2W84A

Structure of pex14 in complex with pex5
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
57
structure length
57
Chain Sequence
ENVLPREPLIATAVKFLQNSRVRQSPLATRRAFLKKKGLTDEEIDMAFQQSGTAADE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords PEROXISOMAL MEMBRANE PROTEIN PEX14
publication title Structural basis for competitive interactions of Pex14 with the import receptors Pex5 and Pex19.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2009-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2w84A00
5AIQA 3EYIA 1ONVA 3GWZA 3J80K 2GIVA 2F2EA 2FE3A 1REPC 1SD4A 4I02A 1YO5C 3QPHA 4R8HA 3IWZA 4YFNF 5F1RA 3MWMA 1G3YA 1GXQA 4OMZA 2A61A 4XBFA 2GXGA 1IXSB 4M73A 4A12A 5LHHA 5KVRA 2MH9A 4P9FA 2C6YA 2XAHA 2XAJA 4O5VA 5K1YA 4M72A 1QPMA 4L9VA 1S29A 4KNYA 3DF8A 1J59A 2OQGA 2QYOA 1R00A 3MCZA 3TDUC 3ZMUA 4IRHA 1XGMA 2H27A 2XAQA 5D4RA 1TNSA 2OBPA 3DFGA 1FYKA 3H3UA 2GQQA 4HX4A 2GA1A 1KQ9A 2ZCWA 3U1DA 1S8NA 2Z3YA 2GAUA 3I5UA 3F8CA 4OIRF 3ISPA 3MEXA 2FF4A 3WU0A 3SXYA 1F9NA 4OMYA 5D4SA 5FB2A 3I0TA 2RV8A 1R1VA 4KMFA 2ZKZA 2LNBA 2JSCA 3WG9A 1XGNA 3F23A 1FP2A 3D0SA 2JT1A 4OIPF 1OYIA 4UNOA 2OQRA 4L18B 1KQ8A 1S7OA 4YFKF 1W4MA 4WWCA 2FNAA 4G9YA 4G7OF 3GFLA 5L3BA 4AD9A 4RGRA 5ILUA 1XCVA 1I6XA 2EWNA 1BI1A 5LLQA 3B73A 2A6HF 2XV4S 3F72A 2DK5A 4HOBA 4BHCA 3K1MA 3E5UA 2JPBA 2EA2A 5BPIA 5EEHA 1UCRA 1FNNA 3I71A 3K0LA 3I53A 1R5GA 2YU3A 4LD5A 2E7XA 2COMA 4KUMA 2MBFA 1MGTA 2HOEA 2KJCA 3DKWA 5D5WB 1J2XA 1DPRA 1KYZA 2VC1A 1KGSA 3BY6A 4QLCU 5HVQC 1VTNC 2K7LA 2VBYA 2EV5A 4YFXF 3GXOA 1XCBA 3IHUA 3E3VA 1BOAA 2RC4A 1U8RA 1FBQA 1MD0A 2M8EA 3PQJA 5K5OA 3FWEA 2GWRA 2M45A 3U2RA 4NHJA 2E1CA 4G6DA 5FD5A 4M74A 1DPUA 3T8TA 1IZ1A 1S3JA 3I59B 1LNWA 1MZBA 4DQ2A 2OAZA 3GFMA 3VODA 5BOXA 1FBSA 2G9WA 3N4MA 2Y75A 4LMYA 3T1BA 1QNTA 1AWCA 1B1BA 4RB3C 4G7ZF 4ENMA 1H9GA 3HRMA 2FNPA 3JAMZ 1Z7UA 3F8MA 1L3LA 2HYFA 2FBHA 3OV8A 4YIFA 3KZYA 3I54A 2IJLA 4IF4A 5D8LB 4ZZLA 2QQBA 3RI4A 5CJ9A 3I59A 1J7KA 4M71A 3RIRA 2CW0F 3HRSA 1R23A 5DCFA 3P7NA 1FY7A 2FOKA 2VODA 2QUFA 4OU0A 4UV8A 2HKOA 2FEZA 5L3CA 2EV6A 4RS8A 4EQQA 3L00A 1W5SA 4NQWA 3KP4A 1IN7A 1SMYF 2E7WA 2ADUA 3KEQA 2VOOA 2XIGA 3KP5A 1JHFA 3WTYC 3JSPA 4ESJA 2M30A 1IN4A 4CICA 1ODDA 2FMYA 1P4XA 3COAC 2QBYA 2XAGA 2GA2A 3BZ6A 3ZP5A 1SMTA 3MQ0A 4OIOF 3LWFA 4HW0A 4A0ZA 1T98A 1IXRC 1PP7U 1YW9A 2EFOA 3CUOA 3FMSA 5HLIA 1J75A 4Q5SF 4KN4X 2PG4A 4M6XA 3T0YA 1TW2A 4I0AA 2CYYA 3RKXA 1FBUA 5LRRA 1G4DA 2L3DA 2DFIA 3M8EA 3WTUC 3CUQC 5AIPA 5IT9K 3PFIA 5A2QZ 3L7WA 1TW3A 3LFKA 3R0AA 2WWYA 4ESBA 1HW2A 3KP2A 2MD5A 2PFBA 1LQ1A 2P8TA 4HYEA 4YIIA 1O3RA 1LDJA 3BOQA 5LRSA 3T8RA 3WGIA 2M5WA 2XHKA 2D2WA 3RJPA 4HV6A 4I7HA 6PAXA 2Y48A 1E2XA 1FWZA 5LBQA 1LVAA 1TQPA 4ENJA 4WXHA 4KIFA 1XMKA 2V79A 1OKRA 3EQLF 2KIUA 5HS7A 1I1SA 4KT5C 2IA0A 3DPLC 2MLKA 1BI0A 5FO5A 4P55A 4IXAA 3O3KA 2IRFG 5L3GA 3L9FA 4XSZF 3CTAA 1DDNA 3WTTC 4ASNA 1SAXA 3TKYA 3GW2A 5FD6A 5ICCA 1SD5A 4GYIA 2W57A 4L9JA 4AIJA 3NQOA 2H09A 2FBKA 3H3ZA 5CVUA 1TQMA 1ZG1A 3KCCA 4GCVA 2W25A 1U3EM 1TNTA 2VE8A 1KA8A 3LQRA 2XAFA 2P6TA 5CYVA 3G3ZA 1RNLA 3CJNA 4XLPF 5DEQA 3JW4A 4AIKA 3F8FA 3RKWA 5ILSA 2KIMA 5ICFA 3K1NA 3FMQA 5L3DA 1MDMB 4M9ZA 2YSRA 3BDDA 2MLGA 2D1HA 2HTSA 4HF0A 3LA3A 3CO7C 5FLXZ 1SFXA 2BBYA 4JK1X 3F6VA 3GEZA 1ZN2A 4CHUA 4LG0B 3K9TA 3B02A 1XN7A 2JRTA 4Z2YA 1WRJA 1WQ2A 3HSRA 3F22A 1YQAA 3ML6A 2ETHA 4XLNF 2STWA 4XSXF 3J80Z 2A68F 4H0EA 3I58A 3MZHA 2LKPA 1QO0D 3REOA 3KLOA 5J8FA 1A04A 3IKTA 1IUYA 3IKVA 4U0YA 4LG0A 1O3QA 2EFNA 2IP2A 1R1UA 1DUXC 4LLNA 2RQPA 1EH7A 4U7BA 1DP7P 2YPRA 1TLHB 3BPXA 1T0FA 4DNCA 1F5TA 2HEOA 5L3FA 4G8XA 4CYDA 3BJAA 5BS6A 3ZPLA 4HLYA 2L54A 5D5XB 2H6BA 1MKMA 1BJAA 2IVMA 2G7UA 3KP3A 2Q2EA 2P6SA 3U9GA 3QPTA 1K78A 1FLIA 3GO5A 4D0PA 5L3EA 5ICEA 3R60A 1SFEA 2FXAA 2OA4A 3DP7A 2H6CA 3WTXC 3D5LA 3HTUA 2XRNA 1TBXA 2QQAA 2RKHA 3HRUA 1FOKA 3EETA 4EJUA 4RB0A 2P5VA 2HKXA 1XD7A 2G7HA 2YR2A 4LK1F 1ON2A 1IN8A 3GZ6A 2OU2A 1XB4A 4N0BA 3KP7A 1P2FA 3C7JA 3EYYA 1T2KA 2DU9A 4U0WA 4R79A 4PGHA 4MEXF 1ULYA 3VB2A 4G6QA 1ZREA 5E8GA 1R7JA 2VC0A 3F21A 2EJRA 1STZA 1FYMA 2DI3A 2Y0MA 3WTSC 3CUQB 1B6AA 2MA3A 3WU1B 3NEUA 3FX3A 1V3FA 3T5XA 1ZGJA 2RVCA 3DQVC 5H6QA 1Z91A 4MTDA 3FMRA 5CVRA 2ZBKA 4A0YA 2Z9OA 1L0OC 4UXNA 1ZG3A 2NRAC 5E18F 2NNNA 5BMZA 2A6EF 1W5TA 1UB9A 2HFHA 5J6XA 3E5QA 1ZRDA 3ROUA 5LEJA 1FC3A 3CUQA 1MJ9A 4K2EA 1J0RA 3HOTA 3SHFA 4GO1A 4MQVA 2MH2A 2DQLA 5HOOA 3ECOA 5CVIA 4O3MA 5CLSA 2EK5A 1D8JA 1YFHA 3GUDA 4CXFA 2F5FA 1R22A 4BNCA 1IRFA 3HUGA 4KDPA 2ELHA 3HIFA 5ILVA 3ERED 2D45A 2H94A 1YS7A 3TDZC 3KP6A 1FPQA 5EEGA 4HBLA 4RAZA 2OZUA 2PI0A 3CDHA 3FM3A 2JPCA 2VOPA 2ZO4A 4HA8A 4I0BA 1V4RA 3O2PE 1Z05A 1SD6A 3C18A 1HKTA 5FFXA 4HDVA 1U5TC 2FU4A 5DYMA 1ZRCA 4G94A 1R1TA 4KA4A 2ESHA 4R1HA 4NB5A 4EM0B 1F4KA 1WSUA 4M9SA 4A5NA 4M9XA 2FA5A 1GXPA 3QOPA 4ZYEA 2WTEA 4B8XA 4OOIA 2RN7A 1ZYRF 5K5RA 4HV5A 1J9IA 1BBYA 3DXJF 4MTEA 2CGPA 1BC8C 4Q47A 2VBZA 4CDGA 4KN7X 1YIOA 1D5VA 1KU3A 1FSEA 2MC3A 3FXUA 1ZRFA 3GVAA 1ZGAA 1USSA 3TOAA 1FX7A 3I4PA 1BIAA 1KU2A 3CLOA 3V8LA 1LDKB 4HAMA 1QBJA 2Q8KA 2DPDA 2XASA 4AIHA 3DPTA 5IT3A 2QBYB 1T6SA 1PP8F 2CG4A 2QM3A 3E5XA 3R6SA 3GZ5A 2XVCA 5IT9Z 2UXNA 1G6NA 1MJAA 3KFWX 2HYGD 3IRQA 2NAZA 3P9CA 2ZNYA 4MQ9F 1USTA 1RUNA 3IWFA 3TO7A 2O3FA 5D8KB 1O57A 1BC7C 2L4AA 1FYLA 2J5PA 5D6FA 3O6BB 3QP5A 1B59A 3Q9VA 5JFRA 2XUBA 1EV7A 4KICA 3R61A 5HS9A 1P6RA 4MGRA 2PMUA 2XGXA 2FMLA 2VT2A 1I5ZA 4I09A 1U2WA 2J5OA 1IN5A 1I1GA 1HBXG 3K69A 4L5IA 4BHBA 1ZLKA 4ENNA 2PBIA 3TOBA 1HKSA 1K7AA 5F6FA 3NRVA 4A6DA 2XROA 3HTSB 3V7SA 4LLLA 2O8XA 4ZYHA 5FFZA 3HOSA 2EA4A 4HDUA 1X3UA 2X4HA 4U7DA 2E1NA 2VBWA 1Y0UA 2L01A 4KFCA 5JI6A 4UHTA 3OOPA 4S04A 1OYWA 1ZG5A 3J81K 3G73A 5A2QK 3J7AO 3LAJA 3C1DA 3ZMDA 3WODF 3WTZA 2RDPA 2W84A 1JE8A 1IAWA 1K79A 2UXXA 2EFQA 2K27A 3RYPA 3GFJA 3RPUA 3E97A 3HHHA 2FSWA 3HRTA 3VEPA 1YW7A 1OMIA 1C0WA 3DV8A 2CFXA 4EM2A 5HDKA 4RGUA 2ESNA 4IHSA 2D1VA 2VN2A 4Y13A 4PZJA 2BYVE 3FZVA 3WE2A 4UV9A 2Q0OA 3LA7A 1XSDA 3ABUA 3SZPA 5DUIA 2V9VA 3RDIA 1G3SA 2WC2A 3W6KB 3MAJA 4A2UA 3V8JA 1YYVA 3EDPA 3M9AA 2VT3A 2DQRA 2DO7A 1U5TB 3GYHX 2O0YA 4ZZDA 2GZWA 2DBBA 3FHZA 1TQIA 4IHTA 2LSOA 1XSVA 4FX0A 1MJBA 3H92A 5DCMB 1QGPA 5JR3A 4RGSA 2A3SA 2AXLA 3WGHA 3L09A 1K78B 2K86A 3C3WA 4B09A 1HW5A 3WGGA 4RGXA 3TO6A 3R0JA 2QLZA 2NNYA 1U5TA 5K5QA 2ISZA 1D8KA 3I64A 1PUEE 3E6CC 4HF1A 5DCMA 2BEOA 4KIGA 3VOEA 5LGNA 4WF2A 1QZYA 4MNUA 4UVCA 2QVOA 3QRFF 3V8KA 3W6JB 1WKMA 2FRHA 4HF2A 2PMHA 1CF7B 1BI2A 2DW4A 4A0XA 5LHGA 1I27A 1IRGA 2VXZA 3K1PA 2AS5F 4N9IA 4A6EA 3TO9A 3ECHA 2P5KA 3IRRA 5FGMA 3L2CA 2FBIA 5E8IA 4WCGA 2JZYA 1CF7A 3LQQA 4KIBA 1YS6A 5D5UB 1LDDA 4WXDA 1ZH5A 3SQNA 3WTVC 3F6OA 1XSXA 5LGTA 1U78A 2GXBA 5ICGA 1IF1A 1ZAOA 4ENKA 1JGSA 1ZARA 2DK8A 4IJAA 5E1XA 3LAPA 4ETSA 1R5HA 1W7PD 4WK8F 1QZZA 4O6JA 3KEOA 3GFIA 2CWEA 5CVVA 1LEAA 1ON1A 5KK1A 4MHGA 4EM1A 1LJ9A 1QQIA 4OINF 2JTVA 2WV0A 4JBAA 4EVIA 1FZPB 2DPUA 2B0LA 2QZ8A 3EUHA 4P96A 4UVAA 3FF5A 1R36A 4RB1A 1RUOA 2Z5UA 4L5JA 2NS0A 4IRGA 2DLLA 3ZMSA 2A5YB 4S05A 1H9TA 2V1UA 4HX7A 3M7GA 4IRIA 4FX4A 3HSEA 2ZXJA 4LK0F 4ZYGA 3N97A 1NHAA 2RGVA 1SD7A 3HSFA 2LDUA 1HSJA 2LF7A 4E70A 1OPCA 1UHMA 3JTHA 2BV6A 1UHWA 1BIBA 1LB2A 3P9KA 4ZYDA 2V1XA 4Q48A 2K4JA 4MEYF 2XKOA 3Q5FA 4L0YB 3TGNA 2F5CA 3RYRA 2HS5A 4U0VA 3ZQ7A 3E6MA 2ZJ2A 3BJOA 3BWGA 1O7LA 4OIQF 1G3TA 3HHGA 3K2ZA 1IN6A 2YX4A 2ZNZA 4EGZA 2QWWA 4HQEA 1F1ZA 3KZZA 3R4KA 3F3XA 3GX4X 1HXDA 3TQNA 1BN5A 5HDNA 2M87A 2BE5F 4PGGA 1JHHA 3M1EA 1YLFA 1LEBA 1H0MA 1FSHA 1Z1DA 3BJ6A 4IVNA 1J5YA 2ACJA 1B9NA 4I2OA 2DTRA 2QQ9A 3FM5A 2F5DA 4PCQA 3CO6C 1KQ0A 1XMAA 1D3YA 1XGSA 4HQMA 2W24A 1XDUA 2K4BA 1HW1A 2KJBA 3HYIA 5JHUA 2ZMEB 2HZTA 4XRFA 4PDKA 2PN6A 1T38A 4TV7A 4N9HA 4ON0A 1B4AA 1RI7A 1Z6TA 5E20A 5HDGA 2IW5A 4P5OA 4I98B 1KYWA 4IPAA 2IPQX 2KIFA 1GVJA 1IW7F 2HTJA 3QU3A 4L9NA 4Y17A 1R58A 1U6GA 2R7FA 1Z6RA 5D6EA 2PJPA 2QENA 4CZZA 1FT9A 1HQCA 1WWXA 2ZMEA 3FXRA 5TJJA 4KYWA 3AAFA 4GXOA 4LJZF 3KE2A 1HKQA 5DDGA 4EJTA 2P7VB 1XDSA 2ZFWA 1ZLJA 1K6OA 2HR3A 4CGZA 5LGUA 2FQ3A 5DD4A 3ZMVA 1T39A 5DD8A 3JAMK 5BQTA 4UVBA 3ABTA 4GYGA 3PQKA 2PQ8A 5J8CA 2HGCA 4AWXB 2M1BA 2V6CA 4P9UA 2PEXA 5H6RA 1P92A 5HS8A 2O03A 1PDNC 5H20A 2IA2A 1RZ4A 5LHIA 5LEKA 2CSOA 2HWVA 5TRDA 3J81Z 4ESFA 4BH9A 4FHTA 4LB6B 1UFMA 2X0LA 4EJVA 3WTWC 1XGOA 3DEUA 3VFZA 1IXCA 2R3SA 3V7RA 4EJOA 1G3WA 4BAYA 2W85A 2PLYA 3JTGA 5HLHA 4G7HF 4EMSA 2EFWA 1ZHFA 5BPDA 4BYYA 1AOYA 4BXUA 3IC7A 1BM9A 4A5MA 2IA1A 4KMUX 1O3TA 3S2WA 4YG2F 4WX9A 5DV5A 2EFPA 2DT5A 3E6BA 4WXCA 5JVTA 5DUKA 2O61A 3ZMZA 3BP8A 3LSTA 3QP6A 4M6YA 1YW8A 3WE3A 5E1WA 2ISYA 1CGPA 5ERIA 4L9TA 1P4WA 2HQRA 1YTYA 2P5LC 2LF8A 2CO5A 2OD5A 4U88A 4HZFA 2STTA 5CVJA 1Z9CA 4FT8A 2HDCA 1O3SA 1EH8A 4LGWA 4LFUA 2XKPA 2P7CB 2DAOA 3IL2A 2VE9A 2O6GE 3ZN0A 1EH6A 5F64A 2UWMA 3ZN1A 1KU9A 5E17F 4GGGA 4CO8A 4RAYA 2EV0A 4EV0A 1W7PB 1TTYA 5ED4A 3RKYA 4Q4ZF 1YG2A 2F5EA 5E1ZB 2EB7A 2CQKA 5D5VB 4EGYA 4LB5A 3RPQA 2Z99A 4F7ZA 1KU7A 3F8NA 4L0ZB 3KETA 4UUVA 1B9MA 3V4GA 4RB2C 4ZH4F 2VBXA 1W7PA 2R7DA 1HSTA 2K02A 5HLGA 3KLNA 3P9IA 1MDMA 3GF2A 4BHPA 1BI3A 3M8FA 4AVPA 2A69F 4I01A 1O7FA 4HLXA 1JXSA 1S7AA 4Y15A 3SZTA 3LA2A 2V1DA 2IT0A 2RNJA 3ELKA 1E17A 3FXQA 4EJWA 3QAHA 2NYXA 3QU6A 1WI9A 2KRFA 2BGCA 3Q9SA 2L4MA 3BPVA 3GLXA 3E6DA 1Q1HA 3MZYA 4JQFA 2Z33A 3JSOA 3V7CA 3RTRA 2A07F 2TDXA 2OZ6A 2HQNA 4QWQA 2YX7A 3ULQB 3MFKA 2UZKA 4LLGF 1OYYA 5FLXK 1RIOH 1GHCA 1OR7A 2KKOA 4BQAA 4HX8A 1S6LA 3SFZA 1P4AA 1SFUA 3ZMTA 2L02A 2P4WA 2VONA 3F8BA 5AONA 3BROA 1FP1D
chains in the Genus database with same CATH superfamily
1MNMC 5AIQA 3EYIA 1ONVA 3GWZA 5IYDJ 5IP6A 3J80K 2GIVA 3BG3A 4EATA 2F2EA 1GLNA 2FE3A 1REPC 2LR8A 3A4CA 5J4YA 1SD4A 5KAFC 5M5XJ 4I02A 1YO5C 3QPHA 4R8HA 3IWZA 2IEKA 4YFNF 5F1RA 1D5YA 3MWMA 2LYCA 1G3YA 1GXQA 4OMZA 3MN2A 3PSFA 2A61A 4XBFA 2GXGA 2W48A 3CCRI 1IXSB 2E5ZA 4M73A 1LUJB 4A12A 2JA2A 5LHHA 5KVRA 4RMNA 2LTPA 4DW6A 2MH9A 4P9FA 2C6YA 2IS2A 2XAHA 4V2FA 2AQFA 2XAJA 4XICA 3VYTB 2GOMA 2OV7A 4O5VA 1NK3P 2V4JC 4CSWA 3KPHA 5K1YA 4M72A 1T33A 5F08A 1QPMA 2MFZA 3PSIA 4CH7A 3A0HC 3OYEA 3FDYA 3U1KA 4L9VA 1S29A 4KNYA 2QKLB 1WI3A 2WADA 1YOVB 3AKZA 3DF8A 2MW8A 2OQGA 1J59A 4XK4A 9ANTA 2QYOA 1R00A 3MCZA 3TDUC 3ZMUA 1RR7A 1XGMA 4IRHA 1JTYA 3I56I 4MFDA 2H27A 2XAQA 5D4RA 1TNSA 4MIMA 2OBPA 3LOCA 5EGOB 1MBHA 1WJDA 1DU0A 3DFGA 1FYKA 1QZEA 3H3UA 2GQQA 4HX4A 1ETWA 5J1UA 2GA1A 2ZFUA 3RQ4A 1IRXA 1KQ9A 1FOYA 4XMYA 2ZCWA 3U1DA 3ZR8X 1S8NA 2Z3YA 1LFPA 4CCKA 1IDYA 1WH5A 2M4KA 2GAUA 3I5UA 1ETYA 1VQ7I 3F8CA 4OIRF 3ISPA 1X2MA 3MEXA 1TWAJ 2V1NA 2FF4A 1T8IA 1QVUA 5GTHC 3WU0A 1Y1VJ 3M1CA 1MIJA 3RZDJ 2E1MB 3H9GA 4JOMA 3SXYA 1F9NA 4OMYA 5D4SA 5FB2A 3I0TA 4PFOA 3OL4A 4B48A 1IUFA 4ZYAA 2RV8A 1R1VA 4KMFA 2ZKZA 2LNBA 3JRGA 1X19A 3ABLH 2JSCA 2Y69H 3QYFA 3IV5A 2EZKA 3WG9A 1XGNA 1E3OC 5EGOA 1U0JA 3ZQQA 1Z0XA 3ZGKA 1ETXA 3F23A 1FP2A 3D0SA 2JT1A 5M3MJ 4BBSJ 1AU7A 3QPLA 5EF6A 4OIPF 1VQPI 1J09A 1OYIA 2XF7A 3BG6A 2KZGA 2XPWA 4UNOA 1P9QC 3WU2C 1B72B 4RLQA 2OQRA 2DDAA 4L18B 1KQ8A 2PMZA 1S7OA 4JX5A 4AC0A 1W4MA 4YFKF 2L2OA 4WWCA 4IX7A 4E7HA 2FNAA 5IP7J 2CV2A 4G9YA 4G7OF 3GFLA 5L3BA 3DBRB 4AD9A 4P1WA 1S5LC 4RGRA 5ILUA 1XCVA 2L9RA 4NDLA 4CUGA 2ZXIA 1DQUA 1I6XA 2EWNA 2Y0SA 1BI1A 5LLQA 3JRDA 3B73A 3K10A 2A6HF 3BTIA 2DOFA 2XV4S 3F72A 2DK5A 4HOBA 3K1MA 4BHCA 3E5UA 2JPBA 2EA2A 5BPIA 3BT9A 5EEHA 1UCRA 2W4SA 1FNNA 2NOGA 3I71A 5EDNA 3K0LA 3I53A 4XM3A 1R5GA 4XLHA 2YU3A 5BNGA 3CCLI 4DZJA 1JKPC 4LD5A 1B72A 2E7XA 2COMA 4KUMA 2MBFA 1MGTA 2HOEA 3P5JA 2KJCA 4FASD 2HVQA 1IO2A 4B3AA 3DKWA 2K3PA 5DM6F 5D5WB 1J2XA 1DPRA 4B1RA 2LFBA 1KYZA 2VC1A 1KGSA 3BY6A 3AG1H 3MMYB 2MGQA 5GPAA 2DDBA 5GP9A 3ASOH 3F9KA 4QLCU 5HVQC 1VTNC 2K7LA 2LMDA 2EV5A 2VBYA 4YFXF 3GXOA 1XCBA 3IHUA 4DYCA 1BA5A 2ME0A 1AKHB 3OYFA 4XL9A 5IYBJ 2AXTC 3CZ6A 1FMWA 2EILH 3E3VA 1BOAA 2RC4A 3IUOA 3AL0C 1U8RA 2JN6A 1FBQA 1MD0A 2M8EA 3PQJA 2H8WA 3GTMJ 3LL7A 5E3MA 4M3FA 3JR9A 5K5OA 4J19A 4UY8I 3H9QA 3FWEA 1GV2A 1OQYA 2GWRA 4ZDPA 1YX5A 2M45A 3MKWB 3VYUB 3U2RA 1AA7A 1OR7C 3HOXJ 4NHJA 4ANJA 2E1CA 2OTLI 2X1EA 4G6DA 5FD5A 4M74A 1AKHA 1DPUA 2ZJRF 3T8TA 1IZ1A 1S3JA 2JA5J 4ITVA 1UG0A 3I59B 2XGDA 5F04A 1LNWA 1MZBA 2L7ZA 2OAZA 4DQ2A 3GFMA 2BZTA 2JA8J 3VODA 1IDZA 2W7NA 1FBSA 2G9WA 5BOXA 3QYEA 2Y75A 1SVOA 4LMYA 1QNTA 3T1BA 3N4MA 1AWCA 1B1BA 4RB3C 3A02A 4G7ZF 2JUGA 3H0DA 4ENMA 4IOAF 2IS6A 1H9GA 4QIWN 3HRMA 2JUCA 1E3PA 2Z1DA 2FNPA 3S32A 3KEYA 3JAMZ 4A3DJ 1Z7UA 2IGOA 3F8MA 1L3LA 2HYFA 1W0TA 2R7VA 2FBHA 3OV8A 4YIFA 2QKMB 2W1OA 2L7MP 3KZYA 3I54A 2IJLA 4IF4A 5D8LB 4ZZLA 4BXXJ 2QQBA 3RI4A 5CJ9A 2HNHA 5KAIC 3SEZA 2R7OA 3I59A 3LFUA 1J7KA 3IAM2 4M71A 3RIRA 2CUEA 3HPHA 2CW0F 2E71A 2GXAA 1FIAA 3OOUA 3OS1A 3HRSA 1R23A 4D5FA 4JX6A 5DCFA 2MABA 3TMOA 3P7NA 2HZDA 1FY7A 2EBIA 4RM3A 2DT6A 3HXLA 2WAFA 1XMXA 3S1MJ 2R5ZB 2FOKA 2VODA 2QUFA 2LK2A 3BTLA 4DIQA 4OU0A 4UV8A 2HKOA 2FEZA 4JYKA 3D1NI 4RM2A 5L3CA 4XRMA 2HDDA 1B8IA 2LY9A 3S2DJ 2EV6A 4RS8A 4EQQA 3L00A 1W5SA 2Y31A 2DCEA 4NQWA 3CJRB 3KP4A 5M3FJ 1IN7A 1SMYF 2E7WA 2ADUA 3KEQA 3TBIA 2DA4A 3G71I 3VWBA 2VOOA 2XIGA 4FCYA 3KP5A 4I6ZA 1JHFA 3WTYC 1OCZH 4BXFA 3JSPA 4ESJA 4BUPA 2M30A 1IN4A 2H1KA 5C4XJ 1FOWA 4CICA 3QODA 1ODDA 4KISA 2IGKA 4XLEA 4FTHA 3Q3SA 2FMYA 5GPCA 4X1EA 1P4XA 2R5ZA 1Z67A 3COAC 5J1YA 2QBYA 2XAGA 1APLC 2GA2A 1BOBA 3BZ6A 3H5AA 3ZP5A 2NS8A 1SMTA 3MQ0A 4OIOF 1K4SA 1TWCJ 1IG7A 3LWFA 4HW0A 3G1OA 1T98A 4A0ZA 3H3VK 4XN0A 1IXRC 1PP7U 1K6YA 2PJRA 3QYBA 1YW9A 2EFOA 3CUOA 3FMSA 5HLIA 1IJWC 1J75A 4Q5SF 4LIUA 2HI3A 4KN4X 5FROA 2PG4A 4M6XA 1ZTRA 2CV1A 3LSPA 2JVGA 3T0YA 2HU9A 3NWSA 3ZQHA 1WJAA 2CQXA 4C3JJ 1TW2A 2DMTA 3WHBA 4I0AA 5M5WJ 2CYYA 3RKXA 3PM1A 2HYJA 2M4GA 1HF0A 1FBUA 5LRRA 3L2UA 1G4DA 2L3DA 2DFIA 3M8EA 3WTUC 1A6QA 1Y8RB 3K4MA 3CUQC 1LVKA 5AIPA 5IT9K 3PFIA 5A2QZ 3L7WA 3PNTA 2DA2A 3DWLE 4C2UA 2XSDC 4W1UA 1TW3A 3LFKA 3R0AA 2WWYA 4ESBA 2B63J 1HW2A 3KP2A 2VLAA 1EKEA 2VPRA 2MD5A 4XOPA 2PFBA 2KQRA 3MKZA 1LQ1A 2P8TA 4HYEA 4YIIA 3K2AA 2L0KA 3CD6I 4JX4A 2DFHA 1O3RA 1LDJA 3BOQA 5LRSA 5F27A 3T8RA 3WGIA 1SVMA 2JSPA 2M5WA 3HL2A 3BR6A 2XHKA 3L1PA 1IRZA 3GCMA 2D2WA 4F3QA 3CP2A 4PJLA 2F5VA 3RJPA 4HV6A 4I7HA 4IHVA 3OYBA 6PAXA 2Y48A 1E2XA 4XLFA 1FWZA 1VQOI 3RCOA 5LBQA 1LVAA 1TQPA 2XPUA 2GIZA 4M3GA 1YJWI 3FXLA 4ENJA 4WXHA 1UZCA 4KIFA 1XMKA 2V79A 5FJ8J 1OKRA 3EQLF 4E7IA 2B9SA 2KIUA 1YRNB 1HDPA 5HS7A 1I1SA 2JK3A 3CC7I 4KT5C 2IA0A 3DPLC 2MLKA 2XF5A 1BI0A 5FO5A 3HDDA 4P55A 4DYRA 3HOVJ 4IXAA 2NS7A 3O3KA 4DJAA 1U9NA 2IRFG 4BQOA 5L3GA 3L9FA 4XSZF 1XS9A 3CTAA 2VJJA 1DDNA 3QQAA 4ASNA 3WTTC 1SAXA 4RLFA 2VKDA 2A6TA 3TKYA 2E60A 3GW2A 5KCMA 5FD6A 1WVRA 3OIQA 1O4XA 5ICCA 2V26A 1SD5A 4GYIA 3PIPF 1H8AC 4U87A 2W57A 4AU7A 4L9JA 5CQEA 2R4GA 4DYQA 4AIJA 3NQOA 2H09A 2FBKA 3H3ZA 4XRSG 5CVUA 4GDFA 1TQMA 1FEXA 4RAGA 1A36A 4LOCA 3TP0A 1ZG1A 3KCCA 2W25A 3LSIA 4GCVA 3HC7A 2ZXHA 2R7RA 2HQAA 4II2A 3CMYA 1U3EM 4A3EJ 1TNTA 2VE8A 4C2TA 4V19K 1KA8A 2LLKA 2XAFA 3LQRA 1F36A 1ENHA 2P6TA 5CYVA 3G3ZA 1RNLA 4BJTA 5GAHJ 4E7JA 1JUPA 3CJNA 4XLPF 5DEQA 3JW4A 4AIKA 1Y8QB 4RBOA 1LKXA 1PYVA 3F8FA 3RKWA 3I4MJ 5ILSA 1TL8A 2KIMA 1ZQ3P 5ICFA 3K1NA 1ZR2A 3FMQA 5L3DA 1MDMB 4M9ZA 2YSRA 3BDDA 2MLGA 2D1HA 2E2IJ 2HTSA 2COBA 4D1QA 4HF0A 4CCMA 3LA3A 3CO7C 4BE1A 2K9MA 5FLXZ 1SFXA 2BBYA 4JK1X 2OCCH 3JRCA 3F6VA 4E7SA 3GEZA 1ZN2A 2B7EA 3BZCA 4CHUA 4LG0B 2V9KA 3K9TA 4BQQA 2L7FP 3B02A 2X9DA 2E1OA 2LH9A 1JKOC 1XN7A 2JRTA 4Z2YA 3OIOA 1WRJA 2F48A 2OJED 1WQ2A 3AL0B 5HNFA 2NVTJ 3HSRA 5JVGF 3OL3A 3F22A 1YQAA 4F52A 3ML6A 3W6VA 2ETHA 4XLNF 1RESA 2STWA 1LFUP 4XSXF 4CCJA 1SAUA 3J80Z 2A68F 3IH2A 1W5CC 3NARA 4H0EA 3I58A 3MZHA 3HKZN 4ZDOA 2LKPA 1QO0D 3REOA 3KLOA 5J8FA 1A04A 1QA6A 3IKTA 2YS9A 3IKVA 1IUYA 2DA6A 4U0YA 4LG0A 3HPGA 1O3QA 4PJ0C 1PUFA 2EFNA 2TCTA 2IP2A 1R1UA 2QCOA 5FKLA 1DUXC 4LLNA 4HSRA 2DMPA 2RQPA 1EH7A 3EPZA 4U7BA 3L2RA 1DP7P 3DKYA 3M4OJ 2YPRA 1TLHB 3BPXA 2E2HJ 5F0FA 1T0FA 3VSLA 3OYLA 4DNCA 4NC7A 1F5TA 2HEOA 3OWTA 3BR3A 5L3FA 3CF5F 1R9TJ 2HQ5A 3A01B 4G8XA 2HVRA 1Y6IA 4CYDA 3BTJA 3BJAA 5BS6A 3FXMA 3ZPLA 2KFDA 2WB1N 4HLYA 2L54A 1VQMI 1JUSA 5D5XB 2H6BA 1MKMA 3GMEA 5F1JA 1BJAA 2IVMA 2Z16A 2UV1A 2G7UA 3KP3A 2Q2EA 4CZCA 2P6SA 1WGXA 5E3OA 3L2VA 3LMMA 3U9GA 3QPTA 2M34A 1K78A 1Q1VA 1FLIA 3GO5A 3BR0A 2BW3B 2LG4A 4D0PA 5L3EA 1P7IA 4HNVA 5E3NA 2R7SA 2ZXWH 1JTXA 5ICEA 3R60A 3OYIA 1SFEA 2FXAA 3RPUD 2RNGA 5FKNA 5EEAA 1JT6A 3ONQA 2OA4A 3DP7A 2H6CA 3A01A 3OYCA 3WTXC 2I8DA 3D5LA 3HTUA 1VQNI 2XRNA 1TBXA 2QQAA 1ACIA 2CUFA 2RKHA 3HRUA 1FOKA 3EETA 4EJUA 3KIOA 4RB0A 3PO3J 2P5VA 1OCPA 3W2AA 2HKXA 3FK7A 1XD7A 3EUKL 1UHSA 2G7HA 2FUG2 4BU2A 2YR2A 3KYLA 1ETQA 3JRHA 1TWFJ 1GUUA 1T08B 2BW3A 2GOXB 3GLLA 2HOAA 4LK1F 2DYSH 1ON2A 1IN8A 3GZ6A 2OU2A 1XB4A 2CUJA 4N0BA 1WJCA 3K4LA 4XR6A 3KP7A 1P2FA 3C7JA 2ZJPF 2JMWA 2QQ8A 3EYYA 3ABKH 3CCYA 1T2KA 2DU9A 2WY7Q 4U0WA 4R79A 5C44J 4E7ZA 4NC6A 4BBRJ 4UUSB 4PGHA 3FHNA 4MEXF 2F4IA 3CC4I 1ULYA 1RRJA 3S1RJ 2P81A 4BY7J 2OC6A 3VB2A 4G6QA 1D1AA 2VKVA 3E7LA 1ZREA 5EJCA 5E8GA 5IOYA 5FKKA 4AM3A 1R7JA 2VC0A 3PJRA 5J3LA 3UKGA 3MD2A 1H88C 1XX5A 4A3IJ 3F21A 2EJRA 2R7XA 1D0YA 1STZA 1FYMA 2DI3A 2Y0MA 3CQZJ 3WTSC 4QTRA 3CUQB 2R5YA 3D5RC 4KJZA 1B6AA 2MA3A 3CCEI 2Y2ZA 4FE7A 3WU1B 3NEUA 3FX3A 1V3FA 4A3JJ 3T5XA 2L9NA 1ZGJA 4XLCA 2CQ7A 2DA5A 4C9YA 2RVCA 5GAGJ 1Y0NA 3DQVC 3ASNH 1Z91A 5H6QA 4UUSA 4MTDA 2LREA 3FMRA 3G1MA 5CVRA 3IAS2 1QHHD 1VFCA 2CH0A 2DOAA 2ZBKA 4A0YA 2KP6A 2Z9OA 1L0OC 4UXNA 1ZG3A 2NRAC 2XB0X 5E18F 2ELKA 2NNNA 5BMZA 2A6EF 1W5TA 1UB9A 2HFHA 5J6XA 3E5QA 1W1WE 1EA3A 2CUZA 1ZRDA 1T95A 1HC8A 2OUMA 3OIPA 1I50J 3ROUA 5LEJA 3CUQA 1FC3A 1MJ9A 2JRMA 2X6OA 4A3GJ 4S0HB 3TEDA 4K2EA 1J0RA 3HOTA 3SHFA 1G2HA 3C2BA 4GO1A 2QSGX 4MQVA 2MH2A 1QPIA 2DQLA 5HOOA 3W2WA 3ECOA 5CVIA 1LE8B 1OLTA 4O3MA 2YUSA 2ICWG 2HVSA 5CLSA 2EK5A 1D8JA 1YFHA 3GUDA 1RR8C 4CXFA 2BY3A 2F5FA 4B4CA 1N77A 1R22A 2VI6A 3PUFA 4ZJZA 2R92J 1NH3A 4BNCA 2VQCA 2JVHA 1IRFA 3HUGA 4KDPA 2ELHA 3TL4X 3HIFA 5M5YJ 5ILVA 4XIDA 3ERED 3IH3A 2H94A 1YS7A 1WFXA 3TDZC 2D45A 3KP6A 1FPQA 5EEGA 1TT0A 2VB6A 5FLVA 4HBLA 4RAZA 1NG6A 2OZUA 2PI0A 3GTOJ 1E0EA 3CDHA 2V7FA 2Y9ZA 2KPMA 2ID3A 4ZDLA 1SFOJ 3FM3A 2JPCA 2VOPA 2LP0A 2ZO4A 1BJZA 4HA8A 2EZHA 4I0BA 1V4RA 1KZHA 3J7YJ 1LE8A 3O2PE 1Z05A 1SD6A 3C18A 1HKTA 2V9PA 5FFXA 4C3HJ 5HODA 3J7ZI 1BR2A 4HDVA 1T0FC 1MSEC 1U5TC 2FU4A 5DYMA 2DA7A 1MBFA 4PUSA 4XNFA 1ZRCA 4G94A 3JRAA 1R1TA 4KA4A 2ESHA 3S3MA 3O8HA 2EPFA 2BHZA 2WB1A 3CCMI 3GTPJ 3KX2A 4R1HA 2E2JJ 4NB5A 4BE2A 2E19A 4EM0B 4BE0A 1F4KA 2BY2A 1OCTC 1WSUA 4M9SA 4A5NA 3MZ8A 2LC2A 1EJ9A 4M9XA 3PFYA 2X1CA 2FA5A 1GXPA 4J01A 2GLOA 1XG1A 3QOPA 4ZYEA 2QGUA 3PIOF 2WTEA 4B8XA 1YJNI 3FBIB 3G6EI 2L5QA 2W00A 3W2VA 3OYNA 4OOIA 3ABMH 1FTTA 2KDOA 2RN7A 2V6EA 1ZYRF 3CMMA 5K5RA 4HV5A 1J9IA 1BBYA 1VQ4I 1VF9A 3DXJF 1TP4A 3S3OA 4MTEA 2CGPA 1BC8C 4Q47A 2VBZA 4CDGA 2N8GA 4KN7X 1ZR4A 1YIOA 1B8IB 2HXIA 3OMYA 1SFKA 2LY1A 1D5VA 1KU3A 1V55H 3HM5A 1FSEA 4NQWB 2FOWA 1LPQA 2MC3A 3OSGA 4UB8C 1X3WB 1MBEA 3FXUA 2K9SA 2I5UA 1ZRFA 5B1AH 3GTKJ 4LIVA 3GVAA 1S9HA 1ZGAA 1PVEA 1USSA 2NVXJ 3GTLJ 3TOAA 1FX7A 2E35A 3I4PA 1BIAA 1KU2A 3CLOA 3V8LA 2X85A 1LDKB 4Y33A 4HAMA 1QBJA 2Q8KA 2DPDA 2XASA 4AIHA 3DPTA 5IT3A 2QBYB 1T6SA 3OS0A 1PP8F 1I3AA 2CG4A 2QM3A 3M07A 2NXNB 3E5XA 3R6SA 2L9VA 2XVCA 3GZ5A 2UXNA 1JJ8C 1G6NA 5IT9Z 1MJAA 1RC9A 2PJRB 2DJIA 3FKIJ 3H5NA 3KFWX 2BHYA 3WG7H 1KONA 2X1DA 3B6CA 2HYGD 3IRQA 4IO9F 3OSFA 1VQKI 2NAZA 3P9CA 1GT0C 2ZNYA 1IV6A 4XN3A 4MQ9F 3FISA 2VIXA 3ZQGA 5KHDA 3DU6A 1USTA 2VUMJ 1RUNA 3HBLA 2CQQA 2OF7A 3IWFA 5JLWA 1SC7A 1SEUA 4IKFA 3TO7A 2O3FA 5D8KB 1O57A 3H1CA 1VQ6I 2EIMH 5DS9A 1BC7C 2WAQN 3S93A 1VZ0A 1X1CA 4A3LJ 1BW6A 2BY0A 2L4AA 3SDBA 1FYLA 3G4SI 2J5PA 5D6FA 2KZVA 3O6BB 2DYRH 3H0GJ 3QP5A 1B59A 2L9SA 3E0JB 3Q9VA 1HDDC 2XPVA 3S17J 4IOCF 5JFRA 2XUBA 2F6CA 3DLAA 3V42A 1EV7A 4KICA 1BR4A 2CW7A 3R61A 3OYAA 5EZHA 5HS9A 4OAZA 2EINH 4C2MJ 1P6RA 4IL6C 2PMUA 3B6AA 4MGRA 2XGXA 2FMLA 1V5EA 4AIDA 2VT2A 1I5ZA 2R7QA 4I09A 1X1DA 5LFAA 1Y1WJ 1XTAA 1U2WA 2J5OA 1IN5A 4N4OB 3FXJA 1I1GA 2FJ1A 1K83J 2IS4A 1HBXG 3K69A 4L5IA 3NWTA 1YX3A 2KISA 4FISA 4HG2A 4BHBA 1ZLKA 5TGTA 4ENNA 2PBIA 3TOBA 3A1YA 3K70D 1HKSA 2GM4A 2NVQJ 4XKWA 1K7AA 5F6FA 5CKTA 2VKEA 3NRVA 4UUTA 1MW7A 4C3IJ 1ERDA 3FK6A 3LSHA 4A6DA 2HOTA 3Q0UA 2XROA 3S1NJ 1ZK8A 1JJ6C 1QHGA 3HTSB 3V7SA 4LLLA 2ECBA 2O8XA 2GBYA 4ZYHA 3TW7A 3CC2I 5FFZA 3HOSA 2FX0A 3NAUA 2EA4A 4HDUA 1LFBA 1X3UA 4Y4RA 3LSJA 1IV8A 2X4HA 2CFOA 3FBNB 3K6GA 4U7DA 2E1NA 2ZSIB 2FD5A 3RQIA 1WJ5A 3OYGA 2VKHA 3CESA 3SEQA 1GDTA 2VBWA 1Y0UA 2L01A 4NUBA 4NNJA 1OCOH 4KFCA 4BJ6C 3CCVI 5J40A 5JI6A 1MH4A 2WA0A 1X1AA 5IOZA 4UHTA 4GFBA 3OOPA 2ECCA 2K5CA 4S04A 1OYWA 1ZG5A 4AVZA 1EF4A 3VPRA 1IGNA 3J81K 2LY2A 3DLLF 1MMNA 1VQ5I 2KHMA 3G73A 5FKOA 2E36A 1FMVA 1MMDA 5A2QK 3J7AO 3LAJA 3C1DA 3ZMDA 3PUBA 3WODF 3WTZA 2RDPA 2K9NA 2W84A 1JE8A 1IAWA 3D5SC 2LVSA 2UXXA 2EFQA 3JRFA 1K79A 2K27A 4XRSA 3RYPA 2K3FA 3GFJA 1H89C 1AHDP 3RPUA 3K70C 5C3EJ 2X6WA 3E97A 3HHHA 3QWLA 2FSWA 4HNUA 1YIJI 1WJBA 3BG5A 4CCLA 3OYHA 3HRTA 3VEPA 1YW7A 1OMIA 1C0WA 1HLVA 2P0WA 1UELB 3LSRA 5J47A 1HCRA 3OS2A 5IPAA 3PO2J 5GAEJ 2WAEA 1BR1A 3DV8A 5E3LA 2CFXA 2XAUA 4EM2A 5HDKA 1VQLI 4OWRB 2BXYA 4RGUA 2ESNA 4IHSA 2D1VA 4QPQA 2XC7A 2MD0A 4A93J 1N78A 2VN2A 4Y13A 4PZJA 2BYVE 4JP0A 3CMEI 3FZVA 3WE2A 4UV9A 3BC8A 2Q0OA 4FETA 3G2BA 3ZXSA 4BDZA 2DN0A 1HA8A 4CYCB 3LA7A 2DT7B 1XSDA 3ABUA 3SZPA 2IGMA 3FXOA 4HSTA 5DUIA 2V9VA 3RDIA 1G3SA 4PK4A 1VNDA 1PUFB 1Z3XA 2WC2A 3JRIA 3W6KB 3MAJA 3PL8A 4A2UA 3V8JA 4YEJA 1YYVA 2XSJC 3EDPA 3M3YJ 2M9HA 3M9AA 2VT3A 3DTIA 2DO7A 2DQRA 4I99C 2M3AA 1X1PA 3ZQIA 4FQGA 4F92B 3CCUI 2ZMEC 1U5TB 1WHUA 2Y30A 3WHCA 3GYHX 2O0YA 4ZZDA 2GZWA 2MYSA 2VJ4A 2DBBA 3S1QJ 3FHZA 1TQIA 4IHTA 2LSOA 1XSVA 5TISC 4FX0A 2EQRA 1MJBA 4ZTFA 2M0MA 3BCAA 3H92A 5DCMB 1QGPA 5JR3A 4RGSA 2NVYJ 4CYCA 2M2EA 1ZELA 2E34A 3SJMA 2A3SA 3RSNA 3BLYA 1RPWA 2BVMA 2AXLA 2Q2EB 3G1LA 2WAQA 3WGHA 1VI0A 5GTIC 3L09A 1K78B 1E3HA 2K86A 2G0EA 3C3WA 4B09A 3S14J 4XKCA 1HW5A 4L5EA 3WGGA 1JKRC 1YHQI 4RGXA 1ETVA 1Y56A 1Z77A 5CPRB 3TO6A 3R0JA 2QLZA 3KYCB 2NNYA 1DP3A 4BEHB 1U5TA 5K5QA 2ISZA 1D8KA 2X6XA 1Z21A 3I64A 1PUEE 3BQZA 2AHQA 3E6CC 4HF1A 1HOMA 3OYMA 5DCMA 3MKYB 1ITYA 2BEOA 4KIGA 1MNDA 3VOEA 5LGNA 2VASA 4QPOA 4WF2A 3CJQB 1QZYA 2BVLA 4II3A 4MNUA 2MC4A 5B66C 3FXKA 4D7MA 1YJ9I 1F43A 2CV0A 4UVCA 2JJ7A 2QVOA 3QRFF 3V8KA 3W6JB 4EEFG 2YU9J 4HPQA 1WKMA 2FRHA 1TC3C 2JA6J 1CQTA 4HF2A 4M3DA 2PMHA 1CF7B 2KL4A 1MMSA 1R4NB 1JGGA 4BEHA 1BI2A 2DW4A 1JUMA 3DCFA 3K4BA 4A0XA 3DPUA 2RAEA 5LHGA 3J7AY 3IP4B 1I27A 4XOTA 1IRGA 2VXZA 3K1PA 2AS5F 3K4KA 1QVTA 5GADJ 3JRBA 2IS1A 4V2GA 3C2HA 4N9IA 3HGYA 3SDGA 4A6EA 3TO9A 4B3XA 3ECHA 3CMAI 2P5KA 3IRRA 4D7NA 5DM7F 1RKTA 5FGMA 3N05A 1YE9A 3L2CA 4A3FJ 2K9LA 2FBIA 5E8IA 4BKXA 4WCGA 4LITA 3VSKA 1FTZA 4A3MJ 2JZYA 2K9QA 1CF7A 3LQQA 4KIBA 1YS6A 5D5UB 1LDDA 1JKQC 3S8PA 5JHFA 4WXDA 1ZH5A 3HB9A 3SQNA 3BQYA 3WTVC 1D0XA 3FKJA 3F6OA 1XSXA 5LGTA 4B47A 2R5YB 1U78A 2GXBA 1YI2I 2OCEA 5FKMA 3TP3A 5ICGA 2QA4I 1IF1A 1ZAOA 4AUXA 2KMUA 3I9V2 4ENKA 1JGSA 1ZARA 2DK8A 2CU7A 2Z2SB 3MKLA 2DOEA 2O5RA 4IJAA 2CJJA 4AYBN 5E1XA 2QSHX 1S7EA 4ETSA 3LAPA 1R5HA 2XGEA 5EYRA 4ZTJA 3KZIC 1W7PD 4WK8F 1R4MB 1QZZA 4O6JA 3JREA 2ZSHB 3BCBA 3KEOA 4DBRA 3H36A 2VL8A 3GFIA 2CWEA 4DGWB 3BR5A 3CDIA 5CVVA 1LEAA 1ON1A 5KK1A 4MHGA 4EM1A 1VQ8I 1LJ9A 3ZOBA 3S3NA 3HOUJ 1QQIA 3JCUC 2DA3A 4OINF 4A69C 4Y3OA 2JTVA 4G6TB 3X2QH 4IEJA 2WV0A 2XGCA 3HZJA 4JBAA 4EVIA 1FZPB 2DPUA 2B0LA 2QZ8A 5EG0B 3EUHA 4P96A 4UVAA 1VQ9I 3FF5A 1R36A 3BG7A 3I4NJ 3CCJI 1X58A 4RB1A 1RUOA 2VJIA 4BS9A 2EZIA 2DTZA 4YELA 4CCOA 2Z5UA 3LSGA 4L5JA 2NS0A 2BXZA 4RDUA 1A35A 4IRGA 2DLLA 3ZMSA 1ZKGA 4PJJA 2A5YB 3ZQLA 2PX9A 4S05A 1RETA 1H9TA 2V1UA 4HX7A 3HUGB 3M7GA 4IRIA 4FX4A 3HSEA 2ZXJA 4LK0F 4ZYGA 3N97A 1NHAA 2BOLA 3DKXA 1UMQA 2RGVA 1SD7A 3HSFA 2LDUA 1HSJA 2LF7A 4E70A 5IP9J 1OPCA 1UHMA 3JTHA 5B3SH 2BV6A 1UHWA 2LD5A 5EG0A 1POGA 4BL0B 3H9JA 3F0CA 4KT6A 1BIBA 1LB2A 3P9KA 4ZYDA 1NK2P 4A3BJ 2V1XA 1G8XA 2K85A 3OY9A 4Q48A 4XQFA 2X6YA 4MO7A 2CMPA 2K4JA 2M7AA 2XKOA 3DEEA 4MEYF 5HLTA 2Y9YA 1V54H 1OJLA 2MG4A 1Z3YA 3Q5FA 4FE4A 4L0YB 3TGNA 3HKZA 3AFHA 2F5CA 2HS5A 4U0VA 3RYRA 3ZQ7A 3E6MA 2EIKH 4YIRX 1DGWY 3QPSA 3SFIA 2ZJ2A 1JT0A 3BJOA 3BWGA 1A5JA 1O7LA 5HNHA 4Y52J 4OIQF 5K7HA 1TT5B 1G3TA 4CA0A 2XDVA 3HHGA 3K2ZA 1IN6A 2YX4A 1ETKA 2ZNZA 4EGZA 2QWWA 5F0HA 4HQEA 3CCQI 1F1ZA 3KZZA 4ABZA 4LG3A 3R4KA 3OR1C 1X2NA 3F3XA 3GX4X 2ZC2A 4PSWA 1HXDA 1P7JA 3TQNA 4PJNA 1XC5A 1BN5A 2AQEA 4IQ4A 5HDNA 2M87A 2EH3A 3MVPA 5LD2C 2O8KA 2BE5F 3DTKA 4PGGA 3A2KA 2DMUA 1JHHA 3M1EA 1ZGWA 1YITI 1YLFA 3A03A 4E6KG 1LEBA 2CQNA 3L2QA 1X1BA 2KT0A 1H0MA 4BY1J 4N4NB 1FSHA 2NOJB 5H2FC 1Z1DA 3BJ6A 1OFCX 1FIPA 4IVNA 1J5YA 4G12A 2ACJA 2QF7A 3CLQA 1B9NA 1R71A 4I2OA 3ERMA 2DTRA 3AG2H 2QQ9A 2M7BA 3FM5A 4B43A 2K40A 2F5DA 4PCQA 1QRYA 4Z6YA 3CO6C 1V5FA 2EIJH 1KQ0A 1XMAA 1D3YA 2F4MB 1XGSA 2DFEA 4HQMA 2W24A 1XDUA 3PNVA 2K4BA 4KITB 2H8RA 2HPMA 2WBMA 1HW1A 3HGGA 2KJBA 1WCMJ 3HYIA 5JHUA 2ZMEB 2HZTA 4I76A 4XRFA 1NG7A 4PDKA 2PN6A 1T38A 4TV7A 2VQGA 4N9HA 4ON0A 1B4AA 3GTQJ 1RI7A 1Z6TA 2M0CA 1RKWA 5E20A 3S16J 5HDGA 1M1EB 2IW5A 4P5OA 2W82A 4I98B 1KYWA 4IPAA 4BDYA 2IPQX 1FOXA 2KIFA 3GTJJ 2DMNA 1GVJA 1IW7F 2HTJA 3QU3A 3C2GA 4L9NA 4Y17A 1WJEA 4BGDA 1R58A 2H1LA 1U6GA 2DMQA 2R7FA 1WJFA 1Z6RA 2UUZA 3CF2A 4J00A 4QSHA 5D6EA 2HPIA 1D0ZA 2ZJQF 1R5ID 2IGNA 1U8BA 2PJPA 5K7FA 2QENA 4CZZA 1FT9A 1HQCA 1WWXA 1BL0A 5FLMJ 5F0CA 4AYBA 2ZMEA 2VPLA 3DBLB 3Q0WA 4D9JA 1MNEA 1UAAA 1QU3A 1G59A 4C30A 2O9LA 1PJRA 4D5CA 3FXRA 5TJJA 4KYWA 3AAFA 4F91B 4GXOA 4LJZF 3KE2A 2KRCA 1DU6A 1HKQA 5IY5H 3SYTA 2QSFX 5DDGA 4EJTA 2P7VB 1XDSA 1S72I 2ZFWA 1ZLJA 1K6OA 1W0UA 3H5RA 2LBFB 2ME6A 1OCCH 4PFPA 3I3LA 3GZNB 2HR3A 5K7ZA 5LGUA 4CGZA 2FQ3A 3LSKA 1GVDA 4HNTA 2R7TA 1T56A 2IXSA 5DD4A 2TRTA 3EUHC 5DD8A 3ZMVA 3JAMK 1T39A 4IQJA 1X3ZB 5BQTA 1TWHJ 2JA7J 4UVBA 3ABTA 4GYGA 3HEFA 2KIQA 3PQKA 2PQ8A 5J8CA 2HGCA 4AWXB 4XKVA 1W36D 2M1BA 4W97A 2KDZA 4PSXA 4X6AJ 4DBQA 2V6CA 4E4HA 4HEA2 4P9UA 2PEXA 5H6RA 1MSFC 2FQ4A 1P92A 5HS8A 2LBFA 2DFFA 1MH3A 3FIWA 2XB5A 2O03A 1PDNC 2X48A 2R7WA 1OISA 1WH7A 5H20A 2IA2A 1RZ4A 1X4OA 5LHIA 5LEKA 2CSOA 2HWVA 4HRIA 5TRDA 4RA2A 1MBGA 3J81Z 2E1MC 1WZ2A 4ESFA 4BH9A 4FHTA 4LB6B 1UFMA 2X0LA 4EJVA 1SVLA 1XPXA 1WPKA 2CRGA 2R7ZJ 1V5GA 1XGOA 3DEUA 1I3QJ 3WTWC 3VFZA 1IXCA 2R3SA 3LSMA 4XORA 3V7RA 4EJOA 1G3WA 2BY1A 4BAYA 2W85A 1MBKA 2PLYA 3JTGA 2D5VA 5HLHA 2VQHA 4ZC3A 4EMSA 4G7HF 4X0GA 2EFWA 4BQNA 1ZHFA 5BPDA 4BYYA 1AOYA 2HXOA 3VYRB 4BXUA 3IC7A 1R6RA 1IC8A 1BM9A 4A5MA 2R93J 2IA1A 4KMUX 1O3TA 2DJNA 3DTEA 2LOOA 3BTCA 3S2WA 4YG2F 4WX9A 3ZQFA 2OPTA 2DXIA 1U9OA 1BW5A 1TZLA 1FJLA 5DV5A 2M8GX 5EZGA 2EFPA 2DT5A 3E6BA 4NC8A 4DZPA 4WXCA 4MFEA 5DUKA 5JVTA 3PNYA 5CQGA 1W36C 4M6VA 2O61A 2WY8Q 3K4JA 2DODA 3ZMZA 2KLOA 3BP8A 5B1BH 3LSTA 3QP6A 2VXDA 3CP8A 4M6YA 2JQ7A 4A3KJ 1YW8A 3ESWB 3WE3A 5E1WA 2ISYA 1CGPA 4F55A 5ERIA 3SZGA 1OCRH 5C4JJ 3LNQA 2MSYA 4L9TA 1P4WA 1A6IA 5FRNA 3S2HJ 2HQRA 3DEWA 1DGRM 4BJ5C 4CCNA 1YTYA 2P5LC 2LKSA 4IHWA 2XRLA 3HG9A 1YRNA 1Z7LA 2LF8A 5DTDA 2CO5A 2OD5A 4U88A 4HZFA 3UNGC 2STTA 5CVJA 1Z9CA 4FT8A 2HDCA 2NVUB 5IYCJ 3ZQCA 2IAIA 1O3SA 1EH8A 5KNLA 4LGWA 1A31A 4LFUA 3QOEA 5E79C 2XKPA 3Q0VA 3RKQA 4IHYA 4E7KA 4F93B 2P7CB 4XONA 4OAYA 2DAOA 5J1RA 3IL2A 2VE9A 4M3BA 3CCSI 2O6GE 3BZKA 3ZN0A 4IHXA 1EH6A 5F64A 2XF6A 2A05A 3M8JA 3IH4A 2UWMA 2ID6A 3ZN1A 1KU9A 2OTJI 2EZLA 5E17F 1MBJA 4GGGA 3CDLA 3VYSB 4CO8A 3AG4H 4RAYA 2EV0A 3EUAA 4GRIA 4EV0A 1W7PB 1TTYA 4M3EA 3W3CA 5ED4A 2I10A 2IBDA 2VJ5A 1R49A 2LRDA 3RKYA 1MMGA 3OR2C 4Q4ZF 3OYDA 2A5WA 4A3CJ 1I6HJ 1YG2A 3ZRGA 2F5EA 3BG9A 1UJ8A 1I39A 5E1ZB 2PMZN 2EB7A 2CQKA 4MLOA 1N25A 5D5VB 4EGYA 3GTGJ 4NBQA 2CW8A 1ETOA 3OYJA 4LB5A 3RPQA 2Z99A 4F7ZA 1KU7A 1MMAA 3F8NA 2WV1A 3GBGA 2VQLA 4PJMA 4L0ZB 2Y0SN 3KETA 3I55I 3BR1A 5B5EC 4UUVA 1B9MA 3V4GA 2ELJA 3S15J 4RB2C 1ORKA 4ZH4F 1K4TA 3HOWJ 3ZCOA 2VBXA 3HOYJ 2KRHA 1W7PA 2R7DA 3DBHB 1HSTA 3K7AJ 3VDXA 2E5NA 2RQQA 2K02A 3H35A 5HLGA 3DU5A 2HDWA 3OYKA 3KLNA 1D1CA 2HOSA 3P9IA 1MDMA 3GF2A 4XLAA 4BHPA 1BI3A 3M8FA 4AVPA 2RREA 5J4VA 2JWTA 1TWGJ 3KYDB 2L7KA 4UB6C 3U21A 2A69F 4I01A 1O7FA 4HLXA 1JXSA 1S7AA 4Y15A 3SZTA 5JLXA 3LA2A 2V1DA 2IT0A 2RNJA 3BR2A 3ELKA 4Y7NJ 1E17A 3FXQA 2F4OB 1GV5A 4EJWA 3QAHA 2NYXA 1SANA 3QU6A 1WI9A 2KRFA 2BGCA 3Q9SA 2L4MA 3TW6A 3HOZJ 2ZB9A 3BPVA 3CJTB 1UG2A 2DA1A 4DOZA 3GLXA 4B44A 3E6DA 1Q1HA 3A0BC 3MZYA 4JQFA 2Z33A 1NTCA 2R0QC 3AG3H 3JSOA 2AO9A 3V7CA 3RTRA 2A07F 2TDXA 3UR3C 2OZ6A 1D1BA 2HQNA 4QWQA 2QEXI 4H4KC 2YX7A 4XKBA 3ULQB 2R7UA 3MFKA 1K61A 2UZKA 3HJEA 4LLGF 1OYYA 5FLXK 2Q1ZB 1JI8A 1N75A 1X4PA 1RIOH 1GHCA 1OR7A 2KKOA 4IZZA 4BQAA 3RZOJ 4HX8A 2CS3A 1S6LA 3O8GA 3SFZA 2O7OA 1P4AA 1SFUA 3K4CA 4RAFA 3ZMTA 4E7LA 4YRVA 3L2WA 1Y39A 2L02A 2P4WA 5FRMA 2LKXA 2X51A 2VONA 3F8BA 3K4NA 5AONA 3BROA 4BACA 1FP1D 3E1SA
chains in the Genus database with same CATH topology
5AIQA 3EYIA 1ONVA 3GWZA 3J80K 2GIVA 2F2EA 2FE3A 1REPC 1SD4A 4I02A 1YO5C 3QPHA 4R8HA 3IWZA 4YFNF 5F1RA 3MWMA 1G3YA 1GXQA 4OMZA 2A61A 4XBFA 2GXGA 1IXSB 4M73A 4A12A 5LHHA 5KVRA 2MH9A 4P9FA 2C6YA 2XAHA 2XAJA 4O5VA 5K1YA 4M72A 1QPMA 4L9VA 1S29A 4KNYA 3DF8A 1J59A 2OQGA 2QYOA 1R00A 3MCZA 3TDUC 3ZMUA 4IRHA 1XGMA 2H27A 2XAQA 5D4RA 1TNSA 2OBPA 3DFGA 1FYKA 3H3UA 2GQQA 4HX4A 2GA1A 1KQ9A 2ZCWA 3U1DA 1S8NA 2Z3YA 2GAUA 3I5UA 3F8CA 4OIRF 3ISPA 3MEXA 2FF4A 3WU0A 3SXYA 1F9NA 4OMYA 5D4SA 5FB2A 3I0TA 2RV8A 1R1VA 4KMFA 2ZKZA 2LNBA 2JSCA 3WG9A 1XGNA 3F23A 1FP2A 3D0SA 2JT1A 4OIPF 1OYIA 4UNOA 2OQRA 4L18B 1KQ8A 1S7OA 4YFKF 1W4MA 4WWCA 2FNAA 4G9YA 4G7OF 3GFLA 5L3BA 4AD9A 4RGRA 5ILUA 1XCVA 1I6XA 2EWNA 1BI1A 5LLQA 3B73A 2A6HF 2XV4S 3F72A 2DK5A 4HOBA 4BHCA 3K1MA 3E5UA 2JPBA 2EA2A 5BPIA 5EEHA 1UCRA 1FNNA 3I71A 3K0LA 3I53A 1R5GA 2YU3A 4LD5A 2E7XA 2COMA 4KUMA 2MBFA 1MGTA 2HOEA 2KJCA 3DKWA 5D5WB 1J2XA 1DPRA 1KYZA 2VC1A 1KGSA 3BY6A 4QLCU 5HVQC 1VTNC 2K7LA 2VBYA 2EV5A 4YFXF 3GXOA 1XCBA 3IHUA 3E3VA 1BOAA 2RC4A 1U8RA 1FBQA 1MD0A 2M8EA 3PQJA 5K5OA 3FWEA 2GWRA 2M45A 3U2RA 4NHJA 2E1CA 4G6DA 5FD5A 4M74A 1DPUA 3T8TA 1IZ1A 1S3JA 3I59B 1LNWA 1MZBA 4DQ2A 2OAZA 3GFMA 3VODA 5BOXA 1FBSA 2G9WA 3N4MA 2Y75A 4LMYA 3T1BA 1QNTA 1AWCA 1B1BA 4RB3C 4G7ZF 4ENMA 1H9GA 3HRMA 2FNPA 3JAMZ 1Z7UA 3F8MA 1L3LA 2HYFA 2FBHA 3OV8A 4YIFA 3KZYA 3I54A 2IJLA 4IF4A 5D8LB 4ZZLA 2QQBA 3RI4A 5CJ9A 3I59A 1J7KA 4M71A 3RIRA 2CW0F 3HRSA 1R23A 5DCFA 3P7NA 1FY7A 2FOKA 2VODA 2QUFA 4OU0A 4UV8A 2HKOA 2FEZA 5L3CA 2EV6A 4RS8A 4EQQA 3L00A 1W5SA 4NQWA 3KP4A 1IN7A 1SMYF 2E7WA 2ADUA 3KEQA 2VOOA 2XIGA 3KP5A 1JHFA 3WTYC 3JSPA 4ESJA 2M30A 1IN4A 4CICA 1ODDA 2FMYA 1P4XA 3COAC 2QBYA 2XAGA 2GA2A 3BZ6A 3ZP5A 1SMTA 3MQ0A 4OIOF 3LWFA 4HW0A 4A0ZA 1T98A 1IXRC 1PP7U 1YW9A 2EFOA 3CUOA 3FMSA 5HLIA 1J75A 4Q5SF 4KN4X 2PG4A 4M6XA 3T0YA 1TW2A 4I0AA 2CYYA 3RKXA 1FBUA 5LRRA 1G4DA 2L3DA 2DFIA 3M8EA 3WTUC 3CUQC 5AIPA 5IT9K 3PFIA 5A2QZ 3L7WA 1TW3A 3LFKA 3R0AA 2WWYA 4ESBA 1HW2A 3KP2A 2MD5A 2PFBA 1LQ1A 2P8TA 4HYEA 4YIIA 1O3RA 1LDJA 3BOQA 5LRSA 3T8RA 3WGIA 2M5WA 2XHKA 2D2WA 3RJPA 4HV6A 4I7HA 6PAXA 2Y48A 1E2XA 1FWZA 5LBQA 1LVAA 1TQPA 4ENJA 4WXHA 4KIFA 1XMKA 2V79A 1OKRA 3EQLF 2KIUA 5HS7A 1I1SA 4KT5C 2IA0A 3DPLC 2MLKA 1BI0A 5FO5A 4P55A 4IXAA 3O3KA 2IRFG 5L3GA 3L9FA 4XSZF 3CTAA 1DDNA 3WTTC 4ASNA 1SAXA 3TKYA 3GW2A 5FD6A 5ICCA 1SD5A 4GYIA 2W57A 4L9JA 4AIJA 3NQOA 2H09A 2FBKA 3H3ZA 5CVUA 1TQMA 1ZG1A 3KCCA 4GCVA 2W25A 1U3EM 1TNTA 2VE8A 1KA8A 3LQRA 2XAFA 2P6TA 5CYVA 3G3ZA 1RNLA 3CJNA 4XLPF 5DEQA 3JW4A 4AIKA 3F8FA 3RKWA 5ILSA 2KIMA 5ICFA 3K1NA 3FMQA 5L3DA 1MDMB 4M9ZA 2YSRA 3BDDA 2MLGA 2D1HA 2HTSA 4HF0A 3LA3A 3CO7C 5FLXZ 1SFXA 2BBYA 4JK1X 3F6VA 3GEZA 1ZN2A 4CHUA 4LG0B 3K9TA 3B02A 1XN7A 2JRTA 4Z2YA 1WRJA 1WQ2A 3HSRA 3F22A 1YQAA 3ML6A 2ETHA 4XLNF 2STWA 4XSXF 3J80Z 2A68F 4H0EA 3I58A 3MZHA 2LKPA 1QO0D 3REOA 3KLOA 5J8FA 1A04A 3IKTA 1IUYA 3IKVA 4U0YA 4LG0A 1O3QA 2EFNA 2IP2A 1R1UA 1DUXC 4LLNA 2RQPA 1EH7A 4U7BA 1DP7P 2YPRA 1TLHB 3BPXA 1T0FA 4DNCA 1F5TA 2HEOA 5L3FA 4G8XA 4CYDA 3BJAA 5BS6A 3ZPLA 4HLYA 2L54A 5D5XB 2H6BA 1MKMA 1BJAA 2IVMA 2G7UA 3KP3A 2Q2EA 2P6SA 3U9GA 3QPTA 1K78A 1FLIA 3GO5A 4D0PA 5L3EA 5ICEA 3R60A 1SFEA 2FXAA 2OA4A 3DP7A 2H6CA 3WTXC 3D5LA 3HTUA 2XRNA 1TBXA 2QQAA 2RKHA 3HRUA 1FOKA 3EETA 4EJUA 4RB0A 2P5VA 2HKXA 1XD7A 2G7HA 2YR2A 4LK1F 1ON2A 1IN8A 3GZ6A 2OU2A 1XB4A 4N0BA 3KP7A 1P2FA 3C7JA 3EYYA 1T2KA 2DU9A 4U0WA 4R79A 4PGHA 4MEXF 1ULYA 3VB2A 4G6QA 1ZREA 5E8GA 1R7JA 2VC0A 3F21A 2EJRA 1STZA 1FYMA 2DI3A 2Y0MA 3WTSC 3CUQB 1B6AA 2MA3A 3WU1B 3NEUA 3FX3A 1V3FA 3T5XA 1ZGJA 2RVCA 3DQVC 5H6QA 1Z91A 4MTDA 3FMRA 5CVRA 2ZBKA 4A0YA 2Z9OA 1L0OC 4UXNA 1ZG3A 2NRAC 5E18F 2NNNA 5BMZA 2A6EF 1W5TA 1UB9A 2HFHA 5J6XA 3E5QA 1ZRDA 3ROUA 5LEJA 1FC3A 3CUQA 1MJ9A 4K2EA 1J0RA 3HOTA 3SHFA 4GO1A 4MQVA 2MH2A 2DQLA 5HOOA 3ECOA 5CVIA 4O3MA 5CLSA 2EK5A 1D8JA 1YFHA 3GUDA 4CXFA 2F5FA 1R22A 4BNCA 1IRFA 3HUGA 4KDPA 2ELHA 3HIFA 5ILVA 3ERED 2D45A 2H94A 1YS7A 3TDZC 3KP6A 1FPQA 5EEGA 4HBLA 4RAZA 2OZUA 2PI0A 3CDHA 3FM3A 2JPCA 2VOPA 2ZO4A 4HA8A 4I0BA 1V4RA 3O2PE 1Z05A 1SD6A 3C18A 1HKTA 5FFXA 4HDVA 1U5TC 2FU4A 5DYMA 1ZRCA 4G94A 1R1TA 4KA4A 2ESHA 4R1HA 4NB5A 4EM0B 1F4KA 1WSUA 4M9SA 4A5NA 4M9XA 2FA5A 1GXPA 3QOPA 4ZYEA 2WTEA 4B8XA 4OOIA 2RN7A 1ZYRF 5K5RA 4HV5A 1J9IA 1BBYA 3DXJF 4MTEA 2CGPA 1BC8C 4Q47A 2VBZA 4CDGA 4KN7X 1YIOA 1D5VA 1KU3A 1FSEA 2MC3A 3FXUA 1ZRFA 3GVAA 1ZGAA 1USSA 3TOAA 1FX7A 3I4PA 1BIAA 1KU2A 3CLOA 3V8LA 1LDKB 4HAMA 1QBJA 2Q8KA 2DPDA 2XASA 4AIHA 3DPTA 5IT3A 2QBYB 1T6SA 1PP8F 2CG4A 2QM3A 3E5XA 3R6SA 3GZ5A 2XVCA 5IT9Z 2UXNA 1G6NA 1MJAA 3KFWX 2HYGD 3IRQA 2NAZA 3P9CA 2ZNYA 4MQ9F 1USTA 1RUNA 3IWFA 3TO7A 2O3FA 5D8KB 1O57A 1BC7C 2L4AA 1FYLA 2J5PA 5D6FA 3O6BB 3QP5A 1B59A 3Q9VA 5JFRA 2XUBA 1EV7A 4KICA 3R61A 5HS9A 1P6RA 4MGRA 2PMUA 2XGXA 2FMLA 2VT2A 1I5ZA 4I09A 1U2WA 2J5OA 1IN5A 1I1GA 1HBXG 3K69A 4L5IA 4BHBA 1ZLKA 4ENNA 2PBIA 3TOBA 1HKSA 1K7AA 5F6FA 3NRVA 4A6DA 2XROA 3HTSB 3V7SA 4LLLA 2O8XA 4ZYHA 5FFZA 3HOSA 2EA4A 4HDUA 1X3UA 2X4HA 4U7DA 2E1NA 2VBWA 1Y0UA 2L01A 4KFCA 5JI6A 4UHTA 3OOPA 4S04A 1OYWA 1ZG5A 3J81K 3G73A 5A2QK 3J7AO 3LAJA 3C1DA 3ZMDA 3WODF 3WTZA 2RDPA 2W84A 1JE8A 1IAWA 1K79A 2UXXA 2EFQA 2K27A 3RYPA 3GFJA 3RPUA 3E97A 3HHHA 2FSWA 3HRTA 3VEPA 1YW7A 1OMIA 1C0WA 3DV8A 2CFXA 4EM2A 5HDKA 4RGUA 2ESNA 4IHSA 2D1VA 2VN2A 4Y13A 4PZJA 2BYVE 3FZVA 3WE2A 4UV9A 2Q0OA 3LA7A 1XSDA 3ABUA 3SZPA 5DUIA 2V9VA 3RDIA 1G3SA 2WC2A 3W6KB 3MAJA 4A2UA 3V8JA 1YYVA 3EDPA 3M9AA 2VT3A 2DQRA 2DO7A 1U5TB 3GYHX 2O0YA 4ZZDA 2GZWA 2DBBA 3FHZA 1TQIA 4IHTA 2LSOA 1XSVA 4FX0A 1MJBA 3H92A 5DCMB 1QGPA 5JR3A 4RGSA 2A3SA 2AXLA 3WGHA 3L09A 1K78B 2K86A 3C3WA 4B09A 1HW5A 3WGGA 4RGXA 3TO6A 3R0JA 2QLZA 2NNYA 1U5TA 5K5QA 2ISZA 1D8KA 3I64A 1PUEE 3E6CC 4HF1A 5DCMA 2BEOA 4KIGA 3VOEA 5LGNA 4WF2A 1QZYA 4MNUA 4UVCA 2QVOA 3QRFF 3V8KA 3W6JB 1WKMA 2FRHA 4HF2A 2PMHA 1CF7B 1BI2A 2DW4A 4A0XA 5LHGA 1I27A 1IRGA 2VXZA 3K1PA 2AS5F 4N9IA 4A6EA 3TO9A 3ECHA 2P5KA 3IRRA 5FGMA 3L2CA 2FBIA 5E8IA 4WCGA 2JZYA 1CF7A 3LQQA 4KIBA 1YS6A 5D5UB 1LDDA 4WXDA 1ZH5A 3SQNA 3WTVC 3F6OA 1XSXA 5LGTA 1U78A 2GXBA 5ICGA 1IF1A 1ZAOA 4ENKA 1JGSA 1ZARA 2DK8A 4IJAA 5E1XA 3LAPA 4ETSA 1R5HA 1W7PD 4WK8F 1QZZA 4O6JA 3KEOA 3GFIA 2CWEA 5CVVA 1LEAA 1ON1A 5KK1A 4MHGA 4EM1A 1LJ9A 1QQIA 4OINF 2JTVA 2WV0A 4JBAA 4EVIA 1FZPB 2DPUA 2B0LA 2QZ8A 3EUHA 4P96A 4UVAA 3FF5A 1R36A 4RB1A 1RUOA 2Z5UA 4L5JA 2NS0A 4IRGA 2DLLA 3ZMSA 2A5YB 4S05A 1H9TA 2V1UA 4HX7A 3M7GA 4IRIA 4FX4A 3HSEA 2ZXJA 4LK0F 4ZYGA 3N97A 1NHAA 2RGVA 1SD7A 3HSFA 2LDUA 1HSJA 2LF7A 4E70A 1OPCA 1UHMA 3JTHA 2BV6A 1UHWA 1BIBA 1LB2A 3P9KA 4ZYDA 2V1XA 4Q48A 2K4JA 4MEYF 2XKOA 3Q5FA 4L0YB 3TGNA 2F5CA 3RYRA 2HS5A 4U0VA 3ZQ7A 3E6MA 2ZJ2A 3BJOA 3BWGA 1O7LA 4OIQF 1G3TA 3HHGA 3K2ZA 1IN6A 2YX4A 2ZNZA 4EGZA 2QWWA 4HQEA 1F1ZA 3KZZA 3R4KA 3F3XA 3GX4X 1HXDA 3TQNA 1BN5A 5HDNA 2M87A 2BE5F 4PGGA 1JHHA 3M1EA 1YLFA 1LEBA 1H0MA 1FSHA 1Z1DA 3BJ6A 4IVNA 1J5YA 2ACJA 1B9NA 4I2OA 2DTRA 2QQ9A 3FM5A 2F5DA 4PCQA 3CO6C 1KQ0A 1XMAA 1D3YA 1XGSA 4HQMA 2W24A 1XDUA 2K4BA 1HW1A 2KJBA 3HYIA 5JHUA 2ZMEB 2HZTA 4XRFA 4PDKA 2PN6A 1T38A 4TV7A 4N9HA 4ON0A 1B4AA 1RI7A 1Z6TA 5E20A 5HDGA 2IW5A 4P5OA 4I98B 1KYWA 4IPAA 2IPQX 2KIFA 1GVJA 1IW7F 2HTJA 3QU3A 4L9NA 4Y17A 1R58A 1U6GA 2R7FA 1Z6RA 5D6EA 2PJPA 2QENA 4CZZA 1FT9A 1HQCA 1WWXA 2ZMEA 3FXRA 5TJJA 4KYWA 3AAFA 4GXOA 4LJZF 3KE2A 1HKQA 5DDGA 4EJTA 2P7VB 1XDSA 2ZFWA 1ZLJA 1K6OA 2HR3A 4CGZA 5LGUA 2FQ3A 5DD4A 3ZMVA 1T39A 5DD8A 3JAMK 5BQTA 4UVBA 3ABTA 4GYGA 3PQKA 2PQ8A 5J8CA 2HGCA 4AWXB 2M1BA 2V6CA 4P9UA 2PEXA 5H6RA 1P92A 5HS8A 2O03A 1PDNC 5H20A 2IA2A 1RZ4A 5LHIA 5LEKA 2CSOA 2HWVA 5TRDA 3J81Z 4ESFA 4BH9A 4FHTA 4LB6B 1UFMA 2X0LA 4EJVA 3WTWC 1XGOA 3DEUA 3VFZA 1IXCA 2R3SA 3V7RA 4EJOA 1G3WA 4BAYA 2W85A 2PLYA 3JTGA 5HLHA 4G7HF 4EMSA 2EFWA 1ZHFA 5BPDA 4BYYA 1AOYA 4BXUA 3IC7A 1BM9A 4A5MA 2IA1A 4KMUX 1O3TA 3S2WA 4YG2F 4WX9A 5DV5A 2EFPA 2DT5A 3E6BA 4WXCA 5JVTA 5DUKA 2O61A 3ZMZA 3BP8A 3LSTA 3QP6A 4M6YA 1YW8A 3WE3A 5E1WA 2ISYA 1CGPA 5ERIA 4L9TA 1P4WA 2HQRA 1YTYA 2P5LC 2LF8A 2CO5A 2OD5A 4U88A 4HZFA 2STTA 5CVJA 1Z9CA 4FT8A 2HDCA 1O3SA 1EH8A 4LGWA 4LFUA 2XKPA 2P7CB 2DAOA 3IL2A 2VE9A 2O6GE 3ZN0A 1EH6A 5F64A 2UWMA 3ZN1A 1KU9A 5E17F 4GGGA 4CO8A 4RAYA 2EV0A 4EV0A 1W7PB 1TTYA 5ED4A 3RKYA 4Q4ZF 1YG2A 2F5EA 5E1ZB 2EB7A 2CQKA 5D5VB 4EGYA 4LB5A 3RPQA 2Z99A 4F7ZA 1KU7A 3F8NA 4L0ZB 3KETA 4UUVA 1B9MA 3V4GA 4RB2C 4ZH4F 2VBXA 1W7PA 2R7DA 1HSTA 2K02A 5HLGA 3KLNA 3P9IA 1MDMA 3GF2A 4BHPA 1BI3A 3M8FA 4AVPA 2A69F 4I01A 1O7FA 4HLXA 1JXSA 1S7AA 4Y15A 3SZTA 3LA2A 2V1DA 2IT0A 2RNJA 3ELKA 1E17A 3FXQA 4EJWA 3QAHA 2NYXA 3QU6A 1WI9A 2KRFA 2BGCA 3Q9SA 2L4MA 3BPVA 3GLXA 3E6DA 1Q1HA 3MZYA 4JQFA 2Z33A 3JSOA 3V7CA 3RTRA 2A07F 2TDXA 2OZ6A 2HQNA 4QWQA 2YX7A 3ULQB 3MFKA 2UZKA 4LLGF 1OYYA 5FLXK 1RIOH 1GHCA 1OR7A 2KKOA 4BQAA 4HX8A 1S6LA 3SFZA 1P4AA 1SFUA 3ZMTA 2L02A 2P4WA 2VONA 3F8BA 5AONA 3BROA 1FP1D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AIQ A;  3EYI A;  1ONV A;  3GWZ A;  3J80 K;  2GIV A;  2F2E A;  2FE3 A;  1REP C;  1SD4 A;  4I02 A;  1YO5 C;  3QPH A;  4R8H A;  3IWZ A;  4YFN F;  5F1R A;  3MWM A;  1G3Y A;  1GXQ A;  4OMZ A;  2A61 A;  4XBF A;  2GXG A;  1IXS B;  4M73 A;  4A12 A;  5LHH A;  5KVR A;  2MH9 A;  4P9F A;  2C6Y A;  2XAH A;  2XAJ A;  4O5V A;  5K1Y A;  4M72 A;  1QPM A;  4L9V A;  1S29 A;  4KNY A;  3DF8 A;  1J59 A;  2OQG A;  2QYO A;  1R00 A;  3MCZ A;  3TDU C;  3ZMU A;  4IRH A;  1XGM A;  2H27 A;  2XAQ A;  5D4R A;  1TNS A;  2OBP A;  3DFG A;  1FYK A;  3H3U A;  2GQQ A;  4HX4 A;  2GA1 A;  1KQ9 A;  2ZCW A;  3U1D A;  1S8N A;  2Z3Y A;  2GAU A;  3I5U A;  3F8C A;  4OIR F;  3ISP A;  3MEX A;  2FF4 A;  3WU0 A;  3SXY A;  1F9N A;  4OMY A;  5D4S A;  5FB2 A;  3I0T A;  2RV8 A;  1R1V A;  4KMF A;  2ZKZ A;  2LNB A;  2JSC A;  3WG9 A;  1XGN A;  3F23 A;  1FP2 A;  3D0S A;  2JT1 A;  4OIP F;  1OYI A;  4UNO A;  2OQR A;  4L18 B;  1KQ8 A;  1S7O A;  4YFK F;  1W4M A;  4WWC A;  2FNA A;  4G9Y A;  4G7O F;  3GFL A;  5L3B A;  4AD9 A;  4RGR A;  5ILU A;  1XCV A;  1I6X A;  2EWN A;  1BI1 A;  5LLQ A;  3B73 A;  2A6H F;  2XV4 S;  3F72 A;  2DK5 A;  4HOB A;  4BHC A;  3K1M A;  3E5U A;  2JPB A;  2EA2 A;  5BPI A;  5EEH A;  1UCR A;  1FNN A;  3I71 A;  3K0L A;  3I53 A;  1R5G A;  2YU3 A;  4LD5 A;  2E7X A;  2COM A;  4KUM A;  2MBF A;  1MGT A;  2HOE A;  2KJC A;  3DKW A;  5D5W B;  1J2X A;  1DPR A;  1KYZ A;  2VC1 A;  1KGS A;  3BY6 A;  4QLC U;  5HVQ C;  1VTN C;  2K7L A;  2VBY A;  2EV5 A;  4YFX F;  3GXO A;  1XCB A;  3IHU A;  3E3V A;  1BOA A;  2RC4 A;  1U8R A;  1FBQ A;  1MD0 A;  2M8E A;  3PQJ A;  5K5O A;  3FWE A;  2GWR A;  2M45 A;  3U2R A;  4NHJ A;  2E1C A;  4G6D A;  5FD5 A;  4M74 A;  1DPU A;  3T8T A;  1IZ1 A;  1S3J A;  3I59 B;  1LNW A;  1MZB A;  4DQ2 A;  2OAZ A;  3GFM A;  3VOD A;  5BOX A;  1FBS A;  2G9W A;  3N4M A;  2Y75 A;  4LMY A;  3T1B A;  1QNT A;  1AWC A;  1B1B A;  4RB3 C;  4G7Z F;  4ENM A;  1H9G A;  3HRM A;  2FNP A;  3JAM Z;  1Z7U A;  3F8M A;  1L3L A;  2HYF A;  2FBH A;  3OV8 A;  4YIF A;  3KZY A;  3I54 A;  2IJL A;  4IF4 A;  5D8L B;  4ZZL A;  2QQB A;  3RI4 A;  5CJ9 A;  3I59 A;  1J7K A;  4M71 A;  3RIR A;  2CW0 F;  3HRS A;  1R23 A;  5DCF A;  3P7N A;  1FY7 A;  2FOK A;  2VOD A;  2QUF A;  4OU0 A;  4UV8 A;  2HKO A;  2FEZ A;  5L3C A;  2EV6 A;  4RS8 A;  4EQQ A;  3L00 A;  1W5S A;  4NQW A;  3KP4 A;  1IN7 A;  1SMY F;  2E7W A;  2ADU A;  3KEQ A;  2VOO A;  2XIG A;  3KP5 A;  1JHF A;  3WTY C;  3JSP A;  4ESJ A;  2M30 A;  1IN4 A;  4CIC A;  1ODD A;  2FMY A;  1P4X A;  3COA C;  2QBY A;  2XAG A;  2GA2 A;  3BZ6 A;  3ZP5 A;  1SMT A;  3MQ0 A;  4OIO F;  3LWF A;  4HW0 A;  4A0Z A;  1T98 A;  1IXR C;  1PP7 U;  1YW9 A;  2EFO A;  3CUO A;  3FMS A;  5HLI A;  1J75 A;  4Q5S F;  4KN4 X;  2PG4 A;  4M6X A;  3T0Y A;  1TW2 A;  4I0A A;  2CYY A;  3RKX A;  1FBU A;  5LRR A;  1G4D A;  2L3D A;  2DFI A;  3M8E A;  3WTU C;  3CUQ C;  5AIP A;  5IT9 K;  3PFI A;  5A2Q Z;  3L7W A;  1TW3 A;  3LFK A;  3R0A A;  2WWY A;  4ESB A;  1HW2 A;  3KP2 A;  2MD5 A;  2PFB A;  1LQ1 A;  2P8T A;  4HYE A;  4YII A;  1O3R A;  1LDJ A;  3BOQ A;  5LRS A;  3T8R A;  3WGI A;  2M5W A;  2XHK A;  2D2W A;  3RJP A;  4HV6 A;  4I7H A;  6PAX A;  2Y48 A;  1E2X A;  1FWZ A;  5LBQ A;  1LVA A;  1TQP A;  4ENJ A;  4WXH A;  4KIF A;  1XMK A;  2V79 A;  1OKR A;  3EQL F;  2KIU A;  5HS7 A;  1I1S A;  4KT5 C;  2IA0 A;  3DPL C;  2MLK A;  1BI0 A;  5FO5 A;  4P55 A;  4IXA A;  3O3K A;  2IRF G;  5L3G A;  3L9F A;  4XSZ F;  3CTA A;  1DDN A;  3WTT C;  4ASN A;  1SAX A;  3TKY A;  3GW2 A;  5FD6 A;  5ICC A;  1SD5 A;  4GYI A;  2W57 A;  4L9J A;  4AIJ A;  3NQO A;  2H09 A;  2FBK A;  3H3Z A;  5CVU A;  1TQM A;  1ZG1 A;  3KCC A;  4GCV A;  2W25 A;  1U3E M;  1TNT A;  2VE8 A;  1KA8 A;  3LQR A;  2XAF A;  2P6T A;  5CYV A;  3G3Z A;  1RNL A;  3CJN A;  4XLP F;  5DEQ A;  3JW4 A;  4AIK A;  3F8F A;  3RKW A;  5ILS A;  2KIM A;  5ICF A;  3K1N A;  3FMQ A;  5L3D A;  1MDM B;  4M9Z A;  2YSR A;  3BDD A;  2MLG A;  2D1H A;  2HTS A;  4HF0 A;  3LA3 A;  3CO7 C;  5FLX Z;  1SFX A;  2BBY A;  4JK1 X;  3F6V A;  3GEZ A;  1ZN2 A;  4CHU A;  4LG0 B;  3K9T A;  3B02 A;  1XN7 A;  2JRT A;  4Z2Y A;  1WRJ A;  1WQ2 A;  3HSR A;  3F22 A;  1YQA A;  3ML6 A;  2ETH A;  4XLN F;  2STW A;  4XSX F;  3J80 Z;  2A68 F;  4H0E A;  3I58 A;  3MZH A;  2LKP A;  1QO0 D;  3REO A;  3KLO A;  5J8F A;  1A04 A;  3IKT A;  1IUY A;  3IKV A;  4U0Y A;  4LG0 A;  1O3Q A;  2EFN A;  2IP2 A;  1R1U A;  1DUX C;  4LLN A;  2RQP A;  1EH7 A;  4U7B A;  1DP7 P;  2YPR A;  1TLH B;  3BPX A;  1T0F A;  4DNC A;  1F5T A;  2HEO A;  5L3F A;  4G8X A;  4CYD A;  3BJA A;  5BS6 A;  3ZPL A;  4HLY A;  2L54 A;  5D5X B;  2H6B A;  1MKM A;  1BJA A;  2IVM A;  2G7U A;  3KP3 A;  2Q2E A;  2P6S A;  3U9G A;  3QPT A;  1K78 A;  1FLI A;  3GO5 A;  4D0P A;  5L3E A;  5ICE A;  3R60 A;  1SFE A;  2FXA A;  2OA4 A;  3DP7 A;  2H6C A;  3WTX C;  3D5L A;  3HTU A;  2XRN A;  1TBX A;  2QQA A;  2RKH A;  3HRU A;  1FOK A;  3EET A;  4EJU A;  4RB0 A;  2P5V A;  2HKX A;  1XD7 A;  2G7H A;  2YR2 A;  4LK1 F;  1ON2 A;  1IN8 A;  3GZ6 A;  2OU2 A;  1XB4 A;  4N0B A;  3KP7 A;  1P2F A;  3C7J A;  3EYY A;  1T2K A;  2DU9 A;  4U0W A;  4R79 A;  4PGH A;  4MEX F;  1ULY A;  3VB2 A;  4G6Q A;  1ZRE A;  5E8G A;  1R7J A;  2VC0 A;  3F21 A;  2EJR A;  1STZ A;  1FYM A;  2DI3 A;  2Y0M A;  3WTS C;  3CUQ B;  1B6A A;  2MA3 A;  3WU1 B;  3NEU A;  3FX3 A;  1V3F A;  3T5X A;  1ZGJ A;  2RVC A;  3DQV C;  5H6Q A;  1Z91 A;  4MTD A;  3FMR A;  5CVR A;  2ZBK A;  4A0Y A;  2Z9O A;  1L0O C;  4UXN A;  1ZG3 A;  2NRA C;  5E18 F;  2NNN A;  5BMZ A;  2A6E F;  1W5T A;  1UB9 A;  2HFH A;  5J6X A;  3E5Q A;  1ZRD A;  3ROU A;  5LEJ A;  1FC3 A;  3CUQ A;  1MJ9 A;  4K2E A;  1J0R A;  3HOT A;  3SHF A;  4GO1 A;  4MQV A;  2MH2 A;  2DQL A;  5HOO A;  3ECO A;  5CVI A;  4O3M A;  5CLS A;  2EK5 A;  1D8J A;  1YFH A;  3GUD A;  4CXF A;  2F5F A;  1R22 A;  4BNC A;  1IRF A;  3HUG A;  4KDP A;  2ELH A;  3HIF A;  5ILV A;  3ERE D;  2D45 A;  2H94 A;  1YS7 A;  3TDZ C;  3KP6 A;  1FPQ A;  5EEG A;  4HBL A;  4RAZ A;  2OZU A;  2PI0 A;  3CDH A;  3FM3 A;  2JPC A;  2VOP A;  2ZO4 A;  4HA8 A;  4I0B A;  1V4R A;  3O2P E;  1Z05 A;  1SD6 A;  3C18 A;  1HKT A;  5FFX A;  4HDV A;  1U5T C;  2FU4 A;  5DYM A;  1ZRC A;  4G94 A;  1R1T A;  4KA4 A;  2ESH A;  4R1H A;  4NB5 A;  4EM0 B;  1F4K A;  1WSU A;  4M9S A;  4A5N A;  4M9X A;  2FA5 A;  1GXP A;  3QOP A;  4ZYE A;  2WTE A;  4B8X A;  4OOI A;  2RN7 A;  1ZYR F;  5K5R A;  4HV5 A;  1J9I A;  1BBY A;  3DXJ F;  4MTE A;  2CGP A;  1BC8 C;  4Q47 A;  2VBZ A;  4CDG A;  4KN7 X;  1YIO A;  1D5V A;  1KU3 A;  1FSE A;  2MC3 A;  3FXU A;  1ZRF A;  3GVA A;  1ZGA A;  1USS A;  3TOA A;  1FX7 A;  3I4P A;  1BIA A;  1KU2 A;  3CLO A;  3V8L A;  1LDK B;  4HAM A;  1QBJ A;  2Q8K A;  2DPD A;  2XAS A;  4AIH A;  3DPT A;  5IT3 A;  2QBY B;  1T6S A;  1PP8 F;  2CG4 A;  2QM3 A;  3E5X A;  3R6S A;  3GZ5 A;  2XVC A;  5IT9 Z;  2UXN A;  1G6N A;  1MJA A;  3KFW X;  2HYG D;  3IRQ A;  2NAZ A;  3P9C A;  2ZNY A;  4MQ9 F;  1UST A;  1RUN A;  3IWF A;  3TO7 A;  2O3F A;  5D8K B;  1O57 A;  1BC7 C;  2L4A A;  1FYL A;  2J5P A;  5D6F A;  3O6B B;  3QP5 A;  1B59 A;  3Q9V A;  5JFR A;  2XUB A;  1EV7 A;  4KIC A;  3R61 A;  5HS9 A;  1P6R A;  4MGR A;  2PMU A;  2XGX A;  2FML A;  2VT2 A;  1I5Z A;  4I09 A;  1U2W A;  2J5O A;  1IN5 A;  1I1G A;  1HBX G;  3K69 A;  4L5I A;  4BHB A;  1ZLK A;  4ENN A;  2PBI A;  3TOB A;  1HKS A;  1K7A A;  5F6F A;  3NRV A;  4A6D A;  2XRO A;  3HTS B;  3V7S A;  4LLL A;  2O8X A;  4ZYH A;  5FFZ A;  3HOS A;  2EA4 A;  4HDU A;  1X3U A;  2X4H A;  4U7D A;  2E1N A;  2VBW A;  1Y0U A;  2L01 A;  4KFC A;  5JI6 A;  4UHT A;  3OOP A;  4S04 A;  1OYW A;  1ZG5 A;  3J81 K;  3G73 A;  5A2Q K;  3J7A O;  3LAJ A;  3C1D A;  3ZMD A;  3WOD F;  3WTZ A;  2RDP A;  2W84 A;  1JE8 A;  1IAW A;  1K79 A;  2UXX A;  2EFQ A;  2K27 A;  3RYP A;  3GFJ A;  3RPU A;  3E97 A;  3HHH A;  2FSW A;  3HRT A;  3VEP A;  1YW7 A;  1OMI A;  1C0W A;  3DV8 A;  2CFX A;  4EM2 A;  5HDK A;  4RGU A;  2ESN A;  4IHS A;  2D1V A;  2VN2 A;  4Y13 A;  4PZJ A;  2BYV E;  3FZV A;  3WE2 A;  4UV9 A;  2Q0O A;  3LA7 A;  1XSD A;  3ABU A;  3SZP A;  5DUI A;  2V9V A;  3RDI A;  1G3S A;  2WC2 A;  3W6K B;  3MAJ A;  4A2U A;  3V8J A;  1YYV A;  3EDP A;  3M9A A;  2VT3 A;  2DQR A;  2DO7 A;  1U5T B;  3GYH X;  2O0Y A;  4ZZD A;  2GZW A;  2DBB A;  3FHZ A;  1TQI A;  4IHT A;  2LSO A;  1XSV A;  4FX0 A;  1MJB A;  3H92 A;  5DCM B;  1QGP A;  5JR3 A;  4RGS A;  2A3S A;  2AXL A;  3WGH A;  3L09 A;  1K78 B;  2K86 A;  3C3W A;  4B09 A;  1HW5 A;  3WGG A;  4RGX A;  3TO6 A;  3R0J A;  2QLZ A;  2NNY A;  1U5T A;  5K5Q A;  2ISZ A;  1D8K A;  3I64 A;  1PUE E;  3E6C C;  4HF1 A;  5DCM A;  2BEO A;  4KIG A;  3VOE A;  5LGN A;  4WF2 A;  1QZY A;  4MNU A;  4UVC A;  2QVO A;  3QRF F;  3V8K A;  3W6J B;  1WKM A;  2FRH A;  4HF2 A;  2PMH A;  1CF7 B;  1BI2 A;  2DW4 A;  4A0X A;  5LHG A;  1I27 A;  1IRG A;  2VXZ A;  3K1P A;  2AS5 F;  4N9I A;  4A6E A;  3TO9 A;  3ECH A;  2P5K A;  3IRR A;  5FGM A;  3L2C A;  2FBI A;  5E8I A;  4WCG A;  2JZY A;  1CF7 A;  3LQQ A;  4KIB A;  1YS6 A;  5D5U B;  1LDD A;  4WXD A;  1ZH5 A;  3SQN A;  3WTV C;  3F6O A;  1XSX A;  5LGT A;  1U78 A;  2GXB A;  5ICG A;  1IF1 A;  1ZAO A;  4ENK A;  1JGS A;  1ZAR A;  2DK8 A;  4IJA A;  5E1X A;  3LAP A;  4ETS A;  1R5H A;  1W7P D;  4WK8 F;  1QZZ A;  4O6J A;  3KEO A;  3GFI A;  2CWE A;  5CVV A;  1LEA A;  1ON1 A;  5KK1 A;  4MHG A;  4EM1 A;  1LJ9 A;  1QQI A;  4OIN F;  2JTV A;  2WV0 A;  4JBA A;  4EVI A;  1FZP B;  2DPU A;  2B0L A;  2QZ8 A;  3EUH A;  4P96 A;  4UVA A;  3FF5 A;  1R36 A;  4RB1 A;  1RUO A;  2Z5U A;  4L5J A;  2NS0 A;  4IRG A;  2DLL A;  3ZMS A;  2A5Y B;  4S05 A;  1H9T A;  2V1U A;  4HX7 A;  3M7G A;  4IRI A;  4FX4 A;  3HSE A;  2ZXJ A;  4LK0 F;  4ZYG A;  3N97 A;  1NHA A;  2RGV A;  1SD7 A;  3HSF A;  2LDU A;  1HSJ A;  2LF7 A;  4E70 A;  1OPC A;  1UHM A;  3JTH A;  2BV6 A;  1UHW A;  1BIB A;  1LB2 A;  3P9K A;  4ZYD A;  2V1X A;  4Q48 A;  2K4J A;  4MEY F;  2XKO A;  3Q5F A;  4L0Y B;  3TGN A;  2F5C A;  3RYR A;  2HS5 A;  4U0V A;  3ZQ7 A;  3E6M A;  2ZJ2 A;  3BJO A;  3BWG A;  1O7L A;  4OIQ F;  1G3T A;  3HHG A;  3K2Z A;  1IN6 A;  2YX4 A;  2ZNZ A;  4EGZ A;  2QWW A;  4HQE A;  1F1Z A;  3KZZ A;  3R4K A;  3F3X A;  3GX4 X;  1HXD A;  3TQN A;  1BN5 A;  5HDN A;  2M87 A;  2BE5 F;  4PGG A;  1JHH A;  3M1E A;  1YLF A;  1LEB A;  1H0M A;  1FSH A;  1Z1D A;  3BJ6 A;  4IVN A;  1J5Y A;  2ACJ A;  1B9N A;  4I2O A;  2DTR A;  2QQ9 A;  3FM5 A;  2F5D A;  4PCQ A;  3CO6 C;  1KQ0 A;  1XMA A;  1D3Y A;  1XGS A;  4HQM A;  2W24 A;  1XDU A;  2K4B A;  1HW1 A;  2KJB A;  3HYI A;  5JHU A;  2ZME B;  2HZT A;  4XRF A;  4PDK A;  2PN6 A;  1T38 A;  4TV7 A;  4N9H A;  4ON0 A;  1B4A A;  1RI7 A;  1Z6T A;  5E20 A;  5HDG A;  2IW5 A;  4P5O A;  4I98 B;  1KYW A;  4IPA A;  2IPQ X;  2KIF A;  1GVJ A;  1IW7 F;  2HTJ A;  3QU3 A;  4L9N A;  4Y17 A;  1R58 A;  1U6G A;  2R7F A;  1Z6R A;  5D6E A;  2PJP A;  2QEN A;  4CZZ A;  1FT9 A;  1HQC A;  1WWX A;  2ZME A;  3FXR A;  5TJJ A;  4KYW A;  3AAF A;  4GXO A;  4LJZ F;  3KE2 A;  1HKQ A;  5DDG A;  4EJT A;  2P7V B;  1XDS A;  2ZFW A;  1ZLJ A;  1K6O A;  2HR3 A;  4CGZ A;  5LGU A;  2FQ3 A;  5DD4 A;  3ZMV A;  1T39 A;  5DD8 A;  3JAM K;  5BQT A;  4UVB A;  3ABT A;  4GYG A;  3PQK A;  2PQ8 A;  5J8C A;  2HGC A;  4AWX B;  2M1B A;  2V6C A;  4P9U A;  2PEX A;  5H6R A;  1P92 A;  5HS8 A;  2O03 A;  1PDN C;  5H20 A;  2IA2 A;  1RZ4 A;  5LHI A;  5LEK A;  2CSO A;  2HWV A;  5TRD A;  3J81 Z;  4ESF A;  4BH9 A;  4FHT A;  4LB6 B;  1UFM A;  2X0L A;  4EJV A;  3WTW C;  1XGO A;  3DEU A;  3VFZ A;  1IXC A;  2R3S A;  3V7R A;  4EJO A;  1G3W A;  4BAY A;  2W85 A;  2PLY A;  3JTG A;  5HLH A;  4G7H F;  4EMS A;  2EFW A;  1ZHF A;  5BPD A;  4BYY A;  1AOY A;  4BXU A;  3IC7 A;  1BM9 A;  4A5M A;  2IA1 A;  4KMU X;  1O3T A;  3S2W A;  4YG2 F;  4WX9 A;  5DV5 A;  2EFP A;  2DT5 A;  3E6B A;  4WXC A;  5JVT A;  5DUK A;  2O61 A;  3ZMZ A;  3BP8 A;  3LST A;  3QP6 A;  4M6Y A;  1YW8 A;  3WE3 A;  5E1W A;  2ISY A;  1CGP A;  5ERI A;  4L9T A;  1P4W A;  2HQR A;  1YTY A;  2P5L C;  2LF8 A;  2CO5 A;  2OD5 A;  4U88 A;  4HZF A;  2STT A;  5CVJ A;  1Z9C A;  4FT8 A;  2HDC A;  1O3S A;  1EH8 A;  4LGW A;  4LFU A;  2XKP A;  2P7C B;  2DAO A;  3IL2 A;  2VE9 A;  2O6G E;  3ZN0 A;  1EH6 A;  5F64 A;  2UWM A;  3ZN1 A;  1KU9 A;  5E17 F;  4GGG A;  4CO8 A;  4RAY A;  2EV0 A;  4EV0 A;  1W7P B;  1TTY A;  5ED4 A;  3RKY A;  4Q4Z F;  1YG2 A;  2F5E A;  5E1Z B;  2EB7 A;  2CQK A;  5D5V B;  4EGY A;  4LB5 A;  3RPQ A;  2Z99 A;  4F7Z A;  1KU7 A;  3F8N A;  4L0Z B;  3KET A;  4UUV A;  1B9M A;  3V4G A;  4RB2 C;  4ZH4 F;  2VBX A;  1W7P A;  2R7D A;  1HST A;  2K02 A;  5HLG A;  3KLN A;  3P9I A;  1MDM A;  3GF2 A;  4BHP A;  1BI3 A;  3M8F A;  4AVP A;  2A69 F;  4I01 A;  1O7F A;  4HLX A;  1JXS A;  1S7A A;  4Y15 A;  3SZT A;  3LA2 A;  2V1D A;  2IT0 A;  2RNJ A;  3ELK A;  1E17 A;  3FXQ A;  4EJW A;  3QAH A;  2NYX A;  3QU6 A;  1WI9 A;  2KRF A;  2BGC A;  3Q9S A;  2L4M A;  3BPV A;  3GLX A;  3E6D A;  1Q1H A;  3MZY A;  4JQF A;  2Z33 A;  3JSO A;  3V7C A;  3RTR A;  2A07 F;  2TDX A;  2OZ6 A;  2HQN A;  4QWQ A;  2YX7 A;  3ULQ B;  3MFK A;  2UZK A;  4LLG F;  1OYY A;  5FLX K;  1RIO H;  1GHC A;  1OR7 A;  2KKO A;  4BQA A;  4HX8 A;  1S6L A;  3SFZ A;  1P4A A;  1SFU A;  3ZMT A;  2L02 A;  2P4W A;  2VON A;  3F8B A;  5AON A;  3BRO A;  1FP1 D; 
#chains in the Genus database with same CATH topology
 1MNM C;  5AIQ A;  3EYI A;  1ONV A;  3GWZ A;  5IYD J;  5IP6 A;  3J80 K;  2GIV A;  3BG3 A;  4EAT A;  2F2E A;  1GLN A;  2FE3 A;  1REP C;  2LR8 A;  3A4C A;  5J4Y A;  1SD4 A;  5KAF C;  5M5X J;  4I02 A;  1YO5 C;  3QPH A;  4R8H A;  3IWZ A;  2IEK A;  4YFN F;  5F1R A;  1D5Y A;  3MWM A;  2LYC A;  1G3Y A;  1GXQ A;  4OMZ A;  3MN2 A;  3PSF A;  2A61 A;  4XBF A;  2GXG A;  2W48 A;  3CCR I;  1IXS B;  2E5Z A;  4M73 A;  1LUJ B;  4A12 A;  2JA2 A;  5LHH A;  5KVR A;  4RMN A;  2LTP A;  4DW6 A;  2MH9 A;  4P9F A;  2C6Y A;  2IS2 A;  2XAH A;  4V2F A;  2AQF A;  2XAJ A;  4XIC A;  3VYT B;  2GOM A;  2OV7 A;  4O5V A;  1NK3 P;  2V4J C;  4CSW A;  3KPH A;  5K1Y A;  4M72 A;  1T33 A;  5F08 A;  1QPM A;  2MFZ A;  3PSI A;  4CH7 A;  3A0H C;  3OYE A;  3FDY A;  3U1K A;  4L9V A;  1S29 A;  4KNY A;  2QKL B;  1WI3 A;  2WAD A;  1YOV B;  3AKZ A;  3DF8 A;  2MW8 A;  2OQG A;  1J59 A;  4XK4 A;  9ANT A;  2QYO A;  1R00 A;  3MCZ A;  3TDU C;  3ZMU A;  1RR7 A;  1XGM A;  4IRH A;  1JTY A;  3I56 I;  4MFD A;  2H27 A;  2XAQ A;  5D4R A;  1TNS A;  4MIM A;  2OBP A;  3LOC A;  5EGO B;  1MBH A;  1WJD A;  1DU0 A;  3DFG A;  1FYK A;  1QZE A;  3H3U A;  2GQQ A;  4HX4 A;  1ETW A;  5J1U A;  2GA1 A;  2ZFU A;  3RQ4 A;  1IRX A;  1KQ9 A;  1FOY A;  4XMY A;  2ZCW A;  3U1D A;  3ZR8 X;  1S8N A;  2Z3Y A;  1LFP A;  4CCK A;  1IDY A;  1WH5 A;  2M4K A;  2GAU A;  3I5U A;  1ETY A;  1VQ7 I;  3F8C A;  4OIR F;  3ISP A;  1X2M A;  3MEX A;  1TWA J;  2V1N A;  2FF4 A;  1T8I A;  1QVU A;  5GTH C;  3WU0 A;  1Y1V J;  3M1C A;  1MIJ A;  3RZD J;  2E1M B;  3H9G A;  4JOM A;  3SXY A;  1F9N A;  4OMY A;  5D4S A;  5FB2 A;  3I0T A;  4PFO A;  3OL4 A;  4B48 A;  1IUF A;  4ZYA A;  2RV8 A;  1R1V A;  4KMF A;  2ZKZ A;  2LNB A;  3JRG A;  1X19 A;  3ABL H;  2JSC A;  2Y69 H;  3QYF A;  3IV5 A;  2EZK A;  3WG9 A;  1XGN A;  1E3O C;  5EGO A;  1U0J A;  3ZQQ A;  1Z0X A;  3ZGK A;  1ETX A;  3F23 A;  1FP2 A;  3D0S A;  2JT1 A;  5M3M J;  4BBS J;  1AU7 A;  3QPL A;  5EF6 A;  4OIP F;  1VQP I;  1J09 A;  1OYI A;  2XF7 A;  3BG6 A;  2KZG A;  2XPW A;  4UNO A;  1P9Q C;  3WU2 C;  1B72 B;  4RLQ A;  2OQR A;  2DDA A;  4L18 B;  1KQ8 A;  2PMZ A;  1S7O A;  4JX5 A;  4AC0 A;  1W4M A;  4YFK F;  2L2O A;  4WWC A;  4IX7 A;  4E7H A;  2FNA A;  5IP7 J;  2CV2 A;  4G9Y A;  4G7O F;  3GFL A;  5L3B A;  3DBR B;  4AD9 A;  4P1W A;  1S5L C;  4RGR A;  5ILU A;  1XCV A;  2L9R A;  4NDL A;  4CUG A;  2ZXI A;  1DQU A;  1I6X A;  2EWN A;  2Y0S A;  1BI1 A;  5LLQ A;  3JRD A;  3B73 A;  3K10 A;  2A6H F;  3BTI A;  2DOF A;  2XV4 S;  3F72 A;  2DK5 A;  4HOB A;  3K1M A;  4BHC A;  3E5U A;  2JPB A;  2EA2 A;  5BPI A;  3BT9 A;  5EEH A;  1UCR A;  2W4S A;  1FNN A;  2NOG A;  3I71 A;  5EDN A;  3K0L A;  3I53 A;  4XM3 A;  1R5G A;  4XLH A;  2YU3 A;  5BNG A;  3CCL I;  4DZJ A;  1JKP C;  4LD5 A;  1B72 A;  2E7X A;  2COM A;  4KUM A;  2MBF A;  1MGT A;  2HOE A;  3P5J A;  2KJC A;  4FAS D;  2HVQ A;  1IO2 A;  4B3A A;  3DKW A;  2K3P A;  5DM6 F;  5D5W B;  1J2X A;  1DPR A;  4B1R A;  2LFB A;  1KYZ A;  2VC1 A;  1KGS A;  3BY6 A;  3AG1 H;  3MMY B;  2MGQ A;  5GPA A;  2DDB A;  5GP9 A;  3ASO H;  3F9K A;  4QLC U;  5HVQ C;  1VTN C;  2K7L A;  2LMD A;  2EV5 A;  2VBY A;  4YFX F;  3GXO A;  1XCB A;  3IHU A;  4DYC A;  1BA5 A;  2ME0 A;  1AKH B;  3OYF A;  4XL9 A;  5IYB J;  2AXT C;  3CZ6 A;  1FMW A;  2EIL H;  3E3V A;  1BOA A;  2RC4 A;  3IUO A;  3AL0 C;  1U8R A;  2JN6 A;  1FBQ A;  1MD0 A;  2M8E A;  3PQJ A;  2H8W A;  3GTM J;  3LL7 A;  5E3M A;  4M3F A;  3JR9 A;  5K5O A;  4J19 A;  4UY8 I;  3H9Q A;  3FWE A;  1GV2 A;  1OQY A;  2GWR A;  4ZDP A;  1YX5 A;  2M45 A;  3MKW B;  3VYU B;  3U2R A;  1AA7 A;  1OR7 C;  3HOX J;  4NHJ A;  4ANJ A;  2E1C A;  2OTL I;  2X1E A;  4G6D A;  5FD5 A;  4M74 A;  1AKH A;  1DPU A;  2ZJR F;  3T8T A;  1IZ1 A;  1S3J A;  2JA5 J;  4ITV A;  1UG0 A;  3I59 B;  2XGD A;  5F04 A;  1LNW A;  1MZB A;  2L7Z A;  2OAZ A;  4DQ2 A;  3GFM A;  2BZT A;  2JA8 J;  3VOD A;  1IDZ A;  2W7N A;  1FBS A;  2G9W A;  5BOX A;  3QYE A;  2Y75 A;  1SVO A;  4LMY A;  1QNT A;  3T1B A;  3N4M A;  1AWC A;  1B1B A;  4RB3 C;  3A02 A;  4G7Z F;  2JUG A;  3H0D A;  4ENM A;  4IOA F;  2IS6 A;  1H9G A;  4QIW N;  3HRM A;  2JUC A;  1E3P A;  2Z1D A;  2FNP A;  3S32 A;  3KEY A;  3JAM Z;  4A3D J;  1Z7U A;  2IGO A;  3F8M A;  1L3L A;  2HYF A;  1W0T A;  2R7V A;  2FBH A;  3OV8 A;  4YIF A;  2QKM B;  2W1O A;  2L7M P;  3KZY A;  3I54 A;  2IJL A;  4IF4 A;  5D8L B;  4ZZL A;  4BXX J;  2QQB A;  3RI4 A;  5CJ9 A;  2HNH A;  5KAI C;  3SEZ A;  2R7O A;  3I59 A;  3LFU A;  1J7K A;  3IAM 2;  4M71 A;  3RIR A;  2CUE A;  3HPH A;  2CW0 F;  2E71 A;  2GXA A;  1FIA A;  3OOU A;  3OS1 A;  3HRS A;  1R23 A;  4D5F A;  4JX6 A;  5DCF A;  2MAB A;  3TMO A;  3P7N A;  2HZD A;  1FY7 A;  2EBI A;  4RM3 A;  2DT6 A;  3HXL A;  2WAF A;  1XMX A;  3S1M J;  2R5Z B;  2FOK A;  2VOD A;  2QUF A;  2LK2 A;  3BTL A;  4DIQ A;  4OU0 A;  4UV8 A;  2HKO A;  2FEZ A;  4JYK A;  3D1N I;  4RM2 A;  5L3C A;  4XRM A;  2HDD A;  1B8I A;  2LY9 A;  3S2D J;  2EV6 A;  4RS8 A;  4EQQ A;  3L00 A;  1W5S A;  2Y31 A;  2DCE A;  4NQW A;  3CJR B;  3KP4 A;  5M3F J;  1IN7 A;  1SMY F;  2E7W A;  2ADU A;  3KEQ A;  3TBI A;  2DA4 A;  3G71 I;  3VWB A;  2VOO A;  2XIG A;  4FCY A;  3KP5 A;  4I6Z A;  1JHF A;  3WTY C;  1OCZ H;  4BXF A;  3JSP A;  4ESJ A;  4BUP A;  2M30 A;  1IN4 A;  2H1K A;  5C4X J;  1FOW A;  4CIC A;  3QOD A;  1ODD A;  4KIS A;  2IGK A;  4XLE A;  4FTH A;  3Q3S A;  2FMY A;  5GPC A;  4X1E A;  1P4X A;  2R5Z A;  1Z67 A;  3COA C;  5J1Y A;  2QBY A;  2XAG A;  1APL C;  2GA2 A;  1BOB A;  3BZ6 A;  3H5A A;  3ZP5 A;  2NS8 A;  1SMT A;  3MQ0 A;  4OIO F;  1K4S A;  1TWC J;  1IG7 A;  3LWF A;  4HW0 A;  3G1O A;  1T98 A;  4A0Z A;  3H3V K;  4XN0 A;  1IXR C;  1PP7 U;  1K6Y A;  2PJR A;  3QYB A;  1YW9 A;  2EFO A;  3CUO A;  3FMS A;  5HLI A;  1IJW C;  1J75 A;  4Q5S F;  4LIU A;  2HI3 A;  4KN4 X;  5FRO A;  2PG4 A;  4M6X A;  1ZTR A;  2CV1 A;  3LSP A;  2JVG A;  3T0Y A;  2HU9 A;  3NWS A;  3ZQH A;  1WJA A;  2CQX A;  4C3J J;  1TW2 A;  2DMT A;  3WHB A;  4I0A A;  5M5W J;  2CYY A;  3RKX A;  3PM1 A;  2HYJ A;  2M4G A;  1HF0 A;  1FBU A;  5LRR A;  3L2U A;  1G4D A;  2L3D A;  2DFI A;  3M8E A;  3WTU C;  1A6Q A;  1Y8R B;  3K4M A;  3CUQ C;  1LVK A;  5AIP A;  5IT9 K;  3PFI A;  5A2Q Z;  3L7W A;  3PNT A;  2DA2 A;  3DWL E;  4C2U A;  2XSD C;  4W1U A;  1TW3 A;  3LFK A;  3R0A A;  2WWY A;  4ESB A;  2B63 J;  1HW2 A;  3KP2 A;  2VLA A;  1EKE A;  2VPR A;  2MD5 A;  4XOP A;  2PFB A;  2KQR A;  3MKZ A;  1LQ1 A;  2P8T A;  4HYE A;  4YII A;  3K2A A;  2L0K A;  3CD6 I;  4JX4 A;  2DFH A;  1O3R A;  1LDJ A;  3BOQ A;  5LRS A;  5F27 A;  3T8R A;  3WGI A;  1SVM A;  2JSP A;  2M5W A;  3HL2 A;  3BR6 A;  2XHK A;  3L1P A;  1IRZ A;  3GCM A;  2D2W A;  4F3Q A;  3CP2 A;  4PJL A;  2F5V A;  3RJP A;  4HV6 A;  4I7H A;  4IHV A;  3OYB A;  6PAX A;  2Y48 A;  1E2X A;  4XLF A;  1FWZ A;  1VQO I;  3RCO A;  5LBQ A;  1LVA A;  1TQP A;  2XPU A;  2GIZ A;  4M3G A;  1YJW I;  3FXL A;  4ENJ A;  4WXH A;  1UZC A;  4KIF A;  1XMK A;  2V79 A;  5FJ8 J;  1OKR A;  3EQL F;  4E7I A;  2B9S A;  2KIU A;  1YRN B;  1HDP A;  5HS7 A;  1I1S A;  2JK3 A;  3CC7 I;  4KT5 C;  2IA0 A;  3DPL C;  2MLK A;  2XF5 A;  1BI0 A;  5FO5 A;  3HDD A;  4P55 A;  4DYR A;  3HOV J;  4IXA A;  2NS7 A;  3O3K A;  4DJA A;  1U9N A;  2IRF G;  4BQO A;  5L3G A;  3L9F A;  4XSZ F;  1XS9 A;  3CTA A;  2VJJ A;  1DDN A;  3QQA A;  4ASN A;  3WTT C;  1SAX A;  4RLF A;  2VKD A;  2A6T A;  3TKY A;  2E60 A;  3GW2 A;  5KCM A;  5FD6 A;  1WVR A;  3OIQ A;  1O4X A;  5ICC A;  2V26 A;  1SD5 A;  4GYI A;  3PIP F;  1H8A C;  4U87 A;  2W57 A;  4AU7 A;  4L9J A;  5CQE A;  2R4G A;  4DYQ A;  4AIJ A;  3NQO A;  2H09 A;  2FBK A;  3H3Z A;  4XRS G;  5CVU A;  4GDF A;  1TQM A;  1FEX A;  4RAG A;  1A36 A;  4LOC A;  3TP0 A;  1ZG1 A;  3KCC A;  2W25 A;  3LSI A;  4GCV A;  3HC7 A;  2ZXH A;  2R7R A;  2HQA A;  4II2 A;  3CMY A;  1U3E M;  4A3E J;  1TNT A;  2VE8 A;  4C2T A;  4V19 K;  1KA8 A;  2LLK A;  2XAF A;  3LQR A;  1F36 A;  1ENH A;  2P6T A;  5CYV A;  3G3Z A;  1RNL A;  4BJT A;  5GAH J;  4E7J A;  1JUP A;  3CJN A;  4XLP F;  5DEQ A;  3JW4 A;  4AIK A;  1Y8Q B;  4RBO A;  1LKX A;  1PYV A;  3F8F A;  3RKW A;  3I4M J;  5ILS A;  1TL8 A;  2KIM A;  1ZQ3 P;  5ICF A;  3K1N A;  1ZR2 A;  3FMQ A;  5L3D A;  1MDM B;  4M9Z A;  2YSR A;  3BDD A;  2MLG A;  2D1H A;  2E2I J;  2HTS A;  2COB A;  4D1Q A;  4HF0 A;  4CCM A;  3LA3 A;  3CO7 C;  4BE1 A;  2K9M A;  5FLX Z;  1SFX A;  2BBY A;  4JK1 X;  2OCC H;  3JRC A;  3F6V A;  4E7S A;  3GEZ A;  1ZN2 A;  2B7E A;  3BZC A;  4CHU A;  4LG0 B;  2V9K A;  3K9T A;  4BQQ A;  2L7F P;  3B02 A;  2X9D A;  2E1O A;  2LH9 A;  1JKO C;  1XN7 A;  2JRT A;  4Z2Y A;  3OIO A;  1WRJ A;  2F48 A;  2OJE D;  1WQ2 A;  3AL0 B;  5HNF A;  2NVT J;  3HSR A;  5JVG F;  3OL3 A;  3F22 A;  1YQA A;  4F52 A;  3ML6 A;  3W6V A;  2ETH A;  4XLN F;  1RES A;  2STW A;  1LFU P;  4XSX F;  4CCJ A;  1SAU A;  3J80 Z;  2A68 F;  3IH2 A;  1W5C C;  3NAR A;  4H0E A;  3I58 A;  3MZH A;  3HKZ N;  4ZDO A;  2LKP A;  1QO0 D;  3REO A;  3KLO A;  5J8F A;  1A04 A;  1QA6 A;  3IKT A;  2YS9 A;  3IKV A;  1IUY A;  2DA6 A;  4U0Y A;  4LG0 A;  3HPG A;  1O3Q A;  4PJ0 C;  1PUF A;  2EFN A;  2TCT A;  2IP2 A;  1R1U A;  2QCO A;  5FKL A;  1DUX C;  4LLN A;  4HSR A;  2DMP A;  2RQP A;  1EH7 A;  3EPZ A;  4U7B A;  3L2R A;  1DP7 P;  3DKY A;  3M4O J;  2YPR A;  1TLH B;  3BPX A;  2E2H J;  5F0F A;  1T0F A;  3VSL A;  3OYL A;  4DNC A;  4NC7 A;  1F5T A;  2HEO A;  3OWT A;  3BR3 A;  5L3F A;  3CF5 F;  1R9T J;  2HQ5 A;  3A01 B;  4G8X A;  2HVR A;  1Y6I A;  4CYD A;  3BTJ A;  3BJA A;  5BS6 A;  3FXM A;  3ZPL A;  2KFD A;  2WB1 N;  4HLY A;  2L54 A;  1VQM I;  1JUS A;  5D5X B;  2H6B A;  1MKM A;  3GME A;  5F1J A;  1BJA A;  2IVM A;  2Z16 A;  2UV1 A;  2G7U A;  3KP3 A;  2Q2E A;  4CZC A;  2P6S A;  1WGX A;  5E3O A;  3L2V A;  3LMM A;  3U9G A;  3QPT A;  2M34 A;  1K78 A;  1Q1V A;  1FLI A;  3GO5 A;  3BR0 A;  2BW3 B;  2LG4 A;  4D0P A;  5L3E A;  1P7I A;  4HNV A;  5E3N A;  2R7S A;  2ZXW H;  1JTX A;  5ICE A;  3R60 A;  3OYI A;  1SFE A;  2FXA A;  3RPU D;  2RNG A;  5FKN A;  5EEA A;  1JT6 A;  3ONQ A;  2OA4 A;  3DP7 A;  2H6C A;  3A01 A;  3OYC A;  3WTX C;  2I8D A;  3D5L A;  3HTU A;  1VQN I;  2XRN A;  1TBX A;  2QQA A;  1ACI A;  2CUF A;  2RKH A;  3HRU A;  1FOK A;  3EET A;  4EJU A;  3KIO A;  4RB0 A;  3PO3 J;  2P5V A;  1OCP A;  3W2A A;  2HKX A;  3FK7 A;  1XD7 A;  3EUK L;  1UHS A;  2G7H A;  2FUG 2;  4BU2 A;  2YR2 A;  3KYL A;  1ETQ A;  3JRH A;  1TWF J;  1GUU A;  1T08 B;  2BW3 A;  2GOX B;  3GLL A;  2HOA A;  4LK1 F;  2DYS H;  1ON2 A;  1IN8 A;  3GZ6 A;  2OU2 A;  1XB4 A;  2CUJ A;  4N0B A;  1WJC A;  3K4L A;  4XR6 A;  3KP7 A;  1P2F A;  3C7J A;  2ZJP F;  2JMW A;  2QQ8 A;  3EYY A;  3ABK H;  3CCY A;  1T2K A;  2DU9 A;  2WY7 Q;  4U0W A;  4R79 A;  5C44 J;  4E7Z A;  4NC6 A;  4BBR J;  4UUS B;  4PGH A;  3FHN A;  4MEX F;  2F4I A;  3CC4 I;  1ULY A;  1RRJ A;  3S1R J;  2P81 A;  4BY7 J;  2OC6 A;  3VB2 A;  4G6Q A;  1D1A A;  2VKV A;  3E7L A;  1ZRE A;  5EJC A;  5E8G A;  5IOY A;  5FKK A;  4AM3 A;  1R7J A;  2VC0 A;  3PJR A;  5J3L A;  3UKG A;  3MD2 A;  1H88 C;  1XX5 A;  4A3I J;  3F21 A;  2EJR A;  2R7X A;  1D0Y A;  1STZ A;  1FYM A;  2DI3 A;  2Y0M A;  3CQZ J;  3WTS C;  4QTR A;  3CUQ B;  2R5Y A;  3D5R C;  4KJZ A;  1B6A A;  2MA3 A;  3CCE I;  2Y2Z A;  4FE7 A;  3WU1 B;  3NEU A;  3FX3 A;  1V3F A;  4A3J J;  3T5X A;  2L9N A;  1ZGJ A;  4XLC A;  2CQ7 A;  2DA5 A;  4C9Y A;  2RVC A;  5GAG J;  1Y0N A;  3DQV C;  3ASN H;  1Z91 A;  5H6Q A;  4UUS A;  4MTD A;  2LRE A;  3FMR A;  3G1M A;  5CVR A;  3IAS 2;  1QHH D;  1VFC A;  2CH0 A;  2DOA A;  2ZBK A;  4A0Y A;  2KP6 A;  2Z9O A;  1L0O C;  4UXN A;  1ZG3 A;  2NRA C;  2XB0 X;  5E18 F;  2ELK A;  2NNN A;  5BMZ A;  2A6E F;  1W5T A;  1UB9 A;  2HFH A;  5J6X A;  3E5Q A;  1W1W E;  1EA3 A;  2CUZ A;  1ZRD A;  1T95 A;  1HC8 A;  2OUM A;  3OIP A;  1I50 J;  3ROU A;  5LEJ A;  3CUQ A;  1FC3 A;  1MJ9 A;  2JRM A;  2X6O A;  4A3G J;  4S0H B;  3TED A;  4K2E A;  1J0R A;  3HOT A;  3SHF A;  1G2H A;  3C2B A;  4GO1 A;  2QSG X;  4MQV A;  2MH2 A;  1QPI A;  2DQL A;  5HOO A;  3W2W A;  3ECO A;  5CVI A;  1LE8 B;  1OLT A;  4O3M A;  2YUS A;  2ICW G;  2HVS A;  5CLS A;  2EK5 A;  1D8J A;  1YFH A;  3GUD A;  1RR8 C;  4CXF A;  2BY3 A;  2F5F A;  4B4C A;  1N77 A;  1R22 A;  2VI6 A;  3PUF A;  4ZJZ A;  2R92 J;  1NH3 A;  4BNC A;  2VQC A;  2JVH A;  1IRF A;  3HUG A;  4KDP A;  2ELH A;  3TL4 X;  3HIF A;  5M5Y J;  5ILV A;  4XID A;  3ERE D;  3IH3 A;  2H94 A;  1YS7 A;  1WFX A;  3TDZ C;  2D45 A;  3KP6 A;  1FPQ A;  5EEG A;  1TT0 A;  2VB6 A;  5FLV A;  4HBL A;  4RAZ A;  1NG6 A;  2OZU A;  2PI0 A;  3GTO J;  1E0E A;  3CDH A;  2V7F A;  2Y9Z A;  2KPM A;  2ID3 A;  4ZDL A;  1SFO J;  3FM3 A;  2JPC A;  2VOP A;  2LP0 A;  2ZO4 A;  1BJZ A;  4HA8 A;  2EZH A;  4I0B A;  1V4R A;  1KZH A;  3J7Y J;  1LE8 A;  3O2P E;  1Z05 A;  1SD6 A;  3C18 A;  1HKT A;  2V9P A;  5FFX A;  4C3H J;  5HOD A;  3J7Z I;  1BR2 A;  4HDV A;  1T0F C;  1MSE C;  1U5T C;  2FU4 A;  5DYM A;  2DA7 A;  1MBF A;  4PUS A;  4XNF A;  1ZRC A;  4G94 A;  3JRA A;  1R1T A;  4KA4 A;  2ESH A;  3S3M A;  3O8H A;  2EPF A;  2BHZ A;  2WB1 A;  3CCM I;  3GTP J;  3KX2 A;  4R1H A;  2E2J J;  4NB5 A;  4BE2 A;  2E19 A;  4EM0 B;  4BE0 A;  1F4K A;  2BY2 A;  1OCT C;  1WSU A;  4M9S A;  4A5N A;  3MZ8 A;  2LC2 A;  1EJ9 A;  4M9X A;  3PFY A;  2X1C A;  2FA5 A;  1GXP A;  4J01 A;  2GLO A;  1XG1 A;  3QOP A;  4ZYE A;  2QGU A;  3PIO F;  2WTE A;  4B8X A;  1YJN I;  3FBI B;  3G6E I;  2L5Q A;  2W00 A;  3W2V A;  3OYN A;  4OOI A;  3ABM H;  1FTT A;  2KDO A;  2RN7 A;  2V6E A;  1ZYR F;  3CMM A;  5K5R A;  4HV5 A;  1J9I A;  1BBY A;  1VQ4 I;  1VF9 A;  3DXJ F;  1TP4 A;  3S3O A;  4MTE A;  2CGP A;  1BC8 C;  4Q47 A;  2VBZ A;  4CDG A;  2N8G A;  4KN7 X;  1ZR4 A;  1YIO A;  1B8I B;  2HXI A;  3OMY A;  1SFK A;  2LY1 A;  1D5V A;  1KU3 A;  1V55 H;  3HM5 A;  1FSE A;  4NQW B;  2FOW A;  1LPQ A;  2MC3 A;  3OSG A;  4UB8 C;  1X3W B;  1MBE A;  3FXU A;  2K9S A;  2I5U A;  1ZRF A;  5B1A H;  3GTK J;  4LIV A;  3GVA A;  1S9H A;  1ZGA A;  1PVE A;  1USS A;  2NVX J;  3GTL J;  3TOA A;  1FX7 A;  2E35 A;  3I4P A;  1BIA A;  1KU2 A;  3CLO A;  3V8L A;  2X85 A;  1LDK B;  4Y33 A;  4HAM A;  1QBJ A;  2Q8K A;  2DPD A;  2XAS A;  4AIH A;  3DPT A;  5IT3 A;  2QBY B;  1T6S A;  3OS0 A;  1PP8 F;  1I3A A;  2CG4 A;  2QM3 A;  3M07 A;  2NXN B;  3E5X A;  3R6S A;  2L9V A;  2XVC A;  3GZ5 A;  2UXN A;  1JJ8 C;  1G6N A;  5IT9 Z;  1MJA A;  1RC9 A;  2PJR B;  2DJI A;  3FKI J;  3H5N A;  3KFW X;  2BHY A;  3WG7 H;  1KON A;  2X1D A;  3B6C A;  2HYG D;  3IRQ A;  4IO9 F;  3OSF A;  1VQK I;  2NAZ A;  3P9C A;  1GT0 C;  2ZNY A;  1IV6 A;  4XN3 A;  4MQ9 F;  3FIS A;  2VIX A;  3ZQG A;  5KHD A;  3DU6 A;  1UST A;  2VUM J;  1RUN A;  3HBL A;  2CQQ A;  2OF7 A;  3IWF A;  5JLW A;  1SC7 A;  1SEU A;  4IKF A;  3TO7 A;  2O3F A;  5D8K B;  1O57 A;  3H1C A;  1VQ6 I;  2EIM H;  5DS9 A;  1BC7 C;  2WAQ N;  3S93 A;  1VZ0 A;  1X1C A;  4A3L J;  1BW6 A;  2BY0 A;  2L4A A;  3SDB A;  1FYL A;  3G4S I;  2J5P A;  5D6F A;  2KZV A;  3O6B B;  2DYR H;  3H0G J;  3QP5 A;  1B59 A;  2L9S A;  3E0J B;  3Q9V A;  1HDD C;  2XPV A;  3S17 J;  4IOC F;  5JFR A;  2XUB A;  2F6C A;  3DLA A;  3V42 A;  1EV7 A;  4KIC A;  1BR4 A;  2CW7 A;  3R61 A;  3OYA A;  5EZH A;  5HS9 A;  4OAZ A;  2EIN H;  4C2M J;  1P6R A;  4IL6 C;  2PMU A;  3B6A A;  4MGR A;  2XGX A;  2FML A;  1V5E A;  4AID A;  2VT2 A;  1I5Z A;  2R7Q A;  4I09 A;  1X1D A;  5LFA A;  1Y1W J;  1XTA A;  1U2W A;  2J5O A;  1IN5 A;  4N4O B;  3FXJ A;  1I1G A;  2FJ1 A;  1K83 J;  2IS4 A;  1HBX G;  3K69 A;  4L5I A;  3NWT A;  1YX3 A;  2KIS A;  4FIS A;  4HG2 A;  4BHB A;  1ZLK A;  5TGT A;  4ENN A;  2PBI A;  3TOB A;  3A1Y A;  3K70 D;  1HKS A;  2GM4 A;  2NVQ J;  4XKW A;  1K7A A;  5F6F A;  5CKT A;  2VKE A;  3NRV A;  4UUT A;  1MW7 A;  4C3I J;  1ERD A;  3FK6 A;  3LSH A;  4A6D A;  2HOT A;  3Q0U A;  2XRO A;  3S1N J;  1ZK8 A;  1JJ6 C;  1QHG A;  3HTS B;  3V7S A;  4LLL A;  2ECB A;  2O8X A;  2GBY A;  4ZYH A;  3TW7 A;  3CC2 I;  5FFZ A;  3HOS A;  2FX0 A;  3NAU A;  2EA4 A;  4HDU A;  1LFB A;  1X3U A;  4Y4R A;  3LSJ A;  1IV8 A;  2X4H A;  2CFO A;  3FBN B;  3K6G A;  4U7D A;  2E1N A;  2ZSI B;  2FD5 A;  3RQI A;  1WJ5 A;  3OYG A;  2VKH A;  3CES A;  3SEQ A;  1GDT A;  2VBW A;  1Y0U A;  2L01 A;  4NUB A;  4NNJ A;  1OCO H;  4KFC A;  4BJ6 C;  3CCV I;  5J40 A;  5JI6 A;  1MH4 A;  2WA0 A;  1X1A A;  5IOZ A;  4UHT A;  4GFB A;  3OOP A;  2ECC A;  2K5C A;  4S04 A;  1OYW A;  1ZG5 A;  4AVZ A;  1EF4 A;  3VPR A;  1IGN A;  3J81 K;  2LY2 A;  3DLL F;  1MMN A;  1VQ5 I;  2KHM A;  3G73 A;  5FKO A;  2E36 A;  1FMV A;  1MMD A;  5A2Q K;  3J7A O;  3LAJ A;  3C1D A;  3ZMD A;  3PUB A;  3WOD F;  3WTZ A;  2RDP A;  2K9N A;  2W84 A;  1JE8 A;  1IAW A;  3D5S C;  2LVS A;  2UXX A;  2EFQ A;  3JRF A;  1K79 A;  2K27 A;  4XRS A;  3RYP A;  2K3F A;  3GFJ A;  1H89 C;  1AHD P;  3RPU A;  3K70 C;  5C3E J;  2X6W A;  3E97 A;  3HHH A;  3QWL A;  2FSW A;  4HNU A;  1YIJ I;  1WJB A;  3BG5 A;  4CCL A;  3OYH A;  3HRT A;  3VEP A;  1YW7 A;  1OMI A;  1C0W A;  1HLV A;  2P0W A;  1UEL B;  3LSR A;  5J47 A;  1HCR A;  3OS2 A;  5IPA A;  3PO2 J;  5GAE J;  2WAE A;  1BR1 A;  3DV8 A;  5E3L A;  2CFX A;  2XAU A;  4EM2 A;  5HDK A;  1VQL I;  4OWR B;  2BXY A;  4RGU A;  2ESN A;  4IHS A;  2D1V A;  4QPQ A;  2XC7 A;  2MD0 A;  4A93 J;  1N78 A;  2VN2 A;  4Y13 A;  4PZJ A;  2BYV E;  4JP0 A;  3CME I;  3FZV A;  3WE2 A;  4UV9 A;  3BC8 A;  2Q0O A;  4FET A;  3G2B A;  3ZXS A;  4BDZ A;  2DN0 A;  1HA8 A;  4CYC B;  3LA7 A;  2DT7 B;  1XSD A;  3ABU A;  3SZP A;  2IGM A;  3FXO A;  4HST A;  5DUI A;  2V9V A;  3RDI A;  1G3S A;  4PK4 A;  1VND A;  1PUF B;  1Z3X A;  2WC2 A;  3JRI A;  3W6K B;  3MAJ A;  3PL8 A;  4A2U A;  3V8J A;  4YEJ A;  1YYV A;  2XSJ C;  3EDP A;  3M3Y J;  2M9H A;  3M9A A;  2VT3 A;  3DTI A;  2DO7 A;  2DQR A;  4I99 C;  2M3A A;  1X1P A;  3ZQI A;  4FQG A;  4F92 B;  3CCU I;  2ZME C;  1U5T B;  1WHU A;  2Y30 A;  3WHC A;  3GYH X;  2O0Y A;  4ZZD A;  2GZW A;  2MYS A;  2VJ4 A;  2DBB A;  3S1Q J;  3FHZ A;  1TQI A;  4IHT A;  2LSO A;  1XSV A;  5TIS C;  4FX0 A;  2EQR A;  1MJB A;  4ZTF A;  2M0M A;  3BCA A;  3H92 A;  5DCM B;  1QGP A;  5JR3 A;  4RGS A;  2NVY J;  4CYC A;  2M2E A;  1ZEL A;  2E34 A;  3SJM A;  2A3S A;  3RSN A;  3BLY A;  1RPW A;  2BVM A;  2AXL A;  2Q2E B;  3G1L A;  2WAQ A;  3WGH A;  1VI0 A;  5GTI C;  3L09 A;  1K78 B;  1E3H A;  2K86 A;  2G0E A;  3C3W A;  4B09 A;  3S14 J;  4XKC A;  1HW5 A;  4L5E A;  3WGG A;  1JKR C;  1YHQ I;  4RGX A;  1ETV A;  1Y56 A;  1Z77 A;  5CPR B;  3TO6 A;  3R0J A;  2QLZ A;  3KYC B;  2NNY A;  1DP3 A;  4BEH B;  1U5T A;  5K5Q A;  2ISZ A;  1D8K A;  2X6X A;  1Z21 A;  3I64 A;  1PUE E;  3BQZ A;  2AHQ A;  3E6C C;  4HF1 A;  1HOM A;  3OYM A;  5DCM A;  3MKY B;  1ITY A;  2BEO A;  4KIG A;  1MND A;  3VOE A;  5LGN A;  2VAS A;  4QPO A;  4WF2 A;  3CJQ B;  1QZY A;  2BVL A;  4II3 A;  4MNU A;  2MC4 A;  5B66 C;  3FXK A;  4D7M A;  1YJ9 I;  1F43 A;  2CV0 A;  4UVC A;  2JJ7 A;  2QVO A;  3QRF F;  3V8K A;  3W6J B;  4EEF G;  2YU9 J;  4HPQ A;  1WKM A;  2FRH A;  1TC3 C;  2JA6 J;  1CQT A;  4HF2 A;  4M3D A;  2PMH A;  1CF7 B;  2KL4 A;  1MMS A;  1R4N B;  1JGG A;  4BEH A;  1BI2 A;  2DW4 A;  1JUM A;  3DCF A;  3K4B A;  4A0X A;  3DPU A;  2RAE A;  5LHG A;  3J7A Y;  3IP4 B;  1I27 A;  4XOT A;  1IRG A;  2VXZ A;  3K1P A;  2AS5 F;  3K4K A;  1QVT A;  5GAD J;  3JRB A;  2IS1 A;  4V2G A;  3C2H A;  4N9I A;  3HGY A;  3SDG A;  4A6E A;  3TO9 A;  4B3X A;  3ECH A;  3CMA I;  2P5K A;  3IRR A;  4D7N A;  5DM7 F;  1RKT A;  5FGM A;  3N05 A;  1YE9 A;  3L2C A;  4A3F J;  2K9L A;  2FBI A;  5E8I A;  4BKX A;  4WCG A;  4LIT A;  3VSK A;  1FTZ A;  4A3M J;  2JZY A;  2K9Q A;  1CF7 A;  3LQQ A;  4KIB A;  1YS6 A;  5D5U B;  1LDD A;  1JKQ C;  3S8P A;  5JHF A;  4WXD A;  1ZH5 A;  3HB9 A;  3SQN A;  3BQY A;  3WTV C;  1D0X A;  3FKJ A;  3F6O A;  1XSX A;  5LGT A;  4B47 A;  2R5Y B;  1U78 A;  2GXB A;  1YI2 I;  2OCE A;  5FKM A;  3TP3 A;  5ICG A;  2QA4 I;  1IF1 A;  1ZAO A;  4AUX A;  2KMU A;  3I9V 2;  4ENK A;  1JGS A;  1ZAR A;  2DK8 A;  2CU7 A;  2Z2S B;  3MKL A;  2DOE A;  2O5R A;  4IJA A;  2CJJ A;  4AYB N;  5E1X A;  2QSH X;  1S7E A;  4ETS A;  3LAP A;  1R5H A;  2XGE A;  5EYR A;  4ZTJ A;  3KZI C;  1W7P D;  4WK8 F;  1R4M B;  1QZZ A;  4O6J A;  3JRE A;  2ZSH B;  3BCB A;  3KEO A;  4DBR A;  3H36 A;  2VL8 A;  3GFI A;  2CWE A;  4DGW B;  3BR5 A;  3CDI A;  5CVV A;  1LEA A;  1ON1 A;  5KK1 A;  4MHG A;  4EM1 A;  1VQ8 I;  1LJ9 A;  3ZOB A;  3S3N A;  3HOU J;  1QQI A;  3JCU C;  2DA3 A;  4OIN F;  4A69 C;  4Y3O A;  2JTV A;  4G6T B;  3X2Q H;  4IEJ A;  2WV0 A;  2XGC A;  3HZJ A;  4JBA A;  4EVI A;  1FZP B;  2DPU A;  2B0L A;  2QZ8 A;  5EG0 B;  3EUH A;  4P96 A;  4UVA A;  1VQ9 I;  3FF5 A;  1R36 A;  3BG7 A;  3I4N J;  3CCJ I;  1X58 A;  4RB1 A;  1RUO A;  2VJI A;  4BS9 A;  2EZI A;  2DTZ A;  4YEL A;  4CCO A;  2Z5U A;  3LSG A;  4L5J A;  2NS0 A;  2BXZ A;  4RDU A;  1A35 A;  4IRG A;  2DLL A;  3ZMS A;  1ZKG A;  4PJJ A;  2A5Y B;  3ZQL A;  2PX9 A;  4S05 A;  1RET A;  1H9T A;  2V1U A;  4HX7 A;  3HUG B;  3M7G A;  4IRI A;  4FX4 A;  3HSE A;  2ZXJ A;  4LK0 F;  4ZYG A;  3N97 A;  1NHA A;  2BOL A;  3DKX A;  1UMQ A;  2RGV A;  1SD7 A;  3HSF A;  2LDU A;  1HSJ A;  2LF7 A;  4E70 A;  5IP9 J;  1OPC A;  1UHM A;  3JTH A;  5B3S H;  2BV6 A;  1UHW A;  2LD5 A;  5EG0 A;  1POG A;  4BL0 B;  3H9J A;  3F0C A;  4KT6 A;  1BIB A;  1LB2 A;  3P9K A;  4ZYD A;  1NK2 P;  4A3B J;  2V1X A;  1G8X A;  2K85 A;  3OY9 A;  4Q48 A;  4XQF A;  2X6Y A;  4MO7 A;  2CMP A;  2K4J A;  2M7A A;  2XKO A;  3DEE A;  4MEY F;  5HLT A;  2Y9Y A;  1V54 H;  1OJL A;  2MG4 A;  1Z3Y A;  3Q5F A;  4FE4 A;  4L0Y B;  3TGN A;  3HKZ A;  3AFH A;  2F5C A;  2HS5 A;  4U0V A;  3RYR A;  3ZQ7 A;  3E6M A;  2EIK H;  4YIR X;  1DGW Y;  3QPS A;  3SFI A;  2ZJ2 A;  1JT0 A;  3BJO A;  3BWG A;  1A5J A;  1O7L A;  5HNH A;  4Y52 J;  4OIQ F;  5K7H A;  1TT5 B;  1G3T A;  4CA0 A;  2XDV A;  3HHG A;  3K2Z A;  1IN6 A;  2YX4 A;  1ETK A;  2ZNZ A;  4EGZ A;  2QWW A;  5F0H A;  4HQE A;  3CCQ I;  1F1Z A;  3KZZ A;  4ABZ A;  4LG3 A;  3R4K A;  3OR1 C;  1X2N A;  3F3X A;  3GX4 X;  2ZC2 A;  4PSW A;  1HXD A;  1P7J A;  3TQN A;  4PJN A;  1XC5 A;  1BN5 A;  2AQE A;  4IQ4 A;  5HDN A;  2M87 A;  2EH3 A;  3MVP A;  5LD2 C;  2O8K A;  2BE5 F;  3DTK A;  4PGG A;  3A2K A;  2DMU A;  1JHH A;  3M1E A;  1ZGW A;  1YIT I;  1YLF A;  3A03 A;  4E6K G;  1LEB A;  2CQN A;  3L2Q A;  1X1B A;  2KT0 A;  1H0M A;  4BY1 J;  4N4N B;  1FSH A;  2NOJ B;  5H2F C;  1Z1D A;  3BJ6 A;  1OFC X;  1FIP A;  4IVN A;  1J5Y A;  4G12 A;  2ACJ A;  2QF7 A;  3CLQ A;  1B9N A;  1R71 A;  4I2O A;  3ERM A;  2DTR A;  3AG2 H;  2QQ9 A;  2M7B A;  3FM5 A;  4B43 A;  2K40 A;  2F5D A;  4PCQ A;  1QRY A;  4Z6Y A;  3CO6 C;  1V5F A;  2EIJ H;  1KQ0 A;  1XMA A;  1D3Y A;  2F4M B;  1XGS A;  2DFE A;  4HQM A;  2W24 A;  1XDU A;  3PNV A;  2K4B A;  4KIT B;  2H8R A;  2HPM A;  2WBM A;  1HW1 A;  3HGG A;  2KJB A;  1WCM J;  3HYI A;  5JHU A;  2ZME B;  2HZT A;  4I76 A;  4XRF A;  1NG7 A;  4PDK A;  2PN6 A;  1T38 A;  4TV7 A;  2VQG A;  4N9H A;  4ON0 A;  1B4A A;  3GTQ J;  1RI7 A;  1Z6T A;  2M0C A;  1RKW A;  5E20 A;  3S16 J;  5HDG A;  1M1E B;  2IW5 A;  4P5O A;  2W82 A;  4I98 B;  1KYW A;  4IPA A;  4BDY A;  2IPQ X;  1FOX A;  2KIF A;  3GTJ J;  2DMN A;  1GVJ A;  1IW7 F;  2HTJ A;  3QU3 A;  3C2G A;  4L9N A;  4Y17 A;  1WJE A;  4BGD A;  1R58 A;  2H1L A;  1U6G A;  2DMQ A;  2R7F A;  1WJF A;  1Z6R A;  2UUZ A;  3CF2 A;  4J00 A;  4QSH A;  5D6E A;  2HPI A;  1D0Z A;  2ZJQ F;  1R5I D;  2IGN A;  1U8B A;  2PJP A;  5K7F A;  2QEN A;  4CZZ A;  1FT9 A;  1HQC A;  1WWX A;  1BL0 A;  5FLM J;  5F0C A;  4AYB A;  2ZME A;  2VPL A;  3DBL B;  3Q0W A;  4D9J A;  1MNE A;  1UAA A;  1QU3 A;  1G59 A;  4C30 A;  2O9L A;  1PJR A;  4D5C A;  3FXR A;  5TJJ A;  4KYW A;  3AAF A;  4F91 B;  4GXO A;  4LJZ F;  3KE2 A;  2KRC A;  1DU6 A;  1HKQ A;  5IY5 H;  3SYT A;  2QSF X;  5DDG A;  4EJT A;  2P7V B;  1XDS A;  1S72 I;  2ZFW A;  1ZLJ A;  1K6O A;  1W0U A;  3H5R A;  2LBF B;  2ME6 A;  1OCC H;  4PFP A;  3I3L A;  3GZN B;  2HR3 A;  5K7Z A;  5LGU A;  4CGZ A;  2FQ3 A;  3LSK A;  1GVD A;  4HNT A;  2R7T A;  1T56 A;  2IXS A;  5DD4 A;  2TRT A;  3EUH C;  5DD8 A;  3ZMV A;  3JAM K;  1T39 A;  4IQJ A;  1X3Z B;  5BQT A;  1TWH J;  2JA7 J;  4UVB A;  3ABT A;  4GYG A;  3HEF A;  2KIQ A;  3PQK A;  2PQ8 A;  5J8C A;  2HGC A;  4AWX B;  4XKV A;  1W36 D;  2M1B A;  4W97 A;  2KDZ A;  4PSX A;  4X6A J;  4DBQ A;  2V6C A;  4E4H A;  4HEA 2;  4P9U A;  2PEX A;  5H6R A;  1MSF C;  2FQ4 A;  1P92 A;  5HS8 A;  2LBF A;  2DFF A;  1MH3 A;  3FIW A;  2XB5 A;  2O03 A;  1PDN C;  2X48 A;  2R7W A;  1OIS A;  1WH7 A;  5H20 A;  2IA2 A;  1RZ4 A;  1X4O A;  5LHI A;  5LEK A;  2CSO A;  2HWV A;  4HRI A;  5TRD A;  4RA2 A;  1MBG A;  3J81 Z;  2E1M C;  1WZ2 A;  4ESF A;  4BH9 A;  4FHT A;  4LB6 B;  1UFM A;  2X0L A;  4EJV A;  1SVL A;  1XPX A;  1WPK A;  2CRG A;  2R7Z J;  1V5G A;  1XGO A;  3DEU A;  1I3Q J;  3WTW C;  3VFZ A;  1IXC A;  2R3S A;  3LSM A;  4XOR A;  3V7R A;  4EJO A;  1G3W A;  2BY1 A;  4BAY A;  2W85 A;  1MBK A;  2PLY A;  3JTG A;  2D5V A;  5HLH A;  2VQH A;  4ZC3 A;  4EMS A;  4G7H F;  4X0G A;  2EFW A;  4BQN A;  1ZHF A;  5BPD A;  4BYY A;  1AOY A;  2HXO A;  3VYR B;  4BXU A;  3IC7 A;  1R6R A;  1IC8 A;  1BM9 A;  4A5M A;  2R93 J;  2IA1 A;  4KMU X;  1O3T A;  2DJN A;  3DTE A;  2LOO A;  3BTC A;  3S2W A;  4YG2 F;  4WX9 A;  3ZQF A;  2OPT A;  2DXI A;  1U9O A;  1BW5 A;  1TZL A;  1FJL A;  5DV5 A;  2M8G X;  5EZG A;  2EFP A;  2DT5 A;  3E6B A;  4NC8 A;  4DZP A;  4WXC A;  4MFE A;  5DUK A;  5JVT A;  3PNY A;  5CQG A;  1W36 C;  4M6V A;  2O61 A;  2WY8 Q;  3K4J A;  2DOD A;  3ZMZ A;  2KLO A;  3BP8 A;  5B1B H;  3LST A;  3QP6 A;  2VXD A;  3CP8 A;  4M6Y A;  2JQ7 A;  4A3K J;  1YW8 A;  3ESW B;  3WE3 A;  5E1W A;  2ISY A;  1CGP A;  4F55 A;  5ERI A;  3SZG A;  1OCR H;  5C4J J;  3LNQ A;  2MSY A;  4L9T A;  1P4W A;  1A6I A;  5FRN A;  3S2H J;  2HQR A;  3DEW A;  1DGR M;  4BJ5 C;  4CCN A;  1YTY A;  2P5L C;  2LKS A;  4IHW A;  2XRL A;  3HG9 A;  1YRN A;  1Z7L A;  2LF8 A;  5DTD A;  2CO5 A;  2OD5 A;  4U88 A;  4HZF A;  3UNG C;  2STT A;  5CVJ A;  1Z9C A;  4FT8 A;  2HDC A;  2NVU B;  5IYC J;  3ZQC A;  2IAI A;  1O3S A;  1EH8 A;  5KNL A;  4LGW A;  1A31 A;  4LFU A;  3QOE A;  5E79 C;  2XKP A;  3Q0V A;  3RKQ A;  4IHY A;  4E7K A;  4F93 B;  2P7C B;  4XON A;  4OAY A;  2DAO A;  5J1R A;  3IL2 A;  2VE9 A;  4M3B A;  3CCS I;  2O6G E;  3BZK A;  3ZN0 A;  4IHX A;  1EH6 A;  5F64 A;  2XF6 A;  2A05 A;  3M8J A;  3IH4 A;  2UWM A;  2ID6 A;  3ZN1 A;  1KU9 A;  2OTJ I;  2EZL A;  5E17 F;  1MBJ A;  4GGG A;  3CDL A;  3VYS B;  4CO8 A;  3AG4 H;  4RAY A;  2EV0 A;  3EUA A;  4GRI A;  4EV0 A;  1W7P B;  1TTY A;  4M3E A;  3W3C A;  5ED4 A;  2I10 A;  2IBD A;  2VJ5 A;  1R49 A;  2LRD A;  3RKY A;  1MMG A;  3OR2 C;  4Q4Z F;  3OYD A;  2A5W A;  4A3C J;  1I6H J;  1YG2 A;  3ZRG A;  2F5E A;  3BG9 A;  1UJ8 A;  1I39 A;  5E1Z B;  2PMZ N;  2EB7 A;  2CQK A;  4MLO A;  1N25 A;  5D5V B;  4EGY A;  3GTG J;  4NBQ A;  2CW8 A;  1ETO A;  3OYJ A;  4LB5 A;  3RPQ A;  2Z99 A;  4F7Z A;  1KU7 A;  1MMA A;  3F8N A;  2WV1 A;  3GBG A;  2VQL A;  4PJM A;  4L0Z B;  2Y0S N;  3KET A;  3I55 I;  3BR1 A;  5B5E C;  4UUV A;  1B9M A;  3V4G A;  2ELJ A;  3S15 J;  4RB2 C;  1ORK A;  4ZH4 F;  1K4T A;  3HOW J;  3ZCO A;  2VBX A;  3HOY J;  2KRH A;  1W7P A;  2R7D A;  3DBH B;  1HST A;  3K7A J;  3VDX A;  2E5N A;  2RQQ A;  2K02 A;  3H35 A;  5HLG A;  3DU5 A;  2HDW A;  3OYK A;  3KLN A;  1D1C A;  2HOS A;  3P9I A;  1MDM A;  3GF2 A;  4XLA A;  4BHP A;  1BI3 A;  3M8F A;  4AVP A;  2RRE A;  5J4V A;  2JWT A;  1TWG J;  3KYD B;  2L7K A;  4UB6 C;  3U21 A;  2A69 F;  4I01 A;  1O7F A;  4HLX A;  1JXS A;  1S7A A;  4Y15 A;  3SZT A;  5JLX A;  3LA2 A;  2V1D A;  2IT0 A;  2RNJ A;  3BR2 A;  3ELK A;  4Y7N J;  1E17 A;  3FXQ A;  2F4O B;  1GV5 A;  4EJW A;  3QAH A;  2NYX A;  1SAN A;  3QU6 A;  1WI9 A;  2KRF A;  2BGC A;  3Q9S A;  2L4M A;  3TW6 A;  3HOZ J;  2ZB9 A;  3BPV A;  3CJT B;  1UG2 A;  2DA1 A;  4DOZ A;  3GLX A;  4B44 A;  3E6D A;  1Q1H A;  3A0B C;  3MZY A;  4JQF A;  2Z33 A;  1NTC A;  2R0Q C;  3AG3 H;  3JSO A;  2AO9 A;  3V7C A;  3RTR A;  2A07 F;  2TDX A;  3UR3 C;  2OZ6 A;  1D1B A;  2HQN A;  4QWQ A;  2QEX I;  4H4K C;  2YX7 A;  4XKB A;  3ULQ B;  2R7U A;  3MFK A;  1K61 A;  2UZK A;  3HJE A;  4LLG F;  1OYY A;  5FLX K;  2Q1Z B;  1JI8 A;  1N75 A;  1X4P A;  1RIO H;  1GHC A;  1OR7 A;  2KKO A;  4IZZ A;  4BQA A;  3RZO J;  4HX8 A;  2CS3 A;  1S6L A;  3O8G A;  3SFZ A;  2O7O A;  1P4A A;  1SFU A;  3K4C A;  4RAF A;  3ZMT A;  4E7L A;  4YRV A;  3L2W A;  1Y39 A;  2L02 A;  2P4W A;  5FRM A;  2LKX A;  2X51 A;  2VON A;  3F8B A;  3K4N A;  5AON A;  3BRO A;  4BAC A;  1FP1 D;  3E1S A; 
#chains in the Genus database with same CATH homology
 5AIQ A;  3EYI A;  1ONV A;  3GWZ A;  3J80 K;  2GIV A;  2F2E A;  2FE3 A;  1REP C;  1SD4 A;  4I02 A;  1YO5 C;  3QPH A;  4R8H A;  3IWZ A;  4YFN F;  5F1R A;  3MWM A;  1G3Y A;  1GXQ A;  4OMZ A;  2A61 A;  4XBF A;  2GXG A;  1IXS B;  4M73 A;  4A12 A;  5LHH A;  5KVR A;  2MH9 A;  4P9F A;  2C6Y A;  2XAH A;  2XAJ A;  4O5V A;  5K1Y A;  4M72 A;  1QPM A;  4L9V A;  1S29 A;  4KNY A;  3DF8 A;  1J59 A;  2OQG A;  2QYO A;  1R00 A;  3MCZ A;  3TDU C;  3ZMU A;  4IRH A;  1XGM A;  2H27 A;  2XAQ A;  5D4R A;  1TNS A;  2OBP A;  3DFG A;  1FYK A;  3H3U A;  2GQQ A;  4HX4 A;  2GA1 A;  1KQ9 A;  2ZCW A;  3U1D A;  1S8N A;  2Z3Y A;  2GAU A;  3I5U A;  3F8C A;  4OIR F;  3ISP A;  3MEX A;  2FF4 A;  3WU0 A;  3SXY A;  1F9N A;  4OMY A;  5D4S A;  5FB2 A;  3I0T A;  2RV8 A;  1R1V A;  4KMF A;  2ZKZ A;  2LNB A;  2JSC A;  3WG9 A;  1XGN A;  3F23 A;  1FP2 A;  3D0S A;  2JT1 A;  4OIP F;  1OYI A;  4UNO A;  2OQR A;  4L18 B;  1KQ8 A;  1S7O A;  4YFK F;  1W4M A;  4WWC A;  2FNA A;  4G9Y A;  4G7O F;  3GFL A;  5L3B A;  4AD9 A;  4RGR A;  5ILU A;  1XCV A;  1I6X A;  2EWN A;  1BI1 A;  5LLQ A;  3B73 A;  2A6H F;  2XV4 S;  3F72 A;  2DK5 A;  4HOB A;  4BHC A;  3K1M A;  3E5U A;  2JPB A;  2EA2 A;  5BPI A;  5EEH A;  1UCR A;  1FNN A;  3I71 A;  3K0L A;  3I53 A;  1R5G A;  2YU3 A;  4LD5 A;  2E7X A;  2COM A;  4KUM A;  2MBF A;  1MGT A;  2HOE A;  2KJC A;  3DKW A;  5D5W B;  1J2X A;  1DPR A;  1KYZ A;  2VC1 A;  1KGS A;  3BY6 A;  4QLC U;  5HVQ C;  1VTN C;  2K7L A;  2VBY A;  2EV5 A;  4YFX F;  3GXO A;  1XCB A;  3IHU A;  3E3V A;  1BOA A;  2RC4 A;  1U8R A;  1FBQ A;  1MD0 A;  2M8E A;  3PQJ A;  5K5O A;  3FWE A;  2GWR A;  2M45 A;  3U2R A;  4NHJ A;  2E1C A;  4G6D A;  5FD5 A;  4M74 A;  1DPU A;  3T8T A;  1IZ1 A;  1S3J A;  3I59 B;  1LNW A;  1MZB A;  4DQ2 A;  2OAZ A;  3GFM A;  3VOD A;  5BOX A;  1FBS A;  2G9W A;  3N4M A;  2Y75 A;  4LMY A;  3T1B A;  1QNT A;  1AWC A;  1B1B A;  4RB3 C;  4G7Z F;  4ENM A;  1H9G A;  3HRM A;  2FNP A;  3JAM Z;  1Z7U A;  3F8M A;  1L3L A;  2HYF A;  2FBH A;  3OV8 A;  4YIF A;  3KZY A;  3I54 A;  2IJL A;  4IF4 A;  5D8L B;  4ZZL A;  2QQB A;  3RI4 A;  5CJ9 A;  3I59 A;  1J7K A;  4M71 A;  3RIR A;  2CW0 F;  3HRS A;  1R23 A;  5DCF A;  3P7N A;  1FY7 A;  2FOK A;  2VOD A;  2QUF A;  4OU0 A;  4UV8 A;  2HKO A;  2FEZ A;  5L3C A;  2EV6 A;  4RS8 A;  4EQQ A;  3L00 A;  1W5S A;  4NQW A;  3KP4 A;  1IN7 A;  1SMY F;  2E7W A;  2ADU A;  3KEQ A;  2VOO A;  2XIG A;  3KP5 A;  1JHF A;  3WTY C;  3JSP A;  4ESJ A;  2M30 A;  1IN4 A;  4CIC A;  1ODD A;  2FMY A;  1P4X A;  3COA C;  2QBY A;  2XAG A;  2GA2 A;  3BZ6 A;  3ZP5 A;  1SMT A;  3MQ0 A;  4OIO F;  3LWF A;  4HW0 A;  4A0Z A;  1T98 A;  1IXR C;  1PP7 U;  1YW9 A;  2EFO A;  3CUO A;  3FMS A;  5HLI A;  1J75 A;  4Q5S F;  4KN4 X;  2PG4 A;  4M6X A;  3T0Y A;  1TW2 A;  4I0A A;  2CYY A;  3RKX A;  1FBU A;  5LRR A;  1G4D A;  2L3D A;  2DFI A;  3M8E A;  3WTU C;  3CUQ C;  5AIP A;  5IT9 K;  3PFI A;  5A2Q Z;  3L7W A;  1TW3 A;  3LFK A;  3R0A A;  2WWY A;  4ESB A;  1HW2 A;  3KP2 A;  2MD5 A;  2PFB A;  1LQ1 A;  2P8T A;  4HYE A;  4YII A;  1O3R A;  1LDJ A;  3BOQ A;  5LRS A;  3T8R A;  3WGI A;  2M5W A;  2XHK A;  2D2W A;  3RJP A;  4HV6 A;  4I7H A;  6PAX A;  2Y48 A;  1E2X A;  1FWZ A;  5LBQ A;  1LVA A;  1TQP A;  4ENJ A;  4WXH A;  4KIF A;  1XMK A;  2V79 A;  1OKR A;  3EQL F;  2KIU A;  5HS7 A;  1I1S A;  4KT5 C;  2IA0 A;  3DPL C;  2MLK A;  1BI0 A;  5FO5 A;  4P55 A;  4IXA A;  3O3K A;  2IRF G;  5L3G A;  3L9F A;  4XSZ F;  3CTA A;  1DDN A;  3WTT C;  4ASN A;  1SAX A;  3TKY A;  3GW2 A;  5FD6 A;  5ICC A;  1SD5 A;  4GYI A;  2W57 A;  4L9J A;  4AIJ A;  3NQO A;  2H09 A;  2FBK A;  3H3Z A;  5CVU A;  1TQM A;  1ZG1 A;  3KCC A;  4GCV A;  2W25 A;  1U3E M;  1TNT A;  2VE8 A;  1KA8 A;  3LQR A;  2XAF A;  2P6T A;  5CYV A;  3G3Z A;  1RNL A;  3CJN A;  4XLP F;  5DEQ A;  3JW4 A;  4AIK A;  3F8F A;  3RKW A;  5ILS A;  2KIM A;  5ICF A;  3K1N A;  3FMQ A;  5L3D A;  1MDM B;  4M9Z A;  2YSR A;  3BDD A;  2MLG A;  2D1H A;  2HTS A;  4HF0 A;  3LA3 A;  3CO7 C;  5FLX Z;  1SFX A;  2BBY A;  4JK1 X;  3F6V A;  3GEZ A;  1ZN2 A;  4CHU A;  4LG0 B;  3K9T A;  3B02 A;  1XN7 A;  2JRT A;  4Z2Y A;  1WRJ A;  1WQ2 A;  3HSR A;  3F22 A;  1YQA A;  3ML6 A;  2ETH A;  4XLN F;  2STW A;  4XSX F;  3J80 Z;  2A68 F;  4H0E A;  3I58 A;  3MZH A;  2LKP A;  1QO0 D;  3REO A;  3KLO A;  5J8F A;  1A04 A;  3IKT A;  1IUY A;  3IKV A;  4U0Y A;  4LG0 A;  1O3Q A;  2EFN A;  2IP2 A;  1R1U A;  1DUX C;  4LLN A;  2RQP A;  1EH7 A;  4U7B A;  1DP7 P;  2YPR A;  1TLH B;  3BPX A;  1T0F A;  4DNC A;  1F5T A;  2HEO A;  5L3F A;  4G8X A;  4CYD A;  3BJA A;  5BS6 A;  3ZPL A;  4HLY A;  2L54 A;  5D5X B;  2H6B A;  1MKM A;  1BJA A;  2IVM A;  2G7U A;  3KP3 A;  2Q2E A;  2P6S A;  3U9G A;  3QPT A;  1K78 A;  1FLI A;  3GO5 A;  4D0P A;  5L3E A;  5ICE A;  3R60 A;  1SFE A;  2FXA A;  2OA4 A;  3DP7 A;  2H6C A;  3WTX C;  3D5L A;  3HTU A;  2XRN A;  1TBX A;  2QQA A;  2RKH A;  3HRU A;  1FOK A;  3EET A;  4EJU A;  4RB0 A;  2P5V A;  2HKX A;  1XD7 A;  2G7H A;  2YR2 A;  4LK1 F;  1ON2 A;  1IN8 A;  3GZ6 A;  2OU2 A;  1XB4 A;  4N0B A;  3KP7 A;  1P2F A;  3C7J A;  3EYY A;  1T2K A;  2DU9 A;  4U0W A;  4R79 A;  4PGH A;  4MEX F;  1ULY A;  3VB2 A;  4G6Q A;  1ZRE A;  5E8G A;  1R7J A;  2VC0 A;  3F21 A;  2EJR A;  1STZ A;  1FYM A;  2DI3 A;  2Y0M A;  3WTS C;  3CUQ B;  1B6A A;  2MA3 A;  3WU1 B;  3NEU A;  3FX3 A;  1V3F A;  3T5X A;  1ZGJ A;  2RVC A;  3DQV C;  5H6Q A;  1Z91 A;  4MTD A;  3FMR A;  5CVR A;  2ZBK A;  4A0Y A;  2Z9O A;  1L0O C;  4UXN A;  1ZG3 A;  2NRA C;  5E18 F;  2NNN A;  5BMZ A;  2A6E F;  1W5T A;  1UB9 A;  2HFH A;  5J6X A;  3E5Q A;  1ZRD A;  3ROU A;  5LEJ A;  1FC3 A;  3CUQ A;  1MJ9 A;  4K2E A;  1J0R A;  3HOT A;  3SHF A;  4GO1 A;  4MQV A;  2MH2 A;  2DQL A;  5HOO A;  3ECO A;  5CVI A;  4O3M A;  5CLS A;  2EK5 A;  1D8J A;  1YFH A;  3GUD A;  4CXF A;  2F5F A;  1R22 A;  4BNC A;  1IRF A;  3HUG A;  4KDP A;  2ELH A;  3HIF A;  5ILV A;  3ERE D;  2D45 A;  2H94 A;  1YS7 A;  3TDZ C;  3KP6 A;  1FPQ A;  5EEG A;  4HBL A;  4RAZ A;  2OZU A;  2PI0 A;  3CDH A;  3FM3 A;  2JPC A;  2VOP A;  2ZO4 A;  4HA8 A;  4I0B A;  1V4R A;  3O2P E;  1Z05 A;  1SD6 A;  3C18 A;  1HKT A;  5FFX A;  4HDV A;  1U5T C;  2FU4 A;  5DYM A;  1ZRC A;  4G94 A;  1R1T A;  4KA4 A;  2ESH A;  4R1H A;  4NB5 A;  4EM0 B;  1F4K A;  1WSU A;  4M9S A;  4A5N A;  4M9X A;  2FA5 A;  1GXP A;  3QOP A;  4ZYE A;  2WTE A;  4B8X A;  4OOI A;  2RN7 A;  1ZYR F;  5K5R A;  4HV5 A;  1J9I A;  1BBY A;  3DXJ F;  4MTE A;  2CGP A;  1BC8 C;  4Q47 A;  2VBZ A;  4CDG A;  4KN7 X;  1YIO A;  1D5V A;  1KU3 A;  1FSE A;  2MC3 A;  3FXU A;  1ZRF A;  3GVA A;  1ZGA A;  1USS A;  3TOA A;  1FX7 A;  3I4P A;  1BIA A;  1KU2 A;  3CLO A;  3V8L A;  1LDK B;  4HAM A;  1QBJ A;  2Q8K A;  2DPD A;  2XAS A;  4AIH A;  3DPT A;  5IT3 A;  2QBY B;  1T6S A;  1PP8 F;  2CG4 A;  2QM3 A;  3E5X A;  3R6S A;  3GZ5 A;  2XVC A;  5IT9 Z;  2UXN A;  1G6N A;  1MJA A;  3KFW X;  2HYG D;  3IRQ A;  2NAZ A;  3P9C A;  2ZNY A;  4MQ9 F;  1UST A;  1RUN A;  3IWF A;  3TO7 A;  2O3F A;  5D8K B;  1O57 A;  1BC7 C;  2L4A A;  1FYL A;  2J5P A;  5D6F A;  3O6B B;  3QP5 A;  1B59 A;  3Q9V A;  5JFR A;  2XUB A;  1EV7 A;  4KIC A;  3R61 A;  5HS9 A;  1P6R A;  4MGR A;  2PMU A;  2XGX A;  2FML A;  2VT2 A;  1I5Z A;  4I09 A;  1U2W A;  2J5O A;  1IN5 A;  1I1G A;  1HBX G;  3K69 A;  4L5I A;  4BHB A;  1ZLK A;  4ENN A;  2PBI A;  3TOB A;  1HKS A;  1K7A A;  5F6F A;  3NRV A;  4A6D A;  2XRO A;  3HTS B;  3V7S A;  4LLL A;  2O8X A;  4ZYH A;  5FFZ A;  3HOS A;  2EA4 A;  4HDU A;  1X3U A;  2X4H A;  4U7D A;  2E1N A;  2VBW A;  1Y0U A;  2L01 A;  4KFC A;  5JI6 A;  4UHT A;  3OOP A;  4S04 A;  1OYW A;  1ZG5 A;  3J81 K;  3G73 A;  5A2Q K;  3J7A O;  3LAJ A;  3C1D A;  3ZMD A;  3WOD F;  3WTZ A;  2RDP A;  2W84 A;  1JE8 A;  1IAW A;  1K79 A;  2UXX A;  2EFQ A;  2K27 A;  3RYP A;  3GFJ A;  3RPU A;  3E97 A;  3HHH A;  2FSW A;  3HRT A;  3VEP A;  1YW7 A;  1OMI A;  1C0W A;  3DV8 A;  2CFX A;  4EM2 A;  5HDK A;  4RGU A;  2ESN A;  4IHS A;  2D1V A;  2VN2 A;  4Y13 A;  4PZJ A;  2BYV E;  3FZV A;  3WE2 A;  4UV9 A;  2Q0O A;  3LA7 A;  1XSD A;  3ABU A;  3SZP A;  5DUI A;  2V9V A;  3RDI A;  1G3S A;  2WC2 A;  3W6K B;  3MAJ A;  4A2U A;  3V8J A;  1YYV A;  3EDP A;  3M9A A;  2VT3 A;  2DQR A;  2DO7 A;  1U5T B;  3GYH X;  2O0Y A;  4ZZD A;  2GZW A;  2DBB A;  3FHZ A;  1TQI A;  4IHT A;  2LSO A;  1XSV A;  4FX0 A;  1MJB A;  3H92 A;  5DCM B;  1QGP A;  5JR3 A;  4RGS A;  2A3S A;  2AXL A;  3WGH A;  3L09 A;  1K78 B;  2K86 A;  3C3W A;  4B09 A;  1HW5 A;  3WGG A;  4RGX A;  3TO6 A;  3R0J A;  2QLZ A;  2NNY A;  1U5T A;  5K5Q A;  2ISZ A;  1D8K A;  3I64 A;  1PUE E;  3E6C C;  4HF1 A;  5DCM A;  2BEO A;  4KIG A;  3VOE A;  5LGN A;  4WF2 A;  1QZY A;  4MNU A;  4UVC A;  2QVO A;  3QRF F;  3V8K A;  3W6J B;  1WKM A;  2FRH A;  4HF2 A;  2PMH A;  1CF7 B;  1BI2 A;  2DW4 A;  4A0X A;  5LHG A;  1I27 A;  1IRG A;  2VXZ A;  3K1P A;  2AS5 F;  4N9I A;  4A6E A;  3TO9 A;  3ECH A;  2P5K A;  3IRR A;  5FGM A;  3L2C A;  2FBI A;  5E8I A;  4WCG A;  2JZY A;  1CF7 A;  3LQQ A;  4KIB A;  1YS6 A;  5D5U B;  1LDD A;  4WXD A;  1ZH5 A;  3SQN A;  3WTV C;  3F6O A;  1XSX A;  5LGT A;  1U78 A;  2GXB A;  5ICG A;  1IF1 A;  1ZAO A;  4ENK A;  1JGS A;  1ZAR A;  2DK8 A;  4IJA A;  5E1X A;  3LAP A;  4ETS A;  1R5H A;  1W7P D;  4WK8 F;  1QZZ A;  4O6J A;  3KEO A;  3GFI A;  2CWE A;  5CVV A;  1LEA A;  1ON1 A;  5KK1 A;  4MHG A;  4EM1 A;  1LJ9 A;  1QQI A;  4OIN F;  2JTV A;  2WV0 A;  4JBA A;  4EVI A;  1FZP B;  2DPU A;  2B0L A;  2QZ8 A;  3EUH A;  4P96 A;  4UVA A;  3FF5 A;  1R36 A;  4RB1 A;  1RUO A;  2Z5U A;  4L5J A;  2NS0 A;  4IRG A;  2DLL A;  3ZMS A;  2A5Y B;  4S05 A;  1H9T A;  2V1U A;  4HX7 A;  3M7G A;  4IRI A;  4FX4 A;  3HSE A;  2ZXJ A;  4LK0 F;  4ZYG A;  3N97 A;  1NHA A;  2RGV A;  1SD7 A;  3HSF A;  2LDU A;  1HSJ A;  2LF7 A;  4E70 A;  1OPC A;  1UHM A;  3JTH A;  2BV6 A;  1UHW A;  1BIB A;  1LB2 A;  3P9K A;  4ZYD A;  2V1X A;  4Q48 A;  2K4J A;  4MEY F;  2XKO A;  3Q5F A;  4L0Y B;  3TGN A;  2F5C A;  3RYR A;  2HS5 A;  4U0V A;  3ZQ7 A;  3E6M A;  2ZJ2 A;  3BJO A;  3BWG A;  1O7L A;  4OIQ F;  1G3T A;  3HHG A;  3K2Z A;  1IN6 A;  2YX4 A;  2ZNZ A;  4EGZ A;  2QWW A;  4HQE A;  1F1Z A;  3KZZ A;  3R4K A;  3F3X A;  3GX4 X;  1HXD A;  3TQN A;  1BN5 A;  5HDN A;  2M87 A;  2BE5 F;  4PGG A;  1JHH A;  3M1E A;  1YLF A;  1LEB A;  1H0M A;  1FSH A;  1Z1D A;  3BJ6 A;  4IVN A;  1J5Y A;  2ACJ A;  1B9N A;  4I2O A;  2DTR A;  2QQ9 A;  3FM5 A;  2F5D A;  4PCQ A;  3CO6 C;  1KQ0 A;  1XMA A;  1D3Y A;  1XGS A;  4HQM A;  2W24 A;  1XDU A;  2K4B A;  1HW1 A;  2KJB A;  3HYI A;  5JHU A;  2ZME B;  2HZT A;  4XRF A;  4PDK A;  2PN6 A;  1T38 A;  4TV7 A;  4N9H A;  4ON0 A;  1B4A A;  1RI7 A;  1Z6T A;  5E20 A;  5HDG A;  2IW5 A;  4P5O A;  4I98 B;  1KYW A;  4IPA A;  2IPQ X;  2KIF A;  1GVJ A;  1IW7 F;  2HTJ A;  3QU3 A;  4L9N A;  4Y17 A;  1R58 A;  1U6G A;  2R7F A;  1Z6R A;  5D6E A;  2PJP A;  2QEN A;  4CZZ A;  1FT9 A;  1HQC A;  1WWX A;  2ZME A;  3FXR A;  5TJJ A;  4KYW A;  3AAF A;  4GXO A;  4LJZ F;  3KE2 A;  1HKQ A;  5DDG A;  4EJT A;  2P7V B;  1XDS A;  2ZFW A;  1ZLJ A;  1K6O A;  2HR3 A;  4CGZ A;  5LGU A;  2FQ3 A;  5DD4 A;  3ZMV A;  1T39 A;  5DD8 A;  3JAM K;  5BQT A;  4UVB A;  3ABT A;  4GYG A;  3PQK A;  2PQ8 A;  5J8C A;  2HGC A;  4AWX B;  2M1B A;  2V6C A;  4P9U A;  2PEX A;  5H6R A;  1P92 A;  5HS8 A;  2O03 A;  1PDN C;  5H20 A;  2IA2 A;  1RZ4 A;  5LHI A;  5LEK A;  2CSO A;  2HWV A;  5TRD A;  3J81 Z;  4ESF A;  4BH9 A;  4FHT A;  4LB6 B;  1UFM A;  2X0L A;  4EJV A;  3WTW C;  1XGO A;  3DEU A;  3VFZ A;  1IXC A;  2R3S A;  3V7R A;  4EJO A;  1G3W A;  4BAY A;  2W85 A;  2PLY A;  3JTG A;  5HLH A;  4G7H F;  4EMS A;  2EFW A;  1ZHF A;  5BPD A;  4BYY A;  1AOY A;  4BXU A;  3IC7 A;  1BM9 A;  4A5M A;  2IA1 A;  4KMU X;  1O3T A;  3S2W A;  4YG2 F;  4WX9 A;  5DV5 A;  2EFP A;  2DT5 A;  3E6B A;  4WXC A;  5JVT A;  5DUK A;  2O61 A;  3ZMZ A;  3BP8 A;  3LST A;  3QP6 A;  4M6Y A;  1YW8 A;  3WE3 A;  5E1W A;  2ISY A;  1CGP A;  5ERI A;  4L9T A;  1P4W A;  2HQR A;  1YTY A;  2P5L C;  2LF8 A;  2CO5 A;  2OD5 A;  4U88 A;  4HZF A;  2STT A;  5CVJ A;  1Z9C A;  4FT8 A;  2HDC A;  1O3S A;  1EH8 A;  4LGW A;  4LFU A;  2XKP A;  2P7C B;  2DAO A;  3IL2 A;  2VE9 A;  2O6G E;  3ZN0 A;  1EH6 A;  5F64 A;  2UWM A;  3ZN1 A;  1KU9 A;  5E17 F;  4GGG A;  4CO8 A;  4RAY A;  2EV0 A;  4EV0 A;  1W7P B;  1TTY A;  5ED4 A;  3RKY A;  4Q4Z F;  1YG2 A;  2F5E A;  5E1Z B;  2EB7 A;  2CQK A;  5D5V B;  4EGY A;  4LB5 A;  3RPQ A;  2Z99 A;  4F7Z A;  1KU7 A;  3F8N A;  4L0Z B;  3KET A;  4UUV A;  1B9M A;  3V4G A;  4RB2 C;  4ZH4 F;  2VBX A;  1W7P A;  2R7D A;  1HST A;  2K02 A;  5HLG A;  3KLN A;  3P9I A;  1MDM A;  3GF2 A;  4BHP A;  1BI3 A;  3M8F A;  4AVP A;  2A69 F;  4I01 A;  1O7F A;  4HLX A;  1JXS A;  1S7A A;  4Y15 A;  3SZT A;  3LA2 A;  2V1D A;  2IT0 A;  2RNJ A;  3ELK A;  1E17 A;  3FXQ A;  4EJW A;  3QAH A;  2NYX A;  3QU6 A;  1WI9 A;  2KRF A;  2BGC A;  3Q9S A;  2L4M A;  3BPV A;  3GLX A;  3E6D A;  1Q1H A;  3MZY A;  4JQF A;  2Z33 A;  3JSO A;  3V7C A;  3RTR A;  2A07 F;  2TDX A;  2OZ6 A;  2HQN A;  4QWQ A;  2YX7 A;  3ULQ B;  3MFK A;  2UZK A;  4LLG F;  1OYY A;  5FLX K;  1RIO H;  1GHC A;  1OR7 A;  2KKO A;  4BQA A;  4HX8 A;  1S6L A;  3SFZ A;  1P4A A;  1SFU A;  3ZMT A;  2L02 A;  2P4W A;  2VON A;  3F8B A;  5AON A;  3BRO A;  1FP1 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...