3MKWB

Structure of sopb(155-272)-18mer complex, i23 form
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
115
structure length
115
Chain Sequence
PTSAYERGQRYASRLQNEFAGNISALADAENISRKIITRCINTAKLPKSVVALFSHPGELSARSGDALQKAFTDKEELLKQQASNLHEQKKAGVIFEADEVITLLTSVLKTSSAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*CP*TP*GP*GP*GP*AP*CP*CP*AP*TP*GP*GP*TP*CP*CP*CP*A
publication title Insight into F plasmid DNA segregation revealed by structures of SopB and SopB-DNA complexes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein/dna
total genus 38
structure length 115
sequence length 115
chains with identical sequence P
ec nomenclature
pdb deposition date 2010-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF18090 SoPB_HTH Centromere-binding protein HTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2830 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3mkwB00
3VWBA 3MKZA 1VZ0A 3MKYB 3W2AA 3W3CA 3MKWB
chains in the Genus database with same CATH superfamily
1LKXA 1EH7A 3GZ5A 1Z05A 1YIOA 2IP2A 3EDPA 4CCMA 4XSZF 1T38A 2IPQX 1MNEA 1S7OA 1W1WE 1XGNA 3Q9VA 4MQ9F 3GTJJ 1KU3A 2NVXJ 2R7VA 1R4MB 1I1GA 2KZVA 1TWAJ 4F52A 2E1MB 3QQAA 2FF4A 2ZJQF 1VQLI 3K1MA 3RTRA 3PQJA 1P7JA 1RRJA 2Y48A 1IXCA 1VQ7I 2IEKA 2XDVA 2R5ZA 4HLXA 2LLKA 2JPCA 1SFUA 3S32A 2Q0OA 5JLWA 4D7NA 2ZO4A 4BHBA 2PBIA 1MD0A 4IHSA 1KU9A 1UMQA 2A6EF 3H0DA 2XKOA 2A6TA 3ZQLA 1Z7UA 1K6OA 3S3NA 1WGXA 2DYRH 4YEJA 4RBOA 1XGSA 2XPVA 3GTLJ 4B8XA 3QYBA 2HXIA 2JRMA 5GTHC 1U2WA 5M5YJ 4UVBA 3DFGA 4WXCA 2V4JC 4L0ZB 5L3GA 4XLAA 1KQ9A 1XSVA 4CZCA 5GAEJ 4IQJA 3HRMA 5E8IA 3CF2A 1BI3A 1G3TA 1MMGA 3VEPA 4G7HF 4IOAF 1QU3A 4U7BA 4A3EJ 1W0UA 2A3SA 3QOEA 5D4SA 1Y8QB 5KCMA 1YJ9I 1FY7A 5FRMA 2V1NA 3H1CA 4FETA 3BQZA 1LDKB 1MSFC 3WE3A 1Y1VJ 2ME0A 1KGSA 2E19A 2MW8A 4FQGA 4IHTA 5H6RA 2FOWA 4JX6A 3O3KA 3ZMUA 3FXUA 5E8GA 2K9SA 2VE9A 2DQRA 1H88C 1GXPA 4NC8A 2CUJA 4P9UA 1D1CA 4DBRA 2XV4S 3VYSB 3I56I 3H9GA 4BACA 2L5QA 2LMDA 2D1VA 3A03A 1WKMA 3ZMVA 5EYRA 3TDUC 4O6JA 1EH8A 2V9VA 4RLFA 4KIBA 2BYVE 2EFNA 2DW4A 4Y4RA 4YG2F 1VQ5I 2V7FA 2JPBA 2UXNA 1RC9A 4IHXA 1WJFA 3O8GA 2F48A 2M3AA 2Y0SA 3CJRB 2Q2EB 4EJOA 5DUKA 1O7LA 2K9LA 3EUHA 4AWXB 4BXFA 2JUGA 3JRAA 2EB7A 1ETKA 1VFCA 2DTZA 1Y0UA 1J2XA 3EUAA 2FMYA 3OYAA 2FEZA 3QP5A 3D5LA 3M7GA 4M71A 4E4HA 1JXSA 1ZH5A 4EMSA 1TWHJ 1V4RA 2GOXB 3IWFA 2QBYA 3ZQHA 1VQ4I 2X1CA 3FK6A 4R79A 3GVAA 4LOCA 2QQ9A 3L00A 2DA3A 2RVCA 1HQCA 1REPC 1R7JA 4G94A 4A2UA 1D1AA 3VDXA 2NOGA 1YG2A 1U9OA 1R00A 3KCCA 2EIKH 2R5YB 3CF5F 4WXDA 2JT1A 1VQ9I 2XAUA 1P7IA 1RNLA 3FBNB 2D45A 2HFHA 3CCJI 3BDDA 1F1ZA 2BGCA 4M74A 3LSRA 2UXXA 2LBFB 1NH3A 1MZBA 1XSXA 4LFUA 2CFXA 4OIRF 1FPQA 4X1EA 1K78B 2KIQA 2M45A 4CYCB 3F8BA 1T95A 1X1AA 2DMPA 4G7OF 2HWVA 5BOXA 3J80Z 3WTUC 2G7HA 2TDXA 4S05A 4IKFA 2O03A 3ABKH 3BR2A 4IX7A 3W6VA 1IRXA 2MH2A 1X1DA 3KETA 1YJWI 4RB2C 2FSWA 2NVUB 3HIFA 3DEEA 4U87A 5ICGA 3PIOF 3OS2A 2BHZA 1ZGWA 2DPDA 4BGDA 3COAC 1XGMA 4HZFA 4FX0A 3MKZA 4EM1A 1T08B 4UB8C 1K83J 1IDZA 3OIQA 4F91B 2RNGA 4MGRA 4FASD 3FZVA 1B9MA 3IHUA 1HCRA 1VQKI 4HLYA 3IRRA 4B43A 2FUG2 3CJQB 4CA0A 2AQEA 3AAFA 1SD7A 2KPMA 2X6XA 3A4CA 3J7YJ 4ESJA 1S9HA 2AO9A 3ROUA 4KUMA 3JW4A 4JP0A 2AXTC 2PG4A 1I39A 5J8FA 2L7FP 3A02A 1VQNI 3BG9A 5FKNA 2MA3A 5F08A 3K0LA 1T39A 2B7EA 1ZG3A 1YYVA 3CJTB 2HDCA 2WY8Q 5KHDA 2RC4A 2K5CA 2WA0A 2CS3A 2OCEA 3OYIA 1XMAA 2CW7A 1HDPA 3GFIA 2LTPA 4YIFA 3OYGA 3DLLF 1N77A 1LEAA 1W7PA 3L09A 1O7FA 4Z6YA 2P7VB 1G3YA 3A1YA 5BQTA 2BV6A 4PZJA 3DKXA 3QYEA 1YRNA 1X1BA 3LSGA 2CV0A 2DOFA 3IH3A 4HG2A 1AWCA 1TWCJ 3PIPF 1TWFJ 2N8GA 1IAWA 4BY1J 3FMRA 4U7DA 3G71I 4I98B 2CRGA 3RKXA 3T8TA 3ZQCA 3Q0WA 3G2BA 1DP7P 3V8LA 4D0PA 5H2FC 3K4BA 4I09A 1IJWC 5HDKA 2OAZA 3M9AA 1Z0XA 5L3CA 2O6GE 2PN6A 3C18A 1FSEA 1RKTA 3R0JA 2KDOA 4ENNA 1USSA 1QZYA 4Y17A 3OYBA 1X4OA 5JVGF 1HSTA 2RNJA 3FBIB 3OYDA 2X1EA 4QPOA 5A2QZ 2KRHA 2V1XA 4CUGA 1XN7A 4KFCA 3BG3A 2LG4A 3ISPA 4C2MJ 1GHCA 1MDMA 2KRFA 3O2PE 1MJAA 2HQNA 5E20A 1V3FA 1VQMI 5EEAA 4MHGA 5LGUA 1S3JA 5FLVA 1SC7A 3E5XA 1P4WA 3CDHA 5CVJA 4GGGA 3GYHX 5GADJ 2DO7A 1OCOH 3V42A 1YQAA 2VE8A 3CO6C 4NC7A 4ITVA 2G0EA 2JA6J 1BIAA 2V1DA 2IXSA 4YFKF 2PI0A 5F27A 2JN6A 2Z2SB 4BE1A 2H94A 3BWGA 4N9IA 4NHJA 4B1RA 4CH7A 2E36A 1IXSB 1S7EA 3I5UA 3KP5A 3NEUA 3WTYC 5BPDA 1QA6A 4BJ6C 2E1NA 4HF1A 1R9TJ 2GAUA 4N0BA 3OL4A 3WTSC 3D0SA 2OTLI 5EZGA 1X1PA 2DMNA 3REOA 2M4GA 3V8JA 2PMUA 2MABA 2KIUA 3DXJF 2CQ7A 4Q5SF 1UELB 2LDUA 2KHMA 2VPLA 4S04A 1BA5A 3B73A 2A5YB 1R4NB 1IN4A 1MKMA 2RREA 3K4LA 3N97A 3H5AA 5L3FA 1AKHB 3DKYA 2P4WA 2W84A 2XAQA 1JKPC 1Z21A 4A0ZA 2GWRA 2OQGA 3GF2A 5AIPA 2VOOA 2K85A 3ZQ7A 2IS4A 5EGOB 2VB6A 1MNDA 1RUOA 2HNHA 1XDUA 2EFQA 2Y9ZA 1FSHA 2QKLB 3F3XA 3IKTA 2PEXA 4D7MA 4CCLA 4DJAA 2STTA 4XRMA 3IWZA 1RETA 1FT9A 4GRIA 4QSHA 2KZGA 4Y13A 1OYIA 3GFJA 3OYLA 3KE2A 4E7ZA 2VI6A 2FU4A 4KNYA 3PM1A 1A35A 4IF4A 2L2OA 5H6QA 5LEJA 1QPMA 5CQGA 5JI6A 1Q1HA 3DCFA 2X1DA 3TO9A 2X6YA 4DZPA 2M5WA 2HQAA 4RAGA 2R5YA 1BW5A 3BR5A 4P96A 5C4XJ 1DU0A 3HUGB 1BI2A 1B4AA 4A3KJ 1OCCH 2EH3A 2VKVA 2RAEA 2VQHA 2XKPA 4C2TA 5FLXK 2M8GX 1R5HA 1P6RA 1SMYF 3EYYA 4RAYA 4BQNA 5ILUA 1Z67A 3PO2J 4BE0A 1J09A 2DDBA 3RQ4A 1LFUP 2PLYA 2XPUA 2K40A 4BL0B 4BY7J 2X51A 3LSJA 4BDZA 3M07A 3B02A 2NVQJ 2JTVA 3RSNA 5B3SH 4G8XA 3SXYA 4UY8I 4PFOA 4J01A 1L0OC 2ZMEA 1CGPA 1IG7A 5DEQA 2MYSA 1IN8A 1A31A 3CLQA 2LRDA 3WE2A 3SZPA 4MEXF 3BOQA 1Z1DA 2COBA 2HPMA 1S8NA 1QNTA 4D9JA 3OS0A 4A3DJ 4JX4A 3O8HA 5HS8A 1DDNA 2IS6A 1DP3A 3E5UA 2KJCA 5D5WB 4BHCA 2OD5A 4A0YA 5CVVA 2F2EA 2HI3A 3S14J 4X0GA 2QQ8A 3BTCA 3FM3A 2E5NA 2MH9A 3SDGA 2M34A 4S0HB 1JGGA 2CQXA 2OU2A 2DT5A 1A04A 2EWNA 2XAGA 4A6DA 5H20A 4ZYGA 5IP7J 2KP6A 1VQPI 1B1BA 1X19A 2BW3B 3DTIA 4BBSJ 2RV8A 1QZZA 3F8CA 5FFXA 1SAXA 4EJUA 1ZQ3P 4HPQA 2HR3A 4YIRX 1S5LC 4M3GA 3JREA 5TJJA 2V26A 3H35A 4XBFA 3LSPA 3BG5A 2EV6A 1CQTA 3BR6A 3K9TA 1A36A 1FMWA 2HZTA 1VI0A 1SAUA 2EINH 3ABLH 3F21A 3CCEI 1H0MA 2A68F 3S3MA 3GMEA 2DFIA 3H36A 2HVRA 1ZLJA 1HDDC 5GPCA 4L9VA 9ANTA 1ZN2A 3Q0UA 3KEYA 5BS6A 1R1TA 2OV7A 1W5CC 1BR2A 4NQWB 1OJLA 1XSDA 3CCVI 1WVRA 4HQEA 1WI3A 3HOWJ 2R7OA 3CP2A 3SEQA 4NNJA 3G1MA 4QPQA 2AXLA 5IT9Z 3KP3A 2VKEA 1BBYA 1XMKA 1Z9CA 3N05A 4B47A 2F5FA 3BZCA 4XLFA 3MKLA 3G3ZA 2BY2A 5KVRA 2VUMJ 3FF5A 4OMYA 4IVNA 3L2UA 1R36A 4FTHA 2ZXWH 4LLGF 3OYFA 2LSOA 2PX9A 4ZZLA 4HQMA 3ABMH 1QRYA 2CUEA 1HXDA 2DMUA 1W0TA 2CWEA 2LOOA 4B3XA 3K4MA 1E3PA 2IA0A 5CQEA 2HVSA 1ZRFA 1GDTA 3VSKA 2QSHX 2ZC2A 4JQFA 4UVCA 1TWGJ 2L9SA 3ABTA 3WTVC 4XORA 1IV6A 3TP0A 3KZZA 5DM7F 3ASOH 1TT0A 2QZ8A 4DIQA 2EBIA 2I8DA 3SDBA 2B0LA 1Y56A 3WTXC 2HQ5A 3ONQA 2YU3A 3MMYB 4F7ZA 1SVLA 1HLVA 5JVTA 4LG0A 2EILH 3G4SI 1TW2A 1ZG5A 1KA8A 3HC7A 3VYUB 1MBJA 1W36C 3BR3A 4ZYHA 1ZHFA 2XGXA 4BYYA 1FZPB 2DK8A 5HLTA 1WRJA 3A0HC 4EJVA 3DBLB 5FROA 1FJLA 2O5RA 1M1EB 2BY1A 4NUBA 2IS2A 1IN7A 3CUQA 1XCBA 1RZ4A 3K7AJ 3PNYA 2FE3A 4P9FA 3JRCA 2F5EA 2GBYA 1R1VA 3TO6A 3BLYA 3QU3A 1STZA 2KKOA 4HX7A 4RM2A 4PSWA 1BOAA 1XPXA 4IRHA 3IL2A 3A01A 5D4RA 3OOUA 5HLHA 1E3OC 2NRAC 2M4KA 3O6BB 4AU7A 1ZLKA 3LSMA 1T0FA 1V55H 1UG2A 2EZKA 2VQGA 1P2FA 3ECOA 3FXOA 1IV8A 3F6OA 2MD0A 4J00A 4CYDA 2V79A 4L18B 1XC5A 2W48A 1N78A 5E3MA 3UKGA 3B6CA 2IBDA 5LRSA 1U78A 3GZNB 3OR1C 3KP2A 4A3JJ 2EV5A 4L9TA 2PJRB 1I27A 1JUSA 3Q0VA 1TQMA 4E7LA 2QA4I 3EUHC 2WV1A 3TL4X 1TQIA 3NRVA 3P7NA 2P5LC 3ZMTA 3JRHA 2LC2A 3PQKA 1B9NA 3WGHA 4ABZA 1OQYA 1J7KA 3BJ6A 2K4JA 1U5TA 4ZYEA 3I55I 2VT3A 2DK5A 4TV7A 4QWQA 1NK3P 4OINF 5ILSA 5EEHA 1SFKA 4HF0A 2ZXIA 4K2EA 1U8RA 1ENHA 2OC6A 4NDLA 4CCJA 2EV0A 4KYWA 2VXZA 3E5QA 3DWLE 2KQRA 4IQ4A 4UUVA 2QF7A 2Y0MA 4A12A 2LFBA 2FRHA 1TNSA 1QQIA 5K7FA 2R7QA 2OZ6A 3DPTA 4ETSA 1OR7A 2YSRA 5FD6A 5J8CA 4AD9A 3PNVA 3ZQIA 2BHYA 2CYYA 4AUXA 2DFHA 2G9WA 1K4SA 1IDYA 2FMLA 3M3YJ 5E1WA 3QPLA 1UJ8A 1PUFA 2M87A 3FXKA 3HPHA 3K4KA 2JSCA 2BY3A 4IRIA 3G6EI 2HU9A 4M73A 3ZXSA 3FXQA 2VC0A 2FD5A 3LMMA 3K70C 2VKHA 3CMYA 2VODA 4KICA 3RPQA 3M1EA 4KIFA 3DBRB 4CZZA 2RN7A 2ZJPF 2Y31A 2OUMA 1E17A 1Z3YA 2ECCA 3ZN0A 1TL8A 1E3HA 2JA8J 1V5GA 4BJ5C 1QHGA 2P81A 2ZCWA 3H9JA 4LB5A 1YOVB 3F6VA 4HSRA 4L0YB 2G7UA 2R3SA 5HNFA 3M4OJ 1FC3A 4MIMA 4KN7X 3N4MA 5J6XA 5D8KB 3FX3A 3KZYA 4RB1A 4AIKA 2B63J 2ECBA 1V5EA 1DQUA 1O57A 4E6KG 2BXZA 3GCMA 4ASNA 3Q9SA 1ZR2A 1ZTRA 4BXUA 4N9HA 3VODA 1XMXA 3OL3A 2Z9OA 2L0KA 3G73A 4HV6A 1HW2A 1B72B 3BP8A 2CG4A 1YFHA 2R7RA 4RAZA 5HODA 4P5OA 3WG7H 5L3DA 3RKYA 5D5UB 1NG7A 1Z6TA 4PJMA 3G1OA 4NQWA 4AVZA 1YHQI 1YO5C 3S1QJ 2KL4A 3ZMDA 4ZDPA 2DA7A 5LRRA 2QLZA 3OYKA 1R22A 4FE4A 2W00A 2QVOA 2O61A 1LNWA 2HYFA 2IA2A 2YS9A 5EJCA 3DKWA 1ERDA 2XASA 3BPVA 2FXAA 4MEYF 1CF7A 2WWYA 2ME6A 5ICCA 1XS9A 1FTZA 1R58A 2WY7Q 1GXQA 2QQBA 5JHUA 2ACJA 2L7ZA 3QPSA 4V19K 4ZH4F 1ETOA 3LA7A 4XN3A 4II3A 1D5YA 3W6KB 2HEOA 1FOWA 2V9PA 3R61A 3VFZA 2FNPA 1ZREA 4BH9A 4UVAA 4PJJA 4A3IJ 1TLHB 2YPRA 2IAIA 2E7WA 5HNHA 4EJWA 1BIBA 3L2VA 3OSGA 1MSEC 1PDNC 3MKYB 2HYJA 2L4MA 1SVMA 1ETWA 2EZIA 2D2WA 3V7CA 3V8KA 1YTYA 2FX0A 2CMPA 2P5VA 3MQ0A 3PFIA 5FKOA 1Z7LA 1PVEA 2K3FA 2HOSA 2Q8KA 1I1SA 2QUFA 4PGHA 2Z5UA 2E1OA 4Y3OA 2DAOA 2FJ1A 3S15J 1S6LA 4MTDA 4GCVA 1B6AA 2K7LA 4L5JA 3KYLA 3ABUA 4L5IA 5B1BH 2Z33A 1TP4A 3FXRA 1V5FA 5B5EC 4WF2A 1OCTC 4II2A 4C9YA 1LE8B 1XGOA 3F0CA 3DTEA 1P9QC 4XRSA 2GA2A 1TC3C 3FWEA 3W3CA 3FXJA 2GXGA 3DEWA 3MWMA 4UV8A 2I5UA 3AKZA 2IS1A 2XF6A 2VJ4A 4BQOA 4G6TB 1R49A 1IUFA 3DPLC 1H9TA 2DU9A 5DYMA 2IGNA 1X3WB 2KDZA 4HRIA 3P9IA 5EEGA 4A6EA 1Y1WJ 4WX9A 1AA7A 2Y75A 2DJNA 3M8EA 3SYTA 5LGNA 4QTRA 2F6CA 4C3JJ 1DU6A 2OTJI 3PSFA 4G6DA 3HSEA 3ZQGA 1FP1D 5C4JJ 1OPCA 2R7DA 2E2IJ 2E71A 1XG1A 2ELHA 2K27A 4GYGA 2FQ3A 3HZJA 2AS5F 3E0JB 3BR0A 2O0YA 2QWWA 1TBXA 4EV0A 4GDFA 2W7NA 2M7BA 1SD5A 3QPHA 2XSJC 4OOIA 4UUSA 4BUPA 2HPIA 5K5OA 1BN5A 2HS5A 1AHDP 2E1CA 4ON0A 2IGOA 3ZOBA 2E34A 1VQ6I 1BI1A 1WJBA 5HDGA 2DFFA 3GTOJ 5D5VB 3IC7A 2L01A 1MMAA 1WWXA 3E6CC 4DGWB 2GZWA 4MFEA 4LK1F 4XM3A 2K02A 3ESWB 2EPFA 4M3EA 1BR4A 1F4KA 4HV5A 1FWZA 1JI8A 1FIAA 2QM3A 1LPQA 4UXNA 2RDPA 4CCOA 1VF9A 1BJZA 1D0XA 3DP7A 3WU0A 3L2QA 3T0YA 3HTSB 3QAHA 5GTIC 1JT6A 5DCMB 1ETQA 3HSRA 1BR1A 4YIIA 1K61A 3QU6A 4KMUX 4AVPA 2MD5A 1KU7A 3FIWA 3TEDA 3GW2A 3KX2A 1LDJA 4HW0A 5TISC 4L9JA 1WPKA 3QP6A 1WJ5A 4XN0A 1RR8C 2LKSA 4ENKA 1T8IA 1ZYRF 2IGKA 2KJBA 4XKVA 1YX3A 2ISYA 5J4YA 3Q5FA 1JKQC 1FBSA 5DS9A 3JR9A 4R8HA 2EA4A 2W82A 2M1BA 3HPGA 4DQ2A 2DT7B 4EGYA 3C2HA 1K4TA 2CGPA 5CVRA 3BZ6A 4EQQA 4IO9F 2LD5A 1ZARA 2P5KA 2L9NA 4LB6B 3BZKA 1J5YA 1BL0A 1F36A 3H92A 3CC7I 2XB5A 4XKBA 1JKOC 1PP8F 4HNUA 2W57A 1UZCA 2EA2A 5FJ8J 3C2GA 5C3EJ 2ZMEC 1A6IA 3NQOA 5GP9A 3HHGA 3BTIA 1GLNA 4OIQF 2IGMA 2QGUA 3RPUA 3BC8A 1NK2P 5E79C 2P7CB 3KEOA 4D5CA 2VL8A 3JSOA 2EQRA 1JE8A 1IC8A 1X2NA 4KT5C 2EZLA 1APLC 1ZRCA 2GM4A 3CD6I 3AL0C 2A6HF 3WHCA 3KYDB 3HB9A 5D5XB 4ESBA 1QVUA 1S7AA 2EFWA 3WTTC 2GIVA 1OCZH 3AG2H 4ZTFA 3J81K 1UHMA 2VBXA 3ZCOA 3B6AA 1YS7A 5E17F 2VBWA 1XB4A 1YITI 2KIMA 5AIQA 3MZHA 2X6OA 1HW5A 5LHGA 3F9KA 3CC4I 2ESHA 3NARA 3KP7A 2CUZA 3BCBA 2DXIA 4O5VA 4BQAA 4OIPF 1ZKGA 3VOEA 1MBFA 3EQLF 4RGXA 3CCLI 2HTSA 2F5DA 2H8WA 4D5FA 1BI0A 2VBYA 4PJNA 4OAZA 4DBQA 4F3QA 2O3FA 2DOEA 2R7UA 4NC6A 1WJDA 3OSFA 3GEZA 5F64A 3TBIA 2Q2EA 3PUBA 4XRSG 1YI2I 2UZKA 4FX4A 3NAUA 4IZZA 4U0WA 3GTKJ 2LY2A 1W36D 1QHHD 4A0XA 2YU9J 2A07F 3ASNH 2ICWG 5M3FJ 2J5OA 2IT0A 3HOXJ 2DI3A 5B66C 3FHZA 2NOJB 3I53A 3OYJA 2V1UA 1WJCA 3EUKL 3LOCA 3GFMA 4XL9A 1RI7A 3I71A 1RKWA 4GO1A 2LR8A 1AOYA 3HDDA 2MLGA 2LYCA 2KT0A 4GXOA 3GTGJ 1XCVA 2ZSIB 2JVHA 1FX7A 4LIVA 2R92J 3DF8A 4UB6C 2L7MP 5E3LA 2EIMH 5J1YA 2VQCA 5FKKA 2LBFA 4R1HA 2ZJ2A 2MC4A 4ZTJA 2FA5A 1UHWA 4RAFA 1UFMA 2PFBA 5EZHA 1ETYA 2E35A 1BC8C 2XGDA 1LE8A 1K78A 2CH0A 4CYCA 1LUJB 3TMOA 2JWTA 4CCNA 5F0CA 2OQRA 2JJ7A 4YELA 1H89C 4LJZF 3A0BC 3LA2A 5FLXZ 1Q1VA 3JAMK 1OISA 3BJOA 3J7AO 2ELKA 2ESNA 3I64A 3VYTB 3H5NA 2O8XA 1KYZA 5GAHJ 3D5SC 2CW8A 4KITB 2CV1A 3MZYA 3GTQJ 3EPZA 3W2AA 4CGZA 3HJEA 3S1RJ 1P4XA 3DPUA 2XAFA 3JCUC 1KU2A 1QGPA 3R60A 4MNUA 4M6VA 4BE2A 1SVOA 2ZFUA 3PSIA 3JRDA 3S16J 1TQPA 3KIOA 2CW0F 1HW1A 2YX7A 4G6QA 1G59A 2H27A 4RGRA 3CUQC 4ZDLA 2XVCA 4ZYAA 1O3RA 4PJLA 1ZGAA 3OV8A 2R5ZB 4RGSA 2VIXA 3HOYJ 4PSXA 4ZC3A 1ODDA 1KQ0A 3KYCB 1T2KA 2OCCH 3NWTA 2UUZA 2VJ5A 4EEFG 2R7WA 4XQFA 3ZRGA 3MCZA 2XHKA 2D1HA 3U2RA 2PMZN 2X4HA 5EF6A 3F23A 4IJAA 2H8RA 3ZPLA 1T0FC 2J5PA 4E70A 2FOKA 2NYXA 2ADUA 2A61A 2JMWA 1U0JA 1FBQA 3OS1A 1GVJA 3A2KA 1UB9A 3U1DA 2X0LA 4E7KA 1SFEA 4IEJA 1D1BA 1F9NA 4M3BA 4UUTA 2OJED 4PJ0C 5FD5A 3K70D 2A5WA 2JVGA 4QLCU 4UNOA 5DV5A 3BG6A 1R5GA 2L7KA 4BHPA 3FMQA 4Q47A 3KPHA 5IOYA 4AIDA 1JTXA 4XLHA 1FEXA 2ETHA 2DLLA 2ELJA 2XPWA 5IYDJ 3HEFA 2A05A 2ZBKA 4BJTA 3HOSA 3L2RA 1J9IA 3HRUA 2H6BA 3E6BA 2OA4A 4GFBA 4RMNA 3LWFA 1R5ID 2WB1N 4HDVA 5E3NA 4XLCA 2GLOA 1D0YA 4XR6A 2M7AA 5M5WJ 1MIJA 3HKZN 1FBUA 4A3LJ 4M9SA 1OR7C 3CCSI 1DGWY 2AQFA 3HTUA 4JOMA 1KQ8A 4GYIA 4F93B 2HKOA 1OYWA 2WAQN 1YJNI 4OAYA 3CDLA 2W85A 3OYMA 4XK4A 1OYYA 2VASA 4PFPA 4E7SA 3S1NJ 2QBYB 1S29A 3TDZC 2QKMB 3KP6A 3HOVJ 2L3DA 2NNYA 4XLPF 4Y15A 3J7AY 2NVTJ 4ZJZA 4A93J 3RZOJ 4BS9A 5FKLA 3S2DJ 3ZP5A 3W6JB 3VSLA 1FP2A 3RJPA 1OKRA 1F5TA 1ACIA 5LLQA 2H1KA 2IRFG 1VQOI 2P0WA 1QVTA 1IRGA 1ITYA 1HF0A 1B59A 3CCYA 1BW6A 4M72A 3ZMZA 4BQQA 1PP7U 5FRNA 5HVQC 3E1SA 5E1XA 2O7OA 2A69F 3CLOA 3RCOA 5B1AH 2VT2A 2WBMA 4V2GA 2P8TA 2YR2A 5ERIA 1TT5B 4JX5A 5BMZA 2HTJA 2V6EA 4LIUA 4XOTA 4CO8A 2F4OB 4EM0B 1AKHA 3FXLA 3K4NA 2QCOA 5IP6A 2HKXA 1I6XA 3JTHA 1H9GA 2Y2ZA 4MQVA 3GLXA 5J4VA 4FISA 4NBQA 2MGQA 5F1RA 1D8KA 5EGOA 2L4AA 3HGGA 3GUDA 3KLOA 2NS0A 3CESA 1AU7A 5E3OA 3LNQA 2FQ4A 1HKQA 2QSFX 4B09A 1IRZA 3C3WA 3LSKA 3SQNA 4N4NB 1POGA 1G6NA 1Y8RB 2LNBA 3CCMI 2V6CA 3IH2A 1QZEA 3PFYA 4L9NA 1D5VA 1ZAOA 2CQQA 4PK4A 4BNCA 3SZTA 3HUGA 4PUSA 1KYWA 3AG3H 1MJBA 3CDIA 5IYBJ 3E6DA 4WWCA 4MFDA 2MFZA 1GT0C 4HF2A 1JJ8C 2IA1A 4A3BJ 4C2UA 4BBRJ 2VBZA 1I3AA 4AM3A 3LAJA 3HG9A 3CCQI 2UWMA 1DGRM 4Y52J 5IOZA 3E97A 1EJ9A 3HSFA 1WHUA 2DA6A 4C30A 5IY5H 4PGGA 5EDNA 2WTEA 2HGCA 3WGGA 4IHVA 2MC3A 4KT6A 5KNLA 3MKWB 1QPIA 2K3PA 2O8KA 4XICA 3S8PA 1YRNB 2YUSA 2XB0X 1IRFA 1Y0NA 2VONA 1I6HJ 2RQPA 3JTGA 4QIWN 2HVQA 4B4CA 1T56A 4IRGA 4M6XA 1JKRC 2L9VA 1ON2A 2QENA 3HXLA 3GWZA 2FNAA 1V54H 1XX5A 3LL7A 3M8FA 1YW8A 1MNMC 1ETXA 2BY0A 2LKXA 3QOPA 2XROA 3AG4H 3P9CA 3MAJA 3ZMSA 3IH4A 4P1WA 1NTCA 3RQIA 2QQAA 3U1KA 1JJ6C 4ANJA 1DPRA 2ZB9A 3K1NA 2BVMA 4L5EA 3HL2A 3GLLA 5DCFA 3L7WA 4DYQA 1H8AC 3VYRB 3LA3A 5CVIA 1HSJA 3BT9A 5CYVA 3LSHA 4C3IJ 3JRBA 3E7LA 1FYLA 2WC2A 3GTPJ 1EV7A 2BW3A 3IP4B 1MDMB 2D5VA 2LY9A 1IN5A 5BNGA 4IHYA 5GAGJ 6PAXA 1JGSA 4PCQA 2K4BA 3CCUI 2W4SA 4M3FA 5AONA 3KLNA 4ESFA 3FHNA 2M0MA 4HYEA 3OMYA 2F5CA 2DTRA 2F5VA 5F0FA 1FMVA 4EM2A 5HDNA 2HDWA 1OCPA 2VQLA 2IVMA 2BE5F 3R0AA 3W2WA 5K7ZA 1QBJA 3C2BA 3K6GA 2FBIA 4I76A 4ZYDA 5FKMA 3OYNA 1SEUA 2DQLA 4HEA2 2XIGA 4BEHB 5LD2C 2PMZA 4RLQA 3U21A 1WFXA 2DA4A 5DUIA 1JT0A 3K4CA 1LB2A 2H1LA 3K1PA 4ZZDA 3OIPA 2DFEA 3UR3C 3QRFF 4XKWA 1LQ1A 1YE9A 2CQKA 2QEXI 2NS7A 3KEQA 4LK0F 1T33A 4LMYA 1OLTA 4IL6C 4IOCF 4OMZA 4FHTA 5D8LB 4NB5A 5HLIA 2DA2A 4D1QA 1RIOH 2ZSHB 5HS7A 2BXYA 3TW7A 1BJAA 1LFPA 2HOAA 2ZFWA 4XOPA 3S93A 5LHHA 2R7TA 1Z91A 3CC2I 5FB2A 1HKTA 2ID6A 1MMSA 1USTA 1WH5A 2E1MC 3IKVA 1RESA 3TW6A 5LBQA 4Q4ZF 2E5ZA 1DPUA 4G9YA 3R4KA 3K69A 3F22A 1WQ2A 3LSTA 4N4OB 3WGIA 2WB1A 4FE7A 4HX4A 1S72I 3AG1H 2VC1A 3I59B 2E2JJ 3ERMA 1X3ZB 3TKYA 2XGEA 2IJLA 3HHHA 3OYEA 3V7RA 3HKZA 1YIJI 2CJJA 2BOLA 2XSDC 3D1NI 1LEBA 4Z2YA 4I2OA 5J40A 1WJAA 2COMA 3H3ZA 2GXAA 1A6QA 4AIHA 3WODF 5FLMJ 3J80K 2EFPA 4A69C 2DN0A 2WAQA 2K86A 1MMDA 3BPXA 3C7JA 3FM5A 2BZTA 2EJRA 2X6WA 3I0TA 5D6EA 4M9XA 3TP3A 3CMMA 2P6TA 3T1BA 3K10A 1N25A 1VNDA 3FKIJ 1ZRDA 3HOUJ 2E7XA 1LVKA 3ML6A 1ZR4A 4OU0A 1I50J 4U0VA 1LDDA 1O4XA 1LJ9A 1QO0D 4Q48A 3MVPA 1ZK8A 2NXNB 2X85A 1J0RA 2NS8A 2ZNZA 4JK1X 3LQRA 4RDUA 1R23A 3FDYA 2ZMEB 1MMNA 2QSGX 3F72A 3FKJA 4DW6A 4LLLA 4XONA 3TO7A 1FYMA 3I4PA 1BM9A 2XF7A 2Z1DA 3I3LA 1IO2A 5IP9J 5JR3A 3RKWA 1BOBA 2KLOA 2R4GA 2LF7A 3PNTA 4X6AJ 4UHTA 3H3UA 2W24A 4V2FA 3T5XA 3AL0B 2LKPA 1OCRH 3ZQFA 1W5SA 1FLIA 3I4MJ 5F1JA 3SJMA 5LHIA 2R0QC 3W2VA 4F92B 1XD7A 3OY9A 2PJRA 5LFAA 1ZELA 5LEKA 1IF1A 3I54A 3S3OA 3S17J 3V4GA 2I10A 4UV9A 3S2HJ 3S1MJ 1EA3A 4KISA 5ICEA 3FMSA 1SANA 2KFDA 2DPUA 3DU6A 1LFBA 3HGYA 3RKQA 3CQZJ 4LITA 1P4AA 4I02A 2DOAA 3CTAA 3ULQB 4KDPA 5KAFC 1G3WA 3BTJA 4I01A 4IXAA 1HA8A 3D5RC 1T98A 2CU7A 4I0AA 1UG0A 1IW7F 5K5QA 3SFZA 3DV8A 3BROA 4HNVA 1R6RA 3K2ZA 2BVLA 2Q1ZB 2XRLA 5A2QK 4ENMA 2EIJH 4HSTA 2JA5J 1WCMJ 2PQ8A 3ZGKA 4E7JA 1YLFA 1KONA 2P6SA 1J59A 3UNGC 1B8IB 3OYCA 3QPTA 4BAYA 2NNNA 5E1ZB 1GV5A 1L3LA 1GV2A 1RPWA 1X3UA 3LFUA 2L9RA 4RM3A 1FTTA 4B3AA 3R6SA 2ZXHA 2JA7J 2WADA 2X48A 2Y9YA 1RUNA 2ISZA 2C6YA 2EK5A 2OF7A 3SFIA 1IN6A 3FXMA 3QODA 4M3DA 3VB2A 4EATA 3CJNA 4XLNF 4RGUA 3VWBA 4A5MA 3GTMJ 2XRNA 3QWLA 4CICA 2VJJA 5K1YA 3ZN1A 2OPTA 4AYBN 1Z3XA 4J19A 2DA5A 2WV0A 3V7SA 3P5JA 4G12A 5J1UA 1G8XA 4G7ZF 2VXDA 3SEZA 4EJTA 3H0GJ 1VZ0A 1B72A 2VPRA 4HDUA 4LG0B 1FYKA 4AIJA 4P55A 4BEHA 2R7ZJ 2UV1A 3GO5A 3H3VK 1R71A 5JLXA 1RR7A 3PL8A 1WI9A 3S2WA 1IXRC 3J81Z 1PJRA 5D6FA 2O9LA 4E7HA 3U9GA 4HNTA 5KAIC 1G2HA 1U9NA 3ELKA 2XF5A 3LSIA 4LGWA 3CUQB 1WJEA 4XSXF 4A3MJ 3X2QH 2ZKZA 3BJAA 3DTKA 1GUUA 2JK3A 3C1DA 3BG7A 1K79A 3PJRA 1O3QA 5ICFA 3MN2A 4BXXJ 4EVIA 1MH4A 3FISA 1D0ZA 2RGVA 3A01B 2DMTA 5E18F 2R7XA 3DQVC 2X9DA 1EKEA 3RIRA 5C44J 1Z77A 1I3QJ 4HAMA 4FCYA 3I9V2 3DLAA 1MBHA 5KK1A 3CUOA 3M1CA 4DNCA 3I4NJ 2BBYA 4Y33A 3DBHB 1TW3A 1YX5A 4LD5A 1P92A 4YFXF 2CUFA 2BEOA 3F8NA 5J1RA 3CP8A 2DMQA 3I59A 5FGMA 3OR2C 5DDGA 4IPAA 3DU5A 2L54A 3OYHA 3TOBA 2M2EA 4DYCA 2K9MA 1Z6RA 5ILVA 1IZ1A 2KIFA 2KMUA 1JUPA 3WTWC 3EYIA 4DOZA 2CV2A 5EG0B 1C0WA 1U5TB 4A3GJ 1TNTA 2Y69H 4DYRA 2GIZA 3EETA 3KFWX 5DD8A 1W5TA 3BTLA 1TTYA 3WG9A 3LFKA 4E7IA 2KRCA 2W25A 5IYCJ 3DEUA 1UCRA 3HYIA 3WTZA 4Y7NJ 4WXHA 3IV5A 3L9FA 4LLNA 2Y30A 1E0EA 1ZGJA 3F8MA 2JZYA 2W1OA 1R1UA 4LG3A 4WCGA 3HOTA 2R7FA 4U88A 5DM6F 3QYFA 3JRGA 4BU2A 3GX4X 2DBBA 1JTYA 2GQQA 1XTAA 1SMTA 1K7AA 5HOOA 2XAJA 2PMHA 3ZR8X 3HM5A 1X58A 5BPIA 3LQQA 2Z3YA 3MFKA 5J47A 3E3VA 2Z99A 3JAMZ 1MBKA 2TRTA 4XNFA 5CKTA 2L02A 2R93J 1K6YA 1PUFB 2Z16A 1J75A 1X4PA 2MLKA 1X1CA 2CQNA 3JRIA 2QYOA 1UHSA 3BCAA 4WK8F 1HBXG 3HBLA 2M8EA 4KA4A 1NG6A 4A5NA 3L2CA 4DZJA 2F4IA 4H4KC 1MH3A 3WU2C 2VLAA 3KP4A 5F0HA 3NWSA 5IT3A 4IHWA 2GA1A 1JHHA 1F43A 2LREA 1D8JA 5CPRB 2JRTA 1MBEA 4XRFA 4RB3C 2V9KA 2VKDA 1U8BA 2F4MB 3OOPA 3F8FA 3CO7C 4PDKA 3GXOA 4M6YA 3P9KA 4HOBA 2HOEA 2HZDA 3J7ZI 5IT9K 5DCMA 1D3YA 3L1PA 3IRQA 4XMYA 4CSWA 3K4JA 2DT6A 1HOMA 4F55A 3H9QA 4C3HJ 2YX4A 3H5RA 1U5TC 4HA8A 2M30A 2DJIA 1ZG1A 1G4DA 2KISA 1U6GA 3IAS2 1IGNA 4JYKA 1EF4A 3BR1A 2PJPA 1WZ2A 1EH6A 1I5ZA 2E60A 2Y0SN 1SD6A 1SD4A 4MLOA 3ECHA 2K9QA 1HKSA 2OZUA 2JSPA 1W4MA 4W97A 4CXFA 3HRSA 1MW7A 1ONVA 4I7HA 4M9ZA 3L2WA 1LVAA 2LH9A 5TRDA 1XDSA 4B44A 2B9SA 1B8IA 4A3CJ 1KZHA 4KN4X 3TQNA 1ON1A 3JRFA 2H6CA 1O3SA 1CF7B 2LVSA 1YS6A 4JBAA 3OIOA 2HXOA 3RI4A 2DODA 4RB0A 4A3FJ 1ORKA 4I99C 2STWA 4U0YA 3RYPA 3GZ6A 3JSPA 3CCRI 1VQ8I 1MBGA 4RA2A 4I0BA 1W7PD 1GVDA 3SZGA 4OIOF 2NVYJ 2AHQA 2LF8A 1FNNA 2XUBA 5TGTA 4ENJA 2ID3A 5DD4A 5F04A 2HOTA 3FK7A 1Y6IA 3WU1B 4XKCA 1SFXA 2M9HA 3CMAI 3IUOA 2M0CA 5L3EA 3G1LA 3RDIA 3SHFA 2MBFA 2TCTA 5K5RA 2ZJRF 2HYGD 1YW7A 4KMFA 5DTDA 4AC0A 2LY1A 1FOKA 1JHFA 4CHUA 3Q3SA 5CVUA 4O3MA 3MEXA 3MD2A 2JQ7A 3PO3J 2LK2A 4ZDOA 1Y39A 3CZ6A 1OMIA 3TGNA 1WH7A 5ED4A 3HRTA 3GBGA 3T8RA 2VOPA 5K7HA 3KZIC 3TOAA 5HLGA 3BQYA 2JA2A 4BKXA 4AYBA 3CMEI 1SFOJ 1A5JA 3E6MA 1IUYA 1NHAA 1WSUA 5GPAA 4B48A 2RQQA 1E2XA 3I58A 2FBHA 2XAHA 1HC8A 5IPAA 4W1UA 5M5XJ 3IAM2 1FIPA 3WHBA 5L3BA 2DA1A 4HBLA 1TZLA 4I6ZA 1MGTA 1PYVA 4YRVA 1X2MA 1FOXA 4FT8A 4MTEA 3RPUD 4XIDA 2OBPA 5LGTA 1ULYA 4XLEA 4YFNF 2DYSH 2RKHA 1VTNC 3PUFA 5JFRA 2ZXJA 2CFOA 1JUMA 2FBKA 1T6SA 1ETVA 3OWTA 4H0EA 2DCEA 1G3SA 5CLSA 3LAPA 2VN2A 5F6FA 1N75A 1YW9A 5J3LA 1U3EM 2CO5A 3ZQQA 5M3MJ 3ERED 4CDGA 4MO7A 2XC7A 2XGCA 3BY6A 4RS8A 4CCKA 2DDAA 4UUSB 1BC7C 2MG4A 5HS9A 2MSYA 2NAZA 2HQRA 3AFHA 2ZNYA 2IW5A 3HOZJ 4KIGA 5FFZA 2WAEA 4KJZA 5FO5A 2WAFA 3M8JA 3VPRA 4EGZA 5CJ9A 2EFOA 1PUEE 2CSOA 2JUCA 2R7SA 1FOYA 2LP0A 2EZHA 5JHFA 1MJ9A 3GFLA 3RYRA 1W7PB 2K9NA 3MZ8A 2HDDA 2VJIA 2GOMA 5EG0A 3RZDJ 1DUXC 2GXBA 2H09A 1OFCX 2E2HJ 1O3TA 4OWRB 1UAAA 4BDYA 4HX8A 3K2AA
chains in the Genus database with same CATH topology
3F9KA 2DXIA 1LKXA 2CUZA 2R7OA 1LVKA 3BCBA 3CP2A 4NNJA 4QPQA 3SEQA 4CCMA 1MNEA 3N05A 4B47A 4PJNA 4OAZA 2X85A 2R7VA 4DBQA 4F3QA 2KZVA 4XLFA 4F52A 2R7UA 2E1MB 1WJDA 3FDYA 1MMNA 3TBIA 3FKJA 3RTRA 3PUBA 4XONA 3L2UA 3OYFA 2XF7A 2Z1DA 3I3LA 4IZZA 2XDVA 2LY2A 1W36D 1QHHD 1BOBA 2KLOA 3S32A 2R4GA 3PNTA 2LOOA 3AL0B 4B3XA 3K4MA 2NOJB 3OYJA 5CQEA 3H0DA 2HVSA 1WJCA 2A6TA 3EUKL 3VSKA 4XL9A 3W2VA 4F92B 4JQFA 3S3NA 3OY9A 2L9SA 4YEJA 2PJRA 5LFAA 1ZELA 2LYCA 4XORA 2ZSIB 2JVHA 3S3OA 3QYBA 4LIVA 1TT0A 4DIQA 2I8DA 2V4JC 3SDBA 4XLAA 1EA3A 4CZCA 4IQJA 1Y56A 4KISA 2VQCA 3CF2A 1MMGA 2LBFA 2MC4A 1QU3A 4U7BA 4ZTJA 3DU6A 3ONQA 3MMYB 4LITA 3QOEA 2DOAA 5KCMA 5FRMA 2CH0A 3HC7A 3VYUB 1HA8A 2V1NA 4FETA 3D5RC 1LDKB 1W36C 3TMOA 4CCNA 1UG0A 4YELA 5HLTA 5FROA 1R6RA 2O5RA 4NUBA 2IS2A 4NC8A 2BVLA 2CUJA 2Q1ZB 1D1CA 3VYTB 4DBRA 3VYSB 3H5NA 3PNYA 4HSTA 3H9GA 3D5SC 2CW8A 2L5QA 4BACA 3ZGKA 4KITB 4E7JA 2CV1A 3EPZA 3BLYA 3W2AA 1KONA 4RM2A 3DPUA 4RLFA 3UNGC 4PSWA 4Y4RA 3OYCA 2V7FA 4BE2A 3OOUA 2ZFUA 3PSIA 2M4KA 1WJFA 4AU7A 2M3AA 2Y0SA 3CJRB 2Q2EB 1G59A 2K9LA 4BXFA 2JUGA 4ZDLA 3LSMA 4ZYAA 3LFUA 2VQGA 4PJLA 4RM3A 4J00A 2MD0A 2VIXA 3EUAA 2ZXHA 3OYAA 2WADA 4PSXA 3D5LA 4ZC3A 4E4HA 1N78A 3NWTA 2GOXB 2UUZA 2VJ5A 2R7WA 2X1CA 3QODA 4EATA 4XQFA 3ZRGA 4R79A 3OR1C 3VWBA 1D1AA 2PJRB 3VDXA 4E7LA 3EUHC 3TL4X 2VJJA 1T0FC 2XAUA 2LC2A 3FBNB 1U0JA 1Z3XA 3A2KA 3OS1A 1G8XA 2VXDA 4E7KA 3SEZA 1D1BA 2LBFB 1SFKA 2ZXIA 3K70D 2A5WA 1VZ0A 2JVGA 3BG6A 2OC6A 4CCJA 2L7KA 4BEHA 2UV1A 1T95A 1X1AA 2VXZA 3DWLE 2KQRA 3PL8A 4IQ4A 4XLHA 1PJRA 4E7HA 4IKFA 2R7QA 3DPTA 4IX7A 1IRXA 4HNTA 2ELJA 2XF5A 3LSIA 1X1DA 1WJEA 3PNVA 3HOSA 4BJTA 3L2RA 3OS2A 3DTKA 3DEEA 4U87A 4BGDA 4RMNA 3MKZA 3BG7A 3PJRA 3HPHA 3K4KA 3OIQA 4XLCA 4F91B 2RNGA 4FASD 1D0YA 4XR6A 2M7AA 1D0ZA 2HU9A 3ZXSA 2R7XA 4B43A 3DQVC 3LMMA 2FUG2 1OR7C 3K70C 2VKHA 3CJQB 4CA0A 2AQEA 1DGWY 2AQFA 2X6XA 2KPMA 3I9V2 3DLAA 3A4CA 4JOMA 1S9HA 2OUMA 3M1CA 1Z3YA 4F93B 4OAYA 1V5GA 4Y33A 1QHGA 4BJ5C 3OYMA 3H9JA 2VASA 4PFPA 4E7SA 4HSRA 1YX5A 5HNFA 2QKMB 3CP8A 3J7AY 3OR2C 4ZJZA 2WY8Q 3DU5A 3OYHA 1V5EA 4BS9A 1DQUA 4E6KG 5KHDA 2K5CA 2K9MA 2WA0A 2CS3A 3VSLA 3OYIA 2KMUA 2CW7A 4DOZA 2CV2A 3OYGA 1N77A 3OL3A 2P0WA 3A1YA 5FRNA 4BQQA 4E7IA 3DKXA 2KRCA 3QYEA 5HVQC 1X1BA 3E1SA 3LSGA 2CV0A 3RCOA 2R7RA 2WBMA 4P5OA 4HG2A 1NG7A 4PJMA 4AVZA 1E0EA 2KL4A 4ZDPA 2W1OA 3OYKA 2V6EA 4LG3A 4LIUA 4XOTA 3HOTA 3G2BA 2W00A 3K4NA 3K4BA 3QYFA 4BU2A 1ERDA 5HOOA 3ZR8X 2KDOA 2WY7Q 3OYBA 4XN3A 4XNFA 1X4OA 3CESA 4II3A 5CKTA 3FBIB 3OYDA 1K6YA 2X1EA 4QPOA 2KRHA 2Z16A 4CUGA 1X4PA 4PJJA 1X1CA 2LG4A 3BCAA 3LSKA 5HNHA 1NG6A 3L2VA 4N4NB 2F4IA 4H4KC 3MKYB 2VLAA 3NWSA 3PFYA 2CMPA 2LREA 1Z7LA 3V42A 4PK4A 4NC7A 5CPRB 4ITVA 4Y3OA 4PUSA 2IXSA 2V9KA 2MFZA 2VKDA 2Z2SB 4BE1A 3KYLA 4C2UA 4CH7A 1V5FA 4BJ6C 2HZDA 3HG9A 2UWMA 1DGRM 4II2A 4C9YA 4C30A 3OL4A 4XMYA 4CSWA 3K4JA 3DTEA 1P9QC 2DT6A 4F55A 3H9QA 3W3CA 2IS1A 3AKZA 4KT6A 5KNLA 3MKWB 3H5RA 2M4GA 2K3PA 2MABA 2DJIA 2XF6A 2VJ4A 3IAS2 3S8PA 4BQOA 4G6TB 1UELB 3DPLC 2E60A 4MLOA 2IGNA 4HRIA 2KHMA 2VPLA 2HVQA 1AA7A 2JSPA 3SYTA 2F6CA 2RREA 1MW7A 3PSFA 3HXLA 3K4LA 3L2WA 3H5AA 2LH9A 3DKYA 3LL7A 1Z21A 4B44A 4P1WA 2IS4A 2VB6A 1MNDA 4ANJA 2HNHA 3HL2A 3E0JB 2BVMA 2QKLB 3VYRB 4CCLA 4DJAA 2W7NA 3LSHA 2M7BA 2XSJC 4BUPA 2HPIA 4GRIA 2BW3A 3IP4B 3SZGA 2IGOA 3OYLA 4E7ZA 5TGTA 2L2OA 2W4SA 1WJBA 1Y6IA 5CQGA 4XKCA 2X1DA 3FHNA 1MMAA 2M0MA 2X6YA 4DGWB 2HQAA 3IUOA 3OMYA 4XM3A 2F5VA 1FMVA 1BR4A 2HDWA 3HUGB 2VQLA 3W2WA 4C2TA 2VQHA 1JI8A 2LY1A 3K6GA 4BQNA 4CCOA 1D0XA 3L2QA 1J09A 3RQ4A 3OYNA 4BE0A 3MD2A 4HEA2 4BL0B 4ZDOA 3CZ6A 4BEHB 1BR1A 2X51A 5LD2C 4BDZA 2PMZA 3GBGA 4RLQA 3U21A 1WFXA 3KX2A 2JA2A 4AYBA 3K4CA 3RSNA 3OIPA 3UR3C 4XN0A 1WJ5A 4XKWA 1YE9A 4PFOA 4B48A 2RQQA 4J01A 2IGKA 4XKVA 1YX3A 1OLTA 2MYSA 3IAM2 2LRDA 1TZLA 4YRVA 1PYVA 4D1QA 2ZSHB 3RPUD 2HPMA 2W82A 3HPGA 4XLEA 2DT7B 4D9JA 3C2HA 3OS0A 2IS6A 1LFPA 1DP3A 4XOPA 3S93A 2R7TA 2L9NA 2CFOA 3OWTA 2DCEA 4XKBA 1N75A 4X0GA 4HNUA 2E1MC 3ZQQA 2E5NA 3C2GA 2XC7A 1GLNA 2E5ZA 2IGMA 4CCKA 2KP6A 3BC8A 1X19A 2BW3B 3DTIA 3AFHA 4N4OB 2VL8A 2WB1A 2WAEA 4HPQA 4KJZA 3AL0C 3OYEA 3HKZA 2V26A 3H35A 2WAFA 3M8JA 2BOLA 1WJAA 1FMWA 2R7SA 1SAUA 5JHFA 4ZTFA 3S3MA 2WAQA 2HVRA 1MMDA 3ZCOA 2VJIA 2GOMA 2X6WA 3CMMA 3K10A 4OWRB 3KEYA 1UAAA 4BDYA 2OV7A 1BR2A 4NQWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VWB A;  3MKZ A;  1VZ0 A;  3MKY B;  3W2A A;  3W3C A;  3MKW B; 
#chains in the Genus database with same CATH topology
 1LKX A;  1EH7 A;  3GZ5 A;  1Z05 A;  1YIO A;  2IP2 A;  3EDP A;  4CCM A;  4XSZ F;  1T38 A;  2IPQ X;  1MNE A;  1S7O A;  1W1W E;  1XGN A;  3Q9V A;  4MQ9 F;  3GTJ J;  1KU3 A;  2NVX J;  2R7V A;  1R4M B;  1I1G A;  2KZV A;  1TWA J;  4F52 A;  2E1M B;  3QQA A;  2FF4 A;  2ZJQ F;  1VQL I;  3K1M A;  3RTR A;  3PQJ A;  1P7J A;  1RRJ A;  2Y48 A;  1IXC A;  1VQ7 I;  2IEK A;  2XDV A;  2R5Z A;  4HLX A;  2LLK A;  2JPC A;  1SFU A;  3S32 A;  2Q0O A;  5JLW A;  4D7N A;  2ZO4 A;  4BHB A;  2PBI A;  1MD0 A;  4IHS A;  1KU9 A;  1UMQ A;  2A6E F;  3H0D A;  2XKO A;  2A6T A;  3ZQL A;  1Z7U A;  1K6O A;  3S3N A;  1WGX A;  2DYR H;  4YEJ A;  4RBO A;  1XGS A;  2XPV A;  3GTL J;  4B8X A;  3QYB A;  2HXI A;  2JRM A;  5GTH C;  1U2W A;  5M5Y J;  4UVB A;  3DFG A;  4WXC A;  2V4J C;  4L0Z B;  5L3G A;  4XLA A;  1KQ9 A;  1XSV A;  4CZC A;  5GAE J;  4IQJ A;  3HRM A;  5E8I A;  3CF2 A;  1BI3 A;  1G3T A;  1MMG A;  3VEP A;  4G7H F;  4IOA F;  1QU3 A;  4U7B A;  4A3E J;  1W0U A;  2A3S A;  3QOE A;  5D4S A;  1Y8Q B;  5KCM A;  1YJ9 I;  1FY7 A;  5FRM A;  2V1N A;  3H1C A;  4FET A;  3BQZ A;  1LDK B;  1MSF C;  3WE3 A;  1Y1V J;  2ME0 A;  1KGS A;  2E19 A;  2MW8 A;  4FQG A;  4IHT A;  5H6R A;  2FOW A;  4JX6 A;  3O3K A;  3ZMU A;  3FXU A;  5E8G A;  2K9S A;  2VE9 A;  2DQR A;  1H88 C;  1GXP A;  4NC8 A;  2CUJ A;  4P9U A;  1D1C A;  4DBR A;  2XV4 S;  3VYS B;  3I56 I;  3H9G A;  4BAC A;  2L5Q A;  2LMD A;  2D1V A;  3A03 A;  1WKM A;  3ZMV A;  5EYR A;  3TDU C;  4O6J A;  1EH8 A;  2V9V A;  4RLF A;  4KIB A;  2BYV E;  2EFN A;  2DW4 A;  4Y4R A;  4YG2 F;  1VQ5 I;  2V7F A;  2JPB A;  2UXN A;  1RC9 A;  4IHX A;  1WJF A;  3O8G A;  2F48 A;  2M3A A;  2Y0S A;  3CJR B;  2Q2E B;  4EJO A;  5DUK A;  1O7L A;  2K9L A;  3EUH A;  4AWX B;  4BXF A;  2JUG A;  3JRA A;  2EB7 A;  1ETK A;  1VFC A;  2DTZ A;  1Y0U A;  1J2X A;  3EUA A;  2FMY A;  3OYA A;  2FEZ A;  3QP5 A;  3D5L A;  3M7G A;  4M71 A;  4E4H A;  1JXS A;  1ZH5 A;  4EMS A;  1TWH J;  1V4R A;  2GOX B;  3IWF A;  2QBY A;  3ZQH A;  1VQ4 I;  2X1C A;  3FK6 A;  4R79 A;  3GVA A;  4LOC A;  2QQ9 A;  3L00 A;  2DA3 A;  2RVC A;  1HQC A;  1REP C;  1R7J A;  4G94 A;  4A2U A;  1D1A A;  3VDX A;  2NOG A;  1YG2 A;  1U9O A;  1R00 A;  3KCC A;  2EIK H;  2R5Y B;  3CF5 F;  4WXD A;  2JT1 A;  1VQ9 I;  2XAU A;  1P7I A;  1RNL A;  3FBN B;  2D45 A;  2HFH A;  3CCJ I;  3BDD A;  1F1Z A;  2BGC A;  4M74 A;  3LSR A;  2UXX A;  2LBF B;  1NH3 A;  1MZB A;  1XSX A;  4LFU A;  2CFX A;  4OIR F;  1FPQ A;  4X1E A;  1K78 B;  2KIQ A;  2M45 A;  4CYC B;  3F8B A;  1T95 A;  1X1A A;  2DMP A;  4G7O F;  2HWV A;  5BOX A;  3J80 Z;  3WTU C;  2G7H A;  2TDX A;  4S05 A;  4IKF A;  2O03 A;  3ABK H;  3BR2 A;  4IX7 A;  3W6V A;  1IRX A;  2MH2 A;  1X1D A;  3KET A;  1YJW I;  4RB2 C;  2FSW A;  2NVU B;  3HIF A;  3DEE A;  4U87 A;  5ICG A;  3PIO F;  3OS2 A;  2BHZ A;  1ZGW A;  2DPD A;  4BGD A;  3COA C;  1XGM A;  4HZF A;  4FX0 A;  3MKZ A;  4EM1 A;  1T08 B;  4UB8 C;  1K83 J;  1IDZ A;  3OIQ A;  4F91 B;  2RNG A;  4MGR A;  4FAS D;  3FZV A;  1B9M A;  3IHU A;  1HCR A;  1VQK I;  4HLY A;  3IRR A;  4B43 A;  2FUG 2;  3CJQ B;  4CA0 A;  2AQE A;  3AAF A;  1SD7 A;  2KPM A;  2X6X A;  3A4C A;  3J7Y J;  4ESJ A;  1S9H A;  2AO9 A;  3ROU A;  4KUM A;  3JW4 A;  4JP0 A;  2AXT C;  2PG4 A;  1I39 A;  5J8F A;  2L7F P;  3A02 A;  1VQN I;  3BG9 A;  5FKN A;  2MA3 A;  5F08 A;  3K0L A;  1T39 A;  2B7E A;  1ZG3 A;  1YYV A;  3CJT B;  2HDC A;  2WY8 Q;  5KHD A;  2RC4 A;  2K5C A;  2WA0 A;  2CS3 A;  2OCE A;  3OYI A;  1XMA A;  2CW7 A;  1HDP A;  3GFI A;  2LTP A;  4YIF A;  3OYG A;  3DLL F;  1N77 A;  1LEA A;  1W7P A;  3L09 A;  1O7F A;  4Z6Y A;  2P7V B;  1G3Y A;  3A1Y A;  5BQT A;  2BV6 A;  4PZJ A;  3DKX A;  3QYE A;  1YRN A;  1X1B A;  3LSG A;  2CV0 A;  2DOF A;  3IH3 A;  4HG2 A;  1AWC A;  1TWC J;  3PIP F;  1TWF J;  2N8G A;  1IAW A;  4BY1 J;  3FMR A;  4U7D A;  3G71 I;  4I98 B;  2CRG A;  3RKX A;  3T8T A;  3ZQC A;  3Q0W A;  3G2B A;  1DP7 P;  3V8L A;  4D0P A;  5H2F C;  3K4B A;  4I09 A;  1IJW C;  5HDK A;  2OAZ A;  3M9A A;  1Z0X A;  5L3C A;  2O6G E;  2PN6 A;  3C18 A;  1FSE A;  1RKT A;  3R0J A;  2KDO A;  4ENN A;  1USS A;  1QZY A;  4Y17 A;  3OYB A;  1X4O A;  5JVG F;  1HST A;  2RNJ A;  3FBI B;  3OYD A;  2X1E A;  4QPO A;  5A2Q Z;  2KRH A;  2V1X A;  4CUG A;  1XN7 A;  4KFC A;  3BG3 A;  2LG4 A;  3ISP A;  4C2M J;  1GHC A;  1MDM A;  2KRF A;  3O2P E;  1MJA A;  2HQN A;  5E20 A;  1V3F A;  1VQM I;  5EEA A;  4MHG A;  5LGU A;  1S3J A;  5FLV A;  1SC7 A;  3E5X A;  1P4W A;  3CDH A;  5CVJ A;  4GGG A;  3GYH X;  5GAD J;  2DO7 A;  1OCO H;  3V42 A;  1YQA A;  2VE8 A;  3CO6 C;  4NC7 A;  4ITV A;  2G0E A;  2JA6 J;  1BIA A;  2V1D A;  2IXS A;  4YFK F;  2PI0 A;  5F27 A;  2JN6 A;  2Z2S B;  4BE1 A;  2H94 A;  3BWG A;  4N9I A;  4NHJ A;  4B1R A;  4CH7 A;  2E36 A;  1IXS B;  1S7E A;  3I5U A;  3KP5 A;  3NEU A;  3WTY C;  5BPD A;  1QA6 A;  4BJ6 C;  2E1N A;  4HF1 A;  1R9T J;  2GAU A;  4N0B A;  3OL4 A;  3WTS C;  3D0S A;  2OTL I;  5EZG A;  1X1P A;  2DMN A;  3REO A;  2M4G A;  3V8J A;  2PMU A;  2MAB A;  2KIU A;  3DXJ F;  2CQ7 A;  4Q5S F;  1UEL B;  2LDU A;  2KHM A;  2VPL A;  4S04 A;  1BA5 A;  3B73 A;  2A5Y B;  1R4N B;  1IN4 A;  1MKM A;  2RRE A;  3K4L A;  3N97 A;  3H5A A;  5L3F A;  1AKH B;  3DKY A;  2P4W A;  2W84 A;  2XAQ A;  1JKP C;  1Z21 A;  4A0Z A;  2GWR A;  2OQG A;  3GF2 A;  5AIP A;  2VOO A;  2K85 A;  3ZQ7 A;  2IS4 A;  5EGO B;  2VB6 A;  1MND A;  1RUO A;  2HNH A;  1XDU A;  2EFQ A;  2Y9Z A;  1FSH A;  2QKL B;  3F3X A;  3IKT A;  2PEX A;  4D7M A;  4CCL A;  4DJA A;  2STT A;  4XRM A;  3IWZ A;  1RET A;  1FT9 A;  4GRI A;  4QSH A;  2KZG A;  4Y13 A;  1OYI A;  3GFJ A;  3OYL A;  3KE2 A;  4E7Z A;  2VI6 A;  2FU4 A;  4KNY A;  3PM1 A;  1A35 A;  4IF4 A;  2L2O A;  5H6Q A;  5LEJ A;  1QPM A;  5CQG A;  5JI6 A;  1Q1H A;  3DCF A;  2X1D A;  3TO9 A;  2X6Y A;  4DZP A;  2M5W A;  2HQA A;  4RAG A;  2R5Y A;  1BW5 A;  3BR5 A;  4P96 A;  5C4X J;  1DU0 A;  3HUG B;  1BI2 A;  1B4A A;  4A3K J;  1OCC H;  2EH3 A;  2VKV A;  2RAE A;  2VQH A;  2XKP A;  4C2T A;  5FLX K;  2M8G X;  1R5H A;  1P6R A;  1SMY F;  3EYY A;  4RAY A;  4BQN A;  5ILU A;  1Z67 A;  3PO2 J;  4BE0 A;  1J09 A;  2DDB A;  3RQ4 A;  1LFU P;  2PLY A;  2XPU A;  2K40 A;  4BL0 B;  4BY7 J;  2X51 A;  3LSJ A;  4BDZ A;  3M07 A;  3B02 A;  2NVQ J;  2JTV A;  3RSN A;  5B3S H;  4G8X A;  3SXY A;  4UY8 I;  4PFO A;  4J01 A;  1L0O C;  2ZME A;  1CGP A;  1IG7 A;  5DEQ A;  2MYS A;  1IN8 A;  1A31 A;  3CLQ A;  2LRD A;  3WE2 A;  3SZP A;  4MEX F;  3BOQ A;  1Z1D A;  2COB A;  2HPM A;  1S8N A;  1QNT A;  4D9J A;  3OS0 A;  4A3D J;  4JX4 A;  3O8H A;  5HS8 A;  1DDN A;  2IS6 A;  1DP3 A;  3E5U A;  2KJC A;  5D5W B;  4BHC A;  2OD5 A;  4A0Y A;  5CVV A;  2F2E A;  2HI3 A;  3S14 J;  4X0G A;  2QQ8 A;  3BTC A;  3FM3 A;  2E5N A;  2MH9 A;  3SDG A;  2M34 A;  4S0H B;  1JGG A;  2CQX A;  2OU2 A;  2DT5 A;  1A04 A;  2EWN A;  2XAG A;  4A6D A;  5H20 A;  4ZYG A;  5IP7 J;  2KP6 A;  1VQP I;  1B1B A;  1X19 A;  2BW3 B;  3DTI A;  4BBS J;  2RV8 A;  1QZZ A;  3F8C A;  5FFX A;  1SAX A;  4EJU A;  1ZQ3 P;  4HPQ A;  2HR3 A;  4YIR X;  1S5L C;  4M3G A;  3JRE A;  5TJJ A;  2V26 A;  3H35 A;  4XBF A;  3LSP A;  3BG5 A;  2EV6 A;  1CQT A;  3BR6 A;  3K9T A;  1A36 A;  1FMW A;  2HZT A;  1VI0 A;  1SAU A;  2EIN H;  3ABL H;  3F21 A;  3CCE I;  1H0M A;  2A68 F;  3S3M A;  3GME A;  2DFI A;  3H36 A;  2HVR A;  1ZLJ A;  1HDD C;  5GPC A;  4L9V A;  9ANT A;  1ZN2 A;  3Q0U A;  3KEY A;  5BS6 A;  1R1T A;  2OV7 A;  1W5C C;  1BR2 A;  4NQW B;  1OJL A;  1XSD A;  3CCV I;  1WVR A;  4HQE A;  1WI3 A;  3HOW J;  2R7O A;  3CP2 A;  3SEQ A;  4NNJ A;  3G1M A;  4QPQ A;  2AXL A;  5IT9 Z;  3KP3 A;  2VKE A;  1BBY A;  1XMK A;  1Z9C A;  3N05 A;  4B47 A;  2F5F A;  3BZC A;  4XLF A;  3MKL A;  3G3Z A;  2BY2 A;  5KVR A;  2VUM J;  3FF5 A;  4OMY A;  4IVN A;  3L2U A;  1R36 A;  4FTH A;  2ZXW H;  4LLG F;  3OYF A;  2LSO A;  2PX9 A;  4ZZL A;  4HQM A;  3ABM H;  1QRY A;  2CUE A;  1HXD A;  2DMU A;  1W0T A;  2CWE A;  2LOO A;  4B3X A;  3K4M A;  1E3P A;  2IA0 A;  5CQE A;  2HVS A;  1ZRF A;  1GDT A;  3VSK A;  2QSH X;  2ZC2 A;  4JQF A;  4UVC A;  1TWG J;  2L9S A;  3ABT A;  3WTV C;  4XOR A;  1IV6 A;  3TP0 A;  3KZZ A;  5DM7 F;  3ASO H;  1TT0 A;  2QZ8 A;  4DIQ A;  2EBI A;  2I8D A;  3SDB A;  2B0L A;  1Y56 A;  3WTX C;  2HQ5 A;  3ONQ A;  2YU3 A;  3MMY B;  4F7Z A;  1SVL A;  1HLV A;  5JVT A;  4LG0 A;  2EIL H;  3G4S I;  1TW2 A;  1ZG5 A;  1KA8 A;  3HC7 A;  3VYU B;  1MBJ A;  1W36 C;  3BR3 A;  4ZYH A;  1ZHF A;  2XGX A;  4BYY A;  1FZP B;  2DK8 A;  5HLT A;  1WRJ A;  3A0H C;  4EJV A;  3DBL B;  5FRO A;  1FJL A;  2O5R A;  1M1E B;  2BY1 A;  4NUB A;  2IS2 A;  1IN7 A;  3CUQ A;  1XCB A;  1RZ4 A;  3K7A J;  3PNY A;  2FE3 A;  4P9F A;  3JRC A;  2F5E A;  2GBY A;  1R1V A;  3TO6 A;  3BLY A;  3QU3 A;  1STZ A;  2KKO A;  4HX7 A;  4RM2 A;  4PSW A;  1BOA A;  1XPX A;  4IRH A;  3IL2 A;  3A01 A;  5D4R A;  3OOU A;  5HLH A;  1E3O C;  2NRA C;  2M4K A;  3O6B B;  4AU7 A;  1ZLK A;  3LSM A;  1T0F A;  1V55 H;  1UG2 A;  2EZK A;  2VQG A;  1P2F A;  3ECO A;  3FXO A;  1IV8 A;  3F6O A;  2MD0 A;  4J00 A;  4CYD A;  2V79 A;  4L18 B;  1XC5 A;  2W48 A;  1N78 A;  5E3M A;  3UKG A;  3B6C A;  2IBD A;  5LRS A;  1U78 A;  3GZN B;  3OR1 C;  3KP2 A;  4A3J J;  2EV5 A;  4L9T A;  2PJR B;  1I27 A;  1JUS A;  3Q0V A;  1TQM A;  4E7L A;  2QA4 I;  3EUH C;  2WV1 A;  3TL4 X;  1TQI A;  3NRV A;  3P7N A;  2P5L C;  3ZMT A;  3JRH A;  2LC2 A;  3PQK A;  1B9N A;  3WGH A;  4ABZ A;  1OQY A;  1J7K A;  3BJ6 A;  2K4J A;  1U5T A;  4ZYE A;  3I55 I;  2VT3 A;  2DK5 A;  4TV7 A;  4QWQ A;  1NK3 P;  4OIN F;  5ILS A;  5EEH A;  1SFK A;  4HF0 A;  2ZXI A;  4K2E A;  1U8R A;  1ENH A;  2OC6 A;  4NDL A;  4CCJ A;  2EV0 A;  4KYW A;  2VXZ A;  3E5Q A;  3DWL E;  2KQR A;  4IQ4 A;  4UUV A;  2QF7 A;  2Y0M A;  4A12 A;  2LFB A;  2FRH A;  1TNS A;  1QQI A;  5K7F A;  2R7Q A;  2OZ6 A;  3DPT A;  4ETS A;  1OR7 A;  2YSR A;  5FD6 A;  5J8C A;  4AD9 A;  3PNV A;  3ZQI A;  2BHY A;  2CYY A;  4AUX A;  2DFH A;  2G9W A;  1K4S A;  1IDY A;  2FML A;  3M3Y J;  5E1W A;  3QPL A;  1UJ8 A;  1PUF A;  2M87 A;  3FXK A;  3HPH A;  3K4K A;  2JSC A;  2BY3 A;  4IRI A;  3G6E I;  2HU9 A;  4M73 A;  3ZXS A;  3FXQ A;  2VC0 A;  2FD5 A;  3LMM A;  3K70 C;  2VKH A;  3CMY A;  2VOD A;  4KIC A;  3RPQ A;  3M1E A;  4KIF A;  3DBR B;  4CZZ A;  2RN7 A;  2ZJP F;  2Y31 A;  2OUM A;  1E17 A;  1Z3Y A;  2ECC A;  3ZN0 A;  1TL8 A;  1E3H A;  2JA8 J;  1V5G A;  4BJ5 C;  1QHG A;  2P81 A;  2ZCW A;  3H9J A;  4LB5 A;  1YOV B;  3F6V A;  4HSR A;  4L0Y B;  2G7U A;  2R3S A;  5HNF A;  3M4O J;  1FC3 A;  4MIM A;  4KN7 X;  3N4M A;  5J6X A;  5D8K B;  3FX3 A;  3KZY A;  4RB1 A;  4AIK A;  2B63 J;  2ECB A;  1V5E A;  1DQU A;  1O57 A;  4E6K G;  2BXZ A;  3GCM A;  4ASN A;  3Q9S A;  1ZR2 A;  1ZTR A;  4BXU A;  4N9H A;  3VOD A;  1XMX A;  3OL3 A;  2Z9O A;  2L0K A;  3G73 A;  4HV6 A;  1HW2 A;  1B72 B;  3BP8 A;  2CG4 A;  1YFH A;  2R7R A;  4RAZ A;  5HOD A;  4P5O A;  3WG7 H;  5L3D A;  3RKY A;  5D5U B;  1NG7 A;  1Z6T A;  4PJM A;  3G1O A;  4NQW A;  4AVZ A;  1YHQ I;  1YO5 C;  3S1Q J;  2KL4 A;  3ZMD A;  4ZDP A;  2DA7 A;  5LRR A;  2QLZ A;  3OYK A;  1R22 A;  4FE4 A;  2W00 A;  2QVO A;  2O61 A;  1LNW A;  2HYF A;  2IA2 A;  2YS9 A;  5EJC A;  3DKW A;  1ERD A;  2XAS A;  3BPV A;  2FXA A;  4MEY F;  1CF7 A;  2WWY A;  2ME6 A;  5ICC A;  1XS9 A;  1FTZ A;  1R58 A;  2WY7 Q;  1GXQ A;  2QQB A;  5JHU A;  2ACJ A;  2L7Z A;  3QPS A;  4V19 K;  4ZH4 F;  1ETO A;  3LA7 A;  4XN3 A;  4II3 A;  1D5Y A;  3W6K B;  2HEO A;  1FOW A;  2V9P A;  3R61 A;  3VFZ A;  2FNP A;  1ZRE A;  4BH9 A;  4UVA A;  4PJJ A;  4A3I J;  1TLH B;  2YPR A;  2IAI A;  2E7W A;  5HNH A;  4EJW A;  1BIB A;  3L2V A;  3OSG A;  1MSE C;  1PDN C;  3MKY B;  2HYJ A;  2L4M A;  1SVM A;  1ETW A;  2EZI A;  2D2W A;  3V7C A;  3V8K A;  1YTY A;  2FX0 A;  2CMP A;  2P5V A;  3MQ0 A;  3PFI A;  5FKO A;  1Z7L A;  1PVE A;  2K3F A;  2HOS A;  2Q8K A;  1I1S A;  2QUF A;  4PGH A;  2Z5U A;  2E1O A;  4Y3O A;  2DAO A;  2FJ1 A;  3S15 J;  1S6L A;  4MTD A;  4GCV A;  1B6A A;  2K7L A;  4L5J A;  3KYL A;  3ABU A;  4L5I A;  5B1B H;  2Z33 A;  1TP4 A;  3FXR A;  1V5F A;  5B5E C;  4WF2 A;  1OCT C;  4II2 A;  4C9Y A;  1LE8 B;  1XGO A;  3F0C A;  3DTE A;  1P9Q C;  4XRS A;  2GA2 A;  1TC3 C;  3FWE A;  3W3C A;  3FXJ A;  2GXG A;  3DEW A;  3MWM A;  4UV8 A;  2I5U A;  3AKZ A;  2IS1 A;  2XF6 A;  2VJ4 A;  4BQO A;  4G6T B;  1R49 A;  1IUF A;  3DPL C;  1H9T A;  2DU9 A;  5DYM A;  2IGN A;  1X3W B;  2KDZ A;  4HRI A;  3P9I A;  5EEG A;  4A6E A;  1Y1W J;  4WX9 A;  1AA7 A;  2Y75 A;  2DJN A;  3M8E A;  3SYT A;  5LGN A;  4QTR A;  2F6C A;  4C3J J;  1DU6 A;  2OTJ I;  3PSF A;  4G6D A;  3HSE A;  3ZQG A;  1FP1 D;  5C4J J;  1OPC A;  2R7D A;  2E2I J;  2E71 A;  1XG1 A;  2ELH A;  2K27 A;  4GYG A;  2FQ3 A;  3HZJ A;  2AS5 F;  3E0J B;  3BR0 A;  2O0Y A;  2QWW A;  1TBX A;  4EV0 A;  4GDF A;  2W7N A;  2M7B A;  1SD5 A;  3QPH A;  2XSJ C;  4OOI A;  4UUS A;  4BUP A;  2HPI A;  5K5O A;  1BN5 A;  2HS5 A;  1AHD P;  2E1C A;  4ON0 A;  2IGO A;  3ZOB A;  2E34 A;  1VQ6 I;  1BI1 A;  1WJB A;  5HDG A;  2DFF A;  3GTO J;  5D5V B;  3IC7 A;  2L01 A;  1MMA A;  1WWX A;  3E6C C;  4DGW B;  2GZW A;  4MFE A;  4LK1 F;  4XM3 A;  2K02 A;  3ESW B;  2EPF A;  4M3E A;  1BR4 A;  1F4K A;  4HV5 A;  1FWZ A;  1JI8 A;  1FIA A;  2QM3 A;  1LPQ A;  4UXN A;  2RDP A;  4CCO A;  1VF9 A;  1BJZ A;  1D0X A;  3DP7 A;  3WU0 A;  3L2Q A;  3T0Y A;  3HTS B;  3QAH A;  5GTI C;  1JT6 A;  5DCM B;  1ETQ A;  3HSR A;  1BR1 A;  4YII A;  1K61 A;  3QU6 A;  4KMU X;  4AVP A;  2MD5 A;  1KU7 A;  3FIW A;  3TED A;  3GW2 A;  3KX2 A;  1LDJ A;  4HW0 A;  5TIS C;  4L9J A;  1WPK A;  3QP6 A;  1WJ5 A;  4XN0 A;  1RR8 C;  2LKS A;  4ENK A;  1T8I A;  1ZYR F;  2IGK A;  2KJB A;  4XKV A;  1YX3 A;  2ISY A;  5J4Y A;  3Q5F A;  1JKQ C;  1FBS A;  5DS9 A;  3JR9 A;  4R8H A;  2EA4 A;  2W82 A;  2M1B A;  3HPG A;  4DQ2 A;  2DT7 B;  4EGY A;  3C2H A;  1K4T A;  2CGP A;  5CVR A;  3BZ6 A;  4EQQ A;  4IO9 F;  2LD5 A;  1ZAR A;  2P5K A;  2L9N A;  4LB6 B;  3BZK A;  1J5Y A;  1BL0 A;  1F36 A;  3H92 A;  3CC7 I;  2XB5 A;  4XKB A;  1JKO C;  1PP8 F;  4HNU A;  2W57 A;  1UZC A;  2EA2 A;  5FJ8 J;  3C2G A;  5C3E J;  2ZME C;  1A6I A;  3NQO A;  5GP9 A;  3HHG A;  3BTI A;  1GLN A;  4OIQ F;  2IGM A;  2QGU A;  3RPU A;  3BC8 A;  1NK2 P;  5E79 C;  2P7C B;  3KEO A;  4D5C A;  2VL8 A;  3JSO A;  2EQR A;  1JE8 A;  1IC8 A;  1X2N A;  4KT5 C;  2EZL A;  1APL C;  1ZRC A;  2GM4 A;  3CD6 I;  3AL0 C;  2A6H F;  3WHC A;  3KYD B;  3HB9 A;  5D5X B;  4ESB A;  1QVU A;  1S7A A;  2EFW A;  3WTT C;  2GIV A;  1OCZ H;  3AG2 H;  4ZTF A;  3J81 K;  1UHM A;  2VBX A;  3ZCO A;  3B6A A;  1YS7 A;  5E17 F;  2VBW A;  1XB4 A;  1YIT I;  2KIM A;  5AIQ A;  3MZH A;  2X6O A;  1HW5 A;  5LHG A;  3F9K A;  3CC4 I;  2ESH A;  3NAR A;  3KP7 A;  2CUZ A;  3BCB A;  2DXI A;  4O5V A;  4BQA A;  4OIP F;  1ZKG A;  3VOE A;  1MBF A;  3EQL F;  4RGX A;  3CCL I;  2HTS A;  2F5D A;  2H8W A;  4D5F A;  1BI0 A;  2VBY A;  4PJN A;  4OAZ A;  4DBQ A;  4F3Q A;  2O3F A;  2DOE A;  2R7U A;  4NC6 A;  1WJD A;  3OSF A;  3GEZ A;  5F64 A;  3TBI A;  2Q2E A;  3PUB A;  4XRS G;  1YI2 I;  2UZK A;  4FX4 A;  3NAU A;  4IZZ A;  4U0W A;  3GTK J;  2LY2 A;  1W36 D;  1QHH D;  4A0X A;  2YU9 J;  2A07 F;  3ASN H;  2ICW G;  5M3F J;  2J5O A;  2IT0 A;  3HOX J;  2DI3 A;  5B66 C;  3FHZ A;  2NOJ B;  3I53 A;  3OYJ A;  2V1U A;  1WJC A;  3EUK L;  3LOC A;  3GFM A;  4XL9 A;  1RI7 A;  3I71 A;  1RKW A;  4GO1 A;  2LR8 A;  1AOY A;  3HDD A;  2MLG A;  2LYC A;  2KT0 A;  4GXO A;  3GTG J;  1XCV A;  2ZSI B;  2JVH A;  1FX7 A;  4LIV A;  2R92 J;  3DF8 A;  4UB6 C;  2L7M P;  5E3L A;  2EIM H;  5J1Y A;  2VQC A;  5FKK A;  2LBF A;  4R1H A;  2ZJ2 A;  2MC4 A;  4ZTJ A;  2FA5 A;  1UHW A;  4RAF A;  1UFM A;  2PFB A;  5EZH A;  1ETY A;  2E35 A;  1BC8 C;  2XGD A;  1LE8 A;  1K78 A;  2CH0 A;  4CYC A;  1LUJ B;  3TMO A;  2JWT A;  4CCN A;  5F0C A;  2OQR A;  2JJ7 A;  4YEL A;  1H89 C;  4LJZ F;  3A0B C;  3LA2 A;  5FLX Z;  1Q1V A;  3JAM K;  1OIS A;  3BJO A;  3J7A O;  2ELK A;  2ESN A;  3I64 A;  3VYT B;  3H5N A;  2O8X A;  1KYZ A;  5GAH J;  3D5S C;  2CW8 A;  4KIT B;  2CV1 A;  3MZY A;  3GTQ J;  3EPZ A;  3W2A A;  4CGZ A;  3HJE A;  3S1R J;  1P4X A;  3DPU A;  2XAF A;  3JCU C;  1KU2 A;  1QGP A;  3R60 A;  4MNU A;  4M6V A;  4BE2 A;  1SVO A;  2ZFU A;  3PSI A;  3JRD A;  3S16 J;  1TQP A;  3KIO A;  2CW0 F;  1HW1 A;  2YX7 A;  4G6Q A;  1G59 A;  2H27 A;  4RGR A;  3CUQ C;  4ZDL A;  2XVC A;  4ZYA A;  1O3R A;  4PJL A;  1ZGA A;  3OV8 A;  2R5Z B;  4RGS A;  2VIX A;  3HOY J;  4PSX A;  4ZC3 A;  1ODD A;  1KQ0 A;  3KYC B;  1T2K A;  2OCC H;  3NWT A;  2UUZ A;  2VJ5 A;  4EEF G;  2R7W A;  4XQF A;  3ZRG A;  3MCZ A;  2XHK A;  2D1H A;  3U2R A;  2PMZ N;  2X4H A;  5EF6 A;  3F23 A;  4IJA A;  2H8R A;  3ZPL A;  1T0F C;  2J5P A;  4E70 A;  2FOK A;  2NYX A;  2ADU A;  2A61 A;  2JMW A;  1U0J A;  1FBQ A;  3OS1 A;  1GVJ A;  3A2K A;  1UB9 A;  3U1D A;  2X0L A;  4E7K A;  1SFE A;  4IEJ A;  1D1B A;  1F9N A;  4M3B A;  4UUT A;  2OJE D;  4PJ0 C;  5FD5 A;  3K70 D;  2A5W A;  2JVG A;  4QLC U;  4UNO A;  5DV5 A;  3BG6 A;  1R5G A;  2L7K A;  4BHP A;  3FMQ A;  4Q47 A;  3KPH A;  5IOY A;  4AID A;  1JTX A;  4XLH A;  1FEX A;  2ETH A;  2DLL A;  2ELJ A;  2XPW A;  5IYD J;  3HEF A;  2A05 A;  2ZBK A;  4BJT A;  3HOS A;  3L2R A;  1J9I A;  3HRU A;  2H6B A;  3E6B A;  2OA4 A;  4GFB A;  4RMN A;  3LWF A;  1R5I D;  2WB1 N;  4HDV A;  5E3N A;  4XLC A;  2GLO A;  1D0Y A;  4XR6 A;  2M7A A;  5M5W J;  1MIJ A;  3HKZ N;  1FBU A;  4A3L J;  4M9S A;  1OR7 C;  3CCS I;  1DGW Y;  2AQF A;  3HTU A;  4JOM A;  1KQ8 A;  4GYI A;  4F93 B;  2HKO A;  1OYW A;  2WAQ N;  1YJN I;  4OAY A;  3CDL A;  2W85 A;  3OYM A;  4XK4 A;  1OYY A;  2VAS A;  4PFP A;  4E7S A;  3S1N J;  2QBY B;  1S29 A;  3TDZ C;  2QKM B;  3KP6 A;  3HOV J;  2L3D A;  2NNY A;  4XLP F;  4Y15 A;  3J7A Y;  2NVT J;  4ZJZ A;  4A93 J;  3RZO J;  4BS9 A;  5FKL A;  3S2D J;  3ZP5 A;  3W6J B;  3VSL A;  1FP2 A;  3RJP A;  1OKR A;  1F5T A;  1ACI A;  5LLQ A;  2H1K A;  2IRF G;  1VQO I;  2P0W A;  1QVT A;  1IRG A;  1ITY A;  1HF0 A;  1B59 A;  3CCY A;  1BW6 A;  4M72 A;  3ZMZ A;  4BQQ A;  1PP7 U;  5FRN A;  5HVQ C;  3E1S A;  5E1X A;  2O7O A;  2A69 F;  3CLO A;  3RCO A;  5B1A H;  2VT2 A;  2WBM A;  4V2G A;  2P8T A;  2YR2 A;  5ERI A;  1TT5 B;  4JX5 A;  5BMZ A;  2HTJ A;  2V6E A;  4LIU A;  4XOT A;  4CO8 A;  2F4O B;  4EM0 B;  1AKH A;  3FXL A;  3K4N A;  2QCO A;  5IP6 A;  2HKX A;  1I6X A;  3JTH A;  1H9G A;  2Y2Z A;  4MQV A;  3GLX A;  5J4V A;  4FIS A;  4NBQ A;  2MGQ A;  5F1R A;  1D8K A;  5EGO A;  2L4A A;  3HGG A;  3GUD A;  3KLO A;  2NS0 A;  3CES A;  1AU7 A;  5E3O A;  3LNQ A;  2FQ4 A;  1HKQ A;  2QSF X;  4B09 A;  1IRZ A;  3C3W A;  3LSK A;  3SQN A;  4N4N B;  1POG A;  1G6N A;  1Y8R B;  2LNB A;  3CCM I;  2V6C A;  3IH2 A;  1QZE A;  3PFY A;  4L9N A;  1D5V A;  1ZAO A;  2CQQ A;  4PK4 A;  4BNC A;  3SZT A;  3HUG A;  4PUS A;  1KYW A;  3AG3 H;  1MJB A;  3CDI A;  5IYB J;  3E6D A;  4WWC A;  4MFD A;  2MFZ A;  1GT0 C;  4HF2 A;  1JJ8 C;  2IA1 A;  4A3B J;  4C2U A;  4BBR J;  2VBZ A;  1I3A A;  4AM3 A;  3LAJ A;  3HG9 A;  3CCQ I;  2UWM A;  1DGR M;  4Y52 J;  5IOZ A;  3E97 A;  1EJ9 A;  3HSF A;  1WHU A;  2DA6 A;  4C30 A;  5IY5 H;  4PGG A;  5EDN A;  2WTE A;  2HGC A;  3WGG A;  4IHV A;  2MC3 A;  4KT6 A;  5KNL A;  3MKW B;  1QPI A;  2K3P A;  2O8K A;  4XIC A;  3S8P A;  1YRN B;  2YUS A;  2XB0 X;  1IRF A;  1Y0N A;  2VON A;  1I6H J;  2RQP A;  3JTG A;  4QIW N;  2HVQ A;  4B4C A;  1T56 A;  4IRG A;  4M6X A;  1JKR C;  2L9V A;  1ON2 A;  2QEN A;  3HXL A;  3GWZ A;  2FNA A;  1V54 H;  1XX5 A;  3LL7 A;  3M8F A;  1YW8 A;  1MNM C;  1ETX A;  2BY0 A;  2LKX A;  3QOP A;  2XRO A;  3AG4 H;  3P9C A;  3MAJ A;  3ZMS A;  3IH4 A;  4P1W A;  1NTC A;  3RQI A;  2QQA A;  3U1K A;  1JJ6 C;  4ANJ A;  1DPR A;  2ZB9 A;  3K1N A;  2BVM A;  4L5E A;  3HL2 A;  3GLL A;  5DCF A;  3L7W A;  4DYQ A;  1H8A C;  3VYR B;  3LA3 A;  5CVI A;  1HSJ A;  3BT9 A;  5CYV A;  3LSH A;  4C3I J;  3JRB A;  3E7L A;  1FYL A;  2WC2 A;  3GTP J;  1EV7 A;  2BW3 A;  3IP4 B;  1MDM B;  2D5V A;  2LY9 A;  1IN5 A;  5BNG A;  4IHY A;  5GAG J;  6PAX A;  1JGS A;  4PCQ A;  2K4B A;  3CCU I;  2W4S A;  4M3F A;  5AON A;  3KLN A;  4ESF A;  3FHN A;  2M0M A;  4HYE A;  3OMY A;  2F5C A;  2DTR A;  2F5V A;  5F0F A;  1FMV A;  4EM2 A;  5HDN A;  2HDW A;  1OCP A;  2VQL A;  2IVM A;  2BE5 F;  3R0A A;  3W2W A;  5K7Z A;  1QBJ A;  3C2B A;  3K6G A;  2FBI A;  4I76 A;  4ZYD A;  5FKM A;  3OYN A;  1SEU A;  2DQL A;  4HEA 2;  2XIG A;  4BEH B;  5LD2 C;  2PMZ A;  4RLQ A;  3U21 A;  1WFX A;  2DA4 A;  5DUI A;  1JT0 A;  3K4C A;  1LB2 A;  2H1L A;  3K1P A;  4ZZD A;  3OIP A;  2DFE A;  3UR3 C;  3QRF F;  4XKW A;  1LQ1 A;  1YE9 A;  2CQK A;  2QEX I;  2NS7 A;  3KEQ A;  4LK0 F;  1T33 A;  4LMY A;  1OLT A;  4IL6 C;  4IOC F;  4OMZ A;  4FHT A;  5D8L B;  4NB5 A;  5HLI A;  2DA2 A;  4D1Q A;  1RIO H;  2ZSH B;  5HS7 A;  2BXY A;  3TW7 A;  1BJA A;  1LFP A;  2HOA A;  2ZFW A;  4XOP A;  3S93 A;  5LHH A;  2R7T A;  1Z91 A;  3CC2 I;  5FB2 A;  1HKT A;  2ID6 A;  1MMS A;  1UST A;  1WH5 A;  2E1M C;  3IKV A;  1RES A;  3TW6 A;  5LBQ A;  4Q4Z F;  2E5Z A;  1DPU A;  4G9Y A;  3R4K A;  3K69 A;  3F22 A;  1WQ2 A;  3LST A;  4N4O B;  3WGI A;  2WB1 A;  4FE7 A;  4HX4 A;  1S72 I;  3AG1 H;  2VC1 A;  3I59 B;  2E2J J;  3ERM A;  1X3Z B;  3TKY A;  2XGE A;  2IJL A;  3HHH A;  3OYE A;  3V7R A;  3HKZ A;  1YIJ I;  2CJJ A;  2BOL A;  2XSD C;  3D1N I;  1LEB A;  4Z2Y A;  4I2O A;  5J40 A;  1WJA A;  2COM A;  3H3Z A;  2GXA A;  1A6Q A;  4AIH A;  3WOD F;  5FLM J;  3J80 K;  2EFP A;  4A69 C;  2DN0 A;  2WAQ A;  2K86 A;  1MMD A;  3BPX A;  3C7J A;  3FM5 A;  2BZT A;  2EJR A;  2X6W A;  3I0T A;  5D6E A;  4M9X A;  3TP3 A;  3CMM A;  2P6T A;  3T1B A;  3K10 A;  1N25 A;  1VND A;  3FKI J;  1ZRD A;  3HOU J;  2E7X A;  1LVK A;  3ML6 A;  1ZR4 A;  4OU0 A;  1I50 J;  4U0V A;  1LDD A;  1O4X A;  1LJ9 A;  1QO0 D;  4Q48 A;  3MVP A;  1ZK8 A;  2NXN B;  2X85 A;  1J0R A;  2NS8 A;  2ZNZ A;  4JK1 X;  3LQR A;  4RDU A;  1R23 A;  3FDY A;  2ZME B;  1MMN A;  2QSG X;  3F72 A;  3FKJ A;  4DW6 A;  4LLL A;  4XON A;  3TO7 A;  1FYM A;  3I4P A;  1BM9 A;  2XF7 A;  2Z1D A;  3I3L A;  1IO2 A;  5IP9 J;  5JR3 A;  3RKW A;  1BOB A;  2KLO A;  2R4G A;  2LF7 A;  3PNT A;  4X6A J;  4UHT A;  3H3U A;  2W24 A;  4V2F A;  3T5X A;  3AL0 B;  2LKP A;  1OCR H;  3ZQF A;  1W5S A;  1FLI A;  3I4M J;  5F1J A;  3SJM A;  5LHI A;  2R0Q C;  3W2V A;  4F92 B;  1XD7 A;  3OY9 A;  2PJR A;  5LFA A;  1ZEL A;  5LEK A;  1IF1 A;  3I54 A;  3S3O A;  3S17 J;  3V4G A;  2I10 A;  4UV9 A;  3S2H J;  3S1M J;  1EA3 A;  4KIS A;  5ICE A;  3FMS A;  1SAN A;  2KFD A;  2DPU A;  3DU6 A;  1LFB A;  3HGY A;  3RKQ A;  3CQZ J;  4LIT A;  1P4A A;  4I02 A;  2DOA A;  3CTA A;  3ULQ B;  4KDP A;  5KAF C;  1G3W A;  3BTJ A;  4I01 A;  4IXA A;  1HA8 A;  3D5R C;  1T98 A;  2CU7 A;  4I0A A;  1UG0 A;  1IW7 F;  5K5Q A;  3SFZ A;  3DV8 A;  3BRO A;  4HNV A;  1R6R A;  3K2Z A;  2BVL A;  2Q1Z B;  2XRL A;  5A2Q K;  4ENM A;  2EIJ H;  4HST A;  2JA5 J;  1WCM J;  2PQ8 A;  3ZGK A;  4E7J A;  1YLF A;  1KON A;  2P6S A;  1J59 A;  3UNG C;  1B8I B;  3OYC A;  3QPT A;  4BAY A;  2NNN A;  5E1Z B;  1GV5 A;  1L3L A;  1GV2 A;  1RPW A;  1X3U A;  3LFU A;  2L9R A;  4RM3 A;  1FTT A;  4B3A A;  3R6S A;  2ZXH A;  2JA7 J;  2WAD A;  2X48 A;  2Y9Y A;  1RUN A;  2ISZ A;  2C6Y A;  2EK5 A;  2OF7 A;  3SFI A;  1IN6 A;  3FXM A;  3QOD A;  4M3D A;  3VB2 A;  4EAT A;  3CJN A;  4XLN F;  4RGU A;  3VWB A;  4A5M A;  3GTM J;  2XRN A;  3QWL A;  4CIC A;  2VJJ A;  5K1Y A;  3ZN1 A;  2OPT A;  4AYB N;  1Z3X A;  4J19 A;  2DA5 A;  2WV0 A;  3V7S A;  3P5J A;  4G12 A;  5J1U A;  1G8X A;  4G7Z F;  2VXD A;  3SEZ A;  4EJT A;  3H0G J;  1VZ0 A;  1B72 A;  2VPR A;  4HDU A;  4LG0 B;  1FYK A;  4AIJ A;  4P55 A;  4BEH A;  2R7Z J;  2UV1 A;  3GO5 A;  3H3V K;  1R71 A;  5JLX A;  1RR7 A;  3PL8 A;  1WI9 A;  3S2W A;  1IXR C;  3J81 Z;  1PJR A;  5D6F A;  2O9L A;  4E7H A;  3U9G A;  4HNT A;  5KAI C;  1G2H A;  1U9N A;  3ELK A;  2XF5 A;  3LSI A;  4LGW A;  3CUQ B;  1WJE A;  4XSX F;  4A3M J;  3X2Q H;  2ZKZ A;  3BJA A;  3DTK A;  1GUU A;  2JK3 A;  3C1D A;  3BG7 A;  1K79 A;  3PJR A;  1O3Q A;  5ICF A;  3MN2 A;  4BXX J;  4EVI A;  1MH4 A;  3FIS A;  1D0Z A;  2RGV A;  3A01 B;  2DMT A;  5E18 F;  2R7X A;  3DQV C;  2X9D A;  1EKE A;  3RIR A;  5C44 J;  1Z77 A;  1I3Q J;  4HAM A;  4FCY A;  3I9V 2;  3DLA A;  1MBH A;  5KK1 A;  3CUO A;  3M1C A;  4DNC A;  3I4N J;  2BBY A;  4Y33 A;  3DBH B;  1TW3 A;  1YX5 A;  4LD5 A;  1P92 A;  4YFX F;  2CUF A;  2BEO A;  3F8N A;  5J1R A;  3CP8 A;  2DMQ A;  3I59 A;  5FGM A;  3OR2 C;  5DDG A;  4IPA A;  3DU5 A;  2L54 A;  3OYH A;  3TOB A;  2M2E A;  4DYC A;  2K9M A;  1Z6R A;  5ILV A;  1IZ1 A;  2KIF A;  2KMU A;  1JUP A;  3WTW C;  3EYI A;  4DOZ A;  2CV2 A;  5EG0 B;  1C0W A;  1U5T B;  4A3G J;  1TNT A;  2Y69 H;  4DYR A;  2GIZ A;  3EET A;  3KFW X;  5DD8 A;  1W5T A;  3BTL A;  1TTY A;  3WG9 A;  3LFK A;  4E7I A;  2KRC A;  2W25 A;  5IYC J;  3DEU A;  1UCR A;  3HYI A;  3WTZ A;  4Y7N J;  4WXH A;  3IV5 A;  3L9F A;  4LLN A;  2Y30 A;  1E0E A;  1ZGJ A;  3F8M A;  2JZY A;  2W1O A;  1R1U A;  4LG3 A;  4WCG A;  3HOT A;  2R7F A;  4U88 A;  5DM6 F;  3QYF A;  3JRG A;  4BU2 A;  3GX4 X;  2DBB A;  1JTY A;  2GQQ A;  1XTA A;  1SMT A;  1K7A A;  5HOO A;  2XAJ A;  2PMH A;  3ZR8 X;  3HM5 A;  1X58 A;  5BPI A;  3LQQ A;  2Z3Y A;  3MFK A;  5J47 A;  3E3V A;  2Z99 A;  3JAM Z;  1MBK A;  2TRT A;  4XNF A;  5CKT A;  2L02 A;  2R93 J;  1K6Y A;  1PUF B;  2Z16 A;  1J75 A;  1X4P A;  2MLK A;  1X1C A;  2CQN A;  3JRI A;  2QYO A;  1UHS A;  3BCA A;  4WK8 F;  1HBX G;  3HBL A;  2M8E A;  4KA4 A;  1NG6 A;  4A5N A;  3L2C A;  4DZJ A;  2F4I A;  4H4K C;  1MH3 A;  3WU2 C;  2VLA A;  3KP4 A;  5F0H A;  3NWS A;  5IT3 A;  4IHW A;  2GA1 A;  1JHH A;  1F43 A;  2LRE A;  1D8J A;  5CPR B;  2JRT A;  1MBE A;  4XRF A;  4RB3 C;  2V9K A;  2VKD A;  1U8B A;  2F4M B;  3OOP A;  3F8F A;  3CO7 C;  4PDK A;  3GXO A;  4M6Y A;  3P9K A;  4HOB A;  2HOE A;  2HZD A;  3J7Z I;  5IT9 K;  5DCM A;  1D3Y A;  3L1P A;  3IRQ A;  4XMY A;  4CSW A;  3K4J A;  2DT6 A;  1HOM A;  4F55 A;  3H9Q A;  4C3H J;  2YX4 A;  3H5R A;  1U5T C;  4HA8 A;  2M30 A;  2DJI A;  1ZG1 A;  1G4D A;  2KIS A;  1U6G A;  3IAS 2;  1IGN A;  4JYK A;  1EF4 A;  3BR1 A;  2PJP A;  1WZ2 A;  1EH6 A;  1I5Z A;  2E60 A;  2Y0S N;  1SD6 A;  1SD4 A;  4MLO A;  3ECH A;  2K9Q A;  1HKS A;  2OZU A;  2JSP A;  1W4M A;  4W97 A;  4CXF A;  3HRS A;  1MW7 A;  1ONV A;  4I7H A;  4M9Z A;  3L2W A;  1LVA A;  2LH9 A;  5TRD A;  1XDS A;  4B44 A;  2B9S A;  1B8I A;  4A3C J;  1KZH A;  4KN4 X;  3TQN A;  1ON1 A;  3JRF A;  2H6C A;  1O3S A;  1CF7 B;  2LVS A;  1YS6 A;  4JBA A;  3OIO A;  2HXO A;  3RI4 A;  2DOD A;  4RB0 A;  4A3F J;  1ORK A;  4I99 C;  2STW A;  4U0Y A;  3RYP A;  3GZ6 A;  3JSP A;  3CCR I;  1VQ8 I;  1MBG A;  4RA2 A;  4I0B A;  1W7P D;  1GVD A;  3SZG A;  4OIO F;  2NVY J;  2AHQ A;  2LF8 A;  1FNN A;  2XUB A;  5TGT A;  4ENJ A;  2ID3 A;  5DD4 A;  5F04 A;  2HOT A;  3FK7 A;  1Y6I A;  3WU1 B;  4XKC A;  1SFX A;  2M9H A;  3CMA I;  3IUO A;  2M0C A;  5L3E A;  3G1L A;  3RDI A;  3SHF A;  2MBF A;  2TCT A;  5K5R A;  2ZJR F;  2HYG D;  1YW7 A;  4KMF A;  5DTD A;  4AC0 A;  2LY1 A;  1FOK A;  1JHF A;  4CHU A;  3Q3S A;  5CVU A;  4O3M A;  3MEX A;  3MD2 A;  2JQ7 A;  3PO3 J;  2LK2 A;  4ZDO A;  1Y39 A;  3CZ6 A;  1OMI A;  3TGN A;  1WH7 A;  5ED4 A;  3HRT A;  3GBG A;  3T8R A;  2VOP A;  5K7H A;  3KZI C;  3TOA A;  5HLG A;  3BQY A;  2JA2 A;  4BKX A;  4AYB A;  3CME I;  1SFO J;  1A5J A;  3E6M A;  1IUY A;  1NHA A;  1WSU A;  5GPA A;  4B48 A;  2RQQ A;  1E2X A;  3I58 A;  2FBH A;  2XAH A;  1HC8 A;  5IPA A;  4W1U A;  5M5X J;  3IAM 2;  1FIP A;  3WHB A;  5L3B A;  2DA1 A;  4HBL A;  1TZL A;  4I6Z A;  1MGT A;  1PYV A;  4YRV A;  1X2M A;  1FOX A;  4FT8 A;  4MTE A;  3RPU D;  4XID A;  2OBP A;  5LGT A;  1ULY A;  4XLE A;  4YFN F;  2DYS H;  2RKH A;  1VTN C;  3PUF A;  5JFR A;  2ZXJ A;  2CFO A;  1JUM A;  2FBK A;  1T6S A;  1ETV A;  3OWT A;  4H0E A;  2DCE A;  1G3S A;  5CLS A;  3LAP A;  2VN2 A;  5F6F A;  1N75 A;  1YW9 A;  5J3L A;  1U3E M;  2CO5 A;  3ZQQ A;  5M3M J;  3ERE D;  4CDG A;  4MO7 A;  2XC7 A;  2XGC A;  3BY6 A;  4RS8 A;  4CCK A;  2DDA A;  4UUS B;  1BC7 C;  2MG4 A;  5HS9 A;  2MSY A;  2NAZ A;  2HQR A;  3AFH A;  2ZNY A;  2IW5 A;  3HOZ J;  4KIG A;  5FFZ A;  2WAE A;  4KJZ A;  5FO5 A;  2WAF A;  3M8J A;  3VPR A;  4EGZ A;  5CJ9 A;  2EFO A;  1PUE E;  2CSO A;  2JUC A;  2R7S A;  1FOY A;  2LP0 A;  2EZH A;  5JHF A;  1MJ9 A;  3GFL A;  3RYR A;  1W7P B;  2K9N A;  3MZ8 A;  2HDD A;  2VJI A;  2GOM A;  5EG0 A;  3RZD J;  1DUX C;  2GXB A;  2H09 A;  1OFC X;  2E2H J;  1O3T A;  4OWR B;  1UAA A;  4BDY A;  4HX8 A;  3K2A A; 
#chains in the Genus database with same CATH homology
 3F9K A;  2DXI A;  1LKX A;  2CUZ A;  2R7O A;  1LVK A;  3BCB A;  3CP2 A;  4NNJ A;  4QPQ A;  3SEQ A;  4CCM A;  1MNE A;  3N05 A;  4B47 A;  4PJN A;  4OAZ A;  2X85 A;  2R7V A;  4DBQ A;  4F3Q A;  2KZV A;  4XLF A;  4F52 A;  2R7U A;  2E1M B;  1WJD A;  3FDY A;  1MMN A;  3TBI A;  3FKJ A;  3RTR A;  3PUB A;  4XON A;  3L2U A;  3OYF A;  2XF7 A;  2Z1D A;  3I3L A;  4IZZ A;  2XDV A;  2LY2 A;  1W36 D;  1QHH D;  1BOB A;  2KLO A;  3S32 A;  2R4G A;  3PNT A;  2LOO A;  3AL0 B;  4B3X A;  3K4M A;  2NOJ B;  3OYJ A;  5CQE A;  3H0D A;  2HVS A;  1WJC A;  2A6T A;  3EUK L;  3VSK A;  4XL9 A;  3W2V A;  4F92 B;  4JQF A;  3S3N A;  3OY9 A;  2L9S A;  4YEJ A;  2PJR A;  5LFA A;  1ZEL A;  2LYC A;  4XOR A;  2ZSI B;  2JVH A;  3S3O A;  3QYB A;  4LIV A;  1TT0 A;  4DIQ A;  2I8D A;  2V4J C;  3SDB A;  4XLA A;  1EA3 A;  4CZC A;  4IQJ A;  1Y56 A;  4KIS A;  2VQC A;  3CF2 A;  1MMG A;  2LBF A;  2MC4 A;  1QU3 A;  4U7B A;  4ZTJ A;  3DU6 A;  3ONQ A;  3MMY B;  4LIT A;  3QOE A;  2DOA A;  5KCM A;  5FRM A;  2CH0 A;  3HC7 A;  3VYU B;  1HA8 A;  2V1N A;  4FET A;  3D5R C;  1LDK B;  1W36 C;  3TMO A;  4CCN A;  1UG0 A;  4YEL A;  5HLT A;  5FRO A;  1R6R A;  2O5R A;  4NUB A;  2IS2 A;  4NC8 A;  2BVL A;  2CUJ A;  2Q1Z B;  1D1C A;  3VYT B;  4DBR A;  3VYS B;  3H5N A;  3PNY A;  4HST A;  3H9G A;  3D5S C;  2CW8 A;  2L5Q A;  4BAC A;  3ZGK A;  4KIT B;  4E7J A;  2CV1 A;  3EPZ A;  3BLY A;  3W2A A;  1KON A;  4RM2 A;  3DPU A;  4RLF A;  3UNG C;  4PSW A;  4Y4R A;  3OYC A;  2V7F A;  4BE2 A;  3OOU A;  2ZFU A;  3PSI A;  2M4K A;  1WJF A;  4AU7 A;  2M3A A;  2Y0S A;  3CJR B;  2Q2E B;  1G59 A;  2K9L A;  4BXF A;  2JUG A;  4ZDL A;  3LSM A;  4ZYA A;  3LFU A;  2VQG A;  4PJL A;  4RM3 A;  4J00 A;  2MD0 A;  2VIX A;  3EUA A;  2ZXH A;  3OYA A;  2WAD A;  4PSX A;  3D5L A;  4ZC3 A;  4E4H A;  1N78 A;  3NWT A;  2GOX B;  2UUZ A;  2VJ5 A;  2R7W A;  2X1C A;  3QOD A;  4EAT A;  4XQF A;  3ZRG A;  4R79 A;  3OR1 C;  3VWB A;  1D1A A;  2PJR B;  3VDX A;  4E7L A;  3EUH C;  3TL4 X;  2VJJ A;  1T0F C;  2XAU A;  2LC2 A;  3FBN B;  1U0J A;  1Z3X A;  3A2K A;  3OS1 A;  1G8X A;  2VXD A;  4E7K A;  3SEZ A;  1D1B A;  2LBF B;  1SFK A;  2ZXI A;  3K70 D;  2A5W A;  1VZ0 A;  2JVG A;  3BG6 A;  2OC6 A;  4CCJ A;  2L7K A;  4BEH A;  2UV1 A;  1T95 A;  1X1A A;  2VXZ A;  3DWL E;  2KQR A;  3PL8 A;  4IQ4 A;  4XLH A;  1PJR A;  4E7H A;  4IKF A;  2R7Q A;  3DPT A;  4IX7 A;  1IRX A;  4HNT A;  2ELJ A;  2XF5 A;  3LSI A;  1X1D A;  1WJE A;  3PNV A;  3HOS A;  4BJT A;  3L2R A;  3OS2 A;  3DTK A;  3DEE A;  4U87 A;  4BGD A;  4RMN A;  3MKZ A;  3BG7 A;  3PJR A;  3HPH A;  3K4K A;  3OIQ A;  4XLC A;  4F91 B;  2RNG A;  4FAS D;  1D0Y A;  4XR6 A;  2M7A A;  1D0Z A;  2HU9 A;  3ZXS A;  2R7X A;  4B43 A;  3DQV C;  3LMM A;  2FUG 2;  1OR7 C;  3K70 C;  2VKH A;  3CJQ B;  4CA0 A;  2AQE A;  1DGW Y;  2AQF A;  2X6X A;  2KPM A;  3I9V 2;  3DLA A;  3A4C A;  4JOM A;  1S9H A;  2OUM A;  3M1C A;  1Z3Y A;  4F93 B;  4OAY A;  1V5G A;  4Y33 A;  1QHG A;  4BJ5 C;  3OYM A;  3H9J A;  2VAS A;  4PFP A;  4E7S A;  4HSR A;  1YX5 A;  5HNF A;  2QKM B;  3CP8 A;  3J7A Y;  3OR2 C;  4ZJZ A;  2WY8 Q;  3DU5 A;  3OYH A;  1V5E A;  4BS9 A;  1DQU A;  4E6K G;  5KHD A;  2K5C A;  2K9M A;  2WA0 A;  2CS3 A;  3VSL A;  3OYI A;  2KMU A;  2CW7 A;  4DOZ A;  2CV2 A;  3OYG A;  1N77 A;  3OL3 A;  2P0W A;  3A1Y A;  5FRN A;  4BQQ A;  4E7I A;  3DKX A;  2KRC A;  3QYE A;  5HVQ C;  1X1B A;  3E1S A;  3LSG A;  2CV0 A;  3RCO A;  2R7R A;  2WBM A;  4P5O A;  4HG2 A;  1NG7 A;  4PJM A;  4AVZ A;  1E0E A;  2KL4 A;  4ZDP A;  2W1O A;  3OYK A;  2V6E A;  4LG3 A;  4LIU A;  4XOT A;  3HOT A;  3G2B A;  2W00 A;  3K4N A;  3K4B A;  3QYF A;  4BU2 A;  1ERD A;  5HOO A;  3ZR8 X;  2KDO A;  2WY7 Q;  3OYB A;  4XN3 A;  4XNF A;  1X4O A;  3CES A;  4II3 A;  5CKT A;  3FBI B;  3OYD A;  1K6Y A;  2X1E A;  4QPO A;  2KRH A;  2Z16 A;  4CUG A;  1X4P A;  4PJJ A;  1X1C A;  2LG4 A;  3BCA A;  3LSK A;  5HNH A;  1NG6 A;  3L2V A;  4N4N B;  2F4I A;  4H4K C;  3MKY B;  2VLA A;  3NWS A;  3PFY A;  2CMP A;  2LRE A;  1Z7L A;  3V42 A;  4PK4 A;  4NC7 A;  5CPR B;  4ITV A;  4Y3O A;  4PUS A;  2IXS A;  2V9K A;  2MFZ A;  2VKD A;  2Z2S B;  4BE1 A;  3KYL A;  4C2U A;  4CH7 A;  1V5F A;  4BJ6 C;  2HZD A;  3HG9 A;  2UWM A;  1DGR M;  4II2 A;  4C9Y A;  4C30 A;  3OL4 A;  4XMY A;  4CSW A;  3K4J A;  3DTE A;  1P9Q C;  2DT6 A;  4F55 A;  3H9Q A;  3W3C A;  2IS1 A;  3AKZ A;  4KT6 A;  5KNL A;  3MKW B;  3H5R A;  2M4G A;  2K3P A;  2MAB A;  2DJI A;  2XF6 A;  2VJ4 A;  3IAS 2;  3S8P A;  4BQO A;  4G6T B;  1UEL B;  3DPL C;  2E60 A;  4MLO A;  2IGN A;  4HRI A;  2KHM A;  2VPL A;  2HVQ A;  1AA7 A;  2JSP A;  3SYT A;  2F6C A;  2RRE A;  1MW7 A;  3PSF A;  3HXL A;  3K4L A;  3L2W A;  3H5A A;  2LH9 A;  3DKY A;  3LL7 A;  1Z21 A;  4B44 A;  4P1W A;  2IS4 A;  2VB6 A;  1MND A;  4ANJ A;  2HNH A;  3HL2 A;  3E0J B;  2BVM A;  2QKL B;  3VYR B;  4CCL A;  4DJA A;  2W7N A;  3LSH A;  2M7B A;  2XSJ C;  4BUP A;  2HPI A;  4GRI A;  2BW3 A;  3IP4 B;  3SZG A;  2IGO A;  3OYL A;  4E7Z A;  5TGT A;  2L2O A;  2W4S A;  1WJB A;  1Y6I A;  5CQG A;  4XKC A;  2X1D A;  3FHN A;  1MMA A;  2M0M A;  2X6Y A;  4DGW B;  2HQA A;  3IUO A;  3OMY A;  4XM3 A;  2F5V A;  1FMV A;  1BR4 A;  2HDW A;  3HUG B;  2VQL A;  3W2W A;  4C2T A;  2VQH A;  1JI8 A;  2LY1 A;  3K6G A;  4BQN A;  4CCO A;  1D0X A;  3L2Q A;  1J09 A;  3RQ4 A;  3OYN A;  4BE0 A;  3MD2 A;  4HEA 2;  4BL0 B;  4ZDO A;  3CZ6 A;  4BEH B;  1BR1 A;  2X51 A;  5LD2 C;  4BDZ A;  2PMZ A;  3GBG A;  4RLQ A;  3U21 A;  1WFX A;  3KX2 A;  2JA2 A;  4AYB A;  3K4C A;  3RSN A;  3OIP A;  3UR3 C;  4XN0 A;  1WJ5 A;  4XKW A;  1YE9 A;  4PFO A;  4B48 A;  2RQQ A;  4J01 A;  2IGK A;  4XKV A;  1YX3 A;  1OLT A;  2MYS A;  3IAM 2;  2LRD A;  1TZL A;  4YRV A;  1PYV A;  4D1Q A;  2ZSH B;  3RPU D;  2HPM A;  2W82 A;  3HPG A;  4XLE A;  2DT7 B;  4D9J A;  3C2H A;  3OS0 A;  2IS6 A;  1LFP A;  1DP3 A;  4XOP A;  3S93 A;  2R7T A;  2L9N A;  2CFO A;  3OWT A;  2DCE A;  4XKB A;  1N75 A;  4X0G A;  4HNU A;  2E1M C;  3ZQQ A;  2E5N A;  3C2G A;  2XC7 A;  1GLN A;  2E5Z A;  2IGM A;  4CCK A;  2KP6 A;  3BC8 A;  1X19 A;  2BW3 B;  3DTI A;  3AFH A;  4N4O B;  2VL8 A;  2WB1 A;  2WAE A;  4HPQ A;  4KJZ A;  3AL0 C;  3OYE A;  3HKZ A;  2V26 A;  3H35 A;  2WAF A;  3M8J A;  2BOL A;  1WJA A;  1FMW A;  2R7S A;  1SAU A;  5JHF A;  4ZTF A;  3S3M A;  2WAQ A;  2HVR A;  1MMD A;  3ZCO A;  2VJI A;  2GOM A;  2X6W A;  3CMM A;  3K10 A;  4OWR B;  3KEY A;  1UAA A;  4BDY A;  2OV7 A;  1BR2 A;  4NQW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...