2YSRA

Solution structure of the dep domain from human dep domain-containing protein 1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
105
structure length
105
Chain Sequence
GSSGSSGYRATKLWNEVTTSFRAGMPLRKHRQHFKKYGNCFTAGEAVDWLYDLLRNNSNFGPEVTRQQTIQLLRKFLKNHVIEDIKGRWGSENVDDNNQLFRFPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords DEP domain-containing protein 1
publication title Solution structure of the DEP domain from human DEP domain-containing protein 1
rcsb
source organism Homo sapiens
total genus 21
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00610 DEP Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ysrA00
1SMYF 2A3SA 4G7ZF 3H92A 1R7JA 1G3SA 1YO5C 2P5LC 1I6XA 3IWFA 4EQQA 4BNCA 1V3FA 4HOBA 2ISYA 2LDUA 3HOTA 1ZYRF 3KEOA 2Y48A 4WXCA 4R1HA 4JK1X 1WQ2A 5EEHA 4HX8A 1BI2A 4EM2A 3B73A 5LEKA 1KU9A 2JPBA 5ICEA 3M9AA 1ZREA 3E6CC 4XSZF 2OAZA 2NRAC 2BYVE 4G9YA 3I59B 3JAMK 1IW7F 2P6SA 1XCVA 4ZYDA 3ZPLA 2O0YA 1G4DA 2IP2A 3ROUA 2DQRA 4U0WA 3T8TA 5CVUA 1JE8A 3J81K 2ESNA 1UB9A 2NNYA 3M8EA 2VC1A 3TGNA 4MNUA 2XVCA 2ELHA 2E1CA 4H0EA 1SD4A 2FMYA 3BROA 1BN5A 2VE8A 1D5VA 3IRRA 2ESHA 1KYWA 4KIFA 4LJZF 4PZJA 2M30A 2P5KA 4WX9A 4A12A 4A6DA 3RIRA 4GCVA 4L0ZB 5DD8A 3LA2A 2ZFWA 2L54A 5IT3A 1ZRDA 4AVPA 1YIOA 3CO6C 3NEUA 1WWXA 4HF2A 1J75A 1JXSA 2FBHA 3IHUA 3HTUA 3MQ0A 3Q9SA 1FYKA 2FQ3A 4RB3C 3K9TA 3ML6A 3KP4A 1RIOH 3WTXC 4G8XA 4IHTA 2Q2EA 2EFQA 1FP2A 2L01A 1BM9A 4BH9A 2BGCA 4IF4A 3I53A 3GZ6A 5BS6A 3ABUA 2FE3A 3QRFF 2O6GE 4IPAA 4EV0A 1QZYA 3ERED 4AWXB 4GO1A 2XROA 3LA3A 1BBYA 3MEXA 1FWZA 4MHGA 1QZZA 2HDCA 5FLXK 4QWQA 4MTEA 1DPRA 1R23A 1RZ4A 3ZMZA 5E18F 4O6JA 1K78B 3HSEA 3KLNA 1B6AA 4EM1A 4PGGA 3ZMDA 3SXYA 2MH9A 3S2WA 3P9KA 5TRDA 1ZG1A 2XUBA 3CO7C 5D4SA 1WRJA 4ZZLA 1TLHB 2AXLA 2EWNA 2HWVA 2LSOA 5A2QK 1MDMB 1K7AA 2ACJA 1KQ8A 5JVTA 4HLXA 2K86A 4QLCU 4KFCA 1G6NA 3FMSA 2WTEA 1ONVA 3E6BA 5D5XB 3DP7A 1X3UA 5LHIA 3CTAA 1R5HA 2HFHA 2O61A 2V9VA 5CVIA 1UCRA 2RKHA 4LMYA 4I7HA 2ZCWA 1F1ZA 1TW3A 3TO9A 1FBQA 4HV6A 1JHHA 4M6YA 4YG2F 4EGYA 2H6BA 2XASA 3L09A 1HSJA 4OIRF 4KMFA 2VE9A 1MGTA 1Z7UA 3CUOA 3ZMVA 3E6DA 1IAWA 4Q47A 1D3YA 5DV5A 3QOPA 3OOPA 3FHZA 3F23A 1U5TB 2EV6A 2EFPA 2LKPA 4ZZDA 2D2WA 1ZLKA 2FOKA 1SD5A 3U1DA 1VTNC 1U5TA 3E5QA 1KU2A 1P4AA 1OYIA 5E17F 2OD5A 1JGSA 2M1BA 4WXHA 4L9JA 4A5NA 1Z91A 1B9MA 2P5VA 4P9UA 4GGGA 4DQ2A 4KIBA 4EVIA 1R22A 2OBPA 4G6DA 1G3TA 2M87A 3IKTA 5D6FA 3HHHA 3I0TA 3WTSC 5LBQA 2JSCA 2W84A 1AOYA 2Q0OA 2DBBA 1YG2A 4L9VA 4EJTA 5BMZA 3DPTA 1T38A 2VXZA 3BZ6A 3WTYC 1SMTA 1OKRA 3NRVA 2BEOA 1IRGA 2EFWA 3KE2A 1LEBA 3HSRA 2EV0A 1YS6A 2QWWA 2IA1A 2QVOA 5L3EA 2ZNZA 3DKWA 2GIVA 4LGWA 1LVAA 3E97A 3R4KA 2GA1A 3IC7A 2C6YA 4RGRA 3D5LA 1IN7A 2KIUA 5DYMA 3KFWX 3F8BA 2V1DA 2MD5A 4LLLA 5E8IA 2ZNYA 2DW4A 3ULQB 4UNOA 1Z6TA 4U88A 1MJ9A 1U2WA 5ED4A 5ICFA 4B8XA 1FX7A 4L0YB 1XN7A 3R0AA 2EJRA 1L3LA 1KQ9A 5AIPA 5E1ZB 1LDKB 5AONA 3RYPA 4BQAA 5KK1A 4RB0A 2YX4A 4M9XA 2UWMA 1IN4A 1FNNA 3C7JA 2RGVA 4YFXF 3GFJA 4XBFA 2YX7A 1BIAA 5F1RA 3F8MA 1J9IA 2CG4A 1J2XA 3CUQB 2BE5F 3F3XA 4M6XA 3ISPA 2MC3A 3WTZA 3K0LA 3CUQA 3QPHA 4HA8A 2DPDA 2HQRA 4RB2C 4R8HA 1LEAA 4O3MA 5D8LB 4L9NA 5DCMB 2P7CB 1XSVA 1FYMA 2W85A 3IWZA 2QUFA 3MWMA 2HR3A 4M74A 5DCMA 5CVRA 1GXPA 3KCCA 1LQ1A 3K69A 3K1NA 4AD9A 4L9TA 4UVAA 3J80K 2HOEA 1KQ0A 5L3CA 4MTDA 5EEGA 3GZ5A 5FD5A 3KP6A 1FZPB 3GLXA 3F72A 2Y75A 2Z5UA 1ZGAA 1ON2A 1U8RA 2NS0A 2VODA 3SHFA 2XHKA 2A69F 4KMUX 1YS7A 4LK0F 2ZKZA 2VC0A 1DUXC 1WKMA 4CYDA 4UVBA 1Z9CA 3KETA 2IT0A 2A6HF 3KLOA 2XAJA 4MQVA 4M71A 4S04A 2QZ8A 2F5FA 2L4AA 2XAFA 1KA8A 3BY6A 4KN7X 5IT9Z 3RJPA 2HTJA 3PQJA 2HTSA 5DCFA 3G73A 3FX3A 2JZYA 1HQCA 3RDIA 1MZBA 1HXDA 1XMAA 4MEXF 1BIBA 2MBFA 2IA2A 4XRFA 4LD5A 1XD7A 1EH8A 3WU0A 4R79A 2EA4A 3U2RA 1IN5A 1HKSA 1ON1A 4EJWA 2MA3A 2V1UA 2CYYA 5ERIA 3E6MA 4I09A 3GVAA 1EH6A 2YSRA 3V7SA 1BC8C 2HQNA 1P6RA 1CF7B 5F6FA 2QLZA 4MEYF 3HSFA 3CDHA 1L0OC 3H3UA 3I54A 1IZ1A 2D45A 2HYFA 2P7VB 5D5VB 1I27A 3P9IA 5HOOA 3I64A 3FF5A 4ON0A 3COAC 2QBYB 3I59A 3ECHA 4OMYA 1HBXG 3EETA 2F5EA 3C18A 5H6QA 4IHSA 2ISZA 4UXNA 3HTSB 3HUGA 2L02A 3O6BB 2JPCA 2XGXA 3FXQA 4ASNA 1ZAOA 4BAYA 1ZLJA 3LQRA 4HLYA 4CO8A 3GFLA 3WTVC 5HLHA 5CVJA 3G3ZA 3LA7A 3EYYA 3R61A 2H09A 1KYZA 1J5YA 4L18B 1T98A 2UXXA 1XGMA 3F22A 1GXQA 2XAHA 1XDSA 3LAPA 2PFBA 4HF0A 5J8FA 4ZYGA 3R6SA 4Z2YA 3DEUA 4I0BA 5D6EA 1LNWA 2OQRA 5J8CA 3GWZA 2FEZA 4UHTA 3Q5FA 2NAZA 3FWEA 5HLIA 2KJCA 3PFIA 1JHFA 3HRSA 1R5GA 1PDNC 4FT8A 1U5TC 1ZGJA 4HZFA 5J6XA 2CWEA 3WE3A 4UV8A 1LDJA 4IJAA 1IXRC 1U3EM 3QU6A 3WTTC 2XKPA 4IRIA 1OR7A 1ZARA 2A07F 2PJPA 1B4AA 4RGUA 1K6OA 4A0XA 2DT5A 5D8KB 4CHUA 3T0YA 2PQ8A 3N97A 4I98B 4LLGF 3H3ZA 4U0YA 2MLKA 3TKYA 3ZP5A 4L5JA 2DFIA 1IF1A 2STWA 4EJUA 4IVNA 2VBYA 3T5XA 1PP8F 2XV4S 1K78A 1YQAA 2STTA 4KT5C 2JRTA 5FO5A 4N9HA 1YW8A 3RI4A 2YPRA 3JTGA 3FMRA 1BOAA 2P4WA 3GW2A 3DPLC 1MDMA 3V4GA 2XRNA 2M45A 1QPMA 2HZTA 1OMIA 4BYYA 3RTRA 3K1MA 3KEQA 1K79A 2GZWA 4EGZA 4B09A 2PG4A 1TQPA 4FHTA 1S6LA 3VOEA 2Z99A 1FC3A 4KN4X 2E7XA 3O2PE 4A2UA 2Z3YA 1SFUA 1TQMA 5LGTA 4U7BA 3WU1B 2X0LA 3QU3A 4A0ZA 3Q9VA 2G9WA 4I0AA 1HW2A 4BHBA 2Y0MA 3BJOA 1T0FA 2NNNA 3KP2A 3REOA 3TQNA 3AAFA 4BXUA 1RI7A 3W6KB 2PBIA 2DPUA 1FY7A 1QQIA 2XIGA 3F8NA 4HDUA 5HLGA 4OIPF 1XGSA 2E1NA 4ZYEA 3LAJA 1S29A 4EMSA 2O8XA 1KU3A 2VBZA 1Z05A 1G3YA 1XMKA 3ECOA 4P55A 2V6CA 2W57A 3JW4A 1HKTA 4D0PA 4I01A 1MKMA 1S7AA 3F8FA 5LEJA 3NQOA 1J7KA 3CJNA 3RPUA 1WSUA 1R00A 1IXCA 2LNBA 1KU7A 2Z33A 1GVJA 2OA4A 2ETHA 2OU2A 5D5WB 1RUOA 2A6EF 2FBIA 4KUMA 2ADUA 2X4HA 5KVRA 4M72A 1MJAA 1QBJA 1MD0A 3RKWA 1P4XA 3VFZA 4XLPF 2ZMEB 3FMQA 3M7GA 2ZXJA 5JFRA 3DQVC 5L3DA 4IRHA 5ILVA 2ZMEA 1UHMA 1MJBA 1UFMA 4EM0B 3TOBA 2RN7A 3TOAA 3JSOA 3ABTA 3BDDA 4PGHA 3RKYA 5FFXA 4ETSA 2DAOA 3HRTA 2QENA 4NQWA 3SZPA 1H0MA 2QM3A 4IRGA 3I5UA 2HS5A 2TDXA 2EFOA 2L3DA 5HDNA 3I71A 1LJ9A 1FPQA 4BHPA 4WF2A 3EDPA 4YIIA 2VOPA 3F6VA 2JT1A 1ZG5A 1I5ZA 2UZKA 2Q8KA 1FT9A 1ZH5A 5FGMA 4HX7A 4NB5A 4L5IA 5L3FA 2OZUA 1B1BA 4RGSA 5CVVA 1J59A 5E8GA 1REPC 1DP7P 2DU9A 1XDUA 2W24A 4JQFA 2MLGA 4XSXF 2RVCA 2CQKA 3DFGA 3E5UA 2EV5A 2FBKA 2IA0A 3GXOA 4FX4A 2DK8A 2DLLA 3L7WA 3ZN1A 1F4KA 4Q48A 5HS9A 5ICGA 1XCBA 1TBXA 3BWGA 2R7DA 2PMUA 4P96A 2GAUA 2H27A 1BI0A 3KP5A 3IKVA 2FNPA 2B0LA 2HEOA 3RPQA 1KGSA 5D4RA 2PEXA 1OYYA 2DQLA 3P9CA 2COMA 3FXRA 4HBLA 2DI3A 1F5TA 1HW1A 4RB1A 1QGPA 2CO5A 1UHWA 5DEQA 3M1EA 4HX4A 2KJBA 4U7DA 2F2EA 3LQQA 2M5WA 1RUNA 2RC4A 2DTRA 1YYVA 1IXSB 5ILSA 2UXNA 4I2OA 1DDNA 2PI0A 1P2FA 1W7PB 2RV8A 2PLYA 1W7PD 4AIJA 4GYIA 1G3WA 3GUDA 4N9IA 4KA4A 3C3WA 4YFKF 1R1UA 5BPDA 1W7PA 3GO5A 3D0SA 1ULYA 1I1GA 5L3GA 3JAMZ 3GYHX 4ENKA 3GFIA 4LG0B 2J5PA 5HDKA 1T39A 3R60A 4NHJA 3L9FA 4LG0A 4OIOF 1XGOA 1SFXA 2XAQA 1OYWA 2P6TA 1W4MA 3J81Z 2JTVA 1YTYA 4KICA 2P8TA 5LRRA 1FP1D 4HYEA 2WWYA 4JBAA 1FSHA 3K2ZA 1TNTA 4OMZA 1SD6A 2GXBA 2K27A 3KZZA 4RGXA 4HF1A 1B9NA 4FX0A 4OU0A 4Y17A 3WODF 4S05A 5E20A 5DUKA 1S8NA 4WWCA 2EB7A 2BV6A 3ZMUA 2V79A 1CF7A 4I02A 6PAXA 3SZTA 4CGZA 3F8CA 1BI3A 1TQIA 1T2KA 3WE2A 1J0RA 3TO6A 2PN6A 2YR2A 2HKOA 1HSTA 2VN2A 1HW5A 2QBYA 4ZYHA 2FNAA 1EV7A 5IT9K 1SD7A 4RAZA 1O3QA 1YW7A 2QQ9A 3BPVA 1P92A 3JTHA 5L3BA 2VBWA 3ZMSA 4CDGA 5K5OA 2HKXA 3T1BA 3QP5A 2D1VA 2FA5A 5FLXZ 3GX4X 4OOIA 3KP3A 3IRQA 5BQTA 4WK8F 3HHGA 4EJVA 3LFKA 3V8JA 2FSWA 1T6SA 1IUYA 3E5XA 1EH7A 1FBSA 3LSTA 5HDGA 5LHGA 5A2QZ 1TTYA 3T8RA 2MH2A 3BJ6A 2XAGA 2A68F 3L00A 4ESBA 3BPXA 4WCGA 5ICCA 5HS7A 2K7LA 4F7ZA 3HOSA 1ZHFA 3FM3A 2IPQX 3P7NA 4A0YA 1Y0UA 4AIKA 1YLFA 2DO7A 2J5OA 1F9NA 1AWCA 3M8FA 4LK1F 5BOXA 4OINF 3ELKA 1ZN2A 2F5DA 4UUVA 2AS5F 2OZ6A 2CW0F 5LLQA 1U78A 5AIQA 2FRHA 4PCQA 4WXDA 2KRFA 1W5SA 1ZG3A 2EFNA 2QYOA 3F21A 2QQBA 4P9FA 3JSPA 2IJLA 4E70A 1O7FA 5K1YA 4ZH4F 3GFMA 4LB6B 2O3FA 1XSDA 2VONA 5LHHA 1O3RA 4KYWA 5ILUA 2KKOA 3TDUC 3C1DA 3LWFA 5FFZA 3BP8A 4KDPA 2KIFA 1FOKA 4ENJA 1Q1HA 1A04A 1ZRFA 3IL2A 3I4PA 1P4WA 4HW0A 2KIMA 3QP6A 4M9SA 3TO7A 4KIGA 1U6GA 1YFHA 1BJAA 4GXOA 2VT3A 3HIFA 4U0VA 2GXGA 4M73A 1E2XA 1W5TA 4XLNF 4PDKA 1H9GA 4K2EA 3WTUC 1ODDA 4N0BA 1FLIA 1O7LA 1PUEE 4MGRA 4G94A 3J7AO 1YW9A 4M9ZA 4HQMA 1GHCA 3WGHA 2ZO4A 2EA2A 3ZMTA 4Q4ZF 2K4JA 3FXUA 3V7RA 4GYGA 2VT2A 5CYVA 2O03A 5HVQC 5JR3A 3VB2A 1HKQA 4Y15A 4LFUA 3EQLF 3I58A 4UV9A 5LRSA 2HGCA 1XSXA 4A5MA 3MZHA 3VEPA 1D8JA 4UVCA 3EYIA 2GQQA 3K1PA 3OV8A 3CUQC 3SQNA 2H94A 2CFXA 3W6JB 3O3KA 4Y13A 5HS8A 2RDPA 5JI6A 3KP7A 1CGPA 1PP7U 2R7FA 2D1HA 3GF2A 3B02A 1FBUA 1XB4A 4AIHA 3ZN0A 1FYLA 1TNSA 1R1VA 1S3JA 1USSA 3DV8A 4KNYA 2E7WA 2K02A 1R36A 3HRUA 1WI9A 3BOQA 3QAHA 2IW5A 4MQ9F 3MZYA 4TV7A 3TDZC 2L4MA 5LGNA 2ZBKA 5FB2A 3RYRA 3QPTA 2XKOA 3MAJA 3BJAA 5CJ9A 3GEZA 2IRFG 1TW2A 5DDGA 5TJJA 1XGNA 3WGGA 2FU4A 2EK5A 2W25A 4IXAA 5DD4A 3N4MA 2DK5A 2NYXA 2FF4A 3RKXA 1OPCA 1QNTA 4HAMA 3WG9A 2CGPA 4ESJA 3U9GA 2A5YB 3FZVA 5D5UB 2CSOA 3PQKA 2V1XA 1H9TA 3J80Z 1Z6RA 3HYIA 1O3SA 3R0JA 4CXFA 3E3VA 4G7OF 2VOOA 5CLSA 1Z1DA 2K4BA 5LGUA 1O3TA 1R58A 5H20A 1IRFA 3DF8A 1DPUA 3WTWC 2QQAA 1BC7C 4RS8A 3KZYA 2ZJ2A 1R1TA 2RNJA 2FXAA 2BBYA 1S7OA 1QO0D 1O57A 3FM5A 1SFEA 1LDDA 4OIQF 2R3SA 3EUHA 3V7CA 3HRMA 1BI1A 4LB5A 2OQGA 1RNLA 3DXJF 2WV0A 5JHUA 4LLNA 5H6RA 4BHCA 4ENMA 1D8KA 4YFNF 2FMLA 4G6QA 4CZZA 2GWRA 3ZQ7A 2HYGD 2RQPA 4YIFA 3V8LA 4P5OA 1B59A 2VBXA 2G7HA 4O5VA 1C0WA 1USTA 5DUIA 3L2CA 5E1WA 1E17A 5K5RA 4ENNA 2A61A 2PMHA 4ESFA 2H6CA 2G7UA 4HV5A 3MCZA 1LB2A 2Z9OA 2LF8A 5BPIA 1SAXA 1ZRCA 1V4RA 2IVMA 4RAYA 2YU3A 4Q5SF 1I1SA 3VODA 1IN6A 3V8KA 4HDVA 2F5CA 4HQEA 3WGIA 5FD6A 5K5QA 3F6OA 2M8EA 5F64A 5E1XA 4CICA 3CLOA 1FSEA 1NHAA 4A6EA 2WC2A 4EJOA 3SFZA 4DNCA 2LF7A 3MFKA 2GA2A 4G7HF 1STZA 1IN8A
chains in the Genus database with same CATH superfamily
1VI0A 1SMYF 2A3SA 2RNGA 1GUUA 3IH2A 4G7ZF 1TZLA 3OYMA 5FLVA 3H92A 1R7JA 1S7EA 1G3SA 1A5JA 1YO5C 2P5LC 3EUKL 2W48A 5C4JJ 1I6XA 4B44A 3IWFA 3OL4A 2DTZA 3ZR8X 2KDZA 2QKLB 4EQQA 2A5WA 3H0GJ 4UB6C 2K9SA 3DBRB 1A36A 3PIOF 4BNCA 2DFHA 1V3FA 1SC7A 1AKHB 4HOBA 2ISYA 2EINH 2LDUA 3HOTA 1ZYRF 3KEOA 2Y48A 5DTDA 4WXCA 4BKXA 4R1HA 1AKHA 4JK1X 1WQ2A 5EEHA 1OLTA 2X9DA 1BI2A 4HX8A 4EM2A 3B73A 1KU9A 2JPBA 5LEKA 5ICEA 2GM4A 2KHMA 3M9AA 2DA7A 5J1RA 1ZREA 3E6CC 4XSZF 2OAZA 2NRAC 3KEYA 4OAZA 2BYVE 3LSKA 4G9YA 2O8KA 3I59B 1UG0A 3JAMK 3HOXJ 2B9SA 2GOMA 1IW7F 2DA5A 1YITI 2P6SA 3A01A 2IS1A 3LOCA 2KRCA 1EJ9A 1XCVA 5DM7F 4ZYDA 2DYRH 2OF7A 3ZPLA 2OTJI 2W7NA 4DYQA 2O0YA 1G4DA 2H8WA 2IP2A 3ROUA 2DQRA 2ID6A 1Y39A 2QKMB 1XS9A 3CCSI 3S2HJ 4U0WA 3T8TA 3OYNA 5CVUA 1JE8A 1D0ZA 3J81K 5HNHA 4XOTA 4G12A 2R7QA 1NTCA 2ESNA 2DMTA 1UB9A 3H5AA 2NNYA 2UV1A 3M8EA 2JK3A 2VC1A 4YEJA 3TGNA 4MNUA 4Y33A 5FLMJ 2XVCA 2ELHA 2ZJQF 3JR9A 2E1CA 1Y1WJ 4A93J 3W3CA 2XSJC 3OYFA 4H0EA 2ID3A 1SD4A 2FMYA 3DKXA 3BROA 1BN5A 2EZLA 2VE8A 1D5VA 3K7AJ 1VQ5I 3IRRA 2ESHA 1KYWA 2W82A 4KIFA 4LJZF 3FBIB 4PZJA 2M30A 2P5KA 2R0QC 4WX9A 1VFCA 3S1MJ 2XGDA 4A12A 4A6DA 2IAIA 3RIRA 3OYHA 4GCVA 4L0ZB 4RLFA 5DD8A 3LA2A 2ZFWA 2L54A 3LFUA 5IT3A 2X85A 1ZRDA 3ZQIA 4AVPA 1YIOA 4PUSA 3CO6C 2OTLI 1XG1A 3NEUA 5IYCJ 3CCVI 1X1DA 2DOEA 2MYSA 1WWXA 2CQ7A 1WJ5A 2HPIA 2XRLA 4HF2A 2M34A 1J75A 1JXSA 2FBHA 3IHUA 4DYCA 1N25A 3HTUA 3AG3H 3MQ0A 2GXAA 3J7ZI 3Q9SA 1U8BA 1P9QC 1FYKA 2FQ3A 4RB3C 2IEKA 3K9TA 5FROA 2Q2EB 2ECCA 3ML6A 4DZJA 2W4SA 2JVHA 3KP4A 3IUOA 2VKDA 1RIOH 3WTXC 4G8XA 4IHTA 2EPFA 2NS8A 2EFQA 2Q2EA 1X1CA 3PSFA 1FP2A 2CQXA 3M8JA 2CQQA 4F91B 2L01A 1BM9A 2I10A 2LFBA 4HSTA 4BH9A 1ETOA 2BGCA 4IF4A 1WHUA 1ETWA 5KHDA 1R4MB 3HKZN 3I53A 3BR5A 3GZ6A 5BS6A 3ABUA 1JKOC 2FE3A 3QRFF 1MMAA 3D5SC 3DTIA 5IP7J 1G59A 3GTJJ 2O6GE 2KRHA 5K7FA 1GLNA 3K4LA 3QWLA 3FXKA 4W1UA 1OCZH 4IPAA 4DGWB 4EV0A 1QZYA 3ERED 3S17J 1NK3P 4AWXB 2DDAA 2V9KA 4GO1A 1WJDA 3LA3A 1BBYA 3MEXA 2XROA 1FWZA 4MHGA 1MBFA 1QZZA 1Z21A 2HDCA 1X4OA 5FLXK 4QWQA 4MTEA 1QVTA 3PSIA 1DPRA 1R23A 1RZ4A 3ZMZA 3DU5A 4BJTA 3LSJA 4O6JA 2R7OA 5E18F 1K78B 3HSEA 2VPLA 3KLNA 1B6AA 4EM1A 1SEUA 5FKOA 1T8IA 2X1EA 4PGGA 3ZMDA 2M9HA 2MH9A 3SXYA 3S2WA 4KJZA 3P9KA 5TRDA 1ZG1A 1MMNA 2XUBA 3CO7C 3JRBA 2R92J 5D4SA 5JLWA 1WRJA 4LOCA 4ZZLA 1TLHB 2AXLA 2EWNA 2ZMEC 4XOPA 2HWVA 1RR8C 3K70D 3ASNH 2LSOA 5A2QK 5C44J 1MDMB 2FX0A 1K7AA 3ERMA 2KPMA 3GMEA 3HZJA 2E19A 3OYEA 2ACJA 5JVTA 1KQ8A 4HLXA 3JREA 2MW8A 1FJLA 2K86A 3FDYA 4QLCU 4KFCA 1G6NA 3FMSA 4NBQA 2EQRA 2CUEA 2WTEA 3A4CA 2LP0A 1ONVA 2QSGX 3E6BA 3L2QA 4CH7A 1Y8QB 3VYRB 5D5XB 3OMYA 1D1BA 3DP7A 3J7YJ 1X3UA 2MGQA 5LHIA 3HOWJ 3A0HC 4XKBA 2V26A 1SVMA 2M4GA 1X19A 3CTAA 5J4YA 1R5HA 4BY1J 2HFHA 4HG2A 2O61A 3PO3J 3OSFA 2V9VA 5CVIA 1UCRA 2RKHA 4LMYA 4I7HA 3JRDA 2ZCWA 2O5RA 1F1ZA 3HJEA 3P5JA 3K4CA 1QHGA 2K9QA 1VQ6I 1TW3A 2JUGA 3TO9A 1FBQA 2DMNA 3DKYA 2LH9A 3ZQLA 3A03A 2ZSHB 4HV6A 1JHHA 4M6YA 5GADJ 4YG2F 4EGYA 4XICA 3DPUA 4NUBA 3HGGA 2H6BA 2VJIA 2XASA 3C2GA 2L7ZA 3L09A 1HSJA 3ZQGA 1AU7A 1ETVA 4OIRF 3ZGKA 2QSHX 4KMFA 2HXIA 2R5YB 3OYLA 2VE9A 1MGTA 1Z7UA 3CUOA 3ZMVA 2HDDA 1MW7A 5F0CA 1JKPC 3E6DA 4ZDPA 3CCYA 4Q47A 1D3YA 1IAWA 5DV5A 3PO2J 3QOPA 3OOPA 3FHZA 1BJZA 5EG0B 2KZVA 3F23A 1V5GA 2EIMH 1U5TB 2EV6A 5LFAA 3L2VA 2EFPA 3ZQCA 2LKPA 1OCRH 4ZZDA 2D2WA 1ZLKA 2FOKA 4B3AA 2VI6A 4QTRA 1SD5A 4NC8A 3U1DA 1VTNC 1U5TA 3E5QA 3AKZA 1KU2A 1H8AC 2P81A 3PM1A 2DCEA 1P4AA 3SEQA 1OYIA 5E17F 3VSLA 4D5FA 2OD5A 2VJ4A 1JGSA 2M1BA 1LE8A 4WXHA 4L9JA 2W00A 3HG9A 4A5NA 1Z91A 2ZB9A 1B9MA 3HB9A 2P5VA 1VQMI 2HVQA 5J1YA 2QCOA 2HI3A 4P9UA 4GGGA 4DQ2A 4KIBA 5GAEJ 1FTTA 3Q0UA 4EVIA 1HLVA 3GTLJ 1R22A 5K7HA 4XM3A 2HVRA 1TT5B 1JUSA 2OBPA 4G6DA 5F0HA 2M4KA 1G3TA 2M87A 3OS0A 4BQNA 5D6FA 2EIJH 3HHHA 4B3XA 3IKTA 3I0TA 3WTSC 4FCYA 5LBQA 2JSCA 2EH3A 2TRTA 5CKTA 2W84A 1AOYA 2Q0OA 2PMZN 3BR0A 2IGOA 1PJRA 2DBBA 2F4MB 1YG2A 4L9VA 4V19K 4IQJA 4EJTA 5BMZA 4IHYA 2XPVA 3DPTA 1T38A 3S2DJ 2VXZA 2JA2A 3BZ6A 3WTYC 1SMTA 1OKRA 3NRVA 3MKWB 2BEOA 1IRGA 2EFWA 2BY3A 1X1PA 2G0EA 4G6TB 1I3QJ 3KE2A 1LEBA 3BT9A 4L5EA 4BBRJ 1SAUA 3HSRA 2EV0A 1YS6A 2QWWA 2IA1A 2QVOA 1MNEA 3OYDA 4IEJA 5L3EA 2ZNZA 3DKWA 2GIVA 4LGWA 2LBFB 3I56I 1LFPA 5IYDJ 1PVEA 3AG4H 4DYRA 1LVAA 2IBDA 3E97A 4B43A 3R4KA 2GA1A 3IC7A 2C6YA 4RGRA 1YRNA 3D5LA 1IG7A 2L9NA 2LKXA 1HF0A 1IN7A 2KIUA 5DYMA 1VQ9I 2WY7Q 3HL2A 3KFWX 1MSEC 3F8BA 2XPWA 4CCLA 4MFDA 3RZDJ 5M5YJ 1GT0C 3LSIA 3FHNA 2V1DA 2MD5A 2QQ8A 4LLLA 5E8IA 1WFXA 5K7ZA 3OYCA 4A3GJ 2ZNYA 2XPUA 4U87A 2ZXHA 2DW4A 1QHHD 3OIPA 2MABA 4Y7NJ 3ULQB 3IH4A 1JTXA 2CW7A 4UNOA 3H36A 2DA2A 3J7AY 1Z0XA 1Z6TA 4U88A 1N78A 1MJ9A 4CUGA 2X48A 3CMEI 1MH3A 2B63J 2CJJA 3G1OA 3BR6A 4PFPA 1U2WA 5ED4A 3U21A 1PUFB 3VSKA 4F93B 3OYGA 2OCCH 5ICFA 5TGTA 4B8XA 3M3YJ 4MFEA 1FX7A 3OIOA 4L0YB 1XN7A 3UR3C 3R0AA 2EJRA 2LLKA 1VQPI 2IGMA 1LFUP 1L3LA 3H3VK 1KQ9A 3OL3A 5FKNA 2LREA 3H9GA 5AIPA 5E1ZB 2Z16A 1LDKB 5AONA 3RYPA 2KFDA 2OCEA 4BQAA 3ABMH 5KK1A 3G1LA 1ZR4A 2JA7J 4RB0A 2YX4A 3CF5F 5BNGA 4M9XA 2UWMA 5IP9J 1IN4A 1RETA 1FNNA 1Y56A 1TC3C 3C7JA 4E6KG 2RGVA 1IV8A 3NWSA 4DZPA 4A3BJ 4YFXF 2Y31A 3ABKH 3CP8A 4DIQA 3GFJA 4ITVA 2LOOA 4XBFA 2YX7A 3BZKA 1X2MA 1BIAA 5F1RA 3F8MA 1J9IA 2CG4A 1V5FA 4XRSA 4HRIA 1J2XA 3CUQB 4D9JA 3OY9A 1H88C 2BE5F 3F3XA 1XTAA 5HLTA 4A3MJ 4M6XA 3HOZJ 3ISPA 2O7OA 4YIRX 2MC3A 3WTZA 3K0LA 3CUQA 3CMMA 1K4TA 3QPHA 4HA8A 2DPDA 4A3CJ 2HQRA 5EYRA 4FE4A 3BG7A 4RB2C 2IS2A 4R8HA 1GV2A 1LEAA 2B7EA 2O9LA 4O3MA 4LIUA 5D8LB 4L9NA 1G2HA 2E60A 3C2BA 5DCMB 2P7CB 1XSVA 3OYKA 1WH7A 3ZRGA 1RESA 2W85A 1FYMA 3K4JA 3IWZA 2QUFA 3MWMA 2HR3A 1R49A 9ANTA 3FK7A 4M74A 5CQEA 5DCMA 2HXOA 5CVRA 1GXPA 3KCCA 1JJ6C 2Y0SA 2Y69H 1LQ1A 3K69A 4ANJA 2DMQA 2ZXWH 4C2TA 3K1NA 3G2BA 2VLAA 4AD9A 5JVGF 4L9TA 4UVAA 3VPRA 2HOEA 3J80K 1KQ0A 4IHWA 5L3CA 4QIWN 4MTDA 5EEGA 3GZ5A 5FD5A 3KP6A 1FZPB 3GLXA 3LMMA 2JQ7A 2X6YA 3F72A 1WJCA 2Y75A 2X6WA 2CV1A 2OV7A 2Z5UA 1ZGAA 2LD5A 1ON2A 1U8RA 3HPHA 2NS0A 2VODA 3SHFA 2XHKA 3DWLE 3VWBA 4I6ZA 2A69F 4KMUX 1YS7A 4LK0F 2ZKZA 2VC0A 1DUXC 1WKMA 3BG6A 4CYDA 4UVBA 1Z9CA 3DTKA 3DBLB 3KETA 2IT0A 2H1LA 2A6HF 1TWHJ 3KLOA 2XAJA 4MQVA 2XSDC 4M71A 4S04A 2QZ8A 2F5FA 2L4AA 2XAFA 1KA8A 3BY6A 4KN7X 2V7FA 5IT9Z 3UNGC 4AU7A 1MMGA 4HPQA 4RBOA 2BOLA 2ZSIB 2VQCA 3RJPA 2VKEA 2HTJA 1WGXA 3PQJA 3LSRA 1POGA 2HTSA 5DCFA 1OQYA 3A0BC 3G73A 1WJEA 2DJNA 3FX3A 2JZYA 1HQCA 3RDIA 2DMUA 1VQ8I 1MZBA 4CCNA 3PIPF 1HXDA 1IJWC 1XMAA 4MEXF 3CJTB 1BIBA 2MBFA 1ZTRA 2IA2A 2WAFA 4XRFA 1MBEA 1ZK8A 2X51A 1FMVA 3I4NJ 4LD5A 2OUMA 1XD7A 5GAHJ 2F6CA 1V5EA 1EH8A 1IC8A 2VQGA 1OJLA 3WU0A 1D0XA 4R79A 2EA4A 3U2RA 1IN5A 3DBHB 1HKSA 4ZYAA 1ON1A 4EJWA 2MA3A 2V1UA 5EEAA 2CYYA 5ERIA 1JGGA 3E6MA 1DGRM 3LSMA 4I09A 2LC2A 1W36D 3GVAA 2N8GA 3PNYA 4M3GA 3SZGA 4UUSB 1EH6A 2YSRA 3V7SA 3RCOA 5DS9A 1BC8C 2HQNA 5EJCA 1P6RA 1CF7B 5F6FA 2QLZA 4MEYF 3HSFA 3CDHA 1L0OC 1ORKA 3C2HA 3H3UA 3BR3A 3I54A 1IZ1A 2D45A 4LITA 2HYFA 2P7VB 3FISA 1I27A 5D5VB 3P9IA 5HOOA 3RZOJ 3I64A 3FF5A 4ON0A 3COAC 2QBYB 3K70C 1MBJA 2OPTA 3HEFA 3I59A 4FASD 2XB0X 2DT7B 5EZGA 3ABLH 3ECHA 4OMYA 4XK4A 1HBXG 3EETA 2F5EA 3HUGB 3C18A 4V2FA 5GTHC 4BL0B 4XORA 5H6QA 4IHSA 2ISZA 3CCLI 4C30A 4UXNA 4ZDOA 2WBMA 3HTSB 3E0JB 3HUGA 2L02A 3O6BB 2JPCA 2E1MC 2XGXA 3FXQA 4ASNA 1ZAOA 1S5LC 1V55H 1ZLJA 4BAYA 3LQRA 4HLYA 4CO8A 3GFLA 2K9LA 3WTVC 5HLHA 1B72B 5CVJA 3G3ZA 1RR7A 4FISA 3LA7A 3EYYA 1BR4A 4NC7A 2L7FP 3TL4X 3R61A 2H09A 1B72A 4E7KA 3D1NI 1IO2A 1KYZA 2EZKA 4BBSJ 1J5YA 4L18B 1T98A 4NC6A 2UXXA 2F48A 2Y9ZA 1XGMA 3F22A 1GXQA 4GFBA 2XAHA 4XNFA 5GPCA 5B66C 4E7LA 4CCKA 1XDSA 3LAPA 2PFBA 2A6TA 4HF0A 5J8FA 4ZYGA 1TWCJ 3R6SA 2M0MA 4Z2YA 3DEUA 2RREA 4I0BA 3CC2I 5D6EA 1LNWA 2XF6A 3B6AA 4II3A 3PUFA 2OQRA 3MKYB 2A05A 5J8CA 3GWZA 2BVMA 2FEZA 2E2IJ 3VYSB 4IZZA 3M07A 4NNJA 2P0WA 1E3OC 4UHTA 3Q5FA 2NAZA 2BHZA 3FWEA 5HLIA 2KJCA 1HC8A 3PFIA 4JYKA 1JHFA 3HRSA 3OWTA 1R5GA 1PDNC 4FT8A 1YIJI 1U5TC 1ZGJA 2V9PA 2HOTA 4B1RA 4HZFA 5J6XA 2CWEA 3WE3A 2H1KA 4UV8A 1LDJA 1W5CC 4IJAA 3KYCB 1IXRC 5J1UA 5TISC 3QU6A 3WTTC 1U3EM 2R7TA 2EIKH 2XKPA 4IRIA 1OR7A 5EF6A 1ZARA 2HPMA 2A07F 2PJPA 1VNDA 2R7SA 1B4AA 4RGUA 1K6OA 1GVDA 4A0XA 2DT5A 5D8KB 4CHUA 1SANA 3CLQA 1F43A 3T0YA 5B1BH 2PQ8A 2VQHA 3N97A 3AG2H 1UELB 4I98B 1BL0A 1DU6A 4LLGF 3H3ZA 4U0YA 2MLKA 5J40A 1ETXA 3HBLA 3TKYA 3HOVJ 1FOXA 1P7JA 3ZP5A 4L5JA 2DFIA 1IF1A 3F0CA 1STZA 4EJUA 2STWA 4IVNA 1GV5A 2VBYA 3T5XA 1MBKA 2FQ4A 1PP8F 5F27A 4BY7J 2XV4S 1K78A 4I76A 1YQAA 3S93A 2MSYA 2STTA 4KT5C 2CQNA 3H9JA 2JRTA 5FO5A 4J00A 2XF5A 4N9HA 1YW8A 3RI4A 2YPRA 3JTGA 1UZCA 3FIWA 3FMRA 2VIXA 2MFZA 2UUZA 1RRJA 1BOAA 2P4WA 3GW2A 2KT0A 4PSWA 3DPLC 1MDMA 3H5NA 5F0FA 1N75A 3V4GA 2XRNA 2M45A 1QPMA 2HZTA 1OMIA 3CDIA 4BYYA 4RLQA 1ITYA 3FXJA 5KNLA 1UMQA 2FJ1A 3AL0C 3K6GA 3RTRA 3K1MA 2EBIA 3KEQA 5FKLA 1K79A 2GZWA 3CP2A 4EGZA 2CUFA 2LKSA 4B09A 3QODA 4E7JA 2KIQA 2PG4A 3WU2C 1ENHA 3ONQA 1TQPA 4F52A 1Y0NA 4FHTA 3ASOH 1S6LA 3SDGA 2QA4I 3VOEA 2Z99A 1FC3A 4KN4X 1I39A 2E7XA 3O2PE 4A2UA 2Z3YA 2WAQA 5FJ8J 3TBIA 1SFUA 2XGCA 3ZQQA 2LY2A 4BACA 1TQMA 5LGTA 3CESA 4U7BA 3SFIA 3WU1B 2X0LA 4E7SA 3CCMI 3QU3A 2LYCA 4A0ZA 5F1JA 5E3NA 3Q9VA 2G9WA 2GOXB 3HC7A 4I0AA 1ZKGA 1HW2A 2VB6A 4BHBA 1J09A 4BE0A 2Y0MA 3BJOA 1QU3A 1T0FA 3K4KA 2NNNA 4E4HA 5E3LA 3KP2A 3REOA 2ELJA 3TQNA 3AAFA 2L2OA 3JCUC 5B1AH 1MNDA 2R5YA 1JT0A 4BXUA 1RI7A 4II2A 1QZEA 2K3PA 4QSHA 3W6KB 2PBIA 2DPUA 1FY7A 1QQIA 2XIGA 4JP0A 1U0JA 1VQ4I 1D0YA 3F8NA 5JLXA 5DM6F 4HDUA 3HOUJ 2DFEA 3TW6A 5HLGA 4OIPF 4RDUA 1XGSA 2JA8J 2E1NA 4ZYEA 3LAJA 1VQ7I 1S29A 2E34A 5EG0A 4EMSA 2O8XA 4AVZA 1KU3A 2VBZA 1BW6A 1Z05A 1G3YA 3EUHC 1XMKA 1ZQ3P 2Y30A 3ECOA 2IGKA 4P55A 2V6CA 1QRYA 3CQZJ 3L2RA 2WB1N 1XPXA 3IP4B 3H1CA 2W57A 2X1DA 4BJ5C 2HQ5A 1N77A 3JW4A 3CC4I 1HKTA 4D0PA 3OYAA 3GTPJ 1Y8RB 2X1CA 1I50J 4HNUA 4I01A 2ZJRF 1MKMA 1S7AA 4AM3A 2QSFX 3F8FA 2L9RA 5LEJA 4FETA 3UKGA 3NQOA 3RPUD 1YJNI 1IRXA 1J7KA 1ZELA 3CJNA 3RPUA 4A3DJ 1WSUA 1R00A 1IXCA 1Z3YA 1ACIA 3QOEA 2LNBA 3GZNB 1KU7A 2Z33A 1GVJA 3HDDA 2OA4A 2ETHA 2OU2A 1FEXA 2JMWA 5J47A 5D5WB 1RUOA 3CD6I 2A6EF 2FBIA 4PSXA 3GCMA 4KUMA 1LKXA 2ADUA 4JOMA 5C3EJ 1A6QA 2X4HA 1K4SA 1E0EA 5KVRA 4M72A 1MJAA 3E7LA 1QBJA 2WB1A 1MD0A 3RKWA 5GP9A 1P4XA 3VFZA 1Z77A 4XLPF 3A2KA 4KT6A 2ZMEB 3FMQA 3M7GA 5HODA 2ZXJA 3I3LA 5JFRA 3DQVC 1DQUA 2WAEA 2WY8Q 3RQIA 3SYTA 2R7VA 1U9OA 3TMOA 3CZ6A 5L3DA 4IRHA 5ILVA 2ZMEA 1UHMA 2LBFA 5EDNA 1MJBA 1UFMA 4EM0B 1FIPA 4XKVA 1WZ2A 1YI2I 1HA8A 3TOBA 3ZOBA 4IL6C 4V2GA 2RN7A 3CDLA 5EGOB 3TOAA 3JSOA 4C3IJ 3ABTA 3BDDA 4NQWB 5CQGA 4W97A 4PGHA 4CCJA 3RKYA 3FK6A 5FFXA 5EGOA 3DLAA 3BR1A 4ETSA 2DAOA 3HGYA 3HRTA 1R6RA 2QENA 4NQWA 3SZPA 1K61A 1H0MA 3KPHA 1YJ9I 3CMAI 1O4XA 2QM3A 2ZXIA 4IRGA 4YELA 3I5UA 2HS5A 2R7RA 2V4JC 1DP3A 2TDXA 2EFOA 3GBGA 3IAM2 2L3DA 4XRMA 4H4KC 5HDNA 3I71A 3O8GA 2MG4A 1LJ9A 1FPQA 3PNVA 2EILH 4BHPA 3CCJI 4WF2A 3EDPA 4YIIA 1DU0A 2VOPA 3CJQB 3F6VA 1PUFA 2DA3A 3SDBA 2JT1A 3TP0A 1ZG5A 1I5ZA 4FE7A 2UZKA 2Q8KA 2NVXJ 1FT9A 3OOUA 5EZHA 1ZH5A 3HOYJ 5FGMA 4HX7A 5FKKA 2DA6A 4NB5A 4L5IA 5L3FA 2DA1A 1UG2A 2LY1A 1D1CA 3BTJA 2OZUA 1B1BA 4RGSA 5CVVA 1J59A 5E8GA 2GBYA 1REPC 4XLAA 4M6VA 4X0GA 1S72I 2R7WA 1DP7P 2DU9A 1XDUA 2ZC2A 4IOAF 2W24A 2Y0SN 1W36C 4JQFA 3OR2C 2MLGA 3CF2A 1SFKA 4XSXF 2RVCA 2CQKA 4BDZA 3DFGA 2KDOA 3E5UA 5GTIC 2EV5A 3OR1C 2FBKA 1KONA 2IA0A 3NAUA 3GXOA 2BY2A 2RQQA 4FX4A 3OS2A 3HPGA 2XDVA 2DK8A 2DLLA 3L7WA 2HOSA 2GIZA 2GLOA 5E3OA 3ZN1A 3TEDA 2AO9A 1F4KA 2FOWA 2JN6A 1SVLA 2JSPA 2ZJPF 3LSPA 4Q48A 2BVLA 5HS9A 5ICGA 1XCBA 3WHBA 2I8DA 1LPQA 4BEHB 1TBXA 3BWGA 4XN3A 2R7DA 2CS3A 2PMUA 3GTKJ 4P96A 1AHDP 2GAUA 2H27A 1BI0A 3FKJA 3KP5A 5F04A 4B48A 3IKVA 4XRSG 2FNPA 4BEHA 2IXSA 4IQ4A 3LSGA 2MD0A 3MN2A 4HNVA 3TP3A 2B0LA 3AFHA 4C2MJ 2HEOA 3RPQA 2RAEA 1KGSA 5D4RA 2PEXA 1GDTA 1OYYA 3MD2A 3H9QA 2DQLA 3P9CA 2COMA 1WJBA 2M0CA 3FXRA 4HBLA 2DI3A 4XL9A 1I3AA 1JTYA 1CQTA 1F5TA 3PNTA 1HW1A 2FD5A 4RB1A 1QGPA 3Q3SA 2CO5A 4JX4A 1UHWA 5DEQA 5KAIC 3M1EA 4HX4A 2KJBA 2M2EA 4CCOA 2F2EA 1IDYA 3LQQA 1EA3A 4U7DA 5GAGJ 2VXDA 3I9V2 3BZCA 1FOWA 2M5WA 1RUNA 5C4XJ 2RC4A 2DTRA 1YYVA 4RMNA 1IXSB 1LVKA 4M3DA 2NOJB 5ILSA 2UXNA 4GDFA 4I2OA 5IPAA 1DDNA 4YRVA 2NS7A 4D1QA 2PI0A 1P2FA 3S1NJ 2K85A 2Y9YA 2BW3B 2BY1A 4FQGA 1WPKA 3TW7A 4A3JJ 1W7PB 1WJFA 2RV8A 2CRGA 2PLYA 1W7PD 4AIJA 4GYIA 1G3WA 1UAAA 2BW3A 3GTOJ 3GUDA 4N9IA 4KA4A 3C3WA 4YFKF 1R1UA 1IRZA 5E3MA 5BPDA 1W7PA 3GO5A 2CW8A 3B6CA 3D0SA 2ECBA 1ULYA 1I1GA 5L3GA 1VZ0A 2HDWA 3JAMZ 3GYHX 4ENKA 3S1QJ 2E36A 4LIVA 2BXYA 3GFIA 1T95A 4LG0B 2J5PA 5HDKA 2K9NA 1T39A 3PUBA 3R60A 3BQZA 2VKHA 4AYBN 4NHJA 2IGNA 4XMYA 3L9FA 3NARA 1JUMA 3KX2A 4LG0A 2XGEA 4OIOF 1XGOA 2M7BA 4N4NB 4CCMA 1SFXA 5IOYA 2XAQA 1OYWA 1UJ8A 3BQYA 2DN0A 2P6TA 2X6OA 1W4MA 3J81Z 2KL4A 2JTVA 5H2FC 1YTYA 1MMSA 4KICA 4BE1A 5IP6A 4IX7A 2P8TA 1MBGA 5M3FJ 1VQKI 5LRRA 1FP1D 3S1RJ 4Z6YA 4HYEA 2WWYA 4PJ0C 3S15J 4JBAA 4A3EJ 4ZTFA 1FSHA 2LR8A 3BTLA 4QPOA 3K2ZA 4XLEA 1TNTA 2L9VA 4OMZA 1SD6A 2GXBA 2FUG2 4XLHA 2K27A 2PX9A 3KZZA 3S16J 1JT6A 2TCTA 4RGXA 3IV5A 1YJWI 4HF1A 1B9NA 4FX0A 4OAYA 4OU0A 4Y17A 2E5ZA 3WODF 1M1EB 5FKMA 1RPWA 4S05A 3BLYA 1ZR2A 4AYBA 5GPAA 5E20A 5DUKA 1S8NA 3OYIA 3CCQI 4WWCA 2HQAA 2EB7A 3BCBA 3IH3A 4AUXA 2BV6A 3ZMUA 2R5ZB 5F08A 2E71A 2IS6A 4UUSA 2V79A 1F36A 2K40A 1CF7A 4I02A 6PAXA 1ETYA 3SZTA 4CGZA 2XF7A 3GLLA 3F8CA 2R5ZA 4PFOA 1BI3A 1W0UA 4E7IA 1TQIA 4UB8C 4C3HJ 1T2KA 1W1WE 3WE2A 2X6XA 1J0RA 3TO6A 2PN6A 2YR2A 2HKOA 4C3JJ 1X3WB 1P7IA 1SFOJ 1HSTA 1NH3A 2VN2A 1YX5A 1HW5A 4XKWA 1MBHA 1R5ID 2K9MA 2QBYA 4Y3OA 4ZYHA 1NG7A 3A01B 5M3MJ 2FNAA 1EV7A 5IT9K 1SD7A 4RAZA 5CPRB 3H35A 3CCUI 3AG1H 4M3BA 4ZJZA 3HXLA 1Y6IA 1O3QA 2DMPA 1YW7A 2QQ9A 3FXLA 3BPVA 3N05A 2JA5J 1P92A 1WH5A 3JTHA 1MSFC 2JA6J 4AC0A 2JVGA 5L3BA 2VBWA 3ZMSA 4CDGA 3BG3A 5B3SH 4PJJA 1VQNI 5K5OA 3BG9A 2CUJA 2HKXA 4X6AJ 1MMDA 3T1BA 3W2WA 3QP5A 2VKVA 2R7UA 1OCOH 4XQFA 3ESWB 2D1VA 2FA5A 3QYBA 2MC4A 3W2VA 3MVPA 4IO9F 1B8IB 4BUPA 4P1WA 3S8PA 5FLXZ 3GX4X 4OOIA 1B8IA 3KP3A 3IRQA 2JRMA 5BQTA 1OISA 4WK8F 1T0FC 3HHGA 4EJVA 3LFKA 1FMWA 3V8JA 2H8RA 2FSWA 1T6SA 3SJMA 2NXNB 1IUYA 3E5XA 1EH7A 1FBSA 3LSTA 5HDGA 5LHGA 4RAFA 3CC7I 1X3ZB 3K4BA 5A2QZ 1TTYA 3G1MA 3CMYA 3T8RA 5IOZA 2MH2A 3QQAA 1W0TA 3BJ6A 3G4SI 2XAGA 1OCTC 2A68F 3OSGA 3L00A 1X58A 4ESBA 3Q0WA 1LUJB 3BPXA 4LG3A 5ICCA 2DDBA 5HS7A 4WCGA 2CH0A 3QPSA 1WI3A 3Q0VA 3GTQJ 2QGUA 2HU9A 2K7LA 4F7ZA 2CUZA 3S3OA 2LTPA 3EUAA 3GTMJ 1RKWA 3M4OJ 3HOSA 4A3KJ 1ZHFA 4KITB 2DOFA 3FM3A 2Z1DA 4BDYA 2IPQX 3P7NA 4Y4RA 4A0YA 1Y0UA 4AIKA 1YLFA 3MKLA 2DO7A 2JWTA 2J5OA 1F9NA 2OJED 5M5XJ 1AWCA 3M8FA 4LK1F 1TWGJ 5BOXA 2KMUA 4OINF 4QPQA 3ELKA 4RM2A 1ZN2A 2EZIA 2F5DA 1FIAA 4CYCB 1YX3A 2CV2A 4JX6A 4UUVA 2COBA 1T56A 3S14J 2AS5F 2OZ6A 1IGNA 4DJAA 3K2AA 2CW0F 5LLQA 4CYCA 5AIQA 2FRHA 3FBNB 4BJ6C 1U78A 4D5CA 4PCQA 3NWTA 3PFYA 1E3HA 4WXDA 2KRFA 4HSRA 1W5SA 2WV1A 1ZG3A 1BOBA 2EFNA 4XIDA 3JRIA 2CFOA 2QYOA 3F21A 1JJ8C 1FOYA 2QQBA 4B47A 1QVUA 2L7MP 2WAQN 3VYUB 2NVQJ 4P9FA 3M1CA 3JSPA 2IJLA 1IV6A 2LK2A 4E70A 2HYJA 1HOMA 5FRMA 1O7FA 2VQLA 5K1YA 3S3MA 3MZ8A 3CCRI 4ZH4F 2ZFUA 5LD2C 2KQRA 3GFMA 2NVYJ 4LB6B 2O3FA 1XSDA 2VONA 5LHHA 4A3IJ 4EEFG 3JRGA 1O3RA 4KYWA 5ILUA 3HKZA 2KKOA 3W6VA 3TDUC 4A69C 3C1DA 3BTCA 3LWFA 5FFZA 3BP8A 4KDPA 2KIFA 1OCPA 1FOKA 2Y2ZA 2BHYA 4ENJA 1ETKA 1Q1HA 1WCMJ 3FXMA 4HEA2 1A04A 4EATA 1ZRFA 4MO7A 5IY5H 2E1MB 4IKFA 2YU9J 2R7XA 4C9YA 1WJAA 4CZCA 2NVTJ 3IL2A 3I4PA 2F5VA 3CCEI 1P4WA 2M3AA 2I5UA 4HW0A 2QEXI 2KIMA 4CA0A 3LSHA 3QP6A 4M9SA 4N4OB 4UUTA 3TO7A 2AHQA 1ERDA 1VQOI 1TWFJ 2D5VA 4KIGA 3LNQA 3U1KA 1U6GA 1XMXA 1A31A 1YFHA 1BJAA 4BXFA 4GXOA 1RKTA 4I99C 3RQ4A 2VT3A 3HIFA 2Z2SB 4U0VA 2M8GX 2GXGA 1PYVA 4M73A 1E2XA 1Y1VJ 3BCAA 1W5TA 2QF7A 4D7NA 4XLNF 3MMYB 5IYBJ 4PDKA 1H9GA 4K2EA 4M3EA 3SEZA 3WTUC 3PL8A 3PJRA 2XAUA 1ODDA 4N0BA 1FLIA 1O7LA 1VF9A 1Z7LA 1PUEE 4MGRA 4G94A 4X1EA 3J7AO 4MLOA 2ME6A 1YW9A 4IOCF 1MNMC 4ZC3A 4M9ZA 4HQMA 1GHCA 2E35A 3WGHA 1BR1A 2ZO4A 2EA2A 3ZMTA 4Q4ZF 2K4JA 1D5YA 3FXUA 3V7RA 4GYGA 4A3FJ 1BW5A 2W1OA 2VT2A 3A02A 5CYVA 2O03A 5HVQC 5JR3A 3VB2A 1HKQA 3GTGJ 5HNFA 3FXOA 4AIDA 1TL8A 2VJJA 2V1NA 3WHCA 4Y15A 4LFUA 3RKQA 3EQLF 2JUCA 3I58A 4UV9A 3L1PA 1HDDC 2DODA 5LRSA 2HGCA 4Y52J 1WVRA 1XSXA 3S32A 3VDXA 4A5MA 3KYLA 3MZHA 3VEPA 2R93J 1D8JA 2DYSH 4UVCA 3EYIA 2GQQA 4FTHA 3K1PA 3OV8A 1UHSA 1Z3XA 3CUQC 3SQNA 2CU7A 2H94A 1LE8B 2AQEA 2CFXA 3W6JB 4CSWA 1E3PA 1VQLI 1EF4A 2L0KA 3BG5A 3F9KA 2YS9A 3O3KA 3FKIJ 3G71I 4Y13A 5HS8A 3MKZA 2RDPA 5JI6A 4PJNA 3KP7A 1CGPA 1PP7U 2R7FA 1KZHA 2D1HA 4XKCA 2BY0A 3GF2A 2AXTC 3B02A 3VYTB 3I4MJ 1FBUA 1TWAJ 1XB4A 2ICWG 3ZN0A 4AIHA 1FYLA 1G8XA 1TNSA 1R1VA 1S3JA 1BR2A 1USSA 3DV8A 4KNYA 2E7WA 4M3FA 1MIJA 3H0DA 2K02A 4BXXJ 1R36A 2IS4A 1MH4A 3HRUA 1APLC 1WI9A 3BOQA 3QAHA 2IW5A 3L2UA 5J4VA 1QA6A 4MIMA 2VL8A 4MQ9F 3DEWA 4DBQA 3MZYA 2L5QA 4TV7A 3TDZC 2L4MA 1YE9A 3KIOA 3IAS2 1LFBA 2HZDA 1AA7A 5LGNA 4RM3A 1A6IA 2ELKA 2ZBKA 3ZQFA 5FB2A 3JRCA 2Q1ZB 1JKQC 3RYRA 1X2NA 3QPTA 3G6EI 1I6HJ 2XKOA 4HNTA 3MAJA 3BJAA 4ZDLA 2L7KA 1YRNB 1ETQA 5CJ9A 1R9TJ 4XLFA 3AL0B 3DTEA 2VJ5A 2VASA 3D5RC 2NVUB 3K4MA 4UY8I 2HNHA 4PJLA 4BQOA 2F4OB 3GEZA 2NOGA 2IRFG 1TW2A 2R7ZJ 5DDGA 1X1AA 1HCRA 1YOVB 4F55A 1XX5A 5TJJA 4OWRB 1XGNA 3WGGA 5B5EC 2FU4A 2EK5A 2DT6A 2W25A 3ZXSA 4IXAA 5DD4A 3N4MA 4IHVA 2BZTA 4D7MA 2DK5A 2NYXA 2FF4A 1A35A 3RKXA 2EZHA 2PMZA 4BE2A 5FRNA 1OPCA 1V54H 3OIQA 1QNTA 4RA2A 4HAMA 3WG9A 2CGPA 2R4GA 4JX5A 2WADA 3JRHA 4ESJA 3U9GA 2A5YB 2CMPA 3FZVA 5KAFC 3K10A 4C2UA 1T33A 3RSNA 4BQQA 3QYEA 4F3QA 5D5UB 3KZIC 2E5NA 2CSOA 3PQKA 3L2WA 2V1XA 1H9TA 3CJRB 1X4PA 3J80Z 1Z6RA 3HYIA 1O3SA 5JHFA 2PJRB 3R0JA 4CXFA 3E3VA 4DBRA 2LY9A 4G7OF 4XN0A 2VOOA 3KYDB 5CLSA 1Z1DA 2K4BA 5LGUA 3BC8A 2PJRA 1O3TA 2VPRA 2K5CA 1R58A 5H20A 1IRFA 3DF8A 1OCCH 1DPUA 4RAGA 3WTWC 2KZGA 2QQAA 1BC7C 4RS8A 3JRFA 1K83J 2JJ7A 2E1OA 4IHXA 2XC7A 3KZYA 1SVOA 1Q1VA 1DGWY 2ZJ2A 2L9SA 3E1SA 2V6EA 4DW6A 1D1AA 1R1TA 4GRIA 2RNJA 2FXAA 3HM5A 2KP6A 2BBYA 1X1BA 5KCMA 1NG6A 1S7OA 2XB5A 3OYJA 2VUMJ 1QO0D 4XR6A 2CV0A 1O57A 3FM5A 2LG4A 3DCFA 1SFEA 1LDDA 4OIQF 2R3SA 3EUHA 1R71A 4BU2A 4DOZA 3V7CA 1JKRC 3HRMA 1IDZA 1BI1A 4XLCA 4S0HB 2DOAA 1IUFA 2DA4A 3BTIA 4LB5A 2OQGA 5M5WJ 1FTZA 4BS9A 1RNLA 2AQFA 3DXJF 1XC5A 5E79C 2WV0A 5JHUA 3DEEA 4LLNA 5H6RA 4BHCA 4ENMA 1D8KA 3WG7H 2FMLA 4G6QA 4YFNF 4J01A 4CZZA 2KLOA 3LL7A 1QPIA 2E2JJ 4PJMA 2GWRA 3ZQ7A 5J3LA 2LVSA 2HYGD 2OC6A 2RQPA 4ZTJA 4YIFA 3V8LA 3V42A 4P5OA 1B59A 1TT0A 1H89C 2VBXA 1Z67A 2G7HA 3H5RA 4O5VA 1C0WA 1EKEA 1USTA 5DUIA 3L2CA 3QYFA 5E1WA 1E17A 5K5RA 2E2HJ 4ENNA 4B4CA 2A61A 4XONA 4KISA 1R4NB 2PMHA 1TP4A 4ESFA 2F4IA 2ME0A 3S3NA 3K4NA 1YHQI 3QPLA 2HVSA 2H6CA 2G7UA 2WA0A 2BXZA 2YUSA 4J19A 4HV5A 3DU6A 1JI8A 3MCZA 3ZCOA 3JRAA 1U9NA 1ZGWA 1LB2A 2Z9OA 4NDLA 2DFFA 2LF8A 5BPIA 1SAXA 1ZRCA 1V4RA 2IVMA 2KISA 4RAYA 3OS1A 2M7AA 4F92B 2YU3A 2DXIA 4Q5SF 3BR2A 1I1SA 3VODA 1K6YA 1IN6A 3V8KA 4HDVA 3O8HA 2F5CA 1S9HA 1HDPA 3OYBA 4A3LJ 3X2QH 4PK4A 4HQEA 3W2AA 3WGIA 1OR7C 1OFCX 2LRDA 3A1YA 5FD6A 3DLLF 1RC9A 1BA5A 3EPZA 2LMDA 3ZQHA 5K5QA 3F6OA 2M8EA 5F64A 5E1XA 4CICA 3CLOA 1FSEA 1NK2P 1T08B 1NHAA 4A6EA 4E7ZA 2WC2A 4EJOA 4BGDA 3SFZA 2K3FA 1JUPA 2LF7A 4ABZA 4DNCA 3I55I 3MFKA 2GA2A 4E7HA 4G7HF 2HOAA 2DJIA 1IN8A
chains in the Genus database with same CATH topology
1SMYF 2A3SA 4G7ZF 3H92A 1R7JA 1G3SA 1YO5C 2P5LC 1I6XA 3IWFA 4EQQA 4BNCA 1V3FA 4HOBA 2ISYA 2LDUA 3HOTA 1ZYRF 3KEOA 2Y48A 4WXCA 4R1HA 4JK1X 1WQ2A 5EEHA 4HX8A 1BI2A 4EM2A 3B73A 5LEKA 1KU9A 2JPBA 5ICEA 3M9AA 1ZREA 3E6CC 4XSZF 2OAZA 2NRAC 2BYVE 4G9YA 3I59B 3JAMK 1IW7F 2P6SA 1XCVA 4ZYDA 3ZPLA 2O0YA 1G4DA 2IP2A 3ROUA 2DQRA 4U0WA 3T8TA 5CVUA 1JE8A 3J81K 2ESNA 1UB9A 2NNYA 3M8EA 2VC1A 3TGNA 4MNUA 2XVCA 2ELHA 2E1CA 4H0EA 1SD4A 2FMYA 3BROA 1BN5A 2VE8A 1D5VA 3IRRA 2ESHA 1KYWA 4KIFA 4LJZF 4PZJA 2M30A 2P5KA 4WX9A 4A12A 4A6DA 3RIRA 4GCVA 4L0ZB 5DD8A 3LA2A 2ZFWA 2L54A 5IT3A 1ZRDA 4AVPA 1YIOA 3CO6C 3NEUA 1WWXA 4HF2A 1J75A 1JXSA 2FBHA 3IHUA 3HTUA 3MQ0A 3Q9SA 1FYKA 2FQ3A 4RB3C 3K9TA 3ML6A 3KP4A 1RIOH 3WTXC 4G8XA 4IHTA 2Q2EA 2EFQA 1FP2A 2L01A 1BM9A 4BH9A 2BGCA 4IF4A 3I53A 3GZ6A 5BS6A 3ABUA 2FE3A 3QRFF 2O6GE 4IPAA 4EV0A 1QZYA 3ERED 4AWXB 4GO1A 2XROA 3LA3A 1BBYA 3MEXA 1FWZA 4MHGA 1QZZA 2HDCA 5FLXK 4QWQA 4MTEA 1DPRA 1R23A 1RZ4A 3ZMZA 5E18F 4O6JA 1K78B 3HSEA 3KLNA 1B6AA 4EM1A 4PGGA 3ZMDA 3SXYA 2MH9A 3S2WA 3P9KA 5TRDA 1ZG1A 2XUBA 3CO7C 5D4SA 1WRJA 4ZZLA 1TLHB 2AXLA 2EWNA 2HWVA 2LSOA 5A2QK 1MDMB 1K7AA 2ACJA 1KQ8A 5JVTA 4HLXA 2K86A 4QLCU 4KFCA 1G6NA 3FMSA 2WTEA 1ONVA 3E6BA 5D5XB 3DP7A 1X3UA 5LHIA 3CTAA 1R5HA 2HFHA 2O61A 2V9VA 5CVIA 1UCRA 2RKHA 4LMYA 4I7HA 2ZCWA 1F1ZA 1TW3A 3TO9A 1FBQA 4HV6A 1JHHA 4M6YA 4YG2F 4EGYA 2H6BA 2XASA 3L09A 1HSJA 4OIRF 4KMFA 2VE9A 1MGTA 1Z7UA 3CUOA 3ZMVA 3E6DA 1IAWA 4Q47A 1D3YA 5DV5A 3QOPA 3OOPA 3FHZA 3F23A 1U5TB 2EV6A 2EFPA 2LKPA 4ZZDA 2D2WA 1ZLKA 2FOKA 1SD5A 3U1DA 1VTNC 1U5TA 3E5QA 1KU2A 1P4AA 1OYIA 5E17F 2OD5A 1JGSA 2M1BA 4WXHA 4L9JA 4A5NA 1Z91A 1B9MA 2P5VA 4P9UA 4GGGA 4DQ2A 4KIBA 4EVIA 1R22A 2OBPA 4G6DA 1G3TA 2M87A 3IKTA 5D6FA 3HHHA 3I0TA 3WTSC 5LBQA 2JSCA 2W84A 1AOYA 2Q0OA 2DBBA 1YG2A 4L9VA 4EJTA 5BMZA 3DPTA 1T38A 2VXZA 3BZ6A 3WTYC 1SMTA 1OKRA 3NRVA 2BEOA 1IRGA 2EFWA 3KE2A 1LEBA 3HSRA 2EV0A 1YS6A 2QWWA 2IA1A 2QVOA 5L3EA 2ZNZA 3DKWA 2GIVA 4LGWA 1LVAA 3E97A 3R4KA 2GA1A 3IC7A 2C6YA 4RGRA 3D5LA 1IN7A 2KIUA 5DYMA 3KFWX 3F8BA 2V1DA 2MD5A 4LLLA 5E8IA 2ZNYA 2DW4A 3ULQB 4UNOA 1Z6TA 4U88A 1MJ9A 1U2WA 5ED4A 5ICFA 4B8XA 1FX7A 4L0YB 1XN7A 3R0AA 2EJRA 1L3LA 1KQ9A 5AIPA 5E1ZB 1LDKB 5AONA 3RYPA 4BQAA 5KK1A 4RB0A 2YX4A 4M9XA 2UWMA 1IN4A 1FNNA 3C7JA 2RGVA 4YFXF 3GFJA 4XBFA 2YX7A 1BIAA 5F1RA 3F8MA 1J9IA 2CG4A 1J2XA 3CUQB 2BE5F 3F3XA 4M6XA 3ISPA 2MC3A 3WTZA 3K0LA 3CUQA 3QPHA 4HA8A 2DPDA 2HQRA 4RB2C 4R8HA 1LEAA 4O3MA 5D8LB 4L9NA 5DCMB 2P7CB 1XSVA 1FYMA 2W85A 3IWZA 2QUFA 3MWMA 2HR3A 4M74A 5DCMA 5CVRA 1GXPA 3KCCA 1LQ1A 3K69A 3K1NA 4AD9A 4L9TA 4UVAA 3J80K 2HOEA 1KQ0A 5L3CA 4MTDA 5EEGA 3GZ5A 5FD5A 3KP6A 1FZPB 3GLXA 3F72A 2Y75A 2Z5UA 1ZGAA 1ON2A 1U8RA 2NS0A 2VODA 3SHFA 2XHKA 2A69F 4KMUX 1YS7A 4LK0F 2ZKZA 2VC0A 1DUXC 1WKMA 4CYDA 4UVBA 1Z9CA 3KETA 2IT0A 2A6HF 3KLOA 2XAJA 4MQVA 4M71A 4S04A 2QZ8A 2F5FA 2L4AA 2XAFA 1KA8A 3BY6A 4KN7X 5IT9Z 3RJPA 2HTJA 3PQJA 2HTSA 5DCFA 3G73A 3FX3A 2JZYA 1HQCA 3RDIA 1MZBA 1HXDA 1XMAA 4MEXF 1BIBA 2MBFA 2IA2A 4XRFA 4LD5A 1XD7A 1EH8A 3WU0A 4R79A 2EA4A 3U2RA 1IN5A 1HKSA 1ON1A 4EJWA 2MA3A 2V1UA 2CYYA 5ERIA 3E6MA 4I09A 3GVAA 1EH6A 2YSRA 3V7SA 1BC8C 2HQNA 1P6RA 1CF7B 5F6FA 2QLZA 4MEYF 3HSFA 3CDHA 1L0OC 3H3UA 3I54A 1IZ1A 2D45A 2HYFA 2P7VB 5D5VB 1I27A 3P9IA 5HOOA 3I64A 3FF5A 4ON0A 3COAC 2QBYB 3I59A 3ECHA 4OMYA 1HBXG 3EETA 2F5EA 3C18A 5H6QA 4IHSA 2ISZA 4UXNA 3HTSB 3HUGA 2L02A 3O6BB 2JPCA 2XGXA 3FXQA 4ASNA 1ZAOA 4BAYA 1ZLJA 3LQRA 4HLYA 4CO8A 3GFLA 3WTVC 5HLHA 5CVJA 3G3ZA 3LA7A 3EYYA 3R61A 2H09A 1KYZA 1J5YA 4L18B 1T98A 2UXXA 1XGMA 3F22A 1GXQA 2XAHA 1XDSA 3LAPA 2PFBA 4HF0A 5J8FA 4ZYGA 3R6SA 4Z2YA 3DEUA 4I0BA 5D6EA 1LNWA 2OQRA 5J8CA 3GWZA 2FEZA 4UHTA 3Q5FA 2NAZA 3FWEA 5HLIA 2KJCA 3PFIA 1JHFA 3HRSA 1R5GA 1PDNC 4FT8A 1U5TC 1ZGJA 4HZFA 5J6XA 2CWEA 3WE3A 4UV8A 1LDJA 4IJAA 1IXRC 1U3EM 3QU6A 3WTTC 2XKPA 4IRIA 1OR7A 1ZARA 2A07F 2PJPA 1B4AA 4RGUA 1K6OA 4A0XA 2DT5A 5D8KB 4CHUA 3T0YA 2PQ8A 3N97A 4I98B 4LLGF 3H3ZA 4U0YA 2MLKA 3TKYA 3ZP5A 4L5JA 2DFIA 1IF1A 2STWA 4EJUA 4IVNA 2VBYA 3T5XA 1PP8F 2XV4S 1K78A 1YQAA 2STTA 4KT5C 2JRTA 5FO5A 4N9HA 1YW8A 3RI4A 2YPRA 3JTGA 3FMRA 1BOAA 2P4WA 3GW2A 3DPLC 1MDMA 3V4GA 2XRNA 2M45A 1QPMA 2HZTA 1OMIA 4BYYA 3RTRA 3K1MA 3KEQA 1K79A 2GZWA 4EGZA 4B09A 2PG4A 1TQPA 4FHTA 1S6LA 3VOEA 2Z99A 1FC3A 4KN4X 2E7XA 3O2PE 4A2UA 2Z3YA 1SFUA 1TQMA 5LGTA 4U7BA 3WU1B 2X0LA 3QU3A 4A0ZA 3Q9VA 2G9WA 4I0AA 1HW2A 4BHBA 2Y0MA 3BJOA 1T0FA 2NNNA 3KP2A 3REOA 3TQNA 3AAFA 4BXUA 1RI7A 3W6KB 2PBIA 2DPUA 1FY7A 1QQIA 2XIGA 3F8NA 4HDUA 5HLGA 4OIPF 1XGSA 2E1NA 4ZYEA 3LAJA 1S29A 4EMSA 2O8XA 1KU3A 2VBZA 1Z05A 1G3YA 1XMKA 3ECOA 4P55A 2V6CA 2W57A 3JW4A 1HKTA 4D0PA 4I01A 1MKMA 1S7AA 3F8FA 5LEJA 3NQOA 1J7KA 3CJNA 3RPUA 1WSUA 1R00A 1IXCA 2LNBA 1KU7A 2Z33A 1GVJA 2OA4A 2ETHA 2OU2A 5D5WB 1RUOA 2A6EF 2FBIA 4KUMA 2ADUA 2X4HA 5KVRA 4M72A 1MJAA 1QBJA 1MD0A 3RKWA 1P4XA 3VFZA 4XLPF 2ZMEB 3FMQA 3M7GA 2ZXJA 5JFRA 3DQVC 5L3DA 4IRHA 5ILVA 2ZMEA 1UHMA 1MJBA 1UFMA 4EM0B 3TOBA 2RN7A 3TOAA 3JSOA 3ABTA 3BDDA 4PGHA 3RKYA 5FFXA 4ETSA 2DAOA 3HRTA 2QENA 4NQWA 3SZPA 1H0MA 2QM3A 4IRGA 3I5UA 2HS5A 2TDXA 2EFOA 2L3DA 5HDNA 3I71A 1LJ9A 1FPQA 4BHPA 4WF2A 3EDPA 4YIIA 2VOPA 3F6VA 2JT1A 1ZG5A 1I5ZA 2UZKA 2Q8KA 1FT9A 1ZH5A 5FGMA 4HX7A 4NB5A 4L5IA 5L3FA 2OZUA 1B1BA 4RGSA 5CVVA 1J59A 5E8GA 1REPC 1DP7P 2DU9A 1XDUA 2W24A 4JQFA 2MLGA 4XSXF 2RVCA 2CQKA 3DFGA 3E5UA 2EV5A 2FBKA 2IA0A 3GXOA 4FX4A 2DK8A 2DLLA 3L7WA 3ZN1A 1F4KA 4Q48A 5HS9A 5ICGA 1XCBA 1TBXA 3BWGA 2R7DA 2PMUA 4P96A 2GAUA 2H27A 1BI0A 3KP5A 3IKVA 2FNPA 2B0LA 2HEOA 3RPQA 1KGSA 5D4RA 2PEXA 1OYYA 2DQLA 3P9CA 2COMA 3FXRA 4HBLA 2DI3A 1F5TA 1HW1A 4RB1A 1QGPA 2CO5A 1UHWA 5DEQA 3M1EA 4HX4A 2KJBA 4U7DA 2F2EA 3LQQA 2M5WA 1RUNA 2RC4A 2DTRA 1YYVA 1IXSB 5ILSA 2UXNA 4I2OA 1DDNA 2PI0A 1P2FA 1W7PB 2RV8A 2PLYA 1W7PD 4AIJA 4GYIA 1G3WA 3GUDA 4N9IA 4KA4A 3C3WA 4YFKF 1R1UA 5BPDA 1W7PA 3GO5A 3D0SA 1ULYA 1I1GA 5L3GA 3JAMZ 3GYHX 4ENKA 3GFIA 4LG0B 2J5PA 5HDKA 1T39A 3R60A 4NHJA 3L9FA 4LG0A 4OIOF 1XGOA 1SFXA 2XAQA 1OYWA 2P6TA 1W4MA 3J81Z 2JTVA 1YTYA 4KICA 2P8TA 5LRRA 1FP1D 4HYEA 2WWYA 4JBAA 1FSHA 3K2ZA 1TNTA 4OMZA 1SD6A 2GXBA 2K27A 3KZZA 4RGXA 4HF1A 1B9NA 4FX0A 4OU0A 4Y17A 3WODF 4S05A 5E20A 5DUKA 1S8NA 4WWCA 2EB7A 2BV6A 3ZMUA 2V79A 1CF7A 4I02A 6PAXA 3SZTA 4CGZA 3F8CA 1BI3A 1TQIA 1T2KA 3WE2A 1J0RA 3TO6A 2PN6A 2YR2A 2HKOA 1HSTA 2VN2A 1HW5A 2QBYA 4ZYHA 2FNAA 1EV7A 5IT9K 1SD7A 4RAZA 1O3QA 1YW7A 2QQ9A 3BPVA 1P92A 3JTHA 5L3BA 2VBWA 3ZMSA 4CDGA 5K5OA 2HKXA 3T1BA 3QP5A 2D1VA 2FA5A 5FLXZ 3GX4X 4OOIA 3KP3A 3IRQA 5BQTA 4WK8F 3HHGA 4EJVA 3LFKA 3V8JA 2FSWA 1T6SA 1IUYA 3E5XA 1EH7A 1FBSA 3LSTA 5HDGA 5LHGA 5A2QZ 1TTYA 3T8RA 2MH2A 3BJ6A 2XAGA 2A68F 3L00A 4ESBA 3BPXA 4WCGA 5ICCA 5HS7A 2K7LA 4F7ZA 3HOSA 1ZHFA 3FM3A 2IPQX 3P7NA 4A0YA 1Y0UA 4AIKA 1YLFA 2DO7A 2J5OA 1F9NA 1AWCA 3M8FA 4LK1F 5BOXA 4OINF 3ELKA 1ZN2A 2F5DA 4UUVA 2AS5F 2OZ6A 2CW0F 5LLQA 1U78A 5AIQA 2FRHA 4PCQA 4WXDA 2KRFA 1W5SA 1ZG3A 2EFNA 2QYOA 3F21A 2QQBA 4P9FA 3JSPA 2IJLA 4E70A 1O7FA 5K1YA 4ZH4F 3GFMA 4LB6B 2O3FA 1XSDA 2VONA 5LHHA 1O3RA 4KYWA 5ILUA 2KKOA 3TDUC 3C1DA 3LWFA 5FFZA 3BP8A 4KDPA 2KIFA 1FOKA 4ENJA 1Q1HA 1A04A 1ZRFA 3IL2A 3I4PA 1P4WA 4HW0A 2KIMA 3QP6A 4M9SA 3TO7A 4KIGA 1U6GA 1YFHA 1BJAA 4GXOA 2VT3A 3HIFA 4U0VA 2GXGA 4M73A 1E2XA 1W5TA 4XLNF 4PDKA 1H9GA 4K2EA 3WTUC 1ODDA 4N0BA 1FLIA 1O7LA 1PUEE 4MGRA 4G94A 3J7AO 1YW9A 4M9ZA 4HQMA 1GHCA 3WGHA 2ZO4A 2EA2A 3ZMTA 4Q4ZF 2K4JA 3FXUA 3V7RA 4GYGA 2VT2A 5CYVA 2O03A 5HVQC 5JR3A 3VB2A 1HKQA 4Y15A 4LFUA 3EQLF 3I58A 4UV9A 5LRSA 2HGCA 1XSXA 4A5MA 3MZHA 3VEPA 1D8JA 4UVCA 3EYIA 2GQQA 3K1PA 3OV8A 3CUQC 3SQNA 2H94A 2CFXA 3W6JB 3O3KA 4Y13A 5HS8A 2RDPA 5JI6A 3KP7A 1CGPA 1PP7U 2R7FA 2D1HA 3GF2A 3B02A 1FBUA 1XB4A 4AIHA 3ZN0A 1FYLA 1TNSA 1R1VA 1S3JA 1USSA 3DV8A 4KNYA 2E7WA 2K02A 1R36A 3HRUA 1WI9A 3BOQA 3QAHA 2IW5A 4MQ9F 3MZYA 4TV7A 3TDZC 2L4MA 5LGNA 2ZBKA 5FB2A 3RYRA 3QPTA 2XKOA 3MAJA 3BJAA 5CJ9A 3GEZA 2IRFG 1TW2A 5DDGA 5TJJA 1XGNA 3WGGA 2FU4A 2EK5A 2W25A 4IXAA 5DD4A 3N4MA 2DK5A 2NYXA 2FF4A 3RKXA 1OPCA 1QNTA 4HAMA 3WG9A 2CGPA 4ESJA 3U9GA 2A5YB 3FZVA 5D5UB 2CSOA 3PQKA 2V1XA 1H9TA 3J80Z 1Z6RA 3HYIA 1O3SA 3R0JA 4CXFA 3E3VA 4G7OF 2VOOA 5CLSA 1Z1DA 2K4BA 5LGUA 1O3TA 1R58A 5H20A 1IRFA 3DF8A 1DPUA 3WTWC 2QQAA 1BC7C 4RS8A 3KZYA 2ZJ2A 1R1TA 2RNJA 2FXAA 2BBYA 1S7OA 1QO0D 1O57A 3FM5A 1SFEA 1LDDA 4OIQF 2R3SA 3EUHA 3V7CA 3HRMA 1BI1A 4LB5A 2OQGA 1RNLA 3DXJF 2WV0A 5JHUA 4LLNA 5H6RA 4BHCA 4ENMA 1D8KA 4YFNF 2FMLA 4G6QA 4CZZA 2GWRA 3ZQ7A 2HYGD 2RQPA 4YIFA 3V8LA 4P5OA 1B59A 2VBXA 2G7HA 4O5VA 1C0WA 1USTA 5DUIA 3L2CA 5E1WA 1E17A 5K5RA 4ENNA 2A61A 2PMHA 4ESFA 2H6CA 2G7UA 4HV5A 3MCZA 1LB2A 2Z9OA 2LF8A 5BPIA 1SAXA 1ZRCA 1V4RA 2IVMA 4RAYA 2YU3A 4Q5SF 1I1SA 3VODA 1IN6A 3V8KA 4HDVA 2F5CA 4HQEA 3WGIA 5FD6A 5K5QA 3F6OA 2M8EA 5F64A 5E1XA 4CICA 3CLOA 1FSEA 1NHAA 4A6EA 2WC2A 4EJOA 3SFZA 4DNCA 2LF7A 3MFKA 2GA2A 4G7HF 1STZA 1IN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SMY F;  2A3S A;  4G7Z F;  3H92 A;  1R7J A;  1G3S A;  1YO5 C;  2P5L C;  1I6X A;  3IWF A;  4EQQ A;  4BNC A;  1V3F A;  4HOB A;  2ISY A;  2LDU A;  3HOT A;  1ZYR F;  3KEO A;  2Y48 A;  4WXC A;  4R1H A;  4JK1 X;  1WQ2 A;  5EEH A;  4HX8 A;  1BI2 A;  4EM2 A;  3B73 A;  5LEK A;  1KU9 A;  2JPB A;  5ICE A;  3M9A A;  1ZRE A;  3E6C C;  4XSZ F;  2OAZ A;  2NRA C;  2BYV E;  4G9Y A;  3I59 B;  3JAM K;  1IW7 F;  2P6S A;  1XCV A;  4ZYD A;  3ZPL A;  2O0Y A;  1G4D A;  2IP2 A;  3ROU A;  2DQR A;  4U0W A;  3T8T A;  5CVU A;  1JE8 A;  3J81 K;  2ESN A;  1UB9 A;  2NNY A;  3M8E A;  2VC1 A;  3TGN A;  4MNU A;  2XVC A;  2ELH A;  2E1C A;  4H0E A;  1SD4 A;  2FMY A;  3BRO A;  1BN5 A;  2VE8 A;  1D5V A;  3IRR A;  2ESH A;  1KYW A;  4KIF A;  4LJZ F;  4PZJ A;  2M30 A;  2P5K A;  4WX9 A;  4A12 A;  4A6D A;  3RIR A;  4GCV A;  4L0Z B;  5DD8 A;  3LA2 A;  2ZFW A;  2L54 A;  5IT3 A;  1ZRD A;  4AVP A;  1YIO A;  3CO6 C;  3NEU A;  1WWX A;  4HF2 A;  1J75 A;  1JXS A;  2FBH A;  3IHU A;  3HTU A;  3MQ0 A;  3Q9S A;  1FYK A;  2FQ3 A;  4RB3 C;  3K9T A;  3ML6 A;  3KP4 A;  1RIO H;  3WTX C;  4G8X A;  4IHT A;  2Q2E A;  2EFQ A;  1FP2 A;  2L01 A;  1BM9 A;  4BH9 A;  2BGC A;  4IF4 A;  3I53 A;  3GZ6 A;  5BS6 A;  3ABU A;  2FE3 A;  3QRF F;  2O6G E;  4IPA A;  4EV0 A;  1QZY A;  3ERE D;  4AWX B;  4GO1 A;  2XRO A;  3LA3 A;  1BBY A;  3MEX A;  1FWZ A;  4MHG A;  1QZZ A;  2HDC A;  5FLX K;  4QWQ A;  4MTE A;  1DPR A;  1R23 A;  1RZ4 A;  3ZMZ A;  5E18 F;  4O6J A;  1K78 B;  3HSE A;  3KLN A;  1B6A A;  4EM1 A;  4PGG A;  3ZMD A;  3SXY A;  2MH9 A;  3S2W A;  3P9K A;  5TRD A;  1ZG1 A;  2XUB A;  3CO7 C;  5D4S A;  1WRJ A;  4ZZL A;  1TLH B;  2AXL A;  2EWN A;  2HWV A;  2LSO A;  5A2Q K;  1MDM B;  1K7A A;  2ACJ A;  1KQ8 A;  5JVT A;  4HLX A;  2K86 A;  4QLC U;  4KFC A;  1G6N A;  3FMS A;  2WTE A;  1ONV A;  3E6B A;  5D5X B;  3DP7 A;  1X3U A;  5LHI A;  3CTA A;  1R5H A;  2HFH A;  2O61 A;  2V9V A;  5CVI A;  1UCR A;  2RKH A;  4LMY A;  4I7H A;  2ZCW A;  1F1Z A;  1TW3 A;  3TO9 A;  1FBQ A;  4HV6 A;  1JHH A;  4M6Y A;  4YG2 F;  4EGY A;  2H6B A;  2XAS A;  3L09 A;  1HSJ A;  4OIR F;  4KMF A;  2VE9 A;  1MGT A;  1Z7U A;  3CUO A;  3ZMV A;  3E6D A;  1IAW A;  4Q47 A;  1D3Y A;  5DV5 A;  3QOP A;  3OOP A;  3FHZ A;  3F23 A;  1U5T B;  2EV6 A;  2EFP A;  2LKP A;  4ZZD A;  2D2W A;  1ZLK A;  2FOK A;  1SD5 A;  3U1D A;  1VTN C;  1U5T A;  3E5Q A;  1KU2 A;  1P4A A;  1OYI A;  5E17 F;  2OD5 A;  1JGS A;  2M1B A;  4WXH A;  4L9J A;  4A5N A;  1Z91 A;  1B9M A;  2P5V A;  4P9U A;  4GGG A;  4DQ2 A;  4KIB A;  4EVI A;  1R22 A;  2OBP A;  4G6D A;  1G3T A;  2M87 A;  3IKT A;  5D6F A;  3HHH A;  3I0T A;  3WTS C;  5LBQ A;  2JSC A;  2W84 A;  1AOY A;  2Q0O A;  2DBB A;  1YG2 A;  4L9V A;  4EJT A;  5BMZ A;  3DPT A;  1T38 A;  2VXZ A;  3BZ6 A;  3WTY C;  1SMT A;  1OKR A;  3NRV A;  2BEO A;  1IRG A;  2EFW A;  3KE2 A;  1LEB A;  3HSR A;  2EV0 A;  1YS6 A;  2QWW A;  2IA1 A;  2QVO A;  5L3E A;  2ZNZ A;  3DKW A;  2GIV A;  4LGW A;  1LVA A;  3E97 A;  3R4K A;  2GA1 A;  3IC7 A;  2C6Y A;  4RGR A;  3D5L A;  1IN7 A;  2KIU A;  5DYM A;  3KFW X;  3F8B A;  2V1D A;  2MD5 A;  4LLL A;  5E8I A;  2ZNY A;  2DW4 A;  3ULQ B;  4UNO A;  1Z6T A;  4U88 A;  1MJ9 A;  1U2W A;  5ED4 A;  5ICF A;  4B8X A;  1FX7 A;  4L0Y B;  1XN7 A;  3R0A A;  2EJR A;  1L3L A;  1KQ9 A;  5AIP A;  5E1Z B;  1LDK B;  5AON A;  3RYP A;  4BQA A;  5KK1 A;  4RB0 A;  2YX4 A;  4M9X A;  2UWM A;  1IN4 A;  1FNN A;  3C7J A;  2RGV A;  4YFX F;  3GFJ A;  4XBF A;  2YX7 A;  1BIA A;  5F1R A;  3F8M A;  1J9I A;  2CG4 A;  1J2X A;  3CUQ B;  2BE5 F;  3F3X A;  4M6X A;  3ISP A;  2MC3 A;  3WTZ A;  3K0L A;  3CUQ A;  3QPH A;  4HA8 A;  2DPD A;  2HQR A;  4RB2 C;  4R8H A;  1LEA A;  4O3M A;  5D8L B;  4L9N A;  5DCM B;  2P7C B;  1XSV A;  1FYM A;  2W85 A;  3IWZ A;  2QUF A;  3MWM A;  2HR3 A;  4M74 A;  5DCM A;  5CVR A;  1GXP A;  3KCC A;  1LQ1 A;  3K69 A;  3K1N A;  4AD9 A;  4L9T A;  4UVA A;  3J80 K;  2HOE A;  1KQ0 A;  5L3C A;  4MTD A;  5EEG A;  3GZ5 A;  5FD5 A;  3KP6 A;  1FZP B;  3GLX A;  3F72 A;  2Y75 A;  2Z5U A;  1ZGA A;  1ON2 A;  1U8R A;  2NS0 A;  2VOD A;  3SHF A;  2XHK A;  2A69 F;  4KMU X;  1YS7 A;  4LK0 F;  2ZKZ A;  2VC0 A;  1DUX C;  1WKM A;  4CYD A;  4UVB A;  1Z9C A;  3KET A;  2IT0 A;  2A6H F;  3KLO A;  2XAJ A;  4MQV A;  4M71 A;  4S04 A;  2QZ8 A;  2F5F A;  2L4A A;  2XAF A;  1KA8 A;  3BY6 A;  4KN7 X;  5IT9 Z;  3RJP A;  2HTJ A;  3PQJ A;  2HTS A;  5DCF A;  3G73 A;  3FX3 A;  2JZY A;  1HQC A;  3RDI A;  1MZB A;  1HXD A;  1XMA A;  4MEX F;  1BIB A;  2MBF A;  2IA2 A;  4XRF A;  4LD5 A;  1XD7 A;  1EH8 A;  3WU0 A;  4R79 A;  2EA4 A;  3U2R A;  1IN5 A;  1HKS A;  1ON1 A;  4EJW A;  2MA3 A;  2V1U A;  2CYY A;  5ERI A;  3E6M A;  4I09 A;  3GVA A;  1EH6 A;  2YSR A;  3V7S A;  1BC8 C;  2HQN A;  1P6R A;  1CF7 B;  5F6F A;  2QLZ A;  4MEY F;  3HSF A;  3CDH A;  1L0O C;  3H3U A;  3I54 A;  1IZ1 A;  2D45 A;  2HYF A;  2P7V B;  5D5V B;  1I27 A;  3P9I A;  5HOO A;  3I64 A;  3FF5 A;  4ON0 A;  3COA C;  2QBY B;  3I59 A;  3ECH A;  4OMY A;  1HBX G;  3EET A;  2F5E A;  3C18 A;  5H6Q A;  4IHS A;  2ISZ A;  4UXN A;  3HTS B;  3HUG A;  2L02 A;  3O6B B;  2JPC A;  2XGX A;  3FXQ A;  4ASN A;  1ZAO A;  4BAY A;  1ZLJ A;  3LQR A;  4HLY A;  4CO8 A;  3GFL A;  3WTV C;  5HLH A;  5CVJ A;  3G3Z A;  3LA7 A;  3EYY A;  3R61 A;  2H09 A;  1KYZ A;  1J5Y A;  4L18 B;  1T98 A;  2UXX A;  1XGM A;  3F22 A;  1GXQ A;  2XAH A;  1XDS A;  3LAP A;  2PFB A;  4HF0 A;  5J8F A;  4ZYG A;  3R6S A;  4Z2Y A;  3DEU A;  4I0B A;  5D6E A;  1LNW A;  2OQR A;  5J8C A;  3GWZ A;  2FEZ A;  4UHT A;  3Q5F A;  2NAZ A;  3FWE A;  5HLI A;  2KJC A;  3PFI A;  1JHF A;  3HRS A;  1R5G A;  1PDN C;  4FT8 A;  1U5T C;  1ZGJ A;  4HZF A;  5J6X A;  2CWE A;  3WE3 A;  4UV8 A;  1LDJ A;  4IJA A;  1IXR C;  1U3E M;  3QU6 A;  3WTT C;  2XKP A;  4IRI A;  1OR7 A;  1ZAR A;  2A07 F;  2PJP A;  1B4A A;  4RGU A;  1K6O A;  4A0X A;  2DT5 A;  5D8K B;  4CHU A;  3T0Y A;  2PQ8 A;  3N97 A;  4I98 B;  4LLG F;  3H3Z A;  4U0Y A;  2MLK A;  3TKY A;  3ZP5 A;  4L5J A;  2DFI A;  1IF1 A;  2STW A;  4EJU A;  4IVN A;  2VBY A;  3T5X A;  1PP8 F;  2XV4 S;  1K78 A;  1YQA A;  2STT A;  4KT5 C;  2JRT A;  5FO5 A;  4N9H A;  1YW8 A;  3RI4 A;  2YPR A;  3JTG A;  3FMR A;  1BOA A;  2P4W A;  3GW2 A;  3DPL C;  1MDM A;  3V4G A;  2XRN A;  2M45 A;  1QPM A;  2HZT A;  1OMI A;  4BYY A;  3RTR A;  3K1M A;  3KEQ A;  1K79 A;  2GZW A;  4EGZ A;  4B09 A;  2PG4 A;  1TQP A;  4FHT A;  1S6L A;  3VOE A;  2Z99 A;  1FC3 A;  4KN4 X;  2E7X A;  3O2P E;  4A2U A;  2Z3Y A;  1SFU A;  1TQM A;  5LGT A;  4U7B A;  3WU1 B;  2X0L A;  3QU3 A;  4A0Z A;  3Q9V A;  2G9W A;  4I0A A;  1HW2 A;  4BHB A;  2Y0M A;  3BJO A;  1T0F A;  2NNN A;  3KP2 A;  3REO A;  3TQN A;  3AAF A;  4BXU A;  1RI7 A;  3W6K B;  2PBI A;  2DPU A;  1FY7 A;  1QQI A;  2XIG A;  3F8N A;  4HDU A;  5HLG A;  4OIP F;  1XGS A;  2E1N A;  4ZYE A;  3LAJ A;  1S29 A;  4EMS A;  2O8X A;  1KU3 A;  2VBZ A;  1Z05 A;  1G3Y A;  1XMK A;  3ECO A;  4P55 A;  2V6C A;  2W57 A;  3JW4 A;  1HKT A;  4D0P A;  4I01 A;  1MKM A;  1S7A A;  3F8F A;  5LEJ A;  3NQO A;  1J7K A;  3CJN A;  3RPU A;  1WSU A;  1R00 A;  1IXC A;  2LNB A;  1KU7 A;  2Z33 A;  1GVJ A;  2OA4 A;  2ETH A;  2OU2 A;  5D5W B;  1RUO A;  2A6E F;  2FBI A;  4KUM A;  2ADU A;  2X4H A;  5KVR A;  4M72 A;  1MJA A;  1QBJ A;  1MD0 A;  3RKW A;  1P4X A;  3VFZ A;  4XLP F;  2ZME B;  3FMQ A;  3M7G A;  2ZXJ A;  5JFR A;  3DQV C;  5L3D A;  4IRH A;  5ILV A;  2ZME A;  1UHM A;  1MJB A;  1UFM A;  4EM0 B;  3TOB A;  2RN7 A;  3TOA A;  3JSO A;  3ABT A;  3BDD A;  4PGH A;  3RKY A;  5FFX A;  4ETS A;  2DAO A;  3HRT A;  2QEN A;  4NQW A;  3SZP A;  1H0M A;  2QM3 A;  4IRG A;  3I5U A;  2HS5 A;  2TDX A;  2EFO A;  2L3D A;  5HDN A;  3I71 A;  1LJ9 A;  1FPQ A;  4BHP A;  4WF2 A;  3EDP A;  4YII A;  2VOP A;  3F6V A;  2JT1 A;  1ZG5 A;  1I5Z A;  2UZK A;  2Q8K A;  1FT9 A;  1ZH5 A;  5FGM A;  4HX7 A;  4NB5 A;  4L5I A;  5L3F A;  2OZU A;  1B1B A;  4RGS A;  5CVV A;  1J59 A;  5E8G A;  1REP C;  1DP7 P;  2DU9 A;  1XDU A;  2W24 A;  4JQF A;  2MLG A;  4XSX F;  2RVC A;  2CQK A;  3DFG A;  3E5U A;  2EV5 A;  2FBK A;  2IA0 A;  3GXO A;  4FX4 A;  2DK8 A;  2DLL A;  3L7W A;  3ZN1 A;  1F4K A;  4Q48 A;  5HS9 A;  5ICG A;  1XCB A;  1TBX A;  3BWG A;  2R7D A;  2PMU A;  4P96 A;  2GAU A;  2H27 A;  1BI0 A;  3KP5 A;  3IKV A;  2FNP A;  2B0L A;  2HEO A;  3RPQ A;  1KGS A;  5D4R A;  2PEX A;  1OYY A;  2DQL A;  3P9C A;  2COM A;  3FXR A;  4HBL A;  2DI3 A;  1F5T A;  1HW1 A;  4RB1 A;  1QGP A;  2CO5 A;  1UHW A;  5DEQ A;  3M1E A;  4HX4 A;  2KJB A;  4U7D A;  2F2E A;  3LQQ A;  2M5W A;  1RUN A;  2RC4 A;  2DTR A;  1YYV A;  1IXS B;  5ILS A;  2UXN A;  4I2O A;  1DDN A;  2PI0 A;  1P2F A;  1W7P B;  2RV8 A;  2PLY A;  1W7P D;  4AIJ A;  4GYI A;  1G3W A;  3GUD A;  4N9I A;  4KA4 A;  3C3W A;  4YFK F;  1R1U A;  5BPD A;  1W7P A;  3GO5 A;  3D0S A;  1ULY A;  1I1G A;  5L3G A;  3JAM Z;  3GYH X;  4ENK A;  3GFI A;  4LG0 B;  2J5P A;  5HDK A;  1T39 A;  3R60 A;  4NHJ A;  3L9F A;  4LG0 A;  4OIO F;  1XGO A;  1SFX A;  2XAQ A;  1OYW A;  2P6T A;  1W4M A;  3J81 Z;  2JTV A;  1YTY A;  4KIC A;  2P8T A;  5LRR A;  1FP1 D;  4HYE A;  2WWY A;  4JBA A;  1FSH A;  3K2Z A;  1TNT A;  4OMZ A;  1SD6 A;  2GXB A;  2K27 A;  3KZZ A;  4RGX A;  4HF1 A;  1B9N A;  4FX0 A;  4OU0 A;  4Y17 A;  3WOD F;  4S05 A;  5E20 A;  5DUK A;  1S8N A;  4WWC A;  2EB7 A;  2BV6 A;  3ZMU A;  2V79 A;  1CF7 A;  4I02 A;  6PAX A;  3SZT A;  4CGZ A;  3F8C A;  1BI3 A;  1TQI A;  1T2K A;  3WE2 A;  1J0R A;  3TO6 A;  2PN6 A;  2YR2 A;  2HKO A;  1HST A;  2VN2 A;  1HW5 A;  2QBY A;  4ZYH A;  2FNA A;  1EV7 A;  5IT9 K;  1SD7 A;  4RAZ A;  1O3Q A;  1YW7 A;  2QQ9 A;  3BPV A;  1P92 A;  3JTH A;  5L3B A;  2VBW A;  3ZMS A;  4CDG A;  5K5O A;  2HKX A;  3T1B A;  3QP5 A;  2D1V A;  2FA5 A;  5FLX Z;  3GX4 X;  4OOI A;  3KP3 A;  3IRQ A;  5BQT A;  4WK8 F;  3HHG A;  4EJV A;  3LFK A;  3V8J A;  2FSW A;  1T6S A;  1IUY A;  3E5X A;  1EH7 A;  1FBS A;  3LST A;  5HDG A;  5LHG A;  5A2Q Z;  1TTY A;  3T8R A;  2MH2 A;  3BJ6 A;  2XAG A;  2A68 F;  3L00 A;  4ESB A;  3BPX A;  4WCG A;  5ICC A;  5HS7 A;  2K7L A;  4F7Z A;  3HOS A;  1ZHF A;  3FM3 A;  2IPQ X;  3P7N A;  4A0Y A;  1Y0U A;  4AIK A;  1YLF A;  2DO7 A;  2J5O A;  1F9N A;  1AWC A;  3M8F A;  4LK1 F;  5BOX A;  4OIN F;  3ELK A;  1ZN2 A;  2F5D A;  4UUV A;  2AS5 F;  2OZ6 A;  2CW0 F;  5LLQ A;  1U78 A;  5AIQ A;  2FRH A;  4PCQ A;  4WXD A;  2KRF A;  1W5S A;  1ZG3 A;  2EFN A;  2QYO A;  3F21 A;  2QQB A;  4P9F A;  3JSP A;  2IJL A;  4E70 A;  1O7F A;  5K1Y A;  4ZH4 F;  3GFM A;  4LB6 B;  2O3F A;  1XSD A;  2VON A;  5LHH A;  1O3R A;  4KYW A;  5ILU A;  2KKO A;  3TDU C;  3C1D A;  3LWF A;  5FFZ A;  3BP8 A;  4KDP A;  2KIF A;  1FOK A;  4ENJ A;  1Q1H A;  1A04 A;  1ZRF A;  3IL2 A;  3I4P A;  1P4W A;  4HW0 A;  2KIM A;  3QP6 A;  4M9S A;  3TO7 A;  4KIG A;  1U6G A;  1YFH A;  1BJA A;  4GXO A;  2VT3 A;  3HIF A;  4U0V A;  2GXG A;  4M73 A;  1E2X A;  1W5T A;  4XLN F;  4PDK A;  1H9G A;  4K2E A;  3WTU C;  1ODD A;  4N0B A;  1FLI A;  1O7L A;  1PUE E;  4MGR A;  4G94 A;  3J7A O;  1YW9 A;  4M9Z A;  4HQM A;  1GHC A;  3WGH A;  2ZO4 A;  2EA2 A;  3ZMT A;  4Q4Z F;  2K4J A;  3FXU A;  3V7R A;  4GYG A;  2VT2 A;  5CYV A;  2O03 A;  5HVQ C;  5JR3 A;  3VB2 A;  1HKQ A;  4Y15 A;  4LFU A;  3EQL F;  3I58 A;  4UV9 A;  5LRS A;  2HGC A;  1XSX A;  4A5M A;  3MZH A;  3VEP A;  1D8J A;  4UVC A;  3EYI A;  2GQQ A;  3K1P A;  3OV8 A;  3CUQ C;  3SQN A;  2H94 A;  2CFX A;  3W6J B;  3O3K A;  4Y13 A;  5HS8 A;  2RDP A;  5JI6 A;  3KP7 A;  1CGP A;  1PP7 U;  2R7F A;  2D1H A;  3GF2 A;  3B02 A;  1FBU A;  1XB4 A;  4AIH A;  3ZN0 A;  1FYL A;  1TNS A;  1R1V A;  1S3J A;  1USS A;  3DV8 A;  4KNY A;  2E7W A;  2K02 A;  1R36 A;  3HRU A;  1WI9 A;  3BOQ A;  3QAH A;  2IW5 A;  4MQ9 F;  3MZY A;  4TV7 A;  3TDZ C;  2L4M A;  5LGN A;  2ZBK A;  5FB2 A;  3RYR A;  3QPT A;  2XKO A;  3MAJ A;  3BJA A;  5CJ9 A;  3GEZ A;  2IRF G;  1TW2 A;  5DDG A;  5TJJ A;  1XGN A;  3WGG A;  2FU4 A;  2EK5 A;  2W25 A;  4IXA A;  5DD4 A;  3N4M A;  2DK5 A;  2NYX A;  2FF4 A;  3RKX A;  1OPC A;  1QNT A;  4HAM A;  3WG9 A;  2CGP A;  4ESJ A;  3U9G A;  2A5Y B;  3FZV A;  5D5U B;  2CSO A;  3PQK A;  2V1X A;  1H9T A;  3J80 Z;  1Z6R A;  3HYI A;  1O3S A;  3R0J A;  4CXF A;  3E3V A;  4G7O F;  2VOO A;  5CLS A;  1Z1D A;  2K4B A;  5LGU A;  1O3T A;  1R58 A;  5H20 A;  1IRF A;  3DF8 A;  1DPU A;  3WTW C;  2QQA A;  1BC7 C;  4RS8 A;  3KZY A;  2ZJ2 A;  1R1T A;  2RNJ A;  2FXA A;  2BBY A;  1S7O A;  1QO0 D;  1O57 A;  3FM5 A;  1SFE A;  1LDD A;  4OIQ F;  2R3S A;  3EUH A;  3V7C A;  3HRM A;  1BI1 A;  4LB5 A;  2OQG A;  1RNL A;  3DXJ F;  2WV0 A;  5JHU A;  4LLN A;  5H6R A;  4BHC A;  4ENM A;  1D8K A;  4YFN F;  2FML A;  4G6Q A;  4CZZ A;  2GWR A;  3ZQ7 A;  2HYG D;  2RQP A;  4YIF A;  3V8L A;  4P5O A;  1B59 A;  2VBX A;  2G7H A;  4O5V A;  1C0W A;  1UST A;  5DUI A;  3L2C A;  5E1W A;  1E17 A;  5K5R A;  4ENN A;  2A61 A;  2PMH A;  4ESF A;  2H6C A;  2G7U A;  4HV5 A;  3MCZ A;  1LB2 A;  2Z9O A;  2LF8 A;  5BPI A;  1SAX A;  1ZRC A;  1V4R A;  2IVM A;  4RAY A;  2YU3 A;  4Q5S F;  1I1S A;  3VOD A;  1IN6 A;  3V8K A;  4HDV A;  2F5C A;  4HQE A;  3WGI A;  5FD6 A;  5K5Q A;  3F6O A;  2M8E A;  5F64 A;  5E1X A;  4CIC A;  3CLO A;  1FSE A;  1NHA A;  4A6E A;  2WC2 A;  4EJO A;  3SFZ A;  4DNC A;  2LF7 A;  3MFK A;  2GA2 A;  4G7H F;  1STZ A;  1IN8 A; 
#chains in the Genus database with same CATH topology
 1VI0 A;  1SMY F;  2A3S A;  2RNG A;  1GUU A;  3IH2 A;  4G7Z F;  1TZL A;  3OYM A;  5FLV A;  3H92 A;  1R7J A;  1S7E A;  1G3S A;  1A5J A;  1YO5 C;  2P5L C;  3EUK L;  2W48 A;  5C4J J;  1I6X A;  4B44 A;  3IWF A;  3OL4 A;  2DTZ A;  3ZR8 X;  2KDZ A;  2QKL B;  4EQQ A;  2A5W A;  3H0G J;  4UB6 C;  2K9S A;  3DBR B;  1A36 A;  3PIO F;  4BNC A;  2DFH A;  1V3F A;  1SC7 A;  1AKH B;  4HOB A;  2ISY A;  2EIN H;  2LDU A;  3HOT A;  1ZYR F;  3KEO A;  2Y48 A;  5DTD A;  4WXC A;  4BKX A;  4R1H A;  1AKH A;  4JK1 X;  1WQ2 A;  5EEH A;  1OLT A;  2X9D A;  1BI2 A;  4HX8 A;  4EM2 A;  3B73 A;  1KU9 A;  2JPB A;  5LEK A;  5ICE A;  2GM4 A;  2KHM A;  3M9A A;  2DA7 A;  5J1R A;  1ZRE A;  3E6C C;  4XSZ F;  2OAZ A;  2NRA C;  3KEY A;  4OAZ A;  2BYV E;  3LSK A;  4G9Y A;  2O8K A;  3I59 B;  1UG0 A;  3JAM K;  3HOX J;  2B9S A;  2GOM A;  1IW7 F;  2DA5 A;  1YIT I;  2P6S A;  3A01 A;  2IS1 A;  3LOC A;  2KRC A;  1EJ9 A;  1XCV A;  5DM7 F;  4ZYD A;  2DYR H;  2OF7 A;  3ZPL A;  2OTJ I;  2W7N A;  4DYQ A;  2O0Y A;  1G4D A;  2H8W A;  2IP2 A;  3ROU A;  2DQR A;  2ID6 A;  1Y39 A;  2QKM B;  1XS9 A;  3CCS I;  3S2H J;  4U0W A;  3T8T A;  3OYN A;  5CVU A;  1JE8 A;  1D0Z A;  3J81 K;  5HNH A;  4XOT A;  4G12 A;  2R7Q A;  1NTC A;  2ESN A;  2DMT A;  1UB9 A;  3H5A A;  2NNY A;  2UV1 A;  3M8E A;  2JK3 A;  2VC1 A;  4YEJ A;  3TGN A;  4MNU A;  4Y33 A;  5FLM J;  2XVC A;  2ELH A;  2ZJQ F;  3JR9 A;  2E1C A;  1Y1W J;  4A93 J;  3W3C A;  2XSJ C;  3OYF A;  4H0E A;  2ID3 A;  1SD4 A;  2FMY A;  3DKX A;  3BRO A;  1BN5 A;  2EZL A;  2VE8 A;  1D5V A;  3K7A J;  1VQ5 I;  3IRR A;  2ESH A;  1KYW A;  2W82 A;  4KIF A;  4LJZ F;  3FBI B;  4PZJ A;  2M30 A;  2P5K A;  2R0Q C;  4WX9 A;  1VFC A;  3S1M J;  2XGD A;  4A12 A;  4A6D A;  2IAI A;  3RIR A;  3OYH A;  4GCV A;  4L0Z B;  4RLF A;  5DD8 A;  3LA2 A;  2ZFW A;  2L54 A;  3LFU A;  5IT3 A;  2X85 A;  1ZRD A;  3ZQI A;  4AVP A;  1YIO A;  4PUS A;  3CO6 C;  2OTL I;  1XG1 A;  3NEU A;  5IYC J;  3CCV I;  1X1D A;  2DOE A;  2MYS A;  1WWX A;  2CQ7 A;  1WJ5 A;  2HPI A;  2XRL A;  4HF2 A;  2M34 A;  1J75 A;  1JXS A;  2FBH A;  3IHU A;  4DYC A;  1N25 A;  3HTU A;  3AG3 H;  3MQ0 A;  2GXA A;  3J7Z I;  3Q9S A;  1U8B A;  1P9Q C;  1FYK A;  2FQ3 A;  4RB3 C;  2IEK A;  3K9T A;  5FRO A;  2Q2E B;  2ECC A;  3ML6 A;  4DZJ A;  2W4S A;  2JVH A;  3KP4 A;  3IUO A;  2VKD A;  1RIO H;  3WTX C;  4G8X A;  4IHT A;  2EPF A;  2NS8 A;  2EFQ A;  2Q2E A;  1X1C A;  3PSF A;  1FP2 A;  2CQX A;  3M8J A;  2CQQ A;  4F91 B;  2L01 A;  1BM9 A;  2I10 A;  2LFB A;  4HST A;  4BH9 A;  1ETO A;  2BGC A;  4IF4 A;  1WHU A;  1ETW A;  5KHD A;  1R4M B;  3HKZ N;  3I53 A;  3BR5 A;  3GZ6 A;  5BS6 A;  3ABU A;  1JKO C;  2FE3 A;  3QRF F;  1MMA A;  3D5S C;  3DTI A;  5IP7 J;  1G59 A;  3GTJ J;  2O6G E;  2KRH A;  5K7F A;  1GLN A;  3K4L A;  3QWL A;  3FXK A;  4W1U A;  1OCZ H;  4IPA A;  4DGW B;  4EV0 A;  1QZY A;  3ERE D;  3S17 J;  1NK3 P;  4AWX B;  2DDA A;  2V9K A;  4GO1 A;  1WJD A;  3LA3 A;  1BBY A;  3MEX A;  2XRO A;  1FWZ A;  4MHG A;  1MBF A;  1QZZ A;  1Z21 A;  2HDC A;  1X4O A;  5FLX K;  4QWQ A;  4MTE A;  1QVT A;  3PSI A;  1DPR A;  1R23 A;  1RZ4 A;  3ZMZ A;  3DU5 A;  4BJT A;  3LSJ A;  4O6J A;  2R7O A;  5E18 F;  1K78 B;  3HSE A;  2VPL A;  3KLN A;  1B6A A;  4EM1 A;  1SEU A;  5FKO A;  1T8I A;  2X1E A;  4PGG A;  3ZMD A;  2M9H A;  2MH9 A;  3SXY A;  3S2W A;  4KJZ A;  3P9K A;  5TRD A;  1ZG1 A;  1MMN A;  2XUB A;  3CO7 C;  3JRB A;  2R92 J;  5D4S A;  5JLW A;  1WRJ A;  4LOC A;  4ZZL A;  1TLH B;  2AXL A;  2EWN A;  2ZME C;  4XOP A;  2HWV A;  1RR8 C;  3K70 D;  3ASN H;  2LSO A;  5A2Q K;  5C44 J;  1MDM B;  2FX0 A;  1K7A A;  3ERM A;  2KPM A;  3GME A;  3HZJ A;  2E19 A;  3OYE A;  2ACJ A;  5JVT A;  1KQ8 A;  4HLX A;  3JRE A;  2MW8 A;  1FJL A;  2K86 A;  3FDY A;  4QLC U;  4KFC A;  1G6N A;  3FMS A;  4NBQ A;  2EQR A;  2CUE A;  2WTE A;  3A4C A;  2LP0 A;  1ONV A;  2QSG X;  3E6B A;  3L2Q A;  4CH7 A;  1Y8Q B;  3VYR B;  5D5X B;  3OMY A;  1D1B A;  3DP7 A;  3J7Y J;  1X3U A;  2MGQ A;  5LHI A;  3HOW J;  3A0H C;  4XKB A;  2V26 A;  1SVM A;  2M4G A;  1X19 A;  3CTA A;  5J4Y A;  1R5H A;  4BY1 J;  2HFH A;  4HG2 A;  2O61 A;  3PO3 J;  3OSF A;  2V9V A;  5CVI A;  1UCR A;  2RKH A;  4LMY A;  4I7H A;  3JRD A;  2ZCW A;  2O5R A;  1F1Z A;  3HJE A;  3P5J A;  3K4C A;  1QHG A;  2K9Q A;  1VQ6 I;  1TW3 A;  2JUG A;  3TO9 A;  1FBQ A;  2DMN A;  3DKY A;  2LH9 A;  3ZQL A;  3A03 A;  2ZSH B;  4HV6 A;  1JHH A;  4M6Y A;  5GAD J;  4YG2 F;  4EGY A;  4XIC A;  3DPU A;  4NUB A;  3HGG A;  2H6B A;  2VJI A;  2XAS A;  3C2G A;  2L7Z A;  3L09 A;  1HSJ A;  3ZQG A;  1AU7 A;  1ETV A;  4OIR F;  3ZGK A;  2QSH X;  4KMF A;  2HXI A;  2R5Y B;  3OYL A;  2VE9 A;  1MGT A;  1Z7U A;  3CUO A;  3ZMV A;  2HDD A;  1MW7 A;  5F0C A;  1JKP C;  3E6D A;  4ZDP A;  3CCY A;  4Q47 A;  1D3Y A;  1IAW A;  5DV5 A;  3PO2 J;  3QOP A;  3OOP A;  3FHZ A;  1BJZ A;  5EG0 B;  2KZV A;  3F23 A;  1V5G A;  2EIM H;  1U5T B;  2EV6 A;  5LFA A;  3L2V A;  2EFP A;  3ZQC A;  2LKP A;  1OCR H;  4ZZD A;  2D2W A;  1ZLK A;  2FOK A;  4B3A A;  2VI6 A;  4QTR A;  1SD5 A;  4NC8 A;  3U1D A;  1VTN C;  1U5T A;  3E5Q A;  3AKZ A;  1KU2 A;  1H8A C;  2P81 A;  3PM1 A;  2DCE A;  1P4A A;  3SEQ A;  1OYI A;  5E17 F;  3VSL A;  4D5F A;  2OD5 A;  2VJ4 A;  1JGS A;  2M1B A;  1LE8 A;  4WXH A;  4L9J A;  2W00 A;  3HG9 A;  4A5N A;  1Z91 A;  2ZB9 A;  1B9M A;  3HB9 A;  2P5V A;  1VQM I;  2HVQ A;  5J1Y A;  2QCO A;  2HI3 A;  4P9U A;  4GGG A;  4DQ2 A;  4KIB A;  5GAE J;  1FTT A;  3Q0U A;  4EVI A;  1HLV A;  3GTL J;  1R22 A;  5K7H A;  4XM3 A;  2HVR A;  1TT5 B;  1JUS A;  2OBP A;  4G6D A;  5F0H A;  2M4K A;  1G3T A;  2M87 A;  3OS0 A;  4BQN A;  5D6F A;  2EIJ H;  3HHH A;  4B3X A;  3IKT A;  3I0T A;  3WTS C;  4FCY A;  5LBQ A;  2JSC A;  2EH3 A;  2TRT A;  5CKT A;  2W84 A;  1AOY A;  2Q0O A;  2PMZ N;  3BR0 A;  2IGO A;  1PJR A;  2DBB A;  2F4M B;  1YG2 A;  4L9V A;  4V19 K;  4IQJ A;  4EJT A;  5BMZ A;  4IHY A;  2XPV A;  3DPT A;  1T38 A;  3S2D J;  2VXZ A;  2JA2 A;  3BZ6 A;  3WTY C;  1SMT A;  1OKR A;  3NRV A;  3MKW B;  2BEO A;  1IRG A;  2EFW A;  2BY3 A;  1X1P A;  2G0E A;  4G6T B;  1I3Q J;  3KE2 A;  1LEB A;  3BT9 A;  4L5E A;  4BBR J;  1SAU A;  3HSR A;  2EV0 A;  1YS6 A;  2QWW A;  2IA1 A;  2QVO A;  1MNE A;  3OYD A;  4IEJ A;  5L3E A;  2ZNZ A;  3DKW A;  2GIV A;  4LGW A;  2LBF B;  3I56 I;  1LFP A;  5IYD J;  1PVE A;  3AG4 H;  4DYR A;  1LVA A;  2IBD A;  3E97 A;  4B43 A;  3R4K A;  2GA1 A;  3IC7 A;  2C6Y A;  4RGR A;  1YRN A;  3D5L A;  1IG7 A;  2L9N A;  2LKX A;  1HF0 A;  1IN7 A;  2KIU A;  5DYM A;  1VQ9 I;  2WY7 Q;  3HL2 A;  3KFW X;  1MSE C;  3F8B A;  2XPW A;  4CCL A;  4MFD A;  3RZD J;  5M5Y J;  1GT0 C;  3LSI A;  3FHN A;  2V1D A;  2MD5 A;  2QQ8 A;  4LLL A;  5E8I A;  1WFX A;  5K7Z A;  3OYC A;  4A3G J;  2ZNY A;  2XPU A;  4U87 A;  2ZXH A;  2DW4 A;  1QHH D;  3OIP A;  2MAB A;  4Y7N J;  3ULQ B;  3IH4 A;  1JTX A;  2CW7 A;  4UNO A;  3H36 A;  2DA2 A;  3J7A Y;  1Z0X A;  1Z6T A;  4U88 A;  1N78 A;  1MJ9 A;  4CUG A;  2X48 A;  3CME I;  1MH3 A;  2B63 J;  2CJJ A;  3G1O A;  3BR6 A;  4PFP A;  1U2W A;  5ED4 A;  3U21 A;  1PUF B;  3VSK A;  4F93 B;  3OYG A;  2OCC H;  5ICF A;  5TGT A;  4B8X A;  3M3Y J;  4MFE A;  1FX7 A;  3OIO A;  4L0Y B;  1XN7 A;  3UR3 C;  3R0A A;  2EJR A;  2LLK A;  1VQP I;  2IGM A;  1LFU P;  1L3L A;  3H3V K;  1KQ9 A;  3OL3 A;  5FKN A;  2LRE A;  3H9G A;  5AIP A;  5E1Z B;  2Z16 A;  1LDK B;  5AON A;  3RYP A;  2KFD A;  2OCE A;  4BQA A;  3ABM H;  5KK1 A;  3G1L A;  1ZR4 A;  2JA7 J;  4RB0 A;  2YX4 A;  3CF5 F;  5BNG A;  4M9X A;  2UWM A;  5IP9 J;  1IN4 A;  1RET A;  1FNN A;  1Y56 A;  1TC3 C;  3C7J A;  4E6K G;  2RGV A;  1IV8 A;  3NWS A;  4DZP A;  4A3B J;  4YFX F;  2Y31 A;  3ABK H;  3CP8 A;  4DIQ A;  3GFJ A;  4ITV A;  2LOO A;  4XBF A;  2YX7 A;  3BZK A;  1X2M A;  1BIA A;  5F1R A;  3F8M A;  1J9I A;  2CG4 A;  1V5F A;  4XRS A;  4HRI A;  1J2X A;  3CUQ B;  4D9J A;  3OY9 A;  1H88 C;  2BE5 F;  3F3X A;  1XTA A;  5HLT A;  4A3M J;  4M6X A;  3HOZ J;  3ISP A;  2O7O A;  4YIR X;  2MC3 A;  3WTZ A;  3K0L A;  3CUQ A;  3CMM A;  1K4T A;  3QPH A;  4HA8 A;  2DPD A;  4A3C J;  2HQR A;  5EYR A;  4FE4 A;  3BG7 A;  4RB2 C;  2IS2 A;  4R8H A;  1GV2 A;  1LEA A;  2B7E A;  2O9L A;  4O3M A;  4LIU A;  5D8L B;  4L9N A;  1G2H A;  2E60 A;  3C2B A;  5DCM B;  2P7C B;  1XSV A;  3OYK A;  1WH7 A;  3ZRG A;  1RES A;  2W85 A;  1FYM A;  3K4J A;  3IWZ A;  2QUF A;  3MWM A;  2HR3 A;  1R49 A;  9ANT A;  3FK7 A;  4M74 A;  5CQE A;  5DCM A;  2HXO A;  5CVR A;  1GXP A;  3KCC A;  1JJ6 C;  2Y0S A;  2Y69 H;  1LQ1 A;  3K69 A;  4ANJ A;  2DMQ A;  2ZXW H;  4C2T A;  3K1N A;  3G2B A;  2VLA A;  4AD9 A;  5JVG F;  4L9T A;  4UVA A;  3VPR A;  2HOE A;  3J80 K;  1KQ0 A;  4IHW A;  5L3C A;  4QIW N;  4MTD A;  5EEG A;  3GZ5 A;  5FD5 A;  3KP6 A;  1FZP B;  3GLX A;  3LMM A;  2JQ7 A;  2X6Y A;  3F72 A;  1WJC A;  2Y75 A;  2X6W A;  2CV1 A;  2OV7 A;  2Z5U A;  1ZGA A;  2LD5 A;  1ON2 A;  1U8R A;  3HPH A;  2NS0 A;  2VOD A;  3SHF A;  2XHK A;  3DWL E;  3VWB A;  4I6Z A;  2A69 F;  4KMU X;  1YS7 A;  4LK0 F;  2ZKZ A;  2VC0 A;  1DUX C;  1WKM A;  3BG6 A;  4CYD A;  4UVB A;  1Z9C A;  3DTK A;  3DBL B;  3KET A;  2IT0 A;  2H1L A;  2A6H F;  1TWH J;  3KLO A;  2XAJ A;  4MQV A;  2XSD C;  4M71 A;  4S04 A;  2QZ8 A;  2F5F A;  2L4A A;  2XAF A;  1KA8 A;  3BY6 A;  4KN7 X;  2V7F A;  5IT9 Z;  3UNG C;  4AU7 A;  1MMG A;  4HPQ A;  4RBO A;  2BOL A;  2ZSI B;  2VQC A;  3RJP A;  2VKE A;  2HTJ A;  1WGX A;  3PQJ A;  3LSR A;  1POG A;  2HTS A;  5DCF A;  1OQY A;  3A0B C;  3G73 A;  1WJE A;  2DJN A;  3FX3 A;  2JZY A;  1HQC A;  3RDI A;  2DMU A;  1VQ8 I;  1MZB A;  4CCN A;  3PIP F;  1HXD A;  1IJW C;  1XMA A;  4MEX F;  3CJT B;  1BIB A;  2MBF A;  1ZTR A;  2IA2 A;  2WAF A;  4XRF A;  1MBE A;  1ZK8 A;  2X51 A;  1FMV A;  3I4N J;  4LD5 A;  2OUM A;  1XD7 A;  5GAH J;  2F6C A;  1V5E A;  1EH8 A;  1IC8 A;  2VQG A;  1OJL A;  3WU0 A;  1D0X A;  4R79 A;  2EA4 A;  3U2R A;  1IN5 A;  3DBH B;  1HKS A;  4ZYA A;  1ON1 A;  4EJW A;  2MA3 A;  2V1U A;  5EEA A;  2CYY A;  5ERI A;  1JGG A;  3E6M A;  1DGR M;  3LSM A;  4I09 A;  2LC2 A;  1W36 D;  3GVA A;  2N8G A;  3PNY A;  4M3G A;  3SZG A;  4UUS B;  1EH6 A;  2YSR A;  3V7S A;  3RCO A;  5DS9 A;  1BC8 C;  2HQN A;  5EJC A;  1P6R A;  1CF7 B;  5F6F A;  2QLZ A;  4MEY F;  3HSF A;  3CDH A;  1L0O C;  1ORK A;  3C2H A;  3H3U A;  3BR3 A;  3I54 A;  1IZ1 A;  2D45 A;  4LIT A;  2HYF A;  2P7V B;  3FIS A;  1I27 A;  5D5V B;  3P9I A;  5HOO A;  3RZO J;  3I64 A;  3FF5 A;  4ON0 A;  3COA C;  2QBY B;  3K70 C;  1MBJ A;  2OPT A;  3HEF A;  3I59 A;  4FAS D;  2XB0 X;  2DT7 B;  5EZG A;  3ABL H;  3ECH A;  4OMY A;  4XK4 A;  1HBX G;  3EET A;  2F5E A;  3HUG B;  3C18 A;  4V2F A;  5GTH C;  4BL0 B;  4XOR A;  5H6Q A;  4IHS A;  2ISZ A;  3CCL I;  4C30 A;  4UXN A;  4ZDO A;  2WBM A;  3HTS B;  3E0J B;  3HUG A;  2L02 A;  3O6B B;  2JPC A;  2E1M C;  2XGX A;  3FXQ A;  4ASN A;  1ZAO A;  1S5L C;  1V55 H;  1ZLJ A;  4BAY A;  3LQR A;  4HLY A;  4CO8 A;  3GFL A;  2K9L A;  3WTV C;  5HLH A;  1B72 B;  5CVJ A;  3G3Z A;  1RR7 A;  4FIS A;  3LA7 A;  3EYY A;  1BR4 A;  4NC7 A;  2L7F P;  3TL4 X;  3R61 A;  2H09 A;  1B72 A;  4E7K A;  3D1N I;  1IO2 A;  1KYZ A;  2EZK A;  4BBS J;  1J5Y A;  4L18 B;  1T98 A;  4NC6 A;  2UXX A;  2F48 A;  2Y9Z A;  1XGM A;  3F22 A;  1GXQ A;  4GFB A;  2XAH A;  4XNF A;  5GPC A;  5B66 C;  4E7L A;  4CCK A;  1XDS A;  3LAP A;  2PFB A;  2A6T A;  4HF0 A;  5J8F A;  4ZYG A;  1TWC J;  3R6S A;  2M0M A;  4Z2Y A;  3DEU A;  2RRE A;  4I0B A;  3CC2 I;  5D6E A;  1LNW A;  2XF6 A;  3B6A A;  4II3 A;  3PUF A;  2OQR A;  3MKY B;  2A05 A;  5J8C A;  3GWZ A;  2BVM A;  2FEZ A;  2E2I J;  3VYS B;  4IZZ A;  3M07 A;  4NNJ A;  2P0W A;  1E3O C;  4UHT A;  3Q5F A;  2NAZ A;  2BHZ A;  3FWE A;  5HLI A;  2KJC A;  1HC8 A;  3PFI A;  4JYK A;  1JHF A;  3HRS A;  3OWT A;  1R5G A;  1PDN C;  4FT8 A;  1YIJ I;  1U5T C;  1ZGJ A;  2V9P A;  2HOT A;  4B1R A;  4HZF A;  5J6X A;  2CWE A;  3WE3 A;  2H1K A;  4UV8 A;  1LDJ A;  1W5C C;  4IJA A;  3KYC B;  1IXR C;  5J1U A;  5TIS C;  3QU6 A;  3WTT C;  1U3E M;  2R7T A;  2EIK H;  2XKP A;  4IRI A;  1OR7 A;  5EF6 A;  1ZAR A;  2HPM A;  2A07 F;  2PJP A;  1VND A;  2R7S A;  1B4A A;  4RGU A;  1K6O A;  1GVD A;  4A0X A;  2DT5 A;  5D8K B;  4CHU A;  1SAN A;  3CLQ A;  1F43 A;  3T0Y A;  5B1B H;  2PQ8 A;  2VQH A;  3N97 A;  3AG2 H;  1UEL B;  4I98 B;  1BL0 A;  1DU6 A;  4LLG F;  3H3Z A;  4U0Y A;  2MLK A;  5J40 A;  1ETX A;  3HBL A;  3TKY A;  3HOV J;  1FOX A;  1P7J A;  3ZP5 A;  4L5J A;  2DFI A;  1IF1 A;  3F0C A;  1STZ A;  4EJU A;  2STW A;  4IVN A;  1GV5 A;  2VBY A;  3T5X A;  1MBK A;  2FQ4 A;  1PP8 F;  5F27 A;  4BY7 J;  2XV4 S;  1K78 A;  4I76 A;  1YQA A;  3S93 A;  2MSY A;  2STT A;  4KT5 C;  2CQN A;  3H9J A;  2JRT A;  5FO5 A;  4J00 A;  2XF5 A;  4N9H A;  1YW8 A;  3RI4 A;  2YPR A;  3JTG A;  1UZC A;  3FIW A;  3FMR A;  2VIX A;  2MFZ A;  2UUZ A;  1RRJ A;  1BOA A;  2P4W A;  3GW2 A;  2KT0 A;  4PSW A;  3DPL C;  1MDM A;  3H5N A;  5F0F A;  1N75 A;  3V4G A;  2XRN A;  2M45 A;  1QPM A;  2HZT A;  1OMI A;  3CDI A;  4BYY A;  4RLQ A;  1ITY A;  3FXJ A;  5KNL A;  1UMQ A;  2FJ1 A;  3AL0 C;  3K6G A;  3RTR A;  3K1M A;  2EBI A;  3KEQ A;  5FKL A;  1K79 A;  2GZW A;  3CP2 A;  4EGZ A;  2CUF A;  2LKS A;  4B09 A;  3QOD A;  4E7J A;  2KIQ A;  2PG4 A;  3WU2 C;  1ENH A;  3ONQ A;  1TQP A;  4F52 A;  1Y0N A;  4FHT A;  3ASO H;  1S6L A;  3SDG A;  2QA4 I;  3VOE A;  2Z99 A;  1FC3 A;  4KN4 X;  1I39 A;  2E7X A;  3O2P E;  4A2U A;  2Z3Y A;  2WAQ A;  5FJ8 J;  3TBI A;  1SFU A;  2XGC A;  3ZQQ A;  2LY2 A;  4BAC A;  1TQM A;  5LGT A;  3CES A;  4U7B A;  3SFI A;  3WU1 B;  2X0L A;  4E7S A;  3CCM I;  3QU3 A;  2LYC A;  4A0Z A;  5F1J A;  5E3N A;  3Q9V A;  2G9W A;  2GOX B;  3HC7 A;  4I0A A;  1ZKG A;  1HW2 A;  2VB6 A;  4BHB A;  1J09 A;  4BE0 A;  2Y0M A;  3BJO A;  1QU3 A;  1T0F A;  3K4K A;  2NNN A;  4E4H A;  5E3L A;  3KP2 A;  3REO A;  2ELJ A;  3TQN A;  3AAF A;  2L2O A;  3JCU C;  5B1A H;  1MND A;  2R5Y A;  1JT0 A;  4BXU A;  1RI7 A;  4II2 A;  1QZE A;  2K3P A;  4QSH A;  3W6K B;  2PBI A;  2DPU A;  1FY7 A;  1QQI A;  2XIG A;  4JP0 A;  1U0J A;  1VQ4 I;  1D0Y A;  3F8N A;  5JLX A;  5DM6 F;  4HDU A;  3HOU J;  2DFE A;  3TW6 A;  5HLG A;  4OIP F;  4RDU A;  1XGS A;  2JA8 J;  2E1N A;  4ZYE A;  3LAJ A;  1VQ7 I;  1S29 A;  2E34 A;  5EG0 A;  4EMS A;  2O8X A;  4AVZ A;  1KU3 A;  2VBZ A;  1BW6 A;  1Z05 A;  1G3Y A;  3EUH C;  1XMK A;  1ZQ3 P;  2Y30 A;  3ECO A;  2IGK A;  4P55 A;  2V6C A;  1QRY A;  3CQZ J;  3L2R A;  2WB1 N;  1XPX A;  3IP4 B;  3H1C A;  2W57 A;  2X1D A;  4BJ5 C;  2HQ5 A;  1N77 A;  3JW4 A;  3CC4 I;  1HKT A;  4D0P A;  3OYA A;  3GTP J;  1Y8R B;  2X1C A;  1I50 J;  4HNU A;  4I01 A;  2ZJR F;  1MKM A;  1S7A A;  4AM3 A;  2QSF X;  3F8F A;  2L9R A;  5LEJ A;  4FET A;  3UKG A;  3NQO A;  3RPU D;  1YJN I;  1IRX A;  1J7K A;  1ZEL A;  3CJN A;  3RPU A;  4A3D J;  1WSU A;  1R00 A;  1IXC A;  1Z3Y A;  1ACI A;  3QOE A;  2LNB A;  3GZN B;  1KU7 A;  2Z33 A;  1GVJ A;  3HDD A;  2OA4 A;  2ETH A;  2OU2 A;  1FEX A;  2JMW A;  5J47 A;  5D5W B;  1RUO A;  3CD6 I;  2A6E F;  2FBI A;  4PSX A;  3GCM A;  4KUM A;  1LKX A;  2ADU A;  4JOM A;  5C3E J;  1A6Q A;  2X4H A;  1K4S A;  1E0E A;  5KVR A;  4M72 A;  1MJA A;  3E7L A;  1QBJ A;  2WB1 A;  1MD0 A;  3RKW A;  5GP9 A;  1P4X A;  3VFZ A;  1Z77 A;  4XLP F;  3A2K A;  4KT6 A;  2ZME B;  3FMQ A;  3M7G A;  5HOD A;  2ZXJ A;  3I3L A;  5JFR A;  3DQV C;  1DQU A;  2WAE A;  2WY8 Q;  3RQI A;  3SYT A;  2R7V A;  1U9O A;  3TMO A;  3CZ6 A;  5L3D A;  4IRH A;  5ILV A;  2ZME A;  1UHM A;  2LBF A;  5EDN A;  1MJB A;  1UFM A;  4EM0 B;  1FIP A;  4XKV A;  1WZ2 A;  1YI2 I;  1HA8 A;  3TOB A;  3ZOB A;  4IL6 C;  4V2G A;  2RN7 A;  3CDL A;  5EGO B;  3TOA A;  3JSO A;  4C3I J;  3ABT A;  3BDD A;  4NQW B;  5CQG A;  4W97 A;  4PGH A;  4CCJ A;  3RKY A;  3FK6 A;  5FFX A;  5EGO A;  3DLA A;  3BR1 A;  4ETS A;  2DAO A;  3HGY A;  3HRT A;  1R6R A;  2QEN A;  4NQW A;  3SZP A;  1K61 A;  1H0M A;  3KPH A;  1YJ9 I;  3CMA I;  1O4X A;  2QM3 A;  2ZXI A;  4IRG A;  4YEL A;  3I5U A;  2HS5 A;  2R7R A;  2V4J C;  1DP3 A;  2TDX A;  2EFO A;  3GBG A;  3IAM 2;  2L3D A;  4XRM A;  4H4K C;  5HDN A;  3I71 A;  3O8G A;  2MG4 A;  1LJ9 A;  1FPQ A;  3PNV A;  2EIL H;  4BHP A;  3CCJ I;  4WF2 A;  3EDP A;  4YII A;  1DU0 A;  2VOP A;  3CJQ B;  3F6V A;  1PUF A;  2DA3 A;  3SDB A;  2JT1 A;  3TP0 A;  1ZG5 A;  1I5Z A;  4FE7 A;  2UZK A;  2Q8K A;  2NVX J;  1FT9 A;  3OOU A;  5EZH A;  1ZH5 A;  3HOY J;  5FGM A;  4HX7 A;  5FKK A;  2DA6 A;  4NB5 A;  4L5I A;  5L3F A;  2DA1 A;  1UG2 A;  2LY1 A;  1D1C A;  3BTJ A;  2OZU A;  1B1B A;  4RGS A;  5CVV A;  1J59 A;  5E8G A;  2GBY A;  1REP C;  4XLA A;  4M6V A;  4X0G A;  1S72 I;  2R7W A;  1DP7 P;  2DU9 A;  1XDU A;  2ZC2 A;  4IOA F;  2W24 A;  2Y0S N;  1W36 C;  4JQF A;  3OR2 C;  2MLG A;  3CF2 A;  1SFK A;  4XSX F;  2RVC A;  2CQK A;  4BDZ A;  3DFG A;  2KDO A;  3E5U A;  5GTI C;  2EV5 A;  3OR1 C;  2FBK A;  1KON A;  2IA0 A;  3NAU A;  3GXO A;  2BY2 A;  2RQQ A;  4FX4 A;  3OS2 A;  3HPG A;  2XDV A;  2DK8 A;  2DLL A;  3L7W A;  2HOS A;  2GIZ A;  2GLO A;  5E3O A;  3ZN1 A;  3TED A;  2AO9 A;  1F4K A;  2FOW A;  2JN6 A;  1SVL A;  2JSP A;  2ZJP F;  3LSP A;  4Q48 A;  2BVL A;  5HS9 A;  5ICG A;  1XCB A;  3WHB A;  2I8D A;  1LPQ A;  4BEH B;  1TBX A;  3BWG A;  4XN3 A;  2R7D A;  2CS3 A;  2PMU A;  3GTK J;  4P96 A;  1AHD P;  2GAU A;  2H27 A;  1BI0 A;  3FKJ A;  3KP5 A;  5F04 A;  4B48 A;  3IKV A;  4XRS G;  2FNP A;  4BEH A;  2IXS A;  4IQ4 A;  3LSG A;  2MD0 A;  3MN2 A;  4HNV A;  3TP3 A;  2B0L A;  3AFH A;  4C2M J;  2HEO A;  3RPQ A;  2RAE A;  1KGS A;  5D4R A;  2PEX A;  1GDT A;  1OYY A;  3MD2 A;  3H9Q A;  2DQL A;  3P9C A;  2COM A;  1WJB A;  2M0C A;  3FXR A;  4HBL A;  2DI3 A;  4XL9 A;  1I3A A;  1JTY A;  1CQT A;  1F5T A;  3PNT A;  1HW1 A;  2FD5 A;  4RB1 A;  1QGP A;  3Q3S A;  2CO5 A;  4JX4 A;  1UHW A;  5DEQ A;  5KAI C;  3M1E A;  4HX4 A;  2KJB A;  2M2E A;  4CCO A;  2F2E A;  1IDY A;  3LQQ A;  1EA3 A;  4U7D A;  5GAG J;  2VXD A;  3I9V 2;  3BZC A;  1FOW A;  2M5W A;  1RUN A;  5C4X J;  2RC4 A;  2DTR A;  1YYV A;  4RMN A;  1IXS B;  1LVK A;  4M3D A;  2NOJ B;  5ILS A;  2UXN A;  4GDF A;  4I2O A;  5IPA A;  1DDN A;  4YRV A;  2NS7 A;  4D1Q A;  2PI0 A;  1P2F A;  3S1N J;  2K85 A;  2Y9Y A;  2BW3 B;  2BY1 A;  4FQG A;  1WPK A;  3TW7 A;  4A3J J;  1W7P B;  1WJF A;  2RV8 A;  2CRG A;  2PLY A;  1W7P D;  4AIJ A;  4GYI A;  1G3W A;  1UAA A;  2BW3 A;  3GTO J;  3GUD A;  4N9I A;  4KA4 A;  3C3W A;  4YFK F;  1R1U A;  1IRZ A;  5E3M A;  5BPD A;  1W7P A;  3GO5 A;  2CW8 A;  3B6C A;  3D0S A;  2ECB A;  1ULY A;  1I1G A;  5L3G A;  1VZ0 A;  2HDW A;  3JAM Z;  3GYH X;  4ENK A;  3S1Q J;  2E36 A;  4LIV A;  2BXY A;  3GFI A;  1T95 A;  4LG0 B;  2J5P A;  5HDK A;  2K9N A;  1T39 A;  3PUB A;  3R60 A;  3BQZ A;  2VKH A;  4AYB N;  4NHJ A;  2IGN A;  4XMY A;  3L9F A;  3NAR A;  1JUM A;  3KX2 A;  4LG0 A;  2XGE A;  4OIO F;  1XGO A;  2M7B A;  4N4N B;  4CCM A;  1SFX A;  5IOY A;  2XAQ A;  1OYW A;  1UJ8 A;  3BQY A;  2DN0 A;  2P6T A;  2X6O A;  1W4M A;  3J81 Z;  2KL4 A;  2JTV A;  5H2F C;  1YTY A;  1MMS A;  4KIC A;  4BE1 A;  5IP6 A;  4IX7 A;  2P8T A;  1MBG A;  5M3F J;  1VQK I;  5LRR A;  1FP1 D;  3S1R J;  4Z6Y A;  4HYE A;  2WWY A;  4PJ0 C;  3S15 J;  4JBA A;  4A3E J;  4ZTF A;  1FSH A;  2LR8 A;  3BTL A;  4QPO A;  3K2Z A;  4XLE A;  1TNT A;  2L9V A;  4OMZ A;  1SD6 A;  2GXB A;  2FUG 2;  4XLH A;  2K27 A;  2PX9 A;  3KZZ A;  3S16 J;  1JT6 A;  2TCT A;  4RGX A;  3IV5 A;  1YJW I;  4HF1 A;  1B9N A;  4FX0 A;  4OAY A;  4OU0 A;  4Y17 A;  2E5Z A;  3WOD F;  1M1E B;  5FKM A;  1RPW A;  4S05 A;  3BLY A;  1ZR2 A;  4AYB A;  5GPA A;  5E20 A;  5DUK A;  1S8N A;  3OYI A;  3CCQ I;  4WWC A;  2HQA A;  2EB7 A;  3BCB A;  3IH3 A;  4AUX A;  2BV6 A;  3ZMU A;  2R5Z B;  5F08 A;  2E71 A;  2IS6 A;  4UUS A;  2V79 A;  1F36 A;  2K40 A;  1CF7 A;  4I02 A;  6PAX A;  1ETY A;  3SZT A;  4CGZ A;  2XF7 A;  3GLL A;  3F8C A;  2R5Z A;  4PFO A;  1BI3 A;  1W0U A;  4E7I A;  1TQI A;  4UB8 C;  4C3H J;  1T2K A;  1W1W E;  3WE2 A;  2X6X A;  1J0R A;  3TO6 A;  2PN6 A;  2YR2 A;  2HKO A;  4C3J J;  1X3W B;  1P7I A;  1SFO J;  1HST A;  1NH3 A;  2VN2 A;  1YX5 A;  1HW5 A;  4XKW A;  1MBH A;  1R5I D;  2K9M A;  2QBY A;  4Y3O A;  4ZYH A;  1NG7 A;  3A01 B;  5M3M J;  2FNA A;  1EV7 A;  5IT9 K;  1SD7 A;  4RAZ A;  5CPR B;  3H35 A;  3CCU I;  3AG1 H;  4M3B A;  4ZJZ A;  3HXL A;  1Y6I A;  1O3Q A;  2DMP A;  1YW7 A;  2QQ9 A;  3FXL A;  3BPV A;  3N05 A;  2JA5 J;  1P92 A;  1WH5 A;  3JTH A;  1MSF C;  2JA6 J;  4AC0 A;  2JVG A;  5L3B A;  2VBW A;  3ZMS A;  4CDG A;  3BG3 A;  5B3S H;  4PJJ A;  1VQN I;  5K5O A;  3BG9 A;  2CUJ A;  2HKX A;  4X6A J;  1MMD A;  3T1B A;  3W2W A;  3QP5 A;  2VKV A;  2R7U A;  1OCO H;  4XQF A;  3ESW B;  2D1V A;  2FA5 A;  3QYB A;  2MC4 A;  3W2V A;  3MVP A;  4IO9 F;  1B8I B;  4BUP A;  4P1W A;  3S8P A;  5FLX Z;  3GX4 X;  4OOI A;  1B8I A;  3KP3 A;  3IRQ A;  2JRM A;  5BQT A;  1OIS A;  4WK8 F;  1T0F C;  3HHG A;  4EJV A;  3LFK A;  1FMW A;  3V8J A;  2H8R A;  2FSW A;  1T6S A;  3SJM A;  2NXN B;  1IUY A;  3E5X A;  1EH7 A;  1FBS A;  3LST A;  5HDG A;  5LHG A;  4RAF A;  3CC7 I;  1X3Z B;  3K4B A;  5A2Q Z;  1TTY A;  3G1M A;  3CMY A;  3T8R A;  5IOZ A;  2MH2 A;  3QQA A;  1W0T A;  3BJ6 A;  3G4S I;  2XAG A;  1OCT C;  2A68 F;  3OSG A;  3L00 A;  1X58 A;  4ESB A;  3Q0W A;  1LUJ B;  3BPX A;  4LG3 A;  5ICC A;  2DDB A;  5HS7 A;  4WCG A;  2CH0 A;  3QPS A;  1WI3 A;  3Q0V A;  3GTQ J;  2QGU A;  2HU9 A;  2K7L A;  4F7Z A;  2CUZ A;  3S3O A;  2LTP A;  3EUA A;  3GTM J;  1RKW A;  3M4O J;  3HOS A;  4A3K J;  1ZHF A;  4KIT B;  2DOF A;  3FM3 A;  2Z1D A;  4BDY A;  2IPQ X;  3P7N A;  4Y4R A;  4A0Y A;  1Y0U A;  4AIK A;  1YLF A;  3MKL A;  2DO7 A;  2JWT A;  2J5O A;  1F9N A;  2OJE D;  5M5X J;  1AWC A;  3M8F A;  4LK1 F;  1TWG J;  5BOX A;  2KMU A;  4OIN F;  4QPQ A;  3ELK A;  4RM2 A;  1ZN2 A;  2EZI A;  2F5D A;  1FIA A;  4CYC B;  1YX3 A;  2CV2 A;  4JX6 A;  4UUV A;  2COB A;  1T56 A;  3S14 J;  2AS5 F;  2OZ6 A;  1IGN A;  4DJA A;  3K2A A;  2CW0 F;  5LLQ A;  4CYC A;  5AIQ A;  2FRH A;  3FBN B;  4BJ6 C;  1U78 A;  4D5C A;  4PCQ A;  3NWT A;  3PFY A;  1E3H A;  4WXD A;  2KRF A;  4HSR A;  1W5S A;  2WV1 A;  1ZG3 A;  1BOB A;  2EFN A;  4XID A;  3JRI A;  2CFO A;  2QYO A;  3F21 A;  1JJ8 C;  1FOY A;  2QQB A;  4B47 A;  1QVU A;  2L7M P;  2WAQ N;  3VYU B;  2NVQ J;  4P9F A;  3M1C A;  3JSP A;  2IJL A;  1IV6 A;  2LK2 A;  4E70 A;  2HYJ A;  1HOM A;  5FRM A;  1O7F A;  2VQL A;  5K1Y A;  3S3M A;  3MZ8 A;  3CCR I;  4ZH4 F;  2ZFU A;  5LD2 C;  2KQR A;  3GFM A;  2NVY J;  4LB6 B;  2O3F A;  1XSD A;  2VON A;  5LHH A;  4A3I J;  4EEF G;  3JRG A;  1O3R A;  4KYW A;  5ILU A;  3HKZ A;  2KKO A;  3W6V A;  3TDU C;  4A69 C;  3C1D A;  3BTC A;  3LWF A;  5FFZ A;  3BP8 A;  4KDP A;  2KIF A;  1OCP A;  1FOK A;  2Y2Z A;  2BHY A;  4ENJ A;  1ETK A;  1Q1H A;  1WCM J;  3FXM A;  4HEA 2;  1A04 A;  4EAT A;  1ZRF A;  4MO7 A;  5IY5 H;  2E1M B;  4IKF A;  2YU9 J;  2R7X A;  4C9Y A;  1WJA A;  4CZC A;  2NVT J;  3IL2 A;  3I4P A;  2F5V A;  3CCE I;  1P4W A;  2M3A A;  2I5U A;  4HW0 A;  2QEX I;  2KIM A;  4CA0 A;  3LSH A;  3QP6 A;  4M9S A;  4N4O B;  4UUT A;  3TO7 A;  2AHQ A;  1ERD A;  1VQO I;  1TWF J;  2D5V A;  4KIG A;  3LNQ A;  3U1K A;  1U6G A;  1XMX A;  1A31 A;  1YFH A;  1BJA A;  4BXF A;  4GXO A;  1RKT A;  4I99 C;  3RQ4 A;  2VT3 A;  3HIF A;  2Z2S B;  4U0V A;  2M8G X;  2GXG A;  1PYV A;  4M73 A;  1E2X A;  1Y1V J;  3BCA A;  1W5T A;  2QF7 A;  4D7N A;  4XLN F;  3MMY B;  5IYB J;  4PDK A;  1H9G A;  4K2E A;  4M3E A;  3SEZ A;  3WTU C;  3PL8 A;  3PJR A;  2XAU A;  1ODD A;  4N0B A;  1FLI A;  1O7L A;  1VF9 A;  1Z7L A;  1PUE E;  4MGR A;  4G94 A;  4X1E A;  3J7A O;  4MLO A;  2ME6 A;  1YW9 A;  4IOC F;  1MNM C;  4ZC3 A;  4M9Z A;  4HQM A;  1GHC A;  2E35 A;  3WGH A;  1BR1 A;  2ZO4 A;  2EA2 A;  3ZMT A;  4Q4Z F;  2K4J A;  1D5Y A;  3FXU A;  3V7R A;  4GYG A;  4A3F J;  1BW5 A;  2W1O A;  2VT2 A;  3A02 A;  5CYV A;  2O03 A;  5HVQ C;  5JR3 A;  3VB2 A;  1HKQ A;  3GTG J;  5HNF A;  3FXO A;  4AID A;  1TL8 A;  2VJJ A;  2V1N A;  3WHC A;  4Y15 A;  4LFU A;  3RKQ A;  3EQL F;  2JUC A;  3I58 A;  4UV9 A;  3L1P A;  1HDD C;  2DOD A;  5LRS A;  2HGC A;  4Y52 J;  1WVR A;  1XSX A;  3S32 A;  3VDX A;  4A5M A;  3KYL A;  3MZH A;  3VEP A;  2R93 J;  1D8J A;  2DYS H;  4UVC A;  3EYI A;  2GQQ A;  4FTH A;  3K1P A;  3OV8 A;  1UHS A;  1Z3X A;  3CUQ C;  3SQN A;  2CU7 A;  2H94 A;  1LE8 B;  2AQE A;  2CFX A;  3W6J B;  4CSW A;  1E3P A;  1VQL I;  1EF4 A;  2L0K A;  3BG5 A;  3F9K A;  2YS9 A;  3O3K A;  3FKI J;  3G71 I;  4Y13 A;  5HS8 A;  3MKZ A;  2RDP A;  5JI6 A;  4PJN A;  3KP7 A;  1CGP A;  1PP7 U;  2R7F A;  1KZH A;  2D1H A;  4XKC A;  2BY0 A;  3GF2 A;  2AXT C;  3B02 A;  3VYT B;  3I4M J;  1FBU A;  1TWA J;  1XB4 A;  2ICW G;  3ZN0 A;  4AIH A;  1FYL A;  1G8X A;  1TNS A;  1R1V A;  1S3J A;  1BR2 A;  1USS A;  3DV8 A;  4KNY A;  2E7W A;  4M3F A;  1MIJ A;  3H0D A;  2K02 A;  4BXX J;  1R36 A;  2IS4 A;  1MH4 A;  3HRU A;  1APL C;  1WI9 A;  3BOQ A;  3QAH A;  2IW5 A;  3L2U A;  5J4V A;  1QA6 A;  4MIM A;  2VL8 A;  4MQ9 F;  3DEW A;  4DBQ A;  3MZY A;  2L5Q A;  4TV7 A;  3TDZ C;  2L4M A;  1YE9 A;  3KIO A;  3IAS 2;  1LFB A;  2HZD A;  1AA7 A;  5LGN A;  4RM3 A;  1A6I A;  2ELK A;  2ZBK A;  3ZQF A;  5FB2 A;  3JRC A;  2Q1Z B;  1JKQ C;  3RYR A;  1X2N A;  3QPT A;  3G6E I;  1I6H J;  2XKO A;  4HNT A;  3MAJ A;  3BJA A;  4ZDL A;  2L7K A;  1YRN B;  1ETQ A;  5CJ9 A;  1R9T J;  4XLF A;  3AL0 B;  3DTE A;  2VJ5 A;  2VAS A;  3D5R C;  2NVU B;  3K4M A;  4UY8 I;  2HNH A;  4PJL A;  4BQO A;  2F4O B;  3GEZ A;  2NOG A;  2IRF G;  1TW2 A;  2R7Z J;  5DDG A;  1X1A A;  1HCR A;  1YOV B;  4F55 A;  1XX5 A;  5TJJ A;  4OWR B;  1XGN A;  3WGG A;  5B5E C;  2FU4 A;  2EK5 A;  2DT6 A;  2W25 A;  3ZXS A;  4IXA A;  5DD4 A;  3N4M A;  4IHV A;  2BZT A;  4D7M A;  2DK5 A;  2NYX A;  2FF4 A;  1A35 A;  3RKX A;  2EZH A;  2PMZ A;  4BE2 A;  5FRN A;  1OPC A;  1V54 H;  3OIQ A;  1QNT A;  4RA2 A;  4HAM A;  3WG9 A;  2CGP A;  2R4G A;  4JX5 A;  2WAD A;  3JRH A;  4ESJ A;  3U9G A;  2A5Y B;  2CMP A;  3FZV A;  5KAF C;  3K10 A;  4C2U A;  1T33 A;  3RSN A;  4BQQ A;  3QYE A;  4F3Q A;  5D5U B;  3KZI C;  2E5N A;  2CSO A;  3PQK A;  3L2W A;  2V1X A;  1H9T A;  3CJR B;  1X4P A;  3J80 Z;  1Z6R A;  3HYI A;  1O3S A;  5JHF A;  2PJR B;  3R0J A;  4CXF A;  3E3V A;  4DBR A;  2LY9 A;  4G7O F;  4XN0 A;  2VOO A;  3KYD B;  5CLS A;  1Z1D A;  2K4B A;  5LGU A;  3BC8 A;  2PJR A;  1O3T A;  2VPR A;  2K5C A;  1R58 A;  5H20 A;  1IRF A;  3DF8 A;  1OCC H;  1DPU A;  4RAG A;  3WTW C;  2KZG A;  2QQA A;  1BC7 C;  4RS8 A;  3JRF A;  1K83 J;  2JJ7 A;  2E1O A;  4IHX A;  2XC7 A;  3KZY A;  1SVO A;  1Q1V A;  1DGW Y;  2ZJ2 A;  2L9S A;  3E1S A;  2V6E A;  4DW6 A;  1D1A A;  1R1T A;  4GRI A;  2RNJ A;  2FXA A;  3HM5 A;  2KP6 A;  2BBY A;  1X1B A;  5KCM A;  1NG6 A;  1S7O A;  2XB5 A;  3OYJ A;  2VUM J;  1QO0 D;  4XR6 A;  2CV0 A;  1O57 A;  3FM5 A;  2LG4 A;  3DCF A;  1SFE A;  1LDD A;  4OIQ F;  2R3S A;  3EUH A;  1R71 A;  4BU2 A;  4DOZ A;  3V7C A;  1JKR C;  3HRM A;  1IDZ A;  1BI1 A;  4XLC A;  4S0H B;  2DOA A;  1IUF A;  2DA4 A;  3BTI A;  4LB5 A;  2OQG A;  5M5W J;  1FTZ A;  4BS9 A;  1RNL A;  2AQF A;  3DXJ F;  1XC5 A;  5E79 C;  2WV0 A;  5JHU A;  3DEE A;  4LLN A;  5H6R A;  4BHC A;  4ENM A;  1D8K A;  3WG7 H;  2FML A;  4G6Q A;  4YFN F;  4J01 A;  4CZZ A;  2KLO A;  3LL7 A;  1QPI A;  2E2J J;  4PJM A;  2GWR A;  3ZQ7 A;  5J3L A;  2LVS A;  2HYG D;  2OC6 A;  2RQP A;  4ZTJ A;  4YIF A;  3V8L A;  3V42 A;  4P5O A;  1B59 A;  1TT0 A;  1H89 C;  2VBX A;  1Z67 A;  2G7H A;  3H5R A;  4O5V A;  1C0W A;  1EKE A;  1UST A;  5DUI A;  3L2C A;  3QYF A;  5E1W A;  1E17 A;  5K5R A;  2E2H J;  4ENN A;  4B4C A;  2A61 A;  4XON A;  4KIS A;  1R4N B;  2PMH A;  1TP4 A;  4ESF A;  2F4I A;  2ME0 A;  3S3N A;  3K4N A;  1YHQ I;  3QPL A;  2HVS A;  2H6C A;  2G7U A;  2WA0 A;  2BXZ A;  2YUS A;  4J19 A;  4HV5 A;  3DU6 A;  1JI8 A;  3MCZ A;  3ZCO A;  3JRA A;  1U9N A;  1ZGW A;  1LB2 A;  2Z9O A;  4NDL A;  2DFF A;  2LF8 A;  5BPI A;  1SAX A;  1ZRC A;  1V4R A;  2IVM A;  2KIS A;  4RAY A;  3OS1 A;  2M7A A;  4F92 B;  2YU3 A;  2DXI A;  4Q5S F;  3BR2 A;  1I1S A;  3VOD A;  1K6Y A;  1IN6 A;  3V8K A;  4HDV A;  3O8H A;  2F5C A;  1S9H A;  1HDP A;  3OYB A;  4A3L J;  3X2Q H;  4PK4 A;  4HQE A;  3W2A A;  3WGI A;  1OR7 C;  1OFC X;  2LRD A;  3A1Y A;  5FD6 A;  3DLL F;  1RC9 A;  1BA5 A;  3EPZ A;  2LMD A;  3ZQH A;  5K5Q A;  3F6O A;  2M8E A;  5F64 A;  5E1X A;  4CIC A;  3CLO A;  1FSE A;  1NK2 P;  1T08 B;  1NHA A;  4A6E A;  4E7Z A;  2WC2 A;  4EJO A;  4BGD A;  3SFZ A;  2K3F A;  1JUP A;  2LF7 A;  4ABZ A;  4DNC A;  3I55 I;  3MFK A;  2GA2 A;  4E7H A;  4G7H F;  2HOA A;  2DJI A;  1IN8 A; 
#chains in the Genus database with same CATH homology
 1SMY F;  2A3S A;  4G7Z F;  3H92 A;  1R7J A;  1G3S A;  1YO5 C;  2P5L C;  1I6X A;  3IWF A;  4EQQ A;  4BNC A;  1V3F A;  4HOB A;  2ISY A;  2LDU A;  3HOT A;  1ZYR F;  3KEO A;  2Y48 A;  4WXC A;  4R1H A;  4JK1 X;  1WQ2 A;  5EEH A;  4HX8 A;  1BI2 A;  4EM2 A;  3B73 A;  5LEK A;  1KU9 A;  2JPB A;  5ICE A;  3M9A A;  1ZRE A;  3E6C C;  4XSZ F;  2OAZ A;  2NRA C;  2BYV E;  4G9Y A;  3I59 B;  3JAM K;  1IW7 F;  2P6S A;  1XCV A;  4ZYD A;  3ZPL A;  2O0Y A;  1G4D A;  2IP2 A;  3ROU A;  2DQR A;  4U0W A;  3T8T A;  5CVU A;  1JE8 A;  3J81 K;  2ESN A;  1UB9 A;  2NNY A;  3M8E A;  2VC1 A;  3TGN A;  4MNU A;  2XVC A;  2ELH A;  2E1C A;  4H0E A;  1SD4 A;  2FMY A;  3BRO A;  1BN5 A;  2VE8 A;  1D5V A;  3IRR A;  2ESH A;  1KYW A;  4KIF A;  4LJZ F;  4PZJ A;  2M30 A;  2P5K A;  4WX9 A;  4A12 A;  4A6D A;  3RIR A;  4GCV A;  4L0Z B;  5DD8 A;  3LA2 A;  2ZFW A;  2L54 A;  5IT3 A;  1ZRD A;  4AVP A;  1YIO A;  3CO6 C;  3NEU A;  1WWX A;  4HF2 A;  1J75 A;  1JXS A;  2FBH A;  3IHU A;  3HTU A;  3MQ0 A;  3Q9S A;  1FYK A;  2FQ3 A;  4RB3 C;  3K9T A;  3ML6 A;  3KP4 A;  1RIO H;  3WTX C;  4G8X A;  4IHT A;  2Q2E A;  2EFQ A;  1FP2 A;  2L01 A;  1BM9 A;  4BH9 A;  2BGC A;  4IF4 A;  3I53 A;  3GZ6 A;  5BS6 A;  3ABU A;  2FE3 A;  3QRF F;  2O6G E;  4IPA A;  4EV0 A;  1QZY A;  3ERE D;  4AWX B;  4GO1 A;  2XRO A;  3LA3 A;  1BBY A;  3MEX A;  1FWZ A;  4MHG A;  1QZZ A;  2HDC A;  5FLX K;  4QWQ A;  4MTE A;  1DPR A;  1R23 A;  1RZ4 A;  3ZMZ A;  5E18 F;  4O6J A;  1K78 B;  3HSE A;  3KLN A;  1B6A A;  4EM1 A;  4PGG A;  3ZMD A;  3SXY A;  2MH9 A;  3S2W A;  3P9K A;  5TRD A;  1ZG1 A;  2XUB A;  3CO7 C;  5D4S A;  1WRJ A;  4ZZL A;  1TLH B;  2AXL A;  2EWN A;  2HWV A;  2LSO A;  5A2Q K;  1MDM B;  1K7A A;  2ACJ A;  1KQ8 A;  5JVT A;  4HLX A;  2K86 A;  4QLC U;  4KFC A;  1G6N A;  3FMS A;  2WTE A;  1ONV A;  3E6B A;  5D5X B;  3DP7 A;  1X3U A;  5LHI A;  3CTA A;  1R5H A;  2HFH A;  2O61 A;  2V9V A;  5CVI A;  1UCR A;  2RKH A;  4LMY A;  4I7H A;  2ZCW A;  1F1Z A;  1TW3 A;  3TO9 A;  1FBQ A;  4HV6 A;  1JHH A;  4M6Y A;  4YG2 F;  4EGY A;  2H6B A;  2XAS A;  3L09 A;  1HSJ A;  4OIR F;  4KMF A;  2VE9 A;  1MGT A;  1Z7U A;  3CUO A;  3ZMV A;  3E6D A;  1IAW A;  4Q47 A;  1D3Y A;  5DV5 A;  3QOP A;  3OOP A;  3FHZ A;  3F23 A;  1U5T B;  2EV6 A;  2EFP A;  2LKP A;  4ZZD A;  2D2W A;  1ZLK A;  2FOK A;  1SD5 A;  3U1D A;  1VTN C;  1U5T A;  3E5Q A;  1KU2 A;  1P4A A;  1OYI A;  5E17 F;  2OD5 A;  1JGS A;  2M1B A;  4WXH A;  4L9J A;  4A5N A;  1Z91 A;  1B9M A;  2P5V A;  4P9U A;  4GGG A;  4DQ2 A;  4KIB A;  4EVI A;  1R22 A;  2OBP A;  4G6D A;  1G3T A;  2M87 A;  3IKT A;  5D6F A;  3HHH A;  3I0T A;  3WTS C;  5LBQ A;  2JSC A;  2W84 A;  1AOY A;  2Q0O A;  2DBB A;  1YG2 A;  4L9V A;  4EJT A;  5BMZ A;  3DPT A;  1T38 A;  2VXZ A;  3BZ6 A;  3WTY C;  1SMT A;  1OKR A;  3NRV A;  2BEO A;  1IRG A;  2EFW A;  3KE2 A;  1LEB A;  3HSR A;  2EV0 A;  1YS6 A;  2QWW A;  2IA1 A;  2QVO A;  5L3E A;  2ZNZ A;  3DKW A;  2GIV A;  4LGW A;  1LVA A;  3E97 A;  3R4K A;  2GA1 A;  3IC7 A;  2C6Y A;  4RGR A;  3D5L A;  1IN7 A;  2KIU A;  5DYM A;  3KFW X;  3F8B A;  2V1D A;  2MD5 A;  4LLL A;  5E8I A;  2ZNY A;  2DW4 A;  3ULQ B;  4UNO A;  1Z6T A;  4U88 A;  1MJ9 A;  1U2W A;  5ED4 A;  5ICF A;  4B8X A;  1FX7 A;  4L0Y B;  1XN7 A;  3R0A A;  2EJR A;  1L3L A;  1KQ9 A;  5AIP A;  5E1Z B;  1LDK B;  5AON A;  3RYP A;  4BQA A;  5KK1 A;  4RB0 A;  2YX4 A;  4M9X A;  2UWM A;  1IN4 A;  1FNN A;  3C7J A;  2RGV A;  4YFX F;  3GFJ A;  4XBF A;  2YX7 A;  1BIA A;  5F1R A;  3F8M A;  1J9I A;  2CG4 A;  1J2X A;  3CUQ B;  2BE5 F;  3F3X A;  4M6X A;  3ISP A;  2MC3 A;  3WTZ A;  3K0L A;  3CUQ A;  3QPH A;  4HA8 A;  2DPD A;  2HQR A;  4RB2 C;  4R8H A;  1LEA A;  4O3M A;  5D8L B;  4L9N A;  5DCM B;  2P7C B;  1XSV A;  1FYM A;  2W85 A;  3IWZ A;  2QUF A;  3MWM A;  2HR3 A;  4M74 A;  5DCM A;  5CVR A;  1GXP A;  3KCC A;  1LQ1 A;  3K69 A;  3K1N A;  4AD9 A;  4L9T A;  4UVA A;  3J80 K;  2HOE A;  1KQ0 A;  5L3C A;  4MTD A;  5EEG A;  3GZ5 A;  5FD5 A;  3KP6 A;  1FZP B;  3GLX A;  3F72 A;  2Y75 A;  2Z5U A;  1ZGA A;  1ON2 A;  1U8R A;  2NS0 A;  2VOD A;  3SHF A;  2XHK A;  2A69 F;  4KMU X;  1YS7 A;  4LK0 F;  2ZKZ A;  2VC0 A;  1DUX C;  1WKM A;  4CYD A;  4UVB A;  1Z9C A;  3KET A;  2IT0 A;  2A6H F;  3KLO A;  2XAJ A;  4MQV A;  4M71 A;  4S04 A;  2QZ8 A;  2F5F A;  2L4A A;  2XAF A;  1KA8 A;  3BY6 A;  4KN7 X;  5IT9 Z;  3RJP A;  2HTJ A;  3PQJ A;  2HTS A;  5DCF A;  3G73 A;  3FX3 A;  2JZY A;  1HQC A;  3RDI A;  1MZB A;  1HXD A;  1XMA A;  4MEX F;  1BIB A;  2MBF A;  2IA2 A;  4XRF A;  4LD5 A;  1XD7 A;  1EH8 A;  3WU0 A;  4R79 A;  2EA4 A;  3U2R A;  1IN5 A;  1HKS A;  1ON1 A;  4EJW A;  2MA3 A;  2V1U A;  2CYY A;  5ERI A;  3E6M A;  4I09 A;  3GVA A;  1EH6 A;  2YSR A;  3V7S A;  1BC8 C;  2HQN A;  1P6R A;  1CF7 B;  5F6F A;  2QLZ A;  4MEY F;  3HSF A;  3CDH A;  1L0O C;  3H3U A;  3I54 A;  1IZ1 A;  2D45 A;  2HYF A;  2P7V B;  5D5V B;  1I27 A;  3P9I A;  5HOO A;  3I64 A;  3FF5 A;  4ON0 A;  3COA C;  2QBY B;  3I59 A;  3ECH A;  4OMY A;  1HBX G;  3EET A;  2F5E A;  3C18 A;  5H6Q A;  4IHS A;  2ISZ A;  4UXN A;  3HTS B;  3HUG A;  2L02 A;  3O6B B;  2JPC A;  2XGX A;  3FXQ A;  4ASN A;  1ZAO A;  4BAY A;  1ZLJ A;  3LQR A;  4HLY A;  4CO8 A;  3GFL A;  3WTV C;  5HLH A;  5CVJ A;  3G3Z A;  3LA7 A;  3EYY A;  3R61 A;  2H09 A;  1KYZ A;  1J5Y A;  4L18 B;  1T98 A;  2UXX A;  1XGM A;  3F22 A;  1GXQ A;  2XAH A;  1XDS A;  3LAP A;  2PFB A;  4HF0 A;  5J8F A;  4ZYG A;  3R6S A;  4Z2Y A;  3DEU A;  4I0B A;  5D6E A;  1LNW A;  2OQR A;  5J8C A;  3GWZ A;  2FEZ A;  4UHT A;  3Q5F A;  2NAZ A;  3FWE A;  5HLI A;  2KJC A;  3PFI A;  1JHF A;  3HRS A;  1R5G A;  1PDN C;  4FT8 A;  1U5T C;  1ZGJ A;  4HZF A;  5J6X A;  2CWE A;  3WE3 A;  4UV8 A;  1LDJ A;  4IJA A;  1IXR C;  1U3E M;  3QU6 A;  3WTT C;  2XKP A;  4IRI A;  1OR7 A;  1ZAR A;  2A07 F;  2PJP A;  1B4A A;  4RGU A;  1K6O A;  4A0X A;  2DT5 A;  5D8K B;  4CHU A;  3T0Y A;  2PQ8 A;  3N97 A;  4I98 B;  4LLG F;  3H3Z A;  4U0Y A;  2MLK A;  3TKY A;  3ZP5 A;  4L5J A;  2DFI A;  1IF1 A;  2STW A;  4EJU A;  4IVN A;  2VBY A;  3T5X A;  1PP8 F;  2XV4 S;  1K78 A;  1YQA A;  2STT A;  4KT5 C;  2JRT A;  5FO5 A;  4N9H A;  1YW8 A;  3RI4 A;  2YPR A;  3JTG A;  3FMR A;  1BOA A;  2P4W A;  3GW2 A;  3DPL C;  1MDM A;  3V4G A;  2XRN A;  2M45 A;  1QPM A;  2HZT A;  1OMI A;  4BYY A;  3RTR A;  3K1M A;  3KEQ A;  1K79 A;  2GZW A;  4EGZ A;  4B09 A;  2PG4 A;  1TQP A;  4FHT A;  1S6L A;  3VOE A;  2Z99 A;  1FC3 A;  4KN4 X;  2E7X A;  3O2P E;  4A2U A;  2Z3Y A;  1SFU A;  1TQM A;  5LGT A;  4U7B A;  3WU1 B;  2X0L A;  3QU3 A;  4A0Z A;  3Q9V A;  2G9W A;  4I0A A;  1HW2 A;  4BHB A;  2Y0M A;  3BJO A;  1T0F A;  2NNN A;  3KP2 A;  3REO A;  3TQN A;  3AAF A;  4BXU A;  1RI7 A;  3W6K B;  2PBI A;  2DPU A;  1FY7 A;  1QQI A;  2XIG A;  3F8N A;  4HDU A;  5HLG A;  4OIP F;  1XGS A;  2E1N A;  4ZYE A;  3LAJ A;  1S29 A;  4EMS A;  2O8X A;  1KU3 A;  2VBZ A;  1Z05 A;  1G3Y A;  1XMK A;  3ECO A;  4P55 A;  2V6C A;  2W57 A;  3JW4 A;  1HKT A;  4D0P A;  4I01 A;  1MKM A;  1S7A A;  3F8F A;  5LEJ A;  3NQO A;  1J7K A;  3CJN A;  3RPU A;  1WSU A;  1R00 A;  1IXC A;  2LNB A;  1KU7 A;  2Z33 A;  1GVJ A;  2OA4 A;  2ETH A;  2OU2 A;  5D5W B;  1RUO A;  2A6E F;  2FBI A;  4KUM A;  2ADU A;  2X4H A;  5KVR A;  4M72 A;  1MJA A;  1QBJ A;  1MD0 A;  3RKW A;  1P4X A;  3VFZ A;  4XLP F;  2ZME B;  3FMQ A;  3M7G A;  2ZXJ A;  5JFR A;  3DQV C;  5L3D A;  4IRH A;  5ILV A;  2ZME A;  1UHM A;  1MJB A;  1UFM A;  4EM0 B;  3TOB A;  2RN7 A;  3TOA A;  3JSO A;  3ABT A;  3BDD A;  4PGH A;  3RKY A;  5FFX A;  4ETS A;  2DAO A;  3HRT A;  2QEN A;  4NQW A;  3SZP A;  1H0M A;  2QM3 A;  4IRG A;  3I5U A;  2HS5 A;  2TDX A;  2EFO A;  2L3D A;  5HDN A;  3I71 A;  1LJ9 A;  1FPQ A;  4BHP A;  4WF2 A;  3EDP A;  4YII A;  2VOP A;  3F6V A;  2JT1 A;  1ZG5 A;  1I5Z A;  2UZK A;  2Q8K A;  1FT9 A;  1ZH5 A;  5FGM A;  4HX7 A;  4NB5 A;  4L5I A;  5L3F A;  2OZU A;  1B1B A;  4RGS A;  5CVV A;  1J59 A;  5E8G A;  1REP C;  1DP7 P;  2DU9 A;  1XDU A;  2W24 A;  4JQF A;  2MLG A;  4XSX F;  2RVC A;  2CQK A;  3DFG A;  3E5U A;  2EV5 A;  2FBK A;  2IA0 A;  3GXO A;  4FX4 A;  2DK8 A;  2DLL A;  3L7W A;  3ZN1 A;  1F4K A;  4Q48 A;  5HS9 A;  5ICG A;  1XCB A;  1TBX A;  3BWG A;  2R7D A;  2PMU A;  4P96 A;  2GAU A;  2H27 A;  1BI0 A;  3KP5 A;  3IKV A;  2FNP A;  2B0L A;  2HEO A;  3RPQ A;  1KGS A;  5D4R A;  2PEX A;  1OYY A;  2DQL A;  3P9C A;  2COM A;  3FXR A;  4HBL A;  2DI3 A;  1F5T A;  1HW1 A;  4RB1 A;  1QGP A;  2CO5 A;  1UHW A;  5DEQ A;  3M1E A;  4HX4 A;  2KJB A;  4U7D A;  2F2E A;  3LQQ A;  2M5W A;  1RUN A;  2RC4 A;  2DTR A;  1YYV A;  1IXS B;  5ILS A;  2UXN A;  4I2O A;  1DDN A;  2PI0 A;  1P2F A;  1W7P B;  2RV8 A;  2PLY A;  1W7P D;  4AIJ A;  4GYI A;  1G3W A;  3GUD A;  4N9I A;  4KA4 A;  3C3W A;  4YFK F;  1R1U A;  5BPD A;  1W7P A;  3GO5 A;  3D0S A;  1ULY A;  1I1G A;  5L3G A;  3JAM Z;  3GYH X;  4ENK A;  3GFI A;  4LG0 B;  2J5P A;  5HDK A;  1T39 A;  3R60 A;  4NHJ A;  3L9F A;  4LG0 A;  4OIO F;  1XGO A;  1SFX A;  2XAQ A;  1OYW A;  2P6T A;  1W4M A;  3J81 Z;  2JTV A;  1YTY A;  4KIC A;  2P8T A;  5LRR A;  1FP1 D;  4HYE A;  2WWY A;  4JBA A;  1FSH A;  3K2Z A;  1TNT A;  4OMZ A;  1SD6 A;  2GXB A;  2K27 A;  3KZZ A;  4RGX A;  4HF1 A;  1B9N A;  4FX0 A;  4OU0 A;  4Y17 A;  3WOD F;  4S05 A;  5E20 A;  5DUK A;  1S8N A;  4WWC A;  2EB7 A;  2BV6 A;  3ZMU A;  2V79 A;  1CF7 A;  4I02 A;  6PAX A;  3SZT A;  4CGZ A;  3F8C A;  1BI3 A;  1TQI A;  1T2K A;  3WE2 A;  1J0R A;  3TO6 A;  2PN6 A;  2YR2 A;  2HKO A;  1HST A;  2VN2 A;  1HW5 A;  2QBY A;  4ZYH A;  2FNA A;  1EV7 A;  5IT9 K;  1SD7 A;  4RAZ A;  1O3Q A;  1YW7 A;  2QQ9 A;  3BPV A;  1P92 A;  3JTH A;  5L3B A;  2VBW A;  3ZMS A;  4CDG A;  5K5O A;  2HKX A;  3T1B A;  3QP5 A;  2D1V A;  2FA5 A;  5FLX Z;  3GX4 X;  4OOI A;  3KP3 A;  3IRQ A;  5BQT A;  4WK8 F;  3HHG A;  4EJV A;  3LFK A;  3V8J A;  2FSW A;  1T6S A;  1IUY A;  3E5X A;  1EH7 A;  1FBS A;  3LST A;  5HDG A;  5LHG A;  5A2Q Z;  1TTY A;  3T8R A;  2MH2 A;  3BJ6 A;  2XAG A;  2A68 F;  3L00 A;  4ESB A;  3BPX A;  4WCG A;  5ICC A;  5HS7 A;  2K7L A;  4F7Z A;  3HOS A;  1ZHF A;  3FM3 A;  2IPQ X;  3P7N A;  4A0Y A;  1Y0U A;  4AIK A;  1YLF A;  2DO7 A;  2J5O A;  1F9N A;  1AWC A;  3M8F A;  4LK1 F;  5BOX A;  4OIN F;  3ELK A;  1ZN2 A;  2F5D A;  4UUV A;  2AS5 F;  2OZ6 A;  2CW0 F;  5LLQ A;  1U78 A;  5AIQ A;  2FRH A;  4PCQ A;  4WXD A;  2KRF A;  1W5S A;  1ZG3 A;  2EFN A;  2QYO A;  3F21 A;  2QQB A;  4P9F A;  3JSP A;  2IJL A;  4E70 A;  1O7F A;  5K1Y A;  4ZH4 F;  3GFM A;  4LB6 B;  2O3F A;  1XSD A;  2VON A;  5LHH A;  1O3R A;  4KYW A;  5ILU A;  2KKO A;  3TDU C;  3C1D A;  3LWF A;  5FFZ A;  3BP8 A;  4KDP A;  2KIF A;  1FOK A;  4ENJ A;  1Q1H A;  1A04 A;  1ZRF A;  3IL2 A;  3I4P A;  1P4W A;  4HW0 A;  2KIM A;  3QP6 A;  4M9S A;  3TO7 A;  4KIG A;  1U6G A;  1YFH A;  1BJA A;  4GXO A;  2VT3 A;  3HIF A;  4U0V A;  2GXG A;  4M73 A;  1E2X A;  1W5T A;  4XLN F;  4PDK A;  1H9G A;  4K2E A;  3WTU C;  1ODD A;  4N0B A;  1FLI A;  1O7L A;  1PUE E;  4MGR A;  4G94 A;  3J7A O;  1YW9 A;  4M9Z A;  4HQM A;  1GHC A;  3WGH A;  2ZO4 A;  2EA2 A;  3ZMT A;  4Q4Z F;  2K4J A;  3FXU A;  3V7R A;  4GYG A;  2VT2 A;  5CYV A;  2O03 A;  5HVQ C;  5JR3 A;  3VB2 A;  1HKQ A;  4Y15 A;  4LFU A;  3EQL F;  3I58 A;  4UV9 A;  5LRS A;  2HGC A;  1XSX A;  4A5M A;  3MZH A;  3VEP A;  1D8J A;  4UVC A;  3EYI A;  2GQQ A;  3K1P A;  3OV8 A;  3CUQ C;  3SQN A;  2H94 A;  2CFX A;  3W6J B;  3O3K A;  4Y13 A;  5HS8 A;  2RDP A;  5JI6 A;  3KP7 A;  1CGP A;  1PP7 U;  2R7F A;  2D1H A;  3GF2 A;  3B02 A;  1FBU A;  1XB4 A;  4AIH A;  3ZN0 A;  1FYL A;  1TNS A;  1R1V A;  1S3J A;  1USS A;  3DV8 A;  4KNY A;  2E7W A;  2K02 A;  1R36 A;  3HRU A;  1WI9 A;  3BOQ A;  3QAH A;  2IW5 A;  4MQ9 F;  3MZY A;  4TV7 A;  3TDZ C;  2L4M A;  5LGN A;  2ZBK A;  5FB2 A;  3RYR A;  3QPT A;  2XKO A;  3MAJ A;  3BJA A;  5CJ9 A;  3GEZ A;  2IRF G;  1TW2 A;  5DDG A;  5TJJ A;  1XGN A;  3WGG A;  2FU4 A;  2EK5 A;  2W25 A;  4IXA A;  5DD4 A;  3N4M A;  2DK5 A;  2NYX A;  2FF4 A;  3RKX A;  1OPC A;  1QNT A;  4HAM A;  3WG9 A;  2CGP A;  4ESJ A;  3U9G A;  2A5Y B;  3FZV A;  5D5U B;  2CSO A;  3PQK A;  2V1X A;  1H9T A;  3J80 Z;  1Z6R A;  3HYI A;  1O3S A;  3R0J A;  4CXF A;  3E3V A;  4G7O F;  2VOO A;  5CLS A;  1Z1D A;  2K4B A;  5LGU A;  1O3T A;  1R58 A;  5H20 A;  1IRF A;  3DF8 A;  1DPU A;  3WTW C;  2QQA A;  1BC7 C;  4RS8 A;  3KZY A;  2ZJ2 A;  1R1T A;  2RNJ A;  2FXA A;  2BBY A;  1S7O A;  1QO0 D;  1O57 A;  3FM5 A;  1SFE A;  1LDD A;  4OIQ F;  2R3S A;  3EUH A;  3V7C A;  3HRM A;  1BI1 A;  4LB5 A;  2OQG A;  1RNL A;  3DXJ F;  2WV0 A;  5JHU A;  4LLN A;  5H6R A;  4BHC A;  4ENM A;  1D8K A;  4YFN F;  2FML A;  4G6Q A;  4CZZ A;  2GWR A;  3ZQ7 A;  2HYG D;  2RQP A;  4YIF A;  3V8L A;  4P5O A;  1B59 A;  2VBX A;  2G7H A;  4O5V A;  1C0W A;  1UST A;  5DUI A;  3L2C A;  5E1W A;  1E17 A;  5K5R A;  4ENN A;  2A61 A;  2PMH A;  4ESF A;  2H6C A;  2G7U A;  4HV5 A;  3MCZ A;  1LB2 A;  2Z9O A;  2LF8 A;  5BPI A;  1SAX A;  1ZRC A;  1V4R A;  2IVM A;  4RAY A;  2YU3 A;  4Q5S F;  1I1S A;  3VOD A;  1IN6 A;  3V8K A;  4HDV A;  2F5C A;  4HQE A;  3WGI A;  5FD6 A;  5K5Q A;  3F6O A;  2M8E A;  5F64 A;  5E1X A;  4CIC A;  3CLO A;  1FSE A;  1NHA A;  4A6E A;  2WC2 A;  4EJO A;  3SFZ A;  4DNC A;  2LF7 A;  3MFK A;  2GA2 A;  4G7H F;  1STZ A;  1IN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...