1IO2A

Crystal structure of type 2 ribonuclease h from hyperthermophilic archaeon, thermococcus kodakaraensis kod1
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
213
structure length
213
Chain Sequence
b'MKIAGIDEAGRGPVIGPMVIAAVVVDENSLPKLEELKVRDSKKLTPKRREKLFNEILGVLDDYVILELPPDVIGSREGTLNEFEVENFAKALNSLKVKPDVIYADAADVDEERFARELGERLNFEAEVVAKHKADDIFPVVSAASILAKVTRDRAVEKLKEEYGEIGSGYPSDPRTRAFLENYYREHGEFPPIVRKGWKTLKKIAEKVESEKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE HII
publication title Catalytic center of an archaeal type 2 ribonuclease H as revealed by X-ray crystallographic and mutational analyses.
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
total genus 69
structure length 213
sequence length 213
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2000-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 1io2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1io2A01
5J2MA 1U47A 3IRXA 5EU7A 1WN7A 2XY8A 4F8RA 1QQCA 4KO0A 1RTHA 4DFKA 1TGOA 1ZYQA 2D5RA 3AVIA 4JRPA 3DM2A 3SCXA 1VSFA 3MEDA 2BGGA 4E3SA 1RBRA 1YTAA 1VSDA 3DRRA 1XWLA 2FC0A 3LZIA 2HHTA 2E4LA 3IG1A 5KGWA 3QIPA 1TK8A 1NJYA 4AHTA 2A1RA 3QO9A 2ETJA 4Z4CA 3OS0A 4EZ9A 4PUOA 4M3YA 3PX4A 4CK2A 1JLCA 3HT3A 1BQNA 4W5OA 3AVNA 2FBTA 2IDOA 5JS1A 3ALYA 4PWDA 2Z1IA 2VWJA 4FLUA 1KRPA 1FKOA 4CJKA 4Q5VA 2F8TA 4CESA 3AVFA 3DMJA 3LAMA 4B8CA 4MQ3A 4DSKA 1D9DA 2ZD1A 1RDAA 1NKEA 4B9SA 1N5YA 2G8WA 1ZBIA 4FLTA 3PV8A 4IG0A 1UAXA 1CLQA 1VSLA 3QLHA 2P1JA 2Y1IA 4H4MA 4Y1DA 4OPJA 3VQPA 1S6PA 2YNGA 1TAUA 1HYVA 1ASWA 1KVBA 4AH9A 5T7BA 4DQRA 3SI6A 5D3GA 4ICLA 3QEVA 1WSIA 3PO5A 4N41A 3T1AA 2R7YA 1WNSA 4RG8A 3QETA 1KFSA 2DFEA 2BANA 4JLHA 4ELTA 3AA4A 3OJUA 2X74A 4CJUA 3ZSVA 4FLXA 4BE2A 4HUEA 1NOZA 2G8VA 2KFZA 3L3UA 4E7KA 3VQCA 2KTQA 2LSNA 3PX0A 3SJJA 4KHWA 2YKMA 2HNDA 1S1WA 4JRQA 4IFVA 3VQ8A 4Z4GA 4Z0UA 3M8RA 2Y1JA 4KTQA 4L8RB 5FDLA 2B4JA 2BE2A 2Q3SA 3G10A 3ZSRA 3QNOA 3HPHA 3AO4A 2G8UA 1UA0A 1RBVA 1ZBUA 3SUQA 3BDPA 4M42A 3DLBA 1L3SA 3LWLA 3LPTA 4DU1A 1HPZA 4CEAA 4CJWA 3D0PA 3RWUA 1Y97A 3MXJA 2NUBA 1NK8A 2P51A 4C8KA 1VSJA 1JKHA 4FCYA 1TL3A 1Z26A 4B9UA 5HRSA 4Z4FA 2HHQA 4KKOA 3NF7A 3M8QA 3OYBA 4W5RA 1NKCA 4CJQA 1CXUA 1TAQA 1X9SA 2IS3A 1NK0A 4ID5A 3HPGA 3SQ0A 2HNZA 2EX3A 3MEGA 4JS5A 1WAFA 2RKIA 4FLZA 4B08A 1KLNA 2HVHA 2RPIA 1BL3A 3F9KA 4DWIA 4CF1A 1TKDA 3AVAA 4I9LA 2XRIA 1WSHA 3KKRA 3OYIA 4M3ZA 1ZBHA 4IFYA 4R5PA 4RW6A 1NOYA 3QNNA 1NJZA 1MU2A 2QXFA 3VQ5A 1J54A 5CYMA 4DG1A 3VA0A 4ZTJA 3ZSZA 5DMRA 4FM1A 2DY4A 3OYEA 2W42A 4O5BA 3O3GA 5KGXA 2YHAA 4NYNA 3LAKA 4CEDA 4DTJA 4DFMA 1SUQA 2JGUA 3KK3A 4C8OA 1F21A 3P1GA 4IKFA 1T8EA 4OLAA 4Y1CA 2VG7A 4CFCA 1N6QA 4NCAA 3V6DA 1RILA 1IKWA 3NH2A 2XHBA 5JS2A 1TKXA 3OJSA 3QEPA 1QTMA 4CCHA 1A5VA 4KREA 4DF4A 4KTZA 4BWJA 4OKJA 4CJ5A 2F8SA 3OY9A 4B8AB 3KKSA 1I39A 1SL1A 3AO3A 1HYZA 3CM6A 4CJFA 3M8PA 3TR8A 4I2PA 5J2NA 1RBUA 3K5NA 3C6TA 2QKKA 2G8KA 1RT4A 2XY7A 4OGEA 5HP1A 1RT6A 4E1NA 3TAMA 3K5LA 4H8KA 3VQEA 3EYZA 1EETA 2HNYA 4O4GA 1JXBA 4OVLA 3OYKA 3KK1A 3I8DA 4KFBA 2KZMA 3FFIA 3PY8A 3A2FA 1ASUA 1B9DA 1X9MA 2Z1HA 3VQ9A 3NAEA 3OYJA 4CGFA 3DLRA 4CHNA 3ULDA 2QKBA 5E41A 3C95A 2HMIA 3HSTB 5KRSA 1TVRA 4FJ8A 2FBXA 3AVLA 1UA1A 3QIOA 2KZZA 3AO2A 4OKEA 4CGDA 4IDKA 1WSJA 4DTXA 4DTMA 5HBMA 3RMDA 3VQ7A 1C0TA 2IGIA 2Z1JA 4CIFA 3L8BA 2PYJA 4C8NA 1Z25A 3ZT2A 3RRGA 3L2RA 2OZSA 1U4BA 4PQUA 4AHVA 1RDBA 1L3VA 3AVCA 3O4NA 1RDCA 4CJLA 4FJ5A 1C0MA 4CIGA 3O3FA 2ATQA 4IG3A 1EX4A 2WOMA 4E7IA 3THVA 4B9MA 3CFOA 3OYDA 3ZSYA 4Z4HA 2HHVA 5DK5A 1TK5A 3LP3A 3H08A 4AHCA 4F2SA 4CGIA 1C1BA 3V81A 2OPRA 2HW3A 4W5NA 2OZMA 3NH0A 1KVAA 4E0DA 4FJJA 4FJMA 2I5JA 3DOKA 4HUFA 3HL8A 5HROA 3DOLA 4FZXC 1VSIA 3LP1A 1EXQA 2DFHA 5HRPA 3UIQA 1BIZA 3HVTA 1S1UA 4M41A 3JYTA 1SL0A 3D45A 4Q0BA 4QCLA 4HHTA 1XC9A 3QESA 4KAZA 4W5TA 4PA1A 2OYQA 4K8XA 1HRHA 1TKZA 3C6UA 4KHUA 1B9FA 3OS1A 5J2QA 1RT7A 4N56A 3V9ZA 1CXQA 1KCFA 1WSEA 1JL2A 1HNVA 4FJHA 3NGIA 3V1OA 1QHTA 1RT5A 1YT3A 4CJPA 3DYAA 4O0IA 2FBVA 1NK4A 4FYDA 4B9VA 4B9TA 3DLHA 4NYFA 3TABA 2Z1GA 3NFAA 4CEBA 4BACA 1S1VA 3K5OA 4IBNA 4DS4A 3SUPA 1RT3A 3SYZA 1NJXA 1L3TA 4I9QA 2BDPA 1TKTA 2X6SA 1SV5A 1JLFA 4I7FA 4RW7A 3CFRA 3LP0A 4KHQA 3KLFA 3RMCA 1L3UA 4DTNA 1IKYA 3F73A 1HNIA 3SQ2A 4OKKA 4DQIA 4KI4A 4CEZA 5C25A 1REVA 3TAFA 3KD1E 4M3UA 3HPOA 4E7JA 3SUOA 3HVRA 3TARA 2P5GA 2A1SA 2X78A 4F2RA 4G1QA 2X6NA 3VQBA 3NGYA 2GUIA 3ZT0A 1TL1A 3CG7A 3NDKA 3LZJA 4FJIA 3HJFA 1DTQA 2IAJA 1VSKA 3K5MA 4F3OA 1QSSA 3OYHA 1J5OA 3ZCMA 3DLGA 3BGRA 1S1XA 1HJRA 3S9HA 5HRRA 2EHGA 5CZ1A 1VK0A 4HCBA 4DU4A 3CM5A 2HHWA 2XY5A 4NCBA 4CHYA 1NK9A 1BCOA 3AO1A 3L2UA 3SV3A 4EZ6A 4FJGA 1XI1A 1LAVA 1VRUA 2GV9A 3OYAA 1JXEA 3NH1A 3TI0A 4CGJA 2VG5A 4MFBA 4KPYA 4GVMA 4O55A 3V9UA 4CERA 3ZSXA 3SQ1A 3KLIA 2YHBA 3MECA 4PY5A 1KTQA 1C0UA 3O3HA 1BCMA 3NCIA 4FJ9A 3S3NA 1J9AA 3QEIA 2F96A 1C1CA 3SPZA 4YFUA 4KRFA 3V1RA 4M3RA 3PUFA 4FJXA 3AVMA 3AV9A 3RTVA 3P5JA 1Q9YA 1RTDA 4UQGA 4J2AA 4DMNA 1RDDA 3AVJA 4CJ3A 4M3TA 4CF0A 3S3MA 3ZSOA 4DSJA 2OPPA 4OJRA 2PYLA 3V1QA 4W5QA 1FK9A 2QK9A 4FM2A 3K57A 4C8LA 4DFJA 5J2PA 3DRSA 4DSLA 4AHRA 4DSIA 1S9EA 4FZZA 1WSFA 1SKRA 3SQ4A 4AHSA 5SWMA 1X1PA 3KLEA 3DLKA 3AA2A 3EZ5A 2ZQBA 3MAQA 4CGHA 4F4KA 1HQUA 4KB0A 4JS4A 4DLEA 1IKVA 3VN5A 2WONA 4HUGA 1DTTA 1NK6A 4KV8A 3TAPA 1KFDA 4GMJB 3RR7A 1B92A 4RW9A 5K14A 4FW2A 4CHOA 5HRNA 3NHGA 5J1EA 5KRTA 1T05A 4FJLA 4KHYA 4CGGA 2RF2A 4CFDA 3K58A 5CYQA 2PY5A 4CHPA 4CJRA 4ZHRA 3SZ2A 3K2PA 1ZBLA 2DTUA 1HQEA 3TANA 1D8YA 1GOBA 3ZT4A 4CEOA 3HO1A 1JLBA 4E89A 4XIUA 4BDZA 3L3VA 3VA3A 3RMBA 1S6QA 3RMAA 1QSYA 1WAJA 4OPKA 3CFPA 3SUNA 2O4GA 1RBTA 4EP4A 4OGCA 4LSNA 4F3TA 2OA8A 3KLGA 4CF8A 1RCHA 1VSEA 4M45A 3OVNA 4CHQA 1SKWA 4AHUA 1VRTA 1VSMA 1U45A 1W0HA 1ZBFA 4CEEA 1TV6A 2PZSA 4DQQA 1LWCA 3LPUA 4CE9A 4E19A 4FLVA 4FLWA 3DLEA 3O4QA 4CEFA 4BE1A 3V9SA 4DTOA 2P5OA 4FK2A 1YTUA 2E6LA 3QINA 1EP4A 4DQPA 4LY7A 1LWEA 1U48A 2FBYA 1JLQA 1FXXA 1GOCA 1KSPA 1BI4A 4B9NA 1K6YA 1RTJA 1NK7A 1XHXA 2G8FA 2E6MA 1A5WA 2HHSA 1QE1A 1ASVA 3VQ6A 1U49A 4DQSA 1BHLA 2ZE2A 4BWMA 3ASMA 1G15A 3VQDA 1RBSA 4FJNA 3LANA 2XO7A 3VQAA 5SZTA 3SPYA 2OPQA 2KW4A 4J2BA 1JLAA 3I0RA 4EP5A 3LWMA 4LH4A 3SV4A 1RTIA 1NKBA 4DU3A 2XY6A 2HHXA 3AVHA 5C42A 1DLOA 1SL2A 2YKNA 3VQ4A 3OYCA 3QEXA 1HYSA 4FLYA 4DTPA 3T3FA 4GW6A 5I3UA 1IO2A 1QSLA 1D5AA 4QAGA 4KTWA 4CF2A 4DLGA 1FKPA 4E7LA 1Q9XA 2YNFA 3KIOA 4FVMA 3K59A 3TAEA 4O0JA 1IG9A 1I3AA 3G0ZA 1JLGA 5CY4A 3OYFA 3HXMA 3OYNA 2G8IA 1EKEA 3AO5A 3DI6A 1LV5A 1L5UA 3RR8A 4NCGA 3ITHA 3MXIA 4LH5A 3AA3A 1WSGA 4ID1A 1GOAA 4FM0A 2KFNA 1LW0A 3P83D 4E1MA 4FZYA 3KK2A 3VQQA 1WLJA 3L2QA 1UOCA 1LW2A 4CK3A 4DTRA 3RRHA 1ITGA 4K8ZA 4DS5A 1UWBA 4CJTA 3M8SA 3V4IA 4CIEA 2G8HA 1RNHA 3U3YA 1S9GA 4HCCA 1NK5A 2OPSA 5FRMA 4CFBA 4J2EA 2O4IA 1C1AA 1CZ9A 5KTQA 4N47A 3HM9A 2AJQA 4FJ7A 4QOZB 1BISA 3OYLA 4ELUA 4TSXA 5C24A 2GBZA 1S1TA 1CZBA 4Z4EA 2YV0X 1A5XA 3ISNC 1D9FA 1JLEA 5FROA 3MEEA 4ELVA 4FK4A 2VWKA 1XHZA 1BIUA 3KD5E 2ITGA 4N5SA 1Q8IA 3B6PA 4CJVA 4FXDA 5FRNA 1KLMA 2VG6A 2B6AA 4CJEA 3IS9A 5CZ2A 2JLEA 3C94A 1O1WA 4O44A 3TAQA 4H4OA 3B6OA 4M3WA 3CQ8A 4J2DA 1S5JA 3HP6A 4KHNA 4YNQA 4KI6A 3S3OA 4LD0A 1BI4B 4ZTFA 3AA5X 3QEWA 1C6VA 1J53A 1T03A 1R0AA 2HB5A 4BE0A 1RT1A 4CHZA 3NF6A 3ZT1A 4CEQA 4C8MA 3NE6A 1X9WA 2YNIA 3MXMA 3KTQA 2RN2A 2IC3A 3WNEA 4CJ4A 3OYGA 3OS2A 3NBPA 3AVBA 3T19A 1LWFA 1T7PA 2DFFA 3HK2A 1KVCA 4RW4A 3SNNA 1NJWA 3HYFA 3JSMA 3LP2A 4KHSA 4HTUA 2HHUA 3ZSQA 3DRPA 3V9WA 4AILC 1YVUA 4OLBA 3EY1A 4FW1A 4FJKA 4DTUA 3WNGA 3KJVA 3E01A 1IH7A 4CK1A 3OYMA 3QERA 4B9LA 3WNHA 3PO4A 1IKXA 4DFPA 4Z4IA 1SKSA 4CECA 4KB1A 1TK0A 3U6FA 4BDYA 4DF8A 5HLFA 3LALA 1JL1A 3NF8A 3ZSWA 3HP9A 2D0AA 4CJSA 3IAYA 4CFAA 1HMVA 2YNHA 3NF9A 2KQ2A 3WNFA 4DTSA 4I2QA 1RT2A 1VSHA 4DSEA 4FK0A 1U04A 2B5JA 3ZT3A 3TWHA 3TAGA 1BGXT 2D0CA 3L2VA 4BDPA 3CYMA 4CF9A 4M3XA 3KLHA 3U3GA 3AVKA 3I0SA 4HVJA 3L2WA 3V9XA 3LDSA 1W9HA 4N76A 1BQMA 4LSLA 3NGZA 4E7HA 4DSFA 4B3OA 4WE1A 3AVGA 5KI6A 3PX6A 5I42A 4RW8A 1QS4A 2HVIA 1LAWA 2D0BA 2IOCA
chains in the Genus database with same CATH superfamily
3WTTC 1KC8O 3JTGA 3CP2A 4E70A 5FO5A 5DM7F 2BGGA 5E18F 1RBRA 1VSDA 3BTCA 4BR5A 3JRFA 3PX4A 1BQNA 3DP7A 2UXCK 4IL6C 4OIOF 1RDAA 2NNYA 3OA9A 2IA1A 1O3RA 1S72N 5T7BA 2P5KA 1QPMA 2PI0A 1X4OA 1WJEA 3AA4A 5GAEJ 4BE2A 4Q5SF 2ZXIA 5M5WJ 3VQ8A 2HR3A 5FD6A 5IT3A 2FEZA 4FSVA 1NH3A 3ZQHA 3MXJA 1TWFJ 1Z6TA 2Y30A 1JKHA 4CO8A 4LJZF 1IN8A 2IVMA 3DKYA 2Y9ZA 2VODA 1WB9A 1MMSA 2EX3A 1RDUA 1BL3A 1LVAA 1TKDA 1QHGA 4RW6A 2NRTA 2BTFA 4O5BA 1LQ1A 4C3IJ 3MCAB 5ELZA 2XHBA 4DF4A 3HIFA 3FXQA 1UG2A 1OISA 2HKOA 2Z5UA 2BXZA 2LF8A 4E1NA 4OIRF 2R4GA 1WI9A 3KZYA 1JCFA 4YFXF 5E17F 3CCUI 4DTXA 1MH3A 5HBMA 4LFAK 1C0TA 4N9HA 2VKVA 1FBSA 2WOMA 1OCCH 2JUCA 4Z4HA 1XMOK 4D0PA 4BY1J 5HROA 4NHJA 4Q47A 5EVZA 2JPBA 1U6ZA 4M41A 2LYCA 2P81A 3WXIA 4KAZA 5DUKA 4YDUA 4FJHA 1U2WA 2DOAA 4O0IA 4O5FA 2O8FB 4A3EJ 2E35A 1PDNC 2HXOA 4NDLA 1TKTA 2JRTA 3SQ2A 4KI4A 4XMYA 2BVLA 3TW6A 5EY4A 1V55H 4L9JA 5F04A 4XH5A 3GMEA 4JYAK 4HEA2 1XUPO 2XPVA 4A5NA 5CVUA 3AG1H 2ESHA 2K85A 1HW2A 3ENOA 3I5UA 1RDDA 4YG2F 3AVJA 4CJ3A 1WKMA 2PYLA 1BI1A 4FASD 2MYSA 2MW8A 5AQUA 2L9SA 1TT5B 1YI2N 2QENA 3GDQA 2FQ4A 3DXJF 3SK3A 2ZC2A 2XF7A 2VXDA 4UXNA 2HPMA 1UELB 3SZ2A 3VA3A 4U0VA 4EJOA 4EP4A 1RBTA 3JAMK 3K9KA 1MH4A 1N33K 2O3FA 2RAEA 4A3BJ 5IPAA 2FJ1A 1GOCA 1K6YA 3TPQA 3K0LA 4NQWA 2HZTA 4ZYHA 3K6GA 3HL2A 2ZE2A 2V52B 4DZPA 3JRAA 2OCCH 4KUMA 1G15A 1RBSA 1NG7A 2L54A 3FISA 3K69A 4U0WA 4GFBA 1RTIA 1DLOA 2OTJI 3LDPA 4M6VA 2PAVA 5CY4A 1JLGA 1LV5A 1OMIA 5EGOB 1S7OA 1GOAA 3QRFF 4DTRA 1LW2A 4AIHA 3G1LA 5FGMA 4GGGA 1QA6A 4X64K 3HM9A 3ZQ7A 1BR4A 5D8LB 3EZWA 1OJLA 2F4IA 2AXLA 4EHTA 4GNIA 4KI6A 3I71A 3E7LA 1YHQN 3E3VA 1RT1A 3TQNA 2O61A 3I53A 3T5XA 4DUYK 3TMOA 4BU2A 1JXSA 3V8KA 4LLNA 1XSVA 4XSZF 4FW1A 2FMLA 2DK5A 2V9VA 4B9LA 4HYEA 1SFXA 2K40A 3E66A 5AQRA 3I55N 3RKQA 1TNSA 2DMNA 4I01A 1ONVA 3CYMA 1XS9A 4ABZA 4HVJA 1R58A 3S32A 2M8EA 4E7HA 4WE1A 2F5CA 4BNCA 2GXAA 1QS4A 2D0BA 1J6ZA 3K4LA 1JHFA 2M30A 1XWLA 2QM1A 4A61A 1SMTA 4I2OA 2E4LA 2BW3B 5KGWA 4BRKA 4HX7A 2WV1A 1JGGA 4MQ9F 1XMQK 5TKYA 3CLOA 3AVFA 1JGSA 4MQ3A 4FLTA 4XRSA 2X4HA 3MVPA 3RCOA 3OSFA 1T38A 2P1JA 4EJVA 3TOBA 3VQPA 1DP7P 3P31A 5CHIA 4ENKA 3LSRA 3O9TA 1SZ2A 1VQON 3SJJA 2KRHA 4XEIA 5CLSA 2DA1A 4BHPA 2B4JA 3G10A 4BR2A 4BYYA 3DLBA 2E7XA 1DT9A 1FYKA 3RWUA 2CV1A 1ATRA 3PIOL 3WEEA 5FKNA 4RM3A 3DTEA 2P9LB 3FMRA 4NXNK 4ID5A 4ZYGA 3AVAA 4X6AJ 3C6AA 1K73O 3MWTA 1NJZA 5H2FC 2K7LA 4DHYA 3HRGA 4LC9B 3G3ZA 4EIAA 2ECBA 3V6DA 1QTMA 4LB5A 1HYZA 3LMMA 3DWLE 3K5LA 3ZLJA 4BC2A 5D6EA 3DPTA 3PO2J 3FM3A 2RC4A 1RDWX 2EFOA 4L3QA 3UE5A 2CUJA 1S7AA 3K2ZA 2UXNA 3THWB 4H5TA 2H94A 3BZCA 1UAAA 2X1CA 2O8CA 1WJFA 2COMA 4UNOA 4EAHD 1HA8A 4Q0BA 1X4PA 4XOTA 5CVRA 1BR2A 3KEYA 2CH6A 1HRHA 1I5ZA 1PUEE 5CJ9A 1RT5A 4CA0A 4C2UA 4JKBA 4XOPA 2YJEA 2X6SA 1G2HA 4JKGB 3CCJI 3GTQJ 2QQ9A 5B1BH 1TT0A 3CG7A 3NDKA 3ZN0A 3OYHA 4K25A 3KLOA 4RB2C 2WAFA 2QWNA 5HRRA 4DR7K 1WVRA 1DDNA 4WF2A 4B3RK 3HB9A 4PZJA 1UMQA 4KIBA 3ZSXA 3NCIA 4FJ9A 3SEZA 1W36D 1WBDA 2CW8A 2NNWA 1KU2A 3AV9A 5E26A 4OJRA 3D7EO 3M07A 3AKZA 4KN4X 2WY8Q 1XB4A 1YVNA 4BXFA 4K0KK 1LFBA 3CMAI 2XROA 4C2TA 3DFGA 3DPUA 3F72A 4CJRA 4BC3A 3E6MA 3JW4A 2M7BA 1NGIA 3CJRB 3RMBA 1S6QA 4OPKA 3WQTA 2OA8A 3Q9SA 3H45C 2JSPA 4F7ZA 4E19A 4FLVA 1VQNI 3CCUN 2GELA 1FXXA 3RPUD 1KSPA 4S0HB 5EEGA 2XIGA 5A2QO 2NRAC 4ESBA 5AZIB 4K42A 5BOXA 3VQDA 4HZFA 4FJNA 2OV7A 1F43A 3I0RA 4HNVA 1Z67A 1YJNN 4L0YB 5I3UA 1HCRA 2A5WA 1IN7A 3G0ZA 2G8IA 1IV8A 4ILGB 3BR0A 2F4OB 5M5XJ 4JI5K 4PJ0C 1LW0A 1BI0A 4P55A 1BW5A 4DCHA 4DS5A 4CIEA 2PMZA 2QQAA 1T33A 1CZ9A 1QVUA 2LNBA 3IP4B 4RLFA 3E5UA 1O3SA 5FRNA 2DJNA 1U2VB 3CC7N 3O5BA 3TAQA 3B6OA 2V9PA 3O9QA 3DLAA 4BRNA 3J7AO 1TUYA 4FWMA 4H0VB 2KIMA 4C8MA 1VQ7N 3G71N 5AQFA 4AU7A 3JSMA 3LP2A 1TWHJ 5FPEA 1MMNA 4DTUA 2UWMA 4MGRA 4C1NI 2KQRA 1XMAA 3FBNB 4RWTA 4GKJK 4XKWA 4HLXA 4BEHA 4CFAA 3ZQGA 3L7WA 2KIFA 5M3FJ 2XF6A 4DSEA 5FJ8J 2EV6A 1S6LA 4B3OA 3WTUC 3PX6A 1FIAA 3MN2A 2E1NA 4RW8A 3A2KA 1PP8F 3AVIA 3DM2A 5J8FA 4BRQA 1YTAA 2XKOA 1EO1A 3WGGA 3OS0A 4EZ9A 4BC4A 5CVJA 2FBTA 2Z1IA 3TTDA 2BVMA 1ZH5A 4IEJA 3DMJA 3D2EB 1D9DA 2NVYJ 4X62K 4Y1DA 5EG0A 2GM4A 4IQJA 1OLTA 3T1AA 4BRLA 2BANA 4JYKA 2GTDA 1ITYA 4FWRA 4WXHA 2ESNA 3L1PA 2D1KA 3HGGA 4KTQA 2P9NA 3G1MA 1RBVA 4CBXA 3HUGA 4OOIA 4ENNA 1Y97A 3DXKB 2V1NA 2BHYA 2P7VB 3W0LA 4EM0B 4Z6YA 2J5PA 1VQLN 4A0YA 4BC5A 4FLZA 4JS5A 1W5CC 4A0XA 2D1VA 4M3ZA 4JI1K 4EJTA 2O8EA 1UG0A 3ZQFA 5KPRA 2YHAA 1SFEA 4OX9K 2XB0X 1EWRA 3OL3A 2E5ZA 1P90A 3OJSA 3CCMN 1A5VA 5FD5A 1I39A 4C30A 3H92A 4OPHA 3LDNA 3MMYB 3VF4A 2YX4A 1EETA 4OVLA 5EGOA 1E4GT 1BG3A 3QDKA 3DLRA 2E2QA 1N25A 4N9IA 4BAYA 4AD9A 2Y2ZA 3VESA 3L8BA 2ZXWH 2GZWA 5EEAA 2R7TA 1OKJA 3O6BB 2LD5A 2OTLI 3S16J 3QYEA 1C0MA 3O3FA 5AQGA 1Z77A 4B1ZA 2K9LA 5LGNA 5DK5A 3B6CA 1K7AA 4B4CA 2VBXA 4KT5C 3M1FA 3W3CA 4DR3K 1RETA 2OQGA 3JRIA 3CJCA 1XC9A 5LEKA 2VJIA 3VDXA 2OUMA 2R5ZA 4GV9A 4LLLA 5IY5H 4UVBA 5AQHA 1QHTA 3VODA 5IWAK 4ON0A 1L3TA 3A5LC 2R5YB 3F73A 1UFMA 2Q2RA 4AM6A 3HVRA 2WBNA 1HX1A 2K3PA 2OZUA 2HQNA 3ROUA 4RB3C 2CH5A 1BOBA 2GV9A 3NMUA 3J81K 4B43A 4BR9A 3SQ1A 3D1NI 2YHBA 4PY5A 1FY7A 2AA4A 3IH3A 3PUFA 2BYVE 4UQGA 4DMNA 3M8JA 5M1NA 4JX5A 2OPPA 1FK9A 4FM2A 3K57A 1VF9A 5LGUA 4HWIA 4CVNE 4DSIA 3QPHA 2DPUA 3SQ4A 1T3VA 4QS7A 4A59A 1NK2P 1IG7A 3WTWC 3GCMA 5LJWA 2X51A 4ETSA 1ERDA 2PY5A 4CGZA 4UB6C 4ZHRA 4LK1F 4E89A 4U88A 4X65K 4CZZA 5IT9O 3DTKA 4Y13A 1V3FA 2V6CA 5EX5A 4AYBA 1W2BM 3UKRA 4PJLA 4ZDPA 3KP4A 4FLWA 4CEFA 1HSTA 3DCFA 3W3DA 4B9NA 2ITMA 4DGWB 3MAJA 3THXB 2BY1A 2DA2A 3OYCA 4BVPA 5J8CA 2QQ8A 3T1YK 2HSTA 4KTWA 1U8RA 1WZ2A 4IPAA 1LFUP 5KK1A 2NRWA 3WG9A 4ZYEA 4FZYA 2QQBA 4A12A 3F6VA 1WLJA 1Y39A 1UOCA 2P9SB 4CJTA 3ZR8X 4F91B 1R71A 2NRVA 4G12A 3M8SA 1E3HA 2HWVA 4HCCA 2ZGYA 3GYHX 2OPTA 1ZGJA 2PFUA 1VQMI 3U9GA 3VOVA 4G9YA 4MLHA 3F8NA 1K4TA 1BOTO 1JTXA 1R5HA 3ZCOA 4XH1A 1GVDA 2VE8A 4XRMA 2W48A 4HPQA 2YUSA 3BR2A 1IH7A 1FZPB 4V19S 3WTYC 3WNHA 3QP5A 1UCRA 3MMVA 3M8FA 3WXLA 3NF8A 4IOCL 4GVEA 2FNPA 4EFHA 3CMAN 3FXRA 4M3XA 4DQ8A 2CWEA 3WGIA 1A35A 1BQMA 4RAZA 4CCOA 2KL4A 3LDOA 5KHDA 4H0TB 4XLHA 4YIIA 2D5RA 3CQXA 3SCXA 3BZ6A 2PBIA 4E1JA 3FM5A 1VQNN 3QIPA 2DTZA 3A0IX 2R7FA 2ID6A 4U87A 1R1VA 3HT3A 2IDOA 1HKQA 2R7DA 3EE8A 2CW0F 5AQQA 1NKEA 3E9OA 1CLQA 2BUPA 1OPCA 2P8TA 3WU0A 1TW3A 3GG4A 5CKTA 3PO5A 1WNSA 3SBTA 3FMSA 2X74A 4DYCA 2EWSA 2G8VA 3L3UA 4FOIA 4MFEA 1X3WB 2Y1JA 1H0MA 5J1YA 4DU1A 5DD4A 5D5VB 1GLLO 2NXNB 3PNTA 1IN4A 3FK6A 2EB7A 3EKUA 3H5AA 2R7VA 5JMVA 2HNZA 3LA3A 2QBYA 2ZSIB 3VOEA 4ZTJA 3H9QA 3MDQA 5AZIA 3UKGA 3HHGA 4DQ2A 3P1GA 1FOXA 1E4FT 2VG7A 4HTLA 1GLNA 3S41A 1ETYA 2CUZA 2CV2A 4OO1J 2A5XA 4L9VA 5J2NA 4IO9F 1B8IA 1O3QA 2ZWHA 4ZH4F 3F8CA 4O4GA 2HQ5A 3KK1A 4EHUA 1X9MA 3NAEA 4KMUX 2KPMA 5E84A 3ID6A 4XLEA 4OKEA 1ZQ3P 1WSJA 1U4BA 2CQXA 2QEXN 9ANTA 3HM5A 1U2VA 2LH9A 4BQLA 2HHVA 3G4SI 4AHCA 4W5NA 3LSMA 2I5UA 2MD5A 1SD5A 3DOLA 4W97A 3UIQA 1BIZA 1LEBA 3D5SC 2K5CA 3CC2N 1S7EA 4K8XA 4H0XB 3CO6C 1ULYA 4CCMA 2RREA 1R4MB 2EA2A 1ZN2A 4RBOA 4B9TA 3TABA 3NFAA 1S1VA 1QQMA 3BG3A 1POGA 1XMKA 4BY9C 3EDPA 1IRFA 2ACJA 4DQIA 2RN7A 3BJ6A 4E7JA 3KP7A 2YR2A 3CC4I 1VSKA 4B3AA 1HJRA 2EHGA 1VK0A 2XY5A 2ZM6K 3AO1A 3BQZA 4EZ6A 3D6RA 3IFRA 3CQZJ 3VGKA 1ATSA 1KTQA 3EUAA 4JKFA 5C15A 4YFUA 3C18A 2IIRA 3LSGA 3P5JA 5EOYA 3GE1A 4M3TA 5IP6A 1O3TA 2FLOA 4W5QA 2ZMEC 1XMXA 1AWCA 4DSLA 2LKXA 4IRGA 2HOAA 3D2EA 3MAQA 3T0YA 3TP3A 3VN5A 2P9KB 3MZHA 3IH4A 3F23A 1NNEA 2VOOA 2HBKA 4A3FJ 3CFPA 2O4GA 4XSXF 2LFBA 2R7XA 4CHQA 2NRHA 4CDGA 3DLEA 1FTZA 2RV8A 1LWEA 4HBLA 5JHFA 1AKHA 1BI4A 2OTLN 4DQSA 3LANA 2W41A 4DR4K 3VQAA 2EV0A 4N4NB 5ICFA 1SL2A 2K86A 4EATA 1IO2A 1X1DA 3BR5A 4DOZA 3O9UA 1JCEA 1WSGA 3CHWA 3LAJA 1D5YA 4E1MA 1MNDA 3ZETB 2O4IA 4CFBA 4J2EA 1EH8A 1S9HA 3JRCA 2GBZA 4TV7A 2YV0X 3ISNC 4FK4A 3RSEB 1YRNB 1KLMA 2L3DA 1MWMA 3CUQB 4P5OA 4D5FA 2LREA 3QEWA 4OIQF 2ZSHB 4CEQA 3HI0A 5EYRA 1Y0UA 3O08A 3C6HA 5CYVA 3QMLA 1NGBA 4K41A 1T8IA 3KLNA 2RQPA 5F27A 5KAIC 5K7HA 3CUQC 1SKSA 1HF0A 2QI2A 2IA0A 4BDYA 3T8RA 1X3UA 1D1AA 2IGNA 5C10A 3HP9A 2F9WA 3UNGC 4I76A 4FK0A 5TJJA 3ASOH 3KYCB 4M6YA 2GXGA 3BT9A 1YW8A 3BR3A 5LMNK 4XN3A 2M5WA 1ORKA 3AVGA 2R5YA 5F1RA 1T98A 1LAWA 1B92A 2HVIA 3HTSB 1JUSA 1WN7A 1KGSA 1VSFA 3RKXA 4RAFA 4AHTA 1FSEA 4M3YA 4B09A 4EJWA 2VWBA 1YITI 1NG6A 1GLDG 4L5EA 1YJWI 4LF9K 5L3GA 4RGXA 3QFPA 4ZZDA 3LSJA 3OV8A 2M0CA 1S6PA 1T95A 3MQ0A 3C7NB 4ZZLA 2IPQX 4LG3A 1KFSA 3QETA 4LOCA 2E2IJ 3ZSVA 3PFYA 5J40A 1JHHA 5AQPA 2HBJA 2Q3SA 1UA0A 1ZBUA 3FXUA 3D0PA 3KYDB 3BR6A 2V6EA 1KQ0A 4PJNA 4PUSA 3BTIA 3CUOA 1SC7A 1U6GA 3HBLA 5E3LA 5C2FA 4WCEL 1DEJA 1FYLA 4KN7X 2KDZA 3MEGA 3LM2A 4B08A 1YX5A 5DDGA 1F36A 3KKRA 5E8IA 2Z1DA 4FM1A 3ZPLA 2KRFA 5L3BA 4NYNA 3DU6A 1SUQA 4IKFA 3JR9A 1P2FA 3WQUA 5K5QA 1BA0A 3VTHA 1R5GA 2M7AA 1HW1A 3C6TA 4J8FA 2F5FA 3O8HA 4HNUA 2QWPA 4A3JJ 4CGFA 4EEFG 3BEXA 3FXJA 2XSDC 5BRHA 3HSTB 2LF7A 3N4MA 1TVRA 2RHKA 1R00A 2BZTA 2KZZA 3AO2A 3J7ZO 2XAFA 5TKWA 3AG2H 1RDBA 2L4AA 5J1UA 1RDCA 3THYA 2DI3A 2DTRA 3IMXA 3H3OB 4E0DA 5J1RA 4HUFA 4JI6K 1T6SA 1WPKA 5HRPA 1KAYA 1I1GA 2GWRA 4NB5A 3A1YA 5IYCJ 1TKZA 3OOUA 1B9FA 5D4SA 2FBKA 3V9ZA 4MTEA 4DS4A 3CCLI 3CCSN 3A02A 1JLFA 3HPOA 3H6EA 3VQBA 2WV0A 4JBAA 4PK4A 2NOJB 3VYRB 4CYCB 4J19A 4NCBA 4CH7A 3I4NJ 1BDGA 1VZ0A 1LAVA 4CGJA 1AHDP 3TTFA 1EH6A 3FHNA 1G6NA 1ZG3A 4M3RA 4FJXA 4CF0A 3S3MA 3PIPL 2A6TA 4DFJA 4I6ZA 1G99A 5SWMA 2LKPA 3SZGA 3HOSA 4KB0A 3F8BA 4JS4A 1OYIA 2E2OA 2OU2A 3H5NA 3QODA 2VE9A 1HQEA 2E1MB 3R60A 3JRHA 3L3VA 2OZ6A 1NGCA 2M4GA 3IWFA 4M71A 4M45A 3M7GA 1ZHFA 3TDZC 2Y0MA 1E0EA 3FXOA 1X2NA 4GYIA 4BQZA 1OH7A 1UJ8A 2KKZA 1BBYA 4I0AA 5BR9A 1WJAA 3SMSA 4G6DA 1PUFB 3AAPA 4XLCA 5GADP 4MEXF 3G4SN 1N36K 4EP5A 3F0CA 1HYSA 2W24A 4IHXA 2O8XA 4FQGA 3IHUA 4JHDA 1Q9XA 1YO5C 2KLAA 1IW7F 2FF6A 3VERA 1U3EM 2COBA 2E34A 2X6WA 4LH5A 3GFJA 4M73A 3KK2A 2GOMA 3PIPF 4KITB 1MBFA 4XLPF 3ZX3A 4W1UA 4BRGA 2EIMH 3RI4A 5C24A 1KYWA 1ZGWA 5IYDJ 1BUPA 1Q8IA 1S3XA 3FR0A 2JLEA 4YNQA 3I33A 2P9PA 1FJLA 1T03A 4JD2B 2PQ8A 2E19A 4B3MK 3RZOJ 4I02A 3AVBA 4RW4A 1NJWA 3FZFA 3ZSQA 2JPCA 3BPVA 3ZXSA 2WY7Q 4DFPA 4R1HA 4DF8A 3GZNB 1Z0XA 4C2MJ 1HMVA 4FISA 3TL4X 5HLTA 5KVRA 4HW0A 3RQ4A 2WC9A 2HTSA 1VQ5I 3AVKA 4HRIA 4IWVA 2UUAK 3OW2M 4DR5K 4DV4K 3NGZA 2L7FP 3WU2C 5F1XA 3IRXA 2YX7A 2IW5A 3CPWM 1V5FA 2VGMA 2FC0A 1KQSM 5M3MJ 1RKTA 2A1RA 3QO9A 3RKWA 2W4SA 2ZMEA 3S93A 4W5OA 4M9SA 1TQMA 2L4MA 5IOZA 3LAMA 4UUVA 3VSLA 3PV8A 3I58A 5ICGA 2IGMA 3CCQI 2PG4A 4RA2A 2X6YA 2CV0A 3GZ6A 1LB2A 2P9KA 4MO4A 1S1WA 4KH4A 3IRQA 1NK3P 1HLUA 4M42A 1BA5A 2LMDA 1W5SA 3KK7A 3SAHA 3FZVA 1P92A 5E3NA 5HS8A 4Z4FA 3HTUA 4BS9A 4CJQA 5C2DA 1BJAA 4RB1A 4A3GJ 5LL6Z 4BHCA 3FKJA 2RPIA 4DWIA 1TQPA 4EQQA 5EJCA 4PFOA 3MCPA 1J2XA 2VC1A 4CZGA 2QA4N 2JVHA 1RILA 4CZHA 4WWCA 4A62A 5LLQA 1B9NA 4KTZA 4CYDA 4B8AB 3VSKA 1KQ8A 1YAGA 4CJFA 2DA7A 2Q2EB 1IC8A 3I56N 1NG9A 3OYKA 1WH7A 2M3AA 1ASUA 2X48A 2E2NA 3ZETA 3V8LA 1ZAOA 3AVLA 4E6KG 5AIPA 4CGDA 3DJCA 4IDKA 3I0TA 3ZMVA 3BP8A 2BHZA 4WQ5C 3RSEA 1ZGAA 3CFOA 4A2BA 3CUQA 5GAHJ 1AU7A 4I99C 3HL8A 1VQ6N 2OD5A 4HSTA 2DW4A 5CR4A 1YITN 1B59A 3D45A 3FFKB 4QCLA 2RNJA 5J47A 3TSQA 4EM2A 4W5TA 1YJWN 4A0ZA 3C6UA 1HNVA 5CPRB 1TK0A 1NJXA 3I3LA 2B9SA 4I7FA 3IL2A 4OKKA 2FBHA 5IP9J 2A1SA 2X78A 1Y56A 1TL1A 1BO5O 3G1OA 2XGCA 5JLWA 3ZCMA 3OBYA 5E3OA 2IEKA 2WB1N 3GTMJ 3BTJA 4FPAA 4JKHA 1R1UA 3GTKJ 1JE8A 1N32K 1ZG5A 2VASA 2Z99A 2FX0A 2Y75A 2YHXA 1WFXA 4HUGA 1BL0A 3CMEI 2KZVA 3C7NA 5F0HA 1D8YA 4BDZA 3QFUA 2QVOA 5B5EC 1QSYA 2H1LA 1NGJA 4OGCA 1SKWA 1LWCA 4CE9A 4UUTA 1XHXA 5F0FA 1ZTRA 1X58A 4DYQA 3EYIA 3KX2A 4FWLA 3BG7A 4H0EA 4GW6A 2PN6A 2EV5A 3AG3H 4GDFA 5BQTA 3IRRA 3K10A 1I3AA 4JOMA 3AO5A 2X6XA 1YJ9I 1VQKN 2JVGA 2FSNA 2K4JA 1UWBA 1W0UA 4RS8A 2K3FA 3U3YA 4A57A 1IDZA 2NNNA 1IXCA 1BIUA 3KD5E 1Y0NA 4CJEA 3CQ8A 2Y69H 1C6VA 2HQAA 4KIFA 4NQWB 3IAM2 2ZF5O 1GXQA 1FW6A 3MXMA 2N8GA 5HS7A 2ZXHA 5BRFA 2K9QA 1HUXA 5D4RA 2DA6A 3BCAA 1IKXA 4Z4IA 3V7SA 3GVAA 4UB8C 3LOCA 2VKHA 5D5UB 2O8KA 3BCBA 2JWLA 1J0RA 5BPDA 2JRMA 4JK7A 5GIOA 2QZ8A 5HODA 4OAYA 2BXYA 3BUZB 1SVOA 2CGPA 4I98B 4DB3A 2J5OA 3HRTA 5IT9Z 3K2AA 1LVKA 2K02A 3A5NC 4DFKA 2PX9A 1ZYQA 1QZYA 2R7SA 3KPHA 1ENHA 2C6YA 5D8KB 1N78A 4GO1A 1JLCA 2EA4A 1YYVA 4MDAA 1ZLKA 1GLCG 2YSRA 4IZ9A 2E2JJ 2XGXA 4B1XB 2L7MP 4UY8O 4XQFA 2Y1IA 2IS6A 4A2AA 1KAXA 5BPMA 4CZJA 3WXJA 4RG8A 1KAZA 4ELTA 4AC0A 4R8HA 2LSNA 3DBRB 2O0YA 3EPZA 4WQ4C 3ZSRA 1LE8A 3FK7A 3OOPA 1HKGA 2CSOA 1RI7A 1WUAA 2OA4A 4FWPA 1FOYA 4HQMA 3HBTA 5C12A 1V54H 1LDDA 4IF4A 2BY2A 3ZGKA 4IFYA 4HG2A 2Q31A 4Y52J 3WTSC 5CYMA 3VA0A 1VQ9I 3ZSZA 2DY4A 4DR1K 1PUFA 2GUPA 1NGFA 2QLZA 4C8OA 2F5DA 3F5TA 4CFCA 1MBJA 1XTAA 3NH2A 2DFIA 5JI6A 3LL7A 3PL8A 4JKDA 3CXCM 1B72A 3J7AY 1GLBG 2VCPA 1U0JA 1X3NA 3F8MA 4H8KA 3EYZA 4MQVA 4NBQA 4LIVA 2ME6A 5AQOA 3PSIA 1VQ5N 2VQLA 1IXSB 4K2EA 3KWIA 3Q0UA 2QKBA 1WRJA 2STTA 4IX7A 4IQ4A 4FJ8A 1UA1A 4ESJA 1YS7A 4H5VA 3RMDA 4PQUA 2FOWA 3ZT2A 3O4NA 1EX4A 2FQ3A 5FKOA 3CO7C 2HYJA 2FSKA 1M1EB 2JWTA 4N4OB 4K43A 2VXZA 4IOXA 2XPUA 3O80A 2XRNA 3K4KA 4DYRA 4DV5K 3HRSA 3BTLA 3CJ1A 4GRIA 1CF7B 3AG4H 3MN5A 4BRIA 2FSWA 1HNIA 3TAFA 3SUOA 2P5GA 1K4SA 3DLGA 2DO7A 1OH6A 3H3UA 2YHYA 2V26A 1MNMC 4GVMA 2L02A 2KIQA 5BMZA 3MECA 1XG1A 1C0UA 2K9SA 1J9AA 2O8CB 3J7ZI 4AF1A 3IH2A 1FJGK 4ILHA 4LFBK 3W2WA 1WH5A 2ZNYA 1H8AC 2PFBA 5LRRA 4F4KA 4PFPA 1IKVA 3CESA 4RLQA 4EGZA 3O9RA 3GOIA 4CEOA 1GLJO 4JI0K 4NC8A 3OVNA 1IV6A 2VJ4A 2EINH 1VSMA 2IS2A 1ZBFA 4CEEA 3OR2C 1IZ1A 4QWQA 4DTOA 2VOPA 3DKWA 2E6MA 3VQ6A 1U49A 4GV3A 4FWQA 4BWMA 5JICA 4J2BA 3SV4A 1B4AA 2XY6A 3KEQA 3HOWJ 3KIOA 3K59A 3O6WA 2FUG2 3BOQA 1OQYA 4BR4A 2BOLA 2FSJA 1W7AA 2JTVA 1XDSA 3OR1C 5BPNA 2Q2EA 4O8UA 1KA8A 4WQ5A 3CCYA 5FROA 3MEEA 1H89C 2ITGA 2MBFA 3UB5A 3NE6A 4WFAL 3UKUA 2FU4A 2P5LC 2I7PA 4HV5A 3GTJJ 4B3TK 2XAJA 3FXKA 1BIBA 1I6HJ 3E01A 3TSPA 2O5RA 4BJ5C 3BZKA 3OTOK 2DOFA 4KB1A 2UU9K 3QOPA 3BF1A 1NWKA 4Y17A 3NF9A 5L3DA 4U7BA 3TBIA 3ZQQA 4CBUA 3CMEN 1USTA 3O3KA 4QTRA 1K78A 4YFNF 4A6EA 4AIDA 3OSGA 2VBZA 2H09A 2RQQA 1WJCA 2VQCA 3C0BA 1RFQA 3MX5A 3S1RJ 2M45A 3ZP5A 2KRCA 4BBRJ 2V79A 2K4BA 2X6OA 1CQTA 4HF0A 5KPZA 2XASA 3LDQA 3D5RC 1DGRM 3QBWA 2KIUA 4BQOA 1VSLA 5E79C 4BEHB 1ZR2A 2R7YA 5L3FA 1B1BA 3S15J 4XORA 1YJ9N 1NOZA 1XGMA 2BE5F 2NS0A 4YORA 2KFZA 4CHUA 2H27A 3D0SA 2WWYA 4II3A 2DLLA 2E1CA 1MBGA 2ISZA 1GT0C 1NKCA 4LMYA 4CUGA 4KJZA 2IS3A 1X9SA 3A03A 4YOXA 1J75A 3F9KA 4CF1A 3BY5A 1QZ5A 1ZBHA 4ZDLA 1OCTC 3ENHA 1MU2A 2V1XA 2EIKH 1SMYF 5EG0B 3OIQA 1DKGD 1X2MA 1TLHB 1T39A 2HFHA 2M34A 1RRJA 3VEPA 4I2PA 2P9NB 4Q48A 3KWGA 2DCEA 3L2CA 3KYLA 2P9UA 3OYJA 3R1XA 3HUGB 4KHPK 5ED4A 3O8GA 2VQEK 5KAFC 3HJEA 4LG0A 1QZZA 4C8NA 4FWKA 4AHVA 4FJ5A 4E7IA 5M1KA 2ATQA 3R6MA 3F6OA 1FP2A 3LSIA 3H08A 2XAUA 2DT6A 2O8EB 1XD7A 4P9FA 3OL4A 3WHBA 1YIJI 3LP1A 5ADXH 2DFHA 4CBWA 2A69F 1J7KA 5HNFA 2V1DA 5LBQA 4L18B 1BWFO 4PSXA 2HHHK 3CPEA 1Y1WJ 3K5OA 3HHHA 3QOEA 2IVPA 1RR8C 3ZMTA 4PJJA 4V2GA 4HF1A 3NWTA 1T56A 3KD1E 4EM1A 3KE2A 3K4JA 3SXYA 2IAIA 4DV7K 4IZZA 2Q0OA 1RUOA 1IN6A 2R7OA 1EJ9A 1OCOH 1XC5A 3TGNA 1JXEA 3TI0A 2Z9OA 3PQKA 3V9UA 3KP2A 1F4KA 3VF6A 1BCMA 1HPMA 4FHTA 2NLXA 2FMYA 3KETA 5TGTA 4Q4ZF 1I94K 2DDAA 2R5ZB 4AHSA 2LDUA 1R7JA 4CZKA 2R3SA 1NMDA 1V5EA 4WQ4A 4PGGA 3OMYA 2UXDK 1RIOH 4FW2A 3BG6A 3NWSA 2DQRA 1GOBA 3A4CA 3GXOA 3EE9A 4B1UB 3SUNA 5FFXA 5EDNA 1HJOA 3GEZA 1TV6A 1WCMJ 2GEMA 1ETVA 1KU3A 3WT0A 2FE3A 3S14J 4DQPA 1EP4A 4LY7A 2QWLA 1JLQA 3AGKA 2P6TA 2VC0A 2KJBA 3DU5A 4BRMA 4L9NA 3ASMA 1J59A 1FBUA 1FPQA 2UXXA 1QQNA 2V51B 3EYYA 1A5JA 5DS9A 1MMAA 1D0XA 3RIRA 4BJ6C 3CJAA 4DLGA 2CGLA 1FKPA 1VQPN 2NAZA 2NVXJ 1USSA 2D2WA 4JN4A 2KHOA 1V4RA 5EZGA 1S9GA 1OVQA 1JI8A 1BISA 3ELKA 1S1TA 4FO0A 3UKRB 4CJVA 2D5VA 1O1WA 4ZYAA 4M3WA 3HP6A 4KHNA 3CERA 3KEOA 1IBKK 2HB5A 3G6EI 3QYFA 5BNGA 3NBPA 3Q9VA 2IBDA 2DXIA 3ZYYX 3DRPA 3OYMA 4ASNA 2WA0A 1SVLA 1O13A 4JI2K 4CJSA 4F92B 5HDKA 2DN0A 4MEYF 4CICA 1K8KB 4IOAL 3KLHA 5HNHA 1BJZA 1CF7A 3ZEUB 4N76A 3CJ7A 1XPXA 1GV5A 2IS1A 2X1EA 3MX2A 4XICA 4QPQA 5KNLA 5CVVA 2IVNA 5J2MA 2XY8A 2LTPA 2HMPA 4JX6A 5LRSA 1G59A 3DRRA 2M87A 3LZIA 4RCHA 3GX4X 2H3GX 2G0EA 5GPCA 1U5TC 4KH5A 3AVNA 1OH5A 2H6BA 1UB9A 4Q5VA 4JKCA 1S72I 3GTGJ 2HI3A 2F5VA 2J4RA 4AH9A 3V7RA 5D3GA 4IDHA 4CJUA 3QICA 1U8BA 2KTQA 4ENMA 1FMVA 2WTEA 3RTRA 4JI4K 5FDLA 3AO4A 2QW9A 3K4BA 1L3SA 5ILUA 4CJWA 4MO5A 2NUBA 4D7NA 5B1AH 5A2QK 4LB6B 5HRSA 4KKOA 3M8QA 3OYBA 4I0BA 4IOAF 1G3SA 2HDWA 3SQ0A 1LPQA 4ESFA 2E88A 1SQKA 1EA3A 4EMSA 2Y0SA 5KGXA 3K9JA 1VFCA 4AIKA 1MMDA 4A5AA 4YY3K 1YE9A 2M8GX 5JS2A 4I7HA 4JI3K 4DUZK 3A5OC 3IKMA 4FE7A 2FBIA 3K4CA 3CM6A 3J8AA 4LITA 1QZEA 3E5XA 3FFIA 3PY8A 2Z1HA 4A5MA 3F3XA 4RMNA 1R6RA 4YOWA 4IVNA 5GAEP 4XNFA 2VBYA 3VQ7A 1IUFA 2OZSA 3K9TA 2ZJRL 2H1KA 3CMMA 4CJLA 2QBYB 4B9MA 1SFUA 2MSYA 2E60A 1Z91A 3LP3A 2KFDA 2RE2A 2OZMA 1KVAA 2EBIA 3TKYA 1EXQA 1K83J 3CETA 3T8TA 3QESA 2OYQA 4XM3A 4H0OA 3O8MA 3OS1A 5JLHA 1JL2A 2K9MA 4M7YA 3IUCA 1B8IB 2DOEA 4BACA 4IBNA 4I9QA 1FYMA 3J80O 3CFRA 3SDBA 4OWRB 2PBDA 5DTDA 4M3UA 2ZJ2A 5JLXA 1MZBA 3TARA 2O8BA 1Q86O 3V7CA 2GUIA 3O9SA 1DUXC 4H5RA 4B8XA 2QXLA 3VFZA 2O8DA 2DYSH 2GQQA 5AQNA 1JKOC 4DU4A 1NK9A 4FJGA 3BG9A 4MFBA 4BUPA 1TL8A 5F08A 2OBPA 4BREA 1QU3A 1J5YA 4BH9A 4X0GA 5J6XA 3FXLA 5K5OA 1CGPA 2ZJRF 4IJNA 1S9EA 1GDTA 3M5RA 2LR8A 4F9OA 3DLKA 1E3PA 5AR0A 4GMJB 3LSKA 4RW9A 4AWXB 4CHOA 4M3DA 5J1EA 2GA1A 4FJLA 3AAQA 5ICCA 1UHSA 5IP7J 4U7DA 3TANA 5LEJA 1MBHA 1O7LA 1J5EK 5K7ZA 1R59O 3L4QA 1N77A 4FK2A 5DUIA 3GLLA 1R9TJ 3GW2A 4G7OF 3FDYA 4P9UA 1D0ZA 4JI7K 2D0PA 2YKNA 1Y1VJ 4WFNL 3VGLA 1ATNA 4JKEA 5JR3A 2W6KA 2V4JC 4AUXA 3TAEA 3P4IA 2FOKA 2CU7A 1NGEA 2OTJN 4B1YB 3VGMA 1LOTB 3L2QA 1RNHA 1KONA 4B1WB 3WTZA 2MFZA 4BQAA 4FJ7A 2BY0A 3ABKH 5K7FA 4BG8A 4Z4EA 1YHQI 1P4WA 3P9KA 1ZREA 3NQOA 5CZ2A 5LHGA 1XCBA 1AKHB 3EUHC 4ZTFA 1BI4B 3AA5X 1YS6A 2R7UA 1ZR4A 3NF6A 3LQQA 1OYYA 2IC3A 3SNNA 3P39A 3I55I 2CQ7A 3CCEI 4AVZA 2MA3A 3S1QJ 3H3NO 3HOZJ 4ZJZA 4O3MA 3BDDA 4RGRA 3R3LA 2ZJPL 3HC7A 3WNFA 1VI0A 4DTSA 2HOEA 4ZC3A 3EQLF 3TWHA 1BGXT 2P6SA 4EGYA 1W9HA 2LK2A 2ASMA 2IOCA 2HNHA 1U47A 5EU7A 2L9RA 3OIPA 1TGOA 4DV0K 2JWKA 4S04A 1BIAA 4G6QA 5AFUA 4PUOA 4XK4A 3IKTA 1R36A 5AQWA 3C2GA 5JVGL 1Y6IA 1K9MO 3L0QA 3CJ9A 1VHXA 2G8WA 2A68F 2AP1A 2CFOA 1ASWA 1KVBA 1VQOI 3Q0WA 1WSIA 3BG5A 2ZB9A 2DPDA 4FWSA 2HOSA 3OJUA 5IT9K 1TYQA 2NVTJ 3HGYA 3VQCA 4S05A 2YKMA 2V7ZA 2HNDA 3HKZA 1PP7U 3GLXA 3C7JA 2D0OA 1DQUA 3I59A 1HPZA 2ZJPF 5J4YA 3FZLA 1K6OA 2HHQA 2ZXJA 1TWGJ 2QWWA 4KNYA 1H1VA 3E97A 5F2RA 2VQHA 1BR1A 4I9LA 2XRIA 3U21A 3SZTA 4IHTA 2NRRA 2EJRA 4DFMA 4DTJA 1LJ9A 2VJ5A 3H9GA 4Y1CA 1N6QA 4IRIA 1TKXA 4D1QA 3VYUB 4BWJA 5BREA 2QGUA 3JSPA 3U8XA 2Q36A 5JVGF 1FMWA 3HZJA 3QU3A 3M8PA 4BR7A 5EEHA 1RBUA 2IGKA 1JJ2M 5FKKA 4OGEA 4PL8A 1SANA 1JXBA 2Q97A 1ZC6A 3ZQIA 5AZJA 3MZ8A 1DPRA 1I3QJ 5E41A 4F55A 3HOUJ 3IKVA 5JVHL 2PYJA 3RRGA 1IBMK 1Z25A 4BHBA 3T69A 5HOOA 3AVCA 4C3JJ 3V81A 1ETKA 4FJJA 1HR0K 4JQFA 1D4XA 5AQZA 5B3SH 3CDLA 3IWZA 3EL2A 3RVCA 3MKWB 1CXQA 2F4VK 1WSEA 1UHWA 2W00A 2XAQA 1VQ4I 3DYAA 1NK4A 3PQJA 4FE4A 1L3UA 1CZAN 3JCUC 5EZHA 3SAGA 1R5ID 1REVA 2E1YA 1K8KA 4YIFA 3HJFA 3CCJN 4A2UA 3ZEUA 1U5TA 3ZMDA 1S1XA 2W40A 4AVPA 2EIJH 2R7RA 2M1BA 3THYB 2KISA 2Q0UA 2ECCA 1XSDA 1HKSA 4CERA 5AQVA 3O2PE 3D2FA 1GLFO 2EZLA 3FWEA 1JUMA 2I8DA 3CLQA 3KLEA 4FTHA 3AA2A 3E6BA 4CGHA 1YOVB 1DTTA 1KFDA 3GBGA 4B48A 2RF2A 3EUKL 2ELKA 2GXBA 2DTUA 4XIUA 3RMAA 2F7TA 5GPAA 3WG7H 4CF8A 2W85A 2DMTA 3RQIA 4G7ZF 2PZSA 3QPTA 3FMQA 3CF5L 1P8ZA 3QINA 2FRHA 4M7XA 1NK7A 1A5WA 2HVQA 2QUFA 1YJNI 3KZZA 2VQFK 1YG2A 1W1WE 2ZJQL 3LDLA 1U9NA 4FL9A 2JA6J 4IO9L 4H4KC 1HNWK 4HOBA 1IG8A 1IN5A 4MIMA 2QSGX 3LSHA 3SZPA 3OYFA 4WFBL 1EKEA 3ESWB 2RVCA 3KHYA 4CK3A 3V4IA 4FWOA 4KIGA 3ZMUA 2HW3A 3CC7I 4IRHA 3E6DA 2AJQA 1ZKGA 5H20A 2M0MA 2Y9YA 4WF9L 4JV5K 4E7SA 4OU0A 2VWKA 1M90O 4FXDA 2DDBA 3IS9A 4O44A 1DU6A 1VQ7I 4KISA 2DMPA 4A3MJ 3G71I 3MCZA 1S29A 3LNQA 2YJFA 3FHZA 2TRTA 4BE0A 4CZLA 1E2XA 2QWOA 4BROA 2KLOA 2RDPA 2R0QC 5J4VA 4BRFA 3WXKA 3HM8A 1W7PA 1T7PA 2VJJA 1KVCA 2DMUA 2YS9A 3GTLJ 3WUHA 2YCHA 4AM7A 1Q82O 2NVUB 2R92J 4IHVA 3CF5F 4JHDB 4BQQA 1J09A 4QS8A 1VNDA 3LALA 4RDUA 1SVMA 5GTHC 1XNQK 3IAYA 3SLCA 1LDJA 2B5JA 3H5RA 2ZJQF 4CF9A 3OIOA 1B9MA 3L2WA 5LGTA 1STZA 2EPFA 3FLCO 2JQ7A 1QQCA 3ID8A 5I9EB 3MEDA 2P9PB 4E3SA 2Z16A 3IG1A 1QQIA 1NJYA 1S8NA 3M9AA 5FPMA 1MJ9A 2RNGA 3ABTA 3EKSA 3MEXA 3G73A 4LLGF 1S22A 1YXQA 4DSKA 1NGAA 4B9SA 2CQKA 2H6CA 3C1DA 4IG0A 3VEWA 3O4WA 2XV4S 1HYVA 3BWGA 4QS9A 3QAHA 4FPBA 4JLHA 2F4MB 3FZMA 3GTOJ 4PL7A 4FLXA 2JZYA 3V42A 3GTPJ 4E7KA 4CZIA 2VBWA 3HPHA 4A3CJ 1VQLI 4JI8K 1NK8A 4YIRX 4C8KA 1Z26A 3LA2A 2QF7A 4BXXJ 4G94A 1SFOJ 2R7WA 3JAMO 3QYBA 5AQMA 5GINA 1KU7A 5HLGA 2ZMEB 3HPGA 2V7YA 1MD0A 1KLNA 2HTJA 2K9NA 1WSHA 3MK6A 3NARA 3CCMI 2VKDA 5DMRA 3CCEN 1IDYA 5LHHA 2H8WA 3M3ZA 2F8SA 4CJ5A 2LC2A 4MO7A 3AO3A 2MLGA 3MFKA 3D5LA 5HP1A 1RT6A 3AGRA 3TAMA 2HNYA 2KZMA 4RAYA 3KCCA 2WTUA 2DT5A 4UVAA 4YOVA 3EUHA 3HOTA 4CHNA 4WX9A 2MG4A 4Y3OA 4D5CA 3C95A 2FBXA 3B02A 3CCRI 4U67L 2CO5A 4G8XA 3GF2A 1NGGA 3ULEB 4F2SA 2KDOA 1D3YA 1N8RO 5LMUK 1OCRH 3JYTA 3TO7A 1N75A 2CQNA 5FKMA 5KQDA 4LD5A 3A01B 3NGIA 1P7JA 1ESVA 1YT3A 4CJPA 4CEBA 1Z9CA 2XGEA 2BDPA 3TO6A 2GLOA 4QLCU 3LP0A 3U9DA 5F1JA 3S2WA 3I4PA 2QSHX 1EF4A 3RDIA 3NGYA 2OANA 3GUDA 2CGKA 2WAEA 1ETWA 3CD6I 1R4NB 3NEUA 3SV3A 1YX3A 2QKLB 1PVEA 3TDUC 1DGWY 3SYTA 3VTIA 2CUFA 4DR2K 3S3NA 2PJRA 2HYFA 1C1CA 1Q9YA 3DXMB 5AONA 4BY7J 3ZSOA 1TC3C 2A3SA 1G8XA 2JA7J 3TAPA 5E20A 3WU1B 5HRNA 5IOYA 3ERMA 1JKQC 4DZJA 4M63C 2AXTC 3ENBA 3WTVC 3HO1A 4MFDA 5E1WA 4F3TA 3M8EA 3HOXJ 4AHUA 2L01A 2IT0A 1MSFC 3DV8A 1ON1A 1JTYA 1U48A 1TW2A 2MABA 2HDCA 5DCMA 1QE1A 1ASVA 3PIOF 3CF2A 4AIJA 4B3XA 2YU9J 3L00A 1Z3XA 1X3ZB 2KW4A 1MDMB 2HHXA 3AVHA 4MLEA 2OCEA 1X1BA 2D1HA 4QAGA 4CF2A 3H1QA 1IG9A 3HSFA 3ITHA 1VQ4N 2KFNA 3VQQA 3AY9A 1ITGA 4CD1A 4A3LJ 2L7ZA 2CRGA 1ETXA 1VQ8I 2GIVA 4TSXA 3FXMA 1W0TA 2RGVA 1A5XA 2ETHA 5K1YA 4DW6A 2CFXA 3C94A 2QTDA 2BH1A 4LD0A 3I54A 5C3EJ 4FX4A 3E1SA 1VQMN 3MN7A 3OYGA 1OYWA 1LWFA 1G4DA 4JEPA 4HNTA 5KPTA 4HTUA 3V9WA 4AILC 2I10A 3KJVA 3WNGA 3PNYA 2HF4A 3PM1A 2LG4A 1QVGM 4NC6A 4WYBA 2D0AA 1RT2A 4I09A 1U04A 3TAGA 3HYIA 3F22A 3U3GA 1G3WA 2VPRA 1LDKB 1RPWA 2Z33A 4PGHA 4XKCA 2E1ZA 3CMYA 4NLCA 4RGUA 5EF6A 2A41A 4Z2YA 1FBQA 2ETJA 3QP6A 2VQGA 3SAFA 1LFPA 1QVTA 1FKOA 4CJKA 2F8TA 2IJLA 4B8CA 2ZD1A 3EO3A 1N5YA 4CD3A 3KP3A 4M74A 3LM9A 3N4PA 3QBXA 1KXPA 4H4MA 3ZOBA 4DQRA 4YRVA 3S2HJ 1W97L 2UUBK 3KP6A 4HUEA 1JT6A 1R1TA 4JRQA 2BE2A 3WODF 1EWQA 3VB2A 2FNAA 3J7AP 1D0YA 4FCYA 2P4WA 1P4AA 4HSRA 1HNZK 1KU9A 4LFCK 3K70C 1NGHA 4XR6A 3E6CC 2CW7A 2HVHA 4X1EA 1ODDA 1YQAA 3P9CA 2UUZA 4MNUA 3PNVA 4CEDA 3E1YA 2QWRA 1Q1VA 2GWKA 3DAWA 4OLAA 3VEYA 4NCAA 3HRUA 3OBWA 3MWMA 4OKJA 5F0CA 2F9TA 4XRSG 4P96A 1HC8A 3K5NA 2ICWG 2O8FA 1RT4A 2F6CA 2GA2A 3A2FA 1JJ8C 1LE8B 3ULDA 1I50J 3IUOA 1SD4A 1IV0A 2QEXI 4O8KA 2HMIA 5KRSA 4ENJA 3H3VK 1H9TA 2IGIA 4CIFA 3ECOA 1HDPA 2ZKZA 5HLIA 1Z21A 1L3VA 1HW5A 3ULQB 3GFMA 1TK5A 5FLXZ 1Q18A 4CGIA 3CC2I 1ETQA 4CI6A 2I5JA 1EV7A 4KFCA 3ZMSA 4PA1A 2EZKA 2EFPA 2G9WA 1TNTA 5GP9A 1RESA 1B72B 1MMGA 1SS6A 4XKBA 2FBVA 4B9VA 2HDDA 2Z1GA 3SUPA 3QB0A 5AFUH 5D5XB 2ELJA 4RTFD 6PAXA 4H0PA 4HDUA 4F2RA 2E2PA 4ISFA 3K5MA 1SD6A 4X66K 2UZKA 4LF6K 3JRBA 5CZ1A 2GAUA 5ILVA 4HQEA 1BCOA 3CC4N 2M4KA 3OYAA 3Q3SA 4YEJA 1WJDA 3O3HA 2EH3A 3VEVA 1MJBA 4CZMA 3Q7CA 3DPLC 1NLVA 4FZZA 3DRSA 3QU6A 3EZ5A 2VIXA 3HOVJ 3K7AJ 2CUEA 3VYTB 1GVJA 4CGGA 2IS4A 1ZBLA 1ETOA 3U4LA 4NNJA 2OF7A 2O9LA 1C0WA 2R7QA 1TTYA 4OAZA 1OCZH 1OKRA 2PJPA 4KDPA 3KLGA 1C0GA 1VSEA 1QO0D 4N0BA 1GHCA 2Q0RA 3CTAA 5ADXA 3OWTA 1N34K 4HV6A 2CGJA 1MW7A 1GLAG 1D8JA 2JT1A 4HAMA 4A6DA 2QWQA 2X9DA 3CCRN 2YPRA 4JP0A 2E6LA 2FXAA 2FBYA 2VONA 1ZELA 3LFUA 2V1UA 1YW7A 4L5JA 5SZTA 1V5GA 5LHIA 3L4IA 3QEXA 3KZIC 4CW7B 3GL1A 2XGDA 2XB5A 4KMFA 4DV2K 3HXMA 2KMUA 3OYNA 3DI6A 3H1CA 4NCGA 4M3BA 3MXIA 3AA3A 4ID1A 4FM0A 2DYRH 3B6AA 3K1PA 2LP0A 3J80Z 1T6CA 1C1AA 4N47A 4QOZB 4JK9A 2DK8A 1XHZA 2DPNA 2VG6A 1TWAJ 3HDDA 3PO3J 1S5JA 4J2DA 3CD6N 3ML6A 3DEUA 1R0AA 1E3OC 2BW3A 3K1NA 3ERED 3V8JA 4PHTX 3ULEA 2A6HF 4OLBA 1GXPA 2F48A 4CK1A 3CDIA 2DBBA 3Q5FA 3K0SA 2ASOA 3BC8A 1JL1A 3ZSWA 2YNHA 1WBBA 2A6EF 2KKOA 3L2VA 1IBLK 3A01A 4C23A 1V4TA 2LSOA 1IGNA 3I0SA 4H5WA 4BGBA 3LDSA 3MN6A 1A04A 1RKWA 4LIUA 3I9V2 5JFRA 4I6MB 4CZFA 1G3TA 4AM3A 4KO0A 4BRPA 1FOWA 1TP4A 4U0YA 4KYWA 2P9LA 2W7NA 2NVQJ 5AQKA 1TK8A 2LRDA 3CJBA 3UKUB 3TEDA 1FNNA 3SFIA 4E7ZA 4FLUA 1RUNA 4CESA 2EWNA 3J81O 2O6GE 2CS3A 1H88C 5C4XJ 2WBMA 3DXMA 3SI6A 2ADUA 4ICLA 1HQCA 3K4MA 2IRFG 2DFEA 2M2EA 1K79A 2AQEA 2EFNA 1OVYA 2CQQA 1K78B 1F9NA 1MKMA 2XAHA 3ABUA 4OINF 1Z05A 1FP1D 3W2VA 2XF5A 5FFZA 1DPUA 1VQ8N 2ZBKA 1FC3A 2DA5A 3K1MA 2P51A 3L9FA 2JSCA 3NF7A 4O5VA 2OC6A 1CXUA 4XBFA 2MLKA 1HBXG 2EFQA 3WE2A 2W82A 4DV6K 3THWA 5AQSA 2FD5A 1OH8A 4BXUA 2MH9A 2QXFA 3MKLA 3IAS2 3LAKA 3TU5A 3JTHA 1Y8QB 4DV1K 2ME0A 2MC3A 4DIQA 1MDMA 2W84A 3TW7A 3ISPA 4C3HJ 2VB6A 3NAUA 5KCMA 5JHUA 2PMUA 5H6QA 4MTDA 2QKKA 5DD8A 2IP2A 4JKGA 3M1EA 4KT6A 1MDUB 4G9ZA 4GY2B 4WXDA 3HSEA 1ZARA 1E17A 3QIOA 3B73A 4MDBA 4DTMA 2LBFB 3CJQB 2P7CB 4YELA 3THVA 3ASNH 3ZSYA 2ZFWA 1C1BA 2OPRA 2A07F 4FJMA 3VEOA 3Q0VA 2DMQA 4HF2A 4UVCA 1QVFM 4KHUA 1ZBSA 3CCSI 1RT7A 1QPIA 5KQ8A 1I1SA 2ISYA 5H1SQ 2VKEA 3P9IA 4M9ZA 2NOGA 3BR1A 1SV5A 1NMNA 4ZYDA 4RW7A 4A3IJ 1IKYA 2A3ZA 2P9UB 1IJWC 5C25A 2TCTA 4IOCF 3CCLN 2IXSA 4G1QA 2X6NA 2E5NA 3ZT0A 4FT8A 2IAJA 4Y15A 5GADJ 1QSSA 4RM2A 1J5OA 4LG0B 3HSRA 2DAOA 5BPLA 3GFLA 4ANJA 1I6XA 2VLAA 2DA4A 4JK1X 4PJMA 2KZGA 1LNWA 2FF3B 3A0BC 2LY9A 2DQLA 1I27A 1UHMA 3QEIA 1KYZA 1PJRA 4KRFA 3RTVA 4PKGA 1RTDA 5F6FA 4DSJA 5FRMA 4AHRA 2ID3A 1WSFA 2EILH 4II2A 1JUPA 1WI3A 1XQSC 3LL3A 3SBGA 4KV8A 1FX7A 3SDGA 1MNEA 3MWPA 5K14A 5KRTA 4LF8K 3CP8A 4L0ZB 3S1MJ 3SHFA 5ILSA 2HVRA 2XUBA 2ZO4A 3O1BA 2F2EA 3G2BA 5BRDA 3S17J 1RCHA 2YI1A 5GIPA 4ILJA 4F3QA 2L9VA 2NZTA 4B47A 4BE1A 3U1DA 4EJUA 1RTJA 2VI6A 2LKSA 2OAZA 2W6LA 3R8EA 4F52A 3LWFA 3RYPA 1FT9A 2F5EA 3LWMA 4LH4A 5C42A 2A40A 1W36C 3G25A 4G7HF 4FVMA 2A5YB 2QKMB 3P83D 3KVGA 4K8ZA 3LSPA 5JVTA 3DBLB 1L3LA 3R6SA 4NO7A 4OPAA 1HXDA 2CH0A 4ELUA 2ASPA 3L6QA 1D9FA 1DU0A 3U2RA 3TO9A 5FLMJ 1YUWA 1TUUA 2JMWA 2D45A 5CE3A 1G3YA 1P4XA 2YNIA 3KTQA 3WNEA 4CJ4A 3HEFA 3VPRA 4H5NA 2K27A 3LQRA 3CDHA 3HYFA 3F8FA 1YVUA 4FJKA 4OMYA 1ZYRF 3LSTA 4JKAA 1IRZA 1C0FA 2GX9A 3H3ZA 5GTIC 1TZLA 1KD1O 1BM9A 3QPLA 1W4MA 1QRYA 1XGOA 3JRDA 4I2QA 4GXOA 1O4XA 3ZT3A 4BDPA 1A6QA 2R93J 3S1NJ 1IF1A 2W1OA 3ZX2A 5CQEA 1A36A 2WAQN 1RTHA 4LF5K 3HSCA 3DXKA 5C0YA 1Z7LA 5BR8K 4RAGA 1FEXA 1P7IA 1LUJB 4ISEA 1YTYA 4RGSA 4PWDA 3W2AA 1KRPA 3HRMA 1YFHA 2A6AA 2V9KA 1IRGA 1SAUA 4CCLA 4P1WA 4ZDOA 3QEVA 3ATUA 2KHMA 4JX4A 3CCQN 5BN8A 4Z0UA 4L8RB 2NRZA 2ZCWA 3ABLH 1KZHA 4FWNA 2FXUA 2A05A 4YOUA 3DKXA 2EFWA 3SUQA 1IAWA 2QWMA 4CEAA 4DR6K 5DV5A 2E36A 1MA9B 2P5VA 1Q1HA 4JNEA 3A8YA 1NHAA 3VF2A 1NK0A 2RKIA 2O7OA 2AQFA 3OYIA 2EZHA 4HX4A 2QA4I 4BGAA 1NOYA 4NUBA 3VQ5A 5AQIA 1J54A 1W7PD 3OYEA 2VN2A 5M1PA 3VPZA 2NRXA 3KK3A 2CJJA 1F21A 4BBSJ 1T8EA 1IKWA 3I56I 1OR7C 2XC7A 3OY9A 4FVUA 1J9IA 1SL1A 2DT7B 1TQIA 3KFWX 2G8KA 2XY7A 4IO8A 5AQTA 3VQEA 3I8DA 3FIWA 4IHWA 2Q8KA 2P9IB 3L2RA 3PJRA 3FF5A 1VQ6I 5LJVA 4A69C 2AO9A 4IG3A 3AAFA 3RZDJ 3OYDA 4PCQA 2UXBK 4WK8F 4V19K 2ELHA 2EK5A 3H35A 2AS5F 3REOA 1VSIA 3SJMA 4BQNA 4KA4A 3VYSB 2LY1A 1SL0A 4PKHA 4HHTA 1XX5A 4N56A 3E9PA 1YF5L 1BU6O 4BJTA 1S3JA 3CZ6A 3DLHA 4NYFA 4Y0WA 4UV9A 3C2HA 3BPXA 5AIQA 4KHQA 1IRXA 3R0JA 3RMCA 1A6IA 1GV2A 3DEWA 4FJIA 3LZJA 1WJBA 4DBRA 3S9HA 4HCBA 3JSOA 1YIOA 3GO5A 1WOQA 4I6MA 4BRHA 1XI1A 3BF3A 1D1CA 3DTIA 3NH1A 2VG5A 3JAMZ 1Q7YO 4H0YB 4M6XA 3SPZA 2CYYA 3WXMB 2BBYA 3THXA 3JREA 3V1QA 3FGUA 3HTVA 1X1PA 1U9OA 4CJ7A 5GAHP 2HQRA 3HG9A 4DLEA 1R22A 3ZQLA 1Y64A 4WCGA 1ZLJA 3W6JB 2EZIA 3X2QH 3K58A 1XCVA 5CYQA 2BV6A 2X85A 3K2PA 2P9SA 3C3WA 4KICA 2O8BB 3JS6A 5DM6L 4LSNA 3GBTA 2O8DB 2XKPA 5HS9A 3GWZA 5BPIA 4IEEA 1W0HA 4AQYK 3CIPA 3NVKA 3ZX0A 3O4QA 2KP6A 2XAGA 3MKYB 1FOKA 3I4MJ 2G8FA 1WJ5A 1MWKA 5F0XA 3ABMH 1FTTA 2XO7A 2OPQA 5FPNA 5HDGA 5AQLA 1NKBA 4CXFA 3FZHA 3T3FA 4M3FA 1QSLA 1VQKI 1Z7UA 1LKXA 1S5LC 4QIWN 1XGNA 3TOAA 1TBXA 3T7ZA 5CVIA 5LFAA 4UUSB 3K4NA 2OPSA 5KTQA 1PYVA 1JLEA 4N5SA 1LCUA 2OQRA 2B6AA 2A61A 4XKVA 4NLBA 1T2KA 3R9PA 4CZCA 2I7NA 2XPWA 3S3OA 1J53A 1ZG1A 5HLHA 2AHQA 5BS6A 4YOTA 4CHZA 3ZT1A 2Y31A 2LBFA 2VGNA 5DM6F 1T6DA 3VEZA 4RB0A 3C2BA 2E71A 1MBKA 3T19A 2DFFA 4KHSA 2HHUA 4BKXA 3EY1A 5GAGJ 3DEEA 1HSJA 2DODA 1JKPC 4BRDA 3TP0A 3TTCA 4IJAA 4Z94A 2MH2A 1SEUA 3U6FA 3VEXA 5HLFA 5LD2C 1D8KA 2B7EA 2DA3A 2KQ2A 5EXWA 2D0CA 3HOYJ 4ISGA 1H9GA 2L0KA 3HXLA 2Z3YA 2GWJA 4A3KJ 1VAZA 4EV0A 5DEQA 4JRPA 5J3LA 2E1MC 1RZ4A 5HVQC 3N97A 4OIPF 2GIZA 1GLEG 3U1KA 1QGPA 4Z4CA 4LK0F 4CK2A 2E8AA 3N05A 5B8HA 1IJJA 2WFBA 4MLOA 4FETA 4BRCA 1R49A 4LF4K 2HS5A 1K61A 5L3EA 4BR0A 1MGTA 1UAXA 4HLYA 4YFKF 2MGQA 2YNGA 2V7FA 2VUMJ 4N41A 3UR3C 3DQVC 3PX0A 3E9LA 4GV6A 4Z4GA 4IFVA 5E8GA 3QNOA 3W6VA 3BDPA 3FX3A 3J7YJ 1HOMA 3LWLA 3B8AX 1P9QC 3WE3A 4A3DJ 2HU9A 1WWXA 5AQXA 1TL3A 2B0LA 1U78A 5C44J 4W5RA 1RGIA 2HPIA 3VETA 1WAFA 3DBHB 4DBQA 2HBMA 2LLKA 1D5VA 3QNNA 3WTXC 1B6AA 1BI2A 2W42A 3O3GA 1WHUA 5JLFA 2JGUA 2NS8A 2HXIA 1BW6A 2KT0A 1EQYA 2X0LA 1VQ9N 4CCHA 4KREA 3MZYA 1TYQB 3VENA 3TR8A 5ERIA 1F1ZA 3NVMA 1XSXA 3SEQA 1XNRK 3I59B 3VQ9A 2LVSA 3E0JB 5M5YJ 4XLNF 4LFUA 2KJCA 4B3SK 3FBIB 3LAPA 2PMHA 5HL7L 2FA5A 1LEAA 3RPUA 1T0FC 3H0DA 4CIGA 2DJIA 5A2QZ 4C9YA 2DU9A 2YHWA 3BROA 3I8BA 4V2FA 1WQ2A 4R79A 4MHGA 2TDXA 3RYRA 3MD2A 3QPSA 4CSWA 1KCFA 3WHCA 2CMPA 3V1OA 5FB2A 1RT3A 4M72A 3CCVI 4IXCA 3KLFA 5F64A 3BQYA 4CCKA 5AZJB 2L5QA 3DF8A 5E1ZB 3QQAA 1DTQA 3SFZA 5FLXK 3BJAA 1V4SA 3BGRA 1HDDC 1BC7C 2HHWA 1XDUA 2WADA 3CM5A 3PLAA 3L2UA 1VRUA 2YU3A 2LY2A 4KPYA 2HYGD 2LOOA 3KLIA 4D9JA 4BVOA 3P7NA 4L5IA 2F96A 2O03A 2HVSA 1ZK8A 3EEQA 2YX6A 5E1XA 4JAXA 4C8LA 2XDVA 1SAZA 4D7MA 1Y8RB 2ZQBA 3U9ZA 3SMPA 5IYBJ 3M3YJ 3N4QA 2UUCK 3RR7A 1JKRC 3R61A 2Q1NA 2NS7A 1ZRCA 4CFDA 4CHPA 1R23A 3FZKA 3AL0B 1HKTA 3ZT4A 1FIPA 1JLBA 3H36A 4HX8A 4KBOA 4QPOA 3A0HC 4J01A 3A5MC 1U5TB 1QZ6A 2D4WA 1VRTA 1U45A 3TSUA 5CQGA 1YRNA 2P5OA 2QYOA 3V9SA 1YTUA 4HDVA 4NC7A 1X19A 1O57A 1A31A 3D2FB 3AL0C 2Y0SN 2IVOA 2HHSA 5FLXO 2W57A 3QWLA 1OR7A 1NU0A 3FE1A 1Z6RA 2ZGZA 4G6TB 2XVCA 4DU3A 4YOYA 1VTNC 5BN9A 1ACIA 4XH4A 1UZCA 4UV8A 2E2HJ 2UYTA 2YNFA 2MC4A 4O0JA 2BY3A 1ZRFA 1L5UA 5ICEA 2L7KA 3H46O 4BG9A 3OHRA 4H03B 3RRHA 4ITVA 1HLVA 2Y48A 5TISC 4B1RA 2WUSA 3ZMZA 1NK5A 5L3CA 2XRLA 1O7FA 2HGCA 2P0WA 5D6FA 3H0GJ 3OYLA 5LY3A 1X3MA 4ELVA 5M1QA 2JN6A 3B6PA 4CCNA 4H4OA 1HKCA 1HNXK 3IV5A 3V4GA 3I64A 3Q7BA 2P9IA 2RN2A 3OS2A 1NGDA 3HK2A 5H6RA 3PUBA 1MIJA 1X1AA 2X1DA 1F5TA 3J80K 2QM3A 4EVIA 1ON2A 2M9HA 2H8RA 1NBWA 2QCOA 1SD7A 2PMZN 3F21A 5M1OA 2L9NA 5MLCQ 1BOAA 4YDUC 3ZRGA 3V9XA 4UY8I 1ILYA 3CI5A 2HEOA 3L09A 4DSFA 5I42A 1IUYA 1QHHD 3SYZA 1ZXOA 4F8RA 4LF7K 2E20A 1BA1A 3VWBA 4B44A 1T44A 1XGSA 3S2DJ 3CJTB 2HHTA 1RC9A 4IHYA 3ZQCA 4CZEA 3BJOA 2EQRA 4DV3K 1W7PB 4UHTA 5JS1A 3ALYA 2VWJA 2E1OA 4Y4RA 2WB1A 5AQJA 3H9JA 3NRVA 4JK8A 1FWZA 1ZBIA 1NTCA 2PEXA 3QLHA 4YHHK 4IXAA 4OPJA 4BGDA 1TWCJ 3LFKA 1TAUA 1BN5A 1QNTA 1T08B 1APLC 1MSEC 4Y33A 3CQYA 2BGCA 1RNLA 1QBJA 4BRAA 4KHWA 1RR7A 1MBEA 3M8RA 2HZDA 2STWA 1QQOA 2G7HA 2G8UA 3ATVA 3LPTA 4J00A 1XN7A 4WXCA 1VSJA 4M3GA 4B9UA 1MJAA 4BL0B 4L9TA 4IFEA 1TAQA 2CG4A 4XN0A 3RSNA 4LGWA 3GFIA 1X1CA 4R5PA 4XLAA 4PSWA 3F2KA 4DG1A 3C65A 4XONA 1NM1A 2VYPA 4PKIA 5FPDA 1Z1DA 1SAXA 1ZRDA 3QEPA 4KH6A 1YI2I 3KKSA 4DJAA 3M4OJ 2JA2A 1YW9A 3O1WA 4B9QA 1AA7A 4XLFA 4XIDA 2R7ZJ 4KFBA 2Q1ZB 1B9DA 3R0AA 3F9MA 2E5LK 1Q81O 3ECHA 3SQNA 4B1VA 4UUSA 3EN9A 2GBYA 4A93J 2Z1JA 4HA8A 4CYCA 2RKHA 1SFKA 3JRGA 3NH0A 3S8PA 3DOKA 4FZXC 4M3EA 1BC8C 1X9JA 3HVTA 2G7UA 1S1UA 3J81Z 5D5WB 4E4HA 3BLYA 3AFHA 5J2QA 5FKLA 1YIJN 1DGKN 2ZNZA 5GAGP 4FYDA 5FLVA 3DLLL 3RKYA 1EH7A 3VMFB 3M1CA 4DTNA 2HBLA 4CEZA 1REPC 4C1NK 1IXRC 2QSFX 5K5RA 4O6JA 3W6KB 4F3OA 1WSUA 1QHAA 4Y7NJ 1YLFA 5DCFA 5AJ3K 4CHYA 2HKXA 2FF4A 2XHKA 1AOYA 4O55A 2JUGA 2UV1A 4PDKA 4CCJA 2Z2SB 4NB4A 3MKZA 5TRDA 4DKWA 3V1RA 1D1BA 3AVMA 3IDHA 4J2AA 3T1BA 1WGXA 3KZBA 3ZN1A 1HKBA 2QK9A 3FKIJ 1FLIA 5J2PA 1FSHA 1SKRA 4GYGA 1HQUA 3MN9A 2WONA 1NK6A 2NYXA 3HKZN 3NHGA 1T05A 3GZ5A 4KHYA 4GKKK 5DYMA 3E5QA 2VT2A 1K8AO 3COAC 3PFIA 1JT0A 2ZFUA 2E7WA 1M1KO 2L2OA 1WAJA 3WEEB 3R4KA 4IHSA 3WGHA 4M9XA 2MD0A 4DQQA 3DLLF 3LPUA 3KP5A 1OFCX 3EETA 3J7YP 2HOTA 3AARA 3H1VX 4JD2A 4DNCA 4FX0A 2PJRB 1E3MA 1BHLA 3SJHA 1OCPA 1Z3YA 2A42A 3RPQA 3SPYA 1VQPI 4IEIA 2JJ7A 1JLAA 4OMZA 3VQ4A 4FLYA 4DTPA 2VT3A 2PLYA 2B63J 3M6GA 1D5AA 4NXMK 1GUUA 4E7LA 4XRFA 4FOEA 2XSJC 5E3MA 2OJED 2IGOA 3RR8A 1P6RA 5HDNA 5B66C 1XC3A 5DM7L 3RJPA 5AQYA 2G8HA 1JCGA 1W5TA 4QSHA 3CCVN 3T1HK 1KQ9A 1T0FA 1CZBA 4AYBN 2WAQA 3BY6A 1JJ6C 2JA8J 1BI3A 1NJIO 5DCMB 2W25A 3HZ6A 1X9WA 5C4JJ 2BEOA 2GOXB 3CJNA 3G6EN 2JA5J 2IA2A 3LA7A 3QERA 3PO4A 1DP3A 1L0OC 4CECA 2VPLA 3DWLA 4GCVA 3ONQA 3IC7A 2HF3A 1VSHA 2WC2A 3JXUA 3P38A 2VL8A 2JK3A 4LSLA 4XL9A 4F93B 3K70D 5KI6A 5M1FA 3PSFA 4A5BA
chains in the Genus database with same CATH topology
5J2MA 1U47A 3IRXA 5EU7A 1WN7A 2XY8A 4F8RA 1QQCA 4KO0A 1RTHA 4DFKA 1TGOA 1ZYQA 2D5RA 3AVIA 4JRPA 3DM2A 3SCXA 1VSFA 3MEDA 2BGGA 4E3SA 1RBRA 1YTAA 1VSDA 3DRRA 1XWLA 2FC0A 3LZIA 2HHTA 2E4LA 3IG1A 5KGWA 3QIPA 1TK8A 1NJYA 4AHTA 2A1RA 3QO9A 2ETJA 4Z4CA 3OS0A 4EZ9A 4PUOA 4M3YA 3PX4A 4CK2A 1JLCA 3HT3A 1BQNA 4W5OA 3AVNA 2FBTA 2IDOA 5JS1A 3ALYA 4PWDA