4ON0A

Crystal structure of nolr from sinorhizobium fredii in complex with oligo aa dna
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
97
structure length
97
Chain Sequence
QPLSPEKHEEAEIAAGFLSAMANPKRLLILDSLVKEEMAVGALANKVGLSQSALSQHLSKLRAQNLVSTRRDAQTIYYSSSSDSVMKILGALSEIYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NolR
publication title Structural basis for regulation of rhizobial nodulation and symbiosis gene expression by the regulatory protein NolR.
pubmed doi rcsb
source organism Sinorhizobium fredii
molecule tags Transcription/dna
total genus 31
structure length 97
sequence length 97
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4on0A00
1X3UA 4U0VA 4IXAA 1TQMA 1KYZA 3CUOA 4HA8A 1K6OA 3T5XA 3HTSB 2HQNA 1PDNC 1FSHA 1J5YA 2D45A 3TKYA 1PUEE 2Y75A 1R7JA 1R5HA 5A2QK 4RGRA 2QM3A 2QQ9A 2KJBA 1KU3A 4NB5A 3KEOA 3V8KA 1YG2A 5DCMB 3ZMSA 1P4WA 4HDVA 1J9IA 1MJBA 2JTVA 2VOOA 1QZYA 1ON2A 2IP2A 3FZVA 5D8KB 1U5TB 1HQCA 3ULQB 2WTEA 4KICA 2EWNA 1ZHFA 2G7HA 2MBFA 2ZCWA 4A6DA 3M8FA 2TDXA 1WRJA 3EUHA 4A2UA 2GXGA 1FLIA 5DCFA 1XGOA 4M9SA 4EM1A 4L0YB 3QU3A 2VT3A 1C0WA 4GCVA 1MZBA 5HS7A 1H9GA 1O3QA 3V7RA 1OKRA 3F8BA 4ZZLA 3IL2A 2CQKA 1W5TA 4O5VA 3F8FA 3V4GA 1RUNA 4LJZF 3E5UA 3P9IA 5E20A 1QNTA 2L4MA 5LGTA 2F5DA 4B09A 3I59B 1S7OA 1B9NA 4RAYA 3GVAA 1T38A 3DEUA 1DDNA 1BBYA 3L9FA 3HRUA 5HOOA 3J81Z 3ECOA 1UFMA 2HEOA 2DPDA 2IRFG 4MHGA 1XCVA 1BC8C 3RKYA 3W6KB 2STWA 1E17A 4CYDA 1ZRDA 2ESHA 3F22A 2K02A 1RI7A 5DV5A 3DPTA 1BIBA 4EMSA 1FBSA 1YTYA 1FPQA 2MC3A 2V9VA 1BI2A 2DLLA 2HZTA 2YU3A 2COMA 2HTJA 1P92A 2DQRA 4G7OF 3KZZA 1FNNA 2QUFA 4RB3C 5JVTA 5K1YA 3IWFA 1EV7A 2OQGA 3WU1B 4HW0A 1R23A 1XMAA 1G3WA 2J5OA 4LB5A 1SD5A 1OYWA 3CDHA 1R1TA 3K9TA 2M5WA 5CVIA 4AIJA 5L3EA 3QP6A 1GXPA 4BHCA 5HS9A 1SAXA 3DPLC 3BROA 1Z7UA 3CO7C 2K7LA 1MGTA 3M8EA 1MJ9A 1SMTA 4OIOF 5BQTA 2HWVA 1XB4A 4OIRF 3VODA 1G3YA 4YIFA 4JBAA 4LLGF 3FHZA 3Q9SA 3E6DA 1FT9A 4YFXF 4G8XA 2HKXA 4WCGA 4OINF 5FGMA 3I0TA 3J81K 1GVJA 2DI3A 5DEQA 3BDDA 2ZJ2A 1SD4A 1SFUA 5J8CA 1IF1A 3BWGA 2W25A 2ZXJA 1Z9CA 1TW3A 4XBFA 1U5TC 2H94A 2PI0A 1BC7C 2FNAA 2GXBA 3J80Z 5D8LB 4UV9A 2XAQA 4L9VA 3GUDA 2G9WA 5HVQC 3I54A 4Q4ZF 2Q0OA 4M9XA 2VOPA 4AD9A 3FXRA 2IA0A 4BH9A 4A0XA 1FBQA 2O03A 3TQNA 1O3TA 2LF8A 4WWCA 3AAFA 2STTA 2CYYA 4M73A 4LG0B 1FC3A 2NNYA 4N9IA 2MA3A 1FP2A 5ERIA 1CF7A 2L01A 2EFQA 2RV8A 4QWQA 3DV8A 2HYGD 3COAC 4IRGA 3R61A 5HS8A 2K27A 4H0EA 5CVUA 2R3SA 1MD0A 2LKPA 2DT5A 1G3TA 5TRDA 2EA2A 2BV6A 3KP7A 1G4DA 3RIRA 2V6CA 2K86A 2ZMEB 2P4WA 3Q5FA 4JK1X 4NHJA 1B4AA 1TQIA 4UHTA 3R0JA 3HHHA 1FY7A 3U9GA 2Q8KA 1W7PD 2CW0F 3SZTA 2EV0A 4OIPF 1G6NA 5KVRA 3PQJA 2EA4A 1F4KA 3LQRA 5LHIA 4HV5A 2MD5A 3SFZA 1ON1A 1K78B 3GEZA 1QO0D 4HBLA 1T2KA 3BPXA 4ENMA 2P6SA 1YW9A 2PQ8A 1BJAA 2O3FA 3E6CC 5LGUA 4A5MA 5EEGA 2QQBA 3QU6A 1ZARA 4EGYA 1QBJA 1FYLA 3J80K 2JT1A 3IWZA 3O3KA 3SQNA 4ZYDA 1J75A 4HLXA 1BN5A 3P7NA 2XVCA 5LEKA 1P4AA 3IKTA 5D5XB 4L9JA 2BBYA 4I01A 5DYMA 4F7ZA 1S3JA 2GZWA 2VC1A 2JPCA 3EQLF 1V3FA 4WXDA 1U6GA 5E1ZB 2J5PA 5FD6A 2A5YB 1FBUA 1R1UA 3BP8A 2ZNZA 1HXDA 3HSEA 2MH9A 3F23A 1RUOA 1BIAA 3QOPA 4RGUA 1XGMA 3TOAA 3EYYA 3MFKA 1Z6TA 5FFZA 2OBPA 1LVAA 2ISZA 4OMZA 4L5IA 3TO6A 2HS5A 1Q1HA 1KQ0A 4L5JA 2ELHA 4IHSA 5BPDA 5LGNA 2JRTA 3I71A 3JSOA 3ZN0A 1O7FA 4TV7A 4KN4X 1IN6A 1LDDA 1ZLJA 4ZH4F 3WTUC 4EJUA 4BYYA 1FZPB 5EEHA 2AXLA 1SFEA 2RDPA 2KIMA 3GF2A 4BHBA 4XLPF 1RNLA 1YIOA 3SXYA 3I5UA 2EV5A 4LMYA 4MQ9F 3K2ZA 3F8CA 5E1WA 3RPUA 5CVJA 2M8EA 1FYKA 4P5OA 3SZPA 3V8JA 3KE2A 3R0AA 2L54A 3WU0A 1HBXG 5E8IA 2DAOA 4ENNA 2V1DA 2XIGA 2BYVE 3O2PE 4UNOA 3ZP5A 4I98B 2FBHA 3HRSA 3C7JA 2X0LA 1W7PA 2QQAA 5CLSA 4KT5C 1XD7A 2RN7A 4Z2YA 5L3FA 3GLXA 4OMYA 2ZO4A 1Y0UA 5HLIA 5HLGA 2ETHA 4GGGA 4HX8A 1ZLKA 5AIQA 3GZ6A 1F9NA 3HYIA 1MKMA 1IW7F 2XV4S 3MCZA 5E8GA 2OZUA 3BJOA 3G73A 2E1NA 3RJPA 1MDMA 2H09A 4KYWA 3L00A 4L9NA 3TGNA 2L02A 1IXCA 2K4BA 1ZG3A 2VXZA 4EJTA 4MTDA 3F6OA 1ZREA 4M9ZA 2QZ8A 4E70A 2QBYB 5LHGA 3WGHA 3N4MA 4YFNF 3HSRA 3GYHX 6PAXA 1ZAOA 4IF4A 4LLLA 2O8XA 1XSXA 4LK0F 2OU2A 4EV0A 4ESBA 3QRFF 3DFGA 1MJAA 2EFNA 3F72A 1W5SA 4M71A 3OOPA 2XHKA 2DFIA 4HF1A 2E7WA 4CXFA 4Q5SF 4BQAA 2PFBA 2Z3YA 3VB2A 3Q9VA 4M74A 5IT3A 3L09A 3C18A 2R7FA 4DNCA 3WGIA 4R79A 2BE5F 4A0YA 2A69F 5ILUA 1H9TA 2OD5A 4RB1A 1KU7A 2HQRA 3IHUA 3FM5A 3ZMTA 1OPCA 1JXSA 3MZHA 4LGWA 4UXNA 3KFWX 4L9TA 1JGSA 3CUQB 1RIOH 2NYXA 3HUGA 3V7SA 2ZNYA 1UHWA 2CSOA 2EFPA 4N9HA 2GAUA 3E97A 3GFMA 4EM0B 3FXQA 1TLHB 5D6FA 1HKTA 1GHCA 3T1BA 2VBYA 1ZYRF 2H6CA 3EETA 2Z99A 2IPQX 2FSWA 4Q48A 5HLHA 3P9KA 4O3MA 1U78A 3D0SA 2A07F 2KKOA 1D5VA 5D5VB 4XSZF 3I4PA 1LEAA 1R58A 2M87A 1WSUA 3KP5A 1FP1D 4ETSA 3MAJA 3TO9A 4P96A 4YFKF 4EVIA 3FXUA 1YW8A 4EM2A 4HYEA 1SMYF 2HR3A 1FWZA 5H20A 3K1NA 3M1EA 3R60A 2XKOA 3LAPA 4IRHA 3BOQA 1XSDA 1R22A 5LRSA 1TNSA 4IVNA 2FOKA 5LLQA 1FX7A 1WKMA 2XKPA 1HKQA 3N97A 1S29A 2ISYA 5DUKA 5TJJA 3GX4X 1KA8A 1S6LA 5DCMA 3FWEA 3H3ZA 3CJNA 2FQ3A 4G7HF 3L2CA 1REPC 3R6SA 2QVOA 4D0PA 2WWYA 2MLKA 2RQPA 4BXUA 1XMKA 5BMZA 4I0AA 3PQKA 5D5WB 3V8LA 5F1RA 2KRFA 3LAJA 5F64A 1T6SA 1YQAA 1U5TA 2CWEA 4M6XA 2UWMA 4HX7A 2DBBA 3LA2A 4R1HA 4UVBA 2WC2A 3RPQA 1AWCA 3W6JB 5LEJA 3T8TA 4KNYA 5FFXA 3ERED 4RB2C 3NQOA 3WTWC 3WTZA 1BM9A 4L18B 3RI4A 4LD5A 4PZJA 3O6BB 3BPVA 2VBZA 5CJ9A 2CGPA 3B73A 2XRNA 5AONA 4P55A 3VFZA 2XAGA 1BI0A 4BAYA 2Z33A 4HF2A 3VOEA 2D1VA 4G6DA 1ZN2A 5D4SA 2YSRA 1K79A 1XGSA 3EYIA 3HTUA 1Z1DA 3I59A 3LSTA 4EJOA 2FEZA 3G3ZA 4A6EA 1GXQA 4KIGA 2L3DA 5L3BA 1S7AA 1KQ9A 1YLFA 2RC4A 3BZ6A 4FX0A 4XSXF 2YR2A 4AIKA 4YIIA 3ZMDA 2XAFA 1CGPA 2YX7A 4S04A 1HSTA 2QYOA 1LQ1A 3DP7A 1FYMA 2DK8A 2D1HA 3FF5A 4RS8A 1IN4A 5FO5A 2PEXA 1IRFA 1XSVA 4G94A 4XLNF 2NAZA 3WG9A 1O7LA 1LDKB 3ZMUA 1A04A 1IUYA 1U3EM 2Z9OA 4ON0A 3M7GA 2FA5A 2XAJA 1YFHA 3WE3A 1KU2A 1ZGAA 1J59A 2XGXA 2WV0A 1IXSB 3ROUA 2M45A 4QLCU 5LBQA 3JTHA 3WTTC 1BI1A 3C3WA 2M1BA 2W85A 4CO8A 2C6YA 1IN5A 3ZMVA 4KIBA 3BJAA 2FE3A 3NEUA 2LF7A 1KGSA 1J7KA 4U0WA 4CICA 3MZYA 1P4XA 3KLNA 4AWXB 5ICGA 4FX4A 1TQPA 2E1CA 4WXHA 4P9FA 2LNBA 3GW2A 3HRMA 2MH2A 3QAHA 4P9UA 2KIUA 2IVMA 2RVCA 4BNCA 2HGCA 2GIVA 2B0LA 3GWZA 2XASA 2Z5UA 3CTAA 4IPAA 5F6FA 1SD7A 2NRAC 2VE8A 5CVRA 1LNWA 1XDSA 4HX4A 3K1MA 3F21A 3FMRA 3REOA 1KU9A 2YX4A 3TDZC 1XDUA 1USTA 3LWFA 3OV8A 3QPHA 4RAZA 5ICFA 3HSFA 3IKVA 3ABTA 5ILVA 4LFUA 1VTNC 1HW5A 2FNPA 4ASNA 2GA1A 2F5CA 3BY6A 2ADUA 1LEBA 4OOIA 2AS5F 1WI9A 3IRRA 3ZPLA 4CZZA 1ODDA 2G7UA 4LG0A 3JTGA 3M9AA 3K69A 2H6BA 3WTSC 1QZZA 3FMSA 5DD8A 3S2WA 4WF2A 1I6XA 4KUMA 3L7WA 5E1XA 2L4AA 2QWWA 2A6HF 4YG2F 3TO7A 2NS0A 2W84A 4ESFA 5FB2A 3U1DA 2UXXA 1LB2A 5J6XA 2DW4A 2D2WA 2JSCA 2V1XA 4MNUA 2DTRA 4AVPA 2HFHA 1BI3A 2ZKZA 1D8JA 4I7HA 4U88A 2EK5A 1K7AA 2UXNA 3KP3A 2IT0A 4UUVA 3JAMZ 1S8NA 3SHFA 4GXOA 3EDPA 2ZMEA 5L3DA 5CYVA 1TBXA 4LK1F 1ZRCA 1J0RA 2VC0A 3E5XA 2O6GE 2HKOA 5H6QA 2DK5A 5FLXZ 1ONVA 3FMQA 2UZKA 2KJCA 3MEXA 4IHTA 5L3GA 1T98A 4JQFA 3F6VA 3F8NA 3GO5A 2P7CB 1K78A 2ACJA 3P9CA 2RNJA 2W57A 3KZYA 2IA2A 1ZG1A 4EJWA 5H6RA 2PBIA 3MQ0A 1UHMA 3ISPA 3QP5A 2EFWA 1ZRFA 1ZH5A 3HRTA 3I64A 4L0ZB 2LSOA 4FHTA 1IN8A 3NRVA 2IJLA 1HKSA 3HOTA 2O61A 4BHPA 3F3XA 1DPRA 4MQVA 3JSPA 3FM3A 2HYFA 1P2FA 2DO7A 3LFKA 4DQ2A 2ZFWA 4A0ZA 2P5KA 1CF7B 4ZYHA 3IC7A 1DPUA 4HLYA 2V79A 3LA7A 4WXCA 5BPIA 2F2EA 2DPUA 2VODA 1FSEA 2VONA 4KDPA 3WGGA 3QPTA 1B59A 4KN7X 4ZZDA 4G6QA 2P5VA 5L3CA 2HDCA 4PGGA 5HDNA 1LJ9A 2XROA 3D5LA 1B1BA 2JZYA 2V1UA 4IJAA 2FF4A 1R5GA 4HZFA 5AIPA 4OIQF 1BOAA 1I5ZA 1D8KA 2IA1A 2K4JA 1I1SA 3E6BA 1T39A 1Z6RA 3JAMK 3ZMZA 4R8HA 4Y15A 3TOBA 1B9MA 3R4KA 3TDUC 1Z05A 3I58A 2LDUA 1O3SA 1ZGJA 4I09A 3DKWA 3KEQA 5FLXK 5J8FA 3GXOA 4K2EA 3K1PA 1WWXA 2PMHA 3ZN1A 1OMIA 1OYYA 3BJ6A 1DUXC 3WTYC 1Z91A 3VEPA 5HDGA 1QPMA 2FBIA 1JE8A 2Y48A 1E2XA 1G3SA 4HQMA 2P6TA 1XGNA 5E18F 1KQ8A 5CVVA 3U2RA 2EFOA 1SFXA 4G7ZF 2E7XA 4AIHA 4FT8A 4I0BA 3LA3A 4GYGA 4MGRA 3F8MA 4M6YA 4S05A 1IAWA 4U7BA 3DQVC 2OAZA 3MWMA 5IT9Z 3RYRA 2OQRA 4HV6A 1RZ4A 1O57A 2KIFA 5K5RA 1TNTA 3E6MA 2GA2A 4B8XA 1O3RA 4KIFA 1FOKA 3V7CA 1ULYA 2P5LC 3ABUA 3T0YA 2FBKA 4G9YA 1AOYA 1TW2A 2BGCA 4LB6B 4IRIA 1UCRA 4KMUX 5KK1A 1F5TA 1IN7A 5K5OA 4U7DA 2FXAA 4CDGA 1U8RA 4WK8F 2QBYA 4A12A 5ICCA 2A68F 2O0YA 1YS7A 4HAMA 1ZG5A 3GZ5A 1L3LA 3FX3A 3HOSA 2GWRA 1I1GA 5BOXA 1XCBA 2ZBKA 2HTSA 4CGZA 1IZ1A 4EJVA 2MLGA 2VT2A 3B02A 4A5NA 3KLOA 2GQQA 3HHGA 2DU9A 3KP4A 4MEYF 2PJPA 3LQQA 1W7PB 1IXRC 2EB7A 5D6EA 2CFXA 4GO1A 1R00A 1HSJA 3WODF 2P7VB 4ENJA 1OR7A 3CLOA 5LRRA 3C1DA 4GYIA 3ELKA 5FD5A 3KP6A 5D4RA 4RGXA 4RGSA 2HOEA 1IRGA 2NNNA 4RB0A 3CUQC 5ED4A 1DP7P 2VBXA 3H92A 2A61A 1MDMB 5IT9K 1R36A 3CUQA 5BS6A 2PG4A 2FU4A 1H0MA 4XRFA 4U0YA 4PDKA 3CO6C 3ML6A 4MTEA 5DD4A 5JI6A 4HOBA 2RGVA 1YW7A 1J2XA 2OZ6A 1OYIA 2P8TA 5JFRA 2BEOA 1QQIA 4NQWA 2YPRA 1YYVA 2XUBA 4MEXF 1L0OC 2QLZA 4KA4A 1YO5C 1D3YA 5JHUA 2PN6A 4ENKA 2M30A 4PCQA 2VE9A 2Q2EA 4KFCA 1T0FA 5JR3A 3DF8A 2F5EA 4EGZA 3RKXA 3KETA 2PMUA 2XAHA 1U2WA 2W24A 2A3SA 4HF0A 2CO5A 4Q47A 2OA4A 4EQQA 3I53A 1STZA 2FRHA 4N0BA 4HDUA 1V4RA 3WTXC 5ILSA 1EH8A 4ZYGA 3HIFA 3GFIA 3KP2A 5LHHA 2DQLA 3E3VA 1WQ2A 1JHHA 3IRQA 5A2QZ 1SD6A 5ICEA 1KYWA 5HDKA 4PGHA 1NHAA 2Y0MA 2JPBA 1HW2A 3WTVC 4Y13A 4I2OA 2EJRA 1PP7U 2PLYA 1HW1A 3RDIA 2VBWA 2FMLA 3JW4A 1XN7A 1PP8F 5D5UB 5K5QA 2H27A 4KMFA 1YS6A 4HQEA 1JHFA 4OU0A 1QGPA 1TTYA 2F5FA 2QENA 2VN2A 1I27A 3H3UA 2ESNA 5DDGA 1EH6A 3KCCA 2FMYA 4UV8A 3ECHA 4UVCA 4M72A 1F1ZA 3RYPA 2CG4A 1LDJA 4ESJA 4CHUA 4Y17A 1R1VA 4LLNA 1UB9A 3GFLA 1W4MA 3T8RA 3RKWA 3PFIA 1B6AA 2R7DA 4O6JA 2RKHA 2X4HA 4I02A 3E5QA 4UVAA 2EV6A 2IW5A 3WE2A 3J7AO 1EH7A 3ZQ7A 3K0LA 3DXJF 3RTRA 4ZYEA 4WX9A 1P6RA 3GFJA 1USSA 5E17F 5DUIA 2A6EF
chains in the Genus database with same CATH superfamily
1X3UA 3RQIA 3LNQA 4E7ZA 4U0VA 4IXAA 1TQMA 1KYZA 3CUOA 4HA8A 4BQQA 1JT0A 1K6OA 3T5XA 1R4MB 4NBQA 4YEJA 3HTSB 3BR0A 2E34A 2HQNA 1PDNC 1FSHA 3L2WA 2R7OA 1J5YA 1TWFJ 1DGWY 2D45A 3K10A 4DOZA 2W4SA 3ONQA 1WZ2A 3TKYA 1UG0A 3MKZA 1PUEE 2ZB9A 4MO7A 2Y75A 1R7JA 1R5HA 5A2QK 3RSNA 2YS9A 4RGRA 2QM3A 5B66C 2QQ9A 2KJBA 1KU3A 4NB5A 3LSJA 3KEOA 4RA2A 5E3NA 1HCRA 1K4TA 3NWTA 3V8KA 2IS1A 1YG2A 5DCMB 3ZMSA 4AYBA 5E3OA 1QHHD 2HDDA 1P4WA 1VI0A 4HDVA 1ZKGA 2DMUA 4PJLA 1RKWA 1J9IA 5DM6F 1MJBA 2HQAA 2IGOA 2JTVA 1LFPA 1UELB 1QZYA 2VOOA 2E71A 2HQ5A 1ON2A 4PJ0C 2CFOA 1QZEA 1AA7A 2IP2A 2BY1A 5B1BH 2IBDA 3FZVA 5D8KB 1U5TB 1HQCA 3ULQB 2HXOA 2WTEA 4KICA 2EWNA 1ZHFA 3DLLF 1JI8A 2G7HA 2MBFA 2VPRA 2ZCWA 3L2UA 4A6DA 3M8FA 2TDXA 3ZQGA 1WRJA 3EUHA 1T33A 4A2UA 4QPQA 2GXGA 1FLIA 2VI6A 5DCFA 1PUFB 2E36A 2Z16A 1YJ9I 4BXFA 1XGOA 4IX7A 2OF7A 3LSGA 3MVPA 4M9SA 4EM1A 1MBKA 3ABKH 1R5ID 2KFDA 3BG3A 3S1NJ 4L0YB 1NK3P 3F0CA 3QU3A 2VT3A 4HNVA 1C0WA 4GCVA 3FK6A 1MZBA 3H1CA 2E2HJ 5HS7A 2KDZA 1H9GA 1O3QA 4DYRA 3V7RA 1OKRA 1H88C 3F8BA 4ZZLA 1AKHB 1DU0A 3IL2A 2CQKA 2HZDA 1W5TA 4O5VA 3F8FA 4DJAA 3OYMA 3V4GA 1RUNA 4LJZF 5B3SH 3HOVJ 1SFOJ 3I3LA 1X2NA 2GOMA 4JX5A 2E5NA 3OMYA 3E5UA 3P9IA 2VJ4A 5EG0A 3PNTA 4E7IA 5E20A 3BCAA 4X0GA 3H9JA 4GDFA 1QNTA 3S1MJ 2Y30A 3S14J 4BY7J 4IOCF 2L4MA 2KZVA 3AL0B 1ZR4A 5LGTA 2I8DA 2F5DA 4B09A 3I59B 1S7OA 1HF0A 1B9NA 5J3LA 4RAYA 9ANTA 3VYSB 4XN0A 1D0ZA 2JVGA 3GVAA 1T38A 3DEUA 2JUCA 1DDNA 1BBYA 2HVSA 3L9FA 3HRUA 5HOOA 1POGA 3J81Z 3ECOA 1IG7A 1UFMA 4DW6A 1Z3YA 3DWLE 5J4YA 2DPDA 2HEOA 2IRFG 3CF5F 1BR4A 4MHGA 2VASA 1D1AA 1XCVA 1BC8C 4D7MA 3RKYA 4FASD 5M3MJ 1R4NB 4NC8A 1Q1VA 3W6KB 2STWA 3QYFA 3GTKJ 2VQGA 1OCPA 4CYDA 1E17A 4XLAA 2NOGA 1ZRDA 2ESHA 3QYEA 3F22A 2CQXA 2K02A 4HNUA 2HVRA 1RI7A 5CPRB 3DBRB 2EPFA 3JCUC 3BTLA 3LMMA 2QCOA 5DV5A 3DPTA 1BIBA 4EMSA 3F9KA 2GXAA 1FBSA 1YTYA 5BNGA 1FPQA 2MC3A 2E35A 2IGMA 2V9VA 1BI2A 2DLLA 2HZTA 3EPZA 3OYDA 2YU3A 3K4JA 1X4OA 2COMA 2HTJA 2DOEA 1P92A 1FEXA 2DQRA 2OTJI 2FX0A 4G7OF 4UB6C 3KZZA 4A3DJ 2H8WA 4P1WA 3KX2A 1FNNA 2QUFA 4RB3C 5JVTA 5K1YA 3IWFA 1EV7A 2OQGA 1E3OC 3WU1B 4HW0A 1Y6IA 1R23A 1XMAA 1G3WA 2F4OB 2J5OA 4LB5A 4D9JA 2NOJB 4PK4A 2E19A 3FXJA 1SD5A 1OYWA 4F92B 3CDHA 2DT7B 1R1TA 3J7ZI 3K9TA 2M5WA 5CVIA 3JR9A 5L3EA 4AIJA 3QP6A 4D5FA 4BHCA 1GXPA 5HS9A 3A2KA 1LE8A 3L1PA 1SAXA 3DPLC 5GP9A 2Y69H 3UKGA 3BROA 1FTTA 1Z7UA 3CO7C 2K7LA 3A02A 4CCLA 1MGTA 2JSPA 3M8EA 1RESA 4BDYA 1MNMC 1MJ9A 5EYRA 1SMTA 2X6OA 1FOYA 4IQJA 1X58A 3QQAA 4OIOF 4XL9A 5F0HA 4GFBA 5BQTA 2XPUA 2HWVA 1XB4A 2DXIA 2R93J 3I4NJ 1RC9A 4OIRF 3VODA 2KT0A 4A3BJ 3PNYA 3PNVA 5CKTA 1G3YA 4YIFA 4JBAA 4LLGF 3FHZA 1JKOC 3Q9SA 1E0EA 3E6DA 1FT9A 3CDIA 4YFXF 2KP6A 5JHFA 4G8XA 5GAGJ 3PO3J 2HKXA 4RBOA 1FOWA 2R5ZB 4DZPA 2ZSIB 3S1RJ 2QEXI 4WCGA 4OINF 5FGMA 3DTIA 4B44A 2IGNA 3I0TA 3J81K 1OFCX 2K3PA 3IH2A 1GVJA 5GAHJ 4KISA 1NH3A 2DI3A 5DEQA 3BDDA 2ZJ2A 4X6AJ 5EZGA 1SD4A 2WAEA 4RM2A 4BBRJ 5J8CA 2DA6A 3OSGA 1SFUA 1K83J 1IF1A 1BW6A 3BWGA 1QA6A 2XSJC 2VQLA 4CCNA 2W25A 2ZXJA 1Z9CA 1TW3A 4XBFA 1U5TC 2H94A 2PI0A 3GLLA 1BC7C 3BR5A 2FNAA 2GXBA 1NG7A 3J80Z 5D8LB 4UV9A 3CESA 1UHSA 1MBJA 2XAQA 1S9HA 3V42A 5IYCJ 1RRJA 4L9VA 3GUDA 2G9WA 3A0BC 1LKXA 5HVQC 3I54A 4HSTA 4Q4ZF 2AXTC 2Q0OA 4M9XA 2VOPA 4DBRA 3SJMA 2E5ZA 2QF7A 3L2QA 3J7YJ 4AD9A 1A31A 4BL0B 3FXRA 1D1BA 2IA0A 1BR1A 4A0XA 4BH9A 2LKXA 1FBQA 2M4KA 2L5QA 2O03A 3TQNA 1O3TA 1I6HJ 1I50J 3HGGA 3ZQFA 2LF8A 2KHMA 3TP0A 4WWCA 3AAFA 2STTA 2CYYA 4M73A 3H5NA 4LG0B 1FC3A 3PIPF 1Z3XA 5JLWA 3H5RA 1GV5A 1ETVA 2NNYA 4N9IA 2MA3A 4FE4A 3IUOA 1FP2A 3FXKA 3LSKA 3OIOA 4XLEA 5ERIA 4BE0A 1CF7A 4A3LJ 2L01A 1YHQI 4AM3A 2Y9ZA 4BXXJ 2EFQA 2RV8A 1NK2P 4QWQA 3ZGKA 3DV8A 2HYGD 2CS3A 3COAC 4IRGA 2EZLA 3R61A 3A4CA 1YJWI 5HS8A 1MBEA 2K27A 4XR6A 1OLTA 4H0EA 3H9QA 3JREA 1ETWA 1LFBA 4HG2A 5CVUA 2R3SA 1MD0A 2LKPA 4V2FA 1G3TA 5TRDA 2EA2A 1XMXA 2BV6A 4XNFA 3LSPA 1ETKA 2HOTA 3KP7A 1G4DA 2VQHA 2L9SA 3RIRA 2V6CA 4M3GA 3G1MA 3H5AA 5J47A 1WCMJ 2K86A 2ZMEB 5K7FA 2P4WA 3Q5FA 4MLOA 4JK1X 2XGCA 2XRLA 1YRNA 4A3CJ 4NHJA 1B4AA 1TQIA 4UHTA 2HOAA 3R0JA 3FBNB 3HHHA 4C9YA 4A93J 1FY7A 2HPMA 3U9GA 2Q8KA 2V9KA 2MYSA 3JRCA 1B72B 4RLQA 1YI2I 1W7PD 4I76A 2CW0F 4XOTA 2CQNA 3RQ4A 3SZTA 2EV0A 3GMEA 4OIPF 1G6NA 5KVRA 2I10A 3PQJA 2EA4A 1F4KA 3LQRA 5LHIA 4HV5A 1G8XA 2MD5A 3SFZA 1ON1A 1K4SA 1K78B 3GEZA 1QO0D 4HBLA 3W2WA 1T2KA 3BPXA 4A69C 4ENMA 2P6SA 4IL6C 1YW9A 2PQ8A 2WBMA 1BJAA 2O3FA 3JRFA 3E6CC 1FTZA 5LGUA 2LBFA 3TMOA 4V19K 2KDOA 2NXNB 3SDGA 2QQBA 3QU6A 3DBHB 1ZARA 5EEGA 4A5MA 4EGYA 1QBJA 2KPMA 1FYLA 3J80K 1DGRM 2JT1A 4KJZA 1JGGA 3IWZA 3O3KA 2DMQA 3SQNA 4ZYDA 1J75A 4UUSB 4HLXA 1ETXA 1BN5A 2WY7Q 3P7NA 2XVCA 3PL8A 4UUTA 5LEKA 3CCUI 1P4AA 4C30A 5D5XB 3IKTA 1WJAA 4L9JA 4A3EJ 2BBYA 2ELJA 4I01A 5DYMA 4B43A 4F7ZA 1S3JA 2GZWA 2VC1A 3CLQA 2JPCA 3EQLF 2PMZN 1V3FA 2EINH 4WXDA 4AIDA 1R6RA 3BG7A 1U6GA 2ME0A 1HA8A 1OISA 3AG1H 1X3WB 3CMYA 5E1ZB 3OYJA 2J5PA 1ZK8A 5FD6A 4II3A 2JJ7A 5TISC 2A5YB 1FBUA 2QKMB 1R1UA 3BP8A 2ZNZA 1HXDA 4DGWB 3HSEA 1WJFA 2MH9A 4M6VA 3F23A 1RUOA 1BIAA 3PUFA 3QOPA 4RGUA 1PVEA 3VYUB 4XICA 5EG0B 1SC7A 2RREA 1XGMA 4BBSJ 3TOAA 1X1DA 2DYRH 1Y1VJ 3EYYA 2W82A 3QOEA 3Q3SA 3MFKA 1Z6TA 5FFZA 4A3GJ 3BR6A 3CJQB 2OBPA 2P81A 3PJRA 1LVAA 2ISZA 4OMZA 4X1EA 4L5IA 3TO6A 2HS5A 1Q1HA 1KQ0A 3DLAA 4L5JA 2ELHA 2AQEA 4IHSA 1FMVA 2CH0A 2JA6J 5BPDA 3X2QH 3AG4H 2JRTA 5LGNA 3I71A 4IOAF 3JSOA 1N77A 3ZN0A 1AHDP 1O7FA 2UV1A 3S32A 3WG7H 4MIMA 1FIAA 5IYBJ 4TV7A 2HNHA 2M7BA 2O5RA 1X4PA 4IKFA 2HPIA 3ZQLA 4KN4X 1IN6A 3CCEI 2GOXB 4W1UA 1LDDA 1ZLJA 4ZH4F 3DTKA 3WTUC 4ANJA 5IP9J 2A5WA 4EJUA 4BYYA 1FZPB 5EEHA 3VYRB 2AXLA 1JJ8C 1SFEA 1Z67A 2RDPA 3BCBA 4BY1J 3A01B 1KZHA 2KIMA 3GF2A 3KYDB 4XRSG 4BHBA 4LIUA 2LG4A 4XLPF 5M3FJ 3HDDA 1RNLA 3ERMA 3M8JA 2R7QA 1YIOA 1WH7A 3SXYA 3I5UA 2EV5A 4LMYA 4MQ9F 1Z0XA 2CW8A 3F8CA 3K2ZA 3JRGA 3NARA 5FLMJ 3OYKA 1MH3A 5E1WA 2JWTA 3RPUA 5CVJA 2M8EA 1FYKA 2WY8Q 4ZDLA 4E7SA 3HOYJ 4P5OA 1D0YA 3SZPA 2VXDA 3K4BA 3V8JA 3KE2A 1IRXA 3R0AA 2L54A 4IHVA 3SYTA 3WU0A 5GTIC 1HBXG 3W2AA 4A3KJ 5E8IA 2DAOA 2O9LA 4ENNA 2V1DA 1G2HA 2XIGA 3OYHA 3OY9A 2BYVE 3O2PE 5GAEJ 4UNOA 1MBHA 3ZP5A 4ZTFA 4G12A 4I98B 2KL4A 4CYCB 1DP3A 1SANA 2FBHA 3HRSA 1MBGA 2PJRB 2EIMH 3C7JA 3DEWA 1S72I 3DKXA 2X0LA 1W7PA 5EGOA 3D1NI 2ZFUA 1GV2A 1BA5A 2QQAA 2LKSA 2XPWA 5CLSA 3FISA 5JLXA 4KT5C 2K5CA 1XD7A 3WHCA 2RN7A 3S15J 4Z2YA 5F0FA 5L3FA 3GLXA 2X9DA 4OMYA 2ZO4A 3GTJJ 2K40A 3OYBA 2WV1A 2DA1A 4HRIA 1Y0UA 5HLIA 5HLGA 2EIKH 2ETHA 2B9SA 4GGGA 4HX8A 1ZLKA 1B8IB 5AIQA 3GZ6A 2R7TA 4F3QA 3CCLI 1F9NA 3PM1A 3ZRGA 3HYIA 3GTOJ 1MKMA 1IW7F 2XV4S 3MCZA 5E8GA 2OZUA 2BXZA 2KMUA 3BJOA 3ABLH 3G73A 2E1NA 3RJPA 2OTLI 4PJNA 2ZMEC 1MDMA 2H09A 4KYWA 5EEAA 5C4XJ 2ECCA 1LFUP 3L00A 4L9NA 2R7ZJ 5FKOA 3TGNA 4PJJA 2L02A 1IXCA 1Y0NA 2K4BA 4ZTJA 1ZG3A 2VXZA 2H1LA 3ESWB 3K7AJ 4EJTA 4MTDA 1JKPC 2CV1A 4D5CA 3F6OA 1ZREA 2DFHA 4M9ZA 2M3AA 5GPAA 4HNTA 2L7KA 1H8AC 2QZ8A 4E70A 1JTYA 2QBYB 3ZQHA 2XF6A 1ENHA 5LHGA 3WGHA 3N4MA 2V1NA 3PSFA 4M3DA 4YFNF 3L2VA 3HSRA 2LMDA 3GYHX 6PAXA 1ZAOA 2CU7A 4IF4A 3E7LA 2DTZA 3EUAA 1IGNA 4LLLA 1IUFA 2O8XA 5IYDJ 2WADA 1XSXA 3JRBA 4LK0F 1MMDA 2CQ7A 5HODA 2OU2A 4EV0A 3ASOH 4ESBA 4QIWN 2VKHA 3VWBA 2LC2A 2L9NA 3QRFF 3DFGA 2KLOA 1MJAA 4PFPA 2EFNA 3F72A 1W5SA 4M71A 4CA0A 3OOPA 1P7IA 2VJIA 1N25A 1YX5A 4C3HJ 2XHKA 2DFIA 5JVGF 4HF1A 3FXLA 3C2GA 1MNEA 1ZTRA 2K9SA 4OAYA 2E7WA 1EKEA 4CXFA 3CC2I 1NTCA 4Q5SF 2OCEA 4BQAA 2ZXIA 4RAGA 2PFBA 2Z3YA 3HXLA 3VB2A 4QSHA 1T8IA 3Q9VA 4M74A 5KCMA 3L09A 5IT3A 3C18A 1J09A 4F93B 4DIQA 2R7FA 4DNCA 3WGIA 1IV6A 3A0HC 2DOFA 2R5YB 4R79A 2BE5F 2RQQA 2NVUB 1HC8A 3B6CA 4PJMA 2BW3B 2A69F 4A0YA 5ILUA 4XRSA 3IV5A 1H9TA 2OD5A 4RB1A 3M4OJ 2X6XA 4BJ5C 2HQRA 3CJRB 4BEHB 3E0JB 1KU7A 3IHUA 3FM5A 2BHZA 3ZMTA 1OPCA 1JXSA 4HSRA 3K6GA 2VKEA 3MZHA 4LGWA 4UXNA 4H4KC 3BQZA 3HB9A 3OS0A 2R7UA 3DPUA 3S1QJ 2DJIA 2DA7A 3KFWX 4L9TA 1WJEA 1JGSA 3CUQB 1RIOH 2H8RA 2NYXA 3HUGA 4CUGA 3TL4X 3V7SA 4NUBA 1K61A 5IOZA 2ZNYA 1UHWA 2CSOA 3HGYA 3H0GJ 1AU7A 2EFPA 3DTEA 4N9HA 2GAUA 2JK3A 3E97A 2JUGA 2ELKA 3GFMA 2W48A 3FKIJ 4EM0B 3FXQA 1WH5A 5J1RA 4FTHA 1VZ0A 1TLHB 4A3FJ 3SEZA 5D6FA 3G4SI 5J40A 3A03A 1OJLA 3CQZJ 1HKTA 1GHCA 3T1BA 4NQWB 2VBYA 1ZYRF 2H6CA 2VB6A 5EJCA 2IGKA 2QSFX 3EETA 4AC0A 5E79C 2Z99A 2BZTA 2IPQX 1IO2A 4FCYA 4ITVA 1WFXA 1X2MA 2EZKA 1V5EA 3PIOF 2FSWA 4BJTA 4Q48A 3W6VA 5HLHA 3P9KA 4O3MA 1U78A 1VFCA 3D0SA 3FBIB 2A07F 2KKOA 1D5VA 3I56I 2R7SA 5D5VB 4XSZF 4BS9A 1ETQA 1EJ9A 2L9RA 3I4PA 2Q2EB 1LEAA 1R58A 1V54H 2M87A 1WSUA 1T08B 5GTHC 3KP5A 5FKLA 1FP1D 5LD2C 4ETSA 4XRMA 2L9VA 3MAJA 3OYFA 1QVTA 3TO9A 4P96A 1MIJA 4YFKF 3FKJA 4EVIA 3H9GA 3FXUA 3FXOA 2GBYA 4XLFA 1YW8A 2XPVA 4EM2A 2ECBA 2JN6A 4HYEA 1SMYF 2HR3A 2XC7A 3H0DA 1FWZA 1JKQC 4XKBA 5H20A 2MSYA 3K1NA 2XDVA 1UG2A 3M1EA 2V7FA 3R60A 2XKOA 4UB8C 3LAPA 1SVMA 4IRHA 3BOQA 3K2AA 4F91B 3JRIA 2JQ7A 4J00A 4RDUA 3HPHA 1R71A 3CMAI 1XSDA 3BR1A 1R22A 1Y8QB 5LRSA 1TNSA 4Z6YA 4IVNA 5K7ZA 4D1QA 2WAQN 2FOKA 4JX4A 1PJRA 4B4CA 5LLQA 4I99C 1F43A 1FX7A 2W00A 1WKMA 2XKPA 1HKQA 3PUBA 3FDYA 4A3IJ 3N97A 1S29A 1WI3A 3U21A 2ISYA 5DUKA 1QRYA 3TW7A 5TJJA 3GX4X 5DS9A 1KA8A 1S6LA 4E7LA 5DCMA 3FWEA 3H3ZA 3GTPJ 2DN0A 1HOMA 2G0EA 2DFFA 3I9V2 3CJNA 3K4MA 1UAAA 2M8GX 2FQ3A 4G7HF 3G1LA 2XGEA 2HXIA 3L2CA 1REPC 3R6SA 2QVOA 4AUXA 3N05A 4D0PA 2WWYA 2MLKA 2RQPA 4BXUA 1XMKA 1SVOA 4XLHA 5BMZA 4I0AA 3PQKA 5D5WB 3MZ8A 3V8LA 4CCKA 5F1RA 2V6EA 1I3AA 2KRFA 3LAJA 3DKYA 3CDLA 3WU2C 2MFZA 5F64A 1T6SA 1YQAA 1U5TA 4G6TB 2K3FA 2CWEA 4NDLA 4M6XA 1GDTA 2UWMA 4HX7A 2DBBA 3LA2A 4PSXA 4R1HA 4UVBA 2WC2A 3RPQA 2AHQA 1AWCA 3W6JB 5LEJA 1PUFA 3T8TA 3W2VA 1VF9A 1O4XA 4KNYA 1FMWA 2QKLB 2DT6A 4S0HB 4EEFG 5IP7J 5FFXA 4BJ6C 3ERED 2E60A 4RB2C 3NQOA 3WTWC 3WTZA 3K4KA 1BM9A 4QTRA 4L18B 5J4VA 3RI4A 3CP8A 1IDZA 1MW7A 2DA4A 2CUJA 5KNLA 2LY1A 4LD5A 4PZJA 3O6BB 4F55A 3BPVA 4B48A 2LY2A 3S93A 3OS2A 2LREA 2VBZA 3D5SC 3NAUA 1XTAA 1Y8RB 1IDYA 5CJ9A 2CGPA 3B73A 2X1CA 1JTXA 1WHUA 2XRNA 1WGXA 5F27A 3SDBA 5AONA 1VQKI 1SAUA 1QHGA 4P55A 3OIQA 3VFZA 2XAGA 1BI0A 4BAYA 3S3NA 3HBLA 4Y3OA 3AL0C 5J1UA 2L7MP 2Z33A 4HF2A 3OR2C 1DU6A 3VOEA 3GTMJ 3S3MA 5KAFC 2D1VA 4G6DA 2LLKA 5FROA 4D7NA 1ZN2A 2R4GA 5D4SA 3J7AY 2MC4A 3FIWA 3GZNB 2YSRA 1K79A 1ETOA 3RCOA 1XGSA 3EYIA 3HTUA 4B3AA 5FKNA 1Z1DA 3I59A 3LSTA 2L7FP 2D5VA 3HM5A 2DMNA 4EJOA 2FEZA 4E7HA 3G3ZA 4A6EA 2DA2A 1GXQA 4KIGA 1V5FA 2VKDA 1W36D 2L3DA 3KEYA 5L3BA 4B3XA 1GUUA 2PMZA 1S7AA 1KQ9A 2IS2A 1YLFA 2RC4A 3BZ6A 4FX0A 1SFKA 2CRGA 2DMTA 4XSXF 2YR2A 5B1AH 4AIKA 4YIIA 1IJWC 3BG5A 1S7EA 4V2GA 3ZMDA 3ZOBA 2XAFA 1CGPA 2YX7A 4S04A 1HSTA 2QYOA 1LQ1A 3DP7A 1FYMA 1QPIA 2QGUA 2NVQJ 2PX9A 5HNFA 2A05A 3IP4B 2DK8A 2D1HA 3FF5A 4RS8A 2DMPA 1IN4A 5FO5A 2PEXA 1IRFA 1XSVA 2ZJQF 4G94A 4XLNF 1R9TJ 2NAZA 3WG9A 2DODA 1O7LA 2EZHA 1LDKB 3ZMUA 1A04A 3L2RA 1IUYA 5E3LA 5F1JA 3GTQJ 2BVLA 1U3EM 2Z9OA 4ON0A 3M7GA 2FA5A 4BQOA 2XAJA 3CCQI 1T0FC 3VSKA 3WE3A 4Y33A 2AO9A 1YFHA 2IS6A 1KU2A 1ZGAA 3JRAA 1J59A 2XGXA 2WV0A 3KPHA 2IS4A 1IXSB 3ROUA 2HVQA 2M45A 4ZYAA 4QLCU 3TW6A 2BY2A 3CCJI 5LBQA 1ZR2A 2ZXHA 2Y0SN 3DEEA 5FKMA 2JA5J 2K9NA 3JTHA 1N75A 3WTTC 1BI1A 3C3WA 2M1BA 2W85A 4CO8A 5K7HA 4JX6A 1IN5A 2C6YA 3ZMVA 3ABMH 5B5EC 1X1CA 2ICWG 4KIBA 3BJAA 3G1OA 2FE3A 3AFHA 3NEUA 2K9LA 2LF7A 1KGSA 1J7KA 2RNGA 2O8KA 2JVHA 4U0WA 3BTJA 1W0TA 2VQCA 2H1KA 4CICA 2OUMA 1P4XA 3MZYA 2K9QA 1VQLI 3S2HJ 1XPXA 2LD5A 3BLYA 3KLNA 2VPLA 2XAUA 3A1YA 4AWXB 5ICGA 3ZCOA 4FX4A 1TQPA 1G59A 2E1CA 4PFOA 4XMYA 2GLOA 4WXHA 4U87A 1VQNI 4P9FA 5M5WJ 3BZCA 2LNBA 3GW2A 3S8PA 3HRMA 2E1OA 2DDAA 2MH2A 2FQ4A 3QAHA 4P9UA 2KIUA 2IVMA 3HOWJ 2RVCA 1ACIA 4BNCA 2HGCA 4IHWA 2FD5A 2GIVA 3CCYA 2UUZA 2B0LA 3GWZA 3G6EI 2XASA 2Z5UA 3CTAA 4IPAA 5F6FA 1SD7A 3DU5A 2NRAC 2VE8A 1VQ9I 3S2DJ 1GVDA 2HDWA 5CVRA 2LY9A 1LNWA 1XDSA 3IH4A 2R5ZA 4E4HA 1TL8A 1XS9A 3GBGA 3HUGB 4HX4A 5HLTA 3K1MA 3F21A 3CCVI 4C3IJ 3ZR8X 3H3VK 3FMRA 4C2UA 2DJNA 3REOA 1KU9A 2YX4A 3IH3A 3TDZC 1XDUA 2LFBA 1ETYA 1USTA 3BTCA 3LWFA 3HJEA 3OV8A 2XF5A 3QPHA 1NG6A 1MMSA 1N78A 2IXSA 2NVXJ 2YU9J 4RAZA 3FXMA 4XORA 3KIOA 4BGDA 2X48A 3AKZA 3TBIA 3Q0WA 5ICFA 5M5XJ 1GT0C 2NS7A 3HSFA 3IKVA 3ABTA 4Y7NJ 5ILVA 3CF2A 3GTLJ 4LFUA 5DTDA 3S3OA 1UMQA 1A5JA 1VTNC 4XQFA 1HW5A 2FNPA 4ASNA 1MSEC 3TEDA 1W36C 2GIZA 2GA1A 2F5CA 3BY6A 1U9NA 1TC3C 4ZC3A 2M9HA 2DFEA 3OYCA 3MMYB 2ADUA 3P5JA 1LEBA 3MN2A 4OOIA 2AS5F 2F4IA 1WI9A 2M0CA 3IRRA 3ZPLA 4CZZA 3AG3H 2X6YA 1ODDA 2G7UA 4LG0A 5M5YJ 2L7ZA 3TP3A 3JTGA 3M9AA 2O7OA 3K69A 2H6BA 3WTSC 1QZZA 3FMSA 5DD8A 3S2WA 4WF2A 1I6XA 5FJ8J 5GPCA 1TT5B 4KUMA 3DU6A 2R0QC 1LE8B 3L7WA 5E1XA 3ZQIA 2L4AA 2JRMA 1YIJI 2QWWA 4XKCA 2A6HF 2LRDA 4YG2F 4BU2A 3TO7A 2NS0A 2W84A 4ESFA 1T95A 5FB2A 3U1DA 2UXXA 1LB2A 1S5LC 2VUMJ 5J6XA 2DW4A 5F0CA 2WB1N 3HKZN 4N4OB 3NWSA 1P9QC 2QSGX 2D2WA 2JSCA 2V1XA 4MNUA 2DTRA 4AVPA 4E7JA 1ZQ3P 2HFHA 3C2HA 5EZHA 3K70D 1BI3A 1MNDA 2ZKZA 3OYGA 1MBFA 2ZXWH 1D8JA 1KONA 4I7HA 4U88A 2CMPA 2EK5A 1K7AA 5IY5H 2KISA 2UXNA 3KP3A 2IT0A 4UUVA 3BR3A 3JAMZ 1S8NA 3SHFA 4GXOA 2EILH 4ABZA 3FHNA 3EDPA 4XLCA 1T56A 2ZMEA 5L3DA 4M3BA 3CMMA 5CYVA 5DM7F 3HEFA 2OJED 1TBXA 4LK1F 4DYCA 1ZRCA 2ZJPF 1J0RA 2VC0A 3E5XA 2HU9A 2O6GE 2HKOA 3SEQA 1VQ8I 5H6QA 2DK5A 5J1YA 5FLXZ 1ONVA 3FMQA 1B72A 2X51A 3H36A 2UZKA 2KJCA 2M7AA 3MEXA 4IHTA 5L3GA 1T98A 4J19A 1LUJB 2ZJRF 1I39A 3K4LA 4JQFA 2V9PA 1BJZA 1Z21A 3KYCB 1E3HA 3F6VA 4RMNA 2LR8A 1P7JA 2LVSA 4IHXA 2DCEA 3F8NA 3EUHC 3GO5A 2P7CB 1K78A 2ACJA 4XK4A 3P9CA 2RNJA 4HEA2 2W57A 3KZYA 1VQMI 1VQ7I 2IA2A 2M2EA 1ZG1A 2E2IJ 4EJWA 1TZLA 5IPAA 5H6RA 3ZQCA 1EA3A 2PBIA 2VIXA 3HOUJ 3MQ0A 4E6KG 1UHMA 2JMWA 3ISPA 3PO2J 3QP5A 2EFWA 4MFDA 1ZRFA 3G71I 4UUSA 1ZH5A 3HRTA 3I64A 4L0ZB 2LSOA 4FHTA 1IN8A 1A6QA 3NRVA 2M4GA 4KT6A 2IJLA 4AYBN 1HKSA 3HOTA 1OQYA 2CUEA 1BOBA 4BHPA 3F3XA 2O61A 1DPRA 4Y4RA 1E3PA 3ZQQA 4MQVA 5LFAA 3JSPA 2X6WA 4CCOA 3FM3A 2HYFA 1D5YA 1P2FA 2DO7A 3LFKA 4DQ2A 2ZFWA 4A0ZA 2P5KA 1CF7B 4F52A 1PYVA 2OV7A 4ZYHA 1JUPA 3IC7A 5EDNA 4BE2A 1RPWA 4HLYA 1JUMA 2EZIA 2V79A 1DPUA 3LA7A 2IAIA 4WXCA 3M1CA 3OYNA 5BPIA 4M3FA 2F2EA 5F04A 2QQ8A 2F5VA 2DPUA 1LPQA 3OIPA 2VODA 4QPOA 1X3ZB 1FSEA 2VONA 3LL7A 4KDPA 3WGGA 3QPTA 1B59A 4OAZA 3JRHA 4KN7X 3VYTB 4PUSA 4G6QA 3UR3C 4ZZDA 2P5VA 5L3CA 4LG3A 2HDCA 2Z1DA 3MKLA 4PGGA 5HDNA 1TWGJ 3LOCA 1LJ9A 2R7RA 2XROA 3D5LA 1B1BA 2JZYA 2V1UA 4IJAA 2FF4A 4OWRB 1R5GA 4HZFA 4UY8I 5AIPA 4OIQF 1BOAA 1I5ZA 1D8KA 1YJNI 3BZKA 2IA1A 2HYJA 2K4JA 2X1EA 1I1SA 1JT6A 2OCCH 3E6BA 5IP6A 2Y2ZA 2F4MB 1T39A 1YRNB 1Z6RA 2XB5A 1FJLA 3HL2A 3JAMK 3ZMZA 2Y9YA 3CJTB 4Y52J 4R8HA 4Y15A 1ORKA 3VPRA 3TOBA 1B9MA 3R4KA 3TDUC 4YELA 1Z05A 3I58A 2LK2A 2FJ1A 2LDUA 4YIRX 1O3SA 1ZGJA 2IEKA 2ZSHB 2ME6A 3A01A 4I09A 4ZDPA 3DKWA 3KEQA 1U9OA 3E1SA 1Y39A 5FLXK 4IEJA 5J8FA 4DZJA 3GXOA 3K70C 4K2EA 2GM4A 3BTIA 3K1PA 2KRHA 1WJDA 1ZELA 1WWXA 2PMHA 2YUSA 3OS1A 4JP0A 2LBFB 3ZN1A 1OMIA 3QPLA 1OYYA 3BJ6A 1DUXC 3HOZJ 2WAQA 3WTYC 1OCCH 1Z91A 3VEPA 1A35A 5HDGA 4A3MJ 5E3MA 3HC7A 1QPMA 1FOXA 1WVRA 4PSWA 3OYLA 3UNGC 3AG2H 1W5CC 1WJCA 2FBIA 1JE8A 2Y48A 1R49A 1M1EB 3BC8A 1E2XA 1G3SA 1Y56A 4HQMA 4CYCA 2P6TA 2DA5A 1XGNA 5CQEA 5E18F 1KQ8A 5CVVA 1D1CA 3U2RA 2PJRA 4IO9F 4XOPA 4CCJA 1TP4A 2EFOA 1K6YA 1SFXA 4G7ZF 1RKTA 2E7XA 4AIHA 2OPTA 4FT8A 3HOXJ 4BUPA 4M3EA 2BXYA 4I0BA 3LA3A 4GYGA 2E1MB 1I3QJ 4MGRA 3OSFA 4FE7A 1QU3A 3F8MA 2B63J 1Z77A 4M6YA 4S05A 1IAWA 1YE9A 2QSHX 4AU7A 3SFIA 1A36A 1Z7LA 4U7BA 3DQVC 3LSIA 1MH4A 2OAZA 2MW8A 4ZJZA 3MWMA 5IT9Z 3RYRA 2OQRA 2MD0A 4HV6A 2LOOA 1RZ4A 1O57A 2KIFA 1B8IA 2BY0A 2BY3A 5K5RA 1TNTA 3E6MA 5FRNA 3CCMI 1V55H 5C44J 2LYCA 1TWCJ 3PFYA 5KHDA 3FK7A 2GA2A 3HZJA 4B8XA 1O3RA 2V4JC 4KIFA 1FOKA 3S16J 4CZCA 1IC8A 4B47A 2ID3A 3V7CA 1EF4A 1ULYA 2LP0A 4N4NB 1RETA 2EQRA 2M0MA 2R7WA 2P5LC 1TWAJ 1X1AA 3ABUA 1W1WE 3T0YA 2FBKA 4G9YA 3MKYB 1AOYA 2MGQA 4C3JJ 1TW2A 1VQOI 2BGCA 4LB6B 4IRIA 1UCRA 3GCMA 4KMUX 5KK1A 1LVKA 2B7EA 3EUKL 3LFUA 1F5TA 2ID6A 1XG1A 1IN7A 5K5OA 4U7DA 1TWHJ 1HDDC 1OCTC 3BR2A 2FXAA 4CDGA 3OYEA 4BACA 4E7KA 1U8RA 4FETA 4C2MJ 4WK8F 2QBYA 4A12A 5ICCA 5KAIC 2A68F 4I6ZA 2O0YA 4LITA 2K9MA 1YS7A 4MFEA 4HAMA 1ZG5A 1WJBA 4JOMA 3GZ5A 1L3LA 1X1PA 1VQ4I 3FX3A 3HOSA 1MSFC 3CMEI 3JRDA 2GWRA 3QYBA 3CC4I 2R7XA 3ASNH 3W3CA 2CUFA 2MG4A 1YITI 1I1GA 3MKWB 5BOXA 1XCBA 2ZBKA 1HDPA 2AQFA 4W97A 5HNHA 2HTSA 3ZXSA 4CGZA 2KZGA 1FIPA 1IZ1A 4XM3A 3KZIC 4EJVA 2MLGA 2NVYJ 2VT2A 3B02A 4IHYA 4A5NA 3KLOA 2GQQA 1AKHA 1QVUA 3B6AA 3HHGA 2DU9A 3DCFA 3KP4A 4MEYF 2PJPA 2XF7A 1JUSA 4RAFA 4II2A 3LQQA 4CH7A 2F48A 5TGTA 4C2TA 3H35A 1Y1WJ 4EATA 1W7PB 1IXRC 2I5UA 5EGOB 2R7VA 4L5EA 3OL3A 4FISA 2EB7A 2EIJH 2CW7A 3QPSA 5D6EA 2CFXA 2WAFA 1OR7C 3LSRA 4JYKA 4GO1A 4GRIA 3M3YJ 1R00A 1HSJA 3CZ6A 2R92J 5FRMA 3WODF 4BKXA 5DUIA 3CCRI 1RR7A 2Y31A 3KYLA 5IOYA 2P7VB 4ENJA 3LSMA 1OR7A 3CLOA 5LRRA 1BW5A 3BT9A 1X1BA 3C1DA 1GLNA 4BE1A 2XB0X 4GYIA 2Z2SB 2DYSH 2R5YA 2L2OA 2FUG2 1SVLA 2QA4I 2BW3A 1UZCA 3ELKA 3Q0UA 1MMAA 2VJ5A 4HPQA 5FD5A 1ZGWA 4IZZA 3KP6A 1SEUA 4BEHA 5D4RA 4RGXA 4RGSA 2HOEA 1W0UA 3K4NA 1IRGA 3RPUD 2NNNA 4RB0A 3CUQC 5ED4A 1U8BA 1DP7P 2VBXA 3H92A 2A61A 3OL4A 2LH9A 3DBLB 5C3EJ 1MDMB 4AVZA 5IT9K 1R36A 4CCMA 3S17J 4RM3A 3CUQA 5BS6A 3OYIA 2Y0SA 2PG4A 4XONA 2FU4A 1H0MA 4XRFA 4U0YA 5F08A 2EBIA 4PDKA 2W1OA 3VSLA 3CO6C 3ML6A 4MTEA 2VL8A 1YOVB 2X85A 1UJ8A 4ZDOA 4KITB 5DD4A 1IV8A 5JI6A 4HOBA 2RGVA 2Q1ZB 1YW7A 3O8HA 1J2XA 4BQNA 3PSIA 2JA7J 2OZ6A 1OYIA 5GADJ 2P8TA 5JFRA 2JA8J 2BEOA 1QQIA 2EH3A 3O8GA 1ITYA 3LSHA 3D5RC 2YPRA 4NQWA 2VJJA 1YYVA 2XUBA 4MEXF 1IRZA 1YX3A 3SZGA 1L0OC 1WPKA 2QLZA 2DDBA 1ERDA 4KA4A 1D0XA 2JA2A 2X1DA 1YO5C 1D3YA 1BL0A 1H89C 2N8GA 5JHUA 2PN6A 2XGDA 4FQGA 4ENKA 3WHBA 2M30A 2W7NA 1OCZH 2P0WA 4PCQA 3BG9A 2VE9A 2Q2EA 4KFCA 1T0FA 2BHYA 5JR3A 3DF8A 4DBQA 2F5EA 2F6CA 3RKXA 4EGZA 1JKRC 3CCSI 3KETA 2PMUA 2XAHA 1U2WA 2W24A 2A3SA 4LIVA 4HF0A 4LOCA 2CO5A 4Q47A 2OA4A 1APLC 1VNDA 1V5GA 4EQQA 4J01A 1VQPI 3I53A 1STZA 1XC5A 2A6TA 2FRHA 2V26A 4N0BA 3HPGA 3QODA 4HDUA 2ZC2A 1V4RA 3WTXC 2CV0A 2HOSA 5ILSA 1EH8A 4ZYGA 1MMNA 2LTPA 3HIFA 1BR2A 3GFIA 3KP2A 2XSDC 5LHHA 2DQLA 1OCRH 3E3VA 1WQ2A 3RKQA 2CV2A 3GTGJ 2E1MC 1JHHA 5C4JJ 3IRQA 2VLAA 5A2QZ 3K4CA 2TRTA 1WJ5A 1SD6A 5CQGA 5ICEA 5FKKA 1KYWA 5H2FC 5HDKA 4PGHA 2CUZA 4XKWA 2VKVA 1NHAA 2KQRA 2Y0MA 2CQQA 4YRVA 2JPBA 3IAM2 1VQ5I 3CC7I 1VQ6I 1HW2A 3OYAA 3WTVC 2L0KA 2NS8A 3VDXA 3OR1C 3OWTA 2DOAA 4Y13A 4I2OA 3RZOJ 2OC6A 3Q0VA 2KRCA 2EJRA 3M07A 3I55I 3IAS2 2CJJA 2KIQA 1PP7U 2PLYA 3C2BA 1HW1A 2FOWA 3RDIA 4A3JJ 2VBWA 2E2JJ 2FMLA 3JW4A 3CD6I 1XN7A 1PP8F 1TT0A 1CQTA 5D5UB 5K5QA 2H27A 4KMFA 1YS6A 2COBA 4B1RA 4HQEA 1JHFA 4NNJA 4OU0A 1QGPA 1TTYA 2F5FA 2QENA 2VN2A 1I27A 3H3UA 4NC7A 4RLFA 2ESNA 3BQYA 1HLVA 5DDGA 2TCTA 1EH6A 1MMGA 3KCCA 2FMYA 4UV8A 3ECHA 4UVCA 1OCOH 4M72A 2BOLA 1F1ZA 3RYPA 3HG9A 3U1KA 2CG4A 3G2BA 3I4MJ 2WA0A 1LDJA 4DYQA 5FLVA 2BVMA 4BDZA 2WB1A 3CP2A 3HKZA 4ESJA 3QWLA 4CHUA 4XIDA 4Y17A 1R1VA 4LLNA 1UB9A 2RAEA 3GFLA 1W4MA 2MABA 1DQUA 3BG6A 1F36A 1JJ6C 3MD2A 3T8RA 3RKWA 2M34A 3PFIA 1B6AA 2R7DA 4XN3A 4O6JA 2RKHA 2X4HA 1RR8C 4I02A 1X19A 3E5QA 4UVAA 4CSWA 2EV6A 1XX5A 1U0JA 2IW5A 3WE2A 4NC6A 3J7AO 1EH7A 1A6IA 3ZQ7A 5EF6A 4IQ4A 3K0LA 2K85A 3DXJF 3OOUA 3RTRA 4ZYEA 2HI3A 4WX9A 3RZDJ 1P6RA 3GFJA 1USSA 4XKVA 2NVTJ 5E17F 2DA3A 2DT5A 2A6EF
chains in the Genus database with same CATH topology
1X3UA 4U0VA 4IXAA 1TQMA 1KYZA 3CUOA 4HA8A 1K6OA 3T5XA 3HTSB 2HQNA 1PDNC 1FSHA 1J5YA 2D45A 3TKYA 1PUEE 2Y75A 1R7JA 1R5HA 5A2QK 4RGRA 2QM3A 2QQ9A 2KJBA 1KU3A 4NB5A 3KEOA 3V8KA 1YG2A 5DCMB 3ZMSA 1P4WA 4HDVA 1J9IA 1MJBA 2JTVA 2VOOA 1QZYA 1ON2A 2IP2A 3FZVA 5D8KB 1U5TB 1HQCA 3ULQB 2WTEA 4KICA 2EWNA 1ZHFA 2G7HA 2MBFA 2ZCWA 4A6DA 3M8FA 2TDXA 1WRJA 3EUHA 4A2UA 2GXGA 1FLIA 5DCFA 1XGOA 4M9SA 4EM1A 4L0YB 3QU3A 2VT3A 1C0WA 4GCVA 1MZBA 5HS7A 1H9GA 1O3QA 3V7RA 1OKRA 3F8BA 4ZZLA 3IL2A 2CQKA 1W5TA 4O5VA 3F8FA 3V4GA 1RUNA 4LJZF 3E5UA 3P9IA 5E20A 1QNTA 2L4MA 5LGTA 2F5DA 4B09A 3I59B 1S7OA 1B9NA 4RAYA 3GVAA 1T38A 3DEUA 1DDNA 1BBYA 3L9FA 3HRUA 5HOOA 3J81Z 3ECOA 1UFMA 2HEOA 2DPDA 2IRFG 4MHGA 1XCVA 1BC8C 3RKYA 3W6KB 2STWA 1E17A 4CYDA 1ZRDA 2ESHA 3F22A 2K02A 1RI7A 5DV5A 3DPTA 1BIBA 4EMSA 1FBSA 1YTYA 1FPQA 2MC3A 2V9VA 1BI2A 2DLLA 2HZTA 2YU3A 2COMA 2HTJA 1P92A 2DQRA 4G7OF 3KZZA 1FNNA 2QUFA 4RB3C 5JVTA 5K1YA 3IWFA 1EV7A 2OQGA 3WU1B 4HW0A 1R23A 1XMAA 1G3WA 2J5OA 4LB5A 1SD5A 1OYWA 3CDHA 1R1TA 3K9TA 2M5WA 5CVIA 4AIJA 5L3EA 3QP6A 1GXPA 4BHCA 5HS9A 1SAXA 3DPLC 3BROA 1Z7UA 3CO7C 2K7LA 1MGTA 3M8EA 1MJ9A 1SMTA 4OIOF 5BQTA 2HWVA 1XB4A 4OIRF 3VODA 1G3YA 4YIFA 4JBAA 4LLGF 3FHZA 3Q9SA 3E6DA 1FT9A 4YFXF 4G8XA 2HKXA 4WCGA 4OINF 5FGMA 3I0TA 3J81K 1GVJA 2DI3A 5DEQA 3BDDA 2ZJ2A 1SD4A 1SFUA 5J8CA 1IF1A 3BWGA 2W25A 2ZXJA 1Z9CA 1TW3A 4XBFA 1U5TC 2H94A 2PI0A 1BC7C 2FNAA 2GXBA 3J80Z 5D8LB 4UV9A 2XAQA 4L9VA 3GUDA 2G9WA 5HVQC 3I54A 4Q4ZF 2Q0OA 4M9XA 2VOPA 4AD9A 3FXRA 2IA0A 4BH9A 4A0XA 1FBQA 2O03A 3TQNA 1O3TA 2LF8A 4WWCA 3AAFA 2STTA 2CYYA 4M73A 4LG0B 1FC3A 2NNYA 4N9IA 2MA3A 1FP2A 5ERIA 1CF7A 2L01A 2EFQA 2RV8A 4QWQA 3DV8A 2HYGD 3COAC 4IRGA 3R61A 5HS8A 2K27A 4H0EA 5CVUA 2R3SA 1MD0A 2LKPA 2DT5A 1G3TA 5TRDA 2EA2A 2BV6A 3KP7A 1G4DA 3RIRA 2V6CA 2K86A 2ZMEB 2P4WA 3Q5FA 4JK1X 4NHJA 1B4AA 1TQIA 4UHTA 3R0JA 3HHHA 1FY7A 3U9GA 2Q8KA 1W7PD 2CW0F 3SZTA 2EV0A 4OIPF 1G6NA 5KVRA 3PQJA 2EA4A 1F4KA 3LQRA 5LHIA 4HV5A 2MD5A 3SFZA 1ON1A 1K78B 3GEZA 1QO0D 4HBLA 1T2KA 3BPXA 4ENMA 2P6SA 1YW9A 2PQ8A 1BJAA 2O3FA 3E6CC 5LGUA 4A5MA 5EEGA 2QQBA 3QU6A 1ZARA 4EGYA 1QBJA 1FYLA 3J80K 2JT1A 3IWZA 3O3KA 3SQNA 4ZYDA 1J75A 4HLXA 1BN5A 3P7NA 2XVCA 5LEKA 1P4AA 3IKTA 5D5XB 4L9JA 2BBYA 4I01A 5DYMA 4F7ZA 1S3JA 2GZWA 2VC1A 2JPCA 3EQLF 1V3FA 4WXDA 1U6GA 5E1ZB 2J5PA 5FD6A 2A5YB 1FBUA 1R1UA 3BP8A 2ZNZA 1HXDA 3HSEA 2MH9A 3F23A 1RUOA 1BIAA 3QOPA 4RGUA 1XGMA 3TOAA 3EYYA 3MFKA 1Z6TA 5FFZA 2OBPA 1LVAA 2ISZA 4OMZA 4L5IA 3TO6A 2HS5A 1Q1HA 1KQ0A 4L5JA 2ELHA 4IHSA 5BPDA 5LGNA 2JRTA 3I71A 3JSOA 3ZN0A 1O7FA 4TV7A 4KN4X 1IN6A 1LDDA 1ZLJA 4ZH4F 3WTUC 4EJUA 4BYYA 1FZPB 5EEHA 2AXLA 1SFEA 2RDPA 2KIMA 3GF2A 4BHBA 4XLPF 1RNLA 1YIOA 3SXYA 3I5UA 2EV5A 4LMYA 4MQ9F 3K2ZA 3F8CA 5E1WA 3RPUA 5CVJA 2M8EA 1FYKA 4P5OA 3SZPA 3V8JA 3KE2A 3R0AA 2L54A 3WU0A 1HBXG 5E8IA 2DAOA 4ENNA 2V1DA 2XIGA 2BYVE 3O2PE 4UNOA 3ZP5A 4I98B 2FBHA 3HRSA 3C7JA 2X0LA 1W7PA 2QQAA 5CLSA 4KT5C 1XD7A 2RN7A 4Z2YA 5L3FA 3GLXA 4OMYA 2ZO4A 1Y0UA 5HLIA 5HLGA 2ETHA 4GGGA 4HX8A 1ZLKA 5AIQA 3GZ6A 1F9NA 3HYIA 1MKMA 1IW7F 2XV4S 3MCZA 5E8GA 2OZUA 3BJOA 3G73A 2E1NA 3RJPA 1MDMA 2H09A 4KYWA 3L00A 4L9NA 3TGNA 2L02A 1IXCA 2K4BA 1ZG3A 2VXZA 4EJTA 4MTDA 3F6OA 1ZREA 4M9ZA 2QZ8A 4E70A 2QBYB 5LHGA 3WGHA 3N4MA 4YFNF 3HSRA 3GYHX 6PAXA 1ZAOA 4IF4A 4LLLA 2O8XA 1XSXA 4LK0F 2OU2A 4EV0A 4ESBA 3QRFF 3DFGA 1MJAA 2EFNA 3F72A 1W5SA 4M71A 3OOPA 2XHKA 2DFIA 4HF1A 2E7WA 4CXFA 4Q5SF 4BQAA 2PFBA 2Z3YA 3VB2A 3Q9VA 4M74A 5IT3A 3L09A 3C18A 2R7FA 4DNCA 3WGIA 4R79A 2BE5F 4A0YA 2A69F 5ILUA 1H9TA 2OD5A 4RB1A 1KU7A 2HQRA 3IHUA 3FM5A 3ZMTA 1OPCA 1JXSA 3MZHA 4LGWA 4UXNA 3KFWX 4L9TA 1JGSA 3CUQB 1RIOH 2NYXA 3HUGA 3V7SA 2ZNYA 1UHWA 2CSOA 2EFPA 4N9HA 2GAUA 3E97A 3GFMA 4EM0B 3FXQA 1TLHB 5D6FA 1HKTA 1GHCA 3T1BA 2VBYA 1ZYRF 2H6CA 3EETA 2Z99A 2IPQX 2FSWA 4Q48A 5HLHA 3P9KA 4O3MA 1U78A 3D0SA 2A07F 2KKOA 1D5VA 5D5VB 4XSZF 3I4PA 1LEAA 1R58A 2M87A 1WSUA 3KP5A 1FP1D 4ETSA 3MAJA 3TO9A 4P96A 4YFKF 4EVIA 3FXUA 1YW8A 4EM2A 4HYEA 1SMYF 2HR3A 1FWZA 5H20A 3K1NA 3M1EA 3R60A 2XKOA 3LAPA 4IRHA 3BOQA 1XSDA 1R22A 5LRSA 1TNSA 4IVNA 2FOKA 5LLQA 1FX7A 1WKMA 2XKPA 1HKQA 3N97A 1S29A 2ISYA 5DUKA 5TJJA 3GX4X 1KA8A 1S6LA 5DCMA 3FWEA 3H3ZA 3CJNA 2FQ3A 4G7HF 3L2CA 1REPC 3R6SA 2QVOA 4D0PA 2WWYA 2MLKA 2RQPA 4BXUA 1XMKA 5BMZA 4I0AA 3PQKA 5D5WB 3V8LA 5F1RA 2KRFA 3LAJA 5F64A 1T6SA 1YQAA 1U5TA 2CWEA 4M6XA 2UWMA 4HX7A 2DBBA 3LA2A 4R1HA 4UVBA 2WC2A 3RPQA 1AWCA 3W6JB 5LEJA 3T8TA 4KNYA 5FFXA 3ERED 4RB2C 3NQOA 3WTWC 3WTZA 1BM9A 4L18B 3RI4A 4LD5A 4PZJA 3O6BB 3BPVA 2VBZA 5CJ9A 2CGPA 3B73A 2XRNA 5AONA 4P55A 3VFZA 2XAGA 1BI0A 4BAYA 2Z33A 4HF2A 3VOEA 2D1VA 4G6DA 1ZN2A 5D4SA 2YSRA 1K79A 1XGSA 3EYIA 3HTUA 1Z1DA 3I59A 3LSTA 4EJOA 2FEZA 3G3ZA 4A6EA 1GXQA 4KIGA 2L3DA 5L3BA 1S7AA 1KQ9A 1YLFA 2RC4A 3BZ6A 4FX0A 4XSXF 2YR2A 4AIKA 4YIIA 3ZMDA 2XAFA 1CGPA 2YX7A 4S04A 1HSTA 2QYOA 1LQ1A 3DP7A 1FYMA 2DK8A 2D1HA 3FF5A 4RS8A 1IN4A 5FO5A 2PEXA 1IRFA 1XSVA 4G94A 4XLNF 2NAZA 3WG9A 1O7LA 1LDKB 3ZMUA 1A04A 1IUYA 1U3EM 2Z9OA 4ON0A 3M7GA 2FA5A 2XAJA 1YFHA 3WE3A 1KU2A 1ZGAA 1J59A 2XGXA 2WV0A 1IXSB 3ROUA 2M45A 4QLCU 5LBQA 3JTHA 3WTTC 1BI1A 3C3WA 2M1BA 2W85A 4CO8A 2C6YA 1IN5A 3ZMVA 4KIBA 3BJAA 2FE3A 3NEUA 2LF7A 1KGSA 1J7KA 4U0WA 4CICA 3MZYA 1P4XA 3KLNA 4AWXB 5ICGA 4FX4A 1TQPA 2E1CA 4WXHA 4P9FA 2LNBA 3GW2A 3HRMA 2MH2A 3QAHA 4P9UA 2KIUA 2IVMA 2RVCA 4BNCA 2HGCA 2GIVA 2B0LA 3GWZA 2XASA 2Z5UA 3CTAA 4IPAA 5F6FA 1SD7A 2NRAC 2VE8A 5CVRA 1LNWA 1XDSA 4HX4A 3K1MA 3F21A 3FMRA 3REOA 1KU9A 2YX4A 3TDZC 1XDUA 1USTA 3LWFA 3OV8A 3QPHA 4RAZA 5ICFA 3HSFA 3IKVA 3ABTA 5ILVA 4LFUA 1VTNC 1HW5A 2FNPA 4ASNA 2GA1A 2F5CA 3BY6A 2ADUA 1LEBA 4OOIA 2AS5F 1WI9A 3IRRA 3ZPLA 4CZZA 1ODDA 2G7UA 4LG0A 3JTGA 3M9AA 3K69A 2H6BA 3WTSC 1QZZA 3FMSA 5DD8A 3S2WA 4WF2A 1I6XA 4KUMA 3L7WA 5E1XA 2L4AA 2QWWA 2A6HF 4YG2F 3TO7A 2NS0A 2W84A 4ESFA 5FB2A 3U1DA 2UXXA 1LB2A 5J6XA 2DW4A 2D2WA 2JSCA 2V1XA 4MNUA 2DTRA 4AVPA 2HFHA 1BI3A 2ZKZA 1D8JA 4I7HA 4U88A 2EK5A 1K7AA 2UXNA 3KP3A 2IT0A 4UUVA 3JAMZ 1S8NA 3SHFA 4GXOA 3EDPA 2ZMEA 5L3DA 5CYVA 1TBXA 4LK1F 1ZRCA 1J0RA 2VC0A 3E5XA 2O6GE 2HKOA 5H6QA 2DK5A 5FLXZ 1ONVA 3FMQA 2UZKA 2KJCA 3MEXA 4IHTA 5L3GA 1T98A 4JQFA 3F6VA 3F8NA 3GO5A 2P7CB 1K78A 2ACJA 3P9CA 2RNJA 2W57A 3KZYA 2IA2A 1ZG1A 4EJWA 5H6RA 2PBIA 3MQ0A 1UHMA 3ISPA 3QP5A 2EFWA 1ZRFA 1ZH5A 3HRTA 3I64A 4L0ZB 2LSOA 4FHTA 1IN8A 3NRVA 2IJLA 1HKSA 3HOTA 2O61A 4BHPA 3F3XA 1DPRA 4MQVA 3JSPA 3FM3A 2HYFA 1P2FA 2DO7A 3LFKA 4DQ2A 2ZFWA 4A0ZA 2P5KA 1CF7B 4ZYHA 3IC7A 1DPUA 4HLYA 2V79A 3LA7A 4WXCA 5BPIA 2F2EA 2DPUA 2VODA 1FSEA 2VONA 4KDPA 3WGGA 3QPTA 1B59A 4KN7X 4ZZDA 4G6QA 2P5VA 5L3CA 2HDCA 4PGGA 5HDNA 1LJ9A 2XROA 3D5LA 1B1BA 2JZYA 2V1UA 4IJAA 2FF4A 1R5GA 4HZFA 5AIPA 4OIQF 1BOAA 1I5ZA 1D8KA 2IA1A 2K4JA 1I1SA 3E6BA 1T39A 1Z6RA 3JAMK 3ZMZA 4R8HA 4Y15A 3TOBA 1B9MA 3R4KA 3TDUC 1Z05A 3I58A 2LDUA 1O3SA 1ZGJA 4I09A 3DKWA 3KEQA 5FLXK 5J8FA 3GXOA 4K2EA 3K1PA 1WWXA 2PMHA 3ZN1A 1OMIA 1OYYA 3BJ6A 1DUXC 3WTYC 1Z91A 3VEPA 5HDGA 1QPMA 2FBIA 1JE8A 2Y48A 1E2XA 1G3SA 4HQMA 2P6TA 1XGNA 5E18F 1KQ8A 5CVVA 3U2RA 2EFOA 1SFXA 4G7ZF 2E7XA 4AIHA 4FT8A 4I0BA 3LA3A 4GYGA 4MGRA 3F8MA 4M6YA 4S05A 1IAWA 4U7BA 3DQVC 2OAZA 3MWMA 5IT9Z 3RYRA 2OQRA 4HV6A 1RZ4A 1O57A 2KIFA 5K5RA 1TNTA 3E6MA 2GA2A 4B8XA 1O3RA 4KIFA 1FOKA 3V7CA 1ULYA 2P5LC 3ABUA 3T0YA 2FBKA 4G9YA 1AOYA 1TW2A 2BGCA 4LB6B 4IRIA 1UCRA 4KMUX 5KK1A 1F5TA 1IN7A 5K5OA 4U7DA 2FXAA 4CDGA 1U8RA 4WK8F 2QBYA 4A12A 5ICCA 2A68F 2O0YA 1YS7A 4HAMA 1ZG5A 3GZ5A 1L3LA 3FX3A 3HOSA 2GWRA 1I1GA 5BOXA 1XCBA 2ZBKA 2HTSA 4CGZA 1IZ1A 4EJVA 2MLGA 2VT2A 3B02A 4A5NA 3KLOA 2GQQA 3HHGA 2DU9A 3KP4A 4MEYF 2PJPA 3LQQA 1W7PB 1IXRC 2EB7A 5D6EA 2CFXA 4GO1A 1R00A 1HSJA 3WODF 2P7VB 4ENJA 1OR7A 3CLOA 5LRRA 3C1DA 4GYIA 3ELKA 5FD5A 3KP6A 5D4RA 4RGXA 4RGSA 2HOEA 1IRGA 2NNNA 4RB0A 3CUQC 5ED4A 1DP7P 2VBXA 3H92A 2A61A 1MDMB 5IT9K 1R36A 3CUQA 5BS6A 2PG4A 2FU4A 1H0MA 4XRFA 4U0YA 4PDKA 3CO6C 3ML6A 4MTEA 5DD4A 5JI6A 4HOBA 2RGVA 1YW7A 1J2XA 2OZ6A 1OYIA 2P8TA 5JFRA 2BEOA 1QQIA 4NQWA 2YPRA 1YYVA 2XUBA 4MEXF 1L0OC 2QLZA 4KA4A 1YO5C 1D3YA 5JHUA 2PN6A 4ENKA 2M30A 4PCQA 2VE9A 2Q2EA 4KFCA 1T0FA 5JR3A 3DF8A 2F5EA 4EGZA 3RKXA 3KETA 2PMUA 2XAHA 1U2WA 2W24A 2A3SA 4HF0A 2CO5A 4Q47A 2OA4A 4EQQA 3I53A 1STZA 2FRHA 4N0BA 4HDUA 1V4RA 3WTXC 5ILSA 1EH8A 4ZYGA 3HIFA 3GFIA 3KP2A 5LHHA 2DQLA 3E3VA 1WQ2A 1JHHA 3IRQA 5A2QZ 1SD6A 5ICEA 1KYWA 5HDKA 4PGHA 1NHAA 2Y0MA 2JPBA 1HW2A 3WTVC 4Y13A 4I2OA 2EJRA 1PP7U 2PLYA 1HW1A 3RDIA 2VBWA 2FMLA 3JW4A 1XN7A 1PP8F 5D5UB 5K5QA 2H27A 4KMFA 1YS6A 4HQEA 1JHFA 4OU0A 1QGPA 1TTYA 2F5FA 2QENA 2VN2A 1I27A 3H3UA 2ESNA 5DDGA 1EH6A 3KCCA 2FMYA 4UV8A 3ECHA 4UVCA 4M72A 1F1ZA 3RYPA 2CG4A 1LDJA 4ESJA 4CHUA 4Y17A 1R1VA 4LLNA 1UB9A 3GFLA 1W4MA 3T8RA 3RKWA 3PFIA 1B6AA 2R7DA 4O6JA 2RKHA 2X4HA 4I02A 3E5QA 4UVAA 2EV6A 2IW5A 3WE2A 3J7AO 1EH7A 3ZQ7A 3K0LA 3DXJF 3RTRA 4ZYEA 4WX9A 1P6RA 3GFJA 1USSA 5E17F 5DUIA 2A6EF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3U A;  4U0V A;  4IXA A;  1TQM A;  1KYZ A;  3CUO A;  4HA8 A;  1K6O A;  3T5X A;  3HTS B;  2HQN A;  1PDN C;  1FSH A;  1J5Y A;  2D45 A;  3TKY A;  1PUE E;  2Y75 A;  1R7J A;  1R5H A;  5A2Q K;  4RGR A;  2QM3 A;  2QQ9 A;  2KJB A;  1KU3 A;  4NB5 A;  3KEO A;  3V8K A;  1YG2 A;  5DCM B;  3ZMS A;  1P4W A;  4HDV A;  1J9I A;  1MJB A;  2JTV A;  2VOO A;  1QZY A;  1ON2 A;  2IP2 A;  3FZV A;  5D8K B;  1U5T B;  1HQC A;  3ULQ B;  2WTE A;  4KIC A;  2EWN A;  1ZHF A;  2G7H A;  2MBF A;  2ZCW A;  4A6D A;  3M8F A;  2TDX A;  1WRJ A;  3EUH A;  4A2U A;  2GXG A;  1FLI A;  5DCF A;  1XGO A;  4M9S A;  4EM1 A;  4L0Y B;  3QU3 A;  2VT3 A;  1C0W A;  4GCV A;  1MZB A;  5HS7 A;  1H9G A;  1O3Q A;  3V7R A;  1OKR A;  3F8B A;  4ZZL A;  3IL2 A;  2CQK A;  1W5T A;  4O5V A;  3F8F A;  3V4G A;  1RUN A;  4LJZ F;  3E5U A;  3P9I A;  5E20 A;  1QNT A;  2L4M A;  5LGT A;  2F5D A;  4B09 A;  3I59 B;  1S7O A;  1B9N A;  4RAY A;  3GVA A;  1T38 A;  3DEU A;  1DDN A;  1BBY A;  3L9F A;  3HRU A;  5HOO A;  3J81 Z;  3ECO A;  1UFM A;  2HEO A;  2DPD A;  2IRF G;  4MHG A;  1XCV A;  1BC8 C;  3RKY A;  3W6K B;  2STW A;  1E17 A;  4CYD A;  1ZRD A;  2ESH A;  3F22 A;  2K02 A;  1RI7 A;  5DV5 A;  3DPT A;  1BIB A;  4EMS A;  1FBS A;  1YTY A;  1FPQ A;  2MC3 A;  2V9V A;  1BI2 A;  2DLL A;  2HZT A;  2YU3 A;  2COM A;  2HTJ A;  1P92 A;  2DQR A;  4G7O F;  3KZZ A;  1FNN A;  2QUF A;  4RB3 C;  5JVT A;  5K1Y A;  3IWF A;  1EV7 A;  2OQG A;  3WU1 B;  4HW0 A;  1R23 A;  1XMA A;  1G3W A;  2J5O A;  4LB5 A;  1SD5 A;  1OYW A;  3CDH A;  1R1T A;  3K9T A;  2M5W A;  5CVI A;  4AIJ A;  5L3E A;  3QP6 A;  1GXP A;  4BHC A;  5HS9 A;  1SAX A;  3DPL C;  3BRO A;  1Z7U A;  3CO7 C;  2K7L A;  1MGT A;  3M8E A;  1MJ9 A;  1SMT A;  4OIO F;  5BQT A;  2HWV A;  1XB4 A;  4OIR F;  3VOD A;  1G3Y A;  4YIF A;  4JBA A;  4LLG F;  3FHZ A;  3Q9S A;  3E6D A;  1FT9 A;  4YFX F;  4G8X A;  2HKX A;  4WCG A;  4OIN F;  5FGM A;  3I0T A;  3J81 K;  1GVJ A;  2DI3 A;  5DEQ A;  3BDD A;  2ZJ2 A;  1SD4 A;  1SFU A;  5J8C A;  1IF1 A;  3BWG A;  2W25 A;  2ZXJ A;  1Z9C A;  1TW3 A;  4XBF A;  1U5T C;  2H94 A;  2PI0 A;  1BC7 C;  2FNA A;  2GXB A;  3J80 Z;  5D8L B;  4UV9 A;  2XAQ A;  4L9V A;  3GUD A;  2G9W A;  5HVQ C;  3I54 A;  4Q4Z F;  2Q0O A;  4M9X A;  2VOP A;  4AD9 A;  3FXR A;  2IA0 A;  4BH9 A;  4A0X A;  1FBQ A;  2O03 A;  3TQN A;  1O3T A;  2LF8 A;  4WWC A;  3AAF A;  2STT A;  2CYY A;  4M73 A;  4LG0 B;  1FC3 A;  2NNY A;  4N9I A;  2MA3 A;  1FP2 A;  5ERI A;  1CF7 A;  2L01 A;  2EFQ A;  2RV8 A;  4QWQ A;  3DV8 A;  2HYG D;  3COA C;  4IRG A;  3R61 A;  5HS8 A;  2K27 A;  4H0E A;  5CVU A;  2R3S A;  1MD0 A;  2LKP A;  2DT5 A;  1G3T A;  5TRD A;  2EA2 A;  2BV6 A;  3KP7 A;  1G4D A;  3RIR A;  2V6C A;  2K86 A;  2ZME B;  2P4W A;  3Q5F A;  4JK1 X;  4NHJ A;  1B4A A;  1TQI A;  4UHT A;  3R0J A;  3HHH A;  1FY7 A;  3U9G A;  2Q8K A;  1W7P D;  2CW0 F;  3SZT A;  2EV0 A;  4OIP F;  1G6N A;  5KVR A;  3PQJ A;  2EA4 A;  1F4K A;  3LQR A;  5LHI A;  4HV5 A;  2MD5 A;  3SFZ A;  1ON1 A;  1K78 B;  3GEZ A;  1QO0 D;  4HBL A;  1T2K A;  3BPX A;  4ENM A;  2P6S A;  1YW9 A;  2PQ8 A;  1BJA A;  2O3F A;  3E6C C;  5LGU A;  4A5M A;  5EEG A;  2QQB A;  3QU6 A;  1ZAR A;  4EGY A;  1QBJ A;  1FYL A;  3J80 K;  2JT1 A;  3IWZ A;  3O3K A;  3SQN A;  4ZYD A;  1J75 A;  4HLX A;  1BN5 A;  3P7N A;  2XVC A;  5LEK A;  1P4A A;  3IKT A;  5D5X B;  4L9J A;  2BBY A;  4I01 A;  5DYM A;  4F7Z A;  1S3J A;  2GZW A;  2VC1 A;  2JPC A;  3EQL F;  1V3F A;  4WXD A;  1U6G A;  5E1Z B;  2J5P A;  5FD6 A;  2A5Y B;  1FBU A;  1R1U A;  3BP8 A;  2ZNZ A;  1HXD A;  3HSE A;  2MH9 A;  3F23 A;  1RUO A;  1BIA A;  3QOP A;  4RGU A;  1XGM A;  3TOA A;  3EYY A;  3MFK A;  1Z6T A;  5FFZ A;  2OBP A;  1LVA A;  2ISZ A;  4OMZ A;  4L5I A;  3TO6 A;  2HS5 A;  1Q1H A;  1KQ0 A;  4L5J A;  2ELH A;  4IHS A;  5BPD A;  5LGN A;  2JRT A;  3I71 A;  3JSO A;  3ZN0 A;  1O7F A;  4TV7 A;  4KN4 X;  1IN6 A;  1LDD A;  1ZLJ A;  4ZH4 F;  3WTU C;  4EJU A;  4BYY A;  1FZP B;  5EEH A;  2AXL A;  1SFE A;  2RDP A;  2KIM A;  3GF2 A;  4BHB A;  4XLP F;  1RNL A;  1YIO A;  3SXY A;  3I5U A;  2EV5 A;  4LMY A;  4MQ9 F;  3K2Z A;  3F8C A;  5E1W A;  3RPU A;  5CVJ A;  2M8E A;  1FYK A;  4P5O A;  3SZP A;  3V8J A;  3KE2 A;  3R0A A;  2L54 A;  3WU0 A;  1HBX G;  5E8I A;  2DAO A;  4ENN A;  2V1D A;  2XIG A;  2BYV E;  3O2P E;  4UNO A;  3ZP5 A;  4I98 B;  2FBH A;  3HRS A;  3C7J A;  2X0L A;  1W7P A;  2QQA A;  5CLS A;  4KT5 C;  1XD7 A;  2RN7 A;  4Z2Y A;  5L3F A;  3GLX A;  4OMY A;  2ZO4 A;  1Y0U A;  5HLI A;  5HLG A;  2ETH A;  4GGG A;  4HX8 A;  1ZLK A;  5AIQ A;  3GZ6 A;  1F9N A;  3HYI A;  1MKM A;  1IW7 F;  2XV4 S;  3MCZ A;  5E8G A;  2OZU A;  3BJO A;  3G73 A;  2E1N A;  3RJP A;  1MDM A;  2H09 A;  4KYW A;  3L00 A;  4L9N A;  3TGN A;  2L02 A;  1IXC A;  2K4B A;  1ZG3 A;  2VXZ A;  4EJT A;  4MTD A;  3F6O A;  1ZRE A;  4M9Z A;  2QZ8 A;  4E70 A;  2QBY B;  5LHG A;  3WGH A;  3N4M A;  4YFN F;  3HSR A;  3GYH X;  6PAX A;  1ZAO A;  4IF4 A;  4LLL A;  2O8X A;  1XSX A;  4LK0 F;  2OU2 A;  4EV0 A;  4ESB A;  3QRF F;  3DFG A;  1MJA A;  2EFN A;  3F72 A;  1W5S A;  4M71 A;  3OOP A;  2XHK A;  2DFI A;  4HF1 A;  2E7W A;  4CXF A;  4Q5S F;  4BQA A;  2PFB A;  2Z3Y A;  3VB2 A;  3Q9V A;  4M74 A;  5IT3 A;  3L09 A;  3C18 A;  2R7F A;  4DNC A;  3WGI A;  4R79 A;  2BE5 F;  4A0Y A;  2A69 F;  5ILU A;  1H9T A;  2OD5 A;  4RB1 A;  1KU7 A;  2HQR A;  3IHU A;  3FM5 A;  3ZMT A;  1OPC A;  1JXS A;  3MZH A;  4LGW A;  4UXN A;  3KFW X;  4L9T A;  1JGS A;  3CUQ B;  1RIO H;  2NYX A;  3HUG A;  3V7S A;  2ZNY A;  1UHW A;  2CSO A;  2EFP A;  4N9H A;  2GAU A;  3E97 A;  3GFM A;  4EM0 B;  3FXQ A;  1TLH B;  5D6F A;  1HKT A;  1GHC A;  3T1B A;  2VBY A;  1ZYR F;  2H6C A;  3EET A;  2Z99 A;  2IPQ X;  2FSW A;  4Q48 A;  5HLH A;  3P9K A;  4O3M A;  1U78 A;  3D0S A;  2A07 F;  2KKO A;  1D5V A;  5D5V B;  4XSZ F;  3I4P A;  1LEA A;  1R58 A;  2M87 A;  1WSU A;  3KP5 A;  1FP1 D;  4ETS A;  3MAJ A;  3TO9 A;  4P96 A;  4YFK F;  4EVI A;  3FXU A;  1YW8 A;  4EM2 A;  4HYE A;  1SMY F;  2HR3 A;  1FWZ A;  5H20 A;  3K1N A;  3M1E A;  3R60 A;  2XKO A;  3LAP A;  4IRH A;  3BOQ A;  1XSD A;  1R22 A;  5LRS A;  1TNS A;  4IVN A;  2FOK A;  5LLQ A;  1FX7 A;  1WKM A;  2XKP A;  1HKQ A;  3N97 A;  1S29 A;  2ISY A;  5DUK A;  5TJJ A;  3GX4 X;  1KA8 A;  1S6L A;  5DCM A;  3FWE A;  3H3Z A;  3CJN A;  2FQ3 A;  4G7H F;  3L2C A;  1REP C;  3R6S A;  2QVO A;  4D0P A;  2WWY A;  2MLK A;  2RQP A;  4BXU A;  1XMK A;  5BMZ A;  4I0A A;  3PQK A;  5D5W B;  3V8L A;  5F1R A;  2KRF A;  3LAJ A;  5F64 A;  1T6S A;  1YQA A;  1U5T A;  2CWE A;  4M6X A;  2UWM A;  4HX7 A;  2DBB A;  3LA2 A;  4R1H A;  4UVB A;  2WC2 A;  3RPQ A;  1AWC A;  3W6J B;  5LEJ A;  3T8T A;  4KNY A;  5FFX A;  3ERE D;  4RB2 C;  3NQO A;  3WTW C;  3WTZ A;  1BM9 A;  4L18 B;  3RI4 A;  4LD5 A;  4PZJ A;  3O6B B;  3BPV A;  2VBZ A;  5CJ9 A;  2CGP A;  3B73 A;  2XRN A;  5AON A;  4P55 A;  3VFZ A;  2XAG A;  1BI0 A;  4BAY A;  2Z33 A;  4HF2 A;  3VOE A;  2D1V A;  4G6D A;  1ZN2 A;  5D4S A;  2YSR A;  1K79 A;  1XGS A;  3EYI A;  3HTU A;  1Z1D A;  3I59 A;  3LST A;  4EJO A;  2FEZ A;  3G3Z A;  4A6E A;  1GXQ A;  4KIG A;  2L3D A;  5L3B A;  1S7A A;  1KQ9 A;  1YLF A;  2RC4 A;  3BZ6 A;  4FX0 A;  4XSX F;  2YR2 A;  4AIK A;  4YII A;  3ZMD A;  2XAF A;  1CGP A;  2YX7 A;  4S04 A;  1HST A;  2QYO A;  1LQ1 A;  3DP7 A;  1FYM A;  2DK8 A;  2D1H A;  3FF5 A;  4RS8 A;  1IN4 A;  5FO5 A;  2PEX A;  1IRF A;  1XSV A;  4G94 A;  4XLN F;  2NAZ A;  3WG9 A;  1O7L A;  1LDK B;  3ZMU A;  1A04 A;  1IUY A;  1U3E M;  2Z9O A;  4ON0 A;  3M7G A;  2FA5 A;  2XAJ A;  1YFH A;  3WE3 A;  1KU2 A;  1ZGA A;  1J59 A;  2XGX A;  2WV0 A;  1IXS B;  3ROU A;  2M45 A;  4QLC U;  5LBQ A;  3JTH A;  3WTT C;  1BI1 A;  3C3W A;  2M1B A;  2W85 A;  4CO8 A;  2C6Y A;  1IN5 A;  3ZMV A;  4KIB A;  3BJA A;  2FE3 A;  3NEU A;  2LF7 A;  1KGS A;  1J7K A;  4U0W A;  4CIC A;  3MZY A;  1P4X A;  3KLN A;  4AWX B;  5ICG A;  4FX4 A;  1TQP A;  2E1C A;  4WXH A;  4P9F A;  2LNB A;  3GW2 A;  3HRM A;  2MH2 A;  3QAH A;  4P9U A;  2KIU A;  2IVM A;  2RVC A;  4BNC A;  2HGC A;  2GIV A;  2B0L A;  3GWZ A;  2XAS A;  2Z5U A;  3CTA A;  4IPA A;  5F6F A;  1SD7 A;  2NRA C;  2VE8 A;  5CVR A;  1LNW A;  1XDS A;  4HX4 A;  3K1M A;  3F21 A;  3FMR A;  3REO A;  1KU9 A;  2YX4 A;  3TDZ C;  1XDU A;  1UST A;  3LWF A;  3OV8 A;  3QPH A;  4RAZ A;  5ICF A;  3HSF A;  3IKV A;  3ABT A;  5ILV A;  4LFU A;  1VTN C;  1HW5 A;  2FNP A;  4ASN A;  2GA1 A;  2F5C A;  3BY6 A;  2ADU A;  1LEB A;  4OOI A;  2AS5 F;  1WI9 A;  3IRR A;  3ZPL A;  4CZZ A;  1ODD A;  2G7U A;  4LG0 A;  3JTG A;  3M9A A;  3K69 A;  2H6B A;  3WTS C;  1QZZ A;  3FMS A;  5DD8 A;  3S2W A;  4WF2 A;  1I6X A;  4KUM A;  3L7W A;  5E1X A;  2L4A A;  2QWW A;  2A6H F;  4YG2 F;  3TO7 A;  2NS0 A;  2W84 A;  4ESF A;  5FB2 A;  3U1D A;  2UXX A;  1LB2 A;  5J6X A;  2DW4 A;  2D2W A;  2JSC A;  2V1X A;  4MNU A;  2DTR A;  4AVP A;  2HFH A;  1BI3 A;  2ZKZ A;  1D8J A;  4I7H A;  4U88 A;  2EK5 A;  1K7A A;  2UXN A;  3KP3 A;  2IT0 A;  4UUV A;  3JAM Z;  1S8N A;  3SHF A;  4GXO A;  3EDP A;  2ZME A;  5L3D A;  5CYV A;  1TBX A;  4LK1 F;  1ZRC A;  1J0R A;  2VC0 A;  3E5X A;  2O6G E;  2HKO A;  5H6Q A;  2DK5 A;  5FLX Z;  1ONV A;  3FMQ A;  2UZK A;  2KJC A;  3MEX A;  4IHT A;  5L3G A;  1T98 A;  4JQF A;  3F6V A;  3F8N A;  3GO5 A;  2P7C B;  1K78 A;  2ACJ A;  3P9C A;  2RNJ A;  2W57 A;  3KZY A;  2IA2 A;  1ZG1 A;  4EJW A;  5H6R A;  2PBI A;  3MQ0 A;  1UHM A;  3ISP A;  3QP5 A;  2EFW A;  1ZRF A;  1ZH5 A;  3HRT A;  3I64 A;  4L0Z B;  2LSO A;  4FHT A;  1IN8 A;  3NRV A;  2IJL A;  1HKS A;  3HOT A;  2O61 A;  4BHP A;  3F3X A;  1DPR A;  4MQV A;  3JSP A;  3FM3 A;  2HYF A;  1P2F A;  2DO7 A;  3LFK A;  4DQ2 A;  2ZFW A;  4A0Z A;  2P5K A;  1CF7 B;  4ZYH A;  3IC7 A;  1DPU A;  4HLY A;  2V79 A;  3LA7 A;  4WXC A;  5BPI A;  2F2E A;  2DPU A;  2VOD A;  1FSE A;  2VON A;  4KDP A;  3WGG A;  3QPT A;  1B59 A;  4KN7 X;  4ZZD A;  4G6Q A;  2P5V A;  5L3C A;  2HDC A;  4PGG A;  5HDN A;  1LJ9 A;  2XRO A;  3D5L A;  1B1B A;  2JZY A;  2V1U A;  4IJA A;  2FF4 A;  1R5G A;  4HZF A;  5AIP A;  4OIQ F;  1BOA A;  1I5Z A;  1D8K A;  2IA1 A;  2K4J A;  1I1S A;  3E6B A;  1T39 A;  1Z6R A;  3JAM K;  3ZMZ A;  4R8H A;  4Y15 A;  3TOB A;  1B9M A;  3R4K A;  3TDU C;  1Z05 A;  3I58 A;  2LDU A;  1O3S A;  1ZGJ A;  4I09 A;  3DKW A;  3KEQ A;  5FLX K;  5J8F A;  3GXO A;  4K2E A;  3K1P A;  1WWX A;  2PMH A;  3ZN1 A;  1OMI A;  1OYY A;  3BJ6 A;  1DUX C;  3WTY C;  1Z91 A;  3VEP A;  5HDG A;  1QPM A;  2FBI A;  1JE8 A;  2Y48 A;  1E2X A;  1G3S A;  4HQM A;  2P6T A;  1XGN A;  5E18 F;  1KQ8 A;  5CVV A;  3U2R A;  2EFO A;  1SFX A;  4G7Z F;  2E7X A;  4AIH A;  4FT8 A;  4I0B A;  3LA3 A;  4GYG A;  4MGR A;  3F8M A;  4M6Y A;  4S05 A;  1IAW A;  4U7B A;  3DQV C;  2OAZ A;  3MWM A;  5IT9 Z;  3RYR A;  2OQR A;  4HV6 A;  1RZ4 A;  1O57 A;  2KIF A;  5K5R A;  1TNT A;  3E6M A;  2GA2 A;  4B8X A;  1O3R A;  4KIF A;  1FOK A;  3V7C A;  1ULY A;  2P5L C;  3ABU A;  3T0Y A;  2FBK A;  4G9Y A;  1AOY A;  1TW2 A;  2BGC A;  4LB6 B;  4IRI A;  1UCR A;  4KMU X;  5KK1 A;  1F5T A;  1IN7 A;  5K5O A;  4U7D A;  2FXA A;  4CDG A;  1U8R A;  4WK8 F;  2QBY A;  4A12 A;  5ICC A;  2A68 F;  2O0Y A;  1YS7 A;  4HAM A;  1ZG5 A;  3GZ5 A;  1L3L A;  3FX3 A;  3HOS A;  2GWR A;  1I1G A;  5BOX A;  1XCB A;  2ZBK A;  2HTS A;  4CGZ A;  1IZ1 A;  4EJV A;  2MLG A;  2VT2 A;  3B02 A;  4A5N A;  3KLO A;  2GQQ A;  3HHG A;  2DU9 A;  3KP4 A;  4MEY F;  2PJP A;  3LQQ A;  1W7P B;  1IXR C;  2EB7 A;  5D6E A;  2CFX A;  4GO1 A;  1R00 A;  1HSJ A;  3WOD F;  2P7V B;  4ENJ A;  1OR7 A;  3CLO A;  5LRR A;  3C1D A;  4GYI A;  3ELK A;  5FD5 A;  3KP6 A;  5D4R A;  4RGX A;  4RGS A;  2HOE A;  1IRG A;  2NNN A;  4RB0 A;  3CUQ C;  5ED4 A;  1DP7 P;  2VBX A;  3H92 A;  2A61 A;  1MDM B;  5IT9 K;  1R36 A;  3CUQ A;  5BS6 A;  2PG4 A;  2FU4 A;  1H0M A;  4XRF A;  4U0Y A;  4PDK A;  3CO6 C;  3ML6 A;  4MTE A;  5DD4 A;  5JI6 A;  4HOB A;  2RGV A;  1YW7 A;  1J2X A;  2OZ6 A;  1OYI A;  2P8T A;  5JFR A;  2BEO A;  1QQI A;  4NQW A;  2YPR A;  1YYV A;  2XUB A;  4MEX F;  1L0O C;  2QLZ A;  4KA4 A;  1YO5 C;  1D3Y A;  5JHU A;  2PN6 A;  4ENK A;  2M30 A;  4PCQ A;  2VE9 A;  2Q2E A;  4KFC A;  1T0F A;  5JR3 A;  3DF8 A;  2F5E A;  4EGZ A;  3RKX A;  3KET A;  2PMU A;  2XAH A;  1U2W A;  2W24 A;  2A3S A;  4HF0 A;  2CO5 A;  4Q47 A;  2OA4 A;  4EQQ A;  3I53 A;  1STZ A;  2FRH A;  4N0B A;  4HDU A;  1V4R A;  3WTX C;  5ILS A;  1EH8 A;  4ZYG A;  3HIF A;  3GFI A;  3KP2 A;  5LHH A;  2DQL A;  3E3V A;  1WQ2 A;  1JHH A;  3IRQ A;  5A2Q Z;  1SD6 A;  5ICE A;  1KYW A;  5HDK A;  4PGH A;  1NHA A;  2Y0M A;  2JPB A;  1HW2 A;  3WTV C;  4Y13 A;  4I2O A;  2EJR A;  1PP7 U;  2PLY A;  1HW1 A;  3RDI A;  2VBW A;  2FML A;  3JW4 A;  1XN7 A;  1PP8 F;  5D5U B;  5K5Q A;  2H27 A;  4KMF A;  1YS6 A;  4HQE A;  1JHF A;  4OU0 A;  1QGP A;  1TTY A;  2F5F A;  2QEN A;  2VN2 A;  1I27 A;  3H3U A;  2ESN A;  5DDG A;  1EH6 A;  3KCC A;  2FMY A;  4UV8 A;  3ECH A;  4UVC A;  4M72 A;  1F1Z A;  3RYP A;  2CG4 A;  1LDJ A;  4ESJ A;  4CHU A;  4Y17 A;  1R1V A;  4LLN A;  1UB9 A;  3GFL A;  1W4M A;  3T8R A;  3RKW A;  3PFI A;  1B6A A;  2R7D A;  4O6J A;  2RKH A;  2X4H A;  4I02 A;  3E5Q A;  4UVA A;  2EV6 A;  2IW5 A;  3WE2 A;  3J7A O;  1EH7 A;  3ZQ7 A;  3K0L A;  3DXJ F;  3RTR A;  4ZYE A;  4WX9 A;  1P6R A;  3GFJ A;  1USS A;  5E17 F;  5DUI A;  2A6E F; 
#chains in the Genus database with same CATH topology
 1X3U A;  3RQI A;  3LNQ A;  4E7Z A;  4U0V A;  4IXA A;  1TQM A;  1KYZ A;  3CUO A;  4HA8 A;  4BQQ A;  1JT0 A;  1K6O A;  3T5X A;  1R4M B;  4NBQ A;  4YEJ A;  3HTS B;  3BR0 A;  2E34 A;  2HQN A;  1PDN C;  1FSH A;  3L2W A;  2R7O A;  1J5Y A;  1TWF J;  1DGW Y;  2D45 A;  3K10 A;  4DOZ A;  2W4S A;  3ONQ A;  1WZ2 A;  3TKY A;  1UG0 A;  3MKZ A;  1PUE E;  2ZB9 A;  4MO7 A;  2Y75 A;  1R7J A;  1R5H A;  5A2Q K;  3RSN A;  2YS9 A;  4RGR A;  2QM3 A;  5B66 C;  2QQ9 A;  2KJB A;  1KU3 A;  4NB5 A;  3LSJ A;  3KEO A;  4RA2 A;  5E3N A;  1HCR A;  1K4T A;  3NWT A;  3V8K A;  2IS1 A;  1YG2 A;  5DCM B;  3ZMS A;  4AYB A;  5E3O A;  1QHH D;  2HDD A;  1P4W A;  1VI0 A;  4HDV A;  1ZKG A;  2DMU A;  4PJL A;  1RKW A;  1J9I A;  5DM6 F;  1MJB A;  2HQA A;  2IGO A;  2JTV A;  1LFP A;  1UEL B;  1QZY A;  2VOO A;  2E71 A;  2HQ5 A;  1ON2 A;  4PJ0 C;  2CFO A;  1QZE A;  1AA7 A;  2IP2 A;  2BY1 A;  5B1B H;  2IBD A;  3FZV A;  5D8K B;  1U5T B;  1HQC A;  3ULQ B;  2HXO A;  2WTE A;  4KIC A;  2EWN A;  1ZHF A;  3DLL F;  1JI8 A;  2G7H A;  2MBF A;  2VPR A;  2ZCW A;  3L2U A;  4A6D A;  3M8F A;  2TDX A;  3ZQG A;  1WRJ A;  3EUH A;  1T33 A;  4A2U A;  4QPQ A;  2GXG A;  1FLI A;  2VI6 A;  5DCF A;  1PUF B;  2E36 A;  2Z16 A;  1YJ9 I;  4BXF A;  1XGO A;  4IX7 A;  2OF7 A;  3LSG A;  3MVP A;  4M9S A;  4EM1 A;  1MBK A;  3ABK H;  1R5I D;  2KFD A;  3BG3 A;  3S1N J;  4L0Y B;  1NK3 P;  3F0C A;  3QU3 A;  2VT3 A;  4HNV A;  1C0W A;  4GCV A;  3FK6 A;  1MZB A;  3H1C A;  2E2H J;  5HS7 A;  2KDZ A;  1H9G A;  1O3Q A;  4DYR A;  3V7R A;  1OKR A;  1H88 C;  3F8B A;  4ZZL A;  1AKH B;  1DU0 A;  3IL2 A;  2CQK A;  2HZD A;  1W5T A;  4O5V A;  3F8F A;  4DJA A;  3OYM A;  3V4G A;  1RUN A;  4LJZ F;  5B3S H;  3HOV J;  1SFO J;  3I3L A;  1X2N A;  2GOM A;  4JX5 A;  2E5N A;  3OMY A;  3E5U A;  3P9I A;  2VJ4 A;  5EG0 A;  3PNT A;  4E7I A;  5E20 A;  3BCA A;  4X0G A;  3H9J A;  4GDF A;  1QNT A;  3S1M J;  2Y30 A;  3S14 J;  4BY7 J;  4IOC F;  2L4M A;  2KZV A;  3AL0 B;  1ZR4 A;  5LGT A;  2I8D A;  2F5D A;  4B09 A;  3I59 B;  1S7O A;  1HF0 A;  1B9N A;  5J3L A;  4RAY A;  9ANT A;  3VYS B;  4XN0 A;  1D0Z A;  2JVG A;  3GVA A;  1T38 A;  3DEU A;  2JUC A;  1DDN A;  1BBY A;  2HVS A;  3L9F A;  3HRU A;  5HOO A;  1POG A;  3J81 Z;  3ECO A;  1IG7 A;  1UFM A;  4DW6 A;  1Z3Y A;  3DWL E;  5J4Y A;  2DPD A;  2HEO A;  2IRF G;  3CF5 F;  1BR4 A;  4MHG A;  2VAS A;  1D1A A;  1XCV A;  1BC8 C;  4D7M A;  3RKY A;  4FAS D;  5M3M J;  1R4N B;  4NC8 A;  1Q1V A;  3W6K B;  2STW A;  3QYF A;  3GTK J;  2VQG A;  1OCP A;  4CYD A;  1E17 A;  4XLA A;  2NOG A;  1ZRD A;  2ESH A;  3QYE A;  3F22 A;  2CQX A;  2K02 A;  4HNU A;  2HVR A;  1RI7 A;  5CPR B;  3DBR B;  2EPF A;  3JCU C;  3BTL A;  3LMM A;  2QCO A;  5DV5 A;  3DPT A;  1BIB A;  4EMS A;  3F9K A;  2GXA A;  1FBS A;  1YTY A;  5BNG A;  1FPQ A;  2MC3 A;  2E35 A;  2IGM A;  2V9V A;  1BI2 A;  2DLL A;  2HZT A;  3EPZ A;  3OYD A;  2YU3 A;  3K4J A;  1X4O A;  2COM A;  2HTJ A;  2DOE A;  1P92 A;  1FEX A;  2DQR A;  2OTJ I;  2FX0 A;  4G7O F;  4UB6 C;  3KZZ A;  4A3D J;  2H8W A;  4P1W A;  3KX2 A;  1FNN A;  2QUF A;  4RB3 C;  5JVT A;  5K1Y A;  3IWF A;  1EV7 A;  2OQG A;  1E3O C;  3WU1 B;  4HW0 A;  1Y6I A;  1R23 A;  1XMA A;  1G3W A;  2F4O B;  2J5O A;  4LB5 A;  4D9J A;  2NOJ B;  4PK4 A;  2E19 A;  3FXJ A;  1SD5 A;  1OYW A;  4F92 B;  3CDH A;  2DT7 B;  1R1T A;  3J7Z I;  3K9T A;  2M5W A;  5CVI A;  3JR9 A;  5L3E A;  4AIJ A;  3QP6 A;  4D5F A;  4BHC A;  1GXP A;  5HS9 A;  3A2K A;  1LE8 A;  3L1P A;  1SAX A;  3DPL C;  5GP9 A;  2Y69 H;  3UKG A;  3BRO A;  1FTT A;  1Z7U A;  3CO7 C;  2K7L A;  3A02 A;  4CCL A;  1MGT A;  2JSP A;  3M8E A;  1RES A;  4BDY A;  1MNM C;  1MJ9 A;  5EYR A;  1SMT A;  2X6O A;  1FOY A;  4IQJ A;  1X58 A;  3QQA A;  4OIO F;  4XL9 A;  5F0H A;  4GFB A;  5BQT A;  2XPU A;  2HWV A;  1XB4 A;  2DXI A;  2R93 J;  3I4N J;  1RC9 A;  4OIR F;  3VOD A;  2KT0 A;  4A3B J;  3PNY A;  3PNV A;  5CKT A;  1G3Y A;  4YIF A;  4JBA A;  4LLG F;  3FHZ A;  1JKO C;  3Q9S A;  1E0E A;  3E6D A;  1FT9 A;  3CDI A;  4YFX F;  2KP6 A;  5JHF A;  4G8X A;  5GAG J;  3PO3 J;  2HKX A;  4RBO A;  1FOW A;  2R5Z B;  4DZP A;  2ZSI B;  3S1R J;  2QEX I;  4WCG A;  4OIN F;  5FGM A;  3DTI A;  4B44 A;  2IGN A;  3I0T A;  3J81 K;  1OFC X;  2K3P A;  3IH2 A;  1GVJ A;  5GAH J;  4KIS A;  1NH3 A;  2DI3 A;  5DEQ A;  3BDD A;  2ZJ2 A;  4X6A J;  5EZG A;  1SD4 A;  2WAE A;  4RM2 A;  4BBR J;  5J8C A;  2DA6 A;  3OSG A;  1SFU A;  1K83 J;  1IF1 A;  1BW6 A;  3BWG A;  1QA6 A;  2XSJ C;  2VQL A;  4CCN A;  2W25 A;  2ZXJ A;  1Z9C A;  1TW3 A;  4XBF A;  1U5T C;  2H94 A;  2PI0 A;  3GLL A;  1BC7 C;  3BR5 A;  2FNA A;  2GXB A;  1NG7 A;  3J80 Z;  5D8L B;  4UV9 A;  3CES A;  1UHS A;  1MBJ A;  2XAQ A;  1S9H A;  3V42 A;  5IYC J;  1RRJ A;  4L9V A;  3GUD A;  2G9W A;  3A0B C;  1LKX A;  5HVQ C;  3I54 A;  4HST A;  4Q4Z F;  2AXT C;  2Q0O A;  4M9X A;  2VOP A;  4DBR A;  3SJM A;  2E5Z A;  2QF7 A;  3L2Q A;  3J7Y J;  4AD9 A;  1A31 A;  4BL0 B;  3FXR A;  1D1B A;  2IA0 A;  1BR1 A;  4A0X A;  4BH9 A;  2LKX A;  1FBQ A;  2M4K A;  2L5Q A;  2O03 A;  3TQN A;  1O3T A;  1I6H J;  1I50 J;  3HGG A;  3ZQF A;  2LF8 A;  2KHM A;  3TP0 A;  4WWC A;  3AAF A;  2STT A;  2CYY A;  4M73 A;  3H5N A;  4LG0 B;  1FC3 A;  3PIP F;  1Z3X A;  5JLW A;  3H5R A;  1GV5 A;  1ETV A;  2NNY A;  4N9I A;  2MA3 A;  4FE4 A;  3IUO A;  1FP2 A;  3FXK A;  3LSK A;  3OIO A;  4XLE A;  5ERI A;  4BE0 A;  1CF7 A;  4A3L J;  2L01 A;  1YHQ I;  4AM3 A;  2Y9Z A;  4BXX J;  2EFQ A;  2RV8 A;  1NK2 P;  4QWQ A;  3ZGK A;  3DV8 A;  2HYG D;  2CS3 A;  3COA C;  4IRG A;  2EZL A;  3R61 A;  3A4C A;  1YJW I;  5HS8 A;  1MBE A;  2K27 A;  4XR6 A;  1OLT A;  4H0E A;  3H9Q A;  3JRE A;  1ETW A;  1LFB A;  4HG2 A;  5CVU A;  2R3S A;  1MD0 A;  2LKP A;  4V2F A;  1G3T A;  5TRD A;  2EA2 A;  1XMX A;  2BV6 A;  4XNF A;  3LSP A;  1ETK A;  2HOT A;  3KP7 A;  1G4D A;  2VQH A;  2L9S A;  3RIR A;  2V6C A;  4M3G A;  3G1M A;  3H5A A;  5J47 A;  1WCM J;  2K86 A;  2ZME B;  5K7F A;  2P4W A;  3Q5F A;  4MLO A;  4JK1 X;  2XGC A;  2XRL A;  1YRN A;  4A3C J;  4NHJ A;  1B4A A;  1TQI A;  4UHT A;  2HOA A;  3R0J A;  3FBN B;  3HHH A;  4C9Y A;  4A93 J;  1FY7 A;  2HPM A;  3U9G A;  2Q8K A;  2V9K A;  2MYS A;  3JRC A;  1B72 B;  4RLQ A;  1YI2 I;  1W7P D;  4I76 A;  2CW0 F;  4XOT A;  2CQN A;  3RQ4 A;  3SZT A;  2EV0 A;  3GME A;  4OIP F;  1G6N A;  5KVR A;  2I10 A;  3PQJ A;  2EA4 A;  1F4K A;  3LQR A;  5LHI A;  4HV5 A;  1G8X A;  2MD5 A;  3SFZ A;  1ON1 A;  1K4S A;  1K78 B;  3GEZ A;  1QO0 D;  4HBL A;  3W2W A;  1T2K A;  3BPX A;  4A69 C;  4ENM A;  2P6S A;  4IL6 C;  1YW9 A;  2PQ8 A;  2WBM A;  1BJA A;  2O3F A;  3JRF A;  3E6C C;  1FTZ A;  5LGU A;  2LBF A;  3TMO A;  4V19 K;  2KDO A;  2NXN B;  3SDG A;  2QQB A;  3QU6 A;  3DBH B;  1ZAR A;  5EEG A;  4A5M A;  4EGY A;  1QBJ A;  2KPM A;  1FYL A;  3J80 K;  1DGR M;  2JT1 A;  4KJZ A;  1JGG A;  3IWZ A;  3O3K A;  2DMQ A;  3SQN A;  4ZYD A;  1J75 A;  4UUS B;  4HLX A;  1ETX A;  1BN5 A;  2WY7 Q;  3P7N A;  2XVC A;  3PL8 A;  4UUT A;  5LEK A;  3CCU I;  1P4A A;  4C30 A;  5D5X B;  3IKT A;  1WJA A;  4L9J A;  4A3E J;  2BBY A;  2ELJ A;  4I01 A;  5DYM A;  4B43 A;  4F7Z A;  1S3J A;  2GZW A;  2VC1 A;  3CLQ A;  2JPC A;  3EQL F;  2PMZ N;  1V3F A;  2EIN H;  4WXD A;  4AID A;  1R6R A;  3BG7 A;  1U6G A;  2ME0 A;  1HA8 A;  1OIS A;  3AG1 H;  1X3W B;  3CMY A;  5E1Z B;  3OYJ A;  2J5P A;  1ZK8 A;  5FD6 A;  4II3 A;  2JJ7 A;  5TIS C;  2A5Y B;  1FBU A;  2QKM B;  1R1U A;  3BP8 A;  2ZNZ A;  1HXD A;  4DGW B;  3HSE A;  1WJF A;  2MH9 A;  4M6V A;  3F23 A;  1RUO A;  1BIA A;  3PUF A;  3QOP A;  4RGU A;  1PVE A;  3VYU B;  4XIC A;  5EG0 B;  1SC7 A;  2RRE A;  1XGM A;  4BBS J;  3TOA A;  1X1D A;  2DYR H;  1Y1V J;  3EYY A;  2W82 A;  3QOE A;  3Q3S A;  3MFK A;  1Z6T A;  5FFZ A;  4A3G J;  3BR6 A;  3CJQ B;  2OBP A;  2P81 A;  3PJR A;  1LVA A;  2ISZ A;  4OMZ A;  4X1E A;  4L5I A;  3TO6 A;  2HS5 A;  1Q1H A;  1KQ0 A;  3DLA A;  4L5J A;  2ELH A;  2AQE A;  4IHS A;  1FMV A;  2CH0 A;  2JA6 J;  5BPD A;  3X2Q H;  3AG4 H;  2JRT A;  5LGN A;  3I71 A;  4IOA F;  3JSO A;  1N77 A;  3ZN0 A;  1AHD P;  1O7F A;  2UV1 A;  3S32 A;  3WG7 H;  4MIM A;  1FIA A;  5IYB J;  4TV7 A;  2HNH A;  2M7B A;  2O5R A;  1X4P A;  4IKF A;  2HPI A;  3ZQL A;  4KN4 X;  1IN6 A;  3CCE I;  2GOX B;  4W1U A;  1LDD A;  1ZLJ A;  4ZH4 F;  3DTK A;  3WTU C;  4ANJ A;  5IP9 J;  2A5W A;  4EJU A;  4BYY A;  1FZP B;  5EEH A;  3VYR B;  2AXL A;  1JJ8 C;  1SFE A;  1Z67 A;  2RDP A;  3BCB A;  4BY1 J;  3A01 B;  1KZH A;  2KIM A;  3GF2 A;  3KYD B;  4XRS G;  4BHB A;  4LIU A;  2LG4 A;  4XLP F;  5M3F J;  3HDD A;  1RNL A;  3ERM A;  3M8J A;  2R7Q A;  1YIO A;  1WH7 A;  3SXY A;  3I5U A;  2EV5 A;  4LMY A;  4MQ9 F;  1Z0X A;  2CW8 A;  3F8C A;  3K2Z A;  3JRG A;  3NAR A;  5FLM J;  3OYK A;  1MH3 A;  5E1W A;  2JWT A;  3RPU A;  5CVJ A;  2M8E A;  1FYK A;  2WY8 Q;  4ZDL A;  4E7S A;  3HOY J;  4P5O A;  1D0Y A;  3SZP A;  2VXD A;  3K4B A;  3V8J A;  3KE2 A;  1IRX A;  3R0A A;  2L54 A;  4IHV A;  3SYT A;  3WU0 A;  5GTI C;  1HBX G;  3W2A A;  4A3K J;  5E8I A;  2DAO A;  2O9L A;  4ENN A;  2V1D A;  1G2H A;  2XIG A;  3OYH A;  3OY9 A;  2BYV E;  3O2P E;  5GAE J;  4UNO A;  1MBH A;  3ZP5 A;  4ZTF A;  4G12 A;  4I98 B;  2KL4 A;  4CYC B;  1DP3 A;  1SAN A;  2FBH A;  3HRS A;  1MBG A;  2PJR B;  2EIM H;  3C7J A;  3DEW A;  1S72 I;  3DKX A;  2X0L A;  1W7P A;  5EGO A;  3D1N I;  2ZFU A;  1GV2 A;  1BA5 A;  2QQA A;  2LKS A;  2XPW A;  5CLS A;  3FIS A;  5JLX A;  4KT5 C;  2K5C A;  1XD7 A;  3WHC A;  2RN7 A;  3S15 J;  4Z2Y A;  5F0F A;  5L3F A;  3GLX A;  2X9D A;  4OMY A;  2ZO4 A;  3GTJ J;  2K40 A;  3OYB A;  2WV1 A;  2DA1 A;  4HRI A;  1Y0U A;  5HLI A;  5HLG A;  2EIK H;  2ETH A;  2B9S A;  4GGG A;  4HX8 A;  1ZLK A;  1B8I B;  5AIQ A;  3GZ6 A;  2R7T A;  4F3Q A;  3CCL I;  1F9N A;  3PM1 A;  3ZRG A;  3HYI A;  3GTO J;  1MKM A;  1IW7 F;  2XV4 S;  3MCZ A;  5E8G A;  2OZU A;  2BXZ A;  2KMU A;  3BJO A;  3ABL H;  3G73 A;  2E1N A;  3RJP A;  2OTL I;  4PJN A;  2ZME C;  1MDM A;  2H09 A;  4KYW A;  5EEA A;  5C4X J;  2ECC A;  1LFU P;  3L00 A;  4L9N A;  2R7Z J;  5FKO A;  3TGN A;  4PJJ A;  2L02 A;  1IXC A;  1Y0N A;  2K4B A;  4ZTJ A;  1ZG3 A;  2VXZ A;  2H1L A;  3ESW B;  3K7A J;  4EJT A;  4MTD A;  1JKP C;  2CV1 A;  4D5C A;  3F6O A;  1ZRE A;  2DFH A;  4M9Z A;  2M3A A;  5GPA A;  4HNT A;  2L7K A;  1H8A C;  2QZ8 A;  4E70 A;  1JTY A;  2QBY B;  3ZQH A;  2XF6 A;  1ENH A;  5LHG A;  3WGH A;  3N4M A;  2V1N A;  3PSF A;  4M3D A;  4YFN F;  3L2V A;  3HSR A;  2LMD A;  3GYH X;  6PAX A;  1ZAO A;  2CU7 A;  4IF4 A;  3E7L A;  2DTZ A;  3EUA A;  1IGN A;  4LLL A;  1IUF A;  2O8X A;  5IYD J;  2WAD A;  1XSX A;  3JRB A;  4LK0 F;  1MMD A;  2CQ7 A;  5HOD A;  2OU2 A;  4EV0 A;  3ASO H;  4ESB A;  4QIW N;  2VKH A;  3VWB A;  2LC2 A;  2L9N A;  3QRF F;  3DFG A;  2KLO A;  1MJA A;  4PFP A;  2EFN A;  3F72 A;  1W5S A;  4M71 A;  4CA0 A;  3OOP A;  1P7I A;  2VJI A;  1N25 A;  1YX5 A;  4C3H J;  2XHK A;  2DFI A;  5JVG F;  4HF1 A;  3FXL A;  3C2G A;  1MNE A;  1ZTR A;  2K9S A;  4OAY A;  2E7W A;  1EKE A;  4CXF A;  3CC2 I;  1NTC A;  4Q5S F;  2OCE A;  4BQA A;  2ZXI A;  4RAG A;  2PFB A;  2Z3Y A;  3HXL A;  3VB2 A;  4QSH A;  1T8I A;  3Q9V A;  4M74 A;  5KCM A;  3L09 A;  5IT3 A;  3C18 A;  1J09 A;  4F93 B;  4DIQ A;  2R7F A;  4DNC A;  3WGI A;  1IV6 A;  3A0H C;  2DOF A;  2R5Y B;  4R79 A;  2BE5 F;  2RQQ A;  2NVU B;  1HC8 A;  3B6C A;  4PJM A;  2BW3 B;  2A69 F;  4A0Y A;  5ILU A;  4XRS A;  3IV5 A;  1H9T A;  2OD5 A;  4RB1 A;  3M4O J;  2X6X A;  4BJ5 C;  2HQR A;  3CJR B;  4BEH B;  3E0J B;  1KU7 A;  3IHU A;  3FM5 A;  2BHZ A;  3ZMT A;  1OPC A;  1JXS A;  4HSR A;  3K6G A;  2VKE A;  3MZH A;  4LGW A;  4UXN A;  4H4K C;  3BQZ A;  3HB9 A;  3OS0 A;  2R7U A;  3DPU A;  3S1Q J;  2DJI A;  2DA7 A;  3KFW X;  4L9T A;  1WJE A;  1JGS A;  3CUQ B;  1RIO H;  2H8R A;  2NYX A;  3HUG A;  4CUG A;  3TL4 X;  3V7S A;  4NUB A;  1K61 A;  5IOZ A;  2ZNY A;  1UHW A;  2CSO A;  3HGY A;  3H0G J;  1AU7 A;  2EFP A;  3DTE A;  4N9H A;  2GAU A;  2JK3 A;  3E97 A;  2JUG A;  2ELK A;  3GFM A;  2W48 A;  3FKI J;  4EM0 B;  3FXQ A;  1WH5 A;  5J1R A;  4FTH A;  1VZ0 A;  1TLH B;  4A3F J;  3SEZ A;  5D6F A;  3G4S I;  5J40 A;  3A03 A;  1OJL A;  3CQZ J;  1HKT A;  1GHC A;  3T1B A;  4NQW B;  2VBY A;  1ZYR F;  2H6C A;  2VB6 A;  5EJC A;  2IGK A;  2QSF X;  3EET A;  4AC0 A;  5E79 C;  2Z99 A;  2BZT A;  2IPQ X;  1IO2 A;  4FCY A;  4ITV A;  1WFX A;  1X2M A;  2EZK A;  1V5E A;  3PIO F;  2FSW A;  4BJT A;  4Q48 A;  3W6V A;  5HLH A;  3P9K A;  4O3M A;  1U78 A;  1VFC A;  3D0S A;  3FBI B;  2A07 F;  2KKO A;  1D5V A;  3I56 I;  2R7S A;  5D5V B;  4XSZ F;  4BS9 A;  1ETQ A;  1EJ9 A;  2L9R A;  3I4P A;  2Q2E B;  1LEA A;  1R58 A;  1V54 H;  2M87 A;  1WSU A;  1T08 B;  5GTH C;  3KP5 A;  5FKL A;  1FP1 D;  5LD2 C;  4ETS A;  4XRM A;  2L9V A;  3MAJ A;  3OYF A;  1QVT A;  3TO9 A;  4P96 A;  1MIJ A;  4YFK F;  3FKJ A;  4EVI A;  3H9G A;  3FXU A;  3FXO A;  2GBY A;  4XLF A;  1YW8 A;  2XPV A;  4EM2 A;  2ECB A;  2JN6 A;  4HYE A;  1SMY F;  2HR3 A;  2XC7 A;  3H0D A;  1FWZ A;  1JKQ C;  4XKB A;  5H20 A;  2MSY A;  3K1N A;  2XDV A;  1UG2 A;  3M1E A;  2V7F A;  3R60 A;  2XKO A;  4UB8 C;  3LAP A;  1SVM A;  4IRH A;  3BOQ A;  3K2A A;  4F91 B;  3JRI A;  2JQ7 A;  4J00 A;  4RDU A;  3HPH A;  1R71 A;  3CMA I;  1XSD A;  3BR1 A;  1R22 A;  1Y8Q B;  5LRS A;  1TNS A;  4Z6Y A;  4IVN A;  5K7Z A;  4D1Q A;  2WAQ N;  2FOK A;  4JX4 A;  1PJR A;  4B4C A;  5LLQ A;  4I99 C;  1F43 A;  1FX7 A;  2W00 A;  1WKM A;  2XKP A;  1HKQ A;  3PUB A;  3FDY A;  4A3I J;  3N97 A;  1S29 A;  1WI3 A;  3U21 A;  2ISY A;  5DUK A;  1QRY A;  3TW7 A;  5TJJ A;  3GX4 X;  5DS9 A;  1KA8 A;  1S6L A;  4E7L A;  5DCM A;  3FWE A;  3H3Z A;  3GTP J;  2DN0 A;  1HOM A;  2G0E A;  2DFF A;  3I9V 2;  3CJN A;  3K4M A;  1UAA A;  2M8G X;  2FQ3 A;  4G7H F;  3G1L A;  2XGE A;  2HXI A;  3L2C A;  1REP C;  3R6S A;  2QVO A;  4AUX A;  3N05 A;  4D0P A;  2WWY A;  2MLK A;  2RQP A;  4BXU A;  1XMK A;  1SVO A;  4XLH A;  5BMZ A;  4I0A A;  3PQK A;  5D5W B;  3MZ8 A;  3V8L A;  4CCK A;  5F1R A;  2V6E A;  1I3A A;  2KRF A;  3LAJ A;  3DKY A;  3CDL A;  3WU2 C;  2MFZ A;  5F64 A;  1T6S A;  1YQA A;  1U5T A;  4G6T B;  2K3F A;  2CWE A;  4NDL A;  4M6X A;  1GDT A;  2UWM A;  4HX7 A;  2DBB A;  3LA2 A;  4PSX A;  4R1H A;  4UVB A;  2WC2 A;  3RPQ A;  2AHQ A;  1AWC A;  3W6J B;  5LEJ A;  1PUF A;  3T8T A;  3W2V A;  1VF9 A;  1O4X A;  4KNY A;  1FMW A;  2QKL B;  2DT6 A;  4S0H B;  4EEF G;  5IP7 J;  5FFX A;  4BJ6 C;  3ERE D;  2E60 A;  4RB2 C;  3NQO A;  3WTW C;  3WTZ A;  3K4K A;  1BM9 A;  4QTR A;  4L18 B;  5J4V A;  3RI4 A;  3CP8 A;  1IDZ A;  1MW7 A;  2DA4 A;  2CUJ A;  5KNL A;  2LY1 A;  4LD5 A;  4PZJ A;  3O6B B;  4F55 A;  3BPV A;  4B48 A;  2LY2 A;  3S93 A;  3OS2 A;  2LRE A;  2VBZ A;  3D5S C;  3NAU A;  1XTA A;  1Y8R B;  1IDY A;  5CJ9 A;  2CGP A;  3B73 A;  2X1C A;  1JTX A;  1WHU A;  2XRN A;  1WGX A;  5F27 A;  3SDB A;  5AON A;  1VQK I;  1SAU A;  1QHG A;  4P55 A;  3OIQ A;  3VFZ A;  2XAG A;  1BI0 A;  4BAY A;  3S3N A;  3HBL A;  4Y3O A;  3AL0 C;  5J1U A;  2L7M P;  2Z33 A;  4HF2 A;  3OR2 C;  1DU6 A;  3VOE A;  3GTM J;  3S3M A;  5KAF C;  2D1V A;  4G6D A;  2LLK A;  5FRO A;  4D7N A;  1ZN2 A;  2R4G A;  5D4S A;  3J7A Y;  2MC4 A;  3FIW A;  3GZN B;  2YSR A;  1K79 A;  1ETO A;  3RCO A;  1XGS A;  3EYI A;  3HTU A;  4B3A A;  5FKN A;  1Z1D A;  3I59 A;  3LST A;  2L7F P;  2D5V A;  3HM5 A;  2DMN A;  4EJO A;  2FEZ A;  4E7H A;  3G3Z A;  4A6E A;  2DA2 A;  1GXQ A;  4KIG A;  1V5F A;  2VKD A;  1W36 D;  2L3D A;  3KEY A;  5L3B A;  4B3X A;  1GUU A;  2PMZ A;  1S7A A;  1KQ9 A;  2IS2 A;  1YLF A;  2RC4 A;  3BZ6 A;  4FX0 A;  1SFK A;  2CRG A;  2DMT A;  4XSX F;  2YR2 A;  5B1A H;  4AIK A;  4YII A;  1IJW C;  3BG5 A;  1S7E A;  4V2G A;  3ZMD A;  3ZOB A;  2XAF A;  1CGP A;  2YX7 A;  4S04 A;  1HST A;  2QYO A;  1LQ1 A;  3DP7 A;  1FYM A;  1QPI A;  2QGU A;  2NVQ J;  2PX9 A;  5HNF A;  2A05 A;  3IP4 B;  2DK8 A;  2D1H A;  3FF5 A;  4RS8 A;  2DMP A;  1IN4 A;  5FO5 A;  2PEX A;  1IRF A;  1XSV A;  2ZJQ F;  4G94 A;  4XLN F;  1R9T J;  2NAZ A;  3WG9 A;  2DOD A;  1O7L A;  2EZH A;  1LDK B;  3ZMU A;  1A04 A;  3L2R A;  1IUY A;  5E3L A;  5F1J A;  3GTQ J;  2BVL A;  1U3E M;  2Z9O A;  4ON0 A;  3M7G A;  2FA5 A;  4BQO A;  2XAJ A;  3CCQ I;  1T0F C;  3VSK A;  3WE3 A;  4Y33 A;  2AO9 A;  1YFH A;  2IS6 A;  1KU2 A;  1ZGA A;  3JRA A;  1J59 A;  2XGX A;  2WV0 A;  3KPH A;  2IS4 A;  1IXS B;  3ROU A;  2HVQ A;  2M45 A;  4ZYA A;  4QLC U;  3TW6 A;  2BY2 A;  3CCJ I;  5LBQ A;  1ZR2 A;  2ZXH A;  2Y0S N;  3DEE A;  5FKM A;  2JA5 J;  2K9N A;  3JTH A;  1N75 A;  3WTT C;  1BI1 A;  3C3W A;  2M1B A;  2W85 A;  4CO8 A;  5K7H A;  4JX6 A;  1IN5 A;  2C6Y A;  3ZMV A;  3ABM H;  5B5E C;  1X1C A;  2ICW G;  4KIB A;  3BJA A;  3G1O A;  2FE3 A;  3AFH A;  3NEU A;  2K9L A;  2LF7 A;  1KGS A;  1J7K A;  2RNG A;  2O8K A;  2JVH A;  4U0W A;  3BTJ A;  1W0T A;  2VQC A;  2H1K A;  4CIC A;  2OUM A;  1P4X A;  3MZY A;  2K9Q A;  1VQL I;  3S2H J;  1XPX A;  2LD5 A;  3BLY A;  3KLN A;  2VPL A;  2XAU A;  3A1Y A;  4AWX B;  5ICG A;  3ZCO A;  4FX4 A;  1TQP A;  1G59 A;  2E1C A;  4PFO A;  4XMY A;  2GLO A;  4WXH A;  4U87 A;  1VQN I;  4P9F A;  5M5W J;  3BZC A;  2LNB A;  3GW2 A;  3S8P A;  3HRM A;  2E1O A;  2DDA A;  2MH2 A;  2FQ4 A;  3QAH A;  4P9U A;  2KIU A;  2IVM A;  3HOW J;  2RVC A;  1ACI A;  4BNC A;  2HGC A;  4IHW A;  2FD5 A;  2GIV A;  3CCY A;  2UUZ A;  2B0L A;  3GWZ A;  3G6E I;  2XAS A;  2Z5U A;  3CTA A;  4IPA A;  5F6F A;  1SD7 A;  3DU5 A;  2NRA C;  2VE8 A;  1VQ9 I;  3S2D J;  1GVD A;  2HDW A;  5CVR A;  2LY9 A;  1LNW A;  1XDS A;  3IH4 A;  2R5Z A;  4E4H A;  1TL8 A;  1XS9 A;  3GBG A;  3HUG B;  4HX4 A;  5HLT A;  3K1M A;  3F21 A;  3CCV I;  4C3I J;  3ZR8 X;  3H3V K;  3FMR A;  4C2U A;  2DJN A;  3REO A;  1KU9 A;  2YX4 A;  3IH3 A;  3TDZ C;  1XDU A;  2LFB A;  1ETY A;  1UST A;  3BTC A;  3LWF A;  3HJE A;  3OV8 A;  2XF5 A;  3QPH A;  1NG6 A;  1MMS A;  1N78 A;  2IXS A;  2NVX J;  2YU9 J;  4RAZ A;  3FXM A;  4XOR A;  3KIO A;  4BGD A;  2X48 A;  3AKZ A;  3TBI A;  3Q0W A;  5ICF A;  5M5X J;  1GT0 C;  2NS7 A;  3HSF A;  3IKV A;  3ABT A;  4Y7N J;  5ILV A;  3CF2 A;  3GTL J;  4LFU A;  5DTD A;  3S3O A;  1UMQ A;  1A5J A;  1VTN C;  4XQF A;  1HW5 A;  2FNP A;  4ASN A;  1MSE C;  3TED A;  1W36 C;  2GIZ A;  2GA1 A;  2F5C A;  3BY6 A;  1U9N A;  1TC3 C;  4ZC3 A;  2M9H A;  2DFE A;  3OYC A;  3MMY B;  2ADU A;  3P5J A;  1LEB A;  3MN2 A;  4OOI A;  2AS5 F;  2F4I A;  1WI9 A;  2M0C A;  3IRR A;  3ZPL A;  4CZZ A;  3AG3 H;  2X6Y A;  1ODD A;  2G7U A;  4LG0 A;  5M5Y J;  2L7Z A;  3TP3 A;  3JTG A;  3M9A A;  2O7O A;  3K69 A;  2H6B A;  3WTS C;  1QZZ A;  3FMS A;  5DD8 A;  3S2W A;  4WF2 A;  1I6X A;  5FJ8 J;  5GPC A;  1TT5 B;  4KUM A;  3DU6 A;  2R0Q C;  1LE8 B;  3L7W A;  5E1X A;  3ZQI A;  2L4A A;  2JRM A;  1YIJ I;  2QWW A;  4XKC A;  2A6H F;  2LRD A;  4YG2 F;  4BU2 A;  3TO7 A;  2NS0 A;  2W84 A;  4ESF A;  1T95 A;  5FB2 A;  3U1D A;  2UXX A;  1LB2 A;  1S5L C;  2VUM J;  5J6X A;  2DW4 A;  5F0C A;  2WB1 N;  3HKZ N;  4N4O B;  3NWS A;  1P9Q C;  2QSG X;  2D2W A;  2JSC A;  2V1X A;  4MNU A;  2DTR A;  4AVP A;  4E7J A;  1ZQ3 P;  2HFH A;  3C2H A;  5EZH A;  3K70 D;  1BI3 A;  1MND A;  2ZKZ A;  3OYG A;  1MBF A;  2ZXW H;  1D8J A;  1KON A;  4I7H A;  4U88 A;  2CMP A;  2EK5 A;  1K7A A;  5IY5 H;  2KIS A;  2UXN A;  3KP3 A;  2IT0 A;  4UUV A;  3BR3 A;  3JAM Z;  1S8N A;  3SHF A;  4GXO A;  2EIL H;  4ABZ A;  3FHN A;  3EDP A;  4XLC A;  1T56 A;  2ZME A;  5L3D A;  4M3B A;  3CMM A;  5CYV A;  5DM7 F;  3HEF A;  2OJE D;  1TBX A;  4LK1 F;  4DYC A;  1ZRC A;  2ZJP F;  1J0R A;  2VC0 A;  3E5X A;  2HU9 A;  2O6G E;  2HKO A;  3SEQ A;  1VQ8 I;  5H6Q A;  2DK5 A;  5J1Y A;  5FLX Z;  1ONV A;  3FMQ A;  1B72 A;  2X51 A;  3H36 A;  2UZK A;  2KJC A;  2M7A A;  3MEX A;  4IHT A;  5L3G A;  1T98 A;  4J19 A;  1LUJ B;  2ZJR F;  1I39 A;  3K4L A;  4JQF A;  2V9P A;  1BJZ A;  1Z21 A;  3KYC B;  1E3H A;  3F6V A;  4RMN A;  2LR8 A;  1P7J A;  2LVS A;  4IHX A;  2DCE A;  3F8N A;  3EUH C;  3GO5 A;  2P7C B;  1K78 A;  2ACJ A;  4XK4 A;  3P9C A;  2RNJ A;  4HEA 2;  2W57 A;  3KZY A;  1VQM I;  1VQ7 I;  2IA2 A;  2M2E A;  1ZG1 A;  2E2I J;  4EJW A;  1TZL A;  5IPA A;  5H6R A;  3ZQC A;  1EA3 A;  2PBI A;  2VIX A;  3HOU J;  3MQ0 A;  4E6K G;  1UHM A;  2JMW A;  3ISP A;  3PO2 J;  3QP5 A;  2EFW A;  4MFD A;  1ZRF A;  3G71 I;  4UUS A;  1ZH5 A;  3HRT A;  3I64 A;  4L0Z B;  2LSO A;  4FHT A;  1IN8 A;  1A6Q A;  3NRV A;  2M4G A;  4KT6 A;  2IJL A;  4AYB N;  1HKS A;  3HOT A;  1OQY A;  2CUE A;  1BOB A;  4BHP A;  3F3X A;  2O61 A;  1DPR A;  4Y4R A;  1E3P A;  3ZQQ A;  4MQV A;  5LFA A;  3JSP A;  2X6W A;  4CCO A;  3FM3 A;  2HYF A;  1D5Y A;  1P2F A;  2DO7 A;  3LFK A;  4DQ2 A;  2ZFW A;  4A0Z A;  2P5K A;  1CF7 B;  4F52 A;  1PYV A;  2OV7 A;  4ZYH A;  1JUP A;  3IC7 A;  5EDN A;  4BE2 A;  1RPW A;  4HLY A;  1JUM A;  2EZI A;  2V79 A;  1DPU A;  3LA7 A;  2IAI A;  4WXC A;  3M1C A;  3OYN A;  5BPI A;  4M3F A;  2F2E A;  5F04 A;  2QQ8 A;  2F5V A;  2DPU A;  1LPQ A;  3OIP A;  2VOD A;  4QPO A;  1X3Z B;  1FSE A;  2VON A;  3LL7 A;  4KDP A;  3WGG A;  3QPT A;  1B59 A;  4OAZ A;  3JRH A;  4KN7 X;  3VYT B;  4PUS A;  4G6Q A;  3UR3 C;  4ZZD A;  2P5V A;  5L3C A;  4LG3 A;  2HDC A;  2Z1D A;  3MKL A;  4PGG A;  5HDN A;  1TWG J;  3LOC A;  1LJ9 A;  2R7R A;  2XRO A;  3D5L A;  1B1B A;  2JZY A;  2V1U A;  4IJA A;  2FF4 A;  4OWR B;  1R5G A;  4HZF A;  4UY8 I;  5AIP A;  4OIQ F;  1BOA A;  1I5Z A;  1D8K A;  1YJN I;  3BZK A;  2IA1 A;  2HYJ A;  2K4J A;  2X1E A;  1I1S A;  1JT6 A;  2OCC H;  3E6B A;  5IP6 A;  2Y2Z A;  2F4M B;  1T39 A;  1YRN B;  1Z6R A;  2XB5 A;  1FJL A;  3HL2 A;  3JAM K;  3ZMZ A;  2Y9Y A;  3CJT B;  4Y52 J;  4R8H A;  4Y15 A;  1ORK A;  3VPR A;  3TOB A;  1B9M A;  3R4K A;  3TDU C;  4YEL A;  1Z05 A;  3I58 A;  2LK2 A;  2FJ1 A;  2LDU A;  4YIR X;  1O3S A;  1ZGJ A;  2IEK A;  2ZSH B;  2ME6 A;  3A01 A;  4I09 A;  4ZDP A;  3DKW A;  3KEQ A;  1U9O A;  3E1S A;  1Y39 A;  5FLX K;  4IEJ A;  5J8F A;  4DZJ A;  3GXO A;  3K70 C;  4K2E A;  2GM4 A;  3BTI A;  3K1P A;  2KRH A;  1WJD A;  1ZEL A;  1WWX A;  2PMH A;  2YUS A;  3OS1 A;  4JP0 A;  2LBF B;  3ZN1 A;  1OMI A;  3QPL A;  1OYY A;  3BJ6 A;  1DUX C;  3HOZ J;  2WAQ A;  3WTY C;  1OCC H;  1Z91 A;  3VEP A;  1A35 A;  5HDG A;  4A3M J;  5E3M A;  3HC7 A;  1QPM A;  1FOX A;  1WVR A;  4PSW A;  3OYL A;  3UNG C;  3AG2 H;  1W5C C;  1WJC A;  2FBI A;  1JE8 A;  2Y48 A;  1R49 A;  1M1E B;  3BC8 A;  1E2X A;  1G3S A;  1Y56 A;  4HQM A;  4CYC A;  2P6T A;  2DA5 A;  1XGN A;  5CQE A;  5E18 F;  1KQ8 A;  5CVV A;  1D1C A;  3U2R A;  2PJR A;  4IO9 F;  4XOP A;  4CCJ A;  1TP4 A;  2EFO A;  1K6Y A;  1SFX A;  4G7Z F;  1RKT A;  2E7X A;  4AIH A;  2OPT A;  4FT8 A;  3HOX J;  4BUP A;  4M3E A;  2BXY A;  4I0B A;  3LA3 A;  4GYG A;  2E1M B;  1I3Q J;  4MGR A;  3OSF A;  4FE7 A;  1QU3 A;  3F8M A;  2B63 J;  1Z77 A;  4M6Y A;  4S05 A;  1IAW A;  1YE9 A;  2QSH X;  4AU7 A;  3SFI A;  1A36 A;  1Z7L A;  4U7B A;  3DQV C;  3LSI A;  1MH4 A;  2OAZ A;  2MW8 A;  4ZJZ A;  3MWM A;  5IT9 Z;  3RYR A;  2OQR A;  2MD0 A;  4HV6 A;  2LOO A;  1RZ4 A;  1O57 A;  2KIF A;  1B8I A;  2BY0 A;  2BY3 A;  5K5R A;  1TNT A;  3E6M A;  5FRN A;  3CCM I;  1V55 H;  5C44 J;  2LYC A;  1TWC J;  3PFY A;  5KHD A;  3FK7 A;  2GA2 A;  3HZJ A;  4B8X A;  1O3R A;  2V4J C;  4KIF A;  1FOK A;  3S16 J;  4CZC A;  1IC8 A;  4B47 A;  2ID3 A;  3V7C A;  1EF4 A;  1ULY A;  2LP0 A;  4N4N B;  1RET A;  2EQR A;  2M0M A;  2R7W A;  2P5L C;  1TWA J;  1X1A A;  3ABU A;  1W1W E;  3T0Y A;  2FBK A;  4G9Y A;  3MKY B;  1AOY A;  2MGQ A;  4C3J J;  1TW2 A;  1VQO I;  2BGC A;  4LB6 B;  4IRI A;  1UCR A;  3GCM A;  4KMU X;  5KK1 A;  1LVK A;  2B7E A;  3EUK L;  3LFU A;  1F5T A;  2ID6 A;  1XG1 A;  1IN7 A;  5K5O A;  4U7D A;  1TWH J;  1HDD C;  1OCT C;  3BR2 A;  2FXA A;  4CDG A;  3OYE A;  4BAC A;  4E7K A;  1U8R A;  4FET A;  4C2M J;  4WK8 F;  2QBY A;  4A12 A;  5ICC A;  5KAI C;  2A68 F;  4I6Z A;  2O0Y A;  4LIT A;  2K9M A;  1YS7 A;  4MFE A;  4HAM A;  1ZG5 A;  1WJB A;  4JOM A;  3GZ5 A;  1L3L A;  1X1P A;  1VQ4 I;  3FX3 A;  3HOS A;  1MSF C;  3CME I;  3JRD A;  2GWR A;  3QYB A;  3CC4 I;  2R7X A;  3ASN H;  3W3C A;  2CUF A;  2MG4 A;  1YIT I;  1I1G A;  3MKW B;  5BOX A;  1XCB A;  2ZBK A;  1HDP A;  2AQF A;  4W97 A;  5HNH A;  2HTS A;  3ZXS A;  4CGZ A;  2KZG A;  1FIP A;  1IZ1 A;  4XM3 A;  3KZI C;  4EJV A;  2MLG A;  2NVY J;  2VT2 A;  3B02 A;  4IHY A;  4A5N A;  3KLO A;  2GQQ A;  1AKH A;  1QVU A;  3B6A A;  3HHG A;  2DU9 A;  3DCF A;  3KP4 A;  4MEY F;  2PJP A;  2XF7 A;  1JUS A;  4RAF A;  4II2 A;  3LQQ A;  4CH7 A;  2F48 A;  5TGT A;  4C2T A;  3H35 A;  1Y1W J;  4EAT A;  1W7P B;  1IXR C;  2I5U A;  5EGO B;  2R7V A;  4L5E A;  3OL3 A;  4FIS A;  2EB7 A;  2EIJ H;  2CW7 A;  3QPS A;  5D6E A;  2CFX A;  2WAF A;  1OR7 C;  3LSR A;  4JYK A;  4GO1 A;  4GRI A;  3M3Y J;  1R00 A;  1HSJ A;  3CZ6 A;  2R92 J;  5FRM A;  3WOD F;  4BKX A;  5DUI A;  3CCR I;  1RR7 A;  2Y31 A;  3KYL A;  5IOY A;  2P7V B;  4ENJ A;  3LSM A;  1OR7 A;  3CLO A;  5LRR A;  1BW5 A;  3BT9 A;  1X1B A;  3C1D A;  1GLN A;  4BE1 A;  2XB0 X;  4GYI A;  2Z2S B;  2DYS H;  2R5Y A;  2L2O A;  2FUG 2;  1SVL A;  2QA4 I;  2BW3 A;  1UZC A;  3ELK A;  3Q0U A;  1MMA A;  2VJ5 A;  4HPQ A;  5FD5 A;  1ZGW A;  4IZZ A;  3KP6 A;  1SEU A;  4BEH A;  5D4R A;  4RGX A;  4RGS A;  2HOE A;  1W0U A;  3K4N A;  1IRG A;  3RPU D;  2NNN A;  4RB0 A;  3CUQ C;  5ED4 A;  1U8B A;  1DP7 P;  2VBX A;  3H92 A;  2A61 A;  3OL4 A;  2LH9 A;  3DBL B;  5C3E J;  1MDM B;  4AVZ A;  5IT9 K;  1R36 A;  4CCM A;  3S17 J;  4RM3 A;  3CUQ A;  5BS6 A;  3OYI A;  2Y0S A;  2PG4 A;  4XON A;  2FU4 A;  1H0M A;  4XRF A;  4U0Y A;  5F08 A;  2EBI A;  4PDK A;  2W1O A;  3VSL A;  3CO6 C;  3ML6 A;  4MTE A;  2VL8 A;  1YOV B;  2X85 A;  1UJ8 A;  4ZDO A;  4KIT B;  5DD4 A;  1IV8 A;  5JI6 A;  4HOB A;  2RGV A;  2Q1Z B;  1YW7 A;  3O8H A;  1J2X A;  4BQN A;  3PSI A;  2JA7 J;  2OZ6 A;  1OYI A;  5GAD J;  2P8T A;  5JFR A;  2JA8 J;  2BEO A;  1QQI A;  2EH3 A;  3O8G A;  1ITY A;  3LSH A;  3D5R C;  2YPR A;  4NQW A;  2VJJ A;  1YYV A;  2XUB A;  4MEX F;  1IRZ A;  1YX3 A;  3SZG A;  1L0O C;  1WPK A;  2QLZ A;  2DDB A;  1ERD A;  4KA4 A;  1D0X A;  2JA2 A;  2X1D A;  1YO5 C;  1D3Y A;  1BL0 A;  1H89 C;  2N8G A;  5JHU A;  2PN6 A;  2XGD A;  4FQG A;  4ENK A;  3WHB A;  2M30 A;  2W7N A;  1OCZ H;  2P0W A;  4PCQ A;  3BG9 A;  2VE9 A;  2Q2E A;  4KFC A;  1T0F A;  2BHY A;  5JR3 A;  3DF8 A;  4DBQ A;  2F5E A;  2F6C A;  3RKX A;  4EGZ A;  1JKR C;  3CCS I;  3KET A;  2PMU A;  2XAH A;  1U2W A;  2W24 A;  2A3S A;  4LIV A;  4HF0 A;  4LOC A;  2CO5 A;  4Q47 A;  2OA4 A;  1APL C;  1VND A;  1V5G A;  4EQQ A;  4J01 A;  1VQP I;  3I53 A;  1STZ A;  1XC5 A;  2A6T A;  2FRH A;  2V26 A;  4N0B A;  3HPG A;  3QOD A;  4HDU A;  2ZC2 A;  1V4R A;  3WTX C;  2CV0 A;  2HOS A;  5ILS A;  1EH8 A;  4ZYG A;  1MMN A;  2LTP A;  3HIF A;  1BR2 A;  3GFI A;  3KP2 A;  2XSD C;  5LHH A;  2DQL A;  1OCR H;  3E3V A;  1WQ2 A;  3RKQ A;  2CV2 A;  3GTG J;  2E1M C;  1JHH A;  5C4J J;  3IRQ A;  2VLA A;  5A2Q Z;  3K4C A;  2TRT A;  1WJ5 A;  1SD6 A;  5CQG A;  5ICE A;  5FKK A;  1KYW A;  5H2F C;  5HDK A;  4PGH A;  2CUZ A;  4XKW A;  2VKV A;  1NHA A;  2KQR A;  2Y0M A;  2CQQ A;  4YRV A;  2JPB A;  3IAM 2;  1VQ5 I;  3CC7 I;  1VQ6 I;  1HW2 A;  3OYA A;  3WTV C;  2L0K A;  2NS8 A;  3VDX A;  3OR1 C;  3OWT A;  2DOA A;  4Y13 A;  4I2O A;  3RZO J;  2OC6 A;  3Q0V A;  2KRC A;  2EJR A;  3M07 A;  3I55 I;  3IAS 2;  2CJJ A;  2KIQ A;  1PP7 U;  2PLY A;  3C2B A;  1HW1 A;  2FOW A;  3RDI A;  4A3J J;  2VBW A;  2E2J J;  2FML A;  3JW4 A;  3CD6 I;  1XN7 A;  1PP8 F;  1TT0 A;  1CQT A;  5D5U B;  5K5Q A;  2H27 A;  4KMF A;  1YS6 A;  2COB A;  4B1R A;  4HQE A;  1JHF A;  4NNJ A;  4OU0 A;  1QGP A;  1TTY A;  2F5F A;  2QEN A;  2VN2 A;  1I27 A;  3H3U A;  4NC7 A;  4RLF A;  2ESN A;  3BQY A;  1HLV A;  5DDG A;  2TCT A;  1EH6 A;  1MMG A;  3KCC A;  2FMY A;  4UV8 A;  3ECH A;  4UVC A;  1OCO H;  4M72 A;  2BOL A;  1F1Z A;  3RYP A;  3HG9 A;  3U1K A;  2CG4 A;  3G2B A;  3I4M J;  2WA0 A;  1LDJ A;  4DYQ A;  5FLV A;  2BVM A;  4BDZ A;  2WB1 A;  3CP2 A;  3HKZ A;  4ESJ A;  3QWL A;  4CHU A;  4XID A;  4Y17 A;  1R1V A;  4LLN A;  1UB9 A;  2RAE A;  3GFL A;  1W4M A;  2MAB A;  1DQU A;  3BG6 A;  1F36 A;  1JJ6 C;  3MD2 A;  3T8R A;  3RKW A;  2M34 A;  3PFI A;  1B6A A;  2R7D A;  4XN3 A;  4O6J A;  2RKH A;  2X4H A;  1RR8 C;  4I02 A;  1X19 A;  3E5Q A;  4UVA A;  4CSW A;  2EV6 A;  1XX5 A;  1U0J A;  2IW5 A;  3WE2 A;  4NC6 A;  3J7A O;  1EH7 A;  1A6I A;  3ZQ7 A;  5EF6 A;  4IQ4 A;  3K0L A;  2K85 A;  3DXJ F;  3OOU A;  3RTR A;  4ZYE A;  2HI3 A;  4WX9 A;  3RZD J;  1P6R A;  3GFJ A;  1USS A;  4XKV A;  2NVT J;  5E17 F;  2DA3 A;  2DT5 A;  2A6E F; 
#chains in the Genus database with same CATH homology
 1X3U A;  4U0V A;  4IXA A;  1TQM A;  1KYZ A;  3CUO A;  4HA8 A;  1K6O A;  3T5X A;  3HTS B;  2HQN A;  1PDN C;  1FSH A;  1J5Y A;  2D45 A;  3TKY A;  1PUE E;  2Y75 A;  1R7J A;  1R5H A;  5A2Q K;  4RGR A;  2QM3 A;  2QQ9 A;  2KJB A;  1KU3 A;  4NB5 A;  3KEO A;  3V8K A;  1YG2 A;  5DCM B;  3ZMS A;  1P4W A;  4HDV A;  1J9I A;  1MJB A;  2JTV A;  2VOO A;  1QZY A;  1ON2 A;  2IP2 A;  3FZV A;  5D8K B;  1U5T B;  1HQC A;  3ULQ B;  2WTE A;  4KIC A;  2EWN A;  1ZHF A;  2G7H A;  2MBF A;  2ZCW A;  4A6D A;  3M8F A;  2TDX A;  1WRJ A;  3EUH A;  4A2U A;  2GXG A;  1FLI A;  5DCF A;  1XGO A;  4M9S A;  4EM1 A;  4L0Y B;  3QU3 A;  2VT3 A;  1C0W A;  4GCV A;  1MZB A;  5HS7 A;  1H9G A;  1O3Q A;  3V7R A;  1OKR A;  3F8B A;  4ZZL A;  3IL2 A;  2CQK A;  1W5T A;  4O5V A;  3F8F A;  3V4G A;  1RUN A;  4LJZ F;  3E5U A;  3P9I A;  5E20 A;  1QNT A;  2L4M A;  5LGT A;  2F5D A;  4B09 A;  3I59 B;  1S7O A;  1B9N A;  4RAY A;  3GVA A;  1T38 A;  3DEU A;  1DDN A;  1BBY A;  3L9F A;  3HRU A;  5HOO A;  3J81 Z;  3ECO A;  1UFM A;  2HEO A;  2DPD A;  2IRF G;  4MHG A;  1XCV A;  1BC8 C;  3RKY A;  3W6K B;  2STW A;  1E17 A;  4CYD A;  1ZRD A;  2ESH A;  3F22 A;  2K02 A;  1RI7 A;  5DV5 A;  3DPT A;  1BIB A;  4EMS A;  1FBS A;  1YTY A;  1FPQ A;  2MC3 A;  2V9V A;  1BI2 A;  2DLL A;  2HZT A;  2YU3 A;  2COM A;  2HTJ A;  1P92 A;  2DQR A;  4G7O F;  3KZZ A;  1FNN A;  2QUF A;  4RB3 C;  5JVT A;  5K1Y A;  3IWF A;  1EV7 A;  2OQG A;  3WU1 B;  4HW0 A;  1R23 A;  1XMA A;  1G3W A;  2J5O A;  4LB5 A;  1SD5 A;  1OYW A;  3CDH A;  1R1T A;  3K9T A;  2M5W A;  5CVI A;  4AIJ A;  5L3E A;  3QP6 A;  1GXP A;  4BHC A;  5HS9 A;  1SAX A;  3DPL C;  3BRO A;  1Z7U A;  3CO7 C;  2K7L A;  1MGT A;  3M8E A;  1MJ9 A;  1SMT A;  4OIO F;  5BQT A;  2HWV A;  1XB4 A;  4OIR F;  3VOD A;  1G3Y A;  4YIF A;  4JBA A;  4LLG F;  3FHZ A;  3Q9S A;  3E6D A;  1FT9 A;  4YFX F;  4G8X A;  2HKX A;  4WCG A;  4OIN F;  5FGM A;  3I0T A;  3J81 K;  1GVJ A;  2DI3 A;  5DEQ A;  3BDD A;  2ZJ2 A;  1SD4 A;  1SFU A;  5J8C A;  1IF1 A;  3BWG A;  2W25 A;  2ZXJ A;  1Z9C A;  1TW3 A;  4XBF A;  1U5T C;  2H94 A;  2PI0 A;  1BC7 C;  2FNA A;  2GXB A;  3J80 Z;  5D8L B;  4UV9 A;  2XAQ A;  4L9V A;  3GUD A;  2G9W A;  5HVQ C;  3I54 A;  4Q4Z F;  2Q0O A;  4M9X A;  2VOP A;  4AD9 A;  3FXR A;  2IA0 A;  4BH9 A;  4A0X A;  1FBQ A;  2O03 A;  3TQN A;  1O3T A;  2LF8 A;  4WWC A;  3AAF A;  2STT A;  2CYY A;  4M73 A;  4LG0 B;  1FC3 A;  2NNY A;  4N9I A;  2MA3 A;  1FP2 A;  5ERI A;  1CF7 A;  2L01 A;  2EFQ A;  2RV8 A;  4QWQ A;  3DV8 A;  2HYG D;  3COA C;  4IRG A;  3R61 A;  5HS8 A;  2K27 A;  4H0E A;  5CVU A;  2R3S A;  1MD0 A;  2LKP A;  2DT5 A;  1G3T A;  5TRD A;  2EA2 A;  2BV6 A;  3KP7 A;  1G4D A;  3RIR A;  2V6C A;  2K86 A;  2ZME B;  2P4W A;  3Q5F A;  4JK1 X;  4NHJ A;  1B4A A;  1TQI A;  4UHT A;  3R0J A;  3HHH A;  1FY7 A;  3U9G A;  2Q8K A;  1W7P D;  2CW0 F;  3SZT A;  2EV0 A;  4OIP F;  1G6N A;  5KVR A;  3PQJ A;  2EA4 A;  1F4K A;  3LQR A;  5LHI A;  4HV5 A;  2MD5 A;  3SFZ A;  1ON1 A;  1K78 B;  3GEZ A;  1QO0 D;  4HBL A;  1T2K A;  3BPX A;  4ENM A;  2P6S A;  1YW9 A;  2PQ8 A;  1BJA A;  2O3F A;  3E6C C;  5LGU A;  4A5M A;  5EEG A;  2QQB A;  3QU6 A;  1ZAR A;  4EGY A;  1QBJ A;  1FYL A;  3J80 K;  2JT1 A;  3IWZ A;  3O3K A;  3SQN A;  4ZYD A;  1J75 A;  4HLX A;  1BN5 A;  3P7N A;  2XVC A;  5LEK A;  1P4A A;  3IKT A;  5D5X B;  4L9J A;  2BBY A;  4I01 A;  5DYM A;  4F7Z A;  1S3J A;  2GZW A;  2VC1 A;  2JPC A;  3EQL F;  1V3F A;  4WXD A;  1U6G A;  5E1Z B;  2J5P A;  5FD6 A;  2A5Y B;  1FBU A;  1R1U A;  3BP8 A;  2ZNZ A;  1HXD A;  3HSE A;  2MH9 A;  3F23 A;  1RUO A;  1BIA A;  3QOP A;  4RGU A;  1XGM A;  3TOA A;  3EYY A;  3MFK A;  1Z6T A;  5FFZ A;  2OBP A;  1LVA A;  2ISZ A;  4OMZ A;  4L5I A;  3TO6 A;  2HS5 A;  1Q1H A;  1KQ0 A;  4L5J A;  2ELH A;  4IHS A;  5BPD A;  5LGN A;  2JRT A;  3I71 A;  3JSO A;  3ZN0 A;  1O7F A;  4TV7 A;  4KN4 X;  1IN6 A;  1LDD A;  1ZLJ A;  4ZH4 F;  3WTU C;  4EJU A;  4BYY A;  1FZP B;  5EEH A;  2AXL A;  1SFE A;  2RDP A;  2KIM A;  3GF2 A;  4BHB A;  4XLP F;  1RNL A;  1YIO A;  3SXY A;  3I5U A;  2EV5 A;  4LMY A;  4MQ9 F;  3K2Z A;  3F8C A;  5E1W A;  3RPU A;  5CVJ A;  2M8E A;  1FYK A;  4P5O A;  3SZP A;  3V8J A;  3KE2 A;  3R0A A;  2L54 A;  3WU0 A;  1HBX G;  5E8I A;  2DAO A;  4ENN A;  2V1D A;  2XIG A;  2BYV E;  3O2P E;  4UNO A;  3ZP5 A;  4I98 B;  2FBH A;  3HRS A;  3C7J A;  2X0L A;  1W7P A;  2QQA A;  5CLS A;  4KT5 C;  1XD7 A;  2RN7 A;  4Z2Y A;  5L3F A;  3GLX A;  4OMY A;  2ZO4 A;  1Y0U A;  5HLI A;  5HLG A;  2ETH A;  4GGG A;  4HX8 A;  1ZLK A;  5AIQ A;  3GZ6 A;  1F9N A;  3HYI A;  1MKM A;  1IW7 F;  2XV4 S;  3MCZ A;  5E8G A;  2OZU A;  3BJO A;  3G73 A;  2E1N A;  3RJP A;  1MDM A;  2H09 A;  4KYW A;  3L00 A;  4L9N A;  3TGN A;  2L02 A;  1IXC A;  2K4B A;  1ZG3 A;  2VXZ A;  4EJT A;  4MTD A;  3F6O A;  1ZRE A;  4M9Z A;  2QZ8 A;  4E70 A;  2QBY B;  5LHG A;  3WGH A;  3N4M A;  4YFN F;  3HSR A;  3GYH X;  6PAX A;  1ZAO A;  4IF4 A;  4LLL A;  2O8X A;  1XSX A;  4LK0 F;  2OU2 A;  4EV0 A;  4ESB A;  3QRF F;  3DFG A;  1MJA A;  2EFN A;  3F72 A;  1W5S A;  4M71 A;  3OOP A;  2XHK A;  2DFI A;  4HF1 A;  2E7W A;  4CXF A;  4Q5S F;  4BQA A;  2PFB A;  2Z3Y A;  3VB2 A;  3Q9V A;  4M74 A;  5IT3 A;  3L09 A;  3C18 A;  2R7F A;  4DNC A;  3WGI A;  4R79 A;  2BE5 F;  4A0Y A;  2A69 F;  5ILU A;  1H9T A;  2OD5 A;  4RB1 A;  1KU7 A;  2HQR A;  3IHU A;  3FM5 A;  3ZMT A;  1OPC A;  1JXS A;  3MZH A;  4LGW A;  4UXN A;  3KFW X;  4L9T A;  1JGS A;  3CUQ B;  1RIO H;  2NYX A;  3HUG A;  3V7S A;  2ZNY A;  1UHW A;  2CSO A;  2EFP A;  4N9H A;  2GAU A;  3E97 A;  3GFM A;  4EM0 B;  3FXQ A;  1TLH B;  5D6F A;  1HKT A;  1GHC A;  3T1B A;  2VBY A;  1ZYR F;  2H6C A;  3EET A;  2Z99 A;  2IPQ X;  2FSW A;  4Q48 A;  5HLH A;  3P9K A;  4O3M A;  1U78 A;  3D0S A;  2A07 F;  2KKO A;  1D5V A;  5D5V B;  4XSZ F;  3I4P A;  1LEA A;  1R58 A;  2M87 A;  1WSU A;  3KP5 A;  1FP1 D;  4ETS A;  3MAJ A;  3TO9 A;  4P96 A;  4YFK F;  4EVI A;  3FXU A;  1YW8 A;  4EM2 A;  4HYE A;  1SMY F;  2HR3 A;  1FWZ A;  5H20 A;  3K1N A;  3M1E A;  3R60 A;  2XKO A;  3LAP A;  4IRH A;  3BOQ A;  1XSD A;  1R22 A;  5LRS A;  1TNS A;  4IVN A;  2FOK A;  5LLQ A;  1FX7 A;  1WKM A;  2XKP A;  1HKQ A;  3N97 A;  1S29 A;  2ISY A;  5DUK A;  5TJJ A;  3GX4 X;  1KA8 A;  1S6L A;  5DCM A;  3FWE A;  3H3Z A;  3CJN A;  2FQ3 A;  4G7H F;  3L2C A;  1REP C;  3R6S A;  2QVO A;  4D0P A;  2WWY A;  2MLK A;  2RQP A;  4BXU A;  1XMK A;  5BMZ A;  4I0A A;  3PQK A;  5D5W B;  3V8L A;  5F1R A;  2KRF A;  3LAJ A;  5F64 A;  1T6S A;  1YQA A;  1U5T A;  2CWE A;  4M6X A;  2UWM A;  4HX7 A;  2DBB A;  3LA2 A;  4R1H A;  4UVB A;  2WC2 A;  3RPQ A;  1AWC A;  3W6J B;  5LEJ A;  3T8T A;  4KNY A;  5FFX A;  3ERE D;  4RB2 C;  3NQO A;  3WTW C;  3WTZ A;  1BM9 A;  4L18 B;  3RI4 A;  4LD5 A;  4PZJ A;  3O6B B;  3BPV A;  2VBZ A;  5CJ9 A;  2CGP A;  3B73 A;  2XRN A;  5AON A;  4P55 A;  3VFZ A;  2XAG A;  1BI0 A;  4BAY A;  2Z33 A;  4HF2 A;  3VOE A;  2D1V A;  4G6D A;  1ZN2 A;  5D4S A;  2YSR A;  1K79 A;  1XGS A;  3EYI A;  3HTU A;  1Z1D A;  3I59 A;  3LST A;  4EJO A;  2FEZ A;  3G3Z A;  4A6E A;  1GXQ A;  4KIG A;  2L3D A;  5L3B A;  1S7A A;  1KQ9 A;  1YLF A;  2RC4 A;  3BZ6 A;  4FX0 A;  4XSX F;  2YR2 A;  4AIK A;  4YII A;  3ZMD A;  2XAF A;  1CGP A;  2YX7 A;  4S04 A;  1HST A;  2QYO A;  1LQ1 A;  3DP7 A;  1FYM A;  2DK8 A;  2D1H A;  3FF5 A;  4RS8 A;  1IN4 A;  5FO5 A;  2PEX A;  1IRF A;  1XSV A;  4G94 A;  4XLN F;  2NAZ A;  3WG9 A;  1O7L A;  1LDK B;  3ZMU A;  1A04 A;  1IUY A;  1U3E M;  2Z9O A;  4ON0 A;  3M7G A;  2FA5 A;  2XAJ A;  1YFH A;  3WE3 A;  1KU2 A;  1ZGA A;  1J59 A;  2XGX A;  2WV0 A;  1IXS B;  3ROU A;  2M45 A;  4QLC U;  5LBQ A;  3JTH A;  3WTT C;  1BI1 A;  3C3W A;  2M1B A;  2W85 A;  4CO8 A;  2C6Y A;  1IN5 A;  3ZMV A;  4KIB A;  3BJA A;  2FE3 A;  3NEU A;  2LF7 A;  1KGS A;  1J7K A;  4U0W A;  4CIC A;  3MZY A;  1P4X A;  3KLN A;  4AWX B;  5ICG A;  4FX4 A;  1TQP A;  2E1C A;  4WXH A;  4P9F A;  2LNB A;  3GW2 A;  3HRM A;  2MH2 A;  3QAH A;  4P9U A;  2KIU A;  2IVM A;  2RVC A;  4BNC A;  2HGC A;  2GIV A;  2B0L A;  3GWZ A;  2XAS A;  2Z5U A;  3CTA A;  4IPA A;  5F6F A;  1SD7 A;  2NRA C;  2VE8 A;  5CVR A;  1LNW A;  1XDS A;  4HX4 A;  3K1M A;  3F21 A;  3FMR A;  3REO A;  1KU9 A;  2YX4 A;  3TDZ C;  1XDU A;  1UST A;  3LWF A;  3OV8 A;  3QPH A;  4RAZ A;  5ICF A;  3HSF A;  3IKV A;  3ABT A;  5ILV A;  4LFU A;  1VTN C;  1HW5 A;  2FNP A;  4ASN A;  2GA1 A;  2F5C A;  3BY6 A;  2ADU A;  1LEB A;  4OOI A;  2AS5 F;  1WI9 A;  3IRR A;  3ZPL A;  4CZZ A;  1ODD A;  2G7U A;  4LG0 A;  3JTG A;  3M9A A;  3K69 A;  2H6B A;  3WTS C;  1QZZ A;  3FMS A;  5DD8 A;  3S2W A;  4WF2 A;  1I6X A;  4KUM A;  3L7W A;  5E1X A;  2L4A A;  2QWW A;  2A6H F;  4YG2 F;  3TO7 A;  2NS0 A;  2W84 A;  4ESF A;  5FB2 A;  3U1D A;  2UXX A;  1LB2 A;  5J6X A;  2DW4 A;  2D2W A;  2JSC A;  2V1X A;  4MNU A;  2DTR A;  4AVP A;  2HFH A;  1BI3 A;  2ZKZ A;  1D8J A;  4I7H A;  4U88 A;  2EK5 A;  1K7A A;  2UXN A;  3KP3 A;  2IT0 A;  4UUV A;  3JAM Z;  1S8N A;  3SHF A;  4GXO A;  3EDP A;  2ZME A;  5L3D A;  5CYV A;  1TBX A;  4LK1 F;  1ZRC A;  1J0R A;  2VC0 A;  3E5X A;  2O6G E;  2HKO A;  5H6Q A;  2DK5 A;  5FLX Z;  1ONV A;  3FMQ A;  2UZK A;  2KJC A;  3MEX A;  4IHT A;  5L3G A;  1T98 A;  4JQF A;  3F6V A;  3F8N A;  3GO5 A;  2P7C B;  1K78 A;  2ACJ A;  3P9C A;  2RNJ A;  2W57 A;  3KZY A;  2IA2 A;  1ZG1 A;  4EJW A;  5H6R A;  2PBI A;  3MQ0 A;  1UHM A;  3ISP A;  3QP5 A;  2EFW A;  1ZRF A;  1ZH5 A;  3HRT A;  3I64 A;  4L0Z B;  2LSO A;  4FHT A;  1IN8 A;  3NRV A;  2IJL A;  1HKS A;  3HOT A;  2O61 A;  4BHP A;  3F3X A;  1DPR A;  4MQV A;  3JSP A;  3FM3 A;  2HYF A;  1P2F A;  2DO7 A;  3LFK A;  4DQ2 A;  2ZFW A;  4A0Z A;  2P5K A;  1CF7 B;  4ZYH A;  3IC7 A;  1DPU A;  4HLY A;  2V79 A;  3LA7 A;  4WXC A;  5BPI A;  2F2E A;  2DPU A;  2VOD A;  1FSE A;  2VON A;  4KDP A;  3WGG A;  3QPT A;  1B59 A;  4KN7 X;  4ZZD A;  4G6Q A;  2P5V A;  5L3C A;  2HDC A;  4PGG A;  5HDN A;  1LJ9 A;  2XRO A;  3D5L A;  1B1B A;  2JZY A;  2V1U A;  4IJA A;  2FF4 A;  1R5G A;  4HZF A;  5AIP A;  4OIQ F;  1BOA A;  1I5Z A;  1D8K A;  2IA1 A;  2K4J A;  1I1S A;  3E6B A;  1T39 A;  1Z6R A;  3JAM K;  3ZMZ A;  4R8H A;  4Y15 A;  3TOB A;  1B9M A;  3R4K A;  3TDU C;  1Z05 A;  3I58 A;  2LDU A;  1O3S A;  1ZGJ A;  4I09 A;  3DKW A;  3KEQ A;  5FLX K;  5J8F A;  3GXO A;  4K2E A;  3K1P A;  1WWX A;  2PMH A;  3ZN1 A;  1OMI A;  1OYY A;  3BJ6 A;  1DUX C;  3WTY C;  1Z91 A;  3VEP A;  5HDG A;  1QPM A;  2FBI A;  1JE8 A;  2Y48 A;  1E2X A;  1G3S A;  4HQM A;  2P6T A;  1XGN A;  5E18 F;  1KQ8 A;  5CVV A;  3U2R A;  2EFO A;  1SFX A;  4G7Z F;  2E7X A;  4AIH A;  4FT8 A;  4I0B A;  3LA3 A;  4GYG A;  4MGR A;  3F8M A;  4M6Y A;  4S05 A;  1IAW A;  4U7B A;  3DQV C;  2OAZ A;  3MWM A;  5IT9 Z;  3RYR A;  2OQR A;  4HV6 A;  1RZ4 A;  1O57 A;  2KIF A;  5K5R A;  1TNT A;  3E6M A;  2GA2 A;  4B8X A;  1O3R A;  4KIF A;  1FOK A;  3V7C A;  1ULY A;  2P5L C;  3ABU A;  3T0Y A;  2FBK A;  4G9Y A;  1AOY A;  1TW2 A;  2BGC A;  4LB6 B;  4IRI A;  1UCR A;  4KMU X;  5KK1 A;  1F5T A;  1IN7 A;  5K5O A;  4U7D A;  2FXA A;  4CDG A;  1U8R A;  4WK8 F;  2QBY A;  4A12 A;  5ICC A;  2A68 F;  2O0Y A;  1YS7 A;  4HAM A;  1ZG5 A;  3GZ5 A;  1L3L A;  3FX3 A;  3HOS A;  2GWR A;  1I1G A;  5BOX A;  1XCB A;  2ZBK A;  2HTS A;  4CGZ A;  1IZ1 A;  4EJV A;  2MLG A;  2VT2 A;  3B02 A;  4A5N A;  3KLO A;  2GQQ A;  3HHG A;  2DU9 A;  3KP4 A;  4MEY F;  2PJP A;  3LQQ A;  1W7P B;  1IXR C;  2EB7 A;  5D6E A;  2CFX A;  4GO1 A;  1R00 A;  1HSJ A;  3WOD F;  2P7V B;  4ENJ A;  1OR7 A;  3CLO A;  5LRR A;  3C1D A;  4GYI A;  3ELK A;  5FD5 A;  3KP6 A;  5D4R A;  4RGX A;  4RGS A;  2HOE A;  1IRG A;  2NNN A;  4RB0 A;  3CUQ C;  5ED4 A;  1DP7 P;  2VBX A;  3H92 A;  2A61 A;  1MDM B;  5IT9 K;  1R36 A;  3CUQ A;  5BS6 A;  2PG4 A;  2FU4 A;  1H0M A;  4XRF A;  4U0Y A;  4PDK A;  3CO6 C;  3ML6 A;  4MTE A;  5DD4 A;  5JI6 A;  4HOB A;  2RGV A;  1YW7 A;  1J2X A;  2OZ6 A;  1OYI A;  2P8T A;  5JFR A;  2BEO A;  1QQI A;  4NQW A;  2YPR A;  1YYV A;  2XUB A;  4MEX F;  1L0O C;  2QLZ A;  4KA4 A;  1YO5 C;  1D3Y A;  5JHU A;  2PN6 A;  4ENK A;  2M30 A;  4PCQ A;  2VE9 A;  2Q2E A;  4KFC A;  1T0F A;  5JR3 A;  3DF8 A;  2F5E A;  4EGZ A;  3RKX A;  3KET A;  2PMU A;  2XAH A;  1U2W A;  2W24 A;  2A3S A;  4HF0 A;  2CO5 A;  4Q47 A;  2OA4 A;  4EQQ A;  3I53 A;  1STZ A;  2FRH A;  4N0B A;  4HDU A;  1V4R A;  3WTX C;  5ILS A;  1EH8 A;  4ZYG A;  3HIF A;  3GFI A;  3KP2 A;  5LHH A;  2DQL A;  3E3V A;  1WQ2 A;  1JHH A;  3IRQ A;  5A2Q Z;  1SD6 A;  5ICE A;  1KYW A;  5HDK A;  4PGH A;  1NHA A;  2Y0M A;  2JPB A;  1HW2 A;  3WTV C;  4Y13 A;  4I2O A;  2EJR A;  1PP7 U;  2PLY A;  1HW1 A;  3RDI A;  2VBW A;  2FML A;  3JW4 A;  1XN7 A;  1PP8 F;  5D5U B;  5K5Q A;  2H27 A;  4KMF A;  1YS6 A;  4HQE A;  1JHF A;  4OU0 A;  1QGP A;  1TTY A;  2F5F A;  2QEN A;  2VN2 A;  1I27 A;  3H3U A;  2ESN A;  5DDG A;  1EH6 A;  3KCC A;  2FMY A;  4UV8 A;  3ECH A;  4UVC A;  4M72 A;  1F1Z A;  3RYP A;  2CG4 A;  1LDJ A;  4ESJ A;  4CHU A;  4Y17 A;  1R1V A;  4LLN A;  1UB9 A;  3GFL A;  1W4M A;  3T8R A;  3RKW A;  3PFI A;  1B6A A;  2R7D A;  4O6J A;  2RKH A;  2X4H A;  4I02 A;  3E5Q A;  4UVA A;  2EV6 A;  2IW5 A;  3WE2 A;  3J7A O;  1EH7 A;  3ZQ7 A;  3K0L A;  3DXJ F;  3RTR A;  4ZYE A;  4WX9 A;  1P6R A;  3GFJ A;  1USS A;  5E17 F;  5DUI A;  2A6E F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...