1IO2A

Crystal structure of type 2 ribonuclease h from hyperthermophilic archaeon, thermococcus kodakaraensis kod1
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
213
structure length
213
Chain Sequence
MKIAGIDEAGRGPVIGPMVIAAVVVDENSLPKLEELKVRDSKKLTPKRREKLFNEILGVLDDYVILELPPDVIGSREGTLNEFEVENFAKALNSLKVKPDVIYADAADVDEERFARELGERLNFEAEVVAKHKADDIFPVVSAASILAKVTRDRAVEKLKEEYGEIGSGYPSDPRTRAFLENYYREHGEFPPIVRKGWKTLKKIAEKVESEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic center of an archaeal type 2 ribonuclease H as revealed by X-ray crystallographic and mutational analyses.
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
molecule keywords RIBONUCLEASE HII
total genus 69
structure length 213
sequence length 213
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2000-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 1io2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1io2A01
3K2PA 3QIPA 3DMJA 3V9SA 5EU7A 1A5WA 1ASUA 1S6PA 2Q3SA 3AVJA 3QINA 3KK3A 2XY5A 2HHVA 4CJ5A 2YKMA 1SUQA 2XY8A 3CQ8A 4FLZA 1HQEA 2IS3A 3NFAA 5KRSA 4CJPA 2XO7A 1L3VA 1VSDA 1RTHA 1WSEA 2DY4A 4Q5VA 3SYZA 4NCBA 1D5AA 1BIUA 2VG5A 4FJ8A 3KD1E 4F2RA 3NF9A 1BISA 1RT4A 3ZSYA 4DQPA 4CIFA 4AH9A 1VSIA 1HRHA 4RW6A 1KRPA 3AVIA 3BGRA 3TAEA 3EYZA 3AA2A 1T8EA 4KTQA 3CFOA 4KFBA 4CF0A 4UQGA 1T7PA 4EZ6A 3QLHA 3VN5A 4CFCA 3NGYA 1RNHA 3P5JA 4DTXA 1QSLA 4MFBA 4N47A 3VQAA 4CGIA 2WONA 3CFRA 4DTSA 4LH5A 1KCFA 4OGEA 3NGIA 4OPJA 3V6DA 1BI4A 1VSHA 4HHTA 1NKCA 3PV8A 4DWIA 4CJLA 4KHSA 1RT5A 4CJKA 3SUNA 1LWCA 2HHTA 3SUPA 1NOYA 4FZZA 4JRQA 4DSLA 1BQMA 1QHTA 2I5JA 3G0ZA 3AVMA 3QEXA 3WNEA 4HUFA 3OYDA 4IKFA 3NF7A 1VRUA 3LDSA 3LP0A 3V1RA 3AO2A 3LANA 5KTQA 4LH4A 1TL1A 1X9MA 3LWLA 2PZSA 1JLAA 2QKBA 4RW4A 4HVJA 4OKKA 2HHQA 3HL8A 1ZYQA 4CJSA 3NH2A 4FW2A 3VQ4A 1IH7A 3JSMA 4M3TA 3K58A 3T3FA 4FJXA 4FJHA 1IKYA 3RR7A 4KV8A 1NK4A 4DTUA 1TKDA 1SV5A 4W5NA 3CG7A 4PQUA 1JXBA 4CK2A 4MQ3A 1BHLA 3ITHA 4ICLA 3OJSA 4FYDA 1SKWA 3OYEA 3ZT2A 1T03A 3K5MA 4IFYA 3HYFA 4O0JA 2P51A 1HYZA 3AO3A 4CGJA 2PY5A 4DTOA 1I3AA 2KZZA 4KREA 4JS5A 3V4IA 1CXQA 3AO5A 3JYTA 1KTQA 3PX0A 3WNGA 2GBZA 1HNVA 4CIEA 2BGGA 3MXJA 1WSFA 2E6MA 3IAYA 4H4MA 4AHVA 2X6SA 2AJQA 1WSGA 1JLFA 1FKPA 1UWBA 4CGDA 1NK8A 2ZD1A 4FJNA 2P1JA 1RCHA 1HYSA 3ISNC 4E7KA 1D8YA 4YFUA 4PA1A 4I9LA 1A5VA 1CZ9A 3HPHA 3RRGA 1J9AA 3TARA 4N56A 4FJKA 3DOLA 1RT2A 4B8AB 1TKXA 3ZSQA 1U47A 4CGGA 3HP9A 3FFIA 1JLBA 3LALA 3OYMA 3KK1A 5I42A 2XHBA 4C8LA 4DSFA 3HK2A 4QCLA 3F9KA 4E7JA 1RDBA 1J5OA 3QEIA 2RN2A 4B9LA 2G8UA 1RTJA 1IKWA 3S3MA 1NK7A 3K5LA 1LWFA 3E01A 1JXEA 4CERA 4CCHA 3K5OA 4M3ZA 3L3VA 1Z25A 4I2QA 1EETA 2XY7A 1U49A 3ZSWA 2G8FA 1TVRA 3G10A 3TAMA 4E7HA 1KLMA 4PY5A 2HNDA 4FJ5A 4KHUA 1HYVA 1KFDA 3KLFA 5I3UA 4EP4A 1IKXA 4DF4A 1IO2A 4DTRA 1TKTA 4BE2A 1YTAA 4C8OA 1WNSA 1SL0A 5FRMA 1DTTA 4B08A 1N5YA 1EP4A 3HPGA 4TSXA 3KLGA 4FK4A 1EKEA 4RG8A 1JKHA 1FXXA 1W0HA 4CJVA 4DU3A 2BANA 4I9QA 1VSKA 2Z1IA 3NDKA 4DF8A 3I0RA 4OPKA 4BDYA 3EY1A 4BE1A 3QNOA 4FXDA 2IAJA 3KKSA 1REVA 4BACA 4CF2A 1S1VA 1D9FA 1L5UA 1S9GA 3AVFA 4DTJA 1NK9A 4L8RB 2DFEA 4B9MA 1S5JA 2ZE2A 4FCYA 3DLGA 3SJJA 4ZTFA 4B9UA 4CJTA 1TV6A 3LWMA 2HVHA 3VA3A 4KO0A 1YTUA 4H4OA 2FC0A 3VQ5A 4GVMA 3ZCMA 3LAMA 2HNZA 4O55A 4OJRA 3KLHA 3NH0A 1LAWA 2ZQBA 3KKRA 4O44A 4DQIA 4Z4FA 2XRIA 2A1RA 4M3UA 2F96A 3HVRA 3OYHA 4FJ9A 1ITGA 3VQPA 3BDPA 1GOCA 4FVMA 4B9VA 5E41A 4I7FA 1WAFA 5SZTA 1BGXT 3V1QA 4W5RA 4OLAA 4FM1A 4CJRA 4CGFA 3TABA 1VK0A 4CFBA 2D0CA 1Z26A 1BCOA 4E7IA 3AVGA 3DRRA 2D0BA 3HPOA 3D0PA 2Y1IA 2YHAA 3ZSXA 4DFKA 1XC9A 3SQ4A 1MU2A 1RBTA 3AVCA 2D0AA 3CYMA 4CJQA 1ASVA 3S9HA 1U4BA 2RF2A 1ZBUA 2HB5A 4CHOA 4OKEA 1U48A 4AHRA 1L3SA 1JL2A 4CFAA 4E3SA 4M42A 4C8MA 1J53A 4KTWA 4FLUA 3THVA 1KFSA 4CEDA 1QQCA 2ITGA 3MECA 3ZSVA 4W5QA 1KVAA 1K6YA 3AV9A 3ZT4A 3QEWA 4AHCA 3CM6A 2IDOA 1Q8IA 3AO1A 4CJEA 2HHWA 4YNQA 3O3GA 4FK0A 2Z1GA 1UA1A 1KVCA 2KW4A 4KI4A 4B8CA 3VQEA 4DFMA 2YNFA 3LP1A 3TAQA 3L3UA 2YNIA 3TR8A 4G1QA 3NHGA 1XHXA 3QEPA 1QE1A 1QS4A 3U6FA 2KFNA 4GMJB 1EX4A 1XI1A 4FJIA 5HRSA 4CEZA 3VQ7A 5CYQA 2FBYA 3V9XA 2Z1HA 3SNNA 3I8DA 3TAPA 3HXMA 3CFPA 4F2SA 1VSLA 5C42A 4DQRA 1TK8A 4KAZA 3KLEA 2KTQA 3TAFA 2DTUA 4H8KA 3KIOA 4CE9A 1GOBA 3DRSA 4PWDA 3OYLA 3PUFA 2D5RA 2ETJA 4CEEA 4BE0A 4PUOA 4J2BA 2O4IA 4FM2A 3OYAA 3K57A 2YNGA 4DLEA 4CJUA 2KFZA 3KD5E 3I0SA 1XHZA 4DLGA 1W9HA 4CJ3A 3OYJA 2QXFA 3WNFA 4CGHA 3RMBA 3SCXA 1QTMA 2E6LA 3NF6A 3HJFA 4E7LA 4K8ZA 1RT3A 1HNIA 3DI6A 5J2MA 4CIGA 1LV5A 2B6AA 4FLXA 3PX4A 2RPIA 4FJJA 4DTNA 5JS2A 1RDCA 4CJFA 3OYBA 3RTVA 4JS4A 4CESA 4KHYA 3MEGA 3M8SA 3MXIA 1VRTA 1BL3A 3NGZA 4AHSA 3S3NA 5HBMA 4CEQA 3PY8A 4BWJA 5C24A 3U3YA 4DMNA 4DS4A 4IDKA 3L2UA 1B9DA 4O4GA 2X78A 4KTZA 1IG9A 3O3FA 5KRTA 1KSPA 4J2DA 4FLWA 3MEDA 4KB0A 4OKJA 2FBXA 4DFJA 2PYLA 3ZSZA 4Z4IA 4JLHA 3NF8A 5DK5A 4R5PA 5J2PA 1KLNA 3QEVA 1QSSA 4B9SA 2E4LA 4FLVA 1WSJA 3ZT0A 3ZT1A 5CY4A 3HO1A 4KKOA 3L2VA 1X9SA 1LW2A 3MAQA 3V9ZA 2P5GA 3H08A 4QOZB 4B3OA 2FBTA 3U3GA 1JLEA 1BQNA 1TGOA 2QK9A 1FK9A 4BDZA 3DLKA 4W5OA 1S1XA 4IBNA 4NCAA 4KHNA 1UAXA 1XWLA 1G15A 3AVKA 4E1MA 3LZIA 1U45A 1NJYA 3A2FA 3M8PA 4FJMA 4Q0BA 4BDPA 2YNHA 3VQCA 4AHUA 3OYNA 4OGCA 3OYIA 3V9WA 3RMCA 4M45A 4M3WA 3B6OA 4M3RA 4O5BA 4DG1A 3L2QA 4FLYA 2HMIA 1BIZA 1EXQA 3VQ9A 4LSLA 3V9UA 2DFHA 1F21A 2HNYA 1RDDA 3F73A 3NCIA 5HRNA 4E0DA 4FLTA 2BE2A 2IC3A 4DU1A 3QETA 3AVHA 4FM0A 4ELVA 4CEAA 2WOMA 4DU4A 1JLGA 3OYFA 3MEEA 4CK3A 3OY9A 2VG6A 4AILC 1N6QA 1NKEA 1NKBA 1I39A 3MXMA 2Z1JA 4OLBA 3V81A 1R0AA 3EZ5A 4DSEA 1BCMA 1C0TA 2HHSA 4KPYA 3AO4A 1VSEA 2XY6A 1TAUA 4F4KA 3LAKA 3AA3A 3K5NA 2JGUA 3DLEA 1ASWA 2A1SA 4HCBA 2OPSA 4ID1A 1S6QA 2JLEA 4CHQA 2VWJA 3KTQA 1YVUA 3VQDA 4B9NA 3RMDA 3C6TA 1NJXA 2G8HA 2EX3A 3O4QA 3OVNA 1RBSA 1Q9XA 1S1UA 4NYNA 4LD0A 3L2WA 2HHXA 2KZMA 3ZSOA 4XIUA 3VA0A 4DS5A 5J2NA 1LAVA 3PX6A 4DSIA 4Z4HA 1A5XA 3C94A 5DMRA 4CHZA 1RT6A 3VQ6A 1TK0A 2ATQA 1B92A 2IOCA 3IG1A 3NE6A 3CM5A 1NK5A 4DTMA 1WSHA 3T1AA 3AVLA 4CFDA 3WNHA 5C25A 2GV9A 1WAJA 2R7YA 1NK0A 4FJGA 4J2EA 1CZBA 4CEFA 3TWHA 3ZSRA 1NOZA 3K59A 4Y1CA 1HJRA 3AA4A 5FRNA 1RTIA 5T7BA 1JLCA 4CJWA 1FKOA 4DQQA 2HW3A 3KLIA 1TKZA 4ID5A 4FJLA 2GUIA 2KQ2A 4KB1A 1O1WA 3KJVA 3SQ0A 1SKSA 5HRPA 3SV4A 2X6NA 1SKRA 1ZBHA 5JS1A 3DLRA 2PYJA 3PO5A 1RT1A 4E1NA 4B9TA 1WN7A 2YHBA 5FROA 4CF9A 3O3HA 1RBUA 2F8TA 1S1TA 4I2PA 4CECA 3S3OA 3OYKA 2RKIA 3M8QA 4Y1DA 1SL1A 2G8IA 3HT3A 4IFVA 1RBVA 3SQ1A 1Q9YA 1Y97A 4ELTA 4ZHRA 2EHGA 4RW9A 5HROA 1B9FA 1TK5A 2X74A 5KGXA 1T05A 4Z4EA 4Z4CA 1C0UA 3P1GA 3NH1A 3TAGA 4CF8A 1BI4B 1LW0A 5HLFA 3VQBA 2DFFA 1HQUA 4NYFA 2G8WA 1WSIA 4N76A 1UOCA 3VQQA 3ASMA 4HUEA 1UA0A 1NJWA 3RR8A 1ZBIA 4RW8A 2HVIA 4FJ7A 4M3XA 1RT7A 3TI0A 3AA5X 3QIOA 3QO9A 1C1CA 4W5TA 3QNNA 1X9WA 2LSNA 1CXUA 2YV0X 5CYMA 3SPZA 1YT3A 5CZ1A 3SZ2A 4CF1A 4FW1A 5SWMA 3SUOA 5K14A 3ZT3A 3AVNA 3HVTA 4DTPA 3QERA 1JL1A 3AVBA 1U04A 3ULDA 3LP2A 3C95A 1TAQA 3HM9A 3RWUA 1DLOA 1C1AA 2G8VA 2NUBA 3LPTA 4C8NA 3QESA 3OYCA 2B4JA 3VQ8A 1KVBA 1L3UA 1SL2A 4KHWA 3M8RA 4CHNA 3LZJA 1D9DA 4ELUA 3D45A 3L8BA 3NAEA 4DSJA 3T19A 4J2AA 1S1WA 3DOKA 5FDLA 2OPRA 1C0MA 1C1BA 4EP5A 3L2RA 2HHUA 3NBPA 5KGWA 3KK2A 2YKNA 4N41A 4CK1A 4OVLA 3OS0A 3OJUA 3P83D 3OS2A 3HSTB 4NCGA 4KHQA 4RW7A 4Z0UA 2OPQA 4CEBA 1LWEA 2OYQA 1WLJA 1CLQA 4F3TA 3OYGA 2W42A 3IRXA 2QKKA 5CZ2A 5J2QA 4DFPA 4C8KA 1X1PA 1VSFA 1GOAA 5J1EA 4QAGA 1NJZA 3UIQA 2O4GA 3V1OA 4HTUA 3DYAA 1ZBFA 2VWKA 5HP1A 3C6UA 4LY7A 4WE1A 2F8SA 3LPUA 4AHTA 3RMAA 2IGIA 3DM2A 2G8KA 4KI6A 1HMVA 4K8XA 1RTDA 2VG7A 3DLHA 3SI6A 4ZTJA 3TANA 4CJ4A 4E89A 4N5SA 1QSYA 1TL3A 1NK6A 4JRPA 4EZ9A 4FK2A 2OPPA 1JLQA 3PO4A 4M41A 2OZSA 4DQSA 3AVAA 4LSNA 4HUGA 3O4NA 4HCCA 3RRHA 1HPZA 1DTQA 3B6PA 4CHPA 4E19A 3SPYA 2OZMA 4FZYA 2P5OA 2FBVA 4IG3A 5HRRA 3DRPA 1J54A 5KI6A 2OA8A 4F8RA 3ALYA 3IS9A 2B5JA 1RDAA 4O0IA 4M3YA 1RILA 3SV3A 4BWMA 3DLBA 4KRFA 4IG0A 2Y1JA 2BDPA 3OS1A 5D3GA 4FZXC 1IKVA 1L3TA 4F3OA 4CHYA 1VSMA 3HP6A 3SUQA 4GW6A 1ZBLA 1VSJA 4CEOA 3LP3A 1C6VA 1S9EA 4Z4GA 4DSKA 3SQ2A 1RBRA
chains in the Genus database with same CATH superfamily
5E20A 1E17A 3K70D 4FPAA 4CCLA 1ASUA 1O3TA 1VFCA 2XY5A 2HFHA 1YAGA 2YKMA 5AQXA 1W4MA 3HUGA 1LFUP 1ETVA 4O8KA 4XQFA 2OTLI 5KRSA 2P8TA 4CJPA 4HF0A 3ZMUA 4FX0A 3H36A 1RTHA 1WSEA 5DUKA 4F3QA 2GM4A 1R59O 1PDNC 1BIUA 5E84A 5DUIA 5FGMA 2NOGA 2JA8J 1HW5A 1HKCA 1T98A 3ZSYA 3F22A 3CCLI 5BRDA 3RPQA 3H9GA 3ZN1A 1KRPA 1F43A 3AVIA 1CGPA 5IWAK 5KVRA 1YUWA 2A6HF 3DPTA 3H3UA 4KFBA 4CF0A 3RCOA 5GAHJ 3QLHA 3DU5A 4MLEA 2JSCA 4CGIA 3CFRA 4BBRJ 5JVHL 5KAFC 2L7FP 3BPXA 3D5RC 3TTCA 4OPJA 1NKCA 1VSHA 1AKHA 4CJLA 4KHSA 3CO7C 4CUGA 4CJKA 2LREA 2LFBA 1IGNA 1LWCA 3K9JA 4NXNK 5FLXO 3CCVN 4CO8A 4FZZA 4M9ZA 5DCMB 2UWMA 4V2GA 3RZDJ 2ECCA 5E79C 2GQQA 1XGSA 4BRQA 3AVMA 2X1CA 1N33K 4HUFA 4OOIA 1VRUA 3LDSA 3S1QJ 1VQMI 1RGIA 1RUOA 5BQTA 2WB1N 4CCNA 3JAMO 3QPHA 1GLCG 4BRGA 4KHPK 3ZRGA 2HZDA 4XLCA 3K1NA 1O7FA 3OV8A 2CWEA 2BUPA 1LDJA 3JTGA 2DT6A 4FW2A 1DP3A 4PK4A 4N9HA 2H8RA 3K58A 2OJED 4YG2F 2V6EA 2E2NA 2NVTJ 3LM2A 1IAWA 3CDIA 1XC3A 3QFUA 1X1AA 2DMQA 3FK7A 4C30A 2DPUA 3S15J 4BRCA 5JVTA 2VE9A 5LY3A 4E6KG 1KQSM 3BF1A 1TKDA 2HHHK 1S8NA 3OJSA 3RIRA 2VC1A 5EG0B 1N25A 3OYEA 1FBQA 3K4BA 5JLHA 3K5MA 2JRTA 3GE1A 3EN9A 1I1SA 3K4NA 4G6DA 3A0BC 2L02A 4IOAF 3HG9A 2ASMA 2P51A 1XCBA 1VQ9N 1MJBA 3AO3A 3TO7A 4CGJA 1XMAA 5L3GA 3DJCA 2LF8A 1FP1D 2KZZA 1Y0NA 5F64A 3WE3A 3H9QA 3AO5A 4F92B 2DO7A 3ZP5A 5AIPA 3Q7BA 3WNGA 3V7CA 3SK3A 1SFEA 2BGGA 1YVNA 3PSIA 2YX4A 2ZJPL 4NB4A 3IAYA 1V5FA 2LY2A 4H4MA 1YJNI 2X6SA 2DDAA 4A93J 4CGDA 1HYSA 3I64A 4RB3C 3K7AJ 3E97A 4E7KA 1REPC 4FQGA 4MIMA 3DXKB 4H5TA 2XHKA 5DV5A 1RZ4A 5A2QO 4LG0B 4H0TB 2F9TA 1P4WA 1J9AA 4M71A 3CD6N 1NNEA 1XTAA 4FJKA 2R5ZA 1MBGA 4L9TA 2WBNA 2D1VA 1VQ8N 4PDKA 4XL9A 4P9UA 3VMFB 1W0UA 5IT9Z 3FFIA 1JLBA 5TISC 3L7WA 3HK2A 2FJ1A 4IEJA 3CMEI 4E7JA 1QVFM 1DGRM 1J5OA 3QEIA 2RN2A 4B9LA 3JW4A 2VE8A 3A2KA 1IKWA 5C10A 3UKUA 2FX0A 1DUXC 2DA7A 4U7DA 1JXEA 3E01A 1TBXA 5JHFA 1PUEE 2Q0RA 3K5OA 4CCHA 2DK8A 4WX9A 3TTDA 1Z25A 2HS5A 2EV0A 3W6JB 4OIOF 1EETA 1ENHA 2VT3A 5HOOA 3TAMA 4M7XA 4OX9K 4PCQA 3SZTA 3H35A 2VBXA 3HIFA 5LHHA 2HNDA 1VQPN 3V42A 3TSUA 3OR2C 2JA5J 5ELZA 3QU6A 1IDYA 2HOAA 2HPMA 1GV2A 2ZSIB 2V1DA 5FRMA 2R7RA 4B08A 2WAEA 4G7OF 3SJJA 2I8DA 2H6CA 3H9JA 4HPQA 3VF6A 1ODDA 3HPGA 3R4KA 2W40A 1IN4A 1EKEA 3CCRN 1A36A 2F5CA 3BG9A 4DCHA 2MLKA 2WADA 2YUSA 1VSKA 2Z1IA 4C23A 3CCEI 1T38A 1RDWX 4BDYA 3OBYA 4OPKA 2K7LA 2BEOA 3KZZA 3QNOA 4FXDA 3KKSA 2ZBKA 2ZM6K 5D5WB 4CF2A 1D9FA 1VQ7N 3AVFA 4RM2A 1UFMA 4FT8A 4M63C 4L8RB 2IA0A 2DFEA 1E3PA 1IXSB 1E0EA 2P5KA 3V8JA 3WTSC 2IGKA 4FCYA 3E3VA 4HQMA 3CF5L 3J7AP 4B9UA 2IRFG 4M72A 1WH7A 3ZQCA 1ZKGA 5F2RA 2HVHA 4FWLA 3QFPA 4H4OA 4XIDA 1RNLA 2IS2A 2CH5A 1TNTA 2DQLA 4OJRA 4BR4A 3JRGA 1LB2A 4DQIA 2HF3A 1P8ZA 2XRIA 3TSPA 2A1RA 4M3UA 3QBWA 4RM3A 1R1UA 2E88A 2WAFA 3CMEN 3Q0UA 3BDPA 1ZGJA 3H5NA 1P92A 4HF1A 3AKZA 1G3YA 5AQWA 5E41A 5JLWA 4D5CA 4FM1A 4CJRA 4CGFA 1U5TB 3DAWA 3RSNA 1VK0A 2J4RA 5LRRA 2STWA 1Z26A 3O9QA 4DV0K 3AVGA 5E3NA 3GTKJ 1MBJA 3DRRA 2D0BA 3HPOA 2Y1IA 2W4SA 3DBRB 2YHAA 3TPQA 2QSHX 3AVCA 1RBTA 3S9HA 4K2EA 1YW9A 2DMTA 4CJQA 1U4BA 4GV9A 1TP4A 2CUFA 2YR2A 4UNOA 4CHOA 1Z6RA 2HQRA 4CFAA 1L3SA 5M5WJ 2O5RA 2MH2A 5CVUA 3DWLE 4N0BA 4A5NA 4A3LJ 4JI4K 2ITGA 2AS5F 4EJUA 3R8EA 3VESA 3GTJJ 2AQFA 3AV9A 4H5WA 2JWTA 4EIAA 2DJIA 3JS6A 1R4MB 1C0WA 3FM3A 1Q8IA 3AAPA 3CMAI 3BJAA 3U21A 4B09A 2VJ5A 2Z1GA 1UA1A 4M7YA 5FJ8J 1X3ZB 2QWPA 4UY8I 3KK7A 3KYCB 3IMXA 1WUAA 2VB6A 5FFZA 2K3FA 1TQPA 2M0CA 3MZ8A 5B3SH 3K4LA 3EUHA 1B9MA 1TUUA 1JTXA 3U6FA 1MNEA 2PMZA 3TP3A 2RAEA 4EQQA 3LSGA 3R60A 4AU7A 2DMUA 1D1BA 4L9JA 4MEYF 4MLHA 4CEZA 5HRSA 5CYQA 1SFOJ 1JXSA 2Z1HA 1JKRC 5IT9K 1F4KA 4MQ9F 1WI3A 1G3SA 4HV6A 1IC8A 1RETA 3I8DA 4S05A 3ERMA 3CJ9A 1IW7F 2BTFA 4XRSA 4IFEA 3HOWJ 1TK8A 2QM3A 4KAZA 3TAFA 3W2AA 2KTQA 4WXDA 2DTUA 3EPZA 2HGCA 3KIOA 3QB0A 3LDLA 3BT9A 4V2FA 4CZEA 1S5LC 5EGOB 4FWQA 2D5RA 4CEEA 4DV1K 3CPWM 3CO6C 1K7AA 3B6CA 2CV1A 4A3DJ 2YNGA 4A3FJ 4CZLA 1XMQK 3GFJA 4LFUA 4CJUA 4WXCA 3KD5E 2KFZA 3CF5F 5K5OA 1P2FA 3OYJA 2QXFA 4BG8A 4BRPA 4AQYK 1XG1A 3RKWA 1QTMA 4E7LA 4K8ZA 3QYEA 5BNGA 2F4MB 1GLJO 1OYWA 3CQXA 1LV5A 1XDUA 3UE5A 1KONA 2ZGYA 3DU6A 2EILH 1SMYF 2JRMA 4BVOA 1E3MA 4KN7X 2EINH 2IGMA 3RTVA 3FMQA 1ATSA 4JHDB 3VTHA 3M8SA 3OW2M 4N4OB 2CGJA 2Z9OA 4XH5A 3J81Z 3FISA 2ZXWH 1MDUB 4BR5A 2GOXB 1B9DA 2JWKA 4BYYA 2DW4A 1RDUA 4I2OA 2X78A 4BQZA 1IG9A 2F4VK 2R5YA 1LFBA 3GZ5A 4OIRF 5FPNA 2EA2A 3KLHA 3U1DA 2FBXA 4DV3K 4NHJA 3NQOA 3ZSZA 4Y15A 4MO7A 1BA1A 2XPVA 2OBPA 1NJIO 2GXGA 3I3LA 1P4XA 3G2BA 4B9SA 2A5YB 2DT7B 4G9YA 5F0XA 4EJVA 2PBDA 1FOWA 1VTNC 4KKOA 1X9SA 3BY6A 3H3ZA 1MMGA 3C18A 4C2TA 4R8HA 3WXMB 2A41A 1MNMC 3G3ZA 2L9RA 2XGCA 1WJBA 5DM7L 3HSFA 2EZHA 4CDGA 4BDZA 4NCAA 2UV1A 2BW3B 1KZHA 4W5OA 1HC8A 1BA5A 4K25A 1ZRCA 4IF4A 1XWLA 2Q1ZB 1IZ1A 5D6FA 3CJ1A 3R1XA 4M73A 4XLHA 3CCYA 2QTDA 4YFKF 4TV7A 3Q0WA 3LAJA 1B8IB 1BU6O 5ICEA 3DEEA 3GLLA 3REOA 2YNHA 4AHUA 4LLNA 2QQBA 3RMCA 3ULQB 5JICA 2W48A 2HBJA 5KHDA 4I6MB 2E5NA 4A6EA 1QQOA 4M3RA 2QF7A 3SFZA 1GLBG 1WFXA 1PJRA 4C3JJ 4DG1A 1N36K 2XAUA 3S1MJ 4KNYA 1QVTA 2H1LA 4UUTA 3FDYA 4G7ZF 4ZYDA 1XSDA 1N78A 3E5UA 5HRNA 1N34K 2KIMA 2BE2A 3BR0A 2IC3A 5AQGA 3BJOA 2WBMA 2NYXA 3W6VA 3RSEA 2VOOA 1VQLI 2LR8A 4YHHK 3WGGA 5TKWA 2AHQA 1KU7A 3F8CA 4DQ8A 1WSUA 1XD7A 4QS7A 1YHQI 2R7VA 1MH4A 4HSTA 3IC7A 2GIZA 1R0AA 4BC2A 4DSEA 4RA2A 2Q2EB 1BCMA 1C0TA 5M1QA 2HHSA 3M6GA 1OCPA 4G6QA 2VYPA 4JKBA 1TAUA 1D8YA 4MTEA 1JJ2M 1YIOA 1SVLA 2JGUA 3DLEA 4BU2A 2A6EF 2CW0F 1HR0K 4PZJA 4IJNA 3TEDA 4CHQA 1AA7A 3FGUA 4GVEA 3VQDA 1W7PD 4B9NA 4XN3A 4BY9C 3I59B 3ABKH 1U0JA 4YOUA 2G8HA 4UXNA 3OVNA 2XF7A 2K9LA 2KL4A 4NYNA 3L2WA 1XMXA 3T1YK 1LAVA 1W5SA 3DEWA 2NVQJ 2QM1A 4OMYA 5DMRA 2AJQA 2LKXA 2Q2RA 2VL8A 3VQ6A 3NE6A 1I1GA 2MSYA 4FWNA 1NK5A 2ZKZA 4WWCA 3NVMA 1WSHA 4CFDA 1T6DA 1X4OA 2NRHA 2IP2A 5L3CA 2R7YA 3HB9A 2PZSA 1Z91A 4FJGA 1IJJA 3GTQJ 4U67L 2AQEA 3MZYA 2QW9A 2B7EA 3K0SA 1HJRA 3U2RA 1VQ9I 3EETA 1FKOA 2HXOA 4A3GJ 1TKZA 3SQ0A 3QO9A 2QBYB 3FBIB 3SV4A 2LYCA 1ZBHA 3KE2A 3KWGA 1JKQC 3DLRA 5FKMA 4MO5A 2VQEK 3TOAA 3HSEA 3FXKA 2BHZA 3LFKA 4M6VA 4B3MK 2VC0A 2YHBA 2ZXHA 5FROA 3C1DA 5FB2A 5EZGA 2F8TA 3ZQFA 1X2MA 4CCMA 5L3FA 3S3OA 2V7ZA 1AKHB 2RKIA 4Y1DA 1SL1A 1X3NA 1BR1A 4ITVA 4P5OA 2A40A 4B1VA 1TWGJ 4B44A 3HOXJ 2HXIA 4ABZA 4RW9A 5LGNA 1TK5A 3CCLN 2E8AA 3EO3A 1C0UA 3P1GA 4JI8K 1FLIA 4FX4A 4CF8A 3PQKA 2DDBA 4HX7A 4YIRX 1LW0A 3ULEA 3VQBA 3GCMA 4PL7A 1XMOK 4BHBA 2G8WA 4BQAA 5IT9O 1WSIA 4JEPA 4L0YB 5FKKA 1UOCA 2NVYJ 1MDMB 1LE8B 4GDFA 3ASMA 1UA0A 2HVIA 4HG2A 2ESHA 5DS9A 1NMDA 4L3QA 2IEKA 4LK0F 5HVQC 5IOYA 2WUSA 3N4PA 1E3HA 2FBKA 3QIOA 3I9V2 2G0EA 1B59A 1CZAN 2LSNA 5CYMA 4EJOA 4X0GA 3BG7A 3MKLA 5IPAA 5HNHA 3WTVC 1R5GA 1W5CC 3I0TA 5IOZA 3AVNA 3HVTA 3NMUA 1WI9A 3ABTA 3Q5FA 3B6AA 1SMTA 2CO5A 2EFNA 2QQ9A 1Z05A 3AFHA 3IKVA 3A01B 1W36C 4HNUA 1U04A 3C95A 1HSTA 4IO9L 2QZ8A 2NUBA 2ACJA 3QESA 5BPNA 1QRYA 2Y31A 4LJZF 4CZKA 1UAAA 1MZBA 3HRMA 4W5NA 2M2EA 2UZKA 3M8RA 4KHWA 4ELUA 4B3XA 1FY7A 3UKGA 4NC6A 1NK2P 5CQGA 3PSFA 3QICA 3MZHA 1GUUA 1LDKB 5AONA 4EGYA 1JE8A 2BY2A 4LC9B 2HHUA 3TMOA 1W97L 2L5QA 1LVAA 2R7SA 4BHCA 4N41A 5H2FC 3ZQIA 3OS0A 3M3ZA 4OVLA 3GOIA 3AAFA 1XCVA 3PNVA 3JCUC 1IBKK 2HBLA 3DXMB 3M5RA 4KHQA 1IXRC 2QLZA 2CV2A 5GAGJ 1JI8A 1OKRA 2IGOA 1LWEA 2NNWA 3LDNA 4Z0UA 2OYQA 4F3TA 2W42A 5F1XA 5CZ2A 2FQ3A 3ZMZA 1OVQA 2DOFA 2OTJN 1X1PA 4M3GA 4BVPA 4LFBK 3VYRB 5EYRA 4HTUA 3RQ4A 2GIVA 2KHMA 2L9SA 2PG4A 3F21A 1Y39A 1BM9A 4IL6C 3IL2A 2F8SA 4AHTA 2O8FB 4PFOA 1GT0C 2XV4S 2G8KA 1HMVA 2O9LA 3W2WA 3CD6I 1B72A 3THXA 4DR7K 3F8NA 3R0AA 2MC4A 1SQKA 4M3BA 4EMSA 4EZ9A 3HXLA 2OPTA 1QVUA 4RAGA 5KCMA 1R36A 4JI1K 1LVKA 4KITB 1KU9A 5KPTA 2A68F 4BRAA 4FK2A 5BPLA 2E71A 2D1KA 3CC2I 4LSNA 4HSRA 2WV0A 1NHAA 3O4NA 4HCCA 3B6PA 1KSPA 5TRDA 3KZBA 1ZELA 2OA8A 1MMSA 1S72N 2PJPA 2D2WA 1J54A 5E17F 2EV5A 4O0IA 1RDAA 4M3YA 4DQ2A 2PLYA 3VERA 2VGMA 5AZJA 4WFAL 2IVNA 3DXJF 4BWMA 2OZUA 3M4OJ 5CVIA 3CCJN 2MG4A 4BGDA 1WJEA 2Y9ZA 4IZ9A 3ZYYX 5D3GA 3ECHA 1UJ8A 5EGOA 1L3TA 1QZZA 4CHYA 1MBHA 1P4AA 2LY9A 3I71A 2LF7A 3K1MA 4GW6A 1ZBLA 4UUSA 4CEOA 4Y0WA 2LSOA 2CMPA 1C6VA 4X66K 4DSKA 5F08A 1G8XA 4JI0K 4G7HF 3I5UA 2M7BA 2O8BB 1JJ8C 2ZJPF 2KZVA 1T95A 2EV6A 5ICFA 3MWPA 2VJIA 5IY5H 1D0YA 3U4LA 2MH9A 2XY8A 3ABMH 2RVCA 3BG6A 1BC7C 1PUFB 5IYDJ 4DWIA 3IP4B 3CHWA 1VI0A 3LQRA 4B43A 1VSDA 3O80A 3HOYJ 1OFCX 4NLBA 4FWRA 5ADXH 1D5AA 1ZG5A 1XN7A 2VG5A 3S17J 2F5EA 1SS6A 2P9PA 5J6XA 1K8KB 1FSHA 3HTVA 1FTTA 1XPXA 3EYZA 5E1ZB 3AA2A 5GAHP 4CJ7A 2K02A 2WAQA 4U0WA 3NGYA 1QQIA 1ZRFA 4LIUA 1FOYA 2WONA 2XAGA 3Q9SA 4A0ZA 3VEYA 5HLIA 2VBYA 2ASPA 2BGCA 2L0KA 4ENJA 3BTLA 3WTXC 4HHTA 3SZGA 2IS4A 4PKGA 3V6DA 3PV8A 2HZTA 2M5WA 3M07A 2FSNA 3THYA 1FW6A 2D45A 1B6AA 1SAXA 4MDBA 3I56I 3G1LA 3SUPA 3I4MJ 1L3LA 1YX3A 2I5JA 2QKMB 4CD3A 2KIUA 1JGSA 4OINF 4MO4A 3OYDA 3NF7A 2E1NA 3ZMDA 5FPMA 3V1RA 3AO2A 3LANA 1X9MA 4LH4A 4FOEA 1KQ9A 2KHOA 3HM8A 1JLAA 2L2OA 3KWIA 4IRGA 3THWA 4OKKA 4QSHA 1GHCA 1ZYQA 2KIQA 3VODA 1SFUA 3NH2A 4JYAK 3JSMA 3WU1B 5AQIA 2NRVA 3ZX3A 3TQNA 2LBFB 4YIIA 1D8KA 2ZJRF 5F6FA 2P4WA 3KEYA 1NK4A 2X6OA 5EDNA 3E1SA 1ETYA 3OIQA 1TK0A 1SV5A 2W6LA 4DB3A 1O3SA 5J3LA 4MQ3A 5HLHA 3A1YA 3ITHA 4ICLA 3BEXA 1OYYA 2X1DA 1R4NB 4IRHA 4IFYA 1V54H 2GWRA 2VQHA 4BXXJ 3HRGA 4O0JA 1SD7A 2KT0A 1V5GA 4JKCA 3QP6A 1BR4A 3KEQA 1ZXOA 2VUMJ 4DTOA 2QWOA 1BUPA 4GGGA 3CMAN 3GTPJ 2VGNA 3V4IA 4KREA 1FIPA 3WT0A 5K5RA 3O9RA 2Z99A 4BGBA 4YFUA 4XLFA 3WUHA 1JKPC 3O6WA 3ROUA 2E1MC 1QBJA 4DHYA 2CW7A 2UUZA 4HX4A 2E6MA 3CCSN 4PJMA 4I7HA 2XPUA 2YS9A 1WSGA 3H45C 2CSOA 3OL4A 2PAVA 4NLCA 2ZD1A 4OPHA 1NK8A 1RCHA 1XGMA 1Y0UA 4FJNA 3PL8A 3ISNC 3D6RA 3FFKB 5C0YA 1RESA 3FKJA 1KYWA 4PA1A 3E6CC 1CZ9A 1Y1VJ 3RRGA 2EFPA 3L2CA 4N56A 3DOLA 1R5HA 4WQ4A 4QIWN 1TKXA 2X6YA 2DLLA 3C7JA 4EAHD 5AQRA 2HKOA 4M3FA 3OYMA 3GG4A 2KZGA 4C8LA 1XQSC 5JMVA 1BJZA 2QWNA 3F9KA 4QCLA 1H9GA 3VEOA 3F6VA 3RPUD 1IN7A 4EJTA 2QWRA 4RAYA 2IA2A 4OWRB 3OIPA 1TUYA 4JAXA 2HTJA 3D2FA 4BRDA 3IUOA 4CERA 4EHUA 3J81O 4DBQA 2M34A 4ISGA 1DPUA 2O7OA 3H92A 3K9TA 1RFQA 3ENBA 2G8FA 3RZOJ 4YFXF 1JCFA 1HNXK 1K9MO 4IX7A 2L9VA 4NXMK 2CQ7A 4PY5A 1TT0A 3CDLA 4CICA 2R0QC 3WGHA 1TZLA 2XSJC 2N8GA 3RQIA 3KLFA 2XAFA 4EP4A 1TC3C 4XN0A 5FLVA 1KQ8A 4BE2A 2I7NA 1ILYA 4X62K 2FSKA 2CRGA 1DTTA 3SV3A 4NDLA 3HHHA 1WGXA 4GYGA 4PJ0C 1EP4A 3L9FA 4AD9A 3JR9A 4J19A 3SJMA 3EQLF 1G99A 4DU3A 2BANA 3KP5A 4HNVA 3NDKA 3JRFA 2KFDA 3NEUA 3EY1A 1AHDP 4BACA 1REVA 1GXPA 3BCAA 1L5UA 3VFZA 1S9GA 4NQWB 3FHNA 5D4SA 1DT9A 2P9NB 1D1CA 4B9MA 5CR4A 1S5JA 4E0DA 2ESNA 1K8KA 5AQPA 2GWJA 1Z6TA 3LNQA 3J80O 3BG3A 4XMYA 5F0CA 3K0LA 3ZQLA 5M1KA 2JVHA 2KPMA 4YEJA 3LWMA 5M1PA 2XUBA 2UUAK 2WAQN 2ZC2A 3BZKA 5EEHA 2M3AA 2I10A 4DJAA 5EG0A 4RB2C 4GVMA 4KO0A 3VQ5A 4YOXA 3ZCMA 1A31A 4DR2K 1VQ4N 2F6CA 2HF4A 2R7FA 2XF5A 2B9SA 1QHGA 2F5DA 4BNCA 4B1XB 4DIQA 3KKRA 2O8BA 3DPLC 3M1CA 3CP2A 4H03B 2OTJI 2F96A 1TQIA 2RC4A 3HVRA 3G1OA 1R22A 1FT9A 1LEAA 3BJ6A 4FHTA 4BJ5C 3OYHA 4HF2A 3CPEA 2HVRA 2NLXA 3VQPA 4B9VA 1OCCH 5JR3A 1WAFA 3S8PA 1BGXT 4L9VA 4BC3A 5SZTA 1BO5O 1SFKA 5AQVA 2YX7A 1H89C 5C44J 2W24A 3BTCA 4EATA 2IXSA 5DCMA 4JK7A 2TCTA 3ZMSA 2CQQA 2P9UA 3ZSXA 2XF6A 1HKTA 3LOCA 2D0AA 4PGHA 2HDDA 1S22A 4KT5C 3VYUB 2HB5A 4OKEA 4B1RA 1JL2A 2GOMA 2IS6A 4X65K 1J53A 3THVA 1KFSA 2XAHA 3U1KA 2K3PA 3MECA 3ZSVA 1Z77A 2NAZA 3VPRA 3ZT4A 1QGPA 3CM6A 4CJEA 3UNGC 4BC5A 2VKHA 3O3GA 2KW4A 3KYLA 1MSFC 3L09A 4LFAK 4KI4A 4XLNF 1R5ID 4I76A 5DDGA 3KLOA 1XGNA 3QRFF 2DODA 3F72A 4RDUA 4XKWA 3TR8A 2W84A 1UHWA 4XICA 4PJLA 5FO5A 3NHGA 3QEPA 3SXYA 1QE1A 2E1ZA 2L3DA 1FOKA 5BMZA 1XI1A 4M3EA 1KYZA 2BZTA 3OTOK 4QS9A 2FBYA 1XGOA 3JSPA 3K4KA 1T56A 2E7XA 3PNYA 3H3OB 3VOVA 3CFPA 2VQLA 3FWEA 4EV0A 3SBTA 5K7HA 2V9KA 5LMNK 3ATVA 1YLFA 1E4GT 4KUMA 5J1RA 2NZTA 4CE9A 2ZMEC 1G59A 2V51B 3HSRA 5FD6A 1RPWA 3DRSA 1VQKI 2ETJA 4PUOA 3OYAA 2WFBA 4JKEA 1FPQA 3ENHA 4CSWA 2G7HA 1YTYA 1R71A 3DV8A 3EDPA 3TBIA 1YRNB 3I0SA 5LHIA 4FPBA 2DI3A 1XHZA 4DLGA 2JQ7A 4CJ3A 4JI7K 1RIOH 1RT3A 2Q97A 2GXBA 5DTDA 3SBGA 1VQ6I 4CIGA 5BRHA 2ZMEA 4FLXA 2RPIA 2ITMA 3HDDA 2H1KA 5JS2A 5C15A 1GLEG 3MDQA 4JS4A 4CESA 4KHYA 5HLGA 1VQNI 1KU3A 1VRTA 2VASA 1BL3A 2EJRA 1NU0A 3GL1A 2WTEA 3NGZA 3EE8A 3F6OA 2FU4A 4WF2A 1ON2A 2DQRA 3QMLA 2ZFWA 4BWJA 2CS3A 4IDKA 3ENOA 4DS4A 1OQYA 3U3YA 3NRVA 2GLOA 1OPCA 1H0MA 3HOTA 3DBHB 5KRTA 2YX6A 1I6XA 1QU3A 2L7KA 4ZH4F 2IAIA 2LK2A 3A8YA 3F5TA 4C1NK 4LG0A 2IT0A 4BY1J 4Z4IA 4R5PA 5J2PA 1U3EM 3QEVA 4DGWB 1QSSA 5GADP 1WSJA 3CJRB 3ZT0A 4YDUC 4EM0B 4E7SA 5CY4A 3WE2A 1LW2A 3R0JA 3V9ZA 1HSJA 3DP7A 3DCFA 4QOZB 4HRIA 2FBTA 1ZH5A 3SNNA 3DKXA 4NNJA 2GUPA 4YIFA 1BQNA 1TGOA 2O0YA 1FK9A 1MW7A 2VKVA 1S1XA 2JUCA 4IBNA 4KHNA 4FE4A 1RC9A 3QOEA 3VEPA 1T8IA 1G15A 2Y30A 3VEVA 4CBXA 2O8EB 2COMA 4RAFA 4UUSB 1OCRH 3A5LC 3A2FA 3M8PA 5AQYA 2YHXA 2EZIA 4BY7J 4XH4A 3LSTA 4OGCA 4ISEA 3PIPL 3O8HA 4IQJA 4LK1F 4M3WA 3K4CA 4F55A 1NGFA 4O5VA 1VQ4I 3VQ9A 3SLCA 3T69A 3A02A 3T5XA 2H8WA 1USTA 2JJ7A 3G6EI 3TO6A 2JA7J 2HNYA 3GBTA 4BGAA 1YHQN 1RDDA 2DMNA 2QWQA 3D2EB 1TWCJ 3VGMA 2QSFX 3SAGA 2P9SB 2DJNA 2LBFA 4ELVA 3B8AX 3AVHA 4I0AA 1Z0XA 4WQ5C 4CEAA 4Z6YA 4CK3A 3OY9A 4LG3A 1GLFO 1Q1HA 2JA2A 2VG6A 2DYRH 3H1VX 1K4TA 3KCCA 3A4CA 2VCPA 3LSKA 4OLBA 1S6LA 3F8BA 2BXYA 1YITN 1QHAA 4A3EJ 3J7AO 1S29A 2P7CB 3BC8A 3OMYA 3OR1C 2V1UA 4KPYA 1QZEA 3KP6A 3SFIA 1VSEA 2E5ZA 5BS6A 4F4KA 3ECOA 4HOBA 4G12A 2M87A 5D5XB 2CFXA 1X4PA 4MDAA 2GWKA 2A1SA 2CH6A 4HCBA 5E26A 3RYRA 2JLEA 2OF7A 3RMDA 2DK5A 3CJNA 3L00A 1WJFA 5M1NA 1NJXA 2YCHA 4LD0A 4HAMA 2ME0A 1ETOA 4Z94A 3I55N 1VQ5I 1IRGA 3ZSOA 3KHYA 3DEUA 3G1MA 1TYQA 3PX6A 1ON1A 2V6CA 3KZYA 4FE7A 4Z4HA 4DSIA 2CGLA 4AC0A 2AXLA 4DV6K 1R6RA 3FXLA 3IG1A 4PUSA 4NO7A 3ZEUB 2VKDA 3V7SA 3T1AA 4CZFA 5C25A 3J7YP 1HKQA 1MWKA 1QVGM 1QNTA 4XR6A 4CEFA 3VYTB 2FOWA 3K59A 2A6AA 4Y1CA 3PO2J 4Y13A 2FUG2 3AA4A 1J09A 1QQMA 1JLCA 2HDWA 3LA7A 1LQ1A 1O13A 2FE3A 2KLOA 4CHUA 1K61A 3MD2A 5HODA 1T2KA 2FLOA 4AWXB 3KP2A 4X6AJ 1JCGA 2GUIA 1VQON 2FMLA 4KB1A 4OO1J 1FYKA 4F9OA 1Z1DA 2HPIA 2BXZA 4S0HB 2M0MA 2QQAA 3ZXSA 5LBQA 4I0BA 2BYVE 2L7MP 2AO9A 3FMSA 5K7FA 1YRNA 1YQAA 1XS9A 1RT1A 2F9WA 4MEXF 2FXUA 4BEHA 2YJEA 2VI6A 4CF9A 1RBUA 2E36A 3IV5A 3VF4A 5E8IA 1W7AA 4CECA 3M8QA 2G8IA 1R00A 3I59A 2IVMA 2K86A 1A04A 2OA4A 2VN2A 4LOCA 3CCUI 3GTMJ 1J6ZA 1WQ2A 1Q9YA 3WEEA 4ELTA 2IVPA 2LC2A 5HROA 2X74A 5KGXA 4DR1K 4Z4CA 4A3BJ 4B47A 4K43A 2DN0A 3W6KB 4QTRA 2ZO4A 3GTOJ 2DFFA 2RN7A 1YE9A 4CYCA 3MFKA 3QOPA 3VWBA 4AM3A 1WOQA 2A5WA 4JK8A 2L4MA 2LKSA 1VQNN 3E66A 3VQQA 2UXXA 4HUEA 3ML6A 2R7ZJ 4RW8A 1RT7A 1ZAOA 3FXRA 3KEOA 3EL2A 2Q0OA 2VXZA 3QNNA 1NBWA 4A57A 3F23A 3SPZA 2F4OB 2KIFA 4WFBL 1ZGAA 5CZ1A 4FW1A 5SWMA 2R5YB 4I09A 4DYQA 4WCGA 3ZT3A 4FWKA 1FBUA 4XM3A 1JL1A 5AQUA 3ULDA 3LP2A 2HYGD 5CJ9A 3C0BA 2B63J 4IQ4A 1Q82O 3RWUA 5J1YA 4CXFA 3J7AY 5AQZA 3DWLA 2Q36A 2JK3A 5BR8K 2B4JA 2CGPA 1KVBA 1PUFA 1HA8A 4JI2K 5ADXA 1K83J 4B1UB 2DPDA 1SL2A 1CF7A 3FR0A 3P39A 4CHNA 1KXPA 3LZJA 1IV0A 3L8BA 3QPLA 4DSJA 3O3KA 3TGNA 4J2AA 5C4JJ 2XRLA 4D0PA 1DU0A 5DD4A 3LSRA 4UHTA 3AARA 1D0XA 2QKLB 2E1YA 2D5VA 1YW8A 1C0GA 1T0FA 3E6BA 2XB0X 3FIWA 1R23A 3GVAA 4J00A 2YKNA 1WBBA 2X1EA 1B1BA 2OU2A 3IH3A 5ICCA 3W3DA 4XBFA 5EOYA 4BR0A 4U88A 2OPQA 3WXKA 2KJCA 1WLJA 3TW7A 3AAQA 3ID6A 3DKYA 2QKKA 5HS7A 5GIPA 2PQ8A 3SEQA 4IOCL 2NVUB 2DA5A 3GFIA 3CC7N 1R9TJ 3E6MA 2O4GA 5HP1A 2I5UA 1IF1A 1ZBFA 2VWKA 3C6UA 3DYAA 3KETA 2X51A 3MWTA 1HW2A 4LY7A 3GFLA 2ID3A 4AIJA 2NS8A 2I7PA 3WXJA 1BOBA 3N4MA 4JK9A 4KI6A 4J01A 2VG7A 2IIRA 4CCOA 1Y8QB 2KRCA 3TANA 2VBWA 3GW2A 4E89A 2DA4A 2VBZA 4BRKA 3CLQA 3AG2H 1G3WA 4ZZDA 1IBMK 3PO4A 3AG3H 3RJPA 4F52A 4M41A 4DQSA 2PJRA 4B3SK 3U9ZA 4HUGA 2BHYA 1JT6A 3RPUA 4BQQA 1UHMA 1HPZA 3TTFA 4R1HA 4E19A 5BN8A 4FTHA 3HRUA 2WV1A 3SHFA 4BQNA 5EF6A 2FBVA 3DRPA 3NARA 4IG3A 5HRRA 5KI6A 1LOTB 1TWHJ 2X6XA 1NGDA 2K4JA 2B5JA 3O2PE 2FSJA 3IS9A 1IN5A 4A61A 1DPRA 2BE5F 1U5TC 2BV6A 4XRMA 4DZPA 5EX5A 3DLBA 3ZGKA 4G94A 4I6MA 3ZETB 2Z16A 2Q31A 3GF2A 2DU9A 4CH7A 2O61A 3QBXA 4A3KJ 3K69A 4YELA 3SQ2A 2B0LA 3TDUC 2XROA 4GV3A 3P31A 1A5WA 2R7DA 4LF5K 3ONQA 4GO1A 1U5TA 3KK3A 1HQCA 1M1EB 4CJ5A 1G6NA 3EYYA 5J4YA 1SUQA 5GAEJ 3A5NC 3WTYC 4FLZA 1ZARA 1HQEA 2IS3A 5J40A 3NFAA 2KRHA 3EZWA 3THXB 1X2NA 1S3JA 3KX2A 1IRFA 5M3MJ 4MGRA 3FXOA 1OISA 2A69F 3GZNB 4IHSA 4NCBA 4FJ8A 5DYMA 3CESA 3ZQQA 1X3WB 4DQPA 4LB5A 5EJCA 4AH9A 1VSIA 1R1TA 3K10A 4YOVA 4RW6A 3TAEA 1T8EA 1ZLJA 1RUNA 4EZ6A 4DTXA 3FE1A 3MAJA 2BVLA 3P5JA 1RNHA 1Q81O 4MFBA 3S1RJ 4JHDA 4DTSA 2QWMA 4HTLA 4D7MA 1KCFA 1QHHD 2YI1A 4LH5A 4OGEA 1NK3P 4C2UA 3I8BA 5M5YJ 2W00A 1BI4A 4DUYK 4II2A 4ENKA 4IHWA 3IUCA 2ZNZA 1RT5A 2IBDA 3MX2A 3SUNA 1VQOI 3VSKA 1JJ6C 1XUPO 4YOYA 1UELB 1YO5C 4KIBA 1NOYA 4JRQA 2LH9A 2Z3YA 4BRFA 3TSQA 3NVKA 3CCEN 3QEXA 3WNEA 4IKFA 2RDPA 2O03A 1KAYA 3LP0A 5KTQA 1TL1A 3LWLA 4CZGA 3LSMA 3HOVJ 4RW4A 4C8KA 2QKBA 5E1WA 1EV7A 5L3DA 4EM1A 2FF3B 1IRXA 4ILHA 3VEXA 1IRZA 1YI2N 4M74A 5ICGA 1IH7A 2RGVA 3FKIJ 1YJWN 1NGHA 2HR3A 4FJXA 3RKQA 4BXUA 2GELA 4M9XA 1D5VA 5AQLA 1WB9A 1MMAA 1MMNA 2IW5A 2R7QA 1S7AA 4LF9K 4KV8A 3V7RA 2P9LB 3J80K 3T8RA 1Q18A 2AP1A 4H0YB 4DTUA 2W1OA 3RTRA 2JWLA 3P9CA 3CG7A 3K2ZA 3G4SI 1J5YA 2KJBA 1JXBA 4CK2A 5AJ3K 1BHLA 5AQOA 1X1CA 3I53A 3E6DA 4ESBA 3JAMK 2XGEA 1T39A 1U8RA 1YJ9N 1Q7YO 2O8CB 3HYFA 3K4JA 1HKGA 2HKXA 3FM5A 1ETWA 1HYZA 1BIBA 5EEAA 5IYBJ 4BG9A 4O8UA 4BJ6C 2PY5A 2EIMH 2V79A 1I3AA 1P6RA 1V4RA 1EH8A 2CQKA 3JRDA 4IHYA 3JYTA 3H1CA 1KTQA 1K79A 3P7NA 1X1BA 5E3LA 3PX0A 2GBZA 2V7FA 5H6QA 3PM1A 2Z2SB 5TGTA 3K6GA 1FBSA 2OCEA 4BAYA 4IHXA 3QU3A 2IJLA 3VTIA 2JN6A 2L01A 1U2VB 5IYCJ 3MN2A 2PBIA 2EFWA 1ETQA 1MDMA 4M3TA 4IVNA 1ETKA 1BR2A 2E7WA 3GMEA 2ZXIA 2MGQA 4RB0A 2E1CA 2OQGA 2P1JA 4H5NA 1W2BM 2QK9A 3JRIA 1G4DA 3ZQHA 4BEHB 3LSHA 5IP9J 4EGZA 1LCUA 5C3EJ 1NWKA 2CJJA 2M8GX 3T8TA 3CI5A 5AQJA 2QSGX 2LRDA 2O8EA 3QQAA 4BR2A 2XAJA 2P9PB 4B8AB 1U47A 4OPAA 2DXIA 4U0YA 4IZZA 2L54A 4OIQF 5AQHA 3ZSQA 4CGGA 1NMNA 2K5CA 3F8FA 5I42A 3TO9A 2Q2EA 3CMMA 1RDBA 4GY2B 4BR9A 2HQNA 4H0EA 1VAZA 2D0OA 5AFUH 1BI1A 4MQVA 1F1ZA 2GAUA 3HKZA 2RKHA 4E1NA 5BPMA 2XASA 3CXCM 1NK7A 3R6SA 1D8JA 5A2QK 4M3ZA 3L3VA 3GFMA 2ZGZA 4BREA 2K9NA 2QBYA 3ZSWA 3LDPA 4E7HA 3X2QH 1TVRA 3G10A 3HM5A 3P9IA 2P0WA 3M1EA 4I6ZA 1ZGWA 4L18B 3J80Z 4V19S 1VQ6N 1Z3YA 2QGUA 3E5QA 2CQNA 4BKXA 5LRSA 1W36D 1SD4A 5I3UA 3BZ6A 1IKXA 4DF4A 1IO2A 4QLCU 4HYEA 4MNUA 3OHRA 5BR9A 3ISPA 1YTAA 1A5JA 3KFWX 3HJEA 4OU0A 4KIFA 4HEA2 2LD5A 4CBUA 2V1NA 3H0GJ 4TSXA 4ENMA 4JX5A 1Z9CA 4FASD 3KLGA 1J0RA 1WJAA 1VQMN 1W0HA 2YSRA 4HLYA 5JVGL 1YIJN 4I9QA 3E7LA 3DBLB 3I0RA 4FWSA 3H5RA 4BE1A 5F27A 5CVJA 3WG9A 3IFRA 2H27A 3MMVA 2WWYA 1S1VA 1I6HJ 4XLAA 3ZCOA 2ZWHA 1NK9A 1RR7A 1LUJB 3BR6A 1J9IA 2QXLA 2DA1A 3G4SN 3WTTC 2YU3A 3FZLA 4MFEA 1HLVA 1QPIA 4YRVA 2K9QA 4OAYA 4ISFA 4W1UA 4ZTFA 5LL6Z 3ZQGA 1TV6A 3C2GA 4CJTA 3HL2A 2DAOA 5LHGA 3FHZA 1YTUA 5EY4A 4L0ZB 1MKMA 1V3FA 3HUGB 1U9NA 3CIPA 3LAMA 2AXTC 4LMYA 4AIHA 2HNZA 3OA9A 3HSCA 3MX5A 1OMIA 3W3CA 2YJFA 4KJZA 4KBOA 3NH0A 4NC7A 1LAWA 2GTDA 4O44A 3J7ZO 4A3CJ 1BWFO 4Z4FA 2XGDA 2Z33A 3WXLA 4HQEA 3DF8A 3V8LA 2UXBK 1HOMA 4ASNA 4WFNL 1FNNA 2Y0SA 1ITYA 1KLNA 4W5RA 4OLAA 4Y7NJ 2J5OA 3SDBA 3PO3J 2E2JJ 3ELKA 3TABA 4V19K 4IEIA 4FWMA 2O8XA 1MD0A 1TW2A 4JP0A 4CFBA 3ZLJA 2R5ZB 1BCOA 4I99C 3WTUC 4FWPA 5TJJA 1X1DA 2HBMA 4XRFA 3HC7A 3D0PA 4WF9L 2FBHA 1XC9A 3SQ4A 3S41A 1MU2A 5F1JA 1CF7B 1MNDA 2RF2A 1U48A 4OAZA 1W0TA 3H1QA 4H5RA 4KH6A 3C3WA 4AHRA 3E9LA 4DKWA 5GAEP 3MKZA 4FLUA 4E3SA 4M42A 3LMMA 4L5EA 2E2IJ 5H6RA 1LEBA 1K6YA 3QEWA 2O8FA 3A01A 4AHCA 1LJ9A 3ERED 5GINA 3AO1A 2HHWA 2WC9A 4YNQA 2CYYA 2CW8A 2JTVA 3VQEA 4DFMA 3P9KA 2E35A 2YNFA 1SZ2A 1BG3A 3IAS2 3LP1A 3BPVA 3TAQA 1MH3A 2TDXA 3M8FA 5ILUA 1XHXA 1QS4A 1VQ5N 1O4XA 2V1XA 3R6MA 2RREA 1T33A 4MLOA 1EX4A 2OCCH 4FJIA 4C9YA 2GXAA 1NGCA 3V9XA 2VWBA 2VOPA 1QZ5A 3S16J 2ZFUA 2CUZA 2R7OA 1JHHA 5GPCA 2ISZA 1VSLA 3TAPA 1YJNN 1LKXA 4JYKA 4QPOA 2E19A 2J5PA 3HZJA 3G71N 1D1AA 2XGXA 3QYFA 1YIJI 1FYLA 4H8KA 2EZKA 3VPZA 2HU9A 2JPBA 3S2WA 4NUBA 3GXOA 3V8KA 4BE0A 1Y1WJ 4PWDA 2O4IA 3K57A 2VJJA 1GLNA 1U2WA 4E70A 2VIXA 1X9JA 1UHSA 4BBSJ 4CZHA 4CA0A 4DYCA 1QZYA 1I3QJ 1W9HA 3WNFA 4CGHA 3SCXA 1WRJA 1STZA 3H5AA 3HJFA 2HWVA 3BWGA 2GBYA 3LWFA 3DI6A 5FPEA 3K4MA 3KP3A 5J2MA 1ZG1A 3PX4A 3FZHA 2JPCA 5C2DA 2PN6A 4CJFA 5M1FA 2VQGA 3OYBA 4RGRA 3FZKA 2R4GA 3I33A 4A2UA 4PKHA 3CCSI 2V52B 4H0VB 1WWXA 3TP0A 3MEGA 4XK4A 2OAZA 1DDNA 4AHSA 3S3NA 5HBMA 4CEQA 3PY8A 3BCBA 5C24A 4Q48A 1ZREA 3EYIA 4DMNA 2P5VA 1LE8A 3CZ6A 2R93J 1EH7A 3MCPA 1ETXA 2DA2A 3WTWC 4Q4ZF 1XSXA 3IKMA 3OSFA 2VONA 1M1KO 5HDKA 4PKIA 4OKJA 4XLPF 4BROA 4DFJA 4HZFA 1NLVA 4Q47A 4U87A 4HDUA 3LL7A 4DR6K 3NF8A 4CW7B 2O3FA 4HX8A 3HOZJ 3GUDA 4GRIA 4F91B 4FSVA 4KDPA 4H0XB 4JN4A 3ASNH 4FLVA 2KP6A 4XOTA 3ZT1A 1YG2A 3HO1A 3L2VA 1XX5A 2P5GA 2FA5A 3UKRA 4B3OA 1A6IA 1ZTRA 3O5BA 2ZB9A 2HTSA 1JLEA 2G8UA 2P6TA 3BTIA 3GYHX 2EQRA 2RHKA 1OR7A 2ZSHB 2JVGA 1ERDA 2IVOA 5AZIB 3TL4X 5GIOA 1BC8C 3EUAA 3AVKA 4E1MA 4FJMA 3VB2A 3FF5A 4RGSA 4W97A 1J5EK 4J8FA 2F4IA 2VQCA 4QWQA 1T0FC 3L4QA 3VQCA 1JUSA 4BDPA 1U45A 2OV7A 3C2BA 5CYVA 3OYNA 3OYIA 3TU5A 4JK1X 2NRXA 3MN6A 2NS0A 4F7ZA 1YX5A 3A5OC 3B6OA 5AIQA 3L2QA 1BOTO 3T7ZA 2QA4N 3IWFA 1LPQA 3GTLJ 1BIZA 3QPTA 2HOTA 4LSLA 2OUMA 5CLSA 2DFHA 1F21A 3O08A 3N05A 4L5JA 2BY3A 5HDNA 3LL3A 3F73A 2M4KA 1BW5A 3VETA 4PHTX 1WKMA 2LLKA 3NCIA 4FLTA 4EHTA 4FM0A 4DU1A 2WOMA 4RGUA 4GYIA 3C2HA 1JLGA 3MEEA 2OQRA 4B48A 4FO0A 4NB5A 4I01A 1U6ZA 4AILC 4DFPA 1VQ7I 4XH1A 1X3MA 1I39A 4A5BA 2QI2A 2F48A 3NWTA 4BXFA 2M1BA 3EZ5A 3MVPA 4A3MJ 1Z21A 4UVCA 3A0IX 1B8IA 4Z2YA 4LITA 4C2MJ 3ZPLA 4AYBA 3BR3A 3AO4A 4JKGA 2XY6A 5HNFA 3E9PA 5BN9A 4IWVA 4XSXF 1X58A 2FOKA 5AQSA 3K5NA 5M5XJ 3IH2A 4A0XA 3G71I 1HF0A 4JQFA 3P38A 4ILJA 3A03A 5DCFA 5IP6A 4ID1A 5AQFA 3CUQC 2VWJA 5B5EC 3HOUJ 3RKYA 4B1WB 1MIJA 3C6TA 4U7BA 1U2VA 3EEQA 4RGXA 3WEEB 1RBSA 1OH5A 1S1UA 3CJQB 3HBTA 5KPRA 2KZMA 5ILVA 4AVPA 1TW3A 4DS5A 5J2NA 4PL8A 3K70C 4LLGF 3C94A 3CC4I 2MA3A 4G8XA 2JUGA 2ZJ2A 3K9KA 2P81A 5B8HA 3V4GA 4AYBN 3F8MA 1B92A 1GV5A 1JUMA 2ATQA 2IOCA 3F9MA 3UB5A 1T6SA 3VGKA 3AVLA 2CH0A 3WNHA 1V5EA 5GTHC 1WAJA 2GV9A 1NK0A 5D4RA 4J2EA 2JMWA 3HYIA 2ELHA 3FLCO 5I9EB 5D8KB 3TWHA 1PYVA 3ZX0A 5J8CA 1ACIA 3OBWA 4KISA 3SZPA 5FRNA 4A5MA 5DM6F 1RTIA 5T7BA 1OVYA 4LF4K 2ZJQL 1WJDA 2M8EA 2TRTA 3KLIA 2A07F 1QQNA 4LF8K 3AGKA 2HW3A 3UR3C 3B73A 4CZCA 1O57A 3IRQA 2Y69H 4ZYEA 2BY0A 4M3DA 2PFUA 1SKSA 1ZBSA 2W41A 1BI2A 1SKRA 1VQLN 2NNYA 1MWMA 2FF4A 4IXCA 2PYJA 2GX9A 5KQ8A 4O6JA 3SAHA 1T3VA 5CVRA 4ZYAA 4DYRA 4CGZA 3I4NJ 1WN7A 1FWZA 1WCMJ 2D0PA 3VYSB 5DD8A 3WHCA 4ETSA 2G7UA 1S1TA 5M1OA 3TOBA 3OYKA 3PIPF 1YJWI 2PMZN 1MBKA 4PSWA 2IS1A 4FWOA 1Y8RB 4QS8A 4IFVA 1RBVA 3F3XA 4A12A 5F04A 2JA6J 2QYOA 4EJWA 5M3FJ 3S1NJ 1Y97A 2EHGA 1R7JA 2P9IA 4ZHRA 1T05A 3CCRI 1W1WE 1EA3A 2R7XA 1Z67A 3E1YA 1SD6A 2Y9YA 1GLAG 1TYQB 3PIOL 3KYDB 1R1VA 1TLHB 1VZ0A 3ABLH 4AUXA 1BI4B 1HQUA 2EH3A 3BQZA 5HLFA 4KH4A 4UB6C 1WJ5A 2VQFK 3CCUN 1DGKN 2EB7A 1NG6A 1TWFJ 1I94K 1SAZA 4KICA 5B1AH 2VXDA 3RR8A 1ZBIA 3ESWB 4GKKK 4E4HA 3I55I 3AA5X 1C1CA 1VHXA 2YV0X 1KU2A 5CPRB 5D8LB 2LMDA 3SZ2A 3S14J 1B4AA 1ZK8A 1UG0A 3SUOA 1K78A 2CUJA 3E5XA 4A6DA 1AU7A 3O9UA 4IJAA 4BR7A 4DTPA 1N8RO 4NC8A 1FP2A 3AL0C 4AM6A 4CZIA 2ZCWA 4RB1A 5J47A 1ZR4A 4WQ5A 1JUPA 4XORA 4BHPA 3R9PA 4KA4A 2MFZA 5F0FA 1DLOA 3T0YA 2OD5A 3C6HA 1LFPA 3D2FB 2DTRA 4KYWA 1KA8A 3FMRA 1HXDA 5EVZA 1L3UA 3ULEB 4KT6A 4C3IJ 3HTSB 5E3MA 2A42A 1D9DA 5CKTA 1HNWK 3D45A 3CDHA 3ZETA 3OOPA 5ED4A 3LAPA 3IHUA 4ENNA 3LM9A 5FDLA 3KP7A 4B1YB 3SJHA 3HRTA 1C0MA 1C1BA 5LGUA 3L2RA 2JT1A 3BOQA 1DU6A 3CUQB 3NBPA 1KAXA 5KGWA 5JLFA 1FJGK 1K8AO 3TKYA 1ESVA 4CK1A 4PFPA 3BTJA 5K7ZA 4HLXA 3P83D 3NAUA 1E4FT 4N4NB 1EO1A 4AM7A 2LKPA 2R3SA 4O3MA 4CEBA 1CLQA 5HL7L 4UVAA 4XNFA 1XC5A 2GEMA 1AWCA 2K27A 3IRXA 4MFDA 3A0HC 4JX4A 2ZJQF 1E2XA 1SEUA 2M30A 4IHVA 5C4XJ 4HDVA 1O3QA 1VSFA 2X0LA 5J1EA 1NGEA 1MSEC 2UXNA 5JLXA 1E3OC 4QAGA 1FZPB 3V1OA 1PVEA 3BY5A 3R3LA 1IJWC 4WE1A 3O4WA 3OL3A 3LPUA 3TDZC 4NBQA 2YPRA 4CI6A 2VPRA 3LQQA 3PFIA 4K8XA 1BJAA 3G73A 2CU7A 1U8BA 3O8MA 2UU9K 3CTAA 4M9SA 4N5SA 1QSYA 2CQXA 1NK6A 1ATRA 2KMUA 5JHUA 1JLQA 3Q3SA 2HBKA 2OPPA 3B02A 1D3YA 2CG4A 4DR3K 2E2OA 3AVAA 4BJTA 5L3EA 1TNSA 2W85A 3RRHA 1OCOH 1RR8C 2OZMA 2L4AA 3O6BB 3LSJA 3HBLA 2P5OA 2VJ4A 4JKDA 5MLCQ 4BRHA 2QCOA 1IG8A 3MKWB 3ALYA 2MW8A 2M7AA 3EE9A 2ELKA 1VF9A 4XSZF 5K5QA 2NRRA 2EK5A 2V7YA 3FXUA 4IG0A 2Y1JA 4BS9A 3OS1A 2BDPA 3R61A 3IWZA 1IKVA 3FZFA 5BREA 4DUZK 3DKWA 1MBFA 5LJWA 4F3OA 3QYBA 1R49A 1VSMA 1D0ZA 4ZDPA 3P4IA 4IOXA 2ECBA 2HI3A 2IPQX 3DTIA 1VSJA 3KVGA 3L0QA 3MCAB 3LP3A 1S9EA 4DV2K 2OTLN 4Z4GA 2HNHA 4K41A 2XAQA 2BW3A 1OYIA 5A2QZ 1RBRA 3K2PA 3DLAA 3DMJA 2V4JC 3QIPA 3V9SA 5EU7A 3QP5A 4P9FA 1S6PA 2Q3SA 3AVJA 3QINA 2HHVA 2VODA 2GA2A 1G3TA 4CVNE 2FNPA 1S9HA 3KPHA 1HX1A 3GBGA 2KDOA 2ZF5O 4UB8C 3CQ8A 1YYVA 4P96A 4CYDA 2QWWA 4MTDA 3GO5A 2XO7A 1OLTA 2P9KB 2PI0A 1L3VA 2Q1NA 1YFHA 2KKOA 3JRBA 4Z4EA 3CCQN 5JI6A 4DV4K 4CZMA 2X4HA 3IRRA 4Q5VA 3SYZA 2DY4A 3FBNB 3KD1E 2ADUA 3NF9A 2VLAA 1BISA 4F2RA 1RT4A 2H3GX 3EUHC 4P55A 3MN5A 4CIFA 5E18F 5AQTA 1P9QC 1DP7P 2NRAC 2OZ6A 1HRHA 3MXIA 3BGRA 2E2PA 4A3IJ 3HOSA 4RMNA 1KC8O 4D7NA 2XPWA 5D5VB 3CFOA 4UQGA 4EM2A 1T7PA 3SEZA 4KTQA 2WY8Q 3VN5A 4CFCA 2W6KA 1QSLA 3VA3A 1NGJA 3VQAA 4N47A 5E3OA 5EZHA 3PNTA 3NGIA 1IXCA 1VQPI 3S2DJ 1Q86O 4EEFG 2STTA 4UY8O 5KPZA 2HQ5A 4E7ZA 2W57A 1OR7C 2XKOA 3DTKA 5FPDA 2HHTA 1WVRA 4U0VA 1ZC6A 1BN5A 1EH6A 1I5ZA 3FXQA 4DSLA 4GXOA 3U9DA 4RWTA 1BQMA 1KAZA 1QHTA 3CJAA 3G0ZA 3T1HK 4JKGB 3FX3A 2HOEA 5B66C 1ATNA 5GADJ 4UV9A 3ZN0A 2G9WA 2JZYA 1K4SA 1HCRA 3BLYA 5D6EA 4HVJA 3KP4A 1DKGD 2HHQA 1P7JA 2WC2A 3HL8A 2FMYA 1TL8A 4BRMA 2FD5A 4CJSA 4LFCK 3VQ4A 3UKUB 5FLXZ 2PEXA 1A6QA 3CJBA 3T3FA 1P7IA 1YJ9I 1JKOC 2HYJA 5K1YA 4FJHA 5BPIA 1OCTC 3FZVA 2QVOA 1T44A 1Y6IA 1IKYA 3C7NB 3H3NO 3RR7A 4L9NA 2LTPA 1JGGA 2L9NA 3IAM2 1H88C 2BBYA 2E34A 2QWLA 4PQUA 2PMHA 3SYTA 1FJLA 1SKWA 4FYDA 3ZT2A 1T03A 1TTYA 2MD5A 5CE3A 4ZYGA 1TQMA 5FKLA 4CCKA 2RV8A 3CJTB 5JFRA 5LMUK 1SVOA 2HVSA 1X19A 1FC3A 2RE2A 3ATUA 2P9NA 4JS5A 1CXQA 5L3BA 5B1BH 1HLUA 4IOAL 3Q9VA 4ZC3A 3I58A 1HNVA 2O8KA 2H94A 4CIEA 2W82A 3MXJA 1K6OA 5KQDA 2LP0A 1WSFA 2ASOA 1W7PB 3CCJI 1YS7A 4AHVA 2ICWG 4NQWA 3VDXA 3GLXA 1JLFA 1FKPA 1UWBA 4PJNA 2BOLA 3WHBA 3HGYA 3S32A 1QA6A 4BQLA 3TW6A 4I9LA 4FL9A 4II3A 1A5VA 1VNDA 3HPHA 3TARA 4G6TB 4BL0B 2Y2ZA 5BPDA 1GLDG 1OH6A 1NTCA 2RNGA 3J7YJ 1FX7A 1OCZH 2A6TA 1RT2A 1XNQK 2ID6A 3JRHA 4IEEA 3QDKA 3HP9A 5CQEA 2QUFA 3KK1A 3MCZA 3LALA 2XHBA 2IGNA 4DSFA 4PSXA 2EFOA 3H3VK 3W0LA 2LG4A 4IHTA 4ON0A 1RTJA 4B9TA 3S3MA 3MEXA 3FXJA 1DGWY 3WU2C 1ZQ3P 1LWFA 3K5LA 2O8CA 2DCEA 4LIVA 1NM1A 2P9SA 1S72I 1YITI 4YOWA 2P5LC 2QQ8A 2V9PA 4I2QA 2Y75A 4Q5SF 2XY7A 1ZRDA 1U49A 2H6BA 2NRZA 5EEGA 4UVBA 3HRSA 4UUVA 4B3AA 1Y56A 2ETHA 1YOVB 2W25A 1FYMA 1KLMA 2NS7A 2CGKA 3GEZA 4JKAA 4B9QA 4FJ5A 1MGTA 1HYVA 4KHUA 3CERA 2QENA 1KFDA 3HZ6A 5C2FA 4JKFA 4H4KC 2NRTA 5FKOA 3J81K 4DTRA 5CVVA 1TKTA 1OH8A 4CBWA 4C8OA 2LOOA 1WNSA 3UKRB 1SL0A 4DV5K 5IP7J 3CMYA 1N5YA 2QA4I 1EQYA 1JTYA 3M9AA 3Q0VA 2HDCA 2YHWA 9ANTA 4FK4A 3KLNA 1OH7A 3FZMA 2WA0A 4RG8A 1BI3A 2PFBA 2E1OA 1UG2A 4HV5A 3OWTA 1JKHA 1FXXA 3O9SA 4CJVA 1V4TA 3LA3A 4DF8A 1BI0A 2GZWA 4BC4A 1TWAJ 1IUYA 1IDZA 3EUKL 4ESFA 1CQTA 2IAJA 2GA1A 4BRLA 3CQZJ 3AGRA 4DTJA 5JVGF 3H6EA 4CD1A 1GDTA 2ZE2A 2FSWA 2Q0UA 5E1XA 3DLGA 4AIKA 1D4XA 1GVJA 4JI3K 3JRCA 2KISA 3IH4A 2EIJH 2VKEA 3HI0A 4GFBA 2FC0A 3HKZN 3FXMA 5HDGA 2CV0A 1NGGA 2DOEA 3ZMVA 4RAZA 3D5SC 2R7WA 2D1HA 2YHYA 4O55A 2ELJA 2P9KA 1FMWA 4YFNF 1J7KA 1ZG3A 3AG1H 2ZQBA 4AIDA 3CC7I 1MBEA 3DQVC 4RLQA 1XB4A 4X1EA 3MN9A 4JD2B 1M90O 1VQKN 4JV5K 3RYPA 1RI7A 3ASOH 4FJ9A 3DXMA 1ITGA 2AA4A 1SFXA 1GOCA 4FVMA 4B3TK 4CCJA 4I98B 1B9NA 4I7FA 3JXUA 3V1QA 3H46O 3CCVI 1EWQA 1W5TA 3LSIA 3ZEUA 2WTUA 2WY7Q 3FK6A 3RDIA 1X3UA 3HGGA 3DTEA 4XRSG 2D0CA 1GVDA 3EKUA 1R58A 1LNWA 4E7IA 2CFOA 5HS8A 2MD0A 5AZIA 4DFKA 2NNNA 3MMYB 4JNEA 3CYMA 1HDPA 2QEXN 4JBAA 5J2QA 1ASVA 3RI4A 4D9JA 1ZBUA 4RCHA 1KD1O 4KMUX 4JI6K 3T1BA 4C8MA 4KTWA 4CEDA 1QQCA 5TKYA 2P6SA 3IDHA 1J75A 1KVAA 4KH5A 4FOIA 4S04A 3CJ7A 4W5QA 2Y0SN 4A62A 2UXCK 1V55H 1EWRA 2IDOA 3LSPA 2V9VA 4FK0A 3U9GA 1SVMA 1KVCA 1XNRK 4B8CA 1MJAA 1QO0D 3SAFA 3O8GA 1WPKA 3K2AA 3WG7H 3L3UA 2YNIA 3D7EO 4FVUA 4G1QA 3O9TA 2MABA 2UUBK 4C1NI 1PP8F 5H20A 2BVMA 1D5YA 2ZXJA 4GMJB 2KFNA 5AR0A 2BY1A 4PJJA 3C6AA 3VQ7A 1WH5A 5BRFA 1ULYA 2IA1A 5GP9A 3MN7A 4BRNA 3HXMA 1EF4A 1I50J 4F2SA 1ZYRF 5C42A 4DQRA 4BRIA 4XEIA 3GTGJ 2DMPA 3KLEA 3PQJA 4DV7K 2XDVA 3JAMZ 3VEWA 4Y4RA 3ZMTA 4BH9A 1GOBA 4JI5K 3OIOA 2EA4A 1F36A 1U6GA 3OYLA 3PUFA 4RBOA 5LD2C 1P90A 1HNZK 1TT5B 2XIGA 4J2BA 4M6YA 4FM2A 1T6CA 4LLLA 4YY3K 1RKTA 2K4BA 3MKYB 4B1ZA 5C12A 3CUOA 4DLEA 2F5VA 2E5LK 4HW0A 3I56N 4GV6A 1NGBA 2XB5A 2X6WA 1H9TA 3DLLF 3RMBA 4KFCA 3BQYA 3BP8A 2E6LA 3NF6A 3JREA 3CQYA 1HNIA 3PUBA 2B6AA 1N75A 3ZOBA 3GZ6A 4FJJA 1HDDC 5HLTA 1RDCA 2KLAA 4IDHA 3DLLL 3G6EN 4DTNA 5KNLA 3D1NI 4X64K 1KQ0A 1Z7UA 3I54A 2KDZA 3SDGA 1JT0A 2FRHA 3QPSA 2HQAA 3BUZB 3RVCA 3VF2A 3M8EA 3QODA 3EKSA 3BR2A 4I02A 2EFQA 4GCVA 3RKXA 4XONA 3GWZA 3L2UA 2M45A 1B72B 1DEJA 5J8FA 4O4GA 3A5MC 3ABUA 2HYFA 1Q1VA 4DNCA 4KTZA 3LA2A 4G9ZA 4B4CA 5BOXA 3O3FA 2R7UA 1K78B 1S7OA 5FKNA 3O1BA 5F0HA 5LEKA 4FLWA 4MHGA 2Z1DA 1BBYA 3MEDA 4KB0A 4J2DA 2PYLA 1VQ8I 4A2BA 4FISA 5GPAA 3VOEA 4KMFA 4JLHA 5DK5A 3HTUA 1ORKA 2DT5A 3H0DA 2QEXI 4WYBA 2ZNYA 5DM7F 4Y17A 2E4LA 3C65A 1K73O 2E1MB 3PLAA 4PGGA 2M4GA 4XKVA 3MAQA 2ZMEB 3H08A 3QAHA 2LVSA 3U3GA 5FD5A 3D5LA 4BUPA 2NXNB 2D4WA 2DBBA 3DLKA 3L4IA 1UZCA 1UAXA 2FXAA 1IUFA 4ZDLA 3CF2A 3LZIA 1BA0A 4L5IA 1NJYA 1YS6A 2P9IB 1WBDA 2A05A 4Q0BA 2Q8KA 1N77A 2R7TA 4E1JA 1ZLKA 3V9WA 4ILGB 1FSEA 1NGAA 4YDUA 4M45A 3PFYA 2FQ4A 2O8DB 4O5BA 1QPMA 4FLYA 2HMIA 1HPMA 1EXQA 3NWSA 3BG5A 3V9UA 2PMUA 2X48A 1UCRA 3LFUA 1YXQA 4YOTA 2E2HJ 1BIAA 3CC2N 3F0CA 4WCEL 4H5VA 5LJVA 3CETA 3E0JB 3QETA 4N9IA 3QWLA 4WK8F 4DZJA 4DU4A 1IN6A 4B8XA 3OYFA 3IKTA 1RRJA 2E2QA 4XKCA 1EJ9A 3BROA 4A3JJ 1NKEA 1NKBA 1N6QA 2MBFA 4GKJK 3MXMA 2Z1JA 4RTFD 3BZCA 2XVCA 4XOPA 1FEXA 5KAIC 1BDGA 4WQ4C 3V81A 2KQRA 3M8JA 1NH3A 4A5AA 4LF7K 2DPNA 4LD5A 5AQNA 1QZ6A 2E60A 2ME6A 4OIPF 1IV8A 2XRNA 4B3RK 5E8GA 3OOUA 3GX4X 3LAKA 3AA3A 2FF6A 1KGSA 2K85A 5LEJA 3CCQI 2HEOA 1S7EA 4CYCB 1ASWA 4WXHA 1YF5L 2LY1A 1AOYA 2OPSA 1S6QA 1SC7A 3KTQA 1YVUA 3CC4N 2UXDK 1SD5A 1WHUA 2PX9A 4KIGA 3JSOA 1J59A 2E20A 3BDDA 3L1PA 2F2EA 2EX3A 2DFIA 1UMQA 3O4QA 4DR4K 1Q9XA 4C3HJ 1IV6A 2HHXA 2A3ZA 2L7ZA 2A61A 4M6XA 1N32K 2HOSA 4XIUA 3VA0A 3I4PA 4FETA 3KZIC 2P9UB 1NG9A 3BR5A 2DTZA 1A5XA 2EZLA 3Q7CA 4CHZA 1RT6A 5FFXA 2XC7A 1HJOA 2XKPA 1GLLO 3CM5A 4EVIA 4DTMA 1FIAA 1SAUA 1HBXG 2P9LA 5ERIA 3E9OA 5DM6L 4ZYHA 3AY9A 3WGIA 4O5FA 1F9NA 3K1PA 1CZBA 1RKWA 1XDSA 4ESJA 3ZSRA 1NOZA 4H0PA 2DYSH 3CP8A 4A2AA 2RQQA 2X9DA 4CJWA 4D5FA 3ZR8X 3M7GA 3VENA 4ID5A 5FLXK 4DQQA 4FJLA 1IBLK 1FMVA 4IOCF 2KQ2A 2VPLA 1O1WA 3KJVA 2F7TA 2UUCK 2X6NA 1ZN2A 2KRFA 1ZHFA 5J1UA 4IPAA 5FLMJ 3D2EA 5JS1A 3PO5A 4DOZA 3THWB 4K0KK 4LF6K 4IRIA 2O8DA 2DA3A 2O6GE 3MQ0A 2A3SA 1ZR2A 3J7ZI 3DXKA 3LDOA 3VGLA 2EPFA 3O3HA 3WQUA 1USSA 4I2PA 4JKHA 3S2HJ 5CHIA 3PIOF 2YU9J 1SANA 3HT3A 2K9SA 3DPUA 5D5UB 4HNTA 4YORA 3SQ1A 1W7PA 3N97A 2EBIA 1B9FA 3L6QA 2FBIA 3CCMI 1XMKA 2CUEA 5IT3A 1PP7U 6PAXA 3NH1A 3THYB 3TAGA 3MWMA 2MYSA 4Y33A 4IXAA 4NYFA 1HW1A 3S93A 3WTZA 2OC6A 5HS9A 2RQPA 2PJRB 4N76A 3CLOA 2K9MA 1DQUA 4EFHA 3GDQA 1YW7A 2NVXJ 1Z7LA 1FTZA 1UB9A 3BF3A 1NJWA 3U8XA 3ZQ7A 4FJ7A 1A35A 2MLGA 4M3XA 5AQQA 3TI0A 2Y48A 4P1WA 2DOAA 1H8AC 2C6YA 4W5TA 1X9WA 1IG7A 1CXUA 2MC3A 5EXWA 4JOMA 1YT3A 1GXQA 4XKBA 3SMPA 2DA6A 4CZZA 4CF1A 2WB1A 3WXIA 3AL0B 3HEFA 1Y64A 5K14A 1YI2I 3QERA 2HVQA 3RSEB 1F5TA 4A69C 1G2HA 3OSGA 1WJCA 3AVBA 4ZZLA 3AG4H 4CZJA 2A5XA 3C7NA 1TAQA 1L0OC 4UV8A 5KK1A 3HM9A 2G8VA 1C1AA 1I27A 2Z5UA 3LPTA 4C8NA 3OYCA 3VQ8A 2JSPA 1NG7A 2X85A 1IN8A 1S3XA 2OANA 2Y0MA 1JCEA 5DEQA 5LLQA 1U9OA 3O1WA 3SMSA 5LFAA 3ZX2A 4IO9F 3CUQA 4Y52J 1H1VA 3NAEA 2FNAA 2F5FA 1HUXA 1FOXA 3T19A 5AZJB 1S1WA 3DOKA 3BR1A 2OPRA 4EP5A 3G25A 2LNBA 1BOAA 3DFGA 3KK2A 3HHGA 4LB6B 2P7VB 3JTHA 2EIKH 5GTIC 3OJUA 4JX6A 3OS2A 3HSTB 1T08B 2RNJA 4NCGA 4RW7A 3COAC 5AFUA 5H1SQ 2LDUA 4R79A 2KKZA 3OYGA 1WZ2A 2HMPA 2COBA 2FEZA 1NGIA 3CJCA 3VSLA 3F2KA 1J2XA 4LGWA 1GOAA 2EWSA 4D1QA 1POGA 1NJZA 3UIQA 4HA8A 3WODF 1BW6A 4A0YA 1HKBA 1JHFA 4AVZA 4KN4X 4Y3OA 5LGTA 2M9HA 5ILSA 1O3RA 2HSTA 2K40A 3M1FA 3D0SA 4DBRA 2IGIA 3DM2A 3RMAA 2H09A 4BQOA 4K42A 4A59A 1Z3XA 1RTDA 1MA9B 4DW6A 5AQKA 1MMDA 3SI6A 3DLHA 4ZTJA 2V26A 3VEZA 4CJ4A 1TL3A 2EWNA 4JRPA 3N4QA 4AF1A 1APLC 1OKJA 2OZSA 5AQMA 2ISYA 4HBLA 4RLFA 3JRAA 1BL0A 4OMZA 4H0OA 2ZJRL 4CHPA 1DTQA 3SPYA 1HKSA 3LDQA 2NRWA 4FZYA 3M3YJ 2BH1A 2XSDC 5GAGP 3WQTA 4F8RA 3SQNA 1U78A 2W7NA 1C0FA 3J8AA 4F93B 1OJLA 3W2VA 2R92J 1XSVA 1O7LA 5F1RA 3WU0A 1RILA 4GNIA 4HWIA 3CCMN 4KRFA 2NOJB 4DR5K 1LDDA 4QPQA 4FZXC 2VT2A 3ID8A 1MJ9A 4RS8A 4ANJA 4ZDOA 1V4SA 3MK6A 3HP6A 1ONVA 3SUQA 4ZJZA 4IO8A 4XLEA 5J4VA 2UYTA 4JD2A 3PJRA 5HRPA
chains in the Genus database with same CATH topology
3K2PA 3QIPA 3DMJA 3V9SA 5EU7A 1A5WA 1ASUA 1S6PA 2Q3SA 3AVJA 3QINA 3KK3A 2XY5A 2HHVA 4CJ5A 2YKMA 1SUQA 2XY8A 3CQ8A 4FLZA 1HQEA 2IS3A 3NFAA 5KRSA 4CJPA 2XO7A 1L3VA 1VSDA 1RTHA 1WSEA 2DY4A 4Q5VA 3SYZA 4NCBA 1D5AA 1BIUA 2VG5A 4FJ8A 3KD1E 4F2RA 3NF9A 1BISA 1RT4A 3ZSYA 4DQPA 4CIFA 4AH9A 1VSIA 1HRHA 4RW6A 1KRPA 3AVIA 3BGRA 3TAEA 3EYZA 3AA2A 1T8EA