3MKWB

Structure of sopb(155-272)-18mer complex, i23 form
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
115
structure length
115
Chain Sequence
PTSAYERGQRYASRLQNEFAGNISALADAENISRKIITRCINTAKLPKSVVALFSHPGELSARSGDALQKAFTDKEELLKQQASNLHEQKKAGVIFEADEVITLLTSVLKTSSAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*CP*TP*GP*GP*GP*AP*CP*CP*AP*TP*GP*GP*TP*CP*CP*CP*A
publication title Insight into F plasmid DNA segregation revealed by structures of SopB and SopB-DNA complexes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein/dna
total genus 38
structure length 115
sequence length 115
chains with identical sequence P
ec nomenclature
pdb deposition date 2010-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF18090 SoPB_HTH Centromere-binding protein HTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2830 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3mkwB00
1VZ0A 3MKWB 3VWBA 3W3CA 3MKZA 3W2AA 3MKYB
chains in the Genus database with same CATH superfamily
2D2WA 2GOXB 2DJNA 3OYNA 3H1CA 4AVPA 2EV5A 2RNJA 2W85A 2MD0A 5IP9J 5E1XA 3OIOA 3DBLB 3BR3A 2OD5A 1QPMA 2OQRA 2WBMA 2R7UA 3FBIB 2A5YB 1SD7A 4JK1X 1UG0A 3JR9A 4IQ4A 2DOEA 2E7WA 4AC0A 3IUOA 4Y13A 5DM6F 2K02A 2MYSA 3GTQJ 3AL0B 4IHTA 4HNVA 3S17J 1J5YA 2X0LA 4ZDLA 3ZQIA 4BAYA 1JJ8C 4V2FA 2DK5A 3MQ0A 2JRMA 1SAUA 1GLNA 3A0BC 4LIVA 4IO9F 2BVLA 3CZ6A 2IEKA 5FKKA 2LG4A 4YFKF 2VBXA 4YIFA 2CV1A 1LE8B 3KEYA 4XOTA 2R7RA 2YSRA 2GM4A 3ZN1A 4BACA 1FZPB 3K7AJ 2XAHA 1LVKA 3HRTA 2IS2A 1X4OA 1K4TA 2W7NA 2CQQA 3SQNA 1KU2A 3J7AO 2EFNA 4KITB 3CCYA 1S9HA 4UXNA 2HKOA 4F3QA 2A5WA 2FBKA 3QP6A 2EILH 5DV5A 3DTEA 2HPMA 2FUG2 4HNUA 1MBGA 1F5TA 3IKTA 4HF2A 2WV1A 5E3LA 3G73A 1XDUA 2LF7A 4EGYA 1J9IA 2QM3A 1WCMJ 2YUSA 1FSHA 3E5QA 1XX5A 4UV8A 2DA7A 3G71I 3RPUA 3GTMJ 4ZTJA 3G3ZA 5F0CA 1R22A 2BXZA 1BI1A 1A31A 3H0DA 1Y1WJ 1MMDA 2FA5A 2DODA 4QIWN 2MH9A 1FOKA 3R0JA 1J2XA 5E18F 1W36C 3BZCA 1PUEE 2JUGA 1MBKA 4LLGF 3KP3A 2ZMEB 5ICEA 2HR3A 1G3YA 3J80K 1R00A 2CU7A 1VQOI 5JVGF 4BL0B 4EM0B 3H5NA 3MFKA 2COBA 1B72B 1UMQA 2YPRA 5LRRA 3OYHA 3OL4A 2IJLA 1TQIA 1JTXA 4CA0A 4B43A 3E6BA 2NVXJ 1IF1A 1ZR4A 4MTEA 1F36A 2R0QC 4Y7NJ 1ETXA 4UVCA 4BE0A 1KQ9A 1LJ9A 3F8CA 3TO6A 1B4AA 2DMPA 2V1DA 1R1VA 2G9WA 3CCSI 3AG3H 4I7HA 1P7IA 4EQQA 3ECHA 3FDYA 1N78A 3N05A 3DPLC 3GZNB 3H36A 2A3SA 2A68F 3S93A 2E2IJ 1NHAA 1I3QJ 5ILVA 4DBQA 5ED4A 1VQKI 1A36A 4XQFA 1CF7A 5IYDJ 2YU3A 2RVCA 2CW0F 3H5RA 4E7KA 3FBNB 2X1EA 3E3VA 4OU0A 3K4NA 1AKHB 3OV8A 4CZCA 3HIFA 1QZYA 2EBIA 4HLYA 2ZXIA 4X6AJ 2XAJA 3T1BA 3G1LA 1NK3P 1RKWA 1Z91A 2CYYA 4A3LJ 3M8FA 2F5EA 1M1EB 5EEAA 3U1DA 1GUUA 4AIDA 3DEUA 3FF5A 2HYGD 2K86A 3W6JB 4DYRA 1KGSA 5IT9K 1WJAA 2IS6A 3W6VA 4B3AA 1I6HJ 4F7ZA 4DOZA 1FMWA 2QENA 5IP7J 1QU3A 4IL6C 1YJNI 2HGCA 2LF8A 3OSFA 1XC5A 5HNHA 3OMYA 1A04A 1OMIA 4ENJA 2LYCA 1ZLKA 4CICA 5E17F 2DN0A 1KA8A 4BQOA 4LLLA 1UJ8A 2IP2A 3S1MJ 2LOOA 4D9JA 2K9SA 5K5OA 5FRNA 2E1CA 2ZSIB 1IXRC 1O4XA 2JSPA 5CJ9A 1TT5B 1Z7LA 2I8DA 5J3LA 3ZOBA 4UVAA 1R1TA 4BQAA 2XF7A 2M9HA 4LOCA 1TWAJ 1XDSA 5LGNA 2QZ8A 1I6XA 3FMRA 2JA6J 3WTWC 5HS7A 4KMUX 2DA5A 5DM7F 1CGPA 3HJEA 2O7OA 3O8GA 4I2OA 3BWGA 5LGTA 2MABA 3HKZA 2RDPA 4RAFA 3DKWA 3HHHA 5IP6A 5F0HA 2M87A 2BYVE 2NOGA 3VYTB 2IXSA 1GHCA 1OISA 1SMTA 2D1HA 3A01A 3HOVJ 1UHSA 2NVQJ 1TC3C 1BW6A 3M1CA 1N25A 2AXTC 3FXRA 5H20A 2BZTA 5DCMB 3WGHA 4HDVA 4S05A 1K78B 1KU3A 3HUGB 1OPCA 3KE2A 4A3CJ 3HGYA 1HXDA 2WB1N 1S3JA 2V1NA 2E2HJ 2XUBA 1ZR2A 2BY3A 2E7XA 4QTRA 1WJDA 2O0YA 2QWWA 1S6LA 1TZLA 1UHMA 3KP5A 5DUKA 5B5EC 1RR8C 1MSEC 2IVMA 3M07A 5FLVA 1ZGWA 3ASNH 1E17A 1KZHA 2VT2A 2UWMA 1BIAA 4RGRA 3J81Z 2XAUA 1DPRA 2XPUA 2HQAA 1WJEA 2FXAA 3RI4A 2KIUA 1JUSA 4G6QA 4PJJA 4D5CA 3IRQA 5J1RA 1LPQA 3LSMA 3U9GA 1D8KA 3ESWB 4BH9A 2NRAC 3QYEA 2EK5A 4JBAA 3WTTC 1SFOJ 4GYGA 3PJRA 3CESA 1ZN2A 3JRBA 2ACJA 5KVRA 1XSXA 3U2RA 3A2KA 2O5RA 2AHQA 2H09A 2WAQA 4XKCA 2V9KA 2R5YB 3S15J 4FX4A 5KAIC 3LAJA 1K7AA 2KHMA 1A6QA 1WSUA 4E7SA 3DCFA 4RM2A 2EPFA 3R4KA 2E19A 1GVDA 2K9NA 2WTEA 2Q0OA 3KZYA 4FISA 3DV8A 2XROA 2EJRA 2KFDA 2PJRA 3PIPF 3OYIA 1MKMA 4L9NA 4NC7A 4Z6YA 1L3LA 3MZHA 4RLFA 4A69C 3IC7A 3ZQQA 1XG1A 4S04A 5E1ZB 3WE2A 1QVUA 1WHUA 4BNCA 2PJPA 4CO8A 1FYLA 1X2MA 5L3DA 1T95A 2XSJC 3F9KA 5FROA 4M3BA 4IJAA 4ZTFA 4Y3OA 1V54H 3WHBA 2V6CA 4X0GA 3HSRA 4HF0A 5FD5A 1HQCA 2DYRH 2FQ3A 3QOEA 5FO5A 1PDNC 2AQFA 4XLAA 2HYJA 1BOBA 3DPUA 2XGCA 4CCJA 1P4XA 3WTYC 1QA6A 4L9TA 3JAMK 1E0EA 3BTCA 2L7MP 2MLGA 3VSLA 5LLQA 4LIUA 3I5UA 2JA7J 3KFWX 1GV5A 4RB1A 2XRNA 3CCJI 3RQIA 3IWZA 3LSHA 2OTLI 3BQZA 4BJTA 2JTVA 2R7SA 3HOTA 3TGNA 5EGOB 2M8EA 4B48A 1ETQA 2OBPA 2TRTA 4L5JA 2HDDA 1XS9A 4NNJA 1SD6A 4XLEA 2XGEA 1HDDC 3E7LA 4QPOA 2LK2A 4BQNA 2BOLA 2EA2A 2LTPA 4FASD 4IKFA 2M7AA 3P5JA 1VQ6I 1TTYA 2BHYA 2EFPA 2M2EA 2IGNA 1VQPI 4A2UA 2ZJPF 3BQYA 2I5UA 3HB9A 2OPTA 3V42A 2M4KA 5D8LB 1OFCX 3RPQA 1P2FA 2K3FA 3B73A 3OYDA 1BR1A 3PQKA 3F8BA 5E3MA 1AA7A 2VOPA 2O03A 3PNTA 1GT0C 2NS8A 3H9JA 4OAYA 1W0UA 1K79A 2ETHA 2FNAA 3KCCA 1X2NA 1T08B 3CJQB 1U9OA 1IJWC 1R5HA 2ZNYA 4BYYA 1WH7A 1HOMA 3HOUJ 3I9V2 1STZA 1ON1A 3HEFA 2CQNA 3GTPJ 4L5EA 3CMAI 3NARA 4YELA 5FLXK 2E60A 2JK3A 4WXHA 4XLFA 5J4VA 1HW2A 1O3RA 2RQQA 1S8NA 2NVYJ 4KJZA 1JGGA 1VZ0A 4AU7A 5JHUA 5GAHJ 1P6RA 4AVZA 4F91B 1D0YA 2KRHA 1USSA 1IN5A 1FP2A 2ID6A 4ZZDA 1U3EM 3RSNA 4MHGA 5FKNA 2DT7B 1FOXA 4N0BA 1WKMA 3N97A 2F4OB 3KYDB 1IAWA 4PFPA 4B3XA 4MQ9F 2MFZA 4ETSA 1G4DA 2NS0A 3D5RC 1SFXA 4V2GA 3HPHA 4DQ2A 1RESA 3PO3J 1TWCJ 3VWBA 2OJED 2D45A 3WGGA 1RKTA 2DPUA 3E5UA 1YI2I 3F72A 4XKVA 4OMYA 4DW6A 3IRRA 2ZXWH 3U21A 2XAQA 4BBSJ 4AYBN 3L7WA 4NDLA 1BC7C 3M3YJ 2WY8Q 1QQIA 2X9DA 3IP4B 2K9QA 4NHJA 2BY0A 3CCQI 3G1OA 4BHCA 1W5CC 1UAAA 3BPVA 5TISC 4OINF 3T5XA 3FMSA 1ZELA 3GBGA 4LGWA 2E5ZA 3DTIA 3WU1B 2KIFA 2HTSA 3BC8A 4KT5C 1KYZA 2K7LA 2LC2A 1XTAA 1X19A 1SAXA 3IH4A 2RAEA 1QZEA 1QHHD 5AONA 4A3BJ 1FMVA 4MFDA 2Q1ZB 1T38A 1ZG5A 1YW9A 1PYVA 3NWTA 1ODDA 3ERED 1FYKA 1BIBA 3OY9A 2K40A 5L3GA 3KP4A 1I50J 2P0WA 4LG3A 1YTYA 4DJAA 2GLOA 3W2WA 2ZCWA 2EFWA 1IN4A 4C3JJ 3PSFA 5A2QK 4D0PA 3FZVA 3JRHA 2W25A 2XAFA 2CW8A 3F8FA 2HOAA 1X4PA 3F6VA 4KIFA 2E36A 2COMA 3OIQA 2A6HF 5H6RA 2AXLA 2STWA 2V26A 5D8KB 1SD5A 1SEUA 5IT3A 3LNQA 3TDUC 4KNYA 2GQQA 1GXQA 3ZPLA 4KA4A 1DUXC 1UELB 1VNDA 3P9KA 4C30A 4RAYA 4UUSB 3TP3A 2LMDA 1JUPA 5HDNA 3CC7I 2I10A 3M7GA 3PUBA 3TW7A 4EM1A 4I6ZA 4XLNF 4HYEA 3SZPA 2ZFWA 2V1UA 3CJNA 3EQLF 3SEZA 2LKPA 4PGHA 1ONVA 5H6QA 4NQWA 1E3HA 5F04A 5BPDA 3LA7A 5KCMA 3CC2I 3CJRB 1TW3A 5HLIA 1MMNA 1QO0D 1IZ1A 2XIGA 1R7JA 2UXXA 1I5ZA 3F3XA 3OOPA 2JRTA 3HOZJ 3ISPA 3S2DJ 3HSEA 1W7PB 3GTKJ 1YW8A 4Q5SF 2ZSHB 5LHIA 3LL7A 1Y1VJ 3HPGA 1WWXA 1U0JA 1FBSA 1H89C 4A0ZA 1G2HA 1K83J 3V4GA 1FYMA 4EEFG 3HSFA 1B9MA 1V5EA 2PMUA 3L2UA 3HDDA 1D5YA 3P7NA 3HRSA 3F8NA 5A2QZ 2QVOA 2KL4A 2QQBA 3FK6A 4DYQA 3H3UA 2OF7A 3TOBA 3JW4A 3DXJF 3KETA 1G3WA 4KYWA 1ZAOA 2DTRA 3EUHC 3V8KA 1OCPA 1EV7A 5B3SH 1LNWA 2JT1A 4E4HA 3K6GA 2PMZA 5J1YA 1MH3A 2MLKA 2X85A 2XC7A 5E8GA 3CUQA 2ID3A 5IOZA 2OU2A 3Q9SA 4A3KJ 5L3BA 1XGSA 2H27A 4HF1A 4L0ZB 1NH3A 4A3FJ 2FJ1A 1YQAA 1X1CA 2HXIA 3BG9A 3FK7A 4XM3A 2DOAA 1VQNI 3DTKA 1A35A 2E34A 3ROUA 1P92A 1FBQA 3S2WA 4C2UA 4HOBA 1XGOA 2JWTA 1J0RA 5GAGJ 4OIQF 3OYFA 3RYRA 3TP0A 2VB6A 5IYCJ 2QQAA 1SC7A 2AO9A 3F23A 1EH6A 2VPLA 2E5NA 1BJAA 3SDGA 4JP0A 1MDMA 1QBJA 5BOXA 3TOAA 2CJJA 2B7EA 1Y56A 4HQMA 5E79C 2XDVA 2X51A 2LR8A 3BCBA 5TGTA 3CCLI 3TKYA 3E0JB 5CVJA 5GAEJ 3KEOA 5LHGA 3RKQA 4PJ0C 2VN2A 2QBYA 2RGVA 1JHHA 2HFHA 2IGKA 3DFGA 4OOIA 4ZZLA 1GXPA 3LAPA 3I56I 4P9UA 3W2VA 2DW4A 2IA1A 3E97A 5M5WJ 5M3FJ 2GAUA 4P1WA 4EATA 3ZQLA 1JKOC 3OYMA 4BXXJ 1RUNA 3E6DA 1ULYA 1FSEA 4Y52J 3I0TA 2JMWA 2YS9A 5F64A 4Q48A 1FC3A 3BG6A 2XB0X 2HKXA 4A12A 3C18A 1YHQI 3F8MA 2Y0SN 3LSKA 1G3SA 3S3NA 3BR0A 2MD5A 3L00A 4M3FA 4RBOA 1MW7A 4IZZA 4E7LA 2O9LA 1OCTC 3OS2A 1ZH5A 2V9PA 3A1YA 4G6DA 2F5DA 4EJVA 2DFEA 3FKJA 2VBWA 5EEHA 3BROA 2Z2SB 4II2A 1MNEA 1EF4A 3AG2H 4FE7A 2LBFB 1HBXG 3JCUC 1YYVA 1RR7A 3F22A 2W57A 3RJPA 1R6RA 2R7OA 3GLXA 1BC8C 2IS4A 2XPVA 4OAZA 3GFJA 4Y4RA 2LNBA 1DDNA 5GPCA 1ETOA 4GFBA 3M9AA 2R7VA 2FE3A 2DO7A 5EYRA 5IPAA 4N9IA 1U9NA 1E3OC 3H0GJ 3DKXA 1F9NA 1FWZA 4L9VA 2DOFA 2X6WA 2DDBA 2K27A 1DU0A 4JOMA 2ME6A 2VOOA 1DGRM 1SFUA 2XKOA 4BDZA 2VXDA 1LE8A 3CC4I 2UXNA 2Y0MA 1TL8A 4XR6A 1OR7C 3WHCA 4R79A 3GO5A 2W48A 5JVTA 4HG2A 4QWQA 1XN7A 2HQ5A 3ZQCA 2E71A 3ASOH 3JRGA 2L54A 4G12A 1R4NB 2JPBA 2OZUA 1MBFA 3DEEA 4E7ZA 3PUFA 2Z99A 3CUOA 5F08A 1XCVA 1OYYA 3HG9A 3I4NJ 5E1WA 4ENMA 3CCEI 3LA2A 1OYIA 2L9RA 1FIPA 5B1BH 1T0FA 2IGOA 2RN7A 3BJAA 3R0AA 4KN7X 4ZJZA 4IHVA 1SVLA 4BDYA 4B4CA 1VQ9I 3BTLA 3C2HA 1PUFA 2MSYA 1WJCA 2EFQA 1WZ2A 4Q4ZF 4BXFA 1IUYA 3IAM2 3ELKA 3WTSC 5J6XA 2MBFA 1XGMA 1Y8QB 1OYWA 5B1AH 2HVQA 4ON0A 1BI2A 1V55H 2EIMH 1KONA 1Y0UA 3L2QA 2MC4A 4RAGA 2DQLA 4D1QA 1ETWA 4HEA2 1FY7A 5CVIA 3G4SI 4GGGA 3K4LA 3O6BB 4HX4A 3IH2A 4P96A 4RLQA 3GEZA 4EV0A 3QYBA 5DD8A 1OJLA 3CO7C 2PQ8A 3M8EA 1QHGA 3LQRA 3GVAA 3MKLA 1RETA 1QGPA 1VFCA 1B72A 2ESNA 4RA2A 4CCNA 3QRFF 1W36D 2DT6A 1GVJA 4HX7A 4AYBA 2Z16A 2KKOA 3BY6A 4M9SA 1MNMC 3DU6A 1U5TC 3ERMA 3A01B 4I0BA 3HC7A 3W3CA 2DK8A 3LFUA 4JQFA 4A5NA 3J81K 5L3CA 3CMEI 1TBXA 4PFOA 4A6DA 4I09A 5C4XJ 1SVOA 2BEOA 2GXGA 1VQLI 3HBLA 1B1BA 5GPAA 3ZQ7A 3GYHX 3ONQA 4LD5A 4LG0A 3ZMZA 2CUFA 4DNCA 3LSRA 2LKSA 2R7XA 4GXOA 4M72A 4FTHA 4LB6B 4I0AA 1B8IA 2WAFA 1MD0A 2DA1A 5ICCA 1FOWA 4L0YB 3DKYA 5D5XB 1RRJA 3L09A 3BCAA 1WJ5A 3IAS2 1Y39A 4E7JA 1VQ8I 2M5WA 5ILSA 3G1MA 2XB5A 4RB3C 4AM3A 3HOSA 2MH2A 4HQEA 3BZ6A 1YS6A 2HZTA 3ZP5A 5DTDA 1EA3A 2NS7A 4IHYA 4MTDA 2DU9A 1FOYA 4IPAA 3HOYJ 1FLIA 1FTTA 2MC3A 4PGGA 4W1UA 3CO6C 2BW3B 4BUPA 3D5SC 1X58A 2VC1A 2KP6A 2P7CB 5FJ8J 3LMMA 1ZGAA 3RTRA 1G3TA 3DPTA 3H92A 3PIOF 2H6BA 3JSOA 1ETYA 4UHTA 1ITYA 2VL8A 4P9FA 1IN7A 2Y2ZA 5F0FA 2H1KA 3T8TA 2DFHA 2FF4A 2EA4A 2H6CA 2IA0A 4XRFA 4UY8I 1P7JA 3NRVA 3QQAA 1BI0A 5K7HA 3MKZA 3R61A 1HW5A 1Z6RA 4WXDA 2PJRB 2X6YA 4M3GA 4B8XA 2DMUA 1HC8A 2KZGA 3BJ6A 2ISYA 3LFKA 4PCQA 3FXLA 1BBYA 4BEHA 3K4MA 1YFHA 2L4AA 5L3EA 4A3EJ 1YRNB 4KIBA 4HDUA 2CO5A 2ZJQF 4U7DA 1Z3XA 2LDUA 2HVSA 1I1SA 3Q3SA 4XSXF 1BJZA 4J01A 4RAZA 1Z7UA 3EUAA 3WODF 3ZMTA 3W2AA 2HWVA 4XN3A 2Q2EA 1MIJA 2HOTA 4AUXA 2NAZA 3SZGA 4WWCA 3J7ZI 1K6OA 1GDTA 3E6CC 4P5OA 4CCOA 4DGWB 1KU7A 3B02A 3K1PA 5DCMA 5EJCA 4D7MA 1LFPA 4YFNF 1X1BA 5HLHA 2P81A 3HUGA 3OR1C 3L2WA 1K78A 2ADUA 4XKBA 2F6CA 1UG2A 5LEJA 2HDCA 1H9GA 3L2RA 1T2KA 2L01A 3QP5A 1JKQC 2W84A 1OLTA 3I54A 3GFIA 2QCOA 4B47A 2E35A 3DBHB 3U1KA 4ESFA 2L3DA 2Y75A 4IOCF 2VUMJ 4R1HA 1OQYA 3WGIA 5LD2C 2DA2A 1FIAA 2V7FA 1LUJB 2F48A 2DDAA 4UVBA 2X1CA 1Z0XA 2ZC2A 3A0HC 1WVRA 2DCEA 4BU2A 1QPIA 3VFZA 3IH3A 3LSIA 2L9VA 2N8GA 3PNVA 4G9YA 3KZZA 2HU9A 3K4CA 1FX7A 3BG5A 1T8IA 2AS5F 3NWSA 2M0CA 2ECCA 1ACIA 2VKHA 1NK2P 1IW7F 4E70A 2VE8A 1ZYRF 4XK4A 4MQVA 1FEXA 4IRHA 2XGDA 2P7VB 1V3FA 4CHUA 3CDLA 2PMHA 4A6EA 5HVQC 1OKRA 4DZPA 1H9TA 4IOAF 2W00A 2QSHX 2L2OA 1BM9A 3WTZA 4Y15A 5J40A 1R4MB 5D4SA 1PP7U 3CQZJ 5K1YA 1I3AA 1SANA 1Y6IA 4MEYF 5DYMA 1UCRA 3ZMUA 4KUMA 4MO7A 3HXLA 1ZRFA 1REPC 2VQHA 3FISA 2BGCA 1T98A 4PJLA 3VOEA 4WK8F 3GLLA 4P55A 2RKHA 5DCFA 3IL2A 1ZQ3P 4NB5A 4N4NB 4KN4X 3AAFA 5K7ZA 3FKIJ 3K70C 1HSTA 2EWNA 3OSGA 2RC4A 3ML6A 3TO7A 3MKWB 2Z1DA 1U5TB 2Y0SA 4XBFA 4AD9A 4ESJA 1ORKA 4DBRA 2M8GX 2EQRA 1R58A 2XKPA 2WC2A 4FQGA 4XLHA 1RIOH 2K4BA 3WU2C 5EZHA 3CCVI 4DYCA 2FMLA 1ENHA 2OC6A 3O8HA 1IXSB 3WTXC 1S7OA 2QQ9A 3ULQB 3RZOJ 4HRIA 3CTAA 3OR2C 2R5ZB 1ZRDA 3CCMI 1Z21A 2O61A 1ETKA 3CDIA 4FX0A 1UFMA 4IEJA 3WTUC 1LKXA 2L7FP 4JX6A 3EYIA 5EG0B 2O8XA 1S72I 1KU9A 5EGOA 3L1PA 4IX7A 2DYSH 4OWRB 2DA3A 1JUMA 4XKWA 5HOOA 2X6XA 2NVTJ 2C6YA 1Z9CA 3O2PE 1U8BA 1NTCA 2HDWA 2KIQA 2KJCA 2L7ZA 3ZXSA 3CD6I 4NUBA 3MZYA 2VASA 2BV6A 2W82A 1IV8A 1W7PD 5ERIA 2W1OA 1VQ7I 5FD6A 3T8RA 2YX7A 4BHBA 3CJTB 1XPXA 1MZBA 2CUJA 4A3GJ 4M73A 3HHGA 2R7TA 3PNYA 4RGUA 4OMZA 4UUTA 3GUDA 2CQXA 2Y31A 2ZBKA 1KQ8A 2X48A 3UNGC 4ZYEA 4TV7A 4CSWA 4A3DJ 2CG4A 4E7HA 2VBZA 3F0CA 4BQQA 1D0ZA 2LKXA 1Y8RB 5FFXA 2X6OA 2XHKA 2VE9A 2O6GE 1W4MA 4II3A 2CUZA 2GWRA 2D1VA 2R7FA 4WF2A 2UZKA 3V7RA 4I02A 4ESBA 1IGNA 2HI3A 3A03A 2EZIA 3DF8A 3D1NI 4V19K 1IUFA 1USTA 4N4OB 3ECOA 1VQ5I 3AG4H 4E6KG 3VDXA 3SFIA 1JXSA 2PEXA 4H4KC 1U2WA 1X1PA 3IKVA 4LK0F 1D5VA 4EJUA 1MJ9A 1J7KA 1DP7P 3BR6A 1J75A 4NQWB 3KX2A 1HDPA 4M6YA 3JRIA 4RB2C 1G8XA 2XF6A 2FOKA 1K6YA 5HODA 1IRFA 4X1EA 1R1UA 3FXUA 4XRSA 1R5ID 2XPWA 1XD7A 1XB4A 1VF9A 5E3NA 3CF5F 3NEUA 3OYBA 2LRDA 4WX9A 2DFFA 3HRUA 2K9LA 1N77A 3C2GA 3REOA 2HPIA 3DQVC 1ZG3A 4I98B 3Q9VA 4W97A 3HKZN 3KZIC 5FKMA 2F5CA 4KFCA 1H0MA 3OL3A 2PBIA 4CH7A 4UUVA 1QVTA 3VPRA 5C3EJ 1R71A 3H5AA 2Z3YA 5BQTA 4GDFA 1HKQA 3FHNA 3S1QJ 3RPUD 1SMYF 5FB2A 5K5QA 9ANTA 3H35A 2PLYA 3PQJA 2DQRA 4HSTA 4IVNA 5D5WB 1MBEA 4C3HJ 4B44A 1GV2A 4C2MJ 2V1XA 5JR3A 3ZRGA 4YRVA 2CRGA 1V4RA 2R7DA 1SFEA 3OWTA 2WADA 1IG7A 5KAFC 2JA5J 3AFHA 2M4GA 4CYCB 3QAHA 2VLAA 4OIOF 3BPXA 1DU6A 3QWLA 1PJRA 3K2AA 3I71A 4PSWA 3GX4X 2FRHA 3P9CA 1G59A 2OV7A 1A6IA 4CCKA 2E1OA 1NG6A 1V5GA 2O3FA 3MWMA 3MD2A 5E3OA 1TWGJ 2K5CA 4ENKA 3ZR8X 4BY7J 4O3MA 2IRFG 2KLOA 3LSJA 1D1CA 3QPTA 5FKOA 4XLPF 3I58A 3FX3A 2L7KA 4EM2A 4D5FA 1B6AA 4UNOA 2WB1A 1A5JA 1MDMB 1D1AA 5KK1A 3GWZA 5F1RA 2VC0A 3FIWA 1AWCA 3T0YA 5EZGA 4U7BA 3RKYA 5KNLA 3PL8A 4UB6C 1MBJA 3SDBA 4F92B 2Z9OA 4UUSA 4HZFA 4IQJA 1U6GA 2M34A 3BR2A 4I76A 3RCOA 3M8JA 3ZN0A 3I55I 4EGZA 5GADJ 3ZQHA 2A6EF 3K4KA 2QBYB 2ZO4A 1JT0A 2JVHA 3ZCOA 3FMQA 4FETA 1BOAA 4RGSA 2IW5A 1POGA 3I59A 3K9TA 3L2VA 1OCOH 4XL9A 2IGMA 2CUEA 2EZLA 3AKZA 4A93J 1X3ZB 3K4JA 4XRMA 1S5LC 2F5FA 2DAOA 4A3IJ 1Z3YA 2DPDA 3BDDA 1MJBA 5JLWA 4BY1J 5J1UA 3OS0A 2H94A 4AIHA 1Z1DA 2Y9YA 5D4RA 4AIKA 4S0HB 3WG7H 3BJOA 2E2JJ 4BGDA 4ZYHA 1LB2A 3I64A 1YLFA 2EH3A 3E5XA 2X4HA 3RYPA 3BG7A 4HA8A 2E1MC 1F4KA 2XSDC 3M4OJ 1JGSA 3OYLA 1YX3A 4FT8A 1O3QA 1Z6TA 3PSIA 1ZREA 1EH8A 3GTLJ 3WG9A 2JN6A 3HTUA 2Y30A 2OCCH 2RV8A 3A02A 4XNFA 2OTJI 2XRLA 3C2BA 3OOUA 3D5LA 2Y9ZA 1IRZA 4PJMA 3S32A 1ON2A 1MH4A 4BHPA 3R6SA 1K4SA 6PAXA 4E7IA 2A61A 3QODA 4IF4A 1F1ZA 4M9XA 3CLOA 2LY1A 3GF2A 2GXAA 2O8KA 1QRYA 2KMUA 5HDGA 2HTJA 2OZ6A 5ILUA 2G7UA 2NXNB 2EIKH 4XSZF 2R7QA 4DZJA 3BR1A 3RDIA 5LFAA 3S2HJ 1B59A 5HS9A 2KRCA 1W0TA 2FSWA 2QYOA 2PI0A 3VSKA 5ICGA 1MMSA 3UR3C 2EINH 3L2CA 1WGXA 3ZMSA 2IAIA 1U8RA 3UKGA 2VBYA 1WJBA 2TDXA 1VTNC 5FFZA 2HOSA 2VQCA 1IRXA 2NYXA 2OQGA 3E6MA 2BHZA 3F6OA 2LLKA 3S8PA 2IBDA 2WA0A 5D6FA 2MA3A 3D0SA 3FHZA 4JX4A 3TEDA 1Q1HA 1V5FA 1T39A 1IN6A 4KDPA 4XLCA 5E20A 4M74A 2HYFA 1ZHFA 4PJNA 2F4IA 1ZTRA 1W5SA 2ZXJA 2XASA 3BT9A 5IOYA 3IWFA 5F1JA 1PUFB 1HLVA 2GXBA 1I39A 3HOWJ 3TMOA 1CF7B 2JQ7A 3CF2A 5GP9A 3VODA 1O7FA 4ZYAA 3I3LA 3FWEA 1YO5C 3SYTA 3ZGKA 2PN6A 1ERDA 1BR2A 5CQGA 3GFLA 4BJ5C 5DUIA 5M5XJ 3JRCA 4KMFA 1DPUA 3N4MA 3BTIA 2E1NA 3BOQA 2VQLA 2EZHA 2M7BA 4BXUA 5J47A 2JUCA 5CLSA 3BR5A 1YJWI 3SZTA 4A5MA 3S14J 2HXOA 4QSHA 4KIGA 3GTJJ 1RUOA 3BG3A 2KIMA 2GBYA 4HX8A 1AOYA 4ABZA 3KPHA 5TRDA 4I01A 3LWFA 2M0MA 5JFRA 1TWHJ 1Z77A 1BA5A 1YOVB 3JTHA 4M6XA 1BR4A 2VIXA 4ZDPA 4BBRJ 4F55A 4G94A 1W5TA 3L9FA 4C2TA 4MFEA 1SVMA 2M45A 5CKTA 3CP2A 5CPRB 5GTHC 2LBFA 1WFXA 3VYUB 4G8XA 2G7HA 3GZ6A 1O3SA 2DXIA 3A4CA 2P5KA 1S7EA 1XSDA 2L9NA 2W4SA 5M3MJ 5DEQA 1SFKA 5L3FA 1TQMA 1FT9A 3K1NA 1YE9A 2XF5A 1U78A 5JHFA 1DQUA 5JI6A 3HOXJ 1R23A 2QSFX 3LSPA 4L9JA 1UHWA 3RQ4A 2CSOA 3MAJA 4ITVA 4MGRA 2ZMEA 4F93B 2BE5F 2H1LA 2NOJB 4U88A 3V8LA 1LQ1A 4LG0B 1TWFJ 1I27A 3GZ5A 4XRSG 5BMZA 4LB5A 2JA2A 1IRGA 1B8IB 1ZK8A 3E1SA 1FJLA 2BY1A 3K69A 5D6EA 2V4JC 3JREA 3Q0UA 3ABLH 5K5RA 1WJFA 2JJ7A 2KZVA 4QPQA 2J5OA 1MMAA 1LEBA 3EYYA 1IC8A 2KJBA 3OS1A 3SXYA 4LMYA 2KISA 2ELKA 2L9SA 3IHUA 1TLHB 2IS1A 4HSRA 3J7YJ 1MJAA 4ZYGA 2D5VA 2MG4A 3ZQGA 3H3ZA 3J80Z 2EIJH 3EUKL 2CWEA 1IV6A 3FM5A 4Z2YA 2YX4A 1FP1D 3H3VK 1H8AC 2YR2A 4EVIA 4UB8C 1R9TJ 2F2EA 4A3JJ 2ME0A 2J5PA 4A3MJ 3S3OA 1QNTA 2Q8KA 5BPIA 5F6FA 4KISA 2FMYA 1F43A 3G2BA 4FHTA 3WU0A 1PP8F 2VJJA 2QEXI 2LH9A 5D5VB 2DBBA 2DJIA 2XAGA 1J09A 1JI8A 4RS8A 4ZYDA 3CP8A 4BE2A 4IHWA 3VYRB 4GO1A 1FNNA 2XV4S 1AKHA 5FGMA 3FM3A 5LHHA 3RKXA 4A0XA 2W24A 2FBHA 3GW2A 2H8RA 2H8WA 2JZYA 4YIIA 4BEHB 2LY9A 3MZ8A 1ETVA 3TL4X 2E1MB 4J19A 3RIRA 3G6EI 2ECBA 3JSPA 3OYEA 3I53A 3EUHA 1JJ6C 4M3EA 2HNHA 4J00A 2DA6A 5LEKA 5CYVA 3DP7A 3VEPA 3QPSA 2HZDA 4LITA 5DDGA 1MBHA 1ZLJA 2DLLA 1ZG1A 2Q2EB 3GMEA 3GXOA 4EMSA 2ISZA 4OIRF 4XMYA 1R5GA 1NG7A 3KLNA 3MCZA 3OYAA 2R7WA 1LDDA 4XONA 2YU9J 1G6NA 3I4PA 3V8JA 3EDPA 2GA1A 4LJZF 5E8IA 4G6TB 3AG1H 2EV6A 2GA2A 4K2EA 5B66C 2CQKA 1RC9A 4HV5A 2NVUB 2CGPA 5IT9Z 4M71A 2KRFA 5HS8A 2PMZN 3QU6A 3C7JA 2A69F 1ZRCA 4HAMA 1JKRC 3LOCA 2ELHA 3QOPA 3ABMH 2A07F 2CS3A 4AWXB 2XVCA 3I4MJ 3P9IA 3FXKA 4HLXA 1LDJA 4PUSA 4CXFA 1XMXA 4FCYA 2LREA 1O7LA 2OAZA 3KP7A 2VI6A 1X1DA 2STTA 3QPLA 1TT0A 2ZNZA 1XMKA 3GTOJ 4YEJA 2G0EA 2K4JA 2FQ4A 1XCBA 1IN8A 2K9MA 4O6JA 2FNPA 1K61A 2R93J 2BW3A 4JX5A 3Q0VA 1EKEA 3V7SA 2OCEA 2QF7A 5FLMJ 2MGQA 4AIJA 5FKLA 2FX0A 2HVRA 3KLOA 2A6TA 2P6TA 3MMYB 3HL2A 1JHFA 3KIOA 5BS6A 1HKTA 1HSJA 2AQEA 2P8TA 2PG4A 3LSGA 3RZDJ 3PFIA 1JTYA 4D7NA 1T56A 2LY2A 3SJMA 5EEGA 3DLAA 3RKWA 3S1RJ 4HW0A 4M3DA 1R36A 1RNLA 4XOPA 4Y33A 3WE3A 1BI3A 3KYCB 1JE8A 2NNYA 2F4MB 4F52A 3JRDA 2VONA 1MNDA 1RZ4A 2CMPA 1LFUP 4WCGA 1B9NA 2TCTA 4C9YA 1E2XA 2BVMA 2CV2A 3HRMA 3CUQC 3K0LA 5H2FC 1YRNA 3NQOA 2RNGA 2B0LA 2L4MA 3GFMA 3K4BA 1I1GA 4CCMA 3CCRI 1PVEA 4MNUA 3Q0WA 5CQEA 2FU4A 2IPQX 2M30A 2R5YA 2GOMA 2HQNA 4JYKA 3QYFA 5CVUA 4IRIA 4IHSA 3CMMA 4CDGA 1D8JA 1W1WE 1Z67A 2CV0A 1YG2A 3PM1A 1LFBA 1FTZA 1VQ4I 3EETA 4Q47A 3J7AY 4LK1F 4YFXF 5M5YJ 3DWLE 2DT5A 5EDNA 2M1BA 2ZB9A 2ELJA 5J4YA 5IY5H 5HLTA 2ESHA 3LSTA 5HNFA 2ZFUA 1OR7A 4HPQA 2WY7Q 3KEQA 2WWYA 1ZKGA 3NAUA 2CFOA 2GZWA 3EPZA 4PSXA 3TQNA 3TW6A 3JRFA 2VXZA 2R7ZJ 2DMNA 2R4GA 1LVAA 3QU3A 4XIDA 4U0YA 3CCUI 2ZJRF 2LVSA 3IV5A 3HZJA 4RM3A 4EJTA 3MEXA 3DLLF 4YIRX 1RI7A 3VYSB 3MN2A 2DA4A 1IXCA 2BY2A 2DTZA 3KP6A 2MW8A 4PDKA 3BP8A 2QKMB 3LA3A 3C1DA 3S3MA 1YW7A 1P9QC 4ANJA 3OYJA 4DIQA 3GTGJ 1HKSA 3K1MA 2K85A 3MKYB 1DP3A 1SD4A 4CGZA 1Q1VA 2P5VA 1VI0A 1DGWY 1YITI 1XSVA 1IO2A 1L0OC 3FXOA 4C3IJ 2KQRA 1BN5A 2ICWG 1TNTA 4KICA 1KQ0A 1T6SA 4CUGA 1WPKA 4H0EA 1HA8A 5KHDA 3VB2A 4HNTA 2EV0A 4CYDA 4NBQA 4ENNA 2HEOA 2JSCA 1QZZA 5HLGA 2VPRA 5C4JJ 2BXYA 3HM5A 1YX5A 4PZJA 3S16J 1Z05A 1UZCA 3JAMZ 1FPQA 2M3AA 3OYCA 2UV1A 4IRGA 4U87A 3TDZC 2L0KA 4KT6A 2R92J 1WI9A 2Z5UA 2LD5A 5ICFA 3SFZA 4U0WA 2EFOA 4HV6A 4L18B 2HOEA 1ZARA 4GYIA 2HQRA 3FXJA 2KDZA 3ZQFA 2R3SA 2KDOA 1YJ9I 3AL0C 5CVVA 1TNSA 4I99C 2BBYA 4PK4A 1HF0A 3KYLA 2CH0A 3X2QH 4XORA 1HCRA 3PFYA 2FD5A 1U5TA 3OYGA 3OYKA 3ABKH 5J8CA 1S7AA 2LP0A 3BZKA 4BS9A 3ZMVA 3C3WA 2JPCA 2QKLB 1YIOA 2PX9A 4GRIA 3TBIA 5AIPA 4GCVA 1D0XA 3CLQA 2L02A 2QGUA 3W6KB 5DD4A 1H88C 4G7ZF 1D1BA 1TW2A 2R5ZA 3SEQA 1X3WB 4RGXA 3K70D 3K10A 3TO9A 3Q5FA 3CDHA 4HBLA 1J59A 1FBUA 2VJIA 5EG0A 2LSOA 2P4WA 1LEAA 4G7HF 2IA2A 2QLZA 4EJWA 2FBIA 3QPHA 3R60A 1BL0A 2LFBA 2VQGA 4M6VA 4ASNA 4B1RA 1EH7A 2QQ8A 1OCRH 2ZKZA 2L5QA 1T0FC 1TP4A 2KT0A 1O57A 2ZXHA 5J8FA 1APLC 2DMQA 2QSGX 4RB0A 4LFUA 4M9ZA 4OIPF 3SHFA 3CMYA 4XN0A 2JVGA 4ZC3A 1P4WA 1ZGJA 3K2ZA 4O5VA 3DEWA 5FLXZ 1UB9A 4NC8A 2UUZA 3COAC 4BKXA 2VJ4A 1OCZH 1C0WA 5AIQA 4IXAA 1XMAA 1MMGA 4MIMA 2RREA 2QUFA 2V79A 3FXQA 2ZMEC 4CZZA 2EZKA 2DMTA 1WH5A 4NC6A 1WRJA 4MEXF 2XGXA 5GTIC 2VKDA 3ABUA 2DFIA 1EJ9A 2JA8J 2VT3A 5HDKA 3H9QA 3DU5A 1MSFC 2OA4A 2DI3A 1E3PA 3ABTA 5DS9A 2ZJ2A 1IDYA 3ZMDA 3OIPA 2WAEA 3CUQB 4MLOA 2Y69H 2VODA 4EJOA 2V6EA 5D5UB 3B6AA 1HW1A 3H9GA 4ZH4F 2FEZA 2VKVA 5LBQA 1VQMI 2OUMA 1N75A 5C44J 3LQQA 4ZDOA 3I59B 5IYBJ 4BJ6C 4LLNA 4A0YA 2NNNA 1P4AA 5EF6A 1JKPC 1MGTA 2VKEA 2HS5A 4BE1A 1X1AA 3FXMA 2V9VA 5F27A 1IDZA 1YIJI 1YS7A 2QA4I 4N9HA 4UV9A 2FOWA 4G7OF 1KYWA 2F5VA 4Y17A 4RMNA 2K3PA 1Y0NA 2VJ5A 1WI3A 3DBRB 2B9SA 1WQ2A 3JRAA 4FE4A 4YG2F 2GIVA 3M1EA 2WAQN 2CW7A 3O3KA 4L5IA 2CFXA 1O3TA 2P5LC 2EB7A 3S1NJ 5LGUA 1JT6A 4U0VA 5K7FA 1X3UA 2IT0A 3MVPA 4CCLA 1R49A 3PO2J 2Z33A 2CQ7A 2X1DA 2RQPA 3BLYA 3KP2A 1AU7A 3HTSB 5FRMA 3F21A 4IHXA 1T33A 4WXCA 1RPWA 2P6SA 1OCCH 1BW5A 3HGGA 1AHDP 2GIZA 4R8HA 4XICA 4QLCU 2KPMA 5JLXA 4RDUA 1D3YA 2B63J 1XGNA 3B6CA 5TJJA 1W7PA 1TQPA 3HYIA 5CVRA 3GCMA 3V7CA 5BNGA 4B09A 2A05A 3JTGA 1CQTA 3BTJA 4CYCA 2Y48A 1LDKB 5LRSA 3WTVC 2WV0A 2PFBA 1S29A
chains in the Genus database with same CATH topology
4F93B 3L2RA 2NOJB 2GOXB 3OYNA 1OLTA 2WY8Q 2JA2A 3IP4B 4B47A 3E1SA 1UAAA 2V4JC 2MD0A 1WJFA 2KZVA 4QPQA 1ZELA 3GBGA 1MMAA 2E5ZA 2WBMA 5LD2C 2R7UA 3DTIA 3FBIB 3OS1A 2V7FA 3BC8A 1UG0A 4IQ4A 2L9SA 2X1CA 2IS1A 4HSRA 2LC2A 3IUOA 1X19A 2MYSA 1QHHD 2DCEA 3AL0B 4BU2A 1FMVA 2Q1ZB 3LSIA 1PYVA 3NWTA 3PNVA 3EUKL 4ZDLA 2HU9A 3K4CA 3OY9A 3NWSA 2P0WA 4LG3A 2VKHA 1SAUA 1GLNA 4DJAA 4LIVA 3W2WA 2BVLA 3CZ6A 2LG4A 3PSFA 3S3OA 2CV1A 3KEYA 4XOTA 2R7RA 4KISA 5HVQC 3G2BA 2W00A 2CW8A 2VJJA 4BACA 1X4PA 2LH9A 1LVKA 2DJIA 2L2OA 1J09A 2IS2A 1JI8A 1X4OA 3OIQA 3CP8A 4BE2A 3VYRB 2W7NA 2V26A 4KITB 1S9HA 1Y6IA 4F3QA 2A5WA 3HXLA 2VQHA 1UELB 3DTEA 4BEHB 2FUG2 4C30A 3TL4X 4PJLA 4HNUA 2E1MB 3OYEA 3PUBA 4N4NB 2HNHA 3K70C 4J00A 3SEZA 3MKWB 2Z1DA 5KCMA 2HZDA 4LITA 3CJRB 4ZTJA 2Y0SA 1MMNA 2Q2EB 4DBRA 3H0DA 4XLHA 1MMDA 4XMYA 1NG7A 3OYAA 2R7WA 4XONA 2OC6A 1W36C 4G6TB 2JUGA 2ZSHB 4HRIA 3LL7A 3OR2C 3HPGA 1U0JA 1Z21A 1V5EA 1LKXA 3L2UA 2KL4A 4BL0B 4IX7A 3H5NA 4OWRB 2CS3A 4XKWA 5HOOA 2X6XA 3EUHC 4PUSA 2LREA 3OYHA 3OL4A 2HDWA 3ZXSA 4E4HA 4CA0A 1X1DA 4NUBA 3K6GA 4B43A 2PMZA 1TT0A 2VASA 2W82A 2W1OA 2X85A 4YEJA 2XC7A 4BE0A 2CUJA 2K9MA 2R7TA 3PNYA 2BW3A 3FDYA 1X1CA 4XM3A 3UNGC 2DOAA 1N78A 3DTKA 3N05A 3DPLC 4CSWA 3S93A 4E7HA 4C2UA 2HVRA 4BQQA 1D0ZA 2A6TA 3MMYB 3OYFA 3HL2A 2VB6A 4DBQA 4XQFA 2AQEA 4II3A 2CUZA 3LSGA 3H5RA 4E7KA 3FBNB 2VPLA 2LY2A 2X1EA 2E5NA 3DLAA 3K4NA 4CZCA 2ZXIA 4XOPA 4Y33A 1Y56A 4N4OB 2XDVA 2X51A 4F52A 4E6KG 1MNDA 3BCBA 5TGTA 2CMPA 3VDXA 3E0JB 4C9YA 4H4KC 2BVMA 2CV2A 1WJAA 2RNGA 2IS6A 4CCMA 3K4BA 4NQWB 3KX2A 2IGKA 5CQEA 4DOZA 1FMWA 1QU3A 1G8XA 2XF6A 1K6YA 3W2VA 2GOMA 4P1WA 3QYFA 4EATA 3OMYA 5HNHA 3CMMA 3OYMA 2LYCA 2CV0A 3OYBA 2LRDA 2K9LA 4BQOA 1N77A 3C2GA 3BG6A 3J7AY 2HPIA 3DQVC 2LOOA 4D9JA 3DWLE 5FRNA 2ZSIB 2JSPA 3LSKA 1Z7LA 2ELJA 2I8DA 3OL3A 3S3NA 1MW7A 4CH7A 5HLTA 4IZZA 5HNFA 4E7LA 2ZFUA 2XF7A 3OS2A 4HPQA 2WY7Q 3A1YA 3H5AA 2CFOA 3EPZA 4PSXA 3FHNA 2VXZA 3RPUD 2R4GA 3FKJA 2Z2SB 4RM3A 3H35A 4II2A 1MNEA 2MABA 3HKZA 3VYSB 2LBFB 4HSTA 3VYTB 2IXSA 4B44A 1R6RA 2R7OA 2QKMB 2IS4A 4OAZA 4Y4RA 3M1CA 3ZRGA 1P9QC 4ANJA 4YRVA 3OYJA 3S3MA 3OWTA 4DIQA 2R7VA 2WADA 3MKYB 3HUGB 3AFHA 2M4GA 1DP3A 1DGWY 3DKXA 2VLAA 2V1NA 2X6WA 2KQRA 1PJRA 4JOMA 4PSWA 1DGRM 4BDZA 2VXDA 1WJDA 4CUGA 1G59A 1HA8A 1TZLA 2OV7A 4CCKA 5KHDA 1V5GA 1NG6A 4HNTA 3MD2A 4XR6A 1OR7C 2K5CA 4R79A 3ZR8X 2KLOA 4HG2A 1D1CA 2UWMA 1YX5A 2L7KA 2XAUA 2WB1A 3DEEA 4E7ZA 2M3AA 3OYCA 1D1AA 2UV1A 4U87A 4KT6A 2HQAA 1WJEA 4U7BA 5KNLA 3PL8A 3HG9A 3SDBA 4F92B 4PJJA 4IQJA 3RCOA 3LSMA 2HPMA 2KDOA 3M8JA 3AL0C 3K4KA 3QYEA 2JVHA 3ZCOA 2IGOA 4PK4A 3KYLA 2CH0A 3CESA 4FETA 3PJRA 4ZJZA 4XORA 3A2KA 2O5RA 3PFYA 3L2VA 4BDYA 2WAQA 4XKCA 2V9KA 3OYKA 3OYGA 4XL9A 2IGMA 3C2HA 1WJCA 3AKZA 2KHMA 4BS9A 3K4JA 4E7SA 2QKLB 4BXFA 4RM2A 1Z3YA 3IAM2 4GRIA 3TBIA 1D0XA 2HVQA 3OS0A 1KONA 3L2QA 1D1BA 2MC4A 3SEQA 4D1QA 2PJRA 3OYIA 3K10A 4HEA2 3K70D 4NC7A 3K4LA 4BGDA 2VJIA 4RLQA 4RLFA 3QYBA 1QHGA 3ZQQA 3BG7A 2E1MC 2VQGA 3OYLA 1YX3A 1T95A 2XSJC 2L5QA 3PSIA 4CCNA 3F9KA 5FROA 1T0FC 4ZTFA 4Y3OA 2DT6A 4X0GA 1W36D 4AYBA 2ZXHA 2Z16A 3QOEA 2AQFA 4XLAA 3DU6A 4XNFA 1BOBA 4XN0A 3HC7A 3W3CA 2JVGA 3OOUA 3DPUA 3D5LA 3LFUA 4JQFA 4ZC3A 4CCJA 4PJMA 3S32A 4PFOA 1E0EA 3VSLA 4LIUA 4E7IA 3QODA 4NC8A 2UUZA 2LY1A 2VJ4A 3LSHA 2KMUA 3ONQA 4BJTA 1MMGA 2R7XA 2RREA 2R7SA 3HOTA 2R7QA 4B48A 5LFAA 2WAFA 4NNJA 2KRCA 3DKYA 4XLEA 2VKDA 4QPOA 3BCAA 3VSKA 1WJ5A 2BOLA 3IAS2 3UR3C 4BQNA 4FASD 2M7AA 4IKFA 3H9QA 3DU5A 4E7JA 2IGNA 1WJBA 2VQCA 1IRXA 3V42A 3HOSA 3OIPA 2WAEA 3S8PA 2M4KA 2WA0A 4MLOA 1EA3A 3OYDA 2V6EA 1V5FA 1BR1A 3H9GA 4XLCA 2BW3B 4BUPA 3D5SC 1AA7A 2OUMA 2KP6A 1N75A 3PNTA 4PJNA 2F4IA 4ZDOA 3LMMA 3H9JA 3RTRA 3DPTA 4BJ6C 4OAYA 3TMOA 4BE1A 1X1AA 3CJQB 2VL8A 3CF2A 4ZYAA 3I3LA 3SYTA 3ZGKA 2F5VA 3I9V2 4RMNA 2K3PA 1ERDA 1BR2A 5CQGA 4BJ5C 2VJ5A 3MKZA 2VQLA 2M7BA 2PJRB 2CW7A 4YELA 2X6YA 2E60A 4XLFA 4BEHA 3K4MA 2RQQA 4KJZA 1VZ0A 4AU7A 2M0MA 4CCLA 1BR4A 2VIXA 2X1DA 3BLYA 4ZDPA 4AVZA 1Z3XA 4F55A 1D0YA 4F91B 2KRHA 2HVSA 4C2TA 5FRMA 4J01A 3RSNA 5CKTA 3CP2A 3EUAA 5CPRB 2DT7B 3W2AA 2LBFA 1WFXA 3VYUB 2DXIA 4XN3A 3A4CA 4PFPA 2L9NA 2KPMA 4B3XA 2W4SA 2MFZA 3SZGA 3D5RC 1SFKA 1YE9A 2XF5A 5JHFA 1DQUA 3HPHA 4P5OA 4CCOA 4DGWB 1LFPA 3RQ4A 1X1BA 3L2WA 4ITVA 3OR1C 3VWBA 1LDKB 4XKBA 2F6CA 4XKVA 3U21A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VZ0 A;  3MKW B;  3VWB A;  3W3C A;  3MKZ A;  3W2A A;  3MKY B; 
#chains in the Genus database with same CATH topology
 2D2W A;  2GOX B;  2DJN A;  3OYN A;  3H1C A;  4AVP A;  2EV5 A;  2RNJ A;  2W85 A;  2MD0 A;  5IP9 J;  5E1X A;  3OIO A;  3DBL B;  3BR3 A;  2OD5 A;  1QPM A;  2OQR A;  2WBM A;  2R7U A;  3FBI B;  2A5Y B;  1SD7 A;  4JK1 X;  1UG0 A;  3JR9 A;  4IQ4 A;  2DOE A;  2E7W A;  4AC0 A;  3IUO A;  4Y13 A;  5DM6 F;  2K02 A;  2MYS A;  3GTQ J;  3AL0 B;  4IHT A;  4HNV A;  3S17 J;  1J5Y A;  2X0L A;  4ZDL A;  3ZQI A;  4BAY A;  1JJ8 C;  4V2F A;  2DK5 A;  3MQ0 A;  2JRM A;  1SAU A;  1GLN A;  3A0B C;  4LIV A;  4IO9 F;  2BVL A;  3CZ6 A;  2IEK A;  5FKK A;  2LG4 A;  4YFK F;  2VBX A;  4YIF A;  2CV1 A;  1LE8 B;  3KEY A;  4XOT A;  2R7R A;  2YSR A;  2GM4 A;  3ZN1 A;  4BAC A;  1FZP B;  3K7A J;  2XAH A;  1LVK A;  3HRT A;  2IS2 A;  1X4O A;  1K4T A;  2W7N A;  2CQQ A;  3SQN A;  1KU2 A;  3J7A O;  2EFN A;  4KIT B;  3CCY A;  1S9H A;  4UXN A;  2HKO A;  4F3Q A;  2A5W A;  2FBK A;  3QP6 A;  2EIL H;  5DV5 A;  3DTE A;  2HPM A;  2FUG 2;  4HNU A;  1MBG A;  1F5T A;  3IKT A;  4HF2 A;  2WV1 A;  5E3L A;  3G73 A;  1XDU A;  2LF7 A;  4EGY A;  1J9I A;  2QM3 A;  1WCM J;  2YUS A;  1FSH A;  3E5Q A;  1XX5 A;  4UV8 A;  2DA7 A;  3G71 I;  3RPU A;  3GTM J;  4ZTJ A;  3G3Z A;  5F0C A;  1R22 A;  2BXZ A;  1BI1 A;  1A31 A;  3H0D A;  1Y1W J;  1MMD A;  2FA5 A;  2DOD A;  4QIW N;  2MH9 A;  1FOK A;  3R0J A;  1J2X A;  5E18 F;  1W36 C;  3BZC A;  1PUE E;  2JUG A;  1MBK A;  4LLG F;  3KP3 A;  2ZME B;  5ICE A;  2HR3 A;  1G3Y A;  3J80 K;  1R00 A;  2CU7 A;  1VQO I;  5JVG F;  4BL0 B;  4EM0 B;  3H5N A;  3MFK A;  2COB A;  1B72 B;  1UMQ A;  2YPR A;  5LRR A;  3OYH A;  3OL4 A;  2IJL A;  1TQI A;  1JTX A;  4CA0 A;  4B43 A;  3E6B A;  2NVX J;  1IF1 A;  1ZR4 A;  4MTE A;  1F36 A;  2R0Q C;  4Y7N J;  1ETX A;  4UVC A;  4BE0 A;  1KQ9 A;  1LJ9 A;  3F8C A;  3TO6 A;  1B4A A;  2DMP A;  2V1D A;  1R1V A;  2G9W A;  3CCS I;  3AG3 H;  4I7H A;  1P7I A;  4EQQ A;  3ECH A;  3FDY A;  1N78 A;  3N05 A;  3DPL C;  3GZN B;  3H36 A;  2A3S A;  2A68 F;  3S93 A;  2E2I J;  1NHA A;  1I3Q J;  5ILV A;  4DBQ A;  5ED4 A;  1VQK I;  1A36 A;  4XQF A;  1CF7 A;  5IYD J;  2YU3 A;  2RVC A;  2CW0 F;  3H5R A;  4E7K A;  3FBN B;  2X1E A;  3E3V A;  4OU0 A;  3K4N A;  1AKH B;  3OV8 A;  4CZC A;  3HIF A;  1QZY A;  2EBI A;  4HLY A;  2ZXI A;  4X6A J;  2XAJ A;  3T1B A;  3G1L A;  1NK3 P;  1RKW A;  1Z91 A;  2CYY A;  4A3L J;  3M8F A;  2F5E A;  1M1E B;  5EEA A;  3U1D A;  1GUU A;  4AID A;  3DEU A;  3FF5 A;  2HYG D;  2K86 A;  3W6J B;  4DYR A;  1KGS A;  5IT9 K;  1WJA A;  2IS6 A;  3W6V A;  4B3A A;  1I6H J;  4F7Z A;  4DOZ A;  1FMW A;  2QEN A;  5IP7 J;  1QU3 A;  4IL6 C;  1YJN I;  2HGC A;  2LF8 A;  3OSF A;  1XC5 A;  5HNH A;  3OMY A;  1A04 A;  1OMI A;  4ENJ A;  2LYC A;  1ZLK A;  4CIC A;  5E17 F;  2DN0 A;  1KA8 A;  4BQO A;  4LLL A;  1UJ8 A;  2IP2 A;  3S1M J;  2LOO A;  4D9J A;  2K9S A;  5K5O A;  5FRN A;  2E1C A;  2ZSI B;  1IXR C;  1O4X A;  2JSP A;  5CJ9 A;  1TT5 B;  1Z7L A;  2I8D A;  5J3L A;  3ZOB A;  4UVA A;  1R1T A;  4BQA A;  2XF7 A;  2M9H A;  4LOC A;  1TWA J;  1XDS A;  5LGN A;  2QZ8 A;  1I6X A;  3FMR A;  2JA6 J;  3WTW C;  5HS7 A;  4KMU X;  2DA5 A;  5DM7 F;  1CGP A;  3HJE A;  2O7O A;  3O8G A;  4I2O A;  3BWG A;  5LGT A;  2MAB A;  3HKZ A;  2RDP A;  4RAF A;  3DKW A;  3HHH A;  5IP6 A;  5F0H A;  2M87 A;  2BYV E;  2NOG A;  3VYT B;  2IXS A;  1GHC A;  1OIS A;  1SMT A;  2D1H A;  3A01 A;  3HOV J;  1UHS A;  2NVQ J;  1TC3 C;  1BW6 A;  3M1C A;  1N25 A;  2AXT C;  3FXR A;  5H20 A;  2BZT A;  5DCM B;  3WGH A;  4HDV A;  4S05 A;  1K78 B;  1KU3 A;  3HUG B;  1OPC A;  3KE2 A;  4A3C J;  3HGY A;  1HXD A;  2WB1 N;  1S3J A;  2V1N A;  2E2H J;  2XUB A;  1ZR2 A;  2BY3 A;  2E7X A;  4QTR A;  1WJD A;  2O0Y A;  2QWW A;  1S6L A;  1TZL A;  1UHM A;  3KP5 A;  5DUK A;  5B5E C;  1RR8 C;  1MSE C;  2IVM A;  3M07 A;  5FLV A;  1ZGW A;  3ASN H;  1E17 A;  1KZH A;  2VT2 A;  2UWM A;  1BIA A;  4RGR A;  3J81 Z;  2XAU A;  1DPR A;  2XPU A;  2HQA A;  1WJE A;  2FXA A;  3RI4 A;  2KIU A;  1JUS A;  4G6Q A;  4PJJ A;  4D5C A;  3IRQ A;  5J1R A;  1LPQ A;  3LSM A;  3U9G A;  1D8K A;  3ESW B;  4BH9 A;  2NRA C;  3QYE A;  2EK5 A;  4JBA A;  3WTT C;  1SFO J;  4GYG A;  3PJR A;  3CES A;  1ZN2 A;  3JRB A;  2ACJ A;  5KVR A;  1XSX A;  3U2R A;  3A2K A;  2O5R A;  2AHQ A;  2H09 A;  2WAQ A;  4XKC A;  2V9K A;  2R5Y B;  3S15 J;  4FX4 A;  5KAI C;  3LAJ A;  1K7A A;  2KHM A;  1A6Q A;  1WSU A;  4E7S A;  3DCF A;  4RM2 A;  2EPF A;  3R4K A;  2E19 A;  1GVD A;  2K9N A;  2WTE A;  2Q0O A;  3KZY A;  4FIS A;  3DV8 A;  2XRO A;  2EJR A;  2KFD A;  2PJR A;  3PIP F;  3OYI A;  1MKM A;  4L9N A;  4NC7 A;  4Z6Y A;  1L3L A;  3MZH A;  4RLF A;  4A69 C;  3IC7 A;  3ZQQ A;  1XG1 A;  4S04 A;  5E1Z B;  3WE2 A;  1QVU A;  1WHU A;  4BNC A;  2PJP A;  4CO8 A;  1FYL A;  1X2M A;  5L3D A;  1T95 A;  2XSJ C;  3F9K A;  5FRO A;  4M3B A;  4IJA A;  4ZTF A;  4Y3O A;  1V54 H;  3WHB A;  2V6C A;  4X0G A;  3HSR A;  4HF0 A;  5FD5 A;  1HQC A;  2DYR H;  2FQ3 A;  3QOE A;  5FO5 A;  1PDN C;  2AQF A;  4XLA A;  2HYJ A;  1BOB A;  3DPU A;  2XGC A;  4CCJ A;  1P4X A;  3WTY C;  1QA6 A;  4L9T A;  3JAM K;  1E0E A;  3BTC A;  2L7M P;  2MLG A;  3VSL A;  5LLQ A;  4LIU A;  3I5U A;  2JA7 J;  3KFW X;  1GV5 A;  4RB1 A;  2XRN A;  3CCJ I;  3RQI A;  3IWZ A;  3LSH A;  2OTL I;  3BQZ A;  4BJT A;  2JTV A;  2R7S A;  3HOT A;  3TGN A;  5EGO B;  2M8E A;  4B48 A;  1ETQ A;  2OBP A;  2TRT A;  4L5J A;  2HDD A;  1XS9 A;  4NNJ A;  1SD6 A;  4XLE A;  2XGE A;  1HDD C;  3E7L A;  4QPO A;  2LK2 A;  4BQN A;  2BOL A;  2EA2 A;  2LTP A;  4FAS D;  4IKF A;  2M7A A;  3P5J A;  1VQ6 I;  1TTY A;  2BHY A;  2EFP A;  2M2E A;  2IGN A;  1VQP I;  4A2U A;  2ZJP F;  3BQY A;  2I5U A;  3HB9 A;  2OPT A;  3V42 A;  2M4K A;  5D8L B;  1OFC X;  3RPQ A;  1P2F A;  2K3F A;  3B73 A;  3OYD A;  1BR1 A;  3PQK A;  3F8B A;  5E3M A;  1AA7 A;  2VOP A;  2O03 A;  3PNT A;  1GT0 C;  2NS8 A;  3H9J A;  4OAY A;  1W0U A;  1K79 A;  2ETH A;  2FNA A;  3KCC A;  1X2N A;  1T08 B;  3CJQ B;  1U9O A;  1IJW C;  1R5H A;  2ZNY A;  4BYY A;  1WH7 A;  1HOM A;  3HOU J;  3I9V 2;  1STZ A;  1ON1 A;  3HEF A;  2CQN A;  3GTP J;  4L5E A;  3CMA I;  3NAR A;  4YEL A;  5FLX K;  2E60 A;  2JK3 A;  4WXH A;  4XLF A;  5J4V A;  1HW2 A;  1O3R A;  2RQQ A;  1S8N A;  2NVY J;  4KJZ A;  1JGG A;  1VZ0 A;  4AU7 A;  5JHU A;  5GAH J;  1P6R A;  4AVZ A;  4F91 B;  1D0Y A;  2KRH A;  1USS A;  1IN5 A;  1FP2 A;  2ID6 A;  4ZZD A;  1U3E M;  3RSN A;  4MHG A;  5FKN A;  2DT7 B;  1FOX A;  4N0B A;  1WKM A;  3N97 A;  2F4O B;  3KYD B;  1IAW A;  4PFP A;  4B3X A;  4MQ9 F;  2MFZ A;  4ETS A;  1G4D A;  2NS0 A;  3D5R C;  1SFX A;  4V2G A;  3HPH A;  4DQ2 A;  1RES A;  3PO3 J;  1TWC J;  3VWB A;  2OJE D;  2D45 A;  3WGG A;  1RKT A;  2DPU A;  3E5U A;  1YI2 I;  3F72 A;  4XKV A;  4OMY A;  4DW6 A;  3IRR A;  2ZXW H;  3U21 A;  2XAQ A;  4BBS J;  4AYB N;  3L7W A;  4NDL A;  1BC7 C;  3M3Y J;  2WY8 Q;  1QQI A;  2X9D A;  3IP4 B;  2K9Q A;  4NHJ A;  2BY0 A;  3CCQ I;  3G1O A;  4BHC A;  1W5C C;  1UAA A;  3BPV A;  5TIS C;  4OIN F;  3T5X A;  3FMS A;  1ZEL A;  3GBG A;  4LGW A;  2E5Z A;  3DTI A;  3WU1 B;  2KIF A;  2HTS A;  3BC8 A;  4KT5 C;  1KYZ A;  2K7L A;  2LC2 A;  1XTA A;  1X19 A;  1SAX A;  3IH4 A;  2RAE A;  1QZE A;  1QHH D;  5AON A;  4A3B J;  1FMV A;  4MFD A;  2Q1Z B;  1T38 A;  1ZG5 A;  1YW9 A;  1PYV A;  3NWT A;  1ODD A;  3ERE D;  1FYK A;  1BIB A;  3OY9 A;  2K40 A;  5L3G A;  3KP4 A;  1I50 J;  2P0W A;  4LG3 A;  1YTY A;  4DJA A;  2GLO A;  3W2W A;  2ZCW A;  2EFW A;  1IN4 A;  4C3J J;  3PSF A;  5A2Q K;  4D0P A;  3FZV A;  3JRH A;  2W25 A;  2XAF A;  2CW8 A;  3F8F A;  2HOA A;  1X4P A;  3F6V A;  4KIF A;  2E36 A;  2COM A;  3OIQ A;  2A6H F;  5H6R A;  2AXL A;  2STW A;  2V26 A;  5D8K B;  1SD5 A;  1SEU A;  5IT3 A;  3LNQ A;  3TDU C;  4KNY A;  2GQQ A;  1GXQ A;  3ZPL A;  4KA4 A;  1DUX C;  1UEL B;  1VND A;  3P9K A;  4C30 A;  4RAY A;  4UUS B;  3TP3 A;  2LMD A;  1JUP A;  5HDN A;  3CC7 I;  2I10 A;  3M7G A;  3PUB A;  3TW7 A;  4EM1 A;  4I6Z A;  4XLN F;  4HYE A;  3SZP A;  2ZFW A;  2V1U A;  3CJN A;  3EQL F;  3SEZ A;  2LKP A;  4PGH A;  1ONV A;  5H6Q A;  4NQW A;  1E3H A;  5F04 A;  5BPD A;  3LA7 A;  5KCM A;  3CC2 I;  3CJR B;  1TW3 A;  5HLI A;  1MMN A;  1QO0 D;  1IZ1 A;  2XIG A;  1R7J A;  2UXX A;  1I5Z A;  3F3X A;  3OOP A;  2JRT A;  3HOZ J;  3ISP A;  3S2D J;  3HSE A;  1W7P B;  3GTK J;  1YW8 A;  4Q5S F;  2ZSH B;  5LHI A;  3LL7 A;  1Y1V J;  3HPG A;  1WWX A;  1U0J A;  1FBS A;  1H89 C;  4A0Z A;  1G2H A;  1K83 J;  3V4G A;  1FYM A;  4EEF G;  3HSF A;  1B9M A;  1V5E A;  2PMU A;  3L2U A;  3HDD A;  1D5Y A;  3P7N A;  3HRS A;  3F8N A;  5A2Q Z;  2QVO A;  2KL4 A;  2QQB A;  3FK6 A;  4DYQ A;  3H3U A;  2OF7 A;  3TOB A;  3JW4 A;  3DXJ F;  3KET A;  1G3W A;  4KYW A;  1ZAO A;  2DTR A;  3EUH C;  3V8K A;  1OCP A;  1EV7 A;  5B3S H;  1LNW A;  2JT1 A;  4E4H A;  3K6G A;  2PMZ A;  5J1Y A;  1MH3 A;  2MLK A;  2X85 A;  2XC7 A;  5E8G A;  3CUQ A;  2ID3 A;  5IOZ A;  2OU2 A;  3Q9S A;  4A3K J;  5L3B A;  1XGS A;  2H27 A;  4HF1 A;  4L0Z B;  1NH3 A;  4A3F J;  2FJ1 A;  1YQA A;  1X1C A;  2HXI A;  3BG9 A;  3FK7 A;  4XM3 A;  2DOA A;  1VQN I;  3DTK A;  1A35 A;  2E34 A;  3ROU A;  1P92 A;  1FBQ A;  3S2W A;  4C2U A;  4HOB A;  1XGO A;  2JWT A;  1J0R A;  5GAG J;  4OIQ F;  3OYF A;  3RYR A;  3TP0 A;  2VB6 A;  5IYC J;  2QQA A;  1SC7 A;  2AO9 A;  3F23 A;  1EH6 A;  2VPL A;  2E5N A;  1BJA A;  3SDG A;  4JP0 A;  1MDM A;  1QBJ A;  5BOX A;  3TOA A;  2CJJ A;  2B7E A;  1Y56 A;  4HQM A;  5E79 C;  2XDV A;  2X51 A;  2LR8 A;  3BCB A;  5TGT A;  3CCL I;  3TKY A;  3E0J B;  5CVJ A;  5GAE J;  3KEO A;  5LHG A;  3RKQ A;  4PJ0 C;  2VN2 A;  2QBY A;  2RGV A;  1JHH A;  2HFH A;  2IGK A;  3DFG A;  4OOI A;  4ZZL A;  1GXP A;  3LAP A;  3I56 I;  4P9U A;  3W2V A;  2DW4 A;  2IA1 A;  3E97 A;  5M5W J;  5M3F J;  2GAU A;  4P1W A;  4EAT A;  3ZQL A;  1JKO C;  3OYM A;  4BXX J;  1RUN A;  3E6D A;  1ULY A;  1FSE A;  4Y52 J;  3I0T A;  2JMW A;  2YS9 A;  5F64 A;  4Q48 A;  1FC3 A;  3BG6 A;  2XB0 X;  2HKX A;  4A12 A;  3C18 A;  1YHQ I;  3F8M A;  2Y0S N;  3LSK A;  1G3S A;  3S3N A;  3BR0 A;  2MD5 A;  3L00 A;  4M3F A;  4RBO A;  1MW7 A;  4IZZ A;  4E7L A;  2O9L A;  1OCT C;  3OS2 A;  1ZH5 A;  2V9P A;  3A1Y A;  4G6D A;  2F5D A;  4EJV A;  2DFE A;  3FKJ A;  2VBW A;  5EEH A;  3BRO A;  2Z2S B;  4II2 A;  1MNE A;  1EF4 A;  3AG2 H;  4FE7 A;  2LBF B;  1HBX G;  3JCU C;  1YYV A;  1RR7 A;  3F22 A;  2W57 A;  3RJP A;  1R6R A;  2R7O A;  3GLX A;  1BC8 C;  2IS4 A;  2XPV A;  4OAZ A;  3GFJ A;  4Y4R A;  2LNB A;  1DDN A;  5GPC A;  1ETO A;  4GFB A;  3M9A A;  2R7V A;  2FE3 A;  2DO7 A;  5EYR A;  5IPA A;  4N9I A;  1U9N A;  1E3O C;  3H0G J;  3DKX A;  1F9N A;  1FWZ A;  4L9V A;  2DOF A;  2X6W A;  2DDB A;  2K27 A;  1DU0 A;  4JOM A;  2ME6 A;  2VOO A;  1DGR M;  1SFU A;  2XKO A;  4BDZ A;  2VXD A;  1LE8 A;  3CC4 I;  2UXN A;  2Y0M A;  1TL8 A;  4XR6 A;  1OR7 C;  3WHC A;  4R79 A;  3GO5 A;  2W48 A;  5JVT A;  4HG2 A;  4QWQ A;  1XN7 A;  2HQ5 A;  3ZQC A;  2E71 A;  3ASO H;  3JRG A;  2L54 A;  4G12 A;  1R4N B;  2JPB A;  2OZU A;  1MBF A;  3DEE A;  4E7Z A;  3PUF A;  2Z99 A;  3CUO A;  5F08 A;  1XCV A;  1OYY A;  3HG9 A;  3I4N J;  5E1W A;  4ENM A;  3CCE I;  3LA2 A;  1OYI A;  2L9R A;  1FIP A;  5B1B H;  1T0F A;  2IGO A;  2RN7 A;  3BJA A;  3R0A A;  4KN7 X;  4ZJZ A;  4IHV A;  1SVL A;  4BDY A;  4B4C A;  1VQ9 I;  3BTL A;  3C2H A;  1PUF A;  2MSY A;  1WJC A;  2EFQ A;  1WZ2 A;  4Q4Z F;  4BXF A;  1IUY A;  3IAM 2;  3ELK A;  3WTS C;  5J6X A;  2MBF A;  1XGM A;  1Y8Q B;  1OYW A;  5B1A H;  2HVQ A;  4ON0 A;  1BI2 A;  1V55 H;  2EIM H;  1KON A;  1Y0U A;  3L2Q A;  2MC4 A;  4RAG A;  2DQL A;  4D1Q A;  1ETW A;  4HEA 2;  1FY7 A;  5CVI A;  3G4S I;  4GGG A;  3K4L A;  3O6B B;  4HX4 A;  3IH2 A;  4P96 A;  4RLQ A;  3GEZ A;  4EV0 A;  3QYB A;  5DD8 A;  1OJL A;  3CO7 C;  2PQ8 A;  3M8E A;  1QHG A;  3LQR A;  3GVA A;  3MKL A;  1RET A;  1QGP A;  1VFC A;  1B72 A;  2ESN A;  4RA2 A;  4CCN A;  3QRF F;  1W36 D;  2DT6 A;  1GVJ A;  4HX7 A;  4AYB A;  2Z16 A;  2KKO A;  3BY6 A;  4M9S A;  1MNM C;  3DU6 A;  1U5T C;  3ERM A;  3A01 B;  4I0B A;  3HC7 A;  3W3C A;  2DK8 A;  3LFU A;  4JQF A;  4A5N A;  3J81 K;  5L3C A;  3CME I;  1TBX A;  4PFO A;  4A6D A;  4I09 A;  5C4X J;  1SVO A;  2BEO A;  2GXG A;  1VQL I;  3HBL A;  1B1B A;  5GPA A;  3ZQ7 A;  3GYH X;  3ONQ A;  4LD5 A;  4LG0 A;  3ZMZ A;  2CUF A;  4DNC A;  3LSR A;  2LKS A;  2R7X A;  4GXO A;  4M72 A;  4FTH A;  4LB6 B;  4I0A A;  1B8I A;  2WAF A;  1MD0 A;  2DA1 A;  5ICC A;  1FOW A;  4L0Y B;  3DKY A;  5D5X B;  1RRJ A;  3L09 A;  3BCA A;  1WJ5 A;  3IAS 2;  1Y39 A;  4E7J A;  1VQ8 I;  2M5W A;  5ILS A;  3G1M A;  2XB5 A;  4RB3 C;  4AM3 A;  3HOS A;  2MH2 A;  4HQE A;  3BZ6 A;  1YS6 A;  2HZT A;  3ZP5 A;  5DTD A;  1EA3 A;  2NS7 A;  4IHY A;  4MTD A;  2DU9 A;  1FOY A;  4IPA A;  3HOY J;  1FLI A;  1FTT A;  2MC3 A;  4PGG A;  4W1U A;  3CO6 C;  2BW3 B;  4BUP A;  3D5S C;  1X58 A;  2VC1 A;  2KP6 A;  2P7C B;  5FJ8 J;  3LMM A;  1ZGA A;  3RTR A;  1G3T A;  3DPT A;  3H92 A;  3PIO F;  2H6B A;  3JSO A;  1ETY A;  4UHT A;  1ITY A;  2VL8 A;  4P9F A;  1IN7 A;  2Y2Z A;  5F0F A;  2H1K A;  3T8T A;  2DFH A;  2FF4 A;  2EA4 A;  2H6C A;  2IA0 A;  4XRF A;  4UY8 I;  1P7J A;  3NRV A;  3QQA A;  1BI0 A;  5K7H A;  3MKZ A;  3R61 A;  1HW5 A;  1Z6R A;  4WXD A;  2PJR B;  2X6Y A;  4M3G A;  4B8X A;  2DMU A;  1HC8 A;  2KZG A;  3BJ6 A;  2ISY A;  3LFK A;  4PCQ A;  3FXL A;  1BBY A;  4BEH A;  3K4M A;  1YFH A;  2L4A A;  5L3E A;  4A3E J;  1YRN B;  4KIB A;  4HDU A;  2CO5 A;  2ZJQ F;  4U7D A;  1Z3X A;  2LDU A;  2HVS A;  1I1S A;  3Q3S A;  4XSX F;  1BJZ A;  4J01 A;  4RAZ A;  1Z7U A;  3EUA A;  3WOD F;  3ZMT A;  3W2A A;  2HWV A;  4XN3 A;  2Q2E A;  1MIJ A;  2HOT A;  4AUX A;  2NAZ A;  3SZG A;  4WWC A;  3J7Z I;  1K6O A;  1GDT A;  3E6C C;  4P5O A;  4CCO A;  4DGW B;  1KU7 A;  3B02 A;  3K1P A;  5DCM A;  5EJC A;  4D7M A;  1LFP A;  4YFN F;  1X1B A;  5HLH A;  2P81 A;  3HUG A;  3OR1 C;  3L2W A;  1K78 A;  2ADU A;  4XKB A;  2F6C A;  1UG2 A;  5LEJ A;  2HDC A;  1H9G A;  3L2R A;  1T2K A;  2L01 A;  3QP5 A;  1JKQ C;  2W84 A;  1OLT A;  3I54 A;  3GFI A;  2QCO A;  4B47 A;  2E35 A;  3DBH B;  3U1K A;  4ESF A;  2L3D A;  2Y75 A;  4IOC F;  2VUM J;  4R1H A;  1OQY A;  3WGI A;  5LD2 C;  2DA2 A;  1FIA A;  2V7F A;  1LUJ B;  2F48 A;  2DDA A;  4UVB A;  2X1C A;  1Z0X A;  2ZC2 A;  3A0H C;  1WVR A;  2DCE A;  4BU2 A;  1QPI A;  3VFZ A;  3IH3 A;  3LSI A;  2L9V A;  2N8G A;  3PNV A;  4G9Y A;  3KZZ A;  2HU9 A;  3K4C A;  1FX7 A;  3BG5 A;  1T8I A;  2AS5 F;  3NWS A;  2M0C A;  2ECC A;  1ACI A;  2VKH A;  1NK2 P;  1IW7 F;  4E70 A;  2VE8 A;  1ZYR F;  4XK4 A;  4MQV A;  1FEX A;  4IRH A;  2XGD A;  2P7V B;  1V3F A;  4CHU A;  3CDL A;  2PMH A;  4A6E A;  5HVQ C;  1OKR A;  4DZP A;  1H9T A;  4IOA F;  2W00 A;  2QSH X;  2L2O A;  1BM9 A;  3WTZ A;  4Y15 A;  5J40 A;  1R4M B;  5D4S A;  1PP7 U;  3CQZ J;  5K1Y A;  1I3A A;  1SAN A;  1Y6I A;  4MEY F;  5DYM A;  1UCR A;  3ZMU A;  4KUM A;  4MO7 A;  3HXL A;  1ZRF A;  1REP C;  2VQH A;  3FIS A;  2BGC A;  1T98 A;  4PJL A;  3VOE A;  4WK8 F;  3GLL A;  4P55 A;  2RKH A;  5DCF A;  3IL2 A;  1ZQ3 P;  4NB5 A;  4N4N B;  4KN4 X;  3AAF A;  5K7Z A;  3FKI J;  3K70 C;  1HST A;  2EWN A;  3OSG A;  2RC4 A;  3ML6 A;  3TO7 A;  3MKW B;  2Z1D A;  1U5T B;  2Y0S A;  4XBF A;  4AD9 A;  4ESJ A;  1ORK A;  4DBR A;  2M8G X;  2EQR A;  1R58 A;  2XKP A;  2WC2 A;  4FQG A;  4XLH A;  1RIO H;  2K4B A;  3WU2 C;  5EZH A;  3CCV I;  4DYC A;  2FML A;  1ENH A;  2OC6 A;  3O8H A;  1IXS B;  3WTX C;  1S7O A;  2QQ9 A;  3ULQ B;  3RZO J;  4HRI A;  3CTA A;  3OR2 C;  2R5Z B;  1ZRD A;  3CCM I;  1Z21 A;  2O61 A;  1ETK A;  3CDI A;  4FX0 A;  1UFM A;  4IEJ A;  3WTU C;  1LKX A;  2L7F P;  4JX6 A;  3EYI A;  5EG0 B;  2O8X A;  1S72 I;  1KU9 A;  5EGO A;  3L1P A;  4IX7 A;  2DYS H;  4OWR B;  2DA3 A;  1JUM A;  4XKW A;  5HOO A;  2X6X A;  2NVT J;  2C6Y A;  1Z9C A;  3O2P E;  1U8B A;  1NTC A;  2HDW A;  2KIQ A;  2KJC A;  2L7Z A;  3ZXS A;  3CD6 I;  4NUB A;  3MZY A;  2VAS A;  2BV6 A;  2W82 A;  1IV8 A;  1W7P D;  5ERI A;  2W1O A;  1VQ7 I;  5FD6 A;  3T8R A;  2YX7 A;  4BHB A;  3CJT B;  1XPX A;  1MZB A;  2CUJ A;  4A3G J;  4M73 A;  3HHG A;  2R7T A;  3PNY A;  4RGU A;  4OMZ A;  4UUT A;  3GUD A;  2CQX A;  2Y31 A;  2ZBK A;  1KQ8 A;  2X48 A;  3UNG C;  4ZYE A;  4TV7 A;  4CSW A;  4A3D J;  2CG4 A;  4E7H A;  2VBZ A;  3F0C A;  4BQQ A;  1D0Z A;  2LKX A;  1Y8R B;  5FFX A;  2X6O A;  2XHK A;  2VE9 A;  2O6G E;  1W4M A;  4II3 A;  2CUZ A;  2GWR A;  2D1V A;  2R7F A;  4WF2 A;  2UZK A;  3V7R A;  4I02 A;  4ESB A;  1IGN A;  2HI3 A;  3A03 A;  2EZI A;  3DF8 A;  3D1N I;  4V19 K;  1IUF A;  1UST A;  4N4O B;  3ECO A;  1VQ5 I;  3AG4 H;  4E6K G;  3VDX A;  3SFI A;  1JXS A;  2PEX A;  4H4K C;  1U2W A;  1X1P A;  3IKV A;  4LK0 F;  1D5V A;  4EJU A;  1MJ9 A;  1J7K A;  1DP7 P;  3BR6 A;  1J75 A;  4NQW B;  3KX2 A;  1HDP A;  4M6Y A;  3JRI A;  4RB2 C;  1G8X A;  2XF6 A;  2FOK A;  1K6Y A;  5HOD A;  1IRF A;  4X1E A;  1R1U A;  3FXU A;  4XRS A;  1R5I D;  2XPW A;  1XD7 A;  1XB4 A;  1VF9 A;  5E3N A;  3CF5 F;  3NEU A;  3OYB A;  2LRD A;  4WX9 A;  2DFF A;  3HRU A;  2K9L A;  1N77 A;  3C2G A;  3REO A;  2HPI A;  3DQV C;  1ZG3 A;  4I98 B;  3Q9V A;  4W97 A;  3HKZ N;  3KZI C;  5FKM A;  2F5C A;  4KFC A;  1H0M A;  3OL3 A;  2PBI A;  4CH7 A;  4UUV A;  1QVT A;  3VPR A;  5C3E J;  1R71 A;  3H5A A;  2Z3Y A;  5BQT A;  4GDF A;  1HKQ A;  3FHN A;  3S1Q J;  3RPU D;  1SMY F;  5FB2 A;  5K5Q A;  9ANT A;  3H35 A;  2PLY A;  3PQJ A;  2DQR A;  4HST A;  4IVN A;  5D5W B;  1MBE A;  4C3H J;  4B44 A;  1GV2 A;  4C2M J;  2V1X A;  5JR3 A;  3ZRG A;  4YRV A;  2CRG A;  1V4R A;  2R7D A;  1SFE A;  3OWT A;  2WAD A;  1IG7 A;  5KAF C;  2JA5 J;  3AFH A;  2M4G A;  4CYC B;  3QAH A;  2VLA A;  4OIO F;  3BPX A;  1DU6 A;  3QWL A;  1PJR A;  3K2A A;  3I71 A;  4PSW A;  3GX4 X;  2FRH A;  3P9C A;  1G59 A;  2OV7 A;  1A6I A;  4CCK A;  2E1O A;  1NG6 A;  1V5G A;  2O3F A;  3MWM A;  3MD2 A;  5E3O A;  1TWG J;  2K5C A;  4ENK A;  3ZR8 X;  4BY7 J;  4O3M A;  2IRF G;  2KLO A;  3LSJ A;  1D1C A;  3QPT A;  5FKO A;  4XLP F;  3I58 A;  3FX3 A;  2L7K A;  4EM2 A;  4D5F A;  1B6A A;  4UNO A;  2WB1 A;  1A5J A;  1MDM B;  1D1A A;  5KK1 A;  3GWZ A;  5F1R A;  2VC0 A;  3FIW A;  1AWC A;  3T0Y A;  5EZG A;  4U7B A;  3RKY A;  5KNL A;  3PL8 A;  4UB6 C;  1MBJ A;  3SDB A;  4F92 B;  2Z9O A;  4UUS A;  4HZF A;  4IQJ A;  1U6G A;  2M34 A;  3BR2 A;  4I76 A;  3RCO A;  3M8J A;  3ZN0 A;  3I55 I;  4EGZ A;  5GAD J;  3ZQH A;  2A6E F;  3K4K A;  2QBY B;  2ZO4 A;  1JT0 A;  2JVH A;  3ZCO A;  3FMQ A;  4FET A;  1BOA A;  4RGS A;  2IW5 A;  1POG A;  3I59 A;  3K9T A;  3L2V A;  1OCO H;  4XL9 A;  2IGM A;  2CUE A;  2EZL A;  3AKZ A;  4A93 J;  1X3Z B;  3K4J A;  4XRM A;  1S5L C;  2F5F A;  2DAO A;  4A3I J;  1Z3Y A;  2DPD A;  3BDD A;  1MJB A;  5JLW A;  4BY1 J;  5J1U A;  3OS0 A;  2H94 A;  4AIH A;  1Z1D A;  2Y9Y A;  5D4R A;  4AIK A;  4S0H B;  3WG7 H;  3BJO A;  2E2J J;  4BGD A;  4ZYH A;  1LB2 A;  3I64 A;  1YLF A;  2EH3 A;  3E5X A;  2X4H A;  3RYP A;  3BG7 A;  4HA8 A;  2E1M C;  1F4K A;  2XSD C;  3M4O J;  1JGS A;  3OYL A;  1YX3 A;  4FT8 A;  1O3Q A;  1Z6T A;  3PSI A;  1ZRE A;  1EH8 A;  3GTL J;  3WG9 A;  2JN6 A;  3HTU A;  2Y30 A;  2OCC H;  2RV8 A;  3A02 A;  4XNF A;  2OTJ I;  2XRL A;  3C2B A;  3OOU A;  3D5L A;  2Y9Z A;  1IRZ A;  4PJM A;  3S32 A;  1ON2 A;  1MH4 A;  4BHP A;  3R6S A;  1K4S A;  6PAX A;  4E7I A;  2A61 A;  3QOD A;  4IF4 A;  1F1Z A;  4M9X A;  3CLO A;  2LY1 A;  3GF2 A;  2GXA A;  2O8K A;  1QRY A;  2KMU A;  5HDG A;  2HTJ A;  2OZ6 A;  5ILU A;  2G7U A;  2NXN B;  2EIK H;  4XSZ F;  2R7Q A;  4DZJ A;  3BR1 A;  3RDI A;  5LFA A;  3S2H J;  1B59 A;  5HS9 A;  2KRC A;  1W0T A;  2FSW A;  2QYO A;  2PI0 A;  3VSK A;  5ICG A;  1MMS A;  3UR3 C;  2EIN H;  3L2C A;  1WGX A;  3ZMS A;  2IAI A;  1U8R A;  3UKG A;  2VBY A;  1WJB A;  2TDX A;  1VTN C;  5FFZ A;  2HOS A;  2VQC A;  1IRX A;  2NYX A;  2OQG A;  3E6M A;  2BHZ A;  3F6O A;  2LLK A;  3S8P A;  2IBD A;  2WA0 A;  5D6F A;  2MA3 A;  3D0S A;  3FHZ A;  4JX4 A;  3TED A;  1Q1H A;  1V5F A;  1T39 A;  1IN6 A;  4KDP A;  4XLC A;  5E20 A;  4M74 A;  2HYF A;  1ZHF A;  4PJN A;  2F4I A;  1ZTR A;  1W5S A;  2ZXJ A;  2XAS A;  3BT9 A;  5IOY A;  3IWF A;  5F1J A;  1PUF B;  1HLV A;  2GXB A;  1I39 A;  3HOW J;  3TMO A;  1CF7 B;  2JQ7 A;  3CF2 A;  5GP9 A;  3VOD A;  1O7F A;  4ZYA A;  3I3L A;  3FWE A;  1YO5 C;  3SYT A;  3ZGK A;  2PN6 A;  1ERD A;  1BR2 A;  5CQG A;  3GFL A;  4BJ5 C;  5DUI A;  5M5X J;  3JRC A;  4KMF A;  1DPU A;  3N4M A;  3BTI A;  2E1N A;  3BOQ A;  2VQL A;  2EZH A;  2M7B A;  4BXU A;  5J47 A;  2JUC A;  5CLS A;  3BR5 A;  1YJW I;  3SZT A;  4A5M A;  3S14 J;  2HXO A;  4QSH A;  4KIG A;  3GTJ J;  1RUO A;  3BG3 A;  2KIM A;  2GBY A;  4HX8 A;  1AOY A;  4ABZ A;  3KPH A;  5TRD A;  4I01 A;  3LWF A;  2M0M A;  5JFR A;  1TWH J;  1Z77 A;  1BA5 A;  1YOV B;  3JTH A;  4M6X A;  1BR4 A;  2VIX A;  4ZDP A;  4BBR J;  4F55 A;  4G94 A;  1W5T A;  3L9F A;  4C2T A;  4MFE A;  1SVM A;  2M45 A;  5CKT A;  3CP2 A;  5CPR B;  5GTH C;  2LBF A;  1WFX A;  3VYU B;  4G8X A;  2G7H A;  3GZ6 A;  1O3S A;  2DXI A;  3A4C A;  2P5K A;  1S7E A;  1XSD A;  2L9N A;  2W4S A;  5M3M J;  5DEQ A;  1SFK A;  5L3F A;  1TQM A;  1FT9 A;  3K1N A;  1YE9 A;  2XF5 A;  1U78 A;  5JHF A;  1DQU A;  5JI6 A;  3HOX J;  1R23 A;  2QSF X;  3LSP A;  4L9J A;  1UHW A;  3RQ4 A;  2CSO A;  3MAJ A;  4ITV A;  4MGR A;  2ZME A;  4F93 B;  2BE5 F;  2H1L A;  2NOJ B;  4U88 A;  3V8L A;  1LQ1 A;  4LG0 B;  1TWF J;  1I27 A;  3GZ5 A;  4XRS G;  5BMZ A;  4LB5 A;  2JA2 A;  1IRG A;  1B8I B;  1ZK8 A;  3E1S A;  1FJL A;  2BY1 A;  3K69 A;  5D6E A;  2V4J C;  3JRE A;  3Q0U A;  3ABL H;  5K5R A;  1WJF A;  2JJ7 A;  2KZV A;  4QPQ A;  2J5O A;  1MMA A;  1LEB A;  3EYY A;  1IC8 A;  2KJB A;  3OS1 A;  3SXY A;  4LMY A;  2KIS A;  2ELK A;  2L9S A;  3IHU A;  1TLH B;  2IS1 A;  4HSR A;  3J7Y J;  1MJA A;  4ZYG A;  2D5V A;  2MG4 A;  3ZQG A;  3H3Z A;  3J80 Z;  2EIJ H;  3EUK L;  2CWE A;  1IV6 A;  3FM5 A;  4Z2Y A;  2YX4 A;  1FP1 D;  3H3V K;  1H8A C;  2YR2 A;  4EVI A;  4UB8 C;  1R9T J;  2F2E A;  4A3J J;  2ME0 A;  2J5P A;  4A3M J;  3S3O A;  1QNT A;  2Q8K A;  5BPI A;  5F6F A;  4KIS A;  2FMY A;  1F43 A;  3G2B A;  4FHT A;  3WU0 A;  1PP8 F;  2VJJ A;  2QEX I;  2LH9 A;  5D5V B;  2DBB A;  2DJI A;  2XAG A;  1J09 A;  1JI8 A;  4RS8 A;  4ZYD A;  3CP8 A;  4BE2 A;  4IHW A;  3VYR B;  4GO1 A;  1FNN A;  2XV4 S;  1AKH A;  5FGM A;  3FM3 A;  5LHH A;  3RKX A;  4A0X A;  2W24 A;  2FBH A;  3GW2 A;  2H8R A;  2H8W A;  2JZY A;  4YII A;  4BEH B;  2LY9 A;  3MZ8 A;  1ETV A;  3TL4 X;  2E1M B;  4J19 A;  3RIR A;  3G6E I;  2ECB A;  3JSP A;  3OYE A;  3I53 A;  3EUH A;  1JJ6 C;  4M3E A;  2HNH A;  4J00 A;  2DA6 A;  5LEK A;  5CYV A;  3DP7 A;  3VEP A;  3QPS A;  2HZD A;  4LIT A;  5DDG A;  1MBH A;  1ZLJ A;  2DLL A;  1ZG1 A;  2Q2E B;  3GME A;  3GXO A;  4EMS A;  2ISZ A;  4OIR F;  4XMY A;  1R5G A;  1NG7 A;  3KLN A;  3MCZ A;  3OYA A;  2R7W A;  1LDD A;  4XON A;  2YU9 J;  1G6N A;  3I4P A;  3V8J A;  3EDP A;  2GA1 A;  4LJZ F;  5E8I A;  4G6T B;  3AG1 H;  2EV6 A;  2GA2 A;  4K2E A;  5B66 C;  2CQK A;  1RC9 A;  4HV5 A;  2NVU B;  2CGP A;  5IT9 Z;  4M71 A;  2KRF A;  5HS8 A;  2PMZ N;  3QU6 A;  3C7J A;  2A69 F;  1ZRC A;  4HAM A;  1JKR C;  3LOC A;  2ELH A;  3QOP A;  3ABM H;  2A07 F;  2CS3 A;  4AWX B;  2XVC A;  3I4M J;  3P9I A;  3FXK A;  4HLX A;  1LDJ A;  4PUS A;  4CXF A;  1XMX A;  4FCY A;  2LRE A;  1O7L A;  2OAZ A;  3KP7 A;  2VI6 A;  1X1D A;  2STT A;  3QPL A;  1TT0 A;  2ZNZ A;  1XMK A;  3GTO J;  4YEJ A;  2G0E A;  2K4J A;  2FQ4 A;  1XCB A;  1IN8 A;  2K9M A;  4O6J A;  2FNP A;  1K61 A;  2R93 J;  2BW3 A;  4JX5 A;  3Q0V A;  1EKE A;  3V7S A;  2OCE A;  2QF7 A;  5FLM J;  2MGQ A;  4AIJ A;  5FKL A;  2FX0 A;  2HVR A;  3KLO A;  2A6T A;  2P6T A;  3MMY B;  3HL2 A;  1JHF A;  3KIO A;  5BS6 A;  1HKT A;  1HSJ A;  2AQE A;  2P8T A;  2PG4 A;  3LSG A;  3RZD J;  3PFI A;  1JTY A;  4D7N A;  1T56 A;  2LY2 A;  3SJM A;  5EEG A;  3DLA A;  3RKW A;  3S1R J;  4HW0 A;  4M3D A;  1R36 A;  1RNL A;  4XOP A;  4Y33 A;  3WE3 A;  1BI3 A;  3KYC B;  1JE8 A;  2NNY A;  2F4M B;  4F52 A;  3JRD A;  2VON A;  1MND A;  1RZ4 A;  2CMP A;  1LFU P;  4WCG A;  1B9N A;  2TCT A;  4C9Y A;  1E2X A;  2BVM A;  2CV2 A;  3HRM A;  3CUQ C;  3K0L A;  5H2F C;  1YRN A;  3NQO A;  2RNG A;  2B0L A;  2L4M A;  3GFM A;  3K4B A;  1I1G A;  4CCM A;  3CCR I;  1PVE A;  4MNU A;  3Q0W A;  5CQE A;  2FU4 A;  2IPQ X;  2M30 A;  2R5Y A;  2GOM A;  2HQN A;  4JYK A;  3QYF A;  5CVU A;  4IRI A;  4IHS A;  3CMM A;  4CDG A;  1D8J A;  1W1W E;  1Z67 A;  2CV0 A;  1YG2 A;  3PM1 A;  1LFB A;  1FTZ A;  1VQ4 I;  3EET A;  4Q47 A;  3J7A Y;  4LK1 F;  4YFX F;  5M5Y J;  3DWL E;  2DT5 A;  5EDN A;  2M1B A;  2ZB9 A;  2ELJ A;  5J4Y A;  5IY5 H;  5HLT A;  2ESH A;  3LST A;  5HNF A;  2ZFU A;  1OR7 A;  4HPQ A;  2WY7 Q;  3KEQ A;  2WWY A;  1ZKG A;  3NAU A;  2CFO A;  2GZW A;  3EPZ A;  4PSX A;  3TQN A;  3TW6 A;  3JRF A;  2VXZ A;  2R7Z J;  2DMN A;  2R4G A;  1LVA A;  3QU3 A;  4XID A;  4U0Y A;  3CCU I;  2ZJR F;  2LVS A;  3IV5 A;  3HZJ A;  4RM3 A;  4EJT A;  3MEX A;  3DLL F;  4YIR X;  1RI7 A;  3VYS B;  3MN2 A;  2DA4 A;  1IXC A;  2BY2 A;  2DTZ A;  3KP6 A;  2MW8 A;  4PDK A;  3BP8 A;  2QKM B;  3LA3 A;  3C1D A;  3S3M A;  1YW7 A;  1P9Q C;  4ANJ A;  3OYJ A;  4DIQ A;  3GTG J;  1HKS A;  3K1M A;  2K85 A;  3MKY B;  1DP3 A;  1SD4 A;  4CGZ A;  1Q1V A;  2P5V A;  1VI0 A;  1DGW Y;  1YIT I;  1XSV A;  1IO2 A;  1L0O C;  3FXO A;  4C3I J;  2KQR A;  1BN5 A;  2ICW G;  1TNT A;  4KIC A;  1KQ0 A;  1T6S A;  4CUG A;  1WPK A;  4H0E A;  1HA8 A;  5KHD A;  3VB2 A;  4HNT A;  2EV0 A;  4CYD A;  4NBQ A;  4ENN A;  2HEO A;  2JSC A;  1QZZ A;  5HLG A;  2VPR A;  5C4J J;  2BXY A;  3HM5 A;  1YX5 A;  4PZJ A;  3S16 J;  1Z05 A;  1UZC A;  3JAM Z;  1FPQ A;  2M3A A;  3OYC A;  2UV1 A;  4IRG A;  4U87 A;  3TDZ C;  2L0K A;  4KT6 A;  2R92 J;  1WI9 A;  2Z5U A;  2LD5 A;  5ICF A;  3SFZ A;  4U0W A;  2EFO A;  4HV6 A;  4L18 B;  2HOE A;  1ZAR A;  4GYI A;  2HQR A;  3FXJ A;  2KDZ A;  3ZQF A;  2R3S A;  2KDO A;  1YJ9 I;  3AL0 C;  5CVV A;  1TNS A;  4I99 C;  2BBY A;  4PK4 A;  1HF0 A;  3KYL A;  2CH0 A;  3X2Q H;  4XOR A;  1HCR A;  3PFY A;  2FD5 A;  1U5T A;  3OYG A;  3OYK A;  3ABK H;  5J8C A;  1S7A A;  2LP0 A;  3BZK A;  4BS9 A;  3ZMV A;  3C3W A;  2JPC A;  2QKL B;  1YIO A;  2PX9 A;  4GRI A;  3TBI A;  5AIP A;  4GCV A;  1D0X A;  3CLQ A;  2L02 A;  2QGU A;  3W6K B;  5DD4 A;  1H88 C;  4G7Z F;  1D1B A;  1TW2 A;  2R5Z A;  3SEQ A;  1X3W B;  4RGX A;  3K70 D;  3K10 A;  3TO9 A;  3Q5F A;  3CDH A;  4HBL A;  1J59 A;  1FBU A;  2VJI A;  5EG0 A;  2LSO A;  2P4W A;  1LEA A;  4G7H F;  2IA2 A;  2QLZ A;  4EJW A;  2FBI A;  3QPH A;  3R60 A;  1BL0 A;  2LFB A;  2VQG A;  4M6V A;  4ASN A;  4B1R A;  1EH7 A;  2QQ8 A;  1OCR H;  2ZKZ A;  2L5Q A;  1T0F C;  1TP4 A;  2KT0 A;  1O57 A;  2ZXH A;  5J8F A;  1APL C;  2DMQ A;  2QSG X;  4RB0 A;  4LFU A;  4M9Z A;  4OIP F;  3SHF A;  3CMY A;  4XN0 A;  2JVG A;  4ZC3 A;  1P4W A;  1ZGJ A;  3K2Z A;  4O5V A;  3DEW A;  5FLX Z;  1UB9 A;  4NC8 A;  2UUZ A;  3COA C;  4BKX A;  2VJ4 A;  1OCZ H;  1C0W A;  5AIQ A;  4IXA A;  1XMA A;  1MMG A;  4MIM A;  2RRE A;  2QUF A;  2V79 A;  3FXQ A;  2ZME C;  4CZZ A;  2EZK A;  2DMT A;  1WH5 A;  4NC6 A;  1WRJ A;  4MEX F;  2XGX A;  5GTI C;  2VKD A;  3ABU A;  2DFI A;  1EJ9 A;  2JA8 J;  2VT3 A;  5HDK A;  3H9Q A;  3DU5 A;  1MSF C;  2OA4 A;  2DI3 A;  1E3P A;  3ABT A;  5DS9 A;  2ZJ2 A;  1IDY A;  3ZMD A;  3OIP A;  2WAE A;  3CUQ B;  4MLO A;  2Y69 H;  2VOD A;  4EJO A;  2V6E A;  5D5U B;  3B6A A;  1HW1 A;  3H9G A;  4ZH4 F;  2FEZ A;  2VKV A;  5LBQ A;  1VQM I;  2OUM A;  1N75 A;  5C44 J;  3LQQ A;  4ZDO A;  3I59 B;  5IYB J;  4BJ6 C;  4LLN A;  4A0Y A;  2NNN A;  1P4A A;  5EF6 A;  1JKP C;  1MGT A;  2VKE A;  2HS5 A;  4BE1 A;  1X1A A;  3FXM A;  2V9V A;  5F27 A;  1IDZ A;  1YIJ I;  1YS7 A;  2QA4 I;  4N9H A;  4UV9 A;  2FOW A;  4G7O F;  1KYW A;  2F5V A;  4Y17 A;  4RMN A;  2K3P A;  1Y0N A;  2VJ5 A;  1WI3 A;  3DBR B;  2B9S A;  1WQ2 A;  3JRA A;  4FE4 A;  4YG2 F;  2GIV A;  3M1E A;  2WAQ N;  2CW7 A;  3O3K A;  4L5I A;  2CFX A;  1O3T A;  2P5L C;  2EB7 A;  3S1N J;  5LGU A;  1JT6 A;  4U0V A;  5K7F A;  1X3U A;  2IT0 A;  3MVP A;  4CCL A;  1R49 A;  3PO2 J;  2Z33 A;  2CQ7 A;  2X1D A;  2RQP A;  3BLY A;  3KP2 A;  1AU7 A;  3HTS B;  5FRM A;  3F21 A;  4IHX A;  1T33 A;  4WXC A;  1RPW A;  2P6S A;  1OCC H;  1BW5 A;  3HGG A;  1AHD P;  2GIZ A;  4R8H A;  4XIC A;  4QLC U;  2KPM A;  5JLX A;  4RDU A;  1D3Y A;  2B63 J;  1XGN A;  3B6C A;  5TJJ A;  1W7P A;  1TQP A;  3HYI A;  5CVR A;  3GCM A;  3V7C A;  5BNG A;  4B09 A;  2A05 A;  3JTG A;  1CQT A;  3BTJ A;  4CYC A;  2Y48 A;  1LDK B;  5LRS A;  3WTV C;  2WV0 A;  2PFB A;  1S29 A; 
#chains in the Genus database with same CATH homology
 4F93 B;  3L2R A;  2NOJ B;  2GOX B;  3OYN A;  1OLT A;  2WY8 Q;  2JA2 A;  3IP4 B;  4B47 A;  3E1S A;  1UAA A;  2V4J C;  2MD0 A;  1WJF A;  2KZV A;  4QPQ A;  1ZEL A;  3GBG A;  1MMA A;  2E5Z A;  2WBM A;  5LD2 C;  2R7U A;  3DTI A;  3FBI B;  3OS1 A;  2V7F A;  3BC8 A;  1UG0 A;  4IQ4 A;  2L9S A;  2X1C A;  2IS1 A;  4HSR A;  2LC2 A;  3IUO A;  1X19 A;  2MYS A;  1QHH D;  2DCE A;  3AL0 B;  4BU2 A;  1FMV A;  2Q1Z B;  3LSI A;  1PYV A;  3NWT A;  3PNV A;  3EUK L;  4ZDL A;  2HU9 A;  3K4C A;  3OY9 A;  3NWS A;  2P0W A;  4LG3 A;  2VKH A;  1SAU A;  1GLN A;  4DJA A;  4LIV A;  3W2W A;  2BVL A;  3CZ6 A;  2LG4 A;  3PSF A;  3S3O A;  2CV1 A;  3KEY A;  4XOT A;  2R7R A;  4KIS A;  5HVQ C;  3G2B A;  2W00 A;  2CW8 A;  2VJJ A;  4BAC A;  1X4P A;  2LH9 A;  1LVK A;  2DJI A;  2L2O A;  1J09 A;  2IS2 A;  1JI8 A;  1X4O A;  3OIQ A;  3CP8 A;  4BE2 A;  3VYR B;  2W7N A;  2V26 A;  4KIT B;  1S9H A;  1Y6I A;  4F3Q A;  2A5W A;  3HXL A;  2VQH A;  1UEL B;  3DTE A;  4BEH B;  2FUG 2;  4C30 A;  3TL4 X;  4PJL A;  4HNU A;  2E1M B;  3OYE A;  3PUB A;  4N4N B;  2HNH A;  3K70 C;  4J00 A;  3SEZ A;  3MKW B;  2Z1D A;  5KCM A;  2HZD A;  4LIT A;  3CJR B;  4ZTJ A;  2Y0S A;  1MMN A;  2Q2E B;  4DBR A;  3H0D A;  4XLH A;  1MMD A;  4XMY A;  1NG7 A;  3OYA A;  2R7W A;  4XON A;  2OC6 A;  1W36 C;  4G6T B;  2JUG A;  2ZSH B;  4HRI A;  3LL7 A;  3OR2 C;  3HPG A;  1U0J A;  1Z21 A;  1V5E A;  1LKX A;  3L2U A;  2KL4 A;  4BL0 B;  4IX7 A;  3H5N A;  4OWR B;  2CS3 A;  4XKW A;  5HOO A;  2X6X A;  3EUH C;  4PUS A;  2LRE A;  3OYH A;  3OL4 A;  2HDW A;  3ZXS A;  4E4H A;  4CA0 A;  1X1D A;  4NUB A;  3K6G A;  4B43 A;  2PMZ A;  1TT0 A;  2VAS A;  2W82 A;  2W1O A;  2X85 A;  4YEJ A;  2XC7 A;  4BE0 A;  2CUJ A;  2K9M A;  2R7T A;  3PNY A;  2BW3 A;  3FDY A;  1X1C A;  4XM3 A;  3UNG C;  2DOA A;  1N78 A;  3DTK A;  3N05 A;  3DPL C;  4CSW A;  3S93 A;  4E7H A;  4C2U A;  2HVR A;  4BQQ A;  1D0Z A;  2A6T A;  3MMY B;  3OYF A;  3HL2 A;  2VB6 A;  4DBQ A;  4XQF A;  2AQE A;  4II3 A;  2CUZ A;  3LSG A;  3H5R A;  4E7K A;  3FBN B;  2VPL A;  2LY2 A;  2X1E A;  2E5N A;  3DLA A;  3K4N A;  4CZC A;  2ZXI A;  4XOP A;  4Y33 A;  1Y56 A;  4N4O B;  2XDV A;  2X51 A;  4F52 A;  4E6K G;  1MND A;  3BCB A;  5TGT A;  2CMP A;  3VDX A;  3E0J B;  4C9Y A;  4H4K C;  2BVM A;  2CV2 A;  1WJA A;  2RNG A;  2IS6 A;  4CCM A;  3K4B A;  4NQW B;  3KX2 A;  2IGK A;  5CQE A;  4DOZ A;  1FMW A;  1QU3 A;  1G8X A;  2XF6 A;  1K6Y A;  3W2V A;  2GOM A;  4P1W A;  3QYF A;  4EAT A;  3OMY A;  5HNH A;  3CMM A;  3OYM A;  2LYC A;  2CV0 A;  3OYB A;  2LRD A;  2K9L A;  4BQO A;  1N77 A;  3C2G A;  3BG6 A;  3J7A Y;  2HPI A;  3DQV C;  2LOO A;  4D9J A;  3DWL E;  5FRN A;  2ZSI B;  2JSP A;  3LSK A;  1Z7L A;  2ELJ A;  2I8D A;  3OL3 A;  3S3N A;  1MW7 A;  4CH7 A;  5HLT A;  4IZZ A;  5HNF A;  4E7L A;  2ZFU A;  2XF7 A;  3OS2 A;  4HPQ A;  2WY7 Q;  3A1Y A;  3H5A A;  2CFO A;  3EPZ A;  4PSX A;  3FHN A;  2VXZ A;  3RPU D;  2R4G A;  3FKJ A;  2Z2S B;  4RM3 A;  3H35 A;  4II2 A;  1MNE A;  2MAB A;  3HKZ A;  3VYS B;  2LBF B;  4HST A;  3VYT B;  2IXS A;  4B44 A;  1R6R A;  2R7O A;  2QKM B;  2IS4 A;  4OAZ A;  4Y4R A;  3M1C A;  3ZRG A;  1P9Q C;  4ANJ A;  4YRV A;  3OYJ A;  3S3M A;  3OWT A;  4DIQ A;  2R7V A;  2WAD A;  3MKY B;  3HUG B;  3AFH A;  2M4G A;  1DP3 A;  1DGW Y;  3DKX A;  2VLA A;  2V1N A;  2X6W A;  2KQR A;  1PJR A;  4JOM A;  4PSW A;  1DGR M;  4BDZ A;  2VXD A;  1WJD A;  4CUG A;  1G59 A;  1HA8 A;  1TZL A;  2OV7 A;  4CCK A;  5KHD A;  1V5G A;  1NG6 A;  4HNT A;  3MD2 A;  4XR6 A;  1OR7 C;  2K5C A;  4R79 A;  3ZR8 X;  2KLO A;  4HG2 A;  1D1C A;  2UWM A;  1YX5 A;  2L7K A;  2XAU A;  2WB1 A;  3DEE A;  4E7Z A;  2M3A A;  3OYC A;  1D1A A;  2UV1 A;  4U87 A;  4KT6 A;  2HQA A;  1WJE A;  4U7B A;  5KNL A;  3PL8 A;  3HG9 A;  3SDB A;  4F92 B;  4PJJ A;  4IQJ A;  3RCO A;  3LSM A;  2HPM A;  2KDO A;  3M8J A;  3AL0 C;  3K4K A;  3QYE A;  2JVH A;  3ZCO A;  2IGO A;  4PK4 A;  3KYL A;  2CH0 A;  3CES A;  4FET A;  3PJR A;  4ZJZ A;  4XOR A;  3A2K A;  2O5R A;  3PFY A;  3L2V A;  4BDY A;  2WAQ A;  4XKC A;  2V9K A;  3OYK A;  3OYG A;  4XL9 A;  2IGM A;  3C2H A;  1WJC A;  3AKZ A;  2KHM A;  4BS9 A;  3K4J A;  4E7S A;  2QKL B;  4BXF A;  4RM2 A;  1Z3Y A;  3IAM 2;  4GRI A;  3TBI A;  1D0X A;  2HVQ A;  3OS0 A;  1KON A;  3L2Q A;  1D1B A;  2MC4 A;  3SEQ A;  4D1Q A;  2PJR A;  3OYI A;  3K10 A;  4HEA 2;  3K70 D;  4NC7 A;  3K4L A;  4BGD A;  2VJI A;  4RLQ A;  4RLF A;  3QYB A;  1QHG A;  3ZQQ A;  3BG7 A;  2E1M C;  2VQG A;  3OYL A;  1YX3 A;  1T95 A;  2XSJ C;  2L5Q A;  3PSI A;  4CCN A;  3F9K A;  5FRO A;  1T0F C;  4ZTF A;  4Y3O A;  2DT6 A;  4X0G A;  1W36 D;  4AYB A;  2ZXH A;  2Z16 A;  3QOE A;  2AQF A;  4XLA A;  3DU6 A;  4XNF A;  1BOB A;  4XN0 A;  3HC7 A;  3W3C A;  2JVG A;  3OOU A;  3DPU A;  3D5L A;  3LFU A;  4JQF A;  4ZC3 A;  4CCJ A;  4PJM A;  3S32 A;  4PFO A;  1E0E A;  3VSL A;  4LIU A;  4E7I A;  3QOD A;  4NC8 A;  2UUZ A;  2LY1 A;  2VJ4 A;  3LSH A;  2KMU A;  3ONQ A;  4BJT A;  1MMG A;  2R7X A;  2RRE A;  2R7S A;  3HOT A;  2R7Q A;  4B48 A;  5LFA A;  2WAF A;  4NNJ A;  2KRC A;  3DKY A;  4XLE A;  2VKD A;  4QPO A;  3BCA A;  3VSK A;  1WJ5 A;  2BOL A;  3IAS 2;  3UR3 C;  4BQN A;  4FAS D;  2M7A A;  4IKF A;  3H9Q A;  3DU5 A;  4E7J A;  2IGN A;  1WJB A;  2VQC A;  1IRX A;  3V42 A;  3HOS A;  3OIP A;  2WAE A;  3S8P A;  2M4K A;  2WA0 A;  4MLO A;  1EA3 A;  3OYD A;  2V6E A;  1V5F A;  1BR1 A;  3H9G A;  4XLC A;  2BW3 B;  4BUP A;  3D5S C;  1AA7 A;  2OUM A;  2KP6 A;  1N75 A;  3PNT A;  4PJN A;  2F4I A;  4ZDO A;  3LMM A;  3H9J A;  3RTR A;  3DPT A;  4BJ6 C;  4OAY A;  3TMO A;  4BE1 A;  1X1A A;  3CJQ B;  2VL8 A;  3CF2 A;  4ZYA A;  3I3L A;  3SYT A;  3ZGK A;  2F5V A;  3I9V 2;  4RMN A;  2K3P A;  1ERD A;  1BR2 A;  5CQG A;  4BJ5 C;  2VJ5 A;  3MKZ A;  2VQL A;  2M7B A;  2PJR B;  2CW7 A;  4YEL A;  2X6Y A;  2E60 A;  4XLF A;  4BEH A;  3K4M A;  2RQQ A;  4KJZ A;  1VZ0 A;  4AU7 A;  2M0M A;  4CCL A;  1BR4 A;  2VIX A;  2X1D A;  3BLY A;  4ZDP A;  4AVZ A;  1Z3X A;  4F55 A;  1D0Y A;  4F91 B;  2KRH A;  2HVS A;  4C2T A;  5FRM A;  4J01 A;  3RSN A;  5CKT A;  3CP2 A;  3EUA A;  5CPR B;  2DT7 B;  3W2A A;  2LBF A;  1WFX A;  3VYU B;  2DXI A;  4XN3 A;  3A4C A;  4PFP A;  2L9N A;  2KPM A;  4B3X A;  2W4S A;  2MFZ A;  3SZG A;  3D5R C;  1SFK A;  1YE9 A;  2XF5 A;  5JHF A;  1DQU A;  3HPH A;  4P5O A;  4CCO A;  4DGW B;  1LFP A;  3RQ4 A;  1X1B A;  3L2W A;  4ITV A;  3OR1 C;  3VWB A;  1LDK B;  4XKB A;  2F6C A;  4XKV A;  3U21 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...