4ON0A

Crystal structure of nolr from sinorhizobium fredii in complex with oligo aa dna
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
97
structure length
97
Chain Sequence
QPLSPEKHEEAEIAAGFLSAMANPKRLLILDSLVKEEMAVGALANKVGLSQSALSQHLSKLRAQNLVSTRRDAQTIYYSSSSDSVMKILGALSEIYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NolR
publication title Structural basis for regulation of rhizobial nodulation and symbiosis gene expression by the regulatory protein NolR.
pubmed doi rcsb
source organism Sinorhizobium fredii
molecule tags Transcription/dna
total genus 31
structure length 97
sequence length 97
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4on0A00
2GA1A 5H20A 3QOPA 4U0YA 3TGNA 5D4RA 3HHGA 1LDKB 1U2WA 4IHTA 3GZ6A 1WRJA 5KVRA 2LNBA 3KP2A 3J7AO 3KP4A 5FLXK 2DT5A 1T6SA 2Q0OA 1P4XA 2NYXA 4ETSA 3F6VA 2DO7A 5FFZA 1FP1D 1W7PB 3F72A 4N9HA 4O6JA 1FP2A 3GO5A 1DP7P 3KZZA 2EWNA 2L02A 4GCVA 4EGZA 3BPVA 3T8RA 2FF4A 5D5UB 1J0RA 1YQAA 5EEHA 1FY7A 1KU3A 1BC7C 5A2QZ 1RI7A 2QQAA 4KICA 3ISPA 1V4RA 2QVOA 2XAQA 1LB2A 1XDSA 2O3FA 3NRVA 2YX4A 5DYMA 1KYWA 4YG2F 2A3SA 2YPRA 1IXRC 1R58A 4P5OA 3GYHX 3KP6A 5FB2A 2H6BA 3WODF 1U6GA 4WWCA 3TOBA 1B59A 1F5TA 1MDMA 2E7XA 3ZMTA 5BQTA 5LLQA 3K1NA 5LEKA 1S7OA 1U3EM 3I53A 4RGXA 4OU0A 1YG2A 2Y48A 5CYVA 3ROUA 3W6KB 5LEJA 1QBJA 3J81Z 3HOTA 4XRFA 2P4WA 3KEOA 5LGNA 4L18B 3H3UA 3FHZA 3FMRA 2HZTA 4PCQA 1Q1HA 2DQLA 3ECOA 5ICFA 4EM2A 4HX8A 1IXSB 5LGTA 2COMA 1Z6TA 2BBYA 3IKTA 2XVCA 4HDVA 1ZREA 4I02A 5IT9K 4M71A 2IA2A 3KETA 2FOKA 3MAJA 1R5GA 2XASA 4KMUX 2V1DA 4CYDA 2CW0F 2ZCWA 5EEGA 3QAHA 3L2CA 3WTTC 5ICEA 2ZMEB 2K86A 1D5VA 3HHHA 3HRSA 2FRHA 1W4MA 3CTAA 5BPDA 3CO7C 5ED4A 4CXFA 3T8TA 3IL2A 4ASNA 4OIOF 4LMYA 2A68F 2IW5A 3OV8A 2V1XA 1YLFA 3RKYA 2HR3A 5K1YA 2LF7A 1ZLKA 5L3BA 3TKYA 2QLZA 4EJWA 1Z9CA 3B02A 3NEUA 2UZKA 2EFPA 3C1DA 2ZKZA 4RAYA 2ZJ2A 4G7HF 1ZRFA 4EMSA 4FT8A 2DLLA 4MHGA 1AOYA 3DKWA 4YIFA 4ZYGA 3Q9SA 1HXDA 4U88A 1XGNA 4U0VA 2PI0A 1UFMA 1XSDA 3KFWX 4U7DA 1R1TA 5CJ9A 1BI1A 2EFOA 1T39A 2RQPA 2OAZA 1SD5A 1V3FA 4R79A 4M72A 4I7HA 4HLXA 2M87A 1FLIA 4HZFA 1S3JA 3I59A 3IWZA 3E6MA 3Q9VA 4IF4A 3GUDA 2PBIA 2DW4A 3JW4A 2EV0A 4I2OA 5ERIA 5DEQA 1ZAOA 2NNNA 5IT3A 3KE2A 4EJVA 1U5TB 3S2WA 3F8CA 4B09A 2P8TA 1GVJA 2XRNA 2PN6A 4H0EA 4GXOA 1U8RA 1W5TA 2EV5A 2RVCA 3DPTA 5AONA 5HLHA 1CF7A 4K2EA 2FBIA 3HTSB 2UWMA 4Q47A 4L0ZB 3DEUA 3HIFA 3DF8A 1JE8A 1HSJA 1FWZA 2P5KA 2L4MA 4YIIA 1IN5A 3M8FA 1RUOA 3E6DA 1SMYF 1RZ4A 5DCFA 2JSCA 2VN2A 1MDMB 4RAZA 3WG9A 4IRGA 2XAJA 5JHUA 3I4PA 3PQJA 2JT1A 1R23A 1XSVA 4U0WA 2O8XA 2R7FA 1J75A 3DP7A 1TBXA 2DFIA 3V4GA 3VB2A 1X3UA 2YU3A 3QP5A 3E5UA 4AWXB 4YFNF 5LHIA 1K78A 1P92A 5CVIA 1XCVA 1KU7A 5FD5A 3FXRA 3TO6A 1SFUA 4P9FA 3K0LA 4XLPF 3OOPA 4A6EA 5TRDA 3HRUA 1XSXA 3H3ZA 4U7BA 3N4MA 5DV5A 1BJAA 1ZHFA 3P9CA 3ERED 2HYFA 4M6YA 1Y0UA 3LA2A 2DK5A 3TO7A 2D45A 4BHCA 3ZPLA 4HX4A 4BHBA 1LEBA 2A6EF 5ICCA 2PMUA 5H6QA 1R22A 2HS5A 1YYVA 3FM3A 3GFJA 2O6GE 1FBSA 1SFXA 2Y75A 3CUQA 4G7OF 1FOKA 4RGRA 1SMTA 2KKOA 2Z33A 3K1PA 3VODA 1KA8A 5ICGA 3M9AA 4XLNF 2GQQA 3CO6C 3FXUA 2PJPA 1WSUA 2FMYA 2PG4A 4HF0A 1IW7F 5ILSA 3E3VA 3ZMUA 2DQRA 1XGMA 3V8JA 1TNSA 4AIJA 2OU2A 5CVUA 4JBAA 2PLYA 3SFZA 4JK1X 4LK0F 3FWEA 5LHHA 4M74A 4NHJA 1ON2A 2J5OA 1ZRDA 1P6RA 1IF1A 1VTNC 3DQVC 2GAUA 4FHTA 1MJBA 4L9VA 1OPCA 5CLSA 2FXAA 4UHTA 1TNTA 4HQMA 3Q5FA 2HQRA 1XB4A 2GA2A 1O7FA 1W7PD 3TDUC 1ZG1A 2GZWA 3R0JA 3E5QA 2DPUA 3HYIA 4PZJA 3I59B 2HDCA 1USTA 4RB2C 4QWQA 4B8XA 3ML6A 1BI3A 3K2ZA 2PEXA 1I1SA 4CDGA 2YR2A 3HSEA 4A0YA 2K27A 4ENMA 2R7DA 2M30A 5FD6A 2YSRA 4BAYA 2STWA 2CQKA 2XV4S 4A5NA 1JGSA 3SXYA 3MFKA 5DDGA 2WTEA 1USSA 4UV8A 4EM1A 4AIKA 3CJNA 3RYPA 4EQQA 5ILUA 4XSZF 2GXBA 1EV7A 2VXZA 1T2KA 2P5LC 5LGUA 2J5PA 4ZYHA 4ZZLA 2NNYA 2QZ8A 1S6LA 2FU4A 1F1ZA 4WK8F 3HRMA 4GO1A 4UUVA 3I58A 2NAZA 2L01A 3SZPA 2V1UA 1K78B 1KU2A 3KLNA 2G7HA 1TQPA 5A2QK 5J8CA 2ELHA 2JZYA 1IN4A 4EVIA 2W84A 3K69A 5K5OA 3P7NA 4F7ZA 3LSTA 2ESNA 5JVTA 1FX7A 2GIVA 3F8FA 1YS6A 2ZO4A 4GGGA 2OQGA 5F64A 3RI4A 3PQKA 3RPQA 2L3DA 1B9NA 1BOAA 3DXJF 3HOSA 3QU6A 2KJBA 3LAJA 1O3RA 1ZYRF 2RV8A 4Q48A 4MQVA 3CUQB 2FBKA 2QWWA 3FM5A 1WI9A 2VC0A 3I71A 4LB6B 4KN7X 5LRRA 1IN8A 3IKVA 1G3SA 3J81K 2DBBA 5BS6A 5HDGA 1GHCA 1BI0A 4BQAA 3KLOA 1FBUA 2VBXA 1KQ8A 4MEXF 4N9IA 3LAPA 2DAOA 2HWVA 2O0YA 3I0TA 3TO9A 4IRHA 4WXDA 5HS8A 3L9FA 1B1BA 2Z3YA 5CVVA 1TLHB 2ISYA 2P7CB 1DDNA 2CFXA 1MZBA 3O6BB 2F5DA 2QBYB 1H0MA 2HKOA 5E1WA 4G8XA 2KIMA 2RN7A 2QUFA 2RGVA 2YX7A 2P5VA 3BDDA 1YFHA 3QP6A 2HYGD 5D5XB 2ACJA 5DUIA 2GWRA 4DNCA 3ABUA 3E97A 2NRAC 4ESBA 5K5RA 2STTA 2HTSA 4LGWA 3RKWA 5DUKA 4CHUA 2A6HF 4XSXF 2ZBKA 4OMYA 2RNJA 3HUGA 4UXNA 1XDUA 1K6OA 1EH7A 1TW2A 3IWFA 4I01A 3GZ5A 3TDZC 2M1BA 4L5JA 3B73A 1L3LA 2KRFA 4OOIA 2ZFWA 2E1CA 2NS0A 1DPUA 1BIBA 3BWGA 4LJZF 2W85A 1J9IA 2M8EA 4TV7A 2H09A 2VONA 5J6XA 2VOPA 1UHWA 3D0SA 1Z05A 1P4WA 2Z99A 3W6JB 2QYOA 3GW2A 5L3GA 2E7WA 1F9NA 3MEXA 1XMKA 2BEOA 3KZYA 2IRFG 3CUOA 1QPMA 3BJAA 4A0XA 2E1NA 3CLOA 3REOA 2CWEA 3F23A 2IA1A 3GVAA 5K5QA 4UVCA 2EK5A 4EJUA 4BYYA 1WKMA 1DUXC 1FC3A 1T98A 3WGHA 4HX7A 2EJRA 3WTVC 4HQEA 4OIRF 1TQIA 3L09A 3KCCA 3ABTA 4M73A 1Z7UA 2CSOA 1Z1DA 2FMLA 1FZPB 2F2EA 5E17F 2P6SA 1LEAA 1SAXA 1MJ9A 1YW9A 1QQIA 1O7LA 3RJPA 1QZYA 1G6NA 3K9TA 2CGPA 1FSEA 3FF5A 4CGZA 5CVRA 4KUMA 2HTJA 1K79A 1U5TC 2IPQX 4KMFA 4A2UA 4MTDA 2C6YA 2MLGA 5BOXA 2HKXA 1FNNA 5E20A 1IUYA 3K1MA 2XROA 1A04A 1HKQA 3V7CA 2IJLA 2XKOA 3ZN0A 3LQQA 4NQWA 1ZN2A 1LNWA 1B4AA 4QLCU 3ECHA 4LB5A 5ILVA 4G6QA 4A6DA 1R1UA 3IHUA 4ZYDA 3GWZA 4E70A 2F5CA 1H9GA 4MEYF 1H9TA 4UVAA 5LRSA 2EB7A 3LA3A 4I0AA 1E2XA 1HW1A 5DD8A 2BYVE 3BROA 4HV5A 4Y15A 1K7AA 4ENKA 3V7SA 1YIOA 1I5ZA 3ZMVA 4ZH4F 1ODDA 2LDUA 4OIPF 1FT9A 1BBYA 5D4SA 3R61A 4FX0A 1S8NA 2QQ9A 2IA0A 3ZP5A 1GXQA 2K4BA 3IRRA 2DK8A 1XD7A 3F22A 3WE3A 3JTGA 2FE3A 4HV6A 1ZLJA 4RGUA 3DPLC 3VFZA 1UB9A 2X0LA 4S04A 1D8JA 4RB1A 3V8KA 1R1VA 1G3WA 4JQFA 1KQ9A 1UHMA 2JTVA 5L3FA 2K02A 4M9ZA 3C18A 4KN4X 2QENA 3E6CC 1XCBA 2W25A 3P9KA 1FYMA 4HDUA 1WQ2A 2XHKA 5TJJA 3V7RA 1RNLA 3R6SA 4L0YB 2HOEA 1KU9A 3WTSC 3M7GA 3FMSA 2Q8KA 3HTUA 1J7KA 1HQCA 2M45A 4HOBA 3E5XA 1P4AA 2B0LA 1I6XA 3G73A 1BC8C 2VBYA 4I09A 5HS7A 2EFNA 1IN6A 3FX3A 2PFBA 4NB5A 1T0FA 4ON0A 1L0OC 4KIFA 3F21A 2CG4A 3CDHA 1MD0A 2W24A 4L9NA 3DFGA 1LDJA 2ESHA 2FEZA 1FSHA 3J80Z 5HOOA 1MJAA 3H92A 2A5YB 3GX4X 2F5EA 3RTRA 2XIGA 4P96A 3KP3A 3LQRA 4IJAA 4OINF 1CF7B 3ZQ7A 4LD5A 3F8MA 2EV6A 4N0BA 4KYWA 2AXLA 2A07F 1MKMA 3C7JA 1YO5C 2X4HA 1SFEA 4I98B 3TQNA 1FBQA 3JSOA 1BIAA 5D5VB 5E8GA 5BMZA 5FLXZ 5D8LB 2XAGA 3WTWC 3WTXC 2H94A 4EM0B 5JFRA 4ZYEA 3BOQA 4MQ9F 1J5YA 2OQRA 4BXUA 2DI3A 2EA2A 3VEPA 4IHSA 1O3TA 2M5WA 1FYKA 2V9VA 2LF8A 1B6AA 1YS7A 1HSTA 1U5TA 4PDKA 4IXAA 2JRTA 2A61A 3U1DA 1I1GA 4GYGA 1LDDA 3EUHA 2DTRA 4FX4A 5DCMA 3ELKA 3ZN1A 3FMQA 2L4AA 2PMHA 1REPC 5HDKA 2KJCA 5JI6A 2MH9A 2FSWA 4KNYA 1D3YA 2MH2A 2D1VA 4WX9A 3D5LA 2L54A 1ZGAA 5CVJA 3WTUC 3M8EA 4RB0A 4HBLA 3R0AA 3F3XA 5E8IA 2G9WA 2PQ8A 4PGGA 1KYZA 4AVPA 5D8KB 2IP2A 1KGSA 3QU3A 4L9JA 3WTYC 3I54A 1HKTA 3G3ZA 2OA4A 1ONVA 5F1RA 2EFWA 4UV9A 1P2FA 1PDNC 3GFLA 1R00A 3O3KA 4P55A 2VBWA 1RUNA 4KFCA 3RDIA 1CGPA 4UVBA 3BP8A 4P9UA 3LA7A 3BZ6A 3GLXA 4OIQF 2OZUA 4Y17A 3JSPA 3MQ0A 3RKXA 3CUQC 4YFKF 4Y13A 1EH6A 4RS8A 5IT9Z 5HS9A 1IAWA 5FO5A 4DQ2A 2MC3A 4BHPA 2P6TA 2RDPA 3O2PE 4ENNA 2IT0A 2WC2A 1HW2A 1OYWA 1QZZA 2WV0A 1KQ0A 1B9MA 4A12A 2OBPA 4R1HA 2G7UA 1SD6A 4PGHA 2FNPA 2DU9A 3SZTA 2UXNA 1JXSA 5FGMA 3N97A 4AIHA 3EQLF 1TTYA 2VT3A 2UXXA 2XAFA 4LLLA 1C0WA 3EYIA 1ON1A 1J59A 1D8KA 1EH8A 1BN5A 4M9XA 2EA4A 2KIFA 2FQ3A 2XKPA 3COAC 3KP5A 1ZRCA 4R8HA 2HFHA 5DD4A 2Z5UA 3ZMZA 3EDPA 4WXCA 3IC7A 4EJTA 1IN7A 3DV8A 1DPRA 4KIGA 3T1BA 4M6XA 3ZMSA 4HW0A 4OMZA 3WU1B 1HW5A 4HF2A 4G6DA 2MD5A 4ZZDA 6PAXA 2RC4A 4XBFA 1QGPA 4EV0A 1ZGJA 1OR7A 3MZHA 1HKSA 1JHHA 4LG0A 2V6CA 2VC1A 3MCZA 4BNCA 2GXGA 3U9GA 4RB3C 2TDXA 1RIOH 1O3SA 5D6EA 1J2XA 3C3WA 3JTHA 2BGCA 5J8FA 2WWYA 1I27A 5HVQC 4EJOA 4EGYA 2MA3A 1IRFA 5E18F 2BE5F 1ZARA 1ZG5A 3E6BA 4HAMA 2ZXJA 3WGGA 2HGCA 1UCRA 2LSOA 2MBFA 2W57A 3JAMZ 1G3TA 2VT2A 3F8NA 2XAHA 1G3YA 1Z91A 3ZMDA 2R3SA 2KIUA 3I5UA 3IRQA 3JAMK 1S29A 5DCMB 2D2WA 4WF2A 2XUBA 1S7AA 5L3CA 1OYIA 4YFXF 2H27A 1ZH5A 3RIRA 4A0ZA 4IVNA 5H6RA 3F8BA 4O5VA 2FBHA 1O57A 3KEQA 4D0PA 4AD9A 1OKRA 5D6FA 2F5FA 3SQNA 4ENJA 2VOOA 1YW8A 2K4JA 4G9YA 1LVAA 1MGTA 4IRIA 4HYEA 1W7PA 3EETA 1IZ1A 5BPIA 3GEZA 1ULYA 4LFUA 2ISZA 3MWMA 5L3DA 2OD5A 2K7LA 4IPAA 2RKHA 1QO0D 2Z9OA 1BM9A 1E17A 3GFMA 3T0YA 1GXPA 4ESFA 4L5IA 5AIQA 3R60A 1R5HA 5AIPA 1LQ1A 1G4DA 4UNOA 4G7ZF 2HQNA 3U2RA 2LKPA 3BJ6A 2CYYA 3NQOA 5E1XA 3M1EA 4KIBA 4M9SA 3WGIA 1YW7A 3WU0A 2QQBA 1TW3A 2VBZA 2H6CA 3KP7A 4CO8A 1JHFA 4KA4A 4LLNA 4WCGA 3BY6A 3WTZA 2P7VB 2D1HA 2JPCA 5KK1A 1XGOA 4WXHA 1F4KA 3F6OA 3WE2A 1HBXG 3BPXA 4GYIA 4MNUA 3QPHA 3HSFA 4O3MA 3HRTA 2EFQA 4I0BA 2AS5F 3L00A 5HDNA 2HEOA 1IRGA 3LFKA 4HA8A 4Q5SF 1XMAA 3GXOA 3RYRA 5L3EA 1ZG3A 2Q2EA 2ADUA 4KT5C 3SHFA 4CICA 1XGSA 4KDPA 2FNAA 3HSRA 1WWXA 2VE9A 1AWCA 5HLGA 1R36A 1SD4A 4ESJA 2BV6A 3L7WA 5FFXA 2A69F 4MTEA 1FYLA 5E1ZB 3T5XA 3TOAA 2ETHA 1PP7U 3I64A 5LBQA 1STZA 2IVMA 2QBYA 1YTYA 2ZMEA 4CZZA 1Z6RA 3FXQA 1TQMA 1T38A 2Y0MA 2O61A 2MLKA 5F6FA 4LG0B 4LK1F 1NHAA 2FA5A 1U78A 2QM3A 3PFIA 4MGRA 3GF2A 4HF1A 1QNTA 1W5SA 4HLYA 3VOEA 5D5WB 3R4KA 1OMIA 2O03A 4Z2YA 3QPTA 1BI2A 1OYYA 1IXCA 3LWFA 3QRFF 4S05A 2VODA 3FZVA 5HLIA 4RGSA 3J80K 2V79A 2ZNYA 3ULQB 5JR3A 3EYYA 4G94A 4LLGF 1SD7A 3AAFA 2DPDA 2OZ6A 4BH9A 3P9IA 1FPQA 3V8LA 3BJOA 2VE8A 2XGXA 4A5MA 1LJ9A 2ZNZA 1PUEE 3GFIA 2JPBA 3RPUA 2CO5A 1XN7A 1PP8F 5LHGA 3MZYA 4Q4ZF 4L9TA 1R7JA 1O3QA
chains in the Genus database with same CATH superfamily
5E3NA 1YE9A 2GA1A 5H20A 1YHQI 3QOPA 4U0YA 2JWTA 3TGNA 3BR0A 2BVMA 5D4RA 2CUFA 2LH9A 3HHGA 2MG4A 4RLFA 1LDKB 3CF2A 1U2WA 2K9SA 4Y52J 3H1CA 4IHTA 3GZ6A 2R93J 1WRJA 5KVRA 3ABMH 2LNBA 3ZQHA 1P7IA 3KP2A 3J7AO 3KP4A 5EG0A 4CCMA 5FLXK 2DT5A 3IP4B 4IQ4A 1T6SA 2Q0OA 1P4XA 2DA5A 2NYXA 3BQZA 3M3YJ 2Y0SN 3F6VA 4ETSA 3X2QH 1YI2I 2DO7A 1VQ7I 1W36C 4F93B 2Y69H 5FFZA 2DOFA 1FP1D 2E60A 1W7PB 2FOWA 3F72A 4NC7A 4N9HA 4O6JA 2A6TA 1FP2A 2WBMA 3GTJJ 1LE8B 5B3SH 3GO5A 1VQMI 1DP7P 2D5VA 3BR6A 3KZZA 2EWNA 3L2WA 1WJFA 3VYTB 4JP0A 2L02A 2DA2A 4GCVA 4NQWB 2QSHX 4EGZA 1BOBA 5C4XJ 4OWRB 3BPVA 3T8RA 1R4MB 2FF4A 5D5UB 4DOZA 1QVTA 1J0RA 5FLVA 1YQAA 5EEHA 1FY7A 1KU3A 2K9QA 1BC7C 2DTZA 5A2QZ 1JKPC 5IP9J 1RI7A 2QQAA 4MLOA 4KICA 4RAGA 1BW6A 3BT9A 2M2EA 3ISPA 4BXFA 1V4RA 2QVOA 2XAQA 4HNTA 1LB2A 3S1QJ 3TEDA 1XDSA 1QVUA 4IHXA 1Z7LA 2O3FA 3NRVA 2YX4A 5DYMA 1KYWA 2JVGA 2A3SA 4YG2F 3S1RJ 3SYTA 2KPMA 2YPRA 3LSMA 1VQ5I 1IXRC 1F36A 1OCZH 1R58A 2BY3A 2UV1A 4P5OA 1H88C 2WV1A 3FBNB 4BGDA 3GYHX 3KP6A 2Y0SA 5FB2A 4MIMA 2DMNA 2H6BA 2XDVA 3WODF 1U6GA 4WWCA 4D7MA 3TOBA 3H9JA 3C2BA 1B59A 4KJZA 2NXNB 1X3WB 3EUAA 1F5TA 1E0EA 4E7LA 1MDMA 4M3DA 5IPAA 3LNQA 1SEUA 2E7XA 1X4OA 3ZMTA 5EEAA 2CFOA 5BQTA 5LLQA 3HC7A 4I76A 3K1NA 5LEKA 1S7OA 3IV5A 3M8JA 3I53A 4RGXA 4EEFG 1U3EM 1F43A 1MH4A 4OU0A 3G1LA 1YG2A 3F9KA 2OPTA 2Y48A 3H0DA 1M1EB 5CYVA 3WHBA 3QPSA 1WJEA 2KZGA 3ROUA 3W6KB 5LEJA 2HQAA 2CQQA 3B6AA 1QBJA 4UY8I 3NWTA 2VKHA 4PJLA 3J81Z 3HOTA 4CYCB 4XRFA 4ZYAA 2P4WA 3AL0C 1B72A 2LREA 3KEOA 4AC0A 3OIPA 1DU6A 5LGNA 4L18B 3H3UA 3FHZA 3FMRA 1YRNB 4CZCA 2Q2EB 2HZTA 3QQAA 3LSKA 4PCQA 1Q1HA 2GXAA 4BEHB 2DQLA 3ECOA 5ICFA 4AU7A 4EM2A 4HX8A 5J3LA 1IXSB 4JX5A 5LGTA 2CRGA 2COMA 1Z6TA 3CC4I 2BBYA 2Q1ZB 5EZGA 2ME6A 3IKTA 2KLOA 4F91B 2XVCA 5FKKA 4HDVA 1XC5A 2R7SA 5DTDA 3GZNB 4XM3A 5F08A 1ZREA 4I02A 1POGA 4DZPA 5IT9K 3J7YJ 2XGDA 4M71A 2IA2A 3KETA 1MNMC 2FOKA 3FBIB 3MAJA 1R5GA 2XASA 4KMUX 2V1DA 2ZJRF 4CYDA 2CW0F 2VLAA 3W2AA 2ZCWA 2CV1A 1I39A 2F48A 3QAHA 5EEGA 3L2CA 3WTTC 5ICEA 2ZMEB 2ZXIA 3CDIA 5F0CA 2K86A 3RQ4A 4D5FA 4FQGA 1D5VA 5EF6A 3FISA 1X19A 3HHHA 4XQFA 3W2WA 3HRSA 2OCCH 2FRHA 1W4MA 2XF6A 3CTAA 4IEJA 5JHFA 5BPDA 3CO7C 4Y4RA 5ED4A 1W0UA 3KYCB 3ZQFA 3SFIA 1PYVA 3JRIA 4E7JA 4CXFA 3T8TA 3IL2A 3F0CA 4PFOA 2PMZN 3J7ZI 4ASNA 4OIOF 1Z0XA 4LMYA 1PUFA 2ZXWH 2A68F 4PUSA 2IW5A 3CCQI 3OV8A 2F4IA 2V1XA 1YLFA 3RKYA 2HR3A 3CD6I 5K1YA 2LF7A 1ZLKA 5L3BA 4BQNA 3UR3C 2B63J 3TKYA 2KRCA 2OV7A 3DTIA 2QLZA 4FETA 4EJWA 5JLWA 1Z9CA 3B02A 3HM5A 4HSTA 3NEUA 2UZKA 1A6IA 3W3CA 2EFPA 2PJRA 3C1DA 4DW6A 1Y39A 3CMMA 2ZKZA 4RAYA 3IUOA 3CCLI 5HLTA 2CV2A 2ZJ2A 3GBGA 4HG2A 2NS8A 4II3A 1JJ6C 1IDYA 4G7HF 1FMWA 4AIDA 1ZRFA 4EMSA 2BW3A 4FT8A 1Z77A 4ZTFA 2DLLA 4MHGA 3D5RC 4MO7A 2H8WA 3OYJA 1BA5A 4S0HB 1AOYA 3DKWA 4YIFA 4ZYGA 3Q9SA 1HXDA 4XLAA 1MSFC 4U88A 1XGNA 4U0VA 2N8GA 1ITYA 2PI0A 2PMZA 4ABZA 1UFMA 1XSDA 3CDLA 1K6YA 3KFWX 4V19K 1Y0NA 4U7DA 1R1TA 3N05A 5CJ9A 1TWGJ 1BI1A 2EFOA 1T39A 1IC8A 2R7WA 2WAQN 2RQPA 2OAZA 5FKOA 1SD5A 1V3FA 3WG7H 4R79A 2CW7A 4M72A 3GTOJ 4I7HA 4HLXA 2M87A 1FLIA 2EIKH 4HZFA 1S3JA 3I59A 3IWZA 3E6MA 3Q9VA 4IF4A 2UUZA 1XMXA 3HJEA 3S16J 1ETQA 3GUDA 2PBIA 2DW4A 2B9SA 3JW4A 2EV0A 4RMNA 1TL8A 4I2OA 5ERIA 5DEQA 3CZ6A 1ZAOA 2NNNA 5IT3A 3KE2A 5FRNA 4EJVA 9ANTA 1D0ZA 1U5TB 2F4OB 3S2WA 3F8CA 1OCCH 4B09A 2P8TA 1GVJA 1OISA 2XRNA 2PN6A 1S9HA 4H0EA 4GXOA 1U8RA 1W5TA 2EV5A 2RVCA 3DPTA 5AONA 5C4JJ 1VQ4I 1V55H 1QRYA 5HLHA 1WH7A 2QQ8A 3S1NJ 4NNJA 1CF7A 3OOUA 2NOJB 4AYBA 4K2EA 3S3NA 2FBIA 3HTSB 2UWMA 4Q47A 5CKTA 4BY7J 3S3MA 3M07A 4L0ZB 2EZHA 3AG4H 3DWLE 4OAZA 3DEUA 3HIFA 3DF8A 5J1RA 1JE8A 3EUKL 1HSJA 2RAEA 1FWZA 2P5KA 2L4MA 5IOYA 3MVPA 4YIIA 2V26A 1IN5A 3M8FA 1RUOA 3E6DA 4PJJA 1BL0A 4MFDA 1SMYF 1RZ4A 1CQTA 5DCFA 2JSCA 2CU7A 2VN2A 1MDMB 4RAZA 1R4NB 3WG9A 4IRGA 2XAJA 5JHUA 4W97A 3I4PA 3M4OJ 1FOWA 3PQJA 2JT1A 3SDGA 5K7HA 1R23A 1XSVA 2KL4A 5HODA 1VQLI 4U0WA 2O8XA 3ZR8X 2R7FA 1J75A 1MMAA 3JRFA 5M5XJ 3DP7A 1MBJA 2CMPA 1TBXA 3ZQQA 2DCEA 3JRHA 2DFIA 2GIZA 3V4GA 2ZSHB 3VB2A 4IKFA 1X3UA 3W2VA 2YU3A 4CCNA 3QP5A 3E5UA 4AWXB 4YFNF 5LD2C 3TP0A 2JA7J 4CCKA 5LHIA 1K78A 1FJLA 1P92A 5CVIA 1XCVA 2KFDA 1KU7A 2H1KA 1B72B 5FD5A 3FXRA 2LY9A 1HOMA 3TO6A 1RR7A 1N77A 1SFUA 2VPRA 3JRDA 4P9FA 4ANJA 1GLNA 3K0LA 4XLPF 4A3LJ 3OOPA 4A6EA 5TRDA 2DA6A 3CQZJ 1TT5B 2JA6J 3HEFA 3HRUA 3OYNA 1XSXA 3H3ZA 4U7BA 3N4MA 5DV5A 4F55A 2MFZA 2L9VA 1BJAA 2ECCA 1ZHFA 4BJTA 3BR5A 3P9CA 5FKNA 3ERED 1MH3A 2LOOA 2HYFA 2HDDA 2Y2ZA 1ENHA 4M6YA 1Y0UA 1U0JA 2RREA 3LA2A 2WAFA 2DK5A 4FISA 3TO7A 2D45A 4BHCA 1RC9A 3ZPLA 4HX4A 4BHBA 1LEBA 2Y9ZA 2VKEA 1H89C 3HOVJ 2A6EF 5CQEA 2KT0A 4XMYA 5ICCA 2PMUA 5H6QA 4A3MJ 1R22A 2HS5A 4DGWB 1YYVA 3FM3A 3GFJA 5E3LA 1U9NA 3VDXA 2KRHA 2O6GE 1MMNA 1FBSA 1SFXA 1WPKA 2Y75A 3CUQA 1A31A 1MW7A 2WB1N 4G7OF 3CP8A 3DLLF 1QU3A 2A5WA 1FOKA 1SMTA 4RGRA 1FTTA 2R7UA 4C2MJ 2KKOA 2Z33A 3K1PA 3VODA 1KA8A 1MNEA 3HOWJ 1RESA 5ICGA 3H5AA 2VXDA 1JUPA 1X2NA 4XLEA 2X51A 1W0TA 3M9AA 4XLNF 2KDOA 2GQQA 5F1JA 3CO6C 1WJBA 3BTIA 3FXUA 2PJPA 1WSUA 4XLHA 1FIAA 1UELB 2FMYA 1OJLA 3OY9A 4HRIA 2PG4A 5KAIC 2WY8Q 4HF0A 3D5SC 1IW7F 5ILSA 3E3VA 3ZMUA 4RM3A 1TT0A 2XF5A 2DQRA 1XGMA 3PSIA 3V8JA 1TNSA 1X3ZB 4AIJA 2OU2A 1KONA 2I10A 1XX5A 1FTZA 5CVUA 1WCMJ 1YOVB 3RKQA 4JBAA 2PJRB 2IS6A 2PLYA 1Y8RB 3SFZA 4J01A 4B3AA 4JK1X 4LK0F 2DN0A 3FWEA 1G2HA 2E19A 5LHHA 2BW3B 4M74A 3BTCA 4IL6C 4D7NA 4NHJA 1MBGA 1ON2A 3OYBA 2J5OA 1ZRDA 2WY7Q 1D1BA 1P6RA 2AQEA 3BG7A 4E7ZA 1IF1A 4YELA 1VTNC 3FDYA 3K4LA 3PSFA 4BDYA 4D1QA 1EJ9A 4C30A 3DQVC 2GAUA 4FHTA 1MJBA 3HOUJ 4L9VA 1OPCA 1JKRC 5CLSA 2DJNA 2XF7A 4ITVA 2FXAA 2HOSA 4UHTA 1TNTA 2L2OA 2VJ4A 4HQMA 3VSKA 3Q5FA 3VPRA 3GTQJ 2HQRA 1Q1VA 3PL8A 1XB4A 3OMYA 3GLLA 2GA2A 4XKVA 1O7FA 1W7PD 3NWSA 2LP0A 2CJJA 3TDUC 1ZG1A 2GZWA 4C2UA 4XKCA 3R0JA 3E5QA 4BUPA 3P5JA 2DPUA 3HYIA 2M8GX 4PZJA 3VWBA 4GFBA 2XRLA 3VYRB 3I59B 2HDCA 4A3GJ 1USTA 3K2AA 4RB2C 4QWQA 4B8XA 1OCPA 2VQGA 3ML6A 1BI3A 1T08B 4UUTA 3K2ZA 2PEXA 1I1SA 4CDGA 2LTPA 2YR2A 3HSEA 4A0YA 2K27A 4ENMA 2R7DA 1GV5A 4IZZA 2M30A 5FD6A 3IAS2 4IHWA 3ASOH 2YSRA 3W6VA 4E4HA 4BAYA 2STWA 2CQKA 1ERDA 3ZQLA 3HPHA 3JRBA 5GP9A 3PJRA 1WJDA 2QCOA 2XV4S 4A5NA 1JGSA 3SXYA 4F3QA 5HNFA 4UUSA 3AKZA 3MFKA 3FKJA 4PJ0C 4IQJA 5DDGA 5E3OA 2WTEA 3CJTB 1USSA 3TBIA 4UV8A 1WZ2A 4EM1A 3O8GA 2ELJA 4AIKA 2KIQA 4XKBA 3CJNA 3G4SI 3RYPA 4EQQA 3PNTA 5ILUA 4XSZF 2GXBA 1EV7A 1WVRA 2LLKA 2VXZA 4P1WA 1T2KA 2P5LC 5LGUA 2R7TA 1YX5A 1D1CA 4PJNA 2BOLA 4AVZA 1K4TA 2R92J 4A3BJ 2J5PA 4U87A 4ZYHA 4ZZLA 2K9NA 2NNYA 2QZ8A 2W1OA 4XONA 1S6LA 1GV2A 2FU4A 3C2HA 3LOCA 3PUFA 3CMAI 1F1ZA 2LYCA 4WK8F 3HRMA 4GO1A 4UUVA 3I58A 2E1MC 4RAFA 2R7VA 1WJAA 2NAZA 2TCTA 3OR1C 3A01B 3RCOA 2L01A 3SZPA 3S1MJ 5FKLA 1SFKA 5B5EC 2V1UA 2VB6A 2ZC2A 2EBIA 1GT0C 1Z21A 1K78B 1YITI 4A3CJ 1KU2A 2XPVA 3KLNA 1E3HA 2G7HA 1TQPA 3EPZA 5A2QK 5J8CA 2ELHA 3H36A 2JZYA 1IN4A 5EGOA 1XTAA 4EVIA 2X1CA 2W84A 3BG9A 4PSXA 5CPRB 3K69A 3ONQA 5K5OA 3P7NA 3ZCOA 4F7ZA 2LG4A 1T8IA 3TP3A 3LSTA 1OCRH 2W48A 2XSDC 2ESNA 5JVTA 1FX7A 2GIVA 3F8FA 1YS6A 3ASNH 2ZO4A 3OS0A 3TW7A 4KITB 4GGGA 2OQGA 5F64A 3RI4A 4BXXJ 2CQ7A 3PQKA 3QPLA 1TWFJ 1A6QA 2VKDA 4JX4A 3GTPJ 2HVQA 3FK6A 4CA0A 3RPQA 2L3DA 3OSFA 1B9NA 3AL0B 1AA7A 4BKXA 1BOAA 3DXJF 3A03A 3HOSA 4X0GA 3QU6A 4A3EJ 2KJBA 3K4NA 3LAJA 2R7XA 2Y30A 4QSHA 4RDUA 3BG5A 1O3RA 1ZYRF 1VZ0A 2RV8A 4Q48A 2E2IJ 3JRGA 4MQVA 3OYEA 3CMYA 4M3GA 2FD5A 3CESA 1V54H 1MBHA 2F6CA 3BR1A 4CCLA 1X2MA 3CUQB 3MMYB 3ZQIA 2FBKA 2MABA 2E5NA 2QWWA 3FM5A 4GDFA 5J4YA 2IXSA 1WI9A 2VC0A 3I71A 3TMOA 4LB6B 2NVYJ 4KN7X 3GTLJ 2ZJPF 2KP6A 3OYMA 5LRRA 3A0HC 4V2GA 1IN8A 3IKVA 1G3SA 2HXIA 3DKYA 3J81K 2DBBA 3K70D 1I3AA 2MYSA 2EQRA 3NAUA 5HDGA 5BS6A 1GHCA 1BI0A 4BQAA 3KLOA 3LSGA 4G6TB 1FBUA 2XPUA 2VBXA 1KQ8A 2VPLA 4MEXF 3I4MJ 4N9IA 1X1CA 3LAPA 3MKLA 1IV8A 4OAYA 3GMEA 2V6EA 2DAOA 4BE2A 2HWVA 2IBDA 2O0YA 3I0TA 1ETVA 3TO9A 4IRHA 4WXDA 2E2JJ 5HS8A 1U9OA 3VSLA 3L9FA 4HNVA 1B1BA 1IJWC 2Z3YA 5CVVA 1TLHB 1V5FA 1W1WE 2ISYA 4B43A 2JUCA 5J1YA 2P7CB 1DDNA 3H9QA 1X1PA 2CFXA 1MZBA 1P7JA 3RPUD 3O6BB 2F5DA 4I99C 2QBYB 2EINH 1H0MA 2HKOA 2R7QA 5E1WA 3HOXJ 5EZHA 4G8XA 4A3FJ 2KIMA 2RN7A 2L0KA 4FE4A 2XSJC 1MBKA 2QUFA 1UHSA 2CQNA 2IGMA 5KAFC 2RGVA 2YX7A 2GOMA 3ERMA 2DT6A 5GTIC 1TC3C 3O8HA 5FROA 4BU2A 2V9KA 2P5VA 1NK3P 3S2HJ 2DA3A 3BDDA 1YFHA 3QP6A 2HYGD 5D5XB 2ACJA 1RETA 2MD0A 3ABLH 2LY1A 2GWRA 4DNCA 4F92B 3ABUA 5DUIA 3E7LA 3E97A 2NRAC 4IOCF 4ESBA 2QEXI 5K5RA 2STTA 2HTSA 4LGWA 2AO9A 3RKWA 2O7OA 2Z1DA 5DUKA 4CHUA 2A6HF 1RPWA 1SVLA 2ZBKA 4XSXF 2NVXJ 4OMYA 1FMVA 2RNJA 4XR6A 3HUGA 5M3MJ 1VNDA 2Y31A 3BQYA 1UJ8A 3K4CA 4UXNA 2ZMEC 1XDUA 1VQKI 3DEEA 1K6OA 2ZJQF 1EH7A 3QOEA 4XLCA 1ORKA 3CMEI 3LMMA 4E7IA 2DMUA 3G71I 1XS9A 1ACIA 1TW2A 2R5YB 3IWFA 1WH5A 2QKLB 4I01A 4XRSG 3GZ5A 1UAAA 3TDZC 1VFCA 2M1BA 4L5JA 2XB0X 3ZXSA 3B73A 2A05A 1L3LA 3FXMA 2X6YA 1T0FC 2DOEA 2KRFA 5GAGJ 1SC7A 4OOIA 4M3FA 4CUGA 3S15J 2ZFWA 4QPOA 2E1CA 2COBA 2NS0A 4ZDLA 1DPUA 1BIBA 2V1NA 3BWGA 5F04A 4LG3A 4LJZF 2W85A 1J9IA 3E1SA 1NTCA 4B47A 2M8EA 2K9MA 2EH3A 2EZKA 2H09A 3G1MA 4TV7A 4DYQA 5J6XA 1UHWA 2VONA 3D0SA 2VOPA 1Z05A 5FLMJ 1P4WA 4UUSB 2Z99A 3PM1A 3K70C 3W6JB 4H4KC 1XPXA 1T56A 1A5JA 1BR4A 1VF9A 4AYBN 4BDZA 1ETKA 2QYOA 3GW2A 5L3GA 2E7WA 1F9NA 3MEXA 5EG0B 1MBEA 1XMKA 2BEOA 2ME0A 2PX9A 2YS9A 3KZYA 2IRFG 2CUZA 2EPFA 3CUOA 5GPAA 1QPMA 3BJAA 4A0XA 2NVUB 2RQQA 2QSGX 2E1NA 3DU5A 3CLOA 2DDAA 3REOA 2CWEA 3F23A 2IA1A 4X1EA 3GVAA 1MNDA 1B8IA 5K5QA 4UVCA 2EK5A 4EJUA 2EZIA 4IOAF 3JRCA 4BYYA 3G6EI 1QZEA 1WKMA 4M3EA 2DA1A 1DUXC 1FC3A 1T98A 3WGHA 4HX7A 1ETWA 3PFYA 1BJZA 2EJRA 3U1KA 4CSWA 1UG0A 1RKTA 3I56I 3WTVC 4G12A 5FRMA 1V5EA 5F0HA 4HQEA 4RBOA 5CQGA 4OIRF 1TQIA 3L09A 1N25A 3K4KA 3ABTA 3KCCA 4M73A 1Z7UA 2CSOA 4LIUA 1R6RA 3CF5F 1DGWY 1ZKGA 4DZJA 1Z1DA 2QF7A 1X4PA 2FMLA 5EGOB 2F2EA 1FZPB 5E17F 2P6SA 1Z67A 3PIOF 1LEAA 1SAXA 3K4BA 2NVQJ 3HPGA 1MJ9A 1YW9A 1QQIA 2AXTC 1JKOC 3KPHA 4C2TA 1O7LA 2HDWA 5GAEJ 2LBFA 3RJPA 1QZYA 1G6NA 3OL3A 2DYRH 2E5ZA 3K9TA 2CGPA 1FSEA 3FF5A 4CGZA 4RM2A 5CVRA 3OYAA 2NS7A 2GOXB 4KUMA 2HTJA 3G1OA 2Z2SB 1K79A 1U5TC 4XK4A 2IPQX 5K7FA 3FXJA 4KMFA 2M34A 4XIDA 4A2UA 4B44A 1VQ6I 2CS3A 2JMWA 4MTDA 5F0FA 3EUHC 1N75A 2C6YA 3OSGA 2MLGA 5BOXA 1DU0A 2BHZA 3IH2A 2DXIA 4HEA2 2NVTJ 2HKXA 4KISA 1FNNA 5E20A 1DP3A 5B1BH 3L2UA 1IUYA 1MMSA 2CH0A 3K1MA 1UMQA 4E7SA 2XROA 1A04A 1HKQA 3V7CA 4X6AJ 2IJLA 4LOCA 2W4SA 2XKOA 3DEWA 2V9PA 3ZN0A 3LQQA 4NQWA 1YX3A 1LNWA 1ZN2A 3S93A 1B4AA 2HVRA 4QLCU 1GDTA 2GM4A 3ECHA 1X1BA 4LB5A 5ILVA 5BNGA 1YJNI 4YEJA 4G6QA 4A6DA 1R1UA 3IHUA 4ZYDA 3GWZA 4M6VA 3IH3A 3VYUB 2L7FP 2F5CA 1H9GA 1LKXA 3AG1H 4E70A 1X1DA 4PFPA 2M4GA 5IP6A 4MEYF 2L7ZA 2FX0A 1Z3XA 2BY2A 1T95A 2FQ4A 3DU6A 1H9TA 4UVAA 5LRSA 4FTHA 1LVKA 2MGQA 2EB7A 3LA3A 3KEYA 5LFAA 4HSRA 4QTRA 3B6CA 4I0AA 2X6OA 3OYGA 4BJ6C 5DM7F 1E2XA 2HZDA 1WGXA 5M3FJ 1HW1A 4NC8A 5DD8A 3LFUA 3OWTA 2BYVE 4XL9A 2JRMA 2B7EA 2M9HA 3BROA 4HV5A 3A2KA 2BZTA 4Y15A 1K7AA 4ENKA 3V7SA 3OYLA 2HOAA 1YIOA 1I5ZA 3I9V2 3VYSB 3ZMVA 1NK2P 4ZH4F 1ODDA 2LDUA 2K3PA 1D0YA 4OIPF 1FT9A 1BBYA 1TWCJ 4Z6YA 4FCYA 1AU7A 5D4SA 3A02A 3R61A 1IO2A 4FX0A 1S8NA 3HKZN 2QQ9A 2IA0A 4DJAA 2VASA 4C3JJ 3ZP5A 1GXQA 2K4BA 2BY1A 3IRRA 3DKXA 2DK8A 2H1LA 1XD7A 2DFFA 2VJ5A 2YUSA 3WE3A 3D1NI 3F22A 3JTGA 4BE0A 1JGGA 2FE3A 1WJCA 4HV6A 3ZQGA 1ZLJA 4DIQA 3CCVI 1PUFB 1ETYA 4RGUA 1OCTC 1JUSA 1Y1VJ 3DPLC 3VFZA 1ETXA 3TW6A 1UB9A 2X0LA 1R49A 2XB5A 4S04A 1P9QC 1D1AA 5KCMA 1D8JA 1TZLA 4RB1A 3PNYA 4DBRA 1VQ8I 2LY2A 3V8KA 2EIMH 4A69C 4IHVA 3HUGB 1R1VA 2LRDA 3K10A 1VQ9I 1QHGA 1G3WA 5GAHJ 4JQFA 2HQ5A 5H2FC 1KQ9A 1UHMA 2JTVA 4EATA 5L3FA 2K02A 4M9ZA 3C18A 2K85A 4KN4X 4A3KJ 1Z3YA 2OUMA 2QENA 2DFHA 1WI3A 3Q3SA 3K4JA 1W36D 2NOGA 3KYDB 3E6CC 1XCBA 3HGGA 3HKZA 2W25A 4BL0B 3P9KA 1JTYA 1FYMA 2DYSH 2YU9J 3S2DJ 4HDUA 2K5CA 2M0CA 3BR2A 4XRSA 1WQ2A 2XHKA 5TJJA 4NUBA 3V7RA 4YRVA 1RNLA 3R6SA 3MKYB 4L0YB 4B1RA 2HOEA 1JKQC 4D9JA 1KU9A 3WTSC 1BR1A 5B66C 3M7GA 4YIRX 3FMSA 2Q8KA 1FIPA 3HTUA 1J7KA 1HQCA 2BVLA 2M45A 4HOBA 3E5XA 3K7AJ 3Q0WA 1P4AA 2B0LA 1I6XA 3K4MA 3G73A 3HDDA 1BC8C 2VBYA 4MFEA 4I09A 5HS7A 2EFNA 1IN6A 3CJQB 3FX3A 2PFBA 1PVEA 2LK2A 5TISC 2WAEA 2DJIA 4NB5A 1T0FA 3GCMA 4ON0A 3ESWB 3SDBA 4JYKA 1MMDA 3C2GA 1L0OC 3OR2C 5EDNA 4KIFA 3F21A 2CG4A 4BS9A 1B8IB 2JK3A 1ZQ3P 3CDHA 1MD0A 2W24A 4BE1A 4L9NA 4IX7A 1IRZA 3DFGA 1LDJA 2ESHA 2FEZA 1FSHA 3J80Z 2L7KA 4PJMA 5HOOA 1MJAA 1OR7C 3H92A 1I50J 2A5YB 1S72I 3KZIC 4CCJA 3GX4X 3DTKA 2F5EA 3RTRA 1MBFA 2ZSIB 3AFHA 2XIGA 3IH4A 4P96A 4DYRA 3CCSI 1SAUA 2M4KA 3KP3A 4A3DJ 3FXOA 3LQRA 4IJAA 4OINF 5JLXA 5IP7J 1CF7B 1ZELA 2R7OA 3ZQ7A 4LD5A 3F8MA 2EV6A 2TRTA 3ZQCA 4N0BA 2VJIA 4KYWA 2AXLA 3DBLB 2A07F 2LFBA 3BG3A 1MKMA 2DOAA 5DS9A 1VQOI 3C7JA 3OIOA 2LBFB 3BC8A 4Y3OA 1YO5C 2X4HA 2EIJH 1Y6IA 1SFEA 3GTGJ 1UG2A 4BQOA 1IUFA 1GVDA 4I98B 1YJ9I 1DGRM 3TQNA 1FBQA 3JSOA 1HCRA 1BIAA 3WU2C 3BTJA 5D5VB 5E8GA 5JVGF 3H5NA 5BMZA 5FLXZ 5GADJ 5D8LB 2XAGA 3WTWC 4ZJZA 3BLYA 2M0MA 5HNHA 3WTXC 4ZTJA 5E3MA 3PUBA 3CCUI 2H94A 1V5GA 2HU9A 2LKXA 1RKWA 4EM0B 4ZYEA 5JFRA 4RLQA 3BOQA 4MQ9F 3OYIA 1J5YA 2E34A 2OQRA 4BXUA 2DI3A 4I6ZA 4NC6A 2EA2A 3BCAA 1VQPI 2ICWG 3VEPA 1G8XA 4QPQA 3I55I 2ZFUA 1MSEC 4IHSA 1O3TA 2M5WA 1FYKA 3DLAA 2V9VA 2LF8A 3H3VK 1B6AA 1YS7A 2EZLA 1HSTA 1U5TA 3DCFA 4PDKA 4IXAA 2JRTA 1OLTA 2A61A 2W82A 3U1DA 1I1GA 2DFEA 4GYGA 2HVSA 4BBRJ 3RZOJ 1LDDA 3EUHA 2DTRA 5FKMA 4FX4A 5DCMA 3ELKA 2K3FA 1AKHA 3ZN1A 3FMQA 2CW8A 1HDPA 1T33A 3L1PA 2L4AA 2PMHA 4A3JJ 1H8AC 1REPC 5HDKA 2AHQA 2KJCA 4E7KA 1QA6A 1JT6A 5IY5H 1NG7A 1OQYA 5JI6A 3ZRGA 5E79C 2MH9A 2FSWA 4KNYA 1D3YA 3SZGA 3MZ8A 3S32A 2CUJA 2MH2A 2D1VA 4WX9A 1IDZA 2IS2A 4FE7A 1JUMA 2F5VA 3D5LA 2L54A 2K9LA 2XGCA 1ZGAA 3Q0UA 2ZB9A 3G2BA 1YIJI 5CVJA 2H8RA 3WTUC 4W1UA 3M8EA 4RB0A 4HBLA 3R0AA 2E1OA 3F3XA 5E8IA 2G9WA 2PQ8A 2XGEA 4PGGA 1KYZA 4XKWA 2DT7B 2WADA 3AG3H 4AVPA 5D8KB 2HPMA 2O8KA 1GUUA 2IP2A 1ZR4A 3ZGKA 1KGSA 1NG6A 3QU3A 4L9JA 2E2HJ 3WTYC 4HPQA 2V7FA 1D0XA 4XRMA 1RR8C 2VI6A 3I54A 1LUJB 2V4JC 1TP4A 1HKTA 3G3ZA 1S5LC 3QYFA 2OA4A 2KISA 2VQLA 1ONVA 5F1RA 1HF0A 2EFWA 3QYEA 3MD2A 2HOTA 2DA7A 4UV9A 1P2FA 3LSPA 4ZDOA 1O4XA 4Y33A 1PDNC 3GFLA 1R00A 3O3KA 1Y8QB 4P55A 4CH7A 2OJED 2VBWA 2X1EA 1RUNA 4KFCA 3RDIA 1CGPA 4A93J 4UVBA 1QPIA 2L9SA 3BP8A 3LA7A 4P9UA 3BTLA 3BZ6A 3GLXA 4M3BA 5C3EJ 2OZUA 4OIQF 1LFPA 4Y17A 3JSPA 3MQ0A 2L7MP 3RKXA 2F4MB 3OYDA 2IEKA 3CUQC 4YFKF 4Y13A 5B1AH 1EH6A 1EF4A 3ABKH 2DMTA 1K61A 2LMDA 2QSFX 2CQXA 2EILH 4RS8A 3L2QA 5IT9Z 5HS9A 3LL7A 5DM6F 1IAWA 1R5ID 5J40A 5FO5A 2HPIA 2X9DA 4DQ2A 2MC3A 4BHPA 3HBLA 3NARA 2P6TA 2IS1A 2RDPA 3A1YA 3O2PE 4ENNA 2IT0A 2WC2A 5FJ8J 1HW2A 1OYWA 2CUEA 1QZZA 2WA0A 1LFUP 2WV0A 4PSWA 3GTKJ 1KQ0A 1Y56A 3SEQA 2VUMJ 1B9MA 2IGNA 2HXOA 3H9GA 3FXKA 2BXYA 4A12A 2OBPA 2XAUA 2LR8A 4R1HA 5M5YJ 2E71A 2G7UA 2LC2A 1SD6A 1ZK8A 3U21A 2JVHA 4PGHA 2FNPA 2DU9A 3RZDJ 3SZTA 2UXNA 2W7NA 3I4NJ 1JXSA 5FGMA 3N97A 1U8BA 4AIHA 4N4OB 2BHYA 3EQLF 4XNFA 1TTYA 5TGTA 2VT3A 3BG6A 2UXXA 3HZJA 4NDLA 2QA4I 4E7HA 1Y1WJ 2XAFA 3TL4X 4LLLA 3OYCA 1C0WA 3EYIA 2L5QA 2JJ7A 2VJJA 2OC6A 3PNVA 1ON1A 2QKMB 2QGUA 1J59A 1D8KA 1EH8A 1BN5A 4M9XA 2EA4A 3KX2A 2KIFA 3RSNA 2FQ3A 2JSPA 2XKPA 2HI3A 3COAC 1KZHA 3KP5A 3A0BC 1ZRCA 2R7ZJ 4R8HA 3S17J 2HFHA 4Y7NJ 5DD4A 2Z5UA 2IGKA 3ZMZA 3EDPA 3CCRI 4WXCA 3IC7A 2HYJA 4EJTA 1IN7A 1W5CC 3DV8A 1DPRA 4KIGA 3T1BA 4M6XA 1A36A 2IS4A 3ZMSA 2JA8J 4D5CA 1WJ5A 4HW0A 4OMZA 2OTLI 3WU1B 1HW5A 1IG7A 3LSRA 1DQUA 2R5ZA 1OCOH 1EKEA 4G6DA 4JOMA 3HXLA 3OYHA 1ZR2A 4C3IJ 4HF2A 2MD5A 4DBQA 4ZZDA 6PAXA 5M5WJ 2RC4A 1JT0A 1HC8A 4XBFA 1QGPA 1UZCA 4XN3A 2MW8A 2DMQA 2M7BA 3Q0VA 4EV0A 3H0GJ 1ZGJA 2ZXHA 3CP2A 4B48A 4B3XA 3OS1A 1FEXA 1WFXA 2BXZA 3S3OA 1OR7A 3MZHA 3A4CA 3FHNA 3S8PA 1JTXA 2E35A 1JJ8C 1VI0A 1HKSA 2Y9YA 1JHHA 4LG0A 2V6CA 2VC1A 2Z16A 3MCZA 4QIWN 2DA4A 4BNCA 4ZDPA 2GXGA 3U9GA 4RB3C 2TDXA 4BACA 5IYCJ 3BZKA 1RIOH 1O3SA 5D6EA 5J47A 2ELKA 1I3QJ 2IAIA 2R0QC 4JX6A 1J2XA 3C3WA 3JTHA 2BGCA 5J8FA 2WWYA 1NH3A 3CC2I 1I27A 5J4VA 3CJRB 5HVQC 4EJOA 4EGYA 3CC7I 2MA3A 1BW5A 2E36A 4UB8C 1IRFA 5E18F 2FUG2 2BE5F 1ZARA 1ZG5A 4XN0A 3E6BA 3HGYA 4IO9F 4HAMA 2ZXJA 3WGGA 2HGCA 2KHMA 1UCRA 1XG1A 2KZVA 2LSOA 2MBFA 3KYLA 1FOXA 2W57A 3JAMZ 1G3TA 2ECBA 2VT2A 3F8NA 2R7RA 3LSIA 2XAHA 1G3YA 1Z91A 3ZMDA 2KDZA 2M7AA 2R3SA 2KIUA 1IGNA 3CCJI 3I5UA 3IRQA 2LKSA 3JAMK 2VKVA 3L2VA 3H5RA 1S29A 4J19A 5DCMB 4XICA 2D2WA 2FJ1A 4WF2A 4LITA 2XUBA 1S7AA 5L3CA 1OYIA 4YFXF 1AKHB 2H27A 3GTMJ 2JQ7A 1ZH5A 3OYFA 3RIRA 4A0ZA 4CCOA 2ID3A 2WAQA 4IVNA 4XORA 3FXLA 4XLFA 1MIJA 5H6RA 3UKGA 3K6GA 3F8BA 4O5VA 1G59A 2FBHA 1O57A 3KEQA 3CCYA 4D0PA 4AD9A 4ZC3A 3CCEI 1OKRA 5D6FA 2F5FA 1HA8A 1EA3A 3E0JB 3SQNA 4ENJA 2VOOA 1YW8A 1SVOA 2JA5J 2K4JA 4G9YA 3DBRB 3WHCA 2W00A 3LSJA 3FKIJ 3PO3J 1LVAA 1MGTA 2LVSA 4FASD 4IRIA 2GLOA 2O9LA 5K7ZA 4HYEA 1W7PA 3BR3A 3EETA 1SANA 1IZ1A 2K40A 5BPIA 1LE8A 2O5RA 3GEZA 1ULYA 2I5UA 1TWHJ 2OCEA 2XPWA 4LFUA 2ISZA 1A35A 3MWMA 4BY1J 5L3DA 2OD5A 3KIOA 2K7LA 3JRAA 4IPAA 2RKHA 2AQFA 1QO0D 2Z9OA 1BM9A 1PJRA 2OF7A 4AM3A 4HNUA 1TWAJ 1E17A 3GFMA 3T0YA 1ETOA 4BBSJ 4J00A 4UB6C 3A01A 1GXPA 4ESFA 4L5IA 5AIQA 4GRIA 3V42A 4B4CA 3R60A 1R5HA 5AIPA 1LQ1A 1G4DA 4L5EA 3HL2A 4DYCA 4C9YA 4UNOA 4G7ZF 5EYRA 2HQNA 3U2RA 3SEZA 5GPCA 1FOYA 2LKPA 3BJ6A 2CYYA 3NQOA 5E1XA 3M1EA 4KIBA 2X48A 4M9SA 3FIWA 3WGIA 1YW7A 3HG9A 2M3AA 4II2A 3CLQA 2X85A 3WU0A 5EJCA 4PK4A 4XOPA 2QQBA 3FK7A 1TW3A 2VBZA 1IV6A 2H6CA 2RNGA 3KP7A 4CO8A 2VQCA 1JHFA 1BR2A 3DBHB 1E3OC 1X1AA 2G0EA 4KA4A 1APLC 1N78A 2GBYA 5KNLA 4LLNA 4WCGA 3BY6A 3BCBA 4E6KG 3WTZA 1IRXA 1E3PA 2P7VB 2D1HA 1HDDC 2JPCA 5KK1A 1XGOA 2I8DA 4WXHA 1WHUA 1F4KA 3F6OA 3WE2A 1HBXG 3BPXA 4GYIA 1K83J 4MNUA 3QPHA 3RQIA 3HSFA 4CYCA 4O3MA 3HRTA 3QODA 2EFQA 4I0BA 2AS5F 3L00A 5HDNA 1MMGA 2HEOA 1IRGA 2IGOA 4N4NB 3LFKA 4HA8A 4BQQA 3S14J 4Q5SF 1XMAA 1S7EA 3GXOA 3HB9A 4IHYA 3RYRA 1R9TJ 2VIXA 5L3EA 1YRNA 1ZG3A 1ZGWA 1SVMA 2Q2EA 1HLVA 2ADUA 2P81A 3JREA 3MN2A 4KT5C 3SHFA 4CICA 1XGSA 2X6XA 4KDPA 1VQNI 1AHDP 2FNAA 2OTJI 2VQHA 3HSRA 4BEHA 1WWXA 2VE9A 3DPUA 2LD5A 1AWCA 1QHHD 1SFOJ 5IOZA 5HLGA 2R4GA 3QYBA 4F52A 1R36A 4BJ5C 3H35A 1SD4A 4ESJA 2JN6A 2VL8A 2BV6A 2MSYA 4V2FA 3L7WA 5FFXA 2A69F 3M1CA 4MTEA 1JI8A 3BZCA 1FYLA 3AG2H 5E1ZB 3T5XA 3TOAA 2ETHA 1PP7U 3I64A 1K4SA 3IAM2 5LBQA 5IYBJ 2R5ZB 2WB1A 1STZA 2XC7A 3I3LA 2IVMA 3OS2A 2QBYA 1YTYA 3CCMI 2JA2A 4KT6A 2ZMEA 4CZZA 1Z6RA 4XOTA 2ID6A 2DODA 3FXQA 1I6HJ 1D5YA 3MKWB 2L9NA 1TQMA 2X1DA 1T38A 2L9RA 3MKZA 1J09A 2Y0MA 4NBQA 4A3IJ 2O61A 2MLKA 5F6FA 5IYDJ 5C44J 4LG0B 4LK1F 1NHAA 2HNHA 4RA2A 2FA5A 2X6WA 1U78A 2QM3A 2JUGA 3PFIA 4MGRA 3GF2A 3LSHA 4HF1A 3PO2J 1QNTA 1LPQA 3QWLA 1W5SA 4HLYA 3VOEA 4LIVA 5D5WB 3R4KA 1YJWI 1OMIA 2O03A 3UNGC 2DMPA 4Z2YA 2CV0A 3QPTA 3DTEA 1BI2A 1OYYA 1IXCA 3LWFA 3ZOBA 1OFCX 2MC4A 3OL4A 4S05A 3QRFF 2VODA 2DDBA 3FZVA 1X58A 5HLIA 3SJMA 4RGSA 3JR9A 3J7AY 1RRJA 3J80K 2V79A 2P0WA 2ZNYA 3OYKA 3JCUC 3PIPF 3ULQB 5JR3A 3EYYA 4G94A 4LLGF 1SD7A 3AAFA 2DPDA 2OZ6A 4AUXA 2KMUA 3OIQA 4BH9A 3P9IA 1FPQA 3V8LA 2R5YA 3HOYJ 3BJOA 2VE8A 2KQRA 3L2RA 2XGXA 4A5MA 1LJ9A 2ZNZA 1PUEE 3GFIA 3HOZJ 2JPBA 1LFBA 3RPUA 4C3HJ 2BY0A 2CO5A 1XN7A 5KHDA 1PP8F 2E1MB 5J1UA 1R71A 5GTHC 5LHGA 3MZYA 4Q4ZF 4L9TA 1R7JA 5F27A 1ZTRA 1O3QA
chains in the Genus database with same CATH topology
2GA1A 5H20A 3QOPA 4U0YA 3TGNA 5D4RA 3HHGA 1LDKB 1U2WA 4IHTA 3GZ6A 1WRJA 5KVRA 2LNBA 3KP2A 3J7AO 3KP4A 5FLXK 2DT5A 1T6SA 2Q0OA 1P4XA 2NYXA 4ETSA 3F6VA 2DO7A 5FFZA 1FP1D 1W7PB 3F72A 4N9HA 4O6JA 1FP2A 3GO5A 1DP7P 3KZZA 2EWNA 2L02A 4GCVA 4EGZA 3BPVA 3T8RA 2FF4A 5D5UB 1J0RA 1YQAA 5EEHA 1FY7A 1KU3A 1BC7C 5A2QZ 1RI7A 2QQAA 4KICA 3ISPA 1V4RA 2QVOA 2XAQA 1LB2A 1XDSA 2O3FA 3NRVA 2YX4A 5DYMA 1KYWA 4YG2F 2A3SA 2YPRA 1IXRC 1R58A 4P5OA 3GYHX 3KP6A 5FB2A 2H6BA 3WODF 1U6GA 4WWCA 3TOBA 1B59A 1F5TA 1MDMA 2E7XA 3ZMTA 5BQTA 5LLQA 3K1NA 5LEKA 1S7OA 1U3EM 3I53A 4RGXA 4OU0A 1YG2A 2Y48A 5CYVA 3ROUA 3W6KB 5LEJA 1QBJA 3J81Z 3HOTA 4XRFA 2P4WA 3KEOA 5LGNA 4L18B 3H3UA 3FHZA 3FMRA 2HZTA 4PCQA 1Q1HA 2DQLA 3ECOA 5ICFA 4EM2A 4HX8A 1IXSB 5LGTA 2COMA 1Z6TA 2BBYA 3IKTA 2XVCA 4HDVA 1ZREA 4I02A 5IT9K 4M71A 2IA2A 3KETA 2FOKA 3MAJA 1R5GA 2XASA 4KMUX 2V1DA 4CYDA 2CW0F 2ZCWA 5EEGA 3QAHA 3L2CA 3WTTC 5ICEA 2ZMEB 2K86A 1D5VA 3HHHA 3HRSA 2FRHA 1W4MA 3CTAA 5BPDA 3CO7C 5ED4A 4CXFA 3T8TA 3IL2A 4ASNA 4OIOF 4LMYA 2A68F 2IW5A 3OV8A 2V1XA 1YLFA 3RKYA 2HR3A 5K1YA 2LF7A 1ZLKA 5L3BA 3TKYA 2QLZA 4EJWA 1Z9CA 3B02A 3NEUA 2UZKA 2EFPA 3C1DA 2ZKZA 4RAYA 2ZJ2A 4G7HF 1ZRFA 4EMSA 4FT8A 2DLLA 4MHGA 1AOYA 3DKWA 4YIFA 4ZYGA 3Q9SA 1HXDA 4U88A 1XGNA 4U0VA 2PI0A 1UFMA 1XSDA 3KFWX 4U7DA 1R1TA 5CJ9A 1BI1A 2EFOA 1T39A 2RQPA 2OAZA 1SD5A 1V3FA 4R79A 4M72A 4I7HA 4HLXA 2M87A 1FLIA 4HZFA 1S3JA 3I59A 3IWZA 3E6MA 3Q9VA 4IF4A 3GUDA 2PBIA 2DW4A 3JW4A 2EV0A 4I2OA 5ERIA 5DEQA 1ZAOA 2NNNA 5IT3A 3KE2A 4EJVA 1U5TB 3S2WA 3F8CA 4B09A 2P8TA 1GVJA 2XRNA 2PN6A 4H0EA 4GXOA 1U8RA 1W5TA 2EV5A 2RVCA 3DPTA 5AONA 5HLHA 1CF7A 4K2EA 2FBIA 3HTSB 2UWMA 4Q47A 4L0ZB 3DEUA 3HIFA 3DF8A 1JE8A 1HSJA 1FWZA 2P5KA 2L4MA 4YIIA 1IN5A 3M8FA 1RUOA 3E6DA 1SMYF 1RZ4A 5DCFA 2JSCA 2VN2A 1MDMB 4RAZA 3WG9A 4IRGA 2XAJA 5JHUA 3I4PA 3PQJA 2JT1A 1R23A 1XSVA 4U0WA 2O8XA 2R7FA 1J75A 3DP7A 1TBXA 2DFIA 3V4GA 3VB2A 1X3UA 2YU3A 3QP5A 3E5UA 4AWXB 4YFNF 5LHIA 1K78A 1P92A 5CVIA 1XCVA 1KU7A 5FD5A 3FXRA 3TO6A 1SFUA 4P9FA 3K0LA 4XLPF 3OOPA 4A6EA 5TRDA 3HRUA 1XSXA 3H3ZA 4U7BA 3N4MA 5DV5A 1BJAA 1ZHFA 3P9CA 3ERED 2HYFA 4M6YA 1Y0UA 3LA2A 2DK5A 3TO7A 2D45A 4BHCA 3ZPLA 4HX4A 4BHBA 1LEBA 2A6EF 5ICCA 2PMUA 5H6QA 1R22A 2HS5A 1YYVA 3FM3A 3GFJA 2O6GE 1FBSA 1SFXA 2Y75A 3CUQA 4G7OF 1FOKA 4RGRA 1SMTA 2KKOA 2Z33A 3K1PA 3VODA 1KA8A 5ICGA 3M9AA 4XLNF 2GQQA 3CO6C 3FXUA 2PJPA 1WSUA 2FMYA 2PG4A 4HF0A 1IW7F 5ILSA 3E3VA 3ZMUA 2DQRA 1XGMA 3V8JA 1TNSA 4AIJA 2OU2A 5CVUA 4JBAA 2PLYA 3SFZA 4JK1X 4LK0F 3FWEA 5LHHA 4M74A 4NHJA 1ON2A 2J5OA 1ZRDA 1P6RA 1IF1A 1VTNC 3DQVC 2GAUA 4FHTA 1MJBA 4L9VA 1OPCA 5CLSA 2FXAA 4UHTA 1TNTA 4HQMA 3Q5FA 2HQRA 1XB4A 2GA2A 1O7FA 1W7PD 3TDUC 1ZG1A 2GZWA 3R0JA 3E5QA 2DPUA 3HYIA 4PZJA 3I59B 2HDCA 1USTA 4RB2C 4QWQA 4B8XA 3ML6A 1BI3A 3K2ZA 2PEXA 1I1SA 4CDGA 2YR2A 3HSEA 4A0YA 2K27A 4ENMA 2R7DA 2M30A 5FD6A 2YSRA 4BAYA 2STWA 2CQKA 2XV4S 4A5NA 1JGSA 3SXYA 3MFKA 5DDGA 2WTEA 1USSA 4UV8A 4EM1A 4AIKA 3CJNA 3RYPA 4EQQA 5ILUA 4XSZF 2GXBA 1EV7A 2VXZA 1T2KA 2P5LC 5LGUA 2J5PA 4ZYHA 4ZZLA 2NNYA 2QZ8A 1S6LA 2FU4A 1F1ZA 4WK8F 3HRMA 4GO1A 4UUVA 3I58A 2NAZA 2L01A 3SZPA 2V1UA 1K78B 1KU2A 3KLNA 2G7HA 1TQPA 5A2QK 5J8CA 2ELHA 2JZYA 1IN4A 4EVIA 2W84A 3K69A 5K5OA 3P7NA 4F7ZA 3LSTA 2ESNA 5JVTA 1FX7A 2GIVA 3F8FA 1YS6A 2ZO4A 4GGGA 2OQGA 5F64A 3RI4A 3PQKA 3RPQA 2L3DA 1B9NA 1BOAA 3DXJF 3HOSA 3QU6A 2KJBA 3LAJA 1O3RA 1ZYRF 2RV8A 4Q48A 4MQVA 3CUQB 2FBKA 2QWWA 3FM5A 1WI9A 2VC0A 3I71A 4LB6B 4KN7X 5LRRA 1IN8A 3IKVA 1G3SA 3J81K 2DBBA 5BS6A 5HDGA 1GHCA 1BI0A 4BQAA 3KLOA 1FBUA 2VBXA 1KQ8A 4MEXF 4N9IA 3LAPA 2DAOA 2HWVA 2O0YA 3I0TA 3TO9A 4IRHA 4WXDA 5HS8A 3L9FA 1B1BA 2Z3YA 5CVVA 1TLHB 2ISYA 2P7CB 1DDNA 2CFXA 1MZBA 3O6BB 2F5DA 2QBYB 1H0MA 2HKOA 5E1WA 4G8XA 2KIMA 2RN7A 2QUFA 2RGVA 2YX7A 2P5VA 3BDDA 1YFHA 3QP6A 2HYGD 5D5XB 2ACJA 5DUIA 2GWRA 4DNCA 3ABUA 3E97A 2NRAC 4ESBA 5K5RA 2STTA 2HTSA 4LGWA 3RKWA 5DUKA 4CHUA 2A6HF 4XSXF 2ZBKA 4OMYA 2RNJA 3HUGA 4UXNA 1XDUA 1K6OA 1EH7A 1TW2A 3IWFA 4I01A 3GZ5A 3TDZC 2M1BA 4L5JA 3B73A 1L3LA 2KRFA 4OOIA 2ZFWA 2E1CA 2NS0A 1DPUA 1BIBA 3BWGA 4LJZF 2W85A 1J9IA 2M8EA 4TV7A 2H09A 2VONA 5J6XA 2VOPA 1UHWA 3D0SA 1Z05A 1P4WA 2Z99A 3W6JB 2QYOA 3GW2A 5L3GA 2E7WA 1F9NA 3MEXA 1XMKA 2BEOA 3KZYA 2IRFG 3CUOA 1QPMA 3BJAA 4A0XA 2E1NA 3CLOA 3REOA 2CWEA 3F23A 2IA1A 3GVAA 5K5QA 4UVCA 2EK5A 4EJUA 4BYYA 1WKMA 1DUXC 1FC3A 1T98A 3WGHA 4HX7A 2EJRA 3WTVC 4HQEA 4OIRF 1TQIA 3L09A 3KCCA 3ABTA 4M73A 1Z7UA 2CSOA 1Z1DA 2FMLA 1FZPB 2F2EA 5E17F 2P6SA 1LEAA 1SAXA 1MJ9A 1YW9A 1QQIA 1O7LA 3RJPA 1QZYA 1G6NA 3K9TA 2CGPA 1FSEA 3FF5A 4CGZA 5CVRA 4KUMA 2HTJA 1K79A 1U5TC 2IPQX 4KMFA 4A2UA 4MTDA 2C6YA 2MLGA 5BOXA 2HKXA 1FNNA 5E20A 1IUYA 3K1MA 2XROA 1A04A 1HKQA 3V7CA 2IJLA 2XKOA 3ZN0A 3LQQA 4NQWA 1ZN2A 1LNWA 1B4AA 4QLCU 3ECHA 4LB5A 5ILVA 4G6QA 4A6DA 1R1UA 3IHUA 4ZYDA 3GWZA 4E70A 2F5CA 1H9GA 4MEYF 1H9TA 4UVAA 5LRSA 2EB7A 3LA3A 4I0AA 1E2XA 1HW1A 5DD8A 2BYVE 3BROA 4HV5A 4Y15A 1K7AA 4ENKA 3V7SA 1YIOA 1I5ZA 3ZMVA 4ZH4F 1ODDA 2LDUA 4OIPF 1FT9A 1BBYA 5D4SA 3R61A 4FX0A 1S8NA 2QQ9A 2IA0A 3ZP5A 1GXQA 2K4BA 3IRRA 2DK8A 1XD7A 3F22A 3WE3A 3JTGA 2FE3A 4HV6A 1ZLJA 4RGUA 3DPLC 3VFZA 1UB9A 2X0LA 4S04A 1D8JA 4RB1A 3V8KA 1R1VA 1G3WA 4JQFA 1KQ9A 1UHMA 2JTVA 5L3FA 2K02A 4M9ZA 3C18A 4KN4X 2QENA 3E6CC 1XCBA 2W25A 3P9KA 1FYMA 4HDUA 1WQ2A 2XHKA 5TJJA 3V7RA 1RNLA 3R6SA 4L0YB 2HOEA 1KU9A 3WTSC 3M7GA 3FMSA 2Q8KA 3HTUA 1J7KA 1HQCA 2M45A 4HOBA 3E5XA 1P4AA 2B0LA 1I6XA 3G73A 1BC8C 2VBYA 4I09A 5HS7A 2EFNA 1IN6A 3FX3A 2PFBA 4NB5A 1T0FA 4ON0A 1L0OC 4KIFA 3F21A 2CG4A 3CDHA 1MD0A 2W24A 4L9NA 3DFGA 1LDJA 2ESHA 2FEZA 1FSHA 3J80Z 5HOOA 1MJAA 3H92A 2A5YB 3GX4X 2F5EA 3RTRA 2XIGA 4P96A 3KP3A 3LQRA 4IJAA 4OINF 1CF7B 3ZQ7A 4LD5A 3F8MA 2EV6A 4N0BA 4KYWA 2AXLA 2A07F 1MKMA 3C7JA 1YO5C 2X4HA 1SFEA 4I98B 3TQNA 1FBQA 3JSOA 1BIAA 5D5VB 5E8GA 5BMZA 5FLXZ 5D8LB 2XAGA 3WTWC 3WTXC 2H94A 4EM0B 5JFRA 4ZYEA 3BOQA 4MQ9F 1J5YA 2OQRA 4BXUA 2DI3A 2EA2A 3VEPA 4IHSA 1O3TA 2M5WA 1FYKA 2V9VA 2LF8A 1B6AA 1YS7A 1HSTA 1U5TA 4PDKA 4IXAA 2JRTA 2A61A 3U1DA 1I1GA 4GYGA 1LDDA 3EUHA 2DTRA 4FX4A 5DCMA 3ELKA 3ZN1A 3FMQA 2L4AA 2PMHA 1REPC 5HDKA 2KJCA 5JI6A 2MH9A 2FSWA 4KNYA 1D3YA 2MH2A 2D1VA 4WX9A 3D5LA 2L54A 1ZGAA 5CVJA 3WTUC 3M8EA 4RB0A 4HBLA 3R0AA 3F3XA 5E8IA 2G9WA 2PQ8A 4PGGA 1KYZA 4AVPA 5D8KB 2IP2A 1KGSA 3QU3A 4L9JA 3WTYC 3I54A 1HKTA 3G3ZA 2OA4A 1ONVA 5F1RA 2EFWA 4UV9A 1P2FA 1PDNC 3GFLA 1R00A 3O3KA 4P55A 2VBWA 1RUNA 4KFCA 3RDIA 1CGPA 4UVBA 3BP8A 4P9UA 3LA7A 3BZ6A 3GLXA 4OIQF 2OZUA 4Y17A 3JSPA 3MQ0A 3RKXA 3CUQC 4YFKF 4Y13A 1EH6A 4RS8A 5IT9Z 5HS9A 1IAWA 5FO5A 4DQ2A 2MC3A 4BHPA 2P6TA 2RDPA 3O2PE 4ENNA 2IT0A 2WC2A 1HW2A 1OYWA 1QZZA 2WV0A 1KQ0A 1B9MA 4A12A 2OBPA 4R1HA 2G7UA 1SD6A 4PGHA 2FNPA 2DU9A 3SZTA 2UXNA 1JXSA 5FGMA 3N97A 4AIHA 3EQLF 1TTYA 2VT3A 2UXXA 2XAFA 4LLLA 1C0WA 3EYIA 1ON1A 1J59A 1D8KA 1EH8A 1BN5A 4M9XA 2EA4A 2KIFA 2FQ3A 2XKPA 3COAC 3KP5A 1ZRCA 4R8HA 2HFHA 5DD4A 2Z5UA 3ZMZA 3EDPA 4WXCA 3IC7A 4EJTA 1IN7A 3DV8A 1DPRA 4KIGA 3T1BA 4M6XA 3ZMSA 4HW0A 4OMZA 3WU1B 1HW5A 4HF2A 4G6DA 2MD5A 4ZZDA 6PAXA 2RC4A 4XBFA 1QGPA 4EV0A 1ZGJA 1OR7A 3MZHA 1HKSA 1JHHA 4LG0A 2V6CA 2VC1A 3MCZA 4BNCA 2GXGA 3U9GA 4RB3C 2TDXA 1RIOH 1O3SA 5D6EA 1J2XA 3C3WA 3JTHA 2BGCA 5J8FA 2WWYA 1I27A 5HVQC 4EJOA 4EGYA 2MA3A 1IRFA 5E18F 2BE5F 1ZARA 1ZG5A 3E6BA 4HAMA 2ZXJA 3WGGA 2HGCA 1UCRA 2LSOA 2MBFA 2W57A 3JAMZ 1G3TA 2VT2A 3F8NA 2XAHA 1G3YA 1Z91A 3ZMDA 2R3SA 2KIUA 3I5UA 3IRQA 3JAMK 1S29A 5DCMB 2D2WA 4WF2A 2XUBA 1S7AA 5L3CA 1OYIA 4YFXF 2H27A 1ZH5A 3RIRA 4A0ZA 4IVNA 5H6RA 3F8BA 4O5VA 2FBHA 1O57A 3KEQA 4D0PA 4AD9A 1OKRA 5D6FA 2F5FA 3SQNA 4ENJA 2VOOA 1YW8A 2K4JA 4G9YA 1LVAA 1MGTA 4IRIA 4HYEA 1W7PA 3EETA 1IZ1A 5BPIA 3GEZA 1ULYA 4LFUA 2ISZA 3MWMA 5L3DA 2OD5A 2K7LA 4IPAA 2RKHA 1QO0D 2Z9OA 1BM9A 1E17A 3GFMA 3T0YA 1GXPA 4ESFA 4L5IA 5AIQA 3R60A 1R5HA 5AIPA 1LQ1A 1G4DA 4UNOA 4G7ZF 2HQNA 3U2RA 2LKPA 3BJ6A 2CYYA 3NQOA 5E1XA 3M1EA 4KIBA 4M9SA 3WGIA 1YW7A 3WU0A 2QQBA 1TW3A 2VBZA 2H6CA 3KP7A 4CO8A 1JHFA 4KA4A 4LLNA 4WCGA 3BY6A 3WTZA 2P7VB 2D1HA 2JPCA 5KK1A 1XGOA 4WXHA 1F4KA 3F6OA 3WE2A 1HBXG 3BPXA 4GYIA 4MNUA 3QPHA 3HSFA 4O3MA 3HRTA 2EFQA 4I0BA 2AS5F 3L00A 5HDNA 2HEOA 1IRGA 3LFKA 4HA8A 4Q5SF 1XMAA 3GXOA 3RYRA 5L3EA 1ZG3A 2Q2EA 2ADUA 4KT5C 3SHFA 4CICA 1XGSA 4KDPA 2FNAA 3HSRA 1WWXA 2VE9A 1AWCA 5HLGA 1R36A 1SD4A 4ESJA 2BV6A 3L7WA 5FFXA 2A69F 4MTEA 1FYLA 5E1ZB 3T5XA 3TOAA 2ETHA 1PP7U 3I64A 5LBQA 1STZA 2IVMA 2QBYA 1YTYA 2ZMEA 4CZZA 1Z6RA 3FXQA 1TQMA 1T38A 2Y0MA 2O61A 2MLKA 5F6FA 4LG0B 4LK1F 1NHAA 2FA5A 1U78A 2QM3A 3PFIA 4MGRA 3GF2A 4HF1A 1QNTA 1W5SA 4HLYA 3VOEA 5D5WB 3R4KA 1OMIA 2O03A 4Z2YA 3QPTA 1BI2A 1OYYA 1IXCA 3LWFA 3QRFF 4S05A 2VODA 3FZVA 5HLIA 4RGSA 3J80K 2V79A 2ZNYA 3ULQB 5JR3A 3EYYA 4G94A 4LLGF 1SD7A 3AAFA 2DPDA 2OZ6A 4BH9A 3P9IA 1FPQA 3V8LA 3BJOA 2VE8A 2XGXA 4A5MA 1LJ9A 2ZNZA 1PUEE 3GFIA 2JPBA 3RPUA 2CO5A 1XN7A 1PP8F 5LHGA 3MZYA 4Q4ZF 4L9TA 1R7JA 1O3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GA1 A;  5H20 A;  3QOP A;  4U0Y A;  3TGN A;  5D4R A;  3HHG A;  1LDK B;  1U2W A;  4IHT A;  3GZ6 A;  1WRJ A;  5KVR A;  2LNB A;  3KP2 A;  3J7A O;  3KP4 A;  5FLX K;  2DT5 A;  1T6S A;  2Q0O A;  1P4X A;  2NYX A;  4ETS A;  3F6V A;  2DO7 A;  5FFZ A;  1FP1 D;  1W7P B;  3F72 A;  4N9H A;  4O6J A;  1FP2 A;  3GO5 A;  1DP7 P;  3KZZ A;  2EWN A;  2L02 A;  4GCV A;  4EGZ A;  3BPV A;  3T8R A;  2FF4 A;  5D5U B;  1J0R A;  1YQA A;  5EEH A;  1FY7 A;  1KU3 A;  1BC7 C;  5A2Q Z;  1RI7 A;  2QQA A;  4KIC A;  3ISP A;  1V4R A;  2QVO A;  2XAQ A;  1LB2 A;  1XDS A;  2O3F A;  3NRV A;  2YX4 A;  5DYM A;  1KYW A;  4YG2 F;  2A3S A;  2YPR A;  1IXR C;  1R58 A;  4P5O A;  3GYH X;  3KP6 A;  5FB2 A;  2H6B A;  3WOD F;  1U6G A;  4WWC A;  3TOB A;  1B59 A;  1F5T A;  1MDM A;  2E7X A;  3ZMT A;  5BQT A;  5LLQ A;  3K1N A;  5LEK A;  1S7O A;  1U3E M;  3I53 A;  4RGX A;  4OU0 A;  1YG2 A;  2Y48 A;  5CYV A;  3ROU A;  3W6K B;  5LEJ A;  1QBJ A;  3J81 Z;  3HOT A;  4XRF A;  2P4W A;  3KEO A;  5LGN A;  4L18 B;  3H3U A;  3FHZ A;  3FMR A;  2HZT A;  4PCQ A;  1Q1H A;  2DQL A;  3ECO A;  5ICF A;  4EM2 A;  4HX8 A;  1IXS B;  5LGT A;  2COM A;  1Z6T A;  2BBY A;  3IKT A;  2XVC A;  4HDV A;  1ZRE A;  4I02 A;  5IT9 K;  4M71 A;  2IA2 A;  3KET A;  2FOK A;  3MAJ A;  1R5G A;  2XAS A;  4KMU X;  2V1D A;  4CYD A;  2CW0 F;  2ZCW A;  5EEG A;  3QAH A;  3L2C A;  3WTT C;  5ICE A;  2ZME B;  2K86 A;  1D5V A;  3HHH A;  3HRS A;  2FRH A;  1W4M A;  3CTA A;  5BPD A;  3CO7 C;  5ED4 A;  4CXF A;  3T8T A;  3IL2 A;  4ASN A;  4OIO F;  4LMY A;  2A68 F;  2IW5 A;  3OV8 A;  2V1X A;  1YLF A;  3RKY A;  2HR3 A;  5K1Y A;  2LF7 A;  1ZLK A;  5L3B A;  3TKY A;  2QLZ A;  4EJW A;  1Z9C A;  3B02 A;  3NEU A;  2UZK A;  2EFP A;  3C1D A;  2ZKZ A;  4RAY A;  2ZJ2 A;  4G7H F;  1ZRF A;  4EMS A;  4FT8 A;  2DLL A;  4MHG A;  1AOY A;  3DKW A;  4YIF A;  4ZYG A;  3Q9S A;  1HXD A;  4U88 A;  1XGN A;  4U0V A;  2PI0 A;  1UFM A;  1XSD A;  3KFW X;  4U7D A;  1R1T A;  5CJ9 A;  1BI1 A;  2EFO A;  1T39 A;  2RQP A;  2OAZ A;  1SD5 A;  1V3F A;  4R79 A;  4M72 A;  4I7H A;  4HLX A;  2M87 A;  1FLI A;  4HZF A;  1S3J A;  3I59 A;  3IWZ A;  3E6M A;  3Q9V A;  4IF4 A;  3GUD A;  2PBI A;  2DW4 A;  3JW4 A;  2EV0 A;  4I2O A;  5ERI A;  5DEQ A;  1ZAO A;  2NNN A;  5IT3 A;  3KE2 A;  4EJV A;  1U5T B;  3S2W A;  3F8C A;  4B09 A;  2P8T A;  1GVJ A;  2XRN A;  2PN6 A;  4H0E A;  4GXO A;  1U8R A;  1W5T A;  2EV5 A;  2RVC A;  3DPT A;  5AON A;  5HLH A;  1CF7 A;  4K2E A;  2FBI A;  3HTS B;  2UWM A;  4Q47 A;  4L0Z B;  3DEU A;  3HIF A;  3DF8 A;  1JE8 A;  1HSJ A;  1FWZ A;  2P5K A;  2L4M A;  4YII A;  1IN5 A;  3M8F A;  1RUO A;  3E6D A;  1SMY F;  1RZ4 A;  5DCF A;  2JSC A;  2VN2 A;  1MDM B;  4RAZ A;  3WG9 A;  4IRG A;  2XAJ A;  5JHU A;  3I4P A;  3PQJ A;  2JT1 A;  1R23 A;  1XSV A;  4U0W A;  2O8X A;  2R7F A;  1J75 A;  3DP7 A;  1TBX A;  2DFI A;  3V4G A;  3VB2 A;  1X3U A;  2YU3 A;  3QP5 A;  3E5U A;  4AWX B;  4YFN F;  5LHI A;  1K78 A;  1P92 A;  5CVI A;  1XCV A;  1KU7 A;  5FD5 A;  3FXR A;  3TO6 A;  1SFU A;  4P9F A;  3K0L A;  4XLP F;  3OOP A;  4A6E A;  5TRD A;  3HRU A;  1XSX A;  3H3Z A;  4U7B A;  3N4M A;  5DV5 A;  1BJA A;  1ZHF A;  3P9C A;  3ERE D;  2HYF A;  4M6Y A;  1Y0U A;  3LA2 A;  2DK5 A;  3TO7 A;  2D45 A;  4BHC A;  3ZPL A;  4HX4 A;  4BHB A;  1LEB A;  2A6E F;  5ICC A;  2PMU A;  5H6Q A;  1R22 A;  2HS5 A;  1YYV A;  3FM3 A;  3GFJ A;  2O6G E;  1FBS A;  1SFX A;  2Y75 A;  3CUQ A;  4G7O F;  1FOK A;  4RGR A;  1SMT A;  2KKO A;  2Z33 A;  3K1P A;  3VOD A;  1KA8 A;  5ICG A;  3M9A A;  4XLN F;  2GQQ A;  3CO6 C;  3FXU A;  2PJP A;  1WSU A;  2FMY A;  2PG4 A;  4HF0 A;  1IW7 F;  5ILS A;  3E3V A;  3ZMU A;  2DQR A;  1XGM A;  3V8J A;  1TNS A;  4AIJ A;  2OU2 A;  5CVU A;  4JBA A;  2PLY A;  3SFZ A;  4JK1 X;  4LK0 F;  3FWE A;  5LHH A;  4M74 A;  4NHJ A;  1ON2 A;  2J5O A;  1ZRD A;  1P6R A;  1IF1 A;  1VTN C;  3DQV C;  2GAU A;  4FHT A;  1MJB A;  4L9V A;  1OPC A;  5CLS A;  2FXA A;  4UHT A;  1TNT A;  4HQM A;  3Q5F A;  2HQR A;  1XB4 A;  2GA2 A;  1O7F A;  1W7P D;  3TDU C;  1ZG1 A;  2GZW A;  3R0J A;  3E5Q A;  2DPU A;  3HYI A;  4PZJ A;  3I59 B;  2HDC A;  1UST A;  4RB2 C;  4QWQ A;  4B8X A;  3ML6 A;  1BI3 A;  3K2Z A;  2PEX A;  1I1S A;  4CDG A;  2YR2 A;  3HSE A;  4A0Y A;  2K27 A;  4ENM A;  2R7D A;  2M30 A;  5FD6 A;  2YSR A;  4BAY A;  2STW A;  2CQK A;  2XV4 S;  4A5N A;  1JGS A;  3SXY A;  3MFK A;  5DDG A;  2WTE A;  1USS A;  4UV8 A;  4EM1 A;  4AIK A;  3CJN A;  3RYP A;  4EQQ A;  5ILU A;  4XSZ F;  2GXB A;  1EV7 A;  2VXZ A;  1T2K A;  2P5L C;  5LGU A;  2J5P A;  4ZYH A;  4ZZL A;  2NNY A;  2QZ8 A;  1S6L A;  2FU4 A;  1F1Z A;  4WK8 F;  3HRM A;  4GO1 A;  4UUV A;  3I58 A;  2NAZ A;  2L01 A;  3SZP A;  2V1U A;  1K78 B;  1KU2 A;  3KLN A;  2G7H A;  1TQP A;  5A2Q K;  5J8C A;  2ELH A;  2JZY A;  1IN4 A;  4EVI A;  2W84 A;  3K69 A;  5K5O A;  3P7N A;  4F7Z A;  3LST A;  2ESN A;  5JVT A;  1FX7 A;  2GIV A;  3F8F A;  1YS6 A;  2ZO4 A;  4GGG A;  2OQG A;  5F64 A;  3RI4 A;  3PQK A;  3RPQ A;  2L3D A;  1B9N A;  1BOA A;  3DXJ F;  3HOS A;  3QU6 A;  2KJB A;  3LAJ A;  1O3R A;  1ZYR F;  2RV8 A;  4Q48 A;  4MQV A;  3CUQ B;  2FBK A;  2QWW A;  3FM5 A;  1WI9 A;  2VC0 A;  3I71 A;  4LB6 B;  4KN7 X;  5LRR A;  1IN8 A;  3IKV A;  1G3S A;  3J81 K;  2DBB A;  5BS6 A;  5HDG A;  1GHC A;  1BI0 A;  4BQA A;  3KLO A;  1FBU A;  2VBX A;  1KQ8 A;  4MEX F;  4N9I A;  3LAP A;  2DAO A;  2HWV A;  2O0Y A;  3I0T A;  3TO9 A;  4IRH A;  4WXD A;  5HS8 A;  3L9F A;  1B1B A;  2Z3Y A;  5CVV A;  1TLH B;  2ISY A;  2P7C B;  1DDN A;  2CFX A;  1MZB A;  3O6B B;  2F5D A;  2QBY B;  1H0M A;  2HKO A;  5E1W A;  4G8X A;  2KIM A;  2RN7 A;  2QUF A;  2RGV A;  2YX7 A;  2P5V A;  3BDD A;  1YFH A;  3QP6 A;  2HYG D;  5D5X B;  2ACJ A;  5DUI A;  2GWR A;  4DNC A;  3ABU A;  3E97 A;  2NRA C;  4ESB A;  5K5R A;  2STT A;  2HTS A;  4LGW A;  3RKW A;  5DUK A;  4CHU A;  2A6H F;  4XSX F;  2ZBK A;  4OMY A;  2RNJ A;  3HUG A;  4UXN A;  1XDU A;  1K6O A;  1EH7 A;  1TW2 A;  3IWF A;  4I01 A;  3GZ5 A;  3TDZ C;  2M1B A;  4L5J A;  3B73 A;  1L3L A;  2KRF A;  4OOI A;  2ZFW A;  2E1C A;  2NS0 A;  1DPU A;  1BIB A;  3BWG A;  4LJZ F;  2W85 A;  1J9I A;  2M8E A;  4TV7 A;  2H09 A;  2VON A;  5J6X A;  2VOP A;  1UHW A;  3D0S A;  1Z05 A;  1P4W A;  2Z99 A;  3W6J B;  2QYO A;  3GW2 A;  5L3G A;  2E7W A;  1F9N A;  3MEX A;  1XMK A;  2BEO A;  3KZY A;  2IRF G;  3CUO A;  1QPM A;  3BJA A;  4A0X A;  2E1N A;  3CLO A;  3REO A;  2CWE A;  3F23 A;  2IA1 A;  3GVA A;  5K5Q A;  4UVC A;  2EK5 A;  4EJU A;  4BYY A;  1WKM A;  1DUX C;  1FC3 A;  1T98 A;  3WGH A;  4HX7 A;  2EJR A;  3WTV C;  4HQE A;  4OIR F;  1TQI A;  3L09 A;  3KCC A;  3ABT A;  4M73 A;  1Z7U A;  2CSO A;  1Z1D A;  2FML A;  1FZP B;  2F2E A;  5E17 F;  2P6S A;  1LEA A;  1SAX A;  1MJ9 A;  1YW9 A;  1QQI A;  1O7L A;  3RJP A;  1QZY A;  1G6N A;  3K9T A;  2CGP A;  1FSE A;  3FF5 A;  4CGZ A;  5CVR A;  4KUM A;  2HTJ A;  1K79 A;  1U5T C;  2IPQ X;  4KMF A;  4A2U A;  4MTD A;  2C6Y A;  2MLG A;  5BOX A;  2HKX A;  1FNN A;  5E20 A;  1IUY A;  3K1M A;  2XRO A;  1A04 A;  1HKQ A;  3V7C A;  2IJL A;  2XKO A;  3ZN0 A;  3LQQ A;  4NQW A;  1ZN2 A;  1LNW A;  1B4A A;  4QLC U;  3ECH A;  4LB5 A;  5ILV A;  4G6Q A;  4A6D A;  1R1U A;  3IHU A;  4ZYD A;  3GWZ A;  4E70 A;  2F5C A;  1H9G A;  4MEY F;  1H9T A;  4UVA A;  5LRS A;  2EB7 A;  3LA3 A;  4I0A A;  1E2X A;  1HW1 A;  5DD8 A;  2BYV E;  3BRO A;  4HV5 A;  4Y15 A;  1K7A A;  4ENK A;  3V7S A;  1YIO A;  1I5Z A;  3ZMV A;  4ZH4 F;  1ODD A;  2LDU A;  4OIP F;  1FT9 A;  1BBY A;  5D4S A;  3R61 A;  4FX0 A;  1S8N A;  2QQ9 A;  2IA0 A;  3ZP5 A;  1GXQ A;  2K4B A;  3IRR A;  2DK8 A;  1XD7 A;  3F22 A;  3WE3 A;  3JTG A;  2FE3 A;  4HV6 A;  1ZLJ A;  4RGU A;  3DPL C;  3VFZ A;  1UB9 A;  2X0L A;  4S04 A;  1D8J A;  4RB1 A;  3V8K A;  1R1V A;  1G3W A;  4JQF A;  1KQ9 A;  1UHM A;  2JTV A;  5L3F A;  2K02 A;  4M9Z A;  3C18 A;  4KN4 X;  2QEN A;  3E6C C;  1XCB A;  2W25 A;  3P9K A;  1FYM A;  4HDU A;  1WQ2 A;  2XHK A;  5TJJ A;  3V7R A;  1RNL A;  3R6S A;  4L0Y B;  2HOE A;  1KU9 A;  3WTS C;  3M7G A;  3FMS A;  2Q8K A;  3HTU A;  1J7K A;  1HQC A;  2M45 A;  4HOB A;  3E5X A;  1P4A A;  2B0L A;  1I6X A;  3G73 A;  1BC8 C;  2VBY A;  4I09 A;  5HS7 A;  2EFN A;  1IN6 A;  3FX3 A;  2PFB A;  4NB5 A;  1T0F A;  4ON0 A;  1L0O C;  4KIF A;  3F21 A;  2CG4 A;  3CDH A;  1MD0 A;  2W24 A;  4L9N A;  3DFG A;  1LDJ A;  2ESH A;  2FEZ A;  1FSH A;  3J80 Z;  5HOO A;  1MJA A;  3H92 A;  2A5Y B;  3GX4 X;  2F5E A;  3RTR A;  2XIG A;  4P96 A;  3KP3 A;  3LQR A;  4IJA A;  4OIN F;  1CF7 B;  3ZQ7 A;  4LD5 A;  3F8M A;  2EV6 A;  4N0B A;  4KYW A;  2AXL A;  2A07 F;  1MKM A;  3C7J A;  1YO5 C;  2X4H A;  1SFE A;  4I98 B;  3TQN A;  1FBQ A;  3JSO A;  1BIA A;  5D5V B;  5E8G A;  5BMZ A;  5FLX Z;  5D8L B;  2XAG A;  3WTW C;  3WTX C;  2H94 A;  4EM0 B;  5JFR A;  4ZYE A;  3BOQ A;  4MQ9 F;  1J5Y A;  2OQR A;  4BXU A;  2DI3 A;  2EA2 A;  3VEP A;  4IHS A;  1O3T A;  2M5W A;  1FYK A;  2V9V A;  2LF8 A;  1B6A A;  1YS7 A;  1HST A;  1U5T A;  4PDK A;  4IXA A;  2JRT A;  2A61 A;  3U1D A;  1I1G A;  4GYG A;  1LDD A;  3EUH A;  2DTR A;  4FX4 A;  5DCM A;  3ELK A;  3ZN1 A;  3FMQ A;  2L4A A;  2PMH A;  1REP C;  5HDK A;  2KJC A;  5JI6 A;  2MH9 A;  2FSW A;  4KNY A;  1D3Y A;  2MH2 A;  2D1V A;  4WX9 A;  3D5L A;  2L54 A;  1ZGA A;  5CVJ A;  3WTU C;  3M8E A;  4RB0 A;  4HBL A;  3R0A A;  3F3X A;  5E8I A;  2G9W A;  2PQ8 A;  4PGG A;  1KYZ A;  4AVP A;  5D8K B;  2IP2 A;  1KGS A;  3QU3 A;  4L9J A;  3WTY C;  3I54 A;  1HKT A;  3G3Z A;  2OA4 A;  1ONV A;  5F1R A;  2EFW A;  4UV9 A;  1P2F A;  1PDN C;  3GFL A;  1R00 A;  3O3K A;  4P55 A;  2VBW A;  1RUN A;  4KFC A;  3RDI A;  1CGP A;  4UVB A;  3BP8 A;  4P9U A;  3LA7 A;  3BZ6 A;  3GLX A;  4OIQ F;  2OZU A;  4Y17 A;  3JSP A;  3MQ0 A;  3RKX A;  3CUQ C;  4YFK F;  4Y13 A;  1EH6 A;  4RS8 A;  5IT9 Z;  5HS9 A;  1IAW A;  5FO5 A;  4DQ2 A;  2MC3 A;  4BHP A;  2P6T A;  2RDP A;  3O2P E;  4ENN A;  2IT0 A;  2WC2 A;  1HW2 A;  1OYW A;  1QZZ A;  2WV0 A;  1KQ0 A;  1B9M A;  4A12 A;  2OBP A;  4R1H A;  2G7U A;  1SD6 A;  4PGH A;  2FNP A;  2DU9 A;  3SZT A;  2UXN A;  1JXS A;  5FGM A;  3N97 A;  4AIH A;  3EQL F;  1TTY A;  2VT3 A;  2UXX A;  2XAF A;  4LLL A;  1C0W A;  3EYI A;  1ON1 A;  1J59 A;  1D8K A;  1EH8 A;  1BN5 A;  4M9X A;  2EA4 A;  2KIF A;  2FQ3 A;  2XKP A;  3COA C;  3KP5 A;  1ZRC A;  4R8H A;  2HFH A;  5DD4 A;  2Z5U A;  3ZMZ A;  3EDP A;  4WXC A;  3IC7 A;  4EJT A;  1IN7 A;  3DV8 A;  1DPR A;  4KIG A;  3T1B A;  4M6X A;  3ZMS A;  4HW0 A;  4OMZ A;  3WU1 B;  1HW5 A;  4HF2 A;  4G6D A;  2MD5 A;  4ZZD A;  6PAX A;  2RC4 A;  4XBF A;  1QGP A;  4EV0 A;  1ZGJ A;  1OR7 A;  3MZH A;  1HKS A;  1JHH A;  4LG0 A;  2V6C A;  2VC1 A;  3MCZ A;  4BNC A;  2GXG A;  3U9G A;  4RB3 C;  2TDX A;  1RIO H;  1O3S A;  5D6E A;  1J2X A;  3C3W A;  3JTH A;  2BGC A;  5J8F A;  2WWY A;  1I27 A;  5HVQ C;  4EJO A;  4EGY A;  2MA3 A;  1IRF A;  5E18 F;  2BE5 F;  1ZAR A;  1ZG5 A;  3E6B A;  4HAM A;  2ZXJ A;  3WGG A;  2HGC A;  1UCR A;  2LSO A;  2MBF A;  2W57 A;  3JAM Z;  1G3T A;  2VT2 A;  3F8N A;  2XAH A;  1G3Y A;  1Z91 A;  3ZMD A;  2R3S A;  2KIU A;  3I5U A;  3IRQ A;  3JAM K;  1S29 A;  5DCM B;  2D2W A;  4WF2 A;  2XUB A;  1S7A A;  5L3C A;  1OYI A;  4YFX F;  2H27 A;  1ZH5 A;  3RIR A;  4A0Z A;  4IVN A;  5H6R A;  3F8B A;  4O5V A;  2FBH A;  1O57 A;  3KEQ A;  4D0P A;  4AD9 A;  1OKR A;  5D6F A;  2F5F A;  3SQN A;  4ENJ A;  2VOO A;  1YW8 A;  2K4J A;  4G9Y A;  1LVA A;  1MGT A;  4IRI A;  4HYE A;  1W7P A;  3EET A;  1IZ1 A;  5BPI A;  3GEZ A;  1ULY A;  4LFU A;  2ISZ A;  3MWM A;  5L3D A;  2OD5 A;  2K7L A;  4IPA A;  2RKH A;  1QO0 D;  2Z9O A;  1BM9 A;  1E17 A;  3GFM A;  3T0Y A;  1GXP A;  4ESF A;  4L5I A;  5AIQ A;  3R60 A;  1R5H A;  5AIP A;  1LQ1 A;  1G4D A;  4UNO A;  4G7Z F;  2HQN A;  3U2R A;  2LKP A;  3BJ6 A;  2CYY A;  3NQO A;  5E1X A;  3M1E A;  4KIB A;  4M9S A;  3WGI A;  1YW7 A;  3WU0 A;  2QQB A;  1TW3 A;  2VBZ A;  2H6C A;  3KP7 A;  4CO8 A;  1JHF A;  4KA4 A;  4LLN A;  4WCG A;  3BY6 A;  3WTZ A;  2P7V B;  2D1H A;  2JPC A;  5KK1 A;  1XGO A;  4WXH A;  1F4K A;  3F6O A;  3WE2 A;  1HBX G;  3BPX A;  4GYI A;  4MNU A;  3QPH A;  3HSF A;  4O3M A;  3HRT A;  2EFQ A;  4I0B A;  2AS5 F;  3L00 A;  5HDN A;  2HEO A;  1IRG A;  3LFK A;  4HA8 A;  4Q5S F;  1XMA A;  3GXO A;  3RYR A;  5L3E A;  1ZG3 A;  2Q2E A;  2ADU A;  4KT5 C;  3SHF A;  4CIC A;  1XGS A;  4KDP A;  2FNA A;  3HSR A;  1WWX A;  2VE9 A;  1AWC A;  5HLG A;  1R36 A;  1SD4 A;  4ESJ A;  2BV6 A;  3L7W A;  5FFX A;  2A69 F;  4MTE A;  1FYL A;  5E1Z B;  3T5X A;  3TOA A;  2ETH A;  1PP7 U;  3I64 A;  5LBQ A;  1STZ A;  2IVM A;  2QBY A;  1YTY A;  2ZME A;  4CZZ A;  1Z6R A;  3FXQ A;  1TQM A;  1T38 A;  2Y0M A;  2O61 A;  2MLK A;  5F6F A;  4LG0 B;  4LK1 F;  1NHA A;  2FA5 A;  1U78 A;  2QM3 A;  3PFI A;  4MGR A;  3GF2 A;  4HF1 A;  1QNT A;  1W5S A;  4HLY A;  3VOE A;  5D5W B;  3R4K A;  1OMI A;  2O03 A;  4Z2Y A;  3QPT A;  1BI2 A;  1OYY A;  1IXC A;  3LWF A;  3QRF F;  4S05 A;  2VOD A;  3FZV A;  5HLI A;  4RGS A;  3J80 K;  2V79 A;  2ZNY A;  3ULQ B;  5JR3 A;  3EYY A;  4G94 A;  4LLG F;  1SD7 A;  3AAF A;  2DPD A;  2OZ6 A;  4BH9 A;  3P9I A;  1FPQ A;  3V8L A;  3BJO A;  2VE8 A;  2XGX A;  4A5M A;  1LJ9 A;  2ZNZ A;  1PUE E;  3GFI A;  2JPB A;  3RPU A;  2CO5 A;  1XN7 A;  1PP8 F;  5LHG A;  3MZY A;  4Q4Z F;  4L9T A;  1R7J A;  1O3Q A; 
#chains in the Genus database with same CATH topology
 5E3N A;  1YE9 A;  2GA1 A;  5H20 A;  1YHQ I;  3QOP A;  4U0Y A;  2JWT A;  3TGN A;  3BR0 A;  2BVM A;  5D4R A;  2CUF A;  2LH9 A;  3HHG A;  2MG4 A;  4RLF A;  1LDK B;  3CF2 A;  1U2W A;  2K9S A;  4Y52 J;  3H1C A;  4IHT A;  3GZ6 A;  2R93 J;  1WRJ A;  5KVR A;  3ABM H;  2LNB A;  3ZQH A;  1P7I A;  3KP2 A;  3J7A O;  3KP4 A;  5EG0 A;  4CCM A;  5FLX K;  2DT5 A;  3IP4 B;  4IQ4 A;  1T6S A;  2Q0O A;  1P4X A;  2DA5 A;  2NYX A;  3BQZ A;  3M3Y J;  2Y0S N;  3F6V A;  4ETS A;  3X2Q H;  1YI2 I;  2DO7 A;  1VQ7 I;  1W36 C;  4F93 B;  2Y69 H;  5FFZ A;  2DOF A;  1FP1 D;  2E60 A;  1W7P B;  2FOW A;  3F72 A;  4NC7 A;  4N9H A;  4O6J A;  2A6T A;  1FP2 A;  2WBM A;  3GTJ J;  1LE8 B;  5B3S H;  3GO5 A;  1VQM I;  1DP7 P;  2D5V A;  3BR6 A;  3KZZ A;  2EWN A;  3L2W A;  1WJF A;  3VYT B;  4JP0 A;  2L02 A;  2DA2 A;  4GCV A;  4NQW B;  2QSH X;  4EGZ A;  1BOB A;  5C4X J;  4OWR B;  3BPV A;  3T8R A;  1R4M B;  2FF4 A;  5D5U B;  4DOZ A;  1QVT A;  1J0R A;  5FLV A;  1YQA A;  5EEH A;  1FY7 A;  1KU3 A;  2K9Q A;  1BC7 C;  2DTZ A;  5A2Q Z;  1JKP C;  5IP9 J;  1RI7 A;  2QQA A;  4MLO A;  4KIC A;  4RAG A;  1BW6 A;  3BT9 A;  2M2E A;  3ISP A;  4BXF A;  1V4R A;  2QVO A;  2XAQ A;  4HNT A;  1LB2 A;  3S1Q J;  3TED A;  1XDS A;  1QVU A;  4IHX A;  1Z7L A;  2O3F A;  3NRV A;  2YX4 A;  5DYM A;  1KYW A;  2JVG A;  2A3S A;  4YG2 F;  3S1R J;  3SYT A;  2KPM A;  2YPR A;  3LSM A;  1VQ5 I;  1IXR C;  1F36 A;  1OCZ H;  1R58 A;  2BY3 A;  2UV1 A;  4P5O A;  1H88 C;  2WV1 A;  3FBN B;  4BGD A;  3GYH X;  3KP6 A;  2Y0S A;  5FB2 A;  4MIM A;  2DMN A;  2H6B A;  2XDV A;  3WOD F;  1U6G A;  4WWC A;  4D7M A;  3TOB A;  3H9J A;  3C2B A;  1B59 A;  4KJZ A;  2NXN B;  1X3W B;  3EUA A;  1F5T A;  1E0E A;  4E7L A;  1MDM A;  4M3D A;  5IPA A;  3LNQ A;  1SEU A;  2E7X A;  1X4O A;  3ZMT A;  5EEA A;  2CFO A;  5BQT A;  5LLQ A;  3HC7 A;  4I76 A;  3K1N A;  5LEK A;  1S7O A;  3IV5 A;  3M8J A;  3I53 A;  4RGX A;  4EEF G;  1U3E M;  1F43 A;  1MH4 A;  4OU0 A;  3G1L A;  1YG2 A;  3F9K A;  2OPT A;  2Y48 A;  3H0D A;  1M1E B;  5CYV A;  3WHB A;  3QPS A;  1WJE A;  2KZG A;  3ROU A;  3W6K B;  5LEJ A;  2HQA A;  2CQQ A;  3B6A A;  1QBJ A;  4UY8 I;  3NWT A;  2VKH A;  4PJL A;  3J81 Z;  3HOT A;  4CYC B;  4XRF A;  4ZYA A;  2P4W A;  3AL0 C;  1B72 A;  2LRE A;  3KEO A;  4AC0 A;  3OIP A;  1DU6 A;  5LGN A;  4L18 B;  3H3U A;  3FHZ A;  3FMR A;  1YRN B;  4CZC A;  2Q2E B;  2HZT A;  3QQA A;  3LSK A;  4PCQ A;  1Q1H A;  2GXA A;  4BEH B;  2DQL A;  3ECO A;  5ICF A;  4AU7 A;  4EM2 A;  4HX8 A;  5J3L A;  1IXS B;  4JX5 A;  5LGT A;  2CRG A;  2COM A;  1Z6T A;  3CC4 I;  2BBY A;  2Q1Z B;  5EZG A;  2ME6 A;  3IKT A;  2KLO A;  4F91 B;  2XVC A;  5FKK A;  4HDV A;  1XC5 A;  2R7S A;  5DTD A;  3GZN B;  4XM3 A;  5F08 A;  1ZRE A;  4I02 A;  1POG A;  4DZP A;  5IT9 K;  3J7Y J;  2XGD A;  4M71 A;  2IA2 A;  3KET A;  1MNM C;  2FOK A;  3FBI B;  3MAJ A;  1R5G A;  2XAS A;  4KMU X;  2V1D A;  2ZJR F;  4CYD A;  2CW0 F;  2VLA A;  3W2A A;  2ZCW A;  2CV1 A;  1I39 A;  2F48 A;  3QAH A;  5EEG A;  3L2C A;  3WTT C;  5ICE A;  2ZME B;  2ZXI A;  3CDI A;  5F0C A;  2K86 A;  3RQ4 A;  4D5F A;  4FQG A;  1D5V A;  5EF6 A;  3FIS A;  1X19 A;  3HHH A;  4XQF A;  3W2W A;  3HRS A;  2OCC H;  2FRH A;  1W4M A;  2XF6 A;  3CTA A;  4IEJ A;  5JHF A;  5BPD A;  3CO7 C;  4Y4R A;  5ED4 A;  1W0U A;  3KYC B;  3ZQF A;  3SFI A;  1PYV A;  3JRI A;  4E7J A;  4CXF A;  3T8T A;  3IL2 A;  3F0C A;  4PFO A;  2PMZ N;  3J7Z I;  4ASN A;  4OIO F;  1Z0X A;  4LMY A;  1PUF A;  2ZXW H;  2A68 F;  4PUS A;  2IW5 A;  3CCQ I;  3OV8 A;  2F4I A;  2V1X A;  1YLF A;  3RKY A;  2HR3 A;  3CD6 I;  5K1Y A;  2LF7 A;  1ZLK A;  5L3B A;  4BQN A;  3UR3 C;  2B63 J;  3TKY A;  2KRC A;  2OV7 A;  3DTI A;  2QLZ A;  4FET A;  4EJW A;  5JLW A;  1Z9C A;  3B02 A;  3HM5 A;  4HST A;  3NEU A;  2UZK A;  1A6I A;  3W3C A;  2EFP A;  2PJR A;  3C1D A;  4DW6 A;  1Y39 A;  3CMM A;  2ZKZ A;  4RAY A;  3IUO A;  3CCL I;  5HLT A;  2CV2 A;  2ZJ2 A;  3GBG A;  4HG2 A;  2NS8 A;  4II3 A;  1JJ6 C;  1IDY A;  4G7H F;  1FMW A;  4AID A;  1ZRF A;  4EMS A;  2BW3 A;  4FT8 A;  1Z77 A;  4ZTF A;  2DLL A;  4MHG A;  3D5R C;  4MO7 A;  2H8W A;  3OYJ A;  1BA5 A;  4S0H B;  1AOY A;  3DKW A;  4YIF A;  4ZYG A;  3Q9S A;  1HXD A;  4XLA A;  1MSF C;  4U88 A;  1XGN A;  4U0V A;  2N8G A;  1ITY A;  2PI0 A;  2PMZ A;  4ABZ A;  1UFM A;  1XSD A;  3CDL A;  1K6Y A;  3KFW X;  4V19 K;  1Y0N A;  4U7D A;  1R1T A;  3N05 A;  5CJ9 A;  1TWG J;  1BI1 A;  2EFO A;  1T39 A;  1IC8 A;  2R7W A;  2WAQ N;  2RQP A;  2OAZ A;  5FKO A;  1SD5 A;  1V3F A;  3WG7 H;  4R79 A;  2CW7 A;  4M72 A;  3GTO J;  4I7H A;  4HLX A;  2M87 A;  1FLI A;  2EIK H;  4HZF A;  1S3J A;  3I59 A;  3IWZ A;  3E6M A;  3Q9V A;  4IF4 A;  2UUZ A;  1XMX A;  3HJE A;  3S16 J;  1ETQ A;  3GUD A;  2PBI A;  2DW4 A;  2B9S A;  3JW4 A;  2EV0 A;  4RMN A;  1TL8 A;  4I2O A;  5ERI A;  5DEQ A;  3CZ6 A;  1ZAO A;  2NNN A;  5IT3 A;  3KE2 A;  5FRN A;  4EJV A;  9ANT A;  1D0Z A;  1U5T B;  2F4O B;  3S2W A;  3F8C A;  1OCC H;  4B09 A;  2P8T A;  1GVJ A;  1OIS A;  2XRN A;  2PN6 A;  1S9H A;  4H0E A;  4GXO A;  1U8R A;  1W5T A;  2EV5 A;  2RVC A;  3DPT A;  5AON A;  5C4J J;  1VQ4 I;  1V55 H;  1QRY A;  5HLH A;  1WH7 A;  2QQ8 A;  3S1N J;  4NNJ A;  1CF7 A;  3OOU A;  2NOJ B;  4AYB A;  4K2E A;  3S3N A;  2FBI A;  3HTS B;  2UWM A;  4Q47 A;  5CKT A;  4BY7 J;  3S3M A;  3M07 A;  4L0Z B;  2EZH A;  3AG4 H;  3DWL E;  4OAZ A;  3DEU A;  3HIF A;  3DF8 A;  5J1R A;  1JE8 A;  3EUK L;  1HSJ A;  2RAE A;  1FWZ A;  2P5K A;  2L4M A;  5IOY A;  3MVP A;  4YII A;  2V26 A;  1IN5 A;  3M8F A;  1RUO A;  3E6D A;  4PJJ A;  1BL0 A;  4MFD A;  1SMY F;  1RZ4 A;  1CQT A;  5DCF A;  2JSC A;  2CU7 A;  2VN2 A;  1MDM B;  4RAZ A;  1R4N B;  3WG9 A;  4IRG A;  2XAJ A;  5JHU A;  4W97 A;  3I4P A;  3M4O J;  1FOW A;  3PQJ A;  2JT1 A;  3SDG A;  5K7H A;  1R23 A;  1XSV A;  2KL4 A;  5HOD A;  1VQL I;  4U0W A;  2O8X A;  3ZR8 X;  2R7F A;  1J75 A;  1MMA A;  3JRF A;  5M5X J;  3DP7 A;  1MBJ A;  2CMP A;  1TBX A;  3ZQQ A;  2DCE A;  3JRH A;  2DFI A;  2GIZ A;  3V4G A;  2ZSH B;  3VB2 A;  4IKF A;  1X3U A;  3W2V A;  2YU3 A;  4CCN A;  3QP5 A;  3E5U A;  4AWX B;  4YFN F;  5LD2 C;  3TP0 A;  2JA7 J;  4CCK A;  5LHI A;  1K78 A;  1FJL A;  1P92 A;  5CVI A;  1XCV A;  2KFD A;  1KU7 A;  2H1K A;  1B72 B;  5FD5 A;  3FXR A;  2LY9 A;  1HOM A;  3TO6 A;  1RR7 A;  1N77 A;  1SFU A;  2VPR A;  3JRD A;  4P9F A;  4ANJ A;  1GLN A;  3K0L A;  4XLP F;  4A3L J;  3OOP A;  4A6E A;  5TRD A;  2DA6 A;  3CQZ J;  1TT5 B;  2JA6 J;  3HEF A;  3HRU A;  3OYN A;  1XSX A;  3H3Z A;  4U7B A;  3N4M A;  5DV5 A;  4F55 A;  2MFZ A;  2L9V A;  1BJA A;  2ECC A;  1ZHF A;  4BJT A;  3BR5 A;  3P9C A;  5FKN A;  3ERE D;  1MH3 A;  2LOO A;  2HYF A;  2HDD A;  2Y2Z A;  1ENH A;  4M6Y A;  1Y0U A;  1U0J A;  2RRE A;  3LA2 A;  2WAF A;  2DK5 A;  4FIS A;  3TO7 A;  2D45 A;  4BHC A;  1RC9 A;  3ZPL A;  4HX4 A;  4BHB A;  1LEB A;  2Y9Z A;  2VKE A;  1H89 C;  3HOV J;  2A6E F;  5CQE A;  2KT0 A;  4XMY A;  5ICC A;  2PMU A;  5H6Q A;  4A3M J;  1R22 A;  2HS5 A;  4DGW B;  1YYV A;  3FM3 A;  3GFJ A;  5E3L A;  1U9N A;  3VDX A;  2KRH A;  2O6G E;  1MMN A;  1FBS A;  1SFX A;  1WPK A;  2Y75 A;  3CUQ A;  1A31 A;  1MW7 A;  2WB1 N;  4G7O F;  3CP8 A;  3DLL F;  1QU3 A;  2A5W A;  1FOK A;  1SMT A;  4RGR A;  1FTT A;  2R7U A;  4C2M J;  2KKO A;  2Z33 A;  3K1P A;  3VOD A;  1KA8 A;  1MNE A;  3HOW J;  1RES A;  5ICG A;  3H5A A;  2VXD A;  1JUP A;  1X2N A;  4XLE A;  2X51 A;  1W0T A;  3M9A A;  4XLN F;  2KDO A;  2GQQ A;  5F1J A;  3CO6 C;  1WJB A;  3BTI A;  3FXU A;  2PJP A;  1WSU A;  4XLH A;  1FIA A;  1UEL B;  2FMY A;  1OJL A;  3OY9 A;  4HRI A;  2PG4 A;  5KAI C;  2WY8 Q;  4HF0 A;  3D5S C;  1IW7 F;  5ILS A;  3E3V A;  3ZMU A;  4RM3 A;  1TT0 A;  2XF5 A;  2DQR A;  1XGM A;  3PSI A;  3V8J A;  1TNS A;  1X3Z B;  4AIJ A;  2OU2 A;  1KON A;  2I10 A;  1XX5 A;  1FTZ A;  5CVU A;  1WCM J;  1YOV B;  3RKQ A;  4JBA A;  2PJR B;  2IS6 A;  2PLY A;  1Y8R B;  3SFZ A;  4J01 A;  4B3A A;  4JK1 X;  4LK0 F;  2DN0 A;  3FWE A;  1G2H A;  2E19 A;  5LHH A;  2BW3 B;  4M74 A;  3BTC A;  4IL6 C;  4D7N A;  4NHJ A;  1MBG A;  1ON2 A;  3OYB A;  2J5O A;  1ZRD A;  2WY7 Q;  1D1B A;  1P6R A;  2AQE A;  3BG7 A;  4E7Z A;  1IF1 A;  4YEL A;  1VTN C;  3FDY A;  3K4L A;  3PSF A;  4BDY A;  4D1Q A;  1EJ9 A;  4C30 A;  3DQV C;  2GAU A;  4FHT A;  1MJB A;  3HOU J;  4L9V A;  1OPC A;  1JKR C;  5CLS A;  2DJN A;  2XF7 A;  4ITV A;  2FXA A;  2HOS A;  4UHT A;  1TNT A;  2L2O A;  2VJ4 A;  4HQM A;  3VSK A;  3Q5F A;  3VPR A;  3GTQ J;  2HQR A;  1Q1V A;  3PL8 A;  1XB4 A;  3OMY A;  3GLL A;  2GA2 A;  4XKV A;  1O7F A;  1W7P D;  3NWS A;  2LP0 A;  2CJJ A;  3TDU C;  1ZG1 A;  2GZW A;  4C2U A;  4XKC A;  3R0J A;  3E5Q A;  4BUP A;  3P5J A;  2DPU A;  3HYI A;  2M8G X;  4PZJ A;  3VWB A;  4GFB A;  2XRL A;  3VYR B;  3I59 B;  2HDC A;  4A3G J;  1UST A;  3K2A A;  4RB2 C;  4QWQ A;  4B8X A;  1OCP A;  2VQG A;  3ML6 A;  1BI3 A;  1T08 B;  4UUT A;  3K2Z A;  2PEX A;  1I1S A;  4CDG A;  2LTP A;  2YR2 A;  3HSE A;  4A0Y A;  2K27 A;  4ENM A;  2R7D A;  1GV5 A;  4IZZ A;  2M30 A;  5FD6 A;  3IAS 2;  4IHW A;  3ASO H;  2YSR A;  3W6V A;  4E4H A;  4BAY A;  2STW A;  2CQK A;  1ERD A;  3ZQL A;  3HPH A;  3JRB A;  5GP9 A;  3PJR A;  1WJD A;  2QCO A;  2XV4 S;  4A5N A;  1JGS A;  3SXY A;  4F3Q A;  5HNF A;  4UUS A;  3AKZ A;  3MFK A;  3FKJ A;  4PJ0 C;  4IQJ A;  5DDG A;  5E3O A;  2WTE A;  3CJT B;  1USS A;  3TBI A;  4UV8 A;  1WZ2 A;  4EM1 A;  3O8G A;  2ELJ A;  4AIK A;  2KIQ A;  4XKB A;  3CJN A;  3G4S I;  3RYP A;  4EQQ A;  3PNT A;  5ILU A;  4XSZ F;  2GXB A;  1EV7 A;  1WVR A;  2LLK A;  2VXZ A;  4P1W A;  1T2K A;  2P5L C;  5LGU A;  2R7T A;  1YX5 A;  1D1C A;  4PJN A;  2BOL A;  4AVZ A;  1K4T A;  2R92 J;  4A3B J;  2J5P A;  4U87 A;  4ZYH A;  4ZZL A;  2K9N A;  2NNY A;  2QZ8 A;  2W1O A;  4XON A;  1S6L A;  1GV2 A;  2FU4 A;  3C2H A;  3LOC A;  3PUF A;  3CMA I;  1F1Z A;  2LYC A;  4WK8 F;  3HRM A;  4GO1 A;  4UUV A;  3I58 A;  2E1M C;  4RAF A;  2R7V A;  1WJA A;  2NAZ A;  2TCT A;  3OR1 C;  3A01 B;  3RCO A;  2L01 A;  3SZP A;  3S1M J;  5FKL A;  1SFK A;  5B5E C;  2V1U A;  2VB6 A;  2ZC2 A;  2EBI A;  1GT0 C;  1Z21 A;  1K78 B;  1YIT I;  4A3C J;  1KU2 A;  2XPV A;  3KLN A;  1E3H A;  2G7H A;  1TQP A;  3EPZ A;  5A2Q K;  5J8C A;  2ELH A;  3H36 A;  2JZY A;  1IN4 A;  5EGO A;  1XTA A;  4EVI A;  2X1C A;  2W84 A;  3BG9 A;  4PSX A;  5CPR B;  3K69 A;  3ONQ A;  5K5O A;  3P7N A;  3ZCO A;  4F7Z A;  2LG4 A;  1T8I A;  3TP3 A;  3LST A;  1OCR H;  2W48 A;  2XSD C;  2ESN A;  5JVT A;  1FX7 A;  2GIV A;  3F8F A;  1YS6 A;  3ASN H;  2ZO4 A;  3OS0 A;  3TW7 A;  4KIT B;  4GGG A;  2OQG A;  5F64 A;  3RI4 A;  4BXX J;  2CQ7 A;  3PQK A;  3QPL A;  1TWF J;  1A6Q A;  2VKD A;  4JX4 A;  3GTP J;  2HVQ A;  3FK6 A;  4CA0 A;  3RPQ A;  2L3D A;  3OSF A;  1B9N A;  3AL0 B;  1AA7 A;  4BKX A;  1BOA A;  3DXJ F;  3A03 A;  3HOS A;  4X0G A;  3QU6 A;  4A3E J;  2KJB A;  3K4N A;  3LAJ A;  2R7X A;  2Y30 A;  4QSH A;  4RDU A;  3BG5 A;  1O3R A;  1ZYR F;  1VZ0 A;  2RV8 A;  4Q48 A;  2E2I J;  3JRG A;  4MQV A;  3OYE A;  3CMY A;  4M3G A;  2FD5 A;  3CES A;  1V54 H;  1MBH A;  2F6C A;  3BR1 A;  4CCL A;  1X2M A;  3CUQ B;  3MMY B;  3ZQI A;  2FBK A;  2MAB A;  2E5N A;  2QWW A;  3FM5 A;  4GDF A;  5J4Y A;  2IXS A;  1WI9 A;  2VC0 A;  3I71 A;  3TMO A;  4LB6 B;  2NVY J;  4KN7 X;  3GTL J;  2ZJP F;  2KP6 A;  3OYM A;  5LRR A;  3A0H C;  4V2G A;  1IN8 A;  3IKV A;  1G3S A;  2HXI A;  3DKY A;  3J81 K;  2DBB A;  3K70 D;  1I3A A;  2MYS A;  2EQR A;  3NAU A;  5HDG A;  5BS6 A;  1GHC A;  1BI0 A;  4BQA A;  3KLO A;  3LSG A;  4G6T B;  1FBU A;  2XPU A;  2VBX A;  1KQ8 A;  2VPL A;  4MEX F;  3I4M J;  4N9I A;  1X1C A;  3LAP A;  3MKL A;  1IV8 A;  4OAY A;  3GME A;  2V6E A;  2DAO A;  4BE2 A;  2HWV A;  2IBD A;  2O0Y A;  3I0T A;  1ETV A;  3TO9 A;  4IRH A;  4WXD A;  2E2J J;  5HS8 A;  1U9O A;  3VSL A;  3L9F A;  4HNV A;  1B1B A;  1IJW C;  2Z3Y A;  5CVV A;  1TLH B;  1V5F A;  1W1W E;  2ISY A;  4B43 A;  2JUC A;  5J1Y A;  2P7C B;  1DDN A;  3H9Q A;  1X1P A;  2CFX A;  1MZB A;  1P7J A;  3RPU D;  3O6B B;  2F5D A;  4I99 C;  2QBY B;  2EIN H;  1H0M A;  2HKO A;  2R7Q A;  5E1W A;  3HOX J;  5EZH A;  4G8X A;  4A3F J;  2KIM A;  2RN7 A;  2L0K A;  4FE4 A;  2XSJ C;  1MBK A;  2QUF A;  1UHS A;  2CQN A;  2IGM A;  5KAF C;  2RGV A;  2YX7 A;  2GOM A;  3ERM A;  2DT6 A;  5GTI C;  1TC3 C;  3O8H A;  5FRO A;  4BU2 A;  2V9K A;  2P5V A;  1NK3 P;  3S2H J;  2DA3 A;  3BDD A;  1YFH A;  3QP6 A;  2HYG D;  5D5X B;  2ACJ A;  1RET A;  2MD0 A;  3ABL H;  2LY1 A;  2GWR A;  4DNC A;  4F92 B;  3ABU A;  5DUI A;  3E7L A;  3E97 A;  2NRA C;  4IOC F;  4ESB A;  2QEX I;  5K5R A;  2STT A;  2HTS A;  4LGW A;  2AO9 A;  3RKW A;  2O7O A;  2Z1D A;  5DUK A;  4CHU A;  2A6H F;  1RPW A;  1SVL A;  2ZBK A;  4XSX F;  2NVX J;  4OMY A;  1FMV A;  2RNJ A;  4XR6 A;  3HUG A;  5M3M J;  1VND A;  2Y31 A;  3BQY A;  1UJ8 A;  3K4C A;  4UXN A;  2ZME C;  1XDU A;  1VQK I;  3DEE A;  1K6O A;  2ZJQ F;  1EH7 A;  3QOE A;  4XLC A;  1ORK A;  3CME I;  3LMM A;  4E7I A;  2DMU A;  3G71 I;  1XS9 A;  1ACI A;  1TW2 A;  2R5Y B;  3IWF A;  1WH5 A;  2QKL B;  4I01 A;  4XRS G;  3GZ5 A;  1UAA A;  3TDZ C;  1VFC A;  2M1B A;  4L5J A;  2XB0 X;  3ZXS A;  3B73 A;  2A05 A;  1L3L A;  3FXM A;  2X6Y A;  1T0F C;  2DOE A;  2KRF A;  5GAG J;  1SC7 A;  4OOI A;  4M3F A;  4CUG A;  3S15 J;  2ZFW A;  4QPO A;  2E1C A;  2COB A;  2NS0 A;  4ZDL A;  1DPU A;  1BIB A;  2V1N A;  3BWG A;  5F04 A;  4LG3 A;  4LJZ F;  2W85 A;  1J9I A;  3E1S A;  1NTC A;  4B47 A;  2M8E A;  2K9M A;  2EH3 A;  2EZK A;  2H09 A;  3G1M A;  4TV7 A;  4DYQ A;  5J6X A;  1UHW A;  2VON A;  3D0S A;  2VOP A;  1Z05 A;  5FLM J;  1P4W A;  4UUS B;  2Z99 A;  3PM1 A;  3K70 C;  3W6J B;  4H4K C;  1XPX A;  1T56 A;  1A5J A;  1BR4 A;  1VF9 A;  4AYB N;  4BDZ A;  1ETK A;  2QYO A;  3GW2 A;  5L3G A;  2E7W A;  1F9N A;  3MEX A;  5EG0 B;  1MBE A;  1XMK A;  2BEO A;  2ME0 A;  2PX9 A;  2YS9 A;  3KZY A;  2IRF G;  2CUZ A;  2EPF A;  3CUO A;  5GPA A;  1QPM A;  3BJA A;  4A0X A;  2NVU B;  2RQQ A;  2QSG X;  2E1N A;  3DU5 A;  3CLO A;  2DDA A;  3REO A;  2CWE A;  3F23 A;  2IA1 A;  4X1E A;  3GVA A;  1MND A;  1B8I A;  5K5Q A;  4UVC A;  2EK5 A;  4EJU A;  2EZI A;  4IOA F;  3JRC A;  4BYY A;  3G6E I;  1QZE A;  1WKM A;  4M3E A;  2DA1 A;  1DUX C;  1FC3 A;  1T98 A;  3WGH A;  4HX7 A;  1ETW A;  3PFY A;  1BJZ A;  2EJR A;  3U1K A;  4CSW A;  1UG0 A;  1RKT A;  3I56 I;  3WTV C;  4G12 A;  5FRM A;  1V5E A;  5F0H A;  4HQE A;  4RBO A;  5CQG A;  4OIR F;  1TQI A;  3L09 A;  1N25 A;  3K4K A;  3ABT A;  3KCC A;  4M73 A;  1Z7U A;  2CSO A;  4LIU A;  1R6R A;  3CF5 F;  1DGW Y;  1ZKG A;  4DZJ A;  1Z1D A;  2QF7 A;  1X4P A;  2FML A;  5EGO B;  2F2E A;  1FZP B;  5E17 F;  2P6S A;  1Z67 A;  3PIO F;  1LEA A;  1SAX A;  3K4B A;  2NVQ J;  3HPG A;  1MJ9 A;  1YW9 A;  1QQI A;  2AXT C;  1JKO C;  3KPH A;  4C2T A;  1O7L A;  2HDW A;  5GAE J;  2LBF A;  3RJP A;  1QZY A;  1G6N A;  3OL3 A;  2DYR H;  2E5Z A;  3K9T A;  2CGP A;  1FSE A;  3FF5 A;  4CGZ A;  4RM2 A;  5CVR A;  3OYA A;  2NS7 A;  2GOX B;  4KUM A;  2HTJ A;  3G1O A;  2Z2S B;  1K79 A;  1U5T C;  4XK4 A;  2IPQ X;  5K7F A;  3FXJ A;  4KMF A;  2M34 A;  4XID A;  4A2U A;  4B44 A;  1VQ6 I;  2CS3 A;  2JMW A;  4MTD A;  5F0F A;  3EUH C;  1N75 A;  2C6Y A;  3OSG A;  2MLG A;  5BOX A;  1DU0 A;  2BHZ A;  3IH2 A;  2DXI A;  4HEA 2;  2NVT J;  2HKX A;  4KIS A;  1FNN A;  5E20 A;  1DP3 A;  5B1B H;  3L2U A;  1IUY A;  1MMS A;  2CH0 A;  3K1M A;  1UMQ A;  4E7S A;  2XRO A;  1A04 A;  1HKQ A;  3V7C A;  4X6A J;  2IJL A;  4LOC A;  2W4S A;  2XKO A;  3DEW A;  2V9P A;  3ZN0 A;  3LQQ A;  4NQW A;  1YX3 A;  1LNW A;  1ZN2 A;  3S93 A;  1B4A A;  2HVR A;  4QLC U;  1GDT A;  2GM4 A;  3ECH A;  1X1B A;  4LB5 A;  5ILV A;  5BNG A;  1YJN I;  4YEJ A;  4G6Q A;  4A6D A;  1R1U A;  3IHU A;  4ZYD A;  3GWZ A;  4M6V A;  3IH3 A;  3VYU B;  2L7F P;  2F5C A;  1H9G A;  1LKX A;  3AG1 H;  4E70 A;  1X1D A;  4PFP A;  2M4G A;  5IP6 A;  4MEY F;  2L7Z A;  2FX0 A;  1Z3X A;  2BY2 A;  1T95 A;  2FQ4 A;  3DU6 A;  1H9T A;  4UVA A;  5LRS A;  4FTH A;  1LVK A;  2MGQ A;  2EB7 A;  3LA3 A;  3KEY A;  5LFA A;  4HSR A;  4QTR A;  3B6C A;  4I0A A;  2X6O A;  3OYG A;  4BJ6 C;  5DM7 F;  1E2X A;  2HZD A;  1WGX A;  5M3F J;  1HW1 A;  4NC8 A;  5DD8 A;  3LFU A;  3OWT A;  2BYV E;  4XL9 A;  2JRM A;  2B7E A;  2M9H A;  3BRO A;  4HV5 A;  3A2K A;  2BZT A;  4Y15 A;  1K7A A;  4ENK A;  3V7S A;  3OYL A;  2HOA A;  1YIO A;  1I5Z A;  3I9V 2;  3VYS B;  3ZMV A;  1NK2 P;  4ZH4 F;  1ODD A;  2LDU A;  2K3P A;  1D0Y A;  4OIP F;  1FT9 A;  1BBY A;  1TWC J;  4Z6Y A;  4FCY A;  1AU7 A;  5D4S A;  3A02 A;  3R61 A;  1IO2 A;  4FX0 A;  1S8N A;  3HKZ N;  2QQ9 A;  2IA0 A;  4DJA A;  2VAS A;  4C3J J;  3ZP5 A;  1GXQ A;  2K4B A;  2BY1 A;  3IRR A;  3DKX A;  2DK8 A;  2H1L A;  1XD7 A;  2DFF A;  2VJ5 A;  2YUS A;  3WE3 A;  3D1N I;  3F22 A;  3JTG A;  4BE0 A;  1JGG A;  2FE3 A;  1WJC A;  4HV6 A;  3ZQG A;  1ZLJ A;  4DIQ A;  3CCV I;  1PUF B;  1ETY A;  4RGU A;  1OCT C;  1JUS A;  1Y1V J;  3DPL C;  3VFZ A;  1ETX A;  3TW6 A;  1UB9 A;  2X0L A;  1R49 A;  2XB5 A;  4S04 A;  1P9Q C;  1D1A A;  5KCM A;  1D8J A;  1TZL A;  4RB1 A;  3PNY A;  4DBR A;  1VQ8 I;  2LY2 A;  3V8K A;  2EIM H;  4A69 C;  4IHV A;  3HUG B;  1R1V A;  2LRD A;  3K10 A;  1VQ9 I;  1QHG A;  1G3W A;  5GAH J;  4JQF A;  2HQ5 A;  5H2F C;  1KQ9 A;  1UHM A;  2JTV A;  4EAT A;  5L3F A;  2K02 A;  4M9Z A;  3C18 A;  2K85 A;  4KN4 X;  4A3K J;  1Z3Y A;  2OUM A;  2QEN A;  2DFH A;  1WI3 A;  3Q3S A;  3K4J A;  1W36 D;  2NOG A;  3KYD B;  3E6C C;  1XCB A;  3HGG A;  3HKZ A;  2W25 A;  4BL0 B;  3P9K A;  1JTY A;  1FYM A;  2DYS H;  2YU9 J;  3S2D J;  4HDU A;  2K5C A;  2M0C A;  3BR2 A;  4XRS A;  1WQ2 A;  2XHK A;  5TJJ A;  4NUB A;  3V7R A;  4YRV A;  1RNL A;  3R6S A;  3MKY B;  4L0Y B;  4B1R A;  2HOE A;  1JKQ C;  4D9J A;  1KU9 A;  3WTS C;  1BR1 A;  5B66 C;  3M7G A;  4YIR X;  3FMS A;  2Q8K A;  1FIP A;  3HTU A;  1J7K A;  1HQC A;  2BVL A;  2M45 A;  4HOB A;  3E5X A;  3K7A J;  3Q0W A;  1P4A A;  2B0L A;  1I6X A;  3K4M A;  3G73 A;  3HDD A;  1BC8 C;  2VBY A;  4MFE A;  4I09 A;  5HS7 A;  2EFN A;  1IN6 A;  3CJQ B;  3FX3 A;  2PFB A;  1PVE A;  2LK2 A;  5TIS C;  2WAE A;  2DJI A;  4NB5 A;  1T0F A;  3GCM A;  4ON0 A;  3ESW B;  3SDB A;  4JYK A;  1MMD A;  3C2G A;  1L0O C;  3OR2 C;  5EDN A;  4KIF A;  3F21 A;  2CG4 A;  4BS9 A;  1B8I B;  2JK3 A;  1ZQ3 P;  3CDH A;  1MD0 A;  2W24 A;  4BE1 A;  4L9N A;  4IX7 A;  1IRZ A;  3DFG A;  1LDJ A;  2ESH A;  2FEZ A;  1FSH A;  3J80 Z;  2L7K A;  4PJM A;  5HOO A;  1MJA A;  1OR7 C;  3H92 A;  1I50 J;  2A5Y B;  1S72 I;  3KZI C;  4CCJ A;  3GX4 X;  3DTK A;  2F5E A;  3RTR A;  1MBF A;  2ZSI B;  3AFH A;  2XIG A;  3IH4 A;  4P96 A;  4DYR A;  3CCS I;  1SAU A;  2M4K A;  3KP3 A;  4A3D J;  3FXO A;  3LQR A;  4IJA A;  4OIN F;  5JLX A;  5IP7 J;  1CF7 B;  1ZEL A;  2R7O A;  3ZQ7 A;  4LD5 A;  3F8M A;  2EV6 A;  2TRT A;  3ZQC A;  4N0B A;  2VJI A;  4KYW A;  2AXL A;  3DBL B;  2A07 F;  2LFB A;  3BG3 A;  1MKM A;  2DOA A;  5DS9 A;  1VQO I;  3C7J A;  3OIO A;  2LBF B;  3BC8 A;  4Y3O A;  1YO5 C;  2X4H A;  2EIJ H;  1Y6I A;  1SFE A;  3GTG J;  1UG2 A;  4BQO A;  1IUF A;  1GVD A;  4I98 B;  1YJ9 I;  1DGR M;  3TQN A;  1FBQ A;  3JSO A;  1HCR A;  1BIA A;  3WU2 C;  3BTJ A;  5D5V B;  5E8G A;  5JVG F;  3H5N A;  5BMZ A;  5FLX Z;  5GAD J;  5D8L B;  2XAG A;  3WTW C;  4ZJZ A;  3BLY A;  2M0M A;  5HNH A;  3WTX C;  4ZTJ A;  5E3M A;  3PUB A;  3CCU I;  2H94 A;  1V5G A;  2HU9 A;  2LKX A;  1RKW A;  4EM0 B;  4ZYE A;  5JFR A;  4RLQ A;  3BOQ A;  4MQ9 F;  3OYI A;  1J5Y A;  2E34 A;  2OQR A;  4BXU A;  2DI3 A;  4I6Z A;  4NC6 A;  2EA2 A;  3BCA A;  1VQP I;  2ICW G;  3VEP A;  1G8X A;  4QPQ A;  3I55 I;  2ZFU A;  1MSE C;  4IHS A;  1O3T A;  2M5W A;  1FYK A;  3DLA A;  2V9V A;  2LF8 A;  3H3V K;  1B6A A;  1YS7 A;  2EZL A;  1HST A;  1U5T A;  3DCF A;  4PDK A;  4IXA A;  2JRT A;  1OLT A;  2A61 A;  2W82 A;  3U1D A;  1I1G A;  2DFE A;  4GYG A;  2HVS A;  4BBR J;  3RZO J;  1LDD A;  3EUH A;  2DTR A;  5FKM A;  4FX4 A;  5DCM A;  3ELK A;  2K3F A;  1AKH A;  3ZN1 A;  3FMQ A;  2CW8 A;  1HDP A;  1T33 A;  3L1P A;  2L4A A;  2PMH A;  4A3J J;  1H8A C;  1REP C;  5HDK A;  2AHQ A;  2KJC A;  4E7K A;  1QA6 A;  1JT6 A;  5IY5 H;  1NG7 A;  1OQY A;  5JI6 A;  3ZRG A;  5E79 C;  2MH9 A;  2FSW A;  4KNY A;  1D3Y A;  3SZG A;  3MZ8 A;  3S32 A;  2CUJ A;  2MH2 A;  2D1V A;  4WX9 A;  1IDZ A;  2IS2 A;  4FE7 A;  1JUM A;  2F5V A;  3D5L A;  2L54 A;  2K9L A;  2XGC A;  1ZGA A;  3Q0U A;  2ZB9 A;  3G2B A;  1YIJ I;  5CVJ A;  2H8R A;  3WTU C;  4W1U A;  3M8E A;  4RB0 A;  4HBL A;  3R0A A;  2E1O A;  3F3X A;  5E8I A;  2G9W A;  2PQ8 A;  2XGE A;  4PGG A;  1KYZ A;  4XKW A;  2DT7 B;  2WAD A;  3AG3 H;  4AVP A;  5D8K B;  2HPM A;  2O8K A;  1GUU A;  2IP2 A;  1ZR4 A;  3ZGK A;  1KGS A;  1NG6 A;  3QU3 A;  4L9J A;  2E2H J;  3WTY C;  4HPQ A;  2V7F A;  1D0X A;  4XRM A;  1RR8 C;  2VI6 A;  3I54 A;  1LUJ B;  2V4J C;  1TP4 A;  1HKT A;  3G3Z A;  1S5L C;  3QYF A;  2OA4 A;  2KIS A;  2VQL A;  1ONV A;  5F1R A;  1HF0 A;  2EFW A;  3QYE A;  3MD2 A;  2HOT A;  2DA7 A;  4UV9 A;  1P2F A;  3LSP A;  4ZDO A;  1O4X A;  4Y33 A;  1PDN C;  3GFL A;  1R00 A;  3O3K A;  1Y8Q B;  4P55 A;  4CH7 A;  2OJE D;  2VBW A;  2X1E A;  1RUN A;  4KFC A;  3RDI A;  1CGP A;  4A93 J;  4UVB A;  1QPI A;  2L9S A;  3BP8 A;  3LA7 A;  4P9U A;  3BTL A;  3BZ6 A;  3GLX A;  4M3B A;  5C3E J;  2OZU A;  4OIQ F;  1LFP A;  4Y17 A;  3JSP A;  3MQ0 A;  2L7M P;  3RKX A;  2F4M B;  3OYD A;  2IEK A;  3CUQ C;  4YFK F;  4Y13 A;  5B1A H;  1EH6 A;  1EF4 A;  3ABK H;  2DMT A;  1K61 A;  2LMD A;  2QSF X;  2CQX A;  2EIL H;  4RS8 A;  3L2Q A;  5IT9 Z;  5HS9 A;  3LL7 A;  5DM6 F;  1IAW A;  1R5I D;  5J40 A;  5FO5 A;  2HPI A;  2X9D A;  4DQ2 A;  2MC3 A;  4BHP A;  3HBL A;  3NAR A;  2P6T A;  2IS1 A;  2RDP A;  3A1Y A;  3O2P E;  4ENN A;  2IT0 A;  2WC2 A;  5FJ8 J;  1HW2 A;  1OYW A;  2CUE A;  1QZZ A;  2WA0 A;  1LFU P;  2WV0 A;  4PSW A;  3GTK J;  1KQ0 A;  1Y56 A;  3SEQ A;  2VUM J;  1B9M A;  2IGN A;  2HXO A;  3H9G A;  3FXK A;  2BXY A;  4A12 A;  2OBP A;  2XAU A;  2LR8 A;  4R1H A;  5M5Y J;  2E71 A;  2G7U A;  2LC2 A;  1SD6 A;  1ZK8 A;  3U21 A;  2JVH A;  4PGH A;  2FNP A;  2DU9 A;  3RZD J;  3SZT A;  2UXN A;  2W7N A;  3I4N J;  1JXS A;  5FGM A;  3N97 A;  1U8B A;  4AIH A;  4N4O B;  2BHY A;  3EQL F;  4XNF A;  1TTY A;  5TGT A;  2VT3 A;  3BG6 A;  2UXX A;  3HZJ A;  4NDL A;  2QA4 I;  4E7H A;  1Y1W J;  2XAF A;  3TL4 X;  4LLL A;  3OYC A;  1C0W A;  3EYI A;  2L5Q A;  2JJ7 A;  2VJJ A;  2OC6 A;  3PNV A;  1ON1 A;  2QKM B;  2QGU A;  1J59 A;  1D8K A;  1EH8 A;  1BN5 A;  4M9X A;  2EA4 A;  3KX2 A;  2KIF A;  3RSN A;  2FQ3 A;  2JSP A;  2XKP A;  2HI3 A;  3COA C;  1KZH A;  3KP5 A;  3A0B C;  1ZRC A;  2R7Z J;  4R8H A;  3S17 J;  2HFH A;  4Y7N J;  5DD4 A;  2Z5U A;  2IGK A;  3ZMZ A;  3EDP A;  3CCR I;  4WXC A;  3IC7 A;  2HYJ A;  4EJT A;  1IN7 A;  1W5C C;  3DV8 A;  1DPR A;  4KIG A;  3T1B A;  4M6X A;  1A36 A;  2IS4 A;  3ZMS A;  2JA8 J;  4D5C A;  1WJ5 A;  4HW0 A;  4OMZ A;  2OTL I;  3WU1 B;  1HW5 A;  1IG7 A;  3LSR A;  1DQU A;  2R5Z A;  1OCO H;  1EKE A;  4G6D A;  4JOM A;  3HXL A;  3OYH A;  1ZR2 A;  4C3I J;  4HF2 A;  2MD5 A;  4DBQ A;  4ZZD A;  6PAX A;  5M5W J;  2RC4 A;  1JT0 A;  1HC8 A;  4XBF A;  1QGP A;  1UZC A;  4XN3 A;  2MW8 A;  2DMQ A;  2M7B A;  3Q0V A;  4EV0 A;  3H0G J;  1ZGJ A;  2ZXH A;  3CP2 A;  4B48 A;  4B3X A;  3OS1 A;  1FEX A;  1WFX A;  2BXZ A;  3S3O A;  1OR7 A;  3MZH A;  3A4C A;  3FHN A;  3S8P A;  1JTX A;  2E35 A;  1JJ8 C;  1VI0 A;  1HKS A;  2Y9Y A;  1JHH A;  4LG0 A;  2V6C A;  2VC1 A;  2Z16 A;  3MCZ A;  4QIW N;  2DA4 A;  4BNC A;  4ZDP A;  2GXG A;  3U9G A;  4RB3 C;  2TDX A;  4BAC A;  5IYC J;  3BZK A;  1RIO H;  1O3S A;  5D6E A;  5J47 A;  2ELK A;  1I3Q J;  2IAI A;  2R0Q C;  4JX6 A;  1J2X A;  3C3W A;  3JTH A;  2BGC A;  5J8F A;  2WWY A;  1NH3 A;  3CC2 I;  1I27 A;  5J4V A;  3CJR B;  5HVQ C;  4EJO A;  4EGY A;  3CC7 I;  2MA3 A;  1BW5 A;  2E36 A;  4UB8 C;  1IRF A;  5E18 F;  2FUG 2;  2BE5 F;  1ZAR A;  1ZG5 A;  4XN0 A;  3E6B A;  3HGY A;  4IO9 F;  4HAM A;  2ZXJ A;  3WGG A;  2HGC A;  2KHM A;  1UCR A;  1XG1 A;  2KZV A;  2LSO A;  2MBF A;  3KYL A;  1FOX A;  2W57 A;  3JAM Z;  1G3T A;  2ECB A;  2VT2 A;  3F8N A;  2R7R A;  3LSI A;  2XAH A;  1G3Y A;  1Z91 A;  3ZMD A;  2KDZ A;  2M7A A;  2R3S A;  2KIU A;  1IGN A;  3CCJ I;  3I5U A;  3IRQ A;  2LKS A;  3JAM K;  2VKV A;  3L2V A;  3H5R A;  1S29 A;  4J19 A;  5DCM B;  4XIC A;  2D2W A;  2FJ1 A;  4WF2 A;  4LIT A;  2XUB A;  1S7A A;  5L3C A;  1OYI A;  4YFX F;  1AKH B;  2H27 A;  3GTM J;  2JQ7 A;  1ZH5 A;  3OYF A;  3RIR A;  4A0Z A;  4CCO A;  2ID3 A;  2WAQ A;  4IVN A;  4XOR A;  3FXL A;  4XLF A;  1MIJ A;  5H6R A;  3UKG A;  3K6G A;  3F8B A;  4O5V A;  1G59 A;  2FBH A;  1O57 A;  3KEQ A;  3CCY A;  4D0P A;  4AD9 A;  4ZC3 A;  3CCE I;  1OKR A;  5D6F A;  2F5F A;  1HA8 A;  1EA3 A;  3E0J B;  3SQN A;  4ENJ A;  2VOO A;  1YW8 A;  1SVO A;  2JA5 J;  2K4J A;  4G9Y A;  3DBR B;  3WHC A;  2W00 A;  3LSJ A;  3FKI J;  3PO3 J;  1LVA A;  1MGT A;  2LVS A;  4FAS D;  4IRI A;  2GLO A;  2O9L A;  5K7Z A;  4HYE A;  1W7P A;  3BR3 A;  3EET A;  1SAN A;  1IZ1 A;  2K40 A;  5BPI A;  1LE8 A;  2O5R A;  3GEZ A;  1ULY A;  2I5U A;  1TWH J;  2OCE A;  2XPW A;  4LFU A;  2ISZ A;  1A35 A;  3MWM A;  4BY1 J;  5L3D A;  2OD5 A;  3KIO A;  2K7L A;  3JRA A;  4IPA A;  2RKH A;  2AQF A;  1QO0 D;  2Z9O A;  1BM9 A;  1PJR A;  2OF7 A;  4AM3 A;  4HNU A;  1TWA J;  1E17 A;  3GFM A;  3T0Y A;  1ETO A;  4BBS J;  4J00 A;  4UB6 C;  3A01 A;  1GXP A;  4ESF A;  4L5I A;  5AIQ A;  4GRI A;  3V42 A;  4B4C A;  3R60 A;  1R5H A;  5AIP A;  1LQ1 A;  1G4D A;  4L5E A;  3HL2 A;  4DYC A;  4C9Y A;  4UNO A;  4G7Z F;  5EYR A;  2HQN A;  3U2R A;  3SEZ A;  5GPC A;  1FOY A;  2LKP A;  3BJ6 A;  2CYY A;  3NQO A;  5E1X A;  3M1E A;  4KIB A;  2X48 A;  4M9S A;  3FIW A;  3WGI A;  1YW7 A;  3HG9 A;  2M3A A;  4II2 A;  3CLQ A;  2X85 A;  3WU0 A;  5EJC A;  4PK4 A;  4XOP A;  2QQB A;  3FK7 A;  1TW3 A;  2VBZ A;  1IV6 A;  2H6C A;  2RNG A;  3KP7 A;  4CO8 A;  2VQC A;  1JHF A;  1BR2 A;  3DBH B;  1E3O C;  1X1A A;  2G0E A;  4KA4 A;  1APL C;  1N78 A;  2GBY A;  5KNL A;  4LLN A;  4WCG A;  3BY6 A;  3BCB A;  4E6K G;  3WTZ A;  1IRX A;  1E3P A;  2P7V B;  2D1H A;  1HDD C;  2JPC A;  5KK1 A;  1XGO A;  2I8D A;  4WXH A;  1WHU A;  1F4K A;  3F6O A;  3WE2 A;  1HBX G;  3BPX A;  4GYI A;  1K83 J;  4MNU A;  3QPH A;  3RQI A;  3HSF A;  4CYC A;  4O3M A;  3HRT A;  3QOD A;  2EFQ A;  4I0B A;  2AS5 F;  3L00 A;  5HDN A;  1MMG A;  2HEO A;  1IRG A;  2IGO A;  4N4N B;  3LFK A;  4HA8 A;  4BQQ A;  3S14 J;  4Q5S F;  1XMA A;  1S7E A;  3GXO A;  3HB9 A;  4IHY A;  3RYR A;  1R9T J;  2VIX A;  5L3E A;  1YRN A;  1ZG3 A;  1ZGW A;  1SVM A;  2Q2E A;  1HLV A;  2ADU A;  2P81 A;  3JRE A;  3MN2 A;  4KT5 C;  3SHF A;  4CIC A;  1XGS A;  2X6X A;  4KDP A;  1VQN I;  1AHD P;  2FNA A;  2OTJ I;  2VQH A;  3HSR A;  4BEH A;  1WWX A;  2VE9 A;  3DPU A;  2LD5 A;  1AWC A;  1QHH D;  1SFO J;  5IOZ A;  5HLG A;  2R4G A;  3QYB A;  4F52 A;  1R36 A;  4BJ5 C;  3H35 A;  1SD4 A;  4ESJ A;  2JN6 A;  2VL8 A;  2BV6 A;  2MSY A;  4V2F A;  3L7W A;  5FFX A;  2A69 F;  3M1C A;  4MTE A;  1JI8 A;  3BZC A;  1FYL A;  3AG2 H;  5E1Z B;  3T5X A;  3TOA A;  2ETH A;  1PP7 U;  3I64 A;  1K4S A;  3IAM 2;  5LBQ A;  5IYB J;  2R5Z B;  2WB1 A;  1STZ A;  2XC7 A;  3I3L A;  2IVM A;  3OS2 A;  2QBY A;  1YTY A;  3CCM I;  2JA2 A;  4KT6 A;  2ZME A;  4CZZ A;  1Z6R A;  4XOT A;  2ID6 A;  2DOD A;  3FXQ A;  1I6H J;  1D5Y A;  3MKW B;  2L9N A;  1TQM A;  2X1D A;  1T38 A;  2L9R A;  3MKZ A;  1J09 A;  2Y0M A;  4NBQ A;  4A3I J;  2O61 A;  2MLK A;  5F6F A;  5IYD J;  5C44 J;  4LG0 B;  4LK1 F;  1NHA A;  2HNH A;  4RA2 A;  2FA5 A;  2X6W A;  1U78 A;  2QM3 A;  2JUG A;  3PFI A;  4MGR A;  3GF2 A;  3LSH A;  4HF1 A;  3PO2 J;  1QNT A;  1LPQ A;  3QWL A;  1W5S A;  4HLY A;  3VOE A;  4LIV A;  5D5W B;  3R4K A;  1YJW I;  1OMI A;  2O03 A;  3UNG C;  2DMP A;  4Z2Y A;  2CV0 A;  3QPT A;  3DTE A;  1BI2 A;  1OYY A;  1IXC A;  3LWF A;  3ZOB A;  1OFC X;  2MC4 A;  3OL4 A;  4S05 A;  3QRF F;  2VOD A;  2DDB A;  3FZV A;  1X58 A;  5HLI A;  3SJM A;  4RGS A;  3JR9 A;  3J7A Y;  1RRJ A;  3J80 K;  2V79 A;  2P0W A;  2ZNY A;  3OYK A;  3JCU C;  3PIP F;  3ULQ B;  5JR3 A;  3EYY A;  4G94 A;  4LLG F;  1SD7 A;  3AAF A;  2DPD A;  2OZ6 A;  4AUX A;  2KMU A;  3OIQ A;  4BH9 A;  3P9I A;  1FPQ A;  3V8L A;  2R5Y A;  3HOY J;  3BJO A;  2VE8 A;  2KQR A;  3L2R A;  2XGX A;  4A5M A;  1LJ9 A;  2ZNZ A;  1PUE E;  3GFI A;  3HOZ J;  2JPB A;  1LFB A;  3RPU A;  4C3H J;  2BY0 A;  2CO5 A;  1XN7 A;  5KHD A;  1PP8 F;  2E1M B;  5J1U A;  1R71 A;  5GTH C;  5LHG A;  3MZY A;  4Q4Z F;  4L9T A;  1R7J A;  5F27 A;  1ZTR A;  1O3Q A; 
#chains in the Genus database with same CATH homology
 2GA1 A;  5H20 A;  3QOP A;  4U0Y A;  3TGN A;  5D4R A;  3HHG A;  1LDK B;  1U2W A;  4IHT A;  3GZ6 A;  1WRJ A;  5KVR A;  2LNB A;  3KP2 A;  3J7A O;  3KP4 A;  5FLX K;  2DT5 A;  1T6S A;  2Q0O A;  1P4X A;  2NYX A;  4ETS A;  3F6V A;  2DO7 A;  5FFZ A;  1FP1 D;  1W7P B;  3F72 A;  4N9H A;  4O6J A;  1FP2 A;  3GO5 A;  1DP7 P;  3KZZ A;  2EWN A;  2L02 A;  4GCV A;  4EGZ A;  3BPV A;  3T8R A;  2FF4 A;  5D5U B;  1J0R A;  1YQA A;  5EEH A;  1FY7 A;  1KU3 A;  1BC7 C;  5A2Q Z;  1RI7 A;  2QQA A;  4KIC A;  3ISP A;  1V4R A;  2QVO A;  2XAQ A;  1LB2 A;  1XDS A;  2O3F A;  3NRV A;  2YX4 A;  5DYM A;  1KYW A;  4YG2 F;  2A3S A;  2YPR A;  1IXR C;  1R58 A;  4P5O A;  3GYH X;  3KP6 A;  5FB2 A;  2H6B A;  3WOD F;  1U6G A;  4WWC A;  3TOB A;  1B59 A;  1F5T A;  1MDM A;  2E7X A;  3ZMT A;  5BQT A;  5LLQ A;  3K1N A;  5LEK A;  1S7O A;  1U3E M;  3I53 A;  4RGX A;  4OU0 A;  1YG2 A;  2Y48 A;  5CYV A;  3ROU A;  3W6K B;  5LEJ A;  1QBJ A;  3J81 Z;  3HOT A;  4XRF A;  2P4W A;  3KEO A;  5LGN A;  4L18 B;  3H3U A;  3FHZ A;  3FMR A;  2HZT A;  4PCQ A;  1Q1H A;  2DQL A;  3ECO A;  5ICF A;  4EM2 A;  4HX8 A;  1IXS B;  5LGT A;  2COM A;  1Z6T A;  2BBY A;  3IKT A;  2XVC A;  4HDV A;  1ZRE A;  4I02 A;  5IT9 K;  4M71 A;  2IA2 A;  3KET A;  2FOK A;  3MAJ A;  1R5G A;  2XAS A;  4KMU X;  2V1D A;  4CYD A;  2CW0 F;  2ZCW A;  5EEG A;  3QAH A;  3L2C A;  3WTT C;  5ICE A;  2ZME B;  2K86 A;  1D5V A;  3HHH A;  3HRS A;  2FRH A;  1W4M A;  3CTA A;  5BPD A;  3CO7 C;  5ED4 A;  4CXF A;  3T8T A;  3IL2 A;  4ASN A;  4OIO F;  4LMY A;  2A68 F;  2IW5 A;  3OV8 A;  2V1X A;  1YLF A;  3RKY A;  2HR3 A;  5K1Y A;  2LF7 A;  1ZLK A;  5L3B A;  3TKY A;  2QLZ A;  4EJW A;  1Z9C A;  3B02 A;  3NEU A;  2UZK A;  2EFP A;  3C1D A;  2ZKZ A;  4RAY A;  2ZJ2 A;  4G7H F;  1ZRF A;  4EMS A;  4FT8 A;  2DLL A;  4MHG A;  1AOY A;  3DKW A;  4YIF A;  4ZYG A;  3Q9S A;  1HXD A;  4U88 A;  1XGN A;  4U0V A;  2PI0 A;  1UFM A;  1XSD A;  3KFW X;  4U7D A;  1R1T A;  5CJ9 A;  1BI1 A;  2EFO A;  1T39 A;  2RQP A;  2OAZ A;  1SD5 A;  1V3F A;  4R79 A;  4M72 A;  4I7H A;  4HLX A;  2M87 A;  1FLI A;  4HZF A;  1S3J A;  3I59 A;  3IWZ A;  3E6M A;  3Q9V A;  4IF4 A;  3GUD A;  2PBI A;  2DW4 A;  3JW4 A;  2EV0 A;  4I2O A;  5ERI A;  5DEQ A;  1ZAO A;  2NNN A;  5IT3 A;  3KE2 A;  4EJV A;  1U5T B;  3S2W A;  3F8C A;  4B09 A;  2P8T A;  1GVJ A;  2XRN A;  2PN6 A;  4H0E A;  4GXO A;  1U8R A;  1W5T A;  2EV5 A;  2RVC A;  3DPT A;  5AON A;  5HLH A;  1CF7 A;  4K2E A;  2FBI A;  3HTS B;  2UWM A;  4Q47 A;  4L0Z B;  3DEU A;  3HIF A;  3DF8 A;  1JE8 A;  1HSJ A;  1FWZ A;  2P5K A;  2L4M A;  4YII A;  1IN5 A;  3M8F A;  1RUO A;  3E6D A;  1SMY F;  1RZ4 A;  5DCF A;  2JSC A;  2VN2 A;  1MDM B;  4RAZ A;  3WG9 A;  4IRG A;  2XAJ A;  5JHU A;  3I4P A;  3PQJ A;  2JT1 A;  1R23 A;  1XSV A;  4U0W A;  2O8X A;  2R7F A;  1J75 A;  3DP7 A;  1TBX A;  2DFI A;  3V4G A;  3VB2 A;  1X3U A;  2YU3 A;  3QP5 A;  3E5U A;  4AWX B;  4YFN F;  5LHI A;  1K78 A;  1P92 A;  5CVI A;  1XCV A;  1KU7 A;  5FD5 A;  3FXR A;  3TO6 A;  1SFU A;  4P9F A;  3K0L A;  4XLP F;  3OOP A;  4A6E A;  5TRD A;  3HRU A;  1XSX A;  3H3Z A;  4U7B A;  3N4M A;  5DV5 A;  1BJA A;  1ZHF A;  3P9C A;  3ERE D;  2HYF A;  4M6Y A;  1Y0U A;  3LA2 A;  2DK5 A;  3TO7 A;  2D45 A;  4BHC A;  3ZPL A;  4HX4 A;  4BHB A;  1LEB A;  2A6E F;  5ICC A;  2PMU A;  5H6Q A;  1R22 A;  2HS5 A;  1YYV A;  3FM3 A;  3GFJ A;  2O6G E;  1FBS A;  1SFX A;  2Y75 A;  3CUQ A;  4G7O F;  1FOK A;  4RGR A;  1SMT A;  2KKO A;  2Z33 A;  3K1P A;  3VOD A;  1KA8 A;  5ICG A;  3M9A A;  4XLN F;  2GQQ A;  3CO6 C;  3FXU A;  2PJP A;  1WSU A;  2FMY A;  2PG4 A;  4HF0 A;  1IW7 F;  5ILS A;  3E3V A;  3ZMU A;  2DQR A;  1XGM A;  3V8J A;  1TNS A;  4AIJ A;  2OU2 A;  5CVU A;  4JBA A;  2PLY A;  3SFZ A;  4JK1 X;  4LK0 F;  3FWE A;  5LHH A;  4M74 A;  4NHJ A;  1ON2 A;  2J5O A;  1ZRD A;  1P6R A;  1IF1 A;  1VTN C;  3DQV C;  2GAU A;  4FHT A;  1MJB A;  4L9V A;  1OPC A;  5CLS A;  2FXA A;  4UHT A;  1TNT A;  4HQM A;  3Q5F A;  2HQR A;  1XB4 A;  2GA2 A;  1O7F A;  1W7P D;  3TDU C;  1ZG1 A;  2GZW A;  3R0J A;  3E5Q A;  2DPU A;  3HYI A;  4PZJ A;  3I59 B;  2HDC A;  1UST A;  4RB2 C;  4QWQ A;  4B8X A;  3ML6 A;  1BI3 A;  3K2Z A;  2PEX A;  1I1S A;  4CDG A;  2YR2 A;  3HSE A;  4A0Y A;  2K27 A;  4ENM A;  2R7D A;  2M30 A;  5FD6 A;  2YSR A;  4BAY A;  2STW A;  2CQK A;  2XV4 S;  4A5N A;  1JGS A;  3SXY A;  3MFK A;  5DDG A;  2WTE A;  1USS A;  4UV8 A;  4EM1 A;  4AIK A;  3CJN A;  3RYP A;  4EQQ A;  5ILU A;  4XSZ F;  2GXB A;  1EV7 A;  2VXZ A;  1T2K A;  2P5L C;  5LGU A;  2J5P A;  4ZYH A;  4ZZL A;  2NNY A;  2QZ8 A;  1S6L A;  2FU4 A;  1F1Z A;  4WK8 F;  3HRM A;  4GO1 A;  4UUV A;  3I58 A;  2NAZ A;  2L01 A;  3SZP A;  2V1U A;  1K78 B;  1KU2 A;  3KLN A;  2G7H A;  1TQP A;  5A2Q K;  5J8C A;  2ELH A;  2JZY A;  1IN4 A;  4EVI A;  2W84 A;  3K69 A;  5K5O A;  3P7N A;  4F7Z A;  3LST A;  2ESN A;  5JVT A;  1FX7 A;  2GIV A;  3F8F A;  1YS6 A;  2ZO4 A;  4GGG A;  2OQG A;  5F64 A;  3RI4 A;  3PQK A;  3RPQ A;  2L3D A;  1B9N A;  1BOA A;  3DXJ F;  3HOS A;  3QU6 A;  2KJB A;  3LAJ A;  1O3R A;  1ZYR F;  2RV8 A;  4Q48 A;  4MQV A;  3CUQ B;  2FBK A;  2QWW A;  3FM5 A;  1WI9 A;  2VC0 A;  3I71 A;  4LB6 B;  4KN7 X;  5LRR A;  1IN8 A;  3IKV A;  1G3S A;  3J81 K;  2DBB A;  5BS6 A;  5HDG A;  1GHC A;  1BI0 A;  4BQA A;  3KLO A;  1FBU A;  2VBX A;  1KQ8 A;  4MEX F;  4N9I A;  3LAP A;  2DAO A;  2HWV A;  2O0Y A;  3I0T A;  3TO9 A;  4IRH A;  4WXD A;  5HS8 A;  3L9F A;  1B1B A;  2Z3Y A;  5CVV A;  1TLH B;  2ISY A;  2P7C B;  1DDN A;  2CFX A;  1MZB A;  3O6B B;  2F5D A;  2QBY B;  1H0M A;  2HKO A;  5E1W A;  4G8X A;  2KIM A;  2RN7 A;  2QUF A;  2RGV A;  2YX7 A;  2P5V A;  3BDD A;  1YFH A;  3QP6 A;  2HYG D;  5D5X B;  2ACJ A;  5DUI A;  2GWR A;  4DNC A;  3ABU A;  3E97 A;  2NRA C;  4ESB A;  5K5R A;  2STT A;  2HTS A;  4LGW A;  3RKW A;  5DUK A;  4CHU A;  2A6H F;  4XSX F;  2ZBK A;  4OMY A;  2RNJ A;  3HUG A;  4UXN A;  1XDU A;  1K6O A;  1EH7 A;  1TW2 A;  3IWF A;  4I01 A;  3GZ5 A;  3TDZ C;  2M1B A;  4L5J A;  3B73 A;  1L3L A;  2KRF A;  4OOI A;  2ZFW A;  2E1C A;  2NS0 A;  1DPU A;  1BIB A;  3BWG A;  4LJZ F;  2W85 A;  1J9I A;  2M8E A;  4TV7 A;  2H09 A;  2VON A;  5J6X A;  2VOP A;  1UHW A;  3D0S A;  1Z05 A;  1P4W A;  2Z99 A;  3W6J B;  2QYO A;  3GW2 A;  5L3G A;  2E7W A;  1F9N A;  3MEX A;  1XMK A;  2BEO A;  3KZY A;  2IRF G;  3CUO A;  1QPM A;  3BJA A;  4A0X A;  2E1N A;  3CLO A;  3REO A;  2CWE A;  3F23 A;  2IA1 A;  3GVA A;  5K5Q A;  4UVC A;  2EK5 A;  4EJU A;  4BYY A;  1WKM A;  1DUX C;  1FC3 A;  1T98 A;  3WGH A;  4HX7 A;  2EJR A;  3WTV C;  4HQE A;  4OIR F;  1TQI A;  3L09 A;  3KCC A;  3ABT A;  4M73 A;  1Z7U A;  2CSO A;  1Z1D A;  2FML A;  1FZP B;  2F2E A;  5E17 F;  2P6S A;  1LEA A;  1SAX A;  1MJ9 A;  1YW9 A;  1QQI A;  1O7L A;  3RJP A;  1QZY A;  1G6N A;  3K9T A;  2CGP A;  1FSE A;  3FF5 A;  4CGZ A;  5CVR A;  4KUM A;  2HTJ A;  1K79 A;  1U5T C;  2IPQ X;  4KMF A;  4A2U A;  4MTD A;  2C6Y A;  2MLG A;  5BOX A;  2HKX A;  1FNN A;  5E20 A;  1IUY A;  3K1M A;  2XRO A;  1A04 A;  1HKQ A;  3V7C A;  2IJL A;  2XKO A;  3ZN0 A;  3LQQ A;  4NQW A;  1ZN2 A;  1LNW A;  1B4A A;  4QLC U;  3ECH A;  4LB5 A;  5ILV A;  4G6Q A;  4A6D A;  1R1U A;  3IHU A;  4ZYD A;  3GWZ A;  4E70 A;  2F5C A;  1H9G A;  4MEY F;  1H9T A;  4UVA A;  5LRS A;  2EB7 A;  3LA3 A;  4I0A A;  1E2X A;  1HW1 A;  5DD8 A;  2BYV E;  3BRO A;  4HV5 A;  4Y15 A;  1K7A A;  4ENK A;  3V7S A;  1YIO A;  1I5Z A;  3ZMV A;  4ZH4 F;  1ODD A;  2LDU A;  4OIP F;  1FT9 A;  1BBY A;  5D4S A;  3R61 A;  4FX0 A;  1S8N A;  2QQ9 A;  2IA0 A;  3ZP5 A;  1GXQ A;  2K4B A;  3IRR A;  2DK8 A;  1XD7 A;  3F22 A;  3WE3 A;  3JTG A;  2FE3 A;  4HV6 A;  1ZLJ A;  4RGU A;  3DPL C;  3VFZ A;  1UB9 A;  2X0L A;  4S04 A;  1D8J A;  4RB1 A;  3V8K A;  1R1V A;  1G3W A;  4JQF A;  1KQ9 A;  1UHM A;  2JTV A;  5L3F A;  2K02 A;  4M9Z A;  3C18 A;  4KN4 X;  2QEN A;  3E6C C;  1XCB A;  2W25 A;  3P9K A;  1FYM A;  4HDU A;  1WQ2 A;  2XHK A;  5TJJ A;  3V7R A;  1RNL A;  3R6S A;  4L0Y B;  2HOE A;  1KU9 A;  3WTS C;  3M7G A;  3FMS A;  2Q8K A;  3HTU A;  1J7K A;  1HQC A;  2M45 A;  4HOB A;  3E5X A;  1P4A A;  2B0L A;  1I6X A;  3G73 A;  1BC8 C;  2VBY A;  4I09 A;  5HS7 A;  2EFN A;  1IN6 A;  3FX3 A;  2PFB A;  4NB5 A;  1T0F A;  4ON0 A;  1L0O C;  4KIF A;  3F21 A;  2CG4 A;  3CDH A;  1MD0 A;  2W24 A;  4L9N A;  3DFG A;  1LDJ A;  2ESH A;  2FEZ A;  1FSH A;  3J80 Z;  5HOO A;  1MJA A;  3H92 A;  2A5Y B;  3GX4 X;  2F5E A;  3RTR A;  2XIG A;  4P96 A;  3KP3 A;  3LQR A;  4IJA A;  4OIN F;  1CF7 B;  3ZQ7 A;  4LD5 A;  3F8M A;  2EV6 A;  4N0B A;  4KYW A;  2AXL A;  2A07 F;  1MKM A;  3C7J A;  1YO5 C;  2X4H A;  1SFE A;  4I98 B;  3TQN A;  1FBQ A;  3JSO A;  1BIA A;  5D5V B;  5E8G A;  5BMZ A;  5FLX Z;  5D8L B;  2XAG A;  3WTW C;  3WTX C;  2H94 A;  4EM0 B;  5JFR A;  4ZYE A;  3BOQ A;  4MQ9 F;  1J5Y A;  2OQR A;  4BXU A;  2DI3 A;  2EA2 A;  3VEP A;  4IHS A;  1O3T A;  2M5W A;  1FYK A;  2V9V A;  2LF8 A;  1B6A A;  1YS7 A;  1HST A;  1U5T A;  4PDK A;  4IXA A;  2JRT A;  2A61 A;  3U1D A;  1I1G A;  4GYG A;  1LDD A;  3EUH A;  2DTR A;  4FX4 A;  5DCM A;  3ELK A;  3ZN1 A;  3FMQ A;  2L4A A;  2PMH A;  1REP C;  5HDK A;  2KJC A;  5JI6 A;  2MH9 A;  2FSW A;  4KNY A;  1D3Y A;  2MH2 A;  2D1V A;  4WX9 A;  3D5L A;  2L54 A;  1ZGA A;  5CVJ A;  3WTU C;  3M8E A;  4RB0 A;  4HBL A;  3R0A A;  3F3X A;  5E8I A;  2G9W A;  2PQ8 A;  4PGG A;  1KYZ A;  4AVP A;  5D8K B;  2IP2 A;  1KGS A;  3QU3 A;  4L9J A;  3WTY C;  3I54 A;  1HKT A;  3G3Z A;  2OA4 A;  1ONV A;  5F1R A;  2EFW A;  4UV9 A;  1P2F A;  1PDN C;  3GFL A;  1R00 A;  3O3K A;  4P55 A;  2VBW A;  1RUN A;  4KFC A;  3RDI A;  1CGP A;  4UVB A;  3BP8 A;  4P9U A;  3LA7 A;  3BZ6 A;  3GLX A;  4OIQ F;  2OZU A;  4Y17 A;  3JSP A;  3MQ0 A;  3RKX A;  3CUQ C;  4YFK F;  4Y13 A;  1EH6 A;  4RS8 A;  5IT9 Z;  5HS9 A;  1IAW A;  5FO5 A;  4DQ2 A;  2MC3 A;  4BHP A;  2P6T A;  2RDP A;  3O2P E;  4ENN A;  2IT0 A;  2WC2 A;  1HW2 A;  1OYW A;  1QZZ A;  2WV0 A;  1KQ0 A;  1B9M A;  4A12 A;  2OBP A;  4R1H A;  2G7U A;  1SD6 A;  4PGH A;  2FNP A;  2DU9 A;  3SZT A;  2UXN A;  1JXS A;  5FGM A;  3N97 A;  4AIH A;  3EQL F;  1TTY A;  2VT3 A;  2UXX A;  2XAF A;  4LLL A;  1C0W A;  3EYI A;  1ON1 A;  1J59 A;  1D8K A;  1EH8 A;  1BN5 A;  4M9X A;  2EA4 A;  2KIF A;  2FQ3 A;  2XKP A;  3COA C;  3KP5 A;  1ZRC A;  4R8H A;  2HFH A;  5DD4 A;  2Z5U A;  3ZMZ A;  3EDP A;  4WXC A;  3IC7 A;  4EJT A;  1IN7 A;  3DV8 A;  1DPR A;  4KIG A;  3T1B A;  4M6X A;  3ZMS A;  4HW0 A;  4OMZ A;  3WU1 B;  1HW5 A;  4HF2 A;  4G6D A;  2MD5 A;  4ZZD A;  6PAX A;  2RC4 A;  4XBF A;  1QGP A;  4EV0 A;  1ZGJ A;  1OR7 A;  3MZH A;  1HKS A;  1JHH A;  4LG0 A;  2V6C A;  2VC1 A;  3MCZ A;  4BNC A;  2GXG A;  3U9G A;  4RB3 C;  2TDX A;  1RIO H;  1O3S A;  5D6E A;  1J2X A;  3C3W A;  3JTH A;  2BGC A;  5J8F A;  2WWY A;  1I27 A;  5HVQ C;  4EJO A;  4EGY A;  2MA3 A;  1IRF A;  5E18 F;  2BE5 F;  1ZAR A;  1ZG5 A;  3E6B A;  4HAM A;  2ZXJ A;  3WGG A;  2HGC A;  1UCR A;  2LSO A;  2MBF A;  2W57 A;  3JAM Z;  1G3T A;  2VT2 A;  3F8N A;  2XAH A;  1G3Y A;  1Z91 A;  3ZMD A;  2R3S A;  2KIU A;  3I5U A;  3IRQ A;  3JAM K;  1S29 A;  5DCM B;  2D2W A;  4WF2 A;  2XUB A;  1S7A A;  5L3C A;  1OYI A;  4YFX F;  2H27 A;  1ZH5 A;  3RIR A;  4A0Z A;  4IVN A;  5H6R A;  3F8B A;  4O5V A;  2FBH A;  1O57 A;  3KEQ A;  4D0P A;  4AD9 A;  1OKR A;  5D6F A;  2F5F A;  3SQN A;  4ENJ A;  2VOO A;  1YW8 A;  2K4J A;  4G9Y A;  1LVA A;  1MGT A;  4IRI A;  4HYE A;  1W7P A;  3EET A;  1IZ1 A;  5BPI A;  3GEZ A;  1ULY A;  4LFU A;  2ISZ A;  3MWM A;  5L3D A;  2OD5 A;  2K7L A;  4IPA A;  2RKH A;  1QO0 D;  2Z9O A;  1BM9 A;  1E17 A;  3GFM A;  3T0Y A;  1GXP A;  4ESF A;  4L5I A;  5AIQ A;  3R60 A;  1R5H A;  5AIP A;  1LQ1 A;  1G4D A;  4UNO A;  4G7Z F;  2HQN A;  3U2R A;  2LKP A;  3BJ6 A;  2CYY A;  3NQO A;  5E1X A;  3M1E A;  4KIB A;  4M9S A;  3WGI A;  1YW7 A;  3WU0 A;  2QQB A;  1TW3 A;  2VBZ A;  2H6C A;  3KP7 A;  4CO8 A;  1JHF A;  4KA4 A;  4LLN A;  4WCG A;  3BY6 A;  3WTZ A;  2P7V B;  2D1H A;  2JPC A;  5KK1 A;  1XGO A;  4WXH A;  1F4K A;  3F6O A;  3WE2 A;  1HBX G;  3BPX A;  4GYI A;  4MNU A;  3QPH A;  3HSF A;  4O3M A;  3HRT A;  2EFQ A;  4I0B A;  2AS5 F;  3L00 A;  5HDN A;  2HEO A;  1IRG A;  3LFK A;  4HA8 A;  4Q5S F;  1XMA A;  3GXO A;  3RYR A;  5L3E A;  1ZG3 A;  2Q2E A;  2ADU A;  4KT5 C;  3SHF A;  4CIC A;  1XGS A;  4KDP A;  2FNA A;  3HSR A;  1WWX A;  2VE9 A;  1AWC A;  5HLG A;  1R36 A;  1SD4 A;  4ESJ A;  2BV6 A;  3L7W A;  5FFX A;  2A69 F;  4MTE A;  1FYL A;  5E1Z B;  3T5X A;  3TOA A;  2ETH A;  1PP7 U;  3I64 A;  5LBQ A;  1STZ A;  2IVM A;  2QBY A;  1YTY A;  2ZME A;  4CZZ A;  1Z6R A;  3FXQ A;  1TQM A;  1T38 A;  2Y0M A;  2O61 A;  2MLK A;  5F6F A;  4LG0 B;  4LK1 F;  1NHA A;  2FA5 A;  1U78 A;  2QM3 A;  3PFI A;  4MGR A;  3GF2 A;  4HF1 A;  1QNT A;  1W5S A;  4HLY A;  3VOE A;  5D5W B;  3R4K A;  1OMI A;  2O03 A;  4Z2Y A;  3QPT A;  1BI2 A;  1OYY A;  1IXC A;  3LWF A;  3QRF F;  4S05 A;  2VOD A;  3FZV A;  5HLI A;  4RGS A;  3J80 K;  2V79 A;  2ZNY A;  3ULQ B;  5JR3 A;  3EYY A;  4G94 A;  4LLG F;  1SD7 A;  3AAF A;  2DPD A;  2OZ6 A;  4BH9 A;  3P9I A;  1FPQ A;  3V8L A;  3BJO A;  2VE8 A;  2XGX A;  4A5M A;  1LJ9 A;  2ZNZ A;  1PUE E;  3GFI A;  2JPB A;  3RPU A;  2CO5 A;  1XN7 A;  1PP8 F;  5LHG A;  3MZY A;  4Q4Z F;  4L9T A;  1R7J A;  1O3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...