2W84A

Structure of pex14 in complex with pex5
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
57
structure length
57
Chain Sequence
ENVLPREPLIATAVKFLQNSRVRQSPLATRRAFLKKKGLTDEEIDMAFQQSGTAADE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEROXISOMAL MEMBRANE PROTEIN PEX14
publication title Structural basis for competitive interactions of Pex14 with the import receptors Pex5 and Pex19.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 19
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2009-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2w84A00
1QBJA 3RDIA 2VOOA 2HEOA 4KICA 2QVOA 2UZKA 2WC2A 2QUFA 1OPCA 4P9FA 3EDPA 3KCCA 2FA5A 5CVIA 3GUDA 2ZNZA 2H6BA 5CLSA 2IPQX 4ZYDA 4H0EA 4LB6B 4CDGA 2LF8A 1ZGAA 1W7PA 3DPTA 3GWZA 2IA2A 1XCBA 2V1XA 5D5WB 3JW4A 2PJPA 1U5TA 1R22A 3BJ6A 2HTSA 3RPQA 4LG0B 5BPDA 2FXAA 1DP7P 3WODF 3M9AA 4PZJA 4FT8A 2NS0A 3K9TA 1D8KA 1BI2A 4A0XA 4MGRA 5D6FA 1SMTA 2JRTA 3HIFA 3CUQB 1FP2A 2W24A 2J5PA 2DT5A 3I58A 1IRFA 5E8IA 2FBIA 4KDPA 3R4KA 3I53A 1SD4A 4G8XA 3I64A 1PDNC 2VT3A 1LDDA 4LLNA 2V1UA 2OD5A 3ZMZA 4BXUA 1QGPA 3KZZA 3VODA 4UV8A 4UUVA 3ZN0A 1XD7A 4EVIA 4CHUA 5D8KB 2VE8A 2P5LC 3F72A 2ZFWA 4UNOA 2VE9A 2G7HA 2XKPA 4EM1A 4BHPA 2AXLA 3QOPA 5LEJA 2CGPA 2HS5A 1OYWA 2Q0OA 1DUXC 2CYYA 3T8RA 1YS6A 3QU6A 2YX7A 4XLPF 2XVCA 4RB1A 2BV6A 3EUHA 3F8CA 1UHMA 2Z99A 2F2EA 1ZARA 3WE3A 2HYGD 3V4GA 2A61A 4CZZA 2A5YB 5DDGA 4M9ZA 2P5KA 4O5VA 3LAPA 3JSOA 4HF1A 1XMKA 3FM5A 2VODA 1O57A 1XGNA 3MZHA 3DEUA 1SFXA 1RUNA 1BC8C 3HHGA 2DPUA 1RNLA 1QNTA 5FB2A 1VTNC 3HSRA 1ZYRF 4R8HA 4XRFA 4HQEA 2Y75A 3IKTA 4M74A 2OU2A 3ECOA 3LFKA 3F6OA 1NHAA 5CVVA 2HYFA 1OMIA 3HUGA 1XGOA 4EQQA 5L3EA 2P8TA 2K4BA 2P4WA 4IXAA 3LQRA 1OYYA 2YSRA 4R79A 4U88A 5L3GA 1D5VA 4Y15A 3I59B 1LDKB 2JSCA 2NNNA 3MCZA 2ZXJA 4HOBA 1YTYA 1R7JA 3L09A 3F22A 3BJOA 2MC3A 1ZH5A 3FXUA 4ESBA 3ZMDA 5IT9K 3VFZA 3TO9A 2MLGA 1SFUA 2L01A 3LWFA 3H3ZA 2K27A 3J80K 1Z9CA 4M73A 4IF4A 2BE5F 3H92A 1MGTA 3GFMA 3NQOA 3ZMVA 3E6MA 5CVRA 3RJPA 4R1HA 1HKQA 1QZYA 3FMSA 5F6FA 2GQQA 3K2ZA 3KP2A 4A12A 1YW9A 4Z2YA 1KQ9A 2AS5F 2XAJA 1C0WA 5E1WA 1H9TA 2BBYA 2QBYA 2RC4A 5E17F 1U6GA 2WWYA 5DCFA 1G3SA 1V4RA 1P6RA 4UHTA 4IHTA 1ZRDA 4A0ZA 4HBLA 3JAMZ 2HWVA 3HTSB 1GXQA 2J5OA 1LDJA 4N9IA 3MZYA 5KK1A 2H27A 4ENKA 3FMQA 1P4XA 3AAFA 3GO5A 3HRTA 5HS8A 4ZYEA 2B0LA 5AONA 2ZNYA 4HLYA 4MHGA 1P4WA 3MFKA 1IXRC 2YR2A 5HS7A 2OZ6A 4LGWA 1ZN2A 1EV7A 4KMUX 1RZ4A 5HOOA 1G3TA 3COAC 2P6TA 2DU9A 3ERED 2ISZA 1T39A 3EETA 1B9NA 3SFZA 3WG9A 2EJRA 4P55A 4EJOA 1XSXA 4OINF 1B6AA 3GFJA 3IC7A 5TRDA 2LKPA 3D5LA 3TGNA 2Z5UA 4XBFA 4AVPA 3FX3A 2VOPA 4UV9A 1E2XA 4HQMA 4BNCA 5ERIA 2JPCA 3GFIA 1ONVA 2JPBA 3WTTC 4MTDA 2NAZA 1HW5A 5BPIA 3P7NA 1Z91A 2QQAA 5HLIA 3ELKA 1FBSA 1R00A 1CF7A 1IXCA 3E6CC 2XASA 4KIFA 5K5QA 2Q2EA 1XB4A 1QZZA 2XIGA 4PGHA 3RKYA 3U1DA 1ZAOA 2ACJA 2EFQA 3V7RA 1XGMA 1IN7A 4K2EA 3ZMTA 1ZRFA 1T38A 4PDKA 3CUOA 1BJAA 4BQAA 4L9VA 5CJ9A 1R5HA 4GO1A 4L0ZB 4M9SA 3F8NA 5ICGA 1MJAA 2PMHA 3BJAA 3I0TA 5LRRA 4M6YA 2FNPA 4U0YA 2FNAA 4MQVA 2F5FA 3H3UA 3C3WA 3FF5A 4HDUA 3P9KA 4WX9A 2XAHA 4BH9A 2VC0A 1KU3A 2ADUA 1QQIA 4OOIA 3TO6A 1LQ1A 3J81Z 3FM3A 2DO7A 2HQNA 4M71A 5BMZA 1DPUA 4LK1F 1ZG5A 5LHGA 4XSXF 2GZWA 2M45A 1P4AA 4Q4ZF 1JHHA 1T0FA 3R0AA 5E1XA 3B02A 3C7JA 1Q1HA 1MD0A 4WXDA 4KFCA 5DEQA 1X3UA 1ZRCA 1SFEA 4DNCA 4PGGA 3ML6A 5FLXK 1G4DA 4HX8A 3ZN1A 4N9HA 4XSZF 5K5RA 2MD5A 2YX4A 1I5ZA 4ZYGA 4A6DA 1LJ9A 3SQNA 2DLLA 1L0OC 2W85A 1FLIA 2FE3A 3KP6A 3KP5A 3ZPLA 5FGMA 4RB2C 4BHBA 2GWRA 2R7DA 1CGPA 5K1YA 4LG0A 2PMUA 1USTA 1YFHA 3TO7A 2FOKA 2CSOA 1MKMA 1QPMA 3I5UA 2A6HF 2G9WA 3GLXA 2C6YA 3PQKA 4G9YA 4HV5A 1J0RA 2TDXA 4I01A 2XAQA 3L00A 4YFKF 3M8FA 4E70A 3IWZA 1K79A 3MWMA 4P9UA 3K1MA 1FNNA 3CUQA 1H9GA 4OIOF 4ENNA 5BOXA 4IRIA 4KMFA 1D8JA 4EJTA 2CO5A 2F5CA 5TJJA 1KGSA 3BOQA 5E8GA 4LK0F 1FYKA 5HDNA 2M5WA 3B73A 1HKTA 3KLNA 5DUIA 2O8XA 1KU9A 4HF0A 1BIAA 4OMYA 1MDMB 2V9VA 2XAFA 5JR3A 2HQRA 2LNBA 4RB0A 3KFWX 2CWEA 2D2WA 3WTYC 2PLYA 2RGVA 2HZTA 2EV0A 2FBHA 5D5UB 5DYMA 2K86A 3P9IA 3GYHX 4L9TA 4IPAA 4QLCU 4G6DA 2E1NA 5EEHA 2ISYA 5LGUA 1BI0A 4RGUA 4KT5C 4ESJA 3R60A 3HSFA 1W7PB 3F6VA 1O7LA 1FY7A 1R1VA 4FX4A 5J6XA 1U5TB 4XLNF 2NYXA 3IKVA 2F5EA 3KETA 2M87A 3RYRA 3ROUA 1R36A 1TTYA 2GIVA 5HS9A 2IJLA 2EFWA 4ZH4F 2IRFG 3ABUA 5J8CA 3BY6A 4UVBA 4EJUA 2CQKA 1O3SA 4L5JA 1K7AA 3IRQA 4EV0A 1TW3A 1W7PD 3LQQA 3LA2A 5ED4A 1IUYA 4N0BA 3IWFA 3N97A 1T98A 4AD9A 5HDKA 1JHFA 3GVAA 3WGHA 4L9NA 1W4MA 1I1SA 2Q8KA 3FWEA 5DD4A 1GXPA 3QPHA 3Q9VA 2KIUA 3GX4X 4KN7X 1Y0UA 1FOKA 3EYYA 2ZO4A 1K6OA 3TQNA 5DV5A 2Y48A 3E6BA 5D6EA 2RQPA 2A3SA 2QQ9A 3HRSA 3GEZA 1ON2A 1UCRA 5A2QZ 5CVJA 3CLOA 5ILVA 1YW7A 4KIGA 2HKXA 2VBYA 1MJ9A 1TQIA 4YIIA 3KE2A 4KUMA 2L54A 3CUQC 3MAJA 4L0YB 2EB7A 5AIPA 1IZ1A 1FX7A 2QWWA 3I59A 4MTEA 3TDUC 5ILSA 1XMAA 3LAJA 4KIBA 3BZ6A 4Q48A 2EFOA 2RDPA 4ETSA 4ENMA 3T5XA 1B59A 4IRHA 2BEOA 3BDDA 5FD5A 1ZHFA 1OYIA 3RPUA 1HBXG 4RAYA 3Q5FA 2HFHA 1YLFA 3L9FA 1J2XA 3DFGA 1IAWA 1XSVA 3O2PE 3V7CA 4A2UA 2FQ3A 4OIRF 1F9NA 3P9CA 1LB2A 1XN7A 2VT2A 1TQMA 2YPRA 2ZJ2A 3TDZC 1K78B 1J7KA 2DBBA 2IP2A 3CO7C 3WGGA 1W5SA 1FYLA 5LHIA 2EA4A 2MH9A 5IT9Z 1KU2A 4RB3C 3BP8A 4AIJA 3FMRA 4KA4A 2DPDA 1J59A 4MEYF 2DFIA 2BYVE 3J80Z 1SD5A 4RGRA 3VB2A 1S7OA 4GCVA 3WTWC 4WWCA 2M1BA 2QYOA 3CO6C 4F7ZA 2O0YA 5DCMA 1LEBA 4ZZLA 2O3FA 1EH6A 3G3ZA 3GFLA 1XGSA 4B09A 4L5IA 4ASNA 3DP7A 1U78A 3V8JA 2UXXA 2W57A 1KQ0A 4L18B 5H6RA 3PFIA 3K0LA 3CDHA 4RGXA 1ON1A 1YYVA 3F23A 3V8LA 1MJBA 3S2WA 2KIFA 1O3QA 1IN4A 4M9XA 3O6BB 5FD6A 3JAMK 2VN2A 3PQJA 5F1RA 3GZ5A 5DUKA 2P5VA 1HQCA 3RKXA 2NNYA 3M1EA 1IF1A 1YIOA 4JK1X 3Q9SA 4RS8A 3SHFA 5D5XB 4M72A 3SZPA 5KVRA 4O3MA 4ZYHA 1RUOA 1ULYA 5LRSA 1FP1D 4YFXF 5JVTA 5D4RA 1FT9A 3RKWA 4EM2A 3C18A 4KN4X 3WE2A 3WGIA 4GYIA 3E5UA 3T8TA 2IVMA 2FU4A 4IRGA 3JTHA 1I6XA 2Z9OA 2VONA 1EH8A 3RYPA 2Z33A 1DPRA 4P96A 4ESFA 4CGZA 3REOA 4EGYA 2HDCA 4UVCA 2OQRA 2DK5A 1WQ2A 3WTVC 1HSTA 4HLXA 3N4MA 1S3JA 5FFXA 4HYEA 5L3CA 4AIHA 4WCGA 4IJAA 1S29A 1REPC 4UXNA 1SAXA 4S04A 2FSWA 1BOAA 4JBAA 1Z6TA 3ZMSA 3OOPA 1KU7A 4MQ9F 4HW0A 4RAZA 2P6SA 3KLOA 1R58A 5L3DA 3ULQB 5JHUA 2PI0A 4AIKA 2P7VB 3DQVC 2QLZA 3NRVA 3BROA 4EJVA 3DF8A 4CICA 3ISPA 1ZLJA 1HKSA 4BHCA 2O6GE 3RIRA 1O3RA 1S8NA 1P92A 1BI1A 2H09A 4ON0A 2V79A 1U2WA 3R0JA 1RIOH 4LMYA 3LA7A 3IL2A 1G3WA 1IN6A 2FF4A 1PP8F 1ODDA 2O61A 3EYIA 1LNWA 1FZPB 2EV5A 2KJBA 2PFBA 3W6JB 1KQ8A 3MQ0A 2P7CB 2XUBA 3O3KA 4LLLA 4MNUA 2CG4A 3VEPA 5JI6A 4WXCA 4HA8A 3WU0A 2VBZA 3HRUA 4M6XA 4G7ZF 1B9MA 2RV8A 1TW2A 3VOEA 3IRRA 2XHKA 3DPLC 4Y17A 1I27A 1AWCA 4HX4A 1F4KA 4HV6A 3E3VA 5D5VB 3WTUC 2FRHA 4A5MA 4JQFA 3T1BA 3F8BA 2JZYA 2ZMEB 4EM0B 2KJCA 3IHUA 4HX7A 3JTGA 1R23A 6PAXA 4EGZA 4G7OF 3TKYA 1HXDA 4CO8A 3ZQ7A 2PBIA 3WTSC 2FBKA 4ZZDA 3GW2A 2IT0A 4HF2A 1Z7UA 1O7FA 2STTA 5LLQA 2FMYA 5H20A 3JSPA 3FHZA 1J75A 1MDMA 3HSEA 2ESNA 2X4HA 1S7AA 2OQGA 2ZBKA 3QP5A 3TOBA 4I0AA 1H0MA 3SXYA 1HW2A 5ICFA 4KYWA 3F8MA 1LEAA 2MLKA 1UHWA 2XGXA 2EWNA 1WSUA 2LSOA 2L4AA 2KKOA 2MA3A 5K5OA 5D8LB 1IW7F 4I2OA 3HRMA 4OIPF 3HYIA 2W25A 2WTEA 5L3FA 1ZREA 2F5DA 1EH7A 1USSA 2KRFA 2IA0A 4U0VA 1V3FA 2OBPA 1GHCA 2PN6A 1QO0D 2GA1A 2G7UA 4AWXB 5CVUA 1R1TA 3K69A 3KZYA 1L3LA 2EA2A 2V1DA 5ILUA 3QP6A 3L7WA 1XDUA 1U3EM 1BBYA 2O03A 3W6KB 3ECHA 3L2CA 3HOTA 3ZMUA 3OV8A 4S05A 2YU3A 4YIFA 1TLHB 3BPVA 5F64A 5HLGA 3WTZA 2EK5A 1F1ZA 2ZCWA 5L3BA 4BAYA 3M8EA 1WI9A 1J9IA 1STZA 2FMLA 3F3XA 3TOAA 1XDSA 1OR7A 2JT1A 4CXFA 3F8FA 5E20A 1J5YA 1ZGJA 4I02A 4HZFA 4FX0A 5HVQC 1FBUA 1WRJA 4I0BA 3DXJF 1YG2A 4I98B 4HDVA 1YS7A 3EQLF 2A6EF 2V6CA 3HTUA 3U9GA 3K1NA 2CFXA 2GXGA 3E6DA 5HLHA 1IN8A 1R1UA 4LFUA 1FSHA 1G6NA 4LLGF 2D1VA 1RI7A 2OZUA 5A2QK 3KP7A 2GAUA 2Y0MA 1FC3A 1UFMA 3QRFF 1GVJA 2HR3A 1DDNA 4GGGA 2UWMA 5J8FA 3BPXA 3KEOA 2OAZA 4MEXF 4FHTA 1BI3A 2D1HA 3WTXC 1D3YA 5D4SA 3HHHA 2A69F 5E1ZB 3F21A 2HOEA 4BYYA 1K78A 1U5TC 1Z6RA 2LDUA 2EV6A 5H6QA 5LHHA 4IHSA 3KP3A 5E18F 4HAMA 2A07F 3BWGA 3SZTA 4O6JA 1FWZA 3DV8A 1JE8A 1UB9A 1IXSB 1HSJA 2DW4A 3I4PA 1F5TA 2M30A 1ZG3A 1IRGA 2MBFA 2H94A 4ENJA 5FFZA 5BQTA 2M8EA 4UVAA 2R3SA 2RVCA 1KYWA 2E7XA 5JFRA 2DK8A 2RNJA 2DTRA 4YFNF 1FPQA 2DAOA 5IT3A 2XKOA 4Q5SF 3V8KA 3KEQA 1OKRA 1BM9A 1B4AA 4B8XA 4GYGA 5AIQA 1Z1DA 2RN7A 1ZG1A 3HOSA 3G73A 3FXRA 1Z05A 2STWA 2D45A 4I7HA 1TQPA 2NRAC 2OA4A 5LGNA 5LGTA 4OU0A 5EEGA 4QWQA 2QM3A 2ESHA 3U2RA 1FSEA 1XCVA 2XRNA 3FXQA 2QQBA 1MZBA 2PQ8A 1B1BA 1FYMA 5LEKA 4KNYA 2L4MA 2DQRA 5FO5A 2VBXA 3LSTA 4NQWA 1KYZA 5CYVA 4RGSA 2VXZA 3NEUA 4I09A 3E5QA 2X0LA 1SD7A 1TNTA 2XV4S 1T2KA 5DCMB 5ICEA 1YW8A 3I71A 4Y13A 2COMA 3DKWA 1KA8A 3ZP5A 4NB5A 2RKHA 3K1PA 4IVNA 2FEZA 2LF7A 3GZ6A 2QBYB 1P2FA 2K7LA 1TNSA 3I54A 1JGSA 2E1CA 3D0SA 3GXOA 4GXOA 2IW5A 4G6QA 4WK8F 4G7HF 2IA1A 2QENA 4U0WA 3T0YA 3R61A 1HW1A 1SMYF 3E97A 1R5GA 3RTRA 4TV7A 2MH2A 2QZ8A 2L3DA 3M7GA 2ZKZA 2E7WA 1XSDA 2HTJA 1W5TA 1BN5A 3RI4A 3QPTA 2UXNA 1IN5A 2A68F 1YQAA 2HGCA 4A6EA 2W84A 2DQLA 1PP7U 4DQ2A 2H6CA 3CJNA 2BGCA 2GA2A 1TBXA 1BIBA 4LB5A 1CF7B 2JTVA 4EMSA 4CYDA 2ETHA 2K02A 1WKMA 2L02A 3CTAA 1S6LA 1G3YA 4OIQF 2EFNA 1U8RA 3E5XA 3MEXA 4WF2A 3FZVA 1T6SA 3LA3A 3R6SA 4EJWA 4A5NA 1BC7C 1E17A 2GXBA 2XAGA 1LVAA 1I1GA 2VC1A 1A04A 3KP4A 5LBQA 4Q47A 4YG2F 2PG4A 1AOYA 2ZMEA 1JXSA 3J81K 3V7SA 4U7BA 5DD8A 4G94A 1WWXA 4L9JA 3WU1B 1SD6A 4LJZF 4PCQA 5ICCA 1PUEE 2ELHA 3QAHA 5BS6A 2CW0F 4A0YA 1O3TA 1ZLKA 1YO5C 2Z3YA 3QU3A 4LD5A 3ABTA 2VBWA 4D0PA 4OMZA 4WXHA 2EFPA 5FLXZ 2PEXA 2DI3A 2HKOA 3J7AO 3GF2A 2XROA 1FBQA 4NHJA 2R7FA 2KIMA 3C1DA 2WV0A 2K4JA 4U7DA 5HDGA 4P5OA
chains in the Genus database with same CATH superfamily
5FJ8J 5IOYA 1FTTA 1X1BA 1QBJA 3RDIA 3ONQA 1QU3A 3OWTA 5EG0B 2BHZA 2VOOA 2HEOA 5FLVA 4KICA 3TBIA 3ZRGA 2WY8Q 2QVOA 3J7ZI 2UZKA 2N8GA 1WPKA 3BG3A 2WC2A 2QUFA 1OPCA 4P9FA 4M3FA 2JUGA 1VQKI 3EDPA 2WBMA 2M9HA 3KCCA 4IZZA 2FA5A 3A0HC 1WJ5A 3V42A 2HQ5A 5CVIA 1V5GA 2W00A 3GUDA 1FMVA 3I3LA 2ZNZA 3BR1A 2GOXB 2H6BA 5CLSA 2E34A 2IPQX 2NVUB 4ZYDA 4A3KJ 1SVLA 2DFHA 3TW7A 1AA7A 3KX2A 4H0EA 3HOZJ 3L2UA 4GRIA 4LB6B 2KT0A 4CDGA 2LF8A 2DJNA 2PMZA 1ZGAA 1W7PA 3DPTA 3GWZA 2IA2A 1XCBA 2V1XA 1ZR2A 5D5WB 2E35A 3JW4A 4BDZA 2PJPA 1U5TA 1LVKA 1R22A 3BJ6A 1WVRA 2HTSA 3RPQA 2DXIA 4LG0B 2ECBA 5BPDA 1A5JA 2FXAA 2K9SA 1DP7P 3WODF 3M9AA 4PZJA 4E7LA 4FT8A 2NS0A 3K9TA 1D8KA 3C2HA 3ESWB 2LVSA 1BI2A 4A0XA 3LSPA 4MGRA 5D6FA 4BXXJ 1SMTA 1I50J 3P5JA 3OMYA 1W36D 1FJLA 4XRSG 4AVZA 2JRTA 3HIFA 1K4SA 2LD5A 4BXFA 3CUQB 1FP2A 1ENHA 2W24A 1NK2P 2E60A 2O8KA 2YUSA 1TP4A 2J5PA 2DT5A 2CQXA 3I58A 2ZMEC 1MMAA 1IRFA 3G71I 4CCKA 1G2HA 1RRJA 2HVRA 5E8IA 2FBIA 4KDPA 3R4KA 3FXKA 3I53A 3HB9A 3L2RA 1SD4A 3SFIA 1JJ6C 2M3AA 4G8XA 1MW7A 3I64A 3GTKJ 1PDNC 2VT3A 4HSTA 1LDDA 5FRMA 2VKVA 4LLNA 2V1UA 1APLC 4OAZA 4D9JA 3K4KA 1OCZH 2OD5A 3ZMZA 4BXUA 1GLNA 1QGPA 3GTJJ 5JVGF 3GTPJ 3KZZA 2H8WA 2L5QA 2X51A 3VODA 1D5YA 2F4MB 4II3A 2HOSA 1OISA 4UV8A 2K3PA 4UUVA 3ZN0A 1XD7A 4EVIA 4CHUA 2R7WA 2Y69H 5D8KB 3BQYA 4JX5A 2VE8A 3W2WA 2P5LC 2RQQA 3GZNB 3F72A 2ZFWA 4UNOA 4F52A 2VE9A 1GV5A 2CUJA 2G7HA 2OTJI 1CQTA 1RKWA 2LBFA 4DYRA 4E7IA 2XKPA 4EM1A 2QSHX 2KFDA 5IY5H 4BHPA 2AXLA 1UJ8A 4Z6YA 3QOPA 5LEJA 3HKZN 3VPRA 3CMAI 2CGPA 4RAFA 2HS5A 1OYWA 2DYSH 2Q0OA 2NOJB 4KISA 1DUXC 2I10A 2CYYA 3T8RA 3I9V2 3OYKA 2OJED 2JA8J 1QZEA 1YS6A 3QU6A 2YX7A 1A35A 4XLPF 3CCLI 2XVCA 4RB1A 2BV6A 3EUHA 3F8CA 4HSRA 2V9PA 3LSHA 1UHMA 2Z99A 4F3QA 4ZDOA 1I39A 1RKTA 2F2EA 1ZARA 3WE3A 2HYGD 3V4GA 2LRDA 4I99C 4A3MJ 3KIOA 2A61A 2XF5A 2A5YB 4CZZA 5DDGA 3HOUJ 4M9ZA 3WU2C 3M3YJ 1BOBA 2HNHA 1POGA 1X4OA 2E71A 2P5KA 4XN0A 1D1AA 4O5VA 3JRCA 3LAPA 3JSOA 4HF1A 5F08A 1XMKA 1X3WB 4Y33A 3FM5A 4IX7A 2VODA 1O57A 1X1DA 2Z1DA 1JTXA 1XGNA 3ZR8X 3MZHA 3DEUA 2R0QC 1SFXA 1RUNA 3K6GA 2EQRA 1BC8C 3HHGA 2DPUA 1RNLA 1QNTA 5FB2A 1VTNC 3HSRA 3MKYB 1ZYRF 3DLLF 3I4NJ 4R8HA 4XRFA 4J01A 4HQEA 2Y75A 1Y6IA 2W1OA 3D5SC 3IKTA 4M74A 4UB8C 3EPZA 4C30A 2P0WA 2OU2A 1JUMA 3ECOA 2R7ZJ 3LFKA 3F6OA 1NHAA 4PJLA 5CVVA 5J47A 1YOVB 3OOUA 2HYFA 2O9LA 3DTEA 1OMIA 2GBYA 1JKOC 3HUGA 1WJAA 2DDAA 3CMEI 4BL0B 4DGWB 1XGOA 1BR2A 4ABZA 1ZELA 4EQQA 5L3EA 2A05A 2K9QA 2P8TA 4FETA 2R7TA 2K4BA 3S14J 2P4WA 3HOYJ 4IXAA 3HZJA 3LQRA 1OYYA 1M1EB 5EYRA 2YSRA 1PYVA 4R79A 3KYCB 4BGDA 2QEXI 2VUMJ 1OCOH 1TT5B 1A36A 4U88A 3DKXA 4V19K 5L3GA 1D5VA 1LKXA 4Y15A 3I59B 4RM2A 1LDKB 2XSJC 2JSCA 2KLOA 2NNNA 3MCZA 3TP0A 2ZXJA 3KYLA 4HOBA 1YTYA 5BNGA 4F55A 4D5FA 1R7JA 2V26A 2DMUA 2PJRA 1VZ0A 3BR0A 3L09A 3F22A 4BJ6C 3BJOA 2MC3A 1ZH5A 1W0UA 4CA0A 1ETYA 2K9NA 2X1EA 2VJIA 1SAUA 4LIUA 3FXUA 3FDYA 4ESBA 3QYFA 3ZMDA 4XKBA 3KEYA 5IT9K 2DMQA 3VFZA 4BUPA 3TO9A 4XL9A 3I4MJ 2MLGA 1SFUA 2JVHA 2L01A 3S3MA 3LWFA 4L5EA 4AUXA 3H3ZA 3QWLA 5IP9J 2DMNA 2K27A 3J80K 2EPFA 2I5UA 4M73A 4DIQA 4XRMA 3CCJI 4IF4A 1Z9CA 2LLKA 1Y1VJ 4AIDA 2Y2ZA 2DA2A 2BE5F 2L7MP 3H92A 3OL4A 2B9SA 1MGTA 3GFMA 4YELA 2LK2A 3NQOA 3ZMVA 2DOAA 3K2AA 3E6MA 1I3AA 4A3CJ 5CVRA 3DPUA 3RJPA 4R1HA 1HKQA 1QZYA 3FMSA 5F6FA 2GQQA 4RLFA 3K2ZA 3ABKH 3KP2A 4A12A 1YW9A 4Z2YA 5GADJ 3PIPF 1KQ9A 2AS5F 3OYLA 1X4PA 1JJ8C 2XAJA 1IJWC 2LC2A 2LY1A 2LFBA 4U87A 3CZ6A 1MBKA 1R4NB 2EZHA 3RZOJ 1QHGA 2VJ4A 2DOFA 3EUHC 2VQCA 1C0WA 2ZC2A 3S93A 3OS0A 2COBA 5E1WA 1H9TA 4QSHA 2BBYA 4RBOA 2QBYA 2RC4A 3K70D 5E17F 1U6GA 2WWYA 4A93J 2DN0A 5DCFA 1TC3C 1G3SA 1V4RA 1P6RA 5GPCA 4UHTA 1Y8RB 1GV2A 4IHTA 1ZRDA 5EDNA 5E3OA 3G4SI 2HDDA 3MKZA 4A0ZA 4HBLA 3JAMZ 2HWVA 3HTSB 1GXQA 1UHSA 1LDJA 2J5OA 4N9IA 3H36A 1Y8QB 3MZYA 4B47A 3CCUI 5KK1A 2H27A 4ENKA 2QSGX 3S1RJ 3FMQA 1P4XA 4F92B 3HOXJ 4NUBA 3AAFA 2KDZA 3BG7A 3NWSA 3GO5A 3HRTA 4J00A 1E0EA 5HS8A 4ZYEA 2B0LA 3M8JA 5AONA 5GAEJ 3MMYB 2ZNYA 4HLYA 4MHGA 3DBLB 1P4WA 1WGXA 4OAYA 3MFKA 1IXRC 2ME0A 2BW3B 5KNLA 2YR2A 3O8GA 1JKRC 5HS7A 2OZ6A 4LGWA 1ERDA 3OYBA 1ZN2A 1GT0C 3JRBA 3AL0B 1EV7A 2R7SA 3SEZA 4KMUX 3H5AA 1LE8A 3BC8A 2JQ7A 1RZ4A 5HOOA 5KHDA 1G3TA 2DA6A 1VQNI 3COAC 2P6TA 2DU9A 1W0TA 2QSFX 3ERED 2UV1A 2ISZA 1T39A 1R71A 2ZJRF 3EETA 3A03A 1B9NA 4NQWB 3SFZA 3WG9A 2EJRA 2AQEA 3OYIA 1WJDA 4P55A 3FXJA 4EJOA 1XSXA 4OINF 1B6AA 3GFJA 3IC7A 3LSMA 2ZJQF 2ID6A 3WG7H 5TRDA 2LKPA 3PL8A 3D5LA 4MFEA 3PO3J 4IL6C 3TGNA 1P7JA 2Z5UA 3FKIJ 2EIJH 3M4OJ 4XBFA 1FOYA 3FKJA 4AVPA 3FX3A 1SFKA 2VOPA 4UV9A 5GPAA 1E2XA 4HQMA 4BNCA 5ERIA 2JPCA 3GFIA 1ONVA 2JPBA 3WTTC 3CF2A 4MTDA 2NAZA 2EZLA 1HW5A 2JWTA 5BPIA 1X1AA 2R7QA 3P7NA 1Z91A 2JVGA 2QQAA 2NOGA 4C2MJ 2JA7J 5HLIA 3ELKA 1FBSA 1R00A 4AYBN 1JKQC 2KIQA 2L9VA 1CF7A 2FQ4A 1IXCA 2FX0A 4B1RA 2X1DA 2E2JJ 3E6CC 2X9DA 4PJ0C 2HDWA 2XASA 3CCEI 3VYRB 3OS2A 3HEFA 4KIFA 1Q1VA 1JGGA 4B48A 5K5QA 4IKFA 2Q2EA 4XNFA 1XB4A 4PUSA 2CW7A 4DZJA 3LOCA 3I55I 5FKKA 4NBQA 1QZZA 3H35A 2XIGA 4PGHA 3RKYA 5GAHJ 3U1DA 2LH9A 1ZAOA 2ACJA 2EFQA 3V7RA 1TWHJ 4A3FJ 2E1MB 2WAQN 1XGMA 3DWLE 2AHQA 4ZYAA 5LFAA 4IHXA 3ZXSA 1IN7A 4K2EA 2OPTA 3ZMTA 1ZRFA 3CLQA 1T38A 2Y9ZA 4D1QA 1Z21A 4PDKA 3CUOA 1BJAA 3FBNB 3SEQA 4BQAA 3OYHA 4L9VA 5CJ9A 4E6KG 3JRFA 4XM3A 4XONA 1MH3A 1R5HA 4GO1A 1ZQ3P 4L0ZB 3RQ4A 4M9SA 3MKWB 3F8NA 2L2OA 5F0HA 2ELKA 2OCCH 5ICGA 3BG9A 1MJAA 2PMHA 3BJAA 3AG2H 3I0TA 5LRRA 4NDLA 4M6YA 2FNPA 2O7OA 2Z2SB 4II2A 4IHVA 4U0YA 1MSFC 2H1KA 2Y31A 2FNAA 4XKWA 4MQVA 2F5FA 3H3UA 3C3WA 3CQZJ 2LY2A 3FF5A 4HDUA 3P9KA 2ID3A 4WX9A 2OF7A 2XAHA 2MGQA 4BH9A 1K6YA 2MFZA 2VC0A 1KU3A 2ADUA 2AXTC 3B6AA 3PUFA 1QQIA 4OOIA 3TO6A 1LQ1A 3J81Z 4XIDA 3FM3A 2DO7A 2HQNA 4M71A 5BMZA 2LY9A 2BXZA 3BCBA 1DGRM 2FJ1A 2KHMA 2MD0A 4CCOA 1DPUA 5E3MA 4LK1F 1ZG5A 5LHGA 4BY1J 1V5EA 3HC7A 4XSXF 2GZWA 2M45A 1P4AA 3HPGA 3L2WA 4XN3A 4Q4ZF 1JHHA 3A02A 1ETWA 1T0FA 1U0JA 3R0AA 3UNGC 1EF4A 5EG0A 3K7AJ 5E1XA 5FRNA 1PUFA 3B02A 3C7JA 1Q1HA 1MD0A 3W2AA 4WXDA 4KFCA 4XMYA 5DEQA 3JRAA 3QYEA 4A3BJ 1X3UA 1ZRCA 4RM3A 1SFEA 4DNCA 4PGGA 3ML6A 4V2GA 5FLXK 1TL8A 3BLYA 1G4DA 4HX8A 3FBIB 3ZN1A 2UUZA 4N9HA 4XSZF 5K5RA 2MD5A 4FQGA 1VQMI 2YX4A 1I5ZA 4ZYGA 3D5RC 4A6DA 4CYCB 1RR8C 4IQJA 4NNJA 5EGOB 1LJ9A 3SQNA 1GVDA 2NS8A 1VNDA 2HI3A 2DLLA 1L0OC 4CCNA 2W85A 2K40A 1FLIA 2FE3A 3KP6A 3KP5A 3ZPLA 5FGMA 4RB2C 4BACA 5M3FJ 4BHBA 3H5RA 2GWRA 2R7DA 5GAGJ 1CGPA 5K1YA 4LG0A 1MNMC 2PMUA 1IV6A 3OYDA 2TCTA 1USTA 3VYTB 3BR3A 3KYDB 2VKEA 1YFHA 3TO7A 3CC2I 1TWGJ 1XX5A 1VQ6I 2FOKA 2CSOA 1MKMA 1T56A 5JHFA 1QPMA 3I5UA 2A6HF 2G9WA 3GLXA 4NC6A 2C6YA 3PQKA 4G9YA 4HV5A 1J0RA 2TDXA 4I01A 3OYFA 2XAQA 2XGEA 3L00A 1JTYA 4GFBA 4ZDLA 4YFKF 4E7KA 1IRZA 3M8FA 4B43A 4E70A 3IWZA 5F1JA 1K79A 4FISA 2LTPA 2V4JC 3MWMA 4P9UA 2F5VA 3K1MA 5HODA 1FNNA 3CUQA 3W3CA 1H9GA 4UUSA 4OIOF 4IO9F 4ENNA 3A01B 5BOXA 1RESA 4IRIA 4KMFA 1D8JA 2Z16A 4EJTA 2CO5A 2F5CA 1WFXA 5TJJA 1KGSA 4C3HJ 3BOQA 5E8GA 4YIRX 3FK7A 4LK0F 1FYKA 2LKSA 2VQGA 5HDNA 2M5WA 3CP2A 3HOWJ 3B73A 1HKTA 3KLNA 5DUIA 5HNFA 2DA4A 4M3EA 2O8XA 2XF6A 1KU9A 3S3NA 3OIQA 4HF0A 1BIAA 2GM4A 4OMYA 1MDMB 2V9VA 2M0CA 2XAFA 3MVPA 2V6EA 2EZIA 4BE2A 5JR3A 2HQRA 2KRHA 2LNBA 3IAM2 3FK6A 4RB0A 3LFUA 1WI3A 3KFWX 1E3PA 2CWEA 2D2WA 3IH2A 4XQFA 5J3LA 2JUCA 3WTYC 4M3DA 2PLYA 2RGVA 2HZTA 2EV0A 2FBHA 3MN2A 5D5UB 4AU7A 5DYMA 2K86A 3CJTB 3P9IA 1IDZA 3GYHX 4L9TA 1Y0NA 1HOMA 2PMZN 2MG4A 1TWAJ 4IPAA 3ABLH 4QLCU 4G6DA 1YJNI 2E1NA 2GXAA 5EEHA 4QIWN 3TW6A 2CU7A 3FIWA 1D1BA 2ISYA 2M8GX 3VSKA 5LGUA 1BI0A 4RGUA 3L2QA 4KT5C 4ESJA 3R60A 1QHHD 3LMMA 3HSFA 1W7PB 3F6VA 2VPRA 4UUTA 1O7LA 1R9TJ 1FY7A 1R1VA 4FX4A 2M4KA 2L7KA 5J6XA 1U5TB 4XLNF 2NYXA 1JUPA 4Y52J 3CP8A 3IKVA 5FKOA 1BW6A 2F5EA 3KETA 2A6TA 2M87A 3RYRA 1UZCA 3ROUA 1R36A 1TTYA 2GIVA 5HS9A 2IJLA 4DW6A 1B72B 3E1SA 4ZH4F 1T0FC 2FUG2 3ABUA 2EFWA 5J8CA 2IRFG 1PJRA 3BY6A 4UVBA 3HM5A 4EJUA 4KITB 1BA5A 1H88C 2FOWA 2CQKA 1V5FA 1O3SA 4M3BA 4L5JA 1K7AA 4XLAA 2V1NA 1TW3A 1W7PD 4EV0A 3LQQA 3IRQA 1WJCA 1HDDC 3GCMA 3FXLA 3LA2A 4A3IJ 5ED4A 1KONA 3DBRB 1IUYA 4N0BA 3IWFA 1S9HA 3N97A 3LSJA 4ZTJA 1T98A 2W7NA 2V9KA 4AD9A 5HDKA 1JI8A 1T08B 2IXSA 1JHFA 3GVAA 3WGHA 4L9NA 4BQQA 2R92J 1W4MA 3N05A 3VYUB 1I1SA 2Q8KA 3FWEA 1T33A 3GTLJ 5DD4A 3H9GA 1R4MB 3DTIA 1GXPA 2DDBA 3Q0UA 3QPHA 4CZCA 3Q9VA 1E3HA 1IGNA 3PO2J 2A5WA 2KIUA 2VI6A 4KN7X 3GX4X 3X2QH 1Y0UA 1FOKA 3EYYA 2ZO4A 3BQZA 1TT0A 1K6OA 3GLLA 4PK4A 3TQNA 4XICA 5DV5A 3CDIA 2Y48A 3E6BA 5D6EA 2RQPA 2A3SA 2QQ9A 1OCPA 3HRSA 2JRMA 2XGCA 3H0DA 1VQ7I 4BQOA 3GEZA 1YE9A 1ON2A 1UCRA 5EZHA 4D5CA 5A2QZ 3S17J 5CVJA 3CLOA 3DU6A 5ILVA 1OFCX 1YW7A 4KIGA 2JMWA 2HKXA 2VBYA 1VQ5I 4XK4A 1MJ9A 1TQIA 4X0GA 4YIIA 3KE2A 1OCTC 4KUMA 2L54A 3CUQC 3MAJA 1ETXA 2HXIA 4L0YB 4HRIA 1FTZA 1I3QJ 2EB7A 5AIPA 1IZ1A 1MMGA 3E0JB 5K7ZA 1FX7A 2ZJPF 3F9KA 2QWWA 3I59A 4MTEA 2EH3A 3TDUC 3UKGA 3VDXA 2IS4A 2XPWA 5ILSA 3H9JA 1Z3XA 1XMAA 3LAJA 4KIBA 3BZ6A 5EJCA 3S8PA 2DT7B 1XMXA 4Q48A 4H4KC 4JX6A 2EFOA 3KPHA 2RDPA 4ETSA 2RNGA 2V7FA 2R7XA 3OIPA 4BE1A 2GIZA 4ENMA 2DODA 5KAIC 3T5XA 1Z67A 3ZQHA 3L2VA 1XPXA 1B59A 4IRHA 2BEOA 3BDDA 3GMEA 1EA3A 5FD5A 1ZHFA 5DTDA 1OYIA 2IS6A 3DEWA 2MYSA 3RPUA 1Y39A 1HBXG 4RAYA 3Q5FA 2HFHA 1YLFA 1NH3A 3L9FA 1J2XA 1IUFA 4ITVA 4XLEA 3DFGA 5JLXA 1IAWA 2L7FP 1U9NA 1XSVA 3O2PE 3V7CA 3ZCOA 4A2UA 2FQ3A 4OIRF 1F9NA 4G6TB 2MABA 2GOMA 4MLOA 3P9CA 2NVQJ 3H3VK 1LB2A 2Y0SA 1XN7A 2PX9A 4A69C 2ZJ2A 1TQMA 1MIJA 2VT2A 2YPRA 4PJMA 2JN6A 4BJTA 2EIKH 1G8XA 3TDZC 1K78B 3LSRA 1J7KA 2DBBA 2IP2A 3CO7C 1QPIA 3WGGA 1W5SA 2DA3A 1FYLA 2K5CA 1LUJB 2M7AA 2EA4A 4MO7A 5LHIA 3A2KA 2MH9A 5IT9Z 1KU2A 3BT9A 4RB3C 3BP8A 4BEHB 4AIJA 3FMRA 1OLTA 4KA4A 2DPDA 2BVLA 1X2NA 1J59A 4MEYF 1Z77A 2EINH 2DFIA 2BYVE 3J80Z 3CJRB 1SD5A 1AKHB 4RGRA 2E5NA 3VB2A 2HQAA 1S7OA 4GCVA 1ORKA 2IGMA 3HBLA 3WTWC 2QA4I 4WWCA 3ZGKA 1K83J 2M1BA 2E2HJ 3BZCA 2QYOA 3CO6C 5C44J 4F7ZA 4NC8A 2O0YA 5DCMA 1LEBA 3BZKA 2R5YB 3C2BA 1V55H 4ZZLA 2O3FA 4JP0A 2M7BA 1EH6A 5F27A 3G6EI 3MZ8A 3DU5A 3G3ZA 4Y7NJ 4E7SA 1XTAA 3GFLA 1XGSA 4B09A 2PJRB 1PVEA 4L5IA 4ASNA 3DP7A 1U78A 3V8JA 1EJ9A 2UXXA 2W57A 2B7EA 1KQ0A 4L18B 2NS7A 2CRGA 5H6RA 2E1OA 3PFIA 1SVOA 3K0LA 2EZKA 3TL4X 1D1CA 1VQPI 3OYGA 3CDHA 4RGXA 5HLTA 1ON1A 2F4IA 4DBQA 1YYVA 3F23A 5B5EC 2HOAA 5FKMA 3JREA 3V8LA 3F0CA 1WZ2A 4XLHA 1MJBA 3S2WA 2KIFA 3PUBA 1O3QA 3M1CA 4HPQA 3G1OA 1IN4A 2E19A 2ICWG 4M9XA 3O6BB 5FD6A 1UMQA 4QPOA 3JAMK 2VN2A 4ZTFA 3PQJA 5F1RA 3SJMA 3GZ5A 5DUKA 3GTMJ 1N77A 3AG4H 2P5VA 3A0BC 1HQCA 1IRXA 3RKXA 2ZXIA 1DU0A 1MSEC 2BZTA 2NNYA 3M1EA 1IF1A 1MBFA 1YIOA 4JK1X 3Q9SA 5JLWA 2R93J 4RS8A 1IG7A 1JT6A 3SHFA 5D5XB 1S5LC 3HGYA 4M72A 3SZPA 5KVRA 3UR3C 4O3MA 4ZYHA 5F0CA 1RUOA 1ULYA 1SC7A 3G2BA 2P81A 1E3OC 5LRSA 1D0ZA 2L9NA 4ZJZA 1FP1D 4YFXF 5JVTA 4PFPA 5D4RA 3JRDA 1FT9A 3RKWA 1HA8A 4EM2A 1Y56A 5DM6F 3C18A 1B8IB 4KN4X 3WE2A 3WGIA 4GYIA 3E5UA 4IEJA 3T8TA 2IVMA 2FU4A 4IRGA 2CV2A 3JTHA 3OL3A 3BTIA 1N25A 1I6XA 1A6IA 2Z9OA 2VONA 3BTJA 1EH8A 3RYPA 2Z33A 1DPRA 3QOEA 3AKZA 2F4OB 4BE0A 2Y30A 4BS9A 1R6RA 1A31A 4P96A 3K4LA 2ZFUA 4ESFA 1K4TA 1ETQA 4CGZA 4PSWA 3REOA 3BG5A 1I6HJ 3K70C 3FISA 2ZSHB 3CCRI 2HYJA 2KZGA 2F6CA 2JA2A 2RAEA 4EGYA 5LD2C 2HDCA 4UVCA 3KZIC 2OQRA 1RC9A 2DK5A 4PJJA 1WQ2A 2KPMA 3WTVC 1BR4A 1HSTA 4HLXA 3N4MA 1FMWA 3PNTA 9ANTA 1TWCJ 1S3JA 2HVSA 5FFXA 2IS2A 4HYEA 5L3CA 2MSYA 4AIHA 4WCGA 4IJAA 1S29A 3IAS2 2R5ZA 1REPC 4UXNA 1LFUP 2X85A 1SAXA 4N4OB 4S04A 4D7NA 2FSWA 1BOAA 4JBAA 1Z6TA 3ZMSA 3OOPA 4CH7A 1YHQI 1KU7A 2WAEA 4MQ9F 2JK3A 4DYQA 4HW0A 4RAZA 1YIJI 2P6SA 3KLOA 3ASOH 1R58A 3J7AY 4BBRJ 5L3DA 3ULQB 5JHUA 2PI0A 4AIKA 2P7VB 3DQVC 1AHDP 5CQGA 3LL7A 2QLZA 4DYCA 1D0XA 4LIVA 1HDPA 4A3EJ 3NRVA 3BROA 4EJVA 3DF8A 1YRNB 4CICA 3ISPA 1ZLJA 1HKSA 2DMPA 4BHCA 2WV1A 2O6GE 3RIRA 1VI0A 2NVTJ 1XS9A 2NXNB 1YI2I 1O3RA 1S8NA 3PSFA 1F43A 1P92A 1BI1A 2ZXHA 2H09A 4C2TA 4ON0A 3AFHA 2V79A 1U2WA 3R0JA 1RIOH 2KL4A 4LMYA 3LA7A 4XKCA 3SZGA 3IL2A 2R7RA 3IUOA 1G3WA 1IN6A 2AO9A 2FF4A 4MFDA 1PP8F 1S7EA 3OYCA 1ODDA 2O61A 3AL0C 3RZDJ 2RREA 3EYIA 1LNWA 1IO2A 1FZPB 2EV5A 2Q2EB 2KJBA 2D5VA 2PFBA 3W6JB 1KQ8A 2K9LA 2QQ8A 3AG3H 3MQ0A 2P7CB 2XUBA 3O3KA 4LLLA 2DTZA 4MNUA 5E3LA 1GDTA 2DFFA 3H9QA 4RMNA 2HXOA 3MD2A 4AC0A 2CG4A 1MH4A 5J1UA 3VEPA 1Y1WJ 5JI6A 3RKQA 3O8HA 4WXCA 2YS9A 3RSNA 4HA8A 4CYCA 3WU0A 1R5ID 1SANA 5EGOA 1FIAA 1UG2A 1T8IA 3H1CA 2VBZA 5B1BH 4XOTA 3HRUA 4E4HA 1YITI 3S1NJ 4M6XA 3M07A 2FD5A 4G7ZF 1YJ9I 1DP3A 2CUFA 1B9MA 2BVMA 1FOWA 3U1KA 3ZQGA 3OYEA 5KAFC 2NVXJ 2RV8A 1TW2A 3VOEA 2KP6A 3IRRA 2ELJA 2XHKA 3DPLC 1MNEA 1W5CC 4Y17A 1ZTRA 1I27A 1AWCA 4HX4A 3OIOA 4G12A 1F4KA 4HV6A 4KJZA 3E3VA 5D5VB 3WTUC 1VFCA 2FRHA 1F36A 4A5MA 1HLVA 1ETOA 2BOLA 4JQFA 3T1BA 2JJ7A 3OSFA 3F8BA 2JZYA 2ZMEB 2ME6A 3LNQA 1HCRA 2WADA 2WB1N 4DJAA 4EM0B 2KJCA 1DQUA 3IHUA 4QPQA 2QCOA 2VPLA 4HX7A 3JTGA 1ITYA 1R23A 6PAXA 4BJ5C 4EGZA 1LFBA 4G7OF 3TKYA 2E5ZA 1HXDA 4I76A 4CO8A 2NVYJ 3A01A 5M5WJ 2VASA 5C3EJ 3HGGA 3ZQ7A 4JOMA 5M5XJ 2BY0A 3CCYA 2I8DA 2PBIA 2E1MC 3WTSC 2FBKA 4ZZDA 3GW2A 2DJIA 4BQNA 1VQLI 2IT0A 3DLAA 1FIPA 5IPAA 2IEKA 1J09A 5HNHA 4HF2A 1Z7UA 1O7FA 2STTA 3VWBA 5LLQA 2FMYA 3EUAA 5H20A 3OYAA 2CV0A 1HC8A 4JX4A 1Z3YA 3JSPA 4CCLA 3FHZA 1PUFB 1J75A 4EEFG 2CW8A 5E79C 3DTKA 1MDMA 3HSEA 2ESNA 2X4HA 2ZSIB 2IGKA 1S7AA 2OQGA 2ZBKA 4BKXA 4EATA 2XB5A 3QP5A 4I0AA 3TOBA 5B3SH 5DM7F 2KDOA 1H0MA 3SXYA 1O4XA 1HW2A 3BTCA 5ICFA 4KYWA 3F8MA 1LEAA 2MLKA 1WH7A 1UHWA 3U21A 3L1PA 2Q1ZB 2XGXA 2EWNA 1WSUA 2LSOA 2L4AA 3A1YA 2KKOA 2VJJA 2MW8A 4FE4A 2DCEA 2XPUA 1MMDA 2DA7A 2MA3A 3VYSB 5K5OA 4CCMA 5D8LB 1IW7F 3SDBA 4I2OA 4BY7J 2XGDA 3HRMA 2VKHA 4OIPF 4HG2A 3HYIA 2W25A 2WTEA 2EIMH 1S72I 5L3FA 1IV8A 1ZREA 2F5DA 5FKNA 1GUUA 1EH7A 2TRTA 2LMDA 2DA1A 2OTLI 2DA5A 1USSA 2KRFA 3QPLA 4A3DJ 3CCSI 2IA0A 1NTCA 1V3FA 4U0VA 3S16J 3QPSA 1VQOI 3G1MA 2OBPA 1GHCA 3GTGJ 2PN6A 1B72A 2R7OA 1QO0D 2GA1A 3CMMA 1RETA 1WJFA 2G7UA 1X58A 4HNUA 2X1CA 5CVUA 4AWXB 1R1TA 3K69A 4Y3OA 4IQ4A 3KZYA 1L3LA 1N78A 1WHUA 4B44A 4RLQA 2G0EA 2EA2A 2V1DA 1UG0A 4LG3A 5ILUA 4FTHA 3IH3A 2DOEA 4UUSB 3QP6A 4HNVA 5EEAA 3L7WA 1AU7A 1ZKGA 1XDUA 5J40A 3ZOBA 1U3EM 1BBYA 1OCRH 2O03A 3J7YJ 3FXMA 2X6XA 3W6KB 3ECHA 3Q0WA 3L2CA 2HOTA 2QF7A 3HKZA 3TMOA 3HOTA 3MKLA 5F04A 1MNDA 1X1CA 3ZMUA 3OV8A 2HU9A 2M2EA 1XC5A 4S05A 2YU3A 4YIFA 1MBJA 5KCMA 1TLHB 3BPVA 1ACIA 1WH5A 2BY3A 5F64A 5IOZA 5HLGA 2IAIA 3WTZA 2EK5A 2ZCWA 1F1ZA 1FEXA 5L3BA 1LFPA 4BAYA 3CCQI 3M8EA 3JRHA 1WI9A 4YRVA 3PM1A 1J9IA 4M3GA 3PSIA 1WCMJ 2OV7A 3TEDA 1STZA 3Q0VA 2CQ7A 2FMLA 3F3XA 3TOAA 1V54H 1XDSA 2L7ZA 3PIOF 4JYKA 3CDLA 1OR7A 1H89C 2JT1A 2QKLB 2CQNA 2VKDA 1N75A 1RPWA 4CXFA 3F8FA 5E20A 2EBIA 1J5YA 1ZGJA 4I02A 3FXOA 4HZFA 2E2IJ 5IP7J 4FX0A 1P7IA 1W36C 5HVQC 3CCMI 1EKEA 3HPHA 1IDYA 2LYCA 4XORA 1T95A 3OR1C 1FBUA 1WRJA 3RCOA 3WHBA 3S3OA 4D7MA 4I0BA 3H0GJ 2OC6A 3DXJF 2KZVA 1YG2A 5J4YA 2W82A 4I98B 2XAUA 4HDVA 1WJEA 1YS7A 3EQLF 2A6EF 2JA5J 2V6CA 3HTUA 3IP4B 3U9GA 3K1NA 2CFXA 2GXGA 3E6DA 3S1QJ 2DFEA 2CUZA 5HLHA 2XRLA 1IN8A 1R1UA 3TP3A 3DBHB 2W48A 4LFUA 1FSHA 4B4CA 1G6NA 4LLGF 2D1VA 2LBFB 3DCFA 1TWFJ 1RI7A 2BY2A 2OZUA 5A2QK 3NAUA 3KP7A 5GP9A 2E36A 2GAUA 2Y0MA 1FC3A 1UFMA 3FHNA 1XG1A 3SDGA 1OQYA 3QRFF 3OYMA 5CKTA 1GVJA 2HR3A 1K61A 1U8BA 1DDNA 2M4GA 2DT6A 4DZPA 4GGGA 2WAFA 2UWMA 2BY1A 5J8FA 1VQ4I 3BPXA 1WJBA 1X3ZB 3KEOA 1QRYA 4YEJA 2B63J 2OAZA 4MEXF 4FHTA 1BI3A 2D1HA 3WTXC 2LKXA 1D3YA 2HVQA 5D4SA 3HHHA 2A69F 1RR7A 2IBDA 5E1ZB 4HNTA 3F21A 2HOEA 3K4BA 4BYYA 1K78A 1ETKA 1U5TC 2LREA 1Z6RA 3OYJA 2LDUA 2EV6A 5H6QA 5LHHA 4HEA2 4IHSA 4I6ZA 3KP3A 5E18F 2VQLA 4HAMA 4BEHA 4V2FA 3QQAA 1HF0A 2A07F 3K4JA 3K4CA 4BDYA 3BWGA 3EUKL 3SZTA 4O6JA 2MC4A 3ZQQA 1AKHA 1FWZA 3DV8A 1SFOJ 1JE8A 3JRGA 2BHYA 1UB9A 1IXSB 1HSJA 2DW4A 3I4PA 2QGUA 2VIXA 1YJWI 1JT0A 1F5TA 1YX5A 4B3AA 2M30A 3C2GA 5C4JJ 4FASD 1ZG3A 4C2UA 1IRGA 5EF6A 2XDVA 2MBFA 2H94A 4ENJA 5FFZA 5FROA 2R5YA 1DGWY 4IHYA 4CSWA 1ZK8A 2M8EA 4UVAA 5BQTA 2R3SA 1BW5A 2RVCA 2VB6A 3W2VA 1KYWA 4C3IJ 3HUGB 4F93B 3LSIA 2E7XA 5JFRA 2ZXWH 1TZLA 2DK8A 2RNJA 1X2MA 2DTRA 4YFNF 2R7UA 1FPQA 3OYNA 3HDDA 1X1PA 2DAOA 5IT3A 2XKOA 2CMPA 2CUEA 4Q5SF 3V8KA 3KEQA 1OKRA 4GDFA 1BM9A 3ASNH 1B4AA 3ZQIA 4B8XA 2IGNA 3CJQB 4GYGA 1OR7C 1BJZA 5AIQA 3S15J 1Z1DA 3CESA 2RN7A 3K4MA 1ZG1A 2Y0SN 3HOSA 2JSPA 1QVTA 3G73A 3FXRA 1Z05A 2STWA 2D45A 4I7HA 2K85A 2H8RA 1TQPA 2NRAC 2CS3A 3PFYA 2OA4A 5GTHC 3ERMA 5LGNA 5LGTA 4OU0A 2ECCA 3OR2C 5EEGA 4DBRA 4QWQA 2BW3A 2QM3A 1MMNA 4X6AJ 2ESHA 1ZR4A 3U2RA 2M34A 1FSEA 1XCVA 2XRNA 2XSDC 3FXQA 2QQBA 4PFOA 1MZBA 2HPIA 3G1LA 3IH4A 3ZQLA 3RPUD 2CFOA 2LP0A 2PQ8A 1IC8A 1B1BA 1FYMA 3CMYA 3OY9A 5LEKA 4ZC3A 4KNYA 2LG4A 2IGOA 1H8AC 2L4MA 2DQRA 1B8IA 5FO5A 3CC7I 1P9QC 3AG1H 3H5NA 2VBXA 3LSTA 4NQWA 1KYZA 4KT6A 5CYVA 4RGSA 2VXZA 3CCVI 2AQFA 3NEUA 4I09A 3E5QA 4F91B 5FLMJ 2X0LA 2JA6J 3QYBA 1SD7A 1TNTA 1NK3P 2XV4S 2X6YA 2KQRA 1T2KA 1YX3A 5DCMB 4NC7A 4UB6C 5J1YA 3NWTA 5ICEA 1YW8A 3I71A 1KZHA 4IOCF 4Y13A 2COMA 5TISC 3DKWA 3ZQCA 2KRCA 1KA8A 3ZP5A 3WHCA 4NB5A 2RKHA 3K1PA 4J19A 3E7LA 2KMUA 4LOCA 3HL2A 4IVNA 2FEZA 1QVUA 3HOVJ 2LF7A 2IS1A 3HJEA 3GZ6A 2GLOA 2QBYB 1P2FA 3GTQJ 2K7LA 4C9YA 1TNSA 3I54A 4XKVA 3OSGA 1JGSA 2E1CA 2OUMA 3D0SA 4IOAF 3GXOA 4AYBA 4GXOA 5J4VA 2IW5A 2XC7A 3DEEA 2DYRH 4G6QA 4WK8F 3BG6A 3BR2A 1BL0A 4G7HF 3LSGA 2IA1A 3PNYA 3ABMH 2QENA 2CQQA 4U0WA 4UY8I 3S2DJ 3T0YA 2W4SA 2CH0A 3BTLA 2LR8A 3R61A 5J1RA 5B1AH 1HW1A 1FOXA 1SMYF 3E97A 1R5GA 3Q3SA 3RTRA 3SYTA 4MIMA 1VQ8I 5H2FC 4TV7A 5EZGA 2ZB9A 1MBEA 2MH2A 2QZ8A 2X6OA 1MBHA 1YRNA 2L3DA 3M7GA 1VF9A 2WAQA 1A6QA 3BR6A 2ZKZA 2E7WA 1XSDA 1LE8B 4FCYA 5F0FA 4Y4RA 3BCAA 3CC4I 2H1LA 5CQEA 2HTJA 1BR1A 1W5TA 3PNVA 4ANJA 1BN5A 1ETVA 3S2HJ 3IV5A 3RI4A 1UAAA 4A3JJ 2F48A 3HXLA 2X48A 3QPTA 2UXNA 1IN5A 3OS1A 2A68F 1YQAA 3JCUC 3BR5A 1JKPC 2HGCA 2X6WA 1G59A 4W97A 4CUGA 4A6EA 2W84A 2DQLA 1PP7U 4DQ2A 4A3LJ 2VQHA 4XLFA 2H6CA 5IYCJ 2L9SA 2XB0X 3CJNA 5FKLA 2XPVA 2BGCA 3A4CA 2GA2A 2OCEA 1TBXA 1D0YA 3S1MJ 1BIBA 4XRSA 4W1UA 3RQIA 1LPQA 4LB5A 4LITA 1CF7B 4XR6A 4CCJA 3CD6I 2JTVA 1DU6A 4ZDPA 4EMSA 1U9OA 3QODA 4CYDA 2ETHA 1OCCH 2K02A 1WKMA 4OWRB 3PJRA 2L02A 3CTAA 1S6LA 2K9MA 1NG7A 3B6CA 2O5RA 5TGTA 4XOPA 1G3YA 4OIQF 2EFNA 3HG9A 1Z7LA 2CV1A 1U8RA 3E5XA 3MEXA 3JRIA 4AM3A 4WF2A 2R5ZB 3FZVA 1T6SA 3LA3A 3R6SA 4EJWA 5M5YJ 4A5NA 4BU2A 1BC7C 4PSXA 3LSKA 1E17A 2GXBA 2XAGA 1LVAA 4S0HB 1I1GA 2VC1A 1MBGA 1A04A 3KP4A 2QKMB 2L0KA 4XLCA 5LBQA 5IYDJ 4Q47A 4C3JJ 4X1EA 1UELB 4M6VA 4DOZA 1MMSA 2R4GA 2VL8A 2VXDA 2PG4A 4YG2F 1AOYA 2ZMEA 4E7JA 3JR9A 1JXSA 3K4NA 3DKYA 5E3NA 3J81K 3V7SA 1R49A 3I56I 4IHWA 2Y9YA 4E7HA 2VJ5A 4U7BA 3NARA 2LOOA 5DD8A 4G94A 3GTOJ 5K7FA 1WWXA 1W1WE 3K10A 4L9JA 5CPRB 3WU1B 2WB1A 2YU9J 1SD6A 4LJZF 4PCQA 3W6VA 3D1NI 1NG6A 4B3XA 2WY7Q 5ICCA 2KISA 1PUEE 2ELHA 3QAHA 5BS6A 4RDUA 1ZGWA 2CW0F 4A0YA 1Z0XA 2WA0A 4BBSJ 1O3TA 2HZDA 3CF5F 1ZLKA 4N4NB 1YO5C 4RA2A 2Z3YA 2K3FA 3QU3A 4LD5A 1VQ9I 3ABTA 2M0MA 5K7HA 2VBWA 2EILH 4D0PA 1X19A 4OMZA 2XF7A 4E7ZA 4WXHA 2L9RA 2EFPA 5FLXZ 2PEXA 1SEUA 2DI3A 5IP6A 2HKOA 3ZQFA 3J7AO 2CJJA 3GF2A 5GTIC 2XROA 5B66C 5IYBJ 1FBQA 4NHJA 2R7VA 2R7FA 2VLAA 2KIMA 2BXYA 1OJLA 3C1DA 5C4XJ 1SVMA 4A3GJ 4FE7A 2WV0A 2DMTA 2K4JA 2HPMA 5M3MJ 4PJNA 3GBGA 1JUSA 3S32A 4U7DA 3VSLA 5DS9A 4QTRA 4RAGA 4P1WA 1QA6A 5HDGA 4P5OA
chains in the Genus database with same CATH topology
1QBJA 3RDIA 2VOOA 2HEOA 4KICA 2QVOA 2UZKA 2WC2A 2QUFA 1OPCA 4P9FA 3EDPA 3KCCA 2FA5A 5CVIA 3GUDA 2ZNZA 2H6BA 5CLSA 2IPQX 4ZYDA 4H0EA 4LB6B 4CDGA 2LF8A 1ZGAA 1W7PA 3DPTA 3GWZA 2IA2A 1XCBA 2V1XA 5D5WB 3JW4A 2PJPA 1U5TA 1R22A 3BJ6A 2HTSA 3RPQA 4LG0B 5BPDA 2FXAA 1DP7P 3WODF 3M9AA 4PZJA 4FT8A 2NS0A 3K9TA 1D8KA 1BI2A 4A0XA 4MGRA 5D6FA 1SMTA 2JRTA 3HIFA 3CUQB 1FP2A 2W24A 2J5PA 2DT5A 3I58A 1IRFA 5E8IA 2FBIA 4KDPA 3R4KA 3I53A 1SD4A 4G8XA 3I64A 1PDNC 2VT3A 1LDDA 4LLNA 2V1UA 2OD5A 3ZMZA 4BXUA 1QGPA 3KZZA 3VODA 4UV8A 4UUVA 3ZN0A 1XD7A 4EVIA 4CHUA 5D8KB 2VE8A 2P5LC 3F72A 2ZFWA 4UNOA 2VE9A 2G7HA 2XKPA 4EM1A 4BHPA 2AXLA 3QOPA 5LEJA 2CGPA 2HS5A 1OYWA 2Q0OA 1DUXC 2CYYA 3T8RA 1YS6A 3QU6A 2YX7A 4XLPF 2XVCA 4RB1A 2BV6A 3EUHA 3F8CA 1UHMA 2Z99A 2F2EA 1ZARA 3WE3A 2HYGD 3V4GA 2A61A 4CZZA 2A5YB 5DDGA 4M9ZA 2P5KA 4O5VA 3LAPA 3JSOA 4HF1A 1XMKA 3FM5A 2VODA 1O57A 1XGNA 3MZHA 3DEUA 1SFXA 1RUNA 1BC8C 3HHGA 2DPUA 1RNLA 1QNTA 5FB2A 1VTNC 3HSRA 1ZYRF 4R8HA 4XRFA 4HQEA 2Y75A 3IKTA 4M74A 2OU2A 3ECOA 3LFKA 3F6OA 1NHAA 5CVVA 2HYFA 1OMIA 3HUGA 1XGOA 4EQQA 5L3EA 2P8TA 2K4BA 2P4WA 4IXAA 3LQRA 1OYYA 2YSRA 4R79A 4U88A 5L3GA 1D5VA 4Y15A 3I59B 1LDKB 2JSCA 2NNNA 3MCZA 2ZXJA 4HOBA 1YTYA 1R7JA 3L09A 3F22A 3BJOA 2MC3A 1ZH5A 3FXUA 4ESBA 3ZMDA 5IT9K 3VFZA 3TO9A 2MLGA 1SFUA 2L01A 3LWFA 3H3ZA 2K27A 3J80K 1Z9CA 4M73A 4IF4A 2BE5F 3H92A 1MGTA 3GFMA 3NQOA 3ZMVA 3E6MA 5CVRA 3RJPA 4R1HA 1HKQA 1QZYA 3FMSA 5F6FA 2GQQA 3K2ZA 3KP2A 4A12A 1YW9A 4Z2YA 1KQ9A 2AS5F 2XAJA 1C0WA 5E1WA 1H9TA 2BBYA 2QBYA 2RC4A 5E17F 1U6GA 2WWYA 5DCFA 1G3SA 1V4RA 1P6RA 4UHTA 4IHTA 1ZRDA 4A0ZA 4HBLA 3JAMZ 2HWVA 3HTSB 1GXQA 2J5OA 1LDJA 4N9IA 3MZYA 5KK1A 2H27A 4ENKA 3FMQA 1P4XA 3AAFA 3GO5A 3HRTA 5HS8A 4ZYEA 2B0LA 5AONA 2ZNYA 4HLYA 4MHGA 1P4WA 3MFKA 1IXRC 2YR2A 5HS7A 2OZ6A 4LGWA 1ZN2A 1EV7A 4KMUX 1RZ4A 5HOOA 1G3TA 3COAC 2P6TA 2DU9A 3ERED 2ISZA 1T39A 3EETA 1B9NA 3SFZA 3WG9A 2EJRA 4P55A 4EJOA 1XSXA 4OINF 1B6AA 3GFJA 3IC7A 5TRDA 2LKPA 3D5LA 3TGNA 2Z5UA 4XBFA 4AVPA 3FX3A 2VOPA 4UV9A 1E2XA 4HQMA 4BNCA 5ERIA 2JPCA 3GFIA 1ONVA 2JPBA 3WTTC 4MTDA 2NAZA 1HW5A 5BPIA 3P7NA 1Z91A 2QQAA 5HLIA 3ELKA 1FBSA 1R00A 1CF7A 1IXCA 3E6CC 2XASA 4KIFA 5K5QA 2Q2EA 1XB4A 1QZZA 2XIGA 4PGHA 3RKYA 3U1DA 1ZAOA 2ACJA 2EFQA 3V7RA 1XGMA 1IN7A 4K2EA 3ZMTA 1ZRFA 1T38A 4PDKA 3CUOA 1BJAA 4BQAA 4L9VA 5CJ9A 1R5HA 4GO1A 4L0ZB 4M9SA 3F8NA 5ICGA 1MJAA 2PMHA 3BJAA 3I0TA 5LRRA 4M6YA 2FNPA 4U0YA 2FNAA 4MQVA 2F5FA 3H3UA 3C3WA 3FF5A 4HDUA 3P9KA 4WX9A 2XAHA 4BH9A 2VC0A 1KU3A 2ADUA 1QQIA 4OOIA 3TO6A 1LQ1A 3J81Z 3FM3A 2DO7A 2HQNA 4M71A 5BMZA 1DPUA 4LK1F 1ZG5A 5LHGA 4XSXF 2GZWA 2M45A 1P4AA 4Q4ZF 1JHHA 1T0FA 3R0AA 5E1XA 3B02A 3C7JA 1Q1HA 1MD0A 4WXDA 4KFCA 5DEQA 1X3UA 1ZRCA 1SFEA 4DNCA 4PGGA 3ML6A 5FLXK 1G4DA 4HX8A 3ZN1A 4N9HA 4XSZF 5K5RA 2MD5A 2YX4A 1I5ZA 4ZYGA 4A6DA 1LJ9A 3SQNA 2DLLA 1L0OC 2W85A 1FLIA 2FE3A 3KP6A 3KP5A 3ZPLA 5FGMA 4RB2C 4BHBA 2GWRA 2R7DA 1CGPA 5K1YA 4LG0A 2PMUA 1USTA 1YFHA 3TO7A 2FOKA 2CSOA 1MKMA 1QPMA 3I5UA 2A6HF 2G9WA 3GLXA 2C6YA 3PQKA 4G9YA 4HV5A 1J0RA 2TDXA 4I01A 2XAQA 3L00A 4YFKF 3M8FA 4E70A 3IWZA 1K79A 3MWMA 4P9UA 3K1MA 1FNNA 3CUQA 1H9GA 4OIOF 4ENNA 5BOXA 4IRIA 4KMFA 1D8JA 4EJTA 2CO5A 2F5CA 5TJJA 1KGSA 3BOQA 5E8GA 4LK0F 1FYKA 5HDNA 2M5WA 3B73A 1HKTA 3KLNA 5DUIA 2O8XA 1KU9A 4HF0A 1BIAA 4OMYA 1MDMB 2V9VA 2XAFA 5JR3A 2HQRA 2LNBA 4RB0A 3KFWX 2CWEA 2D2WA 3WTYC 2PLYA 2RGVA 2HZTA 2EV0A 2FBHA 5D5UB 5DYMA 2K86A 3P9IA 3GYHX 4L9TA 4IPAA 4QLCU 4G6DA 2E1NA 5EEHA 2ISYA 5LGUA 1BI0A 4RGUA 4KT5C 4ESJA 3R60A 3HSFA 1W7PB 3F6VA 1O7LA 1FY7A 1R1VA 4FX4A 5J6XA 1U5TB 4XLNF 2NYXA 3IKVA 2F5EA 3KETA 2M87A 3RYRA 3ROUA 1R36A 1TTYA 2GIVA 5HS9A 2IJLA 2EFWA 4ZH4F 2IRFG 3ABUA 5J8CA 3BY6A 4UVBA 4EJUA 2CQKA 1O3SA 4L5JA 1K7AA 3IRQA 4EV0A 1TW3A 1W7PD 3LQQA 3LA2A 5ED4A 1IUYA 4N0BA 3IWFA 3N97A 1T98A 4AD9A 5HDKA 1JHFA 3GVAA 3WGHA 4L9NA 1W4MA 1I1SA 2Q8KA 3FWEA 5DD4A 1GXPA 3QPHA 3Q9VA 2KIUA 3GX4X 4KN7X 1Y0UA 1FOKA 3EYYA 2ZO4A 1K6OA 3TQNA 5DV5A 2Y48A 3E6BA 5D6EA 2RQPA 2A3SA 2QQ9A 3HRSA 3GEZA 1ON2A 1UCRA 5A2QZ 5CVJA 3CLOA 5ILVA 1YW7A 4KIGA 2HKXA 2VBYA 1MJ9A 1TQIA 4YIIA 3KE2A 4KUMA 2L54A 3CUQC 3MAJA 4L0YB 2EB7A 5AIPA 1IZ1A 1FX7A 2QWWA 3I59A 4MTEA 3TDUC 5ILSA 1XMAA 3LAJA 4KIBA 3BZ6A 4Q48A 2EFOA 2RDPA 4ETSA 4ENMA 3T5XA 1B59A 4IRHA 2BEOA 3BDDA 5FD5A 1ZHFA 1OYIA 3RPUA 1HBXG 4RAYA 3Q5FA 2HFHA 1YLFA 3L9FA 1J2XA 3DFGA 1IAWA 1XSVA 3O2PE 3V7CA 4A2UA 2FQ3A 4OIRF 1F9NA 3P9CA 1LB2A 1XN7A 2VT2A 1TQMA 2YPRA 2ZJ2A 3TDZC 1K78B 1J7KA 2DBBA 2IP2A 3CO7C 3WGGA 1W5SA 1FYLA 5LHIA 2EA4A 2MH9A 5IT9Z 1KU2A 4RB3C 3BP8A 4AIJA 3FMRA 4KA4A 2DPDA 1J59A 4MEYF 2DFIA 2BYVE 3J80Z 1SD5A 4RGRA 3VB2A 1S7OA 4GCVA 3WTWC 4WWCA 2M1BA 2QYOA 3CO6C 4F7ZA 2O0YA 5DCMA 1LEBA 4ZZLA 2O3FA 1EH6A 3G3ZA 3GFLA 1XGSA 4B09A 4L5IA 4ASNA 3DP7A 1U78A 3V8JA 2UXXA 2W57A 1KQ0A 4L18B 5H6RA 3PFIA 3K0LA 3CDHA 4RGXA 1ON1A 1YYVA 3F23A 3V8LA 1MJBA 3S2WA 2KIFA 1O3QA 1IN4A 4M9XA 3O6BB 5FD6A 3JAMK 2VN2A 3PQJA 5F1RA 3GZ5A 5DUKA 2P5VA 1HQCA 3RKXA 2NNYA 3M1EA 1IF1A 1YIOA 4JK1X 3Q9SA 4RS8A 3SHFA 5D5XB 4M72A 3SZPA 5KVRA 4O3MA 4ZYHA 1RUOA 1ULYA 5LRSA 1FP1D 4YFXF 5JVTA 5D4RA 1FT9A 3RKWA 4EM2A 3C18A 4KN4X 3WE2A 3WGIA 4GYIA 3E5UA 3T8TA 2IVMA 2FU4A 4IRGA 3JTHA 1I6XA 2Z9OA 2VONA 1EH8A 3RYPA 2Z33A 1DPRA 4P96A 4ESFA 4CGZA 3REOA 4EGYA 2HDCA 4UVCA 2OQRA 2DK5A 1WQ2A 3WTVC 1HSTA 4HLXA 3N4MA 1S3JA 5FFXA 4HYEA 5L3CA 4AIHA 4WCGA 4IJAA 1S29A 1REPC 4UXNA 1SAXA 4S04A 2FSWA 1BOAA 4JBAA 1Z6TA 3ZMSA 3OOPA 1KU7A 4MQ9F 4HW0A 4RAZA 2P6SA 3KLOA 1R58A 5L3DA 3ULQB 5JHUA 2PI0A 4AIKA 2P7VB 3DQVC 2QLZA 3NRVA 3BROA 4EJVA 3DF8A 4CICA 3ISPA 1ZLJA 1HKSA 4BHCA 2O6GE 3RIRA 1O3RA 1S8NA 1P92A 1BI1A 2H09A 4ON0A 2V79A 1U2WA 3R0JA 1RIOH 4LMYA 3LA7A 3IL2A 1G3WA 1IN6A 2FF4A 1PP8F 1ODDA 2O61A 3EYIA 1LNWA 1FZPB 2EV5A 2KJBA 2PFBA 3W6JB 1KQ8A 3MQ0A 2P7CB 2XUBA 3O3KA 4LLLA 4MNUA 2CG4A 3VEPA 5JI6A 4WXCA 4HA8A 3WU0A 2VBZA 3HRUA 4M6XA 4G7ZF 1B9MA 2RV8A 1TW2A 3VOEA 3IRRA 2XHKA 3DPLC 4Y17A 1I27A 1AWCA 4HX4A 1F4KA 4HV6A 3E3VA 5D5VB 3WTUC 2FRHA 4A5MA 4JQFA 3T1BA 3F8BA 2JZYA 2ZMEB 4EM0B 2KJCA 3IHUA 4HX7A 3JTGA 1R23A 6PAXA 4EGZA 4G7OF 3TKYA 1HXDA 4CO8A 3ZQ7A 2PBIA 3WTSC 2FBKA 4ZZDA 3GW2A 2IT0A 4HF2A 1Z7UA 1O7FA 2STTA 5LLQA 2FMYA 5H20A 3JSPA 3FHZA 1J75A 1MDMA 3HSEA 2ESNA 2X4HA 1S7AA 2OQGA 2ZBKA 3QP5A 3TOBA 4I0AA 1H0MA 3SXYA 1HW2A 5ICFA 4KYWA 3F8MA 1LEAA 2MLKA 1UHWA 2XGXA 2EWNA 1WSUA 2LSOA 2L4AA 2KKOA 2MA3A 5K5OA 5D8LB 1IW7F 4I2OA 3HRMA 4OIPF 3HYIA 2W25A 2WTEA 5L3FA 1ZREA 2F5DA 1EH7A 1USSA 2KRFA 2IA0A 4U0VA 1V3FA 2OBPA 1GHCA 2PN6A 1QO0D 2GA1A 2G7UA 4AWXB 5CVUA 1R1TA 3K69A 3KZYA 1L3LA 2EA2A 2V1DA 5ILUA 3QP6A 3L7WA 1XDUA 1U3EM 1BBYA 2O03A 3W6KB 3ECHA 3L2CA 3HOTA 3ZMUA 3OV8A 4S05A 2YU3A 4YIFA 1TLHB 3BPVA 5F64A 5HLGA 3WTZA 2EK5A 1F1ZA 2ZCWA 5L3BA 4BAYA 3M8EA 1WI9A 1J9IA 1STZA 2FMLA 3F3XA 3TOAA 1XDSA 1OR7A 2JT1A 4CXFA 3F8FA 5E20A 1J5YA 1ZGJA 4I02A 4HZFA 4FX0A 5HVQC 1FBUA 1WRJA 4I0BA 3DXJF 1YG2A 4I98B 4HDVA 1YS7A 3EQLF 2A6EF 2V6CA 3HTUA 3U9GA 3K1NA 2CFXA 2GXGA 3E6DA 5HLHA 1IN8A 1R1UA 4LFUA 1FSHA 1G6NA 4LLGF 2D1VA 1RI7A 2OZUA 5A2QK 3KP7A 2GAUA 2Y0MA 1FC3A 1UFMA 3QRFF 1GVJA 2HR3A 1DDNA 4GGGA 2UWMA 5J8FA 3BPXA 3KEOA 2OAZA 4MEXF 4FHTA 1BI3A 2D1HA 3WTXC 1D3YA 5D4SA 3HHHA 2A69F 5E1ZB 3F21A 2HOEA 4BYYA 1K78A 1U5TC 1Z6RA 2LDUA 2EV6A 5H6QA 5LHHA 4IHSA 3KP3A 5E18F 4HAMA 2A07F 3BWGA 3SZTA 4O6JA 1FWZA 3DV8A 1JE8A 1UB9A 1IXSB 1HSJA 2DW4A 3I4PA 1F5TA 2M30A 1ZG3A 1IRGA 2MBFA 2H94A 4ENJA 5FFZA 5BQTA 2M8EA 4UVAA 2R3SA 2RVCA 1KYWA 2E7XA 5JFRA 2DK8A 2RNJA 2DTRA 4YFNF 1FPQA 2DAOA 5IT3A 2XKOA 4Q5SF 3V8KA 3KEQA 1OKRA 1BM9A 1B4AA 4B8XA 4GYGA 5AIQA 1Z1DA 2RN7A 1ZG1A 3HOSA 3G73A 3FXRA 1Z05A 2STWA 2D45A 4I7HA 1TQPA 2NRAC 2OA4A 5LGNA 5LGTA 4OU0A 5EEGA 4QWQA 2QM3A 2ESHA 3U2RA 1FSEA 1XCVA 2XRNA 3FXQA 2QQBA 1MZBA 2PQ8A 1B1BA 1FYMA 5LEKA 4KNYA 2L4MA 2DQRA 5FO5A 2VBXA 3LSTA 4NQWA 1KYZA 5CYVA 4RGSA 2VXZA 3NEUA 4I09A 3E5QA 2X0LA 1SD7A 1TNTA 2XV4S 1T2KA 5DCMB 5ICEA 1YW8A 3I71A 4Y13A 2COMA 3DKWA 1KA8A 3ZP5A 4NB5A 2RKHA 3K1PA 4IVNA 2FEZA 2LF7A 3GZ6A 2QBYB 1P2FA 2K7LA 1TNSA 3I54A 1JGSA 2E1CA 3D0SA 3GXOA 4GXOA 2IW5A 4G6QA 4WK8F 4G7HF 2IA1A 2QENA 4U0WA 3T0YA 3R61A 1HW1A 1SMYF 3E97A 1R5GA 3RTRA 4TV7A 2MH2A 2QZ8A 2L3DA 3M7GA 2ZKZA 2E7WA 1XSDA 2HTJA 1W5TA 1BN5A 3RI4A 3QPTA 2UXNA 1IN5A 2A68F 1YQAA 2HGCA 4A6EA 2W84A 2DQLA 1PP7U 4DQ2A 2H6CA 3CJNA 2BGCA 2GA2A 1TBXA 1BIBA 4LB5A 1CF7B 2JTVA 4EMSA 4CYDA 2ETHA 2K02A 1WKMA 2L02A 3CTAA 1S6LA 1G3YA 4OIQF 2EFNA 1U8RA 3E5XA 3MEXA 4WF2A 3FZVA 1T6SA 3LA3A 3R6SA 4EJWA 4A5NA 1BC7C 1E17A 2GXBA 2XAGA 1LVAA 1I1GA 2VC1A 1A04A 3KP4A 5LBQA 4Q47A 4YG2F 2PG4A 1AOYA 2ZMEA 1JXSA 3J81K 3V7SA 4U7BA 5DD8A 4G94A 1WWXA 4L9JA 3WU1B 1SD6A 4LJZF 4PCQA 5ICCA 1PUEE 2ELHA 3QAHA 5BS6A 2CW0F 4A0YA 1O3TA 1ZLKA 1YO5C 2Z3YA 3QU3A 4LD5A 3ABTA 2VBWA 4D0PA 4OMZA 4WXHA 2EFPA 5FLXZ 2PEXA 2DI3A 2HKOA 3J7AO 3GF2A 2XROA 1FBQA 4NHJA 2R7FA 2KIMA 3C1DA 2WV0A 2K4JA 4U7DA 5HDGA 4P5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QBJ A;  3RDI A;  2VOO A;  2HEO A;  4KIC A;  2QVO A;  2UZK A;  2WC2 A;  2QUF A;  1OPC A;  4P9F A;  3EDP A;  3KCC A;  2FA5 A;  5CVI A;  3GUD A;  2ZNZ A;  2H6B A;  5CLS A;  2IPQ X;  4ZYD A;  4H0E A;  4LB6 B;  4CDG A;  2LF8 A;  1ZGA A;  1W7P A;  3DPT A;  3GWZ A;  2IA2 A;  1XCB A;  2V1X A;  5D5W B;  3JW4 A;  2PJP A;  1U5T A;  1R22 A;  3BJ6 A;  2HTS A;  3RPQ A;  4LG0 B;  5BPD A;  2FXA A;  1DP7 P;  3WOD F;  3M9A A;  4PZJ A;  4FT8 A;  2NS0 A;  3K9T A;  1D8K A;  1BI2 A;  4A0X A;  4MGR A;  5D6F A;  1SMT A;  2JRT A;  3HIF A;  3CUQ B;  1FP2 A;  2W24 A;  2J5P A;  2DT5 A;  3I58 A;  1IRF A;  5E8I A;  2FBI A;  4KDP A;  3R4K A;  3I53 A;  1SD4 A;  4G8X A;  3I64 A;  1PDN C;  2VT3 A;  1LDD A;  4LLN A;  2V1U A;  2OD5 A;  3ZMZ A;  4BXU A;  1QGP A;  3KZZ A;  3VOD A;  4UV8 A;  4UUV A;  3ZN0 A;  1XD7 A;  4EVI A;  4CHU A;  5D8K B;  2VE8 A;  2P5L C;  3F72 A;  2ZFW A;  4UNO A;  2VE9 A;  2G7H A;  2XKP A;  4EM1 A;  4BHP A;  2AXL A;  3QOP A;  5LEJ A;  2CGP A;  2HS5 A;  1OYW A;  2Q0O A;  1DUX C;  2CYY A;  3T8R A;  1YS6 A;  3QU6 A;  2YX7 A;  4XLP F;  2XVC A;  4RB1 A;  2BV6 A;  3EUH A;  3F8C A;  1UHM A;  2Z99 A;  2F2E A;  1ZAR A;  3WE3 A;  2HYG D;  3V4G A;  2A61 A;  4CZZ A;  2A5Y B;  5DDG A;  4M9Z A;  2P5K A;  4O5V A;  3LAP A;  3JSO A;  4HF1 A;  1XMK A;  3FM5 A;  2VOD A;  1O57 A;  1XGN A;  3MZH A;  3DEU A;  1SFX A;  1RUN A;  1BC8 C;  3HHG A;  2DPU A;  1RNL A;  1QNT A;  5FB2 A;  1VTN C;  3HSR A;  1ZYR F;  4R8H A;  4XRF A;  4HQE A;  2Y75 A;  3IKT A;  4M74 A;  2OU2 A;  3ECO A;  3LFK A;  3F6O A;  1NHA A;  5CVV A;  2HYF A;  1OMI A;  3HUG A;  1XGO A;  4EQQ A;  5L3E A;  2P8T A;  2K4B A;  2P4W A;  4IXA A;  3LQR A;  1OYY A;  2YSR A;  4R79 A;  4U88 A;  5L3G A;  1D5V A;  4Y15 A;  3I59 B;  1LDK B;  2JSC A;  2NNN A;  3MCZ A;  2ZXJ A;  4HOB A;  1YTY A;  1R7J A;  3L09 A;  3F22 A;  3BJO A;  2MC3 A;  1ZH5 A;  3FXU A;  4ESB A;  3ZMD A;  5IT9 K;  3VFZ A;  3TO9 A;  2MLG A;  1SFU A;  2L01 A;  3LWF A;  3H3Z A;  2K27 A;  3J80 K;  1Z9C A;  4M73 A;  4IF4 A;  2BE5 F;  3H92 A;  1MGT A;  3GFM A;  3NQO A;  3ZMV A;  3E6M A;  5CVR A;  3RJP A;  4R1H A;  1HKQ A;  1QZY A;  3FMS A;  5F6F A;  2GQQ A;  3K2Z A;  3KP2 A;  4A12 A;  1YW9 A;  4Z2Y A;  1KQ9 A;  2AS5 F;  2XAJ A;  1C0W A;  5E1W A;  1H9T A;  2BBY A;  2QBY A;  2RC4 A;  5E17 F;  1U6G A;  2WWY A;  5DCF A;  1G3S A;  1V4R A;  1P6R A;  4UHT A;  4IHT A;  1ZRD A;  4A0Z A;  4HBL A;  3JAM Z;  2HWV A;  3HTS B;  1GXQ A;  2J5O A;  1LDJ A;  4N9I A;  3MZY A;  5KK1 A;  2H27 A;  4ENK A;  3FMQ A;  1P4X A;  3AAF A;  3GO5 A;  3HRT A;  5HS8 A;  4ZYE A;  2B0L A;  5AON A;  2ZNY A;  4HLY A;  4MHG A;  1P4W A;  3MFK A;  1IXR C;  2YR2 A;  5HS7 A;  2OZ6 A;  4LGW A;  1ZN2 A;  1EV7 A;  4KMU X;  1RZ4 A;  5HOO A;  1G3T A;  3COA C;  2P6T A;  2DU9 A;  3ERE D;  2ISZ A;  1T39 A;  3EET A;  1B9N A;  3SFZ A;  3WG9 A;  2EJR A;  4P55 A;  4EJO A;  1XSX A;  4OIN F;  1B6A A;  3GFJ A;  3IC7 A;  5TRD A;  2LKP A;  3D5L A;  3TGN A;  2Z5U A;  4XBF A;  4AVP A;  3FX3 A;  2VOP A;  4UV9 A;  1E2X A;  4HQM A;  4BNC A;  5ERI A;  2JPC A;  3GFI A;  1ONV A;  2JPB A;  3WTT C;  4MTD A;  2NAZ A;  1HW5 A;  5BPI A;  3P7N A;  1Z91 A;  2QQA A;  5HLI A;  3ELK A;  1FBS A;  1R00 A;  1CF7 A;  1IXC A;  3E6C C;  2XAS A;  4KIF A;  5K5Q A;  2Q2E A;  1XB4 A;  1QZZ A;  2XIG A;  4PGH A;  3RKY A;  3U1D A;  1ZAO A;  2ACJ A;  2EFQ A;  3V7R A;  1XGM A;  1IN7 A;  4K2E A;  3ZMT A;  1ZRF A;  1T38 A;  4PDK A;  3CUO A;  1BJA A;  4BQA A;  4L9V A;  5CJ9 A;  1R5H A;  4GO1 A;  4L0Z B;  4M9S A;  3F8N A;  5ICG A;  1MJA A;  2PMH A;  3BJA A;  3I0T A;  5LRR A;  4M6Y A;  2FNP A;  4U0Y A;  2FNA A;  4MQV A;  2F5F A;  3H3U A;  3C3W A;  3FF5 A;  4HDU A;  3P9K A;  4WX9 A;  2XAH A;  4BH9 A;  2VC0 A;  1KU3 A;  2ADU A;  1QQI A;  4OOI A;  3TO6 A;  1LQ1 A;  3J81 Z;  3FM3 A;  2DO7 A;  2HQN A;  4M71 A;  5BMZ A;  1DPU A;  4LK1 F;  1ZG5 A;  5LHG A;  4XSX F;  2GZW A;  2M45 A;  1P4A A;  4Q4Z F;  1JHH A;  1T0F A;  3R0A A;  5E1X A;  3B02 A;  3C7J A;  1Q1H A;  1MD0 A;  4WXD A;  4KFC A;  5DEQ A;  1X3U A;  1ZRC A;  1SFE A;  4DNC A;  4PGG A;  3ML6 A;  5FLX K;  1G4D A;  4HX8 A;  3ZN1 A;  4N9H A;  4XSZ F;  5K5R A;  2MD5 A;  2YX4 A;  1I5Z A;  4ZYG A;  4A6D A;  1LJ9 A;  3SQN A;  2DLL A;  1L0O C;  2W85 A;  1FLI A;  2FE3 A;  3KP6 A;  3KP5 A;  3ZPL A;  5FGM A;  4RB2 C;  4BHB A;  2GWR A;  2R7D A;  1CGP A;  5K1Y A;  4LG0 A;  2PMU A;  1UST A;  1YFH A;  3TO7 A;  2FOK A;  2CSO A;  1MKM A;  1QPM A;  3I5U A;  2A6H F;  2G9W A;  3GLX A;  2C6Y A;  3PQK A;  4G9Y A;  4HV5 A;  1J0R A;  2TDX A;  4I01 A;  2XAQ A;  3L00 A;  4YFK F;  3M8F A;  4E70 A;  3IWZ A;  1K79 A;  3MWM A;  4P9U A;  3K1M A;  1FNN A;  3CUQ A;  1H9G A;  4OIO F;  4ENN A;  5BOX A;  4IRI A;  4KMF A;  1D8J A;  4EJT A;  2CO5 A;  2F5C A;  5TJJ A;  1KGS A;  3BOQ A;  5E8G A;  4LK0 F;  1FYK A;  5HDN A;  2M5W A;  3B73 A;  1HKT A;  3KLN A;  5DUI A;  2O8X A;  1KU9 A;  4HF0 A;  1BIA A;  4OMY A;  1MDM B;  2V9V A;  2XAF A;  5JR3 A;  2HQR A;  2LNB A;  4RB0 A;  3KFW X;  2CWE A;  2D2W A;  3WTY C;  2PLY A;  2RGV A;  2HZT A;  2EV0 A;  2FBH A;  5D5U B;  5DYM A;  2K86 A;  3P9I A;  3GYH X;  4L9T A;  4IPA A;  4QLC U;  4G6D A;  2E1N A;  5EEH A;  2ISY A;  5LGU A;  1BI0 A;  4RGU A;  4KT5 C;  4ESJ A;  3R60 A;  3HSF A;  1W7P B;  3F6V A;  1O7L A;  1FY7 A;  1R1V A;  4FX4 A;  5J6X A;  1U5T B;  4XLN F;  2NYX A;  3IKV A;  2F5E A;  3KET A;  2M87 A;  3RYR A;  3ROU A;  1R36 A;  1TTY A;  2GIV A;  5HS9 A;  2IJL A;  2EFW A;  4ZH4 F;  2IRF G;  3ABU A;  5J8C A;  3BY6 A;  4UVB A;  4EJU A;  2CQK A;  1O3S A;  4L5J A;  1K7A A;  3IRQ A;  4EV0 A;  1TW3 A;  1W7P D;  3LQQ A;  3LA2 A;  5ED4 A;  1IUY A;  4N0B A;  3IWF A;  3N97 A;  1T98 A;  4AD9 A;  5HDK A;  1JHF A;  3GVA A;  3WGH A;  4L9N A;  1W4M A;  1I1S A;  2Q8K A;  3FWE A;  5DD4 A;  1GXP A;  3QPH A;  3Q9V A;  2KIU A;  3GX4 X;  4KN7 X;  1Y0U A;  1FOK A;  3EYY A;  2ZO4 A;  1K6O A;  3TQN A;  5DV5 A;  2Y48 A;  3E6B A;  5D6E A;  2RQP A;  2A3S A;  2QQ9 A;  3HRS A;  3GEZ A;  1ON2 A;  1UCR A;  5A2Q Z;  5CVJ A;  3CLO A;  5ILV A;  1YW7 A;  4KIG A;  2HKX A;  2VBY A;  1MJ9 A;  1TQI A;  4YII A;  3KE2 A;  4KUM A;  2L54 A;  3CUQ C;  3MAJ A;  4L0Y B;  2EB7 A;  5AIP A;  1IZ1 A;  1FX7 A;  2QWW A;  3I59 A;  4MTE A;  3TDU C;  5ILS A;  1XMA A;  3LAJ A;  4KIB A;  3BZ6 A;  4Q48 A;  2EFO A;  2RDP A;  4ETS A;  4ENM A;  3T5X A;  1B59 A;  4IRH A;  2BEO A;  3BDD A;  5FD5 A;  1ZHF A;  1OYI A;  3RPU A;  1HBX G;  4RAY A;  3Q5F A;  2HFH A;  1YLF A;  3L9F A;  1J2X A;  3DFG A;  1IAW A;  1XSV A;  3O2P E;  3V7C A;  4A2U A;  2FQ3 A;  4OIR F;  1F9N A;  3P9C A;  1LB2 A;  1XN7 A;  2VT2 A;  1TQM A;  2YPR A;  2ZJ2 A;  3TDZ C;  1K78 B;  1J7K A;  2DBB A;  2IP2 A;  3CO7 C;  3WGG A;  1W5S A;  1FYL A;  5LHI A;  2EA4 A;  2MH9 A;  5IT9 Z;  1KU2 A;  4RB3 C;  3BP8 A;  4AIJ A;  3FMR A;  4KA4 A;  2DPD A;  1J59 A;  4MEY F;  2DFI A;  2BYV E;  3J80 Z;  1SD5 A;  4RGR A;  3VB2 A;  1S7O A;  4GCV A;  3WTW C;  4WWC A;  2M1B A;  2QYO A;  3CO6 C;  4F7Z A;  2O0Y A;  5DCM A;  1LEB A;  4ZZL A;  2O3F A;  1EH6 A;  3G3Z A;  3GFL A;  1XGS A;  4B09 A;  4L5I A;  4ASN A;  3DP7 A;  1U78 A;  3V8J A;  2UXX A;  2W57 A;  1KQ0 A;  4L18 B;  5H6R A;  3PFI A;  3K0L A;  3CDH A;  4RGX A;  1ON1 A;  1YYV A;  3F23 A;  3V8L A;  1MJB A;  3S2W A;  2KIF A;  1O3Q A;  1IN4 A;  4M9X A;  3O6B B;  5FD6 A;  3JAM K;  2VN2 A;  3PQJ A;  5F1R A;  3GZ5 A;  5DUK A;  2P5V A;  1HQC A;  3RKX A;  2NNY A;  3M1E A;  1IF1 A;  1YIO A;  4JK1 X;  3Q9S A;  4RS8 A;  3SHF A;  5D5X B;  4M72 A;  3SZP A;  5KVR A;  4O3M A;  4ZYH A;  1RUO A;  1ULY A;  5LRS A;  1FP1 D;  4YFX F;  5JVT A;  5D4R A;  1FT9 A;  3RKW A;  4EM2 A;  3C18 A;  4KN4 X;  3WE2 A;  3WGI A;  4GYI A;  3E5U A;  3T8T A;  2IVM A;  2FU4 A;  4IRG A;  3JTH A;  1I6X A;  2Z9O A;  2VON A;  1EH8 A;  3RYP A;  2Z33 A;  1DPR A;  4P96 A;  4ESF A;  4CGZ A;  3REO A;  4EGY A;  2HDC A;  4UVC A;  2OQR A;  2DK5 A;  1WQ2 A;  3WTV C;  1HST A;  4HLX A;  3N4M A;  1S3J A;  5FFX A;  4HYE A;  5L3C A;  4AIH A;  4WCG A;  4IJA A;  1S29 A;  1REP C;  4UXN A;  1SAX A;  4S04 A;  2FSW A;  1BOA A;  4JBA A;  1Z6T A;  3ZMS A;  3OOP A;  1KU7 A;  4MQ9 F;  4HW0 A;  4RAZ A;  2P6S A;  3KLO A;  1R58 A;  5L3D A;  3ULQ B;  5JHU A;  2PI0 A;  4AIK A;  2P7V B;  3DQV C;  2QLZ A;  3NRV A;  3BRO A;  4EJV A;  3DF8 A;  4CIC A;  3ISP A;  1ZLJ A;  1HKS A;  4BHC A;  2O6G E;  3RIR A;  1O3R A;  1S8N A;  1P92 A;  1BI1 A;  2H09 A;  4ON0 A;  2V79 A;  1U2W A;  3R0J A;  1RIO H;  4LMY A;  3LA7 A;  3IL2 A;  1G3W A;  1IN6 A;  2FF4 A;  1PP8 F;  1ODD A;  2O61 A;  3EYI A;  1LNW A;  1FZP B;  2EV5 A;  2KJB A;  2PFB A;  3W6J B;  1KQ8 A;  3MQ0 A;  2P7C B;  2XUB A;  3O3K A;  4LLL A;  4MNU A;  2CG4 A;  3VEP A;  5JI6 A;  4WXC A;  4HA8 A;  3WU0 A;  2VBZ A;  3HRU A;  4M6X A;  4G7Z F;  1B9M A;  2RV8 A;  1TW2 A;  3VOE A;  3IRR A;  2XHK A;  3DPL C;  4Y17 A;  1I27 A;  1AWC A;  4HX4 A;  1F4K A;  4HV6 A;  3E3V A;  5D5V B;  3WTU C;  2FRH A;  4A5M A;  4JQF A;  3T1B A;  3F8B A;  2JZY A;  2ZME B;  4EM0 B;  2KJC A;  3IHU A;  4HX7 A;  3JTG A;  1R23 A;  6PAX A;  4EGZ A;  4G7O F;  3TKY A;  1HXD A;  4CO8 A;  3ZQ7 A;  2PBI A;  3WTS C;  2FBK A;  4ZZD A;  3GW2 A;  2IT0 A;  4HF2 A;  1Z7U A;  1O7F A;  2STT A;  5LLQ A;  2FMY A;  5H20 A;  3JSP A;  3FHZ A;  1J75 A;  1MDM A;  3HSE A;  2ESN A;  2X4H A;  1S7A A;  2OQG A;  2ZBK A;  3QP5 A;  3TOB A;  4I0A A;  1H0M A;  3SXY A;  1HW2 A;  5ICF A;  4KYW A;  3F8M A;  1LEA A;  2MLK A;  1UHW A;  2XGX A;  2EWN A;  1WSU A;  2LSO A;  2L4A A;  2KKO A;  2MA3 A;  5K5O A;  5D8L B;  1IW7 F;  4I2O A;  3HRM A;  4OIP F;  3HYI A;  2W25 A;  2WTE A;  5L3F A;  1ZRE A;  2F5D A;  1EH7 A;  1USS A;  2KRF A;  2IA0 A;  4U0V A;  1V3F A;  2OBP A;  1GHC A;  2PN6 A;  1QO0 D;  2GA1 A;  2G7U A;  4AWX B;  5CVU A;  1R1T A;  3K69 A;  3KZY A;  1L3L A;  2EA2 A;  2V1D A;  5ILU A;  3QP6 A;  3L7W A;  1XDU A;  1U3E M;  1BBY A;  2O03 A;  3W6K B;  3ECH A;  3L2C A;  3HOT A;  3ZMU A;  3OV8 A;  4S05 A;  2YU3 A;  4YIF A;  1TLH B;  3BPV A;  5F64 A;  5HLG A;  3WTZ A;  2EK5 A;  1F1Z A;  2ZCW A;  5L3B A;  4BAY A;  3M8E A;  1WI9 A;  1J9I A;  1STZ A;  2FML A;  3F3X A;  3TOA A;  1XDS A;  1OR7 A;  2JT1 A;  4CXF A;  3F8F A;  5E20 A;  1J5Y A;  1ZGJ A;  4I02 A;  4HZF A;  4FX0 A;  5HVQ C;  1FBU A;  1WRJ A;  4I0B A;  3DXJ F;  1YG2 A;  4I98 B;  4HDV A;  1YS7 A;  3EQL F;  2A6E F;  2V6C A;  3HTU A;  3U9G A;  3K1N A;  2CFX A;  2GXG A;  3E6D A;  5HLH A;  1IN8 A;  1R1U A;  4LFU A;  1FSH A;  1G6N A;  4LLG F;  2D1V A;  1RI7 A;  2OZU A;  5A2Q K;  3KP7 A;  2GAU A;  2Y0M A;  1FC3 A;  1UFM A;  3QRF F;  1GVJ A;  2HR3 A;  1DDN A;  4GGG A;  2UWM A;  5J8F A;  3BPX A;  3KEO A;  2OAZ A;  4MEX F;  4FHT A;  1BI3 A;  2D1H A;  3WTX C;  1D3Y A;  5D4S A;  3HHH A;  2A69 F;  5E1Z B;  3F21 A;  2HOE A;  4BYY A;  1K78 A;  1U5T C;  1Z6R A;  2LDU A;  2EV6 A;  5H6Q A;  5LHH A;  4IHS A;  3KP3 A;  5E18 F;  4HAM A;  2A07 F;  3BWG A;  3SZT A;  4O6J A;  1FWZ A;  3DV8 A;  1JE8 A;  1UB9 A;  1IXS B;  1HSJ A;  2DW4 A;  3I4P A;  1F5T A;  2M30 A;  1ZG3 A;  1IRG A;  2MBF A;  2H94 A;  4ENJ A;  5FFZ A;  5BQT A;  2M8E A;  4UVA A;  2R3S A;  2RVC A;  1KYW A;  2E7X A;  5JFR A;  2DK8 A;  2RNJ A;  2DTR A;  4YFN F;  1FPQ A;  2DAO A;  5IT3 A;  2XKO A;  4Q5S F;  3V8K A;  3KEQ A;  1OKR A;  1BM9 A;  1B4A A;  4B8X A;  4GYG A;  5AIQ A;  1Z1D A;  2RN7 A;  1ZG1 A;  3HOS A;  3G73 A;  3FXR A;  1Z05 A;  2STW A;  2D45 A;  4I7H A;  1TQP A;  2NRA C;  2OA4 A;  5LGN A;  5LGT A;  4OU0 A;  5EEG A;  4QWQ A;  2QM3 A;  2ESH A;  3U2R A;  1FSE A;  1XCV A;  2XRN A;  3FXQ A;  2QQB A;  1MZB A;  2PQ8 A;  1B1B A;  1FYM A;  5LEK A;  4KNY A;  2L4M A;  2DQR A;  5FO5 A;  2VBX A;  3LST A;  4NQW A;  1KYZ A;  5CYV A;  4RGS A;  2VXZ A;  3NEU A;  4I09 A;  3E5Q A;  2X0L A;  1SD7 A;  1TNT A;  2XV4 S;  1T2K A;  5DCM B;  5ICE A;  1YW8 A;  3I71 A;  4Y13 A;  2COM A;  3DKW A;  1KA8 A;  3ZP5 A;  4NB5 A;  2RKH A;  3K1P A;  4IVN A;  2FEZ A;  2LF7 A;  3GZ6 A;  2QBY B;  1P2F A;  2K7L A;  1TNS A;  3I54 A;  1JGS A;  2E1C A;  3D0S A;  3GXO A;  4GXO A;  2IW5 A;  4G6Q A;  4WK8 F;  4G7H F;  2IA1 A;  2QEN A;  4U0W A;  3T0Y A;  3R61 A;  1HW1 A;  1SMY F;  3E97 A;  1R5G A;  3RTR A;  4TV7 A;  2MH2 A;  2QZ8 A;  2L3D A;  3M7G A;  2ZKZ A;  2E7W A;  1XSD A;  2HTJ A;  1W5T A;  1BN5 A;  3RI4 A;  3QPT A;  2UXN A;  1IN5 A;  2A68 F;  1YQA A;  2HGC A;  4A6E A;  2W84 A;  2DQL A;  1PP7 U;  4DQ2 A;  2H6C A;  3CJN A;  2BGC A;  2GA2 A;  1TBX A;  1BIB A;  4LB5 A;  1CF7 B;  2JTV A;  4EMS A;  4CYD A;  2ETH A;  2K02 A;  1WKM A;  2L02 A;  3CTA A;  1S6L A;  1G3Y A;  4OIQ F;  2EFN A;  1U8R A;  3E5X A;  3MEX A;  4WF2 A;  3FZV A;  1T6S A;  3LA3 A;  3R6S A;  4EJW A;  4A5N A;  1BC7 C;  1E17 A;  2GXB A;  2XAG A;  1LVA A;  1I1G A;  2VC1 A;  1A04 A;  3KP4 A;  5LBQ A;  4Q47 A;  4YG2 F;  2PG4 A;  1AOY A;  2ZME A;  1JXS A;  3J81 K;  3V7S A;  4U7B A;  5DD8 A;  4G94 A;  1WWX A;  4L9J A;  3WU1 B;  1SD6 A;  4LJZ F;  4PCQ A;  5ICC A;  1PUE E;  2ELH A;  3QAH A;  5BS6 A;  2CW0 F;  4A0Y A;  1O3T A;  1ZLK A;  1YO5 C;  2Z3Y A;  3QU3 A;  4LD5 A;  3ABT A;  2VBW A;  4D0P A;  4OMZ A;  4WXH A;  2EFP A;  5FLX Z;  2PEX A;  2DI3 A;  2HKO A;  3J7A O;  3GF2 A;  2XRO A;  1FBQ A;  4NHJ A;  2R7F A;  2KIM A;  3C1D A;  2WV0 A;  2K4J A;  4U7D A;  5HDG A;  4P5O A; 
#chains in the Genus database with same CATH topology
 5FJ8 J;  5IOY A;  1FTT A;  1X1B A;  1QBJ A;  3RDI A;  3ONQ A;  1QU3 A;  3OWT A;  5EG0 B;  2BHZ A;  2VOO A;  2HEO A;  5FLV A;  4KIC A;  3TBI A;  3ZRG A;  2WY8 Q;  2QVO A;  3J7Z I;  2UZK A;  2N8G A;  1WPK A;  3BG3 A;  2WC2 A;  2QUF A;  1OPC A;  4P9F A;  4M3F A;  2JUG A;  1VQK I;  3EDP A;  2WBM A;  2M9H A;  3KCC A;  4IZZ A;  2FA5 A;  3A0H C;  1WJ5 A;  3V42 A;  2HQ5 A;  5CVI A;  1V5G A;  2W00 A;  3GUD A;  1FMV A;  3I3L A;  2ZNZ A;  3BR1 A;  2GOX B;  2H6B A;  5CLS A;  2E34 A;  2IPQ X;  2NVU B;  4ZYD A;  4A3K J;  1SVL A;  2DFH A;  3TW7 A;  1AA7 A;  3KX2 A;  4H0E A;  3HOZ J;  3L2U A;  4GRI A;  4LB6 B;  2KT0 A;  4CDG A;  2LF8 A;  2DJN A;  2PMZ A;  1ZGA A;  1W7P A;  3DPT A;  3GWZ A;  2IA2 A;  1XCB A;  2V1X A;  1ZR2 A;  5D5W B;  2E35 A;  3JW4 A;  4BDZ A;  2PJP A;  1U5T A;  1LVK A;  1R22 A;  3BJ6 A;  1WVR A;  2HTS A;  3RPQ A;  2DXI A;  4LG0 B;  2ECB A;  5BPD A;  1A5J A;  2FXA A;  2K9S A;  1DP7 P;  3WOD F;  3M9A A;  4PZJ A;  4E7L A;  4FT8 A;  2NS0 A;  3K9T A;  1D8K A;  3C2H A;  3ESW B;  2LVS A;  1BI2 A;  4A0X A;  3LSP A;  4MGR A;  5D6F A;  4BXX J;  1SMT A;  1I50 J;  3P5J A;  3OMY A;  1W36 D;  1FJL A;  4XRS G;  4AVZ A;  2JRT A;  3HIF A;  1K4S A;  2LD5 A;  4BXF A;  3CUQ B;  1FP2 A;  1ENH A;  2W24 A;  1NK2 P;  2E60 A;  2O8K A;  2YUS A;  1TP4 A;  2J5P A;  2DT5 A;  2CQX A;  3I58 A;  2ZME C;  1MMA A;  1IRF A;  3G71 I;  4CCK A;  1G2H A;  1RRJ A;  2HVR A;  5E8I A;  2FBI A;  4KDP A;  3R4K A;  3FXK A;  3I53 A;  3HB9 A;  3L2R A;  1SD4 A;  3SFI A;  1JJ6 C;  2M3A A;  4G8X A;  1MW7 A;  3I64 A;  3GTK J;  1PDN C;  2VT3 A;  4HST A;  1LDD A;  5FRM A;  2VKV A;  4LLN A;  2V1U A;  1APL C;  4OAZ A;  4D9J A;  3K4K A;  1OCZ H;  2OD5 A;  3ZMZ A;  4BXU A;  1GLN A;  1QGP A;  3GTJ J;  5JVG F;  3GTP J;  3KZZ A;  2H8W A;  2L5Q A;  2X51 A;  3VOD A;  1D5Y A;  2F4M B;  4II3 A;  2HOS A;  1OIS A;  4UV8 A;  2K3P A;  4UUV A;  3ZN0 A;  1XD7 A;  4EVI A;  4CHU A;  2R7W A;  2Y69 H;  5D8K B;  3BQY A;  4JX5 A;  2VE8 A;  3W2W A;  2P5L C;  2RQQ A;  3GZN B;  3F72 A;  2ZFW A;  4UNO A;  4F52 A;  2VE9 A;  1GV5 A;  2CUJ A;  2G7H A;  2OTJ I;  1CQT A;  1RKW A;  2LBF A;  4DYR A;  4E7I A;  2XKP A;  4EM1 A;  2QSH X;  2KFD A;  5IY5 H;  4BHP A;  2AXL A;  1UJ8 A;  4Z6Y A;  3QOP A;  5LEJ A;  3HKZ N;  3VPR A;  3CMA I;  2CGP A;  4RAF A;  2HS5 A;  1OYW A;  2DYS H;  2Q0O A;  2NOJ B;  4KIS A;  1DUX C;  2I10 A;  2CYY A;  3T8R A;  3I9V 2;  3OYK A;  2OJE D;  2JA8 J;  1QZE A;  1YS6 A;  3QU6 A;  2YX7 A;  1A35 A;  4XLP F;  3CCL I;  2XVC A;  4RB1 A;  2BV6 A;  3EUH A;  3F8C A;  4HSR A;  2V9P A;  3LSH A;  1UHM A;  2Z99 A;  4F3Q A;  4ZDO A;  1I39 A;  1RKT A;  2F2E A;  1ZAR A;  3WE3 A;  2HYG D;  3V4G A;  2LRD A;  4I99 C;  4A3M J;  3KIO A;  2A61 A;  2XF5 A;  2A5Y B;  4CZZ A;  5DDG A;  3HOU J;  4M9Z A;  3WU2 C;  3M3Y J;  1BOB A;  2HNH A;  1POG A;  1X4O A;  2E71 A;  2P5K A;  4XN0 A;  1D1A A;  4O5V A;  3JRC A;  3LAP A;  3JSO A;  4HF1 A;  5F08 A;  1XMK A;  1X3W B;  4Y33 A;  3FM5 A;  4IX7 A;  2VOD A;  1O57 A;  1X1D A;  2Z1D A;  1JTX A;  1XGN A;  3ZR8 X;  3MZH A;  3DEU A;  2R0Q C;  1SFX A;  1RUN A;  3K6G A;  2EQR A;  1BC8 C;  3HHG A;  2DPU A;  1RNL A;  1QNT A;  5FB2 A;  1VTN C;  3HSR A;  3MKY B;  1ZYR F;  3DLL F;  3I4N J;  4R8H A;  4XRF A;  4J01 A;  4HQE A;  2Y75 A;  1Y6I A;  2W1O A;  3D5S C;  3IKT A;  4M74 A;  4UB8 C;  3EPZ A;  4C30 A;  2P0W A;  2OU2 A;  1JUM A;  3ECO A;  2R7Z J;  3LFK A;  3F6O A;  1NHA A;  4PJL A;  5CVV A;  5J47 A;  1YOV B;  3OOU A;  2HYF A;  2O9L A;  3DTE A;  1OMI A;  2GBY A;  1JKO C;  3HUG A;  1WJA A;  2DDA A;  3CME I;  4BL0 B;  4DGW B;  1XGO A;  1BR2 A;  4ABZ A;  1ZEL A;  4EQQ A;  5L3E A;  2A05 A;  2K9Q A;  2P8T A;  4FET A;  2R7T A;  2K4B A;  3S14 J;  2P4W A;  3HOY J;  4IXA A;  3HZJ A;  3LQR A;  1OYY A;  1M1E B;  5EYR A;  2YSR A;  1PYV A;  4R79 A;  3KYC B;  4BGD A;  2QEX I;  2VUM J;  1OCO H;  1TT5 B;  1A36 A;  4U88 A;  3DKX A;  4V19 K;  5L3G A;  1D5V A;  1LKX A;  4Y15 A;  3I59 B;  4RM2 A;  1LDK B;  2XSJ C;  2JSC A;  2KLO A;  2NNN A;  3MCZ A;  3TP0 A;  2ZXJ A;  3KYL A;  4HOB A;  1YTY A;  5BNG A;  4F55 A;  4D5F A;  1R7J A;  2V26 A;  2DMU A;  2PJR A;  1VZ0 A;  3BR0 A;  3L09 A;  3F22 A;  4BJ6 C;  3BJO A;  2MC3 A;  1ZH5 A;  1W0U A;  4CA0 A;  1ETY A;  2K9N A;  2X1E A;  2VJI A;  1SAU A;  4LIU A;  3FXU A;  3FDY A;  4ESB A;  3QYF A;  3ZMD A;  4XKB A;  3KEY A;  5IT9 K;  2DMQ A;  3VFZ A;  4BUP A;  3TO9 A;  4XL9 A;  3I4M J;  2MLG A;  1SFU A;  2JVH A;  2L01 A;  3S3M A;  3LWF A;  4L5E A;  4AUX A;  3H3Z A;  3QWL A;  5IP9 J;  2DMN A;  2K27 A;  3J80 K;  2EPF A;  2I5U A;  4M73 A;  4DIQ A;  4XRM A;  3CCJ I;  4IF4 A;  1Z9C A;  2LLK A;  1Y1V J;  4AID A;  2Y2Z A;  2DA2 A;  2BE5 F;  2L7M P;  3H92 A;  3OL4 A;  2B9S A;  1MGT A;  3GFM A;  4YEL A;  2LK2 A;  3NQO A;  3ZMV A;  2DOA A;  3K2A A;  3E6M A;  1I3A A;  4A3C J;  5CVR A;  3DPU A;  3RJP A;  4R1H A;  1HKQ A;  1QZY A;  3FMS A;  5F6F A;  2GQQ A;  4RLF A;  3K2Z A;  3ABK H;  3KP2 A;  4A12 A;  1YW9 A;  4Z2Y A;  5GAD J;  3PIP F;  1KQ9 A;  2AS5 F;  3OYL A;  1X4P A;  1JJ8 C;  2XAJ A;  1IJW C;  2LC2 A;  2LY1 A;  2LFB A;  4U87 A;  3CZ6 A;  1MBK A;  1R4N B;  2EZH A;  3RZO J;  1QHG A;  2VJ4 A;  2DOF A;  3EUH C;  2VQC A;  1C0W A;  2ZC2 A;  3S93 A;  3OS0 A;  2COB A;  5E1W A;  1H9T A;  4QSH A;  2BBY A;  4RBO A;  2QBY A;  2RC4 A;  3K70 D;  5E17 F;  1U6G A;  2WWY A;  4A93 J;  2DN0 A;  5DCF A;  1TC3 C;  1G3S A;  1V4R A;  1P6R A;  5GPC A;  4UHT A;  1Y8R B;  1GV2 A;  4IHT A;  1ZRD A;  5EDN A;  5E3O A;  3G4S I;  2HDD A;  3MKZ A;  4A0Z A;  4HBL A;  3JAM Z;  2HWV A;  3HTS B;  1GXQ A;  1UHS A;  1LDJ A;  2J5O A;  4N9I A;  3H36 A;  1Y8Q B;  3MZY A;  4B47 A;  3CCU I;  5KK1 A;  2H27 A;  4ENK A;  2QSG X;  3S1R J;  3FMQ A;  1P4X A;  4F92 B;  3HOX J;  4NUB A;  3AAF A;  2KDZ A;  3BG7 A;  3NWS A;  3GO5 A;  3HRT A;  4J00 A;  1E0E A;  5HS8 A;  4ZYE A;  2B0L A;  3M8J A;  5AON A;  5GAE J;  3MMY B;  2ZNY A;  4HLY A;  4MHG A;  3DBL B;  1P4W A;  1WGX A;  4OAY A;  3MFK A;  1IXR C;  2ME0 A;  2BW3 B;  5KNL A;  2YR2 A;  3O8G A;  1JKR C;  5HS7 A;  2OZ6 A;  4LGW A;  1ERD A;  3OYB A;  1ZN2 A;  1GT0 C;  3JRB A;  3AL0 B;  1EV7 A;  2R7S A;  3SEZ A;  4KMU X;  3H5A A;  1LE8 A;  3BC8 A;  2JQ7 A;  1RZ4 A;  5HOO A;  5KHD A;  1G3T A;  2DA6 A;  1VQN I;  3COA C;  2P6T A;  2DU9 A;  1W0T A;  2QSF X;  3ERE D;  2UV1 A;  2ISZ A;  1T39 A;  1R71 A;  2ZJR F;  3EET A;  3A03 A;  1B9N A;  4NQW B;  3SFZ A;  3WG9 A;  2EJR A;  2AQE A;  3OYI A;  1WJD A;  4P55 A;  3FXJ A;  4EJO A;  1XSX A;  4OIN F;  1B6A A;  3GFJ A;  3IC7 A;  3LSM A;  2ZJQ F;  2ID6 A;  3WG7 H;  5TRD A;  2LKP A;  3PL8 A;  3D5L A;  4MFE A;  3PO3 J;  4IL6 C;  3TGN A;  1P7J A;  2Z5U A;  3FKI J;  2EIJ H;  3M4O J;  4XBF A;  1FOY A;  3FKJ A;  4AVP A;  3FX3 A;  1SFK A;  2VOP A;  4UV9 A;  5GPA A;  1E2X A;  4HQM A;  4BNC A;  5ERI A;  2JPC A;  3GFI A;  1ONV A;  2JPB A;  3WTT C;  3CF2 A;  4MTD A;  2NAZ A;  2EZL A;  1HW5 A;  2JWT A;  5BPI A;  1X1A A;  2R7Q A;  3P7N A;  1Z91 A;  2JVG A;  2QQA A;  2NOG A;  4C2M J;  2JA7 J;  5HLI A;  3ELK A;  1FBS A;  1R00 A;  4AYB N;  1JKQ C;  2KIQ A;  2L9V A;  1CF7 A;  2FQ4 A;  1IXC A;  2FX0 A;  4B1R A;  2X1D A;  2E2J J;  3E6C C;  2X9D A;  4PJ0 C;  2HDW A;  2XAS A;  3CCE I;  3VYR B;  3OS2 A;  3HEF A;  4KIF A;  1Q1V A;  1JGG A;  4B48 A;  5K5Q A;  4IKF A;  2Q2E A;  4XNF A;  1XB4 A;  4PUS A;  2CW7 A;  4DZJ A;  3LOC A;  3I55 I;  5FKK A;  4NBQ A;  1QZZ A;  3H35 A;  2XIG A;  4PGH A;  3RKY A;  5GAH J;  3U1D A;  2LH9 A;  1ZAO A;  2ACJ A;  2EFQ A;  3V7R A;  1TWH J;  4A3F J;  2E1M B;  2WAQ N;  1XGM A;  3DWL E;  2AHQ A;  4ZYA A;  5LFA A;  4IHX A;  3ZXS A;  1IN7 A;  4K2E A;  2OPT A;  3ZMT A;  1ZRF A;  3CLQ A;  1T38 A;  2Y9Z A;  4D1Q A;  1Z21 A;  4PDK A;  3CUO A;  1BJA A;  3FBN B;  3SEQ A;  4BQA A;  3OYH A;  4L9V A;  5CJ9 A;  4E6K G;  3JRF A;  4XM3 A;  4XON A;  1MH3 A;  1R5H A;  4GO1 A;  1ZQ3 P;  4L0Z B;  3RQ4 A;  4M9S A;  3MKW B;  3F8N A;  2L2O A;  5F0H A;  2ELK A;  2OCC H;  5ICG A;  3BG9 A;  1MJA A;  2PMH A;  3BJA A;  3AG2 H;  3I0T A;  5LRR A;  4NDL A;  4M6Y A;  2FNP A;  2O7O A;  2Z2S B;  4II2 A;  4IHV A;  4U0Y A;  1MSF C;  2H1K A;  2Y31 A;  2FNA A;  4XKW A;  4MQV A;  2F5F A;  3H3U A;  3C3W A;  3CQZ J;  2LY2 A;  3FF5 A;  4HDU A;  3P9K A;  2ID3 A;  4WX9 A;  2OF7 A;  2XAH A;  2MGQ A;  4BH9 A;  1K6Y A;  2MFZ A;  2VC0 A;  1KU3 A;  2ADU A;  2AXT C;  3B6A A;  3PUF A;  1QQI A;  4OOI A;  3TO6 A;  1LQ1 A;  3J81 Z;  4XID A;  3FM3 A;  2DO7 A;  2HQN A;  4M71 A;  5BMZ A;  2LY9 A;  2BXZ A;  3BCB A;  1DGR M;  2FJ1 A;  2KHM A;  2MD0 A;  4CCO A;  1DPU A;  5E3M A;  4LK1 F;  1ZG5 A;  5LHG A;  4BY1 J;  1V5E A;  3HC7 A;  4XSX F;  2GZW A;  2M45 A;  1P4A A;  3HPG A;  3L2W A;  4XN3 A;  4Q4Z F;  1JHH A;  3A02 A;  1ETW A;  1T0F A;  1U0J A;  3R0A A;  3UNG C;  1EF4 A;  5EG0 A;  3K7A J;  5E1X A;  5FRN A;  1PUF A;  3B02 A;  3C7J A;  1Q1H A;  1MD0 A;  3W2A A;  4WXD A;  4KFC A;  4XMY A;  5DEQ A;  3JRA A;  3QYE A;  4A3B J;  1X3U A;  1ZRC A;  4RM3 A;  1SFE A;  4DNC A;  4PGG A;  3ML6 A;  4V2G A;  5FLX K;  1TL8 A;  3BLY A;  1G4D A;  4HX8 A;  3FBI B;  3ZN1 A;  2UUZ A;  4N9H A;  4XSZ F;  5K5R A;  2MD5 A;  4FQG A;  1VQM I;  2YX4 A;  1I5Z A;  4ZYG A;  3D5R C;  4A6D A;  4CYC B;  1RR8 C;  4IQJ A;  4NNJ A;  5EGO B;  1LJ9 A;  3SQN A;  1GVD A;  2NS8 A;  1VND A;  2HI3 A;  2DLL A;  1L0O C;  4CCN A;  2W85 A;  2K40 A;  1FLI A;  2FE3 A;  3KP6 A;  3KP5 A;  3ZPL A;  5FGM A;  4RB2 C;  4BAC A;  5M3F J;  4BHB A;  3H5R A;  2GWR A;  2R7D A;  5GAG J;  1CGP A;  5K1Y A;  4LG0 A;  1MNM C;  2PMU A;  1IV6 A;  3OYD A;  2TCT A;  1UST A;  3VYT B;  3BR3 A;  3KYD B;  2VKE A;  1YFH A;  3TO7 A;  3CC2 I;  1TWG J;  1XX5 A;  1VQ6 I;  2FOK A;  2CSO A;  1MKM A;  1T56 A;  5JHF A;  1QPM A;  3I5U A;  2A6H F;  2G9W A;  3GLX A;  4NC6 A;  2C6Y A;  3PQK A;  4G9Y A;  4HV5 A;  1J0R A;  2TDX A;  4I01 A;  3OYF A;  2XAQ A;  2XGE A;  3L00 A;  1JTY A;  4GFB A;  4ZDL A;  4YFK F;  4E7K A;  1IRZ A;  3M8F A;  4B43 A;  4E70 A;  3IWZ A;  5F1J A;  1K79 A;  4FIS A;  2LTP A;  2V4J C;  3MWM A;  4P9U A;  2F5V A;  3K1M A;  5HOD A;  1FNN A;  3CUQ A;  3W3C A;  1H9G A;  4UUS A;  4OIO F;  4IO9 F;  4ENN A;  3A01 B;  5BOX A;  1RES A;  4IRI A;  4KMF A;  1D8J A;  2Z16 A;  4EJT A;  2CO5 A;  2F5C A;  1WFX A;  5TJJ A;  1KGS A;  4C3H J;  3BOQ A;  5E8G A;  4YIR X;  3FK7 A;  4LK0 F;  1FYK A;  2LKS A;  2VQG A;  5HDN A;  2M5W A;  3CP2 A;  3HOW J;  3B73 A;  1HKT A;  3KLN A;  5DUI A;  5HNF A;  2DA4 A;  4M3E A;  2O8X A;  2XF6 A;  1KU9 A;  3S3N A;  3OIQ A;  4HF0 A;  1BIA A;  2GM4 A;  4OMY A;  1MDM B;  2V9V A;  2M0C A;  2XAF A;  3MVP A;  2V6E A;  2EZI A;  4BE2 A;  5JR3 A;  2HQR A;  2KRH A;  2LNB A;  3IAM 2;  3FK6 A;  4RB0 A;  3LFU A;  1WI3 A;  3KFW X;  1E3P A;  2CWE A;  2D2W A;  3IH2 A;  4XQF A;  5J3L A;  2JUC A;  3WTY C;  4M3D A;  2PLY A;  2RGV A;  2HZT A;  2EV0 A;  2FBH A;  3MN2 A;  5D5U B;  4AU7 A;  5DYM A;  2K86 A;  3CJT B;  3P9I A;  1IDZ A;  3GYH X;  4L9T A;  1Y0N A;  1HOM A;  2PMZ N;  2MG4 A;  1TWA J;  4IPA A;  3ABL H;  4QLC U;  4G6D A;  1YJN I;  2E1N A;  2GXA A;  5EEH A;  4QIW N;  3TW6 A;  2CU7 A;  3FIW A;  1D1B A;  2ISY A;  2M8G X;  3VSK A;  5LGU A;  1BI0 A;  4RGU A;  3L2Q A;  4KT5 C;  4ESJ A;  3R60 A;  1QHH D;  3LMM A;  3HSF A;  1W7P B;  3F6V A;  2VPR A;  4UUT A;  1O7L A;  1R9T J;  1FY7 A;  1R1V A;  4FX4 A;  2M4K A;  2L7K A;  5J6X A;  1U5T B;  4XLN F;  2NYX A;  1JUP A;  4Y52 J;  3CP8 A;  3IKV A;  5FKO A;  1BW6 A;  2F5E A;  3KET A;  2A6T A;  2M87 A;  3RYR A;  1UZC A;  3ROU A;  1R36 A;  1TTY A;  2GIV A;  5HS9 A;  2IJL A;  4DW6 A;  1B72 B;  3E1S A;  4ZH4 F;  1T0F C;  2FUG 2;  3ABU A;  2EFW A;  5J8C A;  2IRF G;  1PJR A;  3BY6 A;  4UVB A;  3HM5 A;  4EJU A;  4KIT B;  1BA5 A;  1H88 C;  2FOW A;  2CQK A;  1V5F A;  1O3S A;  4M3B A;  4L5J A;  1K7A A;  4XLA A;  2V1N A;  1TW3 A;  1W7P D;  4EV0 A;  3LQQ A;  3IRQ A;  1WJC A;  1HDD C;  3GCM A;  3FXL A;  3LA2 A;  4A3I J;  5ED4 A;  1KON A;  3DBR B;  1IUY A;  4N0B A;  3IWF A;  1S9H A;  3N97 A;  3LSJ A;  4ZTJ A;  1T98 A;  2W7N A;  2V9K A;  4AD9 A;  5HDK A;  1JI8 A;  1T08 B;  2IXS A;  1JHF A;  3GVA A;  3WGH A;  4L9N A;  4BQQ A;  2R92 J;  1W4M A;  3N05 A;  3VYU B;  1I1S A;  2Q8K A;  3FWE A;  1T33 A;  3GTL J;  5DD4 A;  3H9G A;  1R4M B;  3DTI A;  1GXP A;  2DDB A;  3Q0U A;  3QPH A;  4CZC A;  3Q9V A;  1E3H A;  1IGN A;  3PO2 J;  2A5W A;  2KIU A;  2VI6 A;  4KN7 X;  3GX4 X;  3X2Q H;  1Y0U A;  1FOK A;  3EYY A;  2ZO4 A;  3BQZ A;  1TT0 A;  1K6O A;  3GLL A;  4PK4 A;  3TQN A;  4XIC A;  5DV5 A;  3CDI A;  2Y48 A;  3E6B A;  5D6E A;  2RQP A;  2A3S A;  2QQ9 A;  1OCP A;  3HRS A;  2JRM A;  2XGC A;  3H0D A;  1VQ7 I;  4BQO A;  3GEZ A;  1YE9 A;  1ON2 A;  1UCR A;  5EZH A;  4D5C A;  5A2Q Z;  3S17 J;  5CVJ A;  3CLO A;  3DU6 A;  5ILV A;  1OFC X;  1YW7 A;  4KIG A;  2JMW A;  2HKX A;  2VBY A;  1VQ5 I;  4XK4 A;  1MJ9 A;  1TQI A;  4X0G A;  4YII A;  3KE2 A;  1OCT C;  4KUM A;  2L54 A;  3CUQ C;  3MAJ A;  1ETX A;  2HXI A;  4L0Y B;  4HRI A;  1FTZ A;  1I3Q J;  2EB7 A;  5AIP A;  1IZ1 A;  1MMG A;  3E0J B;  5K7Z A;  1FX7 A;  2ZJP F;  3F9K A;  2QWW A;  3I59 A;  4MTE A;  2EH3 A;  3TDU C;  3UKG A;  3VDX A;  2IS4 A;  2XPW A;  5ILS A;  3H9J A;  1Z3X A;  1XMA A;  3LAJ A;  4KIB A;  3BZ6 A;  5EJC A;  3S8P A;  2DT7 B;  1XMX A;  4Q48 A;  4H4K C;  4JX6 A;  2EFO A;  3KPH A;  2RDP A;  4ETS A;  2RNG A;  2V7F A;  2R7X A;  3OIP A;  4BE1 A;  2GIZ A;  4ENM A;  2DOD A;  5KAI C;  3T5X A;  1Z67 A;  3ZQH A;  3L2V A;  1XPX A;  1B59 A;  4IRH A;  2BEO A;  3BDD A;  3GME A;  1EA3 A;  5FD5 A;  1ZHF A;  5DTD A;  1OYI A;  2IS6 A;  3DEW A;  2MYS A;  3RPU A;  1Y39 A;  1HBX G;  4RAY A;  3Q5F A;  2HFH A;  1YLF A;  1NH3 A;  3L9F A;  1J2X A;  1IUF A;  4ITV A;  4XLE A;  3DFG A;  5JLX A;  1IAW A;  2L7F P;  1U9N A;  1XSV A;  3O2P E;  3V7C A;  3ZCO A;  4A2U A;  2FQ3 A;  4OIR F;  1F9N A;  4G6T B;  2MAB A;  2GOM A;  4MLO A;  3P9C A;  2NVQ J;  3H3V K;  1LB2 A;  2Y0S A;  1XN7 A;  2PX9 A;  4A69 C;  2ZJ2 A;  1TQM A;  1MIJ A;  2VT2 A;  2YPR A;  4PJM A;  2JN6 A;  4BJT A;  2EIK H;  1G8X A;  3TDZ C;  1K78 B;  3LSR A;  1J7K A;  2DBB A;  2IP2 A;  3CO7 C;  1QPI A;  3WGG A;  1W5S A;  2DA3 A;  1FYL A;  2K5C A;  1LUJ B;  2M7A A;  2EA4 A;  4MO7 A;  5LHI A;  3A2K A;  2MH9 A;  5IT9 Z;  1KU2 A;  3BT9 A;  4RB3 C;  3BP8 A;  4BEH B;  4AIJ A;  3FMR A;  1OLT A;  4KA4 A;  2DPD A;  2BVL A;  1X2N A;  1J59 A;  4MEY F;  1Z77 A;  2EIN H;  2DFI A;  2BYV E;  3J80 Z;  3CJR B;  1SD5 A;  1AKH B;  4RGR A;  2E5N A;  3VB2 A;  2HQA A;  1S7O A;  4GCV A;  1ORK A;  2IGM A;  3HBL A;  3WTW C;  2QA4 I;  4WWC A;  3ZGK A;  1K83 J;  2M1B A;  2E2H J;  3BZC A;  2QYO A;  3CO6 C;  5C44 J;  4F7Z A;  4NC8 A;  2O0Y A;  5DCM A;  1LEB A;  3BZK A;  2R5Y B;  3C2B A;  1V55 H;  4ZZL A;  2O3F A;  4JP0 A;  2M7B A;  1EH6 A;  5F27 A;  3G6E I;  3MZ8 A;  3DU5 A;  3G3Z A;  4Y7N J;  4E7S A;  1XTA A;  3GFL A;  1XGS A;  4B09 A;  2PJR B;  1PVE A;  4L5I A;  4ASN A;  3DP7 A;  1U78 A;  3V8J A;  1EJ9 A;  2UXX A;  2W57 A;  2B7E A;  1KQ0 A;  4L18 B;  2NS7 A;  2CRG A;  5H6R A;  2E1O A;  3PFI A;  1SVO A;  3K0L A;  2EZK A;  3TL4 X;  1D1C A;  1VQP I;  3OYG A;  3CDH A;  4RGX A;  5HLT A;  1ON1 A;  2F4I A;  4DBQ A;  1YYV A;  3F23 A;  5B5E C;  2HOA A;  5FKM A;  3JRE A;  3V8L A;  3F0C A;  1WZ2 A;  4XLH A;  1MJB A;  3S2W A;  2KIF A;  3PUB A;  1O3Q A;  3M1C A;  4HPQ A;  3G1O A;  1IN4 A;  2E19 A;  2ICW G;  4M9X A;  3O6B B;  5FD6 A;  1UMQ A;  4QPO A;  3JAM K;  2VN2 A;  4ZTF A;  3PQJ A;  5F1R A;  3SJM A;  3GZ5 A;  5DUK A;  3GTM J;  1N77 A;  3AG4 H;  2P5V A;  3A0B C;  1HQC A;  1IRX A;  3RKX A;  2ZXI A;  1DU0 A;  1MSE C;  2BZT A;  2NNY A;  3M1E A;  1IF1 A;  1MBF A;  1YIO A;  4JK1 X;  3Q9S A;  5JLW A;  2R93 J;  4RS8 A;  1IG7 A;  1JT6 A;  3SHF A;  5D5X B;  1S5L C;  3HGY A;  4M72 A;  3SZP A;  5KVR A;  3UR3 C;  4O3M A;  4ZYH A;  5F0C A;  1RUO A;  1ULY A;  1SC7 A;  3G2B A;  2P81 A;  1E3O C;  5LRS A;  1D0Z A;  2L9N A;  4ZJZ A;  1FP1 D;  4YFX F;  5JVT A;  4PFP A;  5D4R A;  3JRD A;  1FT9 A;  3RKW A;  1HA8 A;  4EM2 A;  1Y56 A;  5DM6 F;  3C18 A;  1B8I B;  4KN4 X;  3WE2 A;  3WGI A;  4GYI A;  3E5U A;  4IEJ A;  3T8T A;  2IVM A;  2FU4 A;  4IRG A;  2CV2 A;  3JTH A;  3OL3 A;  3BTI A;  1N25 A;  1I6X A;  1A6I A;  2Z9O A;  2VON A;  3BTJ A;  1EH8 A;  3RYP A;  2Z33 A;  1DPR A;  3QOE A;  3AKZ A;  2F4O B;  4BE0 A;  2Y30 A;  4BS9 A;  1R6R A;  1A31 A;  4P96 A;  3K4L A;  2ZFU A;  4ESF A;  1K4T A;  1ETQ A;  4CGZ A;  4PSW A;  3REO A;  3BG5 A;  1I6H J;  3K70 C;  3FIS A;  2ZSH B;  3CCR I;  2HYJ A;  2KZG A;  2F6C A;  2JA2 A;  2RAE A;  4EGY A;  5LD2 C;  2HDC A;  4UVC A;  3KZI C;  2OQR A;  1RC9 A;  2DK5 A;  4PJJ A;  1WQ2 A;  2KPM A;  3WTV C;  1BR4 A;  1HST A;  4HLX A;  3N4M A;  1FMW A;  3PNT A;  9ANT A;  1TWC J;  1S3J A;  2HVS A;  5FFX A;  2IS2 A;  4HYE A;  5L3C A;  2MSY A;  4AIH A;  4WCG A;  4IJA A;  1S29 A;  3IAS 2;  2R5Z A;  1REP C;  4UXN A;  1LFU P;  2X85 A;  1SAX A;  4N4O B;  4S04 A;  4D7N A;  2FSW A;  1BOA A;  4JBA A;  1Z6T A;  3ZMS A;  3OOP A;  4CH7 A;  1YHQ I;  1KU7 A;  2WAE A;  4MQ9 F;  2JK3 A;  4DYQ A;  4HW0 A;  4RAZ A;  1YIJ I;  2P6S A;  3KLO A;  3ASO H;  1R58 A;  3J7A Y;  4BBR J;  5L3D A;  3ULQ B;  5JHU A;  2PI0 A;  4AIK A;  2P7V B;  3DQV C;  1AHD P;  5CQG A;  3LL7 A;  2QLZ A;  4DYC A;  1D0X A;  4LIV A;  1HDP A;  4A3E J;  3NRV A;  3BRO A;  4EJV A;  3DF8 A;  1YRN B;  4CIC A;  3ISP A;  1ZLJ A;  1HKS A;  2DMP A;  4BHC A;  2WV1 A;  2O6G E;  3RIR A;  1VI0 A;  2NVT J;  1XS9 A;  2NXN B;  1YI2 I;  1O3R A;  1S8N A;  3PSF A;  1F43 A;  1P92 A;  1BI1 A;  2ZXH A;  2H09 A;  4C2T A;  4ON0 A;  3AFH A;  2V79 A;  1U2W A;  3R0J A;  1RIO H;  2KL4 A;  4LMY A;  3LA7 A;  4XKC A;  3SZG A;  3IL2 A;  2R7R A;  3IUO A;  1G3W A;  1IN6 A;  2AO9 A;  2FF4 A;  4MFD A;  1PP8 F;  1S7E A;  3OYC A;  1ODD A;  2O61 A;  3AL0 C;  3RZD J;  2RRE A;  3EYI A;  1LNW A;  1IO2 A;  1FZP B;  2EV5 A;  2Q2E B;  2KJB A;  2D5V A;  2PFB A;  3W6J B;  1KQ8 A;  2K9L A;  2QQ8 A;  3AG3 H;  3MQ0 A;  2P7C B;  2XUB A;  3O3K A;  4LLL A;  2DTZ A;  4MNU A;  5E3L A;  1GDT A;  2DFF A;  3H9Q A;  4RMN A;  2HXO A;  3MD2 A;  4AC0 A;  2CG4 A;  1MH4 A;  5J1U A;  3VEP A;  1Y1W J;  5JI6 A;  3RKQ A;  3O8H A;  4WXC A;  2YS9 A;  3RSN A;  4HA8 A;  4CYC A;  3WU0 A;  1R5I D;  1SAN A;  5EGO A;  1FIA A;  1UG2 A;  1T8I A;  3H1C A;  2VBZ A;  5B1B H;  4XOT A;  3HRU A;  4E4H A;  1YIT I;  3S1N J;  4M6X A;  3M07 A;  2FD5 A;  4G7Z F;  1YJ9 I;  1DP3 A;  2CUF A;  1B9M A;  2BVM A;  1FOW A;  3U1K A;  3ZQG A;  3OYE A;  5KAF C;  2NVX J;  2RV8 A;  1TW2 A;  3VOE A;  2KP6 A;  3IRR A;  2ELJ A;  2XHK A;  3DPL C;  1MNE A;  1W5C C;  4Y17 A;  1ZTR A;  1I27 A;  1AWC A;  4HX4 A;  3OIO A;  4G12 A;  1F4K A;  4HV6 A;  4KJZ A;  3E3V A;  5D5V B;  3WTU C;  1VFC A;  2FRH A;  1F36 A;  4A5M A;  1HLV A;  1ETO A;  2BOL A;  4JQF A;  3T1B A;  2JJ7 A;  3OSF A;  3F8B A;  2JZY A;  2ZME B;  2ME6 A;  3LNQ A;  1HCR A;  2WAD A;  2WB1 N;  4DJA A;  4EM0 B;  2KJC A;  1DQU A;  3IHU A;  4QPQ A;  2QCO A;  2VPL A;  4HX7 A;  3JTG A;  1ITY A;  1R23 A;  6PAX A;  4BJ5 C;  4EGZ A;  1LFB A;  4G7O F;  3TKY A;  2E5Z A;  1HXD A;  4I76 A;  4CO8 A;  2NVY J;  3A01 A;  5M5W J;  2VAS A;  5C3E J;  3HGG A;  3ZQ7 A;  4JOM A;  5M5X J;  2BY0 A;  3CCY A;  2I8D A;  2PBI A;  2E1M C;  3WTS C;  2FBK A;  4ZZD A;  3GW2 A;  2DJI A;  4BQN A;  1VQL I;  2IT0 A;  3DLA A;  1FIP A;  5IPA A;  2IEK A;  1J09 A;  5HNH A;  4HF2 A;  1Z7U A;  1O7F A;  2STT A;  3VWB A;  5LLQ A;  2FMY A;  3EUA A;  5H20 A;  3OYA A;  2CV0 A;  1HC8 A;  4JX4 A;  1Z3Y A;  3JSP A;  4CCL A;  3FHZ A;  1PUF B;  1J75 A;  4EEF G;  2CW8 A;  5E79 C;  3DTK A;  1MDM A;  3HSE A;  2ESN A;  2X4H A;  2ZSI B;  2IGK A;  1S7A A;  2OQG A;  2ZBK A;  4BKX A;  4EAT A;  2XB5 A;  3QP5 A;  4I0A A;  3TOB A;  5B3S H;  5DM7 F;  2KDO A;  1H0M A;  3SXY A;  1O4X A;  1HW2 A;  3BTC A;  5ICF A;  4KYW A;  3F8M A;  1LEA A;  2MLK A;  1WH7 A;  1UHW A;  3U21 A;  3L1P A;  2Q1Z B;  2XGX A;  2EWN A;  1WSU A;  2LSO A;  2L4A A;  3A1Y A;  2KKO A;  2VJJ A;  2MW8 A;  4FE4 A;  2DCE A;  2XPU A;  1MMD A;  2DA7 A;  2MA3 A;  3VYS B;  5K5O A;  4CCM A;  5D8L B;  1IW7 F;  3SDB A;  4I2O A;  4BY7 J;  2XGD A;  3HRM A;  2VKH A;  4OIP F;  4HG2 A;  3HYI A;  2W25 A;  2WTE A;  2EIM H;  1S72 I;  5L3F A;  1IV8 A;  1ZRE A;  2F5D A;  5FKN A;  1GUU A;  1EH7 A;  2TRT A;  2LMD A;  2DA1 A;  2OTL I;  2DA5 A;  1USS A;  2KRF A;  3QPL A;  4A3D J;  3CCS I;  2IA0 A;  1NTC A;  1V3F A;  4U0V A;  3S16 J;  3QPS A;  1VQO I;  3G1M A;  2OBP A;  1GHC A;  3GTG J;  2PN6 A;  1B72 A;  2R7O A;  1QO0 D;  2GA1 A;  3CMM A;  1RET A;  1WJF A;  2G7U A;  1X58 A;  4HNU A;  2X1C A;  5CVU A;  4AWX B;  1R1T A;  3K69 A;  4Y3O A;  4IQ4 A;  3KZY A;  1L3L A;  1N78 A;  1WHU A;  4B44 A;  4RLQ A;  2G0E A;  2EA2 A;  2V1D A;  1UG0 A;  4LG3 A;  5ILU A;  4FTH A;  3IH3 A;  2DOE A;  4UUS B;  3QP6 A;  4HNV A;  5EEA A;  3L7W A;  1AU7 A;  1ZKG A;  1XDU A;  5J40 A;  3ZOB A;  1U3E M;  1BBY A;  1OCR H;  2O03 A;  3J7Y J;  3FXM A;  2X6X A;  3W6K B;  3ECH A;  3Q0W A;  3L2C A;  2HOT A;  2QF7 A;  3HKZ A;  3TMO A;  3HOT A;  3MKL A;  5F04 A;  1MND A;  1X1C A;  3ZMU A;  3OV8 A;  2HU9 A;  2M2E A;  1XC5 A;  4S05 A;  2YU3 A;  4YIF A;  1MBJ A;  5KCM A;  1TLH B;  3BPV A;  1ACI A;  1WH5 A;  2BY3 A;  5F64 A;  5IOZ A;  5HLG A;  2IAI A;  3WTZ A;  2EK5 A;  2ZCW A;  1F1Z A;  1FEX A;  5L3B A;  1LFP A;  4BAY A;  3CCQ I;  3M8E A;  3JRH A;  1WI9 A;  4YRV A;  3PM1 A;  1J9I A;  4M3G A;  3PSI A;  1WCM J;  2OV7 A;  3TED A;  1STZ A;  3Q0V A;  2CQ7 A;  2FML A;  3F3X A;  3TOA A;  1V54 H;  1XDS A;  2L7Z A;  3PIO F;  4JYK A;  3CDL A;  1OR7 A;  1H89 C;  2JT1 A;  2QKL B;  2CQN A;  2VKD A;  1N75 A;  1RPW A;  4CXF A;  3F8F A;  5E20 A;  2EBI A;  1J5Y A;  1ZGJ A;  4I02 A;  3FXO A;  4HZF A;  2E2I J;  5IP7 J;  4FX0 A;  1P7I A;  1W36 C;  5HVQ C;  3CCM I;  1EKE A;  3HPH A;  1IDY A;  2LYC A;  4XOR A;  1T95 A;  3OR1 C;  1FBU A;  1WRJ A;  3RCO A;  3WHB A;  3S3O A;  4D7M A;  4I0B A;  3H0G J;  2OC6 A;  3DXJ F;  2KZV A;  1YG2 A;  5J4Y A;  2W82 A;  4I98 B;  2XAU A;  4HDV A;  1WJE A;  1YS7 A;  3EQL F;  2A6E F;  2JA5 J;  2V6C A;  3HTU A;  3IP4 B;  3U9G A;  3K1N A;  2CFX A;  2GXG A;  3E6D A;  3S1Q J;  2DFE A;  2CUZ A;  5HLH A;  2XRL A;  1IN8 A;  1R1U A;  3TP3 A;  3DBH B;  2W48 A;  4LFU A;  1FSH A;  4B4C A;  1G6N A;  4LLG F;  2D1V A;  2LBF B;  3DCF A;  1TWF J;  1RI7 A;  2BY2 A;  2OZU A;  5A2Q K;  3NAU A;  3KP7 A;  5GP9 A;  2E36 A;  2GAU A;  2Y0M A;  1FC3 A;  1UFM A;  3FHN A;  1XG1 A;  3SDG A;  1OQY A;  3QRF F;  3OYM A;  5CKT A;  1GVJ A;  2HR3 A;  1K61 A;  1U8B A;  1DDN A;  2M4G A;  2DT6 A;  4DZP A;  4GGG A;  2WAF A;  2UWM A;  2BY1 A;  5J8F A;  1VQ4 I;  3BPX A;  1WJB A;  1X3Z B;  3KEO A;  1QRY A;  4YEJ A;  2B63 J;  2OAZ A;  4MEX F;  4FHT A;  1BI3 A;  2D1H A;  3WTX C;  2LKX A;  1D3Y A;  2HVQ A;  5D4S A;  3HHH A;  2A69 F;  1RR7 A;  2IBD A;  5E1Z B;  4HNT A;  3F21 A;  2HOE A;  3K4B A;  4BYY A;  1K78 A;  1ETK A;  1U5T C;  2LRE A;  1Z6R A;  3OYJ A;  2LDU A;  2EV6 A;  5H6Q A;  5LHH A;  4HEA 2;  4IHS A;  4I6Z A;  3KP3 A;  5E18 F;  2VQL A;  4HAM A;  4BEH A;  4V2F A;  3QQA A;  1HF0 A;  2A07 F;  3K4J A;  3K4C A;  4BDY A;  3BWG A;  3EUK L;  3SZT A;  4O6J A;  2MC4 A;  3ZQQ A;  1AKH A;  1FWZ A;  3DV8 A;  1SFO J;  1JE8 A;  3JRG A;  2BHY A;  1UB9 A;  1IXS B;  1HSJ A;  2DW4 A;  3I4P A;  2QGU A;  2VIX A;  1YJW I;  1JT0 A;  1F5T A;  1YX5 A;  4B3A A;  2M30 A;  3C2G A;  5C4J J;  4FAS D;  1ZG3 A;  4C2U A;  1IRG A;  5EF6 A;  2XDV A;  2MBF A;  2H94 A;  4ENJ A;  5FFZ A;  5FRO A;  2R5Y A;  1DGW Y;  4IHY A;  4CSW A;  1ZK8 A;  2M8E A;  4UVA A;  5BQT A;  2R3S A;  1BW5 A;  2RVC A;  2VB6 A;  3W2V A;  1KYW A;  4C3I J;  3HUG B;  4F93 B;  3LSI A;  2E7X A;  5JFR A;  2ZXW H;  1TZL A;  2DK8 A;  2RNJ A;  1X2M A;  2DTR A;  4YFN F;  2R7U A;  1FPQ A;  3OYN A;  3HDD A;  1X1P A;  2DAO A;  5IT3 A;  2XKO A;  2CMP A;  2CUE A;  4Q5S F;  3V8K A;  3KEQ A;  1OKR A;  4GDF A;  1BM9 A;  3ASN H;  1B4A A;  3ZQI A;  4B8X A;  2IGN A;  3CJQ B;  4GYG A;  1OR7 C;  1BJZ A;  5AIQ A;  3S15 J;  1Z1D A;  3CES A;  2RN7 A;  3K4M A;  1ZG1 A;  2Y0S N;  3HOS A;  2JSP A;  1QVT A;  3G73 A;  3FXR A;  1Z05 A;  2STW A;  2D45 A;  4I7H A;  2K85 A;  2H8R A;  1TQP A;  2NRA C;  2CS3 A;  3PFY A;  2OA4 A;  5GTH C;  3ERM A;  5LGN A;  5LGT A;  4OU0 A;  2ECC A;  3OR2 C;  5EEG A;  4DBR A;  4QWQ A;  2BW3 A;  2QM3 A;  1MMN A;  4X6A J;  2ESH A;  1ZR4 A;  3U2R A;  2M34 A;  1FSE A;  1XCV A;  2XRN A;  2XSD C;  3FXQ A;  2QQB A;  4PFO A;  1MZB A;  2HPI A;  3G1L A;  3IH4 A;  3ZQL A;  3RPU D;  2CFO A;  2LP0 A;  2PQ8 A;  1IC8 A;  1B1B A;  1FYM A;  3CMY A;  3OY9 A;  5LEK A;  4ZC3 A;  4KNY A;  2LG4 A;  2IGO A;  1H8A C;  2L4M A;  2DQR A;  1B8I A;  5FO5 A;  3CC7 I;  1P9Q C;  3AG1 H;  3H5N A;  2VBX A;  3LST A;  4NQW A;  1KYZ A;  4KT6 A;  5CYV A;  4RGS A;  2VXZ A;  3CCV I;  2AQF A;  3NEU A;  4I09 A;  3E5Q A;  4F91 B;  5FLM J;  2X0L A;  2JA6 J;  3QYB A;  1SD7 A;  1TNT A;  1NK3 P;  2XV4 S;  2X6Y A;  2KQR A;  1T2K A;  1YX3 A;  5DCM B;  4NC7 A;  4UB6 C;  5J1Y A;  3NWT A;  5ICE A;  1YW8 A;  3I71 A;  1KZH A;  4IOC F;  4Y13 A;  2COM A;  5TIS C;  3DKW A;  3ZQC A;  2KRC A;  1KA8 A;  3ZP5 A;  3WHC A;  4NB5 A;  2RKH A;  3K1P A;  4J19 A;  3E7L A;  2KMU A;  4LOC A;  3HL2 A;  4IVN A;  2FEZ A;  1QVU A;  3HOV J;  2LF7 A;  2IS1 A;  3HJE A;  3GZ6 A;  2GLO A;  2QBY B;  1P2F A;  3GTQ J;  2K7L A;  4C9Y A;  1TNS A;  3I54 A;  4XKV A;  3OSG A;  1JGS A;  2E1C A;  2OUM A;  3D0S A;  4IOA F;  3GXO A;  4AYB A;  4GXO A;  5J4V A;  2IW5 A;  2XC7 A;  3DEE A;  2DYR H;  4G6Q A;  4WK8 F;  3BG6 A;  3BR2 A;  1BL0 A;  4G7H F;  3LSG A;  2IA1 A;  3PNY A;  3ABM H;  2QEN A;  2CQQ A;  4U0W A;  4UY8 I;  3S2D J;  3T0Y A;  2W4S A;  2CH0 A;  3BTL A;  2LR8 A;  3R61 A;  5J1R A;  5B1A H;  1HW1 A;  1FOX A;  1SMY F;  3E97 A;  1R5G A;  3Q3S A;  3RTR A;  3SYT A;  4MIM A;  1VQ8 I;  5H2F C;  4TV7 A;  5EZG A;  2ZB9 A;  1MBE A;  2MH2 A;  2QZ8 A;  2X6O A;  1MBH A;  1YRN A;  2L3D A;  3M7G A;  1VF9 A;  2WAQ A;  1A6Q A;  3BR6 A;  2ZKZ A;  2E7W A;  1XSD A;  1LE8 B;  4FCY A;  5F0F A;  4Y4R A;  3BCA A;  3CC4 I;  2H1L A;  5CQE A;  2HTJ A;  1BR1 A;  1W5T A;  3PNV A;  4ANJ A;  1BN5 A;  1ETV A;  3S2H J;  3IV5 A;  3RI4 A;  1UAA A;  4A3J J;  2F48 A;  3HXL A;  2X48 A;  3QPT A;  2UXN A;  1IN5 A;  3OS1 A;  2A68 F;  1YQA A;  3JCU C;  3BR5 A;  1JKP C;  2HGC A;  2X6W A;  1G59 A;  4W97 A;  4CUG A;  4A6E A;  2W84 A;  2DQL A;  1PP7 U;  4DQ2 A;  4A3L J;  2VQH A;  4XLF A;  2H6C A;  5IYC J;  2L9S A;  2XB0 X;  3CJN A;  5FKL A;  2XPV A;  2BGC A;  3A4C A;  2GA2 A;  2OCE A;  1TBX A;  1D0Y A;  3S1M J;  1BIB A;  4XRS A;  4W1U A;  3RQI A;  1LPQ A;  4LB5 A;  4LIT A;  1CF7 B;  4XR6 A;  4CCJ A;  3CD6 I;  2JTV A;  1DU6 A;  4ZDP A;  4EMS A;  1U9O A;  3QOD A;  4CYD A;  2ETH A;  1OCC H;  2K02 A;  1WKM A;  4OWR B;  3PJR A;  2L02 A;  3CTA A;  1S6L A;  2K9M A;  1NG7 A;  3B6C A;  2O5R A;  5TGT A;  4XOP A;  1G3Y A;  4OIQ F;  2EFN A;  3HG9 A;  1Z7L A;  2CV1 A;  1U8R A;  3E5X A;  3MEX A;  3JRI A;  4AM3 A;  4WF2 A;  2R5Z B;  3FZV A;  1T6S A;  3LA3 A;  3R6S A;  4EJW A;  5M5Y J;  4A5N A;  4BU2 A;  1BC7 C;  4PSX A;  3LSK A;  1E17 A;  2GXB A;  2XAG A;  1LVA A;  4S0H B;  1I1G A;  2VC1 A;  1MBG A;  1A04 A;  3KP4 A;  2QKM B;  2L0K A;  4XLC A;  5LBQ A;  5IYD J;  4Q47 A;  4C3J J;  4X1E A;  1UEL B;  4M6V A;  4DOZ A;  1MMS A;  2R4G A;  2VL8 A;  2VXD A;  2PG4 A;  4YG2 F;  1AOY A;  2ZME A;  4E7J A;  3JR9 A;  1JXS A;  3K4N A;  3DKY A;  5E3N A;  3J81 K;  3V7S A;  1R49 A;  3I56 I;  4IHW A;  2Y9Y A;  4E7H A;  2VJ5 A;  4U7B A;  3NAR A;  2LOO A;  5DD8 A;  4G94 A;  3GTO J;  5K7F A;  1WWX A;  1W1W E;  3K10 A;  4L9J A;  5CPR B;  3WU1 B;  2WB1 A;  2YU9 J;  1SD6 A;  4LJZ F;  4PCQ A;  3W6V A;  3D1N I;  1NG6 A;  4B3X A;  2WY7 Q;  5ICC A;  2KIS A;  1PUE E;  2ELH A;  3QAH A;  5BS6 A;  4RDU A;  1ZGW A;  2CW0 F;  4A0Y A;  1Z0X A;  2WA0 A;  4BBS J;  1O3T A;  2HZD A;  3CF5 F;  1ZLK A;  4N4N B;  1YO5 C;  4RA2 A;  2Z3Y A;  2K3F A;  3QU3 A;  4LD5 A;  1VQ9 I;  3ABT A;  2M0M A;  5K7H A;  2VBW A;  2EIL H;  4D0P A;  1X19 A;  4OMZ A;  2XF7 A;  4E7Z A;  4WXH A;  2L9R A;  2EFP A;  5FLX Z;  2PEX A;  1SEU A;  2DI3 A;  5IP6 A;  2HKO A;  3ZQF A;  3J7A O;  2CJJ A;  3GF2 A;  5GTI C;  2XRO A;  5B66 C;  5IYB J;  1FBQ A;  4NHJ A;  2R7V A;  2R7F A;  2VLA A;  2KIM A;  2BXY A;  1OJL A;  3C1D A;  5C4X J;  1SVM A;  4A3G J;  4FE7 A;  2WV0 A;  2DMT A;  2K4J A;  2HPM A;  5M3M J;  4PJN A;  3GBG A;  1JUS A;  3S32 A;  4U7D A;  3VSL A;  5DS9 A;  4QTR A;  4RAG A;  4P1W A;  1QA6 A;  5HDG A;  4P5O A; 
#chains in the Genus database with same CATH homology
 1QBJ A;  3RDI A;  2VOO A;  2HEO A;  4KIC A;  2QVO A;  2UZK A;  2WC2 A;  2QUF A;  1OPC A;  4P9F A;  3EDP A;  3KCC A;  2FA5 A;  5CVI A;  3GUD A;  2ZNZ A;  2H6B A;  5CLS A;  2IPQ X;  4ZYD A;  4H0E A;  4LB6 B;  4CDG A;  2LF8 A;  1ZGA A;  1W7P A;  3DPT A;  3GWZ A;  2IA2 A;  1XCB A;  2V1X A;  5D5W B;  3JW4 A;  2PJP A;  1U5T A;  1R22 A;  3BJ6 A;  2HTS A;  3RPQ A;  4LG0 B;  5BPD A;  2FXA A;  1DP7 P;  3WOD F;  3M9A A;  4PZJ A;  4FT8 A;  2NS0 A;  3K9T A;  1D8K A;  1BI2 A;  4A0X A;  4MGR A;  5D6F A;  1SMT A;  2JRT A;  3HIF A;  3CUQ B;  1FP2 A;  2W24 A;  2J5P A;  2DT5 A;  3I58 A;  1IRF A;  5E8I A;  2FBI A;  4KDP A;  3R4K A;  3I53 A;  1SD4 A;  4G8X A;  3I64 A;  1PDN C;  2VT3 A;  1LDD A;  4LLN A;  2V1U A;  2OD5 A;  3ZMZ A;  4BXU A;  1QGP A;  3KZZ A;  3VOD A;  4UV8 A;  4UUV A;  3ZN0 A;  1XD7 A;  4EVI A;  4CHU A;  5D8K B;  2VE8 A;  2P5L C;  3F72 A;  2ZFW A;  4UNO A;  2VE9 A;  2G7H A;  2XKP A;  4EM1 A;  4BHP A;  2AXL A;  3QOP A;  5LEJ A;  2CGP A;  2HS5 A;  1OYW A;  2Q0O A;  1DUX C;  2CYY A;  3T8R A;  1YS6 A;  3QU6 A;  2YX7 A;  4XLP F;  2XVC A;  4RB1 A;  2BV6 A;  3EUH A;  3F8C A;  1UHM A;  2Z99 A;  2F2E A;  1ZAR A;  3WE3 A;  2HYG D;  3V4G A;  2A61 A;  4CZZ A;  2A5Y B;  5DDG A;  4M9Z A;  2P5K A;  4O5V A;  3LAP A;  3JSO A;  4HF1 A;  1XMK A;  3FM5 A;  2VOD A;  1O57 A;  1XGN A;  3MZH A;  3DEU A;  1SFX A;  1RUN A;  1BC8 C;  3HHG A;  2DPU A;  1RNL A;  1QNT A;  5FB2 A;  1VTN C;  3HSR A;  1ZYR F;  4R8H A;  4XRF A;  4HQE A;  2Y75 A;  3IKT A;  4M74 A;  2OU2 A;  3ECO A;  3LFK A;  3F6O A;  1NHA A;  5CVV A;  2HYF A;  1OMI A;  3HUG A;  1XGO A;  4EQQ A;  5L3E A;  2P8T A;  2K4B A;  2P4W A;  4IXA A;  3LQR A;  1OYY A;  2YSR A;  4R79 A;  4U88 A;  5L3G A;  1D5V A;  4Y15 A;  3I59 B;  1LDK B;  2JSC A;  2NNN A;  3MCZ A;  2ZXJ A;  4HOB A;  1YTY A;  1R7J A;  3L09 A;  3F22 A;  3BJO A;  2MC3 A;  1ZH5 A;  3FXU A;  4ESB A;  3ZMD A;  5IT9 K;  3VFZ A;  3TO9 A;  2MLG A;  1SFU A;  2L01 A;  3LWF A;  3H3Z A;  2K27 A;  3J80 K;  1Z9C A;  4M73 A;  4IF4 A;  2BE5 F;  3H92 A;  1MGT A;  3GFM A;  3NQO A;  3ZMV A;  3E6M A;  5CVR A;  3RJP A;  4R1H A;  1HKQ A;  1QZY A;  3FMS A;  5F6F A;  2GQQ A;  3K2Z A;  3KP2 A;  4A12 A;  1YW9 A;  4Z2Y A;  1KQ9 A;  2AS5 F;  2XAJ A;  1C0W A;  5E1W A;  1H9T A;  2BBY A;  2QBY A;  2RC4 A;  5E17 F;  1U6G A;  2WWY A;  5DCF A;  1G3S A;  1V4R A;  1P6R A;  4UHT A;  4IHT A;  1ZRD A;  4A0Z A;  4HBL A;  3JAM Z;  2HWV A;  3HTS B;  1GXQ A;  2J5O A;  1LDJ A;  4N9I A;  3MZY A;  5KK1 A;  2H27 A;  4ENK A;  3FMQ A;  1P4X A;  3AAF A;  3GO5 A;  3HRT A;  5HS8 A;  4ZYE A;  2B0L A;  5AON A;  2ZNY A;  4HLY A;  4MHG A;  1P4W A;  3MFK A;  1IXR C;  2YR2 A;  5HS7 A;  2OZ6 A;  4LGW A;  1ZN2 A;  1EV7 A;  4KMU X;  1RZ4 A;  5HOO A;  1G3T A;  3COA C;  2P6T A;  2DU9 A;  3ERE D;  2ISZ A;  1T39 A;  3EET A;  1B9N A;  3SFZ A;  3WG9 A;  2EJR A;  4P55 A;  4EJO A;  1XSX A;  4OIN F;  1B6A A;  3GFJ A;  3IC7 A;  5TRD A;  2LKP A;  3D5L A;  3TGN A;  2Z5U A;  4XBF A;  4AVP A;  3FX3 A;  2VOP A;  4UV9 A;  1E2X A;  4HQM A;  4BNC A;  5ERI A;  2JPC A;  3GFI A;  1ONV A;  2JPB A;  3WTT C;  4MTD A;  2NAZ A;  1HW5 A;  5BPI A;  3P7N A;  1Z91 A;  2QQA A;  5HLI A;  3ELK A;  1FBS A;  1R00 A;  1CF7 A;  1IXC A;  3E6C C;  2XAS A;  4KIF A;  5K5Q A;  2Q2E A;  1XB4 A;  1QZZ A;  2XIG A;  4PGH A;  3RKY A;  3U1D A;  1ZAO A;  2ACJ A;  2EFQ A;  3V7R A;  1XGM A;  1IN7 A;  4K2E A;  3ZMT A;  1ZRF A;  1T38 A;  4PDK A;  3CUO A;  1BJA A;  4BQA A;  4L9V A;  5CJ9 A;  1R5H A;  4GO1 A;  4L0Z B;  4M9S A;  3F8N A;  5ICG A;  1MJA A;  2PMH A;  3BJA A;  3I0T A;  5LRR A;  4M6Y A;  2FNP A;  4U0Y A;  2FNA A;  4MQV A;  2F5F A;  3H3U A;  3C3W A;  3FF5 A;  4HDU A;  3P9K A;  4WX9 A;  2XAH A;  4BH9 A;  2VC0 A;  1KU3 A;  2ADU A;  1QQI A;  4OOI A;  3TO6 A;  1LQ1 A;  3J81 Z;  3FM3 A;  2DO7 A;  2HQN A;  4M71 A;  5BMZ A;  1DPU A;  4LK1 F;  1ZG5 A;  5LHG A;  4XSX F;  2GZW A;  2M45 A;  1P4A A;  4Q4Z F;  1JHH A;  1T0F A;  3R0A A;  5E1X A;  3B02 A;  3C7J A;  1Q1H A;  1MD0 A;  4WXD A;  4KFC A;  5DEQ A;  1X3U A;  1ZRC A;  1SFE A;  4DNC A;  4PGG A;  3ML6 A;  5FLX K;  1G4D A;  4HX8 A;  3ZN1 A;  4N9H A;  4XSZ F;  5K5R A;  2MD5 A;  2YX4 A;  1I5Z A;  4ZYG A;  4A6D A;  1LJ9 A;  3SQN A;  2DLL A;  1L0O C;  2W85 A;  1FLI A;  2FE3 A;  3KP6 A;  3KP5 A;  3ZPL A;  5FGM A;  4RB2 C;  4BHB A;  2GWR A;  2R7D A;  1CGP A;  5K1Y A;  4LG0 A;  2PMU A;  1UST A;  1YFH A;  3TO7 A;  2FOK A;  2CSO A;  1MKM A;  1QPM A;  3I5U A;  2A6H F;  2G9W A;  3GLX A;  2C6Y A;  3PQK A;  4G9Y A;  4HV5 A;  1J0R A;  2TDX A;  4I01 A;  2XAQ A;  3L00 A;  4YFK F;  3M8F A;  4E70 A;  3IWZ A;  1K79 A;  3MWM A;  4P9U A;  3K1M A;  1FNN A;  3CUQ A;  1H9G A;  4OIO F;  4ENN A;  5BOX A;  4IRI A;  4KMF A;  1D8J A;  4EJT A;  2CO5 A;  2F5C A;  5TJJ A;  1KGS A;  3BOQ A;  5E8G A;  4LK0 F;  1FYK A;  5HDN A;  2M5W A;  3B73 A;  1HKT A;  3KLN A;  5DUI A;  2O8X A;  1KU9 A;  4HF0 A;  1BIA A;  4OMY A;  1MDM B;  2V9V A;  2XAF A;  5JR3 A;  2HQR A;  2LNB A;  4RB0 A;  3KFW X;  2CWE A;  2D2W A;  3WTY C;  2PLY A;  2RGV A;  2HZT A;  2EV0 A;  2FBH A;  5D5U B;  5DYM A;  2K86 A;  3P9I A;  3GYH X;  4L9T A;  4IPA A;  4QLC U;  4G6D A;  2E1N A;  5EEH A;  2ISY A;  5LGU A;  1BI0 A;  4RGU A;  4KT5 C;  4ESJ A;  3R60 A;  3HSF A;  1W7P B;  3F6V A;  1O7L A;  1FY7 A;  1R1V A;  4FX4 A;  5J6X A;  1U5T B;  4XLN F;  2NYX A;  3IKV A;  2F5E A;  3KET A;  2M87 A;  3RYR A;  3ROU A;  1R36 A;  1TTY A;  2GIV A;  5HS9 A;  2IJL A;  2EFW A;  4ZH4 F;  2IRF G;  3ABU A;  5J8C A;  3BY6 A;  4UVB A;  4EJU A;  2CQK A;  1O3S A;  4L5J A;  1K7A A;  3IRQ A;  4EV0 A;  1TW3 A;  1W7P D;  3LQQ A;  3LA2 A;  5ED4 A;  1IUY A;  4N0B A;  3IWF A;  3N97 A;  1T98 A;  4AD9 A;  5HDK A;  1JHF A;  3GVA A;  3WGH A;  4L9N A;  1W4M A;  1I1S A;  2Q8K A;  3FWE A;  5DD4 A;  1GXP A;  3QPH A;  3Q9V A;  2KIU A;  3GX4 X;  4KN7 X;  1Y0U A;  1FOK A;  3EYY A;  2ZO4 A;  1K6O A;  3TQN A;  5DV5 A;  2Y48 A;  3E6B A;  5D6E A;  2RQP A;  2A3S A;  2QQ9 A;  3HRS A;  3GEZ A;  1ON2 A;  1UCR A;  5A2Q Z;  5CVJ A;  3CLO A;  5ILV A;  1YW7 A;  4KIG A;  2HKX A;  2VBY A;  1MJ9 A;  1TQI A;  4YII A;  3KE2 A;  4KUM A;  2L54 A;  3CUQ C;  3MAJ A;  4L0Y B;  2EB7 A;  5AIP A;  1IZ1 A;  1FX7 A;  2QWW A;  3I59 A;  4MTE A;  3TDU C;  5ILS A;  1XMA A;  3LAJ A;  4KIB A;  3BZ6 A;  4Q48 A;  2EFO A;  2RDP A;  4ETS A;  4ENM A;  3T5X A;  1B59 A;  4IRH A;  2BEO A;  3BDD A;  5FD5 A;  1ZHF A;  1OYI A;  3RPU A;  1HBX G;  4RAY A;  3Q5F A;  2HFH A;  1YLF A;  3L9F A;  1J2X A;  3DFG A;  1IAW A;  1XSV A;  3O2P E;  3V7C A;  4A2U A;  2FQ3 A;  4OIR F;  1F9N A;  3P9C A;  1LB2 A;  1XN7 A;  2VT2 A;  1TQM A;  2YPR A;  2ZJ2 A;  3TDZ C;  1K78 B;  1J7K A;  2DBB A;  2IP2 A;  3CO7 C;  3WGG A;  1W5S A;  1FYL A;  5LHI A;  2EA4 A;  2MH9 A;  5IT9 Z;  1KU2 A;  4RB3 C;  3BP8 A;  4AIJ A;  3FMR A;  4KA4 A;  2DPD A;  1J59 A;  4MEY F;  2DFI A;  2BYV E;  3J80 Z;  1SD5 A;  4RGR A;  3VB2 A;  1S7O A;  4GCV A;  3WTW C;  4WWC A;  2M1B A;  2QYO A;  3CO6 C;  4F7Z A;  2O0Y A;  5DCM A;  1LEB A;  4ZZL A;  2O3F A;  1EH6 A;  3G3Z A;  3GFL A;  1XGS A;  4B09 A;  4L5I A;  4ASN A;  3DP7 A;  1U78 A;  3V8J A;  2UXX A;  2W57 A;  1KQ0 A;  4L18 B;  5H6R A;  3PFI A;  3K0L A;  3CDH A;  4RGX A;  1ON1 A;  1YYV A;  3F23 A;  3V8L A;  1MJB A;  3S2W A;  2KIF A;  1O3Q A;  1IN4 A;  4M9X A;  3O6B B;  5FD6 A;  3JAM K;  2VN2 A;  3PQJ A;  5F1R A;  3GZ5 A;  5DUK A;  2P5V A;  1HQC A;  3RKX A;  2NNY A;  3M1E A;  1IF1 A;  1YIO A;  4JK1 X;  3Q9S A;  4RS8 A;  3SHF A;  5D5X B;  4M72 A;  3SZP A;  5KVR A;  4O3M A;  4ZYH A;  1RUO A;  1ULY A;  5LRS A;  1FP1 D;  4YFX F;  5JVT A;  5D4R A;  1FT9 A;  3RKW A;  4EM2 A;  3C18 A;  4KN4 X;  3WE2 A;  3WGI A;  4GYI A;  3E5U A;  3T8T A;  2IVM A;  2FU4 A;  4IRG A;  3JTH A;  1I6X A;  2Z9O A;  2VON A;  1EH8 A;  3RYP A;  2Z33 A;  1DPR A;  4P96 A;  4ESF A;  4CGZ A;  3REO A;  4EGY A;  2HDC A;  4UVC A;  2OQR A;  2DK5 A;  1WQ2 A;  3WTV C;  1HST A;  4HLX A;  3N4M A;  1S3J A;  5FFX A;  4HYE A;  5L3C A;  4AIH A;  4WCG A;  4IJA A;  1S29 A;  1REP C;  4UXN A;  1SAX A;  4S04 A;  2FSW A;  1BOA A;  4JBA A;  1Z6T A;  3ZMS A;  3OOP A;  1KU7 A;  4MQ9 F;  4HW0 A;  4RAZ A;  2P6S A;  3KLO A;  1R58 A;  5L3D A;  3ULQ B;  5JHU A;  2PI0 A;  4AIK A;  2P7V B;  3DQV C;  2QLZ A;  3NRV A;  3BRO A;  4EJV A;  3DF8 A;  4CIC A;  3ISP A;  1ZLJ A;  1HKS A;  4BHC A;  2O6G E;  3RIR A;  1O3R A;  1S8N A;  1P92 A;  1BI1 A;  2H09 A;  4ON0 A;  2V79 A;  1U2W A;  3R0J A;  1RIO H;  4LMY A;  3LA7 A;  3IL2 A;  1G3W A;  1IN6 A;  2FF4 A;  1PP8 F;  1ODD A;  2O61 A;  3EYI A;  1LNW A;  1FZP B;  2EV5 A;  2KJB A;  2PFB A;  3W6J B;  1KQ8 A;  3MQ0 A;  2P7C B;  2XUB A;  3O3K A;  4LLL A;  4MNU A;  2CG4 A;  3VEP A;  5JI6 A;  4WXC A;  4HA8 A;  3WU0 A;  2VBZ A;  3HRU A;  4M6X A;  4G7Z F;  1B9M A;  2RV8 A;  1TW2 A;  3VOE A;  3IRR A;  2XHK A;  3DPL C;  4Y17 A;  1I27 A;  1AWC A;  4HX4 A;  1F4K A;  4HV6 A;  3E3V A;  5D5V B;  3WTU C;  2FRH A;  4A5M A;  4JQF A;  3T1B A;  3F8B A;  2JZY A;  2ZME B;  4EM0 B;  2KJC A;  3IHU A;  4HX7 A;  3JTG A;  1R23 A;  6PAX A;  4EGZ A;  4G7O F;  3TKY A;  1HXD A;  4CO8 A;  3ZQ7 A;  2PBI A;  3WTS C;  2FBK A;  4ZZD A;  3GW2 A;  2IT0 A;  4HF2 A;  1Z7U A;  1O7F A;  2STT A;  5LLQ A;  2FMY A;  5H20 A;  3JSP A;  3FHZ A;  1J75 A;  1MDM A;  3HSE A;  2ESN A;  2X4H A;  1S7A A;  2OQG A;  2ZBK A;  3QP5 A;  3TOB A;  4I0A A;  1H0M A;  3SXY A;  1HW2 A;  5ICF A;  4KYW A;  3F8M A;  1LEA A;  2MLK A;  1UHW A;  2XGX A;  2EWN A;  1WSU A;  2LSO A;  2L4A A;  2KKO A;  2MA3 A;  5K5O A;  5D8L B;  1IW7 F;  4I2O A;  3HRM A;  4OIP F;  3HYI A;  2W25 A;  2WTE A;  5L3F A;  1ZRE A;  2F5D A;  1EH7 A;  1USS A;  2KRF A;  2IA0 A;  4U0V A;  1V3F A;  2OBP A;  1GHC A;  2PN6 A;  1QO0 D;  2GA1 A;  2G7U A;  4AWX B;  5CVU A;  1R1T A;  3K69 A;  3KZY A;  1L3L A;  2EA2 A;  2V1D A;  5ILU A;  3QP6 A;  3L7W A;  1XDU A;  1U3E M;  1BBY A;  2O03 A;  3W6K B;  3ECH A;  3L2C A;  3HOT A;  3ZMU A;  3OV8 A;  4S05 A;  2YU3 A;  4YIF A;  1TLH B;  3BPV A;  5F64 A;  5HLG A;  3WTZ A;  2EK5 A;  1F1Z A;  2ZCW A;  5L3B A;  4BAY A;  3M8E A;  1WI9 A;  1J9I A;  1STZ A;  2FML A;  3F3X A;  3TOA A;  1XDS A;  1OR7 A;  2JT1 A;  4CXF A;  3F8F A;  5E20 A;  1J5Y A;  1ZGJ A;  4I02 A;  4HZF A;  4FX0 A;  5HVQ C;  1FBU A;  1WRJ A;  4I0B A;  3DXJ F;  1YG2 A;  4I98 B;  4HDV A;  1YS7 A;  3EQL F;  2A6E F;  2V6C A;  3HTU A;  3U9G A;  3K1N A;  2CFX A;  2GXG A;  3E6D A;  5HLH A;  1IN8 A;  1R1U A;  4LFU A;  1FSH A;  1G6N A;  4LLG F;  2D1V A;  1RI7 A;  2OZU A;  5A2Q K;  3KP7 A;  2GAU A;  2Y0M A;  1FC3 A;  1UFM A;  3QRF F;  1GVJ A;  2HR3 A;  1DDN A;  4GGG A;  2UWM A;  5J8F A;  3BPX A;  3KEO A;  2OAZ A;  4MEX F;  4FHT A;  1BI3 A;  2D1H A;  3WTX C;  1D3Y A;  5D4S A;  3HHH A;  2A69 F;  5E1Z B;  3F21 A;  2HOE A;  4BYY A;  1K78 A;  1U5T C;  1Z6R A;  2LDU A;  2EV6 A;  5H6Q A;  5LHH A;  4IHS A;  3KP3 A;  5E18 F;  4HAM A;  2A07 F;  3BWG A;  3SZT A;  4O6J A;  1FWZ A;  3DV8 A;  1JE8 A;  1UB9 A;  1IXS B;  1HSJ A;  2DW4 A;  3I4P A;  1F5T A;  2M30 A;  1ZG3 A;  1IRG A;  2MBF A;  2H94 A;  4ENJ A;  5FFZ A;  5BQT A;  2M8E A;  4UVA A;  2R3S A;  2RVC A;  1KYW A;  2E7X A;  5JFR A;  2DK8 A;  2RNJ A;  2DTR A;  4YFN F;  1FPQ A;  2DAO A;  5IT3 A;  2XKO A;  4Q5S F;  3V8K A;  3KEQ A;  1OKR A;  1BM9 A;  1B4A A;  4B8X A;  4GYG A;  5AIQ A;  1Z1D A;  2RN7 A;  1ZG1 A;  3HOS A;  3G73 A;  3FXR A;  1Z05 A;  2STW A;  2D45 A;  4I7H A;  1TQP A;  2NRA C;  2OA4 A;  5LGN A;  5LGT A;  4OU0 A;  5EEG A;  4QWQ A;  2QM3 A;  2ESH A;  3U2R A;  1FSE A;  1XCV A;  2XRN A;  3FXQ A;  2QQB A;  1MZB A;  2PQ8 A;  1B1B A;  1FYM A;  5LEK A;  4KNY A;  2L4M A;  2DQR A;  5FO5 A;  2VBX A;  3LST A;  4NQW A;  1KYZ A;  5CYV A;  4RGS A;  2VXZ A;  3NEU A;  4I09 A;  3E5Q A;  2X0L A;  1SD7 A;  1TNT A;  2XV4 S;  1T2K A;  5DCM B;  5ICE A;  1YW8 A;  3I71 A;  4Y13 A;  2COM A;  3DKW A;  1KA8 A;  3ZP5 A;  4NB5 A;  2RKH A;  3K1P A;  4IVN A;  2FEZ A;  2LF7 A;  3GZ6 A;  2QBY B;  1P2F A;  2K7L A;  1TNS A;  3I54 A;  1JGS A;  2E1C A;  3D0S A;  3GXO A;  4GXO A;  2IW5 A;  4G6Q A;  4WK8 F;  4G7H F;  2IA1 A;  2QEN A;  4U0W A;  3T0Y A;  3R61 A;  1HW1 A;  1SMY F;  3E97 A;  1R5G A;  3RTR A;  4TV7 A;  2MH2 A;  2QZ8 A;  2L3D A;  3M7G A;  2ZKZ A;  2E7W A;  1XSD A;  2HTJ A;  1W5T A;  1BN5 A;  3RI4 A;  3QPT A;  2UXN A;  1IN5 A;  2A68 F;  1YQA A;  2HGC A;  4A6E A;  2W84 A;  2DQL A;  1PP7 U;  4DQ2 A;  2H6C A;  3CJN A;  2BGC A;  2GA2 A;  1TBX A;  1BIB A;  4LB5 A;  1CF7 B;  2JTV A;  4EMS A;  4CYD A;  2ETH A;  2K02 A;  1WKM A;  2L02 A;  3CTA A;  1S6L A;  1G3Y A;  4OIQ F;  2EFN A;  1U8R A;  3E5X A;  3MEX A;  4WF2 A;  3FZV A;  1T6S A;  3LA3 A;  3R6S A;  4EJW A;  4A5N A;  1BC7 C;  1E17 A;  2GXB A;  2XAG A;  1LVA A;  1I1G A;  2VC1 A;  1A04 A;  3KP4 A;  5LBQ A;  4Q47 A;  4YG2 F;  2PG4 A;  1AOY A;  2ZME A;  1JXS A;  3J81 K;  3V7S A;  4U7B A;  5DD8 A;  4G94 A;  1WWX A;  4L9J A;  3WU1 B;  1SD6 A;  4LJZ F;  4PCQ A;  5ICC A;  1PUE E;  2ELH A;  3QAH A;  5BS6 A;  2CW0 F;  4A0Y A;  1O3T A;  1ZLK A;  1YO5 C;  2Z3Y A;  3QU3 A;  4LD5 A;  3ABT A;  2VBW A;  4D0P A;  4OMZ A;  4WXH A;  2EFP A;  5FLX Z;  2PEX A;  2DI3 A;  2HKO A;  3J7A O;  3GF2 A;  2XRO A;  1FBQ A;  4NHJ A;  2R7F A;  2KIM A;  3C1D A;  2WV0 A;  2K4J A;  4U7D A;  5HDG A;  4P5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...