3WGIA

Crystal structure of rsp in complex with beta-nad+ and operator dna
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
217
structure length
217
Chain Sequence
KTIVSMAVIRRLPRYHRYLEELLKNDVKRISSRELSEKMGVTASQIRQDLNNFGGFGQQGYGYNVEELYNNLTKILGLDKTYNTIIIGAGNLGQAIANYTSFEKSGFNLKGIFDINPRLFGLKIRDVEVMDVETVEDFIARNKIDIGILCIPKDNAQYTADRLVRAGIKAIWNFLPIDLKVPDDVILENVHLSDSLFTVSYRLNEEELFKKLKGETA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinct structural features of Rex-family repressors to sense redox levels in anaerobes and aerobes
doi rcsb
source organism Thermoanaerobacter ethanolicus
molecule tags Transcription/dna
molecule keywords Redox-sensing transcriptional repressor rex
total genus 69
structure length 217
sequence length 217
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02629 CoA_binding CoA binding domain
A PF06971 Put_DNA-bind_N Putative DNA-binding protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wgiA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wgiA02
4AL4A 4DQXA 3JQBA 4J3FA 3UKOA 4I01A 3FM3A 1AWCA 1UAYA 3T8RA 4UV8A 3ABTA 3STHA 4BIIA 1WDMA 3GEGA 4BNFA 4I0BA 1YL5A 4FR5A 2QZ8A 5IXSA 2PZKA 1Q0LA 4L9VA 1GQQA 4LFUA 2ET6A 3L09A 2H27A 1EK6A 2EA2A 1R22A 4MKZA 1ZREA 2M30A 3COAC 2EFQA 1PS0A 1TW3A 4RVGA 1DLJA 4IF4A 3I9OA 1W5SA 3N58A 5CP8A 2HQNA 3JSAA 5T67A 4D44A 1KY4A 3TNLA 2C07A 3RKUA 3C3WA 2UZKA 3K92A 4IDAA 2Q8KA 1FWZA 5AXBA 1ADBA 3JQ8A 2K27A 4DGSA 4IVNA 1MGOA 3LC2O 1FZPB 3IWZA 4ENMA 2MA3A 1JVBA 5IAAA 2DFDA 3GN1A 1KU9A 1B16A 1V3TA 2LDBA 5BT9A 3OICA 2NVWA 1CF7A 1N7GA 5A2QZ 1P3DA 1F8FA 2VBXA 4LW8A 3QP6A 5JCXA 3SQNA 3BPVA 2O2SA 5B12A 2H63A 2Q99A 2NNLD 1GU7A 1YW7A 4CZZA 4ALJA 1NVMB 5ICMA 4B7CA 2YR2A 4JJFA 4XDZA 4XRFA 4KUHA 4IJKA 3B6ZA 3H3ZA 1QYWA 2GA2A 3IRQA 3VTFA 1G3TA 1A7KA 2WWYA 1T2KA 1A9YA 1EQUA 3E6BA 3DMTC 3JV7A 4CM4A 4RPHA 3H7AA 1PL8A 3KOUA 4J1NA 3BMOB 1BXGB 4PG6A 1T4DA 3LF1A 1UXHA 4EW6A 2V9VA 4MVJI 4A2UA 1H2HA 1YBAA 4IM7A 2DU9A 2MD5A 3JQDA 3ZWOA 9LDTA 3FWZA 3K69A 5L53A 5KNLA 5CEFA 3WSWA 3RDIA 3KP3A 3P9KA 4R1SA 4HQEA 1ULYA 3RBZA 1B2LA 1DFIA 4FD3A 4NBRA 5DUKA 2FNAA 1QKIA 2A35A 1S3JA 3QE3A 1DJNA 2EFWA 1IPEA 3M7GA 4CXFA 3LU1A 2W57A 5DT9A 3ECHA 1EE2A 1B9NA 1NHWA 4HF1A 4YJHA 2PBIA 1V9LA 3V8BA 3FHLA 1N2SA 1NVTA 4PGFA 2A94A 4AJNA 4EJ0A 5AXCA 3ZHBA 1MXFA 1ZFNA 3ENNA 5B4TA 4LCEA 4HXYA 3Q1LA 4HV6A 2PD4A 4HW0A 3K1NA 1P33A 4LJZF 2QYSA 1I1SA 1HDOA 4UVCA 4FGWA 2QZ9A 4YACA 3ROMA 4CMBA 1HTBA 4FN4A 4CM5A 2OL4A 2YHIB 5JAQA 1ONOA 1G4DA 4UVDA 1T24A 3B1FA 1W73A 4NG5A 4OO3A 4PLTA 1R7JA 4D7AA 4FSHA 5CDGA 3H5NA 2GUGA 3LT4A 3U4HA 2CY0A 1J5PA 2ZB3A 1R6DA 2OP1A 4RPKA 4XX0A 1ONNA 3R4KA 4Y15A 1PJSA 1DLIA 3D5TA 2VN8A 3DFUA 1B8PA 3K0LA 3K31A 1EVIA 2Z99A 1T25A 1FPQA 1EDOA 2CDBA 2HMSA 2HLPA 2PZJA 3JYLA 4WCFA 2Q50A 3FWEA 1Y6JA 4CL8A 1F5TA 1VSUA 1ZK1A 3CUKA 1KC3A 3HNPA 3WFJA 1NQAO 2Q2VA 4ESJA 1RJWA 4I2OA 3TOBA 2SCUA 1MG5A 4NU6A 3RUIA 4KYWA 1ULSA 2J5QA 2CO5A 1ZK0A 1ZBQA 1YS7A 4XKJA 1K78A 4FJ1A 1I1GA 1S7AA 1YQDA 4HA8A 3G17A 5K6AC 3I59B 1C0WA 3CSDA 2HAEA 3WBBA 4D79A 4DLAA 3WGGA 1QP8A 1HKQA 4HY3A 4XCVA 1J0XO 3GFMA 3GVIA 1G3SA 1DEHA 3OA2A 4L0ZB 2WE8A 3ORFA 1LXCA 2JHFA 1KVRA 2YV2A 4TZTA 4ENNA 4RGUA 2GF2A 5ENDA 3VH3A 2EV5A 1DDNA 2Y1CA 3TZQA 1L7EA 5BNIA 5JYDA 2PKQO 4BB6A 3C7DB 3RFVA 3AY3A 4HLYA 3D3WB 4Z9YA 4DL9A 3VDRA 3BY6A 2L01A 3PJFA 4CMJA 1E1KA 4ND1A 3GMDA 1K3TA 3CH6A 5CDUA 3GUDA 3KLOA 4KQXA 2MBFA 2DPHA 4MEXF 1KVSA 2NU8A 4BS9A 2DPDA 5IN4A 2CVZA 3HRMA 1QYVA 4NH4A 4CLDA 3S2GA 4M54A 3WTSC 1GHCA 2Y0MA 1ISJA 1ZGAA 2PKQP 2BGCA 3RTRA 1VM6A 3GNQA 1BI2A 3JD3A 3W4JA 2JKVA 3FXQA 1GVJA 2KIMA 4PLGA 1I5RA 2G1UA 5EEGA 3SEFA 2YZ7A 1Y5RA 3D4NA 3GPIA 4YYZA 3DBHB 5EIOA 4UHTA 1H6CA 2FSSA 5D5WB 1M67A 4WXCA 3IQDB 3ZZNA 1I24A 3VH1A 2GLXA 2FP4A 2GZ3A 3NX4A 4YG2F 2RDPA 2ZYAA 2B4TO 2DVMA 3BTOA 4I02A 1M6WA 1TT5A 4FBGA 1BWSA 4L9JA 5D8KB 2UUPA 2GERA 1UZMA 5JY6A 1R4NB 5JXWA 5FLXK 2X4HA 1R00A 4QO8A 1XEAA 1TQPA 3QJ5A 2BF7A 1YJQA 1NAIA 2YHUA 4GSKA 5JCJA 1M6HA 1P6RA 3EUWA 1EUCA 2D4AA 2P5VA 3JYNA 2X58A 4ZQHA 2PG4A 4MKXA 3KLMX 5ITVA 2NTJA 1M2WA 3PHJA 3WOHA 3RSHA 1LLQA 4I5GA 2ILTA 1P2FA 3BTSA 4H16A 2E82A 1YOVA 1QYCA 4BNKA 3EYIA 4PZCA 2G76A 1MUUA 9LDBA 4RL6A 3DXFA 3NKLA 5JE8A 1U5TA 2Q1TA 2VTDA 4MINA 4ZQEA 5IF3A 1RUOA 3CMMA 2D0IA 4W7IA 1ENZA 1YKFA 3AUTA 4OIPF 5E1WA 2ZB4A 1HDZA 4P8RA 1ZO8A 2GYYA 2X0JA 3WMWA 4PVCA 3D7LA 3IHUA 4M74A 2ZJ1A 3WX0A 2VWPA 3R3SA 5KJ6A 1HE4A 4RQTA 3AUSA 1D1SA 1D1TA 4MVJD 1NTOA 4ZVVA 5JYEA 4L0YB 3RASA 2QQ9A 1LNWA 2BGMA 1N9GA 2VQ3A 4OIMA 3FMRA 2EGHA 3OJEA 3ZW8A 2CW0F 1F0YA 5A3JA 4P9UA 2FWMX 3U0BA 1H9TA 1HZZA 3UHAA 3ZV4A 1EVJA 3C7AA 1EFLA 5ICFA 1PDNC 4OH1A 2FMUA 3C1OA 3O38A 4MHGA 4S1VA 3SX2A 1IF1A 2M45A 2V6CA 5ENVA 2ZTUA 1YYVA 5KVQA 1CYDA 1QLHA 1D4FA 1P1HA 3DZFA 3WGYA 1K89A 2C82A 1N8KA 5J23A 2DBBA 1AUPA 4ZJUA 3WSVA 3JW4A 1SNYA 2JPCA 5L3FA 5T6BA 3OIGA 3EYYA 4F7ZA 2FBIA 2PLYA 1U2GA 3PGXA 4CQLA 4JJGA 1KU7A 2CUKA 2HR3A 3OQ1A 1STZA 1UXIA 4WK8F 4K6FA 3B1JA 4LD5A 4PLFA 1RNLA 2O3JA 4JJIA 3WYEA 3QP5A 1PJLA 3TKYA 3I9KA 2HGCA 1JAXA 1O9BA 3BHMA 4ZICA 4XSZF 1VSVA 4PG4A 1GZ3A 1YS4A 4YVFA 2OORA 4U7DA 3VZQA 1KQ9A 5HS9A 1BG6A 2P91A 3AUAA 4QFCA 3HWRA 3FNHA 1HSJA 2HMVA 1BVRA 5BMZA 4NBUA 4LG0B 5G4KB 1FMCA 1LDMA 4IIVA 3K9TA 6LDHA 4RGBA 3RC2A 2VT2A 5ILSA 4FT8A 1BC8C 5GZ3A 1R4MA 5CEJA 1E6WA 1PJQA 3H4VA 4J2HA 3M9AA 4AVYA 1WSUA 1V4RA 3P2OA 3ITDA 3K2EA 1LSUA 4JIGA 2DKNA 2E7WA 3T4XA 5A05A 2YFQA 3FNFA 4YQYA 3OQ6A 2IA2A 2FRHA 3DAGA 1R0KA 2KJBA 1KVUA 2B36A 4W7HA 3BHIA 2PQ8A 3GH3A 4IJAA 4II2A 4Y6RA 1LLCA 3ZWXA 2P4WA 1MC4A 1Z05A 1JE8A 1PEDA 1PU2A 4J2OA 4AJHA 4B4OA 1A5ZA 3RROA 1B4AA 1ADFA 1U5AA 4BV8A 3DDNA 3TFOA 5LRSA 1X13A 2GN6A 3W1VA 1ZSVA 2O7SA 4GI2A 4NJMA 4P9FA 2V6FA 3E48A 5TNXA 1IN7A 1IHYA 1ZK2A 2JL1A 2HQRA 3K2BA 4ZQGA 2ZK7A 3DFGA 1AHHA 4XB1A 3DKWA 4M73A 3ADPA 5DN9A 3RU7A 1PJ3A 3T5XA 2EP7A 3F46A 1WWXA 2X22A 4BQRA 3QU6A 2YDYA 4S3MA 3U1DA 4WGGA 1B0AA 4XYBA 1UXJA 3S8MA 1D5VA 4A27A 1X14A 2R7FA 2J3IA 4NK4A 4JN6B 3NYWA 2RN7A 3PWSA 4UUOA 5HVQC 1JAYA 4ILKA 4J7CA 2GXGA 2JCVA 5JMWA 3VTZA 4Z6KA 3QY9A 5C7OO 4L9RA 4DVJA 1NAHA 4UREA 1Q7CA 2BLLA 1FP1D 3VOSA 2QRJA 2EW2A 3DXJF 5L45A 3G1UA 2ESHA 2XIGA 3J81K 3KXDA 4ZZLA 4R9RA 3ZHYA 2F00A 5U9CA 1ZEJA 3VZRA 1MX3A 1QLJA 3E03A 3EZLA 1NP3A 5JC8A 5LGUA 4HADA 5FWNA 2QIOA 4AJ4A 1A4UA 5L7YA 1BBYA 4WKGA 1U4OA 4EM0B 2K4JA 2IZ1A 2FBKA 1Z6TA 3DZBA 2XVCA 2P7CB 1P1FA 1Y8RA 5DCWA 4Z3KA 1BI0A 1QNTA 1W5TA 1HE2A 5A4DA 1ZH8A 2VXZA 6PAXA 1NPDA 1ZEMA 3MJTA 1J5YA 2IPQX 2VONA 2HKIA 5HS8A 1M75A 5FGMA 1GPJA 2EFPA 2I66A 3OA0A 3SXYA 3GWZA 4FCCA 4L76A 4A5OA 5ICCA 4PZJA 1Y8QB 3NUGA 3S2IA 2FBHA 5I7FA 1CF2O 3ADOA 4LB6B 1KS9A 2FPGA 1C14A 1PUEE 3T4EA 5JY1A 4LMYA 1ZRDA 2LNBA 4CM7A 2F2EA 3ZMTA 1IZ9A 4WECA 2EKPA 4UVBA 3GVAA 4WLOA 1GV1A 2FNPA 5HDKA 1M76A 5HS6A 3ZHXA 3WTYC 4OXNA 3OJFA 3P9IA 2XV4S 3GDOA 2CMDA 1D8AA 4YDRA 4XGNA 5COBA 3WWZA 4G94A 1QYDA 5I8ZA 2STTA 5JSFA 4YPOA 1G6NA 4U5QA 3U2RA 2JFGA 1O7FA 1S7OA 2H09A 1PP8F 1YXMA 4HX5A 4BNXA 4J91A 1LEHA 1NQTA 1LJ8A 2CG4A 1TB4A 4WOKA 2VHZA 3W8EA 4L4XA 1LDNA 2HK8A 1JWAB 2LKPA 4H3VA 3DFZA 4IDBA 4RVHA 1ARZA 2VBZA 3O2PE 4IDGA 3FR7A 3ZQ7A 5KOIA 4HBGA 2VBWA 1OI7A 4E5YA 3F8BA 1YVEI 4PDKA 4BQPA 3DBHA 2J5OA 1GEGA 1RYDA 4E2WA 2XAHA 1UDCA 1P4XA 3ZGYA 1RM4A 1YQAA 3IRRA 4BL5A 5J8CA 1C1DB 2OZUA 2OZPA 4Q5SF 4UUMA 3HRSA 1JW9B 4PGHA 1GDHA 2DAOA 2O61A 4EJ6A 4BO4A 5JFOA 3RIRA 3TQHA 1IL0A 2PA3A 2CSUA 1MFZA 1HYEA 1YGYA 3OIFA 3WTWC 1DHRA 1T1RA 4AIHA 3K6JA 4DIFA 3DMTA 3LA2A 4AJPA 1GQ2A 3F1KA 2ZFWA 3DMYA 1EBUA 3VKUA 2VT3A 1JVSA 2UUOA 1MKMA 4JXKA 1N1EA 4ESOA 3H9EO 4Q47A 2NQTA 2NWQA 1SD7A 4BNNA 3AY7A 1FSHA 2NADA 3PFFA 2CQKA 2HKOA 1T2DA 2RCYA 3PQFA 5G2OA 3V8LA 3CLOA 1FX7A 2GWRA 4KMFA 5IZCC 4L8VA 1I01A 4XYMA 1XGSA 4AJ1A 3V1YA 2K02A 4TRRA 1R1TA 4R8HA 2ZMEB 2PNFA 4MP6A 3BA1A 4CLOA 3PFWO 1KEVA 3UFXA 3HDYA 5DOZA 3H9QA 5E1ZB 1B15A 2H6BA 2UAGA 4GKBA 2HRZA 4PLZA 3GFLA 2VOEA 1K6XA 4KT5C 2Q1WA 5D4RA 4CDGA 5K5OA 5KKCA 3AW9A 4Q39A 1V0JA 2QBYB 1AGNA 3KZYA 5LHIA 3AOGA 3WFIA 3RYPA 4BMNA 2VODA 3TDUC 1R16A 2VWHA 4OIOF 3HB4X 3HFGA 2DM6A 4KMSA 4TRJA 4DRYA 2RH8A 3CE6A 5IFLA 3PQKA 1JQBA 2WTBA 4OSOA 4QFDA 1RZ4A 2CWEA 4QXMA 3VHRA 3ISPA 1LA2A 2XGXA 1XGNA 4BNWA 4BKPA 4R68A 3HUDA 1ZIDA 4DWVA 3F5SA 3F6YA 2ZATA 2FZWA 4AJ2A 3KZVA 5TLSA 3U9LA 3PTZA 4CMEC 1O3RA 1ZSNA 4ALMA 1HW2A 4D3SA 1X7GA 4BO9A 3PQEA 1O8CA 3UVEA 5CPFA 3SZPA 4EJUA 1ZVMA 1LX6A 3WTTC 1XLTA 3RQSA 4A7PA 4OOIA 2PI0A 2RGVA 1FYMA 2MH9A 1L1FA 5HDNA 3O03A 3KEQA 3WBFA 4MNUA 4UVAA 2GR9A 4EM2A 4OIQF 1UXKA 1A4IA 2PR2A 3IDSA 2B4RO 5G0UA 4P22A 3WTUC 3ZWBA 4CUKA 4EEXA 1KY5A 4A73A 4E5PA 3ZWAA 4ZYEA 3V8KA 4EVIA 3H6KA 3MJSA 4PFJA 2RKHA 4J43A 3RKRA 1SD5A 5E18F 3Q11A 4FOSA 4J7UA 5CFZA 3GUCA 4OINF 4YJGA 4D42A 3K5PA 3QQPA 3HN2A 5G0SA 4BYYA 3AFNA 4LK3A 5D8LB 2Y48A 1DRVA 1G3YA 2XKOA 4N5NA 2X4GA 2NS0A 3Q9UA 3D0SA 4TVOA 4ZHSA 4OJNA 5COAA 2CSOA 3RD5A 2PD3A 3ZMVA 4RVUA 2FN7A 4XQCA 1DDOA 3WODF 1UHWA 1Q2XA 2Y0CA 4FPXA 1I3LA 3A4VA 4ND2A 4ALLA 4RO0A 2PK3A 1PZEA 3K2ZA 4KICA 4AWXB 4PLVA 1SMTA 2QQ5A 4EUFA 2ZYDA 2HRBA 1FOKA 2ELHA 3WMXA 4CLHA 2QQAA 4HZFA 1IB6A 2VYND 2DK8A 2VHXA 5F1PA 3WTXC 1A04A 1X15A 3MJVA 1PWXA 3H2ZA 1R66A 2R2GA 5DD4A 3GOHA 1XSEA 3F5QA 1JTVA 3SC4A 4ETSA 4J4BA 3LFKA 1NFQA 4E6PA 5ICSA 3WLEA 2Y0EA 3JTMA 2NU6A 4YFNF 2WWRA 2X1HA 4PZDA 4MTEA 2KIFA 3TO6A 2H94A 1C1DA 4CQMD 5MGBA 2YU3A 3D3WA 3LAPA 5IDYA 4WPGA 1OYYA 4YT2A 2HEOA 1QZYA 3L7WA 1Q0QA 3QWBA 2BV6A 3JD4A 2PV7A 4AG3A 3U62A 2RVCA 3P19A 3G3ZA 4WASA 3WGOA 3NJ8A 4B8XA 4KA4A 3WJAA 4GX5A 1K0UA 2Q45A 2R00C 3DBRB 1E7WA 2DLLA 2M5WA 3MCVA 1XQ1A 4NHEA 4CLXA 1WMAA 2PMHA 1ZNQO 1VPDA 2EF1A 5TRTA 3V1TC 1G3WA 4EI2A 5A1TA 1MJBA 1ZRCA 3C7JA 2A69F 5BPDA 2XAFA 2IE0A 2W4QA 2Y68A 2YQ5A 3L6OO 1IUYA 4JBIA 2JFHA 4ASNA 4L4RA 4LSMA 4WLVA 1A9ZA 1GXQA 1B1BA 1W8DA 2EW8A 2ZTMA 5BS6A 4BNVA 2AG5A 3HDHA 4BVAA 3N7UA 5L3ZA 2VUSA 2X9VA 4XJTA 5LEJA 1C0PA 4FFLA 3CUQC 3I5UA 1Z45A 2VYNA 4KP7A 3TZKA 4CUZA 2ZMEA 3C18A 4I8XA 1IAWA 3R0AA 1MD0A 3DBLB 5EEHA 2IT0A 1LQ1A 1U5TB 3FPLA 1IOLA 5JR3A 1UH5A 2NTVA 4MP8A 1TQMA 4FB5A 5L3EA 5HDGA 4M8SA 5A9SB 4Q3CA 3JQAD 1C0IA 3Q2IA 4GLOA 3F8CA 1U4SA 3G79A 2A68F 1E77A 5U1PA 3LT2A 5LRRA 5ICGA 4ZU3A 3E9MA 3RC7A 1QXSA 3FRJA 1OYIA 1P44A 1MGTA 3V5NA 4JGBA 2X0NA 4CM9D 4EDFA 5EPOA 3OJ0A 3RI4A 3BMNB 3V2GA 1DUXC 1E1NA 3ITKA 1DAPA 1HE5A 2HK9A 4LN1A 1KQ0A 2LDUA 1C3VA 2B0JA 4I5DA 4YIIA 3U09A 3P9CA 1YBVA 3BOQA 2AEMA 3AOEC 3JD1A 1QR6A 4L73A 1TQIA 4WK6A 2XXJA 1YIOA 1WAMA 3W8DA 3LA3A 4XYGA 4CM8B 2O4UX 2WMDA 2Y0DA 3PPIA 2I3AA 3EVNA 5F6FA 7MDHA 1DXYA 3ZN0A 1TLTA 1S29A 1KA8A 1QBJA 1DRWA 2UVDA 3ECOA 3GT0A 4IIUA 5C7IO 5ADHA 4P96A 1BI3A 3ROUA 4IDCA 2CDCA 1O94A 3O6BB 2Q4EA 4TRMA 2BFOA 4G7ZF 4BNCA 1E17A 4INAA 2LF8A 4CGZA 1NQ5A 1P0FA 3LWFA 4JNKA 3AAFA 1XDWA 2Y93A 3LC1O 1HZJA 3NGLA 1HWYA 4QWQA 2OD5A 2XAQA 1VJ0A 1IPFA 2I76A 4OL9A 4HAMA 4LG0A 1LDKB 2P5YA 4Y98A 4YQZA 4GYGA 3LLSA 1KOLA 2YQ4A 4NFHA 1MA0A 4OKIA 3ONDA 4E33A 4MEYF 1DFGA 5FFXA 1ZUD1 2X7HA 2KRFA 3RC9A 3GRKA 2VHYA 3IWFA 1U8XX 3I3OA 1HXDA 4AFNA 4LK0F 2DPUA 5EMHA 1UDAA 1GD1O 1ZZEA 2C5EA 2NQ8A 1EUZA 2O23A 3SZTA 5MDHA 3GVCA 1K6IA 2GSDA 3DBRA 1N1GA 4OXKA 5IG2A 3PWZA 3RUFA 3QPHA 4FJ0A 1LJ9A 1QGPA 4GGGA 4S05A 2ZKLA 3I83A 5DCUA 4ENJA 4IRGA 2Q1UA 5F3RA 3RU9A 3V2HA 2ZNYA 1SMKA 3I5MA 4JBHA 5ILUA 2CVOA 4FOOA 1PS9A 3NDIA 4EEZA 3BPXA 2Z3YA 1LSOA 3TO7A 3RVDA 2B35A 1Y8QA 4BO3A 3ZNOA 3E18A 2O48X 1LC0A 4MPDA 1ZXBA 1HXHA 2R3SA 3FF5A 1J49A 1E2XA 4TVBA 4E31A 5IXYA 4WCFB 1RWBA 3G73A 3SBOA 4RLSA 4IJWA 3TGNA 1G6KA 4ALIA 3FM5A 4DC1A 4BNIA 1O0SA 2WYWA 3FR8A 1RIOH 1JDJA 1YL7A 2WD8A 1YB5A 5DDGA 1UR5A 5HA5A 2A9FA 4ALKA 1XSDA 2HJSA 3EMKA 5L9AA 3IKTA 3MZHA 4BHBA 5D6FA 4J9VA 2VYVA 1YG2A 3BAZA 3P7MA 3QSGA 4I08A 4CUJA 2PGLA 4KTVE 2AEFA 5TT1A 4D46A 4A0SA 3L00A 5DULA 2BKAA 2ACJA 3I6QA 2DU8A 3QVTA 3ZMZA 3UOGA 3WS7A 5LC1A 4RVDA 4P4NA 3OEYA 4U7BA 4KZPA 5A3VA 1LEAA 5CHEA 2H6EA 1N92A 1U5CA 5JHUA 1KYZA 3IUPA 2OBPA 4HQMA 1SCUA 2G0TA 1PJTA 1A72A 2PD6A 3EVTA 2F5EA 1LC3A 1NWHA 4UVEA 5KTKA 4KN7X 3BTUA 1U8FO 3EYWA 3K1PA 1MP0A 3P7NA 2Y1FA 1GL3A 5JDIC 1R12A 1U1IA 1I6XA 2D5AA 5TF4A 3F4BA 2DK5A 1H6AA 5IN5A 1VKNA 2G7HA 3QU3A 2JAHA 1ZLKA 5A03A 2X5OA 2ZQZA 3NJ4A 4G7HF 2YJZA 4YJHB 1WRJA 2O4CA 4B8WA 4AJOA 5HRUA 3CO7C 4W6ZA 4OMYA 3NTRA 1NXQA 1Z7BA 4PRLA 3KM0A 3GEZA 4RF2A 5CLSA 3F23A 4KWIA 4BXUA 3ANMA 2XF8A 1SB8A 4GWGA 4CICA 3FCOA 4IY1A 1B3RA 1R37A 3PP8A 3RFTA 5HTOA 1LDGA 2HMUA 4BO1A 2B69A 4XGKA 1E5LA 2IZZA 1F1ZA 1RM0A 3HHHA 3PYMA 2A6HF 4RZIA 4DA9A 1T0FA 2RV8A 2VC0A 2UWMA 2J3KA 3O8QB 5DP2A 3GGOA 2V1DA 1MDMB 4Y13A 5FFZA 2VYVD 3D5LA 1I5ZA 3HOSA 2Y05A 3B70A 3Q3CA 5LDGA 3KUXA 4U88A 2IW5A 3JSOA 3ETGA 3UXYA 3CIFA 4IPAA 5BSFA 2FZEA 4GLLA 5TRDA 1ENPA 2C6YA 1JWBB 1JGSA 3PIDA 5FO5A 2IZ0A 3LQRA 3BTVA 2AQIA 5ED4A 3V4GA 3WGHA 3S2EA 5IJZA 3F1LA 4J9UE 3KP5A 3H3JA 1SC6A 3KHUA 3GZ6A 1B3BA 1BVUA 3TWOA 3W4KA 2JT1A 3BDDA 4IMRA 4MTDA 1BI1A 4R69A 4WXHA 1LDBA 4EJWA 1H9BA 3GDGA 1DOHA 1IN8A 4MVJP 3T7CA 3GQVA 3NDRA 1GCUA 4IGEA 3BMNA 1WZIA 4G7OF 2PLAA 4M87A 1BW9B 2C0CA 4J90A 4MVJE 4A26A 4AJEA 1T2FA 2AQHA 2ZTVA 4PCVA 1YLFA 3VOEA 1D3AA 4WEOA 2LSOA 2FMLA 4O5VA 3V7SA 2FR1A 1E1LA 2Y67A 1QYXA 2PY6A 3I9NA 3JQ7B 1HBXG 1MB4A 1J59A 3L9XA 4N7RA 4BOYA 1GQYA 4NQZA 3PQDA 2QRLA 5IDXA 4GX1A 3UN1A 4CYDA 2AQ8A 2D8AA 2O3FA 3GEDA 4EMSA 4CQLB 3FTNA 1GZ6A 3UGKA 1BC7C 5FEUA 3BJAA 2X0IA 2YUTA 2OGUA 1XYGA 4EGZA 3GF4A 1GYPA 1IRGA 5JI6A 1B7GO 3OEWA 1ISFA 4XYEA 1I36A 2DTDA 4P4LA 4E0BA 3OHSX 1T98A 1J6UA 3F21A 5LBQA 4RPGA 2VUUA 5JDCC 3MJCA 4M71A 4XLNF 4BQAA 2A92A 1QZZA 2EWNA 3HTUA 2JFFA 3M6IA 3PDUA 3KE2A 1SEVA 4BKOA 3FMQA 1XKQA 2J6IA 3NRVA 2G17A 4MQ9F 3VVBA 4GVLA 8ADHA 1ISGA 3KSDO 3AM5A 3E8XA 3P2YA 4P4GA 4M55A 2W85A 2R00A 1U8RA 4A10A 4BNMA 1LEBA 3I0TA 1XCBA 4UUVA 1BRMA 3UUWA 2ZXJA 2NAZA 4RS8A 4KQWA 2NVBA 3DZJA 1DPGA 4CMAA 5L51A 4GGPA 4NBVA 1B59A 2L4AA 1YH3A 1U28A 3EY4A 1VL0A 2C5AA 2D1VA 4HYEA 2W2KA 1NHGA 3ANNA 3LT0A 2XOXA 2JJYA 2DW4A 2HTSA 1DAOA 1BW9A 2W25A 2OOSA 3ICCA 3JQAA 3PWKA 4Y67A 1ON1A 2X9GA 5A9TA 3ETEA 3AM3A 4EBFA 5ERIA 3DL2A 2FR8A 1ZARA 4NU5A 2WE7A 4B3IA 1ZXLA 5LLQA 4XJSA 1ZK4A 1C1XB 4L18B 2HU2A 4KUGA 1XA0A 4E4YA 2ZCVA 1R4NA 2XAGA 4HNGA 2GGSA 5FD6A 3BMQA 3H5RA 3TZHA 3D0OA 5EL0A 4OYRA 2BE5F 2GXBA 2I6TA 3QW2A 4E70A 3JAMZ 1W6UA 4R5MA 3I9LA 3IL2A 4CR8A 4E13A 2QQBA 3Q5FA 5ER9A 4M9ZA 1ZN2A 2VC1A 2P4HX 3U5TA 1U3WA 2NU7A 5IZ4A 5TIIA 5JVTA 2BHLA 4JQFA 3TDKA 3O8QA 1IZ1A 2B4QA 1XGOA 4RF3A 4OOEA 1WNTA 1DC4A 2P6SA 1IYZA 3ZWMA 2C20A 2GAUA 4HBLA 3BZUA 4YBZA 2XAAA 3D4OA 5K9ZA 3GG2A 1EQ2A 4IQ0A 2G7UA 2ISYA 1MC5A 1XGKA 5JAMA 5IT3A 3OF2A 2RHCA 1ZJYA 3QLJA 3DQPA 3WTCA 2ESNA 1F12A 1KVTA 2P68A 3AUUA 1PQUA 2QYTA 2B5VA 4XQGA 3S2FA 1OPCA 2HJRA 4E12A 3ELKA 4M6YA 5D5XB 2VOOA 4AVPA 3LSYA 5DD8A 1P92A 4BB5A 2ZO4A 1EFKA 2C29D 3E5MA 4R79A 3G49A 3UCEA 5IZCA 3TFQA 1WDLA 4CPDA 5KCZA 4XGIA 2XROA 3MWMA 1YTYA 1BMDA 2W84A 1WW8A 2GN4A 1EE9A 3V1UA 3QVXA 4OSPA 3E97A 3DF8A 3W6KB 5HS7A 2OAZA 4YIFA 1XU9A 3I71A 2AS5F 1T2CA 1XCVA 2VOPA 2E7XA 1USSA 5I7SA 5HOOA 2FPIA 1P77A 1HDXA 2YHIA 4Q48A 1VJTA 2Y1DA 4KTTE 1FK8A 3GDFA 3KYBA 4CM9A 5IDWA 4ON0A 4MO2A 1PJ4A 2FHSA 3GFGA 3F3SA 2JD0A 3A06A 3BXXA 2UXNA 3AI1A 4ZGWA 3CJNA 1A71A 4LSWA 4QQRA 4LLNA 1RPNA 2EK5A 5TJHA 3W8FA 2DUUA 3HFSA 2O3TA 3Q6IA 4GH5A 4IDEA 2XUBA 2VBYA 3DQVC 1PR9A 2BI7A 4HP8A 3B02A 1AXEA 2DO7A 1VL6A 3GEMA 4OM8A 5HLIA 3EW7A 4FDAA 1SFXA 4YRBA 1REPC 2LF7A 4Y9DA 4AJKA 5TS3A 2B83A 2BGLA 3KP6A 2H1SA 3N74A 2KJCA 4NK5A 1R1VA 3GZNA 1KETA 1YONA 5FI3A 3EDPA 3CMCO 3KO8A 1KU2A 1YS6A 5L4LA 1Q7GA 3RAJA 2HTJA 1TXGA 2JCXA 4PRKA 3OOPA 4ZYDA 1F8GA 3H8VA 5CVJA 4RVFA 1H9AA 1WDKA 5BOXA 2H5LA 4HX8A 1GEEA 4BNTA 4O63O 4PZEA 4AD9A 3LA7A 4CMIB 2M8EA 1QMGA 4U6SA 3HSEA 4M6XA 1Q0HA 4R5HA 4DC0A 1LDEA 1PX0A 4A12A 2WJPA 2BBYA 1ZCJA 2P7VB 5E20A 2Y1GA 1SEPA 2DC1A 1UCRA 4UXNA 2VZ9A 1LLUA 1Y81A 4H7PA 3DR3A 2J3HA 1XG5A 1N7HA 3HSRA 3QPTA 3L07A 4PG5A 5JS6A 2D59A 2I67A 5JDIA 4R1TA 4N9HA 1BOAA 2YV1A 2E6UX 1S7CA 1W4ZA 5IT9K 4RV9A 2GQQA 2RBEA 5LGNA 5E1XA 2RIRA 4GWKA 3WJ7A 1LRLA 1P9LA 5L4SA 3LQQA 3L9FA 2X9NA 4PLYA 5FI5A 2EIHA 2QLZA 4N54A 1BDBA 2ZYGA 3LDHA 5A02A 2NLOA 1YW8A 5B4VA 3WICA 3ZPLA 4TKLA 4IZHA 3KEOA 1DHTA 2X5KO 4LCJA 1Z9CA 2NM0A 4U8GA 1MLDA 2YW9A 4IRIA 1P1RA 1XD7A 1MDMA 1LSSA 3X2EA 2OQRA 1XB4A 3F72A 2AXLA 1ZG5A 1FDVA 2VWGA 3NEPX 3DWFA 5JO9A 1KQ8A 1S6YA 4WJZA 5ILGA 1OZAA 2JAPA 2FEZA 3C1AA 5ITWA 4Q3BA 1P1KA 3HQ4O 4XSXF 4L74A 5DBIA 3TZ6A 4CMCA 4CR7A 3IKVA 1FDSA 1ZMTA 4YAEA 4L5JA 3PYXA 1FDWA 1KVQA 3G0OA 3HZZA 5K1YA 5DNAA 5C5IA 4UNOA 2HUNA 4MIOA 1K6JA 4Z3DA 4EUHA 1BIAA 5ES3A 2O0YA 4HWKA 4BAYA 3I52A 4CM4B 3CINA 2HKXA 1GCOA 4RGSA 5FD5A 1HDYA 1L7DA 2CDAA 1CRWG 5JPIA 5JFRA 1P1IA 3UICA 3PI7A 3RUEA 4E21A 1JU9A 3MJ4A 4LLGF 1FJHA 2P2SA 1BM9A 2AG8A 5F64A 3MJEA 3PEFA 4UUPA 1E6EA 1PSDA 2FXAA 1O3SA 1DIBA 1XIVA 4YT8A 1XQ6A 4BGEA 1T4BA 2Z5LA 5FB2A 4KUEA 4MIEA 3B20A 4EJTA 3HHPA 2A07F 3JTGA 4P5OA 1IHXA 2A61A 4QUKA 2OU2A 1TLHB 3L9WA 1ORRA 4NFSA 3RKYA 1UP4A 4ZN6A 3EHEA 4OXYA 5L7WA 2ZIZA 1LTHR 4FW8A 1KEWA 4TWRA 3DOCA 2Q2QA 4H0EA 2W24A 4K6CA 4F46A 6ADHA 5FF9A 5TGDA 2P5KA 2VNSA 1ZLJA 2YDXA 5KVSA 1WZEA 5CPBA 5CDTA 4LISA 1EK5A 2HMWA 3VPHA 4DMLA 4IUYA 3RCBA 4LGVA 3TRIA 2HDCA 4FC6A 5ILOA 3KSZO 3Q2KA 2A4KA 2BGKA 2CZCA 3CPSA 3MOIA 3PRJA 1GAEO 1Z6RA 1NR7A 1I3KA 4S04A 1KBZA 1YOVB 1SD4A 1YL6A 2GN9A 5CEEA 4Y6SA 4BGIA 4HDVA 1QPMA 2I5PO 4B79A 3OM9A 5AVOA 5KVRA 4AIJA 1FBUA 4N5LA 2P9GA 3JYPA 4GGOA 1O89A 4II3A 3L0DA 3LQFA 4BKQA 1RI7A 1YFHA 1EBFA 1GR0A 1LLDA 4FGSA 2K4BA 4I5FA 4PLHA 1DO8A 3A9WA 4WLFA 5EJ2A 3RIHA 4IXAA 4G6DA 3J80Z 2O50A 2WYVA 1IXSB 3SXPA 2DTXA 3ZWNA 4JP2A 2FQ3A 3FBTA 2OXIA 4E32A 3K30A 1IRFA 4IMPA 1FSEA 4HLXA 4O0LA 1HL3A 2Y99A 3ZV3A 4Q3EA 4BHTA 2C2XA 3KETA 2O3QA 3MOGA 4KOAA 5A2QK 5DBFA 4R1UA 1U9JA 5AQ1A 3HE3A 4M1QA 1E92A 4ZQFA 2GASA 1PL7A 4DLBA 3M1EA 3QIVA 5EQDA 1UHMA 1B8VA 1JKIA 3WU1B 3WWYA 1GZ4A 1BXKA 3I53A 1ML3A 3KRTA 3L4SO 5FYDA 2PTGA 1IXCA 2DQ4A 3VVCA 1UDBA 2Z1NA 1O5IA 1K79A 3ERED 3CUQB 2EJWA 5T8KA 4NHJA 3TO9A 1R5HA 5ICEA 3N4MA 3FTPA 4RQUA 4WCFC 5K5QA 4ALNA 3LK7A 1ISHA 3TDZC 4XLPF 1XR3A 3VPGA 1Z7EA 5KJCA 1HKUA 2WD7B 4WEQA 3GA0A 4NB5A 1GPDG 1VE9A 3D5QA 1OR7A 2RQPA 1H0MA 2OUIA 1E5QA 2Q2WA 3QA9A 4R41A 1KEUA 1MJAA 4ZRNA 5G4KA 1X1EA 2DTEA 2DBQA 2ZCUA 2VE9A 4O59O 3ABUA 2AEJA 3ONFA 4ND3A 5T5QA 3IC7A 2EA4A 1SD6A 2JPBA 1K6OA 1HLDA 4OU0A 1DJQA 1Y5MA 3NDJA 3PHLA 3PJGA 4XB2A 3REOA 2TMDA 3GHHA 5B4UA 1XMKA 2EV6A 1HW5A 1YO5C 1UZNA 1V8BA 2IEDA 3GR6A 3WNQA 3C24A 1WPQA 4R4JA 3JQAB 2Q3EA 1QORA 2DQRA 2IA0A 1PZGA 4R1HA 4ID9A 2F5CA 2QRKA 4Z0PA 5BSEA 1NYTA 1O95A 3NTOA 2HO5A 2JD1A 2W2KB 3JQ9C 5JNLA 2VZ8A 3AU9A 4OQZA 1CERA 2EFOA 3PHIA 4FFRA 1HT0A 1Y0UA 1F4KA 2W90A 3UCFA 4ND5A 4JLWA 2EV0A 4ESBA 4OOFA 3KVOA 2TMGA 3VB2A 1AHIA 4ENKA 3OSUA 4D3FA 4CQMA 2PMUA 3OBBA 4PN3A 1ADCA 3NT5A 4XRRA 4MVJF 3L4BC 4GXOA 1S8NA 1VRWA 5LCXA 5DCMA 1KGSA 4GX0A 1P4AA 2RNJA 1R58A 1IZ0A 2VTEA 3DO5A 1R5GA 4LMRA 3FNEA 1KERA 2QWWA 5HM8A 3VPFA 2I65A 4DBZA 4BUCA 4R1NA 4B7UA 3VPXA 4FFNA 3LT1A 4YAIA 5DP1A 2OZ6A 1GUFA 3LYLA 4P55A 3WNVA 2BFPA 2FRDA 2K86A 1DSSG 2ZJ0A 1R1UA 4BNGA 2OBNA 4IS2A 3JQCA 4OMUA 2IEBA 5TQVA 4O6JA 1PR3A 1Y9EA 4OHUA 2NU9A 4D0PA 1W0CA 1LDYA 2HQ1A 1U5TC 1ENYA 3GAFA 3LSTA 5G4LA 2ISZA 2BRUA 1QSGA 3EQLF 3B1KA 4IQ8A 4OMZA 3NGXA 1ONVA 4JK1X 2AQKA 4KIFA 5G0VA 1BGVA 3TJRA 4D43A 2GZ2A 2L3DA 2HFHA 1YB4A 4UVGA 4OKNA 4EGYA 1GADO 5D6EA 2PWZA 4C4OA 2CF5A 2BFMA 2QX7A 2IVMA 4DREA 1HRDA 2LDXA 5JBIA 3RUDA 3IJRA 2GDZA 3JQ6A 4EM1A 5KJFA 3SHFA 3I4CA 4NBTA 3ZCXA 2GIVA 3R6DA 3LLVA 2VN2A 3ZNQA 4GAEA 1JKJA 1QG6A 1LI4A 3QP9A 3O9ZA 4OIRF 3OMLA 1FYLA 4F6CA 1Z7UA 3JYOA 1YJ8A 1RYEA 1LQTA 1WQ2A 5K5RA 1I3NA 5L4NA 5CJ9A 5KK1A 1VLLA 3X2FA 3A1NA 3INGA 1M66A 1NVGA 3FNGA 2O7QA 5C37A 3IP1A 1SOVA 3WYBA 3MEXA 4UEJA 2P4QA 2O03A 4XIYA 2FSVA 3IAHA 2YX4A 2HYFA 1DP7P 4J16A 1P0CA 4YTEA 1BN5A 3FF4A 4DPMA 4UUNA 3I4FA 3R61A 5E17F 1OC2A 4EV0A 1MFPA 4N9IA 1JA9A 1MZBA 2PFGA 1CQIA 2GPTA 3MWEB 2W8ZA 2KIUA 4ND4A 3ON5A 4Q3AA 5HWSA 3WE3A 1F14A 2I3GA 2QENA 4M9XA 3T0YA 4L0QA 1CWUA 5FLXZ 4HX4A 5GZ1A 2ZB8A 4I1IA 3M1LA 5L40A 1PZFA 1CDOA 1R4MB 4D45A 1WXDA 3DP7A 1NNUA 1KU3A 5KIAA 1KIFA 4YAGA 3H9JA 1Z73A 2Q0OA 3ABIA 3T8TA 2M87A 3IUSA 3HJAA 1UP7A 1FBSA 5BSHA 1ZAOA 1IN6A 5BR7A 1I3MA 3MAJA 4LRTB 3SFZA 1E3LA 2DAPA 4RGXA 2Y66A 4XR9A 4J0FA 3I1JA 2HCTA 2JD2A 1IUKA 1AE1A 2DI3A 1PWZA 3QWIA 1ON2A 2R7DA 3H92A 3CXRA 1NPYA 4NDNE 3ZMSA 3KP2A 1C1XA 1LVAA 4IBOA 4WWCA 3G3EA 1XGMA 2FPPA 2BYVE 3TPCA 1WP4A 3KTDA 1Y8RB 4ZQBA 4DQVA 5H6RA 4ESFA 1XU7A 4Y8VA 2D2IA 4YWJA 1G0NA 4J1QA 4LK1F 1OKRA 4TQGA 1UJMA 4WCDA 4BHPA 4HF2A 2O2YA 1MG0A 3SC6A 4LGWA 1ZW1A 1E3JA 1U3TA 2ZJ2A 3KCCA 1P4WA 3I6IA 4M72A 4L9NA 3N97A 3ZDFA 2H6CA 1UXGA 4IGFA 3RJ9A 3F3XA 4KDEA 3BMCB 3LC7O 2GZWA 2NSDA 5I8WA 3C1TA 1SMYF 1BHSA 3BMCA 3D3EA 5COQA 3ZW9A 2AHRA 2HWVA 2PJPA 2DUWA 2EJRA 3DONA 3GN2A 1FXSA 2YYYA 4WUVA 4DXHA 4U0JA 3KFWX 5T8KC 1ZK3A 2GNAA 5I9MA 1SO8A 2NRAC 1QO0D 3AM4A 1J4AA 2WTEA 1V35A 2VRBA 2ZBKA 3VH4A 1T38A 4LVUA 4DLLA 1L0OC 5J8FA 4GMFA 3JQGA 3E9NA 1B8UA 2Y1EA 3K8ZA 1UUFA 4WLEA 3WU0A 5C3MA 3HDQA 4KIBA 3IMFA 3MTGA 4YJFB 4BNUA 4U7WA 3UAGA 3WR5A 2A5YB 3JD2A 2IRWA 3E9QA 1E3SA 3OP4A 4UULA 3UF0A 3V8JA 1OMOA 1ZH5A 4GCVA 4NZ9A 3BWGA 5DEQA 3S2WA 3GY0A 4CL3A 1IY8A 3AI3A 4MQVA 2QBYA 3A14A 4M86A 3F22A 4RJTA 1OAAA 3H3FA 4YT4A 2E37A 3GZNB 1SZJG 3KLNA 1B6AA 1XELA 3F6VA 4IS3A 1LUAA 4RPJA 4I09A 1E7SA 3PYLA 3DOJA 4D41A 4F45A 1TI7A 1YW9A 5B37A 3DZKA 3E5UA 3WTVC 3SLKA 1EV7A 1WI9A 2X6TA 4Q9NA 1TNTA 2G5CA 1UFMA 2OHXA 5LHGA 2HOEA 1FC3A 3VFZA 1ENOA 4YFKF 3NEUA 2Q1SA 3DTTA 1ADGA 1HDRA 4KNYA 3E5XA 1FNNA 4TSKA 4HV4A 5CDSA 5DCMB 2GO1A 3M2TA 3WXBA 5AIPA 2QYOA 2D45A 3FSRA 1XN7A 4B3JA 4MVJH 2IJLA 3HTSB 5L95A 4QT0A 1BSVA 3JQBC 4LRSB 3GLXA 4CMIA 1KYQA 1YWGO 5I9LA 2BMAA 5EERA 5KJ1A 2F5FA 4O3MA 1HDCA 2O6GE 4L5IA 3RYRA 1WVGA 3E1KA 3IC5A 2DFVA 3RWBA 3HDJA 4BGVA 4G5HA 4R54A 3GGPA 1ULUA 1W7PA 1O57A 1GY8A 1Y1PA 2Z5UA 3WG9A 4GBJA 5THKA 1ZHFA 3ANLA 1WLYA 4HDUA 2D3TA 1I2BA 2NV6A 3PHGA 5J6XA 3M8FA 4WCGA 2C7GA 4IDDA 3EC7A 4OAQA 3PIIA 4Y6PA 1J7KA 4RAZA 1IXRC 3OV8A 3QVOA 4GX2A 5EESA 2DBRA 3HRUA 3BZ6A 1H2BA 1N5DA 4RPLA 1A7AA 1U78A 4Y17A 5DF1A 2KKOA 1OBFO 2FU4A 1EEHA 3IIEA 4HFNA 2EERA 2JHGA 5CAEA 4RVSA 1XSXA 3QHAA 4RAYA 1USTA 2Q4BA 5F1OA 3EETA 4FJ2A 4IJVA 3LAJA 3TZCA 2QG4A 2DBVO 2AE1A 2Y1OA 4AICA 3TL2A 3GFJA 4EITA 3PGJA 4B7XA 3A28A 4O6VA 5CVVA 2EXXA 5A04A 5JW6A 3HIFA 3KZZA 2AMFA 5K0ZA 3K9QO 1RM5A 2IXBA 2IODA 4Q3DA 3VEPA 4RF4A 4PIVA 1WWKA 5L3DA 1Y7TA 2GZ1A 3C85A 3CZRA 3GGGA 3GPDG 1Z6ZA 1LNQA 4A6DA 3ZU2A 3PK0A 1PL6A 1E3EA 3M1AA 4N18A 2POQX 4LVCA 1SFUA 4XWYA 1R15A 1CQJA 1OMIA 4GPD1 4ZD6A 1LRKA 4G6QA 4G9YA 3L6EA 2FMYA 2NUAA 1PTJA 4B4WA 1AXGA 1NASA 4GQAA 2C7VA 4RZHA 2QHXA 4XIJA 4FX0A 4AJJA 5BSGA 1D8JA 1JHFA 3J7AO 4E5NA 4JX8A 3C3XA 1Z75A 3GVXA 5DBGA 2E1NA 1TT7A 1YB1A 1H6BA 2EWMA 3CO6C 1E1MA 4IXTA 3JTHA 3R1IA 3ZV5A 4CLOB 5JAIA 3WDSA 4F6LA 4BHCA 1IN5A 3WGIA 3BIOA 4J1SA 4Z9XA 3F4LA 1EH6A 1B26A 5AXDA 3FMSA 2J5PA 3ZU3A 4NR0A 1KC1A 4BO2A 1I27A 2NYXA 4Q3NA 5G0WA 5GY7A 3V2UA 4ZH4F 2GA1A 3QVWA 4TZKA 4HOBA 4K2EA 1NQOA 1E7YA 3U4IA 5TT0A 1PGNA 4GO1A 1HQCA 1E3WB 1LSJA 3WGQA 1X7HA 3WQQA 2X5JO 1H94A 4R01A 3KV3O 1QQIA 3Q9SA 4C7KA 4FIZA 2RAFA 1YO6A 4Z2YA 2E4AA 5DDIP 1J2XA 4IHSA 2L4MA 3HADA 3JQ9A 3Q9NA 4FHTA 3E5RA 1U2WA 2ZB7A 4Z9FA 3DHNA 2FSWA 3SJUA 3OQBA 4DYDA 3ULQB 1ZRFA 3G1TA 3MWDB 5A9SA 3CZMA 2Z1MA 3WIDA 2V1UA 3O26A 3VAZA 4Z0TA 4XR4A 1TT5B 4DMMA 5CDYA 4UEOA 2V6MA 1I8TA 5JLAA 4KWHA 2ADUA 4PLCA 5LHHA 3BMOA 4BO5A 2MLGA 1TA4A 2Q49A 2VHVA 3ETDA 4L4SA 4A6EA 2P5LC 3HSFA 2B5WA 2DBZA 4MOWA 2DTRA 1WMBA 1V6AA 1HSZA 5H81A 3RUAA 3GW2A 3ZN2A 4L9TA 1IN4A 3WTBA 2XASA 4LB5A 2V79A 3SJ7A 3ZU5A 3FXRA 4J6FA 4A5NA 1XWFA 4BH9A 1RKXA 2CD9A 1YQXA 4CMGA 4TKMA 3LZ6A 4XBFA 3KYCA 1W4MA 2HYGD 3KYCB 3JQ7A 3F6OA 3BP8A 3BROA 2OBYA 4OGWA 4AIKA 4CLRB 1DRUA 4E5KA 3PVZA 3RUCA 1GV0A 4DPKA 3OJOA 3ZWWA 2P9CA 1L3LA 4O5OA 3CTAA 3TL3A 3KP4A 5D4SA 4QECA 1X7DA 4A0YA 4YA6A 4HFRA 2MLKA 4MVJG 1C0LA 2HMTA 3INTA 1QV7A 1TEHA 1I2CA 3JQFC 4J0EA 1YBMA 3ASVA 3VC7A 4EJOA 1UP6A 4FFPA 4MJLA 4QLCU 4BV9A 1SFEA 4EJMA 4CHUA 5DOVA 1E3IA 3R0IA 1PQWA 5BNTA 8LDHA 4XEHA 2FA5A 4A5MA 3RKWA 1ZYRF 2DQLA 1RUNA 3PLNA 2UV8A 1DIGA 3H5AA 4U0KA 1Z82A 1HKSA 2K7LA 2V6GA 4FFMA 3HB5X 2C59A 3WQSB 2FF4A 3DTYA 5CVIA 2WYUA 3OH8A 4HUJA 2OO5A 2YX7A 4YCAA 2VOJA 4PG8A 3QRFF 1DFHA 3ZHZA 5AOVA 3PLRA 4WNCA 3PJEA 4LLLA 1PGOA 3F8FA 1CGPA 4CMHA 1NFRA 2EEZA 2NVUA 1QV6A 1ODDA 1YQGA 2EJVA 1B9MA 1KYWA 2O3SA 3KB6A 1JXSA 3PXXA 2RH4A 4PGGA 1PGPA 1ZJZA 3E6AA 4DYVA 2UXXA 1FP2A 3GVPA 1TVEA 3FZVA 3S55A 5JCJD 2WSBA 2GCGA 4YAJA 1HDGO 3ZWCA 4U6QA 2DT5A 3E5QA 3HOTA 2IP2A 3WTZA 3DAPA 3DEYX 4RDIA 1U3EM 3ZMUA 1NFFA 1R0SA 4YAKA 3QWHA 4NFYA 4YB8A 2CYYA 1CF7B 4GKVA 4BNHA 4A2CA 4G2NA 5BNFA 1V3UA 3C8MA 1EH8A 1ZMOA 2VE8A 1T2AA 3I58A 2EHDA 1SAYA 3PDJA 2NNNA 1PQPA 3GG9A 4W9NA 1DPUA 4XYLA 1CEQA 3MTJA 2EV9A 2B0LA 1T39A 2PFBA 3BMQB 1HF3A 3JCZA 1X0VA 3HG7A 4MDHA 3AI2A 4PVDA 1MV8A 4RB2C 2QUFA 3I4PA 2EKLA 3KBOA 4CR6A 5BPIA 1JN0A 3GUYA 1BXGA 3ASUA 4R9SA 4XQ9A 3ZWYA 4O1MA 3K73O 2MC3A 3H2SA 2COMA 1LB2A 2XPCA 5HS4A 3DAFA 5LEKA 2VRCD 4IQGA 4HFJA 4YFXF 1D7OA 1G1AA 1LBEA 3RC1A 3RJ5A 1U7HA 1HEUA 4U0WA 2BEOA 1FYKA 2PZLA 1MXHA 1J9IA 4B4VA 1ID1A 1H93A 3JAMK 1UZLA 3ST7A 1E3WA 4EUEA 4D3DA 3U4DA 2Z33A 4K28A 1E6UA 3GO5A 1O3TA 2JTVA 1EVYA 1P31A 3AJRA 3NTQA 3GRPA 4CLEA 4DQUA 1XDUA 3RFXA 4DUPA 5F1RA 1R0LA 3TF5A 3BJOA 3EAGA 4XA8A 4R3WA 4EJVA 1ZSYA 1E0DA 4XDYA 2VZ0A 4D0SA 2UDPA 3ZU4A 5G0TA 2P9EA 3J81Z 4DQ2A 4BNZA 2JZYA 3MFKA 3GHYA 1OFGA 3KSUA 4ONEA 4GYIA 3SVTA 3ICPA 3O4RA 4M9SA 5A9RA 1TBXA 1DIAA 3U4CA 3PZRA 1LRJA 4JROA 2X0RA 2VHWA 5D5VB 1LU9A 2ZTLA 3COSA 4YR9A 1H6DA 1NWCA 4TRNA 1DBVO 3ROPA 1GYQA 4E2ZA 1PJ2A 4CV3A 1I33A 1U6GA 3PQJA 2HS5A 7ADHA 3RBVA 1YDWA 3T7EA 4RB1A 2YY7A 4I7HA 3QVSA 4I9NA 2G9WA 4YJGB 4CM3A 1EVZA 3FI9A 2JRTA 3E6MA 2V6BA 4JP3A 3VZSA 4CV0A 5GZ6A 2VRCA 4I9HA 2WEKA 3ENKA 2WDZA 1J0RA 2W2LA 3NQOA 1FDUA 4WOJA 4R3NA 3GC6A 1I32A 4I9UA 4BNJA 3I64A 1LDDA 1AOYA 3WE2A 1VTNC 3K1MA 1O6ZA 1A27A 2Z95A 1OOEA 4DPLA 4E5MA 1IW7F 4BMVA 3BYZA 4QX6A 3ML6A 2E1CA 2W98A 3PZBA 4CO8A 2FOIA 3R6SA 1HW1A 5ILVA 5AIQA 3NRCA 4W99A 2AW5A 3M2PA 3QV1A 5E8IA 2OMEA 3CTMA 3LVFO 3MEQA 3JQEA 4NPCA 4ZRMA 3CEAA 5CVRA 1NM5A 2PN6A 3OJLA 3QRWA 1R23A 3DPLC 4DBVO 2X86A 2A3SA 1ZG1A 2Y75A 1E7QA 1O3QA 3GZ5A 1WKMA 4I5EA 4B8ZA 2OA4A 2QZZA 4BO8A 1HYHA 1FBQA 3DV8A 3FWNA 5TJ9A 3LF2A 1CETA 1N9GB 2GN8A 3JQ8B 5ER6A 4P38A 3CKYA 1VC2A 4NQWA 3HHGA 1I30A 1P1JA 3CUQA 1D3YA 1Z91A 4HX7A 3UH1A 1GTMA 2ZNZA 3EDMA 4UVIA 3FHZA 1XMAA 4QSMA 3L6DA 4G81A 2NNYA 2YPRA 3QAHA 1PGJA 5KKAA 2O3RA 1HETA 1BIBA 4EGFA 2IYOA 5JC1A 5TC4A 3VZPA 1YE3A 4IXWA 2CVQA 2CFCA 2YV3A 2RC4A 3AY6A 5F5LA 2Z9OA 1XHLA 3ZNNA 3AOEA 3PFIA 3IOYA 4NBWA 5A5FA 2HK7A 5U4QA 4EQQA 3BJ6A 3U9GA 1ZG3A 3CUOA 2NTNA 1ZGJA 2D1HA 1Q7BA 5T64A 4IPTA 3VDQA 1T1SA 3JQFA 3ONEA 3DHEA 4U0VA 5DV5A 4JBAA 5AYVA 3CDHA 4N5MA 1JLLA 4IDFA 2PH5A 4M89A 1W7PD 3FBGA 4BKUA 2G82A 2FOKA 1GYRA 2J5KA 3WYCA 2DLDA 1FT9A 3DBLA 4J4HA 4NMHA 1I2ZA 4CV2A 4I0AA 2BI8A 1XSVA 4I98B 1VJ1A 2V65A 3HN7A 4JBGA 2BELA 4NJMB 3GX4X 5E8GA 3MCZA 2VCYA 3U3XA 2AE2A 3KYDB 3OETA 4KMUX 1PP7U 1E7MA 1ISIA 3UCXA 2WC2A 4E30A 4EZBA 5C7LO 3EZYA 4ROSA 4WE3A 4R51A 4WF2A 4RDHA 4E2YA 5CYVA 2GD1O 1BDMA 1CJCA 2FE3A 4MIYA 4TV7A 4ZA2A 5H20A 1I0ZA 5F1KA 2I9PA 3TOZA 4YRAA 3RUHA 3W4IA 3IJPA 2P5UA 3D64A 2IA1A 1X1TA 3TOAA 2UYYA 3H9GA 5HBRA 4FFOA 2CGPA 4XD2A 4E3ZA 1ZKMA 5A06A 1SOWA 4J7XA 4L75A 3RJPA 4PLPA 5EN4A 2DPGA 2PZMA 4IZIA 4NI5A 4KFCA 4A03A 3KLPX 3ZI0A 3MQ0A 2ZCWA 5EINA 1E7RA 1VI2A 5BQTA 2OP0A 2FY8A 3ZV6A 3VH2A 4KDFA 1OYWA 4CM8A 1H9GA 2Q2EA 1SPXA 2EGGA 2H9IA 5KVVA 1BXZA 2IXAA 4J4TA 3W6ZA 5KJEA 4KN4X 2ZQYA 3R3JA 4KUMA 4W4TA 4BMSA 4D0RA 3Q9VA 3R60A 1GUYA 3VPSA 3UW3A 1VKOA 2VNAA 1HKTA 2QW8A 1V3VA 4JCOA 3D4PA 3RI3A 2MH2A 1AN9A 5I9NA 4WNIA 4YJDA 3I23A 2PGJA 1K2WA 5I7VA 4UV9A 2PKRA 1T2EA 4UVHA 3JYQA 1S6LA 4BKRA 1GUZA 1W7PB 1P45A 4RF5A 3I59A 1PJCA 3GVHA 2XAJA 4W9NC 3NT2A 4GVXA 1PIWA 2P8TA 4G8XA 1U7TA 3EK2A 4M49A 5KVCA 4DNCA 1Y9AA 1DPRA 1FY7A 3DZGA 4Z0HO 5FFFA 3ULKA 3RKXA 1Z1DA 5F21A 4K1LA 5DUIA 5DCFA 2NVUB 5KWEA 2HDHA 1IE3A 3I9JA 3EGOA 4K26A 4YXFA 3TOXA 1NR1A 1NHAA 2P6TA 2EKQA 3GLQA 3ZMDA 3P5SA 1Q1HA 5HLHA 1K78B 4RB3C 1HE3A 5H83A 3ROQA 5H6QA 2CNBA 4K9DA 4MVJM 1HYGA 3L77A 2E48A 3S1LA 3WGZA 4CM6A 3GYHX 4CODB 3GMSA 1UB9A 4N0BA 2WV0A 1PJBA 5JDCA 2AXQA 3WB9A 5GMOA 3EUHA 1HLPA 4ZYGA 3C7CB 2AA3A 5L3BA 1NX6A 3K96A 3F8MA 4MGRA 3C1DA 4J1TA 4YRDA 3WLFA 4KIGA 1DC5A 5T57A 1FF9A 1T6SA 3J80K 2J8ZA 4PCQA 3PJDA 4XQEA 3D1LA 3DPTA 4G65A 5DCYA 2BFAA 4URFA 2R6JA 2XXBA 4HF0A 3MZ0A 1GXPA 2WM3A 4YEDA 5L3CA 5LGTA 3OECA 2X0LA 1P74A 1U2DA 3ZWVA 2A6EF 5JAZA 1YRLA 3I54A 5HLGA 4FS3A 4RGRA 2WD7A 2V1XA 1HSTA 2PGDA 1F17A 1G0OA 3F9IA 5K6AA 5H82A 2XHKA 4A0XA 5L3GA 3V7CA 1XDSA 4ZZDA 3JSPA 3F47A 3ROKA 1ONPA 3ZNPA 3HSKA 4XZ3A 3V7RA 1SB9A 3GNSA 4CMEA 2CFXA 4GL4A 3SLGA 2BD0A 5TJJA 3O3KA 1V3FA 1D8KA 5B1YA 2L02A 3GFBA 4HNHA 4BNYA 2XKPA 1LQUA 4IINA 3FPCA 3QWAA 1IULA 1RM3A 1GFSA 2E49A 4CM1A 2VWQA 2C54A 3RPUA 1DIHA 2I99A 3FD8A 1BJAA 4RB0A 4WXDA 3FX3A 1EDZA 3KYDA 2D2WA 2PEXA 3W6JB 3L4BA 4GMGA 1PZHA 1MJ9A 4BO0A 1ISMA 3RPQA 4NIMA 1UAGA 5I7EA 3R0JA 2QM3A 4TROA 3ZH2A 3JD0A 1J75A 2XRNA 2D1YA 4UAGA 4AJIA 2HSDA 5BQFA 1H0KA 1NPTO 2JSCA 4NJOA 4WX9A 2F5DA 5CVUA 1OC4A 1O7LA 3WIEA 4DIOA 4TMFA 5IDQA 2O8XA 4HV5A 4BO6A 3OIDA 3E6DA 4FQ8A 1FDTA 2J3JA 2V7PA 3GXOA 2B37A 2NACA 3F8NA 3ZP5A 3I9MA 4RCVA 5THQA 3FXUA 1K7AA 4IRHA 4CJXA 2J5RA 3HYIA 1C0KA 4X54A 4DIBA 3BHJA 4XRGA 3HRTA 3TQNA 2Q46A 4AJLA 3VKVA 1B14A 3HUGA 1SAXA 3ZN1A 1SBYA 2BH9A 4JQCA 5D5UB 3GK3A 1DB3A 1EUDA 1LDJA 2VUTA 1YDEA 2D5CA 5F5NA 3B73A 3H3UA 3FN4A 2JCYA 3DOOA 3NT4A 1JKFA 4CV1A 2OQGA 4R16A 3DBVO 5CG1A 4MVJA 4C7JA 1EZ4A 3W6UA 3AU8A 2STWA 3TN7A 5LDHA 2IYPA 3T1BA 3H9UA 1F9NA 4EYEA 3INRA 1T26A 1I10A 2ETHA 5IT9Z 1DC6A 3NAQA 2GRAA 3E6CC 1R36A 1K5HA 3GAZA 5JO0A 3L2CA 3VODA 2C2YA 4ITUA 4PG7A 2EB7A 2FR0A 3PHHA 4QO7A 4E2XA 4B4UA 4QEDA 5L7TA 3GNTA 2YSRA 4PLWA 5TSDA 1QRRA 3IP3A 4ZYHA 2EFNA 1Q1NA 1BTOA 2EP5A 5TX7A 2OFPA 4MKRA 1FLIA 4NNJA 4UEKA 1DC3A 3WGTA 4YT5A 4BNLA 5DYMA 5CG2A 1PS8A 4QTZA 4H15A 3U49A 3M8EA 4FX4A 1EMDA 3NV9A 2PH3A 4OQYA 2X23A 3IS3A 4IJUA 3Q0EA 1H5QA 4B3HA 1DIRA 2EG9A 4CMKA 3DZIA 3GZ4A 1VL8A 2O3UA 4LMPA 3TSCA 4CQMB 1EH7A 2TDXA 1CIVA 1HSOA 1Z74A 5DZSA 4MP3A 4RORA 2X8LA 4Q4ZF 3ZWPA 4YJFA 3QWFA 2M1BA 3WQRA 2F1KA 1X3UA 2CF6A 1TNSA 3GF2A 2YFHA 4IHTA 4FC7A 3DEUA 4J49A 1U3VA 5A5EA 4GSLA 2L54A 3MZYA 2RHRA 3AWDA 3AFMA 1NBOA 4CLRA 3GFIA 4HKTA 4WLNA 4BO7A 4KDPA 5AXAA 3RBXA 5AONA 1F06A 3AK4A 1KEPA 4JK3A 4F3YA 1TW2A 3DB2A 4HFMA 4RLHA 4A0ZA 1U3UA 4U0YA 2IRFG 3QOPA 3DHYA 2HZTA 1X0XA 2W2LD 1JHHA 3KP7A 3DC2A 3DZHA 3JQGB 2QVOA 4WLUA 4BGUA 4DTIA 3OFSA 2DFIA 2IDZA 4W82A 3H65A 4B09A 3E3VA 1PGQA 5JMPA 1TTYA 5EQFA 3E82A 2ZKZA
chains in the Genus database with same CATH superfamily
3N39C 1S2LA 3CUWA 4J3FA 3EIEA 3VZBA 4EA6A 3IR5A 3QI7A 4UPEA 2R7ZJ 1UAYA 4P0PB 4MVWA 1DXHA 3ABTA 4S1OA 1Q91A 3S7ZA 5CH8A 2IYWA 2P0YA 3H3XA 4BRZA 2OV3A 4OYLA 1SOUA 4YMLA 2CYCA 1EWQA 1FOYA 5IXSA 2VL7A 4MHOA 1FMFA 2L9NA 4CSWA 4XX1A 2AUTA 2EA2A 4BLSA 1ZREA 2M30A 3COAC 2EFQA 1RJ9B 1NLZA 4KXNA 3T3MB 5JAZA 1DLJA 4JP0A 2VAVA 3O8DA 1I80A 1KY4A 5SYMA 3C3WA 2D5VA 5AXBA 3TIIA 1SKUA 1ADBA 5DU2A 4N40A 5IMSA 2H00A 4M76B 2IX3A 1YIDA 2CXUA 1JVBA 5KUTA 2LDBA 3QBTA 3CRNA 5BT9A 3OICA 3RRFA 3O8OA 4W1UA 3ISVA 1N7GA 4FE7A 1U2PA 1F8FA 2VBXA 3HBNA 2ZI9A 3FGNA 4DIQA 4PAMA 4A6PA 1D4AA 4A8JB 3EZ2A 4C0KA 5B12A 2Q99A 5LBUA 1H2WA 4XIIA 2AK2A 1NVDA 2JJ7A 4D99A 4TXMA 5KC9A 5CH5A 3G02A 3B6ZA 4IJKA 5JRZA 1QYWA 2GA2A 3IRQA 1GKUB 1M2EA 1MOSA 3N0TA 3TW0A 1A7KA 2WWYA 2R44A 1EQUA 4CM4A 5I45A 1DI0A 5HG0A 5EE3A 1W96A 1PL8A 5AM2A 4OI0A 3WLKX 1T4DA 1AM4D 2QTTA 3ZHOA 5JFGA 1UMBA 4MVJI 1H2HA 3OCZA 6AT1A 9LDTA 3HV0A 3JQDA 3ZWOA 3FWZA 3K69A 5B3SH 2C9CA 4NCJA 5TVKA 2N9UA 4F3QA 3RDIA 3BX1A 1Q1AA 2DSNA 3V1LA 1G20E 3P9KA 4EWLA 4HQEA 1Z2NX 3RBZA 1SQSA 1G66A 4UUSA 2XQJA 3LHIA 4B7ZA 2Z98A 4NBRA 2IUSA 1QKIA 3QE3A 1TIBA 4JOSA 4MUBA 4UMFA 4AG6A 4CXFA 2QL6A 1VMEA 5DGCA 4WY5A 3ECHA 4ER0A 1SHKA 1E64A 3EMVA 1B9NA 3L4EA 4MGYR 3GTGJ 1TJ3A 2KIQA 1V9LA 2Q27A 2YJ6A 1Z21A 4PJNA 1NVTA 2A94A 3FHLA 1DWPA 3A1DA 1SC4A 4RBNA 1P5FA 4AJNA 3AONB 1BN7A 1NY5A 1MSEC 1HG0A 1ZFNA 3PHBE 2XWQA 3ENNA 4HATA 4L8FA 4Q05A 4PYIA 3HLYA 4YMIA 2P3LA 5B4TA 3ZDBA 3ILSA 1L5QA 3ILYA 3MWFA 3OIFA 2VDJA 5A2QA 4HW0A 1AHPA 4UU7A 1I1SA 1HDOA 1VG9B 2AN1A 2QZ9A 1JNXX 2YHBA 1LFAA 3ROMA 4RA2A 2CXQA 4Z0NA 4LHEA 2OL4A 2YHIB 3M4NA 3OG9A 4HO1X 4OOEA 5C32A 2O7NA 5C53B 3K70B 1H2AS 2C3PA 3JQPA 5MFZA 4RTJA 1TF7A 1R88A 2QVCA 3A6KA 4NG5A 1BDIA 1NUQA 3R5KA 4YCNA 4MUJA 3AEQB 1T3HA 4IIXA 3WKDA 4BMZA 3H5NA 3PNSA 3TQRA 4I5IA 4I3HA 2I1QA 2RHDA 1QRYA 2OP1A 3LBFA 1U7OA 1ONNA 3R4KA 2G70A 2PBFA 4G9BA 1PJSA 3AESA 2OJED 4ZTBA 2OHHA 4CU2A 4G6TB 3AUKA 3DFUA 3S16J 1MABB 1JBEA 3PCTA 5LSAA 2NU9B 3KHKA 5KSOA 2HMSA 1FSSA 2Q50A 3AJDA 3KOXA 1F5TA 1P0IA 4CL8A 1ZK1A 2X4DA 3CUKA 2C3YA 3ONWA 2BR4A 4UAUA 5BN1A 4ESJA 1O6BA 5CT4A 3TOBA 2SCUA 1MG5A 2OKGA 1UBUS 1TZMA 2R6ZA 3CUSA 3IDQA 4JUAA 2ST1A 1UADA 1MH4A 3RG8A 2WHYA 4DSNA 1KJ8A 1ZBQA 4XKJA 5HFNA 1K98A 2QTAA 1I1GA 1YQUA 1YQDA 4ZHQF 5K6AC 1C0WA 1MBEA 3A0UA 3CSDA 4D79A 3K4MA 2IHVA 1XRNA 3T54A 4TXNA 2A1TS 1D04A 5C9ZA 4UM9D 3HDVA 4KR3A 5BWNA 1X19A 5D6OA 1UOQA 5IRCD 3NARA 4OLBA 3ZXXA 4L0ZB 1SIUA 5J47A 1Z8NA 1J8FA 2FQQA 2JHFA 3R0VA 2PX2A 4PK4A 2EV5A 5BN4A 1PG2A 2R97A 1LK7A 5H68A 4I1YA 4Y2GA 4HUQA 1P81A 3U13A 2BGJA 1YMUA 1Q1GA 3QUAA 4NICA 4Z9YA 3OF5A 3GGDA 1HCRA 3ZDEA 3R8FA 5ISMA 1M7HA 3RSNA 3LECA 1JR3A 1JXAA 4WX2B 3WHKA 1C50A 2DPHA 5IP5A 3VO1A 5JDCC 4BS9A 1XRMA 2NU8A 2DPDA 1U0LA 1QF6A 5IN4A 5CLGA 3OPQA 1EUQA 1ESZA 4CLDA 4ZCIA 5FJ8J 2BGIA 2PUWA 4EEFG 1D1QA 4G0XA 2J4DA 3LC0A 4LI0A 2PKQP 2MSDB 4RMHA 1JEAA 1T36A 3AG6A 3CT4A 2G40A 3FXQA 4OJMX 1I5RA 3ESDA 2G1UA 1PHRA 5EG0A 5EEGA 1KJJA 1E2GA 1WPRA 3A1TA 3GPIA 3SEFA 3DBHB 4DABA 4YRMA 3U5ZB 2FSSA 4WXCA 5IH7A 1YVUA 4YAUA 1I24A 1RQGA 2YMQA 3U3MA 3FFBA 3NGMA 4XAQA 1BS2A 1OVGA 2HCBA 1THZA 3SMQA 2XYQA 3SIXA 4BPBA 2DVMA 2I4RA 3BR3A 1M6WA 3R4VA 4FEYA 1XE3A 1R4NB 5FLXK 3M6FA 3T12A 3G7SA 1X7XB 1XZIA 1EFRA 1WJAA 4TTTS 1BQ4A 3S15J 1PKXA 4NMWA 4EB3A 3HACA 2QVZX 1QPBA 3SQLA 1UELB 1Y37A 1R00A 2TECE 1XEAA 2ZJ8A 3DMDA 3FYUB 3G8YA 2BF7A 2VDKB 1YJQA 4HPQA 1NAIA 3P9SA 3QJ5A 4HLUC 4Q37A 5F78A 5JCJA 2OO3A 1P6RA 3EUWA 4PZLA 1P4JA 1XV5A 3JYNA 1KONA 1NR5A 2X58A 4QL3A 2PG4A 1ZY2A 3RVJA 2NTJA 1KFJB 3L2RA 1M2WA 3WOHA 4TVSA 3PNYA 2NSJA 3DD5A 4P5PA 5JNSA 5KTYA 1M10A 1TJ5A 1MIOA 1H9CA 1JPVA 1T0UA 2CNKA 5ALTA 1MUUA 2QM8A 3UEOA 3HEAA 1U2ZA 3EGCA 3BD7A 3NKLA 4MQ6A 3UAOA 2ZS7A 2B20A 1DDGA 1HORA 1QFSA 1YZUA 1AS3A 1JT9A 4DT1A 3KKOA 1W47A 3TTVA 2AJBA 2B2CA 1ULZA 1RI3A 1X1RA 2JFPA 4G0MA 4QRDA 5DGIA 2DCUA 4BYGA 4CKBB 4TYNA 4C6HA 5ITZA 2ZB4A 1D07A 1HDZA 3K72B 3VR6D 1YI8A 1BKDR 1IBRA 4LNHA 3D7LA 2ZJ1A 2VWPA 1Q0SA 2C03A 3RHSA 4NV3A 3OSFA 1M3SA 3LSIA 3GOQA 4MVJD 1D1TA 3IAAA 1NTOA 1VECA 4OP3A 2M9HA 2DGDA 4PIPA 2P0AA 4HDKA 4QXPA 5DXFA 4V38A 4YECA 1N2CE 4KITB 2ZT5A 3IALA 1N9GA 4D0NA 3FMRA 3OJEA 3CW2A 4JBLA 2FWMX 1VMIA 1SVIA 1NXXA 1HZZA 3IO5A 3UHAA 1EVJA 3ZBQA 4OH1A 1PV1A 3M3PA 4FGZA 4CYMA 2ES4A 2V6CA 5KU1A 1M6YA 2BCJQ 2I33A 4WXPA 1SWVA 3Q9LA 1WXXA 1LUJB 2O0LA 2QT9A 1JXQA 2C82A 2VB6A 1JZQA 2Q6OA 3BVPA 3LHKA 3GCWA 1KGDA 1PK9A 2OG2A 4YCJA 5ERYA 5FNVF 4ZJUA 4JB8A 1YFJA 5T6BA 1GSOA 3BR0A 3EYYA 3PGXA 3LKZA 4HPXB 4IH1A 1W0KD 3RV3A 3SY8A 3OQ1A 1QS0B 1STZA 4WK8F 3AI7A 3B8HA 4LD5A 1FBNA 1RNLA 1L5SA 2O3JA 121PA 3X1YA 4Q4CA 4HQFA 1UPCA 1PJLA 3R7FA 4O1HA 4PC1A 2IU4A 4JB3A 4XSZF 1U6JA 2FFBA 1V1JA 3QPCA 2PQ6A 5FLEX 3T3EA 3CYFA 3LLCA 4DZRA 5JZBA 4U7DA 5CNJA 1L4HA 4PHTA 3RS8A 1BG6A 3HGGA 2JIZA 2P91A 4QFCA 4UE3S 3TMAA 3H0CA 3TLGB 2K3PA 2ZTSA 3QVVA 1URPA 4LG0B 5HIKA 1A1SA 1FMCA 1FDIA 1LDMA 4L8LA 3HYCA 2XBUA 3AFOA 4YN3A 1IBKB 5BW5A 4KB5A 5D00A 4MWBA 3L04A 3TIFA 4ZAVA 3M9AA 1EX9A 1UMDB 3ITNA 3P2OA 3B1VA 3ME5A 3VDMA 1WHSB 5FUYA 4MUIA 2Z5FA 2YHAA 2OXTA 3OQ6A 1IJKA 1A8UA 1BE1A 3VNQA 2B36A 3NMUF 3BHIA 5CURA 4HGNA 3FPHA 3GH3A 1H66A 3RVOA 4QU9A 2W5UA 4II2A 4MIMA 2JRCA 2O2GA 4FGKA 4KO8A 1Q1ZA 4P32A 3GUVA 3WNDA 2A9VA 3M3YJ 4J2OA 1XZNA 3SC2A 2D7DA 2YJTD 1PTJC 1TJNA 1FNSA 3THOA 3TFOA 3W1VA 3MILA 2V6EA 3QYJA 1ZSVA 2O7SA 4L3OA 3FOBA 5E4YA 1GNVA 4EB0A 5BWLA 2GETA 1T6ZA 3HWX1 3ZD7A 2J9ZB 3HVUA 3QNUA 4OQQA 3TAHA 5JYBA 3E48A 2P2CA 1IN7A 2IX9A 2JL1A 4G0NA 2HQRA 2XDYA 4FDTA 4FFBA 2UUZA 3PL5A 2X14A 2Z09A 4QJ5A 3DKWA 3ZQIA 2DFLA 2V54A 3H9BA 1YIAA 4BE1A 2DECA 2EP7A 1WWXA 3OYIA 2F67A 3F46A 4H0CA 3BWCA 4UU0A 2YDYA 3OQPA 3VO2A 3U1DA 4DA7A 2JUCA 1B0AA 2O14A 2QAGC 3K3PA 4A27A 2R7FA 2J3IA 4CIXA 3SC3A 1N8SA 2G3YA 2FQ1A 1ZELA 2GBYA 2W2OA 2ZZKA 3L2UA 1QRDA 4CCKA 1KQ3A 4UUOA 4CKZA 3HPGA 1B4DA 4BMXA 2GXGA 2CQQA 1CUHA 2JCVA 5JMWA 4B6EA 5ALPA 3WWDA 3EEOA 3H4MA 4UREA 4EA8A 5I7WA 1Z4JA 5H2FC 1CRQA 3H2KA 3K0CA 3M5WA 3DXJF 1D6MA 1K6EA 2VP2A 4TLCA 13PKA 3DS8A 3ZE8A 2IH2A 2XIGA 4V2FA 1NT4A 2FU5C 1CFJA 4R9RA 4QEZA 4DBZA 1CNMA 1G2QA 3VZRA 1E3OC 1MX3A 3AEKA 3E03A 3K0FB 2JAWA 3GD5A 3EZLA 2YCLA 3MRSA 4IP0A 2R8BA 2PMBA 4E7KA 3JASB 4R2MA 3RYFA 3VM6A 4AJ4A 5JC8A 5LIRA 3H1PA 3BD8A 3J7AY 4WKGA 1JIUA 1G2OA 4EM0B 1U4OA 4TL6A 1NTRA 1QF9A 2OCIA 4CFSA 2HA6A 1Z6TA 2EX1A 1Z5OA 1WJBA 3KTAA 4H6VA 1P4HA 3O8BA 1VIAA 4PHGA 5H8WA 3MWYW 4TYYA 3JVDA 2AD1A 4DJEC 3G85A 1E3TA 1J5YA 3E9ZA 2ZBQA 3ZGOA 2HKIA 3MF4A 3OKCA 5FGMA 5FOUA 2IY7A 1J2TA 3OA0A 2OC4A 4L76A 1NDQA 2DFHA 5ICCA 1QZTA 5DTMA 5I7FA 5JQWA 2WP0A 2ZJPF 5ESXA 3ADOA 1XVVA 1KS9A 2FPGA 3GJZA 5JT1A 5DPMA 5H3CA 3KKNA 1NI5A 1JAHA 1DDIA 1KK3A 4G36A 5BO5A 4QBIA 1NQXA 1Y9DA 3ZCQA 4F5EA 4UVBA 2BUBA 4UUSB 3C0KA 4IFEA 2B8JA 1JFSA 1WKBA 3NHJA 5AM3A 4BXOB 5C3UA 4CHTA 2NMVA 4OXNA 2ZI3A 1K66A 4ZYXA 1THGA 3GDOA 1N36B 2STTA 1DG9A 1UXOA 2QJWA 5B66C 3GD7A 1H42A 3K0HA 3LCRA 4KGVA 1GGVA 1JEOA 2H09A 1WJEA 2NYVA 1NLFA 2FFQA 1OB2A 2H7YA 1LEHA 5DI9A 4GBED 4WOKA 1GL9B 2V9PA 3MMPA 1LDNA 2HK8A 3FMOB 4L4XA 3IP7A 4ETIA 4JR2A 9ABPA 3KTOA 2A9RA 5FLKA 1XPUA 2AN3A 4ZAWA 1JG6A 1Y82A 1P9OA 2F62A 1KI2A 5KOIA 3LMKA 2CNNA 1CJUC 1EGAA 3V00A 1RYDA 1KA9H 1K6YA 3A26A 3FDIA 3PUIA 1CHDA 1RM4A 3DL7A 3JAWA 3IRRA 3F90A 2BZ1A 5F76A 3VH3A 2A0YA 4Q5SF 5CGZA 1GDHA 4AYXA 4MLOA 4PWZA 4A92A 3HOVJ 3IQZA 4G56A 5FI1B 3TQHA 4BO4A 4M0FA 1MFZA 5IYZF 3CCVI 1YGYA 5IJXA 3ZHRA 1REQA 1WKVA 1T1RA 2XMDA 2EX0A 3L0BA 2D0PB 3O3NB 4JYBA 4LTNA 5CIWA 5CNMA 1TZJA 3SIWA 3ACDA 3GTOJ 3FWHA 3FUUA 1VP9A 3S8PA 3CLUD 2YVUA 2BUAA 4LOLA 4G5RA 1ADYA 2UUOA 5M34A 3ZKWA 1N1EA 3H9EO 2RI6A 2NQTA 2NWQA 3FTDA 4LJLA 4NS1A 4TTQA 4BNNA 2XKKA 2E89A 4BEHA 5JWRA 5J2TA 2YZKA 4B4DA 1AA9A 1IEWA 5CNKA 2XTMA 3QU7A 2WSSD 3ASZA 5G2OA 3ZYZA 5BVGB 2QD1A 3ZUGA 4FSXA 4IX7A 4ZKDA 3V8LA 1HV8A 3CLOA 2WUDA 2XCQA 3IIKA 4HWPA 2PZEA 3IQFA 1I01A 4XYMA 4AJ1A 4QBKA 2BW0A 4YGYA 4ZYVA 4TRRA 1XP8A 4R8HA 1W34A 2ZMEB 4N47A 3BA1A 1CR1A 3PFWO 1KEVA 5LP6A 4FWIB 2I71A 3FZEA 3HDYA 2XB0X 3M4JA 5DOZA 1B15A 4DLVA 2GS9A 3JAKB 1GRNA 4RFSA 4R7TA 5C8ZA 1V41E 1IZ8A 1RZUA 1ZBDA 4LZNA 5EKDA 1P4GA 5FHQA 2J0EA 1N0HA 1PLKA 1C4KA 3BBLA 3AW9A 3QBDA 1UM9B 1W0UA 3P2JA 4GE3A 3AOGA 1QGUB 4V39A 5CBPA 5AW2A 3HB4X 2BVMA 1SHJA 5DSXA 2ZUWA 2WTBA 3BIFA 1E79D 4QFDA 4DANA 4MVXA 1UPTA 2BDUA 2NV2B 4QXMA 4DR2B 4BFWA 4TX1A 3GQBB 4HQOA 2XGXA 1PQ4A 1T3GA 4DOZA 4M1ZA 4RGVA 2JGDA 1J06A 5JU6A 3F5SA 3M7IA 3F6YA 4FMDB 4F3TA 4PX2A 4FLEA 4TXLA 2REBA 3AF3A 1ETXA 4YELA 3K09A 3KZVA 1VKHA 1NJ1A 2YR0A 3OM1A 2WTXA 2OQVA 4AP5A 3Q3GE 4LIPD 2HOQA 4UD6A 3RTGA 5F2OA 4BO9A 1YULA 3AGPA 4E09A 3PR3A 3UVEA 5JYCA 3IEMA 4GUDA 4KIJA 4EJUA 1ZVMA 3OCCA 3PC8A 1BDHA 1XLTA 3WTTC 2P1DA 3A4MA 2ZUFA 3A2KA 4OOIA 2PI0A 4KQCA 1J09A 2MH9A 2IPMA 2BFCA 4MTCA 3R5TA 4TS4A 2WM2A 2JK1A 4UHEA 3ZCRA 3EFOB 3MIIA 5HUQA 4UVAA 3AIKA 1CVRA 2GN2A 2GR9A 3AW8A 4XARA 1M1YE 2XWJI 3SSAA 3ZWBA 3TXXA 4EEXA 3L4JA 2F3SA 2I8LA 2XF5A 5AVVA 4OXQA 1MW7A 4C7XA 4E5PA 1E9CA 1UWVA 2IFTA 1NW5A 3U39A 1R5OA 4M3DA 4J7UA 2FW1A 3N5CA 4UB6C 4OINF 3EARA 2J85A 2Q4TA 4PLVA 5G0SA 1KDYA 1FMJA 2H7XA 1CUIA 3AFNA 4MVCA 2Y48A 1WX1A 4M7OA 4EECA 1H1LB 4N5NA 2M4GA 1MZPA 3Q9UA 1GKIA 4ZHSA 2P6MA 3WL4A 5KO2A 1EJ9A 5AIAA 3RJMA 3DU5A 2NTEA 2RI0A 3VI3B 3EGVA 1OFTA 2FN7A 3OC0A 1Q2XA 3WODF 5DI3B 3JWIA 3OYDA 3A4VA 4ND2A 3PVSA 1VQMI 4FBLA 4RO0A 1E2NA 1KDTA 4Q7KA 4PCAA 4TN5A 4KICA 1Y7IA 1E69A 2V74B 1SMTA 3AXSA 4P92A 2JB9A 2HRBA 3GEHA 2OBLA 4CLHA 4DDHA 1KJQA 4HZFA 3QHQA 4Q3LA 2VKEA 2DK8A 5CRIA 1GLVA 2VQCA 5FPKA 1FIPA 3MJVA 1G55A 2VT7A 1KI3A 2ZIUB 3RSZA 4ER5A 4WBSA 1PWXA 3ZCPA 2W42A 3GOHA 4M4SA 5FTJA 1LVHA 1X92A 2AUMA 2J6BA 4XUGB 3F5QA 3S81A 1JTVA 1UOPA 2BFFA 1GCIA 4Q4LA 4MS3B 1Q74A 1UINA 4FYMA 4S24A 3ZXSA 4UMEA 4C29A 1AIPA 4E6PA 5K0EA 4HB4A 3JTMA 2YXNA 3UHOA 3D02A 4MTEA 2JJ1D 4G4SO 2H94A 4J75A 1IIRA 4LRWA 1TYCA 3FDYA 2RGEA 5B1IA 4CQMD 3FPKA 4PFKA 1NH3A 1A5BB 1YRAA 2CXNA 4Q0MA 3LSRA 1BYUA 4ZVRA 2PV7A 4F86A 3X1JA 1KZYC 3GPCA 4PTLA 2Y3IA 3NJ8A 3O9MA 4KA4A 1YDMA 3WJAA 4GX5A 1CUAA 4IEJA 2OCBA 4BECA 3HZHA 3IHWA 3DBRB 3OZBA 3WLMA 4AS3A 3TMYA 2GFHA 1XQ1A 4NHEA 2HGSA 4QARA 4CLXA 4B83A 1ESNA 3UHFA 4ZREA 4DZTA 5JD6A 5KNBD 5TRTA 3V1TC 2ZI6A 5IHPA 2V8OA 3EF1A 4C4OA 2XAFA 2XMRA 5EQFA 1HOXA 1Y4DE 1I14A 3R44A 2JFHA 1SOMA 3BSWA 3MMZA 2YWXA 2WAEA 1TPYA 4D5EA 4KQJA 1RLMA 5DO9A 3AH8A 4BNVA 2AG5A 1JSLA 1VP3A 4QJIA 1W9HA 3OYJA 5L3ZA 5KYNA 3ML1A 4XJTA 2OHIA 1C0PA 4FFLA 3I5UA 2JI9A 3EZ6A 1OHHA 1M1NA 2FCRA 4FOLA 3RWMB 3TZKA