3WGIA

Crystal structure of rsp in complex with beta-nad+ and operator dna
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
217
structure length
217
Chain Sequence
KTIVSMAVIRRLPRYHRYLEELLKNDVKRISSRELSEKMGVTASQIRQDLNNFGGFGQQGYGYNVEELYNNLTKILGLDKTYNTIIIGAGNLGQAIANYTSFEKSGFNLKGIFDINPRLFGLKIRDVEVMDVETVEDFIARNKIDIGILCIPKDNAQYTADRLVRAGIKAIWNFLPIDLKVPDDVILENVHLSDSLFTVSYRLNEEELFKKLKGETA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords Redox-sensing transcriptional repressor rex
publication title Distinct structural features of Rex-family repressors to sense redox levels in anaerobes and aerobes
doi rcsb
source organism Thermoanaerobacter ethanolicus
total genus 69
structure length 217
sequence length 217
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02629 CoA_binding CoA binding domain
A PF06971 Put_DNA-bind_N Putative DNA-binding protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wgiA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wgiA02
3L00A 4Y17A 3A28A 3NT4A 4GMFA 3GHHA 1KYZA 3WOHA 3ZHBA 1IN6A 4XSZF 3SVTA 1CDOA 3AM3A 3D4NA 3L9XA 4IS3A 2BFMA 3OJOA 3CO7C 1QZZA 1JW9B 1G1AA 1ZJZA 5G0SA 5IFLA 1DC6A 3PZRA 2I3AA 2QYOA 1B26A 1TT5B 4HAMA 4BNJA 4DMMA 4IPAA 1Z82A 3ROUA 4QTZA 1U6GA 1ULUA 1ZO8A 2EHDA 3BHMA 3LU1A 4KMUX 3P2YA 2VONA 1FWZA 2Q45A 1MG0A 2VHYA 1Y81A 1HXHA 4BNMA 3NYWA 3SXYA 1F17A 5F21A 1UUFA 4WUVA 1HE4A 4B4UA 1T0FA 4Y15A 3E6AA 3I4CA 1G6NA 2K27A 2UXNA 3BTOA 3D5LA 5CFZA 4RZIA 3CMMA 5EIOA 2BELA 4HP8A 4K9DA 3BJ6A 5LGNA 1YWGO 4DPKA 4GCVA 4A12A 1BTOA 2OP0A 3DBLA 1UDCA 4UULA 1FXSA 5BNTA 5CDGA 3DPLC 3MQ0A 1G3SA 4J90A 4YRAA 1LRJA 4NG5A 2VHXA 1A7AA 2EXXA 3JQAB 4DA9A 1K2WA 1BG6A 3GZNB 4AJIA 2RQPA 1LA2A 1NWCA 4IJWA 3ABIA 2AEJA 3JSOA 4RV9A 2E82A 5K9ZA 2PZMA 4Y6SA 5CEJA 1PR3A 3MOGA 2P4WA 1J5YA 3F8MA 1PJBA 1EK5A 2HR3A 1N9GB 2H1SA 2PR2A 3B1KA 4G2NA 1DUXC 4C7JA 1IOLA 2G7UA 2C29D 3WQRA 4WXCA 3AI2A 3I6QA 4MKZA 5C37A 1LUAA 3WFIA 1GADO 3RQSA 2Q2VA 3AFNA 5L4LA 4CLOB 4ZYHA 2NNYA 2DQLA 5BNFA 4TRNA 4GXOA 1BC8C 5L3BA 1GPJA 3AJRA 2KIFA 1SBYA 2FOIA 1YQGA 3AM5A 3E6MA 4M72A 4YJHB 4DIFA 2X0IA 2JD0A 5EPOA 3ABUA 3RBXA 2GN6A 3VZSA 5K5OA 4E2ZA 1KU9A 2JFGA 5ES3A 4AJ2A 1P0FA 2OZPA 1HT0A 2GXBA 1YGYA 5JLAA 3KO8A 4ZHSA 3HTUA 3CIFA 1GD1O 4BO0A 1SAXA 3GVAA 2VOOA 4W6ZA 2QENA 1O7LA 3I53A 2A4KA 3GAFA 4M1QA 3ZNOA 5HDGA 2RBEA 4YTEA 4CMHA 3F6OA 2PQ8A 5B37A 1J59A 3CE6A 1ON2A 3TOZA 4BHTA 3F6VA 1KQ8A 1MA0A 2DPGA 2Y0EA 3B73A 4PLYA 3CDHA 3T8TA 3GXOA 4CR6A 3TOBA 2VOPA 2WD7A 3COSA 3E3VA 2O3SA 1K6OA 4KQWA 4XQEA 4AJPA 4AJHA 2Q2EA 4B8XA 3I54A 1LQ1A 1U3VA 3RTRA 1R37A 2W2KA 2YQ5A 4OO3A 2GNAA 1CF2O 3E6CC 1QORA 1ISHA 6LDHA 5T64A 4IY1A 4CUKA 1YOVB 4CR7A 4MVJD 2Z95A 1H2HA 4ZZLA 1TBXA 4PZJA 3JQBC 3EW7A 4ZICA 3RFVA 5IT9K 2OZ6A 3K6JA 3MJSA 3ZU5A 1S7OA 4JIGA 4MIEA 3RKWA 4NNJA 4ZQFA 3JQGA 3IWZA 3OBBA 4JQCA 2NYXA 2GUGA 2HO5A 1OPCA 2VYVD 4J43A 4NIMA 3DOOA 1A27A 3S2GA 4CQMA 4CMGA 1B3RA 3ZMDA 1NHGA 2HK9A 1DFIA 4L18B 4GKBA 4J1SA 2C5EA 3ASUA 5A5EA 4JGBA 1YQAA 2ZTVA 4IRGA 1K7AA 4S1VA 1N5DA 1EZ4A 5H20A 4GVXA 1ID1A 3ZH2A 1GTMA 2FSWA 2LF8A 4Q4ZF 3L2CA 2PJPA 2GASA 4IUYA 3TKYA 1NNUA 3ROPA 3QU3A 3SJ7A 3FMSA 3DZHA 5L51A 2BMAA 2BRUA 3OJEA 4KTTE 4QFCA 3WQQA 1I1GA 2YV2A 2AHRA 3FBTA 2XGXA 3VEPA 1HBXG 1AN9A 3FNFA 1DLJA 4F3YA 3LZ6A 2Q1WA 3HSFA 1OBFO 1RM0A 2PMHA 4R1HA 3V4GA 2G9WA 4TV7A 1UP6A 4NHJA 3KP6A 1WSUA 2IP2A 1UP4A 3IS3A 5IZCA 1MFZA 3R6DA 1NQTA 4R1UA 1U5TA 3NGLA 3GVHA 2C7GA 3GN2A 2QRKA 1PJ2A 4ND4A 4XR9A 2F2EA 3DQVC 3JQGB 2WTBA 3U09A 4M89A 5EJ2A 2DK5A 1YL6A 2W90A 2HSDA 5CEEA 3WSWA 2KIMA 3DV8A 2DAOA 3GZ6A 4MOWA 2M45A 1AHIA 2QIOA 4FJ2A 3KSDO 3KETA 3ECOA 3VTFA 4UXNA 1JVBA 2YZ7A 3CO6C 1YVEI 5FB2A 1N7GA 2DBRA 4XRRA 3WU1B 4PZEA 2GXGA 5CVVA 3C7CB 5HS8A 1C0IA 4P55A 3GVIA 4KMSA 1LXCA 4BKQA 4DBZA 2IW5A 1MP0A 3FPCA 3GEZA 2NACA 3K9TA 3P9CA 2Q1TA 4AJLA 4DVJA 1M75A 3F22A 2LF7A 1HDZA 4M55A 3K1PA 4X54A 5DP1A 1PUEE 3IUSA 4CMBA 3RKXA 3SQNA 1UDBA 4U0YA 3GUYA 2Y0MA 4LMYA 1XSXA 1VTNC 2V1UA 4NMHA 2VRBA 4PRKA 3WNVA 4BGVA 2P9CA 4J0FA 3I3OA 3LDHA 4CM8A 1XB4A 1HKTA 4GL4A 2YQ4A 5HWSA 4LLLA 3SLGA 1ADCA 2D5CA 2P4HX 5CLSA 4ALKA 4BNYA 1T38A 1RJWA 4N0BA 5TT1A 3BWGA 1NPTO 2DPDA 3I5MA 1AGNA 2GD1O 4OYRA 2CNBA 1LDKB 2YHIB 1HE3A 4NHEA 4BL5A 4QO7A 3I71A 1Y9AA 1JQBA 2BEOA 3J81Z 4GO1A 2DUWA 2I6TA 1QO0D 3UCFA 5K6AA 1I0ZA 4FBGA 4DQXA 1LQTA 1BWSA 2EKPA 3BMCA 3K31A 4BHCA 5HLHA 4HNHA 2FBIA 3H5AA 1LB2A 3PJFA 4PLVA 4Q3NA 3ZHYA 1KVTA 1VJTA 1V3VA 4A03A 2AG8A 4B4VA 4CLRB 1ZYRF 3CUKA 4IDGA 4A2CA 2NVWA 4CUJA 2AQIA 2DTDA 1R0SA 3H7AA 1JHFA 4J7XA 4D42A 4YFNF 4JXKA 3H6KA 5K5RA 2EP5A 3JQ8A 1GR0A 4O1MA 3JQDA 4A27A 4EV0A 1JKJA 2VUUA 2J8ZA 4MEXF 1A72A 3PI7A 2Y0DA 4IJKA 2IEBA 1HSOA 1ZUD1 2C07A 2PMUA 1LU9A 1SEVA 2FPIA 3PHLA 2FMLA 4L9VA 5K1YA 4HUJA 4YJGB 3V1TC 4BB6A 1BC7C 3FF5A 1SB8A 3M8FA 3F3XA 3P7NA 1PZGA 3E5QA 3GMDA 1PQPA 3WTWC 3BMOA 3QWHA 1ISJA 2PKQO 2UAGA 1LSOA 3GMSA 3O26A 5TT0A 4CMEC 3S2EA 4J9UE 1CWUA 4NZ9A 3WGGA 1I24A 4BV8A 4H16A 5AVOA 2CVOA 4HQMA 4WASA 2X58A 3DHEA 4LISA 5D6FA 1SMKA 4LK1F 1YB1A 4PLTA 4OOFA 4GWKA 4HF0A 4IJUA 3QHAA 1XR3A 3ECHA 3WTYC 2Y68A 5T8KC 1A4IA 3HSEA 4ZYEA 4LMPA 1XELA 2WYVA 1U4SA 3S2WA 3GPIA 2GSDA 4HKTA 4W7IA 2Y67A 3VH2A 4I2OA 4FN4A 3OF2A 1WZEA 4UV9A 1UXHA 3P2OA 4RPLA 3KCCA 5DEQA 4A5MA 5IT9Z 1NR7A 2NLOA 3PPIA 1DHRA 3FXQA 4AWXB 4J7UA 1YO5C 4K2EA 2DLDA 5D5XB 2PGLA 2PH5A 1EH7A 1GQ2A 4EGZA 4AJJA 1A9YA 1YRLA 1XEAA 4RPKA 3V2HA 3HRTA 3TGNA 1GXQA 2FR1A 1E3EA 1IN5A 2O3TA 1RNLA 3JCZA 4DLAA 4OIMA 3DHNA 3GEMA 3VZPA 2EW8A 4GKVA 5ERIA 3GK3A 3KZZA 3OFSA 3SBOA 3FZVA 3EYIA 1BSVA 2IPQX 5E8IA 3LVFO 3WTCA 4MO2A 3QU6A 4YIIA 1B9NA 4S05A 2UUOA 1EVJA 4PIVA 3NDJA 4BMSA 2YU3A 4P9UA 1ZRFA 1DIRA 3A4VA 3DONA 2PV7A 1NXQA 3UW3A 1P74A 4BO2A 2VWQA 4A2UA 4AL4A 1S3JA 1AXEA 3OQ1A 4ON0A 4CR8A 4RPGA 2Q0OA 5L9AA 3B02A 1KERA 5CJ9A 1FYLA 2HYFA 4I7HA 1HETA 3S1LA 2YJZA 4LG0A 2FF4A 1KVSA 1R0LA 4OHUA 2D1VA 4RDIA 2PZLA 1PJ3A 5IN5A 1QLHA 2O2YA 4BO7A 4ENMA 2XUBA 1OC2A 1R22A 2M87A 1W73A 2PZKA 5THQA 1K5HA 1EFKA 3PFIA 4KDPA 1UDAA 4NJMB 4XDZA 5JC1A 3WTVC 4ND3A 5TNXA 4CMAA 4G6DA 1XU9A 3RI3A 2LSOA 1J9IA 5HTOA 2FEZA 3G1TA 1W7PD 2HEOA 2O23A 4CV1A 4MP8A 3O03A 2GF2A 1H6BA 4XYEA 4RVHA 3M2PA 1TLTA 4ONEA 3P7MA 4Q48A 3ZWVA 1YG2A 4I5EA 2G17A 2QM3A 4BV9A 1WKMA 4XGIA 4HV5A 1LDDA 4WKGA 4ZVVA 1DJNA 1ENZA 1I3MA 3JQBA 5A9SB 4DPMA 3CZMA 2GDZA 4RGXA 1TT7A 1ZEMA 3LC2O 1P4XA 3I1JA 3PVZA 4KOAA 4GX2A 4KUHA 4DLBA 1PR9A 5D8KB 1D3YA 4YFKF 3UAGA 1GV0A 1LLUA 3I83A 5TF4A 5JY1A 2GZ3A 4N18A 2H63A 5DT9A 4E2YA 1I2BA 4I0AA 1ZMOA 5JO9A 1MB4A 2OORA 3OA0A 3I5UA 4XZ3A 3LAJA 2W84A 1P31A 1M6WA 5F5NA 3C1TA 3S8MA 3DZJA 4E70A 3GQVA 2YY7A 1X0VA 5TGDA 3BTSA 4DXHA 4LB6B 4CQLB 3PYMA 3TZQA 1P1KA 2W98A 4PG8A 4E5PA 1ZN2A 3ZMUA 2L4MA 2PLAA 2X9GA 3H2SA 4JJGA 1GY8A 1NFFA 2P9GA 3LT4A 5AOVA 3AM4A 3QVTA 5JCJD 4CMIB 1LDBA 3VTZA 5CVRA 3ZN1A 4UUVA 3MWEB 5D5WB 1CGPA 4J2HA 4P4GA 3WXBA 2IZZA 3U1DA 2C6YA 2JAHA 3G3EA 1R66A 2I99A 4KWIA 1S6LA 1S29A 3LT0A 3ORFA 4L75A 1PQWA 2TDXA 3ZV5A 1U8XX 2Z3YA 3QV1A 2DUUA 3V2GA 5JSFA 2G76A 4KA4A 1UXKA 3MJTA 3L9WA 4TMFA 1IXRC 2WSBA 3JD0A 2RKHA 1LLQA 1H93A 1Q1HA 3E9QA 1B8UA 3VDRA 4YJFA 2PZJA 2UXXA 3ZWOA 2X6TA 5HDNA 1FYMA 4NFSA 4IPTA 4D7AA 3RPUA 1ZK3A 2XROA 3LWFA 2P91A 2G82A 4B7XA 4ZRNA 4IZIA 4YYZA 4UVIA 4CJXA 2Q3EA 2XAGA 4OKNA 4Y6PA 4A6DA 1M67A 1WDMA 2H5LA 5F1KA 1JDJA 3CKYA 3O4RA 4YAKA 1DOHA 5TJ9A 5I7VA 4UUOA 3ZMZA 1AUPA 3M6IA 2AXLA 4RVFA 1X7HA 2C2YA 3DBRB 3ZWXA 1T24A 1H6AA 1OOEA 3ZDFA 1D3AA 2V7PA 1N7HA 4XQCA 4IDBA 2J3IA 2FBHA 1R00A 4JJIA 4BNTA 4EW6A 2GIVA 3R0JA 2HFHA 5D6EA 1P3DA 4AVYA 1U1IA 3WYEA 4BNXA 4G94A 1S8NA 4HV4A 2ACJA 2IT0A 2VNSA 3GDFA 4YAJA 5AXBA 5GY7A 5JXWA 1V3UA 4OH1A 1V6AA 5FF9A 3COAC 3I23A 1TW3A 4IDAA 1W5SA 1WAMA 4KWHA 3H8VA 4WPGA 2ZO4A 4A0SA 4WLFA 2DI3A 2OU2A 3NJ8A 2OHXA 2VZ9A 2I65A 4PLHA 1Z7EA 3BMQB 5L3ZA 3JQ7A 2XRNA 3DAFA 1A04A 2OP1A 4QSMA 2CY0A 3BZ6A 2NSDA 3AU9A 3FM3A 4IDDA 3IRRA 4KQXA 5CG1A 4DPLA 4U6SA 1GZ4A 5HLGA 5DD8A 2CF6A 4UEKA 3ANMA 3QP9A 2K02A 3LA3A 5BPDA 1KQ9A 1DBVO 1X13A 1ZSNA 2C2XA 3E48A 3Q1LA 1PJTA 3ANNA 4FPXA 1O94A 2P6TA 4AIJA 4QQRA 4ZQBA 2OUIA 4A6EA 3H5RA 4BNWA 2EV6A 5B4TA 2X23A 4UAGA 4DYDA 4NBTA 3W8FA 3M1LA 4NFHA 1NHWA 3KLMX 3GFGA 4WLEA 3KYDB 1A9ZA 2AQ8A 1I33A 3DBHA 1P4WA 4H7PA 2WTEA 1RPNA 1EVYA 1VSVA 1U3TA 1X7GA 3SZPA 3J7AO 1LX6A 1Y5MA 4CMEA 1E7MA 1FC3A 1E3SA 4AG3A 1W0CA 4N5LA 2XASA 1HSTA 3MTJA 4J1TA 1PEDA 3H5NA 5AONA 4ZQGA 1SNYA 5DZSA 1YL7A 1I2ZA 2B4TO 2CW0F 4HQEA 1WMAA 1MC4A 2LKPA 2PA3A 2Y1CA 4BHPA 5IT3A 2Q46A 5T8KA 5HS6A 4J1NA 4J4TA 3ZHXA 1FPQA 1XCBA 4IHSA 4ZA2A 5D5VB 2YPRA 2Y1FA 4ALIA 4DL9A 4IVNA 1W7PB 1GPDG 3L6OO 1G4DA 2OFPA 2QG4A 2FXAA 4OQYA 4XYLA 2YW9A 1F8GA 2MD5A 3ENKA 5COQA 3PTZA 2ZJ2A 5DCMB 2QHXA 3JYPA 1LRKA 2GN4A 3HOSA 3ROMA 1TTYA 1P1HA 3GVPA 5I9LA 1UR5A 3T8RA 2FSVA 5JAQA 4EM0B 1T98A 1XCVA 2VODA 2VHZA 1WI9A 5JPIA 3TL3A 3J80K 3CMCO 3ZU2A 4BNKA 2VN2A 2VBYA 3C1DA 3EETA 3VODA 4EJTA 4DUPA 3QJ5A 5GMOA 5T5QA 3GT0A 2JKVA 2BGKA 5KVCA 3KP7A 4RQTA 4UVCA 3V7RA 4LD5A 4LLGF 2JCVA 4JBAA 2TMGA 3OJ0A 2FHSA 2DBZA 4P5OA 1U28A 4L76A 4I01A 3QE3A 1F4KA 3GRKA 4G7HF 2STTA 1ISIA 5JDIA 3ZWNA 4FFMA 1OYIA 3V2UA 4E30A 1VM6A 1FT9A 4IRHA 2ZTUA 2Y05A 1P92A 3DL2A 1DRVA 2F5CA 3GUDA 1PL7A 2OBNA 5KK1A 2QBYB 4B3IA 5DBFA 1M66A 2HCTA 1SC6A 4FC7A 2JFFA 4MHGA 3GVXA 3JV7A 4TROA 4YIFA 2DFDA 3OQ6A 1R23A 2XAJA 1BIAA 2QW8A 1B7GO 4K26A 2WV0A 1LBEA 4KFCA 3PIDA 3RC7A 3RPQA 4CM7A 2QUFA 3TOXA 2D5AA 2Q99A 3DOJA 1UHWA 5IN4A 4XBFA 1HDYA 3O8QA 3VH3A 4RB1A 2BFAA 2DPHA 3NX4A 4HFNA 2FE3A 3QOPA 1C0WA 3M1AA 5KKCA 3WX0A 1IRFA 2VCYA 1E7SA 1HLDA 4OOIA 3HFGA 4R8HA 1OYWA 1MZBA 1OR7A 5BSHA 1BXGB 2AA3A 2ZQZA 3A06A 3LK7A 2OQRA 5D8LB 1U78A 2Y1GA 2Q49A 2VC0A 3G3ZA 2PD6A 3AUUA 3EVNA 3IJPA 4UREA 4HX7A 1GVJA 4EM1A 4N54A 4NPCA 3I9OA 3QWFA 1PJLA 2AW5A 4R79A 3ENNA 3RBZA 2BI7A 1KYWA 4KYWA 3HDQA 2DLLA 5KOIA 4AJKA 4KTVE 5H6QA 1ZK0A 3FR8A 3NUGA 2VE9A 3JAMK 4Q9NA 3HHPA 5A9RA 3SC6A 1F06A 3KYCA 1M2WA 4GH5A 2V6CA 1FZPB 4R3WA 1Z05A 4KZPA 1XG5A 4E33A 3O8QB 1S7CA 4HDUA 3WODF 4UEJA 5DN9A 1CETA 1KC1A 5BOXA 1XLTA 3U4IA 1B6AA 1YS6A 1DC4A 5C7IO 2GN9A 4MVJG 3K92A 2QQ9A 3QQPA 4PLWA 2L02A 2JL1A 4BKPA 4M73A 4DQ2A 3T4XA 1RI7A 3IHUA 2NM0A 3PDJA 1O9BA 4KNYA 1BW9B 3D1LA 3KHUA 3ZI0A 4WOKA 2ET6A 4WGGA 1U7HA 5DNAA 5EMHA 4YB8A 2LDUA 4B79A 3GN1A 3STHA 4FQ8A 1XGKA 4F6LA 3EHEA 1WDLA 3FRJA 1HW1A 1ENOA 2EP7A 4XB1A 3G79A 3U3XA 4RL6A 1CQJA 1FP2A 2VT2A 2JPCA 2MLKA 1ZFNA 1P2FA 2EB7A 4LGWA 3GFJA 1KEPA 1QMGA 2E6UX 2EJVA 5BSEA 3OOPA 5JAMA 1E3WB 1HQCA 4XSXF 2ILTA 1W6UA 2HZTA 1DPRA 4YRBA 3W8EA 3WSVA 4E0BA 2AQHA 5JVTA 4Z0HO 2OGUA 2H09A 3RC1A 2X1HA 1MD0A 2HGCA 1FJHA 1KEWA 3L6EA 1OMOA 4JROA 3WGZA 3V1YA 1JAXA 1YE3A 3LQFA 4EEZA 1Q7BA 1IHXA 1B8PA 4QLCU 4MQ9F 2EWNA 2MBFA 1ZGJA 2VC1A 3RYPA 2VQ3A 5G4KB 5F6FA 2F5EA 4P4LA 1TQIA 4HWKA 2KRFA 3E5XA 1I3NA 3ICCA 4W7HA 1UCRA 2CYYA 3AOGA 2MH9A 3ROKA 4HA8A 1ZH5A 3HHHA 4G65A 4XGNA 3WWZA 3ZWWA 2O48X 3DFUA 4ENNA 4CMCA 2VUSA 3H65A 1K89A 3H9EO 4JX8A 1ZG5A 1CQIA 1ZW1A 1H6DA 3PQEA 4UUNA 1UP7A 1ZH8A 4ZQHA 1PP7U 3RU7A 3JQAA 3R6SA 3DMTC 4XRGA 3ZWCA 3OIFA 1ORRA 2R00C 3J80Z 4MVJF 3I4FA 2W2LA 3GZNA 4BO9A 5J23A 2NADA 3GAZA 1VJ1A 4JN6B 3TNLA 3TZKA 4NU6A 4D3FA 1MFPA 2VN8A 1ZAOA 1PZEA 5F3RA 3SEFA 3PFWO 3LYLA 2QLZA 1QYCA 2QVOA 3IJRA 3JD4A 3U5TA 3EDMA 3WTBA 2XKPA 1N9GA 4PCQA 1HE2A 2WJPA 1KGSA 4DMLA 1IUKA 1GUZA 2VUTA 3WLFA 2RNJA 2ELHA 4U0WA 4MTEA 2ETHA 5DP2A 4CM4A 3LSTA 1GCUA 3HFSA 3H3JA 3TWOA 4R1NA 2H6BA 2FPGA 1BI2A 3F8BA 2P4QA 4CLOA 5GZ3A 4KN4X 5JC8A 1WZIA 4L73A 4F45A 5DCWA 2QZZA 1GHCA 2PH3A 2XHKA 3ZP5A 4YJHA 3L07A 3KBOA 1Y1PA 4URFA 5E20A 4CGZA 2O3FA 1EE2A 5FLXK 3HB5X 3K1MA 1EBFA 1PWXA 3F8FA 3IRQA 4YT8A 3F23A 1W4ZA 1TNTA 3VB2A 3ZN0A 1LC0A 3BMQA 1J6UA 1I3KA 2Z9OA 1NVMB 4F46A 2QX7A 3WTTC 1PWZA 4IS2A 6PAXA 4WLOA 3RJ9A 3HJAA 1Z6RA 4D3SA 3PIIA 3O3KA 3P9IA 1FDUA 1HWYA 2FR0A 2VOJA 5TX7A 1TQMA 3ADPA 4II2A 5HS4A 2BYVE 2DPUA 4S3MA 3TF5A 1VSUA 1TEHA 4IXAA 2YFHA 1G3YA 5CVIA 1M6HA 4CM4B 4KP7A 2HQRA 3H9QA 3GGGA 4CL3A 4TVBA 1EUDA 3HN7A 4L0QA 4YVFA 4CMKA 5KTKA 2ZCWA 1TA4A 4IF4A 2P5VA 4PDKA 3CPSA 2G0TA 1IZ1A 1NBOA 5FYDA 2IEDA 1VL0A 3FWNA 1O57A 3PWZA 4LSMA 5IDYA 3SLKA 4EJ0A 5JI6A 4YWJA 1YOVA 1GYRA 3KFWX 3I59B 1E6EA 3QP5A 1PGOA 2JRTA 2R3SA 4KIGA 3SHFA 3EK2A 4Z3KA 3JAMZ 1MGTA 3AAFA 3IKVA 3B20A 1R58A 2GR9A 2JD1A 3AFMA 4MVJP 4UNOA 2FA5A 3KVOA 3Q9NA 3T1BA 1HW5A 1HE5A 5AIQA 4ZYDA 1RIOH 1NPDA 4B4OA 4IQGA 5DBIA 5HLIA 1U2DA 4ESOA 5A5FA 5JYDA 4GSKA 3IC7A 4Z9XA 5F64A 3TO6A 4AJOA 1OZAA 2QWWA 2JZYA 3JQ6A 1VC2A 2WMDA 4I9UA 2STWA 3F1LA 2ZKZA 3R61A 2YSRA 1TNSA 2FRDA 2JHFA 5KJCA 2FNAA 3PJDA 4BMVA 5C3MA 1B16A 1YYVA 3HDHA 5ITVA 4JP2A 5TSDA 4DIBA 3MJVA 4AIKA 2NWQA 2GQQA 2RGVA 2O61A 3GEGA 5ER9A 4AFNA 3VVBA 2HQ1A 1LI4A 1R1TA 4J4BA 3JSPA 4EM2A 1SEPA 4ALLA 4EYEA 3BTVA 1XWFA 3QP6A 4CXFA 5MGBA 2P5KA 4BOYA 1YL5A 1XMKA 4IDEA 3GDGA 4L5IA 3VPFA 3G49A 2EF1A 3A1NA 5A1TA 2W24A 2VT3A 4RB0A 1K78B 2CGPA 1X1EA 1XYGA 2EGHA 3K96A 3DB2A 1ONOA 4EVIA 2E1NA 1DEHA 1DHTA 2NU6A 3PHIA 2R6JA 1J0RA 1OKRA 2FBKA 4HX5A 4XB2A 2EEZA 3Q9SA 2PY6A 1ZRCA 2PGDA 3GX4X 1NASA 2DAPA 2Y1EA 3KEOA 1IY8A 4FGWA 1AE1A 1KQ0A 5HDKA 5I9NA 4IBOA 3H92A 5L3DA 5H83A 3GVCA 3VFZA 2BGCA 2AQKA 2AXQA 1DFHA 1NVTA 5FO5A 2FWMX 2EW2A 2E7XA 4IDFA 5DUKA 3RDIA 1IUYA 2WM3A 3RASA 2RC4A 5ICSA 1R4MB 3KP5A 3OQBA 3INRA 3FR7A 3F8NA 3IAHA 2GLXA 4ZYGA 4DQVA 4R1TA 2Z1NA 1LLCA 3WYBA 4JNKA 4WNIA 2D2WA 5E18F 1QQIA 4IQ8A 4PZCA 3RUCA 5G0VA 1GL3A 5DYMA 1Q0HA 1YFHA 3DQPA 1ON1A 2DU9A 3L7WA 5J8FA 4MTDA 2ZCUA 5ICEA 5F1OA 5TC4A 4MGRA 1GCOA 4LCEA 4IMRA 1YJQA 3I9MA 1W5TA 4ENKA 3RKUA 3UCEA 4GPD1 1FY7A 1FLIA 1RYEA 3IKTA 3V8KA 2QZ8A 2BV6A 3MZYA 1NAHA 3BMNB 4B09A 2HMWA 3IOYA 2YHIA 4BB5A 4UUPA 1BI1A 4OMZA 3VOEA 4O5OA 4AJNA 4BQPA 4YG2F 1GYPA 1SB9A 3RUDA 3HQ4O 5DCYA 1VKOA 4LB5A 1NQAO 1P1IA 4Y13A 4ND1A 4WK6A 3F9IA 3EUHA 2BH9A 4CLRA 4E6PA 1I1SA 4PRLA 3FNEA 5ILVA 1T1SA 3DC2A 4R5HA 2DBBA 2VZ8A 2JCXA 1AOYA 2RIRA 3VPSA 3KV3O 2UWMA 3U9LA 3ZW8A 1SCUA 4NR0A 3WLEA 5B1YA 3KOUA 3HE3A 1E7QA 3OECA 4YCAA 4NQZA 4B7UA 5FLXZ 3H2ZA 3ONEA 2NTVA 2Q1UA 1D8AA 4Y6RA 3WGTA 4CLHA 3PLNA 5AXDA 5KJ1A 1NX6A 3WE3A 2AE1A 2Y75A 4J6FA 2LDXA 2FP4A 4WXDA 4YJGA 3ZZNA 3W8DA 2DBQA 4FC6A 3FTPA 2VRCD 1QYDA 3F72A 3M2TA 2PLYA 3FM5A 3PWSA 5I7FA 2B83A 4AJ4A 4YAGA 2SCUA 1GQYA 2Y1OA 5AQ1A 1YXMA 1N1GA 4YXFA 5C7OO 2Q8KA 2UYYA 2HKIA 2VZ0A 1B4AA 2ZYDA 4BO1A 4BNHA 4GGGA 2D1YA 4G81A 1UAGA 1IZ9A 3O9ZA 2V6FA 5L3GA 3Q2IA 1QRRA 1SO8A 1XGSA 3RYRA 3DMTA 4EI2A 1ZCJA 5IJZA 3WU0A 2R00A 9LDBA 1LEHA 1NR1A 1BXKA 3D3WB 2MLGA 3WB9A 4EJOA 4OMYA 1HTBA 4EITA 4P4NA 1D8JA 1Y8QB 2X5JO 2MH2A 2PTGA 1EDOA 3SC4A 1F12A 5BNIA 2DTRA 5I8ZA 4OINF 3KE2A 4MQVA 1YBAA 4MVJA 3E5UA 2P68A 2PGJA 2HS5A 2C5AA 1GQQA 2PFGA 1UJMA 5DBGA 1PSDA 1M76A 1R5HA 5JHUA 1E7WA 2UV8A 3CLOA 3HNPA 4MJLA 4YR9A 4BYYA 3WFJA 2D45A 2VYVA 3GC6A 2J6IA 3MEQA 4RLSA 4BNVA 1EQUA 1YLFA 4TRRA 2PKRA 1ZXLA 2HAEA 5A05A 4BO5A 5K0ZA 1ADFA 4Z6KA 2ZB7A 1XGMA 1N8KA 1ARZA 2GCGA 3L77A 1E6WA 2ZB4A 4DRYA 1WNTA 3HHGA 2RAFA 5HVQC 3DOCA 4BH9A 4HDVA 4EUHA 1FBUA 2FU4A 1O5IA 2K86A 4BKRA 5LCXA 4GSLA 2L01A 1QXSA 1SFXA 4Z2YA 3QVOA 4OOEA 1B3BA 3WS7A 4CLEA 2EK5A 4IJVA 3GDOA 3I9NA 3ROQA 1J2XA 3K2EA 3WE2A 1MUUA 3D0OA 4NJMA 3L6DA 2RHRA 4IIVA 2EFWA 3R3SA 3HRMA 4RQUA 1LJ9A 4PG7A 3CUQB 3GH3A 2GPTA 1ZLJA 4XYGA 3HSKA 3K5PA 3BROA 4M9XA 4Q47A 1IHYA 5JO0A 1ZJYA 2PNFA 4P9FA 2X0NA 1IYZA 3MZ0A 3C7AA 3ONFA 1QP8A 3UHAA 3WGYA 4I09A 1V0JA 1C14A 4RZHA 3ERED 3QIVA 3WJ7A 1ZZEA 5IXSA 1E0DA 3PQDA 4KUGA 4KIBA 4JQFA 1KS9A 4GYGA 1AHHA 1U8FO 3W4JA 4XYMA 3FNHA 3W6UA 5A9SA 1F1ZA 2ESHA 1E77A 3F5QA 3LAPA 3TL2A 1U5AA 3TDZC 5AIPA 2PD3A 2ZQYA 3MWDB 1SD4A 5LGUA 3GHYA 4U6QA 1YO6A 1YONA 3I0TA 1ADGA 5DF1A 5JDIC 4JK1X 1HDGO 1ZRDA 2I76A 3HOTA 5FGMA 3TOAA 2V65A 3OIGA 4J49A 3TZCA 3LC7O 1U3WA 3VVCA 1K6JA 3KLPX 3RUAA 4BUCA 1I36A 2WYWA 3AUSA 1EFLA 4GBJA 2J5OA 4LCJA 1JLLA 3B1FA 4XIJA 2VE8A 3IP1A 1G3TA 4KICA 1ZSYA 3F5SA 1B8VA 5DOVA 1G0NA 4H3VA 5EN4A 3W1VA 4R69A 4CQLA 1Z75A 1DRWA 5A3VA 1PGPA 3R4KA 1T2KA 1C3VA 1EE9A 1PS8A 2A35A 1LSUA 3VKUA 1K0UA 2POQX 4CMIA 2PWZA 3WJAA 3QRWA 1NYTA 2H6CA 4M87A 4K6FA 4UEOA 5E17F 2OO5A 3KRTA 2EJRA 2V1DA 3E5RA 3GYHX 3GEDA 1TI7A 2QYSA 5DV5A 5FFXA 2XKOA 3KM0A 5BQTA 2V6GA 4S04A 5KVRA 5CEFA 2X4HA 2PK3A 1ZHFA 2HOEA 1JU9A 4JCOA 3WBBA 2MA3A 1PGNA 4ZRMA 3BAZA 1Z45A 1FX7A 3FXUA 1BI0A 2HU2A 3MTGA 3OICA 5JS6A 5L95A 3K8ZA 1LDNA 2F1KA 4EJMA 5KVVA 5LC1A 2VYND 3ZWMA 2WYUA 1H0KA 4WF2A 4GVLA 3TO7A 1SMYF 1DSSG 1TXGA 1USTA 5LHHA 3HADA 3HN2A 3N97A 4RF4A 2KJBA 2Q4BA 4EJ6A 2ZKLA 1USSA 5BS6A 2C59A 3PHJA 4JLWA 4PZDA 1HZZA 4W82A 5CHEA 5FFZA 4EMSA 1LRLA 2IZ1A 2EJWA 3DBRA 3LC1O 5L53A 2B0LA 1RUOA 1NPYA 3KSZO 5I7EA 4FB5A 4M86A 1DIAA 4Q3DA 2ZK7A 3TFOA 2UVDA 4XDYA 3FMQA 3SXPA 3V8JA 2ZB3A 3RKRA 1P1FA 2X86A 2PD4A 4RLHA 3K2BA 1MG5A 3H3UA 4IRIA 5IZ4A 1JWBB 1T4BA 4GX5A 2GAUA 5C7LO 5BSGA 2QQBA 1RZ4A 1HEUA 1V35A 4I8XA 3MJEA 1KEVA 1QNTA 4NDNE 5G0WA 2FNPA 3ZU3A 3BPXA 1E5QA 4A0YA 1Z91A 1GUYA 2FMUA 3MEXA 3HUGA 2R7DA 1QYXA 2JHGA 4U88A 2NQ8A 3KUXA 4CODB 3I52A 3GOHA 2CG4A 1LC3A 4IM7A 4DQUA 5I8WA 1V8BA 1I5ZA 2V1XA 3R1IA 3X2FA 4RGUA 2IVMA 3F21A 4BNFA 3M1EA 1DLIA 3EMKA 4CM1A 4CYDA 4IXWA 3ZHZA 5TS3A 3IC5A 5ICMA 2W25A 2I3GA 2CDCA 2DT5A 3JW4A 4WCFB 2YUTA 3DZBA 1CERA 3E03A 4M71A 3OH8A 1PJ4A 1GEGA 4GI2A 4LN1A 1JTVA 1ZMTA 4DREA 2EFQA 2BF7A 4RB3C 4EZBA 5U9CA 2ZIZA 4DWVA 3DXFA 1E7YA 5AXCA 3TRIA 3E5MA 3KYDA 1HSZA 1E1NA 2X5KO 1PTJA 1Y6JA 3GGPA 4R01A 5IG2A 1LDGA 3NTRA 4FOSA 1R4NB 2PKQP 4UVGA 5CDTA 4ZH4F 2F5DA 4HFJA 2DC1A 4NBUA 4GMGA 4FT8A 1ENYA 3JQFC 3QVSA 3VDQA 1G6KA 5TRDA 4R1SA 4CHUA 4HOBA 1ZBQA 2OBYA 1ONPA 4YT4A 5F5LA 5CVJA 2J5PA 3H3FA 4K1LA 4A0XA 4Z9YA 3Q9UA 1YQDA 2VTEA 2VWPA 4W9NC 5EQFA 5I9MA 2Z99A 3GFBA 4AJ1A 2VBZA 4DTIA 4OQZA 2EFNA 1W7PA 2BGMA 4EQQA 3T7EA 3R3JA 5JFOA 1YQXA 3N58A 1Y0UA 3E6DA 3I6IA 4L9NA 1WWXA 4HXYA 1BM9A 2F5FA 1K79A 2COMA 4MNUA 1UZLA 3ANLA 4D44A 4EBFA 2HDHA 1BOAA 3U0BA 1E3IA 3KP4A 5K5QA 1T2DA 5DCMA 1UXJA 3FXRA 3R60A 4R9RA 3S55A 3VZRA 4BQRA 1SZJG 4U7BA 2X0JA 4OXYA 4BGUA 1W4MA 1C0PA 4RORA 2GGSA 4CM9D 5BR7A 1DJQA 1U8RA 4YPOA 4JBGA 4OSPA 3V5NA 1UFMA 3UFXA 2DVMA 1T1RA 4IIUA 1BRMA 1Y9EA 3TDKA 3T5XA 4J9VA 1G3WA 3DKWA 2B35A 2YFQA 4QO8A 2VWHA 4WLUA 3ABTA 4CICA 2P9EA 3JTMA 3HSRA 5F1RA 4Q3CA 1P6RA 4KDEA 4PG4A 1XA0A 1KU3A 2OQGA 1TVEA 1QLJA 1BVRA 4TKMA 1XDWA 3KLOA 2IYPA 4XWYA 4U7WA 3BJOA 2Z1MA 1PL6A 4YA6A 5IDXA 3BPVA 3PHGA 5EERA 1RM5A 4HADA 3FSRA 1R15A 5AXAA 4HX4A 4QXMA 3FWEA 1LLDA 2CVQA 3KB6A 3IWFA 5JCXA 1E1LA 1P45A 3FX3A 4U0KA 3RC2A 1Y7TA 1ODDA 4AVPA 2QBYA 1QV7A 2HWVA 3W6ZA 5KJFA 1FBSA 1Z6TA 4OXNA 3NRCA 4L4XA 4U0JA 3UH1A 1YTYA 4D45A 4D79A 1ENPA 4Y8VA 4INAA 4CZZA 3KXDA 3PZBA 1GZ6A 2Q2QA 4J2OA 2JTVA 2D1HA 3E6BA 4U8GA 1HYHA 5T67A 4BO8A 1YS7A 2WC2A 2ZYAA 4OSOA 1XSDA 1IAWA 3DEUA 5G0TA 3S2IA 4BNGA 1QR6A 3RWBA 2BGLA 2BBYA 2X7HA 3PJEA 4O0LA 4HBGA 3E8XA 3INGA 2EV0A 4Q5SF 3IDSA 3CSDA 2NV6A 4L0ZB 2FMYA 2EFPA 2AEFA 4IHTA 1CJCA 1BN5A 3OSUA 3RIHA 4DLLA 3T0YA 2XXBA 1ISFA 4M8SA 3VC7A 4PLZA 2GERA 3OMLA 1U2WA 3QRFF 1BXGA 4XJTA 2NVBA 3F1KA 2O6GE 1UZMA 4BMNA 4D0RA 2QZ9A 3E82A 4HY3A 3UUWA 1I6XA 1YW7A 1P1JA 1LVAA 1WW8A 2P7CB 1KYQA 2X0RA 3QWBA 4WEOA 3MWMA 4OMUA 1DIHA 3RROA 3S2FA 3IIEA 4A0ZA 4UVBA 1NWHA 3HG7A 1Z1DA 3TQHA 5CDSA 2B5WA 3UKOA 4DIOA 3ETGA 2W57A 2EV9A 2XPCA 2C54A 5FD5A 2P5YA 4J0EA 1SD5A 4LK3A 3QVWA 1FMCA 1K6IA 1FNNA 3Q5FA 2NRAC 2PN6A 1ISGA 3ULKA 3OA2A 4BGIA 5COAA 3ON5A 4ILKA 3PLRA 1PS9A 2HYGD 3CTMA 3GWZA 4KUMA 4BQAA 3LSYA 1XN7A 1PL8A 2Y66A 1O3SA 3RUFA 3U4HA 1NQOA 4TWRA 3TSCA 1MDMB 3FPLA 3KTDA 4FFNA 1QGPA 3RBVA 2C20A 4FW8A 1BBYA 2ZTMA 1J7KA 4FX4A 1HW2A 1BW9A 5L4NA 5L7YA 3BDDA 3VH1A 3EGOA 2BE5F 1P0CA 1L7EA 3OEWA 2GA2A 3D64A 5HBRA 2OBPA 2A07F 4I08A 4RDHA 4ASNA 1ZK4A 1HZJA 2VBXA 5B4VA 2O4CA 5KCZA 4MP3A 3CEAA 4BNLA 2E7WA 2A6HF 5LEJA 2HDCA 5ILSA 3C3XA 1I5RA 1E3WA 1J49A 2O4UX 1OC4A 4IZHA 2K4JA 2A3SA 3FD8A 2X8LA 3U49A 4OM8A 4B4WA 3HWRA 1JA9A 2PEXA 2Y48A 5CP8A 4BO3A 4BNNA 3MAJA 4FCCA 2ZXJA 1H6CA 3FWZA 4CV0A 3L0DA 1WPQA 3R0AA 1GEEA 1HYGA 1I32A 4WX9A 3EQLF 4K28A 2IRFG 1WWKA 4A10A 3F3SA 4BO6A 5A9TA 1JHHA 4IMPA 1DAPA 3AY7A 4ESJA 3DHYA 1MKMA 5G4KA 5BQFA 1CYDA 2XAFA 1Y8RB 4GGOA 4R3NA 2VWGA 1H9AA 1C1DB 1ZLKA 5A2QK 1E5LA 5D4SA 2H27A 3CINA 4UUMA 1LNWA 4J1QA 1NP3A 1K3TA 5DOZA 1MJBA 3NJ4A 5KNLA 4E4YA 2WE7A 3FN4A 1QYWA 4E31A 1WDKA 1PJCA 5T6BA 5LRSA 4WECA 3KYBA 3UVEA 4ZJUA 4MIOA 2ZJ1A 1HLPA 1J75A 1Q7CA 3AOEC 4FD3A 3D4OA 3DAGA 3PDUA 4ETSA 4G8XA 4XYBA 2X5OA 4WLNA 5L7WA 4R54A 1I3LA 1E2XA 3K69A 1HRDA 4FDAA 1K6XA 2ISYA 3JD1A 1RYDA 3LF2A 3BZUA 2ZMEB 4NBRA 2BFOA 2PBIA 3C7JA 3ISPA 1UH5A 1WMBA 2A9FA 3F6YA 3K30A 3OJFA 2B36A 5F1PA 3RJ5A 3B6ZA 5AYVA 5U4QA 5DCUA 3ITKA 5JMPA 1NFQA 2FSSA 4LFUA 2D0IA 2NU8A 2O8XA 1HKQA 1H9TA 2B0JA 3ELKA 5H6RA 2H6EA 2WEKA 1YKFA 3IMFA 1MX3A 3DFZA 2VOEA 2I5PO 2J5RA 3MOIA 1GAEO 4BAYA 1LEBA 1JVSA 1DC5A 3AK4A 4DNCA 2ZFWA 4G6QA 1C1XB 1UB9A 3JQFA 1H5QA 5TQVA 4XA8A 3ZV4A 3ZNNA 5A4DA 4NJOA 2P8TA 4MPDA 1FDWA 1ZREA 2KKOA 4R68A 3LA2A 4YQYA 1YW9A 3L09A 4ROSA 4EJVA 1SOWA 3QPTA 4W9NA 5EINA 3PP8A 3H9GA 1FDTA 2M30A 1IN8A 4YAIA 5ED4A 3C3WA 4HFRA 4N9HA 2GN8A 2FN7A 5D5UB 5LDHA 3B1JA 3GPDG 2L4AA 2JD2A 4I9NA 4RVDA 3CUQC 5DD4A 1U4OA 5CVUA 2J3JA 2Z5UA 1FK8A 4O3MA 1NTOA 1AXGA 4FX0A 4FFLA 4QEDA 4XIYA 4CM3A 2XVCA 4J91A 1EV7A 4CQMD 4N7RA 1T2CA 2C0CA 4KDFA 4GYIA 4RGSA 1DAOA 4JK3A 2X0LA 4RGRA 4LJZF 4PCVA 2EA4A 4Z9FA 1I2CA 2NU9A 2V6MA 4FFOA 3I59A 4NU5A 3INTA 2VHWA 1O3QA 3PXXA 4BNZA 1CF7B 2Y93A 3GR6A 4Z0PA 1AWCA 1SOVA 4AJEA 4E3ZA 8ADHA 3F47A 4PVDA 1UXGA 4WEQA 3PFFA 4E21A 2E37A 1KY4A 1DRUA 4YRDA 3UXYA 4GQAA 1LSJA 4CV3A 3JYLA 4EJWA 2NVUB 3ZMTA 2WWYA 3LFKA 1UXIA 2CDAA 1HF3A 5IXYA 2HKXA 5KVQA 2A92A 2ZATA 4ALMA 2CF5A 5CG2A 5HA5A 4E5MA 4R5MA 2HTSA 4CLDA 4O5VA 3V1UA 3ZWAA 2HQNA 4HF1A 2B37A 3MCVA 4RVGA 4EGFA 3DR3A 4Z3DA 5THKA 4M9SA 2A61A 2VXZA 1ADBA 1UAYA 4LLNA 1KVQA 3TDUC 1D5VA 3BA1A 3PQKA 4R9SA 1PJSA 4F7ZA 2V6BA 5IDWA 3MCZA 3Q6IA 3HTSB 4GWGA 3D7LA 3MJ4A 3UOGA 2Y0CA 4F6CA 1OFGA 2P5UA 2CUKA 1CRWG 4XJSA 3J81K 1Q0LA 1MJAA 1GUFA 7ADHA 4UVAA 3DWFA 4NFYA 2V79A 4L5JA 3M9AA 2UDPA 3NGXA 1K78A 3ZCXA 4TKLA 4OIQF 5D4RA 1ZKMA 3ZMVA 5ILUA 3GLXA 2OMEA 2A6EF 4I02A 2RV8A 3CXRA 3O38A 3JSAA 5ENVA 1E7RA 3DZFA 3OJLA 4ND5A 1HDXA 3I4PA 3DBLB 2W8ZA 1IE3A 3OIDA 5ILGA 5A04A 1B15A 4A7PA 3I64A 1X14A 3DAPA 1X15A 4Q39A 4ALNA 2PFBA 5A2QZ 1X0XA 4L9TA 1BGVA 3RI4A 2PI0A 2RH4A 2WDZA 1R4MA 3BYZA 4FFRA 4XD2A 1FF9A 1VPDA 1VLLA 2EKQA 2IA0A 3C1AA 3V7SA 1Z74A 1FOKA 2V9VA 1EMDA 3D4PA 2OZUA 2UZKA 2YYYA 3ASVA 1LSSA 5IDQA 2IXBA 2P5LC 5IF3A 1Q7GA 4TZKA 1XMAA 3U4CA 2EFOA 5H81A 5L3EA 5KWEA 2GYYA 3KEQA 3WTZA 1FDVA 3EUWA 4HF2A 1WVGA 2HJRA 1L3LA 1LQUA 4EGYA 2O50A 3BMNA 1I30A 4D46A 1XGOA 2ESNA 3LQQA 4IJAA 1HDRA 3QAHA 4A73A 1OAAA 2FRHA 1D1SA 3FHZA 1OYYA 3LT2A 1I01A 3BY6A 3CJNA 1E1MA 2QRLA 4HV6A 4II3A 3ZN2A 2YR2A 1RM3A 4LW8A 3C85A 2JT1A 4YT2A 4PG5A 3RSHA 2O3QA 1GZ3A 3F4LA 4G7OF 2EERA 3N74A 1PIWA 1D7OA 1R0KA 1HDCA 4QWQA 4MEYF 3W6KB 1YB4A 4WCFC 4AICA 2HTJA 2ADUA 1E6UA 1E17A 2G1UA 3LT1A 4R4JA 3SX2A 4HLYA 5ILOA 4WOJA 4RS8A 1YS4A 2FPPA 4MDHA 1J4AA 4XLNF 2B5VA 2DU8A 3OM9A 3K2ZA 1QBJA 1O89A 2RVCA 4W4TA 1IL0A 1U9JA 1U3EM 1WLYA 4OIRF 5U1PA 5FWNA 1F0YA 4GAEA 1EH8A 3TN7A 2ISZA 3ZWPA 3WTXC 3QW2A 4HNGA 1BXZA 4TRMA 2WD7B 3E9MA 1C0LA 4LMRA 4OAQA 2D8AA 2J5KA 4LRSB 4IGEA 4XQ9A 1I8TA 2DFVA 2W2KB 4RCVA 2OXIA 3GZ5A 1TB4A 4JJFA 2O3UA 3IUPA 4KN7X 1ZGAA 3FMRA 1O7FA 1YIOA 3U9GA 1V3FA 1EH6A 3LQRA 4RB2C 4HZFA 2Q50A 4FSHA 3AU8A 1D8KA 3AW9A 5JMWA 4BNIA 3KLNA 2KJCA 3TQNA 3ULQB 1LTHR 1XSEA 4L74A 4RF2A 3LA7A 1J0XO 1EVIA 1DPGA 1F8FA 3HDYA 4XQGA 3EDPA 4RPJA 4E2WA 4OIOF 5JY6A 4O6VA 2JAPA 3D3WA 5FD6A 1JKFA 3GFLA 3AOEA 4CQMB 5JYEA 3DTTA 4NH4A 2DKNA 1H9GA 2R2GA 4WWCA 2BFPA 3AUTA 3L4BC 3T4EA 2GWRA 1SAYA 1Y8QA 1XQ6A 4ITUA 2XAHA 3HIFA 4WXHA 5C5IA 4WJZA 5CDYA 1E92A 4QUKA 2D59A 3ZW9A 1XQ1A 5B12A 2YHUA 3WIDA 1DB3A 2DQRA 2CSOA 2XV4S 1ONVA 1I10A 2XOXA 2OD5A 1R12A 3W6JB 2CDBA 1WRJA 1KIFA 4NQWA 2D3TA 4XKJA 4Q3BA 3BIOA 3L9FA 4RF3A 4MKXA 3GG9A 1LEAA 3I9KA 3U4DA 1FP1D 2GZ1A 4WCGA 2IODA 3ZWYA 3PYXA 1SFEA 3ML6A 5LGTA 5ICFA 4BIIA 2YX4A 4UV8A 1EBUA 1U2GA 1ZK2A 3EYWA 1U5TB 4A5NA 1MJ9A 5LHGA 1QKIA 3QPHA 2AG5A 2Q2WA 3NDRA 2M8EA 2ZJ0A 1IN4A 5FFFA 4B8ZA 3DF8A 3A14A 2XIGA 2BI8A 4XLPF 3DEYX 2P7VB 1H2BA 5L40A 3GW2A 4Q3EA 2Y99A 3RUIA 1YDEA 1N1EA 2AEMA 4U5QA 3D5TA 3LF1A 3VPXA 2HK8A 2EKLA 5EL0A 1SD6A 2RN7A 2IZ0A 3RD5A 2W85A 3GGOA 3PK0A 4ZU3A 5DDGA 3EVTA 3QWIA 5BSFA 3CUQA 1B9MA 3WGHA 4BKUA 2QRJA 4RAZA 3RC9A 1DO8A 1DIBA 3O6BB 3MJCA 4BO4A 3JQ9C 3WQSB 4E12A 1V9LA 4W99A 3GLQA 2X22A 3GF2A 1DDOA 2Y1DA 3W4IA 4CM8B 4D43A 4PN3A 3NT5A 2WD8A 1BHSA 3JTHA 3SZTA 6ADHA 1Q0QA 3OHSX 3PGJA 3PHHA 3GNQA 4WK8F 4CL8A 4E5NA 3HYIA 4G9YA 4M74A 5A3JA 2FZEA 1E3JA 3PRJA 3RUHA 4M9ZA 3F46A 3T7CA 1F9NA 1RWBA 1E1KA 5BT9A 1XIVA 4TSKA 5E8GA 4L8VA 3CUOA 1NQ5A 4NBWA 4B3JA 3RIRA 1MXFA 5KIAA 1XU7A 2DO7A 2HKOA 4MVJM 3SJUA 5FI5A 3WMXA 1H94A 1YB5A 4Z0TA 5EEHA 2O03A 2HJSA 3BMCB 2UUPA 3QA9A 4D0SA 3QWAA 2IRWA 2L3DA 4GX0A 2EV5A 1ZSVA 4BNCA 2LDBA 4XGKA 1HKSA 4EEXA 2CQKA 1PZHA 3ETDA 3NKLA 4L4RA 1QV6A 3I9JA 5LBQA 1G0OA 3JQ8B 4NK5A 5T57A 3E18A 2IXAA 1R1UA 5TJJA 3H9JA 2OA4A 3WGIA 4H0EA 4WNCA 4YFXF 1HDOA 2M5WA 2BD0A 3N7UA 4L9JA 4P38A 5JNLA 3OP4A 4NBVA 1N2SA 1ZXBA 4BVAA 3ONDA 1L1FA 3N4MA 4XCVA 2IJLA 2QYTA 5ICGA 1X3UA 5JW6A 1QG6A 4RF5A 4RO0A 1XGNA 4BS9A 4TQGA 3FCOA 3BMOB 3RFTA 1EEHA 4ND2A 2I67A 3ETEA 3RVDA 3DPTA 4YJDA 5E1WA 1ULYA 3PQJA 4D0PA 1JXSA 4P96A 2A94A 5FEUA 4IDCA 3HUDA 2RHCA 3H4VA 1MGOA 4AIHA 2HRBA 2NS0A 2NQTA 3GFMA 3ITDA 1CIVA 5CPBA 3V8BA 5KVSA 4PFJA 3G73A 1YBMA 4EJUA 4R51A 2BKAA 5J6XA 1W8DA 3TO9A 2BHLA 4H15A 5A02A 3V8LA 2NUAA 2YV1A 2DW4A 1T39A 2VRCA 5L4SA 1U3UA 4QECA 2C7VA 2DTXA 3OETA 3PQFA 4PGFA 3WGQA 1PX0A 2NNLD 4GX1A 2FY8A 1LDEA 3FNGA 2E4AA 3RU9A 1ZVMA 5L3FA 1XDUA 1DP7P 1H9BA 5TLSA 4HBLA 1GXPA 4M54A 1ZG1A 2HMTA 2NNNA 5DCFA 2HMUA 1R7JA 3AY6A 2CD9A 1BVUA 3K73O 4DGSA 1Z7UA 2CSUA 5LRRA 1YH3A 2B69A 3VPGA 1R36A 4FHTA 1HKUA 3ADOA 1B59A 3JD3A 5L7TA 1P44A 2IDZA 3DZKA 5FI3A 3HRSA 4I5DA 2VTDA 4M6XA 1ONNA 2JFHA 1N92A 3U62A 4LRTB 1TLHB 5TIIA 4MP6A 4IGFA 2JJYA 3M7GA 2G7HA 1JGSA 3BOQA 1F14A 3BXXA 3G0OA 1BDMA 4YT5A 1EUZA 4MVJI 2ZYGA 2RH8A 3RUEA 5G4LA 2H94A 3PGXA 2OAZA 3AUAA 3ZNQA 4LK0F 4RJTA 4LG0B 1U5CA 2XAAA 1O3TA 4WCFA 3OV8A 5COBA 2E1CA 5EESA 2IA1A 2HMVA 4CPDA 1HXDA 3Q2KA 1KU7A 3ZWBA 3JQEA 1ML3A 1T4DA 5I7SA 4Y9DA 2VNAA 4HYEA 1XD7A 3GA0A 2NTJA 1JE8A 1ZK1A 1EQ2A 3TPCA 4OL9A 5L3CA 3ZPLA 3Q11A 5DUIA 2Z5LA 4FFPA 4FOOA 4CM5A 1HL3A 4PGGA 2ZTLA 5ICCA 1RKXA 5KJEA 4EUFA 1NM5A 4DBVO 4CV2A 1R4NA 4FIZA 1EUCA 4J3FA 5H82A 1P4AA 1A71A 1LDMA 4JP3A 3VH4A 5IAAA 3LLVA 4I5FA 3GZ4A 3RFXA 2X9VA 4NI5A 3I58A 1A5ZA 4ZD6A 5MDHA 3KP3A 4BXUA 2MC3A 5BMZA 4GGPA 1D4FA 1IXCA 3DXJF 1FSHA 3CZRA 3KSUA 4M49A 1T6SA 4I5GA 2TMDA 4MIYA 1GFSA 1NAIA 4I9HA 1PJQA 3UN1A 3WBFA 4N5NA 2IA2A 1JN0A 4B7CA 1ZEJA 3WR5A 3KZVA 2O3JA 9LDTA 3WNQA 3PWKA 1KEUA 3L4SO 5JDCC 3L4BA 5JE8A 3DMYA 1O6ZA 5DDIP 4CDGA 2NU7A 1JKIA 4GLOA 1KVUA 5ADHA 2I66A 4YEDA 1VE9A 2ZNYA 4E5YA 3DO5A 3GNTA 1Z9CA 4O59O 3ZV3A 1KBZA 4WLVA 4JBIA 5HOOA 2HMSA 2HLPA 3FF4A 3K9QO 2CFXA 4A26A 2Q4EA 3U2RA 5LDGA 5ITWA 2XXJA 3DTYA 1PQUA 4WCDA 3TZ6A 4KUEA 5JBIA 1TQPA 2GZWA 2DTEA 1V4RA 2IYOA 4OIPF 4TRJA 1WXDA 1IPEA 3GNSA 1FYKA 3V7CA 1LNQA 2J3HA 1P77A 5L45A 2L54A 3F8CA 4OU0A 4U0VA 1T26A 1Q1NA 1Y5RA 2XAQA 2EGGA 1IF1A 4KMFA 1A7KA 4YJFB 1LDJA 2NAZA 3QY9A 4OKIA 4DYVA 3NRVA 5E1ZB 1XSVA 5HS7A 1ULSA 2B4RO 1SFUA 4MVJH 4OXKA 4R16A 1IULA 1UZNA 4N9IA 4LVUA 5TJHA 1PU2A 2IE0A 1VKNA 4B3HA 2D4AA 3NAQA 2GRAA 4ZQEA 4J16A 1R5GA 3K1NA 2GZ2A 1R6DA 1NFRA 4QT0A 1XHLA 3QSGA 4YQZA 5KKAA 3P19A 3GRPA 3IQDB 4ESFA 3NEPX 4RVUA 1A4UA 3REOA 3KZYA 1FBQA 2YDXA 1LDYA 4UVDA 1BI3A 2ZB8A 3VPHA 2GA1A 5LLQA 1IPFA 4LGVA 1R16A 4CMJA 4L0YB 3ZV6A 2CWEA 3JQ9A 4ID9A 4EUEA 3AY3A 4DC1A 4B8WA 5HRUA 3WTSC 3MZHA 2DFIA 1GYQA 3AI3A 1IN7A 4ESBA 1VJ0A 3VOSA 3GF4A 4P8RA 1NHAA 3PEFA 1IXSB 2VYNA 1L0OC 3UICA 5HM8A 2JSCA 4XX0A 4RVSA 2EA2A 4NB5A 2J5QA 4I1IA 5JAIA 1NVGA 2AE2A 3ST7A 1ZARA 3D5QA 3HZZA 4P22A 2QQAA 3BJAA 1QZYA 4HW0A 3AWDA 1T2FA 3FI9A 3HDJA 5JCJA 4M6YA 3O2PE 2HRZA 1F5TA 5CYVA 5EEGA 4BKOA 3JQ7B 2A69F 1IW7F 3NEUA 3WYCA 1IZ0A 2YX7A 4KT5C 1KA8A 1KETA 2YDYA 3EZLA 4RGBA 3GG2A 4XR4A 4G7ZF 3DDNA 4IXTA 3WWYA 4FJ1A 4YBZA 3RJPA 4N5MA 5G0UA 4Q3AA 2B4QA 4IINA 3E97A 3D0SA 2HUNA 4MVJE 3Q9VA 4HX8A 2JCYA 3JYOA 1KOLA 1TW2A 2DM6A 3E9NA 1O3RA 4TZTA 2DK8A 3NV9A 3M8EA 3GY0A 1VL6A 3I9LA 3NT2A 4WE3A 3UCXA 4AD9A 2DBVO 1YDWA 3EZYA 1WP4A 3WMWA 3WGOA 4PGHA 2H9IA 2Z33A 2I9PA 3KP2A 3NDIA 2RDPA 3DBHB 1MDMA 3EYYA 1YW8A 2FOKA 3VHRA 1DXYA 2P6SA 3JD2A 4O63O 3RCBA 5B4UA 2YV3A 4PLFA 4MINA 1X1TA 2GO1A 4BNUA 3C7DB 2HK7A 1QSGA 2OOSA 3E1KA 3Q3CA 4EDFA 2CZCA 3VAZA 4BHBA 4FR5A 2E49A 4E5KA 4FS3A 1PP8F 3CTAA 3R0IA 1YBVA 3DBVO 1S7AA 4QX6A 3C8MA 3PYLA 3ZQ7A 1DC3A 2O0YA 2Q1SA 4PLCA 1L7DA 2G5CA 5EQDA 1REPC 5LHIA 3IP3A 5CDUA 4HFMA 3NQOA 2K4BA 4JBHA 2A68F 3ZMSA 2M1BA 1E3LA 1FDSA 1BIBA 1GU7A 1QYVA 1X7DA 3EAGA 3TFQA 4PLGA 3MFKA 3UF0A 3JQAD 1PGQA 1R1VA 1PS0A 1GV1A 1ZNQO 5KJ6A 2CFCA 1DPUA 2W2LD 1ZIDA 1O0SA 4LVCA 3CH6A 2ZNZA 3G17A 3TJRA 2XF8A 3GUCA 3JYQA 1T25A 3LLSA 1Y8RA 3EC7A 5A03A 1C1DA 4ENJA 1HSJA 2FQ3A 1P9LA 3C1OA 5JR3A 4FJ0A 4ZZDA 1PGJA 4OGWA 1Z6ZA 1D1TA 4UVHA 1I27A 4O6JA 4HLXA 3WICA 4D41A 4OJNA 1IB6A 2E48A 3W4KA 1BJAA 2ZBKA 3D3EA 4UVEA 4U7DA 1O8CA 3P5SA 3Q0EA 4DC0A 1MC5A 3TZHA 3HB4X 4RPHA 3G1UA 3PJGA 1SD7A 3GFIA 2J3KA 4D3DA 2O7SA 4RAYA 5HS9A 2D2IA 4TVOA 7MDHA 4CM9A 2VBWA 1H0MA 4ALJA 3FBGA 2VHVA 1PDNC 4XRFA 4NK4A 1IRGA 5A06A 4C4OA 4FGSA 3JYNA 3BHJA 4ZN6A 1O95A 3VZQA 2FZWA 1GDHA 4Y67A 4J4HA 2PG4A 1B2LA 3WG9A 1EK6A 2ZMEA 2AMFA 1P1RA 2FR8A 2CVZA 1Q2XA 1BDBA 3ZNPA 1VL8A 3A9WA 5DULA 4CUZA 3EY4A 1MLDA 1DFGA 3HRUA 2NTNA 4CO8A 3BP8A 3C18A 5LEKA 5TRTA 2O2SA 1CEQA 3UGKA 4L4SA 2EIHA 1T2AA 4QFDA 3SFZA 3JQCA 4CLXA 1PZFA 5ENDA 1VI2A 5ER6A 5BPIA 5IZCC 4I98B 3JTGA 3K0LA 4J7CA 1U5TC 1U7TA 1KY5A 1C1XA 2O7QA 2C82A 4C7KA 1BMDA 4E32A 3BTUA 1B1BA 1EVZA 2OL4A 1JAYA 3H3ZA 4K6CA 4PLPA 4E13A 1KC3A 1S6YA 3WTUC 1Z73A 2P2SA 2WWRA 3X2EA 3H9UA 3QLJA 5CAEA 1MV8A 1XDSA 3C24A 1C0KA 1RM4A 4IQ0A 5E1XA 3RKYA 3DFGA 4YAEA 5G2OA 4MKRA 1B14A 3BHIA 2JPBA 4BGEA 5CPFA 2BLLA 3NTQA 2W4QA 4CM6A 5J8CA 2X4GA 2ZCVA 2LNBA 1P33A 3WDSA 2DQ4A 3ICPA 5JDCA 1STZA 1YJ8A 1UHMA 3NTOA 2AS5F 3QVXA 2R7FA 3ZU4A 2F00A 5JFRA 5GZ6A 5GZ1A 2CO5A 3IL2A 2O3RA 5JAZA 1OI7A 1B0AA 3FTNA 3OEYA 4PVCA 3WIEA 2A5YB 1SPXA 3DP7A 1Z7BA 4E2XA 1FSEA 3DZIA 1EDZA 1DDNA 4XEHA 4YDRA 2K7LA 4R41A 8LDHA 1DIGA 1HYEA 1TT5A 1KVRA 2X9NA 1VRWA 2RCYA 3DZGA 4ZGWA 1LJ8A 1J5PA 4G5HA 3KYCB 4I0BA 4KIFA 2KIUA 1T2EA 3ZGYA 3FHLA 3RAJA 4LSWA 3AI1A 3VKVA 2WE8A 1QPMA 1SMTA 3GO5A 1CF7A 2EG9A 4UHTA 2EWMA 1ZG3A 4A5OA 1MXHA 1XKQA 1V3TA 4YACA 1WQ2A 3B70A 4Y98A 2QQ5A 3F4BA 4GLLA 3P9KA 2NVUA 1RUNA 1ISMA 1JWAB 5K6AC 4PG6A 1KU2A 2CMDA 1OMIA 4L9RA
chains in the Genus database with same CATH superfamily
3GHHA 3BRQA 2BFMA 4AZ0A 5TS2A 2GS9A 1KJJA 3DDHA 2JFBA 2H65A 5K0EA 2VONA 2VHYA 1Y81A 5E0KB 4AW9A 4GXNA 1VQ4I 4N7JA 5LGNA 4AI6A 4A12A 1UDCA 4I1SA 4ADSG 1HC8A 3ONQA 3T7SA 5KX5B 5JISA 3ABIA 3CLKA 2XCIA 3ZY3A 2P65A 3R3WA 4HJRA 1BGWA 2FJ1A 1QE3A 3FMIA 2C29D 1VLZA 2CEKA 2DPMA 4MKZA 1LUAA 3ILSA 5BNFA 4R2XA 3NP9A 3I01M 2FOIA 4JA0A 1M1NA 3CRW1 5EKXA 4WFQA 1ZR2A 4P0TA 2PQ8A 1J59A 1ON2A 3QM1A 2PT5A 1M1UA 4G0OA 3SSMA 4LJ8A 2Z43A 4CR6A 1MDBA 4KQWA 1XV5A 4LE2A 4B8XA 3RS2A 4LSZA 3WWCA 4QUBA 6LDHA 1D9XA 2PMZN 1I3QJ 1HURA 1NBMA 2CL7X 1JIVA 1S7OA 221PA 3KXLA 1UPAA 2NOJB 1A27A 4CMGA 2E5ZA 3TX2A 1W581 5A5EA 2ZWAA 5C8YB 2GN1A 3L2CA 2M1ZA 4G4SO 3FBTA 2XGXA 1AN9A 1JAIA 1DLJA 4JI4B 5J4VA 4WGFA 4NHJA 5TGTA 1VSQA 3UANA 2QRKA 4D5CA 2IU4A 4ZREA 5M04A 4FGKA 4QD3A 2M45A 4PQGA 3ECOA 4Q4HA 1DEOA 4AJLA 2R7OA 3WGVA 2C1ZA 1HKTA 4GL4A 1E32A 3WU2C 2VBIA 4IX1A 1XG1A 4FWIB 3ABMH 1QO0D 5K6AA 3H5AA 1LB2A 2C2KA 3ZHYA 4CLRB 3EULA 3NARA 1KAOA 3DTEA 2C07A 4KQGA 1BC7C 2QVXX 4Q3LA 1NVWQ 4Y2UA 1QOPB 2PUGA 2M8GX 3O26A 3U39A 1I24A 4QXAA 2GBLA 3LY9A 2K2QB 4LRQA 4IJUA 3RSFA 4HGOA 1XELA 1VQ8I 2WYVA 4W7IA 1SBTA 1Z0IA 2Y67A 3PQ8A 3T8YA 2FXVA 3V32A 4OBWA 1JTXA 2PH5A 2IU0A 2ZIUB 3PX7A 2FR1A 3JCZA 4KE7A 5B3SH 3LVQE 1AO3A 3QU4A 1NXQA 3PX2A 4RCYA 4EB3A 2FF4A 3PNYA 2HU7A 1UDAA 1ETOA 3FUCA 2ETVA 4EABA 2JLBA 1J9IA 4HL6A 2EZUA 4RHXA 3GPLA 1TLTA 3PEUA 2PX2A 5F51A 5FPTA 1JDTA 1F0NA 2BXYA 4I0AA 3SFTA 3I5UA 3EGDA 2MWMA 3F9RA 4JITA 1JLLB 4E70A 3L1HA 2W98A 4EHFA 3IE1A 4UUVA 3U1DA 3R9IA 3DTIA 2CK3A 2I99A 4P33A 4EDHA 4YP0A 2QVYX 4G8CA 4MUJA 2CN1A 3BX1A 1OH7A 4B7XA 1A77A 2XE4A 1WDMA 2GYVA 4GSYA 5KTTA 3ZWXA 2F7SA 5I4CA 1BGXT 1IH8A 2OQVA 4CKCB 1MF7A 2GILA 1VFNA 3GDFA 1XO1A 3WGNA 2AFRA 4UQOA 2AD1A 2N8GA 1QH8A 1NSFA 5FUYA 7GPBA 1W2WB 1JT6A 1Z56C 3T12A 1OTXA 4X1KB 2OPTA 2ZKIA 4IYJA 4ZVNA 4NBTA 4L3OA 4JVMA 2R1ZA 3LM8A 4C0KA 3FTCA 4H7PA 4C04A 3ORYA 4YMVA 1E7MA 2X8AA 3MWLA 2J41A 1OCOH 1OCEA 4OHRA 3FHOA 1PEDA 3KC2A 1FP4A 3QXSA 3N2GA 5HNHA 3ZHXA 3LWDA 1QUEA 1GPDG 2W71A 2JHPA 1HT2E 1E4VA 1XMIA 5EHXA 1TWHJ 1UM8A 2ZS9A 4RVCA 1N6LA 3HV2A 2FMTA 2REXB 2C42A 3FPSA 1UR5A 3AHEA 4XUEA 1XCVA 1EDEA 3C0KA 3F3MA 3LSMA 4XB6B 3D1NI 2VBYA 4PR3A 4DUPA 1T8YA 1ECFA 3VU1A 1MX9A 2BGKA 5C8YF 5J4YA 1CUUA 3ZG6A 1YRWA 4Z86A 1Z8NA 1KKLA 3AJEA 4LJKA 2P4UA 3AT1A 5L3SA 4IRHA 5A3QA 1O6CA 4HUQB 2L9NA 3PIOF 2B8WA 1Z4QA 3PHCA 2H1OA 4KACA 3D8HA 4XK4A 5HX7A 1DKQA 1E7SA 4EECA 4CCSA 4MW5A 4U63A 3RT1A 3LK7A 3ESRA 1RIIA 1LKXA 3RBZA 1RKQA 1DC7A 3CNQS 5CCEA 1G5IA 3FR8A 1FTWA 1UEIA 3SC6A 1BKDR 3DM5A 1CUCA 5M5BA 3UXHA 3MBIA 1EBBA 4UTNA 1GZUA 2GCNA 2ZSUA 1EFRA 4PAGA 2H1HA 2QQ9A 3K92A 3EASA 4A8JA 4WOKA 3CXUA 1Z0SA 4NAVA 2AS0A 3G79A 4EOGA 1XDGA 1FP2A 1ZFNA 4FINA 1T8SA 4PYRA 1HQCA 3WSVA 2AQHA 2RJNA 4GYWA 2ST1A 3GRRA 1IQRA 1TQ4A 1CIPA 2YN4A 5KQRA 2YNMC 3T5TA 2P77A 1M0TA 1UQTA 1I3NA 4I50A 3QQ5A 1Q1AA 5EZSA 4XWKA 3LL4A 4LY0A 4MVJF 1IUOA 2WY2D 1NL3A 4JSRA 1OX6A 4RD3A 4PCQA 2WJPA 1GCUA 1SPBS 1NXSA 3L07A 4URFA 2P1DA 5IVKA 3F8FA 4A2PA 3NAZA 4IQFA 3W7BA 1QLWA 1LF5A 1NQVA 2DFEA 1FFGA 2ZITA 1XALA 3H9QA 2GTHA 4TVBA 4FLMA 3R77A 1TWAJ 3FLBA 3M4JA 1E6EA 1OLXA 2UUAB 1QIJA 2RI0A 4YJ2A 5EPUA 2TECE 1M8JA 2K9QA 3R61A 3CPEA 4RNDB 3PE3A 1L4MA 2IH2A 4OHPA 3JSPA 1HORA 2P5KA 3ORQA 1HK7A 3RRNA 3LC0A 3YASA 5BRJA 5AKLA 4GOND 3HCDA 1Y1TA 1XVTA 2WFLB 3HJBA 4AZTA 3T5BA 3CX8A 1WGXA 4N7MA 2BFFB 3TXYA 1WW3A 1SHZA 1Y3HA 2P3LA 4CYCB 4BRZA 1FXWA 5C1IA 5IT4A 3H11B 1YFHA 1VBKA 3ESQA 3PR1A 2XBUA 3CNBA 4GPD1 1V25A 3BMNB 5E6SB 4OMZA 2PE5A 4YG2F 1SB9A 1W0KD 4JL6A 3TW8A 4ND1A 3WLAA 3EUHA 1SVKA 1AOYA 1B43A 4U7TB 5JOQA 2JAOA 3B36A 1YHZA 4CLHA 3QVLA 4IFBA 1H3NA 4L7QA 3R0ZA 1RHRA 5EJ6A 2ZI3A 3S15J 3UWPA 4YAGA 2ZJYA 2J0SA 1YXMA 1UCFA 2BJVA 1W8IA 3DKPA 4AECA 4G84A 1ZVQA 4V0OA 5FBHA 4MUNA 3RYRA 1X1CA 4TMZA 1OIVA 3E27A 1D1BA 1HPLA 4O8CA 2GEDA 1Y8QB 1EDOA 5I8ZA 4MGEA 5E9JA 5A2GA 1AKQA 1EFDN 4EFDA 3WFJA 1WZ2A 3TB6A 3OESA 3LYUA 1BKYA 2IYZA 5GV8A 1N8KA 2IUYA 1DL5A 2PMFA 1Z0UA 2BONA 4EUHA 2K86A 1E3OC 4M6VA 4GSLA 4UCWA 2HWYA 4MUHA 5AUPB 3K2EA 1II0A 3PDCA 4UARA 3JW8A 2GPTA 3V7FA 3G8BA 2JANA 3I9FA 1Z6AA 4LTNA 3UHAA 5A4FS 1QP8A 3KZ1E 3QIVA 5IK2A 1PBTA 2ESHA 3CLTD 4MUKA 3CCVI 1GRCA 1F9EA 5BUCA 2DECA 5E79C 2FUG1 1THGA 4KZKA 5LQJA 3OZWA 1IQPA 3W1VA 4O4IA 1KI6B 1ZN9A 3NAGA 2C61A 1E2NA 3GUVA 4D9BA 5CNMA 2GCOB 1QGUA 3EWNA 4CKEB 3HFJA 3BZWA 3HXQA 2Z83A 4HD8A 1XQXA 2HU2A 2C3MA 1OWOA 2GPAA 4GZMA 5CB8A 1SXJD 4HSTA 3N97A 2XMSA 3AYXB 1T56A 3LNCA 5EYPA 4F1KA 4HN4B 2BFBA 2WF8A 1S3FA 2XMRA 2FMUA 3DZCA 1OI2A 2EBHX 3BOSA 3ZDZB 2PH1A 1P1BA 5IHXA 2MD0A 3EMKA 5TS3A 3KPYA 5C5DA 2XKAA 1E18A 4LN1A 3EC2A 1SCBA 3TRIA 5F7JA 2IJGX 4KAJA 1XMVA 3RWMB 1JKPC 5B64A 4QXPA 2OBYA 2VXYA 5CVJA 5LNK6 3QUTA 2J5PA 1H69A 4W9NC 4YRGA 1L5RA 1N2XA 1MJ5A 1KZ1A 3B51X 4QAQA 3AF3A 4X41A 1T2DA 2V6JA 2V7WA 4HDSB 4OSPA 1FZQA 4DNXA 1BN6A 1YUBA 3PNPA 3T5XA 4YUYA 5DBEX 3ABTA 4CICA 5F1RA 1QPZA 1E1DA 4TKMA 3KLOA 1COWA 2WSYB 3PHGA 3RC2A 2VJAA 1ODDA 3AV3A 2QN3A 3L7MA 1AS0A 3OWHA 1KAGA 1ZISA 3GLLA 3FHTA 4DM7A 5G0TA 2J59A 4WNAB 2BBYA 2IYQA 4MV3A 4ODIA 4XARA 1RXVA 3H8JA 3O8BA 4BVGA 2Z2IA 4MW7A 3F1KA 1UZMA 1YOBA 1VIDA 2VDUE 5IUKC 5BOSA 1WOYA 1NWHA 3BIJA 3ZE8A 2UZ1A 2B7LA 2VATA 5FD5A 5GM1A 1GXSA 5D00A 3ON5A 3EPRA 2VBGA 4UAVA 1XN7A 1KWKA 4F3QA 2F90A 3QF4A 4PWZA 2QW1A 3IVRA 3EGOA 1WVRA 1H9CA 3D64A 3K4LA 2A07F 3LQKA 2WICA 4IVRA 5K3SA 1TGYA 4I9GA 4LDJA 3O4IA 3MKWB 1Q21A 1VQOI 2JZOA 3KYJB 1NF2A 3MAJA 2JFOA 1GEEA 2NZXA 5FPHA 3A1FA 1ORIA 4ESJA 3EQ9A 5BQFA 4R3NA 5K0GA 2VWGA 2H27A 2LR0A 2IGNA 4DCNA 1TRKA 4NG4A 3NW9A 3MXTA 1PJCA 5FI1B 1Q7CA 1J75A 3F7MA 4WLNA 3G71I 2RBGA 5JCZA 5IPAA 2A9FA 1FDRA 1TVCA 4WZZA 2WIAA 2FSSA 2C4TA 1QU2A 1YKFA 2P30A 3EEOA 1PFGA 1GAEO 1LEBA 1W29A 121PA 4G6QA 2XD4A 1AD2A 4Z1OA 4PFQA 3F2IA 4V2FA 4AX8A 4BLSA 5CGZA 4HQRA 4BP8A 3GJ4A 2Z5UA 2ICWG 3KXKA 3NEAA 3JQPA 4GD3Q 4GYIA 5BWOA 3RLIA 2WUDA 2NU9A 4ZOBA 1O3QA 1I94B 4ASUD 2QMQA 3GR6A 1EQAA 1QG2A 2XYQA 2FG6C 1HF3A 2ODPA 1ZW6A 5HA5A 1FTGA 2I6SA 3BRWA 4RVGA 2O8DA 1ADBA 5LOVF 1LPQA 3EFOA 4WADA 2P41A 4GM0A 3UA4A 1YI0A 2OCLA 3C6YA 1I50J 3DWFA 3D8RA 1E4EA 3GLXA 4B33A 3GLFE 1AS3A 1E7RA 4LHXA 1WL8A 2HDDA 3DAPA 4ALNA 4R83A 2C0PA 1FF9A 1JUPA 2C9YA 1TM4E 3C1AA 2ZRKA 2UZKA 1CB7A 2EFOA 4TS4A 1CVIA 4CU5A 1T0BA 3WTZA 1WVGA 1LQUA 1MJFA 4Y2HA 3UGQA 3O47A 3OZAA 1ZUHA 3K16A 5LMNB 1YHYA 3PCRB 4ZVQA 8OHMA 1PG2A 3H2YA 2EERA 3PCXA 2Q7OE 1E17A 3E3MA 4LQLA 3K2ZA 1ZH6A 1IL0A 2LY2A 4RXMA 5B6PA 1HQYE 1Y5NA 5J59A 4ZPXA 1KS2A 4DA8A 2ZREA 3OUZA 3LQRA 3DULA 2JAPA 3LBAA 4R1MA 3GFLA 4WWCA 5JZSA 2FOXA 1E92A 3ZW9A 1N6OA 5DX8A 2VHTA 4M8LA 3W6JB 3GRFA 1YK1A 5LGTA 2G9ZA 1U5TB 3QPHA 2I2XB 4B8ZA 4HYQA 2PRSA 3I0MA 4RX1A 3UT5B 2HK8A 3BD7A 4JB2A 4FQ7A 3GGOA 1G4AE 3L7DA 2RGGA 2ID6A 3U7RA 1Q57A 1Z68A 5JI2E 1K2VN 1XQWA 3JTHA 3IUNA 1KQNA 2CUZA 2M6SA 1F9NA 3MELA 1Z4MA 3SF8A 4TSKA 1A1VA 2Q6VA 5IJ0B 1H94A 3D3JA 4D0SA 4NJEA 2EV5A 1ZSVA 1R1DA 3DV9A 2RGBA 2R4GA 3I9JA 1G0OA 1JSLA 3AKDA 3O6VA 1RRFA 1NJ5A 3K09A 2HXSA 4BVAA 4LE1A 3BD9A 5JW6A 3LPMA 5BQOA 4ZJPA 5DM70 1QFYA 3VR6D 1NXWA 5KTMA 2NS0A 1FRNA 2I1VB 2AW3A 3AEKB 1AS2A 4LTDA 3CP8A 4PNHA 4JI3B 3LNQA 1F20A 3INYA 4M46A 3PA8A 1QVVA 4MUFA 2L5QA 3FUTA 4MQFA 3A9CA 5DSXA 3O4HA 2NNNA 3LE8A 2ZDGA 3K4CA 3ASNH 2K5UA 2FAXA 4HDKB 4BB9A 1OR8A 1M5RA 4XPIA 1RQXA 5TIIA 4MP6A 4B45A 2G7HA 3BOQA 2ZW9A 4MVJI 4BRWA 4RJTA 2HPAA 3RYIA 3OV8A 3OIPA 2A9KA 4LDQA 1Z7GA 4OGGA 4PF1A 3TLEA 3AZQA 2NTJA 5AVVA 3O4VA 4UC0A 5ICCA 4S1OA 5GTIC 5JJCA 1Q17A 3DNMA 1D4FA 3FW1A 4I9HA 2C2OA 2EX0A 2WADA 3RVBA 2L7FP 2Y9MB 4B3MB 2ZNYA 3D1JA 4M3BA 1W85B 2H1RA 3C4QA 2D5BA 3FSJX 4OIPF 5A4MS 3V7CA 3QBDA 4U0VA 4NNOA 1T9AA 5AI8A 4LVUA 2D4AA 2FQ4A 4M7PA 1CULC 2ES4A 1YIDA 3NJRA 3QSGA 3GRPA 1A4UA 3E2IA 2YDXA 3OD5A 3OM1A 4QDUA 5E4TA 1TQDA 1GNSA 1GYQA 5LQNA 1K8QA 2XWBF 3WAKA 1U8EA 1JG2A 3MN2A 4RVSA 2AUTA 2J5QA 1ZARA 2LW7A 4FBMA 2LCFA 1NGSA 5HCUA 2YX7A 4RGBA 2YASA 3GG2A 4FYHA 3ZTWA 1QGOA 4TZTA 1N6RA 1PSZA 4JJEA 4MV8A 4JOSA 1WEHA 5EZHA 2DOEA 1F4VA 4FBLA 5BYJA 3KX2A 4BHBA 4FS3A 4OSEA 1TGVA 3BCBA 1DGWY 2FGKA 3EIHA 3UJ6A 3IUYA 4G1VA 2HRDA 3IP3A 1T34A 5AHRA 3OEHA 1GU7A 1X4OA 3C87A 1JYEA 1PS0A 1ZNQO 1JTEA 3ZC3A 4RHCA 2W2LD 4P80A 3WICA 2E48A 2OZLA 1V7PC 4UVEA 2VAPA 4NCBA 4AYXA 3QFHA 3MHTA 3GFIA 1K08A 4MV4A 7MDHA 3K0HA 3CRNA 2R84A 4Y67A 5AJZA 3P4UA 2FR8A 4YROA 3PIRA 3EY4A 5AJWA 2H4YA 1N2GA 4KFRA 3C5VA 1G2HA 1U5TC 1C1XA 3JVUA 2WYHA 4JT2A 4K6CA 5EC8A 4ZO7A 5FWYB 5CPFA 3H18A 5CVTA 1UT8A 2AMYA 3EBLA 4URHA 2A5YB 4R41A 1WZCA 4MPRA 4A0FA 3G2IA 1LJ8A 4LY3A 4LSWA 1JG1A 3D54D 4A5OA 3GO5A 4FHDA 1Z6PA 1ISMA 2ANCA 2BY0A 4CKYA 4JB0A 1LBHA 1JW9B 4XVQA 2NYRA 1PG0A 2Z8ZA 3L0BA 5TQ0A 1M8PA 1VHJA 3V4FA 2FU5C 5KAPA 1PHPA 1IOVA 3OYJA 1BTOA 1TJ4A 1CQIB 4MVWA 3ZGKA 2VHXA 4U1RA 1A7AA 2O19A 4LPSA 2X48A 4RV9A 2E82A 3VNBA 4ZI3A 2AH5A 4ACAA 1ABBA 1POGA 3B1KA 3X1ZA 3M4YA 3U1KA 1SKQA 1W4RA 3B7GA 4UNQA 5AUOB 1RP7A 2RHTA 3UUGA 2BEVB 4MWSA 3ABUA 1SXJE 4PSCA 3ND9A 4IXMA 1KMMA 1W5BA 3ZLUA 2VOOA 4EX6A 4ITVA 3NBXX 1YCFA 2HIHA 3G13A 1U0LA 4OUDB 1PT7A 3MS7A 1B6TA 4CR7A 3HZOA 4YREA 4C76A 3GX1A 4DV2B 3UK7A 2HV9A 5HG0A 4GYKA 3CKLA 4AFNA 2H8WA 2PJPA 2GASA 3ROPA 1OIXA 4KQKA 1UBHS 4GQIA 4F3RA 3MD2A 3IP4B 1UP4A 4N76A 1FLNA 3NM4A 2PHZA 3U09A 3HM5A 5EXDA 3MLEA 2P1ZA 3HYCA 4YAFA 3OWXA 1FP7A 4WXYB 1CUYA 3C7CB 1C0IA 1G8PA 4LZOA 1SCDA 4B3AA 9ATCA 4D6PA 4GC9A 3UMGA 4CMBA 1UDBA 3LPLA 1B2RA 1XB4A 2VJLA 1DZIA 1Z17A 2R6R1 5CLSA 3GLHE 3LY8A 1GNQA 2O0MA 3ZWKA 3EZFA 3CBGA 2CNBA 2ZSDA 2I6TA 4FBGA 4Q3NA 2AQIA 4CTOA 3NIBA 3H6KA 2EP5A 1ZINA 4EV0A 5DM2A 3HCOA 1G5PA 1OZHA 1HSOA 2ZUBA 2FPIA 1SEVA 4BB6A 3V1TC 4BWGA 1DJLA 1HEYA 2F43A 3I6MA 3MKYB 3I5AA 3TG8A 3M81A 3M70A 4IEEA 1OI4A 4CYMA 4QBTA 3Q7PA 3MAAC 4GKKB 1A76A 2LR8A 3GEMA 4CCJA 5CX1B 3OFSA 2ZE6A 4QEKA 4JASB 1OFVA 3ONVA 4MO2A 4S05A 3NDJA 4BMSA 3CUUA 1K88A 1WMDA 1Y7PA 2E9SA 1BJKA 3OQ1A 2J9ZB 1D1QA 3FJYA 3OKAA 2JAWA 3MCWA 3C3AA 2XUBA 4ENMA 5A6VA 2RGRA 4MMXB 4G6DA 4WKBA 4UTVA 3OT4A 5DM60 4B75A 4E7ZA 1DTSA 3QLVC 3T5PA 3CJQB 3JQBA 1Z8DA 3E53A 1ZJ5A 3DOUA 2QR2A 2KHMA 4D9GA 2UV1A 1JDBB 1LLUA 5JY1A 3KTFA 2OFFA 3H9BA 5ALMA 5JO9A 4BMYA 3EF0A 3FYSA 5HF5A 4EW3A 5JWHA 3BTSA 4LB6B 1LBTA 4PG8A 4I4CA 2RHGB 3OOSA 3ZN1A 3FIWA 1CGPA 3FTEA 4W1SA 4OK3A 4XKCA 1WXQA 2QJTA 4AD8A 2PZFA 1UXKA 4TMFA 1FB5A 1N4AA 1Y39A 1RT9A 2PZJA 4IO1A 1Z29A 1WR8A 3QX7A 2WJHA 2JVKA 4PPFA 4YAKA 3AF2A 1ZRMA 4IXDA 1JIUA 3Q0VA 2HFHA 1U1IA 5K99A 1JJAA 4PQYA 3JQ7A 2XRNA 3HWX1 1W96A 4O4JA 4N9WA 1AA6A 5HLGA 2XHEA 5E9QA 4Z49A 1X13A 3ANNA