1IO2A

Crystal structure of type 2 ribonuclease h from hyperthermophilic archaeon, thermococcus kodakaraensis kod1
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
213
structure length
213
Chain Sequence
MKIAGIDEAGRGPVIGPMVIAAVVVDENSLPKLEELKVRDSKKLTPKRREKLFNEILGVLDDYVILELPPDVIGSREGTLNEFEVENFAKALNSLKVKPDVIYADAADVDEERFARELGERLNFEAEVVAKHKADDIFPVVSAASILAKVTRDRAVEKLKEEYGEIGSGYPSDPRTRAFLENYYREHGEFPPIVRKGWKTLKKIAEKVESEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic center of an archaeal type 2 ribonuclease H as revealed by X-ray crystallographic and mutational analyses.
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
molecule keywords RIBONUCLEASE HII
total genus 69
structure length 213
sequence length 213
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2000-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 1io2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1io2A01
1JLGA 2FBTA 4CFDA 4FLXA 1FXXA 3HL8A 4M3ZA 3DMJA 3HPOA 4LSNA 2IC3A 3SPZA 2F8SA 3SZ2A 5C42A 4J2AA 1BISA 4GMJB 4R5PA 3RMDA 3S3OA 1DTQA 2G8HA 3AVKA 1SKSA 3KKRA 2HNZA 4CJVA 2ETJA 4FLVA 4DTMA 4FLTA 2GUIA 4CEOA 2IDOA 4E1NA 1HMVA 4CJRA 2QKBA 2YKNA 4M42A 4DTNA 1XHXA 4CJLA 4B9SA 1RBRA 1RT6A 4G1QA 4CJKA 1NK4A 4CEAA 3OYJA 4B8AB 4PQUA 2HHSA 3HP9A 4DMNA 1HQEA 3DRRA 2E6LA 1ASWA 4CGFA 4FJNA 1TGOA 3K59A 4FZYA 3NF6A 4I7FA 3LPUA 4CJ5A 3V9UA 4B9MA 4DLEA 3QETA 3PUFA 2OPRA 4KHNA 5FRMA 3NGZA 2X6SA 3KLGA 1UOCA 4DQQA 1XC9A 4KTQA 3KK1A 2G8UA 3AVBA 3LPTA 1QTMA 1S5JA 4C8OA 4FK0A 4AHCA 2HNDA 4KREA 3ZSQA 4K8ZA 1WNSA 3THVA 4WE1A 4JRPA 3T3FA 4FCYA 2ZQBA 3SQ2A 1T8EA 4DFKA 1WSHA 3DLEA 2OPQA 1WN7A 3HM9A 4DQSA 3JSMA 4FK4A 1CXQA 1ZBHA 4MQ3A 2YNGA 2HHVA 2X6NA 3NGYA 3AO1A 1RTIA 2B5JA 3L2UA 2DTUA 1S1TA 4N47A 4DTPA 4DFMA 1HYZA 3M8RA 4Q0BA 4O5BA 4FJIA 4PWDA 2ITGA 4CJ4A 1T7PA 3LP2A 4CIGA 3P5JA 3DYAA 3OYDA 3I8DA 4FJ9A 1RDCA 1KLMA 1HNIA 1S6PA 1RDBA 2RN2A 3HYFA 3U3GA 1NK0A 3O4QA 4I9QA 4NCGA 5I3UA 3NE6A 1ZYQA 3L3UA 4OGEA 2JLEA 4IG0A 2BANA 3ALYA 4CE9A 1XI1A 1NK9A 4B9LA 3HPGA 2W42A 3TAQA 1JLAA 4E7LA 3RTVA 1BI4B 2YNFA 1U48A 1JLFA 3ZT0A 1KCFA 2E4LA 3KK2A 4FM1A 3V1QA 3U6FA 4FYDA 1VRUA 1S9GA 1RDAA 4O55A 1NOZA 3ZT4A 3DLBA 2G8IA 1S6QA 3MEDA 5J2MA 2HHUA 3AVGA 3AA4A 3AVCA 2IS3A 4ELTA 3LDSA 1SL0A 2RF2A 5FRNA 4W5TA 2HHXA 1WLJA 2B6AA 4DS4A 3KD5E 3HSTB 1LW2A 2EX3A 1Z26A 1Y97A 2ZE2A 3AO2A 3OYLA 1JLBA 3ZT1A 3SI6A 3NF7A 3S3MA 3VQBA 3TANA 1N6QA 3RR7A 3VQQA 5HRRA 4DU4A 1WSGA 3OYMA 3SQ1A 2IGIA 4Y1DA 1TV6A 2LSNA 1HYSA 4DTJA 2AJQA 5SZTA 5CZ2A 1W9HA 5CYMA 3TABA 1RT5A 5JS2A 3OY9A 1D9DA 1RNHA 1B92A 1VSEA 3ZT2A 1TK5A 4LSLA 3UIQA 1FK9A 3RRHA 1BIUA 1C1CA 1RDDA 2NUBA 3PY8A 1ZBUA 3T19A 2PYLA 4FJ5A 4HTUA 3CFPA 2GV9A 2Y1IA 3LP3A 1J54A 4GVMA 3DLRA 3SYZA 1C0UA 1TVRA 4OKEA 4H8KA 1D8YA 4IKFA 1IG9A 4E1MA 4CEEA 4CGHA 4CHZA 1ZBIA 1RT1A 3QEIA 2G8VA 4KRFA 3P1GA 4CJSA 4EP5A 2DFFA 3TAPA 3SV3A 1CZ9A 3OJSA 3QINA 3NGIA 4YNQA 3L2VA 2XO7A 3AO5A 3LZJA 4IFVA 2XHBA 2VWKA 4AILC 3RR8A 4CJ3A 1KVCA 3NAEA 1KFSA 4ELVA 1C0TA 4HUEA 3VQ5A 4E7KA 3C94A 3RMCA 1SV5A 3KJVA 3VQ9A 2FBVA 2G8WA 4Z4FA 1D5AA 4ICLA 4BDZA 2YNHA 5FROA 4DTOA 4FJ8A 1VSHA 4CJFA 4JS5A 4CCHA 5C24A 3NDKA 3QNNA 1TKTA 3C95A 4C8NA 2KW4A 1L5UA 1CLQA 1B9DA 5EU7A 4KB1A 4CESA 3CM6A 4F3OA 3V9ZA 3SUOA 4DQRA 4M3TA 4DSFA 4BACA 4CEBA 1WSEA 2DFHA 3OS1A 4CERA 1S1VA 1HYVA 1LW0A 4CK3A 1QHTA 3CFRA 1RT7A 3KLHA 2XY6A 3PO5A 4EZ9A 4CHYA 4C8MA 2P51A 1WSIA 3OJUA 1W0HA 1G15A 4KTWA 4CEZA 1R0AA 4PUOA 3NFAA 1LWFA 4AHVA 4B9UA 2QXFA 2HVIA 4LY7A 4DU1A 2HHTA 3K57A 3SUNA 1L3VA 4FZZA 3ITHA 3AVIA 4AHSA 3V9SA 5KI6A 1RTJA 4CJWA 3D0PA 3V6DA 3TR8A 1RT3A 1RTHA 4AH9A 4CIFA 3ZSXA 1UA1A 3OYNA 5KGWA 3VQEA 4CGJA 2B4JA 3AVMA 4FJJA 1NKCA 4KAZA 3HPHA 3I0SA 3QEPA 3PV8A 1HJRA 1CXUA 3ULDA 1TKDA 4DTXA 3LAKA 4Z4EA 1YVUA 4RW7A 3NH2A 2RKIA 3PX4A 4CJEA 2BGGA 3L3VA 1RCHA 4LD0A 4H4OA 3PX6A 1TAQA 5HP1A 1JXBA 4KV8A 1NK8A 1T03A 3IAYA 3RMBA 4DQIA 4CJUA 3EYZA 2KTQA 1SKRA 4FXDA 1JL2A 3SQ0A 5FDLA 2D0BA 2Z1GA 3E01A 2F96A 4GW6A 4HUFA 1UWBA 3OYKA 4DFJA 3SPYA 4FLUA 3AVAA 4CGGA 2FBXA 3ZSOA 2OZSA 4M41A 4Z4HA 4KI6A 4CEQA 1NJWA 3KTQA 4BDYA 3RWUA 3LWLA 3KKSA 1QSLA 1RBVA 3WNGA 4DSLA 1JLEA 1RT2A 1ITGA 3CFOA 4DG1A 3NH1A 3ZSYA 3JYTA 4CJPA 4KHQA 3DLHA 5I42A 4Q5VA 3V1OA 4Z4IA 2Z1JA 4KO0A 3QNOA 4M3UA 5HRPA 4FJ7A 4KHYA 2I5JA 3CYMA 3M8SA 4FLWA 3I0RA 1VSJA 1Q9XA 2KFZA 3AA5X 3M8PA 3CM5A 4NYFA 4OKKA 5SWMA 3G10A 4KHUA 3K2PA 3OYEA 3P83D 3LANA 3O3FA 2RPIA 2P5GA 1EX4A 1KVBA 5KGXA 2OYQA 4FJMA 1VSFA 1KVAA 1DLOA 1QQCA 1KTQA 3OYIA 4Y1CA 3NHGA 4N41A 4J2BA 2YV0X 3QIOA 3VQ8A 1XHZA 1NOYA 3AO3A 1SKWA 4RG8A 4RW6A 1IKVA 4HCBA 4ELUA 1WSJA 1EETA 3OVNA 2X78A 3TAMA 3DOKA 3HVTA 3IG1A 3L2RA 3L2QA 3OYAA 2YHBA 3SQ4A 1KLNA 1EXQA 3HXMA 1S1XA 3V1RA 3IRXA 1BIZA 1D9FA 2ATQA 2VWJA 4OLAA 2DFEA 1GOCA 4Z4CA 1A5VA 4M3RA 3VQ7A 4XIUA 1RTDA 1GOBA 1NKEA 4UQGA 1J5OA 4B9NA 1F21A 2QK9A 2VG7A 2YNIA 1B9FA 1HPZA 3AV9A 3OS0A 4BE2A 3DI6A 4CIEA 1C0MA 3MECA 3QIPA 5HROA 4PA1A 2FC0A 1WSFA 1EKEA 2Z1HA 2D5RA 4FW1A 3NCIA 2KFNA 3C6UA 2A1RA 3K5NA 3LP0A 2HB5A 1DTTA 1YT3A 3DOLA 4FVMA 3DLGA 5CZ1A 2PYJA 3OYFA 2F8TA 4NCBA 2VG6A 1U4BA 4DQPA 1U49A 3K5LA 1NJXA 3DRPA 4CGIA 3LP1A 1C1BA 3DRSA 1L3UA 4OPJA 1X9SA 1YTUA 4H4MA 2PY5A 1LWCA 4B08A 1LAWA 4OJRA 5HRSA 4NCAA 2WONA 3SV4A 3O4NA 4KB0A 4FM2A 2WOMA 4IDKA 5K14A 1ASUA 2Q3SA 1RILA 3VQDA 4CECA 3KIOA 3K58A 3QEWA 4KHWA 4CF8A 5KRTA 3S9HA 1NKBA 1J53A 2YHAA 3V9WA 3VQ4A 4CF9A 1BHLA 3SUPA 1JLQA 4M45A 3B6OA 3KK3A 1IKXA 3L2WA 4W5RA 1S1UA 1TKXA 2P5OA 1X9WA 1JKHA 1LAVA 4FJGA 1LWEA 3AVJA 1TKZA 3B6PA 1EP4A 3RMAA 4OVLA 1U47A 3KLFA 3C6TA 3G0ZA 1QSYA 4BWJA 3OS2A 4OKJA 2A1SA 1TL1A 2FBYA 2X74A 3ISNC 3QO9A 3PO4A 4M3YA 3CG7A 4W5NA 3O3HA 1BL3A 1BQMA 1RBUA 4FM0A 4F3TA 2O4GA 2XRIA 1Z25A 3U3YA 4YFUA 5J2QA 4CGDA 4FJHA 1LV5A 4CK1A 1REVA 1S1WA 3ASMA 1WAJA 3QERA 4QOZB 3OYGA 1NJZA 3BGRA 4FJXA 1SL1A 3MEEA 1BCOA 3HVRA 4O0IA 3LZIA 4Z4GA 3NBPA 5HBMA 4FLZA 4RW8A 2HNYA 1SUQA 3T1AA 1VRTA 4CJTA 3TI0A 4DSEA 2OPSA 4IG3A 2DY4A 1QE1A 3KD1E 4M3WA 2HMIA 3AVNA 4CF1A 4B3OA 3ZT3A 2XY7A 3ZSWA 4B9TA 3L8BA 3S3NA 1Q9YA 3K5MA 4AHUA 4KKOA 3V9XA 4DFPA 2R7YA 3V81A 3HO1A 4N56A 2HVHA 4CF2A 2IOCA 2IAJA 1UA0A 3AO4A 2D0AA 4O44A 5DMRA 3HP6A 4E0DA 2KZZA 5CY4A 1U45A 4N76A 4QCLA 4J2EA 1L3SA 3F9KA 3V4IA 4KFBA 2OZMA 3AVFA 4E7IA 4DSIA 3CQ8A 2VG5A 4ID1A 1HQUA 3DM2A 2XY8A 1KFDA 4K8XA 2D0CA 3HJFA 3WNFA 3ZSVA 4CFAA 3TARA 1YTAA 2KZMA 3LAMA 4O0JA 3VQPA 4E89A 3AVHA 4KI4A 1XWLA 4W5OA 4I2QA 4M3XA 4W5QA 1T05A 1IKYA 3MXMA 3F73A 4MFBA 4F2RA 4F2SA 2P1JA 2JGUA 1U04A 3M8QA 4DTRA 3QEVA 4PY5A 1C6VA 3HK2A 1RT4A 4IFYA 1N5YA 4BDPA 3KLEA 4F8RA 4HHTA 2G8FA 1VSIA 3K5OA 4CHOA 3MAQA 1ASVA 3WNEA 3TAEA 3EZ5A 4E19A 1IO2A 4CK2A 5D3GA 1S9EA 4NYNA 3VQCA 3A2FA 4HCCA 3D45A 1ZBLA 5JS1A 4ZHRA 3LWMA 3EY1A 4DF4A 2QKKA 4LH5A 4L8RB 5J2NA 4FJLA 3AVLA 4KTZA 3OYBA 4E7JA 4I2PA 3SJJA 3NF9A 1TK8A 4JRQA 2OPPA 4Z0UA 2HHQA 3IS9A 1I39A 1RBSA 5HRNA 1FKPA 1K6YA 1X1PA 1JLCA 4KPYA 1FKOA 2BE2A 3KLIA 4C8KA 3RRGA 4CHQA 3SCXA 4CFBA 5CYQA 4CFCA 4DU3A 1X9MA 4FZXC 3ZSRA 3LALA 3OYHA 3VA3A 2KQ2A 3FFIA 3OYCA 2HHWA 4B8CA 1J9AA 1JXEA 3QESA 5KTQA 2PZSA 4DSJA 1HRHA 2EHGA 1VSDA 3TAFA 3MXIA 4CEDA 5KRSA 3VN5A 4DTUA 3H08A 4LH4A 2OA8A 3ZCMA 4DLGA 3NH0A 1NK6A 4RW9A 2HW3A 4FJKA 1BGXT 2XY5A 3WNHA 1SL2A 4BE0A 1QS4A 4HUGA 1KRPA 1GOAA 4C8LA 4CF0A 1A5WA 1L3TA 4CHPA 5C25A 4JLHA 1TL3A 4KHSA 3PX0A 1Q8IA 1BCMA 4DS5A 4CJQA 3MXJA 1CZBA 5DK5A 1JL1A 4EP4A 4E3SA 2Z1IA 1A5XA 1BI4A 4IBNA 5J2PA 3QEXA 3NF8A 1KSPA 4AHRA 4FW2A 4I9LA 4O4GA 2GBZA 4CEFA 1WAFA 4BWMA 3ZSZA 1UAXA 3TAGA 3SUQA 4QAGA 2G8KA 4J2DA 4HVJA 4AHTA 5T7BA 4ID5A 1VSKA 3VQ6A 1RBTA 2YKMA 3AA3A 1NK7A 4RW4A 2BDPA 1NK5A 1NJYA 2ZD1A 4DF8A 1O1WA 3O3GA 1TK0A 3BDPA 4OGCA 3VA0A 1VSMA 4N5SA 4TSXA 1TAUA 3SNNA 5J1EA 4E7HA 3VQAA 4B9VA 5HLFA 4F4KA 4DSKA 1C1AA 3QLHA 4ZTJA 1VK0A 3AA2A 4OPKA 1I3AA 4BE1A 3DLKA 3MEGA 4FLYA 4JS4A 3HT3A 4OLBA 2O4IA 3TWHA 4DTSA 1BQNA 1MU2A 1VSLA 1IKWA 4CHNA 1QSSA 1ZBFA 4FK2A 2E6MA 1HNVA 5E41A 2Y1JA 4ZTFA 4DWIA 1IH7A 4EZ6A
chains in the Genus database with same CATH superfamily
3M1FA 4EEFG 4LLLA 1OFCX 4CFDA 3H9JA 3DKXA 3L0QA 1VQLN 3I8BA 4GV6A 1FOKA 2EV0A 5DS9A 5HLGA 2D1HA 2FSWA 3OOUA 3SZ2A 4Y4RA 4J2AA 3S3OA 2HU9A 2QEXN 2XGEA 2ZJ2A 1SKSA 3WTTC 5IWAK 3WEEA 4F92B 3D7EO 4DR7K 4FLVA 5MLCQ 3ABLH 1JJ6C 4DTMA 1R1VA 3QAHA 1V4SA 1X1BA 2AXLA 4JD2A 4M42A 2VONA 1XNRK 4UB8C 3CCEI 2Y2ZA 1X2NA 4KIGA 1X3ZB 2G9WA 4XN0A 1DT9A 1RT6A 3OR1C 2LMDA 4G1QA 4CJKA 1QHAA 1H9GA 5E8IA 4NDLA 4DMNA 2JRTA 3MN2A 1HQEA 3IP4B 1VTNC 1ASWA 3MAQA 2M0MA 1BI1A 1NMDA 4CJ5A 3V9UA 3CQYA 4JX5A 3V4GA 4DLEA 3SJMA 2EV6A 5M5WJ 2DDAA 2HTJA 5CPRB 1E3OC 1MNMC 3D2FA 1YFHA 1UOCA 3TSQA 1DU6A 2O8KA 1XC9A 2X0LA 3WQUA 2RVCA 3E6DA 4XKVA 1JI8A 3AVBA 1S5JA 4C8OA 3DCFA 4K8ZA 1MMNA 4GV3A 4WE1A 2E1MB 1Z7UA 3UB5A 4FVUA 1ZBHA 3HM9A 1WN7A 4FK4A 3QU6A 2NS0A 4MQ3A 2QSFX 3SAGA 3W6JB 4C1NK 3NGYA 5GAHJ 3AO1A 3MD2A 1MWMA 1YJ9N 4A69C 3B73A 1XG1A 2A6HF 3O2PE 4N47A 1TWCJ 4BR4A 4BQLA 4R8HA 2B63J 3M8RA 2WBMA 5D5UB 4CZZA 3S93A 3JXUA 4L3QA 4FJIA 4AIJA 2KIMA 5FGMA 3LP2A 4CIGA 4HTLA 4F91B 3BUZB 1X3UA 2K3PA 1WJBA 2TDXA 1H1VA 4XLEA 1RDCA 1S6PA 2EWSA 3VOEA 4OAZA 2RN2A 2WTUA 2NS7A 4I9QA 2KZGA 5I3UA 5C2FA 2E36A 4S05A 2JLEA 1WI9A 3ALYA 4L9JA 4BJ5C 3ZMVA 1FJLA 3EKSA 4CE9A 1KAZA 3TAQA 1D1CA 1GVDA 3DTKA 3M8FA 4E7LA 1OYYA 1G6NA 3PL8A 1JLFA 4HAMA 3ZT0A 4FM1A 3V1QA 3U6FA 2XAUA 1NGDA 5B8HA 4FYDA 2O3FA 3MKLA 5E1ZB 4ENMA 2YSRA 3DLBA 3ZT4A 4FO0A 4DU1A 5AIQA 2G8IA 1GV5A 4U0VA 4U88A 3TKYA 5DCMA 4A0ZA 2NRAC 2Q1ZB 2K7LA 4NLCA 1BOTO 2BTFA 2HSTA 2X1DA 4AIDA 3LFUA 3F23A 1Y8QB 1R59O 4S0HB 2IS3A 1NG9A 4B1WB 2H6BA 3I71A 4DQ2A 3HXLA 3P9IA 4ELTA 4O5VA 2E88A 1ESVA 2RF2A 2V9KA 2YPRA 3BR3A 4A3GJ 5AQTA 2LK2A 5D6FA 3CMEI 1JHHA 3AG2H 3JRFA 2M8EA 4H5NA 2EFOA 3MMVA 4DS4A 4CUGA 2QWLA 2L3DA 1KFSA 5B3SH 2CV0A 2EX3A 2CUEA 1LKXA 2RGVA 1N6QA 4OPHA 3NF7A 3TO9A 3VQBA 1HKQA 5L3BA 2Q0UA 4DU4A 3QPHA 4XL9A 1GDTA 3AGKA 1ERDA 3EN9A 3T1BA 2GBYA 1HYSA 3RTRA 5J1RA 1ZGJA 2Y0SN 3HKZN 5KHDA 1UELB 4D1QA 1C0WA 3M4OJ 2Q31A 3UR3C 4IO8A 2UUZA 5AQQA 1W9HA 3NRVA 4A93J 3WXKA 3QETA 3MZYA 2JSCA 1X3WB 1B92A 3QOPA 4B3RK 1BIBA 1IV6A 1C1CA 1CQTA 2F4IA 2HQAA 3Q0UA 2H8RA 4R79A 2EQRA 4HTUA 2GV9A 1S7AA 1TYQB 1YW7A 1J54A 4GVMA 2L5QA 2NRRA 2DO7A 4OKEA 4YY3K 3ZQFA 2ZJPL 1K8KB 4CGHA 2DW4A 2IS4A 3LSKA 2YCHA 3HZ6A 1FEXA 2DFFA 3EUHC 2V52B 3F22A 3L2CA 3QINA 1S3JA 5C4XJ 3NGIA 1J5YA 3OSFA 2DLLA 2XIGA 2HKOA 4Q48A 1O4XA 1H8AC 1YUWA 2XO7A 3HSFA 3LZJA 4AILC 1A36A 3O6WA 1P4XA 1TW2A 2JA8J 3CC4I 1KVCA 5BR9A 3NAEA 1C0TA 5J6XA 1U5TB 1ZH5A 3J7ZI 4B1UB 5JR3A 1QVGM 3JSPA 1SV5A 2B9SA 3BT9A 3MWTA 1R5ID 2ECCA 2XDVA 1P92A 1D5AA 3O9TA 2LY9A 2NVYJ 2KDOA 2WA0A 3CQXA 4IEEA 4EHUA 1RKWA 2MLGA 3QMLA 5C24A 1OLTA 2LH9A 1DPUA 2HBLA 2Q36A 3AAQA 1BJAA 1BJZA 3GUDA 2OAZA 1SD7A 4F3OA 3DXMB 3V9ZA 1Z91A 3BJOA 3SFIA 3L4QA 5AQIA 2ZJRL 4DUYK 4BACA 4DQRA 1U5TA 2GWJA 4CK3A 3CFRA 4EZ9A 2V79A 1QHTA 2I10A 1RT7A 3VERA 1V5GA 3KLOA 4ENKA 4FETA 3E5QA 3RJPA 3IWZA 1WSIA 1P2FA 1V5EA 4X0GA 1G15A 3OV8A 3U2RA 4PY5A 1IF1A 4AHVA 1X4OA 2Y9ZA 3LA2A 4C9YA 2QXFA 4EV0A 3EUKL 2CWEA 2FNAA 1NGEA 2KQRA 4M3FA 2EB7A 3ERED 4LG0B 3K57A 3SUNA 4JKGA 3B6AA 4DYQA 2XB0X 1K4SA 3HGYA 2EFNA 3GF2A 4BJ6C 1XGMA 2E7XA 1USSA 2ZKZA 5F08A 3QU3A 3UNGC 3CCLN 1RT3A 3OW2M 4P5OA 1RTHA 4QIWN 4CIFA 5M5YJ 2L54A 1BM9A 1K79A 1VQON 5KGWA 3TSPA 3IAS2 4YOYA 4YFNF 3I0SA 3CCRN 3JW4A 3DAWA 1HJRA 4F52A 1TKDA 5LGNA 3E5XA 1MBGA 1V3FA 3HK2A 2UUBK 1YVUA 1U9NA 4A5AA 4FL9A 2RKIA 3PX4A 4CJEA 2BGGA 4PJJA 1SFEA 5KNLA 4KV8A 1J6ZA 3RMBA 2KTQA 3VB2A 2VPLA 5DDGA 4BRLA 2HTSA 3HRUA 4BBRJ 2PQ8A 4NC8A 2D0BA 2Z1GA 3PIPL 2F96A 2W84A 4GW6A 1UWBA 2R5ZB 1IJJA 1XNQK 3AVAA 3ZSOA 2Z1DA 2FBIA 4DGWB 4Z4HA 2VJIA 4DYRA 2DA6A 2DCEA 4BDYA 1SZ2A 2CUFA 5EEHA 5AZIB 3TTDA 2B7EA 3RCOA 1D4XA 4ITVA 3CHWA 4DHYA 1OH5A 3LSTA 3J8AA 1OCOH 1JLEA 2P9LA 1X4PA 3GFLA 3CFOA 3NH1A 3K0SA 4EHTA 3VWBA 4GO1A 2J5OA 1CF7A 3HRMA 4MTDA 3K2AA 3V1OA 3QNOA 3VEPA 3DJCA 1Z7LA 5F27A 4RTFD 4L9TA 4A3LJ 3W0LA 5HRPA 1D8JA 4GXOA 2LKSA 1YXQA 3PIOF 4WQ4C 2FE3A 2W82A 3I0RA 2KFZA 3M8PA 3SXYA 4KHUA 2NNNA 2XAJA 2D0OA 3K2PA 3P83D 1TQIA 2HZTA 3I5UA 5E1XA 2P9IA 2RPIA 4WFBL 1X58A 3O3FA 2ZXIA 4DV3K 4AIKA 3QODA 1KVBA 1YAGA 1WB9A 4BL0B 2R5YA 2X4HA 1DLOA 1XSVA 3OYIA 2CQXA 5IT3A 2FSNA 4B9SA 2L9NA 3ZXSA 4J2BA 4CZIA 1XDSA 3LA3A 1SKWA 1JUMA 5GADP 2P5GA 4RW6A 2V26A 5LGUA 1IKVA 3KK7A 1ZG3A 1WRJA 3NQOA 4L5IA 1GLCG 2GIZA 1QPIA 3DOKA 2VQGA 2UUAK 4IHYA 2WC9A 2E5ZA 2E60A 3U1KA 3D6RA 2VJJA 5LFAA 5CYVA 1T05A 1D9FA 3JRCA 1IUYA 2ATQA 2FX0A 4YIIA 2VWJA 2B0LA 4Z4CA 3E9OA 1VQ9I 3K4BA 4Z2YA 1YX5A 3LSGA 1XSDA 2IEKA 2PX9A 1HKGA 3VQ7A 2DMUA 1GOBA 3ZLJA 1C0FA 2RQQA 3VETA 4UXNA 1RRJA 2VOPA 1OH6A 1RESA 3ZGKA 3M5RA 2ASOA 5HL7L 2JA2A 4L9VA 2QW9A 4NXNK 1YO5C 2EJRA 3CD6I 5GADJ 2LKXA 3KP6A 5E3LA 5HROA 3DF8A 1WSFA 2KJCA 2Z1HA 3SZTA 1Y8RB 3WTZA 1HKBA 1IRZA 3C6UA 4CYCB 3QFUA 4IEJA 2PYJA 3DOLA 4A0XA 3DLGA 3SFZA 3GFIA 1B59A 1GUUA 2GOMA 5L3CA 1T44A 4IOXA 1W5SA 1Q7YO 1K8AO 2QWQA 1I6HJ 5J4VA 3K5LA 3PNYA 4CCNA 2HMPA 4JP0A 3DRSA 3O9SA 2L01A 2ZNYA 2Z9OA 4XSZF 4OPJA 1FIPA 1LWCA 1JJ8C 1LAWA 4D9JA 1VFCA 2EBIA 1OCZH 1XGNA 4OJRA 1XMOK 3SV4A 3MAJA 3I53A 4FM2A 4IDKA 1X19A 2Q3SA 3Q9VA 1MBKA 3GZNB 2STWA 3KIOA 5IP7J 3GDQA 2QKKA 4BGBA 2P8TA 3S9HA 2E35A 1ATNA 1J53A 2E8AA 2YHAA 3VQ4A 1T0FA 1ZHFA 2QGUA 1BHLA 2RAEA 1POGA 5F1XA 2P9SB 3B6OA 2QA4N 2NYXA 3KK3A 3GMEA 5HP1A 4W5RA 2CJJA 2FSKA 2HBKA 3G1MA 2P5OA 3K9TA 1LWEA 3AVJA 3A03A 5BRDA 3B6PA 1EP4A 4Y7NJ 1KU7A 1N36K 2PFUA 5AQNA 3KLFA 5IT9Z 5HODA 1ZKGA 4BWJA 2ZFUA 5A2QK 3OS2A 2KLAA 1GLBG 4M71A 3V7CA 2FBYA 4B3TK 2XPUA 1U0JA 1P6RA 5F0XA 3G1LA 2IVMA 4P55A 3TW6A 2F5CA 3UKUB 3LSIA 1XGSA 5HVQC 3K0LA 2ISYA 2LF8A 5F0HA 2RN7A 3EO3A 1BO5O 1MDMB 4CZKA 3IUCA 2UXCK 1MBJA 4PZJA 4CGDA 4XN3A 3C0BA 3R3LA 4HX4A 3NWTA 4DQ8A 1S1WA 2WBNA 1P7IA 2DPNA 3GE1A 1IRFA 5HDGA 2QWRA 5ADXH 5AQHA 5K1YA 2R7XA 3HVRA 2W85A 1X3NA 3LZIA 4MLHA 1X3MA 3E1YA 1ONVA 2CQQA 3D1NI 3WTUC 4WF2A 4H5VA 4RW8A 3TI0A 4AQYK 4IOAL 4A2UA 2EPFA 3KLNA 2DY4A 1E2XA 3KD1E 2VKDA 4JK9A 1R5HA 3ZN0A 5B5EC 3O8GA 5M1NA 1FIAA 2HNHA 4F7ZA 4M3WA 2PMZA 3WG7H 4JKEA 2P5LC 3ZT3A 1VI0A 2OQGA 2XY7A 4K43A 4I99C 4B9TA 1XCVA 1JTYA 2K86A 1BL0A 1NK5A 1Q9YA 5C12A 2OTJI 1GXQA 3RSNA 1TWAJ 3K9KA 3W6KB 2CMPA 4AD9A 3LQRA 3V81A 2HVHA 3LMMA 2VYPA 4EFHA 1TUYA 4U0WA 3HKZA 3HP6A 3HOTA 2IS2A 1KXPA 4BKXA 4Y15A 2KZZA 1U45A 2K9MA 4QCLA 1ZGWA 2ID3A 1QQIA 1YE9A 2K3FA 1P7JA 3KFWX 3PO3J 3ZEUA 3NVMA 3WEEB 4E7IA 4YOWA 2HI3A 3CCVN 5AQGA 4DSIA 2IXSA 2ECBA 2ETHA 2XY8A 3DM2A 5CVRA 4H0EA 3F8NA 2R7UA 4O8KA 3WNFA 1R00A 1WQ2A 5GAEJ 2GXAA 2NS8A 4HBLA 2V6EA 2KZMA 2GA2A 3GO5A 3VQPA 3AVHA 3FE1A 2GM4A 2W6KA 1ATSA 2VI6A 4I2QA 4W5OA 2WAEA 2R92J 4CJ7A 4W5QA 1IKYA 4I6MA 5HOOA 3K2ZA 2FXUA 4F9OA 3HEFA 2AXTC 1R7JA 2LR8A 2BH1A 3QEVA 2O8FA 3LFKA 3CMYA 3HOVJ 4IFYA 3TMOA 4DBRA 1JGSA 4A61A 1ULYA 2DMTA 4HPQA 3SBTA 2DK5A 3QYBA 3TAEA 5TISC 3G1OA 1YTYA 2JA5J 3M07A 1SMYF 4I09A 3THXA 2O8CA 2X6WA 3AL0B 5JS1A 1NK3P 1HKTA 3R1XA 2M34A 5E3MA 1WOQA 4NC7A 3ONQA 2DA7A 1FZPB 4FJLA 4IHTA 5FO5A 4BVOA 4CZCA 5DCFA 2EFPA 4JQFA 3VEZA 3H1CA 2DMQA 5HDNA 4DTRA 2EIMH 1CGPA 3R61A 5AQRA 5ICEA 3O80A 4XH1A 5GTIC 5JLHA 1EWQA 3K4MA 4CHQA 3BQYA 4KISA 1W0TA 5CYQA 2Z99A 2D4WA 3BP8A 1ITYA 4CFCA 2DYRH 3OYHA 2HQ5A 4X66K 4DV7K 3BZCA 4MGRA 4FWKA 3CZ6A 2O8DB 1ZAOA 5HS8A 4HOBA 4B8CA 4BG8A 2PZSA 3E6BA 4I98B 3RPQA 3O08A 1FT9A 4DSJA 1HRHA 3QPLA 1ZRCA 2MG4A 4ZDOA 4CEDA 2ZXJA 4DTUA 3IKTA 3ZCMA 2IA0A 5JVGL 3VF2A 2CG4A 2P5KA 1ZBSA 1A6IA 1ETKA 1DEJA 2BHZA 3M7GA 4BE0A 4MO4A 3GWZA 2A69F 3BTLA 3OA9A 1NTCA 1K61A 4JKGB 2IT0A 4OIPF 4C8LA 1HDDC 2CSOA 3E66A 2EV5A 5LHHA 2P7CB 6PAXA 5JLFA 3P31A 4WXCA 3DEUA 4DS5A 4EP4A 2DYSH 3GX4X 1N32K 3ELKA 4GGGA 4KUMA 3IC7A 4C3JJ 1V4TA 3EEQA 3ZQQA 3NF8A 3QEXA 4W1UA 4A6DA 4FW2A 2CYYA 4CEFA 1WH7A 1TT5B 4BU2A 4FWLA 3FIWA 3PSIA 3ZSZA 1UAXA 1JUPA 4NC6A 3WHBA 4YG2F 4JK7A 2ELJA 3S1NJ 1S29A 2A5XA 3LL7A 1ZELA 2VGMA 2FUG2 2YX6A 2BDPA 3KEQA 4BJTA 1KSPA 3OIOA 1RI7A 1Y56A 1J0RA 3CC7I 4HF0A 4KN4X 1XDUA 3O3GA 3OTOK 3CO6C 3BDPA 1K83J 1XUPO 4H5RA 3SNNA 2COMA 4B9VA 1WHUA 1R49A 2A40A 1QQMA 1XMAA 2AS5F 3AG1H 3AGRA 2W24A 3AA2A 2P6SA 3SMPA 3ZQHA 1DUXC 4FLYA 3TQNA 4OLBA 1K8KA 4KNYA 4DTSA 5D8KB 1BQNA 5AQPA 1F1ZA 3MEXA 5D6EA 1PP7U 2E6MA 4LB6B 1W7AA 4YORA 1FTZA 3L6QA 3GZ6A 1MJAA 1S7EA 2LDUA 4KMUX 4UVBA 4A0YA 5L3FA 1JLGA 2E1NA 3VSLA 2FBTA 4JEPA 4MQVA 4CH7A 5EY4A 2CH6A 4AIHA 2F8SA 3SPZA 4QPQA 5AQSA 4DSLA 5C42A 1MNDA 4M72A 4IWVA 3HOSA 2LOOA 4R5PA 5JVTA 1ZLKA 3GTMJ 4PSWA 2G8HA 1LNWA 2NOGA 3CUQC 4P9FA 3S2WA 4ZZDA 4A3BJ 3ZX2A 1SD6A 4CJVA 2ETJA 4PSXA 3HGGA 3GLLA 1UG0A 2A3ZA 2GUIA 1Z67A 2AO9A 2P81A 1YJWI 1DQUA 4WWCA 1YRNA 1HMVA 1NM1A 2D0PA 5E26A 2QKBA 3TGNA 3GTKJ 1EWRA 1HCRA 2GWRA 4CJLA 3PQJA 3I64A 4NBQA 1HW5A 4OAYA 2BY0A 2GOXB 4AVPA 4U7DA 3S2HJ 4AU7A 1ZK8A 2O8BB 1VQKI 1FSHA 5AFUH 4B8AB 2HHSA 4CZJA 5EYRA 3WGHA 3K59A 2FQ4A 3NF6A 4I7FA 2E2QA 3O8HA 1K4TA 3PUFA 1VQ6N 4BR7A 2V6CA 3NGZA 2X6SA 1Y6IA 1BR4A 3K4JA 3TDZC 3WUHA 3SAFA 4XR6A 1QTMA 4AHCA 2HNDA 4KREA 3ZSQA 2EZIA 5LMUK 1WNSA 3T3FA 3E3VA 2XF7A 4FCYA 1JT6A 5BPNA 4DFKA 1JUSA 1XPXA 2UZKA 3GTQJ 1CXQA 4IEIA 4DKWA 4CHUA 4EJWA 3HOXJ 2K27A 1IN4A 3HTSB 1MA9B 1M90O 4RLQA 2UXXA 4HNTA 4CD1A 4KT5C 3L2UA 2EZLA 2CQNA 1F9NA 3J81K 3M6GA 1OYIA 4DTPA 2QQBA 4Q0BA 1Y39A 4XQFA 3EL2A 3NMUA 2NVTJ 2VCPA 3K1MA 1ZR2A 1N25A 4CJ4A 3CUOA 4JKBA 3DYAA 1HNIA 3U3GA 1RDBA 2F5DA 4LGWA 4XOTA 5AQFA 4NUBA 1NK0A 1GLFO 4OINF 4NCGA 5LY3A 5ERIA 4LJZF 3S1QJ 2QKLB 3FZHA 3F21A 3ESWB 3KWIA 5AZJA 1NG6A 3HPGA 2W42A 3H9QA 3FXMA 1QZ6A 3N4QA 2HQRA 3RTVA 1BI4B 4B48A 2JJ7A 4XORA 2YNFA 1MZBA 3G71N 1T98A 5CVVA 5FB2A 2Y31A 1VF9A 2R7ZJ 1S9GA 3JCUC 1X2MA 1SAXA 5KPRA 1S6QA 3FZLA 2A68F 2BW3A 4BHPA 2HVRA 3MEDA 1TNSA 3B02A 2UXDK 2DTRA 3CO7C 1VQKN 3HHGA 1QHGA 3T8TA 3AVGA 3BR2A 2Z2SB 5D8LB 2LD5A 2HS5A 3FDYA 2LREA 5ICFA 2UYTA 5FRNA 5DYMA 4W5TA 4EGYA 1WCMJ 2CFXA 1WLJA 1KU3A 1S22A 4BHBA 1CF7B 4HEA2 4C30A 1AOYA 3MZHA 5E17F 2BE5F 1Z26A 1Y97A 2ZE2A 4RWTA 2KZVA 3WU2C 2HQNA 3SI6A 4M63C 1YITN 3IUOA 3J81Z 3OYMA 3J7ZO 5JHFA 3TEDA 1ETXA 3AARA 4DTJA 5FKLA 2VPRA 4EAHD 2NRHA 2NRVA 2AQEA 4YIRX 3VGMA 2Z33A 3WHCA 3ENOA 4WF9L 3TABA 1Z6RA 5JS2A 3C6HA 3FXKA 4XEIA 1TBXA 3UIQA 4B4CA 1NJIO 2Q8KA 3GCMA 3TOAA 2EFWA 1BIUA 2VKEA 1RDDA 2NUBA 3SJHA 5LJVA 1DGKN 4JHDA 4IO9F 3LDNA 3E9PA 5AJ3K 3SEQA 2FOKA 3C2BA 2Q2EB 3R4KA 3SYZA 1Z77A 1TVRA 1IXCA 3FR0A 4I2OA 4PL7A 1U6ZA 4RB2C 4IDHA 5D4RA 4E1MA 2Q0OA 1RT1A 2G8VA 3I59B 4G7OF 5IOZA 1OQYA 3P7NA 3ULEA 2A3SA 2VJ4A 5BN8A 3MCZA 3FHZA 1CZ9A 2KFDA 2XF6A 2DOFA 3U8XA 2LC2A 3A5LC 1X1CA 3L2VA 1QVUA 5DTDA 1SAZA 1SD5A 4RLFA 4UV8A 4AYBA 4FWSA 2XHBA 4ELVA 4Y33A 2V1XA 4CJ3A 2O8BA 3ZX3A 3TW7A 3WXLA 4Q47A 5JVHL 3FFKB 3KJVA 1S6LA 1EV7A 2ZSHB 3VQ9A 3QYFA 4B47A 2G8WA 2XROA 4V19S 4BDZA 4ICLA 5EZGA 5FROA 1VQNI 3VSKA 4CJFA 3GEZA 2VB6A 4JX4A 2XGDA 1TKTA 4G9ZA 3FKJA 4MEYF 4ENNA 1B9DA 2I7NA 3TSUA 2IA2A 3WU0A 3CM6A 3CMAI 2R7QA 2ZMEA 3GFMA 2CRGA 1TL8A 4DSFA 4CEBA 3ZN1A 2DFHA 4FASD 5CR4A 3I9V2 1Z6TA 1LW0A 1S1VA 2XY6A 4BC3A 3KLHA 5HLTA 4RB3C 4A5NA 4CHYA 4G6DA 2XHKA 3D2FB 4BRQA 4C8MA 1YS6A 1W0HA 2O0YA 2WTEA 4NQWB 1KZHA 4JK8A 4EM1A 4KTWA 4CEZA 1R0AA 4B9UA 1UCRA 4JKDA 1SMTA 4LY7A 3MX5A 1ZN2A 4BR0A 2DXIA 2HR3A 3BDDA 2PLYA 1HLUA 2LFBA 3AVIA 1K6OA 3J80O 4UUTA 2H1KA 4LLNA 2JSPA 4CJWA 5HNHA 3SAHA 3LDPA 4A3CJ 2HKXA 4AH9A 5CVUA 3U4LA 1XN7A 3S16J 4CGJA 1QZYA 2B4JA 3AVMA 4FJJA 2DAOA 4CDGA 2E5LK 1WBDA 4FE7A 4DTXA 2BW3B 1J2XA 1NGHA 4QLCU 4RW7A 3S1RJ 3FK6A 3NH2A 4DUZK 2ITMA 4FE4A 2E7WA 2VC0A 1J7KA 1TW3A 3D5RC 4N9IA 4HDVA 1D0XA 4HG2A 2HPMA 4AM3A 3HRGA 4H4OA 1T03A 4CJUA 4DQIA 4JK1X 5IP9J 1H9TA 3F6VA 2Y48A 2LKPA 5FDLA 1VQOI 1RNLA 3FXOA 4X64K 3SPYA 3HC7A 1OR7C 4MFEA 4ZZLA 3OSGA 1X9JA 2H6CA 2FBXA 4AF1A 2Z16A 4CZGA 2OZSA 5IY5H 3RPUD 1FBQA 4A12A 3IMXA 4M41A 1NNEA 5GAHP 2M7BA 3WXMB 5GIPA 1NJWA 2PBDA 3L7WA 1B6AA 3M1EA 4HSRA 1K78B 2QI2A 4B1ZA 3DBLB 4BQOA 3TDUC 1I3QJ 3WNGA 1ITGA 1HUXA 4XH4A 3CF5L 2G7UA 3JYTA 3V8JA 1QBJA 4HF2A 1AWCA 2H1LA 1R71A 2P9PA 3GL1A 4KH5A 4Z4IA 3AAFA 4M74A 3P4IA 4G7HF 5C10A 4KHYA 3JRDA 2I5JA 3M8SA 2FEZA 3JSOA 2CH5A 4IPAA 3QP5A 4B1YB 1Q9XA 2MABA 3JRHA 5LRRA 5SZTA 1Q81O 3K4LA 2KRCA 4GKJK 4NYFA 2HHVA 5CVIA 5L3EA 4ISFA 3A0HC 2OCEA 2KIQA 3KEOA 5IOYA 1NGJA 1YJ9I 4EM2A 1MH3A 1P9QC 5KGXA 4FJMA 1VSFA 2QSGX 1BC8C 2QENA 4N41A 4EM0B 1NOYA 5EGOB 4MLEA 5GINA 2L7MP 3GTLJ 4RG8A 5ILSA 3KVGA 5FPMA 5BOXA 1WSJA 3CXCM 1B72B 1EETA 4CZLA 1T0FC 1G3YA 5GAGP 3L2QA 3R0JA 2YHWA 2YHBA 3SQ4A 3FK7A 1IGNA 4H0PA 1KLNA 4RM3A 1BIZA 3FXUA 2QWWA 4HX8A 4YDUA 1BI0A 1ZLJA 1YQAA 3MKWB 3MN6A 3MFKA 4NHJA 1GOCA 4OLAA 1QQOA 4IRIA 2R7DA 2QWPA 2VLAA 4IRGA 4B9NA 4IL6C 4P96A 1MBFA 2LRDA 1QPMA 2YUSA 1D8KA 3D5LA 1ZR4A 2BZTA 1WJCA 1NGIA 1OH7A 2QBYA 1B9FA 1GLAG 2XC7A 1WJEA 1WFXA 5BPLA 2LSOA 1EQYA 1M1EB 1E3PA 4PA1A 4JX6A 3GBGA 1OKRA 2W48A 2OUMA 3DU6A 1FLIA 4FW1A 3NCIA 4JI0K 3K5NA 2VQLA 2KFNA 3LP0A 2HB5A 1DTTA 1YT3A 2F4OB 1YS7A 2OF7A 5GAGJ 2D45A 3GBTA 4FVMA 3HOYJ 2VG6A 5LJWA 2D1KA 1U4BA 5LBQA 2NVUB 2XAFA 3RYPA 1BI3A 5K7HA 3V8KA 1PDNC 2VOOA 1QO0D 1IXSB 4M6XA 3E6MA 3DRPA 1U49A 2VBWA 3BZKA 1NJXA 2VJ5A 5K7ZA 3HB9A 4LK1F 2KMUA 1X9SA 1VQLI 3BR6A 3ECOA 1FYKA 3DXMA 4B08A 5ADXA 1KYZA 5HLHA 1LCUA 2WONA 4KB0A 3DTIA 1QZ5A 2WOMA 4ISGA 4WX9A 5K14A 1RILA 4WFNL 2BV6A 1OCTC 5M1KA 3QEWA 1KA8A 3VPRA 1U8BA 1NGGA 3GVAA 1WVRA 4A5BA 4HSTA 3FWEA 4O5FA 4LG3A 1JLQA 4F3QA 4CZFA 1IKXA 2IGOA 5DCMB 5FD6A 1S1UA 3V7SA 2BXYA 4N4OB 4LG0A 3J80Z 1DPRA 1MKMA 3IDHA 2ELHA 3RMAA 2XASA 5AQMA 4LFBK 1B9MA 1ACIA 4OVLA 4JYKA 4O6JA 2V9VA 2DMPA 3FXRA 1BOAA 2YS9A 1ZC6A 5AR0A 1QSYA 2NLXA 1I6XA 4PJ0C 2MH9A 5TGTA 1E4GT 3H3UA 5ICGA 5H6QA 4LD5A 1ETOA 2DT7B 1FMWA 1BG3A 3ISNC 4X6AJ 3QO9A 3PO4A 4YEJA 5C0YA 2YX4A 3KYCB 3CPWM 2XUBA 1LDKB 1BQMA 2VWBA 3CJNA 1AA7A 4HNVA 1TUUA 1O57A 4H0TB 2XRIA 3WXJA 2V9PA 4G6TB 2WV1A 3U3YA 3RSEA 1T95A 4FJHA 4DNCA 1LV5A 4CK1A 5AQUA 5FFZA 1WBBA 4BRHA 3BTJA 2ACJA 3QBWA 3ASMA 3HRTA 4M7YA 1B4AA 3OYGA 4AM7A 4K41A 1SANA 1BCOA 4M3GA 1WZ2A 4EMSA 3WXIA 4A62A 4O0IA 4Z4GA 2WWYA 2NAZA 4C1NI 4CJTA 4FX4A 4QWQA 2DOEA 4A3MJ 4HQEA 1Q86O 4DYCA 3KP7A 1LEBA 3GFJA 2E2OA 1NBWA 2E20A 4I6ZA 3N05A 4DV5K 1SVOA 3ZMTA 1XCBA 4D7MA 2KJBA 5FD5A 4UB6C 5AZIA 3CCSN 2HMIA 4IOAF 1QZZA 5LLQA 1GHCA 1YIOA 3BJAA 4PCQA 4TV7A 3FGUA 5GPAA 2RE2A 1J09A 1V4RA 1IAWA 4BR5A 3VTHA 3V9XA 2V1DA 3LSPA 3HO1A 2IS1A 3CJ7A 1KONA 2IAIA 3CQZJ 5J8FA 2Y75A 1WWXA 1FBSA 2K4BA 3ZCOA 3GYHX 1O7FA 3KEYA 4ESJA 2O6GE 2IAJA 5E1WA 2ZXWH 5H20A 2WC2A 2DODA 3JAMO 4ILGB 2LY2A 2DU9A 5CY4A 2A61A 2VC1A 3CCYA 3CCJN 3LDOA 3BJ6A 1JKPC 4J2EA 3F9KA 4XM3A 5J1UA 3PFYA 4FPAA 3H0GJ 4NO7A 4BRIA 2BVMA 3J7YJ 4A2AA 1YHQN 2VG5A 3J7AP 1DU0A 3EE9A 4BQQA 4Y52J 1KFDA 4LF6K 1T6CA 2JPBA 1M1KO 1R36A 3HJFA 1I50J 4FTHA 2Y0SA 3ZSVA 2OU2A 1K7AA 3TARA 3LAMA 4E89A 2QBYB 4L0YB 2DPDA 1XWLA 1U8RA 1XSXA 3K4KA 5IPAA 1YIJN 2F4VK 3BTIA 3HOWJ 3HTVA 3QWLA 2DT5A 3DLLF 3MXMA 2P7VB 3GXOA 3HG9A 3FZMA 2CQ7A 3BZ6A 3MN5A 5KAFC 2R3SA 2W7NA 3LM9A 4E4HA 3G4SN 4F8RA 1TWGJ 2DJIA 2G8FA 3K5OA 3ABKH 3ERMA 3KYDB 3VYUB 3E6CC 2ZJPF 3VQCA 1PJRA 4CCMA 4WFAL 1UFMA 1LVAA 2O03A 3VODA 2DN0A 2QM3A 4F93B 3N97A 2ZF5O 4LH5A 5M1OA 5KCMA 3LWMA 4BRFA 2BYVE 4JV5K 4DR3K 2CW8A 3OYBA 3J7AY 4I2PA 4KTZA 3F3XA 4DR1K 3RIRA 5AONA 1VZ0A 2YHYA 5CLSA 4YOVA 2HHQA 1BWFO 1RBSA 1JTXA 4EJTA 2JA7J 4DR6K 2MC3A 3HTUA 5EX5A 2Q1NA 1K6YA 4CO8A 3FZVA 1FKOA 1VQ8I 3KLIA 4JKAA 3FHNA 4MO5A 3LDLA 4C8KA 1HNWK 3FXJA 2GZWA 2JT1A 3OIQA 4CFBA 3WODF 4HV5A 4B3MK 5AQYA 2F2EA 3LALA 3ZSRA 4FZXC 4KA4A 5A2QZ 3OYCA 1R9TJ 3FFIA 3ZQLA 1YI2N 3EDPA 2CV2A 5KTQA 1TTYA 1V55H 3CLQA 2YJFA 2IS6A 3MXIA 2XGCA 1FW6A 2O8EB 5EJCA 2QVOA 4BYYA 5FLVA 4FOEA 1UMQA 3OIPA 3OR2C 4WXDA 3NH0A 3NARA 5BPIA 4MQ9F 3D2EB 2HW3A 4FJKA 5D4SA 2X1CA 2DTZA 5IP6A 1BGXT 3FZFA 2XY5A 3WNHA 2UU9K 2XB5A 4RB0A 1D0ZA 2NOJB 5DEQA 1ZRDA 1QS4A 2I5UA 2R7WA 3JREA 2E2IJ 4B3AA 3T8RA 4I0AA 3WT0A 4A2BA 5KPTA 3K70C 1XD7A 2LP0A 2P6TA 2M8GX 4GYIA 1D5YA 3IFRA 2E2JJ 1TL3A 3W6VA 1GV2A 4FWOA 2P9KB 1Y0NA 1MGTA 2R7FA 1Q8IA 4E3SA 1GLEG 3VEXA 1FYMA 3H3ZA 4IO9L 1A5XA 5J2PA 2LTPA 2RREA 3I4MJ 1KD1O 1QQNA 3THYA 2MYSA 3F8FA 3GOIA 3R8EA 2MH2A 1NHAA 2QZ8A 3T7ZA 3CCEN 3JAMZ 4JI3K 4BWMA 2KIUA 3DU5A 3SBGA 4CCKA 2HOAA 1QZEA 2HPIA 4OOIA 2G8KA 4PDKA 4AHTA 4A3DJ 2OPTA 5T7BA 4AWXB 3F8CA 2BUPA 4RAYA 5J1YA 1RBTA 3H3NO 2QEXI 4KIFA 3BR1A 3ABMH 1FBUA 1PYVA 2BY1A 2MD5A 3EYIA 4RW4A 1U2VB 3FX3A 4IQ4A 4YFKF 5AQLA 1O1WA 3A1YA 3VGKA 4IXCA 2BXZA 2EFQA 1VSMA 4TSXA 3VA0A 2L7FP 2IIRA 4YRVA 4E7HA 4DOZA 5HLFA 4DSKA 1C1AA 1S72N 1ATRA 4H03B 3O1BA 4ZTJA 2RDPA 2X6OA 3DPLC 2X9DA 1HBXG 1QU3A 2LG4A 3LA7A 3GLXA 1W97L 1R5GA 3DLKA 3VYTB 3WTVC 2E19A 2O4IA 1QSSA 5J40A 3CETA 1ZBFA 4FK2A 2FF6A 5BRFA 3L00A 3I0TA 4ZTFA 4DWIA 4EZ6A 3WU1B 1T56A 1FPQA 3I56I 5FPNA 1WUAA 2P9PB 1WI3A 2IJLA 3DMJA 5D5XB 2IC3A 4LSNA 3H3OB 2M30A 4PK4A 4LOCA 3DQVC 5TKYA 4BRNA 1HPMA 3I55N 4D0PA 4GMJB 2KP6A 3R6MA 4JI5K 2OZUA 4JI7K 2ZNZA 3HZJA 1MBHA 4PUSA 4P9UA 3AVKA 1XQSC 4JN4A 3CESA 3KKRA 1IRGA 1IDZA 5FLXO 2K40A 2MC4A 3ZEUB 2P9NB 1IG8A 2DQLA 2IDOA 4CJRA 3AG4H 5JLXA 2YKNA 4G7ZF 4DTNA 2FBHA 1ZARA 1XHXA 4RGRA 4A3JJ 1FTTA 2OD5A 3VENA 3TO7A 3DTEA 5FJ8J 4CEAA 1ETVA 1VQ5N 2YU9J 2ZMEB 1KQ8A 3DRRA 2E6LA 3L09A 4OIRF 1Z21A 4FZYA 1D1AA 4B9MA 2R4GA 4JKFA 3K9JA 5BNGA 2OPRA 2ESHA 4C23A 5FRMA 4XLAA 3DWLE 2HXOA 3MWMA 1O13A 1T38A 1OR7A 5HDKA 1S7OA 3BY5A 3T1YK 1SC7A 3KK1A 3LPTA 1MD0A 1CZAN 3Q7CA 3UE5A 4A59A 3CF5F 2G8UA 1Y1WJ 1R6RA 4M3EA 1GXPA 2HF3A 2ZXHA 1E0EA 4O8UA 1T8EA 1WSHA 1V54H 4ABZA 1H0MA 3JSMA 1LQ1A 3HBTA 4N4NB 4Z6YA 3G6EN 4FSVA 2CUZA 3CMMA 3K10A 3K4NA 1RTIA 1HA8A 4JYAK 1S1TA 2HYFA 3ATVA 4CA0A 5H2FC 4DFMA 1WJDA 4BXFA 2ESNA 2R7TA 1I1SA 2ASPA 1Z05A 2ITGA 1G99A 2FD5A 1MDMA 3W3DA 1LE8B 1PUFB 2Y69H 4LF7K 4RAFA 4H0VB 3OYDA 2LYCA 3I8DA 3EQLF 1LPQA 4EJUA 4CXFA 3F8BA 3HYFA 2DQRA 3A2KA 3O4QA 4IFEA 1FJGK 3LNQA 4XRSA 2FLOA 4R1HA 4CZMA 1RUOA 2W40A 1HKCA 3PFIA 1GLLO 2BANA 1NK9A 4ZYAA 2FRHA 4OX9K 1JLAA 3NWSA 3CJBA 2NXNB 3LSHA 3IH3A 2E4LA 3KHYA 1QA6A 3KK2A 1VRUA 3FISA 3THYB 1ILYA 1RDAA 1ZRFA 4O55A 2HHUA 1WH5A 2ZO4A 1DDNA 2EK5A 5J2MA 4FJ9A 2P4WA 1NG7A 3HBLA 5KPZA 2AQFA 3AA4A 2Y0MA 3AVCA 4YOTA 3CD6N 2DA5A 2VKHA 3E1SA 5C4JJ 3TTFA 2VN2A 2DJNA 3LDSA 2CGPA 3IKMA 1SL0A 2F7TA 2JUGA 3O9UA 3ZX0A 4FOIA 3R60A 1WPKA 2QWOA 2B6AA 2FOWA 3KD5E 3HSTB 1D0YA 3HSEA 3OYLA 3AO2A 3ZT1A 3X2QH 1N77A 1VHXA 3TANA 3MK6A 4RGUA 3EE8A 3H46O 5HRRA 4B1VA 4KN7X 1I1GA 1S5LC 3SQ1A 1TV6A 2KKZA 3MVPA 1K73O 3F0CA 2EZHA 2J4RA 3GTJJ 3S17J 3BCAA 3BG7A 1PP8F 1BUPA 5CYMA 3WQTA 5BPMA 1NU0A 2VUMJ 3OY9A 2V7YA 4KBOA 1D9DA 1VSEA 3T5XA 1JCEA 2L4AA 1TK5A 4G12A 1FK9A 3ZQ7A 1Y1VJ 2VQHA 1LFUP 3ATUA 3F9MA 2TRTA 3T19A 4FJ5A 1EH7A 4JKCA 4K0KK 4HX7A 2K85A 5CVJA 3UKGA 3LP3A 4HYEA 1R1TA 3DLRA 4E6KG 1F43A 4H8KA 3VDXA 3PQKA 3SQNA 4CHZA 4V2FA 2GUPA 4KRFA 4CJSA 2NRTA 2ZB9A 2R0QC 1FNNA 3DKYA 4QS9A 4JOMA 3OMYA 3WTWC 4H5WA 3VGLA 3VESA 1KU9A 1WJ5A 1E3HA 4WQ4A 2HBMA 4DV1K 3RR8A 2OANA 4HUEA 3D0SA 3K1PA 3M8EA 4W97A 5E79C 3E97A 2HDDA 3C94A 4B1RA 1S9HA 4HQMA 1L0OC 2JTVA 3RMCA 2HDCA 2GX9A 4UNOA 2A42A 4Z4FA 2M4KA 3CCJI 3KP2A 1FOWA 1U3EM 2YNHA 3L4IA 3KYLA 4DTOA 1VSHA 2YX7A 4B44A 5DM6L 2E5NA 2JVGA 4FPBA 4XRFA 2X1EA 2VQCA 3H5NA 3IAM2 2MGQA 1USTA 1KYWA 3NDKA 1YJWN 2V7ZA 1CLQA 4XLNF 3ZQIA 2XF5A 5EU7A 4U0YA 1Y64A 4CESA 4UHTA 4XSXF 4B3XA 4XRMA 1JE8A 5FKOA 4M3TA 2GIVA 5AIPA 2BY2A 3CJ9A 3WG9A 1WSEA 1W7PB 4CERA 2DMNA 4I76A 4BY9C 2EA2A 4K42A 3JTGA 4DZJA 5CE3A 4N76A 1KGSA 4LIUA 3H5RA 1ORKA 2OTLI 4J01A 2PN6A 4PUOA 1XGOA 2EILH 2H09A 1J75A 2OCCH 1TNTA 3CCQI 1LWFA 4JAXA 2E1MC 3QBXA 4CBXA 3KETA 3CMAN 1X1DA 1LE8A 1IN5A 1L3VA 5FLMJ 3CC2N 4IF4A 2UV1A 4UVAA 3ITHA 4DV6K 5AQOA 3F2KA 5C2DA 2NVXJ 1SEUA 4AHSA 3V9SA 4JKHA 3D0PA 4LIVA 1ETWA 3TR8A 5BS6A 1JHFA 4ZJZA 2R7RA 4BQZA 3S15J 2ZJQL 3ZSXA 4B09A 2R7OA 1DGWY 3OYNA 3DBHB 2R7SA 3VQEA 5AFUA 3FF5A 3OL4A 3GG4A 1VNDA 3U9ZA 2F5VA 3HPHA 3QEPA 2P9SA 2M1BA 4KFCA 5FLXK 3ULDA 2WV0A 2F5EA 2N8GA 5FKMA 3C7NB 3RVCA 5GTHC 1IDYA 4AC0A 1OPCA 3MMYB 4CD3A 3PSFA 3CDHA 2NNYA 2ME0A 1HW2A 4LD0A 3RPUA 1TAQA 4GRIA 4KICA 3LOCA 1JXBA 4HWIA 3EUAA 4BR9A 3EYZA 3LAPA 1YI2I 4KMFA 5TKWA 1ZG5A 5LL6Z 1JL2A 4FXDA 5HNFA 4FJNA 4HUFA 4NB4A 4DFJA 2LY1A 3OYKA 4RB1A 3QRFF 2PMZN 4BROA 4CGGA 5BR8K 2LLKA 1YW8A 3TO6A 4KI6A 3TP3A 5BMZA 4CEQA 2XGXA 4ANJA 3KTQA 1A35A 3WTYC 3CJRB 2NNWA 1XC3A 3RWUA 4RM2A 1Z9CA 1RBVA 3KKSA 1QSLA 1Q18A 2AHQA 1YX3A 2CS3A 1F36A 4I01A 2FMYA 1UG2A 3E5UA 1V5FA 2QQ8A 3I54A 3JRBA 1XS9A 1FOYA 2P9KA 4KHQA 1RZ4A 2DDBA 2DOAA 1AKHB 5I42A 3VMFB 2YR2A 2Z1JA 3BG3A 4M3UA 2VKVA 2HVQA 5LD2C 4FJ7A 3MX2A 1HJOA 2Z3YA 4FLWA 4BR2A 3DPUA 4H4KC 3WGGA 1RFQA 5EZHA 3AA5X 4OKKA 2C6YA 5SWMA 1ZQ3P 3OYEA 5I9EB 4GKKK 3LANA 2UXBK 4BRAA 1EX4A 4IJAA 1LDJA 1MBEA 2P9LB 1KVAA 2JQ7A 1J5EK 1SFOJ 3B6CA 3BY6A 4Y1CA 5M1FA 2YV0X 1XHZA 2H27A 3VQ8A 4PL8A 5AQKA 3S41A 5IT9O 2CFOA 3HUGA 2QWNA 4C3HJ 2ZJQF 5D5WB 5JVGF 1VAZA 3OVNA 4IHSA 2X78A 3QB0A 4OPAA 3TAMA 4OO1J 5JLWA 3IG1A 1EO1A 5LGTA 3M9AA 3OYAA 1YJNN 1EXQA 5HS9A 3TAPA 1U5TC 3H36A 3SZGA 2CW7A 2LNBA 4G6QA 3IRXA 3RKYA 4BH9A 2Q0RA 2XAHA 4KYWA 2A6TA 3G2BA 3ASOH 1SS6A 2LBFB 1A5VA 4M3RA 1RTDA 1G3SA 2XAQA 3OBWA 1VQMN 3KP4A 1LFBA 2E34A 3HM8A 1NKEA 1EA3A 1BR2A 1J5OA 3KPHA 2QK9A 2W25A 3HRSA 2VQEK 5IYCJ 5KAIC 3KZIC 1ZYQA 4DZPA 3DI6A 1GVJA 1C0MA 1ZYRF 3CDLA 3QIPA 4UUSB 2FC0A 1EKEA 4L5EA 4J00A 2JZYA 2O5RA 3A0BC 2BHYA 2DFIA 4LFCK 3CC7N 2F8TA 5F2RA 3FMSA 3EKUA 1VQ8N 3Q7BA 5EF6A 2NZTA 3DPTA 2KKOA 1MNEA 1LUJB 3BR5A 3CCRI 3LP1A 1C1BA 1L3UA 3QDKA 4CCOA 1UZCA 1YTUA 1T33A 3A01B 3RZOJ 3TU5A 4NCAA 3I4PA 4IX7A 3CCLI 3PLAA 5BRHA 4CBUA 1Z3YA 2K02A 2Y9YA 5LRSA 4CF8A 4C3IJ 2EWNA 4CYCA 5DUIA 3ZMDA 5DD4A 5FLXZ 2ZJRF 3SUPA 2G7HA 3EUHA 3CJTB 5CKTA 3F8MA 4Y17A 4OIOF 1TKXA 5B66C 2H3GX 1JKHA 1LAVA 2F6CA 4M9XA 1TKZA 1QGPA 3AG3H 1U47A 3FBNB 2DA4A 1LB2A 2YHXA 4JBAA 3W2WA 1RR7A 3C6TA 4X1EA 3G0ZA 2KDZA 4LK0F 2HOSA 4GFBA 3DFGA 1D3YA 5F64A 2A1SA 3EPZA 4HNUA 1S3XA 1TL1A 2JWLA 5JHUA 2VL8A 5GP9A 2HF4A 3P38A 4M3YA 2BOLA 3COAC 5EDNA 2A05A 1NGFA 1IBMK 2VE9A 4BDPA 3O3HA 3DWLA 2JA6J 3HOUJ 1BL3A 2WB1A 1YHQI 1RBUA 2L9SA 4FM0A 1N75A 2O4GA 2W4SA 4DIQA 4KITB 2GA1A 5J2QA 2COBA 2YJEA 4JI8K 1MMAA 2W00A 2GELA 1REVA 1MIJA 1WJAA 2OV7A 1WAJA 3QERA 3BWGA 1NJZA 4FJXA 1N33K 3F6OA 1SL1A 3MEEA 4FWNA 2HHXA 1U2VA 2MA3A 1AKHA 4BG9A 4CVNE 1BU6O 3NBPA 1MMDA 5HBMA 4FLZA 3J80K 1A31A 1SUQA 1UJ8A 4AVZA 3IWFA 3T1AA 4DSEA 2IVPA 3SHFA 3RZDJ 2FJ1A 4IG3A 1TWHJ 2UUCK 2VE8A 1YJNI 5E3OA 4ASNA 5D5VB 4CI6A 4BHCA 1E17A 5AQWA 4B3OA 4CF1A 5C44J 3ZSWA 2JRMA 3L8BA 3S3NA 3V8LA 3FBIB 3FXQA 3HJEA 1E3MA 2KHMA 1BN5A 2VXDA 5KVRA 2WAFA 4K2EA 1UAAA 1SFXA 3C3WA 4ZYGA 4FWRA 4AHUA 1OCPA 4BRKA 3ECHA 1TWFJ 1FP2A 4ESBA 1T8IA 1IXRC 1N8RO 5ILUA 1BIAA 3HUGB 2QUFA 4CF2A 2IOCA 4ZDLA 4HF1A 3JS6A 4I0BA 2V7FA 1UA0A 1SQKA 1UB9A 5L3DA 1APLC 1BA5A 2D0AA 4O44A 4E0DA 2JMWA 3FZKA 3ZPLA 1YF5L 4BNCA 3G3ZA 4JI6K 2O8FB 5LEJA 2KL4A 3AVFA 2P9NA 4X65K 1LEAA 3T0YA 4IOCF 5LEKA 3LM2A 4G9YA 4IXAA 1JCGA 4KHPK 4PFOA 1SFUA 1HLVA 5J47A 4K8XA 2D0CA 3ABUA 3IRQA 3VEYA 4CFAA 3H92A 5ELZA 3SJJA 4CW7B 4O0JA 2F4MB 2RNJA 3LAJA 3E0JB 3CJ1A 2L7ZA 4M3XA 3MDQA 3KWGA 2DBBA 1IV8A 4F2RA 2NRZA 2O8XA 4F2SA 2P1JA 2JGUA 1U04A 4EJOA 1W5TA 2QWMA 3U9DA 4QSHA 3VEVA 2BGCA 5E20A 2ZGYA 2XSDC 1NGCA 1Z3XA 3AAPA 1RT4A 3QFPA 2ZWHA 1R4NB 3IRRA 2FNPA 3H6EA 3KLEA 2RKHA 2FBKA 1VQ4I 5TJJA 3WNEA 3P9CA 4HHTA 3VFZA 3Q0VA 4E19A 5D3GA 1S9EA 2M45A 1BOBA 4NYNA 4Y13A 1ETQA 2VBYA 1U78A 4ZHRA 3EY1A 1ZBLA 2VQFK 4L8RB 4JI2K 5H6RA 1H88C 3QQAA 3CUQA 1HW1A 3WTXC 4PKHA 3PNTA 3AVLA 3T69A 1T6SA 4YELA 5FKNA 2VODA 3O9QA 4B9QA 3DKWA 2OPPA 1TK8A 4YOXA 2QSHX 1G59A 4BVPA 4UY8O 1IRXA 1QNTA 2GXGA 5FKKA 5BPDA 3PIOL 1YITI 3ZP5A 2RNGA 4OMYA 4C2UA 1VQ5I 1JLCA 3C65A 4FWPA 5H1SQ 4KPYA 2VXZA 3RRGA 2W57A 3MKZA 3KP3A 4ZH4F 2M5WA 3BTCA 3FXLA 1X9MA 3THXB 2O8CB 2KQ2A 1JKRC 1G4DA 1HOMA 1JXEA 4BEHB 4BS9A 5IT9K 2JWKA 4LMYA 4A5MA 1MSFC 1ETYA 2X6XA 3Q5FA 1SFKA 3GTOJ 3B8AX 3C7JA 4P1WA 3H08A 4LH4A 4I7HA 3E7LA 2OA8A 4BRGA 3RQ4A 4E7SA 4DLGA 1NK6A 4RW9A 5M1PA 4AM6A 4DJAA 1T39A 3DV8A 5GPCA 1SL2A 2QF7A 1JGGA 4GY2B 4HUGA 2WADA 1KRPA 1KQ9A 1K78A 4LLGF 2HOEA 4CF0A 1A5WA 4AYBN 2P9UA 3A5OC 2GLOA 3P9KA 2QTDA 4BEHA 5L3GA 1G3TA 4JLHA 1SD4A 4MDBA 1P4WA 4ZYEA 5DK5A 2IW5A 1U6GA 3BCBA 4CCLA 1BI4A 5EG0B 1FY7A 4KIBA 2TCTA 4L9NA 3AKZA 2E2PA 5CJ9A 3JRGA 3BPXA 1IBLK 3IV5A 3IH2A 4I9LA 4O4GA 4WCGA 2BEOA 1TC3C 1NH3A 2VT2A 2WY8Q 4LITA 2L9VA 2WFBA 4DV2K 3MN9A 4D5CA 3TAGA 1HR0K 4QAGA 5FPEA 4LFUA 4HVJA 3SMSA 5CQEA 1BW5A 2P9UB 1VSKA 3VQ6A 3AA3A 2L9RA 3V6DA 3DEWA 1JJ2M 2OC6A 3K1NA 2ZD1A 3PX6A 4MIMA 2PMHA 4MTEA 5EGOA 1HNZK 4N5SA 3S32A 3QP6A 2D5VA 4DG1A 4XONA 2ZC2A 5J1EA 4WXHA 2M87A 2OQRA 2QQ9A 3CI5A 1T6DA 2HYJA 2JVHA 2WY7Q 4H0XB 4IQJA 4ILJA 3QPTA 1I3AA 1KU2A 4ZC3A 3MEGA 4D5FA 2W1OA 2A07F 3I33A 4DB3A 3LL3A 5E84A 1MU2A 1ZG1A 3HT3A 4RGSA 2FU4A 4BQAA 3G73A 4LF8K 1HNVA 1WKMA 3TOBA 3CP8A 1ZREA 4F55A 3KP5A 1PUEE 2QKMB 4FLXA 4EATA 1FXXA 3HL8A 3R6SA 4M3ZA 2CQKA 3LSJA 5F6FA 3O1WA 2IVNA 1RC9A 3HPOA 3ZRGA 4NXMK 4JHDB 4OIQF 4HZFA 1BISA 3RMDA 2IGKA 3IHUA 1MH4A 1DTQA 1BC7C 5F04A 1G3WA 2NVQJ 3M3ZA 4XH5A 1OISA 1P8ZA 2KPMA 1BI2A 2H94A 1SAUA 2HNZA 4XICA 4KT6A 3MKYB 2PI0A 1OVYA 1IN7A 1IBKK 3ULQB 4OWRB 3O4WA 4FLTA 4CEOA 2CO5A 3O5BA 4E1NA 3EZWA 4HV6A 4CCJA 2L0KA 3KCCA 3CLOA 4FQGA 5F1RA 4WYBA 1REPC 1RBRA 1NK4A 4A3IJ 1FMVA 2IA1A 4RGXA 3OYJA 2QA4I 1MSEC 3A8YA 3HP9A 4PQUA 3L1PA 1ZXOA 4CGFA 1IW7F 4OU0A 1TGOA 2CGJA 1W7PA 4XOPA 1IZ1A 2XKOA 2JWTA 4CGZA 3JRIA 3LPUA 4KHNA 2RQPA 4M6VA 3C18A 3KLGA 4DQQA 1BA0A 3CCQN 1TQMA 4E70A 3ENHA 2LBFA 4KTQA 3N4MA 3F72A 4FK0A 4WQ5C 1RGIA 1C0GA 1HSTA 1R23A 4II3A 4CZEA 4JRPA 3BF1A 3G25A 3THVA 2K4JA 2ZQBA 1IG7A 3DLAA 2HFHA 3H1QA 3DLEA 2OPQA 4K25A 4DQSA 2O8DA 2K5CA 5F0FA 4XIDA 1NMNA 1A5JA 2YNGA 2X6NA 3CPEA 5AZJB 3U1DA 3THWB 5F0CA 2HYGD 5J4YA 3CDIA 4M7XA 4JI1K 3ZETA 2B5JA 2DTUA 3SK3A 2V1NA 1HYZA 4O5BA 4PWDA 2L7KA 1HQCA 2UWMA 1W4MA 2A6EF 2FXAA 1T7PA 2DK8A 3C7NA 1RDUA 1W5CC 3P5JA 3RDIA 1LOTB 2HWVA 2X51A 1KLMA 1NLVA 4KH4A 2IGNA 4RA2A 3VYSB 1FYLA 3FM5A 1B8IB 2D2WA 3BR0A 3L3UA 4OGEA 3NE6A 4IG0A 2XRNA 4MEXF 4BRPA 1XI1A 4NNJA 4ETSA 4UY8I 5KQDA 4MHGA 3AL0C 1N34K 3JTHA 4B9LA 1U48A 4OMZA 3OHRA 3CJCA 3NEUA 1KCFA 3MQ0A 1IC8A 4A3KJ 1Z0XA 4PHTX 1RR8C 3CMEN 1NOZA 2XRLA 1FWZA 4IHWA 2GWKA 4HLXA 2GQQA 2M9HA 3QICA 5J8CA 4A3EJ 5KQ8A 3L9FA 5AQZA 2NRXA 1LFPA 4L5JA 3HL2A 4YIFA 4H0OA 4N0BA 4PJLA 4BC2A 2HHHK 2HXIA 1VQPN 1HXDA 2XSJC 1LW2A 2ID6A 3S14J 1VQ9N 1JLBA 3S3MA 3RR7A 3UKUA 1DP3A 1W2BM 5F1JA 3K4CA 2IPQX 3VQQA 5HS7A 1IJWC 4XLPF 1WSGA 4H5TA 1MDUB 2IGIA 3ID6A 4Y1DA 3S1MJ 2X48A 2LSNA 4XLCA 3RKXA 2P9IB 3JR9A 2AJQA 5CZ2A 1YOVB 2HDWA 5J3LA 3W2AA 2QYOA 3VF4A 3BROA 4I02A 1RT5A 5EOYA 2ZFWA 3VTIA 2X85A 1RNHA 3ZT2A 3K70D 3BPVA 3WGIA 4LSLA 3RRHA 2QQAA 5JFRA 3ZQGA 1ODDA 1IV0A 1ZBUA 2PYLA 4GCVA 4XLFA 5M5XJ 3CFPA 5CQGA 2Y1IA 2OBPA 1B1BA 1R4MB 2LVSA 1F5TA 3J7YP 4LF5K 1D8YA 1C0UA 3RKWA 4IKFA 4Q5SF 1IG9A 2BBYA 5CHIA 4M6YA 4CEEA 5LHGA 1ZBIA 3QEIA 3P39A 4HRIA 3HI0A 3P1GA 4BQNA 4EP5A 1XTAA 4XBFA 3H9GA 3OJSA 3UKRB 3VYRB 3RYRA 1G2HA 4YNQA 4JNEA 4EQQA 3ZMUA 3AO5A 3VQ5A 5DUKA 2M7AA 3O3KA 1MWKA 1T2KA 1NGAA 2VWKA 3A0IX 3W2VA 2VASA 2E1ZA 1XMKA 3O8MA 4JI4K 2ICWG 2W41A 2K9NA 3BG6A 4E7KA 4ZYHA 4UUSA 3GZ5A 3ZMSA 2EH3A 2PBIA 2FBVA 4U7BA 1S8NA 1I5ZA 3MZ8A 3ISPA 4M9SA 1XMXA 4M3DA 4FJ8A 3OWTA 3K7AJ 3H35A 4JS5A 4BC5A 4CCHA 1DKGD 3QNNA 4GV9A 1BR1A 2A5WA 2XV4S 4CYDA 2DPUA 2GXBA 2KW4A 4MNUA 3C95A 4C8NA 3VOVA 1L5UA 2KLOA 4FT8A 3FLCO 4KB1A 2CH0A 3A01A 4ESFA 3H3VK 3SUOA 4ILHA 1L3LA 4YFXF 3W3CA 2QXLA 3KZZA 3DXKB 3FM3A 1KQSM 3OS1A 2HEOA 4YDUC 1HYVA 3PO5A 1MW7A 4MLOA 5B1BH 1O3SA 3TP0A 1AHDP 2P51A 1Y0UA 3OJUA 2KRFA 1QRYA 3D2EA 1OKJA 4J8FA 2Z5UA 3HSRA 2IBDA 3BG5A 3NFAA 3RI4A 2CGLA 4NLBA 2HHTA 4XRSG 3REOA 2F9TA 4FZZA 5ICCA 2OA4A 2FMLA 4G8XA 3V42A 4RCHA 3ZYYX 1ON2A 2HGCA 3AFHA 3O6BB 5K7FA 2PJPA 1RTJA 4M9ZA 5KI6A 1T08B 3Q9SA 3CCUN 3CJAA 1VQNN 3DXKA 2E2HJ 1ZTRA 4RAGA 1UA1A 1D1BA 3G71I 3PNVA 4RS8A 3H5AA 3NAUA 3ROUA 2JUCA 3PM1A 4DV4K 1VQ7N 1B9NA 3NVKA 2OTJN 3GTPJ 1NKCA 4KAZA 1WGXA 1D5VA 3PV8A 2PJRB 4EVIA 1CXUA 3CF2A 3LAKA 3HOZJ 4Z4EA 1W7PD 1OJLA 5B1AH 4E7ZA 5BQTA 1NK2P 2UXNA 4FWMA 3L3VA 1RCHA 1TZLA 3IAYA 4ZDPA 2K9QA 2HVIA 2AA4A 1YYVA 2ZBKA 4BRCA 1OYWA 1SKRA 4MFDA 5DV5A 3Q3SA 3G4SI 2KT0A 3SQ0A 2VBZA 4UVCA 2HVSA 1P90A 2GEMA 3E01A 3O9RA 3KZYA 4FLUA 2EIKH 1NGBA 1YIJI 4GYGA 2FA5A 2MBFA 3K69A 2M4GA 1QVFM 2LF7A 1U2WA 1MMGA 2WAQN 4MDAA 1KC8O 2Q2RA 2PG4A 3CC2I 4BY7J 3LWLA 1P4AA 3QPSA 3TL4X 4LC9B 4RAZA 3OOPA 2I7PA 4QS7A 4C2MJ 1RT2A 5BN9A 4EGZA 4II2A 3ZSYA 5TRDA 4CJPA 2RC4A 1STZA 3DLHA 1DGRM 4NB5A 5IYBJ 4Q5VA 5E3NA 5EG0A 4A6EA 4PGHA 5DD8A 3V7RA 4KO0A 2E71A 4IHVA 3I4NJ 2W6LA 4PFPA 5LMNK 3CJQB 1B72A 4PGGA 3CYMA 4EIAA 4GVEA 4Y0WA 1BW6A 3J81O 1VSJA 2KIFA 2QLZA 1YLFA 3KE2A 3CM5A 1OH8A 3G10A 5IYDJ 3MN7A 4PKGA 1NK8A 2OYQA 3A5NC 1Q1HA 4RMNA 1LVKA 3G6EI 2K9LA 1QQCA 1KTQA 2MLKA 3HM5A 4XKCA 4JD2B 4B1XB 3NHGA 3M3YJ 2CW0F 1QHHD 2EIJH 1JXSA 3AO3A 3QIOA 3UKRA 3C2GA 2F9WA 3CCSI 4ELUA 4HCBA 5KK1A 2MFZA 3HVTA 3FKIJ 1QVTA 4D7NA 3L2RA 2X6YA 1EH8A 1TP4A 5E8GA 4I6MB 4RBOA 3HXMA 2PEXA 2MW8A 1N78A 3BLYA 1S1XA 2A6AA 2F48A 3SYTA 2V51B 3V1RA 4HW0A 1EH6A 2DFEA 4A3FJ 4BGDA 5JICA 2M3AA 1VQ4N 3GTGJ 4XIUA 5EXWA 4M3BA 1FP1D 4G94A 3CP2A 3TWHA 4UQGA 9ANTA 1F21A 3SEZA 1O3TA 2KISA 3DBRB 3M1CA 2VG7A 2YNIA 3AV9A 3OS0A 1HPZA 3FMRA 4BE2A 4CIEA 3CUQB 1YW9A 3MECA 5DM7L 3BC8A 4FWQA 3ZMZA 1JKQC 2Q97A 2D5RA 5FFXA 2XPVA 1W36C 1XC5A 1MMSA 2A1RA 3JAMK 2Z1IA 5CZ1A 3TTCA 2GAUA 4BRMA 3OYFA 4NCBA 1I94K 5DM7F 1GLDG 4Z94A 5K5OA 2ELKA 4DQPA 1YRNB 4V2GA 1OMIA 2IGMA 2JK3A 1G8XA 2ZCWA 3HDDA 3BF3A 3LDQA 4CGIA 4B8XA 4L0ZB 2RHKA 4PJNA 3ID8A 4WK8F 2CGKA 4H4MA 2PY5A 4M73A 5FPDA 5HRSA 4YOUA 4ENJA 1SVMA 2KRHA 4IVNA 3O4NA 4PJMA 3EETA 4X62K 3MCAB 4XMYA 1ASUA 1VQ7I 5M1QA 3VQDA 2ZGZA 1TLHB 3AY9A 4CECA 5GIOA 1EJ9A 3K58A 4KHWA 2IP2A 4E1JA 1BBYA 2A41A 5KRTA 1NKBA 3U21A 4Q4ZF 3TBIA 5E18F 3V9WA 4XKWA 3OBYA 4CF9A 1GT0C 4M45A 2HZDA 4KDPA 4IZ9A 3L2WA 3DLLL 2WUSA 4IRHA 1X9WA 1FSEA 4FJGA 3ASNH 3QYEA 3MWPA 4A57A 3A5MC 3PJRA 4EJVA 2L2OA 2PMUA 5M3FJ 3C6AA 4DV0K 2J5PA 2OTLN 5EVZA 2CV1A 3PUBA 4HDUA 2E1YA 1X1AA 2JPCA 4OKJA 4B3SK 1UHWA 2X74A 1PVEA 5AQXA 3CG7A 3C2HA 3ZETB 4IZZA 2FF3B 1H89C 1WJFA 4W5NA 4RDUA 3A4CA 5C3EJ 4L18B 4F3TA 3CCVI 3VF6A 2PAVA 4FHTA 1O3RA 4XK4A 1Z25A 3ABTA 4YFUA 1KQ0A 4V19K 2MSYA 1TT0A 2R93J 5K5QA 5JMVA 1XX5A 2EA4A 4CHOA 4ON0A 2ZMEC 1FC3A 3ML6A 4U87A 3BGRA 2E2NA 4DBQA 4LF4K 1Q82O 5BREA 1GLJO 3BQZA 2HNYA 1VRTA 1Z1DA 2CU7A 1IUFA 2OPSA 3LSMA 3KX2A 2ASMA 3BG9A 3J7AO 1QE1A 2HOTA 1TYQA 2WAQA 4UUVA 3R9PA 4U67L 3RSEB 2QM1A 3AVNA 1Q1VA 4S04A 3SDGA 3CTAA 4UV9A 1I27A 2DA2A 2OJED 5EEGA 4QTRA 3K5MA 1RIOH 4HA8A 4WCEL 3VEOA 2RV8A 4KKOA 5C25A 4XKBA 1AU7A 4DFPA 2R7YA 3DXJF 4WQ5A 4N56A 1R22A 1T3VA 5HLIA 3I3LA 2VIXA 1SVLA 1XB4A 3C1DA 3AO4A 3PO2J 3H1VX 3PIPF 1OCRH 3ZR8X 5DMRA 1E4FT 1L3SA 4KJZA 3M8JA 1IN8A 3FMQA 2DA3A 4KFBA 3T1HK 3V4IA 2OZMA 5LHIA 3S8PA 1RUNA 2R5YB 3CQ8A 3BOQA 4C2TA 4ID1A 1HQUA 2AP1A 4IFVA 1ENHA 3H0DA 1JCFA 1NWKA 3SDBA 2PFBA 1JKOC 4BBSJ 2ZSIB 1RPWA 3IL2A 3SLCA 5AQJA 1A6QA 1YTAA 4IOCL 2XPWA 5M3MJ 3LWFA 1O3QA 1YVNA 3SV3A 4KI4A 4LB5A 2M0CA 2L02A 2H8WA 4XLHA 3I55I 3CERA 4DCHA 1A04A 1LDDA 4FX0A 2IVOA 2VBXA 3F73A 4MFBA 4BXXJ 1EF4A 1W1WE 3SZPA 3CIPA 1RETA 3M8QA 4GNIA 2WB1N 3I56N 2CUJA 2XAGA 4QS8A 1R1UA 4GDFA 2OZ6A 1C6VA 4PKIA 4BGAA 1VQMI 5GAEP 2KHOA 1N5YA 2DT6A 2STTA 2O7OA 2DA1A 3I58A 2F5FA 1ASVA 1VSIA 3VEWA 4BAYA 3ULEB 2I8DA 1IO2A 4CK2A 3EZ5A 2R7VA 4IJNA 2FSJA 3A2FA 4KH6A 3D45A 4HCCA 3HSCA 4Y3OA 4BXUA 3RQIA 1DP7P 1MJ9A 3MCPA 2YU3A 3WE2A 4DF4A 2EZKA 4DR4K 4DR5K 2JN6A 2XVCA 3DP7A 1S72I 5ILVA 4E7JA 1YG2A 3F5TA 5J2NA 3NF9A 2A5YB 3THWA 4JRQA 1VQ6I 4ZYDA 4Z0UA 2DI3A 3IS9A 1MJBA 1I39A 1GLNA 4IHXA 5C15A 4FISA 5HRNA 2BVLA 4J19A 1FKPA 1XMQK 4QPOA 3ENBA 1HX1A 4CZHA 1UHMA 1X1PA 3CC4N 2BE2A 1R58A 2FQ3A 2HBJA 3E9LA 2ZM6K 3ZOBA 1F4KA 4BRDA 3SCXA 4ISEA 3A02A 4DU3A 3VA3A 5DM6F 4XNFA 2HHWA 2VGNA 1HSJA 1J9AA 4BY1J 3QESA 2E1OA 1HDPA 1B8IA 2O9LA 4H0YB 3LSRA 3HHHA 3HYIA 1VSDA 2EHGA 3TAFA 5KRSA 2ADUA 3VN5A 2G0EA 1OCCH 3EYYA 2R5ZA 3QOEA 4BREA 4YHHK 2P5VA 4LF9K 4NQWA 5AQVA 2QCOA 1HF0A 1U9OA 3JRAA 3D5SC 3U9GA 4BC4A 1PUFA 2BY3A 2D1VA 2XKPA 3Q0WA 1KAXA 1GOAA 1FX7A 1ON1A 3H45C 2GTDA 4CHPA 3S2DJ 2YI1A 1L3TA 5JI6A 4CBWA 2IRFG 4KHSA 3PX0A 3GW2A 4O3MA 2FF4A 1BCMA 4CJQA 5K5RA 1VQPI 4AUXA 2VT3A 2ISZA 1CZBA 1HKSA 1JL1A 3MXJA 4IBNA 3SQ2A 2O8EA 1K9MO 4AHRA 4BUPA 1J9IA 1J59A 5ED4A 2Y30A 2L4MA 2MD0A 2PJRA 2GBZA 4DR2K 1WAFA 2NRWA 4MO7A 2EINH 1FOXA 2M2EA 3R0AA 1BDGA 3VPZA 3WE3A 3SUQA 2V4JC 3DEEA 3K6GA 3RKQA 3N4PA 4J2DA 2ME6A 4CICA 3CCMI 4ID5A 5EEAA 1W36D 4LFAK 3OL3A 2E1CA 3WTSC 2YKMA 1NK7A 4DW6A 1IN6A 3CCMN 1NJYA 1WSUA 1LJ9A 3LQQA 1HNXK 1RDWX 4DF8A 4QOZB 3IH4A 1O7LA 4OGCA 1TK0A 1TAUA 4B43A 2V1UA 4N9HA 3VQAA 4F4KA 1W0UA 1TQPA 3QLHA 2K9SA 4CSWA 1BA1A 1KAYA 5A2QO 3CCUI 2Q2EA 1OVQA 1ZGAA 1RKTA 1VK0A 4BE1A 1HC8A 4OPKA 3PY8A 3ZQCA 3KZBA 4JS4A 3BEXA 4HLYA 3TPQA 1JT0A 1VSLA 4CHNA 2P0WA 1IKWA 1UHSA 3HIFA 3IKVA 5E41A 3I59A 2Y1JA 1IH7A 2O61A
chains in the Genus database with same CATH topology
1JLGA 2FBTA 4CFDA 4FLXA 1FXXA 3HL8A 4M3ZA 3DMJA 3HPOA 4LSNA 2IC3A 3SPZA 2F8SA 3SZ2A 5C42A 4J2AA 1BISA 4GMJB 4R5PA 3RMDA 3S3OA 1DTQA 2G8HA 3AVKA 1SKSA 3KKRA 2HNZA 4CJVA 2ETJA 4FLVA 4DTMA 4FLTA 2GUIA 4CEOA 2IDOA 4E1NA 1HMVA 4CJRA 2QKBA 2YKNA 4M42A 4DTNA 1XHXA 4CJLA 4B9SA 1RBRA 1RT6A 4G1QA 4CJKA 1NK4A 4CEAA 3OYJA 4B8AB 4PQUA 2HHSA 3HP9A 4DMNA