPD A;  3V7C A;  4FX0 A;  4ON0 A;  2BXY A;  3JSP A;  2ZNY A;  4B8X A;  3HKZ N;  2D45 A;  2GXG A;  2LBF B;  4LLN A;  3TW6 A;  2KRH A;  2BGC A;  3H0G J;  4I98 B;  2MD5 A;  1ZGW A;  2K4B A;  2KIU A;  1U6G A;  3K4K A;  5L3B A;  3G1M A;  1D3Y A;  3I3L A;  1WJD A;  2EH3 A;  2CUE A;  3U9G A;  4XRM A;  4BBS J;  2P0W A;  3E5X A;  3ZQ7 A;  5H6R A;  2DK8 A;  3TO6 A;  5FGM A;  2M5W A;  3PFY A;  2BHZ A;  5ERI A;  1MMG A;  1MBF A;  4UHT A;  3RDI A;  3MZH A;  3DKW A;  1T56 A;  1D5V A;  3SZT A;  1TW3 A;  3I4M J;  3CCR I;  3F72 A;  3J7Y J;  4IHX A;  5E17 F;  1IF1 A;  2VT3 A;  3ZQF A;  2NVX J;  1UJ8 A;  1T95 A;  3CO7 C;  1IDY A;  4RLF A;  3OYL A;  4EAT A;  3BTC A;  3MMY B;  1OR7 C;  3KE2 A;  3C2B A;  1TNT A;  2CW7 A;  3BG7 A;  4GFB A;  1WH7 A;  5HLI A;  1NG7 A;  3K0L A;  2LLK A;  5CVV A;  2TDX A;  2ZME B;  3K6G A;  3WOD F;  4BY7 J;  1EH8 A;  2LRE A;  1K7A A;  2DLL A;  3BT9 A;  1U5T B;  4R8H A;  2RC4 A;  3BR2 A;  1R1T A;  1XSV A;  2VKD A;  1JJ8 C;  4NQW A;  3GW2 A;  3ZQI A;  3A02 A;  4UV8 A;  4NC7 A;  4I0A A;  1HKT A;  3OYN A;  4YIR X;  2K85 A;  1YO5 C;  2LH9 A;  1MBH A;  5DM7 F;  3BTL A;  2LSO A;  5F0F A;  2CS3 A;  3SDG A;  1J5Y A;  1K4S A;  3ZR8 X;  2LKX A;  2Q8K A;  3K7A J;  4QSH A;  1ETY A;  5ICG A;  3LSM A;  4B4C A;  2KMU A;  2Q2E B;  1BW5 A;  2K7L A;  1O3T A;  4AWX B;  4HX7 A;  1MSE C;  4RBO A;  3HHH A;  1GVJ A;  1OPC A;  3ZQH A;  4YFK F;  5E18 F;  1T98 A;  3TDU C;  4HV5 A;  3TP3 A;  4HX4 A;  1ITY A;  1MH3 A;  2W57 A;  1J2X A;  2FQ4 A;  1U3E M;  2L9S A;  4XKV A;  3OYC A;  3V8J A;  3CCE I;  4U0W A;  3H9J A;  1WHU A;  2A05 A;  5E3O A;  3A0B C;  2DPU A;  5E8G A;  4PJM A;  4YFX F;  2R5Y A;  1D0Z A;  1G3T A;  2IW5 A;  3LFK A;  1R9T J;  1KU3 A;  2E36 A;  2A5Y B;  1LDJ A;  1ZKG A;  2YX4 A;  2GXA A;  3Q3S A;  4RMN A;  3WHB A;  2VE8 A;  2QM3 A;  2UXN A;  4UVA A;  2LY9 A;  1O3Q A;  2HZD A;  2OJE D;  5GAG J;  3ZPL A;  3RSN A;  2GOM A;  3R0A A;  2EIL H;  3OYF A;  1SD4 A;  5FLV A;  3D5S C;  4ZZD A;  3PSI A;  2GZW A;  2JUC A;  4BEH B;  1S3J A;  4D9J A;  5F27 A;  1O7F A;  3CMM A;  4C3H J;  1ZAR A;  1X1A A;  4C2M J;  1JGS A;  1J7K A;  4J01 A;  4HSR A;  1LB2 A;  3E3V A;  5E3N A;  3MKY B;  3NAU A;  5K5O A;  3HOZ J;  4RGS A;  4AIJ A;  3CUQ B;  4QLC U;  3E5Q A;  4MQV A;  2PMU A;  1Z21 A;  3MEX A;  1GT0 C;  5KAI C;  2GOX B;  2O8X A;  4BQA A;  1APL C;  2WAQ A;  3S3N A;  3DP7 A;  3ULQ B;  1MJ9 A;  1YLF A;  2DT5 A;  1MJB A;  1E3P A;  1LQ1 A;  4PFP A;  1DDN A;  3H5A A;  1A36 A;  1KU9 A;  2V4J C;  3KYD B;  4HPQ A;  1D8K A;  2MH9 A;  1UG2 A;  1GDT A;  2ZC2 A;  5C4X J;  1D0X A;  1KQ0 A;  2Y69 H;  1QU3 A;  5HLH A;  1ETW A;  2VAS A;  3QWL A;  3W2V A;  3Q0U A;  2QQB A;  4IHV A;  3HOS A;  3OYI A;  1K4T A;  4A69 C;  3DTI A;  5A2Q Z;  4IHS A;  2DFI A;  2BXZ A;  2LG4 A;  2R7D A;  4EGY A;  2DI3 A;  2O3F A;  2VT2 A;  3ISP A;  3F8C A;  3ZP5 A;  5CQE A;  5J3L A;  4CA0 A;  2FSW A;  2ZME C;  2NNY A;  3E97 A;  5JVG F;  1P9Q C;  3IHU A;  2CGP A;  3HOV J;  4EM2 A;  3GZ5 A;  3AKZ A;  1ZN2 A;  4BUP A;  4EJO A;  1U5T C;  5LD2 C;  1IV6 A;  4U0V A;  2ZJR F;  1FP1 D;  1OCO H;  3DFG A;  2E5N A;  2R7V A;  1FYK A;  1P6R A;  4ZZL A;  4B3X A;  5D4R A;  4BBR J;  2ISZ A;  1HDP A;  5LGN A;  1F36 A;  4XM3 A;  1A31 A;  1PJR A;  1J9I A;  2XAH A;  2L02 A;  2R7S A;  5KK1 A;  2NAZ A;  2QEN A;  3GXO A;  2IRF G;  2VBX A;  3Q0V A;  1E3H A;  2FEZ A;  1B1B A;  1SAN A;  4L9V A;  3FHN A;  1F9N A;  1DP3 A;  1S6L A;  2ESN A;  1R5I D;  2XUB A;  5FKL A;  3WTY C;  1KYZ A;  3L2U A;  1ZGA A;  3QYB A;  3JRG A;  2JK3 A;  2WWY A;  4FIS A;  2ZFU A;  4M9Z A;  2LR8 A;  2WY8 Q;  1YOV B;  4XID A;  4CYC A;  2YUS A;  2E1C A;  2NVQ J;  5CLS A;  3NQO A;  5EEH A;  3G1L A;  2CUZ A;  2W7N A;  2WA0 A;  1LDD A;  2HYJ A;  3T5X A;  2HR3 A;  2VJJ A;  1H8A C;  4QPO A;  1X58 A;  4Q48 A;  1W5S A;  2LRD A;  2IP2 A;  5DD8 A;  4Q47 A;  2IA1 A;  2DOF A;  3DV8 A;  2V79 A;  1MIJ A;  4I99 C;  5D6E A;  4BU2 A;  4ANJ A;  3RQI A;  4UVC A;  3BQY A;  3FXQ A;  2K02 A;  1UST A;  2WB1 N;  2CH0 A;  3BJ6 A;  4NUB A;  5LRS A;  1YHQ I;  5M3F J;  4NNJ A;  1Z91 A;  4RB0 A;  4W97 A;  1Q1H A;  2EK5 A;  2HOS A;  1OQY A;  4AU7 A;  4BE0 A;  1NK2 P;  4L18 B;  2QVO A;  1ZTR A;  1BOA A;  2R5Y B;  5CJ9 A;  3HGG A;  4BHC A;  1YIT I;  3WGI A;  4OOI A;  1RKW A;  2H8W A;  3D0S A;  3FMQ A;  3RKQ A;  4PJ0 C;  1OYW A;  4KA4 A;  3DQV C;  1IG7 A;  3ABM H;  3BPX A;  4LOC A;  3IC7 A;  1IN5 A;  3V8K A;  2CO5 A;  1WRJ A;  3TDZ C;  4HBL A;  4LLL A;  2VXD A;  2X51 A;  3FX3 A;  5FO5 A;  4HA8 A;  3TQN A;  1G3W A;  1MMD A;  1HLV A;  4XOT A;  5GAE J;  1H88 C;  3CUQ C;  3M7G A;  3L7W A;  2HVR A;  4UB8 C;  1R1U A;  5AON A;  3O8G A;  4I01 A;  4P96 A;  1UMQ A;  5EF6 A;  4OIN F;  2XSD C;  2HVS A;  2W25 A;  4MIM A;  1NG6 A;  3J7A Y;  2QSF X;  4E7L A;  2KFD A;  1OJL A;  1P4X A;  2LF7 A;  3QRF F;  2L7Z A;  1I50 J;  3ZOB A;  4GXO A;  4LG0 A;  3MKZ A;  4E7Z A;  1FOY A;  3JRB A;  2KLO A;  1W0U A;  3IRQ A;  3S15 J;  2M4G A;  1OR7 A;  4XOR A;  4LD5 A;  1R5H A;  3GFL A;  4UVB A;  1VQP I;  1TL8 A;  5CVI A;  2AHQ A;  1YW7 A;  1YIO A;  3FWE A;  1MBG A;  2EFQ A;  1FIA A;  3M1E A;  1JKQ C;  2E34 A;  2ECC A;  4L5E A;  4D7M A;  4HX8 A;  2EA2 A;  3CDL A;  3GBG A;  2HYF A;  3B6A A;  3KCC A;  4KMU X;  1G3Y A;  3BR0 A;  2M7B A;  5LRR A;  1T2K A;  2KJC A;  2EQR A;  4PK4 A;  3LSP A;  2NOJ B;  2DA1 A;  5HLT A;  3GZ6 A;  3WU0 A;  2FXA A;  3EQL F;  3X2Q H;  1XCV A;  4BJ6 C;  4NB5 A;  4LGW A;  2JA2 A;  1KU7 A;  3BTI A;  4BXF A;  4XLC A;  2LVS A;  4JX5 A;  4PDK A;  3VOE A;  3QPL A;  2QEX I;  4MLO A;  1OCP A;  3OWT A;  1WJF A;  4B48 A;  2WV1 A;  5B66 C;  2ID3 A;  3JTG A;  2W1O A;  4RAY A;  4NHJ A;  4EV0 A;  4ZJZ A;  3TO9 A;  1FOW A;  2Q1Z B;  1IO2 A;  4KIS A;  3LMM A;  1I1S A;  3FKJ A;  2WAE A;  4I02 A;  5BS6 A;  2STT A;  2VPL A;  2KT0 A;  5CQG A;  4A3J J;  3AG4 H;  3BG9 A;  3CUO A;  1Y56 A;  3KP3 A;  3ROU A;  3OYJ A;  1D0Y A;  3IP4 B;  2DA5 A;  2RKH A;  2FUG 2;  3EYI A;  2BW3 A;  2I10 A;  1X1P A;  2HOA A;  1X19 A;  3G2B A;  2LKP A;  4DBR A;  4JBA A;  5C44 J;  1BM9 A;  3BLY A;  5ICF A;  1EA3 A;  5DD4 A;  2LOO A;  4ZDP A;  2FA5 A;  3MKL A;  3FMR A;  3G6E I;  2VXZ A;  2K40 A;  5EZH A;  5M5Y J;  1IUF A;  3I5U A;  1YFH A;  4A93 J;  2DOE A;  2WAQ N;  4A6D A;  1EH7 A;  3CMY A;  3HJE A;  2E1O A;  2EBI A;  4A0X A;  2MAB A;  2ZCW A;  4CYC B;  4A3G J;  4CCM A;  2HZT A;  2DMP A;  3FXJ A;  3Q9V A;  2IVM A;  2JN6 A;  4C30 A;  3KEQ A;  4I0B A;  1PDN C;  1FJL A;  3FHZ A;  4ZTJ A;  3CJQ B;  1OCZ H;  3P5J A;  4NC8 A;  2LP0 A;  5E3M A;  4WXH A;  3TBI A;  2PLY A;  2DA3 A;  4C3I J;  2IS6 A;  2FQ3 A;  2OZ6 A;  2BE5 F;  2XB0 X;  2MA3 A;  4IQ4 A;  5CKT A;  4FCY A;  1ON1 A;  4E6K G;  2JVG A;  4MQ9 F;  3OYE A;  5DV5 A;  3JAM Z;  3QP5 A;  3HTU A;  2B7E A;  3E6C C;  1ODD A;  3BWG A;  4RM3 A;  1MKM A;  3FXK A;  3Q9S A;  3PUB A;  3BOQ A;  1S9H A;  1FYL A;  2H94 A;  4X0G A;  1TZL A;  2DFH A;  5D5X B;  1YQA A;  2G0E A;  3AAF A;  1FWZ A;  4KT5 C;  2VL8 A;  1KU2 A;  3P9I A;  2DOD A;  3UNG C;  4L9N A;  3GTQ J;  3I59 A;  1Z0X A;  5DS9 A;  4NBQ A;  1QNT A;  4WK8 F;  2BVM A;  3K4J A;  1YJ9 I;  4AIH A;  1RUO A;  1BI1 A;  1FOX A;  2K9Q A;  1YW8 A;  3ZCO A;  5DUI A;  3ZMV A;  5LHI A;  4H4K C;  3W2A A;  4XRS A;  4Y52 J;  4M3E A;  4WCG A;  3E0J B;  3C2G A;  3D5R C;  4BE1 A;  1UFM A;  1UB9 A;  4M9X A;  3FXR A;  3OS0 A;  1VQL I;  1PP8 F;  2W84 A;  1KGS A;  3FMS A;  5FLX K;  5GPA A;  1MMA A;  4YIF A;  2XAF A;  2FX0 A;  2JA8 J;  3P9C A;  3N05 A;  4JX4 A;  1TLH B;  1U2W A;  3KP4 A;  1O57 A;  4HZF A;  2M1B A;  4LG0 B;  3OYK A;  5KCM A; 
#chains in the Genus database with same CATH homology
 1AA7 A;  1T95 A;  3A2K A;  3OYL A;  4RLF A;  4EAT A;  3H35 A;  3OR2 C;  3VYS B;  3MMY B;  1OR7 C;  4Y4R A;  4RLQ A;  2CW7 A;  3BG7 A;  3H5N A;  2XF6 A;  4P1W A;  1NG7 A;  3E1S A;  3PNT A;  3HL2 A;  3K6G A;  3FDY A;  3L2Q A;  2LRE A;  3CJR B;  4FAS D;  1YX3 A;  2UWM A;  4J00 A;  4DOZ A;  5FRM A;  1LVK A;  2OC6 A;  2F4I A;  4PJL A;  2VKD A;  3LFU A;  4GRI A;  3OYA A;  4Y3O A;  1WJ5 A;  4LG3 A;  2IS2 A;  4NC7 A;  4CH7 A;  2KP6 A;  3KX2 A;  4HNT A;  2MD0 A;  3H9Q A;  3OYN A;  1UAA A;  2LH9 A;  2DT7 B;  2K9M A;  3AL0 C;  1J09 A;  2CS3 A;  3CP8 A;  4B44 A;  4BL0 B;  3ZR8 X;  4CSW A;  3L2R A;  1YE9 A;  2HQA A;  4NQW B;  1X1D A;  2K9L A;  3LSM A;  2HVQ A;  2KMU A;  2Q2E B;  2PJR A;  3K4B A;  3M8J A;  3HOT A;  3LSH A;  4OAY A;  3OYB A;  3LSI A;  3S3O A;  3KEY A;  2HDW A;  3CES A;  4E7J A;  2R7U A;  2I8D A;  2L9N A;  2L9S A;  2MYS A;  4XKV A;  1Z7L A;  3OYC A;  1K6Y A;  1N78 A;  2RQQ A;  3H9J A;  3OL3 A;  2X85 A;  4BDY A;  2CFO A;  4XN3 A;  2E5Z A;  4PSX A;  4PJM A;  1D0Z A;  2X6Y A;  2ZXI A;  3FBN B;  1SAU A;  3S32 A;  4PUS A;  3VSL A;  1WFX A;  2DT6 A;  4RMN A;  3HPG A;  3VDX A;  3OMY A;  3AFH A;  1G59 A;  2AQF A;  4F52 A;  5HNH A;  2IGN A;  3ZRG A;  2HZD A;  3K70 C;  4BJT A;  2O5R A;  2GOM A;  3RSN A;  3OYF A;  1VZ0 A;  3D5S C;  3K4L A;  3PSI A;  3NWT A;  2W00 A;  4BEH B;  4D9J A;  1X1C A;  3LL7 A;  3CMM A;  2V7F A;  4ZDL A;  3DPT A;  1X1A A;  2VLA A;  2E1M B;  1D1C A;  2XDV A;  2WAF A;  4HSR A;  4J01 A;  3IAS 2;  1U0J A;  3BCB A;  4RM2 A;  2E1M C;  1LFP A;  2BOL A;  3MKY B;  1X4P A;  3BC8 A;  2L7K A;  3OOU A;  3DLA A;  2QKL B;  1D1B A;  2XSJ C;  4PJN A;  1Z21 A;  1FMW A;  3PSF A;  2GOX B;  3H5R A;  4YRV A;  2QKM B;  2WAQ A;  3S3N A;  4YEJ A;  3DWL E;  4PFP A;  2XAU A;  3H5A A;  1BR2 A;  3U21 A;  2V4J C;  4HPQ A;  5CPR B;  2LY2 A;  4DIQ A;  1D0X A;  3ZQQ A;  4HST A;  1W36 C;  3OIP A;  1QU3 A;  2VAS A;  3W2V A;  1QHH D;  3HOS A;  3OYI A;  2IGO A;  3HXL A;  2X1E A;  3DTI A;  1T0F C;  3K4N A;  1JI8 A;  2DCE A;  2WAD A;  2VB6 A;  4XLE A;  2LG4 A;  4BQN A;  4IKF A;  2Z1D A;  4CZC A;  4PJJ A;  3RTR A;  4DBQ A;  5CQE A;  4CA0 A;  1LKX A;  3K4C A;  1P9Q C;  1V5E A;  2VJ5 A;  2R7T A;  1ZEL A;  3AKZ A;  5LD2 C;  4BUP A;  4PSW A;  4XMY A;  3K70 D;  4F93 B;  2XF7 A;  2E5N A;  2R7V A;  2RRE A;  4KJZ A;  2IGK A;  2OUM A;  4B3X A;  4XQF A;  4CCN A;  3QOE A;  4E7H A;  4XM3 A;  1PJR A;  3PNV A;  1KON A;  2XF5 A;  2VJ4 A;  4N4O B;  3VYR B;  3S93 A;  2R7S A;  3HKZ A;  5TGT A;  2IS4 A;  2VQC A;  3FHN A;  3DU5 A;  3OL4 A;  2W82 A;  1DP3 A;  3OS1 A;  2KHM A;  3OY9 A;  4CUG A;  3C2H A;  3L2U A;  3QYB A;  3L2V A;  4FET A;  5KNL A;  2ZFU A;  3IAM 2;  3SEQ A;  2KZV A;  2DJI A;  2WY8 Q;  1N75 A;  4XON A;  4U87 A;  4ZYA A;  2DXI A;  2AQE A;  5FRN A;  4CCJ A;  4ZC3 A;  3SZG A;  2CUZ A;  3QYF A;  2W7N A;  3EUK L;  2WA0 A;  2CV2 A;  4XR6 A;  4II3 A;  4HNU A;  3HPH A;  2VJJ A;  3K10 A;  4HG2 A;  1E0E A;  4QPO A;  2ZXH A;  2LRD A;  3PNY A;  3W3C A;  2M7A A;  3HG9 A;  1MW7 A;  1V5G A;  2PJR B;  3SEZ A;  4IX7 A;  4E7K A;  3FBI B;  3MKW B;  1W36 D;  5HOO A;  2KRC A;  3ONQ A;  4BU2 A;  4ANJ A;  4CCO A;  3HUG B;  4D1Q A;  4P5O A;  5FRO A;  2CH0 A;  4NUB A;  1Z3X A;  5HNF A;  2V26 A;  1D1A A;  1QHG A;  4NNJ A;  4XNF A;  4XLH A;  5HVQ C;  2KDO A;  2Z2S B;  3PL8 A;  4AU7 A;  4BE0 A;  4XKB A;  2JSP A;  3DEE A;  1DQU A;  2Y0S A;  3DKY A;  2OV7 A;  3A4C A;  4XKC A;  3ZGK A;  3LSK A;  1ERD A;  4BDZ A;  2HU9 A;  3DQV C;  2MFZ A;  1WJA A;  2JUG A;  4OWR B;  2LBF A;  3VYU B;  4E7S A;  2X6W A;  2VXD A;  2X51 A;  4E7I A;  3H9G A;  3F9K A;  1MMD A;  2LC2 A;  2VQH A;  4XOT A;  3KYL A;  2VQL A;  1Y6I A;  3SDB A;  2K5C A;  4IZZ A;  4C2T A;  2HVR A;  1G8X A;  4CCL A;  2V9K A;  3D5L A;  3S3M A;  2HVS A;  2VJI A;  3DTE A;  3S8P A;  1NG6 A;  3J7A Y;  1WJB A;  4E7L A;  4B43 A;  1DGR M;  2V6E A;  4BGD A;  3MKZ A;  4KT6 A;  4E7Z A;  2KLO A;  2CMP A;  3EPZ A;  1HA8 A;  2WBM A;  2M4G A;  2F6C A;  3L2W A;  3VSK A;  4XOR A;  2CV0 A;  3ZXS A;  2CV1 A;  1X4O A;  4PFO A;  2RNG A;  1FMV A;  3OYD A;  1UG0 A;  4DGW B;  2IS1 A;  4BQO A;  2MC4 A;  2WB1 A;  1WJC A;  1X1B A;  2KPM A;  2VIX A;  1MNE A;  3TL4 X;  1N77 A;  3GBG A;  2A5W A;  4OAZ A;  2M7B A;  4F92 B;  5KHD A;  2M4K A;  2VKH A;  4PK4 A;  1MMN A;  2NOJ B;  4BJ5 C;  3EUA A;  5HLT A;  4BQQ A;  3DPL C;  4N4N B;  4XLA A;  2V1N A;  2F5V A;  4BJ6 C;  2JA2 A;  3PJR A;  3V42 A;  4BXF A;  4XLC A;  1PYV A;  4Y33 A;  3RPU D;  2KQR A;  2M0M A;  3MD2 A;  1DGW Y;  3DTK A;  4MLO A;  3H0D A;  3OWT A;  3OS2 A;  1WJF A;  4B48 A;  1MND A;  2Z16 A;  4YEL A;  1BOB A;  2ELJ A;  2W1O A;  3QYE A;  4XN0 A;  4CCK A;  4HRI A;  4ZJZ A;  2Q1Z B;  4KIS A;  3BCA A;  3LMM A;  3M1C A;  4AYB A;  2R7O A;  1IRX A;  3FKJ A;  2WAE A;  4HEA 2;  3W2W A;  2VPL A;  2DOA A;  5CQG A;  4G6T B;  2VQG A;  3BG6 A;  1Y56 A;  4LIV A;  3OYJ A;  1D0Y A;  2M3A A;  3IP4 B;  1Z3Y A;  3AL0 B;  2FUG 2;  2BW3 A;  3K4M A;  4ZDO A;  2IXS A;  3DU6 A;  2LYC A;  2LY1 A;  4KIT B;  5LFA A;  1X19 A;  3G2B A;  4DBR A;  4E4H A;  4LIT A;  3BLY A;  1EA3 A;  4JQF A;  2LOO A;  3QOD A;  4ZDP A;  1TT0 A;  3CP2 A;  2VXZ A;  1OLT A;  3LSG A;  3DPU A;  2R4G A;  2CUJ A;  4XLF A;  3HC7 A;  2CW8 A;  3CZ6 A;  2X1D A;  3OYG A;  1WJE A;  4ITV A;  2MAB A;  4CCM A;  2BW3 B;  3RCO A;  4U7B A;  2HPM A;  3OYM A;  2X1C A;  2X6X A;  3NWS A;  4XOP A;  4BAC A;  3I9V 2;  1GLN A;  4XKW A;  2JVH A;  1BR1 A;  1V5F A;  4C30 A;  2L5Q A;  3A1Y A;  2UV1 A;  4ZTF A;  4ZTJ A;  3CJQ B;  2R7Q A;  4NC8 A;  3TBI A;  2IS6 A;  2R7R A;  2K3P A;  4II2 A;  3OYH A;  4IQ4 A;  5CKT A;  4C2U A;  4E6K G;  4BEH A;  2JVG A;  4R79 A;  3OYE A;  4BS9 A;  3VWB A;  2KL4 A;  2ZSH B;  2XC7 A;  4QPQ A;  2HPI A;  3VYT B;  4XL9 A;  4RM3 A;  3PUB A;  1S9H A;  4X0G A;  1TZL A;  2BVL A;  3DKX A;  4LIU A;  3IUO A;  1BR4 A;  3SYT A;  4JOM A;  1LDK B;  3OIQ A;  4DJA A;  4F91 B;  1SFK A;  5JHF A;  2W4S A;  2VL8 A;  3UR3 C;  4BE2 A;  2LBF B;  1YX5 A;  3UNG C;  2IGM A;  4C9Y A;  1UEL B;  2KRH A;  2E60 A;  4F55 A;  2R7X A;  3CF2 A;  2BVM A;  3K4J A;  3K4K A;  2HNH A;  3I3L A;  1WJD A;  3ZCO A;  4AVZ A;  4F3Q A;  2P0W A;  4H4K C;  3W2A A;  2L2O A;  3E0J B;  3C2G A;  3D5R C;  4B47 A;  4BE1 A;  3PFY A;  2WY7 Q;  3OS0 A;  1MMG A;  2UUZ A;  1MMA A;  2PMZ A;  3TMO A;  3N05 A;  3OR1 C;  2A6T A;  3RQ4 A;  2R7W A;  1R6R A;  4IQJ A;  3OYK A;  5KCM A;  3EUH C;  2ZSI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...