1IO2A

Crystal structure of type 2 ribonuclease h from hyperthermophilic archaeon, thermococcus kodakaraensis kod1
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
213
structure length
213
Chain Sequence
MKIAGIDEAGRGPVIGPMVIAAVVVDENSLPKLEELKVRDSKKLTPKRREKLFNEILGVLDDYVILELPPDVIGSREGTLNEFEVENFAKALNSLKVKPDVIYADAADVDEERFARELGERLNFEAEVVAKHKADDIFPVVSAASILAKVTRDRAVEKLKEEYGEIGSGYPSDPRTRAFLENYYREHGEFPPIVRKGWKTLKKIAEKVESEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords RIBONUCLEASE HII
publication title Catalytic center of an archaeal type 2 ribonuclease H as revealed by X-ray crystallographic and mutational analyses.
pubmed doi rcsb
source organism Thermococcus kodakarensis
total genus 69
structure length 213
sequence length 213
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2000-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 1io2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1io2A01
1X9MA 3PO5A 3SUQA 3AA3A 4J2EA 4E7KA 1FKPA 2F8SA 4CEFA 1JXEA 4EP5A 1TKXA 1ZBFA 3PX0A 1QTMA 1KSPA 4Z4FA 4CK3A 4CHOA 2DFEA 3T3FA 4B8AB 1UA0A 5CY4A 4B08A 1KRPA 1ZBHA 3C6UA 1NOZA 4IFYA 4CJLA 4B3OA 2KZMA 1NK5A 3NF7A 2IS3A 5DK5A 4AHUA 4KTZA 4CFAA 1WLJA 2DTUA 1LAWA 3IAYA 4PWDA 2KFZA 2P1JA 3I8DA 4DU4A 4DMNA 1NJYA 3LALA 1U48A 2HVHA 2EX3A 5FRNA 3KKRA 4FLXA 3ULDA 3KJVA 4LD0A 2YKMA 2HNDA 3VQCA 3OYHA 4ICLA 1TAQA 3AA5X 3QEIA 5JS2A 1L3TA 3AVGA 3O4QA 3CYMA 3VQ4A 3OJSA 1SKRA 2FBYA 4FCYA 4IBNA 4DSFA 4FK2A 3HL8A 4C8LA 4W5RA 4CJPA 4DTNA 1REVA 3AVJA 4AHSA 4M3UA 1GOBA 3S3MA 1LW0A 4HVJA 2ETJA 3OYJA 3A2FA 1JLEA 4C8MA 3HSTB 3THVA 5HLFA 2YHAA 4H4OA 1N5YA 3AVNA 4CEEA 4KI6A 2KTQA 2LSNA 3B6PA 2HNZA 3NF9A 2X74A 1XWLA 3RRHA 4F4KA 2PY5A 3QEWA 2HMIA 1HPZA 4DFKA 5D3GA 1D8YA 1RBRA 2Z1GA 1TVRA 4BDPA 1J9AA 4CF8A 1JXBA 1NKEA 2YNIA 4ID5A 3V1RA 4RW8A 4C8NA 3G10A 4IFVA 4KTWA 3DM2A 3LZIA 5SZTA 1WSHA 5HBMA 4FJIA 2OA8A 3SI6A 4Z4HA 2ZD1A 1NK0A 4KO0A 1LWCA 1LWEA 3OS1A 3CFPA 2JLEA 4B9MA 1VRTA 1XI1A 4CEBA 3RR7A 2G8UA 1IH7A 4FM2A 4DTMA 1IKVA 3T1AA 4DLGA 3SUOA 1XHXA 4ZHRA 4MFBA 1KLNA 4GW6A 3V1QA 2Y1JA 4CFCA 1RCHA 1VSFA 1LWFA 4CF9A 2FBVA 3AVKA 3NBPA 1SL2A 1Q9XA 3EYZA 3P5JA 1BGXT 3DLKA 4CGHA 3CFRA 3P1GA 4XIUA 3UIQA 3HT3A 4HUFA 1VSLA 1L3VA 5J2PA 4CJEA 4DG1A 3HVTA 4NCGA 4O0JA 3D45A 1VRUA 4CJSA 4I7FA 4DFMA 3ASMA 4CJKA 4F2SA 3LPTA 4OKEA 3V9WA 4ZTJA 3TWHA 4O0IA 1U45A 2WONA 2YV0X 1TAUA 1NKBA 2KW4A 4E7IA 3U3YA 2BE2A 3DYAA 4CESA 3MEDA 3S3NA 1T7PA 3ZT2A 4CF2A 4JRPA 4EP4A 1EETA 4KPYA 4DSEA 4F2RA 3QNNA 3ZSYA 4CJFA 3TAMA 3NFAA 4B9NA 2DFHA 2RPIA 1WSFA 2PZSA 2JGUA 4EZ9A 3LWLA 1JLFA 1GOCA 1BCOA 3MXIA 3KK2A 4ELTA 1RNHA 3I0RA 1QS4A 2A1SA 4CK2A 1C1BA 2P5OA 3LP3A 3IG1A 5KGXA 4CEOA 1HYZA 1SL0A 4DQIA 4OGEA 4Y1CA 2HB5A 3RR8A 4AHTA 1C0UA 4H8KA 3HVRA 1IKWA 3ISNC 3AO5A 4CK1A 3VQ6A 4W5TA 4DS5A 4AH9A 1W0HA 3TANA 3KLHA 4I2PA 4UQGA 1KVBA 3LZJA 4JLHA 4QAGA 4FM1A 4DTOA 1WNSA 3VQPA 2IGIA 3TAGA 4C8OA 2FBXA 4CERA 3WNHA 3K58A 4BE1A 2XY5A 2O4GA 2OPSA 1CXQA 4CJWA 3HPOA 1RDAA 2VG5A 3OS0A 1VSKA 4AHCA 3OYNA 3L2WA 4FM0A 1TV6A 3LP2A 2KQ2A 4CF0A 4M3ZA 4OGCA 4OPJA 1YT3A 4OJRA 1QSSA 4FJ7A 4KHYA 4NYFA 1RDDA 1YVUA 1CZ9A 1ITGA 3NAEA 1RTIA 1J54A 2P5GA 1HYSA 3V9SA 1JLAA 3S9HA 1HMVA 3OJUA 4DTPA 2HHVA 2OPPA 1UA1A 1UAXA 4C8KA 1SV5A 2G8FA 3SQ1A 1RT5A 4CGDA 2R7YA 1QQCA 3PUFA 5J2QA 2G8HA 4I9LA 3OYGA 3SQ4A 2HHSA 3NF8A 3F9KA 2XO7A 4KAZA 1NK8A 2B5JA 1CLQA 2FC0A 1L3UA 3KK3A 1U49A 1JLBA 3FFIA 4J2AA 4KREA 3DLRA 3NH0A 2OPQA 4LSNA 1TK8A 4TSXA 5KRSA 1JLGA 1VSIA 2RN2A 3LAKA 1S9EA 4M45A 4M41A 3ZT1A 1D9DA 1RT6A 2KZZA 4BWJA 4OLBA 1A5VA 3SV3A 1TKTA 1IKYA 2B4JA 1X9WA 4FZYA 1K6YA 4Z4EA 3OYCA 3HK2A 2XY7A 1VSEA 3CM6A 2G8WA 4JS4A 4I9QA 4FW1A 3L2UA 2OZMA 2QK9A 1X1PA 1TGOA 1W9HA 1WSEA 1U47A 4BE2A 3L3VA 1EXQA 3VQ8A 1BIUA 1HNIA 3C95A 2D0CA 4KB1A 5EU7A 2A1RA 1TK5A 3QEXA 4E89A 1O1WA 1IKXA 4CHPA 4DTJA 2HHWA 3SZ2A 1C0MA 1ZYQA 3QEPA 1C0TA 4FJ5A 4MQ3A 1FKOA 3QINA 4FK4A 3OYMA 1A5XA 1S1TA 4N5SA 1RILA 3RMDA 4RW4A 3QEVA 2P51A 1RT4A 3DRPA 3QETA 1TL3A 3CFOA 2DFFA 3NDKA 4HUEA 3K5NA 3AO1A 3L2QA 1RT2A 2VWKA 1D9FA 4KHUA 4KHNA 3ZT3A 1S9GA 4RW7A 3MECA 3TAPA 2BDPA 1G15A 1LAVA 5C24A 4FJMA 1N6QA 2IOCA 3TAFA 1WAJA 4OLAA 5K14A 3VA3A 3NGIA 3PX6A 4FLUA 4FLYA 1TKDA 4O44A 4FJJA 4PUOA 4IDKA 3OVNA 1HQEA 1S1VA 5CYMA 2ITGA 4OKKA 2YNGA 2Z1JA 2XHBA 3K5LA 3HPGA 4CGGA 1WN7A 1EKEA 3K2PA 3VQQA 4B9UA 3ZSVA 2HHQA 3NGYA 4KRFA 4M3TA 4QOZB 2HW3A 3OYFA 3QESA 4CHNA 1DTQA 4HTUA 2XY6A 3L3UA 3IRXA 5T7BA 3LP1A 4N56A 4FJKA 4Q0BA 3KIOA 3U3GA 4E7JA 1R0AA 2O4IA 4ZTFA 5SWMA 4F3TA 2HVIA 1B9DA 1T03A 2G8KA 4CJVA 4CFDA 3K59A 3OYIA 3HYFA 3SYZA 3V6DA 5CYQA 3ZSQA 1WSJA 3TAQA 1Z26A 3H08A 4AHVA 1RTJA 2D5RA 3AV9A 4CJ4A 3DLGA 2W42A 3DOLA 2BANA 4O55A 4CF1A 1FXXA 4DTXA 2ZQBA 4DU1A 1B92A 4FLWA 1LW2A 3OYEA 3KKSA 3RTVA 1QE1A 1CZBA 3VQBA 4DTUA 4DSIA 2G8IA 1HJRA 4CIGA 1ASWA 4CIFA 4CEQA 3VQAA 2KFNA 3VQEA 4BE0A 3QNOA 4ELVA 5HP1A 1D5AA 5KI6A 1XC9A 4BDZA 1SKSA 3M8PA 4JRQA 3EY1A 4W5NA 1IG9A 1VSDA 4F8RA 5CZ2A 4J2DA 2F8TA 4QCLA 1VK0A 5J2MA 4GVMA 4RW6A 3AO3A 3O3HA 1JL2A 5C25A 3OY9A 3OYBA 4DQRA 4GMJB 1EP4A 4CGFA 2X6NA 4FZXC 4M42A 4HHTA 4CFBA 3VQ7A 2ZE2A 3V9XA 4CJ5A 3DLEA 1RBUA 3SQ2A 1DLOA 1BI4A 1RBTA 1Q8IA 4OVLA 5HROA 3C94A 3KLIA 2VG6A 3HP6A 3SPZA 2PYLA 4CJTA 4DTSA 1I3AA 1GOAA 4CEAA 4YFUA 1X9SA 2QXFA 3AVBA 4CJRA 1LV5A 4IKFA 3PV8A 2OZSA 4Z4CA 1J5OA 5E41A 4R5PA 2VWJA 3D0PA 4DQQA 1XHZA 3TAEA 4CHYA 3CM5A 4B9SA 3M8QA 4CECA 1RBSA 1KCFA 2E6LA 4CIEA 2RF2A 3O3GA 3HJFA 5DMRA 3QLHA 3ZSZA 1SL1A 3AVCA 1ASVA 1IO2A 2IC3A 2VG7A 5FROA 3AO4A 3CQ8A 3V9UA 3BGRA 4DSJA 1JL1A 3TR8A 3BDPA 4E0DA 1JLQA 3NH1A 1KFSA 2GBZA 1Q9YA 4KKOA 3AVHA 3IS9A 4PY5A 1VSMA 3SJJA 3QERA 1S1WA 3ZT4A 3O3FA 4FJHA 5FRMA 1YTUA 2I5JA 4PA1A 3V4IA 1L5UA 4E1MA 3KLEA 3L2VA 3M8RA 1KTQA 5JS1A 4CHZA 1T8EA 4FVMA 1HQUA 3VQ9A 4O5BA 1U4BA 3V1OA 3PY8A 4F3OA 1VSHA 3DRRA 4DU3A 2G8VA 4B8CA 1SUQA 4FJXA 2FBTA 4M3XA 4RG8A 3ZSXA 4DS4A 3AVLA 4BWMA 3C6TA 3EZ5A 5HRSA 3MEGA 3V81A 1MU2A 1Y97A 4O4GA 3LPUA 4DWIA 2D0AA 3DI6A 3TI0A 4CJ3A 1WAFA 5HRRA 4FJLA 1UWBA 3VA0A 1HYVA 4M3YA 4LH4A 2Z1IA 3SUPA 2AJQA 3MEEA 1S1UA 4DLEA 1ZBIA 1HRHA 3NF6A 2OPRA 2NUBA 1EX4A 4CGJA 3KTQA 3RRGA 2DY4A 3F73A 2F96A 3PO4A 2D0BA 3HXMA 2BGGA 4HCCA 1RTDA 4NYNA 2E4LA 3AVAA 5CZ1A 4NCBA 4CEZA 1KVAA 3SV4A 4DTRA 1QSYA 4CJUA 1BL3A 3OS2A 3S3OA 1CXUA 1S5JA 4FJ9A 4LSLA 1NK4A 1TKZA 4DSLA 4AILC 1NK6A 3TARA 3LDSA 2Y1IA 4DSKA 1SKWA 3MXJA 1BHLA 3PX4A 3SQ0A 1BQMA 3WNFA 1DTTA 1S6QA 4KHWA 3CG7A 4W5OA 1BCMA 4KV8A 4KTQA 1ZBLA 2YNFA 3K5MA 3NHGA 4CGIA 4YNQA 1RT7A 3LP0A 3AA4A 3NCIA 3P83D 2HHTA 4LY7A 3VQ5A 2GUIA 2OYQA 1NK7A 4B9VA 1NOYA 4K8XA 3DOKA 1TL1A 3I0SA 3TABA 1F21A 1FK9A 4PQUA 4KB0A 3ZCMA 4CE9A 5J1EA 4DQSA 2YNHA 4OKJA 4Z4IA 3AA2A 4KHQA 2B6AA 4N41A 4IG3A 3OYAA 3AO2A 4DF4A 1I39A 3KD5E 3MXMA 3LANA 2RKIA 1KVCA 4Y1DA 4AHRA 3E01A 4OPKA 3M8SA 4FJGA 1BI4B 4CEDA 2X78A 5I3UA 4E7HA 2E6MA 3B6OA 3RMBA 4Q5VA 5HRPA 3VN5A 3SNNA 1BQNA 3KLFA 2HHXA 3K5OA 4KI4A 2QKBA 5KTQA 4DFJA 1RT1A 1NKCA 4ELUA 4KHSA 4FYDA 1VSJA 1C1CA 1S6PA 1C6VA 4G1QA 4IG0A 3U6FA 1RDBA 2Z1HA 4DFPA 1NJZA 3OYDA 5HRNA 4B9TA 2HHUA 3DLHA 3ITHA 4Z4GA 1NK9A 2IAJA 3ZSRA 3DRSA 3VQDA 1ASUA 2X6SA 2XY8A 1HNVA 4K8ZA 4FJNA 4EZ6A 1BIZA 3T19A 1NJWA 3OYKA 1J53A 3NH2A 1UOCA 3AVMA 1A5WA 1KFDA 4ID1A 3LAMA 4I2QA 3ZSWA 4FK0A 3NGZA 4BACA 1L3SA 1QSLA 3V9ZA 4M3WA 3NE6A 3RWUA 3HO1A 1ZBUA 1Z25A 4E1NA 4B9LA 3QIOA 1JLCA 1KLMA 4JS5A 4FLVA 5J2NA 4DF8A 2PYJA 1RTHA 4BDYA 4FJ8A 1BISA 3ALYA 1QHTA 3MAQA 2QKKA 2GV9A 5FDLA 1S1XA 3KD1E 4FZZA 4DQPA 4FXDA 4N47A 3HP9A 4J2BA 3SUNA 4E7LA 4FLZA 1C1AA 2Q3SA 3K57A 4CJQA 1U04A 2WOMA 3AVIA 3AVFA 3DMJA 4Z0UA 4E19A 4HUGA 3RMAA 3SCXA 1NJXA 1RBVA 4L8RB 4CHQA 4FLTA 4RW9A 1WSIA 3KK1A 3QO9A 2XRIA 2ATQA 1YTAA 2YKNA 1RDCA 2IDOA 3HPHA 3L8BA 3LWMA 1WSGA 3HM9A 1JKHA 1RT3A 4NCAA 4N76A 5C42A 4W5QA 1T05A 3JSMA 3SPYA 4KFBA 4WE1A 3ZSOA 3O4NA 3WNEA 3G0ZA 4M3RA 3OYLA 3DLBA 3QIPA 2YHBA 3RMCA 4FW2A 1TK0A 4CCHA 3KLGA 4E3SA 4H4MA 4HCBA 2EHGA 3JYTA 3WNGA 3ZT0A 5KRTA 3L2RA 1B9FA 5I42A 5KGWA 2HNYA 4LH5A
chains in the Genus database with same CATH superfamily
2Y0SA 3FR0A 2KFDA 1YYVA 2L7ZA 3CQXA 4FWMA 1UA0A 2HQAA 4HYEA 4M3FA 1NK5A 3TOAA 1JXSA 1WLJA 4NQWB 2BY3A 4DMNA 4CD1A 4FETA 1JKQC 1ACIA 3CCEI 5FRNA 1HNZK 1GLDG 2FEZA 3OJSA 2KDOA 4C8LA 2QBYA 1SZ2A 2GA2A 1S3JA 2YHWA 5GADJ 3LFUA 3LNQA 4F4KA 1N36K 3JRIA 1JCEA 1J9AA 2DJNA 3CCEN 4FJIA 4JK8A 1Z21A 3ENHA 1QZZA 1SMYF 4CFCA 1RCHA 1QVUA 3G3ZA 3A0IX 2FBVA 3S93A 3EYZA 3C0BA 3L00A 4HG2A 1YW7A 1IJWC 1HKTA 3THXA 3SAFA 2CGLA 2P9LB 1EETA 3DU5A 4B9NA 4FISA 2PZSA 1MKMA 1EQYA 4QS9A 3CCUI 3IG1A 1P2FA 2XF5A 4AH9A 1OCOH 2HDWA 2ZNZA 4BGBA 2LBFA 1HLVA 4UQGA 3OIOA 1HDPA 5H2FC 4QAGA 2L54A 3VENA 1RDAA 4NC8A 3SJHA 3TU5A 3CCUN 3L2WA 3CQYA 2HI3A 1J54A 3EE9A 3F22A 4A12A 4B1VA 3OJUA 3HKZA 1ZK8A 1TNTA 2PBDA 3SQ4A 3ABTA 3KK3A 3DLRA 5AZIB 2P81A 1RT6A 2KZZA 2B9SA 4D0PA 2VXZA 3AGRA 1IXCA 4I9QA 1W1WE 3J7AP 4DB3A 3DTEA 1HNIA 3C95A 3LL7A 4KB1A 2DMQA 4BH9A 3VEOA 4HV5A 1LOTB 3OSGA 1W5TA 3CESA 3THYA 1G4DA 4I6MB 1RT2A 3KZIC 1IN7A 1G15A 3I56I 4OLAA 4FLUA 4PUOA 1MBHA 3OVNA 1S8NA 4H0XB 2YNGA 4XLAA 2G0EA 4CCJA 1I27A 4KRFA 1X3MA 3ABUA 3IAM2 3FLCO 3FDYA 3IH3A 4JK7A 1BM9A 4BR4A 3I56N 3KP7A 3BF3A 3H08A 2R5YB 1YUWA 3RTVA 3C2GA 3VQBA 3U8XA 4FWOA 4G9ZA 1J5YA 1FP1D 1VQMI 1VK0A 4KICA 4GVMA 3PIOF 3OY9A 4GRIA 3I4MJ 3C7NB 2EK5A 3DKYA 4PJMA 2XB5A 2Q0UA 3MDQA 5H6RA 4IKFA 1ZXOA 1ON2A 4R5PA 1YQAA 1T38A 1VQMN 3O3GA 3CQZJ 3AVCA 1XPXA 3TMOA 3BGRA 3TR8A 3CP2A 2O8BB 3H5RA 3BG6A 3KETA 3CCVI 1P7JA 2QQ8A 2RC4A 2DQRA 1F4KA 4CHZA 3KZYA 3JW4A 3TDUC 2E1YA 4FJXA 3TW7A 3BZKA 1HPMA 2ESHA 1NG9A 2EZKA 3G4SI 1ZBIA 3CCVN 3MKZA 1IDYA 3F73A 3PO4A 2NNNA 1HKGA 4BU2A 3OS2A 3QDKA 2WUSA 1WHUA 3F5TA 1BHLA 4CCOA 3SQ0A 2PJRB 4LFBK 1MMGA 2VE8A 1PUFB 3G4SN 3OHRA 4B43A 4IEIA 1TNSA 1JTYA 4JV5K 1DP3A 5IOYA 1QU3A 1OKJA 2FU4A 1NGGA 4IHVA 5GAGP 4H0VB 2RVCA 3PLAA 2HYFA 1Y64A 1NKCA 4G1QA 1FNNA 2YU9J 3R1XA 3VQDA 2XY8A 2ID3A 3AVMA 2R7DA 1W36D 4BACA 4BGAA 4CZJA 5HLIA 4MGRA 5J2NA 4DF8A 1RTHA 3GFIA 4BDYA 3SAHA 3VSKA 2ECBA 4WXCA 2VC1A 3JTGA 4HX7A 2HBKA 2WOMA 4L8RB 4I01A 4ZH4F 4NLCA 3QO9A 2XRIA 4KUMA 4LK1F 1RDCA 3SK3A 1V5GA 3DXKA 3MCPA 2V26A 3SPYA 5CKTA 3TL4X 2D5VA 2OQGA 2BUPA 4LH5A 4F92B 4EP5A 3BG5A 2K9NA 1JTXA 4HV6A 3A01B 2IS3A 4QS8A 4G9YA 1ONVA 2ZC2A 4DU4A 3OR1C 2HNDA 2QF7A 3QEIA 2OANA 4JD2B 2PEXA 3LSMA 3AVNA 5HDKA 2LSNA 1EJ9A 4BRFA 1FSHA 4CZGA 4ABZA 4ID5A 1OJLA 4RW8A 3ZQQA 4HF0A 5JLWA 1NK0A 1LWCA 2E1ZA 4DLGA 3V8LA 1OCTC 3HSFA 2DPNA 4Y3OA 5EDNA 1SL2A 2PMHA 4CYCB 1Z3XA 1IBMK 4J01A 1TAUA 4E7IA 2K4JA 3TO6A 4KH6A 2K86A 2K3PA 1WSFA 3H3ZA 2EFOA 4PFOA 1T44A 1FIPA 1XGSA 2OCCH 2YUSA 1SL0A 4OGEA 3AL0B 1U2VB 1K8AO 5BMZA 2KT0A 5D4SA 4HLYA 3OWTA 3T8TA 4DTOA 1ATSA 3BJAA 1SAZA 1R49A 1K78B 1CXQA 5GTIC 4CJWA 1EH7A 2VPLA 3DFGA 4A61A 2EWNA 3S8PA 5FKNA 4FJ7A 4NYFA 2VKVA 1UELB 3V9SA 2R0QC 3I3LA 3O3KA 2OD5A 4I9LA 1GLEG 3MMYB 1YTYA 1O4XA 2AHQA 1NU0A 1K6YA 3PM1A 2XY7A 2K9LA 3KWGA 2KHOA 3WU2C 2P9IA 1O1WA 1BWFO 3CCYA 2A68F 2DA4A 2AJQA 4KHUA 4WCEL 3Q7CA 5E3NA 4RGSA 2VOOA 4P9UA 4IDKA 1ETWA 2EA2A 1FOYA 2XPUA 1MDMA 5BN9A 3H35A 1SAXA 1IBLK 1P4XA 3K2PA 2F9WA 2QXLA 2BTFA 3R6MA 2E1MB 1RI7A 2NVUB 3SYZA 4MLHA 3OYIA 3LA2A 2AA4A 3ZETB 4CF1A 1BI0A 1IXRC 1J09A 3JS6A 1X3NA 4CIFA 1K7AA 3LA7A 3QNOA 4ELVA 3EY1A 5E1WA 5CZ2A 5IP9J 4WFNL 1OKRA 2W6KA 2BW3B 5LMNK 4AVZA 3GEZA 1DLOA 1Y0NA 3DV8A 1CQTA 5HROA 2O3FA 2HGCA 5D8KB 4IRHA 2DA6A 1XHZA 3I53A 2VIXA 1RBSA 4ILGB 3HJFA 3RPUA 2VE9A 2IC3A 3NEUA 2YHXA 1Q9YA 4KKOA 3M7GA 5BS6A 3RZDJ 1A31A 1ATRA 1UHSA 4QS7A 2R7SA 1D8KA 2WV1A 5C44J 1V55H 4IO8A 3K4LA 3A2KA 1Y39A 4DS4A 3VERA 4AIHA 2GIVA 2LYCA 3E0JB 1Y97A 2LR8A 3D2EB 1TUUA 2VBWA 4F91B 4YRVA 3WG9A 4PGGA 4LLGF 1MBGA 4JX4A 2ETHA 2O8EB 2V51B 4BHCA 2E4LA 5AQZA 3QRFF 4IL6C 3SV4A 2VUMJ 5IYCJ 3PUBA 4U88A 4M63C 2HNHA 3S15J 5M3FJ 4LJZF 2KZGA 1XMKA 3LDSA 2HSTA 2IAIA 4A0YA 3KEYA 2Q0RA 1WQ2A 1ZGWA 2YX4A 1RT7A 3DOKA 4GKJK 1IN6A 4IRIA 2OZUA 2LNBA 3K4KA 1FTTA 3F6VA 1OYYA 4K42A 2ELKA 3RKWA 1MH4A 4CO8A 3J7ZO 5LEKA 3F23A 4PL8A 3J80O 2K40A 4PK4A 3OSFA 4QIWN 4EJWA 5KTQA 5DUIA 3VFZA 1C6VA 1MMAA 2DA5A 2VBXA 1NJZA 1N34K 4W1UA 2ACJA 3ZSRA 1R59O 1F36A 3OV8A 1Z3YA 1HW5A 3G71I 1KLMA 4FLVA 1CF7A 2JA2A 4YG2F 2KIFA 3HTVA 5GPAA 5JMVA 1LQ1A 4JK9A 4N47A 1OPCA 1IRGA 3K57A 3D6RA 3LL3A 4FWLA 2QWLA 1RBVA 3PNTA 4P96A 4BRCA 4RW9A 3CO7C 2CGKA 1RT3A 3G71N 5C15A 3VYUB 4B1UB 2V1NA 3OYLA 2R7TA 3DLBA 2J5PA 1DDNA 3A5OC 2VPRA 2JZYA 2P5LC 5KGWA 1BR4A 1ETQA 4L5JA 3WU0A 3LSIA 3FFKB 4L0YB 4B08A 1B6AA 4BXUA 5C3EJ 1X2NA 4PWDA 4PZJA 3I8DA 3LALA 5DM7L 2BGCA 1YXQA 2PX9A 2Q0OA 3O4QA 2Y9ZA 2FBYA 3QP6A 2VWBA 4AHSA 4M3UA 2G7HA 1SS6A 2O8CA 1RZ4A 4KI6A 2OCEA 4RMNA 4LIVA 1R23A 4YFKF 5D3GA 1DPUA 4J8FA 4CH7A 3WHBA 2JWTA 5B1BH 3ULEB 4C8NA 2Z5UA 4ON0A 4G7HF 4B3RK 4Z4HA 1IV0A 2VQHA 3LA3A 4DV6K 3T1AA 1KONA 4CF9A 4DGWB 3E5QA 3RDIA 1VQ7I 3D45A 1SVLA 4F2SA 3LPTA 2F5EA 4DZPA 3U3YA 3M5RA 1JHFA 2LTPA 3HZ6A 1T0FC 2NAZA 3NFAA 2HKOA 2NNWA 2QVOA 3A4CA 3GTKJ 1VQ7N 1NTCA 3ZPLA 3WXMB 4H8KA 3AO5A 4LLNA 2NRTA 1M1EB 3W2VA 3HXLA 3ZRGA 2IGIA 3GZNB 1K61A 3WNHA 4IHTA 3J7AY 2A07F 3T69A 1UJ8A 5GTHC 5AQKA 1XX5A 1ITGA 3M07A 3MAJA 2P5GA 2HHVA 3SQ1A 3VODA 5J2QA 3LDOA 1Z77A 3KP2A 2QW9A 3ENBA 4A3BJ 2HDDA 2B5JA 4RTFD 4H0PA 1S9EA 3M8FA 4M41A 3JAMZ 4HNVA 5AQWA 2E5LK 4FZYA 2Y2ZA 1PP8F 1ZGAA 2CGPA 3BR3A 3L3VA 2CU7A 2LY9A 3WXKA 3EYYA 3H46O 3BUZB 2BBYA 2OBPA 2Q8KA 4FK4A 2L01A 1A5XA 5GIOA 1Y1WJ 3J7YP 4JKFA 1I94K 1B9NA 5CYMA 1WSUA 1R00A 1VQ8I 1RFQA 2ITMA 2XAQA 3I0TA 4RGXA 4AC0A 1OCZH 4CFDA 3ZSQA 2IGNA 3O1BA 2H6BA 2Q2EA 5M1NA 4B3XA 4LF8K 2FSNA 2Q97A 1VQ8N 3BTIA 2PJPA 2EV5A 1EP4A 2JT1A 3QMLA 4U7DA 1MJ9A 2R5ZA 4E7SA 4P5OA 2A40A 2AXTC 1KU2A 3PQKA 3QLHA 1ASVA 1VQOI 2ZJQL 3ZQGA 4CHUA 3VMFB 3SMSA 3M8RA 1BI3A 5FPEA 2W25A 4FWPA 2IEKA 1NGCA 3U9ZA 5HVQC 4AIKA 2J5OA 1OFCX 1VQON 4M3YA 2LLKA 3K0LA 4C1NI 3GL1A 2F96A 4J00A 3I33A 2D0BA 2P6TA 4NYNA 1R6RA 2RNJA 2HR3A 3EZWA 1TKZA 3GDQA 4RB3C 3EE8A 2HYGD 4I7HA 4UUVA 1NLVA 3RSNA 2W41A 2R7RA 3BZ6A 3NHGA 1TL1A 1QVGM 4LF9K 2DDBA 4IG3A 5KNLA 4Y1DA 4S04A 3M8SA 4CZMA 4HEA2 1Y0UA 1YX5A 4FWQA 5F0FA 5F1JA 1R4MB 2FLOA 5EG0B 3WGHA 4MNUA 4D7MA 1R1TA 5FO5A 1NK9A 2STWA 1A6IA 2R7ZJ 1K8KA 1A5WA 4BJ5C 1IXSB 4M3EA 2CS3A 4TV7A 3RWUA 3HO1A 1O7LA 1Q1HA 1AOYA 3HOWJ 3VETA 4C30A 4LGWA 3UKRA 2Q3SA 3A8YA 1SD7A 2WAEA 3O9QA 1IRZA 3ZYYX 1XNQK 5AQGA 3O4NA 4ZYGA 4EJOA 2HU9A 2UXDK 1VNDA 2DO7A 3VF6A 4H4MA 1B1BA 4BQLA 1X3ZB 3GWZA 4E7KA 2VN2A 1WH7A 3N97A 3IWFA 2DMPA 1ETVA 3EKSA 2YU3A 1BC7C 5JI6A 5ILSA 2DTUA 3IAYA 2EFWA 1K83J 2E88A 3EETA 2Q31A 4LC9B 4ICLA 1L3TA 3BCBA 1Z7UA 4DYRA 1X1AA 4BY7J 4CJPA 2NVYJ 1Y6IA 3NMUA 4BXFA 3QEWA 3VGLA 5GP9A 1D8YA 2P8TA 3ZEUB 1T98A 1W7PD 2J4RA 4DUYK 3OS1A 3MN2A 3FF5A 3WUHA 3F21A 4A3FJ 4BRKA 3MN6A 2EZIA 2NVQJ 2F5VA 1R36A 3V9WA 1XCVA 4G94A 2KW4A 5M5XJ 1ULYA 3MEDA 2DJIA 1TWAJ 3QNNA 5GAGJ 3HRSA 2JUGA 2FF3B 4GNIA 2ZJPF 4BROA 2O8FB 1WWXA 3HIFA 2W40A 1LDJA 4KA4A 3WT0A 1J5EK 2WY8Q 1WFXA 3OS0A 1V4SA 5LGNA 4DTPA 1Z91A 5D6EA 2P9PB 3SQNA 3E6BA 4CGDA 3JCUC 1FWZA 2HHSA 3FFIA 4TSXA 1V4TA 2K5CA 2KHMA 2M8GX 5DD8A 2QKMB 3P31A 1U47A 3MD2A 1BIUA 3GBTA 2XUBA 4CHPA 4DTJA 4MQ3A 2DXIA 4LF6K 3RVCA 3QETA 3NDKA 2IGMA 3L2QA 4A5BA 1QQIA 1HKCA 1JKOC 4FLYA 2O8XA 2ITGA 3GTPJ 1KZHA 1EKEA 3TTDA 3G1OA 2BY2A 2GZWA 4UV9A 2NRVA 3H3VK 2MD5A 2WADA 4AHVA 2XHKA 1ENHA 4BQNA 2CYYA 4FLWA 1QE1A 3ELKA 4CIGA 4RDUA 2Z9OA 4PJLA 4Y52J 1O13A 5E3MA 4J2DA 5J2MA 3O4WA 4B9QA 2WAQN 1U5TB 3FXLA 2L5QA 4HDVA 2LKPA 2FD5A 4QWQA 5FD6A 2PYLA 4CJTA 4I09A 4Z4CA 4BR2A 2MH9A 4XRMA 3CM5A 3JRHA 4JKGB 2FA5A 3KYLA 1DGKN 2F4OB 3AO4A 3CQ8A 3UB5A 5KQDA 3ML6A 2XV4S 1UB9A 3ZMSA 5BPIA 1HQUA 4O5BA 5DS9A 4EM2A 4WWCA 2UUAK 5IT3A 3D0SA 1WAFA 1B72B 1D8JA 3DBRB 2RQQA 1HRHA 2ZNYA 4NCBA 3AVAA 3CXCM 1KVAA 1QSYA 5JVGL 5EF6A 5KCMA 4LSLA 1U78A 1ZBLA 4K8XA 1F21A 2Q1ZB 4KB0A 3R61A 2HQNA 3AA2A 2B6AA 4NC6A 1QHAA 3BPXA 3QB0A 5LMUK 3E01A 3ZMVA 2X78A 2RV8A 1OH8A 3U6FA 3ASNH 2W84A 2NRRA 4JI2K 2IAJA 5GAHP 3GLXA 4BNCA 3MKYB 2O9LA 3GFJA 4FOIA 4GDFA 3M4OJ 4FJ8A 1E0EA 1D0XA 2GV9A 4IWVA 2DA2A 4F9OA 4I02A 3FXQA 2WTEA 1WOQA 1F1ZA 2IXSA 4KN7X 3DMJA 5LY3A 3MCZA 3TEDA 3KK1A 1Y56A 2P0WA 4NCAA 1X2MA 3HM5A 1W4MA 2E2JJ 5EXWA 4HQMA 4M7YA 4U87A 1NGHA 2MC3A 4JAXA 2A3ZA 1FP2A 5KRTA 3E9PA 3PO5A 4BQZA 4DQ2A 2V4JC 1TKXA 4PSWA 1F5TA 1N77A 2TCTA 1AU7A 2XGEA 4GCVA 4YOWA 4IOCL 1XMAA 3HZJA 3K9JA 4XIDA 1R4NB 4XKWA 3AA5X 4DOZA 1P8ZA 1R1UA 4IBNA 2AQFA 1G3TA 1NK3P 4HVJA 2ETJA 2KFZA 4CBUA 2ZBKA 3EUKL 1D0ZA 1T2KA 3QP5A 1PYVA 2FJ1A 1MIJA 2MGQA 5ILUA 2FF4A 3ZN1A 3T1HK 2CQKA 1JJ8C 4FPBA 2ISYA 4H5RA 3DBLB 2QEXI 3V8KA 3P1GA 4XIUA 2ZMEA 4CJSA 3BROA 2Y9YA 4UUSB 3G73A 3WTXC 1T7PA 3ABKH 4IJNA 4CF2A 2I10A 1H88C 4G12A 5DCMB 2JA5J 2JVHA 3MXIA 3CERA 2QEXN 5TRDA 3E1SA 3TOBA 4AHTA 3E5XA 3LAPA 2JVGA 1FBQA 4XMYA 1ZGJA 1X58A 2R7OA 3HPOA 4M9ZA 4JKBA 4FM0A 3LP2A 1X1CA 1OR7A 3B73A 4XRFA 1P4AA 1KAZA 1X3UA 3BTCA 1SV5A 1BOBA 4RAZA 1RT5A 2IP2A 4A93J 3F9KA 3D2FB 5AQUA 5LHGA 4JHDB 2OPQA 2EJRA 2LOOA 3TGNA 4EGZA 2RN2A 2I8DA 3LAKA 3SBTA 1W97L 3DXMB 2W1OA 2LY1A 4OLBA 3VWBA 2NVXJ 2F4VK 3BG9A 3GW2A 5KQ8A 2EZLA 1WSEA 1EXQA 4WYBA 5J6XA 1HUXA 4GKKK 3WHCA 4II3A 3RKYA 4PFPA 3G2BA 4M3ZA 1S9GA 4RW7A 2ASPA 3MECA 4D1QA 2CV0A 1S1VA 3DKXA 3AAFA 2XHBA 2FMYA 2VJJA 4F93B 2F5CA 4UVBA 5IT9Z 2HHQA 2MD0A 3I71A 2HW3A 3OYFA 5FLVA 1TTYA 1ZG1A 2QM3A 2VONA 4Q0BA 1WSJA 3IKTA 1W0UA 3DOLA 3OBYA 1SFKA 5B66C 2G8IA 4BE0A 1X1BA 5KI6A 2OPTA 1U9NA 4YOXA 1JUPA 4CGFA 1S3XA 2IRFG 4ASNA 1YO5C 2P5KA 3SQ2A 2BH1A 1ZLKA 1BI4A 4MTDA 2CH0A 5L3CA 2H1KA 5IP6A 1BL0A 4JEPA 3MKLA 3I9V2 2QTDA 3M8QA 2RF2A 2M7AA 5DM6L 4FWKA 5GAEJ 3N4MA 3RI4A 4G7ZF 3ZT4A 3O3FA 1L5UA 1VSHA 4B8CA 3OIQA 3MVPA 3C6TA 3DI6A 3I4NJ 4OWRB 5LL6Z 2ZJPL 4KFCA 2R7VA 4FOEA 2V9VA 3GFMA 4ENKA 3HTUA 2M34A 1OYIA 4DTRA 3U2RA 4A5NA 4M72A 2NRWA 1NK4A 3GFLA 3TDZC 2H8WA 3PX4A 3WU1B 1BQMA 3S17J 2OYQA 3CC2I 5K5RA 5DDGA 4Z4IA 3C2HA 2HMPA 1STZA 4DR1K 3MXMA 2HVRA 3FE1A 4FWSA 5E1XA 1W5CC 4CEDA 5E26A 3GE1A 2OV7A 3J7YJ 3KYDB 1LDKB 2WTUA 2WBMA 2A41A 1U2WA 3CC2N 2X1DA 4PSXA 5BPDA 1AKHA 4X66K 2F5DA 2CRGA 1FMWA 1OVQA 1WJDA 1JUSA 2UXBK 3NE6A 4JS5A 1TUYA 4LFAK 5FFXA 3KD1E 1FSEA 5J1YA 4CJQA 4HUGA 3EPZA 1NK2P 2H3GX 5TISC 1QPMA 5BR8K 3ZXSA 1GLBG 1IW7F 1FEXA 4N4NB 2QGUA 3P9CA 1GLFO 3L2RA 2MYSA 5A2QK 1J75A 1XUPO 1O3QA 1R22A 4CEFA 4XLCA 1KSPA 2M4KA 4BRAA 3QICA 3I5UA 4B1RA 1ZN2A 3ZQIA 3ESWB 4A0ZA 1S6LA 1ITYA 1SD6A 4BRPA 1LB2A 2GA1A 4DV2K 2FBKA 2ZMEC 4OIPF 3ZLJA 3KJVA 3BWGA 3KZZA 5AQFA 1REVA 2WAFA 3V42A 2L0KA 3T1YK 4H4OA 4XH5A 3T1BA 2W4SA 1XWLA 3CMEI 1VI0A 4XNFA 2BYVE 4XSXF 5KHDA 2X4HA 4CI6A 4HWIA 3G10A 3HUGA 4KO0A 1LE8B 2LKXA 1E3MA 4JI1K 4GW6A 1LCUA 4YELA 1MZBA 3DLKA 3CMEN 2EB7A 2BHZA 4JI6K 1J2XA 1OCPA 1OR7C 3K70C 1ZKGA 3K4JA 2Y30A 1YX3A 4MTEA 2BE5F 2DFHA 3CCSI 4AIDA 2KISA 1Z67A 1FY7A 5GPCA 2EFPA 5EGOA 1IKWA 3TANA 3CMMA 2VBYA 4XKCA 4MIMA 2O4GA 3CCSN 2OPSA 4BRHA 4BEHB 1W2BM 2XB0X 2O8DB 1VQKI 1F43A 4NNJA 1TV6A 3PIPL 4ZDPA 2KQ2A 3NQOA 5EVZA 4W97A 1BW5A 4UB8C 1UAXA 3CO6C 1NWKA 3O8MA 4YDUA 2Q36A 3FZVA 4KAZA 1YFHA 3H1QA 3T7ZA 5LLQA 2DTRA 1VQKN 1A5VA 1ZQ3P 2FNPA 3HK2A 1UFMA 1X1PA 5JFRA 3R9PA 4P9FA 1C0MA 3QFPA 1YIOA 2LC2A 4BAYA 1WAJA 3VA3A 2VODA 2KRCA 4IFEA 4B3MK 1WN7A 4YFXF 4GYGA 1VQ6I 4HA8A 3FGUA 4QOZB 3JTHA 4HTUA 2UXNA 1ZBSA 3TAQA 3BTJA 4CXFA 5F04A 1D4XA 1RDWX 1P7IA 4DU1A 4A62A 3CDLA 4DCHA 1CZBA 5LHHA 3CLOA 1GLJO 4JKCA 3VQAA 1VQ6N 1MMDA 2IJLA 2P7CB 4FZXC 4PJNA 3CJTB 3DXJF 3V9XA 5KPRA 3DLEA 5AIQA 3AG1H 1E3OC 1LEBA 1LFUP 1GOAA 1FOXA 1DPRA 1W5SA 5AQOA 4QTRA 3FZLA 4EV0A 4RS8A 1IO2A 2ZJRL 3AFHA 5CHIA 3AVHA 2NOJB 3CF2A 3SJJA 4FJHA 4PA1A 5J1RA 3L2VA 4BRLA 4LB6B 3PY8A 2M2EA 2HOSA 3M8EA 3RJPA 3ZSXA 4BWMA 3BT9A 3ZOBA 2XGXA 3U4LA 5J47A 4FX4A 4DV0K 1JJ6C 2QSFX 3IUCA 5D4RA 3ULQB 5M1QA 2UUBK 1E4FT 5ICEA 2X48A 4CZCA 1YE9A 2BY0A 3ATVA 1S29A 1HBXG 5AQTA 2X6OA 5AIPA 1GLAG 3ZR8X 1NK7A 4B9VA 4GFBA 1NJIO 4DF4A 2D2WA 5FPDA 3GX4X 2MFZA 4BC3A 2E6MA 2I5UA 3B6OA 3MX2A 3RMBA 3HRGA 4OU0A 2E2QA 2HHXA 2FUG2 3FZFA 1C1CA 1S6PA 2WA0A 1NGBA 4BBSJ 2LY2A 5DCFA 1HNVA 1OH5A 5L3EA 3SBGA 3DF8A 4EFHA 4ID1A 1D5YA 3P9IA 3DEWA 1EA3A 3AG2H 5FPNA 3QPLA 3S14J 1YITI 3MN7A 3M9AA 4HX8A 2ASMA 2QZ8A 5FDLA 4DQPA 4IO9F 3CJ7A 3SUNA 1U6ZA 2P9SA 1ZAOA 1NJXA 3THWA 4AM3A 1A35A 2ATQA 4DBRA 1MBEA 3HPHA 5AQMA 1GDTA 1YITN 4MLEA 3ECOA 1TK0A 2FOKA 4EJVA 2EHGA 4H5WA 2IW5A 1MNDA 2EV0A 4B48A 4DR2K 4CK3A 4H5TA 2E8AA 4IEJA 1HXDA 2OF7A 3ECHA 2QWMA 4AHUA 3WTTC 2WY7Q 3ASOH 2V1UA 2Y69H 2EX3A 3KKRA 5E84A 2K9QA 3R6SA 3AVGA 4B1XB 4L9JA 4FK2A 1RETA 1IN8A 3H3NO 2E2PA 2CFXA 4MDBA 3S3MA 4C8MA 5M1FA 3WEEA 2CG4A 2V1DA 5LJWA 3NF9A 2M5WA 4M6XA 4MO4A 2M30A 4L9VA 3C6HA 5AZJA 3R4KA 4MHGA 4CVNE 1RUOA 4H5VA 2IA1A 1XC3A 2EA4A 4DTMA 2O8KA 1RPWA 3AVKA 3VSLA 1YI2I 4CICA 5M5WJ 1QBJA 4DG1A 1YRNA 3L9FA 4NCGA 1ETOA 1VRUA 2W6LA 3QOEA 3CC7I 4OAZA 3HGGA 5MLCQ 2QUFA 3BZCA 3ZT2A 1TZLA 1OYWA 3V7SA 2KIUA 5FFZA 2RPIA 3LWLA 1JLFA 2ECCA 2JSPA 3I0RA 4YDUC 1YI2N 4CK2A 4I76A 4GO1A 3CC7N 4XRSA 2JQ7A 4RLFA 3QU3A 3CJCA 5GAHJ 1NGEA 3S1RJ 4JLHA 2Y31A 3FM3A 1Z6RA 3VQPA 5FLXZ 4B3AA 1I3QJ 3K1NA 3QPTA 5IWAK 3OOUA 2GXGA 4LK0F 4OGCA 2V7FA 1T95A 2QBYB 1K73O 1J9IA 1JHHA 2XGDA 1Z7LA 4C8KA 4CZZA 4L5EA 3IH2A 5TJJA 3NF8A 2NNYA 1CLQA 3QYEA 4IQ4A 3K10A 3LQQA 3K2ZA 2UWMA 2M45A 3CM6A 1FBSA 3L2UA 2V6EA 4M9XA 1W9HA 3F9MA 3LSRA 5M1PA 3OIPA 2A6AA 3A03A 2HHWA 3ZQFA 3I59A 5K7ZA 3FZMA 3THXB 1RILA 3QEVA 4HBLA 4V2FA 3GYHX 4A3DJ 4FJJA 1SFUA 4OKKA 4JKAA 4B9UA 5E8IA 4IF4A 2WV0A 4IEEA 2E1NA 5E79C 2LBFB 4BC5A 3VEYA 3HYIA 3RYRA 3IV5A 3DLGA 1FOKA 2BANA 4BQOA 4WFBL 3TPQA 4Z2YA 1B92A 3OYEA 4H5NA 1GXPA 3KWIA 1IG9A 4Q47A 1XSVA 3FHNA 1KA8A 2HQRA 3WE2A 4N4OB 4FVUA 2RHKA 2ZE2A 3LSPA 4ZDOA 3QBWA 4M3BA 2VG6A 2ELJA 1F9NA 4Y0WA 2A6TA 4U0VA 1DU0A 3D5LA 4F55A 3ZX3A 5TKYA 4EGYA 1SL1A 3FISA 5FROA 3IMXA 4V2GA 2KJBA 2GBZA 2A5YB 3QERA 2BXYA 3THYB 5L3BA 2Z33A 4F3OA 2HBMA 4DU3A 4FL9A 5F0CA 2FBTA 4F7ZA 2M1BA 2DOFA 2FXUA 1SD5A 4G6DA 1FYLA 3DTKA 4ZYEA 2Z1IA 3SUPA 2UZKA 4GV6A 2E20A 1RKTA 3F8MA 2BGGA 2M0MA 2MBFA 1GLCG 4JP0A 4IDHA 3PSIA 5KPTA 3MMVA 1MH3A 3BR0A 5GINA 2DODA 3SEZA 3MXJA 3O8HA 3F72A 1BA1A 3DBHB 4AU7A 4OMYA 3ATUA 2GUIA 5F2RA 3MK6A 2NS8A 1PUEE 3LANA 2VB6A 5I3UA 1IZ1A 1ILYA 4CCKA 2DPUA 5C12A 2QKBA 2QI2A 4BKXA 1RT1A 4KHSA 1RDBA 5C0YA 1LNWA 1TL8A 5J3LA 5F0XA 4IPAA 1J53A 2XAUA 3ZSWA 2JN6A 5JLFA 2ZXIA 3MAQA 2W24A 3LFKA 3I55I 4A5MA 3RCOA 5D5WB 2IA2A 4ENNA 1VQPI 1R9TJ 2ZXJA 4LF7K 3TP0A 3RMAA 4IXAA 4CGZA 3TSQA 5AONA 1WSGA 3HM9A 3SDBA 1R5ID 2RKHA 2RDPA 5FD5A 5M1OA 1NGJA 1T05A 4YOUA 3ZSOA 3I55N 3G0ZA 3VEPA 3WTVC 4XOPA 3J80K 4FW2A 2HTJA 3KLGA 1VQPN 4HCBA 3K1MA 4A3CJ 4DYCA 2P9UA 1B9FA 2ZGZA 3HOSA 1X4OA 3Q5FA 1XSXA 2PG4A 4CJLA 4EQQA 3AY9A 4CFAA 1LAWA 1HDDC 2F7TA 3KFWX 3RQ4A 2CQQA 1RRJA 1NHAA 2RAEA 4CA0A 3OYHA 3CYMA 3EYIA 1BA5A 1V5FA 4XLNF 3A2FA 3HSTB 5HLFA 2QYOA 4M6VA 2OTLI 1TC3C 1SMTA 1TVRA 3V4GA 1JXBA 2CQ7A 3QU6A 2F48A 3DM2A 4L18B 4K2EA 2NRZA 1IH7A 3VOVA 3MKWB 3DP7A 2OTLN 3ONQA 2W48A 2IS1A 1BGXT 3UIQA 2UYTA 1L3VA 3HVTA 1O57A 2GBYA 2WONA 2YV0X 1NKBA 2OU2A 3DXKB 4JRPA 4EP4A 3K2AA 3C7JA 3W6KB 2JGUA 2XKOA 5F08A 3KK2A 4NBQA 4JI8K 1C1BA 1GUUA 4BR5A 4XEIA 4XLEA 4Y1CA 1W0HA 3F8CA 5LRRA 2FSKA 5FLMJ 3K58A 1V4RA 1WJCA 5DM7F 3OA9A 3ZX2A 2HDCA 5EEHA 4AHCA 2KPMA 3IRQA 1FJGK 1S7OA 1QSSA 5L3FA 2CUJA 5K7HA 2RN7A 5AJ3K 3TO9A 1UA1A 5M3MJ 1JCFA 3E9OA 1M1KO 5E3LA 2DI3A 2QWQA 2FC0A 1BJZA 4PHTX 5KRSA 2PFBA 3LDQA 3GOIA 4IO9L 5JHUA 2E1OA 4IQJA 3FZHA 3AAQA 5EU7A 2IVOA 1C0TA 4II2A 4LFUA 4I2OA 2DT7B 2DFFA 5HDNA 3TAPA 1N6QA 1A36A 5L3DA 3FXRA 3E1YA 1PDNC 3HPGA 5EZGA 4GVEA 4OX9K 1ZRDA 3DAWA 4X64K 1ODDA 2XY6A 2YHYA 3J81O 3IRXA 2O6GE 3V6DA 3HYFA 3HRTA 1W36C 4CJ4A 2XIGA 4I0BA 1USSA 2IA0A 1ZG5A 1U5TC 3TW6A 2R7UA 4FQGA 5BRFA 2EZHA 4BQAA 2HHHK 3U21A 1QNTA 1HLUA 1JI8A 3P4IA 3CMYA 1S7AA 3H36A 3R3LA 5F64A 3BEXA 1NH3A 2OZSA 4RB1A 2X51A 1P6RA 2W82A 2P9IB 3KLOA 3NH1A 4ENJA 1REPC 2RNGA 1NGFA 1S1WA 4WF2A 1XMOK 4Y33A 3DQVC 2JTVA 4FVMA 1U4BA 5EJCA 4G7OF 4KN4X 1SUQA 5KPZA 4NDLA 2XASA 1HKBA 1R5GA 3ID6A 1MDMB 4ILHA 1G3YA 3VOEA 4GY2B 3VA0A 4LH4A 4CZEA 3H3OB 2Y0SN 1JT6A 3NF6A 4CGJA 2DY4A 4EATA 5F6FA 1DGRM 2PQ8A 2HEOA 4AM7A 1X3WB 1BL3A 4FJ9A 1QRYA 1QHHD 5J8CA 1JGSA 1VQ4I 1DTTA 1S6QA 3FMQA 4KV8A 2VASA 3M3ZA 5JVHL 3OBWA 3DWLA 1YS6A 2P9KA 4OKJA 3HL2A 3AO2A 1KQSM 1UMQA 4QPOA 3LMMA 4AHRA 2L7MP 1LUJB 1VQ4N 1HW1A 2MABA 2E5NA 1R71A 3C3WA 4FYDA 1VSJA 4KYWA 3HG9A 2Z1HA 4HF1A 1ASUA 2X6SA 1X4PA 3PQJA 2ZJQF 3WXLA 2L9VA 4ENMA 1QSLA 2HVSA 5AQXA 5AQIA 3DPTA 3FXJA 4LOCA 1ESVA 3HP9A 2K02A 4E7LA 2QQAA 4CUGA 5BPLA 3O08A 4MLOA 3PFYA 4L5IA 3N05A 3A1YA 5FKKA 3CTAA 4WE1A 4M3RA 2IS6A 5C2DA 3VYSB 3MZ8A 5I42A 1T0FA 1QTMA 4Z4FA 1WKMA 2KZMA 4A3IJ 5LGTA 4A3GJ 2YSRA 3HKZN 3BR1A 3ABMH 1Q81O 3O9UA 2JWKA 3TTCA 5JS2A 3VQ4A 1C0FA 2BHYA 2ID6A 2VOPA 2QQ9A 3THVA 3UKUA 4PJ0C 2HNZA 1SC7A 1BI1A 2R93J 3ZMDA 3SI6A 3C65A 3HOVJ 3OW2M 2H6CA 1W0TA 1YAGA 1CF7B 4RWTA 2WWYA 2ZXWH 1KLNA 3H45C 1I6HJ 3LM2A 3W3CA 2PI0A 3O1WA 3HT3A 2KRHA 1OH6A 4O0JA 4IVNA 4OKEA 1FYMA 3DYAA 1TWFJ 3TAMA 5JLHA 2M3AA 1GOCA 2NVTJ 1BBYA 3X2QH 1RNHA 1QS4A 3Q9VA 3L0QA 4A3LJ 3CI5A 5JICA 3EUHA 6PAXA 2R92J 2HB5A 3ZQCA 5HLGA 3VGMA 4CK1A 3V7RA 4OOIA 3HC7A 3T5XA 5FLXO 3NWSA 1TWGJ 3VEXA 2E2HJ 3ZCOA 4CDGA 3SZGA 4YHHK 2XF7A 2D0PA 4B44A 2DMUA 4HOBA 1ATNA 4GV3A 4IRGA 4CZHA 4OPJA 3VTHA 1YVUA 1T08B 5ICCA 2O8CB 4XN0A 1UHMA 4WK8F 1BOTO 3D7EO 2LREA 3PUFA 2HVQA 2DTZA 4LSNA 1B8IA 4BC2A 4WCGA 4ETSA 1TKTA 2QWPA 1FBUA 3VTIA 1XDUA 4RA2A 2QK9A 1QZ5A 4UVAA 4F3QA 3CF5F 2D0CA 3WTZA 1TK5A 3FK7A 3QINA 2HQ5A 5LJVA 2GAUA 3CFOA 4P55A 2ZB9A 1JUMA 2VWKA 1LAVA 2OJED 1SANA 4R79A 1QVFM 3LDNA 1IRFA 5KK1A 4CGGA 5CQEA 3VQQA 3NGYA 3UR3C 4CHNA 3JRGA 1TYQA 4XQFA 5SWMA 2HVIA 2CSOA 4LITA 5L3GA 1X1DA 4KIFA 4O5VA 5FKLA 2IS2A 3R60A 4KH4A 1ASWA 1GHCA 3K69A 3KYCB 5HP1A 5FKOA 4FT8A 4F8RA 4ISGA 4C2TA 2HOAA 4AIJA 3L09A 1B9MA 2FBHA 4M42A 1D3YA 1RBUA 3C2BA 5B8HA 3BY5A 1JKPC 2JWLA 2QXFA 2P9NA 1VHXA 2LDUA 2RGVA 4UV8A 1IJJA 2A5XA 3E97A 4HPQA 3RSEA 2JMWA 1KTQA 1T8EA 3VQ9A 4DNCA 2VQFK 1QZYA 2TDXA 1MW7A 3GBGA 3HSEA 4LMYA 2OPRA 4ISFA 3HBLA 1O3SA 3GZ5A 3TBIA 3QPHA 3S3OA 1CXUA 2OC6A 4DSLA 2Y0MA 3CUQA 5LRSA 3VB2A 2Q2EB 3PO2J 4RAGA 5ED4A 1P90A 3TTFA 3SFZA 2MG4A 3P83D 4BXXJ 4DQSA 1I39A 5DD4A 2GELA 1KVCA 2GUPA 2R5ZB 5F27A 3DLLL 4Q5VA 5D5UB 2ISZA 3MEXA 3G25A 1K9MO 3GTQJ 3H5NA 1NJWA 1W7PA 2LF8A 5HOOA 3P7NA 3LAMA 1X19A 4I2QA 2L7KA 3NGZA 1ZELA 3V9ZA 2FSWA 1KQ0A 2BVMA 1NGAA 2KL4A 3EEQA 3NRVA 2QKKA 3FKIJ 3HEFA 4MEXF 3DKWA 4IJAA 3KX2A 4X1EA 4W5QA 5JVGF 3NAUA 4MO5A 2H27A 2E19A 1WI3A 3TO7A 2EILH 4E3SA 3RTRA 5DUKA 1WJAA 2CUZA 1XG1A 3SUQA 3PX0A 2DFEA 1BIAA 1HF0A 5CY4A 1ZBHA 2A61A 3SJMA 2VKEA 1O3TA 2AS5F 3CC4I 2M8EA 3ULDA 4LFCK 4LD0A 4DV3K 3ERED 2DT5A 1MDUB 3Q3SA 2K3FA 5E18F 2W7NA 1Y8RB 3BY6A 1N32K 1LW0A 2ICWG 2EQRA 3HHGA 4UY8I 5LFAA 2O0YA 1K8KB 3EUHC 4XL9A 2QWRA 4BGDA 2DMNA 3LZIA 5SZTA 4OAYA 5D5VB 3PNYA 3RKXA 2ZD1A 4KIGA 2QWNA 1IGNA 3CFPA 1XI1A 4FM2A 3ABLH 1EH6A 2CUFA 2Y1JA 1LWFA 5I9EB 4Y4RA 1KAYA 3UKRB 3FWEA 3S1NJ 4WX9A 5J2PA 4GYIA 4N0BA 3CJQB 1B4AA 4I7FA 4YY3K 2EINH 3S3NA 2PBIA 1Y1VJ 1N78A 1KQ8A 3E9LA 2ZJ2A 4KPYA 4F2RA 3ZSYA 1YF5L 3OOPA 4YFNF 2PMUA 1DEJA 1NM1A 2NLXA 4DQIA 1K79A 1C0UA 1AHDP 3ISNC 1T6CA 1FX7A 2E2IJ 2L9SA 1ZH5A 1KVBA 4C8OA 4IOCF 2X9DA 1X9JA 5FPMA 4DKWA 2VG5A 1IRXA 2DYRH 4LD5A 4RCHA 3HTSB 2D0OA 2D1VA 5K7FA 3NAEA 2HYJA 4FE4A 2KKOA 3FXMA 4CYDA 3F8BA 1H89C 3N4PA 2G8HA 3GMEA 4BVOA 2JA6J 4XR6A 4C23A 1MSFC 5AQSA 1TK8A 1JLGA 4M45A 4GGGA 4CSWA 3CLQA 3MN9A 2LH9A 5KAFC 4BYYA 1R7JA 3RZOJ 2ZCWA 4RM3A 3CCJI 4BE2A 1ZG3A 4Y7NJ 3QEXA 1QA6A 2MW8A 1D1BA 1SVOA 1FKOA 4AF1A 2DU9A 2G9WA 3CCRI 3TQNA 4HNUA 5CE3A 1IN5A 4PKGA 2A5WA 5K14A 5LD2C 3CCJN 2CW0F 3K5LA 3S41A 2M87A 2E36A 1VQNI 3CCRN 3LP1A 3BG3A 4U67L 3O80A 2LRDA 1ZR4A 5CYQA 1RTJA 3JAMK 4RBOA 4DTXA 1XD7A 1VQNN 3K0SA 4JNEA 1T3VA 2F8TA 4GMJB 2DT6A 2CH5A 1Q8IA 3C94A 3KLIA 3SAGA 1X9SA 2FF6A 4L0ZB 1APLC 1NBWA 3D0PA 4B9SA 1HOMA 4RAFA 2VQCA 2VQEK 3BR6A 5CVJA 3BDPA 3CUQC 4AYBA 2YJFA 1VSMA 4K43A 2I5JA 4E1MA 3KLEA 1J59A 4BRDA 2UXXA 4N9HA 1HSJA 2EFNA 2FQ4A 4LG0A 2FMLA 4FE7A 1FJLA 3TI0A 4CJ3A 3IRRA 5E8GA 2E34A 3CCMI 2HKXA 1EX4A 4ESFA 1Y8QB 4WXHA 4AVPA 3HJEA 1QVTA 4FSVA 3L1PA 3GZ6A 2DA7A 3WTYC 1NK6A 4XK4A 1WCMJ 3J7ZI 1ZHFA 3CCMN 4YNQA 2F9TA 3NCIA 2VKDA 3B02A 1FPQA 4NQWA 3D5SC 1XCBA 2FX0A 4YIFA 3HOTA 1ZLJA 3KLFA 3WODF 3BQYA 5BN8A 2FQ3A 2AP1A 3CF5L 5DM6F 3DLHA 4LF4K 2N8GA 3UNGC 4IHXA 3LM9A 3NH2A 4XRSG 2E7WA 3O6BB 2CW7A 4AQYK 1UCRA 4LF5K 4B9LA 4J19A 3WQUA 1G2HA 1EWQA 2JK3A 1S1XA 4KJZA 1GVJA 3AVFA 3FHZA 4M74A 3E6DA 3VYTB 3LWMA 2P9LA 4MEYF 2IPQX 4DV1K 3JSMA 5CVIA 1VTNC 2CQXA 1Z05A 1FZPB 3CJNA 4UVCA 3ZT0A 2HNYA 4IOAL 2XDVA 3IKVA 2VQLA 3UE5A 4FWNA 1HNWK 1MSEC 3NF7A 4PCQA 3FMRA 4EHTA 1DQUA 1NJYA 3AGKA 1MA9B 4JX5A 4CZKA 2PFUA 4DTNA 2W57A 5ICFA 3HGYA 3RRHA 2HMIA 3HRMA 4A57A 1VF9A 4CF8A 5BNGA 2IGOA 4IFVA 4XLFA 1WSHA 1DGWY 2OA8A 3GVAA 5AZIA 1IBKK 1LWEA 2KLOA 2JLEA 1VRTA 3RR7A 3S1MJ 1IKVA 1JKRC 1QQMA 3LAJA 4DV5K 1Q9XA 2A05A 2X6WA 3BR5A 2VT2A 3ASMA 4CJKA 4ZTJA 3TWHA 1H0MA 2BE2A 4C3JJ 4EJUA 5FJ8J 3S16J 5ICGA 4I6MA 4R8HA 4B8XA 3ZMZA 3QBXA 4BRIA 4K41A 4QLCU 1SD4A 2UUZA 2ZWHA 4OIRF 5BRDA 4Y13A 3RR8A 2R3SA 4HDUA 4DS5A 5BREA 3Q7BA 2OAZA 4JYAK 2P6SA 1OH7A 2B0LA 2R5YA 2LKSA 3LSHA 4EEFG 4CF0A 2D4WA 1IUYA 1RDDA 5LHIA 1B59A 1JLAA 2HBLA 2OPPA 1M90O 5HLHA 2HPIA 2G8FA 1Q7YO 3KVGA 3C7NA 1KAXA 1U49A 5D6FA 4ZJZA 2DA3A 3NH0A 4AD9A 4BWJA 2UXCK 2B4JA 1IKYA 1NG6A 3MWTA 1E2XA 3VYRB 1MMSA 4JS4A 1Q1VA 1TGOA 4O8UA 2E7XA 4XH4A 4JKHA 2HS5A 2ZFWA 2O8BA 2O03A 2ZMEB 4RGUA 2X6XA 4I98B 3VF4A 4RW4A 3K1PA 1WRJA 2BDPA 4UY8O 1WJFA 3D5RC 3TSUA 1TKDA 2Q1NA 2GWKA 3ZN0A 2WC9A 2VQGA 4KT6A 3CCLI 4X6AJ 2KQRA 4JI5K 3FIWA 3FXKA 2O4IA 2YJEA 4HSTA 4CJVA 2D5RA 4C3IJ 1JCGA 4ZYHA 3PIPF 2PJRA 1NMNA 2GXAA 1TWHJ 1PUFA 3CCLN 5JHFA 1VSDA 5AQRA 4XLPF 3SEQA 4RW6A 1JL2A 3TP3A 3H9GA 1V54H 5CYVA 3MWPA 3ZMUA 5D8LB 1E4GT 2L02A 3QYFA 2L9NA 3IAS2 1D1AA 4YFUA 1QQNA 4HW0A 4C2MJ 1J5OA 1A5JA 4DQQA 4A59A 4CECA 3WE3A 2XROA 3IFRA 4E0DA 1KFSA 2W85A 5C10A 1TQMA 4PY5A 2DFIA 2D1HA 1WUAA 3IL2A 2BXZA 3K4BA 4AWXB 4BHPA 3WGIA 1FT9A 4AYBN 3DWLE 2M4GA 4RG8A 4Z94A 2LP0A 1U8BA 2QLZA 2QWOA 4DWIA 2E35A 4G6TB 4FJLA 3NVMA 1RDUA 3OMYA 4KMUX 1E3HA 3A0BC 1S1UA 4DLEA 1I1SA 3BTLA 2NUBA 2Y75A 3HXMA 1Q82O 3F2KA 4XN3A 2L2OA 5HDGA 3MX5A 4DSKA 3WGGA 2GEMA 4MO7A 2IBDA 4JYKA 3M1FA 3A01A 3VPRA 3HOYJ 4O3MA 2MSYA 4IZZA 1ORKA 5AQYA 1BI4B 1T56A 1NNEA 3WTUC 5E1ZB 4JKDA 4JD2A 1BN5A 2BZTA 3Q9SA 1I1GA 1N25A 4B9TA 1GV5A 2ZJRF 3CZ6A 4EZ6A 3T8RA 1PP7U 3CJBA 3DLAA 3A5MC 1WJ5A 4NB5A 1ZBUA 3M6GA 4DZJA 1IG8A 2YX7A 3ALYA 1QHTA 3H0GJ 2VXDA 2D1KA 2KIQA 4DJAA 2JPCA 4B1YB 4KMFA 1TW3A 1C1AA 4CYCA 3AVIA 3HBTA 3S2HJ 1LJ9A 4AUXA 3CUOA 2CO5A 4A3MJ 2ASOA 5HS9A 3KEOA 3HHHA 4YIIA 3VGKA 2XRNA 4DV7K 2VGMA 3RMCA 5HNFA 3WNGA 2M9HA 1ETKA 3PL8A 2F8SA 3TKYA 1U2VA 2L9RA 1VFCA 1IC8A 1RGIA 3BJOA 3DTIA 4OMZA 4Q48A 1K78A 2P1JA 4M71A 4V19S 4EVIA 3QODA 1KD1O 4NXMK 5EX5A 3BJ6A 4AM6A 4B09A 1MD0A 2K9SA 3E3VA 1WGXA 1GOBA 1NMDA 4YOVA 1AKHB 4C2UA 4DW6A 4DFKA 2ZF5O 5HBMA 2VJ4A 3CIPA 2VI6A 3AKZA 1EF4A 1XHXA 2HPMA 1VSFA 1ON1A 4ILJA 2ELHA 3JSOA 5IYBJ 3WTSC 4EZ9A 4M7XA 2FOWA 3O9TA 3VPZA 5AFUA 2I7PA 2V7YA 1O7FA 3LP3A 5KGXA 4CEOA 5HNHA 4XM3A 5ADXH 2O7OA 5CLSA 5HLTA 4MFEA 5DV5A 4X62K 4KNYA 2UU9K 2IVPA 3ZETA 3QPSA 2JPBA 3AARA 1EO1A 4OJRA 4DIQA 1RTIA 1HYSA 4CCMA 1OLTA 4XBFA 3PIOL 2BW3A 2R7YA 2XO7A 1NK8A 3HUGB 5B5EC 3S2DJ 1BC8C 2XSJC 5BR9A 3CPWM 2QENA 1S9HA 2BV6A 3PO3J 2G8WA 3BDDA 2KLAA 2E2NA 2IGKA 2STTA 3LDPA 3IH4A 3EO3A 4HZFA 4JN4A 4WFAL 3MZYA 2A1RA 2O61A 1V5EA 3QEPA 2LFBA 3KLNA 1RT4A 3SZPA 4P1WA 3AO1A 4ZYDA 4KHNA 2DDAA 4RM2A 4ITVA 3JRCA 4PKHA 3KP5A 4ANJA 3IKMA 1SQKA 3D2EA 2Z1JA 5EGOB 1SVMA 1XN7A 2P4WA 4M3TA 1LFPA 3SDGA 3KK7A 2O8EA 4NUBA 3L3UA 1RR8C 1R0AA 4F3TA 3GCMA 1LEAA 2GLOA 4JKEA 1BOAA 3AV9A 2EBIA 4BQQA 4XKBA 1LW2A 4DSIA 4D5CA 4A3EJ 2KFNA 2PLYA 4DYQA 1XC9A 4BDZA 4JRQA 5GAEP 3I54A 4I6ZA 1FIAA 2VYPA 4PDKA 2RE2A 3V8JA 2M7BA 4DTSA 2GWRA 2L4MA 1N33K 1R58A 4CJRA 1VZ0A 3ZX0A 1KU3A 4RGRA 2VWJA 4Q4ZF 4CHYA 1JE8A 4BR0A 1XMXA 2E6LA 5IT9K 2VG7A 3V9UA 5IP7J 2KKZA 4A2BA 4H0TB 4H0EA 3HDDA 1E17A 5EOYA 3I58A 4XOTA 2IIRA 5EEAA 4K25A 3V1OA 3S32A 2YCHA 3V81A 1MU2A 2DBBA 1TQIA 1EV7A 2D0AA 2UV1A 1XNRK 5HRRA 1UWBA 4UB6C 3M1EA 1GV2A 2XAJA 3LSKA 4GXOA 1SFEA 2R7FA 4CBXA 4CZLA 2XRLA 1BO5O 1S5JA 4G8XA 4EM1A 4YOTA 3TARA 2Y1IA 5C2FA 4V19K 3LP0A 1XGMA 4JQFA 3TABA 1FK9A 1DKGD 5J1EA 3B6CA 2C6YA 4EHUA 3BQZA 3KD5E 3PFIA 1J7KA 2V7ZA 1ZRFA 2H94A 2COBA 4KH5A 3BPVA 3ISPA 3K6GA 3VN5A 1BQNA 4KI4A 1WZ2A 2D45A 2WAQA 4D5FA 5HRNA 1R1VA 3LSGA 3ITHA 2B63J 3DRSA 4ZZDA 2DYSH 3O2PE 4U0YA 3ZQLA 2GX9A 1LPQA 1WBBA 3RPUD 3ULEA 2CH6A 5AQJA 1RKWA 2MLGA 1KYZA 4M6YA 4M3WA 3AL0C 1I6XA 2VC0A 3SZTA 2IVNA 1BISA 2WFBA 5K5OA 4PKIA 1USTA 4DR7K 4FLZA 3PNVA 1TWCJ 4FLTA 4DBQA 3CJRB 2L7FP 2HXIA 1E3PA 4N76A 2CV2A 1XQSC 4DR3K 3MFKA 4KFBA 4B3SK 4O5FA 3JYTA 2OQRA 3W3DA 3IDHA 1FKPA 4FX0A 1XC5A 5IY5H 3L2CA 3F8FA 3GO5A 1NOZA 2BVLA 4L3QA 1FOWA 4KTZA 1PVEA 3H92A 3GTMJ 1SFXA 2KP6A 1AA7A 3F0CA 4CJ7A 4FLXA 3E66A 4C3HJ 4DV4K 5J4VA 4EM0B 1YS7A 1POGA 3JRBA 4B4CA 4BL0B 2YHAA 3QYBA 1T39A 2X74A 1DUXC 2ZSHB 2DLLA 3LDLA 1D0YA 2YNIA 1I5ZA 2OZ6A 1UZCA 4XLHA 4B9MA 2KZVA 3BC8A 2M0CA 1Q86O 1KGSA 2NRHA 1FLIA 2E1MC 1QGPA 2DOEA 4ZHRA 2H1LA 2EH3A 3M1CA 3P5JA 4CGHA 2XF6A 4XONA 3J7AO 4CJEA 2P9SB 3HOZJ 5J1UA 3THWB 4DR6K 2WB1A 4O0IA 3J81Z 3W2WA 3ENOA 2VT3A 4H0YB 4E6KG 4WQ5A 2CWEA 4DSEA 1OCRH 3C1DA 3E7LA 5EY4A 1U3EM 2P5OA 1IF1A 2VJIA 2IS4A 3JR9A 1QHGA 1BJAA 3VQ6A 3H1VX 1G8XA 3A0HC 3R0AA 1CZAN 4CW7B 2FBXA 1HKQA 4HRIA 5H1SQ 5FB2A 4ZC3A 3QFUA 2GWJA 3OYNA 3ROUA 2I7NA 2Y48A 4UXNA 3R0JA 4KHYA 1CZ9A 4XICA 4UHTA 3WEEB 2EWSA 1TT0A 2H09A 5AQNA 2DK8A 3GXOA 1FC3A 3O6WA 5AZJB 2XAHA 1JLBA 1G99A 4U0WA 1KXPA 1VSIA 4B3TK 5LBQA 3ZT1A 3U1DA 1UG2A 4F52A 4PJJA 3Q0UA 3HI0A 1EWRA 1IUFA 3A02A 3JSPA 4E89A 1YRNB 1O3RA 2K9MA 1HA8A 1S1TA 1G3SA 2KRFA 4HUEA 3EQLF 5C24A 4NC7A 2K85A 1GT0C 3TAFA 1TT5B 3NGIA 3PX6A 1HQEA 2JA8J 5M5YJ 3ZSVA 5GIPA 3QESA 1QZEA 3DEUA 1KU7A 3JRFA 4UNOA 4QSHA 4ZZLA 3K4NA 4DR5K 5T7BA 4FJKA 4E7JA 4XH1A 3DJCA 1P4WA 3K59A 3FXOA 3WXJA 3LQRA 1N8RO 1TP4A 4HAMA 2A3SA 5J40A 1KYWA 4HQEA 3KKSA 4JOMA 4CEQA 3VQEA 1D5AA 2LG4A 2XKPA 2GOXB 4QCLA 1WVRA 2WC2A 1ZTRA 1YOVB 1SEUA 4JX6A 3T0YA 3VQ7A 1OISA 4CJ5A 3H6EA 5IPAA 4OVLA 3HP6A 5HS8A 1LV5A 4OO1J 5EG0A 2VJ5A 4EJTA 2Z1DA 2FNAA 5AQHA 3HOUJ 1S7EA 3Q0WA 1P92A 3IWZA 3KPHA 4BUPA 3I59B 2Z2SB 3J81K 3GTGJ 1YTUA 4PL7A 3OL4A 4JI0K 1K6OA 4BR7A 4ZDLA 3DRRA 2G8VA 3AVLA 3HRUA 4HTLA 4YIRX 1BI2A 4LG3A 4DUZK 3FBIB 4D7NA 1QPIA 3KTQA 3RRGA 2BEOA 1RTDA 3OR2C 1QZ6A 3CJ9A 3IHUA 3C6AA 2K7LA 4WF9L 4CJUA 5LGUA 4HX4A 4BVPA 3B6AA 4BHBA 4BRQA 2CQNA 2GM4A 3MQ0A 3CG7A 4W5OA 1ETXA 3FBNB 2YNFA 3FM5A 5DYMA 3AA4A 1ZYRF 5J8FA 3ZQHA 4N41A 4FPAA 3N4QA 4BJ6C 2FSJA 4S05A 4EAHD 2DW4A 3QOPA 3SNNA 1DU6A 2EIMH 2EPFA 2DK5A 2E2OA 4DFPA 4A5AA 3GTLJ 3OYDA 1ZC6A 4FJNA 2QKLB 2YX6A 2RREA 2E60A 4CCLA 3GLLA 5HL7L 1BIZA 2R7QA 3OYKA 3ZEUA 3HSRA 4FK0A 4R1HA 3CJAA 2NS0A 1U9OA 3FZKA 3SHFA 3DEEA 2XC7A 1HR0K 4FXDA 4A6DA 1S72I 2DCEA 1U04A 3SCXA 1WJBA 4NHJA 1GVDA 2YKNA 1YLFA 1HX1A 2DAOA 3E5UA 4XKVA 3WNEA 3P38A 4CD3A 4CCHA 1S72N 2TRTA 1LVAA 4FO0A 4IHWA 2QM1A 1JXEA 4KHPK 4JI4K 2O8FA 3CD6I 4B3OA 2AQEA 2P5VA 4YEJA 4EMSA 4HNTA 2LMDA 2B7EA 2LSOA 2LK2A 1JT0A 4W5RA 4WQ5C 1MBKA 3AVJA 1MJBA 4FJGA 1JLEA 1N5YA 1G6NA 3CD6N 1UAAA 1I50J 2P9PA 3K4CA 1Z9CA 1YJNI 3S1QJ 2E5ZA 4KTWA 3W6JB 4N9IA 1BIBA 5EZHA 2HTSA 4E70A 2FBIA 5ERIA 2O5RA 3K4MA 2ZO4A 3V1QA 2DMTA 5K1YA 3NBPA 4BRGA 4OPAA 1YJNN 1AWCA 1KC8O 2HXOA 5F1RA 3A5NC 1U45A 1HNXK 1XMQK 4A6EA 2WB1N 1W7AA 3BR2A 1YW8A 1ZREA 1BA0A 4ELTA 3HB9A 3P39A 2P9UB 3KHYA 1IDZA 2ME6A 1WBDA 3KLHA 3LZJA 4FM1A 4WXDA 4E1JA 4CERA 1ERDA 2Z3YA 1VSKA 1HQCA 1ZR2A 4YOYA 1YT3A 1S22A 4KBOA 5BOXA 3BOQA 5JLXA 1U5TA 1MWMA 2CW8A 1IG7A 2ZFUA 1QQCA 1FTZA 1OMIA 4BRMA 1R5HA 3B8AX 2L4AA 3EL2A 4RAYA 5IOZA 1WI9A 3HSCA 5CR4A 3W6VA 1D9DA 4JI7K 1VSEA 4KITB 4JKGA 4FW1A 3IP4B 2GOMA 5B1AH 2DN0A 2VKHA 3MWMA 3VQ8A 2EIJH 3CCQI 3SZ2A 1ZYQA 2HBJA 3CDHA 5FLXK 5AQLA 3L4IA 4A0XA 2P51A 3DRPA 1XB4A 3F6OA 5BPMA 2X1CA 1D9FA 1LFBA 1RUNA 4NLBA 1SFOJ 3LOCA 2A69F 1B72A 3CCQN 5AR0A 3OL3A 3VEZA 1L3LA 3AG3H 3U3GA 2V52B 1DP7P 1B9DA 2G8KA 1MWKA 3EDPA 3FXUA 3EKUA 3CDIA 1FXXA 2DOAA 1MNEA 3C18A 1IN4A 5TGTA 2LVSA 5FKMA 3AO3A 3KE2A 1U6GA 2DPDA 4O6JA 2NRAC 3H9JA 2XGCA 1BUPA 2EIKH 2CGJA 3PV8A 4IOXA 4Q5SF 3VESA 4CIEA 4IXCA 3ZQ7A 4ESJA 1XDSA 4DSJA 3ERMA 1WB9A 2E1CA 3IS9A 3BF1A 5FRMA 1QO0D 4BR9A 3JAMO 2CMPA 3EZ5A 4O4GA 5GADP 2DA1A 2F2EA 2VLAA 3U9GA 3KZBA 1HYVA 1DT9A 3LSTA 2YPRA 3SFIA 1WH5A 4HCCA 2X85A 1GLLO 4CEZA 4FTHA 2LD5A 3JREA 5IYDJ 2GQQA 4AILC 1SKWA 4HLXA 4KHWA 2ZSIB 1BCMA 4KTQA 2HHTA 3BG7A 2JUCA 3I0SA 4IX7A 3ZCMA 2YNHA 1L0OC 1T6DA 5CVRA 5HS7A 1IV6A 1H9TA 5AFUH 5FGMA 4E7HA 2HOTA 2NYXA 3K5OA 4DFJA 4ELUA 5A2QZ 3GF2A 3SMPA 1RESA 5ELZA 2MC4A 3T19A 2HFHA 1UOCA 3W0LA 1MJAA 1L3SA 5AQPA 1WJEA 4IZ9A 2NRXA 4PUSA 2PYJA 4L9NA 5CVVA 4J2BA 4MDAA 4BJTA 1ZARA 2ZXHA 4UUSA 1CGPA 3L8BA 3VEVA 1XSDA 1VQ9I 5DCMA 2EV6A 2ESNA 3QIPA 1NG7A 2YHBA 5EEGA 1RIOH 1HSTA 4BG9A 4C9YA 1X9MA 3AA3A 1TW2A 4EIAA 3RYPA 1ZBFA 5JR3A 1TQPA 4CHOA 3T3FA 4B8AB 4CZFA 1MMNA 4IFYA 2P9KB 5DK5A 3GG4A 2KIMA 4IHYA 1BG3A 1VQ9N 4A3KJ 2HVHA 3DLLF 1VQLI 3VQCA 4FCYA 1J0RA 3BCAA 3AG4H 4OINF 4CEEA 3B6PA 2PY5A 2Z99A 1HPZA 4ISEA 2X1EA 3V7CA 2JA7J 1RBRA 3D2FA 2FXAA 2X0LA 4JHDA 1VQLN 3DXMA 4CEBA 2G8UA 3SUOA 4I0AA 4KT5C 4MFBA 1ZRCA 5BRHA 3DU6A 2HWVA 3CFRA 1XTAA 4HUFA 1VSLA 2ZGYA 4B1ZA 4DFMA 3ZGKA 4BG8A 3NARA 1YHQI 5JVTA 5KVRA 1Q18A 4QPQA 2R7WA 2AO9A 1BCOA 3OTOK 1HYZA 3HM8A 4CCNA 2QSGX 4S0HB 1XS9A 4BS9A 2BY1A 3HVRA 3HOXJ 1D5VA 1MBJA 3G1MA 1YHQN 3H5AA 1KQ9A 3TAGA 2XY5A 3CMAI 2F4IA 4Y17A 3J8AA 4E4HA 2E71A 5F1XA 1OQYA 2H8RA 2A6EF 4M9SA 3S9HA 1HMVA 5CJ9A 1TLHB 3JRDA 4CBWA 3UKUB 2NS7A 4HSRA 3GTJJ 3P9KA 3CMAN 3S2WA 5J4YA 4BREA 1L3UA 4K0KK 1LDDA 4J2AA 5DEQA 3Q0VA 2YI1A 1S5LC 3SV3A 1X9WA 9ANTA 3OYCA 1D1CA 2OZMA 2G7UA 4Z6YA 4XSZF 2HF4A 3QAHA 2OTJI 3OYMA 2CV1A 5H20A 4N5SA 1TL3A 3K5NA 4H03B 3ZT3A 2A6HF 3RPQA 3DCFA 2QQBA 2WBNA 2OTJN 2XPVA 2XPWA 4Y15A 4CZIA 2EFQA 1YW9A 1BDGA 2PN6A 2XAGA 2OUMA 2P7VB 4ZYAA 1Z26A 3WG7H 2W42A 4O55A 3NWTA 3MZHA 2HOEA 4DTUA 1HJRA 4BBRJ 4B1WB 2X6YA 2V79A 1SKSA 4B47A 3M8PA 3G1LA 5C25A 3K70D 3DPUA 3L7WA 1HW2A 4CEAA 1B8IB 3AVBA 1BU6O 3H0DA 5E41A 3TAEA 1YVNA 1KCFA 3ZSZA 1EH8A 4GV9A 2KDZA 1JLQA 2ZKZA 5EYRA 1IV8A 2PAVA 4BY1J 3V4IA 2YR2A 4A3JJ 2IT0A 5JS1A 3FMSA 3RIRA 1LVKA 1YIJI 3O9RA 2KMUA 3O9SA 5HRSA 3MEGA 4LB5A 5C4XJ 2AXLA 5TKWA 1U8RA 1G3WA 3MN5A 2QWWA 2JSCA 1TYQB 1VAZA 5CZ1A 4IHSA 4DQ8A 1YIJN 4O8KA 5E17F 2UUCK 3FX3A 2DQLA 4A2AA 2VBZA 4ESBA 1HC8A 5HODA 5K5QA 2QSHX 3BP8A 5ILVA 1T6SA 4MQVA 1NOYA 3EN9A 2COMA 4PQUA 3DPLC 3O5BA 4CE9A 3U1KA 4KHQA 3OYAA 3GUDA 1FYKA 2RKIA 4X0GA 5LEJA 3VF2A 4BY9C 4M73A 1T8IA 3SXYA 3KP3A 2V6CA 3H9QA 2VCPA 4PGHA 3K9KA 4IG0A 4NXNK 5E3OA 3F8NA 2LF7A 2P9NB 4FHTA 3NVKA 2HHUA 4H4KC 5E20A 3IUOA 4K8ZA 2ME0A 2XVCA 3MCAB 1RR7A 1UG0A 4DHYA 3RSEB 1XGOA 3PJRA 2CFOA 2JJ7A 1Z25A 1LE8A 1NGDA 3FK6A 2F6CA 2GIZA 4FZZA 3KEQA 1K4TA 4WQ4A 3QWLA 2BOLA 4X65K 4E19A 2HZTA 3SYTA 1GLNA 3CP8A 5CPRB 2IDOA 2PMZA 1JKHA 5C42A 2Z16A 4A2UA 1HKSA 1H8AC 1XGNA 3REOA 1MBFA 3CUQB 4J2EA 3BLYA 1KRPA 3C6UA 4OIQF 3U9DA 4MQ9F 2XSDC 3E6CC 3RKQA 4NO7A 2NXNB 4BEHA 1U48A 3KCCA 2GXBA 1BW6A 2O8DA 2YKMA 1TAQA 1SKRA 4DSFA 3HL8A 2NZTA 3ZMTA 1PJRA 3QQAA 3OYJA 5CVUA 2KTQA 2HF3A 1W7PB 2Z1GA 4BDPA 1NKEA 3V1RA 3WQTA 1Z0XA 1T33A 3IC7A 2FE3A 2K27A 1H9GA 3AAPA 4MFDA 1HCRA 4KISA 2QA4I 2HZDA 5BQTA 1FMVA 5BPNA 3L6QA 4FWRA 4CESA 3WXIA 4BC4A 4A69C 2V9PA 4CJFA 2CJJA 3K7AJ 4U7BA 2QA4N 2A1SA 4IOAF 1IAWA 2JRTA 5DTDA 2RQPA 4W5TA 4I2PA 1WNSA 4BE1A 2V9KA 5H6QA 1J6ZA 1G59A 3E6MA 3JXUA 1YJWI 2YS9A 1A04A 4RB2C 3KP6A 4BRNA 5ADXA 2GTDA 5F0HA 3OYGA 1YJ9I 3VEWA 4NB4A 2L3DA 4KREA 4H0OA 4UUTA 1YJWN 1YG2A 2IVMA 4Z4EA 4L9TA 4LIUA 3H3UA 3TSPA 1H1VA 1IKXA 1YJ9N 4FJ5A 3VDXA 3SLCA 3RMDA 1Z1DA 2VL8A 1OCCH 4FJMA 5C4JJ 3A5LC 2IOCA 4O44A 5M1KA 1BR1A 1GXQA 4DR4K 4KDPA 2W00A 3R8EA 4FASD 1DTQA 2ADUA 3ID8A 3EUAA 4N56A 3KIOA 1K4SA 3COAC 1HJOA 4ZTFA 1T03A 2MH2A 4OPHA 1JJ2M 1V3FA 3H1CA 2ZQBA 1Z6TA 2F4MB 3O8GA 1A6QA 2KJCA 4W5NA 3KP4A 3OYBA 3O3HA 4DQRA 2X6NA 4HHTA 4CFBA 2QCOA 1RBTA 3SPZA 1I3AA 4G6QA 1SAUA 3I64A 5KAIC 2MLKA 3CHWA 1C0WA 1WPKA 3F3XA 5DMRA 1QQOA 1JL1A 3I8BA 3D1NI 3G6EI 1KU9A 4HF2A 1MNMC 2OA4A 4M3XA 5B3SH 4D9JA 2VGNA 3LPUA 3CETA 3MEEA 3LWFA 2ZM6K 3RQIA 3G6EN 3CPEA 4RB0A 4JI3K 2NOGA 3M3YJ 3WNFA 2R7XA 5D5XB 5IT9O 3K5MA 1JGGA 4CGIA 4LY7A 3VQ5A 1RC9A 1NGIA 4OIOF 4JK1X 3UKGA 3CC4N 2MA3A 2F5FA 3K9TA 3ZP5A 4WQ4C 3I4PA 2Q2RA 5CQGA 2R4GA 4OPKA 1LKXA 5HRPA 3J80Z 5A2QO 1U0JA 1TBXA 4KIBA 2CUEA 5AQVA 1P9QC 4Z4GA 4RLQA 3CJ1A 2K4BA 3WTWC 3FKJA 4YORA 4LLLA 1KFDA 2XAFA 4I99C 1OVYA 4E1NA 3LSJA 3QIOA 1JLCA 5AQQA 1VQ5I 1UHWA 3PSFA 4LG0B 4C1NK 4M3GA 3L4QA 4XORA 4Z0UA 1BR2A 1ETYA 1RNLA 4CHQA 1WSIA 1MGTA 1YTAA 1FW6A 4JBAA 3JRAA 4E7ZA 3M8JA 3GTOJ 2V1XA 1VQ5N 4M3DA 2A42A 2JRMA 3W2AA 2PMZN 1N75A 1C0GA 2FRHA
chains in the Genus database with same CATH topology
1X9MA 3PO5A 3SUQA 3AA3A 4J2EA 4E7KA 1FKPA 2F8SA 4CEFA 1JXEA 4EP5A 1TKXA 1ZBFA 3PX0A 1QTMA 1KSPA 4Z4FA 4CK3A 4CHOA 2DFEA 3T3FA 4B8AB 1UA0A 5CY4A 4B08A 1KRPA 1ZBHA 3C6UA 1NOZA 4IFYA 4CJLA 4B3OA 2KZMA 1NK5A 3NF7A 2IS3A 5DK5A 4AHUA 4KTZA 4CFAA 1WLJA 2DTUA 1LAWA 3IAYA 4PWDA 2KFZA 2P1JA 3I8DA 4DU4A 4DMNA 1NJYA 3LALA 1U48A 2HVHA 2EX3A 5FRNA 3KKRA