2YSRA

Solution structure of the dep domain from human dep domain-containing protein 1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
105
structure length
105
Chain Sequence
GSSGSSGYRATKLWNEVTTSFRAGMPLRKHRQHFKKYGNCFTAGEAVDWLYDLLRNNSNFGPEVTRQQTIQLLRKFLKNHVIEDIKGRWGSENVDDNNQLFRFPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEP domain-containing protein 1
publication title Solution structure of the DEP domain from human DEP domain-containing protein 1
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 21
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00610 DEP Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ysrA00
4EM2A 2EFQA 4WK8F 2XKPA 5LGTA 4IRIA 1TQIA 2RDPA 1F5TA 2V6CA 4FX4A 5IT9Z 3RIRA 3EETA 5FD5A 2WV0A 5F6FA 3IKVA 5DYMA 3JW4A 3K9TA 1L3LA 5E1ZB 2EV5A 3R0AA 1ZLJA 3MFKA 4HLXA 4CDGA 1FPQA 1ZRDA 1F4KA 4HOBA 1BI2A 3BOQA 3G3ZA 1QNTA 4XLPF 2MA3A 2EFWA 2VXZA 4AVPA 3WGGA 4WWCA 4KDPA 4UVBA 2DPDA 2HKXA 4BHPA 1I27A 3KEOA 2PFBA 3KP3A 3M7GA 3GZ5A 2YSRA 4EQQA 3GVAA 5LEJA 3P9IA 2FOKA 3KP6A 1XDSA 3R0JA 5HS7A 3C7JA 2NRAC 3KZZA 1G3SA 3FXUA 2NAZA 2IP2A 2O0YA 2MLGA 2VONA 4YIFA 4RB0A 3I64A 2KJCA 3LWFA 1XGMA 1W7PD 1E17A 2PJPA 4A2UA 2FBIA 4IHSA 3COAC 2DQLA 1XN7A 1KA8A 3HTUA 1SAXA 3F72A 4OIRF 1BC8C 2Q8KA 3LA2A 1FYKA 3SXYA 1XSXA 1UHWA 1P6RA 1JHFA 1WWXA 4AD9A 4LJZF 1SMYF 2W24A 1S6LA 2QWWA 2CYYA 3RKYA 4XLNF 5DEQA 2Z99A 2A61A 1BI3A 1XDUA 3NQOA 1Z05A 5LLQA 1MJ9A 1EH6A 4EJOA 1ZN2A 3BPXA 1YQAA 4EJUA 3WU1B 4Q47A 1F9NA 4LK0F 1J7KA 2DBBA 4CXFA 3EYIA 3IRQA 3F6VA 4FX0A 3ZMUA 2L4AA 4UVCA 4ASNA 1MKMA 2RNJA 2OU2A 5A2QZ 3J80K 3OOPA 2O61A 1J0RA 2HFHA 1KU2A 3SFZA 2VODA 2HKOA 2K4BA 2ZXJA 3KP4A 3JSOA 4BHCA 5LBQA 4LMYA 1KQ0A 2F5EA 1MJAA 1TBXA 4RGUA 1MZBA 5H6QA 4WXDA 4Q48A 2RVCA 2ZBKA 1K79A 2XKOA 2STWA 2E1CA 2PI0A 3F3XA 1G4DA 4OMYA 1T98A 2X0LA 4L9VA 1ON2A 4PGGA 2F5DA 2HDCA 4A0YA 3FF5A 4YG2F 3I59A 4EGYA 3MEXA 4JQFA 4FHTA 1TW2A 1HXDA 3EQLF 4AIHA 3U9GA 2P4WA 1KU3A 2F5CA 3ZMSA 1IXRC 2LSOA 1A04A 2XHKA 2HZTA 1BOAA 2W85A 3I5UA 5F1RA 4HLYA 2Y48A 3FX3A 4EJWA 1KYWA 1I6XA 2D1VA 3I0TA 5LGNA 1QZYA 1ZRFA 4G6DA 3RDIA 1KYZA 1O57A 2PMHA 5CVJA 4LGWA 2EV0A 2HEOA 4E70A 4WXHA 1B9NA 2MLKA 1PDNC 2JT1A 3BJ6A 3JSPA 4UHTA 1HW2A 3CUOA 2FEZA 3T5XA 4HF0A 1I5ZA 1SFUA 1R5GA 2IA2A 3QRFF 1DPRA 2TDXA 1HBXG 2OQGA 2ISZA 5JR3A 1IN5A 2QZ8A 3E3VA 4M9ZA 2OBPA 4R79A 3GFMA 3GYHX 2PLYA 1QO0D 2XAQA 4CZZA 1S7AA 2CW0F 3GFLA 2MBFA 3F23A 2FU4A 2L3DA 3MQ0A 4G7ZF 3JAMZ 4BXUA 2IJLA 4YFKF 1IF1A 1FBQA 4HW0A 5FLXZ 3F8NA 5D4RA 4HV6A 2XUBA 3QU3A 1MJBA 3WTTC 5ICCA 4ZYEA 4I2OA 4KICA 1ZHFA 3F6OA 4HX7A 5FFXA 1CF7B 3KEQA 4LB5A 1U78A 5D6FA 3H3UA 1FX7A 1P4XA 1ZAOA 5AIQA 2YX4A 5D8LB 5EEGA 4UNOA 4K2EA 3GZ6A 4BQAA 3DPTA 5ICGA 3ZMVA 2VOPA 2ACJA 4ENJA 2VT2A 1CF7A 1T39A 3HRSA 3Q9SA 1V4RA 4U0VA 4D0PA 1W7PB 4JK1X 3RI4A 3F21A 1R58A 5KK1A 6PAXA 1BI0A 4KYWA 1JHHA 2YU3A 1J5YA 2P5VA 2DW4A 2E1NA 4HV5A 4G7HF 3CUQA 1LDJA 1LJ9A 2CFXA 3E5QA 4H0EA 4G6QA 2GIVA 4Y15A 2RV8A 1W7PA 2UZKA 5DD8A 4HAMA 1VTNC 5CVRA 1YYVA 2L01A 1R00A 5BQTA 3VOEA 2QUFA 2QQ9A 5AIPA 3HYIA 2YPRA 1GVJA 3N4MA 1C0WA 3ECOA 4IRHA 3KCCA 4I7HA 3QPTA 3WTSC 4ESJA 3HHHA 1P2FA 1K78A 1JXSA 2CWEA 1HSTA 3BJAA 2P8TA 5D5WB 2G9WA 4Z2YA 2KRFA 1IUYA 3KE2A 3JTGA 1XGNA 3K69A 2Q0OA 3FMSA 4HX4A 4U7BA 4WF2A 5DCFA 3WGHA 2JPBA 4EM1A 1RUNA 3QOPA 3BPVA 2VBYA 2P6TA 5D8KB 4KMFA 5FGMA 1GXPA 2Y75A 3U2RA 1FP1D 5J8CA 3WU0A 1ONVA 4S05A 3W6KB 4MEYF 3HSRA 4RAYA 2H27A 4HBLA 4MEXF 2ETHA 1IN8A 2FNPA 5CVUA 1R1TA 2CO5A 2DK5A 2IA1A 1D8JA 4QLCU 1IRFA 2HR3A 4O3MA 4ZZLA 2LNBA 1ZYRF 1QGPA 2COMA 4KIBA 2W57A 4FT8A 4CICA 4PGHA 3ROUA 2RC4A 2DT5A 4MNUA 2HWVA 1BC7C 1WSUA 4RB1A 2ADUA 4ETSA 3FXRA 3WE2A 5K5OA 2D2WA 4I09A 5K5RA 5JI6A 4U0YA 3QP5A 2OZUA 1OYWA 3BP8A 2FQ3A 5KVRA 4EMSA 5E17F 3N97A 1U5TB 3KP2A 1J9IA 1WKMA 4I0AA 1ODDA 2IPQX 3ZPLA 3RYRA 3L2CA 2Y0MA 2RKHA 3V7CA 4EM0B 4M71A 4A0XA 1SD4A 2QM3A 1X3UA 1FC3A 2NS0A 2V1DA 5H6RA 1UCRA 1U5TA 1GXQA 3O2PE 2P7VB 2M30A 2EB7A 5K1YA 4OINF 3ABTA 3H3ZA 5HDNA 4G8XA 4L5JA 1LB2A 5HDGA 1JGSA 4ESFA 2FXAA 3KFWX 2R7DA 2VBXA 4ZH4F 4NHJA 3HSEA 5LRRA 2F5FA 2IRFG 2RN7A 2EFOA 2DPUA 4M72A 3TKYA 2GXBA 3WTXC 2KKOA 3TDUC 1R1UA 1MGTA 1XGOA 3GFIA 4XBFA 4HX8A 1JE8A 3I58A 1YO5C 3D0SA 4KIFA 5L3BA 1R5HA 1KGSA 1YLFA 2F2EA 2A68F 5BPDA 4N0BA 1KQ8A 5IT3A 1LQ1A 1RZ4A 3BY6A 3TO9A 3FM3A 4HA8A 4YIIA 2XROA 3L9FA 5HLHA 3DKWA 1E2XA 4KNYA 4RGXA 4GCVA 3GEZA 2QENA 2ZNZA 2DQRA 3HRTA 1ZRCA 2K7LA 4U7DA 1FNNA 1R23A 2M5WA 5LHHA 3E5XA 2ZFWA 1R22A 2RGVA 4UUVA 5HLGA 1T2KA 4TV7A 4ENNA 2OD5A 3E6DA 4P9FA 2HQNA 3EDPA 2VOOA 2R7FA 4M9SA 3AAFA 1D5VA 3L09A 4F7ZA 1LEBA 4MTEA 5CJ9A 2BE5F 1O7FA 1OYIA 3I59B 3J81K 1RIOH 1H0MA 5J8FA 2FE3A 2VT3A 3HRUA 1MD0A 2BV6A 3FXQA 3MZYA 5HOOA 3GX4X 2E7WA 4DQ2A 2FRHA 2EV6A 1QZZA 4BYYA 4IXAA 4L9NA 2V9VA 4ESBA 1OMIA 3K1NA 1O3TA 1ULYA 5DCMB 3K2ZA 1O7LA 2LF7A 3P7NA 1XGSA 4LLLA 4P5OA 4KMUX 1H9TA 2L02A 4OIQF 1I1GA 4GYGA 4BAYA 3P9CA 3S2WA 1WI9A 1RUOA 4A5NA 1T0FA 5JHUA 2BEOA 2ELHA 5DCMA 1J75A 3R61A 1Z7UA 1XMAA 4XSXF 3QAHA 2V1XA 3TDZC 2EJRA 2X4HA 3DFGA 4CYDA 2JPCA 5DUIA 3TO6A 2W84A 2IA0A 3VODA 3M1EA 5F64A 4B8XA 1FT9A 4L0ZB 1GHCA 2FBHA 1MDMB 1Z1DA 4N9IA 2DFIA 4I02A 3CJNA 3KP7A 2IVMA 3FMQA 2L54A 2P5KA 1G3YA 3I4PA 3I71A 3BJOA 3D5LA 1CGPA 5CLSA 2ZCWA 2ZKZA 1R7JA 3SQNA 1QBJA 5H20A 4IHTA 3KETA 3ABUA 3TOBA 4KN7X 4M6XA 1Y0UA 3T0YA 1MDMA 2O3FA 3K0LA 3ECHA 3RTRA 2UXXA 3KLOA 4I0BA 3DF8A 1L0OC 4HQEA 1EH8A 3BDDA 2G7UA 3BWGA 5CVVA 4A6EA 2VE8A 5LGUA 3CO7C 2DTRA 1PP8F 3LA7A 5HS8A 2O6GE 3RJPA 3SZTA 1AOYA 4HDUA 4KA4A 1T6SA 1G3TA 5IT9K 4UXNA 3I54A 4R8HA 5JFRA 2GA2A 4ZYGA 5FD6A 3WE3A 1SFXA 3GLXA 1FBUA 3R4KA 4G9YA 4M73A 3ZMDA 2V79A 2EK5A 3IWZA 2HTSA 4HQMA 3IWFA 2Z3YA 4A0ZA 2KIMA 1DPUA 5TJJA 1KQ9A 2XGXA 5D5XB 3L00A 3T8RA 5BPIA 4M9XA 2GAUA 1IXCA 3CUQB 5E18F 2PBIA 4HDVA 2O03A 4OIOF 2HOEA 3EUHA 5FFZA 3IRRA 3K1PA 1J59A 2ISYA 1XD7A 2L4MA 4KUMA 3OV8A 1YG2A 3MCZA 3HOSA 2Z33A 3C3WA 1IN7A 3F8FA 1ZG3A 2CSOA 1BBYA 4R1HA 1DUXC 2DLLA 3J80Z 2QLZA 3CDHA 2K27A 2P5LC 1TW3A 4AWXB 4EJTA 5ILVA 2M1BA 4WX9A 5E8IA 1EV7A 4CHUA 1ZH5A 1ZGAA 4HZFA 1K78B 2IW5A 3BROA 3QP6A 2H09A 3FHZA 5CVIA 3ULQB 4ZYDA 1TLHB 4MGRA 1STZA 1YIOA 2WWYA 2DU9A 4A12A 1V3FA 2GQQA 1XB4A 1LNWA 4OMZA 4IF4A 4Q4ZF 1O3SA 1K6OA 1WQ2A 5HLIA 3HSFA 3E97A 2GA1A 1DP7P 4N9HA 3DV8A 2KIUA 4KFCA 2M8EA 3F22A 3B02A 3LQQA 5E1WA 3IHUA 3DEUA 2XAJA 1O3RA 1F1ZA 4LLNA 3GUDA 3LA3A 3C18A 2HYFA 2C6YA 1SD6A 4MQVA 5A2QK 4WXCA 1W5SA 1S3JA 4WCGA 2P7CB 2KJBA 5E20A 3NRVA 2VN2A 3KLNA 2VE9A 2FMYA 1SFEA 3IC7A 3WTYC 1FLIA 2QBYA 4GYIA 2ESHA 2A3SA 3E5UA 5HVQC 1PP7U 2BBYA 5FO5A 3KZYA 3ZN1A 3ZN0A 3SHFA 1UHMA 1DDNA 4RGSA 1UB9A 4XRFA 2A6EF 4M6YA 3E6CC 1TTYA 3E6MA 5L3EA 2VC0A 3F8BA 1QQIA 3ML6A 4LG0A 5J6XA 3IL2A 3TGNA 2LKPA 3DPLC 2RQPA 2NYXA 3U1DA 3EYYA 4P55A 2YR2A 2HTJA 1U3EM 1YW9A 2ESNA 4RGRA 1LVAA 4GO1A 3ZP5A 1FOKA 5K5QA 1OPCA 3CO6C 3K1MA 1FY7A 1FWZA 3G73A 2A6HF 5AONA 2EA2A 1FSHA 3CUQC 3CLOA 3PQKA 1KU7A 2HQRA 3M9AA 1ZARA 4LB6B 1NHAA 2J5PA 2MD5A 3FMRA 1BJAA 1I1SA 1G6NA 3GO5A 3TO7A 1B9MA 1SD7A 3ZMTA 1BM9A 5ED4A 3WTZA 3ERED 4IJAA 5E1XA 2HYGD 4LFUA 1S7OA 2EWNA 2XAFA 2CGPA 1IAWA 3JAMK 3V7RA 1ZG5A 1S29A 2M87A 4RB3C 4KT5C 5FLXK 2FA5A 2V1UA 4UV9A 2M45A 5L3CA 1XSDA 2PG4A 1BIAA 2FMLA 2STTA 5DUKA 2DO7A 2PEXA 3QU6A 3VEPA 2H6CA 4L9JA 2O8XA 1IZ1A 2XV4S 1U2WA 3GWZA 3PQJA 2FF4A 1PUEE 1J2XA 3HIFA 2QVOA 1QPMA 2LF8A 4YFNF 3ELKA 5EEHA 1TNSA 3FZVA 4XSZF 2KIFA 2BGCA 4MQ9F 2NNNA 2AXLA 1FBSA 3HTSB 3DXJF 2J5OA 2JRTA 3HHGA 4U88A 4AIKA 2MH2A 2UWMA 3L7WA 5ILSA 3IKTA 3BZ6A 1IN4A 1YS7A 3ZMZA 4P9UA 3W6JB 3LSTA 2DI3A 3ZQ7A 5LHGA 1BI1A 5FB2A 1XCBA 3FM5A 2D1HA 5D5UB 3DP7A 4I98B 4NB5A 4EV0A 2PQ8A 3LFKA 4KN4X 4L9TA 3I53A 1IN6A 4RAZA 2XASA 4PCQA 4LK1F 5E8GA 5L3FA 5ILUA 1P4AA 1HQCA 4O6JA 2DAOA 2MC3A 2IT0A 2XRNA 4P96A 4ENKA 2BYVE 1R36A 4M74A 1HKQA 3V8JA 2OZ6A 5D6EA 3V7SA 1U5TC 5LHIA 2XVCA 1P4WA 2MH9A 3WGIA 4HF2A 3ISPA 2OAZA 2Z5UA 3T1BA 4EJVA 3MWMA 1HW1A 1IXSB 2QYOA 5LEKA 3TQNA 1XMKA 1REPC 1TQPA 1WRJA 3F8MA 5BOXA 1FP2A 1YTYA 1W4MA 5BS6A 3O6BB 2FBKA 5BMZA 3HUGA 1ZREA 2XAGA 2WTEA 2YX7A 1ON1A 3M8EA 3NEUA 5TRDA 2ZMEB 4A6DA 2A07F 2CQKA 5ICEA 2K86A 4LD5A 1HSJA 2ZJ2A 4ENMA 3QPHA 4ZYHA 1HW5A 2B0LA 4BH9A 4BHBA 1B59A 4LLGF 5DV5A 1HKTA 3JTHA 4DNCA 1USTA 1BN5A 1SMTA 4Y13A 2A5YB 2P6SA 4CGZA 2ZMEA 3WTWC 4IVNA 3RKXA 5L3GA 4ZZDA 1HKSA 4MTDA 1SD5A 2GZWA 4NQWA 3HOTA 3DQVC 2K02A 1USSA 3KP5A 4I01A 2VC1A 4PZJA 5HS9A 1OYYA 2UXNA 3RKWA 2GXGA 3PFIA 2AS5F 4L18B 4EGZA 4L0YB 1LDKB 2R3SA 4MHGA 1Z6RA 1U8RA 1RNLA 4BNCA 1YW7A 2ZNYA 2A69F 3GFJA 1O3QA 3RYPA 3WG9A 2Q2EA 3RPQA 1T38A 1FZPB 1UFMA 1H9GA 1LDDA 1XSVA 2JZYA 3FWEA 1BIBA 1FYMA 1IRGA 1K7AA 2NNYA 1EH7A 2VBWA 4HF1A 4G7OF 2FSWA 2CG4A 4YFXF 3VB2A 4IRGA 3O3KA 4EVIA 4UVAA 2WC2A 4AIJA 4IPAA 3CTAA 3RPUA 2OA4A 1YW8A 2EFPA 2K4JA 3V8KA 5ICFA 1ZLKA 4L5IA 4A5MA 2JSCA 1ZGJA 1P92A 1Z6TA 3E6BA 1R1VA 2H6BA 2QQBA 4HYEA 1B6AA 3HRMA 5DDGA 4RB2C 2Z9OA 1RI7A 2EFNA 1OKRA 3J81Z 4ON0A 2XAHA 3B73A 1XCVA 5L3DA 1Q1HA 3GXOA 3Q5FA 2HGCA 3LAJA 2GWRA 3V4GA 1D8KA 5HDKA 4RS8A 3SZPA 2DK8A 1YS6A 1KU9A 3GW2A 4PDKA 1B4AA 3GF2A 1IW7F 2LDUA 1B1BA 4B09A 4Q5SF 3R60A 3F8CA 3R6SA 5JVTA 1Z9CA 2JTVA 4GGGA 2XIGA 2W25A 3T8TA 2PMUA 1OR7A 3WODF 1TNTA 4O5VA 2H94A 2PN6A 2QBYB 5D4SA 4OOIA 1Z91A 3LAPA 4GXOA 2E7XA 1FYLA 3P9KA 1YFHA 4CO8A 1G3WA 4U0WA 4JBAA 2G7HA 3WTUC 3REOA 5DD4A 4G94A 1D3YA 3Q9VA 3MAJA 3H92A 5CYVA 4KIGA 4OU0A 3V8LA 5LRSA 4LG0B 2FNAA 1AWCA 5D5VB 1ZG1A 2OQRA 2VBZA 3MZHA 1FSEA 2EA4A 1S8NA 1W5TA 1TQMA 2HS5A 1U6GA 4QWQA 2ZO4A 2QQAA 4S04A 4UV8A 2D45A 4Y17A 3VFZA 3TOAA 4OIPF 3J7AO 5ERIA 3C1DA 3M8FA 3WTVC 3LQRA 1LEAA
chains in the Genus database with same CATH superfamily
3GBGA 4EM2A 3CZ6A 2EFQA 4WK8F 2ECCA 2XKPA 3DTKA 1MIJA 5LGTA 2KPMA 1TQIA 3EUHC 4CCJA 4EEFG 1VNDA 2EBIA 4IRIA 2RDPA 1F5TA 2X6YA 4DZJA 2V6CA 2LVSA 4FX4A 4BDYA 1IRZA 1OCPA 5IT9Z 3RIRA 2X1EA 1YX5A 3EETA 5FD5A 2WV0A 1DQUA 5F6FA 3ABKH 3H9GA 3IKVA 5DYMA 3BZKA 3JW4A 2XGDA 4NNJA 4LITA 3JRGA 2LH9A 3K9TA 1L3LA 5E1ZB 1TZLA 1A36A 1YRNA 2EV5A 2LRDA 3R0AA 1ZLJA 1MBKA 1R71A 4L5EA 1Y6IA 4AC0A 4HLXA 4CDGA 3MFKA 5M3MJ 4BEHB 1FPQA 4HEA2 1ZRDA 1G2HA 1YE9A 4CYCA 2K9SA 3DKYA 5GAEJ 1F4KA 4Y4RA 1DGWY 4HOBA 1BI2A 3BOQA 1KZHA 3G3ZA 2IGNA 2WB1N 2KP6A 1E0EA 1TWHJ 1QNTA 4XLPF 2MA3A 2EFWA 1HDDC 4XRSG 2VXZA 4AVPA 1VI0A 3WGGA 4NDLA 4WWCA 2ZJPF 4KDPA 4UVBA 4BL0B 2DPDA 2HKXA 3CP2A 1MBJA 1X1AA 4BHPA 4XLEA 1I27A 3ESWB 3KEOA 2PFBA 2B63J 3KP3A 2DA4A 2LY9A 2ZFUA 3BG3A 3WHBA 4ZTJA 3M7GA 3GZ5A 2YSRA 3LL7A 3LMMA 4M3EA 3A4CA 4EQQA 5B66C 1BR1A 3CMEI 3GVAA 4UB6C 2NVQJ 5LEJA 3P9IA 1UELB 5FKMA 4W97A 1PVEA 2FOKA 3KP6A 1XDSA 3R0JA 5DTDA 5HS7A 3C7JA 5IOYA 3G2BA 2NRAC 1HC8A 3KZZA 3L2UA 1G3SA 3FXUA 2NAZA 2IP2A 3VDXA 3O8HA 1Q1VA 3W6VA 4B3XA 3RSNA 2O0YA 3HB9A 2A6TA 2MLGA 3CF5F 2XF6A 2VONA 4YIFA 4RB0A 3I64A 4H4KC 2KJCA 2DYRH 3LWFA 1XGMA 3QYEA 1W7PD 1ITYA 1E17A 2EIMH 2PJPA 4A2UA 2FBIA 4IHSA 3COAC 2DQLA 5GAGJ 1XN7A 1UG2A 1KA8A 3HTUA 1Y1WJ 1SAXA 3RZDJ 3F72A 4OIRF 2NVUB 2JVGA 1BC8C 2Q8KA 3LA2A 2YS9A 1FYKA 3SXYA 3HL2A 1S72I 1XSXA 2R7OA 1UHWA 1P6RA 1JHFA 3S1MJ 1WWXA 3S32A 1E3HA 4AD9A 3S16J 2DOEA 4LJZF 1GV2A 1VF9A 1SMYF 4ZYAA 1QRYA 2EIJH 2W24A 3S93A 4C3IJ 1ETXA 1S6LA 2QWWA 1FIPA 4E6KG 3LSMA 2CYYA 2JUCA 2BY0A 5C44J 2BOLA 2DMUA 3RKYA 2AHQA 4XLNF 3G6EI 3UR3C 5DEQA 1ZR2A 4FISA 1OQYA 2Z99A 2A61A 1UMQA 5C4XJ 1BI3A 1XDUA 1HDPA 1MNMC 2X48A 3NQOA 1Z05A 3QWLA 1MJ9A 5LLQA 2WADA 1EH6A 4EJOA 1ZN2A 1TWGJ 3BPXA 1YQAA 4EJUA 3AG1H 4LG3A 3FBNB 4OAZA 2R7ZJ 3DTIA 3WU1B 3HGGA 2CQ7A 4Q47A 3CCUI 1F9NA 1Y8RB 3OS0A 4LK0F 1J7KA 2DBBA 5J4VA 4CXFA 3G71I 3GCMA 1P7IA 3EYIA 3IRQA 3F6VA 4FX0A 2K85A 4C9YA 4A3JJ 1W5CC 3ZMUA 1V55H 4MLOA 2L4AA 5K7FA 2XGCA 4UVCA 4Z6YA 3FHNA 4ASNA 1MKMA 3H0GJ 2RNJA 2OU2A 2ID3A 5A2QZ 2GIZA 3W2VA 3J80K 3OOPA 2A5WA 4DYCA 2O61A 1J0RA 3VSLA 4Y52J 1DU6A 2HFHA 2FUG2 4DYRA 4DW6A 1KU2A 3SFZA 1P9QC 2VODA 4NC6A 5EGOA 3OMYA 5EEAA 2HKOA 2K4BA 2ZXJA 3KP4A 3JSOA 3CCVI 4HRIA 1OCTC 4BHCA 2ZB9A 5LBQA 3DTEA 4LMYA 2QSHX 1KQ0A 1TT5B 2F5EA 2AQFA 4RLQA 1MSEC 1MJAA 1TBXA 2A05A 4RGUA 1X4OA 1MZBA 3PO3J 5H6QA 1U9OA 4WXDA 2HOTA 4Q48A 2JA5J 4F91B 4XQFA 4NC7A 2DODA 2DOFA 2RVCA 2ZBKA 2LG4A 2XKOA 1Z3YA 3S1RJ 1K79A 2STWA 3L2VA 2E1CA 3I4MJ 2L5QA 2PI0A 2EILH 3F3XA 1G4DA 4OMYA 1T98A 3DPUA 2X0LA 4L9VA 1ON2A 4PGGA 2F5DA 4DOZA 2HDCA 3K70D 3OL4A 2L9SA 4A0YA 1XMXA 3FF5A 2CV0A 2CU7A 1MH4A 4XR6A 4YG2F 3IH4A 3I59A 4EGYA 3MEXA 4UUTA 4FE4A 4JQFA 4CH7A 3PSFA 4FHTA 1TW2A 2E35A 1HXDA 3EQLF 4AIHA 1LFUP 3U9GA 2P4WA 3K4NA 1KU3A 1D1CA 2F5CA 3ZMSA 1IXRC 2L9NA 4D1QA 2LSOA 1X58A 3PUBA 2GOMA 1A04A 2HZDA 2XHKA 3Q0VA 2HZTA 1FTZA 1BOAA 2W85A 3I5UA 1T8IA 5F1RA 4HLYA 4P1WA 2Y48A 3FX3A 4EJWA 1KYWA 1I6XA 2D1VA 2KHMA 2VQLA 3FXMA 4CSWA 3I0TA 1QVTA 5LGNA 3WU2C 1QZYA 2CW7A 5CPRB 1IV6A 1ZRFA 1FEXA 4G6DA 2MGQA 3IAS2 1KYZA 3RDIA 1W0TA 1O57A 2WAFA 3CP8A 2PMHA 5CVJA 1OCCH 4LGWA 3S3OA 5EDNA 3ZQIA 1WPKA 2EV0A 2X6XA 3K4KA 3F0CA 1P7JA 2HEOA 3MD2A 3EUKL 2LYCA 4QPOA 4WXHA 4E70A 1B9NA 3K4MA 2MLKA 1PDNC 2JT1A 2BY3A 3BJ6A 4GRIA 4IQJA 3JSPA 5F27A 1LUJB 1WCMJ 2MD0A 4UHTA 1HW2A 4ZJZA 3CUOA 5HNFA 4FE7A 2E5NA 2FEZA 3T5XA 4HF0A 1I5ZA 1SFUA 2E1MC 1R5GA 2ZXHA 4A3IJ 1ETKA 2IA2A 2KDOA 1EA3A 3QRFF 1DPRA 2TDXA 4X1EA 1HBXG 2AXTC 2OQGA 2KISA 3A02A 1JGGA 2ISZA 5JR3A 1IN5A 1WJDA 2QZ8A 3E3VA 4M9ZA 2OBPA 4R79A 3GFMA 3GYHX 4AUXA 2PLYA 2BW3A 1QZEA 3PL8A 1QO0D 1RPWA 2K40A 2XC7A 2OCEA 2XAQA 4CZZA 2L7MP 1S7AA 3M07A 4B44A 2RNGA 2CW0F 4XKCA 5J1RA 1MMGA 3GFLA 2IAIA 2MBFA 2QA4I 3F23A 2FU4A 2L3DA 4G12A 2VQHA 3MQ0A 3CDLA 2JA8J 1JKOC 4JX5A 4G7ZF 2XB0X 1K61A 3JAMZ 3ONQA 4BXUA 2IJLA 4YFKF 3IH2A 1IF1A 3FBIB 1FBQA 2DJNA 3SYTA 3X2QH 1ZQ3P 3OIPA 4HW0A 5FLXZ 4MIMA 2HVSA 4B48A 2LFBA 3F8NA 1XC5A 3VPRA 5D4RA 1I50J 3LFUA 2XUBA 3QU3A 1MJBA 4HV6A 3WTTC 9ANTA 4A3KJ 5ICCA 4ZYEA 4I2OA 4KICA 1ZHFA 3F6OA 4HX7A 3LOCA 5FFXA 1CF7B 4IHWA 3KEQA 4LB5A 1U78A 5D6FA 1ETVA 3H3UA 4XLAA 1FX7A 1P4XA 1ZAOA 5AIQA 5FKOA 1YJNI 2ID6A 3RKQA 3G1OA 2BXYA 2YX4A 5J1UA 5D8LB 4HG2A 5EEGA 4UNOA 3EPZA 3OYLA 1AKHB 2YU9J 5DM6F 1Y56A 5FKLA 5KHDA 2WB1A 4K2EA 3GZ6A 4BQAA 3DPTA 5ICGA 1MNEA 3BTIA 4AM3A 3ZMVA 2VOPA 1JJ6C 5KAFC 5FKKA 4PJ0C 2KZGA 3OIOA 4HNVA 1SVOA 2ACJA 1MBEA 4ENJA 2VT2A 1CF7A 1T39A 1BJZA 4U87A 2QSGX 3HRSA 3Q3SA 1LKXA 2F6CA 1HLVA 1IUFA 3Q9SA 1V4RA 4U0VA 5E3OA 4D0PA 2X1DA 3GZNB 1W7PB 4JK1X 4AYBN 3RI4A 3F21A 1R58A 3BCAA 4V2FA 5KK1A 3LSPA 6PAXA 1BI0A 4KYWA 1JHHA 2YU3A 1J5YA 3ABLH 2P5VA 2DW4A 2E1NA 4UUSA 4QTRA 1X3ZB 2DYSH 1TWFJ 4HV5A 4G7HF 3CUQA 1Y39A 4BE2A 1LDJA 3I55I 1IGNA 5C3EJ 1LJ9A 1OFCX 1MMDA 2IS4A 2CFXA 3E5QA 2R0QC 5TISC 4H0EA 1FJLA 1Z77A 4F3QA 4G6QA 3MKLA 1R5ID 3L2RA 4GFBA 2GIVA 2L0KA 4Y15A 1RKTA 1X4PA 2RV8A 1W7PA 2IS2A 2UZKA 5DD8A 4HAMA 4IEJA 4BJ6C 2ME0A 1VTNC 5CVRA 4BY1J 1YYVA 2L01A 1R00A 3GTLJ 5BQTA 1N77A 2HPIA 3VOEA 2W4SA 1MBGA 2QUFA 2QQ9A 1Z0XA 1R49A 5AIPA 2EIKH 5EG0A 3HYIA 1XX5A 2YPRA 2OTLI 1GVJA 2IS6A 3N4MA 1C0WA 4RM2A 5E3LA 3JRFA 3ECOA 4RBOA 3HOVJ 2ZSIB 4IRHA 3KCCA 4I7HA 4D5FA 4E7JA 4N4OB 3QPTA 3WTSC 2VI6A 3KIOA 5IP6A 1W36C 3CLQA 5C4JJ 4XOTA 2IGMA 4C3JJ 4ESJA 3HHHA 1P2FA 1K78A 1JXSA 2OC6A 4RMNA 2CWEA 1WJ5A 1HSTA 2LOOA 3BJAA 2P8TA 3ERMA 5D5WB 2G9WA 4Z2YA 2KRFA 1K4SA 1IUYA 2K3FA 3KE2A 3MN2A 4IL6C 4ZDLA 3JTGA 1NK2P 1XGNA 4HPQA 3K69A 2Q0OA 5F1JA 3FMSA 1FTTA 4HX4A 2DFHA 3JRBA 4U7BA 5B1BH 4WF2A 5DCFA 3WGHA 4D7MA 3IH3A 2MFZA 2JPBA 2ZMEC 4EM1A 1RUNA 3QOPA 4MFEA 3BPVA 4ZC3A 1E3OC 2VBYA 1DP3A 2P6TA 5D8KB 2DMNA 4KMFA 1I3QJ 5FGMA 4F52A 1GT0C 1GXPA 2Y75A 3U2RA 2ZXIA 1FP1D 5J8CA 3WU0A 2LC2A 1JUMA 2CJJA 3H5AA 1ONVA 4S05A 3W6KB 2Z2SB 4G6TB 4V2GA 4MEYF 2X85A 3HSRA 3ZQFA 2LD5A 4RAYA 2JUGA 1VFCA 1VQMI 2H27A 4HBLA 4MEXF 2KT0A 2ETHA 1JUPA 1IN8A 2FNPA 2VJ4A 2VKVA 4ZDPA 3OYDA 2K9NA 2KIQA 5CVUA 1R1TA 1OCZH 2CO5A 3TL4X 2DK5A 2R5ZA 3OYEA 1YITI 2IA1A 2LBFB 1D8JA 4QLCU 3H3VK 1IRFA 4E7KA 2HR3A 4O3MA 3HEFA 3FXOA 2CMPA 4ZZLA 3BTCA 3GLLA 2LNBA 1ZYRF 2DMTA 4M3BA 1QGPA 2COMA 1YRNB 4KIBA 2W57A 1V5EA 4FT8A 3S8PA 4CICA 1NH3A 2B7EA 2OTJI 4PGHA 4BQNA 3ROUA 2RC4A 2DT5A 4MNUA 2JJ7A 5FLMJ 2HOSA 4PSXA 2HWVA 1BC7C 4QSHA 1WSUA 4YIRX 3C2BA 4CYCB 4RB1A 1MW7A 2ADUA 5CKTA 5FJ8J 4JX6A 1YI2I 1K6YA 4ETSA 2JA2A 3FXRA 3WE2A 1SVLA 1WVRA 5K5OA 2D2WA 2LBFA 4I09A 1B8IA 5K5RA 3AL0C 3VYRB 5JI6A 4U0YA 3LSRA 2BZTA 4A93J 3QP5A 2OZUA 1OYWA 3BP8A 2FQ3A 5KVRA 4EMSA 5E17F 1ETQA 2FOWA 3N97A 1MBHA 2QKLB 3H36A 4BJ5C 1U5TB 3P5JA 3KP2A 1NTCA 1J9IA 1WJCA 2VASA 4Y7NJ 1WKMA 1MSFC 1U9NA 4XORA 4I0AA 1ODDA 3CCSI 2IPQX 3ZPLA 2XGEA 3RYRA 3L2CA 2Y0MA 4JP0A 4E7SA 2RKHA 3V7CA 4HNUA 3S1NJ 1POGA 1Z3XA 1GV5A 1OJLA 4EM0B 2F4IA 4M71A 3HG9A 1VQ8I 4A0XA 4E7ZA 2ZC2A 2DDBA 4XIDA 1SD4A 5GPAA 2CUZA 2QM3A 1X3UA 1W0UA 3CC4I 1FC3A 2NS0A 3BR0A 3CQZJ 3G1LA 2V1DA 2Y0SN 3Q0UA 1UCRA 5H6RA 1U5TA 1GXQA 3O2PE 2P7VB 3H5NA 2M30A 2EB7A 5K1YA 3PJRA 4OINF 3ABTA 3DBHB 3H3ZA 2XF7A 3MVPA 2OUMA 3BR5A 5HDNA 4XLHA 4G8XA 4L5JA 1LB2A 5HDGA 1JGSA 2WY8Q 4MFDA 3VSKA 4ESFA 2OJED 2FXAA 3KFWX 2R7DA 4E7HA 2VBXA 4ZH4F 1WGXA 4NHJA 2JMWA 5J4YA 3HSEA 5LRRA 1RR7A 3NAUA 1RC9A 2F5FA 2IRFG 2RN7A 1V5GA 4F55A 2EFOA 2DPUA 2XRLA 2CQXA 3ZQGA 4B47A 4IHXA 4M72A 3S3MA 3TKYA 1OISA 2Z16A 4E7IA 2KKOA 2VJ5A 3WTXC 3AFHA 1R1UA 1MGTA 1ORKA 1XGOA 3TDUC 5IP9J 3E1SA 2D5VA 1IC8A 3GFIA 4XBFA 3OR2C 4HX8A 4ABZA 2N8GA 1OR7C 1JE8A 4M3FA 3I58A 1VQ4I 4BY7J 1YO5C 3D0SA 4XOPA 3JRAA 4KIFA 5L3BA 2AO9A 3K2AA 1R5HA 1KGSA 2Y9ZA 3ZQCA 3JRHA 2COBA 2XPVA 1YLFA 2F2EA 2A68F 3TW6A 2LTPA 5GTIC 5M3FJ 3HZJA 5BPDA 4N0BA 3IP4B 1KQ8A 5IT3A 1LQ1A 2Y2ZA 2VKHA 4AVZA 3PM1A 1RZ4A 2LREA 3BY6A 1JTXA 3TO9A 3FM3A 4HA8A 4YIIA 2XROA 3L9FA 2M4KA 3ZQHA 5IYCJ 4BBRJ 1Y0NA 5HLHA 3DKWA 1E2XA 2F4MB 4KNYA 4RGXA 2HU9A 4GCVA 2KLOA 1A6IA 3I56I 1ETOA 3GEZA 4OWRB 2ME6A 2QENA 5EGOB 2ZNZA 4YRVA 4XMYA 1D0XA 2DQRA 3HRTA 2K7LA 4U7DA 1ZRCA 1FNNA 3MKZA 1R23A 3Q0WA 2M5WA 5LHHA 3HOWJ 2FJ1A 1IDYA 3E5XA 3V42A 2XDVA 2DOAA 2LMDA 2ZFWA 1R22A 2NOJB 3CC2I 2P81A 3ZRGA 2RGVA 3PIPF 4IOCF 4UUVA 5IP7J 5HLGA 1T2KA 3BG9A 4XK4A 4TV7A 1RESA 3S2DJ 4BU2A 4ENNA 2OD5A 3E6DA 4P9FA 4BE0A 2HQNA 3EDPA 2VOOA 5M5WJ 2R7FA 4M9SA 4AIDA 4UY8I 3AAFA 2GM4A 1RKWA 3DLAA 3G1MA 1D5VA 2WA0A 3L09A 1UJ8A 4F7ZA 1LEBA 2DA3A 5F08A 4MTEA 2LY2A 5CJ9A 1JI8A 5EZGA 3PNYA 2BE5F 1O7FA 2L9VA 3QPSA 1OYIA 3NARA 4AYBA 3I59B 3J81K 1RIOH 1H0MA 5J8FA 2FE3A 2IEKA 4JX4A 3C2HA 2DDAA 3WG7H 2VT3A 3PIOF 4RA2A 3FDYA 3HRUA 3HPGA 2E34A 1MD0A 2BV6A 3IAM2 3FXQA 3MZYA 3SDBA 5HOOA 2ZJQF 3GX4X 2VKEA 1IO2A 2E7WA 3L1PA 4DQ2A 2FRHA 1I39A 2EV6A 3CDIA 1QZZA 4BYYA 2BVLA 3ZOBA 4IXAA 4L9NA 2V9VA 4ESBA 1QHHD 1OMIA 3K1NA 1AU7A 1O3TA 2EPFA 1ULYA 5DCMB 1YX3A 1ACIA 5FROA 3K2ZA 2EZHA 2MYSA 1H89C 1O7LA 2LF7A 3P7NA 1XGSA 4LLLA 4P5OA 3W3CA 4KMUX 1H9TA 2NVXJ 3JRIA 2L02A 2IBDA 5DS9A 4OIQF 2E71A 4JYKA 1I1GA 5JHFA 5IYBJ 4GYGA 2DT7B 4BAYA 4C2TA 3LSKA 3P9CA 3S2WA 1QVUA 3HXLA 3KYCB 3LNQA 1FOYA 1WI9A 1JKPC 3BC8A 1RUOA 4A5NA 2KFDA 1T0FA 5JHUA 2H1LA 1PYVA 2BEOA 3K10A 5EYRA 2ELHA 1ENHA 5DCMA 1J75A 3R61A 1Z7UA 3U1KA 3K7AJ 3GTJJ 1XMAA 4XSXF 3QAHA 2V6EA 2E2IJ 2NXNB 3A1YA 2XPUA 2V1XA 1V5FA 5F04A 3TDZC 2EJRA 2X4HA 3DFGA 2WY7Q 4CYDA 3HOYJ 2JVHA 3DWLE 2JPCA 5DUIA 3A0HC 3TO6A 2W84A 2IA0A 3VODA 4NUBA 4II2A 3M1EA 5EJCA 2F5VA 5F64A 2BW3B 2M4GA 3K6GA 1TL8A 4B8XA 3ABMH 1FT9A 3K4BA 1X19A 4L0ZB 3S3NA 1GHCA 5IPAA 1LFBA 2FBHA 1MDMB 1Z1DA 1KONA 2DFIA 4N9IA 3RQIA 5HLTA 4DBQA 4I02A 3CJNA 5M5XJ 2R5YA 3CC7I 2CS3A 3KP7A 2IVMA 2M9HA 3FMQA 3TP3A 1ZR4A 3ASNH 2L54A 2VKDA 3HC7A 2HVQA 2CQQA 2P5KA 1G3YA 3I4PA 3I71A 3BJOA 3D5LA 1CGPA 5CLSA 3HOZJ 2ZCWA 2V7FA 5CQEA 2ZKZA 3JRDA 3PNTA 4XN3A 1YIJI 3OS2A 2E60A 1R7JA 4BUPA 3SQNA 1FMVA 2HQAA 1QBJA 5H20A 4IHTA 3KETA 3ABUA 1PUFB 3TOBA 4C2UA 2M7BA 4KN7X 4M6XA 1Y0UA 3T0YA 1MDMA 2O3FA 3K0LA 5FLVA 2V1NA 3ECHA 3RTRA 2UXXA 3VYSB 3KLOA 4I0BA 4CZCA 1WJAA 3DF8A 1L0OC 4I76A 3H9QA 1Z67A 2VPLA 3VWBA 3DKXA 2HDWA 4HQEA 4XKWA 1EH8A 3BDDA 2L9RA 2G7UA 3BWGA 5CVVA 4A6EA 2VE8A 3W2AA 5LGUA 3CO7C 2DTRA 1PP8F 3SEQA 1FIAA 3D1NI 2KDZA 1A35A 2EH3A 3LA7A 3OYHA 3BG5A 5HS8A 4XLFA 2O6GE 3RJPA 3SZTA 1AOYA 1PUFA 4HDUA 2L2OA 4KA4A 1D5YA 1T6SA 1G3TA 5IT9K 4UXNA 2LR8A 3I54A 4R8HA 2OF7A 2GA2A 5JFRA 4ZYGA 5FD6A 3HPHA 4BXXJ 3WE3A 2L7FP 5IYDJ 1ZGWA 3QODA 1SFXA 3GLXA 1FBUA 3R4KA 4G9YA 5IY5H 4YELA 4M73A 4BJTA 3MKYB 4IQ4A 3LSIA 3ZMDA 3A2KA 2V79A 2EK5A 1EJ9A 3IWZA 2UV1A 2HTSA 1T56A 2CRGA 2LKSA 2FD5A 2LLKA 3IWFA 2Z3YA 4HQMA 3MZ8A 4A0ZA 4CCOA 2KIMA 2R7WA 1HF0A 1XPXA 4XRSA 1DPUA 5JLXA 5TJJA 1KQ9A 1M1EB 2UUZA 2XGXA 5D5XB 3L00A 3T8RA 4CCLA 5BPIA 4M9XA 3OSFA 1Z7LA 3UNGC 3L2WA 4UUSB 2IS1A 2IGKA 2CUJA 2GAUA 1IXCA 3CUQB 3K4CA 5E18F 2PBIA 3OS1A 3HOUJ 2BHZA 4RAFA 4HDVA 2O03A 2RREA 3QOEA 4OIOF 2HOEA 2M3AA 3EUHA 4YEJA 5FFZA 3IRRA 1S7EA 3K1PA 2RQQA 2JK3A 2KMUA 2Y0SA 2PX9A 1J59A 2ISYA 1XD7A 2L4MA 4KUMA 4PFPA 3OV8A 2K9LA 4M6VA 1XG1A 4XONA 3OYNA 1YG2A 1NK3P 2VB6A 3MCZA 2FX0A 1SFOJ 3HOSA 2Z33A 1MMSA 3HBLA 3C3WA 1IN7A 3F8FA 4J01A 5J47A 1WI3A 1ZG3A 1BBYA 2CSOA 4R1HA 2DLLA 2R7RA 1DUXC 1JTYA 5EG0B 3J80Z 2LY1A 2QLZA 2GBYA 1VQLI 4RAGA 3CDHA 2K27A 2P5LC 1TW3A 3AKZA 4A3GJ 4AWXB 4EJTA 5ILVA 3GTOJ 1MMAA 3A01A 5BNGA 1XS9A 2M1BA 1H8AC 5B3SH 4WX9A 1HOMA 5E8IA 1SANA 1EV7A 3OYAA 2IXSA 3M3YJ 2X9DA 4CHUA 1ZH5A 4ITVA 1ZGAA 2QEXI 4HZFA 1K78B 2IW5A 4B3AA 4X6AJ 3BROA 3ZQLA 4E7LA 2H1KA 3TMOA 3OYKA 3QP6A 2W1OA 3K4JA 2H09A 3ASOH 3FHZA 2E19A 1WHUA 5CVIA 4KJZA 3ULQB 3WHCA 1RRJA 2EZLA 4IZZA 5EZHA 5GTHC 1ETYA 4ZYDA 1TLHB 4MGRA 3J7YJ 1STZA 1YIOA 2WWYA 1VZ0A 2Y30A 5TGTA 2DU9A 4A12A 1V3FA 2GQQA 1NG6A 1XB4A 1LNWA 2E36A 1K4TA 4OMZA 4IF4A 4Q4ZF 3KYLA 4BACA 3E0JB 1O3SA 1K6OA 3HOXJ 1WQ2A 5HLIA 3HSFA 2DA6A 2XSJC 3E97A 2GA1A 3OR1C 1DP7P 4C3HJ 2MSYA 3DV8A 4N9HA 2KIUA 4KFCA 2M8EA 5B5EC 5LFAA 3KPHA 1IG7A 5EF6A 3F22A 1UG0A 3B02A 5HODA 3LQQA 1ZTRA 4FETA 5E1WA 3IHUA 3DEUA 3C2GA 2XAJA 4BXFA 1WH7A 2QSFX 1O3RA 1F1ZA 4LLNA 3GUDA 5FRMA 2R5ZB 3LA3A 3C18A 2HYFA 2CUFA 2Y69H 2C6YA 1SD6A 4MQVA 5A2QK 1BL0A 4WXCA 2BVMA 1W5SA 1S3JA 3JCUC 4QIWN 1VQOI 1N78A 1OLTA 1YOVB 4WCGA 2P7CB 2KJBA 5E20A 4S0HB 5J40A 1X1BA 3KLNA 2VN2A 3NRVA 1W36D 2VE9A 3SJMA 2F48A 2FMYA 1SFEA 4M3GA 3IC7A 1N25A 1JKRC 2JWTA 2O7OA 3WTYC 1X2NA 1FLIA 4PJNA 1V54H 2QBYA 2H8WA 3LSHA 4GYIA 2ESHA 1RR8C 1B8IB 2B9SA 2A3SA 3E5UA 5HVQC 1PP7U 2BBYA 3CCJI 5FO5A 3KZYA 3N05A 3ZN0A 3ZN1A 3OYCA 2VXDA 4D7NA 3SHFA 2YUSA 3TEDA 1UHMA 4PSWA 2Y9YA 1DDNA 1TWAJ 2HNHA 4RGSA 4D5CA 1UB9A 4XRFA 2XAUA 2A6EF 4M6YA 4XM3A 3E6CC 2M2EA 1TTYA 3E6MA 1ETWA 1BW6A 4KT6A 4QPQA 2VC0A 5L3EA 3F8BA 4KITB 1QQIA 2PMZN 3ML6A 3OY9A 2DXIA 4LG0A 4C30A 3CESA 4FASD 5J6XA 1WZ2A 3TGNA 3IL2A 2LKPA 3H5RA 1UAAA 2K9MA 4J19A 3DPLC 3PFYA 4DIQA 2RQPA 2CV1A 2NYXA 5GAHJ 2VIXA 3BR3A 3FXKA 3U1DA 4ZDOA 3EYYA 4P55A 2WAEA 2YR2A 2HI3A 4F92B 2HTJA 2BY2A 3NWTA 1RETA 1T33A 1U3EM 3GTQJ 1I6HJ 2R7VA 1X1CA 1G8XA 1YW9A 2XB5A 2ESNA 4RGRA 1LVAA 4GO1A 1MH3A 4CA0A 1OCOH 3ZP5A 1LPQA 1FOKA 5K5QA 3L2QA 4FQGA 3FKJA 1OPCA 3CO6C 2CW8A 3HJEA 3K1MA 2KQRA 3PUFA 2DT6A 5F0HA 1FY7A 4OAYA 1FWZA 2M0CA 5JLWA 3G73A 2A6HF 1DU0A 4MO7A 5AONA 2EA2A 1FSHA 3CUQC 3CLOA 3OYBA 3B6CA 1ZKGA 3PQKA 3JRCA 2L7KA 2VLAA 1KU7A 2I10A 2HQRA 3M9AA 2G0EA 5F0FA 4N4NB 4XICA 3JR9A 1ZARA 3NWSA 4LB6B 1NHAA 1B72B 5KCMA 2J5PA 5E3MA 3CJTB 4HSRA 1T08B 3CJRB 2MD5A 3FMRA 3RPUD 1FOWA 5FKNA 2K5CA 4HSTA 1BJAA 3RQ4A 3K4LA 3A03A 1I1SA 2JA6J 1G6NA 2H8RA 4A69C 2KZVA 3GO5A 3TO7A 1OCRH 1B9MA 1WJFA 2F4OB 5K7HA 4GDFA 1SD7A 3ZMTA 2E1MB 4UB8C 2MG4A 1BM9A 5ED4A 3WTZA 4BEHA 2W7NA 3S1QJ 1QU3A 1G59A 3KEYA 3ERED 1Z21A 4XL9A 3QQAA 4IJAA 1R4MB 5E1XA 1YHQI 2HYGD 1B72A 3BLYA 1F36A 1W1WE 4LFUA 2VPRA 2KL4A 1S7OA 2EWNA 1NG7A 2XAFA 2JSPA 2DA2A 2CGPA 1IAWA 3JAMK 3BTJA 3V7RA 1ZG5A 1S29A 1BA5A 2M87A 1CQTA 3UKGA 4E4HA 3AG4H 4RB3C 4BQQA 3VYUB 2GXBA 4KT5C 5FLXK 2FA5A 3BG7A 2V1UA 2ICWG 3IUOA 2M45A 4UV9A 5L3CA 1XSDA 2PG4A 1BIAA 2QCOA 2FMLA 3ZQQA 2DA1A 4IO9F 2STTA 1IJWC 4A3FJ 5E79C 3QPLA 2DO7A 3DEEA 2JN6A 2DFEA 2E5ZA 2PEXA 2H6CA 2VJJA 3QU6A 5DUKA 3SEZA 3U21A 3VEPA 4DYQA 3I4NJ 4L9JA 2E1OA 2O8XA 4CCNA 1IZ1A 1AHDP 2HVRA 1J09A 2XV4S 4LOCA 4I6ZA 1U2WA 3GWZA 2L7ZA 3SFIA 3PQJA 2TCTA 3BR6A 1BR2A 2V9KA 4CCKA 3D5SC 3DCFA 3LSGA 3G4SI 2FF4A 1PUEE 2V9PA 2QF7A 3KX2A 1GUUA 4RLFA 4PJLA 1JT6A 2MW8A 1J2XA 3HIFA 1LFPA 2QVOA 2MABA 3HKZN 5H2FC 3CMYA 1YJ9I 1GVDA 1QPMA 2LF8A 4W1UA 4YFNF 3ELKA 4BKXA 4EATA 2XSDC 5EEHA 4V19K 1TNSA 3FZVA 4XSZF 1BOBA 2KIFA 2OV7A 3SZGA 4FTHA 2BGCA 1O4XA 4MQ9F 2NNNA 2AXLA 1FBSA 2R7SA 3HTSB 3DXJF 2ZJRF 2J5OA 2JRTA 3HHGA 4U88A 4AIKA 2MH2A 2UWMA 2NS7A 2WAQN 4DZPA 3L7WA 5ILSA 3IKTA 4A3CJ 3K70C 3OL3A 3BZ6A 3TW7A 2P0WA 4XNFA 1IN4A 1YS7A 3ZMZA 3FXLA 4P9UA 3W6JB 3LSTA 2DI3A 2EINH 3ZQ7A 5LHGA 3BQZA 4XKVA 2CH0A 2IGOA 1BI1A 5FB2A 1XCBA 3FM5A 1GLNA 2D1HA 4IKFA 5D5UB 1S5LC 3RCOA 3DP7A 4I98B 4NB5A 4RM3A 4EV0A 5LD2C 2PQ8A 3LFKA 4KN4X 1MMNA 4L9TA 3I53A 1IN6A 4RAZA 5JVGF 2M0MA 4J00A 5GP9A 4NBQA 2QKMB 2XASA 3M1CA 4XRMA 3OYFA 3H0DA 3ZXSA 3RZOJ 3BT9A 4PCQA 4XN0A 2X6OA 4LK1F 5E8GA 1D0ZA 1F43A 5L3FA 3BQYA 3DBRB 5ILUA 1P4AA 3GMEA 4IHYA 1IV8A 3HGYA 5FRNA 1HQCA 4O6JA 2DAOA 2BY1A 3E7LA 3PNVA 2MC3A 5GPCA 1WJBA 2IT0A 4B1RA 2XRNA 4P96A 4ENKA 2BYVE 2DTZA 2ELKA 5F0CA 1PJRA 3OYGA 2CFOA 1LE8B 4IOAF 2PJRB 3AG3H 1R36A 4RDUA 4M74A 1HKQA 3V8JA 2OZ6A 1JJ8C 2HPMA 5D6EA 3V7SA 1U5TC 2GLOA 5LHIA 3B6AA 2XVCA 1P4WA 2MH9A 3WGIA 3HUGB 4HF2A 2EQRA 1FMWA 2DCEA 2R5YB 3ISPA 2OAZA 2V4JC 2Z5UA 3T1BA 2JQ7A 4EJVA 1JUSA 3MWMA 4M3DA 1DGRM 1HW1A 1IXSB 2QYOA 5LEKA 3TQNA 1XMKA 1REPC 3QYFA 2DJIA 2VQGA 3I9V2 3W2WA 1TQPA 2VQCA 1WRJA 3LSJA 1LE8A 2HXOA 2PJRA 4IHVA 3S17J 1A31A 2RAEA 3F8MA 3KZIC 2BHYA 1JT0A 3OWTA 1U0JA 5KNLA 5BOXA 3OYMA 1FP2A 1YTYA 2ELJA 2VL8A 1W4MA 3AG2H 5BS6A 3O6BB 2FBKA 5BMZA 3HUGA 1ZREA 3DU5A 1N75A 2WTEA 2XAGA 3ZR8X 2YX7A 1ON1A 2QQ8A 3M8EA 2DN0A 4DGWB 3NEUA 4ANJA 5TRDA 2Y31A 2I5UA 1D0YA 2ZMEB 4A6DA 2A07F 2CQKA 5ICEA 2K86A 4LD5A 1HSJA 2ZJ2A 4ENMA 1ERDA 3QPHA 3ZCOA 4ZYHA 1HW5A 3OYIA 3M4OJ 2B0LA 5J3LA 4BH9A 1R6RA 4BHBA 1B59A 4LLGF 5DV5A 3VYTB 1HKTA 3JTHA 4DNCA 2DMPA 4NQWB 2CV2A 1USTA 1BN5A 3J7AY 4CCMA 1VQ5I 4LIVA 4LIUA 3BTLA 1GDTA 1SMTA 4Y13A 3BR2A 2XPWA 2A5YB 2O5RA 1TC3C 2P6SA 4CGZA 1WFXA 2ZMEA 3QYBA 3WTWC 1X1PA 3CJQB 4IVNA 2VUMJ 3OOUA 3RKXA 3ZGKA 4BBSJ 1MBFA 4A3DJ 3H9JA 5L3GA 4ZZDA 1HKSA 2R7XA 1H88C 2JA7J 3DLLF 3CMAI 3FIWA 4MTDA 2ZSHB 2HDDA 1SD5A 3I3LA 2LP0A 4CUGA 2GZWA 2LKXA 3MMYB 3MKWB 2Q2EB 4NQWA 2PMZA 3HOTA 1VQKI 2R7TA 3DQVC 1VQ6I 3OYJA 2K02A 1MNDA 1USSA 4HNTA 3KP5A 4I01A 2VC1A 4PZJA 2LK2A 5HS9A 1QPIA 2X6WA 1OYYA 3H35A 2UXNA 2GOXB 5CQGA 3RKWA 1YJWI 2GXGA 4IX7A 1BW5A 3PFIA 2HXIA 2AS5F 4EGZA 4L18B 3CCYA 4L0YB 1VQ7I 2JRMA 2NVTJ 1T95A 1LDKB 2R3SA 4MHGA 1Z6RA 3AL0B 1U8RA 1RNLA 4BNCA 1YW7A 2XF5A 3CCRI 2ZNYA 1VQNI 4KISA 2A69F 2NS8A 4XKBA 3JREA 4C2MJ 3GFJA 3PO2J 1O3QA 3RYPA 2EZKA 4DJAA 3WG9A 1A5JA 2QGUA 3CCLI 2ECBA 2Q2EA 3RPQA 1T38A 1FZPB 1UFMA 1H9GA 1LDDA 1XSVA 2JZYA 3FWEA 5E3NA 4BDZA 2R92J 1BIBA 1FYMA 2HOAA 1IRGA 1K7AA 2NNYA 1ZELA 1EH7A 1X2MA 2I8DA 2VBWA 2E2JJ 4HF1A 1HA8A 4I99C 5M5YJ 4G7OF 3KYDB 2FSWA 2CG4A 4YFXF 3VB2A 3S14J 4IRGA 3O3KA 4EVIA 3A01B 4UVAA 1UZCA 2WC2A 4BQOA 4FCYA 4AIJA 4IPAA 3CTAA 2K3PA 3RPUA 3A0BC 2OA4A 1SFKA 1YW8A 2EFPA 5K7ZA 2K4JA 3V8KA 5ICFA 1ZLKA 1XTAA 4L5IA 4A5MA 2FQ4A 3GTPJ 2NVYJ 3BZCA 3GTKJ 3S2HJ 3CCEI 2JSCA 5GADJ 2Q1ZB 4B4CA 3FK6A 1ZGJA 1QA6A 2R4GA 3OSGA 4A3BJ 1FOXA 1P92A 1EKEA 1Z6TA 1D1AA 3E6BA 1R1VA 2H6BA 2QQBA 3CCQI 4HYEA 4A3EJ 1B6AA 3HRMA 5DDGA 4RB2C 2Z9OA 1E3PA 1RI7A 5J1YA 1X3WB 1TWCJ 1R4NB 2EFNA 1AKHA 1OKRA 2OPTA 2DMQA 3EUAA 3J81Z 2M8GX 4ON0A 2NOGA 1T0FC 2XAHA 2ZXWH 3IV5A 1R9TJ 4X0GA 3BCBA 4D9JA 2K9QA 2R93J 3B73A 4XLCA 1XCVA 3BR1A 5L3DA 3CMMA 1Y1VJ 3TBIA 4PK4A 1Q1HA 2R7QA 1I3AA 3GXOA 2W82A 3Q5FA 2HGCA 1Y8QB 2DFFA 3TP0A 3LAJA 2GWRA 3V4GA 1D8KA 5HDKA 1WH5A 4RS8A 3SZPA 2R7UA 3DBLB 1BR4A 2DA7A 2HQ5A 3HM5A 2O9LA 2DK8A 4JOMA 1YS6A 1SEUA 1KU9A 3GW2A 4PDKA 4ZTFA 4BGDA 1VQ9I 1TT0A 4PUSA 1B4AA 3GF2A 1SC7A 1K83J 1IW7F 2WBMA 2LDUA 1AA7A 1B1BA 2EZIA 3PSIA 4B09A 1SAUA 4Q5SF 1IDZA 1LVKA 3R60A 1SVMA 3F8CA 3R6SA 3D5RC 2Z1DA 5JVTA 1Z9CA 2JTVA 3CD6I 3FKIJ 3GTGJ 2KRCA 5HNHA 3FXJA 2CUEA 4GGGA 2XIGA 2W25A 1U8BA 3T8TA 4A3MJ 2PMUA 1OR7A 3WODF 4B43A 1TNTA 4O5VA 2AQEA 5IOZA 2H94A 2HYJA 3FK7A 1X1DA 2PN6A 3HKZA 2QBYB 1WJEA 2V26A 5D4SA 4AU7A 2MC4A 4OOIA 3GTMJ 1Z91A 3LAPA 4PJJA 4GXOA 2E7XA 1FYLA 2X1CA 2VJIA 4A3LJ 3P9KA 4BE1A 3O8GA 1YFHA 4CO8A 1IRXA 5DM7F 2X51A 4BS9A 2E2HJ 4PFOA 1HCRA 5B1AH 1G3WA 1A6QA 4U0WA 4JBAA 2G7HA 3WTUC 2TRTA 3REOA 2WAQA 5DD4A 4PJMA 5KAIC 4G94A 1D3YA 3DEWA 1VQPI 3Q9VA 4II3A 3MAJA 2OCCH 3H92A 4Y3OA 3BG6A 3SDGA 5CYVA 2W00A 4KIGA 4OU0A 3V8LA 5LRSA 1APLC 4LG0B 2FNAA 1AWCA 1QHGA 3OIQA 2BXZA 5D5VB 2M7AA 2W48A 1ZG1A 2OQRA 2CQNA 2VBZA 4F93B 2KRHA 1TP4A 2WV1A 3H1CA 3MZHA 1FSEA 2EA4A 1S9HA 1EF4A 1UHSA 1S8NA 1W5TA 3F9KA 3S15J 1TQMA 3CCMI 2HS5A 2M34A 1U6GA 3J7ZI 4QWQA 2ZO4A 3FISA 1D1BA 2QQAA 1ZK8A 4S04A 4UV8A 4Y33A 2DA5A 2D45A 4Y17A 3VFZA 3M8JA 3TOAA 2O8KA 3CF2A 4OIPF 4DBRA 1JKQC 3HDDA 3J7AO 5ERIA 4NC8A 3C1DA 3M8FA 3DU6A 3WTVC 2GXAA 3LQRA 1LEAA
chains in the Genus database with same CATH topology
4EM2A 2EFQA 4WK8F 2XKPA 5LGTA 4IRIA 1TQIA 2RDPA 1F5TA 2V6CA 4FX4A 5IT9Z 3RIRA 3EETA 5FD5A 2WV0A 5F6FA 3IKVA 5DYMA 3JW4A 3K9TA 1L3LA 5E1ZB 2EV5A 3R0AA 1ZLJA 3MFKA 4HLXA 4CDGA 1FPQA 1ZRDA 1F4KA 4HOBA 1BI2A 3BOQA 3G3ZA 1QNTA 4XLPF 2MA3A 2EFWA 2VXZA 4AVPA 3WGGA 4WWCA 4KDPA 4UVBA 2DPDA 2HKXA 4BHPA 1I27A 3KEOA 2PFBA 3KP3A 3M7GA 3GZ5A 2YSRA 4EQQA 3GVAA 5LEJA 3P9IA 2FOKA 3KP6A 1XDSA 3R0JA 5HS7A 3C7JA 2NRAC 3KZZA 1G3SA 3FXUA 2NAZA 2IP2A 2O0YA 2MLGA 2VONA 4YIFA 4RB0A 3I64A 2KJCA 3LWFA 1XGMA 1W7PD 1E17A 2PJPA 4A2UA 2FBIA 4IHSA 3COAC 2DQLA 1XN7A 1KA8A 3HTUA 1SAXA 3F72A 4OIRF 1BC8C 2Q8KA 3LA2A 1FYKA 3SXYA 1XSXA 1UHWA 1P6RA 1JHFA 1WWXA 4AD9A 4LJZF 1SMYF 2W24A 1S6LA 2QWWA 2CYYA 3RKYA 4XLNF 5DEQA 2Z99A 2A61A 1BI3A 1XDUA 3NQOA 1Z05A 5LLQA 1MJ9A 1EH6A 4EJOA 1ZN2A 3BPXA 1YQAA 4EJUA 3WU1B 4Q47A 1F9NA 4LK0F 1J7KA 2DBBA 4CXFA 3EYIA 3IRQA 3F6VA 4FX0A 3ZMUA 2L4AA 4UVCA 4ASNA 1MKMA 2RNJA 2OU2A 5A2QZ 3J80K 3OOPA 2O61A 1J0RA 2HFHA 1KU2A 3SFZA 2VODA 2HKOA 2K4BA 2ZXJA 3KP4A 3JSOA 4BHCA 5LBQA 4LMYA 1KQ0A 2F5EA 1MJAA 1TBXA 4RGUA 1MZBA 5H6QA 4WXDA 4Q48A 2RVCA 2ZBKA 1K79A 2XKOA 2STWA 2E1CA 2PI0A 3F3XA 1G4DA 4OMYA 1T98A 2X0LA 4L9VA 1ON2A 4PGGA 2F5DA 2HDCA 4A0YA 3FF5A 4YG2F 3I59A 4EGYA 3MEXA 4JQFA 4FHTA 1TW2A 1HXDA 3EQLF 4AIHA 3U9GA 2P4WA 1KU3A 2F5CA 3ZMSA 1IXRC 2LSOA 1A04A 2XHKA 2HZTA 1BOAA 2W85A 3I5UA 5F1RA 4HLYA 2Y48A 3FX3A 4EJWA 1KYWA 1I6XA 2D1VA 3I0TA 5LGNA 1QZYA 1ZRFA 4G6DA 3RDIA 1KYZA 1O57A 2PMHA 5CVJA 4LGWA 2EV0A 2HEOA 4E70A 4WXHA 1B9NA 2MLKA 1PDNC 2JT1A 3BJ6A 3JSPA 4UHTA 1HW2A 3CUOA 2FEZA 3T5XA 4HF0A 1I5ZA 1SFUA 1R5GA 2IA2A 3QRFF 1DPRA 2TDXA 1HBXG 2OQGA 2ISZA 5JR3A 1IN5A 2QZ8A 3E3VA 4M9ZA 2OBPA 4R79A 3GFMA 3GYHX 2PLYA 1QO0D 2XAQA 4CZZA 1S7AA 2CW0F 3GFLA 2MBFA 3F23A 2FU4A 2L3DA 3MQ0A 4G7ZF 3JAMZ 4BXUA 2IJLA 4YFKF 1IF1A 1FBQA 4HW0A 5FLXZ 3F8NA 5D4RA 4HV6A 2XUBA 3QU3A 1MJBA 3WTTC 5ICCA 4ZYEA 4I2OA 4KICA 1ZHFA 3F6OA 4HX7A 5FFXA 1CF7B 3KEQA 4LB5A 1U78A 5D6FA 3H3UA 1FX7A 1P4XA 1ZAOA 5AIQA 2YX4A 5D8LB 5EEGA 4UNOA 4K2EA 3GZ6A 4BQAA 3DPTA 5ICGA 3ZMVA 2VOPA 2ACJA 4ENJA 2VT2A 1CF7A 1T39A 3HRSA 3Q9SA 1V4RA 4U0VA 4D0PA 1W7PB 4JK1X 3RI4A 3F21A 1R58A 5KK1A 6PAXA 1BI0A 4KYWA 1JHHA 2YU3A 1J5YA 2P5VA 2DW4A 2E1NA 4HV5A 4G7HF 3CUQA 1LDJA 1LJ9A 2CFXA 3E5QA 4H0EA 4G6QA 2GIVA 4Y15A 2RV8A 1W7PA 2UZKA 5DD8A 4HAMA 1VTNC 5CVRA 1YYVA 2L01A 1R00A 5BQTA 3VOEA 2QUFA 2QQ9A 5AIPA 3HYIA 2YPRA 1GVJA 3N4MA 1C0WA 3ECOA 4IRHA 3KCCA 4I7HA 3QPTA 3WTSC 4ESJA 3HHHA 1P2FA 1K78A 1JXSA 2CWEA 1HSTA 3BJAA 2P8TA 5D5WB 2G9WA 4Z2YA 2KRFA 1IUYA 3KE2A 3JTGA 1XGNA 3K69A 2Q0OA 3FMSA 4HX4A 4U7BA 4WF2A 5DCFA 3WGHA 2JPBA 4EM1A 1RUNA 3QOPA 3BPVA 2VBYA 2P6TA 5D8KB 4KMFA 5FGMA 1GXPA 2Y75A 3U2RA 1FP1D 5J8CA 3WU0A 1ONVA 4S05A 3W6KB 4MEYF 3HSRA 4RAYA 2H27A 4HBLA 4MEXF 2ETHA 1IN8A 2FNPA 5CVUA 1R1TA 2CO5A 2DK5A 2IA1A 1D8JA 4QLCU 1IRFA 2HR3A 4O3MA 4ZZLA 2LNBA 1ZYRF 1QGPA 2COMA 4KIBA 2W57A 4FT8A 4CICA 4PGHA 3ROUA 2RC4A 2DT5A 4MNUA 2HWVA 1BC7C 1WSUA 4RB1A 2ADUA 4ETSA 3FXRA 3WE2A 5K5OA 2D2WA 4I09A 5K5RA 5JI6A 4U0YA 3QP5A 2OZUA 1OYWA 3BP8A 2FQ3A 5KVRA 4EMSA 5E17F 3N97A 1U5TB 3KP2A 1J9IA 1WKMA 4I0AA 1ODDA 2IPQX 3ZPLA 3RYRA 3L2CA 2Y0MA 2RKHA 3V7CA 4EM0B 4M71A 4A0XA 1SD4A 2QM3A 1X3UA 1FC3A 2NS0A 2V1DA 5H6RA 1UCRA 1U5TA 1GXQA 3O2PE 2P7VB 2M30A 2EB7A 5K1YA 4OINF 3ABTA 3H3ZA 5HDNA 4G8XA 4L5JA 1LB2A 5HDGA 1JGSA 4ESFA 2FXAA 3KFWX 2R7DA 2VBXA 4ZH4F 4NHJA 3HSEA 5LRRA 2F5FA 2IRFG 2RN7A 2EFOA 2DPUA 4M72A 3TKYA 2GXBA 3WTXC 2KKOA 3TDUC 1R1UA 1MGTA 1XGOA 3GFIA 4XBFA 4HX8A 1JE8A 3I58A 1YO5C 3D0SA 4KIFA 5L3BA 1R5HA 1KGSA 1YLFA 2F2EA 2A68F 5BPDA 4N0BA 1KQ8A 5IT3A 1LQ1A 1RZ4A 3BY6A 3TO9A 3FM3A 4HA8A 4YIIA 2XROA 3L9FA 5HLHA 3DKWA 1E2XA 4KNYA 4RGXA 4GCVA 3GEZA 2QENA 2ZNZA 2DQRA 3HRTA 1ZRCA 2K7LA 4U7DA 1FNNA 1R23A 2M5WA 5LHHA 3E5XA 2ZFWA 1R22A 2RGVA 4UUVA 5HLGA 1T2KA 4TV7A 4ENNA 2OD5A 3E6DA 4P9FA 2HQNA 3EDPA 2VOOA 2R7FA 4M9SA 3AAFA 1D5VA 3L09A 4F7ZA 1LEBA 4MTEA 5CJ9A 2BE5F 1O7FA 1OYIA 3I59B 3J81K 1RIOH 1H0MA 5J8FA 2FE3A 2VT3A 3HRUA 1MD0A 2BV6A 3FXQA 3MZYA 5HOOA 3GX4X 2E7WA 4DQ2A 2FRHA 2EV6A 1QZZA 4BYYA 4IXAA 4L9NA 2V9VA 4ESBA 1OMIA 3K1NA 1O3TA 1ULYA 5DCMB 3K2ZA 1O7LA 2LF7A 3P7NA 1XGSA 4LLLA 4P5OA 4KMUX 1H9TA 2L02A 4OIQF 1I1GA 4GYGA 4BAYA 3P9CA 3S2WA 1WI9A 1RUOA 4A5NA 1T0FA 5JHUA 2BEOA 2ELHA 5DCMA 1J75A 3R61A 1Z7UA 1XMAA 4XSXF 3QAHA 2V1XA 3TDZC 2EJRA 2X4HA 3DFGA 4CYDA 2JPCA 5DUIA 3TO6A 2W84A 2IA0A 3VODA 3M1EA 5F64A 4B8XA 1FT9A 4L0ZB 1GHCA 2FBHA 1MDMB 1Z1DA 4N9IA 2DFIA 4I02A 3CJNA 3KP7A 2IVMA 3FMQA 2L54A 2P5KA 1G3YA 3I4PA 3I71A 3BJOA 3D5LA 1CGPA 5CLSA 2ZCWA 2ZKZA 1R7JA 3SQNA 1QBJA 5H20A 4IHTA 3KETA 3ABUA 3TOBA 4KN7X 4M6XA 1Y0UA 3T0YA 1MDMA 2O3FA 3K0LA 3ECHA 3RTRA 2UXXA 3KLOA 4I0BA 3DF8A 1L0OC 4HQEA 1EH8A 3BDDA 2G7UA 3BWGA 5CVVA 4A6EA 2VE8A 5LGUA 3CO7C 2DTRA 1PP8F 3LA7A 5HS8A 2O6GE 3RJPA 3SZTA 1AOYA 4HDUA 4KA4A 1T6SA 1G3TA 5IT9K 4UXNA 3I54A 4R8HA 5JFRA 2GA2A 4ZYGA 5FD6A 3WE3A 1SFXA 3GLXA 1FBUA 3R4KA 4G9YA 4M73A 3ZMDA 2V79A 2EK5A 3IWZA 2HTSA 4HQMA 3IWFA 2Z3YA 4A0ZA 2KIMA 1DPUA 5TJJA 1KQ9A 2XGXA 5D5XB 3L00A 3T8RA 5BPIA 4M9XA 2GAUA 1IXCA 3CUQB 5E18F 2PBIA 4HDVA 2O03A 4OIOF 2HOEA 3EUHA 5FFZA 3IRRA 3K1PA 1J59A 2ISYA 1XD7A 2L4MA 4KUMA 3OV8A 1YG2A 3MCZA 3HOSA 2Z33A 3C3WA 1IN7A 3F8FA 1ZG3A 2CSOA 1BBYA 4R1HA 1DUXC 2DLLA 3J80Z 2QLZA 3CDHA 2K27A 2P5LC 1TW3A 4AWXB 4EJTA 5ILVA 2M1BA 4WX9A 5E8IA 1EV7A 4CHUA 1ZH5A 1ZGAA 4HZFA 1K78B 2IW5A 3BROA 3QP6A 2H09A 3FHZA 5CVIA 3ULQB 4ZYDA 1TLHB 4MGRA 1STZA 1YIOA 2WWYA 2DU9A 4A12A 1V3FA 2GQQA 1XB4A 1LNWA 4OMZA 4IF4A 4Q4ZF 1O3SA 1K6OA 1WQ2A 5HLIA 3HSFA 3E97A 2GA1A 1DP7P 4N9HA 3DV8A 2KIUA 4KFCA 2M8EA 3F22A 3B02A 3LQQA 5E1WA 3IHUA 3DEUA 2XAJA 1O3RA 1F1ZA 4LLNA 3GUDA 3LA3A 3C18A 2HYFA 2C6YA 1SD6A 4MQVA 5A2QK 4WXCA 1W5SA 1S3JA 4WCGA 2P7CB 2KJBA 5E20A 3NRVA 2VN2A 3KLNA 2VE9A 2FMYA 1SFEA 3IC7A 3WTYC 1FLIA 2QBYA 4GYIA 2ESHA 2A3SA 3E5UA 5HVQC 1PP7U 2BBYA 5FO5A 3KZYA 3ZN1A 3ZN0A 3SHFA 1UHMA 1DDNA 4RGSA 1UB9A 4XRFA 2A6EF 4M6YA 3E6CC 1TTYA 3E6MA 5L3EA 2VC0A 3F8BA 1QQIA 3ML6A 4LG0A 5J6XA 3IL2A 3TGNA 2LKPA 3DPLC 2RQPA 2NYXA 3U1DA 3EYYA 4P55A 2YR2A 2HTJA 1U3EM 1YW9A 2ESNA 4RGRA 1LVAA 4GO1A 3ZP5A 1FOKA 5K5QA 1OPCA 3CO6C 3K1MA 1FY7A 1FWZA 3G73A 2A6HF 5AONA 2EA2A 1FSHA 3CUQC 3CLOA 3PQKA 1KU7A 2HQRA 3M9AA 1ZARA 4LB6B 1NHAA 2J5PA 2MD5A 3FMRA 1BJAA 1I1SA 1G6NA 3GO5A 3TO7A 1B9MA 1SD7A 3ZMTA 1BM9A 5ED4A 3WTZA 3ERED 4IJAA 5E1XA 2HYGD 4LFUA 1S7OA 2EWNA 2XAFA 2CGPA 1IAWA 3JAMK 3V7RA 1ZG5A 1S29A 2M87A 4RB3C 4KT5C 5FLXK 2FA5A 2V1UA 4UV9A 2M45A 5L3CA 1XSDA 2PG4A 1BIAA 2FMLA 2STTA 5DUKA 2DO7A 2PEXA 3QU6A 3VEPA 2H6CA 4L9JA 2O8XA 1IZ1A 2XV4S 1U2WA 3GWZA 3PQJA 2FF4A 1PUEE 1J2XA 3HIFA 2QVOA 1QPMA 2LF8A 4YFNF 3ELKA 5EEHA 1TNSA 3FZVA 4XSZF 2KIFA 2BGCA 4MQ9F 2NNNA 2AXLA 1FBSA 3HTSB 3DXJF 2J5OA 2JRTA 3HHGA 4U88A 4AIKA 2MH2A 2UWMA 3L7WA 5ILSA 3IKTA 3BZ6A 1IN4A 1YS7A 3ZMZA 4P9UA 3W6JB 3LSTA 2DI3A 3ZQ7A 5LHGA 1BI1A 5FB2A 1XCBA 3FM5A 2D1HA 5D5UB 3DP7A 4I98B 4NB5A 4EV0A 2PQ8A 3LFKA 4KN4X 4L9TA 3I53A 1IN6A 4RAZA 2XASA 4PCQA 4LK1F 5E8GA 5L3FA 5ILUA 1P4AA 1HQCA 4O6JA 2DAOA 2MC3A 2IT0A 2XRNA 4P96A 4ENKA 2BYVE 1R36A 4M74A 1HKQA 3V8JA 2OZ6A 5D6EA 3V7SA 1U5TC 5LHIA 2XVCA 1P4WA 2MH9A 3WGIA 4HF2A 3ISPA 2OAZA 2Z5UA 3T1BA 4EJVA 3MWMA 1HW1A 1IXSB 2QYOA 5LEKA 3TQNA 1XMKA 1REPC 1TQPA 1WRJA 3F8MA 5BOXA 1FP2A 1YTYA 1W4MA 5BS6A 3O6BB 2FBKA 5BMZA 3HUGA 1ZREA 2XAGA 2WTEA 2YX7A 1ON1A 3M8EA 3NEUA 5TRDA 2ZMEB 4A6DA 2A07F 2CQKA 5ICEA 2K86A 4LD5A 1HSJA 2ZJ2A 4ENMA 3QPHA 4ZYHA 1HW5A 2B0LA 4BH9A 4BHBA 1B59A 4LLGF 5DV5A 1HKTA 3JTHA 4DNCA 1USTA 1BN5A 1SMTA 4Y13A 2A5YB 2P6SA 4CGZA 2ZMEA 3WTWC 4IVNA 3RKXA 5L3GA 4ZZDA 1HKSA 4MTDA 1SD5A 2GZWA 4NQWA 3HOTA 3DQVC 2K02A 1USSA 3KP5A 4I01A 2VC1A 4PZJA 5HS9A 1OYYA 2UXNA 3RKWA 2GXGA 3PFIA 2AS5F 4L18B 4EGZA 4L0YB 1LDKB 2R3SA 4MHGA 1Z6RA 1U8RA 1RNLA 4BNCA 1YW7A 2ZNYA 2A69F 3GFJA 1O3QA 3RYPA 3WG9A 2Q2EA 3RPQA 1T38A 1FZPB 1UFMA 1H9GA 1LDDA 1XSVA 2JZYA 3FWEA 1BIBA 1FYMA 1IRGA 1K7AA 2NNYA 1EH7A 2VBWA 4HF1A 4G7OF 2FSWA 2CG4A 4YFXF 3VB2A 4IRGA 3O3KA 4EVIA 4UVAA 2WC2A 4AIJA 4IPAA 3CTAA 3RPUA 2OA4A 1YW8A 2EFPA 2K4JA 3V8KA 5ICFA 1ZLKA 4L5IA 4A5MA 2JSCA 1ZGJA 1P92A 1Z6TA 3E6BA 1R1VA 2H6BA 2QQBA 4HYEA 1B6AA 3HRMA 5DDGA 4RB2C 2Z9OA 1RI7A 2EFNA 1OKRA 3J81Z 4ON0A 2XAHA 3B73A 1XCVA 5L3DA 1Q1HA 3GXOA 3Q5FA 2HGCA 3LAJA 2GWRA 3V4GA 1D8KA 5HDKA 4RS8A 3SZPA 2DK8A 1YS6A 1KU9A 3GW2A 4PDKA 1B4AA 3GF2A 1IW7F 2LDUA 1B1BA 4B09A 4Q5SF 3R60A 3F8CA 3R6SA 5JVTA 1Z9CA 2JTVA 4GGGA 2XIGA 2W25A 3T8TA 2PMUA 1OR7A 3WODF 1TNTA 4O5VA 2H94A 2PN6A 2QBYB 5D4SA 4OOIA 1Z91A 3LAPA 4GXOA 2E7XA 1FYLA 3P9KA 1YFHA 4CO8A 1G3WA 4U0WA 4JBAA 2G7HA 3WTUC 3REOA 5DD4A 4G94A 1D3YA 3Q9VA 3MAJA 3H92A 5CYVA 4KIGA 4OU0A 3V8LA 5LRSA 4LG0B 2FNAA 1AWCA 5D5VB 1ZG1A 2OQRA 2VBZA 3MZHA 1FSEA 2EA4A 1S8NA 1W5TA 1TQMA 2HS5A 1U6GA 4QWQA 2ZO4A 2QQAA 4S04A 4UV8A 2D45A 4Y17A 3VFZA 3TOAA 4OIPF 3J7AO 5ERIA 3C1DA 3M8FA 3WTVC 3LQRA 1LEAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EM2 A;  2EFQ A;  4WK8 F;  2XKP A;  5LGT A;  4IRI A;  1TQI A;  2RDP A;  1F5T A;  2V6C A;  4FX4 A;  5IT9 Z;  3RIR A;  3EET A;  5FD5 A;  2WV0 A;  5F6F A;  3IKV A;  5DYM A;  3JW4 A;  3K9T A;  1L3L A;  5E1Z B;  2EV5 A;  3R0A A;  1ZLJ A;  3MFK A;  4HLX A;  4CDG A;  1FPQ A;  1ZRD A;  1F4K A;  4HOB A;  1BI2 A;  3BOQ A;  3G3Z A;  1QNT A;  4XLP F;  2MA3 A;  2EFW A;  2VXZ A;  4AVP A;  3WGG A;  4WWC A;  4KDP A;  4UVB A;  2DPD A;  2HKX A;  4BHP A;  1I27 A;  3KEO A;  2PFB A;  3KP3 A;  3M7G A;  3GZ5 A;  2YSR A;  4EQQ A;  3GVA A;  5LEJ A;  3P9I A;  2FOK A;  3KP6 A;  1XDS A;  3R0J A;  5HS7 A;  3C7J A;  2NRA C;  3KZZ A;  1G3S A;  3FXU A;  2NAZ A;  2IP2 A;  2O0Y A;  2MLG A;  2VON A;  4YIF A;  4RB0 A;  3I64 A;  2KJC A;  3LWF A;  1XGM A;  1W7P D;  1E17 A;  2PJP A;  4A2U A;  2FBI A;  4IHS A;  3COA C;  2DQL A;  1XN7 A;  1KA8 A;  3HTU A;  1SAX A;  3F72 A;  4OIR F;  1BC8 C;  2Q8K A;  3LA2 A;  1FYK A;  3SXY A;  1XSX A;  1UHW A;  1P6R A;  1JHF A;  1WWX A;  4AD9 A;  4LJZ F;  1SMY F;  2W24 A;  1S6L A;  2QWW A;  2CYY A;  3RKY A;  4XLN F;  5DEQ A;  2Z99 A;  2A61 A;  1BI3 A;  1XDU A;  3NQO A;  1Z05 A;  5LLQ A;  1MJ9 A;  1EH6 A;  4EJO A;  1ZN2 A;  3BPX A;  1YQA A;  4EJU A;  3WU1 B;  4Q47 A;  1F9N A;  4LK0 F;  1J7K A;  2DBB A;  4CXF A;  3EYI A;  3IRQ A;  3F6V A;  4FX0 A;  3ZMU A;  2L4A A;  4UVC A;  4ASN A;  1MKM A;  2RNJ A;  2OU2 A;  5A2Q Z;  3J80 K;  3OOP A;  2O61 A;  1J0R A;  2HFH A;  1KU2 A;  3SFZ A;  2VOD A;  2HKO A;  2K4B A;  2ZXJ A;  3KP4 A;  3JSO A;  4BHC A;  5LBQ A;  4LMY A;  1KQ0 A;  2F5E A;  1MJA A;  1TBX A;  4RGU A;  1MZB A;  5H6Q A;  4WXD A;  4Q48 A;  2RVC A;  2ZBK A;  1K79 A;  2XKO A;  2STW A;  2E1C A;  2PI0 A;  3F3X A;  1G4D A;  4OMY A;  1T98 A;  2X0L A;  4L9V A;  1ON2 A;  4PGG A;  2F5D A;  2HDC A;  4A0Y A;  3FF5 A;  4YG2 F;  3I59 A;  4EGY A;  3MEX A;  4JQF A;  4FHT A;  1TW2 A;  1HXD A;  3EQL F;  4AIH A;  3U9G A;  2P4W A;  1KU3 A;  2F5C A;  3ZMS A;  1IXR C;  2LSO A;  1A04 A;  2XHK A;  2HZT A;  1BOA A;  2W85 A;  3I5U A;  5F1R A;  4HLY A;  2Y48 A;  3FX3 A;  4EJW A;  1KYW A;  1I6X A;  2D1V A;  3I0T A;  5LGN A;  1QZY A;  1ZRF A;  4G6D A;  3RDI A;  1KYZ A;  1O57 A;  2PMH A;  5CVJ A;  4LGW A;  2EV0 A;  2HEO A;  4E70 A;  4WXH A;  1B9N A;  2MLK A;  1PDN C;  2JT1 A;  3BJ6 A;  3JSP A;  4UHT A;  1HW2 A;  3CUO A;  2FEZ A;  3T5X A;  4HF0 A;  1I5Z A;  1SFU A;  1R5G A;  2IA2 A;  3QRF F;  1DPR A;  2TDX A;  1HBX G;  2OQG A;  2ISZ A;  5JR3 A;  1IN5 A;  2QZ8 A;  3E3V A;  4M9Z A;  2OBP A;  4R79 A;  3GFM A;  3GYH X;  2PLY A;  1QO0 D;  2XAQ A;  4CZZ A;  1S7A A;  2CW0 F;  3GFL A;  2MBF A;  3F23 A;  2FU4 A;  2L3D A;  3MQ0 A;  4G7Z F;  3JAM Z;  4BXU A;  2IJL A;  4YFK F;  1IF1 A;  1FBQ A;  4HW0 A;  5FLX Z;  3F8N A;  5D4R A;  4HV6 A;  2XUB A;  3QU3 A;  1MJB A;  3WTT C;  5ICC A;  4ZYE A;  4I2O A;  4KIC A;  1ZHF A;  3F6O A;  4HX7 A;  5FFX A;  1CF7 B;  3KEQ A;  4LB5 A;  1U78 A;  5D6F A;  3H3U A;  1FX7 A;  1P4X A;  1ZAO A;  5AIQ A;  2YX4 A;  5D8L B;  5EEG A;  4UNO A;  4K2E A;  3GZ6 A;  4BQA A;  3DPT A;  5ICG A;  3ZMV A;  2VOP A;  2ACJ A;  4ENJ A;  2VT2 A;  1CF7 A;  1T39 A;  3HRS A;  3Q9S A;  1V4R A;  4U0V A;  4D0P A;  1W7P B;  4JK1 X;  3RI4 A;  3F21 A;  1R58 A;  5KK1 A;  6PAX A;  1BI0 A;  4KYW A;  1JHH A;  2YU3 A;  1J5Y A;  2P5V A;  2DW4 A;  2E1N A;  4HV5 A;  4G7H F;  3CUQ A;  1LDJ A;  1LJ9 A;  2CFX A;  3E5Q A;  4H0E A;  4G6Q A;  2GIV A;  4Y15 A;  2RV8 A;  1W7P A;  2UZK A;  5DD8 A;  4HAM A;  1VTN C;  5CVR A;  1YYV A;  2L01 A;  1R00 A;  5BQT A;  3VOE A;  2QUF A;  2QQ9 A;  5AIP A;  3HYI A;  2YPR A;  1GVJ A;  3N4M A;  1C0W A;  3ECO A;  4IRH A;  3KCC A;  4I7H A;  3QPT A;  3WTS C;  4ESJ A;  3HHH A;  1P2F A;  1K78 A;  1JXS A;  2CWE A;  1HST A;  3BJA A;  2P8T A;  5D5W B;  2G9W A;  4Z2Y A;  2KRF A;  1IUY A;  3KE2 A;  3JTG A;  1XGN A;  3K69 A;  2Q0O A;  3FMS A;  4HX4 A;  4U7B A;  4WF2 A;  5DCF A;  3WGH A;  2JPB A;  4EM1 A;  1RUN A;  3QOP A;  3BPV A;  2VBY A;  2P6T A;  5D8K B;  4KMF A;  5FGM A;  1GXP A;  2Y75 A;  3U2R A;  1FP1 D;  5J8C A;  3WU0 A;  1ONV A;  4S05 A;  3W6K B;  4MEY F;  3HSR A;  4RAY A;  2H27 A;  4HBL A;  4MEX F;  2ETH A;  1IN8 A;  2FNP A;  5CVU A;  1R1T A;  2CO5 A;  2DK5 A;  2IA1 A;  1D8J A;  4QLC U;  1IRF A;  2HR3 A;  4O3M A;  4ZZL A;  2LNB A;  1ZYR F;  1QGP A;  2COM A;  4KIB A;  2W57 A;  4FT8 A;  4CIC A;  4PGH A;  3ROU A;  2RC4 A;  2DT5 A;  4MNU A;  2HWV A;  1BC7 C;  1WSU A;  4RB1 A;  2ADU A;  4ETS A;  3FXR A;  3WE2 A;  5K5O A;  2D2W A;  4I09 A;  5K5R A;  5JI6 A;  4U0Y A;  3QP5 A;  2OZU A;  1OYW A;  3BP8 A;  2FQ3 A;  5KVR A;  4EMS A;  5E17 F;  3N97 A;  1U5T B;  3KP2 A;  1J9I A;  1WKM A;  4I0A A;  1ODD A;  2IPQ X;  3ZPL A;  3RYR A;  3L2C A;  2Y0M A;  2RKH A;  3V7C A;  4EM0 B;  4M71 A;  4A0X A;  1SD4 A;  2QM3 A;  1X3U A;  1FC3 A;  2NS0 A;  2V1D A;  5H6R A;  1UCR A;  1U5T A;  1GXQ A;  3O2P E;  2P7V B;  2M30 A;  2EB7 A;  5K1Y A;  4OIN F;  3ABT A;  3H3Z A;  5HDN A;  4G8X A;  4L5J A;  1LB2 A;  5HDG A;  1JGS A;  4ESF A;  2FXA A;  3KFW X;  2R7D A;  2VBX A;  4ZH4 F;  4NHJ A;  3HSE A;  5LRR A;  2F5F A;  2IRF G;  2RN7 A;  2EFO A;  2DPU A;  4M72 A;  3TKY A;  2GXB A;  3WTX C;  2KKO A;  3TDU C;  1R1U A;  1MGT A;  1XGO A;  3GFI A;  4XBF A;  4HX8 A;  1JE8 A;  3I58 A;  1YO5 C;  3D0S A;  4KIF A;  5L3B A;  1R5H A;  1KGS A;  1YLF A;  2F2E A;  2A68 F;  5BPD A;  4N0B A;  1KQ8 A;  5IT3 A;  1LQ1 A;  1RZ4 A;  3BY6 A;  3TO9 A;  3FM3 A;  4HA8 A;  4YII A;  2XRO A;  3L9F A;  5HLH A;  3DKW A;  1E2X A;  4KNY A;  4RGX A;  4GCV A;  3GEZ A;  2QEN A;  2ZNZ A;  2DQR A;  3HRT A;  1ZRC A;  2K7L A;  4U7D A;  1FNN A;  1R23 A;  2M5W A;  5LHH A;  3E5X A;  2ZFW A;  1R22 A;  2RGV A;  4UUV A;  5HLG A;  1T2K A;  4TV7 A;  4ENN A;  2OD5 A;  3E6D A;  4P9F A;  2HQN A;  3EDP A;  2VOO A;  2R7F A;  4M9S A;  3AAF A;  1D5V A;  3L09 A;  4F7Z A;  1LEB A;  4MTE A;  5CJ9 A;  2BE5 F;  1O7F A;  1OYI A;  3I59 B;  3J81 K;  1RIO H;  1H0M A;  5J8F A;  2FE3 A;  2VT3 A;  3HRU A;  1MD0 A;  2BV6 A;  3FXQ A;  3MZY A;  5HOO A;  3GX4 X;  2E7W A;  4DQ2 A;  2FRH A;  2EV6 A;  1QZZ A;  4BYY A;  4IXA A;  4L9N A;  2V9V A;  4ESB A;  1OMI A;  3K1N A;  1O3T A;  1ULY A;  5DCM B;  3K2Z A;  1O7L A;  2LF7 A;  3P7N A;  1XGS A;  4LLL A;  4P5O A;  4KMU X;  1H9T A;  2L02 A;  4OIQ F;  1I1G A;  4GYG A;  4BAY A;  3P9C A;  3S2W A;  1WI9 A;  1RUO A;  4A5N A;  1T0F A;  5JHU A;  2BEO A;  2ELH A;  5DCM A;  1J75 A;  3R61 A;  1Z7U A;  1XMA A;  4XSX F;  3QAH A;  2V1X A;  3TDZ C;  2EJR A;  2X4H A;  3DFG A;  4CYD A;  2JPC A;  5DUI A;  3TO6 A;  2W84 A;  2IA0 A;  3VOD A;  3M1E A;  5F64 A;  4B8X A;  1FT9 A;  4L0Z B;  1GHC A;  2FBH A;  1MDM B;  1Z1D A;  4N9I A;  2DFI A;  4I02 A;  3CJN A;  3KP7 A;  2IVM A;  3FMQ A;  2L54 A;  2P5K A;  1G3Y A;  3I4P A;  3I71 A;  3BJO A;  3D5L A;  1CGP A;  5CLS A;  2ZCW A;  2ZKZ A;  1R7J A;  3SQN A;  1QBJ A;  5H20 A;  4IHT A;  3KET A;  3ABU A;  3TOB A;  4KN7 X;  4M6X A;  1Y0U A;  3T0Y A;  1MDM A;  2O3F A;  3K0L A;  3ECH A;  3RTR A;  2UXX A;  3KLO A;  4I0B A;  3DF8 A;  1L0O C;  4HQE A;  1EH8 A;  3BDD A;  2G7U A;  3BWG A;  5CVV A;  4A6E A;  2VE8 A;  5LGU A;  3CO7 C;  2DTR A;  1PP8 F;  3LA7 A;  5HS8 A;  2O6G E;  3RJP A;  3SZT A;  1AOY A;  4HDU A;  4KA4 A;  1T6S A;  1G3T A;  5IT9 K;  4UXN A;  3I54 A;  4R8H A;  5JFR A;  2GA2 A;  4ZYG A;  5FD6 A;  3WE3 A;  1SFX A;  3GLX A;  1FBU A;  3R4K A;  4G9Y A;  4M73 A;  3ZMD A;  2V79 A;  2EK5 A;  3IWZ A;  2HTS A;  4HQM A;  3IWF A;  2Z3Y A;  4A0Z A;  2KIM A;  1DPU A;  5TJJ A;  1KQ9 A;  2XGX A;  5D5X B;  3L00 A;  3T8R A;  5BPI A;  4M9X A;  2GAU A;  1IXC A;  3CUQ B;  5E18 F;  2PBI A;  4HDV A;  2O03 A;  4OIO F;  2HOE A;  3EUH A;  5FFZ A;  3IRR A;  3K1P A;  1J59 A;  2ISY A;  1XD7 A;  2L4M A;  4KUM A;  3OV8 A;  1YG2 A;  3MCZ A;  3HOS A;  2Z33 A;  3C3W A;  1IN7 A;  3F8F A;  1ZG3 A;  2CSO A;  1BBY A;  4R1H A;  1DUX C;  2DLL A;  3J80 Z;  2QLZ A;  3CDH A;  2K27 A;  2P5L C;  1TW3 A;  4AWX B;  4EJT A;  5ILV A;  2M1B A;  4WX9 A;  5E8I A;  1EV7 A;  4CHU A;  1ZH5 A;  1ZGA A;  4HZF A;  1K78 B;  2IW5 A;  3BRO A;  3QP6 A;  2H09 A;  3FHZ A;  5CVI A;  3ULQ B;  4ZYD A;  1TLH B;  4MGR A;  1STZ A;  1YIO A;  2WWY A;  2DU9 A;  4A12 A;  1V3F A;  2GQQ A;  1XB4 A;  1LNW A;  4OMZ A;  4IF4 A;  4Q4Z F;  1O3S A;  1K6O A;  1WQ2 A;  5HLI A;  3HSF A;  3E97 A;  2GA1 A;  1DP7 P;  4N9H A;  3DV8 A;  2KIU A;  4KFC A;  2M8E A;  3F22 A;  3B02 A;  3LQQ A;  5E1W A;  3IHU A;  3DEU A;  2XAJ A;  1O3R A;  1F1Z A;  4LLN A;  3GUD A;  3LA3 A;  3C18 A;  2HYF A;  2C6Y A;  1SD6 A;  4MQV A;  5A2Q K;  4WXC A;  1W5S A;  1S3J A;  4WCG A;  2P7C B;  2KJB A;  5E20 A;  3NRV A;  2VN2 A;  3KLN A;  2VE9 A;  2FMY A;  1SFE A;  3IC7 A;  3WTY C;  1FLI A;  2QBY A;  4GYI A;  2ESH A;  2A3S A;  3E5U A;  5HVQ C;  1PP7 U;  2BBY A;  5FO5 A;  3KZY A;  3ZN1 A;  3ZN0 A;  3SHF A;  1UHM A;  1DDN A;  4RGS A;  1UB9 A;  4XRF A;  2A6E F;  4M6Y A;  3E6C C;  1TTY A;  3E6M A;  5L3E A;  2VC0 A;  3F8B A;  1QQI A;  3ML6 A;  4LG0 A;  5J6X A;  3IL2 A;  3TGN A;  2LKP A;  3DPL C;  2RQP A;  2NYX A;  3U1D A;  3EYY A;  4P55 A;  2YR2 A;  2HTJ A;  1U3E M;  1YW9 A;  2ESN A;  4RGR A;  1LVA A;  4GO1 A;  3ZP5 A;  1FOK A;  5K5Q A;  1OPC A;  3CO6 C;  3K1M A;  1FY7 A;  1FWZ A;  3G73 A;  2A6H F;  5AON A;  2EA2 A;  1FSH A;  3CUQ C;  3CLO A;  3PQK A;  1KU7 A;  2HQR A;  3M9A A;  1ZAR A;  4LB6 B;  1NHA A;  2J5P A;  2MD5 A;  3FMR A;  1BJA A;  1I1S A;  1G6N A;  3GO5 A;  3TO7 A;  1B9M A;  1SD7 A;  3ZMT A;  1BM9 A;  5ED4 A;  3WTZ A;  3ERE D;  4IJA A;  5E1X A;  2HYG D;  4LFU A;  1S7O A;  2EWN A;  2XAF A;  2CGP A;  1IAW A;  3JAM K;  3V7R A;  1ZG5 A;  1S29 A;  2M87 A;  4RB3 C;  4KT5 C;  5FLX K;  2FA5 A;  2V1U A;  4UV9 A;  2M45 A;  5L3C A;  1XSD A;  2PG4 A;  1BIA A;  2FML A;  2STT A;  5DUK A;  2DO7 A;  2PEX A;  3QU6 A;  3VEP A;  2H6C A;  4L9J A;  2O8X A;  1IZ1 A;  2XV4 S;  1U2W A;  3GWZ A;  3PQJ A;  2FF4 A;  1PUE E;  1J2X A;  3HIF A;  2QVO A;  1QPM A;  2LF8 A;  4YFN F;  3ELK A;  5EEH A;  1TNS A;  3FZV A;  4XSZ F;  2KIF A;  2BGC A;  4MQ9 F;  2NNN A;  2AXL A;  1FBS A;  3HTS B;  3DXJ F;  2J5O A;  2JRT A;  3HHG A;  4U88 A;  4AIK A;  2MH2 A;  2UWM A;  3L7W A;  5ILS A;  3IKT A;  3BZ6 A;  1IN4 A;  1YS7 A;  3ZMZ A;  4P9U A;  3W6J B;  3LST A;  2DI3 A;  3ZQ7 A;  5LHG A;  1BI1 A;  5FB2 A;  1XCB A;  3FM5 A;  2D1H A;  5D5U B;  3DP7 A;  4I98 B;  4NB5 A;  4EV0 A;  2PQ8 A;  3LFK A;  4KN4 X;  4L9T A;  3I53 A;  1IN6 A;  4RAZ A;  2XAS A;  4PCQ A;  4LK1 F;  5E8G A;  5L3F A;  5ILU A;  1P4A A;  1HQC A;  4O6J A;  2DAO A;  2MC3 A;  2IT0 A;  2XRN A;  4P96 A;  4ENK A;  2BYV E;  1R36 A;  4M74 A;  1HKQ A;  3V8J A;  2OZ6 A;  5D6E A;  3V7S A;  1U5T C;  5LHI A;  2XVC A;  1P4W A;  2MH9 A;  3WGI A;  4HF2 A;  3ISP A;  2OAZ A;  2Z5U A;  3T1B A;  4EJV A;  3MWM A;  1HW1 A;  1IXS B;  2QYO A;  5LEK A;  3TQN A;  1XMK A;  1REP C;  1TQP A;  1WRJ A;  3F8M A;  5BOX A;  1FP2 A;  1YTY A;  1W4M A;  5BS6 A;  3O6B B;  2FBK A;  5BMZ A;  3HUG A;  1ZRE A;  2XAG A;  2WTE A;  2YX7 A;  1ON1 A;  3M8E A;  3NEU A;  5TRD A;  2ZME B;  4A6D A;  2A07 F;  2CQK A;  5ICE A;  2K86 A;  4LD5 A;  1HSJ A;  2ZJ2 A;  4ENM A;  3QPH A;  4ZYH A;  1HW5 A;  2B0L A;  4BH9 A;  4BHB A;  1B59 A;  4LLG F;  5DV5 A;  1HKT A;  3JTH A;  4DNC A;  1UST A;  1BN5 A;  1SMT A;  4Y13 A;  2A5Y B;  2P6S A;  4CGZ A;  2ZME A;  3WTW C;  4IVN A;  3RKX A;  5L3G A;  4ZZD A;  1HKS A;  4MTD A;  1SD5 A;  2GZW A;  4NQW A;  3HOT A;  3DQV C;  2K02 A;  1USS A;  3KP5 A;  4I01 A;  2VC1 A;  4PZJ A;  5HS9 A;  1OYY A;  2UXN A;  3RKW A;  2GXG A;  3PFI A;  2AS5 F;  4L18 B;  4EGZ A;  4L0Y B;  1LDK B;  2R3S A;  4MHG A;  1Z6R A;  1U8R A;  1RNL A;  4BNC A;  1YW7 A;  2ZNY A;  2A69 F;  3GFJ A;  1O3Q A;  3RYP A;  3WG9 A;  2Q2E A;  3RPQ A;  1T38 A;  1FZP B;  1UFM A;  1H9G A;  1LDD A;  1XSV A;  2JZY A;  3FWE A;  1BIB A;  1FYM A;  1IRG A;  1K7A A;  2NNY A;  1EH7 A;  2VBW A;  4HF1 A;  4G7O F;  2FSW A;  2CG4 A;  4YFX F;  3VB2 A;  4IRG A;  3O3K A;  4EVI A;  4UVA A;  2WC2 A;  4AIJ A;  4IPA A;  3CTA A;  3RPU A;  2OA4 A;  1YW8 A;  2EFP A;  2K4J A;  3V8K A;  5ICF A;  1ZLK A;  4L5I A;  4A5M A;  2JSC A;  1ZGJ A;  1P92 A;  1Z6T A;  3E6B A;  1R1V A;  2H6B A;  2QQB A;  4HYE A;  1B6A A;  3HRM A;  5DDG A;  4RB2 C;  2Z9O A;  1RI7 A;  2EFN A;  1OKR A;  3J81 Z;  4ON0 A;  2XAH A;  3B73 A;  1XCV A;  5L3D A;  1Q1H A;  3GXO A;  3Q5F A;  2HGC A;  3LAJ A;  2GWR A;  3V4G A;  1D8K A;  5HDK A;  4RS8 A;  3SZP A;  2DK8 A;  1YS6 A;  1KU9 A;  3GW2 A;  4PDK A;  1B4A A;  3GF2 A;  1IW7 F;  2LDU A;  1B1B A;  4B09 A;  4Q5S F;  3R60 A;  3F8C A;  3R6S A;  5JVT A;  1Z9C A;  2JTV A;  4GGG A;  2XIG A;  2W25 A;  3T8T A;  2PMU A;  1OR7 A;  3WOD F;  1TNT A;  4O5V A;  2H94 A;  2PN6 A;  2QBY B;  5D4S A;  4OOI A;  1Z91 A;  3LAP A;  4GXO A;  2E7X A;  1FYL A;  3P9K A;  1YFH A;  4CO8 A;  1G3W A;  4U0W A;  4JBA A;  2G7H A;  3WTU C;  3REO A;  5DD4 A;  4G94 A;  1D3Y A;  3Q9V A;  3MAJ A;  3H92 A;  5CYV A;  4KIG A;  4OU0 A;  3V8L A;  5LRS A;  4LG0 B;  2FNA A;  1AWC A;  5D5V B;  1ZG1 A;  2OQR A;  2VBZ A;  3MZH A;  1FSE A;  2EA4 A;  1S8N A;  1W5T A;  1TQM A;  2HS5 A;  1U6G A;  4QWQ A;  2ZO4 A;  2QQA A;  4S04 A;  4UV8 A;  2D45 A;  4Y17 A;  3VFZ A;  3TOA A;  4OIP F;  3J7A O;  5ERI A;  3C1D A;  3M8F A;  3WTV C;  3LQR A;  1LEA A; 
#chains in the Genus database with same CATH topology
 3GBG A;  4EM2 A;  3CZ6 A;  2EFQ A;  4WK8 F;  2ECC A;  2XKP A;  3DTK A;  1MIJ A;  5LGT A;  2KPM A;  1TQI A;  3EUH C;  4CCJ A;  4EEF G;  1VND A;  2EBI A;  4IRI A;  2RDP A;  1F5T A;  2X6Y A;  4DZJ A;  2V6C A;  2LVS A;  4FX4 A;  4BDY A;  1IRZ A;  1OCP A;  5IT9 Z;  3RIR A;  2X1E A;  1YX5 A;  3EET A;  5FD5 A;  2WV0 A;  1DQU A;  5F6F A;  3ABK H;  3H9G A;  3IKV A;  5DYM A;  3BZK A;  3JW4 A;  2XGD A;  4NNJ A;  4LIT A;  3JRG A;  2LH9 A;  3K9T A;  1L3L A;  5E1Z B;  1TZL A;  1A36 A;  1YRN A;  2EV5 A;  2LRD A;  3R0A A;  1ZLJ A;  1MBK A;  1R71 A;  4L5E A;  1Y6I A;  4AC0 A;  4HLX A;  4CDG A;  3MFK A;  5M3M J;  4BEH B;  1FPQ A;  4HEA 2;  1ZRD A;  1G2H A;  1YE9 A;  4CYC A;  2K9S A;  3DKY A;  5GAE J;  1F4K A;  4Y4R A;  1DGW Y;  4HOB A;  1BI2 A;  3BOQ A;  1KZH A;  3G3Z A;  2IGN A;  2WB1 N;  2KP6 A;  1E0E A;  1TWH J;  1QNT A;  4XLP F;  2MA3 A;  2EFW A;  1HDD C;  4XRS G;  2VXZ A;  4AVP A;  1VI0 A;  3WGG A;  4NDL A;  4WWC A;  2ZJP F;  4KDP A;  4UVB A;  4BL0 B;  2DPD A;  2HKX A;  3CP2 A;  1MBJ A;  1X1A A;  4BHP A;  4XLE A;  1I27 A;  3ESW B;  3KEO A;  2PFB A;  2B63 J;  3KP3 A;  2DA4 A;  2LY9 A;  2ZFU A;  3BG3 A;  3WHB A;  4ZTJ A;  3M7G A;  3GZ5 A;  2YSR A;  3LL7 A;  3LMM A;  4M3E A;  3A4C A;  4EQQ A;  5B66 C;  1BR1 A;  3CME I;  3GVA A;  4UB6 C;  2NVQ J;  5LEJ A;  3P9I A;  1UEL B;  5FKM A;  4W97 A;  1PVE A;  2FOK A;  3KP6 A;  1XDS A;  3R0J A;  5DTD A;  5HS7 A;  3C7J A;  5IOY A;  3G2B A;  2NRA C;  1HC8 A;  3KZZ A;  3L2U A;  1G3S A;  3FXU A;  2NAZ A;  2IP2 A;  3VDX A;  3O8H A;  1Q1V A;  3W6V A;  4B3X A;  3RSN A;  2O0Y A;  3HB9 A;  2A6T A;  2MLG A;  3CF5 F;  2XF6 A;  2VON A;  4YIF A;  4RB0 A;  3I64 A;  4H4K C;  2KJC A;  2DYR H;  3LWF A;  1XGM A;  3QYE A;  1W7P D;  1ITY A;  1E17 A;  2EIM H;  2PJP A;  4A2U A;  2FBI A;  4IHS A;  3COA C;  2DQL A;  5GAG J;  1XN7 A;  1UG2 A;  1KA8 A;  3HTU A;  1Y1W J;  1SAX A;  3RZD J;  3F72 A;  4OIR F;  2NVU B;  2JVG A;  1BC8 C;  2Q8K A;  3LA2 A;  2YS9 A;  1FYK A;  3SXY A;  3HL2 A;  1S72 I;  1XSX A;  2R7O A;  1UHW A;  1P6R A;  1JHF A;  3S1M J;  1WWX A;  3S32 A;  1E3H A;  4AD9 A;  3S16 J;  2DOE A;  4LJZ F;  1GV2 A;  1VF9 A;  1SMY F;  4ZYA A;  1QRY A;  2EIJ H;  2W24 A;  3S93 A;  4C3I J;  1ETX A;  1S6L A;  2QWW A;  1FIP A;  4E6K G;  3LSM A;  2CYY A;  2JUC A;  2BY0 A;  5C44 J;  2BOL A;  2DMU A;  3RKY A;  2AHQ A;  4XLN F;  3G6E I;  3UR3 C;  5DEQ A;  1ZR2 A;  4FIS A;  1OQY A;  2Z99 A;  2A61 A;  1UMQ A;  5C4X J;  1BI3 A;  1XDU A;  1HDP A;  1MNM C;  2X48 A;  3NQO A;  1Z05 A;  3QWL A;  1MJ9 A;  5LLQ A;  2WAD A;  1EH6 A;  4EJO A;  1ZN2 A;  1TWG J;  3BPX A;  1YQA A;  4EJU A;  3AG1 H;  4LG3 A;  3FBN B;  4OAZ A;  2R7Z J;  3DTI A;  3WU1 B;  3HGG A;  2CQ7 A;  4Q47 A;  3CCU I;  1F9N A;  1Y8R B;  3OS0 A;  4LK0 F;  1J7K A;  2DBB A;  5J4V A;  4CXF A;  3G71 I;  3GCM A;  1P7I A;  3EYI A;  3IRQ A;  3F6V A;  4FX0 A;  2K85 A;  4C9Y A;  4A3J J;  1W5C C;  3ZMU A;  1V55 H;  4MLO A;  2L4A A;  5K7F A;  2XGC A;  4UVC A;  4Z6Y A;  3FHN A;  4ASN A;  1MKM A;  3H0G J;  2RNJ A;  2OU2 A;  2ID3 A;  5A2Q Z;  2GIZ A;  3W2V A;  3J80 K;  3OOP A;  2A5W A;  4DYC A;  2O61 A;  1J0R A;  3VSL A;  4Y52 J;  1DU6 A;  2HFH A;  2FUG 2;  4DYR A;  4DW6 A;  1KU2 A;  3SFZ A;  1P9Q C;  2VOD A;  4NC6 A;  5EGO A;  3OMY A;  5EEA A;  2HKO A;  2K4B A;  2ZXJ A;  3KP4 A;  3JSO A;  3CCV I;  4HRI A;  1OCT C;  4BHC A;  2ZB9 A;  5LBQ A;  3DTE A;  4LMY A;  2QSH X;  1KQ0 A;  1TT5 B;  2F5E A;  2AQF A;  4RLQ A;  1MSE C;  1MJA A;  1TBX A;  2A05 A;  4RGU A;  1X4O A;  1MZB A;  3PO3 J;  5H6Q A;  1U9O A;  4WXD A;  2HOT A;  4Q48 A;  2JA5 J;  4F91 B;  4XQF A;  4NC7 A;  2DOD A;  2DOF A;  2RVC A;  2ZBK A;  2LG4 A;  2XKO A;  1Z3Y A;  3S1R J;  1K79 A;  2STW A;  3L2V A;  2E1C A;  3I4M J;  2L5Q A;  2PI0 A;  2EIL H;  3F3X A;  1G4D A;  4OMY A;  1T98 A;  3DPU A;  2X0L A;  4L9V A;  1ON2 A;  4PGG A;  2F5D A;  4DOZ A;  2HDC A;  3K70 D;  3OL4 A;  2L9S A;  4A0Y A;  1XMX A;  3FF5 A;  2CV0 A;  2CU7 A;  1MH4 A;  4XR6 A;  4YG2 F;  3IH4 A;  3I59 A;  4EGY A;  3MEX A;  4UUT A;  4FE4 A;  4JQF A;  4CH7 A;  3PSF A;  4FHT A;  1TW2 A;  2E35 A;  1HXD A;  3EQL F;  4AIH A;  1LFU P;  3U9G A;  2P4W A;  3K4N A;  1KU3 A;  1D1C A;  2F5C A;  3ZMS A;  1IXR C;  2L9N A;  4D1Q A;  2LSO A;  1X58 A;  3PUB A;  2GOM A;  1A04 A;  2HZD A;  2XHK A;  3Q0V A;  2HZT A;  1FTZ A;  1BOA A;  2W85 A;  3I5U A;  1T8I A;  5F1R A;  4HLY A;  4P1W A;  2Y48 A;  3FX3 A;  4EJW A;  1KYW A;  1I6X A;  2D1V A;  2KHM A;  2VQL A;  3FXM A;  4CSW A;  3I0T A;  1QVT A;  5LGN A;  3WU2 C;  1QZY A;  2CW7 A;  5CPR B;  1IV6 A;  1ZRF A;  1FEX A;  4G6D A;  2MGQ A;  3IAS 2;  1KYZ A;  3RDI A;  1W0T A;  1O57 A;  2WAF A;  3CP8 A;  2PMH A;  5CVJ A;  1OCC H;  4LGW A;  3S3O A;  5EDN A;  3ZQI A;  1WPK A;  2EV0 A;  2X6X A;  3K4K A;  3F0C A;  1P7J A;  2HEO A;  3MD2 A;  3EUK L;  2LYC A;  4QPO A;  4WXH A;  4E70 A;  1B9N A;  3K4M A;  2MLK A;  1PDN C;  2JT1 A;  2BY3 A;  3BJ6 A;  4GRI A;  4IQJ A;  3JSP A;  5F27 A;  1LUJ B;  1WCM J;  2MD0 A;  4UHT A;  1HW2 A;  4ZJZ A;  3CUO A;  5HNF A;  4FE7 A;  2E5N A;  2FEZ A;  3T5X A;  4HF0 A;  1I5Z A;  1SFU A;  2E1M C;  1R5G A;  2ZXH A;  4A3I J;  1ETK A;  2IA2 A;  2KDO A;  1EA3 A;  3QRF F;  1DPR A;  2TDX A;  4X1E A;  1HBX G;  2AXT C;  2OQG A;  2KIS A;  3A02 A;  1JGG A;  2ISZ A;  5JR3 A;  1IN5 A;  1WJD A;  2QZ8 A;  3E3V A;  4M9Z A;  2OBP A;  4R79 A;  3GFM A;  3GYH X;  4AUX A;  2PLY A;  2BW3 A;  1QZE A;  3PL8 A;  1QO0 D;  1RPW A;  2K40 A;  2XC7 A;  2OCE A;  2XAQ A;  4CZZ A;  2L7M P;  1S7A A;  3M07 A;  4B44 A;  2RNG A;  2CW0 F;  4XKC A;  5J1R A;  1MMG A;  3GFL A;  2IAI A;  2MBF A;  2QA4 I;  3F23 A;  2FU4 A;  2L3D A;  4G12 A;  2VQH A;  3MQ0 A;  3CDL A;  2JA8 J;  1JKO C;  4JX5 A;  4G7Z F;  2XB0 X;  1K61 A;  3JAM Z;  3ONQ A;  4BXU A;  2IJL A;  4YFK F;  3IH2 A;  1IF1 A;  3FBI B;  1FBQ A;  2DJN A;  3SYT A;  3X2Q H;  1ZQ3 P;  3OIP A;  4HW0 A;  5FLX Z;  4MIM A;  2HVS A;  4B48 A;  2LFB A;  3F8N A;  1XC5 A;  3VPR A;  5D4R A;  1I50 J;  3LFU A;  2XUB A;  3QU3 A;  1MJB A;  4HV6 A;  3WTT C;  9ANT A;  4A3K J;  5ICC A;  4ZYE A;  4I2O A;  4KIC A;  1ZHF A;  3F6O A;  4HX7 A;  3LOC A;  5FFX A;  1CF7 B;  4IHW A;  3KEQ A;  4LB5 A;  1U78 A;  5D6F A;  1ETV A;  3H3U A;  4XLA A;  1FX7 A;  1P4X A;  1ZAO A;  5AIQ A;  5FKO A;  1YJN I;  2ID6 A;  3RKQ A;  3G1O A;  2BXY A;  2YX4 A;  5J1U A;  5D8L B;  4HG2 A;  5EEG A;  4UNO A;  3EPZ A;  3OYL A;  1AKH B;  2YU9 J;  5DM6 F;  1Y56 A;  5FKL A;  5KHD A;  2WB1 A;  4K2E A;  3GZ6 A;  4BQA A;  3DPT A;  5ICG A;  1MNE A;  3BTI A;  4AM3 A;  3ZMV A;  2VOP A;  1JJ6 C;  5KAF C;  5FKK A;  4PJ0 C;  2KZG A;  3OIO A;  4HNV A;  1SVO A;  2ACJ A;  1MBE A;  4ENJ A;  2VT2 A;  1CF7 A;  1T39 A;  1BJZ A;  4U87 A;  2QSG X;  3HRS A;  3Q3S A;  1LKX A;  2F6C A;  1HLV A;  1IUF A;  3Q9S A;  1V4R A;  4U0V A;  5E3O A;  4D0P A;  2X1D A;  3GZN B;  1W7P B;  4JK1 X;  4AYB N;  3RI4 A;  3F21 A;  1R58 A;  3BCA A;  4V2F A;  5KK1 A;  3LSP A;  6PAX A;  1BI0 A;  4KYW A;  1JHH A;  2YU3 A;  1J5Y A;  3ABL H;  2P5V A;  2DW4 A;  2E1N A;  4UUS A;  4QTR A;  1X3Z B;  2DYS H;  1TWF J;  4HV5 A;  4G7H F;  3CUQ A;  1Y39 A;  4BE2 A;  1LDJ A;  3I55 I;  1IGN A;  5C3E J;  1LJ9 A;  1OFC X;  1MMD A;  2IS4 A;  2CFX A;  3E5Q A;  2R0Q C;  5TIS C;  4H0E A;  1FJL A;  1Z77 A;  4F3Q A;  4G6Q A;  3MKL A;  1R5I D;  3L2R A;  4GFB A;  2GIV A;  2L0K A;  4Y15 A;  1RKT A;  1X4P A;  2RV8 A;  1W7P A;  2IS2 A;  2UZK A;  5DD8 A;  4HAM A;  4IEJ A;  4BJ6 C;  2ME0 A;  1VTN C;  5CVR A;  4BY1 J;  1YYV A;  2L01 A;  1R00 A;  3GTL J;  5BQT A;  1N77 A;  2HPI A;  3VOE A;  2W4S A;  1MBG A;  2QUF A;  2QQ9 A;  1Z0X A;  1R49 A;  5AIP A;  2EIK H;  5EG0 A;  3HYI A;  1XX5 A;  2YPR A;  2OTL I;  1GVJ A;  2IS6 A;  3N4M A;  1C0W A;  4RM2 A;  5E3L A;  3JRF A;  3ECO A;  4RBO A;  3HOV J;  2ZSI B;  4IRH A;  3KCC A;  4I7H A;  4D5F A;  4E7J A;  4N4O B;  3QPT A;  3WTS C;  2VI6 A;  3KIO A;  5IP6 A;  1W36 C;  3CLQ A;  5C4J J;  4XOT A;  2IGM A;  4C3J J;  4ESJ A;  3HHH A;  1P2F A;  1K78 A;  1JXS A;  2OC6 A;  4RMN A;  2CWE A;  1WJ5 A;  1HST A;  2LOO A;  3BJA A;  2P8T A;  3ERM A;  5D5W B;  2G9W A;  4Z2Y A;  2KRF A;  1K4S A;  1IUY A;  2K3F A;  3KE2 A;  3MN2 A;  4IL6 C;  4ZDL A;  3JTG A;  1NK2 P;  1XGN A;  4HPQ A;  3K69 A;  2Q0O A;  5F1J A;  3FMS A;  1FTT A;  4HX4 A;  2DFH A;  3JRB A;  4U7B A;  5B1B H;  4WF2 A;  5DCF A;  3WGH A;  4D7M A;  3IH3 A;  2MFZ A;  2JPB A;  2ZME C;  4EM1 A;  1RUN A;  3QOP A;  4MFE A;  3BPV A;  4ZC3 A;  1E3O C;  2VBY A;  1DP3 A;  2P6T A;  5D8K B;  2DMN A;  4KMF A;  1I3Q J;  5FGM A;  4F52 A;  1GT0 C;  1GXP A;  2Y75 A;  3U2R A;  2ZXI A;  1FP1 D;  5J8C A;  3WU0 A;  2LC2 A;  1JUM A;  2CJJ A;  3H5A A;  1ONV A;  4S05 A;  3W6K B;  2Z2S B;  4G6T B;  4V2G A;  4MEY F;  2X85 A;  3HSR A;  3ZQF A;  2LD5 A;  4RAY A;  2JUG A;  1VFC A;  1VQM I;  2H27 A;  4HBL A;  4MEX F;  2KT0 A;  2ETH A;  1JUP A;  1IN8 A;  2FNP A;  2VJ4 A;  2VKV A;  4ZDP A;  3OYD A;  2K9N A;  2KIQ A;  5CVU A;  1R1T A;  1OCZ H;  2CO5 A;  3TL4 X;  2DK5 A;  2R5Z A;  3OYE A;  1YIT I;  2IA1 A;  2LBF B;  1D8J A;  4QLC U;  3H3V K;  1IRF A;  4E7K A;  2HR3 A;  4O3M A;  3HEF A;  3FXO A;  2CMP A;  4ZZL A;  3BTC A;  3GLL A;  2LNB A;  1ZYR F;  2DMT A;  4M3B A;  1QGP A;  2COM A;  1YRN B;  4KIB A;  2W57 A;  1V5E A;  4FT8 A;  3S8P A;  4CIC A;  1NH3 A;  2B7E A;  2OTJ I;  4PGH A;  4BQN A;  3ROU A;  2RC4 A;  2DT5 A;  4MNU A;  2JJ7 A;  5FLM J;  2HOS A;  4PSX A;  2HWV A;  1BC7 C;  4QSH A;  1WSU A;  4YIR X;  3C2B A;  4CYC B;  4RB1 A;  1MW7 A;  2ADU A;  5CKT A;  5FJ8 J;  4JX6 A;  1YI2 I;  1K6Y A;  4ETS A;  2JA2 A;  3FXR A;  3WE2 A;  1SVL A;  1WVR A;  5K5O A;  2D2W A;  2LBF A;  4I09 A;  1B8I A;  5K5R A;  3AL0 C;  3VYR B;  5JI6 A;  4U0Y A;  3LSR A;  2BZT A;  4A93 J;  3QP5 A;  2OZU A;  1OYW A;  3BP8 A;  2FQ3 A;  5KVR A;  4EMS A;  5E17 F;  1ETQ A;  2FOW A;  3N97 A;  1MBH A;  2QKL B;  3H36 A;  4BJ5 C;  1U5T B;  3P5J A;  3KP2 A;  1NTC A;  1J9I A;  1WJC A;  2VAS A;  4Y7N J;  1WKM A;  1MSF C;  1U9N A;  4XOR A;  4I0A A;  1ODD A;  3CCS I;  2IPQ X;  3ZPL A;  2XGE A;  3RYR A;  3L2C A;  2Y0M A;  4JP0 A;  4E7S A;  2RKH A;  3V7C A;  4HNU A;  3S1N J;  1POG A;  1Z3X A;  1GV5 A;  1OJL A;  4EM0 B;  2F4I A;  4M71 A;  3HG9 A;  1VQ8 I;  4A0X A;  4E7Z A;  2ZC2 A;  2DDB A;  4XID A;  1SD4 A;  5GPA A;  2CUZ A;  2QM3 A;  1X3U A;  1W0U A;  3CC4 I;  1FC3 A;  2NS0 A;  3BR0 A;  3CQZ J;  3G1L A;  2V1D A;  2Y0S N;  3Q0U A;  1UCR A;  5H6R A;  1U5T A;  1GXQ A;  3O2P E;  2P7V B;  3H5N A;  2M30 A;  2EB7 A;  5K1Y A;  3PJR A;  4OIN F;  3ABT A;  3DBH B;  3H3Z A;  2XF7 A;  3MVP A;  2OUM A;  3BR5 A;  5HDN A;  4XLH A;  4G8X A;  4L5J A;  1LB2 A;  5HDG A;  1JGS A;  2WY8 Q;  4MFD A;  3VSK A;  4ESF A;  2OJE D;  2FXA A;  3KFW X;  2R7D A;  4E7H A;  2VBX A;  4ZH4 F;  1WGX A;  4NHJ A;  2JMW A;  5J4Y A;  3HSE A;  5LRR A;  1RR7 A;  3NAU A;  1RC9 A;  2F5F A;  2IRF G;  2RN7 A;  1V5G A;  4F55 A;  2EFO A;  2DPU A;  2XRL A;  2CQX A;  3ZQG A;  4B47 A;  4IHX A;  4M72 A;  3S3M A;  3TKY A;  1OIS A;  2Z16 A;  4E7I A;  2KKO A;  2VJ5 A;  3WTX C;  3AFH A;  1R1U A;  1MGT A;  1ORK A;  1XGO A;  3TDU C;  5IP9 J;  3E1S A;  2D5V A;  1IC8 A;  3GFI A;  4XBF A;  3OR2 C;  4HX8 A;  4ABZ A;  2N8G A;  1OR7 C;  1JE8 A;  4M3F A;  3I58 A;  1VQ4 I;  4BY7 J;  1YO5 C;  3D0S A;  4XOP A;  3JRA A;  4KIF A;  5L3B A;  2AO9 A;  3K2A A;  1R5H A;  1KGS A;  2Y9Z A;  3ZQC A;  3JRH A;  2COB A;  2XPV A;  1YLF A;  2F2E A;  2A68 F;  3TW6 A;  2LTP A;  5GTI C;  5M3F J;  3HZJ A;  5BPD A;  4N0B A;  3IP4 B;  1KQ8 A;  5IT3 A;  1LQ1 A;  2Y2Z A;  2VKH A;  4AVZ A;  3PM1 A;  1RZ4 A;  2LRE A;  3BY6 A;  1JTX A;  3TO9 A;  3FM3 A;  4HA8 A;  4YII A;  2XRO A;  3L9F A;  2M4K A;  3ZQH A;  5IYC J;  4BBR J;  1Y0N A;  5HLH A;  3DKW A;  1E2X A;  2F4M B;  4KNY A;  4RGX A;  2HU9 A;  4GCV A;  2KLO A;  1A6I A;  3I56 I;  1ETO A;  3GEZ A;  4OWR B;  2ME6 A;  2QEN A;  5EGO B;  2ZNZ A;  4YRV A;  4XMY A;  1D0X A;  2DQR A;  3HRT A;  2K7L A;  4U7D A;  1ZRC A;  1FNN A;  3MKZ A;  1R23 A;  3Q0W A;  2M5W A;  5LHH A;  3HOW J;  2FJ1 A;  1IDY A;  3E5X A;  3V42 A;  2XDV A;  2DOA A;  2LMD A;  2ZFW A;  1R22 A;  2NOJ B;  3CC2 I;  2P81 A;  3ZRG A;  2RGV A;  3PIP F;  4IOC F;  4UUV A;  5IP7 J;  5HLG A;  1T2K A;  3BG9 A;  4XK4 A;  4TV7 A;  1RES A;  3S2D J;  4BU2 A;  4ENN A;  2OD5 A;  3E6D A;  4P9F A;  4BE0 A;  2HQN A;  3EDP A;  2VOO A;  5M5W J;  2R7F A;  4M9S A;  4AID A;  4UY8 I;  3AAF A;  2GM4 A;  1RKW A;  3DLA A;  3G1M A;  1D5V A;  2WA0 A;  3L09 A;  1UJ8 A;  4F7Z A;  1LEB A;  2DA3 A;  5F08 A;  4MTE A;  2LY2 A;  5CJ9 A;  1JI8 A;  5EZG A;  3PNY A;  2BE5 F;  1O7F A;  2L9V A;  3QPS A;  1OYI A;  3NAR A;  4AYB A;  3I59 B;  3J81 K;  1RIO H;  1H0M A;  5J8F A;  2FE3 A;  2IEK A;  4JX4 A;  3C2H A;  2DDA A;  3WG7 H;  2VT3 A;  3PIO F;  4RA2 A;  3FDY A;  3HRU A;  3HPG A;  2E34 A;  1MD0 A;  2BV6 A;  3IAM 2;  3FXQ A;  3MZY A;  3SDB A;  5HOO A;  2ZJQ F;  3GX4 X;  2VKE A;  1IO2 A;  2E7W A;  3L1P A;  4DQ2 A;  2FRH A;  1I39 A;  2EV6 A;  3CDI A;  1QZZ A;  4BYY A;  2BVL A;  3ZOB A;  4IXA A;  4L9N A;  2V9V A;  4ESB A;  1QHH D;  1OMI A;  3K1N A;  1AU7 A;  1O3T A;  2EPF A;  1ULY A;  5DCM B;  1YX3 A;  1ACI A;  5FRO A;  3K2Z A;  2EZH A;  2MYS A;  1H89 C;  1O7L A;  2LF7 A;  3P7N A;  1XGS A;  4LLL A;  4P5O A;  3W3C A;  4KMU X;  1H9T A;  2NVX J;  3JRI A;  2L02 A;  2IBD A;  5DS9 A;  4OIQ F;  2E71 A;  4JYK A;  1I1G A;  5JHF A;  5IYB J;  4GYG A;  2DT7 B;  4BAY A;  4C2T A;  3LSK A;  3P9C A;  3S2W A;  1QVU A;  3HXL A;  3KYC B;  3LNQ A;  1FOY A;  1WI9 A;  1JKP C;  3BC8 A;  1RUO A;  4A5N A;  2KFD A;  1T0F A;  5JHU A;  2H1L A;  1PYV A;  2BEO A;  3K10 A;  5EYR A;  2ELH A;  1ENH A;  5DCM A;  1J75 A;  3R61 A;  1Z7U A;  3U1K A;  3K7A J;  3GTJ J;  1XMA A;  4XSX F;  3QAH A;  2V6E A;  2E2I J;  2NXN B;  3A1Y A;  2XPU A;  2V1X A;  1V5F A;  5F04 A;  3TDZ C;  2EJR A;  2X4H A;  3DFG A;  2WY7 Q;  4CYD A;  3HOY J;  2JVH A;  3DWL E;  2JPC A;  5DUI A;  3A0H C;  3TO6 A;  2W84 A;  2IA0 A;  3VOD A;  4NUB A;  4II2 A;  3M1E A;  5EJC A;  2F5V A;  5F64 A;  2BW3 B;  2M4G A;  3K6G A;  1TL8 A;  4B8X A;  3ABM H;  1FT9 A;  3K4B A;  1X19 A;  4L0Z B;  3S3N A;  1GHC A;  5IPA A;  1LFB A;  2FBH A;  1MDM B;  1Z1D A;  1KON A;  2DFI A;  4N9I A;  3RQI A;  5HLT A;  4DBQ A;  4I02 A;  3CJN A;  5M5X J;  2R5Y A;  3CC7 I;  2CS3 A;  3KP7 A;  2IVM A;  2M9H A;  3FMQ A;  3TP3 A;  1ZR4 A;  3ASN H;  2L54 A;  2VKD A;  3HC7 A;  2HVQ A;  2CQQ A;  2P5K A;  1G3Y A;  3I4P A;  3I71 A;  3BJO A;  3D5L A;  1CGP A;  5CLS A;  3HOZ J;  2ZCW A;  2V7F A;  5CQE A;  2ZKZ A;  3JRD A;  3PNT A;  4XN3 A;  1YIJ I;  3OS2 A;  2E60 A;  1R7J A;  4BUP A;  3SQN A;  1FMV A;  2HQA A;  1QBJ A;  5H20 A;  4IHT A;  3KET A;  3ABU A;  1PUF B;  3TOB A;  4C2U A;  2M7B A;  4KN7 X;  4M6X A;  1Y0U A;  3T0Y A;  1MDM A;  2O3F A;  3K0L A;  5FLV A;  2V1N A;  3ECH A;  3RTR A;  2UXX A;  3VYS B;  3KLO A;  4I0B A;  4CZC A;  1WJA A;  3DF8 A;  1L0O C;  4I76 A;  3H9Q A;  1Z67 A;  2VPL A;  3VWB A;  3DKX A;  2HDW A;  4HQE A;  4XKW A;  1EH8 A;  3BDD A;  2L9R A;  2G7U A;  3BWG A;  5CVV A;  4A6E A;  2VE8 A;  3W2A A;  5LGU A;  3CO7 C;  2DTR A;  1PP8 F;  3SEQ A;  1FIA A;  3D1N I;  2KDZ A;  1A35 A;  2EH3 A;  3LA7 A;  3OYH A;  3BG5 A;  5HS8 A;  4XLF A;  2O6G E;  3RJP A;  3SZT A;  1AOY A;  1PUF A;  4HDU A;  2L2O A;  4KA4 A;  1D5Y A;  1T6S A;  1G3T A;  5IT9 K;  4UXN A;  2LR8 A;  3I54 A;  4R8H A;  2OF7 A;  2GA2 A;  5JFR A;  4ZYG A;  5FD6 A;  3HPH A;  4BXX J;  3WE3 A;  2L7F P;  5IYD J;  1ZGW A;  3QOD A;  1SFX A;  3GLX A;  1FBU A;  3R4K A;  4G9Y A;  5IY5 H;  4YEL A;  4M73 A;  4BJT A;  3MKY B;  4IQ4 A;  3LSI A;  3ZMD A;  3A2K A;  2V79 A;  2EK5 A;  1EJ9 A;  3IWZ A;  2UV1 A;  2HTS A;  1T56 A;  2CRG A;  2LKS A;  2FD5 A;  2LLK A;  3IWF A;  2Z3Y A;  4HQM A;  3MZ8 A;  4A0Z A;  4CCO A;  2KIM A;  2R7W A;  1HF0 A;  1XPX A;  4XRS A;  1DPU A;  5JLX A;  5TJJ A;  1KQ9 A;  1M1E B;  2UUZ A;  2XGX A;  5D5X B;  3L00 A;  3T8R A;  4CCL A;  5BPI A;  4M9X A;  3OSF A;  1Z7L A;  3UNG C;  3L2W A;  4UUS B;  2IS1 A;  2IGK A;  2CUJ A;  2GAU A;  1IXC A;  3CUQ B;  3K4C A;  5E18 F;  2PBI A;  3OS1 A;  3HOU J;  2BHZ A;  4RAF A;  4HDV A;  2O03 A;  2RRE A;  3QOE A;  4OIO F;  2HOE A;  2M3A A;  3EUH A;  4YEJ A;  5FFZ A;  3IRR A;  1S7E A;  3K1P A;  2RQQ A;  2JK3 A;  2KMU A;  2Y0S A;  2PX9 A;  1J59 A;  2ISY A;  1XD7 A;  2L4M A;  4KUM A;  4PFP A;  3OV8 A;  2K9L A;  4M6V A;  1XG1 A;  4XON A;  3OYN A;  1YG2 A;  1NK3 P;  2VB6 A;  3MCZ A;  2FX0 A;  1SFO J;  3HOS A;  2Z33 A;  1MMS A;  3HBL A;  3C3W A;  1IN7 A;  3F8F A;  4J01 A;  5J47 A;  1WI3 A;  1ZG3 A;  1BBY A;  2CSO A;  4R1H A;  2DLL A;  2R7R A;  1DUX C;  1JTY A;  5EG0 B;  3J80 Z;  2LY1 A;  2QLZ A;  2GBY A;  1VQL I;  4RAG A;  3CDH A;  2K27 A;  2P5L C;  1TW3 A;  3AKZ A;  4A3G J;  4AWX B;  4EJT A;  5ILV A;  3GTO J;  1MMA A;  3A01 A;  5BNG A;  1XS9 A;  2M1B A;  1H8A C;  5B3S H;  4WX9 A;  1HOM A;  5E8I A;  1SAN A;  1EV7 A;  3OYA A;  2IXS A;  3M3Y J;  2X9D A;  4CHU A;  1ZH5 A;  4ITV A;  1ZGA A;  2QEX I;  4HZF A;  1K78 B;  2IW5 A;  4B3A A;  4X6A J;  3BRO A;  3ZQL A;  4E7L A;  2H1K A;  3TMO A;  3OYK A;  3QP6 A;  2W1O A;  3K4J A;  2H09 A;  3ASO H;  3FHZ A;  2E19 A;  1WHU A;  5CVI A;  4KJZ A;  3ULQ B;  3WHC A;  1RRJ A;  2EZL A;  4IZZ A;  5EZH A;  5GTH C;  1ETY A;  4ZYD A;  1TLH B;  4MGR A;  3J7Y J;  1STZ A;  1YIO A;  2WWY A;  1VZ0 A;  2Y30 A;  5TGT A;  2DU9 A;  4A12 A;  1V3F A;  2GQQ A;  1NG6 A;  1XB4 A;  1LNW A;  2E36 A;  1K4T A;  4OMZ A;  4IF4 A;  4Q4Z F;  3KYL A;  4BAC A;  3E0J B;  1O3S A;  1K6O A;  3HOX J;  1WQ2 A;  5HLI A;  3HSF A;  2DA6 A;  2XSJ C;  3E97 A;  2GA1 A;  3OR1 C;  1DP7 P;  4C3H J;  2MSY A;  3DV8 A;  4N9H A;  2KIU A;  4KFC A;  2M8E A;  5B5E C;  5LFA A;  3KPH A;  1IG7 A;  5EF6 A;  3F22 A;  1UG0 A;  3B02 A;  5HOD A;  3LQQ A;  1ZTR A;  4FET A;  5E1W A;  3IHU A;  3DEU A;  3C2G A;  2XAJ A;  4BXF A;  1WH7 A;  2QSF X;  1O3R A;  1F1Z A;  4LLN A;  3GUD A;  5FRM A;  2R5Z B;  3LA3 A;  3C18 A;  2HYF A;  2CUF A;  2Y69 H;  2C6Y A;  1SD6 A;  4MQV A;  5A2Q K;  1BL0 A;  4WXC A;  2BVM A;  1W5S A;  1S3J A;  3JCU C;  4QIW N;  1VQO I;  1N78 A;  1OLT A;  1YOV B;  4WCG A;  2P7C B;  2KJB A;  5E20 A;  4S0H B;  5J40 A;  1X1B A;  3KLN A;  2VN2 A;  3NRV A;  1W36 D;  2VE9 A;  3SJM A;  2F48 A;  2FMY A;  1SFE A;  4M3G A;  3IC7 A;  1N25 A;  1JKR C;  2JWT A;  2O7O A;  3WTY C;  1X2N A;  1FLI A;  4PJN A;  1V54 H;  2QBY A;  2H8W A;  3LSH A;  4GYI A;  2ESH A;  1RR8 C;  1B8I B;  2B9S A;  2A3S A;  3E5U A;  5HVQ C;  1PP7 U;  2BBY A;  3CCJ I;  5FO5 A;  3KZY A;  3N05 A;  3ZN0 A;  3ZN1 A;  3OYC A;  2VXD A;  4D7N A;  3SHF A;  2YUS A;  3TED A;  1UHM A;  4PSW A;  2Y9Y A;  1DDN A;  1TWA J;  2HNH A;  4RGS A;  4D5C A;  1UB9 A;  4XRF A;  2XAU A;  2A6E F;  4M6Y A;  4XM3 A;  3E6C C;  2M2E A;  1TTY A;  3E6M A;  1ETW A;  1BW6 A;  4KT6 A;  4QPQ A;  2VC0 A;  5L3E A;  3F8B A;  4KIT B;  1QQI A;  2PMZ N;  3ML6 A;  3OY9 A;  2DXI A;  4LG0 A;  4C30 A;  3CES A;  4FAS D;  5J6X A;  1WZ2 A;  3TGN A;  3IL2 A;  2LKP A;  3H5R A;  1UAA A;  2K9M A;  4J19 A;  3DPL C;  3PFY A;  4DIQ A;  2RQP A;  2CV1 A;  2NYX A;  5GAH J;  2VIX A;  3BR3 A;  3FXK A;  3U1D A;  4ZDO A;  3EYY A;  4P55 A;  2WAE A;  2YR2 A;  2HI3 A;  4F92 B;  2HTJ A;  2BY2 A;  3NWT A;  1RET A;  1T33 A;  1U3E M;  3GTQ J;  1I6H J;  2R7V A;  1X1C A;  1G8X A;  1YW9 A;  2XB5 A;  2ESN A;  4RGR A;  1LVA A;  4GO1 A;  1MH3 A;  4CA0 A;  1OCO H;  3ZP5 A;  1LPQ A;  1FOK A;  5K5Q A;  3L2Q A;  4FQG A;  3FKJ A;  1OPC A;  3CO6 C;  2CW8 A;  3HJE A;  3K1M A;  2KQR A;  3PUF A;  2DT6 A;  5F0H A;  1FY7 A;  4OAY A;  1FWZ A;  2M0C A;  5JLW A;  3G73 A;  2A6H F;  1DU0 A;  4MO7 A;  5AON A;  2EA2 A;  1FSH A;  3CUQ C;  3CLO A;  3OYB A;  3B6C A;  1ZKG A;  3PQK A;  3JRC A;  2L7K A;  2VLA A;  1KU7 A;  2I10 A;  2HQR A;  3M9A A;  2G0E A;  5F0F A;  4N4N B;  4XIC A;  3JR9 A;  1ZAR A;  3NWS A;  4LB6 B;  1NHA A;  1B72 B;  5KCM A;  2J5P A;  5E3M A;  3CJT B;  4HSR A;  1T08 B;  3CJR B;  2MD5 A;  3FMR A;  3RPU D;  1FOW A;  5FKN A;  2K5C A;  4HST A;  1BJA A;  3RQ4 A;  3K4L A;  3A03 A;  1I1S A;  2JA6 J;  1G6N A;  2H8R A;  4A69 C;  2KZV A;  3GO5 A;  3TO7 A;  1OCR H;  1B9M A;  1WJF A;  2F4O B;  5K7H A;  4GDF A;  1SD7 A;  3ZMT A;  2E1M B;  4UB8 C;  2MG4 A;  1BM9 A;  5ED4 A;  3WTZ A;  4BEH A;  2W7N A;  3S1Q J;  1QU3 A;  1G59 A;  3KEY A;  3ERE D;  1Z21 A;  4XL9 A;  3QQA A;  4IJA A;  1R4M B;  5E1X A;  1YHQ I;  2HYG D;  1B72 A;  3BLY A;  1F36 A;  1W1W E;  4LFU A;  2VPR A;  2KL4 A;  1S7O A;  2EWN A;  1NG7 A;  2XAF A;  2JSP A;  2DA2 A;  2CGP A;  1IAW A;  3JAM K;  3BTJ A;  3V7R A;  1ZG5 A;  1S29 A;  1BA5 A;  2M87 A;  1CQT A;  3UKG A;  4E4H A;  3AG4 H;  4RB3 C;  4BQQ A;  3VYU B;  2GXB A;  4KT5 C;  5FLX K;  2FA5 A;  3BG7 A;  2V1U A;  2ICW G;  3IUO A;  2M45 A;  4UV9 A;  5L3C A;  1XSD A;  2PG4 A;  1BIA A;  2QCO A;  2FML A;  3ZQQ A;  2DA1 A;  4IO9 F;  2STT A;  1IJW C;  4A3F J;  5E79 C;  3QPL A;  2DO7 A;  3DEE A;  2JN6 A;  2DFE A;  2E5Z A;  2PEX A;  2H6C A;  2VJJ A;  3QU6 A;  5DUK A;  3SEZ A;  3U21 A;  3VEP A;  4DYQ A;  3I4N J;  4L9J A;  2E1O A;  2O8X A;  4CCN A;  1IZ1 A;  1AHD P;  2HVR A;  1J09 A;  2XV4 S;  4LOC A;  4I6Z A;  1U2W A;  3GWZ A;  2L7Z A;  3SFI A;  3PQJ A;  2TCT A;  3BR6 A;  1BR2 A;  2V9K A;  4CCK A;  3D5S C;  3DCF A;  3LSG A;  3G4S I;  2FF4 A;  1PUE E;  2V9P A;  2QF7 A;  3KX2 A;  1GUU A;  4RLF A;  4PJL A;  1JT6 A;  2MW8 A;  1J2X A;  3HIF A;  1LFP A;  2QVO A;  2MAB A;  3HKZ N;  5H2F C;  3CMY A;  1YJ9 I;  1GVD A;  1QPM A;  2LF8 A;  4W1U A;  4YFN F;  3ELK A;  4BKX A;  4EAT A;  2XSD C;  5EEH A;  4V19 K;  1TNS A;  3FZV A;  4XSZ F;  1BOB A;  2KIF A;  2OV7 A;  3SZG A;  4FTH A;  2BGC A;  1O4X A;  4MQ9 F;  2NNN A;  2AXL A;  1FBS A;  2R7S A;  3HTS B;  3DXJ F;  2ZJR F;  2J5O A;  2JRT A;  3HHG A;  4U88 A;  4AIK A;  2MH2 A;  2UWM A;  2NS7 A;  2WAQ N;  4DZP A;  3L7W A;  5ILS A;  3IKT A;  4A3C J;  3K70 C;  3OL3 A;  3BZ6 A;  3TW7 A;  2P0W A;  4XNF A;  1IN4 A;  1YS7 A;  3ZMZ A;  3FXL A;  4P9U A;  3W6J B;  3LST A;  2DI3 A;  2EIN H;  3ZQ7 A;  5LHG A;  3BQZ A;  4XKV A;  2CH0 A;  2IGO A;  1BI1 A;  5FB2 A;  1XCB A;  3FM5 A;  1GLN A;  2D1H A;  4IKF A;  5D5U B;  1S5L C;  3RCO A;  3DP7 A;  4I98 B;  4NB5 A;  4RM3 A;  4EV0 A;  5LD2 C;  2PQ8 A;  3LFK A;  4KN4 X;  1MMN A;  4L9T A;  3I53 A;  1IN6 A;  4RAZ A;  5JVG F;  2M0M A;  4J00 A;  5GP9 A;  4NBQ A;  2QKM B;  2XAS A;  3M1C A;  4XRM A;  3OYF A;  3H0D A;  3ZXS A;  3RZO J;  3BT9 A;  4PCQ A;  4XN0 A;  2X6O A;  4LK1 F;  5E8G A;  1D0Z A;  1F43 A;  5L3F A;  3BQY A;  3DBR B;  5ILU A;  1P4A A;  3GME A;  4IHY A;  1IV8 A;  3HGY A;  5FRN A;  1HQC A;  4O6J A;  2DAO A;  2BY1 A;  3E7L A;  3PNV A;  2MC3 A;  5GPC A;  1WJB A;  2IT0 A;  4B1R A;  2XRN A;  4P96 A;  4ENK A;  2BYV E;  2DTZ A;  2ELK A;  5F0C A;  1PJR A;  3OYG A;  2CFO A;  1LE8 B;  4IOA F;  2PJR B;  3AG3 H;  1R36 A;  4RDU A;  4M74 A;  1HKQ A;  3V8J A;  2OZ6 A;  1JJ8 C;  2HPM A;  5D6E A;  3V7S A;  1U5T C;  2GLO A;  5LHI A;  3B6A A;  2XVC A;  1P4W A;  2MH9 A;  3WGI A;  3HUG B;  4HF2 A;  2EQR A;  1FMW A;  2DCE A;  2R5Y B;  3ISP A;  2OAZ A;  2V4J C;  2Z5U A;  3T1B A;  2JQ7 A;  4EJV A;  1JUS A;  3MWM A;  4M3D A;  1DGR M;  1HW1 A;  1IXS B;  2QYO A;  5LEK A;  3TQN A;  1XMK A;  1REP C;  3QYF A;  2DJI A;  2VQG A;  3I9V 2;  3W2W A;  1TQP A;  2VQC A;  1WRJ A;  3LSJ A;  1LE8 A;  2HXO A;  2PJR A;  4IHV A;  3S17 J;  1A31 A;  2RAE A;  3F8M A;  3KZI C;  2BHY A;  1JT0 A;  3OWT A;  1U0J A;  5KNL A;  5BOX A;  3OYM A;  1FP2 A;  1YTY A;  2ELJ A;  2VL8 A;  1W4M A;  3AG2 H;  5BS6 A;  3O6B B;  2FBK A;  5BMZ A;  3HUG A;  1ZRE A;  3DU5 A;  1N75 A;  2WTE A;  2XAG A;  3ZR8 X;  2YX7 A;  1ON1 A;  2QQ8 A;  3M8E A;  2DN0 A;  4DGW B;  3NEU A;  4ANJ A;  5TRD A;  2Y31 A;  2I5U A;  1D0Y A;  2ZME B;  4A6D A;  2A07 F;  2CQK A;  5ICE A;  2K86 A;  4LD5 A;  1HSJ A;  2ZJ2 A;  4ENM A;  1ERD A;  3QPH A;  3ZCO A;  4ZYH A;  1HW5 A;  3OYI A;  3M4O J;  2B0L A;  5J3L A;  4BH9 A;  1R6R A;  4BHB A;  1B59 A;  4LLG F;  5DV5 A;  3VYT B;  1HKT A;  3JTH A;  4DNC A;  2DMP A;  4NQW B;  2CV2 A;  1UST A;  1BN5 A;  3J7A Y;  4CCM A;  1VQ5 I;  4LIV A;  4LIU A;  3BTL A;  1GDT A;  1SMT A;  4Y13 A;  3BR2 A;  2XPW A;  2A5Y B;  2O5R A;  1TC3 C;  2P6S A;  4CGZ A;  1WFX A;  2ZME A;  3QYB A;  3WTW C;  1X1P A;  3CJQ B;  4IVN A;  2VUM J;  3OOU A;  3RKX A;  3ZGK A;  4BBS J;  1MBF A;  4A3D J;  3H9J A;  5L3G A;  4ZZD A;  1HKS A;  2R7X A;  1H88 C;  2JA7 J;  3DLL F;  3CMA I;  3FIW A;  4MTD A;  2ZSH B;  2HDD A;  1SD5 A;  3I3L A;  2LP0 A;  4CUG A;  2GZW A;  2LKX A;  3MMY B;  3MKW B;  2Q2E B;  4NQW A;  2PMZ A;  3HOT A;  1VQK I;  2R7T A;  3DQV C;  1VQ6 I;  3OYJ A;  2K02 A;  1MND A;  1USS A;  4HNT A;  3KP5 A;  4I01 A;  2VC1 A;  4PZJ A;  2LK2 A;  5HS9 A;  1QPI A;  2X6W A;  1OYY A;  3H35 A;  2UXN A;  2GOX B;  5CQG A;  3RKW A;  1YJW I;  2GXG A;  4IX7 A;  1BW5 A;  3PFI A;  2HXI A;  2AS5 F;  4EGZ A;  4L18 B;  3CCY A;  4L0Y B;  1VQ7 I;  2JRM A;  2NVT J;  1T95 A;  1LDK B;  2R3S A;  4MHG A;  1Z6R A;  3AL0 B;  1U8R A;  1RNL A;  4BNC A;  1YW7 A;  2XF5 A;  3CCR I;  2ZNY A;  1VQN I;  4KIS A;  2A69 F;  2NS8 A;  4XKB A;  3JRE A;  4C2M J;  3GFJ A;  3PO2 J;  1O3Q A;  3RYP A;  2EZK A;  4DJA A;  3WG9 A;  1A5J A;  2QGU A;  3CCL I;  2ECB A;  2Q2E A;  3RPQ A;  1T38 A;  1FZP B;  1UFM A;  1H9G A;  1LDD A;  1XSV A;  2JZY A;  3FWE A;  5E3N A;  4BDZ A;  2R92 J;  1BIB A;  1FYM A;  2HOA A;  1IRG A;  1K7A A;  2NNY A;  1ZEL A;  1EH7 A;  1X2M A;  2I8D A;  2VBW A;  2E2J J;  4HF1 A;  1HA8 A;  4I99 C;  5M5Y J;  4G7O F;  3KYD B;  2FSW A;  2CG4 A;  4YFX F;  3VB2 A;  3S14 J;  4IRG A;  3O3K A;  4EVI A;  3A01 B;  4UVA A;  1UZC A;  2WC2 A;  4BQO A;  4FCY A;  4AIJ A;  4IPA A;  3CTA A;  2K3P A;  3RPU A;  3A0B C;  2OA4 A;  1SFK A;  1YW8 A;  2EFP A;  5K7Z A;  2K4J A;  3V8K A;  5ICF A;  1ZLK A;  1XTA A;  4L5I A;  4A5M A;  2FQ4 A;  3GTP J;  2NVY J;  3BZC A;  3GTK J;  3S2H J;  3CCE I;  2JSC A;  5GAD J;  2Q1Z B;  4B4C A;  3FK6 A;  1ZGJ A;  1QA6 A;  2R4G A;  3OSG A;  4A3B J;  1FOX A;  1P92 A;  1EKE A;  1Z6T A;  1D1A A;  3E6B A;  1R1V A;  2H6B A;  2QQB A;  3CCQ I;  4HYE A;  4A3E J;  1B6A A;  3HRM A;  5DDG A;  4RB2 C;  2Z9O A;  1E3P A;  1RI7 A;  5J1Y A;  1X3W B;  1TWC J;  1R4N B;  2EFN A;  1AKH A;  1OKR A;  2OPT A;  2DMQ A;  3EUA A;  3J81 Z;  2M8G X;  4ON0 A;  2NOG A;  1T0F C;  2XAH A;  2ZXW H;  3IV5 A;  1R9T J;  4X0G A;  3BCB A;  4D9J A;  2K9Q A;  2R93 J;  3B73 A;  4XLC A;  1XCV A;  3BR1 A;  5L3D A;  3CMM A;  1Y1V J;  3TBI A;  4PK4 A;  1Q1H A;  2R7Q A;  1I3A A;  3GXO A;  2W82 A;  3Q5F A;  2HGC A;  1Y8Q B;  2DFF A;  3TP0 A;  3LAJ A;  2GWR A;  3V4G A;  1D8K A;  5HDK A;  1WH5 A;  4RS8 A;  3SZP A;  2R7U A;  3DBL B;  1BR4 A;  2DA7 A;  2HQ5 A;  3HM5 A;  2O9L A;  2DK8 A;  4JOM A;  1YS6 A;  1SEU A;  1KU9 A;  3GW2 A;  4PDK A;  4ZTF A;  4BGD A;  1VQ9 I;  1TT0 A;  4PUS A;  1B4A A;  3GF2 A;  1SC7 A;  1K83 J;  1IW7 F;  2WBM A;  2LDU A;  1AA7 A;  1B1B A;  2EZI A;  3PSI A;  4B09 A;  1SAU A;  4Q5S F;  1IDZ A;  1LVK A;  3R60 A;  1SVM A;  3F8C A;  3R6S A;  3D5R C;  2Z1D A;  5JVT A;  1Z9C A;  2JTV A;  3CD6 I;  3FKI J;  3GTG J;  2KRC A;  5HNH A;  3FXJ A;  2CUE A;  4GGG A;  2XIG A;  2W25 A;  1U8B A;  3T8T A;  4A3M J;  2PMU A;  1OR7 A;  3WOD F;  4B43 A;  1TNT A;  4O5V A;  2AQE A;  5IOZ A;  2H94 A;  2HYJ A;  3FK7 A;  1X1D A;  2PN6 A;  3HKZ A;  2QBY B;  1WJE A;  2V26 A;  5D4S A;  4AU7 A;  2MC4 A;  4OOI A;  3GTM J;  1Z91 A;  3LAP A;  4PJJ A;  4GXO A;  2E7X A;  1FYL A;  2X1C A;  2VJI A;  4A3L J;  3P9K A;  4BE1 A;  3O8G A;  1YFH A;  4CO8 A;  1IRX A;  5DM7 F;  2X51 A;  4BS9 A;  2E2H J;  4PFO A;  1HCR A;  5B1A H;  1G3W A;  1A6Q A;  4U0W A;  4JBA A;  2G7H A;  3WTU C;  2TRT A;  3REO A;  2WAQ A;  5DD4 A;  4PJM A;  5KAI C;  4G94 A;  1D3Y A;  3DEW A;  1VQP I;  3Q9V A;  4II3 A;  3MAJ A;  2OCC H;  3H92 A;  4Y3O A;  3BG6 A;  3SDG A;  5CYV A;  2W00 A;  4KIG A;  4OU0 A;  3V8L A;  5LRS A;  1APL C;  4LG0 B;  2FNA A;  1AWC A;  1QHG A;  3OIQ A;  2BXZ A;  5D5V B;  2M7A A;  2W48 A;  1ZG1 A;  2OQR A;  2CQN A;  2VBZ A;  4F93 B;  2KRH A;  1TP4 A;  2WV1 A;  3H1C A;  3MZH A;  1FSE A;  2EA4 A;  1S9H A;  1EF4 A;  1UHS A;  1S8N A;  1W5T A;  3F9K A;  3S15 J;  1TQM A;  3CCM I;  2HS5 A;  2M34 A;  1U6G A;  3J7Z I;  4QWQ A;  2ZO4 A;  3FIS A;  1D1B A;  2QQA A;  1ZK8 A;  4S04 A;  4UV8 A;  4Y33 A;  2DA5 A;  2D45 A;  4Y17 A;  3VFZ A;  3M8J A;  3TOA A;  2O8K A;  3CF2 A;  4OIP F;  4DBR A;  1JKQ C;  3HDD A;  3J7A O;  5ERI A;  4NC8 A;  3C1D A;  3M8F A;  3DU6 A;  3WTV C;  2GXA A;  3LQR A;  1LEA A; 
#chains in the Genus database with same CATH homology
 4EM2 A;  2EFQ A;  4WK8 F;  2XKP A;  5LGT A;  4IRI A;  1TQI A;  2RDP A;  1F5T A;  2V6C A;  4FX4 A;  5IT9 Z;  3RIR A;  3EET A;  5FD5 A;  2WV0 A;  5F6F A;  3IKV A;  5DYM A;  3JW4 A;  3K9T A;  1L3L A;  5E1Z B;  2EV5 A;  3R0A A;  1ZLJ A;  3MFK A;  4HLX A;  4CDG A;  1FPQ A;  1ZRD A;  1F4K A;  4HOB A;  1BI2 A;  3BOQ A;  3G3Z A;  1QNT A;  4XLP F;  2MA3 A;  2EFW A;  2VXZ A;  4AVP A;  3WGG A;  4WWC A;  4KDP A;  4UVB A;  2DPD A;  2HKX A;  4BHP A;  1I27 A;  3KEO A;  2PFB A;  3KP3 A;  3M7G A;  3GZ5 A;  2YSR A;  4EQQ A;  3GVA A;  5LEJ A;  3P9I A;  2FOK A;  3KP6 A;  1XDS A;  3R0J A;  5HS7 A;  3C7J A;  2NRA C;  3KZZ A;  1G3S A;  3FXU A;  2NAZ A;  2IP2 A;  2O0Y A;  2MLG A;  2VON A;  4YIF A;  4RB0 A;  3I64 A;  2KJC A;  3LWF A;  1XGM A;  1W7P D;  1E17 A;  2PJP A;  4A2U A;  2FBI A;  4IHS A;  3COA C;  2DQL A;  1XN7 A;  1KA8 A;  3HTU A;  1SAX A;  3F72 A;  4OIR F;  1BC8 C;  2Q8K A;  3LA2 A;  1FYK A;  3SXY A;  1XSX A;  1UHW A;  1P6R A;  1JHF A;  1WWX A;  4AD9 A;  4LJZ F;  1SMY F;  2W24 A;  1S6L A;  2QWW A;  2CYY A;  3RKY A;  4XLN F;  5DEQ A;  2Z99 A;  2A61 A;  1BI3 A;  1XDU A;  3NQO A;  1Z05 A;  5LLQ A;  1MJ9 A;  1EH6 A;  4EJO A;  1ZN2 A;  3BPX A;  1YQA A;  4EJU A;  3WU1 B;  4Q47 A;  1F9N A;  4LK0 F;  1J7K A;  2DBB A;  4CXF A;  3EYI A;  3IRQ A;  3F6V A;  4FX0 A;  3ZMU A;  2L4A A;  4UVC A;  4ASN A;  1MKM A;  2RNJ A;  2OU2 A;  5A2Q Z;  3J80 K;  3OOP A;  2O61 A;  1J0R A;  2HFH A;  1KU2 A;  3SFZ A;  2VOD A;  2HKO A;  2K4B A;  2ZXJ A;  3KP4 A;  3JSO A;  4BHC A;  5LBQ A;  4LMY A;  1KQ0 A;  2F5E A;  1MJA A;  1TBX A;  4RGU A;  1MZB A;  5H6Q A;  4WXD A;  4Q48 A;  2RVC A;  2ZBK A;  1K79 A;  2XKO A;  2STW A;  2E1C A;  2PI0 A;  3F3X A;  1G4D A;  4OMY A;  1T98 A;  2X0L A;  4L9V A;  1ON2 A;  4PGG A;  2F5D A;  2HDC A;  4A0Y A;  3FF5 A;  4YG2 F;  3I59 A;  4EGY A;  3MEX A;  4JQF A;  4FHT A;  1TW2 A;  1HXD A;  3EQL F;  4AIH A;  3U9G A;  2P4W A;  1KU3 A;  2F5C A;  3ZMS A;  1IXR C;  2LSO A;  1A04 A;  2XHK A;  2HZT A;  1BOA A;  2W85 A;  3I5U A;  5F1R A;  4HLY A;  2Y48 A;  3FX3 A;  4EJW A;  1KYW A;  1I6X A;  2D1V A;  3I0T A;  5LGN A;  1QZY A;  1ZRF A;  4G6D A;  3RDI A;  1KYZ A;  1O57 A;  2PMH A;  5CVJ A;  4LGW A;  2EV0 A;  2HEO A;  4E70 A;  4WXH A;  1B9N A;  2MLK A;  1PDN C;  2JT1 A;  3BJ6 A;  3JSP A;  4UHT A;  1HW2 A;  3CUO A;  2FEZ A;  3T5X A;  4HF0 A;  1I5Z A;  1SFU A;  1R5G A;  2IA2 A;  3QRF F;  1DPR A;  2TDX A;  1HBX G;  2OQG A;  2ISZ A;  5JR3 A;  1IN5 A;  2QZ8 A;  3E3V A;  4M9Z A;  2OBP A;  4R79 A;  3GFM A;  3GYH X;  2PLY A;  1QO0 D;  2XAQ A;  4CZZ A;  1S7A A;  2CW0 F;  3GFL A;  2MBF A;  3F23 A;  2FU4 A;  2L3D A;  3MQ0 A;  4G7Z F;  3JAM Z;  4BXU A;  2IJL A;  4YFK F;  1IF1 A;  1FBQ A;  4HW0 A;  5FLX Z;  3F8N A;  5D4R A;  4HV6 A;  2XUB A;  3QU3 A;  1MJB A;  3WTT C;  5ICC A;  4ZYE A;  4I2O A;  4KIC A;  1ZHF A;  3F6O A;  4HX7 A;  5FFX A;  1CF7 B;  3KEQ A;  4LB5 A;  1U78 A;  5D6F A;  3H3U A;  1FX7 A;  1P4X A;  1ZAO A;  5AIQ A;  2YX4 A;  5D8L B;  5EEG A;  4UNO A;  4K2E A;  3GZ6 A;  4BQA A;  3DPT A;  5ICG A;  3ZMV A;  2VOP A;  2ACJ A;  4ENJ A;  2VT2 A;  1CF7 A;  1T39 A;  3HRS A;  3Q9S A;  1V4R A;  4U0V A;  4D0P A;  1W7P B;  4JK1 X;  3RI4 A;  3F21 A;  1R58 A;  5KK1 A;  6PAX A;  1BI0 A;  4KYW A;  1JHH A;  2YU3 A;  1J5Y A;  2P5V A;  2DW4 A;  2E1N A;  4HV5 A;  4G7H F;  3CUQ A;  1LDJ A;  1LJ9 A;  2CFX A;  3E5Q A;  4H0E A;  4G6Q A;  2GIV A;  4Y15 A;  2RV8 A;  1W7P A;  2UZK A;  5DD8 A;  4HAM A;  1VTN C;  5CVR A;  1YYV A;  2L01 A;  1R00 A;  5BQT A;  3VOE A;  2QUF A;  2QQ9 A;  5AIP A;  3HYI A;  2YPR A;  1GVJ A;  3N4M A;  1C0W A;  3ECO A;  4IRH A;  3KCC A;  4I7H A;  3QPT A;  3WTS C;  4ESJ A;  3HHH A;  1P2F A;  1K78 A;  1JXS A;  2CWE A;  1HST A;  3BJA A;  2P8T A;  5D5W B;  2G9W A;  4Z2Y A;  2KRF A;  1IUY A;  3KE2 A;  3JTG A;  1XGN A;  3K69 A;  2Q0O A;  3FMS A;  4HX4 A;  4U7B A;  4WF2 A;  5DCF A;  3WGH A;  2JPB A;  4EM1 A;  1RUN A;  3QOP A;  3BPV A;  2VBY A;  2P6T A;  5D8K B;  4KMF A;  5FGM A;  1GXP A;  2Y75 A;  3U2R A;  1FP1 D;  5J8C A;  3WU0 A;  1ONV A;  4S05 A;  3W6K B;  4MEY F;  3HSR A;  4RAY A;  2H27 A;  4HBL A;  4MEX F;  2ETH A;  1IN8 A;  2FNP A;  5CVU A;  1R1T A;  2CO5 A;  2DK5 A;  2IA1 A;  1D8J A;  4QLC U;  1IRF A;  2HR3 A;  4O3M A;  4ZZL A;  2LNB A;  1ZYR F;  1QGP A;  2COM A;  4KIB A;  2W57 A;  4FT8 A;  4CIC A;  4PGH A;  3ROU A;  2RC4 A;  2DT5 A;  4MNU A;  2HWV A;  1BC7 C;  1WSU A;  4RB1 A;  2ADU A;  4ETS A;  3FXR A;  3WE2 A;  5K5O A;  2D2W A;  4I09 A;  5K5R A;  5JI6 A;  4U0Y A;  3QP5 A;  2OZU A;  1OYW A;  3BP8 A;  2FQ3 A;  5KVR A;  4EMS A;  5E17 F;  3N97 A;  1U5T B;  3KP2 A;  1J9I A;  1WKM A;  4I0A A;  1ODD A;  2IPQ X;  3ZPL A;  3RYR A;  3L2C A;  2Y0M A;  2RKH A;  3V7C A;  4EM0 B;  4M71 A;  4A0X A;  1SD4 A;  2QM3 A;  1X3U A;  1FC3 A;  2NS0 A;  2V1D A;  5H6R A;  1UCR A;  1U5T A;  1GXQ A;  3O2P E;  2P7V B;  2M30 A;  2EB7 A;  5K1Y A;  4OIN F;  3ABT A;  3H3Z A;  5HDN A;  4G8X A;  4L5J A;  1LB2 A;  5HDG A;  1JGS A;  4ESF A;  2FXA A;  3KFW X;  2R7D A;  2VBX A;  4ZH4 F;  4NHJ A;  3HSE A;  5LRR A;  2F5F A;  2IRF G;  2RN7 A;  2EFO A;  2DPU A;  4M72 A;  3TKY A;  2GXB A;  3WTX C;  2KKO A;  3TDU C;  1R1U A;  1MGT A;  1XGO A;  3GFI A;  4XBF A;  4HX8 A;  1JE8 A;  3I58 A;  1YO5 C;  3D0S A;  4KIF A;  5L3B A;  1R5H A;  1KGS A;  1YLF A;  2F2E A;  2A68 F;  5BPD A;  4N0B A;  1KQ8 A;  5IT3 A;  1LQ1 A;  1RZ4 A;  3BY6 A;  3TO9 A;  3FM3 A;  4HA8 A;  4YII A;  2XRO A;  3L9F A;  5HLH A;  3DKW A;  1E2X A;  4KNY A;  4RGX A;  4GCV A;  3GEZ A;  2QEN A;  2ZNZ A;  2DQR A;  3HRT A;  1ZRC A;  2K7L A;  4U7D A;  1FNN A;  1R23 A;  2M5W A;  5LHH A;  3E5X A;  2ZFW A;  1R22 A;  2RGV A;  4UUV A;  5HLG A;  1T2K A;  4TV7 A;  4ENN A;  2OD5 A;  3E6D A;  4P9F A;  2HQN A;  3EDP A;  2VOO A;  2R7F A;  4M9S A;  3AAF A;  1D5V A;  3L09 A;  4F7Z A;  1LEB A;  4MTE A;  5CJ9 A;  2BE5 F;  1O7F A;  1OYI A;  3I59 B;  3J81 K;  1RIO H;  1H0M A;  5J8F A;  2FE3 A;  2VT3 A;  3HRU A;  1MD0 A;  2BV6 A;  3FXQ A;  3MZY A;  5HOO A;  3GX4 X;  2E7W A;  4DQ2 A;  2FRH A;  2EV6 A;  1QZZ A;  4BYY A;  4IXA A;  4L9N A;  2V9V A;  4ESB A;  1OMI A;  3K1N A;  1O3T A;  1ULY A;  5DCM B;  3K2Z A;  1O7L A;  2LF7 A;  3P7N A;  1XGS A;  4LLL A;  4P5O A;  4KMU X;  1H9T A;  2L02 A;  4OIQ F;  1I1G A;  4GYG A;  4BAY A;  3P9C A;  3S2W A;  1WI9 A;  1RUO A;  4A5N A;  1T0F A;  5JHU A;  2BEO A;  2ELH A;  5DCM A;  1J75 A;  3R61 A;  1Z7U A;  1XMA A;  4XSX F;  3QAH A;  2V1X A;  3TDZ C;  2EJR A;  2X4H A;  3DFG A;  4CYD A;  2JPC A;  5DUI A;  3TO6 A;  2W84 A;  2IA0 A;  3VOD A;  3M1E A;  5F64 A;  4B8X A;  1FT9 A;  4L0Z B;  1GHC A;  2FBH A;  1MDM B;  1Z1D A;  4N9I A;  2DFI A;  4I02 A;  3CJN A;  3KP7 A;  2IVM A;  3FMQ A;  2L54 A;  2P5K A;  1G3Y A;  3I4P A;  3I71 A;  3BJO A;  3D5L A;  1CGP A;  5CLS A;  2ZCW A;  2ZKZ A;  1R7J A;  3SQN A;  1QBJ A;  5H20 A;  4IHT A;  3KET A;  3ABU A;  3TOB A;  4KN7 X;  4M6X A;  1Y0U A;  3T0Y A;  1MDM A;  2O3F A;  3K0L A;  3ECH A;  3RTR A;  2UXX A;  3KLO A;  4I0B A;  3DF8 A;  1L0O C;  4HQE A;  1EH8 A;  3BDD A;  2G7U A;  3BWG A;  5CVV A;  4A6E A;  2VE8 A;  5LGU A;  3CO7 C;  2DTR A;  1PP8 F;  3LA7 A;  5HS8 A;  2O6G E;  3RJP A;  3SZT A;  1AOY A;  4HDU A;  4KA4 A;  1T6S A;  1G3T A;  5IT9 K;  4UXN A;  3I54 A;  4R8H A;  5JFR A;  2GA2 A;  4ZYG A;  5FD6 A;  3WE3 A;  1SFX A;  3GLX A;  1FBU A;  3R4K A;  4G9Y A;  4M73 A;  3ZMD A;  2V79 A;  2EK5 A;  3IWZ A;  2HTS A;  4HQM A;  3IWF A;  2Z3Y A;  4A0Z A;  2KIM A;  1DPU A;  5TJJ A;  1KQ9 A;  2XGX A;  5D5X B;  3L00 A;  3T8R A;  5BPI A;  4M9X A;  2GAU A;  1IXC A;  3CUQ B;  5E18 F;  2PBI A;  4HDV A;  2O03 A;  4OIO F;  2HOE A;  3EUH A;  5FFZ A;  3IRR A;  3K1P A;  1J59 A;  2ISY A;  1XD7 A;  2L4M A;  4KUM A;  3OV8 A;  1YG2 A;  3MCZ A;  3HOS A;  2Z33 A;  3C3W A;  1IN7 A;  3F8F A;  1ZG3 A;  2CSO A;  1BBY A;  4R1H A;  1DUX C;  2DLL A;  3J80 Z;  2QLZ A;  3CDH A;  2K27 A;  2P5L C;  1TW3 A;  4AWX B;  4EJT A;  5ILV A;  2M1B A;  4WX9 A;  5E8I A;  1EV7 A;  4CHU A;  1ZH5 A;  1ZGA A;  4HZF A;  1K78 B;  2IW5 A;  3BRO A;  3QP6 A;  2H09 A;  3FHZ A;  5CVI A;  3ULQ B;  4ZYD A;  1TLH B;  4MGR A;  1STZ A;  1YIO A;  2WWY A;  2DU9 A;  4A12 A;  1V3F A;  2GQQ A;  1XB4 A;  1LNW A;  4OMZ A;  4IF4 A;  4Q4Z F;  1O3S A;  1K6O A;  1WQ2 A;  5HLI A;  3HSF A;  3E97 A;  2GA1 A;  1DP7 P;  4N9H A;  3DV8 A;  2KIU A;  4KFC A;  2M8E A;  3F22 A;  3B02 A;  3LQQ A;  5E1W A;  3IHU A;  3DEU A;  2XAJ A;  1O3R A;  1F1Z A;  4LLN A;  3GUD A;  3LA3 A;  3C18 A;  2HYF A;  2C6Y A;  1SD6 A;  4MQV A;  5A2Q K;  4WXC A;  1W5S A;  1S3J A;  4WCG A;  2P7C B;  2KJB A;  5E20 A;  3NRV A;  2VN2 A;  3KLN A;  2VE9 A;  2FMY A;  1SFE A;  3IC7 A;  3WTY C;  1FLI A;  2QBY A;  4GYI A;  2ESH A;  2A3S A;  3E5U A;  5HVQ C;  1PP7 U;  2BBY A;  5FO5 A;  3KZY A;  3ZN1 A;  3ZN0 A;  3SHF A;  1UHM A;  1DDN A;  4RGS A;  1UB9 A;  4XRF A;  2A6E F;  4M6Y A;  3E6C C;  1TTY A;  3E6M A;  5L3E A;  2VC0 A;  3F8B A;  1QQI A;  3ML6 A;  4LG0 A;  5J6X A;  3IL2 A;  3TGN A;  2LKP A;  3DPL C;  2RQP A;  2NYX A;  3U1D A;  3EYY A;  4P55 A;  2YR2 A;  2HTJ A;  1U3E M;  1YW9 A;  2ESN A;  4RGR A;  1LVA A;  4GO1 A;  3ZP5 A;  1FOK A;  5K5Q A;  1OPC A;  3CO6 C;  3K1M A;  1FY7 A;  1FWZ A;  3G73 A;  2A6H F;  5AON A;  2EA2 A;  1FSH A;  3CUQ C;  3CLO A;  3PQK A;  1KU7 A;  2HQR A;  3M9A A;  1ZAR A;  4LB6 B;  1NHA A;  2J5P A;  2MD5 A;  3FMR A;  1BJA A;  1I1S A;  1G6N A;  3GO5 A;  3TO7 A;  1B9M A;  1SD7 A;  3ZMT A;  1BM9 A;  5ED4 A;  3WTZ A;  3ERE D;  4IJA A;  5E1X A;  2HYG D;  4LFU A;  1S7O A;  2EWN A;  2XAF A;  2CGP A;  1IAW A;  3JAM K;  3V7R A;  1ZG5 A;  1S29 A;  2M87 A;  4RB3 C;  4KT5 C;  5FLX K;  2FA5 A;  2V1U A;  4UV9 A;  2M45 A;  5L3C A;  1XSD A;  2PG4 A;  1BIA A;  2FML A;  2STT A;  5DUK A;  2DO7 A;  2PEX A;  3QU6 A;  3VEP A;  2H6C A;  4L9J A;  2O8X A;  1IZ1 A;  2XV4 S;  1U2W A;  3GWZ A;  3PQJ A;  2FF4 A;  1PUE E;  1J2X A;  3HIF A;  2QVO A;  1QPM A;  2LF8 A;  4YFN F;  3ELK A;  5EEH A;  1TNS A;  3FZV A;  4XSZ F;  2KIF A;  2BGC A;  4MQ9 F;  2NNN A;  2AXL A;  1FBS A;  3HTS B;  3DXJ F;  2J5O A;  2JRT A;  3HHG A;  4U88 A;  4AIK A;  2MH2 A;  2UWM A;  3L7W A;  5ILS A;  3IKT A;  3BZ6 A;  1IN4 A;  1YS7 A;  3ZMZ A;  4P9U A;  3W6J B;  3LST A;  2DI3 A;  3ZQ7 A;  5LHG A;  1BI1 A;  5FB2 A;  1XCB A;  3FM5 A;  2D1H A;  5D5U B;  3DP7 A;  4I98 B;  4NB5 A;  4EV0 A;  2PQ8 A;  3LFK A;  4KN4 X;  4L9T A;  3I53 A;  1IN6 A;  4RAZ A;  2XAS A;  4PCQ A;  4LK1 F;  5E8G A;  5L3F A;  5ILU A;  1P4A A;  1HQC A;  4O6J A;  2DAO A;  2MC3 A;  2IT0 A;  2XRN A;  4P96 A;  4ENK A;  2BYV E;  1R36 A;  4M74 A;  1HKQ A;  3V8J A;  2OZ6 A;  5D6E A;  3V7S A;  1U5T C;  5LHI A;  2XVC A;  1P4W A;  2MH9 A;  3WGI A;  4HF2 A;  3ISP A;  2OAZ A;  2Z5U A;  3T1B A;  4EJV A;  3MWM A;  1HW1 A;  1IXS B;  2QYO A;  5LEK A;  3TQN A;  1XMK A;  1REP C;  1TQP A;  1WRJ A;  3F8M A;  5BOX A;  1FP2 A;  1YTY A;  1W4M A;  5BS6 A;  3O6B B;  2FBK A;  5BMZ A;  3HUG A;  1ZRE A;  2XAG A;  2WTE A;  2YX7 A;  1ON1 A;  3M8E A;  3NEU A;  5TRD A;  2ZME B;  4A6D A;  2A07 F;  2CQK A;  5ICE A;  2K86 A;  4LD5 A;  1HSJ A;  2ZJ2 A;  4ENM A;  3QPH A;  4ZYH A;  1HW5 A;  2B0L A;  4BH9 A;  4BHB A;  1B59 A;  4LLG F;  5DV5 A;  1HKT A;  3JTH A;  4DNC A;  1UST A;  1BN5 A;  1SMT A;  4Y13 A;  2A5Y B;  2P6S A;  4CGZ A;  2ZME A;  3WTW C;  4IVN A;  3RKX A;  5L3G A;  4ZZD A;  1HKS A;  4MTD A;  1SD5 A;  2GZW A;  4NQW A;  3HOT A;  3DQV C;  2K02 A;  1USS A;  3KP5 A;  4I01 A;  2VC1 A;  4PZJ A;  5HS9 A;  1OYY A;  2UXN A;  3RKW A;  2GXG A;  3PFI A;  2AS5 F;  4L18 B;  4EGZ A;  4L0Y B;  1LDK B;  2R3S A;  4MHG A;  1Z6R A;  1U8R A;  1RNL A;  4BNC A;  1YW7 A;  2ZNY A;  2A69 F;  3GFJ A;  1O3Q A;  3RYP A;  3WG9 A;  2Q2E A;  3RPQ A;  1T38 A;  1FZP B;  1UFM A;  1H9G A;  1LDD A;  1XSV A;  2JZY A;  3FWE A;  1BIB A;  1FYM A;  1IRG A;  1K7A A;  2NNY A;  1EH7 A;  2VBW A;  4HF1 A;  4G7O F;  2FSW A;  2CG4 A;  4YFX F;  3VB2 A;  4IRG A;  3O3K A;  4EVI A;  4UVA A;  2WC2 A;  4AIJ A;  4IPA A;  3CTA A;  3RPU A;  2OA4 A;  1YW8 A;  2EFP A;  2K4J A;  3V8K A;  5ICF A;  1ZLK A;  4L5I A;  4A5M A;  2JSC A;  1ZGJ A;  1P92 A;  1Z6T A;  3E6B A;  1R1V A;  2H6B A;  2QQB A;  4HYE A;  1B6A A;  3HRM A;  5DDG A;  4RB2 C;  2Z9O A;  1RI7 A;  2EFN A;  1OKR A;  3J81 Z;  4ON0 A;  2XAH A;  3B73 A;  1XCV A;  5L3D A;  1Q1H A;  3GXO A;  3Q5F A;  2HGC A;  3LAJ A;  2GWR A;  3V4G A;  1D8K A;  5HDK A;  4RS8 A;  3SZP A;  2DK8 A;  1YS6 A;  1KU9 A;  3GW2 A;  4PDK A;  1B4A A;  3GF2 A;  1IW7 F;  2LDU A;  1B1B A;  4B09 A;  4Q5S F;  3R60 A;  3F8C A;  3R6S A;  5JVT A;  1Z9C A;  2JTV A;  4GGG A;  2XIG A;  2W25 A;  3T8T A;  2PMU A;  1OR7 A;  3WOD F;  1TNT A;  4O5V A;  2H94 A;  2PN6 A;  2QBY B;  5D4S A;  4OOI A;  1Z91 A;  3LAP A;  4GXO A;  2E7X A;  1FYL A;  3P9K A;  1YFH A;  4CO8 A;  1G3W A;  4U0W A;  4JBA A;  2G7H A;  3WTU C;  3REO A;  5DD4 A;  4G94 A;  1D3Y A;  3Q9V A;  3MAJ A;  3H92 A;  5CYV A;  4KIG A;  4OU0 A;  3V8L A;  5LRS A;  4LG0 B;  2FNA A;  1AWC A;  5D5V B;  1ZG1 A;  2OQR A;  2VBZ A;  3MZH A;  1FSE A;  2EA4 A;  1S8N A;  1W5T A;  1TQM A;  2HS5 A;  1U6G A;  4QWQ A;  2ZO4 A;  2QQA A;  4S04 A;  4UV8 A;  2D45 A;  4Y17 A;  3VFZ A;  3TOA A;  4OIP F;  3J7A O;  5ERI A;  3C1D A;  3M8F A;  3WTV C;  3LQR A;  1LEA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...