3WGIA

Crystal structure of rsp in complex with beta-nad+ and operator dna
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
217
structure length
217
Chain Sequence
b'KTIVSMAVIRRLPRYHRYLEELLKNDVKRISSRELSEKMGVTASQIRQDLNNFGGFGQQGYGYNVEELYNNLTKILGLDKTYNTIIIGAGNLGQAIANYTSFEKSGFNLKGIFDINPRLFGLKIRDVEVMDVETVEDFIARNKIDIGILCIPKDNAQYTADRLVRAGIKAIWNFLPIDLKVPDDVILENVHLSDSLFTVSYRLNEEELFKKLKGETA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Redox-sensing transcriptional repressor rex
publication title Distinct structural features of Rex-family repressors to sense redox levels in anaerobes and aerobes
doi rcsb
source organism Thermoanaerobacter ethanolicus
molecule tags Transcription/dna
total genus 69
structure length 217
sequence length 217
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02629 CoA_binding CoA binding domain
A PF06971 Put_DNA-bind_N Putative DNA-binding protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wgiA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wgiA02
3QIVA 4IGEA 1ZFNA 2X5KO 3QU6A 2VN2A 3LF1A 1E17A 1QQIA 1EFLA 2BGMA 3DEUA 3D4PA 3ETEA 2KJCA 4IZHA 4KQXA 4RPKA 4C4OA 6ADHA 4KNYA 3OIGA 5I7FA 2I65A 4MTDA 2DPGA 1UB9A 2DTXA 3DDNA 2OBPA 3GVAA 1KY5A 2Y0CA 4BO6A 4R41A 4CMCA 4CR7A 5F1RA 3ABTA 4XQGA 3FSRA 5FD5A 1TW3A 4R51A 3I52A 1U3EM 4CM8B 1Q7GA 1ZJZA 2Q46A 3CO7C 4OMZA 1F14A 1GCOA 3ZU2A 1DOHA 1GQQA 1YB4A 4DNCA 3MOGA 3AY6A 4E5MA 1LQUA 5EL0A 5BQFA 3CEAA 3F21A 2JTVA 2EA2A 3KE2A 3V4GA 4EJUA 3EVTA 2D4AA 4ND5A 4DQVA 1ZXBA 2PKRA 4CL8A 2QYTA 5DP1A 4P9FA 3CTMA 4HADA 3MJSA 4I08A 2F5DA 1L0OC 3KM0A 4OKIA 3U62A 3ZWOA 4E13A 3WSWA 2DQRA 3ZHYA 4YVFA 1E7YA 1UP4A 4CR6A 3RYPA 1QMGA 3GG9A 1U4SA 3LU1A 2SCUA 4CMHA 3LFKA 2E7XA 3RUIA 2Y1DA 4BAYA 3WTVC 1MD0A 3MJ4A 1DIAA 4XGKA 4R9SA 3K92A 5TX7A 4EVIA 4M74A 1JAYA 3ADPA 3VPHA 4Q3NA 4OXKA 4YJHA 3ZU4A 2OHXA 2AEJA 5F5NA 3RQSA 4DIOA 3W4IA 5COBA 1XG5A 4NI5A 2BEOA 4YQZA 1T1SA 2EERA 2OU2A 1K6IA 2FMYA 2R00C 3KSDO 4BNNA 3H3JA 3ZV6A 3AOEC 1JWAB 2ZTUA 3TRIA 5GZ3A 1NR7A 3VC7A 3BJOA 2MLKA 4CGZA 2CF5A 2VCYA 4HFMA 4I8XA 3V8KA 2V9VA 4OOEA 1GPJA 1KVSA 5L45A 4PCVA 2IYPA 4BHPA 3RAJA 5CLSA 1UXGA 2JL1A 2ZJ1A 3R0IA 5L3ZA 1O89A 5LBQA 1FJHA 1N2SA 1QZYA 3WTWC 3E6CC 4OMYA 1QSGA 3PHGA 1GL3A 1QXSA 1SFEA 1TQPA 3OA2A 4YJDA 4UHTA 4Y67A 3V1UA 3FTNA 3ZW8A 2Z99A 2VODA 2VXZA 4ILKA 3F3XA 4PIVA 5CVRA 2STTA 3GEDA 3SBOA 1VL0A 3DR3A 3GW2A 4XBFA 4OH1A 2W4QA 3I9JA 2GPTA 3ZNPA 4IXAA 4IJUA 5AXDA 2DFVA 3CMCO 3R0AA 4U0WA 2E82A 1FBQA 2IXBA 3ULQB 1KQ0A 3NDJA 3VFZA 3K1NA 2VYNA 5A04A 3KLMX 5KK1A 4WWCA 4J9VA 4EUHA 1I01A 2W2KA 1ZG1A 4I7HA 3PQFA 2GA1A 2XAGA 3I59A 3KZYA 4U0VA 1RM3A 5IG2A 5IZ4A 3BJAA 3AUUA 4BHBA 3PZBA 4B3JA 2VNSA 1EQUA 1X0VA 3O4RA 1XELA 3BMQA 5DZSA 4GQAA 2HMUA 2XUBA 1GV0A 3ZNQA 2E4AA 1GY8A 4DC0A 4ZYEA 3KYBA 2D1YA 4ZQHA 4A26A 2ADUA 1E5QA 4JQCA 4DWVA 2WTEA 1LI4A 1GYRA 1LRKA 2QUFA 1XLTA 1VLLA 1WWXA 1V0JA 2BF7A 3LLSA 4RVUA 4HLXA 3M2TA 2GZWA 3PWZA 3QA9A 3VZSA 5KVVA 2DO7A 3MQ0A 1JKJA 2Q2EA 4NK4A 2CFXA 1M75A 1WSUA 3OECA 4BO2A 2ZCWA 2JAHA 1VKNA 1IB6A 4OQYA 1IW7F 4CLEA 4RVFA 2NTNA 2QZ9A 4CICA 2CVQA 5HTOA 1ZIDA 1ZHFA 4IJWA 2HTJA 4MEXF 3LK7A 2F1KA 1W73A 5JCJD 1FP1D 1FMCA 1O5IA 2H09A 2HKOA 1T2CA 1U8XX 2VZ9A 4GH5A 4YACA 5L7TA 2YHUA 2B36A 3COSA 1U2DA 4W9NA 5DOVA 2IPQX 1NP3A 5CYVA 1PJTA 1R4NA 2GNAA 2J3JA 1H93A 4RZIA 4CMEA 5JC8A 3U1DA 4R79A 5KKAA 4TVOA 2P9CA 1FDTA 2XAQA 3H2ZA 3RWBA 5JDCC 1Z7UA 5CAEA 4NJOA 1W8DA 3GGOA 4EJTA 2X0JA 4RAYA 4UV9A 3AM4A 4ID9A 1TQIA 1XEAA 2C59A 2P68A 1MKMA 1GAEO 2NQ8A 3PQDA 3FNFA 5CPFA 5TGDA 3U4IA 4L9TA 3GFMA 3RKYA 4XJTA 4BIIA 3BHIA 4K1LA 1U2GA 3DTYA 3GEGA 4PLTA 4WGGA 2FPIA 1FBSA 1D8JA 2VYND 3T8RA 3RKRA 3INRA 3KLNA 1U5TA 5AIPA 4U6QA 5G0TA 2QQ9A 3V8LA 1FZPB 3BXXA 4FFLA 3K5PA 3Q9NA 3ONEA 4RPHA 2ESHA 1QR6A 3K2BA 4HWKA 2GIVA 3JD3A 4W7IA 5B4UA 3ZMZA 2FR8A 2PA3A 4MVJE 1K3TA 3ST7A 1XB4A 5E17F 4QWQA 2FR1A 4RF3A 3F8FA 3GN2A 3VH2A 3WGOA 1ZMTA 4XYMA 4E12A 3UCXA 1ZN2A 2CGPA 4Y9DA 5BPDA 1YJ8A 3DFUA 4DIBA 4EI2A 5FI3A 4BB5A 5C7IO 2JCXA 4A5MA 2Q2VA 3HFGA 3DFZA 5FD6A 4LVCA 1KETA 3ONFA 4UEOA 3LC1O 1SFXA 3MTJA 1WLYA 3WODF 3RUHA 3WBBA 1J5YA 3QE3A 4EZBA 3IKVA 5JO9A 4Q9NA 1YQDA 2P8TA 1JN0A 4K2EA 1Q1NA 5HDKA 5JNLA 4UAGA 3KFWX 3IP3A 4ENMA 3LYLA 1IN5A 3P9KA 1RM4A 4B4UA 1PR3A 2FRDA 2K4JA 5CPBA 4R68A 3T4XA 1P31A 4XB1A 2C7GA 4R1HA 4EQQA 4YEDA 3NJ4A 5HLHA 3PRJA 4J16A 3PJEA 2RHRA 1Y6JA 4MKRA 3G79A 3JW4A 1ZGJA 1XGMA 5BSFA 3G1TA 1ZUD1 2Q1UA 4L4SA 1GPDG 2PZLA 3LLVA 4RVHA 3QOPA 2X58A 4CM8A 4HXYA 5DP2A 3E5UA 4PZJA 4Y13A 3BAZA 3IC5A 3QVTA 4MHGA 1BC7C 4JJFA 4BKRA 1V3TA 4O6JA 4M9ZA 5TRTA 1GUYA 1ORRA 3EDPA 4YBZA 5FWNA 1ZARA 5EPOA 1AHIA 1L1FA 2Q1TA 2EGGA 1TT5B 3RC2A 1OZAA 3EZLA 5D5VB 1X7DA 4I2OA 2Q2QA 4AJJA 4N0BA 4HQEA 4ASNA 1SD5A 1BHSA 1DLJA 2C29D 2DTDA 3QVSA 4BNZA 1Y8RB 1O95A 1EH8A 5C7OO 3GZ6A 3Q9UA 3SFZA 3OIFA 1YJQA 1A71A 5KJ1A 3S1LA 1YG2A 1TBXA 4YWJA 4BO8A 3E5MA 2DBRA 2FN7A 4CQMB 5JC1A 3FPCA 1B8PA 1NHAA 2V6MA 4I9HA 4W4TA 4CLRB 3B1JA 2C5AA 1E2XA 4HW0A 1D4FA 3QPTA 3A06A 3FR8A 4B8ZA 3WTTC 2JD0A 2VONA 1P1JA 2NWQA 4M6XA 1YW8A 3FR7A 4WNCA 4A0YA 2PNFA 1UR5A 3IJRA 3VVCA 1ZH8A 2X1HA 3JQFA 1T4BA 5EERA 3GO5A 3M8EA 4XX0A 3I5MA 2ZMEB 3OQ6A 3FMQA 3P2YA 3PJFA 5AYVA 5CVJA 1LNWA 1I1SA 3EUHA 3GRPA 4M8SA 3RFVA 2ISZA 4XD2A 2HSDA 2DPDA 1MFPA 4C7KA 1F5TA 1G0NA 3GGGA 4QECA 5GMOA 3ZV4A 1IYZA 4PG5A 2EJVA 2VBWA 1U9JA 2BGLA 2ZJ2A 2P7VB 4OIPF 2FSVA 1T2KA 1ISHA 4U8GA 1PZHA 2H6EA 3MEQA 4D0RA 2MLGA 3BDDA 1O3RA 1NVTA 1ZSNA 3CZRA 3GUDA 2K4BA 1VKOA 3PDUA 1ZXLA 1LQ1A 4J1QA 1UFMA 5AQ1A 4BNKA 3ZWXA 2HMTA 1ZK3A 2YX4A 1R22A 1U7TA 4S05A 4CO8A 2E1NA 3EETA 3F22A 2FF4A 5COQA 3DZKA 1O3TA 1QLJA 3JAMZ 1YBAA 3K9QO 1E6WA 2NS0A 4KDPA 5F21A 2F5CA 3AOGA 5TQVA 4E33A 2PY6A 4L18B 2JRTA 2ZNZA 3GEMA 3F4LA 5BT9A 4Z0HO 1WAMA 4WLOA 1Q0QA 1I2CA 1BG6A 3HDYA 1R5GA 3E1KA 1LEBA 4RF2A 3P5SA 2EXXA 1P4AA 2QBYB 5CVVA 4R1TA 5K6AC 4YFNF 1TTYA 2XAAA 5K5RA 4AWXB 2W85A 1ISMA 2TMDA 3AWDA 4E5PA 2PGDA 2DBQA 4L0YB 1B8UA 2HU2A 3W6ZA 1KC1A 4L9RA 1A04A 1JLLA 3QWHA 3IRRA 3QU3A 2POQX 2F5EA 2JZYA 4L4RA 4FJ0A 1XGSA 4A73A 1XSVA 2L3DA 3DBHB 3WU1B 4NU6A 4IXTA 4W6ZA 5CVIA 1ENPA 4RLSA 1SAYA 2QRKA 3ZWCA 4YAJA 4G8XA 2DUWA 4GX2A 1WQ2A 2QWWA 3WTCA 3KSZO 4YJGB 4HBLA 2EJRA 1NQAO 4A7PA 3GK3A 2B4QA 3HN7A 2QM3A 2O4CA 4BS9A 2FHSA 1N7GA 5HLIA 3DMTC 4YT4A 4LCJA 2DPHA 1OFGA 4RPGA 1D3YA 2UWMA 1Z6TA 3BHMA 3JYOA 4RQUA 1YKFA 3D0OA 4FJ2A 1YH3A 2ZTMA 4FFRA 1NHWA 5FI5A 4L73A 9LDBA 2DM6A 3IWZA 1CWUA 5CDGA 1WZEA 5BQTA 4JP2A 2QZ8A 2J5RA 2A6EF 1VTNC 1DIRA 2NVBA 4MP6A 3PHLA 2PEXA 3V1TC 1F06A 3JSAA 1Y9EA 5C7LO 1HL3A 4HAMA 3KP7A 5TIIA 1P74A 1KVUA 1S8NA 3RI3A 2XKOA 2B35A 1CRWG 5B4TA 4NDNE 5DDIP 4WKGA 3LT4A 4GGOA 3RPUA 3SXYA 4IDGA 3WYCA 3QSGA 2DBBA 4O6VA 4LFUA 1E7QA 4OOIA 5TF4A 1A7AA 1OOEA 4FB5A 1FPQA 3E5QA 4HDVA 2KKOA 1HW5A 3R60A 1I36A 3ON5A 4ZYDA 1ZW1A 3WJ7A 3RPQA 2EWNA 3T5XA 3W8DA 2CZCA 3KP2A 3WGQA 5L7WA 3CKYA 1M66A 3CO6C 2DU8A 3IDSA 1JA9A 1VL6A 1BM9A 2BRUA 4ALJA 4DPLA 3HRSA 4I1IA 1R6DA 2B69A 4PLYA 3M6IA 4U7WA 3EYIA 4ITUA 1E1MA 4BOYA 2AG5A 4DBZA 4G6DA 1OC2A 2PFGA 4LMPA 2A68F 5T5QA 4MVJA 2HRZA 1DC3A 2NTVA 4LRTB 1T2DA 4TRRA 1PGJA 3Q11A 4PG7A 5KJFA 5IDYA 3E5RA 3NDRA 3GH3A 2FSSA 2WD7B 1FWZA 2E37A 2XGXA 1LSSA 3LSYA 4ON0A 1E1LA 3GEZA 2YFHA 2ZTVA 1S3JA 2C82A 1WWKA 1KIFA 2YJZA 4IPTA 4ESBA 1U2WA 3DZGA 1JU9A 3ADOA 4BNJA 2H5LA 3V2UA 2O3SA 5AXAA 2RH4A 2RBEA 3JAMK 1PJQA 3JD2A 3KV3O 2O2SA 1UXKA 1WDMA 4GXOA 2DUUA 3GUCA 1TNTA 2A9FA 4NG5A 3RUCA 4E32A 1MV8A 4F6LA 1B9NA 5IN5A 5JBIA 3RUAA 3VPXA 1A9YA 2F5FA 4DLAA 4WCFC 1W7PD 3KETA 4IHTA 3WS7A 1NPDA 4IDDA 4NBWA 1LDKB 2HFHA 4EMSA 3GZ5A 1LJ8A 1TT5A 5JDCA 1DC5A 5JW6A 4RGUA 2JJYA 3JYPA 4WOJA 4UULA 4IMRA 2XIGA 2D5CA 4CM9A 1Y8RA 3NYWA 1QV6A 1V6AA 2DT5A 3SXPA 4R4JA 5FGMA 3WGHA 4IM7A 4PG8A 1HQCA 3H7AA 2HJSA 1BI1A 2PD3A 4CQMA 4YT2A 1HW1A 4UVDA 4MKXA 4WK6A 4CLRA 1P9LA 4U0YA 3GFGA 2IA1A 1UAGA 1U3WA 2DLDA 3RJ5A 1ZGAA 2I99A 2K02A 2XXJA 3WB9A 4TWRA 2H94A 4DREA 3F23A 2C20A 1J2XA 3K0LA 2EWMA 4NMHA 2P4WA 3WR5A 1U28A 4A0ZA 3TO7A 3ITDA 1SZJG 5L51A 4XQEA 4G7ZF 2GCGA 2IZ1A 2DC1A 3BMNB 3C7DB 4I02A 2Y75A 3CUKA 1M67A 3T4EA 3H4VA 3QVOA 1IZ0A 2PZKA 2HMSA 4BVAA 2HK7A 1YTYA 5E8GA 1Z91A 3VKVA 4HNGA 1KU9A 1Z7BA 3WTYC 1UAYA 2EF1A 5F5LA 3C1TA 4XSZF 4QEDA 2C0CA 1SCUA 1JKIA 3P2OA 2D2IA 2JFGA 4JJIA 3CINA 1F9NA 3L0DA 4GPD1 2Y99A 1B1BA 4XR4A 3U4CA 4MNUA 4MO2A 2P4QA 2HKIA 5CG1A 4DQUA 1HDGO 3GAZA 1XD7A 3JQBA 2DK5A 1LU9A 5A3VA 4XEHA 4G7OF 1YDEA 2B0LA 2XPCA 4P4NA 4ZQGA 4RGRA 2M30A 2WMDA 3E6AA 1EDZA 2FMUA 4ALLA 1PJCA 3KXDA 1B3RA 1R58A 1P0FA 2X5OA 1PZFA 4HUJA 4XSXF 4H0EA 2WD8A 1SMKA 4J2HA 3ZHBA 3F4BA 2DU9A 3LQFA 3HNPA 3PFFA 2VBXA 2W24A 3J7AO 2ZB4A 4XQCA 5JSFA 2FBKA 3SVTA 1RM5A 1ZK2A 1G1AA 3ZWPA 5BNTA 2ZXJA 5JFRA 1ZSVA 2HDHA 4RL6A 2Q1SA 2QBYA 1EMDA 1IL0A 1DFIA 4HLYA 2AEMA 1YWGO 5T8KC 1FP2A 3BMCB 2I66A 1F12A 2TMGA 2FWMX 2V1DA 1H9TA 1OYIA 1HDRA 2YYYA 3N4MA 4L0ZB 2ZB7A 4ALMA 4CM9D 4XYLA 1J0XO 1V3FA 4RVSA 2YU3A 4UUMA 3W8FA 1ZG5A 4XGIA 5ADHA 3P9CA 3WIDA 4N9HA 3DBHA 4CQMD 2F2EA 2WSBA 4MDHA 3ZI0A 3LAJA 1KYZA 5I8WA 3W1VA 4OIQF 4J4BA 3ULKA 2OMEA 3DBRB 1PZGA 1K2WA 5TT1A 3JSPA 4YJGA 1LC3A 3K6JA 5JLAA 4P8RA 3GFJA 1S7AA 2BBYA 3I6IA 4B7UA 2EFOA 1GFSA 2O0YA 5FO5A 1UXHA 3WGZA 3UH1A 1IE3A 4HZFA 1ZZEA 4WPGA 4HV6A 1Q0HA 1ID1A 5IZCC 4YRAA 2P5YA 3LAPA 3ITKA 2DQLA 1HSTA 3SHFA 2HK8A 3VEPA 1YQGA 4GWGA 1E3JA 2QQAA 3PYLA 4HV4A 3I6QA 3WWYA 3E03A 2VTDA 3TFQA 3COAC 4WXCA 5DCUA 3H9EO 2QZZA 3TOAA 3ZMVA 5IJZA 1LDNA 1KVTA 1STZA 2AQKA 1LLUA 3DZHA 3G49A 2IEBA 1EVZA 1ONNA 5F1KA 5DD4A 2Y1GA 3C1OA 2DK8A 4KDFA 1U3VA 3ZN2A 1O7FA 2CMDA 4GLOA 1MGTA 4CZZA 5G0VA 2QVOA 1P3DA 1XSEA 2DBZA 1AUPA 3O26A 3WFJA 2JSCA 3WIEA 5A3JA 3UN1A 1LSJA 1HE3A 4S04A 5DUIA 3MWDB 3UAGA 1T1RA 2UDPA 2MH2A 5D8KB 2E7WA 2ACJA 1LNQA 4WLEA 4AG3A 3F9IA 4CUZA 4N9IA 5LHGA 1JW9B 2TDXA 5A02A 1Z45A 2NVWA 2VT3A 3DHEA 3INTA 3C8MA 3QWFA 5ILGA 3UGKA 3WLFA 4NIMA 2W8ZA 1E3LA 3HRMA 3HHPA 2I9PA 3OEWA 3TDKA 3MZYA 1IZ9A 3PPIA 1NQTA 4DA9A 3E48A 2J3IA 2IDZA 2R3SA 4XWYA 1DJNA 1YGYA 2GSDA 2WD7A 2X86A 2BI8A 3BTVA 1JHFA 2BV6A 1I5ZA 1H6CA 2XXBA 2VE9A 3ZWYA 1R15A 4P55A 3WJAA 3CSDA 2UYYA 3F8BA 2AW5A 4QO7A 2W57A 4KQWA 4YYZA 3JQ9C 3HYIA 2WWRA 4FFNA 5JCXA 2VRCA 4BMSA 2I76A 5JI6A 4L4XA 3ENKA 3PQJA 2VNAA 2IODA 4IRIA 4P22A 4TROA 3ZN1A 1GXQA 2VQ3A 4BMNA 3MWMA 5FFFA 1YFHA 1HE4A 4RQTA 4GYIA 3EYYA 3NTOA 3MCVA 3CXRA 4K6CA 1Y9AA 3WICA 4DPMA 4M6YA 1DXYA 5U4QA 3HDQA 3U9GA 4EUFA 2O7QA 4LMYA 3JCZA 4RLHA 1MLDA 1R66A 1WVGA 2EHDA 1YE3A 4RF4A 4AFNA 4ZQBA 4B3HA 4DMMA 4XDZA 2HQ1A 1LDMA 4CV1A 1ZAOA 1DRVA 1QYWA 4JQFA 4BHCA 1B26A 2P2SA 3FHLA 3T7CA 4NQWA 3HDJA 1HKSA 1YS4A 1MFZA 2CSOA 3MZHA 3QRFF 4EEZA 3PZRA 4UUNA 4QSMA 3GYHX 3UHAA 5HM8A 2ZFWA 1IN6A 1HYHA 1Y7TA 3JTGA 3EZYA 4NR0A 5JAIA 1GVJA 2Q8KA 3JTMA 4A2UA 4IJKA 4E70A 4BNLA 2PN6A 4AIJA 1XMAA 3BMNA 1XQ1A 2G17A 4NH4A 3F6OA 3KB6A 3X2EA 1U1IA 1F4KA 4WASA 4R01A 5T57A 2NADA 4EDFA 3PXXA 4LN1A 3P9IA 3FM5A 3QP9A 1SAXA 1QYXA 3AUAA 3S8MA 3QP5A 5KVRA 4KTVE 4BGVA 1X0XA 3RASA 2FMLA 4XDYA 1F0YA 3P7NA 2PWZA 2GZ3A 3D5QA 4E2ZA 5L3CA 1E3WB 3BMOB 3U49A 1KQ8A 4EYEA 4L5JA 4OHUA 2PTGA 2V6GA 3ZMSA 3RUEA 4A6EA 4NBVA 1K6OA 2JD2A 4BHTA 2ESNA 3HIFA 2EW2A 2LKPA 3N97A 2YDXA 4KDEA 1AWCA 4GSLA 3IRQA 3GHYA 3VKUA 2VRCD 1EQ2A 3K73O 5DF1A 1W6UA 1JGSA 4OIOF 4NBRA 3HN2A 4J7XA 1WDKA 2NV6A 3R3JA 1RUNA 1FSHA 2FXAA 1Z6RA 1HWYA 2P9GA 3QRWA 4A10A 2FSWA 2OORA 3V2HA 2YQ4A 1CEQA 4QX6A 4Y15A 1ZLKA 3BMCA 4BNUA 3NT5A 4QXMA 2GN6A 4NBUA 1VI2A 3UICA 1KU2A 4J9UE 1WI9A 4URFA 3GGPA 2A69F 1YL5A 3HTSB 4HFRA 2O4UX 2CYYA 3C7JA 4O5VA 1IPFA 2I67A 3LDHA 4IIVA 2F00A 4ZU3A 3CUQB 3I4PA 5JFOA 2O61A 2YHIB 1S7OA 2L01A 2UZKA 5JO0A 2B4TO 5DCWA 2OA4A 4MINA 1UXJA 3L9FA 1PJBA 1X13A 3DBRA 1SO8A 2JPBA 5LC1A 5L53A 4R5HA 4Z6KA 1ENZA 4IY1A 2NAZA 1TVEA 3CJNA 2UV8A 3JYNA 3IL2A 1MJAA 1YW7A 2NACA 4BKUA 4GLLA 5HS4A 1ZG3A 4EJVA 2YV2A 3ZNOA 2AG8A 4ALKA 1D5VA 3DZFA 1LTHR 1NWCA 2Z1NA 2KRFA 4E5YA 3I1JA 3IMFA 3NTQA 4XRGA 4TZTA 4GX5A 4JLWA 4DIFA 3O38A 3RTRA 3KSUA 3HSKA 5DDGA 3BPXA 3OM9A 1ENYA 2L54A 3PQKA 1H0MA 2AQIA 5THQA 4J2OA 2IP2A 4GO1A 4JP3A 1TNSA 2B5WA 2GD1O 4RB0A 4ZZLA 1BIBA 4FFOA 3R4KA 4IUYA 1Y5MA 3DB2A 2G9WA 4XCVA 3HSFA 4CM6A 2ZATA 3H9QA 1X3UA 1EVIA 3QLJA 4B09A 1IAWA 1XCVA 1I1GA 4L9VA 1EZ4A 2V1XA 2GLXA 1EFKA 2EW8A 4P4GA 5ITWA 5HWSA 5G4KB 1LDBA 4Q3CA 1BDBA 1ZEMA 5COAA 2RN7A 4WXDA 3WTSC 1HDZA 1VJ1A 2P5UA 1OC4A 3HZZA 5E1XA 3Q0EA 4O0LA 3MEXA 2JD1A 2UVDA 3FWEA 4Z0PA 3G3EA 4LRSB 3CLOA 3FMRA 1MUUA 1LDDA 3BPVA 5CVUA 2D3TA 2GWRA 2EJWA 3L2CA 1P1FA 2G0TA 4Q48A 4RORA 1XN7A 2PLYA 1M6HA 2BELA 3GT0A 3L9WA 3BY6A 4NQZA 4ND2A 3BTOA 2VWQA 3OQ1A 1I3LA 2QYSA 2VOOA 2AQ8A 2OBNA 2O3JA 2QENA 3DO5A 4TRMA 2EFWA 5DOZA 3QHAA 3UUWA 3T1BA 2WM3A 3VAZA 3KOUA 4EGYA 3PFWO 1BIAA 3I58A 2H27A 2AA3A 2BFAA 2YW9A 4BNVA 2EEZA 2PBIA 3EVNA 2AQHA 3FNHA 4PRKA 4FIZA 3VPGA 1GU7A 1ULUA 2P6SA 1HKQA 3DOOA 3JD0A 2CD9A 5BMZA 4EUEA 1T2AA 2EIHA 3C3XA 4K6FA 3WQRA 3LT1A 2IA2A 3NEUA 5DBFA 1P44A 1Y5RA 2Z3YA 4EEXA 2YQ5A 2UUOA 5DCMB 1DAOA 1PL7A 2P4HX 3KZVA 3L9XA 3ZMTA 3ASVA 4IINA 4TRNA 3FBGA 3H2SA 3KYDB 4INAA 4B4OA 5IFLA 1KEWA 1W5TA 1RM0A 2FP4A 4TRJA 3RFXA 3VHRA 4CM4B 1DLIA 1KQ9A 3NRVA 4AD9A 4KUMA 4GVLA 4JBGA 3UCFA 4UREA 3SEFA 2Q2WA 3WGYA 4JNKA 4HA8A 3KP4A 3GZ4A 4U7BA 4KFCA 3EUWA 3H3UA 1P92A 2CQKA 4YRDA 3D0SA 1XYGA 5EINA 5IZCA 4UVEA 1JVBA 1BN5A 1GZ6A 2X6TA 4OSOA 2PMHA 5DT9A 5G4LA 4BGUA 1F8FA 3ZV5A 4E0BA 3IP1A 4UVIA 1CF7B 2QLZA 3RFTA 5ICFA 1W4MA 3ASUA 2XVCA 2VUSA 1U3TA 4MVJP 4PFJA 1S7CA 3WFIA 3JQEA 2UAGA 1E7SA 1YW9A 1EUDA 3BA1A 4BKOA 5DD8A 4Z3KA 5BS6A 3D5TA 1RZ4A 5E1ZB 2LF8A 2CUKA 1PTJA 3RKXA 4QQRA 3ZGYA 1UDAA 2D0IA 4RVDA 1E6UA 1HKUA 4ETSA 4BNFA 5KJ6A 1HE2A 4XA8A 1SD4A 3IUPA 3DZBA 4ZYGA 4LSMA 1ZJYA 2AHRA 2Q4BA 2EG9A 4WNIA 3H8VA 4LB6B 4QFDA 3TZKA 3ZWBA 1KU3A 4EW6A 3GF2A 2PKQO 2AS5F 4R8HA 1IHXA 3EY4A 3FWNA 4NJMB 2NU8A 2DBVO 4KUGA 3QJ5A 4GGGA 1H94A 1LB2A 4CV3A 3L4BC 4RCVA 1TQMA 1HTBA 1IOLA 2PFBA 4F7ZA 1I6XA 1U78A 3LC7O 4MP3A 4D3DA 4IDEA 5JXWA 1WNTA 2WWYA 4Q4ZF 4RGBA 1CJCA 3KP5A 2BFMA 2Y1EA 4FN4A 2UXNA 4HNHA 3HFSA 1BC8C 4NK5A 2OZ6A 3O3KA 2O50A 3OIDA 3DEYX 5DV5A 3B73A 4MPDA 2RGVA 3QAHA 3I5UA 1E3WA 2ZB3A 3AU8A 1O0SA 2X9GA 3BMOA 1PJ3A 5ENVA 1PWXA 1XIVA 3V7RA 2A4KA 4CHUA 1YDWA 3OV8A 4I5FA 3QVWA 2RHCA 1QLHA 5DBIA 4CMIB 2WYVA 1SD6A 2I5PO 3R6DA 1CERA 3TKYA 4KUHA 1ML3A 3SX2A 3Q5FA 1KVQA 1B15A 5BNFA 3RUDA 1QYCA 3EW7A 1NFQA 2CW0F 1R1VA 2WYWA 3WTXC 4U88A 1NAIA 3F46A 3JQGB 1MC5A 1T2FA 4YR9A 2CFCA 3F6VA 2FRHA 5BR7A 5JDIC 3L07A 2LNBA 4BNGA 4CLDA 2EV5A 4PLGA 3GVCA 5G2OA 5L4NA 3F8MA 1S29A 4CDGA 1IUYA 5JAMA 5IXSA 3EMKA 3WWZA 4AJOA 2VC1A 2YSRA 1ZBQA 4GVXA 4B3IA 2X9NA 3L6EA 4U0JA 3CUQA 3QQPA 2VC0A 5HS8A 2YHIA 3PYMA 3FF4A 2KIFA 4OL9A 3OJLA 3M8FA 1FYLA 3CUOA 3RI4A 1D1SA 5C3MA 5MDHA 1QO0D 3JYQA 2W25A 3O6BB 2PH3A 3SZPA 4BO9A 3M7GA 2AE2A 4FC7A 5F3RA 3AJRA 1P0CA 1PGPA 5THKA 2BKAA 4E2YA 4KA4A 4Q39A 3FX3A 1OMOA 1MDMB 1R1UA 4Y6RA 3UOGA 3FXUA 3MJEA 1BXGB 1GCUA 3DAPA 3BHJA 3PI7A 5I7SA 5L9AA 4FHTA 1N7HA 2J6IA 4U0KA 4PDKA 3T8TA 2V6BA 5E18F 4TKMA 4KMUX 1ON2A 5B37A 4BO5A 3VDRA 2O03A 3DV8A 2RIRA 5TNXA 2G1UA 3ANLA 3M1AA 3F5QA 5T6BA 2W98A 1RIOH 3ELKA 2WE7A 4IQ8A 1PJ2A 2GXBA 2PKQP 5TC4A 3ROQA 1VRWA 1U8FO 4DMLA 2FOIA 1H9AA 4UVAA 4GKBA 4ENJA 4J1NA 4IIUA 1ZVMA 2W90A 3VTZA 3UKOA 3B1KA 4CJXA 4CM7A 2G7HA 1B3BA 2E49A 2Z5UA 2Y0MA 1GYQA 2NM0A 3JV7A 3VPSA 2QG4A 5G4KA 4RDHA 1FYKA 4RPLA 3PHJA 3TQHA 1NASA 1IXSB 5JYDA 3PK0A 5KNLA 1N1EA 4NHEA 1CYDA 4ZZDA 4Y98A 4ZH4F 1RJWA 2PZMA 2VUUA 2Y1FA 3KZZA 4O59O 1WMBA 3RC9A 3ZNNA 4LLNA 2STWA 2PK3A 2CDBA 4JK1X 4J0FA 1SMYF 1LSOA 1KEUA 1ISFA 3ZH2A 3KHUA 5TS3A 2MC3A 1DO8A 1DIBA 1QV7A 1SMTA 4DRYA 1NX6A 1PQUA 2IRFG 1LJ9A 4NNJA 4ALNA 4D44A 4AJKA 3RJPA 3F6YA 5TLSA 4G5HA 1FDWA 2A6HF 4GX0A 2XAFA 1LVAA 4R3WA 4XIYA 4BKPA 1HDYA 4PVCA 4YQYA 3NGLA 4CMGA 4R9RA 2Y68A 4BNWA 2CVOA 2RQPA 2CG4A 5JVTA 4LB5A 3A4VA 4MP8A 1E0DA 3W4JA 4D0PA 4UNOA 3PEFA 1EEHA 3NUGA 2DAPA 1KYWA 5DCMA 3BWGA 4LLLA 4AVYA 1O9BA 3PJGA 2H6CA 3KYDA 2R00A 3O9ZA 4CMJA 5F6FA 1CGPA 1SB9A 3AOEA 3H65A 4CM4A 5T67A 2OXIA 4H16A 2EA4A 1KYQA 5DN9A 2NQTA 4KWHA 3C85A 4PN3A 2EFQA 3I23A 1GUZA 2GN8A 3ROUA 4P96A 5TJHA 2K27A 3R1IA 2G5CA 1Y8QB 5C37A 5TJJA 2NVUB 3L09A 3VH1A 1N1GA 3PWKA 4RB3C 1CF7A 4BV8A 1LBEA 2DTEA 1VM6A 4YJFB 1PZEA 2NU7A 1ONPA 3ZW9A 3S2WA 2RVCA 3LVFO 1UP6A 1YONA 5JMPA 2J5OA 2YY7A 3PTZA 3H9GA 4JJGA 1JQBA 3IQDB 4KUEA 4O5OA 1ON1A 1JXSA 3CTAA 1UJMA 5F64A 1C3VA 4HX5A 1MG5A 3CDHA 5CDTA 2EKPA 2K7LA 2VYVA 3S2GA 4D7AA 2RH8A 2BE5F 3G0OA 3JQDA 3VB2A 2IZ0A 3NRCA 1K78B 4U7DA 5IT9Z 1SC6A 4Q3BA 5D4SA 3VZRA 4AJPA 3EK2A 4LCEA 4YIFA 1UZLA 4G9YA 4WK8F 4JIGA 4RV9A 4AICA 3C7AA 1IRGA 4WLFA 2PD4A 4EGFA 1GQ2A 3TO9A 4NJMA 3GQVA 3GVIA 3TZQA 1NVMB 1GQYA 3U0BA 4RF5A 2DTRA 1G3YA 1B7GO 1NPYA 4FFMA 1AGNA 3S2EA 1T6SA 3DQVC 5J6XA 1J4AA 3G17A 4GGPA 1R23A 1S6LA 2UUPA 5JY6A 2FNAA 2EB7A 2XROA 4YXFA 2HZTA 5MGBA 4FT8A 4A27A 1PWZA 3QW2A 5LRSA 4P9UA 1MG0A 5LEJA 3LA7A 4MVJM 2O8XA 2A35A 3FRJA 4YT5A 4E4YA 3TO6A 2Q99A 5A03A 2WV0A 1E77A 1A7KA 1N92A 3B70A 4PZDA 1Y0UA 4BNXA 4R5MA 2JFFA 2OQGA 1B4AA 5DCFA 1BXKA 3KTDA 2QW8A 4J1TA 5KJCA 4E21A 1E7WA 5L3FA 2OZUA 1GZ3A 4CMIA 3R0JA 5JYEA 1EBUA 5KCZA 5E1WA 4PLPA 2YR2A 3FD8A 4KMSA 4PGFA 5EIOA 3UFXA 1B59A 1HZZA 4CODB 5CDSA 2VE8A 4JN6B 5AIQA 4RGXA 3ZCXA 3JQGA 2V1UA 3O03A 2V79A 3VOEA 2GN9A 2GA2A 4IDCA 3NQOA 8LDHA 5FFZA 4I5DA 1WXDA 4IDBA 2GN4A 5FYDA 4BQRA 4FW8A 5A5EA 1AN9A 3CH6A 3K9TA 1J49A 2FNPA 3F47A 4PZCA 5EMHA 4R69A 5KVCA 3AY7A 3TL2A 2O6GE 2I6TA 2OO5A 3JQ7B 1Q0LA 4MKZA 3HSEA 3LWFA 3CPSA 3PIDA 1NXQA 1GHCA 3KUXA 3VPFA 1S6YA 4HX7A 2HYGD 4I0BA 1SPXA 3K1MA 3GDFA 2VYVD 4D43A 4EITA 2HO5A 2Q4EA 4DQXA 2YFQA 4LVUA 3ETGA 1PS9A 4HP8A 3LA3A 4TMFA 2PG4A 2P5VA 4S3MA 2X0RA 4CL3A 1TA4A 5D6EA 4D0SA 1BTOA 1ZSYA 2ZMEA 1MDMA 5AXCA 2E48A 1J7KA 2CWEA 2A07F 5G0UA 3W6UA 4L9JA 1BXGA 3WNVA 4BNCA 1JKFA 4RPJA 1SB8A 1PQPA 1R4MB 2NU6A 4MVJD 4XJSA 4ESOA 4AIKA 1PS8A 2QIOA 2XV4S 5TT0A 4LLGF 2LF7A 3WDSA 4IPAA 2VOPA 4OM8A 2Y67A 5D5UB 1J9IA 4H15A 1PIWA 4FGWA 4W7HA 4WJZA 5HBRA 5GZ1A 2Z33A 2OOSA 2ISYA 2PMUA 3ZV3A 2C2YA 3EQLF 3QWAA 3B20A 2A61A 1XWFA 4ZJUA 5ER6A 4A0XA 1GZ4A 3EDMA 2JCYA 2HCTA 1Z9CA 1NNUA 1OR7A 1UUFA 1YBMA 1YVEI 2IVMA 4O63O 2AXLA 3G1UA 4RB2C 1XDUA 2DFIA 3L6OO 2PGLA 4K26A 4XRRA 5JAZA 4R16A 2M8EA 2VUTA 2PH5A 4M72A 4BXUA 4EGZA 1XDWA 5IT9K 2ILTA 4WF2A 4LGWA 4II3A 5JS6A 4WCFB 3GR6A 4DLLA 4N54A 2DPUA 3DAGA 4NFSA 4YFXF 3GDGA 3C18A 4OAQA 1H6BA 4TQGA 3RCBA 5I9MA 2Z1MA 5KVSA 5DEQA 1EH7A 1BGVA 4A12A 1D1TA 1DB3A 3HUDA 3MJVA 5L3GA 1KA8A 4EV0A 4B7CA 1R1TA 4MIOA 2ZYDA 4KZPA 2D8AA 2Q1WA 3JQ8B 3O8QB 4EM1A 2VN8A 4R54A 4YAKA 3RYRA 5IDXA 2GZ2A 4MOWA 4LSWA 1XSXA 4ESFA 1OBFO 3V8JA 2JPCA 1R0LA 3HE3A 4FOSA 1G6NA 2DQ4A 4WEOA 1FY7A 4UEJA 1DJQA 1IXRC 5A06A 1LX6A 1OMIA 4DPKA 1Z73A 4UV8A 4UVGA 4N5MA 4XQ9A 3S2IA 1W4ZA 2PQ8A 3R61A 1T26A 3B1FA 1W0CA 4PGHA 1YB5A 4L9NA 3U4HA 4CMAA 3DBLB 2ZO4A 1ISJA 2EGHA 3D4NA 5ERIA 2FA5A 4FQ8A 3C1DA 4IQGA 1T2EA 3GFBA 3ECHA 1DFHA 1K0UA 5JAQA 1BMDA 3DTTA 4W9NC 1NPTO 1LEAA 5L3BA 1PSDA 2D45A 2P5LC 1LDEA 4CMEC 1Y8QA 3UXYA 1X7HA 3LQRA 2NSDA 2Q3EA 4Q47A 1HT0A 3E9NA 2NVUA 3FCOA 4L0QA 5EJ2A 4MIYA 3GUYA 4C7JA 1MGOA 3VZQA 1J6UA 3HDHA 5IAAA 1C14A 3S2FA 3OICA 4YJFA 2Y05A 3PYXA 1FDVA 2LDXA 3AI3A 3GX4X 1BBYA 3GVHA 5HS6A 3REOA 2R7DA 1AOYA 4GMGA 3RKUA 2BYVE 3PIIA 4J0EA 1BW9B 1R0KA 2BFPA 4EJMA 3AY3A 2PLAA 1HLDA 3O2PE 2YV1A 5KVQA 4X54A 4CR8A 1BWSA 3DPTA 1I2BA 3HOSA 1TLTA 1Y81A 3OSUA 4FSHA 4NFHA 1RNLA 3E5XA 3NDIA 5TSDA 2D2WA 2WDZA 3L77A 5HS9A 4YPOA 1BOAA 1Z7EA 1K78A 3MTGA 2D1HA 1Q2XA 1QP8A 2Q0OA 1YO6A 3IAHA 1UH5A 4AJLA 1T4DA 4ZVVA 2ZIZA 2O3QA 1LEHA 4AJ4A 4PLWA 2XAJA 5K6AA 5LHHA 4AJHA 5HOOA 1FLIA 1EVJA 4J4HA 1ZYRF 4I01A 1Q1HA 2YUTA 1VJTA 5CEEA 5LLQA 2ZYGA 2NUAA 2O7SA 4AJ1A 1I8TA 4LK1F 2YZ7A 1E3IA 4UXNA 3TJRA 2IT0A 3K96A 2BFOA 2IYOA 2Q50A 3VTFA 4GX1A 1V9LA 1UZNA 4OMUA 4PG4A 3ROPA 4NPCA 3DONA 4Y8VA 5EEHA 5K9ZA 1DDOA 5B4VA 1J5PA 2DFDA 3KO8A 4PLFA 4II2A 2QQBA 2HOEA 2A3SA 2O3RA 3NEPX 4XYGA 1D8KA 2X4HA 1WW8A 1X14A 3GZNB 4P38A 1T0FA 4KYWA 4BGIA 3DMTA 4XLNF 5K1YA 4A5OA 5IF3A 1GYPA 4PLVA 3WG9A 3K69A 3Q2IA 3SLKA 1H2HA 1YS6A 2JHGA 4GYGA 1PUEE 4ZICA 4FCCA 4Z2YA 3F5SA 4IHSA 2ZBKA 5ICEA 1FXSA 3J80K 4IQ0A 3EHEA 1I0ZA 1RUOA 2JAPA 4N5NA 3GPIA 6LDHA 2PR2A 5IDWA 1NR1A 4HFJA 4DBVO 2PI0A 2VOEA 1ONOA 3DKWA 2DLLA 1HE5A 1HKTA 4EM2A 3GXOA 4G94A 4B4VA 4GWKA 2XAHA 4MGRA 1K79A 1XGKA 4MVJG 4LJZF 3JQ7A 4BL5A 3VH3A 3IHUA 3D5LA 1I33A 2X4GA 4JK3A 4I09A 1A27A 1BI2A 3AM3A 3E97A 3QV1A 3RVDA 3DXJF 1ENOA 4FGSA 4O1MA 1YS7A 1FSEA 4YIIA 3GRKA 2RAFA 3KP6A 7ADHA 4PCQA 3EC7A 4KWIA 1KEVA 4BV9A 2XHKA 3M1LA 3LQQA 1RYEA 1UP7A 3B6ZA 1DAPA 5A2QZ 2DAOA 1E1KA 5GY7A 3AFMA 4YT8A 1R4MA 5FFXA 3HTUA 4IS3A 2IA0A 2X7HA 1KGSA 3JQFC 3MOIA 5JE8A 2HRBA 2Y0EA 5C5IA 3L7WA 3TF5A 2HS5A 2BI7A 1BI0A 4YAGA 5L40A 3ZHXA 4AL4A 4NB5A 2QQ5A 3NGXA 1C0PA 1L7EA 1JAXA 2LDUA 4B8WA 4Y17A 1LLDA 2C54A 1WRJA 2R7FA 3OOPA 3JD1A 3WTUC 3AFNA 2EFNA 1IRFA 1C1DB 1I30A 1WMAA 2XOXA 4I0AA 3KRTA 3UF0A 4OXYA 3GFIA 1GTMA 4E30A 1H9GA 1D3AA 4R3NA 3FNGA 4QTZA 5H83A 3DZJA 4G2NA 3DC2A 3KVOA 2ZQYA 4LMRA 1WKMA 3JQ6A 2OP0A 3DPLC 5D6FA 4WCGA 1HYGA 1QBJA 4ND4A 2AE1A 4AJ2A 4BYYA 5A4DA 4ZA2A 3V7SA 3A1NA 3ICCA 3TDZC 1KOLA 4WCFA 3QY9A 1ZK4A 4GMFA 2BLLA 5CEJA 2PD6A 5KTKA 3BJ6A 1T25A 3ML6A 4BH9A 1DPUA 2JHFA 3D3EA 4MIEA 1UDCA 1DRWA 3VH4A 1U5CA 4IDAA 2DW4A 5H81A 4R1SA 3PFIA 1SFUA 3JQ8A 3O8QA 4WEQA 2OGUA 4HOBA 3HOTA 4ENKA 1E92A 3HB4X 1TI7A 4OGWA 4M73A 2ZQZA 4PVDA 5IDQA 5IXYA 3F72A 3ZMDA 4L8VA 5LGUA 5HDNA 3KLOA 1G4DA 3WTZA 2EP7A 3NV9A 1MP0A 3GAFA 3GNTA 5I9NA 4Q3EA 5CP8A 1VSUA 1B6AA 1I32A 1JDJA 1XGOA 4OIRF 3FN4A 4JBIA 5DCYA 4RZHA 4OKNA 3DBLA 1ODDA 2FE3A 1H6DA 1ULSA 5BOXA 2A94A 2B4RO 4WLNA 1TEHA 1X15A 4J91A 4YG2F 5FLXZ 4MQVA 1ZH5A 4OIMA 4IRGA 1DHRA 2ZCVA 2NTJA 4ND1A 5JCJA 4M9SA 2V65A 2HGCA 3RIHA 1P77A 1HSOA 3V1YA 2P9EA 1T98A 1BSVA 2EP5A 4KIGA 3BTSA 4M89A 2G7UA 3HJAA 4BB6A 3E3VA 1P1RA 5ILSA 3ZP5A 3ZWMA 1SOVA 4OINF 2E1CA 4CLOB 1U7HA 3HQ4O 3NT2A 2EV6A 1GV1A 1K6XA 1XR3A 3IUSA 4DUPA 1G3SA 4FBGA 3PVZA 3OJOA 1DC4A 1BW9A 2OZPA 3TWOA 4B7XA 3GLXA 5ILUA 3X2FA 3QWBA 2Y1OA 3E18A 4BNTA 5HDGA 1WZIA 2BD0A 1DPGA 3WYEA 3IWFA 3ERED 4OJNA 2NYXA 1MZBA 2UXXA 2Y0DA 1R37A 1T38A 3I9KA 3ETDA 5LHIA 2CF6A 3GY0A 5HLGA 1V3UA 4TVBA 1QRRA 4I5GA 4Z9YA 2VOJA 4Z0TA 3KEOA 4MTEA 4I9UA 3I54A 2VHWA 4LK3A 5LEKA 4WECA 4J49A 4CQLB 2ZK7A 5F1OA 3OH8A 4BNMA 3TSCA 2RCYA 3H3FA 5A2QK 4JGBA 3NT4A 5T8KA 5LGTA 3M1EA 3WLEA 1UHMA 2NNNA 1PDNC 3ABIA 5FEUA 3F8NA 1KS9A 1Z05A 1OYYA 2RV8A 1UXIA 4FDAA 1QORA 1TXGA 4IDFA 4M54A 2FQ3A 4IMPA 4PLHA 4NFYA 3LT2A 5I9LA 1UCRA 2HLPA 4JROA 3PWSA 2ZCUA 3IJPA 4KP7A 2HQNA 4OQZA 3J81K 2WEKA 1H5QA 1GR0A 3DZIA 1EK5A 2LSOA 1A5ZA 5A5FA 3WYBA 2GZ1A 3BP8A 3SJUA 4CM5A 1DEHA 1CETA 2EFPA 1QPMA 3LC2O 1B9MA 3KLPX 3GZNA 1QKIA 3V7CA 4RDIA 2GQQA 3FXQA 3KEQA 2OP1A 4F46A 4AJEA 3DOJA 1ZRFA 1QNTA 4HDUA 4FPXA 2XF8A 1G3WA 1MJBA 4JX8A 3HADA 3CMMA 1XMKA 4KIBA 3C24A 3AW9A 1HETA 1NFFA 1F17A 1SBYA 1PEDA 3PLRA 1HBXG 4J7CA 3U2RA 2O3TA 3IC7A 3K30A 1DP7P 5AOVA 1BRMA 1R00A 3MAJA 1N5DA 1O94A 2CDAA 3MWEB 5LRRA 3AI1A 4D41A 1QYDA 2OQRA 1PJSA 2VZ8A 5EESA 4YDRA 4R1UA 1HXDA 5LDHA 2RNJA 1NWHA 4YTEA 3JQAB 2CO5A 5JY1A 1W7PB 2PGJA 2KJBA 4Q3DA 3VZPA 2I3GA 3WE2A 1REPC 4Y6PA 5BSGA 1P2FA 1DUXC 4XRFA 1ARZA 3U5TA 4WX9A 4TSKA 2FZWA 2WTBA 3DP7A 3ANMA 2GO1A 5H6RA 1MXHA 3GOHA 5A05A 3MJCA 2RC4A 2PV7A 2D5AA 2FY8A 2P6TA 2ZB8A 3W4KA 4CLXA 4WE3A 5DBGA 1ONVA 1DIGA 3DOCA 4DXHA 1PR9A 3RDIA 3ICPA 5TJ9A 3S55A 4HYEA 4M55A 4UUVA 4OXNA 5BNIA 2R2GA 3WBFA 1TT7A 2O2YA 3UVEA 1H2BA 5FLXK 4BGEA 4CMBA 3KP3A 1R0SA 2VBZA 4UVBA 2VWHA 3AK4A 3OETA 3EGOA 3FPLA 4LW8A 1FX7A 3WU0A 1HW2A 1PGQA 2GYYA 2IE0A 1P4XA 2NLOA 4WUVA 1T24A 1P4WA 3N58A 5CDYA 5ILVA 1O3QA 1X1EA 4J43A 1IY8A 2J8ZA 3F1LA 3H9JA 5EEGA 4L76A 3RROA 4CUJA 4PLCA 1C1DA 4AJNA 3HHHA 3OMLA 2BMAA 2G76A 3OF2A 5FF9A 3GNQA 3HB5X 5HS7A 4CMKA 8ADHA 3OHSX 1B2LA 3VOSA 3GG2A 4BNYA 3L00A 1I3NA 4EJ6A 2V7PA 4EM0B 3JQBC 1N8KA 3ZWAA 1BJAA 1O8CA 3GDOA 4BO1A 5B12A 4G65A 1JVSA 4J3FA 4A6DA 3JQ9A 1LA2A 1TW2A 5ICSA 3FZVA 1YBVA 3IIEA 3I9NA 4U6SA 4F3YA 1BXZA 1KY4A 3M2PA 1IN4A 2FEZA 4I98B 4DQ2A 2KIUA 4XLPF 4NHJA 1XQ6A 1YXMA 1IN8A 2IRWA 2ET6A 1KVRA 2P91A 2VHYA 2P7CB 3RU9A 1AXGA 2OD5A 1BDMA 3ANNA 2DI3A 3GFLA 1FF9A 1H6AA 3FWZA 2CDCA 1SOWA 5U1PA 2DVMA 2ZKZA 3WOHA 2QHXA 2GR9A 1V4RA 2M5WA 3C1AA 4J4TA 4OU0A 2GGSA 1WP4A 4ZN6A 4IZIA 4E2WA 5LCXA 3QPHA 1Z75A 4J90A 3DXFA 1GADO 5KKCA 1Z1DA 3BOQA 3FXRA 2HWVA 4M71A 4HF0A 1K5HA 1CF2O 3Q3CA 1F1ZA 3U4DA 3D7LA 3V8BA 2D1VA 1EE2A 1U3UA 1XHLA 3WXBA 4RGSA 4FS3A 2YX7A 4LG0B 4D46A 4E5NA 4K28A 4ROSA 5LDGA 2C07A 3ZU3A 1LUAA 4U5QA 5LGNA 4FFPA 2XRNA 3GF4A 4ENNA 4GKVA 5A9SB 4AIHA 3ONDA 4UUPA 4DL9A 1O6ZA 4GI2A 5EQDA 4QFCA 2QRLA 4IJVA 2IZZA 2J3KA 3BROA 4CV0A 1C1XB 4DTIA 4DC1A 4LISA 5H20A 4RS8A 1XSDA 2HEOA 1E3EA 2Z9OA 3FF5A 3PHHA 1E3SA 2NRAC 3A9WA 4WOKA 4ALIA 5B1YA 5BSHA 4CLOA 1XU7A 5J8FA 5AVOA 1EE9A 1HEUA 1B16A 3AUSA 3FHZA 1YYVA 3DF8A 3A28A 5K0ZA 3KCCA 3L4SO 3VDQA 2VBYA 4IS2A 4I9NA 3ABUA 1EH6A 4KN7X 1D8AA 1GUFA 1NVGA 4QT0A 3WGTA 3VVBA 3TGNA 1J0RA 5CJ9A 2G82A 1U5AA 3H3ZA 2ZYAA 2IEDA 3RBVA 1V8BA 3JYLA 1OKRA 3OFSA 4YCAA 5HA5A 3GN1A 1VC2A 2B0JA 1IN7A 1HRDA 4NZ9A 3HG7A 1VJ0A 3SLGA 4Z9XA 1E5LA 3I4FA 3NAQA 1HZJA 1HDXA 4WLVA 1KEPA 4CQLA 1YQXA 1MC4A 4E31A 1FOKA 4CUKA 4F45A 1H9BA 4RAZA 4XIJA 1EK6A 4MEYF 3N7UA 1GD1O 2L4MA 4M86A 2H9IA 3PDJA 5T64A 3IKTA 3W6KB 4YRBA 5L95A 2HJRA 1AXEA 3OQBA 1BI3A 1LQTA 4P5OA 3OEYA 1Q7CA 4D3SA 2AXQA 4PG6A 1PP7U 2C6YA 5DULA 2X22A 4F6CA 2FOKA 2JFHA 2V6FA 1GEEA 2PZJA 3C3WA 3FTPA 3E6BA 4M9XA 3K1PA 1BVRA 3RC7A 5ER9A 4H7PA 1ZK0A 1ZMOA 1LSUA 4UEKA 1ZRCA 3RIRA 3TOBA 3VODA 5IN4A 5K5OA 2CVZA 3D3WB 3OBBA 3EAGA 5CFZA 1LDYA 5I7VA 4MJLA 1N9GB 3LA2A 1SD7A 2GF2A 2GDZA 4YA6A 3TFOA 3FMSA 4KN4X 4B79A 4CLHA 1LRJA 2M1BA 4GL4A 3GMSA 4TZKA 4QLCU 4HF2A 3GVXA 2ZKLA 3I9MA 4XKJA 2R6JA 3A14A 3N74A 1DPRA 2H6BA 4MVJI 3HSRA 3ZU5A 3GMDA 2M45A 1YRLA 3W8EA 3RKWA 1RYDA 3TQNA 3TNLA 4FOOA 1PQWA 2J3HA 1M2WA 4DYVA 1WPQA 4XGNA 2BGKA 3I9LA 2CSUA 4D79A 4PZEA 1W5SA 5EQFA 3FNEA 3M9AA 4CV2A 4HBGA 1EDOA 5G0SA 1HYEA 1QZZA 4OO3A 4YFKF 1ISGA 3KYCB 3WMWA 3K8ZA 2ZNYA 3ISPA 1ZCJA 1I24A 3JQAA 4J6FA 1YB1A 4WCDA 3WSVA 4BO7A 1XU9A 1W7PA 1OI7A 4XYEA 3HUGA 3I64A 1P1KA 3ZQ7A 2FPGA 1U4OA 3DBVO 3L6DA 3ZWWA 5I7EA 4S1VA 2XASA 2Z5LA 1XDSA 2M87A 4JBHA 3NJ8A 1ADCA 2B83A 1IXCA 5JMWA 2WE8A 4YAIA 5ED4A 3JQCA 5L3EA 3LF2A 1T39A 2BGCA 3TDUC 5D5WB 3ECOA 1C0WA 2NNLD 2W2LA 1NQOA 1X1TA 2EV9A 2X23A 3STHA 5D5XB 2OAZA 1G0OA 2VWPA 2QX7A 3WGGA 1R5HA 3D4OA 3JD4A 3UCEA 1D7OA 2W84A 3DL2A 3H5AA 2L02A 2L4AA 4JBAA 3F3SA 4BO0A 4HV5A 4EJOA 3PGJA 5U9CA 1V3VA 1A4UA 2QYOA 2GXGA 4G6QA 3TPCA 5TRDA 1R12A 1B0AA 1LLCA 3I83A 4ZGWA 3PJDA 3DFGA 4E5KA 3ZDFA 2GUGA 2HUNA 4CYDA 4MQ9F 1MXFA 4D3FA 3INGA 1VSVA 3H6KA 4A5NA 2HMVA 4J7UA 4RB1A 3V5NA 1U6GA 4ZYHA 1E1NA 2KIMA 2IW5A 4N7RA 2HAEA 4WXHA 3MZ0A 5CHEA 1FNNA 1OPCA 1NBOA 3U3XA 3W6JB 5HVQC 1Z74A 3RUFA 4FX0A 4I5EA 5L4LA 4XR9A 3D1LA 4A2CA 4IJAA 1CDOA 3BTUA 2K86A 4TV7A 5KIAA 1FDSA 1P1IA 4RVGA 3NKLA 4DYDA 1HDCA 5IT3A 4O3MA 3HWRA 2Q45A 1OAAA 1I3MA 3G73A 1DBVO 1FDUA 2YV3A 4NBTA 5BPIA 2MH9A 4Q3AA 4E6PA 1ZEJA 3TZ6A 4GCVA 3MFKA 3CIFA 1FYMA 1Z82A 1DDNA 3JTHA 4IGFA 4HFNA 5L7YA 2HQRA 1ISIA 1V35A 4GSKA 2X0IA 2J5PA 3ENNA 3WTBA 5I8ZA 3K2ZA 2VRBA 3Q9SA 4NU5A 3NTRA 1L3LA 3JQAD 3ORFA 4OSPA 3ZWVA 2DKNA 4HX4A 4GAEA 7MDHA 4ZHSA 5GZ6A 3PP8A 1UDBA 2O23A 3F8CA 1O57A 1CIVA 2COMA 1YO5C 1HXHA 4EJWA 1ADBA 1PJLA 3H5RA 2WYUA 3NX4A 4B4WA 4EBFA 1EUZA 2MA3A 1VE9A 3E6DA 4Z3DA 4L74A 1IULA 3E9QA 1IZ1A 4J1SA 4LG0A 2X0NA 1ADGA 3QVXA 1NHGA 2VHXA 3H92A 2VWGA 1FK8A 3CZMA 1NM5A 4G81A 3HHGA 1P33A 4KIFA 4BQAA 1PU2A 1HLPA 1ZNQO 2FPPA 2W2LD 3WMXA 1NFRA 2X5JO 3ZZNA 5A9SA 1PX0A 2X0LA 1YOVB 4OYRA 3L4BA 4KICA 4KMFA 1FC3A 1M76A 1NQ5A 4D42A 4HF1A 2FBHA 1C1XA 2OUIA 5K5QA 3SZTA 3GLQA 2Y48A 3I71A 4LGVA 1EBFA 1MB4A 3G3ZA 2HDCA 5E20A 4EJ0A 4CM1A 5ENDA 1PGOA 4P4LA 4XZ3A 1J59A 4HX8A 4GBJA 3E9MA 1R36A 1NTOA 3H9UA 5H6QA 2ZJ0A 3P7MA 4ZRMA 1TLHB 3LZ6A 1RKXA 3LT0A 4QUKA 5DUKA 2GASA 5JHUA 3WQSB 2EV0A 2OL4A 3EYWA 4MVJH 3WGIA 5JR3A 3I3OA 1DRUA 2D59A 1LDGA 3T7EA 2XKPA 3OJEA 1ZRDA 1LXCA 4BNIA 2YPRA 5L4SA 3GNSA 2HYFA 3OP4A 1J75A 5ICGA 1I3KA 5KOIA 3J80Z 4CM3A 1YLFA 4M1QA 4CXFA 4AJIA 3JSOA 2H63A 3TZHA 1JHHA 4ONEA 1O3SA 4ZQFA 3TL3A 1ZLJA 1IF1A 2RDPA 1KBZA 5G0WA 1ZK1A 2J5KA 3WNQA 5JDIA 4DVJA 3CE6A 1EUCA 1EV7A 1PGNA 4CPDA 2MBFA 3GPDG 1XKQA 1QG6A 2Y93A 1RPNA 4UVHA 1I27A 1PL8A 1YL7A 1ADFA 3K2EA 1ULYA 1HSZA 1Q7BA 1C0KA 3U09A 1L7DA 2FBIA 3SQNA 1AHHA 1C0IA 1GDHA 2BH9A 9LDTA 1DC6A 4Z9FA 1SEVA 1VPDA 2FU4A 2HR3A 1YQAA 3PQEA 4K9DA 5KJEA 3RSHA 3SC6A 1R7JA 3DMYA 4HQMA 3ZMUA 1QYVA 2NU9A 2OFPA 4PGGA 3TOXA 4PLZA 4DLBA 3D3WA 2CY0A 2WJPA 2X8LA 3GVPA 4YJHB 2Z95A 1FBUA 2P5KA 1G6KA 1N9GA 4M49A 5CEFA 1X7GA 1ZREA 1IPEA 5L3DA 1A9ZA 1MA0A 1PP8F 2O3UA 3E6MA 3AU9A 2J5QA 1KC3A 2FZEA 4N18A 2FR0A 1CQJA 4HY3A 1TB4A 4ZQEA 1K6JA 3V2GA 2BHLA 4BO4A 5JPIA 3RJ9A 5A9RA 6PAXA 1USTA 4BMVA 1ZO8A 3U9LA 5ICCA 2Y1CA 5ICMA 4LK0F 2NNYA 1UHWA 3LSTA 3MCZA 4L75A 3I9OA 5HRUA 4FJ1A 2GERA 1FT9A 2Q49A 4IRHA 2ETHA 4IVNA 3BZ6A 5EN4A 4RJTA 1JTVA 2JT1A 1Y1PA 3K31A 3KYCA 3SJ7A 1U8RA 5CDUA 4JXKA 3WX0A 4YAEA 3PLNA 5KWEA 1QGPA 2CNBA 1G3TA 5CG2A 4PRLA 2VT2A 1I2ZA 1MX3A 1MJ9A 1U5TC 1SNYA 2LDBA 5F1PA 2A5YB 4LD5A 3IS3A 4Y6SA 4OOFA 3DWFA 4IBOA 3ZN0A 1IUKA 1HDOA 3FBTA 4MVJF 2VHZA 4IF4A 3D64A 4KTTE 5J23A 3PGXA 2W2KB 2VTEA 2HMWA 3P19A 2AEFA 1P45A 3I59B 4ND3A 4R1NA 1B14A 5D8LB 3HRTA 1JWBB 5ES3A 3UW3A 5BSEA 4M87A 5D4RA 4BO3A 3Q6IA 5DYMA 3BYZA 1P6RA 2E6UX 3BMQB 4B8XA 1E7MA 3DAFA 3TN7A 1HSJA 3GA0A 3OA0A 4A0SA 4FX4A 3RD5A 1RWBA 5AXBA 4KOAA 3QWIA 2HKXA 3DQPA 4G7HF 4JCOA 3AI2A 4HKTA 3AUTA 3FM3A 1HF3A 2EKLA 1WDLA 2YDYA 1E7RA 1NAHA 2MD5A 2H1SA 3OJFA 2IXAA 1I10A 1USSA 3ZWNA 4ZRNA 3TOZA 1DSSG 2JCVA 1R16A 1M6WA 1YIOA 2OBYA 4FR5A 3WE3A 3RC1A 3T0YA 1LLQA 2B5VA 2C5EA 3WQQA 3DHNA 3Q1LA 1DFGA 4H3VA 3Q2KA 1B8VA 1LC0A 3HRUA 2X9VA 2ZTLA 5ITVA 1KU7A 4BKQA 4BUCA 5ILOA 4L5IA 2VHVA 3AM5A 4E3ZA 3FI9A 3RBXA 1R4NB 5AONA 1ZKMA 3DHYA 4TKLA 5A9TA 1OYWA 1GEGA 4WLUA 4Q5SF 2GAUA 5DNAA 1VL8A 3GHHA 2C7VA 2PJPA 2I3AA 1BVUA 1XCBA 1C0LA 1DIHA 4YB8A 1A72A 3R6SA 2V6CA 3MJTA 2RKHA 4IXWA 4BNHA 2GRAA 1JE8A 1LRLA 5H82A 4UVCA 4XB2A 2JKVA 3ZHZA 3I53A 1F8GA 1LDJA 3GC6A 3BZUA 2A92A 2EKQA 3F1KA 3ROMA 3QP6A 4KT5C 1H0KA 3ZPLA 2QRJA 2O3FA 1XA0A 4RO0A 2WC2A 3CUQC 1SEPA 3I4CA 2EK5A 1O7LA 1PJ4A 4W82A 4DGSA 1U5TB 4FD3A 1P1HA 1NYTA 2C2XA 3R3SA 3Q9VA 3OJ0A 2ELHA 3E8XA 2B37A 1Z6ZA 3B02A 1KERA 1EVYA 2Y66A 2O48X 3H5NA 1DHTA 3ROKA 4BQPA 4UUOA 3RU7A 3TZCA 3E82A 4XYBA 3AAFA 4A03A 1RI7A 1A4IA 2HK9A 3KBOA 1YOVA 1PL6A 1IHYA 1PS0A 3PHIA 1XGNA 1GXPA 3SC4A 2HTSA 3J81Z 1I5RA 5FB2A 2AMFA 3I0TA 5A1TA 3IOYA 3RBZA 1K7AA 2IJLA 3GWZA 5J8CA 4ESJA 1K89A 3BIOA 1YL6A 4N5LA 3C7CB 5E8IA 1CQIA 1UZMA 4D45A 4AVPA 4E2XA 1AE1A 4ZD6A 4FC6A 1E6EA 2VZ0A 4W99A 4QO8A
chains in the Genus database with same CATH superfamily
1T5DX 2EZLA 5DFAA 4KQXA 2DPGA 1HGXA 3MT0A 2NO5A 5GINE 2PZEA 4QRHA 1Q7GA 2WM8A 4FYWA 1DQNA 4K3UA 4DQVA 3ECCA 4AM8A 2ODWA 3K8OE 1JIIA 3DE0X 3LUBA 1GZUA 3CEPB 3OZDA 2E7XA 4XGKA 4A3BJ 1X3WB 3ZQLA 4M74A 2X3UA 4Q3NA 3EXHB 3KEYA 5E1OA 1SBNE 4YQZA 3JZDA 1SU6A 5A4JA 1M5TA 4XX0B 2PS9A 3LY7A 1CVLA 4FYVA 4HLCA 4M3NA 2ZETA 3IAXA 2R5ZB 2ZWOA 4OI2A 2OHJA 1XZCA 3ZVRA 4QC2A 3BH7A 1HG1A 3M1YA 3SYTA 4PIVA 4BL0B 4CUGA 1G3MA 1H3NA 1R50A 4HGOA 1KQ0A 2Q0HA 4OAZA 3DOUA 1E98A 3L01A 2QN9A 5A4MS 4UDOA 4B3JA 3IHLA 3A6PC 3OJWA 3AEUA 4GQAA 2HMUA 2R2AA 3SZLA 2XMQA 4XSGA 3WLNA 3WLQA 5IBQA 4U8HA 4D4GA 4JQCA 4U6NA 1W2HA 4ZRDA 2ACKA 2ZJRF 5EHGA 2Q9CA 4WNYA 2E60A 1CE8A 2NXNA 4OQYA 1JB1A 1E9AA 2QRHA 3LK7A 2AR0A 2WJ3A 1V54H 3C3BA 1NF2A 3EUFA 5DOVA 2OD9A 1A88A 4BJ5C 3JCUC 4B6OA 1W8DA 3KVNA 1F0PA 2C59A 1CR4A 5IHXA 1KOGA 3UUGA 2WOOA 2Z83A 2OO5C 5K3CA 1JHZA 3OS1A 3RKRA 3K5PA 1Z29A 3E7LA 2HOQA 3DFUA 1Y7LA 4LVCA 5FD6A 2B98A 3LC1O 1PJ8A 4P5DA 2WHPB 2QJOA 4B4UA 1GG2A 4XB1A 4LJ5A 2C7GA 4R1HA 3OY7A 4MHGA 4JJFA 5TRTA 4IIJF 4M0DA 4DR6B 4E6EA 2LUOA 1L1FA 9MHTA 4X24A 1DVRA 5HKAA 2Q7XA 1MMAA 2VSNA 4EKGA 4QTTB 2ZXWH 3SFZA 1KXJA 3RIMA 4CQMB 5J2UF 3EEYA 5F7OA 2P3LA 4G26A 3DW3X 2QY9A 4KQFA 1TA0A 5HX7A 4WXEA 2NWQA 1XXHE 3JQFA 5GP9A 1TMKA 1HE8B 2VT6A 5KOYA 2P7VB 2XCTB 3CLVA 1MJGA 1PG2A 3UMJA 1IMJA 1NQWA 3FIJA 4N47A 2JFVA 4B47A 4R8SA 2I2AA 4C14A 3Q7QA 1Q0QA 4I1OA 4MWDA 3E1KA 1T5HX 3MKYB 1G1MA 4MKFA 1VLQA 3L0SA 3I8SA 4OY3A 1G8GA 2YKGA 1BHO1 4NU6A 3W34A 4AIDA 3SZMA 4LYGA 1IU9A 4AZTA 5DHSA 5DXFA 1CYEA 2IP4A 1N7GA 2C1ZA 3D0OA 4FHFA 1KEEB 3RVQA 3M6FA 4LQCA 3KDSE 3EIXA 5CT9A 5BSTA 2NG1A 4ZAFA 3M0EA 4KIUA 4JT8A 4WH0A 1D5CA 3A26A 1RVV1 1L7MA 4YECA 1I36A 2YXLA 2VEOA 3N9IA 2AI1A 3JAWB 3Q6MA 1U1DA 2JFYA 1YAHA 4ALJA 5F9HA 3DFIA 5CITA 2EU8A 4YRSA 2PFGA 3B2NA 1GKUB 1D2AA 2NTVA 4AWBA 3EIQA 3UATA 3EGWA 3LXUX 3QVMA 2JCBA 2P2DA 4WY8A 3JAMK 1T8PA 2O2SA 1WDMA 1NVDA 4W97A 2DT7B 3D6FA 3T7SA 1YX3A 2F5FA 3UR3C 3KPVA 3GARA 2A1UA 4I81A 3OTOB 1WF3A 2KW5A 1MABB 4NBWA 4C2BA 2CHUA 2WC1A 1RRFA 3P9YA 4UULA 4KU4A 2I6FA 4U0YA 1ECCA 2DLDA 2JBAA 5IRCD 5ARCA 4NTZA 1YFZA 3EBOA 1XBTA 1Q1ZA 4UHDA 3CUKA 2O2CA 3WISA 2HK7A 3I04M 3CDLA 1W6RA 2CJPA 4ARCA 4B82A 2Y99A 4XR4A 1GA1A 1K4KA 3P97A 4U2GA 5J1TB 1P4RA 3FPAA 3HNPA 5BWCA 4FX5A 3HJNA 1E89A 2F3UA 5JJBA 3PNMA 3LBYA 2GK4A 4MI6A 3DV0B 3NWSA 1VQ1A 3DBHA 1GM5A 3LAJA 4YRGA 3JYHA 2GM9A 1V8DA 1BVYF 3VUEA 3WGZA 4WY5A 3BGDA 1RPJA 3PEEA 3I01M 2P5YA 2QVCA 2VP5A 4HWGA 2FCRA 4QRIA 2AQKA 3DZHA 1EVZA 4LBZA 4LF4B 1U3VA 4KN6A 2D2XA 3ZZTA 1OFIA 3NZEA 1KY2A 3CCRI 1WV1A 3ER6A 3ZZ1A 3KHKA 3MYRA 4B76A 1R8SA 1P9RA 2QQFA 3HHPA 2ZE5A 2IK8A 1TIKA 3TDNA 5BMVA 1MC1A 4ZODA 1JR6A 3R7WB 1WUKS 1FUIA 1J1IA 1HOMA 4JYBA 1R15A 3HVHA 4UE2A 3ZWYA 4ARZB 3ONVA 3RF7A 3MKLA 1W94A 3FDZB 3B13B 2CUJA 1N2JA 4BMSA 4FMCB 5F2OA 3FUVA 1SKBA 1SPBS 3HC7A 4CHGA 4IWNA 5EI5A 4EKYA 1MGPA 3EXG2 4DMMA 4ZQBA 1LDMA 1X8JA 4KBGA 3KUUA 2H9YA 2VJPA 4RZ2A 3JWIA 1VFPA 3MZHA 3QRFF 3I09A 3CC8A 1KZ9A 3MXOA 2ZJAA 4KB5A 4E70A 3L4KA 1EWVA 3TJZA 3UWMA 2GEJA 2X1VA 2GJKA 1MH9A 2QR3A 5J4LA 4BGVA 5D3QA 2GZ3A 4MLDA 5FI1B 3S5UA 3UJPA 1NBMA 5CJ2A 1XN4A 5CBKA 4S2UA 1FA9A 3K10A 4PXAA 1E8DA 1HWYA 2JH9A 1ZQ1A 2AQFA 3DLBA 2GN6A 3DCNA 4HLDA 5JAUA 5E4TA 1QC5A 5K6RA 5B7PA 5JFOA 2IXDA 2B4TO 3RIEA 4CU2A 1YW7A 5CA0B 2YV2A 5AVKA 3KIPA 2ZRJA 4MS1A 2AQIA 1PNQA 2JF0A 1ZYUA 4NU0A 2TECE 4NBSA 4K6MA 3QLJA 3S2UA 3H97A 1TWCJ 1I4EB 4WWHA 1GPKA 2JD1A 4ITVA 5CVUA 1I0IA 1K7YA 4BJHB 2IY7A 5EKTA 3NKVA 1E18A 5BUZA 1Y33E 1YDFA 2FUKA 3DOOA 2EIHA 3C3XA 2IA2A 5DBFA 3NHFA 4EEXA 4LTDA 1XCLA 2OKGA 3KKKA 1OB2A 1KEWA 3FISA 4MCAA 2ODBA 4UREA 4D4JA 2BY2A 4AZ3B 3E9EA 3KP4A 4KFCA 5IZCA 4BEBA 3W7BA 3WLLA 2VO1A 3NHPA 1I80A 3P52A 1SAUA 2OGZA 2NU7B 2YY6A 3GFSA 3OPYI 3KKZA 1E7SA 3BA1A 5J5AA 2RGRA 4HAZA 1FVFA 2JWTA 3ZGYA 2P6MA 3C15C 1ZJYA 1NM5C 3AJEA 4R8HA 3L0PA 1EVKA 3DM9B 4CH7A 4NUBA 1AZWA 1ISRA 5JXWA 3DL7A 4RGBA 2NYUA 1G3QA 3VR5H 2IUSA 3AU8A 1PWXA 3HLKA 1P5FA 2DWQA 4AN1A 4QU9A 3L92A 3EW7A 1NAIA 1T2FA 2WU1A 2CFCA 1VPWA 2FD5A 1JV2B 4KO1S 1S29A 5JAMA 4LNAA 3KQUA 4HYYA 3COZA 4JDPA 5JASA 2Z2IA 1EJBA 1E4EA 2WJ4A 1TECE 5MDHA 4HDSB 2R66A 4DSUA 1PGPA 1OMOA 5DTQA 3A58B 2V6BA 4RADA 5AICA 4BO5A 2QU7A 2DJNA 3VDRA 2CLEB 4KQ2A 2Q5OA 2I0FA 2RE8A 2QG4A 4RPLA 3LBNA 1NASA 3W6NA 2RIPA 4GOKA 4ZH4F 2PZMA 1WMBA 4LE2A 3TLCA 4LLNA 4MH0R 4J75A 4DRYA 2E9SA 3DT6A 3RJPA 2JLQA 2CCGA 2WHYA 4MPJA 4XOTA 3OQJA 3HDDA 1V11A 4PX3A 5F0FA 2R4GA 5HIIA 4QYXA 3ZUPA 4LLLA 3PJGA 3X2SA 1FEXA 3H65A 1KFEB 2JLZA 4L9WA 4GU5A 3O4FA 5K0EA 3ROUA 4J0CA 1Y8QB 4DM7A 2XGJA 4RB3C 3PFCA 2Y71A 1JJ8C 4PO3X 2PHZA 3RS9A 4KUEA 4WKPA 5JBNA 4HX5A 5LYYA 5IT5A 2OV3A 4O4JB 5BVHA 4L9AA 3HABA 1PEKE 3DAYA 2B8TA 4WOPA 4FFMA 2RGNA 3WK6A 3ZVKA 1HUQA 721PA 2QSHX 3CA8A 4A8JC 4OVKA 2HQBA 2O8XA 3S28A 1T36B 2XPVA 2FP3A 1B4AA 2R6HA 5KJCA 2OZUA 5EIOA 1AS0A 1AKVA 5FOVA 5CDSA 5J58A 1B41A 1II8A 4U9IS 5F98A 1ETOA 4G5FA 3JZFA 1OE0A 1UKYA 3CM0A 1KOJA 3Q72A 5ERGB 2VP2A 5KVCA 1NF8A 3ZIAA 1U9NA 4R2LA 5B5EC 3BA6A 2P5TB 3AR5A 5C34B 2WY2D 3WU2C 1ZSYA 4MX8A 2PL9A 3GTMJ 4BNCA 4MVJD 2FFHA 3MMSA 2VOPA 4JC5A 3PQ2A 2W83A 5HBRA 1KMNA 1FTWA 2Y9PB 3ITEA 3B9PA 4N0DA 1YC2A 4AKIA 5EQTA 4JL5A 1WCIA 1DKRA 5HTKA 2ZSUA 4O63O 3NHWA 4XRRA 4L8FA 4LOJA 4Q9LA 2F1OA 3PIOF 5IJAA 1KA8A 5FH9A 1X8XA 4ESFA 4KAAA 3E0JB 3OU6A 1TVKB 2QD4A 4WFQA 2HFKA 4YUZA 4RPIA 4DPKA 4UV8A 1JU3A 2PQ8A 4F91B 3R61A 3U4HA 2AK3A 3GLIA 2O8EB 1K0UA 5JAQA 2OBMA 4F4JA 4C0KA 4BC1A 1LEAA 1LDEA 2BEJA 3IBFA 3GUYA 4RJKA 2F43B 2E5FA 3NDIA 2KZVA 3VWBA 1J2UA 1QP8A 2B6NA 2UYOA 5LHHA 4AJHA 5HOOA 5REQA 4ZI7A 4YCMA 2RAVA 3RF6A 2GJ9A 4ZV7A 3B12A 2MYTA 1UDXA 4PG4A 3ORRA 4EJSA 5H9VA 4HAYA 2A3SA 3NEPX 1O5TA 3BSYA 1H2HA 4D4KA 4CL0A 3GPIA 3GPLA 4CI9A 1NR1A 3M8JA 2WB4A 2QG9A 3O8OA 1HRKA 3KOZA 3F9RA 4D5EA 5LMNB 4O1MA 1FLNA 1VHDA 2PUGA 4M0MA 4TKUA 3DF9A 2XA2A 2LXNA 2VQFB 5AOAA 2ZOSA 1WHTB 3AETB 3WTUC 5FJ8J 3FYUC 5K8UA 3DZJA 1XCJA 3DDHA 3F73A 2BGNA 3HVKA 2VAMA 2FXIA 4FOPA 4RMHA 3OT1A 3DUFB 2I2DA 3HB9A 3ML6A 1DPUA 1U5CA 4R1SA 4W5QA 3QVKA 4FKZA 3DOEA 5IXYA 4EPWA 4CIBA 1XZAA 3CLUD 3G8CA 2G36A 3DBLA 1Q50A 3RIHA 1T98A 4BB6A 2VKEA 1ESNA 1DOAA 1K6XA 5LLDA 2L2QA 1WB6A 2IXGA 1ZCBA 3OBIA 2Y0DA 5HLGA 1N25A 3DE3X 1VQKI 5BMVF 3B1WA 5EIWA 3L05A 3WHKA 2C5HA 4IDFA 1SEUA 5I9LA 4Q15A 1O9GA 4JROA 5EKSA 4H7EA 2Y9ZA 2F1RA 2YZGA 5E4FA 4LYAA 1EK5A 4X0GA 5A5FA 1IWOA 4L1KA 2RB4A 4JMLA 2PDAA 4MQ4A 4YP6A 4B5KA 4QUHA 4HDUA 1J8DA 4X66B 1H22A 1SBYA 3U2RA 4WZBA 3AUYA 2BYTA 2IVFA 5EESA 1E96A 2QN1A 1LH0A 5J40A 2FPGB 4XRFA 1N1DA 4TSKA 3AL2A 2RH5A 4L50A 5C8YA 2H3EA 2IQIA 2DZDA 1XRNA 2HSJA 4OXNA 3UVEA 4TKVA 1N3BA 1N6LA 2RJNA 2GYYA 5JNTA 3PB3A 2WAQN 4OHRA 3H4MA 1IY8A 4AUXA 1UBUS 1IVSA 3HK2A 3GNQA 2CV1A 2IYTA 1B2LA 5IF9A 2JGDA 3GDOA 3NEYA 1YBVA 1GFWA 3M2PA 2FEZA 3HKZA 1ST3A 4E4RA 4H7KA 2P7CB 1S3IA 4JBXA 5LQCA 5K7SA 3CH4B 3OKAA 4IDOA 3OPMA 1KYIA 4I1SA 1LF0A 3V7NA 2WFLB 2OM6A 4KHPB 2LG4A 2C07A 5AKYA 2P41A 2BKUA 3B48A 3DU6A 3WLRA 2Q5LA 1O6ZA 3DKVA 1VIMA 4O02B 1QRTA 2JVJA 2R5YA 4HWPA 3EXIA 3UMCA 4CN8A 1DC7A 3ZE0B 1C7JA 3FHZA 1ETWA 1C7QA 1LBHA 3IE1A 1TM1E 4C0JA 3J7YJ 3AEKA 3M4JA 4O8ZA 3CJRA 4WDQA 3H3ZA 2BHRA 2L7KA 1BROA 3DTIA 4TS1A 3HG7A 1U8EA 2RGUA 3AF2A 1R9MA 2F9FA 1RQPA 1DELA 2PUDA 3MWKA 4QXPA 2GF9A 1A36A 1H85A 4XIJA 3N7UA 1GD1O 1VE6A 1QVWA 3ZE8A 2NUPB 3T3EA 2CT8A 1OCRH 1IUFA 1P6QA 2GDZA 1Z0DA 1K68A 3TFOA 5D84A 1QHGA 3BWVA 1YA8A 2M45A 3ZZUA 3L7AA 1XTIA 3I9LA 2CSUA 4A3JJ 4CHTA 1QIMA 2D0OB 1JIJA 3B3AA 3G7UA 3I76A 4IKEA 3LHKA 2OVBA 1U0FA 1JT9A 3ZQ7A 1JFTA 1W0KD 4QYTA 3S1MJ 4UM7A 4YAIA 5ED4A 3ECOA 3LVQE 3HRKA 3DE6X 2QYOA 2D2EA 4P54A 4NMXB 4HMPA 4K6GA 2HA6A 3FX2A 4E5KA 3AFIA 2GUGA 2VJBA 4P93A 2H29A 1LW7A 4DJEC 1MCZA 4CTNA 1Z74A 4I55B 1HO3A 2QEXI 3NKLA 2KI5A 5JZVA 4L4ZA 3TZ6A 3X44A 3RRBA 4LBWA 4HX4A 1KJJA 3PP8A 1P73A 5KNDA 2JGEA 3TRJA 1VQ7I 4NONA 4ZHQA 3R6WA 4M98A 3WV4A 1RYBA 4U02A 2AWOA 3MN1A 2Y48A 4HNUA 5KHLB 4XZ3A 3LZ6A 3TR0A 3JWPA 4MVJH 1ZRDA 1VFNA 2DT8A 1YLFA 2BMWA 4OEHA 3TZHA 2IYRA 3TL3A 5AJXA 4K46A 2MBFA 4JB8A 4NENA 1G7TA 1HSZA 4UUQA 3KZ1E 1Y6ZA 2BH9A 1C3JA 5EJEA 2WU3A 1QGDA 1WUYA 1QP0A 2NU9A 2RNGA 2OK8A 1W88A 2PSFA 2IH2A 3REGA 4X93A 4YRKA 4UUBA 5ENZA 5E2IA 3MCZA 4FJ1A 1NBWB 5CNMA 3KYJB 1QA6A 2YRFA 5D7BA 4OJYA 3RH0A 2QUBA 2PGOA 4YDSA 5EIEA 3OL4A 1Y4SA 3OYDA 4C01A 1QR2A 1JWBB 2I5UA 5HCIA 5AKEA 1E7MA 4H1UA 4U2FA 5DGXA 1CUEA 1JFFA 1E7RA 1JIXA 2OZLB 1WB9A 3WQQA 1D1AA 4H3VA 2ZTLA 3A7EA 3ZHRA 4BUCA 4K9NA 2F3SA 5A9TA 4Q5SF 4H1WA 3PU6A 2XH8A 3TW8A 4IXWA 3GGJA 4MR8A 4XB2A 1E1RA 2FEAA 1AQIA 3F1KA 3QELA 2O8BA 1SEPA 1E6CA 3EN0A 3AEQA 4HDAA 2Q5IA 3TCKA 3G1MA 1KERA 3VMFA 4AY2A 2L5QA 2UUCB 4XYBA 3TLGB 1EM8A 4Y6GB 4OP2A 2XMZA 3HB0A 3WY9A 3BF8A 1CQIA 4C6HA 1E6EA 4KGZA 2RHTA 3QIVA 2DHRA 5DYIA 2EATA 1DWOA 1S1MA 1FUEA 3FSRA 3RVPA 3CO7C 1CFZA 4G3XA 4DNCA 4HS4A 5BQFA 4GF5A 4IUCS 4EJUA 5ECGC 2I6SA 3CP2A 3WSWA 5CB8A 2DQRA 4CR6A 3P9XA 4MLCA 5BQPA 2RD2A 1M0TA 3RJZA 2DULA 1FFSA 3UH0A 4GMXA 4DMHA 5I7UA 1T1SA 1E5VA 3M5WA 1M2GA 1R0YA 2R00C 3UMYA 4ZQIA 5GZ3A 4AY3A 4ZVOA 4CGZA 4OA8A 3ZHOA 2FH5B 4PCVA 5CLSA 2XOEA 3O95A 2FKAA 2IF0A 3OA2A 1XEWX 3Q85A 1IN1A 3F3XA 1AV7A 4PBTA 5FRNA 2GPTA 2EQAA 5JALA 1F4LA 4ZI7F 1I01A 3W5UA 1V95A 4M9UA 4BKMA 1GV0A 1MEJA 4Q9IA 1LRKA 4YEJA 2GZWA 3DE4X 3UNGC 2H1FA 4DM4A 1QP4A 3ANSA 4OQNA 1GRQA 4J1TC 2YMMA 5EFZA 1VQLI 1REQB 2RGGA 3A1EA 2JGKA 1SR8A 4RANA 2BFBB 2EBWA 4EJTA 2P68A 2NQ8A 5TGDA 4EB8A 3F3YA 1J7JA 2WLSA 4B83A 4MMZB 2I54A 5JT1A 5G0TA 4F6RA 3T1YB 2FR8A 1ZMTA 1XVUA 4RY0A 5IUKC 2KQRA 1SUAA 2HM7A 4Q9NA 1YQDA 4JI3B 2WTNA 2EJTA 5E3MA 4MTLA 3SNKA 1ZUD1 2X58A 4F2DA 1ORRA 4Q3OA 1AHIA 1I2MA 3PNOA 4I2OA 2Q2QA 3H8JA 4P98A 4EZIA 4LDPA 1A71A 1C3EA 4YWJA 1D8TA 1GPAA 4HW0A 1W0UA 3KZXA 1GVHA 3LMKA 3WZLA 2GN2A 1TL7C 1PEAA 5AYVA 2CDRA 1K5DA 4CG2A 3K71B 2QEQA 1AQ6A 5I7OA 2BGLA 4YXWA 3W2WA 4G56A 3RJ5A 5K03A 3EASA 4I1RA 1CDDA 2ZULA 3OE7D 5FBVB 2G8LA 3AYXB 4A92A 1BS9A 5SYAA 4JQYA 3BZKA 2Z9DA 4M3GA 2QF7A 1Y0BA 3V8QA 2R11A 2YZMA 5J2TB 5CVVA 3WHBA 3I55I 4DTCA 1N2HA 1A04A 3OZAA 2MOKA 3N2IA 4NC7A 2UZIR 1PJZA 1C9NA 5E1MA 1KWKA 3TSZA 2EW1A 2G5PA 4Y2JA 4HOYA 1OZ0A 4P08A 4N9QA 2CFIA 4MIMA 3DTVD 5EUQB 4K9MA 2J5RA 3AHGA 2ONKA 3V1TC 3PHLA 2XUJA 3FVWA 5TIIA 3RWOA 3RI3A 5EIBD 1L4YA 3HJGA 2GEDA 3CYFA 1UBSB 1JG2A 4PZZA 2W7TA 2AH5A 3KP2A 1W1WA 2DU8A 1MIHA 2VP0A 3UGTA 4N7MA 1JKMA 4XR6A 3M6IA 3RTGA 2OO7A 1OC2A 3UWOA 5BV0A 2HRZA 2HW8A 5BNZA 5KJFA 1M6VB 4D5CA 2I4RA 3D3NA 1V4BA 2TMKA 2XGXA 4GZ6A 3EC2A 4P0QB 4QGAA 2YJZA 4N3BA 4WZZA