4ON0A

Crystal structure of nolr from sinorhizobium fredii in complex with oligo aa dna
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
97
structure length
97
Chain Sequence
QPLSPEKHEEAEIAAGFLSAMANPKRLLILDSLVKEEMAVGALANKVGLSQSALSQHLSKLRAQNLVSTRRDAQTIYYSSSSDSVMKILGALSEIYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for regulation of rhizobial nodulation and symbiosis gene expression by the regulatory protein NolR.
pubmed doi rcsb
source organism Sinorhizobium fredii
molecule tags Transcription/dna
molecule keywords NolR
total genus 31
structure length 97
sequence length 97
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4on0A00
5ILUA 2DU9A 2QQ9A 2L4AA 3KP3A 3GUDA 3OV8A 2D2WA 1R1UA 2HQNA 2XUBA 3KP2A 4L9VA 3N97A 4KNYA 2NAZA 3O3KA 3QRFF 3KFWX 4ZZDA 1R5GA 1LQ1A 4FX0A 2XAFA 4CYDA 5E17F 5H20A 4KA4A 1KU3A 4RS8A 2DI3A 4KIBA 4M9SA 3ZN0A 4OMYA 3Q9SA 3CLOA 3P9IA 4YFXF 4A6EA 1EH7A 2V9VA 2Z3YA 2VBYA 2EB7A 1SD7A 2EFQA 1QBJA 1FT9A 3I4PA 2OA4A 2G7HA 2V1UA 3QU6A 1R58A 2L01A 3CDHA 1U8RA 2PI0A 3S2WA 4BHCA 2M87A 4CZZA 4KYWA 3BWGA 4EM2A 1LNWA 4EJOA 3HTSB 1T0FA 3I59B 4ESJA 3R6SA 5FD6A 4KN4X 3COAC 4ENNA 5CLSA 4KMUX 3V8KA 2XV4S 5HS8A 3MQ0A 5BS6A 3LQQA 1W5SA 4N9IA 4GYGA 4Z2YA 5ILSA 2Y0MA 3SZPA 1UCRA 2F5CA 2Z99A 5DCMB 2O03A 4CDGA 2R7DA 1JE8A 3KETA 3HUGA 4IRIA 4HX8A 2VXZA 1ON2A 4JK1X 5K5QA 1J5YA 3F23A 4H0EA 3V7RA 2DW4A 2QWWA 4G7OF 2K02A 2DPUA 3U1DA 4U0VA 4N9HA 4DQ2A 2UXXA 1XN7A 3ZPLA 5E8IA 2OU2A 3M1EA 2UXNA 2XHKA 5J6XA 1E17A 1BN5A 4ZYDA 1A04A 1GXQA 4O3MA 4GO1A 5FLXK 1J75A 4UVAA 4HDUA 2A68F 1JXSA 5FO5A 1CF7B 3M8FA 2FSWA 3QPTA 4IPAA 3J80Z 5L3BA 1L0OC 2L02A 3P7NA 4OIRF 4OIOF 1ZRFA 1DPUA 4L9JA 2FBHA 3FXQA 2ETHA 4EVIA 2R3SA 1SAXA 2F5DA 1R00A 3M8EA 2Q0OA 2MA3A 4OU0A 2CWEA 1O3RA 1MKMA 4HDVA 4Y15A 2GQQA 3VODA 2XKOA 2G7UA 3GVAA 3RIRA 1SFEA 5LHHA 2ISYA 1TQMA 1WWXA 2Z9OA 3ZMSA 4RAYA 4LFUA 1D5VA 3C18A 4KICA 2QQAA 5FB2A 2FF4A 3EYYA 2RVCA 3LFKA 1K6OA 1XCVA 1G6NA 4EJVA 3GLXA 4WXDA 3HSFA 3RYPA 4BHBA 5DD4A 1RUOA 2P7CB 5KVRA 3ECOA 5L3CA 3F21A 1YS6A 4FT8A 4OOIA 2MLKA 4DNCA 2BE5F 2VT2A 2EV0A 1IXCA 2WTEA 2E7XA 1BIBA 5DD8A 3KZZA 3ELKA 1ZG5A 2DK8A 2P6SA 1IXRC 1BM9A 2PJPA 4A0XA 4U88A 4LG0B 1L3LA 4BAYA 1O57A 4HLXA 4EM0B 4M6XA 2OQGA 5CVRA 2NYXA 3MCZA 2D45A 2RNJA 3FHZA 2L3DA 4A5NA 4LLLA 2P8TA 3RI4A 2PQ8A 1VTNC 3H3ZA 3GZ5A 3ZMVA 2GAUA 2ZO4A 3RTRA 4YFKF 4LLGF 1R1VA 1FZPB 3N4MA 1JHHA 3K2ZA 1KQ9A 4NB5A 3C1DA 2AS5F 1B6AA 2EFOA 5E1WA 5EEGA 2FBKA 4YIIA 2ZNYA 4B09A 1F1ZA 4F7ZA 2Q8KA 1YLFA 1Z1DA 3J80K 2W24A 3PQKA 4WX9A 5BPIA 4IHTA 2HTJA 5ICCA 3ABTA 4HW0A 3TO9A 4CXFA 2ACJA 1KA8A 1IN4A 2O8XA 2CW0F 1S8NA 2JSCA 4I0BA 4ESFA 5LBQA 4HZFA 1FYLA 5CJ9A 2ZMEB 2P5VA 1J2XA 1QO0D 6PAXA 3LA7A 4G7ZF 2ZCWA 1FOKA 4MNUA 1YTYA 2RN7A 4ZYGA 4BQAA 5HOOA 5FGMA 4LB6B 1ZG1A 4HF1A 3QP5A 2NNYA 1HW1A 1U2WA 3MWMA 4BYYA 4Q4ZF 1U3EM 1HQCA 2MD5A 3G3ZA 3F3XA 3R61A 2E1CA 4M9XA 2XAJA 3HSEA 1V4RA 2KRFA 2M8EA 5AONA 1R22A 3K1PA 1U5TC 2P6TA 5BPDA 5HS7A 4ASNA 3D5LA 1RIOH 4WXHA 2YSRA 1LEAA 4YFNF 3CO6C 5LGUA 3BJ6A 3ABUA 3R4KA 3BPXA 4CO8A 2A61A 2QQBA 2JT1A 3L7WA 2QVOA 3W6KB 4IHSA 5J8FA 4RB3C 3DEUA 1BC8C 5HDNA 2DPDA 3GFMA 2HQRA 1TNSA 1J59A 2FRHA 4G6QA 2EFWA 3L9FA 3BP8A 1KQ0A 2DBBA 4UVBA 1YG2A 5E18F 1KYZA 1KU2A 1DP7P 2JPBA 3GF2A 1XD7A 4IRHA 1FYMA 4ON0A 3IRQA 4GGGA 2K86A 5CVJA 5BMZA 1KGSA 1XGSA 2VC1A 3Q9VA 1MGTA 5FD5A 2A3SA 5L3DA 4MTEA 1TQIA 5HLHA 3TO6A 4TV7A 1I5ZA 1UFMA 1FBSA 4ZZLA 1OYYA 1TLHB 1W7PB 2XAQA 2IVMA 3EETA 1IXSB 3C3WA 1I1GA 1Z91A 2CYYA 3RDIA 2KIMA 3VB2A 1FBQA 1K78B 4OINF 3EDPA 4LK1F 3K1MA 2HOEA 1T98A 5DYMA 1YIOA 3J7AO 3F8NA 2IA2A 5E8GA 3FXRA 3G73A 1PUEE 2BV6A 1RZ4A 2FXAA 3WGHA 1K78A 1CGPA 3FZVA 4KT5C 4KIFA 4IF4A 1DUXC 1PP8F 2HS5A 1STZA 2X4HA 3FM3A 4S05A 4IVNA 4M72A 2MH2A 3E3VA 1Z9CA 2J5OA 2YX4A 4G7HF 3RYRA 2DK5A 1CF7A 2HEOA 2A6HF 5IT3A 4G9YA 2F5FA 1WSUA 1BOAA 1IRFA 2FE3A 4MHGA 1AWCA 1S6LA 3ML6A 2M5WA 5D5XB 2D1HA 4U0YA 1XDSA 2FA5A 2W57A 4M73A 4HV5A 5LHGA 2O6GE 1QNTA 1QQIA 1E2XA 3RKYA 3ZMZA 2YPRA 1SD6A 2PN6A 1YS7A 4XLNF 1OYWA 3CUQB 4HV6A 1IN7A 3QAHA 2QBYB 5TRDA 3PQJA 2HZTA 3EUHA 4NQWA 3ZP5A 1ZG3A 1P4WA 4K2EA 3GXOA 1ZREA 2STTA 3ECHA 1FC3A 3FXUA 2QLZA 3QU3A 3IWFA 2P5LC 2V1XA 4MGRA 2H09A 2FNPA 3TQNA 1ZAOA 1ZRDA 3LAJA 3GFJA 1F4KA 4Y13A 5CVVA 4A0YA 2A07F 2H27A 2Z5UA 3WGIA 1XSXA 2KJBA 5LRRA 3WTVC 3K9TA 2J5PA 4RB0A 3F8BA 3KZYA 1TBXA 5IT9K 1HKQA 3IRRA 1Z6RA 4HOBA 2OBPA 3U2RA 3O2PE 1G4DA 3EQLF 1HSTA 1LDDA 3DF8A 3RPUA 4ENJA 2C6YA 1RUNA 2XKPA 3FMQA 1J7KA 3TKYA 3B02A 4PCQA 1S7OA 2E7WA 1R7JA 4BH9A 1JGSA 5LRSA 3LA2A 4B8XA 4A6DA 1EH8A 4LK0F 3KE2A 4I09A 2YR2A 2Y48A 4Y17A 4AIJA 5BQTA 1P4XA 1R1TA 2HYGD 4EM1A 2VN2A 1DDNA 1YQAA 3BDDA 2YU3A 4XSZF 3V7CA 2KKOA 2VC0A 5D5VB 1TW2A 3FMSA 3BZ6A 4LD5A 1ZGJA 1Z05A 2DFIA 3FM5A 5CVUA 1NHAA 2VT3A 3TO7A 3TDUC 3TOAA 5L3EA 1XSVA 3IWZA 1KYWA 2JZYA 2XRNA 3L2CA 1B1BA 3K69A 4AD9A 3VEPA 3U9GA 3M7GA 4I2OA 4WF2A 2LF8A 1LB2A 1C0WA 3FWEA 2HYFA 5HS9A 1FPQA 2P7VB 2FU4A 4P96A 2UWMA 5JFRA 3SFZA 4UNOA 5HDKA 3T8RA 1JHFA 1LEBA 3BJAA 3LA3A 1OKRA 2GZWA 3F8FA 1QGPA 5LLQA 5JI6A 1XDUA 1LJ9A 1YW9A 2BGCA 5CYVA 5ICGA 3E6BA 1UHMA 3GFLA 2ELHA 2HKOA 4EGZA 2A5YB 2LF7A 3DQVC 3KEOA 5KK1A 4AVPA 1RNLA 3I71A 2NNNA 2IT0A 1KU9A 3ZMTA 2GXBA 3MEXA 3C7JA 2QYOA 4IXAA 4ZYEA 1PDNC 3I64A 2F2EA 1AOYA 1SFUA 1G3TA 3BOQA 5DCMA 3LQRA 2QENA 2PEXA 5D6EA 5ICEA 2DTRA 3GWZA 2ZKZA 3VOEA 2IP2A 1OR7A 4LGWA 4FX4A 2GIVA 2CQKA 2CG4A 2OZ6A 3QOPA 1B9NA 3E6DA 4CICA 1GXPA 4WWCA 4XBFA 2PFBA 3HYIA 3RKXA 4EGYA 1DPRA 1USSA 1K7AA 1ULYA 1WKMA 3MZYA 4M71A 4AIHA 4FHTA 2B0LA 3WE3A 2EK5A 3HIFA 2PLYA 3KLNA 5DEQA 4WK8F 1UHWA 1O3SA 4KMFA 2XAGA 1TTYA 2STWA 2D1VA 2HFHA 4M9ZA 1IN8A 5L3GA 2COMA 3T1BA 1BC7C 3HRMA 3WG9A 5JVTA 2PBIA 4L9NA 3JAMK 3WTSC 3T0YA 1P4AA 4ZYHA 2XVCA 2L54A 2KIFA 2LDUA 3WGGA 3E6CC 1W4MA 4CHUA 4Q47A 2DO7A 2O0YA 2ZJ2A 3JTHA 3WU0A 5E1ZB 1MJ9A 3AAFA 1D8KA 4YIFA 3HHGA 2FEZA 3V8JA 5ERIA 2NS0A 4N0BA 1REPC 3DPTA 5HVQC 5DDGA 2MH9A 5D4RA 3PFIA 1HBXG 1Z6TA 1MJAA 3F72A 1FX7A 3I0TA 1MD0A 4OIPF 1B59A 5K5RA 4R79A 2GA1A 4IRGA 1O7LA 2QUFA 2OZUA 1U78A 2RC4A 3V8LA 4U7DA 1SD5A 2RKHA 2CGPA 1S29A 2EFPA 1ZLKA 3KLOA 5JR3A 4HBLA 1XMKA 3KP7A 1OMIA 1O3QA 2H6BA 1T6SA 1U6GA 1FLIA 3FMRA 2O61A 4MEYF 2ZNZA 3LWFA 4HF0A 1XCBA 3W6JB 3IKVA 1H0MA 1EH6A 4I01A 5HDGA 2HWVA 2V1DA 1F9NA 2H94A 3F8CA 2IRFG 2M30A 3TOBA 1XGNA 3ISPA 4U7BA 2Z33A 4MTDA 1OYIA 1B9MA 3JTGA 4WXCA 3ZMDA 5F6FA 1IAWA 1Z7UA 1YO5C 5CVIA 1ZGAA 3HSRA 1G3SA 1O7FA 1MJBA 4A0ZA 3KP6A 1Q1HA 4KN7X 3CUOA 2A6EF 4HQEA 5H6RA 3GYHX 1ODDA 4L5JA 3RKWA 1MDMB 2MC3A 1ON1A 4U0WA 1R5HA 4P9UA 3T8TA 2KIUA 1HW5A 3E5QA 2W84A 2AXLA 4LB5A 4UUVA 3O6BB 1V3FA 5FLXZ 2FMYA 3SQNA 3ZQ7A 1BIAA 1FSHA 4HQMA 2FBIA 1MZBA 3DP7A 1EV7A 2V79A 4RGRA 1SMTA 2IJLA 2DAOA 1USTA 1U5TB 2GWRA 3QP6A 2XIGA 5DV5A 4BXUA 1IUYA 5DCFA 4NHJA 4MQVA 5D5UB 3ZMUA 2W85A 3GX4X 2HDCA 2LNBA 4HX7A 3MFKA 1HKSA 2TDXA 3KCCA 2O3FA 1XSDA 3CTAA 3LAPA 1ZH5A 2E1NA 5E20A 3K1NA 2OD5A 2LSOA 3WTZA 5L3FA 3D0SA 4PGGA 2VE9A 4OMZA 2OAZA 4P9FA 2VBXA 1FSEA 4KUMA 3RPQA 4AWXB 4LG0A 2K4BA 2CSOA 5DUKA 3J81K 4MEXF 4ENMA 2JRTA 2EWNA 3WTUC 3VFZA 1ZN2A 4A12A 1H9GA 2PMUA 2R7FA 1B4AA 4E70A 5LHIA 4UV8A 1BI2A 3DKWA 3R0JA 2DLLA 5IT9Z 3GO5A 2G9WA 2XAHA 4HAMA 1ONVA 3JSPA 2M45A 3R0AA 4RB2C 4XSXF 1FWZA 4I7HA 4M74A 3B73A 1I27A 3KEQA 5K5OA 3L00A 1S3JA 4KFCA 1XGOA 1KU7A 3TGNA 1HSJA 4D0PA 1FYKA 3RJPA 5AIPA 4UVCA 1I1SA 3BPVA 1UB9A 3WTYC 4OIQF 3H92A 2FOKA 3M9AA 3J81Z 5HLGA 2XGXA 1BI0A 3JW4A 2HTSA 1W7PD 1XMAA 1BJAA 1TNTA 3SHFA 1P92A 2P5KA 4EMSA 5BOXA 3HRSA 4A5MA 2IA0A 5K1YA 2LKPA 2WC2A 4O6JA 5FFZA 2QBYA 1H9TA 2ZFWA 2JPCA 3DPLC 3NRVA 3FF5A 2ESNA 3P9KA 5DUIA 4A2UA 3HRTA 4R8HA 3DV8A 3F6OA 2HKXA 4Q48A 4UV9A 4PGHA 3WU1B 2P4WA 1P6RA 1ZARA 5TJJA 4XLPF 3L09A 1K79A 2FNAA 1LDKB 2EV5A 1YYVA 3HOSA 5HLIA 3IL2A 2EA4A 1YW8A 1S7AA 1YW7A 1KQ8A 3NQOA 4UXNA 3ULQB 3TDZC 1OPCA 3R60A 3MZHA 2WV0A 2ZMEA 2VONA 3SZTA 4G6DA 1W7PA 1GHCA 2K27A 1IN6A 1F5TA 2DQLA 3OOPA 4GXOA 2FQ3A 2XROA 2HGCA 1T38A 1QZZA 1BI3A 3LSTA 4AIKA 1QPMA 2EJRA 2ZBKA 2RQPA 3V7SA 1O3TA 3JSOA 5F1RA 3IC7A 3HOTA 3GZ6A 4P55A 1XGMA 4JBAA 4XRFA 4BHPA 2MBFA 3T5XA 5LEKA 3BY6A 5LGNA 3BJOA 2ADUA 3NEUA 3I59A 1FBUA 3V4GA 3WTWC 3QPHA 2V6CA 3WTXC 3DXJF 4HA8A 4KIGA 1ZYRF 4L0YB 5A2QZ 1WI9A 4L0ZB 2IA1A 2A69F 2YX7A 2RGVA 4G8XA 4I02A 5LEJA 2K7LA 2DT5A 3P9CA 4HF2A 4JQFA 3F8MA 1FP1D 3ERED 3CJNA 2VE8A 1I6XA 4EJWA 5F64A 4I98B 4MQ9F 3E5UA 2QZ8A 3SXYA 1T39A 4Q5SF 4QWQA 2PMHA 4PDKA 4GCVA 3I58A 1WRJA 1HXDA 3MAJA 2EA2A 3I54A 1IRGA 4EJTA 4RGSA 2ISZA 4EV0A 4GYIA 4L9TA 3REOA 2M1BA 5ICFA 3WE2A 1IF1A 5D5WB 4BNCA 1IW7F 1IN5A 5AIQA 1HKTA 2VBZA 1YFHA 3I5UA 1TW3A 1FNNA 2ZXJA 4R1HA 3ROUA 3GEZA 3JAMZ 5J8CA 3K0LA 1SD4A 2EV6A 1W5TA 3BROA 2GXGA 2OQRA 4RGUA 3DFGA 4ZH4F 2GA2A 1U5TA 1P2FA 4ETSA 3WTTC 1TQPA 4KDPA 2Q2EA 2EFNA 3FX3A 1SMYF 4HYEA 1J0RA 2BEOA 1QZYA 4RB1A 2VOOA 3E5XA 4ESBA 2F5EA 4ENKA 1R36A 1G3YA 4P5OA 5D8KB 2VOPA 3Q5FA 4L18B 1IZ1A 2BBYA 4IJAA 3HHHA 4EQQA 1GVJA 4YG2F 2RDPA 3ZN1A 3I53A 2X0LA 3IKTA 5JHUA 4QLCU 5D4SA 1HW2A 1PP7U 1D8JA 3HTUA 1BI1A 4HX4A 1RI7A 2UZKA 3EYIA 1D3YA 2WWYA 2IW5A 3GFIA 3KP4A 1SFXA 1G3WA 4PZJA 4L5IA 2XASA 4S04A 4O5VA 3E97A 1ZLJA 4I0AA 1MDMA 2KJCA 3F6VA 3CO7C 1T2KA 2K4JA 2CFXA 1X3UA 2IPQX 5LGTA 5D8LB 2Y75A 1FY7A 5E1XA 3H3UA 4M6YA 4EJUA 1ZRCA 2NRAC 3E6MA 3CUQA 2ESHA 1ZHFA 2PG4A 3HRUA 2BYVE 1FP2A 3GW2A 2HR3A 5ED4A 2W25A 5ILVA 3CUQC 4UHTA 1LDJA 1R23A 1XB4A 2VBWA 4RAZA 4WCGA 4LLNA 2FMLA 2RV8A 5H6QA 2DQRA 3F22A 2QM3A 2VODA 5FFXA 2CO5A 1J9IA 4LJZF 4RGXA 2L4MA 3KP5A 1BBYA 2JTVA 5EEHA 5A2QK 3WODF 2MLGA 2H6CA 4LMYA 5D6FA 1Y0UA 4HLYA 3IHUA 4G94A 1LVAA 1WQ2A 4CGZA
chains in the Genus database with same CATH superfamily
5ILUA 2PMZN 2DU9A 2QQ9A 1U9OA 4BDZA 2KLOA 4ZYAA 2L4AA 3KP3A 2ZC2A 2HOTA 3FKIJ 3GUDA 3OV8A 2D2WA 4JX5A 1R1UA 2HQNA 2XUBA 3KP2A 4L9VA 3VYUB 3N97A 4KNYA 1ETQA 2KDOA 5EZGA 2NAZA 2XGDA 3O3KA 3QRFF 2I8DA 3KFWX 1YRNA 2QKMB 3TP0A 4ZZDA 4C2UA 2WB1N 1R5GA 2UUZA 1LQ1A 2JVHA 4FX0A 2XAFA 3RKQA 3K70C 4CYDA 4Y52J 5E17F 4XONA 5H20A 2O5RA 3JRAA 5EYRA 4KA4A 1KU3A 3CCYA 1Y8RB 4RS8A 2DI3A 3HEFA 4KIBA 1MBJA 4M9SA 3ZN0A 5J4VA 4OMYA 3Q9SA 3CLOA 3P9IA 4YFXF 4A6EA 5E3NA 1EH7A 2V9VA 2Z3YA 4BGDA 2VBYA 1T95A 2EB7A 2VQLA 1SD7A 2EFQA 3GMEA 1QBJA 1FT9A 3I4PA 2L9RA 2OA4A 2G7HA 3EUAA 1VQ7I 1M1EB 2EQRA 3MN2A 2V1UA 3QU6A 1R58A 2X6XA 3OYKA 2E1MC 2L01A 3IH2A 3CDHA 1U8RA 2PI0A 3S2WA 1X4PA 4QPQA 1OCRH 3FHNA 4BHCA 4M3GA 1OISA 3GTJJ 3GLLA 2M87A 1S72I 4CZZA 1VNDA 2DTZA 4BBRJ 5M3FJ 4KYWA 3BWGA 4EM2A 5FLMJ 2KRCA 1LNWA 4EJOA 3HTSB 1ZK8A 1S7EA 3OYDA 1T0FA 3I59B 4ESJA 3CCUI 3R6SA 5FD6A 3A0BC 4KN4X 3DKXA 3FXOA 3AKZA 3COAC 2WY8Q 4ENNA 1FJLA 2R7UA 5CLSA 2KRHA 4KMUX 3V8KA 1TT0A 2XV4S 4HNVA 5HS8A 4DYQA 3MQ0A 1Z0XA 3LQQA 5BS6A 3WHCA 1W5SA 4N9IA 4GYGA 4Z2YA 1V5FA 5ILSA 2Y0MA 3SZPA 1UCRA 2F5CA 2Z99A 5DCMB 2CFOA 2O03A 3V42A 4C9YA 4CDGA 3H35A 2R7DA 1X19A 2LBFB 5B1BH 3I4MJ 1JE8A 3G6EI 3KETA 4PFOA 4BQNA 3HUGA 4IRIA 3HOWJ 4HX8A 2VXZA 1ON2A 4XLEA 4JK1X 5K5QA 1OFCX 2MABA 1I3AA 4XM3A 1MMNA 3BG9A 1J5YA 2BHYA 3F23A 4H0EA 2KIQA 4BE0A 3K4CA 2KP6A 3V7RA 3OMYA 2DFFA 2DW4A 2QWWA 3BZCA 5K7HA 4G7OF 4JP0A 3MKYB 3K4MA 3U1KA 2R7VA 4NC7A 4E7ZA 5LFAA 3AG3H 2K02A 2DPUA 3U1DA 4U0VA 1YHQI 3B6AA 3CCLI 4XKVA 3PNVA 4N9HA 4DQ2A 2UXXA 1XN7A 3CMAI 1UJ8A 3ZPLA 1KZHA 2DT6A 2IGKA 3GCMA 3LMMA 4BXFA 5EGOB 5E8IA 3KZIC 2OU2A 3M1EA 2UXNA 3IUOA 2XHKA 5J6XA 1E17A 4CYCA 5J1YA 1BN5A 4ZYDA 1A04A 1GXQA 4O3MA 4GO1A 5FLXK 2VASA 4B3XA 1J75A 4I99C 3ZXSA 3P5JA 2JA8J 4UVAA 4HDUA 2A68F 5JVGF 1JXSA 5FO5A 1CF7B 3M8FA 3WHBA 4DW6A 2FSWA 4XORA 1IRZA 1E3HA 3N05A 3QPTA 3E1SA 4IPAA 3J80Z 5L3BA 1JKOC 1L0OC 3SFIA 3K7AJ 2L02A 3P7NA 3CC7I 4OIRF 4OIOF 2MSYA 2YS9A 1ZRFA 1DPUA 1X1PA 5GAHJ 1JUSA 2RNGA 4L9JA 4A3LJ 3FXMA 2FBHA 3FXQA 4XKCA 2ETHA 3HGGA 4EVIA 5M5WJ 1PVEA 4CA0A 2R3SA 1SAXA 4ZDOA 2F5DA 1R00A 3M8EA 2VJIA 3OR2C 2Q0OA 2MA3A 4OU0A 2Z2SB 2CWEA 1O3RA 1MKMA 2CS3A 3K4LA 4HDVA 4Y15A 1YJ9I 2GQQA 2V9PA 3H5NA 3S1NJ 3OYCA 2ZXHA 3DU6A 3VODA 4AU7A 2XKOA 4QTRA 1NG7A 2G7UA 3IH4A 3GVAA 3RIRA 1SFEA 1BA5A 4CZCA 5LHHA 2ISYA 2V9KA 5M5XJ 1TQMA 1WWXA 2Z9OA 3FISA 2BW3A 3ZMSA 4RAYA 4LFUA 2X1EA 1D5VA 4GRIA 3C18A 4KICA 2QQAA 5FB2A 4XLHA 1MBGA 5C4XJ 2FF4A 3EYYA 1WVRA 2RVCA 3LFKA 4II3A 1K6OA 1TC3C 3CC2I 1XCVA 1G6NA 2DA1A 3TW7A 2WAFA 2M8GX 4B4CA 2EZLA 4QSHA 4FTHA 2CH0A 4EJVA 3GLXA 3A01B 4S0HB 1A5JA 4WXDA 3HSFA 3RYPA 4BHBA 5DD4A 1RUOA 2P7CB 3OOUA 5IY5H 5KVRA 3ECOA 5L3CA 3F21A 1YS6A 4FT8A 4BQQA 3JREA 1BJZA 1EKEA 3MD2A 4OOIA 4UUSB 1DU0A 2M4KA 4A3CJ 1FEXA 1DGRM 2MLKA 2Q2EB 1D1CA 2QF7A 4PJLA 1F43A 4DNCA 1SEUA 5H2FC 2BE5F 2VT2A 1FTTA 1LUJB 1RR8C 1BR1A 4IL6C 2EV0A 1IXCA 2WTEA 4A3EJ 2E7XA 4XRSG 1BIBA 5DD8A 3KZZA 3ELKA 1ZG5A 2DK8A 5E3LA 2P6SA 2VPRA 3DCFA 1IXRC 1BM9A 2PJPA 2K3PA 3BTCA 4NC8A 4A0XA 3IH3A 4L5EA 4U88A 2NVUB 1L3LA 4BAYA 4LG0B 1O57A 4HLXA 4EM0B 3JRGA 4M6XA 3QPLA 1A36A 2XPVA 4D1QA 2DFEA 2MG4A 2OQGA 3H1CA 1V55H 1MH3A 2XC7A 2HZDA 3LSIA 5CVRA 2NYXA 1EA3A 4DZJA 1UELB 1I50J 3MCZA 4CCJA 2D45A 2RNJA 3B6CA 3FHZA 4BE1A 3HJEA 2L3DA 4A5NA 4LLLA 4E7SA 2P8TA 3RI4A 2PQ8A 1VTNC 3H3ZA 3GZ5A 3TMOA 2BY0A 3ZMVA 1Z7LA 2GAUA 2VLAA 3AG1H 3BQYA 4FISA 2ZO4A 4XR6A 4UUTA 3RTRA 4YFKF 1I3QJ 1R1VA 4LLGF 5EG0B 1FZPB 3N4MA 4XL9A 1W0UA 1XG1A 1MNMC 3CESA 2ME0A 4NBQA 1JHHA 3K2ZA 1KQ9A 4NB5A 5GTIC 3C1DA 2AS5F 4RM2A 3PO2J 4F91B 2M3AA 1B6AA 2EFOA 1WCMJ 5E1WA 4X1EA 5EEGA 2FBKA 4YIIA 3H0GJ 2WY7Q 2VXDA 1POGA 1ZELA 2ZNYA 2BXZA 5KAIC 4IOAF 4B09A 3ZQIA 1F1ZA 4F7ZA 2Q8KA 1YLFA 1Z1DA 3J80K 2W24A 3CDIA 3PQKA 1BW5A 5B66C 4WX9A 2LOOA 4HSRA 5BPIA 2E35A 2M7AA 1TL8A 4CCNA 3CQZJ 4IHTA 2OTJI 3SDGA 4B3AA 2HTJA 5ICCA 3ABTA 3LSRA 1Y1WJ 5DM6F 3GTKJ 4HW0A 3TO9A 4CXFA 2ACJA 1KA8A 1IN4A 4D7MA 2O8XA 2CW0F 1S8NA 2ECCA 2Y2ZA 2JA2A 2JSCA 3ASNH 4I0BA 4II2A 4NDLA 4ESFA 5LBQA 4HZFA 1FYLA 5CJ9A 2ZMEB 2P5VA 2XF7A 1J2XA 1MW7A 1QO0D 3A1YA 1OCZH 1VQ5I 6PAXA 3LA7A 4G7ZF 2ZCWA 1X2MA 3OY9A 1FOKA 3S8PA 2DMPA 2R7OA 3ABLH 4FQGA 4MNUA 2QSFX 2ZXIA 2EIKH 3M8JA 4FASD 1YTYA 2RN7A 4ZYGA 4BQAA 4G6TB 5HOOA 5FGMA 5E3OA 4LB6B 4HG2A 3OL3A 3QP5A 1ZG1A 4HF1A 3K10A 2ZJRF 3GZNB 1UMQA 2NNYA 2IAIA 2BY1A 4D9JA 1HW1A 3L1PA 2VKHA 3IAS2 1U2WA 3MWMA 4BYYA 4Q4ZF 1U9NA 4E7JA 1R9TJ 1U3EM 2KL4A 2L5QA 3DEEA 1FOWA 1HQCA 3G1MA 2DDAA 1WH5A 1YIJI 2R4GA 1DP3A 2MD5A 3G3ZA 1IGNA 3L2VA 1PYVA 4A3IJ 2DOAA 1TZLA 5IP9J 3F3XA 3R61A 2E1CA 4M9XA 2XAJA 3VPRA 3HSEA 1JKPC 1V4RA 2KRFA 2M8EA 4UUSA 2BXYA 5IYBJ 3PIOF 4IKFA 3AL0B 3OR1C 2LY2A 5AONA 5EJCA 1R22A 3S1MJ 2LLKA 1MH4A 1Z3XA 1WJDA 3K1PA 1U5TC 5GP9A 2P6TA 3OYMA 5HS7A 5BPDA 3I3LA 4ASNA 3D5LA 1RIOH 4WXHA 5FJ8J 3E0JB 2YSRA 1LEAA 4YFNF 4BKXA 3CO6C 2PJRB 4GFBA 2NVXJ 5LGUA 1ETWA 3BJ6A 2K9SA 3ABUA 3R4KA 3BPXA 4CO8A 2A61A 4P1WA 2QQBA 4XOTA 3EPZA 1SVLA 2O9LA 3BG6A 2JT1A 2MFZA 3L7WA 3LSKA 2ZFUA 2QVOA 3W6KB 2KPMA 2XSJC 1LE8A 3JRCA 4IHSA 5J8FA 4RB3C 3DEUA 2W1OA 1VQ8I 1BC8C 5HDNA 2R7ZJ 5KNLA 2DPDA 1APLC 1ZQ3P 1MBKA 2MGQA 3GFMA 2HQRA 1TNSA 1Z67A 1IUFA 1J59A 2FRHA 4G6QA 2HYJA 2EFWA 3L9FA 3BP8A 1KQ0A 4J19A 4E4HA 2DBBA 2E5NA 4UVBA 1YG2A 4IHYA 5E18F 1KYZA 1KU2A 5GPCA 1MSFC 3CP8A 1V5EA 1DP7P 2JPBA 1QPIA 1FMVA 3VYRB 3MKWB 1G59A 2BHZA 3GF2A 1XD7A 2NS8A 3HXLA 2MYSA 4IRHA 3DBRB 2D5VA 4M3BA 1FYMA 2XDVA 4ON0A 1QVTA 3IRQA 4GGGA 2K86A 5CVJA 5GADJ 1KGSA 5BMZA 2E5ZA 3VDXA 3L2UA 1X1BA 3A03A 1XGSA 3OL4A 3H0DA 2VC1A 2DA5A 3LSMA 3Q9VA 1MGTA 4N4NB 4IZZA 5FD5A 2R93J 2HOSA 2M34A 1FOXA 2A3SA 2JA5J 5L3DA 2A6TA 4E7HA 2ELKA 5IOYA 4MTEA 1TQIA 5HLHA 2EH3A 3TO6A 4TV7A 1I5ZA 1UFMA 1FBSA 3BZKA 4ZZLA 1OYYA 1QHGA 3K4JA 4EEFG 1TLHB 1OCTC 4Y7NJ 1W7PB 2CUFA 1WH7A 2V4JC 1HC8A 2HPIA 2XAQA 2IVMA 3EETA 5F0FA 5HNFA 1IXSB 1W0TA 3C3WA 2L7FP 1I1GA 2Y0SA 1Z91A 1YI2I 2CYYA 2BY2A 3RDIA 3BTLA 4BL0B 2DDBA 2KIMA 4J00A 5F04A 3VB2A 4BY7J 4KISA 1FBQA 1K78B 2F4OB 2X6WA 4LIUA 1E3PA 4OINF 3EDPA 2MW8A 2Z1DA 4LK1F 3K1MA 5C3EJ 2KMUA 1ZKGA 2HOEA 1T98A 3GTQJ 5DYMA 1YIOA 2ZSIB 3J7AO 1WZ2A 2XGEA 1P7JA 4HSTA 2HDDA 4B1RA 3ZGKA 1NK2P 3F8NA 2IA2A 5E8GA 1ITYA 2EIMH 3FXRA 3G73A 1PUEE 2BV6A 3C2HA 3CJRB 1MIJA 1RZ4A 2FXAA 3WGHA 4MIMA 1XMXA 2DN0A 4PFPA 1K78A 1CGPA 3BG3A 2R5YB 3FZVA 4KT5C 1TWHJ 4KIFA 1QU3A 4IF4A 2H8RA 1D0YA 1DUXC 3Q3SA 1PP8F 2CJJA 2LFBA 1PJRA 2HS5A 1R4NB 1STZA 4XN3A 1Y1VJ 4LIVA 2X4HA 3FM3A 4S05A 1JTYA 3ZQCA 4IVNA 4M72A 2MH2A 2H8WA 2O7OA 3E3VA 1Z9CA 2J5OA 2YX4A 4G7HF 3RYRA 2DK5A 3H9QA 1CF7A 2VPLA 2HEOA 3FK6A 2LKSA 2A6HF 3CC4I 5IT3A 3H3VK 4G9YA 2F5FA 1D0ZA 1XC5A 3BC8A 2LREA 1WSUA 1BOAA 1IRFA 2FE3A 2PMZA 4MHGA 1W36C 1AWCA 2X1DA 1S6LA 3ML6A 2M5WA 5D5XB 2D1HA 4U0YA 1XDSA 3HM5A 3A4CA 2FA5A 2W57A 4NUBA 2E2JJ 4M73A 4HV5A 5LHGA 2WV1A 1LFPA 2O6GE 1HF0A 2JA6J 5J3LA 4ABZA 1VFCA 1QNTA 5GAEJ 3DTIA 1QQIA 1E2XA 3RKYA 3RPUD 4CH7A 9ANTA 3ZMZA 2YPRA 5M3MJ 1SD6A 2PN6A 2IS6A 3GTLJ 1MBEA 1YS7A 2KHMA 4XLNF 1OYWA 4LG3A 3CCMI 2VJ4A 1VQ9I 5K7ZA 2Y31A 3CUQB 4HV6A 1IN7A 3QAHA 2QBYB 3S93A 5TRDA 3PQJA 2HZTA 2BW3B 2R5ZB 3EUHA 4QPOA 4NQWA 1N75A 2H1LA 3ZP5A 3O8HA 1ZG3A 2EIJH 1HCRA 1P4WA 5IYCJ 3LNQA 4OAYA 4K2EA 3GXOA 1RETA 1ZREA 3ECHA 2STTA 3VSKA 2L9SA 1FC3A 1WFXA 1MBFA 2KDZA 3CCVI 3FXUA 2QLZA 2LYCA 3QU3A 3FIWA 2QQ8A 4AYBA 3IWFA 2PJRA 1A6QA 1VQPI 2P5LC 2V1XA 3KIOA 3L2QA 4C2TA 4MGRA 2W7NA 3BLYA 2H09A 2FNPA 5E3MA 3TQNA 4BY1J 1ZAOA 1ZRDA 3LAJA 3GFJA 1F4KA 4OWRB 4Y13A 1R71A 5CVVA 4A0YA 2A07F 2H27A 1VQOI 5IYDJ 1Y0NA 2Z5UA 1D5YA 1G2HA 1QVUA 2E1MB 2COBA 3WGIA 1XSXA 2KJBA 5LRRA 3TP3A 2K9QA 3WTVC 4A69C 3K9TA 2J5PA 4PUSA 4RB0A 3F8BA 4BBSJ 3KZYA 1TBXA 5IT9K 1HKQA 3LL7A 3IRRA 1Z6RA 4HOBA 2OBPA 3U2RA 3O2PE 1G4DA 2DJNA 3EQLF 5CKTA 4BU2A 2FJ1A 2E2IJ 1HSTA 3H5RA 1LDDA 3DF8A 3RCOA 2DMUA 3RPUA 4ENJA 2C6YA 2W48A 1RUNA 3PSIA 2XKPA 3FMQA 1J7KA 3TKYA 3CF5F 3M4OJ 1N25A 3B02A 4PCQA 1JI8A 1S7OA 4CUGA 2E7WA 1R7JA 4BH9A 1JGSA 5LRSA 3CJTB 3LA2A 3GTOJ 4B8XA 4A6DA 1EH8A 1QZEA 4B44A 4LK0F 3KE2A 5F0HA 4I09A 2YR2A 1SFOJ 2Y48A 1AKHB 1R6RA 2JK3A 4Y17A 4AIJA 2JN6A 3DEWA 5BQTA 4KT6A 1P4XA 1R1TA 3D1NI 2HYGD 4XLCA 4ZJZA 2YU9J 3BCAA 4EM1A 4XRSA 2VN2A 2W00A 3DBHB 1DDNA 1YQAA 4XMYA 3CCJI 3BDDA 1JTXA 2K40A 2CQ7A 3J7ZI 2LBFA 3S1QJ 2YU3A 4XSZF 3V7CA 4UB8C 3CMYA 2KKOA 2VC0A 5D5VB 1TW2A 3FMSA 3BZ6A 3RZOJ 4LD5A 2WBMA 1ZGJA 1Z05A 3S16J 1WI3A 2DFIA 3FM5A 5CVUA 1NHAA 5FLVA 2E71A 4UB6C 2VT3A 3K70D 4BJ5C 1IJWC 3TO7A 3OSGA 1E0EA 2GLOA 3TDUC 3TOAA 5L3EA 3SZGA 4CCKA 2ELJA 1XSVA 3IWZA 1GVDA 4RAGA 1KYWA 2JZYA 1WGXA 1SVMA 1OJLA 2WB1A 4MO7A 1H88C 1B72A 1SAUA 2XRNA 3L2CA 1X1AA 2M0MA 1HLVA 3UR3C 1B1BA 2AO9A 3K69A 4AD9A 3CD6I 3VEPA 1DGWY 3U9GA 5F08A 3M7GA 2R7XA 4XICA 4I2OA 4ZDPA 2R5ZA 1LVKA 4IQ4A 3FBNB 2ME6A 4WF2A 3ZQFA 2LF8A 1LB2A 1BR4A 1C0WA 3OYFA 4M3EA 3FWEA 2VJJA 1VZ0A 2HYFA 5HS9A 1FPQA 2P7VB 2FU4A 3HUGB 4P96A 2LTPA 4E7IA 2UWMA 1TWFJ 5JFRA 3KEYA 1E3OC 1ORKA 3SFZA 3CMMA 1UG0A 2K85A 4UNOA 2L9NA 1VQMI 5HDKA 2CQNA 1W5CC 1ACIA 3T8RA 5J4YA 3FBIB 2L9VA 2LKXA 3A2KA 3IP4B 1JHFA 1LEBA 3BJAA 2F5VA 3LA3A 2M2EA 3D5RC 3C2BA 1SVOA 1WJEA 1OKRA 1NK3P 1MMSA 1LKXA 2GZWA 3G2BA 3F8FA 1QGPA 1BOBA 3WU2C 5B5EC 5LLQA 2B63J 1Q1VA 5JI6A 1XDUA 2CUEA 3AG2H 1LJ9A 1YW9A 2BGCA 2R7SA 5DTDA 5CYVA 2DXIA 5ICGA 3E6BA 1UHMA 3TEDA 3GFLA 2ELHA 3L2WA 5E79C 2NVYJ 2HKOA 1YJWI 2EILH 1OCOH 4EGZA 4IO9F 2A5YB 2LF7A 3HL2A 3CCQI 3BR1A 3DPUA 4C2MJ 3DQVC 3KEOA 5KK1A 4AVPA 1RNLA 4XKWA 3I71A 1YJNI 2CW8A 1MMDA 2NNNA 2XGCA 2IT0A 3ASOH 2K5CA 2ZSHB 2DCEA 2L2OA 1KU9A 3OIPA 5TGTA 3MEXA 3ZMTA 1BL0A 2GXBA 4BE2A 3ZQGA 2XB5A 3C7JA 5CQEA 2QYOA 4IXAA 2FD5A 3OSFA 1FOYA 2E34A 4QIWN 4ZYEA 1G8XA 3I64A 1PDNC 2IGMA 3DU5A 2F2EA 1LFUP 2LY9A 3DTEA 1AOYA 1SFUA 1MBHA 1G3TA 3BOQA 4CYCB 5DCMA 5FKLA 1FIAA 2WAQN 3E7LA 3LQRA 1RKWA 4JX4A 2QENA 2PEXA 2WADA 5D6EA 5ICEA 2DTRA 3ONQA 3WG7H 5JHFA 1GV5A 1A35A 2JSPA 4A3KJ 4FCYA 3GWZA 2ZKZA 3GTGJ 3VOEA 2IP2A 2TRTA 1LE8B 1JGGA 4PJNA 1OR7A 4LGWA 4FX4A 2GIVA 2X6OA 4MFEA 2WAEA 2JVGA 2CQKA 2HXOA 2AQFA 2CG4A 2OZ6A 1T56A 3QOPA 1B9NA 3E6DA 1IV6A 1MMAA 1VQ6I 3Q0VA 4XOPA 4CICA 3G4SI 1GXPA 4WWCA 4XBFA 2PFBA 1Z21A 4DBRA 3HYIA 2BY3A 2XF5A 3RKXA 4EGYA 1DPRA 1USSA 2GXAA 1N77A 4G12A 4PJJA 1XX5A 3M3YJ 1K7AA 1ULYA 1WKMA 2LRDA 1ETYA 3MZYA 1R5ID 3ABMH 4PK4A 4M71A 4AIHA 3JRDA 4FHTA 2B0LA 3WE3A 2EK5A 3HIFA 5JLXA 2PLYA 3KLNA 4Y3OA 5DEQA 4WK8F 1UHWA 2N8GA 1O3SA 2XPUA 4DGWB 2QGUA 4KMFA 2XAGA 1TTYA 3HOYJ 2STWA 3I56I 2D1VA 5IPAA 4AIDA 5C4JJ 1TT5B 2HFHA 4M9ZA 1IN8A 2LY1A 3QQAA 5L3GA 2EZHA 2COMA 3T1BA 5KCMA 4XKBA 3K4KA 3OYGA 1BC7C 1TWAJ 3HRMA 1K6YA 3WG9A 5JVTA 3S2DJ 2IS4A 5F27A 2PBIA 4L9NA 5J47A 3JAMK 3WTSC 3T0YA 1JT0A 1P4AA 2HDWA 4ZYHA 2FQ4A 2X51A 2XVCA 2L54A 2L7ZA 2KIFA 3JRFA 2AHQA 3ZQHA 2LDUA 5J1RA 2XRLA 2IS1A 3WGGA 3E6CC 4Y4RA 4BS9A 5HODA 1ETXA 3A0HC 1W4MA 4A3GJ 1NG6A 2YUSA 4CHUA 4DZPA 5B1AH 4Q47A 2DO7A 2X48A 2LG4A 3ZQQA 2O0YA 2ZJ2A 2QA4I 4Y33A 3JTHA 2GBYA 2XF6A 5CPRB 4RDUA 2R92J 1RKTA 1CQTA 2QSHX 3WU0A 2XSDC 2CW7A 2CU7A 5E1ZB 1MJ9A 3AAFA 1D8KA 4HRIA 4YIFA 3HHGA 2FEZA 3V8JA 1RR7A 2JWTA 5ERIA 5F0CA 3S15J 3MVPA 2CQQA 2NS0A 4UY8I 2CUJA 1WHUA 4XIDA 4CCMA 4N0BA 1REPC 4CCLA 3DPTA 5HVQC 5FKMA 5FKKA 5DDGA 2JUGA 2MH9A 3MZ8A 4ZC3A 5D4RA 3I55I 3HG9A 3PFIA 2B9SA 4DBQA 1GT0C 2G0EA 1HBXG 1X4OA 1Z6TA 5DM7F 2KT0A 3K4BA 2Y30A 1MJAA 3F72A 2LK2A 1FX7A 3X2QH 3FXKA 3I0TA 2JUCA 1MD0A 4OIPF 1B59A 5K5RA 5LD2C 2VQCA 4R79A 2GA1A 4IRGA 2I10A 3H9GA 1O7LA 3RQIA 2QUFA 2OZUA 3BR6A 1IDZA 1U78A 1UHSA 1K4TA 3FKJA 4HPQA 2DYRH 2RC4A 3QPSA 3V8LA 3JRIA 3PL8A 1F36A 3ERMA 4U7DA 4C3HJ 3LSGA 4X0GA 3HC7A 1SD5A 2RKHA 2CGPA 4X6AJ 3BQZA 1S29A 2EFPA 1ZLKA 5JLWA 3KLOA 4PJMA 3RQ4A 2OF7A 3U21A 3ZOBA 5JR3A 4BJ6C 2OV7A 4HBLA 5KHDA 3F9KA 1XMKA 1KONA 3KP7A 1OMIA 2EZIA 2KQRA 1A6IA 1O3QA 3G71I 1UZCA 2V1NA 3CMEI 2H6BA 3FXLA 3F0CA 2NXNB 1T6SA 1U6GA 4IOCF 2HNHA 1P7IA 2ID3A 1FLIA 1VQ4I 3ZQLA 2O8KA 1BW6A 4A93J 1JKRC 3FMRA 3HGYA 3BR5A 2O61A 3CJQB 3HOUJ 4MEYF 3I9V2 2ZNZA 3PIPF 1WJCA 3LWFA 4HF0A 4XK4A 1XCBA 3W6JB 2MD0A 4A3JJ 1TWGJ 5FROA 4HNTA 3IKVA 2JQ7A 2K9MA 1H0MA 1EH6A 2Y0SN 4I01A 3KYCB 5HDGA 3IV5A 2HWVA 2V1DA 3NWTA 1F9NA 4AM3A 2H94A 3F8CA 2IRFG 2Q1ZB 2KFDA 2M30A 3LFUA 3TOBA 1XGNA 2X1CA 3ISPA 5J40A 4U7BA 2Z33A 4MTDA 1OYIA 1B9MA 4KITB 3JTGA 4WXCA 3ZMDA 1T8IA 5F6FA 2GM4A 5CQGA 1IAWA 1Z7UA 2VKVA 4IX7A 1YO5C 2A05A 5CVIA 1H89C 1D1BA 1ZGAA 1GUUA 4C3JJ 3HSRA 2IGOA 1WJFA 4AC0A 4CCOA 4RBOA 4W1UA 1G3SA 1O7FA 4BEHA 1MJBA 5TISC 2LMDA 4A0ZA 1ZR2A 3KP6A 2Y9ZA 1Q1HA 1HDDC 3QYEA 4KN7X 3CUOA 3OWTA 2A6EF 3PUFA 3ABKH 3JR9A 4HQEA 2R7WA 3OS0A 1U0JA 5H6RA 3GYHX 1ODDA 3QYBA 4L5JA 3RKWA 2CQXA 1X58A 2VKEA 1MDMB 2MC3A 1ON1A 3LSPA 2NVTJ 1T0FC 3KYDB 4U0WA 5FKOA 2R0QC 4A3BJ 1R5HA 4P9UA 3HOZJ 3T8TA 5EGOA 2KIUA 4RLQA 1QA6A 1HW5A 2EPFA 3E5QA 3CCSI 3EUKL 3K2AA 4BEHB 2M0CA 1GDTA 4V19K 5B3SH 4EATA 2W84A 3PNYA 2AXLA 4DYRA 2V6EA 4LB5A 4UUVA 3O6BB 1V3FA 2DOEA 5FLXZ 2FMYA 5F1JA 3S3OA 3PUBA 2QKLB 2AXTC 3SQNA 4I6ZA 3ZQ7A 1BIAA 4F93B 4ANJA 3AL0C 1FSHA 3HOVJ 4HQMA 2FBIA 1MZBA 3DP7A 2VUMJ 1EV7A 2V79A 4RGRA 1SMTA 2IJLA 1V5GA 1GLNA 2DAOA 1USTA 1U5TB 1VQNI 3SJMA 2GWRA 3QP6A 2XIGA 5DV5A 2E1OA 4BXUA 1IUYA 1BR2A 4ZTJA 5DCFA 1J09A 4NHJA 1JUPA 3KPHA 4MQVA 3ZMUA 5D5UB 2W85A 2I5UA 1XTAA 4BDYA 2FX0A 3GX4X 1Y6IA 5IOZA 2HDCA 2LNBA 4HX7A 3MFKA 2E19A 3PJRA 2VJ5A 3GBGA 1HKSA 2TDXA 3OYHA 2K3FA 3KCCA 3O8GA 2CV0A 1HOMA 2O3FA 1XSDA 1QHHD 2X85A 3CTAA 2M7BA 3LAPA 1ZGWA 2HVRA 1FMWA 2ECBA 5FRNA 4ZDLA 1ZH5A 4OAZA 2E1NA 2ID6A 5C44J 5E20A 1MNEA 3K1NA 2OD5A 2LSOA 3WTZA 1QRYA 1FIPA 5L3FA 1O4XA 3D0SA 4PGGA 1NH3A 2VE9A 1VQLI 4OMZA 2OAZA 4F92B 5GPAA 2IXSA 4P9FA 4AYBN 2VBXA 2DT7B 2RAEA 1FSEA 3BG5A 4KUMA 4RAFA 3RPQA 4AWXB 5IP7J 3CP2A 3A01A 4F52A 1A31A 4LG0A 3DLLF 3MMYB 2ZMEC 4D7NA 2K4BA 2CSOA 1EF4A 5DUKA 3J81K 1WJAA 4MEXF 3JRBA 3SEQA 4ENMA 2JRTA 2RQQA 2EWNA 3WTUC 4PSXA 1R4MB 2JMWA 3VFZA 2GOXB 2PX9A 1ZN2A 3OYIA 4A12A 4YRVA 1H9GA 2H1KA 2PMUA 3OYNA 2R7FA 1B4AA 3PFYA 3DLAA 4E70A 3DWLE 4UV8A 1OR7C 1BI2A 3DKWA 5LHIA 1LPQA 1YOVB 2IBDA 1B72B 3R0JA 5EG0A 4HNUA 1XPXA 1V54H 2DLLA 3W2VA 2OPTA 1ZR4A 4BACA 3K6GA 5IT9Z 3GO5A 2G9WA 2ZJQF 3OYAA 2XAHA 4HAMA 1SC7A 1K61A 1ERDA 1ONVA 4NNJA 3JSPA 4YELA 2M45A 3R0AA 4RB2C 4XSXF 3W2AA 1FWZA 4I7HA 2XPWA 4M74A 3B73A 1I27A 2P81A 3KEQA 5K5OA 3L00A 1S3JA 1IDYA 4KFCA 1XGOA 3FDYA 1KU7A 3TGNA 1HSJA 4D0PA 1FYKA 2MC4A 3RJPA 1JT6A 1YE9A 5AIPA 4UVCA 1W1WE 4V2GA 1I1SA 3BPVA 2F4IA 1UB9A 4KJZA 3WTYC 4OIQF 3H92A 2FOKA 1R49A 4A3MJ 4BUPA 1X2NA 3M9AA 3S3MA 3J81Z 2HPMA 5HLGA 2XGXA 1Z77A 1BI0A 4JOMA 3JW4A 4HEA2 2HTSA 3J7AY 2DA3A 4PSWA 1W7PD 1VI0A 4I76A 1IO2A 1XMAA 4CSWA 2JA7J 1BJAA 1P9QC 1TNTA 4AVZA 3SHFA 1P92A 4IHXA 4A3FJ 2P5KA 3CDLA 1Z3YA 3GTMJ 3M1CA 4EMSA 5BOXA 3HRSA 1MNDA 4A5MA 2IA0A 5KAFC 3CCRI 5K1YA 4Z6YA 2LKPA 2WC2A 4O6JA 5FFZA 2QBYA 2V7FA 1H9TA 2ZFWA 4LOCA 2UV1A 2JPCA 2ZB9A 3DPLC 4U87A 3J7YJ 1JJ8C 3NRVA 3K4NA 3FF5A 2ESNA 4H4KC 3P9KA 5DUIA 1AA7A 2BVLA 2E36A 2LR8A 4A2UA 1IV8A 3HRTA 4R8HA 3DV8A 4BXXJ 3OIQA 3F6OA 3BCBA 1Y39A 2JJ7A 2HKXA 4Q48A 1T08B 4UV9A 3MKZA 3HB9A 4MLOA 5GAGJ 4ITVA 4PGHA 4F3QA 3WU1B 2VIXA 3H36A 2P4WA 1P6RA 1ZARA 5TJJA 2R7RA 4XLPF 3LSHA 3PNTA 3L09A 4BJTA 1K79A 2FNAA 1LDKB 2EV5A 3Q0WA 5HNHA 1YYVA 3HKZA 5HLTA 3SEZA 3HOSA 1B8IB 5HLIA 3FXJA 3IL2A 2EA4A 3CF2A 3HBLA 1YW8A 3HPGA 5BNGA 1S7AA 1YW7A 1KQ8A 3NQOA 4UXNA 3ULQB 3TDZC 1OPCA 4J01A 3S14J 3R60A 3MZHA 3SYTA 3W2WA 3OS2A 2WV0A 2ZMEA 2VONA 3SZTA 1IC8A 3TW6A 1Y8QB 1WJBA 4G6DA 4M6VA 1W7PA 1RRJA 1GHCA 2K27A 1IN6A 1F5TA 2DQLA 2HXIA 3OOPA 1NTCA 4GXOA 1RC9A 2FQ3A 2HGCA 4DOZA 1D1AA 2LC2A 2M9HA 2XROA 1T38A 3W3CA 1QZZA 1BI3A 3LSTA 4AIKA 1OQYA 1QPMA 2EJRA 4M3FA 3VYTB 1RPWA 1I6HJ 2ZBKA 2RQPA 1PUFA 3V7SA 1O3TA 4XNFA 3S32A 3JSOA 5F1RA 3IC7A 3HOTA 3GZ6A 4P55A 1XGMA 4JBAA 2X6YA 4XRFA 2OJED 4BHPA 2MBFA 1Y56A 3T5XA 4DJAA 5LEKA 3QWLA 3S3NA 3BY6A 5LGNA 3PM1A 3BJOA 2ADUA 3NEUA 2F48A 1DQUA 2NOGA 3I59A 1FBUA 3V4GA 2RREA 3WTWC 3QPHA 1S5LC 1T33A 3RSNA 3QYFA 3G1OA 2V6CA 3WTXC 3DXJF 4HA8A 1K83J 2TCTA 4KIGA 1ZYRF 1UG2A 2DYSH 1PUFB 1XS9A 2L0KA 4L0YB 5A2QZ 1WI9A 5FKNA 4L0ZB 1ETOA 2IA1A 2A69F 1X1DA 2YX7A 2RGVA 4RLFA 4G8XA 4XLAA 4I02A 5LEJA 2DOFA 2K7LA 2DT5A 1SFKA 3P9CA 4B43A 4DYCA 4HF2A 4GDFA 4JQFA 1ETKA 1FP1D 2LH9A 3F8MA 3ERED 1H8AC 3CJNA 3LOCA 2VE8A 1I6XA 3A02A 4EJWA 3S2HJ 5F64A 1DU6A 2L7KA 3JRHA 2F4MB 3HDDA 4I98B 4C30A 1FTZA 2EBIA 4IHWA 3L2RA 4MQ9F 2JRMA 3E5UA 4JX6A 3OYBA 2KISA 2QZ8A 1N78A 2HQAA 3S17J 3FK7A 1D0XA 2EINH 2X9DA 3H9JA 2FOWA 3SXYA 1T39A 4Q5SF 1HA8A 2HU9A 2BOLA 2IGNA 4QWQA 2F6CA 2PMHA 4PDKA 4GCVA 3I58A 1TWCJ 1WRJA 1HXDA 3NWSA 3MAJA 3KYLA 2EA2A 3I54A 1X1CA 1UAAA 2CV2A 1IRGA 2CUZA 4EJTA 4RGSA 2HVSA 2ISZA 3PO3J 1GV2A 1JKQC 4EV0A 2A5WA 4GYIA 4L9TA 1AU7A 4D5FA 4NC6A 3REOA 5EEAA 2M1BA 4YIRX 5ICFA 4F55A 3BG7A 4XRMA 3WE2A 4FE4A 1IF1A 5K7FA 5D5WB 4BNCA 1IW7F 4FE7A 1IN5A 5AIQA 1HKTA 2VBZA 4C3IJ 5DS9A 2OTLI 4XLFA 1YFHA 1HDPA 2P0WA 2VQGA 3I5UA 2R5YA 2BVMA 2EZKA 1JJ6C 2ICWG 3HZJA 1TW3A 1I39A 1FNNA 1B8IA 1YX5A 2ZXJA 3QOEA 1YITI 1K4SA 2DJIA 2DA7A 1U8BA 3NARA 3OYLA 1IRXA 2OCEA 4R1HA 3ROUA 1OCPA 2HI3A 2DA6A 3OYJA 3UKGA 3VSLA 3GEZA 2E2HJ 3TBIA 5IP6A 2CV1A 3JAMZ 4E7KA 3CZ6A 5J8CA 3K0LA 1SD4A 2EV6A 1W5TA 2K9NA 3BROA 2GXGA 2OQRA 2Y9YA 4RGUA 3DFGA 3M07A 3UNGC 4ZH4F 3ZR8X 3CLQA 3Q0UA 2GA2A 4RMNA 4AUXA 1U5TA 1P2FA 4ETSA 3WTTC 1TQPA 4KDPA 4E6KG 2Q2EA 3ZCOA 2DA4A 2EFNA 1YRNB 1RESA 2XAUA 3FX3A 4E7LA 4MFDA 1SMYF 3BR2A 4HYEA 1J0RA 1S9HA 3S1RJ 5EZHA 3HKZN 1LFBA 2FUG2 2BEOA 3DBLB 1MMGA 1QZYA 5J1UA 2BZTA 2NVQJ 4LITA 3RZDJ 4RB1A 3VWBA 3D5SC 2VOOA 2ZXWH 4XQFA 4RM3A 3E5XA 4ESBA 2F5EA 4ENKA 1R36A 2DMQA 1VF9A 2CRGA 2LD5A 1ZTRA 1G3YA 1OLTA 2HOAA 1W36D 4P5OA 5M5YJ 4D5CA 5D8KB 3BTIA 2KZGA 2OCCH 4IHVA 2VOPA 2XB0X 2OC6A 3IAM2 3Q5FA 4N4OB 3C2GA 4L18B 1IZ1A 2BBYA 2LP0A 4IJAA 1IG7A 2R7TA 3HHHA 4EQQA 1GVJA 4YG2F 2RDPA 4NQWB 4ZTFA 3MKLA 3DTKA 3OYEA 3ZN1A 2WAQA 3H5AA 2HVQA 2IEKA 3I53A 2X0LA 3IKTA 5JHUA 4QLCU 5D4SA 3BTJA 1HW2A 1PP7U 2KZVA 2VKDA 2IS2A 1D8JA 3HTUA 5FRMA 1BI1A 2Z16A 4HX4A 1RI7A 2UZKA 3EYIA 1D3YA 2L7MP 3PSFA 4V2FA 3BR3A 2WWYA 2IW5A 2Y69H 3GFIA 3KP4A 2WA0A 4M3DA 1ENHA 1SFXA 1G3WA 3LSJA 2B7EA 1SANA 4PZJA 2K9LA 4L5IA 2VB6A 2W4SA 2XASA 3BT9A 4S04A 1MSEC 4O5VA 3JCUC 5EDNA 3E97A 1ZLJA 4I0AA 1MDMA 2DODA 2KJCA 3F6VA 3CO7C 2QSGX 1X3WB 3ESWB 1T2KA 2K4JA 2CFXA 2DMTA 1X3UA 2IPQX 5LGTA 3NAUA 5D8LB 1ETVA 1WJ5A 2VQHA 2Y75A 4RA2A 2HQ5A 2GOMA 1FY7A 5E1XA 3I4NJ 3H3UA 3W6VA 4M6YA 4BQOA 4EJUA 1ZRCA 4IQJA 4W97A 2NRAC 3E6MA 3CUQA 2ESHA 1ZHFA 2PG4A 3HRUA 3AG4H 5EF6A 2VL8A 2BYVE 1VQKI 2VI6A 2QEXI 2NS7A 1FP2A 3HOXJ 3SDBA 1JUMA 3GW2A 3KX2A 4FETA 4YEJA 1WPKA 1X3ZB 2HR3A 2DFHA 2CMPA 2R7QA 5ED4A 1AKHA 3G1LA 2W82A 3BR0A 3OS1A 2W25A 5ILVA 3CUQC 4B47A 4UHTA 4PJ0C 1LDJA 4DIQA 1R23A 1XB4A 2VBWA 3QODA 2NOJB 4RAZA 3CCEI 2OUMA 4WCGA 4A3DJ 4LLNA 2FMLA 2RV8A 2ZJPF 4IEJA 5H6QA 3TL4X 2DQRA 3F22A 2QM3A 1AHDP 2VODA 5FFXA 2V26A 3HPHA 2CO5A 1J9IA 4XN0A 4LJZF 5GTHC 2M4GA 4RGXA 2L4MA 2E60A 3KP5A 1BBYA 2DMNA 2JTVA 5EEHA 5A2QK 2GIZA 3WODF 2AQEA 1OCCH 3EUHC 2MLGA 2H6CA 1EJ9A 3ZRGA 4B48A 3AFHA 3GTPJ 2QCOA 1TP4A 4JYKA 3OIOA 4LMYA 3DKYA 5D6FA 3VYSB 1YX3A 2LVSA 1Y0UA 4HLYA 3IHUA 2DA2A 4G94A 1LVAA 1WQ2A 4CGZA
chains in the Genus database with same CATH topology
5ILUA 2DU9A 2QQ9A 2L4AA 3KP3A 3GUDA 3OV8A 2D2WA 1R1UA 2HQNA 2XUBA 3KP2A 4L9VA 3N97A 4KNYA 2NAZA 3O3KA 3QRFF 3KFWX 4ZZDA 1R5GA 1LQ1A 4FX0A 2XAFA 4CYDA 5E17F 5H20A 4KA4A 1KU3A 4RS8A 2DI3A 4KIBA 4M9SA 3ZN0A 4OMYA 3Q9SA 3CLOA 3P9IA 4YFXF 4A6EA 1EH7A 2V9VA 2Z3YA 2VBYA 2EB7A 1SD7A 2EFQA 1QBJA 1FT9A 3I4PA 2OA4A 2G7HA 2V1UA 3QU6A 1R58A 2L01A 3CDHA 1U8RA 2PI0A 3S2WA 4BHCA 2M87A 4CZZA 4KYWA 3BWGA 4EM2A 1LNWA 4EJOA 3HTSB 1T0FA 3I59B 4ESJA 3R6SA 5FD6A 4KN4X 3COAC 4ENNA 5CLSA 4KMUX 3V8KA 2XV4S 5HS8A 3MQ0A 5BS6A 3LQQA 1W5SA 4N9IA 4GYGA 4Z2YA 5ILSA 2Y0MA 3SZPA 1UCRA 2F5CA 2Z99A 5DCMB 2O03A 4CDGA 2R7DA 1JE8A 3KETA 3HUGA 4IRIA 4HX8A 2VXZA 1ON2A 4JK1X 5K5QA 1J5YA 3F23A 4H0EA 3V7RA 2DW4A 2QWWA 4G7OF 2K02A 2DPUA 3U1DA 4U0VA 4N9HA 4DQ2A 2UXXA 1XN7A 3ZPLA 5E8IA 2OU2A 3M1EA 2UXNA 2XHKA 5J6XA 1E17A 1BN5A 4ZYDA 1A04A 1GXQA 4O3MA 4GO1A 5FLXK 1J75A 4UVAA 4HDUA 2A68F 1JXSA 5FO5A 1CF7B 3M8FA 2FSWA 3QPTA 4IPAA 3J80Z 5L3BA 1L0OC 2L02A 3P7NA 4OIRF 4OIOF 1ZRFA 1DPUA 4L9JA 2FBHA 3FXQA 2ETHA 4EVIA 2R3SA 1SAXA 2F5DA 1R00A 3M8EA 2Q0OA 2MA3A 4OU0A 2CWEA 1O3RA 1MKMA 4HDVA 4Y15A 2GQQA 3VODA 2XKOA 2G7UA 3GVAA 3RIRA 1SFEA 5LHHA 2ISYA 1TQMA 1WWXA 2Z9OA 3ZMSA 4RAYA 4LFUA 1D5VA 3C18A 4KICA 2QQAA 5FB2A 2FF4A 3EYYA 2RVCA 3LFKA 1K6OA 1XCVA 1G6NA 4EJVA 3GLXA 4WXDA 3HSFA 3RYPA 4BHBA 5DD4A 1RUOA 2P7CB 5KVRA 3ECOA 5L3CA 3F21A 1YS6A 4FT8A 4OOIA 2MLKA 4DNCA 2BE5F 2VT2A 2EV0A 1IXCA 2WTEA 2E7XA 1BIBA 5DD8A 3KZZA 3ELKA 1ZG5A 2DK8A 2P6SA 1IXRC 1BM9A 2PJPA 4A0XA 4U88A 4LG0B 1L3LA 4BAYA 1O57A 4HLXA 4EM0B 4M6XA 2OQGA 5CVRA 2NYXA 3MCZA 2D45A 2RNJA 3FHZA 2L3DA 4A5NA 4LLLA 2P8TA 3RI4A 2PQ8A 1VTNC 3H3ZA 3GZ5A 3ZMVA 2GAUA 2ZO4A 3RTRA 4YFKF 4LLGF 1R1VA 1FZPB 3N4MA 1JHHA 3K2ZA 1KQ9A 4NB5A 3C1DA 2AS5F 1B6AA 2EFOA 5E1WA 5EEGA 2FBKA 4YIIA 2ZNYA 4B09A 1F1ZA 4F7ZA 2Q8KA 1YLFA 1Z1DA 3J80K 2W24A 3PQKA 4WX9A 5BPIA 4IHTA 2HTJA 5ICCA 3ABTA 4HW0A 3TO9A 4CXFA 2ACJA 1KA8A 1IN4A 2O8XA 2CW0F 1S8NA 2JSCA 4I0BA 4ESFA 5LBQA 4HZFA 1FYLA 5CJ9A 2ZMEB 2P5VA 1J2XA 1QO0D 6PAXA 3LA7A 4G7ZF 2ZCWA 1FOKA 4MNUA 1YTYA 2RN7A 4ZYGA 4BQAA 5HOOA 5FGMA 4LB6B 1ZG1A 4HF1A 3QP5A 2NNYA 1HW1A 1U2WA 3MWMA 4BYYA 4Q4ZF 1U3EM 1HQCA 2MD5A 3G3ZA 3F3XA 3R61A 2E1CA 4M9XA 2XAJA 3HSEA 1V4RA 2KRFA 2M8EA 5AONA 1R22A 3K1PA 1U5TC 2P6TA 5BPDA 5HS7A 4ASNA 3D5LA 1RIOH 4WXHA 2YSRA 1LEAA 4YFNF 3CO6C 5LGUA 3BJ6A 3ABUA 3R4KA 3BPXA 4CO8A 2A61A 2QQBA 2JT1A 3L7WA 2QVOA 3W6KB 4IHSA 5J8FA 4RB3C 3DEUA 1BC8C 5HDNA 2DPDA 3GFMA 2HQRA 1TNSA 1J59A 2FRHA 4G6QA 2EFWA 3L9FA 3BP8A 1KQ0A 2DBBA 4UVBA 1YG2A 5E18F 1KYZA 1KU2A 1DP7P 2JPBA 3GF2A 1XD7A 4IRHA 1FYMA 4ON0A 3IRQA 4GGGA 2K86A 5CVJA 5BMZA 1KGSA 1XGSA 2VC1A 3Q9VA 1MGTA 5FD5A 2A3SA 5L3DA 4MTEA 1TQIA 5HLHA 3TO6A 4TV7A 1I5ZA 1UFMA 1FBSA 4ZZLA 1OYYA 1TLHB 1W7PB 2XAQA 2IVMA 3EETA 1IXSB 3C3WA 1I1GA 1Z91A 2CYYA 3RDIA 2KIMA 3VB2A 1FBQA 1K78B 4OINF 3EDPA 4LK1F 3K1MA 2HOEA 1T98A 5DYMA 1YIOA 3J7AO 3F8NA 2IA2A 5E8GA 3FXRA 3G73A 1PUEE 2BV6A 1RZ4A 2FXAA 3WGHA 1K78A 1CGPA 3FZVA 4KT5C 4KIFA 4IF4A 1DUXC 1PP8F 2HS5A 1STZA 2X4HA 3FM3A 4S05A 4IVNA 4M72A 2MH2A 3E3VA 1Z9CA 2J5OA 2YX4A 4G7HF 3RYRA 2DK5A 1CF7A 2HEOA 2A6HF 5IT3A 4G9YA 2F5FA 1WSUA 1BOAA 1IRFA 2FE3A 4MHGA 1AWCA 1S6LA 3ML6A 2M5WA 5D5XB 2D1HA 4U0YA 1XDSA 2FA5A 2W57A 4M73A 4HV5A 5LHGA 2O6GE 1QNTA 1QQIA 1E2XA 3RKYA 3ZMZA 2YPRA 1SD6A 2PN6A 1YS7A 4XLNF 1OYWA 3CUQB 4HV6A 1IN7A 3QAHA 2QBYB 5TRDA 3PQJA 2HZTA 3EUHA 4NQWA 3ZP5A 1ZG3A 1P4WA 4K2EA 3GXOA 1ZREA 2STTA 3ECHA 1FC3A 3FXUA 2QLZA 3QU3A 3IWFA 2P5LC 2V1XA 4MGRA 2H09A 2FNPA 3TQNA 1ZAOA 1ZRDA 3LAJA 3GFJA 1F4KA 4Y13A 5CVVA 4A0YA 2A07F 2H27A 2Z5UA 3WGIA 1XSXA 2KJBA 5LRRA 3WTVC 3K9TA 2J5PA 4RB0A 3F8BA 3KZYA 1TBXA 5IT9K 1HKQA 3IRRA 1Z6RA 4HOBA 2OBPA 3U2RA 3O2PE 1G4DA 3EQLF 1HSTA 1LDDA 3DF8A 3RPUA 4ENJA 2C6YA 1RUNA 2XKPA 3FMQA 1J7KA 3TKYA 3B02A 4PCQA 1S7OA 2E7WA 1R7JA 4BH9A 1JGSA 5LRSA 3LA2A 4B8XA 4A6DA 1EH8A 4LK0F 3KE2A 4I09A 2YR2A 2Y48A 4Y17A 4AIJA 5BQTA 1P4XA 1R1TA 2HYGD 4EM1A 2VN2A 1DDNA 1YQAA 3BDDA 2YU3A 4XSZF 3V7CA 2KKOA 2VC0A 5D5VB 1TW2A 3FMSA 3BZ6A 4LD5A 1ZGJA 1Z05A 2DFIA 3FM5A 5CVUA 1NHAA 2VT3A 3TO7A 3TDUC 3TOAA 5L3EA 1XSVA 3IWZA 1KYWA 2JZYA 2XRNA 3L2CA 1B1BA 3K69A 4AD9A 3VEPA 3U9GA 3M7GA 4I2OA 4WF2A 2LF8A 1LB2A 1C0WA 3FWEA 2HYFA 5HS9A 1FPQA 2P7VB 2FU4A 4P96A 2UWMA 5JFRA 3SFZA 4UNOA 5HDKA 3T8RA 1JHFA 1LEBA 3BJAA 3LA3A 1OKRA 2GZWA 3F8FA 1QGPA 5LLQA 5JI6A 1XDUA 1LJ9A 1YW9A 2BGCA 5CYVA 5ICGA 3E6BA 1UHMA 3GFLA 2ELHA 2HKOA 4EGZA 2A5YB 2LF7A 3DQVC 3KEOA 5KK1A 4AVPA 1RNLA 3I71A 2NNNA 2IT0A 1KU9A 3ZMTA 2GXBA 3MEXA 3C7JA 2QYOA 4IXAA 4ZYEA 1PDNC 3I64A 2F2EA 1AOYA 1SFUA 1G3TA 3BOQA 5DCMA 3LQRA 2QENA 2PEXA 5D6EA 5ICEA 2DTRA 3GWZA 2ZKZA 3VOEA 2IP2A 1OR7A 4LGWA 4FX4A 2GIVA 2CQKA 2CG4A 2OZ6A 3QOPA 1B9NA 3E6DA 4CICA 1GXPA 4WWCA 4XBFA 2PFBA 3HYIA 3RKXA 4EGYA 1DPRA 1USSA 1K7AA 1ULYA 1WKMA 3MZYA 4M71A 4AIHA 4FHTA 2B0LA 3WE3A 2EK5A 3HIFA 2PLYA 3KLNA 5DEQA 4WK8F 1UHWA 1O3SA 4KMFA 2XAGA 1TTYA 2STWA 2D1VA 2HFHA 4M9ZA 1IN8A 5L3GA 2COMA 3T1BA 1BC7C 3HRMA 3WG9A 5JVTA 2PBIA 4L9NA 3JAMK 3WTSC 3T0YA 1P4AA 4ZYHA 2XVCA 2L54A 2KIFA 2LDUA 3WGGA 3E6CC 1W4MA 4CHUA 4Q47A 2DO7A 2O0YA 2ZJ2A 3JTHA 3WU0A 5E1ZB 1MJ9A 3AAFA 1D8KA 4YIFA 3HHGA 2FEZA 3V8JA 5ERIA 2NS0A 4N0BA 1REPC 3DPTA 5HVQC 5DDGA 2MH9A 5D4RA 3PFIA 1HBXG 1Z6TA 1MJAA 3F72A 1FX7A 3I0TA 1MD0A 4OIPF 1B59A 5K5RA 4R79A 2GA1A 4IRGA 1O7LA 2QUFA 2OZUA 1U78A 2RC4A 3V8LA 4U7DA 1SD5A 2RKHA 2CGPA 1S29A 2EFPA 1ZLKA 3KLOA 5JR3A 4HBLA 1XMKA 3KP7A 1OMIA 1O3QA 2H6BA 1T6SA 1U6GA 1FLIA 3FMRA 2O61A 4MEYF 2ZNZA 3LWFA 4HF0A 1XCBA 3W6JB 3IKVA 1H0MA 1EH6A 4I01A 5HDGA 2HWVA 2V1DA 1F9NA 2H94A 3F8CA 2IRFG 2M30A 3TOBA 1XGNA 3ISPA 4U7BA 2Z33A 4MTDA 1OYIA 1B9MA 3JTGA 4WXCA 3ZMDA 5F6FA 1IAWA 1Z7UA 1YO5C 5CVIA 1ZGAA 3HSRA 1G3SA 1O7FA 1MJBA 4A0ZA 3KP6A 1Q1HA 4KN7X 3CUOA 2A6EF 4HQEA 5H6RA 3GYHX 1ODDA 4L5JA 3RKWA 1MDMB 2MC3A 1ON1A 4U0WA 1R5HA 4P9UA 3T8TA 2KIUA 1HW5A 3E5QA 2W84A 2AXLA 4LB5A 4UUVA 3O6BB 1V3FA 5FLXZ 2FMYA 3SQNA 3ZQ7A 1BIAA 1FSHA 4HQMA 2FBIA 1MZBA 3DP7A 1EV7A 2V79A 4RGRA 1SMTA 2IJLA 2DAOA 1USTA 1U5TB 2GWRA 3QP6A 2XIGA 5DV5A 4BXUA 1IUYA 5DCFA 4NHJA 4MQVA 5D5UB 3ZMUA 2W85A 3GX4X 2HDCA 2LNBA 4HX7A 3MFKA 1HKSA 2TDXA 3KCCA 2O3FA 1XSDA 3CTAA 3LAPA 1ZH5A 2E1NA 5E20A 3K1NA 2OD5A 2LSOA 3WTZA 5L3FA 3D0SA 4PGGA 2VE9A 4OMZA 2OAZA 4P9FA 2VBXA 1FSEA 4KUMA 3RPQA 4AWXB 4LG0A 2K4BA 2CSOA 5DUKA 3J81K 4MEXF 4ENMA 2JRTA 2EWNA 3WTUC 3VFZA 1ZN2A 4A12A 1H9GA 2PMUA 2R7FA 1B4AA 4E70A 5LHIA 4UV8A 1BI2A 3DKWA 3R0JA 2DLLA 5IT9Z 3GO5A 2G9WA 2XAHA 4HAMA 1ONVA 3JSPA 2M45A 3R0AA 4RB2C 4XSXF 1FWZA 4I7HA 4M74A 3B73A 1I27A 3KEQA 5K5OA 3L00A 1S3JA 4KFCA 1XGOA 1KU7A 3TGNA 1HSJA 4D0PA 1FYKA 3RJPA 5AIPA 4UVCA 1I1SA 3BPVA 1UB9A 3WTYC 4OIQF 3H92A 2FOKA 3M9AA 3J81Z 5HLGA 2XGXA 1BI0A 3JW4A 2HTSA 1W7PD 1XMAA 1BJAA 1TNTA 3SHFA 1P92A 2P5KA 4EMSA 5BOXA 3HRSA 4A5MA 2IA0A 5K1YA 2LKPA 2WC2A 4O6JA 5FFZA 2QBYA 1H9TA 2ZFWA 2JPCA 3DPLC 3NRVA 3FF5A 2ESNA 3P9KA 5DUIA 4A2UA 3HRTA 4R8HA 3DV8A 3F6OA 2HKXA 4Q48A 4UV9A 4PGHA 3WU1B 2P4WA 1P6RA 1ZARA 5TJJA 4XLPF 3L09A 1K79A 2FNAA 1LDKB 2EV5A 1YYVA 3HOSA 5HLIA 3IL2A 2EA4A 1YW8A 1S7AA 1YW7A 1KQ8A 3NQOA 4UXNA 3ULQB 3TDZC 1OPCA 3R60A 3MZHA 2WV0A 2ZMEA 2VONA 3SZTA 4G6DA 1W7PA 1GHCA 2K27A 1IN6A 1F5TA 2DQLA 3OOPA 4GXOA 2FQ3A 2XROA 2HGCA 1T38A 1QZZA 1BI3A 3LSTA 4AIKA 1QPMA 2EJRA 2ZBKA 2RQPA 3V7SA 1O3TA 3JSOA 5F1RA 3IC7A 3HOTA 3GZ6A 4P55A 1XGMA 4JBAA 4XRFA 4BHPA 2MBFA 3T5XA 5LEKA 3BY6A 5LGNA 3BJOA 2ADUA 3NEUA 3I59A 1FBUA 3V4GA 3WTWC 3QPHA 2V6CA 3WTXC 3DXJF 4HA8A 4KIGA 1ZYRF 4L0YB 5A2QZ 1WI9A 4L0ZB 2IA1A 2A69F 2YX7A 2RGVA 4G8XA 4I02A 5LEJA 2K7LA 2DT5A 3P9CA 4HF2A 4JQFA 3F8MA 1FP1D 3ERED 3CJNA 2VE8A 1I6XA 4EJWA 5F64A 4I98B 4MQ9F 3E5UA 2QZ8A 3SXYA 1T39A 4Q5SF 4QWQA 2PMHA 4PDKA 4GCVA 3I58A 1WRJA 1HXDA 3MAJA 2EA2A 3I54A 1IRGA 4EJTA 4RGSA 2ISZA 4EV0A 4GYIA 4L9TA 3REOA 2M1BA 5ICFA 3WE2A 1IF1A 5D5WB 4BNCA 1IW7F 1IN5A 5AIQA 1HKTA 2VBZA 1YFHA 3I5UA 1TW3A 1FNNA 2ZXJA 4R1HA 3ROUA 3GEZA 3JAMZ 5J8CA 3K0LA 1SD4A 2EV6A 1W5TA 3BROA 2GXGA 2OQRA 4RGUA 3DFGA 4ZH4F 2GA2A 1U5TA 1P2FA 4ETSA 3WTTC 1TQPA 4KDPA 2Q2EA 2EFNA 3FX3A 1SMYF 4HYEA 1J0RA 2BEOA 1QZYA 4RB1A 2VOOA 3E5XA 4ESBA 2F5EA 4ENKA 1R36A 1G3YA 4P5OA 5D8KB 2VOPA 3Q5FA 4L18B 1IZ1A 2BBYA 4IJAA 3HHHA 4EQQA 1GVJA 4YG2F 2RDPA 3ZN1A 3I53A 2X0LA 3IKTA 5JHUA 4QLCU 5D4SA 1HW2A 1PP7U 1D8JA 3HTUA 1BI1A 4HX4A 1RI7A 2UZKA 3EYIA 1D3YA 2WWYA 2IW5A 3GFIA 3KP4A 1SFXA 1G3WA 4PZJA 4L5IA 2XASA 4S04A 4O5VA 3E97A 1ZLJA 4I0AA 1MDMA 2KJCA 3F6VA 3CO7C 1T2KA 2K4JA 2CFXA 1X3UA 2IPQX 5LGTA 5D8LB 2Y75A 1FY7A 5E1XA 3H3UA 4M6YA 4EJUA 1ZRCA 2NRAC 3E6MA 3CUQA 2ESHA 1ZHFA 2PG4A 3HRUA 2BYVE 1FP2A 3GW2A 2HR3A 5ED4A 2W25A 5ILVA 3CUQC 4UHTA 1LDJA 1R23A 1XB4A 2VBWA 4RAZA 4WCGA 4LLNA 2FMLA 2RV8A 5H6QA 2DQRA 3F22A 2QM3A 2VODA 5FFXA 2CO5A 1J9IA 4LJZF 4RGXA 2L4MA 3KP5A 1BBYA 2JTVA 5EEHA 5A2QK 3WODF 2MLGA 2H6CA 4LMYA 5D6FA 1Y0UA 4HLYA 3IHUA 4G94A 1LVAA 1WQ2A 4CGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ILU A;  2DU9 A;  2QQ9 A;  2L4A A;  3KP3 A;  3GUD A;  3OV8 A;  2D2W A;  1R1U A;  2HQN A;  2XUB A;  3KP2 A;  4L9V A;  3N97 A;  4KNY A;  2NAZ A;  3O3K A;  3QRF F;  3KFW X;  4ZZD A;  1R5G A;  1LQ1 A;  4FX0 A;  2XAF A;  4CYD A;  5E17 F;  5H20 A;  4KA4 A;  1KU3 A;  4RS8 A;  2DI3 A;  4KIB A;  4M9S A;  3ZN0 A;  4OMY A;  3Q9S A;  3CLO A;  3P9I A;  4YFX F;  4A6E A;  1EH7 A;  2V9V A;  2Z3Y A;  2VBY A;  2EB7 A;  1SD7 A;  2EFQ A;  1QBJ A;  1FT9 A;  3I4P A;  2OA4 A;  2G7H A;  2V1U A;  3QU6 A;  1R58 A;  2L01 A;  3CDH A;  1U8R A;  2PI0 A;  3S2W A;  4BHC A;  2M87 A;  4CZZ A;  4KYW A;  3BWG A;  4EM2 A;  1LNW A;  4EJO A;  3HTS B;  1T0F A;  3I59 B;  4ESJ A;  3R6S A;  5FD6 A;  4KN4 X;  3COA C;  4ENN A;  5CLS A;  4KMU X;  3V8K A;  2XV4 S;  5HS8 A;  3MQ0 A;  5BS6 A;  3LQQ A;  1W5S A;  4N9I A;  4GYG A;  4Z2Y A;  5ILS A;  2Y0M A;  3SZP A;  1UCR A;  2F5C A;  2Z99 A;  5DCM B;  2O03 A;  4CDG A;  2R7D A;  1JE8 A;  3KET A;  3HUG A;  4IRI A;  4HX8 A;  2VXZ A;  1ON2 A;  4JK1 X;  5K5Q A;  1J5Y A;  3F23 A;  4H0E A;  3V7R A;  2DW4 A;  2QWW A;  4G7O F;  2K02 A;  2DPU A;  3U1D A;  4U0V A;  4N9H A;  4DQ2 A;  2UXX A;  1XN7 A;  3ZPL A;  5E8I A;  2OU2 A;  3M1E A;  2UXN A;  2XHK A;  5J6X A;  1E17 A;  1BN5 A;  4ZYD A;  1A04 A;  1GXQ A;  4O3M A;  4GO1 A;  5FLX K;  1J75 A;  4UVA A;  4HDU A;  2A68 F;  1JXS A;  5FO5 A;  1CF7 B;  3M8F A;  2FSW A;  3QPT A;  4IPA A;  3J80 Z;  5L3B A;  1L0O C;  2L02 A;  3P7N A;  4OIR F;  4OIO F;  1ZRF A;  1DPU A;  4L9J A;  2FBH A;  3FXQ A;  2ETH A;  4EVI A;  2R3S A;  1SAX A;  2F5D A;  1R00 A;  3M8E A;  2Q0O A;  2MA3 A;  4OU0 A;  2CWE A;  1O3R A;  1MKM A;  4HDV A;  4Y15 A;  2GQQ A;  3VOD A;  2XKO A;  2G7U A;  3GVA A;  3RIR A;  1SFE A;  5LHH A;  2ISY A;  1TQM A;  1WWX A;  2Z9O A;  3ZMS A;  4RAY A;  4LFU A;  1D5V A;  3C18 A;  4KIC A;  2QQA A;  5FB2 A;  2FF4 A;  3EYY A;  2RVC A;  3LFK A;  1K6O A;  1XCV A;  1G6N A;  4EJV A;  3GLX A;  4WXD A;  3HSF A;  3RYP A;  4BHB A;  5DD4 A;  1RUO A;  2P7C B;  5KVR A;  3ECO A;  5L3C A;  3F21 A;  1YS6 A;  4FT8 A;  4OOI A;  2MLK A;  4DNC A;  2BE5 F;  2VT2 A;  2EV0 A;  1IXC A;  2WTE A;  2E7X A;  1BIB A;  5DD8 A;  3KZZ A;  3ELK A;  1ZG5 A;  2DK8 A;  2P6S A;  1IXR C;  1BM9 A;  2PJP A;  4A0X A;  4U88 A;  4LG0 B;  1L3L A;  4BAY A;  1O57 A;  4HLX A;  4EM0 B;  4M6X A;  2OQG A;  5CVR A;  2NYX A;  3MCZ A;  2D45 A;  2RNJ A;  3FHZ A;  2L3D A;  4A5N A;  4LLL A;  2P8T A;  3RI4 A;  2PQ8 A;  1VTN C;  3H3Z A;  3GZ5 A;  3ZMV A;  2GAU A;  2ZO4 A;  3RTR A;  4YFK F;  4LLG F;  1R1V A;  1FZP B;  3N4M A;  1JHH A;  3K2Z A;  1KQ9 A;  4NB5 A;  3C1D A;  2AS5 F;  1B6A A;  2EFO A;  5E1W A;  5EEG A;  2FBK A;  4YII A;  2ZNY A;  4B09 A;  1F1Z A;  4F7Z A;  2Q8K A;  1YLF A;  1Z1D A;  3J80 K;  2W24 A;  3PQK A;  4WX9 A;  5BPI A;  4IHT A;  2HTJ A;  5ICC A;  3ABT A;  4HW0 A;  3TO9 A;  4CXF A;  2ACJ A;  1KA8 A;  1IN4 A;  2O8X A;  2CW0 F;  1S8N A;  2JSC A;  4I0B A;  4ESF A;  5LBQ A;  4HZF A;  1FYL A;  5CJ9 A;  2ZME B;  2P5V A;  1J2X A;  1QO0 D;  6PAX A;  3LA7 A;  4G7Z F;  2ZCW A;  1FOK A;  4MNU A;  1YTY A;  2RN7 A;  4ZYG A;  4BQA A;  5HOO A;  5FGM A;  4LB6 B;  1ZG1 A;  4HF1 A;  3QP5 A;  2NNY A;  1HW1 A;  1U2W A;  3MWM A;  4BYY A;  4Q4Z F;  1U3E M;  1HQC A;  2MD5 A;  3G3Z A;  3F3X A;  3R61 A;  2E1C A;  4M9X A;  2XAJ A;  3HSE A;  1V4R A;  2KRF A;  2M8E A;  5AON A;  1R22 A;  3K1P A;  1U5T C;  2P6T A;  5BPD A;  5HS7 A;  4ASN A;  3D5L A;  1RIO H;  4WXH A;  2YSR A;  1LEA A;  4YFN F;  3CO6 C;  5LGU A;  3BJ6 A;  3ABU A;  3R4K A;  3BPX A;  4CO8 A;  2A61 A;  2QQB A;  2JT1 A;  3L7W A;  2QVO A;  3W6K B;  4IHS A;  5J8F A;  4RB3 C;  3DEU A;  1BC8 C;  5HDN A;  2DPD A;  3GFM A;  2HQR A;  1TNS A;  1J59 A;  2FRH A;  4G6Q A;  2EFW A;  3L9F A;  3BP8 A;  1KQ0 A;  2DBB A;  4UVB A;  1YG2 A;  5E18 F;  1KYZ A;  1KU2 A;  1DP7 P;  2JPB A;  3GF2 A;  1XD7 A;  4IRH A;  1FYM A;  4ON0 A;  3IRQ A;  4GGG A;  2K86 A;  5CVJ A;  5BMZ A;  1KGS A;  1XGS A;  2VC1 A;  3Q9V A;  1MGT A;  5FD5 A;  2A3S A;  5L3D A;  4MTE A;  1TQI A;  5HLH A;  3TO6 A;  4TV7 A;  1I5Z A;  1UFM A;  1FBS A;  4ZZL A;  1OYY A;  1TLH B;  1W7P B;  2XAQ A;  2IVM A;  3EET A;  1IXS B;  3C3W A;  1I1G A;  1Z91 A;  2CYY A;  3RDI A;  2KIM A;  3VB2 A;  1FBQ A;  1K78 B;  4OIN F;  3EDP A;  4LK1 F;  3K1M A;  2HOE A;  1T98 A;  5DYM A;  1YIO A;  3J7A O;  3F8N A;  2IA2 A;  5E8G A;  3FXR A;  3G73 A;  1PUE E;  2BV6 A;  1RZ4 A;  2FXA A;  3WGH A;  1K78 A;  1CGP A;  3FZV A;  4KT5 C;  4KIF A;  4IF4 A;  1DUX C;  1PP8 F;  2HS5 A;  1STZ A;  2X4H A;  3FM3 A;  4S05 A;  4IVN A;  4M72 A;  2MH2 A;  3E3V A;  1Z9C A;  2J5O A;  2YX4 A;  4G7H F;  3RYR A;  2DK5 A;  1CF7 A;  2HEO A;  2A6H F;  5IT3 A;  4G9Y A;  2F5F A;  1WSU A;  1BOA A;  1IRF A;  2FE3 A;  4MHG A;  1AWC A;  1S6L A;  3ML6 A;  2M5W A;  5D5X B;  2D1H A;  4U0Y A;  1XDS A;  2FA5 A;  2W57 A;  4M73 A;  4HV5 A;  5LHG A;  2O6G E;  1QNT A;  1QQI A;  1E2X A;  3RKY A;  3ZMZ A;  2YPR A;  1SD6 A;  2PN6 A;  1YS7 A;  4XLN F;  1OYW A;  3CUQ B;  4HV6 A;  1IN7 A;  3QAH A;  2QBY B;  5TRD A;  3PQJ A;  2HZT A;  3EUH A;  4NQW A;  3ZP5 A;  1ZG3 A;  1P4W A;  4K2E A;  3GXO A;  1ZRE A;  2STT A;  3ECH A;  1FC3 A;  3FXU A;  2QLZ A;  3QU3 A;  3IWF A;  2P5L C;  2V1X A;  4MGR A;  2H09 A;  2FNP A;  3TQN A;  1ZAO A;  1ZRD A;  3LAJ A;  3GFJ A;  1F4K A;  4Y13 A;  5CVV A;  4A0Y A;  2A07 F;  2H27 A;  2Z5U A;  3WGI A;  1XSX A;  2KJB A;  5LRR A;  3WTV C;  3K9T A;  2J5P A;  4RB0 A;  3F8B A;  3KZY A;  1TBX A;  5IT9 K;  1HKQ A;  3IRR A;  1Z6R A;  4HOB A;  2OBP A;  3U2R A;  3O2P E;  1G4D A;  3EQL F;  1HST A;  1LDD A;  3DF8 A;  3RPU A;  4ENJ A;  2C6Y A;  1RUN A;  2XKP A;  3FMQ A;  1J7K A;  3TKY A;  3B02 A;  4PCQ A;  1S7O A;  2E7W A;  1R7J A;  4BH9 A;  1JGS A;  5LRS A;  3LA2 A;  4B8X A;  4A6D A;  1EH8 A;  4LK0 F;  3KE2 A;  4I09 A;  2YR2 A;  2Y48 A;  4Y17 A;  4AIJ A;  5BQT A;  1P4X A;  1R1T A;  2HYG D;  4EM1 A;  2VN2 A;  1DDN A;  1YQA A;  3BDD A;  2YU3 A;  4XSZ F;  3V7C A;  2KKO A;  2VC0 A;  5D5V B;  1TW2 A;  3FMS A;  3BZ6 A;  4LD5 A;  1ZGJ A;  1Z05 A;  2DFI A;  3FM5 A;  5CVU A;  1NHA A;  2VT3 A;  3TO7 A;  3TDU C;  3TOA A;  5L3E A;  1XSV A;  3IWZ A;  1KYW A;  2JZY A;  2XRN A;  3L2C A;  1B1B A;  3K69 A;  4AD9 A;  3VEP A;  3U9G A;  3M7G A;  4I2O A;  4WF2 A;  2LF8 A;  1LB2 A;  1C0W A;  3FWE A;  2HYF A;  5HS9 A;  1FPQ A;  2P7V B;  2FU4 A;  4P96 A;  2UWM A;  5JFR A;  3SFZ A;  4UNO A;  5HDK A;  3T8R A;  1JHF A;  1LEB A;  3BJA A;  3LA3 A;  1OKR A;  2GZW A;  3F8F A;  1QGP A;  5LLQ A;  5JI6 A;  1XDU A;  1LJ9 A;  1YW9 A;  2BGC A;  5CYV A;  5ICG A;  3E6B A;  1UHM A;  3GFL A;  2ELH A;  2HKO A;  4EGZ A;  2A5Y B;  2LF7 A;  3DQV C;  3KEO A;  5KK1 A;  4AVP A;  1RNL A;  3I71 A;  2NNN A;  2IT0 A;  1KU9 A;  3ZMT A;  2GXB A;  3MEX A;  3C7J A;  2QYO A;  4IXA A;  4ZYE A;  1PDN C;  3I64 A;  2F2E A;  1AOY A;  1SFU A;  1G3T A;  3BOQ A;  5DCM A;  3LQR A;  2QEN A;  2PEX A;  5D6E A;  5ICE A;  2DTR A;  3GWZ A;  2ZKZ A;  3VOE A;  2IP2 A;  1OR7 A;  4LGW A;  4FX4 A;  2GIV A;  2CQK A;  2CG4 A;  2OZ6 A;  3QOP A;  1B9N A;  3E6D A;  4CIC A;  1GXP A;  4WWC A;  4XBF A;  2PFB A;  3HYI A;  3RKX A;  4EGY A;  1DPR A;  1USS A;  1K7A A;  1ULY A;  1WKM A;  3MZY A;  4M71 A;  4AIH A;  4FHT A;  2B0L A;  3WE3 A;  2EK5 A;  3HIF A;  2PLY A;  3KLN A;  5DEQ A;  4WK8 F;  1UHW A;  1O3S A;  4KMF A;  2XAG A;  1TTY A;  2STW A;  2D1V A;  2HFH A;  4M9Z A;  1IN8 A;  5L3G A;  2COM A;  3T1B A;  1BC7 C;  3HRM A;  3WG9 A;  5JVT A;  2PBI A;  4L9N A;  3JAM K;  3WTS C;  3T0Y A;  1P4A A;  4ZYH A;  2XVC A;  2L54 A;  2KIF A;  2LDU A;  3WGG A;  3E6C C;  1W4M A;  4CHU A;  4Q47 A;  2DO7 A;  2O0Y A;  2ZJ2 A;  3JTH A;  3WU0 A;  5E1Z B;  1MJ9 A;  3AAF A;  1D8K A;  4YIF A;  3HHG A;  2FEZ A;  3V8J A;  5ERI A;  2NS0 A;  4N0B A;  1REP C;  3DPT A;  5HVQ C;  5DDG A;  2MH9 A;  5D4R A;  3PFI A;  1HBX G;  1Z6T A;  1MJA A;  3F72 A;  1FX7 A;  3I0T A;  1MD0 A;  4OIP F;  1B59 A;  5K5R A;  4R79 A;  2GA1 A;  4IRG A;  1O7L A;  2QUF A;  2OZU A;  1U78 A;  2RC4 A;  3V8L A;  4U7D A;  1SD5 A;  2RKH A;  2CGP A;  1S29 A;  2EFP A;  1ZLK A;  3KLO A;  5JR3 A;  4HBL A;  1XMK A;  3KP7 A;  1OMI A;  1O3Q A;  2H6B A;  1T6S A;  1U6G A;  1FLI A;  3FMR A;  2O61 A;  4MEY F;  2ZNZ A;  3LWF A;  4HF0 A;  1XCB A;  3W6J B;  3IKV A;  1H0M A;  1EH6 A;  4I01 A;  5HDG A;  2HWV A;  2V1D A;  1F9N A;  2H94 A;  3F8C A;  2IRF G;  2M30 A;  3TOB A;  1XGN A;  3ISP A;  4U7B A;  2Z33 A;  4MTD A;  1OYI A;  1B9M A;  3JTG A;  4WXC A;  3ZMD A;  5F6F A;  1IAW A;  1Z7U A;  1YO5 C;  5CVI A;  1ZGA A;  3HSR A;  1G3S A;  1O7F A;  1MJB A;  4A0Z A;  3KP6 A;  1Q1H A;  4KN7 X;  3CUO A;  2A6E F;  4HQE A;  5H6R A;  3GYH X;  1ODD A;  4L5J A;  3RKW A;  1MDM B;  2MC3 A;  1ON1 A;  4U0W A;  1R5H A;  4P9U A;  3T8T A;  2KIU A;  1HW5 A;  3E5Q A;  2W84 A;  2AXL A;  4LB5 A;  4UUV A;  3O6B B;  1V3F A;  5FLX Z;  2FMY A;  3SQN A;  3ZQ7 A;  1BIA A;  1FSH A;  4HQM A;  2FBI A;  1MZB A;  3DP7 A;  1EV7 A;  2V79 A;  4RGR A;  1SMT A;  2IJL A;  2DAO A;  1UST A;  1U5T B;  2GWR A;  3QP6 A;  2XIG A;  5DV5 A;  4BXU A;  1IUY A;  5DCF A;  4NHJ A;  4MQV A;  5D5U B;  3ZMU A;  2W85 A;  3GX4 X;  2HDC A;  2LNB A;  4HX7 A;  3MFK A;  1HKS A;  2TDX A;  3KCC A;  2O3F A;  1XSD A;  3CTA A;  3LAP A;  1ZH5 A;  2E1N A;  5E20 A;  3K1N A;  2OD5 A;  2LSO A;  3WTZ A;  5L3F A;  3D0S A;  4PGG A;  2VE9 A;  4OMZ A;  2OAZ A;  4P9F A;  2VBX A;  1FSE A;  4KUM A;  3RPQ A;  4AWX B;  4LG0 A;  2K4B A;  2CSO A;  5DUK A;  3J81 K;  4MEX F;  4ENM A;  2JRT A;  2EWN A;  3WTU C;  3VFZ A;  1ZN2 A;  4A12 A;  1H9G A;  2PMU A;  2R7F A;  1B4A A;  4E70 A;  5LHI A;  4UV8 A;  1BI2 A;  3DKW A;  3R0J A;  2DLL A;  5IT9 Z;  3GO5 A;  2G9W A;  2XAH A;  4HAM A;  1ONV A;  3JSP A;  2M45 A;  3R0A A;  4RB2 C;  4XSX F;  1FWZ A;  4I7H A;  4M74 A;  3B73 A;  1I27 A;  3KEQ A;  5K5O A;  3L00 A;  1S3J A;  4KFC A;  1XGO A;  1KU7 A;  3TGN A;  1HSJ A;  4D0P A;  1FYK A;  3RJP A;  5AIP A;  4UVC A;  1I1S A;  3BPV A;  1UB9 A;  3WTY C;  4OIQ F;  3H92 A;  2FOK A;  3M9A A;  3J81 Z;  5HLG A;  2XGX A;  1BI0 A;  3JW4 A;  2HTS A;  1W7P D;  1XMA A;  1BJA A;  1TNT A;  3SHF A;  1P92 A;  2P5K A;  4EMS A;  5BOX A;  3HRS A;  4A5M A;  2IA0 A;  5K1Y A;  2LKP A;  2WC2 A;  4O6J A;  5FFZ A;  2QBY A;  1H9T A;  2ZFW A;  2JPC A;  3DPL C;  3NRV A;  3FF5 A;  2ESN A;  3P9K A;  5DUI A;  4A2U A;  3HRT A;  4R8H A;  3DV8 A;  3F6O A;  2HKX A;  4Q48 A;  4UV9 A;  4PGH A;  3WU1 B;  2P4W A;  1P6R A;  1ZAR A;  5TJJ A;  4XLP F;  3L09 A;  1K79 A;  2FNA A;  1LDK B;  2EV5 A;  1YYV A;  3HOS A;  5HLI A;  3IL2 A;  2EA4 A;  1YW8 A;  1S7A A;  1YW7 A;  1KQ8 A;  3NQO A;  4UXN A;  3ULQ B;  3TDZ C;  1OPC A;  3R60 A;  3MZH A;  2WV0 A;  2ZME A;  2VON A;  3SZT A;  4G6D A;  1W7P A;  1GHC A;  2K27 A;  1IN6 A;  1F5T A;  2DQL A;  3OOP A;  4GXO A;  2FQ3 A;  2XRO A;  2HGC A;  1T38 A;  1QZZ A;  1BI3 A;  3LST A;  4AIK A;  1QPM A;  2EJR A;  2ZBK A;  2RQP A;  3V7S A;  1O3T A;  3JSO A;  5F1R A;  3IC7 A;  3HOT A;  3GZ6 A;  4P55 A;  1XGM A;  4JBA A;  4XRF A;  4BHP A;  2MBF A;  3T5X A;  5LEK A;  3BY6 A;  5LGN A;  3BJO A;  2ADU A;  3NEU A;  3I59 A;  1FBU A;  3V4G A;  3WTW C;  3QPH A;  2V6C A;  3WTX C;  3DXJ F;  4HA8 A;  4KIG A;  1ZYR F;  4L0Y B;  5A2Q Z;  1WI9 A;  4L0Z B;  2IA1 A;  2A69 F;  2YX7 A;  2RGV A;  4G8X A;  4I02 A;  5LEJ A;  2K7L A;  2DT5 A;  3P9C A;  4HF2 A;  4JQF A;  3F8M A;  1FP1 D;  3ERE D;  3CJN A;  2VE8 A;  1I6X A;  4EJW A;  5F64 A;  4I98 B;  4MQ9 F;  3E5U A;  2QZ8 A;  3SXY A;  1T39 A;  4Q5S F;  4QWQ A;  2PMH A;  4PDK A;  4GCV A;  3I58 A;  1WRJ A;  1HXD A;  3MAJ A;  2EA2 A;  3I54 A;  1IRG A;  4EJT A;  4RGS A;  2ISZ A;  4EV0 A;  4GYI A;  4L9T A;  3REO A;  2M1B A;  5ICF A;  3WE2 A;  1IF1 A;  5D5W B;  4BNC A;  1IW7 F;  1IN5 A;  5AIQ A;  1HKT A;  2VBZ A;  1YFH A;  3I5U A;  1TW3 A;  1FNN A;  2ZXJ A;  4R1H A;  3ROU A;  3GEZ A;  3JAM Z;  5J8C A;  3K0L A;  1SD4 A;  2EV6 A;  1W5T A;  3BRO A;  2GXG A;  2OQR A;  4RGU A;  3DFG A;  4ZH4 F;  2GA2 A;  1U5T A;  1P2F A;  4ETS A;  3WTT C;  1TQP A;  4KDP A;  2Q2E A;  2EFN A;  3FX3 A;  1SMY F;  4HYE A;  1J0R A;  2BEO A;  1QZY A;  4RB1 A;  2VOO A;  3E5X A;  4ESB A;  2F5E A;  4ENK A;  1R36 A;  1G3Y A;  4P5O A;  5D8K B;  2VOP A;  3Q5F A;  4L18 B;  1IZ1 A;  2BBY A;  4IJA A;  3HHH A;  4EQQ A;  1GVJ A;  4YG2 F;  2RDP A;  3ZN1 A;  3I53 A;  2X0L A;  3IKT A;  5JHU A;  4QLC U;  5D4S A;  1HW2 A;  1PP7 U;  1D8J A;  3HTU A;  1BI1 A;  4HX4 A;  1RI7 A;  2UZK A;  3EYI A;  1D3Y A;  2WWY A;  2IW5 A;  3GFI A;  3KP4 A;  1SFX A;  1G3W A;  4PZJ A;  4L5I A;  2XAS A;  4S04 A;  4O5V A;  3E97 A;  1ZLJ A;  4I0A A;  1MDM A;  2KJC A;  3F6V A;  3CO7 C;  1T2K A;  2K4J A;  2CFX A;  1X3U A;  2IPQ X;  5LGT A;  5D8L B;  2Y75 A;  1FY7 A;  5E1X A;  3H3U A;  4M6Y A;  4EJU A;  1ZRC A;  2NRA C;  3E6M A;  3CUQ A;  2ESH A;  1ZHF A;  2PG4 A;  3HRU A;  2BYV E;  1FP2 A;  3GW2 A;  2HR3 A;  5ED4 A;  2W25 A;  5ILV A;  3CUQ C;  4UHT A;  1LDJ A;  1R23 A;  1XB4 A;  2VBW A;  4RAZ A;  4WCG A;  4LLN A;  2FML A;  2RV8 A;  5H6Q A;  2DQR A;  3F22 A;  2QM3 A;  2VOD A;  5FFX A;  2CO5 A;  1J9I A;  4LJZ F;  4RGX A;  2L4M A;  3KP5 A;  1BBY A;  2JTV A;  5EEH A;  5A2Q K;  3WOD F;  2MLG A;  2H6C A;  4LMY A;  5D6F A;  1Y0U A;  4HLY A;  3IHU A;  4G94 A;  1LVA A;  1WQ2 A;  4CGZ A; 
#chains in the Genus database with same CATH topology
 5ILU A;  2PMZ N;  2DU9 A;  2QQ9 A;  1U9O A;  4BDZ A;  2KLO A;  4ZYA A;  2L4A A;  3KP3 A;  2ZC2 A;  2HOT A;  3FKI J;  3GUD A;  3OV8 A;  2D2W A;  4JX5 A;  1R1U A;  2HQN A;  2XUB A;  3KP2 A;  4L9V A;  3VYU B;  3N97 A;  4KNY A;  1ETQ A;  2KDO A;  5EZG A;  2NAZ A;  2XGD A;  3O3K A;  3QRF F;  2I8D A;  3KFW X;  1YRN A;  2QKM B;  3TP0 A;  4ZZD A;  4C2U A;  2WB1 N;  1R5G A;  2UUZ A;  1LQ1 A;  2JVH A;  4FX0 A;  2XAF A;  3RKQ A;  3K70 C;  4CYD A;  4Y52 J;  5E17 F;  4XON A;  5H20 A;  2O5R A;  3JRA A;  5EYR A;  4KA4 A;  1KU3 A;  3CCY A;  1Y8R B;  4RS8 A;  2DI3 A;  3HEF A;  4KIB A;  1MBJ A;  4M9S A;  3ZN0 A;  5J4V A;  4OMY A;  3Q9S A;  3CLO A;  3P9I A;  4YFX F;  4A6E A;  5E3N A;  1EH7 A;  2V9V A;  2Z3Y A;  4BGD A;  2VBY A;  1T95 A;  2EB7 A;  2VQL A;  1SD7 A;  2EFQ A;  3GME A;  1QBJ A;  1FT9 A;  3I4P A;  2L9R A;  2OA4 A;  2G7H A;  3EUA A;  1VQ7 I;  1M1E B;  2EQR A;  3MN2 A;  2V1U A;  3QU6 A;  1R58 A;  2X6X A;  3OYK A;  2E1M C;  2L01 A;  3IH2 A;  3CDH A;  1U8R A;  2PI0 A;  3S2W A;  1X4P A;  4QPQ A;  1OCR H;  3FHN A;  4BHC A;  4M3G A;  1OIS A;  3GTJ J;  3GLL A;  2M87 A;  1S72 I;  4CZZ A;  1VND A;  2DTZ A;  4BBR J;  5M3F J;  4KYW A;  3BWG A;  4EM2 A;  5FLM J;  2KRC A;  1LNW A;  4EJO A;  3HTS B;  1ZK8 A;  1S7E A;  3OYD A;  1T0F A;  3I59 B;  4ESJ A;  3CCU I;  3R6S A;  5FD6 A;  3A0B C;  4KN4 X;  3DKX A;  3FXO A;  3AKZ A;  3COA C;  2WY8 Q;  4ENN A;  1FJL A;  2R7U A;  5CLS A;  2KRH A;  4KMU X;  3V8K A;  1TT0 A;  2XV4 S;  4HNV A;  5HS8 A;  4DYQ A;  3MQ0 A;  1Z0X A;  3LQQ A;  5BS6 A;  3WHC A;  1W5S A;  4N9I A;  4GYG A;  4Z2Y A;  1V5F A;  5ILS A;  2Y0M A;  3SZP A;  1UCR A;  2F5C A;  2Z99 A;  5DCM B;  2CFO A;  2O03 A;  3V42 A;  4C9Y A;  4CDG A;  3H35 A;  2R7D A;  1X19 A;  2LBF B;  5B1B H;  3I4M J;  1JE8 A;  3G6E I;  3KET A;  4PFO A;  4BQN A;  3HUG A;  4IRI A;  3HOW J;  4HX8 A;  2VXZ A;  1ON2 A;  4XLE A;  4JK1 X;  5K5Q A;  1OFC X;  2MAB A;  1I3A A;  4XM3 A;  1MMN A;  3BG9 A;  1J5Y A;  2BHY A;  3F23 A;  4H0E A;  2KIQ A;  4BE0 A;  3K4C A;  2KP6 A;  3V7R A;  3OMY A;  2DFF A;  2DW4 A;  2QWW A;  3BZC A;  5K7H A;  4G7O F;  4JP0 A;  3MKY B;  3K4M A;  3U1K A;  2R7V A;  4NC7 A;  4E7Z A;  5LFA A;  3AG3 H;  2K02 A;  2DPU A;  3U1D A;  4U0V A;  1YHQ I;  3B6A A;  3CCL I;  4XKV A;  3PNV A;  4N9H A;  4DQ2 A;  2UXX A;  1XN7 A;  3CMA I;  1UJ8 A;  3ZPL A;  1KZH A;  2DT6 A;  2IGK A;  3GCM A;  3LMM A;  4BXF A;  5EGO B;  5E8I A;  3KZI C;  2OU2 A;  3M1E A;  2UXN A;  3IUO A;  2XHK A;  5J6X A;  1E17 A;  4CYC A;  5J1Y A;  1BN5 A;  4ZYD A;  1A04 A;  1GXQ A;  4O3M A;  4GO1 A;  5FLX K;  2VAS A;  4B3X A;  1J75 A;  4I99 C;  3ZXS A;  3P5J A;  2JA8 J;  4UVA A;  4HDU A;  2A68 F;  5JVG F;  1JXS A;  5FO5 A;  1CF7 B;  3M8F A;  3WHB A;  4DW6 A;  2FSW A;  4XOR A;  1IRZ A;  1E3H A;  3N05 A;  3QPT A;  3E1S A;  4IPA A;  3J80 Z;  5L3B A;  1JKO C;  1L0O C;  3SFI A;  3K7A J;  2L02 A;  3P7N A;  3CC7 I;  4OIR F;  4OIO F;  2MSY A;  2YS9 A;  1ZRF A;  1DPU A;  1X1P A;  5GAH J;  1JUS A;  2RNG A;  4L9J A;  4A3L J;  3FXM A;  2FBH A;  3FXQ A;  4XKC A;  2ETH A;  3HGG A;  4EVI A;  5M5W J;  1PVE A;  4CA0 A;  2R3S A;  1SAX A;  4ZDO A;  2F5D A;  1R00 A;  3M8E A;  2VJI A;  3OR2 C;  2Q0O A;  2MA3 A;  4OU0 A;  2Z2S B;  2CWE A;  1O3R A;  1MKM A;  2CS3 A;  3K4L A;  4HDV A;  4Y15 A;  1YJ9 I;  2GQQ A;  2V9P A;  3H5N A;  3S1N J;  3OYC A;  2ZXH A;  3DU6 A;  3VOD A;  4AU7 A;  2XKO A;  4QTR A;  1NG7 A;  2G7U A;  3IH4 A;  3GVA A;  3RIR A;  1SFE A;  1BA5 A;  4CZC A;  5LHH A;  2ISY A;  2V9K A;  5M5X J;  1TQM A;  1WWX A;  2Z9O A;  3FIS A;  2BW3 A;  3ZMS A;  4RAY A;  4LFU A;  2X1E A;  1D5V A;  4GRI A;  3C18 A;  4KIC A;  2QQA A;  5FB2 A;  4XLH A;  1MBG A;  5C4X J;  2FF4 A;  3EYY A;  1WVR A;  2RVC A;  3LFK A;  4II3 A;  1K6O A;  1TC3 C;  3CC2 I;  1XCV A;  1G6N A;  2DA1 A;  3TW7 A;  2WAF A;  2M8G X;  4B4C A;  2EZL A;  4QSH A;  4FTH A;  2CH0 A;  4EJV A;  3GLX A;  3A01 B;  4S0H B;  1A5J A;  4WXD A;  3HSF A;  3RYP A;  4BHB A;  5DD4 A;  1RUO A;  2P7C B;  3OOU A;  5IY5 H;  5KVR A;  3ECO A;  5L3C A;  3F21 A;  1YS6 A;  4FT8 A;  4BQQ A;  3JRE A;  1BJZ A;  1EKE A;  3MD2 A;  4OOI A;  4UUS B;  1DU0 A;  2M4K A;  4A3C J;  1FEX A;  1DGR M;  2MLK A;  2Q2E B;  1D1C A;  2QF7 A;  4PJL A;  1F43 A;  4DNC A;  1SEU A;  5H2F C;  2BE5 F;  2VT2 A;  1FTT A;  1LUJ B;  1RR8 C;  1BR1 A;  4IL6 C;  2EV0 A;  1IXC A;  2WTE A;  4A3E J;  2E7X A;  4XRS G;  1BIB A;  5DD8 A;  3KZZ A;  3ELK A;  1ZG5 A;  2DK8 A;  5E3L A;  2P6S A;  2VPR A;  3DCF A;  1IXR C;  1BM9 A;  2PJP A;  2K3P A;  3BTC A;  4NC8 A;  4A0X A;  3IH3 A;  4L5E A;  4U88 A;  2NVU B;  1L3L A;  4BAY A;  4LG0 B;  1O57 A;  4HLX A;  4EM0 B;  3JRG A;  4M6X A;  3QPL A;  1A36 A;  2XPV A;  4D1Q A;  2DFE A;  2MG4 A;  2OQG A;  3H1C A;  1V55 H;  1MH3 A;  2XC7 A;  2HZD A;  3LSI A;  5CVR A;  2NYX A;  1EA3 A;  4DZJ A;  1UEL B;  1I50 J;  3MCZ A;  4CCJ A;  2D45 A;  2RNJ A;  3B6C A;  3FHZ A;  4BE1 A;  3HJE A;  2L3D A;  4A5N A;  4LLL A;  4E7S A;  2P8T A;  3RI4 A;  2PQ8 A;  1VTN C;  3H3Z A;  3GZ5 A;  3TMO A;  2BY0 A;  3ZMV A;  1Z7L A;  2GAU A;  2VLA A;  3AG1 H;  3BQY A;  4FIS A;  2ZO4 A;  4XR6 A;  4UUT A;  3RTR A;  4YFK F;  1I3Q J;  1R1V A;  4LLG F;  5EG0 B;  1FZP B;  3N4M A;  4XL9 A;  1W0U A;  1XG1 A;  1MNM C;  3CES A;  2ME0 A;  4NBQ A;  1JHH A;  3K2Z A;  1KQ9 A;  4NB5 A;  5GTI C;  3C1D A;  2AS5 F;  4RM2 A;  3PO2 J;  4F91 B;  2M3A A;  1B6A A;  2EFO A;  1WCM J;  5E1W A;  4X1E A;  5EEG A;  2FBK A;  4YII A;  3H0G J;  2WY7 Q;  2VXD A;  1POG A;  1ZEL A;  2ZNY A;  2BXZ A;  5KAI C;  4IOA F;  4B09 A;  3ZQI A;  1F1Z A;  4F7Z A;  2Q8K A;  1YLF A;  1Z1D A;  3J80 K;  2W24 A;  3CDI A;  3PQK A;  1BW5 A;  5B66 C;  4WX9 A;  2LOO A;  4HSR A;  5BPI A;  2E35 A;  2M7A A;  1TL8 A;  4CCN A;  3CQZ J;  4IHT A;  2OTJ I;  3SDG A;  4B3A A;  2HTJ A;  5ICC A;  3ABT A;  3LSR A;  1Y1W J;  5DM6 F;  3GTK J;  4HW0 A;  3TO9 A;  4CXF A;  2ACJ A;  1KA8 A;  1IN4 A;  4D7M A;  2O8X A;  2CW0 F;  1S8N A;  2ECC A;  2Y2Z A;  2JA2 A;  2JSC A;  3ASN H;  4I0B A;  4II2 A;  4NDL A;  4ESF A;  5LBQ A;  4HZF A;  1FYL A;  5CJ9 A;  2ZME B;  2P5V A;  2XF7 A;  1J2X A;  1MW7 A;  1QO0 D;  3A1Y A;  1OCZ H;  1VQ5 I;  6PAX A;  3LA7 A;  4G7Z F;  2ZCW A;  1X2M A;  3OY9 A;  1FOK A;  3S8P A;  2DMP A;  2R7O A;  3ABL H;  4FQG A;  4MNU A;  2QSF X;  2ZXI A;  2EIK H;  3M8J A;  4FAS D;  1YTY A;  2RN7 A;  4ZYG A;  4BQA A;  4G6T B;  5HOO A;  5FGM A;  5E3O A;  4LB6 B;  4HG2 A;  3OL3 A;  3QP5 A;  1ZG1 A;  4HF1 A;  3K10 A;  2ZJR F;  3GZN B;  1UMQ A;  2NNY A;  2IAI A;  2BY1 A;  4D9J A;  1HW1 A;  3L1P A;  2VKH A;  3IAS 2;  1U2W A;  3MWM A;  4BYY A;  4Q4Z F;  1U9N A;  4E7J A;  1R9T J;  1U3E M;  2KL4 A;  2L5Q A;  3DEE A;  1FOW A;  1HQC A;  3G1M A;  2DDA A;  1WH5 A;  1YIJ I;  2R4G A;  1DP3 A;  2MD5 A;  3G3Z A;  1IGN A;  3L2V A;  1PYV A;  4A3I J;  2DOA A;  1TZL A;  5IP9 J;  3F3X A;  3R61 A;  2E1C A;  4M9X A;  2XAJ A;  3VPR A;  3HSE A;  1JKP C;  1V4R A;  2KRF A;  2M8E A;  4UUS A;  2BXY A;  5IYB J;  3PIO F;  4IKF A;  3AL0 B;  3OR1 C;  2LY2 A;  5AON A;  5EJC A;  1R22 A;  3S1M J;  2LLK A;  1MH4 A;  1Z3X A;  1WJD A;  3K1P A;  1U5T C;  5GP9 A;  2P6T A;  3OYM A;  5HS7 A;  5BPD A;  3I3L A;  4ASN A;  3D5L A;  1RIO H;  4WXH A;  5FJ8 J;  3E0J B;  2YSR A;  1LEA A;  4YFN F;  4BKX A;  3CO6 C;  2PJR B;  4GFB A;  2NVX J;  5LGU A;  1ETW A;  3BJ6 A;  2K9S A;  3ABU A;  3R4K A;  3BPX A;  4CO8 A;  2A61 A;  4P1W A;  2QQB A;  4XOT A;  3EPZ A;  1SVL A;  2O9L A;  3BG6 A;  2JT1 A;  2MFZ A;  3L7W A;  3LSK A;  2ZFU A;  2QVO A;  3W6K B;  2KPM A;  2XSJ C;  1LE8 A;  3JRC A;  4IHS A;  5J8F A;  4RB3 C;  3DEU A;  2W1O A;  1VQ8 I;  1BC8 C;  5HDN A;  2R7Z J;  5KNL A;  2DPD A;  1APL C;  1ZQ3 P;  1MBK A;  2MGQ A;  3GFM A;  2HQR A;  1TNS A;  1Z67 A;  1IUF A;  1J59 A;  2FRH A;  4G6Q A;  2HYJ A;  2EFW A;  3L9F A;  3BP8 A;  1KQ0 A;  4J19 A;  4E4H A;  2DBB A;  2E5N A;  4UVB A;  1YG2 A;  4IHY A;  5E18 F;  1KYZ A;  1KU2 A;  5GPC A;  1MSF C;  3CP8 A;  1V5E A;  1DP7 P;  2JPB A;  1QPI A;  1FMV A;  3VYR B;  3MKW B;  1G59 A;  2BHZ A;  3GF2 A;  1XD7 A;  2NS8 A;  3HXL A;  2MYS A;  4IRH A;  3DBR B;  2D5V A;  4M3B A;  1FYM A;  2XDV A;  4ON0 A;  1QVT A;  3IRQ A;  4GGG A;  2K86 A;  5CVJ A;  5GAD J;  1KGS A;  5BMZ A;  2E5Z A;  3VDX A;  3L2U A;  1X1B A;  3A03 A;  1XGS A;  3OL4 A;  3H0D A;  2VC1 A;  2DA5 A;  3LSM A;  3Q9V A;  1MGT A;  4N4N B;  4IZZ A;  5FD5 A;  2R93 J;  2HOS A;  2M34 A;  1FOX A;  2A3S A;  2JA5 J;  5L3D A;  2A6T A;  4E7H A;  2ELK A;  5IOY A;  4MTE A;  1TQI A;  5HLH A;  2EH3 A;  3TO6 A;  4TV7 A;  1I5Z A;  1UFM A;  1FBS A;  3BZK A;  4ZZL A;  1OYY A;  1QHG A;  3K4J A;  4EEF G;  1TLH B;  1OCT C;  4Y7N J;  1W7P B;  2CUF A;  1WH7 A;  2V4J C;  1HC8 A;  2HPI A;  2XAQ A;  2IVM A;  3EET A;  5F0F A;  5HNF A;  1IXS B;  1W0T A;  3C3W A;  2L7F P;  1I1G A;  2Y0S A;  1Z91 A;  1YI2 I;  2CYY A;  2BY2 A;  3RDI A;  3BTL A;  4BL0 B;  2DDB A;  2KIM A;  4J00 A;  5F04 A;  3VB2 A;  4BY7 J;  4KIS A;  1FBQ A;  1K78 B;  2F4O B;  2X6W A;  4LIU A;  1E3P A;  4OIN F;  3EDP A;  2MW8 A;  2Z1D A;  4LK1 F;  3K1M A;  5C3E J;  2KMU A;  1ZKG A;  2HOE A;  1T98 A;  3GTQ J;  5DYM A;  1YIO A;  2ZSI B;  3J7A O;  1WZ2 A;  2XGE A;  1P7J A;  4HST A;  2HDD A;  4B1R A;  3ZGK A;  1NK2 P;  3F8N A;  2IA2 A;  5E8G A;  1ITY A;  2EIM H;  3FXR A;  3G73 A;  1PUE E;  2BV6 A;  3C2H A;  3CJR B;  1MIJ A;  1RZ4 A;  2FXA A;  3WGH A;  4MIM A;  1XMX A;  2DN0 A;  4PFP A;  1K78 A;  1CGP A;  3BG3 A;  2R5Y B;  3FZV A;  4KT5 C;  1TWH J;  4KIF A;  1QU3 A;  4IF4 A;  2H8R A;  1D0Y A;  1DUX C;  3Q3S A;  1PP8 F;  2CJJ A;  2LFB A;  1PJR A;  2HS5 A;  1R4N B;  1STZ A;  4XN3 A;  1Y1V J;  4LIV A;  2X4H A;  3FM3 A;  4S05 A;  1JTY A;  3ZQC A;  4IVN A;  4M72 A;  2MH2 A;  2H8W A;  2O7O A;  3E3V A;  1Z9C A;  2J5O A;  2YX4 A;  4G7H F;  3RYR A;  2DK5 A;  3H9Q A;  1CF7 A;  2VPL A;  2HEO A;  3FK6 A;  2LKS A;  2A6H F;  3CC4 I;  5IT3 A;  3H3V K;  4G9Y A;  2F5F A;  1D0Z A;  1XC5 A;  3BC8 A;  2LRE A;  1WSU A;  1BOA A;  1IRF A;  2FE3 A;  2PMZ A;  4MHG A;  1W36 C;  1AWC A;  2X1D A;  1S6L A;  3ML6 A;  2M5W A;  5D5X B;  2D1H A;  4U0Y A;  1XDS A;  3HM5 A;  3A4C A;  2FA5 A;  2W57 A;  4NUB A;  2E2J J;  4M73 A;  4HV5 A;  5LHG A;  2WV1 A;  1LFP A;  2O6G E;  1HF0 A;  2JA6 J;  5J3L A;  4ABZ A;  1VFC A;  1QNT A;  5GAE J;  3DTI A;  1QQI A;  1E2X A;  3RKY A;  3RPU D;  4CH7 A;  9ANT A;  3ZMZ A;  2YPR A;  5M3M J;  1SD6 A;  2PN6 A;  2IS6 A;  3GTL J;  1MBE A;  1YS7 A;  2KHM A;  4XLN F;  1OYW A;  4LG3 A;  3CCM I;  2VJ4 A;  1VQ9 I;  5K7Z A;  2Y31 A;  3CUQ B;  4HV6 A;  1IN7 A;  3QAH A;  2QBY B;  3S93 A;  5TRD A;  3PQJ A;  2HZT A;  2BW3 B;  2R5Z B;  3EUH A;  4QPO A;  4NQW A;  1N75 A;  2H1L A;  3ZP5 A;  3O8H A;  1ZG3 A;  2EIJ H;  1HCR A;  1P4W A;  5IYC J;  3LNQ A;  4OAY A;  4K2E A;  3GXO A;  1RET A;  1ZRE A;  3ECH A;  2STT A;  3VSK A;  2L9S A;  1FC3 A;  1WFX A;  1MBF A;  2KDZ A;  3CCV I;  3FXU A;  2QLZ A;  2LYC A;  3QU3 A;  3FIW A;  2QQ8 A;  4AYB A;  3IWF A;  2PJR A;  1A6Q A;  1VQP I;  2P5L C;  2V1X A;  3KIO A;  3L2Q A;  4C2T A;  4MGR A;  2W7N A;  3BLY A;  2H09 A;  2FNP A;  5E3M A;  3TQN A;  4BY1 J;  1ZAO A;  1ZRD A;  3LAJ A;  3GFJ A;  1F4K A;  4OWR B;  4Y13 A;  1R71 A;  5CVV A;  4A0Y A;  2A07 F;  2H27 A;  1VQO I;  5IYD J;  1Y0N A;  2Z5U A;  1D5Y A;  1G2H A;  1QVU A;  2E1M B;  2COB A;  3WGI A;  1XSX A;  2KJB A;  5LRR A;  3TP3 A;  2K9Q A;  3WTV C;  4A69 C;  3K9T A;  2J5P A;  4PUS A;  4RB0 A;  3F8B A;  4BBS J;  3KZY A;  1TBX A;  5IT9 K;  1HKQ A;  3LL7 A;  3IRR A;  1Z6R A;  4HOB A;  2OBP A;  3U2R A;  3O2P E;  1G4D A;  2DJN A;  3EQL F;  5CKT A;  4BU2 A;  2FJ1 A;  2E2I J;  1HST A;  3H5R A;  1LDD A;  3DF8 A;  3RCO A;  2DMU A;  3RPU A;  4ENJ A;  2C6Y A;  2W48 A;  1RUN A;  3PSI A;  2XKP A;  3FMQ A;  1J7K A;  3TKY A;  3CF5 F;  3M4O J;  1N25 A;  3B02 A;  4PCQ A;  1JI8 A;  1S7O A;  4CUG A;  2E7W A;  1R7J A;  4BH9 A;  1JGS A;  5LRS A;  3CJT B;  3LA2 A;  3GTO J;  4B8X A;  4A6D A;  1EH8 A;  1QZE A;  4B44 A;  4LK0 F;  3KE2 A;  5F0H A;  4I09 A;  2YR2 A;  1SFO J;  2Y48 A;  1AKH B;  1R6R A;  2JK3 A;  4Y17 A;  4AIJ A;  2JN6 A;  3DEW A;  5BQT A;  4KT6 A;  1P4X A;  1R1T A;  3D1N I;  2HYG D;  4XLC A;  4ZJZ A;  2YU9 J;  3BCA A;  4EM1 A;  4XRS A;  2VN2 A;  2W00 A;  3DBH B;  1DDN A;  1YQA A;  4XMY A;  3CCJ I;  3BDD A;  1JTX A;  2K40 A;  2CQ7 A;  3J7Z I;  2LBF A;  3S1Q J;  2YU3 A;  4XSZ F;  3V7C A;  4UB8 C;  3CMY A;  2KKO A;  2VC0 A;  5D5V B;  1TW2 A;  3FMS A;  3BZ6 A;  3RZO J;  4LD5 A;  2WBM A;  1ZGJ A;  1Z05 A;  3S16 J;  1WI3 A;  2DFI A;  3FM5 A;  5CVU A;  1NHA A;  5FLV A;  2E71 A;  4UB6 C;  2VT3 A;  3K70 D;  4BJ5 C;  1IJW C;  3TO7 A;  3OSG A;  1E0E A;  2GLO A;  3TDU C;  3TOA A;  5L3E A;  3SZG A;  4CCK A;  2ELJ A;  1XSV A;  3IWZ A;  1GVD A;  4RAG A;  1KYW A;  2JZY A;  1WGX A;  1SVM A;  1OJL A;  2WB1 A;  4MO7 A;  1H88 C;  1B72 A;  1SAU A;  2XRN A;  3L2C A;  1X1A A;  2M0M A;  1HLV A;  3UR3 C;  1B1B A;  2AO9 A;  3K69 A;  4AD9 A;  3CD6 I;  3VEP A;  1DGW Y;  3U9G A;  5F08 A;  3M7G A;  2R7X A;  4XIC A;  4I2O A;  4ZDP A;  2R5Z A;  1LVK A;  4IQ4 A;  3FBN B;  2ME6 A;  4WF2 A;  3ZQF A;  2LF8 A;  1LB2 A;  1BR4 A;  1C0W A;  3OYF A;  4M3E A;  3FWE A;  2VJJ A;  1VZ0 A;  2HYF A;  5HS9 A;  1FPQ A;  2P7V B;  2FU4 A;  3HUG B;  4P96 A;  2LTP A;  4E7I A;  2UWM A;  1TWF J;  5JFR A;  3KEY A;  1E3O C;  1ORK A;  3SFZ A;  3CMM A;  1UG0 A;  2K85 A;  4UNO A;  2L9N A;  1VQM I;  5HDK A;  2CQN A;  1W5C C;  1ACI A;  3T8R A;  5J4Y A;  3FBI B;  2L9V A;  2LKX A;  3A2K A;  3IP4 B;  1JHF A;  1LEB A;  3BJA A;  2F5V A;  3LA3 A;  2M2E A;  3D5R C;  3C2B A;  1SVO A;  1WJE A;  1OKR A;  1NK3 P;  1MMS A;  1LKX A;  2GZW A;  3G2B A;  3F8F A;  1QGP A;  1BOB A;  3WU2 C;  5B5E C;  5LLQ A;  2B63 J;  1Q1V A;  5JI6 A;  1XDU A;  2CUE A;  3AG2 H;  1LJ9 A;  1YW9 A;  2BGC A;  2R7S A;  5DTD A;  5CYV A;  2DXI A;  5ICG A;  3E6B A;  1UHM A;  3TED A;  3GFL A;  2ELH A;  3L2W A;  5E79 C;  2NVY J;  2HKO A;  1YJW I;  2EIL H;  1OCO H;  4EGZ A;  4IO9 F;  2A5Y B;  2LF7 A;  3HL2 A;  3CCQ I;  3BR1 A;  3DPU A;  4C2M J;  3DQV C;  3KEO A;  5KK1 A;  4AVP A;  1RNL A;  4XKW A;  3I71 A;  1YJN I;  2CW8 A;  1MMD A;  2NNN A;  2XGC A;  2IT0 A;  3ASO H;  2K5C A;  2ZSH B;  2DCE A;  2L2O A;  1KU9 A;  3OIP A;  5TGT A;  3MEX A;  3ZMT A;  1BL0 A;  2GXB A;  4BE2 A;  3ZQG A;  2XB5 A;  3C7J A;  5CQE A;  2QYO A;  4IXA A;  2FD5 A;  3OSF A;  1FOY A;  2E34 A;  4QIW N;  4ZYE A;  1G8X A;  3I64 A;  1PDN C;  2IGM A;  3DU5 A;  2F2E A;  1LFU P;  2LY9 A;  3DTE A;  1AOY A;  1SFU A;  1MBH A;  1G3T A;  3BOQ A;  4CYC B;  5DCM A;  5FKL A;  1FIA A;  2WAQ N;  3E7L A;  3LQR A;  1RKW A;  4JX4 A;  2QEN A;  2PEX A;  2WAD A;  5D6E A;  5ICE A;  2DTR A;  3ONQ A;  3WG7 H;  5JHF A;  1GV5 A;  1A35 A;  2JSP A;  4A3K J;  4FCY A;  3GWZ A;  2ZKZ A;  3GTG J;  3VOE A;  2IP2 A;  2TRT A;  1LE8 B;  1JGG A;  4PJN A;  1OR7 A;  4LGW A;  4FX4 A;  2GIV A;  2X6O A;  4MFE A;  2WAE A;  2JVG A;  2CQK A;  2HXO A;  2AQF A;  2CG4 A;  2OZ6 A;  1T56 A;  3QOP A;  1B9N A;  3E6D A;  1IV6 A;  1MMA A;  1VQ6 I;  3Q0V A;  4XOP A;  4CIC A;  3G4S I;  1GXP A;  4WWC A;  4XBF A;  2PFB A;  1Z21 A;  4DBR A;  3HYI A;  2BY3 A;  2XF5 A;  3RKX A;  4EGY A;  1DPR A;  1USS A;  2GXA A;  1N77 A;  4G12 A;  4PJJ A;  1XX5 A;  3M3Y J;  1K7A A;  1ULY A;  1WKM A;  2LRD A;  1ETY A;  3MZY A;  1R5I D;  3ABM H;  4PK4 A;  4M71 A;  4AIH A;  3JRD A;  4FHT A;  2B0L A;  3WE3 A;  2EK5 A;  3HIF A;  5JLX A;  2PLY A;  3KLN A;  4Y3O A;  5DEQ A;  4WK8 F;  1UHW A;  2N8G A;  1O3S A;  2XPU A;  4DGW B;  2QGU A;  4KMF A;  2XAG A;  1TTY A;  3HOY J;  2STW A;  3I56 I;  2D1V A;  5IPA A;  4AID A;  5C4J J;  1TT5 B;  2HFH A;  4M9Z A;  1IN8 A;  2LY1 A;  3QQA A;  5L3G A;  2EZH A;  2COM A;  3T1B A;  5KCM A;  4XKB A;  3K4K A;  3OYG A;  1BC7 C;  1TWA J;  3HRM A;  1K6Y A;  3WG9 A;  5JVT A;  3S2D J;  2IS4 A;  5F27 A;  2PBI A;  4L9N A;  5J47 A;  3JAM K;  3WTS C;  3T0Y A;  1JT0 A;  1P4A A;  2HDW A;  4ZYH A;  2FQ4 A;  2X51 A;  2XVC A;  2L54 A;  2L7Z A;  2KIF A;  3JRF A;  2AHQ A;  3ZQH A;  2LDU A;  5J1R A;  2XRL A;  2IS1 A;  3WGG A;  3E6C C;  4Y4R A;  4BS9 A;  5HOD A;  1ETX A;  3A0H C;  1W4M A;  4A3G J;  1NG6 A;  2YUS A;  4CHU A;  4DZP A;  5B1A H;  4Q47 A;  2DO7 A;  2X48 A;  2LG4 A;  3ZQQ A;  2O0Y A;  2ZJ2 A;  2QA4 I;  4Y33 A;  3JTH A;  2GBY A;  2XF6 A;  5CPR B;  4RDU A;  2R92 J;  1RKT A;  1CQT A;  2QSH X;  3WU0 A;  2XSD C;  2CW7 A;  2CU7 A;  5E1Z B;  1MJ9 A;  3AAF A;  1D8K A;  4HRI A;  4YIF A;  3HHG A;  2FEZ A;  3V8J A;  1RR7 A;  2JWT A;  5ERI A;  5F0C A;  3S15 J;  3MVP A;  2CQQ A;  2NS0 A;  4UY8 I;  2CUJ A;  1WHU A;  4XID A;  4CCM A;  4N0B A;  1REP C;  4CCL A;  3DPT A;  5HVQ C;  5FKM A;  5FKK A;  5DDG A;  2JUG A;  2MH9 A;  3MZ8 A;  4ZC3 A;  5D4R A;  3I55 I;  3HG9 A;  3PFI A;  2B9S A;  4DBQ A;  1GT0 C;  2G0E A;  1HBX G;  1X4O A;  1Z6T A;  5DM7 F;  2KT0 A;  3K4B A;  2Y30 A;  1MJA A;  3F72 A;  2LK2 A;  1FX7 A;  3X2Q H;  3FXK A;  3I0T A;  2JUC A;  1MD0 A;  4OIP F;  1B59 A;  5K5R A;  5LD2 C;  2VQC A;  4R79 A;  2GA1 A;  4IRG A;  2I10 A;  3H9G A;  1O7L A;  3RQI A;  2QUF A;  2OZU A;  3BR6 A;  1IDZ A;  1U78 A;  1UHS A;  1K4T A;  3FKJ A;  4HPQ A;  2DYR H;  2RC4 A;  3QPS A;  3V8L A;  3JRI A;  3PL8 A;  1F36 A;  3ERM A;  4U7D A;  4C3H J;  3LSG A;  4X0G A;  3HC7 A;  1SD5 A;  2RKH A;  2CGP A;  4X6A J;  3BQZ A;  1S29 A;  2EFP A;  1ZLK A;  5JLW A;  3KLO A;  4PJM A;  3RQ4 A;  2OF7 A;  3U21 A;  3ZOB A;  5JR3 A;  4BJ6 C;  2OV7 A;  4HBL A;  5KHD A;  3F9K A;  1XMK A;  1KON A;  3KP7 A;  1OMI A;  2EZI A;  2KQR A;  1A6I A;  1O3Q A;  3G71 I;  1UZC A;  2V1N A;  3CME I;  2H6B A;  3FXL A;  3F0C A;  2NXN B;  1T6S A;  1U6G A;  4IOC F;  2HNH A;  1P7I A;  2ID3 A;  1FLI A;  1VQ4 I;  3ZQL A;  2O8K A;  1BW6 A;  4A93 J;  1JKR C;  3FMR A;  3HGY A;  3BR5 A;  2O61 A;  3CJQ B;  3HOU J;  4MEY F;  3I9V 2;  2ZNZ A;  3PIP F;  1WJC A;  3LWF A;  4HF0 A;  4XK4 A;  1XCB A;  3W6J B;  2MD0 A;  4A3J J;  1TWG J;  5FRO A;  4HNT A;  3IKV A;  2JQ7 A;  2K9M A;  1H0M A;  1EH6 A;  2Y0S N;  4I01 A;  3KYC B;  5HDG A;  3IV5 A;  2HWV A;  2V1D A;  3NWT A;  1F9N A;  4AM3 A;  2H94 A;  3F8C A;  2IRF G;  2Q1Z B;  2KFD A;  2M30 A;  3LFU A;  3TOB A;  1XGN A;  2X1C A;  3ISP A;  5J40 A;  4U7B A;  2Z33 A;  4MTD A;  1OYI A;  1B9M A;  4KIT B;  3JTG A;  4WXC A;  3ZMD A;  1T8I A;  5F6F A;  2GM4 A;  5CQG A;  1IAW A;  1Z7U A;  2VKV A;  4IX7 A;  1YO5 C;  2A05 A;  5CVI A;  1H89 C;  1D1B A;  1ZGA A;  1GUU A;  4C3J J;  3HSR A;  2IGO A;  1WJF A;  4AC0 A;  4CCO A;  4RBO A;  4W1U A;  1G3S A;  1O7F A;  4BEH A;  1MJB A;  5TIS C;  2LMD A;  4A0Z A;  1ZR2 A;  3KP6 A;  2Y9Z A;  1Q1H A;  1HDD C;  3QYE A;  4KN7 X;  3CUO A;  3OWT A;  2A6E F;  3PUF A;  3ABK H;  3JR9 A;  4HQE A;  2R7W A;  3OS0 A;  1U0J A;  5H6R A;  3GYH X;  1ODD A;  3QYB A;  4L5J A;  3RKW A;  2CQX A;  1X58 A;  2VKE A;  1MDM B;  2MC3 A;  1ON1 A;  3LSP A;  2NVT J;  1T0F C;  3KYD B;  4U0W A;  5FKO A;  2R0Q C;  4A3B J;  1R5H A;  4P9U A;  3HOZ J;  3T8T A;  5EGO A;  2KIU A;  4RLQ A;  1QA6 A;  1HW5 A;  2EPF A;  3E5Q A;  3CCS I;  3EUK L;  3K2A A;  4BEH B;  2M0C A;  1GDT A;  4V19 K;  5B3S H;  4EAT A;  2W84 A;  3PNY A;  2AXL A;  4DYR A;  2V6E A;  4LB5 A;  4UUV A;  3O6B B;  1V3F A;  2DOE A;  5FLX Z;  2FMY A;  5F1J A;  3S3O A;  3PUB A;  2QKL B;  2AXT C;  3SQN A;  4I6Z A;  3ZQ7 A;  1BIA A;  4F93 B;  4ANJ A;  3AL0 C;  1FSH A;  3HOV J;  4HQM A;  2FBI A;  1MZB A;  3DP7 A;  2VUM J;  1EV7 A;  2V79 A;  4RGR A;  1SMT A;  2IJL A;  1V5G A;  1GLN A;  2DAO A;  1UST A;  1U5T B;  1VQN I;  3SJM A;  2GWR A;  3QP6 A;  2XIG A;  5DV5 A;  2E1O A;  4BXU A;  1IUY A;  1BR2 A;  4ZTJ A;  5DCF A;  1J09 A;  4NHJ A;  1JUP A;  3KPH A;  4MQV A;  3ZMU A;  5D5U B;  2W85 A;  2I5U A;  1XTA A;  4BDY A;  2FX0 A;  3GX4 X;  1Y6I A;  5IOZ A;  2HDC A;  2LNB A;  4HX7 A;  3MFK A;  2E19 A;  3PJR A;  2VJ5 A;  3GBG A;  1HKS A;  2TDX A;  3OYH A;  2K3F A;  3KCC A;  3O8G A;  2CV0 A;  1HOM A;  2O3F A;  1XSD A;  1QHH D;  2X85 A;  3CTA A;  2M7B A;  3LAP A;  1ZGW A;  2HVR A;  1FMW A;  2ECB A;  5FRN A;  4ZDL A;  1ZH5 A;  4OAZ A;  2E1N A;  2ID6 A;  5C44 J;  5E20 A;  1MNE A;  3K1N A;  2OD5 A;  2LSO A;  3WTZ A;  1QRY A;  1FIP A;  5L3F A;  1O4X A;  3D0S A;  4PGG A;  1NH3 A;  2VE9 A;  1VQL I;  4OMZ A;  2OAZ A;  4F92 B;  5GPA A;  2IXS A;  4P9F A;  4AYB N;  2VBX A;  2DT7 B;  2RAE A;  1FSE A;  3BG5 A;  4KUM A;  4RAF A;  3RPQ A;  4AWX B;  5IP7 J;  3CP2 A;  3A01 A;  4F52 A;  1A31 A;  4LG0 A;  3DLL F;  3MMY B;  2ZME C;  4D7N A;  2K4B A;  2CSO A;  1EF4 A;  5DUK A;  3J81 K;  1WJA A;  4MEX F;  3JRB A;  3SEQ A;  4ENM A;  2JRT A;  2RQQ A;  2EWN A;  3WTU C;  4PSX A;  1R4M B;  2JMW A;  3VFZ A;  2GOX B;  2PX9 A;  1ZN2 A;  3OYI A;  4A12 A;  4YRV A;  1H9G A;  2H1K A;  2PMU A;  3OYN A;  2R7F A;  1B4A A;  3PFY A;  3DLA A;  4E70 A;  3DWL E;  4UV8 A;  1OR7 C;  1BI2 A;  3DKW A;  5LHI A;  1LPQ A;  1YOV B;  2IBD A;  1B72 B;  3R0J A;  5EG0 A;  4HNU A;  1XPX A;  1V54 H;  2DLL A;  3W2V A;  2OPT A;  1ZR4 A;  4BAC A;  3K6G A;  5IT9 Z;  3GO5 A;  2G9W A;  2ZJQ F;  3OYA A;  2XAH A;  4HAM A;  1SC7 A;  1K61 A;  1ERD A;  1ONV A;  4NNJ A;  3JSP A;  4YEL A;  2M45 A;  3R0A A;  4RB2 C;  4XSX F;  3W2A A;  1FWZ A;  4I7H A;  2XPW A;  4M74 A;  3B73 A;  1I27 A;  2P81 A;  3KEQ A;  5K5O A;  3L00 A;  1S3J A;  1IDY A;  4KFC A;  1XGO A;  3FDY A;  1KU7 A;  3TGN A;  1HSJ A;  4D0P A;  1FYK A;  2MC4 A;  3RJP A;  1JT6 A;  1YE9 A;  5AIP A;  4UVC A;  1W1W E;  4V2G A;  1I1S A;  3BPV A;  2F4I A;  1UB9 A;  4KJZ A;  3WTY C;  4OIQ F;  3H92 A;  2FOK A;  1R49 A;  4A3M J;  4BUP A;  1X2N A;  3M9A A;  3S3M A;  3J81 Z;  2HPM A;  5HLG A;  2XGX A;  1Z77 A;  1BI0 A;  4JOM A;  3JW4 A;  4HEA 2;  2HTS A;  3J7A Y;  2DA3 A;  4PSW A;  1W7P D;  1VI0 A;  4I76 A;  1IO2 A;  1XMA A;  4CSW A;  2JA7 J;  1BJA A;  1P9Q C;  1TNT A;  4AVZ A;  3SHF A;  1P92 A;  4IHX A;  4A3F J;  2P5K A;  3CDL A;  1Z3Y A;  3GTM J;  3M1C A;  4EMS A;  5BOX A;  3HRS A;  1MND A;  4A5M A;  2IA0 A;  5KAF C;  3CCR I;  5K1Y A;  4Z6Y A;  2LKP A;  2WC2 A;  4O6J A;  5FFZ A;  2QBY A;  2V7F A;  1H9T A;  2ZFW A;  4LOC A;  2UV1 A;  2JPC A;  2ZB9 A;  3DPL C;  4U87 A;  3J7Y J;  1JJ8 C;  3NRV A;  3K4N A;  3FF5 A;  2ESN A;  4H4K C;  3P9K A;  5DUI A;  1AA7 A;  2BVL A;  2E36 A;  2LR8 A;  4A2U A;  1IV8 A;  3HRT A;  4R8H A;  3DV8 A;  4BXX J;  3OIQ A;  3F6O A;  3BCB A;  1Y39 A;  2JJ7 A;  2HKX A;  4Q48 A;  1T08 B;  4UV9 A;  3MKZ A;  3HB9 A;  4MLO A;  5GAG J;  4ITV A;  4PGH A;  4F3Q A;  3WU1 B;  2VIX A;  3H36 A;  2P4W A;  1P6R A;  1ZAR A;  5TJJ A;  2R7R A;  4XLP F;  3LSH A;  3PNT A;  3L09 A;  4BJT A;  1K79 A;  2FNA A;  1LDK B;  2EV5 A;  3Q0W A;  5HNH A;  1YYV A;  3HKZ A;  5HLT A;  3SEZ A;  3HOS A;  1B8I B;  5HLI A;  3FXJ A;  3IL2 A;  2EA4 A;  3CF2 A;  3HBL A;  1YW8 A;  3HPG A;  5BNG A;  1S7A A;  1YW7 A;  1KQ8 A;  3NQO A;  4UXN A;  3ULQ B;  3TDZ C;  1OPC A;  4J01 A;  3S14 J;  3R60 A;  3MZH A;  3SYT A;  3W2W A;  3OS2 A;  2WV0 A;  2ZME A;  2VON A;  3SZT A;  1IC8 A;  3TW6 A;  1Y8Q B;  1WJB A;  4G6D A;  4M6V A;  1W7P A;  1RRJ A;  1GHC A;  2K27 A;  1IN6 A;  1F5T A;  2DQL A;  2HXI A;  3OOP A;  1NTC A;  4GXO A;  1RC9 A;  2FQ3 A;  2HGC A;  4DOZ A;  1D1A A;  2LC2 A;  2M9H A;  2XRO A;  1T38 A;  3W3C A;  1QZZ A;  1BI3 A;  3LST A;  4AIK A;  1OQY A;  1QPM A;  2EJR A;  4M3F A;  3VYT B;  1RPW A;  1I6H J;  2ZBK A;  2RQP A;  1PUF A;  3V7S A;  1O3T A;  4XNF A;  3S32 A;  3JSO A;  5F1R A;  3IC7 A;  3HOT A;  3GZ6 A;  4P55 A;  1XGM A;  4JBA A;  2X6Y A;  4XRF A;  2OJE D;  4BHP A;  2MBF A;  1Y56 A;  3T5X A;  4DJA A;  5LEK A;  3QWL A;  3S3N A;  3BY6 A;  5LGN A;  3PM1 A;  3BJO A;  2ADU A;  3NEU A;  2F48 A;  1DQU A;  2NOG A;  3I59 A;  1FBU A;  3V4G A;  2RRE A;  3WTW C;  3QPH A;  1S5L C;  1T33 A;  3RSN A;  3QYF A;  3G1O A;  2V6C A;  3WTX C;  3DXJ F;  4HA8 A;  1K83 J;  2TCT A;  4KIG A;  1ZYR F;  1UG2 A;  2DYS H;  1PUF B;  1XS9 A;  2L0K A;  4L0Y B;  5A2Q Z;  1WI9 A;  5FKN A;  4L0Z B;  1ETO A;  2IA1 A;  2A69 F;  1X1D A;  2YX7 A;  2RGV A;  4RLF A;  4G8X A;  4XLA A;  4I02 A;  5LEJ A;  2DOF A;  2K7L A;  2DT5 A;  1SFK A;  3P9C A;  4B43 A;  4DYC A;  4HF2 A;  4GDF A;  4JQF A;  1ETK A;  1FP1 D;  2LH9 A;  3F8M A;  3ERE D;  1H8A C;  3CJN A;  3LOC A;  2VE8 A;  1I6X A;  3A02 A;  4EJW A;  3S2H J;  5F64 A;  1DU6 A;  2L7K A;  3JRH A;  2F4M B;  3HDD A;  4I98 B;  4C30 A;  1FTZ A;  2EBI A;  4IHW A;  3L2R A;  4MQ9 F;  2JRM A;  3E5U A;  4JX6 A;  3OYB A;  2KIS A;  2QZ8 A;  1N78 A;  2HQA A;  3S17 J;  3FK7 A;  1D0X A;  2EIN H;  2X9D A;  3H9J A;  2FOW A;  3SXY A;  1T39 A;  4Q5S F;  1HA8 A;  2HU9 A;  2BOL A;  2IGN A;  4QWQ A;  2F6C A;  2PMH A;  4PDK A;  4GCV A;  3I58 A;  1TWC J;  1WRJ A;  1HXD A;  3NWS A;  3MAJ A;  3KYL A;  2EA2 A;  3I54 A;  1X1C A;  1UAA A;  2CV2 A;  1IRG A;  2CUZ A;  4EJT A;  4RGS A;  2HVS A;  2ISZ A;  3PO3 J;  1GV2 A;  1JKQ C;  4EV0 A;  2A5W A;  4GYI A;  4L9T A;  1AU7 A;  4D5F A;  4NC6 A;  3REO A;  5EEA A;  2M1B A;  4YIR X;  5ICF A;  4F55 A;  3BG7 A;  4XRM A;  3WE2 A;  4FE4 A;  1IF1 A;  5K7F A;  5D5W B;  4BNC A;  1IW7 F;  4FE7 A;  1IN5 A;  5AIQ A;  1HKT A;  2VBZ A;  4C3I J;  5DS9 A;  2OTL I;  4XLF A;  1YFH A;  1HDP A;  2P0W A;  2VQG A;  3I5U A;  2R5Y A;  2BVM A;  2EZK A;  1JJ6 C;  2ICW G;  3HZJ A;  1TW3 A;  1I39 A;  1FNN A;  1B8I A;  1YX5 A;  2ZXJ A;  3QOE A;  1YIT I;  1K4S A;  2DJI A;  2DA7 A;  1U8B A;  3NAR A;  3OYL A;  1IRX A;  2OCE A;  4R1H A;  3ROU A;  1OCP A;  2HI3 A;  2DA6 A;  3OYJ A;  3UKG A;  3VSL A;  3GEZ A;  2E2H J;  3TBI A;  5IP6 A;  2CV1 A;  3JAM Z;  4E7K A;  3CZ6 A;  5J8C A;  3K0L A;  1SD4 A;  2EV6 A;  1W5T A;  2K9N A;  3BRO A;  2GXG A;  2OQR A;  2Y9Y A;  4RGU A;  3DFG A;  3M07 A;  3UNG C;  4ZH4 F;  3ZR8 X;  3CLQ A;  3Q0U A;  2GA2 A;  4RMN A;  4AUX A;  1U5T A;  1P2F A;  4ETS A;  3WTT C;  1TQP A;  4KDP A;  4E6K G;  2Q2E A;  3ZCO A;  2DA4 A;  2EFN A;  1YRN B;  1RES A;  2XAU A;  3FX3 A;  4E7L A;  4MFD A;  1SMY F;  3BR2 A;  4HYE A;  1J0R A;  1S9H A;  3S1R J;  5EZH A;  3HKZ N;  1LFB A;  2FUG 2;  2BEO A;  3DBL B;  1MMG A;  1QZY A;  5J1U A;  2BZT A;  2NVQ J;  4LIT A;  3RZD J;  4RB1 A;  3VWB A;  3D5S C;  2VOO A;  2ZXW H;  4XQF A;  4RM3 A;  3E5X A;  4ESB A;  2F5E A;  4ENK A;  1R36 A;  2DMQ A;  1VF9 A;  2CRG A;  2LD5 A;  1ZTR A;  1G3Y A;  1OLT A;  2HOA A;  1W36 D;  4P5O A;  5M5Y J;  4D5C A;  5D8K B;  3BTI A;  2KZG A;  2OCC H;  4IHV A;  2VOP A;  2XB0 X;  2OC6 A;  3IAM 2;  3Q5F A;  4N4O B;  3C2G A;  4L18 B;  1IZ1 A;  2BBY A;  2LP0 A;  4IJA A;  1IG7 A;  2R7T A;  3HHH A;  4EQQ A;  1GVJ A;  4YG2 F;  2RDP A;  4NQW B;  4ZTF A;  3MKL A;  3DTK A;  3OYE A;  3ZN1 A;  2WAQ A;  3H5A A;  2HVQ A;  2IEK A;  3I53 A;  2X0L A;  3IKT A;  5JHU A;  4QLC U;  5D4S A;  3BTJ A;  1HW2 A;  1PP7 U;  2KZV A;  2VKD A;  2IS2 A;  1D8J A;  3HTU A;  5FRM A;  1BI1 A;  2Z16 A;  4HX4 A;  1RI7 A;  2UZK A;  3EYI A;  1D3Y A;  2L7M P;  3PSF A;  4V2F A;  3BR3 A;  2WWY A;  2IW5 A;  2Y69 H;  3GFI A;  3KP4 A;  2WA0 A;  4M3D A;  1ENH A;  1SFX A;  1G3W A;  3LSJ A;  2B7E A;  1SAN A;  4PZJ A;  2K9L A;  4L5I A;  2VB6 A;  2W4S A;  2XAS A;  3BT9 A;  4S04 A;  1MSE C;  4O5V A;  3JCU C;  5EDN A;  3E97 A;  1ZLJ A;  4I0A A;  1MDM A;  2DOD A;  2KJC A;  3F6V A;  3CO7 C;  2QSG X;  1X3W B;  3ESW B;  1T2K A;  2K4J A;  2CFX A;  2DMT A;  1X3U A;  2IPQ X;  5LGT A;  3NAU A;  5D8L B;  1ETV A;  1WJ5 A;  2VQH A;  2Y75 A;  4RA2 A;  2HQ5 A;  2GOM A;  1FY7 A;  5E1X A;  3I4N J;  3H3U A;  3W6V A;  4M6Y A;  4BQO A;  4EJU A;  1ZRC A;  4IQJ A;  4W97 A;  2NRA C;  3E6M A;  3CUQ A;  2ESH A;  1ZHF A;  2PG4 A;  3HRU A;  3AG4 H;  5EF6 A;  2VL8 A;  2BYV E;  1VQK I;  2VI6 A;  2QEX I;  2NS7 A;  1FP2 A;  3HOX J;  3SDB A;  1JUM A;  3GW2 A;  3KX2 A;  4FET A;  4YEJ A;  1WPK A;  1X3Z B;  2HR3 A;  2DFH A;  2CMP A;  2R7Q A;  5ED4 A;  1AKH A;  3G1L A;  2W82 A;  3BR0 A;  3OS1 A;  2W25 A;  5ILV A;  3CUQ C;  4B47 A;  4UHT A;  4PJ0 C;  1LDJ A;  4DIQ A;  1R23 A;  1XB4 A;  2VBW A;  3QOD A;  2NOJ B;  4RAZ A;  3CCE I;  2OUM A;  4WCG A;  4A3D J;  4LLN A;  2FML A;  2RV8 A;  2ZJP F;  4IEJ A;  5H6Q A;  3TL4 X;  2DQR A;  3F22 A;  2QM3 A;  1AHD P;  2VOD A;  5FFX A;  2V26 A;  3HPH A;  2CO5 A;  1J9I A;  4XN0 A;  4LJZ F;  5GTH C;  2M4G A;  4RGX A;  2L4M A;  2E60 A;  3KP5 A;  1BBY A;  2DMN A;  2JTV A;  5EEH A;  5A2Q K;  2GIZ A;  3WOD F;  2AQE A;  1OCC H;  3EUH C;  2MLG A;  2H6C A;  1EJ9 A;  3ZRG A;  4B48 A;  3AFH A;  3GTP J;  2QCO A;  1TP4 A;  4JYK A;  3OIO A;  4LMY A;  3DKY A;  5D6F A;  3VYS B;  1YX3 A;  2LVS A;  1Y0U A;  4HLY A;  3IHU A;  2DA2 A;  4G94 A;  1LVA A;  1WQ2 A;  4CGZ A; 
#chains in the Genus database with same CATH homology
 5ILU A;  2DU9 A;  2QQ9 A;  2L4A A;  3KP3 A;  3GUD A;  3OV8 A;  2D2W A;  1R1U A;  2HQN A;  2XUB A;  3KP2 A;  4L9V A;  3N97 A;  4KNY A;  2NAZ A;  3O3K A;  3QRF F;  3KFW X;  4ZZD A;  1R5G A;  1LQ1 A;  4FX0 A;  2XAF A;  4CYD A;  5E17 F;  5H20 A;  4KA4 A;  1KU3 A;  4RS8 A;  2DI3 A;  4KIB A;  4M9S A;  3ZN0 A;  4OMY A;  3Q9S A;  3CLO A;  3P9I A;  4YFX F;  4A6E A;  1EH7 A;  2V9V A;  2Z3Y A;  2VBY A;  2EB7 A;  1SD7 A;  2EFQ A;  1QBJ A;  1FT9 A;  3I4P A;  2OA4 A;  2G7H A;  2V1U A;  3QU6 A;  1R58 A;  2L01 A;  3CDH A;  1U8R A;  2PI0 A;  3S2W A;  4BHC A;  2M87 A;  4CZZ A;  4KYW A;  3BWG A;  4EM2 A;  1LNW A;  4EJO A;  3HTS B;  1T0F A;  3I59 B;  4ESJ A;  3R6S A;  5FD6 A;  4KN4 X;  3COA C;  4ENN A;  5CLS A;  4KMU X;  3V8K A;  2XV4 S;  5HS8 A;  3MQ0 A;  5BS6 A;  3LQQ A;  1W5S A;  4N9I A;  4GYG A;  4Z2Y A;  5ILS A;  2Y0M A;  3SZP A;  1UCR A;  2F5C A;  2Z99 A;  5DCM B;  2O03 A;  4CDG A;  2R7D A;  1JE8 A;  3KET A;  3HUG A;  4IRI A;  4HX8 A;  2VXZ A;  1ON2 A;  4JK1 X;  5K5Q A;  1J5Y A;  3F23 A;  4H0E A;  3V7R A;  2DW4 A;  2QWW A;  4G7O F;  2K02 A;  2DPU A;  3U1D A;  4U0V A;  4N9H A;  4DQ2 A;  2UXX A;  1XN7 A;  3ZPL A;  5E8I A;  2OU2 A;  3M1E A;  2UXN A;  2XHK A;  5J6X A;  1E17 A;  1BN5 A;  4ZYD A;  1A04 A;  1GXQ A;  4O3M A;  4GO1 A;  5FLX K;  1J75 A;  4UVA A;  4HDU A;  2A68 F;  1JXS A;  5FO5 A;  1CF7 B;  3M8F A;  2FSW A;  3QPT A;  4IPA A;  3J80 Z;  5L3B A;  1L0O C;  2L02 A;  3P7N A;  4OIR F;  4OIO F;  1ZRF A;  1DPU A;  4L9J A;  2FBH A;  3FXQ A;  2ETH A;  4EVI A;  2R3S A;  1SAX A;  2F5D A;  1R00 A;  3M8E A;  2Q0O A;  2MA3 A;  4OU0 A;  2CWE A;  1O3R A;  1MKM A;  4HDV A;  4Y15 A;  2GQQ A;  3VOD A;  2XKO A;  2G7U A;  3GVA A;  3RIR A;  1SFE A;  5LHH A;  2ISY A;  1TQM A;  1WWX A;  2Z9O A;  3ZMS A;  4RAY A;  4LFU A;  1D5V A;  3C18 A;  4KIC A;  2QQA A;  5FB2 A;  2FF4 A;  3EYY A;  2RVC A;  3LFK A;  1K6O A;  1XCV A;  1G6N A;  4EJV A;  3GLX A;  4WXD A;  3HSF A;  3RYP A;  4BHB A;  5DD4 A;  1RUO A;  2P7C B;  5KVR A;  3ECO A;  5L3C A;  3F21 A;  1YS6 A;  4FT8 A;  4OOI A;  2MLK A;  4DNC A;  2BE5 F;  2VT2 A;  2EV0 A;  1IXC A;  2WTE A;  2E7X A;  1BIB A;  5DD8 A;  3KZZ A;  3ELK A;  1ZG5 A;  2DK8 A;  2P6S A;  1IXR C;  1BM9 A;  2PJP A;  4A0X A;  4U88 A;  4LG0 B;  1L3L A;  4BAY A;  1O57 A;  4HLX A;  4EM0 B;  4M6X A;  2OQG A;  5CVR A;  2NYX A;  3MCZ A;  2D45 A;  2RNJ A;  3FHZ A;  2L3D A;  4A5N A;  4LLL A;  2P8T A;  3RI4 A;  2PQ8 A;  1VTN C;  3H3Z A;  3GZ5 A;  3ZMV A;  2GAU A;  2ZO4 A;  3RTR A;  4YFK F;  4LLG F;  1R1V A;  1FZP B;  3N4M A;  1JHH A;  3K2Z A;  1KQ9 A;  4NB5 A;  3C1D A;  2AS5 F;  1B6A A;  2EFO A;  5E1W A;  5EEG A;  2FBK A;  4YII A;  2ZNY A;  4B09 A;  1F1Z A;  4F7Z A;  2Q8K A;  1YLF A;  1Z1D A;  3J80 K;  2W24 A;  3PQK A;  4WX9 A;  5BPI A;  4IHT A;  2HTJ A;  5ICC A;  3ABT A;  4HW0 A;  3TO9 A;  4CXF A;  2ACJ A;  1KA8 A;  1IN4 A;  2O8X A;  2CW0 F;  1S8N A;  2JSC A;  4I0B A;  4ESF A;  5LBQ A;  4HZF A;  1FYL A;  5CJ9 A;  2ZME B;  2P5V A;  1J2X A;  1QO0 D;  6PAX A;  3LA7 A;  4G7Z F;  2ZCW A;  1FOK A;  4MNU A;  1YTY A;  2RN7 A;  4ZYG A;  4BQA A;  5HOO A;  5FGM A;  4LB6 B;  1ZG1 A;  4HF1 A;  3QP5 A;  2NNY A;  1HW1 A;  1U2W A;  3MWM A;  4BYY A;  4Q4Z F;  1U3E M;  1HQC A;  2MD5 A;  3G3Z A;  3F3X A;  3R61 A;  2E1C A;  4M9X A;  2XAJ A;  3HSE A;  1V4R A;  2KRF A;  2M8E A;  5AON A;  1R22 A;  3K1P A;  1U5T C;  2P6T A;  5BPD A;  5HS7 A;  4ASN A;  3D5L A;  1RIO H;  4WXH A;  2YSR A;  1LEA A;  4YFN F;  3CO6 C;  5LGU A;  3BJ6 A;  3ABU A;  3R4K A;  3BPX A;  4CO8 A;  2A61 A;  2QQB A;  2JT1 A;  3L7W A;  2QVO A;  3W6K B;  4IHS A;  5J8F A;  4RB3 C;  3DEU A;  1BC8 C;  5HDN A;  2DPD A;  3GFM A;  2HQR A;  1TNS A;  1J59 A;  2FRH A;  4G6Q A;  2EFW A;  3L9F A;  3BP8 A;  1KQ0 A;  2DBB A;  4UVB A;  1YG2 A;  5E18 F;  1KYZ A;  1KU2 A;  1DP7 P;  2JPB A;  3GF2 A;  1XD7 A;  4IRH A;  1FYM A;  4ON0 A;  3IRQ A;  4GGG A;  2K86 A;  5CVJ A;  5BMZ A;  1KGS A;  1XGS A;  2VC1 A;  3Q9V A;  1MGT A;  5FD5 A;  2A3S A;  5L3D A;  4MTE A;  1TQI A;  5HLH A;  3TO6 A;  4TV7 A;  1I5Z A;  1UFM A;  1FBS A;  4ZZL A;  1OYY A;  1TLH B;  1W7P B;  2XAQ A;  2IVM A;  3EET A;  1IXS B;  3C3W A;  1I1G A;  1Z91 A;  2CYY A;  3RDI A;  2KIM A;  3VB2 A;  1FBQ A;  1K78 B;  4OIN F;  3EDP A;  4LK1 F;  3K1M A;  2HOE A;  1T98 A;  5DYM A;  1YIO A;  3J7A O;  3F8N A;  2IA2 A;  5E8G A;  3FXR A;  3G73 A;  1PUE E;  2BV6 A;  1RZ4 A;  2FXA A;  3WGH A;  1K78 A;  1CGP A;  3FZV A;  4KT5 C;  4KIF A;  4IF4 A;  1DUX C;  1PP8 F;  2HS5 A;  1STZ A;  2X4H A;  3FM3 A;  4S05 A;  4IVN A;  4M72 A;  2MH2 A;  3E3V A;  1Z9C A;  2J5O A;  2YX4 A;  4G7H F;  3RYR A;  2DK5 A;  1CF7 A;  2HEO A;  2A6H F;  5IT3 A;  4G9Y A;  2F5F A;  1WSU A;  1BOA A;  1IRF A;  2FE3 A;  4MHG A;  1AWC A;  1S6L A;  3ML6 A;  2M5W A;  5D5X B;  2D1H A;  4U0Y A;  1XDS A;  2FA5 A;  2W57 A;  4M73 A;  4HV5 A;  5LHG A;  2O6G E;  1QNT A;  1QQI A;  1E2X A;  3RKY A;  3ZMZ A;  2YPR A;  1SD6 A;  2PN6 A;  1YS7 A;  4XLN F;  1OYW A;  3CUQ B;  4HV6 A;  1IN7 A;  3QAH A;  2QBY B;  5TRD A;  3PQJ A;  2HZT A;  3EUH A;  4NQW A;  3ZP5 A;  1ZG3 A;  1P4W A;  4K2E A;  3GXO A;  1ZRE A;  2STT A;  3ECH A;  1FC3 A;  3FXU A;  2QLZ A;  3QU3 A;  3IWF A;  2P5L C;  2V1X A;  4MGR A;  2H09 A;  2FNP A;  3TQN A;  1ZAO A;  1ZRD A;  3LAJ A;  3GFJ A;  1F4K A;  4Y13 A;  5CVV A;  4A0Y A;  2A07 F;  2H27 A;  2Z5U A;  3WGI A;  1XSX A;  2KJB A;  5LRR A;  3WTV C;  3K9T A;  2J5P A;  4RB0 A;  3F8B A;  3KZY A;  1TBX A;  5IT9 K;  1HKQ A;  3IRR A;  1Z6R A;  4HOB A;  2OBP A;  3U2R A;  3O2P E;  1G4D A;  3EQL F;  1HST A;  1LDD A;  3DF8 A;  3RPU A;  4ENJ A;  2C6Y A;  1RUN A;  2XKP A;  3FMQ A;  1J7K A;  3TKY A;  3B02 A;  4PCQ A;  1S7O A;  2E7W A;  1R7J A;  4BH9 A;  1JGS A;  5LRS A;  3LA2 A;  4B8X A;  4A6D A;  1EH8 A;  4LK0 F;  3KE2 A;  4I09 A;  2YR2 A;  2Y48 A;  4Y17 A;  4AIJ A;  5BQT A;  1P4X A;  1R1T A;  2HYG D;  4EM1 A;  2VN2 A;  1DDN A;  1YQA A;  3BDD A;  2YU3 A;  4XSZ F;  3V7C A;  2KKO A;  2VC0 A;  5D5V B;  1TW2 A;  3FMS A;  3BZ6 A;  4LD5 A;  1ZGJ A;  1Z05 A;  2DFI A;  3FM5 A;  5CVU A;  1NHA A;  2VT3 A;  3TO7 A;  3TDU C;  3TOA A;  5L3E A;  1XSV A;  3IWZ A;  1KYW A;  2JZY A;  2XRN A;  3L2C A;  1B1B A;  3K69 A;  4AD9 A;  3VEP A;  3U9G A;  3M7G A;  4I2O A;  4WF2 A;  2LF8 A;  1LB2 A;  1C0W A;  3FWE A;  2HYF A;  5HS9 A;  1FPQ A;  2P7V B;  2FU4 A;  4P96 A;  2UWM A;  5JFR A;  3SFZ A;  4UNO A;  5HDK A;  3T8R A;  1JHF A;  1LEB A;  3BJA A;  3LA3 A;  1OKR A;  2GZW A;  3F8F A;  1QGP A;  5LLQ A;  5JI6 A;  1XDU A;  1LJ9 A;  1YW9 A;  2BGC A;  5CYV A;  5ICG A;  3E6B A;  1UHM A;  3GFL A;  2ELH A;  2HKO A;  4EGZ A;  2A5Y B;  2LF7 A;  3DQV C;  3KEO A;  5KK1 A;  4AVP A;  1RNL A;  3I71 A;  2NNN A;  2IT0 A;  1KU9 A;  3ZMT A;  2GXB A;  3MEX A;  3C7J A;  2QYO A;  4IXA A;  4ZYE A;  1PDN C;  3I64 A;  2F2E A;  1AOY A;  1SFU A;  1G3T A;  3BOQ A;  5DCM A;  3LQR A;  2QEN A;  2PEX A;  5D6E A;  5ICE A;  2DTR A;  3GWZ A;  2ZKZ A;  3VOE A;  2IP2 A;  1OR7 A;  4LGW A;  4FX4 A;  2GIV A;  2CQK A;  2CG4 A;  2OZ6 A;  3QOP A;  1B9N A;  3E6D A;  4CIC A;  1GXP A;  4WWC A;  4XBF A;  2PFB A;  3HYI A;  3RKX A;  4EGY A;  1DPR A;  1USS A;  1K7A A;  1ULY A;  1WKM A;  3MZY A;  4M71 A;  4AIH A;  4FHT A;  2B0L A;  3WE3 A;  2EK5 A;  3HIF A;  2PLY A;  3KLN A;  5DEQ A;  4WK8 F;  1UHW A;  1O3S A;  4KMF A;  2XAG A;  1TTY A;  2STW A;  2D1V A;  2HFH A;  4M9Z A;  1IN8 A;  5L3G A;  2COM A;  3T1B A;  1BC7 C;  3HRM A;  3WG9 A;  5JVT A;  2PBI A;  4L9N A;  3JAM K;  3WTS C;  3T0Y A;  1P4A A;  4ZYH A;  2XVC A;  2L54 A;  2KIF A;  2LDU A;  3WGG A;  3E6C C;  1W4M A;  4CHU A;  4Q47 A;  2DO7 A;  2O0Y A;  2ZJ2 A;  3JTH A;  3WU0 A;  5E1Z B;  1MJ9 A;  3AAF A;  1D8K A;  4YIF A;  3HHG A;  2FEZ A;  3V8J A;  5ERI A;  2NS0 A;  4N0B A;  1REP C;  3DPT A;  5HVQ C;  5DDG A;  2MH9 A;  5D4R A;  3PFI A;  1HBX G;  1Z6T A;  1MJA A;  3F72 A;  1FX7 A;  3I0T A;  1MD0 A;  4OIP F;  1B59 A;  5K5R A;  4R79 A;  2GA1 A;  4IRG A;  1O7L A;  2QUF A;  2OZU A;  1U78 A;  2RC4 A;  3V8L A;  4U7D A;  1SD5 A;  2RKH A;  2CGP A;  1S29 A;  2EFP A;  1ZLK A;  3KLO A;  5JR3 A;  4HBL A;  1XMK A;  3KP7 A;  1OMI A;  1O3Q A;  2H6B A;  1T6S A;  1U6G A;  1FLI A;  3FMR A;  2O61 A;  4MEY F;  2ZNZ A;  3LWF A;  4HF0 A;  1XCB A;  3W6J B;  3IKV A;  1H0M A;  1EH6 A;  4I01 A;  5HDG A;  2HWV A;  2V1D A;  1F9N A;  2H94 A;  3F8C A;  2IRF G;  2M30 A;  3TOB A;  1XGN A;  3ISP A;  4U7B A;  2Z33 A;  4MTD A;  1OYI A;  1B9M A;  3JTG A;  4WXC A;  3ZMD A;  5F6F A;  1IAW A;  1Z7U A;  1YO5 C;  5CVI A;  1ZGA A;  3HSR A;  1G3S A;  1O7F A;  1MJB A;  4A0Z A;  3KP6 A;  1Q1H A;  4KN7 X;  3CUO A;  2A6E F;  4HQE A;  5H6R A;  3GYH X;  1ODD A;  4L5J A;  3RKW A;  1MDM B;  2MC3 A;  1ON1 A;  4U0W A;  1R5H A;  4P9U A;  3T8T A;  2KIU A;  1HW5 A;  3E5Q A;  2W84 A;  2AXL A;  4LB5 A;  4UUV A;  3O6B B;  1V3F A;  5FLX Z;  2FMY A;  3SQN A;  3ZQ7 A;  1BIA A;  1FSH A;  4HQM A;  2FBI A;  1MZB A;  3DP7 A;  1EV7 A;  2V79 A;  4RGR A;  1SMT A;  2IJL A;  2DAO A;  1UST A;  1U5T B;  2GWR A;  3QP6 A;  2XIG A;  5DV5 A;  4BXU A;  1IUY A;  5DCF A;  4NHJ A;  4MQV A;  5D5U B;  3ZMU A;  2W85 A;  3GX4 X;  2HDC A;  2LNB A;  4HX7 A;  3MFK A;  1HKS A;  2TDX A;  3KCC A;  2O3F A;  1XSD A;  3CTA A;  3LAP A;  1ZH5 A;  2E1N A;  5E20 A;  3K1N A;  2OD5 A;  2LSO A;  3WTZ A;  5L3F A;  3D0S A;  4PGG A;  2VE9 A;  4OMZ A;  2OAZ A;  4P9F A;  2VBX A;  1FSE A;  4KUM A;  3RPQ A;  4AWX B;  4LG0 A;  2K4B A;  2CSO A;  5DUK A;  3J81 K;  4MEX F;  4ENM A;  2JRT A;  2EWN A;  3WTU C;  3VFZ A;  1ZN2 A;  4A12 A;  1H9G A;  2PMU A;  2R7F A;  1B4A A;  4E70 A;  5LHI A;  4UV8 A;  1BI2 A;  3DKW A;  3R0J A;  2DLL A;  5IT9 Z;  3GO5 A;  2G9W A;  2XAH A;  4HAM A;  1ONV A;  3JSP A;  2M45 A;  3R0A A;  4RB2 C;  4XSX F;  1FWZ A;  4I7H A;  4M74 A;  3B73 A;  1I27 A;  3KEQ A;  5K5O A;  3L00 A;  1S3J A;  4KFC A;  1XGO A;  1KU7 A;  3TGN A;  1HSJ A;  4D0P A;  1FYK A;  3RJP A;  5AIP A;  4UVC A;  1I1S A;  3BPV A;  1UB9 A;  3WTY C;  4OIQ F;  3H92 A;  2FOK A;  3M9A A;  3J81 Z;  5HLG A;  2XGX A;  1BI0 A;  3JW4 A;  2HTS A;  1W7P D;  1XMA A;  1BJA A;  1TNT A;  3SHF A;  1P92 A;  2P5K A;  4EMS A;  5BOX A;  3HRS A;  4A5M A;  2IA0 A;  5K1Y A;  2LKP A;  2WC2 A;  4O6J A;  5FFZ A;  2QBY A;  1H9T A;  2ZFW A;  2JPC A;  3DPL C;  3NRV A;  3FF5 A;  2ESN A;  3P9K A;  5DUI A;  4A2U A;  3HRT A;  4R8H A;  3DV8 A;  3F6O A;  2HKX A;  4Q48 A;  4UV9 A;  4PGH A;  3WU1 B;  2P4W A;  1P6R A;  1ZAR A;  5TJJ A;  4XLP F;  3L09 A;  1K79 A;  2FNA A;  1LDK B;  2EV5 A;  1YYV A;  3HOS A;  5HLI A;  3IL2 A;  2EA4 A;  1YW8 A;  1S7A A;  1YW7 A;  1KQ8 A;  3NQO A;  4UXN A;  3ULQ B;  3TDZ C;  1OPC A;  3R60 A;  3MZH A;  2WV0 A;  2ZME A;  2VON A;  3SZT A;  4G6D A;  1W7P A;  1GHC A;  2K27 A;  1IN6 A;  1F5T A;  2DQL A;  3OOP A;  4GXO A;  2FQ3 A;  2XRO A;  2HGC A;  1T38 A;  1QZZ A;  1BI3 A;  3LST A;  4AIK A;  1QPM A;  2EJR A;  2ZBK A;  2RQP A;  3V7S A;  1O3T A;  3JSO A;  5F1R A;  3IC7 A;  3HOT A;  3GZ6 A;  4P55 A;  1XGM A;  4JBA A;  4XRF A;  4BHP A;  2MBF A;  3T5X A;  5LEK A;  3BY6 A;  5LGN A;  3BJO A;  2ADU A;  3NEU A;  3I59 A;  1FBU A;  3V4G A;  3WTW C;  3QPH A;  2V6C A;  3WTX C;  3DXJ F;  4HA8 A;  4KIG A;  1ZYR F;  4L0Y B;  5A2Q Z;  1WI9 A;  4L0Z B;  2IA1 A;  2A69 F;  2YX7 A;  2RGV A;  4G8X A;  4I02 A;  5LEJ A;  2K7L A;  2DT5 A;  3P9C A;  4HF2 A;  4JQF A;  3F8M A;  1FP1 D;  3ERE D;  3CJN A;  2VE8 A;  1I6X A;  4EJW A;  5F64 A;  4I98 B;  4MQ9 F;  3E5U A;  2QZ8 A;  3SXY A;  1T39 A;  4Q5S F;  4QWQ A;  2PMH A;  4PDK A;  4GCV A;  3I58 A;  1WRJ A;  1HXD A;  3MAJ A;  2EA2 A;  3I54 A;  1IRG A;  4EJT A;  4RGS A;  2ISZ A;  4EV0 A;  4GYI A;  4L9T A;  3REO A;  2M1B A;  5ICF A;  3WE2 A;  1IF1 A;  5D5W B;  4BNC A;  1IW7 F;  1IN5 A;  5AIQ A;  1HKT A;  2VBZ A;  1YFH A;  3I5U A;  1TW3 A;  1FNN A;  2ZXJ A;  4R1H A;  3ROU A;  3GEZ A;  3JAM Z;  5J8C A;  3K0L A;  1SD4 A;  2EV6 A;  1W5T A;  3BRO A;  2GXG A;  2OQR A;  4RGU A;  3DFG A;  4ZH4 F;  2GA2 A;  1U5T A;  1P2F A;  4ETS A;  3WTT C;  1TQP A;  4KDP A;  2Q2E A;  2EFN A;  3FX3 A;  1SMY F;  4HYE A;  1J0R A;  2BEO A;  1QZY A;  4RB1 A;  2VOO A;  3E5X A;  4ESB A;  2F5E A;  4ENK A;  1R36 A;  1G3Y A;  4P5O A;  5D8K B;  2VOP A;  3Q5F A;  4L18 B;  1IZ1 A;  2BBY A;  4IJA A;  3HHH A;  4EQQ A;  1GVJ A;  4YG2 F;  2RDP A;  3ZN1 A;  3I53 A;  2X0L A;  3IKT A;  5JHU A;  4QLC U;  5D4S A;  1HW2 A;  1PP7 U;  1D8J A;  3HTU A;  1BI1 A;  4HX4 A;  1RI7 A;  2UZK A;  3EYI A;  1D3Y A;  2WWY A;  2IW5 A;  3GFI A;  3KP4 A;  1SFX A;  1G3W A;  4PZJ A;  4L5I A;  2XAS A;  4S04 A;  4O5V A;  3E97 A;  1ZLJ A;  4I0A A;  1MDM A;  2KJC A;  3F6V A;  3CO7 C;  1T2K A;  2K4J A;  2CFX A;  1X3U A;  2IPQ X;  5LGT A;  5D8L B;  2Y75 A;  1FY7 A;  5E1X A;  3H3U A;  4M6Y A;  4EJU A;  1ZRC A;  2NRA C;  3E6M A;  3CUQ A;  2ESH A;  1ZHF A;  2PG4 A;  3HRU A;  2BYV E;  1FP2 A;  3GW2 A;  2HR3 A;  5ED4 A;  2W25 A;  5ILV A;  3CUQ C;  4UHT A;  1LDJ A;  1R23 A;  1XB4 A;  2VBW A;  4RAZ A;  4WCG A;  4LLN A;  2FML A;  2RV8 A;  5H6Q A;  2DQR A;  3F22 A;  2QM3 A;  2VOD A;  5FFX A;  2CO5 A;  1J9I A;  4LJZ F;  4RGX A;  2L4M A;  3KP5 A;  1BBY A;  2JTV A;  5EEH A;  5A2Q K;  3WOD F;  2MLG A;  2H6C A;  4LMY A;  5D6F A;  1Y0U A;  4HLY A;  3IHU A;  4G94 A;  1LVA A;  1WQ2 A;  4CGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...