1IO2A

Crystal structure of type 2 ribonuclease h from hyperthermophilic archaeon, thermococcus kodakaraensis kod1
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
213
structure length
213
Chain Sequence
MKIAGIDEAGRGPVIGPMVIAAVVVDENSLPKLEELKVRDSKKLTPKRREKLFNEILGVLDDYVILELPPDVIGSREGTLNEFEVENFAKALNSLKVKPDVIYADAADVDEERFARELGERLNFEAEVVAKHKADDIFPVVSAASILAKVTRDRAVEKLKEEYGEIGSGYPSDPRTRAFLENYYREHGEFPPIVRKGWKTLKKIAEKVESEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE HII
publication title Catalytic center of an archaeal type 2 ribonuclease H as revealed by X-ray crystallographic and mutational analyses.
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
total genus 69
structure length 213
sequence length 213
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2000-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 1io2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1io2A01
5KI6A 1T8EA 4FJGA 2IAJA 5E41A 4KTQA 1JLGA 4CHNA 3KJVA 3E01A 2KW4A 1VRTA 3KKRA 5J2QA 1WAJA 3NFAA 1KRPA 3AVKA 3MEGA 4PUOA 4OLAA 4EZ9A 3ITHA 1WSFA 1HRHA 3OYEA 3M8PA 4WE1A 4HCBA 1F21A 3OYNA 1C6VA 4E7IA 1NK6A 4KHUA 4ZTFA 3L2UA 3WNEA 3OYKA 3AVLA 3DRPA 4CEOA 4FJXA 3V9ZA 2VWJA 1QHTA 4NCBA 2QXFA 3DRRA 3KD5E 2LSNA 3B6OA 1L3UA 1BISA 3PX4A 4CCHA 4AHUA 3WNFA 4E1MA 2OZMA 3VQ9A 4QCLA 4NYNA 3HP9A 4DU3A 4N56A 1X9MA 2Q3SA 5J2PA 4BWMA 4E89A 3NF8A 1EXQA 3AO4A 3OYAA 3D0PA 1TAQA 4CIFA 3OJUA 3PO4A 4M45A 5HLFA 3LP3A 3LP2A 2O4IA 4N76A 3QNOA 1S9EA 4K8XA 1KLMA 3L2WA 4DSKA 4FLXA 4FLTA 3VQPA 1KVCA 1QSLA 3AA4A 1T05A 3KLGA 1RBTA 1BGXT 2IDOA 4C8KA 3HVTA 2KFNA 4MFBA 5FROA 3K5OA 4OKJA 4DG1A 4N5SA 1VSKA 4E3SA 3ZCMA 3TAQA 1ZBHA 2HHVA 4RW4A 1K6YA 1RT5A 2VG6A 3SQ0A 3QETA 1HYSA 1I39A 3HO1A 1UA0A 2A1SA 3AVHA 3CQ8A 3C94A 2ETJA 4ZHRA 3VA3A 4CHPA 3ISNC 1WSEA 2G8IA 1RT7A 4EP4A 4CIEA 4B08A 2HNZA 4DTXA 4LSLA 4B8CA 3NDKA 2HW3A 2P5GA 3AA2A 1MU2A 1ASUA 3NE6A 3S3NA 1S1VA 1LAVA 4NCAA 1L5UA 3M8RA 3TWHA 2YNFA 1ASVA 2KTQA 3L3VA 4CFBA 4YFUA 3THVA 1WSJA 1Y97A 1SL2A 4DMNA 1TKDA 3RR8A 4M3ZA 4CJ4A 3KKSA 4FLVA 3TARA 1SKSA 4CHYA 2YNHA 4CJLA 1S1UA 3ZSWA 2OPPA 3OS1A 3QESA 4W5TA 3NGIA 1RTHA 1UWBA 3HP6A 4DLGA 3DLRA 4CK1A 4CF9A 4BE1A 1GOCA 1NK9A 1S5JA 4CJPA 3VQDA 4CJWA 2XY5A 3RTVA 3T3FA 3L2RA 1TKXA 4FJLA 1IKYA 1HMVA 4CGDA 3CFRA 2G8UA 3TAMA 2AJQA 3IRXA 3V4IA 1YTUA 3TR8A 3CG7A 5HBMA 3BGRA 4CEAA 4E7KA 3RMCA 1A5VA 1HQUA 3SNNA 1CXQA 2ITGA 1L3VA 4B9UA 4Z4HA 3SZ2A 3V9UA 3U3GA 1KVAA 3V9SA 2KZMA 1CLQA 1HQEA 5HRSA 2IC3A 3OYMA 3P83D 1YT3A 3NGZA 3IAYA 5J2NA 3TANA 3PY8A 3MEDA 3RRGA 2EX3A 4IFVA 4DFMA 1D9DA 3G0ZA 5J1EA 4FLYA 5CYMA 4CFCA 4E7JA 2WOMA 3OYJA 3K59A 1NKBA 4FLZA 2XRIA 4AILC 4KI4A 3ASMA 1JLQA 3AA3A 1G15A 3NCIA 1WLJA 5KTQA 5HROA 1JL1A 2DFEA 2HB5A 1DLOA 2YNGA 2P51A 1BI4A 4KTWA 4AHSA 3K5MA 4DSEA 3TABA 1SL1A 1U45A 1KSPA 3RWUA 1VRUA 2PYLA 2YHBA 3CFOA 4BWJA 1WSHA 4FJ5A 4FK2A 4ELTA 2ATQA 1NJYA 4L8RB 1VSIA 4DSFA 1JLCA 1S1WA 4FLWA 3DYAA 1GOAA 4YNQA 3ZSXA 4HTUA 3T19A 1Q9YA 4CJEA 3WNGA 2DY4A 3ZT2A 2HHSA 1TK5A 3MXIA 1JLEA 3S9HA 1ZBFA 3VQ8A 1SL0A 2DTUA 2IGIA 3G10A 1CZBA 1RCHA 2OZSA 3QIOA 1NK5A 3MXMA 3L8BA 3OVNA 4ID5A 4AHCA 2FBYA 3D45A 4W5NA 1TVRA 5T7BA 1ZBUA 1B9FA 3VA0A 5HRRA 1FKOA 4DSJA 4OLBA 4FXDA 3RR7A 3RRHA 3QEVA 1REVA 3TAEA 2ZD1A 1UOCA 2Z1JA 1N6QA 4DTRA 2HHWA 3KLIA 1FKPA 4CJKA 2X6SA 4F2RA 4C8NA 2X74A 1A5XA 5FDLA 3VQQA 4DTJA 3A2FA 4CE9A 4CERA 3DM2A 3SV4A 2FBVA 4B9MA 1LW0A 1JL2A 1SUQA 4F3TA 2KFZA 1JLAA 4CJUA 2X78A 3V9XA 4KAZA 3AVGA 2GBZA 2RN2A 3HYFA 1BQMA 5DK5A 3CM6A 4FCYA 3BDPA 3ZSQA 1BL3A 2OPRA 4I9QA 1UA1A 4OGEA 1C1BA 2Z1IA 1XWLA 4RG8A 2OYQA 4DQPA 1JXBA 3TI0A 4PQUA 4CF8A 2OA8A 3HPOA 4DTNA 5C24A 4PY5A 5CZ2A 3DOLA 1EX4A 4UQGA 4Q5VA 4FZYA 3K5LA 1CZ9A 2GV9A 4KTZA 3VQCA 3S3OA 1NJZA 2XY6A 1TK8A 1VSMA 3LALA 5CZ1A 3PX0A 1DTQA 4OPKA 4KHSA 3OYDA 3NF9A 1RDAA 2Z1HA 4XIUA 3NGYA 4M3WA 4DQRA 5CY4A 1XHZA 3KD1E 1LAWA 4DU1A 3ULDA 3DOKA 1QE1A 4FW2A 3LWLA 3P5JA 3IS9A 1J9AA 3O4NA 2XO7A 1RT4A 3EY1A 1B9DA 2QKKA 1SV5A 2G8VA 3M8SA 1BIZA 4K8ZA 4H4OA 4AHTA 2YKNA 3SQ4A 4CGIA 4CGHA 3AO1A 1U4BA 1NJWA 4NCGA 3B6PA 4O44A 3KIOA 4IFYA 1LV5A 5SZTA 3TAFA 1VSLA 4IDKA 3V1RA 1RT1A 4NYFA 4CJ3A 3AVMA 4DTMA 3QO9A 4CECA 1W0HA 4CF0A 3DRSA 4H4MA 1LWCA 3KK2A 4FJIA 1NOZA 4AHVA 4HUGA 3QINA 4B3OA 2HNYA 2D0AA 3O4QA 3ZT3A 1RBUA 3OY9A 2Z1GA 1ZYQA 4C8OA 1S1TA 1IH7A 3ZT1A 4BE0A 4PWDA 3QIPA 1NKCA 1I3AA 4O55A 3QERA 3DLEA 3VQ5A 3LP0A 1BCOA 2JGUA 1IKVA 4OJRA 4HHTA 3SUOA 4CFAA 1WAFA 1W9HA 4KV8A 2ZE2A 4B8AB 4FJ7A 1WSIA 4DFJA 4HVJA 3EZ5A 3KK3A 2XY7A 4DTSA 4DQQA 1RDDA 4DTOA 3OYCA 1FXXA 5FRMA 2YHAA 4LD0A 4N41A 4M42A 1S9GA 4CFDA 3HPHA 2A1RA 2G8KA 5HP1A 2RKIA 3QEXA 2HHQA 3SYZA 2XHBA 1Q8IA 2RF2A 3DLGA 1X9WA 1JLFA 3K57A 1YVUA 3AVBA 4BDYA 4DQSA 1NJXA 4JRQA 4B9NA 5KGXA 4FJKA 3JYTA 3RMDA 1LW2A 2OPSA 1HNVA 1FK9A 4R5PA 4RW9A 4M3TA 5D3GA 4Z4CA 1C0UA 1B92A 3AV9A 1NKEA 4ICLA 4AH9A 4J2EA 1J5OA 2D0CA 3AA5X 5KRTA 2YKMA 2D0BA 5KRSA 4CJTA 1S6PA 3AVCA 4DF8A 3K5NA 1TAUA 4ZTJA 1VSDA 3ZT4A 3KLFA 3H08A 4KFBA 4O4GA 4AHRA 3NBPA 4GW6A 4IG3A 4OGCA 3HPGA 1KFDA 3LAKA 3DLKA 4IBNA 3K58A 2VWKA 3VN5A 1BHLA 2RPIA 4HUFA 4FJJA 4Z4IA 3PV8A 2Y1IA 2R7YA 3SQ2A 3OYHA 3AVAA 2ZQBA 2PYJA 1KTQA 3CM5A 3ZSRA 4CJ5A 4E7LA 1XI1A 1IKXA 4KPYA 2BDPA 4FK0A 3WNHA 4I9LA 4CGJA 1RTJA 3O3GA 2F96A 3F73A 1ZBLA 2EHGA 4KI6A 4LH5A 3QNNA 5JS2A 4J2DA 4RW6A 4FZZA 1SKRA 3RMBA 3I0SA 4DSLA 1QS4A 4CEFA 2YNIA 4CESA 4I7FA 4DTPA 3V81A 3SQ1A 4OVLA 3I0RA 3C95A 3VQEA 4M3XA 3NF6A 4B9LA 2B5JA 1C1CA 1RNHA 3CYMA 4EP5A 4JRPA 1U49A 3HM9A 2OPQA 1TKZA 3V6DA 4KHNA 4FLUA 3PUFA 1O1WA 1TV6A 4GMJB 4LY7A 3L2VA 4Q0BA 2HHTA 4CEDA 1Q9XA 4QOZB 4KHYA 3IG1A 1HYZA 2P1JA 3SI6A 4CHOA 4KHWA 2BANA 2HHXA 3NF7A 1HJRA 1RBSA 2IS3A 1D9FA 1NK7A 2DFFA 1BQNA 1KLNA 4KB0A 4F8RA 1KVBA 2DFHA 4B9VA 4KHQA 4ID1A 3OYBA 3FFIA 4E7HA 3L2QA 1R0AA 3PX6A 3KTQA 1GOBA 3VQ4A 3TAGA 3C6UA 4CEQA 3MXJA 4CJQA 3HJFA 3HVRA 3OJSA 4CJVA 4IKFA 4FJ8A 3AVIA 2BE2A 4DTUA 4H8KA 4FJMA 4HUEA 1D8YA 4B9SA 1L3SA 2HNDA 1RTIA 3HXMA 1ASWA 1TKTA 1U04A 2KQ2A 3AO5A 4PA1A 5C25A 2IOCA 4M41A 3OYIA 1WN7A 4ELVA 4DFPA 5K14A 3VQBA 4W5RA 2X6NA 1NK8A 3LZIA 4FVMA 2D5RA 2B4JA 3HL8A 1NOYA 3OYGA 1NK4A 4J2AA 4KB1A 3SV3A 4CK2A 3SCXA 5I3UA 4HCCA 3ZSZA 3DMJA 1VK0A 3LP1A 1KFSA 2PY5A 3UIQA 3OS2A 4CF2A 2Y1JA 1X9SA 3NHGA 3LWMA 4DFKA 1S6QA 3MECA 1S1XA 4E1NA 4CJRA 4RW7A 1T7PA 1EP4A 3NH0A 1RT6A 3ZT0A 4Z4FA 2BGGA 4FYDA 1JLBA 1QQCA 3HT3A 4Z0UA 3LDSA 4ELUA 2HHUA 1A5WA 4CEEA 4CHZA 3QEPA 4IG0A 1NK0A 3DLHA 3SUNA 1TGOA 4KO0A 2JLEA 5DMRA 4C8MA 3DI6A 3NAEA 2HVHA 1C1AA 3ZSOA 1HPZA 3VQAA 4G1QA 1TL1A 1WNSA 3M8QA 4B9TA 3F9KA 1TL3A 4CEBA 3LPUA 1QSSA 1J54A 3AVFA 3KK1A 4FW1A 4Y1CA 3AVJA 3NH2A 3U6FA 3VQ6A 3HSTB 1HYVA 2VG7A 3K2PA 1VSFA 1DTTA 3LAMA 4C8LA 1EETA 4BACA 4I2PA 2G8FA 3PO5A 2FBTA 4CHQA 1RILA 3KLEA 4DLEA 2I5JA 3VQ7A 4BDPA 1T03A 4BDZA 4KREA 4FJNA 1QTMA 1IO2A 3MEEA 4RW8A 3L3UA 3HK2A 4Z4EA 4LH4A 4N47A 2P5OA 2G8WA 4FK4A 2HVIA 1RBVA 5FRNA 4LSNA 1TK0A 4CK3A 1BIUA 3RMAA 1U47A 1ITGA 1Z26A 5HRPA 2HMIA 3LPTA 2B6AA 4OKKA 2YV0X 3QEIA 3JSMA 4O0JA 4O5BA 4M3RA 2W42A 3EYZA 4FM0A 4CJFA 3S3MA 2XY8A 4DWIA 1D5AA 5C42A 4J2BA 2QKBA 1ZBIA 3QEWA 3OS0A 1C0TA 3LZJA 2F8SA 1YTAA 3V9WA 4M3UA 2GUIA 3DLBA 1U48A 2G8HA 4EZ6A 4MQ3A 1KCFA 3ALYA 5J2MA 1QSYA 5SWMA 4F3OA 1IKWA 1BI4B 2E6MA 3SPZA 3AVNA 4GVMA 5JS1A 1VSHA 1UAXA 1Z25A 1LWEA 1X1PA 4CGFA 5HRNA 4DQIA 4KKOA 4JS4A 1EKEA 4Y1DA 4BE2A 5EU7A 1J53A 1JKHA 3V1OA 1RT2A 3KLHA 4JLHA 1C0MA 4JS5A 4OPJA 5I42A 1HNIA 1LWFA 4QAGA 4W5OA 1XHXA 2PZSA 4DF4A 3P1GA 3QLHA 4E0DA 1CXUA 4FM2A 2VG5A 4KRFA 4CEZA 1IG9A 4M3YA 4I2QA 1SKWA 2NUBA 4O0IA 1L3TA 1RDCA 4F4KA 1VSEA 3C6TA 2FC0A 4E19A 1RDBA 1JXEA 2E6LA 4TSXA 3I8DA 3SUPA 3OYFA 4FM1A 4DS5A 4FZXC 5KGWA 2O4GA 2F8TA 4DU4A 4CIGA 4W5QA 3V1QA 3ZSVA 1BCMA 3CFPA 4OKEA 3O3FA 3ZSYA 3U3YA 4DSIA 3SUQA 3AO3A 3T1AA 3MAQA 3AO2A 4FJ9A 1N5YA 1RBRA 1WSGA 2WONA 5CYQA 4CF1A 4CJSA 1XC9A 2FBXA 1RTDA 4DS4A 4F2SA 4Z4GA 3OYLA 2E4LA 3TAPA 4FJHA 4CGGA 3O3HA 2KZZA 3SPYA 1VSJA 3NH1A 3LANA 3SJJA 1RT3A 2QK9A
chains in the Genus database with same CATH superfamily
2IAJA 1W1WE 3PIPL 3E01A 1Q82O 3V7CA 2X0LA 5TKYA 3CCQI 1B8IB 2KKOA 1H0MA 1ZELA 2HQ5A 4ZTFA 3R61A 3EUHC 2AXLA 3GZNB 2E60A 3WEEB 4LIVA 4NYNA 4IHTA 1TAQA 3GG4A 2DPNA 3HEFA 4RA2A 2FSJA 2IDOA 2DODA 2ZJPL 2X6YA 1K6YA 4JYAK 1UA0A 3GZ5A 4FTHA 4DTXA 3NDKA 4JHDA 2KP6A 2XB5A 1LDDA 2EWNA 3QWLA 3WGGA 5AQGA 3WTTC 3TARA 3SMSA 3LSKA 3I71A 2XY5A 3L2RA 2I10A 1MMNA 2QA4N 5F0CA 3BGRA 3JTHA 3HIFA 1A5VA 1SD7A 2IIRA 2WTEA 2Z3YA 3EL2A 4EM1A 3B02A 2VL8A 1SS6A 3PY8A 4DFMA 1NG7A 2R7VA 4AVPA 3KCCA 3KLOA 1DLOA 2VKEA 4XLNF 2IRFG 2QI2A 4FETA 1ZBSA 2PYLA 5M1NA 1BN5A 2P9NA 1GOAA 1Q9YA 3BC8A 1V4SA 4BVOA 4PKIA 2LY1A 3RRHA 1W7PD 4DTRA 1MH4A 2FBVA 3A5NC 1P2FA 2CQ7A 1HCRA 2HTJA 4PSXA 1BL3A 4OGEA 3VENA 1DPUA 5C24A 4FWOA 3VWBA 3ATUA 5TISC 3I4MJ 2O8BA 1K78B 1A31A 2R7TA 3ZLJA 3A03A 1SANA 2P81A 2VGNA 2JRMA 1Y8RB 1D5YA 2W57A 4BJ6C 4IEJA 2UXCK 2NNNA 4BHCA 4CECA 4CD3A 4HWIA 3DXMA 2E34A 3DLEA 3TW6A 2JGUA 3CCMI 1WAFA 2Z99A 4N9HA 3CCQN 4XOTA 1HC8A 5AQQA 4DQQA 2R7QA 1FEXA 5ICGA 3QEXA 4NXNK 3W0LA 3JR9A 4ESJA 2RN7A 2OPSA 4UV9A 4PDKA 1BUPA 3CUQB 3N97A 2ZJQL 2D0CA 3LM9A 2Q31A 1TAUA 4I98B 1YUWA 1U3EM 3DAWA 5CKTA 3BP8A 2ZQBA 3TDUC 1XI1A 1WJDA 3HBLA 2VBXA 2K9LA 5JS2A 2NXNB 4IQ4A 2KDOA 4FX4A 1HX1A 4IZ9A 2KT0A 2M34A 4EP5A 2CUFA 5FLXO 1DU0A 4MDBA 3RZOJ 5E3MA 4JI7K 3PSFA 4KHYA 1JHHA 1U5TA 1FJGK 3U9DA 3WE2A 5FKMA 4EVIA 4G7ZF 1IN6A 4DR1K 2HBJA 3S8PA 3CJNA 1ZAOA 4IOXA 2IOCA 4CSWA 4HDUA 4FVMA 1P92A 2EZIA 3O9RA 4U0VA 3B73A 4ESFA 4Y17A 4LF5K 3NHGA 1T7PA 4FYDA 3HT3A 3L1PA 4GV3A 3GDQA 4GRIA 1C1AA 1WNSA 4M72A 3F9KA 3LPUA 4CYCA 3V42A 4YDUC 3I54A 2CW7A 2ZMEB 4BACA 1NU0A 1T03A 3EDPA 5DYMA 1X2NA 3JXUA 4R1HA 2EFOA 3TOAA 1AA7A 2L9VA 2GOXB 5GP9A 3HOTA 2WWYA 5DM7F 1K8AO 1TC3C 2GIVA 2F6CA 2VUMJ 3ZXSA 3U9ZA 2E6MA 3SPZA 1SAUA 3B6AA 2D1HA 3CUOA 3GMEA 1X1BA 5D6EA 4MQVA 5AQVA 3IHUA 1RI7A 3VETA 2W1OA 2XF7A 5EVZA 3CCMN 2JA8J 2X4HA 3W2WA 3I0TA 3HTVA 4CF1A 2JWKA 2XGCA 3LDQA 1Y0UA 1VSJA 4KBOA 4N41A 1NGBA 4FJGA 4B3XA 3CTAA 3FKIJ 2P7VB 1HW1A 4C9YA 1F21A 3BCAA 2P9PB 1P9QC 3OYKA 3DRPA 5JMVA 2QXFA 4KHPK 3CJBA 5LJVA 3MFKA 3WNFA 3QOPA 3HP9A 2XGDA 1X9JA 3CMYA 3PO4A 3TEDA 3L2WA 3HOWJ 1YXQA 1MBEA 1JTYA 1OCZH 4AWXB 2CGJA 1MH3A 1VSKA 3IP4B 1HYSA 2P8TA 3JRBA 3HO1A 5AQSA 1IBMK 2VE9A 3CCRI 3HOSA 5E8IA 4CIEA 4YIRX 4LSLA 2K7LA 3NE6A 3I55I 3S3NA 1R7JA 2P6SA 4CFBA 3G1LA 4YRVA 2R7FA 2P9KB 3BEXA 2XRLA 4BXUA 1UWBA 3T3FA 1MSEC 4G6DA 3HM8A 4YHHK 1YTUA 2M9HA 2KZGA 4IVNA 5EGOA 4Z4HA 1Z91A 1CLQA 1HNZK 3NGZA 1BI3A 1FX7A 3G25A 1XTAA 4CFCA 4RGSA 1ETWA 1NBWA 2DOAA 1G15A 2ZXIA 2P51A 1HLUA 1U45A 4BWJA 1XGNA 4OAZA 2ATQA 4XH4A 3ZSXA 3CCEI 4DHYA 2DY4A 5KCMA 2Q97A 3ZX3A 4AF1A 4EFHA 2IS4A 3D45A 2ZB9A 1JKOC 4DSJA 1TW2A 2NYXA 2P7CB 2XAFA 3K70C 5C3EJ 2DA5A 4CJKA 5FD5A 2XVCA 4M6YA 1SC7A 1JLAA 3ULEB 2B0LA 1U6ZA 3OR1C 1J5YA 4BUPA 5DK5A 4FISA 1QVUA 1C1BA 1VQOI 3QPTA 4CZIA 4WX9A 3J8AA 1BA0A 1JXBA 1LKXA 1FMWA 2DPUA 2DXIA 2MBFA 4FHTA 4XIUA 3SHFA 4M3WA 3ELKA 4FW2A 3JRFA 4M3BA 3G3ZA 3WE3A 3M8SA 5GTHC 4JKEA 3MKZA 2CQQA 5CVRA 3KIOA 5FPNA 1J09A 3TAFA 1JGGA 4IDKA 1WZ2A 1IUYA 2EA2A 3VOEA 1X2MA 5DTDA 1IH7A 3ZETB 5GAGJ 2VT3A 4OPHA 4C23A 3EUKL 4H0OA 1WSIA 4IX7A 4ENMA 2L3DA 4JNEA 1KU2A 4R8HA 4MGRA 1G59A 1RESA 2E2IJ 4BDYA 3LSMA 3JYTA 1WJ5A 1FK9A 1ETYA 4R5PA 4M3TA 4JEPA 2LH9A 5LLQA 1V5EA 1NK2P 2M7BA 5LFAA 1ZLKA 1XMAA 3AA5X 1YAGA 3TPQA 3Q0UA 4BQOA 3O4WA 3H08A 3CCRN 2YHYA 2QQAA 3I55N 3LAKA 4LIUA 2M7AA 5L3BA 3CM5A 2GEMA 2VQLA 4BR0A 3TTDA 2Q8KA 4CESA 1AU7A 4WQ4C 5BN9A 1YHQI 3M1EA 2R7DA 4HTLA 3R3LA 4OX9K 3HOXJ 4B1WB 3BTJA 1VNDA 4CZZA 1JCFA 3RSNA 4X64K 5ILSA 2J4RA 5J1YA 4BG9A 1U0JA 3RDIA 4HUEA 3O6BB 2VJ5A 3K69A 3ZMDA 3CCEN 1WBBA 5D5VB 1IF1A 4UHTA 1OQYA 2Z33A 2OZUA 3A0IX 4DFKA 4GV9A 5D5UB 3K10A 5LBQA 5KPRA 4IG0A 1B4AA 2JQ7A 1QHHD 1MDMA 1TL3A 5HNHA 4A5AA 1QQOA 3ABUA 1EETA 2M1BA 1MJAA 1VQON 1F4KA 2Y0SN 4KREA 4FJNA 3O8MA 4Z4EA 4N47A 1XSXA 1WJFA 1GXQA 3KE2A 3CIPA 3WU2C 1ETOA 2IA1A 4MEXF 2L5QA 4F93B 4V19K 4O0JA 4K43A 4FPBA 2VBZA 5C42A 1ZRDA 2Q2EA 1U48A 2G8HA 1VQ5I 1UFMA 1ODDA 1RPWA 1V3FA 5JS1A 5B5EC 1R4MB 1RUOA 4LITA 3CJ1A 5AQWA 1YIJI 4Q5SF 1P6RA 1SQKA 3LSIA 3I56I 5KGWA 4CIGA 4W5QA 3L2CA 1RBRA 3IKMA 4QPOA 5CYQA 4DS4A 1GXPA 3O08A 4RMNA 2KZZA 3PIOL 3R0JA 4A3EJ 3H46O 3REOA 4A61A 4CEOA 3V9ZA 1S22A 3E3VA 1YW7A 4BR7A 4CYDA 1J9IA 5J2PA 2M0MA 2E2QA 4MDAA 4DSKA 4BR4A 1KVCA 2PFBA 2V4JC 3FHNA 5F6FA 3H45C 3E7LA 3ZQCA 1RT7A 1GLDG 1Y1WJ 4JOMA 1ASUA 5BPMA 1IRZA 1YHQN 3H9QA 2R3SA 1R1UA 2VOPA 3QU6A 1ZK8A 1H1VA 4M3ZA 3S2DJ 1SKSA 3F8FA 3DLRA 1IG9A 4YIFA 4AIJA 5EXWA 1XMQK 2AXTC 5HBMA 3R0AA 4XKWA 5C4JJ 2LTPA 1E2XA 3V9SA 3ECHA 3OYMA 2IC3A 4M3EA 3NCIA 5HROA 2OANA 1Q86O 3KPHA 3CFOA 4ELTA 2M8EA 3MVPA 3MN5A 1XUPO 3VQ8A 2TDXA 3FXJA 2OZSA 3MXMA 3L8BA 5KHDA 4FWNA 4L3QA 4L5IA 1XMXA 2ECBA 4N4NB 3TAEA 5B3SH 1Z21A 5IT9Z 5IP7J 2Q36A 3FLCO 4DTJA 5CQGA 2L4AA 2GBZA 2DQRA 2CQKA 1WQ2A 3CM6A 2P4WA 3S2HJ 1VQ5N 1VQ8I 1IN7A 1QHAA 4GV6A 2NLXA 2IA2A 2JJ7A 2G0EA 4BC2A 1K9MO 4KHSA 1YIJN 2KQRA 3ULDA 1G6NA 3I56N 2HXOA 4K8ZA 4JN4A 3V1RA 1U2VB 4NYFA 2XC7A 3QO9A 5JLFA 3O2PE 1J7KA 5FPEA 1ZYQA 2O7OA 5DUKA 4O55A 1IAWA 1ZKGA 3OV8A 2ZE2A 4OINF 3IV5A 1R1VA 1YJWI 3CERA 3CC2I 4S04A 1XPXA 4XLCA 4YORA 4CFDA 3HPHA 5ADXA 4PUSA 1MBJA 4UUSA 5EX5A 2R5ZA 2NZTA 4ILJA 2FOWA 4NUBA 3TOBA 2ZGYA 2R4GA 5EJCA 1HLVA 5D8KB 3DEWA 3HPGA 3RVCA 2H8WA 1OMIA 3WTXC 4CGJA 2A6EF 4LFCK 3D5LA 3THXB 3L4IA 4IRHA 1SKRA 3IRQA 4LJZF 3HRSA 4HEA2 1U49A 4JRPA 4UUVA 3CP8A 3MK6A 4M3GA 2R7SA 4GYIA 4FQGA 2D2WA 3D2EA 1OFCX 2JA2A 3CJ7A 5IP6A 4IO9L 1KVBA 2DFHA 3WQTA 3JRCA 4JQFA 2NOJB 3RTRA 1K8KA 4JKAA 2HPIA 2Y9YA 3HVRA 1VI0A 4DTUA 1OR7A 2P9UA 1Y64A 2EK5A 4B9SA 3ASNH 3WHCA 4BRAA 3KEQA 1USTA 3V7RA 1OKJA 5I3UA 3DMJA 1R59O 3FE1A 1X9SA 3VEOA 3C7JA 3U4LA 4CJRA 4RW7A 2CUJA 2NS8A 2R7UA 4CEEA 4CHZA 3DLHA 1TGOA 3OSGA 1BWFO 2DPDA 3VQAA 2CJJA 1J54A 1R71A 4JX5A 3RYPA 2MC3A 1I94K 4UY8I 3M07A 2FBTA 1VQ8N 2B7EA 3JRAA 2HVIA 5BS6A 2K85A 1TWCJ 1BIUA 3LL7A 4OKKA 3F72A 3JRIA 4RB1A 2D0OA 2JRTA 3J80K 4MQ3A 1RNLA 1IV6A 4I6MB 1NGDA 1K4TA 4NHJA 4GVMA 3ENOA 4A3LJ 2FRHA 3KLHA 4C1NK 2MC4A 2WY8Q 4K41A 4O0IA 3H3ZA 4TSXA 3MDQA 3V1QA 1YJWN 2A69F 3EUAA 5DM6F 1MW7A 3OYLA 3NH1A 1J2XA 4H4KC 4HNUA 1RT3A 3CMAN 4KN7X 4A59A 1N78A 3JAMK 4IJNA 4KFCA 2VWJA 3CUQC 3OL4A 1Y0NA 3B6OA 1BIBA 4QCLA 1CF7A 1O7FA 4N56A 4F52A 2DA6A 1EXQA 2JTVA 4JI3K 5HLFA 3LP2A 4YOXA 5K7HA 2K40A 2AO9A 1HUXA 3PFIA 3AA4A 4S0HB 3K1MA 2ETJA 5HL7L 1WSEA 2PBDA 2P5GA 4S05A 4EIAA 2QKMB 1O7LA 1EH6A 4YFUA 4F9OA 1O3TA 4DMNA 4CJ4A 2YNHA 4LG3A 4PZJA 3SBGA 1GOCA 1S5JA 2L9NA 3TR8A 1MBGA 1HQUA 2ZC2A 2VN2A 2RQPA 1JUSA 1OCOH 3GWZA 3HOYJ 4DR5K 3CCLI 5GADP 5ILVA 2HB5A 4CHUA 1KYZA 2YNGA 4AYBN 2LKPA 4FJ5A 2K9MA 2ASOA 4Y15A 3D6RA 4CJEA 2HWVA 2DOFA 1SL0A 2DTUA 4Y3OA 2FXUA 1NK5A 4KH5A 3JSOA 1TVRA 3ZEUA 1FKOA 3CDLA 4FXDA 2CU7A 5AQJA 2ZD1A 4P5OA 4RLQA 2WB1N 4FL9A 2QYOA 1HKBA 3L00A 4F3TA 2X78A 3MWPA 4NXMK 3C1DA 4K2EA 2Q0UA 4BRKA 3BDPA 4EJUA 4E1JA 3BG9A 2LY2A 4DQPA 2A61A 2ME0A 2H1LA 4UVCA 1SVLA 2XY6A 1JGSA 2BY0A 1KC8O 4I0AA 4XLFA 1FYLA 1W7PA 4B1XB 1IDZA 5CY4A 3KD1E 2CYYA 3DOKA 2PMZN 1B9DA 1FBSA 5FKLA 1FMVA 1G3SA 3ZQQA 3SQ4A 3OWTA 5DCMB 1X58A 2UYTA 5FLVA 3BR0A 1YW8A 4JK7A 1I3AA 3VF6A 4BQZA 3DQVC 2FXAA 2JWTA 2DT5A 2WC2A 3HDDA 4Y33A 4E70A 3ZX0A 4DTOA 2HQNA 1KAXA 1QZ6A 3W6VA 3AVBA 4H5TA 4P9FA 1LW2A 2HBMA 3MEXA 2XSJC 2IW5A 4XH1A 3H1VX 3DPLC 4UB6C 1NJIO 5KRSA 3SFZA 4ZYGA 3SK3A 1OVYA 3OIPA 4O4GA 1N33K 4GW6A 4MFEA 4X6AJ 3FZVA 3VN5A 1NG6A 2NNYA 4LLLA 2F9WA 2Y1IA 3DV8A 4C1NI 2NOGA 3OSFA 4CCJA 3GBGA 2EIJH 2MYSA 3I0RA 1IZ1A 4ISFA 3EETA 1I5ZA 5AONA 2B5JA 3SXYA 5LMUK 5KK1A 4XICA 4NLCA 3HKZN 4O8KA 4QOZB 3KYLA 3GBTA 3QFUA 4B1YB 1D9FA 2R93J 1RBSA 4BC4A 4FO0A 1G3WA 3CCLN 3JW4A 3KETA 4E7HA 1GOBA 5F27A 5LGNA 2IVPA 2DYSH 1EJ9A 4V19S 2LP0A 1MD0A 3VQBA 1NK8A 3KP3A 4HCCA 2EFNA 4YOVA 3MZYA 1LOTB 3MECA 3VTHA 3I58A 2HHUA 2PEXA 3O6WA 5AJ3K 5DMRA 4B3RK 3MN2A 4G1QA 5CQEA 3SZPA 3HRTA 1ON2A 2LLKA 4CBUA 3H3NO 4I2PA 5GAHP 1YI2I 4BDZA 4RB2C 2HOAA 2IEKA 1WHUA 4FWPA 4LSNA 4DJAA 2BY1A 1JKRC 3BZKA 2VKVA 1K83J 5HRPA 4NBQA 3BDDA 1W5CC 2NRXA 3QBWA 4DYRA 1FBQA 3V9WA 2ZSHB 1HBXG 1KCFA 3W3DA 5BPNA 1IKWA 2RNGA 4LG0B 2FOKA 2YJEA 4BE2A 4JS4A 4FX0A 1T39A 1PP7U 2Q2RA 3BWGA 3TP0A 2WV0A 3QDKA 3OR2C 5M3MJ 4I0BA 3CQXA 2X6OA 4WXCA 3CI5A 4Z4GA 3Q9SA 4Q4ZF 2FBXA 4PJMA 4IOCL 1T0FA 3H3UA 1ZLJA 2G8IA 2DTZA 2H6BA 1KQ0A 1X3WB 3VOVA 3K0SA 4PJLA 4CJ7A 4QS8A 4EZ9A 4HCBA 2A6TA 5ELZA 1YITI 5A2QK 4ZYDA 1QHTA 1JUMA 5JVGF 3PQKA 4CCHA 3ZR8X 3S14J 2E8AA 3OYAA 4XH5A 2L7KA 4XLHA 1T05A 2K9SA 3FGUA 4MFBA 3ZCMA 3SQ0A 2EH3A 3C94A 4EGYA 2EV5A 3UNGC 3CC7I 3WGHA 1L5UA 2BBYA 3BQYA 3GFLA 5FGMA 1G8XA 3CCUI 4BXFA 4IFEA 1KQSM 4QTRA 1TQPA 5EEHA 4BRDA 5JLHA 2TCTA 4CXFA 1FPQA 4KT5C 1GLCG 4X0GA 2K4JA 2KZMA 4C3HJ 2YX4A 5KQ8A 3IAYA 3TANA 1U78A 4HPQA 4IFVA 4RAZA 3SDGA 4M3DA 1YLFA 3ASMA 3UKRB 4LF4K 5M1FA 3MKWB 2ZFUA 3OL3A 4V2FA 3T19A 3MKYB 4P55A 3QPHA 1I6HJ 3QIOA 3DPTA 2X85A 1QNTA 5T7BA 1GLNA 1B9NA 1YI2N 3NARA 2PJRB 1I6XA 3Q0VA 3FXRA 1IC8A 4HA8A 5FFXA 2VC0A 2WY7Q 2Y2ZA 3K2ZA 4CJUA 1PUFB 2P9LB 4X65K 1QVTA 4IEEA 2P9PA 3VEVA 2IS6A 1EX4A 2GIZA 3IL2A 4I6ZA 3WHBA 1VHXA 4WWCA 2L7FP 2ME6A 3VEZA 1YO5C 4RAYA 1J9AA 4IEIA 1OH6A 1RR8C 4O44A 3CJ9A 2LKXA 1VSLA 4C2MJ 1OYWA 3CZ6A 3QICA 2CH6A 2A68F 1FTTA 3VODA 3LP0A 1BCOA 4KV8A 1OR7C 1NH3A 3CHWA 3C2HA 2ADUA 3QP5A 4DFJA 4HVJA 1YITN 3LSHA 1UAAA 4AQYK 2YHAA 4B09A 3J81Z 3JSPA 2XHBA 2GA2A 1N8RO 5FKKA 5MLCQ 4FJKA 2VI6A 1E0EA 2COBA 1MIJA 3UKUB 1NMNA 2YKMA 3AVCA 5DDGA 1OLTA 3ZT4A 3QB0A 3M8EA 3CC7N 3S16J 3MCPA 2ZJ2A 1IN4A 3MWTA 3GW2A 1V5GA 2BYVE 4FK0A 5H6RA 4I9LA 1ZBLA 1QGPA 3CCUN 2M5WA 2L7MP 3THYA 1LDJA 1IN8A 2L0KA 1VZ0A 4KHNA 4KH6A 3JREA 1Q9XA 3S93A 4K0KK 3GTLJ 3ULEA 3EN9A 2ZXJA 1G4DA 1KLNA 2DFFA 4F8RA 4XIDA 3KP5A 3A5MC 3FFIA 3L2QA 1ZYRF 5AQIA 4M9SA 3A5LC 4WFNL 2FF3B 5E3OA 4BQQA 1RTIA 3KFWX 1WN7A 5K14A 1LE8A 2W82A 2PI0A 3I3LA 4G12A 4MLOA 2Y1JA 4CF2A 3IH3A 1BOTO 1S1XA 1EP4A 1F1ZA 3LDSA 2ZO4A 3E5XA 3SUNA 4C8MA 1TL1A 3AVFA 5B66C 1BL0A 4QS9A 3DBRB 2IVOA 3LAMA 3KHYA 4HLYA 2VT2A 4B3MK 3VQ7A 4F7ZA 2ZCWA 3IFRA 1OPCA 4DR2K 3GOIA 4YFNF 4A2BA 1ORKA 1Q18A 3ZPLA 3S3MA 4M3RA 4CJFA 1WCMJ 3QEWA 3WXKA 1JT6A 2V7ZA 3AG1H 4JK1X 1EA3A 3VGLA 4E7SA 5CVUA 2ZJPF 5M5XJ 4JI6K 3FBIB 2EIKH 5KNLA 1LWFA 3LSGA 3P1GA 2Q0RA 4M3YA 2CRGA 2NUBA 3ZX2A 1SZ2A 3ONQA 3MCZA 3VYRB 4DU4A 5F64A 3K4JA 3K4BA 2WONA 3BLYA 1RTDA 4RDUA 2IGOA 3B6CA 1OCCH 3BTCA 3TMOA 1DDNA 1USSA 1PUEE 1WSFA 1HRHA 3O8GA 3FXOA 3CMEN 3R4KA 3T8RA 1DGWY 3BG5A 4CCNA 5D4SA 1ZR4A 5EZHA 3QNOA 1S9EA 3OIQA 3I9V2 3VQPA 2UZKA 1RETA 1ZBHA 1RT5A 2F4IA 3SEZA 1ZGWA 3VA3A 4L5EA 3O9SA 4EP4A 2HNZA 3KP6A 2MH2A 1IGNA 1GLJO 3AA2A 1MU2A 2HVQA 1LAVA 3Q9VA 4GFBA 2YUSA 3U9GA 4G7HF 2GM4A 4BHBA 1X3ZB 1QPMA 1TWAJ 4YY3K 2ISYA 4W5TA 2W40A 4DLGA 4E7ZA 3VQDA 5JI6A 3EZWA 3DU5A 2LNBA 2UWMA 2A5WA 3CG7A 3RMCA 3CXCM 1KONA 2CSOA 4FWRA 1XNRK 1MBFA 3HHHA 3DTKA 3TL4X 1E4FT 1OYIA 3THWB 2UXBK 2HHSA 1TTYA 2IGIA 2LBFB 1W0UA 1IN5A 1ZG1A 5FKOA 3E97A 3MMVA 3IKTA 3BR6A 4JI4K 4BJ5C 3EKUA 2UXXA 1T2KA 3A2FA 1XSDA 3SV4A 4WQ5A 2W4SA 1MSFC 3HGYA 3DWLE 5HLGA 2OA8A 4PY5A 1IDYA 4FZYA 3MX5A 3HUGA 1NJZA 4A5BA 5CZ1A 2IPQX 1MBKA 4BY9C 2A07F 3VDXA 2CW0F 2E1ZA 3M3YJ 4GO1A 2Y0MA 4CGIA 3AO1A 1NJWA 5GIOA 2PMHA 2EQRA 4FJIA 4CF0A 5AZJB 4AHVA 1ETQA 3QAHA 3OY9A 3EYYA 2Z1GA 3E6DA 4JYKA 1YS6A 3F21A 2BHYA 2VBWA 4DTSA 5FRMA 1XX5A 1MMDA 2A1RA 1WJEA 1C0GA 3MCAB 4JRQA 2QF7A 3J80O 2COMA 5GADJ 1N25A 3ENHA 4WFAL 1Q81O 5JVTA 4HX7A 4J2EA 4HOBA 5ICFA 3FXLA 2CW8A 4O5FA 1CZAN 1HPMA 1R5ID 3FZMA 4UV8A 1YYVA 2L01A 3LFKA 5BRHA 4W97A 2R7YA 4PFPA 4J2DA 3DKXA 2UUBK 3CDIA 5FD6A 2D4WA 1RC9A 1IXSB 3V6DA 4LY7A 3G1OA 3DLAA 3CC4I 3JAMO 4YEJA 2QWQA 1Y56A 4BBRJ 1NK7A 3SQNA 3I5UA 2WA0A 2KLAA 3FX3A 4IKFA 1DEJA 1BOBA 1IV8A 4CI6A 1FNNA 3U8XA 3LM2A 3K70D 3OYGA 2W7NA 4KB1A 2OTJI 5F1XA 3UIQA 2UXDK 1D0XA 3LWMA 4LFAK 1ENHA 1ATNA 4ELUA 2AS5F 3GX4X 2HVHA 1V5FA 2IAIA 1E17A 3M8QA 3V8KA 5FJ8J 1G99A 2RV8A 3TBIA 1VSFA 2HTSA 4N0BA 1B72B 4JKFA 2OUMA 4KMFA 2DW4A 3O1BA 1H89C 2EFWA 5CVIA 4XN0A 1T56A 3IH2A 2V9VA 2NRRA 1A35A 2NRTA 4JI8K 1VQ9I 1PP8F 1R22A 3CJTB 2VXDA 2JA5J 1K61A 2BVMA 2NVTJ 5BR9A 2HFHA 2VQFK 2HDDA 3AVNA 4B3SK 3J7AP 4X1EA 1VSHA 2E88A 1X1PA 3P9IA 4A93J 4H0EA 2GA1A 3L6QA 1KAYA 3VB2A 5I42A 3BUZB 4IF4A 2BVLA 1IW7F 4FM2A 4C3IJ 3C6TA 5E1WA 2L9RA 3I8DA 3MZ8A 3EE9A 3VMFB 3AO2A 1IG8A 5F04A 3VYTB 2DU9A 1HA8A 1YVNA 5CVVA 3P7NA 4M7YA 4IRGA 5J2QA 5LL6Z 1NK6A 3AVLA 1KD1O 1QZ5A 5D5XB 3VQ9A 2QKLB 4PKGA 3RPQA 4XMYA 1KLMA 4FLTA 1VAZA 1ZG5A 5GAEP 4IHWA 5HVQC 4EAHD 4CO8A 1JJ6C 4ZJZA 3O1WA 3D1NI 2X9DA 4BVPA 2YNFA 3CC4N 1R4NB 1LUJB 5GAHJ 3CMMA 4CHYA 1TYQA 2D0PA 2OPPA 3N4PA 4CF9A 2H6CA 1IKYA 1HMVA 5D4RA 4X62K 3D5SC 3IRXA 3V4IA 2BE5F 2ZF5O 2O8CA 2MFZA 3SNNA 1MZBA 4AM7A 4HW0A 5AQKA 1XN7A 5ICEA 2QGUA 4XRMA 1BA1A 3K59A 2OTJN 1U8RA 1WLJA 2KIUA 5H6QA 1X4OA 4A0ZA 2P9NB 1NG9A 1HKSA 3K5MA 2OBPA 3RWUA 3JTGA 5LGTA 3S41A 4HG2A 1X4PA 3WTWC 3WNGA 2QBYB 2ZNYA 1GT0C 3DBHB 3PUBA 4XKVA 4MEYF 1RCHA 4DIQA 3QODA 3K9KA 2YSRA 1B9FA 3K4MA 3RR7A 2P0WA 1H9GA 5HDKA 3GTOJ 3A8YA 1D0YA 3F8NA 5M5YJ 3MN7A 3CD6N 2FBHA 3WGIA 3M6GA 5L3GA 3LMMA 1VQ9N 2Z1DA 1CQTA 2W41A 1QQIA 2RAEA 1M90O 2Y0SA 2O8BB 2EIMH 2WBNA 3OYDA 2A3SA 1RKTA 4ZH4F 1UZCA 3U1KA 1S3JA 3QP6A 4CICA 3GTGJ 3BT9A 3IS9A 2CUZA 5J6XA 3FKJA 2RVCA 2R5YB 2E5LK 4HNVA 4OIQF 4LB5A 3AY9A 3KK2A 1SEUA 2HKXA 3WU1B 3WTSC 4BRMA 3A01B 2QCOA 5M1OA 3M9AA 3GTPJ 1YFHA 4CFAA 2JMWA 1GLFO 2DA3A 1MGTA 1NWKA 3J7AY 5J47A 3EPZA 2DI3A 3SYZA 4DQSA 3HG9A 3NWSA 2L02A 1NLVA 1HNVA 2ETHA 1A6IA 2V9KA 2HVRA 4MLHA 3TTCA 4CZMA 3ISPA 3LA3A 3OBWA 3G4SI 4XBFA 2NNWA 4WYBA 4AVZA 4RW6A 2FSNA 4DSLA 2CV1A 2HYJA 3R6SA 4FWQA 4B8XA 1C1CA 1LVKA 1U5TB 4WK8F 1WJBA 3LSRA 1U6GA 4CHOA 2CV2A 3ERMA 2IS3A 4KB0A 4AC0A 5HS9A 4EHUA 1R0AA 5AQLA 3JRGA 1HW2A 4CJVA 2O6GE 4EJWA 4FJMA 2MD5A 3LSJA 3SZTA 2Z2SB 2CGLA 5KAFC 3DWLA 2WADA 1R5GA 2MSYA 1MMAA 1W36C 2O8EA 5ADXH 5AFUA 1ULYA 2V7YA 5DCMA 1S72I 5K5RA 3KWGA 4M73A 2MD0A 5CHIA 1SFUA 2UUAK 2EV0A 2G8FA 4GNIA 3ASOH 3ZMSA 3BY5A 4DZJA 5EZGA 1VQNI 1ON1A 5HNFA 2A05A 3K0LA 4XL9A 2EFQA 3I59B 2P9SB 1POGA 2B6AA 4FM0A 3DU6A 2RKHA 2P5LC 4OMYA 2QW9A 2Y9ZA 3ALYA 5IT9O 5SWMA 3F6OA 5E3LA 2ZXWH 2FMLA 2QTDA 4Y1DA 3SJMA 1OYYA 4QAGA 4Y52J 3GFJA 2PZSA 2VG5A 1R1TA 4OPAA 1GVJA 1JXEA 3NAUA 3D0SA 3OHRA 3CFPA 3E9PA 3C6AA 2ASPA 2JWLA 2WAQN 2XF6A 2HDCA 5KI6A 5E41A 3E1YA 4ON0A 5F0XA 4KIBA 1KRPA 4OLAA 2ZM6K 1T6CA 1IXCA 2V9PA 4KHUA 2CH0A 1SAXA 5EG0B 1BISA 5L3CA 2Q3SA 3G4SN 2KJCA 5FPMA 4N76A 2KKZA 5FPDA 3TAQA 2A5YB 3PL8A 4U0YA 4RW4A 2A1SA 3HOUJ 4FE7A 2HW3A 2X6XA 4NCAA 4BGBA 3S1RJ 4WXDA 1V4RA 5AQRA 4BROA 1TKDA 2LK2A 3KKSA 3HJEA 1TNTA 3BZCA 4I76A 3H5AA 3K9TA 4BE1A 5EGOB 1HXDA 2VKHA 4E7KA 1S3XA 2YHWA 3FXUA 3U3GA 2DMPA 2EJRA 4RAGA 4BAYA 2EX3A 3OYJA 2O3FA 1APLC 3K1PA 3SEQA 2DFEA 4KTWA 4DSEA 1VRUA 2NRWA 3OMYA 2O8DA 1S72N 1WKMA 3MQ0A 1YRNB 4OO1J 1TK5A 4WF9L 3O8HA 4B9QA 3R1XA 4I7HA 4A5MA 3T69A 1ZBUA 2CQXA 1LQ1A 4DR6K 1Q1VA 4RM2A 1YG2A 4C8NA 1NGHA 5LRRA 1VQNN 5FLXK 2V79A 2O61A 5D5WB 4KAZA 1FP2A 1XWLA 3RSEA 2E1CA 3ZMTA 1UHSA 3MZHA 2BOLA 1FY7A 3E1SA 1HF0A 3LALA 1VFCA 1DTQA 2VQEK 4CBXA 3ZYYX 3HBTA 5AIPA 1MMGA 5AQFA 2XO7A 3EY1A 3K4CA 1Z0XA 4YFXF 3WG7H 4DR4K 3R60A 2O8FA 4KN4X 1RT1A 2EBIA 2M3AA 1NOZA 3ENBA 5DM6L 4OIPF 3ZT3A 1KU3A 4P96A 3LAPA 4ILHA 1K6OA 3E0JB 4ZYEA 3FXKA 4LF7K 1S9GA 1ERDA 2RF2A 3K57A 4U88A 1SFKA 4PGGA 5D3GA 1IUFA 1NKEA 3TQNA 4DF8A 3HI0A 4CBWA 5D8LB 3K4KA 3EUHA 3L7WA 3R9PA 3AKZA 4BRQA 4EATA 1S7OA 1Y6IA 1FOKA 1WRJA 3V7SA 3F8CA 1BHLA 4A3FJ 1WUAA 2RPIA 4HUFA 5K7ZA 4HZFA 3T5XA 2CWEA 3T1BA 3K9JA 4XRFA 3ZSRA 4E7LA 3FMRA 2I8DA 5BRDA 2WAFA 3RMBA 3J80Z 1M1KO 3C95A 1LEBA 5DS9A 4B9LA 3H92A 1ZGAA 2M45A 4BRIA 2BTFA 1ZHFA 3DPUA 3VYSB 3J7AO 4KHWA 1PUFA 1HJRA 2FJ1A 5BPDA 4B9VA 2CFOA 3OYBA 4CJQA 3BG3A 2TRTA 2Y31A 2W24A 1XS9A 2LF8A 3LL3A 1BI2A 1LEAA 4TV7A 4BBSJ 3I64A 2XHKA 2D5VA 2QSGX 1P90A 2YHXA 2NRAC 4PCQA 4AIKA 4WFBL 2FE3A 3HYIA 2XPWA 1WJAA 3JAMZ 2E2NA 3P39A 5EEAA 2JPBA 1JLBA 1DPRA 1QQCA 1MDMB 2MH9A 1HR0K 2PAVA 1KAZA 2OQGA 3FISA 3GXOA 5KQDA 5K5OA 4RAFA 1T6SA 3RMAA 4PFOA 1ITGA 2WB1A 2Q2EB 4BQLA 4CCLA 3EQLF 3UKUA 1QSYA 4ISEA 1S7AA 3KP4A 1JKHA 3V1OA 2IVNA 1RT2A 2FNAA 2XB0X 2YS9A 4MO7A 2VJ4A 1DUXC 1XHXA 3QLHA 2A6AA 1CXUA 4F55A 1SKWA 3ZGKA 4DS5A 2PMZA 3O3FA 4FJ9A 3SBTA 2JSCA 2A3ZA 4L9NA 3V8LA 2ELJA 4FJHA 3O3HA 2CUEA 2QK9A 2IGKA 1JLGA 2HDWA 4A3GJ 3F3XA 3IMXA 3DFGA 4MLEA 2E2JJ 3ITHA 2X6WA 3OYEA 4WE1A 3M7GA 1C6VA 1TL8A 3I4PA 4CZCA 3F23A 4O3MA 4RCHA 5AQNA 2AQEA 3J7ZO 2BHZA 3BTLA 1T98A 4YOYA 4CIFA 4K8XA 1PJRA 4GY2B 2DK5A 3M1CA 2PN6A 3FWEA 2P9IB 1BI0A 2OC6A 5C2FA 3OOPA 1RDWX 4H5RA 3M8RA 2WFBA 1TBXA 2F2EA 5DD4A 1O13A 5AQTA 3ECOA 3ZQHA 1RTHA 3HP6A 4CK1A 3BROA 2K86A 2F4MB 1TKXA 1EWQA 2IJLA 1SMYF 2OF7A 3SZGA 3AG3H 1P4WA 3KEOA 3SZ2A 5IOZA 3N4QA 1KVAA 1HQEA 1W2BM 3O9TA 1VQ7I 5J1EA 5ILUA 2ELHA 2DDAA 4CDGA 1MA9B 2PLYA 4DQ2A 1NJYA 5BREA 1S1WA 1ZRFA 5CPRB 3LWFA 3RQ4A 2L7ZA 2EILH 3G1MA 3BF1A 4BEHB 5HODA 1GLEG 5CJ9A 1FYMA 3LDLA 4IZZA 3GO5A 3DTEA 3X2QH 2Z1JA 2HHWA 3S1NJ 1FZPB 4CERA 4B4CA 1JL2A 2AP1A 2VIXA 3HYFA 4KNYA 3U2RA 4YDUA 3A02A 2OPRA 1ZC6A 2K3PA 2GXGA 3WT0A 4PL8A 2GV9A 3EEQA 4ZC3A 5BPLA 1P8ZA 5B1AH 2VWBA 4MHGA 4CZGA 4DQRA 5GAEJ 3OW2M 4IOAF 4DU1A 4XR6A 4XN3A 5AQUA 4BU2A 4HSRA 2W6LA 4AHTA 3C18A 2DBBA 1SVMA 4O6JA 4IFYA 1NGEA 4CCOA 3PO2J 3DTIA 4PSWA 4UVBA 3SMPA 3HHGA 4H4MA 4B3OA 1QO0D 2E7WA 4LK0F 1U9OA 2YI1A 5GAGP 3OIOA 4LLGF 4UUSB 3ABTA 1H8AC 2JN6A 5JVGL 2R5ZB 5FFZA 3BTIA 2BW3B 4Z4CA 1C0UA 2QXLA 3LSTA 5DV5A 2K5CA 5K5QA 2ESNA 4AH9A 1J5OA 2R7RA 2EFPA 3C7NA 4KFBA 4OGCA 2M87A 3WXMB 2GWJA 3PV8A 2F5CA 1KTQA 1SFXA 3PSIA 2BDPA 2W25A 4KI6A 2C6YA 2HQRA 1XCBA 1FT9A 2XF5A 4UNOA 4R79A 5HS8A 3E9LA 3D2EB 3JRHA 1WB9A 1ETKA 4CEDA 2JZYA 3SI6A 1K8KB 1BO5O 2QWMA 3GL1A 4BY1J 1VQ7N 1GV2A 2P9UB 4ZYHA 2A6HF 2DFIA 1TQMA 2YJFA 3S32A 3RZDJ 4IWVA 1L3SA 1T95A 4F91B 3ZQGA 3CQZJ 4YFKF 5CVJA 3KVGA 3LZIA 2NS7A 2D5RA 3N4MA 5L3EA 4H0YB 3DKYA 4BQAA 1KFSA 2PY5A 3OS2A 1ETVA 2I5UA 4L9VA 1GLAG 4E1NA 4AIHA 4HAMA 3NH0A 5A2QZ 3ESWB 4IHVA 4Z0UA 2E1YA 4B1UB 5IY5H 4IXAA 3AFHA 4MNUA 4GGGA 2VGMA 3KK1A 2QWRA 4IOCF 4CZEA 2H3GX 2NRHA 2EA4A 2KPMA 4LGWA 1B9MA 3RPUD 1QTMA 3MEEA 3NEUA 3DEEA 4V2GA 4IXCA 2P5OA 5E1ZB 4DZPA 3LDPA 1PYVA 1U47A 3CF2A 4UUTA 1ATRA 4JX6A 3JSMA 2QKBA 3OS0A 4ZYAA 2E35A 2R92J 2QLZA 4RGRA 5JLWA 5HRNA 1UAXA 2E19A 3FFKB 4JLHA 4JKBA 1PVEA 3KWIA 4E0DA 1ILYA 1DGKN 4DQ8A 2FC0A 2O5RA 3ML6A 4CVNE 1WSGA 3A1YA 3SPYA 1Y8QB 3LANA 4JKDA 4IJAA 2QWWA 3CO7C 3E5QA 3NFAA 4DOZA 1YTYA 2QSFX 2OU2A 4XSXF 1FIAA 2A5XA 1CF7B 3I53A 3A0HC 1TP4A 4AHUA 4IHSA 4QWQA 4B3TK 3NF8A 4G94A 3OJUA 1T08B 4Q48A 2F7TA 3LP3A 2MABA 4BRLA 3W2AA 4FVUA 3HVTA 4HRIA 3CF5F 4OKJA 3CCVI 4EJVA 3J81O 4ZHRA 2FLOA 5CR4A 1KQ9A 4BRPA 4B8CA 3KP7A 3OBYA 3GLLA 1U5TC 3L3VA 2LFBA 5TRDA 4HQEA 2WAEA 3NGIA 4XORA 3AG4H 3G2BA 4WQ4A 1CGPA 3V9UA 4DYCA 4BRCA 3CMAI 2CGPA 1VQKI 1XD7A 3AARA 2A40A 2YPRA 3VGMA 3RRGA 5GPAA 3D2FA 5AQYA 1WSHA 1VSIA 1JLCA 3HGGA 4D7NA 1HNXK 1HSJA 3ZEUB 1JJ2M 1BBYA 2WTUA 3DKWA 4OOIA 2R7XA 2O03A 4H5VA 3E66A 4GDFA 3DXJF 1SFEA 3QEVA 1TWHJ 2KHOA 5LEJA 2E2OA 1BC8C 3CLQA 1A5XA 1OCPA 1T38A 4A3JJ 5DD8A 1O3QA 3ZSQA 2NVXJ 4FWLA 1FYKA 3TDZC 3TI0A 1H88C 4Z6YA 3W2VA 3HPOA 2Y69H 5CZ2A 4G6QA 2M2EA 1W7PB 3ZN1A 1B59A 2W85A 2HMPA 3WXIA 1REPC 3H0DA 5AQPA 4NCGA 2XKOA 3RYRA 3RI4A 2V6EA 4DTMA 5E18F 4ASNA 1W0HA 3ZN0A 4HUGA 3QINA 2HNYA 2HHHK 2DAOA 1R58A 3ZT1A 4PWDA 2FUG2 1IKVA 4LB6B 3IUCA 2D1KA 1RDDA 3FZKA 3A0BC 3BR3A 3NQOA 4FT8A 4XLEA 3A4CA 2HQAA 3DLGA 3N05A 2HBLA 3KYDB 3CJAA 1NJXA 5E8GA 4B47A 3PO3J 1B92A 3UR3C 4LLNA 2D0BA 3CCVN 2HZTA 1V55H 5HDNA 2F9TA 2R7ZJ 6PAXA 2FD5A 2M30A 1QQNA 2KIMA 2QBYA 4CZLA 2FU4A 1U8BA 3S2WA 1OCTC 4MO5A 4BREA 4RGXA 5LD2C 4FZZA 3VTIA 4FPAA 5AQMA 2YNIA 1GUUA 2LOOA 1R49A 3CJQB 3D5RC 2OPQA 2IXSA 4GMJB 4HV6A 3IG1A 2HXIA 1VQKN 1KZHA 1BQNA 2BV6A 2X1EA 4ID1A 2DMTA 3VQ4A 1DT9A 4FJ8A 4H8KA 2HNDA 1ASWA 5C25A 2X51A 1QU3A 3WTUC 3RKQA 1T8IA 3OTOK 1NOYA 4EM2A 2XAHA 1WWXA 2BEOA 2ZXHA 2R5YA 4Z4FA 4LF8K 2RQQA 3R6MA 2UU9K 1A5WA 5J3LA 1F9NA 3L09A 4JK9A 1AKHA 4B9TA 5HS7A 3A01A 3GFMA 4FW1A 3WTYC 1HYVA 4C8LA 1XC5A 3HK2A 2P5VA 2M4KA 2W00A 1TK0A 4EV0A 3QYFA 3PNVA 2DJIA 1J59A 3MN9A 2EB7A 3LZJA 1XGOA 4EZ6A 4A0XA 4AUXA 1BI4B 3QMLA 4I99C 4LF6K 4EJTA 4Z94A 1YJ9I 4CD1A 3GZ6A 3ROUA 3TTFA 4IHYA 4A0YA 4CEZA 4E19A 1T6DA 3Q7CA 2JUCA 4FSVA 2PBIA 4H0XB 4KH4A 4OKEA 3AO3A 5B8HA 4DBQA 2X1CA 4XRSA 5FO5A 2DA2A 3SJJA 5M5WJ 3FHZA 2ICWG 4D0PA 1MNDA 3HOZJ 3UE5A 4H03B 3KKRA 1Z3XA 1WAJA 2LR8A 4B48A 3MEGA 3R8EA 2L9SA 3M8PA 3VSKA 3SFIA 2LYCA 3WNEA 2D1VA 1B8IA 1WPKA 3AL0B 1Z3YA 1UCRA 4DV6K 1X9MA 3GF2A 1JCGA 2O0YA 3WTVC 4C2TA 3Q7BA 3WEEA 2O4IA 2ACJA 5LHGA 2KIQA 5C2DA 4DUYK 1HOMA 5FROA 2HHVA 4YG2F 1Z05A 4JKHA 2VONA 2HBKA 2UUZA 3DEUA 1I39A 3H35A 1QQMA 4DNCA 1S1VA 2G7UA 2RHKA 1GDTA 4LD5A 1Y97A 3KZBA 4P1WA 3GEZA 2HOSA 2HS5A 4CCKA 1DKGD 1HW5A 4Y0WA 3HXLA 3BY6A 3TO9A 5LMNK 4MTDA 1BJAA 1LFBA 4CGDA 3CFRA 3SAHA 1GV5A 1S6LA 1XCVA 4HX8A 5D6FA 3I59A 2P9SA 1W5TA 1BR1A 4G9ZA 4ZDOA 4FLYA 3DLLF 1NKBA 4AILC 5C0YA 3EYIA 1FC3A 4AHSA 3A2KA 3KEYA 1BR2A 2XPVA 3COAC 3DYAA 3HTUA 2EWSA 3GLXA 3BG7A 2F48A 5LGUA 5C12A 3VA0A 4OLBA 3AGKA 2E1NA 1BG3A 1O4XA 3F8MA 1REVA 1JE8A 5L3DA 1FKPA 4F2RA 4CH7A 3LDOA 2YX6A 4B9MA 2UV1A 5EEGA 4PKHA 1UHWA 2RN2A 1NK3P 1NNEA 1A5JA 4A3BJ 1NMDA 3HB9A 3H5RA 2OYQA 3KZZA 4D1QA 5EG0A 1YJ9N 2WV1A 3TO6A 4UVAA 5IOYA 3PX0A 3GYHX 3IRRA 3NF9A 1FW6A 3BG6A 3Q5FA 5J1UA 1EQYA 3VPZA 3BF3A 2PG4A 1RT4A 1K78A 2YKNA 5F1JA 2BZTA 1VQMI 1LWCA 2MGQA 4N4OB 4BE0A 4YOUA 2NVYJ 1WFXA 1W9HA 1SAZA 1NTCA 2BH1A 2DMNA 1HDPA 3OYCA 4JD2B 1Z7LA 2HOTA 1Q8IA 3NRVA 4K25A 2OAZA 4M6XA 1TNSA 4RW9A 4OU0A 3I33A 3FDYA 2VASA 4E4HA 4BRNA 3K5NA 4M3FA 2ZJRL 4BYYA 4HF1A 3CUQA 1L3LA 2HYGD 3MWMA 4ESBA 2JA6J 1RIOH 4Z4IA 1YRNA 2PYJA 4B44A 3THYB 3CCSI 3IC7A 4LFBK 4CEFA 3HSEA 3SQ1A 4RB0A 3VQEA 3ZQLA 2GWRA 5LEKA 3RJPA 1TKZA 4Q0BA 2L2OA 2P1JA 2PQ8A 1O3RA 2Z16A 3LOCA 1R23A 2LDUA 3PX6A 3TAGA 4J8FA 3OJSA 4Z2YA 2QWPA 1LE8B 4ENJA 3BJ6A 1JKQC 2EPFA 3AO5A 4PA1A 1BJZA 5CYVA 3OYIA 1D3YA 4DFPA 4GYGA 1P7IA 2B4JA 4A3MJ 4NB4A 1A6QA 4W1UA 3QYBA 4Y7NJ 5H20A 5AZIB 3ABKH 3DCFA 3G71I 1UG2A 3C6HA 1D4XA 3NVMA 2BGGA 4KO0A 2IS1A 2K4BA 3QFPA 4JI5K 3AVJA 1S29A 3VQ6A 4A2AA 1DTTA 3NMUA 4BR5A 2I5JA 4M6VA 2LG4A 4LH4A 1JHFA 2ZKZA 2ZMEA 5FRNA 3DBLB 1Z26A 2XAGA 2GELA 3PNTA 2YV0X 4KICA 5FLMJ 3C2GA 1ZG3A 3U1DA 1XDUA 2W42A 1JJ8C 4J2BA 1D5AA 4DV0K 2GUIA 1J6ZA 5M1KA 2E71A 1KU7A 4F3OA 1ZXOA 3ATVA 4L5JA 1QRYA 4DQIA 2CH5A 1KU9A 1VQMN 5B1BH 1TUYA 2ECCA 4F4KA 4FZXC 2F8TA 2GQQA 3T1AA 2HYFA 1XC9A 3TAPA 2V1XA 4RM3A 1FOXA 3KJVA 5AFUH 1IRGA 4ANJA 2PMUA 3VFZA 4G7OF 1BW6A 2HNHA 4B1ZA 1ETXA 2JVGA 4I02A 1EH7A 3KD5E 2H8RA 4L0ZB 1NM1A 5CE3A 4E1MA 2E1MC 3ZRGA 2I7PA 4JP0A 4BWMA 2EZKA 4E89A 3FK7A 2HKOA 2QWOA 2VXZA 1BOAA 2LMDA 4FLXA 1QSLA 2Y75A 3FR0A 5JICA 3M8JA 3K5OA 4N5SA 1LNWA 3CCSN 1S8NA 4P9UA 2IS2A 3CO6C 4I01A 1JT0A 4QIWN 3S17J 5AIQA 2IGMA 3PM1A 4D5FA 1WSJA 3RR8A 1NK9A 3IUOA 2P9KA 4CJWA 4FJLA 4U7DA 2G8UA 2GXBA 2HEOA 1W36D 1T3VA 1HJOA 1CXQA 2LD5A 1OKRA 2V1NA 1X1AA 5J2NA 3MKLA 2L54A 2XRIA 1JLQA 3IWFA 2X1DA 5KTQA 1R00A 4A3DJ 3G71N 3CMEI 5E17F 2FBIA 3C65A 4L8RB 1I1GA 3NVKA 2XUBA 2VBYA 1Y39A 3G10A 5EOYA 4ZZDA 2ZFWA 2OJED 2M0CA 4KYWA 5M1QA 1P4XA 2XROA 3GE1A 2X74A 3KZIC 5H1SQ 5EY4A 4H0TB 2JK3A 3V9XA 3GFIA 2J5OA 3AVGA 3L9FA 1FSHA 4DBRA 1Z9CA 1FBUA 3HUGB 1E3MA 1XSVA 4N9IA 1X1DA 4KTZA 4ILGB 4ABZA 3JCUC 4DGWB 5JHFA 1DP7P 1DU6A 1SV5A 3HZ6A 4H4OA 3QPLA 3TSPA 2J5PA 2P9IA 1LV5A 2VJIA 2V1UA 1TT5B 1YIOA 3PJRA 4GKJK 4UY8O 3IKVA 3O4QA 1XG1A 3WG9A 3C2BA 2R7WA 3AG2H 5JHUA 1S1TA 4D5CA 1E4GT 4J01A 3SUOA 4B8AB 3ZETA 4L0YB 2XY7A 4RS8A 2JT1A 3PIPF 4K42A 4NQWB 4XSZF 4M42A 3SDBA 3DXKB 2WAQA 1JLFA 4B9NA 5KGXA 4DCHA 1ITYA 2KHMA 3AV9A 2N8GA 1LFUP 2IA0A 1S6PA 3FM3A 4ZTJA 1Z7UA 2PFUA 1ZREA 3Q3SA 2NVUB 3I8BA 1VQLI 2DLLA 3Q0WA 4BEHA 2DK8A 3KX2A 4BC3A 1HKTA 1EO1A 2YX7A 4NNJA 3I0SA 4I7FA 4OVLA 4YIIA 3H36A 5DUIA 3TSUA 2Z9OA 3HM9A 1WOQA 1AOYA 2KRHA 2W84A 3WU0A 2QM3A 4GVEA 3SAGA 2Q0OA 3O5BA 2Y48A 2BXZA 4ZZLA 3KTQA 2QQ9A 3E6CC 5J1RA 3MXJA 3VF2A 3SAFA 1IXRC 5ICCA 1F5TA 5J8CA 4W5RA 3F0CA 4PJNA 3GTJJ 4FE4A 1ZN2A 5AR0A 1NK4A 5HOOA 5K7FA 1Q1HA 1IJJA 4PGHA 1LB2A 3H6EA 2IGNA 2CGKA 1NK0A 1N75A 2V7FA 2KJBA 1TUUA 4EEFG 3VEYA 2LF7A 5E84A 1MJBA 3LSPA 1BI1A 4Y13A 4NB5A 2CQNA 2GOMA 2M8GX 4AU7A 4RW8A 3MAJA 2R7OA 2V1DA 1W4MA 4FK4A 2OPTA 2OTLI 4CK3A 2QEXI 4FWSA 1QPIA 3DJCA 4DWIA 2BW3A 2XY8A 3T1YK 4M3UA 1Q7YO 3ULQB 3RQIA 3WTZA 1YQAA 4DUZK 2O8XA 3VESA 4BRFA 4UB8C 2DJNA 4JS5A 2FQ4A 4ITVA 3RPUA 2VOOA 1TWGJ 4I2QA 1RDCA 1VSEA 4DYQA 3FF5A 3C3WA 2E36A 3U3YA 2KLOA 4DSIA 3HTSB 4HBLA 4EMSA 5CLSA 1BIAA 1F43A 2BGCA 1HKGA 4KDPA 4D7MA 3BR2A 1L0OC 2E4LA 4WXHA 2HF4A 1YX5A 5IPAA 2KW4A 5BNGA 4JKGB 5H2FC 3OYNA 1FOWA 4E7IA 1OISA 5LHHA 3BPXA 3VSLA 3ABMH 3FMSA 5KVRA 3PX4A 2M4GA 5DM7L 4DU3A 2UXNA 3CDHA 2K9NA 4OIOF 3LFUA 4M45A 1VQLN 5FLXZ 2ZJQF 3HZJA 1QBJA 5E26A 3KLGA 1BGXT 4DR7K 3HM5A 3T8TA 4DG1A 4XK4A 1X3UA 5E1XA 2VG6A 1OH8A 4LK1F 3BOQA 4CHPA 3CESA 2QQ8A 4RTFD 2G7HA 2Y30A 4BS9A 3GCMA 4XONA 2FNPA 1TYQB 1ASVA 2KTQA 2KISA 3OS1A 2GAUA 5DCFA 2O8CB 1KA8A 4CJPA 3RTVA 3WXJA 2HU9A 2XAQA 4B9UA 3M1FA 1LJ9A 5HLHA 1MNMC 1XMOK 4L9JA 3BQZA 4E7JA 4FLZA 4NO7A 4EJOA 3M8FA 3CP2A 1KSPA 2YHBA 4U7BA 3WUHA 2STWA 5E20A 4DSFA 4XLAA 4YNQA 4U67L 3ZT2A 2DA7A 2XRNA 2QQBA 4YELA 2AA4A 4KT6A 1FSEA 2FBYA 4W5NA 3CC2N 1B1BA 1K79A 1G2HA 5HRRA 1F36A 1C0WA 3ZP5A 3CJCA 2JSPA 5M1PA 1WH7A 1FP1D 2OTLN 3ZMZA 2QEXN 3BCBA 1SUQA 1OCRH 4RGUA 5TKWA 1MNEA 2JA7J 1Y1VJ 3SJHA 4CF8A 1TK8A 2G9WA 1VSMA 1RDAA 4IRIA 1ZR2A 1JCEA 3NGYA 1JUPA 1S5LC 1ZGJA 1LAWA 1SD6A 5EDNA 1IG7A 3P31A 1TT0A 2QKKA 3OOUA 1R5HA 1T0FC 1UJ8A 3AAFA 3T0YA 1K4SA 3AVMA 2RE2A 1RBUA 2A42A 5JVHL 1WH5A 2V26A 4C8OA 3FM5A 1U2VA 4IO8A 4DR3K 3K2AA 2BXYA 4DV5K 4FJ7A 2DOEA 4DV2K 4KISA 2HI3A 3AL0C 2DTRA 3CD6I 1LPQA 3ID8A 2ZSIB 1RUNA 4G9YA 2GXAA 4NC8A 3F8BA 4ICLA 4A3KJ 3LQRA 4A6DA 4CJTA 3H5NA 1X19A 4AHRA 4IBNA 1KYWA 4KPYA 4FOEA 3RKXA 3J7YP 2EINH 2EHGA 4C2UA 1JXSA 2ZMEC 4HQMA 4IPAA 1EH8A 1MMSA 2LREA 4M3XA 1YS7A 3THXA 1TLHB 1VF9A 5J40A 3ZOBA 4CUGA 3PUFA 3L2VA 2L4MA 4XLPF 2GX9A 3MN6A 3SYTA 3A5OC 2KFDA 1W5SA 2V51B 4HLXA 2EZHA 2XPUA 2EV6A 1XNQK 4A62A 2BE2A 4NC7A 5EF6A 5C10A 1D8YA 3ABLH 1WI9A 3HXMA 5BQTA 2HF3A 1U04A 1EV7A 4NLBA 1ESVA 2O8EB 4ELVA 2CO5A 2X6NA 3CJRB 1RKWA 1GLLO 3HL8A 4GKKK 3SCXA 9ANTA 3ZSZA 1BU6O 2Q1NA 3ZQIA 3LP1A 1Z1DA 1BM9A 1LDKB 1WJCA 3CLOA 4JI1K 4BH9A 5F0HA 1ACIA 1RT6A 4JHDB 2MG4A 1XGMA 3NAEA 4KIGA 2WBMA 1QSSA 2KL4A 3NH2A 3HSTB 3LNQA 1E3OC 2OD5A 1E3HA 3TO7A 1X3MA 4BQNA 4CZFA 1LCUA 2NAZA 1GLBG 3BJOA 3L3UA 4BGAA 4AM6A 1HNWK 2IP2A 2VC1A 3HOVJ 4EM0B 5JFRA 1NGGA 4B1VA 3TKYA 3FZFA 2F8SA 1C0TA 1FIPA 3DLBA 4JBAA 3EO3A 5J2MA 1G3TA 2VCPA 4IOAL 3K7AJ 3JS6A 2Q1ZB 1WI3A 2STTA 2NRZA 4B43A 4KKOA 3WODF 5EU7A 4I6MA 5JLXA 1C0MA 4Q47A 4OPJA 1SFOJ 4KA4A 2ASMA 3IH4A 3PNYA 4DF4A 4IL6C 1K73O 1L3TA 2KRFA 2LRDA 3UKGA 4Y4RA 4JX4A 4CJSA 4ISGA 2YU9J 4DKWA 5GINA 2ID6A 3CETA 1VRTA 3AVKA 3D7EO 3T7ZA 2W48A 1A36A 2V6CA 4BR2A 3PQJA 4J19A 5LRSA 1EWRA 2LSNA 3L4QA 3HSCA 2QVOA 1HKCA 3AO4A 2CG4A 4CZKA 1XGSA 1U9NA 3FIWA 2OCCH 2FF4A 3JRDA 3VEPA 4C8KA 4X66K 2K27A 4E3SA 4HSTA 1GVDA 3H1CA 2FEZA 4B08A 1IRFA 4PL7A 1YE9A 1RFQA 3TWHA 2AQFA 4ENNA 2H94A 3DXMB 3QOEA 1SL2A 4WF2A 3ZSWA 1BR4A 2RDPA 4HNTA 1TW3A 5JR3A 5IP9J 4U0WA 2IT0A 5IT3A 1U2WA 4L9TA 2NRVA 1L3VA 2K9QA 1D1BA 1LFPA 2IVMA 2PJPA 3VEWA 1QVGM 2WOMA 2O8DB 3LA2A 3B8AX 1JL1A 1BI4A 3WXLA 3TABA 2XGXA 5C4XJ 4OIRF 5M3FJ 3H9GA 3BZ6A 2FF6A 1H9TA 3OVNA 4ID5A 3F6VA 1VQ6I 1K7AA 3ZMUA 3QRFF 2CV0A 1UOCA 3T1HK 3VQQA 2KFZA 5ED4A 3TW7A 4IHXA 2GLOA 3RSEB 3K1NA 2HZDA 4XQFA 1YW9A 3I4NJ 4FCYA 1O3SA 4BC5A 4I9QA 4IQJA 5A2QO 4BY7J 2Z1IA 5TGTA 4RG8A 4CCMA 4UQGA 4Q5VA 2DN0A 4BRHA 3K5LA 1CZ9A 2XASA 1SVOA 3E9OA 3HL2A 1FTZA 1WSUA 1NGAA 3LWLA 3P5JA 2O8FB 2G8VA 4F3QA 1YX3A 3B6PA 1E3PA 2F4VK 4HYEA 3UB5A 2VE8A 2I7NA 1W0TA 2GUPA 2FMYA 2D0AA 2NS0A 1D0ZA 4CYCB 1NKCA 1QZEA 5KAIC 3VQ5A 4HHTA 3KZYA 3WQUA 3GTQJ 4AD9A 3KK3A 3FBNB 3PIOF 2HPMA 2G8KA 2RKIA 3BJAA 1YVUA 1Z77A 3RMDA 4XNFA 4DV1K 4PK4A 4HF2A 4AM3A 3S1MJ 1RRJA 5IT9K 1VSDA 3CF5L 1SD5A 5I9EB 3NBPA 2VODA 4QLCU 1KFDA 2VWKA 4FJJA 1RR7A 5FB2A 1OVQA 1ZARA 1DP3A 1N34K 1IKXA 2XGEA 3F73A 2F96A 3LA7A 3QNNA 1EF4A 3V81A 2H1KA 1YF5L 2KZVA 1MDUB 2AHQA 1BW5A 1RNHA 3W3CA 3CYMA 5C44J 3H3OB 2XAUA 1TV6A 2HHTA 3K4NA 4H5NA 2BANA 1FOYA 4II2A 1D1AA 3FZLA 4KHQA 1YJNI 3C6UA 1N32K 2LVSA 4CW7B 5GTIC 1Z6TA 2XAJA 2RC4A 4BG8A 2QUFA 2YR2A 4QSHA 2LY9A 4LOCA 4M41A 4QPQA 4PHTX 1VQ6N 1IBLK 1S6QA 3G6EI 3O80A 3CCJI 5L3FA 4WQ5C 2JLEA 3MD2A 1HPZA 1FJLA 3O9UA 4MO4A 4Y1CA 4XM3A 3U6FA 1ONVA 2PX9A 4CHQA 1RILA 2ISZA 3H0GJ 2DYRH 4I2OA 2G8WA 2F5VA 1RBVA 2P6TA 2RNJA 4JD2A 4BXXJ 4ENKA 1ZQ3P 2F5EA 4FWKA 3BPVA 2OQRA 4KIFA 2E20A 1YTAA 1QHGA 4OWRB 4RB3C 3FZHA 1EKEA 2EZLA 2R0QC 2H27A 1I50J 4LG0A 3FXMA 1A04A 4NC6A 3M3ZA 3QU3A 1OH7A 2OV7A 1O57A 3OYFA 4EHTA 4RWTA 3ZSVA 3ZSYA 3SUQA 3GVAA 1UB9A 2F5FA 4XRSG 1N5YA 1XC3A 1W7AA 4CGGA 2JUGA 4GCVA 2DMQA 4MQ9F 4CHNA 1M1EB 1BC7C 2FA5A 4G8XA 4OMZA 2VKDA 4FJXA 4HV5A 4NCBA 1XDSA 5ERIA 4DW6A 5F08A 1J75A 3PLAA 2YU3A 2QM1A 2XIGA 3D0PA 4XEIA 3V8JA 4KITB 3QQAA 1S7EA 4GXOA 1RBTA 2KFNA 1P7JA 3CPWM 4XKBA 4A69C 2E5ZA 4CA0A 3QETA 5AZIA 4H0PA 3MX2A 2VJJA 4M7XA 2VB6A 4II3A 2XSDC 4LC9B 5BOXA 3THVA 4FLVA 2E2HJ 4LFUA 1S9HA 3QESA 3ZCOA 1N6QA 1YJNN 2W6KA 2F4OB 3AAQA 1KGSA 4IO9F 2MLKA 2LC2A 1YT3A 2ITMA 4JI0K 3MEDA 1D9DA 3G0ZA 2DA1A 4KI4A 3AA3A 4CZJA 1SD4A 2KMUA 3G6EN 3IAM2 2VPLA 1VQPI 3UKRA 4FLWA 3CCJN 3LQQA 5GIPA 3MXIA 3S9HA 1ZBFA 1CZBA 1ZTRA 4C30A 1STZA 2DMUA 5K1YA 4HF0A 1UHMA 4DV3K 4U87A 3CPEA 2X6SA 1WBDA 2ESHA 5FDLA 1C0FA 3VGKA 3DM2A 4H0VB 1LW0A 2PJRA 2VYPA 1BQMA 2UUCK 1R36A 1QZYA 2LSOA 2P9LA 4PQUA 3TP3A 3DOLA 2Z5UA 1BDGA 5IYCJ 3VQCA 1XB4A 4C3JJ 4MTEA 3W6JB 1UG0A 1NHAA 3F2KA 1D8JA 4KJZA 4EGZA 3O4NA 3DP7A 1BIZA 1RZ4A 1T33A 1N36K 1LVAA 3ID6A 1D1CA 5EYRA 5TJJA 2O9LA 1VTNC 3BR1A 5SZTA 2OZ6A 3DRSA 1NGFA 5LY3A 1NGCA 3HRGA 5KPZA 3U21A 4AYBA 1HSTA 4A5NA 3QIPA 1UMQA 4QS7A 4OJRA 2ZGZA 2P5KA 2XDVA 3KP2A 1MBHA 1P4AA 1FXXA 4LD0A 5HP1A 1AHDP 5LJWA 2LKSA 3C7NB 5BMZA 1T44A 5KRTA 3M5RA 3H9JA 1MWKA 4M63C 3HC7A 3DLKA 3DF8A 4CGZA 3K58A 3SQ2A 3AVAA 4CJ5A 3WNHA 3RCOA 1IJWC 2QZ8A 1J5EK 1KQ8A 1MKMA 2WUSA 3KLNA 4A6EA 2K02A 4DTPA 2OCEA 2FX0A 3NF6A 4H5WA 2DCEA 1TZLA 1Z6RA 1O1WA 5C15A 5E79C 2HHXA 5BPIA 2E5NA 1JKPC 3NF7A 2XV4S 1KXPA 4PJJA 2DDBA 3E5UA 3VEXA 4I09A 1X3NA 3DLLL 1OJLA 1QZZA 3AVIA 4ZDPA 1VQPN 3C0BA 4HDVA 4BL0B 1TKTA 3AGRA 3P9KA 4BKXA 3SV3A 4CK2A 4FASD 5AQOA 4JAXA 4A12A 3ZT0A 1MWMA 3TGNA 3QEPA 3DI6A 2BY2A 4CEBA 1FLIA 3TSQA 2KRCA 2VG7A 3E6MA 3K2PA 4L18B 1V4TA 3KLEA 4DLEA 4BDPA 4LMYA 1IO2A 2FQ3A 1IBKK 3FMQA 2FBKA 1AWCA 1YOVB 4NQWA 3FK6A 3DXKA 4BJTA 1PDNC 3QEIA 4KUMA 3EKSA 1JTXA 4O5BA 2V52B 3VPRA 2E1OA 1WVRA 3HKZA 1QA6A 3PFYA 2QWNA 1Z25A 4YOTA 1LWEA 2WC9A 1J53A 3TU5A 1DGRM 3J7YJ 1HNIA 3ERED 3VERA 1IV0A 4FM1A 2FSWA 2O4GA 2IBDA 3O9QA 4YOWA 4OAYA 5AQXA 3P4IA 1WGXA 3VF4A 1T8EA 4KTQA 1JI8A 4KMUX 4PUOA 1R6RA 3GTKJ 2CFXA 1NGJA 4A3IJ 3L2UA 2GWKA 1D8KA 3DRRA 1VQ4I 1L3UA 4M71A 2B63J 2OZMA 2VQCA 5BN8A 3S1QJ 3MMYB 4HX4A 3S15J 2VQHA 2HVSA 4ZDLA 4BHPA 3AVHA 3CQ8A 3ISNC 4FWMA 5E3NA 2VLAA 3E6BA 1FWZA 2GTDA 4IDHA 5J8FA 2DA4A 4DV7K 3O3KA 2E2PA 1Z67A 1S1UA 4CJLA 1I1SA 5IYBJ 2JVHA 4DV4K 5F2RA 5J4YA 3TAMA 4JKCA 2AJQA 2O8KA 4ETSA 4CEAA 1HQCA 2ITGA 4JV5K 5HRSA 3P83D 3D2FB 5AQHA 5CYMA 1I3QJ 3RIRA 4BGDA 3M4OJ 5IWAK 2VPRA 1SL1A 2QENA 3IWZA 2E1MB 4FK2A 3VYUB 4HTUA 3THWA 4DB3A 1JLEA 2MLGA 4MIMA 2BY3A 4AHCA 3K4LA 3EE8A 4M9ZA 1HDDC 1W97L 4A2UA 2LBFA 3KLIA 2GZWA 3CQYA 4CE9A 2QSHX 4LF9K 4JK8A 4J00A 2CS3A 4JKGA 4JI2K 1UA1A 2KDZA 1QVFM 5F1RA 5F0FA 4DTNA 3SLCA 2MW8A 3QBXA 2K3FA 3S3OA 5KPTA 2F5DA 4FOIA 4OPKA 1HKQA 2Z1HA 2ZJRF 1DQUA 1SMTA 3J7ZI 4XOPA 1XHZA 4RLFA 1QE1A 3KK7A 3ZQ7A 1G3YA 3HSFA 4PJ0C 2OA4A 1XMKA 2MA3A 4CGHA 1U4BA 3RKWA 1XQSC 4CJ3A 4XKCA 1UELB 4G6TB 2NVQJ 4A57A 2RGVA 4A3CJ 1OH5A 2ELKA 2E7XA 2YCHA 3QERA 1RDUA 5AZJA 3P38A 5BRFA 5DEQA 3L0QA 5GPCA 3EZ5A 1VQ4N 2HHQA 1X9WA 3HRUA 4B1RA 1MJ9A 3GUDA 2CMPA 2ID3A 1B6AA 4AIDA 2DT7B 3KLFA 4BNCA 3HSRA 2HR3A 4IG3A 5BR8K 1N77A 2RREA 1IRXA 3OYHA 3O3GA 1RTJA 4LH5A 3QYEA 5IYDJ 1QS4A 3IAS2 4CZHA 3ZQFA 5HLTA 3QPSA 4E6KG 4FLUA 3BR5A 1BA5A 4O8UA 5AQZA 2D45A 4F92B 4BR9A 2H09A 1HYZA 2JPCA 1J0RA 2DQLA 4M9XA 3CCYA 3LDNA 3K6GA 4MFDA 4CEQA 3HJFA 2QA4I 2GBYA 2ZNZA 2ZWHA 3H3VK 1ATSA 4M74A 3ZMVA 2KQ2A 3V4GA 3GTMJ 2QWLA 4B3AA 3IDHA 4J2AA 1I27A 2FSKA 1VK0A 4O5VA 2KIFA 2A41A 2B9SA 2X48A 1V54H 4WCEL 3J81K 1AKHB 4UXNA 5HLIA 3ZSOA 2HGCA 3NWTA 3AAPA 2BUPA 3F9MA 1GHCA 1NGIA 2HOEA 3W6KB 3PO5A 2VQGA 4WCGA 5HDGA 3LAJA 3H1QA 2ZBKA 1B72A 2XKPA 1X1CA 1RGIA 2HMIA 3LPTA 5FKNA 1TWFJ 3P9CA 3EYZA 1ZBIA 3G73A 3HRMA 4RBOA 4D9JA 3F22A 1ZRCA 2DT6A 4CGFA 1R9TJ 5J4VA 2DO7A 4BRGA 4W5OA 4EQQA 4KRFA 1ZH5A 3KYCB 1RDBA 2E6LA 3SUPA 4NDLA 3OA9A 1D5VA 1BCMA 3MAQA 3FXQA 2HSTA 4F2SA 3RKYA 3F5TA 5LHIA 1TQIA
chains in the Genus database with same CATH topology
5KI6A 1T8EA 4FJGA 2IAJA 5E41A 4KTQA 1JLGA 4CHNA 3KJVA 3E01A 2KW4A 1VRTA 3KKRA 5J2QA 1WAJA 3NFAA 1KRPA 3AVKA 3MEGA 4PUOA 4OLAA 4EZ9A 3ITHA 1WSFA 1HRHA 3OYEA 3M8PA 4WE1A 4HCBA 1F21A 3OYNA 1C6VA 4E7IA 1NK6A 4KHUA 4ZTFA 3L2UA 3WNEA 3OYKA 3AVLA 3DRPA 4CEOA 4FJXA 3V9ZA 2VWJA 1QHTA 4NCBA 2QXFA 3DRRA 3KD5E 2LSNA 3B6OA 1L3UA 1BISA 3PX4A 4CCHA 4AHUA