3WGIA

Crystal structure of rsp in complex with beta-nad+ and operator dna
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
217
structure length
217
Chain Sequence
KTIVSMAVIRRLPRYHRYLEELLKNDVKRISSRELSEKMGVTASQIRQDLNNFGGFGQQGYGYNVEELYNNLTKILGLDKTYNTIIIGAGNLGQAIANYTSFEKSGFNLKGIFDINPRLFGLKIRDVEVMDVETVEDFIARNKIDIGILCIPKDNAQYTADRLVRAGIKAIWNFLPIDLKVPDDVILENVHLSDSLFTVSYRLNEEELFKKLKGETA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinct structural features of Rex-family repressors to sense redox levels in anaerobes and aerobes
doi rcsb
source organism Thermoanaerobacter ethanolicus
molecule tags Transcription/dna
molecule keywords Redox-sensing transcriptional repressor rex
total genus 69
structure length 217
sequence length 217
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02629 CoA_binding CoA binding domain
A PF06971 Put_DNA-bind_N Putative DNA-binding protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wgiA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wgiA02
4LN1A 3HN2A 4A26A 3H3ZA 4RORA 4FX4A 2BFAA 5CYVA 3INGA 4I8XA 2HQRA 3SLKA 1MX3A 5A3VA 3FWEA 2FPIA 1PQPA 4XB1A 2Q45A 1L0OC 3JQ8B 4DPKA 3GG2A 5TT1A 1TW3A 3ZNNA 3P7NA 3O8QA 1XN7A 3I54A 1R0SA 4L74A 3TDUC 3UGKA 4BHBA 1YFHA 3P9IA 5I7EA 4A0ZA 5KVRA 2AS5F 3WB9A 2VT2A 5COAA 4ZYEA 5G0UA 1BI1A 4PDKA 3DKWA 4CV0A 4XSXF 2Q2WA 1B15A 4IXWA 5BSEA 4A2CA 3PP8A 2VE8A 1CWUA 3M6IA 2HRBA 4GI2A 4Y15A 5IZ4A 2EJVA 4DA9A 1P2FA 2AE2A 1ZREA 2JFHA 2Q50A 4UUOA 1DPRA 4BO4A 4BH9A 1DBVO 2EV9A 5IN5A 3CUQB 4U6QA 3C18A 3ETGA 4L4RA 5JDIC 3KZVA 5LRSA 1IAWA 1O95A 1GFSA 3KBOA 3KTDA 4O1MA 4TVBA 5L95A 2POQX 4U88A 4GCVA 1CERA 2HCTA 1QP8A 1RM5A 1NTOA 2FY8A 2PI0A 5LRRA 4GAEA 4M71A 4OU0A 4DQUA 3QPHA 5KVQA 5IFLA 1X1EA 1H2BA 1YS7A 4GL4A 3L77A 1ENOA 4CM1A 2L54A 3VODA 4BAYA 2CMDA 2VBWA 3GZ6A 1F1ZA 1FBSA 3A4VA 4NK5A 3E9MA 3BY6A 4AICA 3TZKA 4BNTA 3E1KA 5JLAA 2ZTVA 2HQ1A 3ENNA 1DUXC 5JCXA 3KSZO 1IZ9A 1T2FA 3VEPA 5HLGA 2X0IA 5JY6A 5A9SA 1B9NA 4B3HA 4PGHA 2W8ZA 1VE9A 2W84A 4B4UA 1P3DA 4H15A 5CPFA 3U4DA 2O3JA 1I3KA 2O48X 4RGBA 1Z91A 1O94A 4AL4A 2H6BA 1GV1A 5ER9A 3GW2A 3R3SA 3SX2A 3ZWMA 1MA0A 1NP3A 3K69A 2NM0A 3U4CA 3W6UA 1WRJA 3L09A 1A72A 1Q2XA 2ZYDA 2QZ8A 2EGHA 2V6CA 4XLNF 4IVNA 2VUTA 3K96A 1HDRA 2FR1A 2ZJ1A 2VOOA 3RJ5A 3ZMZA 4YPOA 4GH5A 1EFKA 4W82A 2X22A 5F5NA 4XA8A 1NFRA 1WMBA 3LAPA 2VWHA 4WOJA 3ELKA 3D3EA 2GGSA 3PGJA 4S05A 2XAAA 2ZQYA 4Z6KA 3GQVA 2PMUA 3HYIA 2VTEA 4BO2A 5BR7A 1KS9A 3H9UA 2A4KA 2NTJA 3E48A 3R0AA 1ZYRF 3CJNA 4AVYA 1YL6A 4BNZA 3TRIA 2NYXA 5AVOA 4D0RA 1WKMA 1RPNA 4CUJA 2AA3A 2Q4BA 1I8TA 1SPXA 3GYHX 3TOAA 3H7AA 1DJNA 1ZXBA 2Y1OA 4IINA 1KIFA 4PLWA 4G2NA 3V2UA 1U5TB 1KVTA 3WGYA 1HRDA 5IG2A 3JQAA 1XMAA 1DLJA 3K5PA 4KDEA 1USTA 2XXBA 2Y93A 1FWZA 1XSEA 4BUCA 1J6UA 4RPHA 4TRRA 3U1DA 1H9AA 5JFOA 4FD3A 2CDAA 1Z74A 4E31A 4EI2A 3JQEA 2C6YA 1UXGA 1KYZA 1ZK1A 4MOWA 2G9WA 3FMQA 3PFWO 1NHGA 3ZN1A 3GX4X 2O3TA 2P2SA 1GVJA 2E37A 2QLZA 4GWGA 4ITUA 3T4EA 1D8AA 1J5PA 3AM5A 4GYGA 3KOUA 2EV5A 4RPLA 1R36A 5T67A 4E0BA 2AE1A 2Y05A 1EMDA 2J3HA 5DT9A 3H5RA 4BV8A 5JSFA 3E6CC 1EVZA 2X4HA 2DI3A 1DC6A 1OKRA 1LEHA 1NPDA 2B0JA 1L7DA 2EGGA 2VC0A 1DIRA 4ESJA 1JDJA 1XWFA 4NBRA 3IIEA 3NGXA 1G6NA 4UV9A 2ZJ0A 3ZU2A 2X1HA 3C1AA 3OIFA 4LK0F 4P96A 4FSHA 4OOFA 1LDKB 1MLDA 2OXIA 3M1LA 3ZWXA 1XDUA 5KNLA 3SHFA 1ISGA 2K27A 3OECA 2UXNA 4UV8A 2RNJA 1QV6A 3PPIA 3Q2KA 4BO3A 5I9NA 3BMQA 1WPQA 2FN7A 3MZ0A 4YWJA 2LDUA 1SZJG 2X5KO 3LDHA 1AN9A 4BKOA 1X1TA 4YYZA 1P33A 4LLGF 2CGPA 1Q0QA 3F3XA 3GLXA 1H6CA 1K6JA 4LW8A 1K5HA 1VSUA 6LDHA 2YFQA 5BSHA 1SMTA 2IXAA 3BHIA 3OICA 4KWHA 2HOEA 3NJ8A 4A5MA 2TDXA 3EYIA 1U3VA 4FFNA 2IPQX 4JJFA 4D41A 4B4WA 5IZCC 2M30A 2STTA 1HE3A 2X9VA 5EJ2A 2W2LA 3MTGA 4IIVA 1FDUA 2PR2A 2O3QA 4IUYA 3AOEC 5U4QA 1O8CA 2GR9A 2GYYA 2I9PA 5G0WA 3BTOA 3GO5A 3KZZA 2NRAC 1JA9A 2JFFA 4JP3A 4MPDA 4RZIA 4ZRNA 3V7CA 3JQAD 4J49A 5CDGA 4OM8A 3M2TA 2I3GA 1UXKA 4HAMA 5J8FA 1KQ8A 2X0RA 1M2WA 1PDNC 3E5RA 3IL2A 3PFFA 3VPXA 2OQGA 1G0NA 2DTDA 4CLRA 3K31A 4HX8A 2P5UA 3S8MA 4E6PA 3ZMDA 1BGVA 2CY0A 2WEKA 2BGLA 4WLNA 2NS0A 1Z6ZA 2DM6A 4YJHA 1JTVA 1TLTA 2VBYA 3F8BA 4BS9A 1ZK4A 1I6XA 5TS3A 1E6UA 4KIFA 5C7OO 3A06A 3HDYA 3D7LA 3P2YA 4UVGA 5LDGA 1S7CA 4EJOA 4BQRA 2UYYA 4KUHA 3QVXA 2HMWA 4URFA 4CMGA 3E5MA 1J75A 2DPUA 5HS8A 4LMPA 3V7SA 3D3WB 4Y6SA 4E33A 1ZN2A 4K26A 1P4AA 1LDYA 1NQAO 2JD2A 5BT9A 3TF5A 5JXWA 1QSGA 2HMTA 1YJ8A 2PZKA 3I58A 4OIOF 4RVUA 2HU2A 4AJPA 1EDOA 2O7SA 4PZDA 1KC1A 4RPKA 5KTKA 1H0MA 5TRDA 3KE2A 4E2XA 1R58A 1DIAA 1T4BA 5HOOA 2A94A 3OQBA 3R4KA 4TQGA 4BQPA 2L3DA 1LLQA 2FRDA 4CV1A 1NPYA 4OIQF 2DLLA 2FHSA 4AJ4A 3JD2A 5D6EA 2ACJA 1JW9B 1Q0HA 1O3TA 1TVEA 3NV9A 3OV8A 4L0YB 3WG9A 1DB3A 2OORA 2ETHA 3WTCA 2XHKA 5D4SA 1PR9A 3GUYA 4K28A 5HRUA 1WW8A 4JQCA 1DRVA 3MZHA 3WTSC 3R6DA 2LNBA 3GNQA 2BRUA 4J91A 3HTSB 3DPTA 4PZJA 3RKYA 2YX4A 1MV8A 3ZDFA 3ZHZA 1YO6A 4CQLA 5AIPA 3ON5A 3FRJA 4LMYA 3PYLA 3QWHA 4PCVA 5JPIA 1UXIA 3WGQA 4HV4A 4FJ0A 2EFQA 1M76A 4FCCA 5JVTA 1SBYA 3DZHA 4IXTA 4NFHA 3MCZA 4OSOA 1R6DA 1G3YA 1IULA 4PVCA 4XJTA 1R12A 4EV0A 2HO5A 1T24A 3IC7A 1EBFA 3D5TA 3ZW8A 2LDXA 3WTVC 2E49A 5FYDA 5KKAA 4KUGA 2O3UA 4FDAA 3QSGA 3WTTC 1P92A 3M1EA 5IN4A 3UHAA 2ZMEA 2YX7A 1XA0A 3RD5A 1OMOA 3OEWA 4J7CA 3HTUA 2D5CA 2GAUA 3BTVA 1AXGA 4HOBA 2HWVA 2JKVA 1KQ9A 1KA8A 4LLNA 4E2WA 4AJ1A 3LZ6A 3N4MA 5FI5A 1H5QA 2O0YA 1DC3A 1PX0A 1EH8A 3AU9A 1IN4A 3I5MA 3GH3A 1MDMB 4WLUA 3WJ7A 1UUFA 1VL8A 2QIOA 3B1KA 1ISFA 3IC5A 2MC3A 3CLOA 1CF7A 2HMUA 3BDDA 2CZCA 1EFLA 4P4GA 4UHTA 2VCYA 4R3WA 4C7KA 4UULA 4C7JA 3ZNPA 4YT2A 4UUNA 1XCVA 3BPXA 2Q2VA 2CG4A 5A4DA 5ICSA 1P1HA 3X2EA 4G8XA 3I9NA 2VC1A 3RWBA 3FF4A 4O63O 2NVUA 4L0QA 1IB6A 1C1DA 1NQTA 1QYDA 4PG4A 1OYWA 3LK7A 1A27A 1OC2A 1K3TA 3F46A 4H3VA 3KYDA 4QEDA 1Q7GA 4XDYA 4ID9A 3GVHA 5JHUA 3BMQB 3VVBA 1UFMA 4GWKA 5CFZA 3NT2A 4XQ9A 3VPGA 5TC4A 3KV3O 1WWXA 2RVCA 3J80Z 2IVMA 1FZPB 2OQRA 3ABIA 2NAZA 2YQ5A 1X15A 2CSUA 1XQ6A 3BIOA 3PDUA 1GV0A 4L5JA 2W85A 1JU9A 2UWMA 1ZSYA 3I4PA 1UHWA 3OFSA 3TJRA 4AJOA 2C07A 1IUKA 3RPQA 1PS0A 3E9QA 2FXAA 3HRMA 3GAZA 3QRWA 2VHXA 4U7WA 4DPMA 4XYMA 5B4TA 1QYCA 4W7HA 3VZQA 1KY5A 1ZJZA 2NV6A 1ARZA 4MVJF 5KIAA 4CO8A 1SC6A 2I3AA 4DUPA 3PIDA 3DOJA 2VUSA 4Q3EA 3PHIA 1LX6A 2OO5A 2GZ3A 5CVRA 3EMKA 3UICA 4XGKA 4HFMA 4FJ2A 3SFZA 1DLIA 3M1AA 4KDPA 2JAHA 4FFLA 3JQ9A 3LA7A 4NBWA 5G2OA 5T64A 4BNNA 1SB9A 3QIVA 3T7CA 3UCFA 4HF2A 1QV7A 3QHAA 2TMGA 3BMCA 2EB7A 1YOVA 2UAGA 1K78B 2NLOA 2PA3A 3T8TA 1DP7P 2B5VA 2FRHA 2Z1MA 4J2HA 3F6OA 5TSDA 3FZVA 4QO7A 4K1LA 1O7LA 1SD5A 2EFNA 1W7PA 4JBIA 4S3MA 4UEJA 4CR7A 3PJFA 5G4KB 4IRIA 1PL8A 1CJCA 4WCFC 1JN0A 4LVCA 1PZEA 3OEYA 5I7VA 3F5QA 4XRGA 3R61A 1U4OA 2Y1FA 3NTRA 1HLDA 2Y1DA 1FBUA 1KYQA 2O4CA 1QZYA 4HX7A 2B35A 2ZXJA 4BXUA 2ZK7A 2VQ3A 1CIVA 3P5SA 3GRKA 5E8IA 1BJAA 1PJ3A 5JDCA 3EHEA 1SMKA 3RI3A 4ENJA 3VZRA 2BKAA 1DRWA 2RC4A 4IDDA 2CDCA 1W7PB 5HTOA 5TJJA 1HXHA 4WLFA 4XX0A 5DD4A 1WI9A 4MVJG 4OH1A 3V2HA 3W4IA 5CVIA 3ENKA 4E4YA 3EUWA 3GY0A 4E3ZA 2V6MA 2CFCA 3EY4A 4L9RA 4NH4A 1I3NA 4DREA 4OINF 2ZTUA 5JFRA 4FFMA 5K0ZA 4M6XA 4WF2A 1OZAA 2R7DA 1P31A 2Y99A 4BNJA 1W4ZA 1B7GO 4MP6A 4BB6A 3F5SA 3O3KA 5L4LA 3IDSA 1XSXA 1A5ZA 3QP6A 1OC4A 4IDAA 3V7RA 1ORRA 2I65A 3JQFA 4UEOA 1T4DA 3RU7A 5I7FA 3MQ0A 4GMFA 1IXSB 2PTGA 3CMMA 4A5OA 5IDQA 4R51A 1DFHA 2JAPA 3DF8A 3KFWX 1GAEO 2LDBA 1AHHA 4NHEA 3LA2A 4J1TA 4WCFA 5IT9K 2J5QA 2OMEA 1GZ4A 3D64A 4DLLA 2XUBA 2DPGA 1UP6A 4IRGA 1BXGB 3UOGA 3ZV3A 2OA4A 4NR0A 5ED4A 4PZEA 4U0JA 1REPC 3PVZA 5F6FA 3ZPLA 5HLIA 1UB9A 3OQ6A 3DZJA 3GVAA 2R6JA 5J23A 2X6TA 2H6CA 1PWZA 3HSKA 5MDHA 5AIQA 5B37A 4P55A 3GG9A 3ETDA 5DCFA 1USSA 1HE2A 1FC3A 3NUGA 4BOYA 3OA0A 3QVOA 4BHTA 1N1EA 3O6BB 2GXBA 3ISPA 3LYLA 3NQOA 3WLFA 1YXMA 5AXBA 2P4WA 1P77A 3OJ0A 4A10A 5JC8A 2YV3A 2I67A 4EJVA 2HS5A 2IXBA 2Y1GA 4R16A 2IJLA 4ND2A 1E7SA 1M6HA 2BE5F 2ISYA 1PJSA 2YHIA 5DCYA 3MWMA 2KIUA 5HS4A 1IF1A 4JJIA 3VH4A 1J9IA 1R7JA 4WNCA 1T2EA 3PK0A 4GSKA 1LRJA 1KU3A 1ZLJA 4OOIA 4IQGA 4WCDA 4ALNA 1HKSA 3Q0EA 1WP4A 4FS3A 1YE3A 1ON1A 2Y67A 1YQGA 1X14A 4PLYA 3P7MA 4FC7A 2EV6A 2F5FA 1SO8A 2YYYA 1SEVA 3BZUA 2HQNA 1ML3A 4KNYA 3O4RA 5LGNA 2XV4S 4NFYA 3MAJA 4JROA 4OXYA 3JAMK 3PIIA 2JD0A 1V4RA 3AY3A 5U1PA 5A04A 3KXDA 2V1DA 3I52A 3LT2A 2P4HX 3O8QB 4NPCA 4OHUA 1LTHR 4XQCA 1MDMA 5BNTA 4UVIA 4HDVA 3OJEA 2IP2A 1QNTA 2UV8A 4CL3A 8LDHA 1B6AA 1QORA 1BDMA 3D1LA 4M74A 4CLXA 1SOVA 1Y5RA 3L4SO 4XSZF 4E5PA 3I59A 1AWCA 2GZ1A 1PGJA 4Q9NA 4HY3A 4ZQHA 3VFZA 1HDYA 4BB5A 4YAKA 3SZPA 4RLSA 3GN1A 2O3SA 1ZZEA 3NT5A 4G65A 5G4KA 4RAZA 1B1BA 4R79A 1NYTA 3WGIA 4FQ8A 2G1UA 1PJ4A 4CZZA 3N7UA 5T8KA 4D43A 5F64A 1YS4A 4Z0HO 5BPDA 1FYKA 4ZYDA 2A35A 4LSMA 4G6QA 1F0YA 2EW8A 3L0DA 1K78A 4NU5A 5TRTA 3M8FA 3I9LA 1JHFA 2UUOA 4HWKA 4EMSA 3C7AA 1RYDA 2PWZA 3OA2A 1O3SA 3J80K 4OGWA 3PWZA 3UW3A 1HF3A 3WLEA 2J3IA 1XR3A 4IS3A 2ZKZA 4CMAA 4CMIA 3HE3A 3RJPA 1V6AA 4ALKA 1CGPA 4XYBA 5IXSA 2BELA 1L7EA 2RHRA 3EGOA 2ZB8A 2VYVD 5DCUA 5B1YA 2MBFA 2J5PA 2KRFA 4HZFA 4B09A 2W57A 1ONNA 1UH5A 3PGXA 4OXKA 3JV7A 1LLCA 1BVUA 4DLAA 3BOQA 1J2XA 4ENNA 1DIGA 2HSDA 5JCJA 4NHJA 1YIOA 1ZEJA 1TLHB 3BAZA 1RM3A 1TQMA 3RIRA 1A71A 1LJ9A 2D59A 4ZRMA 1EBUA 1OFGA 1YGYA 2I99A 4R68A 3GRPA 4YIIA 3LA3A 5E18F 1I1SA 1BG6A 4RVFA 3NDJA 4D7AA 5D5WB 4Q39A 4ZJUA 1BBYA 3NTQA 5AOVA 4ON0A 4YAJA 2EV0A 1IOLA 1LB2A 2O50A 1E3WA 3LC1O 1U1IA 5AYVA 2P6SA 3CE6A 1YL7A 4HX5A 3ZV5A 3BJ6A 3I53A 3DXJF 3EAGA 2DUUA 3KYCB 1YG2A 4FFPA 4A2UA 2WE8A 4MIOA 1U9JA 1ZK3A 4ZA2A 5I9LA 4ZICA 3V1YA 1YW8A 2KIFA 4WXCA 3OQ1A 1E3SA 3JQGA 1YO5C 3QY9A 2D3TA 5JMPA 3ZU4A 3DBHB 1IUYA 5FI3A 4KQWA 2PGDA 2B4RO 3TDKA 4CLHA 2FMYA 3HUGA 3O9ZA 1NASA 2D2IA 4B79A 1U28A 3KYBA 2O2SA 4WEOA 4W6ZA 3QPTA 5E1WA 4YFKF 3FR7A 4Y8VA 2CVQA 4XYGA 2YV1A 5BNIA 1BIBA 2DC1A 4NMHA 4Z9XA 1YB4A 3WNVA 4GX0A 2FOKA 2OD5A 4EM2A 2V65A 2VZ9A 4EJ0A 1BDBA 4MVJI 2NTNA 3GT0A 3B70A 4BIIA 1IN7A 1ZSVA 3W1VA 4RJTA 4IHTA 1SFUA 2PKRA 2QHXA 2I6TA 2FA5A 5GMOA 4BHPA 4B4VA 3VTZA 3WU1B 4BKUA 4XLPF 2QZ9A 2C59A 3H9JA 1DEHA 3JQGB 2UZKA 3FWZA 4CMEA 4BGEA 5HDNA 2GERA 4JBHA 1TEHA 1HKTA 3GVIA 3K30A 3VDRA 1BC7C 5HDGA 1PP7U 1DC4A 2WSBA 1K2WA 4O6VA 1FK8A 1ZNQO 3Q9UA 5KJ6A 4HV5A 1V8BA 2JL1A 1K6IA 2FR0A 2DKNA 1LLUA 5CLSA 1QPMA 4LISA 2L02A 1MJBA 3QRFF 5L40A 2FP4A 3AOEA 3ORFA 4HV6A 5HLHA 1MG5A 3FI9A 2HGCA 2DBZA 3GAFA 5L9AA 4M55A 4JCOA 3R60A 4LB5A 1P44A 1RM0A 3GLQA 4I9HA 3B20A 4L4SA 3DR3A 1NFQA 3JYLA 4ZHSA 1LEBA 3L4BA 4E5YA 2DQ4A 3WTYC 3H3FA 2PEXA 4F7ZA 3UFXA 1T39A 1BI2A 2F5CA 5ICFA 3UVEA 4TV7A 4B7XA 4EBFA 1ID1A 4NB5A 1UAGA 5L3GA 4LG0B 3DFGA 1X0VA 3VB2A 5DULA 3Q3CA 2DW4A 3SC4A 1SAXA 1UP4A 3B6ZA 5ITWA 5E1XA 1HBXG 4OJNA 4EJTA 1VKOA 1XD7A 2NVWA 4CMHA 3CZMA 1ZRCA 3WTZA 1AHIA 4KUEA 5IAAA 2C7GA 1IHXA 3ASVA 3MJ4A 1U5AA 4G9YA 3EYYA 4H0EA 2HK9A 2VYND 3LU1A 3PYXA 2A68F 2HYFA 2GIVA 4CM8A 3RYPA 1E77A 1XYGA 4HKTA 3F1LA 3JD4A 2NVBA 4GO1A 2O3RA 2C20A 2X5JO 2JRTA 4MKXA 5JW6A 4LMRA 2FBIA 4EUHA 5DCMB 4CM4B 2Z1NA 3FWNA 4CODB 3GDFA 1Z7UA 3BROA 4RB1A 2P5LC 1X13A 1KC3A 1KVQA 3MOIA 3CKYA 4UAGA 5ES3A 3FN4A 5ICGA 4MKZA 1FP1D 1LC3A 2IYOA 4AJ2A 1EUCA 1JKFA 4O5VA 2DTEA 3FNEA 3CTAA 3GNTA 5DN9A 4XRFA 2DK5A 1QLJA 3DO5A 3I3OA 1TXGA 1UXHA 3JQAB 4FW8A 1O3QA 4XIYA 1U5TA 2E1CA 2CYYA 3K92A 2RH4A 5JC1A 4MVJP 3KZYA 2WWYA 1QYXA 2CO5A 1QLHA 2OBYA 3ZU5A 3RKXA 2AQIA 4ESOA 1YL5A 2WMDA 2X9NA 3WE3A 3R0JA 3LC7O 4DTIA 4JN6B 4IDCA 4UREA 1PSDA 1QYWA 1MFPA 3DBHA 4G7HF 3ICPA 4BNIA 1TA4A 2IYPA 3WTXC 1MC5A 2Q8KA 5KVCA 3IP1A 2M5WA 1ZW1A 4U0KA 5DOZA 1I3MA 2JJYA 3ADPA 3DFUA 3GPIA 3U2RA 5JYEA 1YB5A 1ZLKA 5KJFA 1QBJA 2KIMA 5C3MA 1E3IA 3E6AA 4WNIA 1N92A 2IW5A 1ADBA 1GUFA 1WDMA 5FO5A 1UAYA 2P9GA 4R5MA 2P5VA 4PLCA 4BNUA 2WWRA 3DAGA 5DP2A 5THQA 2X58A 1IN8A 3LSTA 3UXYA 2AXLA 1LLDA 4MVJD 2Q2EA 4LGVA 4U6SA 1ENYA 4RGXA 2W2KA 1OBFO 1X0XA 1ZRDA 3FMSA 5HS6A 4GMGA 4KICA 1NQ5A 3SVTA 2J5OA 3VKUA 1J5YA 2E7WA 4YVFA 1FDVA 1W8DA 4ALIA 4DXHA 1TW2A 1E7YA 1ONOA 4KOAA 1XKQA 4M49A 3OSUA 4QECA 3I9OA 4NBTA 3OH8A 4G5HA 4CLOB 1TT5A 3U5TA 2GPTA 2X86A 4CM9D 4YFXF 3A28A 4I98B 4Z2YA 2GLXA 1CQJA 4ND5A 3HSRA 3E5QA 2QVOA 1E92A 3H2SA 1BXGA 3JYNA 1UDCA 4A12A 4WOKA 4WE3A 2J3KA 1GD1O 1XELA 3C85A 4L4XA 5ILGA 5EEGA 5HM8A 3MFKA 2HKIA 4DIFA 1N9GB 5DUIA 5A2QK 1QG6A 1DC5A 1GQQA 1Y9EA 1NNUA 2PH5A 2XAHA 4M73A 3DTYA 4IJKA 3L9XA 4RV9A 3EQLF 1PWXA 5ICMA 2GN4A 5FLXK 5AQ1A 3GK3A 3E6DA 1GZ6A 5KK1A 4OIMA 1EEHA 4QUKA 3TN7A 4DQVA 3S2FA 2HMVA 2VYNA 4YJFB 2EA4A 1N9GA 1HW5A 1EUDA 1H9BA 2YHUA 2RN7A 1JGSA 1P1JA 1QR6A 4MDHA 3FXRA 3PRJA 1BC8C 1W73A 1YH3A 4DQ2A 1ADCA 4EEZA 2FF4A 3WODF 1G3TA 4QLCU 2HJRA 3G1UA 3WSWA 2Y75A 3WGGA 1FNNA 1QGPA 1JLLA 4TRNA 4LG0A 3E6MA 4YFNF 4PVDA 1HQCA 2EF1A 4FPXA 1ADFA 1CETA 3GHHA 4IDBA 2XXJA 2A3SA 3NGLA 4YB8A 2CWEA 4FOSA 1F9NA 4EUEA 1RI7A 4CYDA 1P1IA 3ZHYA 4LD5A 3BTSA 5K5RA 1KU9A 2H6EA 3QU3A 1XLTA 2JCVA 3IQDB 3RC9A 2OOSA 4NNJA 4Q3AA 4QX6A 1GUYA 4HADA 1EK5A 2NWQA 3DMYA 2ZKLA 4WK8F 4IQ8A 4J6FA 2EP7A 2ADUA 2IEDA 4IXAA 1A4IA 1E6EA 1LQTA 3CUQC 4EJWA 5A2QZ 3GOHA 5CG1A 2Y0EA 2L01A 1YBVA 2RBEA 3U4IA 2R2GA 2DFDA 4R3NA 5EN4A 4BMNA 1D3AA 3NEUA 2D1YA 1A7AA 2GNAA 3DZBA 3ETEA 4PFJA 4R54A 1SAYA 4RS8A 1P0CA 1K89A 4D42A 5H6QA 2H5LA 1NVTA 5DDIP 1VTNC 2F5EA 3TQHA 3WIDA 1YWGO 4G81A 2DO7A 2X23A 1W5SA 3COAC 5L3DA 3GGPA 2M87A 2FNPA 1PQUA 1R66A 1GYQA 1EH6A 3HQ4O 3I9JA 4Y67A 5CEJA 3HOTA 1NAIA 4BNYA 4Q3BA 5A9RA 1MB4A 5JAMA 2GZWA 1FOKA 3W8EA 7ADHA 4NZ9A 3D4OA 4PG7A 4M8SA 5LEJA 1HKUA 2ZATA 4R41A 4EJUA 4WK6A 1U3TA 4XDZA 1DXYA 3KUXA 1G3SA 2NU6A 4RF2A 3ZW9A 4AIHA 3JYQA 4J9UE 3ZWOA 5FWNA 4KFCA 3GMDA 3L2CA 2OAZA 5ENDA 3H6KA 2HMSA 4F6CA 2EKPA 5CEEA 1B59A 1XG5A 2HDHA 4D79A 2ELHA 1ENZA 4EGFA 3JQCA 3CEAA 2QBYA 2TMDA 4N5MA 2RCYA 2B4TO 3C1TA 1AOYA 3UCXA 3HIFA 1ZRFA 2B37A 4M1QA 1F14A 3QV1A 1Q7BA 4B8ZA 4OL9A 3IHUA 4U0WA 5LGTA 1TI7A 5T57A 1OAAA 4BGIA 4MVJA 1I3LA 2EEZA 3DBRA 2QM3A 3C1DA 2V79A 1KYWA 1OPCA 2AXQA 3WYCA 1UDAA 3LQRA 4U7BA 2R00C 3OIDA 4AFNA 4BGUA 2EKQA 3OF2A 3R1IA 1HSTA 2KJCA 4QWQA 2VOJA 4BNXA 2STWA 5KCZA 3DAPA 2QQ5A 2CD9A 4IPAA 1S7OA 4OQZA 2X4GA 3RSHA 3U3XA 2P6TA 1VPDA 2HFHA 1IRFA 4YRBA 3VTFA 2E82A 3B1JA 5JY1A 2V9VA 4RVHA 1B16A 4WLVA 5JCJD 1P45A 1ZHFA 2JTVA 3KHUA 4B8WA 3HNPA 5L3EA 3IJRA 2VOEA 3BMNA 1LQUA 2ZCWA 3WGOA 3C24A 4U7DA 5IJZA 1SD6A 3AUTA 1KEUA 4P4LA 3L6OO 4BKQA 3CDHA 3JQ8A 3EZLA 4MEXF 5JO0A 5FLXZ 2GN9A 1TT7A 1XDWA 2G7UA 2AHRA 3CXRA 3ABUA 3NTOA 3ZHBA 4Q4ZF 1E7QA 1DFIA 1I5ZA 5LHIA 3GF2A 1T25A 4RB2C 3TNLA 3SQNA 2HAEA 2BV6A 2IE0A 3VZSA 3WFIA 3SJUA 1JKJA 4L5IA 5K6AA 3V2GA 1O0SA 1QQIA 3EK2A 3VKVA 2DTXA 3L07A 4HA8A 4N9HA 3DQVC 4LRTB 1K0UA 3JW4A 1Q1NA 2J3JA 3FHZA 2VWQA 3K2EA 5L7TA 1R4MB 1U3UA 1G1AA 4QXMA 3PZRA 1HEUA 2AEMA 2A92A 4RVDA 4LCJA 3Q1LA 3PQFA 1A9ZA 1XMKA 1HE4A 4CMCA 3FD8A 1K6XA 3F6VA 4JBAA 2I5PO 3D0SA 1O9BA 1I24A 4CUZA 5KOIA 5KVVA 3H8VA 2NNNA 4JIGA 2HTJA 1E7RA 4ZU3A 4Q5SF 5AXAA 5JDIA 4PLFA 4DMLA 4I1IA 2G17A 5L4NA 3FHLA 1GXPA 3L9WA 4K6FA 4IJAA 3SLGA 3IJPA 3LLVA 1S7AA 4HX4A 4MVJH 3GXOA 3EYWA 4NQWA 1GCUA 4YBZA 4JK1X 2PD3A 4I0BA 3BHJA 4N7RA 1IN5A 4KZPA 1TNTA 3QWAA 3CSDA 2QQBA 3CO7C 1STZA 1RUNA 3ICCA 3PTZA 5JAQA 3DBRB 3WNQA 1HL3A 4NBVA 1H94A 4OAQA 3U4HA 1T1RA 3HG7A 5CJ9A 2CNBA 3HRTA 2SCUA 1GPJA 3FPLA 1D1SA 2X5OA 3ONEA 2FSVA 4NJOA 4JGBA 4P8RA 5TT0A 4J16A 4DBZA 1WLYA 1PJ2A 4WWCA 5LHGA 3RASA 3F8FA 4CXFA 4GSLA 3ZCXA 4BKRA 1PJLA 1U5TC 3ASUA 2FR8A 3M8EA 2JPCA 2DFVA 3K6JA 1KU7A 4P9UA 2YJZA 4X54A 3VZPA 3WFJA 3ZWCA 4RGRA 2YHIB 5B12A 2Q4EA 2NU9A 1LC0A 2W25A 3HB4X 3HJAA 3FTNA 4DIBA 3Q9VA 2FBKA 1MFZA 3JQ7A 2P9CA 4ND4A 4YCAA 3L9FA 2IA1A 3F21A 4ALJA 3C8MA 5TJ9A 2XAQA 2ZB7A 3GEGA 3AY7A 4B8XA 4GLOA 5CDSA 4FFRA 5FD5A 2VODA 5GY7A 4R1HA 4RVSA 1JQBA 4YACA 3JQDA 1SB8A 1Q1HA 3KLMX 1O6ZA 1RM4A 1YVEI 3GFIA 2C29D 2EA2A 3HOSA 4QTZA 2O03A 4D3DA 5JNLA 1R4NA 1SEPA 2GSDA 5K1YA 2Q1WA 3EW7A 4W99A 1NWHA 1FLIA 3WBBA 4CMKA 4MVJE 3TZ6A 5FB2A 4NDNE 3REOA 5L53A 3DP7A 4M6YA 4CM7A 1PR3A 2WDZA 5JO9A 1GTMA 1D7OA 2UUPA 4B7UA 5TNXA 2AQKA 1ZG3A 4MP3A 1LSOA 3WXBA 1T2CA 2JD1A 2WD8A 4UVHA 3DDNA 3PHJA 3DQPA 4Z3KA 2W24A 4GVXA 4UVBA 2WV0A 4S04A 2HK8A 3H9QA 3NX4A 4R1NA 3AI3A 1ZUD1 3F22A 3PLNA 3AU8A 4D0PA 3L00A 1VJ1A 1GPDG 2V6FA 1SFXA 1PP8F 2DBBA 4JJGA 1DIHA 3M2PA 1PUEE 3RU9A 5FF9A 1R1VA 3WTBA 3ANLA 4TKMA 4KN7X 4WLEA 2MLGA 3HRUA 2JCYA 2E7XA 3HDHA 4MEYF 4IQ0A 3RBZA 3TFQA 1ZK2A 3H65A 3O26A 2YQ4A 4MP8A 3FMRA 4YJDA 4DNCA 3CIFA 1MJ9A 2YV2A 3W4KA 3RBXA 5FD6A 4CMEC 1RIOH 1JAXA 2AQHA 3JQ9C 1T26A 1ZH8A 1FBQA 4XQEA 2CVZA 5BMZA 4II3A 2HKXA 1Z9CA 3GZNA 1F17A 4YT4A 2PD4A 4E32A 4BO8A 3F4LA 1ZGJA 3H3JA 2XROA 3WMWA 4B4OA 2R7FA 3PJGA 4PN3A 5CDUA 3H5NA 4LFUA 2FMUA 4GX1A 1LVAA 4HW0A 3MCVA 5IDYA 3B73A 2XGXA 1XU9A 3N74A 1HYEA 2OGUA 4M54A 4EYEA 5BSFA 7MDHA 2AEFA 3QVWA 5EERA 1PGOA 4L9VA 1YJQA 1S8NA 3ULKA 1BN5A 2XF8A 1HYHA 2A6EF 3AFMA 4YJHB 4IY1A 4CR8A 3W6KB 1KEWA 4PLTA 4RLHA 4Y9DA 3JSOA 1E17A 2ZCVA 3PDJA 4WGGA 3V4GA 1AUPA 4BL5A 2NUAA 1U2DA 4XJSA 2HUNA 4E12A 2Q49A 1U3EM 2QG4A 1P9LA 3DBLA 2CF5A 4IDEA 3WQSB 2ZFWA 5DD8A 3KM0A 3AUUA 4A0XA 1NHWA 2FSSA 2J5RA 2Z3YA 3GEZA 3EC7A 1O89A 2VTDA 2RIRA 5JAZA 3RJ9A 3GWZA 3N97A 1KERA 2QRJA 1V3VA 4UVDA 3NEPX 2DU9A 1ADGA 3CO6C 1E3EA 4FR5A 3RI4A 1BXZA 3WGZA 4L73A 1XDSA 5DZSA 3H5AA 3B02A 1UDBA 2BI7A 2VUUA 2DU8A 4DGSA 2MLKA 3S1LA 3EDPA 3KP3A 2PGJA 2V6GA 3HB5X 2H63A 3NDRA 4GYIA 1H2HA 3QE3A 4J43A 3TL2A 4EUFA 2WYVA 4A6DA 4U0YA 2DLDA 4L9JA 4XB2A 2FZWA 3AJRA 2YW9A 3BMOB 5D8LB 3GFGA 3D5LA 1EQUA 3E6BA 4PG6A 4E30A 2ZIZA 1IYZA 2G5CA 4E21A 2QW8A 4HXYA 1XGNA 2V1XA 2FPGA 3R3JA 2PG4A 2PZJA 2VOPA 1WDKA 2C5AA 2DQRA 4KWIA 1GY8A 4UXNA 1W5TA 2PBIA 1YQXA 3QJ5A 3J81K 3OJFA 4CJXA 4PCQA 1Y81A 1I27A 4IJWA 4JQFA 4N0BA 3RKWA 1X7HA 4A27A 1GYPA 4I01A 2Z5LA 4M87A 3WR5A 3DWFA 5CVVA 1QO0D 2OFPA 5KJ1A 3WGTA 1I33A 2V7PA 1G6KA 3IUSA 5EEHA 3MJSA 4HFNA 4IMRA 4NI5A 2JZYA 2WD7A 5DF1A 1XU7A 2DVMA 1KEPA 3IAHA 2BD0A 2VZ8A 2WJPA 4IS2A 4R69A 3ZI0A 3FR8A 4WJZA 3ZWBA 2XPCA 3LSYA 2GO1A 3IWZA 4AJNA 3BMCB 4ESBA 1QKIA 4P38A 2FPPA 1VJ0A 5H6RA 2OHXA 1BW9B 4M86A 4WCGA 1P1FA 4TVOA 2IA2A 2H09A 1A4UA 2Q1UA 3DEYX 3ULQB 4ZQGA 3GZNB 5TJHA 4CQLB 3I4CA 1BRMA 2PLAA 3VH1A 4OOEA 4E5NA 4BGVA 4OMYA 1FDSA 1TT5B 3MEXA 2DTRA 5T5QA 3I4FA 5E1ZB 3RYRA 2GXGA 3MOGA 3O38A 4ESFA 3HFSA 1FPQA 1DFGA 2VRCA 2MA3A 3MJCA 2QYOA 1F4KA 2EK5A 1LDEA 3ONFA 1HW2A 1ZMTA 2J8ZA 3PQDA 4HNHA 4NQZA 3WJAA 4EDFA 5H81A 4TRJA 1GHCA 5JS6A 2EG9A 1PS9A 4YQZA 2W2KB 3UN1A 4CL8A 2QUFA 4YJGA 1MJAA 3JSPA 2YZ7A 2WYUA 3FF5A 3NRCA 3ML6A 2ZNYA 3OM9A 1FDWA 3QP9A 3D4PA 3RFTA 4I09A 1NR7A 1BTOA 4ZD6A 4AJEA 3D4NA 1Y6JA 1C14A 3WICA 1M67A 3GMSA 3UKOA 1JWBB 2DBQA 1ULYA 2P68A 3F9IA 3G0OA 2PD6A 4GKVA 2QQ9A 1E5QA 3TZCA 4J4TA 4BNGA 3PXXA 2UXXA 1ENPA 4FC6A 2B0LA 2PKQP 4JNKA 4IGFA 1QRRA 1I0ZA 1O3RA 3ZNOA 4OKNA 5B4VA 3HFGA 2VHWA 3JD0A 4KQXA 2LF7A 4UUVA 3GVCA 2ZJ2A 2ZQZA 5A9SB 2ZTMA 2O6GE 4GGOA 2VXZA 5E20A 3DZKA 5GZ3A 1DPGA 2D5AA 3F6YA 4EM0B 2OBNA 3K8ZA 1HDOA 4R9RA 5DCWA 3E5XA 3TOXA 1HDXA 1X3UA 3I83A 4CM5A 4CM6A 2E6UX 3LLSA 4D45A 5LEKA 3G1TA 4FBGA 3RROA 2G0TA 3HRSA 4CQMB 3T7EA 3RCBA 1R15A 5FFXA 3AAFA 1VLLA 1GUZA 3KP6A 2Q46A 1U8FO 1W6UA 1LSJA 1S6LA 4GGPA 4CM4A 3QWBA 2J5KA 1SD7A 2A69F 2IZZA 2PFBA 1GEGA 1UR5A 2NU8A 3U9LA 2XKPA 3V8KA 4BMSA 2RV8A 2JT1A 2Q1TA 2H27A 4RQTA 4XYLA 3VH2A 2Z9OA 2OZPA 1KETA 3F4BA 2IDZA 4RF5A 4XZ3A 4D44A 1P74A 4RGUA 2QWWA 3K1PA 1ISHA 1E7MA 3AW9A 3JQ6A 5F21A 5LDHA 4QFCA 3WX0A 4I5FA 4G94A 1E3WB 4TZTA 2AG5A 3L7WA 1C1XA 3TOBA 4XQGA 4F3YA 2VHYA 4YIFA 2VWGA 5LCXA 3KYCA 3H3UA 1MC4A 4HBGA 3TKYA 5BNFA 2DFIA 3LT0A 5CAEA 2OU2A 1XQ1A 1IZ1A 1XCBA 2CSOA 2A9FA 2CF6A 5D8KB 2EFPA 3CH6A 2GN6A 3NRVA 1HYGA 5EQDA 4OSPA 2HR3A 4P9FA 2VRBA 3MEQA 3HSFA 3SZTA 1O5IA 3DHNA 1KEVA 3ITKA 3MZYA 2EJWA 3RKUA 3VAZA 2BMAA 3LQFA 1H9TA 1G4DA 3KP2A 4RAYA 2C5EA 5EIOA 3R0IA 3B1FA 3GFJA 3WQRA 4TMFA 1Y8QA 1GCOA 1GL3A 1VC2A 2PMHA 1LRLA 5COBA 1ZBQA 3C3WA 3J81Z 1DSSG 1PZHA 5KJEA 2XAGA 1EV7A 1UJMA 3KVOA 2P7VB 4IRHA 1PL7A 1WDLA 3K2BA 4RL6A 3RAJA 1HTBA 5CEFA 4I0AA 1LI4A 4W9NA 3ZWVA 4E5KA 5BQFA 2X9GA 2X0LA 1AXEA 1NHAA 1R4MA 1MKMA 3AFNA 2KJBA 4CMIB 4KTVE 1OOEA 5FGMA 2W90A 1E7WA 1FSHA 1YB1A 5A3JA 3VPHA 3DMTA 1T2AA 3WDSA 3H9EO 2BYVE 5HS7A 3DZFA 3P9KA 1B9MA 5A05A 4CM9A 4KIBA 4UUMA 5ICEA 2FE3A 4II2A 4KDFA 1ZK0A 1TB4A 3K73O 1K79A 2VN8A 5JDCC 4O0LA 1VRWA 2C2YA 4BO0A 1Z6RA 1B3BA 1JVBA 2NQTA 1DAOA 3EVNA 1UP7A 2FEZA 3OJLA 4ASNA 3JSAA 1MGTA 3LF1A 1MP0A 3BP8A 5DV5A 5D4RA 3G17A 2GRAA 2OZUA 1K7AA 3I59B 4DYVA 1DHTA 4FT8A 1ISJA 3MJEA 1HSZA 3I9KA 4EITA 5BSGA 1HZZA 2H9IA 1P4WA 1WZIA 3ZH2A 3JAMZ 5L7WA 1RNLA 4J0EA 2CDBA 2Z95A 2FNAA 2K02A 5E8GA 1E6WA 1NPTO 3FXUA 5KVSA 2QRLA 3SXPA 3JQBA 2BFPA 1BHSA 4JXKA 1EVJA 4CMBA 1LUAA 4E5MA 4PLPA 4ZQFA 4ZYHA 1MG0A 3RUCA 3WQQA 4TKLA 1T38A 1VJTA 1ZEMA 3JD1A 4NBUA 4MIYA 4ENMA 4B7CA 1N8KA 5CDYA 2PH3A 4J4BA 1Z6TA 4WUVA 4E70A 3DV8A 3QP5A 4HLXA 3T5XA 3PHGA 1Y0UA 2IZ0A 1T2KA 5JAIA 1LDBA 1HDCA 1SNYA 4LRSB 5CDTA 2Q99A 4D46A 2EHDA 4CLEA 1Y9AA 3V8BA 3R6SA 1H0KA 3F23A 4QFDA 4BO5A 2FU4A 5CVJA 2QQAA 1JXSA 1SFEA 1CF2O 4ALLA 2YFHA 2HZTA 5ILUA 2QBYB 1YW7A 3GR6A 2IT0A 3VDQA 5D5VB 1R5GA 4EQQA 2ILTA 3DOOA 2GD1O 3ADOA 4MTEA 4I5DA 3VOSA 4A7PA 5GZ1A 1BI3A 2HYGD 1PIWA 1V35A 3ANNA 1BSVA 4PGFA 2ZB4A 4Q3DA 1T98A 2QZZA 2DQLA 1U6GA 4YJGB 1CDOA 1WAMA 4DC1A 3E3VA 4KTTE 3I71A 3ROPA 4ZGWA 4J0FA 1YLFA 3VPSA 1EQ2A 3QLJA 4FJ1A 4U5QA 2PFGA 3RVDA 4EGZA 1OI7A 4MINA 4YXFA 2PY6A 2OBPA 2P7CB 1PGQA 2J6IA 3K2ZA 3JD3A 4OKIA 1H9GA 1PTJA 1PS8A 2IODA 1B4AA 1BMDA 3DB2A 3KLOA 1C0LA 1V3UA 1C0KA 4M72A 3JYPA 4K9DA 1D5VA 3C1OA 3LC2O 3WBFA 2PLYA 3V5NA 1LQ1A 3G79A 4XCVA 4R1SA 3ZGYA 2DT5A 1Z1DA 4BNWA 4CV2A 1IY8A 1HKQA 4MQ9F 4XIJA 1J0XO 5EESA 4RPJA 2C7VA 4HUJA 1MUUA 1Z82A 1OR7A 3GVXA 3OBBA 4OO3A 5THKA 4W9NC 3CMCO 3TL3A 4CR6A 1P1RA 1DHRA 3W6JB 2C2XA 1A7KA 3FTPA 1QXSA 3LAJA 4MIEA 2VHVA 1XB4A 2CVOA 3AOGA 4PLVA 3V8LA 5DOVA 1ODDA 2XVCA 2YU3A 5ILOA 3A9WA 1NXQA 3P2OA 4MGRA 4XWYA 4YT8A 1RUOA 4YG2F 3VOEA 3F3SA 1P4XA 3HSEA 4BHCA 5J6XA 1YDEA 2NTVA 5K6AC 1TBXA 2FZEA 1FSEA 1QYVA 2DAPA 3DAFA 3KEOA 3N58A 1BWSA 1FP2A 1F06A 4ZN6A 3ITDA 3PHLA 2Z5UA 4IGEA 4ZQEA 4ZQBA 4E2YA 5EL0A 3W4JA 1FDTA 4GXOA 3COSA 3DC2A 1YW9A 3S2EA 2EJRA 3RUFA 3QWFA 2F00A 4A73A 2VE9A 5D6FA 2BGKA 2DBRA 2HEOA 3FM3A 1YOVB 3I64A 2NU7A 3EUHA 2Y66A 3HN7A 3WOHA 5JE8A 3JTMA 2P91A 4HP8A 3E5UA 1ZG1A 1J59A 1LA2A 1M6WA 3RDIA 1NAHA 4DYDA 1VM6A 1DJQA 1GQ2A 4LSWA 3KB6A 4BNVA 1O57A 1YDWA 2B4QA 2F2EA 4J7UA 4JP2A 2XASA 3AI2A 3HUDA 4R1TA 4CM3A 3NJ4A 4EZBA 3TFOA 1KOLA 3FCOA 4BNMA 4OIRF 2RAFA 4Y6PA 2FQ3A 4AIKA 4DWVA 2G76A 4GX5A 3P19A 2AMFA 3ROKA 4ILKA 1LXCA 4YTEA 3EVTA 3F72A 5CHEA 1GZ3A 3IOYA 4YT5A 4CPDA 3GZ5A 3PHHA 4OQYA 2A07F 4J9VA 5CP8A 2G7HA 3UCEA 3WYEA 4IPTA 2HTSA 4XGIA 4Z3DA 3AM3A 3WTWC 3QVSA 4NG5A 1XEAA 3V1UA 5C37A 4RB3C 4ROSA 3ZQ7A 1DDNA 1E1KA 2B5WA 1YQDA 3WU0A 2ESNA 1AGNA 3HWRA 2B69A 5J8CA 4WCFB 2ESHA 1KBZA 3F8MA 1C1DB 2PN6A 3WGHA 3V1TC 1JWAB 2BH9A 2IRWA 3G49A 3DMTC 1SD4A 5A9TA 5FFFA 4ZZDA 5BQTA 2FOIA 1R0KA 1PQWA 2D1HA 2L4MA 2G82A 1YQAA 3I1JA 3DFZA 3MWEB 1YTYA 4JX8A 1FYLA 3LWFA 2ISZA 1CYDA 4I9UA 3P9CA 4ZH4F 2DUWA 5HVQC 3M9AA 2FWMX 2WYWA 4GBJA 5U9CA 2H94A 1HLPA 3S2WA 3AI1A 3INTA 5G0TA 3ZMTA 3F8NA 1N5DA 1FT9A 4E13A 2JPBA 3KRTA 4Z9YA 3LVFO 2Y1EA 3LQQA 4GGGA 5D5XB 2P9EA 2R3SA 3G73A 1XIVA 3PWSA 4PLZA 4L9TA 1J0RA 5ERIA 4IM7A 3TSCA 3WTUC 1B3RA 5DBGA 1IXRC 4L0ZB 3INRA 3UH1A 1GDHA 3ZN2A 3KSUA 2Z99A 2ZYAA 3ROQA 3KSDO 2B36A 2XOXA 3JCZA 1B0AA 4LGWA 4PGGA 1E5LA 1HT0A 2BFMA 5T8KC 5TGDA 3ST7A 3U09A 4OMZA 3KP4A 1VSVA 3JYOA 3WS7A 1T2DA 1MZBA 4HF1A 4RGSA 3BYZA 5I8ZA 3A1NA 2EFOA 2H1SA 2A6HF 3BJOA 1A04A 2ZMEB 3BJAA 3OOPA 4HQMA 1R22A 3AK4A 3DL2A 3E8XA 2VRCD 4OXNA 4YJFA 3TZQA 2D45A 4WXHA 5G0SA 1JE8A 2EWNA 2LF8A 4Q3CA 1P1KA 3WSVA 3PWKA 1H93A 1G3WA 2R00A 3PFIA 2DK8A 2Q1SA 3NT4A 4ALMA 4NIMA 1U78A 5L45A 1X7DA 2BGMA 2YDXA 5ITVA 1ZSNA 3O03A 5H20A 3ABTA 3TO7A 4AIJA 3NAQA 3TGNA 3NYWA 1HW1A 4XEHA 4CM8B 5A1TA 4YAIA 1C0WA 1PJBA 4KMSA 5L3ZA 1NVMB 2Q2QA 3U49A 4BO6A 3I5UA 2M1BA 4WXDA 2DPHA 1E0DA 3F47A 3GHYA 1KGSA 1E3JA 1IE3A 5FEUA 4J1SA 1GEEA 1R0LA 3T1BA 4EW6A 5I7SA 3S2GA 3PEFA 2PJPA 3GUDA 1B8PA 3AUAA 4RCVA 4YAGA 4BO7A 2IZ1A 4UEKA 1K6OA 1FMCA 1ON2A 4HNGA 5EQFA 4XKJA 2QRKA 5C7LO 4EGYA 1J49A 3BPVA 2GA1A 3Q9NA 5GZ6A 1LDJA 1FXSA 1N7HA 2EERA 2VWPA 2PV7A 5JMWA 3Q2IA 1YBAA 2EIHA 2MH2A 2ET6A 4DMMA 5HDKA 5LHHA 3HDQA 4JBGA 2NVUB 3ZWWA 5I8WA 2Y0CA 1M66A 3E18A 2BEOA 4IHSA 1NQOA 2B83A 5DBFA 3KYDB 2BLLA 5K9ZA 4AJIA 4IJVA 4CLRB 4ZYGA 4CDGA 1A9YA 1JVSA 2ZCUA 2XKOA 2RQPA 2VONA 2O23A 3JQBC 1IPEA 3DZIA 1CF7B 5DDGA 4NJMA 4OYRA 2I66A 3RC2A 4BMVA 4GVLA 3TO9A 5TQVA 4PLHA 2P8TA 3RBVA 4XRRA 2MH9A 1S6YA 3FNGA 4KP7A 1NVGA 1ZMOA 2M8EA 2NNLD 2W4QA 1RJWA 3PQKA 4LLLA 1Y8RB 3E03A 3WE2A 3KP7A 3OETA 4RZHA 3SC6A 1DDOA 3IRQA 3BA1A 3TOZA 4FOOA 4N5NA 1S29A 4UVEA 2JFGA 4WPGA 1L3LA 1UZLA 1R00A 5G4LA 1KU2A 1HETA 1WQ2A 2PZLA 1Q0LA 3CPSA 5A03A 4IMPA 3MTJA 3KETA 1Y8RA 2PQ8A 4XYEA 1QZZA 3ZHXA 1WSUA 3L4BC 3I23A 4YEDA 3UF0A 3GFLA 4F46A 2VHZA 3RKRA 1EE2A 2CFXA 1FYMA 5DCMA 4PZCA 1R37A 3GF4A 1ZJYA 4HQEA 4P22A 2VBXA 1IHYA 4WLOA 5DNAA 3VVCA 4CQMD 4J3FA 4QQRA 3GGGA 1FJHA 4BNHA 2Y0MA 2COMA 4J1QA 1U2GA 1R16A 1WXDA 2AQ8A 3IUPA 4IZHA 5K5OA 1WNTA 3IMFA 1YONA 2GZ2A 4BQAA 2NNYA 1AE1A 2D1VA 1ISMA 2DBVO 3AWDA 3E82A 5L3FA 1DRUA 3I0TA 4MNUA 5AXCA 1Y8QB 1TQIA 1TTYA 1JHHA 1U8RA 3D5QA 4IDFA 5HWSA 2ZO4A 2X0NA 3KLPX 2Z33A 1PL6A 1VL0A 5L7YA 1I2ZA 3GZ4A 3RUDA 1HSJA 1W7PD 3MJVA 1I2BA 3TZHA 1E2XA 2JCXA 1UZNA 4GLLA 3LF2A 4A03A 3ROUA 4Q47A 3G3EA 3HADA 2PK3A 4DLBA 3BTUA 4EM1A 3W8FA 2MD5A 1B8VA 4XR4A 1XSVA 2VNAA 1I32A 1GU7A 3F8CA 4B3JA 3D3WA 4ETSA 5ILSA 4CUKA 1ZFNA 4F6LA 1DIBA 3G3ZA 1EDZA 1ZGAA 2P5KA 4O3MA 4YDRA 4M89A 2O7QA 2GN8A 3MJTA 3SEFA 5I9MA 2XAFA 5HBRA 2EWMA 9LDTA 2CW0F 1R23A 2HDCA 5H82A 2EFWA 1Z73A 2ZTLA 4PRLA 1P6RA 4WECA 5EMHA 3VH3A 4EJ6A 4Y17A 3U62A 3ZU3A 3EETA 4EJMA 1NR1A 5KWEA 1RYEA 2OP1A 3ONDA 1BXKA 1PGPA 3PYMA 3QAHA 2RKHA 4U0VA 1C3VA 1Z7BA 1I30A 3DPLC 3FBTA 1PZGA 4I7HA 4H7PA 5JR3A 1EUZA 4YA6A 2RHCA 5IF3A 3JTGA 5DUKA 1F12A 2M45A 3RIHA 3RFXA 3GN2A 3MWDB 5KKCA 5KJCA 1OMIA 4I08A 3K9TA 2WD7B 3TDZC 4A6EA 1LDGA 4EVIA 4WX9A 3GEDA 3OMLA 4I9NA 1U7TA 3TPCA 1PU2A 3EZYA 3Q5FA 1R1UA 1TNSA 3RUIA 4GKBA 4GQAA 3U0BA 4K2EA 3BXXA 3A14A 3IS3A 1SMYF 4DPLA 2LSOA 3FM5A 4R5HA 3RTRA 1OYIA 1IXCA 5D5UB 4OIPF 1C0PA 1HE5A 3RUAA 4IJUA 1ONVA 2O61A 4BV9A 1M75A 2XAJA 1UZMA 3PZBA 2X7HA 1OYYA 1GXQA 3V8JA 3S55A 5CG2A 4BYYA 1U5CA 1IW7F 5HS9A 5A02A 2L4AA 4I5EA 2X8LA 2KKOA 3FSRA 4INAA 2NQ8A 3W8DA 4KA4A 3FXQA 1XGOA 1ZH5A 4AWXB 3UAGA 2BBYA 2F5DA 3ZMUA 3AM4A 5LBQA 3DONA 4QSMA 3BMOA 3IKVA 5E17F 1ZARA 1DAPA 1UXJA 3ZWNA 1BOAA 1I01A 1T0FA 2IRFG 4TRMA 1VKNA 3O2PE 3IRRA 1ZAOA 2NADA 3QQPA 1BIAA 3GUCA 1LSUA 3ZNQA 2BFOA 4Z0PA 3T0YA 1HZJA 4QT0A 5C5IA 1NM5A 2A5YB 3OIGA 2UVDA 3H92A 1J4AA 3ZWAA 1U7HA 4FGWA 1CEQA 4CV3A 1S3JA 4L75A 2ZNZA 1ZO8A 4KN4X 4CICA 4PRKA 2GWRA 2C54A 1C0IA 3ECOA 1HSOA 4ENKA 4RF4A 4HFJA 2EKLA 4TROA 4BNFA 4D0SA 2P4QA 1R1TA 1MXHA 3BHMA 5F1PA 1ZKMA 3DBLB 4LCEA 8ADHA 3VC7A 3LT4A 4BO1A 4P5OA 5F1RA 1UHMA 1XGSA 4ONEA 2FMLA 1LBEA 2JHFA 4N5LA 3ZZNA 3UUWA 4AJKA 2GDZA 1P0FA 4HYEA 2GA2A 5IT3A 4Q48A 5ILVA 2NSDA 3E9NA 2QENA 3KEQA 4IBOA 4YAEA 3STHA 5DYMA 1V3TA 3BZ6A 4HDUA 4IF4A 4MTDA 1XGKA 4YR9A 1V0JA 2QX7A 4A0SA 3ZP5A 1T1SA 1BI0A 1LRKA 4O6JA 1LDNA 4GX2A 4RQUA 3PQJA 1U2WA 3EDMA 4BKPA 4R8HA 1BW9A 4DL9A 2WM3A 3I6QA 1NWCA 3RQSA 3H4VA 3CUQA 4A0YA 4BNKA 2D8AA 3HHHA 4UUPA 4PLGA 3QWIA 4LK3A 2EXXA 3GPDG 3ZV6A 4W7IA 1WVGA 3K1MA 1Z75A 2HJSA 3JQFC 4XGNA 1B26A 2O4UX 1HXDA 3H2ZA 1DOHA 3GVPA 2OUIA 1I1GA 4RDIA 4L18B 2D0IA 4YQYA 5L51A 3VPFA 5A06A 2IA0A 4CLOA 1QMGA 1N2SA 2QYSA 1HDZA 5AONA 3GFMA 2XIGA 3ZN0A 2RGVA 1F5TA 1Z45A 1T6SA 2CUKA 3DBVO 4TSKA 4Z9FA 1W0CA 1EH7A 5LC1A 6ADHA 1B8UA 5ICCA 1FY7A 3PLRA 4FIZA 5T6BA 3E97A 4E2ZA 2AG8A 2DAOA 3SBOA 4H16A 3DZGA 5LGUA 4AVPA 3IKTA 1LNQA 2O2YA 3GNSA 1X7GA 4RVGA 4ND1A 5H83A 1WWKA 1SCUA 4JLWA 4LVUA 1SOWA 1XGMA 4IIUA 1D8JA 3D0OA 1E1NA 3LT1A 4R9SA 4MQVA 1FX7A 2K7LA 1CRWG 3AY6A 1RKXA 3ZV4A 4MVJM 1E1MA 5HA5A 1EZ4A 1GR0A 1KVSA 1Z7EA 3PQEA 2O8XA 4M9XA 4LJZF 3PI7A 1YS6A 4NK4A 2Y68A 4CLDA 3KP5A 4NU6A 4FB5A 3RUHA 4AJHA 4HFRA 3QA9A 1KQ0A 2Q3EA 4TWRA 4M9ZA 3RPUA 3C7CB 4DIOA 4AG3A 2DPDA 4KIGA 4JK3A 2W98A 4OMUA 4MHGA 4F45A 1R4NB 4KT5C 4XBFA 4L8VA 1GADO 1H6AA 2VN2A 5ENVA 4FFOA 1BM9A 4I2OA 4L9NA 3RC1A 4YRAA 4N18A 4FX0A 2W2LD 4Y6RA 2GASA 3LFKA 1ISIA 2VYVA 2WC2A 2HRZA 3FBGA 2X0JA 1XHLA 3BWGA 3TWOA 5DP1A 1ZVMA 1Z05A 1Y5MA 1VL6A 4IZIA 4ZVVA 1EK6A 5TX7A 1Y7TA 2A61A 2CQKA 1HWYA 1U4SA 3AUSA 3FNHA 3ZWPA 5L4SA 5A5FA 1IPFA 3IWFA 2OP0A 1L1FA 3FNFA 1G0OA 2XRNA 1N1GA 4C4OA 1PJTA 3HHPA 3JQ7B 1YRLA 4J1NA 3ZWYA 4CMJA 2FBHA 2YDYA 4DC0A 5IZCA 4CGZA 2FSWA 1D8KA 2WTBA 5TIIA 3I9MA 2D2WA 5DBIA 1WMAA 4Q3NA 3T8RA 3KLNA 1NFFA 4Y98A 2E48A 2PKQO 3DHEA 5CPBA 2VZ0A 2RDPA 3NDIA 5F1KA 2WTEA 4BNCA 3ERED 1H6DA 3RUEA 4BNLA 5TLSA 5F1OA 2JSCA 3DHYA 1YBMA 3Q6IA 1I5RA 2O3FA 2OZ6A 1D3YA 1LU9A 1CQIA 1UCRA 2Y48A 4I02A 1KVUA 5EPOA 2V1UA 3K9QO 2BGCA 4CHUA 3M7GA 2JHGA 4O5OA 4D3SA 2BF7A 5A5EA 4UNOA 1IRGA 2ZBKA 1RZ4A 5C7IO 4G6DA 3ECHA 1B2LA 4M9SA 3DEUA 1BVRA 3DTTA 3K1NA 4PIVA 4NFSA 5EINA 2LKPA 4S1VA 2P5YA 1MGOA 2PGLA 4FGSA 1N7GA 2GCGA 3X2FA 2D4AA 3GDOA 3WIEA 1I10A 2VT3A 4G7ZF 3ROMA 4K6CA 3U9GA 4A5NA 1F8GA 3L6DA 4ND3A 4D3FA 3GC6A 3FX3A 1EVYA 3S2IA 2YR2A 3KCCA 4FHTA 2QYTA 3GA0A 1V3FA 1VI2A 4XR9A 1NBOA 5COQA 5DEQA 1PEDA 1TQPA 4RO0A 2EP5A 1DO8A 4RPGA 2I76A 1MD0A 2VNSA 3TO6A 1ULUA 4N9IA 3QOPA 1I36A 3OP4A 1LJ8A 4ZZLA 1GYRA 3FPCA 4AD9A 5B4UA 5BPIA 4IDGA 2Y1CA 3K0LA 4UVAA 1IN6A 4G7OF 1O7FA 4R4JA 1XSDA 3J7AO 2AEJA 1Y1PA 3T4XA 3SJ7A 5FFZA 4J2OA 5ER6A 1F8FA 3OJOA 3WYBA 4DBVO 5IXYA 1JKIA 3HDJA 1LNWA 4J7XA 4HLYA 4YRDA 4KMUX 5F5LA 1I2CA 2OL4A 2V6BA 3NKLA 4RF3A 3RC7A 5BOXA 2GF2A 1ONPA 3L6EA 2YPRA 1LDDA 5AXDA 3SXYA 2ZB3A 4KYWA 2HKOA 1EVIA 1U8XX 2E4AA 1KVRA 3BMNB 4WKGA 1E1LA 2VBZA 4Z0TA 4O59O 5LLQA 1PJQA 1RWBA 2YSRA 3ZMVA 3GDGA 1WZEA 1W4MA 4HF0A 2YY7A 4U8GA 1MXFA 5K5QA 2F1KA 1V9LA 4GPD1 2K86A 5IDWA 4RB0A 5CVUA 4KMFA 4HBLA 1PGNA 1YKFA 1EE9A 3OHSX 4BO9A 3KO8A 4NJMB 1Q7CA 2K4JA 3WWZA 1LEAA 3QW2A 4LB6B 3PJDA 3W6ZA 3H9GA 3CZRA 1IL0A 4UVCA 1LDMA 1C1XB 3Q9SA 2HLPA 2NACA 3GEMA 4RDHA 4WEQA 1ZIDA 1D4FA 5G0VA 5L3CA 2Q0OA 3HZZA 1GQYA 4FN4A 1B14A 1JAYA 4WASA 4DVJA 2GUGA 3HHGA 2IEBA 9LDBA 2C0CA 5BS6A 4B3IA 4PG8A 4LK1F 4XD2A 1ZCJA 3F1KA 3C7DB 5IT9Z 4L76A 2ZYGA 3DOCA 1U3WA 3TQNA 4R01A 4I5GA 1D1TA 4W4TA 1LSSA 1NX6A 3WWYA 4MKRA 6PAXA 4CQMA 1IZ0A 1YYVA 5JBIA 5F3RA 3PJEA 1HDGO 4EEXA 2AW5A 2EW2A 2PZMA 3C3XA 1ZXLA 5MGBA 1ULSA 2HK7A 5JI6A 4DRYA 1KY4A 5JYDA 3IP3A 5L3BA 4MJLA 4N54A 2UDPA 4P4NA 4Y13A 1DPUA 4MO2A 3VHRA 4AJJA 2WE7A 4BVAA 2PNFA 3QVTA 2C82A 1H6BA 1PZFA 3CINA 1FF9A 3WMXA 3GGOA 4J90A 2BI8A 3DXFA 3ANMA 3RFVA 2RH8A 2K4BA 4DQXA 4QO8A 3JTHA 4J4HA 1J7KA 3CTMA 4TZKA 5TF4A 1E3LA 5IDXA 2Y0DA 3CUKA 5ADHA 4R1UA 4AJLA 3C7JA 2GQQA 1ZG5A 2E1NA 3QU6A 1PJCA 3GFBA 4PG5A 4KUMA 2YUTA 3ZMSA 2BHLA 3I6IA 3Q11A 3CUOA 1R5HA
chains in the Genus database with same CATH superfamily
1BJTA 3HN2A 5DNCA 4JSYA 7AT1A 2ZSEA 4MDEA 2XB0X 5CYVA 4I8XA 1Y4AE 5I4BA 1JHAA 1UC5B 1WCXA 3FWEA 1XZJA 2D1FA 5GWXA 5I4KA 1CF9A 1BN6A 1YZTA 3OPQA 4OMFG 1TW3A 4B4DA 4BNMA 4BP9A 1G42A 3W04A 1XN7A 3A6LA 3I54A 3S1AA 4XVUA 1XX6A 3MBKA 3TDUC 4HEHA 4L74A 3UGKA 3PFYA 5K7ZA 4A0ZA 4C9YA 3ESBA 4LPSA 4ZYEA 1GPAA 2BEVA 2OA0A 3DKWA 4CV0A 4XSXF 2Q2WA 1V7CA 2H4FA 1PV4A 4XUCA 5BSEA 3F73A 2O0MA 2DG2A 2OD9A 1W19A 1I4DD 3ND8A 4K1XA 5ALLA 3MGGA 3KKEA 1RR8C 2ZJ4A 4Y15A 4FGLA 5KIAA 5LOVB 4KBGA 5EY5B 5IPAA 4KXUA 3FTCA 4LPKA 4CF6A 5J2UF 3OLCX 2Y9MB 2JMWA 4BO4A 4IO9F 1DBVO 2EV9A 4MTCA 1Y89A 4LY0A 5IN5A 4B3CA 1N3BA 3B36A 2BBOA 3ETGA 3EXEB 3KZVA 3PPVA 1O95A 3JR9A 1FFEA 1F38A 1GFSA 3IP8A 2YX1A 2FF5A 4U88A 4GCVA 2R66A 4IVPA 4Q00A 3NWSA 4JD5A 5TQ2A 3R24A 1NRJB 4BZPA 2OZKA 1NTOA 2QJWA 2CV2A 2PI0A 4GAEA 3HS3A 3GTMJ 2PWAA 4OUDB 3QPHA 4YN3A 5KVQA 2HF8A 4EW2A 1JLSA 1YS7A 1Q0UA 4GL4A 3L77A 4A8HA 4ARZA 4MUMA 2L54A 4C0SA 1T3SA 1BCSA 1M6VB 5HOEA 3GZ6A 3AXTA 1F1ZA 3W1EA 3D43A 4E11A 2XPVA 1E79D 3VNUA 2GF9A 2BXYA 4IHWA 1VQNI 3FFTA 1P1CA 3H87A 4ZU6X 5FWAA 4BNTA 4BO2A 1XP5A 5CBPB 1S96A 1IRXA 1HQKA 1WB6A 3A1TA 4NE9A 3RSGA 1QM5A 2BISA 2HQ1A 2P2YA 3TTWA 4LXXA 5KTNA 5J47A 3KU4A 3PUFA 3N7AA 4Q0MA 1T2FA 1BXRB 3I2YX 4DW6A 5FOQA 5B6IA 5JY6A 2P7IA 4XTCS 2XMRA 4B3HA 4Z9AA 5C8YF 3N8DA 2Q1XA 2Z6UA 1NMXA 1P3DA 4D7NA 1XLVA 2JATA 4RGBA 3OYJA 1O94A 1TYBE 3G88A 3O0TA 4KRXA 4LXHA 3FPAA 1GV1A 1VOTA 2JI8A 3H2JA 3H4MA 3R3SA 4EZEA 3SHVA 1VDMA 2AN3A 2NM0A 3K69A 1YHQI 1LPSA 3AETA 4ECEA 2FZ4A 2YZGA 3ILHA 3ZTTA 4EA9A 5AVSA 1RQNA 3K96A 3CB2A 5G41A 5B58C 1REQB 1EHCA 1EFKA 4KE7A 2X22A 1XFDA 1FTGA 1DKLA 3DO8A 2VWHA 2WHPB 2OSBA 2RIPA 2Z9DA 3ELKA 3D3EA 2GGSA 3PGJA 4GR4A 2XAAA 2X41A 1MH1A 3GQVA 4MDYA 1FFDA 5LZ7A 3X43A 4YCLA 3FK6A 1W0TA 3HUFA 2LD5A 1ZYRF 5M3MJ 2A6TA 2YBDA 2FQWA 3MWJA 3REFA 4BNZA 1RJ9A 2C7PA 1VIAA 2O8FA 1ST2A 1JKRC 1N2OA 1RPNA 2Z9BA 2AA3A 4MWDA 4CUJA 2WD9A 4HEA6 3O2QB 4U3JB 2IXSA 1US8A 1WCYA 3TOAA 1YC5A 2Y1OA 2FCAA 4P36A 4D6PA 4ER7A 3MWDA 2WQZA 1U5TB 4JYKA 3G2PA 3EULA 3C39A 1DLJA 2PMCA 3I32A 4O2AF 1USTA 2WM8A 3K4MA 4XCXA 2H4JA 4GC5A 4IUDS 3BAFA 3HB9A 2PZFA 1MH3A 4FD3A 1PWHA 4N0PA 4E31A 1AHNA 1QAQA 5T3YA 1V1MA 3PNOA 3JQEA 1PQYA 3ZD9A 2IEZA 2YWBA 3GCGA 4MOWA 4Y2RA 3BWVA 3PFWO 2UYCA 3K6GA 2PH1A 2AZXA 3TYXA 2C3OA 2MHCA 3VR2A 2O3TA 3WA6A 4EG4A 1THZA 2W83A 1Z77A 4RJKA 4DXDA 4A8TA 1QIGA 2A9QA 1LZKA 4PF1A 4CIYA 2WFLA 2ODNA 3KOUA 4RPLA 4WRRA 5AW4A 2C84A 5BR1A 2IUTA 1R36A 1M54A 3KAKA 3UGJA 1XCOA 4Q03A 1EMDA 1BVYF 4C0XA 3I6YA 3H5RA 1WJDA 4B8WA 5BWBA 3E6CC 2R9VA 7YASA 4UFPA 1MDBA 1LEHA 4X9XA 1JJ7A 5JCOA 1Y1TA 1L7DA 3GNLA 1YDFA 2AL7A 5TB5A 5JFGA 1U8ZA 5JQGA 2P5TB 3KIPA 3IR5A 3KQKA 3A3NA 3KJIA 4C20A 5JJIA 1Z6GA 2R68A 3BQ9A 2X1HA 1YRNB 3TI7A 3ZU2A 1LDKB 1FQJA 4LSZA 4H2DA 4C0KA 5CJPA 1XDUA 1F5SA 2AHOA 4KKVA 5KNLA 1S4QA 3SHFA 2YWRA 1QVZA 1TM3E 2K27A 3OECA 3A3OA 3Q2KA 3EXHA 1ZI6A 3BMQA 4XAQA 2Q0XA 2EFHB 2FN7A 4PYIA 1DELA 1AN9A 1FMJA 4L7VA 4OIFA 3AEQB 4YI3A 3WLAA 1Q0QA 2H7VA 4BWYA 4CKCA 4F0JA 3F3XA 3GLXA 5EG0B 2VO1A 3ETHA 4TLEA 1VSUA 1AQUA 1R9NA 4H08A 5E1MA 2UVPA 5JAUA 4KX5A 4X65B 1HYBA 4WZBA 4Y18A 2FQ4A 3E3OA 4Q9HA 1JHMA 2ZU0C 5D3QA 1AD2A 3EYIA 3IVAA 1FYVA 3VR5H 2QW1A 4QULA 4B4WA 3D8BA 4P58A 4AC9A 4UTRA 4YHHB 2M30A 2W2LA 1A7JA 3KPWA 1DGRM 1LPQA 1X4PA 3EZ7A 3A4TA 5SY6A 4YRPA 2O8DA 3VI3B 4LOHA 1T9GS 3AOEC 1D2MA 4R7TA 1B1AA 4G41A 3A36A 5I45A 4JP3A 4RZIA 2IGNA 4MQEA 2G71A 2ONJA 1W34A 4B48A 3T5MA 3EOBI 1K7SN 5KDDA 3CEPB 2P40A 4P3XA 3WIVA 2X0RA 2I2FA 3WRYA 1MIJA 2R6DA 2B3DA 1Y6RA 2OQGA 5M3FJ 1SM4A 2QRGA 3GYGA 5FTWA 1N34B 4K2AA 3P0FA 2UYQA 3S8MA 1JGGA 2CY0A 2WEKA 3QBDA 4WLNA 4M9UA 2V7XA 3R6GA 2JUGA 2PWPA 4QPJC 1H66A 1TLTA 3FPJA 5IABA 5JJ5A 5G3YA 1RBZA 5K0TA 2KYRA 1I6XA 2PKEA 2WAEA 1F0PA 3ZJ4A 2QRZA 3A06A 4DSNA 2D7JA 3HJHA 2GOXB 2OZLB 3HDYA 4UVGA 4B82A 2G6TA 3MCUA 3OURA 3R40A 4BQRA 2C8JA 4EI8A 4URFA 4AC0A 5BUCA 4LF9B 4EP1A 3C3DA 4V03A 2V9ZA 3SJZA 3V7SA 3D3WB 4UPVA 4XIFA 5BWMA 1TL7C 4F4HA 3D0KA 1LDYA 4MI1A 3TE6A 2XADA 1PT6A 5BT9A 4LNUA 1QSGA 5GAJA 4RVUA 3PL1A 6YASA 2AVNA 3ZWKA 1S3SA 2EFGA 2HXYA 4R1QA 4ZEXA 1IZ8A 4QNMA 1DINA 2QGUA 3AB7A 4RPKA 1M72A 3D0RA 4OHRA 1EZ1A 1L1EA 1RLJA 5HNKA 4BVJA 3RVQA 1XMQB 3AEXA 3OQBA 4L8YA 4TV8A 3G6EI 5KQGA 1YAHA 2HPZA 2F6CA 2JAXA 3ZE1B 2J87A 2BY1A 4OIQF 2BR3A 4NV1A 2E34A 4B3DA 3JD2A 5D6EA 1JW9B 1Q0HA 3UFXB 4MUBA 3NWBA 5BSTA 4ZTBA 3WTCA 4KO3S 2FP4B 2XHKA 3GUYA 2ZBRA 5HRUA 1WW8A 4LNUB 3R7SA 1RXWA 2AOVA 3MZHA 3CNOA 3WTSC 1W94A 2WTAA 2VNKA 2OCGA 4J91A 4DSTA 1G55A 4OAOA 4CQLA 2YV5A 4EJ2A 1P9RA 3ON5A 2PFSA 1Y7LA 2VSOA 5JPIA 4C22A 1O4WA 4OSOA 5JJKA 1P17A 5JVTA 2Y1KA 4BKQA 2XB9A 3AVWA 1G3YA 1IULA 4CN8A 4OQXA 5KTPA 1UPFA 2GVNA 3ZBPA 2LDXA 3WTVC 5KHDA 1U9CA 1KDYA 5FYDA 5JPCA 2KM1A 3TLJA 2O3UA 4FDAA 1GAXA 1P92A 3M1EA 2QU8A 4URWR 5D1HA 4A15A 3S17J 3D6HA 4M0UA 5FV4A 3RD5A 2P5SA 2OM6A 4NU8X 1AXGA 3D54D 2HWVA 2JKVA 4LLNA 4JZYA 4LBVA 4G8BA 3W3AH 4AJ1A 1JTXA 3LZ6A 5FI5A 3QHQA 3RS4A 1FJXA 1P7WA 3S6JA 1EH8A 3AU9A 4JLPA 2PX6A 4M88A 4QL3A 2JWTA 2EH3A 3GH3A 3IESA 1G8HA 1VJRA 4QQ8A 4CGYA 2AZDA 2XUQA 2QIOA 3WAJA 4BEBA 3B1KA 2W7NA 2AFRA 3BDDA 4X3PA 1IY1A 3M4ZA 4CTKA 1FJGB 3EEQA 4UHTA 2VCYA 2HQAA 4R3WA 3CGGA 4MMXB 4BTEA 1PO7A 3H1EA 4JI5B 1L7MA 5TQJA 4B2YA 4RTRA 2BEUB 2CG4A 1IMOA 3QU5A 5A4DA 2CJPA 2E55A 4G8XA 4IV8A 4W9RA 3K20A 5FRDA 4AK9A 5CB4B 2IKQA 1Q1QA 4DZRA 5LP6F 3KHKA 2L9SA 1E89A 1H5UA 1E3QA 2RAVA 4O02B 3LK7A 3J81A 2R2AA 2WJHA 1JFLA 3KYDA 4JLNA 2QY6A 4O1IA 1Z2CA 1RWVA 1Q7GA 1YQUA 2X3YA 4NRDA 3ZZTA 4RFSB 2HF9A 1NVDA 3GFQA 2YL2A 4QTUB 3QMWA 4IOCF 3WE7A 5C51B 4CL0A 2E2JJ 4IHXA 4PRYA 5HILA 3TIIA 5LVAA 1UIMA 1UMCA 3KOMA 1TQ2A 4G8JA 4HQFA 2PFKA 5TC4A 3J80Z 4L95C 2IVMA 4IMIB 3TH5A 1S01A 3HH8A 4BZQA 4DR5B 2IGBA 2YQ5A 1U9NA 2P6MA 2ZTHA 1H8AC 4XFDA 1XQ6A 3B2EA 1JU9A 1UHWA 2BE7A 3OFSA 3LE8A 4HDOB 2C3PA 3E3NA 3QEMA 4P53A 1Y3HA 2FXAA 3HRMA 4U7WA 3WV5A 2VK1A 2DWCA 4TS9A 1P91A 3QYAA 2C1ZA 1Q7EA 2QY9A 4UUAA 4W7HA 4XYMA 3W3AD 3PM1A 1JEYB 3DTIA 1ZJZA 2NV6A 3PD0A 3KPUA 4CO8A 2I3AA 2JLQA 3FAKA 3KQQA 4MVJF 4W1PA 4DUPA 1NYLA 2VUSA 4Q3EA 3PHIA 2WADA 1LX6A 3PNQA 4MMZB 1ZM9A 5L3RA 3IJEB 4F1WA 4XGKA 4Z7NB 4HFMA 1GSOA 2IIBA 1C0EA 1M6NA 1RWPA 2O0LA 2Q0QA 2H18A 1QWOA 3IXMA 2QPTA 3JQ9A 5G2OA 3ETCA 5D6OA 1X8XA 4MV3A 4O2BF 4DC9A 3PDIA 3F74A 3BMCA 3QUAA 3WWDA 1YOVA 5DFAA 4KWCA 1DP3A 2C0PA 2NZ8A 1BS9A 5LQJA 2NVTJ 4C2MJ 1DP7P 2WV7A 2GKOA 1WEHA 3CF2A 5TSDA 1XTBA 2F67A 2G9VA 2J45A 2FJ1A 2CW8A 2KP6A 3O4IA 3OLXA 2AJDA 3EZ6A 4LF8B 3L8ZA 4A0HA 1HGXA 4IRIA 4WCFC 1ZCZA 3OEYA 1ZX1A 2PZEA 2YWFA 3PUHA 2WKQA 5AKZA 3GLVA 4YXWA 2VK2A 1DPFA 5TEWA 1BMFA 2FLWA 1JR3A 2B35A 3WGLA 4B2PA 4UHBA 4LQCA 1ECLA 2PCLA 2VQ3A 3OS1A 3PQCA 4L0MA 4NENA 2WF9A 3QFCA 1W581 2DFFA 5E8IA 3GRKA 5JDCA 3FSGD 5EZHA 3SWWA 2VPYA 1SMKA 3QXSA 1NXVA 3VZRA 4EI9A 4X20A 4IDDA 3A6KA 5TJJA 3OWXA 3K70B 3LQ1A 4HS9A 1E6KA 5DXAA 1WI9A 3KHTA 4D9NA 1JKQC 4OP2A 5CVIA 1DZ3A 2XCTB 4D92A 1RETA 5EGOB 2WSYB 4OM7A 3F5FA 2FSHA 2B30A 4WKBA 1BRTA 3QKTA 4M6XA 2PX2A 4S0ZA 1OZAA 4BNJA 1AA7A 3QOWA 1FBTA 4MP6A 4AY4A 5AM3A 4EX7A 3IDSA 4MAAA 1GQFA 1XSXA 1XQWA 1OC4A 4IDAA 4PYLA 4UEWA 3V7RA 2I65A 3QUSA 2VI5A 3RU7A 5I7FA 4OQDA 3CP2A 2DYSH 3EW9A 5FPPA 4DDWA 1IXSB 3CMMA 1DEAA 3SFVA 4A5OA 3QPCA 5DM7F 5IDQA 5LM3A 1XN4A 1KQGA 1T36A 2LDBA 1ZN9A 3LA2A 4J1TA 1E2IA 4NMWA 2OMEA 4WCFA 4AZ3B 1XLWA 3OE4A 1Q3TA 3GV0A 3HL0A 1V45E 3OQJA 3SQOA 2BMJA 3C7KA 1FXWF 4NR0A 3VDNB 3J81k 3ZS8A 1JKXA 1GPH1 1NW5A 2J3LA 3TOSA 2V0GA 2QG6A 1VQ5I 2RHTA 3DZJA 4MCIA 3W2IA 3ICOA 2H6CA 3HSKA 1BE6A 1GA4A 4WACA 1KMHA 3BXEA 3EGDB 4HS4A 3QEJA 4R2LA 3OFVA 4YRQA 5EJIA 1FC3A 2ZKIA 5ELXA 1JKPC 3M9LA 4FZ3A 1TKCA 1N1EA 2FPWA 3NIWA 1SBZA 3A2NA 4MV8A 2GXBA 3ISPA 1NE7A 3NQOA 1XD8A 1Y63A 4TUYA 1YXMA 3N5CA 3O91A 3OJ0A 5CJ2A 3VU0A 2YV3A 1G1MA 1ZMBA 2D2XA 2NTEA 2XMGA 8ATCA 1U8UA 1RJGA 1M6HA 1LFUP 2BW3B 5HS4A 3QY0A 3PXAA 1IF1A 1R6XA 1RYFA 3LP8A 4JJIA 1J9IA 4CFZA 4A3GJ 1BAPA 2I7CA 3PK0A 1LRJA 4GSKA 3VZDA 1H2WA 1ZLJA 5KHAA 3VYVA 5L3VA 1MBGA 4Z4IA 3LMKA 2LBPA 4AWXA 1QF9A 4X62B 3WL7A 2HUPA 1CY6A 3G7SA 3M6FA 4LMBA 4PLYA 3P7MA 3WDKA 2RH9B 5LUBA 3S8PA 3GLFA 3UUEA 3BZUA 3AVTA 1Z6AA 4C04A 5J2TB 3VVLA 4KT6A 2GAAA 4NFYA 4D97A 1SIUA 4OXYA 2JD0A 1V4RA 3EAFA 3AY3A 4C0LA 4F21A 5A04A 5FKOA 1Z25A 4O4LB 3G2LA 3BR3A 4NPCA 4OHUA 4P08A 4R8MA 4XQCA 4UVIA 3OJEA 5DGDA 3UB4A 4TYYA 1QNTA 4N5IX 5D6NA 2ZVJA 3R8FA 8LDHA 1BDMA 1TZCA 1PFWA 1X87A 5FEMA 2QSFX 4A3EJ 2WKWA 4UNRA 4Q7MB 1E0JA 2MOKA 4EH1A 3ZR4B 4HAUA 1QQBA 4ZQHA 2OMKA 4BB5A 3AINA 3SZPA 4JLUA 2WU4A 2FOLA 3BPSA 5E95A 4YAKA 4XM2A 4ZYTA 2O3SA 4B3RB 2OT3B 2CBGA 1SCJA 2N42A 1B1BA 1FYFA 2Q5HA 3ZCQA 3WGIA 1OFCX 1H2AS 2WWIA 3FNQA 3NRJA 1RI1A 3EQ8A 3HDGA 2C2HA 3ISJA 4IHKA 4Z0HO 3VYWA 4KLNA 1VA5A 1EU1A 4OI4A 3MTAA 1A95A 3BSWA 2A35A 3OCCA 4J16C 2XF7A 4G6QA 4BRSA 3I56I 3VTKA 1K78A 3I55I 3M8FA 1NVEA 2BV3A 3GTQJ 1QZXA 4GOMD 4HWKA 3T7IA 2P3OA 2B8NA 1O3SA 4RLFA 3AUYA 3J80K 3LM8A 4EG1A 3NV7A 3EVDA 2BEWB 1XR3A 2GBLA 2ZKZA 3SIRA 3OYDA 4CMAA 4AY2A 2ZR9A 3MAGA 2QN3A 2IPXA 4PYQA 3HOXJ 1YDHA 2XY4A 3CLHA 1GRVA 1L7EA 1ORVA 1ZISA 1RRGA 5B1YA 4RIFA 2MBFA 3FUXA 4BPBA 1J20A 4Z99A 3JALA 3PGXA 3LRTA 2X13A 4F3TA 5GVSA 5JCJA 2HSDA 1TJNA 4HZUA 3VU1A 3OQVA 5JAPA 4DIMA 1TLHB 1P5JA 3SDSA 3DFMA 3E0JB 2X2PA 1RM3A 1CJBA 2PL9A 3QG5A 4ZP1A 4LYFA 3NTUA 1CE8A 1YGYA 4D4GA 1UBJS 5DEOA 1OKKD 3GRPA 4FI3C 5DLDA 4DRXB 2IV2X 1G3RA 3OC6A 2PM8A 3EMBA 3VR2D 3VZCA 2HADA 4JDPA 3A1EA 4BBZA 1FU4A 1U8CB 2O50A 4QUGA 5HQTA 3LC1O 3PPXA 2ZSBA 2FZKA 3F7TA 3HPGA 1SXIA 4YJ2F 2G67A 2D7CA 3CE6A 4HX5A 1WRBA 2OR3A 3KYCB 1KO8A 2H7XA 5FPSA 5HCNA 3UATA 4A2UA 3K70D 2WE8A 1GGFA 4MIOA 4Q9AA 4DA0A 4PTYA 4Q4LA 4F8JA 5FL7D 5JTTA 3V1YA 2R7TA 1YW8A 2VQDA 2KIFA 4HB0A 3OQ1A 1E3SA 1NI3A 2D3TA 3DBHB 1IUYA 4M38A 4KQWA 4MYHA 5FI3A 3TIFA 4EA7A 1Q3HA 3WFZA 2CC2A 3TDKA 2XNSA 2XE6A 3DXZA 2IWRA 3SOPA 5FCDA 2D2IA 3NBAA 3FA2A 3IR7A 2YS9A 3GFSA 1Z4LA 5EEAA 4YFKF 4HYTA 2ZBUA 5FO0A 1PKEA 1J2UA 2QG9A 2OENG 4XYGA 4PSDA 4Y8VA 4AKSA 5BNIA 1BIBA 4Z9XA 2G5PA 1YB4A 3H16A 1Y3CE 3NP7A 4IJMA 3IVXA 2FOKA 4GX0A 3U7EB 4BB0A 1A50B 4YROA 2X9QA 2ICAA 3W5DA 1QGOA 2A0FA 2J1LA 3D4LA 3W1VA 3ZVMA 1SFUA 2IYZA 2O59A 2X19A 2FA5A 1GUAA 4BHPA 3QK7A 3WU1B 2D62A 3GT7A 4XLPF 2M4GA 5HIJA 1DEHA 4K87A 1D6SA 1MJFA 4UU8A 3M4XA 3ZW7A 1XZNA 1L5SA 2W6ID 4BGEA 1HMYA 3E7FA 2GERA 3GVIA 4A0RA 1ITYA 4Q34A 3RS3A 5FH9A 1D4AA 5HDGA 1PP7U 2WSBA 2AZ4A 2UYOA 1PFGA 5C18A 3UMCA 3Q9UA 3IPAA 2CXOA 4HV5A 3H0DA 1K6IA 4R2IA 4LISA 3RF7A 4OB7A 5ITWA 3AL0B 3T6KA 1TTTA 2XTZA 4PZYA