3WGIA

Crystal structure of rsp in complex with beta-nad+ and operator dna
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
217
structure length
217
Chain Sequence
KTIVSMAVIRRLPRYHRYLEELLKNDVKRISSRELSEKMGVTASQIRQDLNNFGGFGQQGYGYNVEELYNNLTKILGLDKTYNTIIIGAGNLGQAIANYTSFEKSGFNLKGIFDINPRLFGLKIRDVEVMDVETVEDFIARNKIDIGILCIPKDNAQYTADRLVRAGIKAIWNFLPIDLKVPDDVILENVHLSDSLFTVSYRLNEEELFKKLKGETA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Redox-sensing transcriptional repressor rex
publication title Distinct structural features of Rex-family repressors to sense redox levels in anaerobes and aerobes
doi rcsb
source organism Thermoanaerobacter ethanolicus
molecule tags Transcription/dna
total genus 69
structure length 217
sequence length 217
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02629 CoA_binding CoA binding domain
A PF06971 Put_DNA-bind_N Putative DNA-binding protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wgiA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wgiA02
4OIOF 3L77A 2D5CA 1KQ8A 3F47A 1FMCA 5ER6A 1LJ9A 4YWJA 3AJRA 3BHMA 5ES3A 5DF1A 4QQRA 3GC6A 4R54A 5MDHA 3NT5A 3RC1A 1DRVA 1WXDA 2DM6A 3JQDA 4YT2A 3AAFA 4GCVA 4IY1A 2XGXA 3STHA 4RPHA 3E5QA 1CETA 5J23A 2GZ1A 4LK3A 1Z9CA 1G1AA 4Y6PA 3PJEA 1K6IA 3KE2A 1U8RA 1CF7A 1DIHA 1QZYA 1PGOA 5AONA 1E7RA 2E4AA 5FFXA 5JAZA 5CP8A 4PLZA 2HQNA 1ZREA 4NBUA 2IZ1A 1SNYA 3A1NA 1NPTO 4FFLA 4L0QA 3LWFA 3MJTA 3KUXA 4RB1A 1EE9A 1CDOA 2VBXA 8ADHA 1TQMA 4QSMA 4BB5A 5LC1A 1MFZA 4CQMB 1VJTA 4GMFA 4CMHA 2OQRA 5DCMB 1E3WB 1HDYA 3ZWPA 5HLHA 1WWKA 4ND5A 2EFOA 3V8JA 4FN4A 3P2YA 2OU2A 1ZK4A 4J7UA 3RKYA 4ND1A 4R1NA 3F6YA 4BNWA 3ZWYA 1YB5A 4HADA 1YQGA 4MNUA 1ZH8A 2VYNA 2PLAA 3EUWA 1JAYA 3MOGA 4UREA 5DT9A 4EW6A 4RPJA 1H9TA 4E13A 2Q45A 2DTRA 1I32A 3JYQA 3BOQA 1D4FA 4INAA 4XIYA 4AJOA 2HR3A 4OO3A 3C24A 1ZW1A 2NQTA 1HDXA 3M9AA 4J90A 4O0LA 1UZMA 2MH9A 2ZB7A 5IT9K 1VPDA 2Y0DA 2ZQYA 3F46A 2QWWA 1YS6A 3K6JA 1P1FA 3OEWA 1VLLA 1E7MA 1D8JA 4KOAA 3UXYA 4YXFA 5KVQA 5A05A 2NSDA 3W6UA 3GFJA 2WE7A 1EUZA 3DBLB 4RS8A 3PIDA 2H6CA 1B15A 1GZ4A 1J0XO 2GSDA 4M74A 3F22A 4AJ4A 1KIFA 4TQGA 3E6CC 4RPKA 3JTMA 4YDRA 2FY8A 3PLNA 5AXBA 5KIAA 2QZ8A 3CLOA 4U6SA 2FZEA 3H3JA 2D5AA 3HTUA 2DBRA 2Z33A 5BNIA 5CVRA 3H3UA 5DOVA 2UUOA 1SEVA 2HK7A 3H65A 3U0BA 2V7PA 5CG2A 4ZH4F 2ZTVA 4L4RA 4ALNA 5JI6A 2OL4A 2XPCA 2V6CA 1NVTA 2RBEA 4PDKA 1PJ4A 3F21A 5AOVA 5ENDA 3SBOA 3BMOA 3ON5A 2PGLA 3Q11A 5LRRA 5CPFA 4PLPA 3ANMA 3HB5X 4TRRA 4MVJM 2PMHA 2CDAA 4GPD1 3WWZA 1GPJA 2B4QA 1NP3A 3NQOA 4R68A 4MP6A 3O38A 4E21A 1P9LA 2IA2A 5CEJA 2R7DA 4LMYA 4XYMA 1CYDA 1YDEA 2OXIA 3GZNB 1EQ2A 3H9UA 4ILKA 1BSVA 4EQQA 1MUUA 4LCJA 5K5RA 1HE4A 3KSZO 4CODB 2MD5A 1U8XX 3RDIA 1E92A 2HS5A 3WIDA 4BNYA 2IT0A 2GAUA 4IMRA 4BNCA 1P1JA 4F46A 3ADOA 4CMCA 2CYYA 1BM9A 4KDFA 3ZV3A 3W8EA 3U2RA 4YYZA 4WK6A 5JAMA 2D1HA 3C1AA 4E70A 4UUPA 1HLDA 2A5YB 2KIUA 3P9IA 4M9SA 3CO7C 2RVCA 2JPBA 2EV5A 1RM0A 2C07A 1I1GA 4U6QA 3FXUA 1BC8C 3ETGA 2A07F 3PYXA 4G9YA 4IZHA 2VHXA 3U4CA 4CMBA 5ADHA 4PFJA 4U0JA 4E30A 5DCWA 5JYEA 4KWIA 4B3IA 2HOEA 1I10A 1P1IA 2H27A 3DF8A 3WGIA 1WDMA 3DMYA 1U3UA 3E9QA 3UAGA 4DMMA 2V1DA 1OOEA 1HLPA 1EFKA 2GN9A 3OQ6A 3QRWA 5DDGA 4JGBA 3K0LA 2BYVE 3WGOA 2Q1SA 2B5WA 1D5VA 1ZARA 1GDHA 1JWAB 2YUTA 1U3EM 3DWFA 4IDBA 1KOLA 2GWRA 1R0KA 3ZWAA 4MVJE 1KC1A 4BKUA 2HK8A 2X0LA 2P9EA 5EESA 1HSJA 3W6KB 2WD7A 3R6DA 3NDRA 5L4LA 2FSVA 3NX4A 4RGRA 3VPGA 4J6FA 1R66A 5I7FA 1AHIA 1Y6JA 1J59A 1K3TA 3LFKA 2BKAA 3ZDFA 4BQPA 2ADUA 1VI2A 4CMAA 3FCOA 4RVGA 3CPSA 4XLNF 1T2CA 2HTSA 4WOJA 4AJJA 5FYDA 4YG2F 1E5QA 4J7CA 3F4BA 2Y48A 4IXWA 4YJFB 3AI2A 3W6ZA 5BQFA 3FM5A 3GFIA 2GZ3A 4CMGA 3CSDA 4RDIA 3FXRA 2Q2WA 5KOIA 3WOHA 1X1TA 2BBYA 2RQPA 1IPEA 4DRYA 1XN7A 1E6UA 4RJTA 2W85A 5KTKA 3DOJA 5MGBA 2XXBA 3FRJA 2C59A 1IN5A 3HYIA 2QRLA 2ZYGA 4LVUA 4IDCA 1RIOH 1M6HA 1NYTA 2STWA 1SD6A 4LJZF 4NDNE 5A3JA 2GCGA 2HKOA 4QUKA 2L4AA 5LGTA 1K6XA 4CM4B 4CR7A 5JVTA 4Z0TA 3JQAD 4MJLA 5A2QK 4I0AA 4D42A 1GPDG 4KWHA 5L3EA 2WEKA 4S1VA 1ZG5A 5IG2A 3LT1A 3TKYA 5H81A 1BJAA 3C7AA 4MVJP 4OGWA 3V7CA 1GV1A 3INGA 4ZICA 4AICA 1O3SA 5HLIA 4NQZA 3IOYA 5JAQA 3VH3A 3L07A 2YHIB 4OXYA 4DQVA 2VN8A 4XKJA 4XZ3A 1ADBA 3C8MA 3OF2A 3KM0A 4LK1F 1TQPA 2EV6A 3SHFA 3D3WA 5FEUA 3J81K 4OXKA 2FMLA 3R60A 3H9QA 3HIFA 3VAZA 3PFIA 2ZMEB 5DP1A 2Q1TA 4TRNA 3DXJF 3RYRA 1DHRA 2QZZA 3AM4A 4A73A 1E3IA 3JQBC 4LVCA 3VVBA 1MX3A 1NHGA 2FPPA 2QQ5A 2QQAA 3HQ4O 1CJCA 3MEQA 4KIBA 2PZJA 4PIVA 4AVYA 1MV8A 4CQMA 3DZIA 4O5VA 2FPGA 4XSZF 5DCMA 1E3WA 4J2HA 1KU2A 1OYIA 4Q48A 5LDGA 2EWNA 1SOVA 3JQBA 3WICA 5A1TA 3NAQA 1JLLA 3GVAA 2BLLA 1RYEA 1QV7A 2CF5A 2VOJA 4M86A 3B1JA 1ZUD1 4Q3DA 1YL7A 3K92A 4R3WA 1OMOA 4NU6A 5DZSA 3S2IA 1Q2XA 3HB4X 3CZRA 4IJVA 2GASA 4HV4A 4FJ2A 4ALKA 3K1PA 3J7AO 3Q9NA 4GGOA 1GD1O 4BKPA 3FHLA 4H16A 2M30A 3MJVA 5ER9A 3RSHA 2GD1O 1LU9A 3U62A 4I5GA 5CYVA 2UXNA 2KJBA 1GQYA 3TOBA 3DXFA 1ZVMA 4WXDA 1E1LA 2YDXA 1H9AA 4H7PA 1MFPA 3VPHA 2X1HA 2PD3A 3OETA 5IDWA 1SO8A 3ZU4A 1J6UA 3I6IA 1LQ1A 3FF4A 5GZ1A 4HXYA 4DGSA 3DBLA 2W98A 2AEMA 2J5PA 4EJWA 4WF2A 1N1EA 5BR7A 1GUYA 3F8FA 4FS3A 2FBIA 1V3TA 2O7SA 1I24A 3OFSA 3WYBA 1NVGA 3HUDA 1N2SA 1HQCA 1I3KA 3JQEA 1HDZA 4EUEA 1KS9A 2I5PO 4K9DA 3RFXA 3ELKA 3DBRA 2QENA 1NFQA 4RGSA 1VKOA 2O3RA 4WOKA 4XGNA 1LSJA 4I98B 2HCTA 1G6KA 1T2EA 4I08A 1VC2A 3RFTA 2CF6A 3OV8A 4WLNA 1W73A 3NGLA 3KP4A 3E3VA 4UNOA 1DFIA 3U9LA 2IRWA 3SEFA 1ENYA 2J5RA 3B70A 3L9WA 4HYEA 3I5UA 1T2FA 4E5MA 2ZB4A 3F9IA 3SC4A 3X2EA 2KIMA 5CDTA 2B0JA 4NHJA 5B1YA 3WTXC 2P6SA 3GZNA 1ULSA 3UKOA 1UUFA 1XU7A 3HSFA 5KK1A 3TFOA 4U7BA 1K5HA 2G5CA 3DQPA 1S6LA 1XDUA 2BV6A 2BE5F 3GFLA 1IULA 2XF8A 3CZMA 3FR7A 2B4RO 2YPRA 1UDCA 4DLBA 5L4SA 3ZMUA 3LDHA 3PWZA 1H2HA 2VYVD 4B79A 4WCFB 1R1UA 4NZ9A 1E3SA 1EV7A 1W8DA 2RKHA 3PK0A 1ARZA 1C3VA 5ILSA 1LSOA 3HHGA 1QYXA 3C1TA 5FLXK 4NK4A 3QHAA 4R9RA 4PLVA 2VZ0A 2YJZA 1YB4A 2PFGA 3HFGA 3NUGA 4OQZA 5CJ9A 4LLLA 4BNTA 1I27A 2C7GA 3BJOA 1ZIDA 3BTVA 4CR8A 1HKSA 1BI2A 3COAC 2L02A 3DB2A 1U3VA 3NGXA 1AWCA 4MTEA 5EERA 1W0CA 3BPXA 5L3DA 2Y1EA 5L95A 2R6JA 4BKQA 1WLYA 2VTEA 2AS5F 2V79A 3WJ7A 1HW5A 3RUAA 2Y0MA 4OIQF 1OI7A 1EDOA 4BHPA 3EGOA 4UVBA 4MVJH 2ZNYA 3ZWBA 1TT7A 2HAEA 1S29A 2Q4EA 2ESNA 2X5KO 3K1NA 3T5XA 4L8VA 4F6LA 1XQ1A 1BW9B 2GF2A 2O8XA 2FWMX 4HUJA 1RM5A 3I71A 1GQ2A 5HS9A 2HZTA 4YTEA 3TDUC 1JKFA 4UAGA 4XYGA 5IT3A 1Z7BA 5AXCA 1EVJA 2C0CA 2M1BA 1KBZA 3AI1A 2NU7A 3S55A 4BNIA 1C1DB 1L3LA 4ENKA 1TA4A 2OORA 4KUEA 1FLIA 4Y6RA 2DK5A 2Y75A 5A04A 4GWKA 2Q99A 4WK8F 5JPIA 2LDUA 1FYKA 1PZGA 3D4OA 1HE3A 3PQEA 2X8LA 3OJFA 5IDYA 4BGVA 1ZHFA 4BQAA 1KQ9A 5E20A 3HHPA 3A4VA 4IXTA 1EH7A 3PYLA 3ZV6A 4E12A 5HDGA 1T24A 4KTTE 1IN7A 8LDHA 5FD5A 3C7JA 3K31A 2IRFG 4Y6SA 3WTSC 3NT2A 4L4SA 4HA8A 3R0JA 4B8WA 3QJ5A 3V1UA 4DC1A 5C7IO 3TO6A 4FFOA 1LDBA 4ZQFA 4LGWA 3NRCA 3WIEA 4XYEA 3JQAA 3KLOA 1TT5B 4S3MA 3TWOA 2Q2EA 1RUNA 3CINA 2AG5A 4EZBA 4KICA 5I9MA 3PQJA 3ZQ7A 1Q0HA 1SFEA 4MKRA 4J4HA 3O26A 1MB4A 4WE3A 3RYPA 3E9NA 2IYOA 2PV7A 1WRJA 1FK8A 1HSOA 1YL6A 3E5MA 4R1TA 4CM4A 2WYVA 4FJ1A 2WYWA 1C1XA 1FZPB 3HNPA 1NNUA 4YRDA 3ZWMA 4G6DA 4HBLA 1XSDA 4BO9A 1EUDA 1LXCA 3KP5A 3JD2A 2NYXA 2ET6A 4XGIA 3CKYA 3K5PA 2PFBA 3CUKA 3OECA 4HQMA 3GEZA 2J8ZA 4GO1A 3GG2A 3QVOA 3VTFA 1O57A 1O3RA 2YHIA 1VTNC 3V2HA 3NKLA 4R1HA 2QRKA 2RH8A 1XGMA 3I4PA 2HLPA 2QZ9A 3GO5A 2P2SA 3HDJA 5TJHA 1MA0A 3B73A 3S2WA 2DC1A 2WM3A 2ZMEA 4I09A 1JN0A 2DKNA 3DEYX 2RV8A 1EBUA 3IDSA 3LA2A 2QM3A 2UXXA 4N9HA 2DUUA 4GX0A 2IODA 4XQ9A 1FP2A 1I30A 1MZBA 2NWQA 5HWSA 3KB6A 4JROA 1YRLA 2HMSA 2GIVA 3H9JA 3I3OA 1YONA 3ONEA 1F9NA 3ZMTA 4BMVA 1G3YA 5H83A 4ESBA 4A03A 3JQGB 2CVOA 4GLOA 2CDCA 2UAGA 4QFCA 1HXHA 4RQUA 1HYGA 1HF3A 4DA9A 1YS7A 1HE5A 3PZBA 3VFZA 1QYWA 4YT8A 2NVWA 4OINF 4N9IA 4UVIA 5TF4A 2NS0A 1KY4A 3PI7A 2W2LD 2F2EA 1LDYA 2EIHA 2NM0A 3JCZA 3M1AA 3KVOA 3PRJA 6PAXA 4WPGA 3WMWA 2GDZA 3HDQA 2MLKA 3WXBA 3E18A 1ZJZA 1Z05A 1ZXBA 4W7IA 3T4EA 5CVJA 1K0UA 4Z0HO 2X4HA 4BHBA 2B36A 3KSDO 2VTDA 4DIFA 3I9NA 2DBVO 1LEBA 4CDGA 2P4QA 4J49A 3ZH2A 4PLWA 3RTRA 3LT2A 4L5IA 1I33A 2EV9A 2EFWA 3AOEC 1A72A 1DIGA 1X3UA 3HFSA 3CIFA 3GOHA 3LC1O 3D3EA 4GL4A 1LI4A 1WMAA 1ZMTA 2GPTA 1PQUA 2MLGA 1O8CA 4BO0A 5ILVA 4K28A 4XRGA 1UHWA 1LRJA 2E37A 1KERA 3AOEA 2HGCA 3RPQA 4ENJA 3H9EO 5EMHA 1PJBA 4ROSA 2DFIA 2LSOA 1MP0A 2GN6A 1ML3A 4BQRA 3VZQA 2D3TA 3BMNA 4BL5A 1AN9A 1UAYA 5T67A 2DQ4A 3FNEA 3RUIA 3LYLA 1UCRA 2P9CA 4Z3DA 4A0SA 3LAJA 4E33A 4BNGA 1LDDA 2XKOA 3CUQC 1T2AA 2NU8A 3H5RA 3KZZA 3BMQB 4YAEA 1TNTA 2E7WA 2EGHA 4ITUA 3OIFA 1F12A 1SOWA 4Y67A 4EUFA 1VJ0A 2VYVA 2M8EA 3D5TA 4LCEA 3CUQA 3WTUC 1DJNA 4WCFC 1LLCA 2GNAA 2TMDA 4WASA 1JE8A 3SLKA 2HRZA 2OFPA 1VL6A 3E6AA 3H6KA 3I1JA 3WFIA 1ONOA 2WWYA 2Q46A 3FX3A 3P9CA 1BGVA 2EP7A 2H9IA 2OO5A 5DDIP 2VYND 2JZYA 1S8NA 2GN4A 4NNJA 4WCFA 3E97A 1I1SA 2V65A 1FSEA 2STTA 3ST7A 3WLEA 1W7PB 3HDHA 4XBFA 4RDHA 4XYLA 2FMYA 5TT1A 2QQBA 4JLWA 3MFKA 3VZPA 3PQKA 3QWFA 1B14A 1JQBA 3IS3A 5G4LA 4GYIA 3OICA 4E32A 4GX1A 1H6DA 1V35A 1XQ6A 1ULYA 3NRVA 5ED4A 3PDUA 3ZN2A 2P5YA 1W7PD 3EHEA 2DO7A 1P31A 3KBOA 4XB2A 1W4MA 4XX0A 5EPOA 4EDFA 3F4LA 1ZCJA 1K79A 1PP7U 2NU9A 4ESOA 4E2YA 1IB6A 4R5MA 2AHRA 1J7KA 1U78A 3HOTA 1U9JA 2OP1A 1DUXC 1M67A 1PGPA 3GGGA 3JD1A 3OQ1A 2X0IA 3U3XA 4Q3CA 4KMFA 1S3JA 4BNFA 2QYTA 4BVAA 4NHEA 2ZCWA 1PEDA 2PY6A 3RKUA 4IIUA 3B20A 2DQLA 1Z6RA 1C0WA 1QBJA 4CLXA 1KU9A 3NDIA 3ZMVA 4IGFA 4IGEA 4DVJA 1C1DA 1VKNA 3HG7A 3GNSA 1EK6A 1LQUA 2H1SA 1E5LA 1IF1A 5LGUA 1PJ3A 3WS7A 1YBMA 4JK1X 2J3HA 2VBYA 1NXQA 1Q0LA 5CG1A 1ZRCA 4I7HA 3IRRA 4A5MA 1BRMA 1JDJA 2JCYA 3KLPX 3ZHXA 1Y5MA 4CV0A 4DIOA 4YIFA 1LDMA 4PCVA 1OYYA 2CZCA 2EA4A 4MP3A 1LEAA 2EERA 2O23A 3GVCA 4FD3A 2BELA 1IW7F 2XV4S 1DIRA 4FOOA 4FW8A 4ONEA 3FMQA 3SJ7A 4PGFA 4KN4X 3G3ZA 5JCXA 3UH1A 3WGZA 3LQQA 4AJ1A 4BNXA 1V9LA 2QW8A 1IRFA 2A92A 3ZWWA 3KXDA 4YRAA 3U9GA 2X9VA 4F7ZA 4G5HA 1GCOA 1T4DA 4GSKA 1UR5A 2J3IA 4Y98A 3SLGA 3PVZA 5C7LO 1NR7A 2IYPA 2PH5A 2OAZA 3EC7A 3ICCA 1BC7C 4U0VA 4YJGB 4WCGA 5ENVA 2C5EA 4J7XA 3JYNA 3WWYA 1XSEA 3F72A 4R16A 3FBTA 3P19A 4P4NA 5BPIA 3PHJA 4CLRA 2ZKZA 2NNYA 4LB5A 3E03A 3GF4A 1LX6A 2HJRA 2VHWA 4H15A 4XA8A 2D8AA 2AEJA 4FBGA 3EMKA 4W4TA 4K1LA 1ENPA 3EZLA 2HO5A 4XEHA 4KMSA 4ON0A 4LLNA 2PKRA 5A3VA 4AJHA 5L7TA 1GVJA 2P5LC 1Q0QA 3UF0A 2I66A 1QQIA 5BSHA 3N97A 5L4NA 2H09A 1R23A 5D5WB 1U8FO 1IL0A 1XMKA 4EJUA 2EB7A 2BMAA 2PK3A 3MWEB 1ADCA 3DZHA 2YSRA 3HHHA 3ANLA 3L4SO 3V2GA 1Y9EA 2BGLA 4IBOA 3QPTA 4G7OF 1X1EA 4C7KA 4U0YA 4P55A 4R5HA 2X5JO 5T64A 2JL1A 1O9BA 2PEXA 2PZMA 1P74A 1EH6A 3INRA 3BMCB 2W2LA 3HRUA 2A94A 4RVDA 1NQTA 1AUPA 5BOXA 1FXSA 1PSDA 4PVCA 1WP4A 4HBGA 5GY7A 3RIRA 3FI9A 1FDSA 1M76A 2VUUA 5HS7A 3GN2A 3JQ6A 4BOYA 1LA2A 4RQTA 4HF0A 3JTGA 1CF2O 2OP0A 2O03A 4FHTA 5COQA 5DBFA 4XSXF 3RUDA 5JHUA 1R0LA 2XRNA 1CWUA 2R7FA 2NTNA 3W1VA 3U5TA 4D0PA 3WTWC 1H6CA 3AY7A 2G0TA 1ON1A 4II2A 4AG3A 5IZ4A 3GZ4A 5L45A 1DC3A 5JO0A 1KVQA 2GRAA 4CICA 2EG9A 2BFMA 5TRDA 2RNJA 2P7CB 4HDVA 4XQGA 2HRBA 3DHNA 1FT9A 3SXYA 3QY9A 3K9QO 1EK5A 1FPQA 4LD5A 1R37A 2FZWA 3JYPA 2D1VA 3ZMDA 3I64A 3ZMZA 1IZ9A 3G1UA 3OJEA 4CM6A 2C5AA 3ABTA 1I3MA 4X54A 1ADFA 7ADHA 4IMPA 2DAPA 4KDPA 4I2OA 1NVMB 1I6XA 3F5QA 2VOPA 3PFFA 4RGXA 3E5RA 4KQXA 3E5UA 3W4JA 1QSGA 2FN7A 2O2SA 1KVRA 3FN4A 3E5XA 1HKTA 4DPMA 1CQJA 5A02A 3IC7A 3IQDB 3AOGA 3OEYA 4XQCA 2OMEA 3U4DA 2K4JA 4Q5SF 1MG0A 2JHGA 1J2XA 2DPDA 3G49A 3WNQA 1Z7EA 1HW1A 2D2WA 3OM9A 5G0UA 1HBXG 5HLGA 5E17F 1AE1A 1OR7A 1YTYA 1CGPA 1YBVA 2PGJA 4PLTA 5A9SA 4CYDA 1BXGA 1I5ZA 3OA2A 4ALLA 2WSBA 3JD4A 3RJ9A 2GZ2A 5ILGA 3H5NA 3NEPX 5ITVA 1ID1A 1R4MA 2OZUA 3G79A 3WTYC 1U4OA 2LF8A 2PGDA 1LDGA 4IHSA 2J5KA 4L9JA 3KTDA 3WTTC 1G3WA 4QX6A 4B3JA 3TGNA 1RI7A 1UB9A 1I36A 2PKQP 5DCUA 5TRTA 3DAGA 4CQMD 4YAKA 4B8ZA 1UP4A 1X7HA 3IWFA 4L18B 4EITA 1OBFO 5JYDA 4RB2C 1ZK2A 2NRAC 1KY5A 1GYPA 2PA3A 4AJLA 5LRSA 4GWGA 2HMUA 3QP6A 2PWZA 1BMDA 1Y8RB 1BI3A 4KT5C 1F06A 1LSUA 1NM5A 1ORRA 2ZYAA 1T1SA 1ONVA 1DFGA 2A6EF 2Q8KA 1U5TB 1W7PA 1YJQA 4S04A 1U5AA 1Z45A 3CEAA 4L9NA 3GG9A 3G3EA 3I9MA 4QT0A 5JNLA 3C1DA 4HP8A 5IF3A 3OOPA 4ESFA 5EINA 3KP7A 1G0NA 4MVJI 3BTSA 2YW9A 5DEQA 3VEPA 3D4NA 3FWZA 4WGGA 3ETDA 3SFZA 2AQIA 2W4QA 1ISJA 2DBZA 4W7HA 3TL3A 5IT9Z 1E1NA 1LNWA 3O6BB 1I8TA 4YRBA 1PQWA 4BGEA 1R00A 1UDAA 3I23A 3K9TA 1TTYA 4M71A 3KYBA 4DPLA 1WZIA 3V8BA 4DUPA 4RGBA 4UVEA 4IDEA 4ETSA 3LLVA 2JPCA 4IDAA 3TPCA 2W25A 1OC4A 4E3ZA 4EVIA 4E2WA 4EYEA 3M8FA 3NJ8A 1RKXA 1SB9A 4WLOA 2RHCA 3AUSA 3H7AA 3I83A 3RCBA 4WXCA 3IMFA 4FIZA 1N9GB 4P9FA 3S2FA 1YOVB 1HL3A 4CMEC 1SEPA 2E49A 3QPHA 3I4CA 3RC7A 4XQEA 2XAGA 4D46A 4Z2YA 3CH6A 4JBAA 3PYMA 4BNLA 4A6EA 5HS8A 5LCXA 1HETA 4W6ZA 2QBYB 2VHYA 4WLVA 1P33A 2PG4A 2X7HA 3H9GA 5U9CA 1Y7TA 4CMEA 2ZJ2A 5JLAA 3UOGA 4L9RA 4BO1A 1EBFA 2AE2A 4HW0A 4KQWA 4J1TA 4CJXA 1EFLA 4U88A 4LG0A 1KEWA 1N8KA 2FRHA 2CGPA 2B69A 3MCVA 1MD0A 4PZCA 5KVCA 2I3AA 3WYCA 3I6QA 3R61A 3O03A 4XDZA 4UVDA 1H6BA 3RI4A 1S7CA 4YJHB 3GLQA 1B3RA 1E7SA 1DEHA 2H63A 2H6EA 4JNKA 5CVVA 1E2XA 1V0JA 3RIHA 3D1LA 1GEGA 3NV9A 2Q2VA 3JQ8B 4FFPA 3RUFA 3AUUA 1TNSA 3P9KA 3KSUA 4D7AA 2CMDA 2HDCA 2B0LA 4DQXA 2DU9A 1QYCA 3MJSA 3WYEA 2OBNA 2QIOA 4E5PA 3LU1A 4RZIA 1MKMA 1JVBA 4BNUA 3LC7O 1R22A 1V8BA 4N5NA 5E18F 4IXAA 5BPDA 2RC4A 4KNYA 2YDYA 3QLJA 3ANNA 3HTSB 1KVTA 3FMRA 3MZYA 1YGYA 1LEHA 1YXMA 3G17A 4FSHA 4AJIA 3GEDA 1FNNA 2NAZA 3QRFF 2EKQA 4ND2A 1N92A 1IN8A 5DYMA 3F6VA 2Y0EA 3L4BC 2UWMA 1F8GA 4GX2A 3AI3A 4PN3A 5JS6A 4L0ZB 4A26A 3GF2A 4I0BA 5GZ6A 1WKMA 3SX2A 4CPDA 4CV2A 1QV6A 2IZZA 3FR8A 2WE8A 4RVHA 3F23A 4AD9A 4FFMA 5DV5A 1SMKA 1SD4A 1A9ZA 4IJUA 4NI5A 2TDXA 1TXGA 3QOPA 1DRWA 3L4BA 1AGNA 1LDNA 4AFNA 1GUFA 1UXJA 1FWZA 2DAOA 2SCUA 4TWRA 5F1KA 3LSYA 3BMCA 3PGJA 2VZ9A 3ZGYA 1HT0A 1RNLA 3V4GA 3Q2IA 2J5OA 1KVSA 2H6BA 5D5XB 2ZB8A 4F3YA 2OUIA 2OZPA 4EGZA 1YO5C 3UHAA 1IN6A 1MG5A 4BMSA 2V9VA 4RVSA 3ML6A 4YT4A 2YR2A 1P1HA 2I76A 2FOKA 4NBTA 2X0NA 1IYZA 1P2FA 2Q3EA 3KYCA 4DBVO 2O3TA 3TZ6A 1YVEI 4YAIA 4GXOA 1H6AA 1V3VA 1WWXA 3C3XA 4Q9NA 2YX7A 4YFXF 1LLQA 3TRIA 1JWBB 1H0MA 1WW8A 2AXQA 3DFGA 3GQVA 3NYWA 4EJMA 2GZWA 4A27A 2Q49A 1A71A 4JJGA 4M72A 1IUKA 1FDUA 4OQYA 2I6TA 4CMIB 1W5SA 3NT4A 2PMUA 4S05A 3DEUA 3DFUA 1E7WA 4Q4ZF 2VOOA 1QYDA 4HV6A 2VHZA 5IN4A 3O3KA 2ESHA 3V7SA 2Z5LA 3JQFC 4UXNA 1SD7A 1P6RA 2DW4A 2P7VB 1PL8A 4XJTA 4BAYA 4KUHA 4ZQEA 4BV9A 2NTJA 2DT5A 3GH3A 3LA3A 3LZ6A 2H94A 4JIGA 2DPGA 4LMRA 4OXNA 4WLFA 1HWYA 2X0JA 2ZATA 2BFPA 1OC2A 4DMLA 1U7TA 3JQFA 3ZNPA 3ROMA 3A9WA 5TT0A 4OMUA 3P7NA 2BGMA 3GEGA 5DULA 1PIWA 2FSWA 3J81Z 2FE3A 3OP4A 1I2CA 1VRWA 2PQ8A 2Z95A 4YBZA 5LHGA 2X0RA 5I7VA 5A9TA 1VE9A 2ZCUA 4ZYDA 2HDHA 3IKVA 1Z6ZA 2VZ8A 1R4NB 4OIPF 3GEMA 2DI3A 2MA3A 4G94A 2J5QA 1K89A 3ORFA 2RAFA 4UHTA 1M66A 3GRKA 3Q1LA 3TSCA 5KJCA 3GVIA 2C2YA 4NK5A 1GV0A 4K2EA 2NVUB 3ITKA 4MOWA 1JAXA 1DOHA 2HKIA 4UEOA 1DXYA 2COMA 5HRUA 1PUEE 1ZO8A 2O4CA 1Y8RA 1E3JA 5ICEA 2V6FA 3UCEA 4OIMA 4QEDA 5LEJA 3GRPA 1AHHA 1T1RA 4DNCA 1U2DA 3T0YA 1ZRDA 2VCYA 4IZIA 4RLHA 1GCUA 1CEQA 1BDMA 1YBAA 1HE2A 2IA1A 4AVPA 3V8LA 1DIAA 4Z9FA 1TI7A 3FSRA 5KJ1A 4HLXA 1UXGA 1PZFA 5ILOA 3LAPA 5CVUA 1PZEA 1EQUA 2HQ1A 2GERA 2Y93A 4U0KA 2G7UA 3DZBA 5B4TA 1NPYA 2E7XA 3KHUA 5K9ZA 2LF7A 1P4AA 2XAFA 3QVTA 4B3HA 2Z99A 2VWPA 2C20A 1BHSA 3RASA 4C7JA 3WR5A 3ZCXA 4HZFA 5HDKA 1LC0A 3RJ5A 5CDSA 2Q1WA 3ECHA 1LLUA 1BN5A 3MWMA 4ZYEA 1DB3A 5J8FA 1XGKA 3PJDA 2JD0A 3WGQA 4BGUA 3BIOA 3L00A 3OJLA 6ADHA 1X0XA 4RVFA 2E1NA 2A35A 3F8MA 3ZU5A 1H9GA 1YOVA 2P4HX 4KZPA 2ZIZA 1B9NA 5D6EA 4MGRA 1KYQA 2ZJ0A 3DONA 2ISZA 3GGPA 3EDMA 1EUCA 2OD5A 3HRMA 3GMSA 1T6SA 4OH1A 1ADGA 1IN4A 4GH5A 3NTQA 2QBYA 2G9WA 4CM9D 3LQFA 4AJKA 1OPCA 1MXFA 4A12A 1S6YA 3K30A 5U4QA 1PJSA 4OKNA 3UICA 3L6DA 2QVOA 4MKXA 4GQAA 5CVIA 3ASUA 2V6GA 4JP3A 4ZU3A 3VKUA 4YFNF 1ZH5A 1EVZA 3Q6IA 3W4KA 3TOXA 4B4OA 5F64A 3CE6A 4N5MA 1MDMB 3ULQB 5D5UB 3GPDG 1H2BA 3RU7A 3WE2A 4PLCA 1I3LA 4RF3A 4MTDA 3QW2A 4EV0A 2XAJA 3WGHA 4BO3A 1QMGA 1F8FA 5T5QA 3G0OA 1R16A 2WYUA 4TRJA 4YJHA 1XA0A 2G76A 2Z9OA 2FOIA 1PWXA 4I9UA 3T1BA 3GXOA 3OIGA 3I4FA 3KV3O 3NTOA 2P4WA 5HS4A 4KTVE 4MQVA 3JQ8A 4G6QA 4EJTA 2F5FA 2IZ0A 3GFMA 3RC2A 3IIEA 3L6EA 1GQQA 5HDNA 2Y1CA 3ZZNA 1HRDA 4DC0A 3DQVC 1T98A 3FPCA 4IIVA 3RPUA 4Z0PA 4OOEA 4RORA 1O3TA 3AW9A 3B6ZA 2CVQA 3CMCO 1S7OA 4ZRNA 5T57A 2HYGD 3BYZA 4BXUA 1NWCA 4BKRA 1UZNA 3ZN1A 3GT0A 3BZUA 3OHSX 1LNQA 3R1IA 5F1RA 3D0OA 2KRFA 1NAHA 2JAHA 4I9HA 4BS9A 1U7HA 1ZGAA 3I0TA 4HLYA 1LRKA 4EJ6A 1L7EA 3O4RA 2GUGA 3ADPA 2VOEA 5LBQA 1PL7A 2NV6A 5E1ZB 3TQHA 4GGGA 4EJVA 3TNLA 2OHXA 4ZD6A 1FJHA 1FBUA 4M73A 4CM5A 4FJ0A 4WEQA 1J5PA 2PN6A 1FYMA 5H20A 1RJWA 2JD1A 4YJFA 5CEFA 1DC5A 4FFRA 2I9PA 1B3BA 1E1MA 2GQQA 4F45A 3BHIA 2BF7A 3N58A 5EIOA 2XIGA 3ZW8A 2Y1OA 1SFUA 3M8EA 3ISPA 3WFJA 4D43A 5ICMA 3PP8A 2CSUA 3KLNA 2Y1FA 1SD5A 2F5DA 3FM3A 4I02A 4XGKA 3U49A 2YU3A 5AXDA 5J6XA 3VPFA 3TL2A 1E3LA 4XD2A 4FB5A 1YWGO 3JQCA 1UDBA 2Y99A 1EVIA 1WNTA 4CQLB 5A4DA 9LDBA 4G65A 2UUPA 3V2UA 3E6MA 2H5LA 1K6JA 2AMFA 1MGTA 1YKFA 3SQNA 3PFWO 1USSA 4AIJA 2DVMA 4JXKA 4PG4A 4ZGWA 4RAYA 1O0SA 4P9UA 3K73O 4DQUA 4DL9A 4HNHA 2ETHA 4HFRA 1V4RA 2DTEA 4NMHA 1ZSYA 1PL6A 1YQAA 5EEGA 2HMVA 2ZYDA 4TZKA 3FTPA 3GFBA 1UJMA 3JYOA 3GYHX 2PZKA 5HBRA 1R58A 4ALIA 4FGWA 2HMTA 3I9KA 3JYLA 1ZN2A 2ZXJA 4WNIA 5ICCA 1NR1A 1UP7A 2E82A 3DZGA 3QIVA 4GSLA 3WTBA 3U09A 3AFNA 1KVUA 5LHHA 2QHXA 2X9NA 5FO5A 1RUOA 1XU9A 3M2TA 3F1LA 4I1IA 4OYRA 3HRSA 5G2OA 5GZ3A 1IZ1A 1HW2A 4QECA 1A7KA 2PNFA 1NPDA 3ZU3A 1OAAA 3FZVA 1NQ5A 5CEEA 3EW7A 3LC2O 4E5YA 2CSOA 2ZQZA 4IUYA 3QP5A 4M55A 4N18A 4AJNA 2RH4A 3DPTA 3RKWA 4EM1A 4WX9A 2WJPA 4IM7A 4ALMA 1Y0UA 4TVOA 2HEOA 4D45A 5KJ6A 4B4UA 1RM3A 1BXKA 4BNMA 5I8ZA 4XIJA 2PR2A 1K78B 3WNVA 5HTOA 3LQRA 3L9FA 3F1KA 3I58A 1N7HA 2BFOA 5E1XA 1R4NA 1V3FA 1ZAOA 1F17A 2Z1MA 2ZK7A 1XCVA 4ESJA 3PWSA 5DD4A 1SAXA 3W4IA 2X23A 3IJRA 3UN1A 4E4YA 4RVUA 5CFZA 2VHVA 2CO5A 2HWVA 4ID9A 1IXRC 3ROUA 1QLHA 1YJ8A 1GAEO 3WODF 3EK2A 2YY7A 3SZPA 3KP3A 5DD8A 2GA1A 1F1ZA 2Y1DA 1EEHA 3EYWA 1DP7P 3BTUA 1BTOA 1ZBQA 3M1EA 4M54A 1SAYA 1U6GA 4PZEA 2JHFA 2CFXA 3ROQA 3UVEA 2K86A 1IE3A 2JKVA 3DZJA 3JV7A 5EEHA 4FFNA 3K2BA 3L9XA 1P0CA 1O89A 1MXHA 4KDEA 1G4DA 1B2LA 3INTA 3PHIA 4HFMA 3ULKA 2FF4A 1UXIA 2D4AA 3CMMA 4URFA 4YB8A 2GR9A 4QO8A 5TJJA 4RPGA 2VE9A 5CDYA 2QQ9A 1ULUA 1P45A 1NHWA 2TMGA 1IXSB 3RU9A 5TLSA 1QZZA 3A28A 4MIYA 3RJPA 4WEOA 3GR6A 4FOSA 4GI2A 1CQIA 4CHUA 4MDHA 2W2KB 4CM9A 2EEZA 2CG4A 5B4VA 5JDIC 4UVAA 2Z5UA 1U3TA 5EQDA 3BJ6A 4UVCA 1GZ3A 4PLHA 1KEUA 4DXHA 4Q3EA 4IQ8A 3RBXA 1JVSA 1CF7B 2PTGA 1ZFNA 3R6SA 4ND3A 1YW9A 1TB4A 3E48A 5JDIA 3JTHA 1FX7A 4RCVA 1D3YA 1C0IA 4GMGA 4AJEA 1P3DA 3VPXA 2VNSA 5F1OA 2C54A 3FPLA 3EYYA 2DLDA 4EGFA 1BI1A 1NQOA 3DFZA 4L75A 2P9GA 3RWBA 4HQEA 4G81A 4I8XA 2OA4A 2O3SA 4WCDA 2DBBA 3WQSB 3RBVA 3C85A 3HRTA 1MDMA 4XWYA 5AQ1A 4HX4A 5JMPA 3U1DA 3AWDA 3B1KA 4BIIA 5L7YA 2GXGA 4DYVA 5ICSA 3OQBA 1HZZA 4FQ8A 4IDGA 1HDCA 2HTJA 2IW5A 1HKUA 2X58A 3HSRA 3WU0A 4ZQBA 5DOZA 3FNGA 3RKRA 3UCXA 1E17A 2RHRA 5U1PA 4NJMB 5AVOA 5JW6A 1AXEA 4YEDA 2EKPA 1N1GA 2EJRA 4PG6A 2L3DA 1ZYRF 4OU0A 2NQ8A 3VKVA 3R4KA 2AA3A 1HDOA 2G17A 2NNLD 2WTEA 4KUMA 3WJAA 4HV5A 3L0DA 2VRCA 2E48A 5A5EA 4YVFA 2FRDA 1DLJA 1U28A 1SC6A 1DDNA 4ZQHA 5EJ2A 1IAWA 5JC1A 4MIOA 1GU7A 2XOXA 3KP6A 2BEOA 3EY4A 2RDPA 1BW9A 3RUEA 4CUKA 1DBVO 3GY0A 3IL2A 1FYLA 3BDDA 3NJ4A 1YDWA 4KMUX 5FWNA 3F8CA 4NR0A 3KZVA 4QLCU 4NJOA 4QXMA 4ZJUA 3ROPA 3IAHA 3HUGA 2AQKA 3V1TC 5DP2A 1XIVA 3ZWXA 3CTAA 2FA5A 4YCAA 1HXDA 1F4KA 5BS6A 3HOSA 4NFHA 3QQPA 1O6ZA 4R1UA 3DMTC 5D4SA 3I54A 5FI5A 4N0BA 2CDBA 2UZKA 1A4UA 1QGPA 2Y1GA 1DSSG 4NU5A 5I9NA 4PG8A 1P1KA 3LVFO 1Z73A 1YIOA 1SFXA 1R1TA 3DO5A 3LSTA 1VM6A 1ZSNA 3Q5FA 2ZTMA 2KKOA 3I53A 1IRGA 1T2DA 3DMTA 3TZHA 3WTCA 3DHEA 3SC6A 5FI3A 3DOCA 1TT5A 2P5VA 4UUMA 3WQQA 3JAMZ 3RC9A 4NB5A 3PJFA 3ZWCA 5IAAA 1P92A 2BD0A 3ZU2A 5A06A 1Y8QB 5K5OA 4J91A 5ERIA 3TZCA 3PTZA 1XLTA 1DDOA 4Z3KA 3R0IA 1JHHA 1KU3A 3DC2A 1YS4A 3Q2KA 2ZNZA 5L7WA 3MAJA 2VUSA 1W4ZA 4EJ0A 5COAA 5JFOA 4BMNA 1IXCA 1Z75A 5BMZA 2NLOA 5JO9A 2JAPA 4YT5A 2B4TO 4XJSA 4DYDA 1GUZA 4R9SA 1Q7CA 3PLRA 1WVGA 3E1KA 1GXPA 3JSAA 5KKCA 2Y68A 1LBEA 5BSFA 5A9RA 1ONNA 2FP4A 4JN6B 3DPLC 2GN8A 5BNTA 4HKTA 3GNQA 3OBBA 4U8GA 3ROKA 2EXXA 1SMTA 3L2CA 4AJ2A 5L3GA 3UW3A 5E1WA 3A06A 3ABIA 1P0FA 1IPFA 3ZNNA 4OMZA 1LJ8A 5DBIA 4FPXA 2EGGA 3P7MA 3ZV4A 2IXBA 1D3AA 5FFFA 1BWSA 3FWEA 1QPMA 4CGZA 4U5QA 4CL3A 1PGJA 3VC7A 1NAIA 4WUVA 3BY6A 5E8IA 1H93A 2X86A 3JQGA 1X14A 2FNAA 2K27A 2ZFWA 2WD7B 4YAGA 4CXFA 4GVLA 4K6CA 3SZTA 1P44A 4O6VA 4OM8A 3ZHBA 3DHYA 1ZG3A 3AY6A 1HKQA 1LDJA 1GFSA 5F6FA 3H2ZA 5JAIA 2GA2A 2C6YA 2B37A 2HUNA 2BI7A 2CNBA 2VWGA 1IHYA 1TW3A 5G0VA 2P8TA 4HOBA 3JSOA 3EVTA 4M89A 5CDUA 4G7ZF 1PZHA 4NPCA 3TFQA 5BNFA 1B0AA 1OYWA 4DREA 4ZYHA 2VXZA 2VC0A 1ZK3A 2OBYA 1QR6A 3DAFA 1UHMA 3J80Z 1XD7A 1Y1PA 2FR8A 2ZBKA 3MTJA 4DIBA 1H0KA 4KA4A 1BOAA 1I5RA 2VWHA 3KLMX 3QWAA 1ZRFA 4O1MA 3VDQA 4IINA 1PJLA 3OMLA 1Y9AA 4WLUA 1ONPA 1I2ZA 3HJAA 1HYHA 3WTVC 1MJAA 2FEZA 1MC4A 4PVDA 4UUOA 5CLSA 2QX7A 3F3SA 1FDWA 4CV1A 1C0LA 1CERA 1QLJA 2EW2A 1B1BA 2W57A 1DJQA 3FBGA 1EZ4A 1F5TA 4J16A 5JMWA 1JXSA 2VE8A 4L74A 4GBJA 1H94A 1P4WA 2ZTLA 3I5MA 2L54A 3O8QB 3UGKA 4JQFA 1D7OA 2K7LA 2RGVA 3M1LA 3GW2A 3WMXA 1JGSA 1EE2A 1I01A 4BNNA 4XRFA 4Q39A 2XKPA 1XGNA 6LDHA 5A5FA 3JD0A 2XAHA 5DCYA 2W2KA 1E7QA 4Z9YA 3FD8A 3KZYA 1O3QA 2EWMA 3BMQA 3E9MA 1R5GA 2ZTUA 4AWXB 3TO7A 3RUHA 5A03A 5K6AC 2PKQO 2X9GA 3D3WB 1RM4A 4HX8A 2BI8A 1Z74A 4O5OA 3C3WA 2JCXA 1U2GA 1DC4A 4NBVA 4LMPA 4LW8A 1PDNC 3OJOA 3PEFA 4MPDA 3FWNA 4CLOB 1W5TA 1DHTA 4I9NA 3LA7A 4LFUA 5K6AA 2VWQA 4G8XA 1GYRA 4CM1A 4MINA 2WV0A 2IPQX 4MIEA 4W99A 1ISHA 1JW9B 3I9JA 3JQ7B 5JY6A 3M6IA 1OMIA 4J0EA 4XCVA 4BO7A 2P6TA 3QAHA 4YA6A 4J9VA 3A14A 4RLSA 1ZGJA 3K96A 4DLAA 3E6BA 3ZV5A 4CMJA 4NJMA 1J4AA 5L3BA 1DRUA 3FNFA 4R69A 1PX0A 2O0YA 1LC3A 2DTXA 3IC5A 1KYWA 3QU3A 3HSEA 3DDNA 1IHXA 3VB2A 2LDXA 2PH3A 3ONDA 2Y66A 3AU8A 4GLLA 1NTOA 2R3SA 1VSUA 4M49A 3ZHYA 4R51A 1A5ZA 3ERED 3TOZA 3ZI0A 1R1VA 4KIFA 1LUAA 2O4UX 5G0SA 1XDWA 4YQYA 1KGSA 3FF5A 2GGSA 4L76A 2Y0CA 4JQCA 4ZN6A 5TGDA 1B8VA 4PZDA 3K2ZA 4EEXA 1VL0A 3M7GA 3T7EA 1X7DA 1PR9A 4BNVA 1M2WA 4MP8A 1PJTA 4D0SA 2XVCA 2D0IA 4UUNA 1PTJA 4U7DA 1XB4A 3L7WA 5LGNA 1QORA 1FDTA 2R2GA 3GK3A 4JBGA 4RF5A 3WSWA 5C5IA 2PBIA 3MCZA 3ZMSA 3ZPLA 2A9FA 2M45A 3TO9A 2XROA 1ODDA 2C82A 2DPUA 1AOYA 3DBRB 4GGPA 4KP7A 2O2YA 4MKZA 3SJUA 4ALJA 2L01A 1Z1DA 1SZJG 5K0ZA 5L40A 4ASNA 1HZJA 3F8BA 2F5CA 1A9YA 4P22A 4IRGA 4EEZA 1V3UA 3MZHA 3D5QA 3WB9A 1DC6A 1HSZA 5AIPA 1PJ2A 1PQPA 2O6GE 5CHEA 3IUPA 1ZK0A 1BVRA 3C1OA 2LDBA 4J4TA 4FX0A 3H3FA 1DPUA 3BXXA 4Y8VA 3C7DB 5BQTA 1Z82A 4BNHA 3VPSA 1T4BA 1XEAA 1CIVA 2IP2A 4L9TA 1K2WA 3S2EA 4DWVA 2XAQA 3TQNA 1MC5A 2B35A 1Y8QA 4YJGA 5C37A 1UFMA 3DBVO 4J2OA 2JSCA 2W90A 4R1SA 4EMSA 5J8CA 3QWIA 3S1LA 2GYYA 2WC2A 3O2PE 2HSDA 1FP1D 4PGHA 2DK8A 4NBWA 4BO6A 4E5NA 1GEEA 4YPOA 1WMBA 3FTNA 4HAMA 3LT4A 3RBZA 1R36A 4Y13A 1Q1NA 4YFKF 3R3SA 4MVJG 3MEXA 5BT9A 4Z9XA 4FR5A 3CDHA 4IPAA 4PRKA 4RB3C 3GZ6A 2GO1A 1B4AA 5B37A 4TKMA 1NBOA 4HX5A 4K26A 5EQFA 4OIRF 2EJVA 1WI9A 1Q7BA 3VZRA 4A2CA 2Q4BA 4A2UA 4RO0A 1R6DA 4XDYA 1F14A 2NACA 2GLXA 1GXQA 4YR9A 5THQA 1XSXA 4PZJA 4TRMA 3VH1A 1BIAA 4RV9A 2A6HF 4AJPA 2YQ4A 1RZ4A 4A0YA 1EMDA 3AFMA 4OL9A 5KVVA 2D1YA 4L0YB 2PZLA 1YQDA 4E31A 1N7GA 3GVHA 3Q9SA 3PXXA 5JCJD 4L73A 2WD8A 2HFHA 1PP8F 2A69F 3E8XA 3FHZA 4J3FA 1USTA 7MDHA 1T39A 1PGNA 3T8TA 1ZXLA 1QXSA 4XB1A 4BHCA 1SB8A 5L51A 5ITWA 3VOEA 3LLSA 3C18A 4WNCA 4D0RA 4M87A 2G7HA 3VDRA 3ZNOA 1XYGA 3V7RA 5L9AA 5IJZA 2ELHA 4D79A 2DPHA 4K6FA 4ZHSA 5EL0A 1FBSA 3D5LA 3HDYA 3F3XA 1R0SA 5KNLA 1XGOA 1JU9A 3UUWA 1JHFA 4I01A 3V5NA 4KFCA 3OJ0A 3MJ4A 4HDUA 3MJCA 2PLYA 1OZAA 1UZLA 2BGKA 1C14A 1FC3A 3PQDA 4MVJD 4W9NC 1KQ0A 1ZJYA 4J4BA 4TKLA 3UFXA 2FBKA 1WDKA 5TNXA 4II3A 4CM8B 3BWGA 1GR0A 1FOKA 1G3SA 1WDLA 2NUAA 3MTGA 3AK4A 3DL2A 1BI0A 4YAJA 4RB0A 5F3RA 1J75A 4BO5A 3JQAB 4W9NA 1W6UA 4MVJF 2XAAA 1HTBA 1STZA 4EM2A 5HA5A 4BYYA 2LKPA 1Q7GA 1QKIA 1U4SA 1ZG1A 5A2QZ 3P5SA 1B8PA 4IS2A 3EVNA 5GMOA 2AG8A 1XELA 4FC6A 3VVCA 3PHGA 1D1TA 4N7RA 2K02A 3O8QA 2BH9A 1C1XB 3NDJA 1YL5A 4Q3AA 5BSEA 2AE1A 3ITDA 3EUHA 4LRSB 1B6AA 2Z1NA 2FU4A 2C2XA 3IKTA 2P5UA 5KCZA 1ZKMA 4BUCA 2W84A 5D6FA 1GL3A 2PJPA 4L4XA 1FF9A 1HDGO 2CW0F 3DKWA 4WECA 4D44A 1MGOA 5T6BA 3TDKA 4O63O 3DZKA 5LEKA 3F6OA 1A27A 4LISA 3D64A 5ILUA 1QRRA 4CZZA 5B12A 4R8HA 1LB2A 3RAJA 3CJNA 4LB6B 2YX4A 2A3SA 1U5TC 4KIGA 4ZZDA 3OH8A 4CLOA 1NFRA 1K7AA 4HY3A 4XR4A 1PWZA 2XHKA 4IDDA 4IQGA 2GXBA 5D8KB 2HJSA 4BHTA 4CMKA 4G2NA 4BNJA 2O3UA 2VC1A 3V8KA 1OKRA 3VOSA 1ENZA 3W8FA 1ZZEA 1JKIA 3ZW9A 3BP8A 4BO4A 3BROA 1U5TA 3H2SA 3JQ7A 4LSMA 3GAZA 4ZYGA 2YV1A 3K1MA 1BDBA 1O5IA 5L53A 1LVAA 3ENNA 5FGMA 3QWHA 4E2XA 4JCOA 2EK5A 4EI2A 3ECOA 1PS0A 3GDOA 5DBGA 5HM8A 3GMDA 2OBPA 4R4JA 5D4RA 3U4HA 3ZWVA 3KEOA 1ZSVA 2A4KA 2BRUA 2O48X 2Q2QA 5E8GA 3X2FA 5IZCC 1XHLA 2P91A 5THKA 3PQFA 1J5YA 2JD2A 5KKAA 1SMYF 3E6DA 2EW8A 3T8RA 1YO6A 1JKJA 3DOOA 4Y9DA 4F6CA 4Y17A 1NFFA 2QG4A 4CLDA 4M9XA 5ICFA 4ZVVA 5IZCA 4OOFA 3S2GA 3GPIA 2BFAA 3ZWOA 1LTHR 2EV0A 1QG6A 5TIIA 2EP5A 3U4IA 5FFZA 1N9GA 3H92A 1E6EA 3JW4A 2P68A 2O3FA 3TZKA 5LDHA 1B9MA 3KO8A 4OMYA 4EJOA 5I8WA 3DBHB 3QV1A 4JX8A 5B4UA 1QNTA 3IP3A 2YFHA 3DTTA 4MO2A 1X7GA 1YH3A 3OA0A 1NHAA 5TS3A 3IHUA 2AEFA 3BMNB 3LF1A 1SCUA 3JD3A 1V6AA 5DNAA 1RWBA 4TZTA 3GUCA 3V1YA 4O6JA 1FDVA 2VQ3A 2ZB3A 3GWZA 3KFWX 4N5LA 1T0FA 3GDGA 3WBFA 5KVRA 1EH8A 1MJ9A 3EYIA 3KRTA 1TLTA 3TDZC 5CPBA 3KP2A 2BGCA 2FSSA 4DQ2A 1T2KA 1U1IA 4EUHA 3K69A 4IDFA 2YFQA 4LSWA 3FNHA 1M6WA 4E2ZA 4PLFA 2HQRA 2NNNA 3CUQB 2UDPA 3EZYA 3JQ9C 4A7PA 2CY0A 4CV3A 2HKXA 1PR3A 3ZWNA 2G1UA 2QYOA 3I52A 4JK3A 5FLXZ 3W8DA 1YFHA 2B5VA 2X6TA 4J1SA 4BNZA 1B59A 2NADA 4LLGF 3RFVA 4HWKA 1KYZA 4IHTA 2DTDA 1U2WA 2FBHA 5C3MA 2OGUA 1LRLA 2VBWA 5DUKA 1CRWG 3JQ9A 4I5EA 3K8ZA 4FCCA 5AIQA 2IDZA 1NQAO 5TSDA 4XYBA 2JFHA 2HU2A 2OZ6A 4CLHA 2VODA 5DUIA 2V1XA 3FMSA 2X4GA 2PI0A 5F5LA 5HS6A 1ZEJA 2G82A 1P1RA 2VRCD 2ZJ1A 1DAPA 3TZQA 4NQWA 1XDSA 5G4KB 1G3TA 2IEBA 2FQ3A 4QWQA 1IUYA 3LT0A 4H3VA 5JDCC 4BV8A 2E6UX 4M6YA 3AM3A 3GUYA 1XCBA 1Z7UA 1GYQA 2O3JA 5JCJA 3RD5A 4JJFA 5JBIA 4ENMA 1KA8A 1ZMOA 3LK7A 5D8LB 1HSTA 1XG5A 3MZ0A 1YW8A 1ZLJA 2DLLA 4IJWA 4IPTA 3GNTA 1H9BA 2QUFA 1SPXA 2J6IA 4NBRA 4NIMA 4P4GA 4UUVA 4E0BA 4I5FA 5JDCA 2B83A 2LNBA 4P5OA 4O59O 4A0ZA 1Z91A 2Y67A 2P5KA 4M1QA 4CO8A 3IRQA 3GFGA 2L4MA 2AQ8A 4EGYA 3I9OA 4IF4A 1ZLKA 4P38A 3VZSA 1TLHB 3DP7A 4O3MA 3C7CB 1EVYA 3PIIA 4OSOA 3VH4A 4WXHA 1BBYA 1U3WA 4MQ9F 5ICGA 4BGIA 1LLDA 4R41A 4GVXA 3HADA 3S8MA 2O3QA 3RKXA 1XR3A 4MVJA 3MQ0A 3NTRA 3WTZA 2VRBA 2DFDA 4WJZA 4BO8A 5IFLA 5I7SA 4Q47A 4LK0F 2WWRA 1KEPA 3RVDA 4R79A 1B26A 3AM5A 4PG7A 3QWBA 2F1KA 3WG9A 3ZP5A 1X15A 2VT2A 5TX7A 3IJPA 3WSVA 1B16A 1ON2A 3ICPA 4B7CA 3CTMA 1O7LA 2XUBA 1DFHA 2YQ5A 1RYDA 3GHYA 2K4BA 4A5OA 4QO7A 3BZ6A 1C0PA 2JT1A 4P4LA 4DTIA 5CDGA 1HEUA 4CR6A 4GX5A 4CMIA 3DR3A 4CM8A 4A0XA 5T8KC 2OQGA 3QU6A 4CM7A 1XSVA 3LF2A 2JTVA 4L5JA 3N74A 4FGSA 2JJYA 3AUTA 2DFVA 2X22A 3K2EA 3PJGA 1OFGA 2VN2A 4A6DA 4FX4A 1LDEA 1B7GO 5T8KA 1A4IA 1YE3A 3TJRA 4HX7A 2FXAA 4OOIA 2YHUA 3HN2A 1GADO 1SBYA 4D3DA 4TSKA 4MHGA 1LDKB 1TQIA 1X13A 3BHJA 3H3ZA 4YACA 3WX0A 1R15A 4CLRB 4BH9A 3ETEA 1NASA 1Q1HA 4NH4A 3ONFA 3ZHZA 4KN7X 2C7VA 3QVWA 4J43A 4M6XA 3KYDB 3GLXA 4RPLA 4TV7A 2VNAA 5D5VB 4IQ0A 1D8KA 3QVXA 1PJQA 4G7HF 1AXGA 1ZNQO 4P8RA 3FXQA 3M2PA 4D41A 3AU9A 2DQRA 1G6NA 2F5EA 4M9ZA 2YZ7A 4UVHA 4CUJA 4HF1A 3GN1A 2NVUA 3EQLF 4PG5A 5BSGA 4N54A 3EAGA 5FB2A 5KJEA 3SVTA 1IOLA 2NU6A 1UAGA 4Q3NA 2HYFA 1BIBA 1Y5RA 4MEXF 2J3KA 4FC7A 5FF9A 1GTMA 5JR3A 2VUTA 3IUSA 4HF2A 1K6OA 2D2IA 3N4MA 4U7WA 4DPKA 4CUZA 1FBQA 2M87A 2J3JA 3REOA 1HYEA 1TVEA 4OHUA 4B4WA 2CD9A 4OAQA 3B02A 4GAEA 3L6OO 4YJDA 2ZKLA 4TMFA 3QE3A 1KETA 4AL4A 3KEQA 4RGUA 3WU1B 4UEJA 2VT3A 4E6PA 3WQRA 2FR0A 3AUAA 3PDJA 2DU8A 1UH5A 3VODA 4AIHA 3G73A 1XKQA 5IN5A 1BVUA 2WTBA 4KUGA 2VBZA 2XXJA 4JBHA 3BAZA 2FHSA 1TBXA 1GHCA 4A10A 2I65A 4W82A 3I59B 2CQKA 2O7QA 4U0WA 5IDXA 4NFSA 1DPRA 1WZEA 1QO0D 3O9ZA 2M5WA 1FY7A 5K1YA 3D4PA 3MJEA 1YLFA 3VH2A 2PD6A 3PGXA 5AYVA 4GKVA 3COSA 1WQ2A 3EETA 1J49A 3QA9A 2IE0A 1PGQA 2EFQA 2V6BA 4IJKA 1BG6A 4D3FA 1BXZA 3GX4X 4IRHA 4RL6A 1C0KA 4R3NA 2W8ZA 1R5HA 2HMWA 2XASA 2I67A 5K5QA 2YYYA 1LQTA 2EF1A 2Q50A 3DBHA 3QVSA 5I9LA 1T26A 4KYWA 2JFFA 2A68F 4IJAA 2ZCVA 3HN7A 3SXPA 1YB1A 2IJLA 4XRRA 1A04A 1E7YA 5G0WA 1M75A 3GGOA 5G0TA 4EM0B 1ZK1A 5EN4A 5JY1A 1WPQA 2I99A 5A9SB 5IXSA 1BXGB 1Z6TA 1O95A 2Q1UA 4TVBA 3TN7A 1NWHA 1YG2A 2UYYA 5H6QA 2IXAA 2PD4A 3PZRA 4QTZA 4RF4A 3F5SA 4ZQGA 2NVBA 1R4MB 4LRTB 5COBA 1L7DA 4J9UE 1YQXA 1ISGA 1PS8A 4HFJA 5TJ9A 4J0FA 3WGTA 2EA2A 1YYVA 3H4VA 4OKIA 1NX6A 2F00A 3E82A 2KIFA 2CWEA 3B1FA 3GA0A 4LGVA 4XR9A 1RPNA 3ENKA 2D45A 1VJ1A 3QP9A 4PGGA 2FMUA 4WLEA 2D59A 5C7OO 3TF5A 2UVDA 2WMDA 2HK9A 5DN9A 3BTOA 2EHDA 4L9VA 5TC4A 3VTZA 3DV8A 1WSUA 4ND4A 1QYVA 2CFCA 1E0DA 3UCFA 3Q9UA 2CVZA 4I5DA 4IRIA 1T25A 5H82A 2CUKA 2DUWA 5KJFA 4XLPF 4ZA2A 1PU2A 1L1FA 3ABUA 1VSVA 4YIIA 3ZNQA 3OSUA 4RF2A 2ZO4A 5G4KA 1ZEMA 3RROA 1S7AA 4GYGA 4OSPA 4DBZA 4AIKA 1PJCA 3RUCA 4Z6KA 3WE3A 3Q9VA 3WDSA 3AY3A 2FPIA 3CUOA 2MBFA 1E77A 1PS9A 4UULA 4BB6A 4B8XA 1TW2A 4FT8A 4Q3BA 2W24A 1U5CA 1E1KA 4LN1A 1XMAA 4UV9A 4UEKA 4NG5A 5JC8A 4MEYF 2RN7A 4WWCA 1O7FA 4IS3A 4OJNA 4YQZA 2Y05A 5AXAA 1FSHA 2IEDA 3I9LA 5CAEA 4UV8A 3BMOB 4C4OA 1ISMA 3H5AA 4A5NA 3R3JA 2UV8A 4PRLA 1DPGA 3GVPA 2MC3A 3CO6C 5F21A 1IZ0A 3D7LA 4PLYA 1QP8A 1MLDA 4CQLA 4B7XA 3IP1A 2O61A 3HZZA 3DZFA 3WLFA 1L0OC 2R00C 2Q0OA 1A7AA 3GVXA 3NEUA 1X0VA 3PHLA 3PWKA 4NFYA 1J0RA 1KEVA 4JP2A 2ILTA 3JAMK 3Q3CA 2O50A 1F0YA 4J1NA 4PLGA 3T7CA 2IA0A 3TOAA 3R0AA 4LG0B 5TQVA 5IDQA 5HOOA 2R00A 4FDAA 1DAOA 2Z3YA 3HE3A 2A61A 2IVMA 4ZZLA 4P96A 3RI3A 1GY8A 4E5KA 4ENNA 1G0OA 1P4XA 3BPVA 3BJAA 2I3GA 3BA1A 2EFPA 3DTYA 5IXYA 1R12A 5DCFA 4H0EA 2AQHA 2AW5A 3GHHA 5KVSA 2VONA 2EKLA 2JRTA 4UVGA 4WKGA 4JBIA 1KU7A 3W6JB 1P77A 3CXRA 5LHIA 2ISYA 4BKOA 2RCYA 3PHHA 4EBFA 1WAMA 4M8SA 4Y15A 1MJBA 1D1SA 3WGYA 1R7JA 1TEHA 4B4VA 2QRJA 3F8NA 1UP6A 2X5OA 2FR1A 1UXHA 2EFNA 3WGGA 3GDFA 3RQSA 1XGSA 1ENOA 3VHRA 2DBQA 3N7UA 1O94A 2RIRA 5HVQC 2BHLA 2YV3A 1DIBA 4DLLA 9LDTA 3P2OA 3KYDA 1LSSA 1XWFA 4B09A 1K78A 3DAPA 5F5NA 5JE8A 3D0SA 5H6RA 1DLIA 2WDZA 2NTVA 3IWZA 4CM3A 1H5QA 1HDRA 1B8UA 3G1TA 4QFDA 5LLQA 3GAFA 1E3EA 4D3SA 3HSKA 2E1CA 1YW7A 3T4XA 2FNPA 2MH2A 1I0ZA 2JCVA 4CLEA 2EJWA 5JFRA 4B7UA 4HFNA 3H8VA 1IY8A 4JJIA 2JFGA 3ZN0A 1J9IA 5L3FA 3OIDA 2POQX 3WBBA 1ISIA 4R01A 4PCQA 3GUDA 1REPC 5JSFA 1DO8A 2QLZA 3JSPA 1I2BA 2ACJA 1I3NA 1JTVA 3PPIA 3GZ5A 4ZRMA 3EDPA 1EDZA 1Y81A 1UXKA 3ASVA 1T38A 5F1PA 1KC3A 4TROA 5L3ZA 1E6WA 4J1QA 2YV2A 1GZ6A 2V6MA 3KOUA 2AXLA 3Q0EA 4HNGA 4RAZA 1D8AA 3MWDB 2KJCA 3HWRA 3J80K 3QSGA 1JA9A 2OOSA 5KWEA 3KETA 1VL8A 3KYCB 5L3CA 4CL8A 4RZHA 2C29D 1ISFA 5FD6A 5I7EA 2QYSA 3KCCA 3I59A 5JXWA 4IVNA 1N5DA 4BO2A 4BNKA 4GKBA 3MOIA 2V1UA 3L09A
chains in the Genus database with same CATH superfamily
2D5CA 1LJ9A 2WIAA 3RQ4A 4TYNA 3KX2A 4YP1A 2FZLA 1PGOA 4ER5A 3K16A 4L0QA 2E3JA 3UK6A 4BB5A 3SC2A 1C9JA 1G5IA 5DCMB 4A5SA 4MPPA 1Z47A 1WWKA 4ND5A 5JECA 2GBLC 1ZK4A 4J7UA 4Z9AA 3ABQB 1NI5A 3EUWA 3DNFA 3GTMJ 3P2MA 4G23A 1QRYA 1VLLA 3IPLA 1TWGJ 1E64A 2BJHA 4ZAFA 1J0XO 5FD8A 5BV7A 3L1PA 2IOYA 3N75A 1H1DA 2K2QB 1S4QA 2NZ2A 4GS5A 3G7SA 2Z33A 3H3UA 4B9AA 1JXAA 2JLQA 5LRRA 1AS3A 2FUCA 1U0TA 3SY8A 3SJBA 1H66A 1LVUA 4ZKDA 5D1HA 3BERA 3QEMA 2EFHB 4CTJA 2GLOA 3BZBA 4Z8YA 1BE8A 2YOGA 4G9YA 2VCHA 3N87A 1CS0A 2GN9A 2QRPA 3EODA 1GDHA 1N8SA 2R48A 2J1LA 1JS1X 4CEHA 1H0HA 1JFLA 3VPGA 4DNQA 2IGMA 5ALIA 2NU7B 5HQTA 1T2CA 4WOJA 4Z3OA 4QASA 1NG7A 5AMXA 1HKHA 4JI2B 4YJFB 4AUKA 2H00A 3K5IA 1DINA 1Q1QA 4F21A 2PL1A 4D26A 3L7OA 5BSWA 5CB8A 2OC4A 2ECQA 4OK5A 2RC5A 1P39A 2FLWA 3BJIC 1K6XA 1M7GA 1NJ8A 4MJLA 1EUDB 4EMUA 5EHNA 5H81A 2RGNC 2VUIB 5FPTA 2R9VA 3GLGA 4L8WB 4BBZA 4R1QA 3DXJF 5DNYB 1XZLA 4GMDA 3RRJA 4YRFA 2PZJA 4BVBA 4CQMA 4TS1A 1BFKA 5F9HA 2BLLA 4R3WA 4IJVA 2F3TA 3FVWA 1OE0A 4AG6A 3K1PA 1W34A 5B1SA 4C1BA 2GM5A 2H1KA 3L1VA 3T4UA 1N5OX 3RSHA 3CZ9A 1CUFA 2HD4A 1ECGA 4X6XA 1MFPA 3S2HJ 2PD3A 2NMVA 4I7EA 1KEZA 1GUYA 2AQEA 1G60A 1Y7IA 4PFKA 4WHMA 3QLVC 3ELKA 2AC7A 4D4LA 1T2EA 2WR8A 4KAXA 1CQIB 3SYRA 3O2NA 2AFHB 3E84A 1SWVA 1DFIA 1ENYA 1PE0A 4M1YA 1TEXA 1NDQA 4KRXA 4EYGA 4DF3A 4NHJA 3OZFA 4XUGB 3UGTA 4QXAA 2XCOA 3QA3E 3RWMB 1S6LA 5L4SA 1NV8A 3CR3C 4BFVA 1HUQA 2KHZA 4LJ6A 3NQ41 1NVAA 3NUQA 2VDOB 2CZQA 4M8KA 4ZO6A 3WLLA 5EERA 2HDWA 5L3DA 3AVTA 4BKQA 4GZLA 5BYAA 4X44A 3HOXJ 4BHPA 2R86A 1QIEA 2X5KO 1CY7A 2XGDA 1RM5A 2CNNA 5HS9A 3RTAA 3GEIA 4UUTA 4BNIA 5DLYA 3TSZA 2C7PA 3ENQA 3M5WA 4PV7A 4ZVQA 1KZYC 4I5IA 4B0PA 5CKTA 4D4KA 3OFND 1KHHA 2O0LA 2HHAA 4G4SP 2J4CA 4S2EA 3Q6MA 1HSOA 2WYVA 3LWNA 3SI7A 2NYXA 1FVXA 1FTSA 3CUKA 4D92A 3S3OA 1B8IB 2E4ZA 2DC1A 4XTCS 5CYOA 1S2DA 4GX0A 4XQ9A 4E7SA 1VJCA 3GAAA 4QGFA 4X61A 3O8HA 2AYYA 4DA9A 3AB7A 3VFZA 5TF4A 4FT4A 2NM0A 5HIKA 1Z05A 5CVJA 3STYA 4Z0HO 3NBYC 1XAGA 3SHVA 1R9GA 5ENZA 4L5IA 2P79A 2R8EA 3BCRA 3OU2A 5DEOA 1ZMTA 3TNYA 3D2LA 2DT8A 1TVKB 4ZN6A 4FHZA 3TYXA 2OHJA 5E4TA 4ZMSA 2IYWA 4A0SA 2Z6QA 3CUQC 1T2AA 1YU6A 4ITUA 3AB3A 3T0IA 4BACA 4Y67A 3U3JA 5P21A 5FKNA 1V7QA 2GNAA 4OA5A 2H4HA 4UPEA 1W94A 1M7HA 4DB2A 1AG9A 2OO5A 3R8FA 2GCPA 2ZFUA 2UU9B 2X13A 4IJQA 4FMDB 1LE8B 3ANYB 3ZN2A 1TJ3A 2V7VA 4RIEA 2NU9A 5AVWA 3L6BA 4KPEC 2RONA 4R5MA 3HOTA 1KQFA 1DUXC 5CDHA 1X1SA 1SXQA 4OQEA 4RNCA 4IIUA 2DQLA 3CRQA 5H9VA 3HJBA 4IGFA 2NS7A 1QX4A 3PDHA 4IGEA 3G68A 3WLNA 5CA0B 2H1SA 3NG1A 2IHBA 3BWMA 4A3SA 1HEYA 4D0GA 2ZWAA 3QXXA 3H05A 4FI3C 3E4CA 1FNBA 4FD3A 4I3HA 1RRCA 3OIUA 1C9MA 3MG9A 3EC7A 3OZCA 3JYNA 1PFQA 4UUSB 1NSYA 4V0SA 5DHPA 3H4IA 3ZZ1A 3EZLA 1Q57A 2XUAA 4DYQA 1W6RA 5DRYA 1QQIA 5KU1A 5KSWB 3B1ZA 3ZD9A 3HYRA 3DG9A 3ZDCA 2ZB2A 2PEXA 3BMCB 5IJ9A 5EJCA 2IT1A 5JHUA 4Q7JB 4AIRA 3HM5A 1LVGA 4AG3A 3G1MA 2JH8A 3AJ8A 3LBHA 3G2PA 2BR3A 5FB3A 1XTJA 1M2FA 2XUFA 3UENA 3DEEA 2HJWA 2K2WA 1NE7A 2DPDA 5HWSA 1OR7A 4DV6B 3WK4A 4CYDA 4B7AA 4C88A 3SU8A 1I39A 1B6SA 1UK8A 1SRRA 4AO8A 4MI9A 3JY6A 4IJ5A 4GNKA 1CJUC 3QPSA 3TQSA 4ZCIA 2DZDA 1DTSA 1Y8RB 1LSUA 3CEAA 3I5AA 2D74A 3D4NA 1G5TA 3B2NA 1SCBA 2GM9A 1JAZA 3I23A 4DPLA 3ESDA 1JEYA 2W2VA 3Q7IA 1HL3A 4CMEC 1CTQA 4J1TC 4IOKA 2HT1A 4YALA 2PJZA 1DT5A 4GOMD 3ZDBA 2JH3A 3E7WA 4I0WB 3K8YA 4R2IA 1FTTA 4HQFA 4P4SA 2DHQA 3A03A 3OF5A 3LRTA 3AUUA 3P9KA 1RQNA 2ZOSA 2AO9A 3WYEA 3F6EX 4NCKA 1Q15A 5BPDA 2AUTA 2V6JA 4UHCA 2G28A 5DJ5A 3CC2I 2Q7XA 4GX2A 5JS6A 4JYMA 4CKBA 2RK6A 5DV5A 2IH5A 4P33A 3FCCA 4O4IB 3IEIA 3LECA 3Q2IA 2I9KA 5FBKA 3T7IA 3MA0A 3SYTA 4J0HA 4IRXA 2YX7A 4YFXF 2AXQA 3ZXUB 4MRVA 1XVTA 1JA0A 3NFYA 2PBRA 5B7QA 5IYZB 4DR4B 4NV3A 3GP8A 4UXNA 2AOTB 1BXRA 4DMLA 1U7TA 1PIWA 3DTVB 1FE8A 5CXUA 1RAFA 2IZOA 2Z5FA 1D5WA 5LHGA 3AVOA 1F4LA 1WUHS 1AK9A 1D1AA 2GZRA 1J2TA 5K51A 4BMOB 1OLXB 2J6HA 2Z09A 4PRZA 1JAXA 3MAGA 1DOHA 4OGFA 1PUEE 1TM5E 4BRWA 3NHAA 1AHHA 5CFLA 2WG1A 2ORWA 1HE2A 1PZEA 1OA1A 1ZQ9A 2GLUA 3ZCXA 5KNBA 3G9XA 2JD0A 1X0XA 2PXAA 3F8MA 1U9IA 3CLTD 4AF6A 1Z2AA 3GGPA 4CIYA 2OAQ1 3C7TA 1H2BA 3AV0B 3QW2A 4BUJA 5EJ8A 3WGHA 2D54A 3Q3VA 2ECOA 3T1BA 3I4FA 4DR2B 3FKSA 3UWPA 4G6QA 2F5FA 1J0DA 2JGLA 4FISA 3CYFA 2AR7A 3RPUA 4H1UA 4Z0PA 2QI9C 2CVQA 1E98A 2GYUA 3FTCA 1W88A 4P34A 3GT0A 3BZUA 2KRFA 2VKDA 2V59A 4BNDB 3HUGB 3PFYA 1XRJA 2Q4TA 1CU1A 2CHQA 1FYMA 5CEFA 1S89A 2ZRDA 4O5AA 4CKWA 1W47A 1Z2PX 1H4VB 2I4TA 2RREA 3JQCA 5B30A 3AG3H 3MB8A 1G7TA 4I6GA 2KLBA 1EGVB 4PG4A 3VHXA 4ZGWA 2C95A 1W49A 1PL6A 4F38A 5BNZA 1P9WA 1DE0A 5AVTA 2E82A 3UR3C 1NOIA 1R88A 2CSOA 1BX1A 4WACA 4N18A 2WJPA 1FP4A 4LIPD 3V2IA 1TCBA 1J70A 3EXHB 1IJWC 3HRKA 5E1XA 4K03A 4QVGA 3H1GA 3ABLH 4DUGA 3G7NA 3U81A 3W2FA 2JA2A 2SHKA 3IE0A 3OKCA 3RODA 5HZHA 2QTBA 2BYTA 3CLHA 1IE3A 1PYDA 3IBCA 4I2VA 1KI6A 1OKKA 3CLTC 1P0CA 1ABEA 4LYGA 2XKBA 3M6MD 2QQ9A 3DCYA 3OYIA 1CZHA 2Z4TA 4TN5A 2P9TA 4CKCA 4MDHA 5I01A 1WR8A 3FPSA 2ME6A 2X4IA 1CF7B 4YMSA 2NN3C 3VPXA 4DGWB 2WU0A 4BWYA 1HZZC 1N57A 4RSGA 2JEYA 3RBVA 4C0HA 2LD5A 2HB6A 3R7BA 1L8LA 4IDGA 2B6HA 3QNUA 3FNGA 1FYFA 2WTEA 1WPXA 1DLJA 1SC6A 2ZSFA 1KS2A 3NO4A 3HYTA 1FS5A 3F3YA 4ZVUA 3BDDA 2H3EA 3F8CA 3KZVA 3WA6A 2YWEA 3TD6A 2R2AA 1Y5NA 4WZAB 4U7FA 3HKZN 3CTAA 3A6LA 2NO0A 3HOSA 4NFHA 1GKKA 2XDQA 1RKWA 3I54A 3PO3J 4XIIA 1EEXB 1DSSG 1QWSA 5FQNA 4BCBA 1Z73A 3LL4A 3LSTA 3RF7A 4LDAA 3I53A 2DPMA 2OC9A 2JIZD 1ANKA 3EQ6A 4B71A 4G56A 1ESDA 5ISMA 3PR3A 4BE9A 1Z68A 5BMZA 4WN3A 2XB8A 3ANTA 3CW8X 2ZYUX 2CL6X 3PPWA 2ATEA 2ZXWH 3BB4A 1XRSB 5FV7A 3OZEA 2NG1A 3ZV7A 3OOHA 4U5QA 3DB1A 3OY9A 4WUVA 5J2UF 2AWNA 3CX8A 4MUGA 1CRPA 3AILA 1V43A 1T9AA 1N5MA 1UMCA 3FOZA 4AKEA 3HJGA 3TFQA 4ZYHA 1MH9A 2VC0A 2K3PA 1SVMA 1F2TA 2QX8A 5EXPA 4Y7NJ 2B8WA 4JB0A 4RKYA 3VO2A 2CH0A 3UGKA 4D4JA 1YMQA 4RTPA 3RSNA 1I01A 2ZR8A 3PEYA 2PEYA 3FBWA 2XAHA 3W5CA 2HEIA 3TTXA 4CNBA 5K6AC 3TEDA 1R50A 5IABA 2DOKA 1QAQA 4KYUA 3LBAA 3OM0A 4FETA 4TN1A 4MPDA 2NZYA 4CEIB 3LA7A 2J31A 4A8JA 4FSDA 5DM70 4MIEA 2RHJA 4RLSA 3BRSA 3E8SA 5IUJC 1DRUA 3HEFA 3ONDA 2HJHA 3RB8A 3SNHA 2JANA 1I80A 5LVAA 3FDZB 5D6NA 1U1FA 4P80A 1M2WA 1PJTA 1VDZA 4UUNA 3AONB 4F3RA 2P2GA 3RSFA 1EB9A 2IS1A 1SCUB 2R6DA 3TQFA 5CHEA 3A0UA 3OT1B 3LDFA 3ZVLA 3GJ7A 1CIVA 4LBWA 4NY1A 2ZE5A 4OHFA 4PGHA 2DK8A 2VDLB 4E5NA 3QTBA 5AOCA 4NVRA 4MVJG 1J8QA 2X8AA 2ACEA 2VP0A 2EJVA 1FLVA 2NACA 3VH1A 4RV9A 3C3MA 2YQ4A 3CG0A 1YQDA 1N7GA 1ZP6A 1GKUB 2EWVA 4N6OA 2HFHA 3C18A 4TLMB 5JWRA 1K6MA 2G7HA 4M87A 2HX1A 5D3MB 2DPHA 4ZHSA 2HU8A 2O8BB 2YXDA 4B76A 3K05A 1LNSA 1KZ7B 3DWEX 4MVJD 4BRSA 1W0JA 1KQ0A 4PIPA 4OAYA 3QFRA 4Y0NA 4BO5A 4RB0A 4K3UA 3I0ZA 2ZI3A 1DKOA 5KWIA 5LYYA 4BYYA 3Q88A 3DMPA 3A27A 2B63J 3P4XA 2AF4C 1E8MA 3PVSA 4R7ZA 4P98A 3ITDA 1NLMA 3GGSA 2Z1NA 2LBFA 4QEZA 4F4DA 1ZKMA 3VPCA 3D3KA 2E5NA 3DKWA 5HFAA 1M83A 4Y1GA 1E2FA 1MGOA 1CUZA 3F6OA 2C3MA 2YX4A 4BAZA 2HJSA 5FLMJ 3GP5A 3R24A 2O3UA 3VOSA 4XKBA 2E18A 1JKIA 4BO4A 3ZZUA 3DQZA 4C08A 1RTTA 4C3ZA 1VNDA 3GRYA 3GDOA 5TS2A 2OBPA 1JZSA 3X2FA 4LJKA 3E6DA 2PGIA 4N3NA 3S44A 1XBTA 5CBKA 4HAVA 1UM8A 3WIVA 2RBGA 4UM5A 4D8VA 3Q1KA 2GXQA 3HNOA 3IHUA 3UO8B 1V3QE 2VJOA 1MF7A 1TVMA 1T0FA 1Z38A 3MCAA 1TLTA 3LGXA 4A7PA 1ECLA 4LMBA 4ND7A 3BTCA 3DVQX 3W6PA 3JQ9A 3O92A 4ZCTA 2X4GA 1G3TA 4TMYA 2FQ3A 2CLFB 4H3VA 1P0PA 4CCJA 3C70A 4JJFA 1XG5A 3MZ0A 4IJWA 5JCOC 4ESVA 1JFFA 4NIMA 1SPXA 4UUVA 3E2IA 2LNBA 5BV0A 3G1WA 3GFGA 4XYLA 1OWNA 4WBNA 3HADA 1A9QA 3BHNA 3MQ0A 5JNSA 4N6GA 3K2AA 2CXHA 4RFSB 3M4NA 3BZ6A 6YASA 5IHPA 2RKWA 1XN4A 4UHFA 5JNWA 5HNHA 3T7DA 2JTVA 2FZGA 2XMPA 1ITZA 4FX4A 3DYIA 1YE3A 1LLFA 3HN2A 3AJDA 5DK6A 2E34A 3DULA 1X13A 3ETEA 1NASA 1O4XA 3HDDA 3KYDB 1IHPA 2X19A 1NVDA 3M2PA 4D41A 1G6NA 3E23A 1QG2A 2V7GA 5E9QA 4A6XA 2JAOA 4XVRA 2HYFA 1BIBA 4A2QA 1GTMA 1V45E 1OBVA 3HYSA 2XNHA 4QLAA 4B4WA 4PONA 3G8DA 3KEQA 1N2CE 5AO9A 3CNOA 3CNBA 1XKQA 4C3OB 1WD7A 2XTZA 3BCAA 5K2MA 4U0WA 4ISBA 2OENG 1SXJB 1KI1A 1ZOSA 2PD6A 1PZNA 3T7SA 2ZJAA 4ADSG 2V6BA 2CYBA 2K9MA 3EQ9A 2XECA 1J07A 4IUCS 4P9NA 3AR6A 1W1WA 1V2GA 1E7YA 5JY1A 4M9QA 4UTVA 1LW7A 5DWVA 3F90A 1BCSB 5BW8A 2IKQA 3GLIB 1SUFA 1VJ1A 1Z28A 1MQAA 3TXYA 4XWOA 1LBSA 1IRXA 4L9VA 2ZSBA 4IOCF 3H4MA 3QEBZ 2CMHA 2FEKA 4IRIA 1FYWA 4X62B 1O4VA 2RBKA 1A2KC 5EXXA 1G20B 4AIKA 4G36A 3THSA 4Z6KA 4I1UA 4QNMA 2MBFA 1XMAA 4UV9A 1ECFA 4OQFA 5CAEA 5DHUA 5F2NA 3QVKA 3CO6C 1L5RA 3QPAA 4ATNA 1K61A 2I10A 2R97A 3WHCA 1F4VA 2O1SA 4WVLA 5CA1A 4LG0B 3HE3A 4O2BA 1W0TA 2RH5A 1UK9A 2J9ZB 1IEVA 1Y89A 3A1FA 4N40A 1C7EA 5E3HA 2EFNA 1XGSA 3IBYA 2BHLA 9LDTA 4TTQA 1AUXA 2G1KA 3P2OA 4DSAA 4K9SA 1TWHJ 3F4KA 2NTVA 3UATA 2J9GA 4QPPA 2O6LA 2JCVA 2BM8A 4MCAA 1J9IA 2PVCA 3GELA 1IWPB 3OL3A 2JBAB 4QHSA 1ZRSA 3LNQA 1BJKA 4OHWA 2OCBA 4IYJA 3TAUA 1P61B 4YRIA 3KYCB 3AESB 3BGVA 1RTKA 2B1IA 2R60A 3D4BA 4EW1A 1UBHS 1O0SA 4N4AA 5FIUA 1FMCA 1X39A 2FGJA 3K20A 1MQ9A 5ALMA 3WQHA 4Z7JA 4JB2A 3GLGE 1XAHA 2L7KA 5FKJA 1OR7C 2GO7A 4Y6PA 3PJEA 1VI6A 2H1HA 4NBUA 3SZRA 1VGQA 3RFUA 1DKMA 3D43A 3FMFA 2VYFA 3ZGOA 2QT0A 3O95A 4MAFA 1PUIA 2MC4A 3L1JA 1YQGA 2Z8YA 1H0SA 2GBLA 1I32A 1KZHA 4XIYA 3C24A 5DTMA 2R62A 3ZLBA 2V3VA 4KRFA 1EHYA 3DVAA 4JC4A 4P83A 2W2QA 1B15A 3KPVA 1OCCH 1OT3A 3GEEA 2ERYA 2PX4A 3QKTA 1T3SA 2D5AA 1YMUA 3FPAA 4DDWA 2UUOA 2EKZA 1E5VA 4L4RA 2OL4A 5IBQA 4XWTA 5ENDA 3GTGJ 3V7FA 1MNAA 2O8FA 1I94B 3H9UA 3L06A 1OLOA 3NUZA 2JBWA 5JWOA 1C3LA 4ZOLF 1WO8A 3P5BA 3BD7A 4JUCA 2WFLA 3FXUA 1FS4A 1ZS9A 3QOEA 2HOEA 3ROFA 3DMYA 1U3UA 4LZLA 3UMYA 2Q1SA 3FSEA 3QBEA 2JRMA 4MVJE 2HK8A 3OE4A 3I28A 3QU9A 3ZD7A 3UT6A 4XLNF 1EFUA 4YRZA 4YG2F 1LPAB 4DT1B 2Q1XA 2RHWA 4DM3A 4KI0A 4C9BA 1DZ3A 3WOHA 5CLIA 3IODA 3A1VA 4RJTA 3DOJA 3ZX4A 3KR2A 3C87A 4MGZR 5C44J 1J9ZA 5K8TA 5DNEA 2Y0PA 4A0HA 5JVTA 1OXKB 3JQAD 4X1IA 1Z5UA 1F5SA 2GEDA 5L3EA 4DCUA 1K5GA 4KQGA 4AXXA 3ZHCA 3SFTA 3L07A 4OXYA 3T9EA 1TQPA 4F9GA 5NLLA 5FEUA 3VAZA 1KMCA 2RGNA 4MUYA 2QZZA 4XUCA 4PIVA 4JYKA 2EWNA 1QP0A 1TL7C 2GOYA 3FYCA 3GB9A 4NU6A 1Q2XA 5EC8A 2WQ6A 2VP3A 4H16A 3MJVA 5I7UA 2WYOA 2B4AA 1MNMC 2QDXA 2FXVA 3DPUA 1T15A 4KXQA 1M0SA 4HGQA 4WF2A 3OR1C 3OFSA 3PUHA 3SQMA 3DBRA 1T3LA 5CCBA 3NR2A 4EA8A 3QLVA 1K7EB 2FPSA 3K0AA 4NDLA 3KOYA 4HNAA 2AVDA 3COPA 5CDTA 2B0JA 5BSVA 5EJ9A 3KHTA 4DOZA 4DLBA 3PWZA 5AVVA 1YA8A 3DKKA 2W93A 3K10A 3RIEA 4QC2A 5AI0A 16PKA 1UPAA 2VKQA 3CEJA 4BNTA 3NAMA 3WDMA 4KNVA 3DB2A 4JITA 3MSCA 2G04A 4M1EA 3JVUA 3FTQA 4BDZA 1PG5A 2O8EB 3JZDA 4BJ1A 3NBFA 3LBIA 1KO7A 1X7YA 1THZA 1ZM7A 2JIDA 4EVRA 5JSKA 3G2KA 4NC7A 1SC9A 2R65A 3A4VA 3PYLA 1T24A 1IN7A 1U7UA 1NU8A 3K31A 1NF3A