1IO2A

Crystal structure of type 2 ribonuclease h from hyperthermophilic archaeon, thermococcus kodakaraensis kod1
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
213
structure length
213
Chain Sequence
MKIAGIDEAGRGPVIGPMVIAAVVVDENSLPKLEELKVRDSKKLTPKRREKLFNEILGVLDDYVILELPPDVIGSREGTLNEFEVENFAKALNSLKVKPDVIYADAADVDEERFARELGERLNFEAEVVAKHKADDIFPVVSAASILAKVTRDRAVEKLKEEYGEIGSGYPSDPRTRAFLENYYREHGEFPPIVRKGWKTLKKIAEKVESEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic center of an archaeal type 2 ribonuclease H as revealed by X-ray crystallographic and mutational analyses.
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
molecule keywords RIBONUCLEASE HII
total genus 69
structure length 213
sequence length 213
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2000-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 1io2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1io2A01
1TV6A 4CHYA 4DQPA 3NH1A 4DSIA 2R7YA 3G10A 4KTWA 2KQ2A 3M8RA 4HHTA 1NK5A 1ZBIA 3RR8A 3UIQA 3OS1A 4BE1A 1VSDA 1QS4A 2OZMA 2HVHA 4CGJA 4Z4IA 1X9SA 4C8OA 2YV0X 3QO9A 3L2RA 4ID1A 3V4IA 3LP1A 3HM9A 3SZ2A 2E6MA 1C0TA 4FJMA 3AO5A 3V9SA 4DF4A 2WOMA 1RDAA 4DQIA 4M3YA 2QK9A 1DTTA 1JXEA 1C1CA 1A5XA 3OYCA 1L3VA 2RPIA 1NJXA 3L3VA 3KK2A 3AA4A 4B9TA 1SV5A 3S3MA 2KFNA 1ZBLA 3NH0A 2P5OA 3LALA 3AO1A 5J2NA 3ZCMA 5K14A 3QEXA 4C8KA 2OZSA 3VQAA 1LAVA 4B9LA 3CFOA 4Y1DA 4CF2A 4FJ5A 2F8TA 3WNEA 3DLKA 4CF1A 1C1AA 3O3FA 4FLUA 2QXFA 4Z4HA 2HHXA 3CFPA 3E01A 4OLBA 4M42A 4CEEA 4NYNA 3LZJA 1KVAA 4Q5VA 2YNHA 1WSHA 3JSMA 4FJ9A 5J2QA 1TKTA 4FK0A 1EXQA 1T8EA 3HJFA 1S9EA 1DTQA 3DLGA 3LAKA 4AH9A 4N5SA 3ZSXA 1D9DA 4PA1A 3SPYA 3HVTA 1TAUA 1HYVA 4E7KA 3TARA 3I0SA 1RBVA 3C95A 2HB5A 4DTMA 1T7PA 1RBTA 4RW9A 1JLAA 3KK3A 4DU1A 4DTOA 3T19A 2HHVA 3OYJA 3QETA 4DTJA 2RKIA 3DM2A 3ISNC 4DFMA 2XY6A 4J2AA 4CJRA 4N76A 1X9MA 1REVA 3PO4A 5CYQA 3RRHA 2E6LA 1NK8A 1TK5A 4FM1A 4CECA 2EHGA 4DS5A 1TL3A 3DLRA 4DFPA 4M45A 4AHTA 1RT1A 2BE2A 3SUQA 3S3OA 1EX4A 3CM5A 5HRRA 2G8UA 5C24A 4E7LA 3NF7A 4FVMA 4FJ8A 4O0IA 1U45A 3RMCA 1RDCA 3IAYA 4CK2A 4F8RA 3OYAA 1YT3A 3MXJA 4Z4FA 2D0BA 4CEDA 3L2VA 1KCFA 3FFIA 1LWEA 3C94A 2PZSA 3RRGA 3ZSVA 4E0DA 1W9HA 3SI6A 4FJ7A 1VSFA 3HSTB 4CFDA 3K58A 1NKBA 3ZT2A 4ELUA 4DQQA 3RWUA 3ITHA 4DSEA 2O4GA 2OYQA 4E7IA 4AILC 2Z1GA 2GV9A 4FJKA 4FJLA 2G8WA 1SL1A 4N47A 3AVFA 4Z4GA 2B6AA 3SJJA 3V1RA 1J53A 1RT7A 3HP9A 4OKJA 1WSGA 3ZSYA 4CF8A 4O55A 3KLEA 4PWDA 2HHQA 4KHSA 3VQCA 3I8DA 1A5WA 1VSKA 1TK0A 3WNHA 4CF9A 3V9WA 4DFKA 3G0ZA 4H8KA 1RTHA 1S5JA 4FLXA 3HT3A 3L2QA 3AO2A 1B9FA 1U47A 1D8YA 3QIPA 4HUFA 4KI6A 4CJFA 3VQ4A 3ULDA 4DTSA 2Z1IA 3SQ0A 1S1VA 1JLCA 2PYLA 3VQBA 4C8MA 1UAXA 3DOLA 1JLEA 3RMBA 3CYMA 1IKVA 1FKOA 1VRTA 1WSIA 3PV8A 1ASUA 1CZBA 3HK2A 1BCMA 3RTVA 4CEZA 3NFAA 4O0JA 3JYTA 4OJRA 1TAQA 5SWMA 3P83D 4F3TA 3AVHA 1SL0A 1BIZA 3MEEA 4CJPA 3KK1A 3DLEA 1RBRA 4L8RB 1LW0A 2I5JA 4O5BA 2ATQA 2F8SA 4EP4A 2HNDA 2BANA 3SQ4A 5KGXA 3TR8A 4K8XA 1FK9A 4F4KA 4FLWA 1NOYA 4Z0UA 4QCLA 4KO0A 2HHTA 1GOAA 3V9ZA 4CK1A 4BWJA 3OYEA 4NYFA 3NF6A 4CGGA 4FK2A 3IRXA 4FW2A 3NE6A 3S3NA 1HJRA 3HPHA 3KIOA 4DSLA 3P1GA 4RW8A 4KB0A 4HCBA 1U49A 3HL8A 5FDLA 4HTUA 1BL3A 4E7HA 1LV5A 1Z25A 1LWCA 4YFUA 3RMAA 5HP1A 1NK7A 4BWMA 3ZT3A 1TKXA 3U3YA 1KVCA 2XY8A 5HROA 3OYNA 4M3WA 5CZ1A 3THVA 4NCAA 4CHPA 4AHCA 4FCYA 4DLEA 3AVMA 1JL2A 1HRHA 1S6PA 2B5JA 1HPZA 4CCHA 1ITGA 1Z26A 4BDYA 3U6FA 3MXMA 3AO3A 5I42A 1Q9XA 4I2PA 3CM6A 2QKKA 3KD1E 4OGEA 2KW4A 2OPQA 4LH5A 2RF2A 3CQ8A 1T03A 4ICLA 1TL1A 4CHZA 1X9WA 1SKWA 4M3TA 3HVRA 2P51A 3L2UA 1NJZA 1HYZA 4KHNA 3L3UA 5HRNA 2XY7A 3AVBA 5HLFA 1HQUA 4OLAA 1CLQA 3AVJA 4CJ5A 1VSEA 4CIEA 1XHXA 3QLHA 3OY9A 4ELVA 4W5QA 2X74A 3ZT4A 3EY1A 4W5OA 1MU2A 1NKCA 1NJYA 4FW1A 1NK0A 3LP2A 5T7BA 3M8SA 1NKEA 1ZBHA 1TKZA 2P1JA 4H4OA 1C6VA 2A1RA 2P5GA 4E7JA 4FZYA 4DSJA 3L2WA 3HYFA 2YNFA 1ZBUA 3LWMA 3IG1A 3L8BA 2OA8A 2IDOA 3LPTA 4ELTA 2O4IA 4CEQA 3NHGA 2VG5A 1LW2A 1ASVA 1UA1A 4DSKA 3BGRA 4XIUA 4HUGA 2HHWA 1I3AA 4FJGA 4PY5A 2G8IA 2YKMA 4OKKA 1KTQA 1S9GA 4C8LA 4W5RA 2IS3A 4JRPA 1WSJA 4B9NA 2HMIA 2PYJA 4KAZA 3F73A 1J54A 4BACA 4O44A 4I9QA 1GOBA 3QNOA 4LSLA 2WONA 4DG1A 3AVAA 2BGGA 4FK4A 2HHSA 2FBXA 4KI4A 1A5VA 4CFAA 3O4NA 1QSSA 1SUQA 1S1XA 3LP3A 4JS4A 4OGCA 1FKPA 1JKHA 3OS2A 2Z1JA 3WNGA 2HW3A 1B92A 1C0MA 5KI6A 3TAEA 3DMJA 1QE1A 4CEFA 4CFBA 5KRTA 3NGZA 1WN7A 3K5NA 4FYDA 2OPPA 4CK3A 3NDKA 2AJQA 3AVIA 2DFFA 3AVNA 2FBYA 3MECA 4CEAA 3OYDA 1KRPA 4J2EA 2DY4A 2ZQBA 1BI4A 1R0AA 1SKSA 4AHRA 1L5UA 2HNZA 1QHTA 4B8CA 4DF8A 1RCHA 3K57A 4C8NA 4KFBA 4UQGA 1X1PA 1RBSA 2VWKA 2YHAA 1VSJA 2XO7A 4FXDA 4RW6A 3TANA 5KRSA 2DFEA 3VQEA 3ZSWA 1BHLA 1RTJA 3AA3A 3HPGA 1IO2A 4KTZA 5FROA 3O3GA 3NCIA 1QQCA 3NBPA 3OYLA 4IG3A 3M8QA 3EZ5A 3DLBA 2GUIA 1XHZA 1TKDA 4JS5A 2OPSA 2RN2A 1RT6A 4CEBA 2KZMA 3QNNA 3KD5E 3NH2A 2D5RA 4B8AB 1B9DA 4B9UA 4CJUA 3TAMA 3VQ5A 4CJ3A 3MXIA 4KRFA 2JLEA 1L3SA 1Q9YA 4NCBA 2HNYA 4M41A 4Z4CA 3H08A 5FRNA 2HHUA 3ZT0A 1W0HA 1NK6A 5KGWA 3TWHA 5EU7A 3V1OA 4ZHRA 3SV3A 2G8KA 3KLIA 3LAMA 5J2PA 4EZ9A 3TAPA 3PX0A 3CFRA 3OYFA 4FLTA 4GVMA 3CG7A 3VA0A 3PO5A 3AO4A 3KLFA 4M3XA 2DFHA 1RT2A 1U04A 4MQ3A 3WNFA 4FM0A 2A1SA 2OPRA 3LPUA 4EZ6A 4BE0A 1WSFA 3TAQA 3K59A 2Q3SA 3V81A 2YNIA 3DLHA 4F2RA 1XWLA 3SNNA 4FM2A 1BGXT 3KLHA 1RILA 4FLYA 3ZSRA 1SL2A 3OYGA 4QAGA 1NK9A 1D5AA 4KHQA 1RDDA 1RT3A 4M3RA 4CF0A 4CGDA 1NJWA 1K6YA 5HRPA 1JLGA 2ITGA 1IKWA 4AHSA 3QINA 2NUBA 3OYBA 1RBUA 3QEVA 4CJEA 1ASWA 1KFSA 3T1AA 5E41A 1O1WA 2IOCA 4RG8A 3LWLA 3SQ2A 3SUOA 2ZD1A 1L3UA 1HNIA 3ZSQA 1TGOA 3K2PA 5SZTA 4IFVA 2VWJA 2DTUA 1JXBA 1JLFA 2X78A 3DYAA 3I0RA 4IDKA 4LY7A 4Y1CA 3TABA 1BCOA 2VG7A 1U4BA 4J2BA 4DTUA 3RMDA 3LP0A 1LAWA 4I9LA 1XC9A 1GOCA 1U48A 2FBTA 3OYIA 3EYZA 5CYMA 1VSLA 4CERA 2D0CA 5C25A 4PQUA 4RW4A 4E1NA 1TVRA 2VG6A 3K5LA 4BDZA 4N41A 3C6TA 1RT4A 2Y1JA 4IFYA 2G8FA 4DQSA 4W5TA 4CGFA 3DRPA 4JRQA 1QTMA 4RW7A 4FJXA 3NF9A 3LZIA 3RR7A 3OJSA 3ALYA 3PUFA 1RT5A 4CJLA 4CJQA 4FJNA 4B08A 3PX4A 1VSIA 2ZE2A 3ZT1A 3VQ6A 1LWFA 4CGHA 3VN5A 1D9FA 1UOCA 3F9KA 4JLHA 4CGIA 4OPJA 4H4MA 1BQNA 4DTPA 1IKXA 3KKRA 3VQPA 3OYHA 4DTXA 4HCCA 4NCGA 3QERA 2YNGA 4LSNA 4FZZA 4KPYA 3AVLA 3T3FA 4CJSA 3HXMA 5JS2A 2ETJA 2JGUA 1J9AA 4IG0A 4CEOA 3QEIA 3MEDA 3NAEA 4CHOA 4FJJA 4FJHA 4OVLA 3OYKA 4KHUA 1BIUA 1S1WA 5DMRA 3DOKA 3QESA 1KVBA 4Z4EA 2XHBA 4DU4A 4QOZB 3VA3A 4I7FA 4G1QA 1WAJA 4DS4A 1YVUA 5DK5A 2W42A 3SUNA 2IAJA 4DWIA 5KTQA 3V1QA 4E3SA 4WE1A 2G8VA 1CXQA 4YNQA 1EETA 1WAFA 3HPOA 3V9UA 1BISA 3BDPA 1I39A 4R5PA 3SQ1A 1T05A 3KTQA 3O4QA 2BDPA 1HMVA 1IKYA 1JLBA 1IH7A 4GMJB 3U3GA 3ZSOA 3ASMA 3VQ8A 4CHQA 3QEWA 1L3TA 1VK0A 2Z1HA 1WLJA 3TAGA 4O4GA 4FLZA 1IG9A 4B9MA 3LANA 4K8ZA 3MEGA 3KLGA 1DLOA 1Y97A 1KSPA 5I3UA 2KTQA 3OS0A 1UA0A 3D45A 3QEPA 4B9SA 4M3UA 3K5OA 3NGYA 1VSMA 4PUOA 1CXUA 3AA2A 1C1BA 3OVNA 4MFBA 2Y1IA 2IGIA 4CJVA 4E19A 4DMNA 4E1MA 3K5MA 2EX3A 3VQ7A 3A2FA 4OPKA 1RTDA 1F21A 1Q8IA 1NOZA 2HVIA 4KHYA 2XRIA 3P5JA 3VQQA 4AHUA 3IS9A 4ZTJA 3MAQA 2FBVA 3D0PA 3OJUA 2G8HA 3NF8A 4ZTFA 5J2MA 5D3GA 2XY5A 1FXXA 2FC0A 2YHBA 4F2SA 2X6NA 3OYMA 3DI6A 3V6DA 4BDPA 3AA5X 3S9HA 4EP5A 1WSEA 4KTQA 1EP4A 1WNSA 3DRSA 4CFCA 3B6OA 4OKEA 4DTNA 4ID5A 1XI1A 2F96A 4CJWA 2B4JA 1C0UA 2GBZA 5HBMA 4FLVA 3V9XA 1YTAA 1VSHA 3AVCA 5C42A 1KLMA 3SV4A 1N6QA 1J5OA 4KKOA 3AVGA 4CE9A 3HP6A 3TAFA 1RDBA 1BQMA 4M3ZA 3PY8A 2KFZA 4DU3A 4TSXA 3ZSZA 4Q0BA 1HYSA 1BI4B 4CJ4A 4I2QA 4J2DA 3AVKA 1G15A 1KFDA 2LSNA 1UWBA 2IC3A 5J1EA 4KREA 4W5NA 1HNVA 3SUPA 4DQRA 3SPZA 3NGIA 2YKNA 3DRRA 2KZZA 3C6UA 5HRSA 3HO1A 2QKBA 2E4LA 4AHVA 3TI0A 4GW6A 3AV9A 4B3OA 4FZXC 4E89A 4KB1A 1CZ9A 4CJKA 3VQ9A 4DLGA 4DSFA 4IKFA 4CESA 1QSYA 4N56A 3PX6A 3LDSA 4B9VA 1JL1A 3KKSA 5CZ2A 4CIGA 1QSLA 4KHWA 4CJTA 1TK8A 3B6PA 4IBNA 1KLNA 4LD0A 1RTIA 1S6QA 1VRUA 1S1TA 4DTRA 1YTUA 3SYZA 3KJVA 4HVJA 1SKRA 4DFJA 5CY4A 4LH4A 1HQEA 3VQDA 4FJIA 5FRMA 4CHNA 4F3OA 1S1UA 3M8PA 3SCXA 2X6SA 1RNHA 1ZYQA 4BE2A 1JLQA 4CIFA 1ZBFA 3QIOA 4KV8A 1NK4A 2PY5A 2D0AA 5JS1A 4HUEA 1N5YA 1EKEA 3O3HA
chains in the Genus database with same CATH superfamily
3DTKA 1JKQC 3WG7H 1H9TA 2J5PA 5E84A 1P90A 2WFBA 2HKXA 3K70C 3WE3A 5KAIC 2DT7B 4KMFA 2OTJI 3D2EA 4DBQA 4DU1A 4HSTA 4JX4A 4U0WA 4IHSA 2VKVA 3UIQA 5F1JA 3TO6A 4UNOA 1VSDA 2PFUA 3AAPA 2UU9K 4DR6K 4AIKA 4CGJA 2HVHA 4M73A 2V1XA 1DP7P 1F43A 4BROA 1X9SA 2YV0X 1SFXA 5M3FJ 1ACIA 1S5LC 2K3FA 2QZ8A 5IOZA 2HBKA 3OBYA 1S3JA 4BGDA 3AO5A 4M6YA 4Y33A 2RE2A 4DF4A 2W40A 3LDQA 2J5OA 2O8DA 2GOMA 4R1HA 1JXEA 1A5XA 1NGCA 4BRGA 1VQ6I 1OCRH 3L3VA 1NMDA 4B9TA 1I27A 1P2FA 4JKGB 1KQ9A 3S3MA 2E2HJ 3HHGA 2ZJ2A 3FXRA 3NRVA 2BH1A 4Y0WA 4CD3A 3HM5A 2XAUA 5J2NA 3P9IA 2BUPA 3UKRB 3ZETB 3VQAA 2DOEA 4C2TA 2BHYA 4Y1DA 5C2FA 2VQLA 4BRIA 2DLLA 1JTYA 3DLKA 4QS9A 3WGIA 4B1YB 4A3LJ 5E3OA 1DGWY 4M42A 5ICFA 4F9OA 4NYNA 4DR2K 2FEZA 3K4LA 1KVAA 2CMPA 1TWGJ 2YNHA 5CVJA 3OHRA 2O03A 3ABKH 3OMYA 2VCPA 5J2QA 4JHDA 2IEKA 1TKTA 4CYDA 1YJWI 2W85A 4LGWA 2LKXA 1EXQA 2Q36A 4MHGA 3RYPA 5BREA 4QLCU 2HBJA 5AQNA 4PA1A 4N5SA 5IT9K 1D9DA 2Y0SN 4B1UB 1HYVA 1GHCA 2ZFUA 3W6KB 2JWKA 1RBTA 4RW9A 5JLWA 3CDHA 1JLAA 3RPQA 1Q18A 5AFUH 2DPNA 3J81Z 3KK3A 4DTOA 4DTJA 2HHVA 3ISNC 3VEXA 4YELA 1AKHA 4N76A 1X9MA 2E6LA 1TK5A 2HPMA 1TT0A 2VKHA 2WB1A 2JA5J 4CECA 2IPQX 3TL4X 1RKWA 1W0TA 1T33A 1BC8C 2BE2A 3S3OA 2QXLA 3DLRA 3LL3A 1GUUA 3I4NJ 1JUPA 4N0BA 3J81K 3I5UA 4E7LA 1C0FA 5C24A 2XRNA 1DU0A 4FJ8A 1KYWA 1U45A 4MLOA 1GV2A 2Y0MA 4F8RA 3OYAA 2ICWG 5HS8A 1XNRK 1SAUA 4N9IA 3F8FA 4OIRF 4AVZA 2OTLI 1KCFA 3A5NC 3FFIA 3ZSVA 2MGQA 2PZSA 4FJ7A 3ELKA 4CFDA 2QVOA 2HMPA 3FHNA 4B1XB 4ELUA 4GVEA 2ZMEA 5FGMA 4HV5A 3PJRA 4DJAA 4M9ZA 1NGBA 2O4GA 2P9NA 5BPIA 3ITHA 4BG8A 2V4JC 4E7IA 2OYQA 2Z1GA 1Q82O 5LHGA 4FWPA 3BG9A 2AXLA 5FLMJ 2G8WA 3VFZA 5DCMA 4Z4GA 3HUGA 2KZVA 1DU6A 4L18B 4OKJA 1BC7C 4CF8A 1RDWX 3KLEA 2HHQA 2VKDA 2XC7A 1R22A 2F4MB 2E1YA 3K9KA 1YRNB 3WNHA 1R36A 4IEIA 4DFKA 4H8KA 4FLXA 1TNTA 3I59A 2G9WA 1HJOA 3AO2A 3WUHA 3HT3A 1U9OA 1U0JA 4GXOA 4CJFA 5I9EB 1CGPA 1FEXA 2CRGA 4WFBL 4KI6A 1CF7A 5AJ3K 4I99C 3MWPA 1YJNI 3J7ZI 4DR5K 1JLCA 1XNQK 1T0FC 2ZNYA 2P9NB 1RKTA 2Q2EB 4XM3A 1IV0A 4KFCA 3DOLA 1BWFO 4LF6K 1MW7A 3EKSA 5DS9A 3O8HA 4XLPF 1S22A 1MWMA 1VRTA 3RZOJ 3AGKA 1BCMA 1LDKB 2DPDA 1MMSA 1TAQA 4BL0B 2DU9A 3CJTB 4H0EA 1TQIA 4Z94A 4F3TA 1E3PA 1W5SA 1T6SA 3ZYYX 1BA1A 5L3GA 3CUQC 1P4WA 4L8RB 1QVTA 2ATQA 3IC7A 1LDDA 3R4KA 2HNDA 3SQ4A 2Z2SB 3TDUC 2BW3B 3R1XA 3J81O 5FKMA 1FIAA 4CCJA 1NMNA 4CUGA 4P1WA 3G25A 2O61A 2HTSA 2HKOA 2JWLA 4LLGF 3WE2A 3DWLA 1GOAA 4YOUA 1JKHA 2Z5UA 3FXLA 3FKIJ 4ZDOA 3HGGA 4WCEL 3MKWB 3THYA 1L0OC 5KCMA 4D5FA 1QVUA 2XKPA 1IF1A 3HPHA 4PDKA 5E3MA 1KYZA 1TWAJ 2ADUA 3LSJA 1DUXC 4RW8A 3VEOA 1ETXA 2FA5A 2KQRA 4BBRJ 4CSWA 5DUIA 4H0VB 4I02A 5FDLA 3R8EA 4KH4A 3JREA 4HTUA 1Y0UA 4E7HA 4FWOA 1SFUA 2QQBA 1LV5A 4ESBA 3CJ9A 4YFUA 5L3FA 3D7EO 4OOIA 1O3SA 1MKMA 2OZUA 3ID8A 3U3YA 4LF8K 2DMTA 4RTFD 4CHPA 4AHCA 3RSEB 1NHAA 3DPTA 1EQYA 4GV3A 1ILYA 3Q3SA 4CXFA 1S6PA 1Z6TA 2QA4N 5BN9A 5EGOB 4I2PA 4F2SA 3CM6A 2GZWA 3KD1E 2RC4A 2KW4A 1POGA 2DYSH 4JKGA 2K85A 2LVSA 1T6CA 4OU0A 2UUBK 4FWNA 3MEXA 3TO7A 4B1ZA 1Z1DA 2ETHA 4JI0K 1MDUB 3AVBA 2R7XA 2L9RA 1Q86O 3W2WA 2UYTA 4OLAA 1CLQA 2M0MA 4PFPA 1VSEA 3I64A 3OY9A 4I6ZA 1XHXA 2P5KA 2CV2A 4EM2A 3EY1A 2WA0A 2R7UA 1OH8A 4W5OA 4BQAA 1NJYA 3ZLJA 3GEZA 2BE5F 1NKEA 1NK0A 4MNUA 4JI4K 2A1RA 3BR0A 3VDXA 1YITN 2A6EF 2EB7A 4E7JA 3CC4I 4FZYA 1HLUA 3MCPA 4DSJA 2CW7A 4PCQA 3PM1A 2OA8A 2GAUA 4JX6A 1SD4A 4PL8A 4JKFA 4I0BA 2KL4A 1LW2A 1ASVA 1VQ7N 2NZTA 1QGPA 2V7YA 3SBGA 4DSKA 2K40A 1R5ID 2HYGD 3DKYA 3S14J 5E17F 3TQNA 1ZBSA 1ETVA 3CQZJ 4HDVA 4C8LA 4PGHA 3TANA 3N4MA 4DV2K 3H9GA 4CZGA 4B9NA 2PYJA 5ILUA 4BACA 1NK3P 2K02A 2UWMA 2HS5A 1QVGM 2K4JA 3WU2C 2RGVA 2NVTJ 3KLNA 1LVAA 3C2BA 4ILJA 4NXMK 4DG1A 2BGGA 2TDXA 3EEQA 1XB4A 3EQLF 4CFAA 5D8KB 1QSSA 2O8CB 1SUQA 3LP3A 3VYUB 5FPNA 1JJ8C 4M6XA 3CCQN 4M63C 5KI6A 2DOFA 1AU7A 4X64K 4H5RA 1O4XA 2QF7A 4MQVA 4U7DA 2CQKA 1MDMB 3K5NA 4FYDA 4O6JA 4CK3A 1SVMA 1VF9A 3PUBA 3NDKA 2AJQA 3VYRB 3EUAA 4NB5A 3HL2A 3GL1A 1KRPA 1FP1D 1F5TA 1VAZA 2UXCK 3GG4A 2HNZA 3IWFA 3NAUA 1QHTA 2DJNA 4C8NA 2K9SA 2X0LA 4BNCA 2XAQA 2VL8A 2PG4A 3HHHA 3K2AA 4FXDA 4IHXA 1MBEA 4RW6A 3QWLA 2MD5A 1MBGA 2K9NA 5K1YA 5M5WJ 2L7KA 5CQGA 1H88C 1BHLA 2ECBA 5FROA 3AA3A 1YQAA 2QLZA 3WTWC 2W6KA 3GTKJ 1QQCA 4JNEA 3OYLA 3A4CA 3R61A 4LFUA 2V6EA 1WZ2A 3AGRA 3U1DA 1OVQA 1ZLJA 2HVRA 2OPSA 1L3LA 2OPTA 1RT6A 4U67L 2KZMA 1WWXA 5J4VA 3GE1A 3D0SA 3JRAA 3MXIA 3THXA 4JI7K 2YU3A 1HNXK 1E2XA 4BHBA 1TYQA 1Q9YA 2HNYA 4NCBA 2WC2A 2LK2A 3ATVA 4CZJA 1BR4A 3MDQA 1KU3A 2DJIA 3SZGA 4A5MA 1WJDA 4F91B 3TWHA 2CFXA 1ETQA 3BTCA 5BRFA 1GT0C 5J2PA 1W7PA 1NU0A 4K42A 2UUCK 4GFBA 3E97A 1VQMN 2KHOA 3CG7A 1V5FA 4GVMA 1QQIA 4XH1A 3JRBA 3AAQA 4HLXA 3CJBA 1VQKN 4M3XA 3JRFA 2V7ZA 3WNFA 3LAKA 1VHXA 4FM0A 2A1SA 3IL2A 2ZNZA 3C7JA 4BE0A 4BAYA 3VESA 4UY8O 5F0XA 5GTIC 1KONA 4CYCA 1BGXT 1YG2A 2AQEA 2IA1A 3KLHA 3THXB 5IT9O 4FVUA 1NK9A 3ZGKA 3FDYA 2MW8A 4J01A 1RDDA 4M3RA 3KP6A 1K6YA 1BI1A 3FXQA 5M3MJ 2HW3A 1R1VA 4U0YA 3BG5A 2NUBA 2QWQA 5FFZA 2FE3A 5E41A 4FETA 4H0OA 3I3LA 4HSRA 3EYYA 4BS9A 3CCVN 1F4KA 3SQ2A 3SUOA 3W3DA 4HV6A 1TGOA 2ZBKA 4CCKA 1VQPN 5E3NA 3K2PA 4M9SA 4Y1CA 2F5DA 3QYBA 3CCRI 1U4BA 3S15J 1NM1A 3OL4A 1J59A 2DOAA 3PIPL 3LP0A 2E2OA 4L3QA 3RMDA 4CH7A 1X3ZB 3OYIA 3HRMA 2HWVA 5E8GA 3WODF 3CJCA 1SL1A 1VSLA 3G71N 3CERA 4HQEA 3OTOK 4PZJA 2E5NA 3BR1A 3KK7A 2CSOA 5M5YJ 4DUZK 3R9PA 1TVRA 2VG6A 4N41A 1K8KB 3C6TA 3QOPA 5H1SQ 3H3UA 2DDBA 1UMQA 2L2OA 2KPMA 1NLVA 2LMDA 4FWLA 1BIAA 2VPLA 2CFOA 3H36A 3D2FB 4IPAA 3MCAB 4RW7A 3DKWA 2CUJA 3A02A 3NF9A 3EE8A 4I6MB 3LZIA 3IAS2 1X58A 5LMNK 3RR7A 3ZQFA 3PUFA 2KKZA 4N9HA 2A3ZA 4FJNA 3CPWM 2W4SA 4PUSA 3E6CC 2FD5A 1VSIA 2ZE2A 3K69A 3VQ6A 1LWFA 1BG3A 1A31A 3VGKA 4H0PA 4ILHA 4OPJA 4MIMA 4KHPK 3GFIA 1IDZA 1WCMJ 5M1PA 2HHSA 3PFIA 2XHKA 3V7RA 2XPUA 2NRAC 5FKKA 3THWB 1S72N 4HCCA 1B59A 2VQFK 2EILH 1R9TJ 2FSNA 3QERA 3LSGA 4CW7B 4FZZA 2ZSIB 2EIKH 3QP6A 1VZ0A 4AF1A 2FU4A 9ANTA 2VQEK 4B3SK 1U2VA 2RN7A 3WQTA 4CEOA 3SAHA 3QEIA 4DR1K 3QPHA 1HOMA 2F5VA 4FJJA 4PSWA 1T2KA 2KJBA 2CH6A 1VQ8N 3DOKA 4HF1A 1KVBA 1IRFA 1K8AO 1E3OC 4DV6K 4ILGB 4DU4A 2H6BA 2GXBA 5LY3A 5JR3A 1I94K 5F0FA 4AU7A 3WEEA 2W42A 3K4NA 1QA6A 5FLXO 5KTQA 3BP8A 2G8VA 4YNQA 3CLQA 3TP0A 1I39A 4BH9A 5AQWA 4CZEA 3GWZA 1FZPB 3SQ1A 3CCRN 4BR0A 1ZAOA 3O4QA 2BDPA 4X0GA 2BBYA 4P55A 3U3GA 1L3TA 1T0FA 3VQ8A 3SYTA 3NMUA 1VK0A 2O3FA 1WLJA 2Z1HA 4FLZA 1Q1HA 1G2HA 3LANA 4K8ZA 1N25A 1SANA 4CZIA 4IJAA 3KLGA 3HJEA 3G73A 1DLOA 1Y97A 5J1YA 1UA0A 4PJJA 2QGUA 4NHJA 2Q2RA 2EIJH 3JRHA 4M3UA 1Z7LA 3JSPA 1X2MA 3FXUA 4CJVA 2LY9A 1RTDA 4MO5A 3SMPA 4EIAA 3VQ7A 4GV9A 2EFPA 3FXKA 1F21A 1B72A 1Q8IA 4JN4A 4BRKA 2HVIA 1Z7UA 4ZTJA 4LFCK 1S7OA 2DT5A 2STTA 3D0PA 1FW6A 3NF8A 3JAMO 5A2QO 4LF7K 5FKOA 3C3WA 5J2MA 4QS8A 1ONVA 5H6QA 2VJJA 2YHBA 1IN4A 3ABTA 1MBFA 4L5JA 3ZMTA 3OYMA 4IZZA 4ENKA 1FTZA 3DI6A 1K9MO 3S9HA 4BDPA 4XKWA 1ZRDA 4PKIA 1WNSA 2XGDA 4DV1K 2LDUA 4FX0A 4ID5A 4DW6A 3FXOA 4GY2B 2GBZA 1J2XA 3RKXA 3G4SN 5C42A 1J5OA 4PSXA 3IDHA 4M3WA 3J7AO 4CZZA 3CMEN 1SQKA 3AVGA 4BR5A 3HP6A 3TAFA 3EE9A 3F23A 1IRXA 1XSXA 4OIOF 3PY8A 5AIPA 3K7AJ 5BPMA 4LF9K 2WBMA 3EETA 4Y13A 1GLDG 1BDGA 4IFVA 3I54A 4IHVA 3CCLI 2KT0A 3CCMI 1KFDA 4J2DA 1UWBA 3K6GA 4CI6A 3DEUA 2PI0A 4NDLA 1AHDP 3DRRA 3A03A 2EV0A 1VQLI 1K79A 3C6UA 3I0TA 3HO1A 4AHVA 3JW4A 3TI0A 4GW6A 3AV9A 1Q7YO 4B3OA 5D6EA 4JHDB 3ISPA 4E89A 1JGSA 1SAXA 2YS9A 1DKGD 4KB1A 2ELHA 3P39A 3HGYA 3LA2A 3ZQGA 3G6EN 4HBLA 1JL1A 3F3XA 4CIGA 1QSLA 1ENHA 2ZXJA 1ZHFA 4U88A 1HF0A 2DODA 1KLNA 1RTIA 1D0XA 1S6QA 2P9LA 3DLLF 3G1OA 4DTRA 5BRHA 3E9LA 2HQRA 3SYZA 1FJGK 1QU3A 4JAXA 4ZYHA 4BC2A 4M3GA 1Q81O 2XAJA 5H20A 3DEWA 4B47A 4E1JA 5TISC 4F3OA 2P9UA 2Z3YA 1MH3A 2X6SA 1N8RO 4P9UA 4BE2A 2QA4I 4XN0A 2L4MA 4X6AJ 2D0AA 5A2QK 2KIFA 4V2GA 4HWIA 4W1UA 5JFRA 3O3HA 1N5YA 3CI5A 1O57A 1SD7A 3CLOA 3LFKA 2OV7A 3ZMUA 4BRCA 2ESNA 2A6AA 2KQ2A 4J8FA 4HHTA 3O4WA 1NK5A 1QO0D 1ZBIA 3H3OB 3RR8A 3U1KA 3ASNH 2KIQA 3V8LA 1RFQA 5CVIA 5FD6A 1QS4A 3U4LA 4AM3A 3M4OJ 4E70A 4UXNA 3WEEB 2PMHA 4JQFA 2IVPA 3L2RA 3F8NA 4HX8A 3QO9A 4ID1A 3LP1A 3O6BB 3G2BA 3IV5A 2E6MA 1C0TA 2DI3A 2LBFA 2KISA 2PN6A 1MNEA 2WOMA 4D1QA 2FXAA 1VQ4N 3DPUA 2P4WA 1C1CA 4MTDA 3MN6A 1Z3YA 3OYCA 4IXCA 4X65K 3O9RA 3MN7A 2M34A 4ON0A 3E6MA 1NG6A 3TBIA 3AA4A 4BC4A 1YS6A 1SV5A 4FPAA 3KK2A 5HDGA 3JTGA 4RAZA 1QQNA 1GVDA 4AM7A 1VQ4I 4A61A 4FISA 5K14A 4B9LA 2Y9YA 1LAVA 1W5CC 4YDUC 5CQEA 3HTUA 4Y4RA 1EWRA 5HOOA 2H1KA 1T6DA 3WNEA 3BTJA 1C1AA 3O3FA 3WTTC 4B48A 2LLKA 1J7KA 3KP4A 1XDUA 2CUZA 5CR4A 2M8EA 3DU5A 3F0CA 4Z4HA 4YY3K 4Z2YA 4IWVA 3CFPA 5J8CA 3LSHA 5CVVA 5FPMA 3LZJA 2KFDA 2R7VA 3MFKA 3QPSA 4D9JA 3CJNA 3MQ0A 3BY5A 1FSEA 3M6GA 1D8KA 3T7ZA 4LLNA 2EPFA 3BR2A 4U7BA 2N8GA 1HQCA 2VBWA 1IRZA 1WSHA 1FBUA 2QWOA 2V7FA 3PLAA 3HRUA 2LG4A 4FL9A 4MEYF 3WXJA 1LE8A 4YG2F 4AH9A 1OH6A 1WSUA 4JKHA 4EFHA 2TRTA 3HVTA 3RQIA 4DR3K 1SFKA 1TAUA 1R7JA 4JK8A 1Z91A 1VQNI 3SAFA 4RDUA 4G9ZA 3C95A 2HB5A 4HX7A 4DTMA 2EFWA 1T38A 1R00A 4LB5A 2XY6A 4DFMA 2RKIA 3DM2A 1M90O 1S7AA 4RGXA 3UKRA 2FQ3A 4CJRA 2JA7J 4JD2B 2ZJRL 4XLEA 2X51A 4AWXB 1NK8A 4DS5A 1TL3A 4M74A 2NRHA 4M45A 4AHTA 1MNDA 1JCGA 5FB2A 4A3MJ 1H0MA 2DA4A 2IGKA 2Q8KA 1EX4A 3CM5A 4JKAA 5HRRA 1IBLK 4LK1F 3TOAA 3F21A 3FFKB 3DP7A 3NF7A 1ZYRF 1OR7A 4MFEA 2GA1A 2UZKA 3D1NI 2VKEA 3VMFB 5KQDA 3RMCA 4B09A 3IAYA 3VEZA 3NQOA 4OMYA 2OC6A 3ASOH 3HZJA 2HDWA 3LFUA 3ZMVA 4CK2A 2FBHA 4DV3K 1SC7A 3ZX2A 4B9MA 5ERIA 4BR2A 1BL0A 1OJLA 4E0DA 4JP0A 3O8GA 3CCEN 3DCFA 2BVLA 2GQQA 1R4NB 1FPQA 2MD0A 1DEJA 3WXMB 3FR0A 1M1KO 3MVPA 2HI3A 5CHIA 1LE8B 1F1ZA 2ZSHB 4GO1A 5J1UA 3CCSI 1N77A 4OMZA 5KK1A 3WHCA 3H92A 3BR5A 3H1QA 2LC2A 3ULQB 4X66K 1HNZK 4FJLA 1DQUA 2DA7A 1NGIA 1J53A 3V1RA 4CZHA 1YJ9N 1D8YA 1R58A 3H9QA 3HP9A 3QBWA 3ZSYA 4O55A 4PWDA 3KYDB 2HR3A 3VQCA 3I8DA 3L2CA 2VWBA 1VSKA 1XPXA 1YW7A 3V9WA 2DMUA 3GFMA 1RDUA 4CBUA 1WHUA 1LOTB 5GIPA 2YHYA 4Y3OA 1SFOJ 3KLOA 4HUFA 2V9KA 3R6SA 3TP3A 3O2PE 3ULDA 3U8XA 2Z1IA 2QM3A 3SQ0A 4GDFA 3CJAA 1VQ9N 4BY7J 4A93J 2AS5F 2PYLA 2H09A 4JI3K 3CF2A 5EOYA 4C8MA 4KJZA 3FKJA 1XDSA 3WU1B 2O8FB 2M3AA 4L0ZB 3P9KA 5JVGF 1TC3C 2HEOA 1IGNA 1IKVA 1FKOA 5F6FA 2CH5A 1ASUA 1WQ2A 4IHWA 3PV8A 4BXFA 4KITB 3CMEI 3O08A 1PDNC 4H03B 4CEZA 1S8NA 3ZR8X 3JYTA 3T8TA 2FOWA 5DDGA 4PJMA 1Y39A 3CQXA 5SWMA 5KPZA 5EZHA 1BBYA 5B66C 4RB2C 3LWFA 1NGHA 3P38A 4CJPA 2R7FA 3E9OA 3KK1A 1V55H 3DLEA 1RBRA 5AQPA 4LLLA 4ESFA 5EXWA 1AOYA 4CGHA 4BBSJ 4EP4A 3D5SC 2F8SA 3E1YA 5KGXA 3TR8A 3SBTA 3MZ8A 1DDNA 4FLWA 3Q0WA 4Z0UA 3CCYA 1G3SA 5E79C 3I55I 4LG0B 2XROA 1QZ6A 1QPIA 3CESA 2FMLA 1YF5L 2HHTA 4BUPA 2K9MA 3HSEA 1BJZA 4RGRA 4KA4A 3V9ZA 3OYEA 1LCUA 3E6DA 2HYFA 2QW9A 1K7AA 3Q9SA 2MFZA 3BT9A 2M45A 3KPHA 5FPDA 2IS6A 3AG4H 3SEQA 3Q0UA 1SZ2A 5K7HA 3P1GA 1U2WA 2HDCA 2H8RA 3M9AA 2Z16A 1SD6A 2LTPA 2NVXJ 2IP2A 1E4FT 3DEEA 3EUHC 4E7SA 3H3NO 4CA0A 1QRYA 2ACJA 2ZMEB 1IDYA 1Y8RB 3JRDA 3RMAA 4KH5A 3O5BA 2KDOA 3VYSB 2NS8A 3GTPJ 1TKXA 1RR8C 1KVCA 5HROA 3WGHA 4XL9A 2IJLA 3BUZB 3WTXC 2PJPA 1YAGA 2NOJB 5J47A 2RAEA 2V26A 1JL2A 1HRHA 2B5JA 3J80O 1HPZA 4CCHA 4V19S 1ATRA 1YVNA 1Z26A 4BQLA 1FMWA 5FD5A 2D5VA 4G7OF 2IW5A 3OIOA 4A2BA 4OGEA 4MDAA 1NGAA 4RM3A 1U2VB 3VPRA 4HDUA 3GZNB 1PVEA 2RF2A 4BRLA 3CQ8A 2DCEA 1T03A 4BY9C 2YU9J 2COMA 4FE7A 4LK0F 4CHZA 2GM4A 2QWLA 1JE8A 4BY1J 3OR2C 3DTIA 3NWSA 1QNTA 4M3FA 4PGGA 4MO4A 3DBLB 3HVRA 1LFBA 4QWQA 2CWEA 2XY7A 3GMEA 1ZG5A 2PMZA 2ECCA 1IXSB 1FBQA 1FY7A 2Y0SA 4A6EA 3BF3A 2D2WA 3DBRB 4I01A 2L01A 4Y15A 2IIRA 5A2QZ 2BZTA 1UG2A 2LY2A 3DU6A 1OFCX 5JICA 5DM7L 2X74A 1V5GA 3ZT4A 3FBNB 1IAWA 3HOUJ 5AQZA 1MU2A 5F1XA 1DPRA 4FW1A 3RI4A 3P4IA 1ON1A 4DR4K 2A40A 4FO0A 4DBRA 2P5LC 2CGPA 4DNCA 1TKZA 2P1JA 4H4OA 2P5GA 1JJ2M 3I9V2 3LSMA 2ASMA 5LBQA 1HBXG 2CV1A 5LEJA 3L2WA 3LWMA 2GWRA 2MC4A 2WY8Q 1E4GT 1ZBUA 2YNFA 2IDOA 3IG1A 3LPTA 3VPZA 1X4PA 1FC3A 2ZKZA 2X85A 4CEQA 4DV5K 5ADXA 2VG5A 4IZ9A 3KD5E 2WADA 1UA1A 1PYVA 4G12A 3KYCB 2D0PA 3BGRA 1TW3A 1QZZA 4NUBA 5DTDA 5IPAA 5M5XJ 5EGOA 1WBBA 2YKMA 2G8IA 4OKKA 4PY5A 2MSYA 3LSKA 4BRDA 2K4BA 2EA4A 4B9QA 2PBIA 1VQ7I 2VONA 2P6SA 4JRPA 2FNAA 1RPWA 1HDDC 2KRCA 1ZRFA 3L4QA 2ZO4A 2PLYA 3CPEA 4I9QA 3N97A 3TEDA 3ZEUB 3QNOA 3K0LA 4LSLA 2D1HA 1CZAN 5CVRA 1SS6A 3F6VA 4L9NA 5AZJA 3AVAA 3NVKA 2DA6A 4H5NA 2F5EA 2LY1A 2B9SA 5BN8A 1PP7U 1S1XA 2PQ8A 3ML6A 2ZGZA 1LB2A 4OO1J 2IBDA 5CJ9A 2F7TA 3WNGA 2HOSA 4EQQA 2EIMH 4UUVA 3AL0C 1KU9A 5L3EA 4S0HB 2NRXA 4CFBA 1G8XA 5ADXH 5KRTA 2P0WA 3CCJN 3BJOA 3BJAA 2NS7A 1YXQA 1K4TA 1Z21A 4A62A 2EZLA 2HDDA 1ON2A 1UZCA 1IN7A 1UG0A 1S29A 3ABMH 4AHRA 2ZJPL 4BRAA 2O8FA 5AQHA 2BW3A 4DF8A 3K57A 3KP5A 4UQGA 2R7TA 4XLFA 2VLAA 3PO2J 5DUKA 4Q4ZF 2QWRA 2YHAA 2XO7A 1SVLA 2H6CA 4BRPA 2DMNA 3JS6A 4C9YA 3O3GA 3HPGA 4KTZA 2YSRA 3LA3A 1ZLKA 3N4QA 1LJ9A 4K41A 4HZFA 4XNFA 4A3JJ 2WUSA 3NBPA 3VENA 4M7XA 4PHTX 1ZARA 2GUIA 2E34A 1FYMA 2RN2A 4WXDA 1OKJA 1XCVA 3CCSN 4CEBA 1T8IA 4ANJA 4G6TB 1I50J 1K83J 4Q5SF 1HC8A 1E17A 1LFUP 3DXKA 3ZEUA 4BJTA 3NH2A 5D5WB 4KRFA 2A6TA 2GXGA 1BI3A 2JLEA 1P4XA 2Q0RA 3W3CA 4XH4A 4L5EA 1OYYA 4M41A 4GYIA 4Z4CA 4BHCA 3CHWA 3J7AY 3UE5A 3FXJA 3ZT0A 2BGCA 5KGWA 5EU7A 3V1OA 4ZHRA 3ID6A 1Z05A 3SV3A 1R49A 5C4JJ 2IVNA 1K8KA 1J5YA 4CDGA 5DM6F 3TSUA 3PX0A 3TAPA 1YIJI 4FLTA 3A5LC 4UUSB 4G7ZF 3PO5A 5BPLA 3K9TA 3PQKA 5HLGA 2VXZA 4GYGA 3AO4A 3KX2A 3W0LA 2DFHA 2IGNA 3HUGB 4NNJA 4MQ3A 5LJWA 3KZBA 3TAQA 2YNIA 5AZIB 2F2EA 4HPQA 1OKRA 4FM2A 4F52A 5ICGA 5HL7L 1MBJA 3WXIA 4FASD 1E0EA 1EH8A 1LDJA 3ZSRA 3OYGA 1SL2A 1QVFM 3JCUC 2L4AA 2LSOA 3VF6A 4CF0A 3LDLA 4YFXF 1KAXA 1NJWA 4KHQA 1I6XA 4YOTA 2VUMJ 1JLGA 2YUSA 1ITYA 3OL3A 2VBZA 2E71A 4XRSG 5B1AH 3CP2A 5B5EC 2R5YA 1ASWA 4AHSA 2BY0A 2P9IB 3BWGA 3T1AA 3U21A 1LKXA 1WH7A 4A0XA 4D5CA 5EF6A 1K78B 3E0JB 5B1BH 2E1OA 5IP7J 3U2RA 4OINF 3TW7A 2E1MB 1O1WA 2ZD1A 4AUXA 3MX5A 3ZSQA 4DKWA 4X62K 1L3UA 2X6WA 3AL0B 3S32A 1JXBA 4IDKA 3CC7I 4G7HF 4J2BA 1BCOA 2VG7A 3IKMA 3JR9A 5DM7F 1USSA 2MYSA 4BR7A 1OYWA 1YOVB 2RHKA 2Q0OA 3I56I 3HOXJ 3S1NJ 5CYMA 4ZDPA 2D0CA 4NQWB 5C25A 4RW4A 2KKOA 4HW0A 3GBTA 3BR3A 2HXOA 4BDZA 1EJ9A 4OAYA 1RT4A 2Y1JA 3IH3A 4IFYA 1XG1A 4BHPA 5EG0B 2G8FA 1GVJA 2QKLB 4N4OB 2A5YB 3T8RA 4YFKF 1P4AA 2HSTA 2E1CA 5AQRA 1D5VA 3L7WA 2DXIA 5D5VB 2X9DA 3L0QA 3I4PA 3ENBA 5LEKA 3OJSA 1N75A 5AZJB 1SMTA 5C3EJ 4JYAK 4CJQA 4B08A 2K3PA 2Q1NA 2NVYJ 1WJFA 2XGCA 3DFGA 5HNFA 4IHYA 2A05A 1KZHA 3VN5A 1T56A 3F9KA 1ODDA 1UOCA 1MJ9A 2P7CB 3S16J 4LG0A 1J09A 1XGSA 2OZ6A 1OVYA 3PNTA 4LSNA 5M1KA 3BTLA 3AVLA 3G4SI 4AIJA 3FK6A 4CZKA 4IG0A 2X48A 2Z1DA 3EZWA 3MEDA 4FJHA 3G3ZA 4XIDA 4D0PA 4CCNA 3LAJA 1BIUA 4WK8F 2KIUA 4JD2A 4JK9A 4A3BJ 4ZYGA 3ZQQA 2M9HA 3A0IX 4HX4A 5J40A 4A2AA 1OYIA 2XHBA 3QESA 1OCPA 4Z4EA 2E19A 3Q5FA 1VTNC 2O8BA 5ILVA 3K0SA 2XAFA 4I7FA 5LJVA 4DS4A 2D0OA 3S17J 1UJ8A 1YVUA 4FWMA 2IAJA 1J6ZA 2R7WA 5F27A 2DAOA 4O8KA 5EX5A 4E3SA 3ABLH 3HPOA 2CG4A 2WY7Q 1TWHJ 1BISA 4WQ5C 2JN6A 3BJ6A 1D1CA 1S3XA 2IGMA 1IKYA 5DM6L 5AQKA 4GMJB 4DYQA 1YI2N 3ZSOA 3M7GA 4BG9A 3IUOA 4IRGA 4LF4K 3B6AA 4GKKK 3K2ZA 2MA3A 3RKQA 1I1SA 3MK6A 4O4GA 4BRQA 2BOLA 4JI8K 4BU2A 4IDHA 3DJCA 1USTA 3WT0A 3E5XA 2D1VA 1OCTC 1Y8QB 3UKUA 4NB4A 3HXLA 2E7WA 4EMSA 1C1BA 1GLLO 2HBLA 4MFBA 3GXOA 2IXSA 2IGIA 4E1MA 3K5MA 4DMNA 2Y1IA 4OPKA 3KWIA 4WQ4A 3EPZA 4KHYA 3PO3J 3NARA 3IS9A 3JTHA 2VE9A 1KQ8A 2WAQN 3JXUA 2G8HA 3R60A 2JSPA 2L9VA 4RAGA 3SZTA 3KVGA 2ASOA 1XS9A 1V54H 5JVTA 2XY5A 1FXXA 2Y31A 2X6OA 3JAMZ 3AA5X 1WUAA 4EP5A 4JOMA 4XQFA 4V19K 1EP4A 1XUPO 3B6OA 4BKXA 4OKEA 4DR7K 3BLYA 5GAHP 4C1NI 1DT9A 1H1VA 3KE2A 1X3WB 1YTAA 1HUXA 1VSHA 3KWGA 3SNNA 4S05A 4KPYA 3BPVA 5MLCQ 3FK7A 1WJAA 1G99A 3FLCO 3TKYA 1IJWC 1BQMA 4KIBA 1CF7B 5C4XJ 4M7YA 2KFZA 1N33K 1WKMA 3UNGC 1P9QC 3RKYA 4I2QA 1XGNA 3AVKA 1BOAA 2WWYA 2LSNA 3LM2A 4ETSA 1ATNA 3AAFA 3IMXA 5GPCA 3QRFF 4G8XA 5J1EA 3MX2A 1NG9A 4KREA 1ETWA 2L7MP 1MBKA 3SPZA 2MLGA 1V3FA 2LOOA 3HSRA 3KEOA 4XBFA 3CUQA 2YKNA 4YHHK 1VQON 3Q9VA 3TSQA 1G6NA 2QKBA 4EJTA 3GTOJ 1X1BA 3BZCA 3PSFA 4EGZA 2EA2A 5DD4A 4IO9F 2QCOA 4IXAA 1GLNA 3FXMA 1I1GA 1IN5A 4M3EA 2QBYB 1CZ9A 2Q97A 3FZKA 4JI6K 2LYCA 2CGLA 4CJKA 1QSYA 5DEQA 2E2JJ 3C2GA 3QPLA 2OCEA 1R1UA 4A3KJ 1A6IA 4D7NA 2VC0A 5K5QA 4BXXJ 3CIPA 4IBNA 5CE3A 5GADP 2OF7A 3MWTA 5EEGA 2NVQJ 1TBXA 2LF7A 5BS6A 1W36C 4LD0A 3PL8A 1VRUA 5D5UB 3SZPA 1LPQA 3W2AA 4GV6A 5L3DA 1SKRA 2BHZA 3WTYC 5CY4A 1T08B 1U8BA 1W97L 5GADJ 4II2A 4BRMA 1QHHD 5FRMA 4FJIA 1TWFJ 2QM1A 2M30A 4XR6A 4Z4FA 3K4BA 1RNHA 3OA9A 3BZKA 1I3QJ 5BPNA 1JLQA 1ZH5A 1ZBFA 3QIOA 1IXRC 4R79A 4KV8A 4P96A 5JS1A 2BY3A 3BF1A 4HUEA 2E2PA 2YJEA 2LF8A 4M72A 2F4OB 1TV6A 2EBIA 3FZVA 4CHYA 4IQ4A 1NBWA 5ICEA 1D4XA 2NRZA 3NH1A 1RC9A 2Y30A 5LLQA 4DCHA 1UCRA 3ZN0A 1ORKA 3G10A 3DXMA 3MN9A 5FPEA 2R7YA 3SUQA 4CHUA 4JV5K 4HTLA 3H5AA 5EY4A 1J75A 3OS1A 4BE1A 5M1OA 1XGOA 2O8XA 3F72A 2ZMEC 3GTLJ 2OZMA 2STWA 1RRJA 4C8OA 1D1BA 3EDPA 3M8EA 2R5ZA 3GFJA 3CCJI 5SZTA 2FF6A 3SZ2A 2E1NA 4I7HA 1G4DA 2V1UA 1KFSA 2LRDA 4ABZA 3T1BA 2YPRA 1RDAA 2BYVE 3U9ZA 4M3YA 1JJ6C 1DTTA 2CU7A 4BVOA 3WXKA 1L3VA 4HQMA 4AD9A 3P7NA 4CBXA 3FMQA 3LALA 2DMQA 4B1VA 1B72B 4XMYA 4RGSA 3AO1A 1RESA 2OZSA 3CFOA 4XN3A 2HGCA 4BR4A 1YJ9I 3CMAI 3RSEA 2JSCA 2RV8A 3FZMA 3UKGA 1VI0A 3W2VA 4LD5A 1JKOC 4AIDA 2ZM6K 3IH2A 4L0YB 3UB5A 4CEEA 3AFHA 1MSFC 2O8DB 2FF4A 2PBDA 2WC9A 2VQGA 3JSMA 1TZLA 2JVGA 2P9SA 4DQ8A 3HDDA 5KPRA 2R5ZB 4KIGA 4FK0A 3GOIA 3HJFA 3DQVC 3BROA 2HVSA 3S2HJ 1DTQA 1S9EA 2ZF5O 1ZKGA 4JX5A 3DLGA 3KETA 3RSNA 4MDBA 3ZSXA 4CBWA 2EFOA 3SPYA 5EZGA 2UUAK 1W2BM 3TARA 3DWLE 3I0SA 2QEXN 5JHUA 4NQWA 3VTHA 4MEXF 4XKVA 5IYBJ 3M8FA 3ROUA 3QETA 4J2AA 2E5LK 1X1AA 2GOXB 4XICA 3PO4A 2DMPA 1XQSC 2EFNA 2CO5A 5J1RA 5IWAK 4FM1A 2EHGA 4KBOA 3HKZA 2HF3A 3M1EA 2OTJN 1P8ZA 1RT1A 1EWQA 1D3YA 1TWCJ 2FRHA 3BCAA 2V1DA 2P5VA 1NJXA 3HRSA 4DV0K 3F8BA 3V8KA 1SD5A 3CQYA 1YT3A 3HRGA 3PQJA 2D0BA 2R5YB 5HLHA 2VT3A 3SLCA 4BQZA 5DV5A 3HRTA 3HI0A 1KD1O 4EJVA 4WX9A 2Z9OA 1LWEA 3C94A 1T39A 3SI6A 1J0RA 2X1EA 2JK3A 1JGGA 2E20A 3GLLA 1WJEA 1NKBA 2NNYA 1VQPI 3O9TA 2XIGA 4I76A 1D5YA 1A6QA 1EA3A 4H5WA 1IV6A 5AQTA 3ZQLA 3HB9A 5KPTA 5LHHA 1IZ1A 1GLEG 4J00A 1LNWA 3ZQ7A 2IA2A 4H0TB 2DT6A 4N47A 3AVFA 2KHMA 3BC8A 4UUTA 3F6OA 3I59B 1YS7A 4W97A 1RUNA 2GELA 3SJJA 3GF2A 1NWKA 1WSGA 1XC3A 5AQIA 4YEJA 2IRFG 3ABUA 2FMYA 1BOBA 2BV6A 2DK5A 2ELJA 5CPRB 1A5WA 4EHUA 1TK0A 4CF9A 1NNEA 4EATA 4K43A 3G0ZA 4QIWN 1MMGA 1RTHA 1S5JA 4RB1A 1PJRA 1UELB 5BMZA 3E7LA 1OCZH 3I53A 1ZR4A 1A35A 4H5VA 2M2EA 4CGZA 3ZETA 3VQ4A 4AQYK 3O1BA 4AC0A 1ZR2A 4EJWA 1WVRA 5E8IA 2P9LB 1ZELA 2NRVA 2IS4A 1S1VA 4GCVA 5TGTA 1I6HJ 1TTYA 2DQLA 2YHWA 2XGXA 3VQBA 4OWRB 3J80K 1JKRC 2EZIA 3GLXA 4I0AA 1OISA 1JLEA 4Q48A 3RMBA 3CYMA 1WSIA 3IP4B 3HK2A 2XF7A 1BW5A 2P9KA 3LQRA 3RYRA 3ZN1A 2ITMA 3NFAA 1Y1VJ 1N36K 1HX1A 1APLC 3CF5F 3HOVJ 2R7ZJ 4B3AA 1K6OA 3AVHA 2X6YA 1AWCA 3S1QJ 3CETA 4IFEA 4BGBA 1Y6IA 4BVPA 3OSFA 5D8LB 2K7LA 3JSOA 4OIQF 1RR7A 1Y0NA 1LW0A 1C0WA 2BANA 2I5JA 3L6QA 2QSGX 4UV9A 5LFAA 1KU2A 1BU6O 1PUEE 3VEYA 4F4KA 1WI3A 3HIFA 4F92B 5GAGP 4IL6C 1H8AC 2R7DA 3PSIA 1K61A 3V7CA 4CK1A 4WWCA 4BWJA 4CGGA 3U9GA 3NF6A 1B9MA 4KN7X 5ICCA 5KQ8A 4FK2A 5FKLA 3ESWB 2XPWA 1KA8A 1E3HA 1IBKK 2NNNA 1NJIO 4B3MK 2FQ4A 3ULEA 5K5RA 1U6ZA 1HJRA 5E1WA 3KIOA 3RIRA 4DSLA 1ZN2A 3TTDA 5E26A 4HCBA 4GKJK 1U49A 2L02A 1YLFA 1U47A 2GX9A 5AQQA 5F1RA 5C0YA 1F9NA 1HKTA 1LWCA 3FZLA 5HP1A 1NK7A 4BWMA 3ZT3A 4ZH4F 2RNJA 3S41A 2XY8A 2KRFA 3OYNA 3THVA 2DPUA 3AARA 2O5RA 4FCYA 3J7AP 4KT5C 2YI1A 1HKQA 3LDOA 3E66A 4BDYA 1ITGA 4YOXA 2HYJA 3U6FA 3MXMA 3CD6I 3BQYA 5I42A 5GAEJ 4WFNL 3I58A 1W7PD 1VQ9I 1QPMA 5HDKA 1SEUA 2OPQA 2FBIA 2Y2ZA 4LH5A 3L00A 3OIPA 3VEPA 4ICLA 3QICA 1SKWA 2HHHK 3GW2A 2P51A 2X6XA 2HTJA 2M7AA 3L3UA 5HRNA 3D5LA 2HPIA 4L5IA 4LG3A 1IN8A 1W5TA 3C2HA 4F55A 1RIOH 1MDMA 3ECOA 3AVJA 3T1HK 4CIEA 3SFZA 3PIPF 3FBIB 2GXAA 3ZPLA 4ELVA 2WTEA 1VQOI 2BTFA 4H4KC 3E9PA 4G94A 1IV8A 1HCRA 2QWPA 4A3GJ 1VQLN 4OPAA 3LP2A 5T7BA 3M8SA 2A41A 4A5NA 2HNHA 2OBPA 2VPRA 2H94A 3OOUA 4KUMA 3EYIA 2V52B 5AR0A 3G1MA 4CZCA 2A61A 2CGJA 4UV8A 3MMYB 4IOAL 2PMZN 2DN0A 3HYFA 2BY2A 4ELTA 1XSVA 1GLCG 2O4IA 5E3LA 4C3JJ 3U9DA 3MN2A 1IC8A 1L5UA 2HF4A 2HOEA 3CMAN 3A01B 3FZFA 1YITI 2Y48A 1YW9A 4M3BA 3H1VX 3LDNA 2O6GE 4XIUA 2HHWA 3JRIA 1I3AA 2PAVA 1T44A 3ZX0A 1XD7A 4XSXF 1Y56A 4FJGA 1R1TA 3KP2A 2Z33A 1S9GA 4FQGA 2ME6A 3HOYJ 2IS3A 2WAFA 1MMNA 4UVCA 2A5WA 1J54A 4M71A 4EGYA 1EV7A 3L4IA 4O44A 1KAZA 3F73A 2QSFX 1P6RA 3ZOBA 1GLAG 1QZ5A 2OCCH 1K78A 2W41A 2CH0A 4LIVA 4LC9B 4FK4A 4IO8A 4M9XA 4V2FA 2QBYA 1WB9A 4KI4A 3CUOA 2R4GA 3QOEA 2KDZA 3O4NA 4PJ0C 1ETOA 1T95A 4JS4A 2DYRH 2FOKA 3LSIA 3AG3H 4RM2A 2E2NA 1U9NA 3OS2A 2OAZA 4ZYAA 5JI6A 4PJNA 4LB6B 3D5RC 1STZA 1G3TA 3SJMA 1UAAA 3DMJA 3TAEA 5KVRA 2XRLA 1QE1A 3OOPA 3FZHA 1XC5A 4XH5A 1WN7A 1O7FA 4CEFA 2OPPA 1U78A 1YE9A 2W48A 1GLFO 3AVIA 1HKCA 3AVNA 3OYDA 3M8JA 4CEAA 4J2EA 2R7RA 2DY4A 3EKUA 2ZQBA 2OJED 3BG6A 2XF6A 5FO5A 3WTSC 4JKDA 3LOCA 5IP6A 3IH4A 4RS8A 2CW8A 3FWEA 3RVCA 1JHFA 4UUSA 1VQ6N 4C2MJ 1RBSA 1W4MA 4XORA 1VSJA 4KDPA 4DZJA 2GEMA 3VQEA 3ZSWA 1RZ4A 2GIZA 2RQPA 2IA0A 4CJ7A 4RAYA 2BY1A 1QQOA 1MNMC 2QQAA 3A5OC 2VB6A 1T3VA 3H3ZA 2OQRA 2ID6A 5E18F 3I56N 3EZ5A 3DLBA 3KEQA 4UVAA 4JS5A 1YIOA 3ZMDA 3H5RA 2JMWA 5HDNA 3QNNA 3ZMSA 2D5RA 4B9UA 2VN2A 1KU7A 3VQ5A 4XEIA 3DXJF 4B4CA 2F4IA 2VOOA 2VJ5A 4CYCB 3R3LA 1Z0XA 2QKMB 4DGWB 4ESJA 5FRNA 5JVHL 2HHUA 1W0HA 1NG7A 1NK6A 2D45A 2HQAA 4A2UA 1X9JA 2E88A 2B7EA 4DQSA 4MO7A 5EG0A 2FF3B 2ISYA 3GZ5A 2O8KA 5L3CA 3HOTA 4EZ9A 4ENNA 2R0QC 2NRTA 4II3A 4ENJA 3CFRA 3FF5A 3C0BA 1W7PB 3KHYA 4E4HA 1YHQN 2PEXA 3KLFA 1FMVA 2CQNA 2VJ4A 1U04A 2NOGA 3HOSA 2OPRA 4EZ6A 1B4AA 3BR6A 5FJ8J 3K59A 3V81A 3DLHA 4F2RA 3CCUI 5HS7A 1XWLA 3Q7CA 2Y69H 2X1DA 2CUEA 4F93B 2JJ7A 3W6JB 4JKCA 4O5VA 1D5AA 4QAGA 4B1WB 4DFPA 5B3SH 2J4RA 1HSTA 5D5XB 2QTDA 3K1NA 1R5GA 5E1ZB 1QHGA 2UV1A 1EF4A 1RBUA 1YUWA 1DGRM 3QINA 3KYLA 3VWBA 2ZCWA 1SAZA 4KH6A 4RG8A 2XV4S 4PFOA 1HNIA 2A5XA 3RJPA 4RLFA 1JUSA 1JHHA 2DA1A 2D1KA 3E5QA 1BJAA 3A0HC 2P9PA 2ELKA 3M07A 3H0DA 3HSCA 3I0RA 4LY7A 2VWJA 2DTUA 4U87A 4YOWA 4X1EA 3C1DA 2FBKA 1G3WA 3CCVI 1N78A 3RQ4A 3TU5A 1XC9A 3TGNA 4MFDA 2PMUA 2LD5A 2FBTA 3V7SA 2FSJA 5H6RA 3JAMK 4WXCA 4CERA 3CDIA 4BYYA 3SHFA 4F7ZA 3EUKL 3KZZA 5F0CA 1IG7A 1TUUA 4E1NA 3K5LA 1R4MB 3H3VK 4PQUA 3K70D 1FNNA 1HW5A 2PX9A 2W84A 3H9JA 3K10A 4D7MA 3QDKA 2O9LA 1UHWA 4AM6A 1FWZA 2XSDC 5CKTA 4W5TA 4A3FJ 1Y64A 2I7PA 3DRPA 4JRQA 1P7JA 1HA8A 3VGLA 3CTAA 4FJXA 2W6LA 3SAGA 4KMUX 3ALYA 1Y1WJ 2H1LA 3PFYA 3QFUA 1RT5A 5IYDJ 3ENOA 2G0EA 4HOBA 2EH3A 3O6WA 3WXLA 2F6CA 3C6HA 4YOVA 3ZT1A 4HA8A 2Y9ZA 5LL6Z 3THYB 5J8FA 2IT0A 3CD6N 4FWKA 2M1BA 2P7VB 4CGIA 1B9NA 4JLHA 4NLBA 1BQNA 3T0YA 1DP3A 1IKXA 4EEFG 3KKRA 2HFHA 3VQPA 4BGAA 5M1FA 1TT5B 2CQXA 4XRFA 2HOTA 3I33A 1VQNN 4QSHA 5LRSA 2WBNA 3SEZA 3T3FA 4CJSA 3A01A 1BA0A 2ETJA 1J9AA 4ITVA 1YFHA 1YX5A 4MLEA 5BNGA 2ZWHA 4CHOA 1N32K 5HODA 2AHQA 4DOZA 1T98A 2DTRA 1IXCA 2LBFB 3I55N 5F64A 3CMMA 3GX4X 1V4RA 4BRFA 1QZEA 5HVQC 3T69A 5C44J 3BCBA 4AYBA 4G1QA 5ILSA 2MBFA 5DK5A 4HLYA 3SUNA 2KP6A 4DWIA 4RWTA 4FPBA 4JI2K 3BTIA 1KQ0A 1WAFA 1TQMA 2JWTA 4NC6A 3ENHA 3O80A 2VGNA 5ELZA 1T05A 2W24A 3N05A 3KTQA 5AZIA 1UB9A 4XKCA 4PJLA 1HMVA 3R6MA 3CCEI 3TTFA 2HQ5A 3ASMA 2Z1JA 3QEWA 5FKNA 3DLLL 1P92A 2L9SA 2DA3A 4ENMA 4FE4A 3PIOL 2BEOA 4GNIA 3E5UA 5C15A 3TAGA 1WFXA 2M87A 5KAFC 3G6EI 3C7NA 1TL8A 1Q1VA 1LEAA 2K5CA 2NXNB 3CDLA 3H0GJ 4NBQA 2P9UB 4B9SA 2O7OA 3K5OA 4PUOA 1CXUA 2H8WA 3GTQJ 3VF4A 4LFBK 3OVNA 2MH2A 3L1PA 2VOPA 3IWZA 1LUJB 2EX3A 3A2FA 2ZGYA 3O9UA 1NGJA 3FGUA 2XRIA 3P5JA 3QBXA 4AHUA 4HF2A 2FBVA 4WFAL 3OJUA 1XCBA 2JVHA 1O7LA 1XMAA 2M0CA 4P9FA 5AQUA 2UXBK 4IQJA 3QP5A 3DXKB 1P7IA 5GAHJ 4EHTA 2FC0A 1KGSA 2X6NA 2B0LA 3SQNA 3V6DA 2HOAA 4NLCA 2F48A 1W1WE 2CQ7A 3DF8A 5D4RA 1WSEA 4KTQA 2UXDK 3FM5A 1JCFA 2ZJPF 4HRIA 1X19A 1ZGAA 4XLHA 4ZDLA 5KHDA 1MA9B 2F96A 2GIVA 1C0UA 2B4JA 3IUCA 5HBMA 1GLJO 3V9XA 3SV4A 3V4IA 1CQTA 4NXNK 3D6RA 4JYKA 3GYHX 3HZ6A 4QCLA 4KKOA 2LR8A 3TTCA 1V5EA 1ZRCA 4CE9A 1RDBA 1X3MA 4M3ZA 1MBHA 4G9YA 4BJ6C 1O3QA 1FP2A 5GAGJ 2AQFA 4TSXA 4Q0BA 3SMSA 1AKHB 1HYSA 3K1PA 1BI4B 1I5ZA 5GIOA 3QFPA 4NC8A 2MH9A 3QYEA 1JUMA 1TP4A 4FX4A 1HNWK 3BG7A 2NRWA 1S7EA 2BXYA 1BIBA 3GTJJ 3F22A 4WYBA 3OV8A 3CMYA 4QS7A 1FLIA 4C23A 3J7YP 3NGIA 4K25A 3HOZJ 3VEWA 2EINH 1IUYA 5HRSA 2L7ZA 4DB3A 3LSRA 2ME0A 1Z3XA 4FOIA 2IS2A 4FZXC 2VQCA 4L9JA 2XAGA 4UB6C 3V8JA 2DFIA 5HS9A 3RDIA 3RPUD 4IX7A 4IKFA 1TYQB 3VQ9A 4DSFA 1NGFA 2O8BB 1EH7A 4QPQA 4EV0A 1EO1A 3KEYA 3C6AA 5CZ2A 4KHWA 2IAIA 4CJTA 2R93J 4BC3A 3B6PA 3QEXA 1TK8A 2I5UA 2COBA 4XLAA 3QMLA 3OWTA 2QQ9A 1PUFB 4IJNA 2VYPA 4BQOA 4W5QA 1S1TA 4M3TA 3F5TA 5CLSA 2KIMA 3GZ6A 2WV0A 2A68F 2FNPA 4FT8A 2QSHX 5JLXA 3OSGA 4HVJA 4HAMA 3TW6A 1R59O 3WG9A 4IHTA 4LH4A 4CCMA 1WJBA 3VQDA 4DFJA 1YYVA 1YRNA 5F08A 5AQSA 2XASA 3GBGA 3SCXA 3OBWA 1XGMA 1H9GA 3TO9A 1IW7F 2JUCA 3O9SA 3K4MA 1NK4A 2PY5A 4HNUA 1HLVA 3B73A 5DCFA 2IVOA 2AO9A 5DCMB 3SDGA 4DUYK 4DQPA 1D0ZA 3OR1C 4BXUA 3CO7C 5BPDA 4S04A 1ZTRA 5AQXA 4DSIA 1U5TC 4EM0B 3MWMA 4KTWA 3ZQHA 1NH3A 3RTRA 3M8RA 1HKBA 4DHYA 1G59A 3ATUA 4P5OA 1K4SA 4HNTA 4XK4A 2P8TA 5B8HA 3HM8A 5JLHA 1O3RA 3P9CA 4RCHA 3IFRA 5AQJA 4Z4IA 1XMKA 2G7HA 3TPQA 5DD8A 4C3HJ 5FLXZ 3D2EB 4YIIA 5IOYA 2W25A 4YOYA 3HM9A 1S6LA 2VODA 4FJMA 3V9SA 4BQQA 3M3YJ 5LGNA 3MZYA 1WJCA 3GTGJ 5AQOA 4DQIA 2XDVA 2QK9A 2L3DA 1ETYA 2M4KA 2FX0A 1UHMA 2M7BA 3KP7A 2DTZA 5D6FA 2HBMA 2RPIA 4RMNA 4WXHA 2DA5A 4BEHB 5H2FC 4JBAA 3EO3A 5BQTA 3DAWA 3K4JA 3NH0A 1ZBLA 2P5OA 2KFNA 2Z99A 2QWMA 4C8KA 3ZCMA 2F8TA 3O1WA 4IVNA 4CF2A 4FJ5A 3UKUB 3TOBA 2R92J 4CF1A 1BI0A 1NK2P 4JKEA 4A59A 2AXTC 4FLUA 2QXFA 2HHXA 2W1OA 2QWNA 4FOEA 4A12A 4DV7K 3E01A 4OLBA 1D0YA 2VASA 1OH5A 2K86A 3H35A 5D4SA 2L9NA 1RETA 2W82A 3F8CA 4Q5VA 3LM9A 2L0KA 2B63J 3PNYA 5GINA 4FJ9A 1YJNN 4B3XA 5BOXA 3H46O 1T8EA 2GWKA 4EVIA 2UXNA 4A3EJ 5C10A 2AP1A 4DYRA 1YW8A 2ID3A 3T1YK 2DBBA 3B6CA 3RPUA 3IRQA 3ERED 3OIQA 4I98B 4E7KA 3LAPA 2IS1A 1RBVA 4I09A 2E8AA 2YX6A 5AFUA 1T7PA 1YJWN 4ZJZA 1OR7C 1NGDA 3T19A 3WTVC 3OYJA 5ED4A 3LQQA 3ZRGA 2VIXA 4HYEA 3A5MC 1OH7A 2JRTA 1REVA 4FWSA 5CYQA 3RRHA 3A8YA 2QEXI 2R7QA 4U0VA 1HW1A 3K9JA 4BREA 2P9PB 3IKTA 3FISA 3GO5A 1BI2A 5F04A 4FVMA 2LNBA 3LSTA 4O0IA 2YX4A 3SDBA 1A5JA 3DV8A 1U5TB 1JT0A 1RDCA 1DGKN 3MXJA 2TCTA 4CEDA 1YX3A 3L2VA 1X1DA 4B3TK 4LMYA 1PUFA 3ZCOA 3RRGA 1W9HA 2QENA 1VSFA 3HSTB 1VQ5N 3HKZN 4XOPA 3K58A 2WB1N 5FLVA 3ZT2A 1G3YA 1FBSA 4RGUA 3H6EA 4DSEA 4WQ4C 1N34K 4A3DJ 3DXMB 2XKOA 4AILC 2KLOA 2P81A 3RKWA 4G6QA 2KMUA 1JI8A 2GV9A 3GDQA 4PL7A 2DQRA 2E1MC 2K9QA 1MWKA 3FE1A 3HSFA 2B6AA 1J5EK 3C65A 2ZJQF 1RT7A 4FWQA 1MH4A 4N4NB 1Z77A 2ZXIA 3ECHA 4KHSA 4YDUA 3H45C 1RUOA 4LIUA 3B8AX 4K0KK 3CJRB 3L2QA 4AYBN 1B9FA 4WF9L 1FTTA 3O9QA 3QIPA 3P31A 4M3DA 1TW2A 4DTSA 1YIJN 2HZTA 1GXPA 2XGEA 3MKYB 1D1AA 1M1EB 1X3UA 3QYFA 2BVMA 3FM3A 4PK4A 2R3SA 3WTZA 3IRRA 1H89C 1KXPA 4BQNA 3AG2H 5DYMA 4Z6YA 2A42A 2F9WA 1UAXA 1VQ8I 1V4TA 1YO5C 2VGMA 5BR8K 4B44A 4ZZDA 3S8PA 4WQ5A 2QUFA 1CZBA 1KAYA 5M1QA 5IT3A 3RTVA 2A3SA 2W7NA 4O0JA 4OJRA 3X2QH 4WF2A 3P83D 1BA5A 4ZZLA 3PIOF 3KFWX 3J8AA 4BR9A 3L9FA 1SL0A 2Q2EA 1BIZA 3MEEA 5K7ZA 4BC5A 1OCOH 5EYRA 4O5BA 3VGMA 5TKWA 4RLQA 3I71A 4CO8A 2F5CA 3J7ZO 3SJHA 2QYOA 2X1CA 3QB0A 1YI2I 4O3MA 4BRHA 4K8XA 1FK9A 1NOYA 4RB0A 4KO0A 3FHZA 2ZB9A 2E36A 1ZGWA 3M5RA 2MABA 2XVCA 2RQQA 2WV1A 5L3BA 4RA2A 4NYFA 4NC7A 1TQPA 4KN4X 3W6VA 2E60A 5GTHC 1X1CA 1VQ5I 3IRXA 4FW2A 1E3MA 3C7NB 3NE6A 3S3NA 1XTAA 3VTIA 3J7YJ 3VB2A 5EJCA 2NAZA 3L09A 4KISA 1MGTA 3IKVA 2BXZA 3HBTA 4KB0A 1B1BA 3NVMA 3S1RJ 2JUGA 1C0GA 2NVUB 3HL8A 1EH6A 3DPLC 3TMOA 1BL3A 5AQGA 1SFEA 5EEHA 3WGGA 1Z25A 2MC3A 3S93A 1O3TA 4JKBA 4DQ2A 1FIPA 3JRCA 1FT9A 2DA2A 2ZXHA 5J6XA 5CZ1A 3VEVA 4NCAA 3IAM2 4GRIA 2F5FA 4DLEA 1OQYA 3AVMA 4A3IJ 3RCOA 2GLOA 3TDZC 1ZK8A 2QI2A 3CCQI 3AO3A 2KJCA 4H5TA 1Q9XA 3LA7A 2D4WA 2HU9A 3Q0VA 2Q0UA 1LFPA 3HEFA 4JI1K 4Y7NJ 4BEHA 2NNWA 3E1SA 2HVQA 4L9VA 4XOTA 1LEBA 1ETKA 1TL1A 3QPTA 1X9WA 3TSPA 1WI9A 1MMDA 2VQHA 4OPHA 2VI6A 3L2UA 3MN5A 2EK5A 3THWA 1HYZA 1NJZA 1BW6A 3VOEA 4KHNA 1HR0K 2KLAA 5HLFA 2CJJA 3M1CA 1HQUA 2CGKA 4F3QA 4CJ5A 3QLHA 4A5AA 1GDTA 1MD0A 1NKCA 2P6TA 2M4GA 2QQ8A 1OMIA 1WPKA 5AIQA 3T5XA 5LGTA 4JK7A 2G8UA 1ZBHA 2QKKA 3JRGA 1C6VA 3M1FA 4JK1X 1W7AA 2CV0A 1HKSA 3I8BA 2EWNA 2R7OA 3L8BA 2VC1A 5F2RA 5C2DA 2YJFA 5LD2C 3NHGA 3S2DJ 1FSHA 3H5NA 2JPCA 1V4SA 3GUDA 3CC4N 4HUGA 3ONQA 4LFAK 2MLKA 3BDDA 4XLNF 1FYKA 1HSJA 1XMQK 1WOQA 4LOCA 2JA2A 4K2EA 3CO6C 4KT6A 3WTUC 1KTQA 1ULYA 1FOYA 1WGXA 5JLFA 4W5RA 1RI7A 2DK8A 2ZXWH 1WSJA 2HMIA 2UXXA 2MG4A 2ZC2A 1TUYA 1IBMK 4KAZA 1IUFA 1GOBA 3FMRA 4CCLA 3C18A 2WONA 1Z9CA 5IT9Z 3LMMA 3HC7A 3REOA 3CJ1A 2LFBA 5EDNA 3HOWJ 1YTYA 2FBXA 1A5VA 2GTDA 3FIWA 3O8MA 4A69C 2JT1A 4CCOA 2XSJC 2XPVA 4AIHA 1FYLA 1FKPA 4OGCA 2HQNA 2ASPA 3ULEB 3R0AA 3ZQCA 3RZDJ 1B92A 1VFCA 2M5WA 5E1XA 3O3KA 1C0MA 2GWJA 2YHXA 2ZJQL 3QODA 3NGZA 1ERDA 1PP8F 2OQGA 4B8XA 1ATSA 1AA7A 1MJBA 3MECA 2DFFA 2FBYA 2K9LA 2W00A 3FMSA 1BI4A 1R0AA 4A3CJ 1QBJA 5BR9A 1SKSA 4ISFA 4B8CA 2XUBA 1RCHA 1HKGA 5FLXK 2E1ZA 4KFBA 2WTUA 1X1PA 1FOWA 1O13A 2VWKA 4AVPA 3VYTB 3CC7N 4B1RA 1IN6A 2DFEA 4CVNE 2V6CA 5KRSA 1RTJA 3KZIC 3ZXSA 2E2QA 1IO2A 5HLIA 2V51B 3NCIA 1XX5A 2PFBA 3CCMN 3CCLN 2CUFA 2GUPA 3K1MA 1XMXA 3DBHB 4IG3A 3M8QA 1A04A 2EV6A 2VE8A 1HW2A 5EVZA 4DQQA 3S2WA 1XHZA 1TKDA 3G71I 4YIRX 1JXSA 4Y17A 1ZXOA 3H1CA 1VNDA 5LRRA 5AQMA 1XN7A 3A0BC 3AY9A 3A1YA 4B8AB 1B9DA 4ISEA 4YORA 3TAMA 4CJ3A 4TV7A 4CJUA 1KC8O 4DYCA 4IEJA 4UY8I 1L3SA 1BN5A 2LKPA 5JHFA 2V9PA 3H08A 4BJ5C 2E35A 5CVUA 4QTRA 3V42A 3Q7BA 3CXCM 3COAC 4YFNF 3D2FA 4HF0A 3BZ6A 2G8KA 1R71A 4A0ZA 1ZQ3P 4EAHD 3AKZA 1NGEA 1QZYA 3KLIA 3LAMA 1TNSA 4E7ZA 4BRNA 2EQRA 2EZKA 4WCGA 3OYFA 2H27A 3VERA 1MZBA 2CYYA 4GGGA 3VA0A 2IVMA 1NGGA 3LNQA 3VF2A 3K4KA 3BEXA 3GTMJ 1RT2A 1R23A 3LPUA 4MTEA 1WSFA 4A6DA 2EV5A 2OU2A 4IO9L 2I7NA 4HEA2 2Q3SA 2FXUA 3EL2A 4DV4K 5GPAA 1R6RA 1WH5A 1RILA 1VQKI 1FX7A 5AONA 2CW0F 4FLYA 2DO7A 1LVKA 4DIQA 2RVCA 4RAFA 2EFQA 3V4GA 1W0UA 1FJLA 1RT3A 4O5FA 3E3VA 3G1LA 4CGDA 2ZJRF 4A0YA 2ISZA 3MD2A 5HRPA 1GXQA 4ZYEA 1FOXA 1IKWA 2ITGA 2ZFWA 4UB8C 1Z6RA 3OYBA 3QEVA 4CJEA 3ZX3A 2E7XA 2C6YA 2FUG2 2VXDA 4A57A 5JMVA 2E5ZA 4NO7A 4PKGA 2IOCA 1RNLA 4UVBA 4H0YB 3LWLA 4IOAF 1TLHB 2AA4A 2FSWA 1MJAA 2A6HF 2NS0A 1X2NA 2X78A 1JLFA 2ESHA 1B8IB 3DYAA 3TABA 1GLBG 1SMYF 2XB0X 4O8UA 1BO5O 3LL7A 2FLOA 3N4PA 2A07F 4DTUA 3QU6A 4ZYDA 1LAWA 4I9LA 5JVGL 2JA6J 1GOCA 1U48A 3IHUA 2I8DA 4OIPF 3HTSB 2X4HA 1XSDA 1U3EM 3EYZA 1WRJA 3ZQIA 1U8RA 4CZFA 3BY6A 4M6VA 1HDPA 3F9MA 3LSPA 1J9IA 2E2IJ 1F36A 3CJQB 3EUHA 4QPOA 2O0YA 3MZHA 3AG1H 3E6BA 3HYIA 4CGFA 3EN9A 3CC2N 4I6MA 1QTMA 1QQMA 3HG9A 2OUMA 2P9SB 4IOCL 4CD1A 2VBXA 5TRDA 2CQQA 2DDAA 1ZG3A 1HPMA 4R8HA 1ZGJA 4HNVA 3VSKA 4CJLA 2W57A 3PX4A 2CS3A 2OA4A 2V1NA 2RREA 4IF4A 2M8GX 4IEEA 1B6AA 2EJRA 2OD5A 2XAHA 4YIFA 5LHIA 4C2UA 1BUPA 1X3NA 5TJJA 4KNYA 2JA8J 2OANA 1D9FA 4H4MA 4DTPA 3B02A 4XRSA 5KNLA 3DLAA 3OYHA 1U5TA 4DTXA 2Q1ZB 4NCGA 2IGOA 2JRMA 4E6KG 1S9HA 3MKLA 2YNGA 3LDPA 2G7UA 2JQ7A 3CJ7A 4YRVA 4IRIA 3CCUN 4L9TA 3HXMA 5JS2A 2JGUA 1UHSA 1WJ5A 2NYXA 2YCHA 3MKZA 3HTVA 3NAEA 4OVLA 3OYKA 4HG2A 5LMUK 5DMRA 1S1WA 4KHUA 2F4VK 2YR2A 1OPCA 2HZDA 3M3ZA 2L54A 4QOZB 1HXDA 4C30A 1W36D 4OX9K 4XKBA 3VA3A 4B3RK 1OCCH 5FFXA 4B43A 2KRHA 3S1MJ 4Y52J 1WAJA 1R5HA 4J19A 1MMAA 2A69F 1LQ1A 1K73O 3V1QA 4WE1A 3WQUA 1CXQA 5BRDA 3SXYA 2WAEA 3BQZA 5HLTA 1EETA 3V9UA 1A36A 3BDPA 3A2KA 3BOQA 2DW4A 4R5PA 2V79A 1BR1A 2RDPA 5J4YA 3CP8A 1X4OA 3PNVA 4MQ9F 1JLBA 1IH7A 1RGIA 2Q31A 4CHQA 2OTLN 1REPC 4XSZF 1IG9A 3DTEA 3VOVA 3CF5L 2JTVA 2FJ1A 3QQAA 3QU3A 3MEGA 2RNGA 1OLTA 4ISGA 1KSPA 2KTQA 5I3UA 3BPXA 3OS0A 2UUZA 2YX7A 2EWSA 3D45A 4C3IJ 3QEPA 4A5BA 3NGYA 2O8EA 1VSMA 2K27A 5CYVA 3AA2A 4FTHA 3MMVA 3K4CA 5AQFA 4ASNA 4E19A 3CC2I 5M1NA 1JKPC 1NOZA 4I2OA 2V9VA 2GBYA 3VQQA 1B8IA 1D8JA 1ZG1A 3MAQA 3WHBA 4KICA 3VODA 4Q47A 4ZTFA 1WBDA 4OAZA 5GP9A 1NTCA 1U6GA 5D3GA 1KQSM 1SVOA 2I10A 2LKSA 5TKYA 4ZC3A 2PJRA 3F2KA 5J3LA 2P9IA 3KZYA 4RB3C 2P9KB 4LITA 1S72I 2VBYA 3ZMZA 1ESVA 3DRSA 4MLHA 4CFCA 4DTNA 2KZGA 1XI1A 2VJIA 2F9TA 4LF5K 3ERMA 3HBLA 4CJWA 3CUQB 4FLVA 3KP3A 2NLXA 1N6QA 4FJKA 3GVAA 3AVCA 1KLMA 3I4MJ 4KIFA 4XONA 4G6DA 2Y75A 4FWRA 5C12A 3MAJA 5K7FA 4EJUA 3ZP5A 4DU3A 1XMOK 3R0JA 4CICA 1DPUA 2NRRA 1GV5A 1IJJA 3ZSZA 2L5QA 4IOXA 4CJ4A 5AQLA 2EZHA 3NWTA 2JPBA 3MCZA 1ZREA 5LGUA 1G15A 3NEUA 1JTXA 3UR3C 4RBOA 2IC3A 4EM1A 4W5NA 4XRMA 4XLCA 4CZMA 1HNVA 3BG3A 3OW2M 3SUPA 1BOTO 2LP0A 4DQRA 3RWUA 4H0XB 2FSKA 2KZZA 2R7SA 3F8MA 4JI5K 4DZPA 2E4LA 4MGRA 5AQYA 2XF5A 4EJOA 2O8CA 3CZ6A 1ZC6A 2LH9A 3QAHA 1BM9A 5E20A 2VT2A 1FOKA 2PJRB 4CESA 5EEAA 3VETA 4N56A 4DLGA 3PX6A 1MSEC 4FSVA 5HNHA 2LREA 3GCMA 4UHTA 3KKSA 4C1NK 3LDSA 1JT6A 4B9VA 5IYCJ 2L7FP 2XB5A 1QHAA 4KYWA 2RKHA 2H3GX 3DKXA 2QWWA 1IG8A 1UFMA 1JCEA 3WU0A 1IRGA 1Z67A 1VQMI 2WAQA 3J80Z 1YTUA 4PKHA 4FHTA 3KJVA 2GA2A 1YHQI 3SK3A 5GAEP 5IP9J 4JEPA 1BR2A 4IOCF 1MIJA 1HQEA 4CZLA 6PAXA 5K5OA 2O8EB 3FX3A 4LJZF 4CHNA 3SFIA 1S1UA 3M8PA 4IRHA 2HXIA 5F0HA 1ZYQA 3VSLA 5IY5H 4CIFA 5AQVA 3GFLA 3KCCA 2JZYA 1EKEA
chains in the Genus database with same CATH topology
1TV6A 4CHYA 4DQPA 3NH1A 4DSIA 2R7YA 3G10A 4KTWA 2KQ2A 3M8RA 4HHTA 1NK5A 1ZBIA 3RR8A 3UIQA 3OS1A 4BE1A 1VSDA 1QS4A 2OZMA 2HVHA 4CGJA 4Z4IA 1X9SA 4C8OA 2YV0X 3QO9A 3L2RA 4ID1A 3V4IA 3LP1A 3HM9A 3SZ2A 2E6MA 1C0TA 4FJMA 3AO5A 3V9SA 4DF4A 2WOMA 1RDAA 4DQIA 4M3YA 2QK9A 1DTTA 1JXEA 1C1CA 1A5XA 3OYCA 1L3VA 2RPIA 1NJXA 3L3VA 3KK2A 3AA4A 4B9TA 1SV5A