1DGRM

Refined crystal structure of canavalin from jack bean
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
QLRRYAATLSEGDIIVIPSSFPVALKAASDLNMVGIGVNAENNERNFLAGHKENVIRQIPRQVSDLTFPGSGEEVEELLENQKESYFVDGQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CANAVALIN
publication title X-ray diffraction and atomic force microscopy analysis of twinned crystals: rhombohedral canavalin.
pubmed doi rcsb
molecule tags Plant protein
total genus 14
structure length 92
sequence length 92
chains with identical sequence W, Y
ec nomenclature
pdb deposition date 1999-11-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.840 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1dgrM01
1DGRM 1DGWY
chains in the Genus database with same CATH superfamily
5HS8A 4BE0A 1H0MA 2ZJRF 4OIPF 4ENKA 1D1AA 4KMFA 3G1OA 1FTTA 3FK7A 3HTUA 3CJNA 3DPTA 2V4JC 2K9MA 4I98B 2ME6A 1E2XA 2QEXI 2EQRA 4XRFA 1YRNB 1V4RA 1A6QA 3WG9A 3BTCA 1BR4A 4AIHA 4N9HA 2XB0X 3I4NJ 2GBYA 2DFHA 5FKMA 3K0LA 4PZJA 3WTTC 5TISC 1FLIA 2IJLA 1XD7A 2WTEA 2IS4A 3CDLA 1JKOC 3TO6A 4BHCA 2ZMEB 4KIFA 1PP8F 3DPUA 2WWYA 5M3FJ 4EJUA 3ESWB 4F92B 2HFHA 3MQ0A 5LFAA 4UXNA 2QSFX 2KIMA 4A6EA 2K85A 4ZYAA 2QZ8A 2R7DA 3RPUA 1MMSA 2ZSHB 4MQ9F 4KIBA 1G8XA 3GBGA 4CGZA 2E5NA 4II3A 3TBIA 2WADA 5FLVA 3K1NA 4CH7A 1QHHD 3HOTA 3KIOA 3S2WA 4FTHA 3V8JA 1SD7A 3DV8A 5E8IA 5EZHA 3A1YA 4PSWA 3CCSI 5FFXA 1B8IB 3OYJA 2XGCA 2XSJC 3Q0UA 2CV0A 3GYHX 2OF7A 1EH8A 3L7WA 1TC3C 3KPHA 4KNYA 1EF4A 3DBHB 1MNDA 4M6YA 3Q3SA 4CYCB 3C2BA 4UY8I 1DP3A 1LVKA 1X19A 5D6EA 3DQVC 3E97A 2K40A 2X48A 5KNLA 5DYMA 4A69C 1U8BA 1XGSA 3NWSA 3GXOA 4D5CA 3RZDJ 2R7UA 2ZFUA 3MN2A 3HOWJ 5E3NA 2GOMA 3IL2A 3ML6A 4HV6A 4DZPA 3D5SC 2CFOA 1IV6A 2ZXIA 4BY1J 4IHSA 3BJ6A 1XMAA 3J7YJ 1OCPA 4EVIA 3AL0C 5J1YA 2EWNA 2DMQA 3WG7H 3LSRA 2LH9A 2M7AA 1GT0C 2A61A 5CPRB 1ETYA 4FETA 3G1MA 3SDGA 1XTAA 4XNFA 5E1XA 4CDGA 2DO7A 2VBZA 5F0FA 3HRMA 4XOPA 3ZMTA 4UUTA 3KLOA 4LB5A 4A3DJ 2QKLB 3X2QH 5F64A 2DA6A 1AKHA 4IHXA 5LEJA 5BMZA 2PLYA 2A07F 4LK1F 3V7CA 3WTUC 2G0EA 2XRLA 2UZKA 4ZYHA 4YFXF 2DMUA 3F9KA 3K1MA 2L01A 1Z21A 3SJMA 1S8NA 3QQAA 3C2HA 3H9GA 2VUMJ 3LSKA 2VOOA 3P5JA 2K3PA 1W36D 4BE2A 4C2UA 3OMYA 1NG7A 1DGWY 3GTLJ 3LSGA 2JTVA 5GPCA 1O3QA 1Z3XA 2MBFA 1SFEA 4A5MA 1U5TA 4DIQA 5FD6A 3KE2A 2F2EA 1XC5A 5M5XJ 5LHIA 2ZB9A 1GXQA 3M8EA 3IRQA 2E1CA 1KU3A 4ZC3A 3S3MA 4PFPA 1UB9A 3ROUA 5LHGA 5FO5A 2EA4A 3K4MA 1TQIA 3J81K 2E1OA 5EJCA 2WY8Q 1Y8RB 2KRHA 3BR2A 3FF5A 1HW5A 2A3SA 2BY1A 3IAS2 4N0BA 2F5VA 3FXLA 4HYEA 5CKTA 2L4AA 1FIPA 3K4JA 3ZQGA 5K5RA 1NG6A 2VODA 4BAYA 3BPXA 2A69F 2CS3A 2GIVA 2QF7A 3AG2H 3BR6A 3DCFA 4P55A 5FLMJ 4CXFA 1OISA 5FGMA 3K4CA 1SVLA 4FCYA 2MA3A 1OCRH 3EYYA 1JUSA 3G2BA 4O6JA 4MNUA 2BVLA 1P9QC 1YS7A 5FKNA 1I1SA 3BLYA 4B47A 3CF5F 2RQPA 5KHDA 1ZGAA 2Z33A 4OWRB 1T56A 1YIJI 1R6RA 4A0XA 3CJQB 1XSXA 2L7ZA 3BWGA 2UUZA 2MGQA 4CCJA 3FX3A 1IUFA 1OMIA 4IPAA 2BHYA 2BBYA 1S7AA 2Q8KA 4CSWA 1AOYA 4XQFA 1GDTA 1MGTA 3FBNB 4BY7J 3WTWC 3F8MA 3PQJA 5H6RA 3CCUI 3UR3C 1G3YA 1U9OA 1X2NA 4A3KJ 3CDIA 3FK6A 2BEOA 1K4SA 1RKTA 1HKTA 1ZR4A 4JBAA 1MBHA 2DA4A 2R3SA 1ZRDA 4D0PA 4IHTA 2QWWA 3NQOA 1YHQI 1I39A 3GCMA 4OAZA 2LFBA 4NB5A 3F23A 3J81Z 3D1NI 2BW3A 2HZTA 4JP0A 3OYDA 1VQPI 1ZK8A 1H8AC 3I4PA 3DF8A 2E34A 3OOPA 3R4KA 2MLKA 2HZDA 3SXYA 2EZKA 4RB0A 4GRIA 3PIPF 4Y52J 2NS0A 2LF8A 1JT0A 1LE8A 4HQMA 2R7RA 2LMDA 3U9GA 4LOCA 4HF0A 3Q5FA 4I09A 2AHQA 2IP2A 4NDLA 4ZJZA 3WGIA 4CHUA 2HWVA 1IN5A 2RC4A 3ZMZA 2VOPA 2EFOA 3F72A 1T33A 1ZRFA 3HOSA 2DU9A 2JMWA 5B5EC 2PJRA 3CMMA 3HOXJ 2M45A 3HBLA 2IA1A 4HBLA 3RPUD 1U2WA 2PX9A 4E7LA 3ABLH 4LB6B 2OA4A 4H4KC 3CC2I 1HCRA 3WGHA 2GA2A 3DP7A 3HGYA 2OC6A 2I10A 1BL0A 4QPQA 1FEXA 4BDYA 2JA7J 3KX2A 4AM3A 1QZYA 1Z6TA 2CW0F 2CUFA 3IH2A 3M07A 2XASA 2H1KA 4Y13A 5J1RA 1I5ZA 5F1RA 2DFFA 4BL0B 5LRRA 3E1SA 3W2AA 2EB7A 1FIAA 1BIAA 1T6SA 4HG2A 5HOOA 2DMTA 2OCEA 4HAMA 1YJWI 4XONA 1I50J 1LFUP 3BY6A 3H0DA 2HVQA 5JHUA 2NVUB 2AS5F 3AKZA 1J59A 3I55I 1XS9A 1BN5A 4EGYA 3BZ6A 3SDBA 3F8BA 5EEHA 2DODA 3I9V2 3L2RA 1FT9A 2OU2A 1ETOA 1B9MA 5E3LA 3W2VA 4HA8A 4A12A 2VIXA 1TT5B 3FWEA 4JK1X 4BJTA 5D5XB 4IQJA 3OYBA 2MLGA 1CQTA 2V1UA 1LKXA 2EV0A 1ETVA 5HODA 1EH7A 1FC3A 3DEWA 2FQ3A 2E36A 1HA8A 2DBBA 2VQCA 4XRSA 5FRNA 1T98A 3WU1B 2N8GA 2VXDA 4ZTJA 3KCCA 3DKYA 4B43A 1W5TA 2BOLA 1QA6A 4XRMA 4G8XA 3L2QA 1XGNA 3ASOH 2EZHA 3GF2A 5A2QK 4ZH4F 3CD6I 3H92A 4XKCA 1Q1HA 2V26A 4U0VA 3TL4X 4LLLA 2HYGD 4XMYA 1KU2A 3O2PE 2DT6A 5CLSA 1SANA 2W24A 1USSA 1FOXA 2ISYA 2AQFA 3K2ZA 3RSNA 3CC4I 2KPMA 1YYVA 3I58A 5HLIA 3B6CA 2B63J 3JRCA 2EFQA 5JVGF 3VSKA 2ELHA 3PNYA 4A2UA 2JN6A 4BQQA 4XLCA 1TW2A 1XG1A 2BYVE 5JLWA 3MKZA 3W6JB 4YG2F 1W36C 2V1DA 4QSHA 4HX8A 4GO1A 5ICCA 5LEKA 1S29A 1WZ2A 5F08A 1IRGA 3PFYA 3FXRA 1XX5A 4GXOA 2JPCA 1FOKA 4I0AA 3H36A 2RKHA 1WJ5A 1L0OC 1VQ7I 4B1RA 2A5YB 2EFWA 4DGWB 2EA2A 2CUZA 4G12A 1Z91A 3CCJI 1Z1DA 5DDGA 2ECCA 4E7KA 2WAQA 3LSJA 4I99C 2COMA 3ERED 4QPOA 3JTGA 3TO9A 3M1CA 3NWTA 2A68F 1R22A 1WSUA 2DN0A 1F5TA 2L7KA 2HDDA 2W85A 2V6CA 3F22A 1IRXA 2NXNB 2DOAA 2XPWA 3EUKL 3EDPA 3EUHA 1MDMB 1IO2A 2K7LA 2R7WA 5ICEA 1DGRM 5A2QZ 4HF1A 2PMHA 4AIKA 2MYSA 1OCTC 1Z6RA 2X51A 1RETA 2VN2A 1WKMA 2L9SA 1DU0A 2LBFB 5HS9A 1ZTRA 3U1KA 1J2XA 3F8NA 2E35A 2GXAA 4A3EJ 2VPLA 1SFKA 2XB5A 3FXQA 1MBFA 2OZ6A 1U6GA 2W7NA 3DU6A 2ID3A 4EV0A 5FRMA 2NVYJ 4CYDA 1FNNA 3LA3A 4ABZA 3CP8A 3RYRA 1N78A 1STZA 5F0CA 4M9XA 1G3TA 1QZZA 2W82A 4FX0A 2EPFA 2JPBA 3IH3A 3UKGA 1PP7U 4WF2A 2KP6A 3E3VA 4CICA 2FNAA 3DBLB 3FZVA 1BIBA 2YSRA 2OZUA 3PFIA 2BHZA 2V1XA 1LFBA 1OKRA 3SFZA 2HR3A 4LG3A 2HEOA 1ZLKA 3BPVA 5GAGJ 2I8DA 2VKVA 2R5ZB 3QPTA 1SAXA 3C7JA 1IXSB 3ZQLA 4RS8A 2NNNA 1MD0A 4BBSJ 1MJAA 1JUMA 3H1CA 1UELB 2CQ7A 3GWZA 2CW7A 4N9IA 2FOKA 5BPDA 4G9YA 1EH6A 2MW8A 3HPHA 1D5VA 2VKHA 3B6AA 2LVSA 3HEFA 2DA7A 2ZNZA 3OIQA 2CU7A 5BPIA 3MZYA 1GV2A 3QOEA 1PDNC 5IYBJ 5AONA 1XN7A 1RNLA 2ZKZA 2LREA 4XRSG 2YX7A 2XF5A 3WTSC 4LIVA 2IT0A 3CLOA 3PIOF 2EIMH 1R71A 1DP7P 4ZYGA 1UHMA 2EBIA 2E7WA 4QLCU 4U0WA 2P7VB 5E3OA 3E5QA 3VOEA 3ZMUA 3IP4B 3KZYA 2V79A 1PUEE 3FIWA 1W7PA 1DPRA 2HQAA 1R1UA 3BJOA 3S8PA 2A6HF 4NBQA 1WRJA 5J8CA 4U0YA 1E17A 2QKMB 2HVRA 4Y3OA 2HOSA 3K2AA 2M0CA 2Y75A 1VTNC 4HX4A 5EEAA 3CUQB 4ENNA 1XSVA 1BOAA 2EH3A 4KMUX 2CH0A 2M4KA 4V2GA 1Y1WJ 2NS7A 1IG7A 4I02A 1LEAA 3ZQIA 3BR0A 5HLGA 2EFNA 2NOGA 2JSPA 5F0HA 2LK2A 4WXCA 1ENHA 3RCOA 2VKEA 5AIQA 1ACIA 3DXJF 1J09A 1LNWA 4EATA 5KCMA 1R49A 1KU7A 1LVAA 3K4NA 3MAJA 3HHGA 1R5HA 4C30A 3ZRGA 2VLAA 2ZBKA 1N75A 1MBEA 4B48A 5J4YA 1TWGJ 2D45A 2Y31A 2AQEA 1A5JA 4AVZA 1Z67A 1HLVA 5DCMB 3V42A 4M6VA 5IP9J 4UUSB 1VQOI 2VQLA 4C3HJ 4RB3C 5C44J 3HUGB 1LUJB 4KFCA 2XGDA 1MBJA 1RKWA 1K7AA 4D1QA 4CUGA 3JSPA 5IOYA 1UFMA 4CZCA 4IX7A 2B7EA 2I5UA 2HOAA 2FF4A 3DPLC 3RQIA 3LSMA 5HNHA 3TMOA 3VWBA 1ORKA 4DNCA 3L9FA 1QHGA 1F4KA 3IRRA 4A3FJ 4TV7A 3CTAA 2P8TA 1T8IA 2P5VA 1P4WA 1FYKA 4KISA 3BP8A 3RQ4A 3QPLA 2IGOA 4S04A 3P9KA 4LD5A 4ANJA 1U8RA 4CCKA 2FBIA 1HW2A 2HQ5A 4U7DA 4MIMA 2VT3A 3WHCA 1OPCA 2EINH 2R7ZJ 2Z3YA 3FXKA 3I64A 2KT0A 2WAQN 3PO3J 3EUAA 4LMYA 4PK4A 2EFPA 5IOZA 2VE9A 5IT9K 1D8JA 1I3AA 5BOXA 4E7IA 4A0YA 1MBGA 2COBA 4MFEA 4A3GJ 4NQWB 1U5TC 3GTJJ 3I53A 3KP5A 5JR3A 1AHDP 3EETA 4MEYF 1FMWA 4RAGA 2XVCA 3O8HA 2D2WA 3K4LA 1K78B 1GV5A 1ODDA 3OIPA 1KQ0A 3WHBA 1KYWA 2MABA 2PBIA 4LLGF 5L3GA 1G3SA 4UVBA 4I7HA 1G4DA 1ZYRF 3SZGA 2L2OA 2ZNYA 4FE4A 1OLTA 3BTIA 4RB1A 3F3XA 1YOVB 1U0JA 2WA0A 1G59A 1PYVA 1AA7A 4KJZA 2FJ1A 1P4AA 3AL0B 2LP0A 1YI2I 4UVAA 4C3IJ 1HW1A 2E71A 3HZJA 4L0YB 3OYCA 1IDZA 3I5UA 4G6DA 1R36A 1SD6A 2QGUA 4BEHA 1R4MB 2RV8A 2K9LA 4Y7NJ 4BYYA 5IYDJ 3H3UA 1Y39A 1FYMA 5J6XA 3WGGA 3H3VK 2YPRA 3H0GJ 3RKYA 3CCYA 5LD2C 2QUFA 1TZLA 4MGRA 3A01B 2K27A 1Z3YA 4JX4A 1T2KA 1RC9A 2A6TA 2KL4A 3R60A 4DBQA 2FU4A 2V9VA 2K86A 2XKOA 5CVUA 2R93J 4O3MA 1BM9A 3QWLA 5DD4A 5B3SH 5E18F 1HBXG 1F9NA 4IHYA 3WU2C 4JX5A 2XSDC 2W57A 3CCRI 4C2TA 2JUGA 4XK4A 2CSOA 5FROA 4C2MJ 1D1CA 2LG4A 2JVHA 4ZZDA 1LE8B 4M3DA 1QGPA 3Q9SA 1A35A 5IT9Z 4EJOA 1BBYA 5HVQC 1UHWA 2EV5A 2MG4A 2G7UA 5CQEA 4DBRA 4YEJA 2H09A 4KIGA 4FQGA 3PUBA 6PAXA 1UMQA 4DYRA 3G6EI 1YE9A 2H8WA 4L9JA 2R92J 4DZJA 1WJAA 2MC3A 2O6GE 3E5XA 2PMUA 1QVTA 1FOYA 4FE7A 4A3MJ 1XMKA 1X4OA 5ILSA 5JLXA 2K9SA 4DW6A 1MIJA 4OIQF 4N4NB 2GXBA 3ZOBA 2KIQA 1PUFB 4K2EA 5HDKA 1YO5C 1WH5A 3LSTA 1W4MA 3J7ZI 3L2CA 4IOAF 1FZPB 3B02A 2HXIA 1VQKI 2RDPA 2XAJA 3HDDA 5K7HA 4F55A 5KAIC 1IN7A 3A2KA 1J9IA 4UHTA 2PJPA 4LIUA 2KJBA 3IH4A 5FD5A 3K70D 1HC8A 3M3YJ 4BBRJ 3DTEA 2CG4A 3JRAA 2QBYA 2GIZA 2R5YB 1ZG3A 1YW9A 3TP0A 9ANTA 1X2MA 4DYQA 3OIOA 1YJ9I 2W84A 1E3OC 4A3LJ 1B72A 3CP2A 4XM3A 5DV5A 1X1CA 3V7SA 3FMRA 1SVOA 1W7PD 1Z77A 3HTSB 3S17J 4YIRX 4MEXF 4M3EA 1IGNA 2DXIA 2QQ9A 2CW8A 4FX4A 2LSOA 1RRJA 1G2HA 3KEYA 1IAWA 4AC0A 3MKWB 5LHHA 2OAZA 3CMAI 1JJ6C 4XL9A 1GHCA 5GADJ 1ITYA 2L02A 2Y0SA 1QRYA 4Y4RA 2DA3A 1E3PA 3BG3A 3ZQFA 3KP2A 4BGDA 2UXNA 3O6BB 4AU7A 1WQ2A 1WCMJ 2FNPA 2Y9YA 3ZMDA 1MJ9A 3OYIA 4A6DA 2JQ7A 3VYUB 5GPAA 3M4OJ 2IGNA 1EKEA 2JA6J 3WTZA 4IHVA 1HSJA 3CMEI 4HRIA 4B44A 3CO6C 3GO5A 3FXMA 3TO7A 1KONA 2AXTC 4CCNA 3MKLA 2ZMEA 2BZTA 1SFXA 2DOFA 2WAFA 5GTHC 2XKPA 4RGSA 1VQMI 3DLAA 2XGXA 2DA2A 1X58A 3IUOA 1H9GA 1BR1A 1Y6IA 3RZOJ 3S2DJ 2FA5A 2OTLI 4RGXA 3ABMH 3OYNA 1BI0A 2GWRA 3K6GA 2K4JA 2W4SA 3BOQA 3F6OA 3BQYA 2O3FA 2QQ8A 2B9SA 2VBYA 4I6ZA 2R0QC 3M9AA 3GTMJ 1LEBA 1SEUA 1HXDA 1SVMA 5DUKA 1SC7A 4RGUA 3HOVJ 5ICGA 2FQ4A 3ZPLA 3DTKA 1S9HA 1B8IA 3QYEA 4A0ZA 3N4MA 3ABUA 2DFEA 4BU2A 2VXZA 2DMPA 1K83J 3RJPA 3WE3A 3CCEI 1VF9A 1USTA 2L9RA 3JREA 1FWZA 3FXUA 5H6QA 5D4RA 3VEPA 3LL7A 4BXUA 1VQ5I 4CYCA 1OYYA 2KMUA 1AU7A 3AG4H 2JVGA 2M4GA 3O3KA 4PCQA 1RUNA 3HOUJ 4A5NA 3BROA 2XRNA 1RPWA 5TJJA 1IN8A 1R58A 5L3DA 4W97A 1IXRC 4M74A 1I6HJ 2DA5A 3UNGC 4P5OA 4ETSA 2EILH 4IXAA 3DFGA 2Z9OA 2MD5A 4HLYA 3LA7A 1HDDC 2E5ZA 3F8CA 2LOOA 3CMYA 2MD0A 3K1PA 4W1UA 3GTGJ 1WI9A 3VPRA 2XPVA 3OYKA 2VL8A 2F5EA 2X6YA 1U78A 5BNGA 2XF6A 5FFZA 3S3OA 4GGGA 1X3WB 2HOEA 5DCFA 1X1PA 3D5RC 2IEKA 1ZH5A 1Z9CA 2JUCA 3P7NA 5CYVA 4I2OA 2NS8A 1CF7B 1W5SA 4EM1A 3EQLF 4XORA 3R61A 1ETQA 1FMVA 3ZP5A 3CUOA 4J00A 3JRGA 3COAC 4IVNA 3GLLA 4RAZA 1X1DA 1T95A 4S05A 4X1EA 3N97A 2KZGA 5CQGA 1SFOJ 4X6AJ 3OV8A 3JRDA 1YX5A 4BACA 2FX0A 4BUPA 3EUHC 1MMDA 2QM3A 3W3CA 2M1BA 3OR1C 2W48A 1IW7F 4MTDA 3K69A 4IOCF 1VQ9I 1MZBA 3S1QJ 2UXXA 1FBQA 5B1BH 2JWTA 3FXJA 2VE8A 2JRTA 1U3EM 4IKFA 1F36A 1X3UA 1ZQ3P 2HTJA 2F5DA 3A03A 4BXFA 2P5LC 2FXAA 3MZ8A 2NOJB 5EZGA 2JA8J 1WJCA 3KP7A 1ETXA 4EJWA 1JHHA 1BOBA 1TT0A 4G6QA 1HKSA 1KA8A 4A93J 1V3FA 3JRBA 2DK8A 1IZ1A 2ZFWA 3AG3H 1IRZA 2H6BA 2KISA 3DTIA 1MMGA 4L5JA 3WTYC 4M71A 3BDDA 4N4OB 1JE8A 4PGHA 4R79A 4NUBA 3CC7I 2X9DA 4ZYDA 3FMQA 3SEQA 1VQ8I 5ERIA 4ESBA 2Z99A 3QOPA 5GAEJ 2GM4A 5DEQA 3S1RJ 4Z6YA 2K3FA 4OAYA 4UV8A 3BG7A 4U87A 3C2GA 1XCVA 2CQQA 4F7ZA 5JVTA 5D5WB 3OYGA 4II2A 1YW7A 3BCBA 4LG0B 4I0BA 4YFNF 3BC8A 2P81A 4G7OF 4PDKA 1RIOH 3OOUA 1BW6A 3BZKA 3BR1A 2DFIA 4B8XA 4IRIA 2DJIA 3E0JB 1JKQC 1T39A 2Y30A 4ZDLA 2IA0A 2Q2EB 1XB4A 2KRCA 5EEGA 3F21A 1OCZH 2HQNA 4BXXJ 1A6IA 2WC2A 1BJAA 3K70C 1OFCX 3LAPA 2F4IA 2M0MA 2F6CA 2VASA 2Y0SN 1O57A 2XF7A 3SEZA 1T0FA 1NK2P 3TEDA 3K9TA 1JTXA 1LDKB 3E6DA 2LY9A 5IT3A 5CVJA 5GAHJ 4HDVA 3FM5A 1RI7A 1MNEA 2XAFA 3PQKA 4EGZA 2M2EA 1VFCA 3OYFA 5F1JA 1F1ZA 2PG4A 3J7AO 5EGOB 1IJWC 1GVDA 3PUFA 1XMXA 4CZZA 2G9WA 1GUUA 2O9LA 3M7GA 2CGPA 3OR2C 3I54A 4IHWA 1SD4A 2ME0A 1IRFA 2IGKA 1YITI 2EIJH 3FHZA 4L18B 5IYCJ 3LWFA 4UVCA 4LITA 2E1MC 1QPIA 1V55H 3QPSA 5E1WA 4JOMA 3GMEA 3KZZA 5EG0B 5L3CA 2ZJPF 1KQ9A 4RMNA 4WXDA 4B09A 2HS5A 3ABKH 4YFKF 4Q4ZF 2IS2A 5LGTA 4FISA 4P9FA 5C4XJ 2ACJA 3HB9A 2ETHA 2LDUA 1FP1D 2R7TA 2VJIA 1JXSA 2PN6A 3U21A 5F27A 1XDSA 1YS6A 4O5VA 1BI3A 4WK8F 1R1VA 1REPC 1OYWA 4XLFA 1Y56A 1UG2A 2H1LA 2OUMA 4NC7A 4YIIA 1BJZA 5HS7A 1LQ1A 1DUXC 4IRGA 4YIFA 2H27A 1R9TJ 3OL3A 1MNMC 1ZG5A 4HW0A 4AVPA 1MBKA 1S5LC 2O0YA 3S32A 2DTRA 2QA4I 2ICWG 3S93A 1A04A 2O5RA 3CF2A 4EJVA 1R1TA 4OU0A 3JAMK 3BJAA 3JRIA 3KYCB 5ILUA 4A3BJ 2L7MP 2QYOA 2ELKA 2IRFG 3RI4A 4MHGA 1LDDA 3L2VA 2H94A 3NAUA 2KKOA 1XCBA 5HNFA 2O8KA 1BW5A 3OY9A 4MO7A 4Y15A 1W0UA 3C18A 2K4BA 1ZRCA 4OMZA 3R6SA 1O7LA 4BJ5C 3QRFF 1ZLJA 2RQQA 1WJFA 2HKXA 2QENA 3QP6A 4FASD 1VQLI 5D8LB 5D5UB 1FSHA 2Y48A 4M9ZA 1NTCA 1WHUA 2EZLA 2WB1A 3MEXA 2CQKA 4NHJA 2EJRA 4BDZA 2KFDA 1MH4A 3RYPA 3IWZA 4I01A 3LSIA 4CO8A 4IJAA 2BV6A 3OYMA 3HOZJ 2EK5A 2Y69H 4CCMA 1ZN2A 4A3IJ 4IQ4A 3KETA 2FBKA 5JHFA 2MC4A 4BE1A 4XLNF 1WGXA 1B6AA 1J5YA 1GLNA 1N25A 3L1PA 4MTEA 4DOZA 4XICA 1TQPA 4ZDOA 3NRVA 3ZQ7A 1WJDA 4D7NA 3HSFA 2HYJA 3SZTA 5K7FA 4WCGA 3ZQQA 3BR5A 1V5EA 3HXLA 5H20A 4G7ZF 1H89C 2HI3A 5E1ZB 1ZKGA 3GVAA 3RDIA 2DPUA 2GZWA 4R1HA 3ZN0A 4CA0A 2Q0OA 1XDUA 2CO5A 3GTKJ 1ZARA 5FKLA 4FT8A 3JAMZ 1BR2A 3T5XA 3FISA 4B4CA 4HNUA 2JSCA 4HOBA 3MD2A 5K5QA 1K4TA 1LJ9A 2XUBA 2P0WA 3VYSB 1GVJA 4Q5SF 3TKYA 2QSHX 1Z0XA 2L5QA 4RAYA 3J7AY 2VT2A 4ESJA 3KLNA 3LQQA 1AKHB 4XR6A 2PMZA 2Z5UA 2HXOA 5LGNA 2PI0A 2HVSA 3VYTB 5IPAA 4P96A 3I59A 2A5WA 1D0XA 2XAGA 2K9QA 3F6VA 2FD5A 3P9IA 1NH3A 1IN4A 5DD8A 5FKKA 3S14J 3H5AA 4E70A 5J4VA 3MMYB 4KN7X 1EJ9A 1FYLA 2E7XA 4HSRA 1I27A 3C1DA 2DW4A 5LGUA 2F4OB 4OMYA 3BG5A 1SMYF 1B59A 2JA2A 1U5TB 4XKBA 2DQRA 3I71A 3U1DA 2HPIA 2M5WA 1B4AA 3GLXA 5CVVA 1E0EA 2V1NA 2CFXA 2KIUA 4HPQA 3SQNA 5J47A 4L9VA 3FM3A 1GXPA 1LPQA 2M30A 4ON0A 2IXSA 2DYSH 1ZGJA 4BKXA 2K5CA 1R5GA 1MDMA 3WODF 3LA2A 3M8FA 2PQ8A 1Y0UA 2LD5A 1TL8A 4NNJA 4L5IA 4QTRA 4S0HB 4AWXB 3NARA 2QCOA 3CJTB 3K10A 5E20A 4GCVA 1KZHA 2LBFA 3VODA 1J75A 2LKXA 4MLOA 1OCCH 3V8KA 4F91B 5ILVA 2LTPA 1IN6A 3S1MJ 1YIOA 1QQIA 1JT6A 3S15J 4PJ0C 2VQGA 2BE5F 4BQAA 4WWCA 5LLQA 4BH9A 2KQRA 5EDNA 1O3TA 4UB6C 2VQHA 3ISPA 1ONVA 5CVRA 3FKIJ 1JUPA 2ZO4A 5ED4A 3S16J 4RLFA 2ESNA 1WVRA 1D3YA 1TWHJ 5ICFA 4JYKA 3GFJA 4IO9F 4PSXA 3OYHA 1SMTA 1LDJA 2EIKH 4KDPA 2K02A 2R4GA 1W1WE 3K4KA 3QP5A 2WBMA 4IRHA 4M3BA 4U7BA 4XN3A 3Q0VA 4PJMA 3GTPJ 2JRMA 2WV1A 2DJNA 2Y0MA 4LJZF 4M72A 4B3AA 3KEOA 2QLZA 1PVEA 2Z2SB 2DDBA 3FDYA 3DKXA 1J0RA 3HRSA 2R5ZA 1BA5A 3MWMA 3BQZA 5GTIC 3M8JA 1Q1VA 4E6KG 5LBQA 3H9JA 4HEA2 1YQAA 3HSRA 1C0WA 2HU9A 2PEXA 5D8KB 2XHKA 3IAM2 4Q48A 1TNSA 4UUVA 3QPHA 4M73A 1K79A 3RPQA 3LFUA 3L2WA 2Z16A 4WX9A 1YTYA 1MSFC 2BVMA 5D5VB 2BW3B 2KDZA 4A3JJ 4E7ZA 1HDPA 3OSGA 3BG9A 2OJED 3JRHA 3BZCA 2NAZA 3MFKA 2GQQA 2ZMEC 4BS9A 4ENMA 5E17F 2VC0A 1M1EB 2CUJA 1TNTA 4RM3A 1P7JA 4XSZF 1D5YA 2LLKA 3D5LA 1H9TA 5HLTA 4HX7A 2GOXB 1G3WA 2HKOA 4ASNA 5E79C 3A0BC 1L3LA 5M3MJ 1YG2A 2VB6A 4KYWA 1VNDA 1RUOA 2WB1N 2HOTA 1IDYA 4P1WA 3ELKA 3BR3A 3KP4A 3B73A 1YX3A 1ON2A 1ZHFA 2MSYA 3HPGA 2P6SA 4XKWA 3BCAA 2PJRB 5B66C 1SFUA 4H0EA 1X4PA 3OS2A 3AAFA 3PNTA 4ENJA 1VQNI 3E6CC 2XAUA 4PFOA 1O4XA 3CUQA 2L4MA 4Z2YA 2J5OA 2LKPA 2R7SA 4XLHA 2DYRH 2LYCA 2V9KA 2PFBA 2D5VA 1H88C 3GFIA 3D0SA 5IY5H 1TLHB 1P6RA 4EQQA 3LFKA 4OINF 4AYBA 3DU5A 1W0TA 4OIOF 1X3ZB 4C9YA 4EM2A 4P9UA 2KRFA 3TDZC 2OD5A 2IVMA 5LRSA 2DTZA 2DOEA 3VB2A 2UV1A 1RESA 1D0YA 2BGCA 1OCOH 2FBHA 1DQUA 2VJJA 4Y17A 4D9JA 3E6BA 4BHBA 4HV5A 4PJJA 2X6WA 3FBIB 4HLXA 1ZAOA 2O8XA 2NRAC 3NEUA 1NHAA 2BXYA 1FBSA 3HKZA 4HNTA 5J40A 3QODA 3QU3A 3N05A 5K7ZA 2ZCWA 3HOYJ 2DT7B 2X1CA 3LSHA 4KITB 3CLQA 5DCMA 2HQRA 4UUSA 1QO0D 4XKVA 4E7SA 1O3SA 3ONQA 4L9TA 2MFZA 2V9PA 1FOWA 3WU0A 3H5NA 4X0GA 2AXLA 2ZJ2A 2NNYA 1R5ID 1WJBA 2BY3A 3HUGA 4FHTA 4ZZLA 2BY2A 1R23A 4U88A 1FY7A 2JJ7A 2KHMA 3BTLA 2PMZN 4L5EA 2TRTA 1PJRA 2IW5A 2VONA 5KK1A 1B9NA 3T8TA 3SFIA 1S6LA 3I4MJ 3FKJA 3QU6A 4BQOA 1T08B 2DDAA 2FMYA 1OYIA 1RZ4A 2DCEA 2CV2A 2FSWA 5JI6A 1OR7C 3V7RA 1UG0A 2TCTA 3ZQCA 1YRNA 4GYIA 2NVQJ 2E2IJ 3HSEA 2M9HA 1MW7A 2HYFA 1RR7A 5H2FC 3PNVA 2CMPA 3WE2A 2OQGA 4GYGA 1D8KA 4RA2A 1XGMA 4RLQA 2CV1A 1QVUA 2IAIA 3FXOA 2L7FP 3OYEA 3LOCA 1JTYA 4WXHA 2FUG2 2FE3A 3E5UA 1WPKA 2LF7A 4NQWA 4XN0A 5EF6A 2JZYA 3ZXSA 3QYBA 1P4XA 1UCRA 1V5GA 1ETKA 3GUDA 1K78A 2ISZA 1J7KA 3IHUA 4KN4X 4LK0F 4V19K 3ULQB 1ZG1A 4J01A 3L00A 3MVPA 2O61A 4IL6C 3ZR8X 3HL2A 1FBUA 4HSTA 4AUXA 1ZELA 3TGNA 4YRVA 2XGEA 3ASNH 2XROA 1DDNA 3GX4X 1TBXA 2E19A 3GZNB 3OS1A 1ERDA 3MCZA 3EYIA 1UHSA 4QIWN 4F93B 1XSDA 1G6NA 2GA1A 4OOIA 4IZZA 4PJLA 1HKQA 3T8RA 1S72I 1Z7LA 3HYIA 3IV5A 1MMNA 4LGWA 4DQ2A 4E4HA 2YU9J 3LAJA 3CJRB 3HGGA 4EMSA 4EM0B 3A02A 1QPMA 2HNHA 1WWXA 1QZEA 3LMMA 2Z1DA 1JKPC 1HF0A 3A01A 4QWQA 3CCVI 1OJLA 3ZQHA 1HSTA 1I6XA 2DA1A 2QVOA 1DPUA 3F8FA 1A36A 1KU9A 4D5FA 1XPXA 4M9SA 2G7HA 4NC6A 4BJ6C 5IP7J 3FHNA 2CYYA 1T0FC 2FRHA 2D1HA 2VJ5A 1ETWA 2LRDA 1TW3A 5CJ9A 3CCMI 4D7MA 1O7FA 2FEZA 2ESHA 2M3AA 3CESA 1VQ6I 3ZGKA 5D4SA 1FTZA 3HM5A 1S7EA 2R7XA 3HJEA 3SHFA 2VBWA 4GDFA 3KYLA 1WJEA 4E7HA 2OBPA 1YFHA 3KP6A 1Y1VJ 1O3RA 3RKQA 5M5WJ 3W6KB 1JHFA 4PGGA 5HDGA 5M5YJ 3MKYB 4A3CJ 2C6YA 2KIFA 2BXZA 2CJJA 1XGOA 1OR7A 3BT9A 4C3JJ 1PUFA 4RB2C 4OIRF 1K6OA 2UWMA 2EZIA 5B1AH 1QU3A 4B3XA 1BC7C 2MH2A 2YX4A 2RVCA 3IKTA 3QAHA 4DYCA 2DPDA 1IV8A 1SAUA 2X85A 4XOTA 1EA3A 4HZFA 3TDUC 3A0HC 1IUYA 5FJ8J 1NK3P 3GEZA 3HHHA 2P6TA 5FLXK 2WV0A 1IF1A 2HPMA 1FP2A 3RTRA 1UAAA 2R7VA 4RGRA 1YLFA 2ZSIB 2R5YA 3G71I 1P2FA 3W2WA 3I56I 2XAQA 1MJBA 2CQXA 3SYTA 2JA5J 2R7OA 3CDHA 3DWLE 3WTVC 3TQNA 2ZXJA 4XLAA 5L3EA 4J19A 4AYBN 1A31A 3K4BA 4M6XA 1EV7A 1U9NA 2ADUA 2X0LA 3JRFA 4BNCA 5FKOA 2E60A 4UV9A 3R0AA 2GAUA 3HG9A 5DTDA 2R7FA 3S1NJ 2BY0A 2W1OA 3JSOA 1BC8C 4ZTFA 2M87A 2HDWA 1X1AA 4ZYEA 2VPRA 2YU3A 1HOMA 3HKZN 2QSGX 1W7PB 2LR8A 1JGSA 1WFXA 3CQZJ 2HDCA 1VQ4I 5CVIA 3ZN1A 3HRUA 1TWCJ 3Q0WA 1VI0A 5KVRA 1WI3A 2VI6A 2A05A 3T0YA 2DMNA 1Z7UA 3AFHA 1VZ0A 2F5CA 2DI3A 4F3QA 3OYLA 4RM2A 1E3HA 2P4WA 2E1MB 3BTJA 1FSEA 2RAEA 2IPQX 3DBRB 2KZVA 2IGMA 2Q1ZB 2VC1A 3JCUC 4BHPA 2F48A 4NC8A 1TWAJ 1YJNI 4GFBA 2ZXWH 1OQYA 2ELJA 2RREA 2X4HA 3REOA 1AWCA 2D1VA 1CGPA 3H3ZA 4AIDA 5FLXZ 2L54A 3U2RA 1UJ8A 4HF2A 3IC7A 2L9VA 2M7BA 4ESFA 2VBXA 2FOWA 3RIRA 4G7HF 3HRTA 3Q9VA 3WTXC 2R7QA 3I59B 4CCOA 5HLHA 4KICA 1LFPA 1LB2A 2OCCH 3JTHA 3R0JA 1ZGWA 2NVXJ 4M3GA 1R4NB 3E7LA 1IC8A 3CZ6A 3GTOJ 2M34A 1TTYA 5D6FA 4LLNA 4DJAA 2KJCA 3PSIA 1FX7A 5JFRA 5K1YA 3PJRA 4MQVA 5IP6A 2DQLA 1W5CC 1MMAA 1ON1A 1QNTA 2FMLA 3GFLA 4CCLA 3H5RA 3HC7A 2OTJI 3LQRA 4RDUA 2ZJQF 2GLOA 2ECBA 5L3BA 3VSLA 5TRDA 3JR9A 2XAHA 5J1UA 3JW4A 1MKMA 4M3FA 1JI8A 3ZMVA 3ECOA 2HGCA 2LY1A 3M1EA 1FJLA 5DM6F 3OSFA 3TW7A 1IXCA 2H6CA 3KFWX 1BI1A 2LKSA 1TP4A 3E6MA 2Y2ZA 2H8RA 2ID6A 2L9NA 5F6FA 5C4JJ 1YW8A 5AIPA 5C3EJ 5EYRA 3TOBA 3S3NA 1B1BA 2GXGA 2P5KA 3KP3A 3TW6A 2V6EA 2JK3A 2LNBA 3G3ZA 4XBFA 2E2HJ 1S7OA 3DKWA 2Y9ZA 1CF7A 4HNVA 1KQ8A 2J5PA 4PUSA 2B0LA 2STWA 2IA2A 4XIDA 4RBOA 4JX6A 1V54H 4V2FA 1POGA 1I1GA 3VDXA 3G73A 2CQNA 3ZMSA 4JQFA 2CRGA 5E3MA 4E7JA 2YUSA 2WY7Q 5DM7F 3GTQJ 2DK5A 2X1EA 2DLLA 2F5FA 4UNOA 4R8HA 2E1NA 3VFZA 2CWEA 2L0KA 2ZC2A 5BS6A 3EPZA 3GW2A 2RGVA 3IKVA 3DEEA 4AIJA 3GZ5A 1T38A 2P7CB 3OS0A 1UZCA 1Y8QB 4BEHB 1TQMA 2AO9A 2TDXA 3ECHA 3IWFA 3VYRB 1WH7A 5DS9A 2XV4S 2NVTJ 4G6TB 1FPQA 4XSXF 5GP9A 2MH9A 3P9CA 3LNQA 2XPUA 2VKDA 3OYAA 1KYZA 2QQBA 3ABTA 4LFUA 4MFDA 3G1LA 1K6YA 3OWTA 4YELA 4RAFA 3TOAA 2XC7A 1APLC 5DUIA 5K5OA 4EJTA 2L3DA 4UB8C 1D0ZA 1Z05A 2W00A 1ULYA 2LC2A 2LY2A 2OQRA 1R7JA 3LSPA 1F43A 5J3LA 2IS1A 4F52A 3TP3A 4KT6A 2E2JJ 2NYXA 4IEJA 2ZXHA 1I3QJ 4HQEA 5L3FA 1MSEC 5TGTA 4Y33A 3I0TA 2YS9A 4IF4A 4KT5C 3J80K 3FMSA 3GZ6A 5KAFC 3OL4A 2EV6A 1D1BA 4Q47A 4LG0A 2M8EA 1QBJA 1K61A 1S3JA 5HDNA 1RR8C 3K7AJ 3DLLF 1DU6A 1R00A 3I3LA 2M8GX 3KZIC 5F04A 3H9QA 2KDOA 4BQNA 2DAOA 3A4CA 3C3WA 3PO2J 1BI2A 4KA4A 4AD9A 3PM1A 3W6VA 3GFMA 4G94A 2YR2A 2Q2EA 3DEUA 2X6OA 3ZCOA 3S2HJ 1Y0NA 2RNGA 3KYDB 3HIFA 3L2UA 3BG6A 2F4MB 2OPTA 3SZPA 2CUEA 2WAEA 1P92A 4I76A 1V5FA 2DT5A 3ERMA 4HDUA 3H35A 5EGOA 1ZREA 4KUMA 2STTA 2KLOA 3CCLI 2X6XA 2O7OA 3V8LA 3AG1H 3PL8A 3V4GA 5BQTA 2RNJA 2QBYB 4PJNA 2IBDA 1JJ8C 3PSFA 2OV7A 2XDVA 3QYFA 4ZDPA 4L9NA 3RKXA 4L0ZB 2QQAA 4EEFG 1X1BA 2A6EF 2HTSA 3L09A 3MZHA 1B72B 3KEQA 1P7IA 3RKWA 3F0CA 1JGGA 2RN7A 1TWFJ 3CUQC 2JT1A 5J8FA 3G4SI 2VJ4A 4XLEA 1MH3A 1SD5A 2O03A 1ZR2A 4ITVA 1JKRC 2XIGA 3CCQI 3T1BA 2X1DA 2IS6A 1HQCA 2V7FA 3O8GA 5FB2A 1N77A 5EG0A 1KGSA 5E8GA 2W25A 3CO7C 3J80Z 2K9NA 4XLPF
chains in the Genus database with same CATH topology
3OR1C 2W82A 4BE0A 1WJBA 1D1AA 4IKFA 3DPTA 2KHMA 2V4JC 2KP6A 4BXFA 2K9MA 1PJRA 2NOJB 1BR4A 3FKJA 1WJCA 4BQOA 4LG3A 2DCEA 1BOBA 1TT0A 2I8DA 2CV2A 1OR7C 2IS4A 1UG0A 1MW7A 3DPUA 1UELB 3PNVA 2CW7A 3DTIA 2CMPA 4F92B 1MMGA 5LFAA 3HPHA 4RLQA 2CV1A 4N4OB 2VKHA 4ZYAA 3OYEA 2ZSHB 1G8XA 3OIQA 3GBGA 4NUBA 4R79A 2E5NA 4II3A 3SEQA 3TBIA 3QOEA 2FUG2 4XN0A 2WADA 3ZXSA 3QYBA 1QHHD 4OAYA 4CH7A 3HOTA 1V5GA 3BG7A 3C2GA 4U87A 3OYGA 2LREA 4II2A 3A1YA 3BCBA 4PSWA 4J01A 2XF5A 4LIVA 3ZR8X 3BC8A 3HL2A 3OYJA 4HSTA 1ZELA 2XSJC 2CV0A 3OOUA 4YRVA 1ERDA 3OS1A 1MNDA 2DJIA 3E0JB 4F93B 3IP4B 4ZDLA 4IZZA 2Q2EB 4PJLA 2HQAA 2KRCA 3S8PA 1LVKA 1X19A 1DP3A 3DQVC 1Z7LA 1MMNA 4E4HA 3K70C 2F4IA 5KNLA 3CJRB 2M0MA 2QKMB 2F6CA 2VASA 2HVRA 2XF7A 3NWSA 4Y3OA 3SEZA 2R7UA 2ZFUA 1LDKB 2HNHA 1MNEA 3LMMA 2CH0A 2M4KA 2Z1DA 2GOMA 3OYFA 3D5SC 2CFOA 2ZXIA 3AL0C 2JSPA 2LH9A 2M7AA 5CPRB 3RCOA 4BJ6C 4FETA 3OR2C 3FHNA 4XNFA 1J09A 1T0FC 2IGKA 4XOPA 5KCMA 4EATA 2VJ5A 3K4NA 2LRDA 4C30A 3ZRGA 2VLAA 2QKLB 1N75A 4LITA 4B48A 2M3AA 2E1MC 3CESA 3ZGKA 2AQEA 4JOMA 4AVZA 2R7XA 4RMNA 3V42A 3KYLA 1WJEA 2IS2A 4E7HA 2VQLA 3F9KA 3HUGB 1Z21A 2R7TA 2VJIA 4D1QA 4CUGA 3C2HA 3H9GA 3U21A 4CZCA 3LSKA 3MKYB 4IX7A 4XLFA 3DPLC 1Y56A 2K3PA 3LSMA 2OUMA 5HNHA 4NC7A 3TMOA 1W36D 3VWBA 4BE2A 4C2UA 3OMYA 2UWMA 1NG7A 1QHGA 1DGWY 3OL3A 3LSGA 4B3XA 1QU3A 4KISA 1Z3XA 3RQ4A 2IGOA 4DIQA 3S32A 1SAUA 2X85A 4XOTA 4ANJA 1EA3A 3S93A 2O5RA 3CF2A 4CCKA 4ZC3A 3S3MA 4PFPA 3K4MA 2HPMA 3L2VA 3RTRA 3EUAA 2WY8Q 4PK4A 1UAAA 2R7VA 2KRHA 2ZSIB 5HNFA 3W2WA 3IAS2 3OY9A 4E7IA 2F5VA 5CKTA 3K4JA 3SYTA 2R7OA 3DWLE 1NG6A 4NQWB 2CS3A 4XLAA 4BJ5C 1FMWA 2RQQA 3K4BA 1WJFA 3K4LA 4FASD 3OIPA 3K4CA 2MABA 2E60A 2WB1A 3HG9A 3G2BA 4BDZA 2BVLA 2W1OA 3LSIA 1P9QC 3SZGA 2L2OA 4ZTFA 3OYMA 1OLTA 2HDWA 3BLYA 1X1AA 2WA0A 1U0JA 4B47A 4CCMA 1G59A 5KHDA 1PYVA 1AA7A 4IQ4A 4KJZA 4OWRB 5JHFA 1WFXA 3AL0B 2MC4A 4BE1A 1R6RA 3CJQB 1GLNA 3OYCA 2UUZA 4CCJA 4DOZA 4ZDOA 4BEHA 1WJDA 2K9LA 4CSWA 3AFHA 1VZ0A 3ZQQA 4XQFA 3FBNB 4F3QA 3OYLA 1V5EA 3HXLA 5LD2C 1TZLA 4RM2A 1Z3YA 2E1MB 3UR3C 4CA0A 2KL4A 2A6TA 4DBQA 2KZVA 2IGMA 2Q1ZB 4NC8A 2RREA 2ELJA 1BR2A 4HNUA 4C2TA 2JUGA 4OAZA 3MD2A 2M7BA 5FROA 1D1CA 2LG4A 2JVHA 2BW3A 2P0WA 3VYSB 3OYDA 5HVQC 2R7QA 4CCOA 2L5QA 3J7AY 5CQEA 4DBRA 1LFPA 4YEJA 2HZDA 3CZ6A 4XR6A 3PUBA 4GRIA 2PMZA 1YE9A 2HVSA 3VYTB 4DJAA 2R7RA 3PSIA 1WJAA 3PJRA 2A5WA 1D0XA 4ZJZA 1MMAA 4CCLA 1X4OA 3H5AA 3H5RA 3HC7A 3MMYB 4N4NB 3HOSA 4HSRA 3VSLA 2PJRA 3CMMA 2JA2A 1JI8A 3RPUD 2LY1A 4XKBA 2HPIA 4E7LA 4H4KC 1E0EA 2V1NA 4F55A 4HPQA 3A2KA 4LIUA 2OC6A 3K70D 4QPQA 2IXSA 2L9NA 4BDYA 3DTEA 3KX2A 2K5CA 3S3NA 2V6EA 4NNJA 3CP2A 4XM3A 4BL0B 3E1SA 3K10A 3W2AA 1X1CA 2LBFA 4PUSA 4HG2A 4MLOA 4F91B 5HOOA 4XONA 2DXIA 3H0DA 2CW8A 2HVQA 3KEYA 3AKZA 2VQGA 3VDXA 3MKWB 2KQRA 4JQFA 4E7JA 2WY7Q 2VQHA 3SDBA 4XL9A 2X1EA 3I9V2 3L2RA 4RLFA 3W2VA 2Y0SA 4Y4RA 2VIXA 4BJTA 4IQJA 3OYBA 3EPZA 4PSXA 3OYHA 1LKXA 3DEEA 4BGDA 2R4GA 3K4KA 4AU7A 2WBMA 4U7BA 1HA8A 3OYIA 4XN3A 3OS0A 4PJMA 3VYUB 4BEHB 2VQCA 5FRNA 2VXDA 4ZTJA 2IGNA 3VYRB 4HRIA 3DKYA 4B43A 2BOLA 2Z2SB 4B44A 4G6TB 3FDYA 3L2QA 3DKXA 1KONA 4CCNA 3OYAA 2VKDA 3M8JA 4XKCA 2V26A 2WAFA 3TL4X 1K6YA 3OWTA 4XMYA 4YELA 3H9JA 4HEA2 4E6KG 3DLAA 2XC7A 2HU9A 2DT6A 1D0ZA 2LC2A 2W00A 3IUOA 2LY2A 1BR1A 4BUPA 3IAM2 1Y6IA 2AQFA 3RSNA 3OYNA 2IS1A 3LFUA 4F52A 4KT6A 3L2WA 2Z16A 2KPMA 2ZXHA 2BVMA 3K6GA 5TGTA 2W4SA 2BW3B 4Y33A 3VSKA 3PNYA 4E7ZA 4BQQA 4XLCA 3OL4A 3MKZA 4BS9A 1D1BA 2CUJA 4RM3A 1W36C 3DTKA 1S9HA 3QYEA 3D5LA 3I3LA 4BU2A 5HLTA 2GOXB 2VXZA 3H9QA 3PFYA 2KDOA 4BQNA 3A4CA 2VB6A 3LL7A 4P1WA 1WJ5A 3ZCOA 2KMUA 2JVGA 2M4GA 1YX3A 2RNGA 4DGWB 3HPGA 4XKWA 2CUZA 3BCAA 2PJRB 3L2UA 3BG6A 3UNGC 1X4PA 3OS2A 4P5OA 4E7KA 2WAQA 3PNTA 2WAEA 1V5FA 2XAUA 4PFOA 4QPOA 2E5ZA 2LOOA 2R7SA 2MD0A 4XLHA 3H35A 3M1CA 2LYCA 3OYKA 3NWTA 2VL8A 2X6YA 2V9KA 2KLOA 2X6XA 2XF6A 3S3OA 2L7KA 3PL8A 1IRXA 4AYBA 3DU5A 2DOAA 4PJNA 4C9YA 3EUKL 2OV7A 2XDVA 3D5RC 3PSFA 3QYFA 4ZDPA 2R7WA 1DGRM 1X1BA 2MYSA 2X51A 2UV1A 1D0YA 2L9SA 2LBFB 1DQUA 2VJJA 4XORA 4D9JA 4X0GA 1FMVA 4PJJA 2X6WA 3FBIB 4J00A 2VJ4A 2VPLA 4XLEA 1SFKA 4ITVA 3HKZA 4HNTA 1X1DA 2W7NA 3DU6A 2X1DA 3QODA 5FRMA 2IS6A 1T95A 3N05A 2V7FA 1N77A 2DT7B 2X1CA 3CP8A 3LSHA 5CQGA 4KITB 1N78A 4XKVA 4E7SA 1YX5A 4BACA 3ONQA 2MFZA 3EUHC 1MMDA 3W3CA 3H5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DGR M;  1DGW Y; 
#chains in the Genus database with same CATH topology
 5HS8 A;  4BE0 A;  1H0M A;  2ZJR F;  4OIP F;  4ENK A;  1D1A A;  4KMF A;  3G1O A;  1FTT A;  3FK7 A;  3HTU A;  3CJN A;  3DPT A;  2V4J C;  2K9M A;  4I98 B;  2ME6 A;  1E2X A;  2QEX I;  2EQR A;  4XRF A;  1YRN B;  1V4R A;  1A6Q A;  3WG9 A;  3BTC A;  1BR4 A;  4AIH A;  4N9H A;  2XB0 X;  3I4N J;  2GBY A;  2DFH A;  5FKM A;  3K0L A;  4PZJ A;  3WTT C;  5TIS C;  1FLI A;  2IJL A;  1XD7 A;  2WTE A;  2IS4 A;  3CDL A;  1JKO C;  3TO6 A;  4BHC A;  2ZME B;  4KIF A;  1PP8 F;  3DPU A;  2WWY A;  5M3F J;  4EJU A;  3ESW B;  4F92 B;  2HFH A;  3MQ0 A;  5LFA A;  4UXN A;  2QSF X;  2KIM A;  4A6E A;  2K85 A;  4ZYA A;  2QZ8 A;  2R7D A;  3RPU A;  1MMS A;  2ZSH B;  4MQ9 F;  4KIB A;  1G8X A;  3GBG A;  4CGZ A;  2E5N A;  4II3 A;  3TBI A;  2WAD A;  5FLV A;  3K1N A;  4CH7 A;  1QHH D;  3HOT A;  3KIO A;  3S2W A;  4FTH A;  3V8J A;  1SD7 A;  3DV8 A;  5E8I A;  5EZH A;  3A1Y A;  4PSW A;  3CCS I;  5FFX A;  1B8I B;  3OYJ A;  2XGC A;  2XSJ C;  3Q0U A;  2CV0 A;  3GYH X;  2OF7 A;  1EH8 A;  3L7W A;  1TC3 C;  3KPH A;  4KNY A;  1EF4 A;  3DBH B;  1MND A;  4M6Y A;  3Q3S A;  4CYC B;  3C2B A;  4UY8 I;  1DP3 A;  1LVK A;  1X19 A;  5D6E A;  3DQV C;  3E97 A;  2K40 A;  2X48 A;  5KNL A;  5DYM A;  4A69 C;  1U8B A;  1XGS A;  3NWS A;  3GXO A;  4D5C A;  3RZD J;  2R7U A;  2ZFU A;  3MN2 A;  3HOW J;  5E3N A;  2GOM A;  3IL2 A;  3ML6 A;  4HV6 A;  4DZP A;  3D5S C;  2CFO A;  1IV6 A;  2ZXI A;  4BY1 J;  4IHS A;  3BJ6 A;  1XMA A;  3J7Y J;  1OCP A;  4EVI A;  3AL0 C;  5J1Y A;  2EWN A;  2DMQ A;  3WG7 H;  3LSR A;  2LH9 A;  2M7A A;  1GT0 C;  2A61 A;  5CPR B;  1ETY A;  4FET A;  3G1M A;  3SDG A;  1XTA A;  4XNF A;  5E1X A;  4CDG A;  2DO7 A;  2VBZ A;  5F0F A;  3HRM A;  4XOP A;  3ZMT A;  4UUT A;  3KLO A;  4LB5 A;  4A3D J;  2QKL B;  3X2Q H;  5F64 A;  2DA6 A;  1AKH A;  4IHX A;  5LEJ A;  5BMZ A;  2PLY A;  2A07 F;  4LK1 F;  3V7C A;  3WTU C;  2G0E A;  2XRL A;  2UZK A;  4ZYH A;  4YFX F;  2DMU A;  3F9K A;  3K1M A;  2L01 A;  1Z21 A;  3SJM A;  1S8N A;  3QQA A;  3C2H A;  3H9G A;  2VUM J;  3LSK A;  2VOO A;  3P5J A;  2K3P A;  1W36 D;  4BE2 A;  4C2U A;  3OMY A;  1NG7 A;  1DGW Y;  3GTL J;  3LSG A;  2JTV A;  5GPC A;  1O3Q A;  1Z3X A;  2MBF A;  1SFE A;  4A5M A;  1U5T A;  4DIQ A;  5FD6 A;  3KE2 A;  2F2E A;  1XC5 A;  5M5X J;  5LHI A;  2ZB9 A;  1GXQ A;  3M8E A;  3IRQ A;  2E1C A;  1KU3 A;  4ZC3 A;  3S3M A;  4PFP A;  1UB9 A;  3ROU A;  5LHG A;  5FO5 A;  2EA4 A;  3K4M A;  1TQI A;  3J81 K;  2E1O A;  5EJC A;  2WY8 Q;  1Y8R B;  2KRH A;  3BR2 A;  3FF5 A;  1HW5 A;  2A3S A;  2BY1 A;  3IAS 2;  4N0B A;  2F5V A;  3FXL A;  4HYE A;  5CKT A;  2L4A A;  1FIP A;  3K4J A;  3ZQG A;  5K5R A;  1NG6 A;  2VOD A;  4BAY A;  3BPX A;  2A69 F;  2CS3 A;  2GIV A;  2QF7 A;  3AG2 H;  3BR6 A;  3DCF A;  4P55 A;  5FLM J;  4CXF A;  1OIS A;  5FGM A;  3K4C A;  1SVL A;  4FCY A;  2MA3 A;  1OCR H;  3EYY A;  1JUS A;  3G2B A;  4O6J A;  4MNU A;  2BVL A;  1P9Q C;  1YS7 A;  5FKN A;  1I1S A;  3BLY A;  4B47 A;  3CF5 F;  2RQP A;  5KHD A;  1ZGA A;  2Z33 A;  4OWR B;  1T56 A;  1YIJ I;  1R6R A;  4A0X A;  3CJQ B;  1XSX A;  2L7Z A;  3BWG A;  2UUZ A;  2MGQ A;  4CCJ A;  3FX3 A;  1IUF A;  1OMI A;  4IPA A;  2BHY A;  2BBY A;  1S7A A;  2Q8K A;  4CSW A;  1AOY A;  4XQF A;  1GDT A;  1MGT A;  3FBN B;  4BY7 J;  3WTW C;  3F8M A;  3PQJ A;  5H6R A;  3CCU I;  3UR3 C;  1G3Y A;  1U9O A;  1X2N A;  4A3K J;  3CDI A;  3FK6 A;  2BEO A;  1K4S A;  1RKT A;  1HKT A;  1ZR4 A;  4JBA A;  1MBH A;  2DA4 A;  2R3S A;  1ZRD A;  4D0P A;  4IHT A;  2QWW A;  3NQO A;  1YHQ I;  1I39 A;  3GCM A;  4OAZ A;  2LFB A;  4NB5 A;  3F23 A;  3J81 Z;  3D1N I;  2BW3 A;  2HZT A;  4JP0 A;  3OYD A;  1VQP I;  1ZK8 A;  1H8A C;  3I4P A;  3DF8 A;  2E34 A;  3OOP A;  3R4K A;  2MLK A;  2HZD A;  3SXY A;  2EZK A;  4RB0 A;  4GRI A;  3PIP F;  4Y52 J;  2NS0 A;  2LF8 A;  1JT0 A;  1LE8 A;  4HQM A;  2R7R A;  2LMD A;  3U9G A;  4LOC A;  4HF0 A;  3Q5F A;  4I09 A;  2AHQ A;  2IP2 A;  4NDL A;  4ZJZ A;  3WGI A;  4CHU A;  2HWV A;  1IN5 A;  2RC4 A;  3ZMZ A;  2VOP A;  2EFO A;  3F72 A;  1T33 A;  1ZRF A;  3HOS A;  2DU9 A;  2JMW A;  5B5E C;  2PJR A;  3CMM A;  3HOX J;  2M45 A;  3HBL A;  2IA1 A;  4HBL A;  3RPU D;  1U2W A;  2PX9 A;  4E7L A;  3ABL H;  4LB6 B;  2OA4 A;  4H4K C;  3CC2 I;  1HCR A;  3WGH A;  2GA2 A;  3DP7 A;  3HGY A;  2OC6 A;  2I10 A;  1BL0 A;  4QPQ A;  1FEX A;  4BDY A;  2JA7 J;  3KX2 A;  4AM3 A;  1QZY A;  1Z6T A;  2CW0 F;  2CUF A;  3IH2 A;  3M07 A;  2XAS A;  2H1K A;  4Y13 A;  5J1R A;  1I5Z A;  5F1R A;  2DFF A;  4BL0 B;  5LRR A;  3E1S A;  3W2A A;  2EB7 A;  1FIA A;  1BIA A;  1T6S A;  4HG2 A;  5HOO A;  2DMT A;  2OCE A;  4HAM A;  1YJW I;  4XON A;  1I50 J;  1LFU P;  3BY6 A;  3H0D A;  2HVQ A;  5JHU A;  2NVU B;  2AS5 F;  3AKZ A;  1J59 A;  3I55 I;  1XS9 A;  1BN5 A;  4EGY A;  3BZ6 A;  3SDB A;  3F8B A;  5EEH A;  2DOD A;  3I9V 2;  3L2R A;  1FT9 A;  2OU2 A;  1ETO A;  1B9M A;  5E3L A;  3W2V A;  4HA8 A;  4A12 A;  2VIX A;  1TT5 B;  3FWE A;  4JK1 X;  4BJT A;  5D5X B;  4IQJ A;  3OYB A;  2MLG A;  1CQT A;  2V1U A;  1LKX A;  2EV0 A;  1ETV A;  5HOD A;  1EH7 A;  1FC3 A;  3DEW A;  2FQ3 A;  2E36 A;  1HA8 A;  2DBB A;  2VQC A;  4XRS A;  5FRN A;  1T98 A;  3WU1 B;  2N8G A;  2VXD A;  4ZTJ A;  3KCC A;  3DKY A;  4B43 A;  1W5T A;  2BOL A;  1QA6 A;  4XRM A;  4G8X A;  3L2Q A;  1XGN A;  3ASO H;  2EZH A;  3GF2 A;  5A2Q K;  4ZH4 F;  3CD6 I;  3H92 A;  4XKC A;  1Q1H A;  2V26 A;  4U0V A;  3TL4 X;  4LLL A;  2HYG D;  4XMY A;  1KU2 A;  3O2P E;  2DT6 A;  5CLS A;  1SAN A;  2W24 A;  1USS A;  1FOX A;  2ISY A;  2AQF A;  3K2Z A;  3RSN A;  3CC4 I;  2KPM A;  1YYV A;  3I58 A;  5HLI A;  3B6C A;  2B63 J;  3JRC A;  2EFQ A;  5JVG F;  3VSK A;  2ELH A;  3PNY A;  4A2U A;  2JN6 A;  4BQQ A;  4XLC A;  1TW2 A;  1XG1 A;  2BYV E;  5JLW A;  3MKZ A;  3W6J B;  4YG2 F;  1W36 C;  2V1D A;  4QSH A;  4HX8 A;  4GO1 A;  5ICC A;  5LEK A;  1S29 A;  1WZ2 A;  5F08 A;  1IRG A;  3PFY A;  3FXR A;  1XX5 A;  4GXO A;  2JPC A;  1FOK A;  4I0A A;  3H36 A;  2RKH A;  1WJ5 A;  1L0O C;  1VQ7 I;  4B1R A;  2A5Y B;  2EFW A;  4DGW B;  2EA2 A;  2CUZ A;  4G12 A;  1Z91 A;  3CCJ I;  1Z1D A;  5DDG A;  2ECC A;  4E7K A;  2WAQ A;  3LSJ A;  4I99 C;  2COM A;  3ERE D;  4QPO A;  3JTG A;  3TO9 A;  3M1C A;  3NWT A;  2A68 F;  1R22 A;  1WSU A;  2DN0 A;  1F5T A;  2L7K A;  2HDD A;  2W85 A;  2V6C A;  3F22 A;  1IRX A;  2NXN B;  2DOA A;  2XPW A;  3EUK L;  3EDP A;  3EUH A;  1MDM B;  1IO2 A;  2K7L A;  2R7W A;  5ICE A;  1DGR M;  5A2Q Z;  4HF1 A;  2PMH A;  4AIK A;  2MYS A;  1OCT C;  1Z6R A;  2X51 A;  1RET A;  2VN2 A;  1WKM A;  2L9S A;  1DU0 A;  2LBF B;  5HS9 A;  1ZTR A;  3U1K A;  1J2X A;  3F8N A;  2E35 A;  2GXA A;  4A3E J;  2VPL A;  1SFK A;  2XB5 A;  3FXQ A;  1MBF A;  2OZ6 A;  1U6G A;  2W7N A;  3DU6 A;  2ID3 A;  4EV0 A;  5FRM A;  2NVY J;  4CYD A;  1FNN A;  3LA3 A;  4ABZ A;  3CP8 A;  3RYR A;  1N78 A;  1STZ A;  5F0C A;  4M9X A;  1G3T A;  1QZZ A;  2W82 A;  4FX0 A;  2EPF A;  2JPB A;  3IH3 A;  3UKG A;  1PP7 U;  4WF2 A;  2KP6 A;  3E3V A;  4CIC A;  2FNA A;  3DBL B;  3FZV A;  1BIB A;  2YSR A;  2OZU A;  3PFI A;  2BHZ A;  2V1X A;  1LFB A;  1OKR A;  3SFZ A;  2HR3 A;  4LG3 A;  2HEO A;  1ZLK A;  3BPV A;  5GAG J;  2I8D A;  2VKV A;  2R5Z B;  3QPT A;  1SAX A;  3C7J A;  1IXS B;  3ZQL A;  4RS8 A;  2NNN A;  1MD0 A;  4BBS J;  1MJA A;  1JUM A;  3H1C A;  1UEL B;  2CQ7 A;  3GWZ A;  2CW7 A;  4N9I A;  2FOK A;  5BPD A;  4G9Y A;  1EH6 A;  2MW8 A;  3HPH A;  1D5V A;  2VKH A;  3B6A A;  2LVS A;  3HEF A;  2DA7 A;  2ZNZ A;  3OIQ A;  2CU7 A;  5BPI A;  3MZY A;  1GV2 A;  3QOE A;  1PDN C;  5IYB J;  5AON A;  1XN7 A;  1RNL A;  2ZKZ A;  2LRE A;  4XRS G;  2YX7 A;  2XF5 A;  3WTS C;  4LIV A;  2IT0 A;  3CLO A;  3PIO F;  2EIM H;  1R71 A;  1DP7 P;  4ZYG A;  1UHM A;  2EBI A;  2E7W A;  4QLC U;  4U0W A;  2P7V B;  5E3O A;  3E5Q A;  3VOE A;  3ZMU A;  3IP4 B;  3KZY A;  2V79 A;  1PUE E;  3FIW A;  1W7P A;  1DPR A;  2HQA A;  1R1U A;  3BJO A;  3S8P A;  2A6H F;  4NBQ A;  1WRJ A;  5J8C A;  4U0Y A;  1E17 A;  2QKM B;  2HVR A;  4Y3O A;  2HOS A;  3K2A A;  2M0C A;  2Y75 A;  1VTN C;  4HX4 A;  5EEA A;  3CUQ B;  4ENN A;  1XSV A;  1BOA A;  2EH3 A;  4KMU X;  2CH0 A;  2M4K A;  4V2G A;  1Y1W J;  2NS7 A;  1IG7 A;  4I02 A;  1LEA A;  3ZQI A;  3BR0 A;  5HLG A;  2EFN A;  2NOG A;  2JSP A;  5F0H A;  2LK2 A;  4WXC A;  1ENH A;  3RCO A;  2VKE A;  5AIQ A;  1ACI A;  3DXJ F;  1J09 A;  1LNW A;  4EAT A;  5KCM A;  1R49 A;  1KU7 A;  1LVA A;  3K4N A;  3MAJ A;  3HHG A;  1R5H A;  4C30 A;  3ZRG A;  2VLA A;  2ZBK A;  1N75 A;  1MBE A;  4B48 A;  5J4Y A;  1TWG J;  2D45 A;  2Y31 A;  2AQE A;  1A5J A;  4AVZ A;  1Z67 A;  1HLV A;  5DCM B;  3V42 A;  4M6V A;  5IP9 J;  4UUS B;  1VQO I;  2VQL A;  4C3H J;  4RB3 C;  5C44 J;  3HUG B;  1LUJ B;  4KFC A;  2XGD A;  1MBJ A;  1RKW A;  1K7A A;  4D1Q A;  4CUG A;  3JSP A;  5IOY A;  1UFM A;  4CZC A;  4IX7 A;  2B7E A;  2I5U A;  2HOA A;  2FF4 A;  3DPL C;  3RQI A;  3LSM A;  5HNH A;  3TMO A;  3VWB A;  1ORK A;  4DNC A;  3L9F A;  1QHG A;  1F4K A;  3IRR A;  4A3F J;  4TV7 A;  3CTA A;  2P8T A;  1T8I A;  2P5V A;  1P4W A;  1FYK A;  4KIS A;  3BP8 A;  3RQ4 A;  3QPL A;  2IGO A;  4S04 A;  3P9K A;  4LD5 A;  4ANJ A;  1U8R A;  4CCK A;  2FBI A;  1HW2 A;  2HQ5 A;  4U7D A;  4MIM A;  2VT3 A;  3WHC A;  1OPC A;  2EIN H;  2R7Z J;  2Z3Y A;  3FXK A;  3I64 A;  2KT0 A;  2WAQ N;  3PO3 J;  3EUA A;  4LMY A;  4PK4 A;  2EFP A;  5IOZ A;  2VE9 A;  5IT9 K;  1D8J A;  1I3A A;  5BOX A;  4E7I A;  4A0Y A;  1MBG A;  2COB A;  4MFE A;  4A3G J;  4NQW B;  1U5T C;  3GTJ J;  3I53 A;  3KP5 A;  5JR3 A;  1AHD P;  3EET A;  4MEY F;  1FMW A;  4RAG A;  2XVC A;  3O8H A;  2D2W A;  3K4L A;  1K78 B;  1GV5 A;  1ODD A;  3OIP A;  1KQ0 A;  3WHB A;  1KYW A;  2MAB A;  2PBI A;  4LLG F;  5L3G A;  1G3S A;  4UVB A;  4I7H A;  1G4D A;  1ZYR F;  3SZG A;  2L2O A;  2ZNY A;  4FE4 A;  1OLT A;  3BTI A;  4RB1 A;  3F3X A;  1YOV B;  1U0J A;  2WA0 A;  1G59 A;  1PYV A;  1AA7 A;  4KJZ A;  2FJ1 A;  1P4A A;  3AL0 B;  2LP0 A;  1YI2 I;  4UVA A;  4C3I J;  1HW1 A;  2E71 A;  3HZJ A;  4L0Y B;  3OYC A;  1IDZ A;  3I5U A;  4G6D A;  1R36 A;  1SD6 A;  2QGU A;  4BEH A;  1R4M B;  2RV8 A;  2K9L A;  4Y7N J;  4BYY A;  5IYD J;  3H3U A;  1Y39 A;  1FYM A;  5J6X A;  3WGG A;  3H3V K;  2YPR A;  3H0G J;  3RKY A;  3CCY A;  5LD2 C;  2QUF A;  1TZL A;  4MGR A;  3A01 B;  2K27 A;  1Z3Y A;  4JX4 A;  1T2K A;  1RC9 A;  2A6T A;  2KL4 A;  3R60 A;  4DBQ A;  2FU4 A;  2V9V A;  2K86 A;  2XKO A;  5CVU A;  2R93 J;  4O3M A;  1BM9 A;  3QWL A;  5DD4 A;  5B3S H;  5E18 F;  1HBX G;  1F9N A;  4IHY A;  3WU2 C;  4JX5 A;  2XSD C;  2W57 A;  3CCR I;  4C2T A;  2JUG A;  4XK4 A;  2CSO A;  5FRO A;  4C2M J;  1D1C A;  2LG4 A;  2JVH A;  4ZZD A;  1LE8 B;  4M3D A;  1QGP A;  3Q9S A;  1A35 A;  5IT9 Z;  4EJO A;  1BBY A;  5HVQ C;  1UHW A;  2EV5 A;  2MG4 A;  2G7U A;  5CQE A;  4DBR A;  4YEJ A;  2H09 A;  4KIG A;  4FQG A;  3PUB A;  6PAX A;  1UMQ A;  4DYR A;  3G6E I;  1YE9 A;  2H8W A;  4L9J A;  2R92 J;  4DZJ A;  1WJA A;  2MC3 A;  2O6G E;  3E5X A;  2PMU A;  1QVT A;  1FOY A;  4FE7 A;  4A3M J;  1XMK A;  1X4O A;  5ILS A;  5JLX A;  2K9S A;  4DW6 A;  1MIJ A;  4OIQ F;  4N4N B;  2GXB A;  3ZOB A;  2KIQ A;  1PUF B;  4K2E A;  5HDK A;  1YO5 C;  1WH5 A;  3LST A;  1W4M A;  3J7Z I;  3L2C A;  4IOA F;  1FZP B;  3B02 A;  2HXI A;  1VQK I;  2RDP A;  2XAJ A;  3HDD A;  5K7H A;  4F55 A;  5KAI C;  1IN7 A;  3A2K A;  1J9I A;  4UHT A;  2PJP A;  4LIU A;  2KJB A;  3IH4 A;  5FD5 A;  3K70 D;  1HC8 A;  3M3Y J;  4BBR J;  3DTE A;  2CG4 A;  3JRA A;  2QBY A;  2GIZ A;  2R5Y B;  1ZG3 A;  1YW9 A;  3TP0 A;  9ANT A;  1X2M A;  4DYQ A;  3OIO A;  1YJ9 I;  2W84 A;  1E3O C;  4A3L J;  1B72 A;  3CP2 A;  4XM3 A;  5DV5 A;  1X1C A;  3V7S A;  3FMR A;  1SVO A;  1W7P D;  1Z77 A;  3HTS B;  3S17 J;  4YIR X;  4MEX F;  4M3E A;  1IGN A;  2DXI A;  2QQ9 A;  2CW8 A;  4FX4 A;  2LSO A;  1RRJ A;  1G2H A;  3KEY A;  1IAW A;  4AC0 A;  3MKW B;  5LHH A;  2OAZ A;  3CMA I;  1JJ6 C;  4XL9 A;  1GHC A;  5GAD J;  1ITY A;  2L02 A;  2Y0S A;  1QRY A;  4Y4R A;  2DA3 A;  1E3P A;  3BG3 A;  3ZQF A;  3KP2 A;  4BGD A;  2UXN A;  3O6B B;  4AU7 A;  1WQ2 A;  1WCM J;  2FNP A;  2Y9Y A;  3ZMD A;  1MJ9 A;  3OYI A;  4A6D A;  2JQ7 A;  3VYU B;  5GPA A;  3M4O J;  2IGN A;  1EKE A;  2JA6 J;  3WTZ A;  4IHV A;  1HSJ A;  3CME I;  4HRI A;  4B44 A;  3CO6 C;  3GO5 A;  3FXM A;  3TO7 A;  1KON A;  2AXT C;  4CCN A;  3MKL A;  2ZME A;  2BZT A;  1SFX A;  2DOF A;  2WAF A;  5GTH C;  2XKP A;  4RGS A;  1VQM I;  3DLA A;  2XGX A;  2DA2 A;  1X58 A;  3IUO A;  1H9G A;  1BR1 A;  1Y6I A;  3RZO J;  3S2D J;  2FA5 A;  2OTL I;  4RGX A;  3ABM H;  3OYN A;  1BI0 A;  2GWR A;  3K6G A;  2K4J A;  2W4S A;  3BOQ A;  3F6O A;  3BQY A;  2O3F A;  2QQ8 A;  2B9S A;  2VBY A;  4I6Z A;  2R0Q C;  3M9A A;  3GTM J;  1LEB A;  1SEU A;  1HXD A;  1SVM A;  5DUK A;  1SC7 A;  4RGU A;  3HOV J;  5ICG A;  2FQ4 A;  3ZPL A;  3DTK A;  1S9H A;  1B8I A;  3QYE A;  4A0Z A;  3N4M A;  3ABU A;  2DFE A;  4BU2 A;  2VXZ A;  2DMP A;  1K83 J;  3RJP A;  3WE3 A;  3CCE I;  1VF9 A;  1UST A;  2L9R A;  3JRE A;  1FWZ A;  3FXU A;  5H6Q A;  5D4R A;  3VEP A;  3LL7 A;  4BXU A;  1VQ5 I;  4CYC A;  1OYY A;  2KMU A;  1AU7 A;  3AG4 H;  2JVG A;  2M4G A;  3O3K A;  4PCQ A;  1RUN A;  3HOU J;  4A5N A;  3BRO A;  2XRN A;  1RPW A;  5TJJ A;  1IN8 A;  1R58 A;  5L3D A;  4W97 A;  1IXR C;  4M74 A;  1I6H J;  2DA5 A;  3UNG C;  4P5O A;  4ETS A;  2EIL H;  4IXA A;  3DFG A;  2Z9O A;  2MD5 A;  4HLY A;  3LA7 A;  1HDD C;  2E5Z A;  3F8C A;  2LOO A;  3CMY A;  2MD0 A;  3K1P A;  4W1U A;  3GTG J;  1WI9 A;  3VPR A;  2XPV A;  3OYK A;  2VL8 A;  2F5E A;  2X6Y A;  1U78 A;  5BNG A;  2XF6 A;  5FFZ A;  3S3O A;  4GGG A;  1X3W B;  2HOE A;  5DCF A;  1X1P A;  3D5R C;  2IEK A;  1ZH5 A;  1Z9C A;  2JUC A;  3P7N A;  5CYV A;  4I2O A;  2NS8 A;  1CF7 B;  1W5S A;  4EM1 A;  3EQL F;  4XOR A;  3R61 A;  1ETQ A;  1FMV A;  3ZP5 A;  3CUO A;  4J00 A;  3JRG A;  3COA C;  4IVN A;  3GLL A;  4RAZ A;  1X1D A;  1T95 A;  4S05 A;  4X1E A;  3N97 A;  2KZG A;  5CQG A;  1SFO J;  4X6A J;  3OV8 A;  3JRD A;  1YX5 A;  4BAC A;  2FX0 A;  4BUP A;  3EUH C;  1MMD A;  2QM3 A;  3W3C A;  2M1B A;  3OR1 C;  2W48 A;  1IW7 F;  4MTD A;  3K69 A;  4IOC F;  1VQ9 I;  1MZB A;  3S1Q J;  2UXX A;  1FBQ A;  5B1B H;  2JWT A;  3FXJ A;  2VE8 A;  2JRT A;  1U3E M;  4IKF A;  1F36 A;  1X3U A;  1ZQ3 P;  2HTJ A;  2F5D A;  3A03 A;  4BXF A;  2P5L C;  2FXA A;  3MZ8 A;  2NOJ B;  5EZG A;  2JA8 J;  1WJC A;  3KP7 A;  1ETX A;  4EJW A;  1JHH A;  1BOB A;  1TT0 A;  4G6Q A;  1HKS A;  1KA8 A;  4A93 J;  1V3F A;  3JRB A;  2DK8 A;  1IZ1 A;  2ZFW A;  3AG3 H;  1IRZ A;  2H6B A;  2KIS A;  3DTI A;  1MMG A;  4L5J A;  3WTY C;  4M71 A;  3BDD A;  4N4O B;  1JE8 A;  4PGH A;  4R79 A;  4NUB A;  3CC7 I;  2X9D A;  4ZYD A;  3FMQ A;  3SEQ A;  1VQ8 I;  5ERI A;  4ESB A;  2Z99 A;  3QOP A;  5GAE J;  2GM4 A;  5DEQ A;  3S1R J;  4Z6Y A;  2K3F A;  4OAY A;  4UV8 A;  3BG7 A;  4U87 A;  3C2G A;  1XCV A;  2CQQ A;  4F7Z A;  5JVT A;  5D5W B;  3OYG A;  4II2 A;  1YW7 A;  3BCB A;  4LG0 B;  4I0B A;  4YFN F;  3BC8 A;  2P81 A;  4G7O F;  4PDK A;  1RIO H;  3OOU A;  1BW6 A;  3BZK A;  3BR1 A;  2DFI A;  4B8X A;  4IRI A;  2DJI A;  3E0J B;  1JKQ C;  1T39 A;  2Y30 A;  4ZDL A;  2IA0 A;  2Q2E B;  1XB4 A;  2KRC A;  5EEG A;  3F21 A;  1OCZ H;  2HQN A;  4BXX J;  1A6I A;  2WC2 A;  1BJA A;  3K70 C;  1OFC X;  3LAP A;  2F4I A;  2M0M A;  2F6C A;  2VAS A;  2Y0S N;  1O57 A;  2XF7 A;  3SEZ A;  1T0F A;  1NK2 P;  3TED A;  3K9T A;  1JTX A;  1LDK B;  3E6D A;  2LY9 A;  5IT3 A;  5CVJ A;  5GAH J;  4HDV A;  3FM5 A;  1RI7 A;  1MNE A;  2XAF A;  3PQK A;  4EGZ A;  2M2E A;  1VFC A;  3OYF A;  5F1J A;  1F1Z A;  2PG4 A;  3J7A O;  5EGO B;  1IJW C;  1GVD A;  3PUF A;  1XMX A;  4CZZ A;  2G9W A;  1GUU A;  2O9L A;  3M7G A;  2CGP A;  3OR2 C;  3I54 A;  4IHW A;  1SD4 A;  2ME0 A;  1IRF A;  2IGK A;  1YIT I;  2EIJ H;  3FHZ A;  4L18 B;  5IYC J;  3LWF A;  4UVC A;  4LIT A;  2E1M C;  1QPI A;  1V55 H;  3QPS A;  5E1W A;  4JOM A;  3GME A;  3KZZ A;  5EG0 B;  5L3C A;  2ZJP F;  1KQ9 A;  4RMN A;  4WXD A;  4B09 A;  2HS5 A;  3ABK H;  4YFK F;  4Q4Z F;  2IS2 A;  5LGT A;  4FIS A;  4P9F A;  5C4X J;  2ACJ A;  3HB9 A;  2ETH A;  2LDU A;  1FP1 D;  2R7T A;  2VJI A;  1JXS A;  2PN6 A;  3U21 A;  5F27 A;  1XDS A;  1YS6 A;  4O5V A;  1BI3 A;  4WK8 F;  1R1V A;  1REP C;  1OYW A;  4XLF A;  1Y56 A;  1UG2 A;  2H1L A;  2OUM A;  4NC7 A;  4YII A;  1BJZ A;  5HS7 A;  1LQ1 A;  1DUX C;  4IRG A;  4YIF A;  2H27 A;  1R9T J;  3OL3 A;  1MNM C;  1ZG5 A;  4HW0 A;  4AVP A;  1MBK A;  1S5L C;  2O0Y A;  3S32 A;  2DTR A;  2QA4 I;  2ICW G;  3S93 A;  1A04 A;  2O5R A;  3CF2 A;  4EJV A;  1R1T A;  4OU0 A;  3JAM K;  3BJA A;  3JRI A;  3KYC B;  5ILU A;  4A3B J;  2L7M P;  2QYO A;  2ELK A;  2IRF G;  3RI4 A;  4MHG A;  1LDD A;  3L2V A;  2H94 A;  3NAU A;  2KKO A;  1XCB A;  5HNF A;  2O8K A;  1BW5 A;  3OY9 A;  4MO7 A;  4Y15 A;  1W0U A;  3C18 A;  2K4B A;  1ZRC A;  4OMZ A;  3R6S A;  1O7L A;  4BJ5 C;  3QRF F;  1ZLJ A;  2RQQ A;  1WJF A;  2HKX A;  2QEN A;  3QP6 A;  4FAS D;  1VQL I;  5D8L B;  5D5U B;  1FSH A;  2Y48 A;  4M9Z A;  1NTC A;  1WHU A;  2EZL A;  2WB1 A;  3MEX A;  2CQK A;  4NHJ A;  2EJR A;  4BDZ A;  2KFD A;  1MH4 A;  3RYP A;  3IWZ A;  4I01 A;  3LSI A;  4CO8 A;  4IJA A;  2BV6 A;  3OYM A;  3HOZ J;  2EK5 A;  2Y69 H;  4CCM A;  1ZN2 A;  4A3I J;  4IQ4 A;  3KET A;  2FBK A;  5JHF A;  2MC4 A;  4BE1 A;  4XLN F;  1WGX A;  1B6A A;  1J5Y A;  1GLN A;  1N25 A;  3L1P A;  4MTE A;  4DOZ A;  4XIC A;  1TQP A;  4ZDO A;  3NRV A;  3ZQ7 A;  1WJD A;  4D7N A;  3HSF A;  2HYJ A;  3SZT A;  5K7F A;  4WCG A;  3ZQQ A;  3BR5 A;  1V5E A;  3HXL A;  5H20 A;  4G7Z F;  1H89 C;  2HI3 A;  5E1Z B;  1ZKG A;  3GVA A;  3RDI A;  2DPU A;  2GZW A;  4R1H A;  3ZN0 A;  4CA0 A;  2Q0O A;  1XDU A;  2CO5 A;  3GTK J;  1ZAR A;  5FKL A;  4FT8 A;  3JAM Z;  1BR2 A;  3T5X A;  3FIS A;  4B4C A;  4HNU A;  2JSC A;  4HOB A;  3MD2 A;  5K5Q A;  1K4T A;  1LJ9 A;  2XUB A;  2P0W A;  3VYS B;  1GVJ A;  4Q5S F;  3TKY A;  2QSH X;  1Z0X A;  2L5Q A;  4RAY A;  3J7A Y;  2VT2 A;  4ESJ A;  3KLN A;  3LQQ A;  1AKH B;  4XR6 A;  2PMZ A;  2Z5U A;  2HXO A;  5LGN A;  2PI0 A;  2HVS A;  3VYT B;  5IPA A;  4P96 A;  3I59 A;  2A5W A;  1D0X A;  2XAG A;  2K9Q A;  3F6V A;  2FD5 A;  3P9I A;  1NH3 A;  1IN4 A;  5DD8 A;  5FKK A;  3S14 J;  3H5A A;  4E70 A;  5J4V A;  3MMY B;  4KN7 X;  1EJ9 A;  1FYL A;  2E7X A;  4HSR A;  1I27 A;  3C1D A;  2DW4 A;  5LGU A;  2F4O B;  4OMY A;  3BG5 A;  1SMY F;  1B59 A;  2JA2 A;  1U5T B;  4XKB A;  2DQR A;  3I71 A;  3U1D A;  2HPI A;  2M5W A;  1B4A A;  3GLX A;  5CVV A;  1E0E A;  2V1N A;  2CFX A;  2KIU A;  4HPQ A;  3SQN A;  5J47 A;  4L9V A;  3FM3 A;  1GXP A;  1LPQ A;  2M30 A;  4ON0 A;  2IXS A;  2DYS H;  1ZGJ A;  4BKX A;  2K5C A;  1R5G A;  1MDM A;  3WOD F;  3LA2 A;  3M8F A;  2PQ8 A;  1Y0U A;  2LD5 A;  1TL8 A;  4NNJ A;  4L5I A;  4QTR A;  4S0H B;  4AWX B;  3NAR A;  2QCO A;  3CJT B;  3K10 A;  5E20 A;  4GCV A;  1KZH A;  2LBF A;  3VOD A;  1J75 A;  2LKX A;  4MLO A;  1OCC H;  3V8K A;  4F91 B;  5ILV A;  2LTP A;  1IN6 A;  3S1M J;  1YIO A;  1QQI A;  1JT6 A;  3S15 J;  4PJ0 C;  2VQG A;  2BE5 F;  4BQA A;  4WWC A;  5LLQ A;  4BH9 A;  2KQR A;  5EDN A;  1O3T A;  4UB6 C;  2VQH A;  3ISP A;  1ONV A;  5CVR A;  3FKI J;  1JUP A;  2ZO4 A;  5ED4 A;  3S16 J;  4RLF A;  2ESN A;  1WVR A;  1D3Y A;  1TWH J;  5ICF A;  4JYK A;  3GFJ A;  4IO9 F;  4PSX A;  3OYH A;  1SMT A;  1LDJ A;  2EIK H;  4KDP A;  2K02 A;  2R4G A;  1W1W E;  3K4K A;  3QP5 A;  2WBM A;  4IRH A;  4M3B A;  4U7B A;  4XN3 A;  3Q0V A;  4PJM A;  3GTP J;  2JRM A;  2WV1 A;  2DJN A;  2Y0M A;  4LJZ F;  4M72 A;  4B3A A;  3KEO A;  2QLZ A;  1PVE A;  2Z2S B;  2DDB A;  3FDY A;  3DKX A;  1J0R A;  3HRS A;  2R5Z A;  1BA5 A;  3MWM A;  3BQZ A;  5GTI C;  3M8J A;  1Q1V A;  4E6K G;  5LBQ A;  3H9J A;  4HEA 2;  1YQA A;  3HSR A;  1C0W A;  2HU9 A;  2PEX A;  5D8K B;  2XHK A;  3IAM 2;  4Q48 A;  1TNS A;  4UUV A;  3QPH A;  4M73 A;  1K79 A;  3RPQ A;  3LFU A;  3L2W A;  2Z16 A;  4WX9 A;  1YTY A;  1MSF C;  2BVM A;  5D5V B;  2BW3 B;  2KDZ A;  4A3J J;  4E7Z A;  1HDP A;  3OSG A;  3BG9 A;  2OJE D;  3JRH A;  3BZC A;  2NAZ A;  3MFK A;  2GQQ A;  2ZME C;  4BS9 A;  4ENM A;  5E17 F;  2VC0 A;  1M1E B;  2CUJ A;  1TNT A;  4RM3 A;  1P7J A;  4XSZ F;  1D5Y A;  2LLK A;  3D5L A;  1H9T A;  5HLT A;  4HX7 A;  2GOX B;  1G3W A;  2HKO A;  4ASN A;  5E79 C;  3A0B C;  1L3L A;  5M3M J;  1YG2 A;  2VB6 A;  4KYW A;  1VND A;  1RUO A;  2WB1 N;  2HOT A;  1IDY A;  4P1W A;  3ELK A;  3BR3 A;  3KP4 A;  3B73 A;  1YX3 A;  1ON2 A;  1ZHF A;  2MSY A;  3HPG A;  2P6S A;  4XKW A;  3BCA A;  2PJR B;  5B66 C;  1SFU A;  4H0E A;  1X4P A;  3OS2 A;  3AAF A;  3PNT A;  4ENJ A;  1VQN I;  3E6C C;  2XAU A;  4PFO A;  1O4X A;  3CUQ A;  2L4M A;  4Z2Y A;  2J5O A;  2LKP A;  2R7S A;  4XLH A;  2DYR H;  2LYC A;  2V9K A;  2PFB A;  2D5V A;  1H88 C;  3GFI A;  3D0S A;  5IY5 H;  1TLH B;  1P6R A;  4EQQ A;  3LFK A;  4OIN F;  4AYB A;  3DU5 A;  1W0T A;  4OIO F;  1X3Z B;  4C9Y A;  4EM2 A;  4P9U A;  2KRF A;  3TDZ C;  2OD5 A;  2IVM A;  5LRS A;  2DTZ A;  2DOE A;  3VB2 A;  2UV1 A;  1RES A;  1D0Y A;  2BGC A;  1OCO H;  2FBH A;  1DQU A;  2VJJ A;  4Y17 A;  4D9J A;  3E6B A;  4BHB A;  4HV5 A;  4PJJ A;  2X6W A;  3FBI B;  4HLX A;  1ZAO A;  2O8X A;  2NRA C;  3NEU A;  1NHA A;  2BXY A;  1FBS A;  3HKZ A;  4HNT A;  5J40 A;  3QOD A;  3QU3 A;  3N05 A;  5K7Z A;  2ZCW A;  3HOY J;  2DT7 B;  2X1C A;  3LSH A;  4KIT B;  3CLQ A;  5DCM A;  2HQR A;  4UUS A;  1QO0 D;  4XKV A;  4E7S A;  1O3S A;  3ONQ A;  4L9T A;  2MFZ A;  2V9P A;  1FOW A;  3WU0 A;  3H5N A;  4X0G A;  2AXL A;  2ZJ2 A;  2NNY A;  1R5I D;  1WJB A;  2BY3 A;  3HUG A;  4FHT A;  4ZZL A;  2BY2 A;  1R23 A;  4U88 A;  1FY7 A;  2JJ7 A;  2KHM A;  3BTL A;  2PMZ N;  4L5E A;  2TRT A;  1PJR A;  2IW5 A;  2VON A;  5KK1 A;  1B9N A;  3T8T A;  3SFI A;  1S6L A;  3I4M J;  3FKJ A;  3QU6 A;  4BQO A;  1T08 B;  2DDA A;  2FMY A;  1OYI A;  1RZ4 A;  2DCE A;  2CV2 A;  2FSW A;  5JI6 A;  1OR7 C;  3V7R A;  1UG0 A;  2TCT A;  3ZQC A;  1YRN A;  4GYI A;  2NVQ J;  2E2I J;  3HSE A;  2M9H A;  1MW7 A;  2HYF A;  1RR7 A;  5H2F C;  3PNV A;  2CMP A;  3WE2 A;  2OQG A;  4GYG A;  1D8K A;  4RA2 A;  1XGM A;  4RLQ A;  2CV1 A;  1QVU A;  2IAI A;  3FXO A;  2L7F P;  3OYE A;  3LOC A;  1JTY A;  4WXH A;  2FUG 2;  2FE3 A;  3E5U A;  1WPK A;  2LF7 A;  4NQW A;  4XN0 A;  5EF6 A;  2JZY A;  3ZXS A;  3QYB A;  1P4X A;  1UCR A;  1V5G A;  1ETK A;  3GUD A;  1K78 A;  2ISZ A;  1J7K A;  3IHU A;  4KN4 X;  4LK0 F;  4V19 K;  3ULQ B;  1ZG1 A;  4J01 A;  3L00 A;  3MVP A;  2O61 A;  4IL6 C;  3ZR8 X;  3HL2 A;  1FBU A;  4HST A;  4AUX A;  1ZEL A;  3TGN A;  4YRV A;  2XGE A;  3ASN H;  2XRO A;  1DDN A;  3GX4 X;  1TBX A;  2E19 A;  3GZN B;  3OS1 A;  1ERD A;  3MCZ A;  3EYI A;  1UHS A;  4QIW N;  4F93 B;  1XSD A;  1G6N A;  2GA1 A;  4OOI A;  4IZZ A;  4PJL A;  1HKQ A;  3T8R A;  1S72 I;  1Z7L A;  3HYI A;  3IV5 A;  1MMN A;  4LGW A;  4DQ2 A;  4E4H A;  2YU9 J;  3LAJ A;  3CJR B;  3HGG A;  4EMS A;  4EM0 B;  3A02 A;  1QPM A;  2HNH A;  1WWX A;  1QZE A;  3LMM A;  2Z1D A;  1JKP C;  1HF0 A;  3A01 A;  4QWQ A;  3CCV I;  1OJL A;  3ZQH A;  1HST A;  1I6X A;  2DA1 A;  2QVO A;  1DPU A;  3F8F A;  1A36 A;  1KU9 A;  4D5F A;  1XPX A;  4M9S A;  2G7H A;  4NC6 A;  4BJ6 C;  5IP7 J;  3FHN A;  2CYY A;  1T0F C;  2FRH A;  2D1H A;  2VJ5 A;  1ETW A;  2LRD A;  1TW3 A;  5CJ9 A;  3CCM I;  4D7M A;  1O7F A;  2FEZ A;  2ESH A;  2M3A A;  3CES A;  1VQ6 I;  3ZGK A;  5D4S A;  1FTZ A;  3HM5 A;  1S7E A;  2R7X A;  3HJE A;  3SHF A;  2VBW A;  4GDF A;  3KYL A;  1WJE A;  4E7H A;  2OBP A;  1YFH A;  3KP6 A;  1Y1V J;  1O3R A;  3RKQ A;  5M5W J;  3W6K B;  1JHF A;  4PGG A;  5HDG A;  5M5Y J;  3MKY B;  4A3C J;  2C6Y A;  2KIF A;  2BXZ A;  2CJJ A;  1XGO A;  1OR7 A;  3BT9 A;  4C3J J;  1PUF A;  4RB2 C;  4OIR F;  1K6O A;  2UWM A;  2EZI A;  5B1A H;  1QU3 A;  4B3X A;  1BC7 C;  2MH2 A;  2YX4 A;  2RVC A;  3IKT A;  3QAH A;  4DYC A;  2DPD A;  1IV8 A;  1SAU A;  2X85 A;  4XOT A;  1EA3 A;  4HZF A;  3TDU C;  3A0H C;  1IUY A;  5FJ8 J;  1NK3 P;  3GEZ A;  3HHH A;  2P6T A;  5FLX K;  2WV0 A;  1IF1 A;  2HPM A;  1FP2 A;  3RTR A;  1UAA A;  2R7V A;  4RGR A;  1YLF A;  2ZSI B;  2R5Y A;  3G71 I;  1P2F A;  3W2W A;  3I56 I;  2XAQ A;  1MJB A;  2CQX A;  3SYT A;  2JA5 J;  2R7O A;  3CDH A;  3DWL E;  3WTV C;  3TQN A;  2ZXJ A;  4XLA A;  5L3E A;  4J19 A;  4AYB N;  1A31 A;  3K4B A;  4M6X A;  1EV7 A;  1U9N A;  2ADU A;  2X0L A;  3JRF A;  4BNC A;  5FKO A;  2E60 A;  4UV9 A;  3R0A A;  2GAU A;  3HG9 A;  5DTD A;  2R7F A;  3S1N J;  2BY0 A;  2W1O A;  3JSO A;  1BC8 C;  4ZTF A;  2M87 A;  2HDW A;  1X1A A;  4ZYE A;  2VPR A;  2YU3 A;  1HOM A;  3HKZ N;  2QSG X;  1W7P B;  2LR8 A;  1JGS A;  1WFX A;  3CQZ J;  2HDC A;  1VQ4 I;  5CVI A;  3ZN1 A;  3HRU A;  1TWC J;  3Q0W A;  1VI0 A;  5KVR A;  1WI3 A;  2VI6 A;  2A05 A;  3T0Y A;  2DMN A;  1Z7U A;  3AFH A;  1VZ0 A;  2F5C A;  2DI3 A;  4F3Q A;  3OYL A;  4RM2 A;  1E3H A;  2P4W A;  2E1M B;  3BTJ A;  1FSE A;  2RAE A;  2IPQ X;  3DBR B;  2KZV A;  2IGM A;  2Q1Z B;  2VC1 A;  3JCU C;  4BHP A;  2F48 A;  4NC8 A;  1TWA J;  1YJN I;  4GFB A;  2ZXW H;  1OQY A;  2ELJ A;  2RRE A;  2X4H A;  3REO A;  1AWC A;  2D1V A;  1CGP A;  3H3Z A;  4AID A;  5FLX Z;  2L54 A;  3U2R A;  1UJ8 A;  4HF2 A;  3IC7 A;  2L9V A;  2M7B A;  4ESF A;  2VBX A;  2FOW A;  3RIR A;  4G7H F;  3HRT A;  3Q9V A;  3WTX C;  2R7Q A;  3I59 B;  4CCO A;  5HLH A;  4KIC A;  1LFP A;  1LB2 A;  2OCC H;  3JTH A;  3R0J A;  1ZGW A;  2NVX J;  4M3G A;  1R4N B;  3E7L A;  1IC8 A;  3CZ6 A;  3GTO J;  2M34 A;  1TTY A;  5D6F A;  4LLN A;  4DJA A;  2KJC A;  3PSI A;  1FX7 A;  5JFR A;  5K1Y A;  3PJR A;  4MQV A;  5IP6 A;  2DQL A;  1W5C C;  1MMA A;  1ON1 A;  1QNT A;  2FML A;  3GFL A;  4CCL A;  3H5R A;  3HC7 A;  2OTJ I;  3LQR A;  4RDU A;  2ZJQ F;  2GLO A;  2ECB A;  5L3B A;  3VSL A;  5TRD A;  3JR9 A;  2XAH A;  5J1U A;  3JW4 A;  1MKM A;  4M3F A;  1JI8 A;  3ZMV A;  3ECO A;  2HGC A;  2LY1 A;  3M1E A;  1FJL A;  5DM6 F;  3OSF A;  3TW7 A;  1IXC A;  2H6C A;  3KFW X;  1BI1 A;  2LKS A;  1TP4 A;  3E6M A;  2Y2Z A;  2H8R A;  2ID6 A;  2L9N A;  5F6F A;  5C4J J;  1YW8 A;  5AIP A;  5C3E J;  5EYR A;  3TOB A;  3S3N A;  1B1B A;  2GXG A;  2P5K A;  3KP3 A;  3TW6 A;  2V6E A;  2JK3 A;  2LNB A;  3G3Z A;  4XBF A;  2E2H J;  1S7O A;  3DKW A;  2Y9Z A;  1CF7 A;  4HNV A;  1KQ8 A;  2J5P A;  4PUS A;  2B0L A;  2STW A;  2IA2 A;  4XID A;  4RBO A;  4JX6 A;  1V54 H;  4V2F A;  1POG A;  1I1G A;  3VDX A;  3G73 A;  2CQN A;  3ZMS A;  4JQF A;  2CRG A;  5E3M A;  4E7J A;  2YUS A;  2WY7 Q;  5DM7 F;  3GTQ J;  2DK5 A;  2X1E A;  2DLL A;  2F5F A;  4UNO A;  4R8H A;  2E1N A;  3VFZ A;  2CWE A;  2L0K A;  2ZC2 A;  5BS6 A;  3EPZ A;  3GW2 A;  2RGV A;  3IKV A;  3DEE A;  4AIJ A;  3GZ5 A;  1T38 A;  2P7C B;  3OS0 A;  1UZC A;  1Y8Q B;  4BEH B;  1TQM A;  2AO9 A;  2TDX A;  3ECH A;  3IWF A;  3VYR B;  1WH7 A;  5DS9 A;  2XV4 S;  2NVT J;  4G6T B;  1FPQ A;  4XSX F;  5GP9 A;  2MH9 A;  3P9C A;  3LNQ A;  2XPU A;  2VKD A;  3OYA A;  1KYZ A;  2QQB A;  3ABT A;  4LFU A;  4MFD A;  3G1L A;  1K6Y A;  3OWT A;  4YEL A;  4RAF A;  3TOA A;  2XC7 A;  1APL C;  5DUI A;  5K5O A;  4EJT A;  2L3D A;  4UB8 C;  1D0Z A;  1Z05 A;  2W00 A;  1ULY A;  2LC2 A;  2LY2 A;  2OQR A;  1R7J A;  3LSP A;  1F43 A;  5J3L A;  2IS1 A;  4F52 A;  3TP3 A;  4KT6 A;  2E2J J;  2NYX A;  4IEJ A;  2ZXH A;  1I3Q J;  4HQE A;  5L3F A;  1MSE C;  5TGT A;  4Y33 A;  3I0T A;  2YS9 A;  4IF4 A;  4KT5 C;  3J80 K;  3FMS A;  3GZ6 A;  5KAF C;  3OL4 A;  2EV6 A;  1D1B A;  4Q47 A;  4LG0 A;  2M8E A;  1QBJ A;  1K61 A;  1S3J A;  5HDN A;  1RR8 C;  3K7A J;  3DLL F;  1DU6 A;  1R00 A;  3I3L A;  2M8G X;  3KZI C;  5F04 A;  3H9Q A;  2KDO A;  4BQN A;  2DAO A;  3A4C A;  3C3W A;  3PO2 J;  1BI2 A;  4KA4 A;  4AD9 A;  3PM1 A;  3W6V A;  3GFM A;  4G94 A;  2YR2 A;  2Q2E A;  3DEU A;  2X6O A;  3ZCO A;  3S2H J;  1Y0N A;  2RNG A;  3KYD B;  3HIF A;  3L2U A;  3BG6 A;  2F4M B;  2OPT A;  3SZP A;  2CUE A;  2WAE A;  1P92 A;  4I76 A;  1V5F A;  2DT5 A;  3ERM A;  4HDU A;  3H35 A;  5EGO A;  1ZRE A;  4KUM A;  2STT A;  2KLO A;  3CCL I;  2X6X A;  2O7O A;  3V8L A;  3AG1 H;  3PL8 A;  3V4G A;  5BQT A;  2RNJ A;  2QBY B;  4PJN A;  2IBD A;  1JJ8 C;  3PSF A;  2OV7 A;  2XDV A;  3QYF A;  4ZDP A;  4L9N A;  3RKX A;  4L0Z B;  2QQA A;  4EEF G;  1X1B A;  2A6E F;  2HTS A;  3L09 A;  3MZH A;  1B72 B;  3KEQ A;  1P7I A;  3RKW A;  3F0C A;  1JGG A;  2RN7 A;  1TWF J;  3CUQ C;  2JT1 A;  5J8F A;  3G4S I;  2VJ4 A;  4XLE A;  1MH3 A;  1SD5 A;  2O03 A;  1ZR2 A;  4ITV A;  1JKR C;  2XIG A;  3CCQ I;  3T1B A;  2X1D A;  2IS6 A;  1HQC A;  2V7F A;  3O8G A;  5FB2 A;  1N77 A;  5EG0 A;  1KGS A;  5E8G A;  2W25 A;  3CO7 C;  3J80 Z;  2K9N A;  4XLP F; 
#chains in the Genus database with same CATH homology
 3OR1 C;  2W82 A;  4BE0 A;  1WJB A;  1D1A A;  4IKF A;  3DPT A;  2KHM A;  2V4J C;  2KP6 A;  4BXF A;  2K9M A;  1PJR A;  2NOJ B;  1BR4 A;  3FKJ A;  1WJC A;  4BQO A;  4LG3 A;  2DCE A;  1BOB A;  1TT0 A;  2I8D A;  2CV2 A;  1OR7 C;  2IS4 A;  1UG0 A;  1MW7 A;  3DPU A;  1UEL B;  3PNV A;  2CW7 A;  3DTI A;  2CMP A;  4F92 B;  1MMG A;  5LFA A;  3HPH A;  4RLQ A;  2CV1 A;  4N4O B;  2VKH A;  4ZYA A;  3OYE A;  2ZSH B;  1G8X A;  3OIQ A;  3GBG A;  4NUB A;  4R79 A;  2E5N A;  4II3 A;  3SEQ A;  3TBI A;  3QOE A;  2FUG 2;  4XN0 A;  2WAD A;  3ZXS A;  3QYB A;  1QHH D;  4OAY A;  4CH7 A;  3HOT A;  1V5G A;  3BG7 A;  3C2G A;  4U87 A;  3OYG A;  2LRE A;  4II2 A;  3A1Y A;  3BCB A;  4PSW A;  4J01 A;  2XF5 A;  4LIV A;  3ZR8 X;  3BC8 A;  3HL2 A;  3OYJ A;  4HST A;  1ZEL A;  2XSJ C;  2CV0 A;  3OOU A;  4YRV A;  1ERD A;  3OS1 A;  1MND A;  2DJI A;  3E0J B;  4F93 B;  3IP4 B;  4ZDL A;  4IZZ A;  2Q2E B;  4PJL A;  2HQA A;  2KRC A;  3S8P A;  1LVK A;  1X19 A;  1DP3 A;  3DQV C;  1Z7L A;  1MMN A;  4E4H A;  3K70 C;  2F4I A;  5KNL A;  3CJR B;  2M0M A;  2QKM B;  2F6C A;  2VAS A;  2HVR A;  2XF7 A;  3NWS A;  4Y3O A;  3SEZ A;  2R7U A;  2ZFU A;  1LDK B;  2HNH A;  1MNE A;  3LMM A;  2CH0 A;  2M4K A;  2Z1D A;  2GOM A;  3OYF A;  3D5S C;  2CFO A;  2ZXI A;  3AL0 C;  2JSP A;  2LH9 A;  2M7A A;  5CPR B;  3RCO A;  4BJ6 C;  4FET A;  3OR2 C;  3FHN A;  4XNF A;  1J09 A;  1T0F C;  2IGK A;  4XOP A;  5KCM A;  4EAT A;  2VJ5 A;  3K4N A;  2LRD A;  4C30 A;  3ZRG A;  2VLA A;  2QKL B;  1N75 A;  4LIT A;  4B48 A;  2M3A A;  2E1M C;  3CES A;  3ZGK A;  2AQE A;  4JOM A;  4AVZ A;  2R7X A;  4RMN A;  3V42 A;  3KYL A;  1WJE A;  2IS2 A;  4E7H A;  2VQL A;  3F9K A;  3HUG B;  1Z21 A;  2R7T A;  2VJI A;  4D1Q A;  4CUG A;  3C2H A;  3H9G A;  3U21 A;  4CZC A;  3LSK A;  3MKY B;  4IX7 A;  4XLF A;  3DPL C;  1Y56 A;  2K3P A;  3LSM A;  2OUM A;  5HNH A;  4NC7 A;  3TMO A;  1W36 D;  3VWB A;  4BE2 A;  4C2U A;  3OMY A;  2UWM A;  1NG7 A;  1QHG A;  1DGW Y;  3OL3 A;  3LSG A;  4B3X A;  1QU3 A;  4KIS A;  1Z3X A;  3RQ4 A;  2IGO A;  4DIQ A;  3S32 A;  1SAU A;  2X85 A;  4XOT A;  4ANJ A;  1EA3 A;  3S93 A;  2O5R A;  3CF2 A;  4CCK A;  4ZC3 A;  3S3M A;  4PFP A;  3K4M A;  2HPM A;  3L2V A;  3RTR A;  3EUA A;  2WY8 Q;  4PK4 A;  1UAA A;  2R7V A;  2KRH A;  2ZSI B;  5HNF A;  3W2W A;  3IAS 2;  3OY9 A;  4E7I A;  2F5V A;  5CKT A;  3K4J A;  3SYT A;  2R7O A;  3DWL E;  1NG6 A;  4NQW B;  2CS3 A;  4XLA A;  4BJ5 C;  1FMW A;  2RQQ A;  3K4B A;  1WJF A;  3K4L A;  4FAS D;  3OIP A;  3K4C A;  2MAB A;  2E60 A;  2WB1 A;  3HG9 A;  3G2B A;  4BDZ A;  2BVL A;  2W1O A;  3LSI A;  1P9Q C;  3SZG A;  2L2O A;  4ZTF A;  3OYM A;  1OLT A;  2HDW A;  3BLY A;  1X1A A;  2WA0 A;  1U0J A;  4B47 A;  4CCM A;  1G59 A;  5KHD A;  1PYV A;  1AA7 A;  4IQ4 A;  4KJZ A;  4OWR B;  5JHF A;  1WFX A;  3AL0 B;  2MC4 A;  4BE1 A;  1R6R A;  3CJQ B;  1GLN A;  3OYC A;  2UUZ A;  4CCJ A;  4DOZ A;  4ZDO A;  4BEH A;  1WJD A;  2K9L A;  4CSW A;  3AFH A;  1VZ0 A;  3ZQQ A;  4XQF A;  3FBN B;  4F3Q A;  3OYL A;  1V5E A;  3HXL A;  5LD2 C;  1TZL A;  4RM2 A;  1Z3Y A;  2E1M B;  3UR3 C;  4CA0 A;  2KL4 A;  2A6T A;  4DBQ A;  2KZV A;  2IGM A;  2Q1Z B;  4NC8 A;  2RRE A;  2ELJ A;  1BR2 A;  4HNU A;  4C2T A;  2JUG A;  4OAZ A;  3MD2 A;  2M7B A;  5FRO A;  1D1C A;  2LG4 A;  2JVH A;  2BW3 A;  2P0W A;  3VYS B;  3OYD A;  5HVQ C;  2R7Q A;  4CCO A;  2L5Q A;  3J7A Y;  5CQE A;  4DBR A;  1LFP A;  4YEJ A;  2HZD A;  3CZ6 A;  4XR6 A;  3PUB A;  4GRI A;  2PMZ A;  1YE9 A;  2HVS A;  3VYT B;  4DJA A;  2R7R A;  3PSI A;  1WJA A;  3PJR A;  2A5W A;  1D0X A;  4ZJZ A;  1MMA A;  4CCL A;  1X4O A;  3H5A A;  3H5R A;  3HC7 A;  3MMY B;  4N4N B;  3HOS A;  4HSR A;  3VSL A;  2PJR A;  3CMM A;  2JA2 A;  1JI8 A;  3RPU D;  2LY1 A;  4XKB A;  2HPI A;  4E7L A;  4H4K C;  1E0E A;  2V1N A;  4F55 A;  4HPQ A;  3A2K A;  4LIU A;  2OC6 A;  3K70 D;  4QPQ A;  2IXS A;  2L9N A;  4BDY A;  3DTE A;  3KX2 A;  2K5C A;  3S3N A;  2V6E A;  4NNJ A;  3CP2 A;  4XM3 A;  4BL0 B;  3E1S A;  3K10 A;  3W2A A;  1X1C A;  2LBF A;  4PUS A;  4HG2 A;  4MLO A;  4F91 B;  5HOO A;  4XON A;  2DXI A;  3H0D A;  2CW8 A;  2HVQ A;  3KEY A;  3AKZ A;  2VQG A;  3VDX A;  3MKW B;  2KQR A;  4JQF A;  4E7J A;  2WY7 Q;  2VQH A;  3SDB A;  4XL9 A;  2X1E A;  3I9V 2;  3L2R A;  4RLF A;  3W2V A;  2Y0S A;  4Y4R A;  2VIX A;  4BJT A;  4IQJ A;  3OYB A;  3EPZ A;  4PSX A;  3OYH A;  1LKX A;  3DEE A;  4BGD A;  2R4G A;  3K4K A;  4AU7 A;  2WBM A;  4U7B A;  1HA8 A;  3OYI A;  4XN3 A;  3OS0 A;  4PJM A;  3VYU B;  4BEH B;  2VQC A;  5FRN A;  2VXD A;  4ZTJ A;  2IGN A;  3VYR B;  4HRI A;  3DKY A;  4B43 A;  2BOL A;  2Z2S B;  4B44 A;  4G6T B;  3FDY A;  3L2Q A;  3DKX A;  1KON A;  4CCN A;  3OYA A;  2VKD A;  3M8J A;  4XKC A;  2V26 A;  2WAF A;  3TL4 X;  1K6Y A;  3OWT A;  4XMY A;  4YEL A;  3H9J A;  4HEA 2;  4E6K G;  3DLA A;  2XC7 A;  2HU9 A;  2DT6 A;  1D0Z A;  2LC2 A;  2W00 A;  3IUO A;  2LY2 A;  1BR1 A;  4BUP A;  3IAM 2;  1Y6I A;  2AQF A;  3RSN A;  3OYN A;  2IS1 A;  3LFU A;  4F52 A;  4KT6 A;  3L2W A;  2Z16 A;  2KPM A;  2ZXH A;  2BVM A;  3K6G A;  5TGT A;  2W4S A;  2BW3 B;  4Y33 A;  3VSK A;  3PNY A;  4E7Z A;  4BQQ A;  4XLC A;  3OL4 A;  3MKZ A;  4BS9 A;  1D1B A;  2CUJ A;  4RM3 A;  1W36 C;  3DTK A;  1S9H A;  3QYE A;  3D5L A;  3I3L A;  4BU2 A;  5HLT A;  2GOX B;  2VXZ A;  3H9Q A;  3PFY A;  2KDO A;  4BQN A;  3A4C A;  2VB6 A;  3LL7 A;  4P1W A;  1WJ5 A;  3ZCO A;  2KMU A;  2JVG A;  2M4G A;  1YX3 A;  2RNG A;  4DGW B;  3HPG A;  4XKW A;  2CUZ A;  3BCA A;  2PJR B;  3L2U A;  3BG6 A;  3UNG C;  1X4P A;  3OS2 A;  4P5O A;  4E7K A;  2WAQ A;  3PNT A;  2WAE A;  1V5F A;  2XAU A;  4PFO A;  4QPO A;  2E5Z A;  2LOO A;  2R7S A;  2MD0 A;  4XLH A;  3H35 A;  3M1C A;  2LYC A;  3OYK A;  3NWT A;  2VL8 A;  2X6Y A;  2V9K A;  2KLO A;  2X6X A;  2XF6 A;  3S3O A;  2L7K A;  3PL8 A;  1IRX A;  4AYB A;  3DU5 A;  2DOA A;  4PJN A;  4C9Y A;  3EUK L;  2OV7 A;  2XDV A;  3D5R C;  3PSF A;  3QYF A;  4ZDP A;  2R7W A;  1DGR M;  1X1B A;  2MYS A;  2X51 A;  2UV1 A;  1D0Y A;  2L9S A;  2LBF B;  1DQU A;  2VJJ A;  4XOR A;  4D9J A;  4X0G A;  1FMV A;  4PJJ A;  2X6W A;  3FBI B;  4J00 A;  2VJ4 A;  2VPL A;  4XLE A;  1SFK A;  4ITV A;  3HKZ A;  4HNT A;  1X1D A;  2W7N A;  3DU6 A;  2X1D A;  3QOD A;  5FRM A;  2IS6 A;  1T95 A;  3N05 A;  2V7F A;  1N77 A;  2DT7 B;  2X1C A;  3CP8 A;  3LSH A;  5CQG A;  4KIT B;  1N78 A;  4XKV A;  4E7S A;  1YX5 A;  4BAC A;  3ONQ A;  2MFZ A;  3EUH C;  1MMD A;  3W3C A;  3H5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...