2ZSHB

Structural basis of gibberellin(ga3)-induced della recognition by the gibberellin receptor
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
66
structure length
59
Chain Sequence
GMDELLAVLGYKVRSSEMADVAQKLEQLEVMMSNVLATETVHYNPAELYTWLDSMLTDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone receptor
molecule keywords Probable gibberellin receptor GID1L1
publication title Gibberellin-induced DELLA recognition by the gibberellin receptor GID1
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 20
structure length 59
sequence length 66
ec nomenclature
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12041 DELLA Transcriptional regulator DELLA protein N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1290 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2zshB00
2ZSHB 2ZSIB
chains in the Genus database with same CATH superfamily
1H9GA 1VI0A 4YELA 5LEJA 2L7FP 4MFEA 1B9NA 2CUZA 3EUHA 4PK4A 1Y39A 1ZLJA 3QU3A 4I09A 3I54A 3RPQA 2DTZA 4DYRA 5J1YA 2OQGA 3AKZA 4HDVA 5H20A 2CQKA 1TL8A 2IS4A 4KT6A 2B7EA 1ITYA 4AIHA 4HYEA 1PDNC 1W1WE 5KK1A 5CVRA 4JX6A 2XROA 3MKZA 2CO5A 5DS9A 2IGMA 1F5TA 4OINF 4B3XA 3AG3H 2H6CA 2QUFA 1Z77A 3WTXC 1DP7P 1PYVA 4KT5C 1MBKA 3F23A 2O7OA 4I0AA 4UUTA 1UCRA 1TNTA 1VQLI 2HQNA 3F8BA 3PIPF 1XGNA 1ETKA 2M3AA 2CMPA 4N4OB 3BP8A 2O5RA 2V1UA 2WB1N 4ENNA 4JP0A 2Z5UA 2NNNA 3E1SA 3L09A 4MFDA 1ZG1A 3K0LA 3FXJA 4S05A 1ZTRA 3CC7I 2K3FA 2LP0A 2UXXA 3KX2A 1UHWA 1YLFA 1O3RA 1T56A 4UNOA 1MNMC 4I6ZA 3I9V2 2FNPA 2ZFWA 3RKYA 3HPGA 5H2FC 4EMSA 4DNCA 4HG2A 2MLKA 4BKXA 3C1DA 1BM9A 3V7RA 1D8KA 3TW7A 1K83J 4A2UA 1W5CC 3S1QJ 5C44J 3MAJA 2V6CA 1PP7U 3GTGJ 4HBLA 2BY1A 2JPCA 4MTEA 3VSKA 5BNGA 1JXSA 3AG2H 1Y0UA 3PL8A 1HCRA 2RQQA 4RB2C 3BZKA 4E70A 2EV6A 2BGCA 4IOAF 3GBGA 2ICWG 2RKHA 2A6HF 2VT3A 3BDDA 5FJ8J 1TTYA 3WGGA 2V1XA 3M1EA 3JTGA 3CMMA 2R7OA 3W6VA 4EJVA 5DEQA 3BG9A 4U7DA 2JK3A 4A12A 1LDJA 1SD6A 2EIMH 4BXUA 1DQUA 1R6RA 2DFEA 2O3FA 2M5WA 1DUXC 2OBPA 5LGUA 5K5RA 5DM6F 4RB3C 3HSFA 4YRVA 1YYVA 2E7XA 2XRNA 3OYKA 2Y0SN 1HW1A 1JUMA 4BH9A 1KU9A 4KJZA 3SFZA 2DMTA 3ZR8X 1LPQA 2VONA 3KCCA 3C3WA 2M8EA 1AU7A 3I4MJ 3DP7A 2UZKA 3F0CA 5CKTA 2EH3A 3R0AA 4M9ZA 4YIIA 4LG0A 2LC2A 2CQQA 5KNLA 1Q1HA 4LIVA 4BHPA 2K27A 5M5YJ 1O4XA 5TISC 3Q3SA 3MKYB 3LSPA 2XKOA 2ESNA 2DT6A 2L3DA 3BY6A 3MVPA 5DUKA 1SVMA 1GT0C 2LD5A 3DLLF 3OYJA 1GXQA 4E7HA 4EM1A 2XAQA 4XKBA 4BY1J 3MQ0A 3PM1A 4V2FA 2KIQA 1LE8B 3V8LA 2WB1A 5FD6A 5J4YA 3EUHC 3B02A 2WC2A 2VBZA 3LA3A 2DA5A 3BLYA 5F27A 5FLVA 2HYFA 2ZMEA 1S6LA 5GP9A 4MIMA 2F5VA 2GOMA 5FB2A 5TRDA 3IWZA 2KLOA 3S93A 2FA5A 3MN2A 3BR3A 1GUUA 2WY7Q 4J00A 1SFXA 2CQNA 2NRAC 3G73A 3F9KA 4KN4X 4ETSA 2QKLB 3A4CA 3BR5A 3JTHA 4G6DA 2MFZA 3F8NA 1IN4A 3ASOH 1E3OC 1YRNA 1IN8A 1GLNA 5J6XA 2MD0A 2JZYA 4Q47A 1WJCA 2GWRA 1STZA 1YO5C 1ENHA 3PUBA 5FLXK 4HOBA 1GVDA 2CH0A 1E2XA 1FJLA 2BXZA 4UVBA 1UAAA 4QTRA 2QSHX 4NC8A 3MCZA 2VT2A 3GLLA 3LSGA 1X3ZB 4L0YB 3G4SI 3VDXA 2MA3A 2G7HA 1HXDA 5ILVA 4AM3A 3BG5A 2F5FA 2OD5A 2V7FA 1REPC 3GO5A 3WTUC 1MSEC 1FMWA 4BJ6C 1J59A 1IUYA 2G0EA 4IJAA 3TDZC 1T39A 2A61A 1FIPA 3FXKA 3DXJF 3LSIA 2PJPA 2ZSHB 5FLXZ 1MMGA 4XLPF 1VQPI 3ELKA 4R8HA 3H0DA 1RUOA 1Z3YA 1ZGAA 4IQ4A 4IF4A 5EYRA 2HGCA 4L18B 2XF6A 4JYKA 3J81K 1S8NA 1T95A 1NK2P 3G3ZA 2Q2EA 4M74A 5K7ZA 4IQJA 5ICFA 3CJTB 4U0VA 2LKPA 4BEHA 2P6SA 2EV5A 4CZCA 4RM2A 1HC8A 1U9NA 4E7LA 3HHGA 4UV8A 4HNVA 1Y1VJ 5IP7J 3K4JA 1XS9A 5DCMB 3I59A 4PJ0C 3CMEI 2JA6J 3JSOA 5F6FA 3F21A 1SFEA 4BE1A 1OFCX 5JHFA 3J81Z 2XHKA 3GZ5A 3B6CA 5LHGA 3SZPA 2ZB9A 1U3EM 1FIAA 3ERMA 3HC7A 3ERED 1KU2A 3IKTA 2PMZN 3QPTA 1IN7A 1D0ZA 2YU3A 3FIWA 4IX7A 3DBHB 3QP6A 2TRTA 3TO6A 1MDMB 4BDYA 3VYSB 3A0BC 1TW2A 4ENKA 1WJEA 3AAFA 2KJBA 3E7LA 2HYGD 4OAYA 2R5ZB 3S1RJ 2PN6A 3D5RC 3LSHA 1VFCA 5D8LB 3OIPA 4YIRX 4Z6YA 3ZPLA 2E35A 1JGSA 4P1WA 3CUQC 2DMNA 5J1UA 4I98B 1MNEA 1XCVA 2HOEA 4G6QA 4WCGA 5FFZA 1IW7F 1XGOA 2LVSA 2X1DA 3RKWA 4IHSA 2WADA 2Z9OA 2ZMEC 3QOPA 3O3KA 2KRFA 4A3JJ 3E5QA 4PGGA 1MH3A 1P4WA 1UB9A 3FK6A 1S7EA 4XONA 2DXIA 2E2HJ 4I02A 2IS2A 4BHCA 2OUMA 3ZGKA 5CVVA 2DFHA 2KFDA 1XTAA 5E1ZB 1OCZH 1YI2I 3HTUA 3TBIA 2PG4A 3MD2A 3X2QH 4A0XA 4M6VA 4YFNF 1LFUP 4A3GJ 1SC7A 3OYHA 3JCUC 4HF1A 3I53A 1ZGWA 3JR9A 2QBYA 2L5QA 3I64A 1I3AA 2UXNA 2X6OA 4UHTA 3ZMDA 1EF4A 4EJWA 1WKMA 2EA2A 3RJPA 2XB0X 1W5SA 3E6MA 4Y15A 3RQ4A 3QRFF 3DBLB 1SD5A 3FBNB 3WGIA 4E7ZA 3KEOA 2MYSA 4X6AJ 4CDGA 1RI7A 1SEUA 3K4KA 1IDZA 3IWFA 1Y8RB 1FOXA 3L2UA 4BNCA 1O7LA 1ZKGA 2CJJA 5EG0A 2FMYA 1I1SA 1YS6A 2BY2A 1P2FA 5M5WJ 2W82A 1X58A 5IYDJ 4M6YA 3AFHA 3TEDA 2RREA 5K5QA 3LA7A 2MH9A 3FM3A 3KLNA 5FKLA 3HG9A 1LNWA 2K5CA 2P6TA 1AHDP 2F48A 1VNDA 4XKWA 3VYTB 3RCOA 2XIGA 3CZ6A 3H5AA 1H0MA 3E6DA 3GFLA 3PQKA 2EZHA 2PMZA 3HUGA 4ZDLA 1OMIA 4BQQA 5GAEJ 3R60A 1UG0A 3CJQB 1WSUA 2DA7A 1T38A 2W7NA 2E1NA 4Q4ZF 4KUMA 2EWNA 1IO2A 3LL7A 4CICA 1QZZA 5E17F 2R7UA 2CV2A 1KZHA 1WJ5A 4OAZA 1J7KA 3KFWX 4I2OA 2DW4A 3OWTA 3Q0VA 1J0RA 3QQAA 3VOEA 5FKMA 3JSPA 4LK0F 4MEYF 4E7SA 4II2A 1RC9A 2NVYJ 3ABMH 1BIAA 1ZARA 2M1BA 2LRDA 5AIPA 4ABZA 5IT9K 1X19A 3WTZA 2ECCA 5D5WB 2R7TA 5ICGA 1PVEA 3CJRB 4X1EA 2KL4A 4AVPA 1P4AA 4XK4A 2FOWA 1ZGJA 4B47A 1T33A 4A3LJ 3IAM2 2QQ8A 2COMA 3U9GA 4E7IA 4A3EJ 2R7VA 4M3EA 3RYRA 4S0HB 4N9HA 1XG1A 2EJRA 3QWLA 5E18F 2GXBA 3BT9A 5IT9Z 2X1CA 2BY0A 3GTOJ 1R1UA 1BR2A 2JTVA 2L02A 1O7FA 2Z33A 4J01A 3G1OA 1I39A 3WGHA 1R9TJ 1QRYA 3M8EA 1MJBA 2QCOA 4HDUA 3Q0WA 2IJLA 1W36D 2ELHA 1F4KA 3FMRA 3DF8A 1QA6A 3OV8A 2W4SA 2OV7A 2FMLA 3BTCA 4EJUA 4K2EA 3Q9VA 3EETA 1MBEA 1AKHB 4BQOA 1ZYRF 5BS6A 3PQJA 3K7AJ 3SQNA 3BJAA 3WG9A 1IC8A 4FCYA 4YIFA 3BR6A 5EGOB 3CCSI 2QA4I 3RTRA 2FBKA 2FQ3A 2IBDA 4FE4A 2VQCA 3IH2A 4XSZF 3CO7C 4Y33A 1MGTA 2E1OA 3OIOA 2A69F 4XKCA 2EQRA 4BBRJ 4IO9F 1YTYA 2JPBA 3ABLH 2LY1A 1LVKA 1AWCA 2CU7A 5C4JJ 1XN7A 3DKXA 3LSMA 3W2VA 1WWXA 2XPWA 1D8JA 2KISA 1MKMA 3WTYC 3KZIC 1I6XA 1Y0NA 2M7BA 2HVRA 3VFZA 4LG3A 3DCFA 5E79C 4UXNA 4XRSA 1AOYA 3KYDB 3QYFA 4EJTA 5LEKA 1XSDA 1SMYF 2FSWA 1MMSA 4IOCF 1BR4A 2O0YA 2B63J 2VJ4A 3WU2C 1QU3A 3TKYA 2KZGA 1FSHA 3D0SA 3DQVC 2P7CB 3CMYA 1R4MB 1SMTA 1JGGA 2CV1A 3IH4A 1PJRA 3QODA 5IP9J 1H8AC 3SZTA 1S29A 3U1KA 2K9NA 1MSFC 1W7PD 3V7CA 2K9MA 3M4OJ 3E3VA 4Q48A 2A07F 3KYLA 2Y69H 3KP7A 1FT9A 3KEQA 3BPVA 3DEUA 4IRHA 4NUBA 4DBRA 2J5PA 4R1HA 4EGYA 2DTRA 2ME6A 1X1CA 4OIRF 1X1AA 3IRRA 1TWFJ 4HZFA 1V54H 3MMYB 2DOAA 3RDIA 1VQ7I 3HSEA 2XUBA 5F0FA 1N75A 4OMZA 4RM3A 4ZYDA 3LQRA 2DI3A 5F1JA 3HOWJ 2VBWA 3QPSA 3L2VA 3A0HC 4I76A 4L9JA 4MLOA 4XSXF 3O8HA 3CLQA 4JK1X 2BY3A 4EEFG 2PJRB 2BHYA 1NHAA 4F52A 3I4NJ 3BQYA 2QQAA 3PSFA 3J80Z 1BW6A 3REOA 3WTSC 5EDNA 1NH3A 3NRVA 4FTHA 1KQ9A 2LG4A 1XC5A 1XGSA 4LITA 2WWYA 2B0LA 3HKZN 2FE3A 5E3OA 1QHHD 2P81A 1JI8A 2GA1A 1ZELA 2EIJH 3EPZA 4M3FA 3EQLF 3BCBA 1H9TA 5IOZA 2AQEA 4NDLA 4XLHA 4PCQA 2EFWA 4CYDA 3BTJA 4C3IJ 1U8BA 1ZR4A 2O03A 3ABKH 4RGRA 2EFOA 1K61A 3GTPJ 3A03A 4KIFA 1RRJA 2DYRH 3PNYA 1SFOJ 1Z6TA 3ZQCA 3S16J 3JRBA 1Y8QB 2AS5F 3KZZA 1R5GA 1IXRC 3G2BA 4NB5A 3NAUA 2PQ8A 4ESBA 2Y9YA 1A04A 2E7WA 1K78B 2OA4A 5HLIA 5K7FA 1TZLA 3DLAA 3ZQLA 4FX0A 2TDXA 3DEWA 1HDPA 3OR1C 1IDYA 4HNUA 2YPRA 5EZGA 2BOLA 3TQNA 4HSRA 3BR1A 2H8WA 1W0TA 5D6FA 1NK3P 1JT6A 3CCRI 2BW3A 5HVQC 2OU2A 4EVIA 2LF8A 4RAGA 2UWMA 3OYMA 4P5OA 2VN2A 1XGMA 3EUKL 3AG1H 2FX0A 4G7HF 3UKGA 1YHQI 4KMFA 1IUFA 2EINH 1LB2A 4BBSJ 1MD0A 1DDNA 5EJCA 2LK2A 2GBYA 2LY2A 1JTYA 2DA6A 2MBFA 5L3BA 4Y52J 4OMYA 2E1MC 4P55A 4F55A 2XC7A 4IEJA 5L3GA 3H3ZA 4I01A 4BS9A 2GLOA 3F72A 4PUSA 1IN5A 1Z1DA 5HS8A 3CJNA 4XBFA 1ZK8A 1O3TA 2YUSA 3IHUA 3V4GA 3LA2A 2DPUA 3BJOA 2JWTA 4I0BA 2R7RA 2QQBA 5CPRB 3RPUA 3HSRA 4XOTA 2KP6A 1R71A 1MJAA 1DGRM 3VYUB 1V3FA 4DGWB 4Y13A 5JI6A 2JA2A 4ZTFA 1B72B 3GYHX 4IHVA 1IXCA 3AL0B 2E5NA 1R7JA 2KIMA 1R22A 2JVHA 3CDHA 5CYVA 3TDUC 3CDIA 3QU6A 2L9SA 3ZQIA 1E0EA 1U5TA 2EA4A 3I5UA 3FXOA 4ANJA 4M9XA 1XCBA 2CUFA 4C3HJ 1Z21A 3OIQA 1UG2A 1WI3A 3VSLA 3LMMA 2OCCH 4CCMA 1UMQA 4GFBA 4PJNA 2F5CA 2WA0A 3M3YJ 1A36A 4O3MA 2LYCA 2P4WA 4HPQA 1BOBA 3MKLA 2DA3A 1XD7A 2DDAA 4CYCA 1SFUA 1ZLKA 4OIQF 4HX8A 4F92B 1F43A 1FC3A 3KEYA 3M9AA 2CUEA 2QYOA 4BHBA 1TC3C 2QM3A 1OISA 1B8IB 2HOAA 1B6AA 1G3YA 4DIQA 1R23A 4ZDPA 4Y17A 2ISYA 5FROA 2Y9ZA 1X2MA 4PSWA 2EZIA 3F6OA 3PIOF 3J7AY 4PJJA 5B1AH 5F1RA 1G4DA 1HW5A 2W84A 1G3TA 4MQ9F 2JSPA 2DK5A 1SAUA 1VQNI 1XMAA 5E3LA 1LVAA 5EEAA 4FETA 2OZ6A 3RKQA 2YU9J 4LJZF 3I4PA 3I3LA 4GGGA 5IY5H 2DLLA 2A6EF 2VOPA 2Z16A 4AYBN 2OF7A 4AWXB 2LLKA 2JA8J 3O8GA 1X1DA 1BN5A 2BEOA 4YG2F 1DU6A 3PNVA 2LBFB 4BYYA 5FD5A 1A6IA 2CW8A 4IL6C 2X6XA 5LRRA 3OSGA 2YX4A 1YS7A 2KDOA 1KU3A 4U88A 1T2KA 1WCMJ 2EFPA 1YX3A 5HNFA 2L2OA 2OZUA 4OOIA 2RVCA 3R61A 3M8JA 3K6GA 2VBXA 5GAGJ 5L3EA 3DEEA 1PP8F 4RMNA 3KETA 4BQAA 1IRFA 3TO9A 3P9CA 1XSXA 3OS2A 1BI2A 3GTKJ 1FOYA 5LFAA 2HPIA 3RSNA 3ONQA 1M1EB 5E3MA 2LFBA 5D4RA 4UB8C 5FRNA 2F2EA 4CCKA 1U78A 5FO5A 4MEXF 1LFPA 2J5OA 1HKTA 3W2AA 4PDKA 1CGPA 4KICA 1SVOA 3GEZA 3H3UA 1TWCJ 3HEFA 2DJNA 3IP4B 1LKXA 4D5FA 2GOXB 2WAQN 1Y6IA 2VQGA 3ECOA 1JKQC 3H92A 1X3WB 2DA1A 3H1CA 2KKOA 1T98A 3F8CA 3J7ZI 1NG6A 1RNLA 2F4IA 2BZTA 2IEKA 4IKFA 1T6SA 2AO9A 2G7UA 3HOTA 3BJ6A 2CWEA 3FXMA 2VPLA 2HWVA 3ZP5A 9ANTA 1Z05A 2H8RA 3VYRB 2E1MB 2NOJB 3OYFA 1QPMA 3H5NA 1LUJB 2NVXJ 3FKIJ 3S17J 2Y0SA 2QLZA 4HRIA 2FOKA 4BY7J 4U0YA 3WE3A 4HX4A 3CCLI 1ZG5A 2KT0A 1UHSA 1XMXA 3DPTA 2FEZA 4ZDOA 3SDBA 2R3SA 3HJEA 1PUFA 1X1PA 4AIJA 2DODA 2WTEA 3CCMI 4AYBA 1G59A 1N78A 1WQ2A 2RNJA 2VKHA 4RAFA 4ASNA 1W7PB 3BOQA 4CZZA 3A01B 2ZJQF 2VKEA 4G12A 2A6TA 2LR8A 2OC6A 5EEGA 2CV0A 4NBQA 3FHNA 1MZBA 3ROUA 2P0WA 3FXLA 1XDUA 2ZO4A 3MZ8A 2C6YA 4NHJA 2LKXA 2LMDA 5CJ9A 2ZCWA 3CCQI 1YFHA 3OMYA 4U7BA 3K4LA 4HEA2 5E20A 1IAWA 2I5UA 3KZYA 1PUEE 1BI0A 1ZRFA 4YEJA 2HQRA 2WY8Q 1YX5A 4ZJZA 4C9YA 4PFPA 3S3OA 2Z1DA 1HBXG 2ESHA 4HNTA 1ODDA 3HOXJ 3MWMA 3I58A 4BACA 1BIBA 2N8GA 2ID6A 1YG2A 4KYWA 2FQ4A 4AIKA 4XORA 1IGNA 3ML6A 4UUVA 1MBGA 3CCVI 1ETXA 2CQXA 2JQ7A 2E1CA 2NS8A 1LEBA 3OSFA 3V42A 1IJWC 3S2HJ 4XLNF 3FMSA 5L3DA 3RQIA 4EQQA 3S14J 5FKOA 2X1EA 3H9JA 4B44A 1CF7A 2KHMA 2OQRA 1ETQA 4F93B 1VQ4I 4M9SA 4BJTA 1GV2A 3Q5FA 1R49A 2R4GA 3P9IA 2HEOA 1FPQA 1QHGA 1S7OA 1I27A 4H0EA 2MC3A 4XNFA 5C4XJ 1RKTA 5ED4A 2W1OA 4A3CJ 1Z0XA 4U87A 4MO7A 1IZ1A 3C2GA 4UB6C 4AU7A 2H09A 2QVOA 4GYGA 3COAC 5GAHJ 2Z99A 2JT1A 3NWTA 3DTKA 3BROA 3HRMA 2AQFA 2H27A 1UZCA 2R7QA 2XGXA 2GXAA 3DFGA 5FKKA 3BTIA 3OY9A 4IZZA 2WV1A 2DJIA 2L9NA 1U2WA 2IVMA 3SEZA 3M8FA 2NS7A 1D1BA 2R0QC 5LLQA 3HRSA 1Z3XA 2O8XA 4A3MJ 1EA3A 5DTDA 2V4JC 3OYDA 3RZDJ 4HQEA 2GQQA 4ZH4F 3CD6I 5K1YA 2F5DA 4L9TA 2I8DA 2VJIA 2HQ5A 2W57A 3ZQFA 4A0ZA 3LFUA 4BXFA 5D5VB 1FX7A 1I50J 2E2IJ 5GPCA 3HM5A 1I3QJ 2WAEA 1IF1A 5HNHA 3FF5A 4WWCA 3J7YJ 2VI6A 3HB9A 3BG3A 5H6QA 2PEXA 2IA1A 2TCTA 3PSIA 4A3BJ 5J8CA 3T5XA 4MTDA 1ZRCA 2GM4A 3AG4H 3NEUA 2V9KA 3BR2A 4M71A 1V5GA 2Z3YA 3HIFA 2XSDC 4RGXA 1NTCA 1HSJA 4PJLA 2K4JA 2KMUA 2JRMA 1OCOH 4EV0A 3M7GA 1S5LC 3HOZJ 2XB5A 1WJAA 5TJJA 1RUNA 5HLHA 2ZFUA 4XLAA 1P92A 1ZRDA 1FLIA 3MFKA 2JJ7A 4P9FA 5F0HA 1MW7A 3RZOJ 3JRGA 2EV0A 4DYQA 3IC7A 4UY8I 3DBRB 1QVUA 5HDGA 3JRAA 2MABA 2HS5A 2V26A 1U9OA 4Y4RA 4DYCA 3FX3A 5DDGA 1IRXA 5JHUA 4A0YA 3P7NA 2GXGA 5ICEA 1LQ1A 4B09A 2LH9A 1J09A 4XRMA 5D5UB 3QOEA 2MG4A 3PFIA 4Y7NJ 4L5JA 1FBUA 2STWA 2K9QA 1FY7A 1F9NA 3C2BA 5DM7F 1EH6A 2KJCA 5DD4A 2COBA 4B8XA 2F5EA 5JR3A 1BW5A 2W00A 4EM0B 1WHUA 3BR0A 3U1DA 1QZYA 4WX9A 2STTA 1QPIA 3HPHA 5F64A 1QBJA 3OYGA 2R92J 4ITVA 3EYYA 1IXSB 4HF2A 5E1WA 3RI4A 4EATA 1V5EA 1TT5B 2CW7A 3KP6A 3VODA 2ZKZA 3JRCA 1FTTA 1G8XA 3SEQA 3BG7A 4YFKF 4KISA 3K69A 3IL2A 1T08B 1G2HA 4KIGA 3TOAA 2E34A 2W48A 2NNYA 4HLYA 3ZMVA 3WODF 2V9PA 4AVZA 4E7JA 3W6JB 1OJLA 2IW5A 3ZQGA 2DPDA 5DV5A 4CXFA 3JRIA 3H9GA 4LB5A 4XN0A 3LNQA 3LWFA 3V7SA 2HPMA 1GXPA 4D1QA 4TV7A 1YIJI 2HDCA 3MZHA 2F4OB 4II3A 3V8KA 2M45A 1ULYA 2Q0OA 3J7AO 1RETA 3L7WA 2G9WA 5LRSA 1WH7A 3OYIA 4LG0B 1OR7A 1B1BA 2ZBKA 4GXOA 1LE8A 5LBQA 2XGEA 2EB7A 2VE9A 4U0WA 2EFQA 2LOOA 3IKVA 3E97A 3T8RA 3PNTA 1KYWA 1W0UA 3B73A 1FP2A 2HU9A 2K7LA 2JA5J 3CUQB 3L1PA 2WV0A 2RGVA 3G6EI 2QSGX 1ERDA 2P8TA 1IN6A 2FBHA 2M30A 4FISA 4G94A 1LJ9A 4S04A 3ZQQA 3B6AA 4XLEA 3MZYA 3HL2A 3F8FA 2ZMEB 1VF9A 3BPXA 3S32A 3LAPA 3HXLA 4RDUA 1K7AA 2X0LA 4FE7A 2CSOA 4CGZA 2OTJI 2DT7B 1O57A 4ON0A 1Z9CA 3I0TA 3QPLA 4GO1A 1MBFA 4PZJA 1BA5A 4ZTJA 2R7ZJ 4O6JA 1QVTA 1GV5A 2VQLA 3SDGA 3G1MA 4E6KG 1B59A 3FM5A 2JUCA 1MNDA 2XASA 4L5EA 3HZJA 1N25A 2I10A 2XGDA 4AD9A 1VQ6I 2IA2A 4GRIA 4RGSA 2FRHA 1YRNB 1OCTC 5H6RA 5JVTA 2VJJA 5D8KB 1FEXA 2IGNA 4G9YA 4A3IJ 1HSTA 2CFXA 1D0YA 3FK7A 4MQVA 4ZYAA 2FXAA 4PSXA 3L2RA 2W24A 4JX5A 4W97A 5EEHA 4A69C 3K4NA 1AA7A 3WHBA 1ACIA 3GFMA 4LMYA 1BI1A 3D5SC 3GLXA 3E6CC 2HZTA 1P7JA 2JRTA 2LREA 3J80K 2ELKA 3ABUA 4M72A 4IHXA 4RBOA 4KA4A 3JW4A 2M0CA 2L0KA 5LGNA 1FMVA 3ZQ7A 5D5XB 3CC2I 1P6RA 5AIQA 3I55I 4GDFA 1BJAA 4OIPF 3GX4X 2HZDA 3IUOA 3GUDA 3WTWC 2D2WA 2OPTA 2OCEA 3GTQJ 1ZAOA 5B66C 2EPFA 3BC8A 2BHZA 4XL9A 4N0BA 1X3UA 5ILSA 2HTJA 5DCMA 3ZRGA 4WXCA 2Q2EB 2K02A 3HDDA 3KPHA 4A3DJ 3FBIB 4IHTA 3FXQA 6PAXA 1S9HA 2YS9A 3QAHA 4BEHB 3S2WA 5FFXA 1Q1VA 5EZHA 2BVMA 3BWGA 2HQAA 3CF5F 5KHDA 2GA2A 1E3PA 2KRHA 3I59B 2VOOA 2K40A 1ETYA 1RR8C 4GYIA 4KN7X 4FASD 4UUSB 1JHHA 2QZ8A 1ON1A 4I99C 4XRSG 1XSVA 2PI0A 2M87A 2ID3A 1MDMA 2D1VA 1K4SA 2XRLA 1KA8A 2KIFA 5B3SH 2V79A 2VASA 2HR3A 3WU1B 5BPIA 4CO8A 2R5ZA 1FZPB 5IT3A 2VKVA 3A1YA 3Q0UA 3T1BA 2DO7A 3DU5A 3KYCB 3TL4X 1SVLA 3L2CA 3PO3J 1OR7C 1A6QA 1YW9A 2GZWA 1E3HA 1X1BA 2QEXI 2Y30A 4ZYHA 5BQTA 1POGA 2A5WA 2XKPA 4HSTA 3GMEA 1DGWY 2QQ9A 3EDPA 5D4SA 1FTZA 2AXLA 4LIUA 1VQOI 4CCJA 3C2HA 2XPUA 2RQPA 1ETVA 1QQIA 2M2EA 2CGPA 2LDUA 3KP3A 2XV4S 3FXUA 3CMAI 2CG4A 1L0OC 5F0CA 2RV8A 3TP0A 3OYAA 4D7MA 3G1LA 2NVQJ 2QGUA 3VEPA 2FBIA 3L00A 2L9RA 2NAZA 3PFYA 1Y1WJ 4HAMA 1XDSA 3DPUA 3OYBA 2DFFA 2ZNZA 5DUIA 5BMZA 2VL8A 3WE2A 4CH7A 4HW0A 1RR7A 1OYIA 2DMPA 4M3DA 5FGMA 3CP8A 5IYCJ 2BXYA 2X6YA 2XAHA 2QBYB 5IP6A 1HLVA 4KMUX 4LLGF 2K85A 5KAIC 5GTIC 3R6SA 3RPUD 3W2WA 2ISZA 5CVIA 3GCMA 2DMQA 2Y31A 1FBSA 2UV1A 1HF0A 3FMQA 1BC8C 3HOSA 1V55H 2M4GA 4RB1A 2L54A 3OL4A 2PMHA 2VC1A 1WZ2A 2VJ5A 3FKJA 3R0JA 3ZMZA 1D5VA 5LGTA 1SD7A 1RESA 3H3VK 3HKZA 5EG0B 1T0FA 3M07A 3GTLJ 3SXYA 1JKOC 4Q5SF 3ZXSA 3N97A 5KCMA 4DZPA 1GDTA 2XGCA 2VC0A 2IGOA 2IS1A 3HBLA 3NWSA 4GCVA 2O61A 1X4OA 2CQ7A 1JJ6C 5CQGA 4CCLA 3H36A 1A35A 2NXNB 1BI3A 2DA2A 1Z91A 3LFKA 3C18A 1D3YA 3BZ6A 4FT8A 2FJ1A 1FSEA 1DPUA 3HUGB 5HS7A 1XB4A 2VIXA 1ZG3A 3LOCA 1UFMA 2MW8A 2MC4A 3KP2A 3PUFA 4KDPA 3D5LA 2DQRA 3WU0A 1YW8A 1OLTA 3CUOA 5D6EA 4V19K 4UVCA 1P7IA 3TOBA 1V5FA 3UR3C 4R79A 5E8GA 2WAFA 1QGPA 1L3LA 4LLNA 1LFBA 2QWWA 5M3FJ 1R1TA 1TWGJ 3OL3A 4CCOA 3GXOA 2YR2A 1JJ8C 1UJ8A 3K4BA 3DTIA 3KIOA 2DU9A 3NQOA 2NYXA 1TLHB 1FNNA 2M7AA 1H89C 2RNGA 2XAJA 1TQIA 2HKXA 1K4TA 1UELB 2DMUA 2VXDA 1XMKA 2QSFX 4L5IA 1S7AA 4BUPA 2E5ZA 1ZH5A 4CCNA 2L7MP 2Y0MA 2M9HA 1TQMA 2BE5F 4HV6A 2VQHA 1APLC 3ZMUA 2LY9A 2LNBA 3ULQB 1YJ9I 2IP2A 1USSA 3CCUI 3CC4I 4I7HA 1A31A 1LDKB 3OYCA 2XVCA 3IAS2 1I5ZA 1FP1D 3GFIA 2DN0A 1K79A 2DOEA 2MH2A 2XSJC 4B1RA 1AKHA 2O6GE 3H9QA 2DOFA 4WXDA 1JKRC 1JHFA 3TO7A 4P9UA 3P9KA 2GIVA 3KP4A 4MNUA 2HYJA 3KP5A 5EGOA 1MMAA 1QZEA 1JUPA 4IVNA 1IRGA 1HDDC 3ZCOA 5E3NA 1WH5A 1DPRA 2E71A 4XOPA 4XLCA 4HA8A 5J1RA 3CUQA 3K70D 1QO0D 2R7FA 2X85A 2EILH 1A5JA 5CVUA 1B4AA 2RC4A 3T0YA 5GTHC 4BJ5C 2IRFG 3JRFA 4V2GA 2Y75A 4G8XA 2MD5A 4G7OF 3K1MA 3TGNA 5LHHA 2HVSA 1TWAJ 1FOWA 2VB6A 3JAMK 5FLMJ 1HKQA 2RAEA 3GZNB 1OPCA 4AIDA 3HRTA 5A2QK 1R58A 3F8MA 3L9FA 4YFXF 4M73A 3FXRA 1X4PA 5HODA 4CHUA 1KGSA 2ZXHA 4PFOA 3VB2A 2VKDA 2IA0A 2VXZA 1ZHFA 5FKNA 4A5NA 3OYEA 3IV5A 3HOUJ 2HTSA 1U6GA 5F08A 1HW2A 2PBIA 1IG7A 1T0FC 2CYYA 2LKSA 2FNAA 3GVAA 3P5JA 2L7KA 1WGXA 1U5TC 5B1BH 4CSWA 4RAYA 3I71A 3GTMJ 3ZN0A 3JAMZ 3GF2A 1KONA 1JKPC 4XM3A 3SHFA 4ZYGA 1Z67A 2LSOA 5A2QZ 2DFIA 2K4BA 1JE8A 3ABTA 4RLFA 1YITI 2D5VA 2DYSH 3H0GJ 3F22A 1IV6A 2FU4A 1TQPA 1R4NB 1SANA 3S8PA 4HV5A 5K5OA 4D0PA 2CW0F 4N9IA 4MGRA 1MBHA 1B9MA 3ISPA 1Y56A 3W6KB 4BL0B 5JLXA 5JFRA 2XF5A 5ILUA 1GVJA 1DU0A 3SFIA 3FISA 3WHCA 4QPQA 4Y3OA 4DJAA 5BOXA 2EBIA 3E5XA 1RZ4A 1VTNC 1F36A 3E5UA 2L01A 2P5LC 1O3SA 1EV7A 2HVQA 1R1VA 1TWHJ 2M34A 3LQQA 2XF7A 1KYZA 2YSRA 4MHGA 2VLAA 4FX4A 4XQFA 1G3SA 3BTLA 2PJRA 3S1NJ 2LF7A 4NC7A 1R5HA 4HQMA 3HGYA 4WXHA 1O3QA 1EKEA 1E17A 2R7XA 3S3NA 1JUSA 1ZR2A 2ZSIB 3QYBA 4XIDA 3E0JB 1WFXA 3A2KA 4BAYA 4ZYEA 1BOAA 2K9LA 4UUSA 2HOTA 2AXTC 4XLFA 2HDWA 1BR1A 5ICCA 4QWQA 3K4CA 4JOMA 4XICA 2P5VA 1KU7A 2WAQA 3JRDA 2JMWA 2L4MA 1ONVA 1VQ5I 2R5YB 3HGGA 4XKVA 2R7WA 1IV8A 4RAZA 1BBYA 3F6VA 4NC6A 5GADJ 4G7ZF 2E2JJ 2EZLA 4CUGA 4QIWN 4AC0A 5J3LA 4A6EA 2A05A 3HYIA 5IYBJ 1WJFA 1U0JA 1K78A 1CQTA 1D5YA 5HDNA 1D0XA 1BJZA 3I56I 2O8KA 4ZZLA 5LHIA 4A3KJ 1EH8A 3VPRA 2CFOA 3O6BB 4QPOA 1MJ9A 1W4MA 2RDPA 2A68F 3FDYA 4NQWB 3WG7H 4W1UA 2AHQA 3ZOBA 3K70C 1WJDA 3OOUA 2HXIA 2ZXIA 4A5MA 4ESJA 2VE8A 1BC7C 5DCFA 1YE9A 1VQMI 3BZCA 2NVTJ 4LOCA 4CA0A 4RA2A 1OCPA 2QF7A 4XRFA 2ZJRF 1HOMA 5B5EC 3GWZA 2XPVA 2F6CA 2H1KA 3DKYA 2DQLA 1R00A 1BL0A 1DP3A 2BW3B 2X51A 5FRMA 2K3PA 2DDBA 2R93J 5F04A 1VZ0A 1EH7A 4O5VA 1X2NA 3HOVJ 4RGUA 1G3WA 3HOYJ 3OS1A 2UUZA 5K7HA 2DA4A 5EF6A 4RS8A 2M4KA 2VBYA 4IRGA 4PJMA 4M3BA 4E4HA 1K6YA 3IRQA 1OYYA 4LGWA 2NOGA 1JTXA 1YJWI 2KDZA 1YJNI 1OCRH 4XMYA 3R4KA 4LK1F 1S72I 2F4MB 5HLTA 3CCYA 3CP2A 1B72A 2A5YB 2QKMB 4RLQA 5HS9A 2XDVA 2ADUA 3HTSB 1YOVB 3W3CA 1WVRA 4UV9A 2JVGA 1TP4A 1P4XA 4JX4A 3HHHA 3DKWA 1OQYA 2HI3A 4L9NA 4N4NB 1WPKA 4KNYA 1Z7UA 4F7ZA 4XR6A 3LAJA 4J19A 2DBBA 4M6XA 4XN3A 3UNGC 3GZ6A 5L3CA 3QYEA 3ESWB 1YQAA 2Q1ZB 1H88C 2LTPA 3EUAA 3M1CA 5E8IA 5HDKA 2KIUA 3U21A 2OJED 3BQZA 1K6OA 1U5TB 1SD4A 3LSKA 3FZVA 2V6EA 2CS3A 3K1PA 4FHTA 2H1LA 5HLGA 1ZN2A 1Z7LA 1TW3A 4A3FJ 3PJRA 2HDDA 3A02A 1FOKA 2ZNYA 1B8IA 4BE0A 2X4HA 2ZXJA 1YIOA 4C3JJ 1WJBA 2BYVE 1W5TA 4F3QA 4BE2A 2GAUA 1OKRA 3L2WA 5DYMA 4D9JA 1NG7A 4CYCB 2MLGA 2KQRA 5E1XA 5ERIA 3K1NA 4JBAA 1ORKA 2FD5A 3S15J 2XAFA 2IPQX 3CCJI 2PFBA 3CESA 1ZQ3P 4KFCA 2JUGA 4HLXA 2V9VA 1MH4A 3FWEA 1JT0A 1SAXA 3DWLE 2EZKA 2CUJA 4HX7A 2IS6A 2A3SA 2Y2ZA 4OIOF 4FQGA 4A6DA 2XAUA 1F1ZA 1TT0A 5HOOA 3SJMA 4D7NA 2ACJA 4RB0A 2KRCA 4H4KC 3OYLA 2ZJPF 3TP3A 1J2XA 5J40A 3ECHA 4JQFA 2BBYA 3DV8A 5AONA 2LBFA 1S3JA 1MBJA 1FYMA 4A93J 3DPLC 2DK8A 3CQZJ 3N05A 3Q9SA 2ZJ2A 2R7DA 4OU0A 1D1CA 2K9SA 2KZVA 3V8JA 3LSTA 5L3FA 5M3MJ 2H94A 5GPAA 3GW2A 5IOYA 2GIZA 1TBXA 4PGHA 1SFKA 2VPRA 1KQ8A 3K2ZA 1KQ0A 2IAIA 4IXAA 4HF0A 4LB6B 2D45A 4LD5A 4BU2A 1GHCA 2PX9A 3OOPA 4C30A 1N77A 4X0GA 3LSRA 1WI9A 2VUMJ 2BVLA 1I1GA 4DQ2A 3VWBA 5J8FA 3HRUA 1IRZA 2HXOA 1HQCA 3DTEA 3H35A 1C0WA 4UVAA 4L9VA 2NVUB 5DD8A 4WF2A 4LLLA 2JSCA 2WBMA 3QP5A 3N4MA 2L7ZA 3S1MJ 3QPHA 5C3EJ 1U8RA 3BG6A 3E6BA 4B3AA 2OAZA 5JVGF 1ON2A 1RKWA 2B9SA 5IPAA 3K9TA 2M0MA 2PLYA 3G71I 2BV6A 4L0ZB 2FUG2 2DT5A 4C2MJ 3ASNH 2RN7A 2ZXWH 3D1NI 2ECBA 3RKXA 4M3GA 4D5CA 5CQEA 3SYTA 2Z2SB 4G6TB 3MEXA 1XPXA 2V1NA 3CLOA 1YW7A 1MIJA 5JLWA 4F91B 2IXSA 2E19A 1TNSA 3F3XA 4QSHA 1VQ8I 1ZREA 1XX5A 2DCEA 1RPWA 3KLOA 4BGDA 4C2UA 3AL0C 3PO2J 2P5KA 3CF2A 2MSYA 3EYIA 1FYLA 5BPDA 3JREA 2QENA 3OS0A 2R7SA 3CCEI 4P96A 1HA8A 1HKSA 2MGQA 3GFJA 4B48A 4DBQA 1LEAA 5KVRA 4KIBA 5LD2C 3K2AA 3K4MA 3ZMTA 3C7JA 1T8IA 2X48A 1EJ9A 4B4CA 4DW6A 1R36A 2EIKH 1J5YA 2IGKA 4OWRB 1W7PA 4ZZDA 3A01A 3S2DJ 2X9DA 4BXXJ 2Q8KA 2W25A 1D1AA 3TW6A 3ZQHA 2NS0A 5CLSA 4IHYA 2FF4A 2X6WA 3DU6A 2ETHA 2JA7J 2OTLI 1WRJA 3OR2C 1ETWA 3O2PE 5KAFC 2HNHA 1PUFB 1OCCH 2ELJA 2XAGA 4C2TA 2DAOA 1FWZA 3L2QA 3ZN1A 2YX7A 3CO6C 2K86A 2P7VB 2Y48A 3WTTC 3CTAA 4WK8F 1I6HJ 3K10A 3LSJA 2H6BA 3GTJJ 3KE2A 4IHWA 4DZJA 3JRHA 4ENMA 1R5ID 2ME0A 4DOZA 4BDZA 2EK5A 3FHZA 5TGTA 3SZGA 3S3MA 2HKOA 1MMDA 1P9QC 1Z6RA 2E36A 3CDLA 1J9IA 3RIRA 4EJOA 1J75A 1VQ9I 1FYKA 1LDDA 4NNJA 2O9LA 1QNTA 1G6NA 2R5YA 4ZC3A 2PMUA 3WTVC 3RYPA 2W85A 3MKWB 5J4VA 3T8TA 4E7KA 2L9VA 2JN6A 1USTA 1RIOH 3BCAA 1MMNA 4Z2YA 5CVJA 4EM2A 4IRIA 2E60A 3IH3A 2EFNA 2VODA 2IT0A 1OYWA 2HOSA 3OYNA 2KPMA 2L4AA 1W36C 1CF7B 4ESFA 1FBQA 5J47A 4EGZA 4LFUA 2ZC2A 3TMOA 3NARA 4KITB 4BQNA 4ENJA 1UHMA 4NQWA 1ETOA 3U2RA 4B43A 1V4RA 4QLCU 5M5XJ 2HFHA 2M8GX 3ZMSA 4AUXA 4IPAA 2CRGA 1VQKI 2V1DA 2D1HA 3H5RA
chains in the Genus database with same CATH topology
4YELA 3SEZA 4Y33A 1D1BA 4BJ5C 2CUZA 1Z3XA 1EA3A 4XKCA 4PK4A 2V4JC 3OYDA 2HVSA 2LY1A 1LVKA 2VB6A 2I8DA 3AKZA 2VJIA 3DKXA 3LSMA 3W2VA 2IS4A 3LFUA 4KT6A 4BXFA 1X4PA 2WAEA 2M7BA 2ZXHA 4PFOA 5HNHA 3MKZA 2HVRA 2IGMA 2VKDA 4LG3A 2VXZA 3OYEA 4B3XA 1PYVA 3QYFA 3PSIA 2V9KA 1BR4A 1T0FC 2VJ4A 2L7KA 1QU3A 1V5GA 4CSWA 3DQVC 2CV1A 1KONA 1PJRA 3QODA 4XM3A 4PJLA 2M3AA 2CMPA 2KMUA 4N4OB 2O5RA 1WJAA 2ZFUA 4XLAA 2K9MA 4RLFA 3E1SA 1MW7A 3S8PA 3KYLA 4NUBA 3KX2A 4DBRA 4BL0B 1Y56A 2MABA 2V26A 2XF5A 1X1CA 4Y4RA 1X1AA 3I9V2 4QPQA 4Y3OA 4DJAA 1IRXA 3HPGA 3MMYB 2DOAA 4HG2A 2LH9A 1J09A 2HVQA 3QOEA 2XF7A 1N75A 2VLAA 4RM3A 3VSKA 4XQFA 3PL8A 2RQQA 2PJRA 3L2VA 4NC7A 3GBGA 2W00A 4MLOA 3HPHA 2PJRB 4F52A 3PSFA 2R7XA 3S3NA 3OYGA 2ZSIB 3CMMA 3QYBA 3E0JB 1WFXA 2R7OA 4ITVA 3A2KA 4EATA 2LG4A 1V5EA 2CW7A 2K9LA 4LITA 1G8XA 4XLFA 3SEQA 2HDWA 1BR1A 1DQUA 1R6RA 1JI8A 1QHHD 3BG7A 3K4CA 4JOMA 4KISA 2WAQA 1ZELA 3EPZA 3BCBA 4YRVA 3OYKA 2AQEA 4XKVA 2R7WA 4XLHA 4KJZA 3ZR8X 4AVZA 4E7JA 4CUGA 3H9GA 4XN0A 3PNYA 1WJFA 1U0JA 5CKTA 2HPMA 4D1QA 1D0XA 2LC2A 4II3A 3G2BA 5KNLA 2CFOA 4LIVA 4QPOA 3OYIA 3MKYB 1TZLA 3DLAA 2DT6A 3FDYA 4NQWB 3OYJA 4E7HA 3OR1C 3K70C 1WJDA 3OOUA 4XKBA 4HNUA 2ZXIA 2LOOA 3PNTA 2BOLA 2HU9A 2WB1A 4HSRA 3EUHC 1YE9A 4CA0A 3BLYA 2BW3A 5HVQC 1ERDA 2UWMA 2F6CA 3OYMA 4P5OA 3DKYA 2F5VA 2GOMA 3EUKL 3ZQQA 4XLEA 1DP3A 2BW3B 2X51A 5FRMA 2K3PA 2KLOA 3HL2A 3S93A 1VZ0A 3S32A 3HXLA 2WY7Q 4J00A 2DT7B 2LY2A 3OS1A 2UUZA 2E1MC 3F9KA 4F55A 2M4KA 2XC7A 2QKLB 3A4CA 4BS9A 4ZTJA 4PUSA 4PJMA 2MFZA 4E4HA 1K6YA 1GLNA 2MD0A 2VQLA 4E6KG 1MNDA 1WJCA 4XMYA 2R7RA 3PUBA 4GRIA 5HLTA 2CH0A 2VJJA 3CP2A 5CPRB 2QKMB 2IGNA 4XOTA 2KP6A 1UAAA 4RLQA 2XDVA 4NC8A 1DGRM 3LSGA 3VYUB 4DGWB 1D0YA 3W3CA 3VDXA 2JVGA 2JA2A 4ZYAA 4ZTFA 4PSXA 3L2RA 3K4NA 1AA7A 4N4NB 2V7FA 3AL0B 4XR6A 3D5SC 2E5NA 1FMWA 2JVHA 4BJ6C 1E0EA 2L9SA 3UNGC 4XN3A 2LREA 3QYEA 4ANJA 2Q1ZB 3EUAA 3LSIA 1Z21A 3M1CA 2ZSHB 3OIQA 1FMVA 3U21A 3VSLA 3LMMA 4CCMA 1MMGA 4PJNA 3LSKA 3H0DA 2V6EA 2CS3A 1Z3YA 2WA0A 4IQ4A 2HZDA 3IUOA 2LYCA 4HPQA 1BOBA 1Z7LA 2XF6A 3PJRA 1T95A 4BE0A 3BC8A 1WJBA 4F92B 4IQJA 4XL9A 4F3QA 3KEYA 4BE2A 3ZRGA 4BEHA 3L2WA 4D9JA 2Q2EB 1NG7A 4CZCA 2KQRA 4RM2A 3FBIB 4E7LA 1S9HA 4DIQA 3K4JA 4ZDPA 4BEHB 5FROA 4PSWA 3CESA 2JUGA 3J7AY 2BVMA 4PJJA 2HQAA 5KHDA 2KRHA 3DWLE 4BE1A 2CUJA 2IS6A 5JHFA 2JSPA 4FASD 1SAUA 3HC7A 2XAUA 1TT0A 5HOOA 4FETA 2KRCA 4H4KC 3OYLA 3I3LA 2VASA 1D0ZA 4IX7A 4JQFA 2Z16A 2LBFA 3A1YA 4BDYA 3VYSB 1WJEA 3DU5A 3DPLC 1X1DA 4OAYA 3N05A 3D5RC 3TL4X 3LSHA 1OR7C 1D1CA 2KZVA 3PNVA 2LBFB 3OIPA 1X1BA 2CW8A 2X6XA 4P1WA 1SFKA 2A5WA 2KDOA 4HSTA 1DGWY 1YX3A 5HNFA 2L2OA 1MNEA 4BU2A 4LIUA 4C30A 1N77A 4CCJA 4X0GA 3M8JA 3C2HA 3K6GA 2BVLA 2X1DA 3DEEA 2WADA 4RMNA 3VWBA 3OS2A 3H35A 3DTEA 4XONA 2DXIA 5LFAA 3OYAA 2HPIA 2IS2A 3RSNA 2OUMA 3ONQA 3ZGKA 2WBMA 3TBIA 5FRNA 3MD2A 4CCKA 3BG6A 3PFYA 3OYHA 1LFPA 3W2AA 3DPUA 3OYBA 2M0MA 2L5QA 2VL8A 4CH7A 3IP4B 2FUG2 3CP8A 1LKXA 2GOXB 2X6YA 1Y6IA 2VQGA 3RQ4A 5CQEA 3SYTA 2Z2SB 4G6TB 3FBNB 2V1NA 4E7ZA 2MYSA 3RPUD 3W2WA 4F91B 2IXSA 1NG6A 3K4KA 4IKFA 2F4IA 2UV1A 3L2UA 2DCEA 4BGDA 4C2UA 3AL0C 3HOSA 3CF2A 3HOTA 2M4GA 3OL4A 2VPLA 2VJ5A 3FKJA 3OS0A 2R7SA 1HA8A 3HKZA 2W82A 3VYRB 4B48A 2E1MB 2NOJB 3AFHA 3OYFA 4DBQA 2RREA 3H5NA 3ZXSA 5KCMA 5LD2C 2Y0SA 4HRIA 3HG9A 2K5CA 3K4MA 2IGOA 2IS1A 3NWSA 4XKWA 3RCOA 3VYTB 3CZ6A 3H5AA 1X4OA 5CQGA 2PMZA 3DPTA 4CCLA 4ZDLA 4ZDOA 2IGKA 4OWRB 3SDBA 4BQQA 1UG0A 1D1AA 1G59A 3CJQB 4AYBA 1N78A 2W7NA 2VKHA 2X6WA 3DU6A 3HUGB 2VIXA 3OR2C 3LL7A 2HNHA 2ELJA 2R7UA 2CV2A 2A6TA 4C2TA 1WJ5A 2MC4A 2OC6A 4OAZA 2CV0A 3D5LA 3FHNA 3OWTA 2P0WA 3L2QA 1OLTA 4E7SA 1V5FA 4II2A 3UR3C 4R79A 2LRDA 2WAFA 1X19A 3K10A 2R7TA 3CJRB 3OMYA 2KL4A 4U7BA 3K4LA 4HEA2 4BDZA 4DOZA 3OL3A 4CCOA 5TGTA 4B47A 3SZGA 3K4BA 3S3MA 3DTIA 4YEJA 1MMDA 2WY8Q 1YX5A 3IAM2 4ZJZA 1P9QC 4C9YA 4PFPA 4E7IA 3S3OA 2Z1DA 2M7AA 4NNJA 4HNTA 2RNGA 2R7VA 4BACA 1UELB 2VXDA 4BUPA 4ZC3A 4XORA 2E5ZA 4CCNA 3MKWB 4E7KA 2X1CA 1BR2A 2VQHA 3BCAA 3V42A 1MMNA 4J01A 2X1EA 3H9JA 4B44A 2KHMA 4F93B 2E60A 1LDKB 3OYCA 4BJTA 2L9NA 3IAS2 2R4GA 3OYNA 1W36D 2KPMA 1QHGA 1W36C 2XSJC 4XNFA 3H9QA 2W4SA 2OV7A 3TMOA 2W1OA 4KITB 4BQNA 1MMAA 4U87A 3C2GA 4AU7A 4BQOA 3ZCOA 4B43A 3NWTA 3DTKA 4XOPA 4XLCA 2AQFA 3RTRA 3K70D 2R7QA 2VQCA 2X85A 3OY9A 4IZZA 2DJIA 3H5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZSH B;  2ZSI B; 
#chains in the Genus database with same CATH topology
 1H9G A;  1VI0 A;  4YEL A;  5LEJ A;  2L7F P;  4MFE A;  1B9N A;  2CUZ A;  3EUH A;  4PK4 A;  1Y39 A;  1ZLJ A;  3QU3 A;  4I09 A;  3I54 A;  3RPQ A;  2DTZ A;  4DYR A;  5J1Y A;  2OQG A;  3AKZ A;  4HDV A;  5H20 A;  2CQK A;  1TL8 A;  2IS4 A;  4KT6 A;  2B7E A;  1ITY A;  4AIH A;  4HYE A;  1PDN C;  1W1W E;  5KK1 A;  5CVR A;  4JX6 A;  2XRO A;  3MKZ A;  2CO5 A;  5DS9 A;  2IGM A;  1F5T A;  4OIN F;  4B3X A;  3AG3 H;  2H6C A;  2QUF A;  1Z77 A;  3WTX C;  1DP7 P;  1PYV A;  4KT5 C;  1MBK A;  3F23 A;  2O7O A;  4I0A A;  4UUT A;  1UCR A;  1TNT A;  1VQL I;  2HQN A;  3F8B A;  3PIP F;  1XGN A;  1ETK A;  2M3A A;  2CMP A;  4N4O B;  3BP8 A;  2O5R A;  2V1U A;  2WB1 N;  4ENN A;  4JP0 A;  2Z5U A;  2NNN A;  3E1S A;  3L09 A;  4MFD A;  1ZG1 A;  3K0L A;  3FXJ A;  4S05 A;  1ZTR A;  3CC7 I;  2K3F A;  2LP0 A;  2UXX A;  3KX2 A;  1UHW A;  1YLF A;  1O3R A;  1T56 A;  4UNO A;  1MNM C;  4I6Z A;  3I9V 2;  2FNP A;  2ZFW A;  3RKY A;  3HPG A;  5H2F C;  4EMS A;  4DNC A;  4HG2 A;  2MLK A;  4BKX A;  3C1D A;  1BM9 A;  3V7R A;  1D8K A;  3TW7 A;  1K83 J;  4A2U A;  1W5C C;  3S1Q J;  5C44 J;  3MAJ A;  2V6C A;  1PP7 U;  3GTG J;  4HBL A;  2BY1 A;  2JPC A;  4MTE A;  3VSK A;  5BNG A;  1JXS A;  3AG2 H;  1Y0U A;  3PL8 A;  1HCR A;  2RQQ A;  4RB2 C;  3BZK A;  4E70 A;  2EV6 A;  2BGC A;  4IOA F;  3GBG A;  2ICW G;  2RKH A;  2A6H F;  2VT3 A;  3BDD A;  5FJ8 J;  1TTY A;  3WGG A;  2V1X A;  3M1E A;  3JTG A;  3CMM A;  2R7O A;  3W6V A;  4EJV A;  5DEQ A;  3BG9 A;  4U7D A;  2JK3 A;  4A12 A;  1LDJ A;  1SD6 A;  2EIM H;  4BXU A;  1DQU A;  1R6R A;  2DFE A;  2O3F A;  2M5W A;  1DUX C;  2OBP A;  5LGU A;  5K5R A;  5DM6 F;  4RB3 C;  3HSF A;  4YRV A;  1YYV A;  2E7X A;  2XRN A;  3OYK A;  2Y0S N;  1HW1 A;  1JUM A;  4BH9 A;  1KU9 A;  4KJZ A;  3SFZ A;  2DMT A;  3ZR8 X;  1LPQ A;  2VON A;  3KCC A;  3C3W A;  2M8E A;  1AU7 A;  3I4M J;  3DP7 A;  2UZK A;  3F0C A;  5CKT A;  2EH3 A;  3R0A A;  4M9Z A;  4YII A;  4LG0 A;  2LC2 A;  2CQQ A;  5KNL A;  1Q1H A;  4LIV A;  4BHP A;  2K27 A;  5M5Y J;  1O4X A;  5TIS C;  3Q3S A;  3MKY B;  3LSP A;  2XKO A;  2ESN A;  2DT6 A;  2L3D A;  3BY6 A;  3MVP A;  5DUK A;  1SVM A;  1GT0 C;  2LD5 A;  3DLL F;  3OYJ A;  1GXQ A;  4E7H A;  4EM1 A;  2XAQ A;  4XKB A;  4BY1 J;  3MQ0 A;  3PM1 A;  4V2F A;  2KIQ A;  1LE8 B;  3V8L A;  2WB1 A;  5FD6 A;  5J4Y A;  3EUH C;  3B02 A;  2WC2 A;  2VBZ A;  3LA3 A;  2DA5 A;  3BLY A;  5F27 A;  5FLV A;  2HYF A;  2ZME A;  1S6L A;  5GP9 A;  4MIM A;  2F5V A;  2GOM A;  5FB2 A;  5TRD A;  3IWZ A;  2KLO A;  3S93 A;  2FA5 A;  3MN2 A;  3BR3 A;  1GUU A;  2WY7 Q;  4J00 A;  1SFX A;  2CQN A;  2NRA C;  3G73 A;  3F9K A;  4KN4 X;  4ETS A;  2QKL B;  3A4C A;  3BR5 A;  3JTH A;  4G6D A;  2MFZ A;  3F8N A;  1IN4 A;  3ASO H;  1E3O C;  1YRN A;  1IN8 A;  1GLN A;  5J6X A;  2MD0 A;  2JZY A;  4Q47 A;  1WJC A;  2GWR A;  1STZ A;  1YO5 C;  1ENH A;  3PUB A;  5FLX K;  4HOB A;  1GVD A;  2CH0 A;  1E2X A;  1FJL A;  2BXZ A;  4UVB A;  1UAA A;  4QTR A;  2QSH X;  4NC8 A;  3MCZ A;  2VT2 A;  3GLL A;  3LSG A;  1X3Z B;  4L0Y B;  3G4S I;  3VDX A;  2MA3 A;  2G7H A;  1HXD A;  5ILV A;  4AM3 A;  3BG5 A;  2F5F A;  2OD5 A;  2V7F A;  1REP C;  3GO5 A;  3WTU C;  1MSE C;  1FMW A;  4BJ6 C;  1J59 A;  1IUY A;  2G0E A;  4IJA A;  3TDZ C;  1T39 A;  2A61 A;  1FIP A;  3FXK A;  3DXJ F;  3LSI A;  2PJP A;  2ZSH B;  5FLX Z;  1MMG A;  4XLP F;  1VQP I;  3ELK A;  4R8H A;  3H0D A;  1RUO A;  1Z3Y A;  1ZGA A;  4IQ4 A;  4IF4 A;  5EYR A;  2HGC A;  4L18 B;  2XF6 A;  4JYK A;  3J81 K;  1S8N A;  1T95 A;  1NK2 P;  3G3Z A;  2Q2E A;  4M74 A;  5K7Z A;  4IQJ A;  5ICF A;  3CJT B;  4U0V A;  2LKP A;  4BEH A;  2P6S A;  2EV5 A;  4CZC A;  4RM2 A;  1HC8 A;  1U9N A;  4E7L A;  3HHG A;  4UV8 A;  4HNV A;  1Y1V J;  5IP7 J;  3K4J A;  1XS9 A;  5DCM B;  3I59 A;  4PJ0 C;  3CME I;  2JA6 J;  3JSO A;  5F6F A;  3F21 A;  1SFE A;  4BE1 A;  1OFC X;  5JHF A;  3J81 Z;  2XHK A;  3GZ5 A;  3B6C A;  5LHG A;  3SZP A;  2ZB9 A;  1U3E M;  1FIA A;  3ERM A;  3HC7 A;  3ERE D;  1KU2 A;  3IKT A;  2PMZ N;  3QPT A;  1IN7 A;  1D0Z A;  2YU3 A;  3FIW A;  4IX7 A;  3DBH B;  3QP6 A;  2TRT A;  3TO6 A;  1MDM B;  4BDY A;  3VYS B;  3A0B C;  1TW2 A;  4ENK A;  1WJE A;  3AAF A;  2KJB A;  3E7L A;  2HYG D;  4OAY A;  2R5Z B;  3S1R J;  2PN6 A;  3D5R C;  3LSH A;  1VFC A;  5D8L B;  3OIP A;  4YIR X;  4Z6Y A;  3ZPL A;  2E35 A;  1JGS A;  4P1W A;  3CUQ C;  2DMN A;  5J1U A;  4I98 B;  1MNE A;  1XCV A;  2HOE A;  4G6Q A;  4WCG A;  5FFZ A;  1IW7 F;  1XGO A;  2LVS A;  2X1D A;  3RKW A;  4IHS A;  2WAD A;  2Z9O A;  2ZME C;  3QOP A;  3O3K A;  2KRF A;  4A3J J;  3E5Q A;  4PGG A;  1MH3 A;  1P4W A;  1UB9 A;  3FK6 A;  1S7E A;  4XON A;  2DXI A;  2E2H J;  4I02 A;  2IS2 A;  4BHC A;  2OUM A;  3ZGK A;  5CVV A;  2DFH A;  2KFD A;  1XTA A;  5E1Z B;  1OCZ H;  1YI2 I;  3HTU A;  3TBI A;  2PG4 A;  3MD2 A;  3X2Q H;  4A0X A;  4M6V A;  4YFN F;  1LFU P;  4A3G J;  1SC7 A;  3OYH A;  3JCU C;  4HF1 A;  3I53 A;  1ZGW A;  3JR9 A;  2QBY A;  2L5Q A;  3I64 A;  1I3A A;  2UXN A;  2X6O A;  4UHT A;  3ZMD A;  1EF4 A;  4EJW A;  1WKM A;  2EA2 A;  3RJP A;  2XB0 X;  1W5S A;  3E6M A;  4Y15 A;  3RQ4 A;  3QRF F;  3DBL B;  1SD5 A;  3FBN B;  3WGI A;  4E7Z A;  3KEO A;  2MYS A;  4X6A J;  4CDG A;  1RI7 A;  1SEU A;  3K4K A;  1IDZ A;  3IWF A;  1Y8R B;  1FOX A;  3L2U A;  4BNC A;  1O7L A;  1ZKG A;  2CJJ A;  5EG0 A;  2FMY A;  1I1S A;  1YS6 A;  2BY2 A;  1P2F A;  5M5W J;  2W82 A;  1X58 A;  5IYD J;  4M6Y A;  3AFH A;  3TED A;  2RRE A;  5K5Q A;  3LA7 A;  2MH9 A;  3FM3 A;  3KLN A;  5FKL A;  3HG9 A;  1LNW A;  2K5C A;  2P6T A;  1AHD P;  2F48 A;  1VND A;  4XKW A;  3VYT B;  3RCO A;  2XIG A;  3CZ6 A;  3H5A A;  1H0M A;  3E6D A;  3GFL A;  3PQK A;  2EZH A;  2PMZ A;  3HUG A;  4ZDL A;  1OMI A;  4BQQ A;  5GAE J;  3R60 A;  1UG0 A;  3CJQ B;  1WSU A;  2DA7 A;  1T38 A;  2W7N A;  2E1N A;  4Q4Z F;  4KUM A;  2EWN A;  1IO2 A;  3LL7 A;  4CIC A;  1QZZ A;  5E17 F;  2R7U A;  2CV2 A;  1KZH A;  1WJ5 A;  4OAZ A;  1J7K A;  3KFW X;  4I2O A;  2DW4 A;  3OWT A;  3Q0V A;  1J0R A;  3QQA A;  3VOE A;  5FKM A;  3JSP A;  4LK0 F;  4MEY F;  4E7S A;  4II2 A;  1RC9 A;  2NVY J;  3ABM H;  1BIA A;  1ZAR A;  2M1B A;  2LRD A;  5AIP A;  4ABZ A;  5IT9 K;  1X19 A;  3WTZ A;  2ECC A;  5D5W B;  2R7T A;  5ICG A;  1PVE A;  3CJR B;  4X1E A;  2KL4 A;  4AVP A;  1P4A A;  4XK4 A;  2FOW A;  1ZGJ A;  4B47 A;  1T33 A;  4A3L J;  3IAM 2;  2QQ8 A;  2COM A;  3U9G A;  4E7I A;  4A3E J;  2R7V A;  4M3E A;  3RYR A;  4S0H B;  4N9H A;  1XG1 A;  2EJR A;  3QWL A;  5E18 F;  2GXB A;  3BT9 A;  5IT9 Z;  2X1C A;  2BY0 A;  3GTO J;  1R1U A;  1BR2 A;  2JTV A;  2L02 A;  1O7F A;  2Z33 A;  4J01 A;  3G1O A;  1I39 A;  3WGH A;  1R9T J;  1QRY A;  3M8E A;  1MJB A;  2QCO A;  4HDU A;  3Q0W A;  2IJL A;  1W36 D;  2ELH A;  1F4K A;  3FMR A;  3DF8 A;  1QA6 A;  3OV8 A;  2W4S A;  2OV7 A;  2FML A;  3BTC A;  4EJU A;  4K2E A;  3Q9V A;  3EET A;  1MBE A;  1AKH B;  4BQO A;  1ZYR F;  5BS6 A;  3PQJ A;  3K7A J;  3SQN A;  3BJA A;  3WG9 A;  1IC8 A;  4FCY A;  4YIF A;  3BR6 A;  5EGO B;  3CCS I;  2QA4 I;  3RTR A;  2FBK A;  2FQ3 A;  2IBD A;  4FE4 A;  2VQC A;  3IH2 A;  4XSZ F;  3CO7 C;  4Y33 A;  1MGT A;  2E1O A;  3OIO A;  2A69 F;  4XKC A;  2EQR A;  4BBR J;  4IO9 F;  1YTY A;  2JPB A;  3ABL H;  2LY1 A;  1LVK A;  1AWC A;  2CU7 A;  5C4J J;  1XN7 A;  3DKX A;  3LSM A;  3W2V A;  1WWX A;  2XPW A;  1D8J A;  2KIS A;  1MKM A;  3WTY C;  3KZI C;  1I6X A;  1Y0N A;  2M7B A;  2HVR A;  3VFZ A;  4LG3 A;  3DCF A;  5E79 C;  4UXN A;  4XRS A;  1AOY A;  3KYD B;  3QYF A;  4EJT A;  5LEK A;  1XSD A;  1SMY F;  2FSW A;  1MMS A;  4IOC F;  1BR4 A;  2O0Y A;  2B63 J;  2VJ4 A;  3WU2 C;  1QU3 A;  3TKY A;  2KZG A;  1FSH A;  3D0S A;  3DQV C;  2P7C B;  3CMY A;  1R4M B;  1SMT A;  1JGG A;  2CV1 A;  3IH4 A;  1PJR A;  3QOD A;  5IP9 J;  1H8A C;  3SZT A;  1S29 A;  3U1K A;  2K9N A;  1MSF C;  1W7P D;  3V7C A;  2K9M A;  3M4O J;  3E3V A;  4Q48 A;  2A07 F;  3KYL A;  2Y69 H;  3KP7 A;  1FT9 A;  3KEQ A;  3BPV A;  3DEU A;  4IRH A;  4NUB A;  4DBR A;  2J5P A;  4R1H A;  4EGY A;  2DTR A;  2ME6 A;  1X1C A;  4OIR F;  1X1A A;  3IRR A;  1TWF J;  4HZF A;  1V54 H;  3MMY B;  2DOA A;  3RDI A;  1VQ7 I;  3HSE A;  2XUB A;  5F0F A;  1N75 A;  4OMZ A;  4RM3 A;  4ZYD A;  3LQR A;  2DI3 A;  5F1J A;  3HOW J;  2VBW A;  3QPS A;  3L2V A;  3A0H C;  4I76 A;  4L9J A;  4MLO A;  4XSX F;  3O8H A;  3CLQ A;  4JK1 X;  2BY3 A;  4EEF G;  2PJR B;  2BHY A;  1NHA A;  4F52 A;  3I4N J;  3BQY A;  2QQA A;  3PSF A;  3J80 Z;  1BW6 A;  3REO A;  3WTS C;  5EDN A;  1NH3 A;  3NRV A;  4FTH A;  1KQ9 A;  2LG4 A;  1XC5 A;  1XGS A;  4LIT A;  2WWY A;  2B0L A;  3HKZ N;  2FE3 A;  5E3O A;  1QHH D;  2P81 A;  1JI8 A;  2GA1 A;  1ZEL A;  2EIJ H;  3EPZ A;  4M3F A;  3EQL F;  3BCB A;  1H9T A;  5IOZ A;  2AQE A;  4NDL A;  4XLH A;  4PCQ A;  2EFW A;  4CYD A;  3BTJ A;  4C3I J;  1U8B A;  1ZR4 A;  2O03 A;  3ABK H;  4RGR A;  2EFO A;  1K61 A;  3GTP J;  3A03 A;  4KIF A;  1RRJ A;  2DYR H;  3PNY A;  1SFO J;  1Z6T A;  3ZQC A;  3S16 J;  3JRB A;  1Y8Q B;  2AS5 F;  3KZZ A;  1R5G A;  1IXR C;  3G2B A;  4NB5 A;  3NAU A;  2PQ8 A;  4ESB A;  2Y9Y A;  1A04 A;  2E7W A;  1K78 B;  2OA4 A;  5HLI A;  5K7F A;  1TZL A;  3DLA A;  3ZQL A;  4FX0 A;  2TDX A;  3DEW A;  1HDP A;  3OR1 C;  1IDY A;  4HNU A;  2YPR A;  5EZG A;  2BOL A;  3TQN A;  4HSR A;  3BR1 A;  2H8W A;  1W0T A;  5D6F A;  1NK3 P;  1JT6 A;  3CCR I;  2BW3 A;  5HVQ C;  2OU2 A;  4EVI A;  2LF8 A;  4RAG A;  2UWM A;  3OYM A;  4P5O A;  2VN2 A;  1XGM A;  3EUK L;  3AG1 H;  2FX0 A;  4G7H F;  3UKG A;  1YHQ I;  4KMF A;  1IUF A;  2EIN H;  1LB2 A;  4BBS J;  1MD0 A;  1DDN A;  5EJC A;  2LK2 A;  2GBY A;  2LY2 A;  1JTY A;  2DA6 A;  2MBF A;  5L3B A;  4Y52 J;  4OMY A;  2E1M C;  4P55 A;  4F55 A;  2XC7 A;  4IEJ A;  5L3G A;  3H3Z A;  4I01 A;  4BS9 A;  2GLO A;  3F72 A;  4PUS A;  1IN5 A;  1Z1D A;  5HS8 A;  3CJN A;  4XBF A;  1ZK8 A;  1O3T A;  2YUS A;  3IHU A;  3V4G A;  3LA2 A;  2DPU A;  3BJO A;  2JWT A;  4I0B A;  2R7R A;  2QQB A;  5CPR B;  3RPU A;  3HSR A;  4XOT A;  2KP6 A;  1R71 A;  1MJA A;  1DGR M;  3VYU B;  1V3F A;  4DGW B;  4Y13 A;  5JI6 A;  2JA2 A;  4ZTF A;  1B72 B;  3GYH X;  4IHV A;  1IXC A;  3AL0 B;  2E5N A;  1R7J A;  2KIM A;  1R22 A;  2JVH A;  3CDH A;  5CYV A;  3TDU C;  3CDI A;  3QU6 A;  2L9S A;  3ZQI A;  1E0E A;  1U5T A;  2EA4 A;  3I5U A;  3FXO A;  4ANJ A;  4M9X A;  1XCB A;  2CUF A;  4C3H J;  1Z21 A;  3OIQ A;  1UG2 A;  1WI3 A;  3VSL A;  3LMM A;  2OCC H;  4CCM A;  1UMQ A;  4GFB A;  4PJN A;  2F5C A;  2WA0 A;  3M3Y J;  1A36 A;  4O3M A;  2LYC A;  2P4W A;  4HPQ A;  1BOB A;  3MKL A;  2DA3 A;  1XD7 A;  2DDA A;  4CYC A;  1SFU A;  1ZLK A;  4OIQ F;  4HX8 A;  4F92 B;  1F43 A;  1FC3 A;  3KEY A;  3M9A A;  2CUE A;  2QYO A;  4BHB A;  1TC3 C;  2QM3 A;  1OIS A;  1B8I B;  2HOA A;  1B6A A;  1G3Y A;  4DIQ A;  1R23 A;  4ZDP A;  4Y17 A;  2ISY A;  5FRO A;  2Y9Z A;  1X2M A;  4PSW A;  2EZI A;  3F6O A;  3PIO F;  3J7A Y;  4PJJ A;  5B1A H;  5F1R A;  1G4D A;  1HW5 A;  2W84 A;  1G3T A;  4MQ9 F;  2JSP A;  2DK5 A;  1SAU A;  1VQN I;  1XMA A;  5E3L A;  1LVA A;  5EEA A;  4FET A;  2OZ6 A;  3RKQ A;  2YU9 J;  4LJZ F;  3I4P A;  3I3L A;  4GGG A;  5IY5 H;  2DLL A;  2A6E F;  2VOP A;  2Z16 A;  4AYB N;  2OF7 A;  4AWX B;  2LLK A;  2JA8 J;  3O8G A;  1X1D A;  1BN5 A;  2BEO A;  4YG2 F;  1DU6 A;  3PNV A;  2LBF B;  4BYY A;  5FD5 A;  1A6I A;  2CW8 A;  4IL6 C;  2X6X A;  5LRR A;  3OSG A;  2YX4 A;  1YS7 A;  2KDO A;  1KU3 A;  4U88 A;  1T2K A;  1WCM J;  2EFP A;  1YX3 A;  5HNF A;  2L2O A;  2OZU A;  4OOI A;  2RVC A;  3R61 A;  3M8J A;  3K6G A;  2VBX A;  5GAG J;  5L3E A;  3DEE A;  1PP8 F;  4RMN A;  3KET A;  4BQA A;  1IRF A;  3TO9 A;  3P9C A;  1XSX A;  3OS2 A;  1BI2 A;  3GTK J;  1FOY A;  5LFA A;  2HPI A;  3RSN A;  3ONQ A;  1M1E B;  5E3M A;  2LFB A;  5D4R A;  4UB8 C;  5FRN A;  2F2E A;  4CCK A;  1U78 A;  5FO5 A;  4MEX F;  1LFP A;  2J5O A;  1HKT A;  3W2A A;  4PDK A;  1CGP A;  4KIC A;  1SVO A;  3GEZ A;  3H3U A;  1TWC J;  3HEF A;  2DJN A;  3IP4 B;  1LKX A;  4D5F A;  2GOX B;  2WAQ N;  1Y6I A;  2VQG A;  3ECO A;  1JKQ C;  3H92 A;  1X3W B;  2DA1 A;  3H1C A;  2KKO A;  1T98 A;  3F8C A;  3J7Z I;  1NG6 A;  1RNL A;  2F4I A;  2BZT A;  2IEK A;  4IKF A;  1T6S A;  2AO9 A;  2G7U A;  3HOT A;  3BJ6 A;  2CWE A;  3FXM A;  2VPL A;  2HWV A;  3ZP5 A;  9ANT A;  1Z05 A;  2H8R A;  3VYR B;  2E1M B;  2NOJ B;  3OYF A;  1QPM A;  3H5N A;  1LUJ B;  2NVX J;  3FKI J;  3S17 J;  2Y0S A;  2QLZ A;  4HRI A;  2FOK A;  4BY7 J;  4U0Y A;  3WE3 A;  4HX4 A;  3CCL I;  1ZG5 A;  2KT0 A;  1UHS A;  1XMX A;  3DPT A;  2FEZ A;  4ZDO A;  3SDB A;  2R3S A;  3HJE A;  1PUF A;  1X1P A;  4AIJ A;  2DOD A;  2WTE A;  3CCM I;  4AYB A;  1G59 A;  1N78 A;  1WQ2 A;  2RNJ A;  2VKH A;  4RAF A;  4ASN A;  1W7P B;  3BOQ A;  4CZZ A;  3A01 B;  2ZJQ F;  2VKE A;  4G12 A;  2A6T A;  2LR8 A;  2OC6 A;  5EEG A;  2CV0 A;  4NBQ A;  3FHN A;  1MZB A;  3ROU A;  2P0W A;  3FXL A;  1XDU A;  2ZO4 A;  3MZ8 A;  2C6Y A;  4NHJ A;  2LKX A;  2LMD A;  5CJ9 A;  2ZCW A;  3CCQ I;  1YFH A;  3OMY A;  4U7B A;  3K4L A;  4HEA 2;  5E20 A;  1IAW A;  2I5U A;  3KZY A;  1PUE E;  1BI0 A;  1ZRF A;  4YEJ A;  2HQR A;  2WY8 Q;  1YX5 A;  4ZJZ A;  4C9Y A;  4PFP A;  3S3O A;  2Z1D A;  1HBX G;  2ESH A;  4HNT A;  1ODD A;  3HOX J;  3MWM A;  3I58 A;  4BAC A;  1BIB A;  2N8G A;  2ID6 A;  1YG2 A;  4KYW A;  2FQ4 A;  4AIK A;  4XOR A;  1IGN A;  3ML6 A;  4UUV A;  1MBG A;  3CCV I;  1ETX A;  2CQX A;  2JQ7 A;  2E1C A;  2NS8 A;  1LEB A;  3OSF A;  3V42 A;  1IJW C;  3S2H J;  4XLN F;  3FMS A;  5L3D A;  3RQI A;  4EQQ A;  3S14 J;  5FKO A;  2X1E A;  3H9J A;  4B44 A;  1CF7 A;  2KHM A;  2OQR A;  1ETQ A;  4F93 B;  1VQ4 I;  4M9S A;  4BJT A;  1GV2 A;  3Q5F A;  1R49 A;  2R4G A;  3P9I A;  2HEO A;  1FPQ A;  1QHG A;  1S7O A;  1I27 A;  4H0E A;  2MC3 A;  4XNF A;  5C4X J;  1RKT A;  5ED4 A;  2W1O A;  4A3C J;  1Z0X A;  4U87 A;  4MO7 A;  1IZ1 A;  3C2G A;  4UB6 C;  4AU7 A;  2H09 A;  2QVO A;  4GYG A;  3COA C;  5GAH J;  2Z99 A;  2JT1 A;  3NWT A;  3DTK A;  3BRO A;  3HRM A;  2AQF A;  2H27 A;  1UZC A;  2R7Q A;  2XGX A;  2GXA A;  3DFG A;  5FKK A;  3BTI A;  3OY9 A;  4IZZ A;  2WV1 A;  2DJI A;  2L9N A;  1U2W A;  2IVM A;  3SEZ A;  3M8F A;  2NS7 A;  1D1B A;  2R0Q C;  5LLQ A;  3HRS A;  1Z3X A;  2O8X A;  4A3M J;  1EA3 A;  5DTD A;  2V4J C;  3OYD A;  3RZD J;  4HQE A;  2GQQ A;  4ZH4 F;  3CD6 I;  5K1Y A;  2F5D A;  4L9T A;  2I8D A;  2VJI A;  2HQ5 A;  2W57 A;  3ZQF A;  4A0Z A;  3LFU A;  4BXF A;  5D5V B;  1FX7 A;  1I50 J;  2E2I J;  5GPC A;  3HM5 A;  1I3Q J;  2WAE A;  1IF1 A;  5HNH A;  3FF5 A;  4WWC A;  3J7Y J;  2VI6 A;  3HB9 A;  3BG3 A;  5H6Q A;  2PEX A;  2IA1 A;  2TCT A;  3PSI A;  4A3B J;  5J8C A;  3T5X A;  4MTD A;  1ZRC A;  2GM4 A;  3AG4 H;  3NEU A;  2V9K A;  3BR2 A;  4M71 A;  1V5G A;  2Z3Y A;  3HIF A;  2XSD C;  4RGX A;  1NTC A;  1HSJ A;  4PJL A;  2K4J A;  2KMU A;  2JRM A;  1OCO H;  4EV0 A;  3M7G A;  1S5L C;  3HOZ J;  2XB5 A;  1WJA A;  5TJJ A;  1RUN A;  5HLH A;  2ZFU A;  4XLA A;  1P92 A;  1ZRD A;  1FLI A;  3MFK A;  2JJ7 A;  4P9F A;  5F0H A;  1MW7 A;  3RZO J;  3JRG A;  2EV0 A;  4DYQ A;  3IC7 A;  4UY8 I;  3DBR B;  1QVU A;  5HDG A;  3JRA A;  2MAB A;  2HS5 A;  2V26 A;  1U9O A;  4Y4R A;  4DYC A;  3FX3 A;  5DDG A;  1IRX A;  5JHU A;  4A0Y A;  3P7N A;  2GXG A;  5ICE A;  1LQ1 A;  4B09 A;  2LH9 A;  1J09 A;  4XRM A;  5D5U B;  3QOE A;  2MG4 A;  3PFI A;  4Y7N J;  4L5J A;  1FBU A;  2STW A;  2K9Q A;  1FY7 A;  1F9N A;  3C2B A;  5DM7 F;  1EH6 A;  2KJC A;  5DD4 A;  2COB A;  4B8X A;  2F5E A;  5JR3 A;  1BW5 A;  2W00 A;  4EM0 B;  1WHU A;  3BR0 A;  3U1D A;  1QZY A;  4WX9 A;  2STT A;  1QPI A;  3HPH A;  5F64 A;  1QBJ A;  3OYG A;  2R92 J;  4ITV A;  3EYY A;  1IXS B;  4HF2 A;  5E1W A;  3RI4 A;  4EAT A;  1V5E A;  1TT5 B;  2CW7 A;  3KP6 A;  3VOD A;  2ZKZ A;  3JRC A;  1FTT A;  1G8X A;  3SEQ A;  3BG7 A;  4YFK F;  4KIS A;  3K69 A;  3IL2 A;  1T08 B;  1G2H A;  4KIG A;  3TOA A;  2E34 A;  2W48 A;  2NNY A;  4HLY A;  3ZMV A;  3WOD F;  2V9P A;  4AVZ A;  4E7J A;  3W6J B;  1OJL A;  2IW5 A;  3ZQG A;  2DPD A;  5DV5 A;  4CXF A;  3JRI A;  3H9G A;  4LB5 A;  4XN0 A;  3LNQ A;  3LWF A;  3V7S A;  2HPM A;  1GXP A;  4D1Q A;  4TV7 A;  1YIJ I;  2HDC A;  3MZH A;  2F4O B;  4II3 A;  3V8K A;  2M45 A;  1ULY A;  2Q0O A;  3J7A O;  1RET A;  3L7W A;  2G9W A;  5LRS A;  1WH7 A;  3OYI A;  4LG0 B;  1OR7 A;  1B1B A;  2ZBK A;  4GXO A;  1LE8 A;  5LBQ A;  2XGE A;  2EB7 A;  2VE9 A;  4U0W A;  2EFQ A;  2LOO A;  3IKV A;  3E97 A;  3T8R A;  3PNT A;  1KYW A;  1W0U A;  3B73 A;  1FP2 A;  2HU9 A;  2K7L A;  2JA5 J;  3CUQ B;  3L1P A;  2WV0 A;  2RGV A;  3G6E I;  2QSG X;  1ERD A;  2P8T A;  1IN6 A;  2FBH A;  2M30 A;  4FIS A;  4G94 A;  1LJ9 A;  4S04 A;  3ZQQ A;  3B6A A;  4XLE A;  3MZY A;  3HL2 A;  3F8F A;  2ZME B;  1VF9 A;  3BPX A;  3S32 A;  3LAP A;  3HXL A;  4RDU A;  1K7A A;  2X0L A;  4FE7 A;  2CSO A;  4CGZ A;  2OTJ I;  2DT7 B;  1O57 A;  4ON0 A;  1Z9C A;  3I0T A;  3QPL A;  4GO1 A;  1MBF A;  4PZJ A;  1BA5 A;  4ZTJ A;  2R7Z J;  4O6J A;  1QVT A;  1GV5 A;  2VQL A;  3SDG A;  3G1M A;  4E6K G;  1B59 A;  3FM5 A;  2JUC A;  1MND A;  2XAS A;  4L5E A;  3HZJ A;  1N25 A;  2I10 A;  2XGD A;  4AD9 A;  1VQ6 I;  2IA2 A;  4GRI A;  4RGS A;  2FRH A;  1YRN B;  1OCT C;  5H6R A;  5JVT A;  2VJJ A;  5D8K B;  1FEX A;  2IGN A;  4G9Y A;  4A3I J;  1HST A;  2CFX A;  1D0Y A;  3FK7 A;  4MQV A;  4ZYA A;  2FXA A;  4PSX A;  3L2R A;  2W24 A;  4JX5 A;  4W97 A;  5EEH A;  4A69 C;  3K4N A;  1AA7 A;  3WHB A;  1ACI A;  3GFM A;  4LMY A;  1BI1 A;  3D5S C;  3GLX A;  3E6C C;  2HZT A;  1P7J A;  2JRT A;  2LRE A;  3J80 K;  2ELK A;  3ABU A;  4M72 A;  4IHX A;  4RBO A;  4KA4 A;  3JW4 A;  2M0C A;  2L0K A;  5LGN A;  1FMV A;  3ZQ7 A;  5D5X B;  3CC2 I;  1P6R A;  5AIQ A;  3I55 I;  4GDF A;  1BJA A;  4OIP F;  3GX4 X;  2HZD A;  3IUO A;  3GUD A;  3WTW C;  2D2W A;  2OPT A;  2OCE A;  3GTQ J;  1ZAO A;  5B66 C;  2EPF A;  3BC8 A;  2BHZ A;  4XL9 A;  4N0B A;  1X3U A;  5ILS A;  2HTJ A;  5DCM A;  3ZRG A;  4WXC A;  2Q2E B;  2K02 A;  3HDD A;  3KPH A;  4A3D J;  3FBI B;  4IHT A;  3FXQ A;  6PAX A;  1S9H A;  2YS9 A;  3QAH A;  4BEH B;  3S2W A;  5FFX A;  1Q1V A;  5EZH A;  2BVM A;  3BWG A;  2HQA A;  3CF5 F;  5KHD A;  2GA2 A;  1E3P A;  2KRH A;  3I59 B;  2VOO A;  2K40 A;  1ETY A;  1RR8 C;  4GYI A;  4KN7 X;  4FAS D;  4UUS B;  1JHH A;  2QZ8 A;  1ON1 A;  4I99 C;  4XRS G;  1XSV A;  2PI0 A;  2M87 A;  2ID3 A;  1MDM A;  2D1V A;  1K4S A;  2XRL A;  1KA8 A;  2KIF A;  5B3S H;  2V79 A;  2VAS A;  2HR3 A;  3WU1 B;  5BPI A;  4CO8 A;  2R5Z A;  1FZP B;  5IT3 A;  2VKV A;  3A1Y A;  3Q0U A;  3T1B A;  2DO7 A;  3DU5 A;  3KYC B;  3TL4 X;  1SVL A;  3L2C A;  3PO3 J;  1OR7 C;  1A6Q A;  1YW9 A;  2GZW A;  1E3H A;  1X1B A;  2QEX I;  2Y30 A;  4ZYH A;  5BQT A;  1POG A;  2A5W A;  2XKP A;  4HST A;  3GME A;  1DGW Y;  2QQ9 A;  3EDP A;  5D4S A;  1FTZ A;  2AXL A;  4LIU A;  1VQO I;  4CCJ A;  3C2H A;  2XPU A;  2RQP A;  1ETV A;  1QQI A;  2M2E A;  2CGP A;  2LDU A;  3KP3 A;  2XV4 S;  3FXU A;  3CMA I;  2CG4 A;  1L0O C;  5F0C A;  2RV8 A;  3TP0 A;  3OYA A;  4D7M A;  3G1L A;  2NVQ J;  2QGU A;  3VEP A;  2FBI A;  3L00 A;  2L9R A;  2NAZ A;  3PFY A;  1Y1W J;  4HAM A;  1XDS A;  3DPU A;  3OYB A;  2DFF A;  2ZNZ A;  5DUI A;  5BMZ A;  2VL8 A;  3WE2 A;  4CH7 A;  4HW0 A;  1RR7 A;  1OYI A;  2DMP A;  4M3D A;  5FGM A;  3CP8 A;  5IYC J;  2BXY A;  2X6Y A;  2XAH A;  2QBY B;  5IP6 A;  1HLV A;  4KMU X;  4LLG F;  2K85 A;  5KAI C;  5GTI C;  3R6S A;  3RPU D;  3W2W A;  2ISZ A;  5CVI A;  3GCM A;  2DMQ A;  2Y31 A;  1FBS A;  2UV1 A;  1HF0 A;  3FMQ A;  1BC8 C;  3HOS A;  1V55 H;  2M4G A;  4RB1 A;  2L54 A;  3OL4 A;  2PMH A;  2VC1 A;  1WZ2 A;  2VJ5 A;  3FKJ A;  3R0J A;  3ZMZ A;  1D5V A;  5LGT A;  1SD7 A;  1RES A;  3H3V K;  3HKZ A;  5EG0 B;  1T0F A;  3M07 A;  3GTL J;  3SXY A;  1JKO C;  4Q5S F;  3ZXS A;  3N97 A;  5KCM A;  4DZP A;  1GDT A;  2XGC A;  2VC0 A;  2IGO A;  2IS1 A;  3HBL A;  3NWS A;  4GCV A;  2O61 A;  1X4O A;  2CQ7 A;  1JJ6 C;  5CQG A;  4CCL A;  3H36 A;  1A35 A;  2NXN B;  1BI3 A;  2DA2 A;  1Z91 A;  3LFK A;  3C18 A;  1D3Y A;  3BZ6 A;  4FT8 A;  2FJ1 A;  1FSE A;  1DPU A;  3HUG B;  5HS7 A;  1XB4 A;  2VIX A;  1ZG3 A;  3LOC A;  1UFM A;  2MW8 A;  2MC4 A;  3KP2 A;  3PUF A;  4KDP A;  3D5L A;  2DQR A;  3WU0 A;  1YW8 A;  1OLT A;  3CUO A;  5D6E A;  4V19 K;  4UVC A;  1P7I A;  3TOB A;  1V5F A;  3UR3 C;  4R79 A;  5E8G A;  2WAF A;  1QGP A;  1L3L A;  4LLN A;  1LFB A;  2QWW A;  5M3F J;  1R1T A;  1TWG J;  3OL3 A;  4CCO A;  3GXO A;  2YR2 A;  1JJ8 C;  1UJ8 A;  3K4B A;  3DTI A;  3KIO A;  2DU9 A;  3NQO A;  2NYX A;  1TLH B;  1FNN A;  2M7A A;  1H89 C;  2RNG A;  2XAJ A;  1TQI A;  2HKX A;  1K4T A;  1UEL B;  2DMU A;  2VXD A;  1XMK A;  2QSF X;  4L5I A;  1S7A A;  4BUP A;  2E5Z A;  1ZH5 A;  4CCN A;  2L7M P;  2Y0M A;  2M9H A;  1TQM A;  2BE5 F;  4HV6 A;  2VQH A;  1APL C;  3ZMU A;  2LY9 A;  2LNB A;  3ULQ B;  1YJ9 I;  2IP2 A;  1USS A;  3CCU I;  3CC4 I;  4I7H A;  1A31 A;  1LDK B;  3OYC A;  2XVC A;  3IAS 2;  1I5Z A;  1FP1 D;  3GFI A;  2DN0 A;  1K79 A;  2DOE A;  2MH2 A;  2XSJ C;  4B1R A;  1AKH A;  2O6G E;  3H9Q A;  2DOF A;  4WXD A;  1JKR C;  1JHF A;  3TO7 A;  4P9U A;  3P9K A;  2GIV A;  3KP4 A;  4MNU A;  2HYJ A;  3KP5 A;  5EGO A;  1MMA A;  1QZE A;  1JUP A;  4IVN A;  1IRG A;  1HDD C;  3ZCO A;  5E3N A;  1WH5 A;  1DPR A;  2E71 A;  4XOP A;  4XLC A;  4HA8 A;  5J1R A;  3CUQ A;  3K70 D;  1QO0 D;  2R7F A;  2X85 A;  2EIL H;  1A5J A;  5CVU A;  1B4A A;  2RC4 A;  3T0Y A;  5GTH C;  4BJ5 C;  2IRF G;  3JRF A;  4V2G A;  2Y75 A;  4G8X A;  2MD5 A;  4G7O F;  3K1M A;  3TGN A;  5LHH A;  2HVS A;  1TWA J;  1FOW A;  2VB6 A;  3JAM K;  5FLM J;  1HKQ A;  2RAE A;  3GZN B;  1OPC A;  4AID A;  3HRT A;  5A2Q K;  1R58 A;  3F8M A;  3L9F A;  4YFX F;  4M73 A;  3FXR A;  1X4P A;  5HOD A;  4CHU A;  1KGS A;  2ZXH A;  4PFO A;  3VB2 A;  2VKD A;  2IA0 A;  2VXZ A;  1ZHF A;  5FKN A;  4A5N A;  3OYE A;  3IV5 A;  3HOU J;  2HTS A;  1U6G A;  5F08 A;  1HW2 A;  2PBI A;  1IG7 A;  1T0F C;  2CYY A;  2LKS A;  2FNA A;  3GVA A;  3P5J A;  2L7K A;  1WGX A;  1U5T C;  5B1B H;  4CSW A;  4RAY A;  3I71 A;  3GTM J;  3ZN0 A;  3JAM Z;  3GF2 A;  1KON A;  1JKP C;  4XM3 A;  3SHF A;  4ZYG A;  1Z67 A;  2LSO A;  5A2Q Z;  2DFI A;  2K4B A;  1JE8 A;  3ABT A;  4RLF A;  1YIT I;  2D5V A;  2DYS H;  3H0G J;  3F22 A;  1IV6 A;  2FU4 A;  1TQP A;  1R4N B;  1SAN A;  3S8P A;  4HV5 A;  5K5O A;  4D0P A;  2CW0 F;  4N9I A;  4MGR A;  1MBH A;  1B9M A;  3ISP A;  1Y56 A;  3W6K B;  4BL0 B;  5JLX A;  5JFR A;  2XF5 A;  5ILU A;  1GVJ A;  1DU0 A;  3SFI A;  3FIS A;  3WHC A;  4QPQ A;  4Y3O A;  4DJA A;  5BOX A;  2EBI A;  3E5X A;  1RZ4 A;  1VTN C;  1F36 A;  3E5U A;  2L01 A;  2P5L C;  1O3S A;  1EV7 A;  2HVQ A;  1R1V A;  1TWH J;  2M34 A;  3LQQ A;  2XF7 A;  1KYZ A;  2YSR A;  4MHG A;  2VLA A;  4FX4 A;  4XQF A;  1G3S A;  3BTL A;  2PJR A;  3S1N J;  2LF7 A;  4NC7 A;  1R5H A;  4HQM A;  3HGY A;  4WXH A;  1O3Q A;  1EKE A;  1E17 A;  2R7X A;  3S3N A;  1JUS A;  1ZR2 A;  2ZSI B;  3QYB A;  4XID A;  3E0J B;  1WFX A;  3A2K A;  4BAY A;  4ZYE A;  1BOA A;  2K9L A;  4UUS A;  2HOT A;  2AXT C;  4XLF A;  2HDW A;  1BR1 A;  5ICC A;  4QWQ A;  3K4C A;  4JOM A;  4XIC A;  2P5V A;  1KU7 A;  2WAQ A;  3JRD A;  2JMW A;  2L4M A;  1ONV A;  1VQ5 I;  2R5Y B;  3HGG A;  4XKV A;  2R7W A;  1IV8 A;  4RAZ A;  1BBY A;  3F6V A;  4NC6 A;  5GAD J;  4G7Z F;  2E2J J;  2EZL A;  4CUG A;  4QIW N;  4AC0 A;  5J3L A;  4A6E A;  2A05 A;  3HYI A;  5IYB J;  1WJF A;  1U0J A;  1K78 A;  1CQT A;  1D5Y A;  5HDN A;  1D0X A;  1BJZ A;  3I56 I;  2O8K A;  4ZZL A;  5LHI A;  4A3K J;  1EH8 A;  3VPR A;  2CFO A;  3O6B B;  4QPO A;  1MJ9 A;  1W4M A;  2RDP A;  2A68 F;  3FDY A;  4NQW B;  3WG7 H;  4W1U A;  2AHQ A;  3ZOB A;  3K70 C;  1WJD A;  3OOU A;  2HXI A;  2ZXI A;  4A5M A;  4ESJ A;  2VE8 A;  1BC7 C;  5DCF A;  1YE9 A;  1VQM I;  3BZC A;  2NVT J;  4LOC A;  4CA0 A;  4RA2 A;  1OCP A;  2QF7 A;  4XRF A;  2ZJR F;  1HOM A;  5B5E C;  3GWZ A;  2XPV A;  2F6C A;  2H1K A;  3DKY A;  2DQL A;  1R00 A;  1BL0 A;  1DP3 A;  2BW3 B;  2X51 A;  5FRM A;  2K3P A;  2DDB A;  2R93 J;  5F04 A;  1VZ0 A;  1EH7 A;  4O5V A;  1X2N A;  3HOV J;  4RGU A;  1G3W A;  3HOY J;  3OS1 A;  2UUZ A;  5K7H A;  2DA4 A;  5EF6 A;  4RS8 A;  2M4K A;  2VBY A;  4IRG A;  4PJM A;  4M3B A;  4E4H A;  1K6Y A;  3IRQ A;  1OYY A;  4LGW A;  2NOG A;  1JTX A;  1YJW I;  2KDZ A;  1YJN I;  1OCR H;  4XMY A;  3R4K A;  4LK1 F;  1S72 I;  2F4M B;  5HLT A;  3CCY A;  3CP2 A;  1B72 A;  2A5Y B;  2QKM B;  4RLQ A;  5HS9 A;  2XDV A;  2ADU A;  3HTS B;  1YOV B;  3W3C A;  1WVR A;  4UV9 A;  2JVG A;  1TP4 A;  1P4X A;  4JX4 A;  3HHH A;  3DKW A;  1OQY A;  2HI3 A;  4L9N A;  4N4N B;  1WPK A;  4KNY A;  1Z7U A;  4F7Z A;  4XR6 A;  3LAJ A;  4J19 A;  2DBB A;  4M6X A;  4XN3 A;  3UNG C;  3GZ6 A;  5L3C A;  3QYE A;  3ESW B;  1YQA A;  2Q1Z B;  1H88 C;  2LTP A;  3EUA A;  3M1C A;  5E8I A;  5HDK A;  2KIU A;  3U21 A;  2OJE D;  3BQZ A;  1K6O A;  1U5T B;  1SD4 A;  3LSK A;  3FZV A;  2V6E A;  2CS3 A;  3K1P A;  4FHT A;  2H1L A;  5HLG A;  1ZN2 A;  1Z7L A;  1TW3 A;  4A3F J;  3PJR A;  2HDD A;  3A02 A;  1FOK A;  2ZNY A;  1B8I A;  4BE0 A;  2X4H A;  2ZXJ A;  1YIO A;  4C3J J;  1WJB A;  2BYV E;  1W5T A;  4F3Q A;  4BE2 A;  2GAU A;  1OKR A;  3L2W A;  5DYM A;  4D9J A;  1NG7 A;  4CYC B;  2MLG A;  2KQR A;  5E1X A;  5ERI A;  3K1N A;  4JBA A;  1ORK A;  2FD5 A;  3S15 J;  2XAF A;  2IPQ X;  3CCJ I;  2PFB A;  3CES A;  1ZQ3 P;  4KFC A;  2JUG A;  4HLX A;  2V9V A;  1MH4 A;  3FWE A;  1JT0 A;  1SAX A;  3DWL E;  2EZK A;  2CUJ A;  4HX7 A;  2IS6 A;  2A3S A;  2Y2Z A;  4OIO F;  4FQG A;  4A6D A;  2XAU A;  1F1Z A;  1TT0 A;  5HOO A;  3SJM A;  4D7N A;  2ACJ A;  4RB0 A;  2KRC A;  4H4K C;  3OYL A;  2ZJP F;  3TP3 A;  1J2X A;  5J40 A;  3ECH A;  4JQF A;  2BBY A;  3DV8 A;  5AON A;  2LBF A;  1S3J A;  1MBJ A;  1FYM A;  4A93 J;  3DPL C;  2DK8 A;  3CQZ J;  3N05 A;  3Q9S A;  2ZJ2 A;  2R7D A;  4OU0 A;  1D1C A;  2K9S A;  2KZV A;  3V8J A;  3LST A;  5L3F A;  5M3M J;  2H94 A;  5GPA A;  3GW2 A;  5IOY A;  2GIZ A;  1TBX A;  4PGH A;  1SFK A;  2VPR A;  1KQ8 A;  3K2Z A;  1KQ0 A;  2IAI A;  4IXA A;  4HF0 A;  4LB6 B;  2D45 A;  4LD5 A;  4BU2 A;  1GHC A;  2PX9 A;  3OOP A;  4C30 A;  1N77 A;  4X0G A;  3LSR A;  1WI9 A;  2VUM J;  2BVL A;  1I1G A;  4DQ2 A;  3VWB A;  5J8F A;  3HRU A;  1IRZ A;  2HXO A;  1HQC A;  3DTE A;  3H35 A;  1C0W A;  4UVA A;  4L9V A;  2NVU B;  5DD8 A;  4WF2 A;  4LLL A;  2JSC A;  2WBM A;  3QP5 A;  3N4M A;  2L7Z A;  3S1M J;  3QPH A;  5C3E J;  1U8R A;  3BG6 A;  3E6B A;  4B3A A;  2OAZ A;  5JVG F;  1ON2 A;  1RKW A;  2B9S A;  5IPA A;  3K9T A;  2M0M A;  2PLY A;  3G71 I;  2BV6 A;  4L0Z B;  2FUG 2;  2DT5 A;  4C2M J;  3ASN H;  2RN7 A;  2ZXW H;  3D1N I;  2ECB A;  3RKX A;  4M3G A;  4D5C A;  5CQE A;  3SYT A;  2Z2S B;  4G6T B;  3MEX A;  1XPX A;  2V1N A;  3CLO A;  1YW7 A;  1MIJ A;  5JLW A;  4F91 B;  2IXS A;  2E19 A;  1TNS A;  3F3X A;  4QSH A;  1VQ8 I;  1ZRE A;  1XX5 A;  2DCE A;  1RPW A;  3KLO A;  4BGD A;  4C2U A;  3AL0 C;  3PO2 J;  2P5K A;  3CF2 A;  2MSY A;  3EYI A;  1FYL A;  5BPD A;  3JRE A;  2QEN A;  3OS0 A;  2R7S A;  3CCE I;  4P96 A;  1HA8 A;  1HKS A;  2MGQ A;  3GFJ A;  4B48 A;  4DBQ A;  1LEA A;  5KVR A;  4KIB A;  5LD2 C;  3K2A A;  3K4M A;  3ZMT A;  3C7J A;  1T8I A;  2X48 A;  1EJ9 A;  4B4C A;  4DW6 A;  1R36 A;  2EIK H;  1J5Y A;  2IGK A;  4OWR B;  1W7P A;  4ZZD A;  3A01 A;  3S2D J;  2X9D A;  4BXX J;  2Q8K A;  2W25 A;  1D1A A;  3TW6 A;  3ZQH A;  2NS0 A;  5CLS A;  4IHY A;  2FF4 A;  2X6W A;  3DU6 A;  2ETH A;  2JA7 J;  2OTL I;  1WRJ A;  3OR2 C;  1ETW A;  3O2P E;  5KAF C;  2HNH A;  1PUF B;  1OCC H;  2ELJ A;  2XAG A;  4C2T A;  2DAO A;  1FWZ A;  3L2Q A;  3ZN1 A;  2YX7 A;  3CO6 C;  2K86 A;  2P7V B;  2Y48 A;  3WTT C;  3CTA A;  4WK8 F;  1I6H J;  3K10 A;  3LSJ A;  2H6B A;  3GTJ J;  3KE2 A;  4IHW A;  4DZJ A;  3JRH A;  4ENM A;  1R5I D;  2ME0 A;  4DOZ A;  4BDZ A;  2EK5 A;  3FHZ A;  5TGT A;  3SZG A;  3S3M A;  2HKO A;  1MMD A;  1P9Q C;  1Z6R A;  2E36 A;  3CDL A;  1J9I A;  3RIR A;  4EJO A;  1J75 A;  1VQ9 I;  1FYK A;  1LDD A;  4NNJ A;  2O9L A;  1QNT A;  1G6N A;  2R5Y A;  4ZC3 A;  2PMU A;  3WTV C;  3RYP A;  2W85 A;  3MKW B;  5J4V A;  3T8T A;  4E7K A;  2L9V A;  2JN6 A;  1UST A;  1RIO H;  3BCA A;  1MMN A;  4Z2Y A;  5CVJ A;  4EM2 A;  4IRI A;  2E60 A;  3IH3 A;  2EFN A;  2VOD A;  2IT0 A;  1OYW A;  2HOS A;  3OYN A;  2KPM A;  2L4A A;  1W36 C;  1CF7 B;  4ESF A;  1FBQ A;  5J47 A;  4EGZ A;  4LFU A;  2ZC2 A;  3TMO A;  3NAR A;  4KIT B;  4BQN A;  4ENJ A;  1UHM A;  4NQW A;  1ETO A;  3U2R A;  4B43 A;  1V4R A;  4QLC U;  5M5X J;  2HFH A;  2M8G X;  3ZMS A;  4AUX A;  4IPA A;  2CRG A;  1VQK I;  2V1D A;  2D1H A;  3H5R A; 
#chains in the Genus database with same CATH homology
 4YEL A;  3SEZ A;  4Y33 A;  1D1B A;  4BJ5 C;  2CUZ A;  1Z3X A;  1EA3 A;  4XKC A;  4PK4 A;  2V4J C;  3OYD A;  2HVS A;  2LY1 A;  1LVK A;  2VB6 A;  2I8D A;  3AKZ A;  2VJI A;  3DKX A;  3LSM A;  3W2V A;  2IS4 A;  3LFU A;  4KT6 A;  4BXF A;  1X4P A;  2WAE A;  2M7B A;  2ZXH A;  4PFO A;  5HNH A;  3MKZ A;  2HVR A;  2IGM A;  2VKD A;  4LG3 A;  2VXZ A;  3OYE A;  4B3X A;  1PYV A;  3QYF A;  3PSI A;  2V9K A;  1BR4 A;  1T0F C;  2VJ4 A;  2L7K A;  1QU3 A;  1V5G A;  4CSW A;  3DQV C;  2CV1 A;  1KON A;  1PJR A;  3QOD A;  4XM3 A;  4PJL A;  2M3A A;  2CMP A;  2KMU A;  4N4O B;  2O5R A;  1WJA A;  2ZFU A;  4XLA A;  2K9M A;  4RLF A;  3E1S A;  1MW7 A;  3S8P A;  3KYL A;  4NUB A;  3KX2 A;  4DBR A;  4BL0 B;  1Y56 A;  2MAB A;  2V26 A;  2XF5 A;  1X1C A;  4Y4R A;  1X1A A;  3I9V 2;  4QPQ A;  4Y3O A;  4DJA A;  1IRX A;  3HPG A;  3MMY B;  2DOA A;  4HG2 A;  2LH9 A;  1J09 A;  2HVQ A;  3QOE A;  2XF7 A;  1N75 A;  2VLA A;  4RM3 A;  3VSK A;  4XQF A;  3PL8 A;  2RQQ A;  2PJR A;  3L2V A;  4NC7 A;  3GBG A;  2W00 A;  4MLO A;  3HPH A;  2PJR B;  4F52 A;  3PSF A;  2R7X A;  3S3N A;  3OYG A;  2ZSI B;  3CMM A;  3QYB A;  3E0J B;  1WFX A;  2R7O A;  4ITV A;  3A2K A;  4EAT A;  2LG4 A;  1V5E A;  2CW7 A;  2K9L A;  4LIT A;  1G8X A;  4XLF A;  3SEQ A;  2HDW A;  1BR1 A;  1DQU A;  1R6R A;  1JI8 A;  1QHH D;  3BG7 A;  3K4C A;  4JOM A;  4KIS A;  2WAQ A;  1ZEL A;  3EPZ A;  3BCB A;  4YRV A;  3OYK A;  2AQE A;  4XKV A;  2R7W A;  4XLH A;  4KJZ A;  3ZR8 X;  4AVZ A;  4E7J A;  4CUG A;  3H9G A;  4XN0 A;  3PNY A;  1WJF A;  1U0J A;  5CKT A;  2HPM A;  4D1Q A;  1D0X A;  2LC2 A;  4II3 A;  3G2B A;  5KNL A;  2CFO A;  4LIV A;  4QPO A;  3OYI A;  3MKY B;  1TZL A;  3DLA A;  2DT6 A;  3FDY A;  4NQW B;  3OYJ A;  4E7H A;  3OR1 C;  3K70 C;  1WJD A;  3OOU A;  4XKB A;  4HNU A;  2ZXI A;  2LOO A;  3PNT A;  2BOL A;  2HU9 A;  2WB1 A;  4HSR A;  3EUH C;  1YE9 A;  4CA0 A;  3BLY A;  2BW3 A;  5HVQ C;  1ERD A;  2UWM A;  2F6C A;  3OYM A;  4P5O A;  3DKY A;  2F5V A;  2GOM A;  3EUK L;  3ZQQ A;  4XLE A;  1DP3 A;  2BW3 B;  2X51 A;  5FRM A;  2K3P A;  2KLO A;  3HL2 A;  3S93 A;  1VZ0 A;  3S32 A;  3HXL A;  2WY7 Q;  4J00 A;  2DT7 B;  2LY2 A;  3OS1 A;  2UUZ A;  2E1M C;  3F9K A;  4F55 A;  2M4K A;  2XC7 A;  2QKL B;  3A4C A;  4BS9 A;  4ZTJ A;  4PUS A;  4PJM A;  2MFZ A;  4E4H A;  1K6Y A;  1GLN A;  2MD0 A;  2VQL A;  4E6K G;  1MND A;  1WJC A;  4XMY A;  2R7R A;  3PUB A;  4GRI A;  5HLT A;  2CH0 A;  2VJJ A;  3CP2 A;  5CPR B;  2QKM B;  2IGN A;  4XOT A;  2KP6 A;  1UAA A;  4RLQ A;  2XDV A;  4NC8 A;  1DGR M;  3LSG A;  3VYU B;  4DGW B;  1D0Y A;  3W3C A;  3VDX A;  2JVG A;  2JA2 A;  4ZYA A;  4ZTF A;  4PSX A;  3L2R A;  3K4N A;  1AA7 A;  4N4N B;  2V7F A;  3AL0 B;  4XR6 A;  3D5S C;  2E5N A;  1FMW A;  2JVH A;  4BJ6 C;  1E0E A;  2L9S A;  3UNG C;  4XN3 A;  2LRE A;  3QYE A;  4ANJ A;  2Q1Z B;  3EUA A;  3LSI A;  1Z21 A;  3M1C A;  2ZSH B;  3OIQ A;  1FMV A;  3U21 A;  3VSL A;  3LMM A;  4CCM A;  1MMG A;  4PJN A;  3LSK A;  3H0D A;  2V6E A;  2CS3 A;  1Z3Y A;  2WA0 A;  4IQ4 A;  2HZD A;  3IUO A;  2LYC A;  4HPQ A;  1BOB A;  1Z7L A;  2XF6 A;  3PJR A;  1T95 A;  4BE0 A;  3BC8 A;  1WJB A;  4F92 B;  4IQJ A;  4XL9 A;  4F3Q A;  3KEY A;  4BE2 A;  3ZRG A;  4BEH A;  3L2W A;  4D9J A;  2Q2E B;  1NG7 A;  4CZC A;  2KQR A;  4RM2 A;  3FBI B;  4E7L A;  1S9H A;  4DIQ A;  3K4J A;  4ZDP A;  4BEH B;  5FRO A;  4PSW A;  3CES A;  2JUG A;  3J7A Y;  2BVM A;  4PJJ A;  2HQA A;  5KHD A;  2KRH A;  3DWL E;  4BE1 A;  2CUJ A;  2IS6 A;  5JHF A;  2JSP A;  4FAS D;  1SAU A;  3HC7 A;  2XAU A;  1TT0 A;  5HOO A;  4FET A;  2KRC A;  4H4K C;  3OYL A;  3I3L A;  2VAS A;  1D0Z A;  4IX7 A;  4JQF A;  2Z16 A;  2LBF A;  3A1Y A;  4BDY A;  3VYS B;  1WJE A;  3DU5 A;  3DPL C;  1X1D A;  4OAY A;  3N05 A;  3D5R C;  3TL4 X;  3LSH A;  1OR7 C;  1D1C A;  2KZV A;  3PNV A;  2LBF B;  3OIP A;  1X1B A;  2CW8 A;  2X6X A;  4P1W A;  1SFK A;  2A5W A;  2KDO A;  4HST A;  1DGW Y;  1YX3 A;  5HNF A;  2L2O A;  1MNE A;  4BU2 A;  4LIU A;  4C30 A;  1N77 A;  4CCJ A;  4X0G A;  3M8J A;  3C2H A;  3K6G A;  2BVL A;  2X1D A;  3DEE A;  2WAD A;  4RMN A;  3VWB A;  3OS2 A;  3H35 A;  3DTE A;  4XON A;  2DXI A;  5LFA A;  3OYA A;  2HPI A;  2IS2 A;  3RSN A;  2OUM A;  3ONQ A;  3ZGK A;  2WBM A;  3TBI A;  5FRN A;  3MD2 A;  4CCK A;  3BG6 A;  3PFY A;  3OYH A;  1LFP A;  3W2A A;  3DPU A;  3OYB A;  2M0M A;  2L5Q A;  2VL8 A;  4CH7 A;  3IP4 B;  2FUG 2;  3CP8 A;  1LKX A;  2GOX B;  2X6Y A;  1Y6I A;  2VQG A;  3RQ4 A;  5CQE A;  3SYT A;  2Z2S B;  4G6T B;  3FBN B;  2V1N A;  4E7Z A;  2MYS A;  3RPU D;  3W2W A;  4F91 B;  2IXS A;  1NG6 A;  3K4K A;  4IKF A;  2F4I A;  2UV1 A;  3L2U A;  2DCE A;  4BGD A;  4C2U A;  3AL0 C;  3HOS A;  3CF2 A;  3HOT A;  2M4G A;  3OL4 A;  2VPL A;  2VJ5 A;  3FKJ A;  3OS0 A;  2R7S A;  1HA8 A;  3HKZ A;  2W82 A;  3VYR B;  4B48 A;  2E1M B;  2NOJ B;  3AFH A;  3OYF A;  4DBQ A;  2RRE A;  3H5N A;  3ZXS A;  5KCM A;  5LD2 C;  2Y0S A;  4HRI A;  3HG9 A;  2K5C A;  3K4M A;  2IGO A;  2IS1 A;  3NWS A;  4XKW A;  3RCO A;  3VYT B;  3CZ6 A;  3H5A A;  1X4O A;  5CQG A;  2PMZ A;  3DPT A;  4CCL A;  4ZDL A;  4ZDO A;  2IGK A;  4OWR B;  3SDB A;  4BQQ A;  1UG0 A;  1D1A A;  1G59 A;  3CJQ B;  4AYB A;  1N78 A;  2W7N A;  2VKH A;  2X6W A;  3DU6 A;  3HUG B;  2VIX A;  3OR2 C;  3LL7 A;  2HNH A;  2ELJ A;  2R7U A;  2CV2 A;  2A6T A;  4C2T A;  1WJ5 A;  2MC4 A;  2OC6 A;  4OAZ A;  2CV0 A;  3D5L A;  3FHN A;  3OWT A;  2P0W A;  3L2Q A;  1OLT A;  4E7S A;  1V5F A;  4II2 A;  3UR3 C;  4R79 A;  2LRD A;  2WAF A;  1X19 A;  3K10 A;  2R7T A;  3CJR B;  3OMY A;  2KL4 A;  4U7B A;  3K4L A;  4HEA 2;  4BDZ A;  4DOZ A;  3OL3 A;  4CCO A;  5TGT A;  4B47 A;  3SZG A;  3K4B A;  3S3M A;  3DTI A;  4YEJ A;  1MMD A;  2WY8 Q;  1YX5 A;  3IAM 2;  4ZJZ A;  1P9Q C;  4C9Y A;  4PFP A;  4E7I A;  3S3O A;  2Z1D A;  2M7A A;  4NNJ A;  4HNT A;  2RNG A;  2R7V A;  4BAC A;  1UEL B;  2VXD A;  4BUP A;  4ZC3 A;  4XOR A;  2E5Z A;  4CCN A;  3MKW B;  4E7K A;  2X1C A;  1BR2 A;  2VQH A;  3BCA A;  3V42 A;  1MMN A;  4J01 A;  2X1E A;  3H9J A;  4B44 A;  2KHM A;  4F93 B;  2E60 A;  1LDK B;  3OYC A;  4BJT A;  2L9N A;  3IAS 2;  2R4G A;  3OYN A;  1W36 D;  2KPM A;  1QHG A;  1W36 C;  2XSJ C;  4XNF A;  3H9Q A;  2W4S A;  2OV7 A;  3TMO A;  2W1O A;  4KIT B;  4BQN A;  1MMA A;  4U87 A;  3C2G A;  4AU7 A;  4BQO A;  3ZCO A;  4B43 A;  3NWT A;  3DTK A;  4XOP A;  4XLC A;  2AQF A;  3RTR A;  3K70 D;  2R7Q A;  2VQC A;  2X85 A;  3OY9 A;  4IZZ A;  2DJI A;  3H5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...