3WGIA

Crystal structure of rsp in complex with beta-nad+ and operator dna
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
217
structure length
217
Chain Sequence
KTIVSMAVIRRLPRYHRYLEELLKNDVKRISSRELSEKMGVTASQIRQDLNNFGGFGQQGYGYNVEELYNNLTKILGLDKTYNTIIIGAGNLGQAIANYTSFEKSGFNLKGIFDINPRLFGLKIRDVEVMDVETVEDFIARNKIDIGILCIPKDNAQYTADRLVRAGIKAIWNFLPIDLKVPDDVILENVHLSDSLFTVSYRLNEEELFKKLKGETA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Redox-sensing transcriptional repressor rex
publication title Distinct structural features of Rex-family repressors to sense redox levels in anaerobes and aerobes
doi rcsb
source organism Thermoanaerobacter ethanolicus
molecule tags Transcription/dna
total genus 69
structure length 217
sequence length 217
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02629 CoA_binding CoA binding domain
A PF06971 Put_DNA-bind_N Putative DNA-binding protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wgiA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wgiA02
4P8RA 3BDDA 1Z7UA 2RV8A 3D5LA 3DPTA 3UHAA 3O2PE 1K5HA 5AQ1A 1RWBA 5DF1A 2HO5A 4CUZA 4N7RA 1WMBA 2C5AA 4MVJF 3ECOA 4I09A 3V8BA 5A5FA 3OJ0A 1YQDA 2PGDA 3JQ9C 3OHSX 1DLIA 1MA0A 2XGXA 2P9GA 2GPTA 3C7AA 3ROMA 1ZK4A 3GX4X 1N9GA 3I9MA 1ZXBA 1X7HA 5JDIA 3PZBA 1BXZA 1TQIA 2C7VA 3U49A 3X2FA 1NXQA 1IN8A 3RKXA 2QLZA 1Y8QB 3QIVA 3F4LA 1FP1D 1MD0A 2DFIA 4N9HA 1EUZA 1G0NA 5I8ZA 1EMDA 5ILGA 4BO7A 1A72A 4ENJA 1U5TC 1H9AA 3HSKA 4BV9A 2NTVA 2RKHA 2GD1O 3QVTA 2HTSA 5LDGA 3G1UA 5T57A 4CLHA 3H3UA 5TNXA 3AUAA 3RWBA 1LDDA 1I27A 5A9TA 3OICA 1G3WA 5A02A 1PP7U 5A2QZ 1HL3A 2O3TA 3IMFA 2KIFA 4YJHA 3VDQA 1W4MA 3KYDB 2IE0A 4E5YA 1U28A 3ZCXA 4BQPA 2DPUA 2P7VB 3TN7A 3WNVA 2K02A 3J7AO 4MP3A 2V1XA 4G9YA 3L9FA 1GCOA 3K96A 4UVIA 4P55A 3JCZA 3EDPA 4TRRA 1K6OA 1V3FA 1NVGA 2VOPA 3M2TA 1K0UA 1ML3A 1R4MA 2FOIA 3RC1A 4I08A 3RC7A 1KU9A 3M1EA 1PP8F 2QRKA 4W82A 4YRBA 3NJ4A 2IZ0A 1GZ4A 1IRGA 3VKVA 1J5YA 2OFPA 2G7UA 3AOEA 4I8XA 1I01A 1K2WA 1SEVA 3CZMA 4N5MA 1P92A 2PGLA 3RFTA 5LC1A 3ZGYA 2X1HA 3EETA 2QX7A 3C18A 4A5NA 2ZYDA 3AUUA 3NT4A 3NUGA 4N54A 2VRCA 3GT0A 5DOVA 3FX3A 4BVAA 3BWGA 2GZWA 3MOIA 3S2IA 2ESNA 1TT5B 1UZMA 3BTUA 1NASA 4KWHA 4Z0HO 1HQCA 1KEVA 1RYDA 2GN6A 4L4XA 3TZ6A 1GFSA 3BJAA 1D1TA 3MJSA 1FYMA 2QYTA 4ZU3A 1YKFA 3FXUA 1I5ZA 1LDKB 2P6SA 3I53A 4GGGA 2O48X 4CQMD 5CG1A 4GSKA 3B1FA 5TIIA 4UV8A 5T64A 4BNNA 1HDGO 4PCVA 1TI7A 1WKMA 4IJAA 2Y0DA 3ULQB 1YB1A 3RI4A 4PGHA 1OFGA 1T2FA 1IYZA 1XA0A 3IRQA 3B70A 1ZLKA 2C20A 3D0OA 3O8QA 5H83A 3VB2A 2O61A 4ALNA 4D0SA 1A4UA 2E7XA 4I5DA 2EGHA 3ERED 2RHCA 5H6QA 3WR5A 2WD8A 1L3LA 4G5HA 1M6WA 1HBXG 4BHTA 5BNTA 1BIAA 5I8WA 1E6WA 4R68A 1BDBA 3B02A 3CTMA 1VPDA 4I5GA 5EN4A 1U6GA 3LA2A 2UUPA 1BOAA 2QZ8A 4A03A 3BMNB 3KZVA 1ONNA 3KP2A 2X7HA 3TFOA 2HGCA 1T24A 2FMUA 3WXBA 1DO8A 4DRYA 5TJHA 5DP2A 4IHSA 2GDZA 1HSOA 2JFHA 3R3JA 2EP7A 1PZEA 3NGXA 5H6RA 1ZBQA 2DT5A 3FTPA 2IDZA 2QIOA 2F00A 2E37A 2PD4A 3FNGA 3OFSA 4YT5A 1QZYA 3G3EA 4JN6B 3PQFA 2Q8KA 4M49A 1QRRA 3SLKA 3T4XA 1FY7A 2ELHA 4L8VA 4I98B 2WJPA 4AJNA 5FFZA 1Q0QA 3F47A 4N9IA 5LEJA 2WD7B 4Q3EA 3OJLA 3DBHA 3GG2A 4DLAA 4DUPA 2DAPA 5JS6A 2UYYA 3VPFA 4HLYA 4ZYHA 2HEOA 1CQJA 4KN4X 1TLTA 2YV2A 1PR3A 1GL3A 2D3TA 5K6AA 4Y6PA 4XIYA 1ONVA 1PTJA 3GEGA 4B8WA 4UUVA 4N5LA 4JBAA 4YB8A 3FMQA 1FP2A 5KVRA 1NFFA 4CDGA 3EC7A 3NDIA 2FU4A 4I0BA 1PJLA 4KIBA 1ZIDA 2VBWA 2E49A 2XF8A 1U2DA 3FM5A 1QPMA 2YFHA 4NG5A 2PMHA 2VOOA 2A68F 4XZ3A 4YAEA 4BNUA 2XAHA 1GYRA 4ZGWA 2Z5UA 1LJ8A 5ICFA 3QWIA 3ECHA 1UR5A 2QYOA 4LJZF 4CICA 4S04A 1B16A 5ER6A 2MBFA 4RB3C 1U3EM 1U5CA 3Q0EA 1E92A 1EUCA 5TSDA 2FOKA 1J5PA 1ZK0A 4B3HA 5CDGA 4XRRA 3GLQA 3P5SA 1SD6A 3IC7A 3SVTA 1H0KA 5CDYA 4CXFA 1DP7P 1FLIA 1D1SA 2IRWA 2NLOA 2J3HA 1ZEJA 3BPVA 2V6GA 2JTVA 3EK2A 4NR0A 5U4QA 2P9EA 1O6ZA 3C24A 4WCFC 1YOVB 3V1TC 2WSBA 1J7KA 1XEAA 2P4QA 1P6RA 1H0MA 5DCUA 4B09A 2HMTA 2HFHA 1CJCA 3HTUA 4ZZLA 2NRAC 1ZGAA 3JQGA 1J59A 4O5OA 2JZYA 4YA6A 2FP4A 3W6UA 1K89A 3ZWOA 3SZPA 5A3JA 5I7SA 4J1SA 5JDCC 4UVDA 2NQ8A 5I7EA 1HYGA 2YJZA 1Q0LA 1B9NA 3AM5A 4ZYEA 1BBYA 3TF5A 1LXCA 4WUVA 3VH2A 2BGCA 1U1IA 5G2OA 3W6ZA 1EFLA 1DRVA 3AU8A 4NK4A 2PA3A 4OXYA 4CUKA 1C1DB 4D45A 2ZNYA 4YRDA 1PZHA 4UVHA 4YAGA 4YRAA 3C7JA 2J5RA 1WQ2A 2YFQA 1O89A 4P4LA 1GAEO 3WGYA 2NVUB 4J9UE 2PKQP 2XKOA 1QMGA 4XX0A 4HP8A 4U0KA 4CM5A 4HXYA 3KP4A 3OJFA 3NT5A 2JHGA 2RDPA 2ZB4A 1UB9A 4FR5A 2C5EA 3L7WA 4EM1A 5HS8A 1UP7A 2K86A 2VE9A 2YHIB 4J2OA 4KDEA 3S2EA 3GVCA 4RGBA 3LT0A 4HQMA 4ZQEA 3ZWMA 1FDUA 1PU2A 2HDHA 2WYVA 3JQAB 4CL3A 2IA1A 5U1PA 3WS7A 2AQ8A 1OYWA 4D0RA 3HSRA 4L9TA 2J3JA 2Y67A 4WASA 3CEAA 1VLLA 4HUJA 4PG6A 2J5KA 4DC1A 3TO6A 4O3MA 5AIPA 3UICA 5A4DA 4HF1A 1EK6A 4KWIA 4DMMA 3L07A 3FCOA 4YT2A 3H92A 5I9LA 1KERA 3GFIA 3FD8A 1FYLA 1P33A 2PZJA 4NBTA 4OGWA 1ZAOA 4FPXA 4IJUA 4WXDA 4CMIA 4CV0A 4M6XA 3DPLC 3F5QA 3I4FA 2A9FA 5ER9A 1SMKA 2NVWA 3E82A 4YJFA 5A04A 5A06A 1W4ZA 5E18F 2ZQZA 4EUHA 1ADGA 2JSCA 3UCEA 4MKRA 2G0TA 1MXFA 4LB5A 3DTTA 4NJOA 5FI3A 2GO1A 2P5VA 3K69A 5CYVA 4Q48A 2I6TA 3JQFA 1NM5A 3HRTA 1UXGA 1B7GO 4CMKA 1I5RA 4I0AA 3RDIA 5G0TA 5ES3A 1SAYA 4B3IA 1A9YA 1KVUA 4ASNA 2FZWA 3CUKA 4FDAA 5AXBA 4UAGA 5CVIA 2ILTA 3M2PA 3FTNA 4YQYA 2EFWA 3F23A 1RYEA 2FR0A 3DBLA 4AJKA 3RUDA 3PJFA 3ZHYA 1E7QA 5HS7A 1TT7A 4PG8A 5K6AC 2JD0A 4J0EA 2VRCD 1Q7CA 3NRCA 3OBBA 3INGA 4D3DA 1HYEA 4YPOA 3QVXA 4UV9A 5AYVA 3VZPA 4ON0A 2ZMEB 4ZZDA 3BYZA 4TV7A 1RM3A 2PK3A 3S2WA 3HB4X 4KIFA 3H3JA 1ODDA 1IUKA 1CQIA 3GEDA 4IM7A 3RIHA 5L4LA 1GUZA 4KIGA 1R4NA 3LT2A 3WWZA 5CFZA 4DPKA 5DD8A 3T7EA 1T2KA 3HSEA 3INTA 3GC6A 4HWKA 2VE8A 1OYIA 3WTWC 2DPGA 1J49A 5TJ9A 4E32A 2O7SA 3TO9A 3ZWWA 1JKFA 4KUMA 4JIGA 2Q2WA 4JXKA 1IUYA 4WEOA 1YO6A 3HOSA 2NAZA 3ENNA 1IE3A 4RPJA 2J5PA 4G7OF 4CPDA 4FGSA 3BXXA 1EZ4A 2UXXA 2VWQA 4UUMA 3WGZA 1UDBA 4ESFA 4QSMA 4E13A 2DTRA 3K1PA 1E0DA 4HF2A 4GMFA 3W4IA 4R9RA 4BO4A 2RC4A 1P0FA 3ICPA 3IRRA 3QW2A 2H09A 1I10A 2Z95A 3A14A 3V2GA 2XHKA 1TQPA 1Q0HA 4D0PA 2GAUA 2R2GA 3UUWA 5TT1A 5AIQA 3E6BA 2NM0A 2AG8A 4LGWA 1PJ2A 2PLAA 2VTDA 1LJ9A 3EAGA 2FR8A 1B26A 4CLOA 3QP5A 4LVCA 5T8KA 2BBYA 3UCXA 3AWDA 5L3DA 4RDHA 4BHPA 4E70A 1OBFO 3PXXA 3ZW8A 3UOGA 1XIVA 2CQKA 1T4DA 2RVCA 4MIYA 3GFLA 4MTDA 1QSGA 1TNSA 3ONDA 2HR3A 1EVJA 4NI5A 4P38A 1JWBB 4MKZA 4G7HF 2RBEA 4PLWA 4XEHA 1G3TA 2L02A 3VPHA 4E31A 2R7DA 1JA9A 4JROA 4MPDA 2I66A 1D3YA 2VZ8A 2E4AA 3FHLA 4HFJA 2ZB8A 5C3MA 1OAAA 2XUBA 1NFQA 3KYCA 4E2YA 3N97A 1K78A 3KP7A 3O3KA 4UUOA 4J1TA 1SAXA 2Z5LA 1NFRA 1XSEA 1T2EA 1YQXA 3BIOA 4MVJH 4JP2A 4XKJA 3JW4A 3DFGA 4A0YA 1D3AA 1ISJA 2P4WA 1RM0A 1JQBA 3CPSA 2ZIZA 4BNJA 3WSWA 2DTDA 3BMQB 5HS9A 4IJWA 4UREA 2Y05A 2STTA 5DBFA 5CVRA 4HF0A 4ITUA 3N7UA 4IIUA 5JAQA 4AJHA 5JO0A 1VJ0A 1FYKA 4OKNA 1KQ0A 3DEUA 3KM0A 4WLEA 2RQPA 1W8DA 1HZJA 3CMCO 4DLLA 2DFDA 5CDSA 3K1NA 1XMAA 3DP7A 2IRFG 1I2ZA 3ORFA 2Y93A 1T6SA 1YE3A 2ZO4A 1QLJA 4R1NA 1CRWG 4KUGA 4RF5A 3ZWNA 1XB4A 1IHXA 5G0WA 4QXMA 3J80K 5HBRA 4HYEA 2GZ1A 4K28A 4W9NC 1F14A 4B4WA 4D79A 1BHSA 1PQPA 2BKAA 5L9AA 1GYQA 2PI0A 3R6DA 4K6FA 1CEQA 2HMWA 3NYWA 4G6QA 3RUHA 5AXAA 1NVMB 4KZPA 2I9PA 1K6IA 1EDZA 3VPXA 4AJPA 4B7CA 3L0DA 3V7RA 4EDFA 5IF3A 3PQDA 1U8XX 1J9IA 1XG5A 4RAZA 3JD0A 3ZV3A 2VBZA 4XIJA 4GWGA 2NV6A 4D44A 3S8MA 4JK1X 3E1KA 1T2CA 2F2EA 3DZJA 1EK5A 3D5QA 1MV8A 1LNWA 3E97A 4MGRA 3F22A 1QYXA 5DYMA 1O95A 4BGIA 1KEUA 4PVDA 1OZAA 1Z74A 1E1MA 5A2QK 2OXIA 1E17A 3GZ4A 4BO3A 1Z91A 1N2SA 2EGGA 2KJBA 1SD4A 1MX3A 2DPDA 1YGYA 2C0CA 3D3EA 1Y5RA 3E6AA 4QX6A 1USSA 1E77A 5BPIA 1R12A 2NQTA 2MLKA 3BJOA 1Z7BA 2X6TA 1PDNC 3WJAA 4XYMA 2LDXA 5F1PA 3ST7A 1IB6A 3FZVA 3HNPA 3KSDO 1OOEA 5D5XB 3IWFA 1L1FA 5EESA 3PGXA 3W8FA 2C6YA 4XB2A 3JQ7B 4YIIA 1F12A 5G4KA 4WEQA 5CDTA 4IDBA 4EEXA 1AOYA 2VHVA 2V9VA 5HA5A 4P4GA 3FR8A 4L9NA 5JBIA 4KNYA 4P22A 3CE6A 1NQTA 4EJWA 4KP7A 5CEFA 4YT8A 3HN7A 1XGMA 2MD5A 3ZMUA 1Q7BA 2NU6A 1HW2A 2ZATA 3TOXA 3HYIA 4WXHA 1I36A 2WEKA 3ZHZA 5HM8A 4FFOA 5GMOA 5KVQA 4E3ZA 3LFKA 3AFNA 2ZYAA 1P44A 3HE3A 4CJXA 4BNHA 2A69F 3EMKA 5DUIA 4AIJA 3CSDA 3GUYA 3JQ8A 3FSRA 5F1RA 1UH5A 3RVDA 3B6ZA 3STHA 4PGGA 3L09A 2PZKA 3GUCA 1C0WA 2IT0A 1CWUA 3CUQA 2VNSA 1HKQA 2X4GA 4RS8A 1S7AA 2VHXA 3NTQA 3COSA 3R3SA 3RC9A 3PWZA 3HTSB 1YBVA 4Q3NA 4AJOA 2VYVA 2UDPA 1UP4A 4TRMA 3AOGA 4CMGA 3DAPA 4CM3A 3OMLA 4B7UA 4GYIA 1O8CA 2BD0A 2YDYA 1AGNA 1FC3A 1LVAA 1E7YA 3I5UA 1LEHA 1GEGA 1DJNA 3HRUA 4IRGA 2DO7A 1H6DA 1T1RA 1FT9A 1PJ3A 5H82A 5BMZA 1SOVA 1F9NA 4DQXA 3HUGA 2M1BA 3LC7O 1O3SA 3KB6A 4FS3A 1D8JA 2V1DA 3QPTA 4ETSA 1WDKA 2NADA 1JKJA 1I3KA 2RHRA 2UUOA 1IRFA 3ZMDA 3PJGA 3GZNA 3QHAA 4IQ8A 4TKLA 3I54A 3TFQA 1LTHR 5C37A 3KZYA 1E6UA 1EQUA 4I7HA 2O03A 3GVHA 4X54A 4UVAA 1A9ZA 1BW9A 3INRA 3DOJA 3WFIA 4EJ6A 4Z6KA 5A03A 5ENDA 4DQUA 2PH5A 3E03A 4XYLA 1G3SA 3ZP5A 1NQ5A 3TOBA 3ZU2A 1L0OC 4GL4A 3ZN0A 3I58A 2E6UX 1ZJZA 1YL6A 5L7YA 2X22A 4EJ0A 1KA8A 3VOSA 4AIHA 5TRDA 2AXLA 5GZ3A 2Y1DA 1F5TA 4EUEA 4RVHA 1E1LA 1N7HA 1UHWA 2D2WA 3FR7A 3PFIA 4ZYGA 2HQ1A 3GG9A 3OM9A 4MVJD 3TGNA 1W73A 3ITKA 3JQ9A 3BAZA 1LU9A 2Q0OA 4IZHA 2CVQA 2HS5A 1ZLJA 4R5HA 4M73A 4ZA2A 3FF5A 5E8GA 4IUYA 4BO8A 1YTYA 1FSEA 5K5QA 3FMRA 1K6JA 5IG2A 1YQAA 3GFJA 1BXGA 3GFMA 1Y8RA 4EGYA 2EERA 3WFJA 3H7AA 2P91A 5GY7A 4XSXF 4IRHA 1BM9A 4XJSA 4OMZA 2WV0A 4IPAA 1P4AA 1U3WA 2BFMA 3A28A 3U4HA 1U5TA 2XV4S 3MWMA 2IZZA 4R51A 3V8JA 4HFNA 5THQA 1HLPA 5EMHA 1USTA 1ARZA 1Y1PA 3GZ6A 4WNCA 4BNGA 1YJQA 2MC3A 4PG4A 3WYCA 4IS2A 4LVUA 1KVSA 4BYYA 3GNQA 5TS3A 4DYDA 4FJ2A 4BMNA 1GUFA 4HFRA 2EKPA 4RPHA 5CVJA 1V6AA 3CINA 3GAFA 3PP8A 1NWHA 3VPGA 3OA0A 3OV8A 2EFPA 3BHJA 3GQVA 2QQ5A 4E21A 2ZCUA 5JO9A 3KOUA 4IJKA 1LI4A 1SOWA 3FXQA 1DFGA 5LGUA 5HRUA 4M8SA 4BUCA 2A3SA 3FWZA 4EBFA 4AJ2A 2H63A 2VUSA 1DAPA 5F1OA 2EWNA 3GMDA 4HKTA 2FR1A 2VRBA 4EVIA 1HRDA 2OBNA 3SLGA 3IKVA 4FOOA 3P19A 4D3SA 4J43A 4E5KA 1NHAA 2EJRA 3G1TA 1UZNA 2W2KB 4U0VA 3MOGA 4Y8VA 3ZNNA 2BGLA 4BOYA 4XDYA 4PIVA 3DL2A 5K9ZA 2HK7A 2CG4A 3DZIA 4H7PA 1O9BA 4XDZA 1RM4A 1ISFA 3I23A 1DPRA 2X0JA 4GPD1 3OQBA 4BKQA 3SBOA 4EGZA 1BI1A 2JPBA 1NPTO 4TQGA 5D8KB 4FD3A 2Y0EA 2ACJA 5L3GA 2IA2A 1YW8A 1HKSA 3GVAA 4ESJA 5IDXA 3F1LA 3PWKA 2PN6A 4OH1A 3B20A 3B73A 4UUPA 5L7TA 3I6QA 3VZSA 4U7DA 3EVNA 4Z3DA 3VEPA 1A7KA 4FFNA 3AY7A 4HX4A 3DC2A 4FJ1A 4ALKA 5EIOA 3T8RA 1FOKA 4M89A 1TNTA 1E1NA 3FBGA 4GKBA 1R1UA 4QT0A 4W99A 4Y98A 5IJZA 4WE3A 1LDYA 4OIPF 1IULA 1Z45A 4ZVVA 3DHEA 4MDHA 4M74A 1SCUA 3ZV5A 5D5UB 5DOZA 5CHEA 4BNZA 3LQFA 3HADA 1D7OA 3REOA 1U2GA 4IVNA 4GCVA 1JHFA 3I9LA 4RZHA 5BT9A 3GH3A 1YDWA 1PWZA 2QW8A 4GSLA 4YQZA 3ZNQA 1C0PA 1KIFA 2OZUA 1IN5A 5DDIP 2HZTA 2HQRA 2IVMA 2P5UA 3ITDA 4U0YA 3L4BA 1NTOA 4ROSA 1FDWA 1HF3A 2GN4A 1BI2A 2M87A 3QE3A 4BNCA 4KN7X 1W7PB 1N5DA 1OC2A 1ZVMA 4HQEA 3RKWA 4J9VA 1NAHA 2VOEA 3PPIA 3ZV6A 3IP1A 5L3FA 3L9XA 4BMVA 3M1AA 4NHEA 3OEWA 3JTGA 2RGVA 4U0WA 4UNOA 5HLHA 4OIQF 2FZEA 1UZLA 3PDUA 4QFDA 1LQUA 3LSYA 4YBZA 4BO0A 1ZJYA 5BSFA 3BP8A 5FFXA 1WPQA 1Z6RA 4C7KA 4D7AA 3PDJA 2QQBA 3AAFA 3L00A 1GV0A 4R3NA 4B8ZA 3ZI0A 3HQ4O 2A6HF 3GO5A 1KC1A 1LBEA 4XGKA 3O26A 4YJGA 1JGSA 3U4CA 2VN2A 2CSOA 1E6EA 4IF4A 1WAMA 1ZH8A 4DQ2A 4JLWA 3IOYA 4R4JA 4BMSA 3UXYA 4R79A 1R66A 2FSWA 4N5NA 3GF4A 1IAWA 4WLOA 2GWRA 1EBFA 2VYVD 1R1VA 1BDMA 2XAQA 3ABIA 4J1NA 2ADUA 2VOJA 3T8TA 2KKOA 1FDTA 1AHHA 3KLOA 5HVQC 2BE5F 5J6XA 1IN7A 2H9IA 4WCFA 3VZQA 3R4KA 1BRMA 1DRWA 1HDCA 3WE2A 1X13A 2W98A 3LQQA 9LDBA 3E5RA 3RUFA 1KU3A 4G65A 4CV1A 4BKPA 3E6MA 2STWA 4E33A 2YR2A 5FD5A 4CM4B 1DDOA 1I2BA 4W6ZA 1GQYA 2B69A 1FJHA 1E2XA 3VTFA 5JDCA 1BC7C 3WYEA 1LQTA 2X0NA 1EV7A 3RPUA 1E3EA 4BNMA 1NQOA 1AN9A 1Z9CA 1EVYA 1PZFA 4OU0A 1QXSA 1YDEA 4OSOA 4CM1A 9LDTA 3K8ZA 5CP8A 5TF4A 2DBQA 2V79A 4CV2A 3SC6A 2I76A 5DDGA 4PLHA 2BI7A 3RBXA 1GPJA 3FHZA 3DO5A 4L0YB 1P45A 4ZQFA 3DZKA 5IXSA 3RUIA 1KY4A 2FPIA 4ND1A 4I9NA 4XQEA 3GVIA 1IHYA 1UAYA 2Y48A 3EYIA 2AE2A 3H4VA 3U62A 5CVUA 2X5OA 3WSVA 1GADO 3MJ4A 4Q4ZF 1YB4A 3NDJA 2CY0A 2PR2A 2Z1MA 3H8VA 2HUNA 5HDNA 4R1HA 4J4HA 2Y75A 1J4AA 1CF2O 2HWVA 2QBYA 2EWMA 4A27A 5IXYA 3WQSB 1Y0UA 4DNCA 1A71A 1NR7A 4M54A 3CDHA 2OZPA 2LDBA 4JCOA 3GWZA 2GN8A 1X7GA 1ISHA 3FMSA 5DULA 1HDOA 1Z7EA 3T1BA 3WBBA 4PZDA 1OR7A 1WLYA 3HG7A 3MJVA 2WYWA 3D3WB 3FRJA 3PGJA 4HAMA 1D5VA 2H6CA 1HEUA 1NAIA 2G82A 2XOXA 3CIFA 4ND4A 1YLFA 3DFZA 4CLRA 2R00C 4CMJA 1S7OA 1PJTA 4Q3CA 2W25A 5L3EA 3H3ZA 3H5AA 4A5OA 3RD5A 3WMWA 5C7OO 5EEHA 3DB2A 1GXQA 2O3UA 5I7FA 2GYYA 4XYEA 4DGSA 4BKRA 4YACA 1T2DA 2PMUA 1KEPA 3P9IA 4LFUA 4H15A 3WTBA 3WE3A 2H6EA 2NWQA 4OIMA 1YW9A 1NWCA 5K5OA 3KLMX 1H9TA 1M76A 3TDZC 3L4BC 4LGVA 2GXGA 2QZ9A 5EERA 4N18A 5JMPA 1Y5MA 3JD1A 5L45A 3F4BA 1I3NA 4L9JA 4LRTB 3Q2KA 2XRNA 3R61A 2O4CA 3I59A 2OQGA 1MFPA 2Y99A 4L0ZB 2O7QA 3OQ1A 1QG6A 3PJEA 2PV7A 3JD4A 5DT9A 3GVXA 4UEOA 1W5TA 2ZTUA 4BNIA 3EZLA 3KSUA 5LDHA 3Q1LA 4FSHA 3IP3A 1ONOA 4NHJA 1A5ZA 4IDGA 2JD1A 1G0OA 5DN9A 2R6JA 3RKYA 4GQAA 2LSOA 3QP6A 2JFGA 4PG7A 5LGTA 1R4NB 2V1UA 1MXHA 4CQLA 3I0TA 1DBVO 1V9LA 2W2LA 3FPCA 2A61A 3JYPA 4JP3A 5TRTA 1XWFA 4O63O 3BA1A 4D41A 1CGPA 3EQLF 1R1TA 2V65A 4CZZA 3HSFA 3O03A 2MH9A 4P9UA 3T4EA 2IODA 2EG9A 3P7NA 2HK8A 3AI1A 3G17A 1B59A 4HOBA 4EUFA 1G4DA 3K1MA 3DONA 3OETA 2HJRA 4MIEA 1AUPA 1A04A 3GHHA 3FNHA 1ISIA 3BROA 2DC1A 4F3YA 3PVZA 2AXQA 1Y8QA 2D0IA 1ZMTA 1LSSA 1IN4A 1RUOA 4J3FA 2FA5A 2WM3A 3CJNA 3PIIA 3OA2A 1ZG3A 2YV3A 3CKYA 3FN4A 3H6KA 3U9LA 4CMCA 4O1MA 1CF7A 2AQHA 1XR3A 5HDKA 4YFXF 1FBUA 2VN8A 1ZSYA 3HUDA 1IZ0A 3JSAA 4NU5A 3D64A 8LDHA 1JXSA 1Z75A 1PWXA 1F8GA 4BNLA 1M67A 1E3IA 4JK3A 4CLEA 1PL7A 3E3VA 4A0XA 3KYDA 2GRAA 4EITA 4XLPF 1WWKA 3O4RA 1KU7A 3FNEA 3VHRA 2FRHA 1YBMA 3WGOA 3ON5A 3SEFA 2BV6A 1ENZA 4ENMA 3HFGA 3X2EA 4ZJUA 4CLOB 4II3A 3ZWXA 4QLCU 3PFFA 3DV8A 5I9MA 4E0BA 4CM9A 2ESHA 3BMCA 1O3RA 3WWYA 4KUHA 5JPIA 2ZCWA 1ZZEA 4RVSA 3VOEA 1H93A 1LSOA 4WECA 1JVSA 5FYDA 3EY4A 4ZRMA 1UXJA 1ORRA 1X0XA 1UJMA 4AVPA 1RJWA 5HDGA 2OP0A 1XSXA 1KVRA 2ZFWA 3C7DB 5KTKA 1R58A 1ID1A 1MUUA 2XIGA 1B3RA 4A5MA 5G0UA 4AICA 2KIMA 4DXHA 4K9DA 4Z0TA 4J6FA 1QKIA 1MC5A 2DU8A 3KYCB 1ADCA 1Z1DA 1TT5A 3F5SA 2FNPA 4LLNA 1K78B 4FW8A 1BIBA 5A9RA 5L51A 3HIFA 5EPOA 4R41A 2FNAA 3NAQA 4U8GA 1ON2A 4NJMB 4RPGA 3T7CA 5CLSA 4GYGA 1BXKA 1LC0A 2O3RA 2GGSA 1U5AA 3RASA 2E7WA 1E5LA 5JY6A 4ZH4F 3C1AA 2OBYA 5DCMA 1P0CA 4M72A 5JCXA 1ZRFA 2KJCA 3WYBA 3ICCA 3Q11A 1TB4A 4CGZA 5MGBA 3GEZA 5BQTA 3NQOA 1VL8A 3NJ8A 3TJRA 1ULYA 3UW3A 3JD3A 2ZBKA 2Z9OA 1GQ2A 1N8KA 1CERA 1QYVA 2J3IA 3DMTC 3MEQA 2JAHA 5CG2A 4E6PA 2G9WA 4E2XA 1LEBA 2HDCA 4BNFA 1PL6A 4CR8A 1MDMA 2ZTMA 3GNTA 2YPRA 3DXFA 4I5FA 4KTVE 1PJCA 3N4MA 2EKQA 2EV5A 3HOTA 4L4SA 4D43A 2M45A 3BOQA 5JVTA 4R16A 3MTJA 4AJ4A 3H9GA 1N1GA 4H3VA 4E5NA 3QWAA 5F5LA 1T98A 1GEEA 2F5CA 2PEXA 2L3DA 4O5VA 1RNLA 2EJVA 3QWHA 1BN5A 1HXDA 2CDCA 2VUUA 3TQNA 3GHYA 3DQPA 1JKIA 4XGIA 3G73A 3DOCA 4TZKA 3R0JA 4FT8A 4IQGA 5FB2A 4DIOA 3QU6A 4MVJG 2VBXA 4NBVA 3ANMA 4Q47A 3WX0A 1X1EA 4EEZA 3HHHA 1I2CA 2EF1A 2FF4A 2BELA 4C7JA 4TKMA 3DKWA 3HWRA 2IP2A 2X23A 4I9UA 4AWXB 5ILVA 1AHIA 2MLGA 2CDBA 3DEYX 3PFWO 2O23A 1YFHA 3CZRA 2M30A 3ROPA 4GXOA 5LRSA 3UN1A 1MGTA 4D46A 4AD9A 3ZWYA 1ZCJA 1B2LA 2NS0A 4BHCA 1WDMA 4ALLA 2AHRA 3K30A 3Q2IA 4IINA 2ZNZA 3HHGA 4M71A 4NDNE 3TQHA 5LHGA 4LN1A 3G3ZA 1HE3A 2QRLA 3Q6IA 4MP8A 2XAJA 4IS3A 3AY3A 4TVBA 5G0SA 4TRJA 4KUEA 3S2FA 3WMXA 1QNTA 1E3LA 1MP0A 2HRZA 2FY8A 3AM4A 3BTSA 4J0FA 2D59A 3RIRA 3SQNA 5ICMA 4U6SA 1H9BA 2AW5A 3HDYA 7MDHA 5BSGA 2DKNA 3ISPA 3QP9A 4K1LA 5TT0A 3QV1A 3JYQA 1WWXA 2PD6A 2AQIA 3LT1A 1Z6TA 3KBOA 4MVJA 3Q9SA 2OHXA 4OXKA 1MLDA 5KVVA 5KCZA 4G8XA 2W84A 1P1HA 1Q7GA 2CD9A 2W8ZA 3C1TA 2PFGA 5B4TA 1FK8A 3E48A 4MIOA 4M87A 4EV0A 4XSZF 2P7CB 2GZ2A 5A3VA 1HSZA 1PZGA 1UXIA 2HJSA 1YL7A 4EM2A 1HLDA 3PQKA 3KUXA 1PS0A 4RGXA 3JQ8B 3MWDB 4A0SA 3JQCA 4I5EA 4DYVA 2UXNA 4UHTA 2EW2A 1SPXA 2ZB3A 2DW4A 2O4UX 3C8MA 3N74A 3Q9UA 4GLOA 4Z9YA 1PL8A 4UVEA 5TQVA 1E3JA 1U3UA 5DZSA 2B4TO 3WJ7A 4UVGA 3CUQB 3JQ6A 3R60A 3WTYC 3WICA 1JAYA 4W7HA 2XASA 2HK9A 2X9NA 1BVRA 1PJSA 2Q1SA 3H9JA 4RF4A 1UAGA 3LF1A 3WTTC 1XKQA 1EVIA 5IZ4A 2X0RA 3I64A 2IZ1A 1LLQA 3GPIA 4Q9NA 5KJFA 1WSUA 2PZLA 1C1DA 1PUEE 1C1XB 5JHUA 2YU3A 2ZKLA 3SXYA 3IKTA 3H65A 4UEJA 1C14A 2HKXA 4Q5SF 4RGRA 3DBVO 5CAEA 1KQ9A 1KEWA 2W2LD 2NVUA 4KFCA 3I9KA 3M8EA 3CMMA 1MJ9A 3LK7A 1FWZA 4IIVA 3WLEA 1NPDA 4BNTA 5JFRA 1ADBA 4BO1A 4YG2F 4ENKA 3IS3A 5GZ6A 4CLXA 2QQAA 1ENPA 1EE2A 1R5GA 2YHIA 3FF4A 3GZNB 4I9HA 1DIGA 4IQ0A 2C54A 4JQCA 5EINA 2DQRA 2O3QA 3K31A 1HWYA 1ADFA 4ZYDA 1VM6A 4EZBA 1B8VA 4GI2A 4JJIA 5ITWA 4QO8A 2PNFA 1P2FA 4P9FA 3Q5FA 1N1EA 2GZ3A 3KRTA 2Y68A 4R1TA 5A05A 5LHHA 3LQRA 1DIAA 2I5PO 4XQCA 3RKRA 2GNAA 4AIKA 3TOAA 1IOLA 1H94A 3GDOA 4FOSA 4BB6A 4ZN6A 3LAJA 3M7GA 3PHJA 2F5EA 2E1NA 4S3MA 2MA3A 2GF2A 2JFFA 1LLCA 2KRFA 2HU2A 4CQMB 5FF9A 3A4VA 2P8TA 4AL4A 2CVOA 6PAXA 2EHDA 1E7SA 4TRNA 4E4YA 1P4XA 3OP4A 1ZGJA 3E9MA 4MINA 3AJRA 5COAA 3ZHXA 3K2BA 5IDQA 1DHRA 4FC7A 4LG0B 2HYFA 1GZ6A 1BXGB 5DUKA 1XLTA 1I32A 3BMOB 4R54A 4CM9D 5HWSA 3FXRA 3C1DA 2HRBA 1DFIA 3DMYA 5JI6A 3ZMZA 3OEYA 3WNQA 2QM3A 4U7BA 1LNQA 3DFUA 3HB5X 2G76A 3AFMA 3ZU4A 3H9UA 3HDHA 1O7FA 1D8AA 1X0VA 3MZYA 1XGOA 1L7DA 3LC1O 4FJ0A 4IGEA 4YCAA 2NU8A 2GQQA 4M9ZA 1Q1NA 4QUKA 3WB9A 3GOHA 3EZYA 1V8BA 1P4WA 4XR4A 3T5XA 2HYGD 4Y15A 3AUSA 2Z1NA 3K9QO 2JAPA 3QVSA 4E2WA 1IL0A 3I9NA 1TW3A 4MEXF 1Y9EA 3F6OA 4Z9XA 3PRJA 1RIOH 3SXPA 4OQYA 4L0QA 3HHPA 2QENA 4ZICA 2O3SA 3QRFF 3JQBC 3U0BA 4IGFA 4MQ9F 1PIWA 1Z6ZA 5E1XA 3GA0A 2OL4A 3PEFA 3IAHA 5KKCA 4JJFA 5E17F 2V7PA 1GD1O 3ZN2A 5ADHA 4WK6A 1U4SA 1Z82A 2QZZA 4R8HA 4BNVA 4NK5A 2FPPA 1QLHA 3D0SA 3DZFA 4HW0A 4FX4A 4RF3A 1MJAA 5FGMA 1DSSG 1YWGO 2RH8A 1ENYA 4BXUA 1NP3A 2R7FA 1E3WB 4LCEA 3MAJA 1E7MA 2Y1EA 3PHHA 2FXAA 1FXSA 4H16A 2Q49A 3ROKA 4GX5A 1SB9A 1NHGA 3LF2A 4PLPA 1SD5A 2DLLA 5ERIA 5J8FA 2NTNA 4GX0A 3F8FA 3LT4A 3RU9A 3K2EA 3ZNPA 2XAAA 1S8NA 1HTBA 3RJ9A 2HOEA 4HADA 5CPBA 1U8FO 2OP1A 4PLYA 3UF0A 2A92A 4NQZA 3ULKA 4MOWA 2NNNA 4GH5A 3TSCA 1R22A 2V6CA 5LRRA 1PJBA 2NUAA 3GY0A 4YYZA 2VQ3A 1BI0A 1B14A 2DUUA 4GBJA 4TMFA 4CM8B 4DQVA 2K4BA 5ICCA 2O2YA 3SZTA 1Q2XA 1SZJG 2GCGA 4XRFA 2OZ6A 3H5NA 3RKUA 3ZU5A 5CEEA 2DBRA 2YDXA 2GUGA 4L9RA 3NTRA 3TOZA 5ED4A 4NPCA 1B15A 1F06A 1HDYA 2C07A 3P9CA 1MG5A 2GERA 1GV1A 2G5CA 2RAFA 4R01A 1AE1A 1EH8A 1IW7F 3GUDA 3L4SO 3PK0A 2FBHA 1ISGA 1I30A 4WOKA 1UCRA 2EA4A 3CTAA 3I6IA 1DLJA 5JAZA 5EQFA 4HX8A 2FBIA 2GA1A 2XAFA 4PFJA 4GGOA 4YDRA 2BF7A 2DBZA 1HSTA 1R5HA 4PN3A 4EM0B 5D4RA 1E1KA 5DCFA 1RUNA 2H1SA 2PTGA 5THKA 1R0LA 4QEDA 5IN4A 3DOOA 3QVOA 2CO5A 2WC2A 3LLSA 5I9NA 2ZQYA 4UXNA 5T5QA 3ZWBA 3I4PA 4CMHA 1ZW1A 4ZD6A 3ZWCA 2AE1A 2OOSA 1PGPA 4ZQGA 1JE8A 3ROUA 5TX7A 3HN2A 5HS4A 3ZMSA 3WIDA 4EJMA 1I0ZA 1G6NA 3QQPA 2TMGA 4FFRA 1HKTA 4B4UA 2BMAA 3AI2A 3RQSA 1JHHA 3BMQA 1QV6A 1TXGA 3M6IA 2B35A 2IXAA 3QVWA 3RUCA 4DPMA 2POQX 4GMGA 2OUIA 5IN5A 5BQFA 1F1ZA 1H9GA 1ZREA 2BFOA 3A1NA 4A10A 4OSPA 2X5KO 2Q3EA 2CZCA 4J4TA 1BC8C 3DBRA 1PJQA 4B4VA 1D8KA 1EH7A 4KMUX 1CETA 1ZFNA 2NNLD 4GVXA 5B37A 1UFMA 4LRSB 4LSWA 1U7TA 5K1YA 1GCUA 1N9GB 3QWFA 3ADOA 2YSRA 5F64A 1W0CA 2M8EA 1DPGA 2R3SA 2XVCA 4Q3BA 4RLSA 4QQRA 4YJGB 2BHLA 4CLDA 3GYHX 5DBGA 4S05A 3KCCA 4L74A 3ASUA 1VSVA 4IDCA 3TKYA 1UDAA 2UAGA 5ILUA 1C0IA 4ALIA 1PEDA 3D4OA 4GLLA 3E9QA 2BGKA 4GO1A 3W6KB 3LA3A 2EEZA 1RM5A 3AI3A 4BO5A 2Y1GA 1YS6A 4YJHB 4A2UA 1FF9A 4OOIA 2CW0F 3U2RA 3KSZO 1DAOA 2WE8A 4WCFB 1EH6A 4RLHA 5JSFA 2L01A 2ZTVA 5LEKA 3FI9A 1HZZA 3RFXA 5JAIA 1V35A 4XR9A 1B9MA 1OKRA 3WTUC 2VWHA 4OYRA 4LMYA 1B6AA 4RAYA 1GXPA 4BKUA 5KVSA 1O0SA 4XYGA 3MEXA 3VC7A 2X9GA 1QO0D 3WIEA 4CR6A 2JCXA 2QVOA 1R4MB 2HMVA 3KYBA 2O8XA 2G7HA 2PJPA 1A4IA 1OI7A 1Z05A 2VNAA 3WTVC 3V4GA 3QLJA 5F6FA 5AXDA 1VL6A 1ZARA 3UGKA 4D42A 5KIAA 1ZN2A 4MHGA 1M66A 4G7ZF 3IJRA 4MVJE 1SB8A 4AVYA 3I9JA 4J90A 2LDUA 1I1SA 2M5WA 4JBGA 4MP6A 4CM7A 3AY6A 2ZJ0A 5DCYA 3V2UA 3VH3A 3DWFA 4I2OA 5IZCC 2AMFA 1PX0A 1YQGA 2AQKA 2B4RO 2D45A 5D6FA 4ZRNA 3UCFA 5D4SA 1EFKA 2BLLA 4RQUA 3HFSA 4WNIA 4WCGA 4FGWA 4DWVA 4KOAA 6LDHA 4RPKA 3KEOA 3OOPA 3NKLA 1JLLA 1KY5A 3OIDA 2CWEA 1G6KA 4NBUA 4GGPA 3L9WA 3VVBA 7ADHA 5AVOA 2UZKA 2EP5A 1HW5A 3Q9VA 3HJAA 2QBYB 1BJAA 1PQWA 2PD3A 2HQNA 3U1DA 3O8QB 2DAOA 1A27A 4IBOA 2JL1A 4JBIA 5HS6A 4AJIA 2EKLA 2FWMX 5ICEA 1JW9B 4IJVA 3A06A 1P3DA 2R00A 1XQ6A 2IYPA 1R36A 2IXBA 1C0LA 3GAZA 3LU1A 4MTEA 1GYPA 4NBRA 1U3TA 1M2WA 5CVVA 1P1FA 1KYQA 3UH1A 1XSVA 4L9VA 1MJBA 2Z99A 3M9AA 2DU9A 3ABTA 1DC3A 1U2WA 1JU9A 1QORA 1FBQA 2NTJA 4KT5C 1NYTA 2E82A 3PYMA 1FPQA 2DK5A 1Z73A 3EVTA 4DC0A 2D1HA 4IXAA 4R1SA 2UVDA 2Z33A 3F3XA 4MNUA 1P1IA 2DM6A 2A6EF 4JJGA 1QGPA 2HTJA 5H20A 3DZGA 1HDZA 4JNKA 1EDOA 4QTZA 5L4NA 2CSUA 4BH9A 3GDGA 3SC4A 2C2XA 3V1YA 3V1UA 5ILOA 4CL8A 4IXTA 2IPQX 3LC2O 4YIFA 1GUYA 3FM3A 2Q99A 3G79A 3E5UA 4BS9A 5MDHA 5LLQA 5BPDA 2DTXA 4J4BA 4YWJA 3MTGA 3LA7A 3AU9A 4U6QA 4OINF 2X9VA 1T2AA 4CHUA 4EMSA 5BR7A 2Q4EA 5JXWA 3EUHA 4IDEA 2LF7A 2Y1OA 3DBHB 4LK1F 2VHZA 5T6BA 2KIUA 5IT3A 2PGJA 4RCVA 2F5DA 4P96A 1UXKA 1S7CA 1R0SA 1LRJA 4RQTA 4XQ9A 3OIGA 4UVBA 5CPFA 4BNYA 3H3FA 4MJLA 1ISMA 2VC0A 2XPCA 1VJ1A 4Z0PA 3S55A 1GHCA 5DD4A 1SFEA 1EQ2A 1MG0A 3S2GA 1JAXA 5L3ZA 5FO5A 3LVFO 5HTOA 3AM3A 3JYLA 3F9IA 5JC8A 4CQLB 3J81Z 2O6GE 2ZK7A 1T26A 2NNYA 4RPLA 3PHGA 1XHLA 5FFFA 2QG4A 2ZJ2A 1P1KA 1F0YA 1R37A 1HE2A 5LBQA 2WYUA 3ADPA 3R0AA 1BSVA 3R6SA 1W6UA 2NVBA 3J80Z 3GN1A 3PHLA 4XB1A 1F17A 1ZRDA 2YX4A 1U78A 3ML6A 3DAFA 4LLGF 1LC3A 3IJPA 3PYLA 4NH4A 2NSDA 3E6CC 3GZ5A 3JYOA 3P2OA 3FWNA 4PDKA 3VVCA 4KA4A 4LISA 3OJOA 4GKVA 3IWZA 4A2CA 4XGNA 4HDUA 3MFKA 3GK3A 3ZPLA 4O0LA 4EJUA 3IDSA 4F6LA 3K5PA 3KETA 1C3VA 1CF7B 3PLNA 1XN7A 4Z9FA 2P6TA 4P5OA 3JQGB 1IY8A 1LLUA 1PGOA 1DDNA 1I8TA 1KVQA 3KV3O 2QRJA 3ZV4A 3RBVA 4BNWA 4W7IA 3VH4A 3GMSA 4I01A 1Y81A 2Q4BA 4CMEC 2ZYGA 1EVZA 2OU2A 3V8LA 2Y1FA 1C0KA 1R23A 1V3TA 1EUDA 2JD2A 3C1OA 4JX8A 3GN2A 3VODA 4DIFA 2C2YA 3G0OA 4EJVA 3WTXC 3GVPA 3SFZA 2JHFA 1DIRA 3BMCB 4J2HA 2O2SA 2BFPA 2DQLA 3GRKA 1VE9A 2DQ4A 3NEUA 4PLTA 2ZB7A 3LLVA 5K5RA 2SCUA 5KJEA 4WX9A 3OECA 2FEZA 1YYVA 3TDUC 4J1QA 5TC4A 2VODA 1BWSA 1GU7A 1GQQA 1PGJA 2W2KA 4RVFA 4DBZA 3UKOA 3WGIA 2IW5A 5B1YA 4U88A 1FX7A 1VKOA 3C3WA 1E7WA 3PI7A 5T67A 3EYWA 1U7HA 4YJDA 4B4OA 1QQIA 3BZ6A 3TO7A 2Q45A 4A73A 3E5MA 3QSGA 4NBWA 4Q39A 4RGSA 2B0JA 3TPCA 5TLSA 3WU1B 5G0VA 4XD2A 1Y9AA 2JCVA 4DVJA 4FN4A 2I65A 2BYVE 2DPHA 2MH2A 4PZCA 5HLIA 2QHXA 5AOVA 2D5CA 4KMFA 1E3SA 3NGLA 5JE8A 4F45A 3GXOA 2C29D 2C59A 3IL2A 4UEKA 4FX0A 3TZQA 2CUKA 1CYDA 4A12A 1HT0A 1VJTA 2I3AA 5DCMB 3WQQA 4LSMA 1SMTA 4RZIA 4KDFA 4A26A 3KLNA 3LSTA 1LDNA 3E18A 4H0EA 4IXWA 4YTEA 4CMIB 4CV3A 4Q3DA 3DMTA 4U7WA 5COBA 3DF8A 4G2NA 3L2CA 1U3VA 4OOEA 2B0LA 1QP8A 2AEFA 5J8CA 1P77A 3IHUA 4YJFB 4EGFA 4OL9A 2IYOA 4RJTA 5B12A 2QQ9A 2P5YA 4J7CA 4PVCA 2Q46A 3B1KA 4XQGA 3S1LA 2ZKZA 2D2IA 2FQ3A 1X15A 4LW8A 4CMAA 4PLVA 3P2YA 1LDGA 3HDQA 1DHTA 1NHWA 1L7EA 1MDMB 2VWGA 4LK3A 4ONEA 3GPDG 3DZBA 1QZZA 3KVOA 1S29A 3JSPA 4FIZA 1X3UA 3JV7A 4OM8A 4J91A 2A35A 3QJ5A 3BTOA 3DBLB 4L5IA 4E12A 3QRWA 1LSJA 2EXXA 4INAA 4IHTA 2P68A 4EJTA 4L4RA 1B3BA 4TWRA 5CJ9A 3SJ7A 2QWWA 4GX2A 2AS5F 1DB3A 3F8CA 4O6JA 3WDSA 4GAEA 4TVOA 3RBZA 1VI2A 1HKUA 1TVEA 3PZRA 3ZQ7A 4KQXA 3I4CA 1W7PA 2PKRA 3JQEA 3WLFA 2XXBA 2EFNA 4WOJA 3JAMZ 2VONA 3I5MA 1Y7TA 1IPFA 5EJ2A 4HX7A 1G1AA 1ZXLA 2FHSA 3C3XA 5JCJA 3WTZA 1LUAA 3NX4A 4A0ZA 2EA2A 3W4JA 4OJNA 1H6BA 3Q9NA 3EDMA 3Q3CA 3WU0A 4RGUA 3E9NA 1GVJA 2GA2A 2DUWA 3RYPA 1BI3A 4R9SA 5CEJA 3KEQA 5IAAA 1HDRA 4TROA 4F46A 1FBSA 2FMYA 2H27A 2VHWA 3CH6A 3VAZA 4CYDA 3EUWA 3COAC 4II2A 3F46A 2J5OA 1I24A 1V3UA 5JDIC 5DBIA 3RAJA 3DHNA 4JGBA 2VWPA 4DIBA 1K3TA 4NZ9A 4R3WA 4LD5A 3NTOA 1Q1HA 5L4SA 5LHIA 1VRWA 2CDAA 3LZ6A 4OIOF 4AJ1A 4NFSA 4KICA 3IUPA 2O50A 2UWMA 1TTYA 1XCVA 1FSHA 3OQ6A 1P1RA 4R1UA 1LRLA 3ZWPA 3PWSA 2FSVA 2PQ8A 1U9JA 2K7LA 3F6YA 3VPSA 3EW7A 5TJJA 2E1CA 3H2ZA 2COMA 2O3FA 1ZK3A 2P2SA 2H94A 4N0BA 1BVUA 1SO8A 4FC6A 4BGVA 4FB5A 2FMLA 4HV4A 1KQ8A 1J6UA 5FLXZ 4FFLA 2FN7A 4CM4A 4Z3KA 5C5IA 3KTDA 2EK5A 1KOLA 3QOPA 5IT9Z 4EYEA 4HDVA 3BTVA 3DTYA 4CMBA 1BG6A 2C7GA 2ZCVA 2JRTA 4AJLA 2EV0A 2FPGA 5L40A 2NYXA 5H81A 3ABUA 3O6BB 1R0KA 2OAZA 2JKVA 4G81A 1G3YA 3AW9A 3DQVC 1K79A 3AOEC 3GFBA 4LMRA 4FQ8A 1ZYRF 2BEOA 1SMYF 3DXJF 2L4MA 1I3LA 1KS9A 5DP1A 4Y17A 4M9XA 4XA8A 3VKUA 4B79A 5JY1A 4HLXA 5BSEA 1GPDG 1S6YA 2WTBA 4CO8A 1WZIA 4B7XA 2EV6A 3MCVA 3F72A 3U5TA 4WXCA 4TSKA 4YFKF 4ZQBA 5AONA 2ZTLA 3ZNOA 2WWRA 1W5SA 2BRUA 4L18B 4OIRF 2X8LA 3H5RA 1IZ1A 5BNFA 1ONPA 4GVLA 3HRSA 4NU6A 1REPC 1LLDA 4MO2A 1NVTA 1S3JA 3WGQA 3D7LA 4EW6A 5KJ1A 5B4UA 3ETEA 2OBPA 2YX7A 2DVMA 3E5XA 1KVTA 3MCZA 3U9GA 4E2ZA 3D3WA 5B4VA 5KWEA 1NQAO 3QWBA 4Z2YA 4IDFA 1LSUA 2VT2A 4ALMA 3BHMA 2NACA 3BMNA 1M75A 3VDRA 2HMUA 2D5AA 1SC6A 4ZQHA 3GNSA 2VYNA 2W4QA 2LNBA 1ZKMA 1YJ8A 3WTCA 4E5MA 1AWCA 2PG4A 3U4IA 2HKOA 4M9SA 3WG9A 1DOHA 5U9CA 4G94A 3PQEA 5C7LO 4HBGA 1KGSA 1XGNA 3WGHA 2J8ZA 2JJYA 3DR3A 4PRLA 5DEQA 3B1JA 3OIFA 2TMDA 4URFA 1HE5A 4OMUA 4YVFA 4DREA 3O38A 3V7SA 2GASA 2V6FA 2WD7A 4QECA 2RH4A 3NRVA 5L3CA 4NFHA 5F3RA 3L6EA 3K9TA 4CUJA 5A9SA 4JQFA 3WQRA 1XGSA 3FNFA 5JFOA 1P1JA 2CF6A 5DCWA 3RC2A 5FEUA 1WRJA 2A94A 4IMRA 3RJ5A 4QO7A 5COQA 4QFCA 1ZHFA 3AK4A 3GFGA 2I67A 4OAQA 3JQBA 3JTMA 4OOFA 3E6DA 3RCBA 3TRIA 2X86A 5AXCA 4MVJP 3QA9A 4B3JA 1J0XO 2FSSA 4R5MA 3PIDA 4LK0F 2X0LA 3HDJA 2EB7A 1KBZA 4K26A 4XLNF 1O57A 2DFVA 3OF2A 4RORA 2DBVO 4W9NA 5G4KB 4AFNA 1SBYA 4FFPA 4PZEA 5F5NA 4HY3A 3ASVA 2IA0A 1WZEA 1B8UA 3F3SA 4OHUA 2X0IA 1WNTA 1HSJA 2X58A 4PCQA 1O7LA 4XJTA 5D5VB 4NNJA 1ZSVA 5A5EA 1A7AA 1YS7A 1P9LA 1SNYA 4PRKA 1PQUA 2HAEA 5G4LA 2RN7A 1YS4A 1NR1A 5C7IO 4W4TA 1YOVA 5I7VA 5ITVA 1AXEA 3K92A 3JTHA 2X5JO 3VTZA 2VUTA 4K2EA 4DPLA 2VBYA 1Y6JA 1XDUA 3GDFA 3W6JB 4ENNA 4BO9A 3I3OA 3F8BA 4BHBA 2BI8A 4MQVA 2EJWA 3GEMA 3WOHA 4ESBA 4UVCA 2Q1UA 1DJQA 1XSDA 4DTIA 3RROA 3RUEA 3D4NA 3PJDA 4KQWA 1LDEA 2DLDA 4L75A 3IIEA 4R69A 3RPQA 1UP6A 4HNGA 1OPCA 4CM6A 4DMLA 4E30A 2DI3A 2Q1WA 1B1BA 3ONEA 5JYDA 2WTEA 4NIMA 3K6JA 1I3MA 3E5QA 2L54A 4BAYA 3EGOA 3W8EA 1SD7A 1H2BA 3PYXA 1TLHB 2OA4A 1SEPA 3JYNA 1SFXA 2B36A 1ZMOA 1JVBA 1W7PD 4MVJI 1I1GA 1KETA 3KP6A 3CO6C 3TZCA 4WKGA 1UHMA 4IDAA 4O6VA 1U8RA 4RO0A 3RFVA 1MC4A 5JCJD 2IEDA 2CFCA 3GR6A 5JLAA 3U4DA 2OO5A 4FBGA 4UUNA 3ZWVA 5E1ZB 5TGDA 1CDOA 1YO5C 1V4RA 1X1TA 3OH8A 4J7XA 4AJJA 4IPTA 4CR7A 4ZHSA 3QPHA 1ZRCA 3L6OO 2GN9A 2XKPA 4LMPA 4Y6RA 3R1IA 4OQZA 4U5QA 2CVZA 3BY6A 1T38A 2VHYA 2WWYA 1PGQA 3JQAA 1BW9B 1KYWA 2B5WA 4DBVO 1U4OA 1IXCA 1LDMA 2W90A 2ZJ1A 3DZHA 3I9OA 5ICSA 3L77A 3BZUA 4NJMA 5J23A 1BTOA 1DC6A 2B37A 2ZXJA 1NBOA 3AUTA 1RPNA 1DIBA 1H6CA 2BGMA 1YRLA 2VCYA 3CO7C 4KTTE 4IY1A 2CF5A 1XD7A 3LAPA 4RB1A 2YHUA 2VC1A 2V6MA 1S6LA 4EQQA 1SFUA 2FRDA 4HNHA 4A6DA 5LGNA 2WE7A 3KHUA 1B8PA 3TWOA 2HSDA 1O3QA 4IDDA 2K27A 4MEYF 1VTNC 5F21A 2HCTA 1YH3A 5L3BA 4MKXA 4DLBA 1TA4A 3DBRB 3ZW9A 4TZTA 6ADHA 2EIHA 3VZRA 1H2HA 4Y67A 4BGEA 2Q2VA 1Y8RB 3J81K 1YONA 1R00A 4J16A 5KK1A 3FBTA 4LCJA 1DUXC 1MKMA 3WBFA 1QV7A 4YAIA 1YG2A 3EYYA 1ZG1A 1WMAA 1LDJA 1T39A 2JPCA 1U5TB 2JT1A 2GLXA 3FPLA 3JQFC 4C4OA 1XGKA 4PG5A 2TDXA 1AXGA 2IJLA 1O5IA 4HV6A 3IQDB 1LDBA 3NDRA 1N7GA 5BNIA 3ZZNA 1BMDA 1R16A 2I3GA 3TDKA 4BNXA 1HW1A 5E20A 3WGGA 2H6BA 2ZMEA 4EJOA 1IPEA 3BHIA 4K6CA 2GXBA 4KMSA 1STZA 4P4NA 4RVUA 2PBIA 3QU3A 2G1UA 4DA9A 1GDHA 1XDSA 3RJPA 4WF2A 3F8NA 5D5WB 4HA8A 2JCYA 3MZ0A 4GX1A 1OMOA 1XU7A 3LWFA 4O59O 1YW7A 3CXRA 5LCXA 5JYEA 1T0FA 4M86A 3ROQA 3ZH2A 5FD6A 4FFMA 1P31A 1X7DA 1OYYA 4FCCA 4M55A 2LKPA 4NB5A 5EL0A 3ZDFA 1PJ4A 4BL5A 2PKQO 3P9KA 1LQ1A 3TZKA 3T0YA 1ZUD1 3C7CB 1YXMA 4HFMA 5A9SB 4YEDA 2DTEA 5DNAA 4HZFA 1NPYA 1CIVA 4BV8A 3ELKA 5CDUA 3K0LA 2Y0CA 3F21A 2PY6A 1RZ4A 4ID9A 2YV1A 5IZCA 4RL6A 1XU9A 3KXDA 3R0IA 5KNLA 2OD5A 4IMPA 2PH3A 1GTMA 2CYYA 3MZHA 3PLRA 2FBKA 1EBUA 3ZWAA 3SX2A 4RVDA 3ZN1A 3WTSC 1IXRC 3GF2A 3I52A 3F8MA 1MB4A 5IFLA 2ET6A 3SHFA 4WWCA 1MFZA 2XROA 2VYND 4L76A 2P4HX 3M1LA 3WGTA 2YYYA 5JMWA 2VZ9A 1ULSA 3D1LA 3KLPX 4S1VA 1IXSB 1NX6A 1FDVA 1PR9A 3CUOA 2YUTA 1QYCA 3GGGA 3GW2A 1LB2A 1JWAB 1KC3A 4Y13A 1B0AA 1UUFA 1WVGA 1V0JA 2B83A 3V7CA 2NU9A 3OJEA 5JAMA 4AG3A 4PZJA 2VTEA 4MVJM 3RU7A 2A07F 1T1SA 3F1KA 3H2SA 2Q1TA 2FE3A 1JTVA 2X4HA 2YY7A 2AEMA 3D4PA 5T8KC 1VL0A 2V6BA 1PS8A 4M6YA 5EQDA 5BSHA 1HETA 1I6XA 2EV9A 3V2HA 2GIVA 4YR9A 2L4AA 3K73O 5HLGA 2B5VA 1XMKA 1PS9A 3ETGA 3I1JA 3RUAA 2W57A 4L5JA 3ANNA 2UV8A 1ZK1A 4RF2A 2CFXA 4Y9DA 2CNBA 3ZHBA 1F8FA 1LEAA 2Q50A 2F5FA 3DHYA 2LF8A 3H9EO 1C1XA 2Y1CA 3W1VA 4J49A 4L73A 3IC5A 1BGVA 4J7UA 2YQ5A 2CGPA 2D1VA 1TW2A 4WLVA 5FI5A 5KVCA 2XAGA 1I33A 1ZEMA 2RCYA 4PLCA 3NEPX 4KDPA 1NNUA 1VSUA 4BNKA 1ENOA 4PLFA 2ISYA 4FHTA 3U09A 3JD2A 5GZ1A 3N58A 3K2ZA 1OMIA 2Y66A 3PHIA 4JBHA 4ALJA 3VH1A 5JC1A 4OMYA 5KJ6A 4AJEA 1ULUA 4IRIA 1GR0A 2O0YA 1UDCA 1XELA 4BB5A 1IZ9A 3GLXA 2I99A 4HV5A 3ZU3A 3LYLA 2OGUA 4LLLA 4YAJA 2YQ4A 2K4JA 2PLYA 1KYZA 4F7ZA 3JAMK 1FDSA 1FNNA 2CMDA 5JNLA 2IEBA 2EFQA 1MGOA 1XYGA 1YL5A 2AG5A 3KP3A 3TZHA 5L7WA 5JR3A 1ZH5A 1FMCA 4UULA 4M1QA 1RI7A 3W8DA 4B8XA 2E48A 2OORA 3QY9A 4WJZA 3ONFA 2DK8A 1V3VA 4BO6A 3RSHA 4PGFA 3SJUA 4PLZA 4OO3A 2AEJA 1ZO8A 4CQMA 1B4AA 1O94A 5K0ZA 1J2XA 4QWQA 1X14A 3G49A 3PQJA 1DFHA 3IUSA 4RV9A 3TL3A 3LDHA 1E5QA 3P7MA 4HBLA 2Z3YA 1PSDA 2EW8A 1H5QA 4ND2A 1YIOA 2B4QA 2ISZA 4LG0A 3RYRA 4ILKA 4E5PA 3BMOA 3BJ6A 2NU7A 1F4KA 1ZG5A 2AA3A 1JN0A 1HXHA 1HE4A 3W4KA 5L53A 1TEHA 3TL2A 4WLUA 3NV9A 1ON1A 4WPGA 2W24A 4NQWA 4ND3A 1DC4A 4WGGA 3KE2A 3ENKA 2P5KA 3L6DA 2YZ7A 4YAKA 4LB6B 1IF1A 1JDJA 3WODF 4RB0A 3A9WA 3I71A 1YVEI 3GGPA 3CLOA 3KO8A 3MJEA 2P9CA 5A1TA 4YXFA 3D5TA 5E8IA 1YBAA 1J0RA 3UAGA 2VZ0A 3C85A 4CMEA 1GZ3A 1DC5A 5FLXK 1OC4A 3JQAD 2Q2QA 3MJCA 3RI3A 1GY8A 1LA2A 2O3JA 1VC2A 4Q3AA 4RB2C 1IN6A 3ZMTA 2W85A 5IT9K 1M6HA 2XXJA 2QUFA 1K6XA 3JQ7A 4DL9A 2J3KA 1PGNA 1WDLA 3TNLA 1ZSNA 2C82A 4IZIA 4A7PA 2J5QA 3ZMVA 5ICGA 1QR6A 3GRPA 1EEHA 5ENVA 4Y6SA 1TBXA 3DAGA 5ILSA 1RKXA 2G17A 2Y0MA 1R6DA 2BFAA 5EEGA 2OQRA 2D1YA 1E3WA 1LX6A 1YB5A 5IDYA 3M8FA 1VKNA 5KKAA 2HKIA 2YW9A 4WLNA 5DV5A 3V8KA 4XCVA 3E8XA 4BO2A 5KJCA 4BQAA 1J75A 2VXZA 3JSOA 2RIRA 1R7JA 2HMSA 1DXYA 5BOXA 1TQMA 2EFOA 2RNJA 1H6AA 3UFXA 3MQ0A 5D8LB 2D8AA 2GSDA 3F6VA 1N92A 3H9QA 1ZK2A 1QYWA 4BIIA 2HLPA 3ETDA 4D3FA 1DRUA 5D6EA 4ND5A 4XWYA 4I02A 4CM8A 5IDWA 2P5LC 2J6IA 3NT2A 5L95A 4CLRB 3GGOA 3MJTA 5JW6A 5FWNA 3BPXA 2GR9A 3O9ZA 4A6EA 1FZPB 3V5NA 2A5YB 1KU2A 2VT3A 1LRKA 4F6CA 3KZZA 3VFZA 1MZBA 3CUQC 1DPUA 3DDNA 8ADHA 1T25A 1WI9A 4NFYA 4OKIA 5BS6A 1WW8A 5KOIA 4GWKA 4BQRA 1EE9A 1T4BA 1E7RA 3MWEB 1D4FA 4U0JA 4WK8F 1XQ1A 1P74A 2H5LA 1ZNQO 4XYBA 4NMHA 4PLGA 1XDWA 4HX5A 1XCBA 2F1KA 3U3XA 2A4KA 1K7AA 3FWEA 4YFNF 4EI2A 4OXNA 3ANLA 1QYDA 4XBFA 1HYHA 4WCDA 4BGUA 3KFWX 4I1IA 4RVGA 5F1KA 1HDXA 3UVEA 3OSUA 3HRMA 3QAHA 1DIHA 4ESOA 2PFBA 4G6DA 2OMEA 1DEHA 3JQDA 4CODB 5E1WA 2BH9A 4RDIA 2ETHA 2DBBA 3I59B 2WDZA 1R15A 3I83A 1WXDA 1QBJA 2WMDA 1WP4A 2QYSA 2D4AA 3HZZA 2Q2EA 4WLFA 4BKOA 3PTZA 4XRGA 1O3TA 5HOOA 4KYWA 3KP5A 3EHEA 2PZMA 4YT4A 3RTRA 2PWZA 1UXHA
chains in the Genus database with same CATH superfamily
3UHAA 3CRMA 2OV8A 2PRYA 1NXPA 3V7UA 3UC5A 1A2OA 5KTSA 4B17A 4H1WA 3ROMA 2R6AA 1N9GA 1PFQA 2Z58A 2ZRNA 3WOVA 1EUZA 2DFIA 4N9HA 3ZDXB 3IEXA 2GD1O 2H1WA 4GKAA 4A1FA 2JLCA 5A9TA 4DV6B 1VJCA 4G5YA 3V7WA 2KIFA 1JJ7A 3ZCXA 1XK6A 2OUMA 4G9YA 2NZWA 5SZIA 3B85A 4YAUA 3TZBA 4JQZA 4LDQA 3TQCA 3DHWC 2C94A 3CRQA 4N5MA 3P26A 5LC1A 3SYLA 1KQFA 4HO1X 5KQRA 2VDPB 1GL7A 3DE5X 4KWHA 5F51A 5LL6P 4X1IA 5M5WJ 4LQCA 4CQMD 4BNNA 1WKMA 1W36B 4YUYA 1F38A 3LA2A 3KZVA 2VB6A 3DB1A 3KP2A 1RQGA 5DP2A 5ELLA 1SKUA 1H8HD 2TMYA 3HP7A 1E2DA 3FNGA 4YT5A 3S44A 1FNCA 2Q8KA 3FFTA 4M49A 1P4SA 1GKLA 1TVMA 2CMHA 4ODIA 2OUKA 2JQ7A 3TDNA 4EHFA 5LQSA 1URPA 4KIBA 1V16A 1DKOA 4MNTA 4AO6A 3ZE0B 2XAHA 2WSSA 4BB0A 4Z8YA 4OMFG 2XBMA 4M0DA 3VPBA 2J07A 5DCUA 4DNFA 2Y31A 4UVDA 4KIWA 1MORA 3FPFA 3E3MA 1TADA 2PWAA 3L1HA 4NK4A 4WXMA 4YRAA 1JVNA 3TLCA 4EPXA 5B6IA 5DO9A 3L7WA 4ZIRA 2PUCA 1U6IA 2NPIA 2BW3B 3HSRA 5TMDA 3QENA 1XN4A 1X8XA 4DMMA 1L4BA 3L07A 2JAQA 1MJHA 3DV0B 1TD1A 1LVKA 1YJCA 3DPLC 1SMKA 1XXHE 3UHOA 1C3OB 1L4UA 1UXGA 4FDAA 4YC7A 4UAGA 3AJAA 2EFWA 1UMDA 4PG8A 4X90A 2V5UA 1O4VA 3BGSA 2BY4A 1WVMA 4FWIB 3LXUX 1R4NA 2RG7A 1JYFA 4KI7A 2O6HA 4MYDA 3LSRA 1CLEA 1XLVA 2IEGA 3UAXA 1IMOA 4KUMA 2NAZA 3SZRA 4WH0A 2H2FA 2XJ4A 4CTKA 1T5BA 3GP8A 3RYIA 4MAAA 1XK7A 1D1PA 3WRYA 3AZOA 2R2GA 5TT1A 2Q1ZB 4YMHA 2V3WA 3D59A 5L3DA 4RDHA 1ZIXA 2XGCA 1YS1X 4ZTZB 3VSCA 3G8DA 1KONA 2ATIA 1D6JA 2BFCB 3CX7A 4MGHA 3EF3A 5KNBA 3C14C 1EF4A 3DWLE 5CM2Z 4RCYA 1PFWA 3RS4A 3OYEA 4P3PA 2DQSA 2QEQA 3VDXA 2C9BA 1KAEA 2DUNA 3HXKA 5HBRA 5EVJA 1N0WA 4G6QA 3RUHA 3D2AA 1M7BA 4GWGA 2WOJA 1MKYA 3GLKA 1QYXA 4R8MA 4HMOA 3OOJA 4JXXA 4PPFA 3BA6A 1MEEA 1EZ1A 3BZKA 3F7MA 5KTRA 3FZVA 2ZJBA 5D5XB 3C8DA 1M8FA 4PAQA 1CZUA 4X24A 5H5JA 3QU5A 1R27A 3RFFA 5B5SA 1I39A 4GL2A 2HX1A 3CCCA 2BUCA 4QBKA 1NYQA 2XUGA 5FWDA 2VDJA 1KO4A 4FFOA 2YC2C 3CSDA 1M0TA 4PYQA 4NCHA 3GUCA 3WGMA 1NXVA 3L1UA 3PWZA 4TS9A 1ODIA 3DAPA 5IMSA 3QH4A 4E1VA 3IQGX 1DJNA 2QEXI 1JDSA 2M1BA 4CMBA 2V1DA 2IHVA 1LTHR 1JLRA 2N1BA 4FYXA 5J2TA 1PVOA 4V0RA 2VEOA 3FR7A 4A3SA 3LQ2A 3ITKA 1ZYUA 2C2HA 2J9GA 3MUOA 5ALPA 2LG4A 3FHOA 4X1KA 4AMUA 3H7AA 4H2DA 4OMZA 4LZZA 3MGCA 4HFNA 2K4MA 3F78A 3A0HC 4QU5A 4BNGA 2MC3A 4HFRA 4RPHA 5KNBD 1T91A 2J7KA 3HSSA 3KOUA 5HRUA 3GT7A 1DAPA 3KJFA 2BFWA 2JFPA 5C2JB 2BKXA 1UZNA 1FMFA 2PWYA 2BGLA 1PUJA 5AM0A 1PYDA 3T1QA 3SEAA 2QUHA 2X0JA 3SBOA 1OX5A 2OLKA 4I1UA 5ENZA 4ZMRA 3QXXA 1M5RA 1HKSA 2OILA 3HU2A 2DT7B 1UK7A 3SZ3A 1ZITA 2COBA 1TC2A 2WF6A 4HH4A 3UJ6A 3JALA 2R6HA 3NAZA 4ZVVA 1RLJA 4JELA 3F98A 1MH4A 1V9SA 4MUMA 5HCNA 3LE8A 1OYVA 2R8XA 4QXQA 4A3DJ 4Q02A 3HZJA 2F43B 5DM1A 4F4FA 3DTVB 1Z5WA 4RTMA 4G0UA 4RZXA 3V7YA 4D8WA 1MB9A 1JEEA 4TLAA 5AHWA 3CEJA 1AKWA 2ZR7A 1OGYA 3O4JA 4IOKA 5DXJA 3HM5A 4YV7A 1FBTA 1W5EA 3M7IA 2AFHA 4CI9A 3U37A 3R4KA 4ZKEA 3WE2A 4WVFA 4FOLA 1HEYA 5UKDA 1HNXB 2IHUA 4BKPA 4B6JA 2C3PA 4JLOA 2Q28A 3KJIA 3BHNA 3WYEA 3HA5A 3CLTC 2ELKA 9LDTA 3K8ZA 3KSAC 1EP9A 5ERGB 2JBAB 2BI7A 1ORKA 3RUIA 1KY4A 3CO5A 4GOND 1TD9A 3OSFA 2RD2A 3TVDA 1M2EA 4A27A 4BATA 3JRWA 4LK2A 3UB4A 1JEDA 3BC8A 1WOYA 1L4GA 1J2UA 2XUFA 1U1GA 2WQ7A 4O4JF 5FBZA 3L7LA 5M34A 5K51A 1NVEA 4H15A 2P5SA 3WL6A 1IVSA 2QX4A 3L02A 2O4CA 2Z8XA 4C0JA 1QG6A 3RVPA 5B7GA 4OXQA 1DWPA 3RZOJ 4EUSA 3BJIC 5GONA 4Q4CA 2RHMA 1L7NA 4O63O 2V65A 5FUWA 4R1QA 5GTDA 3T4EA 2HK8A 4FHZA 2AXQA 4JD5A 3FTCA 2MSNA 3FN4A 3TNYA 4HH1A 2GKSA 1RJFA 1U0GA 1JXSA 4CLEA 2O7RA 3KYDA 2JGMA 3DMGA 5A3RA 1AKHB 4II3A 3LGSA 4DB2A 1PEYA 3BMCA 4UHEA 1Z6XA 3RSOA 3KQLA 2X3UA 3Q15C 5L51A 3N53A 1JXQA 3VSEA 1HT2E 4N0PA 4GYGA 3IAS1 1U5AA 1E5LA 4LYHA 1AQJA 4ZDOA 2XZDA 3PXDA 4M72A 5H02A 2CUNA 3QSYA 4EG7A 1A36A 4F2WA 3NYRA 4JGGA 1U31A 1NXSA 2IWHA 4KTVE 5GV7A 4CZCA 3LW7A 4RBOA 3BG5A 5E1BA 2QA4I 3SWWA 1HXDA 2CDCA 1BOOA 1QHHB 1JEYB 3HL0A 3NWSA 3WX0A 1IXZA 1ODSA 4B45A 1K2VN 1VZ0A 4HDMB 4MRMB 2ZR9A 4AT1A 4P2BA 2MABA 1I9GA 2NYRA 3OIUA 3QJYA 4MARA 2R6FA 4IINA 4EG8A 4NV1A 5LQUA 2XCTB 1YUNA 2YL2A 4TRJA 1E3LA 1PW5A 1UC4B 2QQFA 4E5DA 1DBQA 4R40A 2N3ZA 2G9QA 3RREA 1QR2A 1FK8A 4C7OA 4CODB 1KDOA 2P40A 4OK3A 5ITZB 5BVGB 3VYTB 1OAOA 4IUDS 1SCBA 5FKOA 3PF8A 2G9UA 2B4TO 4OQLA 1PJSA 4EGSA 3LF1A 4Q9NA 4QVKA 4DQ0A 5BSTA 4YMUA 3OZVA 2OFWA 2IH2A 1QAOA 2Y3IA 3CRW1 3ZZMA 3W6VA 5G1PA 2ZBQA 4LBWA 1YI8A 3QLEA 2CXOA 2OAGA 3HCBA 4E4HA 1ADFA 4P4UA 4GI2A 3WO1A 2VJLA 3M7GA 1P2TA 2EHDA 3I04A 2WPDA 2Z2IA 5TB5A 3IAUA 4RK7A 2HRBA 3OC0A 3ZU4A 1J8YF 1GU0A 1G5QA 4FJ0A 2VKQA 4QUKA 1HYQA 2Z4SA 1PD1A 4MRSA 5IBPA 2O3SA 2ZBPA 4ZZIA 1H2WA 4BNVA 3D43A 3DV9A 1MJAA 2RH8A 1HT3A 3DAHA 1FXSA 5B36A 4EHHA 1RTKA 3LF2A 2BDTA 3RU9A 5FBQB 2ZBEA 5U4XA 1FFAA 1GZSA 3TSCA 2NUAA 2VQ3A 1NKVA 4TMFA 4QL3A 1WUTA 1J9EA 2K4BA 3IYLW 4FUQA 3FHTA 3H5NA 2Z83A 1XZHA 4WOBA 1MG5A 4K9RA 4LVOA 1K7FB 5LMUB 5CLGA 2VAPA 3BE6A 5EQFA 4PFJA 2FJ0A 5FUYA 2XGOA 4IHQA 2Z57A 2VTVA 3W3AH 3OCXA 2WWWA 2F9LA 2RCNA 2NOJB 2YMQA 3ZWCA 3CNNA 2OOSA 1KMHA 2RI1A 1S8OA 1MD9A 3HKDA 1BS1A 1DWOA 5HNFA 1G6NA 2K40A 3KJEA 1WQ1R 1ZREA 2X5KO 1VMEA 1D8KA 3HCEA 3N2GB 3TXAA 5K1YA 1EESA 2YHBA 1NJ2A 3EIXA 4CTOA 4BMDA 1R9NA 4Q6WA 3GYHX 3JRXA 3KTAB 1KU6A 3AHFA 3HY3A 3B7GA 1DAOA 4KL8S 1ULTA 5JAIA 3HN6A 3MJHA 1OI7A 4IILA 4MZXA 1UXOA 3NYQA 2Q1XA 2XV1A 3EVBA 4HNSA 2AQKA 2B4RO 5C1BA 3LQYA 4IIDA 3H0CA 4BVKA 5FA8A 1BZYA 3VVBA 3M1IA 2WR8A 4EWLA 4MROA 4ENRA 1HW5A 3NVMB 2WPDD 2GSWA 3A3YA 3A04A 1FBQA 3VM6A 2XWJI 4LDJA 3EQZA 2CSUA 3GDGA 3V1YA 4CL8A 1GUYA 5MDHA 1JDBC 1L7BA 4KQHA 2WMNB 4YAOA 3LA7A 3QFSA 3UGTA 4HDQB 3T9CA 5CVDA 4ZQIA 4GYYA 4QEZA 2OCIA 4RCVA 5IXJA 1S7CA 4AXBA 2QRGA 2R60A 3LCMA 4DRXA 4FILA 3U17A 1APLC 5FO5A 1PUXA 5B6PA 3WK7A 5JC8A 1T6ZA 5FQNA 1T26A 4RPLA 4TMYA 5DLQC 1BSVA 3U3RA 5FUXA 4NH4A 4LLGF 3P2OA 1LVHA 5LMNB 2X8WA 4TS4A 3BD8A 3IDSA 4FLMA 4EMBA 1VMDA 3PLNA 3FAZA 4TPKA 4MWBA 1LLUA 4B2PA 2XVYA 1NQWA 3QELA 2XOKA 2K2WA 1XV5A 3C1OA 4TMTA 4QGFA 3WTXC 1FMJA 4J2HA 4ZARA 1I7LA 3UKOA 3UQYS 1Z3YA 4P4TA 5ANRB 1RYMA 4BMPB 3LY5A 2HD4A 2VKHA 4DYCA 2GA9A 1WV0A 2YWDA 2H52A 4A26A 1MMDA 4A3GJ 3E18A 3LSTA 4KXUA 3LY9A 1L1QA 1XTAA 5COBA 5CFOA 1VKJA 5J8CA 4E5UA 2ZKZA 2P9QA 3P52A 2K7FA 1NHWA 1CE8A 2NO9A 3W2EA 1A35A 3F4KA 4LNHA 2AMVA 1UMKA 3NDBB 4GAEA 1KJIA 3OG9A 3WLFA 4ZEVA 3JAMZ 3TZQA 3C3XA 3U3MA 3WU0A 3GLTA 3DEAA 1HDRA 2NOGA 4KWCA 4FEEA 4JI8B 5DBIA 2LR0A 2FP3A 1KJ8A 4E7ZA 3DTNA 1S4QA 3QPCA 2VQLA 3F8TA 3N07A 4YRFA 3UJNA 3ZE6A 4I3HA 1A9PA 1KQ8A 2FN7A 5C5IA 2Y4NA 3D6JA 1KOLA 2R6CA 5L40A 1GGVA 3KIPA 1PVDA 1K79A 1TAHA 1MDFA 4EF5A 1QDEA 1KS9A 5ALUA 1DTEA 3VKUA 1E0JA 2H65A 1TTQB 2EV6A 3PNBA 4YFKF 1ZDMA 3E9EA 3KEYA 1IZ1A 1EDEA 3GTOJ 4EW6A 4RHCA 5KWEA 2CNOA 3JASA 3E2IA 3A11A 3HYRA 5LYJF 4ALMA 3K3PA 3M4JA 3T15A 5LZ4A 2XUQA 2XMCA 4EGQA 2JLYA 2XOKD 4OL0A 4C08A 2AN1A 4G94A 2CDNA 3DH0A 2PGIA 4K3VA 4OPMA 1TM2A 2OHIA 3DFIA 3K9TA 4JVNA 4IHYA 2B3TA 2B21A 4ZCPA 1ZHFA 3AK4A 3V8VA 4UHHA 3G6EI 4V3BA 1B6TA 2EB7A 1I5OA 3PTLA 2EJUA 4MV8A 1VSBA 4Q3LA 3ASOH 1VQ6I 2V96A 4BKMA 3F3SA 2KQRA 4DAEA 2OZLA 1J8QA 1YS7A 4PRKA 2B4AA 3DDCA 1T36B 1AXEA 3PHCA 3TMAA 4PC7A 1P3JA 4RLQA 3F8BA 2EZHA 1DJQA 4U2FA 2JH3A 2OPTA 2DI3A 4PCUA 1Y80A 1I3MA 5GAHJ 4UU8A 2OAEA 4TN5A 2PJZA 2CFCA 4TTTS 4IPTA 2HVSA 1PGQA 1TLLA 2AUTA 1JIVA 1WU8A 1NBOA 4F93B 1YRLA 2VC1A 2V6MA 5LGNA 2HRDA 1NUUA 1YH3A 3GMTA 3FWKA 1E4EB 1JDPA 3G8BA 6ADHA 2HIGA 1NTCA 3DMPA 1QQTA 3KBBA 3G85A 1QV7A 3KV1A 1U5TB 3H11A 3FHNA 2ZSEA 1P60A 2VPLA 2QT9A 5BMVF 3AR8A 2WIGA 4CG2A 3E35A 3QU3A 1RWNA 1XDSA 1M8GA 1W34A 4XN3A 3AETA 1YW7A 3UG7A 3ZH2A 4DQKA 5HQTA 4BL5A 4I1OA 3RIMA 5IZCA 1G21A 3ZLJA 2I33A 5TGTA 3QX9A 2DT6A 1PR9A 2YRFA 4BB6A 3PQCA 1K08A 4S1WA 2PZ8A 3H2SA 3PFBA 3C48A 3LZDA 2P2LA 1HETA 2AXEA 2VPTA 1H2YA 1EGAA 5PNTA 3T54A 1OISA 3IC5A 1SK8A 4EUKA 2IUYA 1MNEA 3VKGA 4QATA 3W0LB 5J58A 1A5AB 5GZ1A 4IRIA 3ZU3A 5DKFA 4HAYA 4F7ZA 1FDSA 2E9SA 3AERB 3FETA 1Z4PX 3RSLA 2H3EA 2DK8A 4MTLA 4LJRA 3SS8A 5K0ZA 4P58A 5JADA 1A50B 1PSDA 5ALSA 2A5WA 2COEA 1HE4A 3TL2A 3EEBA 2W24A 4NQWA 4PQYA 4B6FA 4LB6B 1JDJA 3WODF 1T8UA 2WF9A 3Q5DA 5IVDA 4X64B 1DQZA 2FSFA 3ZMTA 4LNUB 1HOTA 1ZSNA 1G6HA 1YZHA 2BFAA 4Z7JA 1GPKA 5KKAA 5B1AH 3G8AA 1COWD 3V8KA 4DSTA 3EGVA 4KR3A 2JAUA 1DRUA 1ESMA 2BBSA 4J3JA 1Y3HA 4A6EA 2VJIA 4KC0A 2R7RA 3D6NB 5BS6A 2JZNA 3HTXA 4HUTA 3MWEB 5EY5B 1D4FA 2CXXA 2H5LA 1DUIA 5DU2A 1OQYA 1W6RA 2NX2A 2PUJA 4LC1A 1MNQA 2C7QA 4C87A 1Q95A 2C7RA 2W83A 3ISJA 2OMEA 1DEHA 1JR3D 5IFKA 2WDZA 5KAFC 1G66A 1XUOA 3H18A 4GYWA 4G1EB 2Q2EA 5FL7A 3K70D 5ES4B 1OWLA 4IVPA 1EFDN 3OHSX 4YASA 2DHEA 5DNWA 4YGXB 2QLZA 5I8ZA 5ILGA 2REOA 2H4WA 3O7MA 4EM6A 8GPBA 2PMDA 5TNXA 1KKUA 5AKZA 2WYIA 4BQPA 4OU5A 3AM1A 4MP3A 2V1XA 2QKMB 3CQ9A 1P62B 4C4SA 4RVCA 4DADA 1N2JA 4DCGA 3CCMI 1ADJA 2GZWA 2QRMA 3HM9A 5SZKB 3EOZA 4OHMA 3BJAA 4OJMX 4LOCA 1W4BA 3I53A 5TIIA 3U7RA 5KYXB 3WV5A 3D0OA 3EA0A 2XTJA 4OQQA 4LX0A 3WR5A 3B02A 3B48A 3V4PB 3CNEA 1JH8A 5FXMA 1N3BA 1ONNA 4M2LA 2D7DA 5LIRA 3NHPA 3PQ3A 2QIOA 1QH9A 1JAHA 3JRCA 1E1QA 3ET5A 1F3OA 3FMFA 3P9QA 3GUUA 1K75A 2Q5QA 2YV2A 1PR3A 3NVAA 2ZSKA 4Y6PA 3GEGA 5F1JA 3GCZA 1XFAA 2E49A 1XFDA 3FM5A 4C0AC 2H4YA 1HY3A 4MQEB 1F6DA 3F2IA 2VDUE 4S04A 1B16A 2V7QA 3Q0EA 1AK9A 4RMGA 3UJBA 2QQ0A 2FN8A 3K35A 1WX1A 3QE9Y 1UJ8A 1HG0A 1WFXA 2P4QA 1BA3A 2NRAC 2PMCA 3ANXA 2FP4A 1ZA2A 1BXRB 3C2GA 2BGCA 4A2QA 4X44A 2IHYA 3UBMA 3WLHA 4E15A 2XB9A 4QYIB 2DMTA 4A0HA 4MX8A 2O54A 1MR3F 4KOEC 2K86A 2VE9A 1JBQA 3GVCA 4UXJA 2JCBA 5K8TA 5EP2A 3UICA 3ZJ4A 4KQEA 2NXEA 3OCWA 2XDYA 2BY3A 1STOA 3GFIA 3SKYA 4UM9D 1HK7A 3WLMA 3U3KA 4C3VA 4BDSA 3L49A 1SAYA 2FZWA 3DNMA 3VPCA 4YQYA 1E5XA 3DBLA 2X4LA 2JD0A 2O52A 4O4JB 1ZUNB 3Q7RA 1UKYA 5K2OA 2YJ6A 4MKGA 5KYWB 3INTA 3MMYB 5BSVA 3PIRA 1ILWA 2ZWMA 3WO0A 1JKFA 3EZ6A 1SKBA 3HOSA 1VGVA 5M3MJ 3R3VA 1E0EA 4GMFA 1T3GA 4R9RA 3QW2A 2H09A 4TTVA 5AIQA 2AG8A 1MBEA 4HK4A 3C4JA 1E1QD 3QP5A 4P34A 5HE9A 4EPRA 3WMEA 1OBFO 3U1KA 1NIPA 4UJ3A 3A2LA 4YCSA 4WN9A 2R7DA 1G8YA 3MBOA 5IC6A 3O3KA 4ZDPA 4Z4EA 1Z4MA 2P2GA 1JDBB 3DFGA 1RWQA 5TGZA 4RH0A 5AKEA 3KM0A 4WLEA 3RIYA 1W36C 2BFFA 4X8LA 4XPIA 5JLJA 4JJZA 3DP7A 1TE2A 1D6NA 4G5GA 1OIXA 1CRWG 4TWIA 5D3KA 4JU9A 3ZDRA 3JD0A 1F8XA 3H2GA 4DZTA 4KVAA 3IQEA 1X38A 2VP0A 5CLHA 3GQBB 4DV0B 2IU4A 2CQNA 3OJCA 3A37A 3DW1X 2MLKA 3VJMA 3CNOA 3HJTA 1XZEA 4ZGBA 1DG1G 4ZEMA 3PQ8A 3FG9A 4ZK2A 2QUJA 4IDBA 1FMTA 2X41A 3COZA 4XWOA 1M1YE 1N6RA 5HK9A 4AIJA 2PM8A 3JQ8A 4CETA 3OKAA 2IT0A 4FGUA 3PCTA 4TXLA 4KPEC 5BW5A 4OA8A 1HNNA 3N0RA 4D56A 2XDVA 2A5DA 1S2DA 1O08A 3HACA 3UAVA 4DXDA 1F2UA 1FS5A 2WU1A 3SLRA 1E9BA 3BPSA 4MFEA 1B23P 4BKQA 1I3KA 4TKLA 2V74B 5C37A