1DGRM

Refined crystal structure of canavalin from jack bean
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
QLRRYAATLSEGDIIVIPSSFPVALKAASDLNMVGIGVNAENNERNFLAGHKENVIRQIPRQVSDLTFPGSGEEVEELLENQKESYFVDGQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Plant protein
molecule keywords CANAVALIN
publication title X-ray diffraction and atomic force microscopy analysis of twinned crystals: rhombohedral canavalin.
pubmed doi rcsb
total genus 14
structure length 92
sequence length 92
chains with identical sequence W, Y
ec nomenclature
pdb deposition date 1999-11-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.840 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1dgrM01
1DGRM 1DGWY
chains in the Genus database with same CATH superfamily
4KICA 3T1BA 2VKVA 3IAS2 3RPQA 4DZPA 5L3CA 1SFOJ 3KP4A 3PNTA 2EH3A 4WXCA 3HRMA 2HZTA 2VN2A 2OTLI 2MC4A 2LG4A 4CICA 1OCOH 3W6JB 2R7ZJ 3K1MA 2F2EA 4L9JA 5GTHC 3WTYC 3OOPA 2IGOA 2K7LA 2ZCWA 2JRMA 2VC0A 2EIMH 4RGUA 2BYVE 3PSIA 4HV6A 5EZHA 3HOTA 5TGTA 4CSWA 4B8XA 4BEHA 1R4NB 2QUFA 1RI7A 3CUQA 3E7LA 3RPUA 1G3TA 3B02A 2KIQA 2XRLA 3E3VA 3A01A 1ZAOA 1S8NA 3HGGA 3JTGA 5JVGF 4XLEA 4UNOA 3GTKJ 3N05A 4XRSG 1SC7A 4KDPA 3VSKA 3G1MA 1FSEA 1YIOA 2A6HF 4LOCA 4M9XA 2MYSA 5F0CA 3H0GJ 4I0AA 2DPDA 1TC3C 1NK3P 1V5FA 1TQIA 3IUOA 1KONA 4BDYA 2DMTA 2ZFUA 4I0BA 2R4GA 4HX8A 4C9YA 2FNAA 1ETYA 4JYKA 3CCVI 2E7WA 2RV8A 3CDIA 1LUJB 3F72A 2K4BA 3AKZA 1K78B 4XKCA 2O03A 2WADA 3GTOJ 1R58A 3JAMZ 5FD5A 2LBFA 3HOWJ 3BJOA 3K7AJ 2VBYA 1K61A 1XDUA 2OAZA 1ZKGA 3KP2A 3KLOA 5B3SH 1VTNC 2CQXA 1Z6RA 1YE9A 1JJ8C 3PUFA 2KL4A 2L7MP 5CVVA 3DXJF 3BTCA 4X1EA 3WODF 2IGMA 1QA6A 4GXOA 2DYSH 2EIKH 1O3SA 3ZOBA 4DGWB 5B5EC 3CUQC 5F1RA 1EF4A 2BY3A 4GYIA 1IN7A 1W4MA 1X1DA 4FTHA 4M3FA 4XOTA 3ZRGA 5IOZA 1T8IA 2P5LC 4FISA 4PCQA 4DYCA 4D5FA 3G1LA 1LQ1A 4OU0A 3ERMA 5C44J 2XGXA 3ZQGA 2FNPA 3WGGA 2R7VA 1QO0D 3RTRA 2J5OA 2M7AA 3QYEA 3Q3SA 1VQ7I 2F5EA 3FXRA 3RQIA 5IYDJ 5D4RA 2CO5A 3B73A 2NVXJ 3ERED 1Q1VA 3G4SI 4ZZLA 3MKZA 2ZJ2A 2OC6A 1KQ8A 4ETSA 1YOVB 4PFOA 4QSHA 2CJJA 2A69F 2MSYA 5B1BH 4IKFA 1GDTA 5FLXK 3BTIA 1Z91A 1FOXA 1J9IA 1OQYA 3ZMTA 3HRSA 2CH0A 1FJLA 4QTRA 2VKDA 3C2HA 2GWRA 3LSHA 4KN7X 3TDZC 1EJ9A 2XVCA 1FLIA 1R5ID 2DA3A 2FEZA 3PQKA 1LEAA 2I10A 3E6CC 1EA3A 1YW8A 2QQ8A 2BZTA 2KKOA 3PUBA 3BTJA 1H88C 3CO6C 3CJTB 3PIOF 1FMWA 3G3ZA 3H5AA 1B8IB 1XMAA 4D5CA 4F3QA 2WTEA 3GX4X 2VL8A 1S72I 3VSLA 4LITA 5GPAA 1FTTA 4A2UA 3A1YA 4G7HF 2DCEA 3CF2A 4FQGA 2H27A 1YJ9I 4HSRA 2FQ3A 3I59A 5DS9A 2L54A 1XD7A 3PFIA 4I01A 3HOVJ 3PNVA 2E2IJ 1V54H 4F55A 1Y8QB 4XK4A 1A5JA 1D5YA 4MO7A 4A5MA 2PJRA 1S6LA 1T2KA 3NWSA 2CQKA 4PFPA 3QRFF 4IHSA 2NVQJ 1ON1A 3S1QJ 1U9OA 2R7QA 5L3FA 3VODA 3OS0A 1VQLI 1BC8C 1RKTA 1LFBA 3WG7H 3IH4A 3HJEA 1N25A 2DXIA 5J47A 1QVTA 5GPCA 3M07A 1ZH5A 2FD5A 1FBUA 4XSZF 5C4XJ 1Z0XA 4EV0A 3S17J 5LGUA 1ODDA 3C2GA 4R79A 1T6SA 1AA7A 5E18F 4A6DA 1WCMJ 4LB5A 3GBGA 1ZG3A 3CCEI 5IP7J 1FWZA 4DW6A 5K7FA 1XCVA 3CMEI 3V8LA 1IC8A 1OYWA 3ABLH 1P7JA 3DF8A 3HRTA 2JN6A 1EH8A 3KIOA 1OCCH 2EFWA 1VF9A 1KYZA 1Z77A 2Y69H 3M3YJ 1BI3A 3H3UA 3TP0A 2DA2A 3Q0VA 3LA7A 3J7ZI 4M3BA 1FSHA 3F8FA 3GCMA 3BG3A 3IWZA 2PBIA 3I0TA 3L2CA 3K4MA 2R7DA 3Q0UA 3JRFA 1RUOA 2QBYA 3HUGA 3OSFA 4XICA 5L3BA 1CQTA 5ERIA 5ICFA 1UG2A 3GUDA 1T98A 3SYTA 2ZXJA 2COMA 4D1QA 4J19A 4J01A 1GHCA 3QP5A 1UG0A 1X4OA 1TBXA 3BT9A 1H9GA 2CQNA 4A3FJ 5CLSA 1Z9CA 3Q9VA 1IN8A 3BJ6A 2ZB9A 1U8BA 2HR3A 3S15J 1P7IA 2YX7A 2FF4A 4HAMA 1U5TA 3TW7A 3SDGA 1H89C 3AL0C 2W24A 4IRHA 3GVAA 4P9FA 4L18B 1LB2A 5DCMB 1ZG5A 2OZUA 4CHUA 2CW0F 3ABMH 1WH7A 3I64A 1N75A 2VC1A 2A6TA 1MNEA 2M30A 3RDIA 1N77A 2B9SA 2I8DA 2LH9A 3GLXA 3RIRA 4BXUA 2VXZA 1R1UA 3FWEA 3HKZN 2NVTJ 3E97A 3QAHA 2WAEA 4JBAA 1IRFA 3C2BA 3ISPA 4U0YA 1Y1VJ 3BPXA 1LE8B 3KETA 3VYSB 3CF5F 3BDDA 5E3NA 3S1RJ 4D7NA 4XBFA 2ZJQF 5EG0B 1UMQA 4LGWA 3EETA 2P6TA 1S7EA 3A0BC 2JPCA 3RPUD 2FU4A 4BY7J 1HBXG 4IOCF 3DLAA 4HF2A 3F3XA 1QPIA 3COAC 1Y39A 1A36A 2R3SA 2M5WA 5HLIA 1HLVA 1TT0A 2KIFA 1Z3XA 2DA1A 4Y4RA 1XPXA 1XSXA 5DM7F 3ZQLA 3OR1C 4A0ZA 3CLOA 3S2HJ 3KE2A 1ORKA 2JPBA 3W2AA 2XKPA 1WKMA 1U5TC 4FT8A 3L2WA 2D5VA 3ZN0A 5IY5H 1A6IA 2KQRA 2E5NA 2HVRA 4L5JA 1GV5A 2X1CA 3SQNA 4Q5SF 4YFKF 1R1VA 4XLHA 2P5KA 1W5SA 2DODA 2OZ6A 4E70A 4B4CA 4ANJA 5TISC 4BJTA 2DFFA 4IRIA 1DPUA 4NB5A 2DLLA 2F4OB 1JJ6C 4HW0A 3FZVA 1Y0UA 5ILVA 4Y3OA 4OWRB 2XSJC 3UR3C 1K83J 4WXHA 3N4MA 1TNSA 4HA8A 1MNMC 4I76A 4PJMA 1TQMA 4CCKA 5HS7A 3FX3A 1AU7A 1IXCA 1ENHA 2WB1A 4ESJA 4HX7A 4HPQA 1ZHFA 4GGGA 2KFDA 3DKYA 4Z2YA 1YW7A 2NVUB 3F0CA 2HOAA 4KIBA 1USSA 2B7EA 1QZZA 5IT3A 2ZBKA 2KDOA 3BR5A 4UB8C 3SXYA 1L0OC 4BS9A 2ZMEB 3E5UA 3CP2A 4NHJA 3ROUA 5CQEA 1VQ4I 5D6FA 1BOBA 2FJ1A 3I55I 2CW8A 1RPWA 1YW9A 4A3GJ 4LG0B 1OKRA 2CW7A 4ZC3A 1KGSA 3TO7A 1VQ6I 3VPRA 5LBQA 4I6ZA 1EH7A 2K9MA 2CMPA 3IH2A 3H5NA 3ESWB 4A3DJ 4HNTA 2IS4A 5H20A 1POGA 2K4JA 4ZYEA 5J3LA 1RETA 2O61A 4L0YB 5IT9Z 4M6XA 2R7UA 1KU3A 3FKIJ 4YRVA 4HEA2 1F43A 3DV8A 1JKQC 2BXYA 1P2FA 1MJAA 3HOYJ 2GA2A 2QQBA 2HVSA 1ULYA 5ILSA 4EJUA 3HHGA 3SEZA 1HSTA 2JA7J 1YJNI 3FXJA 1X1AA 2HS5A 5HDKA 2VQGA 2OUMA 1C0WA 1J7KA 3KP5A 2GQQA 3J81K 3CD6I 3ECOA 1IAWA 4YELA 3X2QH 1XMXA 2EFQA 3KZIC 2DJNA 4XKWA 1YS6A 3IC7A 3NWTA 2K40A 2R7FA 4LB6B 4XN0A 2VLAA 2CG4A 3L7WA 2L7ZA 1KU2A 2VT2A 3D0SA 3GO5A 1Z05A 3LNQA 1IN6A 4CCJA 3H9GA 1MBGA 3I71A 4RGRA 5J1UA 3T8RA 4BDZA 1XTAA 4ZH4F 2LREA 2KMUA 3GTJJ 1EV7A 3G2BA 4RAFA 2R7RA 2ID3A 1TL8A 2BHZA 1E3HA 2NS7A 4QLCU 4H0EA 2IXSA 1W7PA 2K9SA 2XB0X 2CV0A 2W00A 3FXUA 2DQLA 2X85A 3WGHA 3J80K 3WTZA 5BNGA 1B9MA 2O8XA 3I54A 3KP6A 3SZGA 4M9SA 1FIAA 5F1JA 1RRJA 4AIDA 2VQHA 2G0EA 3E6BA 1IN4A 2FA5A 4L9NA 5D8LB 2BEOA 4XRMA 3RKWA 2IGKA 3DEEA 1VZ0A 2O6GE 5GTIC 1QHGA 4I02A 2FUG2 2JVGA 2KRHA 2QF7A 2DW4A 3F8NA 1TWGJ 3FXOA 4EQQA 3GFIA 3KPHA 3HTUA 2Z9OA 2E2JJ 2Y31A 2PMZN 1Z7UA 2CQ7A 1WVRA 4N4NB 3KEQA 4DJAA 5FKNA 3VDXA 3BJAA 4XIDA 3WU1B 2K02A 1FC3A 3RZDJ 4AYBN 3FDYA 1SVLA 1SFUA 3DPUA 3GTGJ 4C3JJ 3ZQ7A 1U2WA 4HNVA 4A3KJ 2BY2A 5KAFC 1P6RA 1K4SA 1JUPA 2EZHA 2OPTA 3LFUA 1KQ0A 3PO2J 1LEBA 5CPRB 2VKEA 3CP8A 4IL6C 4AU7A 4CZCA 3S1NJ 4OOIA 1U3EM 1XDSA 5J1YA 2LK2A 2HYGD 4F7ZA 4FHTA 1K4TA 2VQCA 4RA2A 1IUFA 5FJ8J 2W1OA 3GZ5A 1WPKA 2WAQA 3P7NA 4BXFA 3S3NA 1O57A 3LFKA 4UVAA 1RUNA 4KITB 4NNJA 5HS8A 2WWYA 4M9ZA 4LMYA 1O7LA 2OD5A 3CCMI 3JTHA 3R60A 1K79A 5D4SA 4BHCA 2Z1DA 3PM1A 2CGPA 3A03A 1WQ2A 2WAFA 3Q5FA 4QIWN 2JTVA 2X6YA 3K2ZA 2QZ8A 3Q0WA 4JX4A 2MH2A 2JJ7A 4BE2A 3LMMA 3S32A 4Y13A 2LLKA 3P9CA 3M8FA 2Y0SA 3FXKA 5AIPA 1I1SA 2WBMA 3OL4A 2BXZA 2VQLA 1PP7U 2STTA 3QYFA 3NRVA 3L9FA 3FHNA 1U8RA 2CUFA 1KU9A 3GFJA 3OYLA 1GVJA 3KYDB 5J6XA 5K5OA 3RI4A 1R9TJ 3CCLI 2PMUA 3HC7A 5EEAA 5FKLA 3WU2C 3VWBA 2DFEA 4HG2A 2XF7A 1ZG1A 3D5LA 1R71A 2BGCA 3OSGA 4C3IJ 1ON2A 3FM3A 4KIGA 4MHGA 4QWQA 3IP4B 2LC2A 1TWAJ 2DOAA 2VBWA 2ZXWH 4I2OA 3GEZA 3EQLF 2LD5A 4V19K 5EGOA 3GFLA 1W1WE 4XLNF 1ZR2A 3MQ0A 4IZZA 1B4AA 4HDVA 3P9IA 1SANA 4QPOA 3K69A 5H6RA 4F92B 4JK1X 2A61A 1I6XA 2EFPA 1PUFB 2LY2A 3F6VA 3V8JA 2A5YB 1E2XA 1WJDA 3KEYA 3DEWA 1W36C 1V5GA 3MZ8A 5D8KB 5CKTA 2AQFA 2ESNA 5EZGA 4EVIA 3WTTC 1VFCA 4HF1A 3K0LA 4F91B 2JA6J 4KMFA 1XX5A 1UHMA 2Q2EB 1LFPA 2KJBA 1X58A 3JR9A 2GZWA 4DQ2A 5BOXA 3DKXA 3BR3A 3DEUA 1D8KA 3VYRB 2JSCA 2DMPA 4KT6A 1DQUA 2ZFWA 2ZJRF 1I3QJ 4IOAF 4RBOA 3DTIA 4G6DA 2D1VA 2RQQA 1DGWY 2LP0A 1VQ9I 3BOQA 4P1WA 1OISA 3E0JB 1ETQA 2HKOA 4KMUX 2DN0A 2IW5A 4G9YA 4BHBA 5HS9A 2RAEA 2R5ZB 1Y6IA 2XPWA 5K5RA 1WI9A 5HNFA 4PJ0C 4EMSA 4RB1A 1JT6A 4F93B 5HDNA 1X1PA 1O7FA 3HPGA 3CESA 3FXQA 1P92A 3PSFA 2VPLA 3I58A 3M1EA 4XM3A 2P81A 4L5EA 2IS2A 1ZRCA 5F27A 2QGUA 3M1CA 4I98B 3DFGA 1WWXA 3I3LA 1J75A 2HQAA 1VQKI 2HKXA 4LIUA 1SFEA 3MKWB 2O3FA 1YO5C 2LYCA 4HQMA 3LSGA 2KZVA 4YEJA 1MMDA 2V7FA 2PI0A 1X3WB 2LRDA 4XKBA 4CGZA 3ZCOA 2EBIA 4BBRJ 3I4MJ 1D3YA 5K7ZA 4YIRX 2V4JC 3IKVA 3U1KA 4M72A 4A3CJ 1S9HA 5DV5A 2XF5A 1S29A 2DK5A 1JHFA 2V6CA 5A2QZ 2UZKA 3JRHA 4ABZA 3ZGKA 5KAIC 3V7RA 1DU6A 1U78A 3GMEA 1FBQA 1OJLA 1U6GA 4CH7A 3BLYA 1SEUA 4ASNA 5HOOA 1QPMA 2F5CA 1CGPA 2K9LA 2OJED 3HTSB 3CMYA 3U1DA 2UUZA 3O3KA 2R5YB 2ZKZA 4E6KG 3K4NA 2E35A 4LLLA 1ZN2A 2BY0A 1NK2P 5LRRA 2KIUA 1RC9A 2LTPA 3K4KA 3RKQA 4UB6C 3U21A 4KISA 1ZK8A 5DEQA 3PJRA 2Z33A 2HVQA 4XR6A 1HW1A 4U7DA 4OIQF 4XNFA 3K10A 2ADUA 2D1HA 3VFZA 2CWEA 4G94A 5E1ZB 4BU2A 5ICGA 2RC4A 1JT0A 3P5JA 5JLXA 5L3GA 3TP3A 1Y8RB 2ELKA 2ZC2A 1R5GA 2HI3A 4BQOA 4BUPA 3T5XA 4XLFA 5DCFA 4BQQA 3CCYA 2GAUA 2JZYA 2XUBA 1JE8A 4A0YA 4ITVA 3OIPA 4IHYA 3ZMSA 4G6TB 1OCRH 1UCRA 2DA6A 3EUAA 2HTJA 5E79C 3GTQJ 3I4PA 3TMOA 3ZXSA 4IEJA 4BNCA 1HKQA 3TBIA 4AD9A 4O3MA 3CTAA 3BG6A 3HSEA 2RNGA 3QWLA 4W97A 4BEHB 3J7AO 3HOZJ 1IXSB 1ZARA 2QENA 4BE1A 4AVPA 3CUQB 1IV6A 1ZREA 2LDUA 4XMYA 5HLGA 3A01B 3BQYA 2MABA 3BZCA 3OYFA 1E17A 2PG4A 1BJAA 2HXOA 4HNUA 3R0JA 3GZNB 2FE3A 2O9LA 2EV0A 4RM3A 5DTDA 5KHDA 4A3LJ 1AKHA 3OOUA 1Z6TA 2IA2A 2MBFA 4PGGA 1P4XA 2DYRH 3DKWA 2W84A 5LLQA 2DT7B 1FP1D 1YIJI 2QSHX 1KZHA 2RN7A 1W36D 4KIFA 3K6GA 3IKTA 2ZNZA 1YJWI 3CDLA 3ABKH 1G8XA 4TV7A 2BW3A 4A6EA 1IRZA 2TDXA 5EYRA 2FMLA 2LBFB 5JVTA 2MG4A 4ZJZA 2HQ5A 1V3FA 4II2A 2DQRA 1SVMA 4LIVA 4HSTA 3E6MA 2WY7Q 2H8RA 1R4MB 2E19A 3DPLC 4IHWA 1O3TA 2VT3A 4UUSA 2L4MA 4M3EA 2L9VA 2YU3A 2VI6A 4BACA 4UY8I 2OF7A 1VQMI 1T95A 3W6VA 4O6JA 4U88A 5EEHA 1MDMA 3TGNA 2EV5A 4B47A 1T08B 1I1GA 3LSMA 5GAHJ 1DP3A 3NAUA 1B6AA 3A2KA 2Q8KA 1QBJA 2VE8A 3U9GA 3I5UA 2HDWA 5FGMA 3AG3H 3MEXA 1T0FA 2LMDA 1HW5A 3HKZA 3GFMA 1IRXA 5F6FA 3CJRB 2N8GA 3G6EI 4CYCA 3CCQI 4BH9A 3LQRA 5D5UB 2M3AA 3EDPA 1LJ9A 3CC4I 1DPRA 5DD8A 3Q9SA 4PSXA 2CYYA 4BGDA 1X19A 4OIRF 1QZEA 1GXPA 3FF5A 4A3IJ 2VBXA 2CV1A 1UZCA 4NC8A 3WTUC 1BR4A 4MLOA 3U2RA 3D5RC 4LLNA 2PQ8A 2R0QC 1K6OA 2HYFA 2PX9A 3NEUA 5FLXZ 4HBLA 2XAUA 4MFDA 1F4KA 4FE7A 2LY9A 3BWGA 1BC7C 2G7HA 2XAQA 4IHTA 2VOOA 1PJRA 4NC7A 4Q47A 3W2WA 3E6DA 5DUIA 1HCRA 2RNJA 4CYDA 2E60A 2XDVA 3V4GA 3S2DJ 3GTPJ 2YSRA 3I59B 5IYCJ 1YTYA 4S0HB 2L3DA 5LEKA 3AG4H 2EWNA 4DBQA 3UKGA 2PJRB 4M3DA 2FBHA 2XHKA 1NTCA 4IRGA 2CRGA 1BIAA 3AL0B 2M9HA 1XGMA 4RS8A 2X6XA 5BS6A 3QOPA 2V1NA 5CVIA 3WG9A 4I09A 3IRQA 3CC2I 4UUVA 4KN4X 1IUYA 3E5QA 4RB2C 4ESBA 2XASA 3LSJA 2H94A 5KK1A 2ISYA 4B43A 1ZRDA 2F5DA 2V1UA 2K3PA 2ZSIB 4P9UA 3H3ZA 1D0XA 1PDNC 1Z1DA 2W57A 1OYYA 2LFBA 2LF8A 1TW2A 5FKKA 4L9VA 1YG2A 1DUXC 2FOKA 3HOSA 1ETOA 2QBYB 3HUGB 3SJMA 3C7JA 2M87A 1KA8A 4EJOA 5GAGJ 1DP7P 2VJJA 2JA8J 1CF7A 4GCVA 2QM3A 1MGTA 3CCRI 3K9TA 4OMYA 5BQTA 2BBYA 1RIOH 4GO1A 5J8CA 4MNUA 4KT5C 4B1RA 1SFXA 3O6BB 1YRNA 2GM4A 4EM1A 5IT9K 2EILH 2XIGA 1JKRC 2DPUA 3BZKA 3CZ6A 3F23A 2LY1A 1MH3A 2UXNA 4CCOA 1U5TB 2DBBA 4ENJA 1ZQ3P 3BP8A 2DMNA 5E8GA 2HPMA 3SEQA 5CVUA 2BOLA 1J59A 4M71A 1D1AA 1NHAA 1F36A 1D0ZA 5D5XB 2KT0A 2HQRA 2EK5A 2P5VA 3FMRA 1TP4A 3HPHA 4B44A 1IO2A 4UV8A 2IRFG 5BPDA 2DTRA 4PGHA 3GLLA 5JHFA 2LKSA 3RCOA 2M4GA 2ESHA 2IA0A 3BG7A 5H2FC 4XOPA 2RKHA 1SD7A 1FT9A 1S7AA 4W1UA 5D6EA 4D0PA 5LHHA 2QKMB 3DCFA 1JUSA 4IPAA 1HOMA 2J5PA 5LFAA 3FK6A 2A68F 5AIQA 3REOA 3CJNA 1D1CA 2IT0A 3CMAI 2H6BA 1KU7A 3A0HC 4XLCA 2F4MB 3GYHX 1SVOA 2BV6A 2JSPA 4OIPF 4N9HA 2NS8A 5M5YJ 2H6CA 2DDAA 3HBLA 2GOXB 1O3QA 3QQAA 1G2HA 3B6CA 2KISA 4BKXA 1UJ8A 1MJBA 2MC3A 2GIVA 2M8GX 1VQ8I 3S16J 3BR0A 1Y56A 1MBKA 2NNYA 3O8GA 3D5SC 3IWFA 1WFXA 3V7CA 4WX9A 1BW6A 1NH3A 2Y75A 5B1AH 4C30A 1T33A 1VQOI 5LGTA 4JX6A 3BY6A 3PQJA 3ZMUA 1FIPA 4IJAA 4YG2F 3BR1A 3ELKA 3EYYA 2R7XA 4CCLA 1I50J 1WI3A 1G6NA 3CJQB 5E20A 3FMQA 2K85A 1WRJA 2KZGA 5HNHA 3OR2C 1D0YA 2I5UA 1MBFA 2PMZA 1TWHJ 4EM0B 5D5VB 2XV4S 1S5LC 1SMYF 4AYBA 5J40A 3WGIA 1D1BA 3ZP5A 1GXQA 5KCMA 3K70C 3R4KA 3L2VA 4M3GA 2VPRA 4LK1F 1Z7LA 5IP9J 4XRSA 2MFZA 2QQ9A 2M8EA 3HXLA 1MW7A 1BR1A 4EATA 2ZXIA 2DMQA 1UFMA 4U7BA 1QGPA 2R7OA 1GT0C 4A3BJ 1K6YA 2CUJA 2LF7A 3L2UA 1O3RA 2Y9ZA 4YFXF 4Y15A 4OAYA 1LPQA 1P4AA 2V9VA 2LOOA 3DU5A 1JTXA 1WJEA 1R49A 2MW8A 3JSPA 1MH4A 4RDUA 4N0BA 4G7ZF 3DBLB 4KFCA 3FK7A 1H8AC 4XN3A 5F0HA 1SFKA 5HVQC 3T0YA 1R36A 4H4KC 3LAPA 1T38A 1IV8A 2HTSA 5D5WB 1FZPB 1ZGWA 3AG1H 2V1XA 1OLTA 4E7SA 4IXAA 3O8HA 1FNNA 2L4AA 2M34A 2W7NA 1MBHA 4RM2A 4DYQA 1H9TA 3V8KA 2XB5A 3VOEA 5FKOA 2XGDA 3CMMA 5F04A 3FM5A 2RQPA 1ZGJA 2NRAC 3ZR8X 5C4JJ 2X51A 2AXLA 1BI1A 1G3WA 3ZMVA 2V26A 1GUUA 1QNTA 3W3CA 4AWXB 2NOGA 2IS6A 1DGRM 2BVLA 1VQNI 2X1EA 1BR2A 3J81Z 2G7UA 3H36A 3JSOA 3HDDA 3OYDA 4ZTFA 2VIXA 1J09A 2DI3A 3BG5A 5GADJ 1RR8C 1Z67A 4E7IA 2P4WA 1B1BA 3ZMZA 3CCJI 4GFBA 4YIIA 4BJ5C 3TQNA 1ZLJA 3WHBA 1FYMA 2M0CA 3F8BA 5FLMJ 4ON0A 1F5TA 2EB7A 2K9NA 2MD5A 3F8MA 2W85A 2DOEA 2Y30A 1W7PB 3NQOA 3K1NA 2JQ7A 4C2TA 4BYYA 2IGNA 1FBSA 3K4LA 1UB9A 4PUSA 1OCPA 4HX4A 1R22A 2PEXA 5IOYA 2C6YA 3TOAA 1KYWA 3LA2A 1YI2I 2YU9J 2DK8A 4Y33A 1YYVA 1UELB 1ETKA 1WGXA 1VQ5I 3J80Z 5M5WJ 1QZYA 1QHHD 2H8WA 3OIOA 3TOBA 2RREA 3OWTA 4HV5A 1A6QA 3AG2H 2QEXI 2K27A 3I56I 2E1MC 3V7SA 1E0EA 1B72A 1HKTA 2DA5A 2V9PA 5TJJA 2Q0OA 4Q4ZF 4RMNA 3OMYA 1XGSA 2ZNYA 3RKXA 1XN7A 3A02A 1XSDA 2QSGX 1EH6A 5JLWA 4FX4A 2W4SA 3OYNA 2HYJA 2E1MB 5E3OA 1FYLA 5BMZA 2W25A 2A05A 4G8XA 3LQQA 3FMSA 4Y52J 2IEKA 2HQNA 2NXNB 1FOYA 1T56A 3KP7A 4FCYA 2MA3A 3S93A 2VOPA 2P6SA 4N4OB 1MMNA 2XAFA 1R6RA 3F6OA 4UVBA 3GF2A 2YUSA 3DTKA 4M74A 3PNYA 1ONVA 1G59A 1SAXA 4EJWA 1IXRC 2JK3A 1YX5A 3MZHA 2OA4A 5M3MJ 3JRCA 4ENMA 1VNDA 4B09A 3DPTA 4L0ZB 4XKVA 2BHYA 2OV7A 3K70D 4M6VA 3P9KA 2QA4I 1PVEA 1LDKB 3T8TA 1X2NA 3RJPA 3IH3A 2JRTA 5DYMA 2JT1A 3H9JA 5GP9A 4KNYA 3OIQA 2PN6A 4WXDA 1ZRFA 1LDJA 4AIJA 2FQ4A 3HGYA 5K7HA 4NC6A 1FPQA 2E1CA 4RGXA 3KX2A 3S2WA 5HDGA 3S8PA 3L00A 2VJ4A 2YR2A 3B6AA 4DZJA 5FLVA 5CVJA 3GTMJ 2OU2A 4ZTJA 2DMUA 3WU0A 1R1TA 2A3SA 2FXAA 4NBQA 1G3YA 4A3JJ 3JAMK 4Y17A 3KEOA 1WJ5A 3QPLA 1Y1WJ 3HOXJ 3RSNA 1TWFJ 3F21A 3ZQIA 2OCCH 3MKYB 1K78A 2IJLA 4PJLA 2EFOA 1ZR4A 5IYBJ 1IRGA 2VJ5A 2WY8Q 4KA4A 2VJIA 3PO3J 2E71A 3ZQFA 3SFIA 3I4NJ 2DTZA 1PP8F 1K7AA 3SZPA 2HEOA 3ZQCA 4WF2A 4E7ZA 3HSRA 5EGOB 4FETA 3C3WA 4RAYA 3K4CA 3UNGC 5DUKA 3DTEA 3SZTA 3C18A 4JP0A 1ZYRF 2NYXA 2HZDA 5ICCA 1OMIA 3KFWX 3PIPF 1JGSA 3OYAA 2HNHA 4HF0A 2MLGA 3KZYA 5DD4A 4X0GA 5CYVA 5F64A 1XSVA 1Z21A 4ZZDA 1SMTA 3IRRA 1DU0A 2YX4A 3HL2A 2FMYA 1Q1HA 1SD5A 2EINH 1R5HA 1ETVA 4XORA 3BCBA 3G71I 1W7PD 3LL7A 2O7OA 3DLLF 2L0KA 1TW3A 5FB2A 3DQVC 2CSOA 1LNWA 5AONA 4XL9A 3FXMA 2KIMA 3LOCA 5J8FA 1MJ9A 2MGQA 2ID6A 2M2EA 4FASD 3HHHA 3ZQHA 2RGVA 4CXFA 2ECCA 3JRBA 4G6QA 2R7WA 3OYKA 4XLAA 1YLFA 5ICEA 3CC7I 3KYLA 3VYTB 5FO5A 3OS2A 3WTXC 1UHWA 3CCUI 1JGGA 2F6CA 4LFUA 2ME0A 3R6SA 2XSDC 3H1CA 4U87A 4JX5A 3RQ4A 3F8CA 4A69C 2Y2ZA 3JCUC 4GYGA 4I7HA 2GBYA 4CUGA 2IP2A 3OYIA 4Q48A 3EPZA 5TRDA 1I5ZA 3QU3A 4RB0A 6PAXA 4IQJA 3MD2A 4FX0A 1B8IA 3S3OA 2IS1A 2EA4A 3VB2A 1BJZA 1IZ1A 3FHZA 2QWWA 4I99C 2QYOA 2JA2A 1QU3A 1VI0A 3QODA 4S04A 2QVOA 1RZ4A 1WZ2A 1MKMA 4RB3C 3ECHA 1SD4A 1F1ZA 1BI0A 3OY9A 2NOJB 1MSEC 1WJFA 3HG9A 4JOMA 5M3FJ 4C3HJ 3K4BA 3GZ6A 3EUHA 2VUMJ 2R7SA 3VYUB 1T39A 3W6KB 1WJAA 2STWA 2OQGA 2XRNA 4B3AA 2E5ZA 5LD2C 2E7XA 2HWVA 2O8KA 3LSTA 5LHGA 2HDDA 2DA7A 3R0AA 4PSWA 4L5IA 1N78A 1STZA 4MFEA 2KDZA 1LKXA 5J4VA 1JI8A 1BM9A 2KRCA 2E36A 4PK4A 2EJRA 2Z16A 4AC0A 5E1XA 4WK8F 1KQ9A 1S7OA 4J00A 3JRDA 3TO6A 5E3LA 1NG6A 3FISA 2AXTC 4AVZA 5F0FA 2H1KA 3QPHA 2CUEA 3MMYB 3JRGA 1W0TA 1HC8A 3CO7C 1APLC 2Z99A 2P7VB 4RLQA 1R00A 1I6HJ 1QRYA 2D2WA 2QKLB 2L2OA 2ETHA 2KPMA 1ACIA 1BOAA 1WJBA 3ASOH 3BR6A 4PJJA 4HYEA 1U9NA 2OQRA 2P7CB 2VASA 4GDFA 3SHFA 3QPTA 4Y7NJ 1PUEE 2DDBA 5LGNA 2DOFA 2IPQX 1MZBA 4ZYGA 2VE9A 4YIFA 3KLNA 1BIBA 2VXDA 1OYIA 5EEGA 1XGOA 5IPAA 4M6YA 1W5TA 4R1HA 3EUHC 2KP6A 1MMAA 2L9NA 2EFNA 3MCZA 3OL3A 3PFYA 3OYJA 1P4WA 2CFXA 5DCMA 2K9QA 2FOWA 4YFNF 3ZN1A 2CU7A 3QYBA 4A93J 3M8EA 5LRSA 2XKOA 1W0UA 1J2XA 4FE4A 3AAFA 1B59A 1IDYA 2GIZA 3L1PA 2QSFX 2NNNA 2AS5F 1U0JA 2QQAA 3TL4X 5BPIA 1AKHB 5ED4A 3KYCB 1IGNA 3V42A 4BL0B 3CUOA 1LE8A 4IHXA 1ETWA 3WTSC 4MEXF 4V2GA 5EG0A 3L09A 1FOWA 1G3SA 5K1YA 1R23A 3ZMDA 1V55H 2HDCA 2BW3B 2M45A 1USTA 3ASNH 1GLNA 1TT5B 2ACJA 1WJCA 4B48A 4A12A 4ENKA 2GLOA 4K2EA 3H92A 4B3XA 1V5EA 3OYHA 3JRAA 4ZDOA 3M9AA 3OYGA 1E3PA 4UUSB 1MMGA 3KCCA 3CCSI 1ZELA 2PLYA 1YS7A 5FFZA 2JWTA 2JVHA 4BY1J 1XCBA 3RZOJ 5M5XJ 1T0FC 4MQVA 3OV8A 2MH9A 1XG1A 1OPCA 4LLGF 4CA0A 1MDMB 5FRMA 4XLPF 4EGZA 3TO9A 1FMVA 3CQZJ 4ZDPA 5DDGA 1V4RA 4IVNA 3N97A 3E1SA 2LKXA 1FEXA 1ETXA 3QOEA 4HOBA 1UAAA 3BPVA 4D9JA 1NG7A 1AHDP 5KNLA 1FTZA 4GRIA 4CYCB 2G9WA 4MGRA 1A04A 1MIJA 3LA3A 4C2MJ 1RR7A 2Y0MA 1IDZA 3FKJA 1GV2A 1FX7A 5HLHA 3ZPLA 3W2VA 2ECBA 3LWFA 1QVUA 5CVRA 3I9V2 3IL2A 1OR7A 3BROA 2CFOA 3BCAA 3HZJA 3TW6A 5C3EJ 2IAIA 2ZMEA 4ZYHA 2V1DA 2EQRA 2K5CA 3ULQB 1QQIA 1XC5A 1HDPA 4PDKA 3K2AA 5HLTA 3MKLA 4BE0A 4EJVA 2COBA 2E1OA 3JREA 1Y0NA 2CUZA 1S3JA 2BE5F 3I53A 4XRFA 4IQ4A 4CCMA 1YX3A 4CDGA 4LG0A 2DO7A 2LSOA 3TEDA 2FX0A 1PYVA 2EZIA 1ERDA 2Z3YA 3L2QA 2NAZA 3BR2A 3BQZA 2XF6A 2A6EF 2XC7A 2K3FA 3DBHB 4U0WA 1SAUA 1IJWC 4C2UA 1FY7A 2TCTA 1RNLA 2KLOA 2DT5A 2MLKA 1LVAA 3DWLE 3DU6A 3H5RA 5F08A 1TNTA 3OS1A 1E3OC 2V79A 2EZKA 3DBRB 1LFUP 1XGNA 1MBEA 3C1DA 4EM2A 4ZYAA 2B0LA 1MSFC 2P0WA 2UXXA 4S05A 5CJ9A 1DDNA 3H0DA 2XAJA 1OCZH 1JUMA 4IF4A 2L7FP 1Z3YA 4A3EJ 4ESFA 1OR7C 1HW2A 3FIWA 1HA8A 3PL8A 4LJZF 4BAYA 3DP7A 4V2FA 1JKPC 2ZMEC 1BN5A 3CLQA 1ZTRA 4ZDLA 1BA5A 2WV1A 2R92J 2O0YA 3F22A 4EGYA 2VODA 3OYBA 1BI2A 5EJCA 5JFRA 3IV5A 3RYPA 2ELJA 3TDUC 2AO9A 4EEFG 4AIHA 1R7JA 4G12A 2L02A 3OYMA 3SFZA 4P96A 2M1BA 4HLXA 4HLYA 1I27A 2JUCA 4RLFA 5FKMA 1CF7B 1TQPA 2FBIA 1J5YA 1EKEA 4HDUA 3WHCA 2FSWA 3MVPA 2JMWA 1YRNB 2VB6A 2FBKA 1HF0A 1HSJA 3D1NI 3MN2A 1RKWA 2Y9YA 3LSIA 5FRNA 3J7YJ 3GWZA 1OFCX 1IN5A 4ZYDA 3MZYA 4O5VA 2Y48A 1X1CA 4MTEA 2NVYJ 5J1RA 1I39A 2WA0A 1MMSA 3QU6A 2DFHA 4JQFA 2P8TA 2Z5UA 3AFHA 4LG3A 2GXGA 3HOUJ 1RESA 1BW5A 2DT6A 1LDDA 5KVRA 4A3MJ 1ZLKA 1W5CC 4OMZA 2CQQA 4CO8A 5CQGA 4A5NA 4ENNA 1JHHA 4L9TA 4M73A 2F5VA 1WSUA 3LSRA 2EA2A 1MD0A 2ZSHB 5FROA 4IO9F 4BBSJ 4Z6YA 3M4OJ 2VKHA 2EIJH 4LK0F 1BL0A 2IBDA 2X6WA 3S3MA 4HZFA 4NQWA 3BG9A 3WTWC 4OAZA 2W48A 3FXLA 4UHTA 4P55A 2WB1N 2XAGA 2XAHA 3OYEA 4LD5A 4IHVA 1I3AA 1G4DA 2V9KA 2CV2A 4UXNA 1XS9A 2RDPA 2TRTA 1FP2A 3OYCA 4XONA 3BTLA 3QP6A 4QPQA 2OBPA 1ZGAA 4WWCA 2BVMA 2O5RA 2F5FA 3R61A 2HOTA 4HRIA 4BQAA 1HDDC 1X4PA 4BQNA 3K4JA 5EDNA 3EUKL 2PFBA 3ZQQA 1IF1A 3G73A 2K86A 3A4CA 4UVCA 1IW7F 2QLZA 4DYRA 4DNCA 1OCTC 3EYIA 3S14J 1H0MA 4A0XA 3BC8A 2XROA 1YHQI 1WH5A 4KJZA 2H1LA 1P9QC 2DFIA 3KZZA 2AHQA 3JRIA 2HOEA 3WE3A 3O2PE 4E7KA 5E8IA 2EV6A 3TKYA 1L3LA 1FOKA 2UWMA 2D45A 1SD6A 2LVSA 2M7BA 3M8JA 4NUBA 2V6EA 2R7TA 4P5OA 3F9KA 4AUXA 9ANTA 1YITI 4AIKA 2HFHA 2KJCA 4KYWA 3JW4A 2M4KA 2PMHA 4RGSA 2L7KA 4E7JA 3CDHA 2ZXHA 4NDLA 1XB4A 4UUTA 5E17F 3M7GA 1X1BA 3FBIB 1J0RA 3HSFA 4E7HA 2X6OA 4G7OF 1F9NA 2L5QA 1WHUA 2B63J 3J7AY 2Z2SB 2A07F 2L9RA 2IA1A 4BHPA 1HKSA 4NQWB 5E3MA 1AOYA 1D5VA 3IHUA 4II3A 2ZJPF 1X2MA 2EPFA 2FRHA 4RAZA 3BZ6A 1M1EB 2X0LA 5J4YA 3H35A 2E34A 1TLHB 2X4HA 1ITYA 1PUFA 4U0VA 2HPIA 1HXDA 3HB9A 4HQEA 3MWMA 3MAJA 5LHIA 4OIOF 2L9SA 3E5XA 2ICWG 2CS3A 2WC2A 1MBJA 4DBRA 4X6AJ 1TZLA 1X3ZB 5EF6A 2XPUA 2Q2EA 2XPVA 2Q1ZB 1O4XA 4PJNA 5GAEJ 5JHUA 5FD6A 4UV9A 3L2RA 5IP6A 3LAJA 4IX7A 3HYIA 2X1DA 2MD0A 4RAGA 3H3VK 1TWCJ 3WTVC 2E2HJ 4DIQA 2KRFA 4R8HA 1LVKA 5HODA 3KP3A 3VEPA 2EZLA 4BXXJ 4MQ9F 2R5ZA 5JR3A 2L01A 3FBNB 2DAOA 4XSXF 2R93J 1JXSA 2RVCA 3ABTA 4XQFA 1FYKA 3K1PA 2IVMA 4DOZA 3HIFA 3HRUA 2LKPA 2GXAA 5H6QA 2ME6A 2DJIA 3WE2A 1A31A 2GXBA 3QPSA 3SDBA 2LR8A 3ONQA 5ILUA 2X9DA 2VBZA 3GXOA 1UHSA 3MFKA 2DA4A 4MIMA 4CZZA 3LSPA 3ML6A 2E1NA 4BJ6C 4CCNA 2ELHA 5B66C 1MNDA 2KHMA 5A2QK 2HXIA 4MEYF 3GW2A 1XMKA 2BY1A 2F4IA 1JTYA 2M0MA 1IG7A 2XGEA 4PZJA 4E7LA 2JA5J 2GA1A 5E1WA 5JI6A 2XGCA 4N9IA 2WV0A 2ZO4A 3RKYA 2JUGA 5DM6F 2AQEA 3ABUA 3S1MJ 2VONA 2YPRA 2A5WA 4EJTA 1X3UA 1B9NA 2X48A 2GOMA 4WCGA 2H09A 2W82A 3G1OA 2WAQN 1TTYA 5LEJA 3LSKA 5L3DA 5L3EA 2LNBA 3HM5A 1B72B 4AM3A 2OTJI 2R5YA 4MTDA 1HQCA 2F48A 2ISZA 2NS0A 1BBYA 4OINF 1GVDA 1A35A 2DU9A 3NARA 2UV1A 4D7MA 1VQPI 2PJPA 2QCOA 4KUMA 4E4HA 1YQAA 2YS9A 1AWCA 3RYRA 1YFHA 3H9QA 2HGCA 5FFXA 2OCEA 3IAM2 3GTLJ 1D8JA 2Y0SN 5K5QA 4F52A 1JKOC 2HOSA 2HU9A 3HEFA 1REPC
chains in the Genus database with same CATH topology
1D1AA 3IAS2 1D0ZA 4N4NB 4DJAA 3VDXA 2VXDA 3HPHA 3FDYA 3PNTA 3EUHC 2KP6A 1MMAA 2L9NA 4B44A 3DPUA 3OL3A 5JHFA 3PFYA 3OYJA 2MC4A 2LG4A 3RCOA 2M4GA 3QYBA 3BG7A 4XOPA 2IGOA 2QKMB 3LFUA 3PSIA 3HOTA 5TGTA 5LFAA 4CSWA 5CPRB 4BEHA 3CP8A 4AU7A 4CZCA 1D1CA 1U0JA 3TL4X 4XLCA 2V6EA 3V42A 2JSPA 4BL0B 2VQCA 4XLEA 3N05A 2W1OA 3VSKA 2GOXB 2WAQA 4BXFA 2MYSA 3S3NA 4KITB 4NNJA 2BW3B 1Y56A 1GLNA 1V5FA 3D5SC 3IUOA 1WFXA 2Z1DA 1KONA 1WJCA 4B48A 4BDYA 2ZFUA 2R4GA 2WAFA 4C9YA 4C30A 2X6YA 4B3XA 1V5EA 3OYHA 4BE2A 4ZDOA 3LMMA 3S32A 3OYGA 3AKZA 2Y0SA 1MMGA 4XKCA 2R7XA 2WADA 1ZELA 2WBMA 3OL4A 4CCLA 2VQLA 2LBFA 2JVHA 3CJQB 1T0FC 3QYFA 3FHNA 5FRMA 4CA0A 5HNHA 3OR2C 3OYLA 1D0YA 2PMZA 1FMVA 3HC7A 4ZDPA 3VWBA 4HG2A 2XF7A 1YE9A 3D5LA 2KL4A 3E1SA 4AYBA 1D1BA 5KCMA 3QOEA 3K70C 3L2VA 3IP4B 2IGMA 1UAAA 4D9JA 1NG7A 2LC2A 1Z7LA 2DOAA 5KNLA 2MFZA 4DGWB 3HXLA 4GRIA 1MW7A 1BR1A 4EATA 4IZZA 2ZXIA 1X1DA 4U7BA 2R7OA 4XOTA 3ZRGA 1K6YA 2CUJA 4QPOA 4F92B 3L2UA 2LY2A 3FKJA 4OAYA 1WJDA 3KEYA 1W36C 2LOOA 3DU5A 1V5GA 1WJEA 5CKTA 3W2VA 2R7VA 2AQFA 3RTRA 2M7AA 3I9V2 3QYEA 4F91B 2CFOA 3BCAA 2Q2EB 4XN3A 1LFPA 1SFKA 3MKZA 5HVQC 2K5CA 2OC6A 4H4KC 3DKXA 4PFOA 3VYRB 4KT6A 4IKFA 1DQUA 5HLTA 3DTIA 4BE0A 2RQQA 1DGWY 1OLTA 4E7SA 2CUZA 4P1WA 3E0JB 4IQ4A 4CCMA 2CH0A 1YX3A 2W7NA 2VKDA 3C2HA 3LSHA 4RM2A 1Y6IA 1PYVA 1ERDA 3L2QA 5HNFA 1EA3A 3CMMA 2XF6A 3PUBA 2XC7A 4F93B 3ZR8X 1SAUA 1FMWA 3HPGA 2X51A 3CESA 3H5AA 4C2UA 4F3QA 2V26A 2KLOA 2VL8A 3PSFA 4LITA 3VSLA 4XM3A 2VPLA 3DWLE 3DU6A 3W3CA 3H5RA 2IS6A 2IS2A 3A1YA 2DCEA 3CF2A 3OS1A 1DGRM 2BVLA 3M1CA 4HSRA 2X1EA 1BR2A 4ZYAA 3I3LA 2HQAA 3PNVA 4LIUA 3OYDA 2P0WA 4F55A 3MKWB 4ZTFA 2VIXA 1J09A 2LYCA 3LSGA 3H0DA 2PJRA 2KZVA 4YEJA 1MMDA 2V7FA 2LRDA 3NWSA 4PFPA 4XKBA 4E7IA 1Z3YA 3ZCOA 1OR7C 1HA8A 2R7QA 4BJ5C 3PL8A 3OS0A 2V4JC 2DXIA 1S9HA 4ZDLA 2XF5A 4R79A 3C2GA 4C2TA 2IGNA 3K4LA 3OYBA 1AA7A 4PUSA 3ZGKA 3GBGA 2ELJA 4CH7A 3BLYA 5HOOA 2K9LA 4Y33A 3OYMA 2UUZA 1UELB 4E6KG 4RLFA 3K4NA 1QHHD 2RREA 3OWTA 3K4KA 4KISA 3U21A 3K4MA 2VB6A 3PJRA 2E1MC 1E0EA 2HVQA 4XR6A 4RMNA 3OMYA 3LSIA 5FRNA 3SYTA 4J01A 4D1QA 4XNFA 1UG0A 1X4OA 1X1CA 3K10A 2WA0A 4BU2A 4JQFA 2W4SA 3OYNA 2E1MB 3AFHA 4BQOA 4LG3A 4BUPA 4XLFA 4BQQA 2DT6A 3AL0C 4ITVA 3OIPA 5CQGA 2F5VA 3S93A 4G6TB 4N4OB 1MMNA 1R6RA 2ZSHB 5FROA 3DTKA 3EUAA 2VKHA 3PNYA 1N75A 2A6TA 3TMOA 1MNEA 2X6WA 3ZXSA 3TBIA 3S3MA 1G59A 1N77A 2I8DA 2LH9A 4OAZA 1YX5A 3BG6A 3OYEA 2RNGA 4BEHB 2VXZA 2V9KA 4BE1A 2CV2A 3DPTA 4XMYA 4XKVA 2WAEA 3OYCA 4XONA 2OV7A 2MABA 3OYFA 4QPQA 3K70D 3VYSB 4HNUA 1LDKB 2BVMA 2O5RA 4HRIA 4RM3A 1X4PA 4BQNA 5KHDA 3H9JA 3RPUD 3K4JA 3OOUA 3OIQA 3EUKL 3ZQQA 3DLAA 2DT7B 3KX2A 3A4CA 3S8PA 1W36D 1TT0A 2VJ4A 3BC8A 3K6GA 1Z3XA 4Y4RA 4KJZA 1P9QC 1G8XA 2BW3A 3OR1C 4ZTJA 3W2AA 2LBFB 4E7KA 4ZJZA 3L2WA 2UWMA 4II2A 1WJ5A 2M7BA 3M8JA 2KQRA 4LIVA 2E5NA 4NUBA 4P5OA 3F9KA 2HVRA 4HSTA 3RSNA 2R7TA 2WY7Q 3DPLC 2X1CA 2M4KA 3MKYB 4PJLA 4XLHA 2L7KA 4E7JA 4ANJA 2VJ5A 2ZXHA 2WY8Q 4BACA 2VJIA 4BJTA 1T95A 1X1BA 3FBIB 4OWRB 4Y3OA 4E7ZA 4B47A 4E7HA 2XSJC 3UR3C 3LSMA 1DP3A 4FETA 2L5QA 3A2KA 3K4CA 3UNGC 4PJMA 2Z2SB 3DTEA 4CCKA 3J7AY 2HDWA 2HZDA 4NQWB 2WB1A 4HPQA 3OYAA 4II3A 2HNHA 3HKZA 1IRXA 3DKYA 3CJRB 4X0GA 1Z21A 3H35A 3HL2A 4XORA 2KDOA 2M3AA 4BS9A 3BCBA 2HPIA 3CP2A 3LL7A 4PSXA 4BGDA 2L9SA 1X19A 5CQEA 1BOBA 2CS3A 3DQVC 4DBRA 1TZLA 2CW8A 2CV1A 4XL9A 4NC8A 1BR4A 4FASD 2Q1ZB 4MLOA 4PJNA 2CW7A 4ZC3A 3L2RA 3D5RC 2R7WA 3OYKA 4IX7A 2K9MA 2X1DA 2MD0A 4XLAA 2CMPA 3KYLA 3H5NA 3VYTB 2XAUA 4HNTA 4DIQA 2IS4A 3OS2A 2F6CA 1LVKA 2R7UA 4YRVA 4HEA2 4U87A 1PJRA 3RQ4A 4NC7A 3FBNB 3W2WA 2HVSA 2E60A 4CUGA 2XDVA 3OYIA 3EPZA 3SEZA 1X1AA 2VQGA 4XQFA 4IQJA 2OUMA 3MD2A 3S3OA 4DOZA 2IS1A 4YELA 4DBQA 2PJRB 2DJIA 2JA2A 4XKWA 1QU3A 3QODA 3NWTA 3SDBA 3ONQA 2VLAA 3AL0B 4XN0A 2X6XA 2V1NA 3OY9A 2NOJB 1WJFA 3HG9A 4BJ6C 4JOMA 4CCJA 4CCNA 1MNDA 2KHMA 3H9GA 3K4BA 4BDZA 2LREA 2R7SA 2KMUA 2F4IA 3G2BA 2M0MA 3VYUB 2R7RA 4E7LA 4B43A 1WJAA 5LD2C 2E5ZA 2JUGA 2K3PA 2IXSA 2ZSIB 1D0XA 2AQEA 4PSWA 2CV0A 2W00A 2X85A 1N78A 2A5WA 1LKXA 2GOMA 1JI8A 2KRCA 4PK4A 2W82A 2Z16A 3HOSA 3SZGA 3LSKA 3HUGB 4J00A 2VQHA 1NG6A 4AVZA 2VJJA 3MMYB 2UV1A 2IGKA 4RLQA 3DEEA 1VZ0A 4E4HA 2QKLB 2L2OA 1QHGA 2FUG2 2JVGA 2KPMA 2KRHA 3H9QA 3CZ6A 4PJJA 1WJBA 3IAM2 2LY1A 4F52A 4CCOA 2VASA 2HU9A 2HPMA 3SEQA 2BOLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DGR M;  1DGW Y; 
#chains in the Genus database with same CATH topology
 4KIC A;  3T1B A;  2VKV A;  3IAS 2;  3RPQ A;  4DZP A;  5L3C A;  1SFO J;  3KP4 A;  3PNT A;  2EH3 A;  4WXC A;  3HRM A;  2HZT A;  2VN2 A;  2OTL I;  2MC4 A;  2LG4 A;  4CIC A;  1OCO H;  3W6J B;  2R7Z J;  3K1M A;  2F2E A;  4L9J A;  5GTH C;  3WTY C;  3OOP A;  2IGO A;  2K7L A;  2ZCW A;  2JRM A;  2VC0 A;  2EIM H;  4RGU A;  2BYV E;  3PSI A;  4HV6 A;  5EZH A;  3HOT A;  5TGT A;  4CSW A;  4B8X A;  4BEH A;  1R4N B;  2QUF A;  1RI7 A;  3CUQ A;  3E7L A;  3RPU A;  1G3T A;  3B02 A;  2KIQ A;  2XRL A;  3E3V A;  3A01 A;  1ZAO A;  1S8N A;  3HGG A;  3JTG A;  5JVG F;  4XLE A;  4UNO A;  3GTK J;  3N05 A;  4XRS G;  1SC7 A;  4KDP A;  3VSK A;  3G1M A;  1FSE A;  1YIO A;  2A6H F;  4LOC A;  4M9X A;  2MYS A;  5F0C A;  3H0G J;  4I0A A;  2DPD A;  1TC3 C;  1NK3 P;  1V5F A;  1TQI A;  3IUO A;  1KON A;  4BDY A;  2DMT A;  2ZFU A;  4I0B A;  2R4G A;  4HX8 A;  4C9Y A;  2FNA A;  1ETY A;  4JYK A;  3CCV I;  2E7W A;  2RV8 A;  3CDI A;  1LUJ B;  3F72 A;  2K4B A;  3AKZ A;  1K78 B;  4XKC A;  2O03 A;  2WAD A;  3GTO J;  1R58 A;  3JAM Z;  5FD5 A;  2LBF A;  3HOW J;  3BJO A;  3K7A J;  2VBY A;  1K61 A;  1XDU A;  2OAZ A;  1ZKG A;  3KP2 A;  3KLO A;  5B3S H;  1VTN C;  2CQX A;  1Z6R A;  1YE9 A;  1JJ8 C;  3PUF A;  2KL4 A;  2L7M P;  5CVV A;  3DXJ F;  3BTC A;  4X1E A;  3WOD F;  2IGM A;  1QA6 A;  4GXO A;  2DYS H;  2EIK H;  1O3S A;  3ZOB A;  4DGW B;  5B5E C;  3CUQ C;  5F1R A;  1EF4 A;  2BY3 A;  4GYI A;  1IN7 A;  1W4M A;  1X1D A;  4FTH A;  4M3F A;  4XOT A;  3ZRG A;  5IOZ A;  1T8I A;  2P5L C;  4FIS A;  4PCQ A;  4DYC A;  4D5F A;  3G1L A;  1LQ1 A;  4OU0 A;  3ERM A;  5C44 J;  2XGX A;  3ZQG A;  2FNP A;  3WGG A;  2R7V A;  1QO0 D;  3RTR A;  2J5O A;  2M7A A;  3QYE A;  3Q3S A;  1VQ7 I;  2F5E A;  3FXR A;  3RQI A;  5IYD J;  5D4R A;  2CO5 A;  3B73 A;  2NVX J;  3ERE D;  1Q1V A;  3G4S I;  4ZZL A;  3MKZ A;  2ZJ2 A;  2OC6 A;  1KQ8 A;  4ETS A;  1YOV B;  4PFO A;  4QSH A;  2CJJ A;  2A69 F;  2MSY A;  5B1B H;  4IKF A;  1GDT A;  5FLX K;  3BTI A;  1Z91 A;  1FOX A;  1J9I A;  1OQY A;  3ZMT A;  3HRS A;  2CH0 A;  1FJL A;  4QTR A;  2VKD A;  3C2H A;  2GWR A;  3LSH A;  4KN7 X;  3TDZ C;  1EJ9 A;  2XVC A;  1FLI A;  1R5I D;  2DA3 A;  2FEZ A;  3PQK A;  1LEA A;  2I10 A;  3E6C C;  1EA3 A;  1YW8 A;  2QQ8 A;  2BZT A;  2KKO A;  3PUB A;  3BTJ A;  1H88 C;  3CO6 C;  3CJT B;  3PIO F;  1FMW A;  3G3Z A;  3H5A A;  1B8I B;  1XMA A;  4D5C A;  4F3Q A;  2WTE A;  3GX4 X;  2VL8 A;  1S72 I;  3VSL A;  4LIT A;  5GPA A;  1FTT A;  4A2U A;  3A1Y A;  4G7H F;  2DCE A;  3CF2 A;  4FQG A;  2H27 A;  1YJ9 I;  4HSR A;  2FQ3 A;  3I59 A;  5DS9 A;  2L54 A;  1XD7 A;  3PFI A;  4I01 A;  3HOV J;  3PNV A;  2E2I J;  1V54 H;  4F55 A;  1Y8Q B;  4XK4 A;  1A5J A;  1D5Y A;  4MO7 A;  4A5M A;  2PJR A;  1S6L A;  1T2K A;  3NWS A;  2CQK A;  4PFP A;  3QRF F;  4IHS A;  2NVQ J;  1ON1 A;  3S1Q J;  1U9O A;  2R7Q A;  5L3F A;  3VOD A;  3OS0 A;  1VQL I;  1BC8 C;  1RKT A;  1LFB A;  3WG7 H;  3IH4 A;  3HJE A;  1N25 A;  2DXI A;  5J47 A;  1QVT A;  5GPC A;  3M07 A;  1ZH5 A;  2FD5 A;  1FBU A;  4XSZ F;  5C4X J;  1Z0X A;  4EV0 A;  3S17 J;  5LGU A;  1ODD A;  3C2G A;  4R79 A;  1T6S A;  1AA7 A;  5E18 F;  4A6D A;  1WCM J;  4LB5 A;  3GBG A;  1ZG3 A;  3CCE I;  5IP7 J;  1FWZ A;  4DW6 A;  5K7F A;  1XCV A;  3CME I;  3V8L A;  1IC8 A;  1OYW A;  3ABL H;  1P7J A;  3DF8 A;  3HRT A;  2JN6 A;  1EH8 A;  3KIO A;  1OCC H;  2EFW A;  1VF9 A;  1KYZ A;  1Z77 A;  2Y69 H;  3M3Y J;  1BI3 A;  3H3U A;  3TP0 A;  2DA2 A;  3Q0V A;  3LA7 A;  3J7Z I;  4M3B A;  1FSH A;  3F8F A;  3GCM A;  3BG3 A;  3IWZ A;  2PBI A;  3I0T A;  3L2C A;  3K4M A;  2R7D A;  3Q0U A;  3JRF A;  1RUO A;  2QBY A;  3HUG A;  3OSF A;  4XIC A;  5L3B A;  1CQT A;  5ERI A;  5ICF A;  1UG2 A;  3GUD A;  1T98 A;  3SYT A;  2ZXJ A;  2COM A;  4D1Q A;  4J19 A;  4J01 A;  1GHC A;  3QP5 A;  1UG0 A;  1X4O A;  1TBX A;  3BT9 A;  1H9G A;  2CQN A;  4A3F J;  5CLS A;  1Z9C A;  3Q9V A;  1IN8 A;  3BJ6 A;  2ZB9 A;  1U8B A;  2HR3 A;  3S15 J;  1P7I A;  2YX7 A;  2FF4 A;  4HAM A;  1U5T A;  3TW7 A;  3SDG A;  1H89 C;  3AL0 C;  2W24 A;  4IRH A;  3GVA A;  4P9F A;  4L18 B;  1LB2 A;  5DCM B;  1ZG5 A;  2OZU A;  4CHU A;  2CW0 F;  3ABM H;  1WH7 A;  3I64 A;  1N75 A;  2VC1 A;  2A6T A;  1MNE A;  2M30 A;  3RDI A;  1N77 A;  2B9S A;  2I8D A;  2LH9 A;  3GLX A;  3RIR A;  4BXU A;  2VXZ A;  1R1U A;  3FWE A;  3HKZ N;  2NVT J;  3E97 A;  3QAH A;  2WAE A;  4JBA A;  1IRF A;  3C2B A;  3ISP A;  4U0Y A;  1Y1V J;  3BPX A;  1LE8 B;  3KET A;  3VYS B;  3CF5 F;  3BDD A;  5E3N A;  3S1R J;  4D7N A;  4XBF A;  2ZJQ F;  5EG0 B;  1UMQ A;  4LGW A;  3EET A;  2P6T A;  1S7E A;  3A0B C;  2JPC A;  3RPU D;  2FU4 A;  4BY7 J;  1HBX G;  4IOC F;  3DLA A;  4HF2 A;  3F3X A;  1QPI A;  3COA C;  1Y39 A;  1A36 A;  2R3S A;  2M5W A;  5HLI A;  1HLV A;  1TT0 A;  2KIF A;  1Z3X A;  2DA1 A;  4Y4R A;  1XPX A;  1XSX A;  5DM7 F;  3ZQL A;  3OR1 C;  4A0Z A;  3CLO A;  3S2H J;  3KE2 A;  1ORK A;  2JPB A;  3W2A A;  2XKP A;  1WKM A;  1U5T C;  4FT8 A;  3L2W A;  2D5V A;  3ZN0 A;  5IY5 H;  1A6I A;  2KQR A;  2E5N A;  2HVR A;  4L5J A;  1GV5 A;  2X1C A;  3SQN A;  4Q5S F;  4YFK F;  1R1V A;  4XLH A;  2P5K A;  1W5S A;  2DOD A;  2OZ6 A;  4E70 A;  4B4C A;  4ANJ A;  5TIS C;  4BJT A;  2DFF A;  4IRI A;  1DPU A;  4NB5 A;  2DLL A;  2F4O B;  1JJ6 C;  4HW0 A;  3FZV A;  1Y0U A;  5ILV A;  4Y3O A;  4OWR B;  2XSJ C;  3UR3 C;  1K83 J;  4WXH A;  3N4M A;  1TNS A;  4HA8 A;  1MNM C;  4I76 A;  4PJM A;  1TQM A;  4CCK A;  5HS7 A;  3FX3 A;  1AU7 A;  1IXC A;  1ENH A;  2WB1 A;  4ESJ A;  4HX7 A;  4HPQ A;  1ZHF A;  4GGG A;  2KFD A;  3DKY A;  4Z2Y A;  1YW7 A;  2NVU B;  3F0C A;  2HOA A;  4KIB A;  1USS A;  2B7E A;  1QZZ A;  5IT3 A;  2ZBK A;  2KDO A;  3BR5 A;  4UB8 C;  3SXY A;  1L0O C;  4BS9 A;  2ZME B;  3E5U A;  3CP2 A;  4NHJ A;  3ROU A;  5CQE A;  1VQ4 I;  5D6F A;  1BOB A;  2FJ1 A;  3I55 I;  2CW8 A;  1RPW A;  1YW9 A;  4A3G J;  4LG0 B;  1OKR A;  2CW7 A;  4ZC3 A;  1KGS A;  3TO7 A;  1VQ6 I;  3VPR A;  5LBQ A;  4I6Z A;  1EH7 A;  2K9M A;  2CMP A;  3IH2 A;  3H5N A;  3ESW B;  4A3D J;  4HNT A;  2IS4 A;  5H20 A;  1POG A;  2K4J A;  4ZYE A;  5J3L A;  1RET A;  2O61 A;  4L0Y B;  5IT9 Z;  4M6X A;  2R7U A;  1KU3 A;  3FKI J;  4YRV A;  4HEA 2;  1F43 A;  3DV8 A;  1JKQ C;  2BXY A;  1P2F A;  1MJA A;  3HOY J;  2GA2 A;  2QQB A;  2HVS A;  1ULY A;  5ILS A;  4EJU A;  3HHG A;  3SEZ A;  1HST A;  2JA7 J;  1YJN I;  3FXJ A;  1X1A A;  2HS5 A;  5HDK A;  2VQG A;  2OUM A;  1C0W A;  1J7K A;  3KP5 A;  2GQQ A;  3J81 K;  3CD6 I;  3ECO A;  1IAW A;  4YEL A;  3X2Q H;  1XMX A;  2EFQ A;  3KZI C;  2DJN A;  4XKW A;  1YS6 A;  3IC7 A;  3NWT A;  2K40 A;  2R7F A;  4LB6 B;  4XN0 A;  2VLA A;  2CG4 A;  3L7W A;  2L7Z A;  1KU2 A;  2VT2 A;  3D0S A;  3GO5 A;  1Z05 A;  3LNQ A;  1IN6 A;  4CCJ A;  3H9G A;  1MBG A;  3I71 A;  4RGR A;  5J1U A;  3T8R A;  4BDZ A;  1XTA A;  4ZH4 F;  2LRE A;  2KMU A;  3GTJ J;  1EV7 A;  3G2B A;  4RAF A;  2R7R A;  2ID3 A;  1TL8 A;  2BHZ A;  1E3H A;  2NS7 A;  4QLC U;  4H0E A;  2IXS A;  1W7P A;  2K9S A;  2XB0 X;  2CV0 A;  2W00 A;  3FXU A;  2DQL A;  2X85 A;  3WGH A;  3J80 K;  3WTZ A;  5BNG A;  1B9M A;  2O8X A;  3I54 A;  3KP6 A;  3SZG A;  4M9S A;  1FIA A;  5F1J A;  1RRJ A;  4AID A;  2VQH A;  2G0E A;  3E6B A;  1IN4 A;  2FA5 A;  4L9N A;  5D8L B;  2BEO A;  4XRM A;  3RKW A;  2IGK A;  3DEE A;  1VZ0 A;  2O6G E;  5GTI C;  1QHG A;  4I02 A;  2FUG 2;  2JVG A;  2KRH A;  2QF7 A;  2DW4 A;  3F8N A;  1TWG J;  3FXO A;  4EQQ A;  3GFI A;  3KPH A;  3HTU A;  2Z9O A;  2E2J J;  2Y31 A;  2PMZ N;  1Z7U A;  2CQ7 A;  1WVR A;  4N4N B;  3KEQ A;  4DJA A;  5FKN A;  3VDX A;  3BJA A;  4XID A;  3WU1 B;  2K02 A;  1FC3 A;  3RZD J;  4AYB N;  3FDY A;  1SVL A;  1SFU A;  3DPU A;  3GTG J;  4C3J J;  3ZQ7 A;  1U2W A;  4HNV A;  4A3K J;  2BY2 A;  5KAF C;  1P6R A;  1K4S A;  1JUP A;  2EZH A;  2OPT A;  3LFU A;  1KQ0 A;  3PO2 J;  1LEB A;  5CPR B;  2VKE A;  3CP8 A;  4IL6 C;  4AU7 A;  4CZC A;  3S1N J;  4OOI A;  1U3E M;  1XDS A;  5J1Y A;  2LK2 A;  2HYG D;  4F7Z A;  4FHT A;  1K4T A;  2VQC A;  4RA2 A;  1IUF A;  5FJ8 J;  2W1O A;  3GZ5 A;  1WPK A;  2WAQ A;  3P7N A;  4BXF A;  3S3N A;  1O57 A;  3LFK A;  4UVA A;  1RUN A;  4KIT B;  4NNJ A;  5HS8 A;  2WWY A;  4M9Z A;  4LMY A;  1O7L A;  2OD5 A;  3CCM I;  3JTH A;  3R60 A;  1K79 A;  5D4S A;  4BHC A;  2Z1D A;  3PM1 A;  2CGP A;  3A03 A;  1WQ2 A;  2WAF A;  3Q5F A;  4QIW N;  2JTV A;  2X6Y A;  3K2Z A;  2QZ8 A;  3Q0W A;  4JX4 A;  2MH2 A;  2JJ7 A;  4BE2 A;  3LMM A;  3S32 A;  4Y13 A;  2LLK A;  3P9C A;  3M8F A;  2Y0S A;  3FXK A;  5AIP A;  1I1S A;  2WBM A;  3OL4 A;  2BXZ A;  2VQL A;  1PP7 U;  2STT A;  3QYF A;  3NRV A;  3L9F A;  3FHN A;  1U8R A;  2CUF A;  1KU9 A;  3GFJ A;  3OYL A;  1GVJ A;  3KYD B;  5J6X A;  5K5O A;  3RI4 A;  1R9T J;  3CCL I;  2PMU A;  3HC7 A;  5EEA A;  5FKL A;  3WU2 C;  3VWB A;  2DFE A;  4HG2 A;  2XF7 A;  1ZG1 A;  3D5L A;  1R71 A;  2BGC A;  3OSG A;  4C3I J;  1ON2 A;  3FM3 A;  4KIG A;  4MHG A;  4QWQ A;  3IP4 B;  2LC2 A;  1TWA J;  2DOA A;  2VBW A;  2ZXW H;  4I2O A;  3GEZ A;  3EQL F;  2LD5 A;  4V19 K;  5EGO A;  3GFL A;  1W1W E;  4XLN F;  1ZR2 A;  3MQ0 A;  4IZZ A;  1B4A A;  4HDV A;  3P9I A;  1SAN A;  4QPO A;  3K69 A;  5H6R A;  4F92 B;  4JK1 X;  2A61 A;  1I6X A;  2EFP A;  1PUF B;  2LY2 A;  3F6V A;  3V8J A;  2A5Y B;  1E2X A;  1WJD A;  3KEY A;  3DEW A;  1W36 C;  1V5G A;  3MZ8 A;  5D8K B;  5CKT A;  2AQF A;  2ESN A;  5EZG A;  4EVI A;  3WTT C;  1VFC A;  4HF1 A;  3K0L A;  4F91 B;  2JA6 J;  4KMF A;  1XX5 A;  1UHM A;  2Q2E B;  1LFP A;  2KJB A;  1X58 A;  3JR9 A;  2GZW A;  4DQ2 A;  5BOX A;  3DKX A;  3BR3 A;  3DEU A;  1D8K A;  3VYR B;  2JSC A;  2DMP A;  4KT6 A;  1DQU A;  2ZFW A;  2ZJR F;  1I3Q J;  4IOA F;  4RBO A;  3DTI A;  4G6D A;  2D1V A;  2RQQ A;  1DGW Y;  2LP0 A;  1VQ9 I;  3BOQ A;  4P1W A;  1OIS A;  3E0J B;  1ETQ A;  2HKO A;  4KMU X;  2DN0 A;  2IW5 A;  4G9Y A;  4BHB A;  5HS9 A;  2RAE A;  2R5Z B;  1Y6I A;  2XPW A;  5K5R A;  1WI9 A;  5HNF A;  4PJ0 C;  4EMS A;  4RB1 A;  1JT6 A;  4F93 B;  5HDN A;  1X1P A;  1O7F A;  3HPG A;  3CES A;  3FXQ A;  1P92 A;  3PSF A;  2VPL A;  3I58 A;  3M1E A;  4XM3 A;  2P81 A;  4L5E A;  2IS2 A;  1ZRC A;  5F27 A;  2QGU A;  3M1C A;  4I98 B;  3DFG A;  1WWX A;  3I3L A;  1J75 A;  2HQA A;  1VQK I;  2HKX A;  4LIU A;  1SFE A;  3MKW B;  2O3F A;  1YO5 C;  2LYC A;  4HQM A;  3LSG A;  2KZV A;  4YEJ A;  1MMD A;  2V7F A;  2PI0 A;  1X3W B;  2LRD A;  4XKB A;  4CGZ A;  3ZCO A;  2EBI A;  4BBR J;  3I4M J;  1D3Y A;  5K7Z A;  4YIR X;  2V4J C;  3IKV A;  3U1K A;  4M72 A;  4A3C J;  1S9H A;  5DV5 A;  2XF5 A;  1S29 A;  2DK5 A;  1JHF A;  2V6C A;  5A2Q Z;  2UZK A;  3JRH A;  4ABZ A;  3ZGK A;  5KAI C;  3V7R A;  1DU6 A;  1U78 A;  3GME A;  1FBQ A;  1OJL A;  1U6G A;  4CH7 A;  3BLY A;  1SEU A;  4ASN A;  5HOO A;  1QPM A;  2F5C A;  1CGP A;  2K9L A;  2OJE D;  3HTS B;  3CMY A;  3U1D A;  2UUZ A;  3O3K A;  2R5Y B;  2ZKZ A;  4E6K G;  3K4N A;  2E35 A;  4LLL A;  1ZN2 A;  2BY0 A;  1NK2 P;  5LRR A;  2KIU A;  1RC9 A;  2LTP A;  3K4K A;  3RKQ A;  4UB6 C;  3U21 A;  4KIS A;  1ZK8 A;  5DEQ A;  3PJR A;  2Z33 A;  2HVQ A;  4XR6 A;  1HW1 A;  4U7D A;  4OIQ F;  4XNF A;  3K10 A;  2ADU A;  2D1H A;  3VFZ A;  2CWE A;  4G94 A;  5E1Z B;  4BU2 A;  5ICG A;  2RC4 A;  1JT0 A;  3P5J A;  5JLX A;  5L3G A;  3TP3 A;  1Y8R B;  2ELK A;  2ZC2 A;  1R5G A;  2HI3 A;  4BQO A;  4BUP A;  3T5X A;  4XLF A;  5DCF A;  4BQQ A;  3CCY A;  2GAU A;  2JZY A;  2XUB A;  1JE8 A;  4A0Y A;  4ITV A;  3OIP A;  4IHY A;  3ZMS A;  4G6T B;  1OCR H;  1UCR A;  2DA6 A;  3EUA A;  2HTJ A;  5E79 C;  3GTQ J;  3I4P A;  3TMO A;  3ZXS A;  4IEJ A;  4BNC A;  1HKQ A;  3TBI A;  4AD9 A;  4O3M A;  3CTA A;  3BG6 A;  3HSE A;  2RNG A;  3QWL A;  4W97 A;  4BEH B;  3J7A O;  3HOZ J;  1IXS B;  1ZAR A;  2QEN A;  4BE1 A;  4AVP A;  3CUQ B;  1IV6 A;  1ZRE A;  2LDU A;  4XMY A;  5HLG A;  3A01 B;  3BQY A;  2MAB A;  3BZC A;  3OYF A;  1E17 A;  2PG4 A;  1BJA A;  2HXO A;  4HNU A;  3R0J A;  3GZN B;  2FE3 A;  2O9L A;  2EV0 A;  4RM3 A;  5DTD A;  5KHD A;  4A3L J;  1AKH A;  3OOU A;  1Z6T A;  2IA2 A;  2MBF A;  4PGG A;  1P4X A;  2DYR H;  3DKW A;  2W84 A;  5LLQ A;  2DT7 B;  1FP1 D;  1YIJ I;  2QSH X;  1KZH A;  2RN7 A;  1W36 D;  4KIF A;  3K6G A;  3IKT A;  2ZNZ A;  1YJW I;  3CDL A;  3ABK H;  1G8X A;  4TV7 A;  2BW3 A;  4A6E A;  1IRZ A;  2TDX A;  5EYR A;  2FML A;  2LBF B;  5JVT A;  2MG4 A;  4ZJZ A;  2HQ5 A;  1V3F A;  4II2 A;  2DQR A;  1SVM A;  4LIV A;  4HST A;  3E6M A;  2WY7 Q;  2H8R A;  1R4M B;  2E19 A;  3DPL C;  4IHW A;  1O3T A;  2VT3 A;  4UUS A;  2L4M A;  4M3E A;  2L9V A;  2YU3 A;  2VI6 A;  4BAC A;  4UY8 I;  2OF7 A;  1VQM I;  1T95 A;  3W6V A;  4O6J A;  4U88 A;  5EEH A;  1MDM A;  3TGN A;  2EV5 A;  4B47 A;  1T08 B;  1I1G A;  3LSM A;  5GAH J;  1DP3 A;  3NAU A;  1B6A A;  3A2K A;  2Q8K A;  1QBJ A;  2VE8 A;  3U9G A;  3I5U A;  2HDW A;  5FGM A;  3AG3 H;  3MEX A;  1T0F A;  2LMD A;  1HW5 A;  3HKZ A;  3GFM A;  1IRX A;  5F6F A;  3CJR B;  2N8G A;  3G6E I;  4CYC A;  3CCQ I;  4BH9 A;  3LQR A;  5D5U B;  2M3A A;  3EDP A;  1LJ9 A;  3CC4 I;  1DPR A;  5DD8 A;  3Q9S A;  4PSX A;  2CYY A;  4BGD A;  1X19 A;  4OIR F;  1QZE A;  1GXP A;  3FF5 A;  4A3I J;  2VBX A;  2CV1 A;  1UZC A;  4NC8 A;  3WTU C;  1BR4 A;  4MLO A;  3U2R A;  3D5R C;  4LLN A;  2PQ8 A;  2R0Q C;  1K6O A;  2HYF A;  2PX9 A;  3NEU A;  5FLX Z;  4HBL A;  2XAU A;  4MFD A;  1F4K A;  4FE7 A;  2LY9 A;  3BWG A;  1BC7 C;  2G7H A;  2XAQ A;  4IHT A;  2VOO A;  1PJR A;  4NC7 A;  4Q47 A;  3W2W A;  3E6D A;  5DUI A;  1HCR A;  2RNJ A;  4CYD A;  2E60 A;  2XDV A;  3V4G A;  3S2D J;  3GTP J;  2YSR A;  3I59 B;  5IYC J;  1YTY A;  4S0H B;  2L3D A;  5LEK A;  3AG4 H;  2EWN A;  4DBQ A;  3UKG A;  2PJR B;  4M3D A;  2FBH A;  2XHK A;  1NTC A;  4IRG A;  2CRG A;  1BIA A;  3AL0 B;  2M9H A;  1XGM A;  4RS8 A;  2X6X A;  5BS6 A;  3QOP A;  2V1N A;  5CVI A;  3WG9 A;  4I09 A;  3IRQ A;  3CC2 I;  4UUV A;  4KN4 X;  1IUY A;  3E5Q A;  4RB2 C;  4ESB A;  2XAS A;  3LSJ A;  2H94 A;  5KK1 A;  2ISY A;  4B43 A;  1ZRD A;  2F5D A;  2V1U A;  2K3P A;  2ZSI B;  4P9U A;  3H3Z A;  1D0X A;  1PDN C;  1Z1D A;  2W57 A;  1OYY A;  2LFB A;  2LF8 A;  1TW2 A;  5FKK A;  4L9V A;  1YG2 A;  1DUX C;  2FOK A;  3HOS A;  1ETO A;  2QBY B;  3HUG B;  3SJM A;  3C7J A;  2M87 A;  1KA8 A;  4EJO A;  5GAG J;  1DP7 P;  2VJJ A;  2JA8 J;  1CF7 A;  4GCV A;  2QM3 A;  1MGT A;  3CCR I;  3K9T A;  4OMY A;  5BQT A;  2BBY A;  1RIO H;  4GO1 A;  5J8C A;  4MNU A;  4KT5 C;  4B1R A;  1SFX A;  3O6B B;  1YRN A;  2GM4 A;  4EM1 A;  5IT9 K;  2EIL H;  2XIG A;  1JKR C;  2DPU A;  3BZK A;  3CZ6 A;  3F23 A;  2LY1 A;  1MH3 A;  2UXN A;  4CCO A;  1U5T B;  2DBB A;  4ENJ A;  1ZQ3 P;  3BP8 A;  2DMN A;  5E8G A;  2HPM A;  3SEQ A;  5CVU A;  2BOL A;  1J59 A;  4M71 A;  1D1A A;  1NHA A;  1F36 A;  1D0Z A;  5D5X B;  2KT0 A;  2HQR A;  2EK5 A;  2P5V A;  3FMR A;  1TP4 A;  3HPH A;  4B44 A;  1IO2 A;  4UV8 A;  2IRF G;  5BPD A;  2DTR A;  4PGH A;  3GLL A;  5JHF A;  2LKS A;  3RCO A;  2M4G A;  2ESH A;  2IA0 A;  3BG7 A;  5H2F C;  4XOP A;  2RKH A;  1SD7 A;  1FT9 A;  1S7A A;  4W1U A;  5D6E A;  4D0P A;  5LHH A;  2QKM B;  3DCF A;  1JUS A;  4IPA A;  1HOM A;  2J5P A;  5LFA A;  3FK6 A;  2A68 F;  5AIQ A;  3REO A;  3CJN A;  1D1C A;  2IT0 A;  3CMA I;  2H6B A;  1KU7 A;  3A0H C;  4XLC A;  2F4M B;  3GYH X;  1SVO A;  2BV6 A;  2JSP A;  4OIP F;  4N9H A;  2NS8 A;  5M5Y J;  2H6C A;  2DDA A;  3HBL A;  2GOX B;  1O3Q A;  3QQA A;  1G2H A;  3B6C A;  2KIS A;  4BKX A;  1UJ8 A;  1MJB A;  2MC3 A;  2GIV A;  2M8G X;  1VQ8 I;  3S16 J;  3BR0 A;  1Y56 A;  1MBK A;  2NNY A;  3O8G A;  3D5S C;  3IWF A;  1WFX A;  3V7C A;  4WX9 A;  1BW6 A;  1NH3 A;  2Y75 A;  5B1A H;  4C30 A;  1T33 A;  1VQO I;  5LGT A;  4JX6 A;  3BY6 A;  3PQJ A;  3ZMU A;  1FIP A;  4IJA A;  4YG2 F;  3BR1 A;  3ELK A;  3EYY A;  2R7X A;  4CCL A;  1I50 J;  1WI3 A;  1G6N A;  3CJQ B;  5E20 A;  3FMQ A;  2K85 A;  1WRJ A;  2KZG A;  5HNH A;  3OR2 C;  1D0Y A;  2I5U A;  1MBF A;  2PMZ A;  1TWH J;  4EM0 B;  5D5V B;  2XV4 S;  1S5L C;  1SMY F;  4AYB A;  5J40 A;  3WGI A;  1D1B A;  3ZP5 A;  1GXQ A;  5KCM A;  3K70 C;  3R4K A;  3L2V A;  4M3G A;  2VPR A;  4LK1 F;  1Z7L A;  5IP9 J;  4XRS A;  2MFZ A;  2QQ9 A;  2M8E A;  3HXL A;  1MW7 A;  1BR1 A;  4EAT A;  2ZXI A;  2DMQ A;  1UFM A;  4U7B A;  1QGP A;  2R7O A;  1GT0 C;  4A3B J;  1K6Y A;  2CUJ A;  2LF7 A;  3L2U A;  1O3R A;  2Y9Z A;  4YFX F;  4Y15 A;  4OAY A;  1LPQ A;  1P4A A;  2V9V A;  2LOO A;  3DU5 A;  1JTX A;  1WJE A;  1R49 A;  2MW8 A;  3JSP A;  1MH4 A;  4RDU A;  4N0B A;  4G7Z F;  3DBL B;  4KFC A;  3FK7 A;  1H8A C;  4XN3 A;  5F0H A;  1SFK A;  5HVQ C;  3T0Y A;  1R36 A;  4H4K C;  3LAP A;  1T38 A;  1IV8 A;  2HTS A;  5D5W B;  1FZP B;  1ZGW A;  3AG1 H;  2V1X A;  1OLT A;  4E7S A;  4IXA A;  3O8H A;  1FNN A;  2L4A A;  2M34 A;  2W7N A;  1MBH A;  4RM2 A;  4DYQ A;  1H9T A;  3V8K A;  2XB5 A;  3VOE A;  5FKO A;  2XGD A;  3CMM A;  5F04 A;  3FM5 A;  2RQP A;  1ZGJ A;  2NRA C;  3ZR8 X;  5C4J J;  2X51 A;  2AXL A;  1BI1 A;  1G3W A;  3ZMV A;  2V26 A;  1GUU A;  1QNT A;  3W3C A;  4AWX B;  2NOG A;  2IS6 A;  1DGR M;  2BVL A;  1VQN I;  2X1E A;  1BR2 A;  3J81 Z;  2G7U A;  3H36 A;  3JSO A;  3HDD A;  3OYD A;  4ZTF A;  2VIX A;  1J09 A;  2DI3 A;  3BG5 A;  5GAD J;  1RR8 C;  1Z67 A;  4E7I A;  2P4W A;  1B1B A;  3ZMZ A;  3CCJ I;  4GFB A;  4YII A;  4BJ5 C;  3TQN A;  1ZLJ A;  3WHB A;  1FYM A;  2M0C A;  3F8B A;  5FLM J;  4ON0 A;  1F5T A;  2EB7 A;  2K9N A;  2MD5 A;  3F8M A;  2W85 A;  2DOE A;  2Y30 A;  1W7P B;  3NQO A;  3K1N A;  2JQ7 A;  4C2T A;  4BYY A;  2IGN A;  1FBS A;  3K4L A;  1UB9 A;  4PUS A;  1OCP A;  4HX4 A;  1R22 A;  2PEX A;  5IOY A;  2C6Y A;  3TOA A;  1KYW A;  3LA2 A;  1YI2 I;  2YU9 J;  2DK8 A;  4Y33 A;  1YYV A;  1UEL B;  1ETK A;  1WGX A;  1VQ5 I;  3J80 Z;  5M5W J;  1QZY A;  1QHH D;  2H8W A;  3OIO A;  3TOB A;  2RRE A;  3OWT A;  4HV5 A;  1A6Q A;  3AG2 H;  2QEX I;  2K27 A;  3I56 I;  2E1M C;  3V7S A;  1E0E A;  1B72 A;  1HKT A;  2DA5 A;  2V9P A;  5TJJ A;  2Q0O A;  4Q4Z F;  4RMN A;  3OMY A;  1XGS A;  2ZNY A;  3RKX A;  1XN7 A;  3A02 A;  1XSD A;  2QSG X;  1EH6 A;  5JLW A;  4FX4 A;  2W4S A;  3OYN A;  2HYJ A;  2E1M B;  5E3O A;  1FYL A;  5BMZ A;  2W25 A;  2A05 A;  4G8X A;  3LQQ A;  3FMS A;  4Y52 J;  2IEK A;  2HQN A;  2NXN B;  1FOY A;  1T56 A;  3KP7 A;  4FCY A;  2MA3 A;  3S93 A;  2VOP A;  2P6S A;  4N4O B;  1MMN A;  2XAF A;  1R6R A;  3F6O A;  4UVB A;  3GF2 A;  2YUS A;  3DTK A;  4M74 A;  3PNY A;  1ONV A;  1G59 A;  1SAX A;  4EJW A;  1IXR C;  2JK3 A;  1YX5 A;  3MZH A;  2OA4 A;  5M3M J;  3JRC A;  4ENM A;  1VND A;  4B09 A;  3DPT A;  4L0Z B;  4XKV A;  2BHY A;  2OV7 A;  3K70 D;  4M6V A;  3P9K A;  2QA4 I;  1PVE A;  1LDK B;  3T8T A;  1X2N A;  3RJP A;  3IH3 A;  2JRT A;  5DYM A;  2JT1 A;  3H9J A;  5GP9 A;  4KNY A;  3OIQ A;  2PN6 A;  4WXD A;  1ZRF A;  1LDJ A;  4AIJ A;  2FQ4 A;  3HGY A;  5K7H A;  4NC6 A;  1FPQ A;  2E1C A;  4RGX A;  3KX2 A;  3S2W A;  5HDG A;  3S8P A;  3L00 A;  2VJ4 A;  2YR2 A;  3B6A A;  4DZJ A;  5FLV A;  5CVJ A;  3GTM J;  2OU2 A;  4ZTJ A;  2DMU A;  3WU0 A;  1R1T A;  2A3S A;  2FXA A;  4NBQ A;  1G3Y A;  4A3J J;  3JAM K;  4Y17 A;  3KEO A;  1WJ5 A;  3QPL A;  1Y1W J;  3HOX J;  3RSN A;  1TWF J;  3F21 A;  3ZQI A;  2OCC H;  3MKY B;  1K78 A;  2IJL A;  4PJL A;  2EFO A;  1ZR4 A;  5IYB J;  1IRG A;  2VJ5 A;  2WY8 Q;  4KA4 A;  2VJI A;  3PO3 J;  2E71 A;  3ZQF A;  3SFI A;  3I4N J;  2DTZ A;  1PP8 F;  1K7A A;  3SZP A;  2HEO A;  3ZQC A;  4WF2 A;  4E7Z A;  3HSR A;  5EGO B;  4FET A;  3C3W A;  4RAY A;  3K4C A;  3UNG C;  5DUK A;  3DTE A;  3SZT A;  3C18 A;  4JP0 A;  1ZYR F;  2NYX A;  2HZD A;  5ICC A;  1OMI A;  3KFW X;  3PIP F;  1JGS A;  3OYA A;  2HNH A;  4HF0 A;  2MLG A;  3KZY A;  5DD4 A;  4X0G A;  5CYV A;  5F64 A;  1XSV A;  1Z21 A;  4ZZD A;  1SMT A;  3IRR A;  1DU0 A;  2YX4 A;  3HL2 A;  2FMY A;  1Q1H A;  1SD5 A;  2EIN H;  1R5H A;  1ETV A;  4XOR A;  3BCB A;  3G71 I;  1W7P D;  3LL7 A;  2O7O A;  3DLL F;  2L0K A;  1TW3 A;  5FB2 A;  3DQV C;  2CSO A;  1LNW A;  5AON A;  4XL9 A;  3FXM A;  2KIM A;  3LOC A;  5J8F A;  1MJ9 A;  2MGQ A;  2ID6 A;  2M2E A;  4FAS D;  3HHH A;  3ZQH A;  2RGV A;  4CXF A;  2ECC A;  3JRB A;  4G6Q A;  2R7W A;  3OYK A;  4XLA A;  1YLF A;  5ICE A;  3CC7 I;  3KYL A;  3VYT B;  5FO5 A;  3OS2 A;  3WTX C;  1UHW A;  3CCU I;  1JGG A;  2F6C A;  4LFU A;  2ME0 A;  3R6S A;  2XSD C;  3H1C A;  4U87 A;  4JX5 A;  3RQ4 A;  3F8C A;  4A69 C;  2Y2Z A;  3JCU C;  4GYG A;  4I7H A;  2GBY A;  4CUG A;  2IP2 A;  3OYI A;  4Q48 A;  3EPZ A;  5TRD A;  1I5Z A;  3QU3 A;  4RB0 A;  6PAX A;  4IQJ A;  3MD2 A;  4FX0 A;  1B8I A;  3S3O A;  2IS1 A;  2EA4 A;  3VB2 A;  1BJZ A;  1IZ1 A;  3FHZ A;  2QWW A;  4I99 C;  2QYO A;  2JA2 A;  1QU3 A;  1VI0 A;  3QOD A;  4S04 A;  2QVO A;  1RZ4 A;  1WZ2 A;  1MKM A;  4RB3 C;  3ECH A;  1SD4 A;  1F1Z A;  1BI0 A;  3OY9 A;  2NOJ B;  1MSE C;  1WJF A;  3HG9 A;  4JOM A;  5M3F J;  4C3H J;  3K4B A;  3GZ6 A;  3EUH A;  2VUM J;  2R7S A;  3VYU B;  1T39 A;  3W6K B;  1WJA A;  2STW A;  2OQG A;  2XRN A;  4B3A A;  2E5Z A;  5LD2 C;  2E7X A;  2HWV A;  2O8K A;  3LST A;  5LHG A;  2HDD A;  2DA7 A;  3R0A A;  4PSW A;  4L5I A;  1N78 A;  1STZ A;  4MFE A;  2KDZ A;  1LKX A;  5J4V A;  1JI8 A;  1BM9 A;  2KRC A;  2E36 A;  4PK4 A;  2EJR A;  2Z16 A;  4AC0 A;  5E1X A;  4WK8 F;  1KQ9 A;  1S7O A;  4J00 A;  3JRD A;  3TO6 A;  5E3L A;  1NG6 A;  3FIS A;  2AXT C;  4AVZ A;  5F0F A;  2H1K A;  3QPH A;  2CUE A;  3MMY B;  3JRG A;  1W0T A;  1HC8 A;  3CO7 C;  1APL C;  2Z99 A;  2P7V B;  4RLQ A;  1R00 A;  1I6H J;  1QRY A;  2D2W A;  2QKL B;  2L2O A;  2ETH A;  2KPM A;  1ACI A;  1BOA A;  1WJB A;  3ASO H;  3BR6 A;  4PJJ A;  4HYE A;  1U9N A;  2OQR A;  2P7C B;  2VAS A;  4GDF A;  3SHF A;  3QPT A;  4Y7N J;  1PUE E;  2DDB A;  5LGN A;  2DOF A;  2IPQ X;  1MZB A;  4ZYG A;  2VE9 A;  4YIF A;  3KLN A;  1BIB A;  2VXD A;  1OYI A;  5EEG A;  1XGO A;  5IPA A;  4M6Y A;  1W5T A;  4R1H A;  3EUH C;  2KP6 A;  1MMA A;  2L9N A;  2EFN A;  3MCZ A;  3OL3 A;  3PFY A;  3OYJ A;  1P4W A;  2CFX A;  5DCM A;  2K9Q A;  2FOW A;  4YFN F;  3ZN1 A;  2CU7 A;  3QYB A;  4A93 J;  3M8E A;  5LRS A;  2XKO A;  1W0U A;  1J2X A;  4FE4 A;  3AAF A;  1B59 A;  1IDY A;  2GIZ A;  3L1P A;  2QSF X;  2NNN A;  2AS5 F;  1U0J A;  2QQA A;  3TL4 X;  5BPI A;  1AKH B;  5ED4 A;  3KYC B;  1IGN A;  3V42 A;  4BL0 B;  3CUO A;  1LE8 A;  4IHX A;  1ETW A;  3WTS C;  4MEX F;  4V2G A;  5EG0 A;  3L09 A;  1FOW A;  1G3S A;  5K1Y A;  1R23 A;  3ZMD A;  1V55 H;  2HDC A;  2BW3 B;  2M45 A;  1UST A;  3ASN H;  1GLN A;  1TT5 B;  2ACJ A;  1WJC A;  4B48 A;  4A12 A;  4ENK A;  2GLO A;  4K2E A;  3H92 A;  4B3X A;  1V5E A;  3OYH A;  3JRA A;  4ZDO A;  3M9A A;  3OYG A;  1E3P A;  4UUS B;  1MMG A;  3KCC A;  3CCS I;  1ZEL A;  2PLY A;  1YS7 A;  5FFZ A;  2JWT A;  2JVH A;  4BY1 J;  1XCB A;  3RZO J;  5M5X J;  1T0F C;  4MQV A;  3OV8 A;  2MH9 A;  1XG1 A;  1OPC A;  4LLG F;  4CA0 A;  1MDM B;  5FRM A;  4XLP F;  4EGZ A;  3TO9 A;  1FMV A;  3CQZ J;  4ZDP A;  5DDG A;  1V4R A;  4IVN A;  3N97 A;  3E1S A;  2LKX A;  1FEX A;  1ETX A;  3QOE A;  4HOB A;  1UAA A;  3BPV A;  4D9J A;  1NG7 A;  1AHD P;  5KNL A;  1FTZ A;  4GRI A;  4CYC B;  2G9W A;  4MGR A;  1A04 A;  1MIJ A;  3LA3 A;  4C2M J;  1RR7 A;  2Y0M A;  1IDZ A;  3FKJ A;  1GV2 A;  1FX7 A;  5HLH A;  3ZPL A;  3W2V A;  2ECB A;  3LWF A;  1QVU A;  5CVR A;  3I9V 2;  3IL2 A;  1OR7 A;  3BRO A;  2CFO A;  3BCA A;  3HZJ A;  3TW6 A;  5C3E J;  2IAI A;  2ZME A;  4ZYH A;  2V1D A;  2EQR A;  2K5C A;  3ULQ B;  1QQI A;  1XC5 A;  1HDP A;  4PDK A;  3K2A A;  5HLT A;  3MKL A;  4BE0 A;  4EJV A;  2COB A;  2E1O A;  3JRE A;  1Y0N A;  2CUZ A;  1S3J A;  2BE5 F;  3I53 A;  4XRF A;  4IQ4 A;  4CCM A;  1YX3 A;  4CDG A;  4LG0 A;  2DO7 A;  2LSO A;  3TED A;  2FX0 A;  1PYV A;  2EZI A;  1ERD A;  2Z3Y A;  3L2Q A;  2NAZ A;  3BR2 A;  3BQZ A;  2XF6 A;  2A6E F;  2XC7 A;  2K3F A;  3DBH B;  4U0W A;  1SAU A;  1IJW C;  4C2U A;  1FY7 A;  2TCT A;  1RNL A;  2KLO A;  2DT5 A;  2MLK A;  1LVA A;  3DWL E;  3DU6 A;  3H5R A;  5F08 A;  1TNT A;  3OS1 A;  1E3O C;  2V79 A;  2EZK A;  3DBR B;  1LFU P;  1XGN A;  1MBE A;  3C1D A;  4EM2 A;  4ZYA A;  2B0L A;  1MSF C;  2P0W A;  2UXX A;  4S05 A;  5CJ9 A;  1DDN A;  3H0D A;  2XAJ A;  1OCZ H;  1JUM A;  4IF4 A;  2L7F P;  1Z3Y A;  4A3E J;  4ESF A;  1OR7 C;  1HW2 A;  3FIW A;  1HA8 A;  3PL8 A;  4LJZ F;  4BAY A;  3DP7 A;  4V2F A;  1JKP C;  2ZME C;  1BN5 A;  3CLQ A;  1ZTR A;  4ZDL A;  1BA5 A;  2WV1 A;  2R92 J;  2O0Y A;  3F22 A;  4EGY A;  2VOD A;  3OYB A;  1BI2 A;  5EJC A;  5JFR A;  3IV5 A;  3RYP A;  2ELJ A;  3TDU C;  2AO9 A;  4EEF G;  4AIH A;  1R7J A;  4G12 A;  2L02 A;  3OYM A;  3SFZ A;  4P96 A;  2M1B A;  4HLX A;  4HLY A;  1I27 A;  2JUC A;  4RLF A;  5FKM A;  1CF7 B;  1TQP A;  2FBI A;  1J5Y A;  1EKE A;  4HDU A;  3WHC A;  2FSW A;  3MVP A;  2JMW A;  1YRN B;  2VB6 A;  2FBK A;  1HF0 A;  1HSJ A;  3D1N I;  3MN2 A;  1RKW A;  2Y9Y A;  3LSI A;  5FRN A;  3J7Y J;  3GWZ A;  1OFC X;  1IN5 A;  4ZYD A;  3MZY A;  4O5V A;  2Y48 A;  1X1C A;  4MTE A;  2NVY J;  5J1R A;  1I39 A;  2WA0 A;  1MMS A;  3QU6 A;  2DFH A;  4JQF A;  2P8T A;  2Z5U A;  3AFH A;  4LG3 A;  2GXG A;  3HOU J;  1RES A;  1BW5 A;  2DT6 A;  1LDD A;  5KVR A;  4A3M J;  1ZLK A;  1W5C C;  4OMZ A;  2CQQ A;  4CO8 A;  5CQG A;  4A5N A;  4ENN A;  1JHH A;  4L9T A;  4M73 A;  2F5V A;  1WSU A;  3LSR A;  2EA2 A;  1MD0 A;  2ZSH B;  5FRO A;  4IO9 F;  4BBS J;  4Z6Y A;  3M4O J;  2VKH A;  2EIJ H;  4LK0 F;  1BL0 A;  2IBD A;  2X6W A;  3S3M A;  4HZF A;  4NQW A;  3BG9 A;  3WTW C;  4OAZ A;  2W48 A;  3FXL A;  4UHT A;  4P55 A;  2WB1 N;  2XAG A;  2XAH A;  3OYE A;  4LD5 A;  4IHV A;  1I3A A;  1G4D A;  2V9K A;  2CV2 A;  4UXN A;  1XS9 A;  2RDP A;  2TRT A;  1FP2 A;  3OYC A;  4XON A;  3BTL A;  3QP6 A;  4QPQ A;  2OBP A;  1ZGA A;  4WWC A;  2BVM A;  2O5R A;  2F5F A;  3R61 A;  2HOT A;  4HRI A;  4BQA A;  1HDD C;  1X4P A;  4BQN A;  3K4J A;  5EDN A;  3EUK L;  2PFB A;  3ZQQ A;  1IF1 A;  3G73 A;  2K86 A;  3A4C A;  4UVC A;  1IW7 F;  2QLZ A;  4DYR A;  4DNC A;  1OCT C;  3EYI A;  3S14 J;  1H0M A;  4A0X A;  3BC8 A;  2XRO A;  1YHQ I;  1WH5 A;  4KJZ A;  2H1L A;  1P9Q C;  2DFI A;  3KZZ A;  2AHQ A;  3JRI A;  2HOE A;  3WE3 A;  3O2P E;  4E7K A;  5E8I A;  2EV6 A;  3TKY A;  1L3L A;  1FOK A;  2UWM A;  2D45 A;  1SD6 A;  2LVS A;  2M7B A;  3M8J A;  4NUB A;  2V6E A;  2R7T A;  4P5O A;  3F9K A;  4AUX A;  9ANT A;  1YIT I;  4AIK A;  2HFH A;  2KJC A;  4KYW A;  3JW4 A;  2M4K A;  2PMH A;  4RGS A;  2L7K A;  4E7J A;  3CDH A;  2ZXH A;  4NDL A;  1XB4 A;  4UUT A;  5E17 F;  3M7G A;  1X1B A;  3FBI B;  1J0R A;  3HSF A;  4E7H A;  2X6O A;  4G7O F;  1F9N A;  2L5Q A;  1WHU A;  2B63 J;  3J7A Y;  2Z2S B;  2A07 F;  2L9R A;  2IA1 A;  4BHP A;  1HKS A;  4NQW B;  5E3M A;  1AOY A;  1D5V A;  3IHU A;  4II3 A;  2ZJP F;  1X2M A;  2EPF A;  2FRH A;  4RAZ A;  3BZ6 A;  1M1E B;  2X0L A;  5J4Y A;  3H35 A;  2E34 A;  1TLH B;  2X4H A;  1ITY A;  1PUF A;  4U0V A;  2HPI A;  1HXD A;  3HB9 A;  4HQE A;  3MWM A;  3MAJ A;  5LHI A;  4OIO F;  2L9S A;  3E5X A;  2ICW G;  2CS3 A;  2WC2 A;  1MBJ A;  4DBR A;  4X6A J;  1TZL A;  1X3Z B;  5EF6 A;  2XPU A;  2Q2E A;  2XPV A;  2Q1Z B;  1O4X A;  4PJN A;  5GAE J;  5JHU A;  5FD6 A;  4UV9 A;  3L2R A;  5IP6 A;  3LAJ A;  4IX7 A;  3HYI A;  2X1D A;  2MD0 A;  4RAG A;  3H3V K;  1TWC J;  3WTV C;  2E2H J;  4DIQ A;  2KRF A;  4R8H A;  1LVK A;  5HOD A;  3KP3 A;  3VEP A;  2EZL A;  4BXX J;  4MQ9 F;  2R5Z A;  5JR3 A;  2L01 A;  3FBN B;  2DAO A;  4XSX F;  2R93 J;  1JXS A;  2RVC A;  3ABT A;  4XQF A;  1FYK A;  3K1P A;  2IVM A;  4DOZ A;  3HIF A;  3HRU A;  2LKP A;  2GXA A;  5H6Q A;  2ME6 A;  2DJI A;  3WE2 A;  1A31 A;  2GXB A;  3QPS A;  3SDB A;  2LR8 A;  3ONQ A;  5ILU A;  2X9D A;  2VBZ A;  3GXO A;  1UHS A;  3MFK A;  2DA4 A;  4MIM A;  4CZZ A;  3LSP A;  3ML6 A;  2E1N A;  4BJ6 C;  4CCN A;  2ELH A;  5B66 C;  1MND A;  2KHM A;  5A2Q K;  2HXI A;  4MEY F;  3GW2 A;  1XMK A;  2BY1 A;  2F4I A;  1JTY A;  2M0M A;  1IG7 A;  2XGE A;  4PZJ A;  4E7L A;  2JA5 J;  2GA1 A;  5E1W A;  5JI6 A;  2XGC A;  4N9I A;  2WV0 A;  2ZO4 A;  3RKY A;  2JUG A;  5DM6 F;  2AQE A;  3ABU A;  3S1M J;  2VON A;  2YPR A;  2A5W A;  4EJT A;  1X3U A;  1B9N A;  2X48 A;  2GOM A;  4WCG A;  2H09 A;  2W82 A;  3G1O A;  2WAQ N;  1TTY A;  5LEJ A;  3LSK A;  5L3D A;  5L3E A;  2LNB A;  3HM5 A;  1B72 B;  4AM3 A;  2OTJ I;  2R5Y A;  4MTD A;  1HQC A;  2F48 A;  2ISZ A;  2NS0 A;  1BBY A;  4OIN F;  1GVD A;  1A35 A;  2DU9 A;  3NAR A;  2UV1 A;  4D7M A;  1VQP I;  2PJP A;  2QCO A;  4KUM A;  4E4H A;  1YQA A;  2YS9 A;  1AWC A;  3RYR A;  1YFH A;  3H9Q A;  2HGC A;  5FFX A;  2OCE A;  3IAM 2;  3GTL J;  1D8J A;  2Y0S N;  5K5Q A;  4F52 A;  1JKO C;  2HOS A;  2HU9 A;  3HEF A;  1REP C; 
#chains in the Genus database with same CATH homology
 1D1A A;  3IAS 2;  1D0Z A;  4N4N B;  4DJA A;  3VDX A;  2VXD A;  3HPH A;  3FDY A;  3PNT A;  3EUH C;  2KP6 A;  1MMA A;  2L9N A;  4B44 A;  3DPU A;  3OL3 A;  5JHF A;  3PFY A;  3OYJ A;  2MC4 A;  2LG4 A;  3RCO A;  2M4G A;  3QYB A;  3BG7 A;  4XOP A;  2IGO A;  2QKM B;  3LFU A;  3PSI A;  3HOT A;  5TGT A;  5LFA A;  4CSW A;  5CPR B;  4BEH A;  3CP8 A;  4AU7 A;  4CZC A;  1D1C A;  1U0J A;  3TL4 X;  4XLC A;  2V6E A;  3V42 A;  2JSP A;  4BL0 B;  2VQC A;  4XLE A;  3N05 A;  2W1O A;  3VSK A;  2GOX B;  2WAQ A;  4BXF A;  2MYS A;  3S3N A;  4KIT B;  4NNJ A;  2BW3 B;  1Y56 A;  1GLN A;  1V5F A;  3D5S C;  3IUO A;  1WFX A;  2Z1D A;  1KON A;  1WJC A;  4B48 A;  4BDY A;  2ZFU A;  2R4G A;  2WAF A;  4C9Y A;  4C30 A;  2X6Y A;  4B3X A;  1V5E A;  3OYH A;  4BE2 A;  4ZDO A;  3LMM A;  3S32 A;  3OYG A;  3AKZ A;  2Y0S A;  1MMG A;  4XKC A;  2R7X A;  2WAD A;  1ZEL A;  2WBM A;  3OL4 A;  4CCL A;  2VQL A;  2LBF A;  2JVH A;  3CJQ B;  1T0F C;  3QYF A;  3FHN A;  5FRM A;  4CA0 A;  5HNH A;  3OR2 C;  3OYL A;  1D0Y A;  2PMZ A;  1FMV A;  3HC7 A;  4ZDP A;  3VWB A;  4HG2 A;  2XF7 A;  1YE9 A;  3D5L A;  2KL4 A;  3E1S A;  4AYB A;  1D1B A;  5KCM A;  3QOE A;  3K70 C;  3L2V A;  3IP4 B;  2IGM A;  1UAA A;  4D9J A;  1NG7 A;  2LC2 A;  1Z7L A;  2DOA A;  5KNL A;  2MFZ A;  4DGW B;  3HXL A;  4GRI A;  1MW7 A;  1BR1 A;  4EAT A;  4IZZ A;  2ZXI A;  1X1D A;  4U7B A;  2R7O A;  4XOT A;  3ZRG A;  1K6Y A;  2CUJ A;  4QPO A;  4F92 B;  3L2U A;  2LY2 A;  3FKJ A;  4OAY A;  1WJD A;  3KEY A;  1W36 C;  2LOO A;  3DU5 A;  1V5G A;  1WJE A;  5CKT A;  3W2V A;  2R7V A;  2AQF A;  3RTR A;  2M7A A;  3I9V 2;  3QYE A;  4F91 B;  2CFO A;  3BCA A;  2Q2E B;  4XN3 A;  1LFP A;  1SFK A;  3MKZ A;  5HVQ C;  2K5C A;  2OC6 A;  4H4K C;  3DKX A;  4PFO A;  3VYR B;  4KT6 A;  4IKF A;  1DQU A;  5HLT A;  3DTI A;  4BE0 A;  2RQQ A;  1DGW Y;  1OLT A;  4E7S A;  2CUZ A;  4P1W A;  3E0J B;  4IQ4 A;  4CCM A;  2CH0 A;  1YX3 A;  2W7N A;  2VKD A;  3C2H A;  3LSH A;  4RM2 A;  1Y6I A;  1PYV A;  1ERD A;  3L2Q A;  5HNF A;  1EA3 A;  3CMM A;  2XF6 A;  3PUB A;  2XC7 A;  4F93 B;  3ZR8 X;  1SAU A;  1FMW A;  3HPG A;  2X51 A;  3CES A;  3H5A A;  4C2U A;  4F3Q A;  2V26 A;  2KLO A;  2VL8 A;  3PSF A;  4LIT A;  3VSL A;  4XM3 A;  2VPL A;  3DWL E;  3DU6 A;  3W3C A;  3H5R A;  2IS6 A;  2IS2 A;  3A1Y A;  2DCE A;  3CF2 A;  3OS1 A;  1DGR M;  2BVL A;  3M1C A;  4HSR A;  2X1E A;  1BR2 A;  4ZYA A;  3I3L A;  2HQA A;  3PNV A;  4LIU A;  3OYD A;  2P0W A;  4F55 A;  3MKW B;  4ZTF A;  2VIX A;  1J09 A;  2LYC A;  3LSG A;  3H0D A;  2PJR A;  2KZV A;  4YEJ A;  1MMD A;  2V7F A;  2LRD A;  3NWS A;  4PFP A;  4XKB A;  4E7I A;  1Z3Y A;  3ZCO A;  1OR7 C;  1HA8 A;  2R7Q A;  4BJ5 C;  3PL8 A;  3OS0 A;  2V4J C;  2DXI A;  1S9H A;  4ZDL A;  2XF5 A;  4R79 A;  3C2G A;  4C2T A;  2IGN A;  3K4L A;  3OYB A;  1AA7 A;  4PUS A;  3ZGK A;  3GBG A;  2ELJ A;  4CH7 A;  3BLY A;  5HOO A;  2K9L A;  4Y33 A;  3OYM A;  2UUZ A;  1UEL B;  4E6K G;  4RLF A;  3K4N A;  1QHH D;  2RRE A;  3OWT A;  3K4K A;  4KIS A;  3U21 A;  3K4M A;  2VB6 A;  3PJR A;  2E1M C;  1E0E A;  2HVQ A;  4XR6 A;  4RMN A;  3OMY A;  3LSI A;  5FRN A;  3SYT A;  4J01 A;  4D1Q A;  4XNF A;  1UG0 A;  1X4O A;  1X1C A;  3K10 A;  2WA0 A;  4BU2 A;  4JQF A;  2W4S A;  3OYN A;  2E1M B;  3AFH A;  4BQO A;  4LG3 A;  4BUP A;  4XLF A;  4BQQ A;  2DT6 A;  3AL0 C;  4ITV A;  3OIP A;  5CQG A;  2F5V A;  3S93 A;  4G6T B;  4N4O B;  1MMN A;  1R6R A;  2ZSH B;  5FRO A;  3DTK A;  3EUA A;  2VKH A;  3PNY A;  1N75 A;  2A6T A;  3TMO A;  1MNE A;  2X6W A;  3ZXS A;  3TBI A;  3S3M A;  1G59 A;  1N77 A;  2I8D A;  2LH9 A;  4OAZ A;  1YX5 A;  3BG6 A;  3OYE A;  2RNG A;  4BEH B;  2VXZ A;  2V9K A;  4BE1 A;  2CV2 A;  3DPT A;  4XMY A;  4XKV A;  2WAE A;  3OYC A;  4XON A;  2OV7 A;  2MAB A;  3OYF A;  4QPQ A;  3K70 D;  3VYS B;  4HNU A;  1LDK B;  2BVM A;  2O5R A;  4HRI A;  4RM3 A;  1X4P A;  4BQN A;  5KHD A;  3H9J A;  3RPU D;  3K4J A;  3OOU A;  3OIQ A;  3EUK L;  3ZQQ A;  3DLA A;  2DT7 B;  3KX2 A;  3A4C A;  3S8P A;  1W36 D;  1TT0 A;  2VJ4 A;  3BC8 A;  3K6G A;  1Z3X A;  4Y4R A;  4KJZ A;  1P9Q C;  1G8X A;  2BW3 A;  3OR1 C;  4ZTJ A;  3W2A A;  2LBF B;  4E7K A;  4ZJZ A;  3L2W A;  2UWM A;  4II2 A;  1WJ5 A;  2M7B A;  3M8J A;  2KQR A;  4LIV A;  2E5N A;  4NUB A;  4P5O A;  3F9K A;  2HVR A;  4HST A;  3RSN A;  2R7T A;  2WY7 Q;  3DPL C;  2X1C A;  2M4K A;  3MKY B;  4PJL A;  4XLH A;  2L7K A;  4E7J A;  4ANJ A;  2VJ5 A;  2ZXH A;  2WY8 Q;  4BAC A;  2VJI A;  4BJT A;  1T95 A;  1X1B A;  3FBI B;  4OWR B;  4Y3O A;  4E7Z A;  4B47 A;  4E7H A;  2XSJ C;  3UR3 C;  3LSM A;  1DP3 A;  4FET A;  2L5Q A;  3A2K A;  3K4C A;  3UNG C;  4PJM A;  2Z2S B;  3DTE A;  4CCK A;  3J7A Y;  2HDW A;  2HZD A;  4NQW B;  2WB1 A;  4HPQ A;  3OYA A;  4II3 A;  2HNH A;  3HKZ A;  1IRX A;  3DKY A;  3CJR B;  4X0G A;  1Z21 A;  3H35 A;  3HL2 A;  4XOR A;  2KDO A;  2M3A A;  4BS9 A;  3BCB A;  2HPI A;  3CP2 A;  3LL7 A;  4PSX A;  4BGD A;  2L9S A;  1X19 A;  5CQE A;  1BOB A;  2CS3 A;  3DQV C;  4DBR A;  1TZL A;  2CW8 A;  2CV1 A;  4XL9 A;  4NC8 A;  1BR4 A;  4FAS D;  2Q1Z B;  4MLO A;  4PJN A;  2CW7 A;  4ZC3 A;  3L2R A;  3D5R C;  2R7W A;  3OYK A;  4IX7 A;  2K9M A;  2X1D A;  2MD0 A;  4XLA A;  2CMP A;  3KYL A;  3H5N A;  3VYT B;  2XAU A;  4HNT A;  4DIQ A;  2IS4 A;  3OS2 A;  2F6C A;  1LVK A;  2R7U A;  4YRV A;  4HEA 2;  4U87 A;  1PJR A;  3RQ4 A;  4NC7 A;  3FBN B;  3W2W A;  2HVS A;  2E60 A;  4CUG A;  2XDV A;  3OYI A;  3EPZ A;  3SEZ A;  1X1A A;  2VQG A;  4XQF A;  4IQJ A;  2OUM A;  3MD2 A;  3S3O A;  4DOZ A;  2IS1 A;  4YEL A;  4DBQ A;  2PJR B;  2DJI A;  2JA2 A;  4XKW A;  1QU3 A;  3QOD A;  3NWT A;  3SDB A;  3ONQ A;  2VLA A;  3AL0 B;  4XN0 A;  2X6X A;  2V1N A;  3OY9 A;  2NOJ B;  1WJF A;  3HG9 A;  4BJ6 C;  4JOM A;  4CCJ A;  4CCN A;  1MND A;  2KHM A;  3H9G A;  3K4B A;  4BDZ A;  2LRE A;  2R7S A;  2KMU A;  2F4I A;  3G2B A;  2M0M A;  3VYU B;  2R7R A;  4E7L A;  4B43 A;  1WJA A;  5LD2 C;  2E5Z A;  2JUG A;  2K3P A;  2IXS A;  2ZSI B;  1D0X A;  2AQE A;  4PSW A;  2CV0 A;  2W00 A;  2X85 A;  1N78 A;  2A5W A;  1LKX A;  2GOM A;  1JI8 A;  2KRC A;  4PK4 A;  2W82 A;  2Z16 A;  3HOS A;  3SZG A;  3LSK A;  3HUG B;  4J00 A;  2VQH A;  1NG6 A;  4AVZ A;  2VJJ A;  3MMY B;  2UV1 A;  2IGK A;  4RLQ A;  3DEE A;  1VZ0 A;  4E4H A;  2QKL B;  2L2O A;  1QHG A;  2FUG 2;  2JVG A;  2KPM A;  2KRH A;  3H9Q A;  3CZ6 A;  4PJJ A;  1WJB A;  3IAM 2;  2LY1 A;  4F52 A;  4CCO A;  2VAS A;  2HU9 A;  2HPM A;  3SEQ A;  2BOL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...