3J7AO

Cryo-em structure of the plasmodium falciparum 80s ribosome bound to the anti-protozoan drug emetine, small subunit
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
79
structure length
79
Chain Sequence
YSYIPKQNKKLIYEYLFKEGVIVVEKDAKIPRHPHLNVPNLHIMMTLKSLKSRNYVEEKYNWKHQYFILNNEGIEYLRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/inhibitor
molecule keywords 18S ribosomal RNA
publication title Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
pubmed doi rcsb
total genus 19
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF03501 S10_plectin Plectin/S10 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3j7aO00
1P4WA 3KFWX 3J80K 3DF8A 2HYFA 4PZJA 2EV6A 4LG0A 5K5OA 2QYOA 2FA5A 3HRMA 2PJPA 1FWZA 3FZVA 5HVQC 2WV0A 2ADUA 3GO5A 4EM2A 3E6MA 3I59A 3FWEA 1IW7F 3BJ6A 3HUGA 1XDSA 4F7ZA 4S04A 2PFBA 4ESJA 3R0JA 1D8KA 3GUDA 3L00A 2DK8A 1SFEA 1KU7A 4G9YA 2GA1A 4ENNA 3RIRA 2LF7A 2OAZA 4TV7A 2IJLA 2HYGD 3MWMA 1DUXC 1LEAA 3ISPA 4UV9A 2P5KA 4P9UA 4G7HF 4AIHA 4YG2F 3SZTA 3DEUA 4JK1X 4B8XA 3U9GA 2L4AA 4UV8A 1IAWA 2V79A 5ERIA 2HQRA 3HTUA 1MZBA 3O3KA 4K2EA 1TLHB 3P9IA 1QZZA 3ERED 2XGXA 5AIQA 2PI0A 3F6VA 3ABTA 2IT0A 1FBSA 4ZYEA 2BEOA 1U78A 4UVAA 1U5TA 3EETA 1I5ZA 1SAXA 4LMYA 2Y48A 3GVAA 2PN6A 3RKYA 3GWZA 2P5VA 3K2ZA 3L9FA 4UUVA 4WXDA 3F22A 1XN7A 5JI6A 4ZYHA 3TKYA 1A04A 1MDMB 4HQEA 3RYPA 4A0YA 1CGPA 2Y75A 4RAZA 1FY7A 2X4HA 4XRFA 1LDDA 3RKXA 1ZRDA 1JXSA 1YFHA 2DK5A 2ZMEB 2F5EA 1MJAA 5FFZA 5FD5A 3L09A 4RB2C 4OU0A 2W25A 2FRHA 3F72A 5HS8A 2BBYA 4A6EA 1LVAA 2M8EA 4JQFA 2PEXA 3WTYC 4KYWA 1P4XA 4M6XA 3B73A 4EJOA 4FX4A 2FNAA 4N9IA 1W7PA 3BOQA 5LHGA 3WGIA 5FGMA 2DT5A 1ZG1A 2KIFA 4M72A 3ZMUA 4WK8F 3FF5A 1F1ZA 4UVCA 5LGUA 2EFWA 3B02A 1SMTA 2DU9A 1QO0D 2RDPA 5BS6A 2F5DA 1SFXA 4HW0A 4CGZA 1U5TC 1KYZA 2EFOA 1Z6TA 1IRFA 2QUFA 1U8RA 3ECOA 1W7PD 1ONVA 2RGVA 1UB9A 4A12A 2ZMEA 2PBIA 1HW5A 4O5VA 1ZG3A 4A5MA 1IXRC 1P6RA 2V6CA 1JHFA 4LK1F 3WE3A 3M1EA 1EV7A 2VC0A 2IPQX 2LDUA 3KP2A 4JBAA 4IRGA 3TDZC 1H0MA 1ULYA 3R60A 4UHTA 1WRJA 1TQIA 3DQVC 2VE9A 5DD8A 3ULQB 3C7JA 3N97A 2DLLA 5FFXA 4ASNA 2L01A 4ON0A 2V9VA 1R5HA 2LF8A 3KLNA 4RS8A 1J9IA 2VOOA 2OBPA 3F23A 3F6OA 1PP7U 4HX4A 3DXJF 5FLXZ 1CF7B 4GXOA 1RZ4A 3I54A 1R1UA 4KIFA 3GLXA 4MGRA 4U7DA 3U1DA 2A6EF 4BYYA 2CWEA 2R7DA 2UXXA 1R36A 2ZXJA 3WU0A 3FXQA 3J7AO 2PMUA 4MQVA 4S05A 2PMHA 2HQNA 1ZG5A 3CJNA 2VN2A 2BV6A 3M7GA 1K6OA 3D5LA 4RB3C 1XMAA 1YTYA 1SMYF 2MBFA 3JAMZ 4IRIA 1T6SA 2CG4A 2ZCWA 3R6SA 1G3TA 2QLZA 4BH9A 1R00A 1FNNA 3TGNA 3HRTA 1XGOA 3CUOA 3OV8A 1O7LA 3TO6A 5E8GA 4ESBA 1X3UA 4EJVA 2GWRA 4IVNA 4BHBA 5AONA 2K02A 2WC2A 2YU3A 1F9NA 2PLYA 2EFQA 2VODA 5E20A 2XAJA 2XUBA 2H6BA 1TW2A 2FSWA 1FYMA 4G8XA 4I09A 5HOOA 2TDXA 1HW1A 1U2WA 5F1RA 2ZNZA 2VT3A 2GXGA 4RGXA 1J2XA 3CDHA 2V1DA 3CUQB 3KP3A 3KP4A 3WTZA 2EV0A 1STZA 3HOSA 1IN5A 1S6LA 2EA2A 3EYIA 2K86A 3D0SA 4HV5A 1B6AA 3EUHA 4KN4X 3GFJA 1SFUA 3ML6A 2M87A 4M9XA 4BXUA 3I53A 3BY6A 2QENA 1U6GA 2QQ9A 2UWMA 3HSRA 1IN7A 1KQ0A 4ENJA 1GXQA 2QBYA 1E2XA 1SD6A 2H27A 5E1ZB 2D1HA 2FEZA 5HDNA 3S2WA 5FB2A 1PDNC 5CYVA 5LRSA 3C3WA 1KU3A 3CO7C 3K69A 5HDKA 1ZREA 3IL2A 5AIPA 4HF0A 4ENKA 3GEZA 2AS5F 2DI3A 2P6SA 3NEUA 1FZPB 1B9NA 5H6QA 2GA2A 1ZGJA 2RC4A 5H20A 4M74A 3M8FA 4Z2YA 4O3MA 3ELKA 1HKQA 3L7WA 3LAPA 3KZZA 3T5XA 3IKVA 3NRVA 1D8JA 2FNPA 1K78A 1OMIA 5LGNA 2NYXA 3KP5A 4NB5A 2FE3A 4R8HA 3U2RA 5HLHA 1Z7UA 1O3QA 2DQRA 2XVCA 4WCGA 4G6DA 1YS6A 2IA0A 2RNJA 3V8KA 2BYVE 3MAJA 2E7XA 4KA4A 1ZGAA 3JTHA 4KFCA 4XBFA 4MTEA 4P9FA 5CVJA 3PQKA 1OPCA 1R58A 2FXAA 2JPBA 3F8BA 4AIKA 3IWFA 4H0EA 3MZHA 2ZFWA 3NQOA 4KIBA 3K1NA 3G73A 3O2PE 3I0TA 3LFKA 2VONA 1UHWA 3TDUC 5JFRA 4BHCA 2VXZA 3W6KB 5LEJA 4MQ9F 5IT9Z 3QP6A 5D4RA 4BQAA 5J8FA 1KQ8A 5J6XA 4U0VA 3HSEA 1P2FA 3BPXA 2XAHA 1J5YA 2HGCA 2F5FA 3VODA 2QZ8A 1G3SA 2VC1A 4Y15A 3DP7A 4BHPA 2GIVA 1FSHA 4KICA 6PAXA 5K1YA 4EJTA 1XCVA 4B09A 2WWYA 3GF2A 3QRFF 5HS9A 4FX0A 4E70A 2HEOA 3JSPA 3FM3A 1DPUA 3BPVA 5BMZA 1IF1A 3GZ5A 1RUNA 3J80Z 2JSCA 2IP2A 2Q0OA 3LA2A 2A68F 4IHSA 4AVPA 1BC8C 2STTA 2EV5A 1I27A 2LKPA 3RYRA 2XRNA 3KZYA 2EWNA 4Q48A 2A6HF 2XKOA 4YFKF 5ILUA 2L02A 3BZ6A 2DQLA 3K1PA 4MHGA 1LJ9A 4KMUX 2J5OA 3GW2A 5D8KB 5A2QK 3T1BA 3O6BB 4GYGA 3HOTA 5FO5A 1R22A 3F8NA 2GQQA 1MGTA 5H6RA 1ZRCA 1O7FA 4HYEA 3LA7A 4MNUA 2QVOA 1XSDA 4HLXA 4HQMA 3WG9A 5D4SA 2CW0F 2HKOA 5BPDA 2QWWA 4A2UA 5LGTA 2CO5A 2DPUA 1T0FA 5KVRA 2HDCA 2X0LA 1TQMA 4HF2A 5LEKA 1FT9A 4OIRF 2XAGA 3T0YA 1L3LA 2UXNA 1ON1A 4IRHA 3CLOA 1WWXA 4CXFA 5K5QA 1QBJA 3QU6A 4UXNA 1OR7A 4WXCA 4D0PA 4ETSA 3WGHA 5DUIA 4HDUA 3TOAA 1IN8A 5D6FA 3M9AA 2ISYA 4EJUA 3BWGA 4KMFA 1T2KA 4M9SA 1YG2A 3LA3A 1OKRA 2IA1A 3N4MA 2MC3A 3FXUA 2OA4A 4EGZA 4OMYA 1LQ1A 1T98A 1C0WA 2C6YA 3KP7A 5D5UB 3Q5FA 3Q9VA 3FXRA 4GO1A 2LNBA 1O3SA 3IKTA 1UHMA 1LB2A 1JE8A 1S3JA 5LHIA 2VBZA 3SHFA 4BNCA 2XROA 4G94A 2VOPA 4ZZDA 5CVVA 4MEYF 3PFIA 1FP2A 1LNWA 1Z91A 3E5QA 4EMSA 3CO6C 2W57A 2IW5A 3HSFA 2DPDA 5DUKA 1IXCA 2BE5F 4OOIA 3ECHA 5E1XA 2EJRA 4U7BA 3DV8A 2YR2A 4RGUA 1MJBA 3EDPA 1MDMA 2M5WA 3KP6A 3J81Z 1Y0UA 2F5CA 3F8FA 3WGGA 3RI4A 2GXBA 5CVIA 3V7CA 1QZYA 3GFIA 5CJ9A 2UZKA 4EM0B 2F2EA 1KQ9A 1BBYA 3LQRA 2GAUA 1IZ1A 4FHTA 1FBQA 3WTWC 1KGSA 3BP8A 2A61A 3V8LA 4P55A 3M8EA 3MCZA 3W6JB 5HLGA 1NHAA 1H9TA 1XCBA 1ZH5A 5HS7A 2XKPA 3MQ0A 3HRSA 4GCVA 4P96A 1HSTA 2GZWA 2E1NA 4KT5C 3K9TA 4AWXB 1J7KA 1ZRFA 1MD0A 4L9NA 3QP5A 5DV5A 1T38A 4CICA 2P7CB 4EJWA 5K5RA 5E8IA 3PQJA 1S7OA 1BI2A 4IPAA 4R1HA 4A5NA 2A3SA 4G7OF 1YW9A 4DQ2A 4L9JA 3RTRA 1G4DA 1IRGA 3QOPA 2Z9OA 1I1GA 5BPIA 3TQNA 2YPRA 1TTYA 4L0YB 1FOKA 4RB0A 5ILVA 2JPCA 2OZ6A 1GXPA 1E17A 2ZKZA 2NS0A 3IRRA 3ZP5A 2HWVA 2OD5A 4YFNF 3KLOA 2OU2A 4XLNF 3I58A 5ICCA 3FM5A 1FC3A 3HYIA 2EK5A 4QLCU 1Z05A 4HA8A 2G7HA 3TOBA 2JZYA 2M1BA 1IN6A 2FMLA 4KIGA 1HKSA 1Z9CA 2K4JA 4L5IA 3WTTC 4HV6A 1YQAA 2VBWA 3LSTA 1PP8F 1DPRA 1CF7A 2ZNYA 2RVCA 3DPTA 5DCFA 4LB6B 5HDGA 2A5YB 2WTEA 3E6BA 3WTSC 5L3BA 1L0OC 1XB4A 3AAFA 2FF4A 2HS5A 2HZTA 2G7UA 5LRRA 1MJ9A 2M30A 5DCMB 5L3DA 2HTJA 3SXYA 4PDKA 2H94A 3WE2A 3KE2A 3T8RA 3ZN0A 1FP1D 5ILSA 1RIOH 4LJZF 4A0ZA 4LK0F 1XSXA 5JVTA 3RPUA 4I2OA 3L2CA 1D5VA 3I64A 4Q5SF 1VTNC 2H6CA 4HZFA 4LLGF 1WI9A 3CTAA 1FYKA 3BJAA 1U3EM 1J0RA 1S29A 3K1MA 4KDPA 3SQNA 1Q1HA 1G6NA 2HTSA 3E6DA 1R1TA 5CVUA 4LLNA 2NRAC 3BROA 4PGHA 1I6XA 1EH7A 1ZLJA 4LG0B 5TRDA 4I0BA 2V1XA 3CUQA 1YS7A 3V4GA 1ZLKA 4M71A 1FX7A 1REPC 5KK1A 1G3WA 3I59B 2EFNA 5DDGA 2Z99A 3R0AA 1AOYA 1F4KA 4U0YA 4YFXF 1R7JA 2PQ8A 2XASA 2W24A 4LGWA 3E97A 3RDIA 4EM1A 3E5UA 4A6DA 4YIFA 1OYWA 2IRFG 2E1CA 2O61A 1R1VA 5LBQA 1YLFA 1SD5A 3FMQA 2IA2A 2FBHA 3GFMA 2PG4A 3HHGA 1XDUA 2K7LA 4RB1A 4OIOF 2M45A 1RUOA 2XAFA 3IRQA 3QPHA 5DD4A 4MTDA 4QWQA 3JW4A 2NNNA 1LDKB 1W4MA 5BOXA 2AXLA 4KUMA 2XHKA 1XGNA 2OQRA 1WQ2A 1O3TA 2YSRA 1MKMA 2Z5UA 2RQPA 3R4KA 4RGRA 4L0ZB 5EEGA 5E17F 1H9GA 1O3RA 1R23A 4EQQA 1SD4A 2IVMA 5HLIA 3EYYA 5D5XB 2A07F 1ZN2A 3WTUC 1U5TB 1HKTA 1OYIA 2P8TA 2HFHA 5J8CA 1BC7C 1QNTA 3VEPA 2KJCA 5IT3A 2MLGA 3I4PA 4GYIA 1ON2A 3P7NA 2ETHA 3GFLA 3F3XA 4LFUA 2FMYA 1P92A 3H92A 4EVIA 4CYDA 3CUQC 1ZARA 2VBXA 2MH9A 1G3YA 3OOPA 1QPMA 1B4AA 1FPQA 4WWCA 2ZO4A 1TQPA 3GX4X 3Q9SA 4NHJA 1BN5A 3ZMTA 4L9VA 1TNTA 2VT2A 1GVJA 3JTGA 4HX7A 2OZUA 4CHUA 2O6GE 3RJPA 2DTRA 4WX9A 2ESNA 2EFPA 1K79A 3F8CA 2W84A 2KIMA 1TBXA 3VFZA 3HRUA 2KRFA 5DEQA 2V1UA 1O57A 3I5UA 3QAHA 2OQGA 2VBYA 4U0WA 1F5TA 1WSUA 1W7PB 4OIQF 2P4WA 2JRTA 3RPQA 4O6JA 3SFZA 5A2QZ 2LSOA 1BIBA 3KEQA 5BQTA 3VOEA 5TJJA 3E6CC 1XSVA 1YO5C 3ZQ7A 2STWA 5LHHA 2H09A 4HDVA 3R61A 1SD7A 4HOBA 1J75A 1RI7A 2MA3A 3SZPA 2QQBA 3MZYA 4N9HA 5L3FA 3IHUA 2XV4S 1KYWA 1B9MA 1W5SA 1XMKA 3ZPLA 1BI3A 1USTA 2JT1A 2FQ3A 1YYVA 3KCCA 1W5TA 4YIIA 5JR3A 1WKMA 4U88A 4LB5A 1BI1A 2Q8KA 3ABUA 1OYYA 4UVBA 2CQKA 2D2WA 3GZ6A 3DFGA 3H3UA 3ZMDA 1KU9A 4I02A 1BM9A 2JTVA 3K0LA 4RGSA 4ESFA 3J81K 4DNCA 4RAYA 5F6FA 4OIPF 2FBKA 5L3EA 3HIFA 1TNSA 4OINF 1ZHFA 3COAC 2CYYA 2EB7A 3REOA 1HBXG 1HSJA 4I7HA 2ISZA 2YX4A 1YW8A 4WXHA 2P6TA 4GGGA 4CDGA 1PUEE 1ODDA 3V7RA 4HX8A 3E3VA 1QQIA 2COMA 4EGYA 4M73A 3FHZA 1UFMA 4CZZA 2VE8A 5JHUA 4PCQA 1BI0A 4ZH4F 1K7AA 3LWFA 4PGGA 4LD5A 2ZJ2A 2RV8A 5L3GA 5FLXK 5ED4A 2R3SA 2QQAA 2EA4A 4I0AA 2NNYA 5CLSA 4HAMA 1DP7P 4OMZA 5LLQA 1B1BA 3WTVC 1FYLA 3QPTA 3V7SA 4IHTA 1FLIA 3H3ZA 3WU1B 2O03A 2Q2EA 5DYMA 4I01A 3QU3A 3C18A 2XAQA 2L3DA 2K27A 2L54A 4AD9A 3F8MA 4XLPF 4BAYA 2FOKA 1TW3A 3JAMK 1R5GA 1IUYA 3F21A 2CSOA 3KEOA 2RKHA 2O0YA 1J59A 4XSZF 1KU2A 4HLYA 4UNOA 2P5LC 1EH6A 4AIJA 3LAJA 4I98B 3EQLF 4A0XA 3C1DA 1JHHA 3RKWA 3LQQA 1BOAA 2KJBA 2MH2A 4L18B 2Z33A 2D45A 2Z3YA 2ZBKA 3ZMVA 4KNYA 4L5JA 5E1WA 5D6EA 3HHHA 2RN7A 1HQCA 2G9WA 1BJAA 2QBYB 2CFXA 1P4AA 4KN7X 2BGCA 4XSXF 3GYHX 3FX3A 2FBIA 4G6QA 4Q4ZF 2XIGA 2HOEA 4ZYDA 2E7WA 2KIUA 2DAOA 4NQWA 5D5VB 4M9ZA 1S7AA 1RNLA 3TO9A 2ESHA 3BDDA 1HXDA 1YW7A 3P9KA 2R7FA 3HTSB 4L9TA 4IF4A 1IXSB 1LEBA 3P9CA 1XGMA 4EV0A 4WF2A 4IJAA 2K4BA 1KA8A 1T39A 4ZYGA 5ICGA 2DO7A 3IWZA 1EH8A 2MD5A 3IC7A 2CGPA 2L4MA 2Y0MA 1IN4A 1K78B 4Y17A 3MFKA 3WODF 1ZYRF 4G7ZF 1V4RA 3ZMZA 2DW4A 1AWCA 1UCRA 4R79A 3DPLC 3ROUA 1GHCA 2W85A 4CO8A 1FBUA 5D5WB 4ZZLA 2P7VB 4HF1A 1QGPA 3ZMSA 1V3FA 3FMRA 5F64A 2QM3A 5EEHA 3FMSA 3T8TA 4FT8A 5FD6A 2A69F 1I1SA 1HW2A 3V8JA 2O3FA 3GXOA 2ACJA 1B59A 2DFIA 1S8NA 5E18F 5ICFA 3VB2A 4M6YA 3E5XA 2ELHA 1Z1DA 3BJOA 4HBLA 2FU4A 3ZN1A 5DCMA 1YIOA 1USSA 4MEXF 2HR3A 1Z6RA 2DBBA 1D3YA 2D1VA 5IT9K 4P5OA 3KETA 1LDJA 1ZAOA 2YX7A 4N0BA 2MLKA 2KKOA 3I71A 1FSEA 2NAZA 4IXAA 2O8XA 5ICEA 4ENMA 2J5PA 1BIAA 4LLLA 2B0LA 5CVRA 1DDNA 3TO7A 3MEXA 4Q47A 3JSOA 1JGSA 1XD7A 1XGSA 3DKWA 3WTXC 5D8LB 3G3ZA 5L3CA 2HKXA 4Y13A
chains in the Genus database with same CATH superfamily
1P4WA 3KFWX 2R5YA 4AUXA 4A3KJ 3BTJA 2ZJQF 2M9HA 3VYTB 2KLOA 3J80K 3DF8A 2HYFA 1U9OA 4PZJA 2EV6A 4A3BJ 1E3OC 4LG0A 5K5OA 5KHDA 2EZLA 2FA5A 2QYOA 2DJNA 2LC2A 3HRMA 1T8IA 2PJPA 1FWZA 3FZVA 5HVQC 2WV0A 2ADUA 3GO5A 3WG7H 3JRIA 2GOMA 4EM2A 3E6MA 3I59A 2X6WA 2COBA 2R7WA 3FWEA 1MMGA 1IW7F 3TP3A 1BA5A 2VI6A 3BJ6A 4UUSB 3HUGA 2HDDA 1MMAA 2EH3A 2GM4A 1XDSA 2BW3B 2KHMA 3TL4X 3QYFA 4F7ZA 4PFPA 5C4XJ 4S04A 2PFBA 4ESJA 3R0JA 2JA2A 1D8KA 3CJTB 1WPKA 1OCPA 5FLMJ 3GUDA 3L00A 2JVGA 1VQPI 3KX2A 2DK8A 1SFEA 1KU7A 4G9YA 2LKSA 2XC7A 2GA1A 4ENNA 9ANTA 1WJ5A 2CQQA 3BG3A 3RIRA 3HOXJ 3S15J 3OYGA 2LF7A 2OAZA 2X9DA 1MIJA 4TV7A 3HC7A 2IJLA 2HYGD 3MWMA 3MD2A 1DUXC 1LEAA 3ISPA 4UV9A 5M5YJ 3S1MJ 2DA4A 5B5EC 3ZQLA 3OYKA 2LR8A 5KAFC 4CSWA 1VQ8I 2P5KA 3LSKA 4P9UA 4G7HF 1K4TA 4II3A 4AIHA 4YG2F 3SZTA 1F36A 1G8XA 3DEUA 4JK1X 2I5UA 3U9GA 4B8XA 2L4AA 4UV8A 1ETVA 4LOCA 1IAWA 3BQYA 2V79A 2AQEA 2X1EA 2R7UA 5ERIA 3H9QA 2M8GX 2HQRA 3HTUA 1MZBA 3O3KA 3AFHA 4K2EA 1TLHB 3P9IA 3AG1H 3IUOA 2BVMA 2MSYA 1QZZA 3ERED 2XGXA 1P7JA 3OYNA 5AIQA 2PI0A 3F6VA 2NS7A 1FJLA 2BZTA 3ABTA 2IT0A 1FBSA 4CA0A 4ZYEA 2BEOA 2L7MP 1VQ7I 4HRIA 1U78A 1WJDA 4UVAA 2Y69H 1FMVA 1U5TA 2LK2A 3EETA 1I5ZA 1SAXA 3AG4H 4MO7A 4LMYA 2WA0A 2Y48A 2HNHA 2XB5A 2L2OA 2HOAA 1T56A 3GVAA 2PN6A 3OL3A 4PJLA 3RKYA 2HVSA 1RETA 3GWZA 1SFKA 2P5VA 2DOFA 3A02A 1K83J 3K2ZA 3ABMH 3L9FA 5E3MA 4UUVA 4WXDA 3CC4I 2OF7A 4BDYA 3F22A 1XN7A 5JI6A 3I9V2 3I3LA 3DBHB 4ZYHA 3TKYA 1A04A 1MDMB 2EIJH 5TGTA 4J19A 3RQ4A 4HQEA 4XLFA 3JCUC 3RYPA 4C3IJ 4D7MA 5JLWA 4MLOA 4A0YA 5EYRA 3M4OJ 1CGPA 5K7FA 2Y75A 1WJAA 4RAZA 1FY7A 1TP4A 2X4HA 4XRFA 2R7XA 1LDDA 2XDVA 3RKXA 1ZRDA 1JXSA 1YFHA 5J1UA 4A3EJ 2DK5A 2ZMEB 1TWCJ 2L0KA 2F5EA 1MJAA 5FFZA 3CMAI 3OYHA 3CCSI 5FD5A 1ZK8A 3L09A 4RB2C 4OU0A 2KMUA 2W25A 2FRHA 3ASNH 3F72A 5GPAA 2K9SA 3TBIA 4F55A 3S3MA 5HS8A 2E60A 2BBYA 4A6EA 1LVAA 2HXIA 4PSXA 2EZKA 2M8EA 5FKMA 4JQFA 2PEXA 3WTYC 4KYWA 1P4XA 4M6XA 2ME0A 3B73A 4EJOA 1JUSA 5F1JA 3ZQIA 2FNAA 4FX4A 3ZR8X 2XF7A 4N9IA 2OC6A 1X1PA 4BJTA 1W7PA 3LSJA 4YEJA 4RAFA 3BOQA 3PIOF 1RR8C 5LHGA 3WGIA 2QA4I 5FGMA 2DT5A 2LY1A 3VSLA 1ZG1A 1TWGJ 2QSFX 2KIFA 3S17J 4M72A 3ZMUA 2WB1N 2DA3A 4WK8F 2IBDA 3FF5A 4IHXA 1F1ZA 4UVCA 5LGUA 2EFWA 2BHZA 3B02A 1SMTA 1MMSA 2CMPA 1A35A 2LMDA 3BC8A 3NARA 2H8RA 3TW7A 2DU9A 1QO0D 2RDPA 1FOYA 4IHVA 2B63J 2CS3A 5BS6A 2F5DA 1Y56A 3G71I 1CQTA 1RR7A 1DU0A 1SFXA 3LSMA 4HW0A 1IV6A 3CESA 1BW6A 2CFOA 4B43A 4CGZA 2F6CA 3PM1A 1U5TC 1KYZA 2EFOA 5EF6A 1EA3A 1Z6TA 1IRFA 2QUFA 2VJIA 3QWLA 1IRZA 1U8RA 3I56I 3ECOA 1W7PD 3LSPA 1ONVA 3BCAA 4RMNA 2RGVA 1UB9A 1Z3XA 4A12A 3FHNA 2WAQA 2XB0X 1R49A 2ZMEA 2PBIA 1HW5A 2IS1A 4O5VA 1ZG3A 1QU3A 1MBGA 4A5MA 4UB6C 2L7ZA 1IXRC 1E3PA 1RKTA 1P6RA 2V6CA 1ZGWA 1JHFA 4LK1F 3WE3A 3M1EA 1EV7A 2DDAA 2LG4A 3KIOA 2VC0A 4FETA 3RQIA 2IPQX 2E1OA 2LDUA 3KP2A 4JX4A 2WV1A 2CU7A 1WJEA 4JBAA 4IRGA 1E3HA 3TDZC 1MNEA 1TZLA 1PUFB 1H0MA 3G6EI 1ULYA 3R60A 4UHTA 1WRJA 1TQIA 3DQVC 2VE9A 1YOVB 5DD8A 2E1MB 3ULQB 1W0UA 3BTLA 4BY1J 3S1NJ 3C7JA 2XF6A 1BW5A 2TRTA 3N97A 3ZRGA 5J40A 4BL0B 2DLLA 5FFXA 5FKKA 2GBYA 1UHSA 4ASNA 3A01B 2L01A 4ON0A 2V9VA 3JRAA 2W4SA 5KNLA 3HG9A 1YE9A 1R5HA 1HOMA 3WU2C 2LF8A 3KLNA 4RS8A 1J9IA 2HOTA 2M4GA 2VOOA 2OBPA 2X6OA 3F23A 3ZQHA 3F6OA 1PP7U 4HX4A 3DXJF 5FLXZ 1CF7B 4GXOA 1OCRH 4Y13A 1RZ4A 4DIQA 3I54A 2A05A 1R1UA 4FE4A 2R93J 2LYCA 4G12A 3BR1A 4KIFA 1TL8A 3GLXA 4MGRA 4U7DA 1SEUA 4RLFA 4Y4RA 3U1DA 4XLAA 3G2BA 5JHFA 2A6EF 4HNUA 4XOPA 4BYYA 2CWEA 4ZTJA 2R7DA 2UXXA 1R36A 2ZXJA 3WU0A 4QIWN 2Z2SB 2IAIA 3CCRI 4A93J 1DGWY 3FXQA 3HKZN 3J7AO 2PMUA 3I4NJ 4E7SA 1YJWI 1A36A 2UUZA 4MQVA 4S05A 2PMHA 2HQNA 3NWTA 1ZG5A 3CJNA 2VN2A 1SVMA 2BV6A 1XX5A 3M7GA 1K6OA 2HPMA 2WB1A 3D5LA 3L2QA 3FXKA 1Z21A 3ZOBA 1X1DA 2V26A 1SC7A 2WBMA 4RB3C 1XMAA 1YTYA 1SMYF 2MBFA 3JAMZ 4IRIA 4UY8I 3K6GA 1T6SA 2CG4A 2Q1ZB 2ZCWA 2F5VA 3R6SA 3CCYA 3H5RA 1G59A 5IOYA 3FXLA 1G3TA 2QLZA 4BH9A 1D0YA 1R00A 3OYCA 3CDLA 5CPRB 3RKQA 1N77A 2OUMA 3BQZA 1FNNA 3TGNA 5KCMA 2LVSA 3HRTA 1XGOA 3CUOA 3OV8A 3KZIC 1O7LA 2ID6A 4M3EA 2R5ZA 3TO6A 4AVZA 3L2UA 5E8GA 4ESBA 1X3UA 4EJVA 2GWRA 4IVNA 4D9JA 1IJWC 4BHBA 1Y8RB 3OR1C 4BACA 1P7IA 4BEHA 5AONA 2K02A 2WC2A 3H3VK 2YU3A 1F9NA 2PLYA 2EFQA 5F27A 1DGRM 2VODA 1S7EA 5E20A 4Y3OA 4F92B 1POGA 4M3DA 2XAJA 2XUBA 1Z67A 2H6BA 1TW2A 2FSWA 1W5CC 1FYMA 2V7FA 4G8XA 3W6VA 4I09A 4BE1A 5HOOA 2TDXA 3DKXA 4Z6YA 3A2KA 2LH9A 2IGNA 3PL8A 1HW1A 2AXTC 1IRXA 1U2WA 1U9NA 3KYDB 4XMYA 5F1RA 2QSGX 2ZNZA 4XIDA 5FKOA 2VT3A 3V42A 2GXGA 3CMMA 3AG3H 4CYCA 3GTQJ 4A3GJ 4RGXA 1J2XA 3CDHA 2V1DA 3CUQB 3KP3A 3KP4A 3WTZA 3JRFA 3HM5A 4E7HA 2EV0A 1STZA 3HB9A 3HOSA 1IN5A 3GTPJ 1WJBA 1S6LA 3HEFA 4IQJA 4MIMA 3OYAA 2EA2A 2LLKA 3EYIA 2K86A 3D0SA 3F0CA 1B6AA 4HV5A 3EUHA 3S16J 2VB6A 4KN4X 4NNJA 3GFJA 1SFUA 3ML6A 2M87A 4M9XA 4BXUA 3I53A 2V1NA 3BY6A 2DFHA 2HVQA 4F93B 3Q0VA 1FEXA 2QENA 3IV5A 5EZHA 1U6GA 3S14J 4XKVA 3ZQGA 3OMYA 2QQ9A 2GIZA 4I6ZA 2UV1A 4LIUA 4ZC3A 2UWMA 1LVKA 3LMMA 3HSRA 3O8HA 1IN7A 1KQ0A 4X1EA 5C4JJ 4ENJA 1GXQA 2QBYA 4C30A 1I3AA 1E2XA 1SD6A 2H27A 1QA6A 2O8KA 5E1ZB 2D1HA 3HKZA 2FEZA 3BG9A 2L9RA 5HDNA 3S2WA 5FB2A 1PDNC 3H1CA 4XKBA 3TEDA 5CYVA 1A31A 5LRSA 3C3WA 1KU3A 1MMNA 3DU6A 5B3SH 1RC9A 2LY9A 4FQGA 4E6KG 3HGGA 1V5GA 3CO7C 3K69A 5HDKA 1ZREA 4ZDOA 1T33A 3IL2A 3A0BC 5AIPA 4HF0A 4ENKA 3GEZA 3PIPF 1YIJI 5B66C 2AS5F 2DI3A 2P6SA 1HC8A 3NEUA 1FZPB 5C44J 1B9NA 1P9QC 5H6QA 1D1AA 2K9LA 1X19A 2GA2A 1ZGJA 4B1RA 2RC4A 5H20A 4M74A 3M8FA 2WAEA 4Z2YA 3DWLE 1BL0A 4O3MA 1X2NA 3ELKA 4DZPA 1X58A 2VQCA 1HKQA 2HI3A 1MSFC 2BY0A 1FIPA 3L7WA 4CCMA 3LAPA 4JX6A 1HF0A 3KZZA 3T5XA 2EIMH 4DW6A 3HPGA 3IKVA 1ZELA 5E3LA 4P1WA 5EGOB 3RZDJ 4IL6C 2F4IA 3NRVA 1D8JA 4YELA 2FNPA 3U1KA 1K78A 1OMIA 5LGNA 2LP0A 2DA5A 2NYXA 3KP5A 1D1BA 4NB5A 2FE3A 4R8HA 4ABZA 3U2RA 4BXFA 1APLC 1LFUP 3QOEA 5HLHA 4XN0A 2QCOA 3GLLA 4HNVA 1Z7UA 5IY5H 2DQRA 2XVCA 3G1OA 4G6DA 4WCGA 1O3QA 1YS6A 2IA0A 2RNJA 4HSTA 3V8KA 2BYVE 3BG5A 3MAJA 5DTDA 1JJ6C 2E7XA 4KA4A 1ZGAA 2QKLB 3JTHA 3L2VA 1JUMA 4KFCA 4XBFA 5FROA 4MTEA 4P9FA 3LOCA 5CVJA 3PQKA 1TT0A 1OPCA 1R58A 2FXAA 2JPBA 3F8BA 3DBLB 4AIKA 1YJNI 2PJRA 1YX3A 3IWFA 5GP9A 1FTTA 2H1KA 4H0EA 2XPUA 1SVOA 3MZHA 2ZFWA 3NQOA 4KIBA 4DBRA 2W1OA 1IUFA 3K1NA 2ECCA 3G73A 4I76A 3BG6A 3O2PE 3AL0C 3TP0A 4A3JJ 4RAGA 4QPOA 3I0TA 3LFKA 2VONA 2XGDA 3VYSB 1UHWA 3TDUC 1YITI 5JFRA 3NWSA 4BY7J 3LFUA 2VXZA 3W6KB 4BHCA 4MQ9F 5LEJA 3QP6A 5D4RA 5IT9Z 4BQAA 5J8FA 4IEJA 5J1RA 1KQ8A 3ZXSA 2KFDA 2OPTA 1FOWA 2E36A 4U0VA 3HSEA 4ZDLA 5J6XA 5M5XJ 1VQ4I 2R92J 1P2FA 3BPXA 2JSPA 2XAHA 2JK3A 1J5YA 3MMYB 2HGCA 4XLCA 2F5FA 3VODA 1ETWA 2QZ8A 1G3SA 4DYCA 3M07A 2VC1A 3QYEA 4XQFA 4B3AA 4IO9F 4Y15A 3DP7A 3W2WA 1EF4A 4BHPA 2E2JJ 2K9NA 3BR5A 2GIVA 2GOXB 5CQGA 1FSHA 4KICA 3CCMI 6PAXA 1SAUA 5K1YA 1H88C 4EJTA 1XCVA 1X2MA 4B09A 3H9JA 3GF2A 2WWYA 5HS9A 3QRFF 4ZJZA 1YRNA 4AM3A 4BE2A 4FX0A 4E70A 2HEOA 3MKYB 4NDLA 3JSPA 3D5SC 2N8GA 5JVGF 3FM3A 1DPUA 3BPVA 2KRHA 3OYDA 5BMZA 1IF1A 3IP4B 1R71A 4E7ZA 2ZJRF 3L2RA 3PO3J 3GZ5A 1JKRC 1RUNA 3J80Z 2JSCA 2IP2A 2Q0OA 1W1WE 3CMYA 3LA2A 2A68F 4IHSA 4AVPA 1BC8C 2STTA 1MSEC 4E7IA 2EV5A 2OCEA 1I27A 2LKPA 2ZXHA 3K4BA 5E3NA 2ZC2A 3RYRA 2XRNA 5B1BH 4IHYA 3P5JA 2DJIA 3KZYA 4FE7A 2ELKA 3DCFA 2EWNA 4Q48A 1GVDA 1IO2A 1V55H 3PSIA 2A6HF 2NVXJ 2ZSHB 3H0GJ 2JRMA 2XKOA 4YFKF 5H2FC 5ILUA 2L02A 2VIXA 5J3LA 1ETKA 3BZ6A 3CCEI 2WAFA 2DQLA 2ZXWH 3K1PA 2V9PA 4MHGA 3PNTA 2HDWA 1LJ9A 4KMUX 2J5OA 3LL7A 4V2GA 1TT5B 1X1CA 3GW2A 5D8KB 5A2QK 3JR9A 1X3ZB 5E3OA 2CUFA 3T1BA 3O6BB 4GYGA 3HOTA 3KYLA 4A3IJ 2IXSA 1R22A 3F8NA 5FO5A 4XK4A 5IYDJ 5LFAA 4QPQA 5F0HA 2GQQA 1MGTA 2Y31A 5H6RA 2DA7A 1ZRCA 1O7FA 2IGMA 4HYEA 2Y2ZA 4M3FA 3LA7A 3Q3SA 4MNUA 2QVOA 1JUPA 1XSDA 3BT9A 4HLXA 4HQMA 3WG9A 3OYMA 5D4SA 2CW0F 2HKOA 5BPDA 3A4CA 2QWWA 4A2UA 2DMQA 2JA5J 2HU9A 5LGTA 2CO5A 2MFZA 2DPUA 3C2HA 1ETQA 1T0FA 4UUSA 1X1BA 5KVRA 4M6VA 1JI8A 5CKTA 2BW3A 2M4KA 2HDCA 2X0LA 4JYKA 3FXMA 1TQMA 1BOBA 4HF2A 5LEKA 2E2HJ 4BS9A 1FT9A 4OIRF 2K9MA 2CUZA 2WAQN 1S5LC 2W82A 4KJZA 4AIDA 2XAGA 3FISA 3T0YA 3HOWJ 1L3LA 2UXNA 2CW7A 1ON1A 2IGOA 2VL8A 4J01A 4IRHA 3CLOA 1WWXA 4CXFA 5K5QA 2E5NA 1WHUA 5K7HA 1YHQI 2KDZA 1QBJA 1IV8A 1JKPC 2HZDA 3QU6A 1X1AA 1UMQA 4UXNA 4DZJA 1OR7A 2ELJA 3C2GA 4WXCA 4D0PA 3FKIJ 3WGHA 4ETSA 5DUIA 2K40A 5FKLA 4HDUA 3TOAA 1IN8A 5D6FA 3M9AA 2NVQJ 3HGYA 2ISYA 4AU7A 3QODA 3OIOA 3SYTA 4EJUA 2DA6A 3BWGA 4KMFA 1T2KA 4M9SA 2M3AA 5CQEA 1YG2A 4XRSA 3VPRA 4DBQA 3LA3A 1OKRA 1V5FA 2IA1A 5EZGA 3N4MA 2MC3A 3FXUA 2OA4A 4XM3A 4ZYAA 2DCEA 3JRBA 4EGZA 1LQ1A 4GDFA 4OMYA 3OIPA 1T98A 2DOEA 1C0WA 2VUMJ 2C6YA 1WH5A 4HG2A 2I8DA 3KP7A 2VJJA 2IS4A 1OISA 3K10A 5D5UB 2CV1A 4E7JA 3Q5FA 5FRNA 2R7TA 1D1CA 1JT6A 3Q9VA 1V54H 3F9KA 3FXRA 3DEWA 3B6AA 1ZQ3P 2CJJA 4GO1A 2KZVA 2LNBA 3KEYA 4ANJA 4NC6A 3VYUB 1O3SA 4CCKA 3IKTA 3K4JA 1UHMA 1LB2A 2DDBA 1JE8A 1S3JA 5LHIA 2ZB9A 2VBZA 3SHFA 4BKXA 4BNCA 2XROA 3LNQA 4G94A 1JKQC 3ESWB 2VOPA 4A3MJ 2XSDC 4ZZDA 5CVVA 4MEYF 2LBFB 2BY1A 2Q2EB 2KRCA 1K4SA 3PFIA 3OWTA 3BR2A 1FP2A 1LNWA 1Z91A 3D5RC 4PJMA 3E5QA 3C2BA 2OTLI 5EG0B 4EMSA 2MG4A 3CO6C 3FBIB 4NUBA 3UR3C 2W57A 2IW5A 3HSFA 2DYRH 2DPDA 2Z16A 5DUKA 1IXCA 1Z7LA 4YRVA 1X3WB 2BE5F 1Z77A 5IOZA 4OOIA 3DTEA 3ECHA 3K4CA 4LIVA 1HCRA 2L7KA 5E1XA 2JWTA 2EJRA 4U7BA 1MBKA 3DV8A 2YR2A 1W0TA 4S0HB 4RGUA 1MJBA 3EDPA 1RKWA 1MDMA 1B8IB 2M5WA 2JA6J 3KP6A 2KPMA 3H35A 3J81Z 1Y0UA 2F5CA 3OYIA 3F8FA 3WGGA 4F3QA 3RI4A 1R6RA 2FUG2 2GXBA 5CVIA 3GZNB 3V7CA 1T0FC 2KT0A 1QZYA 1ZTRA 3TW6A 3GFIA 2KZGA 1R4NB 5CJ9A 2UZKA 2VKVA 4EM0B 2F2EA 3W3CA 1KQ9A 2XGEA 5K7ZA 4CH7A 2VJ4A 1BBYA 2ZXIA 3K70D 3LQRA 2GAUA 3M1CA 1IZ1A 4FHTA 1FBQA 3H36A 1JJ8C 3WTWC 1KGSA 3BP8A 3VYRB 2A61A 3V8LA 3DLAA 3MVPA 4P55A 3DLLF 1LE8B 3M8EA 2X51A 4C2MJ 2E35A 3MCZA 1WI3A 3W6JB 4AYBN 4IOAF 5HLGA 1NHAA 1K61A 1OR7C 1H9TA 1WJFA 3CCJI 1XCBA 1ZH5A 2VQHA 1TWHJ 2DT6A 5HS7A 3L2WA 1AA7A 5KAIC 1IC8A 5J4VA 2XKPA 1NK3P 3MQ0A 3HRSA 4GCVA 4P96A 3O8GA 2CV0A 1HSTA 2GZWA 4BQQA 2E1NA 4KT5C 2QEXI 2DYSH 4IHWA 3K9TA 4AWXB 3X2QH 1J7KA 2R7VA 2WY7Q 2LY2A 2XPVA 1ZRFA 3DKYA 1MD0A 2W48A 3CP8A 3QP5A 4L9NA 5DV5A 1T38A 3BTCA 4NQWB 4CICA 2P7CB 5GPCA 3G1MA 3CCLI 1JGGA 4U87A 4EJWA 5K5RA 5E8IA 3PQJA 1S7OA 4FCYA 2X6YA 3HZJA 4KISA 1BI2A 4IPAA 3FXOA 4R1HA 1VQ5I 4A5NA 4XL9A 1S9HA 1X4OA 2A3SA 4EATA 4G7OF 1YW9A 4DQ2A 4L9JA 2ECBA 3RTRA 1G4DA 1IRGA 3QOPA 2Z9OA 1I1GA 2QKMB 1MMDA 5BPIA 3FK6A 3TQNA 2ME6A 2FJ1A 2YPRA 1TTYA 2DN0A 4L0YB 1FOKA 4A3CJ 4RB0A 5ILVA 2JPCA 2Y0SN 2OZ6A 1GXPA 1E17A 2ZKZA 2NS0A 2DXIA 4XNFA 2AQFA 2QGUA 3IRRA 3ZP5A 4MFEA 2HWVA 4C3HJ 2OD5A 4YFNF 2DMPA 2W00A 3KLOA 2CQ7A 2TCTA 2OU2A 4XLNF 3CJRB 5B1AH 3I58A 4DGWB 1YI2I 2H8WA 4FASD 3OYBA 5ICCA 2I10A 2BXYA 2VASA 3FM5A 3Q0WA 1FC3A 4M3GA 4F52A 3HYIA 3OSFA 2L9NA 2R4GA 2EK5A 3FDYA 4QLCU 1Z05A 4HA8A 2VLAA 2G7HA 1PUFA 3IAM2 3TOBA 2JZYA 2M1BA 2M34A 4X6AJ 1BR4A 3ZQFA 2HPIA 4X0GA 1IN6A 2FMLA 4HEA2 4KIGA 4XOTA 1HKSA 1Z9CA 2WADA 3GMEA 3A01A 3DTKA 2K4JA 5IP7J 2ZMEC 4L5IA 3WTTC 5GAGJ 1FIAA 4IZZA 4HV6A 1YQAA 4I99C 2VBWA 2R7ZJ 3SFIA 3LSTA 1LUJB 5FJ8J 1PP8F 1DPRA 3RCOA 2YU9J 4AYBA 1CF7A 2ZNYA 2RVCA 4NC7A 3S3NA 4RLQA 3DPTA 3L1PA 1WH7A 5DCFA 2FQ4A 4LB6B 3HL2A 5HDGA 2LD5A 1VI0A 2A5YB 2WTEA 3E6BA 3WTSC 3OYFA 5L3BA 3BZKA 5GAEJ 1L0OC 3FIWA 1XB4A 2JN6A 3AAFA 2FF4A 4XONA 3LSHA 2HS5A 2K9QA 1NG6A 2HZTA 3CZ6A 3CP2A 4LG3A 4XRSG 4ZTFA 5E79C 2G7UA 1WVRA 1ZKGA 4XKWA 5LRRA 1MJ9A 2M30A 1Y8QB 5DCMB 2GXAA 1ITYA 5L3DA 1GV5A 2HTJA 2V9KA 3SXYA 1ERDA 3OY9A 4PDKA 2H94A 3WE2A 1KONA 4CZCA 3KE2A 4E4HA 5EJCA 2JJ7A 3T8RA 1Y6IA 4G6TB 4XKCA 3ZN0A 3G4SI 1FP1D 5ILSA 2X85A 2OTJI 1RIOH 1BR2A 3FXJA 1FMWA 4LJZF 4A0ZA 4LK0F 1XSXA 5JVTA 1Q1VA 3RPUA 1T95A 2R7RA 2LREA 3HXLA 2P81A 1TC3C 2MW8A 4I2OA 2E5ZA 1I6HJ 1OCTC 1MW7A 2Y0SA 1UG0A 2A6TA 5M5WJ 1WCMJ 1KZHA 3L2CA 1AKHB 3I4MJ 1D5VA 3I64A 2YS9A 4Q5SF 3OYLA 1UELB 1VTNC 2H6CA 4HZFA 4LLGF 3CDIA 1MBEA 1WI9A 2EZIA 1AHDP 3CTAA 4V2FA 1FYKA 4BDZA 5F04A 2KP6A 2NVYJ 3BJAA 1U3EM 2Z1DA 4BE0A 4CCLA 4JP0A 3OSGA 3S2DJ 1ETOA 2R5YB 3LSIA 1J0RA 2CUJA 1S29A 3K1MA 2BVLA 4KDPA 3HJEA 3SQNA 1Q1HA 1G6NA 2HTSA 3E6DA 3Q0UA 1R1TA 2O5RA 2LOOA 5CVUA 2NRAC 4LLNA 3BROA 1GDTA 4PGHA 1VF9A 3SZGA 1I6XA 1EH7A 1ZLJA 2NS8A 3RPUD 4RM2A 4LG0B 5TRDA 2O9LA 3HOZJ 4I0BA 4CUGA 2AHQA 2V1XA 3CUQA 1YS7A 3DU5A 3V4GA 3HDDA 2E1MC 4FISA 1ZLKA 4M71A 1FX7A 1REPC 1NG7A 5KK1A 3A03A 1G3WA 4C2UA 3I59B 5EEAA 2EFNA 5DDGA 2Z99A 3R0AA 3ZGKA 5C3EJ 3OS0A 1AOYA 1JKOC 1F4KA 4A3LJ 2DA1A 4U0YA 1MBJA 4YFXF 3ONQA 3HUGB 3BCBA 1R7JA 2PQ8A 3IAS2 4B4CA 2M2EA 1BJZA 3GCMA 2XASA 2W24A 2VQGA 4LGWA 3E97A 3S93A 3RDIA 1SANA 4B48A 4EM1A 3E5UA 4A6DA 2XRLA 4YIFA 2K5CA 1OYWA 2IRFG 2E1CA 2O61A 2LRDA 1R1VA 5LBQA 4QSHA 1Y1WJ 1YLFA 1SD5A 3FMQA 2IA2A 4B47A 1LKXA 2FBHA 2HVRA 4D5FA 2HQ5A 2IS2A 3EUHC 3GFMA 2PG4A 3HHGA 1XDUA 2M0CA 1NK2P 2K7LA 3BR6A 4RB1A 4OIOF 2M45A 4XRMA 3CMEI 1RUOA 2OJED 3S2HJ 2AO9A 2XAFA 3QPHA 3ZQQA 5DD4A 2LTPA 3J7YJ 3IRQA 1JT0A 4MTDA 2XF5A 4QWQA 3MZ8A 3JW4A 3OYJA 4C3JJ 2NNNA 3H5AA 1LDKB 1W4MA 5BOXA 2AXLA 3MKWB 4KUMA 2XHKA 2JA8J 1QHGA 1XGNA 2JMWA 2IS6A 3E0JB 3ABLH 2OQRA 1WQ2A 4A69C 1O3TA 2YSRA 5IP6A 3SDGA 1MKMA 3K4KA 1VQLI 4BXXJ 5M3MJ 2Z5UA 2RQPA 2CQNA 3BG7A 3KPHA 3R4KA 4RGRA 1N75A 3CCQI 4L0ZB 5EEGA 4JOMA 3PO2J 5E17F 1H9GA 1O3RA 1R23A 4BUPA 1SD4A 2NOGA 4EQQA 1HLVA 1K6YA 4BBRJ 2IVMA 2HXOA 5HLIA 2E2IJ 2MYSA 5HODA 5EGOA 4E7KA 2F4MB 3EYYA 3B6CA 4CCJA 1UZCA 1UAAA 5D5XB 4DOZA 3K4MA 2A07F 1ZN2A 3WTUC 1XC5A 1U5TB 3OOUA 1IDZA 1ZR2A 4PJNA 1HKTA 4H4KC 4IKFA 1OYIA 2P8TA 2HFHA 5J8CA 1OFCX 3RZOJ 1BC7C 3QYBA 1QNTA 3QQAA 3CC7I 3VEPA 2KJCA 4D7NA 5IT3A 3ZQCA 2NXNB 2EQRA 2MLGA 3I4PA 4BJ6C 1QRYA 1ON2A 3P7NA 4GYIA 2ETHA 3GFLA 3OL4A 3H5NA 3F3XA 4LFUA 2FMYA 1P92A 3H92A 4QTRA 1VQOI 2E71A 4CYDA 4EVIA 2F4OB 3CUQC 1ZARA 2VBXA 2MH9A 3IH2A 2M7BA 3BR3A 1G3YA 1PVEA 3A1YA 3OOPA 1QPMA 2VPLA 1B4AA 3OS2A 2ID3A 1FPQA 4J00A 4WWCA 2F48A 2VJ5A 1AU7A 2ZO4A 2R7SA 1OQYA 2RQQA 1ENHA 1TQPA 1IGNA 3DTIA 1N78A 1T08B 2NVTJ 3HOUJ 4XN3A 3K7AJ 1ACIA 4UUTA 3GX4X 3CD6I 3Q9SA 2KISA 1VQMI 2L5QA 3MKLA 2R0QC 4NHJA 2FX0A 1BN5A 3PNYA 3ZMTA 1RESA 4L9VA 2EIKH 1TNTA 2VT2A 4BQNA 1GVJA 3JTGA 4HX7A 4RDUA 2OZUA 2KDOA 2PMZN 4CHUA 3K4NA 1XTAA 2O6GE 3RJPA 4MFDA 3S8PA 2DTRA 4WX9A 2VPRA 2BOLA 3S1RJ 3QPSA 2ESNA 2EFPA 1K79A 3F8CA 2W84A 2KIMA 5FRMA 5GTIC 1TBXA 5IPAA 3IH4A 3VFZA 3HRUA 2NOJB 5DS9A 3J7ZI 3JRCA 2KRFA 3ASOH 3SJMA 5DEQA 5GADJ 2V1UA 1VZ0A 2XPWA 1O57A 2V4JC 3I5UA 3QAHA 2EINH 3ABKH 2OQGA 3U21A 2VBYA 5FLVA 4U0WA 1F5TA 4OAYA 1WSUA 1HDPA 1W7PB 2EZHA 4OIQF 2P4WA 2JRTA 4O6JA 3RPQA 3SFZA 5A2QZ 2DMTA 2LSOA 3GTGJ 3OR2C 1BIBA 3KEQA 5BQTA 1JTXA 3VOEA 3JRGA 3DEEA 5TJJA 3E6CC 2X6XA 1XSVA 4UB8C 1YO5C 3ZQ7A 1OJLA 2STWA 1EJ9A 5LHHA 2H09A 1XMXA 2ICWG 3VDXA 4HDVA 4L5EA 3R61A 3OIQA 2DMNA 1MNMC 2HYJA 1SD7A 4JX5A 1MH3A 1X4PA 4HOBA 1J75A 3SEQA 1RI7A 2KL4A 4W97A 1NTCA 2MA3A 3SZPA 2QQBA 3MZYA 1GUUA 4N9HA 5L3FA 4F91B 3IHUA 2XV4S 4IX7A 1KYWA 2KIQA 4A3DJ 1B9MA 1W5SA 1XMKA 3ZPLA 1BI3A 1OLTA 4W1UA 2B7EA 1USTA 2DFEA 1Y39A 2JT1A 2FQ3A 1YYVA 3KCCA 1JTYA 1W5TA 4YIIA 1UJ8A 5JR3A 5EDNA 5DM7F 1WKMA 4U88A 4LB5A 3EUAA 1BI1A 4EEFG 2Q8KA 3ABUA 1OYYA 4UVBA 4BJ5C 2CQKA 2D2WA 1PYVA 3GZ6A 5J4YA 3PFYA 2IGKA 3DFGA 3H3UA 3ZMDA 4IQ4A 1KU9A 4I02A 1BM9A 2JTVA 1MBFA 1PJRA 2K3PA 3CJQB 3K0LA 3KYCB 4GFBA 3D1NI 4RGSA 4ESFA 3J81K 4DNCA 4PJJA 4RAYA 3SEZA 5F6FA 1I3QJ 2JVHA 1YX5A 3BLYA 1DP3A 3FK7A 4OIPF 2CUEA 2FBKA 2PMZA 3HIFA 3QPLA 5L3EA 1TNSA 4OINF 1ZHFA 3COAC 2CYYA 2EB7A 3REOA 1R9TJ 1HBXG 4Y7NJ 2V6EA 1HSJA 4N4OB 4I7HA 4OAZA 2XAUA 2YX4A 4ZDPA 2ISZA 4PUSA 1YW8A 1LFPA 4WXHA 1XS9A 1IG7A 4DYRA 3N05A 4CCNA 2P6TA 1NH3A 1GLNA 2JA7J 4GGGA 4CDGA 2MGQA 3ERMA 1PUEE 4DJAA 1ODDA 3FBNB 3V7RA 4HX8A 3JRDA 3E3VA 1H89C 1QQIA 2CH0A 2COMA 4EGYA 4M73A 2KQRA 4RA2A 3FHZA 1TWFJ 1UFMA 3LSGA 2BY2A 1A6QA 4CZZA 2M0MA 2VE8A 3NAUA 1VQKI 4BU2A 5JHUA 5J47A 2DODA 1R4MB 4KT6A 2D5VA 4YIRX 4PCQA 1OCZH 1BI0A 4ZH4F 4KITB 1K7AA 3LWFA 1R5ID 4PGGA 1SFOJ 4LD5A 2ZJ2A 2RV8A 3H9GA 3UNGC 5L3GA 5GTHC 2EBIA 5F08A 5FLXK 1RRJA 1VNDA 5ED4A 1FOXA 2L7FP 2R3SA 2QQAA 2X48A 4II2A 2BXZA 2EA4A 4I0AA 4OWRB 2NNYA 2PX9A 2VKHA 1Z0XA 5CLSA 4XLEA 4HAMA 1QPIA 1DP7P 1QHHD 4OMZA 5LLQA 1B1BA 3WTVC 1FYLA 3QPTA 3M8JA 3V7SA 4IHTA 1FLIA 2R7QA 3H3ZA 3WU1B 2O7OA 1DU6A 2GLOA 2LBFA 2O03A 2Q2EA 2R5ZB 5DYMA 4I01A 4BBSJ 2VKDA 2Y9ZA 2DA2A 2JUGA 3QU3A 3C18A 3S32A 2XAQA 2L3DA 2K27A 2L54A 3BTIA 4AD9A 5EG0A 3F8MA 2DFFA 3RSNA 4BEHB 4XLPF 4BAYA 3VWBA 1I39A 2FOKA 1GV2A 1TW3A 3HPHA 1B72B 1F43A 1TWAJ 5IP9J 4PSWA 3GTLJ 2CRGA 3DPUA 3JAMK 3UKGA 2IEKA 1R5GA 1ORKA 2ZSIB 3PUBA 1IUYA 3F21A 1HDDC 3PJRA 2CSOA 3GTJJ 3KEOA 1U0JA 2RKHA 1XPXA 1U8BA 2O0YA 1WFXA 3JREA 1J59A 4XSZF 1KU2A 2VQLA 1B8IA 4HLYA 4UNOA 4XORA 2ZFUA 2P5LC 1EH6A 2DTZA 4AIJA 3LAJA 2MABA 4I98B 3EQLF 3S1QJ 2EPFA 4RM3A 4A0XA 3CCUI 3HBLA 4CYCB 3K70C 3C1DA 1JHHA 2E19A 3RKWA 1O4XA 3JRHA 3LQQA 1BOAA 1LFBA 2KJBA 4N4NB 3WHBA 2MH2A 4XR6A 2Z33A 4L18B 3W2VA 2D45A 3AL0B 1LE8A 2Z3YA 2OCCH 5IYBJ 2ZBKA 3ZMVA 4KNYA 1MH4A 4L5JA 1M1EB 2XGCA 1DQUA 5E1WA 5D6EA 3HHHA 2JQ7A 2E34A 2RN7A 3AG2H 1VFCA 1HQCA 4HPQA 2G9WA 3ZCOA 1BJAA 5IYCJ 4NC8A 3M3YJ 4AC0A 3E1SA 4ITVA 2QBYB 2H1LA 1VQNI 2CFXA 2CW8A 1P4AA 4KN7X 1UG2A 2FD5A 3HOVJ 1VQ6I 2BGCA 2RNGA 2Y9YA 4XSXF 3GYHX 3FX3A 2FBIA 5JLXA 3HOYJ 3E7LA 4G6QA 2ZJPF 4Q4ZF 2XIGA 4HNTA 4XLHA 2HOEA 4ZYDA 4Y33A 3WHCA 2E7WA 1ETYA 2KIUA 2DAOA 4NQWA 5D5VB 4M9ZA 2HOSA 1S7AA 1RNLA 2K3FA 3TO9A 4PJ0C 1WGXA 5TISC 2MD0A 5BNGA 4PFOA 2X1DA 1B72A 3W2AA 2ESHA 3BDDA 1HXDA 2JUCA 1YW7A 3P9KA 2R7FA 3HTSB 4L9TA 1N25A 1IXSB 1J09A 1E0EA 1LEBA 3P9CA 3BR0A 1YJ9I 1XGMA 2NVUB 2Y30A 4EV0A 4WF2A 2DMUA 1WZ2A 2RREA 4Y52J 4IJAA 2K4BA 2R7OA 3GTMJ 1KA8A 2G0EA 3AKZA 1T39A 4ZYGA 3VSKA 1IDYA 4LITA 5ICGA 2DO7A 1G2HA 3IWZA 2K85A 1EH8A 2MD5A 2HQAA 3G1LA 3IC7A 3CQZJ 2CGPA 5HNHA 1QVUA 2P0WA 2MC4A 5HNFA 2L4MA 3DBRB 3CF5F 2B9SA 1OCOH 4B44A 1Z3YA 3TMOA 4DYQA 2Y0MA 1IN4A 2WY8Q 3GBGA 2X1CA 1K78B 4Y17A 2DOAA 3MFKA 3GTOJ 3WODF 1ZYRF 1ZR4A 4G7ZF 3J7AY 4B3XA 4BQOA 1V4RA 3ZMZA 2DW4A 2EILH 1AWCA 3K4LA 1W36D 1UCRA 4R79A 3DPLC 3ROUA 4M3BA 1GHCA 3A0HC 1A6IA 2VKEA 2W85A 3LSRA 2M7AA 4CO8A 1FBUA 5D5WB 2DT7B 4ZZLA 3S3OA 2P7VB 5J1YA 5HLTA 4HF1A 4PK4A 1MNDA 1QGPA 4BGDA 3ZMSA 1ETXA 2PJRB 1OCCH 1I50J 5GAHJ 4CCOA 1V3FA 4V19K 3GTKJ 1HA8A 1QZEA 3BZCA 2L9VA 2YUSA 2CQXA 3FMRA 1MBHA 5F64A 1QVTA 2QM3A 2QQ8A 1XG1A 5EEHA 3FMSA 3T8TA 4FT8A 5FD6A 5FKNA 3FKJA 3EUKL 4HSRA 1Y0NA 2CV2A 2A69F 1I1SA 4XICA 1D0XA 4RBOA 1HW2A 3V8JA 1VQ9I 3IH3A 3K2AA 2O3FA 3CF2A 3GXOA 3OYEA 2ACJA 1A5JA 2W7NA 1B59A 3SDBA 2XSJC 2DFIA 1S8NA 5E18F 4FTHA 5ICFA 1BR1A 3VB2A 4M6YA 3E5XA 2QSHX 2ELHA 1Z1DA 3BJOA 4HBLA 2A5WA 2FU4A 3ZN1A 4C2TA 5LD2C 4IOCF 4A3FJ 2OV7A 5DCMA 1YIOA 4E7LA 2L9SA 4NBQA 1S72I 3PNVA 1USSA 4MEXF 1YRNB 1EKEA 2HR3A 1Z6RA 1H8AC 2DBBA 1D3YA 2D1VA 1LPQA 5IT9K 4P5OA 3KETA 1RPWA 5F0FA 1LDJA 1SVLA 1ZAOA 2YX7A 1W36C 4N0BA 2MLKA 1FTZA 2KKOA 3I71A 1FSEA 1D5YA 2BHYA 2NAZA 4IXAA 4D5CA 2O8XA 5ICEA 4ENMA 4C9YA 3CCVI 2J5PA 3PSFA 4GRIA 1Y1VJ 3I55I 3H0DA 1BIAA 2RAEA 1D0ZA 2BY3A 4LLLA 3OS1A 2B0LA 1AKHA 3CC2I 3MN2A 5CVRA 2LFBA 1GT0C 1DDNA 3TO7A 3MEXA 4Q47A 3CLQA 1JGSA 3JSOA 2VXDA 1XD7A 5M3FJ 5F0CA 1XGSA 1V5EA 3DKWA 3WTXC 5D8LB 2QF7A 5DM6F 4D1QA 3MKZA 2FOWA 3EPZA 3PUFA 3G3ZA 2LKXA 5L3CA 1WJCA 2HKXA 4IF4A
chains in the Genus database with same CATH topology
1P4WA 3KFWX 3J80K 3DF8A 2HYFA 4PZJA 2EV6A 4LG0A 5K5OA 2QYOA 2FA5A 3HRMA 2PJPA 1FWZA 3FZVA 5HVQC 2WV0A 2ADUA 3GO5A 4EM2A 3E6MA 3I59A 3FWEA 1IW7F 3BJ6A 3HUGA 1XDSA 4F7ZA 4S04A 2PFBA 4ESJA 3R0JA 1D8KA 3GUDA 3L00A 2DK8A 1SFEA 1KU7A 4G9YA 2GA1A 4ENNA 3RIRA 2LF7A 2OAZA 4TV7A 2IJLA 2HYGD 3MWMA 1DUXC 1LEAA 3ISPA 4UV9A 2P5KA 4P9UA 4G7HF 4AIHA 4YG2F 3SZTA 3DEUA 4JK1X 4B8XA 3U9GA 2L4AA 4UV8A 1IAWA 2V79A 5ERIA 2HQRA 3HTUA 1MZBA 3O3KA 4K2EA 1TLHB 3P9IA 1QZZA 3ERED 2XGXA 5AIQA 2PI0A 3F6VA 3ABTA 2IT0A 1FBSA 4ZYEA 2BEOA 1U78A 4UVAA 1U5TA 3EETA 1I5ZA 1SAXA 4LMYA 2Y48A 3GVAA 2PN6A 3RKYA 3GWZA 2P5VA 3K2ZA 3L9FA 4UUVA 4WXDA 3F22A 1XN7A 5JI6A 4ZYHA 3TKYA 1A04A 1MDMB 4HQEA 3RYPA 4A0YA 1CGPA 2Y75A 4RAZA 1FY7A 2X4HA 4XRFA 1LDDA 3RKXA 1ZRDA 1JXSA 1YFHA 2DK5A 2ZMEB 2F5EA 1MJAA 5FFZA 5FD5A 3L09A 4RB2C 4OU0A 2W25A 2FRHA 3F72A 5HS8A 2BBYA 4A6EA 1LVAA 2M8EA 4JQFA 2PEXA 3WTYC 4KYWA 1P4XA 4M6XA 3B73A 4EJOA 4FX4A 2FNAA 4N9IA 1W7PA 3BOQA 5LHGA 3WGIA 5FGMA 2DT5A 1ZG1A 2KIFA 4M72A 3ZMUA 4WK8F 3FF5A 1F1ZA 4UVCA 5LGUA 2EFWA 3B02A 1SMTA 2DU9A 1QO0D 2RDPA 5BS6A 2F5DA 1SFXA 4HW0A 4CGZA 1U5TC 1KYZA 2EFOA 1Z6TA 1IRFA 2QUFA 1U8RA 3ECOA 1W7PD 1ONVA 2RGVA 1UB9A 4A12A 2ZMEA 2PBIA 1HW5A 4O5VA 1ZG3A 4A5MA 1IXRC 1P6RA 2V6CA 1JHFA 4LK1F 3WE3A 3M1EA 1EV7A 2VC0A 2IPQX 2LDUA 3KP2A 4JBAA 4IRGA 3TDZC 1H0MA 1ULYA 3R60A 4UHTA 1WRJA 1TQIA 3DQVC 2VE9A 5DD8A 3ULQB 3C7JA 3N97A 2DLLA 5FFXA 4ASNA 2L01A 4ON0A 2V9VA 1R5HA 2LF8A 3KLNA 4RS8A 1J9IA 2VOOA 2OBPA 3F23A 3F6OA 1PP7U 4HX4A 3DXJF 5FLXZ 1CF7B 4GXOA 1RZ4A 3I54A 1R1UA 4KIFA 3GLXA 4MGRA 4U7DA 3U1DA 2A6EF 4BYYA 2CWEA 2R7DA 2UXXA 1R36A 2ZXJA 3WU0A 3FXQA 3J7AO 2PMUA 4MQVA 4S05A 2PMHA 2HQNA 1ZG5A 3CJNA 2VN2A 2BV6A 3M7GA 1K6OA 3D5LA 4RB3C 1XMAA 1YTYA 1SMYF 2MBFA 3JAMZ 4IRIA 1T6SA 2CG4A 2ZCWA 3R6SA 1G3TA 2QLZA 4BH9A 1R00A 1FNNA 3TGNA 3HRTA 1XGOA 3CUOA 3OV8A 1O7LA 3TO6A 5E8GA 4ESBA 1X3UA 4EJVA 2GWRA 4IVNA 4BHBA 5AONA 2K02A 2WC2A 2YU3A 1F9NA 2PLYA 2EFQA 2VODA 5E20A 2XAJA 2XUBA 2H6BA 1TW2A 2FSWA 1FYMA 4G8XA 4I09A 5HOOA 2TDXA 1HW1A 1U2WA 5F1RA 2ZNZA 2VT3A 2GXGA 4RGXA 1J2XA 3CDHA 2V1DA 3CUQB 3KP3A 3KP4A 3WTZA 2EV0A 1STZA 3HOSA 1IN5A 1S6LA 2EA2A 3EYIA 2K86A 3D0SA 4HV5A 1B6AA 3EUHA 4KN4X 3GFJA 1SFUA 3ML6A 2M87A 4M9XA 4BXUA 3I53A 3BY6A 2QENA 1U6GA 2QQ9A 2UWMA 3HSRA 1IN7A 1KQ0A 4ENJA 1GXQA 2QBYA 1E2XA 1SD6A 2H27A 5E1ZB 2D1HA 2FEZA 5HDNA 3S2WA 5FB2A 1PDNC 5CYVA 5LRSA 3C3WA 1KU3A 3CO7C 3K69A 5HDKA 1ZREA 3IL2A 5AIPA 4HF0A 4ENKA 3GEZA 2AS5F 2DI3A 2P6SA 3NEUA 1FZPB 1B9NA 5H6QA 2GA2A 1ZGJA 2RC4A 5H20A 4M74A 3M8FA 4Z2YA 4O3MA 3ELKA 1HKQA 3L7WA 3LAPA 3KZZA 3T5XA 3IKVA 3NRVA 1D8JA 2FNPA 1K78A 1OMIA 5LGNA 2NYXA 3KP5A 4NB5A 2FE3A 4R8HA 3U2RA 5HLHA 1Z7UA 1O3QA 2DQRA 2XVCA 4WCGA 4G6DA 1YS6A 2IA0A 2RNJA 3V8KA 2BYVE 3MAJA 2E7XA 4KA4A 1ZGAA 3JTHA 4KFCA 4XBFA 4MTEA 4P9FA 5CVJA 3PQKA 1OPCA 1R58A 2FXAA 2JPBA 3F8BA 4AIKA 3IWFA 4H0EA 3MZHA 2ZFWA 3NQOA 4KIBA 3K1NA 3G73A 3O2PE 3I0TA 3LFKA 2VONA 1UHWA 3TDUC 5JFRA 4BHCA 2VXZA 3W6KB 5LEJA 4MQ9F 5IT9Z 3QP6A 5D4RA 4BQAA 5J8FA 1KQ8A 5J6XA 4U0VA 3HSEA 1P2FA 3BPXA 2XAHA 1J5YA 2HGCA 2F5FA 3VODA 2QZ8A 1G3SA 2VC1A 4Y15A 3DP7A 4BHPA 2GIVA 1FSHA 4KICA 6PAXA 5K1YA 4EJTA 1XCVA 4B09A 2WWYA 3GF2A 3QRFF 5HS9A 4FX0A 4E70A 2HEOA 3JSPA 3FM3A 1DPUA 3BPVA 5BMZA 1IF1A 3GZ5A 1RUNA 3J80Z 2JSCA 2IP2A 2Q0OA 3LA2A 2A68F 4IHSA 4AVPA 1BC8C 2STTA 2EV5A 1I27A 2LKPA 3RYRA 2XRNA 3KZYA 2EWNA 4Q48A 2A6HF 2XKOA 4YFKF 5ILUA 2L02A 3BZ6A 2DQLA 3K1PA 4MHGA 1LJ9A 4KMUX 2J5OA 3GW2A 5D8KB 5A2QK 3T1BA 3O6BB 4GYGA 3HOTA 5FO5A 1R22A 3F8NA 2GQQA 1MGTA 5H6RA 1ZRCA 1O7FA 4HYEA 3LA7A 4MNUA 2QVOA 1XSDA 4HLXA 4HQMA 3WG9A 5D4SA 2CW0F 2HKOA 5BPDA 2QWWA 4A2UA 5LGTA 2CO5A 2DPUA 1T0FA 5KVRA 2HDCA 2X0LA 1TQMA 4HF2A 5LEKA 1FT9A 4OIRF 2XAGA 3T0YA 1L3LA 2UXNA 1ON1A 4IRHA 3CLOA 1WWXA 4CXFA 5K5QA 1QBJA 3QU6A 4UXNA 1OR7A 4WXCA 4D0PA 4ETSA 3WGHA 5DUIA 4HDUA 3TOAA 1IN8A 5D6FA 3M9AA 2ISYA 4EJUA 3BWGA 4KMFA 1T2KA 4M9SA 1YG2A 3LA3A 1OKRA 2IA1A 3N4MA 2MC3A 3FXUA 2OA4A 4EGZA 4OMYA 1LQ1A 1T98A 1C0WA 2C6YA 3KP7A 5D5UB 3Q5FA 3Q9VA 3FXRA 4GO1A 2LNBA 1O3SA 3IKTA 1UHMA 1LB2A 1JE8A 1S3JA 5LHIA 2VBZA 3SHFA 4BNCA 2XROA 4G94A 2VOPA 4ZZDA 5CVVA 4MEYF 3PFIA 1FP2A 1LNWA 1Z91A 3E5QA 4EMSA 3CO6C 2W57A 2IW5A 3HSFA 2DPDA 5DUKA 1IXCA 2BE5F 4OOIA 3ECHA 5E1XA 2EJRA 4U7BA 3DV8A 2YR2A 4RGUA 1MJBA 3EDPA 1MDMA 2M5WA 3KP6A 3J81Z 1Y0UA 2F5CA 3F8FA 3WGGA 3RI4A 2GXBA 5CVIA 3V7CA 1QZYA 3GFIA 5CJ9A 2UZKA 4EM0B 2F2EA 1KQ9A 1BBYA 3LQRA 2GAUA 1IZ1A 4FHTA 1FBQA 3WTWC 1KGSA 3BP8A 2A61A 3V8LA 4P55A 3M8EA 3MCZA 3W6JB 5HLGA 1NHAA 1H9TA 1XCBA 1ZH5A 5HS7A 2XKPA 3MQ0A 3HRSA 4GCVA 4P96A 1HSTA 2GZWA 2E1NA 4KT5C 3K9TA 4AWXB 1J7KA 1ZRFA 1MD0A 4L9NA 3QP5A 5DV5A 1T38A 4CICA 2P7CB 4EJWA 5K5RA 5E8IA 3PQJA 1S7OA 1BI2A 4IPAA 4R1HA 4A5NA 2A3SA 4G7OF 1YW9A 4DQ2A 4L9JA 3RTRA 1G4DA 1IRGA 3QOPA 2Z9OA 1I1GA 5BPIA 3TQNA 2YPRA 1TTYA 4L0YB 1FOKA 4RB0A 5ILVA 2JPCA 2OZ6A 1GXPA 1E17A 2ZKZA 2NS0A 3IRRA 3ZP5A 2HWVA 2OD5A 4YFNF 3KLOA 2OU2A 4XLNF 3I58A 5ICCA 3FM5A 1FC3A 3HYIA 2EK5A 4QLCU 1Z05A 4HA8A 2G7HA 3TOBA 2JZYA 2M1BA 1IN6A 2FMLA 4KIGA 1HKSA 1Z9CA 2K4JA 4L5IA 3WTTC 4HV6A 1YQAA 2VBWA 3LSTA 1PP8F 1DPRA 1CF7A 2ZNYA 2RVCA 3DPTA 5DCFA 4LB6B 5HDGA 2A5YB 2WTEA 3E6BA 3WTSC 5L3BA 1L0OC 1XB4A 3AAFA 2FF4A 2HS5A 2HZTA 2G7UA 5LRRA 1MJ9A 2M30A 5DCMB 5L3DA 2HTJA 3SXYA 4PDKA 2H94A 3WE2A 3KE2A 3T8RA 3ZN0A 1FP1D 5ILSA 1RIOH 4LJZF 4A0ZA 4LK0F 1XSXA 5JVTA 3RPUA 4I2OA 3L2CA 1D5VA 3I64A 4Q5SF 1VTNC 2H6CA 4HZFA 4LLGF 1WI9A 3CTAA 1FYKA 3BJAA 1U3EM 1J0RA 1S29A 3K1MA 4KDPA 3SQNA 1Q1HA 1G6NA 2HTSA 3E6DA 1R1TA 5CVUA 4LLNA 2NRAC 3BROA 4PGHA 1I6XA 1EH7A 1ZLJA 4LG0B 5TRDA 4I0BA 2V1XA 3CUQA 1YS7A 3V4GA 1ZLKA 4M71A 1FX7A 1REPC 5KK1A 1G3WA 3I59B 2EFNA 5DDGA 2Z99A 3R0AA 1AOYA 1F4KA 4U0YA 4YFXF 1R7JA 2PQ8A 2XASA 2W24A 4LGWA 3E97A 3RDIA 4EM1A 3E5UA 4A6DA 4YIFA 1OYWA 2IRFG 2E1CA 2O61A 1R1VA 5LBQA 1YLFA 1SD5A 3FMQA 2IA2A 2FBHA 3GFMA 2PG4A 3HHGA 1XDUA 2K7LA 4RB1A 4OIOF 2M45A 1RUOA 2XAFA 3IRQA 3QPHA 5DD4A 4MTDA 4QWQA 3JW4A 2NNNA 1LDKB 1W4MA 5BOXA 2AXLA 4KUMA 2XHKA 1XGNA 2OQRA 1WQ2A 1O3TA 2YSRA 1MKMA 2Z5UA 2RQPA 3R4KA 4RGRA 4L0ZB 5EEGA 5E17F 1H9GA 1O3RA 1R23A 4EQQA 1SD4A 2IVMA 5HLIA 3EYYA 5D5XB 2A07F 1ZN2A 3WTUC 1U5TB 1HKTA 1OYIA 2P8TA 2HFHA 5J8CA 1BC7C 1QNTA 3VEPA 2KJCA 5IT3A 2MLGA 3I4PA 4GYIA 1ON2A 3P7NA 2ETHA 3GFLA 3F3XA 4LFUA 2FMYA 1P92A 3H92A 4EVIA 4CYDA 3CUQC 1ZARA 2VBXA 2MH9A 1G3YA 3OOPA 1QPMA 1B4AA 1FPQA 4WWCA 2ZO4A 1TQPA 3GX4X 3Q9SA 4NHJA 1BN5A 3ZMTA 4L9VA 1TNTA 2VT2A 1GVJA 3JTGA 4HX7A 2OZUA 4CHUA 2O6GE 3RJPA 2DTRA 4WX9A 2ESNA 2EFPA 1K79A 3F8CA 2W84A 2KIMA 1TBXA 3VFZA 3HRUA 2KRFA 5DEQA 2V1UA 1O57A 3I5UA 3QAHA 2OQGA 2VBYA 4U0WA 1F5TA 1WSUA 1W7PB 4OIQF 2P4WA 2JRTA 3RPQA 4O6JA 3SFZA 5A2QZ 2LSOA 1BIBA 3KEQA 5BQTA 3VOEA 5TJJA 3E6CC 1XSVA 1YO5C 3ZQ7A 2STWA 5LHHA 2H09A 4HDVA 3R61A 1SD7A 4HOBA 1J75A 1RI7A 2MA3A 3SZPA 2QQBA 3MZYA 4N9HA 5L3FA 3IHUA 2XV4S 1KYWA 1B9MA 1W5SA 1XMKA 3ZPLA 1BI3A 1USTA 2JT1A 2FQ3A 1YYVA 3KCCA 1W5TA 4YIIA 5JR3A 1WKMA 4U88A 4LB5A 1BI1A 2Q8KA 3ABUA 1OYYA 4UVBA 2CQKA 2D2WA 3GZ6A 3DFGA 3H3UA 3ZMDA 1KU9A 4I02A 1BM9A 2JTVA 3K0LA 4RGSA 4ESFA 3J81K 4DNCA 4RAYA 5F6FA 4OIPF 2FBKA 5L3EA 3HIFA 1TNSA 4OINF 1ZHFA 3COAC 2CYYA 2EB7A 3REOA 1HBXG 1HSJA 4I7HA 2ISZA 2YX4A 1YW8A 4WXHA 2P6TA 4GGGA 4CDGA 1PUEE 1ODDA 3V7RA 4HX8A 3E3VA 1QQIA 2COMA 4EGYA 4M73A 3FHZA 1UFMA 4CZZA 2VE8A 5JHUA 4PCQA 1BI0A 4ZH4F 1K7AA 3LWFA 4PGGA 4LD5A 2ZJ2A 2RV8A 5L3GA 5FLXK 5ED4A 2R3SA 2QQAA 2EA4A 4I0AA 2NNYA 5CLSA 4HAMA 1DP7P 4OMZA 5LLQA 1B1BA 3WTVC 1FYLA 3QPTA 3V7SA 4IHTA 1FLIA 3H3ZA 3WU1B 2O03A 2Q2EA 5DYMA 4I01A 3QU3A 3C18A 2XAQA 2L3DA 2K27A 2L54A 4AD9A 3F8MA 4XLPF 4BAYA 2FOKA 1TW3A 3JAMK 1R5GA 1IUYA 3F21A 2CSOA 3KEOA 2RKHA 2O0YA 1J59A 4XSZF 1KU2A 4HLYA 4UNOA 2P5LC 1EH6A 4AIJA 3LAJA 4I98B 3EQLF 4A0XA 3C1DA 1JHHA 3RKWA 3LQQA 1BOAA 2KJBA 2MH2A 4L18B 2Z33A 2D45A 2Z3YA 2ZBKA 3ZMVA 4KNYA 4L5JA 5E1WA 5D6EA 3HHHA 2RN7A 1HQCA 2G9WA 1BJAA 2QBYB 2CFXA 1P4AA 4KN7X 2BGCA 4XSXF 3GYHX 3FX3A 2FBIA 4G6QA 4Q4ZF 2XIGA 2HOEA 4ZYDA 2E7WA 2KIUA 2DAOA 4NQWA 5D5VB 4M9ZA 1S7AA 1RNLA 3TO9A 2ESHA 3BDDA 1HXDA 1YW7A 3P9KA 2R7FA 3HTSB 4L9TA 4IF4A 1IXSB 1LEBA 3P9CA 1XGMA 4EV0A 4WF2A 4IJAA 2K4BA 1KA8A 1T39A 4ZYGA 5ICGA 2DO7A 3IWZA 1EH8A 2MD5A 3IC7A 2CGPA 2L4MA 2Y0MA 1IN4A 1K78B 4Y17A 3MFKA 3WODF 1ZYRF 4G7ZF 1V4RA 3ZMZA 2DW4A 1AWCA 1UCRA 4R79A 3DPLC 3ROUA 1GHCA 2W85A 4CO8A 1FBUA 5D5WB 4ZZLA 2P7VB 4HF1A 1QGPA 3ZMSA 1V3FA 3FMRA 5F64A 2QM3A 5EEHA 3FMSA 3T8TA 4FT8A 5FD6A 2A69F 1I1SA 1HW2A 3V8JA 2O3FA 3GXOA 2ACJA 1B59A 2DFIA 1S8NA 5E18F 5ICFA 3VB2A 4M6YA 3E5XA 2ELHA 1Z1DA 3BJOA 4HBLA 2FU4A 3ZN1A 5DCMA 1YIOA 1USSA 4MEXF 2HR3A 1Z6RA 2DBBA 1D3YA 2D1VA 5IT9K 4P5OA 3KETA 1LDJA 1ZAOA 2YX7A 4N0BA 2MLKA 2KKOA 3I71A 1FSEA 2NAZA 4IXAA 2O8XA 5ICEA 4ENMA 2J5PA 1BIAA 4LLLA 2B0LA 5CVRA 1DDNA 3TO7A 3MEXA 4Q47A 3JSOA 1JGSA 1XD7A 1XGSA 3DKWA 3WTXC 5D8LB 3G3ZA 5L3CA 2HKXA 4Y13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P4W A;  3KFW X;  3J80 K;  3DF8 A;  2HYF A;  4PZJ A;  2EV6 A;  4LG0 A;  5K5O A;  2QYO A;  2FA5 A;  3HRM A;  2PJP A;  1FWZ A;  3FZV A;  5HVQ C;  2WV0 A;  2ADU A;  3GO5 A;  4EM2 A;  3E6M A;  3I59 A;  3FWE A;  1IW7 F;  3BJ6 A;  3HUG A;  1XDS A;  4F7Z A;  4S04 A;  2PFB A;  4ESJ A;  3R0J A;  1D8K A;  3GUD A;  3L00 A;  2DK8 A;  1SFE A;  1KU7 A;  4G9Y A;  2GA1 A;  4ENN A;  3RIR A;  2LF7 A;  2OAZ A;  4TV7 A;  2IJL A;  2HYG D;  3MWM A;  1DUX C;  1LEA A;  3ISP A;  4UV9 A;  2P5K A;  4P9U A;  4G7H F;  4AIH A;  4YG2 F;  3SZT A;  3DEU A;  4JK1 X;  4B8X A;  3U9G A;  2L4A A;  4UV8 A;  1IAW A;  2V79 A;  5ERI A;  2HQR A;  3HTU A;  1MZB A;  3O3K A;  4K2E A;  1TLH B;  3P9I A;  1QZZ A;  3ERE D;  2XGX A;  5AIQ A;  2PI0 A;  3F6V A;  3ABT A;  2IT0 A;  1FBS A;  4ZYE A;  2BEO A;  1U78 A;  4UVA A;  1U5T A;  3EET A;  1I5Z A;  1SAX A;  4LMY A;  2Y48 A;  3GVA A;  2PN6 A;  3RKY A;  3GWZ A;  2P5V A;  3K2Z A;  3L9F A;  4UUV A;  4WXD A;  3F22 A;  1XN7 A;  5JI6 A;  4ZYH A;  3TKY A;  1A04 A;  1MDM B;  4HQE A;  3RYP A;  4A0Y A;  1CGP A;  2Y75 A;  4RAZ A;  1FY7 A;  2X4H A;  4XRF A;  1LDD A;  3RKX A;  1ZRD A;  1JXS A;  1YFH A;  2DK5 A;  2ZME B;  2F5E A;  1MJA A;  5FFZ A;  5FD5 A;  3L09 A;  4RB2 C;  4OU0 A;  2W25 A;  2FRH A;  3F72 A;  5HS8 A;  2BBY A;  4A6E A;  1LVA A;  2M8E A;  4JQF A;  2PEX A;  3WTY C;  4KYW A;  1P4X A;  4M6X A;  3B73 A;  4EJO A;  4FX4 A;  2FNA A;  4N9I A;  1W7P A;  3BOQ A;  5LHG A;  3WGI A;  5FGM A;  2DT5 A;  1ZG1 A;  2KIF A;  4M72 A;  3ZMU A;  4WK8 F;  3FF5 A;  1F1Z A;  4UVC A;  5LGU A;  2EFW A;  3B02 A;  1SMT A;  2DU9 A;  1QO0 D;  2RDP A;  5BS6 A;  2F5D A;  1SFX A;  4HW0 A;  4CGZ A;  1U5T C;  1KYZ A;  2EFO A;  1Z6T A;  1IRF A;  2QUF A;  1U8R A;  3ECO A;  1W7P D;  1ONV A;  2RGV A;  1UB9 A;  4A12 A;  2ZME A;  2PBI A;  1HW5 A;  4O5V A;  1ZG3 A;  4A5M A;  1IXR C;  1P6R A;  2V6C A;  1JHF A;  4LK1 F;  3WE3 A;  3M1E A;  1EV7 A;  2VC0 A;  2IPQ X;  2LDU A;  3KP2 A;  4JBA A;  4IRG A;  3TDZ C;  1H0M A;  1ULY A;  3R60 A;  4UHT A;  1WRJ A;  1TQI A;  3DQV C;  2VE9 A;  5DD8 A;  3ULQ B;  3C7J A;  3N97 A;  2DLL A;  5FFX A;  4ASN A;  2L01 A;  4ON0 A;  2V9V A;  1R5H A;  2LF8 A;  3KLN A;  4RS8 A;  1J9I A;  2VOO A;  2OBP A;  3F23 A;  3F6O A;  1PP7 U;  4HX4 A;  3DXJ F;  5FLX Z;  1CF7 B;  4GXO A;  1RZ4 A;  3I54 A;  1R1U A;  4KIF A;  3GLX A;  4MGR A;  4U7D A;  3U1D A;  2A6E F;  4BYY A;  2CWE A;  2R7D A;  2UXX A;  1R36 A;  2ZXJ A;  3WU0 A;  3FXQ A;  3J7A O;  2PMU A;  4MQV A;  4S05 A;  2PMH A;  2HQN A;  1ZG5 A;  3CJN A;  2VN2 A;  2BV6 A;  3M7G A;  1K6O A;  3D5L A;  4RB3 C;  1XMA A;  1YTY A;  1SMY F;  2MBF A;  3JAM Z;  4IRI A;  1T6S A;  2CG4 A;  2ZCW A;  3R6S A;  1G3T A;  2QLZ A;  4BH9 A;  1R00 A;  1FNN A;  3TGN A;  3HRT A;  1XGO A;  3CUO A;  3OV8 A;  1O7L A;  3TO6 A;  5E8G A;  4ESB A;  1X3U A;  4EJV A;  2GWR A;  4IVN A;  4BHB A;  5AON A;  2K02 A;  2WC2 A;  2YU3 A;  1F9N A;  2PLY A;  2EFQ A;  2VOD A;  5E20 A;  2XAJ A;  2XUB A;  2H6B A;  1TW2 A;  2FSW A;  1FYM A;  4G8X A;  4I09 A;  5HOO A;  2TDX A;  1HW1 A;  1U2W A;  5F1R A;  2ZNZ A;  2VT3 A;  2GXG A;  4RGX A;  1J2X A;  3CDH A;  2V1D A;  3CUQ B;  3KP3 A;  3KP4 A;  3WTZ A;  2EV0 A;  1STZ A;  3HOS A;  1IN5 A;  1S6L A;  2EA2 A;  3EYI A;  2K86 A;  3D0S A;  4HV5 A;  1B6A A;  3EUH A;  4KN4 X;  3GFJ A;  1SFU A;  3ML6 A;  2M87 A;  4M9X A;  4BXU A;  3I53 A;  3BY6 A;  2QEN A;  1U6G A;  2QQ9 A;  2UWM A;  3HSR A;  1IN7 A;  1KQ0 A;  4ENJ A;  1GXQ A;  2QBY A;  1E2X A;  1SD6 A;  2H27 A;  5E1Z B;  2D1H A;  2FEZ A;  5HDN A;  3S2W A;  5FB2 A;  1PDN C;  5CYV A;  5LRS A;  3C3W A;  1KU3 A;  3CO7 C;  3K69 A;  5HDK A;  1ZRE A;  3IL2 A;  5AIP A;  4HF0 A;  4ENK A;  3GEZ A;  2AS5 F;  2DI3 A;  2P6S A;  3NEU A;  1FZP B;  1B9N A;  5H6Q A;  2GA2 A;  1ZGJ A;  2RC4 A;  5H20 A;  4M74 A;  3M8F A;  4Z2Y A;  4O3M A;  3ELK A;  1HKQ A;  3L7W A;  3LAP A;  3KZZ A;  3T5X A;  3IKV A;  3NRV A;  1D8J A;  2FNP A;  1K78 A;  1OMI A;  5LGN A;  2NYX A;  3KP5 A;  4NB5 A;  2FE3 A;  4R8H A;  3U2R A;  5HLH A;  1Z7U A;  1O3Q A;  2DQR A;  2XVC A;  4WCG A;  4G6D A;  1YS6 A;  2IA0 A;  2RNJ A;  3V8K A;  2BYV E;  3MAJ A;  2E7X A;  4KA4 A;  1ZGA A;  3JTH A;  4KFC A;  4XBF A;  4MTE A;  4P9F A;  5CVJ A;  3PQK A;  1OPC A;  1R58 A;  2FXA A;  2JPB A;  3F8B A;  4AIK A;  3IWF A;  4H0E A;  3MZH A;  2ZFW A;  3NQO A;  4KIB A;  3K1N A;  3G73 A;  3O2P E;  3I0T A;  3LFK A;  2VON A;  1UHW A;  3TDU C;  5JFR A;  4BHC A;  2VXZ A;  3W6K B;  5LEJ A;  4MQ9 F;  5IT9 Z;  3QP6 A;  5D4R A;  4BQA A;  5J8F A;  1KQ8 A;  5J6X A;  4U0V A;  3HSE A;  1P2F A;  3BPX A;  2XAH A;  1J5Y A;  2HGC A;  2F5F A;  3VOD A;  2QZ8 A;  1G3S A;  2VC1 A;  4Y15 A;  3DP7 A;  4BHP A;  2GIV A;  1FSH A;  4KIC A;  6PAX A;  5K1Y A;  4EJT A;  1XCV A;  4B09 A;  2WWY A;  3GF2 A;  3QRF F;  5HS9 A;  4FX0 A;  4E70 A;  2HEO A;  3JSP A;  3FM3 A;  1DPU A;  3BPV A;  5BMZ A;  1IF1 A;  3GZ5 A;  1RUN A;  3J80 Z;  2JSC A;  2IP2 A;  2Q0O A;  3LA2 A;  2A68 F;  4IHS A;  4AVP A;  1BC8 C;  2STT A;  2EV5 A;  1I27 A;  2LKP A;  3RYR A;  2XRN A;  3KZY A;  2EWN A;  4Q48 A;  2A6H F;  2XKO A;  4YFK F;  5ILU A;  2L02 A;  3BZ6 A;  2DQL A;  3K1P A;  4MHG A;  1LJ9 A;  4KMU X;  2J5O A;  3GW2 A;  5D8K B;  5A2Q K;  3T1B A;  3O6B B;  4GYG A;  3HOT A;  5FO5 A;  1R22 A;  3F8N A;  2GQQ A;  1MGT A;  5H6R A;  1ZRC A;  1O7F A;  4HYE A;  3LA7 A;  4MNU A;  2QVO A;  1XSD A;  4HLX A;  4HQM A;  3WG9 A;  5D4S A;  2CW0 F;  2HKO A;  5BPD A;  2QWW A;  4A2U A;  5LGT A;  2CO5 A;  2DPU A;  1T0F A;  5KVR A;  2HDC A;  2X0L A;  1TQM A;  4HF2 A;  5LEK A;  1FT9 A;  4OIR F;  2XAG A;  3T0Y A;  1L3L A;  2UXN A;  1ON1 A;  4IRH A;  3CLO A;  1WWX A;  4CXF A;  5K5Q A;  1QBJ A;  3QU6 A;  4UXN A;  1OR7 A;  4WXC A;  4D0P A;  4ETS A;  3WGH A;  5DUI A;  4HDU A;  3TOA A;  1IN8 A;  5D6F A;  3M9A A;  2ISY A;  4EJU A;  3BWG A;  4KMF A;  1T2K A;  4M9S A;  1YG2 A;  3LA3 A;  1OKR A;  2IA1 A;  3N4M A;  2MC3 A;  3FXU A;  2OA4 A;  4EGZ A;  4OMY A;  1LQ1 A;  1T98 A;  1C0W A;  2C6Y A;  3KP7 A;  5D5U B;  3Q5F A;  3Q9V A;  3FXR A;  4GO1 A;  2LNB A;  1O3S A;  3IKT A;  1UHM A;  1LB2 A;  1JE8 A;  1S3J A;  5LHI A;  2VBZ A;  3SHF A;  4BNC A;  2XRO A;  4G94 A;  2VOP A;  4ZZD A;  5CVV A;  4MEY F;  3PFI A;  1FP2 A;  1LNW A;  1Z91 A;  3E5Q A;  4EMS A;  3CO6 C;  2W57 A;  2IW5 A;  3HSF A;  2DPD A;  5DUK A;  1IXC A;  2BE5 F;  4OOI A;  3ECH A;  5E1X A;  2EJR A;  4U7B A;  3DV8 A;  2YR2 A;  4RGU A;  1MJB A;  3EDP A;  1MDM A;  2M5W A;  3KP6 A;  3J81 Z;  1Y0U A;  2F5C A;  3F8F A;  3WGG A;  3RI4 A;  2GXB A;  5CVI A;  3V7C A;  1QZY A;  3GFI A;  5CJ9 A;  2UZK A;  4EM0 B;  2F2E A;  1KQ9 A;  1BBY A;  3LQR A;  2GAU A;  1IZ1 A;  4FHT A;  1FBQ A;  3WTW C;  1KGS A;  3BP8 A;  2A61 A;  3V8L A;  4P55 A;  3M8E A;  3MCZ A;  3W6J B;  5HLG A;  1NHA A;  1H9T A;  1XCB A;  1ZH5 A;  5HS7 A;  2XKP A;  3MQ0 A;  3HRS A;  4GCV A;  4P96 A;  1HST A;  2GZW A;  2E1N A;  4KT5 C;  3K9T A;  4AWX B;  1J7K A;  1ZRF A;  1MD0 A;  4L9N A;  3QP5 A;  5DV5 A;  1T38 A;  4CIC A;  2P7C B;  4EJW A;  5K5R A;  5E8I A;  3PQJ A;  1S7O A;  1BI2 A;  4IPA A;  4R1H A;  4A5N A;  2A3S A;  4G7O F;  1YW9 A;  4DQ2 A;  4L9J A;  3RTR A;  1G4D A;  1IRG A;  3QOP A;  2Z9O A;  1I1G A;  5BPI A;  3TQN A;  2YPR A;  1TTY A;  4L0Y B;  1FOK A;  4RB0 A;  5ILV A;  2JPC A;  2OZ6 A;  1GXP A;  1E17 A;  2ZKZ A;  2NS0 A;  3IRR A;  3ZP5 A;  2HWV A;  2OD5 A;  4YFN F;  3KLO A;  2OU2 A;  4XLN F;  3I58 A;  5ICC A;  3FM5 A;  1FC3 A;  3HYI A;  2EK5 A;  4QLC U;  1Z05 A;  4HA8 A;  2G7H A;  3TOB A;  2JZY A;  2M1B A;  1IN6 A;  2FML A;  4KIG A;  1HKS A;  1Z9C A;  2K4J A;  4L5I A;  3WTT C;  4HV6 A;  1YQA A;  2VBW A;  3LST A;  1PP8 F;  1DPR A;  1CF7 A;  2ZNY A;  2RVC A;  3DPT A;  5DCF A;  4LB6 B;  5HDG A;  2A5Y B;  2WTE A;  3E6B A;  3WTS C;  5L3B A;  1L0O C;  1XB4 A;  3AAF A;  2FF4 A;  2HS5 A;  2HZT A;  2G7U A;  5LRR A;  1MJ9 A;  2M30 A;  5DCM B;  5L3D A;  2HTJ A;  3SXY A;  4PDK A;  2H94 A;  3WE2 A;  3KE2 A;  3T8R A;  3ZN0 A;  1FP1 D;  5ILS A;  1RIO H;  4LJZ F;  4A0Z A;  4LK0 F;  1XSX A;  5JVT A;  3RPU A;  4I2O A;  3L2C A;  1D5V A;  3I64 A;  4Q5S F;  1VTN C;  2H6C A;  4HZF A;  4LLG F;  1WI9 A;  3CTA A;  1FYK A;  3BJA A;  1U3E M;  1J0R A;  1S29 A;  3K1M A;  4KDP A;  3SQN A;  1Q1H A;  1G6N A;  2HTS A;  3E6D A;  1R1T A;  5CVU A;  4LLN A;  2NRA C;  3BRO A;  4PGH A;  1I6X A;  1EH7 A;  1ZLJ A;  4LG0 B;  5TRD A;  4I0B A;  2V1X A;  3CUQ A;  1YS7 A;  3V4G A;  1ZLK A;  4M71 A;  1FX7 A;  1REP C;  5KK1 A;  1G3W A;  3I59 B;  2EFN A;  5DDG A;  2Z99 A;  3R0A A;  1AOY A;  1F4K A;  4U0Y A;  4YFX F;  1R7J A;  2PQ8 A;  2XAS A;  2W24 A;  4LGW A;  3E97 A;  3RDI A;  4EM1 A;  3E5U A;  4A6D A;  4YIF A;  1OYW A;  2IRF G;  2E1C A;  2O61 A;  1R1V A;  5LBQ A;  1YLF A;  1SD5 A;  3FMQ A;  2IA2 A;  2FBH A;  3GFM A;  2PG4 A;  3HHG A;  1XDU A;  2K7L A;  4RB1 A;  4OIO F;  2M45 A;  1RUO A;  2XAF A;  3IRQ A;  3QPH A;  5DD4 A;  4MTD A;  4QWQ A;  3JW4 A;  2NNN A;  1LDK B;  1W4M A;  5BOX A;  2AXL A;  4KUM A;  2XHK A;  1XGN A;  2OQR A;  1WQ2 A;  1O3T A;  2YSR A;  1MKM A;  2Z5U A;  2RQP A;  3R4K A;  4RGR A;  4L0Z B;  5EEG A;  5E17 F;  1H9G A;  1O3R A;  1R23 A;  4EQQ A;  1SD4 A;  2IVM A;  5HLI A;  3EYY A;  5D5X B;  2A07 F;  1ZN2 A;  3WTU C;  1U5T B;  1HKT A;  1OYI A;  2P8T A;  2HFH A;  5J8C A;  1BC7 C;  1QNT A;  3VEP A;  2KJC A;  5IT3 A;  2MLG A;  3I4P A;  4GYI A;  1ON2 A;  3P7N A;  2ETH A;  3GFL A;  3F3X A;  4LFU A;  2FMY A;  1P92 A;  3H92 A;  4EVI A;  4CYD A;  3CUQ C;  1ZAR A;  2VBX A;  2MH9 A;  1G3Y A;  3OOP A;  1QPM A;  1B4A A;  1FPQ A;  4WWC A;  2ZO4 A;  1TQP A;  3GX4 X;  3Q9S A;  4NHJ A;  1BN5 A;  3ZMT A;  4L9V A;  1TNT A;  2VT2 A;  1GVJ A;  3JTG A;  4HX7 A;  2OZU A;  4CHU A;  2O6G E;  3RJP A;  2DTR A;  4WX9 A;  2ESN A;  2EFP A;  1K79 A;  3F8C A;  2W84 A;  2KIM A;  1TBX A;  3VFZ A;  3HRU A;  2KRF A;  5DEQ A;  2V1U A;  1O57 A;  3I5U A;  3QAH A;  2OQG A;  2VBY A;  4U0W A;  1F5T A;  1WSU A;  1W7P B;  4OIQ F;  2P4W A;  2JRT A;  3RPQ A;  4O6J A;  3SFZ A;  5A2Q Z;  2LSO A;  1BIB A;  3KEQ A;  5BQT A;  3VOE A;  5TJJ A;  3E6C C;  1XSV A;  1YO5 C;  3ZQ7 A;  2STW A;  5LHH A;  2H09 A;  4HDV A;  3R61 A;  1SD7 A;  4HOB A;  1J75 A;  1RI7 A;  2MA3 A;  3SZP A;  2QQB A;  3MZY A;  4N9H A;  5L3F A;  3IHU A;  2XV4 S;  1KYW A;  1B9M A;  1W5S A;  1XMK A;  3ZPL A;  1BI3 A;  1UST A;  2JT1 A;  2FQ3 A;  1YYV A;  3KCC A;  1W5T A;  4YII A;  5JR3 A;  1WKM A;  4U88 A;  4LB5 A;  1BI1 A;  2Q8K A;  3ABU A;  1OYY A;  4UVB A;  2CQK A;  2D2W A;  3GZ6 A;  3DFG A;  3H3U A;  3ZMD A;  1KU9 A;  4I02 A;  1BM9 A;  2JTV A;  3K0L A;  4RGS A;  4ESF A;  3J81 K;  4DNC A;  4RAY A;  5F6F A;  4OIP F;  2FBK A;  5L3E A;  3HIF A;  1TNS A;  4OIN F;  1ZHF A;  3COA C;  2CYY A;  2EB7 A;  3REO A;  1HBX G;  1HSJ A;  4I7H A;  2ISZ A;  2YX4 A;  1YW8 A;  4WXH A;  2P6T A;  4GGG A;  4CDG A;  1PUE E;  1ODD A;  3V7R A;  4HX8 A;  3E3V A;  1QQI A;  2COM A;  4EGY A;  4M73 A;  3FHZ A;  1UFM A;  4CZZ A;  2VE8 A;  5JHU A;  4PCQ A;  1BI0 A;  4ZH4 F;  1K7A A;  3LWF A;  4PGG A;  4LD5 A;  2ZJ2 A;  2RV8 A;  5L3G A;  5FLX K;  5ED4 A;  2R3S A;  2QQA A;  2EA4 A;  4I0A A;  2NNY A;  5CLS A;  4HAM A;  1DP7 P;  4OMZ A;  5LLQ A;  1B1B A;  3WTV C;  1FYL A;  3QPT A;  3V7S A;  4IHT A;  1FLI A;  3H3Z A;  3WU1 B;  2O03 A;  2Q2E A;  5DYM A;  4I01 A;  3QU3 A;  3C18 A;  2XAQ A;  2L3D A;  2K27 A;  2L54 A;  4AD9 A;  3F8M A;  4XLP F;  4BAY A;  2FOK A;  1TW3 A;  3JAM K;  1R5G A;  1IUY A;  3F21 A;  2CSO A;  3KEO A;  2RKH A;  2O0Y A;  1J59 A;  4XSZ F;  1KU2 A;  4HLY A;  4UNO A;  2P5L C;  1EH6 A;  4AIJ A;  3LAJ A;  4I98 B;  3EQL F;  4A0X A;  3C1D A;  1JHH A;  3RKW A;  3LQQ A;  1BOA A;  2KJB A;  2MH2 A;  4L18 B;  2Z33 A;  2D45 A;  2Z3Y A;  2ZBK A;  3ZMV A;  4KNY A;  4L5J A;  5E1W A;  5D6E A;  3HHH A;  2RN7 A;  1HQC A;  2G9W A;  1BJA A;  2QBY B;  2CFX A;  1P4A A;  4KN7 X;  2BGC A;  4XSX F;  3GYH X;  3FX3 A;  2FBI A;  4G6Q A;  4Q4Z F;  2XIG A;  2HOE A;  4ZYD A;  2E7W A;  2KIU A;  2DAO A;  4NQW A;  5D5V B;  4M9Z A;  1S7A A;  1RNL A;  3TO9 A;  2ESH A;  3BDD A;  1HXD A;  1YW7 A;  3P9K A;  2R7F A;  3HTS B;  4L9T A;  4IF4 A;  1IXS B;  1LEB A;  3P9C A;  1XGM A;  4EV0 A;  4WF2 A;  4IJA A;  2K4B A;  1KA8 A;  1T39 A;  4ZYG A;  5ICG A;  2DO7 A;  3IWZ A;  1EH8 A;  2MD5 A;  3IC7 A;  2CGP A;  2L4M A;  2Y0M A;  1IN4 A;  1K78 B;  4Y17 A;  3MFK A;  3WOD F;  1ZYR F;  4G7Z F;  1V4R A;  3ZMZ A;  2DW4 A;  1AWC A;  1UCR A;  4R79 A;  3DPL C;  3ROU A;  1GHC A;  2W85 A;  4CO8 A;  1FBU A;  5D5W B;  4ZZL A;  2P7V B;  4HF1 A;  1QGP A;  3ZMS A;  1V3F A;  3FMR A;  5F64 A;  2QM3 A;  5EEH A;  3FMS A;  3T8T A;  4FT8 A;  5FD6 A;  2A69 F;  1I1S A;  1HW2 A;  3V8J A;  2O3F A;  3GXO A;  2ACJ A;  1B59 A;  2DFI A;  1S8N A;  5E18 F;  5ICF A;  3VB2 A;  4M6Y A;  3E5X A;  2ELH A;  1Z1D A;  3BJO A;  4HBL A;  2FU4 A;  3ZN1 A;  5DCM A;  1YIO A;  1USS A;  4MEX F;  2HR3 A;  1Z6R A;  2DBB A;  1D3Y A;  2D1V A;  5IT9 K;  4P5O A;  3KET A;  1LDJ A;  1ZAO A;  2YX7 A;  4N0B A;  2MLK A;  2KKO A;  3I71 A;  1FSE A;  2NAZ A;  4IXA A;  2O8X A;  5ICE A;  4ENM A;  2J5P A;  1BIA A;  4LLL A;  2B0L A;  5CVR A;  1DDN A;  3TO7 A;  3MEX A;  4Q47 A;  3JSO A;  1JGS A;  1XD7 A;  1XGS A;  3DKW A;  3WTX C;  5D8L B;  3G3Z A;  5L3C A;  2HKX A;  4Y13 A; 
#chains in the Genus database with same CATH topology
 1P4W A;  3KFW X;  2R5Y A;  4AUX A;  4A3K J;  3BTJ A;  2ZJQ F;  2M9H A;  3VYT B;  2KLO A;  3J80 K;  3DF8 A;  2HYF A;  1U9O A;  4PZJ A;  2EV6 A;  4A3B J;  1E3O C;  4LG0 A;  5K5O A;  5KHD A;  2EZL A;  2FA5 A;  2QYO A;  2DJN A;  2LC2 A;  3HRM A;  1T8I A;  2PJP A;  1FWZ A;  3FZV A;  5HVQ C;  2WV0 A;  2ADU A;  3GO5 A;  3WG7 H;  3JRI A;  2GOM A;  4EM2 A;  3E6M A;  3I59 A;  2X6W A;  2COB A;  2R7W A;  3FWE A;  1MMG A;  1IW7 F;  3TP3 A;  1BA5 A;  2VI6 A;  3BJ6 A;  4UUS B;  3HUG A;  2HDD A;  1MMA A;  2EH3 A;  2GM4 A;  1XDS A;  2BW3 B;  2KHM A;  3TL4 X;  3QYF A;  4F7Z A;  4PFP A;  5C4X J;  4S04 A;  2PFB A;  4ESJ A;  3R0J A;  2JA2 A;  1D8K A;  3CJT B;  1WPK A;  1OCP A;  5FLM J;  3GUD A;  3L00 A;  2JVG A;  1VQP I;  3KX2 A;  2DK8 A;  1SFE A;  1KU7 A;  4G9Y A;  2LKS A;  2XC7 A;  2GA1 A;  4ENN A;  9ANT A;  1WJ5 A;  2CQQ A;  3BG3 A;  3RIR A;  3HOX J;  3S15 J;  3OYG A;  2LF7 A;  2OAZ A;  2X9D A;  1MIJ A;  4TV7 A;  3HC7 A;  2IJL A;  2HYG D;  3MWM A;  3MD2 A;  1DUX C;  1LEA A;  3ISP A;  4UV9 A;  5M5Y J;  3S1M J;  2DA4 A;  5B5E C;  3ZQL A;  3OYK A;  2LR8 A;  5KAF C;  4CSW A;  1VQ8 I;  2P5K A;  3LSK A;  4P9U A;  4G7H F;  1K4T A;  4II3 A;  4AIH A;  4YG2 F;  3SZT A;  1F36 A;  1G8X A;  3DEU A;  4JK1 X;  2I5U A;  3U9G A;  4B8X A;  2L4A A;  4UV8 A;  1ETV A;  4LOC A;  1IAW A;  3BQY A;  2V79 A;  2AQE A;  2X1E A;  2R7U A;  5ERI A;  3H9Q A;  2M8G X;  2HQR A;  3HTU A;  1MZB A;  3O3K A;  3AFH A;  4K2E A;  1TLH B;  3P9I A;  3AG1 H;  3IUO A;  2BVM A;  2MSY A;  1QZZ A;  3ERE D;  2XGX A;  1P7J A;  3OYN A;  5AIQ A;  2PI0 A;  3F6V A;  2NS7 A;  1FJL A;  2BZT A;  3ABT A;  2IT0 A;  1FBS A;  4CA0 A;  4ZYE A;  2BEO A;  2L7M P;  1VQ7 I;  4HRI A;  1U78 A;  1WJD A;  4UVA A;  2Y69 H;  1FMV A;  1U5T A;  2LK2 A;  3EET A;  1I5Z A;  1SAX A;  3AG4 H;  4MO7 A;  4LMY A;  2WA0 A;  2Y48 A;  2HNH A;  2XB5 A;  2L2O A;  2HOA A;  1T56 A;  3GVA A;  2PN6 A;  3OL3 A;  4PJL A;  3RKY A;  2HVS A;  1RET A;  3GWZ A;  1SFK A;  2P5V A;  2DOF A;  3A02 A;  1K83 J;  3K2Z A;  3ABM H;  3L9F A;  5E3M A;  4UUV A;  4WXD A;  3CC4 I;  2OF7 A;  4BDY A;  3F22 A;  1XN7 A;  5JI6 A;  3I9V 2;  3I3L A;  3DBH B;  4ZYH A;  3TKY A;  1A04 A;  1MDM B;  2EIJ H;  5TGT A;  4J19 A;  3RQ4 A;  4HQE A;  4XLF A;  3JCU C;  3RYP A;  4C3I J;  4D7M A;  5JLW A;  4MLO A;  4A0Y A;  5EYR A;  3M4O J;  1CGP A;  5K7F A;  2Y75 A;  1WJA A;  4RAZ A;  1FY7 A;  1TP4 A;  2X4H A;  4XRF A;  2R7X A;  1LDD A;  2XDV A;  3RKX A;  1ZRD A;  1JXS A;  1YFH A;  5J1U A;  4A3E J;  2DK5 A;  2ZME B;  1TWC J;  2L0K A;  2F5E A;  1MJA A;  5FFZ A;  3CMA I;  3OYH A;  3CCS I;  5FD5 A;  1ZK8 A;  3L09 A;  4RB2 C;  4OU0 A;  2KMU A;  2W25 A;  2FRH A;  3ASN H;  3F72 A;  5GPA A;  2K9S A;  3TBI A;  4F55 A;  3S3M A;  5HS8 A;  2E60 A;  2BBY A;  4A6E A;  1LVA A;  2HXI A;  4PSX A;  2EZK A;  2M8E A;  5FKM A;  4JQF A;  2PEX A;  3WTY C;  4KYW A;  1P4X A;  4M6X A;  2ME0 A;  3B73 A;  4EJO A;  1JUS A;  5F1J A;  3ZQI A;  2FNA A;  4FX4 A;  3ZR8 X;  2XF7 A;  4N9I A;  2OC6 A;  1X1P A;  4BJT A;  1W7P A;  3LSJ A;  4YEJ A;  4RAF A;  3BOQ A;  3PIO F;  1RR8 C;  5LHG A;  3WGI A;  2QA4 I;  5FGM A;  2DT5 A;  2LY1 A;  3VSL A;  1ZG1 A;  1TWG J;  2QSF X;  2KIF A;  3S17 J;  4M72 A;  3ZMU A;  2WB1 N;  2DA3 A;  4WK8 F;  2IBD A;  3FF5 A;  4IHX A;  1F1Z A;  4UVC A;  5LGU A;  2EFW A;  2BHZ A;  3B02 A;  1SMT A;  1MMS A;  2CMP A;  1A35 A;  2LMD A;  3BC8 A;  3NAR A;  2H8R A;  3TW7 A;  2DU9 A;  1QO0 D;  2RDP A;  1FOY A;  4IHV A;  2B63 J;  2CS3 A;  5BS6 A;  2F5D A;  1Y56 A;  3G71 I;  1CQT A;  1RR7 A;  1DU0 A;  1SFX A;  3LSM A;  4HW0 A;  1IV6 A;  3CES A;  1BW6 A;  2CFO A;  4B43 A;  4CGZ A;  2F6C A;  3PM1 A;  1U5T C;  1KYZ A;  2EFO A;  5EF6 A;  1EA3 A;  1Z6T A;  1IRF A;  2QUF A;  2VJI A;  3QWL A;  1IRZ A;  1U8R A;  3I56 I;  3ECO A;  1W7P D;  3LSP A;  1ONV A;  3BCA A;  4RMN A;  2RGV A;  1UB9 A;  1Z3X A;  4A12 A;  3FHN A;  2WAQ A;  2XB0 X;  1R49 A;  2ZME A;  2PBI A;  1HW5 A;  2IS1 A;  4O5V A;  1ZG3 A;  1QU3 A;  1MBG A;  4A5M A;  4UB6 C;  2L7Z A;  1IXR C;  1E3P A;  1RKT A;  1P6R A;  2V6C A;  1ZGW A;  1JHF A;  4LK1 F;  3WE3 A;  3M1E A;  1EV7 A;  2DDA A;  2LG4 A;  3KIO A;  2VC0 A;  4FET A;  3RQI A;  2IPQ X;  2E1O A;  2LDU A;  3KP2 A;  4JX4 A;  2WV1 A;  2CU7 A;  1WJE A;  4JBA A;  4IRG A;  1E3H A;  3TDZ C;  1MNE A;  1TZL A;  1PUF B;  1H0M A;  3G6E I;  1ULY A;  3R60 A;  4UHT A;  1WRJ A;  1TQI A;  3DQV C;  2VE9 A;  1YOV B;  5DD8 A;  2E1M B;  3ULQ B;  1W0U A;  3BTL A;  4BY1 J;  3S1N J;  3C7J A;  2XF6 A;  1BW5 A;  2TRT A;  3N97 A;  3ZRG A;  5J40 A;  4BL0 B;  2DLL A;  5FFX A;  5FKK A;  2GBY A;  1UHS A;  4ASN A;  3A01 B;  2L01 A;  4ON0 A;  2V9V A;  3JRA A;  2W4S A;  5KNL A;  3HG9 A;  1YE9 A;  1R5H A;  1HOM A;  3WU2 C;  2LF8 A;  3KLN A;  4RS8 A;  1J9I A;  2HOT A;  2M4G A;  2VOO A;  2OBP A;  2X6O A;  3F23 A;  3ZQH A;  3F6O A;  1PP7 U;  4HX4 A;  3DXJ F;  5FLX Z;  1CF7 B;  4GXO A;  1OCR H;  4Y13 A;  1RZ4 A;  4DIQ A;  3I54 A;  2A05 A;  1R1U A;  4FE4 A;  2R93 J;  2LYC A;  4G12 A;  3BR1 A;  4KIF A;  1TL8 A;  3GLX A;  4MGR A;  4U7D A;  1SEU A;  4RLF A;  4Y4R A;  3U1D A;  4XLA A;  3G2B A;  5JHF A;  2A6E F;  4HNU A;  4XOP A;  4BYY A;  2CWE A;  4ZTJ A;  2R7D A;  2UXX A;  1R36 A;  2ZXJ A;  3WU0 A;  4QIW N;  2Z2S B;  2IAI A;  3CCR I;  4A93 J;  1DGW Y;  3FXQ A;  3HKZ N;  3J7A O;  2PMU A;  3I4N J;  4E7S A;  1YJW I;  1A36 A;  2UUZ A;  4MQV A;  4S05 A;  2PMH A;  2HQN A;  3NWT A;  1ZG5 A;  3CJN A;  2VN2 A;  1SVM A;  2BV6 A;  1XX5 A;  3M7G A;  1K6O A;  2HPM A;  2WB1 A;  3D5L A;  3L2Q A;  3FXK A;  1Z21 A;  3ZOB A;  1X1D A;  2V26 A;  1SC7 A;  2WBM A;  4RB3 C;  1XMA A;  1YTY A;  1SMY F;  2MBF A;  3JAM Z;  4IRI A;  4UY8 I;  3K6G A;  1T6S A;  2CG4 A;  2Q1Z B;  2ZCW A;  2F5V A;  3R6S A;  3CCY A;  3H5R A;  1G59 A;  5IOY A;  3FXL A;  1G3T A;  2QLZ A;  4BH9 A;  1D0Y A;  1R00 A;  3OYC A;  3CDL A;  5CPR B;  3RKQ A;  1N77 A;  2OUM A;  3BQZ A;  1FNN A;  3TGN A;  5KCM A;  2LVS A;  3HRT A;  1XGO A;  3CUO A;  3OV8 A;  3KZI C;  1O7L A;  2ID6 A;  4M3E A;  2R5Z A;  3TO6 A;  4AVZ A;  3L2U A;  5E8G A;  4ESB A;  1X3U A;  4EJV A;  2GWR A;  4IVN A;  4D9J A;  1IJW C;  4BHB A;  1Y8R B;  3OR1 C;  4BAC A;  1P7I A;  4BEH A;  5AON A;  2K02 A;  2WC2 A;  3H3V K;  2YU3 A;  1F9N A;  2PLY A;  2EFQ A;  5F27 A;  1DGR M;  2VOD A;  1S7E A;  5E20 A;  4Y3O A;  4F92 B;  1POG A;  4M3D A;  2XAJ A;  2XUB A;  1Z67 A;  2H6B A;  1TW2 A;  2FSW A;  1W5C C;  1FYM A;  2V7F A;  4G8X A;  3W6V A;  4I09 A;  4BE1 A;  5HOO A;  2TDX A;  3DKX A;  4Z6Y A;  3A2K A;  2LH9 A;  2IGN A;  3PL8 A;  1HW1 A;  2AXT C;  1IRX A;  1U2W A;  1U9N A;  3KYD B;  4XMY A;  5F1R A;  2QSG X;  2ZNZ A;  4XID A;  5FKO A;  2VT3 A;  3V42 A;  2GXG A;  3CMM A;  3AG3 H;  4CYC A;  3GTQ J;  4A3G J;  4RGX A;  1J2X A;  3CDH A;  2V1D A;  3CUQ B;  3KP3 A;  3KP4 A;  3WTZ A;  3JRF A;  3HM5 A;  4E7H A;  2EV0 A;  1STZ A;  3HB9 A;  3HOS A;  1IN5 A;  3GTP J;  1WJB A;  1S6L A;  3HEF A;  4IQJ A;  4MIM A;  3OYA A;  2EA2 A;  2LLK A;  3EYI A;  2K86 A;  3D0S A;  3F0C A;  1B6A A;  4HV5 A;  3EUH A;  3S16 J;  2VB6 A;  4KN4 X;  4NNJ A;  3GFJ A;  1SFU A;  3ML6 A;  2M87 A;  4M9X A;  4BXU A;  3I53 A;  2V1N A;  3BY6 A;  2DFH A;  2HVQ A;  4F93 B;  3Q0V A;  1FEX A;  2QEN A;  3IV5 A;  5EZH A;  1U6G A;  3S14 J;  4XKV A;  3ZQG A;  3OMY A;  2QQ9 A;  2GIZ A;  4I6Z A;  2UV1 A;  4LIU A;  4ZC3 A;  2UWM A;  1LVK A;  3LMM A;  3HSR A;  3O8H A;  1IN7 A;  1KQ0 A;  4X1E A;  5C4J J;  4ENJ A;  1GXQ A;  2QBY A;  4C30 A;  1I3A A;  1E2X A;  1SD6 A;  2H27 A;  1QA6 A;  2O8K A;  5E1Z B;  2D1H A;  3HKZ A;  2FEZ A;  3BG9 A;  2L9R A;  5HDN A;  3S2W A;  5FB2 A;  1PDN C;  3H1C A;  4XKB A;  3TED A;  5CYV A;  1A31 A;  5LRS A;  3C3W A;  1KU3 A;  1MMN A;  3DU6 A;  5B3S H;  1RC9 A;  2LY9 A;  4FQG A;  4E6K G;  3HGG A;  1V5G A;  3CO7 C;  3K69 A;  5HDK A;  1ZRE A;  4ZDO A;  1T33 A;  3IL2 A;  3A0B C;  5AIP A;  4HF0 A;  4ENK A;  3GEZ A;  3PIP F;  1YIJ I;  5B66 C;  2AS5 F;  2DI3 A;  2P6S A;  1HC8 A;  3NEU A;  1FZP B;  5C44 J;  1B9N A;  1P9Q C;  5H6Q A;  1D1A A;  2K9L A;  1X19 A;  2GA2 A;  1ZGJ A;  4B1R A;  2RC4 A;  5H20 A;  4M74 A;  3M8F A;  2WAE A;  4Z2Y A;  3DWL E;  1BL0 A;  4O3M A;  1X2N A;  3ELK A;  4DZP A;  1X58 A;  2VQC A;  1HKQ A;  2HI3 A;  1MSF C;  2BY0 A;  1FIP A;  3L7W A;  4CCM A;  3LAP A;  4JX6 A;  1HF0 A;  3KZZ A;  3T5X A;  2EIM H;  4DW6 A;  3HPG A;  3IKV A;  1ZEL A;  5E3L A;  4P1W A;  5EGO B;  3RZD J;  4IL6 C;  2F4I A;  3NRV A;  1D8J A;  4YEL A;  2FNP A;  3U1K A;  1K78 A;  1OMI A;  5LGN A;  2LP0 A;  2DA5 A;  2NYX A;  3KP5 A;  1D1B A;  4NB5 A;  2FE3 A;  4R8H A;  4ABZ A;  3U2R A;  4BXF A;  1APL C;  1LFU P;  3QOE A;  5HLH A;  4XN0 A;  2QCO A;  3GLL A;  4HNV A;  1Z7U A;  5IY5 H;  2DQR A;  2XVC A;  3G1O A;  4G6D A;  4WCG A;  1O3Q A;  1YS6 A;  2IA0 A;  2RNJ A;  4HST A;  3V8K A;  2BYV E;  3BG5 A;  3MAJ A;  5DTD A;  1JJ6 C;  2E7X A;  4KA4 A;  1ZGA A;  2QKL B;  3JTH A;  3L2V A;  1JUM A;  4KFC A;  4XBF A;  5FRO A;  4MTE A;  4P9F A;  3LOC A;  5CVJ A;  3PQK A;  1TT0 A;  1OPC A;  1R58 A;  2FXA A;  2JPB A;  3F8B A;  3DBL B;  4AIK A;  1YJN I;  2PJR A;  1YX3 A;  3IWF A;  5GP9 A;  1FTT A;  2H1K A;  4H0E A;  2XPU A;  1SVO A;  3MZH A;  2ZFW A;  3NQO A;  4KIB A;  4DBR A;  2W1O A;  1IUF A;  3K1N A;  2ECC A;  3G73 A;  4I76 A;  3BG6 A;  3O2P E;  3AL0 C;  3TP0 A;  4A3J J;  4RAG A;  4QPO A;  3I0T A;  3LFK A;  2VON A;  2XGD A;  3VYS B;  1UHW A;  3TDU C;  1YIT I;  5JFR A;  3NWS A;  4BY7 J;  3LFU A;  2VXZ A;  3W6K B;  4BHC A;  4MQ9 F;  5LEJ A;  3QP6 A;  5D4R A;  5IT9 Z;  4BQA A;  5J8F A;  4IEJ A;  5J1R A;  1KQ8 A;  3ZXS A;  2KFD A;  2OPT A;  1FOW A;  2E36 A;  4U0V A;  3HSE A;  4ZDL A;  5J6X A;  5M5X J;  1VQ4 I;  2R92 J;  1P2F A;  3BPX A;  2JSP A;  2XAH A;  2JK3 A;  1J5Y A;  3MMY B;  2HGC A;  4XLC A;  2F5F A;  3VOD A;  1ETW A;  2QZ8 A;  1G3S A;  4DYC A;  3M07 A;  2VC1 A;  3QYE A;  4XQF A;  4B3A A;  4IO9 F;  4Y15 A;  3DP7 A;  3W2W A;  1EF4 A;  4BHP A;  2E2J J;  2K9N A;  3BR5 A;  2GIV A;  2GOX B;  5CQG A;  1FSH A;  4KIC A;  3CCM I;  6PAX A;  1SAU A;  5K1Y A;  1H88 C;  4EJT A;  1XCV A;  1X2M A;  4B09 A;  3H9J A;  3GF2 A;  2WWY A;  5HS9 A;  3QRF F;  4ZJZ A;  1YRN A;  4AM3 A;  4BE2 A;  4FX0 A;  4E70 A;  2HEO A;  3MKY B;  4NDL A;  3JSP A;  3D5S C;  2N8G A;  5JVG F;  3FM3 A;  1DPU A;  3BPV A;  2KRH A;  3OYD A;  5BMZ A;  1IF1 A;  3IP4 B;  1R71 A;  4E7Z A;  2ZJR F;  3L2R A;  3PO3 J;  3GZ5 A;  1JKR C;  1RUN A;  3J80 Z;  2JSC A;  2IP2 A;  2Q0O A;  1W1W E;  3CMY A;  3LA2 A;  2A68 F;  4IHS A;  4AVP A;  1BC8 C;  2STT A;  1MSE C;  4E7I A;  2EV5 A;  2OCE A;  1I27 A;  2LKP A;  2ZXH A;  3K4B A;  5E3N A;  2ZC2 A;  3RYR A;  2XRN A;  5B1B H;  4IHY A;  3P5J A;  2DJI A;  3KZY A;  4FE7 A;  2ELK A;  3DCF A;  2EWN A;  4Q48 A;  1GVD A;  1IO2 A;  1V55 H;  3PSI A;  2A6H F;  2NVX J;  2ZSH B;  3H0G J;  2JRM A;  2XKO A;  4YFK F;  5H2F C;  5ILU A;  2L02 A;  2VIX A;  5J3L A;  1ETK A;  3BZ6 A;  3CCE I;  2WAF A;  2DQL A;  2ZXW H;  3K1P A;  2V9P A;  4MHG A;  3PNT A;  2HDW A;  1LJ9 A;  4KMU X;  2J5O A;  3LL7 A;  4V2G A;  1TT5 B;  1X1C A;  3GW2 A;  5D8K B;  5A2Q K;  3JR9 A;  1X3Z B;  5E3O A;  2CUF A;  3T1B A;  3O6B B;  4GYG A;  3HOT A;  3KYL A;  4A3I J;  2IXS A;  1R22 A;  3F8N A;  5FO5 A;  4XK4 A;  5IYD J;  5LFA A;  4QPQ A;  5F0H A;  2GQQ A;  1MGT A;  2Y31 A;  5H6R A;  2DA7 A;  1ZRC A;  1O7F A;  2IGM A;  4HYE A;  2Y2Z A;  4M3F A;  3LA7 A;  3Q3S A;  4MNU A;  2QVO A;  1JUP A;  1XSD A;  3BT9 A;  4HLX A;  4HQM A;  3WG9 A;  3OYM A;  5D4S A;  2CW0 F;  2HKO A;  5BPD A;  3A4C A;  2QWW A;  4A2U A;  2DMQ A;  2JA5 J;  2HU9 A;  5LGT A;  2CO5 A;  2MFZ A;  2DPU A;  3C2H A;  1ETQ A;  1T0F A;  4UUS A;  1X1B A;  5KVR A;  4M6V A;  1JI8 A;  5CKT A;  2BW3 A;  2M4K A;  2HDC A;  2X0L A;  4JYK A;  3FXM A;  1TQM A;  1BOB A;  4HF2 A;  5LEK A;  2E2H J;  4BS9 A;  1FT9 A;  4OIR F;  2K9M A;  2CUZ A;  2WAQ N;  1S5L C;  2W82 A;  4KJZ A;  4AID A;  2XAG A;  3FIS A;  3T0Y A;  3HOW J;  1L3L A;  2UXN A;  2CW7 A;  1ON1 A;  2IGO A;  2VL8 A;  4J01 A;  4IRH A;  3CLO A;  1WWX A;  4CXF A;  5K5Q A;  2E5N A;  1WHU A;  5K7H A;  1YHQ I;  2KDZ A;  1QBJ A;  1IV8 A;  1JKP C;  2HZD A;  3QU6 A;  1X1A A;  1UMQ A;  4UXN A;  4DZJ A;  1OR7 A;  2ELJ A;  3C2G A;  4WXC A;  4D0P A;  3FKI J;  3WGH A;  4ETS A;  5DUI A;  2K40 A;  5FKL A;  4HDU A;  3TOA A;  1IN8 A;  5D6F A;  3M9A A;  2NVQ J;  3HGY A;  2ISY A;  4AU7 A;  3QOD A;  3OIO A;  3SYT A;  4EJU A;  2DA6 A;  3BWG A;  4KMF A;  1T2K A;  4M9S A;  2M3A A;  5CQE A;  1YG2 A;  4XRS A;  3VPR A;  4DBQ A;  3LA3 A;  1OKR A;  1V5F A;  2IA1 A;  5EZG A;  3N4M A;  2MC3 A;  3FXU A;  2OA4 A;  4XM3 A;  4ZYA A;  2DCE A;  3JRB A;  4EGZ A;  1LQ1 A;  4GDF A;  4OMY A;  3OIP A;  1T98 A;  2DOE A;  1C0W A;  2VUM J;  2C6Y A;  1WH5 A;  4HG2 A;  2I8D A;  3KP7 A;  2VJJ A;  2IS4 A;  1OIS A;  3K10 A;  5D5U B;  2CV1 A;  4E7J A;  3Q5F A;  5FRN A;  2R7T A;  1D1C A;  1JT6 A;  3Q9V A;  1V54 H;  3F9K A;  3FXR A;  3DEW A;  3B6A A;  1ZQ3 P;  2CJJ A;  4GO1 A;  2KZV A;  2LNB A;  3KEY A;  4ANJ A;  4NC6 A;  3VYU B;  1O3S A;  4CCK A;  3IKT A;  3K4J A;  1UHM A;  1LB2 A;  2DDB A;  1JE8 A;  1S3J A;  5LHI A;  2ZB9 A;  2VBZ A;  3SHF A;  4BKX A;  4BNC A;  2XRO A;  3LNQ A;  4G94 A;  1JKQ C;  3ESW B;  2VOP A;  4A3M J;  2XSD C;  4ZZD A;  5CVV A;  4MEY F;  2LBF B;  2BY1 A;  2Q2E B;  2KRC A;  1K4S A;  3PFI A;  3OWT A;  3BR2 A;  1FP2 A;  1LNW A;  1Z91 A;  3D5R C;  4PJM A;  3E5Q A;  3C2B A;  2OTL I;  5EG0 B;  4EMS A;  2MG4 A;  3CO6 C;  3FBI B;  4NUB A;  3UR3 C;  2W57 A;  2IW5 A;  3HSF A;  2DYR H;  2DPD A;  2Z16 A;  5DUK A;  1IXC A;  1Z7L A;  4YRV A;  1X3W B;  2BE5 F;  1Z77 A;  5IOZ A;  4OOI A;  3DTE A;  3ECH A;  3K4C A;  4LIV A;  1HCR A;  2L7K A;  5E1X A;  2JWT A;  2EJR A;  4U7B A;  1MBK A;  3DV8 A;  2YR2 A;  1W0T A;  4S0H B;  4RGU A;  1MJB A;  3EDP A;  1RKW A;  1MDM A;  1B8I B;  2M5W A;  2JA6 J;  3KP6 A;  2KPM A;  3H35 A;  3J81 Z;  1Y0U A;  2F5C A;  3OYI A;  3F8F A;  3WGG A;  4F3Q A;  3RI4 A;  1R6R A;  2FUG 2;  2GXB A;  5CVI A;  3GZN B;  3V7C A;  1T0F C;  2KT0 A;  1QZY A;  1ZTR A;  3TW6 A;  3GFI A;  2KZG A;  1R4N B;  5CJ9 A;  2UZK A;  2VKV A;  4EM0 B;  2F2E A;  3W3C A;  1KQ9 A;  2XGE A;  5K7Z A;  4CH7 A;  2VJ4 A;  1BBY A;  2ZXI A;  3K70 D;  3LQR A;  2GAU A;  3M1C A;  1IZ1 A;  4FHT A;  1FBQ A;  3H36 A;  1JJ8 C;  3WTW C;  1KGS A;  3BP8 A;  3VYR B;  2A61 A;  3V8L A;  3DLA A;  3MVP A;  4P55 A;  3DLL F;  1LE8 B;  3M8E A;  2X51 A;  4C2M J;  2E35 A;  3MCZ A;  1WI3 A;  3W6J B;  4AYB N;  4IOA F;  5HLG A;  1NHA A;  1K61 A;  1OR7 C;  1H9T A;  1WJF A;  3CCJ I;  1XCB A;  1ZH5 A;  2VQH A;  1TWH J;  2DT6 A;  5HS7 A;  3L2W A;  1AA7 A;  5KAI C;  1IC8 A;  5J4V A;  2XKP A;  1NK3 P;  3MQ0 A;  3HRS A;  4GCV A;  4P96 A;  3O8G A;  2CV0 A;  1HST A;  2GZW A;  4BQQ A;  2E1N A;  4KT5 C;  2QEX I;  2DYS H;  4IHW A;  3K9T A;  4AWX B;  3X2Q H;  1J7K A;  2R7V A;  2WY7 Q;  2LY2 A;  2XPV A;  1ZRF A;  3DKY A;  1MD0 A;  2W48 A;  3CP8 A;  3QP5 A;  4L9N A;  5DV5 A;  1T38 A;  3BTC A;  4NQW B;  4CIC A;  2P7C B;  5GPC A;  3G1M A;  3CCL I;  1JGG A;  4U87 A;  4EJW A;  5K5R A;  5E8I A;  3PQJ A;  1S7O A;  4FCY A;  2X6Y A;  3HZJ A;  4KIS A;  1BI2 A;  4IPA A;  3FXO A;  4R1H A;  1VQ5 I;  4A5N A;  4XL9 A;  1S9H A;  1X4O A;  2A3S A;  4EAT A;  4G7O F;  1YW9 A;  4DQ2 A;  4L9J A;  2ECB A;  3RTR A;  1G4D A;  1IRG A;  3QOP A;  2Z9O A;  1I1G A;  2QKM B;  1MMD A;  5BPI A;  3FK6 A;  3TQN A;  2ME6 A;  2FJ1 A;  2YPR A;  1TTY A;  2DN0 A;  4L0Y B;  1FOK A;  4A3C J;  4RB0 A;  5ILV A;  2JPC A;  2Y0S N;  2OZ6 A;  1GXP A;  1E17 A;  2ZKZ A;  2NS0 A;  2DXI A;  4XNF A;  2AQF A;  2QGU A;  3IRR A;  3ZP5 A;  4MFE A;  2HWV A;  4C3H J;  2OD5 A;  4YFN F;  2DMP A;  2W00 A;  3KLO A;  2CQ7 A;  2TCT A;  2OU2 A;  4XLN F;  3CJR B;  5B1A H;  3I58 A;  4DGW B;  1YI2 I;  2H8W A;  4FAS D;  3OYB A;  5ICC A;  2I10 A;  2BXY A;  2VAS A;  3FM5 A;  3Q0W A;  1FC3 A;  4M3G A;  4F52 A;  3HYI A;  3OSF A;  2L9N A;  2R4G A;  2EK5 A;  3FDY A;  4QLC U;  1Z05 A;  4HA8 A;  2VLA A;  2G7H A;  1PUF A;  3IAM 2;  3TOB A;  2JZY A;  2M1B A;  2M34 A;  4X6A J;  1BR4 A;  3ZQF A;  2HPI A;  4X0G A;  1IN6 A;  2FML A;  4HEA 2;  4KIG A;  4XOT A;  1HKS A;  1Z9C A;  2WAD A;  3GME A;  3A01 A;  3DTK A;  2K4J A;  5IP7 J;  2ZME C;  4L5I A;  3WTT C;  5GAG J;  1FIA A;  4IZZ A;  4HV6 A;  1YQA A;  4I99 C;  2VBW A;  2R7Z J;  3SFI A;  3LST A;  1LUJ B;  5FJ8 J;  1PP8 F;  1DPR A;  3RCO A;  2YU9 J;  4AYB A;  1CF7 A;  2ZNY A;  2RVC A;  4NC7 A;  3S3N A;  4RLQ A;  3DPT A;  3L1P A;  1WH7 A;  5DCF A;  2FQ4 A;  4LB6 B;  3HL2 A;  5HDG A;  2LD5 A;  1VI0 A;  2A5Y B;  2WTE A;  3E6B A;  3WTS C;  3OYF A;  5L3B A;  3BZK A;  5GAE J;  1L0O C;  3FIW A;  1XB4 A;  2JN6 A;  3AAF A;  2FF4 A;  4XON A;  3LSH A;  2HS5 A;  2K9Q A;  1NG6 A;  2HZT A;  3CZ6 A;  3CP2 A;  4LG3 A;  4XRS G;  4ZTF A;  5E79 C;  2G7U A;  1WVR A;  1ZKG A;  4XKW A;  5LRR A;  1MJ9 A;  2M30 A;  1Y8Q B;  5DCM B;  2GXA A;  1ITY A;  5L3D A;  1GV5 A;  2HTJ A;  2V9K A;  3SXY A;  1ERD A;  3OY9 A;  4PDK A;  2H94 A;  3WE2 A;  1KON A;  4CZC A;  3KE2 A;  4E4H A;  5EJC A;  2JJ7 A;  3T8R A;  1Y6I A;  4G6T B;  4XKC A;  3ZN0 A;  3G4S I;  1FP1 D;  5ILS A;  2X85 A;  2OTJ I;  1RIO H;  1BR2 A;  3FXJ A;  1FMW A;  4LJZ F;  4A0Z A;  4LK0 F;  1XSX A;  5JVT A;  1Q1V A;  3RPU A;  1T95 A;  2R7R A;  2LRE A;  3HXL A;  2P81 A;  1TC3 C;  2MW8 A;  4I2O A;  2E5Z A;  1I6H J;  1OCT C;  1MW7 A;  2Y0S A;  1UG0 A;  2A6T A;  5M5W J;  1WCM J;  1KZH A;  3L2C A;  1AKH B;  3I4M J;  1D5V A;  3I64 A;  2YS9 A;  4Q5S F;  3OYL A;  1UEL B;  1VTN C;  2H6C A;  4HZF A;  4LLG F;  3CDI A;  1MBE A;  1WI9 A;  2EZI A;  1AHD P;  3CTA A;  4V2F A;  1FYK A;  4BDZ A;  5F04 A;  2KP6 A;  2NVY J;  3BJA A;  1U3E M;  2Z1D A;  4BE0 A;  4CCL A;  4JP0 A;  3OSG A;  3S2D J;  1ETO A;  2R5Y B;  3LSI A;  1J0R A;  2CUJ A;  1S29 A;  3K1M A;  2BVL A;  4KDP A;  3HJE A;  3SQN A;  1Q1H A;  1G6N A;  2HTS A;  3E6D A;  3Q0U A;  1R1T A;  2O5R A;  2LOO A;  5CVU A;  2NRA C;  4LLN A;  3BRO A;  1GDT A;  4PGH A;  1VF9 A;  3SZG A;  1I6X A;  1EH7 A;  1ZLJ A;  2NS8 A;  3RPU D;  4RM2 A;  4LG0 B;  5TRD A;  2O9L A;  3HOZ J;  4I0B A;  4CUG A;  2AHQ A;  2V1X A;  3CUQ A;  1YS7 A;  3DU5 A;  3V4G A;  3HDD A;  2E1M C;  4FIS A;  1ZLK A;  4M71 A;  1FX7 A;  1REP C;  1NG7 A;  5KK1 A;  3A03 A;  1G3W A;  4C2U A;  3I59 B;  5EEA A;  2EFN A;  5DDG A;  2Z99 A;  3R0A A;  3ZGK A;  5C3E J;  3OS0 A;  1AOY A;  1JKO C;  1F4K A;  4A3L J;  2DA1 A;  4U0Y A;  1MBJ A;  4YFX F;  3ONQ A;  3HUG B;  3BCB A;  1R7J A;  2PQ8 A;  3IAS 2;  4B4C A;  2M2E A;  1BJZ A;  3GCM A;  2XAS A;  2W24 A;  2VQG A;  4LGW A;  3E97 A;  3S93 A;  3RDI A;  1SAN A;  4B48 A;  4EM1 A;  3E5U A;  4A6D A;  2XRL A;  4YIF A;  2K5C A;  1OYW A;  2IRF G;  2E1C A;  2O61 A;  2LRD A;  1R1V A;  5LBQ A;  4QSH A;  1Y1W J;  1YLF A;  1SD5 A;  3FMQ A;  2IA2 A;  4B47 A;  1LKX A;  2FBH A;  2HVR A;  4D5F A;  2HQ5 A;  2IS2 A;  3EUH C;  3GFM A;  2PG4 A;  3HHG A;  1XDU A;  2M0C A;  1NK2 P;  2K7L A;  3BR6 A;  4RB1 A;  4OIO F;  2M45 A;  4XRM A;  3CME I;  1RUO A;  2OJE D;  3S2H J;  2AO9 A;  2XAF A;  3QPH A;  3ZQQ A;  5DD4 A;  2LTP A;  3J7Y J;  3IRQ A;  1JT0 A;  4MTD A;  2XF5 A;  4QWQ A;  3MZ8 A;  3JW4 A;  3OYJ A;  4C3J J;  2NNN A;  3H5A A;  1LDK B;  1W4M A;  5BOX A;  2AXL A;  3MKW B;  4KUM A;  2XHK A;  2JA8 J;  1QHG A;  1XGN A;  2JMW A;  2IS6 A;  3E0J B;  3ABL H;  2OQR A;  1WQ2 A;  4A69 C;  1O3T A;  2YSR A;  5IP6 A;  3SDG A;  1MKM A;  3K4K A;  1VQL I;  4BXX J;  5M3M J;  2Z5U A;  2RQP A;  2CQN A;  3BG7 A;  3KPH A;  3R4K A;  4RGR A;  1N75 A;  3CCQ I;  4L0Z B;  5EEG A;  4JOM A;  3PO2 J;  5E17 F;  1H9G A;  1O3R A;  1R23 A;  4BUP A;  1SD4 A;  2NOG A;  4EQQ A;  1HLV A;  1K6Y A;  4BBR J;  2IVM A;  2HXO A;  5HLI A;  2E2I J;  2MYS A;  5HOD A;  5EGO A;  4E7K A;  2F4M B;  3EYY A;  3B6C A;  4CCJ A;  1UZC A;  1UAA A;  5D5X B;  4DOZ A;  3K4M A;  2A07 F;  1ZN2 A;  3WTU C;  1XC5 A;  1U5T B;  3OOU A;  1IDZ A;  1ZR2 A;  4PJN A;  1HKT A;  4H4K C;  4IKF A;  1OYI A;  2P8T A;  2HFH A;  5J8C A;  1OFC X;  3RZO J;  1BC7 C;  3QYB A;  1QNT A;  3QQA A;  3CC7 I;  3VEP A;  2KJC A;  4D7N A;  5IT3 A;  3ZQC A;  2NXN B;  2EQR A;  2MLG A;  3I4P A;  4BJ6 C;  1QRY A;  1ON2 A;  3P7N A;  4GYI A;  2ETH A;  3GFL A;  3OL4 A;  3H5N A;  3F3X A;  4LFU A;  2FMY A;  1P92 A;  3H92 A;  4QTR A;  1VQO I;  2E71 A;  4CYD A;  4EVI A;  2F4O B;  3CUQ C;  1ZAR A;  2VBX A;  2MH9 A;  3IH2 A;  2M7B A;  3BR3 A;  1G3Y A;  1PVE A;  3A1Y A;  3OOP A;  1QPM A;  2VPL A;  1B4A A;  3OS2 A;  2ID3 A;  1FPQ A;  4J00 A;  4WWC A;  2F48 A;  2VJ5 A;  1AU7 A;  2ZO4 A;  2R7S A;  1OQY A;  2RQQ A;  1ENH A;  1TQP A;  1IGN A;  3DTI A;  1N78 A;  1T08 B;  2NVT J;  3HOU J;  4XN3 A;  3K7A J;  1ACI A;  4UUT A;  3GX4 X;  3CD6 I;  3Q9S A;  2KIS A;  1VQM I;  2L5Q A;  3MKL A;  2R0Q C;  4NHJ A;  2FX0 A;  1BN5 A;  3PNY A;  3ZMT A;  1RES A;  4L9V A;  2EIK H;  1TNT A;  2VT2 A;  4BQN A;  1GVJ A;  3JTG A;  4HX7 A;  4RDU A;  2OZU A;  2KDO A;  2PMZ N;  4CHU A;  3K4N A;  1XTA A;  2O6G E;  3RJP A;  4MFD A;  3S8P A;  2DTR A;  4WX9 A;  2VPR A;  2BOL A;  3S1R J;  3QPS A;  2ESN A;  2EFP A;  1K79 A;  3F8C A;  2W84 A;  2KIM A;  5FRM A;  5GTI C;  1TBX A;  5IPA A;  3IH4 A;  3VFZ A;  3HRU A;  2NOJ B;  5DS9 A;  3J7Z I;  3JRC A;  2KRF A;  3ASO H;  3SJM A;  5DEQ A;  5GAD J;  2V1U A;  1VZ0 A;  2XPW A;  1O57 A;  2V4J C;  3I5U A;  3QAH A;  2EIN H;  3ABK H;  2OQG A;  3U21 A;  2VBY A;  5FLV A;  4U0W A;  1F5T A;  4OAY A;  1WSU A;  1HDP A;  1W7P B;  2EZH A;  4OIQ F;  2P4W A;  2JRT A;  4O6J A;  3RPQ A;  3SFZ A;  5A2Q Z;  2DMT A;  2LSO A;  3GTG J;  3OR2 C;  1BIB A;  3KEQ A;  5BQT A;  1JTX A;  3VOE A;  3JRG A;  3DEE A;  5TJJ A;  3E6C C;  2X6X A;  1XSV A;  4UB8 C;  1YO5 C;  3ZQ7 A;  1OJL A;  2STW A;  1EJ9 A;  5LHH A;  2H09 A;  1XMX A;  2ICW G;  3VDX A;  4HDV A;  4L5E A;  3R61 A;  3OIQ A;  2DMN A;  1MNM C;  2HYJ A;  1SD7 A;  4JX5 A;  1MH3 A;  1X4P A;  4HOB A;  1J75 A;  3SEQ A;  1RI7 A;  2KL4 A;  4W97 A;  1NTC A;  2MA3 A;  3SZP A;  2QQB A;  3MZY A;  1GUU A;  4N9H A;  5L3F A;  4F91 B;  3IHU A;  2XV4 S;  4IX7 A;  1KYW A;  2KIQ A;  4A3D J;  1B9M A;  1W5S A;  1XMK A;  3ZPL A;  1BI3 A;  1OLT A;  4W1U A;  2B7E A;  1UST A;  2DFE A;  1Y39 A;  2JT1 A;  2FQ3 A;  1YYV A;  3KCC A;  1JTY A;  1W5T A;  4YII A;  1UJ8 A;  5JR3 A;  5EDN A;  5DM7 F;  1WKM A;  4U88 A;  4LB5 A;  3EUA A;  1BI1 A;  4EEF G;  2Q8K A;  3ABU A;  1OYY A;  4UVB A;  4BJ5 C;  2CQK A;  2D2W A;  1PYV A;  3GZ6 A;  5J4Y A;  3PFY A;  2IGK A;  3DFG A;  3H3U A;  3ZMD A;  4IQ4 A;  1KU9 A;  4I02 A;  1BM9 A;  2JTV A;  1MBF A;  1PJR A;  2K3P A;  3CJQ B;  3K0L A;  3KYC B;  4GFB A;  3D1N I;  4RGS A;  4ESF A;  3J81 K;  4DNC A;  4PJJ A;  4RAY A;  3SEZ A;  5F6F A;  1I3Q J;  2JVH A;  1YX5 A;  3BLY A;  1DP3 A;  3FK7 A;  4OIP F;  2CUE A;  2FBK A;  2PMZ A;  3HIF A;  3QPL A;  5L3E A;  1TNS A;  4OIN F;  1ZHF A;  3COA C;  2CYY A;  2EB7 A;  3REO A;  1R9T J;  1HBX G;  4Y7N J;  2V6E A;  1HSJ A;  4N4O B;  4I7H A;  4OAZ A;  2XAU A;  2YX4 A;  4ZDP A;  2ISZ A;  4PUS A;  1YW8 A;  1LFP A;  4WXH A;  1XS9 A;  1IG7 A;  4DYR A;  3N05 A;  4CCN A;  2P6T A;  1NH3 A;  1GLN A;  2JA7 J;  4GGG A;  4CDG A;  2MGQ A;  3ERM A;  1PUE E;  4DJA A;  1ODD A;  3FBN B;  3V7R A;  4HX8 A;  3JRD A;  3E3V A;  1H89 C;  1QQI A;  2CH0 A;  2COM A;  4EGY A;  4M73 A;  2KQR A;  4RA2 A;  3FHZ A;  1TWF J;  1UFM A;  3LSG A;  2BY2 A;  1A6Q A;  4CZZ A;  2M0M A;  2VE8 A;  3NAU A;  1VQK I;  4BU2 A;  5JHU A;  5J47 A;  2DOD A;  1R4M B;  4KT6 A;  2D5V A;  4YIR X;  4PCQ A;  1OCZ H;  1BI0 A;  4ZH4 F;  4KIT B;  1K7A A;  3LWF A;  1R5I D;  4PGG A;  1SFO J;  4LD5 A;  2ZJ2 A;  2RV8 A;  3H9G A;  3UNG C;  5L3G A;  5GTH C;  2EBI A;  5F08 A;  5FLX K;  1RRJ A;  1VND A;  5ED4 A;  1FOX A;  2L7F P;  2R3S A;  2QQA A;  2X48 A;  4II2 A;  2BXZ A;  2EA4 A;  4I0A A;  4OWR B;  2NNY A;  2PX9 A;  2VKH A;  1Z0X A;  5CLS A;  4XLE A;  4HAM A;  1QPI A;  1DP7 P;  1QHH D;  4OMZ A;  5LLQ A;  1B1B A;  3WTV C;  1FYL A;  3QPT A;  3M8J A;  3V7S A;  4IHT A;  1FLI A;  2R7Q A;  3H3Z A;  3WU1 B;  2O7O A;  1DU6 A;  2GLO A;  2LBF A;  2O03 A;  2Q2E A;  2R5Z B;  5DYM A;  4I01 A;  4BBS J;  2VKD A;  2Y9Z A;  2DA2 A;  2JUG A;  3QU3 A;  3C18 A;  3S32 A;  2XAQ A;  2L3D A;  2K27 A;  2L54 A;  3BTI A;  4AD9 A;  5EG0 A;  3F8M A;  2DFF A;  3RSN A;  4BEH B;  4XLP F;  4BAY A;  3VWB A;  1I39 A;  2FOK A;  1GV2 A;  1TW3 A;  3HPH A;  1B72 B;  1F43 A;  1TWA J;  5IP9 J;  4PSW A;  3GTL J;  2CRG A;  3DPU A;  3JAM K;  3UKG A;  2IEK A;  1R5G A;  1ORK A;  2ZSI B;  3PUB A;  1IUY A;  3F21 A;  1HDD C;  3PJR A;  2CSO A;  3GTJ J;  3KEO A;  1U0J A;  2RKH A;  1XPX A;  1U8B A;  2O0Y A;  1WFX A;  3JRE A;  1J59 A;  4XSZ F;  1KU2 A;  2VQL A;  1B8I A;  4HLY A;  4UNO A;  4XOR A;  2ZFU A;  2P5L C;  1EH6 A;  2DTZ A;  4AIJ A;  3LAJ A;  2MAB A;  4I98 B;  3EQL F;  3S1Q J;  2EPF A;  4RM3 A;  4A0X A;  3CCU I;  3HBL A;  4CYC B;  3K70 C;  3C1D A;  1JHH A;  2E19 A;  3RKW A;  1O4X A;  3JRH A;  3LQQ A;  1BOA A;  1LFB A;  2KJB A;  4N4N B;  3WHB A;  2MH2 A;  4XR6 A;  2Z33 A;  4L18 B;  3W2V A;  2D45 A;  3AL0 B;  1LE8 A;  2Z3Y A;  2OCC H;  5IYB J;  2ZBK A;  3ZMV A;  4KNY A;  1MH4 A;  4L5J A;  1M1E B;  2XGC A;  1DQU A;  5E1W A;  5D6E A;  3HHH A;  2JQ7 A;  2E34 A;  2RN7 A;  3AG2 H;  1VFC A;  1HQC A;  4HPQ A;  2G9W A;  3ZCO A;  1BJA A;  5IYC J;  4NC8 A;  3M3Y J;  4AC0 A;  3E1S A;  4ITV A;  2QBY B;  2H1L A;  1VQN I;  2CFX A;  2CW8 A;  1P4A A;  4KN7 X;  1UG2 A;  2FD5 A;  3HOV J;  1VQ6 I;  2BGC A;  2RNG A;  2Y9Y A;  4XSX F;  3GYH X;  3FX3 A;  2FBI A;  5JLX A;  3HOY J;  3E7L A;  4G6Q A;  2ZJP F;  4Q4Z F;  2XIG A;  4HNT A;  4XLH A;  2HOE A;  4ZYD A;  4Y33 A;  3WHC A;  2E7W A;  1ETY A;  2KIU A;  2DAO A;  4NQW A;  5D5V B;  4M9Z A;  2HOS A;  1S7A A;  1RNL A;  2K3F A;  3TO9 A;  4PJ0 C;  1WGX A;  5TIS C;  2MD0 A;  5BNG A;  4PFO A;  2X1D A;  1B72 A;  3W2A A;  2ESH A;  3BDD A;  1HXD A;  2JUC A;  1YW7 A;  3P9K A;  2R7F A;  3HTS B;  4L9T A;  1N25 A;  1IXS B;  1J09 A;  1E0E A;  1LEB A;  3P9C A;  3BR0 A;  1YJ9 I;  1XGM A;  2NVU B;  2Y30 A;  4EV0 A;  4WF2 A;  2DMU A;  1WZ2 A;  2RRE A;  4Y52 J;  4IJA A;  2K4B A;  2R7O A;  3GTM J;  1KA8 A;  2G0E A;  3AKZ A;  1T39 A;  4ZYG A;  3VSK A;  1IDY A;  4LIT A;  5ICG A;  2DO7 A;  1G2H A;  3IWZ A;  2K85 A;  1EH8 A;  2MD5 A;  2HQA A;  3G1L A;  3IC7 A;  3CQZ J;  2CGP A;  5HNH A;  1QVU A;  2P0W A;  2MC4 A;  5HNF A;  2L4M A;  3DBR B;  3CF5 F;  2B9S A;  1OCO H;  4B44 A;  1Z3Y A;  3TMO A;  4DYQ A;  2Y0M A;  1IN4 A;  2WY8 Q;  3GBG A;  2X1C A;  1K78 B;  4Y17 A;  2DOA A;  3MFK A;  3GTO J;  3WOD F;  1ZYR F;  1ZR4 A;  4G7Z F;  3J7A Y;  4B3X A;  4BQO A;  1V4R A;  3ZMZ A;  2DW4 A;  2EIL H;  1AWC A;  3K4L A;  1W36 D;  1UCR A;  4R79 A;  3DPL C;  3ROU A;  4M3B A;  1GHC A;  3A0H C;  1A6I A;  2VKE A;  2W85 A;  3LSR A;  2M7A A;  4CO8 A;  1FBU A;  5D5W B;  2DT7 B;  4ZZL A;  3S3O A;  2P7V B;  5J1Y A;  5HLT A;  4HF1 A;  4PK4 A;  1MND A;  1QGP A;  4BGD A;  3ZMS A;  1ETX A;  2PJR B;  1OCC H;  1I50 J;  5GAH J;  4CCO A;  1V3F A;  4V19 K;  3GTK J;  1HA8 A;  1QZE A;  3BZC A;  2L9V A;  2YUS A;  2CQX A;  3FMR A;  1MBH A;  5F64 A;  1QVT A;  2QM3 A;  2QQ8 A;  1XG1 A;  5EEH A;  3FMS A;  3T8T A;  4FT8 A;  5FD6 A;  5FKN A;  3FKJ A;  3EUK L;  4HSR A;  1Y0N A;  2CV2 A;  2A69 F;  1I1S A;  4XIC A;  1D0X A;  4RBO A;  1HW2 A;  3V8J A;  1VQ9 I;  3IH3 A;  3K2A A;  2O3F A;  3CF2 A;  3GXO A;  3OYE A;  2ACJ A;  1A5J A;  2W7N A;  1B59 A;  3SDB A;  2XSJ C;  2DFI A;  1S8N A;  5E18 F;  4FTH A;  5ICF A;  1BR1 A;  3VB2 A;  4M6Y A;  3E5X A;  2QSH X;  2ELH A;  1Z1D A;  3BJO A;  4HBL A;  2A5W A;  2FU4 A;  3ZN1 A;  4C2T A;  5LD2 C;  4IOC F;  4A3F J;  2OV7 A;  5DCM A;  1YIO A;  4E7L A;  2L9S A;  4NBQ A;  1S72 I;  3PNV A;  1USS A;  4MEX F;  1YRN B;  1EKE A;  2HR3 A;  1Z6R A;  1H8A C;  2DBB A;  1D3Y A;  2D1V A;  1LPQ A;  5IT9 K;  4P5O A;  3KET A;  1RPW A;  5F0F A;  1LDJ A;  1SVL A;  1ZAO A;  2YX7 A;  1W36 C;  4N0B A;  2MLK A;  1FTZ A;  2KKO A;  3I71 A;  1FSE A;  1D5Y A;  2BHY A;  2NAZ A;  4IXA A;  4D5C A;  2O8X A;  5ICE A;  4ENM A;  4C9Y A;  3CCV I;  2J5P A;  3PSF A;  4GRI A;  1Y1V J;  3I55 I;  3H0D A;  1BIA A;  2RAE A;  1D0Z A;  2BY3 A;  4LLL A;  3OS1 A;  2B0L A;  1AKH A;  3CC2 I;  3MN2 A;  5CVR A;  2LFB A;  1GT0 C;  1DDN A;  3TO7 A;  3MEX A;  4Q47 A;  3CLQ A;  1JGS A;  3JSO A;  2VXD A;  1XD7 A;  5M3F J;  5F0C A;  1XGS A;  1V5E A;  3DKW A;  3WTX C;  5D8L B;  2QF7 A;  5DM6 F;  4D1Q A;  3MKZ A;  2FOW A;  3EPZ A;  3PUF A;  3G3Z A;  2LKX A;  5L3C A;  1WJC A;  2HKX A;  4IF4 A; 
#chains in the Genus database with same CATH homology
 1P4W A;  3KFW X;  3J80 K;  3DF8 A;  2HYF A;  4PZJ A;  2EV6 A;  4LG0 A;  5K5O A;  2QYO A;  2FA5 A;  3HRM A;  2PJP A;  1FWZ A;  3FZV A;  5HVQ C;  2WV0 A;  2ADU A;  3GO5 A;  4EM2 A;  3E6M A;  3I59 A;  3FWE A;  1IW7 F;  3BJ6 A;  3HUG A;  1XDS A;  4F7Z A;  4S04 A;  2PFB A;  4ESJ A;  3R0J A;  1D8K A;  3GUD A;  3L00 A;  2DK8 A;  1SFE A;  1KU7 A;  4G9Y A;  2GA1 A;  4ENN A;  3RIR A;  2LF7 A;  2OAZ A;  4TV7 A;  2IJL A;  2HYG D;  3MWM A;  1DUX C;  1LEA A;  3ISP A;  4UV9 A;  2P5K A;  4P9U A;  4G7H F;  4AIH A;  4YG2 F;  3SZT A;  3DEU A;  4JK1 X;  4B8X A;  3U9G A;  2L4A A;  4UV8 A;  1IAW A;  2V79 A;  5ERI A;  2HQR A;  3HTU A;  1MZB A;  3O3K A;  4K2E A;  1TLH B;  3P9I A;  1QZZ A;  3ERE D;  2XGX A;  5AIQ A;  2PI0 A;  3F6V A;  3ABT A;  2IT0 A;  1FBS A;  4ZYE A;  2BEO A;  1U78 A;  4UVA A;  1U5T A;  3EET A;  1I5Z A;  1SAX A;  4LMY A;  2Y48 A;  3GVA A;  2PN6 A;  3RKY A;  3GWZ A;  2P5V A;  3K2Z A;  3L9F A;  4UUV A;  4WXD A;  3F22 A;  1XN7 A;  5JI6 A;  4ZYH A;  3TKY A;  1A04 A;  1MDM B;  4HQE A;  3RYP A;  4A0Y A;  1CGP A;  2Y75 A;  4RAZ A;  1FY7 A;  2X4H A;  4XRF A;  1LDD A;  3RKX A;  1ZRD A;  1JXS A;  1YFH A;  2DK5 A;  2ZME B;  2F5E A;  1MJA A;  5FFZ A;  5FD5 A;  3L09 A;  4RB2 C;  4OU0 A;  2W25 A;  2FRH A;  3F72 A;  5HS8 A;  2BBY A;  4A6E A;  1LVA A;  2M8E A;  4JQF A;  2PEX A;  3WTY C;  4KYW A;  1P4X A;  4M6X A;  3B73 A;  4EJO A;  4FX4 A;  2FNA A;  4N9I A;  1W7P A;  3BOQ A;  5LHG A;  3WGI A;  5FGM A;  2DT5 A;  1ZG1 A;  2KIF A;  4M72 A;  3ZMU A;  4WK8 F;  3FF5 A;  1F1Z A;  4UVC A;  5LGU A;  2EFW A;  3B02 A;  1SMT A;  2DU9 A;  1QO0 D;  2RDP A;  5BS6 A;  2F5D A;  1SFX A;  4HW0 A;  4CGZ A;  1U5T C;  1KYZ A;  2EFO A;  1Z6T A;  1IRF A;  2QUF A;  1U8R A;  3ECO A;  1W7P D;  1ONV A;  2RGV A;  1UB9 A;  4A12 A;  2ZME A;  2PBI A;  1HW5 A;  4O5V A;  1ZG3 A;  4A5M A;  1IXR C;  1P6R A;  2V6C A;  1JHF A;  4LK1 F;  3WE3 A;  3M1E A;  1EV7 A;  2VC0 A;  2IPQ X;  2LDU A;  3KP2 A;  4JBA A;  4IRG A;  3TDZ C;  1H0M A;  1ULY A;  3R60 A;  4UHT A;  1WRJ A;  1TQI A;  3DQV C;  2VE9 A;  5DD8 A;  3ULQ B;  3C7J A;  3N97 A;  2DLL A;  5FFX A;  4ASN A;  2L01 A;  4ON0 A;  2V9V A;  1R5H A;  2LF8 A;  3KLN A;  4RS8 A;  1J9I A;  2VOO A;  2OBP A;  3F23 A;  3F6O A;  1PP7 U;  4HX4 A;  3DXJ F;  5FLX Z;  1CF7 B;  4GXO A;  1RZ4 A;  3I54 A;  1R1U A;  4KIF A;  3GLX A;  4MGR A;  4U7D A;  3U1D A;  2A6E F;  4BYY A;  2CWE A;  2R7D A;  2UXX A;  1R36 A;  2ZXJ A;  3WU0 A;  3FXQ A;  3J7A O;  2PMU A;  4MQV A;  4S05 A;  2PMH A;  2HQN A;  1ZG5 A;  3CJN A;  2VN2 A;  2BV6 A;  3M7G A;  1K6O A;  3D5L A;  4RB3 C;  1XMA A;  1YTY A;  1SMY F;  2MBF A;  3JAM Z;  4IRI A;  1T6S A;  2CG4 A;  2ZCW A;  3R6S A;  1G3T A;  2QLZ A;  4BH9 A;  1R00 A;  1FNN A;  3TGN A;  3HRT A;  1XGO A;  3CUO A;  3OV8 A;  1O7L A;  3TO6 A;  5E8G A;  4ESB A;  1X3U A;  4EJV A;  2GWR A;  4IVN A;  4BHB A;  5AON A;  2K02 A;  2WC2 A;  2YU3 A;  1F9N A;  2PLY A;  2EFQ A;  2VOD A;  5E20 A;  2XAJ A;  2XUB A;  2H6B A;  1TW2 A;  2FSW A;  1FYM A;  4G8X A;  4I09 A;  5HOO A;  2TDX A;  1HW1 A;  1U2W A;  5F1R A;  2ZNZ A;  2VT3 A;  2GXG A;  4RGX A;  1J2X A;  3CDH A;  2V1D A;  3CUQ B;  3KP3 A;  3KP4 A;  3WTZ A;  2EV0 A;  1STZ A;  3HOS A;  1IN5 A;  1S6L A;  2EA2 A;  3EYI A;  2K86 A;  3D0S A;  4HV5 A;  1B6A A;  3EUH A;  4KN4 X;  3GFJ A;  1SFU A;  3ML6 A;  2M87 A;  4M9X A;  4BXU A;  3I53 A;  3BY6 A;  2QEN A;  1U6G A;  2QQ9 A;  2UWM A;  3HSR A;  1IN7 A;  1KQ0 A;  4ENJ A;  1GXQ A;  2QBY A;  1E2X A;  1SD6 A;  2H27 A;  5E1Z B;  2D1H A;  2FEZ A;  5HDN A;  3S2W A;  5FB2 A;  1PDN C;  5CYV A;  5LRS A;  3C3W A;  1KU3 A;  3CO7 C;  3K69 A;  5HDK A;  1ZRE A;  3IL2 A;  5AIP A;  4HF0 A;  4ENK A;  3GEZ A;  2AS5 F;  2DI3 A;  2P6S A;  3NEU A;  1FZP B;  1B9N A;  5H6Q A;  2GA2 A;  1ZGJ A;  2RC4 A;  5H20 A;  4M74 A;  3M8F A;  4Z2Y A;  4O3M A;  3ELK A;  1HKQ A;  3L7W A;  3LAP A;  3KZZ A;  3T5X A;  3IKV A;  3NRV A;  1D8J A;  2FNP A;  1K78 A;  1OMI A;  5LGN A;  2NYX A;  3KP5 A;  4NB5 A;  2FE3 A;  4R8H A;  3U2R A;  5HLH A;  1Z7U A;  1O3Q A;  2DQR A;  2XVC A;  4WCG A;  4G6D A;  1YS6 A;  2IA0 A;  2RNJ A;  3V8K A;  2BYV E;  3MAJ A;  2E7X A;  4KA4 A;  1ZGA A;  3JTH A;  4KFC A;  4XBF A;  4MTE A;  4P9F A;  5CVJ A;  3PQK A;  1OPC A;  1R58 A;  2FXA A;  2JPB A;  3F8B A;  4AIK A;  3IWF A;  4H0E A;  3MZH A;  2ZFW A;  3NQO A;  4KIB A;  3K1N A;  3G73 A;  3O2P E;  3I0T A;  3LFK A;  2VON A;  1UHW A;  3TDU C;  5JFR A;  4BHC A;  2VXZ A;  3W6K B;  5LEJ A;  4MQ9 F;  5IT9 Z;  3QP6 A;  5D4R A;  4BQA A;  5J8F A;  1KQ8 A;  5J6X A;  4U0V A;  3HSE A;  1P2F A;  3BPX A;  2XAH A;  1J5Y A;  2HGC A;  2F5F A;  3VOD A;  2QZ8 A;  1G3S A;  2VC1 A;  4Y15 A;  3DP7 A;  4BHP A;  2GIV A;  1FSH A;  4KIC A;  6PAX A;  5K1Y A;  4EJT A;  1XCV A;  4B09 A;  2WWY A;  3GF2 A;  3QRF F;  5HS9 A;  4FX0 A;  4E70 A;  2HEO A;  3JSP A;  3FM3 A;  1DPU A;  3BPV A;  5BMZ A;  1IF1 A;  3GZ5 A;  1RUN A;  3J80 Z;  2JSC A;  2IP2 A;  2Q0O A;  3LA2 A;  2A68 F;  4IHS A;  4AVP A;  1BC8 C;  2STT A;  2EV5 A;  1I27 A;  2LKP A;  3RYR A;  2XRN A;  3KZY A;  2EWN A;  4Q48 A;  2A6H F;  2XKO A;  4YFK F;  5ILU A;  2L02 A;  3BZ6 A;  2DQL A;  3K1P A;  4MHG A;  1LJ9 A;  4KMU X;  2J5O A;  3GW2 A;  5D8K B;  5A2Q K;  3T1B A;  3O6B B;  4GYG A;  3HOT A;  5FO5 A;  1R22 A;  3F8N A;  2GQQ A;  1MGT A;  5H6R A;  1ZRC A;  1O7F A;  4HYE A;  3LA7 A;  4MNU A;  2QVO A;  1XSD A;  4HLX A;  4HQM A;  3WG9 A;  5D4S A;  2CW0 F;  2HKO A;  5BPD A;  2QWW A;  4A2U A;  5LGT A;  2CO5 A;  2DPU A;  1T0F A;  5KVR A;  2HDC A;  2X0L A;  1TQM A;  4HF2 A;  5LEK A;  1FT9 A;  4OIR F;  2XAG A;  3T0Y A;  1L3L A;  2UXN A;  1ON1 A;  4IRH A;  3CLO A;  1WWX A;  4CXF A;  5K5Q A;  1QBJ A;  3QU6 A;  4UXN A;  1OR7 A;  4WXC A;  4D0P A;  4ETS A;  3WGH A;  5DUI A;  4HDU A;  3TOA A;  1IN8 A;  5D6F A;  3M9A A;  2ISY A;  4EJU A;  3BWG A;  4KMF A;  1T2K A;  4M9S A;  1YG2 A;  3LA3 A;  1OKR A;  2IA1 A;  3N4M A;  2MC3 A;  3FXU A;  2OA4 A;  4EGZ A;  4OMY A;  1LQ1 A;  1T98 A;  1C0W A;  2C6Y A;  3KP7 A;  5D5U B;  3Q5F A;  3Q9V A;  3FXR A;  4GO1 A;  2LNB A;  1O3S A;  3IKT A;  1UHM A;  1LB2 A;  1JE8 A;  1S3J A;  5LHI A;  2VBZ A;  3SHF A;  4BNC A;  2XRO A;  4G94 A;  2VOP A;  4ZZD A;  5CVV A;  4MEY F;  3PFI A;  1FP2 A;  1LNW A;  1Z91 A;  3E5Q A;  4EMS A;  3CO6 C;  2W57 A;  2IW5 A;  3HSF A;  2DPD A;  5DUK A;  1IXC A;  2BE5 F;  4OOI A;  3ECH A;  5E1X A;  2EJR A;  4U7B A;  3DV8 A;  2YR2 A;  4RGU A;  1MJB A;  3EDP A;  1MDM A;  2M5W A;  3KP6 A;  3J81 Z;  1Y0U A;  2F5C A;  3F8F A;  3WGG A;  3RI4 A;  2GXB A;  5CVI A;  3V7C A;  1QZY A;  3GFI A;  5CJ9 A;  2UZK A;  4EM0 B;  2F2E A;  1KQ9 A;  1BBY A;  3LQR A;  2GAU A;  1IZ1 A;  4FHT A;  1FBQ A;  3WTW C;  1KGS A;  3BP8 A;  2A61 A;  3V8L A;  4P55 A;  3M8E A;  3MCZ A;  3W6J B;  5HLG A;  1NHA A;  1H9T A;  1XCB A;  1ZH5 A;  5HS7 A;  2XKP A;  3MQ0 A;  3HRS A;  4GCV A;  4P96 A;  1HST A;  2GZW A;  2E1N A;  4KT5 C;  3K9T A;  4AWX B;  1J7K A;  1ZRF A;  1MD0 A;  4L9N A;  3QP5 A;  5DV5 A;  1T38 A;  4CIC A;  2P7C B;  4EJW A;  5K5R A;  5E8I A;  3PQJ A;  1S7O A;  1BI2 A;  4IPA A;  4R1H A;  4A5N A;  2A3S A;  4G7O F;  1YW9 A;  4DQ2 A;  4L9J A;  3RTR A;  1G4D A;  1IRG A;  3QOP A;  2Z9O A;  1I1G A;  5BPI A;  3TQN A;  2YPR A;  1TTY A;  4L0Y B;  1FOK A;  4RB0 A;  5ILV A;  2JPC A;  2OZ6 A;  1GXP A;  1E17 A;  2ZKZ A;  2NS0 A;  3IRR A;  3ZP5 A;  2HWV A;  2OD5 A;  4YFN F;  3KLO A;  2OU2 A;  4XLN F;  3I58 A;  5ICC A;  3FM5 A;  1FC3 A;  3HYI A;  2EK5 A;  4QLC U;  1Z05 A;  4HA8 A;  2G7H A;  3TOB A;  2JZY A;  2M1B A;  1IN6 A;  2FML A;  4KIG A;  1HKS A;  1Z9C A;  2K4J A;  4L5I A;  3WTT C;  4HV6 A;  1YQA A;  2VBW A;  3LST A;  1PP8 F;  1DPR A;  1CF7 A;  2ZNY A;  2RVC A;  3DPT A;  5DCF A;  4LB6 B;  5HDG A;  2A5Y B;  2WTE A;  3E6B A;  3WTS C;  5L3B A;  1L0O C;  1XB4 A;  3AAF A;  2FF4 A;  2HS5 A;  2HZT A;  2G7U A;  5LRR A;  1MJ9 A;  2M30 A;  5DCM B;  5L3D A;  2HTJ A;  3SXY A;  4PDK A;  2H94 A;  3WE2 A;  3KE2 A;  3T8R A;  3ZN0 A;  1FP1 D;  5ILS A;  1RIO H;  4LJZ F;  4A0Z A;  4LK0 F;  1XSX A;  5JVT A;  3RPU A;  4I2O A;  3L2C A;  1D5V A;  3I64 A;  4Q5S F;  1VTN C;  2H6C A;  4HZF A;  4LLG F;  1WI9 A;  3CTA A;  1FYK A;  3BJA A;  1U3E M;  1J0R A;  1S29 A;  3K1M A;  4KDP A;  3SQN A;  1Q1H A;  1G6N A;  2HTS A;  3E6D A;  1R1T A;  5CVU A;  4LLN A;  2NRA C;  3BRO A;  4PGH A;  1I6X A;  1EH7 A;  1ZLJ A;  4LG0 B;  5TRD A;  4I0B A;  2V1X A;  3CUQ A;  1YS7 A;  3V4G A;  1ZLK A;  4M71 A;  1FX7 A;  1REP C;  5KK1 A;  1G3W A;  3I59 B;  2EFN A;  5DDG A;  2Z99 A;  3R0A A;  1AOY A;  1F4K A;  4U0Y A;  4YFX F;  1R7J A;  2PQ8 A;  2XAS A;  2W24 A;  4LGW A;  3E97 A;  3RDI A;  4EM1 A;  3E5U A;  4A6D A;  4YIF A;  1OYW A;  2IRF G;  2E1C A;  2O61 A;  1R1V A;  5LBQ A;  1YLF A;  1SD5 A;  3FMQ A;  2IA2 A;  2FBH A;  3GFM A;  2PG4 A;  3HHG A;  1XDU A;  2K7L A;  4RB1 A;  4OIO F;  2M45 A;  1RUO A;  2XAF A;  3IRQ A;  3QPH A;  5DD4 A;  4MTD A;  4QWQ A;  3JW4 A;  2NNN A;  1LDK B;  1W4M A;  5BOX A;  2AXL A;  4KUM A;  2XHK A;  1XGN A;  2OQR A;  1WQ2 A;  1O3T A;  2YSR A;  1MKM A;  2Z5U A;  2RQP A;  3R4K A;  4RGR A;  4L0Z B;  5EEG A;  5E17 F;  1H9G A;  1O3R A;  1R23 A;  4EQQ A;  1SD4 A;  2IVM A;  5HLI A;  3EYY A;  5D5X B;  2A07 F;  1ZN2 A;  3WTU C;  1U5T B;  1HKT A;  1OYI A;  2P8T A;  2HFH A;  5J8C A;  1BC7 C;  1QNT A;  3VEP A;  2KJC A;  5IT3 A;  2MLG A;  3I4P A;  4GYI A;  1ON2 A;  3P7N A;  2ETH A;  3GFL A;  3F3X A;  4LFU A;  2FMY A;  1P92 A;  3H92 A;  4EVI A;  4CYD A;  3CUQ C;  1ZAR A;  2VBX A;  2MH9 A;  1G3Y A;  3OOP A;  1QPM A;  1B4A A;  1FPQ A;  4WWC A;  2ZO4 A;  1TQP A;  3GX4 X;  3Q9S A;  4NHJ A;  1BN5 A;  3ZMT A;  4L9V A;  1TNT A;  2VT2 A;  1GVJ A;  3JTG A;  4HX7 A;  2OZU A;  4CHU A;  2O6G E;  3RJP A;  2DTR A;  4WX9 A;  2ESN A;  2EFP A;  1K79 A;  3F8C A;  2W84 A;  2KIM A;  1TBX A;  3VFZ A;  3HRU A;  2KRF A;  5DEQ A;  2V1U A;  1O57 A;  3I5U A;  3QAH A;  2OQG A;  2VBY A;  4U0W A;  1F5T A;  1WSU A;  1W7P B;  4OIQ F;  2P4W A;  2JRT A;  3RPQ A;  4O6J A;  3SFZ A;  5A2Q Z;  2LSO A;  1BIB A;  3KEQ A;  5BQT A;  3VOE A;  5TJJ A;  3E6C C;  1XSV A;  1YO5 C;  3ZQ7 A;  2STW A;  5LHH A;  2H09 A;  4HDV A;  3R61 A;  1SD7 A;  4HOB A;  1J75 A;  1RI7 A;  2MA3 A;  3SZP A;  2QQB A;  3MZY A;  4N9H A;  5L3F A;  3IHU A;  2XV4 S;  1KYW A;  1B9M A;  1W5S A;  1XMK A;  3ZPL A;  1BI3 A;  1UST A;  2JT1 A;  2FQ3 A;  1YYV A;  3KCC A;  1W5T A;  4YII A;  5JR3 A;  1WKM A;  4U88 A;  4LB5 A;  1BI1 A;  2Q8K A;  3ABU A;  1OYY A;  4UVB A;  2CQK A;  2D2W A;  3GZ6 A;  3DFG A;  3H3U A;  3ZMD A;  1KU9 A;  4I02 A;  1BM9 A;  2JTV A;  3K0L A;  4RGS A;  4ESF A;  3J81 K;  4DNC A;  4RAY A;  5F6F A;  4OIP F;  2FBK A;  5L3E A;  3HIF A;  1TNS A;  4OIN F;  1ZHF A;  3COA C;  2CYY A;  2EB7 A;  3REO A;  1HBX G;  1HSJ A;  4I7H A;  2ISZ A;  2YX4 A;  1YW8 A;  4WXH A;  2P6T A;  4GGG A;  4CDG A;  1PUE E;  1ODD A;  3V7R A;  4HX8 A;  3E3V A;  1QQI A;  2COM A;  4EGY A;  4M73 A;  3FHZ A;  1UFM A;  4CZZ A;  2VE8 A;  5JHU A;  4PCQ A;  1BI0 A;  4ZH4 F;  1K7A A;  3LWF A;  4PGG A;  4LD5 A;  2ZJ2 A;  2RV8 A;  5L3G A;  5FLX K;  5ED4 A;  2R3S A;  2QQA A;  2EA4 A;  4I0A A;  2NNY A;  5CLS A;  4HAM A;  1DP7 P;  4OMZ A;  5LLQ A;  1B1B A;  3WTV C;  1FYL A;  3QPT A;  3V7S A;  4IHT A;  1FLI A;  3H3Z A;  3WU1 B;  2O03 A;  2Q2E A;  5DYM A;  4I01 A;  3QU3 A;  3C18 A;  2XAQ A;  2L3D A;  2K27 A;  2L54 A;  4AD9 A;  3F8M A;  4XLP F;  4BAY A;  2FOK A;  1TW3 A;  3JAM K;  1R5G A;  1IUY A;  3F21 A;  2CSO A;  3KEO A;  2RKH A;  2O0Y A;  1J59 A;  4XSZ F;  1KU2 A;  4HLY A;  4UNO A;  2P5L C;  1EH6 A;  4AIJ A;  3LAJ A;  4I98 B;  3EQL F;  4A0X A;  3C1D A;  1JHH A;  3RKW A;  3LQQ A;  1BOA A;  2KJB A;  2MH2 A;  4L18 B;  2Z33 A;  2D45 A;  2Z3Y A;  2ZBK A;  3ZMV A;  4KNY A;  4L5J A;  5E1W A;  5D6E A;  3HHH A;  2RN7 A;  1HQC A;  2G9W A;  1BJA A;  2QBY B;  2CFX A;  1P4A A;  4KN7 X;  2BGC A;  4XSX F;  3GYH X;  3FX3 A;  2FBI A;  4G6Q A;  4Q4Z F;  2XIG A;  2HOE A;  4ZYD A;  2E7W A;  2KIU A;  2DAO A;  4NQW A;  5D5V B;  4M9Z A;  1S7A A;  1RNL A;  3TO9 A;  2ESH A;  3BDD A;  1HXD A;  1YW7 A;  3P9K A;  2R7F A;  3HTS B;  4L9T A;  4IF4 A;  1IXS B;  1LEB A;  3P9C A;  1XGM A;  4EV0 A;  4WF2 A;  4IJA A;  2K4B A;  1KA8 A;  1T39 A;  4ZYG A;  5ICG A;  2DO7 A;  3IWZ A;  1EH8 A;  2MD5 A;  3IC7 A;  2CGP A;  2L4M A;  2Y0M A;  1IN4 A;  1K78 B;  4Y17 A;  3MFK A;  3WOD F;  1ZYR F;  4G7Z F;  1V4R A;  3ZMZ A;  2DW4 A;  1AWC A;  1UCR A;  4R79 A;  3DPL C;  3ROU A;  1GHC A;  2W85 A;  4CO8 A;  1FBU A;  5D5W B;  4ZZL A;  2P7V B;  4HF1 A;  1QGP A;  3ZMS A;  1V3F A;  3FMR A;  5F64 A;  2QM3 A;  5EEH A;  3FMS A;  3T8T A;  4FT8 A;  5FD6 A;  2A69 F;  1I1S A;  1HW2 A;  3V8J A;  2O3F A;  3GXO A;  2ACJ A;  1B59 A;  2DFI A;  1S8N A;  5E18 F;  5ICF A;  3VB2 A;  4M6Y A;  3E5X A;  2ELH A;  1Z1D A;  3BJO A;  4HBL A;  2FU4 A;  3ZN1 A;  5DCM A;  1YIO A;  1USS A;  4MEX F;  2HR3 A;  1Z6R A;  2DBB A;  1D3Y A;  2D1V A;  5IT9 K;  4P5O A;  3KET A;  1LDJ A;  1ZAO A;  2YX7 A;  4N0B A;  2MLK A;  2KKO A;  3I71 A;  1FSE A;  2NAZ A;  4IXA A;  2O8X A;  5ICE A;  4ENM A;  2J5P A;  1BIA A;  4LLL A;  2B0L A;  5CVR A;  1DDN A;  3TO7 A;  3MEX A;  4Q47 A;  3JSO A;  1JGS A;  1XD7 A;  1XGS A;  3DKW A;  3WTX C;  5D8L B;  3G3Z A;  5L3C A;  2HKX A;  4Y13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...