1U2WA

Crystal structure of the staphylococcus aureus pi258 cadc
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
109
structure length
105
Chain Sequence
GYDEEKVNRIQGDLQTVDISGVSQILKAIADENRAKITYALCQDEELCVCDIANILGVTIANASHHLRTLYKQGVVNFRLALYSLGDEHIRQIMMIALAHKKEVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cadmium efflux system accessory protein
publication title Crystal structure of the Staphylococcus aureus pI258 CadC Cd(II)/Pb(II)/Zn(II)-responsive repressor
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Dna binding protein
total genus 35
structure length 105
sequence length 109
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1u2wA00
4EQQA 2M45A 3RKYA 4Y17A 4YFNF 2IPQX 1EH7A 1FWZA 1IRFA 3W6JB 3DFGA 1CF7A 3EUHA 1IN7A 2TDXA 4IRGA 2Z9OA 2OA4A 2OQGA 1SFUA 4LLNA 2OAZA 4EMSA 1K79A 2ELHA 3RJPA 1QZZA 2A69F 3JSOA 1Z9CA 1W7PB 3HIFA 2OBPA 5ICEA 3KZYA 1V4RA 4DQ2A 3PFIA 1R5GA 1ZGAA 1KQ8A 2H6BA 4WX9A 2HDCA 3V4GA 3CUQB 2STWA 1USSA 4IRHA 2L4MA 4NB5A 2XV4S 4FT8A 4I02A 4RS8A 1XSXA 3NEUA 2VT3A 2NNYA 4F7ZA 1SFEA 1S3JA 3VODA 4LG0B 4BXUA 3J7AO 2RV8A 3GUDA 4QWQA 1PP7U 4EGYA 2D1VA 1U6GA 4I01A 2P6TA 3IKVA 2K27A 5DCFA 3QAHA 3D0SA 1O3TA 2Q0OA 5BPIA 3HOSA 3ZMTA 1KA8A 3D5LA 2KIFA 1IN5A 4UUVA 3MQ0A 3J80Z 4OIOF 2MH2A 3HHGA 2EA2A 1FC3A 5K5RA 1JHFA 2MH9A 4MEXF 4HQMA 4ENNA 3ZN0A 2YSRA 1IN8A 4OMYA 4L5JA 3DXJF 4MEYF 3H92A 2ZKZA 2A6EF 5FLXZ 1O3QA 3WTUC 3E6BA 2IRFG 3TO7A 3VEPA 4HA8A 1BIBA 4IHTA 4BAYA 2IT0A 4KIBA 4G6DA 3V8KA 2NAZA 2PBIA 3QP6A 4XLPF 1XGNA 1SMTA 3WE3A 1W4MA 1EH6A 3KP6A 2HTSA 1T6SA 4LB5A 4MQ9F 1MJAA 5H20A 1R1UA 2ESNA 2WWYA 2YX4A 4CZZA 3HRTA 2P7CB 1FBQA 2FA5A 3HTUA 4A5MA 1W7PA 1J2XA 3JW4A 1OKRA 4LK0F 4AIKA 2RGVA 2PQ8A 1Z6RA 1BI2A 1YG2A 1T38A 4B09A 3CUQA 5LEJA 1XSVA 3RIRA 2QM3A 1KYZA 4OINF 4RB3C 4OIRF 4A6EA 4IJAA 3EQLF 2XAQA 3JTHA 3BJ6A 5D8LB 5IT9Z 1FP1D 4L9VA 3ZMSA 1WRJA 2VC0A 5ERIA 1JGSA 1QBJA 2W57A 2LSOA 4LG0A 2EA4A 2QWWA 4O6JA 5TJJA 1Z7UA 2J5OA 3E97A 3N4MA 3KEOA 3WG9A 4AIHA 2X0LA 1ZREA 1LDDA 3QPHA 2DQLA 3R0AA 2HYFA 3QPTA 3R4KA 2FF4A 1WQ2A 2O61A 5LHIA 1KU9A 1H9TA 3VFZA 4CO8A 2V1DA 1G6NA 3B02A 2EK5A 4HX7A 2HS5A 2GQQA 2OZUA 2M30A 1DPRA 2XROA 4PCQA 3WODF 3RI4A 2JZYA 4AIJA 4CDGA 1MDMB 4O3MA 5H6RA 4HV5A 1R7JA 1YQAA 4YIFA 3V8LA 1S8NA 3BOQA 2HKOA 1XGSA 1IW7F 4U0VA 6PAXA 2W85A 2A68F 2XUBA 4KMUX 1HSJA 3SZPA 1OR7A 1BC7C 5K5QA 2DFIA 2L01A 1QQIA 2CWEA 5L3CA 3DQVC 4HLYA 3PQKA 2H09A 4I0BA 3CLOA 3DV8A 3GZ5A 2DK5A 1YW9A 1LQ1A 1O7LA 5TRDA 1U8RA 3WTZA 4P5OA 2EFPA 1XGOA 1QO0D 3ERED 1D8KA 4H0EA 3BY6A 4L9NA 2ADUA 1SAXA 3WTXC 4G9YA 4BYYA 2DK8A 2VBXA 1TBXA 4Z2YA 3EYYA 3ULQB 2V9VA 3M8EA 4RB2C 5ICFA 1FP2A 3ZPLA 4L18B 3L2CA 2FXAA 3IWFA 5EEGA 2RKHA 4RGXA 4S05A 3KZZA 3E5XA 1ZRDA 3NRVA 4UXNA 4HDVA 3F23A 1ODDA 3J80K 3ZQ7A 2PLYA 3LQRA 4OU0A 2O03A 2Y0MA 3GX4X 1BBYA 1K78B 1HXDA 2EJRA 1HKQA 4U7DA 3E5UA 5FFXA 5CVVA 3L00A 5ICCA 5E18F 4FX4A 3W6KB 5D8KB 4KDPA 4YFKF 1B59A 1PUEE 2EFQA 5E1XA 1ZRFA 3COAC 2RC4A 3L9FA 3FM3A 1L3LA 3HOTA 1IZ1A 2UWMA 3HTSB 4OIQF 5LLQA 4I7HA 4EJVA 1XN7A 4R79A 2FSWA 2CGPA 3KEQA 5ILVA 2RN7A 3FMRA 1JHHA 3KP4A 2VE9A 1HSTA 2B0LA 2HFHA 3REOA 3BROA 2FOKA 1ZAOA 2M1BA 4ENKA 3R61A 4GYIA 5ILSA 1RIOH 3VOEA 5JVTA 1AOYA 1S7OA 2K02A 1D3YA 2QBYB 2EB7A 1XMKA 4KIFA 1OYIA 1R22A 3I58A 3O2PE 1WKMA 2GA1A 3K0LA 1LEBA 2X4HA 1QPMA 4GO1A 4AVPA 2AXLA 3QU3A 4EM0B 3I59B 4IVNA 3FM5A 3LAJA 3ZP5A 3BPVA 3MCZA 1PDNC 2LDUA 4AD9A 2QVOA 2BE5F 4HF0A 1KQ0A 1UHWA 2JSCA 2D45A 5FD5A 1XB4A 1HBXG 2NYXA 2F5CA 2F5DA 2CG4A 3GEZA 1Z1DA 2W84A 1T39A 2E7XA 1J59A 1DDNA 3F3XA 1H0MA 4KNYA 1K78A 3ZMZA 2PJPA 2VBWA 2YR2A 5D6EA 1YIOA 3P9IA 1ZN2A 3F21A 3C18A 2MA3A 3N97A 2ETHA 3QOPA 1K7AA 5JI6A 2FE3A 1ZARA 1R00A 5HOOA 2CO5A 2COMA 1FLIA 2FBHA 3K9TA 3LA7A 1R5HA 4IXAA 1I1GA 4U0WA 3ABTA 5ICGA 5J6XA 3CJNA 2EV5A 2P7VB 2FQ3A 4I98B 2R7FA 2D2WA 4BHPA 1YYVA 3FXUA 4IF4A 4MNUA 3ECHA 4P9FA 3J81K 1U78A 2FMYA 1MKMA 1LDJA 1KU3A 4M72A 2JPBA 2ACJA 4HV6A 1PP8F 1FPQA 5BMZA 2V1UA 2QBYA 4KFCA 1E2XA 4LLLA 1FYLA 3FX3A 2RVCA 4M9SA 5D4RA 4GXOA 3BZ6A 5JHUA 5A2QK 4FX0A 2AS5F 3HSFA 1YS7A 2Z5UA 2IA0A 3IRQA 4A0XA 3HRUA 3P9KA 1IRGA 2QUFA 1IF1A 4L9JA 4N9IA 2HGCA 4UNOA 3I59A 2FNAA 2HYGD 1XCVA 3RYRA 1MJ9A 1VTNC 4YIIA 1FOKA 2DI3A 5BPDA 4HAMA 4N9HA 4ZYGA 1LVAA 4GGGA 3ZN1A 4A6DA 1XGMA 1ZLJA 2VBZA 1I1SA 2Q2EA 1SD5A 2FU4A 1ZLKA 2ESHA 2A6HF 5AONA 1B4AA 4UHTA 3F8CA 1RI7A 3S2WA 3Q5FA 1D5VA 1TQPA 2HWVA 4BQAA 3ELKA 2G9WA 3L7WA 3FF5A 3BJOA 1XCBA 1RUOA 2ZMEB 2Y75A 3QP5A 4IRIA 3IKTA 3MFKA 4M6XA 3CO6C 4U88A 2L3DA 1X3UA 1QNTA 3DPLC 5L3EA 5HLHA 1JXSA 3MZHA 5DD4A 4LK1F 1USTA 2F2EA 3JAMZ 4G7OF 3BP8A 5AIQA 2W25A 4D0PA 1BC8C 3IC7A 3WTSC 1BM9A 5F64A 5DV5A 4RB0A 3GZ6A 1STZA 2DPDA 4WXDA 1HW2A 1DP7P 3SXYA 4R8HA 4I09A 2QLZA 4G8XA 1J7KA 4FHTA 4G7ZF 1GHCA 4A2UA 3E3VA 3LSTA 2A3SA 3CO7C 3GVAA 2OD5A 4MHGA 1G4DA 2WC2A 2Z3YA 2IP2A 2KKOA 1FSEA 1W7PD 4PGGA 1P4XA 3TGNA 2IW5A 2DLLA 1KQ9A 1I6XA 3BDDA 3RPQA 3KCCA 3M8FA 1WI9A 4LMYA 1FBUA 2WTEA 5E8GA 2OU2A 1YTYA 5FB2A 3FMQA 4PGHA 4KYWA 2XHKA 1EV7A 1QGPA 4KT5C 2EFWA 1G3TA 3AAFA 4BHBA 2RNJA 4DNCA 4O5VA 2YPRA 5D5WB 2R7DA 2RDPA 5HDKA 4L5IA 3ROUA 3GFIA 2H6CA 2L54A 2UXXA 4IPAA 3ML6A 2ZMEA 3KLNA 3IHUA 4Q5SF 1ZG5A 2A5YB 2PI0A 3WTYC 4HZFA 2A07F 2ZNYA 5IT3A 2EFNA 2BYVE 3CTAA 3FZVA 2Z99A 3NQOA 1ON1A 2YX7A 1A04A 1R58A 2E7WA 1R23A 2CSOA 2IA2A 2C6YA 5FGMA 3F8NA 3M1EA 1XMAA 4ESBA 4NHJA 1F4KA 2J5PA 2HTJA 2XRNA 1OYYA 3FXQA 2HOEA 2OQRA 4L9TA 4EGZA 3R6SA 4XBFA 4WWCA 1JE8A 2K4BA 3K1NA 3KP2A 1XSDA 2DT5A 4UVCA 5BQTA 4CGZA 3H3ZA 3FWEA 2UXNA 1FZPB 5CVIA 4HLXA 1Q1HA 1OYWA 1HQCA 2V1XA 3M7GA 3GYHX 2HZTA 3GXOA 2NS0A 3IL2A 4LLGF 4P9UA 4RGSA 2ISYA 3IWZA 4PDKA 4L0YB 2O3FA 5LHHA 3GFLA 1Y0UA 4HF2A 5EEHA 1BI0A 1UCRA 1ON2A 5FLXK 3TDZC 5E8IA 1SD6A 4KICA 1KGSA 4XSZF 1TNSA 2M87A 2JPCA 1ZYRF 1S29A 4RB1A 2BGCA 4U0YA 2CW0F 1MDMA 1BI3A 5DCMB 1S7AA 5LGTA 1WWXA 4ENMA 2H94A 3QRFF 1YW7A 4HYEA 2ZO4A 2HEOA 3JAMK 1O7FA 4LJZF 2JRTA 1HW1A 3OV8A 5D5XB 3JTGA 4UV8A 2W24A 1B6AA 3B73A 2XVCA 5ED4A 4Q48A 1LNWA 2K4JA 1MJBA 2G7UA 1XD7A 2ZBKA 3F8FA 5LGNA 3C3WA 1BI1A 3HRSA 4M9ZA 2K86A 5FO5A 3F72A 1FX7A 2H27A 5IT9K 4P55A 5L3DA 3U1DA 2MBFA 3GF2A 1TNTA 4Q47A 2MLGA 2O6GE 1WSUA 2NNNA 5CJ9A 1FBSA 2VC1A 4MGRA 1R1VA 1Z05A 3GFMA 3KP7A 1F5TA 5F6FA 3WGGA 5D4SA 1IXSB 1O57A 1G3SA 5E20A 1IAWA 1MD0A 3FHZA 4HX8A 3L09A 2LKPA 2UZKA 5FFZA 4KA4A 3P7NA 3K1MA 3TDUC 4Y13A 3KFWX 1L0OC 2XAGA 5DDGA 3ZMDA 1FYMA 5HLIA 1D8JA 3HSEA 2DAOA 3TO6A 4GYGA 1FYKA 3F8BA 5CVRA 5HS8A 2K7LA 5LEKA 1IN6A 4MTEA 4OOIA 3ZMVA 2DPUA 3G73A 4ZYEA 3LWFA 4JQFA 5JFRA 4CYDA 1XDSA 2VXZA 5ILUA 3C7JA 2HR3A 4BNCA 2FBKA 3HHHA 4EJTA 4M74A 4Y15A 1UFMA 2Z33A 3T5XA 2P4WA 2VONA 4ON0A 4RAZA 5L3BA 1J0RA 2VOPA 4UVAA 3MAJA 3WGHA 3RDIA 1REPC 1G3YA 1K6OA 2OZ6A 4QLCU 4HOBA 5D5UB 4S04A 2XIGA 2XASA 2FEZA 3TOBA 3Q9SA 2XAJA 5E17F 4M73A 1LB2A 4XSXF 1U2WA 2P5VA 1P2FA 2KRFA 3HYIA 1KU2A 5LRRA 2ZNZA 2PMUA 1ZHFA 2DU9A 4XLNF 1TW2A 2LNBA 4EJWA 3I0TA 3RTRA 2GZWA 5DYMA 5CYVA 3V7CA 3WTVC 1B9NA 1YW8A 1V3FA 3V7RA 2FRHA 4KN7X 4EV0A 3TQNA 1LEAA 2O0YA 4XRFA 1FSHA 2JT1A 1T98A 2IJLA 1U5TC 5J8FA 2E1CA 2LF8A 2DTRA 5LGUA 1W5SA 1SD4A 4ENJA 2GXBA 1OPCA 1NHAA 1LDKB 3K2ZA 3E5QA 3WU1B 5D5VB 4A0ZA 3MWMA 2QENA 2XGXA 3F6OA 2VODA 2GAUA 2F5EA 4CXFA 2VOOA 2XKOA 5HS9A 3GW2A 3LFKA 2G7HA 5E1ZB 4AWXB 1TTYA 5LBQA 3P9CA 4WF2A 3I5UA 2ZXJA 4HDUA 2CFXA 1F9NA 3V8JA 5KVRA 2P5LC 5D6FA 1RUNA 1SD7A 2PFBA 4YFXF 4L0ZB 4CICA 3I64A 3WGIA 1S6LA 1FT9A 3GLXA 4BHCA 3DKWA 1GXQA 3PQJA 2YU3A 4HQEA 4OMZA 1FY7A 4RGUA 5KK1A 1OMIA 2MC3A 2BBYA 3ECOA 5BOXA 3FMSA 2DO7A 4JK1X 2M5WA 1U3EM 5HLGA 4HW0A 1O3RA 2GXGA 3QU6A 1XDUA 2CYYA 1YS6A 3C1DA 3EYIA 2QZ8A 4K2EA 2VE8A 2EFOA 2QYOA 1RZ4A 3HSRA 1ONVA 3KLOA 1DPUA 1G3WA 1T2KA 2FBIA 1ZH5A 3TKYA 3MEXA 3LA3A 4WXHA 4G7HF 3DF8A 3F22A 4OIPF 1C0WA 5K1YA 4YG2F 1ZGJA 3HUGA 2XAHA 4LFUA 1GVJA 3BJAA 1R36A 4M6YA 4RAYA 3LQQA 3WTTC 5J8CA 2KJCA 4I0AA 1YFHA 3R60A 2Q8KA 1HW5A 4E70A 5HDNA 1ULYA 4BH9A 3HRMA 4ZZDA 2IA1A 3WE2A 1HKTA 2MD5A 2ZFWA 4NQWA 3F8MA 3O6BB 2VT2A 1J9IA 2V6CA 3K1PA 2XAFA 1E17A 4EVIA 1FNNA 4ESJA 4A0YA 3ABUA 3RKWA 1P4AA 3GFJA 3O3KA 3U9GA 4ZYDA 3KE2A 3TO9A 2KJBA 3KP3A 1MGTA 4WK8F 4P96A 3SZTA 3EDPA 1H9GA 4ETSA 2QQBA 2WV0A 4MTDA 5H6QA 3KP5A 5HVQC 2CQKA 1KYWA 1Z91A 2VN2A 2V79A 5HS7A 1BOAA 1I5ZA 3EETA 1UHMA 2P6SA 1IN4A 2KIUA 1TLHB 1SFXA 3E6MA 4KUMA 4N0BA 4UV9A 1HKSA 4HBLA 3CUQC 2EV6A 4G94A 2VBYA 3RYPA 2EWNA 1J75A 2GIVA 5HDGA 1DUXC 2D1HA 5JR3A 3DPTA 5LRSA 5E1WA 3BWGA 4Q4ZF 3T1BA 1BN5A 5DEQA 3T8TA 2FMLA 3J81Z 4KIGA 3MZYA 2L02A 4G6QA 3DEUA 2DW4A 1O3SA 2LF7A 3CDHA 3I53A 2HKXA 3RKXA 3K69A 3FXRA 1R1TA 4UVBA 3OOPA 1QZYA 2HQNA 1U5TB 4RGRA 1ZRCA 4I2OA 5A2QZ 1ZG1A 3LA2A 2F5FA 2DQRA 1B9MA 3U2RA 2P5KA 5DD8A 3T0YA 3E6DA 4CHUA 5K5OA 3T8RA 3I54A 4U7BA 3V7SA 2BV6A 4A5NA 3Q9VA 4LB6B 2HQRA 2GA2A 3SFZA 2P8TA 1P92A 1YLFA 1P6RA 3GWZA 1SMYF 1UB9A 4KMFA 2ZCWA 1ZG3A 2NRAC 2L4AA 3VB2A 2XKPA 3ISPA 4ZZLA 5DUKA 1MZBA 2GWRA 5CVUA 3DP7A 3BPXA 2PMHA 5LHGA 3SQNA 3G3ZA 3LAPA 4WCGA 5DUIA 5L3FA 1CF7B 3F6VA 4HX4A 1TQIA 3E6CC 4ASNA 3GO5A 2ZJ2A 2R3SA 3R0JA 1I27A 5AIPA 1J5YA 1B1BA 2M8EA 1RNLA 2RQPA 4HF1A 5L3GA 4ZYHA 4B8XA 4LGWA 3I4PA 4M9XA 4GCVA 1YO5C 2FNPA 2O8XA 2EV0A 3SHFA 1IXRC 4EJUA 1P4WA 4PZJA 1F1ZA 2MLKA 3JSPA 4MQVA 1CGPA 3ZMUA 2A61A 2PG4A 2DBBA 4IHSA 1T0FA 3WTWC 4WXCA 1W5TA 3CUOA 4R1HA 1LJ9A 5CLSA 1GXPA 2BEOA 4TV7A 1U5TA 2PEXA 5BS6A 4EM1A 3WU0A 1TQMA 5CVJA 3TOAA 4LD5A 2E1NA 1BIAA 3IRRA 4ESFA 1Z6TA 5FD6A 2STTA 4A12A 2Y48A 3M9AA 1KU7A 1IUYA 2ISZA 2QQAA 3RPUA 3H3UA 4EJOA 5DCMA 1EH8A 5F1RA 1BJAA 2PN6A 2JTVA 1AWCA 2IVMA 2KIMA 4KN4X 4JBAA 2QQ9A 4M71A 4EM2A 3I71A 1IXCA 4ZH4F 1TW3A 3KETA
chains in the Genus database with same CATH superfamily
4ZDLA 4EQQA 2M45A 1VQOI 3RKYA 1Y56A 4Y17A 4YFNF 5J4VA 4BDZA 3S8PA 2IPQX 1MBHA 1F36A 4KISA 1EH7A 3L2WA 3CJRB 3FXLA 1FWZA 1IRFA 3W6JB 3DFGA 4C9YA 1CF7A 3EUHA 2NVQJ 1IN7A 2TDXA 4IRGA 4RM2A 4Y7NJ 2ZJQF 2Z9OA 2OA4A 2R7OA 2OQGA 3PSIA 1SFUA 1RETA 4LLNA 4IL6C 2OAZA 1W0TA 4HPQA 4EMSA 1TL8A 2ELHA 1K79A 3RJPA 1QZZA 2A69F 2MYSA 3ESWB 3JSOA 1Z9CA 1W7PB 2K9QA 2H1LA 4IHYA 3HIFA 2OBPA 4N4OB 4XL9A 1T95A 1QVTA 1N77A 5ICEA 3KZYA 1V4RA 4DQ2A 2KLOA 3PFIA 2DA7A 3K4NA 2R93J 5EG0B 1R5GA 1ZGAA 1KQ8A 1V54H 2H6BA 1X1CA 1WJDA 4WX9A 2HDCA 3V4GA 3SYTA 3CUQB 2DDBA 3OIPA 3BR2A 2STWA 1USSA 5JLXA 4IRHA 2L4MA 2IS1A 4NB5A 1Y6IA 2XV4S 5F27A 4FT8A 4I02A 4RS8A 2CRGA 1UMQA 2KDOA 1XSXA 2MSYA 3JRBA 3NEUA 2L5QA 2VT3A 2NNYA 4F7ZA 1FMVA 1ZGWA 2MG4A 1SFEA 4GFBA 1S3JA 2TRTA 3VODA 4LG0B 4B3AA 4AIDA 4E7JA 1Z3YA 2BOLA 4BXUA 3J7AO 2RV8A 1CQTA 4CZCA 3GUDA 2M2EA 4QWQA 4QSHA 1PP7U 2L9VA 4F55A 3N05A 4EGYA 4M3DA 1W36D 2D1VA 2LBFA 3FBNB 1K4TA 2V6EA 1U6GA 4I01A 2P6TA 3IKVA 1IG7A 3J7AY 2K27A 1M1EB 1U9NA 5DCFA 2JA8J 3QAHA 2ZB9A 3D0SA 1O3TA 4RMNA 2Q0OA 2L9SA 4B4CA 5BPIA 3A01A 1IJWC 3HOSA 3ZMTA 1KA8A 3D5LA 2KIFA 5F08A 1IN5A 1VF9A 1KZHA 3QODA 3VYTB 4UUVA 3E1SA 3OYIA 3MQ0A 5IOYA 3J80Z 1Z77A 4OIOF 2MH2A 4E6KG 3IH4A 4XIDA 3HHGA 2EA2A 4XRMA 2AO9A 1FC3A 5K5RA 1JHFA 2MH9A 1SAUA 4MEXF 2KP6A 4HQMA 4F91B 4ENNA 3ZN0A 1SFKA 2YSRA 4QTRA 1IN8A 2GOXB 4OMYA 4L5JA 3DXJF 4MEYF 4BS9A 5F04A 5HNFA 3H0DA 3H92A 3AG1H 2X51A 1SC7A 4Y52J 2ZKZA 3BR1A 4ABZA 2A6EF 5FLXZ 3PJRA 1O3QA 3S17J 5JHFA 4BE0A 2X1CA 1ETKA 3E6BA 3TP3A 3WTUC 1RPWA 2MGQA 2IRFG 3GTGJ 3TO7A 2M9HA 4PJNA 3JRHA 3VEPA 3CD6I 3LSPA 4HA8A 4ZYAA 1BIBA 4IHTA 4D5CA 4BAYA 2IT0A 5K7HA 3HGGA 4KIBA 4G6DA 4RA2A 3V8KA 2NAZA 2PBIA 3QP6A 1VFCA 4XLPF 5GAHJ 3S1NJ 1XGNA 2IS4A 1SMTA 3WE3A 3S2HJ 3A1YA 1W4MA 3K4CA 1EH6A 2CQQA 3KP6A 4PFPA 2HTSA 1T6SA 4LB5A 4MQ9F 1MJAA 1AU7A 5H20A 5M5WJ 1R1UA 2ESNA 2WWYA 5HNHA 3CMAI 1W36C 2YX4A 4C2UA 3SEZA 4CZZA 3HRTA 2LY1A 4A3MJ 2DA5A 2P7CB 1FBQA 4W97A 2FA5A 3HTUA 4A5MA 3HGYA 3DCFA 1W7PA 1J2XA 1OCRH 2CW8A 3JW4A 4ZJZA 3I55I 2O9LA 1OKRA 4LK0F 4A3CJ 2OTLI 1MNMC 2ELKA 4OWRB 5CQEA 4AIKA 2RGVA 1EKEA 1Z6RA 1BI2A 1YG2A 2PQ8A 4I99C 5EG0A 2LLKA 1T38A 2WB1A 4B09A 3LSGA 2MC4A 2LYCA 2NOGA 1X2MA 3ZQIA 2WAFA 3CUQA 3FKJA 1DU6A 3I3LA 4BXXJ 3H5RA 5LEJA 3OR1C 4XONA 1XSVA 3RIRA 2QM3A 1KYZA 4LOCA 4OINF 4RB3C 1A31A 1YITI 4OIRF 4A6EA 2LD5A 4IJAA 5GPAA 1RC9A 2XAQA 3EQLF 3BJ6A 3JTHA 5D8LB 5IT9Z 1FP1D 5CKTA 5FRMA 4L9VA 4MFEA 3ZMSA 4BL0B 4NC8A 1T33A 1WRJA 3H9GA 2VC0A 5ERIA 1JGSA 1QBJA 2W57A 2ME6A 2LSOA 4BQQA 3DBLB 2JUGA 4LG0A 3I4MJ 2EA4A 2QWWA 4O6JA 4XLEA 5TJJA 1DQUA 3PO3J 1Z7UA 2J5OA 3E97A 3N4MA 4BXFA 4F93B 3M8JA 4DYCA 3KEOA 2E34A 2NOJB 3WG9A 4AIHA 2X0LA 1ZREA 1LDDA 3QPHA 1IO2A 2WAQN 4PK4A 2DXIA 2DQLA 3L2UA 3R0AA 2HYFA 3DTKA 3QPTA 3R4KA 2M7AA 2FF4A 1ZTRA 1WQ2A 2O61A 3K4LA 5LHIA 1OJLA 5M5XJ 1KU9A 3PNTA 1TWAJ 2R92J 1H9TA 1UJ8A 3VFZA 3W2WA 4CO8A 5E3OA 4BQOA 2V1DA 1G6NA 3OYHA 3B02A 2EK5A 3OOUA 4NDLA 3UR3C 4HX7A 4II2A 1EF4A 4HSRA 2HS5A 2Y0SN 2B7EA 2GQQA 2OZUA 3RZDJ 2M30A 1DPRA 4M3GA 2X6XA 1EA3A 2MABA 4DW6A 4U87A 2XROA 4PCQA 1WVRA 1BR1A 3WODF 3G71I 3RI4A 2MW8A 2JZYA 2LRDA 4AIJA 4CDGA 1MDMB 4O3MA 5H6RA 4HV5A 3OL4A 1R7JA 1YQAA 2NVYJ 3U21A 4YIFA 2EILH 1APLC 1IV8A 3V8LA 3CMEI 1S8NA 3BOQA 1XX5A 1ETWA 2HKOA 1XGSA 4AC0A 1DP3A 2F48A 2QKLB 1JT0A 1GVDA 1MSFC 5IPAA 1IW7F 4U0VA 3EUKL 6PAXA 1R6RA 2W85A 3OSGA 1X1BA 3QWLA 2A68F 2XUBA 4KMUX 1HSJA 1WH5A 1R5ID 3SZPA 2XDVA 1UHSA 1OR7A 1BC7C 5K5QA 1FIAA 1DGRM 2DFIA 2OJED 2L01A 3CCUI 1QQIA 2CWEA 5L3CA 3FXKA 3DQVC 4Z6YA 3W6VA 3ZQGA 4HLYA 3PQKA 2H09A 2BHZA 3MKYB 4I0BA 3CLOA 1K4SA 3DV8A 1RKTA 3GZ5A 2DK5A 1A36A 3S1RJ 1YW9A 5F0CA 2E36A 1LQ1A 1O7LA 5TRDA 1R4NB 1U8RA 3WTZA 3ZR8X 2VJ5A 4P5OA 3DEWA 4FE7A 4B1RA 2EFPA 4X6AJ 5J1RA 3GTLJ 1XGOA 9ANTA 3ZQHA 2F5VA 1QO0D 2KQRA 3FXJA 1HF0A 3PO2J 4X1EA 3ERED 1D8KA 1X4PA 1I39A 2W4SA 4H0EA 3BY6A 1VQ8I 4CCKA 4L9NA 2ADUA 1SAXA 4A93J 1VQKI 3WTXC 3QYFA 4G9YA 4BYYA 2DK8A 2EH3A 3AL0C 2VBXA 4G12A 1TBXA 4Z2YA 2XRLA 3EYYA 3BR6A 5BNGA 4G6TB 1MW7A 3JRIA 3ULQB 2V9VA 1NK2P 3M8EA 4RB2C 1K6YA 5ICFA 1D1BA 1VQNI 1FP2A 3ZPLA 4L18B 3L2CA 2FXAA 2R7SA 3IWFA 5EEGA 2RKHA 4RGXA 2OF7A 2ZJRF 1X2NA 4PJMA 4S05A 3KZZA 1S7EA 3E5XA 3PNYA 1ZRDA 3RKQA 3NRVA 4UXNA 4BUPA 4AU7A 4FISA 2XC7A 4HDVA 3F23A 2NVTJ 1ODDA 4V2GA 3G1OA 3J80K 2EQRA 3ZQ7A 4Y33A 2PLYA 2DMUA 3ZCOA 3LQRA 3CP2A 4OU0A 2JSPA 2O03A 2Y0MA 3HJEA 3SFIA 3A0BC 2KPMA 3GX4X 1RKWA 1BBYA 2ELJA 4C2TA 1K78B 2Y9ZA 1HXDA 5J1UA 3RCOA 3WHCA 3OS0A 2EJRA 3CDIA 3RSNA 1HKQA 2E1OA 4A3KJ 1MBGA 4EATA 4U7DA 3E5UA 5FFXA 2V4JC 2R7WA 5CVVA 3L00A 3CC7I 5ICCA 2XF7A 3OL3A 1A6IA 2ZMEC 5E18F 4FX4A 3W6KB 3GCMA 5D8KB 5J47A 4KDPA 4YFKF 5E3LA 1HC8A 1B59A 2VL8A 3CESA 1PUEE 2KIQA 1BW6A 1HDDC 2HPIA 3ABKH 2EFQA 3BR5A 4FE4A 5E1XA 1ZRFA 4BU2A 3COAC 2RC4A 3L9FA 1MMAA 3FM3A 3J7YJ 1L3LA 1X1DA 3HOTA 1TC3C 2M4GA 1IZ1A 3OYMA 1MBFA 3HTSB 2UWMA 3ZRGA 4OIQF 5LLQA 4I7HA 2IXSA 1VQ6I 2JWTA 1XN7A 4EJVA 4R79A 1ITYA 2FSWA 4BE1A 2CGPA 3KEQA 3SDGA 5ILVA 1ZKGA 2RN7A 3FMRA 2CH0A 1BJZA 5KAFC 3FXOA 4E7ZA 2F4MB 1JHHA 4BJ6C 3KP4A 2VE9A 1WPKA 3CQZJ 2WB1N 2IBDA 1HSTA 3GTKJ 2B0LA 2HFHA 3ZQLA 3REOA 4A3EJ 3LSKA 2L7FP 3BROA 1ETQA 3SEQA 2V26A 2FOKA 2L7KA 1ZAOA 2M1BA 4Y4RA 4ENKA 3R61A 4XORA 4GYIA 5ILSA 1RIOH 2BZTA 4J19A 2XGCA 3LOCA 2V7FA 3VOEA 5JVTA 1I6HJ 1AOYA 5E3MA 1WH7A 1S7OA 2K02A 2KRHA 1YIJI 3JRGA 1D3YA 2QBYB 4FETA 2EB7A 1XMKA 3TW6A 3JCUC 1K83J 3HKZA 3FXMA 4KIFA 2XB0X 1OYIA 1R22A 2LY2A 2ZXHA 2Y69H 1IV6A 1MSEC 3I58A 5IP7J 3BC8A 1JJ6C 3DU6A 1BL0A 2R7RA 2R7TA 3O2PE 1WKMA 2GA1A 4C3JJ 2WAEA 3K0LA 1LEBA 3MKLA 2X4HA 5GP9A 3BTJA 1LE8B 1P9QC 1QPMA 4GO1A 3KZIC 4AVPA 5H2FC 5EYRA 3JRFA 4B3XA 2AXLA 2XSJC 4OAYA 3AG2H 3QU3A 3PUBA 4EM0B 3BR0A 3K10A 3I59B 1F43A 2DMTA 4IVNA 3FM5A 4BE2A 3E7LA 3H36A 3BPVA 3LAJA 3ZP5A 5F0HA 1SFOJ 3OYKA 3MCZA 1PDNC 2LDUA 4AD9A 2QVOA 3H35A 3GTMJ 2CV0A 2BE5F 4HF0A 1YHQI 1KQ0A 1UHWA 2JSCA 2D45A 5FD5A 4CCOA 1XB4A 1HBXG 3S16J 2NYXA 4Y3OA 2F5CA 3CCVI 4RLQA 2F5DA 1WJAA 1YX5A 3L2QA 2CG4A 4YRVA 2DTZA 4E7LA 2Y2ZA 3GEZA 1Z1DA 3WG7H 2W84A 1T39A 3CMMA 2E7XA 3HOZJ 3LNQA 1J59A 1DDNA 5EEAA 3QYBA 3HOWJ 2Q2EB 3J7ZI 5HLTA 3AG3H 3F3XA 2O5RA 2DOEA 3Q0UA 4JX4A 1H0MA 4KNYA 4MO7A 1K78A 3ZMZA 2PJPA 2VBWA 1MMNA 3AFHA 3DKXA 2R5YA 4XM3A 2JA5J 2Q1ZB 2YR2A 2XF5A 5D6EA 1RR7A 1YIOA 3BQZA 3P9IA 2M34A 1ZN2A 3F21A 4BKXA 1YJWI 3C18A 2XPVA 2MA3A 3N97A 2LG4A 1X3ZB 2ETHA 2WAQA 1TWCJ 5KCMA 3QOPA 3O8HA 1JKPC 1K7AA 5JI6A 5C4XJ 4PJLA 4UUSB 2FE3A 1ZARA 3S93A 3TEDA 1R00A 1X1AA 5KHDA 5HOOA 2K9NA 1D1CA 2CO5A 2COMA 4RDUA 1QVUA 3F9KA 3IP4B 2FBHA 1FLIA 3JREA 2E60A 3K9TA 3LA7A 1R5HA 2X6OA 4FASD 2Y0SA 3GTJJ 4IXAA 2LY9A 1FOXA 4BDYA 1B72B 4DZJA 1I1GA 4U0WA 4IOCF 3ABTA 2CUEA 5ICGA 2B63J 5DS9A 2H8WA 3CJNA 5J6XA 3QQAA 2EV5A 2P7VB 1ZR2A 2DA1A 1TT5B 2HU9A 2FQ3A 4I98B 2AQEA 2R7FA 2D2WA 4BHPA 5TGTA 4BJ5C 1YYVA 3FXUA 4IF4A 4MNUA 3ECHA 4P9FA 3RPUD 3BR3A 2ICWG 5EZHA 3J81K 1U78A 2FMYA 2JJ7A 1XS9A 1MKMA 2X48A 2WADA 3HBLA 3VSKA 2BY0A 4BBRJ 1LDJA 1KU3A 1W5CC 2HI3A 2JPBA 4M72A 2ACJA 4HV6A 3AKZA 4B47A 1PP8F 1FPQA 5BMZA 2V1UA 2AQFA 2QBYA 2YUSA 4JYKA 2P0WA 4BQNA 4FTHA 4KFCA 1E2XA 4LLLA 3CCSI 2WY8Q 4B43A 1FYLA 1WCMJ 3FX3A 4GDFA 3H0GJ 2CQ7A 2RVCA 4M9SA 5D4RA 4GXOA 3BZ6A 5JHUA 1O4XA 4FX0A 5A2QK 2AS5F 3HSFA 3G6EI 1YS7A 2ECBA 2Z5UA 2VKHA 2IA0A 3IRQA 4A0XA 3HRUA 3P9KA 1LE8A 1MNEA 4A3FJ 2QUFA 1IF1A 1IRGA 2I5UA 4L9JA 4N9IA 1ETXA 3OS1A 1X3WB 2VI6A 2HGCA 1Y0NA 1JKQC 4UNOA 2L9NA 2FD5A 4LG3A 3I59A 4RBOA 4UY8I 2FNAA 3A4CA 2HYGD 3K2AA 1XCVA 4DGWB 3RYRA 2LKSA 1MJ9A 2KT0A 2VQHA 5GADJ 1VTNC 3OIQA 1Z7LA 4YIIA 3CCLI 3AL0B 4XR6A 3U1KA 2VQLA 1FOKA 1QHGA 2DI3A 1D0XA 4RAFA 5EGOB 5BPDA 3QYEA 4HAMA 4N9HA 4A3IJ 3BG3A 3BTIA 3V42A 2D5VA 4ZYGA 1LVAA 1MMSA 2HPMA 2DT6A 2I10A 2IEKA 4GGGA 1GDTA 4AYBA 3ZN1A 3HPGA 1XGMA 2VBZA 1ZLJA 4A6DA 1Z21A 3MKZA 1I1SA 2Q2EA 2QSFX 1SD5A 2CQXA 2PX9A 4DBQA 2FU4A 1SVMA 1ZLKA 2ESHA 4NQWB 2A6HF 5AONA 1B4AA 4UHTA 1U9OA 4XKBA 3HOVJ 3F8CA 1RI7A 3LSJA 2EIJH 3G2BA 3S2WA 3Q5FA 2XPUA 2VJJA 1I3QJ 4UUTA 1D5VA 1TQPA 2HWVA 1JI8A 1ORKA 4BQAA 2R4GA 3ZQFA 1GV5A 1ACIA 2COBA 3ELKA 2G9WA 3L7WA 4XOPA 1PYVA 2AHQA 3FF5A 5LD2C 4JP0A 4HNTA 3D1NI 4HRIA 3C2HA 3BJOA 3S14J 4UUSA 1XCBA 1RUOA 2ZMEB 1D1AA 3ZOBA 3S3OA 2Y75A 3VPRA 3QP5A 4IRIA 4XLCA 4D7NA 1H89C 1YE9A 3IKTA 3MFKA 4M6XA 3CO6C 3OYLA 4DZPA 4U88A 3HKZN 5IY5H 3K4BA 2L3DA 4IHXA 1X3UA 1QNTA 2LREA 4XNFA 1B72A 4MIMA 2KHMA 3DPLC 2OUMA 5L3EA 1R49A 1OCPA 5CPRB 3ZXSA 5HLHA 2E2IJ 1OCTC 1JXSA 1AA7A 3MZHA 2FJ1A 5DD4A 2ZSHB 3ZGKA 4LK1F 3CC2I 1USTA 2F2EA 3JAMZ 4G7OF 3BP8A 1W1WE 2CMPA 5AIQA 2W25A 4CUGA 1SVLA 2KZVA 1LVKA 2M0CA 3GLLA 3JRAA 1FMWA 4D0PA 3FK7A 1BC8C 3IC7A 2OV7A 3WTSC 4M6VA 2H1KA 2OC6A 2JMWA 2VJ4A 1BM9A 5F64A 5DV5A 2DFHA 3HOYJ 3RZOJ 4RB0A 3GZ6A 1STZA 1V55H 2X6WA 4CYCB 3HL2A 2PMZN 2DPDA 2IS6A 4XRSA 2CQNA 4WXDA 1HW2A 1DP7P 3SXYA 4IX7A 5FRNA 3DLLF 5FKLA 4R8HA 4XK4A 1MBJA 2QLZA 4I09A 2X6YA 2R7QA 4G8XA 1J7KA 4FHTA 3CJTB 4G7ZF 1GHCA 2X1DA 2HXOA 4A2UA 1VQ5I 1ZELA 3E3VA 3LSTA 2WBMA 2EIMH 1HDPA 1R9TJ 2A3SA 1HOMA 3CO7C 2HOAA 2CU7A 3GVAA 2OD5A 5LFAA 4MHGA 2GXAA 5JLWA 2HNHA 3DPUA 3LSRA 2JQ7A 1B8IB 1G4DA 2WC2A 3IV5A 2Z3YA 2IP2A 2KKOA 4B44A 1FSEA 1W7PD 4PGGA 1P4XA 3TGNA 3K4KA 1S5LC 5EGOA 3VWBA 5IYDJ 4NUBA 2IW5A 4HG2A 2DLLA 1KQ9A 5IP9J 2HOTA 1I6XA 2P81A 3EUAA 3BCAA 3MN2A 3BDDA 1UAAA 3RPQA 4EEFG 4BJTA 1I50J 3BCBA 2XPWA 2XB5A 3M4OJ 3KCCA 3M8FA 1FIPA 1WI9A 4LMYA 3X2QH 1SANA 1FBUA 4D7MA 2WTEA 5E8GA 3CC4I 2CJJA 4V19K 2EBIA 4UB8C 4BACA 2OU2A 1YTYA 5FB2A 2K5CA 3FMQA 4PGHA 4KYWA 1QPIA 4CCJA 3UKGA 2XHKA 1EV7A 1QGPA 1X4OA 4KT5C 2EFWA 1G3TA 3BG6A 3AAFA 4BHBA 2XGEA 2RNJA 3SJMA 2ID3A 4DNCA 4O5VA 2YPRA 5D5WB 5B3SH 1H88C 2TCTA 4IO9F 2R7DA 2RDPA 5FKNA 4KJZA 5HDKA 1NG6A 2I8DA 1U8BA 2W00A 1RESA 4L5IA 3ROUA 2H6CA 2L54A 2UXXA 3GFIA 2OTJI 1ZR4A 4IPAA 3ML6A 2K9SA 2ZMEA 2RQQA 3KLNA 3IHUA 4Q5SF 1ZG5A 2A5YB 2IGOA 5B5EC 2PI0A 1P7IA 3A2KA 2CUJA 2KDZA 1R4MB 3WTYC 4HZFA 1JTYA 4CSWA 1RR8C 2ZNYA 2A07F 4HNUA 3PFYA 5IT3A 2M4KA 2EFNA 2BYVE 3CTAA 5C44J 5M3MJ 3FZVA 1JTXA 2Z99A 1N25A 1K61A 3NQOA 1ON1A 1MMGA 1MIJA 2YX7A 1A04A 1R58A 3RQ4A 1OFCX 2E7WA 1XPXA 3DLAA 1R23A 3ZQQA 2CSOA 2IA2A 2VXDA 1Y39A 2C6YA 5FGMA 2LFBA 3F8NA 2DA3A 1XMAA 3M1EA 4ESBA 4NHJA 1AKHB 3FDYA 2J5PA 1F4KA 4E7IA 2HTJA 1XC5A 2XRNA 1OYYA 1JGGA 4ANJA 3FXQA 2VASA 1I3AA 2HOEA 2OQRA 4L9TA 4EGZA 1BA5A 3P5JA 3R6SA 4XBFA 2L7ZA 4WWCA 2VIXA 2LC2A 1VQMI 4IQ4A 2K4BA 1JE8A 3K1NA 3KP2A 4A3JJ 1XSDA 4F52A 1TWHJ 2DT5A 1Z3XA 1XTAA 1VQ7I 4CYCA 4UVCA 2G0EA 5BQTA 1OCOH 1A35A 2V9PA 4CGZA 3VDXA 3E0JB 4A69C 1OQYA 2EIKH 2DA2A 3H3ZA 3FWEA 2UXNA 1FZPB 1YRNB 5CVIA 1D5YA 2R5ZB 4ZTJA 4AYBN 3GTOJ 4HLXA 1Q1HA 2ME0A 1OYWA 2ZXWH 3H1CA 1Y8QB 4HEA2 1HQCA 2V1XA 1NK3P 3M7GA 1N75A 3GYHX 2NVXJ 2HZTA 3GXOA 5FKMA 3D5RC 2NS0A 1LKXA 2QQ8A 3IL2A 2L0KA 1WFXA 2OCCH 4LLGF 2WA0A 4LITA 3B6AA 4RGSA 4P9UA 2QEXI 1GLNA 2ISYA 2LH9A 3IWZA 5K7FA 2DYSH 4PDKA 4L0YB 4JX5A 2O3FA 3C2BA 4D1QA 5C3EJ 5LHHA 3GFLA 1Y0UA 4HF2A 5EEHA 2AXTC 5EJCA 1BI0A 1UCRA 1ON2A 2HVRA 5FLXK 2JUCA 4B48A 2ZSIB 3TDZC 5E8IA 1GV2A 1SD6A 4KICA 5J3LA 1N78A 2IGKA 1KGSA 4XSZF 4QPOA 3WHBA 1TNSA 2M87A 1IUFA 2JPCA 1OCZH 2GIZA 5M3FJ 1IDZA 1BOBA 3CF5F 2XAUA 1NTCA 1D0ZA 4C3HJ 1ZYRF 3BTLA 1S29A 4RB1A 2BGCA 1MH3A 2LKXA 4XLFA 2CW0F 4U0YA 1MDMA 1BI3A 1UG0A 5DCMB 1S7AA 2VQGA 5B1AH 5LGTA 3CCQI 1WWXA 4ENMA 2H94A 3QRFF 3K7AJ 1YW7A 3H9JA 3Q3SA 2XGDA 2JA7J 4HYEA 3H3VK 4E4HA 4XKVA 1JUMA 1Y8RB 2ZO4A 3DEEA 3JAMK 2HEOA 3QPLA 4ITVA 4KT6A 1O7FA 4LJZF 2JRTA 2VB6A 1HW1A 3LSIA 3OV8A 3TP0A 5D5XB 4M3EA 1TP4A 5F1JA 5TISC 1FEXA 5J40A 2CV2A 2QGUA 2B9SA 3JTGA 4XQFA 4IKFA 4UV8A 2HQAA 2W24A 1B6AA 3B73A 2XVCA 5ED4A 4Q48A 1LNWA 2JRMA 1MJBA 2K4JA 2QSHX 1GUUA 3OIOA 3GMEA 2V9KA 1AHDP 3KYLA 3GTQJ 2ECCA 2G7UA 3OYNA 3HDDA 1XD7A 2ZBKA 3AG4H 3F8FA 2V1NA 1VZ0A 5LGNA 3C3WA 1BI1A 3HRSA 4M9ZA 1QU3A 2K86A 5FO5A 3GBGA 1AKHA 3F72A 1FX7A 2H27A 5IT9K 1G2HA 4P55A 5L3DA 3U1DA 2MBFA 3S1MJ 2W7NA 3GF2A 1TNTA 2BHYA 4Q47A 3MD2A 2DDAA 2MLGA 4GRIA 3PIPF 1WSUA 2O6GE 2NNNA 5CJ9A 1FBSA 2VC1A 4MGRA 3S3MA 1MMDA 1R1VA 1Z05A 3GFMA 3KP7A 1F5TA 3ASOH 2GOMA 4J01A 5F6FA 3WGGA 3IAM2 5D4SA 1YRNA 1IXSB 1O57A 1G3SA 1YJNI 2HZDA 5E20A 2R5ZA 1IAWA 4ZTFA 1MD0A 1UELB 3FHZA 4HX8A 2W1OA 3L09A 4M3FA 2LKPA 2UZKA 5FFZA 1FTTA 4KA4A 4ZDOA 3P7NA 3K1MA 2A6TA 3TDUC 2PMZA 4Y13A 3KFWX 3CMYA 1L0OC 5IYCJ 2XAGA 5DDGA 4PJJA 2WY7Q 3HC7A 4QPQA 3ZMDA 1FYMA 5HLIA 1D8JA 4RAGA 3HSEA 2DAOA 4NBQA 2BW3B 3TO6A 4GYGA 1HCRA 3M07A 1FYKA 3F8BA 2EPFA 2Z1DA 2KISA 4L5EA 5CVRA 5HS8A 3OYAA 2EZHA 3CCYA 2K7LA 5LEKA 2LK2A 5B1BH 1IN6A 1ZK8A 3A03A 4MTEA 4OOIA 4X0GA 2F4OB 3ZMVA 2O8KA 2DPUA 2CFOA 3G73A 2O7OA 3A01B 4ZYEA 3LWFA 2VPLA 4JQFA 5JFRA 4CYDA 4YELA 1XDSA 4BY1J 2VXZA 5ILUA 3S3NA 3DBRB 2KMUA 2JN6A 2E1MC 3C7JA 2HR3A 4BNCA 2FBKA 3HHHA 3LFUA 1JJ8C 2BVLA 3VYSB 2UUZA 2BY1A 4EJTA 4A3GJ 4PJ0C 4M74A 4Y15A 3OYGA 1UFMA 2Z33A 3G4SI 4KITB 3T5XA 2HOSA 1QHHD 4DBRA 4E7SA 2P4WA 1MH4A 2ZC2A 2M0MA 2VONA 4ON0A 2DODA 3S1QJ 4RAZA 5L3BA 1J0RA 2VOPA 4P1WA 2QF7A 2HQ5A 4UVAA 1Y1WJ 1WI3A 4XOTA 3MAJA 5E79C 1U0JA 4DYRA 3WGHA 3RDIA 1REPC 3FBIB 1G3YA 4XRSG 1K6OA 2OZ6A 1D0YA 4QLCU 4HOBA 2CUZA 3FIWA 5D5UB 4AVZA 4S04A 2GM4A 2XIGA 2XASA 2FEZA 3TOBA 3CP8A 3Q9SA 3WU2C 2XAJA 5E17F 2BY3A 4M73A 1LB2A 4XSXF 1U2WA 2NXNB 2P5VA 3H5AA 1P2FA 2KRFA 3HYIA 1KU2A 5LRRA 2ZNZA 4D9JA 2PMUA 3KIOA 3OMYA 1ZHFA 2DU9A 2M7BA 4PSWA 2DOAA 3ONQA 4XLNF 1TW2A 2LNBA 4EJWA 3I0TA 2LMDA 3RTRA 2GZWA 5DYMA 2HXIA 1NG7A 5CYVA 1T0FC 3CF2A 3V7CA 3WTVC 1B9NA 1YW8A 1V3FA 1DU0A 3VYRB 2DA6A 3V7RA 3HOXJ 1X1PA 2FRHA 4KN7X 3NWTA 4EV0A 5DM6F 1RRJA 3TQNA 1LEAA 2O0YA 3KYCB 4CH7A 1MBEA 2A5WA 3RQIA 3HM5A 4XRFA 3OYFA 4XN3A 5IP6A 1FSHA 3L1PA 4H4KC 2JT1A 1T98A 2IJLA 1U5TC 3MMYB 5J8FA 4LIUA 4CCMA 2LF8A 3OYBA 3KYDB 2E1CA 2DTRA 5LGUA 3S15J 4F92B 1W5SA 1SD4A 1A6QA 1ETVA 4ENJA 2GXBA 1OPCA 2X85A 1IGNA 2KFDA 1NHAA 1OLTA 2CW7A 1WJEA 1LDKB 2RAEA 3K2ZA 2VKDA 4XN0A 3E5QA 3CCEI 2BY2A 3WU1B 5D5VB 1OISA 4A0ZA 2RNGA 3MWMA 3HUGB 2QENA 3OY9A 2KL4A 2QA4I 2EZKA 2K9MA 2XGXA 3HOUJ 1FJLA 2YS9A 3F6OA 2VODA 2DOFA 2GAUA 2BW3A 2DFFA 2F5EA 4CXFA 4PFOA 2VOOA 2XKOA 1J09A 2R7UA 2GBYA 4PUSA 3TMOA 5HS9A 3GW2A 3LFKA 2K3FA 2G7HA 2E2JJ 1YOVB 5E1ZB 4AWXB 3LSMA 1TTYA 5LBQA 3S2DJ 3OYDA 2QSGX 2DN0A 3P9CA 3HXLA 4WF2A 5K7ZA 3I5UA 1PUFB 2ZXJA 4HDUA 2CFXA 1PJRA 1WJCA 2X1EA 1F9NA 2XF6A 3V8JA 2DJIA 1P7JA 4XKCA 5KVRA 1FOWA 2P5LC 1TZLA 5D6FA 1XG1A 1RUNA 1SD7A 2PFBA 3JRCA 3C2GA 2K9LA 4BGDA 2HVSA 4YFXF 4L0ZB 1VNDA 4CICA 2LR8A 3I64A 2DMNA 1ETYA 1TWGJ 2IS2A 3HEFA 4S0HB 1JKOC 3WGIA 1ENHA 3EUHC 2ZFUA 3W2AA 1S6LA 1DGWY 4CCNA 4CA0A 1FT9A 3GLXA 4YEJA 4BHCA 3DKWA 1GXQA 3PQJA 1S9HA 2YU3A 4C2MJ 3OS2A 4HQEA 1JUPA 1SEUA 1OCCH 5CQGA 2Y31A 4OMZA 2CUFA 2KZGA 1FY7A 4RGUA 1BR4A 2DA4A 5KK1A 1OMIA 3FKIJ 2MC3A 2BBYA 5HODA 2DCEA 3W3CA 3ECOA 5BOXA 2E5ZA 2LTPA 1ZQ3P 2GLOA 3GZNB 2Z2SB 1V5EA 3FMSA 3BZCA 2DO7A 4JK1X 3EPZA 2M5WA 1U3EM 3CCJI 1JT6A 5HLGA 3PL8A 4HW0A 1Y1VJ 2E2HJ 1O3RA 2GXGA 1ERDA 5GPCA 3F0CA 3QU6A 2NS7A 2XSDC 1XDUA 2CYYA 1YS6A 2OPTA 3VSLA 2K85A 3C1DA 5IOZA 3NWSA 2KRCA 2QZ8A 3EYIA 3OR2C 2MD0A 4K2EA 1EJ9A 2VE8A 2HVQA 2EFOA 2QYOA 1JUSA 2Z16A 1RZ4A 4BY7J 5GAGJ 3HSRA 1ONVA 2BXZA 2EZLA 3KLOA 1DPUA 4E7KA 3G1LA 3KX2A 4XLAA 4IOAF 2VKVA 3IAS2 2CV1A 3I56I 1G3WA 2VQCA 4XLHA 1T2KA 4LIVA 2FBIA 1ZH5A 3TKYA 4QIWN 2JVGA 2EZIA 3MEXA 1WJFA 3K6GA 4UB6C 5EZGA 2VKEA 2K3PA 3LA3A 4IHWA 1FTZA 4JOMA 4WXHA 3IUOA 4G7HF 3PM1A 2W82A 3DF8A 1E0EA 3F22A 4OIPF 1C0WA 3IH2A 5K1YA 4N4NB 5IYBJ 1WJBA 2L9RA 3BG7A 1WHUA 4YG2F 1ZGJA 5B66C 1IRXA 3HUGA 2XAHA 3MZ8A 4LFUA 1GVJA 3BJAA 1R36A 1T08B 4OAZA 4M6YA 4CCLA 4RAYA 3LQQA 3WTTC 3K70D 5J8CA 4ZC3A 3CZ6A 5GTIC 2KJCA 4I0AA 1YFHA 3R60A 2Q8KA 1HW5A 3H9QA 4E70A 3DBHB 5HDNA 3MVPA 1ULYA 4BH9A 2FOWA 3HRMA 4ZZDA 4XMYA 4IHVA 2IA1A 2QCOA 3WE2A 1HKTA 4MLOA 2MD5A 2ZFWA 4NQWA 2Y9YA 2VPRA 3F8MA 3O6BB 2VT2A 1J9IA 2V6CA 3K1PA 2XAFA 1E17A 3BQYA 4II3A 1T8IA 2X9DA 3CDLA 4EVIA 5JVGF 1FNNA 1PUFA 1BR2A 4AUXA 4NC6A 4ESJA 4A0YA 1HA8A 2HDWA 3ABUA 1XMXA 3RKWA 1P4AA 3GFJA 3O3KA 3U9GA 4BEHB 1WGXA 4ZYDA 2IGMA 3KE2A 3S32A 3TO9A 3K4JA 2FUG2 4M3BA 4AM3A 2L2OA 3TW7A 5EF6A 3L2RA 2HYJA 1E3OC 2KJBA 3KP3A 5DM7F 1MGTA 4NNJA 4WK8F 4P96A 3OSFA 3SZTA 1NH3A 3EDPA 1H9GA 2E1MB 4ETSA 2QQBA 2WV0A 4MTDA 2JA6J 2N8GA 1QRYA 4D5FA 5H6QA 3KP5A 5HVQC 3A02A 2CQKA 4RLFA 1KYWA 3HPHA 1Z91A 2LP0A 2VN2A 3KEYA 2V79A 5HS7A 2R7ZJ 1BOAA 1I5ZA 3TBIA 1GT0C 3ABMH 3EETA 1UHMA 2P6SA 1IN4A 3I4NJ 2KIUA 3K70C 1TLHB 4NC7A 1SFXA 3E6MA 2PJRB 4KUMA 4N0BA 1HLVA 4XKWA 2E35A 4UV9A 5KNLA 1HKSA 4HBLA 4BBSJ 3CUQC 2EV6A 1Z67A 4G94A 2VBYA 3QOEA 2WV1A 3CCMI 1V5FA 2DFEA 5FKOA 3RYPA 1UG2A 2EWNA 1G59A 3LMMA 1R71A 1J75A 2GIVA 5C4JJ 5HDGA 1FOYA 2E5NA 1W0UA 1DUXC 4FCYA 2D1HA 3BTCA 1MBKA 2DJNA 1TT0A 4FQGA 4YIRX 5JR3A 3VYUB 3HB9A 2M3AA 2E71A 1LFBA 2K40A 4IQJA 3QPSA 3DPTA 5LRSA 4RM3A 5E1WA 3BWGA 4Q4ZF 3T1BA 5FJ8J 1BN5A 5DEQA 1LFUP 3M1CA 3T8TA 1LPQA 2FMLA 3J81Z 4KIGA 3CCRI 3ABLH 3MZYA 2L02A 4G6QA 2W48A 3DEUA 2DW4A 3PUFA 4XICA 1O3SA 2LF7A 4F3QA 3CDHA 1B8IA 3I53A 2HKXA 4C3IJ 3RKXA 2NS8A 2Y30A 3K69A 1ETOA 3FXRA 3OYEA 3O8GA 3SDBA 1R1TA 4UVBA 3OOPA 1QZYA 3NAUA 2HQNA 1WZ2A 1U5TB 4RGRA 1ZRCA 1G8XA 4I2OA 3K4MA 5M5YJ 4DJAA 5A2QZ 1ZG1A 1UZCA 1VI0A 2VLAA 5J4YA 3DTIA 3LA2A 2F5FA 2DQRA 3SZGA 1B9MA 1JKRC 3U2RA 3LL7A 2LVSA 1V5GA 1E3HA 1IDYA 2P5KA 5DD8A 5FLMJ 1PVEA 2QKMB 5FLVA 3FHNA 2IGNA 3T0YA 2FQ4A 3BLYA 3E6DA 5K5OA 5GAEJ 4CHUA 1KONA 5EDNA 3T8RA 3I54A 2R5YB 4W1UA 3V7SA 4U7BA 4A3DJ 2BV6A 4DIQA 4A5NA 3Q9VA 4LB6B 2DMPA 2M8GX 4IZZA 3IH3A 3DTEA 2HQRA 1S72I 3OYCA 3FK6A 2GA2A 3SFZA 3A0HC 2P8TA 3CLQA 1P92A 4BEHA 1YLFA 1P6RA 3GWZA 1TWFJ 3JRDA 1SMYF 2HDDA 1E3PA 1UB9A 4KMFA 2BVMA 2ZCWA 3L2VA 4I76A 1ZG3A 1OR7C 1SVOA 2NRAC 4J00A 1VQ4I 2L4AA 3W2VA 1BW5A 3PIOF 3VB2A 3LSHA 2A05A 2XKPA 3ISPA 4ZZLA 5DUKA 1MZBA 3BZKA 3CJQB 2GWRA 3I9V2 2BXYA 5CVUA 4A3BJ 3DP7A 3BPXA 2PMHA 5LHGA 1T56A 4JX6A 4HNVA 3SQNA 2RREA 3OWTA 3G3ZA 3LAPA 4WCGA 5DUIA 4DOZA 5L3FA 1CF7B 2R7XA 3F6VA 3MKWB 4HX4A 5E3NA 1TQIA 3E6CC 1MNDA 4ASNA 1A5JA 2EINH 2ZJ2A 3GO5A 2NVUB 2R3SA 3HZJA 3R0JA 2PJRA 1I27A 2YU9J 1Q1VA 5AIPA 1J5YA 3DWLE 1B1BA 2M8EA 1QA6A 3PNVA 1RNLA 2RQPA 3H5NA 3Q0WA 1VQLI 4HF1A 4PSXA 5L3GA 4ZYHA 4B8XA 4I6ZA 4LGWA 3I4PA 3DKYA 4M9XA 3Q0VA 4GCVA 4DYQA 1H8AC 1YO5C 2FNPA 2O8XA 1YI2I 2EV0A 3SHFA 1IXRC 2IAIA 4EJUA 1P4WA 5FKKA 4PZJA 1F1ZA 2FX0A 2MLKA 3D5SC 3M3YJ 1WJ5A 3JR9A 3JSPA 4MQVA 1CGPA 3OYJA 2LOOA 3ZMUA 3GTPJ 2JVHA 2A61A 3ASNH 4C30A 5FROA 2PG4A 2DBBA 2F6CA 5F0FA 4IHSA 3TL4X 2DYRH 1IC8A 3BG5A 1T0FA 4V2FA 2UV1A 2VJIA 3B6CA 1YJ9I 2JK3A 3WTWC 2DMQA 4WXCA 3UNGC 1LFPA 1W5TA 1X58A 1QZEA 3FISA 2MFZA 2R7VA 3CUOA 1X19A 4MFDA 4R1HA 1YX3A 3ZQCA 1LJ9A 5CLSA 2ZJPF 3KPHA 3ERMA 3PSFA 1GXPA 2BEOA 1POGA 4TV7A 1U5TA 2PEXA 2LBFB 5BS6A 4HSTA 4EM1A 3WU0A 1TQMA 5CVJA 1VQ9I 3TOAA 4LD5A 2JA2A 2F4IA 5J1YA 3G1MA 5KAIC 4E7HA 4ZDPA 4IEJA 2E1NA 1BIAA 3DU5A 1VQPI 3IRRA 4ESFA 1Z6TA 1LUJB 5FD6A 2STTA 2OCEA 4A12A 2Y48A 4A3LJ 3M9AA 1KU7A 2E19A 1IUYA 5DTDA 2ISZA 1IRZA 2QQAA 2ID6A 3RPUA 3H3UA 2ZXIA 3BG9A 4EJOA 2L7MP 5DCMA 1EH8A 5F1RA 3NARA 3HG9A 1BJAA 5GTHC 2PN6A 2JTVA 1AWCA 2IVMA 2KIMA 1Z0XA 2VUMJ 4KN4X 4JBAA 2R0QC 2QQ9A 4M71A 4EM2A 3I71A 2DT7B 1IXCA 2H8RA 4ZH4F 1TW3A 3KETA 2CS3A 3BT9A
chains in the Genus database with same CATH topology
4EQQA 2M45A 3RKYA 4Y17A 4YFNF 2IPQX 1EH7A 1FWZA 1IRFA 3W6JB 3DFGA 1CF7A 3EUHA 1IN7A 2TDXA 4IRGA 2Z9OA 2OA4A 2OQGA 1SFUA 4LLNA 2OAZA 4EMSA 1K79A 2ELHA 3RJPA 1QZZA 2A69F 3JSOA 1Z9CA 1W7PB 3HIFA 2OBPA 5ICEA 3KZYA 1V4RA 4DQ2A 3PFIA 1R5GA 1ZGAA 1KQ8A 2H6BA 4WX9A 2HDCA 3V4GA 3CUQB 2STWA 1USSA 4IRHA 2L4MA 4NB5A 2XV4S 4FT8A 4I02A 4RS8A 1XSXA 3NEUA 2VT3A 2NNYA 4F7ZA 1SFEA 1S3JA 3VODA 4LG0B 4BXUA 3J7AO 2RV8A 3GUDA 4QWQA 1PP7U 4EGYA 2D1VA 1U6GA 4I01A 2P6TA 3IKVA 2K27A 5DCFA 3QAHA 3D0SA 1O3TA 2Q0OA 5BPIA 3HOSA 3ZMTA 1KA8A 3D5LA 2KIFA 1IN5A 4UUVA 3MQ0A 3J80Z 4OIOF 2MH2A 3HHGA 2EA2A 1FC3A 5K5RA 1JHFA 2MH9A 4MEXF 4HQMA 4ENNA 3ZN0A 2YSRA 1IN8A 4OMYA 4L5JA 3DXJF 4MEYF 3H92A 2ZKZA 2A6EF 5FLXZ 1O3QA 3WTUC 3E6BA 2IRFG 3TO7A 3VEPA 4HA8A 1BIBA 4IHTA 4BAYA 2IT0A 4KIBA 4G6DA 3V8KA 2NAZA 2PBIA 3QP6A 4XLPF 1XGNA 1SMTA 3WE3A 1W4MA 1EH6A 3KP6A 2HTSA 1T6SA 4LB5A 4MQ9F 1MJAA 5H20A 1R1UA 2ESNA 2WWYA 2YX4A 4CZZA 3HRTA 2P7CB 1FBQA 2FA5A 3HTUA 4A5MA 1W7PA 1J2XA 3JW4A 1OKRA 4LK0F 4AIKA 2RGVA 2PQ8A 1Z6RA 1BI2A 1YG2A 1T38A 4B09A 3CUQA 5LEJA 1XSVA 3RIRA 2QM3A 1KYZA 4OINF 4RB3C 4OIRF 4A6EA 4IJAA 3EQLF 2XAQA 3JTHA 3BJ6A 5D8LB 5IT9Z 1FP1D 4L9VA 3ZMSA 1WRJA 2VC0A 5ERIA 1JGSA 1QBJA 2W57A 2LSOA 4LG0A 2EA4A 2QWWA 4O6JA 5TJJA 1Z7UA 2J5OA 3E97A 3N4MA 3KEOA 3WG9A 4AIHA 2X0LA 1ZREA 1LDDA 3QPHA 2DQLA 3R0AA 2HYFA 3QPTA 3R4KA 2FF4A 1WQ2A 2O61A 5LHIA 1KU9A 1H9TA 3VFZA 4CO8A 2V1DA 1G6NA 3B02A 2EK5A 4HX7A 2HS5A 2GQQA 2OZUA 2M30A 1DPRA 2XROA 4PCQA 3WODF 3RI4A 2JZYA 4AIJA 4CDGA 1MDMB 4O3MA 5H6RA 4HV5A 1R7JA 1YQAA 4YIFA 3V8LA 1S8NA 3BOQA 2HKOA 1XGSA 1IW7F 4U0VA 6PAXA 2W85A 2A68F 2XUBA 4KMUX 1HSJA 3SZPA 1OR7A 1BC7C 5K5QA 2DFIA 2L01A 1QQIA 2CWEA 5L3CA 3DQVC 4HLYA 3PQKA 2H09A 4I0BA 3CLOA 3DV8A 3GZ5A 2DK5A 1YW9A 1LQ1A 1O7LA 5TRDA 1U8RA 3WTZA 4P5OA 2EFPA 1XGOA 1QO0D 3ERED 1D8KA 4H0EA 3BY6A 4L9NA 2ADUA 1SAXA 3WTXC 4G9YA 4BYYA 2DK8A 2VBXA 1TBXA 4Z2YA 3EYYA 3ULQB 2V9VA 3M8EA 4RB2C 5ICFA 1FP2A 3ZPLA 4L18B 3L2CA 2FXAA 3IWFA 5EEGA 2RKHA 4RGXA 4S05A 3KZZA 3E5XA 1ZRDA 3NRVA 4UXNA 4HDVA 3F23A 1ODDA 3J80K 3ZQ7A 2PLYA 3LQRA 4OU0A 2O03A 2Y0MA 3GX4X 1BBYA 1K78B 1HXDA 2EJRA 1HKQA 4U7DA 3E5UA 5FFXA 5CVVA 3L00A 5ICCA 5E18F 4FX4A 3W6KB 5D8KB 4KDPA 4YFKF 1B59A 1PUEE 2EFQA 5E1XA 1ZRFA 3COAC 2RC4A 3L9FA 3FM3A 1L3LA 3HOTA 1IZ1A 2UWMA 3HTSB 4OIQF 5LLQA 4I7HA 4EJVA 1XN7A 4R79A 2FSWA 2CGPA 3KEQA 5ILVA 2RN7A 3FMRA 1JHHA 3KP4A 2VE9A 1HSTA 2B0LA 2HFHA 3REOA 3BROA 2FOKA 1ZAOA 2M1BA 4ENKA 3R61A 4GYIA 5ILSA 1RIOH 3VOEA 5JVTA 1AOYA 1S7OA 2K02A 1D3YA 2QBYB 2EB7A 1XMKA 4KIFA 1OYIA 1R22A 3I58A 3O2PE 1WKMA 2GA1A 3K0LA 1LEBA 2X4HA 1QPMA 4GO1A 4AVPA 2AXLA 3QU3A 4EM0B 3I59B 4IVNA 3FM5A 3LAJA 3ZP5A 3BPVA 3MCZA 1PDNC 2LDUA 4AD9A 2QVOA 2BE5F 4HF0A 1KQ0A 1UHWA 2JSCA 2D45A 5FD5A 1XB4A 1HBXG 2NYXA 2F5CA 2F5DA 2CG4A 3GEZA 1Z1DA 2W84A 1T39A 2E7XA 1J59A 1DDNA 3F3XA 1H0MA 4KNYA 1K78A 3ZMZA 2PJPA 2VBWA 2YR2A 5D6EA 1YIOA 3P9IA 1ZN2A 3F21A 3C18A 2MA3A 3N97A 2ETHA 3QOPA 1K7AA 5JI6A 2FE3A 1ZARA 1R00A 5HOOA 2CO5A 2COMA 1FLIA 2FBHA 3K9TA 3LA7A 1R5HA 4IXAA 1I1GA 4U0WA 3ABTA 5ICGA 5J6XA 3CJNA 2EV5A 2P7VB 2FQ3A 4I98B 2R7FA 2D2WA 4BHPA 1YYVA 3FXUA 4IF4A 4MNUA 3ECHA 4P9FA 3J81K 1U78A 2FMYA 1MKMA 1LDJA 1KU3A 4M72A 2JPBA 2ACJA 4HV6A 1PP8F 1FPQA 5BMZA 2V1UA 2QBYA 4KFCA 1E2XA 4LLLA 1FYLA 3FX3A 2RVCA 4M9SA 5D4RA 4GXOA 3BZ6A 5JHUA 5A2QK 4FX0A 2AS5F 3HSFA 1YS7A 2Z5UA 2IA0A 3IRQA 4A0XA 3HRUA 3P9KA 1IRGA 2QUFA 1IF1A 4L9JA 4N9IA 2HGCA 4UNOA 3I59A 2FNAA 2HYGD 1XCVA 3RYRA 1MJ9A 1VTNC 4YIIA 1FOKA 2DI3A 5BPDA 4HAMA 4N9HA 4ZYGA 1LVAA 4GGGA 3ZN1A 4A6DA 1XGMA 1ZLJA 2VBZA 1I1SA 2Q2EA 1SD5A 2FU4A 1ZLKA 2ESHA 2A6HF 5AONA 1B4AA 4UHTA 3F8CA 1RI7A 3S2WA 3Q5FA 1D5VA 1TQPA 2HWVA 4BQAA 3ELKA 2G9WA 3L7WA 3FF5A 3BJOA 1XCBA 1RUOA 2ZMEB 2Y75A 3QP5A 4IRIA 3IKTA 3MFKA 4M6XA 3CO6C 4U88A 2L3DA 1X3UA 1QNTA 3DPLC 5L3EA 5HLHA 1JXSA 3MZHA 5DD4A 4LK1F 1USTA 2F2EA 3JAMZ 4G7OF 3BP8A 5AIQA 2W25A 4D0PA 1BC8C 3IC7A 3WTSC 1BM9A 5F64A 5DV5A 4RB0A 3GZ6A 1STZA 2DPDA 4WXDA 1HW2A 1DP7P 3SXYA 4R8HA 4I09A 2QLZA 4G8XA 1J7KA 4FHTA 4G7ZF 1GHCA 4A2UA 3E3VA 3LSTA 2A3SA 3CO7C 3GVAA 2OD5A 4MHGA 1G4DA 2WC2A 2Z3YA 2IP2A 2KKOA 1FSEA 1W7PD 4PGGA 1P4XA 3TGNA 2IW5A 2DLLA 1KQ9A 1I6XA 3BDDA 3RPQA 3KCCA 3M8FA 1WI9A 4LMYA 1FBUA 2WTEA 5E8GA 2OU2A 1YTYA 5FB2A 3FMQA 4PGHA 4KYWA 2XHKA 1EV7A 1QGPA 4KT5C 2EFWA 1G3TA 3AAFA 4BHBA 2RNJA 4DNCA 4O5VA 2YPRA 5D5WB 2R7DA 2RDPA 5HDKA 4L5IA 3ROUA 3GFIA 2H6CA 2L54A 2UXXA 4IPAA 3ML6A 2ZMEA 3KLNA 3IHUA 4Q5SF 1ZG5A 2A5YB 2PI0A 3WTYC 4HZFA 2A07F 2ZNYA 5IT3A 2EFNA 2BYVE 3CTAA 3FZVA 2Z99A 3NQOA 1ON1A 2YX7A 1A04A 1R58A 2E7WA 1R23A 2CSOA 2IA2A 2C6YA 5FGMA 3F8NA 3M1EA 1XMAA 4ESBA 4NHJA 1F4KA 2J5PA 2HTJA 2XRNA 1OYYA 3FXQA 2HOEA 2OQRA 4L9TA 4EGZA 3R6SA 4XBFA 4WWCA 1JE8A 2K4BA 3K1NA 3KP2A 1XSDA 2DT5A 4UVCA 5BQTA 4CGZA 3H3ZA 3FWEA 2UXNA 1FZPB 5CVIA 4HLXA 1Q1HA 1OYWA 1HQCA 2V1XA 3M7GA 3GYHX 2HZTA 3GXOA 2NS0A 3IL2A 4LLGF 4P9UA 4RGSA 2ISYA 3IWZA 4PDKA 4L0YB 2O3FA 5LHHA 3GFLA 1Y0UA 4HF2A 5EEHA 1BI0A 1UCRA 1ON2A 5FLXK 3TDZC 5E8IA 1SD6A 4KICA 1KGSA 4XSZF 1TNSA 2M87A 2JPCA 1ZYRF 1S29A 4RB1A 2BGCA 4U0YA 2CW0F 1MDMA 1BI3A 5DCMB 1S7AA 5LGTA 1WWXA 4ENMA 2H94A 3QRFF 1YW7A 4HYEA 2ZO4A 2HEOA 3JAMK 1O7FA 4LJZF 2JRTA 1HW1A 3OV8A 5D5XB 3JTGA 4UV8A 2W24A 1B6AA 3B73A 2XVCA 5ED4A 4Q48A 1LNWA 2K4JA 1MJBA 2G7UA 1XD7A 2ZBKA 3F8FA 5LGNA 3C3WA 1BI1A 3HRSA 4M9ZA 2K86A 5FO5A 3F72A 1FX7A 2H27A 5IT9K 4P55A 5L3DA 3U1DA 2MBFA 3GF2A 1TNTA 4Q47A 2MLGA 2O6GE 1WSUA 2NNNA 5CJ9A 1FBSA 2VC1A 4MGRA 1R1VA 1Z05A 3GFMA 3KP7A 1F5TA 5F6FA 3WGGA 5D4SA 1IXSB 1O57A 1G3SA 5E20A 1IAWA 1MD0A 3FHZA 4HX8A 3L09A 2LKPA 2UZKA 5FFZA 4KA4A 3P7NA 3K1MA 3TDUC 4Y13A 3KFWX 1L0OC 2XAGA 5DDGA 3ZMDA 1FYMA 5HLIA 1D8JA 3HSEA 2DAOA 3TO6A 4GYGA 1FYKA 3F8BA 5CVRA 5HS8A 2K7LA 5LEKA 1IN6A 4MTEA 4OOIA 3ZMVA 2DPUA 3G73A 4ZYEA 3LWFA 4JQFA 5JFRA 4CYDA 1XDSA 2VXZA 5ILUA 3C7JA 2HR3A 4BNCA 2FBKA 3HHHA 4EJTA 4M74A 4Y15A 1UFMA 2Z33A 3T5XA 2P4WA 2VONA 4ON0A 4RAZA 5L3BA 1J0RA 2VOPA 4UVAA 3MAJA 3WGHA 3RDIA 1REPC 1G3YA 1K6OA 2OZ6A 4QLCU 4HOBA 5D5UB 4S04A 2XIGA 2XASA 2FEZA 3TOBA 3Q9SA 2XAJA 5E17F 4M73A 1LB2A 4XSXF 1U2WA 2P5VA 1P2FA 2KRFA 3HYIA 1KU2A 5LRRA 2ZNZA 2PMUA 1ZHFA 2DU9A 4XLNF 1TW2A 2LNBA 4EJWA 3I0TA 3RTRA 2GZWA 5DYMA 5CYVA 3V7CA 3WTVC 1B9NA 1YW8A 1V3FA 3V7RA 2FRHA 4KN7X 4EV0A 3TQNA 1LEAA 2O0YA 4XRFA 1FSHA 2JT1A 1T98A 2IJLA 1U5TC 5J8FA 2E1CA 2LF8A 2DTRA 5LGUA 1W5SA 1SD4A 4ENJA 2GXBA 1OPCA 1NHAA 1LDKB 3K2ZA 3E5QA 3WU1B 5D5VB 4A0ZA 3MWMA 2QENA 2XGXA 3F6OA 2VODA 2GAUA 2F5EA 4CXFA 2VOOA 2XKOA 5HS9A 3GW2A 3LFKA 2G7HA 5E1ZB 4AWXB 1TTYA 5LBQA 3P9CA 4WF2A 3I5UA 2ZXJA 4HDUA 2CFXA 1F9NA 3V8JA 5KVRA 2P5LC 5D6FA 1RUNA 1SD7A 2PFBA 4YFXF 4L0ZB 4CICA 3I64A 3WGIA 1S6LA 1FT9A 3GLXA 4BHCA 3DKWA 1GXQA 3PQJA 2YU3A 4HQEA 4OMZA 1FY7A 4RGUA 5KK1A 1OMIA 2MC3A 2BBYA 3ECOA 5BOXA 3FMSA 2DO7A 4JK1X 2M5WA 1U3EM 5HLGA 4HW0A 1O3RA 2GXGA 3QU6A 1XDUA 2CYYA 1YS6A 3C1DA 3EYIA 2QZ8A 4K2EA 2VE8A 2EFOA 2QYOA 1RZ4A 3HSRA 1ONVA 3KLOA 1DPUA 1G3WA 1T2KA 2FBIA 1ZH5A 3TKYA 3MEXA 3LA3A 4WXHA 4G7HF 3DF8A 3F22A 4OIPF 1C0WA 5K1YA 4YG2F 1ZGJA 3HUGA 2XAHA 4LFUA 1GVJA 3BJAA 1R36A 4M6YA 4RAYA 3LQQA 3WTTC 5J8CA 2KJCA 4I0AA 1YFHA 3R60A 2Q8KA 1HW5A 4E70A 5HDNA 1ULYA 4BH9A 3HRMA 4ZZDA 2IA1A 3WE2A 1HKTA 2MD5A 2ZFWA 4NQWA 3F8MA 3O6BB 2VT2A 1J9IA 2V6CA 3K1PA 2XAFA 1E17A 4EVIA 1FNNA 4ESJA 4A0YA 3ABUA 3RKWA 1P4AA 3GFJA 3O3KA 3U9GA 4ZYDA 3KE2A 3TO9A 2KJBA 3KP3A 1MGTA 4WK8F 4P96A 3SZTA 3EDPA 1H9GA 4ETSA 2QQBA 2WV0A 4MTDA 5H6QA 3KP5A 5HVQC 2CQKA 1KYWA 1Z91A 2VN2A 2V79A 5HS7A 1BOAA 1I5ZA 3EETA 1UHMA 2P6SA 1IN4A 2KIUA 1TLHB 1SFXA 3E6MA 4KUMA 4N0BA 4UV9A 1HKSA 4HBLA 3CUQC 2EV6A 4G94A 2VBYA 3RYPA 2EWNA 1J75A 2GIVA 5HDGA 1DUXC 2D1HA 5JR3A 3DPTA 5LRSA 5E1WA 3BWGA 4Q4ZF 3T1BA 1BN5A 5DEQA 3T8TA 2FMLA 3J81Z 4KIGA 3MZYA 2L02A 4G6QA 3DEUA 2DW4A 1O3SA 2LF7A 3CDHA 3I53A 2HKXA 3RKXA 3K69A 3FXRA 1R1TA 4UVBA 3OOPA 1QZYA 2HQNA 1U5TB 4RGRA 1ZRCA 4I2OA 5A2QZ 1ZG1A 3LA2A 2F5FA 2DQRA 1B9MA 3U2RA 2P5KA 5DD8A 3T0YA 3E6DA 4CHUA 5K5OA 3T8RA 3I54A 4U7BA 3V7SA 2BV6A 4A5NA 3Q9VA 4LB6B 2HQRA 2GA2A 3SFZA 2P8TA 1P92A 1YLFA 1P6RA 3GWZA 1SMYF 1UB9A 4KMFA 2ZCWA 1ZG3A 2NRAC 2L4AA 3VB2A 2XKPA 3ISPA 4ZZLA 5DUKA 1MZBA 2GWRA 5CVUA 3DP7A 3BPXA 2PMHA 5LHGA 3SQNA 3G3ZA 3LAPA 4WCGA 5DUIA 5L3FA 1CF7B 3F6VA 4HX4A 1TQIA 3E6CC 4ASNA 3GO5A 2ZJ2A 2R3SA 3R0JA 1I27A 5AIPA 1J5YA 1B1BA 2M8EA 1RNLA 2RQPA 4HF1A 5L3GA 4ZYHA 4B8XA 4LGWA 3I4PA 4M9XA 4GCVA 1YO5C 2FNPA 2O8XA 2EV0A 3SHFA 1IXRC 4EJUA 1P4WA 4PZJA 1F1ZA 2MLKA 3JSPA 4MQVA 1CGPA 3ZMUA 2A61A 2PG4A 2DBBA 4IHSA 1T0FA 3WTWC 4WXCA 1W5TA 3CUOA 4R1HA 1LJ9A 5CLSA 1GXPA 2BEOA 4TV7A 1U5TA 2PEXA 5BS6A 4EM1A 3WU0A 1TQMA 5CVJA 3TOAA 4LD5A 2E1NA 1BIAA 3IRRA 4ESFA 1Z6TA 5FD6A 2STTA 4A12A 2Y48A 3M9AA 1KU7A 1IUYA 2ISZA 2QQAA 3RPUA 3H3UA 4EJOA 5DCMA 1EH8A 5F1RA 1BJAA 2PN6A 2JTVA 1AWCA 2IVMA 2KIMA 4KN4X 4JBAA 2QQ9A 4M71A 4EM2A 3I71A 1IXCA 4ZH4F 1TW3A 3KETA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EQQ A;  2M45 A;  3RKY A;  4Y17 A;  4YFN F;  2IPQ X;  1EH7 A;  1FWZ A;  1IRF A;  3W6J B;  3DFG A;  1CF7 A;  3EUH A;  1IN7 A;  2TDX A;  4IRG A;  2Z9O A;  2OA4 A;  2OQG A;  1SFU A;  4LLN A;  2OAZ A;  4EMS A;  1K79 A;  2ELH A;  3RJP A;  1QZZ A;  2A69 F;  3JSO A;  1Z9C A;  1W7P B;  3HIF A;  2OBP A;  5ICE A;  3KZY A;  1V4R A;  4DQ2 A;  3PFI A;  1R5G A;  1ZGA A;  1KQ8 A;  2H6B A;  4WX9 A;  2HDC A;  3V4G A;  3CUQ B;  2STW A;  1USS A;  4IRH A;  2L4M A;  4NB5 A;  2XV4 S;  4FT8 A;  4I02 A;  4RS8 A;  1XSX A;  3NEU A;  2VT3 A;  2NNY A;  4F7Z A;  1SFE A;  1S3J A;  3VOD A;  4LG0 B;  4BXU A;  3J7A O;  2RV8 A;  3GUD A;  4QWQ A;  1PP7 U;  4EGY A;  2D1V A;  1U6G A;  4I01 A;  2P6T A;  3IKV A;  2K27 A;  5DCF A;  3QAH A;  3D0S A;  1O3T A;  2Q0O A;  5BPI A;  3HOS A;  3ZMT A;  1KA8 A;  3D5L A;  2KIF A;  1IN5 A;  4UUV A;  3MQ0 A;  3J80 Z;  4OIO F;  2MH2 A;  3HHG A;  2EA2 A;  1FC3 A;  5K5R A;  1JHF A;  2MH9 A;  4MEX F;  4HQM A;  4ENN A;  3ZN0 A;  2YSR A;  1IN8 A;  4OMY A;  4L5J A;  3DXJ F;  4MEY F;  3H92 A;  2ZKZ A;  2A6E F;  5FLX Z;  1O3Q A;  3WTU C;  3E6B A;  2IRF G;  3TO7 A;  3VEP A;  4HA8 A;  1BIB A;  4IHT A;  4BAY A;  2IT0 A;  4KIB A;  4G6D A;  3V8K A;  2NAZ A;  2PBI A;  3QP6 A;  4XLP F;  1XGN A;  1SMT A;  3WE3 A;  1W4M A;  1EH6 A;  3KP6 A;  2HTS A;  1T6S A;  4LB5 A;  4MQ9 F;  1MJA A;  5H20 A;  1R1U A;  2ESN A;  2WWY A;  2YX4 A;  4CZZ A;  3HRT A;  2P7C B;  1FBQ A;  2FA5 A;  3HTU A;  4A5M A;  1W7P A;  1J2X A;  3JW4 A;  1OKR A;  4LK0 F;  4AIK A;  2RGV A;  2PQ8 A;  1Z6R A;  1BI2 A;  1YG2 A;  1T38 A;  4B09 A;  3CUQ A;  5LEJ A;  1XSV A;  3RIR A;  2QM3 A;  1KYZ A;  4OIN F;  4RB3 C;  4OIR F;  4A6E A;  4IJA A;  3EQL F;  2XAQ A;  3JTH A;  3BJ6 A;  5D8L B;  5IT9 Z;  1FP1 D;  4L9V A;  3ZMS A;  1WRJ A;  2VC0 A;  5ERI A;  1JGS A;  1QBJ A;  2W57 A;  2LSO A;  4LG0 A;  2EA4 A;  2QWW A;  4O6J A;  5TJJ A;  1Z7U A;  2J5O A;  3E97 A;  3N4M A;  3KEO A;  3WG9 A;  4AIH A;  2X0L A;  1ZRE A;  1LDD A;  3QPH A;  2DQL A;  3R0A A;  2HYF A;  3QPT A;  3R4K A;  2FF4 A;  1WQ2 A;  2O61 A;  5LHI A;  1KU9 A;  1H9T A;  3VFZ A;  4CO8 A;  2V1D A;  1G6N A;  3B02 A;  2EK5 A;  4HX7 A;  2HS5 A;  2GQQ A;  2OZU A;  2M30 A;  1DPR A;  2XRO A;  4PCQ A;  3WOD F;  3RI4 A;  2JZY A;  4AIJ A;  4CDG A;  1MDM B;  4O3M A;  5H6R A;  4HV5 A;  1R7J A;  1YQA A;  4YIF A;  3V8L A;  1S8N A;  3BOQ A;  2HKO A;  1XGS A;  1IW7 F;  4U0V A;  6PAX A;  2W85 A;  2A68 F;  2XUB A;  4KMU X;  1HSJ A;  3SZP A;  1OR7 A;  1BC7 C;  5K5Q A;  2DFI A;  2L01 A;  1QQI A;  2CWE A;  5L3C A;  3DQV C;  4HLY A;  3PQK A;  2H09 A;  4I0B A;  3CLO A;  3DV8 A;  3GZ5 A;  2DK5 A;  1YW9 A;  1LQ1 A;  1O7L A;  5TRD A;  1U8R A;  3WTZ A;  4P5O A;  2EFP A;  1XGO A;  1QO0 D;  3ERE D;  1D8K A;  4H0E A;  3BY6 A;  4L9N A;  2ADU A;  1SAX A;  3WTX C;  4G9Y A;  4BYY A;  2DK8 A;  2VBX A;  1TBX A;  4Z2Y A;  3EYY A;  3ULQ B;  2V9V A;  3M8E A;  4RB2 C;  5ICF A;  1FP2 A;  3ZPL A;  4L18 B;  3L2C A;  2FXA A;  3IWF A;  5EEG A;  2RKH A;  4RGX A;  4S05 A;  3KZZ A;  3E5X A;  1ZRD A;  3NRV A;  4UXN A;  4HDV A;  3F23 A;  1ODD A;  3J80 K;  3ZQ7 A;  2PLY A;  3LQR A;  4OU0 A;  2O03 A;  2Y0M A;  3GX4 X;  1BBY A;  1K78 B;  1HXD A;  2EJR A;  1HKQ A;  4U7D A;  3E5U A;  5FFX A;  5CVV A;  3L00 A;  5ICC A;  5E18 F;  4FX4 A;  3W6K B;  5D8K B;  4KDP A;  4YFK F;  1B59 A;  1PUE E;  2EFQ A;  5E1X A;  1ZRF A;  3COA C;  2RC4 A;  3L9F A;  3FM3 A;  1L3L A;  3HOT A;  1IZ1 A;  2UWM A;  3HTS B;  4OIQ F;  5LLQ A;  4I7H A;  4EJV A;  1XN7 A;  4R79 A;  2FSW A;  2CGP A;  3KEQ A;  5ILV A;  2RN7 A;  3FMR A;  1JHH A;  3KP4 A;  2VE9 A;  1HST A;  2B0L A;  2HFH A;  3REO A;  3BRO A;  2FOK A;  1ZAO A;  2M1B A;  4ENK A;  3R61 A;  4GYI A;  5ILS A;  1RIO H;  3VOE A;  5JVT A;  1AOY A;  1S7O A;  2K02 A;  1D3Y A;  2QBY B;  2EB7 A;  1XMK A;  4KIF A;  1OYI A;  1R22 A;  3I58 A;  3O2P E;  1WKM A;  2GA1 A;  3K0L A;  1LEB A;  2X4H A;  1QPM A;  4GO1 A;  4AVP A;  2AXL A;  3QU3 A;  4EM0 B;  3I59 B;  4IVN A;  3FM5 A;  3LAJ A;  3ZP5 A;  3BPV A;  3MCZ A;  1PDN C;  2LDU A;  4AD9 A;  2QVO A;  2BE5 F;  4HF0 A;  1KQ0 A;  1UHW A;  2JSC A;  2D45 A;  5FD5 A;  1XB4 A;  1HBX G;  2NYX A;  2F5C A;  2F5D A;  2CG4 A;  3GEZ A;  1Z1D A;  2W84 A;  1T39 A;  2E7X A;  1J59 A;  1DDN A;  3F3X A;  1H0M A;  4KNY A;  1K78 A;  3ZMZ A;  2PJP A;  2VBW A;  2YR2 A;  5D6E A;  1YIO A;  3P9I A;  1ZN2 A;  3F21 A;  3C18 A;  2MA3 A;  3N97 A;  2ETH A;  3QOP A;  1K7A A;  5JI6 A;  2FE3 A;  1ZAR A;  1R00 A;  5HOO A;  2CO5 A;  2COM A;  1FLI A;  2FBH A;  3K9T A;  3LA7 A;  1R5H A;  4IXA A;  1I1G A;  4U0W A;  3ABT A;  5ICG A;  5J6X A;  3CJN A;  2EV5 A;  2P7V B;  2FQ3 A;  4I98 B;  2R7F A;  2D2W A;  4BHP A;  1YYV A;  3FXU A;  4IF4 A;  4MNU A;  3ECH A;  4P9F A;  3J81 K;  1U78 A;  2FMY A;  1MKM A;  1LDJ A;  1KU3 A;  4M72 A;  2JPB A;  2ACJ A;  4HV6 A;  1PP8 F;  1FPQ A;  5BMZ A;  2V1U A;  2QBY A;  4KFC A;  1E2X A;  4LLL A;  1FYL A;  3FX3 A;  2RVC A;  4M9S A;  5D4R A;  4GXO A;  3BZ6 A;  5JHU A;  5A2Q K;  4FX0 A;  2AS5 F;  3HSF A;  1YS7 A;  2Z5U A;  2IA0 A;  3IRQ A;  4A0X A;  3HRU A;  3P9K A;  1IRG A;  2QUF A;  1IF1 A;  4L9J A;  4N9I A;  2HGC A;  4UNO A;  3I59 A;  2FNA A;  2HYG D;  1XCV A;  3RYR A;  1MJ9 A;  1VTN C;  4YII A;  1FOK A;  2DI3 A;  5BPD A;  4HAM A;  4N9H A;  4ZYG A;  1LVA A;  4GGG A;  3ZN1 A;  4A6D A;  1XGM A;  1ZLJ A;  2VBZ A;  1I1S A;  2Q2E A;  1SD5 A;  2FU4 A;  1ZLK A;  2ESH A;  2A6H F;  5AON A;  1B4A A;  4UHT A;  3F8C A;  1RI7 A;  3S2W A;  3Q5F A;  1D5V A;  1TQP A;  2HWV A;  4BQA A;  3ELK A;  2G9W A;  3L7W A;  3FF5 A;  3BJO A;  1XCB A;  1RUO A;  2ZME B;  2Y75 A;  3QP5 A;  4IRI A;  3IKT A;  3MFK A;  4M6X A;  3CO6 C;  4U88 A;  2L3D A;  1X3U A;  1QNT A;  3DPL C;  5L3E A;  5HLH A;  1JXS A;  3MZH A;  5DD4 A;  4LK1 F;  1UST A;  2F2E A;  3JAM Z;  4G7O F;  3BP8 A;  5AIQ A;  2W25 A;  4D0P A;  1BC8 C;  3IC7 A;  3WTS C;  1BM9 A;  5F64 A;  5DV5 A;  4RB0 A;  3GZ6 A;  1STZ A;  2DPD A;  4WXD A;  1HW2 A;  1DP7 P;  3SXY A;  4R8H A;  4I09 A;  2QLZ A;  4G8X A;  1J7K A;  4FHT A;  4G7Z F;  1GHC A;  4A2U A;  3E3V A;  3LST A;  2A3S A;  3CO7 C;  3GVA A;  2OD5 A;  4MHG A;  1G4D A;  2WC2 A;  2Z3Y A;  2IP2 A;  2KKO A;  1FSE A;  1W7P D;  4PGG A;  1P4X A;  3TGN A;  2IW5 A;  2DLL A;  1KQ9 A;  1I6X A;  3BDD A;  3RPQ A;  3KCC A;  3M8F A;  1WI9 A;  4LMY A;  1FBU A;  2WTE A;  5E8G A;  2OU2 A;  1YTY A;  5FB2 A;  3FMQ A;  4PGH A;  4KYW A;  2XHK A;  1EV7 A;  1QGP A;  4KT5 C;  2EFW A;  1G3T A;  3AAF A;  4BHB A;  2RNJ A;  4DNC A;  4O5V A;  2YPR A;  5D5W B;  2R7D A;  2RDP A;  5HDK A;  4L5I A;  3ROU A;  3GFI A;  2H6C A;  2L54 A;  2UXX A;  4IPA A;  3ML6 A;  2ZME A;  3KLN A;  3IHU A;  4Q5S F;  1ZG5 A;  2A5Y B;  2PI0 A;  3WTY C;  4HZF A;  2A07 F;  2ZNY A;  5IT3 A;  2EFN A;  2BYV E;  3CTA A;  3FZV A;  2Z99 A;  3NQO A;  1ON1 A;  2YX7 A;  1A04 A;  1R58 A;  2E7W A;  1R23 A;  2CSO A;  2IA2 A;  2C6Y A;  5FGM A;  3F8N A;  3M1E A;  1XMA A;  4ESB A;  4NHJ A;  1F4K A;  2J5P A;  2HTJ A;  2XRN A;  1OYY A;  3FXQ A;  2HOE A;  2OQR A;  4L9T A;  4EGZ A;  3R6S A;  4XBF A;  4WWC A;  1JE8 A;  2K4B A;  3K1N A;  3KP2 A;  1XSD A;  2DT5 A;  4UVC A;  5BQT A;  4CGZ A;  3H3Z A;  3FWE A;  2UXN A;  1FZP B;  5CVI A;  4HLX A;  1Q1H A;  1OYW A;  1HQC A;  2V1X A;  3M7G A;  3GYH X;  2HZT A;  3GXO A;  2NS0 A;  3IL2 A;  4LLG F;  4P9U A;  4RGS A;  2ISY A;  3IWZ A;  4PDK A;  4L0Y B;  2O3F A;  5LHH A;  3GFL A;  1Y0U A;  4HF2 A;  5EEH A;  1BI0 A;  1UCR A;  1ON2 A;  5FLX K;  3TDZ C;  5E8I A;  1SD6 A;  4KIC A;  1KGS A;  4XSZ F;  1TNS A;  2M87 A;  2JPC A;  1ZYR F;  1S29 A;  4RB1 A;  2BGC A;  4U0Y A;  2CW0 F;  1MDM A;  1BI3 A;  5DCM B;  1S7A A;  5LGT A;  1WWX A;  4ENM A;  2H94 A;  3QRF F;  1YW7 A;  4HYE A;  2ZO4 A;  2HEO A;  3JAM K;  1O7F A;  4LJZ F;  2JRT A;  1HW1 A;  3OV8 A;  5D5X B;  3JTG A;  4UV8 A;  2W24 A;  1B6A A;  3B73 A;  2XVC A;  5ED4 A;  4Q48 A;  1LNW A;  2K4J A;  1MJB A;  2G7U A;  1XD7 A;  2ZBK A;  3F8F A;  5LGN A;  3C3W A;  1BI1 A;  3HRS A;  4M9Z A;  2K86 A;  5FO5 A;  3F72 A;  1FX7 A;  2H27 A;  5IT9 K;  4P55 A;  5L3D A;  3U1D A;  2MBF A;  3GF2 A;  1TNT A;  4Q47 A;  2MLG A;  2O6G E;  1WSU A;  2NNN A;  5CJ9 A;  1FBS A;  2VC1 A;  4MGR A;  1R1V A;  1Z05 A;  3GFM A;  3KP7 A;  1F5T A;  5F6F A;  3WGG A;  5D4S A;  1IXS B;  1O57 A;  1G3S A;  5E20 A;  1IAW A;  1MD0 A;  3FHZ A;  4HX8 A;  3L09 A;  2LKP A;  2UZK A;  5FFZ A;  4KA4 A;  3P7N A;  3K1M A;  3TDU C;  4Y13 A;  3KFW X;  1L0O C;  2XAG A;  5DDG A;  3ZMD A;  1FYM A;  5HLI A;  1D8J A;  3HSE A;  2DAO A;  3TO6 A;  4GYG A;  1FYK A;  3F8B A;  5CVR A;  5HS8 A;  2K7L A;  5LEK A;  1IN6 A;  4MTE A;  4OOI A;  3ZMV A;  2DPU A;  3G73 A;  4ZYE A;  3LWF A;  4JQF A;  5JFR A;  4CYD A;  1XDS A;  2VXZ A;  5ILU A;  3C7J A;  2HR3 A;  4BNC A;  2FBK A;  3HHH A;  4EJT A;  4M74 A;  4Y15 A;  1UFM A;  2Z33 A;  3T5X A;  2P4W A;  2VON A;  4ON0 A;  4RAZ A;  5L3B A;  1J0R A;  2VOP A;  4UVA A;  3MAJ A;  3WGH A;  3RDI A;  1REP C;  1G3Y A;  1K6O A;  2OZ6 A;  4QLC U;  4HOB A;  5D5U B;  4S04 A;  2XIG A;  2XAS A;  2FEZ A;  3TOB A;  3Q9S A;  2XAJ A;  5E17 F;  4M73 A;  1LB2 A;  4XSX F;  1U2W A;  2P5V A;  1P2F A;  2KRF A;  3HYI A;  1KU2 A;  5LRR A;  2ZNZ A;  2PMU A;  1ZHF A;  2DU9 A;  4XLN F;  1TW2 A;  2LNB A;  4EJW A;  3I0T A;  3RTR A;  2GZW A;  5DYM A;  5CYV A;  3V7C A;  3WTV C;  1B9N A;  1YW8 A;  1V3F A;  3V7R A;  2FRH A;  4KN7 X;  4EV0 A;  3TQN A;  1LEA A;  2O0Y A;  4XRF A;  1FSH A;  2JT1 A;  1T98 A;  2IJL A;  1U5T C;  5J8F A;  2E1C A;  2LF8 A;  2DTR A;  5LGU A;  1W5S A;  1SD4 A;  4ENJ A;  2GXB A;  1OPC A;  1NHA A;  1LDK B;  3K2Z A;  3E5Q A;  3WU1 B;  5D5V B;  4A0Z A;  3MWM A;  2QEN A;  2XGX A;  3F6O A;  2VOD A;  2GAU A;  2F5E A;  4CXF A;  2VOO A;  2XKO A;  5HS9 A;  3GW2 A;  3LFK A;  2G7H A;  5E1Z B;  4AWX B;  1TTY A;  5LBQ A;  3P9C A;  4WF2 A;  3I5U A;  2ZXJ A;  4HDU A;  2CFX A;  1F9N A;  3V8J A;  5KVR A;  2P5L C;  5D6F A;  1RUN A;  1SD7 A;  2PFB A;  4YFX F;  4L0Z B;  4CIC A;  3I64 A;  3WGI A;  1S6L A;  1FT9 A;  3GLX A;  4BHC A;  3DKW A;  1GXQ A;  3PQJ A;  2YU3 A;  4HQE A;  4OMZ A;  1FY7 A;  4RGU A;  5KK1 A;  1OMI A;  2MC3 A;  2BBY A;  3ECO A;  5BOX A;  3FMS A;  2DO7 A;  4JK1 X;  2M5W A;  1U3E M;  5HLG A;  4HW0 A;  1O3R A;  2GXG A;  3QU6 A;  1XDU A;  2CYY A;  1YS6 A;  3C1D A;  3EYI A;  2QZ8 A;  4K2E A;  2VE8 A;  2EFO A;  2QYO A;  1RZ4 A;  3HSR A;  1ONV A;  3KLO A;  1DPU A;  1G3W A;  1T2K A;  2FBI A;  1ZH5 A;  3TKY A;  3MEX A;  3LA3 A;  4WXH A;  4G7H F;  3DF8 A;  3F22 A;  4OIP F;  1C0W A;  5K1Y A;  4YG2 F;  1ZGJ A;  3HUG A;  2XAH A;  4LFU A;  1GVJ A;  3BJA A;  1R36 A;  4M6Y A;  4RAY A;  3LQQ A;  3WTT C;  5J8C A;  2KJC A;  4I0A A;  1YFH A;  3R60 A;  2Q8K A;  1HW5 A;  4E70 A;  5HDN A;  1ULY A;  4BH9 A;  3HRM A;  4ZZD A;  2IA1 A;  3WE2 A;  1HKT A;  2MD5 A;  2ZFW A;  4NQW A;  3F8M A;  3O6B B;  2VT2 A;  1J9I A;  2V6C A;  3K1P A;  2XAF A;  1E17 A;  4EVI A;  1FNN A;  4ESJ A;  4A0Y A;  3ABU A;  3RKW A;  1P4A A;  3GFJ A;  3O3K A;  3U9G A;  4ZYD A;  3KE2 A;  3TO9 A;  2KJB A;  3KP3 A;  1MGT A;  4WK8 F;  4P96 A;  3SZT A;  3EDP A;  1H9G A;  4ETS A;  2QQB A;  2WV0 A;  4MTD A;  5H6Q A;  3KP5 A;  5HVQ C;  2CQK A;  1KYW A;  1Z91 A;  2VN2 A;  2V79 A;  5HS7 A;  1BOA A;  1I5Z A;  3EET A;  1UHM A;  2P6S A;  1IN4 A;  2KIU A;  1TLH B;  1SFX A;  3E6M A;  4KUM A;  4N0B A;  4UV9 A;  1HKS A;  4HBL A;  3CUQ C;  2EV6 A;  4G94 A;  2VBY A;  3RYP A;  2EWN A;  1J75 A;  2GIV A;  5HDG A;  1DUX C;  2D1H A;  5JR3 A;  3DPT A;  5LRS A;  5E1W A;  3BWG A;  4Q4Z F;  3T1B A;  1BN5 A;  5DEQ A;  3T8T A;  2FML A;  3J81 Z;  4KIG A;  3MZY A;  2L02 A;  4G6Q A;  3DEU A;  2DW4 A;  1O3S A;  2LF7 A;  3CDH A;  3I53 A;  2HKX A;  3RKX A;  3K69 A;  3FXR A;  1R1T A;  4UVB A;  3OOP A;  1QZY A;  2HQN A;  1U5T B;  4RGR A;  1ZRC A;  4I2O A;  5A2Q Z;  1ZG1 A;  3LA2 A;  2F5F A;  2DQR A;  1B9M A;  3U2R A;  2P5K A;  5DD8 A;  3T0Y A;  3E6D A;  4CHU A;  5K5O A;  3T8R A;  3I54 A;  4U7B A;  3V7S A;  2BV6 A;  4A5N A;  3Q9V A;  4LB6 B;  2HQR A;  2GA2 A;  3SFZ A;  2P8T A;  1P92 A;  1YLF A;  1P6R A;  3GWZ A;  1SMY F;  1UB9 A;  4KMF A;  2ZCW A;  1ZG3 A;  2NRA C;  2L4A A;  3VB2 A;  2XKP A;  3ISP A;  4ZZL A;  5DUK A;  1MZB A;  2GWR A;  5CVU A;  3DP7 A;  3BPX A;  2PMH A;  5LHG A;  3SQN A;  3G3Z A;  3LAP A;  4WCG A;  5DUI A;  5L3F A;  1CF7 B;  3F6V A;  4HX4 A;  1TQI A;  3E6C C;  4ASN A;  3GO5 A;  2ZJ2 A;  2R3S A;  3R0J A;  1I27 A;  5AIP A;  1J5Y A;  1B1B A;  2M8E A;  1RNL A;  2RQP A;  4HF1 A;  5L3G A;  4ZYH A;  4B8X A;  4LGW A;  3I4P A;  4M9X A;  4GCV A;  1YO5 C;  2FNP A;  2O8X A;  2EV0 A;  3SHF A;  1IXR C;  4EJU A;  1P4W A;  4PZJ A;  1F1Z A;  2MLK A;  3JSP A;  4MQV A;  1CGP A;  3ZMU A;  2A61 A;  2PG4 A;  2DBB A;  4IHS A;  1T0F A;  3WTW C;  4WXC A;  1W5T A;  3CUO A;  4R1H A;  1LJ9 A;  5CLS A;  1GXP A;  2BEO A;  4TV7 A;  1U5T A;  2PEX A;  5BS6 A;  4EM1 A;  3WU0 A;  1TQM A;  5CVJ A;  3TOA A;  4LD5 A;  2E1N A;  1BIA A;  3IRR A;  4ESF A;  1Z6T A;  5FD6 A;  2STT A;  4A12 A;  2Y48 A;  3M9A A;  1KU7 A;  1IUY A;  2ISZ A;  2QQA A;  3RPU A;  3H3U A;  4EJO A;  5DCM A;  1EH8 A;  5F1R A;  1BJA A;  2PN6 A;  2JTV A;  1AWC A;  2IVM A;  2KIM A;  4KN4 X;  4JBA A;  2QQ9 A;  4M71 A;  4EM2 A;  3I71 A;  1IXC A;  4ZH4 F;  1TW3 A;  3KET A; 
#chains in the Genus database with same CATH topology
 4ZDL A;  4EQQ A;  2M45 A;  1VQO I;  3RKY A;  1Y56 A;  4Y17 A;  4YFN F;  5J4V A;  4BDZ A;  3S8P A;  2IPQ X;  1MBH A;  1F36 A;  4KIS A;  1EH7 A;  3L2W A;  3CJR B;  3FXL A;  1FWZ A;  1IRF A;  3W6J B;  3DFG A;  4C9Y A;  1CF7 A;  3EUH A;  2NVQ J;  1IN7 A;  2TDX A;  4IRG A;  4RM2 A;  4Y7N J;  2ZJQ F;  2Z9O A;  2OA4 A;  2R7O A;  2OQG A;  3PSI A;  1SFU A;  1RET A;  4LLN A;  4IL6 C;  2OAZ A;  1W0T A;  4HPQ A;  4EMS A;  1TL8 A;  2ELH A;  1K79 A;  3RJP A;  1QZZ A;  2A69 F;  2MYS A;  3ESW B;  3JSO A;  1Z9C A;  1W7P B;  2K9Q A;  2H1L A;  4IHY A;  3HIF A;  2OBP A;  4N4O B;  4XL9 A;  1T95 A;  1QVT A;  1N77 A;  5ICE A;  3KZY A;  1V4R A;  4DQ2 A;  2KLO A;  3PFI A;  2DA7 A;  3K4N A;  2R93 J;  5EG0 B;  1R5G A;  1ZGA A;  1KQ8 A;  1V54 H;  2H6B A;  1X1C A;  1WJD A;  4WX9 A;  2HDC A;  3V4G A;  3SYT A;  3CUQ B;  2DDB A;  3OIP A;  3BR2 A;  2STW A;  1USS A;  5JLX A;  4IRH A;  2L4M A;  2IS1 A;  4NB5 A;  1Y6I A;  2XV4 S;  5F27 A;  4FT8 A;  4I02 A;  4RS8 A;  2CRG A;  1UMQ A;  2KDO A;  1XSX A;  2MSY A;  3JRB A;  3NEU A;  2L5Q A;  2VT3 A;  2NNY A;  4F7Z A;  1FMV A;  1ZGW A;  2MG4 A;  1SFE A;  4GFB A;  1S3J A;  2TRT A;  3VOD A;  4LG0 B;  4B3A A;  4AID A;  4E7J A;  1Z3Y A;  2BOL A;  4BXU A;  3J7A O;  2RV8 A;  1CQT A;  4CZC A;  3GUD A;  2M2E A;  4QWQ A;  4QSH A;  1PP7 U;  2L9V A;  4F55 A;  3N05 A;  4EGY A;  4M3D A;  1W36 D;  2D1V A;  2LBF A;  3FBN B;  1K4T A;  2V6E A;  1U6G A;  4I01 A;  2P6T A;  3IKV A;  1IG7 A;  3J7A Y;  2K27 A;  1M1E B;  1U9N A;  5DCF A;  2JA8 J;  3QAH A;  2ZB9 A;  3D0S A;  1O3T A;  4RMN A;  2Q0O A;  2L9S A;  4B4C A;  5BPI A;  3A01 A;  1IJW C;  3HOS A;  3ZMT A;  1KA8 A;  3D5L A;  2KIF A;  5F08 A;  1IN5 A;  1VF9 A;  1KZH A;  3QOD A;  3VYT B;  4UUV A;  3E1S A;  3OYI A;  3MQ0 A;  5IOY A;  3J80 Z;  1Z77 A;  4OIO F;  2MH2 A;  4E6K G;  3IH4 A;  4XID A;  3HHG A;  2EA2 A;  4XRM A;  2AO9 A;  1FC3 A;  5K5R A;  1JHF A;  2MH9 A;  1SAU A;  4MEX F;  2KP6 A;  4HQM A;  4F91 B;  4ENN A;  3ZN0 A;  1SFK A;  2YSR A;  4QTR A;  1IN8 A;  2GOX B;  4OMY A;  4L5J A;  3DXJ F;  4MEY F;  4BS9 A;  5F04 A;  5HNF A;  3H0D A;  3H92 A;  3AG1 H;  2X51 A;  1SC7 A;  4Y52 J;  2ZKZ A;  3BR1 A;  4ABZ A;  2A6E F;  5FLX Z;  3PJR A;  1O3Q A;  3S17 J;  5JHF A;  4BE0 A;  2X1C A;  1ETK A;  3E6B A;  3TP3 A;  3WTU C;  1RPW A;  2MGQ A;  2IRF G;  3GTG J;  3TO7 A;  2M9H A;  4PJN A;  3JRH A;  3VEP A;  3CD6 I;  3LSP A;  4HA8 A;  4ZYA A;  1BIB A;  4IHT A;  4D5C A;  4BAY A;  2IT0 A;  5K7H A;  3HGG A;  4KIB A;  4G6D A;  4RA2 A;  3V8K A;  2NAZ A;  2PBI A;  3QP6 A;  1VFC A;  4XLP F;  5GAH J;  3S1N J;  1XGN A;  2IS4 A;  1SMT A;  3WE3 A;  3S2H J;  3A1Y A;  1W4M A;  3K4C A;  1EH6 A;  2CQQ A;  3KP6 A;  4PFP A;  2HTS A;  1T6S A;  4LB5 A;  4MQ9 F;  1MJA A;  1AU7 A;  5H20 A;  5M5W J;  1R1U A;  2ESN A;  2WWY A;  5HNH A;  3CMA I;  1W36 C;  2YX4 A;  4C2U A;  3SEZ A;  4CZZ A;  3HRT A;  2LY1 A;  4A3M J;  2DA5 A;  2P7C B;  1FBQ A;  4W97 A;  2FA5 A;  3HTU A;  4A5M A;  3HGY A;  3DCF A;  1W7P A;  1J2X A;  1OCR H;  2CW8 A;  3JW4 A;  4ZJZ A;  3I55 I;  2O9L A;  1OKR A;  4LK0 F;  4A3C J;  2OTL I;  1MNM C;  2ELK A;  4OWR B;  5CQE A;  4AIK A;  2RGV A;  1EKE A;  1Z6R A;  1BI2 A;  1YG2 A;  2PQ8 A;  4I99 C;  5EG0 A;  2LLK A;  1T38 A;  2WB1 A;  4B09 A;  3LSG A;  2MC4 A;  2LYC A;  2NOG A;  1X2M A;  3ZQI A;  2WAF A;  3CUQ A;  3FKJ A;  1DU6 A;  3I3L A;  4BXX J;  3H5R A;  5LEJ A;  3OR1 C;  4XON A;  1XSV A;  3RIR A;  2QM3 A;  1KYZ A;  4LOC A;  4OIN F;  4RB3 C;  1A31 A;  1YIT I;  4OIR F;  4A6E A;  2LD5 A;  4IJA A;  5GPA A;  1RC9 A;  2XAQ A;  3EQL F;  3BJ6 A;  3JTH A;  5D8L B;  5IT9 Z;  1FP1 D;  5CKT A;  5FRM A;  4L9V A;  4MFE A;  3ZMS A;  4BL0 B;  4NC8 A;  1T33 A;  1WRJ A;  3H9G A;  2VC0 A;  5ERI A;  1JGS A;  1QBJ A;  2W57 A;  2ME6 A;  2LSO A;  4BQQ A;  3DBL B;  2JUG A;  4LG0 A;  3I4M J;  2EA4 A;  2QWW A;  4O6J A;  4XLE A;  5TJJ A;  1DQU A;  3PO3 J;  1Z7U A;  2J5O A;  3E97 A;  3N4M A;  4BXF A;  4F93 B;  3M8J A;  4DYC A;  3KEO A;  2E34 A;  2NOJ B;  3WG9 A;  4AIH A;  2X0L A;  1ZRE A;  1LDD A;  3QPH A;  1IO2 A;  2WAQ N;  4PK4 A;  2DXI A;  2DQL A;  3L2U A;  3R0A A;  2HYF A;  3DTK A;  3QPT A;  3R4K A;  2M7A A;  2FF4 A;  1ZTR A;  1WQ2 A;  2O61 A;  3K4L A;  5LHI A;  1OJL A;  5M5X J;  1KU9 A;  3PNT A;  1TWA J;  2R92 J;  1H9T A;  1UJ8 A;  3VFZ A;  3W2W A;  4CO8 A;  5E3O A;  4BQO A;  2V1D A;  1G6N A;  3OYH A;  3B02 A;  2EK5 A;  3OOU A;  4NDL A;  3UR3 C;  4HX7 A;  4II2 A;  1EF4 A;  4HSR A;  2HS5 A;  2Y0S N;  2B7E A;  2GQQ A;  2OZU A;  3RZD J;  2M30 A;  1DPR A;  4M3G A;  2X6X A;  1EA3 A;  2MAB A;  4DW6 A;  4U87 A;  2XRO A;  4PCQ A;  1WVR A;  1BR1 A;  3WOD F;  3G71 I;  3RI4 A;  2MW8 A;  2JZY A;  2LRD A;  4AIJ A;  4CDG A;  1MDM B;  4O3M A;  5H6R A;  4HV5 A;  3OL4 A;  1R7J A;  1YQA A;  2NVY J;  3U21 A;  4YIF A;  2EIL H;  1APL C;  1IV8 A;  3V8L A;  3CME I;  1S8N A;  3BOQ A;  1XX5 A;  1ETW A;  2HKO A;  1XGS A;  4AC0 A;  1DP3 A;  2F48 A;  2QKL B;  1JT0 A;  1GVD A;  1MSF C;  5IPA A;  1IW7 F;  4U0V A;  3EUK L;  6PAX A;  1R6R A;  2W85 A;  3OSG A;  1X1B A;  3QWL A;  2A68 F;  2XUB A;  4KMU X;  1HSJ A;  1WH5 A;  1R5I D;  3SZP A;  2XDV A;  1UHS A;  1OR7 A;  1BC7 C;  5K5Q A;  1FIA A;  1DGR M;  2DFI A;  2OJE D;  2L01 A;  3CCU I;  1QQI A;  2CWE A;  5L3C A;  3FXK A;  3DQV C;  4Z6Y A;  3W6V A;  3ZQG A;  4HLY A;  3PQK A;  2H09 A;  2BHZ A;  3MKY B;  4I0B A;  3CLO A;  1K4S A;  3DV8 A;  1RKT A;  3GZ5 A;  2DK5 A;  1A36 A;  3S1R J;  1YW9 A;  5F0C A;  2E36 A;  1LQ1 A;  1O7L A;  5TRD A;  1R4N B;  1U8R A;  3WTZ A;  3ZR8 X;  2VJ5 A;  4P5O A;  3DEW A;  4FE7 A;  4B1R A;  2EFP A;  4X6A J;  5J1R A;  3GTL J;  1XGO A;  9ANT A;  3ZQH A;  2F5V A;  1QO0 D;  2KQR A;  3FXJ A;  1HF0 A;  3PO2 J;  4X1E A;  3ERE D;  1D8K A;  1X4P A;  1I39 A;  2W4S A;  4H0E A;  3BY6 A;  1VQ8 I;  4CCK A;  4L9N A;  2ADU A;  1SAX A;  4A93 J;  1VQK I;  3WTX C;  3QYF A;  4G9Y A;  4BYY A;  2DK8 A;  2EH3 A;  3AL0 C;  2VBX A;  4G12 A;  1TBX A;  4Z2Y A;  2XRL A;  3EYY A;  3BR6 A;  5BNG A;  4G6T B;  1MW7 A;  3JRI A;  3ULQ B;  2V9V A;  1NK2 P;  3M8E A;  4RB2 C;  1K6Y A;  5ICF A;  1D1B A;  1VQN I;  1FP2 A;  3ZPL A;  4L18 B;  3L2C A;  2FXA A;  2R7S A;  3IWF A;  5EEG A;  2RKH A;  4RGX A;  2OF7 A;  2ZJR F;  1X2N A;  4PJM A;  4S05 A;  3KZZ A;  1S7E A;  3E5X A;  3PNY A;  1ZRD A;  3RKQ A;  3NRV A;  4UXN A;  4BUP A;  4AU7 A;  4FIS A;  2XC7 A;  4HDV A;  3F23 A;  2NVT J;  1ODD A;  4V2G A;  3G1O A;  3J80 K;  2EQR A;  3ZQ7 A;  4Y33 A;  2PLY A;  2DMU A;  3ZCO A;  3LQR A;  3CP2 A;  4OU0 A;  2JSP A;  2O03 A;  2Y0M A;  3HJE A;  3SFI A;  3A0B C;  2KPM A;  3GX4 X;  1RKW A;  1BBY A;  2ELJ A;  4C2T A;  1K78 B;  2Y9Z A;  1HXD A;  5J1U A;  3RCO A;  3WHC A;  3OS0 A;  2EJR A;  3CDI A;  3RSN A;  1HKQ A;  2E1O A;  4A3K J;  1MBG A;  4EAT A;  4U7D A;  3E5U A;  5FFX A;  2V4J C;  2R7W A;  5CVV A;  3L00 A;  3CC7 I;  5ICC A;  2XF7 A;  3OL3 A;  1A6I A;  2ZME C;  5E18 F;  4FX4 A;  3W6K B;  3GCM A;  5D8K B;  5J47 A;  4KDP A;  4YFK F;  5E3L A;  1HC8 A;  1B59 A;  2VL8 A;  3CES A;  1PUE E;  2KIQ A;  1BW6 A;  1HDD C;  2HPI A;  3ABK H;  2EFQ A;  3BR5 A;  4FE4 A;  5E1X A;  1ZRF A;  4BU2 A;  3COA C;  2RC4 A;  3L9F A;  1MMA A;  3FM3 A;  3J7Y J;  1L3L A;  1X1D A;  3HOT A;  1TC3 C;  2M4G A;  1IZ1 A;  3OYM A;  1MBF A;  3HTS B;  2UWM A;  3ZRG A;  4OIQ F;  5LLQ A;  4I7H A;  2IXS A;  1VQ6 I;  2JWT A;  1XN7 A;  4EJV A;  4R79 A;  1ITY A;  2FSW A;  4BE1 A;  2CGP A;  3KEQ A;  3SDG A;  5ILV A;  1ZKG A;  2RN7 A;  3FMR A;  2CH0 A;  1BJZ A;  5KAF C;  3FXO A;  4E7Z A;  2F4M B;  1JHH A;  4BJ6 C;  3KP4 A;  2VE9 A;  1WPK A;  3CQZ J;  2WB1 N;  2IBD A;  1HST A;  3GTK J;  2B0L A;  2HFH A;  3ZQL A;  3REO A;  4A3E J;  3LSK A;  2L7F P;  3BRO A;  1ETQ A;  3SEQ A;  2V26 A;  2FOK A;  2L7K A;  1ZAO A;  2M1B A;  4Y4R A;  4ENK A;  3R61 A;  4XOR A;  4GYI A;  5ILS A;  1RIO H;  2BZT A;  4J19 A;  2XGC A;  3LOC A;  2V7F A;  3VOE A;  5JVT A;  1I6H J;  1AOY A;  5E3M A;  1WH7 A;  1S7O A;  2K02 A;  2KRH A;  1YIJ I;  3JRG A;  1D3Y A;  2QBY B;  4FET A;  2EB7 A;  1XMK A;  3TW6 A;  3JCU C;  1K83 J;  3HKZ A;  3FXM A;  4KIF A;  2XB0 X;  1OYI A;  1R22 A;  2LY2 A;  2ZXH A;  2Y69 H;  1IV6 A;  1MSE C;  3I58 A;  5IP7 J;  3BC8 A;  1JJ6 C;  3DU6 A;  1BL0 A;  2R7R A;  2R7T A;  3O2P E;  1WKM A;  2GA1 A;  4C3J J;  2WAE A;  3K0L A;  1LEB A;  3MKL A;  2X4H A;  5GP9 A;  3BTJ A;  1LE8 B;  1P9Q C;  1QPM A;  4GO1 A;  3KZI C;  4AVP A;  5H2F C;  5EYR A;  3JRF A;  4B3X A;  2AXL A;  2XSJ C;  4OAY A;  3AG2 H;  3QU3 A;  3PUB A;  4EM0 B;  3BR0 A;  3K10 A;  3I59 B;  1F43 A;  2DMT A;  4IVN A;  3FM5 A;  4BE2 A;  3E7L A;  3H36 A;  3BPV A;  3LAJ A;  3ZP5 A;  5F0H A;  1SFO J;  3OYK A;  3MCZ A;  1PDN C;  2LDU A;  4AD9 A;  2QVO A;  3H35 A;  3GTM J;  2CV0 A;  2BE5 F;  4HF0 A;  1YHQ I;  1KQ0 A;  1UHW A;  2JSC A;  2D45 A;  5FD5 A;  4CCO A;  1XB4 A;  1HBX G;  3S16 J;  2NYX A;  4Y3O A;  2F5C A;  3CCV I;  4RLQ A;  2F5D A;  1WJA A;  1YX5 A;  3L2Q A;  2CG4 A;  4YRV A;  2DTZ A;  4E7L A;  2Y2Z A;  3GEZ A;  1Z1D A;  3WG7 H;  2W84 A;  1T39 A;  3CMM A;  2E7X A;  3HOZ J;  3LNQ A;  1J59 A;  1DDN A;  5EEA A;  3QYB A;  3HOW J;  2Q2E B;  3J7Z I;  5HLT A;  3AG3 H;  3F3X A;  2O5R A;  2DOE A;  3Q0U A;  4JX4 A;  1H0M A;  4KNY A;  4MO7 A;  1K78 A;  3ZMZ A;  2PJP A;  2VBW A;  1MMN A;  3AFH A;  3DKX A;  2R5Y A;  4XM3 A;  2JA5 J;  2Q1Z B;  2YR2 A;  2XF5 A;  5D6E A;  1RR7 A;  1YIO A;  3BQZ A;  3P9I A;  2M34 A;  1ZN2 A;  3F21 A;  4BKX A;  1YJW I;  3C18 A;  2XPV A;  2MA3 A;  3N97 A;  2LG4 A;  1X3Z B;  2ETH A;  2WAQ A;  1TWC J;  5KCM A;  3QOP A;  3O8H A;  1JKP C;  1K7A A;  5JI6 A;  5C4X J;  4PJL A;  4UUS B;  2FE3 A;  1ZAR A;  3S93 A;  3TED A;  1R00 A;  1X1A A;  5KHD A;  5HOO A;  2K9N A;  1D1C A;  2CO5 A;  2COM A;  4RDU A;  1QVU A;  3F9K A;  3IP4 B;  2FBH A;  1FLI A;  3JRE A;  2E60 A;  3K9T A;  3LA7 A;  1R5H A;  2X6O A;  4FAS D;  2Y0S A;  3GTJ J;  4IXA A;  2LY9 A;  1FOX A;  4BDY A;  1B72 B;  4DZJ A;  1I1G A;  4U0W A;  4IOC F;  3ABT A;  2CUE A;  5ICG A;  2B63 J;  5DS9 A;  2H8W A;  3CJN A;  5J6X A;  3QQA A;  2EV5 A;  2P7V B;  1ZR2 A;  2DA1 A;  1TT5 B;  2HU9 A;  2FQ3 A;  4I98 B;  2AQE A;  2R7F A;  2D2W A;  4BHP A;  5TGT A;  4BJ5 C;  1YYV A;  3FXU A;  4IF4 A;  4MNU A;  3ECH A;  4P9F A;  3RPU D;  3BR3 A;  2ICW G;  5EZH A;  3J81 K;  1U78 A;  2FMY A;  2JJ7 A;  1XS9 A;  1MKM A;  2X48 A;  2WAD A;  3HBL A;  3VSK A;  2BY0 A;  4BBR J;  1LDJ A;  1KU3 A;  1W5C C;  2HI3 A;  2JPB A;  4M72 A;  2ACJ A;  4HV6 A;  3AKZ A;  4B47 A;  1PP8 F;  1FPQ A;  5BMZ A;  2V1U A;  2AQF A;  2QBY A;  2YUS A;  4JYK A;  2P0W A;  4BQN A;  4FTH A;  4KFC A;  1E2X A;  4LLL A;  3CCS I;  2WY8 Q;  4B43 A;  1FYL A;  1WCM J;  3FX3 A;  4GDF A;  3H0G J;  2CQ7 A;  2RVC A;  4M9S A;  5D4R A;  4GXO A;  3BZ6 A;  5JHU A;  1O4X A;  4FX0 A;  5A2Q K;  2AS5 F;  3HSF A;  3G6E I;  1YS7 A;  2ECB A;  2Z5U A;  2VKH A;  2IA0 A;  3IRQ A;  4A0X A;  3HRU A;  3P9K A;  1LE8 A;  1MNE A;  4A3F J;  2QUF A;  1IF1 A;  1IRG A;  2I5U A;  4L9J A;  4N9I A;  1ETX A;  3OS1 A;  1X3W B;  2VI6 A;  2HGC A;  1Y0N A;  1JKQ C;  4UNO A;  2L9N A;  2FD5 A;  4LG3 A;  3I59 A;  4RBO A;  4UY8 I;  2FNA A;  3A4C A;  2HYG D;  3K2A A;  1XCV A;  4DGW B;  3RYR A;  2LKS A;  1MJ9 A;  2KT0 A;  2VQH A;  5GAD J;  1VTN C;  3OIQ A;  1Z7L A;  4YII A;  3CCL I;  3AL0 B;  4XR6 A;  3U1K A;  2VQL A;  1FOK A;  1QHG A;  2DI3 A;  1D0X A;  4RAF A;  5EGO B;  5BPD A;  3QYE A;  4HAM A;  4N9H A;  4A3I J;  3BG3 A;  3BTI A;  3V42 A;  2D5V A;  4ZYG A;  1LVA A;  1MMS A;  2HPM A;  2DT6 A;  2I10 A;  2IEK A;  4GGG A;  1GDT A;  4AYB A;  3ZN1 A;  3HPG A;  1XGM A;  2VBZ A;  1ZLJ A;  4A6D A;  1Z21 A;  3MKZ A;  1I1S A;  2Q2E A;  2QSF X;  1SD5 A;  2CQX A;  2PX9 A;  4DBQ A;  2FU4 A;  1SVM A;  1ZLK A;  2ESH A;  4NQW B;  2A6H F;  5AON A;  1B4A A;  4UHT A;  1U9O A;  4XKB A;  3HOV J;  3F8C A;  1RI7 A;  3LSJ A;  2EIJ H;  3G2B A;  3S2W A;  3Q5F A;  2XPU A;  2VJJ A;  1I3Q J;  4UUT A;  1D5V A;  1TQP A;  2HWV A;  1JI8 A;  1ORK A;  4BQA A;  2R4G A;  3ZQF A;  1GV5 A;  1ACI A;  2COB A;  3ELK A;  2G9W A;  3L7W A;  4XOP A;  1PYV A;  2AHQ A;  3FF5 A;  5LD2 C;  4JP0 A;  4HNT A;  3D1N I;  4HRI A;  3C2H A;  3BJO A;  3S14 J;  4UUS A;  1XCB A;  1RUO A;  2ZME B;  1D1A A;  3ZOB A;  3S3O A;  2Y75 A;  3VPR A;  3QP5 A;  4IRI A;  4XLC A;  4D7N A;  1H89 C;  1YE9 A;  3IKT A;  3MFK A;  4M6X A;  3CO6 C;  3OYL A;  4DZP A;  4U88 A;  3HKZ N;  5IY5 H;  3K4B A;  2L3D A;  4IHX A;  1X3U A;  1QNT A;  2LRE A;  4XNF A;  1B72 A;  4MIM A;  2KHM A;  3DPL C;  2OUM A;  5L3E A;  1R49 A;  1OCP A;  5CPR B;  3ZXS A;  5HLH A;  2E2I J;  1OCT C;  1JXS A;  1AA7 A;  3MZH A;  2FJ1 A;  5DD4 A;  2ZSH B;  3ZGK A;  4LK1 F;  3CC2 I;  1UST A;  2F2E A;  3JAM Z;  4G7O F;  3BP8 A;  1W1W E;  2CMP A;  5AIQ A;  2W25 A;  4CUG A;  1SVL A;  2KZV A;  1LVK A;  2M0C A;  3GLL A;  3JRA A;  1FMW A;  4D0P A;  3FK7 A;  1BC8 C;  3IC7 A;  2OV7 A;  3WTS C;  4M6V A;  2H1K A;  2OC6 A;  2JMW A;  2VJ4 A;  1BM9 A;  5F64 A;  5DV5 A;  2DFH A;  3HOY J;  3RZO J;  4RB0 A;  3GZ6 A;  1STZ A;  1V55 H;  2X6W A;  4CYC B;  3HL2 A;  2PMZ N;  2DPD A;  2IS6 A;  4XRS A;  2CQN A;  4WXD A;  1HW2 A;  1DP7 P;  3SXY A;  4IX7 A;  5FRN A;  3DLL F;  5FKL A;  4R8H A;  4XK4 A;  1MBJ A;  2QLZ A;  4I09 A;  2X6Y A;  2R7Q A;  4G8X A;  1J7K A;  4FHT A;  3CJT B;  4G7Z F;  1GHC A;  2X1D A;  2HXO A;  4A2U A;  1VQ5 I;  1ZEL A;  3E3V A;  3LST A;  2WBM A;  2EIM H;  1HDP A;  1R9T J;  2A3S A;  1HOM A;  3CO7 C;  2HOA A;  2CU7 A;  3GVA A;  2OD5 A;  5LFA A;  4MHG A;  2GXA A;  5JLW A;  2HNH A;  3DPU A;  3LSR A;  2JQ7 A;  1B8I B;  1G4D A;  2WC2 A;  3IV5 A;  2Z3Y A;  2IP2 A;  2KKO A;  4B44 A;  1FSE A;  1W7P D;  4PGG A;  1P4X A;  3TGN A;  3K4K A;  1S5L C;  5EGO A;  3VWB A;  5IYD J;  4NUB A;  2IW5 A;  4HG2 A;  2DLL A;  1KQ9 A;  5IP9 J;  2HOT A;  1I6X A;  2P81 A;  3EUA A;  3BCA A;  3MN2 A;  3BDD A;  1UAA A;  3RPQ A;  4EEF G;  4BJT A;  1I50 J;  3BCB A;  2XPW A;  2XB5 A;  3M4O J;  3KCC A;  3M8F A;  1FIP A;  1WI9 A;  4LMY A;  3X2Q H;  1SAN A;  1FBU A;  4D7M A;  2WTE A;  5E8G A;  3CC4 I;  2CJJ A;  4V19 K;  2EBI A;  4UB8 C;  4BAC A;  2OU2 A;  1YTY A;  5FB2 A;  2K5C A;  3FMQ A;  4PGH A;  4KYW A;  1QPI A;  4CCJ A;  3UKG A;  2XHK A;  1EV7 A;  1QGP A;  1X4O A;  4KT5 C;  2EFW A;  1G3T A;  3BG6 A;  3AAF A;  4BHB A;  2XGE A;  2RNJ A;  3SJM A;  2ID3 A;  4DNC A;  4O5V A;  2YPR A;  5D5W B;  5B3S H;  1H88 C;  2TCT A;  4IO9 F;  2R7D A;  2RDP A;  5FKN A;  4KJZ A;  5HDK A;  1NG6 A;  2I8D A;  1U8B A;  2W00 A;  1RES A;  4L5I A;  3ROU A;  2H6C A;  2L54 A;  2UXX A;  3GFI A;  2OTJ I;  1ZR4 A;  4IPA A;  3ML6 A;  2K9S A;  2ZME A;  2RQQ A;  3KLN A;  3IHU A;  4Q5S F;  1ZG5 A;  2A5Y B;  2IGO A;  5B5E C;  2PI0 A;  1P7I A;  3A2K A;  2CUJ A;  2KDZ A;  1R4M B;  3WTY C;  4HZF A;  1JTY A;  4CSW A;  1RR8 C;  2ZNY A;  2A07 F;  4HNU A;  3PFY A;  5IT3 A;  2M4K A;  2EFN A;  2BYV E;  3CTA A;  5C44 J;  5M3M J;  3FZV A;  1JTX A;  2Z99 A;  1N25 A;  1K61 A;  3NQO A;  1ON1 A;  1MMG A;  1MIJ A;  2YX7 A;  1A04 A;  1R58 A;  3RQ4 A;  1OFC X;  2E7W A;  1XPX A;  3DLA A;  1R23 A;  3ZQQ A;  2CSO A;  2IA2 A;  2VXD A;  1Y39 A;  2C6Y A;  5FGM A;  2LFB A;  3F8N A;  2DA3 A;  1XMA A;  3M1E A;  4ESB A;  4NHJ A;  1AKH B;  3FDY A;  2J5P A;  1F4K A;  4E7I A;  2HTJ A;  1XC5 A;  2XRN A;  1OYY A;  1JGG A;  4ANJ A;  3FXQ A;  2VAS A;  1I3A A;  2HOE A;  2OQR A;  4L9T A;  4EGZ A;  1BA5 A;  3P5J A;  3R6S A;  4XBF A;  2L7Z A;  4WWC A;  2VIX A;  2LC2 A;  1VQM I;  4IQ4 A;  2K4B A;  1JE8 A;  3K1N A;  3KP2 A;  4A3J J;  1XSD A;  4F52 A;  1TWH J;  2DT5 A;  1Z3X A;  1XTA A;  1VQ7 I;  4CYC A;  4UVC A;  2G0E A;  5BQT A;  1OCO H;  1A35 A;  2V9P A;  4CGZ A;  3VDX A;  3E0J B;  4A69 C;  1OQY A;  2EIK H;  2DA2 A;  3H3Z A;  3FWE A;  2UXN A;  1FZP B;  1YRN B;  5CVI A;  1D5Y A;  2R5Z B;  4ZTJ A;  4AYB N;  3GTO J;  4HLX A;  1Q1H A;  2ME0 A;  1OYW A;  2ZXW H;  3H1C A;  1Y8Q B;  4HEA 2;  1HQC A;  2V1X A;  1NK3 P;  3M7G A;  1N75 A;  3GYH X;  2NVX J;  2HZT A;  3GXO A;  5FKM A;  3D5R C;  2NS0 A;  1LKX A;  2QQ8 A;  3IL2 A;  2L0K A;  1WFX A;  2OCC H;  4LLG F;  2WA0 A;  4LIT A;  3B6A A;  4RGS A;  4P9U A;  2QEX I;  1GLN A;  2ISY A;  2LH9 A;  3IWZ A;  5K7F A;  2DYS H;  4PDK A;  4L0Y B;  4JX5 A;  2O3F A;  3C2B A;  4D1Q A;  5C3E J;  5LHH A;  3GFL A;  1Y0U A;  4HF2 A;  5EEH A;  2AXT C;  5EJC A;  1BI0 A;  1UCR A;  1ON2 A;  2HVR A;  5FLX K;  2JUC A;  4B48 A;  2ZSI B;  3TDZ C;  5E8I A;  1GV2 A;  1SD6 A;  4KIC A;  5J3L A;  1N78 A;  2IGK A;  1KGS A;  4XSZ F;  4QPO A;  3WHB A;  1TNS A;  2M87 A;  1IUF A;  2JPC A;  1OCZ H;  2GIZ A;  5M3F J;  1IDZ A;  1BOB A;  3CF5 F;  2XAU A;  1NTC A;  1D0Z A;  4C3H J;  1ZYR F;  3BTL A;  1S29 A;  4RB1 A;  2BGC A;  1MH3 A;  2LKX A;  4XLF A;  2CW0 F;  4U0Y A;  1MDM A;  1BI3 A;  1UG0 A;  5DCM B;  1S7A A;  2VQG A;  5B1A H;  5LGT A;  3CCQ I;  1WWX A;  4ENM A;  2H94 A;  3QRF F;  3K7A J;  1YW7 A;  3H9J A;  3Q3S A;  2XGD A;  2JA7 J;  4HYE A;  3H3V K;  4E4H A;  4XKV A;  1JUM A;  1Y8R B;  2ZO4 A;  3DEE A;  3JAM K;  2HEO A;  3QPL A;  4ITV A;  4KT6 A;  1O7F A;  4LJZ F;  2JRT A;  2VB6 A;  1HW1 A;  3LSI A;  3OV8 A;  3TP0 A;  5D5X B;  4M3E A;  1TP4 A;  5F1J A;  5TIS C;  1FEX A;  5J40 A;  2CV2 A;  2QGU A;  2B9S A;  3JTG A;  4XQF A;  4IKF A;  4UV8 A;  2HQA A;  2W24 A;  1B6A A;  3B73 A;  2XVC A;  5ED4 A;  4Q48 A;  1LNW A;  2JRM A;  1MJB A;  2K4J A;  2QSH X;  1GUU A;  3OIO A;  3GME A;  2V9K A;  1AHD P;  3KYL A;  3GTQ J;  2ECC A;  2G7U A;  3OYN A;  3HDD A;  1XD7 A;  2ZBK A;  3AG4 H;  3F8F A;  2V1N A;  1VZ0 A;  5LGN A;  3C3W A;  1BI1 A;  3HRS A;  4M9Z A;  1QU3 A;  2K86 A;  5FO5 A;  3GBG A;  1AKH A;  3F72 A;  1FX7 A;  2H27 A;  5IT9 K;  1G2H A;  4P55 A;  5L3D A;  3U1D A;  2MBF A;  3S1M J;  2W7N A;  3GF2 A;  1TNT A;  2BHY A;  4Q47 A;  3MD2 A;  2DDA A;  2MLG A;  4GRI A;  3PIP F;  1WSU A;  2O6G E;  2NNN A;  5CJ9 A;  1FBS A;  2VC1 A;  4MGR A;  3S3M A;  1MMD A;  1R1V A;  1Z05 A;  3GFM A;  3KP7 A;  1F5T A;  3ASO H;  2GOM A;  4J01 A;  5F6F A;  3WGG A;  3IAM 2;  5D4S A;  1YRN A;  1IXS B;  1O57 A;  1G3S A;  1YJN I;  2HZD A;  5E20 A;  2R5Z A;  1IAW A;  4ZTF A;  1MD0 A;  1UEL B;  3FHZ A;  4HX8 A;  2W1O A;  3L09 A;  4M3F A;  2LKP A;  2UZK A;  5FFZ A;  1FTT A;  4KA4 A;  4ZDO A;  3P7N A;  3K1M A;  2A6T A;  3TDU C;  2PMZ A;  4Y13 A;  3KFW X;  3CMY A;  1L0O C;  5IYC J;  2XAG A;  5DDG A;  4PJJ A;  2WY7 Q;  3HC7 A;  4QPQ A;  3ZMD A;  1FYM A;  5HLI A;  1D8J A;  4RAG A;  3HSE A;  2DAO A;  4NBQ A;  2BW3 B;  3TO6 A;  4GYG A;  1HCR A;  3M07 A;  1FYK A;  3F8B A;  2EPF A;  2Z1D A;  2KIS A;  4L5E A;  5CVR A;  5HS8 A;  3OYA A;  2EZH A;  3CCY A;  2K7L A;  5LEK A;  2LK2 A;  5B1B H;  1IN6 A;  1ZK8 A;  3A03 A;  4MTE A;  4OOI A;  4X0G A;  2F4O B;  3ZMV A;  2O8K A;  2DPU A;  2CFO A;  3G73 A;  2O7O A;  3A01 B;  4ZYE A;  3LWF A;  2VPL A;  4JQF A;  5JFR A;  4CYD A;  4YEL A;  1XDS A;  4BY1 J;  2VXZ A;  5ILU A;  3S3N A;  3DBR B;  2KMU A;  2JN6 A;  2E1M C;  3C7J A;  2HR3 A;  4BNC A;  2FBK A;  3HHH A;  3LFU A;  1JJ8 C;  2BVL A;  3VYS B;  2UUZ A;  2BY1 A;  4EJT A;  4A3G J;  4PJ0 C;  4M74 A;  4Y15 A;  3OYG A;  1UFM A;  2Z33 A;  3G4S I;  4KIT B;  3T5X A;  2HOS A;  1QHH D;  4DBR A;  4E7S A;  2P4W A;  1MH4 A;  2ZC2 A;  2M0M A;  2VON A;  4ON0 A;  2DOD A;  3S1Q J;  4RAZ A;  5L3B A;  1J0R A;  2VOP A;  4P1W A;  2QF7 A;  2HQ5 A;  4UVA A;  1Y1W J;  1WI3 A;  4XOT A;  3MAJ A;  5E79 C;  1U0J A;  4DYR A;  3WGH A;  3RDI A;  1REP C;  3FBI B;  1G3Y A;  4XRS G;  1K6O A;  2OZ6 A;  1D0Y A;  4QLC U;  4HOB A;  2CUZ A;  3FIW A;  5D5U B;  4AVZ A;  4S04 A;  2GM4 A;  2XIG A;  2XAS A;  2FEZ A;  3TOB A;  3CP8 A;  3Q9S A;  3WU2 C;  2XAJ A;  5E17 F;  2BY3 A;  4M73 A;  1LB2 A;  4XSX F;  1U2W A;  2NXN B;  2P5V A;  3H5A A;  1P2F A;  2KRF A;  3HYI A;  1KU2 A;  5LRR A;  2ZNZ A;  4D9J A;  2PMU A;  3KIO A;  3OMY A;  1ZHF A;  2DU9 A;  2M7B A;  4PSW A;  2DOA A;  3ONQ A;  4XLN F;  1TW2 A;  2LNB A;  4EJW A;  3I0T A;  2LMD A;  3RTR A;  2GZW A;  5DYM A;  2HXI A;  1NG7 A;  5CYV A;  1T0F C;  3CF2 A;  3V7C A;  3WTV C;  1B9N A;  1YW8 A;  1V3F A;  1DU0 A;  3VYR B;  2DA6 A;  3V7R A;  3HOX J;  1X1P A;  2FRH A;  4KN7 X;  3NWT A;  4EV0 A;  5DM6 F;  1RRJ A;  3TQN A;  1LEA A;  2O0Y A;  3KYC B;  4CH7 A;  1MBE A;  2A5W A;  3RQI A;  3HM5 A;  4XRF A;  3OYF A;  4XN3 A;  5IP6 A;  1FSH A;  3L1P A;  4H4K C;  2JT1 A;  1T98 A;  2IJL A;  1U5T C;  3MMY B;  5J8F A;  4LIU A;  4CCM A;  2LF8 A;  3OYB A;  3KYD B;  2E1C A;  2DTR A;  5LGU A;  3S15 J;  4F92 B;  1W5S A;  1SD4 A;  1A6Q A;  1ETV A;  4ENJ A;  2GXB A;  1OPC A;  2X85 A;  1IGN A;  2KFD A;  1NHA A;  1OLT A;  2CW7 A;  1WJE A;  1LDK B;  2RAE A;  3K2Z A;  2VKD A;  4XN0 A;  3E5Q A;  3CCE I;  2BY2 A;  3WU1 B;  5D5V B;  1OIS A;  4A0Z A;  2RNG A;  3MWM A;  3HUG B;  2QEN A;  3OY9 A;  2KL4 A;  2QA4 I;  2EZK A;  2K9M A;  2XGX A;  3HOU J;  1FJL A;  2YS9 A;  3F6O A;  2VOD A;  2DOF A;  2GAU A;  2BW3 A;  2DFF A;  2F5E A;  4CXF A;  4PFO A;  2VOO A;  2XKO A;  1J09 A;  2R7U A;  2GBY A;  4PUS A;  3TMO A;  5HS9 A;  3GW2 A;  3LFK A;  2K3F A;  2G7H A;  2E2J J;  1YOV B;  5E1Z B;  4AWX B;  3LSM A;  1TTY A;  5LBQ A;  3S2D J;  3OYD A;  2QSG X;  2DN0 A;  3P9C A;  3HXL A;  4WF2 A;  5K7Z A;  3I5U A;  1PUF B;  2ZXJ A;  4HDU A;  2CFX A;  1PJR A;  1WJC A;  2X1E A;  1F9N A;  2XF6 A;  3V8J A;  2DJI A;  1P7J A;  4XKC A;  5KVR A;  1FOW A;  2P5L C;  1TZL A;  5D6F A;  1XG1 A;  1RUN A;  1SD7 A;  2PFB A;  3JRC A;  3C2G A;  2K9L A;  4BGD A;  2HVS A;  4YFX F;  4L0Z B;  1VND A;  4CIC A;  2LR8 A;  3I64 A;  2DMN A;  1ETY A;  1TWG J;  2IS2 A;  3HEF A;  4S0H B;  1JKO C;  3WGI A;  1ENH A;  3EUH C;  2ZFU A;  3W2A A;  1S6L A;  1DGW Y;  4CCN A;  4CA0 A;  1FT9 A;  3GLX A;  4YEJ A;  4BHC A;  3DKW A;  1GXQ A;  3PQJ A;  1S9H A;  2YU3 A;  4C2M J;  3OS2 A;  4HQE A;  1JUP A;  1SEU A;  1OCC H;  5CQG A;  2Y31 A;  4OMZ A;  2CUF A;  2KZG A;  1FY7 A;  4RGU A;  1BR4 A;  2DA4 A;  5KK1 A;  1OMI A;  3FKI J;  2MC3 A;  2BBY A;  5HOD A;  2DCE A;  3W3C A;  3ECO A;  5BOX A;  2E5Z A;  2LTP A;  1ZQ3 P;  2GLO A;  3GZN B;  2Z2S B;  1V5E A;  3FMS A;  3BZC A;  2DO7 A;  4JK1 X;  3EPZ A;  2M5W A;  1U3E M;  3CCJ I;  1JT6 A;  5HLG A;  3PL8 A;  4HW0 A;  1Y1V J;  2E2H J;  1O3R A;  2GXG A;  1ERD A;  5GPC A;  3F0C A;  3QU6 A;  2NS7 A;  2XSD C;  1XDU A;  2CYY A;  1YS6 A;  2OPT A;  3VSL A;  2K85 A;  3C1D A;  5IOZ A;  3NWS A;  2KRC A;  2QZ8 A;  3EYI A;  3OR2 C;  2MD0 A;  4K2E A;  1EJ9 A;  2VE8 A;  2HVQ A;  2EFO A;  2QYO A;  1JUS A;  2Z16 A;  1RZ4 A;  4BY7 J;  5GAG J;  3HSR A;  1ONV A;  2BXZ A;  2EZL A;  3KLO A;  1DPU A;  4E7K A;  3G1L A;  3KX2 A;  4XLA A;  4IOA F;  2VKV A;  3IAS 2;  2CV1 A;  3I56 I;  1G3W A;  2VQC A;  4XLH A;  1T2K A;  4LIV A;  2FBI A;  1ZH5 A;  3TKY A;  4QIW N;  2JVG A;  2EZI A;  3MEX A;  1WJF A;  3K6G A;  4UB6 C;  5EZG A;  2VKE A;  2K3P A;  3LA3 A;  4IHW A;  1FTZ A;  4JOM A;  4WXH A;  3IUO A;  4G7H F;  3PM1 A;  2W82 A;  3DF8 A;  1E0E A;  3F22 A;  4OIP F;  1C0W A;  3IH2 A;  5K1Y A;  4N4N B;  5IYB J;  1WJB A;  2L9R A;  3BG7 A;  1WHU A;  4YG2 F;  1ZGJ A;  5B66 C;  1IRX A;  3HUG A;  2XAH A;  3MZ8 A;  4LFU A;  1GVJ A;  3BJA A;  1R36 A;  1T08 B;  4OAZ A;  4M6Y A;  4CCL A;  4RAY A;  3LQQ A;  3WTT C;  3K70 D;  5J8C A;  4ZC3 A;  3CZ6 A;  5GTI C;  2KJC A;  4I0A A;  1YFH A;  3R60 A;  2Q8K A;  1HW5 A;  3H9Q A;  4E70 A;  3DBH B;  5HDN A;  3MVP A;  1ULY A;  4BH9 A;  2FOW A;  3HRM A;  4ZZD A;  4XMY A;  4IHV A;  2IA1 A;  2QCO A;  3WE2 A;  1HKT A;  4MLO A;  2MD5 A;  2ZFW A;  4NQW A;  2Y9Y A;  2VPR A;  3F8M A;  3O6B B;  2VT2 A;  1J9I A;  2V6C A;  3K1P A;  2XAF A;  1E17 A;  3BQY A;  4II3 A;  1T8I A;  2X9D A;  3CDL A;  4EVI A;  5JVG F;  1FNN A;  1PUF A;  1BR2 A;  4AUX A;  4NC6 A;  4ESJ A;  4A0Y A;  1HA8 A;  2HDW A;  3ABU A;  1XMX A;  3RKW A;  1P4A A;  3GFJ A;  3O3K A;  3U9G A;  4BEH B;  1WGX A;  4ZYD A;  2IGM A;  3KE2 A;  3S32 A;  3TO9 A;  3K4J A;  2FUG 2;  4M3B A;  4AM3 A;  2L2O A;  3TW7 A;  5EF6 A;  3L2R A;  2HYJ A;  1E3O C;  2KJB A;  3KP3 A;  5DM7 F;  1MGT A;  4NNJ A;  4WK8 F;  4P96 A;  3OSF A;  3SZT A;  1NH3 A;  3EDP A;  1H9G A;  2E1M B;  4ETS A;  2QQB A;  2WV0 A;  4MTD A;  2JA6 J;  2N8G A;  1QRY A;  4D5F A;  5H6Q A;  3KP5 A;  5HVQ C;  3A02 A;  2CQK A;  4RLF A;  1KYW A;  3HPH A;  1Z91 A;  2LP0 A;  2VN2 A;  3KEY A;  2V79 A;  5HS7 A;  2R7Z J;  1BOA A;  1I5Z A;  3TBI A;  1GT0 C;  3ABM H;  3EET A;  1UHM A;  2P6S A;  1IN4 A;  3I4N J;  2KIU A;  3K70 C;  1TLH B;  4NC7 A;  1SFX A;  3E6M A;  2PJR B;  4KUM A;  4N0B A;  1HLV A;  4XKW A;  2E35 A;  4UV9 A;  5KNL A;  1HKS A;  4HBL A;  4BBS J;  3CUQ C;  2EV6 A;  1Z67 A;  4G94 A;  2VBY A;  3QOE A;  2WV1 A;  3CCM I;  1V5F A;  2DFE A;  5FKO A;  3RYP A;  1UG2 A;  2EWN A;  1G59 A;  3LMM A;  1R71 A;  1J75 A;  2GIV A;  5C4J J;  5HDG A;  1FOY A;  2E5N A;  1W0U A;  1DUX C;  4FCY A;  2D1H A;  3BTC A;  1MBK A;  2DJN A;  1TT0 A;  4FQG A;  4YIR X;  5JR3 A;  3VYU B;  3HB9 A;  2M3A A;  2E71 A;  1LFB A;  2K40 A;  4IQJ A;  3QPS A;  3DPT A;  5LRS A;  4RM3 A;  5E1W A;  3BWG A;  4Q4Z F;  3T1B A;  5FJ8 J;  1BN5 A;  5DEQ A;  1LFU P;  3M1C A;  3T8T A;  1LPQ A;  2FML A;  3J81 Z;  4KIG A;  3CCR I;  3ABL H;  3MZY A;  2L02 A;  4G6Q A;  2W48 A;  3DEU A;  2DW4 A;  3PUF A;  4XIC A;  1O3S A;  2LF7 A;  4F3Q A;  3CDH A;  1B8I A;  3I53 A;  2HKX A;  4C3I J;  3RKX A;  2NS8 A;  2Y30 A;  3K69 A;  1ETO A;  3FXR A;  3OYE A;  3O8G A;  3SDB A;  1R1T A;  4UVB A;  3OOP A;  1QZY A;  3NAU A;  2HQN A;  1WZ2 A;  1U5T B;  4RGR A;  1ZRC A;  1G8X A;  4I2O A;  3K4M A;  5M5Y J;  4DJA A;  5A2Q Z;  1ZG1 A;  1UZC A;  1VI0 A;  2VLA A;  5J4Y A;  3DTI A;  3LA2 A;  2F5F A;  2DQR A;  3SZG A;  1B9M A;  1JKR C;  3U2R A;  3LL7 A;  2LVS A;  1V5G A;  1E3H A;  1IDY A;  2P5K A;  5DD8 A;  5FLM J;  1PVE A;  2QKM B;  5FLV A;  3FHN A;  2IGN A;  3T0Y A;  2FQ4 A;  3BLY A;  3E6D A;  5K5O A;  5GAE J;  4CHU A;  1KON A;  5EDN A;  3T8R A;  3I54 A;  2R5Y B;  4W1U A;  3V7S A;  4U7B A;  4A3D J;  2BV6 A;  4DIQ A;  4A5N A;  3Q9V A;  4LB6 B;  2DMP A;  2M8G X;  4IZZ A;  3IH3 A;  3DTE A;  2HQR A;  1S72 I;  3OYC A;  3FK6 A;  2GA2 A;  3SFZ A;  3A0H C;  2P8T A;  3CLQ A;  1P92 A;  4BEH A;  1YLF A;  1P6R A;  3GWZ A;  1TWF J;  3JRD A;  1SMY F;  2HDD A;  1E3P A;  1UB9 A;  4KMF A;  2BVM A;  2ZCW A;  3L2V A;  4I76 A;  1ZG3 A;  1OR7 C;  1SVO A;  2NRA C;  4J00 A;  1VQ4 I;  2L4A A;  3W2V A;  1BW5 A;  3PIO F;  3VB2 A;  3LSH A;  2A05 A;  2XKP A;  3ISP A;  4ZZL A;  5DUK A;  1MZB A;  3BZK A;  3CJQ B;  2GWR A;  3I9V 2;  2BXY A;  5CVU A;  4A3B J;  3DP7 A;  3BPX A;  2PMH A;  5LHG A;  1T56 A;  4JX6 A;  4HNV A;  3SQN A;  2RRE A;  3OWT A;  3G3Z A;  3LAP A;  4WCG A;  5DUI A;  4DOZ A;  5L3F A;  1CF7 B;  2R7X A;  3F6V A;  3MKW B;  4HX4 A;  5E3N A;  1TQI A;  3E6C C;  1MND A;  4ASN A;  1A5J A;  2EIN H;  2ZJ2 A;  3GO5 A;  2NVU B;  2R3S A;  3HZJ A;  3R0J A;  2PJR A;  1I27 A;  2YU9 J;  1Q1V A;  5AIP A;  1J5Y A;  3DWL E;  1B1B A;  2M8E A;  1QA6 A;  3PNV A;  1RNL A;  2RQP A;  3H5N A;  3Q0W A;  1VQL I;  4HF1 A;  4PSX A;  5L3G A;  4ZYH A;  4B8X A;  4I6Z A;  4LGW A;  3I4P A;  3DKY A;  4M9X A;  3Q0V A;  4GCV A;  4DYQ A;  1H8A C;  1YO5 C;  2FNP A;  2O8X A;  1YI2 I;  2EV0 A;  3SHF A;  1IXR C;  2IAI A;  4EJU A;  1P4W A;  5FKK A;  4PZJ A;  1F1Z A;  2FX0 A;  2MLK A;  3D5S C;  3M3Y J;  1WJ5 A;  3JR9 A;  3JSP A;  4MQV A;  1CGP A;  3OYJ A;  2LOO A;  3ZMU A;  3GTP J;  2JVH A;  2A61 A;  3ASN H;  4C30 A;  5FRO A;  2PG4 A;  2DBB A;  2F6C A;  5F0F A;  4IHS A;  3TL4 X;  2DYR H;  1IC8 A;  3BG5 A;  1T0F A;  4V2F A;  2UV1 A;  2VJI A;  3B6C A;  1YJ9 I;  2JK3 A;  3WTW C;  2DMQ A;  4WXC A;  3UNG C;  1LFP A;  1W5T A;  1X58 A;  1QZE A;  3FIS A;  2MFZ A;  2R7V A;  3CUO A;  1X19 A;  4MFD A;  4R1H A;  1YX3 A;  3ZQC A;  1LJ9 A;  5CLS A;  2ZJP F;  3KPH A;  3ERM A;  3PSF A;  1GXP A;  2BEO A;  1POG A;  4TV7 A;  1U5T A;  2PEX A;  2LBF B;  5BS6 A;  4HST A;  4EM1 A;  3WU0 A;  1TQM A;  5CVJ A;  1VQ9 I;  3TOA A;  4LD5 A;  2JA2 A;  2F4I A;  5J1Y A;  3G1M A;  5KAI C;  4E7H A;  4ZDP A;  4IEJ A;  2E1N A;  1BIA A;  3DU5 A;  1VQP I;  3IRR A;  4ESF A;  1Z6T A;  1LUJ B;  5FD6 A;  2STT A;  2OCE A;  4A12 A;  2Y48 A;  4A3L J;  3M9A A;  1KU7 A;  2E19 A;  1IUY A;  5DTD A;  2ISZ A;  1IRZ A;  2QQA A;  2ID6 A;  3RPU A;  3H3U A;  2ZXI A;  3BG9 A;  4EJO A;  2L7M P;  5DCM A;  1EH8 A;  5F1R A;  3NAR A;  3HG9 A;  1BJA A;  5GTH C;  2PN6 A;  2JTV A;  1AWC A;  2IVM A;  2KIM A;  1Z0X A;  2VUM J;  4KN4 X;  4JBA A;  2R0Q C;  2QQ9 A;  4M71 A;  4EM2 A;  3I71 A;  2DT7 B;  1IXC A;  2H8R A;  4ZH4 F;  1TW3 A;  3KET A;  2CS3 A;  3BT9 A; 
#chains in the Genus database with same CATH homology
 4EQQ A;  2M45 A;  3RKY A;  4Y17 A;  4YFN F;  2IPQ X;  1EH7 A;  1FWZ A;  1IRF A;  3W6J B;  3DFG A;  1CF7 A;  3EUH A;  1IN7 A;  2TDX A;  4IRG A;  2Z9O A;  2OA4 A;  2OQG A;  1SFU A;  4LLN A;  2OAZ A;  4EMS A;  1K79 A;  2ELH A;  3RJP A;  1QZZ A;  2A69 F;  3JSO A;  1Z9C A;  1W7P B;  3HIF A;  2OBP A;  5ICE A;  3KZY A;  1V4R A;  4DQ2 A;  3PFI A;  1R5G A;  1ZGA A;  1KQ8 A;  2H6B A;  4WX9 A;  2HDC A;  3V4G A;  3CUQ B;  2STW A;  1USS A;  4IRH A;  2L4M A;  4NB5 A;  2XV4 S;  4FT8 A;  4I02 A;  4RS8 A;  1XSX A;  3NEU A;  2VT3 A;  2NNY A;  4F7Z A;  1SFE A;  1S3J A;  3VOD A;  4LG0 B;  4BXU A;  3J7A O;  2RV8 A;  3GUD A;  4QWQ A;  1PP7 U;  4EGY A;  2D1V A;  1U6G A;  4I01 A;  2P6T A;  3IKV A;  2K27 A;  5DCF A;  3QAH A;  3D0S A;  1O3T A;  2Q0O A;  5BPI A;  3HOS A;  3ZMT A;  1KA8 A;  3D5L A;  2KIF A;  1IN5 A;  4UUV A;  3MQ0 A;  3J80 Z;  4OIO F;  2MH2 A;  3HHG A;  2EA2 A;  1FC3 A;  5K5R A;  1JHF A;  2MH9 A;  4MEX F;  4HQM A;  4ENN A;  3ZN0 A;  2YSR A;  1IN8 A;  4OMY A;  4L5J A;  3DXJ F;  4MEY F;  3H92 A;  2ZKZ A;  2A6E F;  5FLX Z;  1O3Q A;  3WTU C;  3E6B A;  2IRF G;  3TO7 A;  3VEP A;  4HA8 A;  1BIB A;  4IHT A;  4BAY A;  2IT0 A;  4KIB A;  4G6D A;  3V8K A;  2NAZ A;  2PBI A;  3QP6 A;  4XLP F;  1XGN A;  1SMT A;  3WE3 A;  1W4M A;  1EH6 A;  3KP6 A;  2HTS A;  1T6S A;  4LB5 A;  4MQ9 F;  1MJA A;  5H20 A;  1R1U A;  2ESN A;  2WWY A;  2YX4 A;  4CZZ A;  3HRT A;  2P7C B;  1FBQ A;  2FA5 A;  3HTU A;  4A5M A;  1W7P A;  1J2X A;  3JW4 A;  1OKR A;  4LK0 F;  4AIK A;  2RGV A;  2PQ8 A;  1Z6R A;  1BI2 A;  1YG2 A;  1T38 A;  4B09 A;  3CUQ A;  5LEJ A;  1XSV A;  3RIR A;  2QM3 A;  1KYZ A;  4OIN F;  4RB3 C;  4OIR F;  4A6E A;  4IJA A;  3EQL F;  2XAQ A;  3JTH A;  3BJ6 A;  5D8L B;  5IT9 Z;  1FP1 D;  4L9V A;  3ZMS A;  1WRJ A;  2VC0 A;  5ERI A;  1JGS A;  1QBJ A;  2W57 A;  2LSO A;  4LG0 A;  2EA4 A;  2QWW A;  4O6J A;  5TJJ A;  1Z7U A;  2J5O A;  3E97 A;  3N4M A;  3KEO A;  3WG9 A;  4AIH A;  2X0L A;  1ZRE A;  1LDD A;  3QPH A;  2DQL A;  3R0A A;  2HYF A;  3QPT A;  3R4K A;  2FF4 A;  1WQ2 A;  2O61 A;  5LHI A;  1KU9 A;  1H9T A;  3VFZ A;  4CO8 A;  2V1D A;  1G6N A;  3B02 A;  2EK5 A;  4HX7 A;  2HS5 A;  2GQQ A;  2OZU A;  2M30 A;  1DPR A;  2XRO A;  4PCQ A;  3WOD F;  3RI4 A;  2JZY A;  4AIJ A;  4CDG A;  1MDM B;  4O3M A;  5H6R A;  4HV5 A;  1R7J A;  1YQA A;  4YIF A;  3V8L A;  1S8N A;  3BOQ A;  2HKO A;  1XGS A;  1IW7 F;  4U0V A;  6PAX A;  2W85 A;  2A68 F;  2XUB A;  4KMU X;  1HSJ A;  3SZP A;  1OR7 A;  1BC7 C;  5K5Q A;  2DFI A;  2L01 A;  1QQI A;  2CWE A;  5L3C A;  3DQV C;  4HLY A;  3PQK A;  2H09 A;  4I0B A;  3CLO A;  3DV8 A;  3GZ5 A;  2DK5 A;  1YW9 A;  1LQ1 A;  1O7L A;  5TRD A;  1U8R A;  3WTZ A;  4P5O A;  2EFP A;  1XGO A;  1QO0 D;  3ERE D;  1D8K A;  4H0E A;  3BY6 A;  4L9N A;  2ADU A;  1SAX A;  3WTX C;  4G9Y A;  4BYY A;  2DK8 A;  2VBX A;  1TBX A;  4Z2Y A;  3EYY A;  3ULQ B;  2V9V A;  3M8E A;  4RB2 C;  5ICF A;  1FP2 A;  3ZPL A;  4L18 B;  3L2C A;  2FXA A;  3IWF A;  5EEG A;  2RKH A;  4RGX A;  4S05 A;  3KZZ A;  3E5X A;  1ZRD A;  3NRV A;  4UXN A;  4HDV A;  3F23 A;  1ODD A;  3J80 K;  3ZQ7 A;  2PLY A;  3LQR A;  4OU0 A;  2O03 A;  2Y0M A;  3GX4 X;  1BBY A;  1K78 B;  1HXD A;  2EJR A;  1HKQ A;  4U7D A;  3E5U A;  5FFX A;  5CVV A;  3L00 A;  5ICC A;  5E18 F;  4FX4 A;  3W6K B;  5D8K B;  4KDP A;  4YFK F;  1B59 A;  1PUE E;  2EFQ A;  5E1X A;  1ZRF A;  3COA C;  2RC4 A;  3L9F A;  3FM3 A;  1L3L A;  3HOT A;  1IZ1 A;  2UWM A;  3HTS B;  4OIQ F;  5LLQ A;  4I7H A;  4EJV A;  1XN7 A;  4R79 A;  2FSW A;  2CGP A;  3KEQ A;  5ILV A;  2RN7 A;  3FMR A;  1JHH A;  3KP4 A;  2VE9 A;  1HST A;  2B0L A;  2HFH A;  3REO A;  3BRO A;  2FOK A;  1ZAO A;  2M1B A;  4ENK A;  3R61 A;  4GYI A;  5ILS A;  1RIO H;  3VOE A;  5JVT A;  1AOY A;  1S7O A;  2K02 A;  1D3Y A;  2QBY B;  2EB7 A;  1XMK A;  4KIF A;  1OYI A;  1R22 A;  3I58 A;  3O2P E;  1WKM A;  2GA1 A;  3K0L A;  1LEB A;  2X4H A;  1QPM A;  4GO1 A;  4AVP A;  2AXL A;  3QU3 A;  4EM0 B;  3I59 B;  4IVN A;  3FM5 A;  3LAJ A;  3ZP5 A;  3BPV A;  3MCZ A;  1PDN C;  2LDU A;  4AD9 A;  2QVO A;  2BE5 F;  4HF0 A;  1KQ0 A;  1UHW A;  2JSC A;  2D45 A;  5FD5 A;  1XB4 A;  1HBX G;  2NYX A;  2F5C A;  2F5D A;  2CG4 A;  3GEZ A;  1Z1D A;  2W84 A;  1T39 A;  2E7X A;  1J59 A;  1DDN A;  3F3X A;  1H0M A;  4KNY A;  1K78 A;  3ZMZ A;  2PJP A;  2VBW A;  2YR2 A;  5D6E A;  1YIO A;  3P9I A;  1ZN2 A;  3F21 A;  3C18 A;  2MA3 A;  3N97 A;  2ETH A;  3QOP A;  1K7A A;  5JI6 A;  2FE3 A;  1ZAR A;  1R00 A;  5HOO A;  2CO5 A;  2COM A;  1FLI A;  2FBH A;  3K9T A;  3LA7 A;  1R5H A;  4IXA A;  1I1G A;  4U0W A;  3ABT A;  5ICG A;  5J6X A;  3CJN A;  2EV5 A;  2P7V B;  2FQ3 A;  4I98 B;  2R7F A;  2D2W A;  4BHP A;  1YYV A;  3FXU A;  4IF4 A;  4MNU A;  3ECH A;  4P9F A;  3J81 K;  1U78 A;  2FMY A;  1MKM A;  1LDJ A;  1KU3 A;  4M72 A;  2JPB A;  2ACJ A;  4HV6 A;  1PP8 F;  1FPQ A;  5BMZ A;  2V1U A;  2QBY A;  4KFC A;  1E2X A;  4LLL A;  1FYL A;  3FX3 A;  2RVC A;  4M9S A;  5D4R A;  4GXO A;  3BZ6 A;  5JHU A;  5A2Q K;  4FX0 A;  2AS5 F;  3HSF A;  1YS7 A;  2Z5U A;  2IA0 A;  3IRQ A;  4A0X A;  3HRU A;  3P9K A;  1IRG A;  2QUF A;  1IF1 A;  4L9J A;  4N9I A;  2HGC A;  4UNO A;  3I59 A;  2FNA A;  2HYG D;  1XCV A;  3RYR A;  1MJ9 A;  1VTN C;  4YII A;  1FOK A;  2DI3 A;  5BPD A;  4HAM A;  4N9H A;  4ZYG A;  1LVA A;  4GGG A;  3ZN1 A;  4A6D A;  1XGM A;  1ZLJ A;  2VBZ A;  1I1S A;  2Q2E A;  1SD5 A;  2FU4 A;  1ZLK A;  2ESH A;  2A6H F;  5AON A;  1B4A A;  4UHT A;  3F8C A;  1RI7 A;  3S2W A;  3Q5F A;  1D5V A;  1TQP A;  2HWV A;  4BQA A;  3ELK A;  2G9W A;  3L7W A;  3FF5 A;  3BJO A;  1XCB A;  1RUO A;  2ZME B;  2Y75 A;  3QP5 A;  4IRI A;  3IKT A;  3MFK A;  4M6X A;  3CO6 C;  4U88 A;  2L3D A;  1X3U A;  1QNT A;  3DPL C;  5L3E A;  5HLH A;  1JXS A;  3MZH A;  5DD4 A;  4LK1 F;  1UST A;  2F2E A;  3JAM Z;  4G7O F;  3BP8 A;  5AIQ A;  2W25 A;  4D0P A;  1BC8 C;  3IC7 A;  3WTS C;  1BM9 A;  5F64 A;  5DV5 A;  4RB0 A;  3GZ6 A;  1STZ A;  2DPD A;  4WXD A;  1HW2 A;  1DP7 P;  3SXY A;  4R8H A;  4I09 A;  2QLZ A;  4G8X A;  1J7K A;  4FHT A;  4G7Z F;  1GHC A;  4A2U A;  3E3V A;  3LST A;  2A3S A;  3CO7 C;  3GVA A;  2OD5 A;  4MHG A;  1G4D A;  2WC2 A;  2Z3Y A;  2IP2 A;  2KKO A;  1FSE A;  1W7P D;  4PGG A;  1P4X A;  3TGN A;  2IW5 A;  2DLL A;  1KQ9 A;  1I6X A;  3BDD A;  3RPQ A;  3KCC A;  3M8F A;  1WI9 A;  4LMY A;  1FBU A;  2WTE A;  5E8G A;  2OU2 A;  1YTY A;  5FB2 A;  3FMQ A;  4PGH A;  4KYW A;  2XHK A;  1EV7 A;  1QGP A;  4KT5 C;  2EFW A;  1G3T A;  3AAF A;  4BHB A;  2RNJ A;  4DNC A;  4O5V A;  2YPR A;  5D5W B;  2R7D A;  2RDP A;  5HDK A;  4L5I A;  3ROU A;  3GFI A;  2H6C A;  2L54 A;  2UXX A;  4IPA A;  3ML6 A;  2ZME A;  3KLN A;  3IHU A;  4Q5S F;  1ZG5 A;  2A5Y B;  2PI0 A;  3WTY C;  4HZF A;  2A07 F;  2ZNY A;  5IT3 A;  2EFN A;  2BYV E;  3CTA A;  3FZV A;  2Z99 A;  3NQO A;  1ON1 A;  2YX7 A;  1A04 A;  1R58 A;  2E7W A;  1R23 A;  2CSO A;  2IA2 A;  2C6Y A;  5FGM A;  3F8N A;  3M1E A;  1XMA A;  4ESB A;  4NHJ A;  1F4K A;  2J5P A;  2HTJ A;  2XRN A;  1OYY A;  3FXQ A;  2HOE A;  2OQR A;  4L9T A;  4EGZ A;  3R6S A;  4XBF A;  4WWC A;  1JE8 A;  2K4B A;  3K1N A;  3KP2 A;  1XSD A;  2DT5 A;  4UVC A;  5BQT A;  4CGZ A;  3H3Z A;  3FWE A;  2UXN A;  1FZP B;  5CVI A;  4HLX A;  1Q1H A;  1OYW A;  1HQC A;  2V1X A;  3M7G A;  3GYH X;  2HZT A;  3GXO A;  2NS0 A;  3IL2 A;  4LLG F;  4P9U A;  4RGS A;  2ISY A;  3IWZ A;  4PDK A;  4L0Y B;  2O3F A;  5LHH A;  3GFL A;  1Y0U A;  4HF2 A;  5EEH A;  1BI0 A;  1UCR A;  1ON2 A;  5FLX K;  3TDZ C;  5E8I A;  1SD6 A;  4KIC A;  1KGS A;  4XSZ F;  1TNS A;  2M87 A;  2JPC A;  1ZYR F;  1S29 A;  4RB1 A;  2BGC A;  4U0Y A;  2CW0 F;  1MDM A;  1BI3 A;  5DCM B;  1S7A A;  5LGT A;  1WWX A;  4ENM A;  2H94 A;  3QRF F;  1YW7 A;  4HYE A;  2ZO4 A;  2HEO A;  3JAM K;  1O7F A;  4LJZ F;  2JRT A;  1HW1 A;  3OV8 A;  5D5X B;  3JTG A;  4UV8 A;  2W24 A;  1B6A A;  3B73 A;  2XVC A;  5ED4 A;  4Q48 A;  1LNW A;  2K4J A;  1MJB A;  2G7U A;  1XD7 A;  2ZBK A;  3F8F A;  5LGN A;  3C3W A;  1BI1 A;  3HRS A;  4M9Z A;  2K86 A;  5FO5 A;  3F72 A;  1FX7 A;  2H27 A;  5IT9 K;  4P55 A;  5L3D A;  3U1D A;  2MBF A;  3GF2 A;  1TNT A;  4Q47 A;  2MLG A;  2O6G E;  1WSU A;  2NNN A;  5CJ9 A;  1FBS A;  2VC1 A;  4MGR A;  1R1V A;  1Z05 A;  3GFM A;  3KP7 A;  1F5T A;  5F6F A;  3WGG A;  5D4S A;  1IXS B;  1O57 A;  1G3S A;  5E20 A;  1IAW A;  1MD0 A;  3FHZ A;  4HX8 A;  3L09 A;  2LKP A;  2UZK A;  5FFZ A;  4KA4 A;  3P7N A;  3K1M A;  3TDU C;  4Y13 A;  3KFW X;  1L0O C;  2XAG A;  5DDG A;  3ZMD A;  1FYM A;  5HLI A;  1D8J A;  3HSE A;  2DAO A;  3TO6 A;  4GYG A;  1FYK A;  3F8B A;  5CVR A;  5HS8 A;  2K7L A;  5LEK A;  1IN6 A;  4MTE A;  4OOI A;  3ZMV A;  2DPU A;  3G73 A;  4ZYE A;  3LWF A;  4JQF A;  5JFR A;  4CYD A;  1XDS A;  2VXZ A;  5ILU A;  3C7J A;  2HR3 A;  4BNC A;  2FBK A;  3HHH A;  4EJT A;  4M74 A;  4Y15 A;  1UFM A;  2Z33 A;  3T5X A;  2P4W A;  2VON A;  4ON0 A;  4RAZ A;  5L3B A;  1J0R A;  2VOP A;  4UVA A;  3MAJ A;  3WGH A;  3RDI A;  1REP C;  1G3Y A;  1K6O A;  2OZ6 A;  4QLC U;  4HOB A;  5D5U B;  4S04 A;  2XIG A;  2XAS A;  2FEZ A;  3TOB A;  3Q9S A;  2XAJ A;  5E17 F;  4M73 A;  1LB2 A;  4XSX F;  1U2W A;  2P5V A;  1P2F A;  2KRF A;  3HYI A;  1KU2 A;  5LRR A;  2ZNZ A;  2PMU A;  1ZHF A;  2DU9 A;  4XLN F;  1TW2 A;  2LNB A;  4EJW A;  3I0T A;  3RTR A;  2GZW A;  5DYM A;  5CYV A;  3V7C A;  3WTV C;  1B9N A;  1YW8 A;  1V3F A;  3V7R A;  2FRH A;  4KN7 X;  4EV0 A;  3TQN A;  1LEA A;  2O0Y A;  4XRF A;  1FSH A;  2JT1 A;  1T98 A;  2IJL A;  1U5T C;  5J8F A;  2E1C A;  2LF8 A;  2DTR A;  5LGU A;  1W5S A;  1SD4 A;  4ENJ A;  2GXB A;  1OPC A;  1NHA A;  1LDK B;  3K2Z A;  3E5Q A;  3WU1 B;  5D5V B;  4A0Z A;  3MWM A;  2QEN A;  2XGX A;  3F6O A;  2VOD A;  2GAU A;  2F5E A;  4CXF A;  2VOO A;  2XKO A;  5HS9 A;  3GW2 A;  3LFK A;  2G7H A;  5E1Z B;  4AWX B;  1TTY A;  5LBQ A;  3P9C A;  4WF2 A;  3I5U A;  2ZXJ A;  4HDU A;  2CFX A;  1F9N A;  3V8J A;  5KVR A;  2P5L C;  5D6F A;  1RUN A;  1SD7 A;  2PFB A;  4YFX F;  4L0Z B;  4CIC A;  3I64 A;  3WGI A;  1S6L A;  1FT9 A;  3GLX A;  4BHC A;  3DKW A;  1GXQ A;  3PQJ A;  2YU3 A;  4HQE A;  4OMZ A;  1FY7 A;  4RGU A;  5KK1 A;  1OMI A;  2MC3 A;  2BBY A;  3ECO A;  5BOX A;  3FMS A;  2DO7 A;  4JK1 X;  2M5W A;  1U3E M;  5HLG A;  4HW0 A;  1O3R A;  2GXG A;  3QU6 A;  1XDU A;  2CYY A;  1YS6 A;  3C1D A;  3EYI A;  2QZ8 A;  4K2E A;  2VE8 A;  2EFO A;  2QYO A;  1RZ4 A;  3HSR A;  1ONV A;  3KLO A;  1DPU A;  1G3W A;  1T2K A;  2FBI A;  1ZH5 A;  3TKY A;  3MEX A;  3LA3 A;  4WXH A;  4G7H F;  3DF8 A;  3F22 A;  4OIP F;  1C0W A;  5K1Y A;  4YG2 F;  1ZGJ A;  3HUG A;  2XAH A;  4LFU A;  1GVJ A;  3BJA A;  1R36 A;  4M6Y A;  4RAY A;  3LQQ A;  3WTT C;  5J8C A;  2KJC A;  4I0A A;  1YFH A;  3R60 A;  2Q8K A;  1HW5 A;  4E70 A;  5HDN A;  1ULY A;  4BH9 A;  3HRM A;  4ZZD A;  2IA1 A;  3WE2 A;  1HKT A;  2MD5 A;  2ZFW A;  4NQW A;  3F8M A;  3O6B B;  2VT2 A;  1J9I A;  2V6C A;  3K1P A;  2XAF A;  1E17 A;  4EVI A;  1FNN A;  4ESJ A;  4A0Y A;  3ABU A;  3RKW A;  1P4A A;  3GFJ A;  3O3K A;  3U9G A;  4ZYD A;  3KE2 A;  3TO9 A;  2KJB A;  3KP3 A;  1MGT A;  4WK8 F;  4P96 A;  3SZT A;  3EDP A;  1H9G A;  4ETS A;  2QQB A;  2WV0 A;  4MTD A;  5H6Q A;  3KP5 A;  5HVQ C;  2CQK A;  1KYW A;  1Z91 A;  2VN2 A;  2V79 A;  5HS7 A;  1BOA A;  1I5Z A;  3EET A;  1UHM A;  2P6S A;  1IN4 A;  2KIU A;  1TLH B;  1SFX A;  3E6M A;  4KUM A;  4N0B A;  4UV9 A;  1HKS A;  4HBL A;  3CUQ C;  2EV6 A;  4G94 A;  2VBY A;  3RYP A;  2EWN A;  1J75 A;  2GIV A;  5HDG A;  1DUX C;  2D1H A;  5JR3 A;  3DPT A;  5LRS A;  5E1W A;  3BWG A;  4Q4Z F;  3T1B A;  1BN5 A;  5DEQ A;  3T8T A;  2FML A;  3J81 Z;  4KIG A;  3MZY A;  2L02 A;  4G6Q A;  3DEU A;  2DW4 A;  1O3S A;  2LF7 A;  3CDH A;  3I53 A;  2HKX A;  3RKX A;  3K69 A;  3FXR A;  1R1T A;  4UVB A;  3OOP A;  1QZY A;  2HQN A;  1U5T B;  4RGR A;  1ZRC A;  4I2O A;  5A2Q Z;  1ZG1 A;  3LA2 A;  2F5F A;  2DQR A;  1B9M A;  3U2R A;  2P5K A;  5DD8 A;  3T0Y A;  3E6D A;  4CHU A;  5K5O A;  3T8R A;  3I54 A;  4U7B A;  3V7S A;  2BV6 A;  4A5N A;  3Q9V A;  4LB6 B;  2HQR A;  2GA2 A;  3SFZ A;  2P8T A;  1P92 A;  1YLF A;  1P6R A;  3GWZ A;  1SMY F;  1UB9 A;  4KMF A;  2ZCW A;  1ZG3 A;  2NRA C;  2L4A A;  3VB2 A;  2XKP A;  3ISP A;  4ZZL A;  5DUK A;  1MZB A;  2GWR A;  5CVU A;  3DP7 A;  3BPX A;  2PMH A;  5LHG A;  3SQN A;  3G3Z A;  3LAP A;  4WCG A;  5DUI A;  5L3F A;  1CF7 B;  3F6V A;  4HX4 A;  1TQI A;  3E6C C;  4ASN A;  3GO5 A;  2ZJ2 A;  2R3S A;  3R0J A;  1I27 A;  5AIP A;  1J5Y A;  1B1B A;  2M8E A;  1RNL A;  2RQP A;  4HF1 A;  5L3G A;  4ZYH A;  4B8X A;  4LGW A;  3I4P A;  4M9X A;  4GCV A;  1YO5 C;  2FNP A;  2O8X A;  2EV0 A;  3SHF A;  1IXR C;  4EJU A;  1P4W A;  4PZJ A;  1F1Z A;  2MLK A;  3JSP A;  4MQV A;  1CGP A;  3ZMU A;  2A61 A;  2PG4 A;  2DBB A;  4IHS A;  1T0F A;  3WTW C;  4WXC A;  1W5T A;  3CUO A;  4R1H A;  1LJ9 A;  5CLS A;  1GXP A;  2BEO A;  4TV7 A;  1U5T A;  2PEX A;  5BS6 A;  4EM1 A;  3WU0 A;  1TQM A;  5CVJ A;  3TOA A;  4LD5 A;  2E1N A;  1BIA A;  3IRR A;  4ESF A;  1Z6T A;  5FD6 A;  2STT A;  4A12 A;  2Y48 A;  3M9A A;  1KU7 A;  1IUY A;  2ISZ A;  2QQA A;  3RPU A;  3H3U A;  4EJO A;  5DCM A;  1EH8 A;  5F1R A;  1BJA A;  2PN6 A;  2JTV A;  1AWC A;  2IVM A;  2KIM A;  4KN4 X;  4JBA A;  2QQ9 A;  4M71 A;  4EM2 A;  3I71 A;  1IXC A;  4ZH4 F;  1TW3 A;  3KET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...