3WGIA

Crystal structure of rsp in complex with beta-nad+ and operator dna
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
217
structure length
217
Chain Sequence
KTIVSMAVIRRLPRYHRYLEELLKNDVKRISSRELSEKMGVTASQIRQDLNNFGGFGQQGYGYNVEELYNNLTKILGLDKTYNTIIIGAGNLGQAIANYTSFEKSGFNLKGIFDINPRLFGLKIRDVEVMDVETVEDFIARNKIDIGILCIPKDNAQYTADRLVRAGIKAIWNFLPIDLKVPDDVILENVHLSDSLFTVSYRLNEEELFKKLKGETA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinct structural features of Rex-family repressors to sense redox levels in anaerobes and aerobes
doi rcsb
source organism Thermoanaerobacter ethanolicus
molecule tags Transcription/dna
molecule keywords Redox-sensing transcriptional repressor rex
total genus 69
structure length 217
sequence length 217
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02629 CoA_binding CoA binding domain
A PF06971 Put_DNA-bind_N Putative DNA-binding protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wgiA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wgiA02
1BBYA 1ZK3A 4W9NC 1E5LA 2WM3A 4K9DA 3DBHB 3TFOA 1ZGAA 4AFNA 5IN4A 1OYYA 4BH9A 1P74A 3DV8A 2HCTA 4UULA 2FMUA 4L18B 1M75A 1X7GA 3Q6IA 3RUHA 3TF5A 4WNIA 2L01A 1UP6A 4IDCA 4XLNF 5A5EA 3PGJA 4HAMA 2HKOA 1ADBA 1YQXA 3E9QA 4PLPA 1Z91A 2LF8A 4EITA 2EEZA 1FX7A 5CDYA 1QNTA 1DP7P 1JHHA 1UB9A 4OIPF 1R0SA 2YHIA 3JQ7A 2DI3A 1E1KA 3D7LA 1ZG5A 4HV5A 3RBVA 4OOIA 4LD5A 3T8RA 4UVEA 1I1SA 1YBVA 2VHWA 3ICCA 1G0OA 3E1KA 4XDZA 3TN7A 3BTSA 3FM3A 4FR5A 3JQ7B 4BMVA 5TLSA 5FYDA 4IJUA 5BNFA 5MGBA 4G7OF 1PWXA 1S6YA 1ZRFA 1GADO 4NBRA 1O94A 3GLQA 4IVNA 2GGSA 1NPYA 2WD8A 2ZATA 3E9NA 1IY8A 5L3GA 2W84A 1I32A 3EDMA 4DQUA 1NBOA 4JXKA 4GI2A 1KVSA 2W2LA 1CIVA 2FHSA 3TWOA 1UJMA 4AICA 1I33A 4CUJA 5A5FA 5DCWA 3D3WB 3QU6A 1KYQA 3JD0A 5HA5A 2OP1A 5CYVA 1XU9A 2OBYA 5EMHA 4ZZDA 1DIGA 3I58A 3TZQA 3ABTA 2O4CA 5IF3A 2W98A 4PVCA 1O5IA 2XHKA 2JD2A 1U28A 1SOVA 4BVAA 4E33A 1R1VA 4CXFA 5L40A 4M6XA 3GFLA 4XD2A 3ZWPA 4TVBA 2XAHA 4E3ZA 2PG4A 2FF4A 2VUTA 1ZO8A 5A4DA 4EJ6A 1ZGJA 1W8DA 1FYKA 4O59O 3FXQA 1JKFA 4D7AA 1BRMA 1PJQA 1R58A 4Z9FA 5KJ6A 3NTQA 4IS2A 5E8IA 1ULYA 2HDCA 1KU7A 1J49A 1LU9A 1SNYA 3WGOA 4DYVA 2IA1A 4IDFA 5JSFA 3GEDA 1HLDA 4UVBA 3BTOA 1NWHA 2HYFA 3LYLA 2WE8A 3SQNA 1I8TA 1H6AA 5ICMA 3RIRA 2V79A 2VNSA 3IKVA 1IOLA 1TQIA 2DQ4A 2IZ1A 2QUFA 2O7SA 4J9UE 1NXQA 4JK3A 4UVHA 8ADHA 3WWZA 2PKRA 4L5IA 1EQ2A 5TT1A 4EJMA 1EMDA 4M72A 2A35A 3VPSA 4FX4A 1R22A 2O4UX 4ESFA 4OIQF 1OC4A 1OI7A 5GMOA 2DPGA 3F22A 5E17F 1HXHA 4UV8A 5TJ9A 1WAMA 2WD7A 3ZU5A 4BNYA 3RFXA 4PZEA 4WLEA 1IUKA 1DIAA 5KIAA 2YYYA 5ITWA 3DHYA 3TOAA 1Y5RA 2LDXA 3QWAA 2VRCA 4R1TA 1EVZA 4A2UA 1NFFA 1G0NA 4KIBA 5LHHA 2X8LA 3GRPA 4WE3A 4Z0PA 1RWBA 1Z6TA 1XEAA 3C8MA 3MJSA 4M55A 4PZCA 3WU1B 5IT9Z 3AU9A 1A72A 3T4EA 5CVVA 4BS9A 1ON2A 1WQ2A 4ZQBA 1KQ8A 3LWFA 3NDJA 1NX6A 1LDMA 4EEXA 4WOKA 2NV6A 3G0OA 4GSKA 3KSDO 5KTKA 3MJEA 1GUFA 9LDTA 1XN7A 2C07A 5C37A 2E7WA 1EEHA 3L6DA 4JCOA 1DSSG 3WSVA 3HOSA 1M67A 3M7GA 4ZU3A 4B4VA 1TXGA 5KJFA 1Z7UA 1LEBA 1LQTA 3HHGA 1ZXBA 4QLCU 3WTXC 5TIIA 2JFHA 4U0KA 5TGDA 3N7UA 5GY7A 1O8CA 2EJRA 4PLYA 4RGXA 3GVCA 2EHDA 3AFNA 3DAFA 3R0IA 1KBZA 5H81A 3WX0A 4YAIA 5A2QK 3E48A 5BMZA 4XQEA 2DM6A 1R00A 1DC4A 1G1AA 2PH3A 5JPIA 2I65A 3CKYA 5CEEA 4IJKA 4PG8A 4BO7A 2FNPA 1GZ4A 1P9LA 4WXCA 2VBXA 1ADFA 4YR9A 3D64A 2ESHA 5CPFA 3M9AA 1C0IA 2GD1O 2VOEA 5KNLA 2ZBKA 5CVUA 1T6SA 1P1IA 2CDAA 2VWPA 4P55A 1DIHA 3M6IA 5F5LA 5LC1A 3HRSA 1DOHA 5JLAA 1QPMA 4WXDA 2SCUA 3KEQA 1QLHA 3SZPA 3KETA 5B37A 1Y7TA 4HWKA 2Z3YA 5FF9A 4R1SA 4HOBA 3BYZA 3IL2A 1WZEA 4CZZA 3I5MA 1I3KA 1VM6A 1I36A 3V1UA 2BLLA 1EFLA 2PTGA 1OBFO 4I8XA 4IF4A 4R5HA 4BNGA 1WMBA 2UWMA 3ZMVA 3RAJA 2J3HA 3X2EA 5KJCA 4XGIA 1UHWA 3MWMA 4N5NA 4YDRA 4RF3A 1U5TA 3PFIA 1ZH8A 3K31A 4A0XA 2B4TO 2C0CA 4R41A 3UFXA 2V9VA 2Y48A 3HB4X 4E2WA 1F8GA 4P5OA 2EIHA 4KIFA 2F1KA 3A06A 5FI3A 4PG4A 3HSKA 5KVVA 3PI7A 4DYDA 3RI3A 1JE8A 3GZNA 3OICA 4FSHA 3W6KB 3WIEA 1Z75A 1NP3A 4B4OA 3FPCA 1NHGA 2YX7A 3KYDB 3H9EO 4H7PA 1XGNA 3HDYA 4JJIA 2EFWA 3I5UA 2NQTA 2E49A 3B73A 4Q3DA 3AU8A 1CDOA 2BRUA 4PLTA 4B79A 1B16A 1EBUA 2IYPA 4UVDA 4IGFA 4YRDA 3Q0EA 5A3VA 3NDIA 3F3SA 4HBGA 3ZHBA 4CODB 3V8JA 4Q47A 5F1RA 1MB4A 3DBRB 2HK8A 1IPEA 1VPDA 4XJTA 5DCUA 1XKQA 1GV0A 4KYWA 3KM0A 4L76A 4CR8A 4EJ0A 1P92A 2XAFA 3WBBA 1YXMA 5CP8A 1H94A 3CH6A 2VOOA 3DBRA 5HS6A 4Z6KA 1CF7A 3GY0A 5AOVA 1STZA 1HW1A 1GQQA 5G0VA 1WWXA 4YWJA 3J7AO 3RKRA 3DMTA 4LSMA 4QXMA 5MDHA 2B0JA 1ONNA 3JV7A 2P4WA 3EHEA 3RU9A 2FRHA 3AJRA 1NNUA 4BNXA 4ZZLA 2GA2A 3E3VA 2FSVA 3DBLB 2ZXJA 5ILOA 3WIDA 4PFJA 3GN1A 3RPQA 4J9VA 1X7HA 3ZU4A 2OZPA 5FB2A 2XXJA 5CPBA 2X0JA 1KU9A 3GQVA 4L75A 2O2YA 3LSYA 1ID1A 1I10A 2D1YA 3C1AA 3F8CA 2RCYA 3DWFA 5DZSA 4KUGA 3ISPA 1DJQA 3WGTA 3RTRA 3WTUC 2V6FA 2H6CA 1QQIA 3CUOA 1R16A 1X1EA 5JO0A 4ONEA 1C1DA 1XGKA 1M76A 1XCVA 2ZCVA 4XB2A 1LBEA 2W57A 2NU7A 4M74A 1OYWA 2FY8A 3QW2A 4G6QA 4CM9D 3KSUA 1TB4A 3PIDA 4KQWA 3HDJA 2IEDA 2PZJA 1C1DB 1B8UA 4CICA 1FNNA 2WE7A 2EJWA 1AUPA 1YYVA 4RGUA 4P9FA 4I5FA 1CYDA 5BQTA 3TGNA 1LSUA 3JQAA 5C7LO 1BVRA 3SXYA 2CO5A 3TZHA 3E8XA 3P5SA 5FLXZ 4J7CA 3D5LA 2Q46A 3K2BA 2ZKLA 3C7CB 2QQBA 4CO8A 1KY4A 2UV8A 3JQ8B 3FNFA 2ZCUA 3A28A 3GF4A 2EV6A 3VVBA 7ADHA 3CUQB 5HDNA 2CWEA 1ENZA 2NSDA 3VKVA 3HSEA 1RUNA 2Q0OA 4OHUA 5CVJA 4J0EA 2X22A 2Q2QA 3Q1LA 4DQXA 1C0PA 2NTJA 5JC1A 3I71A 4MVJH 1HL3A 4YVFA 4ILKA 1QP8A 2L54A 1HE2A 3D4OA 4U5QA 3BHMA 1FDVA 4FCCA 4MVJA 5TRTA 4ZHSA 4RS8A 4I08A 3VH3A 3COSA 5IDXA 1GXQA 3NEUA 4YA6A 4I2OA 4MEYF 4QO7A 3O38A 4MVJD 2X0LA 4LG0A 1FMCA 2DKNA 4UUMA 4IXTA 5ICFA 2F5EA 3FCOA 3C7AA 2XAQA 5LEJA 4PRKA 3SVTA 2Q3EA 3QAHA 5AXAA 5L3EA 1PR9A 1SMTA 2BE5F 2JRTA 1N1EA 2A69F 2YDYA 3CZMA 4ESOA 3K1PA 4ASNA 2EG9A 3ADOA 1U3WA 3ST7A 4FJ1A 4MIEA 2X23A 4JP3A 3G1UA 3NAQA 2HQRA 4HADA 1K79A 1M6WA 2AHRA 5I7VA 1VSUA 1BDBA 3ZWMA 3DEUA 4M54A 4JNKA 4U7WA 2RVCA 1KU2A 3W6JB 3LF2A 3FZVA 3F1KA 4ND2A 5G2OA 3P9KA 1ISHA 1CJCA 3GLXA 3VH4A 4EBFA 1E3JA 1WRJA 2HMVA 4J91A 3LA2A 2NYXA 4FT8A 1JKIA 4FFOA 1MG0A 2EGGA 3V4GA 2X5OA 4B7CA 2ZB3A 4Z9YA 3DFZA 1IAWA 2Q50A 1B6AA 1RM3A 1Z9CA 1UZLA 1SMYF 3KCCA 2OL4A 3CEAA 1SPXA 1Y1PA 1IZ0A 2BKAA 3LC2O 1PGQA 1QZYA 1QZZA 2HYGD 1I24A 1XSVA 1HDRA 1EDZA 1KVUA 3IUSA 3OP4A 3RASA 3EQLF 2CVQA 2DPDA 4KTVE 2UUPA 5D5VB 3QRWA 2G1UA 2PY6A 5DN9A 4E2ZA 2JL1A 1L0OC 2TMGA 4R9RA 4ALJA 4E4YA 3ERED 3PWSA 5ER6A 1S8NA 2ZYAA 2NNYA 3F8FA 1F12A 1YW7A 5LLQA 4Y6SA 2VYNA 1MD0A 4TWRA 4LCEA 4WLVA 4B3IA 3GG2A 3A14A 4EGFA 5DBIA 3FI9A 1T4DA 2DQRA 2FXAA 1JGSA 1V3VA 3KP2A 3GH3A 5EN4A 3BMQB 2EERA 4NJMA 3KYCB 2J3IA 2G7UA 4ALKA 2GN4A 4BNJA 4I1IA 3HSFA 4LSWA 1FT9A 4N5MA 2EXXA 2DC1A 3FR7A 1PJ2A 1YW8A 2E7XA 1YO6A 2ZNYA 3S2IA 2OA4A 2HFHA 3ANLA 5FD5A 1Y8RA 4M89A 3RUCA 3QPTA 1PU2A 4O3MA 1VL6A 1P0FA 1TT5B 3F9IA 3EZYA 2UXNA 5K9ZA 4HBLA 3QP9A 1A9ZA 3D3WA 1YIOA 4XA8A 4M9XA 3RJ5A 2ZNZA 4QECA 5EIOA 4NQZA 3RKYA 4DIBA 4E5KA 1V3UA 1REPC 1GYPA 2JZYA 1O89A 3IRRA 1W0CA 2Q49A 5L4NA 1U2WA 3NQOA 4D3FA 2I9PA 2H9IA 3MCZA 2PD4A 2QX7A 3OA0A 4NFHA 3WQQA 3FM5A 4EI2A 1JAXA 2RGVA 2D45A 1O3TA 1BN5A 1ONOA 1ISMA 3P7MA 4QO8A 1XIVA 4ZD6A 2NU9A 3EY4A 1ON1A 2X4GA 4YT4A 3U1DA 2P5LC 2D1VA 1F1ZA 3I1JA 1LRLA 3S55A 2Q1UA 2YZ7A 4WXHA 1K89A 4Q48A 2P9GA 2Y99A 2AW5A 3KEOA 1E1MA 1K6JA 4NZ9A 2O03A 1IRGA 4S04A 2Q1WA 2Y1OA 3L00A 4Z9XA 3E5QA 5IZ4A 1Z74A 3WICA 2WJPA 3CPSA 1Q0QA 4OXNA 2P9CA 1K7AA 4P4LA 3DB2A 2ZCWA 1XMKA 2Q99A 2QYOA 5IG2A 5D8KB 4CMIA 1HEUA 3KOUA 1SFUA 5CDTA 2HMWA 3PFWO 2VHZA 3I9OA 3B6ZA 4K26A 2EK5A 4WKGA 1OKRA 2CF6A 5HS9A 4DMMA 2H94A 3J80Z 3NEPX 3RSHA 3E18A 2C6YA 5DP2A 3DPLC 2AE2A 3GPIA 2IT0A 4E5NA 4XX0A 2PMUA 1EH7A 1TT5A 1EUZA 1K5HA 1QYXA 4GPD1 3W4KA 1PIWA 5TF4A 4G5HA 2XROA 1B9MA 1LVAA 3DFGA 1E17A 1GYRA 3LQRA 4F46A 3KLMX 1F14A 1OAAA 2K02A 2HMTA 4DLAA 1T39A 2F5FA 5IDWA 5D6FA 4R68A 3LSTA 1GL3A 3K5PA 3KBOA 1TTYA 1DB3A 1PS9A 1LA2A 4TKLA 2C82A 1E6UA 4W6ZA 5THQA 4M87A 1PDNC 4W9NA 3I4CA 4TQGA 2GYYA 2Y0EA 3OETA 4AVYA 1GVJA 2D8AA 4A10A 2GRAA 4ZRNA 1IN4A 4B09A 4L73A 4J7UA 5JO9A 1RI7A 3RQSA 3COAC 3SX2A 3BY6A 1P4AA 4NHJA 3E6BA 3HRTA 2VBWA 4PVDA 3PQJA 4BNIA 1S6LA 1O7LA 1SAYA 5C7IO 4BO1A 4QTZA 1RYDA 2ELHA 1EDOA 3C1TA 2EV9A 4CL8A 3QY9A 1U5AA 1WLYA 1CETA 1HDYA 4PGFA 4AJHA 5IJZA 1G3SA 1JLLA 4U7DA 4HUJA 3PLNA 4MIOA 3M1AA 3B1KA 3E6AA 3INGA 4R8HA 3FF4A 3STHA 5K6AC 4EJWA 1HDZA 4OMUA 3JQ6A 4AIJA 1T98A 1YJ8A 2DBRA 4BGVA 1UXHA 2QRJA 1UDCA 2LDUA 2R2GA 3GWZA 1E7WA 2K7LA 4WX9A 2W2KB 3NTOA 3OBBA 3PHHA 2TDXA 4MP6A 4XBFA 5BT9A 3I59A 2EF1A 4WCDA 3S2GA 4LG0B 1YTYA 1PGNA 3HDHA 3PPIA 4K28A 4CMKA 4I0BA 1VC2A 1Y8QA 1I5ZA 2QQ5A 1UDAA 1Q7GA 5BPIA 2WMDA 3KYDA 3L7WA 5F1OA 4DA9A 1QLJA 1FP2A 4KNYA 2O2SA 3BJ6A 2P4HX 4ND4A 1LLCA 2WYUA 4NBTA 2C29D 5L3FA 4E30A 1ZEJA 4YQZA 1PJ4A 3AUSA 4WK8F 3EZLA 3HNPA 3TL2A 3MAJA 4LCJA 4NBVA 2VHYA 3H92A 4M6YA 2B35A 4K2EA 4S05A 2EGHA 4EUEA 2OXIA 2UZKA 3QJ5A 4E70A 4DQ2A 3O4RA 2NU8A 3VHRA 4LB5A 1VJTA 4DREA 3NGLA 2VN8A 3OIGA 2L4AA 3OMLA 4WOJA 3ZNNA 5BSFA 1QYVA 2OUIA 2QWWA 3Q2IA 3M2TA 1O9BA 2Z99A 4DLLA 1YRLA 2K86A 2FBKA 4MQ9F 4MKZA 3WTBA 5TQVA 3VODA 3D0OA 1PS8A 5IN5A 1J7KA 3QWHA 5EEHA 4YT5A 5AIPA 3QE3A 3BP8A 1IZ9A 4JP2A 2ZK7A 4GGOA 3H3UA 2RH8A 3OJEA 2C20A 4TRJA 2O3UA 3HFGA 3MJCA 3E5RA 1T2FA 3KXDA 2EFPA 4OOEA 4U0WA 1LDYA 4IINA 4MVJI 4CDGA 3DMTC 4EQQA 3BWGA 4J90A 1J0XO 1BVUA 3HADA 5A9RA 4M8SA 2O3FA 4FC7A 1A4UA 2CUKA 2GO1A 5JYDA 3H9JA 5I7EA 1OYIA 3TZKA 2QYSA 3PJFA 3ZW9A 1KYWA 5JDCA 1U3VA 3MOGA 1J2XA 2EP5A 2PZMA 3AM4A 4OAQA 3WR5A 5BR7A 4RF5A 3VH1A 1PZEA 1KVQA 3GHYA 4J4TA 2YW9A 1QO0D 4A26A 1K78A 4TZTA 2VWQA 3L4BA 5JAZA 1RM0A 1U8XX 2V6CA 5TC4A 1ZSNA 1XYGA 1O95A 4TRNA 1L1FA 3M8EA 1IN6A 1IB6A 2E82A 4JJGA 3V2HA 3MJVA 3ZMTA 5ED4A 1LQUA 5E8GA 2QZZA 3ZP5A 5ICEA 3WFJA 1NTOA 3E6DA 4KUEA 4CQMD 2JPBA 1TLHB 4XLPF 2DBQA 2Y0DA 4CV3A 4D79A 1QV6A 4NFSA 3R6SA 5KVCA 2V65A 1HT0A 1USSA 2YQ5A 3SC4A 1JN0A 3VPXA 4E21A 1ISJA 4JLWA 4EDFA 3K0LA 1DFIA 1KEVA 3T0YA 4BNVA 5K6AA 4NMHA 3TJRA 3JQGB 4YBZA 4ZQHA 1U6GA 4YIFA 1EH8A 3UOGA 4F7ZA 4E0BA 4BO9A 4PN3A 5CJ9A 4M9ZA 4CYDA 1MKMA 5E20A 1YGYA 2P5UA 3A9WA 3ANNA 3BMNB 3FD8A 2ZTLA 5K5RA 2QBYB 1LXCA 3TQHA 4CV2A 2Z9OA 5KJEA 2KIFA 3CLOA 3ZI0A 3AUTA 4BKRA 3K73O 3QP5A 3IP1A 3PGXA 3IDSA 2YHIB 3DZBA 2EB7A 4J7XA 3BMQA 1PJCA 3MCVA 4CLRA 2LF7A 3KLOA 2PN6A 4I9NA 4ZRMA 2IEBA 1LDBA 1R1TA 5DUKA 1JWBB 3LFKA 2NVUA 3WB9A 3GW2A 4XGNA 3HHHA 2QW8A 1TVEA 2J5PA 3FMQA 3B1FA 4GH5A 5EQFA 5CDSA 1U3TA 2IRWA 5JY6A 1MXFA 1HDGO 3BA1A 3HFSA 4UVGA 2BFAA 3ZWYA 2X58A 2LNBA 5IT9K 1PJLA 3KVOA 4CV0A 2NTNA 4CHUA 1UUFA 3RC1A 4IRGA 1CQIA 3GZNB 1MJAA 5K5OA 1ISIA 5LHIA 1O3SA 2BFOA 3PIIA 1T1RA 4CM7A 1CQJA 1FDUA 3M2PA 2D5CA 4WEQA 5CHEA 2EKLA 3DF8A 3KP3A 1EK5A 3GHHA 4LW8A 5ITVA 2H6BA 5D5WB 5J8FA 3CUKA 1FYLA 1Z05A 4IZIA 5C7OO 5L4LA 4RB0A 2F5DA 4Y13A 1ENOA 2FWMX 4A73A 3EGOA 1IXCA 4UHTA 1BXGB 3GZ5A 3JAMK 4G7ZF 1AE1A 1A9YA 1DAOA 2D59A 3KSZO 4ND3A 5T5QA 3TO6A 3H9QA 3QLJA 1WI9A 4DRYA 6LDHA 4IDDA 5AYVA 1HW5A 3S2EA 4PGHA 4CLHA 1T2EA 3LT0A 1KQ9A 1MDMB 3VEPA 2PBIA 1RM4A 2CVOA 1LRKA 4I7HA 4MTEA 4J6FA 3GDGA 3HWRA 2X9VA 1ZYRF 5ES3A 4LLNA 2BELA 1P4XA 4I9HA 5COQA 3WODF 1MLDA 5DOVA 4RVGA 4XCVA 4G9YA 2XRNA 2WWYA 4Z3DA 3GVPA 3VTFA 3GT0A 1K6IA 1I30A 4INAA 5C3MA 2ZJ0A 2CQKA 1R12A 2RHCA 5ILVA 1GXPA 4Z2YA 3ENKA 3IC7A 5DD4A 4EM2A 1VRWA 3F6OA 2PR2A 4JX8A 1HE5A 4Q3EA 2EA4A 2AG8A 1EE2A 1JHFA 1DPUA 5JXWA 1P1FA 2D0IA 2HGCA 5JI6A 1N2SA 4R3NA 4O6VA 3ECOA 5DD8A 2A4KA 2IJLA 1UP7A 1C3VA 4ENMA 3HZZA 4FN4A 3OA2A 1Q7BA 3PJGA 4JK1X 1NPTO 3GAFA 2D1HA 5HS7A 3RFVA 1W73A 4QT0A 2Z33A 3G79A 3M1EA 2ACJA 4ENKA 2Q4BA 4XR9A 4BXUA 1YLFA 3K1NA 4LVCA 1PGPA 3Q5FA 1MJBA 4QEDA 4R1NA 3GC6A 2IW5A 5B4TA 3UHAA 5BQFA 4ON0A 3L9WA 4F6CA 2RV8A 3RJPA 4LMRA 1XDSA 3H5RA 1T26A 3ZU3A 1KVRA 1LEAA 3ECHA 1Z6ZA 4D42A 3OV8A 5TJJA 3W8EA 1BWSA 2DTRA 1B4AA 1DJNA 3GRKA 2LDBA 5HBRA 1H5QA 4R54A 4BNWA 4Z0HO 1TLTA 3JYQA 1KEUA 2HKIA 4BUCA 4YJGB 1ISFA 3I59B 4LRTB 1O0SA 5A02A 4JBAA 2VZ8A 3V1TC 3HQ4O 1PJSA 4EUFA 1BGVA 2J5KA 1EV7A 4NB5A 2X1HA 3SLGA 3GFIA 1N7HA 2PFGA 4RVHA 2B5VA 5FI5A 1F5TA 1I01A 4W82A 3D4PA 3JW4A 2DBVO 4BGUA 4CUZA 2X86A 1J5YA 4FFNA 2GIVA 2XAJA 1D7OA 3HN2A 4ESJA 3OEYA 3T7EA 2YQ4A 1YFHA 2GXBA 3OHSX 1IZ1A 3ONEA 4BHBA 1MGOA 1UFMA 2FPGA 3RUFA 1DUXC 1KIFA 3BAZA 3ZV4A 2QVOA 3NJ8A 4HW0A 2GNAA 4YAKA 2HTSA 3QP6A 2DLDA 3F46A 2GDZA 3J81Z 2AEFA 3DAGA 3FXUA 1K0UA 5JAMA 3F8BA 3FWEA 2YHUA 3CUQC 1A27A 3AK4A 4ND1A 3D5QA 1ZCJA 1PGOA 2Y1EA 3V1YA 1HKSA 1E7SA 3E03A 4BHPA 4B4UA 2DW4A 1SEVA 4WJZA 4CM8A 1DIBA 3B1JA 1AGNA 3I4PA 3AUAA 2W24A 1FYMA 1MA0A 1MC5A 4I0AA 4BO5A 5KOIA 4OYRA 3WS7A 2X4HA 4UUVA 4XB1A 1I3MA 2Q2WA 5HOOA 1V4RA 4FFLA 2C2YA 2DK5A 3W4IA 3K2ZA 3E6MA 3KP5A 2PNFA 1DIRA 2QENA 1B3BA 4J43A 3HOTA 4LMPA 1A5ZA 4KFCA 1MGTA 2UAGA 4J4BA 4W7IA 1T2KA 1GPDG 3DZHA 1S3JA 2KIMA 4HLXA 3MTGA 4ZYHA 1NVMB 3K8ZA 1H6BA 1PP8F 4A0YA 2ISZA 1NPDA 2W8ZA 2DLLA 1LC3A 2K4JA 5A2QZ 3DZIA 2VXZA 2GCGA 2P7VB 2OO5A 2Y1CA 3DOCA 4FFPA 3ZZNA 3DDNA 5GZ1A 1WPQA 1C0WA 1JVBA 2BHLA 3B20A 4DL9A 4CLXA 2RN7A 4BKQA 3MQ0A 1SB8A 5J6XA 4DPMA 5EPOA 1IW7F 1XHLA 1B14A 3O3KA 4D3SA 4NG5A 3CDHA 2AEMA 1EH6A 4MTDA 1W4ZA 4PZDA 4MP8A 4NBUA 4URFA 2EV5A 5KKAA 3I9JA 3L6EA 3ANMA 4Z0TA 2FSSA 1M2WA 4I9UA 4CR7A 3E5XA 5F3RA 2EW2A 4CL3A 2QZ9A 1ZREA 2O8XA 5E1XA 2C7GA 6PAXA 4RJTA 3DBLA 2STTA 3PQDA 4BNLA 2FBIA 3WQRA 3ZQ7A 4L0ZB 2PEXA 1R4MB 1BI3A 2PQ8A 1FC3A 3PHJA 1U8RA 3OJLA 3KYBA 3PXXA 5ENVA 1G6KA 3V8BA 3V2GA 3VPGA 1YONA 2EP7A 3U4IA 3DOJA 3ORFA 4N7RA 4MDHA 3CZRA 4IZHA 4Y6PA 2FZEA 5LDHA 4G65A 4DPLA 1H9TA 2K4BA 3RKUA 1XGOA 4R1UA 4J4HA 3ZHZA 1YS6A 4NK5A 1HETA 1ISGA 1I27A 1BIAA 2DO7A 1GPJA 1NFQA 1YQDA 4NK4A 4R01A 1WDMA 4ZQEA 3IWZA 3ZV5A 5BSEA 3C85A 5ICSA 2O3QA 4IPTA 2XUBA 1N8KA 5LGNA 1R1UA 5DDIP 3OFSA 3JQEA 3ROKA 2V6BA 2EWMA 2VHXA 4CLDA 2CZCA 4RPJA 4FS3A 2M45A 3RPUA 1D4FA 1PJ3A 4F45A 3HTUA 1SEPA 1G3YA 3CUQA 2EA2A 1F9NA 4ZN6A 3WE3A 2DUWA 3FF5A 3GVIA 4JQFA 4IDGA 1HF3A 2FQ3A 3WE2A 4BQAA 2PKQO 2FR1A 1LSSA 5HTOA 2Y05A 4ETSA 3H3JA 5F5NA 2W2KA 3OQ6A 4GVXA 4XIYA 4LK3A 1E1NA 1MV8A 2VRBA 4Q3BA 2NAZA 2CVZA 2HLPA 3FBTA 2X9GA 1U78A 1P45A 3GEGA 5H6QA 1LEHA 3R6DA 4IRIA 3ZW8A 1PP7U 1WXDA 3QWBA 1H2HA 5AVOA 4XSXF 4EUHA 1VJ0A 2ZB7A 5K1YA 4LK1F 4GLOA 4NDNE 1SMKA 4CMAA 2OQGA 3F4BA 2GQQA 1ZSVA 2W4QA 1XD7A 3RVDA 2WYVA 2JAPA 4A0ZA 2VONA 3RIHA 2IXBA 4ZVVA 4BKOA 1UAYA 4CMIB 2CNBA 5JFRA 4O5OA 1BI0A 4I09A 2HDHA 4Y98A 4NH4A 1QYWA 4EW6A 3CO6C 1K6OA 1H6DA 1HBXG 2D3TA 2P91A 1OFGA 3B70A 4BO0A 1UH5A 1G3TA 1N5DA 4J1NA 4LJZF 3N97A 1FXSA 2WD7B 4Y6RA 3AAFA 3O2PE 1PJTA 3E5MA 3U0BA 4CLEA 2PJPA 1MXHA 1IL0A 5JW6A 2GF2A 3I0TA 1KA8A 4ZQGA 3MEQA 4OSPA 3I52A 3TOZA 1NHWA 3F5QA 3D1LA 4AVPA 1V3TA 2NLOA 1PX0A 1YH3A 5DCFA 1Y6JA 4XZ3A 4KDPA 4JBGA 3OOPA 1I0ZA 2CFCA 4Q3AA 4A0SA 1IPFA 2H1SA 4DBVO 4J0FA 2BBYA 1P1JA 4O0LA 2X0RA 4CMEA 3GK3A 2YU3A 1BTOA 4L0QA 3AW9A 4YACA 4ZA2A 3UUWA 2GXGA 3HRUA 1DDOA 2Y93A 1EUDA 2CSUA 2MH2A 2R7FA 5CFZA 3GXOA 2VODA 3WTWC 1SOWA 4A6DA 4PCQA 3R0AA 4LK0F 3BOQA 3DHNA 3NRCA 4OMYA 1L3LA 1V35A 4W4TA 3ZNOA 3DONA 4R4JA 1P6RA 1H93A 4KMUX 4HQMA 4LB6B 3ZNQA 1PQUA 1PS0A 3PHGA 1OC2A 2BD0A 1J75A 5JYEA 3LQFA 5J8CA 4CGZA 1KVTA 4C7KA 1IN7A 1EK6A 1T25A 2VUUA 3AY6A 3TO9A 1FBQA 1R0KA 3MTJA 3QVSA 4N5LA 5T57A 5HLGA 1R37A 4UUPA 4PG7A 3LT4A 3DZJA 3WFIA 2BGLA 1YWGO 4IXAA 1D5VA 5H6RA 1UR5A 5KVQA 4RPGA 1KOLA 3N4MA 3GGGA 1GUZA 1ENPA 2AE1A 1JA9A 1RKXA 3WTTC 3WTVC 1FBSA 3K30A 3IKTA 3C1OA 2Y1FA 3ZPLA 2DK8A 1FDSA 1YS4A 1VJ1A 2E37A 2O3SA 2B37A 3NTRA 1U3EM 2ZB8A 1HKUA 3R3SA 3RD5A 1KQ0A 3ZMSA 5IAAA 3W4JA 4EM0B 3QPHA 1IXSB 4WPGA 1BXKA 3V2UA 4MVJM 1SD7A 1HWYA 2AQHA 4IBOA 4IXWA 3I6QA 4GQAA 4D0PA 3JD3A 5DT9A 1S7OA 3PP8A 3RYPA 3BJAA 4M1QA 5IXSA 4PLGA 4GX5A 4FHTA 3VOEA 1NASA 4NR0A 1CWUA 1OMIA 3WG9A 2IZZA 4AWXB 3R4KA 3JQFC 4RPLA 1FK8A 3DAPA 1AN9A 2Q4EA 4Q39A 1DDNA 3MJ4A 2P8TA 3RFTA 2V1UA 1LLUA 2VUSA 4DIOA 3U49A 4BO8A 2AS5F 3WTYC 1HKTA 1UXKA 5LEKA 2QYTA 5EQDA 5DP1A 2EKPA 5H20A 3J81K 3F21A 3FNHA 2EFOA 2YR2A 3BROA 2FR8A 3A1NA 3VFZA 2HS5A 3WTZA 1D3AA 1LDGA 1PZHA 5L45A 3DEYX 1Z82A 5BOXA 1PWZA 2H5LA 3GG9A 4PLHA 4YTEA 4B8ZA 3WU0A 4BB5A 2HAEA 3O26A 1DO8A 4IHTA 4KIGA 3CTAA 3Q9SA 3S2WA 1G6NA 1N92A 1U4OA 2BI8A 3EAGA 2FEZA 4I02A 1U4SA 3C7JA 1R7JA 5FGMA 5IT3A 2P5YA 3H5AA 4IQ0A 4I5GA 5CVIA 1QGPA 3V5NA 5HLIA 4GVLA 1Q1HA 4LLLA 1R36A 1BXGA 1E6WA 3ROMA 1YVEI 4YRBA 1E6EA 4WECA 4RCVA 4LGWA 4DMLA 3WJAA 4CM9A 4FFMA 1P1KA 3LLSA 5JFOA 3JSOA 5A1TA 2XKOA 1EVYA 2W25A 3DZGA 3WMXA 1B0AA 4PLZA 4GX0A 4OJNA 3AI2A 3F72A 3WGGA 4OINF 4MO2A 2ZMEA 1P33A 3JQFA 3F6VA 1E92A 1AWCA 5HM8A 1TQMA 1QR6A 3DXJF 1R4MA 1YG2A 3BHIA 1I6XA 1LLQA 2PKQP 3BHJA 2FMYA 3KLNA 4TKMA 1ZVMA 2JD1A 4Y8VA 5EL0A 2JAHA 2OFPA 4KZPA 3O6BB 3GMSA 2MH9A 4GX2A 1XLTA 4AJPA 1FDTA 3FXRA 3PYMA 4MGRA 1WNTA 2O7QA 4M49A 2AMFA 4RVFA 1QBJA 4IDAA 1W7PA 1G4DA 1IHXA 4Y9DA 3GN2A 5G0UA 1U2DA 1HSJA 2FNAA 3QWIA 1E2XA 4R79A 3JYPA 4GSLA 4S1VA 4WCFB 5T6BA 3UN1A 4XQGA 5FFZA 1MJ9A 1XSDA 4HXYA 4RZHA 3K96A 1DEHA 2P5VA 1GR0A 1ZFNA 2M87A 1ZARA 1RUOA 4RVUA 1AXGA 3X2FA 2HJSA 4RAZA 2AA3A 5E18F 2QBYA 2I76A 4EVIA 4ITUA 3AY7A 3F6YA 4L9TA 3P19A 4IS3A 4ALNA 3ZMZA 3GUDA 4N54A 4BO3A 5ADHA 5LRRA 3IAHA 1ZG3A 1XQ6A 3PWKA 1SO8A 2P68A 2IPQX 2PGJA 3WLFA 3IOYA 1JVSA 5JDIC 1USTA 1GQ2A 3KV3O 1YB1A 5HLHA 1HRDA 5HDKA 1F17A 4MP3A 5HS4A 1EUCA 1O7FA 2VBZA 1MFZA 2M5WA 4ZH4F 2P5KA 3TOXA 1FLIA 3JQ9C 3ROPA 1FBUA 5KJ1A 1Y81A 4AJOA 3U09A 2XGXA 1CGPA 3BTVA 5G4LA 4XWYA 4A7PA 3NDRA 3C3XA 1OMOA 3ZWBA 5D6EA 4KOAA 3E5UA 1IN8A 3FX3A 2X9NA 3DL2A 3ZWCA 4D0RA 4BO2A 2F2EA 4GBJA 3ZDFA 1W7PB 4DVJA 1GZ6A 2W2LD 4WCFC 2PFBA 3EETA 1CF2O 1ZBQA 2DU9A 4FDAA 1Q2XA 2CDBA 1B8VA 2W85A 1Q7CA 2YDXA 4KDEA 4HFRA 3VZQA 3GPDG 4XRFA 2FOIA 4H0EA 1H0MA 4F3YA 2I5PO 1CRWG 2HOEA 3NRVA 1NR1A 1O3QA 4FGSA 4GKBA 2DQLA 1P4WA 3WOHA 2RKHA 3ULQB 5G4KB 2YV3A 1SFXA 4Q3CA 2JTVA 5LGTA 1D8AA 3GNTA 3L0DA 2A6HF 1Y8RB 2DAPA 3MOIA 4AJLA 4DQVA 4BOYA 3FPLA 1YBAA 4CMEC 3GAZA 2HMSA 4J1QA 1GY8A 2NADA 5TSDA 1R4NB 4XYEA 4RO0A 5I8WA 1TNSA 3GGPA 4YEDA 4D44A 1IULA 4XJSA 4BNUA 2QRLA 3G3EA 5AXCA 3VDRA 3RI4A 3ICPA 4KWHA 3ITDA 5D5XB 1ONVA 1YW9A 4WLUA 1N1GA 5L7WA 3L4SO 4CMCA 1YS7A 2GZ3A 1SAXA 2Y67A 2JKVA 4YAJA 2A68F 2FA5A 4TZKA 4ALMA 4IDEA 5FO5A 1C0KA 4D41A 4DTIA 5JC8A 1ZZEA 3ZN2A 2DPUA 2VYVA 3HG7A 3DPTA 2FU4A 3GX4X 5G0WA 5U9CA 1A7KA 1NYTA 1MUUA 3GEMA 4HNHA 3AM5A 4L5JA 4HDVA 4ZYDA 3UVEA 2DTDA 5T67A 5K0ZA 3VPFA 2UUOA 1A04A 4RDHA 2IA0A 1YOVA 2DBZA 3MJTA 3PTZA 3ZWNA 1HXDA 2HZTA 5KVRA 3Q3CA 1XDUA 3PZRA 4H3VA 3ON5A 1LX6A 5CDUA 5F21A 2KJCA 4BNMA 5I7FA 2P6SA 4ENNA 3DHEA 2RIRA 3DKWA 3BXXA 1KEPA 3DFUA 4YT2A 2YV1A 4BGIA 4PDKA 1X13A 1A4IA 1H2BA 1HLPA 3DTYA 4IRHA 3CE6A 3DOOA 3EC7A 4OL9A 3EUWA 2NVBA 2X6TA 5C5IA 5D8LB 5ILUA 2YPRA 2A07F 2V1XA 1DC5A 1NQAO 1IHYA 2UXXA 1MG5A 3RKXA 1ZNQO 1LNWA 3F8MA 1LDEA 3AI1A 3NYWA 3OIDA 2Q1SA 2BGMA 3O9ZA 1B59A 1BI1A 2X5KO 4QFDA 3ELKA 5JBIA 5GZ6A 4KT5C 3TDKA 4HA8A 2EV0A 3L9XA 1WDKA 4I01A 3ETEA 1R5HA 2HEOA 4HX7A 3TRIA 4HV6A 3VPHA 2OORA 4CM3A 2XV4S 1CERA 4XKJA 1SD4A 2CD9A 4NHEA 3JQAB 1FSEA 3H5NA 2VOJA 4L4RA 4WF2A 2VT3A 4K1LA 4P22A 3T5XA 4Y17A 3Q9VA 4OIRF 5A06A 2A61A 4HYEA 4OQZA 4L9RA 4R5MA 2P4QA 3T4XA 1KETA 1VKNA 1XWFA 1W7PD 1O3RA 3Q9UA 1NAHA 2HK9A 2PGDA 3V7SA 1XMAA 1Y0UA 3H2SA 1XB4A 1LUAA 3GOHA 3FHZA 1RJWA 3O8QA 5JE8A 4HNGA 4GGPA 4BKUA 4RGRA 4CR6A 2JHFA 4NIMA 3SJUA 3KO8A 1NVGA 1L7DA 3SFZA 1B26A 2HU2A 4PIVA 2O3JA 3PRJA 1TNTA 5F64A 1JDJA 4L4SA 2NS0A 2OAZA 3UH1A 4L9NA 2R00C 2E4AA 1DRVA 1GTMA 3QVWA 1I2BA 3L6OO 3DQPA 3C1DA 2DFVA 3MEXA 2Y75A 2I3GA 2IE0A 3JYLA 3VAZA 4BNHA 2A3SA 1Z6RA 4TRRA 3VH2A 1X3UA 4R51A 4BYYA 2G0TA 1HQCA 2RC4A 1Y8QB 3LC7O 2VBYA 4MEXF 2DT5A 2BF7A 4UV9A 1F06A 1LDJA 1K6XA 2DTXA 4C4OA 3F8NA 2B36A 2AQKA 1KEWA 1RIOH 1G3WA 1NWCA 1Y5MA 2V6GA 3H65A 3KUXA 3OSUA 1FSHA 4WLNA 4HY3A 3ZCXA 5J23A 3ZU2A 1VI2A 5T64A 1X1TA 4B8XA 3AY3A 2FPIA 2KRFA 3GYHX 1SZJG 3IS3A 4TVOA 4G7HF 5DYMA 4DLBA 4CMHA 1U8FO 4D45A 3IP3A 1ZN2A 2DBBA 2I99A 2HQNA 4CLOA 2H6EA 4JIGA 2ZFWA 2C5AA 4A5MA 1VLLA 1WW8A 4NFYA 5DCYA 4RB1A 5DV5A 4CM5A 5B1YA 4EV0A 5ICCA 2Z5UA 1D3YA 3TNLA 3ZN1A 4EJTA 2UYYA 5IXYA 5KK1A 5L3ZA 1U1IA 5A9TA 4CM1A 2L3DA 1UCRA 1QV7A 2XF8A 3WXBA 3LAPA 2VZ9A 1BW9B 1XSEA 4EZBA 4PZJA 3U4HA 3C18A 2VHVA 1UP4A 4FQ8A 3ZH2A 4AG3A 3HIFA 2M30A 2EWNA 2V1DA 2C54A 3KFWX 3LC1O 4IMRA 3BTUA 2FE3A 1Z45A 4P4NA 3ZWWA 3R61A 3ITKA 3UCEA 3OQ1A 1BI2A 1HKQA 1AXEA 1BXZA 3PDJA 4YFXF 4A12A 4Y67A 2E6UX 4UNOA 4GGGA 1UXGA 1ZMOA 1ZXLA 4MVJE 2PI0A 2GZ1A 4XR4A 3K6JA 3IHUA 1PQPA 2GPTA 2JD0A 5TX7A 3TPCA 3U9LA 3QWFA 3K9TA 1ZH5A 4ZGWA 4GLLA 4DNCA 3ZHYA 4TSKA 1S29A 1BC7C 5EJ2A 3NJ4A 1PL8A 2CY0A 5CG1A 1YO5C 2PWZA 2HWVA 1P3DA 1U9JA 2VE9A 1I2ZA 1U7HA 2G17A 3NX4A 3RJ9A 3SLKA 1H9BA 3WWYA 5LHGA 1P2FA 1YQGA 5DULA 5FD6A 4G8XA 4MKXA 3WBFA 2HO5A 1MX3A 4RORA 3E97A 1HYGA 2FPPA 5BNTA 3V8LA 5JDCC 5L53A 1N9GA 4FJ0A 4RLHA 3F5SA 4Y15A 1NR7A 3DR3A 3NT4A 3JTHA 2GN6A 2ZJ1A 1J59A 1ONPA 3HN7A 1D8KA 5CVRA 3R1IA 4GAEA 4RGSA 1R4NA 2NNNA 2XVCA 4P4GA 2WTEA 3U4DA 1Q0LA 3TZCA 3MZ0A 2VTDA 3TFQA 3RDIA 4GX1A 4DIFA 4Z3KA 4U7BA 1MZBA 1TT7A 3JSPA 4IJVA 2JCXA 3I9NA 4ND5A 3VZRA 2DVMA 4M71A 2JCYA 2XIGA 2NTVA 2O6GE 4FJ2A 4CV1A 4GWKA 4BKPA 1YDEA 1BIBA 1J0RA 4E2XA 2JSCA 1E3WB 3OH8A 4WCGA 1J9IA 1ZIDA 5CEFA 2G9WA 1SB9A 2YJZA 1ZG1A 2CF5A 5KWEA 4FOOA 3RUEA 2QQAA 1X15A 2OHXA 3CXRA 4LGVA 1BJAA 4EJVA 4PLVA 4XIJA 5B12A 5JS6A 4PG5A 4A6EA 5TT0A 4G6DA 8LDHA 4J16A 1SFEA 2AXQA 4HLYA 5EINA 2QM3A 2DPHA 2F00A 3UXYA 3WNQA 4B7XA 2ADUA 2POQX 4IUYA 3WYEA 3INRA 3CSDA 1TI7A 2B0LA 3D0SA 1ZK4A 3H4VA 2WDZA 1TBXA 1E7YA 1IE3A 5L3BA 3GZ6A 2Y1DA 2CFXA 7MDHA 1E5QA 2I66A 1MC4A 4J2HA 2Y1GA 3DZFA 1LDKB 4UEOA 2J6IA 2D2WA 5FFFA 4L9JA 1WWKA 2QHXA 3QV1A 2DFDA 3BJOA 5K5QA 1BHSA 2NNLD 3EVTA 1O57A 3LT1A 3KZYA 3WGQA 3ZWAA 2XKPA 4L0YB 1C1XB 1KC3A 4BV8A 1JQBA 4TV7A 3FTNA 4CMGA 3I9MA 4HF1A 2BH9A 2BYVE 2E1NA 2VC0A 3V7RA 1HSZA 4E5MA 2O3TA 3UCXA 5JNLA 1P77A 2RNJA 3F1LA 2R3SA 1AHHA 1UHMA 2QZ8A 1ZUD1 5DUIA 2YV2A 3BMOB 4UXNA 3JQ8A 3QVTA 1QRRA 4BGEA 4BHTA 3A4VA 1UZNA 2EFNA 3SZTA 3GGOA 3RWBA 1X0VA 2GZWA 1U2GA 3ZN0A 4YFNF 1T1SA 3SBOA 3ZV3A 2ZKZA 2Q8KA 2UDPA 1LTHR 4IY1A 5D5UB 2WYWA 4L4XA 3GUYA 2OBNA 4NU6A 5JCXA 3K69A 4JN6B 4WLFA 2OD5A 2GSDA 3PLRA 4J2OA 1HE4A 4FD3A 3TKYA 4E32A 3H2ZA 4RF2A 5G4KA 4RF4A 3DQVC 2ZTUA 4E13A 2ZYDA 2STWA 4K6FA 2OBPA 2GN9A 4A5OA 2ZMEB 3H3FA 4MVJG 4C7JA 3RBXA 1L7EA 1OZAA 1DPRA 2C2XA 2O61A 2B4QA 3LZ6A 4TRMA 5AIQA 1DHTA 3M8FA 4KDFA 1RM5A 3VVCA 3D5TA 3DBHA 4UVCA 1LLDA 2ZTVA 4L8VA 1PJBA 2GWRA 1YL6A 3ZHXA 3I83A 1ZK1A 3I23A 4FW8A 3VOSA 4XYLA 3EUHA 4MHGA 2HRBA 5U4QA 1GD1O 4D3DA 2NM0A 4NU5A 1Z7BA 4BQRA 3ENNA 3F47A 4XYMA 4EJOA 4BIIA 4OQYA 3H9UA 2NU6A 3CINA 4BQPA 4L9VA 4MIYA 3VB2A 1KERA 2OU2A 2X0IA 3T8TA 3PQKA 4IGEA 5I9LA 1LI4A 5COAA 3BMOA 1DC6A 5D4SA 5DEQA 3P7NA 1DAPA 1PZFA 3OECA 3T1BA 4DUPA 3CO7C 1XGMA 3GA0A 1DRWA 4YAGA 1ZRCA 3I9KA 2QQ9A 2NWQA 4PCVA 1NQ5A 2Y68A 4O6JA 1ULUA 4RQTA 5BPDA 2EW8A 1XELA 1QYDA 3U3XA 4BHCA 3QU3A 1T2CA 1H6CA 3U2RA 4AIHA 1KC1A 2Z5LA 4IQGA 2HTJA 3R0JA 3RKWA 2AQ8A 1LRJA 1P1HA 2VRCD 3L77A 4HFNA 4QSMA 3SJ7A 2OP0A 2GASA 1LQ1A 1YB5A 4RPKA 5L7YA 3G1TA 4I5EA 1IN5A 5DNAA 3MFKA 1ARZA 1SC6A 2H27A 3LDHA 3J80K 2P9EA 4PLCA 1X0XA 1B7GO 4EGZA 2R00A 5LGUA 3JQDA 1QMGA 1QXSA 3OM9A 4CQLB 2OZUA 5LBQA 1LJ9A 3C3WA 2C5EA 3ZGYA 1T38A 3H7AA 4HP8A 2RBEA 1EVJA 4AJ4A 4CMJA 5LCXA 2DTEA 3SC6A 1ZMTA 1JKJA 4U8GA 4ENJA 1T0FA 3FN4A 2G82A 3L9FA 4BNZA 2ET6A 3TOBA 3FMRA 4KMFA 2VWGA 3PDUA 3KYCA 3FR8A 1YOVB 2FZWA 2P7CB 1DLIA 4XEHA 1HE3A 3JD4A 4CQMA 1YB4A 3ETGA 3QVXA 5FFXA 4UUNA 4HZFA 5JVTA 3P2YA 3PYLA 3H3ZA 3FBGA 5KKCA 3UICA 4CPDA 2OQRA 1F8FA 3D4NA 5JHUA 1M6HA 4XGKA 4ROSA 4AJIA 4CQMB 1H9GA 4OIOF 1HYEA 1ML3A 2FRDA 3E82A 4M86A 5A3JA 4IPAA 3ROUA 4RQUA 4RZIA 1KS9A 4G94A 1YDWA 4I98B 3VZPA 1XGSA 5CDGA 4PLFA 3TDUC 4GKVA 5A03A 2B5WA 2VE8A 1NHAA 3ZMUA 1XDWA 4TMFA 2VT2A 1BDMA 4YPOA 1GHCA 4MVJF 3AUUA 1K3TA 4JBHA 5AXDA 2J3KA 2O48X 3IQDB 4D46A 4MINA 1HSOA 2OMEA 1HSTA 3F23A 2WV0A 3KRTA 3H6KA 3KP4A 3ZMDA 1VTNC 2XPCA 2ZQZA 3JQGA 3RC2A 3UF0A 5I7SA 2TMDA 5CLSA 1C1XA 4KWIA 4W99A 2CYYA 4G81A 3OF2A 1PUEE 1UXIA 2BGKA 1DLJA 3AFMA 3FSRA 3HJAA 1PTJA 4HX4A 1EBFA 2Q1TA 4XDYA 3T7CA 1E3SA 1YL7A 1U7TA 3JQ9A 5H83A 4LLGF 1J5PA 2UVDA 1ULSA 2JPCA 1Z7EA 2GR9A 1O6ZA 4FIZA 4KA4A 4B3HA 3HE3A 3GVHA 1T2DA 3LA7A 4H16A 4OKIA 5JMWA 1P1RA 3O8QB 5CG2A 5BS6A 1NQTA 1TEHA 2BV6A 3CJNA 4WASA 4YG2F 3L2CA 5KCZA 1CF7B 3QQPA 4FBGA 4GYIA 5A04A 1H0KA 5CEJA 4PLWA 4KP7A 3DMYA 1TW2A 1W6UA 2EFQA 1U5CA 1WZIA 3WMWA 4N9HA 3INTA 4AL4A 3KZZA 4WWCA 3WYCA 3G49A 2RH4A 4Q3NA 3RYRA 3HB5X 4S3MA 1GV1A 5BNIA 3GVXA 2J5QA 4YJHB 2FOKA 1P44A 4JJFA 1I5RA 1RZ4A 4AJKA 5L7TA 4LRSB 1RYEA 3IWFA 3BPVA 5IZCA 4DWVA 1Q1NA 4CM6A 4AJ2A 2VOPA 3MZYA 3UKOA 3MWEB 4OSOA 3VDQA 2DAOA 3ASVA 2NVWA 1QG6A 2G7HA 4NQWA 4JQCA 1IF1A 1SCUA 1BMDA 4YT8A 4UAGA 5COBA 1DPGA 2R6JA 1P0CA 1EVIA 2A92A 1A71A 5HWSA 4U0JA 4A03A 5L51A 2MC3A 3TZ6A 2WWRA 1WKMA 1NM5A 1JTVA 4YXFA 1T24A 4GMFA 1X7DA 3TSCA 2IXAA 3JYNA 4KQXA 1FOKA 3BMCB 4EEZA 4HQEA 3OEWA 3LAJA 1ZK0A 2Z95A 3AOEA 3Q9NA 1ZEMA 3OJOA 4NI5A 4HFJA 4YJDA 4HF2A 2Y66A 4GXOA 3NT2A 4OM8A 4M9SA 2CDCA 2AEJA 3FNGA 3I64A 4Q5SF 5FEUA 1GEGA 3PK0A 4HFMA 2NRAC 3W1VA 1WMAA 2PH5A 3ZWXA 4RB3C 3LT2A 1NFRA 4OGWA 1P31A 4KUMA 3DO5A 4YJFA 2ZJ2A 4UVAA 1PQWA 5L9AA 5FLXK 5GZ3A 1LC0A 2JHGA 2CMDA 2MBFA 5TRDA 4X54A 4OIMA 3BIOA 4GWGA 2YX4A 1ZLJA 3F3XA 4U88A 1GUYA 3PVZA 5D4RA 2IZ0A 1VL0A 4RAYA 4PRLA 4R16A 3JQAD 4J3FA 5L95A 1E3IA 5TS3A 1ZW1A 3LVFO 3JQBA 3NGXA 2ILTA 1E3EA 4WEOA 5JCJD 1HDXA 3RUAA 2F5CA 2IVMA 1E0DA 4IJAA 1V6AA 3JTMA 3LF1A 2BGCA 3GDFA 3Q11A 3RU7A 1ENYA 4RL6A 1LDNA 1BM9A 2Y0CA 4XQ9A 3KP7A 1R5GA 3BDDA 5DCMB 4RVSA 5I9MA 4R1HA 1JXSA 4U6SA 1PL7A 2XAAA 4YIIA 1KYZA 3PQFA 4QQRA 3MWDB 5ENDA 3IJRA 1JWAB 4E2YA 4E31A 3L4BC 4P8RA 4YJFB 3S1LA 4EJUA 2H09A 4FPXA 4BNNA 3ROQA 3ONDA 4BNFA 3MZHA 2G76A 3ML6A 1FF9A 3S2FA 5ILGA 2IDZA 4P38A 5TNXA 3KE2A 3SHFA 2NACA 1R6DA 1R15A 4II3A 2GA1A 2VNAA 2B83A 1H9AA 2VTEA 2ZIZA 4YJGA 5JDIA 5H82A 2Q2VA 1MFPA 4AJNA 2ETHA 1WVGA 1R23A 3EDPA 4QWQA 3V7CA 4RDIA 3GEZA 1ADCA 2YFHA 4BO4A 3JAMZ 1S7CA 2PZKA 3EMKA 2B4RO 1XA0A 1F4KA 1J6UA 4CMBA 1MP0A 1AHIA 4NJMB 2X0NA 4R9SA 1BOAA 4FGWA 1FY7A 2X5JO 4PG6A 3R60A 1LJ8A 2NQ8A 3NUGA 1E7MA 2DUUA 2A6EF 1OPCA 1UAGA 4J49A 1C0LA 5TJHA 3ONFA 4GYGA 4FB5A 1KU3A 1IUYA 4EM1A 4WUVA 2HR3A 4BNCA 1GCOA 3IIEA 1HDOA 3HUGA 4ZJUA 2QRKA 4IHSA 5ER9A 5F1PA 3W8FA 3QSGA 2J3JA 4N0BA 5JY1A 5B4VA 5DCMA 2FN7A 1BC8C 2GUGA 2V7PA 1DHRA 4LFUA 1GEEA 1BG6A 2BFMA 3DBVO 2JCVA 2PZLA 3QIVA 3HSRA 4AJEA 2J8ZA 4BB6A 9LDBA 4RB2C 3C7DB 4BAYA 1DRUA 2X7HA 2RAFA 5JMPA 5IFLA 3GZ4A 4R69A 4QUKA 3JCZA 1N9GB 3RUIA 3WTCA 3AM3A 1T4BA 4XSZF 3WDSA 3REOA 1S7AA 1HTBA 3VC7A 2D4AA 1ZRDA 1OOEA 2PV7A 5BSGA 4XRGA 4ZICA 3F4LA 2VQ3A 2Z1MA 1YKFA 2VCYA 4MKRA 2L4MA 2VYND 4YQYA 2L02A 1V3FA 1VE9A 4MOWA 1XU7A 1ORRA 4YRAA 1JAYA 1U5TC 1KY5A 3M1LA 4TROA 1V8BA 1VL8A 4M73A 5F6FA 3BMCA 3PHIA 4HKTA 2GAUA 2RHRA 3H8VA 1YQAA 4NPCA 5E1WA 5JAIA 5ERIA 1GFSA 4IMPA 2J5OA 2HRZA 3JD1A 1R0LA 3D3EA 5A05A 5L4SA 1HDCA 3P9IA 5T8KA 3IRQA 4L74A 2ESNA 2HJRA 3QOPA 3IJPA 4J1SA 4U0VA 5EEGA 3QVOA 1GCUA 4W7HA 1LB2A 2AXLA 1EZ4A 2CGPA 3ZWVA 4B7UA 1JW9B 2QLZA 3RC9A 1UDBA 3BZ6A 5DF1A 1OR7A 2K27A 2GZ2A 1XQ1A 4XQCA 3CTMA 2O23A 3EK2A 3K92A 2A9FA 2A5YB 3U62A 4HF0A 4D43A 2CSOA 1EE9A 4FX0A 3KZVA 5DBFA 4IM7A 2JFFA 3RCBA 5JR3A 4MNUA 3RBZA 1W5TA 3WGIA 2MA3A 2MD5A 2VC1A 1IRFA 2DU8A 2AG5A 1NAIA 2COMA 4JGBA 3U5TA 4OO3A 2PD3A 2JJYA 4H15A 1PEDA 2RQPA 1TA4A 3VZSA 4E6PA 4YYZA 2C7VA 5HDGA 2LKPA 3GMDA 3JSAA 1FWZA 4U6QA 3S8MA 3ZV6A 1I2CA 3TDZC 1E77A 3QA9A 4ALLA 1HZJA 3LLVA 2WSBA 4R3WA 2JFGA 3GFBA 3DP7A 1ZHFA 4YCAA 3P9CA 3I3OA 5E1ZB 2VN2A 2FSWA 2KIUA 2P6TA 3GFMA 1D8JA 3FTPA 1IYZA 1PR3A 4XYBA 1SBYA 1FPQA 3LQQA 5IDYA 3K9QO 2E1CA 1Y9AA 2D5AA 2ZQYA 2J5RA 4N18A 5HVQC 2O50A 2V6MA 5F1KA 2I6TA 3W6UA 4AJ1A 1QKIA 5G0TA 5THKA 5FWNA 3PJEA 5I9NA 6ADHA 1I3NA 3VKUA 1LSOA 1XR3A 4ID9A 2WTBA 1U3UA 4AJJA 1TW3A 2GN8A 4RPHA 3L09A 3UGKA 4DPKA 3HDQA 4AD9A 3E9MA 5U1PA 3WLEA 1GQYA 4N9IA 1VKOA 5DDGA 3HTSB 4B8WA 4FC6A 3GO5A 2WC2A 3TQNA 3ASUA 3DC2A 3OJ0A 4HX5A 1ZK2A 3VTZA 4BNKA 2PLYA 1HZZA 3W8DA 3B02A 4HDUA 1B9NA 2R7DA 4OXYA 3IMFA 2ZB4A 3G73A 4DGSA 2NUAA 1AOYA 4CM4A 3UCFA 2Z1NA 4BV9A 4EYEA 2HMUA 3SXPA 2HK7A 2EKQA 1Z1DA 2BI7A 3WQSB 4A2CA 4KICA 3KP6A 3JQBC 4DXHA 4CQLA 2QG4A 2IP2A 2C59A 1YBMA 3C24A 3GNQA 5AONA 1B15A 4NJOA 1I1GA 5ICGA 1X14A 1YL5A 2LSOA 2PGLA 2W90A 4IQ8A 4BL5A 4BMNA 1UZMA 2IYOA 2EJVA 4GMGA 4QFCA 3KTDA 4WCFA 4BNTA 3PFFA 2PK3A 3ABIA 2BMAA 4D0SA 2VWHA 4WGGA 1B1BA 4LMYA 3AWDA 1B3RA 1B8PA 1DC3A 1GZ3A 3NKLA 4OMZA 3GF2A 4OOFA 4F6LA 4DC0A 2CW0F 3HYIA 4I5DA 1QSGA 4E12A 5DBGA 5EESA 5A9SB 1K2WA 1CEQA 4EGYA 1XSXA 3OJFA 4NNJA 4E5YA 3OQBA 2I67A 2M8EA 5AXBA 5I8ZA 2E48A 5CAEA 2NVUB 4IJWA 2ZTMA 4UEJA 3CMCO 4MVJP 2YFQA 3BPXA 2GERA 1D1SA 2Q45A 3W6ZA 4OXKA 3JQCA 2ZO4A 3WNVA 4O63O 1ZSYA 3GVAA 3NV9A 1LSJA 2D2IA 3PYXA 3PEFA 4FFRA 2I3AA 1R66A 1F0YA 1T2AA 3EYYA 3TL3A 4AIKA 4CUKA 1KGSA 1U5TB 4LISA 5KVSA 1Z73A 5LRSA 4MJLA 3I53A 4ZYEA 5HS8A 1VSVA 3UW3A 3WGYA 3G3ZA 2PMHA 4WLOA 3QHAA 3RROA 3N58A 1DFHA 2G5CA 4J1TA 2YY7A 3EW7A 3SEFA 2M1BA 1W5SA 3OIFA 2BFPA 1SD6A 4BMSA 2ISYA 4CJXA 5IDQA 2OOSA 3LA3A 2B69A 3FHLA 3WSWA 1PL6A 2H63A 3PWZA 4YAEA 3BMNA 1WP4A 1LNQA 2O3RA 4YFKF 3K2EA 2MLGA 3AOEC 1V0JA 4P9UA 4II2A 4CLOB 3RUDA 2GLXA 2XASA 3EYWA 2FP4A 4G2NA 4WNCA 1MDMA 3IUPA 1NVTA 4CLRB 5HRUA 3ULKA 1PSDA 5A9SA 4KTTE 1WSUA 4K6CA 5DOZA 4O1MA 4LN1A 4UEKA 5EERA 4OH1A 4UUOA 4YJHA 5T8KC 2FMLA 4O5VA 4DBZA 4CM8B 2XXBA 3GFGA 3UAGA 4ESBA 5L3CA 1Y9EA 2PD6A 3BZUA 3DZKA 1GU7A 1HYHA 1E7RA 2BEOA 3V8KA 1E3LA 1GDHA 3FWNA 5IZCC 1B2LA 2OGUA 1QORA 4KN7X 4Q9NA 1PGJA 3L07A 5B4UA 4UREA 3DTTA 3I4FA 3ZWOA 3PJDA 2KKOA 3HRMA 1V9LA 3CMMA 1ZJYA 2VYVD 3IC5A 4IDBA 4JBIA 4EMSA 4ZQFA 3RC7A 3U4CA 4B4WA 4RVDA 2IA2A 1NQOA 1ZKMA 5BSHA 1GAEO 4KN4X 2PLAA 4JROA 3AOGA 3HUDA 1RNLA 2VZ0A 3GR6A 2FR0A 3ETDA 4XRRA 2OZ6A 1YJQA 1BSVA 1Q0HA 4XYGA 2HSDA 2O0YA 4A27A 2PA3A 4U0YA 2P2SA 4RV9A 4HV4A 4QX6A 3ABUA 1UXJA 3CIFA 4A5NA 1XCBA 2JT1A 4MQVA 3WYBA 2Y0MA 1QYCA 1YE3A 4IIUA 3WJ7A 4PGGA 4ZYGA 2HQ1A 3K1MA 1D1TA 2DFIA 4UVIA 3U9GA 3LU1A 1RPNA 1ODDA 3FMSA 3JTGA 5ILSA 1WDLA 1BW9A 2XOXA 1E7QA 1TQPA 3FRJA 3ZNPA 3FNEA 3G17A 4OU0A 1ADGA 4GO1A 3ADPA 3NT5A 1GYQA 2AQIA 1ZLKA 1JU9A 4IIVA 5G0SA 3EVNA 3GUCA 3LK7A 5L3DA 5JCJA 2QIOA 4RLSA 4ALIA 4CM4B 1SD5A 1IXRC 3TO7A 5LDGA 2HKXA 1ZJZA 3PHLA 4KUHA 4LVUA 4E5PA 5AQ1A 3Q2KA 4BO6A 2CG4A 3WGHA 1EFKA 3P2OA 2MLKA 1E3WA 3PZBA 1DFGA 3GNSA 1HW2A 2YSRA 3E6CC 1XG5A 1EQUA 1E1LA 3FWZA 3JD2A 4GL4A 4P96A 1J4AA 1FZPB 3JYOA 4OKNA 4DC1A 1FJHA 1N7GA 3I54A 1LDDA 3GFJA 3WTSC 2A94A 2IODA 3DXFA 4FOSA 2KJBA 2WEKA 1FP1D 3KLPX 3R3JA 4RGBA 1A7AA 1C14A 3KHUA 4WK6A 4MPDA 5JAQA 3GDOA 3PQEA 3EYIA 4B3JA 2HUNA 3KB6A 1PZGA 2ZYGA 2YUTA 1K78B 4Q4ZF 2Q2EA 4KMSA 2XAGA 2FBHA 2IRFG 3H9GA 4YB8A 3AI3A 1DBVO 1ZAOA 3N74A 4NBWA 3HHPA 3I9LA 3WGZA 1W4MA 1M66A 3I6IA 1FDWA 4GCVA 3O03A 3QRFF 1DXYA 2RDPA 4HX8A 1I3LA
chains in the Genus database with same CATH superfamily
1BBYA 1EIZA 1P9WA 1LFDB 2DA5A 2FUG1 2IXGA 2WM3A 2X0KA 4FMCB 2RI6A 4HNAA 4Y1RB 3EBOA 2W8BB 4QJBA 4YXWD 3S1SA 1E1RD 1P74A 1WSDA 3DV8A 4UULA 3RUHA 3GH1A 4C2MJ 1K8XB 3GUUA 3K5IA 5A5EA 3T3OA 3AJ8A 1WHSB 2HSWA 3ET4A 3IDZA 2A5DA 5G3YA 4EITA 1XRMA 4Z4QA 1FX7A 1T5TA 3T34A 3VOTA 1EFVA 3I28A 1UB9A 1ZL0A 4FYYA 4BJHB 4L2IA 1DV1A 2XVAA 1LFAA 4JI5B 2DI3A 1V7ZA 5DHRA 3D7LA 3DU5A 3C5VA 4OOIA 1OAKA 3GRUA 4RWZA 2JMWA 1I1SA 2VHWA 1C9YA 1NC1A 3TTWA 1FVOA 5CB4F 1MOPA 2FPKA 5CA0F 3K4MA 4EO7A 5TLSA 3FJ1A 1HA3A 3L6UA 3TQTA 5KNBD 3ZCTA 4BFYA 2HWUA 1MMSA 4F5EA 5BV7A 4BE2A 1GADO 4GQIA 1VYVA 3VU9B 4UDNA 1NPYA 1TQ6A 3E9NA 3PNOA 1GQFA 3UTDA 2G6TA 3EDMA 3WG7H 3G59A 3TWOA 7REQB 2VPXA 2YN0A 3L8EA 5A5FA 3T0IA 2QORA 3WHIA 3IV9A 3LLUA 3OCYA 3OMWA 3JD0A 4DAOA 4F5WA 1II0A 4NJEB 1S01A 1ODTC 5LQSA 3TZQA 4KXQA 2C4NA 2O4CA 3EZXA 2F43A 1XXHA 1O5IA 4PVCA 4GQBA 2XHKA 4WVLA 1YF3A 2A1TS 4TT3D 1L5SA 1SOVA 4E33A 1VQOI 1R1VA 2OBMA 4CXFA 3KQMA 2XYHA 2CW5A 5L40A 3OKFA 3ZTYA 2CEAA 1JDBC 1UEJA 3ZWPA 2H2FA 1GV5A 1XRSB 5LMNB 3OTIA 4CKZA 2FF4A 1VJCA 4MGHA 4FUQA 4OU5A 2B82A 2VDLB 5DLEA 1T4MA 4J29A 2FF5A 3AF0A 3CB2A 4HATA 5F9FA 2VRNA 2OHFA 1K5GA 2QP3A 1P6XA 5E8IA 2EARA 3LUKA 2VJIA 1J49A 1DWQA 2H9AA 2BHTA 4MVWA 3CLUD 1T29A 1HLDA 4UVBA 5E2AA 1UBUS 3OTHA 2OV4A 3TM5A 4DIKA 2O8FA 3SQNA 1I8TA 1DARA 1AKRA 1SWWA 3ZQCA 1WZCA 3R24A 4Z1MD 2V79A 5ICMA 4L5AA 2FXIA 2WTUA 3IKVA 1TQIA 1DAHA 1OASA 4UVHA 4MARA 1HV8A 1NXQA 4RAQA 5FKMA 3IIKA 3QV2A 5IK2A 5TARA 4OM7A 1N77A 1DDIA 2PKRA 2O8FB 4D97A 3KALA 4EJMA 3I1IA 2VKQA 1EMDA 3AUXA 5CXXA 4CL2A 4U7PB 1R22A 1POGA 1FU7A 1WMFA 2AFHE 2HNBA 2JASA 4B3CA 1YVDA 4IOLA 2O4UX 4N5IX 4AXBA 1OC4A 1Z7LA 1JZQA 4DDWA 2DPGA 2KE5A 4H08A 8ATCA 2PZGA 4IQ4A 3SHOA 5CDHA 1DIAA 3QE9Y 2FEOA 3W78A 4Q5IA 4UM8B 2QI9F 3TOAA 3DHYA 3FFTA 2HOTA 3EPJA 4RFSA 1F2VA 4KIBA 5LHHA 3MT7A 1XFAA 5EVJA 2ZRKA 1RBZA 4Z0PA 3RGGA 3PD1A 2IWRA 3WRYA 1JHXA 1RQPA 3MJSA 4IVPA 4M55A 3K1TA 3WBJA 5K4HA 3U19A 3WU1B 1A72A 3PPXA 5JH7A 3N07A 1WPKA 1MT0A 3NDJA 4EEXA 2WYOA 3G0OA 2JA1A 2BZTA 1KK3A 2JIDA 3EXHC 4X8MA 5KTKA 1T9HA 3RDPA 2B0CA 2WRZA 5JEDA 1XN7A 2C07A 3KEGA 1EEHA 4JBWA 5C37A 4ZMSA 3WSVA 1JMYA 2G77B 4Q1BA 2HYJA 5JXGA 3GLIA 3BXPA 4X44A 3VNAA 2FUEA 1N0UA 3C6YA 2JATA 1LEBA 1TYAE 2EIMH 3WTXC 2MSCB 3E58A 2IYTA 3PITA 3SJBA 5GY7A 1O8CA 4R7ZA 4PLYA 4RGXA 5D3ZA 2EHDA 2G04A 2NIPA 2I1LA 2VXDA 1KBZA 1N6PA 2FUKA 2R68A 3AFNA 4JL8A 3JR7A 5A2QK 5H81A 4BZWA 4E11A 4LV5B 1DC4A 1G1AA 3U4QA 5LZ5A 1NRIA 3VJMA 1XT6A 1HC7A 1P9LA 2CL5A 2RMKA 3Q0TA 1TJYA 2XWJI 4BE0A 1K7EB 3EEBA 4DY6A 4JYZA 4PHFA 3KR2A 2GHQA 4YR9A 2YXNA 3VZBA 5CPFA 2AC4A 1C0IA 2QUBA 4G5OA 5LQCA 1FTGA 3JQRA 1DU6A 5CVUA 1P1IA 2CDAA 1EFDN 2IW1A 3R3WA 3PGVA 1T3SA 3AYZB 4FWBA 3G6EI 4G4JA 4H6VA 3HRSA 1DOHA 4X93A 4B2IA 1M1EB 4MUBA 1BCRB 4Y9RA 1X87A 5FKLA 2HSGA 3H04A 1P3Y1 3CZ6A 2EZUA 4H1VA 5B37A 4YUWA 1M1UA 4HOBA 1WZEA 3CRRA 1X3SA 4QPPA 4CZZA 3I0ZA 3HJGA 4Q9KA 5DXAA 1OBFO 1PT6A 4BNGA 1CUCA 4Y3OA 1I0IA 4L8YA 5BPHA 2LWIA 5C46F 2UWMA 1U1CA 3DJFA 3EF0A 1Y1VJ 3RAJA 1USUA 4OSEA 4RDUA 5KJCA 2DHDA 2KPMA 4E1VA 3MWMA 1O58A 4LRYA 4BVKA 4RF3A 3PFIA 4EAAA 1TM3E 3AFOA 1RC9A 2V9VA 3DEZA 3ACCA 1CVLA 4P5OA 1TYDE 3HB4X 4MI9A 2IHVA 2NO1A 1Q1QA 4BIMA 4YROA 1GT6A 1TCBA 2WZDA 2BJWA 1FB5A 5IYZA 1GGVA 1U8ZA 3OPVA 3PI7A 3OICA 3ZH9B 4FSHA 2L0KA 2PZBA 4G26A 2NSJA 5CTAA 5DK4A 5AVWA 3FPCA 1ZR2A 4X5OA 3ICEA 1AMNA 3PEWA 3RNOA 3KYDB 1M8KA 3H9EO 1XGNA 4H7PA 4Q3DA 2EFWA 1SVLA 3I5UA 4JC4A 3B73A 1DL5A 1PFKA 2DR0A 1GKIA 4PLTA 3S1AB 3UJCA 2O6LA 4UVDA 4YRDA 2ZWOA 1NG1A 3F3SA 1XMSA 3NDIA 3ZHBA 5AJZA 4Q47A 1IPEA 2ZOSA 3IKLA 3TIIA 3KM0A 2ADMA 3ND6A 4KR6A 3F9CA 4MQBA 2GAFA 1L2TA 2OTCA 3UJ6A 1YJXA 3DBRA 4TN5A 5FV7A 4ETMA 1QIKA 1STZA 4MR8A 4PF1A 1KI6A 5CP8A 3RYHA 3J7AO 1VKZA 4G5XA 3QBTA 2QVLA 2LK2A 1RHJA 4IIHA 5ELLA 1JJ8C 1G6OA 1G2PA 1ONNA 3JV7A 5A6SB 4EY4A 3AJRA 3H5IA 4EARA 1IZYA 3E3VA 3IIIA 3T4UA 1Q50A 3AB3A 1U99A 3E0JB 3GN1A 3H11A 1YU6A 4FMCF 1CXZA 4O4LA 3B1VA 4YCDA 2XXJA 4JYMA 1CB0A 1KU9A 1YR6A 4LBYA 4X91A 4LXQA 4R6WA 1I10A 2ME0A 1HT1E 1VECA 2DX7A 2IDMA 5UKDA 5FBKA 1B72B 4RTMA 1LPQA 3O47A 3P27A 4MI3A 5GPCA 3LKDA 4HOYA 1HH4A 3ZGVA 1X1EA 2X48A 3BSFA 3EOBI 3ZHUA 1TUIA 2XUOA 4HDNA 5AVQA 2H08A 1XCVA 2DWQA 1E66A 2W57A 5IYDJ 1DC7A 3D81A 5HX7A 4N7MA 4YRBA 3KSUA 5JE8A 3TLMA 2PZJA 4D4LA 4ZAFA 2NO7A 4CKBA 1VQ6I 4CICA 5J47A 1B8UA 2YVLA 4RGUA 1SCBA 4P9FA 3HRHA 3MT8A 2H2DA 1EWTA 4LIUA 3TGNA 1NP6A 2O9JA 3TG2A 3GOQA 3W6OA 4DZPA 3E8XA 2DCEA 2NG1A 3P5SA 2C8LA 2F64A 3HFRA 2UV8A 3JQ8B 3IUOA 4N4NB 3TLBA 2HF2A 2O0KA 3WI7A 3COZA 1T6NA 2EV6A 3UNGC 4L15A 1Z47A 2WIAA 1OF1A 2ES4A 4NZPA 4F1JA 1MHTA 4F6RA 3CYFA 3ROXA 1RUNA 2QJRA 4ZPXA 3P5JA 4OHUA 4J0EA 5A4FS 2QKYA 4TPKA 1G60A 1YBFA 3Q1LA 3SY8A 3L2WA 3ZIAA 1XZMA 1F36A 1C0PA 2LIVA 2NTJA 3I71A 2PPVA 1HL3A 5JC1A 4A27A 1G6HA 2R85A 3D4OA 4OP2A 3BHMA 1XEXB 2DPYA 3AR5A 1JKXA 4YRCA 5DNDA 4IMJB 4MVJA 3ICQB 4HNQA 2X2PA 2ZXWH 4ZHSA 3E9DA 2FA9A 1RWNA 1CKEA 1RYBA 2QUAA 2CJYA 3L41A 4Y6LA 5KAMA 3TPFA 3MQ2A 2Y9ZA 1Y1TA 4M99A 1ZM3A 5EZYB 3BEOA 4IYRA 5JFTA 2F5EA 2HOAA 3FCOA 5E95A 1Y7HA 4GLBA 1CUYA 3ZIAD 5L6MB 1E9RA 2IY9A 1WXWA 3EEOA 2A30A 3E3OA 5KKNB 1VHQA 4XTRA 5AXAA 1NE7A 2XUJA 4M0LA 1SMTA 2BE5F 1F43A 3DE3X 2A69F 2G9NA 3WGJA 3TUIC 2EG9A 5LMZA 2ZRIA 4E5VA 3ADOA 4OUDA 2V0CA 4FJ1A 4ZAWA 2P40A 2LKSA 1PFGA 2GNOA 5HZMA 1NVXQ 4HADA 4PIMA 1CULC 1PVVA 4C03A 2A9RA 1VSUA 4Q6BA 4CWAA 4NYMR 4QOIA 3BD9A 2ECKA 5BWNA 1I6WA 2V7XA 4M54A 3WLOA 1Z3IX 2RVCA 4H4CA 1SCJA 1BW5A 1LVHA 1DKLA 2QSFX 4CYCB 1E9CA 3CU5A 3LUBA 5LWHA 1NQUA 1E3JA 1S3FA 1H1LA 3HWSA 1BFDA 1EGQA 3PNTA 2FFAA 3JWPA 3VHXA 2WY7Q 4DM7A 5CEEA 3ZDDA 1D2EA 1MG0A 3TQSA 2GSWA 1PYDA 5JWOA 3DFZA 1IAWA 2R0QC 4ZAXA 1Z9CA 1GNQA 1M2EA 3PKZA 2FLWA 1IZ0A 2BKAA 2JB9A 3FCEA 1X19A 2PEYA 1BVYF 1C9KA 3KUCA 3QF4B 3IOCA 2YRXA 2H65A 3IQXA 5B3AA 3D2CA 2GF9A 2AMLA 3EQLF 1ZRSA 2QTVB 3FUTA 4KMRA 4YMIA 1RVV1 3HDGA 1PNQA 4E2ZA 1L0OC 2MC4A 3DKKA 3FYHA 2G63A 4U2FA 2Y76A 3PWSA 4NEGA 1HG1A 2O1SA 2NNYA 3LY8A 5CLJA 2X6QA 4H17A 5GIPE 4KDRA 2ZYHA 2R66A 4EGFA 4O5AA 1BKYA 1JGSA 1V3VA 2EX0A 1BR2A 4MV7A 3UAZA 3K1AA 1QHHA 2NV0A 1EFRA 3FHJA 4NJMA 3TRDA 2G7UA 4BNJA 1FT9A 2C2OA 3BFKA 2G9QA 5HK9A 1NSTA 2XTAA 3TTTA 1GARA 2GTPA 3QKRA 3ANLA 3ZRGA 3H35A 4Y9TA 4AM8A 2F1HA 1BGXT 3HOVJ 3TAXA 3QPTA 1PU2A 4O3MA 1VL6A 2ETXA 2X76A 3W3CA 1QA6A 4FHEA 4D7NA 2CLFB 4HBLA 3QP9A 5IULC 3S1RJ 4MULA 1YIOA 3I1FA 3RJ5A 4QD3A 2ZNZA 1O97C 3OPMA 4QECA 5EIOA 3RKYA 3OE7D 4YDQA 5BQOA 3LVBA 1GYPA 1U2WA 4H4KC 4MV8A 2QX7A 3OA0A 1WPRA 1T36A 2X77A 2X6RA 2ZGVA 4NDAA 4EI2A 1U2DC 5K0GA 1O3TA 1QG4A 1BN5A 4RYDA 1ONOA 1QB7A 5K03A 4UXHA 1ISMA 3I6BA 3I2KA 2NU9A 4QULA 2P5LC 5CIYA 1BMQA 1RYHA 2BC9A 1F1ZA 4A3LJ 1LRLA 1DQUA 2O14A 2RKWA 4I66A 4KWEA 4FCCA 4CA0A 2P9GA 3ZCSA 4CF3A 3KEOA 4IH4A 2O03A 2CLKB 4S04A 4TLEA 3E5QA 2W7NA 1HOMA 2JIZD 2QTHA 1J39A 2VJYA 2WJPA 3MBKA 4OXNA 3HZJA 1K7AA 4P4LA 4PYIA 2QYOA 1W4LA 3GX1A 3NWEA 1HEUA 2GPBA 3MWFA 4IGIA 3T35A 1SFUA 5CDTA 1UBFA 3DLIA 3VV3A 2NYUA 2KWIA 2XTJA 3W3AA 1U1GA 2H0AA 4NENB 1NBMD 4WN9B 4E7LA 1AZSC 4D8TA 2EK5A 1J24A 2XKAA 2J3LA 2IH5A 5HS9A 5C9ZA 2JH8A 2H94A 3CISA 3WLQA 2DA1A 2WIBA 2BFEB 3U7RA 6GPBA 3DPLC 2NAPA 2PG3A 2IT0A 1NW9B 3KHKA 3H6GA 2W1OA 1WB4A 5A1JA 4GPD1 3KPJA 3W4KA 2LKCA 3MG9A 1ISPA 1QOQB 3G6WA 5FH9A 1K27A 1T6YA 1I4EB 3VR6A 2XROA 1B9MA 3DFGA 1E17A 1GYRA 3PD7A 4OHFA 2GLUA 1RR8C 1T5IA 2G8LA 2K7ZA 3KLMX 3LSPA 4FQ5A 4WK2B 5E6RA 3U9SA 2QL6A 1GU0A 4QTUB 3ENWA 5SY9A 4F8EA 1LPOA 1VE6A 2NU7B 3KBOA 1TTYA 1PS9A 4LG3A 3HB7A 4CDRA 1CR4A 1EA5A 4B1RA 1IEQA 1NLMA 1Q0SA 3BBPA 4H7KA 2PQ2A 4RKFA 4MDFA 1WQ4A 3I4CA 4AVYA 2D8AA 5K4GA 3MAGA 1X7YA 4L73A 1T8RA 1XJCA 1RI7A 3COAC 5HUQA 2FG6C 4K9LA 1P4AA 4OXRA 5C34B 4BCBA 4HH0A 2V1NA 2VBWA 4DNOA 5C1BA 4XLAA 1D6SA 3K35A 1P0IA 1YZLA 1JJIA 1JQLB 3OPYI 3SEAA 3SQDA 2QX6A 1PUFA 4D81A 2GKSA 2ELHA 1EDOA 4CL8A 5FA6A 1HF0A 5CFMA 5AVKA 4N6NA 1CETA 4RNCA 3LXXA 4KQCA 4BMYA 2P0EA 4PGFA 4Q66C 4AJHA 2I71A 2VPQA 1UM9A 5DNVA 3PLNA 3SYRA 4DCJA 3M1AA 3EJWA 3VKFA 2Y30A 2O8BA 3IPAA 4GMXA 3STHA 1W25A 5K6AC 4OMUA 3LBNA 1FYWA 1UBTS 1PLJA 4GR5A 4BGVA 3CCVI 2HA6A 3B60A 1CUJA 3FYDA 4F38A 1UBHS 5C8YA 4MWZA 3ISVA 2KYRA 1W0JA 1BS1A 4GOKA 2NXNB 2EF1A 3D1JA 4ZCIA 1L5KA 5KWJA 1FFXA 2W22A 3G2LA 2GAOA 2ZVQX 4K28A 2BZ1A 4RGQA 1VC2A 1Y8QA 4TMTA 1KAOA 1UDAA 1Q7GA 1VSTA 3LT5A 5F1OA 3V7NA 2XPUA 4RMIA 4DA9A 1FP2A 4KNYA 4EPVA 2YWRA 2AH5A 2P4HX 3P45A 3VSDA 5HIAA 5JSZB 5JATA 5IWAB 4L57A 3KQOA 4QASA 2C29D 4RTJA 2XUKA 5JXJA 3ZE0B 1PJ4A 3FMPB 4AYBA 3M7IA 3WISA 1E94E 5KQPA 3H92A 2WHEA 3QE2A 1COWA 3HA5A 2B35A 4N03A 1XCOA 4K2EA 5K51A 5BNWA 3UW1A 1D2GA 2UZKA 4LXXA 4QYMA 2Z9DA 2OXIA 5JZSA 3A1UA 1XX5A 1IHPA 4QELA 5FPSA 4FFSA 1VJTA 2NU8A 4D99A 5BORA 3P96A 4DREA 1IO2A 1RJFA 2VN8A 2HLDA 1D4OA 3OMLA 3PTLA 3ZNNA 2VQFB 2QWWA 3Q2IA 3M2TA 4QEZA 4CRWB 3UXEA 2DMQA 1H5UA 2FBKA 4A4DA 4JELA 4YMHA 1YNOA 1QHHD 2GAIA 3K8YA 1JG7A 4YIRX 1FDOA 1P6QA 3JWEA 3LA6A 2ZK7A 4LOCA 3DE7X 4D9BA 2MR6A 2C20A 3DA8A 3EUEA 4DSZA 3MJCA 2XNJA 3S3MA 1LDYA 5AUPB 2WM9B 3IP4B 4XD7D 4EQQA 1UQRA 2IHZA 3I42A 3QTBA 5C5DA 4M8SA 2O3FA 4FC7A 1GPWB 1TQ8A 2CUKA 1YUBA 4LXYA 3ESWB 4YASA 1EFPB 4YRFA 1BJTA 3TZKA 1ANKA 3WYCA 2IH4A 2XNKA 4I9FA 3IPXA 1KYWA 1CCWA 4F2HA 4IHWA 2QR3A 3FWPA 4HLDA 4M0DA 4KRFA 2BW3B 2EP5A 1RWMA 5BR7A 1T9KA 3N3AC 1PV4A 4JOMA 3TOCA 1OLXA 2ID6A 3DFFA 5M5YJ 3M6VA 1K78A 1ZC3A 2DFNA 2RGDA 1ORHA 3C2GA 1RM0A 2LCIA 2ZVDA 3AR8A 4LXGA 2V6CA 3GTLJ 1S2LA 5BNGA 3IHTA 2CV2A 4EHBA 4UTVA 3RC8A 1NUTA 3M8EA 3ASZA 2E82A 4JJGA 2Y6VA 4UDXX 5KYKA 1WP9A 4B3SB 3OE1A 4HD8A 2VHQA 3TCNA 3V2HA 1YFLA 2HQSA 3AUYA 3CZCA 2IEKA 1F8UA 1N1MA 1CDZA 1XE3A 2Q9BA 3H3XA 1HEYA 5ICEA 3FDXA 3NLLA 3NIFB 1NTOA 1O1YA 4KUEA 4ZXFA 1FZQA 1TLHB 2E71A 4XLPF 2FF7A 3FRHA 2GDJA 4HR7A 4QRIA 4G3XA 5AJTA 5JD3A 2M6LA 4K9MA 4R31A 2HFJA 1AB5A 5HIKA 2YQ5A 2AWOA 2XGEA 1JIJA 4JI3B 4K05A 1JDNA 4NMHA 5FWYB 3R74A 4Y1RA 4H59A 4YIFA 1GJRA 3FPSA 1Z4PX 3JXEA 3UOGA 3LY5A 4UNNA 5CJ9A 4NV3A 4M9ZA 1A77A 2NZ2A 2WKPA 4N40A 5EHQA 4ETWA 3FD8A 1OXMA 5FP0A 3W2IA 2QBYB 4CCLA 3HN6A 5FTJA 5KJEA 4C1NA 1EE1A 1TWGJ 2FFRA 2PUBA 1WXIA 2A78A 3GD7A 3M4XA 3K73O 3QP5A 2ARKA 2OZLA 3IP1A 4U8HA 2YHIB 1MRNA 4J7XA 3MELA 5CVEA 3E5NA 3CT4A 2JFYA 2IBDA 2M9MA 3MCVA 4ZHQB 1XZNA 1ML4A 2X42A 2CBXA 3RS7A 4D9CA 1R1TA 1DOAA 1XVAA 3LFKA 2D2XA 3FIUA 1H89C 3HHHA 1WIWA 2VDNB 3A4CA 3UKGA 3OU7A 1RTTA 4HDSA 1DBRA 5EXEA 4R6XA 1F9EA 4RGVA 3QVUA 3ZVMA 2GCPA 3T3PB 1KMMA 1KJNA 2Q0XA 3G8CA 4JH0A 1U3TA 3FUVA 5CDSA 1I6LA 4ZALA 3VI3B 1RXIA 3HFSA 3ICOA 3SAJA 2BFAA 2VAXA