3DWLE

Crystal structure of fission yeast arp2/3 complex lacking the arp2 subunit
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
129
structure length
63
Chain Sequence
IDECIGLFRANCFFRNFADRTLIYGTLFISECLERQLNFRQELAYRLLSKWWTCFSKRRFMNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-related protein 3
publication title Structure and biochemical properties of fission yeast arp2/3 complex lacking the arp2 subunit.
pubmed doi rcsb
molecule tags Structural protein
total genus 11
structure length 63
sequence length 129
chains with identical sequence J
ec nomenclature
pdb deposition date 2008-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF04062 P21-Arc ARP2/3 complex ARPC3 (21 kDa) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2810 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3dwlE00
3DWLE
chains in the Genus database with same CATH superfamily
4II3A 3RPUA 1AHDP 5M3FJ 5BPDA 1JE8A 3KP7A 4G6DA 5L3GA 1POGA 3TO6A 3IH4A 1FBSA 1WI9A 2DA7A 3PUFA 3KYLA 2YUSA 3ZQGA 1LVAA 3RPUD 3RKQA 4IXAA 2DT7B 2R5YA 3K1MA 1YS6A 4LD5A 2Z3YA 4WXDA 2JRMA 3S32A 5LHGA 3IKVA 2YSRA 2E2JJ 4HV5A 1KU2A 4P5OA 3GTPJ 1YW9A 1QPMA 4J19A 4R8HA 1I39A 1XD7A 3BG3A 2CGPA 3DTEA 3JTGA 4ZYGA 3DPLC 2K4JA 2LBFA 2ZJQF 2QA4I 1UZCA 5HS9A 2O0YA 2VJ5A 1J7KA 5J1UA 5EG0A 1RUNA 1OISA 3MFKA 3E5XA 4LOCA 4IHYA 4NC6A 4QWQA 1MSEC 1N77A 2GQQA 3PJRA 2IXSA 3GO5A 2R7SA 1HQCA 3I4PA 3I59B 2L7MP 2PMHA 1YJWI 3K2ZA 1JT0A 4CYDA 1DUXC 3I58A 2ZXHA 2A61A 4PJLA 4EGZA 2W48A 2WV1A 2QKMB 4V2FA 5TGTA 2V1UA 5F04A 1I3AA 4LMYA 1V3FA 2LRDA 3O3KA 4ANJA 2E19A 4KN4X 5IP6A 3W2AA 1TWGJ 5LD2C 4XLPF 5D4SA 2ADUA 2PMZN 2IT0A 2Y0SN 2NYXA 4CCMA 2PQ8A 4PSXA 3S16J 3BTJA 1FWZA 1IRGA 1YTYA 4L5JA 1S7OA 1ULYA 3T8RA 1MMSA 2AQEA 2CRGA 2VUMJ 4RAYA 3V7RA 1D1AA 4P55A 3G6EI 4BAYA 3GFJA 1J0RA 1O7FA 4QSHA 4UUSA 4A93J 2CQKA 3T1BA 1MNMC 2Q1ZB 1R7JA 4IRHA 2BW3B 3H3ZA 5F08A 1Z67A 4UVAA 1H8AC 3WTVC 4HF0A 2CQQA 1AWCA 1SVLA 4PJJA 3U1KA 1IJWC 1X2NA 2FBIA 2KHMA 3A01A 1UHWA 4CA0A 4B48A 1U8BA 1BJAA 4EJTA 4I0AA 2R7DA 3REOA 2OF7A 1I27A 2X1EA 1UHMA 2W24A 4KDPA 5AIQA 3Q9SA 1LFPA 2ETHA 4GDFA 4D7MA 4XKCA 3KEQA 1JJ6C 4BJ6C 3LSRA 1DGWY 1U5TA 1FIPA 2K9NA 2VC0A 1JKOC 5F0CA 1OR7C 3K4KA 3ABUA 3S3MA 2CWEA 4BUPA 2UWMA 5ICCA 1XG1A 1MD0A 2JVGA 2PJRB 3RYRA 1BC8C 1BR4A 1SMTA 2Z1DA 1PJRA 1QHHD 2HI3A 3PM1A 1O3QA 5FB2A 1JUPA 2KZVA 4CO8A 1WZ2A 2K86A 1K6YA 5J1RA 4HRIA 1MJBA 4RS8A 2DA3A 5LLQA 2FEZA 2FOKA 1ZR4A 3KIOA 1IV8A 2IA2A 2E1OA 1SD7A 2LKPA 3DKXA 3FXRA 5DS9A 5KK1A 2JA5J 3L2QA 5BPIA 4A0YA 4Y15A 4I99C 3AG2H 4Y33A 2HVQA 4EVIA 5AIPA 5FGMA 2P5KA 5LGTA 1ZK8A 4XOPA 4YIFA 1XPXA 1V5FA 2MW8A 4KJZA 4BQAA 2DN0A 4I6ZA 1VF9A 1D5YA 5IP9J 2R7QA 1RR8C 4RAGA 4JBAA 1O3SA 2X6XA 3N4MA 1AKHB 2XPUA 5IYDJ 2E34A 2HYGD 4RB2C 1FPQA 2DMQA 4JOMA 3QRFF 4KNYA 4NC7A 2XVCA 1M1EB 3ABKH 5B66C 2ZXWH 2I10A 5E1ZB 5GAHJ 4OWRB 1LDJA 4ZZDA 1SEUA 1BIAA 2MH2A 3CZ6A 1IDYA 2P5VA 4IVNA 1I1GA 2GAUA 2ZJRF 1ENHA 1S7AA 1TL8A 3HEFA 4PGHA 3KP6A 1T95A 4G9YA 1SD6A 1YE9A 1ZAOA 1YIJI 3QODA 3WE2A 3I59A 1P7JA 2ESNA 2WAQN 1HSTA 4MO7A 2HGCA 1H9TA 3M8JA 1A04A 3H35A 4JK1X 1K61A 4UVBA 2LTPA 2QLZA 4NC8A 2HYFA 3COAC 4BE1A 3R60A 2VC1A 1FOYA 2HVRA 3C2HA 3V7CA 4IRGA 4D5FA 3BJAA 3H3UA 3C1DA 2LLKA 1F43A 1WCMJ 2CQNA 2STTA 2HEOA 4EM1A 3MKZA 2KZGA 5KAFC 3RKXA 3VYUB 4RA2A 3EPZA 2D45A 3EQLF 1RETA 2P6SA 3A02A 1LB2A 1O7LA 3ELKA 1XGSA 3S15J 2Z33A 4OMZA 3N05A 1B9MA 1UG2A 1Z91A 2ZJPF 2Y0SA 3ZN0A 1S7EA 4G8XA 2LG4A 4OAYA 3SFIA 3OOUA 4DJAA 4B8XA 1FOKA 3CMEI 2BW3A 4ZYDA 4HDVA 5H20A 2G0EA 2M1BA 4W1UA 4CDGA 1L0OC 1R49A 2AO9A 1ZREA 1V54H 2M8EA 2QZ8A 4HF1A 2LY2A 3NAUA 4KN7X 3GF2A 3V4GA 3K10A 3EYIA 1FSHA 3CCUI 5H6QA 3BPXA 1IO2A 2STWA 2HQ5A 2HU9A 2VLAA 3SEQA 5LRRA 2N8GA 3RPQA 4IZZA 5LFAA 3FHZA 4RMNA 4UB6C 3M3YJ 3JRHA 3HOWJ 4MFDA 1GVJA 1D8KA 1GVDA 1ETVA 2YX4A 4M6XA 2DXIA 2PJRA 2BV6A 3WU2C 3F21A 3E97A 3K70D 2M30A 5A2QZ 2NRAC 1VQ8I 5CKTA 4AYBN 1IRXA 2K02A 4HLYA 3PUBA 5EZGA 4CH7A 3JR9A 4BY1J 4S05A 1R22A 5E79C 3IL2A 3G3ZA 5DTDA 2BXYA 3F6OA 4B43A 1Y39A 4HOBA 5FD5A 1S5LC 2FU4A 4E7SA 5HNFA 4PFPA 1W0UA 4XSXF 1R00A 2G9WA 5D6FA 2GIZA 1TBXA 1R4MB 3OYHA 4Q5SF 3BC8A 1OMIA 1D0XA 4N4NB 4XK4A 1V5GA 3CC2I 2FBHA 1UELB 3S1QJ 3FDYA 2IA0A 1WJAA 3DF8A 3I5UA 1KQ0A 3K2AA 1D5VA 1RKWA 3BJ6A 2PN6A 5DM6F 2VASA 1F1ZA 1VQOI 1IZ1A 3W6VA 2A6TA 3OYIA 2L3DA 2K5CA 1LEBA 3MEXA 1AKHA 3HB9A 2ICWG 1BM9A 3MMYB 3ZQFA 1MBKA 2DBBA 4XLFA 1R5HA 2HOAA 4A5NA 1HDPA 3S8PA 2VB6A 5K7FA 3I3LA 3MZHA 2LKSA 3PQJA 3ZXSA 2O5RA 2PMUA 5JVGF 3TL4X 3HSFA 3NWTA 3V8JA 3LA2A 1CGPA 4GXOA 3WTWC 2WV0A 1TC3C 5JI6A 3K4BA 2LSOA 2DFEA 2OBPA 3LSMA 1CQTA 2L0KA 3RJPA 4UV9A 3KP3A 4XN0A 3F23A 4XLAA 1B72B 4DQ2A 4B4CA 2LKXA 1D0YA 1ZRDA 1R6RA 2I8DA 1DGRM 2KIMA 2R7XA 1JKQC 3EUKL 1BL0A 1RUOA 4M6YA 2A6EF 1MMAA 4ZDOA 4FX0A 3KETA 3G1LA 1Z6TA 4KITB 5DD4A 3PL8A 2F5VA 5HVQC 1NH3A 1X3UA 4D0PA 5CPRB 3HOVJ 3CUQB 1XC5A 4OINF 5HLIA 1LE8B 3IUOA 2ZMEC 4BS9A 1J59A 4DZPA 4G7OF 3C7JA 2XF5A 3O8GA 2EZKA 1TQPA 2HS5A 3OL3A 3DXJF 4HNVA 3AG4H 2WAQA 1SD4A 3SFZA 1YG2A 1ZYRF 3I54A 1K4TA 2RQQA 2CW8A 4BBRJ 4F93B 3GMEA 2IS1A 4IRIA 2DA6A 1BJZA 2PFBA 3ZN1A 4ZJZA 1MNDA 3OYFA 1X2MA 1YQAA 5E3LA 5IT9Z 4L9NA 3KX2A 2Y9YA 4XLNF 4HF2A 1Y8QB 2KT0A 4FCYA 3L2RA 5F64A 3HXLA 2H8RA 3WTZA 3PIOF 5EEAA 4DYQA 3Q0VA 4Q4ZF 2VN2A 2BZTA 4CZCA 1Z77A 2W00A 5J8FA 3LMMA 1A5JA 1Z21A 3BJOA 2OA4A 2ID3A 2OD5A 3C2GA 1J5YA 4RGUA 2C6YA 4C3HJ 3GXOA 2V26A 4KT5C 3A2KA 1ETOA 2CMPA 5D6EA 2JK3A 4J01A 2F5FA 5B1AH 1I6HJ 3DKYA 1XTAA 1TT5B 2JSCA 2WY8Q 4L0ZB 4UY8I 4BQNA 1SFXA 4KMFA 1RESA 4XRMA 2CUFA 2V1NA 2HQRA 2XGEA 4RB3C 1XMAA 3H5RA 1IRFA 1ON2A 5J3LA 3HOYJ 3JTHA 1WSUA 3KZYA 4CCJA 3RQ4A 1W7PB 2Q0OA 4BQOA 3TP0A 4AU7A 4EGYA 1ZH5A 3VYSB 4PDKA 2VODA 2VPRA 3MD2A 2ZSIB 2W82A 5FFZA 5D5XB 2X0LA 4EJUA 1C0WA 2IP2A 2XAFA 4LLNA 2F5CA 3EUHC 4F55A 1SANA 2FX0A 4RB1A 3CDHA 2LD5A 3ROUA 3ABMH 5D5WB 3ULQB 3FMRA 2NS7A 3GFMA 4B1RA 1Q1HA 3DBHB 5F1RA 4BJTA 3OYKA 3ZQ7A 1XB4A 3P9CA 3FIWA 5F6FA 1ETQA 4GCVA 4N9HA 3AL0C 3BR2A 3F8FA 1WJDA 3CTAA 1JKPC 2VOOA 4MQ9F 3CLOA 4O6JA 3GEZA 2V9PA 3CD6I 3GCMA 3QU3A 1OLTA 4IO9F 4KYWA 2LP0A 4I98B 4XR6A 1YJ9I 3FXUA 4IHXA 2XIGA 2KRCA 3BP8A 1K83J 3CCSI 3FF5A 4BXFA 5JLWA 2M7BA 2PG4A 2O9LA 2JSPA 2E2IJ 1LKXA 2CU7A 2Z2SB 1AOYA 5AONA 4CYCB 3IRRA 3OYAA 4IHVA 2VBWA 2WAFA 3S3NA 3BQZA 3K6GA 3CJQB 3K69A 2IW5A 1YRNB 3K0LA 2K3PA 1USTA 2YS9A 3F3XA 3HOXJ 3IKTA 1TT0A 4HSTA 3WHBA 2LC2A 1SFKA 3LWFA 2GA1A 2QUFA 3K4CA 1B72A 2DQLA 5JFRA 5FRNA 1KONA 2L9VA 4ESFA 2HKXA 1FJLA 2OCEA 3JRIA 1TW3A 4ENMA 4M9XA 4YEJA 2MGQA 1VQPI 3TOAA 4AVPA 3C2BA 1WKMA 4ESJA 1OPCA 4E70A 1WH5A 5K5QA 5DM7F 2QQ8A 2FUG2 5EF6A 3CUQA 5L3FA 1T08B 1XSXA 3ERED 1KU3A 2Q2EB 1F5TA 1H0MA 1LE8A 4PJMA 2FA5A 4LIVA 3T0YA 3F8MA 2GXBA 3HSRA 2A5WA 4M3DA 3HKZN 2Y30A 2XRLA 2FSWA 2W4SA 3OIOA 4XRSA 1NG6A 3VSKA 1OJLA 2CG4A 2EFQA 1X19A 5EEGA 2M3AA 2DOFA 1NHAA 3RZDJ 4CHUA 2DFIA 2GM4A 2DA5A 2AQFA 4KIBA 2UXNA 2JA6J 3CLQA 4DW6A 2X6YA 1PP7U 2CQ7A 1XCBA 4G6TB 4HDUA 4AUXA 3ASOH 3BLYA 3FXOA 2IGKA 2UUZA 5FKNA 3QPLA 1JHHA 2IS2A 5HDGA 2F4IA 1FP1D 2NS0A 1KYWA 2Y2ZA 1WI3A 2HTJA 4X1EA 5DUKA 3HRSA 2D2WA 4AD9A 2O8KA 2Y31A 2CW0F 1TW2A 1HSJA 1DPRA 1RIOH 1TP4A 3H0DA 2ECBA 2RDPA 3FBIB 4B3XA 1OCCH 5DCMB 4F91B 1Y56A 3W2VA 4U7DA 3F22A 1ODDA 1LFBA 1IUFA 2E1MB 1S8NA 3S2WA 1SVOA 4E7JA 3CDLA 5C44J 1TZLA 3I64A 2VKHA 3RTRA 3GBGA 5HNHA 5EGOB 3VSLA 1V5EA 3CJRB 2CYYA 1QQIA 5IT9K 2K9LA 2M4KA 4RBOA 2ELKA 9ANTA 4AIKA 4RGRA 2P6TA 4M74A 1ACIA 2M9HA 2Z5UA 3BCBA 4IPAA 4KMUX 3ZP5A 2ACJA 1D3YA 3GUDA 3NRVA 3CP8A 2LR8A 5DYMA 2HR3A 1UMQA 2MC4A 3DTIA 2GWRA 3I9V2 3RZOJ 1YW8A 3L9FA 2P4WA 5E3MA 3KPHA 2EWNA 2IPQX 3S2HJ 2IA1A 5DEQA 2XAJA 1MKMA 1WWXA 3FXQA 4LIUA 4U0VA 3GLXA 1WJBA 4QPOA 1YJNI 3B02A 4A0ZA 1VQKI 3J7YJ 2P5LC 4IOCF 4CUGA 3KZIC 3R4KA 5E3OA 2X4HA 1R23A 3HOTA 3W6JB 2HDCA 3RIRA 1JJ8C 1HW1A 2D5VA 3E7LA 5CQGA 4CYCA 2MD0A 2VQCA 5EEHA 1G2HA 2GOXB 1GV2A 2A3SA 1YRNA 4QTRA 1YO5C 2EIKH 2AXTC 3R61A 3T5XA 2VQLA 3QPTA 2COBA 2L9RA 2DI3A 3KFWX 1VZ0A 1LQ1A 2LF7A 4PGGA 2V1DA 2VJJA 1ZGJA 5HODA 2AXLA 5E3NA 3SEZA 4NNJA 3OIQA 3BR6A 4MEYF 1QZZA 1Q1VA 4E4HA 2RV8A 3I4NJ 2JUCA 3KZZA 2EIJH 4IKFA 2FE3A 2L01A 1FC3A 1MDMB 3KP4A 4DNCA 4B3AA 3KLOA 1JUSA 2EV5A 2G7HA 2NXNB 4J00A 1Z3XA 2QWWA 3HM5A 1S3JA 4HV6A 4WCGA 2JQ7A 4I0BA 2XGCA 3U2RA 3DU5A 3TKYA 3SDGA 5EDNA 1PUFB 2K4BA 4A0XA 4FISA 3FK7A 2CW7A 4XOTA 3S3OA 2Q2EA 5EZHA 2X1CA 5ILVA 4E7LA 1YW7A 4I2OA 5TISC 1OFCX 3SZGA 3TP3A 1EKEA 4XKWA 5ICFA 1A6IA 2MYSA 2IS4A 2XROA 1P4WA 3IC7A 3S2DJ 5D8KB 2IAIA 1R4NB 3QPSA 3CF2A 4I7HA 2D1VA 3MQ0A 2F2EA 2WB1N 3G1MA 4DOZA 5IYBJ 1PP8F 4UNOA 2DMUA 2ESHA 1QPIA 4MFEA 4IL6C 3IHUA 2W7NA 1XSVA 2I5UA 2XAUA 4OIPF 2H6BA 3JRAA 3CCYA 4U0YA 1QVTA 1YYVA 1U3EM 4BHBA 4YFNF 3ZMDA 5KVRA 3TBIA 1R58A 3I55I 3JAMZ 2FOWA 4MIMA 4S04A 4W97A 4A3CJ 2KDZA 1T38A 1MH3A 2H1KA 3V8KA 1Y1VJ 2MG4A 2DJNA 3C3WA 2HPIA 1JI8A 3VDXA 2M0CA 1I6XA 1ZGWA 2MD5A 3HTSB 3F6VA 3BOQA 4RLFA 2W84A 3I71A 4FX4A 4Z6YA 2M0MA 3MVPA 2F6CA 3G2BA 2GA2A 3GTQJ 2LF8A 1PDNC 2CUJA 2DMPA 3HHHA 1X4PA 2OAZA 4B44A 3ONQA 1MMNA 4KIGA 5DD8A 2V6CA 2M87A 1TWCJ 5DCMA 4Y7NJ 5FKLA 2ZNZA 5ICEA 3CCJI 3GW2A 2HOEA 3AAFA 5BOXA 2DQRA 2R7OA 4BE2A 3JRGA 1IUYA 3FHNA 1IN8A 3ZQCA 1O57A 2ZBKA 3WTYC 2EFPA 3G73A 1J75A 3DLAA 5FLVA 3TO9A 4Y13A 1WGXA 2EA4A 3A03A 5EGOA 4A3LJ 3AG1H 4GGGA 1U5TC 3L00A 2MABA 4JX6A 2HKOA 2L54A 1W5SA 1GXPA 2WC2A 4ZYHA 1KQ9A 5F0FA 1MH4A 3TQNA 4PK4A 2K3FA 3S93A 3CCRI 5LHIA 1W4MA 2BY3A 3CCEI 4M3GA 2ZNYA 3CMMA 4HX8A 1G3WA 3Q0WA 3DCFA 4P9UA 4G6QA 2KJCA 3ML6A 4HPQA 4BHCA 2XSDC 2EQRA 4R1HA 3P9KA 3E0JB 1UCRA 3OR2C 4Y3OA 1SMYF 2XKPA 4M9ZA 2DDAA 4C3JJ 1D1BA 4PCQA 2FRHA 2B0LA 1BI2A 4DYCA 3ECOA 1STZA 1GUUA 4XICA 4ZTFA 3M9AA 4AVZA 5M3MJ 1R1TA 2VJIA 4ZC3A 3BQYA 2RN7A 3ZCOA 2DJIA 1HW2A 5K7HA 2EINH 3DV8A 3RYPA 2WTEA 2EIMH 3Q9VA 2DFHA 3VYTB 1T56A 3OYNA 4MTEA 2XASA 2PMZA 2PJPA 2OUMA 1YI2I 2DK5A 2O7OA 4C9YA 2K7LA 5HOOA 3E3VA 2XSJC 2LDUA 2L2OA 2UXXA 4NQWB 1FT9A 2K40A 2KJBA 5FLMJ 1T0FA 3QPHA 5B3SH 3JRBA 1D1CA 4PFOA 4RAFA 1T6SA 4ETSA 4BYYA 1QGPA 2LK2A 3VOEA 3QP6A 1MDMA 4KISA 1ZLJA 2CQXA 4M72A 2FNAA 3K4NA 1NK2P 1WFXA 3L2CA 1X3ZB 3TGNA 1EH8A 4KIFA 3WGGA 3DLLF 2BEOA 2M8GX 1TNTA 1PUFA 1PVEA 1P9QC 2L9SA 5CVVA 1E3PA 2BVLA 2OCCH 1GXQA 4LJZF 5HLGA 3OR1C 1XN7A 1VFCA 3JCUC 2O03A 2ZSHB 3OSGA 1HLVA 2ISZA 3BR5A 1JT6A 2KQRA 2D1HA 1X4OA 4HX7A 2R92J 1Y8RB 5FKKA 2L7ZA 2NVYJ 2QQBA 2DPUA 2DA2A 2IEKA 1EH6A 3OYCA 2XPVA 4M73A 3KLNA 1N78A 4HX4A 1BOBA 4G7HF 2H8WA 1MZBA 1I1SA 3FBNB 5CVRA 3HJEA 3G1OA 2R7RA 3F9KA 1IGNA 4NHJA 4Q48A 6PAXA 2JWTA 4LK0F 3VYRB 5E18F 3BG7A 2GOMA 1MBFA 3HRMA 3LSPA 1QHGA 2V9KA 3LA3A 3W3CA 4A3MJ 3ZMVA 5L3CA 4OMYA 4U87A 1E0EA 3HOUJ 2EB7A 3LSHA 2E1NA 1FOWA 2M5WA 4O5VA 3FZVA 2DYSH 2W57A 4HA8A 1TWAJ 2Z16A 2FF4A 1TQIA 1UAAA 2HDDA 3GZ5A 1QVUA 1A31A 4Q47A 3FMSA 4EV0A 4JYKA 3WGHA 5FLXZ 3RKWA 5GTIC 4L5EA 3P7NA 1DQUA 4RM3A 4CZZA 5D8LB 3ZQHA 3LFKA 1IN6A 4ON0A 3D5RC 3MKWB 2F4MB 2DOEA 2JA2A 1S72I 2PX9A 3RSNA 2JUGA 3NARA 3LL7A 3TO7A 4H0EA 1JGSA 1QZYA 2QKLB 2QBYB 4M3EA 4EM0B 3MCZA 3VWBA 4A3BJ 1ITYA 4IEJA 3WTTC 2X1DA 4D5CA 2DCEA 2B63J 3DP7A 1AU7A 2WY7Q 2X6WA 3WTXC 3DPUA 3G71I 2RGVA 3K70C 2BY2A 5DDGA 1YLFA 4DYRA 4BACA 1APLC 2IRFG 1FEXA 2CUZA 4OIOF 1BW5A 2J5OA 1TQMA 2L7KA 1CF7B 5BQTA 1HKQA 2FJ1A 4MEXF 4C3IJ 1P7IA 3JAMK 1HW5A 1Z7UA 3BG9A 3BZ6A 2JZYA 4EJOA 5IOYA 1UJ8A 3PSIA 3X2QH 4UVCA 2E35A 4BE0A 1MBHA 2P8TA 1DDNA 4AM3A 4O3MA 4XORA 2ISYA 4HNUA 3HPGA 1X1DA 4RM2A 4MNUA 3H5NA 5HDNA 4N0BA 3TW7A 3CCMI 4AWXB 1J09A 4ITVA 1B9NA 1YX3A 2LMDA 1TLHB 2R7FA 3TDZC 4WX9A 2RKHA 1FNNA 4XRSG 5IT3A 1X58A 2LY1A 3CF5F 4NQWA 4BKXA 1LVKA 1B6AA 3SDBA 2ZJ2A 5HLTA 1BI1A 2BE5F 1Z7LA 1ON1A 3FM5A 1FIAA 3CC7I 1PUEE 2MH9A 1MBGA 4GRIA 1Y1WJ 2MC3A 3HIFA 2XB0X 2KIFA 2LY9A 1VQ9I 4KFCA 2BY1A 3HOSA 4RGXA 3CO6C 1VTNC 3L09A 3D5LA 1ZR2A 2OTJI 1T39A 5HDKA 1RPWA 3HSEA 3ZQQA 1B8IB 1S6LA 4I02A 5E8GA 1X1CA 2E5ZA 2ZFWA 1B4AA 3QOPA 1EH7A 4IF4A 2VBYA 3IRQA 1FBQA 3LOCA 1EV7A 2RNGA 2OC6A 3PIPF 3W2WA 3PQKA 2VI6A 5E8IA 2JJ7A 3FM3A 3VEPA 4AIDA 2JA7J 5KAIC 4MLOA 2E7WA 5KNLA 3BZCA 2F48A 1S9HA 1XCVA 3H5AA 2CFOA 2EFNA 1P4AA 5ICGA 2W85A 3G4SI 1OCPA 1R5ID 3H92A 3LAPA 2CV2A 2JPCA 2GXGA 2DMTA 3GZNB 3WG7H 1VQMI 3PO3J 4L0YB 4AYBA 2QSHX 4FQGA 2DMNA 2QENA 1SAXA 2X6OA 2P0WA 3HHGA 5CJ9A 5J6XA 1W1WE 5EG0B 2VIXA 1QNTA 2GIVA 5GPCA 3S1NJ 1G3YA 4FE4A 4HW0A 1P4XA 4CGZA 2VKDA 4LG3A 4M3BA 4N4OB 1BI3A 2RC4A 5CLSA 2VONA 2HXIA 4KUMA 3CO7C 2G7UA 3GTGJ 1FMVA 1G8XA 3CMAI 1FLIA 5FJ8J 3OS0A 2V7FA 2ZXIA 5JHFA 2VKVA 1X1AA 4X0GA 2V9VA 1O3RA 1FMWA 4DGWB 4KICA 2LYCA 4NUBA 3CDIA 5KCMA 5ILUA 5JVTA 2NAZA 3BROA 1QRYA 3QWLA 2DA4A 1OKRA 2QBYA 4IHSA 3OSFA 2B7EA 1IN7A 5IY5H 2FMLA 2K27A 2XHKA 4B47A 2UV1A 5A2QK 2Q8KA 2VQGA 1XMKA 1X1BA 5J40A 2EBIA 1N25A 2DT6A 3OWTA 2DT5A 1DU0A 4LG0B 3VPRA 3FXKA 5C4XJ 1MBJA 2VJ4A 3L1PA 4KA4A 4Y4RA 3VFZA 1N75A 2XKOA 3OV8A 2KIQA 5CVUA 1KYZA 1MJ9A 2HVSA 1MJAA 1NTCA 3HUGB 5HS8A 1CF7A 2DU9A 2J5PA 4Z2YA 1ZQ3P 4FT8A 2W25A 4L5IA 4A3KJ 3S14J 4B09A 3WU1B 1L3LA 4OU0A 2YR2A 5CVJA 3KYCB 3O8HA 3RI4A 2XF7A 4C2MJ 3KCCA 5F0HA 2A5YB 1JKRC 3PNYA 4ASNA 3VB2A 1U0JA 3EDPA 2QM3A 3OYGA 4XBFA 3GYHX 2O61A 4FTHA 2VT3A 1U9OA 3A1YA 2HDWA 2HZTA 1XMXA 5M5WJ 2E71A 4NDLA 1VNDA 1MNEA 4MHGA 3CMYA 3N97A 3GX4X 2BVMA 1QA6A 3DFGA 3FISA 4XKVA 3E6BA 2VQHA 3BT9A 5FLXK 2TRTA 3PNTA 2QVOA 3BCAA 3LFUA 1RRJA 2A6HF 2DPDA 3GTKJ 4HZFA 2R7WA 3EETA 4JX5A 2NVQJ 5GPAA 2FD5A 1MGTA 2QF7A 3K4JA 3JSPA 1QU3A 2YX7A 4LITA 3DPTA 5F1JA 2H6CA 3M1CA 2GZWA 1W0TA 1SC7A 2KFDA 2LREA 3MZYA 5HS7A 1YITI 3LAJA 2NOGA 5TRDA 1HF0A 3WTSC 4U7BA 1SFEA 1XDUA 2XAGA 2WBMA 1O4XA 4DIQA 4ZYEA 1GV5A 1BN5A 3JRFA 1IG7A 1G3TA 4UXNA 2JTVA 2HPMA 1E17A 3AKZA 1GLNA 4D7NA 3FXLA 5HLHA 3JREA 4EMSA 5E20A 2XGXA 3SZPA 4Y52J 2DO7A 2BOLA 5C3EJ 3OYDA 3CP2A 1B8IA 4OIQF 1K79A 4LFUA 1DPUA 4E7KA 2HFHA 2R3SA 4MGRA 2EA2A 1SD5A 2ZKZA 4LLLA 1HA8A 4ENJA 1F4KA 2BBYA 3M07A 3HL2A 5J47A 4IHTA 5K5RA 3GTOJ 1W7PA 2XPWA 2EZHA 1E3OC 3IAM2 4F92B 3HOZJ 3JSOA 3LA7A 1BR1A 5FO5A 4V2GA 5LGUA 3PNVA 2DODA 2RNJA 1RKTA 3M1EA 3QQAA 2EZLA 1W7PD 1T2KA 2HYJA 4KT6A 2H27A 4C2UA 3CUQC 4RGSA 4XN3A 3BR3A 3TEDA 2BYVE 3AG3H 3QP5A 3OOPA 4ZYAA 2HOSA 5ED4A 5J4VA 1V55H 2EV6A 4XLHA 3OYLA 4FETA 4XMYA 4ENNA 5GAGJ 2DYRH 3MWMA 1F9NA 2DLLA 1OR7A 2OV7A 2V1XA 3ZMUA 2QSFX 1ZARA 1KU9A 2HOTA 1LNWA 3HC7A 1IN4A 1H89C 4XONA 3WU0A 2FBKA 3R6SA 2XUBA 3T8TA 4ABZA 2NNNA 3B73A 1JHFA 4YFKF 5H2FC 4IQ4A 4A3JJ 1SFOJ 2LNBA 4UUVA 2DTZA 1P2FA 2MFZA 4EQQA 2F4OB 1R36A 4HBLA 1XGMA 2L5QA 4GYIA 3H9GA 2R7VA 5JLXA 4ESBA 5ILSA 2M2EA 3E6CC 1Z1DA 1XSDA 3MKYB 4DZJA 3L2WA 4JQFA 2FMYA 2NS8A 1P92A 3BY6A 4HSRA 4A3EJ 3ZQIA 2E1CA 3ZMTA 3OYBA 3FX3A 3IAS2 3D1NI 2EFWA 4R79A 2A05A 2HTSA 2KDOA 2BGCA 3DU6A 1OYIA 1XGNA 2R5ZB 3PFIA 1ZKGA 4LG0A 5IP7J 2R7UA 1KU7A 4RB0A 2ID6A 2GBYA 2KISA 5JR3A 2EH3A 3K9TA 2EJRA 2LOOA 2P7VB 2XF6A 3HUGA 2XB5A 4NBQA 1R5GA 4ENKA 4A3GJ 3A0BC 2XAQA 2KIUA 2WAEA 3HTUA 4N9IA 2ME0A 4E7HA 1A36A 3KE2A 2QCOA 4RDUA 3M4OJ 3SQNA 1T98A 1I3QJ 3E6MA 3GTJJ 3ECHA 2F5EA 4P1WA 3ASNH 2ME6A 4EJVA 1BOAA 2QQ9A 4WF2A 1IXCA 3H36A 4H4KC 4E6KG 4C2TA 4A6EA 2K9MA 1KZHA 2BY0A 2P81A 3E5QA 3OYEA 1S29A 5BS6A 3UKGA 1ZGAA 3F8CA 3K4LA 4DBQA 5EJCA 2RVCA 1P6RA 1U2WA 2XDVA 4LB5A 1BI0A 4JP0A 3WHCA 1QO0D 5E1XA 3IWFA 2OTLI 1XDSA 3TDUC 5KHDA 2JMWA 3LNQA 2K9SA 2L7FP 2HQNA 2QEXI 3Q3SA 2OQRA 3HKZA 3TOBA 4FE7A 4WWCA 1TWHJ 4LLGF 1IDZA 3Q0UA 4MTDA 4K2EA 2JT1A 3LSJA 1ETKA 3J7ZI 1O3TA 1R9TJ 2ZMEB 4E7ZA 3JRDA 2K85A 2VE8A 1E2XA 3BPVA 3R0AA 2JA8J 2OPTA 1ERDA 4CCLA 2QGUA 4LGWA 3DTKA 3W6KB 3RKYA 5M5YJ 5FRMA 5D5VB 1ONVA 1ZHFA 3QYFA 3F0CA 1RC9A 5LGNA 2COMA 2UZKA 3BZKA 1VQ6I 5E17F 4HAMA 1IN5A 4XM3A 3I56I 1TTYA 3V8LA 3J81Z 4X6AJ 4HNTA 4II2A 3DEEA 2VPLA 2VBXA 1WHUA 1F36A 1ETXA 3HG9A 4A2UA 2NVTJ 2HNHA 1ZRCA 4ZTJA 2GXAA 3O2PE 2YPRA 5FROA 1IXRC 1RR7A 4G94A 4E7IA 5BNGA 1MSFC 2MA3A 2Z99A 1ZN2A 1J2XA 2L4MA 2P7CB 3GVAA 2HWVA 2DFFA 3OY9A 1FBUA 2KL4A 5L3EA 2CS3A 3MN2A 5C4JJ 5H6RA 1UFMA 2EPFA 3GFLA 3KEYA 2IGMA 2E2HJ 3SYTA 2DK8A 3HZJA 1FY7A 3HRUA 2RAEA 2TCTA 5EYRA 4XLEA 3SXYA 4ZZLA 3QYBA 1MMGA 1IAWA 3U9GA 1WPKA 3HDDA 5L3DA 5D4RA 3DBRB 2ZC2A 2RQPA 4OOIA 3BTCA 3O6BB 4L9VA 1VQLI 3RDIA 1QZEA 1VQ7I 1ZG3A 1ZG5A 2TDXA 4AIJA 5K7ZA 4XSZF 3UR3C 4F52A 1DP3A 3HYIA 2KPMA 3HPHA 3LSIA 5LBQA 2HZDA 2XGDA 2LVSA 3I4MJ 1B1BA 1IXSB 2PI0A 3AL0B 1V4RA 3ABLH 4FHTA 4BJ5C 1HOMA 2KMUA 1G59A 2ECCA 3F8BA 3HRTA 2OQGA 4XLCA 2R5ZA 2QSGX 3AFHA 3FKJA 4A3FJ 1HDDC 3ZOBA 3WGIA 2O6GE 2JRTA 3WG9A 3FKIJ 4JX4A 3DQVC 1YHQI 2PEXA 3DEWA 1Z0XA 4CCOA 1NK3P 3KP2A 2IBDA 2LFBA 3R0JA 4EJWA 2M45A 1WQ2A 4EM2A 1OCTC 5DUIA 2O3FA 2VT2A 4BY7J 1TNSA 2AS5F 1K4SA 2E1MC 3GTMJ 1HKTA 3RCOA 1A35A 2KLOA 5F27A 2JPBA 4HLXA 3QU6A 1ZELA 4QPQA 2OZUA 3K1PA 3DKWA 5DCFA 1R71A 1IV6A 5GAEJ 2LH9A 4IX7A 3J7AY 2A69F 1OCRH 3LQQA 5CQEA 3P9IA 4D1QA 3SJMA 4A12A 2MSYA 4I09A 5CYVA 3GZ6A 2KKOA 2H94A 5JHUA 3VODA 3BG6A 1OYYA 2CO5A 2JN6A 2XV4S 3GFIA 3S17J 2EILH 3B6AA 4M3FA 2AHQA 3BTIA 5LRSA 4NB5A 1KQ8A 1FOXA 1A6QA 3E1SA 4BGDA 2EFOA 4IOAF 2WA0A 4A6DA 4BDZA 1BBYA 2YU3A 1K6OA 1LJ9A 4ZDLA 1H9GA 2IJLA 2L4AA 4S0HB 2CSOA 1ZTRA 3D5SC 2L02A 2WB1A 4CICA 1G3SA 3QAHA 5FFXA 2VE9A 2WADA 2ZMEA 3FWEA 1G4DA 1D8JA 1G6NA 1MMDA 2Y48A 3H9QA 3IP4B 4UHTA 3OS1A 2V4JC 1LFUP 3ZGKA 1U78A 2BXZA 4HG2A 1RNLA 3M7GA 4M71A 1VI0A 1E3HA 2E36A 3GWZA 3ZMSA 1LPQA 2XAHA 3EUAA 4CCKA 1K78B 4A3DJ 4GYGA 1VQ4I 3F8NA 3H1CA 4F3QA 1ZRFA 1W36D 3ESWB 2XC7A 4BQQA 4UUTA 2E5NA 1T0FC 3CUOA 2VBZA 3MZ8A 4AIHA 3ZR8X 2DAOA 2X9DA 4BDYA 1ZLKA 4BNCA 3HGYA 1EA3A 3FXMA 4RAZA 1R1UA 3CESA 1Y0UA 3J80Z 2M34A 4G12A 1OCZH 5E1WA 2EV0A 1BR2A 4U0WA 2X51A 1VQ5I 3HBLA 2WWYA 2X48A 3SHFA 1AA7A 2DA1A 3JW4A 4XKBA 3OIPA 1EF4A 2VL8A 5LEKA 3NWSA 3DWLE 2B9SA 3LSGA 2CV0A 2R7TA 1FTZA 3OMYA 5IYCJ 4I76A 2QQAA 4XQFA 1BW6A 3MKLA 5FKOA 4HQMA 1FSEA 4CSWA 3EYYA 3ZMZA 1JXSA 4CCNA 4M9SA 2BHZA 3ABTA 3CC4I 2A07F 1LEAA 1IRZA 1SFUA 2FQ3A 3ISPA 5GP9A 4GO1A 1FZPB 1QBJA 3M8EA 3U1DA 3HGGA 3IWZA 1GDTA 3IH2A 1Z05A 4WXHA 5J1YA 3P5JA 4WK8F 3K1NA 3Q5FA 3S1RJ 3EUHA 4MQVA 2NOJB 3C18A 2CV1A 5M5XJ 4GFBA 1MW7A 3CQZJ 3I53A 3LQRA 4RLQA 3J81K 1LDKB 4Y17A 3PO2J 3WODF 4HEA2 1OQYA 4L9TA 3WTUC 1YOVB 1DU6A 1BC7C 4BEHB 5K1YA 2JVHA 1Z3YA 1W36C 4UB8C 1XGOA 1K7AA 3J7AO 1FX7A 3CCVI 3GTLJ 3KEOA 4LB6B 3K4MA 4BXXJ 1RZ4A 2Y75A 4D9JA 2HQAA 3V7SA 1U8RA 2FNPA 5B5EC 3SZTA 2HXOA 3TMOA 5TJJA 2IS6A 1IF1A 2Y69H 1R1VA 2R7ZJ 5BMZA 2DOAA 3B6CA 2H1LA 5D5UB 3K7AJ 3F72A 4YELA 3IV5A 2GLOA 4BBSJ 4A69C 3ZPLA 4P9FA 1Y6IA 1VQNI 4IQJA 1HXDA 2VXZA 3M8FA 3JRCA 1IC8A 4XL9A 1YIOA 5L3BA 1HKSA 3IH3A 3BTLA 1U9NA 4BHPA 3KYDB 1SAUA 1JUMA 1U6GA 4PUSA 1ETYA 4TV7A 4IHWA 2R0QC 2XRNA 2OU2A 2MLGA 2MBFA 4U88A 3E5UA 4XRFA 2R5YB 3MAJA 3DBLB 1LDDA 4BXUA 1BIBA 2ELHA 2Y9ZA 5FKMA 1KA8A 5GADJ 1JTXA 1MBEA 1FTTA 5ERIA 1I50J 4L9JA 1Y0NA 2H09A 4PJ0C 2A68F 4OIRF 1WJCA 3ZQLA 1FYMA 4OAZA 1WJFA 3H0GJ 4YIIA 4PZJA 4EEFG 2K9QA 4ZDPA 3TW6A 2LBFB 3I0TA 1UHSA 2ZCWA 3ZRGA 1H88C 2E7XA 4IJAA 1Z6RA 2IVMA 1WVRA 2ZO4A 2CJJA 1GT0C 2RREA 2ELJA 1YFHA 3LSTA 2F5DA 3PSFA 1RI7A 2IGNA 3NEUA 2VXDA 1UG0A 1J9IA 3A0HC 1HC8A 2V6EA 2VKEA 3BDDA 2DTRA 3QYEA 3L2UA 2L9NA 5DV5A 4PSWA 1K78A 5LEJA 4QLCU 2BHYA 2OZ6A 1Z9CA 1ORKA 2KRHA 3L7WA 1T8IA 2CH0A 1UB9A 3ERMA 5B1BH 1ETWA 3D0SA 5J8CA 2E60A 4F7ZA 4XIDA 2DDBA 4UV8A 4CXFA 2M7AA 3U21A 4C30A 3KP5A 1BA5A 1XX5A 4QIWN 2FXAA 1OYWA 1TWFJ 1WJEA 1WRJA 4HQEA 2PLYA 3GLLA 1PYVA 5K5OA 4A3IJ 4BL0B 2KRFA 1D0ZA 5GTHC 1HBXG 4HYEA 4UUSB 3BWGA 5J4YA 4P96A 4WXCA 1FYKA 2EK5A 2ZB9A 1IW7F 1USSA 3H3VK 2W1OA 3OL4A 2NVXJ 1REPC 5IOZA 3E6DA 2KP6A 2IGOA 1FYLA 3V42A 3A01B 2M4GA 2FQ4A 1KGSA 4FASD 4I01A 1W5CC 4BH9A 2O8XA 4V19K 2DW4A 3UNGC 1XS9A 2QYOA 2R4GA 4G7ZF 3FK6A 4YG2F 1JGGA 1U5TB 1YS7A 2MLKA 1FP2A 3CCLI 3OS2A 1DP7P 2VOPA 3CCQI 1HCRA 4DBRA 1I5ZA 1WH7A 2X85A 3WE3A 2OJED 2ZXJA 3BG5A 2NVUB 1WJ5A 3RQIA 1X1PA 3FXJA 2CUEA 4AC0A 4BEHA 5IPAA 4YRVA 3J80K 4LK1F 3NQOA 3A4CA 3H9JA 1ZG1A 2CFXA 1W5TA 4ZH4F 1OCOH 3QOEA 1YX5A 1EJ9A 2EZIA 2R93J 3OYJA 3DEUA 4YFXF 3BR0A 3OYMA 1X3WB 1T33A 4A5MA 5LHHA 4XNFA 3L2VA 1LUJB 1B59A 4M6VA 3BR1A 2Z9OA 1SVMA 1JTYA 2Y0MA 3CJTB 2NNYA 4PJNA 2YU9J 1GHCA 2PBIA 3PFYA 5CVIA 4L18B 2V79A 3CJNA 1NG7A 3S1MJ 5FD6A 4EATA 2ZFUA 3FMQA 4BU2A 3LSKA 4YIRX 1MIJA
chains in the Genus database with same CATH topology
4II3A 3H5RA 1ERDA 3FBNB 2R7RA 4CCLA 3F9KA 4CCJA 3RQ4A 3DTKA 4BQOA 3VYRB 4AU7A 5FRMA 3VYSB 3KYLA 3BG7A 2GOMA 1QHGA 2V9KA 3QYFA 3MD2A 3W3CA 3RPUD 2ZSIB 2W82A 2DT7B 4U87A 1E0EA 4XM3A 3LSHA 3EUHC 4F55A 3S32A 4HNTA 4II2A 2Z16A 3DEEA 4P5OA 2VPLA 1UAAA 4BJTA 3OYKA 3HG9A 3DTEA 3DPLC 2LBFA 2HNHA 3AL0C 2VJ5A 1WJDA 1DQUA 4ZTJA 4RM3A 5FROA 1N77A 3PJRA 2IXSA 4E7IA 3D5RC 3MKWB 1OLTA 2JA2A 2R7SA 3RSNA 2JUGA 3LL7A 4XR6A 2QKLB 3OY9A 2KRCA 2KL4A 2CS3A 2ZXHA 3VWBA 4BXFA 4PJLA 2M7BA 3KEYA 2IGMA 2X1DA 2DCEA 2JSPA 3SYTA 2QKMB 5TGTA 1LKXA 2Z2SB 4XLEA 2WY7Q 2X6WA 2LRDA 3QYBA 4ANJA 3OYAA 1MMGA 2WAFA 3DPUA 3K70C 4BACA 3S3NA 3K6GA 3CJQB 3W2AA 2CUZA 5LD2C 2K3PA 2L7KA 4CCMA 4PSXA 1TT0A 4HSTA 2LC2A 1SFKA 3UR3C 4F52A 1DP3A 3K4CA 2AQEA 2KPMA 5FRNA 3HPHA 1KONA 3LSIA 3PSIA 1D1AA 4BE0A 2HZDA 4XORA 3AL0B 4YEJA 4BJ5C 2Q1ZB 2KMUA 1G59A 4HNUA 3HPGA 2BW3B 1X1DA 4RM2A 4XLCA 2FUG2 3AFHA 3FKJA 3H5NA 4PJJA 3DQVC 2Q2EB 1J09A 2KHMA 4ITVA 4PJMA 4CA0A 4B48A 4CCOA 4LIVA 1YX3A 2X1EA 2A5WA 2LY1A 1LFPA 2E1MC 1LVKA 2W4SA 4XKCA 3RCOA 1NG6A 3VSKA 4BJ6C 2KLOA 1DGWY 1X19A 3SDBA 5HLTA 1Z7LA 2M3AA 1ZELA 4QPQA 1OR7C 3K4KA 4GRIA 3S3MA 2UWMA 4BUPA 2JVGA 2PJRB 2AQFA 4IX7A 2LH9A 3J7AY 1BR4A 4D1QA 5CQEA 2Z1DA 3HOSA 2X6YA 1PJRA 1QHHD 3D5LA 3BG6A 4G6TB 2KZVA 3ZQQA 3BLYA 1K6YA 1X1CA 2E5ZA 4HRIA 2IGKA 3E1SA 2UUZA 4BGDA 2WA0A 4BDZA 2RNGA 2OC6A 2IS2A 3W2WA 3DKXA 4ZDLA 2F4IA 3L2QA 3D5SC 2WB1A 4Y33A 2WADA 4MLOA 2HVQA 5KNLA 1MMDA 3H9QA 1S9HA 3H5AA 3IP4B 2CFOA 3H0DA 3FBIB 4B3XA 3OS1A 2V4JC 4XOPA 3ZGKA 4F91B 1Y56A 3W2VA 1V5FA 4KJZA 4HG2A 2E1MB 2CV2A 2R7QA 3EUAA 4E7JA 4AYBA 4CCKA 2X6XA 1TZLA 2P0WA 2VKHA 3RTRA 2VIXA 3GBGA 4F3QA 5HNHA 3VSLA 2XC7A 1W36D 1V5EA 4BQQA 2E5NA 1T0FC 3CJRB 3ZR8X 4JOMA 4BDYA 2K9LA 2M4KA 4NC7A 1EA3A 2VKDA 4LG3A 4N4OB 3CESA 4OWRB 3BCBA 3CZ6A 1FMVA 1G8XA 3OS0A 1BR2A 3CP8A 2X51A 2V7FA 2ZXIA 5JHFA 2MC4A 1X1AA 3DTIA 3I9V2 4X0GA 1AA7A 1FMWA 4XKBA 4DGWB 3OIPA 1T95A 2LYCA 2VL8A 4NUBA 5KCMA 3NWSA 1YE9A 3DWLE 3QODA 3LSGA 2CV0A 2R7TA 4LIUA 3OMYA 1WJBA 4QPOA 4XQFA 3M8JA 3H35A 4CUGA 4CSWA 4B47A 2UV1A 3HOTA 2VQGA 4CCNA 4NC8A 1X1BA 2DT6A 3OWTA 4BE1A 5CQGA 2VJ4A 2MD0A 2VQCA 4Y4RA 2HVRA 3C2HA 2GOXB 1N75A 2HVSA 3HUGB 2VQLA 1VZ0A 2VJJA 3SEZA 2NOJB 4NNJA 3OIQA 3MKZA 2CV1A 3VYUB 3EPZA 1MW7A 2XF7A 4E4HA 3PNYA 1U0JA 3OYGA 4RLQA 4IKFA 1LDKB 3N05A 3A1YA 2HDWA 4J00A 4HEA2 2Y0SA 1Z3XA 2LG4A 4BEHB 2JVHA 1Z3YA 1MNEA 4OAYA 3OOUA 4DJAA 1W36C 2BVMA 2BW3A 3DU5A 4XKVA 2VQHA 3PNTA 3K4MA 3BCAA 2CW7A 3LFUA 4XOTA 3S3OA 4D9JA 2HQAA 2X1CA 4E7LA 2R7WA 3SZGA 2LY2A 3K4JA 4XKWA 3TMOA 2IS6A 1QU3A 2MYSA 3K10A 4LITA 2IS4A 3DPTA 2DOAA 3M1CA 3CF2A 4YELA 2HU9A 2VLAA 2LREA 3SEQA 4DOZA 1Y6IA 4IZZA 5LFAA 4IQJA 4RMNA 2VXZA 4U7BA 2WBMA 4XL9A 4DIQA 2W7NA 2XAUA 2HPMA 2DXIA 3AKZA 1GLNA 1SAUA 2PJRA 4PUSA 3K70D 2BOLA 5CKTA 3TBIA 1IRXA 3OYDA 3PUBA 3CP2A 4CH7A 4E7KA 1HA8A 2HPIA 3HL2A 4B43A 1JI8A 4E7SA 5HNFA 3VDXA 1WJCA 4PFPA 3IAM2 4F92B 4OAZA 1BR1A 1WJFA 4RLFA 4ZDPA 2LBFB 3OYHA 2M0MA 2F6CA 3BC8A 3G2BA 3PNVA 1D0XA 4N4NB 3ZRGA 1V5GA 2CUJA 1X4PA 4KT6A 1UELB 4B44A 2RREA 3ONQA 3FDYA 4C2UA 2ELJA 1MMNA 3PSFA 4XN3A 2IGNA 2VXDA 1UG0A 1WJAA 4ZYAA 2V6EA 2VASA 3QYEA 2R7OA 3L2UA 4BE2A 2L9NA 4XLHA 3FHNA 4PSWA 3OYLA 2A6TA 4FETA 3OYIA 4XMYA 3DLAA 2K5CA 2KRHA 2OV7A 3MMYB 4XLFA 2CH0A 3S8PA 2VB6A 3I3LA 3HC7A 2MABA 2E60A 4XONA 3ZXSA 2O5RA 3TL4X 3NWTA 2M7AA 3U21A 4C30A 4PK4A 3K4BA 3S93A 3LSMA 4IQ4A 3CMMA 1WJEA 2MFZA 4XN0A 2L5QA 4XLAA 4HPQA 3H9GA 2R7VA 1D0YA 1PYVA 1R6RA 2I8DA 1DGRM 3E0JB 3OR2C 4Y3OA 4BL0B 3MKYB 3L2WA 2R7XA 1D0ZA 3EUKL 4JQFA 1D1BA 4HSRA 1MMAA 4ZDOA 3OYBA 3IAS2 4KITB 3PL8A 4R79A 2W1OA 4ZTFA 3OL4A 2F5VA 2KDOA 3DU6A 5HVQC 4AVZA 5CPRB 2VJIA 2R7UA 4ZC3A 3ZCOA 2DJIA 2KP6A 2IGOA 3IUOA 3V42A 4BS9A 2M4GA 2XF5A 3VYTB 2LOOA 3OYNA 3OL3A 2XF6A 2PMZA 2WAQA 2OUMA 4FASD 4C9YA 2RQQA 2CW8A 5HOOA 2XSJC 2L2OA 4NQWB 2WAEA 4F93B 2IS1A 3UNGC 4E7HA 2R4GA 4ZJZA 1MNDA 1D1CA 4PFOA 3OYFA 3OS2A 3KX2A 4DBRA 4KISA 4P1WA 3K4NA 2X85A 1WFXA 1WJ5A 3L2RA 4H4KC 4E6KG 4BEHA 4YRVA 4C2TA 3HXLA 2K9MA 3OYEA 3A4CA 4CZCA 3H9JA 2W00A 3K4LA 4DBQA 3LMMA 1Z21A 1P9QC 1YX5A 2L9SA 2BVLA 2XDVA 3C2GA 3QOEA 3OYJA 3OR1C 3OYMA 2V26A 2ZSHB 3A2KA 2CMPA 5KHDA 4XNFA 3L2VA 2KQRA 1X4OA 4J01A 3HKZA 4PJNA 3DKYA 3PFYA 2WY8Q 3OYCA 4BQNA 1NG7A 4EATA 1N78A 2V1NA 2ZFUA 4E7ZA 4BU2A 3LSKA 1BOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DWL E; 
#chains in the Genus database with same CATH topology
 4II3 A;  3RPU A;  1AHD P;  5M3F J;  5BPD A;  1JE8 A;  3KP7 A;  4G6D A;  5L3G A;  1POG A;  3TO6 A;  3IH4 A;  1FBS A;  1WI9 A;  2DA7 A;  3PUF A;  3KYL A;  2YUS A;  3ZQG A;  1LVA A;  3RPU D;  3RKQ A;  4IXA A;  2DT7 B;  2R5Y A;  3K1M A;  1YS6 A;  4LD5 A;  2Z3Y A;  4WXD A;  2JRM A;  3S32 A;  5LHG A;  3IKV A;  2YSR A;  2E2J J;  4HV5 A;  1KU2 A;  4P5O A;  3GTP J;  1YW9 A;  1QPM A;  4J19 A;  4R8H A;  1I39 A;  1XD7 A;  3BG3 A;  2CGP A;  3DTE A;  3JTG A;  4ZYG A;  3DPL C;  2K4J A;  2LBF A;  2ZJQ F;  2QA4 I;  1UZC A;  5HS9 A;  2O0Y A;  2VJ5 A;  1J7K A;  5J1U A;  5EG0 A;  1RUN A;  1OIS A;  3MFK A;  3E5X A;  4LOC A;  4IHY A;  4NC6 A;  4QWQ A;  1MSE C;  1N77 A;  2GQQ A;  3PJR A;  2IXS A;  3GO5 A;  2R7S A;  1HQC A;  3I4P A;  3I59 B;  2L7M P;  2PMH A;  1YJW I;  3K2Z A;  1JT0 A;  4CYD A;  1DUX C;  3I58 A;  2ZXH A;  2A61 A;  4PJL A;  4EGZ A;  2W48 A;  2WV1 A;  2QKM B;  4V2F A;  5TGT A;  2V1U A;  5F04 A;  1I3A A;  4LMY A;  1V3F A;  2LRD A;  3O3K A;  4ANJ A;  2E19 A;  4KN4 X;  5IP6 A;  3W2A A;  1TWG J;  5LD2 C;  4XLP F;  5D4S A;  2ADU A;  2PMZ N;  2IT0 A;  2Y0S N;  2NYX A;  4CCM A;  2PQ8 A;  4PSX A;  3S16 J;  3BTJ A;  1FWZ A;  1IRG A;  1YTY A;  4L5J A;  1S7O A;  1ULY A;  3T8R A;  1MMS A;  2AQE A;  2CRG A;  2VUM J;  4RAY A;  3V7R A;  1D1A A;  4P55 A;  3G6E I;  4BAY A;  3GFJ A;  1J0R A;  1O7F A;  4QSH A;  4UUS A;  4A93 J;  2CQK A;  3T1B A;  1MNM C;  2Q1Z B;  1R7J A;  4IRH A;  2BW3 B;  3H3Z A;  5F08 A;  1Z67 A;  4UVA A;  1H8A C;  3WTV C;  4HF0 A;  2CQQ A;  1AWC A;  1SVL A;  4PJJ A;  3U1K A;  1IJW C;  1X2N A;  2FBI A;  2KHM A;  3A01 A;  1UHW A;  4CA0 A;  4B48 A;  1U8B A;  1BJA A;  4EJT A;  4I0A A;  2R7D A;  3REO A;  2OF7 A;  1I27 A;  2X1E A;  1UHM A;  2W24 A;  4KDP A;  5AIQ A;  3Q9S A;  1LFP A;  2ETH A;  4GDF A;  4D7M A;  4XKC A;  3KEQ A;  1JJ6 C;  4BJ6 C;  3LSR A;  1DGW Y;  1U5T A;  1FIP A;  2K9N A;  2VC0 A;  1JKO C;  5F0C A;  1OR7 C;  3K4K A;  3ABU A;  3S3M A;  2CWE A;  4BUP A;  2UWM A;  5ICC A;  1XG1 A;  1MD0 A;  2JVG A;  2PJR B;  3RYR A;  1BC8 C;  1BR4 A;  1SMT A;  2Z1D A;  1PJR A;  1QHH D;  2HI3 A;  3PM1 A;  1O3Q A;  5FB2 A;  1JUP A;  2KZV A;  4CO8 A;  1WZ2 A;  2K86 A;  1K6Y A;  5J1R A;  4HRI A;  1MJB A;  4RS8 A;  2DA3 A;  5LLQ A;  2FEZ A;  2FOK A;  1ZR4 A;  3KIO A;  1IV8 A;  2IA2 A;  2E1O A;  1SD7 A;  2LKP A;  3DKX A;  3FXR A;  5DS9 A;  5KK1 A;  2JA5 J;  3L2Q A;  5BPI A;  4A0Y A;  4Y15 A;  4I99 C;  3AG2 H;  4Y33 A;  2HVQ A;  4EVI A;  5AIP A;  5FGM A;  2P5K A;  5LGT A;  1ZK8 A;  4XOP A;  4YIF A;  1XPX A;  1V5F A;  2MW8 A;  4KJZ A;  4BQA A;  2DN0 A;  4I6Z A;  1VF9 A;  1D5Y A;  5IP9 J;  2R7Q A;  1RR8 C;  4RAG A;  4JBA A;  1O3S A;  2X6X A;  3N4M A;  1AKH B;  2XPU A;  5IYD J;  2E34 A;  2HYG D;  4RB2 C;  1FPQ A;  2DMQ A;  4JOM A;  3QRF F;  4KNY A;  4NC7 A;  2XVC A;  1M1E B;  3ABK H;  5B66 C;  2ZXW H;  2I10 A;  5E1Z B;  5GAH J;  4OWR B;  1LDJ A;  4ZZD A;  1SEU A;  1BIA A;  2MH2 A;  3CZ6 A;  1IDY A;  2P5V A;  4IVN A;  1I1G A;  2GAU A;  2ZJR F;  1ENH A;  1S7A A;  1TL8 A;  3HEF A;  4PGH A;  3KP6 A;  1T95 A;  4G9Y A;  1SD6 A;  1YE9 A;  1ZAO A;  1YIJ I;  3QOD A;  3WE2 A;  3I59 A;  1P7J A;  2ESN A;  2WAQ N;  1HST A;  4MO7 A;  2HGC A;  1H9T A;  3M8J A;  1A04 A;  3H35 A;  4JK1 X;  1K61 A;  4UVB A;  2LTP A;  2QLZ A;  4NC8 A;  2HYF A;  3COA C;  4BE1 A;  3R60 A;  2VC1 A;  1FOY A;  2HVR A;  3C2H A;  3V7C A;  4IRG A;  4D5F A;  3BJA A;  3H3U A;  3C1D A;  2LLK A;  1F43 A;  1WCM J;  2CQN A;  2STT A;  2HEO A;  4EM1 A;  3MKZ A;  2KZG A;  5KAF C;  3RKX A;  3VYU B;  4RA2 A;  3EPZ A;  2D45 A;  3EQL F;  1RET A;  2P6S A;  3A02 A;  1LB2 A;  1O7L A;  3ELK A;  1XGS A;  3S15 J;  2Z33 A;  4OMZ A;  3N05 A;  1B9M A;  1UG2 A;  1Z91 A;  2ZJP F;  2Y0S A;  3ZN0 A;  1S7E A;  4G8X A;  2LG4 A;  4OAY A;  3SFI A;  3OOU A;  4DJA A;  4B8X A;  1FOK A;  3CME I;  2BW3 A;  4ZYD A;  4HDV A;  5H20 A;  2G0E A;  2M1B A;  4W1U A;  4CDG A;  1L0O C;  1R49 A;  2AO9 A;  1ZRE A;  1V54 H;  2M8E A;  2QZ8 A;  4HF1 A;  2LY2 A;  3NAU A;  4KN7 X;  3GF2 A;  3V4G A;  3K10 A;  3EYI A;  1FSH A;  3CCU I;  5H6Q A;  3BPX A;  1IO2 A;  2STW A;  2HQ5 A;  2HU9 A;  2VLA A;  3SEQ A;  5LRR A;  2N8G A;  3RPQ A;  4IZZ A;  5LFA A;  3FHZ A;  4RMN A;  4UB6 C;  3M3Y J;  3JRH A;  3HOW J;  4MFD A;  1GVJ A;  1D8K A;  1GVD A;  1ETV A;  2YX4 A;  4M6X A;  2DXI A;  2PJR A;  2BV6 A;  3WU2 C;  3F21 A;  3E97 A;  3K70 D;  2M30 A;  5A2Q Z;  2NRA C;  1VQ8 I;  5CKT A;  4AYB N;  1IRX A;  2K02 A;  4HLY A;  3PUB A;  5EZG A;  4CH7 A;  3JR9 A;  4BY1 J;  4S05 A;  1R22 A;  5E79 C;  3IL2 A;  3G3Z A;  5DTD A;  2BXY A;  3F6O A;  4B43 A;  1Y39 A;  4HOB A;  5FD5 A;  1S5L C;  2FU4 A;  4E7S A;  5HNF A;  4PFP A;  1W0U A;  4XSX F;  1R00 A;  2G9W A;  5D6F A;  2GIZ A;  1TBX A;  1R4M B;  3OYH A;  4Q5S F;  3BC8 A;  1OMI A;  1D0X A;  4N4N B;  4XK4 A;  1V5G A;  3CC2 I;  2FBH A;  1UEL B;  3S1Q J;  3FDY A;  2IA0 A;  1WJA A;  3DF8 A;  3I5U A;  1KQ0 A;  3K2A A;  1D5V A;  1RKW A;  3BJ6 A;  2PN6 A;  5DM6 F;  2VAS A;  1F1Z A;  1VQO I;  1IZ1 A;  3W6V A;  2A6T A;  3OYI A;  2L3D A;  2K5C A;  1LEB A;  3MEX A;  1AKH A;  3HB9 A;  2ICW G;  1BM9 A;  3MMY B;  3ZQF A;  1MBK A;  2DBB A;  4XLF A;  1R5H A;  2HOA A;  4A5N A;  1HDP A;  3S8P A;  2VB6 A;  5K7F A;  3I3L A;  3MZH A;  2LKS A;  3PQJ A;  3ZXS A;  2O5R A;  2PMU A;  5JVG F;  3TL4 X;  3HSF A;  3NWT A;  3V8J A;  3LA2 A;  1CGP A;  4GXO A;  3WTW C;  2WV0 A;  1TC3 C;  5JI6 A;  3K4B A;  2LSO A;  2DFE A;  2OBP A;  3LSM A;  1CQT A;  2L0K A;  3RJP A;  4UV9 A;  3KP3 A;  4XN0 A;  3F23 A;  4XLA A;  1B72 B;  4DQ2 A;  4B4C A;  2LKX A;  1D0Y A;  1ZRD A;  1R6R A;  2I8D A;  1DGR M;  2KIM A;  2R7X A;  1JKQ C;  3EUK L;  1BL0 A;  1RUO A;  4M6Y A;  2A6E F;  1MMA A;  4ZDO A;  4FX0 A;  3KET A;  3G1L A;  1Z6T A;  4KIT B;  5DD4 A;  3PL8 A;  2F5V A;  5HVQ C;  1NH3 A;  1X3U A;  4D0P A;  5CPR B;  3HOV J;  3CUQ B;  1XC5 A;  4OIN F;  5HLI A;  1LE8 B;  3IUO A;  2ZME C;  4BS9 A;  1J59 A;  4DZP A;  4G7O F;  3C7J A;  2XF5 A;  3O8G A;  2EZK A;  1TQP A;  2HS5 A;  3OL3 A;  3DXJ F;  4HNV A;  3AG4 H;  2WAQ A;  1SD4 A;  3SFZ A;  1YG2 A;  1ZYR F;  3I54 A;  1K4T A;  2RQQ A;  2CW8 A;  4BBR J;  4F93 B;  3GME A;  2IS1 A;  4IRI A;  2DA6 A;  1BJZ A;  2PFB A;  3ZN1 A;  4ZJZ A;  1MND A;  3OYF A;  1X2M A;  1YQA A;  5E3L A;  5IT9 Z;  4L9N A;  3KX2 A;  2Y9Y A;  4XLN F;  4HF2 A;  1Y8Q B;  2KT0 A;  4FCY A;  3L2R A;  5F64 A;  3HXL A;  2H8R A;  3WTZ A;  3PIO F;  5EEA A;  4DYQ A;  3Q0V A;  4Q4Z F;  2VN2 A;  2BZT A;  4CZC A;  1Z77 A;  2W00 A;  5J8F A;  3LMM A;  1A5J A;  1Z21 A;  3BJO A;  2OA4 A;  2ID3 A;  2OD5 A;  3C2G A;  1J5Y A;  4RGU A;  2C6Y A;  4C3H J;  3GXO A;  2V26 A;  4KT5 C;  3A2K A;  1ETO A;  2CMP A;  5D6E A;  2JK3 A;  4J01 A;  2F5F A;  5B1A H;  1I6H J;  3DKY A;  1XTA A;  1TT5 B;  2JSC A;  2WY8 Q;  4L0Z B;  4UY8 I;  4BQN A;  1SFX A;  4KMF A;  1RES A;  4XRM A;  2CUF A;  2V1N A;  2HQR A;  2XGE A;  4RB3 C;  1XMA A;  3H5R A;  1IRF A;  1ON2 A;  5J3L A;  3HOY J;  3JTH A;  1WSU A;  3KZY A;  4CCJ A;  3RQ4 A;  1W7P B;  2Q0O A;  4BQO A;  3TP0 A;  4AU7 A;  4EGY A;  1ZH5 A;  3VYS B;  4PDK A;  2VOD A;  2VPR A;  3MD2 A;  2ZSI B;  2W82 A;  5FFZ A;  5D5X B;  2X0L A;  4EJU A;  1C0W A;  2IP2 A;  2XAF A;  4LLN A;  2F5C A;  3EUH C;  4F55 A;  1SAN A;  2FX0 A;  4RB1 A;  3CDH A;  2LD5 A;  3ROU A;  3ABM H;  5D5W B;  3ULQ B;  3FMR A;  2NS7 A;  3GFM A;  4B1R A;  1Q1H A;  3DBH B;  5F1R A;  4BJT A;  3OYK A;  3ZQ7 A;  1XB4 A;  3P9C A;  3FIW A;  5F6F A;  1ETQ A;  4GCV A;  4N9H A;  3AL0 C;  3BR2 A;  3F8F A;  1WJD A;  3CTA A;  1JKP C;  2VOO A;  4MQ9 F;  3CLO A;  4O6J A;  3GEZ A;  2V9P A;  3CD6 I;  3GCM A;  3QU3 A;  1OLT A;  4IO9 F;  4KYW A;  2LP0 A;  4I98 B;  4XR6 A;  1YJ9 I;  3FXU A;  4IHX A;  2XIG A;  2KRC A;  3BP8 A;  1K83 J;  3CCS I;  3FF5 A;  4BXF A;  5JLW A;  2M7B A;  2PG4 A;  2O9L A;  2JSP A;  2E2I J;  1LKX A;  2CU7 A;  2Z2S B;  1AOY A;  5AON A;  4CYC B;  3IRR A;  3OYA A;  4IHV A;  2VBW A;  2WAF A;  3S3N A;  3BQZ A;  3K6G A;  3CJQ B;  3K69 A;  2IW5 A;  1YRN B;  3K0L A;  2K3P A;  1UST A;  2YS9 A;  3F3X A;  3HOX J;  3IKT A;  1TT0 A;  4HST A;  3WHB A;  2LC2 A;  1SFK A;  3LWF A;  2GA1 A;  2QUF A;  3K4C A;  1B72 A;  2DQL A;  5JFR A;  5FRN A;  1KON A;  2L9V A;  4ESF A;  2HKX A;  1FJL A;  2OCE A;  3JRI A;  1TW3 A;  4ENM A;  4M9X A;  4YEJ A;  2MGQ A;  1VQP I;  3TOA A;  4AVP A;  3C2B A;  1WKM A;  4ESJ A;  1OPC A;  4E70 A;  1WH5 A;  5K5Q A;  5DM7 F;  2QQ8 A;  2FUG 2;  5EF6 A;  3CUQ A;  5L3F A;  1T08 B;  1XSX A;  3ERE D;  1KU3 A;  2Q2E B;  1F5T A;  1H0M A;  1LE8 A;  4PJM A;  2FA5 A;  4LIV A;  3T0Y A;  3F8M A;  2GXB A;  3HSR A;  2A5W A;  4M3D A;  3HKZ N;  2Y30 A;  2XRL A;  2FSW A;  2W4S A;  3OIO A;  4XRS A;  1NG6 A;  3VSK A;  1OJL A;  2CG4 A;  2EFQ A;  1X19 A;  5EEG A;  2M3A A;  2DOF A;  1NHA A;  3RZD J;  4CHU A;  2DFI A;  2GM4 A;  2DA5 A;  2AQF A;  4KIB A;  2UXN A;  2JA6 J;  3CLQ A;  4DW6 A;  2X6Y A;  1PP7 U;  2CQ7 A;  1XCB A;  4G6T B;  4HDU A;  4AUX A;  3ASO H;  3BLY A;  3FXO A;  2IGK A;  2UUZ A;  5FKN A;  3QPL A;  1JHH A;  2IS2 A;  5HDG A;  2F4I A;  1FP1 D;  2NS0 A;  1KYW A;  2Y2Z A;  1WI3 A;  2HTJ A;  4X1E A;  5DUK A;  3HRS A;  2D2W A;  4AD9 A;  2O8K A;  2Y31 A;  2CW0 F;  1TW2 A;  1HSJ A;  1DPR A;  1RIO H;  1TP4 A;  3H0D A;  2ECB A;  2RDP A;  3FBI B;  4B3X A;  1OCC H;  5DCM B;  4F91 B;  1Y56 A;  3W2V A;  4U7D A;  3F22 A;  1ODD A;  1LFB A;  1IUF A;  2E1M B;  1S8N A;  3S2W A;  1SVO A;  4E7J A;  3CDL A;  5C44 J;  1TZL A;  3I64 A;  2VKH A;  3RTR A;  3GBG A;  5HNH A;  5EGO B;  3VSL A;  1V5E A;  3CJR B;  2CYY A;  1QQI A;  5IT9 K;  2K9L A;  2M4K A;  4RBO A;  2ELK A;  9ANT A;  4AIK A;  4RGR A;  2P6T A;  4M74 A;  1ACI A;  2M9H A;  2Z5U A;  3BCB A;  4IPA A;  4KMU X;  3ZP5 A;  2ACJ A;  1D3Y A;  3GUD A;  3NRV A;  3CP8 A;  2LR8 A;  5DYM A;  2HR3 A;  1UMQ A;  2MC4 A;  3DTI A;  2GWR A;  3I9V 2;  3RZO J;  1YW8 A;  3L9F A;  2P4W A;  5E3M A;  3KPH A;  2EWN A;  2IPQ X;  3S2H J;  2IA1 A;  5DEQ A;  2XAJ A;  1MKM A;  1WWX A;  3FXQ A;  4LIU A;  4U0V A;  3GLX A;  1WJB A;  4QPO A;  1YJN I;  3B02 A;  4A0Z A;  1VQK I;  3J7Y J;  2P5L C;  4IOC F;  4CUG A;  3KZI C;  3R4K A;  5E3O A;  2X4H A;  1R23 A;  3HOT A;  3W6J B;  2HDC A;  3RIR A;  1JJ8 C;  1HW1 A;  2D5V A;  3E7L A;  5CQG A;  4CYC A;  2MD0 A;  2VQC A;  5EEH A;  1G2H A;  2GOX B;  1GV2 A;  2A3S A;  1YRN A;  4QTR A;  1YO5 C;  2EIK H;  2AXT C;  3R61 A;  3T5X A;  2VQL A;  3QPT A;  2COB A;  2L9R A;  2DI3 A;  3KFW X;  1VZ0 A;  1LQ1 A;  2LF7 A;  4PGG A;  2V1D A;  2VJJ A;  1ZGJ A;  5HOD A;  2AXL A;  5E3N A;  3SEZ A;  4NNJ A;  3OIQ A;  3BR6 A;  4MEY F;  1QZZ A;  1Q1V A;  4E4H A;  2RV8 A;  3I4N J;  2JUC A;  3KZZ A;  2EIJ H;  4IKF A;  2FE3 A;  2L01 A;  1FC3 A;  1MDM B;  3KP4 A;  4DNC A;  4B3A A;  3KLO A;  1JUS A;  2EV5 A;  2G7H A;  2NXN B;  4J00 A;  1Z3X A;  2QWW A;  3HM5 A;  1S3J A;  4HV6 A;  4WCG A;  2JQ7 A;  4I0B A;  2XGC A;  3U2R A;  3DU5 A;  3TKY A;  3SDG A;  5EDN A;  1PUF B;  2K4B A;  4A0X A;  4FIS A;  3FK7 A;  2CW7 A;  4XOT A;  3S3O A;  2Q2E A;  5EZH A;  2X1C A;  5ILV A;  4E7L A;  1YW7 A;  4I2O A;  5TIS C;  1OFC X;  3SZG A;  3TP3 A;  1EKE A;  4XKW A;  5ICF A;  1A6I A;  2MYS A;  2IS4 A;  2XRO A;  1P4W A;  3IC7 A;  3S2D J;  5D8K B;  2IAI A;  1R4N B;  3QPS A;  3CF2 A;  4I7H A;  2D1V A;  3MQ0 A;  2F2E A;  2WB1 N;  3G1M A;  4DOZ A;  5IYB J;  1PP8 F;  4UNO A;  2DMU A;  2ESH A;  1QPI A;  4MFE A;  4IL6 C;  3IHU A;  2W7N A;  1XSV A;  2I5U A;  2XAU A;  4OIP F;  2H6B A;  3JRA A;  3CCY A;  4U0Y A;  1QVT A;  1YYV A;  1U3E M;  4BHB A;  4YFN F;  3ZMD A;  5KVR A;  3TBI A;  1R58 A;  3I55 I;  3JAM Z;  2FOW A;  4MIM A;  4S04 A;  4W97 A;  4A3C J;  2KDZ A;  1T38 A;  1MH3 A;  2H1K A;  3V8K A;  1Y1V J;  2MG4 A;  2DJN A;  3C3W A;  2HPI A;  1JI8 A;  3VDX A;  2M0C A;  1I6X A;  1ZGW A;  2MD5 A;  3HTS B;  3F6V A;  3BOQ A;  4RLF A;  2W84 A;  3I71 A;  4FX4 A;  4Z6Y A;  2M0M A;  3MVP A;  2F6C A;  3G2B A;  2GA2 A;  3GTQ J;  2LF8 A;  1PDN C;  2CUJ A;  2DMP A;  3HHH A;  1X4P A;  2OAZ A;  4B44 A;  3ONQ A;  1MMN A;  4KIG A;  5DD8 A;  2V6C A;  2M87 A;  1TWC J;  5DCM A;  4Y7N J;  5FKL A;  2ZNZ A;  5ICE A;  3CCJ I;  3GW2 A;  2HOE A;  3AAF A;  5BOX A;  2DQR A;  2R7O A;  4BE2 A;  3JRG A;  1IUY A;  3FHN A;  1IN8 A;  3ZQC A;  1O57 A;  2ZBK A;  3WTY C;  2EFP A;  3G73 A;  1J75 A;  3DLA A;  5FLV A;  3TO9 A;  4Y13 A;  1WGX A;  2EA4 A;  3A03 A;  5EGO A;  4A3L J;  3AG1 H;  4GGG A;  1U5T C;  3L00 A;  2MAB A;  4JX6 A;  2HKO A;  2L54 A;  1W5S A;  1GXP A;  2WC2 A;  4ZYH A;  1KQ9 A;  5F0F A;  1MH4 A;  3TQN A;  4PK4 A;  2K3F A;  3S93 A;  3CCR I;  5LHI A;  1W4M A;  2BY3 A;  3CCE I;  4M3G A;  2ZNY A;  3CMM A;  4HX8 A;  1G3W A;  3Q0W A;  3DCF A;  4P9U A;  4G6Q A;  2KJC A;  3ML6 A;  4HPQ A;  4BHC A;  2XSD C;  2EQR A;  4R1H A;  3P9K A;  3E0J B;  1UCR A;  3OR2 C;  4Y3O A;  1SMY F;  2XKP A;  4M9Z A;  2DDA A;  4C3J J;  1D1B A;  4PCQ A;  2FRH A;  2B0L A;  1BI2 A;  4DYC A;  3ECO A;  1STZ A;  1GUU A;  4XIC A;  4ZTF A;  3M9A A;  4AVZ A;  5M3M J;  1R1T A;  2VJI A;  4ZC3 A;  3BQY A;  2RN7 A;  3ZCO A;  2DJI A;  1HW2 A;  5K7H A;  2EIN H;  3DV8 A;  3RYP A;  2WTE A;  2EIM H;  3Q9V A;  2DFH A;  3VYT B;  1T56 A;  3OYN A;  4MTE A;  2XAS A;  2PMZ A;  2PJP A;  2OUM A;  1YI2 I;  2DK5 A;  2O7O A;  4C9Y A;  2K7L A;  5HOO A;  3E3V A;  2XSJ C;  2LDU A;  2L2O A;  2UXX A;  4NQW B;  1FT9 A;  2K40 A;  2KJB A;  5FLM J;  1T0F A;  3QPH A;  5B3S H;  3JRB A;  1D1C A;  4PFO A;  4RAF A;  1T6S A;  4ETS A;  4BYY A;  1QGP A;  2LK2 A;  3VOE A;  3QP6 A;  1MDM A;  4KIS A;  1ZLJ A;  2CQX A;  4M72 A;  2FNA A;  3K4N A;  1NK2 P;  1WFX A;  3L2C A;  1X3Z B;  3TGN A;  1EH8 A;  4KIF A;  3WGG A;  3DLL F;  2BEO A;  2M8G X;  1TNT A;  1PUF A;  1PVE A;  1P9Q C;  2L9S A;  5CVV A;  1E3P A;  2BVL A;  2OCC H;  1GXQ A;  4LJZ F;  5HLG A;  3OR1 C;  1XN7 A;  1VFC A;  3JCU C;  2O03 A;  2ZSH B;  3OSG A;  1HLV A;  2ISZ A;  3BR5 A;  1JT6 A;  2KQR A;  2D1H A;  1X4O A;  4HX7 A;  2R92 J;  1Y8R B;  5FKK A;  2L7Z A;  2NVY J;  2QQB A;  2DPU A;  2DA2 A;  2IEK A;  1EH6 A;  3OYC A;  2XPV A;  4M73 A;  3KLN A;  1N78 A;  4HX4 A;  1BOB A;  4G7H F;  2H8W A;  1MZB A;  1I1S A;  3FBN B;  5CVR A;  3HJE A;  3G1O A;  2R7R A;  3F9K A;  1IGN A;  4NHJ A;  4Q48 A;  6PAX A;  2JWT A;  4LK0 F;  3VYR B;  5E18 F;  3BG7 A;  2GOM A;  1MBF A;  3HRM A;  3LSP A;  1QHG A;  2V9K A;  3LA3 A;  3W3C A;  4A3M J;  3ZMV A;  5L3C A;  4OMY A;  4U87 A;  1E0E A;  3HOU J;  2EB7 A;  3LSH A;  2E1N A;  1FOW A;  2M5W A;  4O5V A;  3FZV A;  2DYS H;  2W57 A;  4HA8 A;  1TWA J;  2Z16 A;  2FF4 A;  1TQI A;  1UAA A;  2HDD A;  3GZ5 A;  1QVU A;  1A31 A;  4Q47 A;  3FMS A;  4EV0 A;  4JYK A;  3WGH A;  5FLX Z;  3RKW A;  5GTI C;  4L5E A;  3P7N A;  1DQU A;  4RM3 A;  4CZZ A;  5D8L B;  3ZQH A;  3LFK A;  1IN6 A;  4ON0 A;  3D5R C;  3MKW B;  2F4M B;  2DOE A;  2JA2 A;  1S72 I;  2PX9 A;  3RSN A;  2JUG A;  3NAR A;  3LL7 A;  3TO7 A;  4H0E A;  1JGS A;  1QZY A;  2QKL B;  2QBY B;  4M3E A;  4EM0 B;  3MCZ A;  3VWB A;  4A3B J;  1ITY A;  4IEJ A;  3WTT C;  2X1D A;  4D5C A;  2DCE A;  2B63 J;  3DP7 A;  1AU7 A;  2WY7 Q;  2X6W A;  3WTX C;  3DPU A;  3G71 I;  2RGV A;  3K70 C;  2BY2 A;  5DDG A;  1YLF A;  4DYR A;  4BAC A;  1APL C;  2IRF G;  1FEX A;  2CUZ A;  4OIO F;  1BW5 A;  2J5O A;  1TQM A;  2L7K A;  1CF7 B;  5BQT A;  1HKQ A;  2FJ1 A;  4MEX F;  4C3I J;  1P7I A;  3JAM K;  1HW5 A;  1Z7U A;  3BG9 A;  3BZ6 A;  2JZY A;  4EJO A;  5IOY A;  1UJ8 A;  3PSI A;  3X2Q H;  4UVC A;  2E35 A;  4BE0 A;  1MBH A;  2P8T A;  1DDN A;  4AM3 A;  4O3M A;  4XOR A;  2ISY A;  4HNU A;  3HPG A;  1X1D A;  4RM2 A;  4MNU A;  3H5N A;  5HDN A;  4N0B A;  3TW7 A;  3CCM I;  4AWX B;  1J09 A;  4ITV A;  1B9N A;  1YX3 A;  2LMD A;  1TLH B;  2R7F A;  3TDZ C;  4WX9 A;  2RKH A;  1FNN A;  4XRS G;  5IT3 A;  1X58 A;  2LY1 A;  3CF5 F;  4NQW A;  4BKX A;  1LVK A;  1B6A A;  3SDB A;  2ZJ2 A;  5HLT A;  1BI1 A;  2BE5 F;  1Z7L A;  1ON1 A;  3FM5 A;  1FIA A;  3CC7 I;  1PUE E;  2MH9 A;  1MBG A;  4GRI A;  1Y1W J;  2MC3 A;  3HIF A;  2XB0 X;  2KIF A;  2LY9 A;  1VQ9 I;  4KFC A;  2BY1 A;  3HOS A;  4RGX A;  3CO6 C;  1VTN C;  3L09 A;  3D5L A;  1ZR2 A;  2OTJ I;  1T39 A;  5HDK A;  1RPW A;  3HSE A;  3ZQQ A;  1B8I B;  1S6L A;  4I02 A;  5E8G A;  1X1C A;  2E5Z A;  2ZFW A;  1B4A A;  3QOP A;  1EH7 A;  4IF4 A;  2VBY A;  3IRQ A;  1FBQ A;  3LOC A;  1EV7 A;  2RNG A;  2OC6 A;  3PIP F;  3W2W A;  3PQK A;  2VI6 A;  5E8I A;  2JJ7 A;  3FM3 A;  3VEP A;  4AID A;  2JA7 J;  5KAI C;  4MLO A;  2E7W A;  5KNL A;  3BZC A;  2F48 A;  1S9H A;  1XCV A;  3H5A A;  2CFO A;  2EFN A;  1P4A A;  5ICG A;  2W85 A;  3G4S I;  1OCP A;  1R5I D;  3H92 A;  3LAP A;  2CV2 A;  2JPC A;  2GXG A;  2DMT A;  3GZN B;  3WG7 H;  1VQM I;  3PO3 J;  4L0Y B;  4AYB A;  2QSH X;  4FQG A;  2DMN A;  2QEN A;  1SAX A;  2X6O A;  2P0W A;  3HHG A;  5CJ9 A;  5J6X A;  1W1W E;  5EG0 B;  2VIX A;  1QNT A;  2GIV A;  5GPC A;  3S1N J;  1G3Y A;  4FE4 A;  4HW0 A;  1P4X A;  4CGZ A;  2VKD A;  4LG3 A;  4M3B A;  4N4O B;  1BI3 A;  2RC4 A;  5CLS A;  2VON A;  2HXI A;  4KUM A;  3CO7 C;  2G7U A;  3GTG J;  1FMV A;  1G8X A;  3CMA I;  1FLI A;  5FJ8 J;  3OS0 A;  2V7F A;  2ZXI A;  5JHF A;  2VKV A;  1X1A A;  4X0G A;  2V9V A;  1O3R A;  1FMW A;  4DGW B;  4KIC A;  2LYC A;  4NUB A;  3CDI A;  5KCM A;  5ILU A;  5JVT A;  2NAZ A;  3BRO A;  1QRY A;  3QWL A;  2DA4 A;  1OKR A;  2QBY A;  4IHS A;  3OSF A;  2B7E A;  1IN7 A;  5IY5 H;  2FML A;  2K27 A;  2XHK A;  4B47 A;  2UV1 A;  5A2Q K;  2Q8K A;  2VQG A;  1XMK A;  1X1B A;  5J40 A;  2EBI A;  1N25 A;  2DT6 A;  3OWT A;  2DT5 A;  1DU0 A;  4LG0 B;  3VPR A;  3FXK A;  5C4X J;  1MBJ A;  2VJ4 A;  3L1P A;  4KA4 A;  4Y4R A;  3VFZ A;  1N75 A;  2XKO A;  3OV8 A;  2KIQ A;  5CVU A;  1KYZ A;  1MJ9 A;  2HVS A;  1MJA A;  1NTC A;  3HUG B;  5HS8 A;  1CF7 A;  2DU9 A;  2J5P A;  4Z2Y A;  1ZQ3 P;  4FT8 A;  2W25 A;  4L5I A;  4A3K J;  3S14 J;  4B09 A;  3WU1 B;  1L3L A;  4OU0 A;  2YR2 A;  5CVJ A;  3KYC B;  3O8H A;  3RI4 A;  2XF7 A;  4C2M J;  3KCC A;  5F0H A;  2A5Y B;  1JKR C;  3PNY A;  4ASN A;  3VB2 A;  1U0J A;  3EDP A;  2QM3 A;  3OYG A;  4XBF A;  3GYH X;  2O61 A;  4FTH A;  2VT3 A;  1U9O A;  3A1Y A;  2HDW A;  2HZT A;  1XMX A;  5M5W J;  2E71 A;  4NDL A;  1VND A;  1MNE A;  4MHG A;  3CMY A;  3N97 A;  3GX4 X;  2BVM A;  1QA6 A;  3DFG A;  3FIS A;  4XKV A;  3E6B A;  2VQH A;  3BT9 A;  5FLX K;  2TRT A;  3PNT A;  2QVO A;  3BCA A;  3LFU A;  1RRJ A;  2A6H F;  2DPD A;  3GTK J;  4HZF A;  2R7W A;  3EET A;  4JX5 A;  2NVQ J;  5GPA A;  2FD5 A;  1MGT A;  2QF7 A;  3K4J A;  3JSP A;  1QU3 A;  2YX7 A;  4LIT A;  3DPT A;  5F1J A;  2H6C A;  3M1C A;  2GZW A;  1W0T A;  1SC7 A;  2KFD A;  2LRE A;  3MZY A;  5HS7 A;  1YIT I;  3LAJ A;  2NOG A;  5TRD A;  1HF0 A;  3WTS C;  4U7B A;  1SFE A;  1XDU A;  2XAG A;  2WBM A;  1O4X A;  4DIQ A;  4ZYE A;  1GV5 A;  1BN5 A;  3JRF A;  1IG7 A;  1G3T A;  4UXN A;  2JTV A;  2HPM A;  1E17 A;  3AKZ A;  1GLN A;  4D7N A;  3FXL A;  5HLH A;  3JRE A;  4EMS A;  5E20 A;  2XGX A;  3SZP A;  4Y52 J;  2DO7 A;  2BOL A;  5C3E J;  3OYD A;  3CP2 A;  1B8I A;  4OIQ F;  1K79 A;  4LFU A;  1DPU A;  4E7K A;  2HFH A;  2R3S A;  4MGR A;  2EA2 A;  1SD5 A;  2ZKZ A;  4LLL A;  1HA8 A;  4ENJ A;  1F4K A;  2BBY A;  3M07 A;  3HL2 A;  5J47 A;  4IHT A;  5K5R A;  3GTO J;  1W7P A;  2XPW A;  2EZH A;  1E3O C;  3IAM 2;  4F92 B;  3HOZ J;  3JSO A;  3LA7 A;  1BR1 A;  5FO5 A;  4V2G A;  5LGU A;  3PNV A;  2DOD A;  2RNJ A;  1RKT A;  3M1E A;  3QQA A;  2EZL A;  1W7P D;  1T2K A;  2HYJ A;  4KT6 A;  2H27 A;  4C2U A;  3CUQ C;  4RGS A;  4XN3 A;  3BR3 A;  3TED A;  2BYV E;  3AG3 H;  3QP5 A;  3OOP A;  4ZYA A;  2HOS A;  5ED4 A;  5J4V A;  1V55 H;  2EV6 A;  4XLH A;  3OYL A;  4FET A;  4XMY A;  4ENN A;  5GAG J;  2DYR H;  3MWM A;  1F9N A;  2DLL A;  1OR7 A;  2OV7 A;  2V1X A;  3ZMU A;  2QSF X;  1ZAR A;  1KU9 A;  2HOT A;  1LNW A;  3HC7 A;  1IN4 A;  1H89 C;  4XON A;  3WU0 A;  2FBK A;  3R6S A;  2XUB A;  3T8T A;  4ABZ A;  2NNN A;  3B73 A;  1JHF A;  4YFK F;  5H2F C;  4IQ4 A;  4A3J J;  1SFO J;  2LNB A;  4UUV A;  2DTZ A;  1P2F A;  2MFZ A;  4EQQ A;  2F4O B;  1R36 A;  4HBL A;  1XGM A;  2L5Q A;  4GYI A;  3H9G A;  2R7V A;  5JLX A;  4ESB A;  5ILS A;  2M2E A;  3E6C C;  1Z1D A;  1XSD A;  3MKY B;  4DZJ A;  3L2W A;  4JQF A;  2FMY A;  2NS8 A;  1P92 A;  3BY6 A;  4HSR A;  4A3E J;  3ZQI A;  2E1C A;  3ZMT A;  3OYB A;  3FX3 A;  3IAS 2;  3D1N I;  2EFW A;  4R79 A;  2A05 A;  2HTS A;  2KDO A;  2BGC A;  3DU6 A;  1OYI A;  1XGN A;  2R5Z B;  3PFI A;  1ZKG A;  4LG0 A;  5IP7 J;  2R7U A;  1KU7 A;  4RB0 A;  2ID6 A;  2GBY A;  2KIS A;  5JR3 A;  2EH3 A;  3K9T A;  2EJR A;  2LOO A;  2P7V B;  2XF6 A;  3HUG A;  2XB5 A;  4NBQ A;  1R5G A;  4ENK A;  4A3G J;  3A0B C;  2XAQ A;  2KIU A;  2WAE A;  3HTU A;  4N9I A;  2ME0 A;  4E7H A;  1A36 A;  3KE2 A;  2QCO A;  4RDU A;  3M4O J;  3SQN A;  1T98 A;  1I3Q J;  3E6M A;  3GTJ J;  3ECH A;  2F5E A;  4P1W A;  3ASN H;  2ME6 A;  4EJV A;  1BOA A;  2QQ9 A;  4WF2 A;  1IXC A;  3H36 A;  4H4K C;  4E6K G;  4C2T A;  4A6E A;  2K9M A;  1KZH A;  2BY0 A;  2P81 A;  3E5Q A;  3OYE A;  1S29 A;  5BS6 A;  3UKG A;  1ZGA A;  3F8C A;  3K4L A;  4DBQ A;  5EJC A;  2RVC A;  1P6R A;  1U2W A;  2XDV A;  4LB5 A;  1BI0 A;  4JP0 A;  3WHC A;  1QO0 D;  5E1X A;  3IWF A;  2OTL I;  1XDS A;  3TDU C;  5KHD A;  2JMW A;  3LNQ A;  2K9S A;  2L7F P;  2HQN A;  2QEX I;  3Q3S A;  2OQR A;  3HKZ A;  3TOB A;  4FE7 A;  4WWC A;  1TWH J;  4LLG F;  1IDZ A;  3Q0U A;  4MTD A;  4K2E A;  2JT1 A;  3LSJ A;  1ETK A;  3J7Z I;  1O3T A;  1R9T J;  2ZME B;  4E7Z A;  3JRD A;  2K85 A;  2VE8 A;  1E2X A;  3BPV A;  3R0A A;  2JA8 J;  2OPT A;  1ERD A;  4CCL A;  2QGU A;  4LGW A;  3DTK A;  3W6K B;  3RKY A;  5M5Y J;  5FRM A;  5D5V B;  1ONV A;  1ZHF A;  3QYF A;  3F0C A;  1RC9 A;  5LGN A;  2COM A;  2UZK A;  3BZK A;  1VQ6 I;  5E17 F;  4HAM A;  1IN5 A;  4XM3 A;  3I56 I;  1TTY A;  3V8L A;  3J81 Z;  4X6A J;  4HNT A;  4II2 A;  3DEE A;  2VPL A;  2VBX A;  1WHU A;  1F36 A;  1ETX A;  3HG9 A;  4A2U A;  2NVT J;  2HNH A;  1ZRC A;  4ZTJ A;  2GXA A;  3O2P E;  2YPR A;  5FRO A;  1IXR C;  1RR7 A;  4G94 A;  4E7I A;  5BNG A;  1MSF C;  2MA3 A;  2Z99 A;  1ZN2 A;  1J2X A;  2L4M A;  2P7C B;  3GVA A;  2HWV A;  2DFF A;  3OY9 A;  1FBU A;  2KL4 A;  5L3E A;  2CS3 A;  3MN2 A;  5C4J J;  5H6R A;  1UFM A;  2EPF A;  3GFL A;  3KEY A;  2IGM A;  2E2H J;  3SYT A;  2DK8 A;  3HZJ A;  1FY7 A;  3HRU A;  2RAE A;  2TCT A;  5EYR A;  4XLE A;  3SXY A;  4ZZL A;  3QYB A;  1MMG A;  1IAW A;  3U9G A;  1WPK A;  3HDD A;  5L3D A;  5D4R A;  3DBR B;  2ZC2 A;  2RQP A;  4OOI A;  3BTC A;  3O6B B;  4L9V A;  1VQL I;  3RDI A;  1QZE A;  1VQ7 I;  1ZG3 A;  1ZG5 A;  2TDX A;  4AIJ A;  5K7Z A;  4XSZ F;  3UR3 C;  4F52 A;  1DP3 A;  3HYI A;  2KPM A;  3HPH A;  3LSI A;  5LBQ A;  2HZD A;  2XGD A;  2LVS A;  3I4M J;  1B1B A;  1IXS B;  2PI0 A;  3AL0 B;  1V4R A;  3ABL H;  4FHT A;  4BJ5 C;  1HOM A;  2KMU A;  1G59 A;  2ECC A;  3F8B A;  3HRT A;  2OQG A;  4XLC A;  2R5Z A;  2QSG X;  3AFH A;  3FKJ A;  4A3F J;  1HDD C;  3ZOB A;  3WGI A;  2O6G E;  2JRT A;  3WG9 A;  3FKI J;  4JX4 A;  3DQV C;  1YHQ I;  2PEX A;  3DEW A;  1Z0X A;  4CCO A;  1NK3 P;  3KP2 A;  2IBD A;  2LFB A;  3R0J A;  4EJW A;  2M45 A;  1WQ2 A;  4EM2 A;  1OCT C;  5DUI A;  2O3F A;  2VT2 A;  4BY7 J;  1TNS A;  2AS5 F;  1K4S A;  2E1M C;  3GTM J;  1HKT A;  3RCO A;  1A35 A;  2KLO A;  5F27 A;  2JPB A;  4HLX A;  3QU6 A;  1ZEL A;  4QPQ A;  2OZU A;  3K1P A;  3DKW A;  5DCF A;  1R71 A;  1IV6 A;  5GAE J;  2LH9 A;  4IX7 A;  3J7A Y;  2A69 F;  1OCR H;  3LQQ A;  5CQE A;  3P9I A;  4D1Q A;  3SJM A;  4A12 A;  2MSY A;  4I09 A;  5CYV A;  3GZ6 A;  2KKO A;  2H94 A;  5JHU A;  3VOD A;  3BG6 A;  1OYY A;  2CO5 A;  2JN6 A;  2XV4 S;  3GFI A;  3S17 J;  2EIL H;  3B6A A;  4M3F A;  2AHQ A;  3BTI A;  5LRS A;  4NB5 A;  1KQ8 A;  1FOX A;  1A6Q A;  3E1S A;  4BGD A;  2EFO A;  4IOA F;  2WA0 A;  4A6D A;  4BDZ A;  1BBY A;  2YU3 A;  1K6O A;  1LJ9 A;  4ZDL A;  1H9G A;  2IJL A;  2L4A A;  4S0H B;  2CSO A;  1ZTR A;  3D5S C;  2L02 A;  2WB1 A;  4CIC A;  1G3S A;  3QAH A;  5FFX A;  2VE9 A;  2WAD A;  2ZME A;  3FWE A;  1G4D A;  1D8J A;  1G6N A;  1MMD A;  2Y48 A;  3H9Q A;  3IP4 B;  4UHT A;  3OS1 A;  2V4J C;  1LFU P;  3ZGK A;  1U78 A;  2BXZ A;  4HG2 A;  1RNL A;  3M7G A;  4M71 A;  1VI0 A;  1E3H A;  2E36 A;  3GWZ A;  3ZMS A;  1LPQ A;  2XAH A;  3EUA A;  4CCK A;  1K78 B;  4A3D J;  4GYG A;  1VQ4 I;  3F8N A;  3H1C A;  4F3Q A;  1ZRF A;  1W36 D;  3ESW B;  2XC7 A;  4BQQ A;  4UUT A;  2E5N A;  1T0F C;  3CUO A;  2VBZ A;  3MZ8 A;  4AIH A;  3ZR8 X;  2DAO A;  2X9D A;  4BDY A;  1ZLK A;  4BNC A;  3HGY A;  1EA3 A;  3FXM A;  4RAZ A;  1R1U A;  3CES A;  1Y0U A;  3J80 Z;  2M34 A;  4G12 A;  1OCZ H;  5E1W A;  2EV0 A;  1BR2 A;  4U0W A;  2X51 A;  1VQ5 I;  3HBL A;  2WWY A;  2X48 A;  3SHF A;  1AA7 A;  2DA1 A;  3JW4 A;  4XKB A;  3OIP A;  1EF4 A;  2VL8 A;  5LEK A;  3NWS A;  3DWL E;  2B9S A;  3LSG A;  2CV0 A;  2R7T A;  1FTZ A;  3OMY A;  5IYC J;  4I76 A;  2QQA A;  4XQF A;  1BW6 A;  3MKL A;  5FKO A;  4HQM A;  1FSE A;  4CSW A;  3EYY A;  3ZMZ A;  1JXS A;  4CCN A;  4M9S A;  2BHZ A;  3ABT A;  3CC4 I;  2A07 F;  1LEA A;  1IRZ A;  1SFU A;  2FQ3 A;  3ISP A;  5GP9 A;  4GO1 A;  1FZP B;  1QBJ A;  3M8E A;  3U1D A;  3HGG A;  3IWZ A;  1GDT A;  3IH2 A;  1Z05 A;  4WXH A;  5J1Y A;  3P5J A;  4WK8 F;  3K1N A;  3Q5F A;  3S1R J;  3EUH A;  4MQV A;  2NOJ B;  3C18 A;  2CV1 A;  5M5X J;  4GFB A;  1MW7 A;  3CQZ J;  3I53 A;  3LQR A;  4RLQ A;  3J81 K;  1LDK B;  4Y17 A;  3PO2 J;  3WOD F;  4HEA 2;  1OQY A;  4L9T A;  3WTU C;  1YOV B;  1DU6 A;  1BC7 C;  4BEH B;  5K1Y A;  2JVH A;  1Z3Y A;  1W36 C;  4UB8 C;  1XGO A;  1K7A A;  3J7A O;  1FX7 A;  3CCV I;  3GTL J;  3KEO A;  4LB6 B;  3K4M A;  4BXX J;  1RZ4 A;  2Y75 A;  4D9J A;  2HQA A;  3V7S A;  1U8R A;  2FNP A;  5B5E C;  3SZT A;  2HXO A;  3TMO A;  5TJJ A;  2IS6 A;  1IF1 A;  2Y69 H;  1R1V A;  2R7Z J;  5BMZ A;  2DOA A;  3B6C A;  2H1L A;  5D5U B;  3K7A J;  3F72 A;  4YEL A;  3IV5 A;  2GLO A;  4BBS J;  4A69 C;  3ZPL A;  4P9F A;  1Y6I A;  1VQN I;  4IQJ A;  1HXD A;  2VXZ A;  3M8F A;  3JRC A;  1IC8 A;  4XL9 A;  1YIO A;  5L3B A;  1HKS A;  3IH3 A;  3BTL A;  1U9N A;  4BHP A;  3KYD B;  1SAU A;  1JUM A;  1U6G A;  4PUS A;  1ETY A;  4TV7 A;  4IHW A;  2R0Q C;  2XRN A;  2OU2 A;  2MLG A;  2MBF A;  4U88 A;  3E5U A;  4XRF A;  2R5Y B;  3MAJ A;  3DBL B;  1LDD A;  4BXU A;  1BIB A;  2ELH A;  2Y9Z A;  5FKM A;  1KA8 A;  5GAD J;  1JTX A;  1MBE A;  1FTT A;  5ERI A;  1I50 J;  4L9J A;  1Y0N A;  2H09 A;  4PJ0 C;  2A68 F;  4OIR F;  1WJC A;  3ZQL A;  1FYM A;  4OAZ A;  1WJF A;  3H0G J;  4YII A;  4PZJ A;  4EEF G;  2K9Q A;  4ZDP A;  3TW6 A;  2LBF B;  3I0T A;  1UHS A;  2ZCW A;  3ZRG A;  1H88 C;  2E7X A;  4IJA A;  1Z6R A;  2IVM A;  1WVR A;  2ZO4 A;  2CJJ A;  1GT0 C;  2RRE A;  2ELJ A;  1YFH A;  3LST A;  2F5D A;  3PSF A;  1RI7 A;  2IGN A;  3NEU A;  2VXD A;  1UG0 A;  1J9I A;  3A0H C;  1HC8 A;  2V6E A;  2VKE A;  3BDD A;  2DTR A;  3QYE A;  3L2U A;  2L9N A;  5DV5 A;  4PSW A;  1K78 A;  5LEJ A;  4QLC U;  2BHY A;  2OZ6 A;  1Z9C A;  1ORK A;  2KRH A;  3L7W A;  1T8I A;  2CH0 A;  1UB9 A;  3ERM A;  5B1B H;  1ETW A;  3D0S A;  5J8C A;  2E60 A;  4F7Z A;  4XID A;  2DDB A;  4UV8 A;  4CXF A;  2M7A A;  3U21 A;  4C30 A;  3KP5 A;  1BA5 A;  1XX5 A;  4QIW N;  2FXA A;  1OYW A;  1TWF J;  1WJE A;  1WRJ A;  4HQE A;  2PLY A;  3GLL A;  1PYV A;  5K5O A;  4A3I J;  4BL0 B;  2KRF A;  1D0Z A;  5GTH C;  1HBX G;  4HYE A;  4UUS B;  3BWG A;  5J4Y A;  4P96 A;  4WXC A;  1FYK A;  2EK5 A;  2ZB9 A;  1IW7 F;  1USS A;  3H3V K;  2W1O A;  3OL4 A;  2NVX J;  1REP C;  5IOZ A;  3E6D A;  2KP6 A;  2IGO A;  1FYL A;  3V42 A;  3A01 B;  2M4G A;  2FQ4 A;  1KGS A;  4FAS D;  4I01 A;  1W5C C;  4BH9 A;  2O8X A;  4V19 K;  2DW4 A;  3UNG C;  1XS9 A;  2QYO A;  2R4G A;  4G7Z F;  3FK6 A;  4YG2 F;  1JGG A;  1U5T B;  1YS7 A;  2MLK A;  1FP2 A;  3CCL I;  3OS2 A;  1DP7 P;  2VOP A;  3CCQ I;  1HCR A;  4DBR A;  1I5Z A;  1WH7 A;  2X85 A;  3WE3 A;  2OJE D;  2ZXJ A;  3BG5 A;  2NVU B;  1WJ5 A;  3RQI A;  1X1P A;  3FXJ A;  2CUE A;  4AC0 A;  4BEH A;  5IPA A;  4YRV A;  3J80 K;  4LK1 F;  3NQO A;  3A4C A;  3H9J A;  1ZG1 A;  2CFX A;  1W5T A;  4ZH4 F;  1OCO H;  3QOE A;  1YX5 A;  1EJ9 A;  2EZI A;  2R93 J;  3OYJ A;  3DEU A;  4YFX F;  3BR0 A;  3OYM A;  1X3W B;  1T33 A;  4A5M A;  5LHH A;  4XNF A;  3L2V A;  1LUJ B;  1B59 A;  4M6V A;  3BR1 A;  2Z9O A;  1SVM A;  1JTY A;  2Y0M A;  3CJT B;  2NNY A;  4PJN A;  2YU9 J;  1GHC A;  2PBI A;  3PFY A;  5CVI A;  4L18 B;  2V79 A;  3CJN A;  1NG7 A;  3S1M J;  5FD6 A;  4EAT A;  2ZFU A;  3FMQ A;  4BU2 A;  3LSK A;  4YIR X;  1MIJ A; 
#chains in the Genus database with same CATH homology
 4II3 A;  3H5R A;  1ERD A;  3FBN B;  2R7R A;  4CCL A;  3F9K A;  4CCJ A;  3RQ4 A;  3DTK A;  4BQO A;  3VYR B;  4AU7 A;  5FRM A;  3VYS B;  3KYL A;  3BG7 A;  2GOM A;  1QHG A;  2V9K A;  3QYF A;  3MD2 A;  3W3C A;  3RPU D;  2ZSI B;  2W82 A;  2DT7 B;  4U87 A;  1E0E A;  4XM3 A;  3LSH A;  3EUH C;  4F55 A;  3S32 A;  4HNT A;  4II2 A;  2Z16 A;  3DEE A;  4P5O A;  2VPL A;  1UAA A;  4BJT A;  3OYK A;  3HG9 A;  3DTE A;  3DPL C;  2LBF A;  2HNH A;  3AL0 C;  2VJ5 A;  1WJD A;  1DQU A;  4ZTJ A;  4RM3 A;  5FRO A;  1N77 A;  3PJR A;  2IXS A;  4E7I A;  3D5R C;  3MKW B;  1OLT A;  2JA2 A;  2R7S A;  3RSN A;  2JUG A;  3LL7 A;  4XR6 A;  2QKL B;  3OY9 A;  2KRC A;  2KL4 A;  2CS3 A;  2ZXH A;  3VWB A;  4BXF A;  4PJL A;  2M7B A;  3KEY A;  2IGM A;  2X1D A;  2DCE A;  2JSP A;  3SYT A;  2QKM B;  5TGT A;  1LKX A;  2Z2S B;  4XLE A;  2WY7 Q;  2X6W A;  2LRD A;  3QYB A;  4ANJ A;  3OYA A;  1MMG A;  2WAF A;  3DPU A;  3K70 C;  4BAC A;  3S3N A;  3K6G A;  3CJQ B;  3W2A A;  2CUZ A;  5LD2 C;  2K3P A;  2L7K A;  4CCM A;  4PSX A;  1TT0 A;  4HST A;  2LC2 A;  1SFK A;  3UR3 C;  4F52 A;  1DP3 A;  3K4C A;  2AQE A;  2KPM A;  5FRN A;  3HPH A;  1KON A;  3LSI A;  3PSI A;  1D1A A;  4BE0 A;  2HZD A;  4XOR A;  3AL0 B;  4YEJ A;  4BJ5 C;  2Q1Z B;  2KMU A;  1G59 A;  4HNU A;  3HPG A;  2BW3 B;  1X1D A;  4RM2 A;  4XLC A;  2FUG 2;  3AFH A;  3FKJ A;  3H5N A;  4PJJ A;  3DQV C;  2Q2E B;  1J09 A;  2KHM A;  4ITV A;  4PJM A;  4CA0 A;  4B48 A;  4CCO A;  4LIV A;  1YX3 A;  2X1E A;  2A5W A;  2LY1 A;  1LFP A;  2E1M C;  1LVK A;  2W4S A;  4XKC A;  3RCO A;  1NG6 A;  3VSK A;  4BJ6 C;  2KLO A;  1DGW Y;  1X19 A;  3SDB A;  5HLT A;  1Z7L A;  2M3A A;  1ZEL A;  4QPQ A;  1OR7 C;  3K4K A;  4GRI A;  3S3M A;  2UWM A;  4BUP A;  2JVG A;  2PJR B;  2AQF A;  4IX7 A;  2LH9 A;  3J7A Y;  1BR4 A;  4D1Q A;  5CQE A;  2Z1D A;  3HOS A;  2X6Y A;  1PJR A;  1QHH D;  3D5L A;  3BG6 A;  4G6T B;  2KZV A;  3ZQQ A;  3BLY A;  1K6Y A;  1X1C A;  2E5Z A;  4HRI A;  2IGK A;  3E1S A;  2UUZ A;  4BGD A;  2WA0 A;  4BDZ A;  2RNG A;  2OC6 A;  2IS2 A;  3W2W A;  3DKX A;  4ZDL A;  2F4I A;  3L2Q A;  3D5S C;  2WB1 A;  4Y33 A;  2WAD A;  4MLO A;  2HVQ A;  5KNL A;  1MMD A;  3H9Q A;  1S9H A;  3H5A A;  3IP4 B;  2CFO A;  3H0D A;  3FBI B;  4B3X A;  3OS1 A;  2V4J C;  4XOP A;  3ZGK A;  4F91 B;  1Y56 A;  3W2V A;  1V5F A;  4KJZ A;  4HG2 A;  2E1M B;  2CV2 A;  2R7Q A;  3EUA A;  4E7J A;  4AYB A;  4CCK A;  2X6X A;  1TZL A;  2P0W A;  2VKH A;  3RTR A;  2VIX A;  3GBG A;  4F3Q A;  5HNH A;  3VSL A;  2XC7 A;  1W36 D;  1V5E A;  4BQQ A;  2E5N A;  1T0F C;  3CJR B;  3ZR8 X;  4JOM A;  4BDY A;  2K9L A;  2M4K A;  4NC7 A;  1EA3 A;  2VKD A;  4LG3 A;  4N4O B;  3CES A;  4OWR B;  3BCB A;  3CZ6 A;  1FMV A;  1G8X A;  3OS0 A;  1BR2 A;  3CP8 A;  2X51 A;  2V7F A;  2ZXI A;  5JHF A;  2MC4 A;  1X1A A;  3DTI A;  3I9V 2;  4X0G A;  1AA7 A;  1FMW A;  4XKB A;  4DGW B;  3OIP A;  1T95 A;  2LYC A;  2VL8 A;  4NUB A;  5KCM A;  3NWS A;  1YE9 A;  3DWL E;  3QOD A;  3LSG A;  2CV0 A;  2R7T A;  4LIU A;  3OMY A;  1WJB A;  4QPO A;  4XQF A;  3M8J A;  3H35 A;  4CUG A;  4CSW A;  4B47 A;  2UV1 A;  3HOT A;  2VQG A;  4CCN A;  4NC8 A;  1X1B A;  2DT6 A;  3OWT A;  4BE1 A;  5CQG A;  2VJ4 A;  2MD0 A;  2VQC A;  4Y4R A;  2HVR A;  3C2H A;  2GOX B;  1N75 A;  2HVS A;  3HUG B;  2VQL A;  1VZ0 A;  2VJJ A;  3SEZ A;  2NOJ B;  4NNJ A;  3OIQ A;  3MKZ A;  2CV1 A;  3VYU B;  3EPZ A;  1MW7 A;  2XF7 A;  4E4H A;  3PNY A;  1U0J A;  3OYG A;  4RLQ A;  4IKF A;  1LDK B;  3N05 A;  3A1Y A;  2HDW A;  4J00 A;  4HEA 2;  2Y0S A;  1Z3X A;  2LG4 A;  4BEH B;  2JVH A;  1Z3Y A;  1MNE A;  4OAY A;  3OOU A;  4DJA A;  1W36 C;  2BVM A;  2BW3 A;  3DU5 A;  4XKV A;  2VQH A;  3PNT A;  3K4M A;  3BCA A;  2CW7 A;  3LFU A;  4XOT A;  3S3O A;  4D9J A;  2HQA A;  2X1C A;  4E7L A;  2R7W A;  3SZG A;  2LY2 A;  3K4J A;  4XKW A;  3TMO A;  2IS6 A;  1QU3 A;  2MYS A;  3K10 A;  4LIT A;  2IS4 A;  3DPT A;  2DOA A;  3M1C A;  3CF2 A;  4YEL A;  2HU9 A;  2VLA A;  2LRE A;  3SEQ A;  4DOZ A;  1Y6I A;  4IZZ A;  5LFA A;  4IQJ A;  4RMN A;  2VXZ A;  4U7B A;  2WBM A;  4XL9 A;  4DIQ A;  2W7N A;  2XAU A;  2HPM A;  2DXI A;  3AKZ A;  1GLN A;  1SAU A;  2PJR A;  4PUS A;  3K70 D;  2BOL A;  5CKT A;  3TBI A;  1IRX A;  3OYD A;  3PUB A;  3CP2 A;  4CH7 A;  4E7K A;  1HA8 A;  2HPI A;  3HL2 A;  4B43 A;  1JI8 A;  4E7S A;  5HNF A;  3VDX A;  1WJC A;  4PFP A;  3IAM 2;  4F92 B;  4OAZ A;  1BR1 A;  1WJF A;  4RLF A;  4ZDP A;  2LBF B;  3OYH A;  2M0M A;  2F6C A;  3BC8 A;  3G2B A;  3PNV A;  1D0X A;  4N4N B;  3ZRG A;  1V5G A;  2CUJ A;  1X4P A;  4KT6 A;  1UEL B;  4B44 A;  2RRE A;  3ONQ A;  3FDY A;  4C2U A;  2ELJ A;  1MMN A;  3PSF A;  4XN3 A;  2IGN A;  2VXD A;  1UG0 A;  1WJA A;  4ZYA A;  2V6E A;  2VAS A;  3QYE A;  2R7O A;  3L2U A;  4BE2 A;  2L9N A;  4XLH A;  3FHN A;  4PSW A;  3OYL A;  2A6T A;  4FET A;  3OYI A;  4XMY A;  3DLA A;  2K5C A;  2KRH A;  2OV7 A;  3MMY B;  4XLF A;  2CH0 A;  3S8P A;  2VB6 A;  3I3L A;  3HC7 A;  2MAB A;  2E60 A;  4XON A;  3ZXS A;  2O5R A;  3TL4 X;  3NWT A;  2M7A A;  3U21 A;  4C30 A;  4PK4 A;  3K4B A;  3S93 A;  3LSM A;  4IQ4 A;  3CMM A;  1WJE A;  2MFZ A;  4XN0 A;  2L5Q A;  4XLA A;  4HPQ A;  3H9G A;  2R7V A;  1D0Y A;  1PYV A;  1R6R A;  2I8D A;  1DGR M;  3E0J B;  3OR2 C;  4Y3O A;  4BL0 B;  3MKY B;  3L2W A;  2R7X A;  1D0Z A;  3EUK L;  4JQF A;  1D1B A;  4HSR A;  1MMA A;  4ZDO A;  3OYB A;  3IAS 2;  4KIT B;  3PL8 A;  4R79 A;  2W1O A;  4ZTF A;  3OL4 A;  2F5V A;  2KDO A;  3DU6 A;  5HVQ C;  4AVZ A;  5CPR B;  2VJI A;  2R7U A;  4ZC3 A;  3ZCO A;  2DJI A;  2KP6 A;  2IGO A;  3IUO A;  3V42 A;  4BS9 A;  2M4G A;  2XF5 A;  3VYT B;  2LOO A;  3OYN A;  3OL3 A;  2XF6 A;  2PMZ A;  2WAQ A;  2OUM A;  4FAS D;  4C9Y A;  2RQQ A;  2CW8 A;  5HOO A;  2XSJ C;  2L2O A;  4NQW B;  2WAE A;  4F93 B;  2IS1 A;  3UNG C;  4E7H A;  2R4G A;  4ZJZ A;  1MND A;  1D1C A;  4PFO A;  3OYF A;  3OS2 A;  3KX2 A;  4DBR A;  4KIS A;  4P1W A;  3K4N A;  2X85 A;  1WFX A;  1WJ5 A;  3L2R A;  4H4K C;  4E6K G;  4BEH A;  4YRV A;  4C2T A;  3HXL A;  2K9M A;  3OYE A;  3A4C A;  4CZC A;  3H9J A;  2W00 A;  3K4L A;  4DBQ A;  3LMM A;  1Z21 A;  1P9Q C;  1YX5 A;  2L9S A;  2BVL A;  2XDV A;  3C2G A;  3QOE A;  3OYJ A;  3OR1 C;  3OYM A;  2V26 A;  2ZSH B;  3A2K A;  2CMP A;  5KHD A;  4XNF A;  3L2V A;  2KQR A;  1X4O A;  4J01 A;  3HKZ A;  4PJN A;  3DKY A;  3PFY A;  2WY8 Q;  3OYC A;  4BQN A;  1NG7 A;  4EAT A;  1N78 A;  2V1N A;  2ZFU A;  4E7Z A;  4BU2 A;  3LSK A;  1BOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...