3J7AO

Cryo-em structure of the plasmodium falciparum 80s ribosome bound to the anti-protozoan drug emetine, small subunit
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
79
structure length
79
Chain Sequence
YSYIPKQNKKLIYEYLFKEGVIVVEKDAKIPRHPHLNVPNLHIMMTLKSLKSRNYVEEKYNWKHQYFILNNEGIEYLRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S ribosomal RNA
publication title Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
pubmed doi rcsb
molecule tags Ribosome/inhibitor
total genus 19
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF03501 S10_plectin Plectin/S10 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3j7aO00
3P9KA 2HEOA 2XGXA 4KN7X 1BIBA 1BI3A 1HKQA 2DI3A 1J59A 2R7FA 4EGZA 2O3FA 1XSVA 1ZLJA 5ILSA 1I5ZA 1FT9A 2V1DA 3U9GA 1IW7F 1YS7A 4UNOA 1S3JA 4WXHA 2EFOA 3V4GA 3PQJA 4IHTA 3VFZA 4L0ZB 1ZH5A 1USSA 3BZ6A 4ZZDA 4XRFA 4BQAA 3GZ6A 1ZARA 3O6BB 1FP2A 2EFQA 3MWMA 3RPUA 1T0FA 3DPTA 1ZRFA 3G3ZA 2FEZA 2OZ6A 4OIPF 4A0XA 3L2CA 2RKHA 2FA5A 3T8RA 4P55A 2O0YA 1FLIA 4RB3C 1R7JA 4HF2A 2RNJA 4MGRA 4ENKA 3S2WA 4U0VA 5ICFA 5K5RA 4EM2A 3P9IA 2VE9A 4IJAA 2VOPA 1FZPB 4N9HA 2DBBA 1KQ9A 2LDUA 2P7VB 1CF7A 1YQAA 4Q47A 4O3MA 4FX0A 2FQ3A 4ZH4F 2AXLA 2KRFA 4M73A 3GO5A 4L18B 2K86A 3IC7A 5FFZA 2DAOA 2XIGA 3R6SA 3F6VA 2LSOA 1DUXC 1EH7A 2PN6A 2WV0A 2IPQX 1IN4A 2ZMEA 2O8XA 2HS5A 3F8MA 4PGGA 2UXNA 4R8HA 5DUIA 2K27A 1F5TA 4A5NA 2RN7A 1S7OA 2CSOA 1WKMA 2ISZA 2H94A 1W7PB 3BPVA 2NNYA 2VONA 4RB0A 1IZ1A 4OOIA 4AD9A 1ON2A 3K9TA 1Z05A 1D5VA 4G6QA 4YFXF 3CUQA 4RB2C 1GHCA 3SZPA 3WTXC 2CFXA 3IKTA 3IWFA 1YW7A 4HV5A 5L3GA 4EGYA 1U2WA 4P9UA 5HLGA 1QGPA 1KQ0A 2VT2A 1H0MA 3EYYA 4PZJA 1HBXG 5LEJA 3GUDA 2V9VA 2K4BA 3IRQA 5DCMB 4RB1A 1UCRA 3J81Z 2WWYA 3EDPA 2EA4A 2STWA 4MHGA 4U0YA 2FMYA 3T5XA 3V8KA 3R4KA 5BQTA 2OD5A 1IXRC 2Q8KA 4KIGA 3QP5A 2VXZA 1J2XA 2HOEA 4ZZLA 1B4AA 1ZRDA 2J5OA 4ENJA 2HYFA 2PQ8A 3LA2A 2W85A 3BPXA 5E1ZB 2GXGA 4LLNA 5F6FA 4OMZA 3LSTA 5K5QA 5LEKA 4YG2F 5JR3A 1IN8A 5HDGA 1F4KA 3FX3A 1IF1A 2VOOA 4LGWA 2P5LC 1IXCA 3KZZA 2LF8A 2CWEA 1B9MA 1BOAA 4UV8A 3DEUA 4PGHA 2QM3A 2D1VA 1T39A 1FYKA 1TQPA 1J7KA 3I71A 2JSCA 1IAWA 4BXUA 1W5TA 2COMA 4LG0A 1HXDA 1XDUA 5FLXZ 5A2QZ 1EH8A 1G3YA 3FWEA 5LGUA 4MNUA 2D1HA 1UHWA 5E8GA 2KIMA 4L9NA 3WTVC 5LHHA 3NEUA 4M74A 2ZBKA 4YIIA 3F6OA 2DFIA 1IRGA 4WCGA 4EJWA 4G7HF 3HYIA 1Z6TA 1P4AA 1U6GA 3NRVA 2P8TA 2ZCWA 3CDHA 1SMYF 4HX7A 2L3DA 2H6CA 5AIPA 4CXFA 4KMFA 4NHJA 2J5PA 2QQ9A 1YYVA 3KLOA 4UVAA 4CGZA 1MDMB 3HTSB 3WTZA 4XBFA 4D0PA 5D4SA 2IA0A 4CO8A 2NNNA 1IN6A 2V1UA 5DD4A 5KVRA 4UVBA 1OYYA 2ISYA 4ASNA 4KA4A 3KZYA 4R79A 2E1NA 3E6DA 4P9FA 3GYHX 3RI4A 3DXJF 2XV4S 3TO7A 1HSJA 3C1DA 4HW0A 2K7LA 3WTUC 3IWZA 5FO5A 1W5SA 2W25A 1OKRA 3LQQA 1J9IA 5L3CA 1SD4A 1JGSA 4I09A 2FOKA 3ZN0A 4CICA 2BV6A 3KP2A 2XASA 4G7OF 3DQVC 3G73A 2YPRA 2PI0A 2FBIA 2EFPA 3BOQA 3V7RA 2UXXA 3HSFA 3LQRA 1TNSA 1XCVA 1Z1DA 2VBYA 5K1YA 3MAJA 2FNPA 1XMKA 1MJBA 4HF0A 1RUOA 4KIBA 2MD5A 4HX4A 5HLIA 2DQLA 1XDSA 4EJUA 2NS0A 4ETSA 1O3TA 2FU4A 1K78B 3I5UA 1XGNA 1YO5C 3ABUA 2JPBA 3RYPA 3FXRA 3TDUC 1KU3A 5J8FA 1O57A 1FNNA 1IN7A 5LGTA 3BJAA 2ZNZA 4HBLA 3K0LA 2PMUA 3D0SA 5D4RA 4IRHA 1ULYA 4IVNA 1S8NA 4JBAA 1F9NA 3RTRA 3BJOA 2QQBA 3IKVA 3JTHA 1OYWA 1G4DA 5DD8A 3BJ6A 3HTUA 3WTYC 1R36A 1ZGJA 4Y13A 3KEQA 2A5YB 3I64A 2F5FA 1O7LA 3HIFA 5JVTA 4QLCU 1YS6A 1Q1HA 2XAGA 1W7PD 2EJRA 4F7ZA 2L4AA 2IP2A 1U78A 4I98B 3GX4X 3L09A 4HZFA 1B59A 5BPIA 1FX7A 3DPLC 2A07F 1P4WA 2XAFA 2RDPA 3JAMK 3I59B 3KE2A 2Q0OA 2YX4A 4Q4ZF 1HQCA 4AIKA 1I6XA 2ZKZA 4E70A 4HOBA 3E5UA 4HLXA 1FP1D 3ZMSA 2MH2A 5E17F 1R58A 2HKOA 3FXUA 5E20A 4UXNA 3W6JB 5IT9Z 5FD5A 5LGNA 4KN4X 3T1BA 3MEXA 1K7AA 4OIQF 3K1NA 4Y15A 2Z9OA 5D5VB 4AWXB 4HA8A 1UB9A 2XKPA 3J7AO 3TQNA 2RC4A 2Z33A 2DW4A 1QNTA 2XVCA 4JK1X 2BBYA 2F2EA 5ED4A 5FD6A 3HHGA 2H6BA 5KK1A 5FFXA 1HW1A 1SFXA 2K02A 2QBYB 5CVVA 3F23A 5CVIA 3WTWC 3R0AA 4NB5A 4EM0B 2A6HF 2GA1A 2ZNYA 5LLQA 3F8FA 2RVCA 2G9WA 1BJAA 1BI0A 5LHGA 4O6JA 4UVCA 4OU0A 3J81K 3O3KA 4IXAA 4P5OA 2Z5UA 1TW3A 4FHTA 1DPRA 4EJOA 4K2EA 2ZJ2A 1XB4A 3ELKA 4LD5A 2QWWA 3FXQA 3GLXA 3HSEA 2E7WA 2EFNA 2M1BA 2HWVA 3W6KB 1FC3A 3J80K 4IRGA 2ZXJA 5CVJA 5E8IA 4UUVA 4OIRF 1DP7P 1QQIA 3C7JA 1TQMA 2O6GE 2MH9A 1ZN2A 2Q2EA 4KIFA 1MGTA 2C6YA 1MKMA 2GIVA 4EM1A 4H0EA 1YW9A 3AAFA 1XGMA 2P5VA 2RV8A 4DNCA 2HTJA 3V8LA 2AS5F 2B0LA 2P4WA 2DPDA 2OU2A 5DEQA 1YG2A 3PQKA 2FSWA 1REPC 5DCMA 2HQRA 3KP5A 1SD5A 3ZMTA 2HDCA 2HZTA 5EEHA 3CJNA 4HDUA 1IUYA 3KCCA 5HS9A 4NQWA 4EVIA 5FLXK 2FMLA 5TRDA 3FHZA 3GFIA 5H6RA 5D5XB 1P92A 3V7CA 4ESBA 2W24A 3QPTA 3RJPA 2BGCA 3HHHA 2OAZA 3KP4A 2XKOA 5BPDA 3WTSC 5CJ9A 3L00A 3RIRA 5E18F 4ZYDA 3GFLA 5HOOA 4Y17A 1CF7B 4HQMA 4L0YB 2ESHA 1T98A 3GW2A 3TO9A 4FX4A 3I53A 3WTTC 1Z9CA 4AVPA 4WWCA 4G94A 2ESNA 3QRFF 2ZMEB 3KP7A 5FB2A 3CO7C 2MBFA 1CGPA 1O3SA 4MQVA 1RI7A 3M1EA 4EV0A 2E1CA 2VBXA 4KYWA 3R61A 4M9XA 3WODF 2V6CA 4BHPA 2XAHA 1L3LA 1DPUA 2VE8A 4KNYA 2GWRA 2RGVA 5EEGA 1SD7A 5AIQA 1R1VA 1G3SA 1ZRCA 2ADUA 4EJTA 4YFNF 4WXCA 5LRSA 4ZYGA 1ZREA 3LA3A 3U2RA 1FSEA 2KJBA 3FZVA 4M72A 5ERIA 3OV8A 4A2UA 4IHSA 1XD7A 1D8JA 2KKOA 4CYDA 1TBXA 1BC8C 3QOPA 3RKXA 1GXQA 3FMRA 5L3DA 1ODDA 2KIUA 4I0BA 1TNTA 1K6OA 1PP8F 1NHAA 3CTAA 1WRJA 3PFIA 1FPQA 3VEPA 1ONVA 4B09A 2PJPA 3T0YA 4MTEA 3DFGA 4KFCA 2DLLA 2A61A 2EV6A 4KT5C 4LMYA 3I58A 3DKWA 3E6BA 3JSOA 4UV9A 3HRUA 4U88A 2PFBA 4QWQA 3MZYA 3H92A 4I7HA 3V7SA 1L0OC 2M87A 2LF7A 3BWGA 2ZO4A 5L3FA 4A6EA 2HGCA 2P6SA 4LB6B 2F5CA 2UZKA 3WE2A 3F21A 3FF5A 4LK0F 3TO6A 2QQAA 1YLFA 3WU0A 3ZPLA 1U5TA 5JFRA 5JI6A 5H6QA 2FE3A 4G6DA 4S05A 2Y75A 4A0ZA 2DK8A 3H3UA 3B02A 1AOYA 1YTYA 4HV6A 3BY6A 4HX8A 1KYZA 3SXYA 2XUBA 2RQPA 4LK1F 2CO5A 3IRRA 3JW4A 2Y0MA 3ML6A 5E1XA 3IHUA 3DF8A 2HR3A 3HOTA 4LG0B 5CYVA 2QZ8A 1HKSA 2IA2A 1R23A 5DYMA 2H27A 3WGIA 4BHBA 3HSRA 4XLNF 1X3UA 3L9FA 4A5MA 1JHFA 4TV7A 3REOA 5D8KB 1QZYA 4GXOA 4HLYA 1I27A 2XAQA 3WG9A 4U7BA 5TJJA 5L3EA 3FM5A 2FBHA 3TDZC 4L5JA 1YIOA 4LJZF 5D8LB 1MZBA 3K1PA 5ICCA 1BM9A 2VODA 3O2PE 5CVRA 2UWMA 1FOKA 4G8XA 2ELHA 3RKYA 1QO0D 2YX7A 2DPUA 2FF4A 4JQFA 2PBIA 2EFWA 1XSDA 3I59A 2JTVA 5F64A 2P6TA 2PMHA 1OYIA 5DCFA 5BMZA 4WXDA 2MLGA 1OMIA 2F5EA 3EETA 5ILVA 4ESJA 2Z99A 4LFUA 3TOAA 2HYGD 5IT3A 1XN7A 4XSZF 1ZLKA 5HVQC 1TLHB 3KEOA 2HTSA 4EQQA 5HDKA 2QENA 2VC0A 4WX9A 2WTEA 2JZYA 2QUFA 3ABTA 3NQOA 4L9JA 2VBWA 3E3VA 5CVUA 4G9YA 3E5XA 2EV5A 3B73A 1ZAOA 1O3QA 3K2ZA 5L3BA 3R60A 4RGSA 2FRHA 1PUEE 1WSUA 1JHHA 3GXOA 1ZG5A 2MLKA 4HYEA 5BS6A 1LJ9A 2GZWA 2CYYA 1QPMA 2MA3A 3RKWA 3QU3A 1LEBA 3N97A 4S04A 4M9SA 2XAJA 2A69F 4CHUA 3MZHA 3KP6A 1V4RA 3CO6C 2IW5A 4BH9A 1J0RA 3I4PA 2VBZA 2OA4A 3GFMA 4RAYA 5HS7A 4O5VA 2IJLA 3GVAA 2JPCA 1B1BA 3VB2A 3EQLF 2OQRA 3CUOA 1R1TA 2GA2A 3ZMDA 3VOEA 3CUQC 4PCQA 4HDVA 2L02A 2FXAA 3KETA 3ZMVA 2ETHA 2V79A 3TGNA 4XLPF 4OIOF 1G6NA 2G7UA 4N9IA 1F1ZA 2IVMA 4KDPA 3WU1B 1W4MA 4OINF 1GXPA 4L9TA 4FT8A 4EJVA 2BYVE 4MQ9F 2DTRA 1Z7UA 4YIFA 2EWNA 2OBPA 2Y48A 3P7NA 2IRFG 3JTGA 5F1RA 3MFKA 2ZFWA 5LBQA 2F5DA 5CLSA 2M5WA 2NRAC 4WF2A 3WGHA 2LNBA 5AONA 2VC1A 4ZYEA 1W7PA 3JSPA 2A68F 4DQ2A 1HKTA 2DQRA 1BI1A 2QVOA 3WE3A 1IN5A 4HAMA 4M6XA 2L54A 4L5IA 3I54A 5DV5A 3F22A 1PP7U 3HRSA 3HRTA 2V1XA 3R0JA 4GO1A 1LVAA 2A6EF 1YFHA 2D45A 1Z6RA 3HRMA 2R7DA 4AIJA 3MQ0A 1KYWA 1PDNC 2IT0A 4GCVA 1RUNA 4RGUA 2O03A 3ULQB 2PG4A 2HQNA 2G7HA 1Y0UA 3JAMZ 1T2KA 2H09A 1SD6A 2OZUA 1G3WA 1E17A 1R5GA 1SFEA 5D6EA 1BC7C 1R1UA 3Q9SA 1HW5A 5D5UB 1LDJA 2GQQA 4HQEA 4IPAA 5A2QK 1XGOA 1RZ4A 3LA7A 1R00A 2HKXA 1XGSA 3DV8A 3F8NA 5ICGA 4I01A 2IA1A 1ZG3A 5FGMA 2GXBA 3L7WA 1WWXA 4N0BA 1JXSA 3M7GA 2VT3A 2YSRA 1U5TC 3GFJA 2QYOA 1KU2A 4MEYF 4RGXA 3LAJA 1S7AA 2KJCA 5LHIA 1FYLA 1DDNA 1KGSA 1FBUA 2E7XA 1ZG1A 2JT1A 4I02A 3RPQA 2P7CB 3TKYA 3EYIA 3ZMZA 5BOXA 1P4XA 2CW0F 3RYRA 1O3RA 1D3YA 3M8EA 1MD0A 4ESFA 4G7ZF 1P6RA 4XSXF 1SMTA 1R5HA 1FBQA 1XSXA 1A04A 1D8KA 1O7FA 3COAC 1MJAA 5J8CA 1ZGAA 2HFHA 2CG4A 3EUHA 3ROUA 2FNAA 2W84A 3SZTA 3RDIA 1FWZA 2STTA 2YR2A 5HS8A 1LDDA 1TW2A 5D5WB 4BAYA 3CLOA 1S29A 2D2WA 1KU9A 2BEOA 1QBJA 3I0TA 3ZMUA 1BN5A 3KLNA 3BDDA 3J80Z 3ERED 3FMSA 1G3TA 4LLGF 2PEXA 3CUQB 2Z3YA 3F8BA 1KQ8A 3ECOA 1RNLA 3LWFA 1WQ2A 3SHFA 1KU7A 1J5YA 4ON0A 1MDMA 1FYMA 1ZHFA 4BYYA 4EMSA 3QAHA 3C18A 5D6FA 4KMUX 5HDNA 1U8RA 1BIAA 2LKPA 3IL2A 4IF4A 4LLLA 1UHMA 4Z2YA 3GWZA 4GGGA 3T8TA 1VTNC 3ECHA 3E5QA 1S6LA 5ICEA 2P5KA 1LNWA 2A3SA 2R3SA 3ISPA 4GYGA 4A0YA 4A12A 4M71A 3P9CA 1H9GA 1STZA 1OR7A 1EH6A 4ENMA 4RS8A 1WI9A 3E6CC 2VN2A 1SAXA 1SFUA 4Q5SF 4KUMA 3N4MA 5E1WA 2XROA 2NAZA 3TOBA 4CDGA 1LEAA 4WK8F 4BNCA 3HOSA 3HUGA 3KP3A 2EK5A 4KICA 6PAXA 1T38A 1B6AA 3F3XA 3MCZA 4YFKF 4HF1A 1K78A 1OPCA 2DT5A 4U0WA 1FY7A 1R22A 1ON1A 1J75A 4U7DA 4A6DA 2KIFA 3WGGA 1P2FA 1BI2A 3M9AA 3F8CA 3E6MA 5IT9K 1LDKB 3GZ5A 2XRNA 3LAPA 2M8EA 4BHCA 1U3EM 2NYXA 4RAZA 2XHKA 1E2XA 3ZP5A 1FBSA 4LB5A 2DU9A 3SFZA 2TDXA 4L9VA 2PLYA 1ZYRF 1HW2A 1C0WA 3FM3A 3KFWX 2DK5A 2ACJA 4I0AA 3VODA 4B8XA 1U5TB 3QPHA 2K4JA 1USTA 2YU3A 5DDGA 2EB7A 3GEZA 1I1SA 4ENNA 1IXSB 1MJ9A 2BE5F 4CZZA 3Q9VA 4GYIA 3E97A 2EV0A 3LFKA 1JE8A 1I1GA 2QLZA 2X0LA 3Q5FA 3U1DA 2L4MA 4I2OA 1IRFA 1BBYA 4PDKA 4OMYA 3DP7A 3C3WA 5J6XA 4UHTA 5DUKA 3QP6A 2CQKA 1XCBA 4M9ZA 3ZQ7A 1T6SA 4M6YA 5JHUA 2M45A 5LRRA 4MTDA 3BP8A 1Z91A 1V3FA 4ZYHA 2X4HA 1GVJA 4R1HA 2M30A 1UFMA 2L01A 1RIOH 1AWCA 2W57A 1KA8A 1LQ1A 2CGPA 4Q48A 4MEXF 3FMQA 3OOPA 1B9NA 4P96A 2WC2A 4IRIA 3D5LA 1K79A 2QBYA 4AIHA 1XMAA 5ILUA 3K1MA 1EV7A 1HSTA 3H3ZA 1QZZA 3V8JA 2MC3A 3GF2A 5K5OA 2OQGA 2GAUA 2JRTA 1LB2A 2EA2A 2DO7A 3ZN1A 3F72A 3QU6A 3SQNA 5H20A 2O61A 1TQIA 3K69A 3BROA 1H9TA 5HLHA 1FSHA 1TTYA 2FBKA 3M8FA 4RGRA 1YW8A
chains in the Genus database with same CATH superfamily
3P9KA 4BBSJ 2HEOA 1X1CA 2M8GX 2XGXA 2QGUA 2LKXA 4KN7X 1BIBA 1BI3A 4DYCA 5FKNA 1HKQA 3KYDB 1WHUA 1YE9A 5EZGA 2DI3A 1Y8RB 3TW6A 4H4KC 1SEUA 1B72A 3OYAA 1J59A 2R7FA 3GTOJ 2MABA 4EGZA 2O3FA 1XSVA 2DTZA 2E35A 1ZLJA 5ILSA 1I5ZA 2KMUA 1UELB 1FT9A 1T08B 4ANJA 4PJMA 1FJLA 2KL4A 2DXIA 2V1DA 2I8DA 3U9GA 1IW7F 1YS7A 1IDZA 5KAIC 3AG1H 4UNOA 5FLVA 1LVKA 1S3JA 2ECBA 1LFBA 2HQAA 2K85A 2EFOA 3BR6A 4WXHA 3S1NJ 2XRLA 3OL3A 3V4GA 2L9VA 1UAAA 3KYLA 4FETA 1ZKGA 3PQJA 4IHTA 3RQ4A 3VFZA 2CW7A 2KISA 1USSA 4L0ZB 1ZH5A 3CP2A 2ELKA 4C30A 3BZ6A 2V9KA 1LFUP 2RREA 3PIOF 3S3NA 4ZZDA 4XRFA 1VQPI 1RR7A 4BQAA 3GZ6A 1ZARA 3O6BB 1FP2A 1GUUA 2EFQA 3MWMA 3RPUA 1Y1WJ 4D1QA 4E7HA 2ELJA 1T0FA 4Y33A 3DPTA 3EUHC 4DIQA 1ZRFA 2L0KA 3G3ZA 1ETQA 4N4NB 2IS2A 4FQGA 1E3OC 2FEZA 2JRMA 2OZ6A 4OIPF 1P7IA 4A0XA 2X1EA 3L2CA 2RKHA 2FA5A 3JRAA 3CCLI 4II2A 2CFOA 3T8RA 4P55A 3H35A 3JR9A 2O0YA 3IUOA 1FLIA 4RB3C 5M5XJ 2NVTJ 2YS9A 1R7JA 4HF2A 2RNJA 4MGRA 3L2QA 4XRSA 3RZDJ 2H1KA 4RAGA 3TBIA 3TL4X 5IYCJ 1YRNA 4ENKA 3S2WA 1JKQC 4U0VA 5JHFA 3OSFA 5C4XJ 5ICFA 2HPMA 5K5RA 2E2JJ 4EM2A 2BXZA 3P9IA 1R6RA 2VE9A 4IJAA 2M0MA 3TP0A 4QPOA 2VOPA 2HVQA 1FZPB 4N9HA 3A1YA 4PSWA 2DBBA 1KQ9A 2LDUA 2P7VB 1CF7A 4RA2A 1YQAA 4XKWA 1JGGA 1OCOH 4Q47A 5B3SH 4O3MA 3FXOA 1V5GA 2DYRH 2FQ3A 4FX0A 2LYCA 3LSKA 4ZH4F 2AXLA 2KRFA 4M73A 1G2HA 1WJBA 2NS8A 3GO5A 4DBRA 1W0UA 2K86A 3IC7A 5FFZA 4L18B 5H2FC 2DAOA 2XIGA 3R6SA 3VYUB 3F6VA 2OUMA 2LSOA 1DUXC 1FMWA 3EUAA 4CYCA 1EH7A 2ZXHA 1Y1VJ 2PN6A 4M3BA 2WV0A 4QPQA 4S0HB 2IPQX 1IN4A 2MC4A 2OF7A 2BW3A 2ZMEA 2O8XA 3UNGC 2Y9ZA 3OYFA 1R49A 2E36A 3S14J 2Y9YA 3S1RJ 2HS5A 3LOCA 3A0BC 1DU0A 3MZ8A 2Y31A 3BLYA 4HEA2 3F8MA 2WADA 4PGGA 2UXNA 4R8HA 5DUIA 2K27A 1F5TA 2XB5A 2RN7A 2BVLA 4A5NA 1S7OA 4UY8I 3KZIC 3LSHA 3CF2A 2CSOA 1WKMA 2KDOA 2ISZA 1N78A 1OR7C 3F0CA 3BCAA 2H94A 2IGMA 5EYRA 3CMMA 1W7PB 3BPVA 2NNYA 2VONA 4RB0A 1R5ID 4BJ5C 1IZ1A 4OOIA 4AD9A 2DYSH 3CC2I 3S1QJ 2VB6A 4ZC3A 1LE8B 1ON2A 1G8XA 2Q2EB 3K9TA 2CUFA 1V55H 1Z05A 1XS9A 1D5VA 1W1WE 2BZTA 4G6QA 4YFXF 4FISA 3CUQA 2LY2A 5E3LA 5EGOB 4B3XA 3SZPA 4RB2C 3WTXC 4M3DA 1JT0A 1GHCA 2CFXA 2X1DA 4IEJA 2JVGA 1IG7A 2M0CA 3IKTA 3IWFA 3EPZA 1YW7A 4HV5A 4PFPA 3UR3C 5L3GA 1U2WA 4P9UA 5HLGA 4EGYA 1QGPA 1KQ0A 4XRMA 1X19A 2VT2A 5EDNA 3S2HJ 1H0MA 2F4IA 3EYYA 4PZJA 1VQ5I 1HBXG 4E7SA 5LEJA 5CQEA 3GUDA 2OV7A 2V9VA 2K4BA 3IRQA 4ZTJA 5DCMB 2L2OA 1MMDA 4RB1A 3I4MJ 4Y52J 1UCRA 3J81Z 3PFYA 2WWYA 3EDPA 2EA4A 2EZKA 3JRHA 1VI0A 2STWA 1EKEA 4XNFA 4MHGA 2XSDC 1W5CC 4U0YA 2TRTA 4NQWB 2FMYA 3T5XA 1ZELA 3V8KA 1HOMA 3R4KA 5BQTA 1S7EA 2OD5A 1IXRC 2X6WA 5J40A 2KDZA 3K4MA 3M8JA 3PIPF 2Q8KA 4KIGA 3TEDA 4BQQA 3QP5A 2VXZA 1ETVA 3LAJA 1J2XA 1X1BA 2HOEA 4ZZLA 2NOJB 3OYJA 1B4AA 1JUPA 1ZRDA 2J5OA 3HOZJ 4ENJA 2HYFA 4BBRJ 4ZDLA 1X1PA 2PQ8A 3LA2A 3PUBA 5KAFC 2VPRA 2W85A 2E19A 3BPXA 3CLQA 5E1ZB 2JA7J 2GXGA 4LLNA 5F6FA 2R7VA 4OMZA 3LMMA 3BG3A 3LSTA 5K5QA 2FOWA 4D5CA 5LEKA 1MBEA 4YG2F 4RDUA 5JR3A 2DA1A 3FK7A 2DMTA 1IGNA 1IN8A 2L7KA 5HDGA 1F4KA 2QSHX 3FXKA 3FX3A 1IF1A 2VOOA 4LGWA 2P5LC 1IXCA 3CCRI 1TP4A 3KZZA 3AL0C 2LF8A 4XOTA 4AU7A 3HB9A 1RR8C 1ETOA 2CWEA 1B9MA 3GZNB 4E7JA 3KX2A 4U87A 1D1AA 1FEXA 1BOAA 1UJ8A 1WJAA 4UV8A 3DEUA 4PGHA 3HGYA 1MH3A 2QM3A 2D1VA 2NOGA 1T39A 1FYKA 3PUFA 1TQPA 1J7KA 4XLEA 3I71A 3ESWB 2JSCA 1IAWA 1I39A 4BXUA 1W5TA 2COMA 3GMEA 2DA3A 3MD2A 1HXDA 1XDUA 4LG0A 5FLXZ 2VL8A 5A2QZ 5J4VA 1MNDA 1EH8A 3H5RA 1G3YA 3FWEA 3NARA 5LGUA 3BG9A 4MNUA 3G2BA 3BT9A 1XPXA 2D1HA 3HGGA 1QRYA 2EPFA 1UHWA 5E8GA 1P9QC 1JTYA 2PJRB 2KIMA 4L9NA 3WTVC 5LHHA 3NEUA 4M74A 4Z6YA 2ZBKA 4YIIA 5B1BH 1ETWA 4V2FA 4IZZA 3F6OA 1UZCA 4M3FA 3HM5A 2DFIA 3HJEA 1IRGA 2W82A 4B43A 3VWBA 1RESA 4WCGA 4EJWA 4G7HF 3HYIA 1GLNA 1Z6TA 2XC7A 1H89C 2CV2A 1P4AA 1U6GA 3NRVA 5B5EC 2R7RA 2P8TA 2ZCWA 3CDHA 1SMYF 4HX7A 2L3DA 2H6CA 5AIPA 4CXFA 5C44J 4XICA 1YJ9I 4KMFA 4NHJA 2J5PA 1ZGWA 3W2WA 2JA6J 2QQ9A 2X6XA 1RPWA 1YYVA 2MFZA 3KLOA 4UVAA 2Y69H 4CGZA 2JUCA 1MDMB 3HTSB 3KPHA 3WTZA 4XBFA 2W48A 4B3AA 5IOYA 5IP6A 3K4BA 4D0PA 5D4SA 2IA0A 4L5EA 4CO8A 1OCZH 2NNNA 1IN6A 1VNDA 2V1UA 4A3MJ 5DD4A 2L9SA 5KVRA 4M3EA 4UVBA 3Q3SA 1NTCA 1OYYA 2ISYA 4ASNA 3G71I 5JVGF 3PNVA 4KA4A 2LG4A 4IQ4A 4E4HA 1VQ7I 3KZYA 3I9V2 3K4NA 4AYBN 3IAM2 1MNEA 1XC5A 4R79A 4IHXA 4A3CJ 2KP6A 4UUSA 2E1NA 1TWFJ 2JA8J 1XX5A 3E6DA 1WCMJ 3PJRA 4P9FA 3GYHX 3TO7A 3DXJF 2XV4S 5F0FA 3ZOBA 1HSJA 3RI4A 1FIAA 2KQRA 3C1DA 4BUPA 4HW0A 2K7LA 3WTUC 2R5ZA 1R9TJ 1UHSA 3IWZA 1E0EA 3BC8A 3G1LA 5FO5A 1TL8A 1W5SA 2W25A 3Q0UA 4IHVA 3QWLA 4FE7A 1OKRA 3LQQA 1J9IA 5L3CA 1SD4A 1JGSA 4I09A 3M07A 2R7UA 2AQFA 2FOKA 2K5CA 3L2VA 1J09A 4IQJA 5IYBJ 2W1OA 3ZN0A 2VLAA 3IH4A 4CICA 4XN0A 2BV6A 1V5EA 1SAUA 3KP2A 4PJNA 2D5VA 2XASA 4G7OF 3DQVC 3G73A 2YPRA 1B8IA 3RQIA 4RLQA 4D5FA 2B9SA 2PI0A 2NVXJ 2FBIA 2EFPA 1RKWA 3BOQA 3LFUA 3V7RA 2UXXA 3HSFA 5TISC 5M5YJ 3DTIA 3LQRA 1TNSA 1XCVA 1Z1DA 2VBYA 5K1YA 3MAJA 1MMNA 2VKEA 2FNPA 1XMKA 2L7ZA 3BG5A 3CCSI 1MJBA 2O7OA 4HF0A 1RUOA 1X4PA 3HUGB 4KIBA 1T0FC 2MD5A 2ZB9A 1WJ5A 4HX4A 5HLIA 2DQLA 1XDSA 4EJUA 2NS0A 4ETSA 1O3TA 2FU4A 3CESA 4Y7NJ 1K78B 3I5UA 1XGNA 1YO5C 3ABUA 1NG7A 2JPBA 3RYPA 3FXRA 3N05A 2M4GA 3VYTB 2H8WA 1NK2P 2HNHA 3OIQA 3QPSA 3TDUC 1KU3A 2DA5A 5J8FA 2HQ5A 3QYFA 4I76A 1O57A 1FNNA 1IN7A 4XL9A 5LGTA 3VYSB 1ENHA 3BJAA 2ZNZA 4HBLA 2G0EA 2F48A 4UB6C 3K0LA 1IJWC 2PMUA 3PNYA 4A3EJ 3D0SA 5D4RA 4IRHA 1ULYA 2VJJA 4IVNA 1S8NA 2E2IJ 4JBAA 4BQNA 3ABKH 3DU5A 1F9NA 2HVSA 2ID3A 3RTRA 1F36A 1VF9A 4HNUA 3BJOA 2QQBA 2VXDA 4XOPA 2KLOA 3IKVA 3JTHA 2V9PA 3GTPJ 2WA0A 1OYWA 2L7FP 1G4DA 5DD8A 3BJ6A 1OFCX 3HTUA 3WTYC 4E7ZA 4A3LJ 1R36A 1ZGJA 4NDLA 2WAQA 4Y13A 3KEQA 4N4OB 2A5YB 3I64A 1H8AC 2GOXB 1YX3A 2F5FA 1O7LA 3HIFA 1YJNI 3FDYA 5JVTA 4QLCU 1YS6A 1Q1HA 2XAGA 2FX0A 1W7PD 2EJRA 4F7ZA 2L4AA 2R92J 4A3DJ 5LFAA 2IP2A 1E3HA 3OR2C 1U78A 4I98B 5EEAA 5HNHA 3ZQHA 3GX4X 3L09A 4HZFA 1B59A 2ZMEC 5BPIA 1FX7A 4G12A 5KHDA 3DPLC 2A07F 2AHQA 1QHHD 1P4WA 2XAFA 1VQ8I 2RDPA 3EUKL 3JAMK 2Y0SA 3I59B 3H5AA 3KE2A 3H9JA 2Q0OA 2YX4A 1BOBA 4Q4ZF 1HQCA 3SFIA 4AIKA 1I6XA 2ZKZA 4CA0A 4E70A 4HOBA 3E5UA 2DCEA 4HLXA 2GBYA 2VASA 2DA6A 1FP1D 4XM3A 3ZMSA 2MH2A 3H9QA 5E17F 4BKXA 2X6YA 3SJMA 1R58A 4MIMA 5FROA 1R71A 2HKOA 3FXUA 5E20A 1UG0A 4UXNA 1N25A 3W6JB 5IT9Z 2BVMA 5FD5A 5FKLA 5LGNA 3CC7I 3S17J 2ZFUA 4KN4X 4JOMA 3T1BA 1I3AA 2X51A 3G1OA 3DBHB 3MEXA 1K7AA 3CF5F 2XGCA 3K1NA 3DEWA 4Y15A 2Z9OA 4OIQF 2K9LA 5D5VB 3ERMA 1D0YA 4Y4RA 2CV0A 4AWXB 1WPKA 4I99C 5J1RA 2X48A 2DDAA 4QIWN 4HA8A 1UB9A 4MFDA 2VQLA 2XKPA 4XIDA 2MW8A 1SVMA 3J7AO 4CCMA 5K7FA 3CJTB 5DM6F 3TQNA 4RM2A 2RC4A 2Z33A 2DW4A 1HA8A 1HC8A 1QNTA 5E3NA 2BY0A 2XVCA 5FJ8J 2FUG2 4JK1X 4PSXA 2EIJH 1IC8A 2BBYA 1JKRC 2F2EA 2LBFB 5ED4A 5FD6A 3HHGA 2H6BA 2N8GA 5KK1A 1Z77A 5FFXA 3A4CA 3E7LA 3W6VA 1HW1A 1SFXA 2K02A 2QBYB 5CVVA 3F23A 5CVIA 3WTWC 2RQQA 3I56I 5F0CA 2XPWA 3DU6A 2LH9A 4PJJA 3DTEA 3R0AA 4ZDOA 5EJCA 4NB5A 2BHZA 3ZQQA 4EM0B 3OYKA 2CJJA 1DGRM 2A6HF 2DDBA 4YEJA 1DP3A 2GA1A 4UUTA 3I4NJ 2ZNYA 5LLQA 2FJ1A 2DFHA 5LD2C 3AKZA 2DJNA 2GXAA 3F8FA 2DT7B 3K70C 4BY1J 4F3QA 2MSYA 2RVCA 2G9WA 2XF7A 1BJAA 1BI0A 3ABLH 5LHGA 4O6JA 4B44A 4UVCA 3WHCA 4OU0A 4PJ0C 3J81K 4RM3A 3O3KA 4IXAA 4P5OA 2Z5UA 2DA2A 1TW3A 1Z3YA 4FHTA 3D5SC 3ABMH 3FXJA 3CD6I 1DPRA 4AYBA 2LD5A 3ZQLA 4EJOA 1ETXA 3FXMA 4OAYA 4K2EA 1T56A 2ZJ2A 1O4XA 1XB4A 3ELKA 4LD5A 5F27A 5EG0A 2QWWA 3FXQA 4HSRA 3GLXA 2M7AA 2F4OB 3HSEA 2E7WA 2FD5A 2EFNA 2JQ7A 2M1BA 2PMZN 2HWVA 3W6KB 1FC3A 1WJEA 3J80K 3HZJA 4IRGA 2LVSA 2ZXJA 5CVJA 3VSLA 5E8IA 5J1YA 4A93J 1NK3P 3H36A 4UUVA 1LE8A 4OIRF 1MBGA 2Y2ZA 1DP7P 1K61A 4C3HJ 1WFXA 4A3GJ 1X1DA 1QQIA 3C7JA 1TQMA 2O6GE 3K70D 2MH9A 1ZN2A 2Q2EA 1WZ2A 2E1OA 4KIFA 3ZXSA 2LMDA 1MGTA 3GTJJ 3BTIA 1HDDC 1BA5A 2C6YA 3KYCB 1MKMA 4MLOA 2BOLA 2GIVA 4EM1A 1A31A 4H0EA 1YW9A 1MBHA 3AAFA 1X3WB 1MSEC 2QSFX 1XGMA 4BACA 2P5VA 1GVDA 2OCEA 2RV8A 4DNCA 5J47A 2HTJA 3V8LA 1A6QA 2HOAA 2AS5F 2B0LA 2P4WA 2DPDA 2OU2A 2A5WA 5DEQA 1YG2A 3PQKA 2FSWA 4CUGA 4C9YA 1REPC 2WB1N 4NUBA 3ZRGA 3BR0A 1S5LC 2WY7Q 5DCMA 3CC4I 3FBIB 2HQRA 2WV1A 3KP5A 1SD5A 3ZMTA 2HDCA 1WJFA 2HZTA 3HPGA 3K10A 2VJ5A 5EEHA 3BR3A 2DJIA 3CJNA 4HDUA 2HXIA 1IUYA 3BZKA 3KCCA 4FASD 2KT0A 1R4MB 3A01A 5HS9A 3DWLE 4LOCA 4NQWA 4EVIA 1K4TA 5FLXK 2FMLA 2QEXI 5TRDA 3FHZA 3OYHA 2NVQJ 3GFIA 1IRXA 5H6RA 5D5XB 1NG6A 5C4JJ 1P92A 3V7CA 4ESBA 3OYIA 2W24A 1QVTA 3QPTA 3RJPA 1AKHB 2BGCA 4I6ZA 1YRNB 3CDIA 1D0XA 3HHHA 1POGA 2OAZA 1X2MA 2XKOA 3KP4A 3S3MA 3CJQB 4EEFG 5BPDA 3WTSC 5CJ9A 2EIKH 3L00A 3RIRA 1A6IA 3FHNA 3OYDA 1RRJA 3GCMA 2E1MC 5E18F 4ZYDA 2F5VA 3HKZN 3GFLA 5HOOA 3W2VA 4XLHA 5IP7J 4Y17A 1CF7B 2EZIA 2UUZA 1JKOC 4HQMA 2IXSA 1MBJA 4L0YB 2IEKA 2ESHA 3Q0VA 1T98A 3GW2A 1IRZA 2TCTA 2AO9A 3BG6A 1WJDA 5TGTA 4UB8C 1PYVA 3TO9A 4B48A 5IP9J 3W2AA 4CYCB 1BJZA 4FX4A 4PJLA 1XTAA 3I53A 3ZCOA 3WTTC 1Z9CA 3MN2A 4AVPA 4WWCA 4G94A 2ESNA 1A5JA 2CUEA 3QRFF 4NBQA 1D5YA 1MBFA 2BW3B 2JSPA 2ZMEB 2QA4I 3KP7A 4RAFA 1OCCH 4XLAA 4NC8A 5FB2A 3CO7C 1WJCA 2MBFA 2R7OA 1SFOJ 1CGPA 3HBLA 1O3SA 4JP0A 3LL7A 1DU6A 4BGDA 2R7TA 4MQVA 1RI7A 3M1EA 5GADJ 4BE0A 1YX5A 3SYTA 5FRNA 2H1LA 2ZXIA 3OYCA 4EV0A 2E1CA 2HZDA 5GAGJ 2OCCH 2DA7A 1Y8QB 2VBXA 1Z0XA 4KYWA 3R61A 4M9XA 3WODF 2ZJPF 2V6CA 2IS1A 1FOYA 3CCYA 4BHPA 2XAHA 2JMWA 1L3LA 1N77A 2EZLA 2HI3A 4P1WA 1VQNI 5DM7F 1DPUA 2VE8A 2DOAA 2GWRA 4DOZA 3JRBA 4KNYA 2VUMJ 3BQZA 5B66C 4HSTA 2RGVA 5EEGA 5JLXA 1SD7A 1Y56A 1U9OA 5AIQA 4DZPA 1R1VA 1G3SA 3CCQI 1ZRCA 2ADUA 4EJTA 1AHDP 3BR2A 4YFNF 4WXCA 5LRSA 4ZYGA 1ZREA 2EIMH 3LA3A 3U2RA 3FKIJ 1LFPA 2A05A 1FSEA 2FQ4A 2KJBA 2Z2SB 2CQXA 2E34A 3FZVA 4M72A 5ERIA 5K7HA 3OV8A 4A2UA 4IHSA 1XD7A 2AXTC 1D8JA 2KKOA 4CYDA 2I5UA 2CV1A 1TBXA 1BC8C 3QOPA 1ETYA 3RKXA 1E3PA 1GXQA 4DJAA 2I10A 2K3FA 3FMRA 3CP8A 5L3DA 3OSGA 2OTLI 1ODDA 2KIUA 4I0BA 1TNTA 1GT0C 1K6OA 3S16J 1PP8F 1MNMC 1NHAA 3PSFA 1VZ0A 3CTAA 3J7ZI 1WRJA 3H3VK 1QU3A 3PFIA 1FPQA 2QKMB 3VEPA 1ONVA 4B09A 3HDDA 2PJPA 3BTCA 3T0YA 3HOVJ 4MTEA 1PUFA 3DFGA 4KFCA 2DLLA 2KZVA 2CQNA 1A36A 2Z1DA 4BEHB 2E5ZA 2L9RA 2A61A 2EV6A 4KT5C 4LMYA 3I58A 3DKWA 3E6BA 4XORA 3JSOA 4UV9A 4CCNA 2CQQA 3HRUA 3HOYJ 4U88A 2VQGA 1UMQA 5HNFA 3FBNB 4HPQA 4C3IJ 2PFBA 2QCOA 4QWQA 3QYEA 3MZYA 3JRDA 2WAFA 3H92A 2W00A 3ZQCA 4I7HA 3V7SA 1L0OC 2M87A 2LF7A 3BWGA 2ZO4A 2X9DA 3E1SA 4A6EA 5L3FA 1BL0A 2HGCA 2P6SA 4LB6B 3HEFA 2F5CA 2UZKA 2CU7A 3WE2A 2OTJI 1P7JA 3OYMA 2R7ZJ 2JA2A 3F21A 3FF5A 4LK0F 4F52A 3TO6A 2QQAA 2LY1A 1YLFA 3WU0A 3ZPLA 1U5TA 5JFRA 5JI6A 2EH3A 5H6QA 1SFKA 1TZLA 2FE3A 3BTJA 4G6DA 1GDTA 4S05A 2Y75A 4A0ZA 2DFFA 1MSFC 1PVEA 2DK8A 3H3UA 2PMZA 3B02A 1AOYA 3GTLJ 1YTYA 4HV6A 3BY6A 2QSGX 4E7IA 1F43A 5GPAA 4HX8A 1KYZA 5C3EJ 1TWHJ 2BHYA 2LY9A 3SXYA 2XUBA 1MMSA 2RQPA 3AG3H 4OWRB 1FOWA 4LK1F 2F6CA 2CO5A 4CSWA 3IRRA 3JW4A 2Y0MA 3ML6A 5E1XA 3IHUA 1JJ6C 3MKLA 3DF8A 1I3QJ 2HR3A 3HOTA 2CH0A 4LG0B 5CYVA 2OC6A 2B7EA 2QZ8A 1HKSA 1DGWY 2V6EA 1MBKA 2DMNA 2IA2A 1R23A 3B6CA 5DYMA 1BW6A 2H27A 3WGIA 4BHBA 3HSRA 3M1CA 2ZXWH 1UG2A 4XLNF 4A69C 5J3LA 1X3UA 1YI2I 3L9FA 1BR4A 2R7SA 4A5MA 1JHFA 2HXOA 3D1NI 4TV7A 3REOA 4V19K 5D8KB 2LFBA 3IV5A 2VQCA 4NNJA 1QZYA 2XSJC 4GXOA 4E6KG 4HLYA 1I27A 2XAQA 4YELA 3WG9A 2VQHA 4U7BA 4HRIA 5TJJA 5L3EA 2R93J 3TP3A 1Y0NA 1ZQ3P 1TT5B 4FTHA 2LC2A 3FM5A 2FBHA 3TDZC 4BDZA 4L5JA 1QVUA 1YIOA 1HDPA 5DS9A 4BJ6C 4LJZF 5D8LB 4BXFA 1U9NA 3MMYB 1MZBA 3K1PA 4BU2A 1BM9A 5ICCA 5BNGA 3HXLA 3SZGA 2VODA 2E1MB 2IBDA 2IAIA 4NC7A 4XLCA 2M3AA 3O2PE 5CVRA 2UWMA 2R0QC 1FOKA 4G8XA 4QTRA 2ELHA 3CCUI 2HOTA 3RKYA 4M3GA 3JRGA 5GAEJ 1OCPA 3K7AJ 1QO0D 2YX7A 3NWSA 2DPUA 3JREA 2FF4A 4JQFA 3HKZA 3X2QH 2PBIA 5HLTA 2EFWA 1XSDA 2IGOA 2R5YA 3SEQA 3QOEA 4CCKA 3I59A 2JTVA 4UUSB 5F64A 3OS1A 4XR6A 2P6TA 2PMHA 3ZQGA 1OYIA 2DFEA 5DCFA 2BY1A 2ICWG 4X1EA 4WXDA 2MLGA 1OMIA 2F5EA 2R5ZB 3EETA 5BMZA 5ILVA 3MKWB 4ESJA 2Z99A 4GRIA 4LFUA 2HYGD 3TOAA 4EATA 5IT3A 1XN7A 4XSZF 1LKXA 1ZLKA 5HVQC 2EZHA 3OYLA 3S8PA 1TLHB 3KEOA 2HTSA 5M5WJ 2M9HA 3BTLA 4EQQA 4MFEA 3RPUD 5HDKA 1AU7A 1YITI 2P81A 1WI3A 2RNGA 1JI8A 4JX4A 2QENA 4LG3A 2VC0A 4WX9A 3QYBA 5M3MJ 4F92B 5F0HA 5EF6A 4D7NA 2K9QA 2WTEA 2JZYA 2QUFA 4D7MA 3ABTA 3NQOA 4L9JA 2VBWA 3E3VA 5CVUA 3PO2J 4G9YA 1VQMI 1B8IB 5GPCA 2VKHA 3E5XA 3B6AA 2EV5A 3B73A 1ZAOA 3D5RC 5E3OA 1O3QA 3K2ZA 2K3PA 2VJIA 3SEZA 2UV1A 5L3BA 3R60A 4RGSA 4XK4A 2FRHA 3PNTA 3W3CA 1DQUA 2AQEA 1PUEE 4IOAF 3AG2H 1JTXA 1WSUA 1JHHA 3GXOA 1ZG5A 1GV2A 2MLKA 4HYEA 4E7LA 4B1RA 5BS6A 3BQYA 3CMAI 3OS0A 4XRSG 2HVRA 1LJ9A 3S93A 2GZWA 2CYYA 1QPMA 1MIJA 4JX5A 4GFBA 2MA3A 3LSRA 2A6TA 3RKWA 3QU3A 1LEBA 3N97A 4S04A 4M9SA 2LREA 2XAJA 2A69F 4CHUA 1V54H 2OJED 3MZHA 1HCRA 3KP6A 4F91B 4C3JJ 1I50J 2K9MA 1K83J 1OCTC 1V4RA 3H1CA 2HDDA 3CO6C 2IW5A 4BH9A 1HLVA 2LKSA 5FKKA 3VYRB 1J0RA 2BY3A 1M1EB 4E7KA 3I4PA 4BY7J 2E2HJ 2VBZA 4RLFA 2BXYA 2OA4A 3GFMA 4MO7A 3L2UA 4RAYA 5DTDA 5HS7A 4O5VA 2IJLA 3GVAA 2JPCA 1B1BA 1KONA 3VB2A 2CUJA 3EQLF 3LSJA 2OQRA 3CUOA 3S32A 1R1TA 1T8IA 2GA2A 3ZMDA 3SDGA 2KZGA 3GLLA 1W0TA 4KISA 2DOFA 3VOEA 3CUQC 3JRIA 4LIVA 4PCQA 2XPVA 2V1NA 1IV6A 4HDVA 5EZHA 2L02A 2ME0A 2NXNB 4BJTA 2ECCA 2L7MP 3PSIA 2FXAA 4XLFA 1ZTRA 2E5NA 1XG1A 3C2BA 1JUSA 3KETA 3ZMVA 3H9GA 2X6OA 2ETHA 2CQ7A 2V79A 3TGNA 3J7AY 2XAUA 3P5JA 4XLPF 2LP0A 4OIOF 2JN6A 1G6NA 2G7UA 2GIZA 3OWTA 4N9IA 2NVYJ 3S1MJ 1F1ZA 2IVMA 4KDPA 3WU1B 3DKYA 1W4MA 3OMYA 1SANA 4OINF 1GXPA 4L9TA 2IGKA 4FT8A 3WU2C 2VKVA 4EJVA 5J4YA 2NVUB 2BYVE 4OAZA 4MQ9F 4IKFA 2DTRA 3FISA 1Z7UA 2M34A 5GTIC 4YIFA 2EWNA 4IHYA 1FTZA 2OBPA 2Y48A 3E0JB 3L1PA 2R4GA 4DZJA 1VQ4I 3P7NA 2IRFG 3VDXA 3ZQFA 3RSNA 4C2TA 3JTGA 1OISA 3GTGJ 5F1RA 3BR1A 1SVOA 3MFKA 1IDYA 2ZFWA 5LBQA 2F5DA 2ZC2A 4ZTFA 5CLSA 2M5WA 1FIPA 3CCVI 2NRAC 2KHMA 1D1CA 4WF2A 3WGHA 2LNBA 5CPRB 5AONA 3HOWJ 3ZR8X 3GTKJ 2VC1A 1R4NB 2OPTA 4ZYEA 1B72B 2K40A 3K4JA 1VFCA 1W7PA 1ZR2A 3DLAA 3JSPA 1JT6A 2A68F 1BW5A 4DQ2A 3OYBA 4A3IJ 1HKTA 2DQRA 3A0HC 3FIWA 1A35A 2B63J 3BR5A 1BI1A 1OQYA 2M2EA 2QVOA 3WE3A 1IN5A 4HAMA 4M6XA 4ZDPA 4HNVA 2L54A 4DW6A 2R7WA 1AKHA 4L5IA 1EA3A 3I54A 5DV5A 1WH5A 2DMPA 3V42A 3F22A 1PP7U 3HRSA 3M4OJ 3HRTA 2V1XA 3R0JA 4GO1A 1LVAA 2A6EF 1YFHA 2D45A 1ZR4A 1Z6RA 3HRMA 2R7DA 4AIJA 3MQ0A 5HODA 5EGOA 1KYWA 5GP9A 1PDNC 1WH7A 2IT0A 3S2DJ 3PL8A 3G1MA 4GCVA 2R7XA 1YOVB 3SDBA 1RUNA 2ZJRF 3OS2A 4RGUA 2O03A 4KITB 3ULQB 2PG4A 2HQNA 3FXLA 3MVPA 2G7HA 2DMQA 1U8BA 4CZCA 2XDVA 1Y0UA 3G6EI 3IP4B 1SC7A 1MH4A 2DODA 2LR8A 3JAMZ 3OIPA 1T2KA 1FMVA 3CCEI 2H09A 1SD6A 2GM4A 2OZUA 3A2KA 1G3WA 3JRCA 1E17A 2DN0A 2KRHA 1R5GA 1SFEA 5D6EA 4AC0A 2VPLA 1BC7C 2GLOA 1R1UA 3Q9SA 4DYQA 4IO9F 1VQ9I 2QF7A 1HW5A 3ONQA 2DA4A 5D5UB 1LDJA 2GQQA 4J19A 4HQEA 1EF4A 1Z67A 2K9SA 4IPAA 4KJZA 5A2QK 1XGOA 1RZ4A 3LA7A 1D0ZA 1R00A 1OLTA 2HKXA 2LK2A 2JK3A 1XGSA 3DV8A 1W36C 3JCUC 2XB0X 2HDWA 1KZHA 3F8NA 1GV5A 1ETKA 2EILH 3BZCA 3I3LA 5ICGA 4I01A 4J01A 2IA1A 1ZG3A 5FGMA 5M3FJ 2GXBA 4A3JJ 3L7WA 3K4LA 5F04A 1TWAJ 2K9NA 1WWXA 4CCOA 4N0BA 3IH2A 5EG0B 1JXSA 3M7GA 2VT3A 2YSRA 1U5TC 3QPLA 4II3A 4XKBA 5GTHC 3DCFA 1Q1VA 3GFJA 4M6VA 2JA5J 2Q1ZB 2QYOA 1KU2A 1X3ZB 2E71A 4MEYF 2ZSHB 4PFOA 4RGXA 1S7AA 2KJCA 5E3MA 1FTTA 5LHIA 3DEEA 1FYLA 2IS6A 4B47A 1KGSA 1DDNA 1MMAA 3LSGA 1FBUA 2E7XA 2VI6A 1ZG1A 2JT1A 4I02A 3RPQA 3UKGA 3HC7A 2P7CB 3TKYA 3EYIA 4GDFA 2H8RA 3ZMZA 3DTKA 1Z21A 3FKJA 3OIOA 5BOXA 1P4XA 4JX6A 3DLLF 1W36D 2CW0F 3VPRA 3RYRA 1O3RA 1D3YA 3M8EA 1MD0A 3M3YJ 4ESFA 1MMGA 4G7ZF 1P6RA 4XSXF 4KT6A 2DMUA 2HYJA 1SMTA 1TT0A 2V4JC 2R7QA 4DYRA 4C2MJ 1R5HA 3J7YJ 1FBQA 1XSXA 3OYEA 1A04A 3H5NA 5CKTA 1D8KA 3O8GA 3K2AA 3H0GJ 4BE1A 5K7ZA 1O7FA 2XF5A 3TW7A 3COAC 1K6YA 1MJAA 1K4SA 5J8CA 3KEYA 1ACIA 5IOZA 1ZGAA 2HFHA 5KNLA 2CG4A 5IY5H 3A01B 1IUFA 3EUHA 3ROUA 2FNAA 2QKLB 2W84A 4BEHA 5B1AH 1JJ8C 2WAQN 3SZTA 2PJRA 3RDIA 1OCRH 1VQKI 1FWZA 2STTA 3OR1C 2XGDA 2YR2A 3G4SI 5HS8A 1LDDA 2JVHA 4PK4A 1TW2A 3RCOA 1YJWI 2O9LA 5D5WB 1RKTA 4BAYA 2L5QA 3CLOA 1S29A 1RC9A 2D2WA 1KU9A 2BEOA 1QBJA 3NAUA 2MGQA 2WAEA 3I0TA 3ZMUA 1BN5A 3KLNA 3BDDA 3ZQIA 3J80Z 4YRVA 3FMSA 4NC6A 3ERED 4A3KJ 1G3TA 2ID6A 2PEXA 4LLGF 1VQOI 1SVLA 3CUQB 2Z3YA 3L2RA 1ORKA 3VSKA 2P0WA 3F8BA 4IHWA 1KQ8A 3NWTA 2V26A 3ECOA 1RNLA 3LWFA 1WQ2A 3SHFA 1KU7A 1OJLA 1J5YA 1RETA 2JUGA 4ON0A 1APLC 2LTPA 2Y0SN 2CRGA 1MDMA 3MKYB 4D9JA 1VQ6I 2JWTA 2LOOA 4CCLA 1FYMA 1ZHFA 2VKDA 2Y30A 4BYYA 2X85A 4ZJZA 4AM3A 2LRDA 1VQLI 1CQTA 3RKQA 4X6AJ 4AVZA 1TWCJ 4EMSA 2F4MB 3QAHA 3C18A 2XGEA 5D6FA 3OY9A 1BR2A 4KMUX 5F08A 5HDNA 1U8RA 1BIAA 2LKPA 1EJ9A 4HG2A 3IL2A 3CCMI 3HOUJ 2O5RA 4ABZA 4IF4A 3HPHA 3WHBA 2KPMA 3LSPA 3GBGA 3HG9A 4C2UA 4LLLA 1UHMA 3BCBA 4Z2YA 4X0GA 9ANTA 3K4KA 3GWZA 4BE2A 4GGGA 3T8TA 1VTNC 3IH3A 4A3FJ 3F9KA 1QPIA 3ECHA 4A3BJ 3E5QA 1Z7LA 4LIUA 3C2GA 5FLMJ 1S6LA 3OYNA 5ICEA 2P5KA 2V7FA 1LNWA 1N75A 2A3SA 2R3SA 3ISPA 4GYGA 1JUMA 4A0YA 3AG4H 2CW8A 4A12A 1X2NA 4M71A 2GOMA 4ITVA 1XMXA 3P9CA 1H9GA 1STZA 1OR7A 1EH6A 4ENMA 3CCJI 3TMOA 4RS8A 4BS9A 1WI9A 3E6CC 2VN2A 1LUJB 1SAXA 1SFUA 4Q5SF 2NS7A 4KUMA 4F93B 3N4MA 4W97A 4XQFA 5E1WA 3I55I 2WY8Q 2XROA 3S15J 2NAZA 5FKMA 3TOBA 4CDGA 2IS4A 1LEAA 1X1AA 4WK8F 2VJ4A 3ASOH 4DGWB 4BNCA 3HOSA 3HUGA 3KP3A 2EK5A 4KICA 6PAXA 4IL6C 1JKPC 1T38A 1B6AA 3F3XA 3K4CA 3MCZA 5F1JA 3L2WA 4YFKF 4B4CA 1BR1A 3DBRB 4HF1A 3QODA 1K78A 3OOUA 2RAEA 1OPCA 3H0DA 1Z3XA 4DBQA 2DT5A 2CMPA 4U0WA 3KIOA 1T33A 4FE4A 1FY7A 3CQZJ 1R22A 3DBLB 5FKOA 1ON1A 4HNTA 1X4OA 1J75A 4U7DA 4A6DA 2KIFA 3WGGA 1P2FA 1D1BA 5IYDJ 3BG7A 1Y39A 5J1UA 1PUFB 2QQ8A 1BI2A 3CMEI 1AA7A 3CZ6A 3M9AA 3AFHA 1V5FA 3CJRB 3A02A 2JJ7A 2WB1A 3WG7H 3F8CA 3E6MA 5IT9K 2YU9J 1LDKB 3GZ5A 2XRNA 3LAPA 2W4SA 2M8EA 4BHCA 1U3EM 1I6HJ 3Q0WA 2NYXA 4RAZA 3QQAA 3U21A 2XHKA 1E2XA 2X1CA 4IX7A 1MW7A 3GTQJ 3ZP5A 1TWGJ 2CS3A 1FBSA 2EBIA 4LB5A 2DU9A 3CDLA 3SFZA 2TDXA 4L9VA 2PLYA 3DKXA 4AUXA 2M4KA 4BL0B 4JYKA 3ASNH 1ZYRF 1HW2A 1C0WA 3FM3A 3KFWX 4PUSA 2DK5A 2ACJA 4I0AA 3VODA 4B8XA 1U5TB 3QPHA 5JLWA 2K4JA 3ZGKA 1USTA 4F55A 2YU3A 5DDGA 2EB7A 3S3OA 3GEZA 3HOXJ 1I1SA 2KIQA 4ENNA 3LSIA 2W7NA 1QZEA 1IXSB 1X58A 2XF6A 1YHQI 1MJ9A 2BE5F 3OL4A 4CZZA 3Q9VA 1S9HA 3E97A 3FK6A 4GYIA 2EV0A 3LFKA 1JE8A 1ERDA 1I1GA 1Y6IA 3GTMJ 2E60A 3CMYA 1IV8A 2QLZA 4QSHA 2IGNA 4W1UA 4BQOA 2XPUA 2X0LA 3Q5FA 4XONA 3U1DA 1QA6A 3C2HA 2KFDA 2L4MA 3PM1A 4I2OA 3O8HA 1IRFA 1T95A 3IAS2 4FCYA 1BBYA 2KRCA 4PDKA 1LPQA 4OMYA 3RZOJ 3DP7A 3C3WA 4ZYAA 4IOCF 4LITA 1PJRA 5J6XA 4UHTA 5DUKA 1U0JA 3QP6A 1YIJI 2CQKA 1XCBA 4M9ZA 3ZQ7A 2ZJQF 1T6SA 3K6GA 4M6YA 2VIXA 5JHUA 2HU9A 4XKCA 5E79C 2L9NA 4AIDA 4CH7A 1WVRA 2M45A 3HL2A 4XN3A 5LRRA 4MTDA 3BP8A 1Z91A 1V3FA 3A03A 4ZYHA 4V2GA 2DT6A 1H88C 1IO2A 1HF0A 2X4HA 1GVJA 1G59A 2YUSA 4R1HA 4J00A 2M30A 1S72I 1UFMA 2L01A 2PX9A 1RIOH 2W57A 1AWCA 1KA8A 4BXXJ 1LQ1A 2CGPA 4Q48A 2BY2A 2LBFA 3FMQA 4MEXF 2HOSA 3OOPA 2ZSIB 1B9NA 4P96A 2WC2A 4IRIA 4YIRX 4RBOA 3D5LA 2Z16A 4Y3OA 1K79A 2QBYA 4AIHA 1XMAA 5ILUA 3DPUA 3K1MA 5CQGA 3OYGA 2DOEA 2HPIA 1EV7A 1HSTA 2EQRA 3H3ZA 1QZZA 3JRFA 3V8JA 2MC3A 2ME6A 3GF2A 1NH3A 5K5OA 2OQGA 2GAUA 2JRTA 2MYSA 4XMYA 2EA2A 1LB2A 2COBA 2DO7A 3ZN1A 3F72A 3U1KA 5GAHJ 2WBMA 3QU6A 3SQNA 5H20A 2O61A 4BDYA 1TQIA 2R5YB 1ZK8A 3MKZA 4CCJA 4G6TB 3K69A 2M7BA 1QHGA 3AL0B 3BROA 4XKVA 1H9TA 1TC3C 5HLHA 2CUZA 2MG4A 2LLKA 1ITYA 5FRMA 2MD0A 5KCMA 1FSHA 1TTYA 3LSMA 3PO3J 2FBKA 3M8FA 1WGXA 2O8KA 1FOXA 4RGRA 5IPAA 3LNQA 1YW8A 2EINH 4RMNA
chains in the Genus database with same CATH topology
3P9KA 2HEOA 2XGXA 4KN7X 1BIBA 1BI3A 1HKQA 2DI3A 1J59A 2R7FA 4EGZA 2O3FA 1XSVA 1ZLJA 5ILSA 1I5ZA 1FT9A 2V1DA 3U9GA 1IW7F 1YS7A 4UNOA 1S3JA 4WXHA 2EFOA 3V4GA 3PQJA 4IHTA 3VFZA 4L0ZB 1ZH5A 1USSA 3BZ6A 4ZZDA 4XRFA 4BQAA 3GZ6A 1ZARA 3O6BB 1FP2A 2EFQA 3MWMA 3RPUA 1T0FA 3DPTA 1ZRFA 3G3ZA 2FEZA 2OZ6A 4OIPF 4A0XA 3L2CA 2RKHA 2FA5A 3T8RA 4P55A 2O0YA 1FLIA 4RB3C 1R7JA 4HF2A 2RNJA 4MGRA 4ENKA 3S2WA 4U0VA 5ICFA 5K5RA 4EM2A 3P9IA 2VE9A 4IJAA 2VOPA 1FZPB 4N9HA 2DBBA 1KQ9A 2LDUA 2P7VB 1CF7A 1YQAA 4Q47A 4O3MA 4FX0A 2FQ3A 4ZH4F 2AXLA 2KRFA 4M73A 3GO5A 4L18B 2K86A 3IC7A 5FFZA 2DAOA 2XIGA 3R6SA 3F6VA 2LSOA 1DUXC 1EH7A 2PN6A 2WV0A 2IPQX 1IN4A 2ZMEA 2O8XA 2HS5A 3F8MA 4PGGA 2UXNA 4R8HA 5DUIA 2K27A 1F5TA 4A5NA 2RN7A 1S7OA 2CSOA 1WKMA 2ISZA 2H94A 1W7PB 3BPVA 2NNYA 2VONA 4RB0A 1IZ1A 4OOIA 4AD9A 1ON2A 3K9TA 1Z05A 1D5VA 4G6QA 4YFXF 3CUQA 4RB2C 1GHCA 3SZPA 3WTXC 2CFXA 3IKTA 3IWFA 1YW7A 4HV5A 5L3GA 4EGYA 1U2WA 4P9UA 5HLGA 1QGPA 1KQ0A 2VT2A 1H0MA 3EYYA 4PZJA 1HBXG 5LEJA 3GUDA 2V9VA 2K4BA 3IRQA 5DCMB 4RB1A 1UCRA 3J81Z 2WWYA 3EDPA 2EA4A 2STWA 4MHGA 4U0YA 2FMYA 3T5XA 3V8KA 3R4KA 5BQTA 2OD5A 1IXRC 2Q8KA 4KIGA 3QP5A 2VXZA 1J2XA 2HOEA 4ZZLA 1B4AA 1ZRDA 2J5OA 4ENJA 2HYFA 2PQ8A 3LA2A 2W85A 3BPXA 5E1ZB 2GXGA 4LLNA 5F6FA 4OMZA 3LSTA 5K5QA 5LEKA 4YG2F 5JR3A 1IN8A 5HDGA 1F4KA 3FX3A 1IF1A 2VOOA 4LGWA 2P5LC 1IXCA 3KZZA 2LF8A 2CWEA 1B9MA 1BOAA 4UV8A 3DEUA 4PGHA 2QM3A 2D1VA 1T39A 1FYKA 1TQPA 1J7KA 3I71A 2JSCA 1IAWA 4BXUA 1W5TA 2COMA 4LG0A 1HXDA 1XDUA 5FLXZ 5A2QZ 1EH8A 1G3YA 3FWEA 5LGUA 4MNUA 2D1HA 1UHWA 5E8GA 2KIMA 4L9NA 3WTVC 5LHHA 3NEUA 4M74A 2ZBKA 4YIIA 3F6OA 2DFIA 1IRGA 4WCGA 4EJWA 4G7HF 3HYIA 1Z6TA 1P4AA 1U6GA 3NRVA 2P8TA 2ZCWA 3CDHA 1SMYF 4HX7A 2L3DA 2H6CA 5AIPA 4CXFA 4KMFA 4NHJA 2J5PA 2QQ9A 1YYVA 3KLOA 4UVAA 4CGZA 1MDMB 3HTSB 3WTZA 4XBFA 4D0PA 5D4SA 2IA0A 4CO8A 2NNNA 1IN6A 2V1UA 5DD4A 5KVRA 4UVBA 1OYYA 2ISYA 4ASNA 4KA4A 3KZYA 4R79A 2E1NA 3E6DA 4P9FA 3GYHX 3RI4A 3DXJF 2XV4S 3TO7A 1HSJA 3C1DA 4HW0A 2K7LA 3WTUC 3IWZA 5FO5A 1W5SA 2W25A 1OKRA 3LQQA 1J9IA 5L3CA 1SD4A 1JGSA 4I09A 2FOKA 3ZN0A 4CICA 2BV6A 3KP2A 2XASA 4G7OF 3DQVC 3G73A 2YPRA 2PI0A 2FBIA 2EFPA 3BOQA 3V7RA 2UXXA 3HSFA 3LQRA 1TNSA 1XCVA 1Z1DA 2VBYA 5K1YA 3MAJA 2FNPA 1XMKA 1MJBA 4HF0A 1RUOA 4KIBA 2MD5A 4HX4A 5HLIA 2DQLA 1XDSA 4EJUA 2NS0A 4ETSA 1O3TA 2FU4A 1K78B 3I5UA 1XGNA 1YO5C 3ABUA 2JPBA 3RYPA 3FXRA 3TDUC 1KU3A 5J8FA 1O57A 1FNNA 1IN7A 5LGTA 3BJAA 2ZNZA 4HBLA 3K0LA 2PMUA 3D0SA 5D4RA 4IRHA 1ULYA 4IVNA 1S8NA 4JBAA 1F9NA 3RTRA 3BJOA 2QQBA 3IKVA 3JTHA 1OYWA 1G4DA 5DD8A 3BJ6A 3HTUA 3WTYC 1R36A 1ZGJA 4Y13A 3KEQA 2A5YB 3I64A 2F5FA 1O7LA 3HIFA 5JVTA 4QLCU 1YS6A 1Q1HA 2XAGA 1W7PD 2EJRA 4F7ZA 2L4AA 2IP2A 1U78A 4I98B 3GX4X 3L09A 4HZFA 1B59A 5BPIA 1FX7A 3DPLC 2A07F 1P4WA 2XAFA 2RDPA 3JAMK 3I59B 3KE2A 2Q0OA 2YX4A 4Q4ZF 1HQCA 4AIKA 1I6XA 2ZKZA 4E70A 4HOBA 3E5UA 4HLXA 1FP1D 3ZMSA 2MH2A 5E17F 1R58A 2HKOA 3FXUA 5E20A 4UXNA 3W6JB 5IT9Z 5FD5A 5LGNA 4KN4X 3T1BA 3MEXA 1K7AA 4OIQF 3K1NA 4Y15A 2Z9OA 5D5VB 4AWXB 4HA8A 1UB9A 2XKPA 3J7AO 3TQNA 2RC4A 2Z33A 2DW4A 1QNTA 2XVCA 4JK1X 2BBYA 2F2EA 5ED4A 5FD6A 3HHGA 2H6BA 5KK1A 5FFXA 1HW1A 1SFXA 2K02A 2QBYB 5CVVA 3F23A 5CVIA 3WTWC 3R0AA 4NB5A 4EM0B 2A6HF 2GA1A 2ZNYA 5LLQA 3F8FA 2RVCA 2G9WA 1BJAA 1BI0A 5LHGA 4O6JA 4UVCA 4OU0A 3J81K 3O3KA 4IXAA 4P5OA 2Z5UA 1TW3A 4FHTA 1DPRA 4EJOA 4K2EA 2ZJ2A 1XB4A 3ELKA 4LD5A 2QWWA 3FXQA 3GLXA 3HSEA 2E7WA 2EFNA 2M1BA 2HWVA 3W6KB 1FC3A 3J80K 4IRGA 2ZXJA 5CVJA 5E8IA 4UUVA 4OIRF 1DP7P 1QQIA 3C7JA 1TQMA 2O6GE 2MH9A 1ZN2A 2Q2EA 4KIFA 1MGTA 2C6YA 1MKMA 2GIVA 4EM1A 4H0EA 1YW9A 3AAFA 1XGMA 2P5VA 2RV8A 4DNCA 2HTJA 3V8LA 2AS5F 2B0LA 2P4WA 2DPDA 2OU2A 5DEQA 1YG2A 3PQKA 2FSWA 1REPC 5DCMA 2HQRA 3KP5A 1SD5A 3ZMTA 2HDCA 2HZTA 5EEHA 3CJNA 4HDUA 1IUYA 3KCCA 5HS9A 4NQWA 4EVIA 5FLXK 2FMLA 5TRDA 3FHZA 3GFIA 5H6RA 5D5XB 1P92A 3V7CA 4ESBA 2W24A 3QPTA 3RJPA 2BGCA 3HHHA 2OAZA 3KP4A 2XKOA 5BPDA 3WTSC 5CJ9A 3L00A 3RIRA 5E18F 4ZYDA 3GFLA 5HOOA 4Y17A 1CF7B 4HQMA 4L0YB 2ESHA 1T98A 3GW2A 3TO9A 4FX4A 3I53A 3WTTC 1Z9CA 4AVPA 4WWCA 4G94A 2ESNA 3QRFF 2ZMEB 3KP7A 5FB2A 3CO7C 2MBFA 1CGPA 1O3SA 4MQVA 1RI7A 3M1EA 4EV0A 2E1CA 2VBXA 4KYWA 3R61A 4M9XA 3WODF 2V6CA 4BHPA 2XAHA 1L3LA 1DPUA 2VE8A 4KNYA 2GWRA 2RGVA 5EEGA 1SD7A 5AIQA 1R1VA 1G3SA 1ZRCA 2ADUA 4EJTA 4YFNF 4WXCA 5LRSA 4ZYGA 1ZREA 3LA3A 3U2RA 1FSEA 2KJBA 3FZVA 4M72A 5ERIA 3OV8A 4A2UA 4IHSA 1XD7A 1D8JA 2KKOA 4CYDA 1TBXA 1BC8C 3QOPA 3RKXA 1GXQA 3FMRA 5L3DA 1ODDA 2KIUA 4I0BA 1TNTA 1K6OA 1PP8F 1NHAA 3CTAA 1WRJA 3PFIA 1FPQA 3VEPA 1ONVA 4B09A 2PJPA 3T0YA 4MTEA 3DFGA 4KFCA 2DLLA 2A61A 2EV6A 4KT5C 4LMYA 3I58A 3DKWA 3E6BA 3JSOA 4UV9A 3HRUA 4U88A 2PFBA 4QWQA 3MZYA 3H92A 4I7HA 3V7SA 1L0OC 2M87A 2LF7A 3BWGA 2ZO4A 5L3FA 4A6EA 2HGCA 2P6SA 4LB6B 2F5CA 2UZKA 3WE2A 3F21A 3FF5A 4LK0F 3TO6A 2QQAA 1YLFA 3WU0A 3ZPLA 1U5TA 5JFRA 5JI6A 5H6QA 2FE3A 4G6DA 4S05A 2Y75A 4A0ZA 2DK8A 3H3UA 3B02A 1AOYA 1YTYA 4HV6A 3BY6A 4HX8A 1KYZA 3SXYA 2XUBA 2RQPA 4LK1F 2CO5A 3IRRA 3JW4A 2Y0MA 3ML6A 5E1XA 3IHUA 3DF8A 2HR3A 3HOTA 4LG0B 5CYVA 2QZ8A 1HKSA 2IA2A 1R23A 5DYMA 2H27A 3WGIA 4BHBA 3HSRA 4XLNF 1X3UA 3L9FA 4A5MA 1JHFA 4TV7A 3REOA 5D8KB 1QZYA 4GXOA 4HLYA 1I27A 2XAQA 3WG9A 4U7BA 5TJJA 5L3EA 3FM5A 2FBHA 3TDZC 4L5JA 1YIOA 4LJZF 5D8LB 1MZBA 3K1PA 5ICCA 1BM9A 2VODA 3O2PE 5CVRA 2UWMA 1FOKA 4G8XA 2ELHA 3RKYA 1QO0D 2YX7A 2DPUA 2FF4A 4JQFA 2PBIA 2EFWA 1XSDA 3I59A 2JTVA 5F64A 2P6TA 2PMHA 1OYIA 5DCFA 5BMZA 4WXDA 2MLGA 1OMIA 2F5EA 3EETA 5ILVA 4ESJA 2Z99A 4LFUA 3TOAA 2HYGD 5IT3A 1XN7A 4XSZF 1ZLKA 5HVQC 1TLHB 3KEOA 2HTSA 4EQQA 5HDKA 2QENA 2VC0A 4WX9A 2WTEA 2JZYA 2QUFA 3ABTA 3NQOA 4L9JA 2VBWA 3E3VA 5CVUA 4G9YA 3E5XA 2EV5A 3B73A 1ZAOA 1O3QA 3K2ZA 5L3BA 3R60A 4RGSA 2FRHA 1PUEE 1WSUA 1JHHA 3GXOA 1ZG5A 2MLKA 4HYEA 5BS6A 1LJ9A 2GZWA 2CYYA 1QPMA 2MA3A 3RKWA 3QU3A 1LEBA 3N97A 4S04A 4M9SA 2XAJA 2A69F 4CHUA 3MZHA 3KP6A 1V4RA 3CO6C 2IW5A 4BH9A 1J0RA 3I4PA 2VBZA 2OA4A 3GFMA 4RAYA 5HS7A 4O5VA 2IJLA 3GVAA 2JPCA 1B1BA 3VB2A 3EQLF 2OQRA 3CUOA 1R1TA 2GA2A 3ZMDA 3VOEA 3CUQC 4PCQA 4HDVA 2L02A 2FXAA 3KETA 3ZMVA 2ETHA 2V79A 3TGNA 4XLPF 4OIOF 1G6NA 2G7UA 4N9IA 1F1ZA 2IVMA 4KDPA 3WU1B 1W4MA 4OINF 1GXPA 4L9TA 4FT8A 4EJVA 2BYVE 4MQ9F 2DTRA 1Z7UA 4YIFA 2EWNA 2OBPA 2Y48A 3P7NA 2IRFG 3JTGA 5F1RA 3MFKA 2ZFWA 5LBQA 2F5DA 5CLSA 2M5WA 2NRAC 4WF2A 3WGHA 2LNBA 5AONA 2VC1A 4ZYEA 1W7PA 3JSPA 2A68F 4DQ2A 1HKTA 2DQRA 1BI1A 2QVOA 3WE3A 1IN5A 4HAMA 4M6XA 2L54A 4L5IA 3I54A 5DV5A 3F22A 1PP7U 3HRSA 3HRTA 2V1XA 3R0JA 4GO1A 1LVAA 2A6EF 1YFHA 2D45A 1Z6RA 3HRMA 2R7DA 4AIJA 3MQ0A 1KYWA 1PDNC 2IT0A 4GCVA 1RUNA 4RGUA 2O03A 3ULQB 2PG4A 2HQNA 2G7HA 1Y0UA 3JAMZ 1T2KA 2H09A 1SD6A 2OZUA 1G3WA 1E17A 1R5GA 1SFEA 5D6EA 1BC7C 1R1UA 3Q9SA 1HW5A 5D5UB 1LDJA 2GQQA 4HQEA 4IPAA 5A2QK 1XGOA 1RZ4A 3LA7A 1R00A 2HKXA 1XGSA 3DV8A 3F8NA 5ICGA 4I01A 2IA1A 1ZG3A 5FGMA 2GXBA 3L7WA 1WWXA 4N0BA 1JXSA 3M7GA 2VT3A 2YSRA 1U5TC 3GFJA 2QYOA 1KU2A 4MEYF 4RGXA 3LAJA 1S7AA 2KJCA 5LHIA 1FYLA 1DDNA 1KGSA 1FBUA 2E7XA 1ZG1A 2JT1A 4I02A 3RPQA 2P7CB 3TKYA 3EYIA 3ZMZA 5BOXA 1P4XA 2CW0F 3RYRA 1O3RA 1D3YA 3M8EA 1MD0A 4ESFA 4G7ZF 1P6RA 4XSXF 1SMTA 1R5HA 1FBQA 1XSXA 1A04A 1D8KA 1O7FA 3COAC 1MJAA 5J8CA 1ZGAA 2HFHA 2CG4A 3EUHA 3ROUA 2FNAA 2W84A 3SZTA 3RDIA 1FWZA 2STTA 2YR2A 5HS8A 1LDDA 1TW2A 5D5WB 4BAYA 3CLOA 1S29A 2D2WA 1KU9A 2BEOA 1QBJA 3I0TA 3ZMUA 1BN5A 3KLNA 3BDDA 3J80Z 3ERED 3FMSA 1G3TA 4LLGF 2PEXA 3CUQB 2Z3YA 3F8BA 1KQ8A 3ECOA 1RNLA 3LWFA 1WQ2A 3SHFA 1KU7A 1J5YA 4ON0A 1MDMA 1FYMA 1ZHFA 4BYYA 4EMSA 3QAHA 3C18A 5D6FA 4KMUX 5HDNA 1U8RA 1BIAA 2LKPA 3IL2A 4IF4A 4LLLA 1UHMA 4Z2YA 3GWZA 4GGGA 3T8TA 1VTNC 3ECHA 3E5QA 1S6LA 5ICEA 2P5KA 1LNWA 2A3SA 2R3SA 3ISPA 4GYGA 4A0YA 4A12A 4M71A 3P9CA 1H9GA 1STZA 1OR7A 1EH6A 4ENMA 4RS8A 1WI9A 3E6CC 2VN2A 1SAXA 1SFUA 4Q5SF 4KUMA 3N4MA 5E1WA 2XROA 2NAZA 3TOBA 4CDGA 1LEAA 4WK8F 4BNCA 3HOSA 3HUGA 3KP3A 2EK5A 4KICA 6PAXA 1T38A 1B6AA 3F3XA 3MCZA 4YFKF 4HF1A 1K78A 1OPCA 2DT5A 4U0WA 1FY7A 1R22A 1ON1A 1J75A 4U7DA 4A6DA 2KIFA 3WGGA 1P2FA 1BI2A 3M9AA 3F8CA 3E6MA 5IT9K 1LDKB 3GZ5A 2XRNA 3LAPA 2M8EA 4BHCA 1U3EM 2NYXA 4RAZA 2XHKA 1E2XA 3ZP5A 1FBSA 4LB5A 2DU9A 3SFZA 2TDXA 4L9VA 2PLYA 1ZYRF 1HW2A 1C0WA 3FM3A 3KFWX 2DK5A 2ACJA 4I0AA 3VODA 4B8XA 1U5TB 3QPHA 2K4JA 1USTA 2YU3A 5DDGA 2EB7A 3GEZA 1I1SA 4ENNA 1IXSB 1MJ9A 2BE5F 4CZZA 3Q9VA 4GYIA 3E97A 2EV0A 3LFKA 1JE8A 1I1GA 2QLZA 2X0LA 3Q5FA 3U1DA 2L4MA 4I2OA 1IRFA 1BBYA 4PDKA 4OMYA 3DP7A 3C3WA 5J6XA 4UHTA 5DUKA 3QP6A 2CQKA 1XCBA 4M9ZA 3ZQ7A 1T6SA 4M6YA 5JHUA 2M45A 5LRRA 4MTDA 3BP8A 1Z91A 1V3FA 4ZYHA 2X4HA 1GVJA 4R1HA 2M30A 1UFMA 2L01A 1RIOH 1AWCA 2W57A 1KA8A 1LQ1A 2CGPA 4Q48A 4MEXF 3FMQA 3OOPA 1B9NA 4P96A 2WC2A 4IRIA 3D5LA 1K79A 2QBYA 4AIHA 1XMAA 5ILUA 3K1MA 1EV7A 1HSTA 3H3ZA 1QZZA 3V8JA 2MC3A 3GF2A 5K5OA 2OQGA 2GAUA 2JRTA 1LB2A 2EA2A 2DO7A 3ZN1A 3F72A 3QU6A 3SQNA 5H20A 2O61A 1TQIA 3K69A 3BROA 1H9TA 5HLHA 1FSHA 1TTYA 2FBKA 3M8FA 4RGRA 1YW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P9K A;  2HEO A;  2XGX A;  4KN7 X;  1BIB A;  1BI3 A;  1HKQ A;  2DI3 A;  1J59 A;  2R7F A;  4EGZ A;  2O3F A;  1XSV A;  1ZLJ A;  5ILS A;  1I5Z A;  1FT9 A;  2V1D A;  3U9G A;  1IW7 F;  1YS7 A;  4UNO A;  1S3J A;  4WXH A;  2EFO A;  3V4G A;  3PQJ A;  4IHT A;  3VFZ A;  4L0Z B;  1ZH5 A;  1USS A;  3BZ6 A;  4ZZD A;  4XRF A;  4BQA A;  3GZ6 A;  1ZAR A;  3O6B B;  1FP2 A;  2EFQ A;  3MWM A;  3RPU A;  1T0F A;  3DPT A;  1ZRF A;  3G3Z A;  2FEZ A;  2OZ6 A;  4OIP F;  4A0X A;  3L2C A;  2RKH A;  2FA5 A;  3T8R A;  4P55 A;  2O0Y A;  1FLI A;  4RB3 C;  1R7J A;  4HF2 A;  2RNJ A;  4MGR A;  4ENK A;  3S2W A;  4U0V A;  5ICF A;  5K5R A;  4EM2 A;  3P9I A;  2VE9 A;  4IJA A;  2VOP A;  1FZP B;  4N9H A;  2DBB A;  1KQ9 A;  2LDU A;  2P7V B;  1CF7 A;  1YQA A;  4Q47 A;  4O3M A;  4FX0 A;  2FQ3 A;  4ZH4 F;  2AXL A;  2KRF A;  4M73 A;  3GO5 A;  4L18 B;  2K86 A;  3IC7 A;  5FFZ A;  2DAO A;  2XIG A;  3R6S A;  3F6V A;  2LSO A;  1DUX C;  1EH7 A;  2PN6 A;  2WV0 A;  2IPQ X;  1IN4 A;  2ZME A;  2O8X A;  2HS5 A;  3F8M A;  4PGG A;  2UXN A;  4R8H A;  5DUI A;  2K27 A;  1F5T A;  4A5N A;  2RN7 A;  1S7O A;  2CSO A;  1WKM A;  2ISZ A;  2H94 A;  1W7P B;  3BPV A;  2NNY A;  2VON A;  4RB0 A;  1IZ1 A;  4OOI A;  4AD9 A;  1ON2 A;  3K9T A;  1Z05 A;  1D5V A;  4G6Q A;  4YFX F;  3CUQ A;  4RB2 C;  1GHC A;  3SZP A;  3WTX C;  2CFX A;  3IKT A;  3IWF A;  1YW7 A;  4HV5 A;  5L3G A;  4EGY A;  1U2W A;  4P9U A;  5HLG A;  1QGP A;  1KQ0 A;  2VT2 A;  1H0M A;  3EYY A;  4PZJ A;  1HBX G;  5LEJ A;  3GUD A;  2V9V A;  2K4B A;  3IRQ A;  5DCM B;  4RB1 A;  1UCR A;  3J81 Z;  2WWY A;  3EDP A;  2EA4 A;  2STW A;  4MHG A;  4U0Y A;  2FMY A;  3T5X A;  3V8K A;  3R4K A;  5BQT A;  2OD5 A;  1IXR C;  2Q8K A;  4KIG A;  3QP5 A;  2VXZ A;  1J2X A;  2HOE A;  4ZZL A;  1B4A A;  1ZRD A;  2J5O A;  4ENJ A;  2HYF A;  2PQ8 A;  3LA2 A;  2W85 A;  3BPX A;  5E1Z B;  2GXG A;  4LLN A;  5F6F A;  4OMZ A;  3LST A;  5K5Q A;  5LEK A;  4YG2 F;  5JR3 A;  1IN8 A;  5HDG A;  1F4K A;  3FX3 A;  1IF1 A;  2VOO A;  4LGW A;  2P5L C;  1IXC A;  3KZZ A;  2LF8 A;  2CWE A;  1B9M A;  1BOA A;  4UV8 A;  3DEU A;  4PGH A;  2QM3 A;  2D1V A;  1T39 A;  1FYK A;  1TQP A;  1J7K A;  3I71 A;  2JSC A;  1IAW A;  4BXU A;  1W5T A;  2COM A;  4LG0 A;  1HXD A;  1XDU A;  5FLX Z;  5A2Q Z;  1EH8 A;  1G3Y A;  3FWE A;  5LGU A;  4MNU A;  2D1H A;  1UHW A;  5E8G A;  2KIM A;  4L9N A;  3WTV C;  5LHH A;  3NEU A;  4M74 A;  2ZBK A;  4YII A;  3F6O A;  2DFI A;  1IRG A;  4WCG A;  4EJW A;  4G7H F;  3HYI A;  1Z6T A;  1P4A A;  1U6G A;  3NRV A;  2P8T A;  2ZCW A;  3CDH A;  1SMY F;  4HX7 A;  2L3D A;  2H6C A;  5AIP A;  4CXF A;  4KMF A;  4NHJ A;  2J5P A;  2QQ9 A;  1YYV A;  3KLO A;  4UVA A;  4CGZ A;  1MDM B;  3HTS B;  3WTZ A;  4XBF A;  4D0P A;  5D4S A;  2IA0 A;  4CO8 A;  2NNN A;  1IN6 A;  2V1U A;  5DD4 A;  5KVR A;  4UVB A;  1OYY A;  2ISY A;  4ASN A;  4KA4 A;  3KZY A;  4R79 A;  2E1N A;  3E6D A;  4P9F A;  3GYH X;  3RI4 A;  3DXJ F;  2XV4 S;  3TO7 A;  1HSJ A;  3C1D A;  4HW0 A;  2K7L A;  3WTU C;  3IWZ A;  5FO5 A;  1W5S A;  2W25 A;  1OKR A;  3LQQ A;  1J9I A;  5L3C A;  1SD4 A;  1JGS A;  4I09 A;  2FOK A;  3ZN0 A;  4CIC A;  2BV6 A;  3KP2 A;  2XAS A;  4G7O F;  3DQV C;  3G73 A;  2YPR A;  2PI0 A;  2FBI A;  2EFP A;  3BOQ A;  3V7R A;  2UXX A;  3HSF A;  3LQR A;  1TNS A;  1XCV A;  1Z1D A;  2VBY A;  5K1Y A;  3MAJ A;  2FNP A;  1XMK A;  1MJB A;  4HF0 A;  1RUO A;  4KIB A;  2MD5 A;  4HX4 A;  5HLI A;  2DQL A;  1XDS A;  4EJU A;  2NS0 A;  4ETS A;  1O3T A;  2FU4 A;  1K78 B;  3I5U A;  1XGN A;  1YO5 C;  3ABU A;  2JPB A;  3RYP A;  3FXR A;  3TDU C;  1KU3 A;  5J8F A;  1O57 A;  1FNN A;  1IN7 A;  5LGT A;  3BJA A;  2ZNZ A;  4HBL A;  3K0L A;  2PMU A;  3D0S A;  5D4R A;  4IRH A;  1ULY A;  4IVN A;  1S8N A;  4JBA A;  1F9N A;  3RTR A;  3BJO A;  2QQB A;  3IKV A;  3JTH A;  1OYW A;  1G4D A;  5DD8 A;  3BJ6 A;  3HTU A;  3WTY C;  1R36 A;  1ZGJ A;  4Y13 A;  3KEQ A;  2A5Y B;  3I64 A;  2F5F A;  1O7L A;  3HIF A;  5JVT A;  4QLC U;  1YS6 A;  1Q1H A;  2XAG A;  1W7P D;  2EJR A;  4F7Z A;  2L4A A;  2IP2 A;  1U78 A;  4I98 B;  3GX4 X;  3L09 A;  4HZF A;  1B59 A;  5BPI A;  1FX7 A;  3DPL C;  2A07 F;  1P4W A;  2XAF A;  2RDP A;  3JAM K;  3I59 B;  3KE2 A;  2Q0O A;  2YX4 A;  4Q4Z F;  1HQC A;  4AIK A;  1I6X A;  2ZKZ A;  4E70 A;  4HOB A;  3E5U A;  4HLX A;  1FP1 D;  3ZMS A;  2MH2 A;  5E17 F;  1R58 A;  2HKO A;  3FXU A;  5E20 A;  4UXN A;  3W6J B;  5IT9 Z;  5FD5 A;  5LGN A;  4KN4 X;  3T1B A;  3MEX A;  1K7A A;  4OIQ F;  3K1N A;  4Y15 A;  2Z9O A;  5D5V B;  4AWX B;  4HA8 A;  1UB9 A;  2XKP A;  3J7A O;  3TQN A;  2RC4 A;  2Z33 A;  2DW4 A;  1QNT A;  2XVC A;  4JK1 X;  2BBY A;  2F2E A;  5ED4 A;  5FD6 A;  3HHG A;  2H6B A;  5KK1 A;  5FFX A;  1HW1 A;  1SFX A;  2K02 A;  2QBY B;  5CVV A;  3F23 A;  5CVI A;  3WTW C;  3R0A A;  4NB5 A;  4EM0 B;  2A6H F;  2GA1 A;  2ZNY A;  5LLQ A;  3F8F A;  2RVC A;  2G9W A;  1BJA A;  1BI0 A;  5LHG A;  4O6J A;  4UVC A;  4OU0 A;  3J81 K;  3O3K A;  4IXA A;  4P5O A;  2Z5U A;  1TW3 A;  4FHT A;  1DPR A;  4EJO A;  4K2E A;  2ZJ2 A;  1XB4 A;  3ELK A;  4LD5 A;  2QWW A;  3FXQ A;  3GLX A;  3HSE A;  2E7W A;  2EFN A;  2M1B A;  2HWV A;  3W6K B;  1FC3 A;  3J80 K;  4IRG A;  2ZXJ A;  5CVJ A;  5E8I A;  4UUV A;  4OIR F;  1DP7 P;  1QQI A;  3C7J A;  1TQM A;  2O6G E;  2MH9 A;  1ZN2 A;  2Q2E A;  4KIF A;  1MGT A;  2C6Y A;  1MKM A;  2GIV A;  4EM1 A;  4H0E A;  1YW9 A;  3AAF A;  1XGM A;  2P5V A;  2RV8 A;  4DNC A;  2HTJ A;  3V8L A;  2AS5 F;  2B0L A;  2P4W A;  2DPD A;  2OU2 A;  5DEQ A;  1YG2 A;  3PQK A;  2FSW A;  1REP C;  5DCM A;  2HQR A;  3KP5 A;  1SD5 A;  3ZMT A;  2HDC A;  2HZT A;  5EEH A;  3CJN A;  4HDU A;  1IUY A;  3KCC A;  5HS9 A;  4NQW A;  4EVI A;  5FLX K;  2FML A;  5TRD A;  3FHZ A;  3GFI A;  5H6R A;  5D5X B;  1P92 A;  3V7C A;  4ESB A;  2W24 A;  3QPT A;  3RJP A;  2BGC A;  3HHH A;  2OAZ A;  3KP4 A;  2XKO A;  5BPD A;  3WTS C;  5CJ9 A;  3L00 A;  3RIR A;  5E18 F;  4ZYD A;  3GFL A;  5HOO A;  4Y17 A;  1CF7 B;  4HQM A;  4L0Y B;  2ESH A;  1T98 A;  3GW2 A;  3TO9 A;  4FX4 A;  3I53 A;  3WTT C;  1Z9C A;  4AVP A;  4WWC A;  4G94 A;  2ESN A;  3QRF F;  2ZME B;  3KP7 A;  5FB2 A;  3CO7 C;  2MBF A;  1CGP A;  1O3S A;  4MQV A;  1RI7 A;  3M1E A;  4EV0 A;  2E1C A;  2VBX A;  4KYW A;  3R61 A;  4M9X A;  3WOD F;  2V6C A;  4BHP A;  2XAH A;  1L3L A;  1DPU A;  2VE8 A;  4KNY A;  2GWR A;  2RGV A;  5EEG A;  1SD7 A;  5AIQ A;  1R1V A;  1G3S A;  1ZRC A;  2ADU A;  4EJT A;  4YFN F;  4WXC A;  5LRS A;  4ZYG A;  1ZRE A;  3LA3 A;  3U2R A;  1FSE A;  2KJB A;  3FZV A;  4M72 A;  5ERI A;  3OV8 A;  4A2U A;  4IHS A;  1XD7 A;  1D8J A;  2KKO A;  4CYD A;  1TBX A;  1BC8 C;  3QOP A;  3RKX A;  1GXQ A;  3FMR A;  5L3D A;  1ODD A;  2KIU A;  4I0B A;  1TNT A;  1K6O A;  1PP8 F;  1NHA A;  3CTA A;  1WRJ A;  3PFI A;  1FPQ A;  3VEP A;  1ONV A;  4B09 A;  2PJP A;  3T0Y A;  4MTE A;  3DFG A;  4KFC A;  2DLL A;  2A61 A;  2EV6 A;  4KT5 C;  4LMY A;  3I58 A;  3DKW A;  3E6B A;  3JSO A;  4UV9 A;  3HRU A;  4U88 A;  2PFB A;  4QWQ A;  3MZY A;  3H92 A;  4I7H A;  3V7S A;  1L0O C;  2M87 A;  2LF7 A;  3BWG A;  2ZO4 A;  5L3F A;  4A6E A;  2HGC A;  2P6S A;  4LB6 B;  2F5C A;  2UZK A;  3WE2 A;  3F21 A;  3FF5 A;  4LK0 F;  3TO6 A;  2QQA A;  1YLF A;  3WU0 A;  3ZPL A;  1U5T A;  5JFR A;  5JI6 A;  5H6Q A;  2FE3 A;  4G6D A;  4S05 A;  2Y75 A;  4A0Z A;  2DK8 A;  3H3U A;  3B02 A;  1AOY A;  1YTY A;  4HV6 A;  3BY6 A;  4HX8 A;  1KYZ A;  3SXY A;  2XUB A;  2RQP A;  4LK1 F;  2CO5 A;  3IRR A;  3JW4 A;  2Y0M A;  3ML6 A;  5E1X A;  3IHU A;  3DF8 A;  2HR3 A;  3HOT A;  4LG0 B;  5CYV A;  2QZ8 A;  1HKS A;  2IA2 A;  1R23 A;  5DYM A;  2H27 A;  3WGI A;  4BHB A;  3HSR A;  4XLN F;  1X3U A;  3L9F A;  4A5M A;  1JHF A;  4TV7 A;  3REO A;  5D8K B;  1QZY A;  4GXO A;  4HLY A;  1I27 A;  2XAQ A;  3WG9 A;  4U7B A;  5TJJ A;  5L3E A;  3FM5 A;  2FBH A;  3TDZ C;  4L5J A;  1YIO A;  4LJZ F;  5D8L B;  1MZB A;  3K1P A;  5ICC A;  1BM9 A;  2VOD A;  3O2P E;  5CVR A;  2UWM A;  1FOK A;  4G8X A;  2ELH A;  3RKY A;  1QO0 D;  2YX7 A;  2DPU A;  2FF4 A;  4JQF A;  2PBI A;  2EFW A;  1XSD A;  3I59 A;  2JTV A;  5F64 A;  2P6T A;  2PMH A;  1OYI A;  5DCF A;  5BMZ A;  4WXD A;  2MLG A;  1OMI A;  2F5E A;  3EET A;  5ILV A;  4ESJ A;  2Z99 A;  4LFU A;  3TOA A;  2HYG D;  5IT3 A;  1XN7 A;  4XSZ F;  1ZLK A;  5HVQ C;  1TLH B;  3KEO A;  2HTS A;  4EQQ A;  5HDK A;  2QEN A;  2VC0 A;  4WX9 A;  2WTE A;  2JZY A;  2QUF A;  3ABT A;  3NQO A;  4L9J A;  2VBW A;  3E3V A;  5CVU A;  4G9Y A;  3E5X A;  2EV5 A;  3B73 A;  1ZAO A;  1O3Q A;  3K2Z A;  5L3B A;  3R60 A;  4RGS A;  2FRH A;  1PUE E;  1WSU A;  1JHH A;  3GXO A;  1ZG5 A;  2MLK A;  4HYE A;  5BS6 A;  1LJ9 A;  2GZW A;  2CYY A;  1QPM A;  2MA3 A;  3RKW A;  3QU3 A;  1LEB A;  3N97 A;  4S04 A;  4M9S A;  2XAJ A;  2A69 F;  4CHU A;  3MZH A;  3KP6 A;  1V4R A;  3CO6 C;  2IW5 A;  4BH9 A;  1J0R A;  3I4P A;  2VBZ A;  2OA4 A;  3GFM A;  4RAY A;  5HS7 A;  4O5V A;  2IJL A;  3GVA A;  2JPC A;  1B1B A;  3VB2 A;  3EQL F;  2OQR A;  3CUO A;  1R1T A;  2GA2 A;  3ZMD A;  3VOE A;  3CUQ C;  4PCQ A;  4HDV A;  2L02 A;  2FXA A;  3KET A;  3ZMV A;  2ETH A;  2V79 A;  3TGN A;  4XLP F;  4OIO F;  1G6N A;  2G7U A;  4N9I A;  1F1Z A;  2IVM A;  4KDP A;  3WU1 B;  1W4M A;  4OIN F;  1GXP A;  4L9T A;  4FT8 A;  4EJV A;  2BYV E;  4MQ9 F;  2DTR A;  1Z7U A;  4YIF A;  2EWN A;  2OBP A;  2Y48 A;  3P7N A;  2IRF G;  3JTG A;  5F1R A;  3MFK A;  2ZFW A;  5LBQ A;  2F5D A;  5CLS A;  2M5W A;  2NRA C;  4WF2 A;  3WGH A;  2LNB A;  5AON A;  2VC1 A;  4ZYE A;  1W7P A;  3JSP A;  2A68 F;  4DQ2 A;  1HKT A;  2DQR A;  1BI1 A;  2QVO A;  3WE3 A;  1IN5 A;  4HAM A;  4M6X A;  2L54 A;  4L5I A;  3I54 A;  5DV5 A;  3F22 A;  1PP7 U;  3HRS A;  3HRT A;  2V1X A;  3R0J A;  4GO1 A;  1LVA A;  2A6E F;  1YFH A;  2D45 A;  1Z6R A;  3HRM A;  2R7D A;  4AIJ A;  3MQ0 A;  1KYW A;  1PDN C;  2IT0 A;  4GCV A;  1RUN A;  4RGU A;  2O03 A;  3ULQ B;  2PG4 A;  2HQN A;  2G7H A;  1Y0U A;  3JAM Z;  1T2K A;  2H09 A;  1SD6 A;  2OZU A;  1G3W A;  1E17 A;  1R5G A;  1SFE A;  5D6E A;  1BC7 C;  1R1U A;  3Q9S A;  1HW5 A;  5D5U B;  1LDJ A;  2GQQ A;  4HQE A;  4IPA A;  5A2Q K;  1XGO A;  1RZ4 A;  3LA7 A;  1R00 A;  2HKX A;  1XGS A;  3DV8 A;  3F8N A;  5ICG A;  4I01 A;  2IA1 A;  1ZG3 A;  5FGM A;  2GXB A;  3L7W A;  1WWX A;  4N0B A;  1JXS A;  3M7G A;  2VT3 A;  2YSR A;  1U5T C;  3GFJ A;  2QYO A;  1KU2 A;  4MEY F;  4RGX A;  3LAJ A;  1S7A A;  2KJC A;  5LHI A;  1FYL A;  1DDN A;  1KGS A;  1FBU A;  2E7X A;  1ZG1 A;  2JT1 A;  4I02 A;  3RPQ A;  2P7C B;  3TKY A;  3EYI A;  3ZMZ A;  5BOX A;  1P4X A;  2CW0 F;  3RYR A;  1O3R A;  1D3Y A;  3M8E A;  1MD0 A;  4ESF A;  4G7Z F;  1P6R A;  4XSX F;  1SMT A;  1R5H A;  1FBQ A;  1XSX A;  1A04 A;  1D8K A;  1O7F A;  3COA C;  1MJA A;  5J8C A;  1ZGA A;  2HFH A;  2CG4 A;  3EUH A;  3ROU A;  2FNA A;  2W84 A;  3SZT A;  3RDI A;  1FWZ A;  2STT A;  2YR2 A;  5HS8 A;  1LDD A;  1TW2 A;  5D5W B;  4BAY A;  3CLO A;  1S29 A;  2D2W A;  1KU9 A;  2BEO A;  1QBJ A;  3I0T A;  3ZMU A;  1BN5 A;  3KLN A;  3BDD A;  3J80 Z;  3ERE D;  3FMS A;  1G3T A;  4LLG F;  2PEX A;  3CUQ B;  2Z3Y A;  3F8B A;  1KQ8 A;  3ECO A;  1RNL A;  3LWF A;  1WQ2 A;  3SHF A;  1KU7 A;  1J5Y A;  4ON0 A;  1MDM A;  1FYM A;  1ZHF A;  4BYY A;  4EMS A;  3QAH A;  3C18 A;  5D6F A;  4KMU X;  5HDN A;  1U8R A;  1BIA A;  2LKP A;  3IL2 A;  4IF4 A;  4LLL A;  1UHM A;  4Z2Y A;  3GWZ A;  4GGG A;  3T8T A;  1VTN C;  3ECH A;  3E5Q A;  1S6L A;  5ICE A;  2P5K A;  1LNW A;  2A3S A;  2R3S A;  3ISP A;  4GYG A;  4A0Y A;  4A12 A;  4M71 A;  3P9C A;  1H9G A;  1STZ A;  1OR7 A;  1EH6 A;  4ENM A;  4RS8 A;  1WI9 A;  3E6C C;  2VN2 A;  1SAX A;  1SFU A;  4Q5S F;  4KUM A;  3N4M A;  5E1W A;  2XRO A;  2NAZ A;  3TOB A;  4CDG A;  1LEA A;  4WK8 F;  4BNC A;  3HOS A;  3HUG A;  3KP3 A;  2EK5 A;  4KIC A;  6PAX A;  1T38 A;  1B6A A;  3F3X A;  3MCZ A;  4YFK F;  4HF1 A;  1K78 A;  1OPC A;  2DT5 A;  4U0W A;  1FY7 A;  1R22 A;  1ON1 A;  1J75 A;  4U7D A;  4A6D A;  2KIF A;  3WGG A;  1P2F A;  1BI2 A;  3M9A A;  3F8C A;  3E6M A;  5IT9 K;  1LDK B;  3GZ5 A;  2XRN A;  3LAP A;  2M8E A;  4BHC A;  1U3E M;  2NYX A;  4RAZ A;  2XHK A;  1E2X A;  3ZP5 A;  1FBS A;  4LB5 A;  2DU9 A;  3SFZ A;  2TDX A;  4L9V A;  2PLY A;  1ZYR F;  1HW2 A;  1C0W A;  3FM3 A;  3KFW X;  2DK5 A;  2ACJ A;  4I0A A;  3VOD A;  4B8X A;  1U5T B;  3QPH A;  2K4J A;  1UST A;  2YU3 A;  5DDG A;  2EB7 A;  3GEZ A;  1I1S A;  4ENN A;  1IXS B;  1MJ9 A;  2BE5 F;  4CZZ A;  3Q9V A;  4GYI A;  3E97 A;  2EV0 A;  3LFK A;  1JE8 A;  1I1G A;  2QLZ A;  2X0L A;  3Q5F A;  3U1D A;  2L4M A;  4I2O A;  1IRF A;  1BBY A;  4PDK A;  4OMY A;  3DP7 A;  3C3W A;  5J6X A;  4UHT A;  5DUK A;  3QP6 A;  2CQK A;  1XCB A;  4M9Z A;  3ZQ7 A;  1T6S A;  4M6Y A;  5JHU A;  2M45 A;  5LRR A;  4MTD A;  3BP8 A;  1Z91 A;  1V3F A;  4ZYH A;  2X4H A;  1GVJ A;  4R1H A;  2M30 A;  1UFM A;  2L01 A;  1RIO H;  1AWC A;  2W57 A;  1KA8 A;  1LQ1 A;  2CGP A;  4Q48 A;  4MEX F;  3FMQ A;  3OOP A;  1B9N A;  4P96 A;  2WC2 A;  4IRI A;  3D5L A;  1K79 A;  2QBY A;  4AIH A;  1XMA A;  5ILU A;  3K1M A;  1EV7 A;  1HST A;  3H3Z A;  1QZZ A;  3V8J A;  2MC3 A;  3GF2 A;  5K5O A;  2OQG A;  2GAU A;  2JRT A;  1LB2 A;  2EA2 A;  2DO7 A;  3ZN1 A;  3F72 A;  3QU6 A;  3SQN A;  5H20 A;  2O61 A;  1TQI A;  3K69 A;  3BRO A;  1H9T A;  5HLH A;  1FSH A;  1TTY A;  2FBK A;  3M8F A;  4RGR A;  1YW8 A; 
#chains in the Genus database with same CATH topology
 3P9K A;  4BBS J;  2HEO A;  1X1C A;  2M8G X;  2XGX A;  2QGU A;  2LKX A;  4KN7 X;  1BIB A;  1BI3 A;  4DYC A;  5FKN A;  1HKQ A;  3KYD B;  1WHU A;  1YE9 A;  5EZG A;  2DI3 A;  1Y8R B;  3TW6 A;  4H4K C;  1SEU A;  1B72 A;  3OYA A;  1J59 A;  2R7F A;  3GTO J;  2MAB A;  4EGZ A;  2O3F A;  1XSV A;  2DTZ A;  2E35 A;  1ZLJ A;  5ILS A;  1I5Z A;  2KMU A;  1UEL B;  1FT9 A;  1T08 B;  4ANJ A;  4PJM A;  1FJL A;  2KL4 A;  2DXI A;  2V1D A;  2I8D A;  3U9G A;  1IW7 F;  1YS7 A;  1IDZ A;  5KAI C;  3AG1 H;  4UNO A;  5FLV A;  1LVK A;  1S3J A;  2ECB A;  1LFB A;  2HQA A;  2K85 A;  2EFO A;  3BR6 A;  4WXH A;  3S1N J;  2XRL A;  3OL3 A;  3V4G A;  2L9V A;  1UAA A;  3KYL A;  4FET A;  1ZKG A;  3PQJ A;  4IHT A;  3RQ4 A;  3VFZ A;  2CW7 A;  2KIS A;  1USS A;  4L0Z B;  1ZH5 A;  3CP2 A;  2ELK A;  4C30 A;  3BZ6 A;  2V9K A;  1LFU P;  2RRE A;  3PIO F;  3S3N A;  4ZZD A;  4XRF A;  1VQP I;  1RR7 A;  4BQA A;  3GZ6 A;  1ZAR A;  3O6B B;  1FP2 A;  1GUU A;  2EFQ A;  3MWM A;  3RPU A;  1Y1W J;  4D1Q A;  4E7H A;  2ELJ A;  1T0F A;  4Y33 A;  3DPT A;  3EUH C;  4DIQ A;  1ZRF A;  2L0K A;  3G3Z A;  1ETQ A;  4N4N B;  2IS2 A;  4FQG A;  1E3O C;  2FEZ A;  2JRM A;  2OZ6 A;  4OIP F;  1P7I A;  4A0X A;  2X1E A;  3L2C A;  2RKH A;  2FA5 A;  3JRA A;  3CCL I;  4II2 A;  2CFO A;  3T8R A;  4P55 A;  3H35 A;  3JR9 A;  2O0Y A;  3IUO A;  1FLI A;  4RB3 C;  5M5X J;  2NVT J;  2YS9 A;  1R7J A;  4HF2 A;  2RNJ A;  4MGR A;  3L2Q A;  4XRS A;  3RZD J;  2H1K A;  4RAG A;  3TBI A;  3TL4 X;  5IYC J;  1YRN A;  4ENK A;  3S2W A;  1JKQ C;  4U0V A;  5JHF A;  3OSF A;  5C4X J;  5ICF A;  2HPM A;  5K5R A;  2E2J J;  4EM2 A;  2BXZ A;  3P9I A;  1R6R A;  2VE9 A;  4IJA A;  2M0M A;  3TP0 A;  4QPO A;  2VOP A;  2HVQ A;  1FZP B;  4N9H A;  3A1Y A;  4PSW A;  2DBB A;  1KQ9 A;  2LDU A;  2P7V B;  1CF7 A;  4RA2 A;  1YQA A;  4XKW A;  1JGG A;  1OCO H;  4Q47 A;  5B3S H;  4O3M A;  3FXO A;  1V5G A;  2DYR H;  2FQ3 A;  4FX0 A;  2LYC A;  3LSK A;  4ZH4 F;  2AXL A;  2KRF A;  4M73 A;  1G2H A;  1WJB A;  2NS8 A;  3GO5 A;  4DBR A;  1W0U A;  2K86 A;  3IC7 A;  5FFZ A;  4L18 B;  5H2F C;  2DAO A;  2XIG A;  3R6S A;  3VYU B;  3F6V A;  2OUM A;  2LSO A;  1DUX C;  1FMW A;  3EUA A;  4CYC A;  1EH7 A;  2ZXH A;  1Y1V J;  2PN6 A;  4M3B A;  2WV0 A;  4QPQ A;  4S0H B;  2IPQ X;  1IN4 A;  2MC4 A;  2OF7 A;  2BW3 A;  2ZME A;  2O8X A;  3UNG C;  2Y9Z A;  3OYF A;  1R49 A;  2E36 A;  3S14 J;  2Y9Y A;  3S1R J;  2HS5 A;  3LOC A;  3A0B C;  1DU0 A;  3MZ8 A;  2Y31 A;  3BLY A;  4HEA 2;  3F8M A;  2WAD A;  4PGG A;  2UXN A;  4R8H A;  5DUI A;  2K27 A;  1F5T A;  2XB5 A;  2RN7 A;  2BVL A;  4A5N A;  1S7O A;  4UY8 I;  3KZI C;  3LSH A;  3CF2 A;  2CSO A;  1WKM A;  2KDO A;  2ISZ A;  1N78 A;  1OR7 C;  3F0C A;  3BCA A;  2H94 A;  2IGM A;  5EYR A;  3CMM A;  1W7P B;  3BPV A;  2NNY A;  2VON A;  4RB0 A;  1R5I D;  4BJ5 C;  1IZ1 A;  4OOI A;  4AD9 A;  2DYS H;  3CC2 I;  3S1Q J;  2VB6 A;  4ZC3 A;  1LE8 B;  1ON2 A;  1G8X A;  2Q2E B;  3K9T A;  2CUF A;  1V55 H;  1Z05 A;  1XS9 A;  1D5V A;  1W1W E;  2BZT A;  4G6Q A;  4YFX F;  4FIS A;  3CUQ A;  2LY2 A;  5E3L A;  5EGO B;  4B3X A;  3SZP A;  4RB2 C;  3WTX C;  4M3D A;  1JT0 A;  1GHC A;  2CFX A;  2X1D A;  4IEJ A;  2JVG A;  1IG7 A;  2M0C A;  3IKT A;  3IWF A;  3EPZ A;  1YW7 A;  4HV5 A;  4PFP A;  3UR3 C;  5L3G A;  1U2W A;  4P9U A;  5HLG A;  4EGY A;  1QGP A;  1KQ0 A;  4XRM A;  1X19 A;  2VT2 A;  5EDN A;  3S2H J;  1H0M A;  2F4I A;  3EYY A;  4PZJ A;  1VQ5 I;  1HBX G;  4E7S A;  5LEJ A;  5CQE A;  3GUD A;  2OV7 A;  2V9V A;  2K4B A;  3IRQ A;  4ZTJ A;  5DCM B;  2L2O A;  1MMD A;  4RB1 A;  3I4M J;  4Y52 J;  1UCR A;  3J81 Z;  3PFY A;  2WWY A;  3EDP A;  2EA4 A;  2EZK A;  3JRH A;  1VI0 A;  2STW A;  1EKE A;  4XNF A;  4MHG A;  2XSD C;  1W5C C;  4U0Y A;  2TRT A;  4NQW B;  2FMY A;  3T5X A;  1ZEL A;  3V8K A;  1HOM A;  3R4K A;  5BQT A;  1S7E A;  2OD5 A;  1IXR C;  2X6W A;  5J40 A;  2KDZ A;  3K4M A;  3M8J A;  3PIP F;  2Q8K A;  4KIG A;  3TED A;  4BQQ A;  3QP5 A;  2VXZ A;  1ETV A;  3LAJ A;  1J2X A;  1X1B A;  2HOE A;  4ZZL A;  2NOJ B;  3OYJ A;  1B4A A;  1JUP A;  1ZRD A;  2J5O A;  3HOZ J;  4ENJ A;  2HYF A;  4BBR J;  4ZDL A;  1X1P A;  2PQ8 A;  3LA2 A;  3PUB A;  5KAF C;  2VPR A;  2W85 A;  2E19 A;  3BPX A;  3CLQ A;  5E1Z B;  2JA7 J;  2GXG A;  4LLN A;  5F6F A;  2R7V A;  4OMZ A;  3LMM A;  3BG3 A;  3LST A;  5K5Q A;  2FOW A;  4D5C A;  5LEK A;  1MBE A;  4YG2 F;  4RDU A;  5JR3 A;  2DA1 A;  3FK7 A;  2DMT A;  1IGN A;  1IN8 A;  2L7K A;  5HDG A;  1F4K A;  2QSH X;  3FXK A;  3FX3 A;  1IF1 A;  2VOO A;  4LGW A;  2P5L C;  1IXC A;  3CCR I;  1TP4 A;  3KZZ A;  3AL0 C;  2LF8 A;  4XOT A;  4AU7 A;  3HB9 A;  1RR8 C;  1ETO A;  2CWE A;  1B9M A;  3GZN B;  4E7J A;  3KX2 A;  4U87 A;  1D1A A;  1FEX A;  1BOA A;  1UJ8 A;  1WJA A;  4UV8 A;  3DEU A;  4PGH A;  3HGY A;  1MH3 A;  2QM3 A;  2D1V A;  2NOG A;  1T39 A;  1FYK A;  3PUF A;  1TQP A;  1J7K A;  4XLE A;  3I71 A;  3ESW B;  2JSC A;  1IAW A;  1I39 A;  4BXU A;  1W5T A;  2COM A;  3GME A;  2DA3 A;  3MD2 A;  1HXD A;  1XDU A;  4LG0 A;  5FLX Z;  2VL8 A;  5A2Q Z;  5J4V A;  1MND A;  1EH8 A;  3H5R A;  1G3Y A;  3FWE A;  3NAR A;  5LGU A;  3BG9 A;  4MNU A;  3G2B A;  3BT9 A;  1XPX A;  2D1H A;  3HGG A;  1QRY A;  2EPF A;  1UHW A;  5E8G A;  1P9Q C;  1JTY A;  2PJR B;  2KIM A;  4L9N A;  3WTV C;  5LHH A;  3NEU A;  4M74 A;  4Z6Y A;  2ZBK A;  4YII A;  5B1B H;  1ETW A;  4V2F A;  4IZZ A;  3F6O A;  1UZC A;  4M3F A;  3HM5 A;  2DFI A;  3HJE A;  1IRG A;  2W82 A;  4B43 A;  3VWB A;  1RES A;  4WCG A;  4EJW A;  4G7H F;  3HYI A;  1GLN A;  1Z6T A;  2XC7 A;  1H89 C;  2CV2 A;  1P4A A;  1U6G A;  3NRV A;  5B5E C;  2R7R A;  2P8T A;  2ZCW A;  3CDH A;  1SMY F;  4HX7 A;  2L3D A;  2H6C A;  5AIP A;  4CXF A;  5C44 J;  4XIC A;  1YJ9 I;  4KMF A;  4NHJ A;  2J5P A;  1ZGW A;  3W2W A;  2JA6 J;  2QQ9 A;  2X6X A;  1RPW A;  1YYV A;  2MFZ A;  3KLO A;  4UVA A;  2Y69 H;  4CGZ A;  2JUC A;  1MDM B;  3HTS B;  3KPH A;  3WTZ A;  4XBF A;  2W48 A;  4B3A A;  5IOY A;  5IP6 A;  3K4B A;  4D0P A;  5D4S A;  2IA0 A;  4L5E A;  4CO8 A;  1OCZ H;  2NNN A;  1IN6 A;  1VND A;  2V1U A;  4A3M J;  5DD4 A;  2L9S A;  5KVR A;  4M3E A;  4UVB A;  3Q3S A;  1NTC A;  1OYY A;  2ISY A;  4ASN A;  3G71 I;  5JVG F;  3PNV A;  4KA4 A;  2LG4 A;  4IQ4 A;  4E4H A;  1VQ7 I;  3KZY A;  3I9V 2;  3K4N A;  4AYB N;  3IAM 2;  1MNE A;  1XC5 A;  4R79 A;  4IHX A;  4A3C J;  2KP6 A;  4UUS A;  2E1N A;  1TWF J;  2JA8 J;  1XX5 A;  3E6D A;  1WCM J;  3PJR A;  4P9F A;  3GYH X;  3TO7 A;  3DXJ F;  2XV4 S;  5F0F A;  3ZOB A;  1HSJ A;  3RI4 A;  1FIA A;  2KQR A;  3C1D A;  4BUP A;  4HW0 A;  2K7L A;  3WTU C;  2R5Z A;  1R9T J;  1UHS A;  3IWZ A;  1E0E A;  3BC8 A;  3G1L A;  5FO5 A;  1TL8 A;  1W5S A;  2W25 A;  3Q0U A;  4IHV A;  3QWL A;  4FE7 A;  1OKR A;  3LQQ A;  1J9I A;  5L3C A;  1SD4 A;  1JGS A;  4I09 A;  3M07 A;  2R7U A;  2AQF A;  2FOK A;  2K5C A;  3L2V A;  1J09 A;  4IQJ A;  5IYB J;  2W1O A;  3ZN0 A;  2VLA A;  3IH4 A;  4CIC A;  4XN0 A;  2BV6 A;  1V5E A;  1SAU A;  3KP2 A;  4PJN A;  2D5V A;  2XAS A;  4G7O F;  3DQV C;  3G73 A;  2YPR A;  1B8I A;  3RQI A;  4RLQ A;  4D5F A;  2B9S A;  2PI0 A;  2NVX J;  2FBI A;  2EFP A;  1RKW A;  3BOQ A;  3LFU A;  3V7R A;  2UXX A;  3HSF A;  5TIS C;  5M5Y J;  3DTI A;  3LQR A;  1TNS A;  1XCV A;  1Z1D A;  2VBY A;  5K1Y A;  3MAJ A;  1MMN A;  2VKE A;  2FNP A;  1XMK A;  2L7Z A;  3BG5 A;  3CCS I;  1MJB A;  2O7O A;  4HF0 A;  1RUO A;  1X4P A;  3HUG B;  4KIB A;  1T0F C;  2MD5 A;  2ZB9 A;  1WJ5 A;  4HX4 A;  5HLI A;  2DQL A;  1XDS A;  4EJU A;  2NS0 A;  4ETS A;  1O3T A;  2FU4 A;  3CES A;  4Y7N J;  1K78 B;  3I5U A;  1XGN A;  1YO5 C;  3ABU A;  1NG7 A;  2JPB A;  3RYP A;  3FXR A;  3N05 A;  2M4G A;  3VYT B;  2H8W A;  1NK2 P;  2HNH A;  3OIQ A;  3QPS A;  3TDU C;  1KU3 A;  2DA5 A;  5J8F A;  2HQ5 A;  3QYF A;  4I76 A;  1O57 A;  1FNN A;  1IN7 A;  4XL9 A;  5LGT A;  3VYS B;  1ENH A;  3BJA A;  2ZNZ A;  4HBL A;  2G0E A;  2F48 A;  4UB6 C;  3K0L A;  1IJW C;  2PMU A;  3PNY A;  4A3E J;  3D0S A;  5D4R A;  4IRH A;  1ULY A;  2VJJ A;  4IVN A;  1S8N A;  2E2I J;  4JBA A;  4BQN A;  3ABK H;  3DU5 A;  1F9N A;  2HVS A;  2ID3 A;  3RTR A;  1F36 A;  1VF9 A;  4HNU A;  3BJO A;  2QQB A;  2VXD A;  4XOP A;  2KLO A;  3IKV A;  3JTH A;  2V9P A;  3GTP J;  2WA0 A;  1OYW A;  2L7F P;  1G4D A;  5DD8 A;  3BJ6 A;  1OFC X;  3HTU A;  3WTY C;  4E7Z A;  4A3L J;  1R36 A;  1ZGJ A;  4NDL A;  2WAQ A;  4Y13 A;  3KEQ A;  4N4O B;  2A5Y B;  3I64 A;  1H8A C;  2GOX B;  1YX3 A;  2F5F A;  1O7L A;  3HIF A;  1YJN I;  3FDY A;  5JVT A;  4QLC U;  1YS6 A;  1Q1H A;  2XAG A;  2FX0 A;  1W7P D;  2EJR A;  4F7Z A;  2L4A A;  2R92 J;  4A3D J;  5LFA A;  2IP2 A;  1E3H A;  3OR2 C;  1U78 A;  4I98 B;  5EEA A;  5HNH A;  3ZQH A;  3GX4 X;  3L09 A;  4HZF A;  1B59 A;  2ZME C;  5BPI A;  1FX7 A;  4G12 A;  5KHD A;  3DPL C;  2A07 F;  2AHQ A;  1QHH D;  1P4W A;  2XAF A;  1VQ8 I;  2RDP A;  3EUK L;  3JAM K;  2Y0S A;  3I59 B;  3H5A A;  3KE2 A;  3H9J A;  2Q0O A;  2YX4 A;  1BOB A;  4Q4Z F;  1HQC A;  3SFI A;  4AIK A;  1I6X A;  2ZKZ A;  4CA0 A;  4E70 A;  4HOB A;  3E5U A;  2DCE A;  4HLX A;  2GBY A;  2VAS A;  2DA6 A;  1FP1 D;  4XM3 A;  3ZMS A;  2MH2 A;  3H9Q A;  5E17 F;  4BKX A;  2X6Y A;  3SJM A;  1R58 A;  4MIM A;  5FRO A;  1R71 A;  2HKO A;  3FXU A;  5E20 A;  1UG0 A;  4UXN A;  1N25 A;  3W6J B;  5IT9 Z;  2BVM A;  5FD5 A;  5FKL A;  5LGN A;  3CC7 I;  3S17 J;  2ZFU A;  4KN4 X;  4JOM A;  3T1B A;  1I3A A;  2X51 A;  3G1O A;  3DBH B;  3MEX A;  1K7A A;  3CF5 F;  2XGC A;  3K1N A;  3DEW A;  4Y15 A;  2Z9O A;  4OIQ F;  2K9L A;  5D5V B;  3ERM A;  1D0Y A;  4Y4R A;  2CV0 A;  4AWX B;  1WPK A;  4I99 C;  5J1R A;  2X48 A;  2DDA A;  4QIW N;  4HA8 A;  1UB9 A;  4MFD A;  2VQL A;  2XKP A;  4XID A;  2MW8 A;  1SVM A;  3J7A O;  4CCM A;  5K7F A;  3CJT B;  5DM6 F;  3TQN A;  4RM2 A;  2RC4 A;  2Z33 A;  2DW4 A;  1HA8 A;  1HC8 A;  1QNT A;  5E3N A;  2BY0 A;  2XVC A;  5FJ8 J;  2FUG 2;  4JK1 X;  4PSX A;  2EIJ H;  1IC8 A;  2BBY A;  1JKR C;  2F2E A;  2LBF B;  5ED4 A;  5FD6 A;  3HHG A;  2H6B A;  2N8G A;  5KK1 A;  1Z77 A;  5FFX A;  3A4C A;  3E7L A;  3W6V A;  1HW1 A;  1SFX A;  2K02 A;  2QBY B;  5CVV A;  3F23 A;  5CVI A;  3WTW C;  2RQQ A;  3I56 I;  5F0C A;  2XPW A;  3DU6 A;  2LH9 A;  4PJJ A;  3DTE A;  3R0A A;  4ZDO A;  5EJC A;  4NB5 A;  2BHZ A;  3ZQQ A;  4EM0 B;  3OYK A;  2CJJ A;  1DGR M;  2A6H F;  2DDB A;  4YEJ A;  1DP3 A;  2GA1 A;  4UUT A;  3I4N J;  2ZNY A;  5LLQ A;  2FJ1 A;  2DFH A;  5LD2 C;  3AKZ A;  2DJN A;  2GXA A;  3F8F A;  2DT7 B;  3K70 C;  4BY1 J;  4F3Q A;  2MSY A;  2RVC A;  2G9W A;  2XF7 A;  1BJA A;  1BI0 A;  3ABL H;  5LHG A;  4O6J A;  4B44 A;  4UVC A;  3WHC A;  4OU0 A;  4PJ0 C;  3J81 K;  4RM3 A;  3O3K A;  4IXA A;  4P5O A;  2Z5U A;  2DA2 A;  1TW3 A;  1Z3Y A;  4FHT A;  3D5S C;  3ABM H;  3FXJ A;  3CD6 I;  1DPR A;  4AYB A;  2LD5 A;  3ZQL A;  4EJO A;  1ETX A;  3FXM A;  4OAY A;  4K2E A;  1T56 A;  2ZJ2 A;  1O4X A;  1XB4 A;  3ELK A;  4LD5 A;  5F27 A;  5EG0 A;  2QWW A;  3FXQ A;  4HSR A;  3GLX A;  2M7A A;  2F4O B;  3HSE A;  2E7W A;  2FD5 A;  2EFN A;  2JQ7 A;  2M1B A;  2PMZ N;  2HWV A;  3W6K B;  1FC3 A;  1WJE A;  3J80 K;  3HZJ A;  4IRG A;  2LVS A;  2ZXJ A;  5CVJ A;  3VSL A;  5E8I A;  5J1Y A;  4A93 J;  1NK3 P;  3H36 A;  4UUV A;  1LE8 A;  4OIR F;  1MBG A;  2Y2Z A;  1DP7 P;  1K61 A;  4C3H J;  1WFX A;  4A3G J;  1X1D A;  1QQI A;  3C7J A;  1TQM A;  2O6G E;  3K70 D;  2MH9 A;  1ZN2 A;  2Q2E A;  1WZ2 A;  2E1O A;  4KIF A;  3ZXS A;  2LMD A;  1MGT A;  3GTJ J;  3BTI A;  1HDD C;  1BA5 A;  2C6Y A;  3KYC B;  1MKM A;  4MLO A;  2BOL A;  2GIV A;  4EM1 A;  1A31 A;  4H0E A;  1YW9 A;  1MBH A;  3AAF A;  1X3W B;  1MSE C;  2QSF X;  1XGM A;  4BAC A;  2P5V A;  1GVD A;  2OCE A;  2RV8 A;  4DNC A;  5J47 A;  2HTJ A;  3V8L A;  1A6Q A;  2HOA A;  2AS5 F;  2B0L A;  2P4W A;  2DPD A;  2OU2 A;  2A5W A;  5DEQ A;  1YG2 A;  3PQK A;  2FSW A;  4CUG A;  4C9Y A;  1REP C;  2WB1 N;  4NUB A;  3ZRG A;  3BR0 A;  1S5L C;  2WY7 Q;  5DCM A;  3CC4 I;  3FBI B;  2HQR A;  2WV1 A;  3KP5 A;  1SD5 A;  3ZMT A;  2HDC A;  1WJF A;  2HZT A;  3HPG A;  3K10 A;  2VJ5 A;  5EEH A;  3BR3 A;  2DJI A;  3CJN A;  4HDU A;  2HXI A;  1IUY A;  3BZK A;  3KCC A;  4FAS D;  2KT0 A;  1R4M B;  3A01 A;  5HS9 A;  3DWL E;  4LOC A;  4NQW A;  4EVI A;  1K4T A;  5FLX K;  2FML A;  2QEX I;  5TRD A;  3FHZ A;  3OYH A;  2NVQ J;  3GFI A;  1IRX A;  5H6R A;  5D5X B;  1NG6 A;  5C4J J;  1P92 A;  3V7C A;  4ESB A;  3OYI A;  2W24 A;  1QVT A;  3QPT A;  3RJP A;  1AKH B;  2BGC A;  4I6Z A;  1YRN B;  3CDI A;  1D0X A;  3HHH A;  1POG A;  2OAZ A;  1X2M A;  2XKO A;  3KP4 A;  3S3M A;  3CJQ B;  4EEF G;  5BPD A;  3WTS C;  5CJ9 A;  2EIK H;  3L00 A;  3RIR A;  1A6I A;  3FHN A;  3OYD A;  1RRJ A;  3GCM A;  2E1M C;  5E18 F;  4ZYD A;  2F5V A;  3HKZ N;  3GFL A;  5HOO A;  3W2V A;  4XLH A;  5IP7 J;  4Y17 A;  1CF7 B;  2EZI A;  2UUZ A;  1JKO C;  4HQM A;  2IXS A;  1MBJ A;  4L0Y B;  2IEK A;  2ESH A;  3Q0V A;  1T98 A;  3GW2 A;  1IRZ A;  2TCT A;  2AO9 A;  3BG6 A;  1WJD A;  5TGT A;  4UB8 C;  1PYV A;  3TO9 A;  4B48 A;  5IP9 J;  3W2A A;  4CYC B;  1BJZ A;  4FX4 A;  4PJL A;  1XTA A;  3I53 A;  3ZCO A;  3WTT C;  1Z9C A;  3MN2 A;  4AVP A;  4WWC A;  4G94 A;  2ESN A;  1A5J A;  2CUE A;  3QRF F;  4NBQ A;  1D5Y A;  1MBF A;  2BW3 B;  2JSP A;  2ZME B;  2QA4 I;  3KP7 A;  4RAF A;  1OCC H;  4XLA A;  4NC8 A;  5FB2 A;  3CO7 C;  1WJC A;  2MBF A;  2R7O A;  1SFO J;  1CGP A;  3HBL A;  1O3S A;  4JP0 A;  3LL7 A;  1DU6 A;  4BGD A;  2R7T A;  4MQV A;  1RI7 A;  3M1E A;  5GAD J;  4BE0 A;  1YX5 A;  3SYT A;  5FRN A;  2H1L A;  2ZXI A;  3OYC A;  4EV0 A;  2E1C A;  2HZD A;  5GAG J;  2OCC H;  2DA7 A;  1Y8Q B;  2VBX A;  1Z0X A;  4KYW A;  3R61 A;  4M9X A;  3WOD F;  2ZJP F;  2V6C A;  2IS1 A;  1FOY A;  3CCY A;  4BHP A;  2XAH A;  2JMW A;  1L3L A;  1N77 A;  2EZL A;  2HI3 A;  4P1W A;  1VQN I;  5DM7 F;  1DPU A;  2VE8 A;  2DOA A;  2GWR A;  4DOZ A;  3JRB A;  4KNY A;  2VUM J;  3BQZ A;  5B66 C;  4HST A;  2RGV A;  5EEG A;  5JLX A;  1SD7 A;  1Y56 A;  1U9O A;  5AIQ A;  4DZP A;  1R1V A;  1G3S A;  3CCQ I;  1ZRC A;  2ADU A;  4EJT A;  1AHD P;  3BR2 A;  4YFN F;  4WXC A;  5LRS A;  4ZYG A;  1ZRE A;  2EIM H;  3LA3 A;  3U2R A;  3FKI J;  1LFP A;  2A05 A;  1FSE A;  2FQ4 A;  2KJB A;  2Z2S B;  2CQX A;  2E34 A;  3FZV A;  4M72 A;  5ERI A;  5K7H A;  3OV8 A;  4A2U A;  4IHS A;  1XD7 A;  2AXT C;  1D8J A;  2KKO A;  4CYD A;  2I5U A;  2CV1 A;  1TBX A;  1BC8 C;  3QOP A;  1ETY A;  3RKX A;  1E3P A;  1GXQ A;  4DJA A;  2I10 A;  2K3F A;  3FMR A;  3CP8 A;  5L3D A;  3OSG A;  2OTL I;  1ODD A;  2KIU A;  4I0B A;  1TNT A;  1GT0 C;  1K6O A;  3S16 J;  1PP8 F;  1MNM C;  1NHA A;  3PSF A;  1VZ0 A;  3CTA A;  3J7Z I;  1WRJ A;  3H3V K;  1QU3 A;  3PFI A;  1FPQ A;  2QKM B;  3VEP A;  1ONV A;  4B09 A;  3HDD A;  2PJP A;  3BTC A;  3T0Y A;  3HOV J;  4MTE A;  1PUF A;  3DFG A;  4KFC A;  2DLL A;  2KZV A;  2CQN A;  1A36 A;  2Z1D A;  4BEH B;  2E5Z A;  2L9R A;  2A61 A;  2EV6 A;  4KT5 C;  4LMY A;  3I58 A;  3DKW A;  3E6B A;  4XOR A;  3JSO A;  4UV9 A;  4CCN A;  2CQQ A;  3HRU A;  3HOY J;  4U88 A;  2VQG A;  1UMQ A;  5HNF A;  3FBN B;  4HPQ A;  4C3I J;  2PFB A;  2QCO A;  4QWQ A;  3QYE A;  3MZY A;  3JRD A;  2WAF A;  3H92 A;  2W00 A;  3ZQC A;  4I7H A;  3V7S A;  1L0O C;  2M87 A;  2LF7 A;  3BWG A;  2ZO4 A;  2X9D A;  3E1S A;  4A6E A;  5L3F A;  1BL0 A;  2HGC A;  2P6S A;  4LB6 B;  3HEF A;  2F5C A;  2UZK A;  2CU7 A;  3WE2 A;  2OTJ I;  1P7J A;  3OYM A;  2R7Z J;  2JA2 A;  3F21 A;  3FF5 A;  4LK0 F;  4F52 A;  3TO6 A;  2QQA A;  2LY1 A;  1YLF A;  3WU0 A;  3ZPL A;  1U5T A;  5JFR A;  5JI6 A;  2EH3 A;  5H6Q A;  1SFK A;  1TZL A;  2FE3 A;  3BTJ A;  4G6D A;  1GDT A;  4S05 A;  2Y75 A;  4A0Z A;  2DFF A;  1MSF C;  1PVE A;  2DK8 A;  3H3U A;  2PMZ A;  3B02 A;  1AOY A;  3GTL J;  1YTY A;  4HV6 A;  3BY6 A;  2QSG X;  4E7I A;  1F43 A;  5GPA A;  4HX8 A;  1KYZ A;  5C3E J;  1TWH J;  2BHY A;  2LY9 A;  3SXY A;  2XUB A;  1MMS A;  2RQP A;  3AG3 H;  4OWR B;  1FOW A;  4LK1 F;  2F6C A;  2CO5 A;  4CSW A;  3IRR A;  3JW4 A;  2Y0M A;  3ML6 A;  5E1X A;  3IHU A;  1JJ6 C;  3MKL A;  3DF8 A;  1I3Q J;  2HR3 A;  3HOT A;  2CH0 A;  4LG0 B;  5CYV A;  2OC6 A;  2B7E A;  2QZ8 A;  1HKS A;  1DGW Y;  2V6E A;  1MBK A;  2DMN A;  2IA2 A;  1R23 A;  3B6C A;  5DYM A;  1BW6 A;  2H27 A;  3WGI A;  4BHB A;  3HSR A;  3M1C A;  2ZXW H;  1UG2 A;  4XLN F;  4A69 C;  5J3L A;  1X3U A;  1YI2 I;  3L9F A;  1BR4 A;  2R7S A;  4A5M A;  1JHF A;  2HXO A;  3D1N I;  4TV7 A;  3REO A;  4V19 K;  5D8K B;  2LFB A;  3IV5 A;  2VQC A;  4NNJ A;  1QZY A;  2XSJ C;  4GXO A;  4E6K G;  4HLY A;  1I27 A;  2XAQ A;  4YEL A;  3WG9 A;  2VQH A;  4U7B A;  4HRI A;  5TJJ A;  5L3E A;  2R93 J;  3TP3 A;  1Y0N A;  1ZQ3 P;  1TT5 B;  4FTH A;  2LC2 A;  3FM5 A;  2FBH A;  3TDZ C;  4BDZ A;  4L5J A;  1QVU A;  1YIO A;  1HDP A;  5DS9 A;  4BJ6 C;  4LJZ F;  5D8L B;  4BXF A;  1U9N A;  3MMY B;  1MZB A;  3K1P A;  4BU2 A;  1BM9 A;  5ICC A;  5BNG A;  3HXL A;  3SZG A;  2VOD A;  2E1M B;  2IBD A;  2IAI A;  4NC7 A;  4XLC A;  2M3A A;  3O2P E;  5CVR A;  2UWM A;  2R0Q C;  1FOK A;  4G8X A;  4QTR A;  2ELH A;  3CCU I;  2HOT A;  3RKY A;  4M3G A;  3JRG A;  5GAE J;  1OCP A;  3K7A J;  1QO0 D;  2YX7 A;  3NWS A;  2DPU A;  3JRE A;  2FF4 A;  4JQF A;  3HKZ A;  3X2Q H;  2PBI A;  5HLT A;  2EFW A;  1XSD A;  2IGO A;  2R5Y A;  3SEQ A;  3QOE A;  4CCK A;  3I59 A;  2JTV A;  4UUS B;  5F64 A;  3OS1 A;  4XR6 A;  2P6T A;  2PMH A;  3ZQG A;  1OYI A;  2DFE A;  5DCF A;  2BY1 A;  2ICW G;  4X1E A;  4WXD A;  2MLG A;  1OMI A;  2F5E A;  2R5Z B;  3EET A;  5BMZ A;  5ILV A;  3MKW B;  4ESJ A;  2Z99 A;  4GRI A;  4LFU A;  2HYG D;  3TOA A;  4EAT A;  5IT3 A;  1XN7 A;  4XSZ F;  1LKX A;  1ZLK A;  5HVQ C;  2EZH A;  3OYL A;  3S8P A;  1TLH B;  3KEO A;  2HTS A;  5M5W J;  2M9H A;  3BTL A;  4EQQ A;  4MFE A;  3RPU D;  5HDK A;  1AU7 A;  1YIT I;  2P81 A;  1WI3 A;  2RNG A;  1JI8 A;  4JX4 A;  2QEN A;  4LG3 A;  2VC0 A;  4WX9 A;  3QYB A;  5M3M J;  4F92 B;  5F0H A;  5EF6 A;  4D7N A;  2K9Q A;  2WTE A;  2JZY A;  2QUF A;  4D7M A;  3ABT A;  3NQO A;  4L9J A;  2VBW A;  3E3V A;  5CVU A;  3PO2 J;  4G9Y A;  1VQM I;  1B8I B;  5GPC A;  2VKH A;  3E5X A;  3B6A A;  2EV5 A;  3B73 A;  1ZAO A;  3D5R C;  5E3O A;  1O3Q A;  3K2Z A;  2K3P A;  2VJI A;  3SEZ A;  2UV1 A;  5L3B A;  3R60 A;  4RGS A;  4XK4 A;  2FRH A;  3PNT A;  3W3C A;  1DQU A;  2AQE A;  1PUE E;  4IOA F;  3AG2 H;  1JTX A;  1WSU A;  1JHH A;  3GXO A;  1ZG5 A;  1GV2 A;  2MLK A;  4HYE A;  4E7L A;  4B1R A;  5BS6 A;  3BQY A;  3CMA I;  3OS0 A;  4XRS G;  2HVR A;  1LJ9 A;  3S93 A;  2GZW A;  2CYY A;  1QPM A;  1MIJ A;  4JX5 A;  4GFB A;  2MA3 A;  3LSR A;  2A6T A;  3RKW A;  3QU3 A;  1LEB A;  3N97 A;  4S04 A;  4M9S A;  2LRE A;  2XAJ A;  2A69 F;  4CHU A;  1V54 H;  2OJE D;  3MZH A;  1HCR A;  3KP6 A;  4F91 B;  4C3J J;  1I50 J;  2K9M A;  1K83 J;  1OCT C;  1V4R A;  3H1C A;  2HDD A;  3CO6 C;  2IW5 A;  4BH9 A;  1HLV A;  2LKS A;  5FKK A;  3VYR B;  1J0R A;  2BY3 A;  1M1E B;  4E7K A;  3I4P A;  4BY7 J;  2E2H J;  2VBZ A;  4RLF A;  2BXY A;  2OA4 A;  3GFM A;  4MO7 A;  3L2U A;  4RAY A;  5DTD A;  5HS7 A;  4O5V A;  2IJL A;  3GVA A;  2JPC A;  1B1B A;  1KON A;  3VB2 A;  2CUJ A;  3EQL F;  3LSJ A;  2OQR A;  3CUO A;  3S32 A;  1R1T A;  1T8I A;  2GA2 A;  3ZMD A;  3SDG A;  2KZG A;  3GLL A;  1W0T A;  4KIS A;  2DOF A;  3VOE A;  3CUQ C;  3JRI A;  4LIV A;  4PCQ A;  2XPV A;  2V1N A;  1IV6 A;  4HDV A;  5EZH A;  2L02 A;  2ME0 A;  2NXN B;  4BJT A;  2ECC A;  2L7M P;  3PSI A;  2FXA A;  4XLF A;  1ZTR A;  2E5N A;  1XG1 A;  3C2B A;  1JUS A;  3KET A;  3ZMV A;  3H9G A;  2X6O A;  2ETH A;  2CQ7 A;  2V79 A;  3TGN A;  3J7A Y;  2XAU A;  3P5J A;  4XLP F;  2LP0 A;  4OIO F;  2JN6 A;  1G6N A;  2G7U A;  2GIZ A;  3OWT A;  4N9I A;  2NVY J;  3S1M J;  1F1Z A;  2IVM A;  4KDP A;  3WU1 B;  3DKY A;  1W4M A;  3OMY A;  1SAN A;  4OIN F;  1GXP A;  4L9T A;  2IGK A;  4FT8 A;  3WU2 C;  2VKV A;  4EJV A;  5J4Y A;  2NVU B;  2BYV E;  4OAZ A;  4MQ9 F;  4IKF A;  2DTR A;  3FIS A;  1Z7U A;  2M34 A;  5GTI C;  4YIF A;  2EWN A;  4IHY A;  1FTZ A;  2OBP A;  2Y48 A;  3E0J B;  3L1P A;  2R4G A;  4DZJ A;  1VQ4 I;  3P7N A;  2IRF G;  3VDX A;  3ZQF A;  3RSN A;  4C2T A;  3JTG A;  1OIS A;  3GTG J;  5F1R A;  3BR1 A;  1SVO A;  3MFK A;  1IDY A;  2ZFW A;  5LBQ A;  2F5D A;  2ZC2 A;  4ZTF A;  5CLS A;  2M5W A;  1FIP A;  3CCV I;  2NRA C;  2KHM A;  1D1C A;  4WF2 A;  3WGH A;  2LNB A;  5CPR B;  5AON A;  3HOW J;  3ZR8 X;  3GTK J;  2VC1 A;  1R4N B;  2OPT A;  4ZYE A;  1B72 B;  2K40 A;  3K4J A;  1VFC A;  1W7P A;  1ZR2 A;  3DLA A;  3JSP A;  1JT6 A;  2A68 F;  1BW5 A;  4DQ2 A;  3OYB A;  4A3I J;  1HKT A;  2DQR A;  3A0H C;  3FIW A;  1A35 A;  2B63 J;  3BR5 A;  1BI1 A;  1OQY A;  2M2E A;  2QVO A;  3WE3 A;  1IN5 A;  4HAM A;  4M6X A;  4ZDP A;  4HNV A;  2L54 A;  4DW6 A;  2R7W A;  1AKH A;  4L5I A;  1EA3 A;  3I54 A;  5DV5 A;  1WH5 A;  2DMP A;  3V42 A;  3F22 A;  1PP7 U;  3HRS A;  3M4O J;  3HRT A;  2V1X A;  3R0J A;  4GO1 A;  1LVA A;  2A6E F;  1YFH A;  2D45 A;  1ZR4 A;  1Z6R A;  3HRM A;  2R7D A;  4AIJ A;  3MQ0 A;  5HOD A;  5EGO A;  1KYW A;  5GP9 A;  1PDN C;  1WH7 A;  2IT0 A;  3S2D J;  3PL8 A;  3G1M A;  4GCV A;  2R7X A;  1YOV B;  3SDB A;  1RUN A;  2ZJR F;  3OS2 A;  4RGU A;  2O03 A;  4KIT B;  3ULQ B;  2PG4 A;  2HQN A;  3FXL A;  3MVP A;  2G7H A;  2DMQ A;  1U8B A;  4CZC A;  2XDV A;  1Y0U A;  3G6E I;  3IP4 B;  1SC7 A;  1MH4 A;  2DOD A;  2LR8 A;  3JAM Z;  3OIP A;  1T2K A;  1FMV A;  3CCE I;  2H09 A;  1SD6 A;  2GM4 A;  2OZU A;  3A2K A;  1G3W A;  3JRC A;  1E17 A;  2DN0 A;  2KRH A;  1R5G A;  1SFE A;  5D6E A;  4AC0 A;  2VPL A;  1BC7 C;  2GLO A;  1R1U A;  3Q9S A;  4DYQ A;  4IO9 F;  1VQ9 I;  2QF7 A;  1HW5 A;  3ONQ A;  2DA4 A;  5D5U B;  1LDJ A;  2GQQ A;  4J19 A;  4HQE A;  1EF4 A;  1Z67 A;  2K9S A;  4IPA A;  4KJZ A;  5A2Q K;  1XGO A;  1RZ4 A;  3LA7 A;  1D0Z A;  1R00 A;  1OLT A;  2HKX A;  2LK2 A;  2JK3 A;  1XGS A;  3DV8 A;  1W36 C;  3JCU C;  2XB0 X;  2HDW A;  1KZH A;  3F8N A;  1GV5 A;  1ETK A;  2EIL H;  3BZC A;  3I3L A;  5ICG A;  4I01 A;  4J01 A;  2IA1 A;  1ZG3 A;  5FGM A;  5M3F J;  2GXB A;  4A3J J;  3L7W A;  3K4L A;  5F04 A;  1TWA J;  2K9N A;  1WWX A;  4CCO A;  4N0B A;  3IH2 A;  5EG0 B;  1JXS A;  3M7G A;  2VT3 A;  2YSR A;  1U5T C;  3QPL A;  4II3 A;  4XKB A;  5GTH C;  3DCF A;  1Q1V A;  3GFJ A;  4M6V A;  2JA5 J;  2Q1Z B;  2QYO A;  1KU2 A;  1X3Z B;  2E71 A;  4MEY F;  2ZSH B;  4PFO A;  4RGX A;  1S7A A;  2KJC A;  5E3M A;  1FTT A;  5LHI A;  3DEE A;  1FYL A;  2IS6 A;  4B47 A;  1KGS A;  1DDN A;  1MMA A;  3LSG A;  1FBU A;  2E7X A;  2VI6 A;  1ZG1 A;  2JT1 A;  4I02 A;  3RPQ A;  3UKG A;  3HC7 A;  2P7C B;  3TKY A;  3EYI A;  4GDF A;  2H8R A;  3ZMZ A;  3DTK A;  1Z21 A;  3FKJ A;  3OIO A;  5BOX A;  1P4X A;  4JX6 A;  3DLL F;  1W36 D;  2CW0 F;  3VPR A;  3RYR A;  1O3R A;  1D3Y A;  3M8E A;  1MD0 A;  3M3Y J;  4ESF A;  1MMG A;  4G7Z F;  1P6R A;  4XSX F;  4KT6 A;  2DMU A;  2HYJ A;  1SMT A;  1TT0 A;  2V4J C;  2R7Q A;  4DYR A;  4C2M J;  1R5H A;  3J7Y J;  1FBQ A;  1XSX A;  3OYE A;  1A04 A;  3H5N A;  5CKT A;  1D8K A;  3O8G A;  3K2A A;  3H0G J;  4BE1 A;  5K7Z A;  1O7F A;  2XF5 A;  3TW7 A;  3COA C;  1K6Y A;  1MJA A;  1K4S A;  5J8C A;  3KEY A;  1ACI A;  5IOZ A;  1ZGA A;  2HFH A;  5KNL A;  2CG4 A;  5IY5 H;  3A01 B;  1IUF A;  3EUH A;  3ROU A;  2FNA A;  2QKL B;  2W84 A;  4BEH A;  5B1A H;  1JJ8 C;  2WAQ N;  3SZT A;  2PJR A;  3RDI A;  1OCR H;  1VQK I;  1FWZ A;  2STT A;  3OR1 C;  2XGD A;  2YR2 A;  3G4S I;  5HS8 A;  1LDD A;  2JVH A;  4PK4 A;  1TW2 A;  3RCO A;  1YJW I;  2O9L A;  5D5W B;  1RKT A;  4BAY A;  2L5Q A;  3CLO A;  1S29 A;  1RC9 A;  2D2W A;  1KU9 A;  2BEO A;  1QBJ A;  3NAU A;  2MGQ A;  2WAE A;  3I0T A;  3ZMU A;  1BN5 A;  3KLN A;  3BDD A;  3ZQI A;  3J80 Z;  4YRV A;  3FMS A;  4NC6 A;  3ERE D;  4A3K J;  1G3T A;  2ID6 A;  2PEX A;  4LLG F;  1VQO I;  1SVL A;  3CUQ B;  2Z3Y A;  3L2R A;  1ORK A;  3VSK A;  2P0W A;  3F8B A;  4IHW A;  1KQ8 A;  3NWT A;  2V26 A;  3ECO A;  1RNL A;  3LWF A;  1WQ2 A;  3SHF A;  1KU7 A;  1OJL A;  1J5Y A;  1RET A;  2JUG A;  4ON0 A;  1APL C;  2LTP A;  2Y0S N;  2CRG A;  1MDM A;  3MKY B;  4D9J A;  1VQ6 I;  2JWT A;  2LOO A;  4CCL A;  1FYM A;  1ZHF A;  2VKD A;  2Y30 A;  4BYY A;  2X85 A;  4ZJZ A;  4AM3 A;  2LRD A;  1VQL I;  1CQT A;  3RKQ A;  4X6A J;  4AVZ A;  1TWC J;  4EMS A;  2F4M B;  3QAH A;  3C18 A;  2XGE A;  5D6F A;  3OY9 A;  1BR2 A;  4KMU X;  5F08 A;  5HDN A;  1U8R A;  1BIA A;  2LKP A;  1EJ9 A;  4HG2 A;  3IL2 A;  3CCM I;  3HOU J;  2O5R A;  4ABZ A;  4IF4 A;  3HPH A;  3WHB A;  2KPM A;  3LSP A;  3GBG A;  3HG9 A;  4C2U A;  4LLL A;  1UHM A;  3BCB A;  4Z2Y A;  4X0G A;  9ANT A;  3K4K A;  3GWZ A;  4BE2 A;  4GGG A;  3T8T A;  1VTN C;  3IH3 A;  4A3F J;  3F9K A;  1QPI A;  3ECH A;  4A3B J;  3E5Q A;  1Z7L A;  4LIU A;  3C2G A;  5FLM J;  1S6L A;  3OYN A;  5ICE A;  2P5K A;  2V7F A;  1LNW A;  1N75 A;  2A3S A;  2R3S A;  3ISP A;  4GYG A;  1JUM A;  4A0Y A;  3AG4 H;  2CW8 A;  4A12 A;  1X2N A;  4M71 A;  2GOM A;  4ITV A;  1XMX A;  3P9C A;  1H9G A;  1STZ A;  1OR7 A;  1EH6 A;  4ENM A;  3CCJ I;  3TMO A;  4RS8 A;  4BS9 A;  1WI9 A;  3E6C C;  2VN2 A;  1LUJ B;  1SAX A;  1SFU A;  4Q5S F;  2NS7 A;  4KUM A;  4F93 B;  3N4M A;  4W97 A;  4XQF A;  5E1W A;  3I55 I;  2WY8 Q;  2XRO A;  3S15 J;  2NAZ A;  5FKM A;  3TOB A;  4CDG A;  2IS4 A;  1LEA A;  1X1A A;  4WK8 F;  2VJ4 A;  3ASO H;  4DGW B;  4BNC A;  3HOS A;  3HUG A;  3KP3 A;  2EK5 A;  4KIC A;  6PAX A;  4IL6 C;  1JKP C;  1T38 A;  1B6A A;  3F3X A;  3K4C A;  3MCZ A;  5F1J A;  3L2W A;  4YFK F;  4B4C A;  1BR1 A;  3DBR B;  4HF1 A;  3QOD A;  1K78 A;  3OOU A;  2RAE A;  1OPC A;  3H0D A;  1Z3X A;  4DBQ A;  2DT5 A;  2CMP A;  4U0W A;  3KIO A;  1T33 A;  4FE4 A;  1FY7 A;  3CQZ J;  1R22 A;  3DBL B;  5FKO A;  1ON1 A;  4HNT A;  1X4O A;  1J75 A;  4U7D A;  4A6D A;  2KIF A;  3WGG A;  1P2F A;  1D1B A;  5IYD J;  3BG7 A;  1Y39 A;  5J1U A;  1PUF B;  2QQ8 A;  1BI2 A;  3CME I;  1AA7 A;  3CZ6 A;  3M9A A;  3AFH A;  1V5F A;  3CJR B;  3A02 A;  2JJ7 A;  2WB1 A;  3WG7 H;  3F8C A;  3E6M A;  5IT9 K;  2YU9 J;  1LDK B;  3GZ5 A;  2XRN A;  3LAP A;  2W4S A;  2M8E A;  4BHC A;  1U3E M;  1I6H J;  3Q0W A;  2NYX A;  4RAZ A;  3QQA A;  3U21 A;  2XHK A;  1E2X A;  2X1C A;  4IX7 A;  1MW7 A;  3GTQ J;  3ZP5 A;  1TWG J;  2CS3 A;  1FBS A;  2EBI A;  4LB5 A;  2DU9 A;  3CDL A;  3SFZ A;  2TDX A;  4L9V A;  2PLY A;  3DKX A;  4AUX A;  2M4K A;  4BL0 B;  4JYK A;  3ASN H;  1ZYR F;  1HW2 A;  1C0W A;  3FM3 A;  3KFW X;  4PUS A;  2DK5 A;  2ACJ A;  4I0A A;  3VOD A;  4B8X A;  1U5T B;  3QPH A;  5JLW A;  2K4J A;  3ZGK A;  1UST A;  4F55 A;  2YU3 A;  5DDG A;  2EB7 A;  3S3O A;  3GEZ A;  3HOX J;  1I1S A;  2KIQ A;  4ENN A;  3LSI A;  2W7N A;  1QZE A;  1IXS B;  1X58 A;  2XF6 A;  1YHQ I;  1MJ9 A;  2BE5 F;  3OL4 A;  4CZZ A;  3Q9V A;  1S9H A;  3E97 A;  3FK6 A;  4GYI A;  2EV0 A;  3LFK A;  1JE8 A;  1ERD A;  1I1G A;  1Y6I A;  3GTM J;  2E60 A;  3CMY A;  1IV8 A;  2QLZ A;  4QSH A;  2IGN A;  4W1U A;  4BQO A;  2XPU A;  2X0L A;  3Q5F A;  4XON A;  3U1D A;  1QA6 A;  3C2H A;  2KFD A;  2L4M A;  3PM1 A;  4I2O A;  3O8H A;  1IRF A;  1T95 A;  3IAS 2;  4FCY A;  1BBY A;  2KRC A;  4PDK A;  1LPQ A;  4OMY A;  3RZO J;  3DP7 A;  3C3W A;  4ZYA A;  4IOC F;  4LIT A;  1PJR A;  5J6X A;  4UHT A;  5DUK A;  1U0J A;  3QP6 A;  1YIJ I;  2CQK A;  1XCB A;  4M9Z A;  3ZQ7 A;  2ZJQ F;  1T6S A;  3K6G A;  4M6Y A;  2VIX A;  5JHU A;  2HU9 A;  4XKC A;  5E79 C;  2L9N A;  4AID A;  4CH7 A;  1WVR A;  2M45 A;  3HL2 A;  4XN3 A;  5LRR A;  4MTD A;  3BP8 A;  1Z91 A;  1V3F A;  3A03 A;  4ZYH A;  4V2G A;  2DT6 A;  1H88 C;  1IO2 A;  1HF0 A;  2X4H A;  1GVJ A;  1G59 A;  2YUS A;  4R1H A;  4J00 A;  2M30 A;  1S72 I;  1UFM A;  2L01 A;  2PX9 A;  1RIO H;  2W57 A;  1AWC A;  1KA8 A;  4BXX J;  1LQ1 A;  2CGP A;  4Q48 A;  2BY2 A;  2LBF A;  3FMQ A;  4MEX F;  2HOS A;  3OOP A;  2ZSI B;  1B9N A;  4P96 A;  2WC2 A;  4IRI A;  4YIR X;  4RBO A;  3D5L A;  2Z16 A;  4Y3O A;  1K79 A;  2QBY A;  4AIH A;  1XMA A;  5ILU A;  3DPU A;  3K1M A;  5CQG A;  3OYG A;  2DOE A;  2HPI A;  1EV7 A;  1HST A;  2EQR A;  3H3Z A;  1QZZ A;  3JRF A;  3V8J A;  2MC3 A;  2ME6 A;  3GF2 A;  1NH3 A;  5K5O A;  2OQG A;  2GAU A;  2JRT A;  2MYS A;  4XMY A;  2EA2 A;  1LB2 A;  2COB A;  2DO7 A;  3ZN1 A;  3F72 A;  3U1K A;  5GAH J;  2WBM A;  3QU6 A;  3SQN A;  5H20 A;  2O61 A;  4BDY A;  1TQI A;  2R5Y B;  1ZK8 A;  3MKZ A;  4CCJ A;  4G6T B;  3K69 A;  2M7B A;  1QHG A;  3AL0 B;  3BRO A;  4XKV A;  1H9T A;  1TC3 C;  5HLH A;  2CUZ A;  2MG4 A;  2LLK A;  1ITY A;  5FRM A;  2MD0 A;  5KCM A;  1FSH A;  1TTY A;  3LSM A;  3PO3 J;  2FBK A;  3M8F A;  1WGX A;  2O8K A;  1FOX A;  4RGR A;  5IPA A;  3LNQ A;  1YW8 A;  2EIN H;  4RMN A; 
#chains in the Genus database with same CATH homology
 3P9K A;  2HEO A;  2XGX A;  4KN7 X;  1BIB A;  1BI3 A;  1HKQ A;  2DI3 A;  1J59 A;  2R7F A;  4EGZ A;  2O3F A;  1XSV A;  1ZLJ A;  5ILS A;  1I5Z A;  1FT9 A;  2V1D A;  3U9G A;  1IW7 F;  1YS7 A;  4UNO A;  1S3J A;  4WXH A;  2EFO A;  3V4G A;  3PQJ A;  4IHT A;  3VFZ A;  4L0Z B;  1ZH5 A;  1USS A;  3BZ6 A;  4ZZD A;  4XRF A;  4BQA A;  3GZ6 A;  1ZAR A;  3O6B B;  1FP2 A;  2EFQ A;  3MWM A;  3RPU A;  1T0F A;  3DPT A;  1ZRF A;  3G3Z A;  2FEZ A;  2OZ6 A;  4OIP F;  4A0X A;  3L2C A;  2RKH A;  2FA5 A;  3T8R A;  4P55 A;  2O0Y A;  1FLI A;  4RB3 C;  1R7J A;  4HF2 A;  2RNJ A;  4MGR A;  4ENK A;  3S2W A;  4U0V A;  5ICF A;  5K5R A;  4EM2 A;  3P9I A;  2VE9 A;  4IJA A;  2VOP A;  1FZP B;  4N9H A;  2DBB A;  1KQ9 A;  2LDU A;  2P7V B;  1CF7 A;  1YQA A;  4Q47 A;  4O3M A;  4FX0 A;  2FQ3 A;  4ZH4 F;  2AXL A;  2KRF A;  4M73 A;  3GO5 A;  4L18 B;  2K86 A;  3IC7 A;  5FFZ A;  2DAO A;  2XIG A;  3R6S A;  3F6V A;  2LSO A;  1DUX C;  1EH7 A;  2PN6 A;  2WV0 A;  2IPQ X;  1IN4 A;  2ZME A;  2O8X A;  2HS5 A;  3F8M A;  4PGG A;  2UXN A;  4R8H A;  5DUI A;  2K27 A;  1F5T A;  4A5N A;  2RN7 A;  1S7O A;  2CSO A;  1WKM A;  2ISZ A;  2H94 A;  1W7P B;  3BPV A;  2NNY A;  2VON A;  4RB0 A;  1IZ1 A;  4OOI A;  4AD9 A;  1ON2 A;  3K9T A;  1Z05 A;  1D5V A;  4G6Q A;  4YFX F;  3CUQ A;  4RB2 C;  1GHC A;  3SZP A;  3WTX C;  2CFX A;  3IKT A;  3IWF A;  1YW7 A;  4HV5 A;  5L3G A;  4EGY A;  1U2W A;  4P9U A;  5HLG A;  1QGP A;  1KQ0 A;  2VT2 A;  1H0M A;  3EYY A;  4PZJ A;  1HBX G;  5LEJ A;  3GUD A;  2V9V A;  2K4B A;  3IRQ A;  5DCM B;  4RB1 A;  1UCR A;  3J81 Z;  2WWY A;  3EDP A;  2EA4 A;  2STW A;  4MHG A;  4U0Y A;  2FMY A;  3T5X A;  3V8K A;  3R4K A;  5BQT A;  2OD5 A;  1IXR C;  2Q8K A;  4KIG A;  3QP5 A;  2VXZ A;  1J2X A;  2HOE A;  4ZZL A;  1B4A A;  1ZRD A;  2J5O A;  4ENJ A;  2HYF A;  2PQ8 A;  3LA2 A;  2W85 A;  3BPX A;  5E1Z B;  2GXG A;  4LLN A;  5F6F A;  4OMZ A;  3LST A;  5K5Q A;  5LEK A;  4YG2 F;  5JR3 A;  1IN8 A;  5HDG A;  1F4K A;  3FX3 A;  1IF1 A;  2VOO A;  4LGW A;  2P5L C;  1IXC A;  3KZZ A;  2LF8 A;  2CWE A;  1B9M A;  1BOA A;  4UV8 A;  3DEU A;  4PGH A;  2QM3 A;  2D1V A;  1T39 A;  1FYK A;  1TQP A;  1J7K A;  3I71 A;  2JSC A;  1IAW A;  4BXU A;  1W5T A;  2COM A;  4LG0 A;  1HXD A;  1XDU A;  5FLX Z;  5A2Q Z;  1EH8 A;  1G3Y A;  3FWE A;  5LGU A;  4MNU A;  2D1H A;  1UHW A;  5E8G A;  2KIM A;  4L9N A;  3WTV C;  5LHH A;  3NEU A;  4M74 A;  2ZBK A;  4YII A;  3F6O A;  2DFI A;  1IRG A;  4WCG A;  4EJW A;  4G7H F;  3HYI A;  1Z6T A;  1P4A A;  1U6G A;  3NRV A;  2P8T A;  2ZCW A;  3CDH A;  1SMY F;  4HX7 A;  2L3D A;  2H6C A;  5AIP A;  4CXF A;  4KMF A;  4NHJ A;  2J5P A;  2QQ9 A;  1YYV A;  3KLO A;  4UVA A;  4CGZ A;  1MDM B;  3HTS B;  3WTZ A;  4XBF A;  4D0P A;  5D4S A;  2IA0 A;  4CO8 A;  2NNN A;  1IN6 A;  2V1U A;  5DD4 A;  5KVR A;  4UVB A;  1OYY A;  2ISY A;  4ASN A;  4KA4 A;  3KZY A;  4R79 A;  2E1N A;  3E6D A;  4P9F A;  3GYH X;  3RI4 A;  3DXJ F;  2XV4 S;  3TO7 A;  1HSJ A;  3C1D A;  4HW0 A;  2K7L A;  3WTU C;  3IWZ A;  5FO5 A;  1W5S A;  2W25 A;  1OKR A;  3LQQ A;  1J9I A;  5L3C A;  1SD4 A;  1JGS A;  4I09 A;  2FOK A;  3ZN0 A;  4CIC A;  2BV6 A;  3KP2 A;  2XAS A;  4G7O F;  3DQV C;  3G73 A;  2YPR A;  2PI0 A;  2FBI A;  2EFP A;  3BOQ A;  3V7R A;  2UXX A;  3HSF A;  3LQR A;  1TNS A;  1XCV A;  1Z1D A;  2VBY A;  5K1Y A;  3MAJ A;  2FNP A;  1XMK A;  1MJB A;  4HF0 A;  1RUO A;  4KIB A;  2MD5 A;  4HX4 A;  5HLI A;  2DQL A;  1XDS A;  4EJU A;  2NS0 A;  4ETS A;  1O3T A;  2FU4 A;  1K78 B;  3I5U A;  1XGN A;  1YO5 C;  3ABU A;  2JPB A;  3RYP A;  3FXR A;  3TDU C;  1KU3 A;  5J8F A;  1O57 A;  1FNN A;  1IN7 A;  5LGT A;  3BJA A;  2ZNZ A;  4HBL A;  3K0L A;  2PMU A;  3D0S A;  5D4R A;  4IRH A;  1ULY A;  4IVN A;  1S8N A;  4JBA A;  1F9N A;  3RTR A;  3BJO A;  2QQB A;  3IKV A;  3JTH A;  1OYW A;  1G4D A;  5DD8 A;  3BJ6 A;  3HTU A;  3WTY C;  1R36 A;  1ZGJ A;  4Y13 A;  3KEQ A;  2A5Y B;  3I64 A;  2F5F A;  1O7L A;  3HIF A;  5JVT A;  4QLC U;  1YS6 A;  1Q1H A;  2XAG A;  1W7P D;  2EJR A;  4F7Z A;  2L4A A;  2IP2 A;  1U78 A;  4I98 B;  3GX4 X;  3L09 A;  4HZF A;  1B59 A;  5BPI A;  1FX7 A;  3DPL C;  2A07 F;  1P4W A;  2XAF A;  2RDP A;  3JAM K;  3I59 B;  3KE2 A;  2Q0O A;  2YX4 A;  4Q4Z F;  1HQC A;  4AIK A;  1I6X A;  2ZKZ A;  4E70 A;  4HOB A;  3E5U A;  4HLX A;  1FP1 D;  3ZMS A;  2MH2 A;  5E17 F;  1R58 A;  2HKO A;  3FXU A;  5E20 A;  4UXN A;  3W6J B;  5IT9 Z;  5FD5 A;  5LGN A;  4KN4 X;  3T1B A;  3MEX A;  1K7A A;  4OIQ F;  3K1N A;  4Y15 A;  2Z9O A;  5D5V B;  4AWX B;  4HA8 A;  1UB9 A;  2XKP A;  3J7A O;  3TQN A;  2RC4 A;  2Z33 A;  2DW4 A;  1QNT A;  2XVC A;  4JK1 X;  2BBY A;  2F2E A;  5ED4 A;  5FD6 A;  3HHG A;  2H6B A;  5KK1 A;  5FFX A;  1HW1 A;  1SFX A;  2K02 A;  2QBY B;  5CVV A;  3F23 A;  5CVI A;  3WTW C;  3R0A A;  4NB5 A;  4EM0 B;  2A6H F;  2GA1 A;  2ZNY A;  5LLQ A;  3F8F A;  2RVC A;  2G9W A;  1BJA A;  1BI0 A;  5LHG A;  4O6J A;  4UVC A;  4OU0 A;  3J81 K;  3O3K A;  4IXA A;  4P5O A;  2Z5U A;  1TW3 A;  4FHT A;  1DPR A;  4EJO A;  4K2E A;  2ZJ2 A;  1XB4 A;  3ELK A;  4LD5 A;  2QWW A;  3FXQ A;  3GLX A;  3HSE A;  2E7W A;  2EFN A;  2M1B A;  2HWV A;  3W6K B;  1FC3 A;  3J80 K;  4IRG A;  2ZXJ A;  5CVJ A;  5E8I A;  4UUV A;  4OIR F;  1DP7 P;  1QQI A;  3C7J A;  1TQM A;  2O6G E;  2MH9 A;  1ZN2 A;  2Q2E A;  4KIF A;  1MGT A;  2C6Y A;  1MKM A;  2GIV A;  4EM1 A;  4H0E A;  1YW9 A;  3AAF A;  1XGM A;  2P5V A;  2RV8 A;  4DNC A;  2HTJ A;  3V8L A;  2AS5 F;  2B0L A;  2P4W A;  2DPD A;  2OU2 A;  5DEQ A;  1YG2 A;  3PQK A;  2FSW A;  1REP C;  5DCM A;  2HQR A;  3KP5 A;  1SD5 A;  3ZMT A;  2HDC A;  2HZT A;  5EEH A;  3CJN A;  4HDU A;  1IUY A;  3KCC A;  5HS9 A;  4NQW A;  4EVI A;  5FLX K;  2FML A;  5TRD A;  3FHZ A;  3GFI A;  5H6R A;  5D5X B;  1P92 A;  3V7C A;  4ESB A;  2W24 A;  3QPT A;  3RJP A;  2BGC A;  3HHH A;  2OAZ A;  3KP4 A;  2XKO A;  5BPD A;  3WTS C;  5CJ9 A;  3L00 A;  3RIR A;  5E18 F;  4ZYD A;  3GFL A;  5HOO A;  4Y17 A;  1CF7 B;  4HQM A;  4L0Y B;  2ESH A;  1T98 A;  3GW2 A;  3TO9 A;  4FX4 A;  3I53 A;  3WTT C;  1Z9C A;  4AVP A;  4WWC A;  4G94 A;  2ESN A;  3QRF F;  2ZME B;  3KP7 A;  5FB2 A;  3CO7 C;  2MBF A;  1CGP A;  1O3S A;  4MQV A;  1RI7 A;  3M1E A;  4EV0 A;  2E1C A;  2VBX A;  4KYW A;  3R61 A;  4M9X A;  3WOD F;  2V6C A;  4BHP A;  2XAH A;  1L3L A;  1DPU A;  2VE8 A;  4KNY A;  2GWR A;  2RGV A;  5EEG A;  1SD7 A;  5AIQ A;  1R1V A;  1G3S A;  1ZRC A;  2ADU A;  4EJT A;  4YFN F;  4WXC A;  5LRS A;  4ZYG A;  1ZRE A;  3LA3 A;  3U2R A;  1FSE A;  2KJB A;  3FZV A;  4M72 A;  5ERI A;  3OV8 A;  4A2U A;  4IHS A;  1XD7 A;  1D8J A;  2KKO A;  4CYD A;  1TBX A;  1BC8 C;  3QOP A;  3RKX A;  1GXQ A;  3FMR A;  5L3D A;  1ODD A;  2KIU A;  4I0B A;  1TNT A;  1K6O A;  1PP8 F;  1NHA A;  3CTA A;  1WRJ A;  3PFI A;  1FPQ A;  3VEP A;  1ONV A;  4B09 A;  2PJP A;  3T0Y A;  4MTE A;  3DFG A;  4KFC A;  2DLL A;  2A61 A;  2EV6 A;  4KT5 C;  4LMY A;  3I58 A;  3DKW A;  3E6B A;  3JSO A;  4UV9 A;  3HRU A;  4U88 A;  2PFB A;  4QWQ A;  3MZY A;  3H92 A;  4I7H A;  3V7S A;  1L0O C;  2M87 A;  2LF7 A;  3BWG A;  2ZO4 A;  5L3F A;  4A6E A;  2HGC A;  2P6S A;  4LB6 B;  2F5C A;  2UZK A;  3WE2 A;  3F21 A;  3FF5 A;  4LK0 F;  3TO6 A;  2QQA A;  1YLF A;  3WU0 A;  3ZPL A;  1U5T A;  5JFR A;  5JI6 A;  5H6Q A;  2FE3 A;  4G6D A;  4S05 A;  2Y75 A;  4A0Z A;  2DK8 A;  3H3U A;  3B02 A;  1AOY A;  1YTY A;  4HV6 A;  3BY6 A;  4HX8 A;  1KYZ A;  3SXY A;  2XUB A;  2RQP A;  4LK1 F;  2CO5 A;  3IRR A;  3JW4 A;  2Y0M A;  3ML6 A;  5E1X A;  3IHU A;  3DF8 A;  2HR3 A;  3HOT A;  4LG0 B;  5CYV A;  2QZ8 A;  1HKS A;  2IA2 A;  1R23 A;  5DYM A;  2H27 A;  3WGI A;  4BHB A;  3HSR A;  4XLN F;  1X3U A;  3L9F A;  4A5M A;  1JHF A;  4TV7 A;  3REO A;  5D8K B;  1QZY A;  4GXO A;  4HLY A;  1I27 A;  2XAQ A;  3WG9 A;  4U7B A;  5TJJ A;  5L3E A;  3FM5 A;  2FBH A;  3TDZ C;  4L5J A;  1YIO A;  4LJZ F;  5D8L B;  1MZB A;  3K1P A;  5ICC A;  1BM9 A;  2VOD A;  3O2P E;  5CVR A;  2UWM A;  1FOK A;  4G8X A;  2ELH A;  3RKY A;  1QO0 D;  2YX7 A;  2DPU A;  2FF4 A;  4JQF A;  2PBI A;  2EFW A;  1XSD A;  3I59 A;  2JTV A;  5F64 A;  2P6T A;  2PMH A;  1OYI A;  5DCF A;  5BMZ A;  4WXD A;  2MLG A;  1OMI A;  2F5E A;  3EET A;  5ILV A;  4ESJ A;  2Z99 A;  4LFU A;  3TOA A;  2HYG D;  5IT3 A;  1XN7 A;  4XSZ F;  1ZLK A;  5HVQ C;  1TLH B;  3KEO A;  2HTS A;  4EQQ A;  5HDK A;  2QEN A;  2VC0 A;  4WX9 A;  2WTE A;  2JZY A;  2QUF A;  3ABT A;  3NQO A;  4L9J A;  2VBW A;  3E3V A;  5CVU A;  4G9Y A;  3E5X A;  2EV5 A;  3B73 A;  1ZAO A;  1O3Q A;  3K2Z A;  5L3B A;  3R60 A;  4RGS A;  2FRH A;  1PUE E;  1WSU A;  1JHH A;  3GXO A;  1ZG5 A;  2MLK A;  4HYE A;  5BS6 A;  1LJ9 A;  2GZW A;  2CYY A;  1QPM A;  2MA3 A;  3RKW A;  3QU3 A;  1LEB A;  3N97 A;  4S04 A;  4M9S A;  2XAJ A;  2A69 F;  4CHU A;  3MZH A;  3KP6 A;  1V4R A;  3CO6 C;  2IW5 A;  4BH9 A;  1J0R A;  3I4P A;  2VBZ A;  2OA4 A;  3GFM A;  4RAY A;  5HS7 A;  4O5V A;  2IJL A;  3GVA A;  2JPC A;  1B1B A;  3VB2 A;  3EQL F;  2OQR A;  3CUO A;  1R1T A;  2GA2 A;  3ZMD A;  3VOE A;  3CUQ C;  4PCQ A;  4HDV A;  2L02 A;  2FXA A;  3KET A;  3ZMV A;  2ETH A;  2V79 A;  3TGN A;  4XLP F;  4OIO F;  1G6N A;  2G7U A;  4N9I A;  1F1Z A;  2IVM A;  4KDP A;  3WU1 B;  1W4M A;  4OIN F;  1GXP A;  4L9T A;  4FT8 A;  4EJV A;  2BYV E;  4MQ9 F;  2DTR A;  1Z7U A;  4YIF A;  2EWN A;  2OBP A;  2Y48 A;  3P7N A;  2IRF G;  3JTG A;  5F1R A;  3MFK A;  2ZFW A;  5LBQ A;  2F5D A;  5CLS A;  2M5W A;  2NRA C;  4WF2 A;  3WGH A;  2LNB A;  5AON A;  2VC1 A;  4ZYE A;  1W7P A;  3JSP A;  2A68 F;  4DQ2 A;  1HKT A;  2DQR A;  1BI1 A;  2QVO A;  3WE3 A;  1IN5 A;  4HAM A;  4M6X A;  2L54 A;  4L5I A;  3I54 A;  5DV5 A;  3F22 A;  1PP7 U;  3HRS A;  3HRT A;  2V1X A;  3R0J A;  4GO1 A;  1LVA A;  2A6E F;  1YFH A;  2D45 A;  1Z6R A;  3HRM A;  2R7D A;  4AIJ A;  3MQ0 A;  1KYW A;  1PDN C;  2IT0 A;  4GCV A;  1RUN A;  4RGU A;  2O03 A;  3ULQ B;  2PG4 A;  2HQN A;  2G7H A;  1Y0U A;  3JAM Z;  1T2K A;  2H09 A;  1SD6 A;  2OZU A;  1G3W A;  1E17 A;  1R5G A;  1SFE A;  5D6E A;  1BC7 C;  1R1U A;  3Q9S A;  1HW5 A;  5D5U B;  1LDJ A;  2GQQ A;  4HQE A;  4IPA A;  5A2Q K;  1XGO A;  1RZ4 A;  3LA7 A;  1R00 A;  2HKX A;  1XGS A;  3DV8 A;  3F8N A;  5ICG A;  4I01 A;  2IA1 A;  1ZG3 A;  5FGM A;  2GXB A;  3L7W A;  1WWX A;  4N0B A;  1JXS A;  3M7G A;  2VT3 A;  2YSR A;  1U5T C;  3GFJ A;  2QYO A;  1KU2 A;  4MEY F;  4RGX A;  3LAJ A;  1S7A A;  2KJC A;  5LHI A;  1FYL A;  1DDN A;  1KGS A;  1FBU A;  2E7X A;  1ZG1 A;  2JT1 A;  4I02 A;  3RPQ A;  2P7C B;  3TKY A;  3EYI A;  3ZMZ A;  5BOX A;  1P4X A;  2CW0 F;  3RYR A;  1O3R A;  1D3Y A;  3M8E A;  1MD0 A;  4ESF A;  4G7Z F;  1P6R A;  4XSX F;  1SMT A;  1R5H A;  1FBQ A;  1XSX A;  1A04 A;  1D8K A;  1O7F A;  3COA C;  1MJA A;  5J8C A;  1ZGA A;  2HFH A;  2CG4 A;  3EUH A;  3ROU A;  2FNA A;  2W84 A;  3SZT A;  3RDI A;  1FWZ A;  2STT A;  2YR2 A;  5HS8 A;  1LDD A;  1TW2 A;  5D5W B;  4BAY A;  3CLO A;  1S29 A;  2D2W A;  1KU9 A;  2BEO A;  1QBJ A;  3I0T A;  3ZMU A;  1BN5 A;  3KLN A;  3BDD A;  3J80 Z;  3ERE D;  3FMS A;  1G3T A;  4LLG F;  2PEX A;  3CUQ B;  2Z3Y A;  3F8B A;  1KQ8 A;  3ECO A;  1RNL A;  3LWF A;  1WQ2 A;  3SHF A;  1KU7 A;  1J5Y A;  4ON0 A;  1MDM A;  1FYM A;  1ZHF A;  4BYY A;  4EMS A;  3QAH A;  3C18 A;  5D6F A;  4KMU X;  5HDN A;  1U8R A;  1BIA A;  2LKP A;  3IL2 A;  4IF4 A;  4LLL A;  1UHM A;  4Z2Y A;  3GWZ A;  4GGG A;  3T8T A;  1VTN C;  3ECH A;  3E5Q A;  1S6L A;  5ICE A;  2P5K A;  1LNW A;  2A3S A;  2R3S A;  3ISP A;  4GYG A;  4A0Y A;  4A12 A;  4M71 A;  3P9C A;  1H9G A;  1STZ A;  1OR7 A;  1EH6 A;  4ENM A;  4RS8 A;  1WI9 A;  3E6C C;  2VN2 A;  1SAX A;  1SFU A;  4Q5S F;  4KUM A;  3N4M A;  5E1W A;  2XRO A;  2NAZ A;  3TOB A;  4CDG A;  1LEA A;  4WK8 F;  4BNC A;  3HOS A;  3HUG A;  3KP3 A;  2EK5 A;  4KIC A;  6PAX A;  1T38 A;  1B6A A;  3F3X A;  3MCZ A;  4YFK F;  4HF1 A;  1K78 A;  1OPC A;  2DT5 A;  4U0W A;  1FY7 A;  1R22 A;  1ON1 A;  1J75 A;  4U7D A;  4A6D A;  2KIF A;  3WGG A;  1P2F A;  1BI2 A;  3M9A A;  3F8C A;  3E6M A;  5IT9 K;  1LDK B;  3GZ5 A;  2XRN A;  3LAP A;  2M8E A;  4BHC A;  1U3E M;  2NYX A;  4RAZ A;  2XHK A;  1E2X A;  3ZP5 A;  1FBS A;  4LB5 A;  2DU9 A;  3SFZ A;  2TDX A;  4L9V A;  2PLY A;  1ZYR F;  1HW2 A;  1C0W A;  3FM3 A;  3KFW X;  2DK5 A;  2ACJ A;  4I0A A;  3VOD A;  4B8X A;  1U5T B;  3QPH A;  2K4J A;  1UST A;  2YU3 A;  5DDG A;  2EB7 A;  3GEZ A;  1I1S A;  4ENN A;  1IXS B;  1MJ9 A;  2BE5 F;  4CZZ A;  3Q9V A;  4GYI A;  3E97 A;  2EV0 A;  3LFK A;  1JE8 A;  1I1G A;  2QLZ A;  2X0L A;  3Q5F A;  3U1D A;  2L4M A;  4I2O A;  1IRF A;  1BBY A;  4PDK A;  4OMY A;  3DP7 A;  3C3W A;  5J6X A;  4UHT A;  5DUK A;  3QP6 A;  2CQK A;  1XCB A;  4M9Z A;  3ZQ7 A;  1T6S A;  4M6Y A;  5JHU A;  2M45 A;  5LRR A;  4MTD A;  3BP8 A;  1Z91 A;  1V3F A;  4ZYH A;  2X4H A;  1GVJ A;  4R1H A;  2M30 A;  1UFM A;  2L01 A;  1RIO H;  1AWC A;  2W57 A;  1KA8 A;  1LQ1 A;  2CGP A;  4Q48 A;  4MEX F;  3FMQ A;  3OOP A;  1B9N A;  4P96 A;  2WC2 A;  4IRI A;  3D5L A;  1K79 A;  2QBY A;  4AIH A;  1XMA A;  5ILU A;  3K1M A;  1EV7 A;  1HST A;  3H3Z A;  1QZZ A;  3V8J A;  2MC3 A;  3GF2 A;  5K5O A;  2OQG A;  2GAU A;  2JRT A;  1LB2 A;  2EA2 A;  2DO7 A;  3ZN1 A;  3F72 A;  3QU6 A;  3SQN A;  5H20 A;  2O61 A;  1TQI A;  3K69 A;  3BRO A;  1H9T A;  5HLH A;  1FSH A;  1TTY A;  2FBK A;  3M8F A;  4RGR A;  1YW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...