1U2WA

Crystal structure of the staphylococcus aureus pi258 cadc
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
109
structure length
105
Chain Sequence
GYDEEKVNRIQGDLQTVDISGVSQILKAIADENRAKITYALCQDEELCVCDIANILGVTIANASHHLRTLYKQGVVNFRLALYSLGDEHIRQIMMIALAHKKEVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Cadmium efflux system accessory protein
publication title Crystal structure of the Staphylococcus aureus pI258 CadC Cd(II)/Pb(II)/Zn(II)-responsive repressor
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 35
structure length 105
sequence length 109
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1u2wA00
2JSCA 4WWCA 4HF1A 1P4XA 4IJAA 4P9UA 2ESNA 1QO0D 1MDMA 3HSFA 5CVRA 4RAZA 1IUYA 1HKQA 4U88A 1CGPA 5CVIA 3FHZA 3TO6A 1FT9A 3LA2A 2ACJA 2D2WA 2GZWA 2MC3A 5D5UB 2JPBA 3VOEA 2CYYA 1W5SA 3Q9SA 3VFZA 4UUVA 3SFZA 3BJOA 2YSRA 5CLSA 1IXSB 2YR2A 2P6SA 2IJLA 3IKTA 1FBSA 2BV6A 3KP4A 2CSOA 2DQLA 2QBYA 2Z99A 2RV8A 1PP8F 3L09A 2VE9A 3I59B 4RGXA 4KYWA 2RQPA 2M5WA 4QWQA 5JR3A 4L0ZB 4I01A 5F6FA 4AD9A 1I1GA 1GHCA 2HKOA 1FX7A 2KJBA 4B8XA 2QENA 3HRSA 2QVOA 3ZP5A 4EJUA 4LFUA 1IN7A 3REOA 3W6KB 4XBFA 2OA4A 5E18F 5DD8A 5ILSA 2QQ9A 3ZPLA 1BIAA 1YG2A 2HR3A 1REPC 5D8KB 3V8KA 2ZMEB 4CGZA 2KKOA 1E2XA 2NNYA 2M87A 3E6BA 1G3WA 1LJ9A 4GCVA 5D4SA 2LNBA 4LJZF 1YS6A 3DXJF 2V1XA 3HOTA 3R0JA 3GFJA 4YFNF 3C18A 3K1MA 2EA4A 3L7WA 2PQ8A 2CFXA 1R5GA 1Z1DA 3TDUC 2O6GE 4XLNF 1IW7F 4LLGF 1U8RA 3LFKA 3DKWA 4LD5A 3E97A 3ML6A 2XVCA 1XB4A 3FM5A 4M6YA 3QU3A 5DUIA 4G6QA 1YTYA 1JHHA 1FWZA 3WTXC 4KA4A 3OV8A 2A6EF 3GYHX 1WI9A 1TLHB 1W7PB 5FD6A 4U0WA 5DD4A 2W25A 1KU3A 2DLLA 1OR7A 1SD6A 4EM2A 5LGTA 4G7OF 2YPRA 3LWFA 3WTZA 2MH9A 1Y0UA 1XMKA 2RN7A 1LVAA 2DBBA 4I02A 4O5VA 5H6RA 4CHUA 1G4DA 2L4AA 1FSEA 1I5ZA 5AIPA 4IF4A 1HKSA 1YO5C 3WU1B 3I59A 2FNPA 4AIKA 1D8KA 3RYPA 3PQKA 1MJ9A 4Q4ZF 5HOOA 4PGGA 3EQLF 5D6EA 1SFUA 3F6OA 3V8JA 3P7NA 3MZHA 1FP1D 2XAHA 3COAC 1K79A 2XKOA 3VODA 3HRTA 3O3KA 3R4KA 4MQVA 1B1BA 4UXNA 3LAJA 3ZMDA 2E1NA 2CQKA 3ABTA 3E6CC 1RIOH 1UCRA 1R36A 1MGTA 2BBYA 3U9GA 2ZMEA 4G94A 1USTA 5FLXZ 5HDGA 3JW4A 1BC7C 2P5LC 1FOKA 2ELHA 3T5XA 1FP2A 2FMYA 4P96A 4OMZA 3U2RA 5IT3A 2YX7A 2K4BA 5HDNA 5CVUA 2O8XA 4ZH4F 1XSDA 2D1HA 3J80Z 1QGPA 2ZCWA 2BEOA 4RGSA 3KEQA 4HAMA 4ENNA 3I58A 2IP2A 4L5IA 1BBYA 3N4MA 1PDNC 3BOQA 4UV8A 4ETSA 3D5LA 3W6JB 2V1DA 2P8TA 3F8NA 3F3XA 2XAFA 2W57A 4I0AA 2IA2A 4PDKA 3E6MA 3LA7A 4I7HA 4MEYF 1XMAA 5LHHA 4I2OA 4L18B 3ZQ7A 2XHKA 2COMA 1EH7A 5FGMA 3GFLA 2L01A 1ZAOA 4HDVA 3BPVA 3FWEA 3ZMUA 1H0MA 2CGPA 2OZ6A 5IT9K 2K4JA 1J59A 3FF5A 1O3QA 3QP5A 3RYRA 1KQ0A 3P9CA 4KUMA 2EFPA 4L9VA 2PG4A 2QZ8A 1O3TA 3I4PA 2KJCA 4YG2F 3K1PA 1ZLKA 1IZ1A 2J5PA 4RGRA 1ZGJA 2JTVA 4A6EA 1P4WA 1FSHA 2X4HA 4E70A 3IKVA 4HX4A 3RIRA 5ICFA 2VBWA 4PCQA 3KP7A 2BE5F 2ZNYA 4IHSA 5FFXA 4KNYA 5JVTA 3WODF 4HZFA 5BMZA 1FBUA 1BOAA 2P4WA 3BDDA 1IN5A 3IRQA 1J5YA 2P7CB 1U6GA 4A12A 1FY7A 3IC7A 3J81K 3M7GA 4ESJA 1P4AA 3WE2A 4CO8A 4LMYA 1ZRCA 2FRHA 2KIMA 2GXBA 4U7DA 3CJNA 4GXOA 3CO6C 4Y15A 2HS5A 3F72A 2B0LA 2IA1A 4Y13A 3H3ZA 1F5TA 2A07F 1YS7A 1W4MA 3K9TA 5L3GA 1Z6RA 2EV0A 3V4GA 1GXPA 2ZKZA 4CYDA 3GUDA 3ABUA 1P6RA 4Q48A 1KYZA 4HV5A 3KE2A 3SHFA 4GGGA 4ENMA 5LEJA 5D6FA 1Q1HA 4U0VA 4UV9A 2A68F 4KT5C 2DU9A 3HHGA 2RDPA 3KETA 3EETA 2YU3A 4UVCA 5KVRA 3RTRA 1U78A 3JAMK 2EFNA 3QPTA 3R61A 1U5TB 3M8FA 1O3RA 2OU2A 1T38A 1XCVA 4NHJA 5LEKA 3BWGA 1IN6A 1TW3A 5K1YA 3I53A 5A2QZ 4WX9A 2FQ3A 4FX4A 2F2EA 3LAPA 4ZYEA 1JHFA 1BI0A 3ELKA 1BC8C 1G3SA 2XAJA 5FFZA 1F4KA 2KIUA 3F8FA 3I0TA 4ASNA 2EK5A 3MZYA 1ZRDA 5D8LB 4EQQA 5ED4A 2DQRA 1IN4A 2Q0OA 1LNWA 4P9FA 1HW5A 4S05A 1YFHA 1J0RA 1SD7A 4M9ZA 2UXNA 3RKXA 3TO9A 2VN2A 1Z91A 2LF7A 2H27A 3KP3A 3P9KA 4WK8F 1YLFA 5E17F 3BZ6A 4O6JA 3MWMA 3Q5FA 3DQVC 1H9TA 3K69A 4ZYHA 4EJTA 4WCGA 1ZLJA 3FMQA 2J5OA 1FC3A 1LDDA 1FYKA 4IHTA 2RGVA 3B73A 4S04A 5JHUA 5ERIA 3ZN0A 2CW0F 2KIFA 1LQ1A 1UB9A 1OYWA 1SFXA 2DPUA 1B9NA 4I98B 4PGHA 2VT3A 2VOOA 2WC2A 2Z5UA 1OYIA 3CUQC 1VTNC 4UVAA 2NRAC 3U1DA 1OPCA 4RB2C 3ZMZA 3WTVC 3WGGA 4GO1A 5L3DA 3I71A 3OOPA 3CUQB 2M30A 2ZO4A 1JGSA 4BAYA 2VC0A 5CYVA 5HS7A 5DCMB 5L3FA 3C7JA 3JTHA 3PFIA 1DPUA 1OYYA 1UHWA 1RZ4A 1O57A 3HIFA 2MD5A 2FU4A 4HW0A 3WU0A 4LB5A 2FBKA 2ZNZA 2O61A 4R1HA 4LG0B 3ZMSA 1R1VA 1PUEE 2EB7A 2NS0A 3I54A 5ICCA 1DUXC 5KK1A 1R1UA 1WQ2A 2LKPA 1J9IA 2O3FA 3GF2A 1J7KA 4FX0A 5D5VB 2E7WA 2HTSA 3RKYA 5J8FA 2UWMA 1RI7A 2HFHA 2YX4A 3WG9A 5E1ZB 1UHMA 5DCFA 4M74A 2VT2A 2R3SA 5AONA 1HW2A 2OQRA 4LGWA 4DQ2A 4ENJA 1JE8A 4I0BA 4M9SA 4UNOA 2ESHA 4KMFA 3IL2A 4HOBA 1D5VA 3BJAA 3GLXA 1T0FA 2Y48A 5D5XB 4A0YA 1S29A 3CUOA 1ZN2A 3KP2A 4UHTA 2FNAA 3FMRA 1IRFA 3DF8A 4BHPA 3DP7A 4WXCA 1GXQA 3E6DA 2W84A 1DDNA 3M1EA 3IWZA 2LDUA 2NAZA 3C3WA 4HQEA 1T2KA 1QQIA 3BP8A 5E1XA 3TO7A 3CUQA 1IF1A 2HKXA 1B4AA 1BIBA 1XCBA 2OZUA 2FF4A 1R1TA 5BPIA 2EJRA 1G6NA 1PP7U 1ZG3A 2Q2EA 1FNNA 3R6SA 3FZVA 5H20A 1QZZA 1LEBA 2H6BA 4U7BA 1KA8A 2VBXA 3F23A 5DUKA 2XV4S 2DI3A 4FHTA 4MQ9F 4KDPA 3ECHA 2H6CA 2Q8KA 2FBIA 5LGNA 3IRRA 4HF2A 3BJ6A 3HYIA 1YQAA 2LSOA 4HV6A 5L3BA 3QAHA 4GYIA 2QYOA 1R23A 4EM0B 1IRGA 4OU0A 3GVAA 3BPXA 5FD5A 1W7PA 3BROA 4CICA 4M9XA 1HSTA 1B6AA 3V7RA 1SD5A 4MTEA 2JT1A 3ISPA 1XGMA 1ZREA 4A0XA 5LRRA 3M8EA 2HQNA 2MBFA 3MEXA 3KFWX 2E7XA 2PJPA 2R7DA 3ZMTA 4OIRF 3K0LA 3EDPA 1J75A 4ZYGA 2IRFG 3FM3A 2HTJA 4HDUA 2G9WA 5K5QA 5FB2A 5DV5A 4QLCU 3WE3A 1FYLA 3R0AA 4ZZDA 4EJWA 2DT5A 1XDUA 1O7FA 3G73A 5HDKA 3ZN1A 3HHHA 4EJOA 5ILUA 2V9VA 2VC1A 1SMYF 1R00A 4HQMA 5J8CA 3VB2A 1MD0A 3T0YA 3WGIA 3D0SA 1B59A 4CDGA 1RUOA 1I27A 2HEOA 3TGNA 2EWNA 5LHGA 1TNTA 1TQIA 3WTWC 1T39A 4N9IA 4R8HA 1R7JA 3V8LA 4IRHA 3V7SA 2A3SA 2P7VB 1KU2A 2OD5A 3ZMVA 1STZA 3DFGA 3E5UA 1KYWA 4BYYA 2F5CA 2ZJ2A 5BPDA 3C1DA 5IT9Z 1E17A 3HRMA 1F9NA 1D8JA 1KGSA 2PEXA 2DFIA 2DTRA 3CDHA 4M6XA 1W7PD 3WTTC 4IRGA 3RI4A 2QUFA 2MLKA 1MZBA 3RDIA 3KZYA 1LDJA 2R7FA 1XD7A 3LA3A 4RB3C 2FEZA 2PFBA 3LQQA 2PN6A 2GWRA 3F8CA 4H0EA 1IAWA 3T8TA 2C6YA 3TQNA 3DV8A 4P5OA 4HX7A 1QBJA 1O7LA 2PMUA 3HTSB 1HKTA 4OIQF 4AIHA 4KN7X 2L02A 2K02A 2QBYB 4WXDA 4A6DA 1ODDA 3FXQA 3EUHA 6PAXA 4EM1A 2DW4A 1EH8A 2WWYA 2P6TA 2K7LA 3QPHA 3IWFA 3E5XA 5TRDA 4U0YA 1ZG5A 4B09A 4LB6B 2F5EA 1U5TC 4G6DA 3LSTA 3JSPA 2XUBA 3O2PE 4M72A 4ESFA 3J81Z 4NQWA 2VOPA 4EGZA 2MA3A 1I1SA 1WKMA 5D5WB 4CXFA 3CLOA 4G9YA 2D45A 3WTSC 2JRTA 2L54A 2WTEA 5DDGA 2QQAA 3I64A 4MTDA 1ZRFA 2OAZA 1BI3A 4EV0A 4A5NA 3M9AA 2P5VA 5E20A 3H3UA 3DPTA 2STTA 1V3FA 4A0ZA 5CJ9A 4OOIA 3GFMA 5HLGA 1S3JA 4EVIA 4JQFA 4D0PA 4L5JA 1KQ9A 3QP6A 1TTYA 2WV0A 4BH9A 4KFCA 3MAJA 2F5DA 2Z3YA 3MCZA 5DEQA 1J2XA 4MEXF 4IPAA 3HSEA 5L3CA 4KIGA 3PQJA 1A04A 3JAMZ 2RVCA 2RKHA 1S8NA 3F21A 4KICA 2OBPA 4HYEA 3HRUA 2Y75A 1LEAA 2O0YA 3HTUA 5J6XA 5LBQA 4L0YB 1QNTA 4YFKF 1LDKB 2JZYA 1DPRA 3KEOA 3FMSA 4P55A 1TNSA 2QQBA 1L3LA 1G3YA 2LF8A 4BHCA 4ON0A 2NYXA 5HLHA 1XDSA 1K7AA 2EV6A 1FYMA 1Z9CA 2HWVA 3T8RA 2FXAA 2P5KA 4O3MA 3HOSA 3JSOA 4LK0F 2IVMA 4WF2A 1FLIA 2VE8A 3ROUA 3WTYC 2FBHA 5E1WA 3BY6A 5BOXA 4AWXB 2G7UA 3CTAA 4G7HF 5AIQA 1QPMA 3MQ0A 3LQRA 3N97A 2XASA 1BI2A 3KLNA 2Z33A 1YW9A 2DK5A 2STWA 2PI0A 1HSJA 3QRFF 3NRVA 3TOAA 3CO7C 4N0BA 3HUGA 2GIVA 2A5YB 1R58A 2M1BA 2X0LA 4F7ZA 4RB1A 1Z7UA 4ENKA 1BI1A 1U5TA 4K2EA 2GA2A 2CG4A 1KQ8A 2V1UA 3JTGA 2IA0A 3RPQA 3DPLC 4EJVA 4ZZLA 3VEPA 5F64A 2IW5A 1KU7A 2VONA 2D1VA 4RS8A 3GZ5A 4WXHA 3FX3A 1ZHFA 3B02A 2H09A 1LB2A 4Z2YA 1MKMA 3K1NA 3R60A 4KIFA 2ZFWA 4G7ZF 4A5MA 2W85A 5H6QA 2CO5A 3KLOA 3V7CA 1FPQA 2A61A 1U2WA 4DNCA 2H94A 3L9FA 4RB0A 4UVBA 5HLIA 1OKRA 2ZBKA 4YIIA 1BM9A 4ZYDA 1S7AA 1ZG1A 1XSVA 2XAGA 1XGNA 2NNNA 1YIOA 3SXYA 2ETHA 5K5OA 2AS5F 1ULYA 2QM3A 2EFQA 1CF7B 2MLGA 2XKPA 2HYGD 2GAUA 2G7HA 5FLXK 3HSRA 3NEUA 1AOYA 4M73A 3S2WA 1WRJA 1T6SA 1HQCA 3I5UA 5FO5A 2AXLA 3J80K 3EYYA 1K6OA 3GFIA 2VODA 5HS9A 4YFXF 5HVQC 2RNJA 3WGHA 3AAFA 4EMSA 2HGCA 1R22A 5ICGA 5BS6A 1HW1A 3T1BA 4XSXF 1TBXA 1RUNA 3FXRA 4XLPF 2PBIA 1X3UA 2L3DA 1S7OA 2M45A 1P92A 3SQNA 3NQOA 2UZKA 2QWWA 4I09A 2ISZA 5DCMA 3GWZA 2F5FA 4KN4X 3F22A 4OIOF 1XGOA 3G3ZA 2KRFA 5ICEA 2DAOA 2FSWA 5LGUA 4JK1X 2K27A 3SZPA 4LG0A 3EYIA 1W5TA 1SAXA 3F8BA 4IXAA 2L4MA 1DP7P 2O03A 5E8IA 5K5RA 2M8EA 4RAYA 2VBZA 2FA5A 4AVPA 1EV7A 5JFRA 4BQAA 1FZPB 3SZTA 3ERED 1OMIA 1IXCA 4BNCA 4KMUX 2XGXA 1NHAA 5L3EA 2EFOA 1S6LA 3KCCA 2EA2A 4HF0A 3QU6A 3GX4X 1SMTA 4KIBA 1CF7A 5EEGA 4OIPF 1SFEA 1BJAA 3L00A 3TKYA 2HDCA 3KP5A 4L9JA 4OMYA 3RPUA 1H9GA 1D3YA 3O6BB 2QLZA 1XSXA 3RKWA 1V4RA 2GA1A 1YW8A 2VBYA 4MHGA 2FOKA 5LRSA 5HS8A 4BHBA 4EGYA 4GYGA 3J7AO 2ZXJA 2OQGA 1BN5A 1XGSA 4MGRA 4YIFA 4ESBA 1T98A 1GVJA 4LLNA 1G3TA 3GEZA 1UFMA 2DK8A 5E8GA 2XROA 1YYVA 4RGUA 4Y17A 1Z6TA 4Q5SF 3ULQB 2A69F 2EV5A 3IHUA 1IN8A 2BGCA 2EFWA 1K78B 2RC4A 1SD4A 3F6VA 2FE3A 4HLXA 4FT8A 5LHIA 3TOBA 2DPDA 1MDMB 1RNLA 4BXUA 3DEUA 1O3SA 5LLQA 4L9NA 4CZZA 1P2FA 2E1CA 4IRIA 1QZYA 3GZ6A 1WWXA 1EH6A 2HQRA 2XRNA 4PZJA 4NB5A 4M71A 1JXSA 1ZH5A 1TQMA 1WSUA 4G8XA 1AWCA 2VXZA 1IXRC 5JI6A 3H92A 2V6CA 1L0OC 1I6XA 5CVJA 2JPCA 2UXXA 3GO5A 4HA8A 2XIGA 4Q47A 2K86A 1HBXG 3Q9VA 1ON2A 4LK1F 1YW7A 5A2QK 3WTUC 4XRFA 2XAQA 3KP6A 1HXDA 2HOEA 5D4RA 2DO7A 2BYVE 1ZGAA 4OINF 4HBLA 4XSZF 3QOPA 1B9MA 2FMLA 1TQPA 5ILVA 3GXOA 4R79A 2Z9OA 1FBQA 4IVNA 4L9TA 1USSA 2PLYA 3GW2A 2CWEA 1XN7A 1KU9A 1R5HA 3E3VA 2MH2A 2V79A 1C0WA 5TJJA 5F1RA 4A2UA 1ZYRF 3FXUA 3ECOA 5CVVA 1MJBA 3P9IA 3L2CA 2ADUA 4MNUA 5BQTA 1ZARA 1TW2A 3TDZC 3RJPA 2GQQA 5EEHA 3F8MA 2HZTA 1U3EM 1ON1A 4LLLA 2HYFA 2ISYA 2IPQX 3K2ZA 5DYMA 2PMHA 3E5QA 2GXGA 2IT0A 3MFKA 4AIJA 1Z05A 4HLYA 2TDXA 1K78A 3KZZA 2W24A 4JBAA 4N9HA 4TV7A 1ONVA 4HX8A 2Y0MA 1MJAA 1F1ZA 2A6HF
chains in the Genus database with same CATH superfamily
2JSCA 4WWCA 1PUFA 1P4XA 4HF1A 2EILH 4IJAA 5FKNA 4P9UA 2ESNA 1QO0D 1BR2A 5JHFA 1MDMA 4C2TA 3HSFA 5CVRA 4RAZA 1QHGA 1IUYA 1HKQA 4U88A 2LBFB 5CPRB 3JRCA 1CGPA 3CD6I 1OR7C 5CVIA 5JLXA 1MSEC 3FHZA 2HVSA 2HQ5A 2I10A 1HCRA 3TO6A 1FT9A 3CLQA 4HPQA 2HI3A 3LA2A 2ACJA 2D2WA 2GZWA 2MC3A 1X3ZB 3OYMA 1JUPA 2CQ7A 3FBNB 5D5UB 2JPBA 3ABMH 3VOEA 2CYYA 1W5SA 3Q9SA 1JUSA 2HOTA 3VFZA 2X85A 1SANA 4UUVA 3SFZA 3BJOA 2YSRA 1GUUA 1PVEA 3G6EI 1TWGJ 5CLSA 2LYCA 1V5FA 3PJRA 3BTLA 1IXSB 2YR2A 2RAEA 3U21A 1E3HA 5J4YA 2P6SA 1MMSA 2IJLA 5HNHA 3IKTA 1FBSA 2HZDA 2BV6A 3KP4A 2CSOA 2DQLA 5E79C 4D5CA 3DLLF 2E60A 2QBYA 2KQRA 2Z99A 1ZKGA 2RV8A 1PP8F 4XONA 1T0FC 5KAFC 3L09A 2Z16A 2VE9A 3I59B 3ZR8X 4RGXA 4D5FA 4DYCA 1ETXA 4KYWA 2RQPA 1MNMC 2M5WA 4XOTA 3EPZA 4QWQA 5JR3A 3OYDA 3FKIJ 4L0ZB 4I01A 4PK4A 4HNVA 2DOAA 5F6FA 2DOFA 1I1GA 4AD9A 1GHCA 1OQYA 4E4HA 1S72I 2HKOA 2R93J 1FX7A 2KJBA 4B8XA 2QENA 3HKZA 5FKOA 4DBRA 3HRSA 2QVOA 3TBIA 3HL2A 4EJUA 3ZP5A 4LFUA 1IN7A 3REOA 3W6KB 4XBFA 2OA4A 4D7MA 5E18F 2ZMEC 4MFDA 5J1UA 1WH5A 5DD8A 5ILSA 2QQ9A 3ZPLA 4UB6C 3OYFA 2LREA 5FKMA 2LR8A 1BIAA 4BQOA 1YG2A 3M07A 2HR3A 1REPC 1VZ0A 3S17J 4RM3A 5D8KB 1SVOA 3V8KA 1HC8A 2ZMEB 4CCLA 2ME6A 4CGZA 2KKOA 1X19A 2O5RA 4E7JA 1E2XA 1IC8A 4C9YA 2NNYA 2M87A 3E6BA 1G3WA 5EEAA 1LJ9A 3VYUB 5EF6A 1LUJB 4GCVA 5D4SA 2LNBA 4LJZF 1YS6A 2VPRA 1W0UA 1SFOJ 3DXJF 2V1XA 3ZQFA 2K9MA 3HOTA 3R0JA 3GFJA 1H8AC 4DJAA 4YFNF 3C18A 3K1MA 2EA4A 3L7WA 2R5ZB 2PQ8A 2CFXA 2NS7A 2JUGA 3LSJA 4BQQA 2DMQA 1R5GA 1Z1DA 3TDUC 4EEFG 3OWTA 2O6GE 4EATA 4XLNF 4JX4A 1IW7F 4CCOA 2VB6A 3BG3A 2WBMA 4LLGF 1U8RA 2AQEA 3MZ8A 1LKXA 2YS9A 3LFKA 2QF7A 3OYJA 3DKWA 1KZHA 4LD5A 3E97A 3ML6A 2R7XA 2K9QA 4FASD 1FMVA 2XVCA 1XB4A 2FUG2 5HNFA 3FM5A 4M6YA 2OJED 2JA7J 3QU3A 2CH0A 4NC7A 4G6QA 4DZPA 2KHMA 3RQ4A 5DUIA 1YTYA 3S1NJ 1JHHA 1FWZA 4OWRB 3WTXC 4KA4A 3DEWA 2A6EF 3OV8A 3GYHX 4G12A 1WI9A 1TLHB 3FXMA 1W7PB 4FETA 5FD6A 4U0WA 5DD4A 2W25A 2WAQA 1KU3A 3JRBA 2DLLA 1OR7A 1SD6A 2KMUA 2CQNA 4EM2A 5LGTA 4G7OF 2X9DA 3KYDB 2W00A 2YUSA 4C2UA 4MO7A 2DT6A 3QYBA 2YPRA 3H9QA 1EF4A 2FQ4A 1Z3YA 3S2DJ 2M3AA 3LWFA 3WTZA 2MH9A 3H5AA 1Y0UA 3M8JA 3RSNA 2F4IA 1XMKA 2RN7A 3FIWA 1LVAA 2DBBA 4I02A 2Y69H 2M34A 4O5VA 5H6RA 4CHUA 1G4DA 2LY2A 2L4AA 3S1QJ 1FSEA 1I5ZA 2KZGA 5AIPA 4IF4A 3EUKL 4GRIA 4C3IJ 1HKSA 2HYJA 1YO5C 1YX3A 3CCLI 3WU1B 3I59A 2FNPA 3K10A 4AIKA 2IS2A 1D8KA 5EGOA 4XK4A 5C4JJ 3RYPA 3PQKA 3L1PA 2XPUA 1MJ9A 4Q4ZF 5HOOA 4PGGA 1S9HA 3EQLF 5D6EA 2LKXA 1AU7A 1SFUA 2K9NA 2QKLB 3F6OA 3NARA 3V8JA 3P7NA 2KISA 3OY9A 2BXZA 3MZHA 2DDBA 1FP1D 2XAHA 2WAEA 3COAC 1K79A 2XKOA 3VODA 3HRTA 5IP7J 3H35A 2JUCA 3O3KA 4HSRA 2EINH 4M3BA 3R4KA 1P9QC 1B1BA 1MNEA 1Z21A 3K4NA 1E3PA 4MQVA 4UXNA 4XLAA 3LAJA 1YI2I 4RA2A 3F0CA 2BY3A 5FJ8J 3ZMDA 2LG4A 4M3FA 2E1NA 2CQKA 3ABTA 3BTIA 3E6CC 3OS0A 1RIOH 1UCRA 2L7MP 5BNGA 2W4SA 1R36A 1MGTA 2BBYA 3U9GA 3X2QH 2ZMEA 1IDYA 4G94A 1ZQ3P 1X4PA 1USTA 5FLXZ 3L2QA 5HDGA 4XLFA 3CC4I 4IHYA 2M4KA 2DFFA 3JW4A 1X58A 1BC7C 2P5LC 1FOKA 2ELHA 3T5XA 1FP2A 5CQEA 2FMYA 3QOEA 4OMZA 1QRYA 4P96A 3U2RA 3WG7H 3WU2C 4Y7NJ 5IT3A 2YX7A 2K4BA 5HDNA 5CVUA 2O8XA 4ZH4F 1WFXA 1XSDA 2IS4A 3NWSA 2JSPA 2D1HA 3J80Z 5K7FA 1VQ4I 1QGPA 2ZCWA 2BEOA 4BJ5C 4RGSA 3AG1H 2R5ZA 3I56I 2BHZA 4ZDPA 3KEQA 3OIPA 4IQJA 1VQ5I 2DA2A 4HAMA 4ENNA 3HOVJ 3A0BC 3OR2C 4XKCA 2QSFX 3I58A 1WGXA 2IP2A 1YJ9I 2HDDA 4L5IA 1BBYA 3N4MA 1PDNC 1MMNA 2KDOA 3BOQA 1QZEA 4UV8A 4ETSA 1A31A 2WY7Q 2KP6A 2VI6A 4Y3OA 3D5LA 1X1CA 3W6JB 4B1RA 2V1DA 2P8TA 3F8NA 3EUHC 3F3XA 2XAFA 2WV1A 2W57A 4I0AA 3BR0A 2IA2A 4PDKA 3HBLA 2AHQA 2OC6A 3E6MA 2DN0A 3LA7A 4I7HA 4A3CJ 2CJJA 4MEYF 2BXYA 3HOUJ 1TWAJ 1JT0A 1XMAA 1Z77A 1SAUA 5LHHA 2M0CA 3OL3A 4I2OA 5KNLA 3K2AA 2A5WA 2L9VA 4L18B 3ZQ7A 4HSTA 4AM3A 4E7LA 2M2EA 2XHKA 2COMA 1I3QJ 1EH7A 5FGMA 4OAYA 3GFLA 2P0WA 2L01A 1ZAOA 3K7AJ 4HDVA 3BPVA 3FWEA 3ZMUA 1FEXA 3NAUA 1H0MA 1UAAA 2F6CA 5HODA 3S14J 2O8KA 3HPGA 2CGPA 2OZ6A 3G1MA 4E7KA 1TT5B 3K4KA 2K4JA 4NQWB 5IT9K 4DOZA 1J59A 1BR1A 3FF5A 5FRMA 1O3QA 1TZLA 4P1WA 3QP5A 3A2KA 3RYRA 1HF0A 2I5UA 4IQ4A 2CUFA 2OPTA 2IGMA 1KQ0A 3P9CA 4KUMA 2EFPA 4L9VA 2PG4A 5TISC 1VFCA 3E1SA 2QZ8A 2W1OA 5M3MJ 1O3TA 3I4PA 4JP0A 3CMYA 2KJCA 2DJNA 4YG2F 3K1PA 1I6HJ 1NK2P 2VJIA 1ZLKA 1IZ1A 3CC2I 2J5PA 4RGRA 1ZGJA 2JTVA 3JRDA 4A6EA 1YRNA 1P4WA 1FSHA 2X4HA 4E70A 4F91B 3IKVA 2GOMA 2ECCA 4HX4A 2ID6A 2VQLA 3RIRA 5ICFA 1LPQA 3MKZA 2VBWA 4PCQA 3KP7A 2BE5F 1YX5A 2R7VA 2ZNYA 2DMPA 3DKXA 1XG1A 4IHSA 1JT6A 5FFXA 5GPCA 5C3EJ 2PJRB 1PJRA 1QPIA 4KNYA 2MABA 5JVTA 4X6AJ 3WODF 3HGYA 4HZFA 5BMZA 4HRIA 1Z3XA 1FBUA 4BUPA 4BXFA 2XPVA 2MFZA 3PM1A 5E3MA 1BOAA 3BQZA 3S1MJ 2QSHX 4GDFA 4ZDOA 1XX5A 2P4WA 3BDDA 2CU7A 1IN5A 2L5QA 5F0HA 1VQOI 3IRQA 1MSFC 4BXXJ 4W97A 2IS1A 2I8DA 1J5YA 2P7CB 1U6GA 4A12A 2JA6J 1FY7A 3IC7A 3J81K 3M7GA 4ESJA 2IAIA 1P4AA 3WE2A 3LSMA 4XRMA 4CO8A 4LMYA 2DMNA 2CS3A 2X51A 3MKYB 1ZRCA 1A6QA 2OTLI 2FRHA 4J01A 2KIMA 3A4CA 4F93B 2GXBA 4U7DA 2QA4I 1QU3A 3CJNA 3PSIA 4GXOA 2VJ5A 2QQ8A 1RKWA 3CO6C 4Y15A 2HS5A 3F72A 4QIWN 2B0LA 1TP4A 2IA1A 4C3JJ 4Y13A 1XPXA 3H3ZA 2QKMB 1F5TA 1X1PA 2A07F 1YS7A 3HXLA 2R92J 1W4MA 2M4GA 3K9TA 5L3GA 1Z6RA 1U0JA 2EV0A 2ID3A 3V4GA 1GXPA 1N78A 2IGKA 2ZKZA 4CYDA 3GUDA 2BVMA 2WB1N 3ABUA 1P6RA 1UELB 2NXNB 4Q48A 2DMTA 4HG2A 1KYZA 4HV5A 3KE2A 2BY1A 3SHFA 3BCBA 4JOMA 4GGGA 3RQIA 4ENMA 5LEJA 5D6FA 1Q1HA 4U0VA 4UV9A 2A68F 4KT5C 3AG2H 5F1JA 2DU9A 3MVPA 1UZCA 2M7AA 3HHGA 2RDPA 4D9JA 5B66C 2JA8J 2XAUA 4RAFA 4E7SA 3KETA 3EETA 3VYTB 4IOCF 1X1AA 2YU3A 4UVCA 5KVRA 3RTRA 1U78A 2BZTA 4XKVA 3JAMK 2EFNA 3QPTA 3GTKJ 3DTEA 2B63J 3VPRA 3ABKH 4IX7A 3ZRGA 3R61A 3S32A 4E6KG 1U5TB 2KL4A 3M8FA 2MD0A 1VQPI 3E0JB 4E7HA 1O3RA 2IGNA 2OU2A 2ZJPF 4XRSG 1T38A 5EZHA 1XCVA 4NHJA 3B6AA 1W1WE 5LEKA 2JA2A 3BWGA 2COBA 1IN6A 1TW3A 2VIXA 3I53A 5K1YA 2KT0A 5A2QZ 2KDZA 1JJ6C 4WX9A 3VWBA 3W2WA 2FQ3A 4FX4A 2F2EA 4F52A 3LAPA 4ZYEA 1JHFA 1BI0A 1V55H 2X6YA 4YRVA 3ELKA 2R7QA 4XLCA 3H9GA 4BU2A 2VASA 5E3LA 1G3SA 1BC8C 3OIOA 3KYLA 2XAJA 4N4NB 2VKDA 2KIUA 5FFZA 1F4KA 1E0EA 3F8FA 3CDLA 2HXOA 3K70C 2PJRA 3I0TA 1RESA 4ASNA 1XTAA 2EK5A 4IEJA 4UUSB 4AUXA 1Y8RB 3MZYA 1ZRDA 3BTJA 1D1BA 2O9LA 2MW8A 5D8LB 4EQQA 5J3LA 4E7ZA 5ED4A 1Y0NA 2DQRA 3FKJA 3DKYA 1MBFA 4BDYA 4XLHA 4UB8C 4FCYA 1IN4A 3BZKA 1Z7LA 2NOGA 2Q0OA 1LNWA 4PSXA 2VXDA 4P9FA 1FMWA 1HW5A 2CUJA 4S05A 1YFHA 1U8BA 1J0RA 1SD7A 3CCMI 3FXOA 4V2GA 4M9ZA 2UXNA 3FBIB 3RKXA 5J1YA 3TO9A 3K4MA 2VN2A 1Z91A 1SEUA 2LF7A 2XB0X 2CV1A 2TRTA 2H27A 3KP3A 3P9KA 3CCRI 4WK8F 1YLFA 2KLOA 3G1OA 3K4JA 5E17F 3CMEI 5GADJ 5LD2C 2HPMA 1ACIA 3BZ6A 4O6JA 3CZ6A 2XSDC 2QGUA 2X6XA 3MWMA 3RZOJ 3Q5FA 3DQVC 3M4OJ 2DA4A 2AXTC 4DGWB 1H9TA 3K69A 1TWFJ 4ZYHA 4EJTA 2PMZN 2WY8Q 4XQFA 4LITA 4I6ZA 1BOBA 4WCGA 1ZLJA 3LNQA 3FMQA 4RBOA 5M3FJ 4RAGA 1ZGWA 2FJ1A 2J5OA 2V9KA 2ZXWH 1FC3A 4PFOA 5IP6A 2HQAA 2VPLA 1LDDA 1FYKA 4IHTA 2RGVA 3B73A 3LSRA 3Q0WA 1BJZA 2IBDA 4S04A 5JHUA 5ERIA 3ZN0A 4IZZA 2CW0F 2JN6A 2KIFA 3CESA 4CUGA 3BG9A 1QHHD 1LQ1A 1UB9A 1OYWA 1SFXA 2FOWA 2DPUA 3RCOA 1B9NA 5DM6F 4DIQA 2M8GX 4LIUA 4A3IJ 4I98B 4PGHA 1V54H 3D1NI 2R0QC 1JJ8C 1BA5A 1X2NA 3OYAA 4M3EA 2VT3A 1AA7A 4BEHB 2B7EA 2E34A 2WC2A 2VOOA 2Z5UA 4IHVA 2R5YB 4PFPA 4B47A 1OYIA 3CUQC 1VTNC 4UVAA 1ZTRA 3FDYA 3IAM2 2H1KA 4CYCB 1ZR4A 2NRAC 3U1DA 1OPCA 1Y39A 3A02A 4RB2C 1MNDA 3ZMZA 3Q0VA 3WTVC 3WGGA 2VJJA 4GO1A 1OISA 5L3DA 3I71A 3CF5F 4Y52J 3OOPA 3CUQB 2M30A 2HU9A 3SEQA 5IPAA 3CMAI 3DBRB 2CUZA 4XN0A 4ZTJA 2ZO4A 1WHUA 1BW6A 2F4OB 1JGSA 2L2OA 2XGDA 3WHCA 4BAYA 2VC0A 5CYVA 5HS7A 5DCMB 2E2IJ 5L3FA 3VYRB 3C7JA 3JTHA 3PFIA 1DPUA 2N8GA 1OYYA 1UHWA 1YJWI 2DOEA 2Q2EB 1RZ4A 3BR5A 1O57A 2LK2A 3H0GJ 2X1EA 3HIFA 2MD5A 2FU4A 3BR2A 3CCUI 4HW0A 3WU0A 2G0EA 3BQYA 4LB5A 3AG4H 2FBKA 2ZNZA 3CJQB 2O61A 4R1HA 2Z1DA 1MIJA 4W1UA 4LG0B 1T56A 2CFOA 4BBSJ 2L7KA 3ZMSA 4NC8A 1OCZH 4NC6A 1BL0A 1WZ2A 1WPKA 1R1VA 1PUEE 3FXLA 2EB7A 4UUSA 2DA5A 4FQGA 4CA0A 1H88C 2NS0A 1MH3A 1YOVB 2LBFA 2X1DA 2R4GA 4BGDA 4IL6C 1B8IB 1RC9A 4PJJA 3I54A 5ICCA 2VL8A 1DUXC 5KK1A 1R1UA 2L9SA 2CQQA 1WQ2A 2XC7A 2LKPA 1J9IA 1MBGA 3KYCB 2EZLA 2O3FA 3GF2A 3ZQQA 1J7KA 1A35A 2TCTA 2E2JJ 5FRNA 1OCTC 3GTMJ 4IHXA 3OL4A 2HOAA 4FX0A 1IG7A 3MN2A 5D5VB 2V1NA 2E7WA 4UUTA 2HTSA 3RKYA 5J8FA 1YIJI 2UWMA 1RI7A 2HFHA 1J09A 2YX4A 3WG9A 2DA6A 1R6RA 1S7EA 2LD5A 3PFYA 5E1ZB 1UHMA 2L7ZA 3I9V2 5DCFA 4M74A 5B3SH 4B3AA 3CJTB 2VT2A 1FTZA 2R3SA 5AONA 1HW2A 2OQRA 4FISA 1WCMJ 2LFBA 4LGWA 1VI0A 1MW7A 2FD5A 2HOSA 1OLTA 3IH2A 2IXSA 2Y9YA 4DQ2A 4JX5A 4YELA 4ENJA 1JE8A 2M7BA 4I0BA 4M9SA 3BG6A 5M5YJ 4UNOA 2ESHA 1ZELA 2VLAA 4KMFA 1W36C 1A5JA 3HZJA 3IL2A 5CQGA 4HOBA 4XL9A 3E7LA 1ETYA 1D5VA 3BJAA 3EUAA 3GLXA 3JREA 3C2BA 1ZR2A 1T0FA 3DLAA 2Y48A 5D5XB 4A0YA 3QPSA 3RKQA 2K40A 1S29A 2DA7A 5K7HA 3CUOA 4A3KJ 5EDNA 1ZN2A 1TWCJ 1GDTA 3KP2A 3O8GA 3CCSI 4UHTA 1FOXA 1T08B 2FNAA 1X2MA 4MLOA 2CV2A 3GZNB 3FMRA 1IRFA 3DF8A 1NH3A 2R7ZJ 4BHPA 3DP7A 4BEHA 4WXCA 1GXQA 1UMQA 1HLVA 2R5YA 2CV0A 3ZOBA 2DYSH 3E6DA 2W84A 2UUZA 2RREA 4CYCA 1DDNA 3HPHA 3M1EA 3IWZA 1LVKA 4BS9A 2LDUA 2NAZA 3C3WA 3GMEA 3G1LA 3I4NJ 4HQEA 4RDUA 1T2KA 1QQIA 3BP8A 5E1XA 1K6YA 3TO7A 3IV5A 1JKRC 4LG3A 3N05A 2CUEA 3CUQA 2HVQA 1IF1A 3D5SC 2HKXA 1D1CA 1B4AA 1BIBA 1XCBA 2QCOA 2VKEA 2H1LA 1FTTA 2Z2SB 2OZUA 3VSLA 1DU6A 5GAHJ 2FF4A 1R1TA 5BPIA 2K9LA 2EJRA 1Z0XA 1UG2A 1G6NA 1PP7U 1ZG3A 2Q2EA 3TMOA 3K70D 1FNNA 3R6SA 3FZVA 5H20A 1QZZA 1LEBA 2H6BA 4U7BA 1KA8A 1K61A 2VBXA 3GTOJ 4A3DJ 3F23A 5DUKA 2ZB9A 2XV4S 1ITYA 1JUMA 2DI3A 5M5XJ 4FHTA 2GBYA 4MQ9F 4KDPA 3UR3C 4XNFA 1RPWA 3ECHA 2H6CA 2Q8KA 2FBIA 3I4MJ 1SVMA 2WB1A 5LGNA 3IRRA 4XRSA 4ANJA 4HF2A 3BJ6A 3ERMA 3HYIA 1YQAA 1WJ5A 2Q1ZB 3M1CA 2LSOA 4HV6A 1XMXA 4FE4A 5L3BA 3CCYA 3LMMA 1MBHA 3QAHA 4GYIA 2GXAA 2QYOA 1B8IA 1R23A 2EZKA 4EM0B 1IRGA 4OU0A 2ZXIA 3M3YJ 3GVAA 3BPXA 5FD5A 1W7PA 3BROA 4CICA 4M9XA 1HSTA 1B6AA 1Y1WJ 3V7RA 1SD5A 3A01B 2V9PA 4PUSA 4MTEA 5GTIC 2JT1A 3ESWB 3ISPA 4D1QA 1XGMA 1ZREA 3DBLB 4A0XA 2DFEA 5LRRA 3BT9A 3M8EA 1X1BA 2HQNA 4H4KC 2MBFA 3MEXA 3KFWX 3OYHA 1OCOH 2E7XA 3S2HJ 3DWLE 5EZGA 2PJPA 2R7DA 4JX6A 3ZMTA 1D5YA 4OIRF 3K0LA 3EDPA 4FTHA 1N25A 2V4JC 3H5RA 1J75A 4ZYGA 2IRFG 1RR7A 3FM3A 2HTJA 2XGEA 4PSWA 4HDUA 2G9WA 5K5QA 5FB2A 5DV5A 5TGTA 4QLCU 3WE3A 3JR9A 1FYLA 1IUFA 3R0AA 1R4NB 4XR6A 2GLOA 2KRCA 4PJNA 4ZZDA 3W6VA 4EJWA 2DT5A 2HPIA 3QPLA 4A3LJ 4II3A 1U9NA 1XDUA 2RQQA 1O7FA 4RLQA 4YEJA 3G73A 5HDKA 3ZN1A 2IEKA 1QVUA 2DXIA 2JQ7A 2PX9A 3HHHA 3OS1A 4EJOA 3DTKA 5GAGJ 2KPMA 3VYSB 5ILUA 2F48A 2V9VA 2VC1A 3WHBA 5F08A 1SMYF 1R00A 4YIRX 4HQMA 5J8CA 2AQFA 3VB2A 3IH4A 1MD0A 3T0YA 5JVGF 1NG6A 3WGIA 4PJMA 3D0SA 1B59A 4CDGA 1RUOA 1I27A 2HEOA 3TGNA 2E71A 1IDZA 1W0TA 2CMPA 4IO9F 1P7IA 2EWNA 3SDBA 3TW6A 5LHGA 3C2HA 1TNTA 1TQIA 2EQRA 3KIOA 3WTWC 3BC8A 5KAIC 2ZSIB 2Y31A 5J1RA 2Y0SN 1T39A 4KISA 4N9IA 4D7NA 1YE9A 2M9HA 3PNVA 4R8HA 2DA1A 5J40A 1GT0C 1R7JA 4ZDLA 3JCUC 3V8LA 2MSYA 3H9JA 4IRHA 4HNTA 3V7SA 3IP4B 1LFBA 2A3SA 3TP0A 3LFUA 2P7VB 3KEYA 1KU2A 2OD5A 3IUOA 3ZMVA 1STZA 1OCPA 3DFGA 3E5UA 1KYWA 3VDXA 4BYYA 1X1DA 2F5CA 2ZJ2A 5BPDA 3C1DA 1HDPA 3PUFA 3W2VA 2VJ4A 5EJCA 2GM4A 2BVLA 5IT9Z 2PMZA 5J47A 1E17A 1IJWC 3HRMA 1F9NA 2ZJQF 1D8JA 1KGSA 2PEXA 1V5EA 2DFIA 2ELKA 2DTRA 3LSIA 1K4TA 2R7RA 3CDHA 3PL8A 4M6XA 1W7PD 3WTTC 4IRGA 2BY0A 3RI4A 1R71A 3DU5A 2QUFA 3FK7A 2X6OA 2MLKA 4DBQA 1MZBA 3CC7I 4KJZA 4IOAF 3OYKA 3RDIA 2HDWA 3KZYA 3PNYA 4NBQA 1LDJA 1OFCX 2R7FA 1XD7A 3LA3A 4RMNA 4RB3C 1WJDA 2FEZA 2PFBA 4CCMA 3LQQA 2IS6A 2VKVA 2PN6A 2GWRA 4BL0B 2EIJH 3F8CA 4H0EA 4AYBN 1IAWA 3BCAA 3T8TA 3DEEA 2C6YA 1UHSA 1TL8A 1ETQA 5HLTA 1FIPA 3TQNA 1FOYA 3DV8A 4P5OA 4B48A 4HX7A 1RR8C 4PJLA 1QBJA 3BG7A 1O7LA 2PMUA 2V7FA 1EJ9A 3HTSB 1HKTA 4OIQF 4XKWA 4AIHA 2DJIA 4X1EA 4KN7X 2L02A 1ENHA 2K02A 4A3BJ 3CDIA 1B72B 2QBYB 4WXDA 5GAEJ 4A6DA 5GP9A 1ODDA 3FXQA 4ITVA 3LSKA 3EUHA 6PAXA 4EM1A 2DW4A 1EH8A 2WWYA 3SFIA 3ABLH 4A3EJ 1PYVA 2P6TA 2K7LA 1RETA 3QPHA 1I50J 2XF6A 1TWHJ 5IY5H 3IWFA 3E5XA 3OR1C 5TRDA 4A3MJ 1W36D 4U0YA 1ZG5A 4B09A 4LB6B 2F5EA 1U5TC 4G6DA 3LSTA 3P5JA 4ZC3A 3MKWB 3JSPA 2XUBA 3HC7A 3O2PE 4M72A 3HUGB 1LFPA 4ESFA 2EIKH 3J81Z 4NQWA 3DCFA 2VOPA 3PO2J 3Q0UA 4V19K 4EGZA 2LP0A 2MA3A 1FIAA 1I1SA 1WKMA 5D5WB 4CXFA 5FROA 3CLOA 3CJRB 5M5WJ 3BR1A 4G9YA 4V2FA 5GTHC 3BZCA 2D45A 3WTSC 2JRTA 1DQUA 2L54A 3JRIA 4I76A 2WTEA 3K4LA 5DDGA 3OYLA 3D5RC 3HEFA 2QQAA 1D1AA 1ORKA 4QSHA 2JA5J 3I64A 4MTDA 1ZRFA 3OYGA 3BR6A 2OAZA 1BI3A 1WJEA 1Q1VA 4RM2A 4BQNA 4A5NA 2ZXHA 4EV0A 3M9AA 2JJ7A 2P5VA 3SYTA 5E20A 2LOOA 3GCMA 3H3UA 3DPTA 2STTA 2KRHA 2RNGA 1V3FA 4A0ZA 1F36A 1OJLA 4CSWA 5CJ9A 4OOIA 1GV5A 3OOUA 1FJLA 2IGOA 1T33A 4GFBA 1QVTA 3GFMA 5LFAA 5HLGA 3SZGA 3CQZJ 1S3JA 4EVIA 5B1BH 2CW8A 4JQFA 4L5JA 4D0PA 1KQ9A 3QP6A 3K6GA 1TTYA 1ETVA 2E35A 3DPUA 2V6EA 2WV0A 4BH9A 4KFCA 1HDDC 1O4XA 3TEDA 3MAJA 2F5DA 2Z3YA 2NVTJ 3MCZA 5DEQA 1J2XA 4MEXF 4IPAA 2GOXB 1Y1VJ 2OF7A 3HSEA 1Z67A 2P81A 2XF7A 5L3CA 4KIGA 2B9SA 1RKTA 1YITI 1TT0A 3PQJA 1YJNI 3AG3H 4ZTFA 1A04A 2K85A 3JAMZ 3S3NA 3S3MA 2H8RA 2RVCA 4A3FJ 2RKHA 1S8NA 3BTCA 3F21A 4BDZA 4KICA 2OBPA 4HYEA 1ZK8A 3HRUA 2OTJI 2Y75A 3JRHA 1LEAA 2O0YA 4BY7J 2R7TA 1SC7A 2LY1A 3HTUA 3LSGA 5J6XA 5LBQA 4L0YB 1ETOA 1QNTA 4YFKF 2ZFUA 1LDKB 2JZYA 1DPRA 2JRMA 3KEOA 4XM3A 4F55A 1M1EB 3FMSA 4P55A 1TNSA 2QQBA 2VQCA 1L3LA 1G3YA 2LF8A 5GPAA 4BHCA 4ON0A 1AKHB 2NYXA 5HLHA 1XDSA 5DS9A 2EV6A 1K7AA 4RLFA 1FYMA 1Z9CA 5IYDJ 1VQ6I 2HWVA 2HNHA 2ZSHB 3T8RA 2FXAA 2P5KA 4O3MA 2LTPA 2R7OA 4U87A 3HOSA 3JSOA 4LK0F 2IVMA 4F3QA 4WF2A 3OSGA 1FLIA 2VE8A 4KT6A 3ROUA 2XRLA 3WTYC 1R9TJ 1B72A 2FBHA 5E1WA 3PNTA 3BY6A 2LVSA 2YU9J 5BOXA 4AWXB 4Z6YA 2ME0A 2G7UA 1ETWA 1VNDA 1UG0A 1EA3A 5K7ZA 3CTAA 4G7HF 1A6IA 2F4MB 5AIQA 1QPMA 4N4OB 4ABZA 3MQ0A 3LQRA 1V5GA 1VQKI 2NVXJ 3N97A 2CRGA 1BI2A 2XASA 3KLNA 5EGOB 2Z33A 1WJFA 1YW9A 3G71I 3MKLA 4B4CA 2VQHA 4XN3A 2DK5A 2STWA 2DCEA 2PI0A 1HSJA 3QYFA 3QRFF 3OMYA 3NRVA 2DA3A 2KZVA 3TOAA 3CO7C 4N0BA 4BE1A 1VQNI 2OCEA 3HUGA 2GIVA 2DFHA 2BW3B 2A5YB 1R58A 2M1BA 5FKKA 4BE2A 2X0LA 4F7ZA 5F0CA 4RB1A 1NK3P 1Z7UA 4ENKA 4BKXA 1BI1A 1U5TA 4MIMA 4K2EA 1NTCA 2GA2A 2CG4A 1KQ8A 2UV1A 2V1UA 4JYKA 3JTGA 4HEA2 2IA0A 3RPQA 4CH7A 3DPLC 3S8PA 4EJVA 2JK3A 4ZZLA 4AC0A 2W48A 3VEPA 4DZJA 3C2GA 1VQLI 5F64A 1R5ID 2IW5A 1KU7A 2H8WA 1IV6A 2VONA 2D1VA 1Y8QB 4RS8A 4I99C 3K4BA 3GZ5A 5KHDA 4WXHA 3FX3A 3ASNH 2NVUB 1ZHFA 3DTIA 4DYRA 3B02A 2H09A 4XKBA 1LB2A 4S0HB 4Z2YA 2BOLA 4CCKA 1MKMA 3K1NA 3R60A 3PSFA 4KIFA 1G59A 2ZFWA 4G7ZF 3FK6A 2L0KA 1XS9A 4A5MA 3NWTA 3SDGA 2W85A 1N77A 5H6QA 2E36A 2CO5A 4HNUA 3KLOA 3VSKA 3FHNA 3A1YA 2JWTA 3V7CA 5C44J 2E2HJ 1BR4A 2ZC2A 2EPFA 1FPQA 2A61A 1U2WA 2Y2ZA 4DNCA 2XPWA 2VQGA 2H94A 3QYEA 3L9FA 4RB0A 4UVBA 2OUMA 2MC4A 5FLMJ 5HLIA 3ZQHA 1OKRA 1MMGA 1WJBA 2ZBKA 3CP2A 3L2RA 3HJEA 4YIIA 3GTPJ 5KCMA 2R7SA 1BM9A 3KZIC 4ZYDA 1S7AA 1LFUP 2LC2A 5F0FA 1ZG1A 4C3HJ 3LSHA 1XSVA 1XC5A 1XGNA 2XAGA 4ZJZA 1VQ7I 2NNNA 1I3AA 4DW6A 1YIOA 3U1KA 1HOMA 4AIDA 3SXYA 2ETHA 5K5OA 2Y9ZA 4ZYAA 2AS5F 1ULYA 2QM3A 2EFQA 2DMUA 1CF7B 2MLGA 3I55I 2JMWA 5DM7F 2XKPA 3GTLJ 1JI8A 4Y33A 2HYGD 1AKHA 2GAUA 2G7HA 2W82A 2W7NA 1JKQC 5FLXK 3HSRA 4M3GA 3NEUA 1AOYA 4M73A 3S2WA 2CQXA 1WRJA 3ZQLA 1QA6A 3ASOH 1T6SA 1HQCA 3GTJJ 1H89C 1SVLA 1WVRA 1A36A 3I5UA 2EZHA 1VQ9I 3HOWJ 5FO5A 3RZDJ 2AXLA 2QEXI 3OYBA 3L2VA 3J80K 2DYRH 1OCRH 2Y0SA 3EYYA 4B3XA 1K6OA 4E7IA 4XMYA 3GFIA 4UY8I 3S3OA 1IRXA 2EIMH 3B6CA 2VUMJ 4LIVA 2VKHA 1G8XA 2VODA 1BW5A 5HS9A 2CW7A 2ZJRF 4YFXF 5HVQC 2MYSA 2RNJA 3WGHA 3AAFA 4G6TB 4EMSA 1X4OA 4AU7A 2HGCA 1R22A 5ICGA 1MMDA 5BS6A 3A0HC 3H36A 1HW1A 3PO3J 1JKPC 3T1BA 2BW3A 4Y4RA 4XSXF 3GTGJ 2HXIA 3L2WA 2R7WA 1WH7A 1TBXA 2EH3A 4XICA 1RUNA 1YRNB 4B44A 3FXRA 4XLPF 3ZCOA 2PBIA 3V42A 1Y6IA 3IAS2 3DU6A 1DGRM 1X3UA 1S5LC 2L9NA 2L3DA 1S7OA 1YHQI 2NOJB 2M45A 1P92A 3SQNA 3NQOA 2UZKA 2QWWA 4I09A 3QODA 1LE8B 2ISZA 5DCMA 3GWZA 2M0MA 2F5FA 3HKZN 4KN4X 1JGGA 2BY2A 4IKFA 3F22A 4OIOF 5H2FC 1XGOA 3G3ZA 2KRFA 4AYBA 5ICEA 3J7AY 9ANTA 2DAOA 2FSWA 3LL7A 5LGUA 4JK1X 4LOCA 2K27A 3HGGA 2E1MC 3SZPA 4LG0A 1K4SA 1D0YA 4II2A 3AFHA 3EYIA 1W5TA 1SAXA 5FKLA 3SJMA 3F8BA 3H0DA 2V26A 4IXAA 2L4MA 1DP7P 2O03A 5E8IA 5K5RA 2M8EA 3F9KA 2XF5A 5F04A 4RAYA 5DTDA 1SFKA 1MBEA 3BR3A 3ZQCA 2VBZA 2E1MB 4BBRJ 2FA5A 3HG9A 3CCQI 4A3JJ 1X3WB 2NVQJ 2WAFA 1R49A 4AVPA 1EV7A 4QPOA 1GV2A 1POGA 2GIZA 5JFRA 4BQAA 1FZPB 3SZTA 3ERED 4X0GA 1OMIA 1HA8A 4BJ6C 1IXCA 4BNCA 3A03A 3LOCA 4KMUX 3AKZA 3TW7A 3PIPF 2E19A 2OV7A 2XGXA 1F43A 1NHAA 2KIQA 5L3EA 2EFOA 1S6LA 2AO9A 1FOWA 2MG4A 3CF2A 3I3LA 3KCCA 5IYCJ 2EA2A 2X48A 4HF0A 3QU6A 3QQAA 3GX4X 1SMTA 3DBHB 5J4VA 4B43A 4KIBA 1CF7A 5EEGA 4OIPF 2FX0A 4A69C 3L2UA 1SFEA 4BE0A 1BJAA 3L00A 3TKYA 3LSPA 4AVZA 2HDCA 3KP5A 4L9JA 3OYEA 4OMYA 3RPUA 1H9GA 1D3YA 3O6BB 2QLZA 5B1AH 1XSXA 3RKWA 1T8IA 1V4RA 1JTYA 2GA1A 1YW8A 2VBYA 4MHGA 1CQTA 3UKGA 2FOKA 5C4XJ 5LRSA 5HS8A 4BHBA 4EGYA 4GYGA 3J7AO 2ZXJA 2OQGA 2WAQN 1BN5A 1GLNA 1IO2A 1XGSA 2K9SA 1DGWY 3CP8A 4MGRA 4YIFA 4ESBA 3GTQJ 1T98A 1MH4A 1GVJA 4QPQA 3G4SI 1AHDP 4LLNA 2K3PA 4NNJA 1G3TA 3FXJA 3GEZA 1D0ZA 3JRAA 1UFMA 2X1CA 1D0XA 2DK8A 2E1OA 5E8GA 5EG0B 2XROA 1ERDA 2XDVA 2ICWG 3S16J 1YYVA 4RGUA 1MBKA 3ZGKA 4Y17A 2L9RA 3HOYJ 1Z6TA 3S93A 1OCCH 5IYBJ 1WJCA 5FLVA 4Q5SF 2JVGA 1WI3A 3ULQB 3ZQGA 2A69F 2EZIA 3GLLA 2EV5A 2Y30A 4MFEA 4FE7A 1K83J 2LY9A 2LRDA 5F27A 3IHUA 1IN8A 2BGCA 1ETKA 3Q3SA 3UNGC 2EFWA 4CZCA 1NG7A 5EYRA 2DDAA 1SD4A 2RC4A 3F6VA 1K78B 2E5NA 2FE3A 2R7UA 4HLXA 2K5CA 3BLYA 2JVHA 2A6TA 4FT8A 1R4MB 3S15J 4XLEA 1WJAA 1W5CC 5LHIA 3OYIA 1G2HA 4M6VA 1GVDA 3FXKA 1LE8A 3TOBA 4KITB 2DPDA 1PUFB 3TL4X 1T95A 5JLWA 3J7ZI 3AL0C 1MDMB 1RNLA 4BXUA 1DU0A 2ECBA 3DEUA 1O3SA 5LLQA 4L9NA 4CZZA 1P2FA 2E1CA 3FISA 3HOZJ 1KONA 4IRIA 1QZYA 3PIOF 3GZ6A 1UJ8A 4CCJA 2D5VA 2XGCA 2HVRA 1WWXA 2DTZA 1EH6A 2HQRA 3AL0B 2XRNA 3HOXJ 4A3GJ 4OAZA 4PZJA 4NB5A 2BHYA 3KPHA 3TP3A 2LLKA 2ELJA 1MBJA 4M71A 1JXSA 4BY1J 1ZH5A 1TQMA 1WSUA 4G8XA 1TC3C 1AWCA 2VXZA 1IXRC 3H3VK 3W3CA 5JI6A 1VQMI 3H92A 4F92B 3ONQA 2V6CA 1L0OC 1I6XA 5CVJA 3KX2A 2JPCA 2UXXA 3GO5A 4HA8A 2XIGA 4Q47A 1RRJA 2K86A 1HBXG 3ZQIA 3A01A 3Q9VA 4QTRA 1JTXA 1ON2A 2F5VA 3RPUD 4LK1F 1I39A 5IOZA 1MMAA 1YW7A 2X6WA 3QWLA 5A2QK 3OYNA 4M3DA 3WTUC 4CCNA 4XRFA 2OCCH 2XAQA 3KP6A 1HXDA 2HOEA 5D4RA 3CMMA 3SEZA 2DO7A 3MD2A 3HDDA 2BYVE 2QSGX 4XOPA 1ZGAA 4OINF 4HBLA 2DT7B 4XSZF 3QOPA 3H1CA 3O8HA 1B9MA 1EKEA 4A93J 2FMLA 1TQPA 3JRFA 3W2AA 3ZXSA 5ILVA 3GXOA 4R79A 2Z9OA 1VF9A 5IOYA 1FBQA 4IVNA 4L9TA 1USSA 3MMYB 1JKOC 2PLYA 4BACA 1Y56A 1E3OC 5IP9J 2LH9A 3GW2A 2L7FP 2CWEA 1XN7A 2LKSA 4NUBA 3G2BA 5CKTA 1KU9A 1DP3A 2KFDA 2LMDA 1R5HA 3E3VA 4L5EA 2MH2A 2V79A 1C0WA 1P7JA 5TJJA 3CCJI 1IRZA 5F1RA 4A2UA 5E3NA 1ZYRF 1N75A 3FXUA 3H5NA 3ECOA 2O7OA 5CVVA 1MJBA 3P9IA 2DODA 3OS2A 3L2CA 4PJ0C 3JRGA 2MGQA 3CCVI 3IH3A 2ADUA 4IHWA 3CCEI 4MNUA 5E3OA 2EBIA 5BQTA 1ZARA 1IV8A 1TW2A 5EG0A 3TDZC 2K3FA 3GBGA 3OSFA 4J19A 3RJPA 2GQQA 5EEHA 1VQ8I 5B5EC 3F8MA 2HZTA 2NVYJ 1U3EM 1U9OA 1ON1A 3OIQA 4LLLA 2HYFA 2ISYA 4XORA 2XSJC 2IPQX 3K2ZA 5DYMA 2PMHA 3E5QA 2GXGA 2WA0A 3BG5A 4C30A 2IT0A 4C2MJ 3MFKA 3HB9A 3PUBA 4AIJA 1Z05A 2XB5A 4NDLA 4HLYA 2A05A 2TDXA 1K78A 2WADA 2NS8A 2W24A 3HM5A 3KZZA 4JBAA 4BJTA 3J7YJ 4N9HA 4TV7A 1ONVA 4HX8A 3OYCA 1IGNA 2Y0MA 4XIDA 3K4CA 4DYQA 1MJAA 2E5ZA 3S1RJ 4J00A 1F1ZA 1APLC 2A6HF
chains in the Genus database with same CATH topology
2JSCA 4WWCA 4HF1A 1P4XA 4IJAA 4P9UA 2ESNA 1QO0D 1MDMA 3HSFA 5CVRA 4RAZA 1IUYA 1HKQA 4U88A 1CGPA 5CVIA 3FHZA 3TO6A 1FT9A 3LA2A 2ACJA 2D2WA 2GZWA 2MC3A 5D5UB 2JPBA 3VOEA 2CYYA 1W5SA 3Q9SA 3VFZA 4UUVA 3SFZA 3BJOA 2YSRA 5CLSA 1IXSB 2YR2A 2P6SA 2IJLA 3IKTA 1FBSA 2BV6A 3KP4A 2CSOA 2DQLA 2QBYA 2Z99A 2RV8A 1PP8F 3L09A 2VE9A 3I59B 4RGXA 4KYWA 2RQPA 2M5WA 4QWQA 5JR3A 4L0ZB 4I01A 5F6FA 4AD9A 1I1GA 1GHCA 2HKOA 1FX7A 2KJBA 4B8XA 2QENA 3HRSA 2QVOA 3ZP5A 4EJUA 4LFUA 1IN7A 3REOA 3W6KB 4XBFA 2OA4A 5E18F 5DD8A 5ILSA 2QQ9A 3ZPLA 1BIAA 1YG2A 2HR3A 1REPC 5D8KB 3V8KA 2ZMEB 4CGZA 2KKOA 1E2XA 2NNYA 2M87A 3E6BA 1G3WA 1LJ9A 4GCVA 5D4SA 2LNBA 4LJZF 1YS6A 3DXJF 2V1XA 3HOTA 3R0JA 3GFJA 4YFNF 3C18A 3K1MA 2EA4A 3L7WA 2PQ8A 2CFXA 1R5GA 1Z1DA 3TDUC 2O6GE 4XLNF 1IW7F 4LLGF 1U8RA 3LFKA 3DKWA 4LD5A 3E97A 3ML6A 2XVCA 1XB4A 3FM5A 4M6YA 3QU3A 5DUIA 4G6QA 1YTYA 1JHHA 1FWZA 3WTXC 4KA4A 3OV8A 2A6EF 3GYHX 1WI9A 1TLHB 1W7PB 5FD6A 4U0WA 5DD4A 2W25A 1KU3A 2DLLA 1OR7A 1SD6A 4EM2A 5LGTA 4G7OF 2YPRA 3LWFA 3WTZA 2MH9A 1Y0UA 1XMKA 2RN7A 1LVAA 2DBBA 4I02A 4O5VA 5H6RA 4CHUA 1G4DA 2L4AA 1FSEA 1I5ZA 5AIPA 4IF4A 1HKSA 1YO5C 3WU1B 3I59A 2FNPA 4AIKA 1D8KA 3RYPA 3PQKA 1MJ9A 4Q4ZF 5HOOA 4PGGA 3EQLF 5D6EA 1SFUA 3F6OA 3V8JA 3P7NA 3MZHA 1FP1D 2XAHA 3COAC 1K79A 2XKOA 3VODA 3HRTA 3O3KA 3R4KA 4MQVA 1B1BA 4UXNA 3LAJA 3ZMDA 2E1NA 2CQKA 3ABTA 3E6CC 1RIOH 1UCRA 1R36A 1MGTA 2BBYA 3U9GA 2ZMEA 4G94A 1USTA 5FLXZ 5HDGA 3JW4A 1BC7C 2P5LC 1FOKA 2ELHA 3T5XA 1FP2A 2FMYA 4P96A 4OMZA 3U2RA 5IT3A 2YX7A 2K4BA 5HDNA 5CVUA 2O8XA 4ZH4F 1XSDA 2D1HA 3J80Z 1QGPA 2ZCWA 2BEOA 4RGSA 3KEQA 4HAMA 4ENNA 3I58A 2IP2A 4L5IA 1BBYA 3N4MA 1PDNC 3BOQA 4UV8A 4ETSA 3D5LA 3W6JB 2V1DA 2P8TA 3F8NA 3F3XA 2XAFA 2W57A 4I0AA 2IA2A 4PDKA 3E6MA 3LA7A 4I7HA 4MEYF 1XMAA 5LHHA 4I2OA 4L18B 3ZQ7A 2XHKA 2COMA 1EH7A 5FGMA 3GFLA 2L01A 1ZAOA 4HDVA 3BPVA 3FWEA 3ZMUA 1H0MA 2CGPA 2OZ6A 5IT9K 2K4JA 1J59A 3FF5A 1O3QA 3QP5A 3RYRA 1KQ0A 3P9CA 4KUMA 2EFPA 4L9VA 2PG4A 2QZ8A 1O3TA 3I4PA 2KJCA 4YG2F 3K1PA 1ZLKA 1IZ1A 2J5PA 4RGRA 1ZGJA 2JTVA 4A6EA 1P4WA 1FSHA 2X4HA 4E70A 3IKVA 4HX4A 3RIRA 5ICFA 2VBWA 4PCQA 3KP7A 2BE5F 2ZNYA 4IHSA 5FFXA 4KNYA 5JVTA 3WODF 4HZFA 5BMZA 1FBUA 1BOAA 2P4WA 3BDDA 1IN5A 3IRQA 1J5YA 2P7CB 1U6GA 4A12A 1FY7A 3IC7A 3J81K 3M7GA 4ESJA 1P4AA 3WE2A 4CO8A 4LMYA 1ZRCA 2FRHA 2KIMA 2GXBA 4U7DA 3CJNA 4GXOA 3CO6C 4Y15A 2HS5A 3F72A 2B0LA 2IA1A 4Y13A 3H3ZA 1F5TA 2A07F 1YS7A 1W4MA 3K9TA 5L3GA 1Z6RA 2EV0A 3V4GA 1GXPA 2ZKZA 4CYDA 3GUDA 3ABUA 1P6RA 4Q48A 1KYZA 4HV5A 3KE2A 3SHFA 4GGGA 4ENMA 5LEJA 5D6FA 1Q1HA 4U0VA 4UV9A 2A68F 4KT5C 2DU9A 3HHGA 2RDPA 3KETA 3EETA 2YU3A 4UVCA 5KVRA 3RTRA 1U78A 3JAMK 2EFNA 3QPTA 3R61A 1U5TB 3M8FA 1O3RA 2OU2A 1T38A 1XCVA 4NHJA 5LEKA 3BWGA 1IN6A 1TW3A 5K1YA 3I53A 5A2QZ 4WX9A 2FQ3A 4FX4A 2F2EA 3LAPA 4ZYEA 1JHFA 1BI0A 3ELKA 1BC8C 1G3SA 2XAJA 5FFZA 1F4KA 2KIUA 3F8FA 3I0TA 4ASNA 2EK5A 3MZYA 1ZRDA 5D8LB 4EQQA 5ED4A 2DQRA 1IN4A 2Q0OA 1LNWA 4P9FA 1HW5A 4S05A 1YFHA 1J0RA 1SD7A 4M9ZA 2UXNA 3RKXA 3TO9A 2VN2A 1Z91A 2LF7A 2H27A 3KP3A 3P9KA 4WK8F 1YLFA 5E17F 3BZ6A 4O6JA 3MWMA 3Q5FA 3DQVC 1H9TA 3K69A 4ZYHA 4EJTA 4WCGA 1ZLJA 3FMQA 2J5OA 1FC3A 1LDDA 1FYKA 4IHTA 2RGVA 3B73A 4S04A 5JHUA 5ERIA 3ZN0A 2CW0F 2KIFA 1LQ1A 1UB9A 1OYWA 1SFXA 2DPUA 1B9NA 4I98B 4PGHA 2VT3A 2VOOA 2WC2A 2Z5UA 1OYIA 3CUQC 1VTNC 4UVAA 2NRAC 3U1DA 1OPCA 4RB2C 3ZMZA 3WTVC 3WGGA 4GO1A 5L3DA 3I71A 3OOPA 3CUQB 2M30A 2ZO4A 1JGSA 4BAYA 2VC0A 5CYVA 5HS7A 5DCMB 5L3FA 3C7JA 3JTHA 3PFIA 1DPUA 1OYYA 1UHWA 1RZ4A 1O57A 3HIFA 2MD5A 2FU4A 4HW0A 3WU0A 4LB5A 2FBKA 2ZNZA 2O61A 4R1HA 4LG0B 3ZMSA 1R1VA 1PUEE 2EB7A 2NS0A 3I54A 5ICCA 1DUXC 5KK1A 1R1UA 1WQ2A 2LKPA 1J9IA 2O3FA 3GF2A 1J7KA 4FX0A 5D5VB 2E7WA 2HTSA 3RKYA 5J8FA 2UWMA 1RI7A 2HFHA 2YX4A 3WG9A 5E1ZB 1UHMA 5DCFA 4M74A 2VT2A 2R3SA 5AONA 1HW2A 2OQRA 4LGWA 4DQ2A 4ENJA 1JE8A 4I0BA 4M9SA 4UNOA 2ESHA 4KMFA 3IL2A 4HOBA 1D5VA 3BJAA 3GLXA 1T0FA 2Y48A 5D5XB 4A0YA 1S29A 3CUOA 1ZN2A 3KP2A 4UHTA 2FNAA 3FMRA 1IRFA 3DF8A 4BHPA 3DP7A 4WXCA 1GXQA 3E6DA 2W84A 1DDNA 3M1EA 3IWZA 2LDUA 2NAZA 3C3WA 4HQEA 1T2KA 1QQIA 3BP8A 5E1XA 3TO7A 3CUQA 1IF1A 2HKXA 1B4AA 1BIBA 1XCBA 2OZUA 2FF4A 1R1TA 5BPIA 2EJRA 1G6NA 1PP7U 1ZG3A 2Q2EA 1FNNA 3R6SA 3FZVA 5H20A 1QZZA 1LEBA 2H6BA 4U7BA 1KA8A 2VBXA 3F23A 5DUKA 2XV4S 2DI3A 4FHTA 4MQ9F 4KDPA 3ECHA 2H6CA 2Q8KA 2FBIA 5LGNA 3IRRA 4HF2A 3BJ6A 3HYIA 1YQAA 2LSOA 4HV6A 5L3BA 3QAHA 4GYIA 2QYOA 1R23A 4EM0B 1IRGA 4OU0A 3GVAA 3BPXA 5FD5A 1W7PA 3BROA 4CICA 4M9XA 1HSTA 1B6AA 3V7RA 1SD5A 4MTEA 2JT1A 3ISPA 1XGMA 1ZREA 4A0XA 5LRRA 3M8EA 2HQNA 2MBFA 3MEXA 3KFWX 2E7XA 2PJPA 2R7DA 3ZMTA 4OIRF 3K0LA 3EDPA 1J75A 4ZYGA 2IRFG 3FM3A 2HTJA 4HDUA 2G9WA 5K5QA 5FB2A 5DV5A 4QLCU 3WE3A 1FYLA 3R0AA 4ZZDA 4EJWA 2DT5A 1XDUA 1O7FA 3G73A 5HDKA 3ZN1A 3HHHA 4EJOA 5ILUA 2V9VA 2VC1A 1SMYF 1R00A 4HQMA 5J8CA 3VB2A 1MD0A 3T0YA 3WGIA 3D0SA 1B59A 4CDGA 1RUOA 1I27A 2HEOA 3TGNA 2EWNA 5LHGA 1TNTA 1TQIA 3WTWC 1T39A 4N9IA 4R8HA 1R7JA 3V8LA 4IRHA 3V7SA 2A3SA 2P7VB 1KU2A 2OD5A 3ZMVA 1STZA 3DFGA 3E5UA 1KYWA 4BYYA 2F5CA 2ZJ2A 5BPDA 3C1DA 5IT9Z 1E17A 3HRMA 1F9NA 1D8JA 1KGSA 2PEXA 2DFIA 2DTRA 3CDHA 4M6XA 1W7PD 3WTTC 4IRGA 3RI4A 2QUFA 2MLKA 1MZBA 3RDIA 3KZYA 1LDJA 2R7FA 1XD7A 3LA3A 4RB3C 2FEZA 2PFBA 3LQQA 2PN6A 2GWRA 3F8CA 4H0EA 1IAWA 3T8TA 2C6YA 3TQNA 3DV8A 4P5OA 4HX7A 1QBJA 1O7LA 2PMUA 3HTSB 1HKTA 4OIQF 4AIHA 4KN7X 2L02A 2K02A 2QBYB 4WXDA 4A6DA 1ODDA 3FXQA 3EUHA 6PAXA 4EM1A 2DW4A 1EH8A 2WWYA 2P6TA 2K7LA 3QPHA 3IWFA 3E5XA 5TRDA 4U0YA 1ZG5A 4B09A 4LB6B 2F5EA 1U5TC 4G6DA 3LSTA 3JSPA 2XUBA 3O2PE 4M72A 4ESFA 3J81Z 4NQWA 2VOPA 4EGZA 2MA3A 1I1SA 1WKMA 5D5WB 4CXFA 3CLOA 4G9YA 2D45A 3WTSC 2JRTA 2L54A 2WTEA 5DDGA 2QQAA 3I64A 4MTDA 1ZRFA 2OAZA 1BI3A 4EV0A 4A5NA 3M9AA 2P5VA 5E20A 3H3UA 3DPTA 2STTA 1V3FA 4A0ZA 5CJ9A 4OOIA 3GFMA 5HLGA 1S3JA 4EVIA 4JQFA 4D0PA 4L5JA 1KQ9A 3QP6A 1TTYA 2WV0A 4BH9A 4KFCA 3MAJA 2F5DA 2Z3YA 3MCZA 5DEQA 1J2XA 4MEXF 4IPAA 3HSEA 5L3CA 4KIGA 3PQJA 1A04A 3JAMZ 2RVCA 2RKHA 1S8NA 3F21A 4KICA 2OBPA 4HYEA 3HRUA 2Y75A 1LEAA 2O0YA 3HTUA 5J6XA 5LBQA 4L0YB 1QNTA 4YFKF 1LDKB 2JZYA 1DPRA 3KEOA 3FMSA 4P55A 1TNSA 2QQBA 1L3LA 1G3YA 2LF8A 4BHCA 4ON0A 2NYXA 5HLHA 1XDSA 1K7AA 2EV6A 1FYMA 1Z9CA 2HWVA 3T8RA 2FXAA 2P5KA 4O3MA 3HOSA 3JSOA 4LK0F 2IVMA 4WF2A 1FLIA 2VE8A 3ROUA 3WTYC 2FBHA 5E1WA 3BY6A 5BOXA 4AWXB 2G7UA 3CTAA 4G7HF 5AIQA 1QPMA 3MQ0A 3LQRA 3N97A 2XASA 1BI2A 3KLNA 2Z33A 1YW9A 2DK5A 2STWA 2PI0A 1HSJA 3QRFF 3NRVA 3TOAA 3CO7C 4N0BA 3HUGA 2GIVA 2A5YB 1R58A 2M1BA 2X0LA 4F7ZA 4RB1A 1Z7UA 4ENKA 1BI1A 1U5TA 4K2EA 2GA2A 2CG4A 1KQ8A 2V1UA 3JTGA 2IA0A 3RPQA 3DPLC 4EJVA 4ZZLA 3VEPA 5F64A 2IW5A 1KU7A 2VONA 2D1VA 4RS8A 3GZ5A 4WXHA 3FX3A 1ZHFA 3B02A 2H09A 1LB2A 4Z2YA 1MKMA 3K1NA 3R60A 4KIFA 2ZFWA 4G7ZF 4A5MA 2W85A 5H6QA 2CO5A 3KLOA 3V7CA 1FPQA 2A61A 1U2WA 4DNCA 2H94A 3L9FA 4RB0A 4UVBA 5HLIA 1OKRA 2ZBKA 4YIIA 1BM9A 4ZYDA 1S7AA 1ZG1A 1XSVA 2XAGA 1XGNA 2NNNA 1YIOA 3SXYA 2ETHA 5K5OA 2AS5F 1ULYA 2QM3A 2EFQA 1CF7B 2MLGA 2XKPA 2HYGD 2GAUA 2G7HA 5FLXK 3HSRA 3NEUA 1AOYA 4M73A 3S2WA 1WRJA 1T6SA 1HQCA 3I5UA 5FO5A 2AXLA 3J80K 3EYYA 1K6OA 3GFIA 2VODA 5HS9A 4YFXF 5HVQC 2RNJA 3WGHA 3AAFA 4EMSA 2HGCA 1R22A 5ICGA 5BS6A 1HW1A 3T1BA 4XSXF 1TBXA 1RUNA 3FXRA 4XLPF 2PBIA 1X3UA 2L3DA 1S7OA 2M45A 1P92A 3SQNA 3NQOA 2UZKA 2QWWA 4I09A 2ISZA 5DCMA 3GWZA 2F5FA 4KN4X 3F22A 4OIOF 1XGOA 3G3ZA 2KRFA 5ICEA 2DAOA 2FSWA 5LGUA 4JK1X 2K27A 3SZPA 4LG0A 3EYIA 1W5TA 1SAXA 3F8BA 4IXAA 2L4MA 1DP7P 2O03A 5E8IA 5K5RA 2M8EA 4RAYA 2VBZA 2FA5A 4AVPA 1EV7A 5JFRA 4BQAA 1FZPB 3SZTA 3ERED 1OMIA 1IXCA 4BNCA 4KMUX 2XGXA 1NHAA 5L3EA 2EFOA 1S6LA 3KCCA 2EA2A 4HF0A 3QU6A 3GX4X 1SMTA 4KIBA 1CF7A 5EEGA 4OIPF 1SFEA 1BJAA 3L00A 3TKYA 2HDCA 3KP5A 4L9JA 4OMYA 3RPUA 1H9GA 1D3YA 3O6BB 2QLZA 1XSXA 3RKWA 1V4RA 2GA1A 1YW8A 2VBYA 4MHGA 2FOKA 5LRSA 5HS8A 4BHBA 4EGYA 4GYGA 3J7AO 2ZXJA 2OQGA 1BN5A 1XGSA 4MGRA 4YIFA 4ESBA 1T98A 1GVJA 4LLNA 1G3TA 3GEZA 1UFMA 2DK8A 5E8GA 2XROA 1YYVA 4RGUA 4Y17A 1Z6TA 4Q5SF 3ULQB 2A69F 2EV5A 3IHUA 1IN8A 2BGCA 2EFWA 1K78B 2RC4A 1SD4A 3F6VA 2FE3A 4HLXA 4FT8A 5LHIA 3TOBA 2DPDA 1MDMB 1RNLA 4BXUA 3DEUA 1O3SA 5LLQA 4L9NA 4CZZA 1P2FA 2E1CA 4IRIA 1QZYA 3GZ6A 1WWXA 1EH6A 2HQRA 2XRNA 4PZJA 4NB5A 4M71A 1JXSA 1ZH5A 1TQMA 1WSUA 4G8XA 1AWCA 2VXZA 1IXRC 5JI6A 3H92A 2V6CA 1L0OC 1I6XA 5CVJA 2JPCA 2UXXA 3GO5A 4HA8A 2XIGA 4Q47A 2K86A 1HBXG 3Q9VA 1ON2A 4LK1F 1YW7A 5A2QK 3WTUC 4XRFA 2XAQA 3KP6A 1HXDA 2HOEA 5D4RA 2DO7A 2BYVE 1ZGAA 4OINF 4HBLA 4XSZF 3QOPA 1B9MA 2FMLA 1TQPA 5ILVA 3GXOA 4R79A 2Z9OA 1FBQA 4IVNA 4L9TA 1USSA 2PLYA 3GW2A 2CWEA 1XN7A 1KU9A 1R5HA 3E3VA 2MH2A 2V79A 1C0WA 5TJJA 5F1RA 4A2UA 1ZYRF 3FXUA 3ECOA 5CVVA 1MJBA 3P9IA 3L2CA 2ADUA 4MNUA 5BQTA 1ZARA 1TW2A 3TDZC 3RJPA 2GQQA 5EEHA 3F8MA 2HZTA 1U3EM 1ON1A 4LLLA 2HYFA 2ISYA 2IPQX 3K2ZA 5DYMA 2PMHA 3E5QA 2GXGA 2IT0A 3MFKA 4AIJA 1Z05A 4HLYA 2TDXA 1K78A 3KZZA 2W24A 4JBAA 4N9HA 4TV7A 1ONVA 4HX8A 2Y0MA 1MJAA 1F1ZA 2A6HF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JSC A;  4WWC A;  4HF1 A;  1P4X A;  4IJA A;  4P9U A;  2ESN A;  1QO0 D;  1MDM A;  3HSF A;  5CVR A;  4RAZ A;  1IUY A;  1HKQ A;  4U88 A;  1CGP A;  5CVI A;  3FHZ A;  3TO6 A;  1FT9 A;  3LA2 A;  2ACJ A;  2D2W A;  2GZW A;  2MC3 A;  5D5U B;  2JPB A;  3VOE A;  2CYY A;  1W5S A;  3Q9S A;  3VFZ A;  4UUV A;  3SFZ A;  3BJO A;  2YSR A;  5CLS A;  1IXS B;  2YR2 A;  2P6S A;  2IJL A;  3IKT A;  1FBS A;  2BV6 A;  3KP4 A;  2CSO A;  2DQL A;  2QBY A;  2Z99 A;  2RV8 A;  1PP8 F;  3L09 A;  2VE9 A;  3I59 B;  4RGX A;  4KYW A;  2RQP A;  2M5W A;  4QWQ A;  5JR3 A;  4L0Z B;  4I01 A;  5F6F A;  4AD9 A;  1I1G A;  1GHC A;  2HKO A;  1FX7 A;  2KJB A;  4B8X A;  2QEN A;  3HRS A;  2QVO A;  3ZP5 A;  4EJU A;  4LFU A;  1IN7 A;  3REO A;  3W6K B;  4XBF A;  2OA4 A;  5E18 F;  5DD8 A;  5ILS A;  2QQ9 A;  3ZPL A;  1BIA A;  1YG2 A;  2HR3 A;  1REP C;  5D8K B;  3V8K A;  2ZME B;  4CGZ A;  2KKO A;  1E2X A;  2NNY A;  2M87 A;  3E6B A;  1G3W A;  1LJ9 A;  4GCV A;  5D4S A;  2LNB A;  4LJZ F;  1YS6 A;  3DXJ F;  2V1X A;  3HOT A;  3R0J A;  3GFJ A;  4YFN F;  3C18 A;  3K1M A;  2EA4 A;  3L7W A;  2PQ8 A;  2CFX A;  1R5G A;  1Z1D A;  3TDU C;  2O6G E;  4XLN F;  1IW7 F;  4LLG F;  1U8R A;  3LFK A;  3DKW A;  4LD5 A;  3E97 A;  3ML6 A;  2XVC A;  1XB4 A;  3FM5 A;  4M6Y A;  3QU3 A;  5DUI A;  4G6Q A;  1YTY A;  1JHH A;  1FWZ A;  3WTX C;  4KA4 A;  3OV8 A;  2A6E F;  3GYH X;  1WI9 A;  1TLH B;  1W7P B;  5FD6 A;  4U0W A;  5DD4 A;  2W25 A;  1KU3 A;  2DLL A;  1OR7 A;  1SD6 A;  4EM2 A;  5LGT A;  4G7O F;  2YPR A;  3LWF A;  3WTZ A;  2MH9 A;  1Y0U A;  1XMK A;  2RN7 A;  1LVA A;  2DBB A;  4I02 A;  4O5V A;  5H6R A;  4CHU A;  1G4D A;  2L4A A;  1FSE A;  1I5Z A;  5AIP A;  4IF4 A;  1HKS A;  1YO5 C;  3WU1 B;  3I59 A;  2FNP A;  4AIK A;  1D8K A;  3RYP A;  3PQK A;  1MJ9 A;  4Q4Z F;  5HOO A;  4PGG A;  3EQL F;  5D6E A;  1SFU A;  3F6O A;  3V8J A;  3P7N A;  3MZH A;  1FP1 D;  2XAH A;  3COA C;  1K79 A;  2XKO A;  3VOD A;  3HRT A;  3O3K A;  3R4K A;  4MQV A;  1B1B A;  4UXN A;  3LAJ A;  3ZMD A;  2E1N A;  2CQK A;  3ABT A;  3E6C C;  1RIO H;  1UCR A;  1R36 A;  1MGT A;  2BBY A;  3U9G A;  2ZME A;  4G94 A;  1UST A;  5FLX Z;  5HDG A;  3JW4 A;  1BC7 C;  2P5L C;  1FOK A;  2ELH A;  3T5X A;  1FP2 A;  2FMY A;  4P96 A;  4OMZ A;  3U2R A;  5IT3 A;  2YX7 A;  2K4B A;  5HDN A;  5CVU A;  2O8X A;  4ZH4 F;  1XSD A;  2D1H A;  3J80 Z;  1QGP A;  2ZCW A;  2BEO A;  4RGS A;  3KEQ A;  4HAM A;  4ENN A;  3I58 A;  2IP2 A;  4L5I A;  1BBY A;  3N4M A;  1PDN C;  3BOQ A;  4UV8 A;  4ETS A;  3D5L A;  3W6J B;  2V1D A;  2P8T A;  3F8N A;  3F3X A;  2XAF A;  2W57 A;  4I0A A;  2IA2 A;  4PDK A;  3E6M A;  3LA7 A;  4I7H A;  4MEY F;  1XMA A;  5LHH A;  4I2O A;  4L18 B;  3ZQ7 A;  2XHK A;  2COM A;  1EH7 A;  5FGM A;  3GFL A;  2L01 A;  1ZAO A;  4HDV A;  3BPV A;  3FWE A;  3ZMU A;  1H0M A;  2CGP A;  2OZ6 A;  5IT9 K;  2K4J A;  1J59 A;  3FF5 A;  1O3Q A;  3QP5 A;  3RYR A;  1KQ0 A;  3P9C A;  4KUM A;  2EFP A;  4L9V A;  2PG4 A;  2QZ8 A;  1O3T A;  3I4P A;  2KJC A;  4YG2 F;  3K1P A;  1ZLK A;  1IZ1 A;  2J5P A;  4RGR A;  1ZGJ A;  2JTV A;  4A6E A;  1P4W A;  1FSH A;  2X4H A;  4E70 A;  3IKV A;  4HX4 A;  3RIR A;  5ICF A;  2VBW A;  4PCQ A;  3KP7 A;  2BE5 F;  2ZNY A;  4IHS A;  5FFX A;  4KNY A;  5JVT A;  3WOD F;  4HZF A;  5BMZ A;  1FBU A;  1BOA A;  2P4W A;  3BDD A;  1IN5 A;  3IRQ A;  1J5Y A;  2P7C B;  1U6G A;  4A12 A;  1FY7 A;  3IC7 A;  3J81 K;  3M7G A;  4ESJ A;  1P4A A;  3WE2 A;  4CO8 A;  4LMY A;  1ZRC A;  2FRH A;  2KIM A;  2GXB A;  4U7D A;  3CJN A;  4GXO A;  3CO6 C;  4Y15 A;  2HS5 A;  3F72 A;  2B0L A;  2IA1 A;  4Y13 A;  3H3Z A;  1F5T A;  2A07 F;  1YS7 A;  1W4M A;  3K9T A;  5L3G A;  1Z6R A;  2EV0 A;  3V4G A;  1GXP A;  2ZKZ A;  4CYD A;  3GUD A;  3ABU A;  1P6R A;  4Q48 A;  1KYZ A;  4HV5 A;  3KE2 A;  3SHF A;  4GGG A;  4ENM A;  5LEJ A;  5D6F A;  1Q1H A;  4U0V A;  4UV9 A;  2A68 F;  4KT5 C;  2DU9 A;  3HHG A;  2RDP A;  3KET A;  3EET A;  2YU3 A;  4UVC A;  5KVR A;  3RTR A;  1U78 A;  3JAM K;  2EFN A;  3QPT A;  3R61 A;  1U5T B;  3M8F A;  1O3R A;  2OU2 A;  1T38 A;  1XCV A;  4NHJ A;  5LEK A;  3BWG A;  1IN6 A;  1TW3 A;  5K1Y A;  3I53 A;  5A2Q Z;  4WX9 A;  2FQ3 A;  4FX4 A;  2F2E A;  3LAP A;  4ZYE A;  1JHF A;  1BI0 A;  3ELK A;  1BC8 C;  1G3S A;  2XAJ A;  5FFZ A;  1F4K A;  2KIU A;  3F8F A;  3I0T A;  4ASN A;  2EK5 A;  3MZY A;  1ZRD A;  5D8L B;  4EQQ A;  5ED4 A;  2DQR A;  1IN4 A;  2Q0O A;  1LNW A;  4P9F A;  1HW5 A;  4S05 A;  1YFH A;  1J0R A;  1SD7 A;  4M9Z A;  2UXN A;  3RKX A;  3TO9 A;  2VN2 A;  1Z91 A;  2LF7 A;  2H27 A;  3KP3 A;  3P9K A;  4WK8 F;  1YLF A;  5E17 F;  3BZ6 A;  4O6J A;  3MWM A;  3Q5F A;  3DQV C;  1H9T A;  3K69 A;  4ZYH A;  4EJT A;  4WCG A;  1ZLJ A;  3FMQ A;  2J5O A;  1FC3 A;  1LDD A;  1FYK A;  4IHT A;  2RGV A;  3B73 A;  4S04 A;  5JHU A;  5ERI A;  3ZN0 A;  2CW0 F;  2KIF A;  1LQ1 A;  1UB9 A;  1OYW A;  1SFX A;  2DPU A;  1B9N A;  4I98 B;  4PGH A;  2VT3 A;  2VOO A;  2WC2 A;  2Z5U A;  1OYI A;  3CUQ C;  1VTN C;  4UVA A;  2NRA C;  3U1D A;  1OPC A;  4RB2 C;  3ZMZ A;  3WTV C;  3WGG A;  4GO1 A;  5L3D A;  3I71 A;  3OOP A;  3CUQ B;  2M30 A;  2ZO4 A;  1JGS A;  4BAY A;  2VC0 A;  5CYV A;  5HS7 A;  5DCM B;  5L3F A;  3C7J A;  3JTH A;  3PFI A;  1DPU A;  1OYY A;  1UHW A;  1RZ4 A;  1O57 A;  3HIF A;  2MD5 A;  2FU4 A;  4HW0 A;  3WU0 A;  4LB5 A;  2FBK A;  2ZNZ A;  2O61 A;  4R1H A;  4LG0 B;  3ZMS A;  1R1V A;  1PUE E;  2EB7 A;  2NS0 A;  3I54 A;  5ICC A;  1DUX C;  5KK1 A;  1R1U A;  1WQ2 A;  2LKP A;  1J9I A;  2O3F A;  3GF2 A;  1J7K A;  4FX0 A;  5D5V B;  2E7W A;  2HTS A;  3RKY A;  5J8F A;  2UWM A;  1RI7 A;  2HFH A;  2YX4 A;  3WG9 A;  5E1Z B;  1UHM A;  5DCF A;  4M74 A;  2VT2 A;  2R3S A;  5AON A;  1HW2 A;  2OQR A;  4LGW A;  4DQ2 A;  4ENJ A;  1JE8 A;  4I0B A;  4M9S A;  4UNO A;  2ESH A;  4KMF A;  3IL2 A;  4HOB A;  1D5V A;  3BJA A;  3GLX A;  1T0F A;  2Y48 A;  5D5X B;  4A0Y A;  1S29 A;  3CUO A;  1ZN2 A;  3KP2 A;  4UHT A;  2FNA A;  3FMR A;  1IRF A;  3DF8 A;  4BHP A;  3DP7 A;  4WXC A;  1GXQ A;  3E6D A;  2W84 A;  1DDN A;  3M1E A;  3IWZ A;  2LDU A;  2NAZ A;  3C3W A;  4HQE A;  1T2K A;  1QQI A;  3BP8 A;  5E1X A;  3TO7 A;  3CUQ A;  1IF1 A;  2HKX A;  1B4A A;  1BIB A;  1XCB A;  2OZU A;  2FF4 A;  1R1T A;  5BPI A;  2EJR A;  1G6N A;  1PP7 U;  1ZG3 A;  2Q2E A;  1FNN A;  3R6S A;  3FZV A;  5H20 A;  1QZZ A;  1LEB A;  2H6B A;  4U7B A;  1KA8 A;  2VBX A;  3F23 A;  5DUK A;  2XV4 S;  2DI3 A;  4FHT A;  4MQ9 F;  4KDP A;  3ECH A;  2H6C A;  2Q8K A;  2FBI A;  5LGN A;  3IRR A;  4HF2 A;  3BJ6 A;  3HYI A;  1YQA A;  2LSO A;  4HV6 A;  5L3B A;  3QAH A;  4GYI A;  2QYO A;  1R23 A;  4EM0 B;  1IRG A;  4OU0 A;  3GVA A;  3BPX A;  5FD5 A;  1W7P A;  3BRO A;  4CIC A;  4M9X A;  1HST A;  1B6A A;  3V7R A;  1SD5 A;  4MTE A;  2JT1 A;  3ISP A;  1XGM A;  1ZRE A;  4A0X A;  5LRR A;  3M8E A;  2HQN A;  2MBF A;  3MEX A;  3KFW X;  2E7X A;  2PJP A;  2R7D A;  3ZMT A;  4OIR F;  3K0L A;  3EDP A;  1J75 A;  4ZYG A;  2IRF G;  3FM3 A;  2HTJ A;  4HDU A;  2G9W A;  5K5Q A;  5FB2 A;  5DV5 A;  4QLC U;  3WE3 A;  1FYL A;  3R0A A;  4ZZD A;  4EJW A;  2DT5 A;  1XDU A;  1O7F A;  3G73 A;  5HDK A;  3ZN1 A;  3HHH A;  4EJO A;  5ILU A;  2V9V A;  2VC1 A;  1SMY F;  1R00 A;  4HQM A;  5J8C A;  3VB2 A;  1MD0 A;  3T0Y A;  3WGI A;  3D0S A;  1B59 A;  4CDG A;  1RUO A;  1I27 A;  2HEO A;  3TGN A;  2EWN A;  5LHG A;  1TNT A;  1TQI A;  3WTW C;  1T39 A;  4N9I A;  4R8H A;  1R7J A;  3V8L A;  4IRH A;  3V7S A;  2A3S A;  2P7V B;  1KU2 A;  2OD5 A;  3ZMV A;  1STZ A;  3DFG A;  3E5U A;  1KYW A;  4BYY A;  2F5C A;  2ZJ2 A;  5BPD A;  3C1D A;  5IT9 Z;  1E17 A;  3HRM A;  1F9N A;  1D8J A;  1KGS A;  2PEX A;  2DFI A;  2DTR A;  3CDH A;  4M6X A;  1W7P D;  3WTT C;  4IRG A;  3RI4 A;  2QUF A;  2MLK A;  1MZB A;  3RDI A;  3KZY A;  1LDJ A;  2R7F A;  1XD7 A;  3LA3 A;  4RB3 C;  2FEZ A;  2PFB A;  3LQQ A;  2PN6 A;  2GWR A;  3F8C A;  4H0E A;  1IAW A;  3T8T A;  2C6Y A;  3TQN A;  3DV8 A;  4P5O A;  4HX7 A;  1QBJ A;  1O7L A;  2PMU A;  3HTS B;  1HKT A;  4OIQ F;  4AIH A;  4KN7 X;  2L02 A;  2K02 A;  2QBY B;  4WXD A;  4A6D A;  1ODD A;  3FXQ A;  3EUH A;  6PAX A;  4EM1 A;  2DW4 A;  1EH8 A;  2WWY A;  2P6T A;  2K7L A;  3QPH A;  3IWF A;  3E5X A;  5TRD A;  4U0Y A;  1ZG5 A;  4B09 A;  4LB6 B;  2F5E A;  1U5T C;  4G6D A;  3LST A;  3JSP A;  2XUB A;  3O2P E;  4M72 A;  4ESF A;  3J81 Z;  4NQW A;  2VOP A;  4EGZ A;  2MA3 A;  1I1S A;  1WKM A;  5D5W B;  4CXF A;  3CLO A;  4G9Y A;  2D45 A;  3WTS C;  2JRT A;  2L54 A;  2WTE A;  5DDG A;  2QQA A;  3I64 A;  4MTD A;  1ZRF A;  2OAZ A;  1BI3 A;  4EV0 A;  4A5N A;  3M9A A;  2P5V A;  5E20 A;  3H3U A;  3DPT A;  2STT A;  1V3F A;  4A0Z A;  5CJ9 A;  4OOI A;  3GFM A;  5HLG A;  1S3J A;  4EVI A;  4JQF A;  4D0P A;  4L5J A;  1KQ9 A;  3QP6 A;  1TTY A;  2WV0 A;  4BH9 A;  4KFC A;  3MAJ A;  2F5D A;  2Z3Y A;  3MCZ A;  5DEQ A;  1J2X A;  4MEX F;  4IPA A;  3HSE A;  5L3C A;  4KIG A;  3PQJ A;  1A04 A;  3JAM Z;  2RVC A;  2RKH A;  1S8N A;  3F21 A;  4KIC A;  2OBP A;  4HYE A;  3HRU A;  2Y75 A;  1LEA A;  2O0Y A;  3HTU A;  5J6X A;  5LBQ A;  4L0Y B;  1QNT A;  4YFK F;  1LDK B;  2JZY A;  1DPR A;  3KEO A;  3FMS A;  4P55 A;  1TNS A;  2QQB A;  1L3L A;  1G3Y A;  2LF8 A;  4BHC A;  4ON0 A;  2NYX A;  5HLH A;  1XDS A;  1K7A A;  2EV6 A;  1FYM A;  1Z9C A;  2HWV A;  3T8R A;  2FXA A;  2P5K A;  4O3M A;  3HOS A;  3JSO A;  4LK0 F;  2IVM A;  4WF2 A;  1FLI A;  2VE8 A;  3ROU A;  3WTY C;  2FBH A;  5E1W A;  3BY6 A;  5BOX A;  4AWX B;  2G7U A;  3CTA A;  4G7H F;  5AIQ A;  1QPM A;  3MQ0 A;  3LQR A;  3N97 A;  2XAS A;  1BI2 A;  3KLN A;  2Z33 A;  1YW9 A;  2DK5 A;  2STW A;  2PI0 A;  1HSJ A;  3QRF F;  3NRV A;  3TOA A;  3CO7 C;  4N0B A;  3HUG A;  2GIV A;  2A5Y B;  1R58 A;  2M1B A;  2X0L A;  4F7Z A;  4RB1 A;  1Z7U A;  4ENK A;  1BI1 A;  1U5T A;  4K2E A;  2GA2 A;  2CG4 A;  1KQ8 A;  2V1U A;  3JTG A;  2IA0 A;  3RPQ A;  3DPL C;  4EJV A;  4ZZL A;  3VEP A;  5F64 A;  2IW5 A;  1KU7 A;  2VON A;  2D1V A;  4RS8 A;  3GZ5 A;  4WXH A;  3FX3 A;  1ZHF A;  3B02 A;  2H09 A;  1LB2 A;  4Z2Y A;  1MKM A;  3K1N A;  3R60 A;  4KIF A;  2ZFW A;  4G7Z F;  4A5M A;  2W85 A;  5H6Q A;  2CO5 A;  3KLO A;  3V7C A;  1FPQ A;  2A61 A;  1U2W A;  4DNC A;  2H94 A;  3L9F A;  4RB0 A;  4UVB A;  5HLI A;  1OKR A;  2ZBK A;  4YII A;  1BM9 A;  4ZYD A;  1S7A A;  1ZG1 A;  1XSV A;  2XAG A;  1XGN A;  2NNN A;  1YIO A;  3SXY A;  2ETH A;  5K5O A;  2AS5 F;  1ULY A;  2QM3 A;  2EFQ A;  1CF7 B;  2MLG A;  2XKP A;  2HYG D;  2GAU A;  2G7H A;  5FLX K;  3HSR A;  3NEU A;  1AOY A;  4M73 A;  3S2W A;  1WRJ A;  1T6S A;  1HQC A;  3I5U A;  5FO5 A;  2AXL A;  3J80 K;  3EYY A;  1K6O A;  3GFI A;  2VOD A;  5HS9 A;  4YFX F;  5HVQ C;  2RNJ A;  3WGH A;  3AAF A;  4EMS A;  2HGC A;  1R22 A;  5ICG A;  5BS6 A;  1HW1 A;  3T1B A;  4XSX F;  1TBX A;  1RUN A;  3FXR A;  4XLP F;  2PBI A;  1X3U A;  2L3D A;  1S7O A;  2M45 A;  1P92 A;  3SQN A;  3NQO A;  2UZK A;  2QWW A;  4I09 A;  2ISZ A;  5DCM A;  3GWZ A;  2F5F A;  4KN4 X;  3F22 A;  4OIO F;  1XGO A;  3G3Z A;  2KRF A;  5ICE A;  2DAO A;  2FSW A;  5LGU A;  4JK1 X;  2K27 A;  3SZP A;  4LG0 A;  3EYI A;  1W5T A;  1SAX A;  3F8B A;  4IXA A;  2L4M A;  1DP7 P;  2O03 A;  5E8I A;  5K5R A;  2M8E A;  4RAY A;  2VBZ A;  2FA5 A;  4AVP A;  1EV7 A;  5JFR A;  4BQA A;  1FZP B;  3SZT A;  3ERE D;  1OMI A;  1IXC A;  4BNC A;  4KMU X;  2XGX A;  1NHA A;  5L3E A;  2EFO A;  1S6L A;  3KCC A;  2EA2 A;  4HF0 A;  3QU6 A;  3GX4 X;  1SMT A;  4KIB A;  1CF7 A;  5EEG A;  4OIP F;  1SFE A;  1BJA A;  3L00 A;  3TKY A;  2HDC A;  3KP5 A;  4L9J A;  4OMY A;  3RPU A;  1H9G A;  1D3Y A;  3O6B B;  2QLZ A;  1XSX A;  3RKW A;  1V4R A;  2GA1 A;  1YW8 A;  2VBY A;  4MHG A;  2FOK A;  5LRS A;  5HS8 A;  4BHB A;  4EGY A;  4GYG A;  3J7A O;  2ZXJ A;  2OQG A;  1BN5 A;  1XGS A;  4MGR A;  4YIF A;  4ESB A;  1T98 A;  1GVJ A;  4LLN A;  1G3T A;  3GEZ A;  1UFM A;  2DK8 A;  5E8G A;  2XRO A;  1YYV A;  4RGU A;  4Y17 A;  1Z6T A;  4Q5S F;  3ULQ B;  2A69 F;  2EV5 A;  3IHU A;  1IN8 A;  2BGC A;  2EFW A;  1K78 B;  2RC4 A;  1SD4 A;  3F6V A;  2FE3 A;  4HLX A;  4FT8 A;  5LHI A;  3TOB A;  2DPD A;  1MDM B;  1RNL A;  4BXU A;  3DEU A;  1O3S A;  5LLQ A;  4L9N A;  4CZZ A;  1P2F A;  2E1C A;  4IRI A;  1QZY A;  3GZ6 A;  1WWX A;  1EH6 A;  2HQR A;  2XRN A;  4PZJ A;  4NB5 A;  4M71 A;  1JXS A;  1ZH5 A;  1TQM A;  1WSU A;  4G8X A;  1AWC A;  2VXZ A;  1IXR C;  5JI6 A;  3H92 A;  2V6C A;  1L0O C;  1I6X A;  5CVJ A;  2JPC A;  2UXX A;  3GO5 A;  4HA8 A;  2XIG A;  4Q47 A;  2K86 A;  1HBX G;  3Q9V A;  1ON2 A;  4LK1 F;  1YW7 A;  5A2Q K;  3WTU C;  4XRF A;  2XAQ A;  3KP6 A;  1HXD A;  2HOE A;  5D4R A;  2DO7 A;  2BYV E;  1ZGA A;  4OIN F;  4HBL A;  4XSZ F;  3QOP A;  1B9M A;  2FML A;  1TQP A;  5ILV A;  3GXO A;  4R79 A;  2Z9O A;  1FBQ A;  4IVN A;  4L9T A;  1USS A;  2PLY A;  3GW2 A;  2CWE A;  1XN7 A;  1KU9 A;  1R5H A;  3E3V A;  2MH2 A;  2V79 A;  1C0W A;  5TJJ A;  5F1R A;  4A2U A;  1ZYR F;  3FXU A;  3ECO A;  5CVV A;  1MJB A;  3P9I A;  3L2C A;  2ADU A;  4MNU A;  5BQT A;  1ZAR A;  1TW2 A;  3TDZ C;  3RJP A;  2GQQ A;  5EEH A;  3F8M A;  2HZT A;  1U3E M;  1ON1 A;  4LLL A;  2HYF A;  2ISY A;  2IPQ X;  3K2Z A;  5DYM A;  2PMH A;  3E5Q A;  2GXG A;  2IT0 A;  3MFK A;  4AIJ A;  1Z05 A;  4HLY A;  2TDX A;  1K78 A;  3KZZ A;  2W24 A;  4JBA A;  4N9H A;  4TV7 A;  1ONV A;  4HX8 A;  2Y0M A;  1MJA A;  1F1Z A;  2A6H F; 
#chains in the Genus database with same CATH topology
 2JSC A;  4WWC A;  1PUF A;  1P4X A;  4HF1 A;  2EIL H;  4IJA A;  5FKN A;  4P9U A;  2ESN A;  1QO0 D;  1BR2 A;  5JHF A;  1MDM A;  4C2T A;  3HSF A;  5CVR A;  4RAZ A;  1QHG A;  1IUY A;  1HKQ A;  4U88 A;  2LBF B;  5CPR B;  3JRC A;  1CGP A;  3CD6 I;  1OR7 C;  5CVI A;  5JLX A;  1MSE C;  3FHZ A;  2HVS A;  2HQ5 A;  2I10 A;  1HCR A;  3TO6 A;  1FT9 A;  3CLQ A;  4HPQ A;  2HI3 A;  3LA2 A;  2ACJ A;  2D2W A;  2GZW A;  2MC3 A;  1X3Z B;  3OYM A;  1JUP A;  2CQ7 A;  3FBN B;  5D5U B;  2JPB A;  3ABM H;  3VOE A;  2CYY A;  1W5S A;  3Q9S A;  1JUS A;  2HOT A;  3VFZ A;  2X85 A;  1SAN A;  4UUV A;  3SFZ A;  3BJO A;  2YSR A;  1GUU A;  1PVE A;  3G6E I;  1TWG J;  5CLS A;  2LYC A;  1V5F A;  3PJR A;  3BTL A;  1IXS B;  2YR2 A;  2RAE A;  3U21 A;  1E3H A;  5J4Y A;  2P6S A;  1MMS A;  2IJL A;  5HNH A;  3IKT A;  1FBS A;  2HZD A;  2BV6 A;  3KP4 A;  2CSO A;  2DQL A;  5E79 C;  4D5C A;  3DLL F;  2E60 A;  2QBY A;  2KQR A;  2Z99 A;  1ZKG A;  2RV8 A;  1PP8 F;  4XON A;  1T0F C;  5KAF C;  3L09 A;  2Z16 A;  2VE9 A;  3I59 B;  3ZR8 X;  4RGX A;  4D5F A;  4DYC A;  1ETX A;  4KYW A;  2RQP A;  1MNM C;  2M5W A;  4XOT A;  3EPZ A;  4QWQ A;  5JR3 A;  3OYD A;  3FKI J;  4L0Z B;  4I01 A;  4PK4 A;  4HNV A;  2DOA A;  5F6F A;  2DOF A;  1I1G A;  4AD9 A;  1GHC A;  1OQY A;  4E4H A;  1S72 I;  2HKO A;  2R93 J;  1FX7 A;  2KJB A;  4B8X A;  2QEN A;  3HKZ A;  5FKO A;  4DBR A;  3HRS A;  2QVO A;  3TBI A;  3HL2 A;  4EJU A;  3ZP5 A;  4LFU A;  1IN7 A;  3REO A;  3W6K B;  4XBF A;  2OA4 A;  4D7M A;  5E18 F;  2ZME C;  4MFD A;  5J1U A;  1WH5 A;  5DD8 A;  5ILS A;  2QQ9 A;  3ZPL A;  4UB6 C;  3OYF A;  2LRE A;  5FKM A;  2LR8 A;  1BIA A;  4BQO A;  1YG2 A;  3M07 A;  2HR3 A;  1REP C;  1VZ0 A;  3S17 J;  4RM3 A;  5D8K B;  1SVO A;  3V8K A;  1HC8 A;  2ZME B;  4CCL A;  2ME6 A;  4CGZ A;  2KKO A;  1X19 A;  2O5R A;  4E7J A;  1E2X A;  1IC8 A;  4C9Y A;  2NNY A;  2M87 A;  3E6B A;  1G3W A;  5EEA A;  1LJ9 A;  3VYU B;  5EF6 A;  1LUJ B;  4GCV A;  5D4S A;  2LNB A;  4LJZ F;  1YS6 A;  2VPR A;  1W0U A;  1SFO J;  3DXJ F;  2V1X A;  3ZQF A;  2K9M A;  3HOT A;  3R0J A;  3GFJ A;  1H8A C;  4DJA A;  4YFN F;  3C18 A;  3K1M A;  2EA4 A;  3L7W A;  2R5Z B;  2PQ8 A;  2CFX A;  2NS7 A;  2JUG A;  3LSJ A;  4BQQ A;  2DMQ A;  1R5G A;  1Z1D A;  3TDU C;  4EEF G;  3OWT A;  2O6G E;  4EAT A;  4XLN F;  4JX4 A;  1IW7 F;  4CCO A;  2VB6 A;  3BG3 A;  2WBM A;  4LLG F;  1U8R A;  2AQE A;  3MZ8 A;  1LKX A;  2YS9 A;  3LFK A;  2QF7 A;  3OYJ A;  3DKW A;  1KZH A;  4LD5 A;  3E97 A;  3ML6 A;  2R7X A;  2K9Q A;  4FAS D;  1FMV A;  2XVC A;  1XB4 A;  2FUG 2;  5HNF A;  3FM5 A;  4M6Y A;  2OJE D;  2JA7 J;  3QU3 A;  2CH0 A;  4NC7 A;  4G6Q A;  4DZP A;  2KHM A;  3RQ4 A;  5DUI A;  1YTY A;  3S1N J;  1JHH A;  1FWZ A;  4OWR B;  3WTX C;  4KA4 A;  3DEW A;  2A6E F;  3OV8 A;  3GYH X;  4G12 A;  1WI9 A;  1TLH B;  3FXM A;  1W7P B;  4FET A;  5FD6 A;  4U0W A;  5DD4 A;  2W25 A;  2WAQ A;  1KU3 A;  3JRB A;  2DLL A;  1OR7 A;  1SD6 A;  2KMU A;  2CQN A;  4EM2 A;  5LGT A;  4G7O F;  2X9D A;  3KYD B;  2W00 A;  2YUS A;  4C2U A;  4MO7 A;  2DT6 A;  3QYB A;  2YPR A;  3H9Q A;  1EF4 A;  2FQ4 A;  1Z3Y A;  3S2D J;  2M3A A;  3LWF A;  3WTZ A;  2MH9 A;  3H5A A;  1Y0U A;  3M8J A;  3RSN A;  2F4I A;  1XMK A;  2RN7 A;  3FIW A;  1LVA A;  2DBB A;  4I02 A;  2Y69 H;  2M34 A;  4O5V A;  5H6R A;  4CHU A;  1G4D A;  2LY2 A;  2L4A A;  3S1Q J;  1FSE A;  1I5Z A;  2KZG A;  5AIP A;  4IF4 A;  3EUK L;  4GRI A;  4C3I J;  1HKS A;  2HYJ A;  1YO5 C;  1YX3 A;  3CCL I;  3WU1 B;  3I59 A;  2FNP A;  3K10 A;  4AIK A;  2IS2 A;  1D8K A;  5EGO A;  4XK4 A;  5C4J J;  3RYP A;  3PQK A;  3L1P A;  2XPU A;  1MJ9 A;  4Q4Z F;  5HOO A;  4PGG A;  1S9H A;  3EQL F;  5D6E A;  2LKX A;  1AU7 A;  1SFU A;  2K9N A;  2QKL B;  3F6O A;  3NAR A;  3V8J A;  3P7N A;  2KIS A;  3OY9 A;  2BXZ A;  3MZH A;  2DDB A;  1FP1 D;  2XAH A;  2WAE A;  3COA C;  1K79 A;  2XKO A;  3VOD A;  3HRT A;  5IP7 J;  3H35 A;  2JUC A;  3O3K A;  4HSR A;  2EIN H;  4M3B A;  3R4K A;  1P9Q C;  1B1B A;  1MNE A;  1Z21 A;  3K4N A;  1E3P A;  4MQV A;  4UXN A;  4XLA A;  3LAJ A;  1YI2 I;  4RA2 A;  3F0C A;  2BY3 A;  5FJ8 J;  3ZMD A;  2LG4 A;  4M3F A;  2E1N A;  2CQK A;  3ABT A;  3BTI A;  3E6C C;  3OS0 A;  1RIO H;  1UCR A;  2L7M P;  5BNG A;  2W4S A;  1R36 A;  1MGT A;  2BBY A;  3U9G A;  3X2Q H;  2ZME A;  1IDY A;  4G94 A;  1ZQ3 P;  1X4P A;  1UST A;  5FLX Z;  3L2Q A;  5HDG A;  4XLF A;  3CC4 I;  4IHY A;  2M4K A;  2DFF A;  3JW4 A;  1X58 A;  1BC7 C;  2P5L C;  1FOK A;  2ELH A;  3T5X A;  1FP2 A;  5CQE A;  2FMY A;  3QOE A;  4OMZ A;  1QRY A;  4P96 A;  3U2R A;  3WG7 H;  3WU2 C;  4Y7N J;  5IT3 A;  2YX7 A;  2K4B A;  5HDN A;  5CVU A;  2O8X A;  4ZH4 F;  1WFX A;  1XSD A;  2IS4 A;  3NWS A;  2JSP A;  2D1H A;  3J80 Z;  5K7F A;  1VQ4 I;  1QGP A;  2ZCW A;  2BEO A;  4BJ5 C;  4RGS A;  3AG1 H;  2R5Z A;  3I56 I;  2BHZ A;  4ZDP A;  3KEQ A;  3OIP A;  4IQJ A;  1VQ5 I;  2DA2 A;  4HAM A;  4ENN A;  3HOV J;  3A0B C;  3OR2 C;  4XKC A;  2QSF X;  3I58 A;  1WGX A;  2IP2 A;  1YJ9 I;  2HDD A;  4L5I A;  1BBY A;  3N4M A;  1PDN C;  1MMN A;  2KDO A;  3BOQ A;  1QZE A;  4UV8 A;  4ETS A;  1A31 A;  2WY7 Q;  2KP6 A;  2VI6 A;  4Y3O A;  3D5L A;  1X1C A;  3W6J B;  4B1R A;  2V1D A;  2P8T A;  3F8N A;  3EUH C;  3F3X A;  2XAF A;  2WV1 A;  2W57 A;  4I0A A;  3BR0 A;  2IA2 A;  4PDK A;  3HBL A;  2AHQ A;  2OC6 A;  3E6M A;  2DN0 A;  3LA7 A;  4I7H A;  4A3C J;  2CJJ A;  4MEY F;  2BXY A;  3HOU J;  1TWA J;  1JT0 A;  1XMA A;  1Z77 A;  1SAU A;  5LHH A;  2M0C A;  3OL3 A;  4I2O A;  5KNL A;  3K2A A;  2A5W A;  2L9V A;  4L18 B;  3ZQ7 A;  4HST A;  4AM3 A;  4E7L A;  2M2E A;  2XHK A;  2COM A;  1I3Q J;  1EH7 A;  5FGM A;  4OAY A;  3GFL A;  2P0W A;  2L01 A;  1ZAO A;  3K7A J;  4HDV A;  3BPV A;  3FWE A;  3ZMU A;  1FEX A;  3NAU A;  1H0M A;  1UAA A;  2F6C A;  5HOD A;  3S14 J;  2O8K A;  3HPG A;  2CGP A;  2OZ6 A;  3G1M A;  4E7K A;  1TT5 B;  3K4K A;  2K4J A;  4NQW B;  5IT9 K;  4DOZ A;  1J59 A;  1BR1 A;  3FF5 A;  5FRM A;  1O3Q A;  1TZL A;  4P1W A;  3QP5 A;  3A2K A;  3RYR A;  1HF0 A;  2I5U A;  4IQ4 A;  2CUF A;  2OPT A;  2IGM A;  1KQ0 A;  3P9C A;  4KUM A;  2EFP A;  4L9V A;  2PG4 A;  5TIS C;  1VFC A;  3E1S A;  2QZ8 A;  2W1O A;  5M3M J;  1O3T A;  3I4P A;  4JP0 A;  3CMY A;  2KJC A;  2DJN A;  4YG2 F;  3K1P A;  1I6H J;  1NK2 P;  2VJI A;  1ZLK A;  1IZ1 A;  3CC2 I;  2J5P A;  4RGR A;  1ZGJ A;  2JTV A;  3JRD A;  4A6E A;  1YRN A;  1P4W A;  1FSH A;  2X4H A;  4E70 A;  4F91 B;  3IKV A;  2GOM A;  2ECC A;  4HX4 A;  2ID6 A;  2VQL A;  3RIR A;  5ICF A;  1LPQ A;  3MKZ A;  2VBW A;  4PCQ A;  3KP7 A;  2BE5 F;  1YX5 A;  2R7V A;  2ZNY A;  2DMP A;  3DKX A;  1XG1 A;  4IHS A;  1JT6 A;  5FFX A;  5GPC A;  5C3E J;  2PJR B;  1PJR A;  1QPI A;  4KNY A;  2MAB A;  5JVT A;  4X6A J;  3WOD F;  3HGY A;  4HZF A;  5BMZ A;  4HRI A;  1Z3X A;  1FBU A;  4BUP A;  4BXF A;  2XPV A;  2MFZ A;  3PM1 A;  5E3M A;  1BOA A;  3BQZ A;  3S1M J;  2QSH X;  4GDF A;  4ZDO A;  1XX5 A;  2P4W A;  3BDD A;  2CU7 A;  1IN5 A;  2L5Q A;  5F0H A;  1VQO I;  3IRQ A;  1MSF C;  4BXX J;  4W97 A;  2IS1 A;  2I8D A;  1J5Y A;  2P7C B;  1U6G A;  4A12 A;  2JA6 J;  1FY7 A;  3IC7 A;  3J81 K;  3M7G A;  4ESJ A;  2IAI A;  1P4A A;  3WE2 A;  3LSM A;  4XRM A;  4CO8 A;  4LMY A;  2DMN A;  2CS3 A;  2X51 A;  3MKY B;  1ZRC A;  1A6Q A;  2OTL I;  2FRH A;  4J01 A;  2KIM A;  3A4C A;  4F93 B;  2GXB A;  4U7D A;  2QA4 I;  1QU3 A;  3CJN A;  3PSI A;  4GXO A;  2VJ5 A;  2QQ8 A;  1RKW A;  3CO6 C;  4Y15 A;  2HS5 A;  3F72 A;  4QIW N;  2B0L A;  1TP4 A;  2IA1 A;  4C3J J;  4Y13 A;  1XPX A;  3H3Z A;  2QKM B;  1F5T A;  1X1P A;  2A07 F;  1YS7 A;  3HXL A;  2R92 J;  1W4M A;  2M4G A;  3K9T A;  5L3G A;  1Z6R A;  1U0J A;  2EV0 A;  2ID3 A;  3V4G A;  1GXP A;  1N78 A;  2IGK A;  2ZKZ A;  4CYD A;  3GUD A;  2BVM A;  2WB1 N;  3ABU A;  1P6R A;  1UEL B;  2NXN B;  4Q48 A;  2DMT A;  4HG2 A;  1KYZ A;  4HV5 A;  3KE2 A;  2BY1 A;  3SHF A;  3BCB A;  4JOM A;  4GGG A;  3RQI A;  4ENM A;  5LEJ A;  5D6F A;  1Q1H A;  4U0V A;  4UV9 A;  2A68 F;  4KT5 C;  3AG2 H;  5F1J A;  2DU9 A;  3MVP A;  1UZC A;  2M7A A;  3HHG A;  2RDP A;  4D9J A;  5B66 C;  2JA8 J;  2XAU A;  4RAF A;  4E7S A;  3KET A;  3EET A;  3VYT B;  4IOC F;  1X1A A;  2YU3 A;  4UVC A;  5KVR A;  3RTR A;  1U78 A;  2BZT A;  4XKV A;  3JAM K;  2EFN A;  3QPT A;  3GTK J;  3DTE A;  2B63 J;  3VPR A;  3ABK H;  4IX7 A;  3ZRG A;  3R61 A;  3S32 A;  4E6K G;  1U5T B;  2KL4 A;  3M8F A;  2MD0 A;  1VQP I;  3E0J B;  4E7H A;  1O3R A;  2IGN A;  2OU2 A;  2ZJP F;  4XRS G;  1T38 A;  5EZH A;  1XCV A;  4NHJ A;  3B6A A;  1W1W E;  5LEK A;  2JA2 A;  3BWG A;  2COB A;  1IN6 A;  1TW3 A;  2VIX A;  3I53 A;  5K1Y A;  2KT0 A;  5A2Q Z;  2KDZ A;  1JJ6 C;  4WX9 A;  3VWB A;  3W2W A;  2FQ3 A;  4FX4 A;  2F2E A;  4F52 A;  3LAP A;  4ZYE A;  1JHF A;  1BI0 A;  1V55 H;  2X6Y A;  4YRV A;  3ELK A;  2R7Q A;  4XLC A;  3H9G A;  4BU2 A;  2VAS A;  5E3L A;  1G3S A;  1BC8 C;  3OIO A;  3KYL A;  2XAJ A;  4N4N B;  2VKD A;  2KIU A;  5FFZ A;  1F4K A;  1E0E A;  3F8F A;  3CDL A;  2HXO A;  3K70 C;  2PJR A;  3I0T A;  1RES A;  4ASN A;  1XTA A;  2EK5 A;  4IEJ A;  4UUS B;  4AUX A;  1Y8R B;  3MZY A;  1ZRD A;  3BTJ A;  1D1B A;  2O9L A;  2MW8 A;  5D8L B;  4EQQ A;  5J3L A;  4E7Z A;  5ED4 A;  1Y0N A;  2DQR A;  3FKJ A;  3DKY A;  1MBF A;  4BDY A;  4XLH A;  4UB8 C;  4FCY A;  1IN4 A;  3BZK A;  1Z7L A;  2NOG A;  2Q0O A;  1LNW A;  4PSX A;  2VXD A;  4P9F A;  1FMW A;  1HW5 A;  2CUJ A;  4S05 A;  1YFH A;  1U8B A;  1J0R A;  1SD7 A;  3CCM I;  3FXO A;  4V2G A;  4M9Z A;  2UXN A;  3FBI B;  3RKX A;  5J1Y A;  3TO9 A;  3K4M A;  2VN2 A;  1Z91 A;  1SEU A;  2LF7 A;  2XB0 X;  2CV1 A;  2TRT A;  2H27 A;  3KP3 A;  3P9K A;  3CCR I;  4WK8 F;  1YLF A;  2KLO A;  3G1O A;  3K4J A;  5E17 F;  3CME I;  5GAD J;  5LD2 C;  2HPM A;  1ACI A;  3BZ6 A;  4O6J A;  3CZ6 A;  2XSD C;  2QGU A;  2X6X A;  3MWM A;  3RZO J;  3Q5F A;  3DQV C;  3M4O J;  2DA4 A;  2AXT C;  4DGW B;  1H9T A;  3K69 A;  1TWF J;  4ZYH A;  4EJT A;  2PMZ N;  2WY8 Q;  4XQF A;  4LIT A;  4I6Z A;  1BOB A;  4WCG A;  1ZLJ A;  3LNQ A;  3FMQ A;  4RBO A;  5M3F J;  4RAG A;  1ZGW A;  2FJ1 A;  2J5O A;  2V9K A;  2ZXW H;  1FC3 A;  4PFO A;  5IP6 A;  2HQA A;  2VPL A;  1LDD A;  1FYK A;  4IHT A;  2RGV A;  3B73 A;  3LSR A;  3Q0W A;  1BJZ A;  2IBD A;  4S04 A;  5JHU A;  5ERI A;  3ZN0 A;  4IZZ A;  2CW0 F;  2JN6 A;  2KIF A;  3CES A;  4CUG A;  3BG9 A;  1QHH D;  1LQ1 A;  1UB9 A;  1OYW A;  1SFX A;  2FOW A;  2DPU A;  3RCO A;  1B9N A;  5DM6 F;  4DIQ A;  2M8G X;  4LIU A;  4A3I J;  4I98 B;  4PGH A;  1V54 H;  3D1N I;  2R0Q C;  1JJ8 C;  1BA5 A;  1X2N A;  3OYA A;  4M3E A;  2VT3 A;  1AA7 A;  4BEH B;  2B7E A;  2E34 A;  2WC2 A;  2VOO A;  2Z5U A;  4IHV A;  2R5Y B;  4PFP A;  4B47 A;  1OYI A;  3CUQ C;  1VTN C;  4UVA A;  1ZTR A;  3FDY A;  3IAM 2;  2H1K A;  4CYC B;  1ZR4 A;  2NRA C;  3U1D A;  1OPC A;  1Y39 A;  3A02 A;  4RB2 C;  1MND A;  3ZMZ A;  3Q0V A;  3WTV C;  3WGG A;  2VJJ A;  4GO1 A;  1OIS A;  5L3D A;  3I71 A;  3CF5 F;  4Y52 J;  3OOP A;  3CUQ B;  2M30 A;  2HU9 A;  3SEQ A;  5IPA A;  3CMA I;  3DBR B;  2CUZ A;  4XN0 A;  4ZTJ A;  2ZO4 A;  1WHU A;  1BW6 A;  2F4O B;  1JGS A;  2L2O A;  2XGD A;  3WHC A;  4BAY A;  2VC0 A;  5CYV A;  5HS7 A;  5DCM B;  2E2I J;  5L3F A;  3VYR B;  3C7J A;  3JTH A;  3PFI A;  1DPU A;  2N8G A;  1OYY A;  1UHW A;  1YJW I;  2DOE A;  2Q2E B;  1RZ4 A;  3BR5 A;  1O57 A;  2LK2 A;  3H0G J;  2X1E A;  3HIF A;  2MD5 A;  2FU4 A;  3BR2 A;  3CCU I;  4HW0 A;  3WU0 A;  2G0E A;  3BQY A;  4LB5 A;  3AG4 H;  2FBK A;  2ZNZ A;  3CJQ B;  2O61 A;  4R1H A;  2Z1D A;  1MIJ A;  4W1U A;  4LG0 B;  1T56 A;  2CFO A;  4BBS J;  2L7K A;  3ZMS A;  4NC8 A;  1OCZ H;  4NC6 A;  1BL0 A;  1WZ2 A;  1WPK A;  1R1V A;  1PUE E;  3FXL A;  2EB7 A;  4UUS A;  2DA5 A;  4FQG A;  4CA0 A;  1H88 C;  2NS0 A;  1MH3 A;  1YOV B;  2LBF A;  2X1D A;  2R4G A;  4BGD A;  4IL6 C;  1B8I B;  1RC9 A;  4PJJ A;  3I54 A;  5ICC A;  2VL8 A;  1DUX C;  5KK1 A;  1R1U A;  2L9S A;  2CQQ A;  1WQ2 A;  2XC7 A;  2LKP A;  1J9I A;  1MBG A;  3KYC B;  2EZL A;  2O3F A;  3GF2 A;  3ZQQ A;  1J7K A;  1A35 A;  2TCT A;  2E2J J;  5FRN A;  1OCT C;  3GTM J;  4IHX A;  3OL4 A;  2HOA A;  4FX0 A;  1IG7 A;  3MN2 A;  5D5V B;  2V1N A;  2E7W A;  4UUT A;  2HTS A;  3RKY A;  5J8F A;  1YIJ I;  2UWM A;  1RI7 A;  2HFH A;  1J09 A;  2YX4 A;  3WG9 A;  2DA6 A;  1R6R A;  1S7E A;  2LD5 A;  3PFY A;  5E1Z B;  1UHM A;  2L7Z A;  3I9V 2;  5DCF A;  4M74 A;  5B3S H;  4B3A A;  3CJT B;  2VT2 A;  1FTZ A;  2R3S A;  5AON A;  1HW2 A;  2OQR A;  4FIS A;  1WCM J;  2LFB A;  4LGW A;  1VI0 A;  1MW7 A;  2FD5 A;  2HOS A;  1OLT A;  3IH2 A;  2IXS A;  2Y9Y A;  4DQ2 A;  4JX5 A;  4YEL A;  4ENJ A;  1JE8 A;  2M7B A;  4I0B A;  4M9S A;  3BG6 A;  5M5Y J;  4UNO A;  2ESH A;  1ZEL A;  2VLA A;  4KMF A;  1W36 C;  1A5J A;  3HZJ A;  3IL2 A;  5CQG A;  4HOB A;  4XL9 A;  3E7L A;  1ETY A;  1D5V A;  3BJA A;  3EUA A;  3GLX A;  3JRE A;  3C2B A;  1ZR2 A;  1T0F A;  3DLA A;  2Y48 A;  5D5X B;  4A0Y A;  3QPS A;  3RKQ A;  2K40 A;  1S29 A;  2DA7 A;  5K7H A;  3CUO A;  4A3K J;  5EDN A;  1ZN2 A;  1TWC J;  1GDT A;  3KP2 A;  3O8G A;  3CCS I;  4UHT A;  1FOX A;  1T08 B;  2FNA A;  1X2M A;  4MLO A;  2CV2 A;  3GZN B;  3FMR A;  1IRF A;  3DF8 A;  1NH3 A;  2R7Z J;  4BHP A;  3DP7 A;  4BEH A;  4WXC A;  1GXQ A;  1UMQ A;  1HLV A;  2R5Y A;  2CV0 A;  3ZOB A;  2DYS H;  3E6D A;  2W84 A;  2UUZ A;  2RRE A;  4CYC A;  1DDN A;  3HPH A;  3M1E A;  3IWZ A;  1LVK A;  4BS9 A;  2LDU A;  2NAZ A;  3C3W A;  3GME A;  3G1L A;  3I4N J;  4HQE A;  4RDU A;  1T2K A;  1QQI A;  3BP8 A;  5E1X A;  1K6Y A;  3TO7 A;  3IV5 A;  1JKR C;  4LG3 A;  3N05 A;  2CUE A;  3CUQ A;  2HVQ A;  1IF1 A;  3D5S C;  2HKX A;  1D1C A;  1B4A A;  1BIB A;  1XCB A;  2QCO A;  2VKE A;  2H1L A;  1FTT A;  2Z2S B;  2OZU A;  3VSL A;  1DU6 A;  5GAH J;  2FF4 A;  1R1T A;  5BPI A;  2K9L A;  2EJR A;  1Z0X A;  1UG2 A;  1G6N A;  1PP7 U;  1ZG3 A;  2Q2E A;  3TMO A;  3K70 D;  1FNN A;  3R6S A;  3FZV A;  5H20 A;  1QZZ A;  1LEB A;  2H6B A;  4U7B A;  1KA8 A;  1K61 A;  2VBX A;  3GTO J;  4A3D J;  3F23 A;  5DUK A;  2ZB9 A;  2XV4 S;  1ITY A;  1JUM A;  2DI3 A;  5M5X J;  4FHT A;  2GBY A;  4MQ9 F;  4KDP A;  3UR3 C;  4XNF A;  1RPW A;  3ECH A;  2H6C A;  2Q8K A;  2FBI A;  3I4M J;  1SVM A;  2WB1 A;  5LGN A;  3IRR A;  4XRS A;  4ANJ A;  4HF2 A;  3BJ6 A;  3ERM A;  3HYI A;  1YQA A;  1WJ5 A;  2Q1Z B;  3M1C A;  2LSO A;  4HV6 A;  1XMX A;  4FE4 A;  5L3B A;  3CCY A;  3LMM A;  1MBH A;  3QAH A;  4GYI A;  2GXA A;  2QYO A;  1B8I A;  1R23 A;  2EZK A;  4EM0 B;  1IRG A;  4OU0 A;  2ZXI A;  3M3Y J;  3GVA A;  3BPX A;  5FD5 A;  1W7P A;  3BRO A;  4CIC A;  4M9X A;  1HST A;  1B6A A;  1Y1W J;  3V7R A;  1SD5 A;  3A01 B;  2V9P A;  4PUS A;  4MTE A;  5GTI C;  2JT1 A;  3ESW B;  3ISP A;  4D1Q A;  1XGM A;  1ZRE A;  3DBL B;  4A0X A;  2DFE A;  5LRR A;  3BT9 A;  3M8E A;  1X1B A;  2HQN A;  4H4K C;  2MBF A;  3MEX A;  3KFW X;  3OYH A;  1OCO H;  2E7X A;  3S2H J;  3DWL E;  5EZG A;  2PJP A;  2R7D A;  4JX6 A;  3ZMT A;  1D5Y A;  4OIR F;  3K0L A;  3EDP A;  4FTH A;  1N25 A;  2V4J C;  3H5R A;  1J75 A;  4ZYG A;  2IRF G;  1RR7 A;  3FM3 A;  2HTJ A;  2XGE A;  4PSW A;  4HDU A;  2G9W A;  5K5Q A;  5FB2 A;  5DV5 A;  5TGT A;  4QLC U;  3WE3 A;  3JR9 A;  1FYL A;  1IUF A;  3R0A A;  1R4N B;  4XR6 A;  2GLO A;  2KRC A;  4PJN A;  4ZZD A;  3W6V A;  4EJW A;  2DT5 A;  2HPI A;  3QPL A;  4A3L J;  4II3 A;  1U9N A;  1XDU A;  2RQQ A;  1O7F A;  4RLQ A;  4YEJ A;  3G73 A;  5HDK A;  3ZN1 A;  2IEK A;  1QVU A;  2DXI A;  2JQ7 A;  2PX9 A;  3HHH A;  3OS1 A;  4EJO A;  3DTK A;  5GAG J;  2KPM A;  3VYS B;  5ILU A;  2F48 A;  2V9V A;  2VC1 A;  3WHB A;  5F08 A;  1SMY F;  1R00 A;  4YIR X;  4HQM A;  5J8C A;  2AQF A;  3VB2 A;  3IH4 A;  1MD0 A;  3T0Y A;  5JVG F;  1NG6 A;  3WGI A;  4PJM A;  3D0S A;  1B59 A;  4CDG A;  1RUO A;  1I27 A;  2HEO A;  3TGN A;  2E71 A;  1IDZ A;  1W0T A;  2CMP A;  4IO9 F;  1P7I A;  2EWN A;  3SDB A;  3TW6 A;  5LHG A;  3C2H A;  1TNT A;  1TQI A;  2EQR A;  3KIO A;  3WTW C;  3BC8 A;  5KAI C;  2ZSI B;  2Y31 A;  5J1R A;  2Y0S N;  1T39 A;  4KIS A;  4N9I A;  4D7N A;  1YE9 A;  2M9H A;  3PNV A;  4R8H A;  2DA1 A;  5J40 A;  1GT0 C;  1R7J A;  4ZDL A;  3JCU C;  3V8L A;  2MSY A;  3H9J A;  4IRH A;  4HNT A;  3V7S A;  3IP4 B;  1LFB A;  2A3S A;  3TP0 A;  3LFU A;  2P7V B;  3KEY A;  1KU2 A;  2OD5 A;  3IUO A;  3ZMV A;  1STZ A;  1OCP A;  3DFG A;  3E5U A;  1KYW A;  3VDX A;  4BYY A;  1X1D A;  2F5C A;  2ZJ2 A;  5BPD A;  3C1D A;  1HDP A;  3PUF A;  3W2V A;  2VJ4 A;  5EJC A;  2GM4 A;  2BVL A;  5IT9 Z;  2PMZ A;  5J47 A;  1E17 A;  1IJW C;  3HRM A;  1F9N A;  2ZJQ F;  1D8J A;  1KGS A;  2PEX A;  1V5E A;  2DFI A;  2ELK A;  2DTR A;  3LSI A;  1K4T A;  2R7R A;  3CDH A;  3PL8 A;  4M6X A;  1W7P D;  3WTT C;  4IRG A;  2BY0 A;  3RI4 A;  1R71 A;  3DU5 A;  2QUF A;  3FK7 A;  2X6O A;  2MLK A;  4DBQ A;  1MZB A;  3CC7 I;  4KJZ A;  4IOA F;  3OYK A;  3RDI A;  2HDW A;  3KZY A;  3PNY A;  4NBQ A;  1LDJ A;  1OFC X;  2R7F A;  1XD7 A;  3LA3 A;  4RMN A;  4RB3 C;  1WJD A;  2FEZ A;  2PFB A;  4CCM A;  3LQQ A;  2IS6 A;  2VKV A;  2PN6 A;  2GWR A;  4BL0 B;  2EIJ H;  3F8C A;  4H0E A;  4AYB N;  1IAW A;  3BCA A;  3T8T A;  3DEE A;  2C6Y A;  1UHS A;  1TL8 A;  1ETQ A;  5HLT A;  1FIP A;  3TQN A;  1FOY A;  3DV8 A;  4P5O A;  4B48 A;  4HX7 A;  1RR8 C;  4PJL A;  1QBJ A;  3BG7 A;  1O7L A;  2PMU A;  2V7F A;  1EJ9 A;  3HTS B;  1HKT A;  4OIQ F;  4XKW A;  4AIH A;  2DJI A;  4X1E A;  4KN7 X;  2L02 A;  1ENH A;  2K02 A;  4A3B J;  3CDI A;  1B72 B;  2QBY B;  4WXD A;  5GAE J;  4A6D A;  5GP9 A;  1ODD A;  3FXQ A;  4ITV A;  3LSK A;  3EUH A;  6PAX A;  4EM1 A;  2DW4 A;  1EH8 A;  2WWY A;  3SFI A;  3ABL H;  4A3E J;  1PYV A;  2P6T A;  2K7L A;  1RET A;  3QPH A;  1I50 J;  2XF6 A;  1TWH J;  5IY5 H;  3IWF A;  3E5X A;  3OR1 C;  5TRD A;  4A3M J;  1W36 D;  4U0Y A;  1ZG5 A;  4B09 A;  4LB6 B;  2F5E A;  1U5T C;  4G6D A;  3LST A;  3P5J A;  4ZC3 A;  3MKW B;  3JSP A;  2XUB A;  3HC7 A;  3O2P E;  4M72 A;  3HUG B;  1LFP A;  4ESF A;  2EIK H;  3J81 Z;  4NQW A;  3DCF A;  2VOP A;  3PO2 J;  3Q0U A;  4V19 K;  4EGZ A;  2LP0 A;  2MA3 A;  1FIA A;  1I1S A;  1WKM A;  5D5W B;  4CXF A;  5FRO A;  3CLO A;  3CJR B;  5M5W J;  3BR1 A;  4G9Y A;  4V2F A;  5GTH C;  3BZC A;  2D45 A;  3WTS C;  2JRT A;  1DQU A;  2L54 A;  3JRI A;  4I76 A;  2WTE A;  3K4L A;  5DDG A;  3OYL A;  3D5R C;  3HEF A;  2QQA A;  1D1A A;  1ORK A;  4QSH A;  2JA5 J;  3I64 A;  4MTD A;  1ZRF A;  3OYG A;  3BR6 A;  2OAZ A;  1BI3 A;  1WJE A;  1Q1V A;  4RM2 A;  4BQN A;  4A5N A;  2ZXH A;  4EV0 A;  3M9A A;  2JJ7 A;  2P5V A;  3SYT A;  5E20 A;  2LOO A;  3GCM A;  3H3U A;  3DPT A;  2STT A;  2KRH A;  2RNG A;  1V3F A;  4A0Z A;  1F36 A;  1OJL A;  4CSW A;  5CJ9 A;  4OOI A;  1GV5 A;  3OOU A;  1FJL A;  2IGO A;  1T33 A;  4GFB A;  1QVT A;  3GFM A;  5LFA A;  5HLG A;  3SZG A;  3CQZ J;  1S3J A;  4EVI A;  5B1B H;  2CW8 A;  4JQF A;  4L5J A;  4D0P A;  1KQ9 A;  3QP6 A;  3K6G A;  1TTY A;  1ETV A;  2E35 A;  3DPU A;  2V6E A;  2WV0 A;  4BH9 A;  4KFC A;  1HDD C;  1O4X A;  3TED A;  3MAJ A;  2F5D A;  2Z3Y A;  2NVT J;  3MCZ A;  5DEQ A;  1J2X A;  4MEX F;  4IPA A;  2GOX B;  1Y1V J;  2OF7 A;  3HSE A;  1Z67 A;  2P81 A;  2XF7 A;  5L3C A;  4KIG A;  2B9S A;  1RKT A;  1YIT I;  1TT0 A;  3PQJ A;  1YJN I;  3AG3 H;  4ZTF A;  1A04 A;  2K85 A;  3JAM Z;  3S3N A;  3S3M A;  2H8R A;  2RVC A;  4A3F J;  2RKH A;  1S8N A;  3BTC A;  3F21 A;  4BDZ A;  4KIC A;  2OBP A;  4HYE A;  1ZK8 A;  3HRU A;  2OTJ I;  2Y75 A;  3JRH A;  1LEA A;  2O0Y A;  4BY7 J;  2R7T A;  1SC7 A;  2LY1 A;  3HTU A;  3LSG A;  5J6X A;  5LBQ A;  4L0Y B;  1ETO A;  1QNT A;  4YFK F;  2ZFU A;  1LDK B;  2JZY A;  1DPR A;  2JRM A;  3KEO A;  4XM3 A;  4F55 A;  1M1E B;  3FMS A;  4P55 A;  1TNS A;  2QQB A;  2VQC A;  1L3L A;  1G3Y A;  2LF8 A;  5GPA A;  4BHC A;  4ON0 A;  1AKH B;  2NYX A;  5HLH A;  1XDS A;  5DS9 A;  2EV6 A;  1K7A A;  4RLF A;  1FYM A;  1Z9C A;  5IYD J;  1VQ6 I;  2HWV A;  2HNH A;  2ZSH B;  3T8R A;  2FXA A;  2P5K A;  4O3M A;  2LTP A;  2R7O A;  4U87 A;  3HOS A;  3JSO A;  4LK0 F;  2IVM A;  4F3Q A;  4WF2 A;  3OSG A;  1FLI A;  2VE8 A;  4KT6 A;  3ROU A;  2XRL A;  3WTY C;  1R9T J;  1B72 A;  2FBH A;  5E1W A;  3PNT A;  3BY6 A;  2LVS A;  2YU9 J;  5BOX A;  4AWX B;  4Z6Y A;  2ME0 A;  2G7U A;  1ETW A;  1VND A;  1UG0 A;  1EA3 A;  5K7Z A;  3CTA A;  4G7H F;  1A6I A;  2F4M B;  5AIQ A;  1QPM A;  4N4O B;  4ABZ A;  3MQ0 A;  3LQR A;  1V5G A;  1VQK I;  2NVX J;  3N97 A;  2CRG A;  1BI2 A;  2XAS A;  3KLN A;  5EGO B;  2Z33 A;  1WJF A;  1YW9 A;  3G71 I;  3MKL A;  4B4C A;  2VQH A;  4XN3 A;  2DK5 A;  2STW A;  2DCE A;  2PI0 A;  1HSJ A;  3QYF A;  3QRF F;  3OMY A;  3NRV A;  2DA3 A;  2KZV A;  3TOA A;  3CO7 C;  4N0B A;  4BE1 A;  1VQN I;  2OCE A;  3HUG A;  2GIV A;  2DFH A;  2BW3 B;  2A5Y B;  1R58 A;  2M1B A;  5FKK A;  4BE2 A;  2X0L A;  4F7Z A;  5F0C A;  4RB1 A;  1NK3 P;  1Z7U A;  4ENK A;  4BKX A;  1BI1 A;  1U5T A;  4MIM A;  4K2E A;  1NTC A;  2GA2 A;  2CG4 A;  1KQ8 A;  2UV1 A;  2V1U A;  4JYK A;  3JTG A;  4HEA 2;  2IA0 A;  3RPQ A;  4CH7 A;  3DPL C;  3S8P A;  4EJV A;  2JK3 A;  4ZZL A;  4AC0 A;  2W48 A;  3VEP A;  4DZJ A;  3C2G A;  1VQL I;  5F64 A;  1R5I D;  2IW5 A;  1KU7 A;  2H8W A;  1IV6 A;  2VON A;  2D1V A;  1Y8Q B;  4RS8 A;  4I99 C;  3K4B A;  3GZ5 A;  5KHD A;  4WXH A;  3FX3 A;  3ASN H;  2NVU B;  1ZHF A;  3DTI A;  4DYR A;  3B02 A;  2H09 A;  4XKB A;  1LB2 A;  4S0H B;  4Z2Y A;  2BOL A;  4CCK A;  1MKM A;  3K1N A;  3R60 A;  3PSF A;  4KIF A;  1G59 A;  2ZFW A;  4G7Z F;  3FK6 A;  2L0K A;  1XS9 A;  4A5M A;  3NWT A;  3SDG A;  2W85 A;  1N77 A;  5H6Q A;  2E36 A;  2CO5 A;  4HNU A;  3KLO A;  3VSK A;  3FHN A;  3A1Y A;  2JWT A;  3V7C A;  5C44 J;  2E2H J;  1BR4 A;  2ZC2 A;  2EPF A;  1FPQ A;  2A61 A;  1U2W A;  2Y2Z A;  4DNC A;  2XPW A;  2VQG A;  2H94 A;  3QYE A;  3L9F A;  4RB0 A;  4UVB A;  2OUM A;  2MC4 A;  5FLM J;  5HLI A;  3ZQH A;  1OKR A;  1MMG A;  1WJB A;  2ZBK A;  3CP2 A;  3L2R A;  3HJE A;  4YII A;  3GTP J;  5KCM A;  2R7S A;  1BM9 A;  3KZI C;  4ZYD A;  1S7A A;  1LFU P;  2LC2 A;  5F0F A;  1ZG1 A;  4C3H J;  3LSH A;  1XSV A;  1XC5 A;  1XGN A;  2XAG A;  4ZJZ A;  1VQ7 I;  2NNN A;  1I3A A;  4DW6 A;  1YIO A;  3U1K A;  1HOM A;  4AID A;  3SXY A;  2ETH A;  5K5O A;  2Y9Z A;  4ZYA A;  2AS5 F;  1ULY A;  2QM3 A;  2EFQ A;  2DMU A;  1CF7 B;  2MLG A;  3I55 I;  2JMW A;  5DM7 F;  2XKP A;  3GTL J;  1JI8 A;  4Y33 A;  2HYG D;  1AKH A;  2GAU A;  2G7H A;  2W82 A;  2W7N A;  1JKQ C;  5FLX K;  3HSR A;  4M3G A;  3NEU A;  1AOY A;  4M73 A;  3S2W A;  2CQX A;  1WRJ A;  3ZQL A;  1QA6 A;  3ASO H;  1T6S A;  1HQC A;  3GTJ J;  1H89 C;  1SVL A;  1WVR A;  1A36 A;  3I5U A;  2EZH A;  1VQ9 I;  3HOW J;  5FO5 A;  3RZD J;  2AXL A;  2QEX I;  3OYB A;  3L2V A;  3J80 K;  2DYR H;  1OCR H;  2Y0S A;  3EYY A;  4B3X A;  1K6O A;  4E7I A;  4XMY A;  3GFI A;  4UY8 I;  3S3O A;  1IRX A;  2EIM H;  3B6C A;  2VUM J;  4LIV A;  2VKH A;  1G8X A;  2VOD A;  1BW5 A;  5HS9 A;  2CW7 A;  2ZJR F;  4YFX F;  5HVQ C;  2MYS A;  2RNJ A;  3WGH A;  3AAF A;  4G6T B;  4EMS A;  1X4O A;  4AU7 A;  2HGC A;  1R22 A;  5ICG A;  1MMD A;  5BS6 A;  3A0H C;  3H36 A;  1HW1 A;  3PO3 J;  1JKP C;  3T1B A;  2BW3 A;  4Y4R A;  4XSX F;  3GTG J;  2HXI A;  3L2W A;  2R7W A;  1WH7 A;  1TBX A;  2EH3 A;  4XIC A;  1RUN A;  1YRN B;  4B44 A;  3FXR A;  4XLP F;  3ZCO A;  2PBI A;  3V42 A;  1Y6I A;  3IAS 2;  3DU6 A;  1DGR M;  1X3U A;  1S5L C;  2L9N A;  2L3D A;  1S7O A;  1YHQ I;  2NOJ B;  2M45 A;  1P92 A;  3SQN A;  3NQO A;  2UZK A;  2QWW A;  4I09 A;  3QOD A;  1LE8 B;  2ISZ A;  5DCM A;  3GWZ A;  2M0M A;  2F5F A;  3HKZ N;  4KN4 X;  1JGG A;  2BY2 A;  4IKF A;  3F22 A;  4OIO F;  5H2F C;  1XGO A;  3G3Z A;  2KRF A;  4AYB A;  5ICE A;  3J7A Y;  9ANT A;  2DAO A;  2FSW A;  3LL7 A;  5LGU A;  4JK1 X;  4LOC A;  2K27 A;  3HGG A;  2E1M C;  3SZP A;  4LG0 A;  1K4S A;  1D0Y A;  4II2 A;  3AFH A;  3EYI A;  1W5T A;  1SAX A;  5FKL A;  3SJM A;  3F8B A;  3H0D A;  2V26 A;  4IXA A;  2L4M A;  1DP7 P;  2O03 A;  5E8I A;  5K5R A;  2M8E A;  3F9K A;  2XF5 A;  5F04 A;  4RAY A;  5DTD A;  1SFK A;  1MBE A;  3BR3 A;  3ZQC A;  2VBZ A;  2E1M B;  4BBR J;  2FA5 A;  3HG9 A;  3CCQ I;  4A3J J;  1X3W B;  2NVQ J;  2WAF A;  1R49 A;  4AVP A;  1EV7 A;  4QPO A;  1GV2 A;  1POG A;  2GIZ A;  5JFR A;  4BQA A;  1FZP B;  3SZT A;  3ERE D;  4X0G A;  1OMI A;  1HA8 A;  4BJ6 C;  1IXC A;  4BNC A;  3A03 A;  3LOC A;  4KMU X;  3AKZ A;  3TW7 A;  3PIP F;  2E19 A;  2OV7 A;  2XGX A;  1F43 A;  1NHA A;  2KIQ A;  5L3E A;  2EFO A;  1S6L A;  2AO9 A;  1FOW A;  2MG4 A;  3CF2 A;  3I3L A;  3KCC A;  5IYC J;  2EA2 A;  2X48 A;  4HF0 A;  3QU6 A;  3QQA A;  3GX4 X;  1SMT A;  3DBH B;  5J4V A;  4B43 A;  4KIB A;  1CF7 A;  5EEG A;  4OIP F;  2FX0 A;  4A69 C;  3L2U A;  1SFE A;  4BE0 A;  1BJA A;  3L00 A;  3TKY A;  3LSP A;  4AVZ A;  2HDC A;  3KP5 A;  4L9J A;  3OYE A;  4OMY A;  3RPU A;  1H9G A;  1D3Y A;  3O6B B;  2QLZ A;  5B1A H;  1XSX A;  3RKW A;  1T8I A;  1V4R A;  1JTY A;  2GA1 A;  1YW8 A;  2VBY A;  4MHG A;  1CQT A;  3UKG A;  2FOK A;  5C4X J;  5LRS A;  5HS8 A;  4BHB A;  4EGY A;  4GYG A;  3J7A O;  2ZXJ A;  2OQG A;  2WAQ N;  1BN5 A;  1GLN A;  1IO2 A;  1XGS A;  2K9S A;  1DGW Y;  3CP8 A;  4MGR A;  4YIF A;  4ESB A;  3GTQ J;  1T98 A;  1MH4 A;  1GVJ A;  4QPQ A;  3G4S I;  1AHD P;  4LLN A;  2K3P A;  4NNJ A;  1G3T A;  3FXJ A;  3GEZ A;  1D0Z A;  3JRA A;  1UFM A;  2X1C A;  1D0X A;  2DK8 A;  2E1O A;  5E8G A;  5EG0 B;  2XRO A;  1ERD A;  2XDV A;  2ICW G;  3S16 J;  1YYV A;  4RGU A;  1MBK A;  3ZGK A;  4Y17 A;  2L9R A;  3HOY J;  1Z6T A;  3S93 A;  1OCC H;  5IYB J;  1WJC A;  5FLV A;  4Q5S F;  2JVG A;  1WI3 A;  3ULQ B;  3ZQG A;  2A69 F;  2EZI A;  3GLL A;  2EV5 A;  2Y30 A;  4MFE A;  4FE7 A;  1K83 J;  2LY9 A;  2LRD A;  5F27 A;  3IHU A;  1IN8 A;  2BGC A;  1ETK A;  3Q3S A;  3UNG C;  2EFW A;  4CZC A;  1NG7 A;  5EYR A;  2DDA A;  1SD4 A;  2RC4 A;  3F6V A;  1K78 B;  2E5N A;  2FE3 A;  2R7U A;  4HLX A;  2K5C A;  3BLY A;  2JVH A;  2A6T A;  4FT8 A;  1R4M B;  3S15 J;  4XLE A;  1WJA A;  1W5C C;  5LHI A;  3OYI A;  1G2H A;  4M6V A;  1GVD A;  3FXK A;  1LE8 A;  3TOB A;  4KIT B;  2DPD A;  1PUF B;  3TL4 X;  1T95 A;  5JLW A;  3J7Z I;  3AL0 C;  1MDM B;  1RNL A;  4BXU A;  1DU0 A;  2ECB A;  3DEU A;  1O3S A;  5LLQ A;  4L9N A;  4CZZ A;  1P2F A;  2E1C A;  3FIS A;  3HOZ J;  1KON A;  4IRI A;  1QZY A;  3PIO F;  3GZ6 A;  1UJ8 A;  4CCJ A;  2D5V A;  2XGC A;  2HVR A;  1WWX A;  2DTZ A;  1EH6 A;  2HQR A;  3AL0 B;  2XRN A;  3HOX J;  4A3G J;  4OAZ A;  4PZJ A;  4NB5 A;  2BHY A;  3KPH A;  3TP3 A;  2LLK A;  2ELJ A;  1MBJ A;  4M71 A;  1JXS A;  4BY1 J;  1ZH5 A;  1TQM A;  1WSU A;  4G8X A;  1TC3 C;  1AWC A;  2VXZ A;  1IXR C;  3H3V K;  3W3C A;  5JI6 A;  1VQM I;  3H92 A;  4F92 B;  3ONQ A;  2V6C A;  1L0O C;  1I6X A;  5CVJ A;  3KX2 A;  2JPC A;  2UXX A;  3GO5 A;  4HA8 A;  2XIG A;  4Q47 A;  1RRJ A;  2K86 A;  1HBX G;  3ZQI A;  3A01 A;  3Q9V A;  4QTR A;  1JTX A;  1ON2 A;  2F5V A;  3RPU D;  4LK1 F;  1I39 A;  5IOZ A;  1MMA A;  1YW7 A;  2X6W A;  3QWL A;  5A2Q K;  3OYN A;  4M3D A;  3WTU C;  4CCN A;  4XRF A;  2OCC H;  2XAQ A;  3KP6 A;  1HXD A;  2HOE A;  5D4R A;  3CMM A;  3SEZ A;  2DO7 A;  3MD2 A;  3HDD A;  2BYV E;  2QSG X;  4XOP A;  1ZGA A;  4OIN F;  4HBL A;  2DT7 B;  4XSZ F;  3QOP A;  3H1C A;  3O8H A;  1B9M A;  1EKE A;  4A93 J;  2FML A;  1TQP A;  3JRF A;  3W2A A;  3ZXS A;  5ILV A;  3GXO A;  4R79 A;  2Z9O A;  1VF9 A;  5IOY A;  1FBQ A;  4IVN A;  4L9T A;  1USS A;  3MMY B;  1JKO C;  2PLY A;  4BAC A;  1Y56 A;  1E3O C;  5IP9 J;  2LH9 A;  3GW2 A;  2L7F P;  2CWE A;  1XN7 A;  2LKS A;  4NUB A;  3G2B A;  5CKT A;  1KU9 A;  1DP3 A;  2KFD A;  2LMD A;  1R5H A;  3E3V A;  4L5E A;  2MH2 A;  2V79 A;  1C0W A;  1P7J A;  5TJJ A;  3CCJ I;  1IRZ A;  5F1R A;  4A2U A;  5E3N A;  1ZYR F;  1N75 A;  3FXU A;  3H5N A;  3ECO A;  2O7O A;  5CVV A;  1MJB A;  3P9I A;  2DOD A;  3OS2 A;  3L2C A;  4PJ0 C;  3JRG A;  2MGQ A;  3CCV I;  3IH3 A;  2ADU A;  4IHW A;  3CCE I;  4MNU A;  5E3O A;  2EBI A;  5BQT A;  1ZAR A;  1IV8 A;  1TW2 A;  5EG0 A;  3TDZ C;  2K3F A;  3GBG A;  3OSF A;  4J19 A;  3RJP A;  2GQQ A;  5EEH A;  1VQ8 I;  5B5E C;  3F8M A;  2HZT A;  2NVY J;  1U3E M;  1U9O A;  1ON1 A;  3OIQ A;  4LLL A;  2HYF A;  2ISY A;  4XOR A;  2XSJ C;  2IPQ X;  3K2Z A;  5DYM A;  2PMH A;  3E5Q A;  2GXG A;  2WA0 A;  3BG5 A;  4C30 A;  2IT0 A;  4C2M J;  3MFK A;  3HB9 A;  3PUB A;  4AIJ A;  1Z05 A;  2XB5 A;  4NDL A;  4HLY A;  2A05 A;  2TDX A;  1K78 A;  2WAD A;  2NS8 A;  2W24 A;  3HM5 A;  3KZZ A;  4JBA A;  4BJT A;  3J7Y J;  4N9H A;  4TV7 A;  1ONV A;  4HX8 A;  3OYC A;  1IGN A;  2Y0M A;  4XID A;  3K4C A;  4DYQ A;  1MJA A;  2E5Z A;  3S1R J;  4J00 A;  1F1Z A;  1APL C;  2A6H F; 
#chains in the Genus database with same CATH homology
 2JSC A;  4WWC A;  4HF1 A;  1P4X A;  4IJA A;  4P9U A;  2ESN A;  1QO0 D;  1MDM A;  3HSF A;  5CVR A;  4RAZ A;  1IUY A;  1HKQ A;  4U88 A;  1CGP A;  5CVI A;  3FHZ A;  3TO6 A;  1FT9 A;  3LA2 A;  2ACJ A;  2D2W A;  2GZW A;  2MC3 A;  5D5U B;  2JPB A;  3VOE A;  2CYY A;  1W5S A;  3Q9S A;  3VFZ A;  4UUV A;  3SFZ A;  3BJO A;  2YSR A;  5CLS A;  1IXS B;  2YR2 A;  2P6S A;  2IJL A;  3IKT A;  1FBS A;  2BV6 A;  3KP4 A;  2CSO A;  2DQL A;  2QBY A;  2Z99 A;  2RV8 A;  1PP8 F;  3L09 A;  2VE9 A;  3I59 B;  4RGX A;  4KYW A;  2RQP A;  2M5W A;  4QWQ A;  5JR3 A;  4L0Z B;  4I01 A;  5F6F A;  4AD9 A;  1I1G A;  1GHC A;  2HKO A;  1FX7 A;  2KJB A;  4B8X A;  2QEN A;  3HRS A;  2QVO A;  3ZP5 A;  4EJU A;  4LFU A;  1IN7 A;  3REO A;  3W6K B;  4XBF A;  2OA4 A;  5E18 F;  5DD8 A;  5ILS A;  2QQ9 A;  3ZPL A;  1BIA A;  1YG2 A;  2HR3 A;  1REP C;  5D8K B;  3V8K A;  2ZME B;  4CGZ A;  2KKO A;  1E2X A;  2NNY A;  2M87 A;  3E6B A;  1G3W A;  1LJ9 A;  4GCV A;  5D4S A;  2LNB A;  4LJZ F;  1YS6 A;  3DXJ F;  2V1X A;  3HOT A;  3R0J A;  3GFJ A;  4YFN F;  3C18 A;  3K1M A;  2EA4 A;  3L7W A;  2PQ8 A;  2CFX A;  1R5G A;  1Z1D A;  3TDU C;  2O6G E;  4XLN F;  1IW7 F;  4LLG F;  1U8R A;  3LFK A;  3DKW A;  4LD5 A;  3E97 A;  3ML6 A;  2XVC A;  1XB4 A;  3FM5 A;  4M6Y A;  3QU3 A;  5DUI A;  4G6Q A;  1YTY A;  1JHH A;  1FWZ A;  3WTX C;  4KA4 A;  3OV8 A;  2A6E F;  3GYH X;  1WI9 A;  1TLH B;  1W7P B;  5FD6 A;  4U0W A;  5DD4 A;  2W25 A;  1KU3 A;  2DLL A;  1OR7 A;  1SD6 A;  4EM2 A;  5LGT A;  4G7O F;  2YPR A;  3LWF A;  3WTZ A;  2MH9 A;  1Y0U A;  1XMK A;  2RN7 A;  1LVA A;  2DBB A;  4I02 A;  4O5V A;  5H6R A;  4CHU A;  1G4D A;  2L4A A;  1FSE A;  1I5Z A;  5AIP A;  4IF4 A;  1HKS A;  1YO5 C;  3WU1 B;  3I59 A;  2FNP A;  4AIK A;  1D8K A;  3RYP A;  3PQK A;  1MJ9 A;  4Q4Z F;  5HOO A;  4PGG A;  3EQL F;  5D6E A;  1SFU A;  3F6O A;  3V8J A;  3P7N A;  3MZH A;  1FP1 D;  2XAH A;  3COA C;  1K79 A;  2XKO A;  3VOD A;  3HRT A;  3O3K A;  3R4K A;  4MQV A;  1B1B A;  4UXN A;  3LAJ A;  3ZMD A;  2E1N A;  2CQK A;  3ABT A;  3E6C C;  1RIO H;  1UCR A;  1R36 A;  1MGT A;  2BBY A;  3U9G A;  2ZME A;  4G94 A;  1UST A;  5FLX Z;  5HDG A;  3JW4 A;  1BC7 C;  2P5L C;  1FOK A;  2ELH A;  3T5X A;  1FP2 A;  2FMY A;  4P96 A;  4OMZ A;  3U2R A;  5IT3 A;  2YX7 A;  2K4B A;  5HDN A;  5CVU A;  2O8X A;  4ZH4 F;  1XSD A;  2D1H A;  3J80 Z;  1QGP A;  2ZCW A;  2BEO A;  4RGS A;  3KEQ A;  4HAM A;  4ENN A;  3I58 A;  2IP2 A;  4L5I A;  1BBY A;  3N4M A;  1PDN C;  3BOQ A;  4UV8 A;  4ETS A;  3D5L A;  3W6J B;  2V1D A;  2P8T A;  3F8N A;  3F3X A;  2XAF A;  2W57 A;  4I0A A;  2IA2 A;  4PDK A;  3E6M A;  3LA7 A;  4I7H A;  4MEY F;  1XMA A;  5LHH A;  4I2O A;  4L18 B;  3ZQ7 A;  2XHK A;  2COM A;  1EH7 A;  5FGM A;  3GFL A;  2L01 A;  1ZAO A;  4HDV A;  3BPV A;  3FWE A;  3ZMU A;  1H0M A;  2CGP A;  2OZ6 A;  5IT9 K;  2K4J A;  1J59 A;  3FF5 A;  1O3Q A;  3QP5 A;  3RYR A;  1KQ0 A;  3P9C A;  4KUM A;  2EFP A;  4L9V A;  2PG4 A;  2QZ8 A;  1O3T A;  3I4P A;  2KJC A;  4YG2 F;  3K1P A;  1ZLK A;  1IZ1 A;  2J5P A;  4RGR A;  1ZGJ A;  2JTV A;  4A6E A;  1P4W A;  1FSH A;  2X4H A;  4E70 A;  3IKV A;  4HX4 A;  3RIR A;  5ICF A;  2VBW A;  4PCQ A;  3KP7 A;  2BE5 F;  2ZNY A;  4IHS A;  5FFX A;  4KNY A;  5JVT A;  3WOD F;  4HZF A;  5BMZ A;  1FBU A;  1BOA A;  2P4W A;  3BDD A;  1IN5 A;  3IRQ A;  1J5Y A;  2P7C B;  1U6G A;  4A12 A;  1FY7 A;  3IC7 A;  3J81 K;  3M7G A;  4ESJ A;  1P4A A;  3WE2 A;  4CO8 A;  4LMY A;  1ZRC A;  2FRH A;  2KIM A;  2GXB A;  4U7D A;  3CJN A;  4GXO A;  3CO6 C;  4Y15 A;  2HS5 A;  3F72 A;  2B0L A;  2IA1 A;  4Y13 A;  3H3Z A;  1F5T A;  2A07 F;  1YS7 A;  1W4M A;  3K9T A;  5L3G A;  1Z6R A;  2EV0 A;  3V4G A;  1GXP A;  2ZKZ A;  4CYD A;  3GUD A;  3ABU A;  1P6R A;  4Q48 A;  1KYZ A;  4HV5 A;  3KE2 A;  3SHF A;  4GGG A;  4ENM A;  5LEJ A;  5D6F A;  1Q1H A;  4U0V A;  4UV9 A;  2A68 F;  4KT5 C;  2DU9 A;  3HHG A;  2RDP A;  3KET A;  3EET A;  2YU3 A;  4UVC A;  5KVR A;  3RTR A;  1U78 A;  3JAM K;  2EFN A;  3QPT A;  3R61 A;  1U5T B;  3M8F A;  1O3R A;  2OU2 A;  1T38 A;  1XCV A;  4NHJ A;  5LEK A;  3BWG A;  1IN6 A;  1TW3 A;  5K1Y A;  3I53 A;  5A2Q Z;  4WX9 A;  2FQ3 A;  4FX4 A;  2F2E A;  3LAP A;  4ZYE A;  1JHF A;  1BI0 A;  3ELK A;  1BC8 C;  1G3S A;  2XAJ A;  5FFZ A;  1F4K A;  2KIU A;  3F8F A;  3I0T A;  4ASN A;  2EK5 A;  3MZY A;  1ZRD A;  5D8L B;  4EQQ A;  5ED4 A;  2DQR A;  1IN4 A;  2Q0O A;  1LNW A;  4P9F A;  1HW5 A;  4S05 A;  1YFH A;  1J0R A;  1SD7 A;  4M9Z A;  2UXN A;  3RKX A;  3TO9 A;  2VN2 A;  1Z91 A;  2LF7 A;  2H27 A;  3KP3 A;  3P9K A;  4WK8 F;  1YLF A;  5E17 F;  3BZ6 A;  4O6J A;  3MWM A;  3Q5F A;  3DQV C;  1H9T A;  3K69 A;  4ZYH A;  4EJT A;  4WCG A;  1ZLJ A;  3FMQ A;  2J5O A;  1FC3 A;  1LDD A;  1FYK A;  4IHT A;  2RGV A;  3B73 A;  4S04 A;  5JHU A;  5ERI A;  3ZN0 A;  2CW0 F;  2KIF A;  1LQ1 A;  1UB9 A;  1OYW A;  1SFX A;  2DPU A;  1B9N A;  4I98 B;  4PGH A;  2VT3 A;  2VOO A;  2WC2 A;  2Z5U A;  1OYI A;  3CUQ C;  1VTN C;  4UVA A;  2NRA C;  3U1D A;  1OPC A;  4RB2 C;  3ZMZ A;  3WTV C;  3WGG A;  4GO1 A;  5L3D A;  3I71 A;  3OOP A;  3CUQ B;  2M30 A;  2ZO4 A;  1JGS A;  4BAY A;  2VC0 A;  5CYV A;  5HS7 A;  5DCM B;  5L3F A;  3C7J A;  3JTH A;  3PFI A;  1DPU A;  1OYY A;  1UHW A;  1RZ4 A;  1O57 A;  3HIF A;  2MD5 A;  2FU4 A;  4HW0 A;  3WU0 A;  4LB5 A;  2FBK A;  2ZNZ A;  2O61 A;  4R1H A;  4LG0 B;  3ZMS A;  1R1V A;  1PUE E;  2EB7 A;  2NS0 A;  3I54 A;  5ICC A;  1DUX C;  5KK1 A;  1R1U A;  1WQ2 A;  2LKP A;  1J9I A;  2O3F A;  3GF2 A;  1J7K A;  4FX0 A;  5D5V B;  2E7W A;  2HTS A;  3RKY A;  5J8F A;  2UWM A;  1RI7 A;  2HFH A;  2YX4 A;  3WG9 A;  5E1Z B;  1UHM A;  5DCF A;  4M74 A;  2VT2 A;  2R3S A;  5AON A;  1HW2 A;  2OQR A;  4LGW A;  4DQ2 A;  4ENJ A;  1JE8 A;  4I0B A;  4M9S A;  4UNO A;  2ESH A;  4KMF A;  3IL2 A;  4HOB A;  1D5V A;  3BJA A;  3GLX A;  1T0F A;  2Y48 A;  5D5X B;  4A0Y A;  1S29 A;  3CUO A;  1ZN2 A;  3KP2 A;  4UHT A;  2FNA A;  3FMR A;  1IRF A;  3DF8 A;  4BHP A;  3DP7 A;  4WXC A;  1GXQ A;  3E6D A;  2W84 A;  1DDN A;  3M1E A;  3IWZ A;  2LDU A;  2NAZ A;  3C3W A;  4HQE A;  1T2K A;  1QQI A;  3BP8 A;  5E1X A;  3TO7 A;  3CUQ A;  1IF1 A;  2HKX A;  1B4A A;  1BIB A;  1XCB A;  2OZU A;  2FF4 A;  1R1T A;  5BPI A;  2EJR A;  1G6N A;  1PP7 U;  1ZG3 A;  2Q2E A;  1FNN A;  3R6S A;  3FZV A;  5H20 A;  1QZZ A;  1LEB A;  2H6B A;  4U7B A;  1KA8 A;  2VBX A;  3F23 A;  5DUK A;  2XV4 S;  2DI3 A;  4FHT A;  4MQ9 F;  4KDP A;  3ECH A;  2H6C A;  2Q8K A;  2FBI A;  5LGN A;  3IRR A;  4HF2 A;  3BJ6 A;  3HYI A;  1YQA A;  2LSO A;  4HV6 A;  5L3B A;  3QAH A;  4GYI A;  2QYO A;  1R23 A;  4EM0 B;  1IRG A;  4OU0 A;  3GVA A;  3BPX A;  5FD5 A;  1W7P A;  3BRO A;  4CIC A;  4M9X A;  1HST A;  1B6A A;  3V7R A;  1SD5 A;  4MTE A;  2JT1 A;  3ISP A;  1XGM A;  1ZRE A;  4A0X A;  5LRR A;  3M8E A;  2HQN A;  2MBF A;  3MEX A;  3KFW X;  2E7X A;  2PJP A;  2R7D A;  3ZMT A;  4OIR F;  3K0L A;  3EDP A;  1J75 A;  4ZYG A;  2IRF G;  3FM3 A;  2HTJ A;  4HDU A;  2G9W A;  5K5Q A;  5FB2 A;  5DV5 A;  4QLC U;  3WE3 A;  1FYL A;  3R0A A;  4ZZD A;  4EJW A;  2DT5 A;  1XDU A;  1O7F A;  3G73 A;  5HDK A;  3ZN1 A;  3HHH A;  4EJO A;  5ILU A;  2V9V A;  2VC1 A;  1SMY F;  1R00 A;  4HQM A;  5J8C A;  3VB2 A;  1MD0 A;  3T0Y A;  3WGI A;  3D0S A;  1B59 A;  4CDG A;  1RUO A;  1I27 A;  2HEO A;  3TGN A;  2EWN A;  5LHG A;  1TNT A;  1TQI A;  3WTW C;  1T39 A;  4N9I A;  4R8H A;  1R7J A;  3V8L A;  4IRH A;  3V7S A;  2A3S A;  2P7V B;  1KU2 A;  2OD5 A;  3ZMV A;  1STZ A;  3DFG A;  3E5U A;  1KYW A;  4BYY A;  2F5C A;  2ZJ2 A;  5BPD A;  3C1D A;  5IT9 Z;  1E17 A;  3HRM A;  1F9N A;  1D8J A;  1KGS A;  2PEX A;  2DFI A;  2DTR A;  3CDH A;  4M6X A;  1W7P D;  3WTT C;  4IRG A;  3RI4 A;  2QUF A;  2MLK A;  1MZB A;  3RDI A;  3KZY A;  1LDJ A;  2R7F A;  1XD7 A;  3LA3 A;  4RB3 C;  2FEZ A;  2PFB A;  3LQQ A;  2PN6 A;  2GWR A;  3F8C A;  4H0E A;  1IAW A;  3T8T A;  2C6Y A;  3TQN A;  3DV8 A;  4P5O A;  4HX7 A;  1QBJ A;  1O7L A;  2PMU A;  3HTS B;  1HKT A;  4OIQ F;  4AIH A;  4KN7 X;  2L02 A;  2K02 A;  2QBY B;  4WXD A;  4A6D A;  1ODD A;  3FXQ A;  3EUH A;  6PAX A;  4EM1 A;  2DW4 A;  1EH8 A;  2WWY A;  2P6T A;  2K7L A;  3QPH A;  3IWF A;  3E5X A;  5TRD A;  4U0Y A;  1ZG5 A;  4B09 A;  4LB6 B;  2F5E A;  1U5T C;  4G6D A;  3LST A;  3JSP A;  2XUB A;  3O2P E;  4M72 A;  4ESF A;  3J81 Z;  4NQW A;  2VOP A;  4EGZ A;  2MA3 A;  1I1S A;  1WKM A;  5D5W B;  4CXF A;  3CLO A;  4G9Y A;  2D45 A;  3WTS C;  2JRT A;  2L54 A;  2WTE A;  5DDG A;  2QQA A;  3I64 A;  4MTD A;  1ZRF A;  2OAZ A;  1BI3 A;  4EV0 A;  4A5N A;  3M9A A;  2P5V A;  5E20 A;  3H3U A;  3DPT A;  2STT A;  1V3F A;  4A0Z A;  5CJ9 A;  4OOI A;  3GFM A;  5HLG A;  1S3J A;  4EVI A;  4JQF A;  4D0P A;  4L5J A;  1KQ9 A;  3QP6 A;  1TTY A;  2WV0 A;  4BH9 A;  4KFC A;  3MAJ A;  2F5D A;  2Z3Y A;  3MCZ A;  5DEQ A;  1J2X A;  4MEX F;  4IPA A;  3HSE A;  5L3C A;  4KIG A;  3PQJ A;  1A04 A;  3JAM Z;  2RVC A;  2RKH A;  1S8N A;  3F21 A;  4KIC A;  2OBP A;  4HYE A;  3HRU A;  2Y75 A;  1LEA A;  2O0Y A;  3HTU A;  5J6X A;  5LBQ A;  4L0Y B;  1QNT A;  4YFK F;  1LDK B;  2JZY A;  1DPR A;  3KEO A;  3FMS A;  4P55 A;  1TNS A;  2QQB A;  1L3L A;  1G3Y A;  2LF8 A;  4BHC A;  4ON0 A;  2NYX A;  5HLH A;  1XDS A;  1K7A A;  2EV6 A;  1FYM A;  1Z9C A;  2HWV A;  3T8R A;  2FXA A;  2P5K A;  4O3M A;  3HOS A;  3JSO A;  4LK0 F;  2IVM A;  4WF2 A;  1FLI A;  2VE8 A;  3ROU A;  3WTY C;  2FBH A;  5E1W A;  3BY6 A;  5BOX A;  4AWX B;  2G7U A;  3CTA A;  4G7H F;  5AIQ A;  1QPM A;  3MQ0 A;  3LQR A;  3N97 A;  2XAS A;  1BI2 A;  3KLN A;  2Z33 A;  1YW9 A;  2DK5 A;  2STW A;  2PI0 A;  1HSJ A;  3QRF F;  3NRV A;  3TOA A;  3CO7 C;  4N0B A;  3HUG A;  2GIV A;  2A5Y B;  1R58 A;  2M1B A;  2X0L A;  4F7Z A;  4RB1 A;  1Z7U A;  4ENK A;  1BI1 A;  1U5T A;  4K2E A;  2GA2 A;  2CG4 A;  1KQ8 A;  2V1U A;  3JTG A;  2IA0 A;  3RPQ A;  3DPL C;  4EJV A;  4ZZL A;  3VEP A;  5F64 A;  2IW5 A;  1KU7 A;  2VON A;  2D1V A;  4RS8 A;  3GZ5 A;  4WXH A;  3FX3 A;  1ZHF A;  3B02 A;  2H09 A;  1LB2 A;  4Z2Y A;  1MKM A;  3K1N A;  3R60 A;  4KIF A;  2ZFW A;  4G7Z F;  4A5M A;  2W85 A;  5H6Q A;  2CO5 A;  3KLO A;  3V7C A;  1FPQ A;  2A61 A;  1U2W A;  4DNC A;  2H94 A;  3L9F A;  4RB0 A;  4UVB A;  5HLI A;  1OKR A;  2ZBK A;  4YII A;  1BM9 A;  4ZYD A;  1S7A A;  1ZG1 A;  1XSV A;  2XAG A;  1XGN A;  2NNN A;  1YIO A;  3SXY A;  2ETH A;  5K5O A;  2AS5 F;  1ULY A;  2QM3 A;  2EFQ A;  1CF7 B;  2MLG A;  2XKP A;  2HYG D;  2GAU A;  2G7H A;  5FLX K;  3HSR A;  3NEU A;  1AOY A;  4M73 A;  3S2W A;  1WRJ A;  1T6S A;  1HQC A;  3I5U A;  5FO5 A;  2AXL A;  3J80 K;  3EYY A;  1K6O A;  3GFI A;  2VOD A;  5HS9 A;  4YFX F;  5HVQ C;  2RNJ A;  3WGH A;  3AAF A;  4EMS A;  2HGC A;  1R22 A;  5ICG A;  5BS6 A;  1HW1 A;  3T1B A;  4XSX F;  1TBX A;  1RUN A;  3FXR A;  4XLP F;  2PBI A;  1X3U A;  2L3D A;  1S7O A;  2M45 A;  1P92 A;  3SQN A;  3NQO A;  2UZK A;  2QWW A;  4I09 A;  2ISZ A;  5DCM A;  3GWZ A;  2F5F A;  4KN4 X;  3F22 A;  4OIO F;  1XGO A;  3G3Z A;  2KRF A;  5ICE A;  2DAO A;  2FSW A;  5LGU A;  4JK1 X;  2K27 A;  3SZP A;  4LG0 A;  3EYI A;  1W5T A;  1SAX A;  3F8B A;  4IXA A;  2L4M A;  1DP7 P;  2O03 A;  5E8I A;  5K5R A;  2M8E A;  4RAY A;  2VBZ A;  2FA5 A;  4AVP A;  1EV7 A;  5JFR A;  4BQA A;  1FZP B;  3SZT A;  3ERE D;  1OMI A;  1IXC A;  4BNC A;  4KMU X;  2XGX A;  1NHA A;  5L3E A;  2EFO A;  1S6L A;  3KCC A;  2EA2 A;  4HF0 A;  3QU6 A;  3GX4 X;  1SMT A;  4KIB A;  1CF7 A;  5EEG A;  4OIP F;  1SFE A;  1BJA A;  3L00 A;  3TKY A;  2HDC A;  3KP5 A;  4L9J A;  4OMY A;  3RPU A;  1H9G A;  1D3Y A;  3O6B B;  2QLZ A;  1XSX A;  3RKW A;  1V4R A;  2GA1 A;  1YW8 A;  2VBY A;  4MHG A;  2FOK A;  5LRS A;  5HS8 A;  4BHB A;  4EGY A;  4GYG A;  3J7A O;  2ZXJ A;  2OQG A;  1BN5 A;  1XGS A;  4MGR A;  4YIF A;  4ESB A;  1T98 A;  1GVJ A;  4LLN A;  1G3T A;  3GEZ A;  1UFM A;  2DK8 A;  5E8G A;  2XRO A;  1YYV A;  4RGU A;  4Y17 A;  1Z6T A;  4Q5S F;  3ULQ B;  2A69 F;  2EV5 A;  3IHU A;  1IN8 A;  2BGC A;  2EFW A;  1K78 B;  2RC4 A;  1SD4 A;  3F6V A;  2FE3 A;  4HLX A;  4FT8 A;  5LHI A;  3TOB A;  2DPD A;  1MDM B;  1RNL A;  4BXU A;  3DEU A;  1O3S A;  5LLQ A;  4L9N A;  4CZZ A;  1P2F A;  2E1C A;  4IRI A;  1QZY A;  3GZ6 A;  1WWX A;  1EH6 A;  2HQR A;  2XRN A;  4PZJ A;  4NB5 A;  4M71 A;  1JXS A;  1ZH5 A;  1TQM A;  1WSU A;  4G8X A;  1AWC A;  2VXZ A;  1IXR C;  5JI6 A;  3H92 A;  2V6C A;  1L0O C;  1I6X A;  5CVJ A;  2JPC A;  2UXX A;  3GO5 A;  4HA8 A;  2XIG A;  4Q47 A;  2K86 A;  1HBX G;  3Q9V A;  1ON2 A;  4LK1 F;  1YW7 A;  5A2Q K;  3WTU C;  4XRF A;  2XAQ A;  3KP6 A;  1HXD A;  2HOE A;  5D4R A;  2DO7 A;  2BYV E;  1ZGA A;  4OIN F;  4HBL A;  4XSZ F;  3QOP A;  1B9M A;  2FML A;  1TQP A;  5ILV A;  3GXO A;  4R79 A;  2Z9O A;  1FBQ A;  4IVN A;  4L9T A;  1USS A;  2PLY A;  3GW2 A;  2CWE A;  1XN7 A;  1KU9 A;  1R5H A;  3E3V A;  2MH2 A;  2V79 A;  1C0W A;  5TJJ A;  5F1R A;  4A2U A;  1ZYR F;  3FXU A;  3ECO A;  5CVV A;  1MJB A;  3P9I A;  3L2C A;  2ADU A;  4MNU A;  5BQT A;  1ZAR A;  1TW2 A;  3TDZ C;  3RJP A;  2GQQ A;  5EEH A;  3F8M A;  2HZT A;  1U3E M;  1ON1 A;  4LLL A;  2HYF A;  2ISY A;  2IPQ X;  3K2Z A;  5DYM A;  2PMH A;  3E5Q A;  2GXG A;  2IT0 A;  3MFK A;  4AIJ A;  1Z05 A;  4HLY A;  2TDX A;  1K78 A;  3KZZ A;  2W24 A;  4JBA A;  4N9H A;  4TV7 A;  1ONV A;  4HX8 A;  2Y0M A;  1MJA A;  1F1Z A;  2A6H F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...