3J7AO

Cryo-em structure of the plasmodium falciparum 80s ribosome bound to the anti-protozoan drug emetine, small subunit
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
79
structure length
79
Chain Sequence
YSYIPKQNKKLIYEYLFKEGVIVVEKDAKIPRHPHLNVPNLHIMMTLKSLKSRNYVEEKYNWKHQYFILNNEGIEYLRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
pubmed doi rcsb
molecule tags Ribosome/inhibitor
molecule keywords 18S ribosomal RNA
total genus 19
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF03501 S10_plectin Plectin/S10 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3j7aO00
1HXDA 2NNYA 4U7BA 1T6SA 5EEHA 3DP7A 3EDPA 2EWNA 2J5OA 2A69F 5LBQA 3LAJA 3ELKA 3DPTA 3GF2A 1ZG3A 3S2WA 1IW7F 2XHKA 4LLGF 2WTEA 4P55A 3GO5A 1XGMA 2H94A 1UHMA 4L5IA 2FNAA 4TV7A 5D6EA 1LDJA 1PDNC 3CJNA 1E17A 3SQNA 2NS0A 1BJAA 5EEGA 1EV7A 3DEUA 1FY7A 4WK8F 3WE2A 2KIFA 1P6RA 2DQLA 3MCZA 4OU0A 2IW5A 4L5JA 5FD6A 1WI9A 3O3KA 4G8XA 5LHIA 1QPMA 4A5MA 3MAJA 1SFEA 3L2CA 2IT0A 1TLHB 3J7AO 4ENJA 5TJJA 3C3WA 1J7KA 4HZFA 1P4XA 5BPDA 4LG0B 2QBYB 4BHPA 2P5VA 1STZA 1EH8A 2ESHA 3F8CA 2XV4S 3TO6A 3SHFA 4DNCA 3GFLA 3FF5A 4I2OA 3FXUA 4HBLA 1ZG1A 3DQVC 3OOPA 2ZMEB 3V4GA 3LAPA 4EVIA 1MJ9A 4RGSA 5ED4A 1G4DA 3W6JB 2EFWA 4E70A 1JHHA 2P6TA 2DU9A 2W57A 3K9TA 1F4KA 4MTEA 5ICFA 4YG2F 4GCVA 3IC7A 2VBYA 5F1RA 1PUEE 2RQPA 1AOYA 2ZJ2A 4D0PA 1P4WA 1SFXA 5DCMB 1LEBA 4PCQA 3BPVA 3E5QA 1PP7U 3FM3A 2H27A 1O3QA 3M1EA 3KLNA 4M73A 4EJVA 1XMKA 1XGNA 2Q2EA 3RPQA 2Z9OA 4HV6A 2IVMA 3M8FA 1MDMB 3I59A 1FLIA 2DAOA 4QWQA 1KYZA 4HLXA 4BHBA 1G6NA 3KP3A 4KUMA 1T0FA 4CICA 4RAZA 1HKSA 4Z2YA 2C6YA 1D8JA 2HWVA 5DUKA 1R5GA 3J81K 3K2ZA 2Z33A 1IN5A 4KMUX 3ERED 3ZN1A 2DW4A 3KFWX 1LJ9A 1F5TA 2XAQA 2VT2A 1QNTA 1ON1A 2K86A 5ERIA 1E2XA 3FMRA 2HKOA 2ELHA 4CXFA 2L4AA 3I58A 3WE3A 1IXRC 2PEXA 3E97A 2A6HF 2QVOA 1G3TA 4JBAA 4UV8A 1T39A 3IL2A 4KN4X 5DD8A 4L0YB 5AIPA 3H92A 2L02A 4WXCA 1TBXA 1WQ2A 1KU3A 2M45A 1B9MA 4IHSA 2GZWA 4R1HA 2E7WA 4ESJA 2GWRA 3ZMSA 5LRSA 2HYFA 5HS9A 5HLGA 5HS8A 3GX4X 1C0WA 1XSXA 4EM1A 2UXNA 4LK1F 5FD5A 3JSOA 4CZZA 3KP7A 3CDHA 2FE3A 4I7HA 4A5NA 3ZN0A 3K1MA 5LRRA 4IVNA 4KNYA 4I09A 2OU2A 2ZO4A 5DUIA 1ZN2A 2YU3A 2ESNA 1LDKB 3DFGA 4EM0B 3RYRA 1K79A 1HQCA 3HRMA 3D5LA 3DXJF 1OYYA 5FGMA 1J5YA 2QZ8A 4L18B 4AVPA 4A0ZA 3CUOA 2FOKA 3PQKA 2FBIA 4L9VA 1YW8A 1LVAA 1B4AA 2L3DA 1MD0A 3R61A 3M8EA 4M9ZA 2CWEA 4A12A 2OAZA 2D1HA 1HBXG 2VODA 1K7AA 1IRFA 2HYGD 4UXNA 3FHZA 3ZPLA 3HRTA 4WX9A 2A5YB 4IXAA 4HQEA 1K6OA 1IN7A 1Z91A 2X0LA 5K5QA 4ENKA 3MZHA 1Q1HA 2RVCA 4MNUA 5D5XB 3IKVA 4LFUA 3R6SA 2L01A 2QYOA 2RDPA 1AWCA 5D8LB 2Y0MA 4FX4A 1F9NA 2OQGA 5J8CA 1Z1DA 3FX3A 2WC2A 4EGZA 1V3FA 2HS5A 5DEQA 4MQ9F 1RZ4A 2HKXA 3RJPA 5ILSA 1XGOA 3E6MA 1VTNC 1OKRA 4MQVA 2M30A 2HTSA 1MDMA 3G73A 1ZARA 1HW5A 3HTUA 3LA7A 2QBYA 3KE2A 2V1XA 2F5FA 3QRFF 3TO9A 4BXUA 3P9IA 4KICA 1SFUA 4F7ZA 1QO0D 5E1XA 1H9TA 3KP5A 4Q48A 2PFBA 3N4MA 2KJCA 1XDUA 1W5TA 2JT1A 2VBWA 3WODF 1BM9A 4EJOA 2KIMA 3NQOA 2A07F 4IRGA 2M87A 1IN6A 3GWZA 1I5ZA 3KEQA 3WTSC 2FRHA 3J80K 1XMAA 2Y75A 5LEJA 2DLLA 2G7UA 4AD9A 2EB7A 4KA4A 1RI7A 2DPDA 2FU4A 1Y0UA 1FYMA 4M6XA 2XAHA 1A04A 4P9FA 3RKXA 2EV0A 1L0OC 1SAXA 1ON2A 5D4RA 3BWGA 4GO1A 1ZLKA 1KU7A 2FXAA 5DV5A 1YIOA 2HOEA 2DK5A 3RTRA 4KN7X 2BBYA 4FHTA 2PLYA 5LEKA 3WU1B 4ZZLA 3P7NA 3EETA 5JHUA 4M9SA 3F72A 5DYMA 1BI3A 2ACJA 4ZH4F 5ICGA 4MHGA 1YFHA 1Z6TA 1QQIA 2FMYA 1ULYA 1SMTA 1HW1A 1ZH5A 3SZPA 5D6FA 3QPHA 4IF4A 2DFIA 2VBZA 4L0ZB 5E1WA 1TNSA 1FSEA 4G7OF 2OBPA 3V8KA 1R22A 2O3FA 1U5TB 4UV9A 1FYLA 1B1BA 3MFKA 3O2PE 1BN5A 4CGZA 3WTZA 5IT3A 3COAC 3V8JA 2VC0A 1CF7B 2ZMEA 3C18A 3ZMVA 3EYYA 4L9JA 2Z99A 3B02A 2LSOA 2D2WA 1K78A 2K4JA 2XAJA 4LJZF 4LLLA 3VEPA 1J9IA 4CYDA 1W7PD 5HOOA 3KLOA 1ODDA 1RNLA 1MGTA 2XROA 1KYWA 4IHTA 1FBSA 1Z7UA 1YTYA 3F3XA 3GFIA 4Q5SF 2KRFA 4R79A 2UWMA 3V7SA 4KIFA 5L3CA 2DTRA 2OD5A 1GHCA 2QLZA 3K69A 3Q5FA 2LKPA 3W6KB 1BC8C 2KKOA 1JGSA 1I1SA 3V7RA 5BMZA 1MZBA 2ISYA 1ZGJA 2ZCWA 2COMA 2LDUA 4WWCA 6PAXA 1O57A 3ABUA 4GXOA 2BYVE 1OYIA 3I64A 3R60A 2Z5UA 2LF8A 2YX7A 4UVBA 1OR7A 4GYIA 2MBFA 3M9AA 2V1DA 5J8FA 5L3FA 2XASA 4I0BA 5HDNA 1U6GA 5FLXK 4IPAA 2OA4A 5D5UB 2O61A 1FOKA 1FBQA 2P8TA 2VN2A 3LFKA 2EFNA 2M8EA 5BOXA 2RC4A 4JQFA 2JSCA 1ZG5A 2UZKA 2BE5F 3C7JA 2PQ8A 5FO5A 1IF1A 4I01A 3KETA 2VXZA 4A0XA 3ISPA 5H6QA 2X4HA 1T38A 4WCGA 1R36A 5K1YA 3T8RA 4B09A 1S8NA 4LGWA 4DQ2A 1S7AA 4Y17A 3CO7C 1Z6RA 2HFHA 2XAFA 2BEOA 2XIGA 2HZTA 2XAGA 3AAFA 2A68F 3E3VA 2GA2A 1UB9A 4N0BA 2QQ9A 3PFIA 4OOIA 1DPRA 2STTA 2F2EA 2O6GE 2F5CA 5JI6A 3F8BA 2BGCA 2TDXA 4OMZA 1DP7P 4RS8A 1HW2A 2DQRA 4G7HF 2W24A 4HF0A 1OMIA 2AXLA 2EA2A 1TW3A 3K1PA 3I0TA 5BS6A 3HRSA 2P5KA 3E6BA 1XD7A 1XN7A 4XSXF 4RGXA 2Y48A 3RPUA 3KZYA 1XSDA 4BHCA 3ZMDA 2DK8A 2CO5A 1T98A 1WSUA 4U0YA 1XCVA 3CLOA 4PGHA 2YX4A 3QU6A 2H6CA 2WV0A 1HKTA 2RN7A 1ONVA 3DV8A 1R58A 3T8TA 5L3GA 3RKYA 4Q4ZF 2FMLA 2DI3A 1RUOA 4GYGA 3F8NA 4NQWA 2FQ3A 1O7LA 4KYWA 3Q9SA 4G94A 1OPCA 5ICCA 3QPTA 2Q0OA 3HSEA 4M72A 1ZLJA 1S3JA 4QLCU 1J2XA 2VT3A 4ZYDA 2PBIA 2EFPA 2FF4A 4P9UA 5CJ9A 1CGPA 1IRGA 2CW0F 3B73A 4R8HA 1BI0A 2E7XA 2MC3A 1YLFA 3BJAA 3IRQA 4OIQF 1FX7A 2K27A 2OQRA 2DO7A 5CVUA 3KEOA 5K5RA 3TO7A 2MLKA 3K1NA 4PDKA 4RB1A 3EQLF 1LB2A 4KDPA 1GVJA 4PGGA 2CYYA 2O0YA 5KVRA 1ZREA 2OZ6A 4YIIA 3C1DA 2HR3A 3U2RA 1TTYA 3WTTC 2OZUA 4A0YA 3WU0A 1J75A 3HUGA 1QZYA 2JZYA 4N9HA 3ECHA 2NRAC 3VODA 3SZTA 3BJ6A 5HDGA 3P9KA 1T2KA 2VBXA 3F6VA 2H6BA 3HTSB 2GXBA 3J80Z 1D8KA 4LMYA 3TDZC 1IZ1A 2FSWA 4RB0A 2E1CA 3U1DA 5LHGA 2AS5F 1BOAA 4P5OA 3GYHX 3D0SA 3H3UA 2QQAA 5L3EA 5D8KB 4MEXF 5ICEA 1FP2A 2JRTA 3EYIA 4OMYA 1SD4A 2JTVA 2VONA 1KQ8A 3CTAA 4UUVA 2MH2A 4ESFA 1YW7A 4B8XA 2H09A 3HSFA 1I6XA 1U5TC 3F8MA 2A3SA 3WTYC 1U2WA 1DDNA 4CO8A 1B59A 4A2UA 3I59B 2QM3A 3P9CA 4M74A 2XVCA 2R7FA 1BC7C 4YIFA 4BH9A 4N9IA 5TRDA 1HSJA 1X3UA 4ASNA 4BYYA 2J5PA 4LG0A 3BY6A 3KP4A 4MGRA 4P96A 4WXDA 4WF2A 3BOQA 5FLXZ 1FPQA 5FB2A 3IKTA 2MH9A 2V79A 4G6QA 2ISZA 3L9FA 3HOTA 3NEUA 1FT9A 2PMUA 2NNNA 1O3SA 4YFKF 4BQAA 5DDGA 1BI1A 2FEZA 1J59A 3V8LA 5LGUA 5DCFA 2RGVA 3BDDA 3M7GA 4IRIA 3IWFA 2NAZA 4XRFA 3TQNA 1O3RA 2QWWA 3E5XA 2P5LC 4YFNF 4KFCA 2F5DA 3VFZA 2P6SA 2ZXJA 3CUQA 3E6DA 4AWXB 4U88A 1REPC 2PN6A 4EV0A 3ZMZA 4OINF 3U9GA 4EJTA 1KQ9A 3JSPA 1QGPA 1HKQA 5JFRA 3DF8A 4KT5C 2P7CB 2ZBKA 1CF7A 3WGIA 2MA3A 3LQRA 1ZGAA 5F6FA 2HEOA 2IP2A 1P2FA 3LWFA 1KU9A 1K78B 1XGSA 2GIVA 3SFZA 3HSRA 4G9YA 4EGYA 1TNTA 1DPUA 1YO5C 3DKWA 1YYVA 2Z3YA 2R7DA 4Q47A 3WTXC 4BNCA 4YFXF 3QAHA 1FZPB 4M6YA 5HS7A 2FBHA 2K02A 3T0YA 3I5UA 1Z9CA 5BQTA 2PG4A 2B0LA 2XKOA 1IXSB 5K5OA 5CVRA 5FFZA 2O03A 1XB4A 4RB2C 1FP1D 4U0WA 4ZZDA 3GXOA 3HHGA 5CVVA 1F1ZA 3VB2A 4LB5A 2E1NA 2RKHA 1B9NA 2EJRA 4ENMA 1BIAA 5CVIA 1UCRA 3WTUC 3RKWA 2D1VA 3O6BB 1S7OA 4CDGA 3CUQC 5IT9Z 1TW2A 4A6EA 2EA4A 3KP6A 3WGHA 5ILUA 4ENNA 3RYPA 4EJWA 2CGPA 5DCMA 2DT5A 2HQNA 3LQQA 3GLXA 4HF2A 1J0RA 4U0VA 4G6DA 2CFXA 2EFOA 1MJAA 1W4MA 3F22A 2UXXA 5AIQA 3ULQB 3F6OA 3LSTA 4ON0A 1BIBA 4H0EA 4L9NA 4LK0F 3F21A 3ZQ7A 1YG2A 3HOSA 1D5VA 2FNPA 1KA8A 4NB5A 3ZMTA 4UVAA 3TOBA 4HLYA 1S6LA 2A61A 3TOAA 2V1UA 4RB3C 4HOBA 4IRHA 2VE9A 1KQ0A 2VOPA 2W84A 5JR3A 3TGNA 3N97A 2HGCA 3L00A 4U7DA 4UHTA 1MJBA 4XLNF 2RNJA 2ADUA 2XKPA 3MWMA 1U8RA 2NYXA 3NRVA 1XSVA 4HX4A 3R0AA 2Q8KA 1R00A 4HDVA 2R3SA 3LA3A 1YS6A 1GXPA 4ESBA 5IT9K 4OIPF 1U5TA 5LLQA 2HTJA 4IJAA 2GQQA 4I0AA 4EMSA 4HDUA 1EH7A 2G9WA 3JTGA 1QZZA 3L09A 4K2EA 1SD5A 1UHWA 1QBJA 4I02A 1MKMA 2DBBA 2XGXA 5LGNA 3CUQB 4Y15A 2LNBA 4HV5A 5HVQC 3GEZA 3HYIA 1W5SA 2V6CA 3FMSA 2CSOA 3ML6A 4HYEA 1YW9A 1KGSA 1R23A 3HIFA 4KIBA 2O8XA 4OIOF 5HLHA 1EH6A 4ZYGA 2LF7A 2EV6A 1HSTA 4RAYA 3ECOA 5D5WB 4RGUA 3TKYA 1ZYRF 3PQJA 3IWZA 1R1VA 3LA2A 4O3MA 1NHAA 4EJUA 1LDDA 3KZZA 3MZYA 2M1BA 1BI2A 3RI4A 2YPRA 2JPCA 2BV6A 4S04A 2ZKZA 4WXHA 3ROUA 2D45A 4MEYF 2K7LA 1USTA 3I71A 5KK1A 1R5HA 5E8GA 2QENA 4HQMA 1LQ1A 3I54A 4HF1A 2QQBA 4I98B 3IHUA 3QP6A 2ZNYA 2V9VA 4JK1X 2STWA 5AONA 5LHHA 1ZRFA 3GW2A 5CVJA 4M9XA 3MQ0A 3BJOA 3KP2A 1SD7A 3FXQA 4XBFA 4AIKA 1FYKA 2GXGA 1UFMA 4O5VA 3R0JA 1I1GA 1R7JA 4O6JA 2EK5A 1WRJA 1O7FA 4RGRA 1BBYA 3CO6C 4GGGA 2IPQX 2ETHA 5E1ZB 3GVAA 3EUHA 5H6RA 2P7VB 5CLSA 3GZ6A 3TDUC 4EM2A 1V4RA 4BAYA 4Y13A 4LB6B 1IN8A 1P92A 2F5EA 4FX0A 3JTHA 1JXSA 1ZRCA 3FXRA 5CYVA 2QUFA 3L7WA 3E6CC 1FWZA 3WTWC 3HHHA 5L3BA 4AIJA 1RUNA 5H20A 1PP8F 2FA5A 2KIUA 3OV8A 2ZFWA 1O3TA 2YR2A 1FSHA 1TQIA 3FM5A 4HAMA 2IA2A 1TQMA 1FC3A 1XCBA 3GZ5A 3V7CA 3F23A 2WWYA 3DPLC 3GUDA 3QU3A 3KCCA 4HA8A 5HDKA 5JVTA 2VOOA 2HQRA 3Q9VA 3HRUA 1OYWA 4FT8A 3WG9A 3K0LA 1L3LA 3QOPA 4A6DA 2IRFG 2IA0A 2ZNZA 1U78A 2PJPA 5F64A 2W25A 3MEXA 4AIHA 4PZJA 5A2QZ 3RIRA 1G3SA 2VC1A 1ZRDA 1I27A 1WWXA 1W7PA 2HDCA 2EFQA 4MTDA 3VOEA 1ZAOA 3FZVA 5E8IA 5L3DA 2GA1A 4KIGA 4L9TA 1P4AA 1IN4A 2A6EF 1YQAA 2M5WA 2P4WA 5E17F 2KJBA 4ZYEA 2XRNA 4ETSA 3RDIA 3BP8A 1LEAA 1TQPA 4CHUA 1IAWA 4UVCA 3WGGA 1D3YA 4NHJA 2EV5A 5D5VB 3WTVC 1R1UA 1LNWA 1G3WA 2MD5A 1Z05A 2JPBA 3GFMA 5E18F 2G7HA 5ILVA 4G7ZF 2W85A 3I53A 1JHFA 1FNNA 2L4MA 3R4KA 4S05A 1KU2A 2PMHA 4KMFA 5J6XA 1H9GA 1G3YA 2XUBA 3T1BA 3I4PA 1FBUA 5D4SA 5FFXA 3ZP5A 3BPXA 2DPUA 3BROA 2YSRA 1SD6A 1GXQA 2PI0A 3FWEA 5LGTA 3REOA 3JW4A 3SXYA 4EQQA 1ZHFA 1U3EM 4HW0A 1SMYF 4HX7A 1B6AA 3ABTA 1W7PB 5E20A 3T5XA 2L54A 4XLPF 5HLIA 3J81Z 1YS7A 1H0MA 5BPIA 4UNOA 3JAMZ 4M71A 2IA1A 4LD5A 1IUYA 2VE8A 1XDSA 4HX8A 1RIOH 1DUXC 3IRRA 3QP5A 5A2QK 4ZYHA 2FBKA 2MLGA 1R1TA 1USSA 1JE8A 3GFJA 3E5UA 3FMQA 2RV8A 3H3ZA 3BZ6A 4XSZF 3F8FA 2K4BA 1S29A 4OIRF 1WKMA 5DD4A 2CG4A 2IJLA 2CQKA 3JAMK 2GAUA 3G3ZA 4LLNA 1IXCA 3ZMUA
chains in the Genus database with same CATH superfamily
3ZQFA 4E7SA 1HXDA 4BE1A 2LLKA 4BU2A 4KISA 4MO7A 4CZCA 2NNYA 4U7BA 1OJLA 1T6SA 3IV5A 2F4MB 2EPFA 4A3LJ 3BR6A 5EEHA 2IGOA 3DP7A 3MMYB 2K5CA 2GLOA 1DU0A 4JX4A 3EDPA 3RQ4A 2EWNA 4C2TA 2DTZA 2J5OA 3M1CA 2A69F 3ZQCA 5GTHC 5LBQA 3LAJA 9ANTA 2DA1A 3K2AA 3ELKA 3DPTA 1YJ9I 5F1JA 5EGOA 1YE9A 1R4MB 3GF2A 5FJ8J 1ZG3A 3BG7A 3S2WA 2V6EA 1IW7F 3S3NA 2XHKA 4LLGF 2JUCA 3CQZJ 2WTEA 4P55A 5FRMA 3GO5A 1XGMA 2BHZA 2HU9A 2H94A 3IUOA 1UHMA 4L5IA 2FNAA 1ZGWA 4TV7A 5D6EA 1T8IA 1LDJA 3S1NJ 2UV1A 5EDNA 1E3OC 2LKSA 1PDNC 2XRLA 1HLVA 2XAUA 3CJNA 1JKPC 1E17A 3SQNA 4OAZA 2NS0A 4AVZA 3OYDA 1WZ2A 1BJAA 1TZLA 1PUFB 5EEGA 1EV7A 3MKZA 3DEUA 1FY7A 4WK8F 1I39A 3WE2A 2KDZA 2KIFA 2CQQA 2L7FP 1P6RA 1HDDC 4CCLA 1FTTA 1NH3A 3ZOBA 2DQLA 3MCZA 4PJMA 4QPQA 2DA7A 2KZVA 2Y69H 4OU0A 2IW5A 4L5JA 4A3EJ 5FD6A 1WI9A 1Z3YA 5F27A 5JLWA 3O3KA 4G8XA 5LHIA 1QPMA 5B1AH 2B9SA 1ORKA 4XKBA 4A5MA 3MAJA 2BXZA 5IP9J 1SFEA 2G0EA 2BXYA 3L2CA 2IT0A 1TLHB 2BVLA 2M3AA 3J7AO 3QODA 2BY0A 4PJ0C 4ENJA 5TJJA 4GRIA 4XR6A 3C3WA 1J7KA 2LRDA 2V7FA 5E3LA 1YJNI 4HZFA 2LVSA 3PO3J 4CYCB 1P4XA 5BPDA 4LG0B 1ETOA 2QBYB 4BHPA 2P5VA 3ZR8X 1STZA 1O4XA 4B3XA 1EH8A 2ESHA 5CKTA 3GTMJ 3F8CA 2XV4S 3TO6A 1VQKI 4LOCA 3HPGA 4RM2A 3SHFA 1F36A 4DNCA 3GFLA 2HQ5A 2Y0SA 3DCFA 3FF5A 1R5ID 3FXUA 4HBLA 1ZG1A 3CC7I 4I2OA 3JRBA 3DQVC 5F0HA 3OOPA 2ZMEB 3C2GA 3V4GA 3LAPA 4EVIA 5JHFA 1MJ9A 1A31A 1SFOJ 3VWBA 3FKJA 4RGSA 5ED4A 4Y4RA 1G4DA 3OSGA 3W6JB 1JT0A 2GIZA 3DEWA 2JJ7A 3A03A 1EKEA 4AC0A 2EFWA 4E70A 3BR5A 1JHHA 2CW7A 2P6TA 2ICWG 1ZELA 3K4KA 4CCNA 2DU9A 2W57A 3K9TA 1F4KA 2LY2A 4MTEA 5ICFA 4YG2F 4GCVA 2VB6A 3IC7A 4MFEA 2EINH 2WBMA 2VBYA 5F1RA 1PUEE 2RQPA 5F08A 3S3OA 3G4SI 3M8JA 1RETA 2IXSA 1AOYA 2ELKA 5JLXA 3RPUD 5FRNA 4Y52J 2VI6A 2JVGA 3QWLA 2ZJ2A 4BE0A 4D0PA 2L5QA 1P4WA 3BG5A 1SFXA 3B6CA 3C2BA 5DCMB 1LEBA 4G12A 4PCQA 3BPVA 1MNMC 3E5QA 2IEKA 1PP7U 3HM5A 1S7EA 2WAQN 3FM3A 2CS3A 3HKZN 4HSTA 4PSXA 1MBEA 4DYRA 1D1AA 4C2UA 1FOWA 2Y0SN 2H27A 1O3QA 3M1EA 4D1QA 3KLNA 4M73A 4EJVA 4PFPA 1XMKA 1XGNA 2Q2EA 3RPQA 2Z9OA 4XLAA 4BY1J 3HPHA 3M3YJ 4HV6A 3JRDA 2IVMA 3CCLI 2VXDA 2JVHA 3M8FA 1MDMB 3I59A 1FLIA 5DS9A 1IV6A 2DAOA 4QWQA 1KYZA 2KHMA 3DLAA 4HLXA 1U0JA 4BHBA 1G6NA 3KP3A 4KUMA 1RC9A 3HGYA 4NQWB 1T0FA 4D5FA 4CICA 4RAZA 2X1EA 1HKSA 2AHQA 4Z2YA 2F4OB 2C6YA 5M5YJ 4M3DA 1D8JA 1U8BA 2HWVA 3K7AJ 3H36A 1R5GA 5DUKA 3J81K 3A0HC 3K2ZA 1KZHA 4XRSG 2Z33A 1IN5A 4KMUX 3ERED 2MSYA 3ABLH 3ZN1A 2DW4A 3OYGA 3KFWX 1LJ9A 1F5TA 2XF7A 2XAQA 2VT2A 2OTJI 1QNTA 4RA2A 2HOTA 1ON1A 2K86A 4FE7A 5ERIA 2IS6A 1Y8QB 2JA5J 1E2XA 3UNGC 1OCPA 2NOGA 3FMRA 1MBKA 2HKOA 2ELHA 4CXFA 5K7ZA 2L4AA 3I58A 3WE3A 2ID3A 1GT0C 1SEUA 1K61A 1IXRC 2JA2A 2PEXA 3E97A 1RR7A 2HZDA 4XKCA 3OR1C 1H88C 2IBDA 2A6HF 3CCSI 5FROA 2QVOA 3C2HA 1G3TA 4IQJA 4JBAA 4UV8A 4A3KJ 5KAFC 2HPIA 1T39A 3IL2A 1BW5A 4KN4X 5DD8A 4L0YB 5AIPA 4XRSA 3H92A 2L02A 4WXCA 1TBXA 1WQ2A 2OUMA 1KU3A 1T56A 2ZJQF 1BL0A 2M45A 1B9MA 4IHSA 2GZWA 4BE2A 1ZK8A 2CUEA 4R1HA 1NTCA 1VZ0A 2E7WA 4ESJA 2GWRA 3ZMSA 5LRSA 2HYFA 5HS9A 5K7FA 5HLGA 3GTLJ 5HS8A 3GX4X 1C0WA 1HDPA 1XSXA 4EM1A 4KJZA 1TWHJ 5FLXZ 1JJ8C 2UXNA 4LK1F 5FD5A 3JSOA 4CZZA 3KP7A 5GTIC 1MSEC 2DODA 3CDHA 3OYKA 1MMDA 1WH5A 2EIKH 2FE3A 5F0CA 4I7HA 4A5NA 1FEXA 1PUFA 5B1BH 3ZN0A 1VFCA 3JR9A 3K1MA 5LRRA 3L1PA 4IVNA 3IAS2 3DWLE 1T0FC 4KNYA 4I09A 1G59A 2VQGA 5GAGJ 4PUSA 2NS7A 3BR0A 2OU2A 4XKVA 2ZO4A 3QYEA 1ZN2A 5DUIA 2YU3A 4ZTJA 1Z67A 2ESNA 1LDKB 2E60A 5KAIC 3DFGA 1A6QA 1TWCJ 1YITI 1D0XA 4F92B 2IGKA 3DEEA 4EM0B 3RYRA 4XOTA 4DGWB 1K79A 1HQCA 3HRMA 3D5LA 3G1LA 4HRIA 3DXJF 2L7MP 1OYYA 1UMQA 5FGMA 1J5YA 2QZ8A 3A02A 1OCCH 3PNVA 4L18B 3VYSB 2EH3A 4QSHA 2EZHA 2TCTA 5EG0B 4AVPA 4A0ZA 1SVLA 1IUFA 3CUOA 4C3IJ 3RCOA 4IOCF 3UR3C 2FOKA 4LIVA 3CCVI 1XG1A 2FBIA 3PQKA 2R7QA 4L9VA 2R0QC 1YW8A 1LVAA 1B4AA 2L3DA 1MD0A 3HB9A 3W6VA 3HZJA 3R61A 4BACA 2VPLA 3OYIA 3M8EA 4M9ZA 1SFKA 2DYSH 2CWEA 4A12A 2OAZA 2D1HA 1HBXG 2VODA 1IRFA 1K7AA 2HYGD 4UXNA 3OMYA 4NUBA 3FXLA 3FHZA 3ZPLA 3HRTA 2Y2ZA 4WX9A 2A5YB 2DA6A 4IXAA 1LVKA 1QHHD 4HQEA 1K6OA 1IN7A 1Z91A 2DDBA 2X0LA 2BVMA 3ZGKA 5H2FC 2EZIA 5K5QA 4ENKA 1S9HA 2IGNA 3MZHA 1Q1HA 1JKRC 2RVCA 4MNUA 5D5XB 3IKVA 2KDOA 5IYBJ 1ITYA 3JRFA 4LFUA 3R6SA 2L01A 2CV0A 2QYOA 2RDPA 1AWCA 3HKZA 2AO9A 5D8LB 2Y0MA 4FX4A 1F9NA 2OQGA 4RM3A 3GLLA 5J8CA 1Z1DA 3FX3A 1FIAA 2R7XA 2WC2A 4IL6C 3SZGA 1WJFA 3AL0B 4EGZA 1V3FA 2HS5A 2X1CA 2E2JJ 4XKWA 5DEQA 4MQ9F 3BR2A 4FASD 1RZ4A 1X1BA 4ZDPA 2R5YA 3GMEA 2HKXA 3EUHC 1ETVA 3RJPA 2W82A 1OFCX 3AG3H 3PUBA 3H0GJ 5ILSA 1XGOA 4E7LA 4XONA 3BG3A 3E6MA 3MVPA 1VTNC 1OKRA 2LC2A 4MQVA 2M30A 2HTSA 1MDMA 2OCCH 2LY1A 3ERMA 3G73A 1ZARA 1HW5A 3HTUA 3LA7A 2QBYA 2Q1ZB 3KE2A 2V1XA 2M8GX 4IEJA 1MSFC 2F5FA 2DMTA 2VKVA 4EEFG 2GM4A 2XB5A 1MNDA 3QRFF 2VKDA 3TO9A 2HXOA 3P9IA 4KICA 4BXUA 1SFUA 4F7ZA 1QO0D 3RQIA 5E1XA 1H9TA 4QTRA 3KP5A 4CCKA 3L2UA 2JMWA 4Q48A 4A3IJ 2PFBA 3S16J 3N4MA 2KJCA 1XDUA 1DP3A 1W5TA 2JT1A 2DJNA 2VBWA 2CUJA 2M7AA 3WODF 4BS9A 1BM9A 4EJOA 2KIMA 2K9SA 3G2BA 3NQOA 2BHYA 2I5UA 3SEZA 4IRGA 2M87A 2A07F 1IN6A 1P7IA 3K4BA 3GWZA 1I5ZA 3KEQA 3WTSC 2FRHA 3J80K 1P7JA 1XMAA 2IAIA 2Y75A 5LEJA 2CMPA 4F55A 2DLLA 2G7UA 4AD9A 2EB7A 2JRMA 1IJWC 2L7KA 1JJ6C 4KA4A 1RI7A 1FTZA 4II3A 1I3AA 2DPDA 1GV5A 2FU4A 2KLOA 1N77A 1YRNB 1R49A 2WAFA 1Y0UA 2CFOA 1FYMA 1RKTA 3A1YA 3K6GA 4M6XA 2XAHA 4UY8I 1A04A 4P9FA 3RKXA 2EV0A 1L0OC 1SAXA 3OS0A 1ON2A 2E5ZA 5D4RA 1BOBA 3BWGA 4GO1A 1ZLKA 1KU7A 3CMAI 2HOSA 2FXAA 5DV5A 4FE4A 1YIOA 1UG0A 2WAEA 2HOEA 2DK5A 3RTRA 2DOFA 2BBYA 2MW8A 4KN7X 2E2IJ 4FHTA 3RKQA 1W5CC 2MD0A 3KYLA 5IOYA 5IP7J 2PLYA 5LEKA 3WU1B 4C2MJ 4ZZLA 3P7NA 4HSRA 1ENHA 3BQZA 1AKHA 3EETA 5JHUA 4BJ5C 2W00A 4M9SA 3F72A 5DYMA 3VSLA 2XPUA 1BI3A 4OAYA 3ZXSA 2WADA 4C30A 2QGUA 1A36A 2ACJA 4ZH4F 5ICGA 4MHGA 2L9RA 3AG1H 1YFHA 3OIOA 1JKOC 1Z6TA 1QQIA 2FMYA 1ULYA 5J3LA 2DDAA 1SMTA 1HW1A 3ZQLA 2BY2A 1ZH5A 3SZPA 5D6FA 2CUFA 3QPHA 2NVYJ 3ONQA 4IF4A 3OL3A 2DFIA 2VBZA 2CV2A 2ZXWH 3WG7H 5C4XJ 2M0CA 4L0ZB 3VSKA 5E1WA 1TNSA 1FSEA 3CJRB 2ZXHA 3OIPA 4V2GA 4B43A 2DOEA 4G7OF 2OBPA 3V8KA 2HPMA 1R22A 4CCMA 2O3FA 4ANJA 1MBFA 1U5TB 4UV9A 1QA6A 4XOPA 1FYLA 1B1BA 3MFKA 2Y31A 4E7ZA 5C3EJ 3AKZA 3O2PE 1BN5A 5B3SH 1X4PA 1WJAA 3TW6A 3WTZA 5IT3A 4CGZA 4DIQA 2H8WA 3COAC 3V8JA 2VC0A 4BQQA 4E6KG 1CF7B 2MYSA 3BR1A 2ZMEA 3HG9A 2LYCA 3OYEA 3C18A 1W0UA 3ZMVA 3HJEA 4HNTA 2MFZA 3EYYA 4L9JA 2Z99A 3B02A 2LSOA 4LIUA 2D2WA 1K78A 2K4JA 1Y39A 3KZIC 3DLLF 2XAJA 4LJZF 3TBIA 4LLLA 3VEPA 1J9IA 4CYDA 3M4OJ 1W7PD 1R4NB 2JSPA 5HOOA 3S1RJ 2ELJA 3KLOA 4RMNA 1ODDA 1RNLA 1MGTA 2XROA 1KYWA 2OPTA 3VYTB 2K3PA 1X3ZB 5EZGA 4IHTA 3S15J 2COBA 1DGWY 2KZGA 2V9KA 2CQNA 1IRXA 3ESWB 1W1WE 1FBSA 2HVRA 1Z7UA 1YTYA 3F3XA 3AL0C 1VQ4I 3H9QA 3LOCA 3GFIA 2V26A 3O8GA 4Q5SF 2KRFA 2HI3A 4R79A 2UWMA 2KL4A 3TW7A 5IY5H 3H0DA 3V7SA 1WVRA 4CUGA 4KIFA 4ZJZA 5L3CA 2DTRA 2DYRH 2OD5A 3DPUA 3E0JB 2F48A 2F6CA 1GHCA 2NVTJ 1G8XA 2QLZA 3K69A 1BR1A 3Q5FA 2LKPA 3W6KB 3PM1A 1A5JA 1BC8C 2DA3A 2ZSHB 2KKOA 1JGSA 1I1SA 3V7RA 5BMZA 3EUAA 3ABMH 3PSFA 1MZBA 1FOXA 2ISYA 1ZGJA 1WI3A 2ZCWA 2COMA 2GOXB 2LDUA 3E1SA 4WWCA 2DXIA 1LFUP 4YELA 6PAXA 1Z7LA 1O57A 4PJLA 3ABUA 5KHDA 1X1PA 3OL4A 2HVSA 3U1KA 2XF6A 4GXOA 2BYVE 2WA0A 3SFIA 4A3CJ 3SDGA 3Q0VA 4CYCA 1OYIA 1V54H 3I64A 3R60A 1WCMJ 2X51A 2Z5UA 2LF8A 3TMOA 2YX7A 4FETA 4UVBA 1OR7A 4GYIA 2MBFA 4DJAA 3M9AA 1U9OA 2PMZA 1NK3P 2V1DA 4F3QA 5J8FA 3ABKH 4C3HJ 1DGRM 5L3FA 3OS1A 2XASA 3CCRI 4I0BA 5HDNA 4ABZA 1U6GA 5FLXK 5DM7F 1V5FA 1WH7A 2OA4A 3M07A 1BR2A 4IPAA 5D5UB 3K4JA 2O61A 4XN3A 4I6ZA 1FOKA 1FBQA 2P8TA 1WPKA 4PFOA 2VN2A 5M3FJ 3LFKA 1SAUA 4RAFA 3LSIA 2EFNA 2M8EA 1QHGA 1IRZA 1QRYA 4YIRX 5BOXA 1R9TJ 2RC4A 2RAEA 4JQFA 2JSCA 1ZG5A 1JTXA 2UZKA 2BE5F 2Q2EB 3C7JA 2PQ8A 5FO5A 1IF1A 3ZRGA 4I01A 1W0TA 3G71I 3LNQA 5J1RA 3HBLA 3KETA 4BBRJ 2A05A 2E71A 2VXZA 5J4VA 4A0XA 2VJIA 3ISPA 5H6QA 2X4HA 3VDXA 1T38A 4PJNA 4WCGA 1R36A 5K1YA 1WJCA 5FKMA 3UKGA 3T8RA 4DBQA 1MNEA 4B09A 1S8NA 4LGWA 4DQ2A 1S7AA 2TRTA 4Y17A 3CO7C 1OLTA 1Z6RA 2YU9J 2HFHA 2R5YB 1ETYA 2K9QA 2XAFA 1ETQA 1MBHA 1Y56A 2BEOA 2XIGA 2HZTA 2XAGA 3AAFA 2A68F 4NC8A 3VYUB 3CF5F 3RSNA 3H3VK 2XSDC 3E3VA 2GA2A 2EIMH 5KNLA 2YS9A 1E3HA 1UB9A 4N0BA 2Y9YA 2QQ9A 2R7UA 3W2WA 5BNGA 1FOYA 5KCMA 1WFXA 3PFIA 4OOIA 3ASNH 1DPRA 5EF6A 1N25A 2R7OA 3GTOJ 2STTA 4AU7A 3ZCOA 2E1MB 1D1CA 3LSPA 2O9LA 2EZLA 2F2EA 2YUSA 3WHCA 2O6GE 2F5CA 5JI6A 3F8BA 3HGGA 2BGCA 2TDXA 2E1MC 2QSFX 2JA8J 4OMZA 5FKLA 1DP7P 4RS8A 2JUGA 1HW2A 2DQRA 4G7HF 3NAUA 4XIDA 1FMWA 2VKHA 2K9NA 2W24A 4HF0A 2PJRB 1DQUA 1OMIA 2NXNB 4NNJA 3BTJA 2AXLA 2EA2A 1TW3A 3K1PA 1D0ZA 3I0TA 3TL4X 5BS6A 2GXAA 3HRSA 2XGEA 4HNVA 2P5KA 3E6BA 1XD7A 2LK2A 1XN7A 4XSXF 4ITVA 4RGXA 2Y48A 2WB1A 3RPUA 3KZYA 4U87A 1XSDA 2KPMA 4B3AA 3L2WA 1QVTA 4BHCA 3ZMDA 2DK8A 2CO5A 1T98A 2VPRA 4DW6A 1WSUA 2VIXA 4U0YA 2L2OA 1XCVA 2NVXJ 1QPIA 3CLOA 4PGHA 3VPRA 2MGQA 2YX4A 4AM3A 3QU6A 1T95A 1MMSA 2H6CA 2O8KA 2WV0A 3HL2A 1E3PA 1HKTA 3HOUJ 2KP6A 2RN7A 5GAHJ 1YX5A 1ONVA 3DV8A 1G2HA 1R58A 3T8TA 1K4TA 5L3GA 2DFHA 3RKYA 4Q4ZF 2KQRA 2FMLA 3NWTA 1MMGA 2DI3A 1RUOA 4GYGA 3F8NA 4NQWA 2FQ3A 3LL7A 2QQ8A 1O7LA 4KYWA 4FTHA 1LE8B 3Q9SA 2HQAA 4G94A 1OPCA 5ICCA 3QPTA 2Q0OA 3J7AY 1HCRA 3HSEA 4M72A 3FHNA 1ZLJA 4XORA 2PX9A 4AIDA 2DFEA 2LBFB 1VQ5I 3E7LA 1S3JA 2DA5A 4QLCU 3X2QH 1J2XA 2VT3A 2XSJC 2F4IA 3DKXA 2PBIA 4ZYDA 2EFPA 3A01B 2FF4A 4KT6A 4P9UA 5CJ9A 3BR3A 1CGPA 1IRGA 4JOMA 4ZYAA 3B73A 2CW0F 3KYDB 4R8HA 1BI0A 1IV8A 2E7XA 2MC3A 2H8RA 1YLFA 3BJAA 3FXJA 1V55H 3IRQA 4OIQF 1FX7A 3MN2A 2K27A 2OQRA 3PJRA 2DO7A 5CVUA 3KEOA 5K5RA 3TO7A 1ZR4A 2MLKA 3K1NA 4PDKA 4RB1A 3EQLF 3J7YJ 1LB2A 4UB8C 4KDPA 1GVJA 2CYYA 4PGGA 2ME0A 4Z6YA 2O0YA 5KVRA 1ZREA 2DJIA 2OZ6A 2L9VA 1GDTA 3BTIA 4YIIA 2MG4A 3C1DA 2HR3A 3U2RA 1TTYA 3WTTC 3QPLA 1YHQI 4CCOA 2OZUA 4A0YA 3HUGB 3WU0A 1J75A 3HUGA 2DA4A 3J7ZI 2E5NA 2EZKA 3W3CA 1QZYA 2JZYA 2FX0A 1NG7A 4MFDA 4N9HA 1ZR2A 3ECHA 2FOWA 3JRGA 3VYRB 3VODA 2NRAC 3SZTA 3BJ6A 5HDGA 3TEDA 3P9KA 1T2KA 1NK2P 2VBXA 3F6VA 2H6BA 3HTSB 2GXBA 1BR4A 3J80Z 2LREA 1D8KA 4LMYA 2AQFA 3TDZC 1IC8A 1IZ1A 2FSWA 4JX5A 2RREA 4RB0A 4M3GA 3CZ6A 2E1CA 3LFUA 3U1DA 1XS9A 3CLQA 3K4MA 5LHGA 2AS5F 1MBGA 1BOAA 3DBLB 2WY8Q 4P5OA 5IP6A 3GYHX 3D0SA 3H3UA 2QQAA 3S3MA 2VQHA 2X9DA 4DYQA 2L9SA 5L3EA 5D8KB 3HDDA 2Z1DA 1K4SA 4MEXF 5ICEA 1FIPA 1FP2A 4GDFA 2KT0A 4I99C 3OYCA 2JRTA 2CRGA 1UELB 3EYIA 4OMYA 1SD4A 1UHSA 4JP0A 2JTVA 2VONA 1J09A 2OC6A 3FKIJ 1XX5A 1TT5B 5CQEA 1X1AA 3JRIA 3DU5A 1I3QJ 1KQ8A 3OYJA 3CTAA 4UUVA 2MH2A 4ESFA 1YW7A 3K10A 1MMNA 2X1DA 4B8XA 2VJ4A 2W1OA 2H09A 3HSFA 3GTGJ 4BKXA 1I6XA 4A69C 1U5TC 2LP0A 3H5RA 3F8MA 2A3SA 3WTYC 1U2WA 1DDNA 4CO8A 1B59A 5E3MA 4A2UA 3S14J 2MABA 2V1NA 3I59B 3I9V2 3S17J 2QM3A 2VQCA 1UJ8A 1YX3A 3P9CA 4M74A 4BY7J 3WU2C 2XVCA 4QPOA 2HYJA 4FISA 3CCEI 2CV1A 1D5YA 1TWAJ 2P0WA 2R7FA 1BC7C 1YRNA 4YIFA 1V5EA 1IO2A 2EIJH 4BH9A 2CQ7A 2BY3A 4N9IA 2M7BA 3BG6A 5TRDA 5JVGF 2CQXA 4XM3A 4IO9F 1HSJA 1X3UA 4ASNA 1KONA 4BYYA 1Z77A 2J5PA 4LG0A 5GAEJ 1XTAA 4BJ6C 2QSHX 1JUSA 2M0MA 3BY6A 3KP4A 4MGRA 4P96A 5F04A 4WXDA 2K40A 3BOQA 1P9QC 4WF2A 2V9PA 4F93B 2L9NA 1FPQA 5FB2A 2K3FA 4RBOA 3IKTA 3MKWB 3CF2A 4BDZA 1VQOI 2MH9A 3OYBA 2V79A 4G6QA 2BW3B 2ISZA 3L9FA 2I8DA 2XPVA 3OYNA 3HOTA 3PFYA 4F91B 3NEUA 1QVUA 3A2KA 1FT9A 1Z0XA 2PMUA 4XLHA 5FLMJ 2NNNA 3CCQI 1EF4A 1O3SA 3ZQQA 3GTJJ 3BCAA 4YFKF 1HA8A 1TC3C 2OTLI 2LKXA 4BQAA 1H8AC 5DDGA 2ME6A 1GVDA 2KISA 1BI1A 2FEZA 3A4CA 1J59A 4M3FA 4G6TB 4NDLA 3V8LA 3LSJA 5LGUA 1VQ9I 5FKNA 5DCFA 2RGVA 2VASA 5J40A 3BDDA 3M7GA 3CC2I 2M2EA 4IRIA 3IWFA 2NAZA 4XRFA 3TQNA 4B1RA 3GTPJ 1O3RA 1S5LC 2QWWA 3E5XA 2P5LC 4JX6A 4XK4A 4YFNF 3PNTA 4KFCA 3JRCA 3ZQGA 3GZNB 2F5DA 5EZHA 3I55I 4V19K 3VFZA 2BW3A 2P6SA 2ZXJA 3CUQA 3KX2A 4B47A 5J47A 3E6DA 4AWXB 3DBRB 4BXFA 4CSWA 2VUMJ 4U88A 1REPC 2BZTA 2PN6A 1EA3A 2DA2A 4M6VA 4B4CA 4EV0A 1HOMA 3Q3SA 3OOUA 3ZMZA 4FCYA 5FKOA 4OINF 3GTKJ 4AYBA 4BDYA 3U9GA 4EJTA 1KQ9A 4ZDLA 3JSPA 2ID6A 1QGPA 1HKQA 5JFRA 3DF8A 2M34A 3MKLA 4KT5C 3HOWJ 2P7CB 4UUSB 2ZBKA 3G1MA 1CF7A 3WGIA 2MA3A 3LQRA 1ZGAA 3H9GA 5F6FA 2HEOA 2LTPA 2R4GA 2IP2A 1P2FA 4XMYA 3LWFA 1KU9A 1MH4A 4A3BJ 1K78B 2DCEA 1LE8A 2WB1N 2PJRA 2KRHA 2MC4A 3AG4H 1LFBA 1XGSA 4BJTA 5B66C 3OIQA 2Z2SB 3B6AA 5M3MJ 2GIVA 3K4CA 3SFZA 2ECBA 3HSRA 4G9YA 4EGYA 4LG3A 4BQOA 1OISA 4D7NA 1TNTA 1DPUA 1YO5C 3DKWA 3ZQHA 1YYVA 1S72I 2Z3YA 2R7DA 3WHBA 1FJLA 4B44A 4Q47A 3WTXC 1V5GA 2W4SA 4YFXF 4BNCA 2CH0A 1Y0NA 3QAHA 1FZPB 4M6YA 3W2VA 5IYDJ 2KMUA 5HS7A 2FBHA 2JA7J 2K02A 3T0YA 4RDUA 3G1OA 2NVQJ 3I5UA 4I76A 4AYBN 2KFDA 1VI0A 3CCUI 1Z9CA 5BQTA 2LOOA 2PG4A 1WGXA 3LSHA 1XMXA 4IHYA 1UZCA 2B0LA 2QKMB 2XKOA 1IXSB 4Y7NJ 1K6YA 5K5OA 5CVRA 1VQNI 4XN0A 4UUSA 5FFZA 2O03A 1XB4A 4RB2C 1LFPA 1FP1D 4U0WA 4ZZDA 2Y9ZA 2DN0A 3GXOA 3HHGA 5CVVA 1F1ZA 3VB2A 1Y1VJ 2E1NA 4LB5A 1X2NA 2RKHA 2RNGA 2DFFA 2K9MA 1B9NA 2EJRA 3DTIA 1ETXA 2E36A 5M5WJ 2LG4A 4ENMA 1A35A 1BIAA 5CVIA 1UCRA 3WTUC 3RKWA 1B72B 5EEAA 2D1VA 4J00A 5GPAA 3O6BB 1S7OA 5TGTA 4CDGA 2LD5A 3CUQC 3D5RC 1QZEA 4XL9A 5IT9Z 3PL8A 1TW2A 2H1LA 4XLEA 1SVMA 4A6EA 3H5AA 3PUFA 2EA4A 3KP6A 3S93A 1OR7C 3WGHA 5ILUA 1GUUA 1VQ8I 4ENNA 5J1YA 3RYPA 4EJWA 2CGPA 5DCMA 2DT5A 2HQNA 3LQQA 3GLXA 4DOZA 5GADJ 1ZQ3P 4HF2A 1J0RA 4U0VA 3CMYA 4G6DA 4GFBA 1FMVA 2CFXA 4YEJA 2EFOA 2F5VA 4HNUA 1MJAA 1W4MA 1LKXA 2DMNA 3F22A 2XF5A 2UXXA 2M4GA 5AIQA 3ULQB 2BY1A 3F6OA 2XPWA 3LSTA 4XLFA 4ON0A 4MLOA 1BIBA 4L9NA 4H0EA 5J4YA 4LK0F 3F21A 3ZQ7A 3K70C 2RQQA 3IP4B 1YG2A 3H35A 3HOSA 1D5VA 2FNPA 1IDYA 3CMMA 3O8HA 1Q1VA 1AU7A 3CCMI 2R93J 1SC7A 1KA8A 1VQPI 2LFBA 4NB5A 3ZMTA 2NOJB 2R7TA 1A6IA 4UVAA 3TOBA 4L5EA 3LSKA 4HLYA 1S6LA 4NC6A 2A61A 3QQAA 3TOAA 1JUPA 2W48A 2VL8A 2V1UA 4MIMA 4RB3C 3ASOH 4JYKA 4HOBA 4IRHA 1QU3A 2VE9A 2QA4I 1KQ0A 2VOPA 4W97A 2W84A 5JR3A 1VQ7I 3TGNA 5EGOB 3HOZJ 2FJ1A 2JA6J 3N97A 2HGCA 3L00A 4U7DA 4UHTA 1MJBA 1WHUA 1R71A 2M9HA 4XLNF 2EQRA 2DOAA 2IS4A 4ZTFA 2RNJA 2ADUA 2XKPA 3BQYA 3MWMA 4PSWA 1U8RA 4E7IA 2NYXA 3NRVA 1XSVA 4HX4A 3R0AA 2Q8KA 1R00A 4HDVA 2R3SA 3LA3A 1YS6A 1GXPA 4ESBA 5IT9K 2HDWA 2IGMA 3HC7A 2VLAA 4OIPF 1U5TA 1IGNA 1I6HJ 3HOXJ 5LLQA 2HTJA 4IJAA 3MKYB 2GQQA 5LFAA 4I0AA 1W36D 4HPQA 4X0GA 4EMSA 4HDUA 1EH7A 5IOZA 2G9WA 3JTGA 1OCZH 2OCEA 2I10A 3OWTA 1QZZA 3CMEI 4N4OB 3L09A 4K2EA 1SD5A 1UHWA 1QBJA 4I02A 5GP9A 5J1UA 3S32A 2LR8A 1MKMA 1DU6A 4M3EA 1E0EA 3DKYA 4D9JA 2WAQA 2VQLA 2WV1A 2DBBA 2XGXA 4Y15A 3CUQB 5LGNA 2CW8A 2LNBA 3FDYA 4HV5A 2R5ZA 1ERDA 1PJRA 5HVQC 3GEZA 3HYIA 3Q0UA 3DTKA 2DT6A 1W5SA 2V6CA 3FMSA 2R5ZB 4IHXA 3D5SC 2CSOA 3ML6A 4HYEA 1YW9A 2ZSIB 1K83J 1R23A 1KGSA 3KIOA 4Y3OA 3HIFA 5M5XJ 4KIBA 1APLC 1JGGA 2O8XA 1X58A 1VQMI 4OIOF 2R7SA 5HLHA 1EH6A 4ZYGA 2LF7A 2EV6A 4C9YA 1HSTA 1B8IA 4RAYA 3ECOA 5D5WB 3PNYA 4RGUA 2HDDA 3S2HJ 1POGA 3TKYA 1BJZA 1ZYRF 4DZJA 3PQJA 3IWZA 1R1VA 3LA2A 4PK4A 3S1MJ 4O3MA 4IKFA 1NHAA 3GCMA 3TP3A 1JKQC 4EJUA 1LDDA 2W7NA 3KZZA 3MZYA 2FD5A 1PYVA 2LBFA 3KEYA 2R7ZJ 1IG7A 2M1BA 1BI2A 1WJ5A 3RI4A 4S0HB 4HEA2 3BTLA 2R7WA 2HOAA 2YPRA 4RLQA 3I3LA 2JPCA 2BV6A 4H4KC 4S04A 4D7MA 2AQEA 2ZKZA 4WXHA 3ROUA 2D45A 1AKHB 4MEYF 3CD6I 2K7LA 4Y33A 1USTA 2O5RA 4EATA 1WJBA 3I71A 3KPHA 2OJED 5KK1A 2M4KA 1R5HA 3CDIA 3SEQA 2A5WA 5E8GA 3A01A 2QENA 4HQMA 1CQTA 4XQFA 5FKKA 1LQ1A 2XDVA 3FBIB 4BEHB 3I54A 4HF1A 3FBNB 4BEHA 2P81A 1X3WB 2NS8A 2QQBA 1U9NA 1TP4A 4I98B 3IHUA 3OYAA 1RR8C 3CJTB 3QP6A 3H1CA 2ECCA 3FK7A 2ZNYA 2N8GA 2V9VA 4JK1X 2STWA 5AONA 5LHHA 3L2VA 1ZRFA 1TT0A 5HODA 3GW2A 4A3GJ 5CVJA 2AXTC 4HG2A 4PJJA 5E3OA 4KITB 1LPQA 1MMAA 5LD2C 3K70D 3QYBA 4M9XA 3MQ0A 3BJOA 2K9LA 3KP2A 3I4MJ 1SD7A 3FXQA 4XBFA 4AIKA 1FYKA 2GXGA 1UFMA 4O5VA 2DMPA 2FUG2 3ZQIA 3R0JA 1I1GA 1R7JA 4CH7A 4IX7A 3BT9A 4O6JA 2EK5A 5EJCA 2R7VA 1H89C 3H9JA 1WRJA 1O7FA 4RGRA 3CCJI 1BBYA 1R6RA 2E1OA 3CO6C 4GGGA 3IH2A 2IPQX 3CDLA 4BXXJ 5F0FA 2ETHA 5E1ZB 5CQGA 3OYFA 1ZKGA 3GVAA 5DTDA 3CCYA 3EUHA 2QCOA 3JRHA 1ZTRA 5H6RA 2EILH 3I56I 2P7VB 4II2A 5CLSA 3DTEA 3GZ6A 3TDUC 1RPWA 4EM2A 1V4RA 3BG9A 4BAYA 3IH3A 4LB6B 4Y13A 2ZJRF 2DT7B 3RZOJ 3A0BC 4ZDOA 1IN8A 1MIJA 1P92A 3LMMA 3L2QA 1AHDP 2JN6A 2F5EA 4FX0A 1OCTC 3JTHA 1JXSA 1ZRCA 3FXRA 4FQGA 5CYVA 2QUFA 2WY7Q 4E4HA 5C44J 1M1EB 2L0KA 3JREA 3L7WA 3E6CC 4BUPA 1JT6A 1FWZA 3I4NJ 2OF7A 4E7HA 3WTWC 4CA0A 3QYFA 3HHHA 5L3BA 4E7KA 3SYTA 5TISC 4AIJA 1D0YA 1RUNA 5H20A 1NG6A 2FA5A 2KIUA 4XLCA 1PP8F 3JRAA 1PVEA 1OCOH 3GBGA 2ZXIA 3DU6A 3OV8A 2O7OA 2ZFWA 3BC8A 3HXLA 1O3TA 1Y1WJ 2YR2A 1FSHA 1TQIA 3FM5A 4XRMA 4HAMA 3V42A 3OY9A 2IA2A 1TQMA 4A93J 1FC3A 1XCBA 3GZ5A 2CUZA 3V7CA 3F23A 1RKWA 5B5EC 2WWYA 3RZDJ 1YOVB 3DPLC 2KIQA 3GUDA 2ZFUA 3QU3A 3OSFA 3KCCA 4HA8A 5HDKA 5JVTA 2VOOA 2HQRA 4X1EA 3BCBA 4UB6C 4AUXA 4A3DJ 3Q9VA 4X6AJ 3HRUA 3TP0A 1TL8A 3QOEA 3BZCA 3CJQB 3S8PA 2LMDA 4ZC3A 1OYWA 4FT8A 3HEFA 4W1UA 3WG9A 3K0LA 1L3LA 3IAM2 3CP8A 4C3JJ 1F43A 3FK6A 3U21A 3QOPA 4A6DA 2X6WA 2IRFG 3FXKA 2IA0A 2ZNZA 3DBHB 1U78A 1VQLI 2UUZA 2PJPA 5F64A 2HNHA 2W25A 2Z16A 3MEXA 4AIHA 3OS2A 4PZJA 2DMUA 2HVQA 5A2QZ 3PIOF 3SJMA 3BTCA 3RIRA 3NARA 1G3SA 2VC1A 2QEXI 3MD2A 1ZRDA 5EG0A 1HC8A 2E19A 1I27A 2NVUB 5HNHA 1D1BA 1WWXA 1W7PA 2HDCA 1VQ6I 5GPCA 4BQNA 2JWTA 1BW6A 4YRVA 2EFQA 5HLTA 4IHWA 2H1KA 2IS2A 1OQYA 4MTDA 3VOEA 4DBRA 3OYHA 3PO2J 1ZAOA 2ZJPF 3FZVA 5E8IA 4E7JA 5L3DA 2GA1A 4KIGA 2E2HJ 4IQ4A 3F0CA 4L9TA 3L2RA 3NWSA 1UG2A 2R7RA 3HOVJ 1XC5A 1P4AA 1IN4A 2A6EF 1YQAA 1JI8A 2M5WA 3EPZA 2P4WA 5E17F 2KJBA 2V4JC 4CCJA 4ZYEA 1WJEA 3CP2A 3OYMA 2XRNA 4ETSA 3RDIA 1UAAA 3BP8A 1VF9A 1ACIA 1LEAA 4A3FJ 1TQPA 4B48A 4CHUA 3JCUC 4RLFA 2DMQA 2PMZN 3MZ8A 4NBQA 1IAWA 1MW7A 4UVCA 3P5JA 4XNFA 3WGGA 5CPRB 1D3YA 2X6XA 4NHJA 2JK3A 2EV5A 2B7EA 5IPAA 5IYCJ 5D5VB 1R1UA 3WTVC 4A3MJ 1LNWA 2BOLA 1G3WA 4F52A 4IHVA 2MD5A 2ZC2A 1Z05A 2JPBA 4V2FA 3GFMA 5E18F 4UUTA 3LSGA 1X2MA 4RAGA 5E79C 2G7HA 5ILVA 1TWFJ 1Z3XA 2XGDA 4G7ZF 1B72A 2X6YA 2W85A 3I53A 1JHFA 3SDBA 2E35A 2X6OA 1FNNA 2L4MA 3R4KA 4DYCA 4S05A 1KU2A 4N4NB 3QPSA 3F9KA 3BLYA 2CJJA 2PMHA 4KMFA 5J6XA 1H9GA 2IS1A 2GBYA 2XB0X 2QKLB 2EBIA 2Y30A 1G3YA 1SANA 3OYLA 2XUBA 2VKEA 1Y8RB 4P1WA 3T1BA 2B63J 3I4PA 5EYRA 1X1CA 1FBUA 1B8IB 1JUMA 3H5NA 5D4SA 1RESA 3S1QJ 4D5CA 5FFXA 3ZP5A 3BPXA 1Y6IA 4OWRB 3CC4I 2DPUA 2XC7A 3BROA 3FXMA 2YSRA 1Z21A 1AA7A 1GLNA 3GTQJ 3FIWA 4QIWN 1SD6A 1GXQA 5K7HA 2PI0A 1W36C 3PSIA 3FWEA 5LGTA 3REOA 3CESA 4IZZA 4IOAF 3W2AA 1LUJB 1X19A 3AFHA 3JW4A 2ZMEC 2KRCA 3IH4A 3SXYA 1GV2A 4EQQA 5HNFA 3PIPF 1IDZA 1RRJA 1ZHFA 4XICA 1U3EM 1N75A 4HW0A 5E3NA 1SMYF 4A3JJ 3D1NI 4HX7A 1X1DA 1B6AA 3ABTA 4DZPA 4BBSJ 2JQ7A 3N05A 1WJDA 1W7PB 1VNDA 5E20A 3T5XA 1T08B 1YI2I 5C4JJ 3BZKA 2L54A 4XLPF 5HLIA 3J81Z 1I50J 4NC7A 1EJ9A 3HOYJ 1YS7A 1N78A 2L7ZA 3S2DJ 1H0MA 2QSGX 1ETKA 5BPIA 4UNOA 4M3BA 1BA5A 2LH9A 2X48A 1YIJI 2HXIA 1TWGJ 3JAMZ 3K4LA 4M71A 2IA1A 5FLVA 3FISA 4LD5A 2OV7A 1IUYA 2VE8A 3FXOA 2X85A 1XDSA 2QF7A 4HX8A 3KYCB 1HF0A 1X4OA 1RIOH 1OCRH 3IRRA 3QP5A 1DUXC 5A2QK 2ZB9A 1SVOA 4ZYHA 2FBKA 2MLGA 1R1TA 1USSA 1JE8A 3GFJA 3E5UA 4BL0B 3FMQA 2RV8A 2FQ4A 3H3ZA 3BZ6A 4XSZF 3F8FA 3G6EI 2VJ5A 2R92J 4LITA 2K4BA 1S29A 3EUKL 3LSMA 3Q0WA 4OIRF 1XPXA 3LSRA 4J19A 1WKMA 3K4NA 1MBJA 5DD4A 4BGDA 1MH3A 2CG4A 1ETWA 2XGCA 2IJLA 2LY9A 2CQKA 3JAMK 2D5VA 1JTYA 2GAUA 3G3ZA 2GOMA 3OR2C 2A6TA 1YJWI 1T33A 2VJJA 4J01A 2CU7A 2K85A 3AG2H 5DM6F 4LLNA 1IXCA 3ZMUA 2E34A
chains in the Genus database with same CATH topology
1HXDA 2NNYA 4U7BA 1T6SA 5EEHA 3DP7A 3EDPA 2EWNA 2J5OA 2A69F 5LBQA 3LAJA 3ELKA 3DPTA 3GF2A 1ZG3A 3S2WA 1IW7F 2XHKA 4LLGF 2WTEA 4P55A 3GO5A 1XGMA 2H94A 1UHMA 4L5IA 2FNAA 4TV7A 5D6EA 1LDJA 1PDNC 3CJNA 1E17A 3SQNA 2NS0A 1BJAA 5EEGA 1EV7A 3DEUA 1FY7A 4WK8F 3WE2A 2KIFA 1P6RA 2DQLA 3MCZA 4OU0A 2IW5A 4L5JA 5FD6A 1WI9A 3O3KA 4G8XA 5LHIA 1QPMA 4A5MA 3MAJA 1SFEA 3L2CA 2IT0A 1TLHB 3J7AO 4ENJA 5TJJA 3C3WA 1J7KA 4HZFA 1P4XA 5BPDA 4LG0B 2QBYB 4BHPA 2P5VA 1STZA 1EH8A 2ESHA 3F8CA 2XV4S 3TO6A 3SHFA 4DNCA 3GFLA 3FF5A 4I2OA 3FXUA 4HBLA 1ZG1A 3DQVC 3OOPA 2ZMEB 3V4GA 3LAPA 4EVIA 1MJ9A 4RGSA 5ED4A 1G4DA 3W6JB 2EFWA 4E70A 1JHHA 2P6TA 2DU9A 2W57A 3K9TA 1F4KA 4MTEA 5ICFA 4YG2F 4GCVA 3IC7A 2VBYA 5F1RA 1PUEE 2RQPA 1AOYA 2ZJ2A 4D0PA 1P4WA 1SFXA 5DCMB 1LEBA 4PCQA 3BPVA 3E5QA 1PP7U 3FM3A 2H27A 1O3QA 3M1EA 3KLNA 4M73A 4EJVA 1XMKA 1XGNA 2Q2EA 3RPQA 2Z9OA 4HV6A 2IVMA 3M8FA 1MDMB 3I59A 1FLIA 2DAOA 4QWQA 1KYZA 4HLXA 4BHBA 1G6NA 3KP3A 4KUMA 1T0FA 4CICA 4RAZA 1HKSA 4Z2YA 2C6YA 1D8JA 2HWVA 5DUKA 1R5GA 3J81K 3K2ZA 2Z33A 1IN5A 4KMUX 3ERED 3ZN1A 2DW4A 3KFWX 1LJ9A 1F5TA 2XAQA 2VT2A 1QNTA 1ON1A 2K86A 5ERIA 1E2XA 3FMRA 2HKOA 2ELHA 4CXFA 2L4AA 3I58A 3WE3A 1IXRC 2PEXA 3E97A 2A6HF 2QVOA 1G3TA 4JBAA 4UV8A 1T39A 3IL2A 4KN4X 5DD8A 4L0YB 5AIPA 3H92A 2L02A 4WXCA 1TBXA 1WQ2A 1KU3A 2M45A 1B9MA 4IHSA 2GZWA 4R1HA 2E7WA 4ESJA 2GWRA 3ZMSA 5LRSA 2HYFA 5HS9A 5HLGA 5HS8A 3GX4X 1C0WA 1XSXA 4EM1A 2UXNA 4LK1F 5FD5A 3JSOA 4CZZA 3KP7A 3CDHA 2FE3A 4I7HA 4A5NA 3ZN0A 3K1MA 5LRRA 4IVNA 4KNYA 4I09A 2OU2A 2ZO4A 5DUIA 1ZN2A 2YU3A 2ESNA 1LDKB 3DFGA 4EM0B 3RYRA 1K79A 1HQCA 3HRMA 3D5LA 3DXJF 1OYYA 5FGMA 1J5YA 2QZ8A 4L18B 4AVPA 4A0ZA 3CUOA 2FOKA 3PQKA 2FBIA 4L9VA 1YW8A 1LVAA 1B4AA 2L3DA 1MD0A 3R61A 3M8EA 4M9ZA 2CWEA 4A12A 2OAZA 2D1HA 1HBXG 2VODA 1K7AA 1IRFA 2HYGD 4UXNA 3FHZA 3ZPLA 3HRTA 4WX9A 2A5YB 4IXAA 4HQEA 1K6OA 1IN7A 1Z91A 2X0LA 5K5QA 4ENKA 3MZHA 1Q1HA 2RVCA 4MNUA 5D5XB 3IKVA 4LFUA 3R6SA 2L01A 2QYOA 2RDPA 1AWCA 5D8LB 2Y0MA 4FX4A 1F9NA 2OQGA 5J8CA 1Z1DA 3FX3A 2WC2A 4EGZA 1V3FA 2HS5A 5DEQA 4MQ9F 1RZ4A 2HKXA 3RJPA 5ILSA 1XGOA 3E6MA 1VTNC 1OKRA 4MQVA 2M30A 2HTSA 1MDMA 3G73A 1ZARA 1HW5A 3HTUA 3LA7A 2QBYA 3KE2A 2V1XA 2F5FA 3QRFF 3TO9A 4BXUA 3P9IA 4KICA 1SFUA 4F7ZA 1QO0D 5E1XA 1H9TA 3KP5A 4Q48A 2PFBA 3N4MA 2KJCA 1XDUA 1W5TA 2JT1A 2VBWA 3WODF 1BM9A 4EJOA 2KIMA 3NQOA 2A07F 4IRGA 2M87A 1IN6A 3GWZA 1I5ZA 3KEQA 3WTSC 2FRHA 3J80K 1XMAA 2Y75A 5LEJA 2DLLA 2G7UA 4AD9A 2EB7A 4KA4A 1RI7A 2DPDA 2FU4A 1Y0UA 1FYMA 4M6XA 2XAHA 1A04A 4P9FA 3RKXA 2EV0A 1L0OC 1SAXA 1ON2A 5D4RA 3BWGA 4GO1A 1ZLKA 1KU7A 2FXAA 5DV5A 1YIOA 2HOEA 2DK5A 3RTRA 4KN7X 2BBYA 4FHTA 2PLYA 5LEKA 3WU1B 4ZZLA 3P7NA 3EETA 5JHUA 4M9SA 3F72A 5DYMA 1BI3A 2ACJA 4ZH4F 5ICGA 4MHGA 1YFHA 1Z6TA 1QQIA 2FMYA 1ULYA 1SMTA 1HW1A 1ZH5A 3SZPA 5D6FA 3QPHA 4IF4A 2DFIA 2VBZA 4L0ZB 5E1WA 1TNSA 1FSEA 4G7OF 2OBPA 3V8KA 1R22A 2O3FA 1U5TB 4UV9A 1FYLA 1B1BA 3MFKA 3O2PE 1BN5A 4CGZA 3WTZA 5IT3A 3COAC 3V8JA 2VC0A 1CF7B 2ZMEA 3C18A 3ZMVA 3EYYA 4L9JA 2Z99A 3B02A 2LSOA 2D2WA 1K78A 2K4JA 2XAJA 4LJZF 4LLLA 3VEPA 1J9IA 4CYDA 1W7PD 5HOOA 3KLOA 1ODDA 1RNLA 1MGTA 2XROA 1KYWA 4IHTA 1FBSA 1Z7UA 1YTYA 3F3XA 3GFIA 4Q5SF 2KRFA 4R79A 2UWMA 3V7SA 4KIFA 5L3CA 2DTRA 2OD5A 1GHCA 2QLZA 3K69A 3Q5FA 2LKPA 3W6KB 1BC8C 2KKOA 1JGSA 1I1SA 3V7RA 5BMZA 1MZBA 2ISYA 1ZGJA 2ZCWA 2COMA 2LDUA 4WWCA 6PAXA 1O57A 3ABUA 4GXOA 2BYVE 1OYIA 3I64A 3R60A 2Z5UA 2LF8A 2YX7A 4UVBA 1OR7A 4GYIA 2MBFA 3M9AA 2V1DA 5J8FA 5L3FA 2XASA 4I0BA 5HDNA 1U6GA 5FLXK 4IPAA 2OA4A 5D5UB 2O61A 1FOKA 1FBQA 2P8TA 2VN2A 3LFKA 2EFNA 2M8EA 5BOXA 2RC4A 4JQFA 2JSCA 1ZG5A 2UZKA 2BE5F 3C7JA 2PQ8A 5FO5A 1IF1A 4I01A 3KETA 2VXZA 4A0XA 3ISPA 5H6QA 2X4HA 1T38A 4WCGA 1R36A 5K1YA 3T8RA 4B09A 1S8NA 4LGWA 4DQ2A 1S7AA 4Y17A 3CO7C 1Z6RA 2HFHA 2XAFA 2BEOA 2XIGA 2HZTA 2XAGA 3AAFA 2A68F 3E3VA 2GA2A 1UB9A 4N0BA 2QQ9A 3PFIA 4OOIA 1DPRA 2STTA 2F2EA 2O6GE 2F5CA 5JI6A 3F8BA 2BGCA 2TDXA 4OMZA 1DP7P 4RS8A 1HW2A 2DQRA 4G7HF 2W24A 4HF0A 1OMIA 2AXLA 2EA2A 1TW3A 3K1PA 3I0TA 5BS6A 3HRSA 2P5KA 3E6BA 1XD7A 1XN7A 4XSXF 4RGXA 2Y48A 3RPUA 3KZYA 1XSDA 4BHCA 3ZMDA 2DK8A 2CO5A 1T98A 1WSUA 4U0YA 1XCVA 3CLOA 4PGHA 2YX4A 3QU6A 2H6CA 2WV0A 1HKTA 2RN7A 1ONVA 3DV8A 1R58A 3T8TA 5L3GA 3RKYA 4Q4ZF 2FMLA 2DI3A 1RUOA 4GYGA 3F8NA 4NQWA 2FQ3A 1O7LA 4KYWA 3Q9SA 4G94A 1OPCA 5ICCA 3QPTA 2Q0OA 3HSEA 4M72A 1ZLJA 1S3JA 4QLCU 1J2XA 2VT3A 4ZYDA 2PBIA 2EFPA 2FF4A 4P9UA 5CJ9A 1CGPA 1IRGA 2CW0F 3B73A 4R8HA 1BI0A 2E7XA 2MC3A 1YLFA 3BJAA 3IRQA 4OIQF 1FX7A 2K27A 2OQRA 2DO7A 5CVUA 3KEOA 5K5RA 3TO7A 2MLKA 3K1NA 4PDKA 4RB1A 3EQLF 1LB2A 4KDPA 1GVJA 4PGGA 2CYYA 2O0YA 5KVRA 1ZREA 2OZ6A 4YIIA 3C1DA 2HR3A 3U2RA 1TTYA 3WTTC 2OZUA 4A0YA 3WU0A 1J75A 3HUGA 1QZYA 2JZYA 4N9HA 3ECHA 2NRAC 3VODA 3SZTA 3BJ6A 5HDGA 3P9KA 1T2KA 2VBXA 3F6VA 2H6BA 3HTSB 2GXBA 3J80Z 1D8KA 4LMYA 3TDZC 1IZ1A 2FSWA 4RB0A 2E1CA 3U1DA 5LHGA 2AS5F 1BOAA 4P5OA 3GYHX 3D0SA 3H3UA 2QQAA 5L3EA 5D8KB 4MEXF 5ICEA 1FP2A 2JRTA 3EYIA 4OMYA 1SD4A 2JTVA 2VONA 1KQ8A 3CTAA 4UUVA 2MH2A 4ESFA 1YW7A 4B8XA 2H09A 3HSFA 1I6XA 1U5TC 3F8MA 2A3SA 3WTYC 1U2WA 1DDNA 4CO8A 1B59A 4A2UA 3I59B 2QM3A 3P9CA 4M74A 2XVCA 2R7FA 1BC7C 4YIFA 4BH9A 4N9IA 5TRDA 1HSJA 1X3UA 4ASNA 4BYYA 2J5PA 4LG0A 3BY6A 3KP4A 4MGRA 4P96A 4WXDA 4WF2A 3BOQA 5FLXZ 1FPQA 5FB2A 3IKTA 2MH9A 2V79A 4G6QA 2ISZA 3L9FA 3HOTA 3NEUA 1FT9A 2PMUA 2NNNA 1O3SA 4YFKF 4BQAA 5DDGA 1BI1A 2FEZA 1J59A 3V8LA 5LGUA 5DCFA 2RGVA 3BDDA 3M7GA 4IRIA 3IWFA 2NAZA 4XRFA 3TQNA 1O3RA 2QWWA 3E5XA 2P5LC 4YFNF 4KFCA 2F5DA 3VFZA 2P6SA 2ZXJA 3CUQA 3E6DA 4AWXB 4U88A 1REPC 2PN6A 4EV0A 3ZMZA 4OINF 3U9GA 4EJTA 1KQ9A 3JSPA 1QGPA 1HKQA 5JFRA 3DF8A 4KT5C 2P7CB 2ZBKA 1CF7A 3WGIA 2MA3A 3LQRA 1ZGAA 5F6FA 2HEOA 2IP2A 1P2FA 3LWFA 1KU9A 1K78B 1XGSA 2GIVA 3SFZA 3HSRA 4G9YA 4EGYA 1TNTA 1DPUA 1YO5C 3DKWA 1YYVA 2Z3YA 2R7DA 4Q47A 3WTXC 4BNCA 4YFXF 3QAHA 1FZPB 4M6YA 5HS7A 2FBHA 2K02A 3T0YA 3I5UA 1Z9CA 5BQTA 2PG4A 2B0LA 2XKOA 1IXSB 5K5OA 5CVRA 5FFZA 2O03A 1XB4A 4RB2C 1FP1D 4U0WA 4ZZDA 3GXOA 3HHGA 5CVVA 1F1ZA 3VB2A 4LB5A 2E1NA 2RKHA 1B9NA 2EJRA 4ENMA 1BIAA 5CVIA 1UCRA 3WTUC 3RKWA 2D1VA 3O6BB 1S7OA 4CDGA 3CUQC 5IT9Z 1TW2A 4A6EA 2EA4A 3KP6A 3WGHA 5ILUA 4ENNA 3RYPA 4EJWA 2CGPA 5DCMA 2DT5A 2HQNA 3LQQA 3GLXA 4HF2A 1J0RA 4U0VA 4G6DA 2CFXA 2EFOA 1MJAA 1W4MA 3F22A 2UXXA 5AIQA 3ULQB 3F6OA 3LSTA 4ON0A 1BIBA 4H0EA 4L9NA 4LK0F 3F21A 3ZQ7A 1YG2A 3HOSA 1D5VA 2FNPA 1KA8A 4NB5A 3ZMTA 4UVAA 3TOBA 4HLYA 1S6LA 2A61A 3TOAA 2V1UA 4RB3C 4HOBA 4IRHA 2VE9A 1KQ0A 2VOPA 2W84A 5JR3A 3TGNA 3N97A 2HGCA 3L00A 4U7DA 4UHTA 1MJBA 4XLNF 2RNJA 2ADUA 2XKPA 3MWMA 1U8RA 2NYXA 3NRVA 1XSVA 4HX4A 3R0AA 2Q8KA 1R00A 4HDVA 2R3SA 3LA3A 1YS6A 1GXPA 4ESBA 5IT9K 4OIPF 1U5TA 5LLQA 2HTJA 4IJAA 2GQQA 4I0AA 4EMSA 4HDUA 1EH7A 2G9WA 3JTGA 1QZZA 3L09A 4K2EA 1SD5A 1UHWA 1QBJA 4I02A 1MKMA 2DBBA 2XGXA 5LGNA 3CUQB 4Y15A 2LNBA 4HV5A 5HVQC 3GEZA 3HYIA 1W5SA 2V6CA 3FMSA 2CSOA 3ML6A 4HYEA 1YW9A 1KGSA 1R23A 3HIFA 4KIBA 2O8XA 4OIOF 5HLHA 1EH6A 4ZYGA 2LF7A 2EV6A 1HSTA 4RAYA 3ECOA 5D5WB 4RGUA 3TKYA 1ZYRF 3PQJA 3IWZA 1R1VA 3LA2A 4O3MA 1NHAA 4EJUA 1LDDA 3KZZA 3MZYA 2M1BA 1BI2A 3RI4A 2YPRA 2JPCA 2BV6A 4S04A 2ZKZA 4WXHA 3ROUA 2D45A 4MEYF 2K7LA 1USTA 3I71A 5KK1A 1R5HA 5E8GA 2QENA 4HQMA 1LQ1A 3I54A 4HF1A 2QQBA 4I98B 3IHUA 3QP6A 2ZNYA 2V9VA 4JK1X 2STWA 5AONA 5LHHA 1ZRFA 3GW2A 5CVJA 4M9XA 3MQ0A 3BJOA 3KP2A 1SD7A 3FXQA 4XBFA 4AIKA 1FYKA 2GXGA 1UFMA 4O5VA 3R0JA 1I1GA 1R7JA 4O6JA 2EK5A 1WRJA 1O7FA 4RGRA 1BBYA 3CO6C 4GGGA 2IPQX 2ETHA 5E1ZB 3GVAA 3EUHA 5H6RA 2P7VB 5CLSA 3GZ6A 3TDUC 4EM2A 1V4RA 4BAYA 4Y13A 4LB6B 1IN8A 1P92A 2F5EA 4FX0A 3JTHA 1JXSA 1ZRCA 3FXRA 5CYVA 2QUFA 3L7WA 3E6CC 1FWZA 3WTWC 3HHHA 5L3BA 4AIJA 1RUNA 5H20A 1PP8F 2FA5A 2KIUA 3OV8A 2ZFWA 1O3TA 2YR2A 1FSHA 1TQIA 3FM5A 4HAMA 2IA2A 1TQMA 1FC3A 1XCBA 3GZ5A 3V7CA 3F23A 2WWYA 3DPLC 3GUDA 3QU3A 3KCCA 4HA8A 5HDKA 5JVTA 2VOOA 2HQRA 3Q9VA 3HRUA 1OYWA 4FT8A 3WG9A 3K0LA 1L3LA 3QOPA 4A6DA 2IRFG 2IA0A 2ZNZA 1U78A 2PJPA 5F64A 2W25A 3MEXA 4AIHA 4PZJA 5A2QZ 3RIRA 1G3SA 2VC1A 1ZRDA 1I27A 1WWXA 1W7PA 2HDCA 2EFQA 4MTDA 3VOEA 1ZAOA 3FZVA 5E8IA 5L3DA 2GA1A 4KIGA 4L9TA 1P4AA 1IN4A 2A6EF 1YQAA 2M5WA 2P4WA 5E17F 2KJBA 4ZYEA 2XRNA 4ETSA 3RDIA 3BP8A 1LEAA 1TQPA 4CHUA 1IAWA 4UVCA 3WGGA 1D3YA 4NHJA 2EV5A 5D5VB 3WTVC 1R1UA 1LNWA 1G3WA 2MD5A 1Z05A 2JPBA 3GFMA 5E18F 2G7HA 5ILVA 4G7ZF 2W85A 3I53A 1JHFA 1FNNA 2L4MA 3R4KA 4S05A 1KU2A 2PMHA 4KMFA 5J6XA 1H9GA 1G3YA 2XUBA 3T1BA 3I4PA 1FBUA 5D4SA 5FFXA 3ZP5A 3BPXA 2DPUA 3BROA 2YSRA 1SD6A 1GXQA 2PI0A 3FWEA 5LGTA 3REOA 3JW4A 3SXYA 4EQQA 1ZHFA 1U3EM 4HW0A 1SMYF 4HX7A 1B6AA 3ABTA 1W7PB 5E20A 3T5XA 2L54A 4XLPF 5HLIA 3J81Z 1YS7A 1H0MA 5BPIA 4UNOA 3JAMZ 4M71A 2IA1A 4LD5A 1IUYA 2VE8A 1XDSA 4HX8A 1RIOH 1DUXC 3IRRA 3QP5A 5A2QK 4ZYHA 2FBKA 2MLGA 1R1TA 1USSA 1JE8A 3GFJA 3E5UA 3FMQA 2RV8A 3H3ZA 3BZ6A 4XSZF 3F8FA 2K4BA 1S29A 4OIRF 1WKMA 5DD4A 2CG4A 2IJLA 2CQKA 3JAMK 2GAUA 3G3ZA 4LLNA 1IXCA 3ZMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HXD A;  2NNY A;  4U7B A;  1T6S A;  5EEH A;  3DP7 A;  3EDP A;  2EWN A;  2J5O A;  2A69 F;  5LBQ A;  3LAJ A;  3ELK A;  3DPT A;  3GF2 A;  1ZG3 A;  3S2W A;  1IW7 F;  2XHK A;  4LLG F;  2WTE A;  4P55 A;  3GO5 A;  1XGM A;  2H94 A;  1UHM A;  4L5I A;  2FNA A;  4TV7 A;  5D6E A;  1LDJ A;  1PDN C;  3CJN A;  1E17 A;  3SQN A;  2NS0 A;  1BJA A;  5EEG A;  1EV7 A;  3DEU A;  1FY7 A;  4WK8 F;  3WE2 A;  2KIF A;  1P6R A;  2DQL A;  3MCZ A;  4OU0 A;  2IW5 A;  4L5J A;  5FD6 A;  1WI9 A;  3O3K A;  4G8X A;  5LHI A;  1QPM A;  4A5M A;  3MAJ A;  1SFE A;  3L2C A;  2IT0 A;  1TLH B;  3J7A O;  4ENJ A;  5TJJ A;  3C3W A;  1J7K A;  4HZF A;  1P4X A;  5BPD A;  4LG0 B;  2QBY B;  4BHP A;  2P5V A;  1STZ A;  1EH8 A;  2ESH A;  3F8C A;  2XV4 S;  3TO6 A;  3SHF A;  4DNC A;  3GFL A;  3FF5 A;  4I2O A;  3FXU A;  4HBL A;  1ZG1 A;  3DQV C;  3OOP A;  2ZME B;  3V4G A;  3LAP A;  4EVI A;  1MJ9 A;  4RGS A;  5ED4 A;  1G4D A;  3W6J B;  2EFW A;  4E70 A;  1JHH A;  2P6T A;  2DU9 A;  2W57 A;  3K9T A;  1F4K A;  4MTE A;  5ICF A;  4YG2 F;  4GCV A;  3IC7 A;  2VBY A;  5F1R A;  1PUE E;  2RQP A;  1AOY A;  2ZJ2 A;  4D0P A;  1P4W A;  1SFX A;  5DCM B;  1LEB A;  4PCQ A;  3BPV A;  3E5Q A;  1PP7 U;  3FM3 A;  2H27 A;  1O3Q A;  3M1E A;  3KLN A;  4M73 A;  4EJV A;  1XMK A;  1XGN A;  2Q2E A;  3RPQ A;  2Z9O A;  4HV6 A;  2IVM A;  3M8F A;  1MDM B;  3I59 A;  1FLI A;  2DAO A;  4QWQ A;  1KYZ A;  4HLX A;  4BHB A;  1G6N A;  3KP3 A;  4KUM A;  1T0F A;  4CIC A;  4RAZ A;  1HKS A;  4Z2Y A;  2C6Y A;  1D8J A;  2HWV A;  5DUK A;  1R5G A;  3J81 K;  3K2Z A;  2Z33 A;  1IN5 A;  4KMU X;  3ERE D;  3ZN1 A;  2DW4 A;  3KFW X;  1LJ9 A;  1F5T A;  2XAQ A;  2VT2 A;  1QNT A;  1ON1 A;  2K86 A;  5ERI A;  1E2X A;  3FMR A;  2HKO A;  2ELH A;  4CXF A;  2L4A A;  3I58 A;  3WE3 A;  1IXR C;  2PEX A;  3E97 A;  2A6H F;  2QVO A;  1G3T A;  4JBA A;  4UV8 A;  1T39 A;  3IL2 A;  4KN4 X;  5DD8 A;  4L0Y B;  5AIP A;  3H92 A;  2L02 A;  4WXC A;  1TBX A;  1WQ2 A;  1KU3 A;  2M45 A;  1B9M A;  4IHS A;  2GZW A;  4R1H A;  2E7W A;  4ESJ A;  2GWR A;  3ZMS A;  5LRS A;  2HYF A;  5HS9 A;  5HLG A;  5HS8 A;  3GX4 X;  1C0W A;  1XSX A;  4EM1 A;  2UXN A;  4LK1 F;  5FD5 A;  3JSO A;  4CZZ A;  3KP7 A;  3CDH A;  2FE3 A;  4I7H A;  4A5N A;  3ZN0 A;  3K1M A;  5LRR A;  4IVN A;  4KNY A;  4I09 A;  2OU2 A;  2ZO4 A;  5DUI A;  1ZN2 A;  2YU3 A;  2ESN A;  1LDK B;  3DFG A;  4EM0 B;  3RYR A;  1K79 A;  1HQC A;  3HRM A;  3D5L A;  3DXJ F;  1OYY A;  5FGM A;  1J5Y A;  2QZ8 A;  4L18 B;  4AVP A;  4A0Z A;  3CUO A;  2FOK A;  3PQK A;  2FBI A;  4L9V A;  1YW8 A;  1LVA A;  1B4A A;  2L3D A;  1MD0 A;  3R61 A;  3M8E A;  4M9Z A;  2CWE A;  4A12 A;  2OAZ A;  2D1H A;  1HBX G;  2VOD A;  1K7A A;  1IRF A;  2HYG D;  4UXN A;  3FHZ A;  3ZPL A;  3HRT A;  4WX9 A;  2A5Y B;  4IXA A;  4HQE A;  1K6O A;  1IN7 A;  1Z91 A;  2X0L A;  5K5Q A;  4ENK A;  3MZH A;  1Q1H A;  2RVC A;  4MNU A;  5D5X B;  3IKV A;  4LFU A;  3R6S A;  2L01 A;  2QYO A;  2RDP A;  1AWC A;  5D8L B;  2Y0M A;  4FX4 A;  1F9N A;  2OQG A;  5J8C A;  1Z1D A;  3FX3 A;  2WC2 A;  4EGZ A;  1V3F A;  2HS5 A;  5DEQ A;  4MQ9 F;  1RZ4 A;  2HKX A;  3RJP A;  5ILS A;  1XGO A;  3E6M A;  1VTN C;  1OKR A;  4MQV A;  2M30 A;  2HTS A;  1MDM A;  3G73 A;  1ZAR A;  1HW5 A;  3HTU A;  3LA7 A;  2QBY A;  3KE2 A;  2V1X A;  2F5F A;  3QRF F;  3TO9 A;  4BXU A;  3P9I A;  4KIC A;  1SFU A;  4F7Z A;  1QO0 D;  5E1X A;  1H9T A;  3KP5 A;  4Q48 A;  2PFB A;  3N4M A;  2KJC A;  1XDU A;  1W5T A;  2JT1 A;  2VBW A;  3WOD F;  1BM9 A;  4EJO A;  2KIM A;  3NQO A;  2A07 F;  4IRG A;  2M87 A;  1IN6 A;  3GWZ A;  1I5Z A;  3KEQ A;  3WTS C;  2FRH A;  3J80 K;  1XMA A;  2Y75 A;  5LEJ A;  2DLL A;  2G7U A;  4AD9 A;  2EB7 A;  4KA4 A;  1RI7 A;  2DPD A;  2FU4 A;  1Y0U A;  1FYM A;  4M6X A;  2XAH A;  1A04 A;  4P9F A;  3RKX A;  2EV0 A;  1L0O C;  1SAX A;  1ON2 A;  5D4R A;  3BWG A;  4GO1 A;  1ZLK A;  1KU7 A;  2FXA A;  5DV5 A;  1YIO A;  2HOE A;  2DK5 A;  3RTR A;  4KN7 X;  2BBY A;  4FHT A;  2PLY A;  5LEK A;  3WU1 B;  4ZZL A;  3P7N A;  3EET A;  5JHU A;  4M9S A;  3F72 A;  5DYM A;  1BI3 A;  2ACJ A;  4ZH4 F;  5ICG A;  4MHG A;  1YFH A;  1Z6T A;  1QQI A;  2FMY A;  1ULY A;  1SMT A;  1HW1 A;  1ZH5 A;  3SZP A;  5D6F A;  3QPH A;  4IF4 A;  2DFI A;  2VBZ A;  4L0Z B;  5E1W A;  1TNS A;  1FSE A;  4G7O F;  2OBP A;  3V8K A;  1R22 A;  2O3F A;  1U5T B;  4UV9 A;  1FYL A;  1B1B A;  3MFK A;  3O2P E;  1BN5 A;  4CGZ A;  3WTZ A;  5IT3 A;  3COA C;  3V8J A;  2VC0 A;  1CF7 B;  2ZME A;  3C18 A;  3ZMV A;  3EYY A;  4L9J A;  2Z99 A;  3B02 A;  2LSO A;  2D2W A;  1K78 A;  2K4J A;  2XAJ A;  4LJZ F;  4LLL A;  3VEP A;  1J9I A;  4CYD A;  1W7P D;  5HOO A;  3KLO A;  1ODD A;  1RNL A;  1MGT A;  2XRO A;  1KYW A;  4IHT A;  1FBS A;  1Z7U A;  1YTY A;  3F3X A;  3GFI A;  4Q5S F;  2KRF A;  4R79 A;  2UWM A;  3V7S A;  4KIF A;  5L3C A;  2DTR A;  2OD5 A;  1GHC A;  2QLZ A;  3K69 A;  3Q5F A;  2LKP A;  3W6K B;  1BC8 C;  2KKO A;  1JGS A;  1I1S A;  3V7R A;  5BMZ A;  1MZB A;  2ISY A;  1ZGJ A;  2ZCW A;  2COM A;  2LDU A;  4WWC A;  6PAX A;  1O57 A;  3ABU A;  4GXO A;  2BYV E;  1OYI A;  3I64 A;  3R60 A;  2Z5U A;  2LF8 A;  2YX7 A;  4UVB A;  1OR7 A;  4GYI A;  2MBF A;  3M9A A;  2V1D A;  5J8F A;  5L3F A;  2XAS A;  4I0B A;  5HDN A;  1U6G A;  5FLX K;  4IPA A;  2OA4 A;  5D5U B;  2O61 A;  1FOK A;  1FBQ A;  2P8T A;  2VN2 A;  3LFK A;  2EFN A;  2M8E A;  5BOX A;  2RC4 A;  4JQF A;  2JSC A;  1ZG5 A;  2UZK A;  2BE5 F;  3C7J A;  2PQ8 A;  5FO5 A;  1IF1 A;  4I01 A;  3KET A;  2VXZ A;  4A0X A;  3ISP A;  5H6Q A;  2X4H A;  1T38 A;  4WCG A;  1R36 A;  5K1Y A;  3T8R A;  4B09 A;  1S8N A;  4LGW A;  4DQ2 A;  1S7A A;  4Y17 A;  3CO7 C;  1Z6R A;  2HFH A;  2XAF A;  2BEO A;  2XIG A;  2HZT A;  2XAG A;  3AAF A;  2A68 F;  3E3V A;  2GA2 A;  1UB9 A;  4N0B A;  2QQ9 A;  3PFI A;  4OOI A;  1DPR A;  2STT A;  2F2E A;  2O6G E;  2F5C A;  5JI6 A;  3F8B A;  2BGC A;  2TDX A;  4OMZ A;  1DP7 P;  4RS8 A;  1HW2 A;  2DQR A;  4G7H F;  2W24 A;  4HF0 A;  1OMI A;  2AXL A;  2EA2 A;  1TW3 A;  3K1P A;  3I0T A;  5BS6 A;  3HRS A;  2P5K A;  3E6B A;  1XD7 A;  1XN7 A;  4XSX F;  4RGX A;  2Y48 A;  3RPU A;  3KZY A;  1XSD A;  4BHC A;  3ZMD A;  2DK8 A;  2CO5 A;  1T98 A;  1WSU A;  4U0Y A;  1XCV A;  3CLO A;  4PGH A;  2YX4 A;  3QU6 A;  2H6C A;  2WV0 A;  1HKT A;  2RN7 A;  1ONV A;  3DV8 A;  1R58 A;  3T8T A;  5L3G A;  3RKY A;  4Q4Z F;  2FML A;  2DI3 A;  1RUO A;  4GYG A;  3F8N A;  4NQW A;  2FQ3 A;  1O7L A;  4KYW A;  3Q9S A;  4G94 A;  1OPC A;  5ICC A;  3QPT A;  2Q0O A;  3HSE A;  4M72 A;  1ZLJ A;  1S3J A;  4QLC U;  1J2X A;  2VT3 A;  4ZYD A;  2PBI A;  2EFP A;  2FF4 A;  4P9U A;  5CJ9 A;  1CGP A;  1IRG A;  2CW0 F;  3B73 A;  4R8H A;  1BI0 A;  2E7X A;  2MC3 A;  1YLF A;  3BJA A;  3IRQ A;  4OIQ F;  1FX7 A;  2K27 A;  2OQR A;  2DO7 A;  5CVU A;  3KEO A;  5K5R A;  3TO7 A;  2MLK A;  3K1N A;  4PDK A;  4RB1 A;  3EQL F;  1LB2 A;  4KDP A;  1GVJ A;  4PGG A;  2CYY A;  2O0Y A;  5KVR A;  1ZRE A;  2OZ6 A;  4YII A;  3C1D A;  2HR3 A;  3U2R A;  1TTY A;  3WTT C;  2OZU A;  4A0Y A;  3WU0 A;  1J75 A;  3HUG A;  1QZY A;  2JZY A;  4N9H A;  3ECH A;  2NRA C;  3VOD A;  3SZT A;  3BJ6 A;  5HDG A;  3P9K A;  1T2K A;  2VBX A;  3F6V A;  2H6B A;  3HTS B;  2GXB A;  3J80 Z;  1D8K A;  4LMY A;  3TDZ C;  1IZ1 A;  2FSW A;  4RB0 A;  2E1C A;  3U1D A;  5LHG A;  2AS5 F;  1BOA A;  4P5O A;  3GYH X;  3D0S A;  3H3U A;  2QQA A;  5L3E A;  5D8K B;  4MEX F;  5ICE A;  1FP2 A;  2JRT A;  3EYI A;  4OMY A;  1SD4 A;  2JTV A;  2VON A;  1KQ8 A;  3CTA A;  4UUV A;  2MH2 A;  4ESF A;  1YW7 A;  4B8X A;  2H09 A;  3HSF A;  1I6X A;  1U5T C;  3F8M A;  2A3S A;  3WTY C;  1U2W A;  1DDN A;  4CO8 A;  1B59 A;  4A2U A;  3I59 B;  2QM3 A;  3P9C A;  4M74 A;  2XVC A;  2R7F A;  1BC7 C;  4YIF A;  4BH9 A;  4N9I A;  5TRD A;  1HSJ A;  1X3U A;  4ASN A;  4BYY A;  2J5P A;  4LG0 A;  3BY6 A;  3KP4 A;  4MGR A;  4P96 A;  4WXD A;  4WF2 A;  3BOQ A;  5FLX Z;  1FPQ A;  5FB2 A;  3IKT A;  2MH9 A;  2V79 A;  4G6Q A;  2ISZ A;  3L9F A;  3HOT A;  3NEU A;  1FT9 A;  2PMU A;  2NNN A;  1O3S A;  4YFK F;  4BQA A;  5DDG A;  1BI1 A;  2FEZ A;  1J59 A;  3V8L A;  5LGU A;  5DCF A;  2RGV A;  3BDD A;  3M7G A;  4IRI A;  3IWF A;  2NAZ A;  4XRF A;  3TQN A;  1O3R A;  2QWW A;  3E5X A;  2P5L C;  4YFN F;  4KFC A;  2F5D A;  3VFZ A;  2P6S A;  2ZXJ A;  3CUQ A;  3E6D A;  4AWX B;  4U88 A;  1REP C;  2PN6 A;  4EV0 A;  3ZMZ A;  4OIN F;  3U9G A;  4EJT A;  1KQ9 A;  3JSP A;  1QGP A;  1HKQ A;  5JFR A;  3DF8 A;  4KT5 C;  2P7C B;  2ZBK A;  1CF7 A;  3WGI A;  2MA3 A;  3LQR A;  1ZGA A;  5F6F A;  2HEO A;  2IP2 A;  1P2F A;  3LWF A;  1KU9 A;  1K78 B;  1XGS A;  2GIV A;  3SFZ A;  3HSR A;  4G9Y A;  4EGY A;  1TNT A;  1DPU A;  1YO5 C;  3DKW A;  1YYV A;  2Z3Y A;  2R7D A;  4Q47 A;  3WTX C;  4BNC A;  4YFX F;  3QAH A;  1FZP B;  4M6Y A;  5HS7 A;  2FBH A;  2K02 A;  3T0Y A;  3I5U A;  1Z9C A;  5BQT A;  2PG4 A;  2B0L A;  2XKO A;  1IXS B;  5K5O A;  5CVR A;  5FFZ A;  2O03 A;  1XB4 A;  4RB2 C;  1FP1 D;  4U0W A;  4ZZD A;  3GXO A;  3HHG A;  5CVV A;  1F1Z A;  3VB2 A;  4LB5 A;  2E1N A;  2RKH A;  1B9N A;  2EJR A;  4ENM A;  1BIA A;  5CVI A;  1UCR A;  3WTU C;  3RKW A;  2D1V A;  3O6B B;  1S7O A;  4CDG A;  3CUQ C;  5IT9 Z;  1TW2 A;  4A6E A;  2EA4 A;  3KP6 A;  3WGH A;  5ILU A;  4ENN A;  3RYP A;  4EJW A;  2CGP A;  5DCM A;  2DT5 A;  2HQN A;  3LQQ A;  3GLX A;  4HF2 A;  1J0R A;  4U0V A;  4G6D A;  2CFX A;  2EFO A;  1MJA A;  1W4M A;  3F22 A;  2UXX A;  5AIQ A;  3ULQ B;  3F6O A;  3LST A;  4ON0 A;  1BIB A;  4H0E A;  4L9N A;  4LK0 F;  3F21 A;  3ZQ7 A;  1YG2 A;  3HOS A;  1D5V A;  2FNP A;  1KA8 A;  4NB5 A;  3ZMT A;  4UVA A;  3TOB A;  4HLY A;  1S6L A;  2A61 A;  3TOA A;  2V1U A;  4RB3 C;  4HOB A;  4IRH A;  2VE9 A;  1KQ0 A;  2VOP A;  2W84 A;  5JR3 A;  3TGN A;  3N97 A;  2HGC A;  3L00 A;  4U7D A;  4UHT A;  1MJB A;  4XLN F;  2RNJ A;  2ADU A;  2XKP A;  3MWM A;  1U8R A;  2NYX A;  3NRV A;  1XSV A;  4HX4 A;  3R0A A;  2Q8K A;  1R00 A;  4HDV A;  2R3S A;  3LA3 A;  1YS6 A;  1GXP A;  4ESB A;  5IT9 K;  4OIP F;  1U5T A;  5LLQ A;  2HTJ A;  4IJA A;  2GQQ A;  4I0A A;  4EMS A;  4HDU A;  1EH7 A;  2G9W A;  3JTG A;  1QZZ A;  3L09 A;  4K2E A;  1SD5 A;  1UHW A;  1QBJ A;  4I02 A;  1MKM A;  2DBB A;  2XGX A;  5LGN A;  3CUQ B;  4Y15 A;  2LNB A;  4HV5 A;  5HVQ C;  3GEZ A;  3HYI A;  1W5S A;  2V6C A;  3FMS A;  2CSO A;  3ML6 A;  4HYE A;  1YW9 A;  1KGS A;  1R23 A;  3HIF A;  4KIB A;  2O8X A;  4OIO F;  5HLH A;  1EH6 A;  4ZYG A;  2LF7 A;  2EV6 A;  1HST A;  4RAY A;  3ECO A;  5D5W B;  4RGU A;  3TKY A;  1ZYR F;  3PQJ A;  3IWZ A;  1R1V A;  3LA2 A;  4O3M A;  1NHA A;  4EJU A;  1LDD A;  3KZZ A;  3MZY A;  2M1B A;  1BI2 A;  3RI4 A;  2YPR A;  2JPC A;  2BV6 A;  4S04 A;  2ZKZ A;  4WXH A;  3ROU A;  2D45 A;  4MEY F;  2K7L A;  1UST A;  3I71 A;  5KK1 A;  1R5H A;  5E8G A;  2QEN A;  4HQM A;  1LQ1 A;  3I54 A;  4HF1 A;  2QQB A;  4I98 B;  3IHU A;  3QP6 A;  2ZNY A;  2V9V A;  4JK1 X;  2STW A;  5AON A;  5LHH A;  1ZRF A;  3GW2 A;  5CVJ A;  4M9X A;  3MQ0 A;  3BJO A;  3KP2 A;  1SD7 A;  3FXQ A;  4XBF A;  4AIK A;  1FYK A;  2GXG A;  1UFM A;  4O5V A;  3R0J A;  1I1G A;  1R7J A;  4O6J A;  2EK5 A;  1WRJ A;  1O7F A;  4RGR A;  1BBY A;  3CO6 C;  4GGG A;  2IPQ X;  2ETH A;  5E1Z B;  3GVA A;  3EUH A;  5H6R A;  2P7V B;  5CLS A;  3GZ6 A;  3TDU C;  4EM2 A;  1V4R A;  4BAY A;  4Y13 A;  4LB6 B;  1IN8 A;  1P92 A;  2F5E A;  4FX0 A;  3JTH A;  1JXS A;  1ZRC A;  3FXR A;  5CYV A;  2QUF A;  3L7W A;  3E6C C;  1FWZ A;  3WTW C;  3HHH A;  5L3B A;  4AIJ A;  1RUN A;  5H20 A;  1PP8 F;  2FA5 A;  2KIU A;  3OV8 A;  2ZFW A;  1O3T A;  2YR2 A;  1FSH A;  1TQI A;  3FM5 A;  4HAM A;  2IA2 A;  1TQM A;  1FC3 A;  1XCB A;  3GZ5 A;  3V7C A;  3F23 A;  2WWY A;  3DPL C;  3GUD A;  3QU3 A;  3KCC A;  4HA8 A;  5HDK A;  5JVT A;  2VOO A;  2HQR A;  3Q9V A;  3HRU A;  1OYW A;  4FT8 A;  3WG9 A;  3K0L A;  1L3L A;  3QOP A;  4A6D A;  2IRF G;  2IA0 A;  2ZNZ A;  1U78 A;  2PJP A;  5F64 A;  2W25 A;  3MEX A;  4AIH A;  4PZJ A;  5A2Q Z;  3RIR A;  1G3S A;  2VC1 A;  1ZRD A;  1I27 A;  1WWX A;  1W7P A;  2HDC A;  2EFQ A;  4MTD A;  3VOE A;  1ZAO A;  3FZV A;  5E8I A;  5L3D A;  2GA1 A;  4KIG A;  4L9T A;  1P4A A;  1IN4 A;  2A6E F;  1YQA A;  2M5W A;  2P4W A;  5E17 F;  2KJB A;  4ZYE A;  2XRN A;  4ETS A;  3RDI A;  3BP8 A;  1LEA A;  1TQP A;  4CHU A;  1IAW A;  4UVC A;  3WGG A;  1D3Y A;  4NHJ A;  2EV5 A;  5D5V B;  3WTV C;  1R1U A;  1LNW A;  1G3W A;  2MD5 A;  1Z05 A;  2JPB A;  3GFM A;  5E18 F;  2G7H A;  5ILV A;  4G7Z F;  2W85 A;  3I53 A;  1JHF A;  1FNN A;  2L4M A;  3R4K A;  4S05 A;  1KU2 A;  2PMH A;  4KMF A;  5J6X A;  1H9G A;  1G3Y A;  2XUB A;  3T1B A;  3I4P A;  1FBU A;  5D4S A;  5FFX A;  3ZP5 A;  3BPX A;  2DPU A;  3BRO A;  2YSR A;  1SD6 A;  1GXQ A;  2PI0 A;  3FWE A;  5LGT A;  3REO A;  3JW4 A;  3SXY A;  4EQQ A;  1ZHF A;  1U3E M;  4HW0 A;  1SMY F;  4HX7 A;  1B6A A;  3ABT A;  1W7P B;  5E20 A;  3T5X A;  2L54 A;  4XLP F;  5HLI A;  3J81 Z;  1YS7 A;  1H0M A;  5BPI A;  4UNO A;  3JAM Z;  4M71 A;  2IA1 A;  4LD5 A;  1IUY A;  2VE8 A;  1XDS A;  4HX8 A;  1RIO H;  1DUX C;  3IRR A;  3QP5 A;  5A2Q K;  4ZYH A;  2FBK A;  2MLG A;  1R1T A;  1USS A;  1JE8 A;  3GFJ A;  3E5U A;  3FMQ A;  2RV8 A;  3H3Z A;  3BZ6 A;  4XSZ F;  3F8F A;  2K4B A;  1S29 A;  4OIR F;  1WKM A;  5DD4 A;  2CG4 A;  2IJL A;  2CQK A;  3JAM K;  2GAU A;  3G3Z A;  4LLN A;  1IXC A;  3ZMU A; 
#chains in the Genus database with same CATH topology
 3ZQF A;  4E7S A;  1HXD A;  4BE1 A;  2LLK A;  4BU2 A;  4KIS A;  4MO7 A;  4CZC A;  2NNY A;  4U7B A;  1OJL A;  1T6S A;  3IV5 A;  2F4M B;  2EPF A;  4A3L J;  3BR6 A;  5EEH A;  2IGO A;  3DP7 A;  3MMY B;  2K5C A;  2GLO A;  1DU0 A;  4JX4 A;  3EDP A;  3RQ4 A;  2EWN A;  4C2T A;  2DTZ A;  2J5O A;  3M1C A;  2A69 F;  3ZQC A;  5GTH C;  5LBQ A;  3LAJ A;  9ANT A;  2DA1 A;  3K2A A;  3ELK A;  3DPT A;  1YJ9 I;  5F1J A;  5EGO A;  1YE9 A;  1R4M B;  3GF2 A;  5FJ8 J;  1ZG3 A;  3BG7 A;  3S2W A;  2V6E A;  1IW7 F;  3S3N A;  2XHK A;  4LLG F;  2JUC A;  3CQZ J;  2WTE A;  4P55 A;  5FRM A;  3GO5 A;  1XGM A;  2BHZ A;  2HU9 A;  2H94 A;  3IUO A;  1UHM A;  4L5I A;  2FNA A;  1ZGW A;  4TV7 A;  5D6E A;  1T8I A;  1LDJ A;  3S1N J;  2UV1 A;  5EDN A;  1E3O C;  2LKS A;  1PDN C;  2XRL A;  1HLV A;  2XAU A;  3CJN A;  1JKP C;  1E17 A;  3SQN A;  4OAZ A;  2NS0 A;  4AVZ A;  3OYD A;  1WZ2 A;  1BJA A;  1TZL A;  1PUF B;  5EEG A;  1EV7 A;  3MKZ A;  3DEU A;  1FY7 A;  4WK8 F;  1I39 A;  3WE2 A;  2KDZ A;  2KIF A;  2CQQ A;  2L7F P;  1P6R A;  1HDD C;  4CCL A;  1FTT A;  1NH3 A;  3ZOB A;  2DQL A;  3MCZ A;  4PJM A;  4QPQ A;  2DA7 A;  2KZV A;  2Y69 H;  4OU0 A;  2IW5 A;  4L5J A;  4A3E J;  5FD6 A;  1WI9 A;  1Z3Y A;  5F27 A;  5JLW A;  3O3K A;  4G8X A;  5LHI A;  1QPM A;  5B1A H;  2B9S A;  1ORK A;  4XKB A;  4A5M A;  3MAJ A;  2BXZ A;  5IP9 J;  1SFE A;  2G0E A;  2BXY A;  3L2C A;  2IT0 A;  1TLH B;  2BVL A;  2M3A A;  3J7A O;  3QOD A;  2BY0 A;  4PJ0 C;  4ENJ A;  5TJJ A;  4GRI A;  4XR6 A;  3C3W A;  1J7K A;  2LRD A;  2V7F A;  5E3L A;  1YJN I;  4HZF A;  2LVS A;  3PO3 J;  4CYC B;  1P4X A;  5BPD A;  4LG0 B;  1ETO A;  2QBY B;  4BHP A;  2P5V A;  3ZR8 X;  1STZ A;  1O4X A;  4B3X A;  1EH8 A;  2ESH A;  5CKT A;  3GTM J;  3F8C A;  2XV4 S;  3TO6 A;  1VQK I;  4LOC A;  3HPG A;  4RM2 A;  3SHF A;  1F36 A;  4DNC A;  3GFL A;  2HQ5 A;  2Y0S A;  3DCF A;  3FF5 A;  1R5I D;  3FXU A;  4HBL A;  1ZG1 A;  3CC7 I;  4I2O A;  3JRB A;  3DQV C;  5F0H A;  3OOP A;  2ZME B;  3C2G A;  3V4G A;  3LAP A;  4EVI A;  5JHF A;  1MJ9 A;  1A31 A;  1SFO J;  3VWB A;  3FKJ A;  4RGS A;  5ED4 A;  4Y4R A;  1G4D A;  3OSG A;  3W6J B;  1JT0 A;  2GIZ A;  3DEW A;  2JJ7 A;  3A03 A;  1EKE A;  4AC0 A;  2EFW A;  4E70 A;  3BR5 A;  1JHH A;  2CW7 A;  2P6T A;  2ICW G;  1ZEL A;  3K4K A;  4CCN A;  2DU9 A;  2W57 A;  3K9T A;  1F4K A;  2LY2 A;  4MTE A;  5ICF A;  4YG2 F;  4GCV A;  2VB6 A;  3IC7 A;  4MFE A;  2EIN H;  2WBM A;  2VBY A;  5F1R A;  1PUE E;  2RQP A;  5F08 A;  3S3O A;  3G4S I;  3M8J A;  1RET A;  2IXS A;  1AOY A;  2ELK A;  5JLX A;  3RPU D;  5FRN A;  4Y52 J;  2VI6 A;  2JVG A;  3QWL A;  2ZJ2 A;  4BE0 A;  4D0P A;  2L5Q A;  1P4W A;  3BG5 A;  1SFX A;  3B6C A;  3C2B A;  5DCM B;  1LEB A;  4G12 A;  4PCQ A;  3BPV A;  1MNM C;  3E5Q A;  2IEK A;  1PP7 U;  3HM5 A;  1S7E A;  2WAQ N;  3FM3 A;  2CS3 A;  3HKZ N;  4HST A;  4PSX A;  1MBE A;  4DYR A;  1D1A A;  4C2U A;  1FOW A;  2Y0S N;  2H27 A;  1O3Q A;  3M1E A;  4D1Q A;  3KLN A;  4M73 A;  4EJV A;  4PFP A;  1XMK A;  1XGN A;  2Q2E A;  3RPQ A;  2Z9O A;  4XLA A;  4BY1 J;  3HPH A;  3M3Y J;  4HV6 A;  3JRD A;  2IVM A;  3CCL I;  2VXD A;  2JVH A;  3M8F A;  1MDM B;  3I59 A;  1FLI A;  5DS9 A;  1IV6 A;  2DAO A;  4QWQ A;  1KYZ A;  2KHM A;  3DLA A;  4HLX A;  1U0J A;  4BHB A;  1G6N A;  3KP3 A;  4KUM A;  1RC9 A;  3HGY A;  4NQW B;  1T0F A;  4D5F A;  4CIC A;  4RAZ A;  2X1E A;  1HKS A;  2AHQ A;  4Z2Y A;  2F4O B;  2C6Y A;  5M5Y J;  4M3D A;  1D8J A;  1U8B A;  2HWV A;  3K7A J;  3H36 A;  1R5G A;  5DUK A;  3J81 K;  3A0H C;  3K2Z A;  1KZH A;  4XRS G;  2Z33 A;  1IN5 A;  4KMU X;  3ERE D;  2MSY A;  3ABL H;  3ZN1 A;  2DW4 A;  3OYG A;  3KFW X;  1LJ9 A;  1F5T A;  2XF7 A;  2XAQ A;  2VT2 A;  2OTJ I;  1QNT A;  4RA2 A;  2HOT A;  1ON1 A;  2K86 A;  4FE7 A;  5ERI A;  2IS6 A;  1Y8Q B;  2JA5 J;  1E2X A;  3UNG C;  1OCP A;  2NOG A;  3FMR A;  1MBK A;  2HKO A;  2ELH A;  4CXF A;  5K7Z A;  2L4A A;  3I58 A;  3WE3 A;  2ID3 A;  1GT0 C;  1SEU A;  1K61 A;  1IXR C;  2JA2 A;  2PEX A;  3E97 A;  1RR7 A;  2HZD A;  4XKC A;  3OR1 C;  1H88 C;  2IBD A;  2A6H F;  3CCS I;  5FRO A;  2QVO A;  3C2H A;  1G3T A;  4IQJ A;  4JBA A;  4UV8 A;  4A3K J;  5KAF C;  2HPI A;  1T39 A;  3IL2 A;  1BW5 A;  4KN4 X;  5DD8 A;  4L0Y B;  5AIP A;  4XRS A;  3H92 A;  2L02 A;  4WXC A;  1TBX A;  1WQ2 A;  2OUM A;  1KU3 A;  1T56 A;  2ZJQ F;  1BL0 A;  2M45 A;  1B9M A;  4IHS A;  2GZW A;  4BE2 A;  1ZK8 A;  2CUE A;  4R1H A;  1NTC A;  1VZ0 A;  2E7W A;  4ESJ A;  2GWR A;  3ZMS A;  5LRS A;  2HYF A;  5HS9 A;  5K7F A;  5HLG A;  3GTL J;  5HS8 A;  3GX4 X;  1C0W A;  1HDP A;  1XSX A;  4EM1 A;  4KJZ A;  1TWH J;  5FLX Z;  1JJ8 C;  2UXN A;  4LK1 F;  5FD5 A;  3JSO A;  4CZZ A;  3KP7 A;  5GTI C;  1MSE C;  2DOD A;  3CDH A;  3OYK A;  1MMD A;  1WH5 A;  2EIK H;  2FE3 A;  5F0C A;  4I7H A;  4A5N A;  1FEX A;  1PUF A;  5B1B H;  3ZN0 A;  1VFC A;  3JR9 A;  3K1M A;  5LRR A;  3L1P A;  4IVN A;  3IAS 2;  3DWL E;  1T0F C;  4KNY A;  4I09 A;  1G59 A;  2VQG A;  5GAG J;  4PUS A;  2NS7 A;  3BR0 A;  2OU2 A;  4XKV A;  2ZO4 A;  3QYE A;  1ZN2 A;  5DUI A;  2YU3 A;  4ZTJ A;  1Z67 A;  2ESN A;  1LDK B;  2E60 A;  5KAI C;  3DFG A;  1A6Q A;  1TWC J;  1YIT I;  1D0X A;  4F92 B;  2IGK A;  3DEE A;  4EM0 B;  3RYR A;  4XOT A;  4DGW B;  1K79 A;  1HQC A;  3HRM A;  3D5L A;  3G1L A;  4HRI A;  3DXJ F;  2L7M P;  1OYY A;  1UMQ A;  5FGM A;  1J5Y A;  2QZ8 A;  3A02 A;  1OCC H;  3PNV A;  4L18 B;  3VYS B;  2EH3 A;  4QSH A;  2EZH A;  2TCT A;  5EG0 B;  4AVP A;  4A0Z A;  1SVL A;  1IUF A;  3CUO A;  4C3I J;  3RCO A;  4IOC F;  3UR3 C;  2FOK A;  4LIV A;  3CCV I;  1XG1 A;  2FBI A;  3PQK A;  2R7Q A;  4L9V A;  2R0Q C;  1YW8 A;  1LVA A;  1B4A A;  2L3D A;  1MD0 A;  3HB9 A;  3W6V A;  3HZJ A;  3R61 A;  4BAC A;  2VPL A;  3OYI A;  3M8E A;  4M9Z A;  1SFK A;  2DYS H;  2CWE A;  4A12 A;  2OAZ A;  2D1H A;  1HBX G;  2VOD A;  1IRF A;  1K7A A;  2HYG D;  4UXN A;  3OMY A;  4NUB A;  3FXL A;  3FHZ A;  3ZPL A;  3HRT A;  2Y2Z A;  4WX9 A;  2A5Y B;  2DA6 A;  4IXA A;  1LVK A;  1QHH D;  4HQE A;  1K6O A;  1IN7 A;  1Z91 A;  2DDB A;  2X0L A;  2BVM A;  3ZGK A;  5H2F C;  2EZI A;  5K5Q A;  4ENK A;  1S9H A;  2IGN A;  3MZH A;  1Q1H A;  1JKR C;  2RVC A;  4MNU A;  5D5X B;  3IKV A;  2KDO A;  5IYB J;  1ITY A;  3JRF A;  4LFU A;  3R6S A;  2L01 A;  2CV0 A;  2QYO A;  2RDP A;  1AWC A;  3HKZ A;  2AO9 A;  5D8L B;  2Y0M A;  4FX4 A;  1F9N A;  2OQG A;  4RM3 A;  3GLL A;  5J8C A;  1Z1D A;  3FX3 A;  1FIA A;  2R7X A;  2WC2 A;  4IL6 C;  3SZG A;  1WJF A;  3AL0 B;  4EGZ A;  1V3F A;  2HS5 A;  2X1C A;  2E2J J;  4XKW A;  5DEQ A;  4MQ9 F;  3BR2 A;  4FAS D;  1RZ4 A;  1X1B A;  4ZDP A;  2R5Y A;  3GME A;  2HKX A;  3EUH C;  1ETV A;  3RJP A;  2W82 A;  1OFC X;  3AG3 H;  3PUB A;  3H0G J;  5ILS A;  1XGO A;  4E7L A;  4XON A;  3BG3 A;  3E6M A;  3MVP A;  1VTN C;  1OKR A;  2LC2 A;  4MQV A;  2M30 A;  2HTS A;  1MDM A;  2OCC H;  2LY1 A;  3ERM A;  3G73 A;  1ZAR A;  1HW5 A;  3HTU A;  3LA7 A;  2QBY A;  2Q1Z B;  3KE2 A;  2V1X A;  2M8G X;  4IEJ A;  1MSF C;  2F5F A;  2DMT A;  2VKV A;  4EEF G;  2GM4 A;  2XB5 A;  1MND A;  3QRF F;  2VKD A;  3TO9 A;  2HXO A;  3P9I A;  4KIC A;  4BXU A;  1SFU A;  4F7Z A;  1QO0 D;  3RQI A;  5E1X A;  1H9T A;  4QTR A;  3KP5 A;  4CCK A;  3L2U A;  2JMW A;  4Q48 A;  4A3I J;  2PFB A;  3S16 J;  3N4M A;  2KJC A;  1XDU A;  1DP3 A;  1W5T A;  2JT1 A;  2DJN A;  2VBW A;  2CUJ A;  2M7A A;  3WOD F;  4BS9 A;  1BM9 A;  4EJO A;  2KIM A;  2K9S A;  3G2B A;  3NQO A;  2BHY A;  2I5U A;  3SEZ A;  4IRG A;  2M87 A;  2A07 F;  1IN6 A;  1P7I A;  3K4B A;  3GWZ A;  1I5Z A;  3KEQ A;  3WTS C;  2FRH A;  3J80 K;  1P7J A;  1XMA A;  2IAI A;  2Y75 A;  5LEJ A;  2CMP A;  4F55 A;  2DLL A;  2G7U A;  4AD9 A;  2EB7 A;  2JRM A;  1IJW C;  2L7K A;  1JJ6 C;  4KA4 A;  1RI7 A;  1FTZ A;  4II3 A;  1I3A A;  2DPD A;  1GV5 A;  2FU4 A;  2KLO A;  1N77 A;  1YRN B;  1R49 A;  2WAF A;  1Y0U A;  2CFO A;  1FYM A;  1RKT A;  3A1Y A;  3K6G A;  4M6X A;  2XAH A;  4UY8 I;  1A04 A;  4P9F A;  3RKX A;  2EV0 A;  1L0O C;  1SAX A;  3OS0 A;  1ON2 A;  2E5Z A;  5D4R A;  1BOB A;  3BWG A;  4GO1 A;  1ZLK A;  1KU7 A;  3CMA I;  2HOS A;  2FXA A;  5DV5 A;  4FE4 A;  1YIO A;  1UG0 A;  2WAE A;  2HOE A;  2DK5 A;  3RTR A;  2DOF A;  2BBY A;  2MW8 A;  4KN7 X;  2E2I J;  4FHT A;  3RKQ A;  1W5C C;  2MD0 A;  3KYL A;  5IOY A;  5IP7 J;  2PLY A;  5LEK A;  3WU1 B;  4C2M J;  4ZZL A;  3P7N A;  4HSR A;  1ENH A;  3BQZ A;  1AKH A;  3EET A;  5JHU A;  4BJ5 C;  2W00 A;  4M9S A;  3F72 A;  5DYM A;  3VSL A;  2XPU A;  1BI3 A;  4OAY A;  3ZXS A;  2WAD A;  4C30 A;  2QGU A;  1A36 A;  2ACJ A;  4ZH4 F;  5ICG A;  4MHG A;  2L9R A;  3AG1 H;  1YFH A;  3OIO A;  1JKO C;  1Z6T A;  1QQI A;  2FMY A;  1ULY A;  5J3L A;  2DDA A;  1SMT A;  1HW1 A;  3ZQL A;  2BY2 A;  1ZH5 A;  3SZP A;  5D6F A;  2CUF A;  3QPH A;  2NVY J;  3ONQ A;  4IF4 A;  3OL3 A;  2DFI A;  2VBZ A;  2CV2 A;  2ZXW H;  3WG7 H;  5C4X J;  2M0C A;  4L0Z B;  3VSK A;  5E1W A;  1TNS A;  1FSE A;  3CJR B;  2ZXH A;  3OIP A;  4V2G A;  4B43 A;  2DOE A;  4G7O F;  2OBP A;  3V8K A;  2HPM A;  1R22 A;  4CCM A;  2O3F A;  4ANJ A;  1MBF A;  1U5T B;  4UV9 A;  1QA6 A;  4XOP A;  1FYL A;  1B1B A;  3MFK A;  2Y31 A;  4E7Z A;  5C3E J;  3AKZ A;  3O2P E;  1BN5 A;  5B3S H;  1X4P A;  1WJA A;  3TW6 A;  3WTZ A;  5IT3 A;  4CGZ A;  4DIQ A;  2H8W A;  3COA C;  3V8J A;  2VC0 A;  4BQQ A;  4E6K G;  1CF7 B;  2MYS A;  3BR1 A;  2ZME A;  3HG9 A;  2LYC A;  3OYE A;  3C18 A;  1W0U A;  3ZMV A;  3HJE A;  4HNT A;  2MFZ A;  3EYY A;  4L9J A;  2Z99 A;  3B02 A;  2LSO A;  4LIU A;  2D2W A;  1K78 A;  2K4J A;  1Y39 A;  3KZI C;  3DLL F;  2XAJ A;  4LJZ F;  3TBI A;  4LLL A;  3VEP A;  1J9I A;  4CYD A;  3M4O J;  1W7P D;  1R4N B;  2JSP A;  5HOO A;  3S1R J;  2ELJ A;  3KLO A;  4RMN A;  1ODD A;  1RNL A;  1MGT A;  2XRO A;  1KYW A;  2OPT A;  3VYT B;  2K3P A;  1X3Z B;  5EZG A;  4IHT A;  3S15 J;  2COB A;  1DGW Y;  2KZG A;  2V9K A;  2CQN A;  1IRX A;  3ESW B;  1W1W E;  1FBS A;  2HVR A;  1Z7U A;  1YTY A;  3F3X A;  3AL0 C;  1VQ4 I;  3H9Q A;  3LOC A;  3GFI A;  2V26 A;  3O8G A;  4Q5S F;  2KRF A;  2HI3 A;  4R79 A;  2UWM A;  2KL4 A;  3TW7 A;  5IY5 H;  3H0D A;  3V7S A;  1WVR A;  4CUG A;  4KIF A;  4ZJZ A;  5L3C A;  2DTR A;  2DYR H;  2OD5 A;  3DPU A;  3E0J B;  2F48 A;  2F6C A;  1GHC A;  2NVT J;  1G8X A;  2QLZ A;  3K69 A;  1BR1 A;  3Q5F A;  2LKP A;  3W6K B;  3PM1 A;  1A5J A;  1BC8 C;  2DA3 A;  2ZSH B;  2KKO A;  1JGS A;  1I1S A;  3V7R A;  5BMZ A;  3EUA A;  3ABM H;  3PSF A;  1MZB A;  1FOX A;  2ISY A;  1ZGJ A;  1WI3 A;  2ZCW A;  2COM A;  2GOX B;  2LDU A;  3E1S A;  4WWC A;  2DXI A;  1LFU P;  4YEL A;  6PAX A;  1Z7L A;  1O57 A;  4PJL A;  3ABU A;  5KHD A;  1X1P A;  3OL4 A;  2HVS A;  3U1K A;  2XF6 A;  4GXO A;  2BYV E;  2WA0 A;  3SFI A;  4A3C J;  3SDG A;  3Q0V A;  4CYC A;  1OYI A;  1V54 H;  3I64 A;  3R60 A;  1WCM J;  2X51 A;  2Z5U A;  2LF8 A;  3TMO A;  2YX7 A;  4FET A;  4UVB A;  1OR7 A;  4GYI A;  2MBF A;  4DJA A;  3M9A A;  1U9O A;  2PMZ A;  1NK3 P;  2V1D A;  4F3Q A;  5J8F A;  3ABK H;  4C3H J;  1DGR M;  5L3F A;  3OS1 A;  2XAS A;  3CCR I;  4I0B A;  5HDN A;  4ABZ A;  1U6G A;  5FLX K;  5DM7 F;  1V5F A;  1WH7 A;  2OA4 A;  3M07 A;  1BR2 A;  4IPA A;  5D5U B;  3K4J A;  2O61 A;  4XN3 A;  4I6Z A;  1FOK A;  1FBQ A;  2P8T A;  1WPK A;  4PFO A;  2VN2 A;  5M3F J;  3LFK A;  1SAU A;  4RAF A;  3LSI A;  2EFN A;  2M8E A;  1QHG A;  1IRZ A;  1QRY A;  4YIR X;  5BOX A;  1R9T J;  2RC4 A;  2RAE A;  4JQF A;  2JSC A;  1ZG5 A;  1JTX A;  2UZK A;  2BE5 F;  2Q2E B;  3C7J A;  2PQ8 A;  5FO5 A;  1IF1 A;  3ZRG A;  4I01 A;  1W0T A;  3G71 I;  3LNQ A;  5J1R A;  3HBL A;  3KET A;  4BBR J;  2A05 A;  2E71 A;  2VXZ A;  5J4V A;  4A0X A;  2VJI A;  3ISP A;  5H6Q A;  2X4H A;  3VDX A;  1T38 A;  4PJN A;  4WCG A;  1R36 A;  5K1Y A;  1WJC A;  5FKM A;  3UKG A;  3T8R A;  4DBQ A;  1MNE A;  4B09 A;  1S8N A;  4LGW A;  4DQ2 A;  1S7A A;  2TRT A;  4Y17 A;  3CO7 C;  1OLT A;  1Z6R A;  2YU9 J;  2HFH A;  2R5Y B;  1ETY A;  2K9Q A;  2XAF A;  1ETQ A;  1MBH A;  1Y56 A;  2BEO A;  2XIG A;  2HZT A;  2XAG A;  3AAF A;  2A68 F;  4NC8 A;  3VYU B;  3CF5 F;  3RSN A;  3H3V K;  2XSD C;  3E3V A;  2GA2 A;  2EIM H;  5KNL A;  2YS9 A;  1E3H A;  1UB9 A;  4N0B A;  2Y9Y A;  2QQ9 A;  2R7U A;  3W2W A;  5BNG A;  1FOY A;  5KCM A;  1WFX A;  3PFI A;  4OOI A;  3ASN H;  1DPR A;  5EF6 A;  1N25 A;  2R7O A;  3GTO J;  2STT A;  4AU7 A;  3ZCO A;  2E1M B;  1D1C A;  3LSP A;  2O9L A;  2EZL A;  2F2E A;  2YUS A;  3WHC A;  2O6G E;  2F5C A;  5JI6 A;  3F8B A;  3HGG A;  2BGC A;  2TDX A;  2E1M C;  2QSF X;  2JA8 J;  4OMZ A;  5FKL A;  1DP7 P;  4RS8 A;  2JUG A;  1HW2 A;  2DQR A;  4G7H F;  3NAU A;  4XID A;  1FMW A;  2VKH A;  2K9N A;  2W24 A;  4HF0 A;  2PJR B;  1DQU A;  1OMI A;  2NXN B;  4NNJ A;  3BTJ A;  2AXL A;  2EA2 A;  1TW3 A;  3K1P A;  1D0Z A;  3I0T A;  3TL4 X;  5BS6 A;  2GXA A;  3HRS A;  2XGE A;  4HNV A;  2P5K A;  3E6B A;  1XD7 A;  2LK2 A;  1XN7 A;  4XSX F;  4ITV A;  4RGX A;  2Y48 A;  2WB1 A;  3RPU A;  3KZY A;  4U87 A;  1XSD A;  2KPM A;  4B3A A;  3L2W A;  1QVT A;  4BHC A;  3ZMD A;  2DK8 A;  2CO5 A;  1T98 A;  2VPR A;  4DW6 A;  1WSU A;  2VIX A;  4U0Y A;  2L2O A;  1XCV A;  2NVX J;  1QPI A;  3CLO A;  4PGH A;  3VPR A;  2MGQ A;  2YX4 A;  4AM3 A;  3QU6 A;  1T95 A;  1MMS A;  2H6C A;  2O8K A;  2WV0 A;  3HL2 A;  1E3P A;  1HKT A;  3HOU J;  2KP6 A;  2RN7 A;  5GAH J;  1YX5 A;  1ONV A;  3DV8 A;  1G2H A;  1R58 A;  3T8T A;  1K4T A;  5L3G A;  2DFH A;  3RKY A;  4Q4Z F;  2KQR A;  2FML A;  3NWT A;  1MMG A;  2DI3 A;  1RUO A;  4GYG A;  3F8N A;  4NQW A;  2FQ3 A;  3LL7 A;  2QQ8 A;  1O7L A;  4KYW A;  4FTH A;  1LE8 B;  3Q9S A;  2HQA A;  4G94 A;  1OPC A;  5ICC A;  3QPT A;  2Q0O A;  3J7A Y;  1HCR A;  3HSE A;  4M72 A;  3FHN A;  1ZLJ A;  4XOR A;  2PX9 A;  4AID A;  2DFE A;  2LBF B;  1VQ5 I;  3E7L A;  1S3J A;  2DA5 A;  4QLC U;  3X2Q H;  1J2X A;  2VT3 A;  2XSJ C;  2F4I A;  3DKX A;  2PBI A;  4ZYD A;  2EFP A;  3A01 B;  2FF4 A;  4KT6 A;  4P9U A;  5CJ9 A;  3BR3 A;  1CGP A;  1IRG A;  4JOM A;  4ZYA A;  3B73 A;  2CW0 F;  3KYD B;  4R8H A;  1BI0 A;  1IV8 A;  2E7X A;  2MC3 A;  2H8R A;  1YLF A;  3BJA A;  3FXJ A;  1V55 H;  3IRQ A;  4OIQ F;  1FX7 A;  3MN2 A;  2K27 A;  2OQR A;  3PJR A;  2DO7 A;  5CVU A;  3KEO A;  5K5R A;  3TO7 A;  1ZR4 A;  2MLK A;  3K1N A;  4PDK A;  4RB1 A;  3EQL F;  3J7Y J;  1LB2 A;  4UB8 C;  4KDP A;  1GVJ A;  2CYY A;  4PGG A;  2ME0 A;  4Z6Y A;  2O0Y A;  5KVR A;  1ZRE A;  2DJI A;  2OZ6 A;  2L9V A;  1GDT A;  3BTI A;  4YII A;  2MG4 A;  3C1D A;  2HR3 A;  3U2R A;  1TTY A;  3WTT C;  3QPL A;  1YHQ I;  4CCO A;  2OZU A;  4A0Y A;  3HUG B;  3WU0 A;  1J75 A;  3HUG A;  2DA4 A;  3J7Z I;  2E5N A;  2EZK A;  3W3C A;  1QZY A;  2JZY A;  2FX0 A;  1NG7 A;  4MFD A;  4N9H A;  1ZR2 A;  3ECH A;  2FOW A;  3JRG A;  3VYR B;  3VOD A;  2NRA C;  3SZT A;  3BJ6 A;  5HDG A;  3TED A;  3P9K A;  1T2K A;  1NK2 P;  2VBX A;  3F6V A;  2H6B A;  3HTS B;  2GXB A;  1BR4 A;  3J80 Z;  2LRE A;  1D8K A;  4LMY A;  2AQF A;  3TDZ C;  1IC8 A;  1IZ1 A;  2FSW A;  4JX5 A;  2RRE A;  4RB0 A;  4M3G A;  3CZ6 A;  2E1C A;  3LFU A;  3U1D A;  1XS9 A;  3CLQ A;  3K4M A;  5LHG A;  2AS5 F;  1MBG A;  1BOA A;  3DBL B;  2WY8 Q;  4P5O A;  5IP6 A;  3GYH X;  3D0S A;  3H3U A;  2QQA A;  3S3M A;  2VQH A;  2X9D A;  4DYQ A;  2L9S A;  5L3E A;  5D8K B;  3HDD A;  2Z1D A;  1K4S A;  4MEX F;  5ICE A;  1FIP A;  1FP2 A;  4GDF A;  2KT0 A;  4I99 C;  3OYC A;  2JRT A;  2CRG A;  1UEL B;  3EYI A;  4OMY A;  1SD4 A;  1UHS A;  4JP0 A;  2JTV A;  2VON A;  1J09 A;  2OC6 A;  3FKI J;  1XX5 A;  1TT5 B;  5CQE A;  1X1A A;  3JRI A;  3DU5 A;  1I3Q J;  1KQ8 A;  3OYJ A;  3CTA A;  4UUV A;  2MH2 A;  4ESF A;  1YW7 A;  3K10 A;  1MMN A;  2X1D A;  4B8X A;  2VJ4 A;  2W1O A;  2H09 A;  3HSF A;  3GTG J;  4BKX A;  1I6X A;  4A69 C;  1U5T C;  2LP0 A;  3H5R A;  3F8M A;  2A3S A;  3WTY C;  1U2W A;  1DDN A;  4CO8 A;  1B59 A;  5E3M A;  4A2U A;  3S14 J;  2MAB A;  2V1N A;  3I59 B;  3I9V 2;  3S17 J;  2QM3 A;  2VQC A;  1UJ8 A;  1YX3 A;  3P9C A;  4M74 A;  4BY7 J;  3WU2 C;  2XVC A;  4QPO A;  2HYJ A;  4FIS A;  3CCE I;  2CV1 A;  1D5Y A;  1TWA J;  2P0W A;  2R7F A;  1BC7 C;  1YRN A;  4YIF A;  1V5E A;  1IO2 A;  2EIJ H;  4BH9 A;  2CQ7 A;  2BY3 A;  4N9I A;  2M7B A;  3BG6 A;  5TRD A;  5JVG F;  2CQX A;  4XM3 A;  4IO9 F;  1HSJ A;  1X3U A;  4ASN A;  1KON A;  4BYY A;  1Z77 A;  2J5P A;  4LG0 A;  5GAE J;  1XTA A;  4BJ6 C;  2QSH X;  1JUS A;  2M0M A;  3BY6 A;  3KP4 A;  4MGR A;  4P96 A;  5F04 A;  4WXD A;  2K40 A;  3BOQ A;  1P9Q C;  4WF2 A;  2V9P A;  4F93 B;  2L9N A;  1FPQ A;  5FB2 A;  2K3F A;  4RBO A;  3IKT A;  3MKW B;  3CF2 A;  4BDZ A;  1VQO I;  2MH9 A;  3OYB A;  2V79 A;  4G6Q A;  2BW3 B;  2ISZ A;  3L9F A;  2I8D A;  2XPV A;  3OYN A;  3HOT A;  3PFY A;  4F91 B;  3NEU A;  1QVU A;  3A2K A;  1FT9 A;  1Z0X A;  2PMU A;  4XLH A;  5FLM J;  2NNN A;  3CCQ I;  1EF4 A;  1O3S A;  3ZQQ A;  3GTJ J;  3BCA A;  4YFK F;  1HA8 A;  1TC3 C;  2OTL I;  2LKX A;  4BQA A;  1H8A C;  5DDG A;  2ME6 A;  1GVD A;  2KIS A;  1BI1 A;  2FEZ A;  3A4C A;  1J59 A;  4M3F A;  4G6T B;  4NDL A;  3V8L A;  3LSJ A;  5LGU A;  1VQ9 I;  5FKN A;  5DCF A;  2RGV A;  2VAS A;  5J40 A;  3BDD A;  3M7G A;  3CC2 I;  2M2E A;  4IRI A;  3IWF A;  2NAZ A;  4XRF A;  3TQN A;  4B1R A;  3GTP J;  1O3R A;  1S5L C;  2QWW A;  3E5X A;  2P5L C;  4JX6 A;  4XK4 A;  4YFN F;  3PNT A;  4KFC A;  3JRC A;  3ZQG A;  3GZN B;  2F5D A;  5EZH A;  3I55 I;  4V19 K;  3VFZ A;  2BW3 A;  2P6S A;  2ZXJ A;  3CUQ A;  3KX2 A;  4B47 A;  5J47 A;  3E6D A;  4AWX B;  3DBR B;  4BXF A;  4CSW A;  2VUM J;  4U88 A;  1REP C;  2BZT A;  2PN6 A;  1EA3 A;  2DA2 A;  4M6V A;  4B4C A;  4EV0 A;  1HOM A;  3Q3S A;  3OOU A;  3ZMZ A;  4FCY A;  5FKO A;  4OIN F;  3GTK J;  4AYB A;  4BDY A;  3U9G A;  4EJT A;  1KQ9 A;  4ZDL A;  3JSP A;  2ID6 A;  1QGP A;  1HKQ A;  5JFR A;  3DF8 A;  2M34 A;  3MKL A;  4KT5 C;  3HOW J;  2P7C B;  4UUS B;  2ZBK A;  3G1M A;  1CF7 A;  3WGI A;  2MA3 A;  3LQR A;  1ZGA A;  3H9G A;  5F6F A;  2HEO A;  2LTP A;  2R4G A;  2IP2 A;  1P2F A;  4XMY A;  3LWF A;  1KU9 A;  1MH4 A;  4A3B J;  1K78 B;  2DCE A;  1LE8 A;  2WB1 N;  2PJR A;  2KRH A;  2MC4 A;  3AG4 H;  1LFB A;  1XGS A;  4BJT A;  5B66 C;  3OIQ A;  2Z2S B;  3B6A A;  5M3M J;  2GIV A;  3K4C A;  3SFZ A;  2ECB A;  3HSR A;  4G9Y A;  4EGY A;  4LG3 A;  4BQO A;  1OIS A;  4D7N A;  1TNT A;  1DPU A;  1YO5 C;  3DKW A;  3ZQH A;  1YYV A;  1S72 I;  2Z3Y A;  2R7D A;  3WHB A;  1FJL A;  4B44 A;  4Q47 A;  3WTX C;  1V5G A;  2W4S A;  4YFX F;  4BNC A;  2CH0 A;  1Y0N A;  3QAH A;  1FZP B;  4M6Y A;  3W2V A;  5IYD J;  2KMU A;  5HS7 A;  2FBH A;  2JA7 J;  2K02 A;  3T0Y A;  4RDU A;  3G1O A;  2NVQ J;  3I5U A;  4I76 A;  4AYB N;  2KFD A;  1VI0 A;  3CCU I;  1Z9C A;  5BQT A;  2LOO A;  2PG4 A;  1WGX A;  3LSH A;  1XMX A;  4IHY A;  1UZC A;  2B0L A;  2QKM B;  2XKO A;  1IXS B;  4Y7N J;  1K6Y A;  5K5O A;  5CVR A;  1VQN I;  4XN0 A;  4UUS A;  5FFZ A;  2O03 A;  1XB4 A;  4RB2 C;  1LFP A;  1FP1 D;  4U0W A;  4ZZD A;  2Y9Z A;  2DN0 A;  3GXO A;  3HHG A;  5CVV A;  1F1Z A;  3VB2 A;  1Y1V J;  2E1N A;  4LB5 A;  1X2N A;  2RKH A;  2RNG A;  2DFF A;  2K9M A;  1B9N A;  2EJR A;  3DTI A;  1ETX A;  2E36 A;  5M5W J;  2LG4 A;  4ENM A;  1A35 A;  1BIA A;  5CVI A;  1UCR A;  3WTU C;  3RKW A;  1B72 B;  5EEA A;  2D1V A;  4J00 A;  5GPA A;  3O6B B;  1S7O A;  5TGT A;  4CDG A;  2LD5 A;  3CUQ C;  3D5R C;  1QZE A;  4XL9 A;  5IT9 Z;  3PL8 A;  1TW2 A;  2H1L A;  4XLE A;  1SVM A;  4A6E A;  3H5A A;  3PUF A;  2EA4 A;  3KP6 A;  3S93 A;  1OR7 C;  3WGH A;  5ILU A;  1GUU A;  1VQ8 I;  4ENN A;  5J1Y A;  3RYP A;  4EJW A;  2CGP A;  5DCM A;  2DT5 A;  2HQN A;  3LQQ A;  3GLX A;  4DOZ A;  5GAD J;  1ZQ3 P;  4HF2 A;  1J0R A;  4U0V A;  3CMY A;  4G6D A;  4GFB A;  1FMV A;  2CFX A;  4YEJ A;  2EFO A;  2F5V A;  4HNU A;  1MJA A;  1W4M A;  1LKX A;  2DMN A;  3F22 A;  2XF5 A;  2UXX A;  2M4G A;  5AIQ A;  3ULQ B;  2BY1 A;  3F6O A;  2XPW A;  3LST A;  4XLF A;  4ON0 A;  4MLO A;  1BIB A;  4L9N A;  4H0E A;  5J4Y A;  4LK0 F;  3F21 A;  3ZQ7 A;  3K70 C;  2RQQ A;  3IP4 B;  1YG2 A;  3H35 A;  3HOS A;  1D5V A;  2FNP A;  1IDY A;  3CMM A;  3O8H A;  1Q1V A;  1AU7 A;  3CCM I;  2R93 J;  1SC7 A;  1KA8 A;  1VQP I;  2LFB A;  4NB5 A;  3ZMT A;  2NOJ B;  2R7T A;  1A6I A;  4UVA A;  3TOB A;  4L5E A;  3LSK A;  4HLY A;  1S6L A;  4NC6 A;  2A61 A;  3QQA A;  3TOA A;  1JUP A;  2W48 A;  2VL8 A;  2V1U A;  4MIM A;  4RB3 C;  3ASO H;  4JYK A;  4HOB A;  4IRH A;  1QU3 A;  2VE9 A;  2QA4 I;  1KQ0 A;  2VOP A;  4W97 A;  2W84 A;  5JR3 A;  1VQ7 I;  3TGN A;  5EGO B;  3HOZ J;  2FJ1 A;  2JA6 J;  3N97 A;  2HGC A;  3L00 A;  4U7D A;  4UHT A;  1MJB A;  1WHU A;  1R71 A;  2M9H A;  4XLN F;  2EQR A;  2DOA A;  2IS4 A;  4ZTF A;  2RNJ A;  2ADU A;  2XKP A;  3BQY A;  3MWM A;  4PSW A;  1U8R A;  4E7I A;  2NYX A;  3NRV A;  1XSV A;  4HX4 A;  3R0A A;  2Q8K A;  1R00 A;  4HDV A;  2R3S A;  3LA3 A;  1YS6 A;  1GXP A;  4ESB A;  5IT9 K;  2HDW A;  2IGM A;  3HC7 A;  2VLA A;  4OIP F;  1U5T A;  1IGN A;  1I6H J;  3HOX J;  5LLQ A;  2HTJ A;  4IJA A;  3MKY B;  2GQQ A;  5LFA A;  4I0A A;  1W36 D;  4HPQ A;  4X0G A;  4EMS A;  4HDU A;  1EH7 A;  5IOZ A;  2G9W A;  3JTG A;  1OCZ H;  2OCE A;  2I10 A;  3OWT A;  1QZZ A;  3CME I;  4N4O B;  3L09 A;  4K2E A;  1SD5 A;  1UHW A;  1QBJ A;  4I02 A;  5GP9 A;  5J1U A;  3S32 A;  2LR8 A;  1MKM A;  1DU6 A;  4M3E A;  1E0E A;  3DKY A;  4D9J A;  2WAQ A;  2VQL A;  2WV1 A;  2DBB A;  2XGX A;  4Y15 A;  3CUQ B;  5LGN A;  2CW8 A;  2LNB A;  3FDY A;  4HV5 A;  2R5Z A;  1ERD A;  1PJR A;  5HVQ C;  3GEZ A;  3HYI A;  3Q0U A;  3DTK A;  2DT6 A;  1W5S A;  2V6C A;  3FMS A;  2R5Z B;  4IHX A;  3D5S C;  2CSO A;  3ML6 A;  4HYE A;  1YW9 A;  2ZSI B;  1K83 J;  1R23 A;  1KGS A;  3KIO A;  4Y3O A;  3HIF A;  5M5X J;  4KIB A;  1APL C;  1JGG A;  2O8X A;  1X58 A;  1VQM I;  4OIO F;  2R7S A;  5HLH A;  1EH6 A;  4ZYG A;  2LF7 A;  2EV6 A;  4C9Y A;  1HST A;  1B8I A;  4RAY A;  3ECO A;  5D5W B;  3PNY A;  4RGU A;  2HDD A;  3S2H J;  1POG A;  3TKY A;  1BJZ A;  1ZYR F;  4DZJ A;  3PQJ A;  3IWZ A;  1R1V A;  3LA2 A;  4PK4 A;  3S1M J;  4O3M A;  4IKF A;  1NHA A;  3GCM A;  3TP3 A;  1JKQ C;  4EJU A;  1LDD A;  2W7N A;  3KZZ A;  3MZY A;  2FD5 A;  1PYV A;  2LBF A;  3KEY A;  2R7Z J;  1IG7 A;  2M1B A;  1BI2 A;  1WJ5 A;  3RI4 A;  4S0H B;  4HEA 2;  3BTL A;  2R7W A;  2HOA A;  2YPR A;  4RLQ A;  3I3L A;  2JPC A;  2BV6 A;  4H4K C;  4S04 A;  4D7M A;  2AQE A;  2ZKZ A;  4WXH A;  3ROU A;  2D45 A;  1AKH B;  4MEY F;  3CD6 I;  2K7L A;  4Y33 A;  1UST A;  2O5R A;  4EAT A;  1WJB A;  3I71 A;  3KPH A;  2OJE D;  5KK1 A;  2M4K A;  1R5H A;  3CDI A;  3SEQ A;  2A5W A;  5E8G A;  3A01 A;  2QEN A;  4HQM A;  1CQT A;  4XQF A;  5FKK A;  1LQ1 A;  2XDV A;  3FBI B;  4BEH B;  3I54 A;  4HF1 A;  3FBN B;  4BEH A;  2P81 A;  1X3W B;  2NS8 A;  2QQB A;  1U9N A;  1TP4 A;  4I98 B;  3IHU A;  3OYA A;  1RR8 C;  3CJT B;  3QP6 A;  3H1C A;  2ECC A;  3FK7 A;  2ZNY A;  2N8G A;  2V9V A;  4JK1 X;  2STW A;  5AON A;  5LHH A;  3L2V A;  1ZRF A;  1TT0 A;  5HOD A;  3GW2 A;  4A3G J;  5CVJ A;  2AXT C;  4HG2 A;  4PJJ A;  5E3O A;  4KIT B;  1LPQ A;  1MMA A;  5LD2 C;  3K70 D;  3QYB A;  4M9X A;  3MQ0 A;  3BJO A;  2K9L A;  3KP2 A;  3I4M J;  1SD7 A;  3FXQ A;  4XBF A;  4AIK A;  1FYK A;  2GXG A;  1UFM A;  4O5V A;  2DMP A;  2FUG 2;  3ZQI A;  3R0J A;  1I1G A;  1R7J A;  4CH7 A;  4IX7 A;  3BT9 A;  4O6J A;  2EK5 A;  5EJC A;  2R7V A;  1H89 C;  3H9J A;  1WRJ A;  1O7F A;  4RGR A;  3CCJ I;  1BBY A;  1R6R A;  2E1O A;  3CO6 C;  4GGG A;  3IH2 A;  2IPQ X;  3CDL A;  4BXX J;  5F0F A;  2ETH A;  5E1Z B;  5CQG A;  3OYF A;  1ZKG A;  3GVA A;  5DTD A;  3CCY A;  3EUH A;  2QCO A;  3JRH A;  1ZTR A;  5H6R A;  2EIL H;  3I56 I;  2P7V B;  4II2 A;  5CLS A;  3DTE A;  3GZ6 A;  3TDU C;  1RPW A;  4EM2 A;  1V4R A;  3BG9 A;  4BAY A;  3IH3 A;  4LB6 B;  4Y13 A;  2ZJR F;  2DT7 B;  3RZO J;  3A0B C;  4ZDO A;  1IN8 A;  1MIJ A;  1P92 A;  3LMM A;  3L2Q A;  1AHD P;  2JN6 A;  2F5E A;  4FX0 A;  1OCT C;  3JTH A;  1JXS A;  1ZRC A;  3FXR A;  4FQG A;  5CYV A;  2QUF A;  2WY7 Q;  4E4H A;  5C44 J;  1M1E B;  2L0K A;  3JRE A;  3L7W A;  3E6C C;  4BUP A;  1JT6 A;  1FWZ A;  3I4N J;  2OF7 A;  4E7H A;  3WTW C;  4CA0 A;  3QYF A;  3HHH A;  5L3B A;  4E7K A;  3SYT A;  5TIS C;  4AIJ A;  1D0Y A;  1RUN A;  5H20 A;  1NG6 A;  2FA5 A;  2KIU A;  4XLC A;  1PP8 F;  3JRA A;  1PVE A;  1OCO H;  3GBG A;  2ZXI A;  3DU6 A;  3OV8 A;  2O7O A;  2ZFW A;  3BC8 A;  3HXL A;  1O3T A;  1Y1W J;  2YR2 A;  1FSH A;  1TQI A;  3FM5 A;  4XRM A;  4HAM A;  3V42 A;  3OY9 A;  2IA2 A;  1TQM A;  4A93 J;  1FC3 A;  1XCB A;  3GZ5 A;  2CUZ A;  3V7C A;  3F23 A;  1RKW A;  5B5E C;  2WWY A;  3RZD J;  1YOV B;  3DPL C;  2KIQ A;  3GUD A;  2ZFU A;  3QU3 A;  3OSF A;  3KCC A;  4HA8 A;  5HDK A;  5JVT A;  2VOO A;  2HQR A;  4X1E A;  3BCB A;  4UB6 C;  4AUX A;  4A3D J;  3Q9V A;  4X6A J;  3HRU A;  3TP0 A;  1TL8 A;  3QOE A;  3BZC A;  3CJQ B;  3S8P A;  2LMD A;  4ZC3 A;  1OYW A;  4FT8 A;  3HEF A;  4W1U A;  3WG9 A;  3K0L A;  1L3L A;  3IAM 2;  3CP8 A;  4C3J J;  1F43 A;  3FK6 A;  3U21 A;  3QOP A;  4A6D A;  2X6W A;  2IRF G;  3FXK A;  2IA0 A;  2ZNZ A;  3DBH B;  1U78 A;  1VQL I;  2UUZ A;  2PJP A;  5F64 A;  2HNH A;  2W25 A;  2Z16 A;  3MEX A;  4AIH A;  3OS2 A;  4PZJ A;  2DMU A;  2HVQ A;  5A2Q Z;  3PIO F;  3SJM A;  3BTC A;  3RIR A;  3NAR A;  1G3S A;  2VC1 A;  2QEX I;  3MD2 A;  1ZRD A;  5EG0 A;  1HC8 A;  2E19 A;  1I27 A;  2NVU B;  5HNH A;  1D1B A;  1WWX A;  1W7P A;  2HDC A;  1VQ6 I;  5GPC A;  4BQN A;  2JWT A;  1BW6 A;  4YRV A;  2EFQ A;  5HLT A;  4IHW A;  2H1K A;  2IS2 A;  1OQY A;  4MTD A;  3VOE A;  4DBR A;  3OYH A;  3PO2 J;  1ZAO A;  2ZJP F;  3FZV A;  5E8I A;  4E7J A;  5L3D A;  2GA1 A;  4KIG A;  2E2H J;  4IQ4 A;  3F0C A;  4L9T A;  3L2R A;  3NWS A;  1UG2 A;  2R7R A;  3HOV J;  1XC5 A;  1P4A A;  1IN4 A;  2A6E F;  1YQA A;  1JI8 A;  2M5W A;  3EPZ A;  2P4W A;  5E17 F;  2KJB A;  2V4J C;  4CCJ A;  4ZYE A;  1WJE A;  3CP2 A;  3OYM A;  2XRN A;  4ETS A;  3RDI A;  1UAA A;  3BP8 A;  1VF9 A;  1ACI A;  1LEA A;  4A3F J;  1TQP A;  4B48 A;  4CHU A;  3JCU C;  4RLF A;  2DMQ A;  2PMZ N;  3MZ8 A;  4NBQ A;  1IAW A;  1MW7 A;  4UVC A;  3P5J A;  4XNF A;  3WGG A;  5CPR B;  1D3Y A;  2X6X A;  4NHJ A;  2JK3 A;  2EV5 A;  2B7E A;  5IPA A;  5IYC J;  5D5V B;  1R1U A;  3WTV C;  4A3M J;  1LNW A;  2BOL A;  1G3W A;  4F52 A;  4IHV A;  2MD5 A;  2ZC2 A;  1Z05 A;  2JPB A;  4V2F A;  3GFM A;  5E18 F;  4UUT A;  3LSG A;  1X2M A;  4RAG A;  5E79 C;  2G7H A;  5ILV A;  1TWF J;  1Z3X A;  2XGD A;  4G7Z F;  1B72 A;  2X6Y A;  2W85 A;  3I53 A;  1JHF A;  3SDB A;  2E35 A;  2X6O A;  1FNN A;  2L4M A;  3R4K A;  4DYC A;  4S05 A;  1KU2 A;  4N4N B;  3QPS A;  3F9K A;  3BLY A;  2CJJ A;  2PMH A;  4KMF A;  5J6X A;  1H9G A;  2IS1 A;  2GBY A;  2XB0 X;  2QKL B;  2EBI A;  2Y30 A;  1G3Y A;  1SAN A;  3OYL A;  2XUB A;  2VKE A;  1Y8R B;  4P1W A;  3T1B A;  2B63 J;  3I4P A;  5EYR A;  1X1C A;  1FBU A;  1B8I B;  1JUM A;  3H5N A;  5D4S A;  1RES A;  3S1Q J;  4D5C A;  5FFX A;  3ZP5 A;  3BPX A;  1Y6I A;  4OWR B;  3CC4 I;  2DPU A;  2XC7 A;  3BRO A;  3FXM A;  2YSR A;  1Z21 A;  1AA7 A;  1GLN A;  3GTQ J;  3FIW A;  4QIW N;  1SD6 A;  1GXQ A;  5K7H A;  2PI0 A;  1W36 C;  3PSI A;  3FWE A;  5LGT A;  3REO A;  3CES A;  4IZZ A;  4IOA F;  3W2A A;  1LUJ B;  1X19 A;  3AFH A;  3JW4 A;  2ZME C;  2KRC A;  3IH4 A;  3SXY A;  1GV2 A;  4EQQ A;  5HNF A;  3PIP F;  1IDZ A;  1RRJ A;  1ZHF A;  4XIC A;  1U3E M;  1N75 A;  4HW0 A;  5E3N A;  1SMY F;  4A3J J;  3D1N I;  4HX7 A;  1X1D A;  1B6A A;  3ABT A;  4DZP A;  4BBS J;  2JQ7 A;  3N05 A;  1WJD A;  1W7P B;  1VND A;  5E20 A;  3T5X A;  1T08 B;  1YI2 I;  5C4J J;  3BZK A;  2L54 A;  4XLP F;  5HLI A;  3J81 Z;  1I50 J;  4NC7 A;  1EJ9 A;  3HOY J;  1YS7 A;  1N78 A;  2L7Z A;  3S2D J;  1H0M A;  2QSG X;  1ETK A;  5BPI A;  4UNO A;  4M3B A;  1BA5 A;  2LH9 A;  2X48 A;  1YIJ I;  2HXI A;  1TWG J;  3JAM Z;  3K4L A;  4M71 A;  2IA1 A;  5FLV A;  3FIS A;  4LD5 A;  2OV7 A;  1IUY A;  2VE8 A;  3FXO A;  2X85 A;  1XDS A;  2QF7 A;  4HX8 A;  3KYC B;  1HF0 A;  1X4O A;  1RIO H;  1OCR H;  3IRR A;  3QP5 A;  1DUX C;  5A2Q K;  2ZB9 A;  1SVO A;  4ZYH A;  2FBK A;  2MLG A;  1R1T A;  1USS A;  1JE8 A;  3GFJ A;  3E5U A;  4BL0 B;  3FMQ A;  2RV8 A;  2FQ4 A;  3H3Z A;  3BZ6 A;  4XSZ F;  3F8F A;  3G6E I;  2VJ5 A;  2R92 J;  4LIT A;  2K4B A;  1S29 A;  3EUK L;  3LSM A;  3Q0W A;  4OIR F;  1XPX A;  3LSR A;  4J19 A;  1WKM A;  3K4N A;  1MBJ A;  5DD4 A;  4BGD A;  1MH3 A;  2CG4 A;  1ETW A;  2XGC A;  2IJL A;  2LY9 A;  2CQK A;  3JAM K;  2D5V A;  1JTY A;  2GAU A;  3G3Z A;  2GOM A;  3OR2 C;  2A6T A;  1YJW I;  1T33 A;  2VJJ A;  4J01 A;  2CU7 A;  2K85 A;  3AG2 H;  5DM6 F;  4LLN A;  1IXC A;  3ZMU A;  2E34 A; 
#chains in the Genus database with same CATH homology
 1HXD A;  2NNY A;  4U7B A;  1T6S A;  5EEH A;  3DP7 A;  3EDP A;  2EWN A;  2J5O A;  2A69 F;  5LBQ A;  3LAJ A;  3ELK A;  3DPT A;  3GF2 A;  1ZG3 A;  3S2W A;  1IW7 F;  2XHK A;  4LLG F;  2WTE A;  4P55 A;  3GO5 A;  1XGM A;  2H94 A;  1UHM A;  4L5I A;  2FNA A;  4TV7 A;  5D6E A;  1LDJ A;  1PDN C;  3CJN A;  1E17 A;  3SQN A;  2NS0 A;  1BJA A;  5EEG A;  1EV7 A;  3DEU A;  1FY7 A;  4WK8 F;  3WE2 A;  2KIF A;  1P6R A;  2DQL A;  3MCZ A;  4OU0 A;  2IW5 A;  4L5J A;  5FD6 A;  1WI9 A;  3O3K A;  4G8X A;  5LHI A;  1QPM A;  4A5M A;  3MAJ A;  1SFE A;  3L2C A;  2IT0 A;  1TLH B;  3J7A O;  4ENJ A;  5TJJ A;  3C3W A;  1J7K A;  4HZF A;  1P4X A;  5BPD A;  4LG0 B;  2QBY B;  4BHP A;  2P5V A;  1STZ A;  1EH8 A;  2ESH A;  3F8C A;  2XV4 S;  3TO6 A;  3SHF A;  4DNC A;  3GFL A;  3FF5 A;  4I2O A;  3FXU A;  4HBL A;  1ZG1 A;  3DQV C;  3OOP A;  2ZME B;  3V4G A;  3LAP A;  4EVI A;  1MJ9 A;  4RGS A;  5ED4 A;  1G4D A;  3W6J B;  2EFW A;  4E70 A;  1JHH A;  2P6T A;  2DU9 A;  2W57 A;  3K9T A;  1F4K A;  4MTE A;  5ICF A;  4YG2 F;  4GCV A;  3IC7 A;  2VBY A;  5F1R A;  1PUE E;  2RQP A;  1AOY A;  2ZJ2 A;  4D0P A;  1P4W A;  1SFX A;  5DCM B;  1LEB A;  4PCQ A;  3BPV A;  3E5Q A;  1PP7 U;  3FM3 A;  2H27 A;  1O3Q A;  3M1E A;  3KLN A;  4M73 A;  4EJV A;  1XMK A;  1XGN A;  2Q2E A;  3RPQ A;  2Z9O A;  4HV6 A;  2IVM A;  3M8F A;  1MDM B;  3I59 A;  1FLI A;  2DAO A;  4QWQ A;  1KYZ A;  4HLX A;  4BHB A;  1G6N A;  3KP3 A;  4KUM A;  1T0F A;  4CIC A;  4RAZ A;  1HKS A;  4Z2Y A;  2C6Y A;  1D8J A;  2HWV A;  5DUK A;  1R5G A;  3J81 K;  3K2Z A;  2Z33 A;  1IN5 A;  4KMU X;  3ERE D;  3ZN1 A;  2DW4 A;  3KFW X;  1LJ9 A;  1F5T A;  2XAQ A;  2VT2 A;  1QNT A;  1ON1 A;  2K86 A;  5ERI A;  1E2X A;  3FMR A;  2HKO A;  2ELH A;  4CXF A;  2L4A A;  3I58 A;  3WE3 A;  1IXR C;  2PEX A;  3E97 A;  2A6H F;  2QVO A;  1G3T A;  4JBA A;  4UV8 A;  1T39 A;  3IL2 A;  4KN4 X;  5DD8 A;  4L0Y B;  5AIP A;  3H92 A;  2L02 A;  4WXC A;  1TBX A;  1WQ2 A;  1KU3 A;  2M45 A;  1B9M A;  4IHS A;  2GZW A;  4R1H A;  2E7W A;  4ESJ A;  2GWR A;  3ZMS A;  5LRS A;  2HYF A;  5HS9 A;  5HLG A;  5HS8 A;  3GX4 X;  1C0W A;  1XSX A;  4EM1 A;  2UXN A;  4LK1 F;  5FD5 A;  3JSO A;  4CZZ A;  3KP7 A;  3CDH A;  2FE3 A;  4I7H A;  4A5N A;  3ZN0 A;  3K1M A;  5LRR A;  4IVN A;  4KNY A;  4I09 A;  2OU2 A;  2ZO4 A;  5DUI A;  1ZN2 A;  2YU3 A;  2ESN A;  1LDK B;  3DFG A;  4EM0 B;  3RYR A;  1K79 A;  1HQC A;  3HRM A;  3D5L A;  3DXJ F;  1OYY A;  5FGM A;  1J5Y A;  2QZ8 A;  4L18 B;  4AVP A;  4A0Z A;  3CUO A;  2FOK A;  3PQK A;  2FBI A;  4L9V A;  1YW8 A;  1LVA A;  1B4A A;  2L3D A;  1MD0 A;  3R61 A;  3M8E A;  4M9Z A;  2CWE A;  4A12 A;  2OAZ A;  2D1H A;  1HBX G;  2VOD A;  1K7A A;  1IRF A;  2HYG D;  4UXN A;  3FHZ A;  3ZPL A;  3HRT A;  4WX9 A;  2A5Y B;  4IXA A;  4HQE A;  1K6O A;  1IN7 A;  1Z91 A;  2X0L A;  5K5Q A;  4ENK A;  3MZH A;  1Q1H A;  2RVC A;  4MNU A;  5D5X B;  3IKV A;  4LFU A;  3R6S A;  2L01 A;  2QYO A;  2RDP A;  1AWC A;  5D8L B;  2Y0M A;  4FX4 A;  1F9N A;  2OQG A;  5J8C A;  1Z1D A;  3FX3 A;  2WC2 A;  4EGZ A;  1V3F A;  2HS5 A;  5DEQ A;  4MQ9 F;  1RZ4 A;  2HKX A;  3RJP A;  5ILS A;  1XGO A;  3E6M A;  1VTN C;  1OKR A;  4MQV A;  2M30 A;  2HTS A;  1MDM A;  3G73 A;  1ZAR A;  1HW5 A;  3HTU A;  3LA7 A;  2QBY A;  3KE2 A;  2V1X A;  2F5F A;  3QRF F;  3TO9 A;  4BXU A;  3P9I A;  4KIC A;  1SFU A;  4F7Z A;  1QO0 D;  5E1X A;  1H9T A;  3KP5 A;  4Q48 A;  2PFB A;  3N4M A;  2KJC A;  1XDU A;  1W5T A;  2JT1 A;  2VBW A;  3WOD F;  1BM9 A;  4EJO A;  2KIM A;  3NQO A;  2A07 F;  4IRG A;  2M87 A;  1IN6 A;  3GWZ A;  1I5Z A;  3KEQ A;  3WTS C;  2FRH A;  3J80 K;  1XMA A;  2Y75 A;  5LEJ A;  2DLL A;  2G7U A;  4AD9 A;  2EB7 A;  4KA4 A;  1RI7 A;  2DPD A;  2FU4 A;  1Y0U A;  1FYM A;  4M6X A;  2XAH A;  1A04 A;  4P9F A;  3RKX A;  2EV0 A;  1L0O C;  1SAX A;  1ON2 A;  5D4R A;  3BWG A;  4GO1 A;  1ZLK A;  1KU7 A;  2FXA A;  5DV5 A;  1YIO A;  2HOE A;  2DK5 A;  3RTR A;  4KN7 X;  2BBY A;  4FHT A;  2PLY A;  5LEK A;  3WU1 B;  4ZZL A;  3P7N A;  3EET A;  5JHU A;  4M9S A;  3F72 A;  5DYM A;  1BI3 A;  2ACJ A;  4ZH4 F;  5ICG A;  4MHG A;  1YFH A;  1Z6T A;  1QQI A;  2FMY A;  1ULY A;  1SMT A;  1HW1 A;  1ZH5 A;  3SZP A;  5D6F A;  3QPH A;  4IF4 A;  2DFI A;  2VBZ A;  4L0Z B;  5E1W A;  1TNS A;  1FSE A;  4G7O F;  2OBP A;  3V8K A;  1R22 A;  2O3F A;  1U5T B;  4UV9 A;  1FYL A;  1B1B A;  3MFK A;  3O2P E;  1BN5 A;  4CGZ A;  3WTZ A;  5IT3 A;  3COA C;  3V8J A;  2VC0 A;  1CF7 B;  2ZME A;  3C18 A;  3ZMV A;  3EYY A;  4L9J A;  2Z99 A;  3B02 A;  2LSO A;  2D2W A;  1K78 A;  2K4J A;  2XAJ A;  4LJZ F;  4LLL A;  3VEP A;  1J9I A;  4CYD A;  1W7P D;  5HOO A;  3KLO A;  1ODD A;  1RNL A;  1MGT A;  2XRO A;  1KYW A;  4IHT A;  1FBS A;  1Z7U A;  1YTY A;  3F3X A;  3GFI A;  4Q5S F;  2KRF A;  4R79 A;  2UWM A;  3V7S A;  4KIF A;  5L3C A;  2DTR A;  2OD5 A;  1GHC A;  2QLZ A;  3K69 A;  3Q5F A;  2LKP A;  3W6K B;  1BC8 C;  2KKO A;  1JGS A;  1I1S A;  3V7R A;  5BMZ A;  1MZB A;  2ISY A;  1ZGJ A;  2ZCW A;  2COM A;  2LDU A;  4WWC A;  6PAX A;  1O57 A;  3ABU A;  4GXO A;  2BYV E;  1OYI A;  3I64 A;  3R60 A;  2Z5U A;  2LF8 A;  2YX7 A;  4UVB A;  1OR7 A;  4GYI A;  2MBF A;  3M9A A;  2V1D A;  5J8F A;  5L3F A;  2XAS A;  4I0B A;  5HDN A;  1U6G A;  5FLX K;  4IPA A;  2OA4 A;  5D5U B;  2O61 A;  1FOK A;  1FBQ A;  2P8T A;  2VN2 A;  3LFK A;  2EFN A;  2M8E A;  5BOX A;  2RC4 A;  4JQF A;  2JSC A;  1ZG5 A;  2UZK A;  2BE5 F;  3C7J A;  2PQ8 A;  5FO5 A;  1IF1 A;  4I01 A;  3KET A;  2VXZ A;  4A0X A;  3ISP A;  5H6Q A;  2X4H A;  1T38 A;  4WCG A;  1R36 A;  5K1Y A;  3T8R A;  4B09 A;  1S8N A;  4LGW A;  4DQ2 A;  1S7A A;  4Y17 A;  3CO7 C;  1Z6R A;  2HFH A;  2XAF A;  2BEO A;  2XIG A;  2HZT A;  2XAG A;  3AAF A;  2A68 F;  3E3V A;  2GA2 A;  1UB9 A;  4N0B A;  2QQ9 A;  3PFI A;  4OOI A;  1DPR A;  2STT A;  2F2E A;  2O6G E;  2F5C A;  5JI6 A;  3F8B A;  2BGC A;  2TDX A;  4OMZ A;  1DP7 P;  4RS8 A;  1HW2 A;  2DQR A;  4G7H F;  2W24 A;  4HF0 A;  1OMI A;  2AXL A;  2EA2 A;  1TW3 A;  3K1P A;  3I0T A;  5BS6 A;  3HRS A;  2P5K A;  3E6B A;  1XD7 A;  1XN7 A;  4XSX F;  4RGX A;  2Y48 A;  3RPU A;  3KZY A;  1XSD A;  4BHC A;  3ZMD A;  2DK8 A;  2CO5 A;  1T98 A;  1WSU A;  4U0Y A;  1XCV A;  3CLO A;  4PGH A;  2YX4 A;  3QU6 A;  2H6C A;  2WV0 A;  1HKT A;  2RN7 A;  1ONV A;  3DV8 A;  1R58 A;  3T8T A;  5L3G A;  3RKY A;  4Q4Z F;  2FML A;  2DI3 A;  1RUO A;  4GYG A;  3F8N A;  4NQW A;  2FQ3 A;  1O7L A;  4KYW A;  3Q9S A;  4G94 A;  1OPC A;  5ICC A;  3QPT A;  2Q0O A;  3HSE A;  4M72 A;  1ZLJ A;  1S3J A;  4QLC U;  1J2X A;  2VT3 A;  4ZYD A;  2PBI A;  2EFP A;  2FF4 A;  4P9U A;  5CJ9 A;  1CGP A;  1IRG A;  2CW0 F;  3B73 A;  4R8H A;  1BI0 A;  2E7X A;  2MC3 A;  1YLF A;  3BJA A;  3IRQ A;  4OIQ F;  1FX7 A;  2K27 A;  2OQR A;  2DO7 A;  5CVU A;  3KEO A;  5K5R A;  3TO7 A;  2MLK A;  3K1N A;  4PDK A;  4RB1 A;  3EQL F;  1LB2 A;  4KDP A;  1GVJ A;  4PGG A;  2CYY A;  2O0Y A;  5KVR A;  1ZRE A;  2OZ6 A;  4YII A;  3C1D A;  2HR3 A;  3U2R A;  1TTY A;  3WTT C;  2OZU A;  4A0Y A;  3WU0 A;  1J75 A;  3HUG A;  1QZY A;  2JZY A;  4N9H A;  3ECH A;  2NRA C;  3VOD A;  3SZT A;  3BJ6 A;  5HDG A;  3P9K A;  1T2K A;  2VBX A;  3F6V A;  2H6B A;  3HTS B;  2GXB A;  3J80 Z;  1D8K A;  4LMY A;  3TDZ C;  1IZ1 A;  2FSW A;  4RB0 A;  2E1C A;  3U1D A;  5LHG A;  2AS5 F;  1BOA A;  4P5O A;  3GYH X;  3D0S A;  3H3U A;  2QQA A;  5L3E A;  5D8K B;  4MEX F;  5ICE A;  1FP2 A;  2JRT A;  3EYI A;  4OMY A;  1SD4 A;  2JTV A;  2VON A;  1KQ8 A;  3CTA A;  4UUV A;  2MH2 A;  4ESF A;  1YW7 A;  4B8X A;  2H09 A;  3HSF A;  1I6X A;  1U5T C;  3F8M A;  2A3S A;  3WTY C;  1U2W A;  1DDN A;  4CO8 A;  1B59 A;  4A2U A;  3I59 B;  2QM3 A;  3P9C A;  4M74 A;  2XVC A;  2R7F A;  1BC7 C;  4YIF A;  4BH9 A;  4N9I A;  5TRD A;  1HSJ A;  1X3U A;  4ASN A;  4BYY A;  2J5P A;  4LG0 A;  3BY6 A;  3KP4 A;  4MGR A;  4P96 A;  4WXD A;  4WF2 A;  3BOQ A;  5FLX Z;  1FPQ A;  5FB2 A;  3IKT A;  2MH9 A;  2V79 A;  4G6Q A;  2ISZ A;  3L9F A;  3HOT A;  3NEU A;  1FT9 A;  2PMU A;  2NNN A;  1O3S A;  4YFK F;  4BQA A;  5DDG A;  1BI1 A;  2FEZ A;  1J59 A;  3V8L A;  5LGU A;  5DCF A;  2RGV A;  3BDD A;  3M7G A;  4IRI A;  3IWF A;  2NAZ A;  4XRF A;  3TQN A;  1O3R A;  2QWW A;  3E5X A;  2P5L C;  4YFN F;  4KFC A;  2F5D A;  3VFZ A;  2P6S A;  2ZXJ A;  3CUQ A;  3E6D A;  4AWX B;  4U88 A;  1REP C;  2PN6 A;  4EV0 A;  3ZMZ A;  4OIN F;  3U9G A;  4EJT A;  1KQ9 A;  3JSP A;  1QGP A;  1HKQ A;  5JFR A;  3DF8 A;  4KT5 C;  2P7C B;  2ZBK A;  1CF7 A;  3WGI A;  2MA3 A;  3LQR A;  1ZGA A;  5F6F A;  2HEO A;  2IP2 A;  1P2F A;  3LWF A;  1KU9 A;  1K78 B;  1XGS A;  2GIV A;  3SFZ A;  3HSR A;  4G9Y A;  4EGY A;  1TNT A;  1DPU A;  1YO5 C;  3DKW A;  1YYV A;  2Z3Y A;  2R7D A;  4Q47 A;  3WTX C;  4BNC A;  4YFX F;  3QAH A;  1FZP B;  4M6Y A;  5HS7 A;  2FBH A;  2K02 A;  3T0Y A;  3I5U A;  1Z9C A;  5BQT A;  2PG4 A;  2B0L A;  2XKO A;  1IXS B;  5K5O A;  5CVR A;  5FFZ A;  2O03 A;  1XB4 A;  4RB2 C;  1FP1 D;  4U0W A;  4ZZD A;  3GXO A;  3HHG A;  5CVV A;  1F1Z A;  3VB2 A;  4LB5 A;  2E1N A;  2RKH A;  1B9N A;  2EJR A;  4ENM A;  1BIA A;  5CVI A;  1UCR A;  3WTU C;  3RKW A;  2D1V A;  3O6B B;  1S7O A;  4CDG A;  3CUQ C;  5IT9 Z;  1TW2 A;  4A6E A;  2EA4 A;  3KP6 A;  3WGH A;  5ILU A;  4ENN A;  3RYP A;  4EJW A;  2CGP A;  5DCM A;  2DT5 A;  2HQN A;  3LQQ A;  3GLX A;  4HF2 A;  1J0R A;  4U0V A;  4G6D A;  2CFX A;  2EFO A;  1MJA A;  1W4M A;  3F22 A;  2UXX A;  5AIQ A;  3ULQ B;  3F6O A;  3LST A;  4ON0 A;  1BIB A;  4H0E A;  4L9N A;  4LK0 F;  3F21 A;  3ZQ7 A;  1YG2 A;  3HOS A;  1D5V A;  2FNP A;  1KA8 A;  4NB5 A;  3ZMT A;  4UVA A;  3TOB A;  4HLY A;  1S6L A;  2A61 A;  3TOA A;  2V1U A;  4RB3 C;  4HOB A;  4IRH A;  2VE9 A;  1KQ0 A;  2VOP A;  2W84 A;  5JR3 A;  3TGN A;  3N97 A;  2HGC A;  3L00 A;  4U7D A;  4UHT A;  1MJB A;  4XLN F;  2RNJ A;  2ADU A;  2XKP A;  3MWM A;  1U8R A;  2NYX A;  3NRV A;  1XSV A;  4HX4 A;  3R0A A;  2Q8K A;  1R00 A;  4HDV A;  2R3S A;  3LA3 A;  1YS6 A;  1GXP A;  4ESB A;  5IT9 K;  4OIP F;  1U5T A;  5LLQ A;  2HTJ A;  4IJA A;  2GQQ A;  4I0A A;  4EMS A;  4HDU A;  1EH7 A;  2G9W A;  3JTG A;  1QZZ A;  3L09 A;  4K2E A;  1SD5 A;  1UHW A;  1QBJ A;  4I02 A;  1MKM A;  2DBB A;  2XGX A;  5LGN A;  3CUQ B;  4Y15 A;  2LNB A;  4HV5 A;  5HVQ C;  3GEZ A;  3HYI A;  1W5S A;  2V6C A;  3FMS A;  2CSO A;  3ML6 A;  4HYE A;  1YW9 A;  1KGS A;  1R23 A;  3HIF A;  4KIB A;  2O8X A;  4OIO F;  5HLH A;  1EH6 A;  4ZYG A;  2LF7 A;  2EV6 A;  1HST A;  4RAY A;  3ECO A;  5D5W B;  4RGU A;  3TKY A;  1ZYR F;  3PQJ A;  3IWZ A;  1R1V A;  3LA2 A;  4O3M A;  1NHA A;  4EJU A;  1LDD A;  3KZZ A;  3MZY A;  2M1B A;  1BI2 A;  3RI4 A;  2YPR A;  2JPC A;  2BV6 A;  4S04 A;  2ZKZ A;  4WXH A;  3ROU A;  2D45 A;  4MEY F;  2K7L A;  1UST A;  3I71 A;  5KK1 A;  1R5H A;  5E8G A;  2QEN A;  4HQM A;  1LQ1 A;  3I54 A;  4HF1 A;  2QQB A;  4I98 B;  3IHU A;  3QP6 A;  2ZNY A;  2V9V A;  4JK1 X;  2STW A;  5AON A;  5LHH A;  1ZRF A;  3GW2 A;  5CVJ A;  4M9X A;  3MQ0 A;  3BJO A;  3KP2 A;  1SD7 A;  3FXQ A;  4XBF A;  4AIK A;  1FYK A;  2GXG A;  1UFM A;  4O5V A;  3R0J A;  1I1G A;  1R7J A;  4O6J A;  2EK5 A;  1WRJ A;  1O7F A;  4RGR A;  1BBY A;  3CO6 C;  4GGG A;  2IPQ X;  2ETH A;  5E1Z B;  3GVA A;  3EUH A;  5H6R A;  2P7V B;  5CLS A;  3GZ6 A;  3TDU C;  4EM2 A;  1V4R A;  4BAY A;  4Y13 A;  4LB6 B;  1IN8 A;  1P92 A;  2F5E A;  4FX0 A;  3JTH A;  1JXS A;  1ZRC A;  3FXR A;  5CYV A;  2QUF A;  3L7W A;  3E6C C;  1FWZ A;  3WTW C;  3HHH A;  5L3B A;  4AIJ A;  1RUN A;  5H20 A;  1PP8 F;  2FA5 A;  2KIU A;  3OV8 A;  2ZFW A;  1O3T A;  2YR2 A;  1FSH A;  1TQI A;  3FM5 A;  4HAM A;  2IA2 A;  1TQM A;  1FC3 A;  1XCB A;  3GZ5 A;  3V7C A;  3F23 A;  2WWY A;  3DPL C;  3GUD A;  3QU3 A;  3KCC A;  4HA8 A;  5HDK A;  5JVT A;  2VOO A;  2HQR A;  3Q9V A;  3HRU A;  1OYW A;  4FT8 A;  3WG9 A;  3K0L A;  1L3L A;  3QOP A;  4A6D A;  2IRF G;  2IA0 A;  2ZNZ A;  1U78 A;  2PJP A;  5F64 A;  2W25 A;  3MEX A;  4AIH A;  4PZJ A;  5A2Q Z;  3RIR A;  1G3S A;  2VC1 A;  1ZRD A;  1I27 A;  1WWX A;  1W7P A;  2HDC A;  2EFQ A;  4MTD A;  3VOE A;  1ZAO A;  3FZV A;  5E8I A;  5L3D A;  2GA1 A;  4KIG A;  4L9T A;  1P4A A;  1IN4 A;  2A6E F;  1YQA A;  2M5W A;  2P4W A;  5E17 F;  2KJB A;  4ZYE A;  2XRN A;  4ETS A;  3RDI A;  3BP8 A;  1LEA A;  1TQP A;  4CHU A;  1IAW A;  4UVC A;  3WGG A;  1D3Y A;  4NHJ A;  2EV5 A;  5D5V B;  3WTV C;  1R1U A;  1LNW A;  1G3W A;  2MD5 A;  1Z05 A;  2JPB A;  3GFM A;  5E18 F;  2G7H A;  5ILV A;  4G7Z F;  2W85 A;  3I53 A;  1JHF A;  1FNN A;  2L4M A;  3R4K A;  4S05 A;  1KU2 A;  2PMH A;  4KMF A;  5J6X A;  1H9G A;  1G3Y A;  2XUB A;  3T1B A;  3I4P A;  1FBU A;  5D4S A;  5FFX A;  3ZP5 A;  3BPX A;  2DPU A;  3BRO A;  2YSR A;  1SD6 A;  1GXQ A;  2PI0 A;  3FWE A;  5LGT A;  3REO A;  3JW4 A;  3SXY A;  4EQQ A;  1ZHF A;  1U3E M;  4HW0 A;  1SMY F;  4HX7 A;  1B6A A;  3ABT A;  1W7P B;  5E20 A;  3T5X A;  2L54 A;  4XLP F;  5HLI A;  3J81 Z;  1YS7 A;  1H0M A;  5BPI A;  4UNO A;  3JAM Z;  4M71 A;  2IA1 A;  4LD5 A;  1IUY A;  2VE8 A;  1XDS A;  4HX8 A;  1RIO H;  1DUX C;  3IRR A;  3QP5 A;  5A2Q K;  4ZYH A;  2FBK A;  2MLG A;  1R1T A;  1USS A;  1JE8 A;  3GFJ A;  3E5U A;  3FMQ A;  2RV8 A;  3H3Z A;  3BZ6 A;  4XSZ F;  3F8F A;  2K4B A;  1S29 A;  4OIR F;  1WKM A;  5DD4 A;  2CG4 A;  2IJL A;  2CQK A;  3JAM K;  2GAU A;  3G3Z A;  4LLN A;  1IXC A;  3ZMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...