1U2WA

Crystal structure of the staphylococcus aureus pi258 cadc
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
109
structure length
105
Chain Sequence
GYDEEKVNRIQGDLQTVDISGVSQILKAIADENRAKITYALCQDEELCVCDIANILGVTIANASHHLRTLYKQGVVNFRLALYSLGDEHIRQIMMIALAHKKEVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cadmium efflux system accessory protein
publication title Crystal structure of the Staphylococcus aureus pI258 CadC Cd(II)/Pb(II)/Zn(II)-responsive repressor
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Dna binding protein
total genus 35
structure length 105
sequence length 109
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1u2wA00
1KU3A 2OZUA 4CICA 4RGUA 4KFCA 1I6XA 2VE9A 5HS9A 2GWRA 3J81Z 2YSRA 2CFXA 1LDJA 2NAZA 2HQNA 2CG4A 3U1DA 2QENA 4BHBA 2VONA 4OINF 1XSVA 1GXPA 5K5QA 3GVAA 3HHHA 4ENJA 4L0YB 1MJAA 1ONVA 2O3FA 3GFMA 2IA0A 4BQAA 3JSOA 3HRMA 3C1DA 3KP7A 3JW4A 4EJTA 1I1SA 4EJUA 1KQ9A 1RIOH 1F4KA 4PCQA 1WI9A 4UVCA 3MFKA 2PN6A 5CYVA 1J0RA 3T8RA 2ACJA 3BP8A 4BAYA 4I0AA 4S05A 3KP5A 3IKVA 3FWEA 2A5YB 1XN7A 4MHGA 2WWYA 4P96A 2PLYA 1ZAOA 2HOEA 2X4HA 3TO6A 4PGHA 5HVQC 2BBYA 2P5KA 3GUDA 3R0AA 3FMSA 1FWZA 4EQQA 5FFXA 1R36A 2IRFG 5J8CA 2VBWA 2XAJA 1ZN2A 2LF7A 2VOOA 5D4SA 1FP2A 1WWXA 5K1YA 1T0FA 3L09A 4UUVA 3CUQC 2F2EA 2PFBA 1SD5A 3L00A 2FEZA 1FBUA 5ICCA 2W57A 3KP3A 4LJZF 2O0YA 4ZYHA 2QUFA 2F5FA 2CO5A 5F6FA 3CTAA 2DPDA 1J9IA 2HWVA 4LG0A 2PG4A 2Q0OA 1PP8F 2DO7A 1JE8A 2VC1A 4LB5A 2Z99A 2O03A 1O3RA 2IT0A 3K1PA 3QPTA 2EFPA 4HX8A 3FHZA 2BEOA 1W7PB 4YFKF 1TW3A 3WTWC 3M8FA 1XB4A 3LQRA 4HF2A 4A5NA 1OPCA 3DPLC 1IRFA 4Q47A 3E6DA 1L3LA 1F5TA 2W25A 1F9NA 4PDKA 3HTSB 3HHGA 1SMYF 3KZZA 2K4JA 3IWZA 4HQMA 5D5WB 3LAPA 3TOAA 2Y0MA 4ENMA 3ECHA 2P5LC 4XSXF 3F72A 2ZBKA 1HSTA 4OMZA 5HDGA 3F21A 1FP1D 4S04A 2RQPA 4I01A 1ZG1A 4QWQA 5IT9Z 2JPCA 3V8LA 1QQIA 1BOAA 4A5MA 1SAXA 1BBYA 4FX4A 1MDMA 5LRSA 3G73A 4G8XA 3FXRA 5J6XA 2XAFA 1I1GA 4L9JA 2VBYA 3FXUA 2AS5F 4LLLA 1FT9A 1B9NA 5ICEA 2KIMA 1CF7A 3JTGA 3WODF 6PAXA 1FY7A 4ON0A 3W6KB 3NEUA 3R0JA 1F1ZA 2Q8KA 1BI0A 2NYXA 3RYRA 3BZ6A 4I0BA 3WTUC 3I4PA 3MZYA 2TDXA 2WTEA 4GCVA 2FBIA 3HSFA 1Z7UA 4HDUA 3FMQA 2D45A 5F1RA 3GX4X 5FLXK 2BYVE 5HDKA 1FPQA 5D4RA 2ISYA 4XBFA 5ILVA 3SZTA 1UCRA 1REPC 1AWCA 3F3XA 2QLZA 2JZYA 3IC7A 5D8LB 2WV0A 4A12A 3RI4A 2ESNA 2A61A 1ZH5A 2D1HA 2H6CA 3M8EA 3E97A 4CZZA 4KICA 1EH7A 1U5TA 2VBZA 1FBSA 2RV8A 3LA2A 5BOXA 3MQ0A 1HW2A 2RVCA 3IL2A 5DD8A 1G4DA 2QQAA 2CW0F 5DEQA 4LG0B 2UWMA 3Q9SA 2GQQA 3GFLA 4L9TA 1K7AA 1STZA 3FF5A 2Z3YA 2H6BA 2OA4A 2P5VA 2P7VB 2HYGD 1R5HA 4K2EA 3BJ6A 4YIIA 2Z9OA 1EH6A 4YFXF 2IA1A 4Y13A 1X3UA 2PQ8A 2A07F 3E5XA 2XV4S 4UVAA 2OD5A 2QM3A 5HS8A 2DT5A 1DP7P 3EETA 3C7JA 3JAMZ 4KMUX 4G7ZF 3LA3A 4JQFA 1W4MA 2O6GE 4MQVA 4G7OF 4HDVA 3F6OA 1LNWA 3I58A 2W85A 1IF1A 2E1NA 2ZKZA 2VODA 4PGGA 1RZ4A 1G3SA 1D5VA 1ZREA 1G3YA 1S7AA 3J81K 5CVUA 3L7WA 2FE3A 5LGTA 1OYIA 2HR3A 2OQRA 1LVAA 3K69A 3RKXA 3TDZC 1MDMB 1U3EM 5LHGA 2LKPA 3WTXC 2YR2A 1ZLJA 3P9CA 4ESBA 3WU1B 4UV8A 3I5UA 4R1HA 1J7KA 5ILSA 1U2WA 2F5EA 2EV0A 2HGCA 1R58A 5LEKA 4L5IA 2Z33A 2A6EF 4NHJA 2EV5A 2RNJA 1ZHFA 1BC8C 2XIGA 1TW2A 1LEBA 5CLSA 4M73A 4ENNA 5DCMA 3N4MA 5BQTA 2DBBA 4HBLA 3KP2A 4A6EA 1TTYA 4F7ZA 1B6AA 1YS6A 3MEXA 3PQJA 5FD6A 3KFWX 1BIAA 1U78A 2FXAA 2HQRA 4EM2A 1KU9A 3I53A 1UHWA 1O57A 2ISZA 3KEOA 1G6NA 4BNCA 2P4WA 2L3DA 1U5TB 1Z91A 4MGRA 1SMTA 1OR7A 2HEOA 1BC7C 4MTDA 4Z2YA 3J7AO 4U7BA 2Y48A 1R22A 4CHUA 2O8XA 1SFEA 3KCCA 2BE5F 2F5CA 2FF4A 4YIFA 4A0YA 2CYYA 3RDIA 2L02A 3ELKA 5TRDA 5J8FA 5FD5A 2NRAC 4RGRA 3O3KA 3EDPA 3TDUC 1WSUA 1B4AA 5DV5A 2ZNYA 2HKXA 2ADUA 5BS6A 2VXZA 1O7FA 3QAHA 4HA8A 2NNYA 3WE2A 5DUKA 3V8JA 3HYIA 3E6CC 1J75A 2MA3A 4M74A 3G3ZA 2FU4A 4LMYA 1S3JA 4IVNA 5DD4A 2Z5UA 3H3ZA 3RPUA 3WTVC 3BWGA 3E5UA 2EK5A 5JFRA 2C6YA 1SD7A 3WGGA 4L5JA 4OIRF 4WWCA 2M87A 4IRGA 4M9XA 4CYDA 5L3DA 1SD6A 2VOPA 4M9ZA 2ZNZA 3P7NA 3ZMSA 2G7HA 1USTA 4NB5A 3GLXA 1MD0A 2DK8A 1XCVA 4HQEA 5BMZA 1XD7A 3QP5A 1HBXG 3C3WA 1JHFA 4QLCU 5D6FA 3DQVC 4KUMA 4MEXF 1K6OA 3RYPA 4UNOA 2HYFA 1P4WA 1OYWA 4WX9A 3U9GA 2O61A 3GXOA 1FYKA 5D5UB 4YFNF 2JSCA 1XCBA 1DUXC 5L3CA 1J2XA 4EGZA 5ED4A 1R1UA 4IRHA 3W6JB 1W7PD 5ICGA 4IPAA 3TO9A 1LEAA 3IHUA 2DTRA 4L18B 1YLFA 1I27A 3QPHA 1IN5A 3ZMTA 2V9VA 1KQ8A 2JRTA 1OYYA 1HSJA 2LNBA 2KJCA 2XKOA 3BROA 2JPBA 2FA5A 1TQMA 3HTUA 3E6MA 3OOPA 2CSOA 1B9MA 1U5TC 4WXCA 2CQKA 3TGNA 3E6BA 4I2OA 1IAWA 2VN2A 4U0WA 4HF1A 5ILUA 3I71A 3AAFA 2FMLA 1ZYRF 1ODDA 2YPRA 4N9HA 3WU0A 2LSOA 1QBJA 4ESFA 2HFHA 3N97A 4UVBA 3GZ5A 3MCZA 3H3UA 2OZ6A 2K4BA 3M1EA 3LAJA 3ECOA 3ERED 2P6SA 1MJBA 2EFOA 4IJAA 3WGIA 4UXNA 2A69F 2FSWA 1R23A 1MZBA 1WRJA 1ZRFA 5KK1A 5E17F 3JTHA 4HLXA 4EVIA 2MH9A 2JT1A 2ZMEA 3V4GA 3FXQA 4Q5SF 5DCFA 3EQLF 2QQ9A 4CDGA 1B59A 5LRRA 4M71A 1B1BA 2MLGA 2PMUA 1E17A 4ZH4F 4EGYA 1Y0UA 3IKTA 3GF2A 1TQIA 5BPIA 4KNYA 5KVRA 4P9UA 4EJVA 2KJBA 1Z6RA 3LWFA 1USSA 2EFWA 3C18A 4HX4A 3ZMVA 3L2CA 3V8KA 2ZXJA 1P2FA 5E20A 2VBXA 3CO7C 1CGPA 2OAZA 3VODA 1LB2A 1KYZA 3K0LA 4I98B 3RKWA 4GO1A 2YU3A 2QBYA 4AVPA 5A2QK 5BPDA 3HIFA 5LHHA 2HKOA 1QNTA 3GWZA 3EUHA 2HZTA 1R5GA 2OQGA 3I59A 4LK0F 4KDPA 3CUQA 2YX7A 3U2RA 3SHFA 3JSPA 3MAJA 5H6RA 2PBIA 1BM9A 4L9VA 3R6SA 2KIFA 5EEGA 3LQQA 4OIQF 2FMYA 1YW8A 3HOTA 4AIKA 1YIOA 1V3FA 4HOBA 3TOBA 4HAMA 4RGXA 4G7HF 3QU6A 4ESJA 4KMFA 4JBAA 1T39A 3R60A 4I02A 1R1TA 1J59A 4HLYA 2D2WA 1XDUA 2XUBA 4KIBA 1HQCA 3GFJA 1QZZA 1D8KA 2P7CB 1XMAA 3LA7A 5ICFA 1H0MA 2XGXA 4HZFA 4LK1F 1IN6A 3LSTA 4GYIA 2RGVA 5E1XA 1TLHB 2YX4A 2J5PA 4PZJA 4MEYF 5E1ZB 2MC3A 2RN7A 2QWWA 1IN8A 1KU7A 4E70A 5L3BA 1W5SA 3I0TA 3RPQA 3IRRA 1GVJA 3KLOA 1BIBA 2L54A 1R7JA 1ZARA 2RC4A 1IZ1A 1UHMA 3GZ6A 5JVTA 4EMSA 1L0OC 1IXCA 1Q1HA 2EB7A 4GXOA 2FBKA 1YO5C 1XMKA 1Z05A 4ZZDA 5JR3A 3ML6A 2IP2A 3V7RA 2K86A 4O6JA 2XROA 4I09A 1KQ0A 3T1BA 5D5XB 3HSRA 2ZCWA 5LHIA 2RKHA 4WXHA 3OV8A 3HRUA 4ASNA 4H0EA 3KE2A 2DW4A 3DF8A 1PDNC 3QU3A 4RB1A 2XVCA 1YG2A 1O3TA 4WF2A 5JI6A 1CF7B 3KLNA 1G3WA 4NQWA 1LQ1A 4L0ZB 2XHKA 1XDSA 5CJ9A 3V7SA 1KA8A 1K78A 2H94A 3B73A 2XASA 4EJOA 1R1VA 3ZMZA 5FLXZ 1KU2A 3F22A 4MTEA 1ZRCA 5ERIA 1ON1A 3ZN0A 4MQ9F 3GYHX 2K27A 3ZMDA 3I59B 3F8FA 2H09A 2VT3A 2GA2A 1QGPA 4IXAA 1FOKA 2R7DA 2R7FA 4IHSA 2OU2A 4OIOF 5E8GA 1YS7A 2CGPA 3M9AA 3B02A 3RKYA 3REOA 5L3FA 4UV9A 4KA4A 3GFIA 3V7CA 3ZQ7A 2K02A 2M5WA 3CO6C 5HLHA 4HYEA 1BI1A 2FRHA 3S2WA 1S8NA 3P9IA 3QOPA 4O5VA 2XAGA 2COMA 2QYOA 3HOSA 4HV6A 1PUEE 1IRGA 2RDPA 3NQOA 2IJLA 2STTA 5FFZA 1O3QA 1HXDA 5K5OA 3BY6A 4LFUA 2M1BA 3VEPA 3QP6A 2MBFA 3K1MA 3J80Z 3BJAA 2FNPA 3H92A 1K79A 2V1UA 3ULQB 5LLQA 4LLGF 2BGCA 1T38A 2E1CA 4FHTA 5FO5A 2G9WA 3PQKA 5F64A 4CO8A 4HX7A 2PEXA 5LEJA 4JK1X 1FC3A 2DPUA 1ZG5A 2DQRA 4RAZA 1FSHA 5HS7A 2XRNA 1XSXA 1U8RA 1WKMA 4LD5A 2A68F 2CWEA 1S29A 3K1NA 4EJWA 2UXXA 3VFZA 4A0ZA 2GZWA 2E7WA 3E3VA 4FX0A 1XSDA 3ZPLA 2MLKA 2ZFWA 1V4RA 3SQNA 1HKQA 5IT9K 1FNNA 4IRIA 3KP6A 5AIPA 2ETHA 1FLIA 4ZYEA 4G6DA 3CJNA 5CVJA 4M6XA 3SZPA 5JHUA 2PI0A 4A6DA 3DXJF 4DNCA 2PJPA 3ABTA 3P9KA 4ZZLA 2KKOA 4KIGA 1K78B 5H20A 3I64A 5AONA 3O6BB 1Z1DA 1YFHA 1BI2A 1T98A 1YW7A 4ETSA 5DCMB 1EH8A 3QRFF 2GAUA 3TKYA 3E5QA 2L01A 5IT3A 3KEQA 4GYGA 3CDHA 4HW0A 2V79A 5DUIA 4RB2C 1P92A 2W84A 3WTTC 4LLNA 4G6QA 4ZYDA 4TV7A 2OBPA 2XKPA 3BDDA 2V6CA 2L4MA 1D8JA 1O7LA 1XGSA 4L9NA 1BJAA 4CGZA 2DK5A 3IWFA 1IW7F 1JXSA 4ENKA 2M45A 3DV8A 4D0PA 3FZVA 1BI3A 5E18F 2LDUA 3ZP5A 2DI3A 1YYVA 4KN4X 3EYIA 3DPTA 3Q5FA 3BPXA 5D6EA 2F5DA 3TO7A 4KIFA 2VC0A 1UFMA 2VT2A 1OMIA 2X0LA 4RB0A 4KT5C 3PFIA 3Q9VA 4EM0B 3KZYA 4KN7X 4AD9A 1W5TA 3DEUA 4OU0A 2GXGA 5AIQA 2IVMA 2GXBA 3SXYA 4MNUA 1FYMA 2R3SA 3F6VA 4Q48A 3ISPA 3F8BA 4EV0A 4AIJA 3T8TA 2P8TA 1GHCA 3DKWA 3F8CA 3NRVA 1XGOA 4I7HA 4AWXB 4Q4ZF 4RAYA 3LFKA 2EJRA 3WTYC 3R61A 3JAMK 2QQBA 2E7XA 2HTJA 3T0YA 2DFIA 2IW5A 2HS5A 3IRQA 2A3SA 1BN5A 4U0YA 2XAQA 2GIVA 3ZN1A 2EFQA 4LB6B 2J5OA 4BXUA 1TQPA 5LGUA 3RTRA 3F8MA 5TJJA 3GEZA 1PP7U 1IXRC 4HV5A 5D8KB 1HKSA 1P4AA 3M7GA 3ZMUA 2FNAA 2HTSA 3BOQA 5FGMA 4KYWA 4BHCA 3HRSA 3WE3A 2LF8A 2EWNA 1RI7A 4UHTA 3CUOA 3FM3A 4EM1A 1KYWA 1XGMA 2GA1A 2QZ8A 2ZO4A 2EA4A 4A2UA 3VOEA 1FZPB 1E2XA 1QZYA 2DQLA 3D0SA 4LGWA 1OKRA 3BPVA 2FBHA 2MH2A 1C0WA 3COAC 1LJ9A 5HOOA 1I5ZA 1DDNA 2STWA 1ZGAA 3KETA 1H9GA 1S7OA 1GXQA 5CVIA 4GGGA 3WG9A 5HLGA 1FYLA 1SD4A 5D5VB 3GW2A 4OIPF 1T6SA 1U6GA 1QO0D 2PMHA 5CVVA 4N9IA 4RS8A 1ZG3A 1ZLKA 4P9FA 5DYMA 2NS0A 1D3YA 5E8IA 3WTZA 2EFNA 3BJOA 5EEHA 4XRFA 1HW1A 1TBXA 3FM5A 4IF4A 4U0VA 2HDCA 1IN7A 4M9SA 4XLPF 1IUYA 2M30A 1YW9A 1RUOA 1SFUA 4HF0A 1MGTA 1SFXA 4U7DA 4R8HA 4RGSA 3HUGA 2BV6A 1YTYA 3J80K 2UXNA 2A6HF 2ZJ2A 3ROUA 4M6YA 1FX7A 4WK8F 4DQ2A 1TNTA 5H6QA 1S6LA 3WTSC 2ZMEB 4XLNF 4P55A 2EV6A 4U88A 4WCGA 3MWMA 3GO5A 4N0BA 1QPMA 3K9TA 4Y17A 5CVRA 1G3TA 2MD5A 1HW5A 3SFZA 2L4AA 2KRFA 1ULYA 5E1WA 2DAOA 4WXDA 1J5YA 2G7UA 2ELHA 1KGSA 2IPQX 4XSZF 2D1VA 2FQ3A 4IHTA 5HDNA 1R00A 1MJ9A 4OOIA 4BYYA 1IN4A 4CXFA 3MZHA 5A2QZ 4RB3C 2FOKA 2UZKA 1YQAA 4BHPA 1TNSA 5K5RA 3DP7A 2QBYB 1ZRDA 2XAHA 1FSEA 3D5LA 4AIHA 3L9FA 1UB9A 1LDKB 1LDDA 1FBQA 3TQNA 4ZYGA 2NNNA 4B09A 5HLIA 4O3MA 3CUQB 3FMRA 2AXLA 3K2ZA 1JHHA 2JTVA 3KP4A 1MKMA 3DFGA 1O3SA 1XGNA 4A0XA 5LGNA 4G9YA 1DPUA 5L3GA 3F8NA 2EA2A 1ON2A 5LBQA 1RUNA 1Z6TA 2WC2A 2DU9A 2KIUA 2DLLA 3RJPA 2VE8A 3HRTA 3FX3A 1Z9CA 3I54A 3ABUA 5DDGA 4P5OA 3CLOA 1ZGJA 3HSEA 3O2PE 1P6RA 3RIRA 1T2KA 4YG2F 4OMYA 2QVOA 4G94A 2H27A 3WGHA 1HKTA 3EYYA 4B8XA 2ESHA 3T5XA 1NHAA 2V1DA 2W24A 3R4KA 2B0LA 4R79A 2IA2A 1W7PA 2Q2EA 2Y75A 4Y15A 1RNLA 1A04A 4BH9A 5FB2A 4FT8A 2M8EA 1IXSB 2K7LA 3F23A 1WQ2A 1P4XA 4M72A 1H9TA 1AOYA 1DPRA 2V1XA 1VTNC 3VB2A 1EV7A 2P6TA 1JGSA 5L3EA
chains in the Genus database with same CATH superfamily
3I4NJ 2K40A 1KU3A 2OF7A 4BKXA 2OZUA 4CICA 4RGUA 4KFCA 1I6HJ 1I6XA 4I99C 5F0CA 5HS9A 2GWRA 3Q3SA 2VE9A 1S72I 3RQ4A 3J81Z 2BVMA 2YSRA 1ZQ3P 1Y1WJ 2PMZA 2L9RA 3K4LA 2CFXA 1LDJA 2NAZA 2HQNA 2CG4A 3U1DA 2QENA 1D0ZA 4BHBA 3JR9A 2VONA 4OINF 1XSVA 1N77A 1GXPA 2K85A 2EPFA 1BR2A 5GP9A 5K5QA 3GTLJ 3GVAA 3OYJA 4V19K 1E3HA 1YX3A 3HHHA 4ENJA 4XORA 4L0YB 4MFEA 4F3QA 5H2FC 1MJAA 1ONVA 2ZMEC 3OMYA 2O3FA 2X51A 3GFMA 1WZ2A 1PVEA 5EZGA 4XK4A 2IA0A 4BQAA 3BQZA 3JSOA 1W1WE 3HRMA 5E3NA 2DMPA 1Z67A 3C1DA 3KP7A 3MZ8A 3JW4A 4EJTA 2HPIA 5J4VA 1I1SA 5GADJ 2GOXB 3Q0UA 3ESWB 4EJUA 1KQ9A 5DM6F 3JREA 1RIOH 1F4KA 3ZQHA 4PCQA 1ZK8A 2DFEA 1VZ0A 3HGGA 4NQWB 1WI9A 3W2AA 4UVCA 3MFKA 3CCUI 2PN6A 4C2MJ 5CYVA 1J0RA 3T8RA 2ACJA 3BP8A 1I39A 4BAYA 4FISA 4I0AA 4S05A 1VQOI 1VQ5I 2CUEA 1V55H 3KP5A 3IKVA 3ZR8X 3FWEA 3TL4X 2A5YB 2WAFA 5C4XJ 4C3JJ 2DYRH 1XN7A 4MHGA 2K9MA 2WWYA 5EDNA 4LG3A 1E3OC 2E1MC 2L9SA 1IV8A 4P96A 3VYTB 2PLYA 3CF5F 1ZAOA 2HOEA 1X3WB 3DLAA 5CPRB 2X4HA 3FIWA 3TO6A 1O4XA 4PGHA 3BLYA 5HVQC 4G6TB 1JJ8C 2BBYA 2P5KA 2DFHA 2X6WA 3GUDA 4J00A 3R0AA 2X1EA 3FMSA 1W0UA 1FWZA 4XLFA 4EQQA 5FFXA 1R36A 2KRCA 2IRFG 4BS9A 5IYBJ 5J8CA 2VBWA 4XL9A 2XAJA 1PJRA 3SDBA 3RQIA 4BY7J 1TP4A 2VIXA 2KDOA 3GTMJ 5GAHJ 2DMQA 1ZN2A 2LF7A 4FETA 2VOOA 5D4SA 4PJLA 1FP2A 3IH3A 4M3EA 1WWXA 5K1YA 1T0FA 3L09A 2M0MA 1NG7A 4UUVA 3CUQC 2F2EA 4DBRA 2PFBA 3GTQJ 1SD5A 3L00A 4FE4A 1ENHA 3DPUA 4DYRA 3I9V2 2FEZA 4ZDLA 1FBUA 2X6OA 5ICCA 4CUGA 3GTPJ 1DU0A 3RPUD 3PNVA 2HPMA 2W57A 2CQXA 1IDYA 3KP3A 2DA7A 2O0YA 4HG2A 4LJZF 4ZYHA 2QUFA 3BQYA 2ZJQF 2F5FA 1B72B 3ZQIA 2CO5A 4X0GA 2UUZA 5F6FA 3CTAA 1SVLA 3BZCA 2DPDA 5HNFA 5E3LA 1J9IA 4CCJA 3JRIA 3QWLA 5IYDJ 2HWVA 4LG0A 2VUMJ 2PG4A 2BY3A 2Q0OA 1PP8F 2DO7A 1EA3A 1JE8A 3OY9A 2VC1A 4LB5A 1D1CA 2Z99A 2O03A 1O3RA 1VQLI 2NVYJ 2FUG2 2L5QA 4IEJA 3WHCA 3K1PA 2IT0A 3QPTA 2F48A 1D1AA 2LYCA 2EFPA 4HX8A 4RA2A 3FHZA 2BEOA 1W7PB 4YFKF 2Q2EB 3CCQI 1TW3A 4HSRA 3WTWC 3DTKA 3M8FA 4A3FJ 4IQ4A 5KCMA 1XB4A 3LQRA 4HF2A 1T8IA 3SYTA 4A5NA 2OTJI 1D1BA 1OPCA 3DPLC 1IRFA 4Q47A 3BR1A 4NUBA 3E6DA 1L3LA 1F5TA 2W25A 5J1UA 1F9NA 4PDKA 3HTSB 4XKVA 3HHGA 3PSIA 1SMYF 3KZZA 3OS0A 2K4JA 3IWZA 2KISA 3CJRB 2OCCH 4HQMA 1MBHA 5D5WB 3LAPA 3TOAA 2BVLA 2Y0MA 3BR6A 1VF9A 3ECHA 2P5LC 4XSXF 3F72A 4ENMA 4MLOA 3QPSA 4Y7NJ 2ZBKA 1HSTA 1CQTA 1WJFA 4OMZA 5HDGA 1MNDA 1VQNI 3F21A 1FP1D 1Z77A 3BZKA 2X1CA 5B1BH 4S04A 2RQPA 2X85A 3A01A 1JKOC 4I01A 2DOEA 1ZG1A 1ORKA 4QWQA 5IT9Z 4LOCA 2JPCA 3V8LA 1QQIA 2FD5A 1BOAA 4A5MA 1SAXA 2VB6A 2CMPA 4XMYA 4DW6A 1GLNA 1WPKA 4II2A 1BBYA 4FX4A 1MDMA 3S16J 4AM3A 5LRSA 3G73A 4G8XA 2HOAA 3QPLA 3FXRA 1Z7LA 2EINH 5J6XA 2XAFA 1JT6A 1K4TA 1I1GA 4AYBA 4L9JA 4A69C 2DOAA 1QVTA 4YIRX 2VBYA 1AHDP 3K4NA 3FXUA 2AS5F 4LLLA 1FT9A 1B9NA 5ICEA 2KIMA 1CF7A 3JTGA 5J1RA 3WODF 6PAXA 4XKWA 1FY7A 4ON0A 1X1CA 3FDYA 3W6KB 5F1JA 1X19A 2IGNA 3KPHA 4BEHA 3NEUA 2R7SA 2WAQA 3R0JA 1F1ZA 2Q8KA 1BI0A 2QKMB 3LSRA 2NYXA 4BXFA 3RYRA 2E2JJ 3BZ6A 3CCJI 4BXXJ 2GM4A 4I0BA 2BW3A 3PIOF 3HG9A 3WTUC 3I4PA 3MZYA 4IQJA 1HC8A 2R7UA 1X1AA 4D7MA 2TDXA 2WTEA 4GCVA 1W5CC 2CJJA 2HOTA 2FBIA 3IH2A 1N78A 4B4CA 3HSFA 3NAUA 1Z7UA 5C3EJ 3FMQA 3QYEA 4HDUA 5F1RA 2D45A 2M2EA 2VKHA 4FQGA 3GX4X 5M5YJ 5LD2C 5FLXK 2BYVE 1VNDA 5HDKA 1FPQA 2XGDA 5D4RA 2ISYA 4XBFA 5ILVA 3M07A 3SZTA 1UCRA 1REPC 1AWCA 2MSYA 3F3XA 2QLZA 2JZYA 3IC7A 5D8LB 2WV0A 1ETOA 1OISA 4A12A 3RI4A 1TWAJ 2ESNA 2HQ5A 2A61A 3IAM2 4A3KJ 1VFCA 1ZH5A 5C4JJ 2D1HA 2EZLA 2H6CA 2LK2A 2VASA 3M8EA 4UUTA 3BG3A 4QIWN 3E97A 4CZZA 4KICA 2XB5A 4XLCA 2DXIA 4MIMA 2A05A 3OWTA 1EH7A 2PX9A 5CQEA 1U5TA 2VBZA 1FBSA 2RV8A 3LA2A 1ETWA 2R7QA 5BOXA 2DMUA 4ZYAA 1IDZA 1N25A 3NARA 4ZC3A 3A4CA 3MQ0A 1HW2A 2RVCA 1UG2A 2X6YA 1FTZA 3L2RA 3ZQQA 3IL2A 5DD8A 3LSPA 2CFOA 2QQAA 1G4DA 2Y30A 2CW0F 2F4IA 3LSGA 5DEQA 1E3PA 4BY1J 4LG0B 4II3A 2UWMA 3Q9SA 2ECBA 2GQQA 3GFLA 5E79C 3OYGA 4L9TA 2MGQA 2VJJA 4HEA2 2LG4A 1K7AA 1STZA 3FF5A 3MMYB 2P0WA 2Z3YA 1HLVA 3CMYA 2H6BA 2OA4A 2P5VA 2P7VB 2HYGD 3I4MJ 2W48A 1R5HA 4XRSG 2CQNA 4K2EA 3BJ6A 3G6EI 1IRZA 4YIIA 2CV0A 1Z3YA 4JX4A 2L7KA 3AG2H 4Z6YA 3J7AY 2Z9OA 1A35A 1UJ8A 1EH6A 4YFXF 2IA1A 4Y13A 1X3UA 4ANJA 2PQ8A 2A07F 4AUXA 1YJWI 3E5XA 2XV4S 2VKDA 3OIOA 3X2QH 1Y8RB 2LBFB 4UVAA 4XN3A 2OD5A 3G1OA 1QHGA 2QM3A 3ASNH 5HS8A 2DT5A 2K3FA 5EYRA 1DP7P 3EETA 4F93B 3C7JA 3JAMZ 1P7IA 2VPRA 2R7VA 2JMWA 4AU7A 4KMUX 4G7ZF 1EJ9A 1SVOA 3LA3A 4JQFA 4XRMA 1W4MA 1BR4A 1G59A 1AKHB 4MQVA 2O6GE 4G7OF 2XPUA 4HDVA 2CQQA 3F6OA 1LNWA 2Z16A 3I58A 4CCLA 5IP7J 2IGOA 2W85A 1IF1A 2E1NA 2ZKZA 2VJIA 1ZR4A 2VODA 4PGGA 3S14J 3A01B 1RZ4A 1G3SA 1D5VA 3OL4A 1YOVB 4B44A 1ZREA 1G3YA 1S7AA 3MN2A 5B1AH 1ACIA 3J81K 2XC7A 5CVUA 3KYCB 3L7WA 2EIMH 2FE3A 5LGTA 1JJ6C 3TMOA 1OYIA 2HR3A 1G2HA 2OQRA 1LVAA 3K69A 3RKXA 4M3GA 3TDZC 4BJ6C 5IOYA 1MDMB 2E2IJ 1U3EM 3HKZN 5LHGA 2L7ZA 2KRHA 2LY1A 2LKPA 2X1DA 3IH4A 3WTXC 2EZKA 4ITVA 2YR2A 1HDPA 1ZLJA 2ZXIA 3K4KA 3P9CA 4ESBA 1S5LC 5KHDA 3S3OA 3WU1B 4UV8A 3JRHA 3I5UA 4R1HA 5J3LA 1WJEA 1J7KA 1FOWA 2EZIA 1IRXA 3L2WA 2R5YA 5ILSA 3OYMA 3PM1A 1U2WA 4UY8I 2DDBA 2F5EA 2EV0A 2HGCA 1R58A 2ZC2A 2XF5A 1HCRA 5LEKA 5DS9A 4L5IA 5B5EC 2Z33A 2A6EF 2CW8A 4NHJA 1Y0NA 2EV5A 2ZB9A 2RNJA 1ZHFA 2L9VA 3A1YA 3IUOA 1BC8C 2XIGA 1TW2A 1LEBA 5CLSA 4M73A 2AQFA 2BW3B 2ZJPF 2EIJH 4ENNA 2K9NA 5DCMA 4CH7A 4IKFA 3K7AJ 3N4MA 5BQTA 3DLLF 3G4SI 1MBJA 2DBBA 3AG3H 4HBLA 3KP2A 3HOUJ 2HYJA 3PFYA 5F0HA 4MFDA 1H88C 4A6EA 2ZXWH 4FE7A 2DDAA 1ETQA 2XSDC 1TTYA 4F7ZA 2VQHA 4PJMA 1B6AA 1YS6A 2Y0SN 3ABKH 3MEXA 3PQJA 4DJAA 3AG1H 3DKXA 5FD6A 3S15J 4A3BJ 3KFWX 1BIAA 4NC7A 5EZHA 1U78A 2FXAA 2HQRA 4EM2A 1KU9A 3I53A 1UHWA 1O57A 5TISC 2ISZA 3KEOA 3HOVJ 1G6NA 3HOZJ 1IGNA 5JLXA 9ANTA 4BNCA 2P4WA 1WCMJ 2L3DA 1U5TB 1Z91A 4MGRA 4F92B 2JVHA 4D5CA 2E60A 5DTDA 1SMTA 3KEYA 1OR7A 1GVDA 1BC7C 2HEOA 1MBGA 5J47A 4MTDA 2M7BA 3F0CA 4Z2YA 3J7AO 3MVPA 1HA8A 2BY2A 2BZTA 4AC0A 3O8GA 3U21A 4U7BA 1S9HA 2Y48A 2DA4A 1R22A 4CHUA 2O8XA 1SFEA 1WGXA 3KCCA 2BE5F 2F5CA 2FF4A 3ERMA 2CW7A 4P1WA 4YIFA 1RRJA 1MNMC 4A0YA 2CYYA 2ZSHB 1MBEA 3RDIA 2L02A 3ELKA 5FKOA 1HDDC 3V42A 5TRDA 5J8FA 1R49A 5FD5A 2NRAC 4RGRA 3TW6A 3O3KA 3EDPA 1WJDA 3VWBA 3TDUC 2KDZA 1WSUA 1W36D 1B4AA 5DV5A 3UKGA 2LMDA 2ZNYA 4DYCA 2E5ZA 2HKXA 3OYEA 3LL7A 4C3IJ 3ONQA 2ADUA 5BS6A 2VXZA 1O7FA 1TT5B 3QAHA 4HA8A 2NNYA 3WE2A 5DUKA 1H8AC 3V8JA 2PJRA 2O7OA 3HYIA 3E6CC 1J75A 3S1RJ 3A2KA 2LP0A 2MA3A 4M74A 3K70D 3G3ZA 2FU4A 4L5EA 1I3AA 2VXDA 3H1CA 4LMYA 2E34A 1S3JA 4IVNA 5DD4A 3FBIB 1ZKGA 2Z5UA 3H3ZA 4BJ5C 3RPUA 1ITYA 4PFOA 3WTVC 3BWGA 4JX5A 1R5ID 3E5UA 2EK5A 5JFRA 2C6YA 1SD7A 3WGGA 3ZQFA 2FJ1A 1AA7A 2WAEA 2LRDA 5TGTA 1V5FA 4E7ZA 4L5JA 4OIRF 4RBOA 4WWCA 2M87A 2F4MB 1A5JA 4IRGA 4M9XA 1DGWY 4CYDA 5L3DA 3K2AA 1SD6A 1D5YA 2VOPA 1FMWA 1FIAA 2ECCA 4M9ZA 2ZNZA 3P7NA 1Y39A 3ZMSA 2G7HA 1USTA 4NB5A 3ZQGA 2JN6A 3GLXA 1MD0A 2DK8A 4Y3OA 1XCVA 5BNGA 4HQEA 2X48A 3TW7A 4ZDOA 3Q0VA 5BMZA 2NVXJ 2UV1A 1XD7A 3F9KA 3QP5A 5J40A 5EG0A 1OCZH 1HBXG 3C3WA 1I50J 1MNEA 1OCPA 2K5CA 3H9QA 1JHFA 4QLCU 5D6FA 3DQVC 4KUMA 5F04A 4MEXF 2E35A 2R5YB 1K6OA 3RYPA 4UNOA 2HYFA 4XRSA 4BQOA 3WHBA 4IX7A 3SEZA 1ETXA 1P4WA 1OYWA 3OSGA 1TC3C 3BG7A 4WX9A 3U9GA 4EATA 1K83J 2O61A 3GXOA 2V1NA 1FYKA 3G1LA 3L2QA 2V9PA 5D5UB 4YFNF 1MMAA 4E7LA 2HOSA 2JSCA 1XCBA 1DUXC 5L3CA 1J2XA 1GUUA 4EGZA 1X58A 5ED4A 4FASD 1R1UA 3BCAA 4IRHA 2BY1A 4IHYA 3H9GA 3W6JB 1TL8A 1UG0A 1W7PD 5ICGA 5IPAA 3H5NA 4X1EA 3HDDA 1MSFC 4IPAA 1MMNA 3TO9A 4QSHA 1YE9A 1LEAA 1NG6A 3IHUA 2LLKA 2ZFUA 1WH5A 2HDWA 3H0GJ 2DTRA 4L18B 1FMVA 3CP2A 1YLFA 1I27A 1TWHJ 2DFFA 3QPHA 1Y1VJ 4E7IA 1IN5A 3ZMTA 4LITA 1A36A 2V9VA 1X4OA 3H5AA 1KQ8A 2JRTA 1ZGWA 2H8RA 1OYYA 3P5JA 1HSJA 1MW7A 2LNBA 3M1CA 5F08A 2KJCA 2XKOA 1AU7A 3BROA 1ETYA 4NBQA 2V26A 2JPBA 1TWGJ 2FA5A 3PJRA 2W82A 3J7YJ 2WY8Q 1TQMA 5HNHA 2ELKA 3HTUA 5FJ8J 2JA8J 3E6MA 2VLAA 1HOMA 5IOZA 2BOLA 2KQRA 3OOPA 2CSOA 2COBA 1B9MA 1U5TC 2F4OB 4EEFG 3MD2A 4WXCA 4E7JA 3FHNA 2CQKA 3TGNA 3IAS2 4Y52J 3E6BA 4C2UA 2LY9A 1FOXA 2XDVA 4I2OA 3C2BA 2JSPA 2CU7A 4XKCA 3K10A 1IAWA 1OCCH 1DGRM 2VN2A 4PK4A 1FOYA 1IUFA 4RM3A 4U0WA 2M9HA 5ILUA 1VQ8I 3I71A 4HF1A 3M4OJ 4B3XA 3HKZA 3AAFA 3OYNA 2FMLA 1ZYRF 1ODDA 2YPRA 1JKRC 4N9HA 2WV1A 3WU0A 2LSOA 1QBJA 4ESFA 2B9SA 2AO9A 2HFHA 3N97A 4XLHA 3RKQA 4UVBA 2PJRB 5FLVA 3GZ5A 3MCZA 5KAIC 3H3UA 3H35A 2OZ6A 5KNLA 2ME0A 1JI8A 2K4BA 3M1EA 2MYSA 3LAJA 3ECOA 3ERED 2GBYA 2P6SA 1MJBA 5GTHC 2IEKA 2EFOA 4IJAA 2NVUB 3WGIA 4UXNA 2A69F 1WVRA 1JKPC 4RLFA 3H36A 1QA6A 1X2MA 2FSWA 1P7JA 2KMUA 1R23A 1GDTA 1OCOH 1MZBA 1WRJA 1ZRFA 5KK1A 5E17F 3JTHA 4HLXA 2R0QC 4EVIA 2MH9A 4XM3A 3VSKA 2JT1A 2ZMEA 3V4GA 3FXQA 3OOUA 5JVGF 4Q5SF 2X6XA 3CCSI 4BBRJ 3BT9A 3B6CA 5DCFA 3PUBA 3EQLF 4BUPA 3HM5A 3WU2C 2QQ9A 4RLQA 4CDGA 5GPCA 1B59A 4M71A 5LRRA 3S2DJ 1B1BA 2MLGA 2PMUA 1E17A 4ZH4F 4EGYA 1Y0UA 4CYCA 2Y0SA 3JCUC 2Y2ZA 1JUSA 3CCYA 4BQQA 1MMDA 3IKTA 3GF2A 1BR1A 2O9LA 2OV7A 1Z21A 3QOEA 3ZQLA 1XS9A 4RMNA 3CJTB 3CC4I 1TQIA 5BPIA 3S93A 2F6CA 5LFAA 4KNYA 4HNVA 5KVRA 4P9UA 3VDXA 3K6GA 1S7EA 3RSNA 4DIQA 4EJVA 2KJBA 2LOOA 1VQ4I 1Z6RA 3TBIA 3LWFA 1USSA 1QZEA 5K7FA 2EFWA 3C18A 4HX4A 3ZMVA 3CDIA 3L2CA 3HOYJ 2WB1N 3BG5A 3V8KA 2ZXJA 1P2FA 3HB9A 5E20A 2VBXA 3CO7C 4PSXA 1CGPA 2OAZA 3VODA 2GIZA 3H0DA 1LB2A 5K7ZA 3GTKJ 1KYZA 4HPQA 3PIPF 3K0LA 5J4YA 4I98B 3RKWA 4GO1A 2YU3A 2QBYA 4AVPA 5A2QK 5BPDA 3M8JA 4OAYA 1ETKA 1F43A 3HIFA 1T08B 1OCRH 5LHHA 4AIDA 2HKOA 1QNTA 1V54H 3U1KA 3GWZA 3HEFA 3EUHA 2PMZN 5FRNA 4XN0A 1LVKA 2HZTA 1VQKI 4HRIA 1R5GA 2V6EA 2Z2SB 2OQGA 3I59A 3K4MA 2H1LA 4LK0F 4KDPA 3CUQA 1WJBA 2YX7A 3FK6A 3OL3A 3U2RA 3SHFA 2YU9J 3JSPA 3S1QJ 2Q1ZB 1SEUA 3MAJA 5H6RA 4DYQA 3CQZJ 1LFUP 2PBIA 3VYRB 1BM9A 3K4CA 4BE1A 4E7SA 1TWCJ 4L9VA 3R6SA 2KIFA 5EEGA 4MO7A 3LQQA 3HOXJ 4OIQF 3CJQB 2FMYA 1YW8A 5GAGJ 2DOFA 3HOTA 2JA2A 4AIKA 1YIOA 4A3DJ 2NXNB 2HI3A 3CCMI 3LSKA 4D7NA 1V3FA 4HOBA 3TOBA 3SEQA 1J09A 4HAMA 3DCFA 4RGXA 4CCKA 3CF2A 4G7HF 3QU6A 1JUMA 3G71I 5M3FJ 1XC5A 4CCOA 4ESJA 4D9JA 4KMFA 4JBAA 4F52A 3R60A 1T39A 3B6AA 4I02A 1R1TA 1J59A 4A3GJ 4HLYA 2FX0A 3DTEA 2D2WA 2H1KA 1OR7C 2R7OA 1XDUA 2KL4A 1VQ6I 3LSMA 2XUBA 4KIBA 1OCTC 1HQCA 3GFJA 1QZZA 1D0YA 2I5UA 1D8KA 2P7CB 5CQGA 2IGMA 1XMAA 3HPGA 1PUFA 3LA7A 5ICFA 1H0MA 2XGXA 4KISA 2DA2A 4HZFA 3ZXSA 4LK1F 1IN6A 5IP6A 5EGOA 3LSTA 4GYIA 2ZXHA 2RGVA 5E1XA 2JA5J 2EIKH 2NVTJ 2OTLI 4PFPA 1TLHB 2BHZA 2YX4A 2HXIA 2J5PA 3HC7A 4PZJA 4G12A 4MEYF 5E1ZB 3OR1C 2MC3A 2RN7A 2QWWA 1IN8A 1KU7A 4E70A 4AVZA 5L3BA 1W5SA 3I0TA 4OAZA 3RPQA 2RQQA 4XR6A 2EBIA 3IRRA 2L7FP 1GVJA 2LC2A 3AG4H 3KLOA 1ZR2A 1BIBA 2L54A 1R7JA 1T56A 1ZARA 2M8GX 2RC4A 1IZ1A 2XF7A 3D5RC 1UHMA 2VI6A 3GZ6A 5JVTA 4EMSA 4J01A 1L0OC 1IXCA 1OJLA 2LREA 3ZCOA 3I55I 2MFZA 1Q1HA 2EB7A 4GXOA 4JP0A 4BL0B 2FBKA 1D0XA 2L0KA 1YO5C 1XMKA 5C44J 1Z05A 4ZZDA 5JR3A 1Y6IA 2OC6A 3ML6A 2IP2A 3V7RA 2K86A 1DQUA 4O6JA 2XROA 3BTJA 1X1BA 4I09A 3VYUB 1KQ0A 1YX5A 3G1MA 3SZGA 3T1BA 5D5XB 3HSRA 2ZCWA 5LHIA 2RKHA 3QQAA 4WXHA 3OV8A 5JHFA 3HRUA 3ZRGA 4ASNA 4CYCB 2NS7A 3KE2A 4H0EA 5FKKA 2DW4A 3ZOBA 1DP3A 2B7EA 3DF8A 1PDNC 3QU3A 1Y56A 4NC6A 1UELB 4RB1A 2XVCA 1YG2A 3QYFA 3PSFA 1O3TA 1MMSA 4WF2A 3NWTA 3AL0B 5JI6A 2VJ4A 1CF7B 3M3YJ 3BCBA 1FTTA 3KLNA 3LSIA 3OIQA 1G3WA 3UNGC 4NQWA 1LQ1A 4L0ZB 2XHKA 1XDSA 4E4HA 4BEHB 2LR8A 5CJ9A 3V7SA 2MABA 2CH0A 3JRCA 1TZLA 1KA8A 1K78A 2H94A 2ICWG 3B73A 1PYVA 4C3HJ 2XASA 4EJOA 2W1OA 1LFPA 1R1VA 3HOWJ 1R4NB 1WHUA 3ZMZA 5FLXZ 4HNUA 1KU2A 3F22A 4MTEA 1FJLA 1ZRCA 3DTIA 5ERIA 1ON1A 3ZN0A 4MQ9F 2V7FA 5CKTA 1MBKA 3GYHX 1V5GA 3E1SA 2KPMA 4PJNA 1XMXA 2DCEA 2K27A 3ZMDA 1U9NA 3CESA 1U9OA 3I59B 1MBFA 3F8FA 3NWSA 3SFIA 2H09A 2VT3A 4DZJA 2GA2A 1QGPA 4IXAA 2ID6A 1FOKA 1QVUA 2R7DA 1TWFJ 2XPWA 2R7FA 4M3FA 2XPVA 4IHSA 2JUGA 2OU2A 2ME6A 5HODA 4OIOF 5E8GA 1YS7A 4B3AA 3CZ6A 2E71A 4B43A 3GBGA 5F27A 2CGPA 2A5WA 3M9AA 3B02A 3RKYA 1IO2A 3REOA 5L3FA 2V4JC 4UV9A 4KA4A 1YI2I 3I3LA 3GFIA 3V7CA 3KYLA 3ZQ7A 3DBLB 2K02A 2DMNA 2M5WA 4BQNA 1T0FC 3CO6C 1NTCA 3A0BC 5HLHA 4HYEA 1BI1A 3CDLA 4OWRB 2IBDA 2DODA 2FRHA 2ZSIB 3KZIC 4YEJA 3BTIA 2QF7A 1U0JA 2HVQA 2GXAA 3S2WA 1B72A 2NOGA 1LPQA 1A6IA 1S8NA 2K3PA 3P9IA 3QOPA 3CD6I 4O5VA 2JQ7A 2XAGA 2COMA 2QYOA 4UUSA 3HOSA 4HV6A 1PUEE 3FBNB 2R5ZA 1IRGA 2RREA 2RDPA 3NQOA 2IJLA 2VQGA 2STTA 1T33A 1IG7A 5FFZA 1O3QA 1HXDA 3D5SC 5K5OA 3CCRI 1H89C 2NOJB 2KZVA 3FK7A 3BY6A 3FISA 4JOMA 3FXLA 1MSEC 1PUFB 4LFUA 3ZQCA 2M1BA 4N4OB 3VEPA 2W7NA 2DYSH 3QP6A 1N75A 2MBFA 3CC7I 3OYBA 3K1MA 2QKLB 3J80Z 3BJAA 2V9KA 2FNPA 3H92A 2LVSA 1VQ7I 1T95A 1K79A 2V1UA 3ULQB 5LLQA 1IC8A 4H4KC 4LLGF 2BGCA 1T38A 2DT7B 2E1CA 1W0TA 2CV2A 3RZDJ 4FHTA 5FO5A 4J19A 4E7HA 3TP0A 2G9WA 3PQKA 5F64A 1NK2P 4CO8A 5IYCJ 2WB1A 2ELJA 2LTPA 1WJAA 3LSHA 1MH3A 4HX7A 1YITI 2PEXA 3ABMH 5LEJA 1FIPA 2O5RA 4JK1X 4YELA 1FC3A 3GMEA 2OJED 4W1UA 4XONA 1ZG5A 4E7KA 2DQRA 2DPUA 2GLOA 4RAZA 2YS9A 1FSHA 3I56I 5HS7A 3OYHA 1XTAA 4GDFA 1KZHA 3BR5A 2XRNA 3SDGA 4B47A 2E2HJ 1X4PA 3CC2I 3L2VA 1XSXA 1U8RA 3FXMA 3SJMA 1WKMA 2QGUA 1VI0A 4LD5A 2A68F 2CWEA 1S29A 2M0CA 3K1NA 4EJWA 2UXXA 2GZWA 1SAUA 2E7WA 3E3VA 3VFZA 4A0ZA 1K4SA 2K9SA 2R7ZJ 4FX0A 4BDYA 1XSDA 3S8PA 3ZPLA 4BJTA 3L2UA 2MLKA 2AQEA 3DU5A 2ZFWA 4NDLA 1V4RA 3SQNA 4HNTA 4ZTJA 1HKQA 4B1RA 5IT9K 1FNNA 4IRIA 3KP6A 2E19A 5AIPA 2ETHA 1M1EB 4IOCF 2JA7J 2BXZA 1FLIA 1QPIA 4ZYEA 4M6VA 4XOTA 2VPLA 1F36A 1YJ9I 4G6DA 3CJNA 1V5EA 5CVJA 4F91B 2MD0A 4M6XA 3SZPA 5JHUA 2PI0A 5HLTA 3PNTA 4A6DA 3DXJF 4DNCA 2PJPA 1R4MB 2CS3A 3ABTA 2DN0A 3P9KA 1UHSA 3LSJA 4ZZLA 2M4GA 2KKOA 2KT0A 3N05A 4KIGA 2QA4I 2A6TA 1WJ5A 1K78B 5H20A 3CP8A 3I64A 5AONA 3O6BB 1Z1DA 2CUJA 1YFHA 3FKJA 3AL0C 5DM7F 1BI2A 3PUFA 3OYLA 3BG6A 4I6ZA 3JRAA 1T98A 1YW7A 4ETSA 5DCMB 1EH8A 1QU3A 3QRFF 2GAUA 3TKYA 2HVRA 5B3SH 2M3AA 3E5QA 2L01A 5IT3A 3KEQA 4GYGA 1SC7A 3CDHA 4HW0A 2R7WA 2V79A 5DUIA 4RB2C 1P92A 2WBMA 2W84A 3RZOJ 3WTTC 3DKYA 4LLNA 4G6QA 2RAEA 4ZYDA 4TV7A 2OBPA 2W4SA 2XKPA 2MG4A 4A3MJ 3BDDA 2HNHA 4N4NB 2V6CA 4Y4RA 2L4MA 4XICA 3EUHC 1D8JA 1O7LA 1XGSA 4L9NA 2LD5A 1BJAA 4CGZA 2DK5A 2XSJC 3IWFA 2NS8A 3J7ZI 1IW7F 1SANA 1JXSA 4ENKA 2M45A 2M7AA 3DV8A 1A31A 1RKTA 4D0PA 3PL8A 3FZVA 4DOZA 4BBSJ 1I3QJ 1BI3A 2KP6A 5E18F 2WADA 2LDUA 3ZP5A 2LKSA 2DI3A 2HQAA 1RETA 4ZTFA 1YYVA 4KN4X 4BE0A 2IS6A 2AXTC 3EYIA 3DPTA 4A3EJ 3Q5FA 3BPXA 5EF6A 5D6EA 1Z0XA 1ERDA 2F5DA 3TO7A 1YHQI 3W2WA 4KIFA 2TCTA 1UFMA 2VC0A 2VT2A 3W6VA 2DMTA 2Z1DA 1OMIA 1EKEA 2OUMA 3KIOA 4UUSB 2X0LA 2XB0X 2G0EA 2IAIA 2R5ZB 1WJCA 4RB0A 2EH3A 1BL0A 3BTLA 2WY7Q 1LFBA 1KONA 3MKLA 2JUCA 4KT5C 2K9QA 3PFIA 3Q9VA 3HL2A 1JT0A 2E1OA 4EM0B 3KZYA 4UB6C 1VQMI 1Y8QB 3FKIJ 4KN7X 4IHWA 4A3JJ 3W2VA 4AD9A 2W00A 2R7XA 1W5TA 3DEUA 4OU0A 4B48A 2GXGA 2XF6A 1BW6A 2DJIA 1QHHD 3EPZA 5AIQA 2IVMA 3UR3C 1UAAA 2DJNA 2GXBA 3SXYA 4MNUA 1FYMA 2R3SA 5M3MJ 5GAEJ 5K7HA 3F6VA 4Q48A 4C2TA 3ISPA 3F8BA 3KYDB 1SFKA 4EV0A 4AIJA 1NK3P 1VQ9I 2H8WA 3RCOA 3FXOA 2LBFA 3T8TA 2MC4A 2P8TA 3H9JA 3OYIA 3DKWA 3F8CA 3NRVA 1XGOA 4A3IJ 3S1NJ 1GHCA 4QPQA 4I7HA 3CLQA 4AWXB 4RAYA 4Q4ZF 3LFKA 2EJRA 3WTYC 5KAFC 3R61A 1AKHA 1JGGA 3C2HA 3JAMK 1ZTRA 1R71A 2QQBA 2E7XA 2HTJA 3T0YA 2DFIA 2IW5A 2HS5A 3IRQA 5GTIC 2A3SA 2N8GA 4PJJA 2LFBA 1BN5A 1MIJA 4U0YA 4IZZA 4NNJA 2XAQA 3A0HC 2GIVA 3ZN1A 2EFQA 2JK3A 4LB6B 3OYAA 4IL6C 3AKZA 2HDDA 4BACA 2J5OA 4BXUA 3D1NI 1TQPA 5LGUA 3RTRA 4IOAF 2DA6A 3F8MA 5TJJA 3GEZA 3OS2A 1PP7U 4XQFA 3IP4B 2QSGX 1X1PA 1IXRC 4HV5A 5D8KB 1K6YA 4KITB 2OCEA 5EG0B 1HKSA 1P4AA 4RDUA 3M7GA 3ZMUA 2LY2A 3PO2J 2FNAA 1JKQC 2HTSA 2HU9A 2K9LA 3W3CA 3BOQA 5FGMA 1B8IA 4KYWA 2R92J 4IHVA 4BHCA 4X6AJ 4LIUA 3HRSA 3WE3A 2JJ7A 2LF8A 2D5VA 2EWNA 1RI7A 4UHTA 3BR2A 3CUOA 1WFXA 3FM3A 4EM1A 4CZCA 1MMGA 1KYWA 4FTHA 4RAFA 2DA5A 1XGMA 4ZDPA 3WG7H 1W36C 2DA1A 2GA1A 1IV6A 2QZ8A 2ZO4A 4V2FA 2HZDA 4XLEA 2I8DA 2MW8A 3ZGKA 2EA4A 4A2UA 3VOEA 1A6QA 1FZPB 1E2XA 1OQYA 1QZYA 2DQLA 3D0SA 1Q1VA 4ABZA 4BU2A 4KT6A 4LGWA 1OKRA 3BPVA 2FBHA 2MH2A 1XG1A 4DZPA 3C2GA 1C0WA 3COAC 3K70C 3LFUA 1LJ9A 2BXYA 3OYDA 1YIJI 2JVGA 1OLTA 5HOOA 1I5ZA 1DDNA 2STWA 3S3NA 3JRFA 1ZGAA 3S17J 3FXJA 4UB8C 5FROA 3KETA 1SVMA 2M4KA 4RM2A 3OYFA 1H9GA 1S7OA 1GXQA 3EUAA 3GZNB 4D5FA 5CVIA 4GGGA 3WG9A 3LOCA 4QPOA 5HLGA 3OS1A 1FYLA 1SD4A 4JX6A 1X3ZB 2IGKA 5D5VB 3MKWB 4YRVA 3K4BA 3H5RA 2IS1A 2KHMA 3GW2A 4D1QA 4OIPF 3S1MJ 1T6SA 3PNYA 2R7RA 4GFBA 3JRBA 2EILH 4A93J 3DBRB 1U6GA 3JRDA 2YUSA 1RR8C 1QO0D 1TT0A 2PMHA 5CVVA 4C9YA 2XRLA 1WH7A 4U87A 2QEXI 3L1PA 2LKXA 1LE8A 4IO9F 1EF4A 5FRMA 1OFCX 1IJWC 4N9IA 2VL8A 4RS8A 1ZG3A 1UMQA 3GLLA 1ZLKA 3HXLA 4P9FA 3BTCA 3CMAI 1R9TJ 4F55A 2KFDA 2NS0A 5DYMA 1D3YA 5E8IA 3WTZA 2EFNA 2AHQA 3BJOA 4M3DA 1P9QC 5EEHA 4XRFA 1HW1A 4BGDA 1YRNA 3GTJJ 2B63J 5F0FA 1TBXA 3FM5A 4IF4A 4U0VA 3OYCA 5FKLA 1MH4A 2HDCA 4PUSA 4ZJZA 4M3BA 1IN7A 4M9SA 1K61A 1LUJB 4XLPF 4BDZA 1IUYA 1RR7A 2HXOA 5EJCA 2L9NA 2M30A 1YW9A 3TP3A 3OR2C 1RUOA 1SFUA 2EZHA 4HF0A 3OIPA 1MGTA 1SFXA 4U7DA 4W97A 4R8HA 3LMMA 2M34A 4RGSA 3HUGA 4XOPA 3DBHB 4XIDA 2BV6A 4CA0A 1YTYA 3J80K 1X1DA 2UXNA 2A6HF 1UZCA 2ZJ2A 3ROUA 3CMMA 4M6YA 3TEDA 1FX7A 4S0HB 4WK8F 3VPRA 4DQ2A 3OYKA 1TNTA 5JLWA 5H6QA 1S6LA 3WTSC 4NC8A 2ZMEB 4RAGA 3H3VK 4XLNF 3DWLE 4P55A 3A02A 2EV6A 2Y9YA 4U88A 5FKNA 5J1YA 3S3MA 1POGA 4WCGA 1RKWA 4C30A 1RPWA 3GO5A 3MWMA 3MKZA 4N0BA 1QPMA 3HGYA 2TRTA 3K9TA 4Y17A 4FCYA 2IS4A 5CVRA 1G3TA 2ZJRF 3KX2A 2MD5A 3LNQA 1R6RA 1HW5A 1ETVA 2FOWA 3K4JA 2L4AA 3BC8A 3SFZA 2KRFA 2IXSA 1ULYA 5E1WA 2DAOA 4WXDA 3FXKA 2BHYA 2QCOA 2VQLA 1J5YA 2R4GA 2G7UA 2ELHA 1KGSA 2Y69H 4PSWA 2IPQX 2E1MB 4XSZF 2D1VA 2WA0A 2FQ3A 3QODA 4XNFA 4IHTA 1R00A 5HDNA 1MJ9A 4OOIA 4BYYA 1JTXA 4CCMA 3PO3J 1IN4A 4CXFA 2LH9A 3Q0WA 3CCVI 1B8IB 3MZHA 2Y31A 1BW5A 5A2QZ 4RB3C 1JUPA 2EQRA 2FOKA 2UZKA 1YQAA 2ID3A 1APLC 4BHPA 1TNSA 3BG9A 3DEEA 5K5RA 1BOBA 2XAUA 2L7MP 3DP7A 2QBYB 3HJEA 1ZRDA 2XAHA 3S2HJ 1U8BA 5IY5H 1FSEA 2E36A 2GOMA 3D5LA 3BR0A 3L9FA 4AIHA 1UB9A 1LDKB 1LDDA 1FBQA 4DGWB 3HPHA 3TQNA 1Z3XA 1YJNI 1XX5A 2R7TA 3CCEI 4XKBA 1GV5A 4ZYGA 2NNNA 5FKMA 1NH3A 4PJ0C 4V2GA 4B09A 5HLIA 4O3MA 3CUQB 3FMRA 2I10A 1QRYA 2AXLA 3K2ZA 1VQPI 1JHHA 2E5NA 2JTVA 2L2OA 2QQ8A 2HVSA 3KP4A 4IHXA 1MKMA 2KIQA 3DFGA 2DA3A 2XGEA 5E3OA 4LIVA 1O3SA 4JYKA 1XGNA 4A0XA 5LGNA 4KJZA 1BA5A 4G9YA 1GT0C 5L3GA 1DPUA 2KLOA 3F8NA 2CUZA 1SFOJ 4A3LJ 2EA2A 2X9DA 1ON2A 1FEXA 3E7LA 2OPTA 4BE2A 3CCLI 5LBQA 2VKVA 1RUNA 1Z6TA 2WC2A 3VSLA 2RNGA 3IV5A 2DU9A 3E0JB 2KIUA 1G8XA 4AYBN 2DLLA 3OSFA 4GRIA 3EUKL 3RJPA 2VE8A 1BJZA 1LKXA 1GV2A 2VKEA 3FX3A 3HRTA 1Z9CA 2IS2A 3I54A 3ABUA 4CCNA 3S32A 5DDGA 3CMEI 3VYSB 5M5XJ 4P5OA 5B66C 3CLOA 3ABLH 2QSHX 2VQCA 5M5WJ 1ZGJA 3HSEA 2XGCA 2QSFX 4HSTA 3O2PE 1RESA 1P6RA 3DU6A 3RIRA 1T2KA 4XLAA 2O8KA 4YG2F 4OMYA 2QVOA 3A03A 1XPXA 1X2NA 2F5VA 3GTGJ 2Y9ZA 1E0EA 2FQ4A 4G94A 2WAQN 4CSWA 2R93J 3BR3A 3MKYB 1LE8B 2H27A 3WGHA 1HKTA 3EYYA 3HBLA 2JWTA 3HZJA 4B8XA 1DU6A 2ESHA 3T5XA 1NHAA 2V1DA 2JRMA 3ASOH 4QTRA 4I76A 2W24A 2DTZA 3R4KA 2VJ5A 3DEWA 2B0LA 2NVQJ 4R79A 2IA2A 1W7PA 2Q2EA 5FLMJ 5EGOB 2CRGA 2Y75A 4Y15A 3QYBA 1YRNB 2KZGA 5IP9J 1WI3A 1JTYA 1RNLA 1RC9A 1HF0A 3O8HA 2CUFA 3GTOJ 1A04A 4BH9A 5FB2A 4FT8A 5EEAA 3GCMA 5GPAA 2M8EA 2P81A 2BY0A 1IXSB 2K7LA 3F23A 2JA6J 1WQ2A 1P4XA 4M72A 4DBQA 2DT6A 1H9TA 4Y33A 1AOYA 2CQ7A 1DPRA 2V1XA 1VTNC 2CV1A 3VB2A 1ZELA 1EV7A 2P6TA 3JRGA 4A3CJ 4E6KG 3HUGB 1JGSA 3G2BA 5E3MA 5L3EA 3AFHA
chains in the Genus database with same CATH topology
1KU3A 2OZUA 4CICA 4RGUA 4KFCA 1I6XA 2VE9A 5HS9A 2GWRA 3J81Z 2YSRA 2CFXA 1LDJA 2NAZA 2HQNA 2CG4A 3U1DA 2QENA 4BHBA 2VONA 4OINF 1XSVA 1GXPA 5K5QA 3GVAA 3HHHA 4ENJA 4L0YB 1MJAA 1ONVA 2O3FA 3GFMA 2IA0A 4BQAA 3JSOA 3HRMA 3C1DA 3KP7A 3JW4A 4EJTA 1I1SA 4EJUA 1KQ9A 1RIOH 1F4KA 4PCQA 1WI9A 4UVCA 3MFKA 2PN6A 5CYVA 1J0RA 3T8RA 2ACJA 3BP8A 4BAYA 4I0AA 4S05A 3KP5A 3IKVA 3FWEA 2A5YB 1XN7A 4MHGA 2WWYA 4P96A 2PLYA 1ZAOA 2HOEA 2X4HA 3TO6A 4PGHA 5HVQC 2BBYA 2P5KA 3GUDA 3R0AA 3FMSA 1FWZA 4EQQA 5FFXA 1R36A 2IRFG 5J8CA 2VBWA 2XAJA 1ZN2A 2LF7A 2VOOA 5D4SA 1FP2A 1WWXA 5K1YA 1T0FA 3L09A 4UUVA 3CUQC 2F2EA 2PFBA 1SD5A 3L00A 2FEZA 1FBUA 5ICCA 2W57A 3KP3A 4LJZF 2O0YA 4ZYHA 2QUFA 2F5FA 2CO5A 5F6FA 3CTAA 2DPDA 1J9IA 2HWVA 4LG0A 2PG4A 2Q0OA 1PP8F 2DO7A 1JE8A 2VC1A 4LB5A 2Z99A 2O03A 1O3RA 2IT0A 3K1PA 3QPTA 2EFPA 4HX8A 3FHZA 2BEOA 1W7PB 4YFKF 1TW3A 3WTWC 3M8FA 1XB4A 3LQRA 4HF2A 4A5NA 1OPCA 3DPLC 1IRFA 4Q47A 3E6DA 1L3LA 1F5TA 2W25A 1F9NA 4PDKA 3HTSB 3HHGA 1SMYF 3KZZA 2K4JA 3IWZA 4HQMA 5D5WB 3LAPA 3TOAA 2Y0MA 4ENMA 3ECHA 2P5LC 4XSXF 3F72A 2ZBKA 1HSTA 4OMZA 5HDGA 3F21A 1FP1D 4S04A 2RQPA 4I01A 1ZG1A 4QWQA 5IT9Z 2JPCA 3V8LA 1QQIA 1BOAA 4A5MA 1SAXA 1BBYA 4FX4A 1MDMA 5LRSA 3G73A 4G8XA 3FXRA 5J6XA 2XAFA 1I1GA 4L9JA 2VBYA 3FXUA 2AS5F 4LLLA 1FT9A 1B9NA 5ICEA 2KIMA 1CF7A 3JTGA 3WODF 6PAXA 1FY7A 4ON0A 3W6KB 3NEUA 3R0JA 1F1ZA 2Q8KA 1BI0A 2NYXA 3RYRA 3BZ6A 4I0BA 3WTUC 3I4PA 3MZYA 2TDXA 2WTEA 4GCVA 2FBIA 3HSFA 1Z7UA 4HDUA 3FMQA 2D45A 5F1RA 3GX4X 5FLXK 2BYVE 5HDKA 1FPQA 5D4RA 2ISYA 4XBFA 5ILVA 3SZTA 1UCRA 1REPC 1AWCA 3F3XA 2QLZA 2JZYA 3IC7A 5D8LB 2WV0A 4A12A 3RI4A 2ESNA 2A61A 1ZH5A 2D1HA 2H6CA 3M8EA 3E97A 4CZZA 4KICA 1EH7A 1U5TA 2VBZA 1FBSA 2RV8A 3LA2A 5BOXA 3MQ0A 1HW2A 2RVCA 3IL2A 5DD8A 1G4DA 2QQAA 2CW0F 5DEQA 4LG0B 2UWMA 3Q9SA 2GQQA 3GFLA 4L9TA 1K7AA 1STZA 3FF5A 2Z3YA 2H6BA 2OA4A 2P5VA 2P7VB 2HYGD 1R5HA 4K2EA 3BJ6A 4YIIA 2Z9OA 1EH6A 4YFXF 2IA1A 4Y13A 1X3UA 2PQ8A 2A07F 3E5XA 2XV4S 4UVAA 2OD5A 2QM3A 5HS8A 2DT5A 1DP7P 3EETA 3C7JA 3JAMZ 4KMUX 4G7ZF 3LA3A 4JQFA 1W4MA 2O6GE 4MQVA 4G7OF 4HDVA 3F6OA 1LNWA 3I58A 2W85A 1IF1A 2E1NA 2ZKZA 2VODA 4PGGA 1RZ4A 1G3SA 1D5VA 1ZREA 1G3YA 1S7AA 3J81K 5CVUA 3L7WA 2FE3A 5LGTA 1OYIA 2HR3A 2OQRA 1LVAA 3K69A 3RKXA 3TDZC 1MDMB 1U3EM 5LHGA 2LKPA 3WTXC 2YR2A 1ZLJA 3P9CA 4ESBA 3WU1B 4UV8A 3I5UA 4R1HA 1J7KA 5ILSA 1U2WA 2F5EA 2EV0A 2HGCA 1R58A 5LEKA 4L5IA 2Z33A 2A6EF 4NHJA 2EV5A 2RNJA 1ZHFA 1BC8C 2XIGA 1TW2A 1LEBA 5CLSA 4M73A 4ENNA 5DCMA 3N4MA 5BQTA 2DBBA 4HBLA 3KP2A 4A6EA 1TTYA 4F7ZA 1B6AA 1YS6A 3MEXA 3PQJA 5FD6A 3KFWX 1BIAA 1U78A 2FXAA 2HQRA 4EM2A 1KU9A 3I53A 1UHWA 1O57A 2ISZA 3KEOA 1G6NA 4BNCA 2P4WA 2L3DA 1U5TB 1Z91A 4MGRA 1SMTA 1OR7A 2HEOA 1BC7C 4MTDA 4Z2YA 3J7AO 4U7BA 2Y48A 1R22A 4CHUA 2O8XA 1SFEA 3KCCA 2BE5F 2F5CA 2FF4A 4YIFA 4A0YA 2CYYA 3RDIA 2L02A 3ELKA 5TRDA 5J8FA 5FD5A 2NRAC 4RGRA 3O3KA 3EDPA 3TDUC 1WSUA 1B4AA 5DV5A 2ZNYA 2HKXA 2ADUA 5BS6A 2VXZA 1O7FA 3QAHA 4HA8A 2NNYA 3WE2A 5DUKA 3V8JA 3HYIA 3E6CC 1J75A 2MA3A 4M74A 3G3ZA 2FU4A 4LMYA 1S3JA 4IVNA 5DD4A 2Z5UA 3H3ZA 3RPUA 3WTVC 3BWGA 3E5UA 2EK5A 5JFRA 2C6YA 1SD7A 3WGGA 4L5JA 4OIRF 4WWCA 2M87A 4IRGA 4M9XA 4CYDA 5L3DA 1SD6A 2VOPA 4M9ZA 2ZNZA 3P7NA 3ZMSA 2G7HA 1USTA 4NB5A 3GLXA 1MD0A 2DK8A 1XCVA 4HQEA 5BMZA 1XD7A 3QP5A 1HBXG 3C3WA 1JHFA 4QLCU 5D6FA 3DQVC 4KUMA 4MEXF 1K6OA 3RYPA 4UNOA 2HYFA 1P4WA 1OYWA 4WX9A 3U9GA 2O61A 3GXOA 1FYKA 5D5UB 4YFNF 2JSCA 1XCBA 1DUXC 5L3CA 1J2XA 4EGZA 5ED4A 1R1UA 4IRHA 3W6JB 1W7PD 5ICGA 4IPAA 3TO9A 1LEAA 3IHUA 2DTRA 4L18B 1YLFA 1I27A 3QPHA 1IN5A 3ZMTA 2V9VA 1KQ8A 2JRTA 1OYYA 1HSJA 2LNBA 2KJCA 2XKOA 3BROA 2JPBA 2FA5A 1TQMA 3HTUA 3E6MA 3OOPA 2CSOA 1B9MA 1U5TC 4WXCA 2CQKA 3TGNA 3E6BA 4I2OA 1IAWA 2VN2A 4U0WA 4HF1A 5ILUA 3I71A 3AAFA 2FMLA 1ZYRF 1ODDA 2YPRA 4N9HA 3WU0A 2LSOA 1QBJA 4ESFA 2HFHA 3N97A 4UVBA 3GZ5A 3MCZA 3H3UA 2OZ6A 2K4BA 3M1EA 3LAJA 3ECOA 3ERED 2P6SA 1MJBA 2EFOA 4IJAA 3WGIA 4UXNA 2A69F 2FSWA 1R23A 1MZBA 1WRJA 1ZRFA 5KK1A 5E17F 3JTHA 4HLXA 4EVIA 2MH9A 2JT1A 2ZMEA 3V4GA 3FXQA 4Q5SF 5DCFA 3EQLF 2QQ9A 4CDGA 1B59A 5LRRA 4M71A 1B1BA 2MLGA 2PMUA 1E17A 4ZH4F 4EGYA 1Y0UA 3IKTA 3GF2A 1TQIA 5BPIA 4KNYA 5KVRA 4P9UA 4EJVA 2KJBA 1Z6RA 3LWFA 1USSA 2EFWA 3C18A 4HX4A 3ZMVA 3L2CA 3V8KA 2ZXJA 1P2FA 5E20A 2VBXA 3CO7C 1CGPA 2OAZA 3VODA 1LB2A 1KYZA 3K0LA 4I98B 3RKWA 4GO1A 2YU3A 2QBYA 4AVPA 5A2QK 5BPDA 3HIFA 5LHHA 2HKOA 1QNTA 3GWZA 3EUHA 2HZTA 1R5GA 2OQGA 3I59A 4LK0F 4KDPA 3CUQA 2YX7A 3U2RA 3SHFA 3JSPA 3MAJA 5H6RA 2PBIA 1BM9A 4L9VA 3R6SA 2KIFA 5EEGA 3LQQA 4OIQF 2FMYA 1YW8A 3HOTA 4AIKA 1YIOA 1V3FA 4HOBA 3TOBA 4HAMA 4RGXA 4G7HF 3QU6A 4ESJA 4KMFA 4JBAA 1T39A 3R60A 4I02A 1R1TA 1J59A 4HLYA 2D2WA 1XDUA 2XUBA 4KIBA 1HQCA 3GFJA 1QZZA 1D8KA 2P7CB 1XMAA 3LA7A 5ICFA 1H0MA 2XGXA 4HZFA 4LK1F 1IN6A 3LSTA 4GYIA 2RGVA 5E1XA 1TLHB 2YX4A 2J5PA 4PZJA 4MEYF 5E1ZB 2MC3A 2RN7A 2QWWA 1IN8A 1KU7A 4E70A 5L3BA 1W5SA 3I0TA 3RPQA 3IRRA 1GVJA 3KLOA 1BIBA 2L54A 1R7JA 1ZARA 2RC4A 1IZ1A 1UHMA 3GZ6A 5JVTA 4EMSA 1L0OC 1IXCA 1Q1HA 2EB7A 4GXOA 2FBKA 1YO5C 1XMKA 1Z05A 4ZZDA 5JR3A 3ML6A 2IP2A 3V7RA 2K86A 4O6JA 2XROA 4I09A 1KQ0A 3T1BA 5D5XB 3HSRA 2ZCWA 5LHIA 2RKHA 4WXHA 3OV8A 3HRUA 4ASNA 4H0EA 3KE2A 2DW4A 3DF8A 1PDNC 3QU3A 4RB1A 2XVCA 1YG2A 1O3TA 4WF2A 5JI6A 1CF7B 3KLNA 1G3WA 4NQWA 1LQ1A 4L0ZB 2XHKA 1XDSA 5CJ9A 3V7SA 1KA8A 1K78A 2H94A 3B73A 2XASA 4EJOA 1R1VA 3ZMZA 5FLXZ 1KU2A 3F22A 4MTEA 1ZRCA 5ERIA 1ON1A 3ZN0A 4MQ9F 3GYHX 2K27A 3ZMDA 3I59B 3F8FA 2H09A 2VT3A 2GA2A 1QGPA 4IXAA 1FOKA 2R7DA 2R7FA 4IHSA 2OU2A 4OIOF 5E8GA 1YS7A 2CGPA 3M9AA 3B02A 3RKYA 3REOA 5L3FA 4UV9A 4KA4A 3GFIA 3V7CA 3ZQ7A 2K02A 2M5WA 3CO6C 5HLHA 4HYEA 1BI1A 2FRHA 3S2WA 1S8NA 3P9IA 3QOPA 4O5VA 2XAGA 2COMA 2QYOA 3HOSA 4HV6A 1PUEE 1IRGA 2RDPA 3NQOA 2IJLA 2STTA 5FFZA 1O3QA 1HXDA 5K5OA 3BY6A 4LFUA 2M1BA 3VEPA 3QP6A 2MBFA 3K1MA 3J80Z 3BJAA 2FNPA 3H92A 1K79A 2V1UA 3ULQB 5LLQA 4LLGF 2BGCA 1T38A 2E1CA 4FHTA 5FO5A 2G9WA 3PQKA 5F64A 4CO8A 4HX7A 2PEXA 5LEJA 4JK1X 1FC3A 2DPUA 1ZG5A 2DQRA 4RAZA 1FSHA 5HS7A 2XRNA 1XSXA 1U8RA 1WKMA 4LD5A 2A68F 2CWEA 1S29A 3K1NA 4EJWA 2UXXA 3VFZA 4A0ZA 2GZWA 2E7WA 3E3VA 4FX0A 1XSDA 3ZPLA 2MLKA 2ZFWA 1V4RA 3SQNA 1HKQA 5IT9K 1FNNA 4IRIA 3KP6A 5AIPA 2ETHA 1FLIA 4ZYEA 4G6DA 3CJNA 5CVJA 4M6XA 3SZPA 5JHUA 2PI0A 4A6DA 3DXJF 4DNCA 2PJPA 3ABTA 3P9KA 4ZZLA 2KKOA 4KIGA 1K78B 5H20A 3I64A 5AONA 3O6BB 1Z1DA 1YFHA 1BI2A 1T98A 1YW7A 4ETSA 5DCMB 1EH8A 3QRFF 2GAUA 3TKYA 3E5QA 2L01A 5IT3A 3KEQA 4GYGA 3CDHA 4HW0A 2V79A 5DUIA 4RB2C 1P92A 2W84A 3WTTC 4LLNA 4G6QA 4ZYDA 4TV7A 2OBPA 2XKPA 3BDDA 2V6CA 2L4MA 1D8JA 1O7LA 1XGSA 4L9NA 1BJAA 4CGZA 2DK5A 3IWFA 1IW7F 1JXSA 4ENKA 2M45A 3DV8A 4D0PA 3FZVA 1BI3A 5E18F 2LDUA 3ZP5A 2DI3A 1YYVA 4KN4X 3EYIA 3DPTA 3Q5FA 3BPXA 5D6EA 2F5DA 3TO7A 4KIFA 2VC0A 1UFMA 2VT2A 1OMIA 2X0LA 4RB0A 4KT5C 3PFIA 3Q9VA 4EM0B 3KZYA 4KN7X 4AD9A 1W5TA 3DEUA 4OU0A 2GXGA 5AIQA 2IVMA 2GXBA 3SXYA 4MNUA 1FYMA 2R3SA 3F6VA 4Q48A 3ISPA 3F8BA 4EV0A 4AIJA 3T8TA 2P8TA 1GHCA 3DKWA 3F8CA 3NRVA 1XGOA 4I7HA 4AWXB 4Q4ZF 4RAYA 3LFKA 2EJRA 3WTYC 3R61A 3JAMK 2QQBA 2E7XA 2HTJA 3T0YA 2DFIA 2IW5A 2HS5A 3IRQA 2A3SA 1BN5A 4U0YA 2XAQA 2GIVA 3ZN1A 2EFQA 4LB6B 2J5OA 4BXUA 1TQPA 5LGUA 3RTRA 3F8MA 5TJJA 3GEZA 1PP7U 1IXRC 4HV5A 5D8KB 1HKSA 1P4AA 3M7GA 3ZMUA 2FNAA 2HTSA 3BOQA 5FGMA 4KYWA 4BHCA 3HRSA 3WE3A 2LF8A 2EWNA 1RI7A 4UHTA 3CUOA 3FM3A 4EM1A 1KYWA 1XGMA 2GA1A 2QZ8A 2ZO4A 2EA4A 4A2UA 3VOEA 1FZPB 1E2XA 1QZYA 2DQLA 3D0SA 4LGWA 1OKRA 3BPVA 2FBHA 2MH2A 1C0WA 3COAC 1LJ9A 5HOOA 1I5ZA 1DDNA 2STWA 1ZGAA 3KETA 1H9GA 1S7OA 1GXQA 5CVIA 4GGGA 3WG9A 5HLGA 1FYLA 1SD4A 5D5VB 3GW2A 4OIPF 1T6SA 1U6GA 1QO0D 2PMHA 5CVVA 4N9IA 4RS8A 1ZG3A 1ZLKA 4P9FA 5DYMA 2NS0A 1D3YA 5E8IA 3WTZA 2EFNA 3BJOA 5EEHA 4XRFA 1HW1A 1TBXA 3FM5A 4IF4A 4U0VA 2HDCA 1IN7A 4M9SA 4XLPF 1IUYA 2M30A 1YW9A 1RUOA 1SFUA 4HF0A 1MGTA 1SFXA 4U7DA 4R8HA 4RGSA 3HUGA 2BV6A 1YTYA 3J80K 2UXNA 2A6HF 2ZJ2A 3ROUA 4M6YA 1FX7A 4WK8F 4DQ2A 1TNTA 5H6QA 1S6LA 3WTSC 2ZMEB 4XLNF 4P55A 2EV6A 4U88A 4WCGA 3MWMA 3GO5A 4N0BA 1QPMA 3K9TA 4Y17A 5CVRA 1G3TA 2MD5A 1HW5A 3SFZA 2L4AA 2KRFA 1ULYA 5E1WA 2DAOA 4WXDA 1J5YA 2G7UA 2ELHA 1KGSA 2IPQX 4XSZF 2D1VA 2FQ3A 4IHTA 5HDNA 1R00A 1MJ9A 4OOIA 4BYYA 1IN4A 4CXFA 3MZHA 5A2QZ 4RB3C 2FOKA 2UZKA 1YQAA 4BHPA 1TNSA 5K5RA 3DP7A 2QBYB 1ZRDA 2XAHA 1FSEA 3D5LA 4AIHA 3L9FA 1UB9A 1LDKB 1LDDA 1FBQA 3TQNA 4ZYGA 2NNNA 4B09A 5HLIA 4O3MA 3CUQB 3FMRA 2AXLA 3K2ZA 1JHHA 2JTVA 3KP4A 1MKMA 3DFGA 1O3SA 1XGNA 4A0XA 5LGNA 4G9YA 1DPUA 5L3GA 3F8NA 2EA2A 1ON2A 5LBQA 1RUNA 1Z6TA 2WC2A 2DU9A 2KIUA 2DLLA 3RJPA 2VE8A 3HRTA 3FX3A 1Z9CA 3I54A 3ABUA 5DDGA 4P5OA 3CLOA 1ZGJA 3HSEA 3O2PE 1P6RA 3RIRA 1T2KA 4YG2F 4OMYA 2QVOA 4G94A 2H27A 3WGHA 1HKTA 3EYYA 4B8XA 2ESHA 3T5XA 1NHAA 2V1DA 2W24A 3R4KA 2B0LA 4R79A 2IA2A 1W7PA 2Q2EA 2Y75A 4Y15A 1RNLA 1A04A 4BH9A 5FB2A 4FT8A 2M8EA 1IXSB 2K7LA 3F23A 1WQ2A 1P4XA 4M72A 1H9TA 1AOYA 1DPRA 2V1XA 1VTNC 3VB2A 1EV7A 2P6TA 1JGSA 5L3EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KU3 A;  2OZU A;  4CIC A;  4RGU A;  4KFC A;  1I6X A;  2VE9 A;  5HS9 A;  2GWR A;  3J81 Z;  2YSR A;  2CFX A;  1LDJ A;  2NAZ A;  2HQN A;  2CG4 A;  3U1D A;  2QEN A;  4BHB A;  2VON A;  4OIN F;  1XSV A;  1GXP A;  5K5Q A;  3GVA A;  3HHH A;  4ENJ A;  4L0Y B;  1MJA A;  1ONV A;  2O3F A;  3GFM A;  2IA0 A;  4BQA A;  3JSO A;  3HRM A;  3C1D A;  3KP7 A;  3JW4 A;  4EJT A;  1I1S A;  4EJU A;  1KQ9 A;  1RIO H;  1F4K A;  4PCQ A;  1WI9 A;  4UVC A;  3MFK A;  2PN6 A;  5CYV A;  1J0R A;  3T8R A;  2ACJ A;  3BP8 A;  4BAY A;  4I0A A;  4S05 A;  3KP5 A;  3IKV A;  3FWE A;  2A5Y B;  1XN7 A;  4MHG A;  2WWY A;  4P96 A;  2PLY A;  1ZAO A;  2HOE A;  2X4H A;  3TO6 A;  4PGH A;  5HVQ C;  2BBY A;  2P5K A;  3GUD A;  3R0A A;  3FMS A;  1FWZ A;  4EQQ A;  5FFX A;  1R36 A;  2IRF G;  5J8C A;  2VBW A;  2XAJ A;  1ZN2 A;  2LF7 A;  2VOO A;  5D4S A;  1FP2 A;  1WWX A;  5K1Y A;  1T0F A;  3L09 A;  4UUV A;  3CUQ C;  2F2E A;  2PFB A;  1SD5 A;  3L00 A;  2FEZ A;  1FBU A;  5ICC A;  2W57 A;  3KP3 A;  4LJZ F;  2O0Y A;  4ZYH A;  2QUF A;  2F5F A;  2CO5 A;  5F6F A;  3CTA A;  2DPD A;  1J9I A;  2HWV A;  4LG0 A;  2PG4 A;  2Q0O A;  1PP8 F;  2DO7 A;  1JE8 A;  2VC1 A;  4LB5 A;  2Z99 A;  2O03 A;  1O3R A;  2IT0 A;  3K1P A;  3QPT A;  2EFP A;  4HX8 A;  3FHZ A;  2BEO A;  1W7P B;  4YFK F;  1TW3 A;  3WTW C;  3M8F A;  1XB4 A;  3LQR A;  4HF2 A;  4A5N A;  1OPC A;  3DPL C;  1IRF A;  4Q47 A;  3E6D A;  1L3L A;  1F5T A;  2W25 A;  1F9N A;  4PDK A;  3HTS B;  3HHG A;  1SMY F;  3KZZ A;  2K4J A;  3IWZ A;  4HQM A;  5D5W B;  3LAP A;  3TOA A;  2Y0M A;  4ENM A;  3ECH A;  2P5L C;  4XSX F;  3F72 A;  2ZBK A;  1HST A;  4OMZ A;  5HDG A;  3F21 A;  1FP1 D;  4S04 A;  2RQP A;  4I01 A;  1ZG1 A;  4QWQ A;  5IT9 Z;  2JPC A;  3V8L A;  1QQI A;  1BOA A;  4A5M A;  1SAX A;  1BBY A;  4FX4 A;  1MDM A;  5LRS A;  3G73 A;  4G8X A;  3FXR A;  5J6X A;  2XAF A;  1I1G A;  4L9J A;  2VBY A;  3FXU A;  2AS5 F;  4LLL A;  1FT9 A;  1B9N A;  5ICE A;  2KIM A;  1CF7 A;  3JTG A;  3WOD F;  6PAX A;  1FY7 A;  4ON0 A;  3W6K B;  3NEU A;  3R0J A;  1F1Z A;  2Q8K A;  1BI0 A;  2NYX A;  3RYR A;  3BZ6 A;  4I0B A;  3WTU C;  3I4P A;  3MZY A;  2TDX A;  2WTE A;  4GCV A;  2FBI A;  3HSF A;  1Z7U A;  4HDU A;  3FMQ A;  2D45 A;  5F1R A;  3GX4 X;  5FLX K;  2BYV E;  5HDK A;  1FPQ A;  5D4R A;  2ISY A;  4XBF A;  5ILV A;  3SZT A;  1UCR A;  1REP C;  1AWC A;  3F3X A;  2QLZ A;  2JZY A;  3IC7 A;  5D8L B;  2WV0 A;  4A12 A;  3RI4 A;  2ESN A;  2A61 A;  1ZH5 A;  2D1H A;  2H6C A;  3M8E A;  3E97 A;  4CZZ A;  4KIC A;  1EH7 A;  1U5T A;  2VBZ A;  1FBS A;  2RV8 A;  3LA2 A;  5BOX A;  3MQ0 A;  1HW2 A;  2RVC A;  3IL2 A;  5DD8 A;  1G4D A;  2QQA A;  2CW0 F;  5DEQ A;  4LG0 B;  2UWM A;  3Q9S A;  2GQQ A;  3GFL A;  4L9T A;  1K7A A;  1STZ A;  3FF5 A;  2Z3Y A;  2H6B A;  2OA4 A;  2P5V A;  2P7V B;  2HYG D;  1R5H A;  4K2E A;  3BJ6 A;  4YII A;  2Z9O A;  1EH6 A;  4YFX F;  2IA1 A;  4Y13 A;  1X3U A;  2PQ8 A;  2A07 F;  3E5X A;  2XV4 S;  4UVA A;  2OD5 A;  2QM3 A;  5HS8 A;  2DT5 A;  1DP7 P;  3EET A;  3C7J A;  3JAM Z;  4KMU X;  4G7Z F;  3LA3 A;  4JQF A;  1W4M A;  2O6G E;  4MQV A;  4G7O F;  4HDV A;  3F6O A;  1LNW A;  3I58 A;  2W85 A;  1IF1 A;  2E1N A;  2ZKZ A;  2VOD A;  4PGG A;  1RZ4 A;  1G3S A;  1D5V A;  1ZRE A;  1G3Y A;  1S7A A;  3J81 K;  5CVU A;  3L7W A;  2FE3 A;  5LGT A;  1OYI A;  2HR3 A;  2OQR A;  1LVA A;  3K69 A;  3RKX A;  3TDZ C;  1MDM B;  1U3E M;  5LHG A;  2LKP A;  3WTX C;  2YR2 A;  1ZLJ A;  3P9C A;  4ESB A;  3WU1 B;  4UV8 A;  3I5U A;  4R1H A;  1J7K A;  5ILS A;  1U2W A;  2F5E A;  2EV0 A;  2HGC A;  1R58 A;  5LEK A;  4L5I A;  2Z33 A;  2A6E F;  4NHJ A;  2EV5 A;  2RNJ A;  1ZHF A;  1BC8 C;  2XIG A;  1TW2 A;  1LEB A;  5CLS A;  4M73 A;  4ENN A;  5DCM A;  3N4M A;  5BQT A;  2DBB A;  4HBL A;  3KP2 A;  4A6E A;  1TTY A;  4F7Z A;  1B6A A;  1YS6 A;  3MEX A;  3PQJ A;  5FD6 A;  3KFW X;  1BIA A;  1U78 A;  2FXA A;  2HQR A;  4EM2 A;  1KU9 A;  3I53 A;  1UHW A;  1O57 A;  2ISZ A;  3KEO A;  1G6N A;  4BNC A;  2P4W A;  2L3D A;  1U5T B;  1Z91 A;  4MGR A;  1SMT A;  1OR7 A;  2HEO A;  1BC7 C;  4MTD A;  4Z2Y A;  3J7A O;  4U7B A;  2Y48 A;  1R22 A;  4CHU A;  2O8X A;  1SFE A;  3KCC A;  2BE5 F;  2F5C A;  2FF4 A;  4YIF A;  4A0Y A;  2CYY A;  3RDI A;  2L02 A;  3ELK A;  5TRD A;  5J8F A;  5FD5 A;  2NRA C;  4RGR A;  3O3K A;  3EDP A;  3TDU C;  1WSU A;  1B4A A;  5DV5 A;  2ZNY A;  2HKX A;  2ADU A;  5BS6 A;  2VXZ A;  1O7F A;  3QAH A;  4HA8 A;  2NNY A;  3WE2 A;  5DUK A;  3V8J A;  3HYI A;  3E6C C;  1J75 A;  2MA3 A;  4M74 A;  3G3Z A;  2FU4 A;  4LMY A;  1S3J A;  4IVN A;  5DD4 A;  2Z5U A;  3H3Z A;  3RPU A;  3WTV C;  3BWG A;  3E5U A;  2EK5 A;  5JFR A;  2C6Y A;  1SD7 A;  3WGG A;  4L5J A;  4OIR F;  4WWC A;  2M87 A;  4IRG A;  4M9X A;  4CYD A;  5L3D A;  1SD6 A;  2VOP A;  4M9Z A;  2ZNZ A;  3P7N A;  3ZMS A;  2G7H A;  1UST A;  4NB5 A;  3GLX A;  1MD0 A;  2DK8 A;  1XCV A;  4HQE A;  5BMZ A;  1XD7 A;  3QP5 A;  1HBX G;  3C3W A;  1JHF A;  4QLC U;  5D6F A;  3DQV C;  4KUM A;  4MEX F;  1K6O A;  3RYP A;  4UNO A;  2HYF A;  1P4W A;  1OYW A;  4WX9 A;  3U9G A;  2O61 A;  3GXO A;  1FYK A;  5D5U B;  4YFN F;  2JSC A;  1XCB A;  1DUX C;  5L3C A;  1J2X A;  4EGZ A;  5ED4 A;  1R1U A;  4IRH A;  3W6J B;  1W7P D;  5ICG A;  4IPA A;  3TO9 A;  1LEA A;  3IHU A;  2DTR A;  4L18 B;  1YLF A;  1I27 A;  3QPH A;  1IN5 A;  3ZMT A;  2V9V A;  1KQ8 A;  2JRT A;  1OYY A;  1HSJ A;  2LNB A;  2KJC A;  2XKO A;  3BRO A;  2JPB A;  2FA5 A;  1TQM A;  3HTU A;  3E6M A;  3OOP A;  2CSO A;  1B9M A;  1U5T C;  4WXC A;  2CQK A;  3TGN A;  3E6B A;  4I2O A;  1IAW A;  2VN2 A;  4U0W A;  4HF1 A;  5ILU A;  3I71 A;  3AAF A;  2FML A;  1ZYR F;  1ODD A;  2YPR A;  4N9H A;  3WU0 A;  2LSO A;  1QBJ A;  4ESF A;  2HFH A;  3N97 A;  4UVB A;  3GZ5 A;  3MCZ A;  3H3U A;  2OZ6 A;  2K4B A;  3M1E A;  3LAJ A;  3ECO A;  3ERE D;  2P6S A;  1MJB A;  2EFO A;  4IJA A;  3WGI A;  4UXN A;  2A69 F;  2FSW A;  1R23 A;  1MZB A;  1WRJ A;  1ZRF A;  5KK1 A;  5E17 F;  3JTH A;  4HLX A;  4EVI A;  2MH9 A;  2JT1 A;  2ZME A;  3V4G A;  3FXQ A;  4Q5S F;  5DCF A;  3EQL F;  2QQ9 A;  4CDG A;  1B59 A;  5LRR A;  4M71 A;  1B1B A;  2MLG A;  2PMU A;  1E17 A;  4ZH4 F;  4EGY A;  1Y0U A;  3IKT A;  3GF2 A;  1TQI A;  5BPI A;  4KNY A;  5KVR A;  4P9U A;  4EJV A;  2KJB A;  1Z6R A;  3LWF A;  1USS A;  2EFW A;  3C18 A;  4HX4 A;  3ZMV A;  3L2C A;  3V8K A;  2ZXJ A;  1P2F A;  5E20 A;  2VBX A;  3CO7 C;  1CGP A;  2OAZ A;  3VOD A;  1LB2 A;  1KYZ A;  3K0L A;  4I98 B;  3RKW A;  4GO1 A;  2YU3 A;  2QBY A;  4AVP A;  5A2Q K;  5BPD A;  3HIF A;  5LHH A;  2HKO A;  1QNT A;  3GWZ A;  3EUH A;  2HZT A;  1R5G A;  2OQG A;  3I59 A;  4LK0 F;  4KDP A;  3CUQ A;  2YX7 A;  3U2R A;  3SHF A;  3JSP A;  3MAJ A;  5H6R A;  2PBI A;  1BM9 A;  4L9V A;  3R6S A;  2KIF A;  5EEG A;  3LQQ A;  4OIQ F;  2FMY A;  1YW8 A;  3HOT A;  4AIK A;  1YIO A;  1V3F A;  4HOB A;  3TOB A;  4HAM A;  4RGX A;  4G7H F;  3QU6 A;  4ESJ A;  4KMF A;  4JBA A;  1T39 A;  3R60 A;  4I02 A;  1R1T A;  1J59 A;  4HLY A;  2D2W A;  1XDU A;  2XUB A;  4KIB A;  1HQC A;  3GFJ A;  1QZZ A;  1D8K A;  2P7C B;  1XMA A;  3LA7 A;  5ICF A;  1H0M A;  2XGX A;  4HZF A;  4LK1 F;  1IN6 A;  3LST A;  4GYI A;  2RGV A;  5E1X A;  1TLH B;  2YX4 A;  2J5P A;  4PZJ A;  4MEY F;  5E1Z B;  2MC3 A;  2RN7 A;  2QWW A;  1IN8 A;  1KU7 A;  4E70 A;  5L3B A;  1W5S A;  3I0T A;  3RPQ A;  3IRR A;  1GVJ A;  3KLO A;  1BIB A;  2L54 A;  1R7J A;  1ZAR A;  2RC4 A;  1IZ1 A;  1UHM A;  3GZ6 A;  5JVT A;  4EMS A;  1L0O C;  1IXC A;  1Q1H A;  2EB7 A;  4GXO A;  2FBK A;  1YO5 C;  1XMK A;  1Z05 A;  4ZZD A;  5JR3 A;  3ML6 A;  2IP2 A;  3V7R A;  2K86 A;  4O6J A;  2XRO A;  4I09 A;  1KQ0 A;  3T1B A;  5D5X B;  3HSR A;  2ZCW A;  5LHI A;  2RKH A;  4WXH A;  3OV8 A;  3HRU A;  4ASN A;  4H0E A;  3KE2 A;  2DW4 A;  3DF8 A;  1PDN C;  3QU3 A;  4RB1 A;  2XVC A;  1YG2 A;  1O3T A;  4WF2 A;  5JI6 A;  1CF7 B;  3KLN A;  1G3W A;  4NQW A;  1LQ1 A;  4L0Z B;  2XHK A;  1XDS A;  5CJ9 A;  3V7S A;  1KA8 A;  1K78 A;  2H94 A;  3B73 A;  2XAS A;  4EJO A;  1R1V A;  3ZMZ A;  5FLX Z;  1KU2 A;  3F22 A;  4MTE A;  1ZRC A;  5ERI A;  1ON1 A;  3ZN0 A;  4MQ9 F;  3GYH X;  2K27 A;  3ZMD A;  3I59 B;  3F8F A;  2H09 A;  2VT3 A;  2GA2 A;  1QGP A;  4IXA A;  1FOK A;  2R7D A;  2R7F A;  4IHS A;  2OU2 A;  4OIO F;  5E8G A;  1YS7 A;  2CGP A;  3M9A A;  3B02 A;  3RKY A;  3REO A;  5L3F A;  4UV9 A;  4KA4 A;  3GFI A;  3V7C A;  3ZQ7 A;  2K02 A;  2M5W A;  3CO6 C;  5HLH A;  4HYE A;  1BI1 A;  2FRH A;  3S2W A;  1S8N A;  3P9I A;  3QOP A;  4O5V A;  2XAG A;  2COM A;  2QYO A;  3HOS A;  4HV6 A;  1PUE E;  1IRG A;  2RDP A;  3NQO A;  2IJL A;  2STT A;  5FFZ A;  1O3Q A;  1HXD A;  5K5O A;  3BY6 A;  4LFU A;  2M1B A;  3VEP A;  3QP6 A;  2MBF A;  3K1M A;  3J80 Z;  3BJA A;  2FNP A;  3H92 A;  1K79 A;  2V1U A;  3ULQ B;  5LLQ A;  4LLG F;  2BGC A;  1T38 A;  2E1C A;  4FHT A;  5FO5 A;  2G9W A;  3PQK A;  5F64 A;  4CO8 A;  4HX7 A;  2PEX A;  5LEJ A;  4JK1 X;  1FC3 A;  2DPU A;  1ZG5 A;  2DQR A;  4RAZ A;  1FSH A;  5HS7 A;  2XRN A;  1XSX A;  1U8R A;  1WKM A;  4LD5 A;  2A68 F;  2CWE A;  1S29 A;  3K1N A;  4EJW A;  2UXX A;  3VFZ A;  4A0Z A;  2GZW A;  2E7W A;  3E3V A;  4FX0 A;  1XSD A;  3ZPL A;  2MLK A;  2ZFW A;  1V4R A;  3SQN A;  1HKQ A;  5IT9 K;  1FNN A;  4IRI A;  3KP6 A;  5AIP A;  2ETH A;  1FLI A;  4ZYE A;  4G6D A;  3CJN A;  5CVJ A;  4M6X A;  3SZP A;  5JHU A;  2PI0 A;  4A6D A;  3DXJ F;  4DNC A;  2PJP A;  3ABT A;  3P9K A;  4ZZL A;  2KKO A;  4KIG A;  1K78 B;  5H20 A;  3I64 A;  5AON A;  3O6B B;  1Z1D A;  1YFH A;  1BI2 A;  1T98 A;  1YW7 A;  4ETS A;  5DCM B;  1EH8 A;  3QRF F;  2GAU A;  3TKY A;  3E5Q A;  2L01 A;  5IT3 A;  3KEQ A;  4GYG A;  3CDH A;  4HW0 A;  2V79 A;  5DUI A;  4RB2 C;  1P92 A;  2W84 A;  3WTT C;  4LLN A;  4G6Q A;  4ZYD A;  4TV7 A;  2OBP A;  2XKP A;  3BDD A;  2V6C A;  2L4M A;  1D8J A;  1O7L A;  1XGS A;  4L9N A;  1BJA A;  4CGZ A;  2DK5 A;  3IWF A;  1IW7 F;  1JXS A;  4ENK A;  2M45 A;  3DV8 A;  4D0P A;  3FZV A;  1BI3 A;  5E18 F;  2LDU A;  3ZP5 A;  2DI3 A;  1YYV A;  4KN4 X;  3EYI A;  3DPT A;  3Q5F A;  3BPX A;  5D6E A;  2F5D A;  3TO7 A;  4KIF A;  2VC0 A;  1UFM A;  2VT2 A;  1OMI A;  2X0L A;  4RB0 A;  4KT5 C;  3PFI A;  3Q9V A;  4EM0 B;  3KZY A;  4KN7 X;  4AD9 A;  1W5T A;  3DEU A;  4OU0 A;  2GXG A;  5AIQ A;  2IVM A;  2GXB A;  3SXY A;  4MNU A;  1FYM A;  2R3S A;  3F6V A;  4Q48 A;  3ISP A;  3F8B A;  4EV0 A;  4AIJ A;  3T8T A;  2P8T A;  1GHC A;  3DKW A;  3F8C A;  3NRV A;  1XGO A;  4I7H A;  4AWX B;  4Q4Z F;  4RAY A;  3LFK A;  2EJR A;  3WTY C;  3R61 A;  3JAM K;  2QQB A;  2E7X A;  2HTJ A;  3T0Y A;  2DFI A;  2IW5 A;  2HS5 A;  3IRQ A;  2A3S A;  1BN5 A;  4U0Y A;  2XAQ A;  2GIV A;  3ZN1 A;  2EFQ A;  4LB6 B;  2J5O A;  4BXU A;  1TQP A;  5LGU A;  3RTR A;  3F8M A;  5TJJ A;  3GEZ A;  1PP7 U;  1IXR C;  4HV5 A;  5D8K B;  1HKS A;  1P4A A;  3M7G A;  3ZMU A;  2FNA A;  2HTS A;  3BOQ A;  5FGM A;  4KYW A;  4BHC A;  3HRS A;  3WE3 A;  2LF8 A;  2EWN A;  1RI7 A;  4UHT A;  3CUO A;  3FM3 A;  4EM1 A;  1KYW A;  1XGM A;  2GA1 A;  2QZ8 A;  2ZO4 A;  2EA4 A;  4A2U A;  3VOE A;  1FZP B;  1E2X A;  1QZY A;  2DQL A;  3D0S A;  4LGW A;  1OKR A;  3BPV A;  2FBH A;  2MH2 A;  1C0W A;  3COA C;  1LJ9 A;  5HOO A;  1I5Z A;  1DDN A;  2STW A;  1ZGA A;  3KET A;  1H9G A;  1S7O A;  1GXQ A;  5CVI A;  4GGG A;  3WG9 A;  5HLG A;  1FYL A;  1SD4 A;  5D5V B;  3GW2 A;  4OIP F;  1T6S A;  1U6G A;  1QO0 D;  2PMH A;  5CVV A;  4N9I A;  4RS8 A;  1ZG3 A;  1ZLK A;  4P9F A;  5DYM A;  2NS0 A;  1D3Y A;  5E8I A;  3WTZ A;  2EFN A;  3BJO A;  5EEH A;  4XRF A;  1HW1 A;  1TBX A;  3FM5 A;  4IF4 A;  4U0V A;  2HDC A;  1IN7 A;  4M9S A;  4XLP F;  1IUY A;  2M30 A;  1YW9 A;  1RUO A;  1SFU A;  4HF0 A;  1MGT A;  1SFX A;  4U7D A;  4R8H A;  4RGS A;  3HUG A;  2BV6 A;  1YTY A;  3J80 K;  2UXN A;  2A6H F;  2ZJ2 A;  3ROU A;  4M6Y A;  1FX7 A;  4WK8 F;  4DQ2 A;  1TNT A;  5H6Q A;  1S6L A;  3WTS C;  2ZME B;  4XLN F;  4P55 A;  2EV6 A;  4U88 A;  4WCG A;  3MWM A;  3GO5 A;  4N0B A;  1QPM A;  3K9T A;  4Y17 A;  5CVR A;  1G3T A;  2MD5 A;  1HW5 A;  3SFZ A;  2L4A A;  2KRF A;  1ULY A;  5E1W A;  2DAO A;  4WXD A;  1J5Y A;  2G7U A;  2ELH A;  1KGS A;  2IPQ X;  4XSZ F;  2D1V A;  2FQ3 A;  4IHT A;  5HDN A;  1R00 A;  1MJ9 A;  4OOI A;  4BYY A;  1IN4 A;  4CXF A;  3MZH A;  5A2Q Z;  4RB3 C;  2FOK A;  2UZK A;  1YQA A;  4BHP A;  1TNS A;  5K5R A;  3DP7 A;  2QBY B;  1ZRD A;  2XAH A;  1FSE A;  3D5L A;  4AIH A;  3L9F A;  1UB9 A;  1LDK B;  1LDD A;  1FBQ A;  3TQN A;  4ZYG A;  2NNN A;  4B09 A;  5HLI A;  4O3M A;  3CUQ B;  3FMR A;  2AXL A;  3K2Z A;  1JHH A;  2JTV A;  3KP4 A;  1MKM A;  3DFG A;  1O3S A;  1XGN A;  4A0X A;  5LGN A;  4G9Y A;  1DPU A;  5L3G A;  3F8N A;  2EA2 A;  1ON2 A;  5LBQ A;  1RUN A;  1Z6T A;  2WC2 A;  2DU9 A;  2KIU A;  2DLL A;  3RJP A;  2VE8 A;  3HRT A;  3FX3 A;  1Z9C A;  3I54 A;  3ABU A;  5DDG A;  4P5O A;  3CLO A;  1ZGJ A;  3HSE A;  3O2P E;  1P6R A;  3RIR A;  1T2K A;  4YG2 F;  4OMY A;  2QVO A;  4G94 A;  2H27 A;  3WGH A;  1HKT A;  3EYY A;  4B8X A;  2ESH A;  3T5X A;  1NHA A;  2V1D A;  2W24 A;  3R4K A;  2B0L A;  4R79 A;  2IA2 A;  1W7P A;  2Q2E A;  2Y75 A;  4Y15 A;  1RNL A;  1A04 A;  4BH9 A;  5FB2 A;  4FT8 A;  2M8E A;  1IXS B;  2K7L A;  3F23 A;  1WQ2 A;  1P4X A;  4M72 A;  1H9T A;  1AOY A;  1DPR A;  2V1X A;  1VTN C;  3VB2 A;  1EV7 A;  2P6T A;  1JGS A;  5L3E A; 
#chains in the Genus database with same CATH topology
 3I4N J;  2K40 A;  1KU3 A;  2OF7 A;  4BKX A;  2OZU A;  4CIC A;  4RGU A;  4KFC A;  1I6H J;  1I6X A;  4I99 C;  5F0C A;  5HS9 A;  2GWR A;  3Q3S A;  2VE9 A;  1S72 I;  3RQ4 A;  3J81 Z;  2BVM A;  2YSR A;  1ZQ3 P;  1Y1W J;  2PMZ A;  2L9R A;  3K4L A;  2CFX A;  1LDJ A;  2NAZ A;  2HQN A;  2CG4 A;  3U1D A;  2QEN A;  1D0Z A;  4BHB A;  3JR9 A;  2VON A;  4OIN F;  1XSV A;  1N77 A;  1GXP A;  2K85 A;  2EPF A;  1BR2 A;  5GP9 A;  5K5Q A;  3GTL J;  3GVA A;  3OYJ A;  4V19 K;  1E3H A;  1YX3 A;  3HHH A;  4ENJ A;  4XOR A;  4L0Y B;  4MFE A;  4F3Q A;  5H2F C;  1MJA A;  1ONV A;  2ZME C;  3OMY A;  2O3F A;  2X51 A;  3GFM A;  1WZ2 A;  1PVE A;  5EZG A;  4XK4 A;  2IA0 A;  4BQA A;  3BQZ A;  3JSO A;  1W1W E;  3HRM A;  5E3N A;  2DMP A;  1Z67 A;  3C1D A;  3KP7 A;  3MZ8 A;  3JW4 A;  4EJT A;  2HPI A;  5J4V A;  1I1S A;  5GAD J;  2GOX B;  3Q0U A;  3ESW B;  4EJU A;  1KQ9 A;  5DM6 F;  3JRE A;  1RIO H;  1F4K A;  3ZQH A;  4PCQ A;  1ZK8 A;  2DFE A;  1VZ0 A;  3HGG A;  4NQW B;  1WI9 A;  3W2A A;  4UVC A;  3MFK A;  3CCU I;  2PN6 A;  4C2M J;  5CYV A;  1J0R A;  3T8R A;  2ACJ A;  3BP8 A;  1I39 A;  4BAY A;  4FIS A;  4I0A A;  4S05 A;  1VQO I;  1VQ5 I;  2CUE A;  1V55 H;  3KP5 A;  3IKV A;  3ZR8 X;  3FWE A;  3TL4 X;  2A5Y B;  2WAF A;  5C4X J;  4C3J J;  2DYR H;  1XN7 A;  4MHG A;  2K9M A;  2WWY A;  5EDN A;  4LG3 A;  1E3O C;  2E1M C;  2L9S A;  1IV8 A;  4P96 A;  3VYT B;  2PLY A;  3CF5 F;  1ZAO A;  2HOE A;  1X3W B;  3DLA A;  5CPR B;  2X4H A;  3FIW A;  3TO6 A;  1O4X A;  4PGH A;  3BLY A;  5HVQ C;  4G6T B;  1JJ8 C;  2BBY A;  2P5K A;  2DFH A;  2X6W A;  3GUD A;  4J00 A;  3R0A A;  2X1E A;  3FMS A;  1W0U A;  1FWZ A;  4XLF A;  4EQQ A;  5FFX A;  1R36 A;  2KRC A;  2IRF G;  4BS9 A;  5IYB J;  5J8C A;  2VBW A;  4XL9 A;  2XAJ A;  1PJR A;  3SDB A;  3RQI A;  4BY7 J;  1TP4 A;  2VIX A;  2KDO A;  3GTM J;  5GAH J;  2DMQ A;  1ZN2 A;  2LF7 A;  4FET A;  2VOO A;  5D4S A;  4PJL A;  1FP2 A;  3IH3 A;  4M3E A;  1WWX A;  5K1Y A;  1T0F A;  3L09 A;  2M0M A;  1NG7 A;  4UUV A;  3CUQ C;  2F2E A;  4DBR A;  2PFB A;  3GTQ J;  1SD5 A;  3L00 A;  4FE4 A;  1ENH A;  3DPU A;  4DYR A;  3I9V 2;  2FEZ A;  4ZDL A;  1FBU A;  2X6O A;  5ICC A;  4CUG A;  3GTP J;  1DU0 A;  3RPU D;  3PNV A;  2HPM A;  2W57 A;  2CQX A;  1IDY A;  3KP3 A;  2DA7 A;  2O0Y A;  4HG2 A;  4LJZ F;  4ZYH A;  2QUF A;  3BQY A;  2ZJQ F;  2F5F A;  1B72 B;  3ZQI A;  2CO5 A;  4X0G A;  2UUZ A;  5F6F A;  3CTA A;  1SVL A;  3BZC A;  2DPD A;  5HNF A;  5E3L A;  1J9I A;  4CCJ A;  3JRI A;  3QWL A;  5IYD J;  2HWV A;  4LG0 A;  2VUM J;  2PG4 A;  2BY3 A;  2Q0O A;  1PP8 F;  2DO7 A;  1EA3 A;  1JE8 A;  3OY9 A;  2VC1 A;  4LB5 A;  1D1C A;  2Z99 A;  2O03 A;  1O3R A;  1VQL I;  2NVY J;  2FUG 2;  2L5Q A;  4IEJ A;  3WHC A;  3K1P A;  2IT0 A;  3QPT A;  2F48 A;  1D1A A;  2LYC A;  2EFP A;  4HX8 A;  4RA2 A;  3FHZ A;  2BEO A;  1W7P B;  4YFK F;  2Q2E B;  3CCQ I;  1TW3 A;  4HSR A;  3WTW C;  3DTK A;  3M8F A;  4A3F J;  4IQ4 A;  5KCM A;  1XB4 A;  3LQR A;  4HF2 A;  1T8I A;  3SYT A;  4A5N A;  2OTJ I;  1D1B A;  1OPC A;  3DPL C;  1IRF A;  4Q47 A;  3BR1 A;  4NUB A;  3E6D A;  1L3L A;  1F5T A;  2W25 A;  5J1U A;  1F9N A;  4PDK A;  3HTS B;  4XKV A;  3HHG A;  3PSI A;  1SMY F;  3KZZ A;  3OS0 A;  2K4J A;  3IWZ A;  2KIS A;  3CJR B;  2OCC H;  4HQM A;  1MBH A;  5D5W B;  3LAP A;  3TOA A;  2BVL A;  2Y0M A;  3BR6 A;  1VF9 A;  3ECH A;  2P5L C;  4XSX F;  3F72 A;  4ENM A;  4MLO A;  3QPS A;  4Y7N J;  2ZBK A;  1HST A;  1CQT A;  1WJF A;  4OMZ A;  5HDG A;  1MND A;  1VQN I;  3F21 A;  1FP1 D;  1Z77 A;  3BZK A;  2X1C A;  5B1B H;  4S04 A;  2RQP A;  2X85 A;  3A01 A;  1JKO C;  4I01 A;  2DOE A;  1ZG1 A;  1ORK A;  4QWQ A;  5IT9 Z;  4LOC A;  2JPC A;  3V8L A;  1QQI A;  2FD5 A;  1BOA A;  4A5M A;  1SAX A;  2VB6 A;  2CMP A;  4XMY A;  4DW6 A;  1GLN A;  1WPK A;  4II2 A;  1BBY A;  4FX4 A;  1MDM A;  3S16 J;  4AM3 A;  5LRS A;  3G73 A;  4G8X A;  2HOA A;  3QPL A;  3FXR A;  1Z7L A;  2EIN H;  5J6X A;  2XAF A;  1JT6 A;  1K4T A;  1I1G A;  4AYB A;  4L9J A;  4A69 C;  2DOA A;  1QVT A;  4YIR X;  2VBY A;  1AHD P;  3K4N A;  3FXU A;  2AS5 F;  4LLL A;  1FT9 A;  1B9N A;  5ICE A;  2KIM A;  1CF7 A;  3JTG A;  5J1R A;  3WOD F;  6PAX A;  4XKW A;  1FY7 A;  4ON0 A;  1X1C A;  3FDY A;  3W6K B;  5F1J A;  1X19 A;  2IGN A;  3KPH A;  4BEH A;  3NEU A;  2R7S A;  2WAQ A;  3R0J A;  1F1Z A;  2Q8K A;  1BI0 A;  2QKM B;  3LSR A;  2NYX A;  4BXF A;  3RYR A;  2E2J J;  3BZ6 A;  3CCJ I;  4BXX J;  2GM4 A;  4I0B A;  2BW3 A;  3PIO F;  3HG9 A;  3WTU C;  3I4P A;  3MZY A;  4IQJ A;  1HC8 A;  2R7U A;  1X1A A;  4D7M A;  2TDX A;  2WTE A;  4GCV A;  1W5C C;  2CJJ A;  2HOT A;  2FBI A;  3IH2 A;  1N78 A;  4B4C A;  3HSF A;  3NAU A;  1Z7U A;  5C3E J;  3FMQ A;  3QYE A;  4HDU A;  5F1R A;  2D45 A;  2M2E A;  2VKH A;  4FQG A;  3GX4 X;  5M5Y J;  5LD2 C;  5FLX K;  2BYV E;  1VND A;  5HDK A;  1FPQ A;  2XGD A;  5D4R A;  2ISY A;  4XBF A;  5ILV A;  3M07 A;  3SZT A;  1UCR A;  1REP C;  1AWC A;  2MSY A;  3F3X A;  2QLZ A;  2JZY A;  3IC7 A;  5D8L B;  2WV0 A;  1ETO A;  1OIS A;  4A12 A;  3RI4 A;  1TWA J;  2ESN A;  2HQ5 A;  2A61 A;  3IAM 2;  4A3K J;  1VFC A;  1ZH5 A;  5C4J J;  2D1H A;  2EZL A;  2H6C A;  2LK2 A;  2VAS A;  3M8E A;  4UUT A;  3BG3 A;  4QIW N;  3E97 A;  4CZZ A;  4KIC A;  2XB5 A;  4XLC A;  2DXI A;  4MIM A;  2A05 A;  3OWT A;  1EH7 A;  2PX9 A;  5CQE A;  1U5T A;  2VBZ A;  1FBS A;  2RV8 A;  3LA2 A;  1ETW A;  2R7Q A;  5BOX A;  2DMU A;  4ZYA A;  1IDZ A;  1N25 A;  3NAR A;  4ZC3 A;  3A4C A;  3MQ0 A;  1HW2 A;  2RVC A;  1UG2 A;  2X6Y A;  1FTZ A;  3L2R A;  3ZQQ A;  3IL2 A;  5DD8 A;  3LSP A;  2CFO A;  2QQA A;  1G4D A;  2Y30 A;  2CW0 F;  2F4I A;  3LSG A;  5DEQ A;  1E3P A;  4BY1 J;  4LG0 B;  4II3 A;  2UWM A;  3Q9S A;  2ECB A;  2GQQ A;  3GFL A;  5E79 C;  3OYG A;  4L9T A;  2MGQ A;  2VJJ A;  4HEA 2;  2LG4 A;  1K7A A;  1STZ A;  3FF5 A;  3MMY B;  2P0W A;  2Z3Y A;  1HLV A;  3CMY A;  2H6B A;  2OA4 A;  2P5V A;  2P7V B;  2HYG D;  3I4M J;  2W48 A;  1R5H A;  4XRS G;  2CQN A;  4K2E A;  3BJ6 A;  3G6E I;  1IRZ A;  4YII A;  2CV0 A;  1Z3Y A;  4JX4 A;  2L7K A;  3AG2 H;  4Z6Y A;  3J7A Y;  2Z9O A;  1A35 A;  1UJ8 A;  1EH6 A;  4YFX F;  2IA1 A;  4Y13 A;  1X3U A;  4ANJ A;  2PQ8 A;  2A07 F;  4AUX A;  1YJW I;  3E5X A;  2XV4 S;  2VKD A;  3OIO A;  3X2Q H;  1Y8R B;  2LBF B;  4UVA A;  4XN3 A;  2OD5 A;  3G1O A;  1QHG A;  2QM3 A;  3ASN H;  5HS8 A;  2DT5 A;  2K3F A;  5EYR A;  1DP7 P;  3EET A;  4F93 B;  3C7J A;  3JAM Z;  1P7I A;  2VPR A;  2R7V A;  2JMW A;  4AU7 A;  4KMU X;  4G7Z F;  1EJ9 A;  1SVO A;  3LA3 A;  4JQF A;  4XRM A;  1W4M A;  1BR4 A;  1G59 A;  1AKH B;  4MQV A;  2O6G E;  4G7O F;  2XPU A;  4HDV A;  2CQQ A;  3F6O A;  1LNW A;  2Z16 A;  3I58 A;  4CCL A;  5IP7 J;  2IGO A;  2W85 A;  1IF1 A;  2E1N A;  2ZKZ A;  2VJI A;  1ZR4 A;  2VOD A;  4PGG A;  3S14 J;  3A01 B;  1RZ4 A;  1G3S A;  1D5V A;  3OL4 A;  1YOV B;  4B44 A;  1ZRE A;  1G3Y A;  1S7A A;  3MN2 A;  5B1A H;  1ACI A;  3J81 K;  2XC7 A;  5CVU A;  3KYC B;  3L7W A;  2EIM H;  2FE3 A;  5LGT A;  1JJ6 C;  3TMO A;  1OYI A;  2HR3 A;  1G2H A;  2OQR A;  1LVA A;  3K69 A;  3RKX A;  4M3G A;  3TDZ C;  4BJ6 C;  5IOY A;  1MDM B;  2E2I J;  1U3E M;  3HKZ N;  5LHG A;  2L7Z A;  2KRH A;  2LY1 A;  2LKP A;  2X1D A;  3IH4 A;  3WTX C;  2EZK A;  4ITV A;  2YR2 A;  1HDP A;  1ZLJ A;  2ZXI A;  3K4K A;  3P9C A;  4ESB A;  1S5L C;  5KHD A;  3S3O A;  3WU1 B;  4UV8 A;  3JRH A;  3I5U A;  4R1H A;  5J3L A;  1WJE A;  1J7K A;  1FOW A;  2EZI A;  1IRX A;  3L2W A;  2R5Y A;  5ILS A;  3OYM A;  3PM1 A;  1U2W A;  4UY8 I;  2DDB A;  2F5E A;  2EV0 A;  2HGC A;  1R58 A;  2ZC2 A;  2XF5 A;  1HCR A;  5LEK A;  5DS9 A;  4L5I A;  5B5E C;  2Z33 A;  2A6E F;  2CW8 A;  4NHJ A;  1Y0N A;  2EV5 A;  2ZB9 A;  2RNJ A;  1ZHF A;  2L9V A;  3A1Y A;  3IUO A;  1BC8 C;  2XIG A;  1TW2 A;  1LEB A;  5CLS A;  4M73 A;  2AQF A;  2BW3 B;  2ZJP F;  2EIJ H;  4ENN A;  2K9N A;  5DCM A;  4CH7 A;  4IKF A;  3K7A J;  3N4M A;  5BQT A;  3DLL F;  3G4S I;  1MBJ A;  2DBB A;  3AG3 H;  4HBL A;  3KP2 A;  3HOU J;  2HYJ A;  3PFY A;  5F0H A;  4MFD A;  1H88 C;  4A6E A;  2ZXW H;  4FE7 A;  2DDA A;  1ETQ A;  2XSD C;  1TTY A;  4F7Z A;  2VQH A;  4PJM A;  1B6A A;  1YS6 A;  2Y0S N;  3ABK H;  3MEX A;  3PQJ A;  4DJA A;  3AG1 H;  3DKX A;  5FD6 A;  3S15 J;  4A3B J;  3KFW X;  1BIA A;  4NC7 A;  5EZH A;  1U78 A;  2FXA A;  2HQR A;  4EM2 A;  1KU9 A;  3I53 A;  1UHW A;  1O57 A;  5TIS C;  2ISZ A;  3KEO A;  3HOV J;  1G6N A;  3HOZ J;  1IGN A;  5JLX A;  9ANT A;  4BNC A;  2P4W A;  1WCM J;  2L3D A;  1U5T B;  1Z91 A;  4MGR A;  4F92 B;  2JVH A;  4D5C A;  2E60 A;  5DTD A;  1SMT A;  3KEY A;  1OR7 A;  1GVD A;  1BC7 C;  2HEO A;  1MBG A;  5J47 A;  4MTD A;  2M7B A;  3F0C A;  4Z2Y A;  3J7A O;  3MVP A;  1HA8 A;  2BY2 A;  2BZT A;  4AC0 A;  3O8G A;  3U21 A;  4U7B A;  1S9H A;  2Y48 A;  2DA4 A;  1R22 A;  4CHU A;  2O8X A;  1SFE A;  1WGX A;  3KCC A;  2BE5 F;  2F5C A;  2FF4 A;  3ERM A;  2CW7 A;  4P1W A;  4YIF A;  1RRJ A;  1MNM C;  4A0Y A;  2CYY A;  2ZSH B;  1MBE A;  3RDI A;  2L02 A;  3ELK A;  5FKO A;  1HDD C;  3V42 A;  5TRD A;  5J8F A;  1R49 A;  5FD5 A;  2NRA C;  4RGR A;  3TW6 A;  3O3K A;  3EDP A;  1WJD A;  3VWB A;  3TDU C;  2KDZ A;  1WSU A;  1W36 D;  1B4A A;  5DV5 A;  3UKG A;  2LMD A;  2ZNY A;  4DYC A;  2E5Z A;  2HKX A;  3OYE A;  3LL7 A;  4C3I J;  3ONQ A;  2ADU A;  5BS6 A;  2VXZ A;  1O7F A;  1TT5 B;  3QAH A;  4HA8 A;  2NNY A;  3WE2 A;  5DUK A;  1H8A C;  3V8J A;  2PJR A;  2O7O A;  3HYI A;  3E6C C;  1J75 A;  3S1R J;  3A2K A;  2LP0 A;  2MA3 A;  4M74 A;  3K70 D;  3G3Z A;  2FU4 A;  4L5E A;  1I3A A;  2VXD A;  3H1C A;  4LMY A;  2E34 A;  1S3J A;  4IVN A;  5DD4 A;  3FBI B;  1ZKG A;  2Z5U A;  3H3Z A;  4BJ5 C;  3RPU A;  1ITY A;  4PFO A;  3WTV C;  3BWG A;  4JX5 A;  1R5I D;  3E5U A;  2EK5 A;  5JFR A;  2C6Y A;  1SD7 A;  3WGG A;  3ZQF A;  2FJ1 A;  1AA7 A;  2WAE A;  2LRD A;  5TGT A;  1V5F A;  4E7Z A;  4L5J A;  4OIR F;  4RBO A;  4WWC A;  2M87 A;  2F4M B;  1A5J A;  4IRG A;  4M9X A;  1DGW Y;  4CYD A;  5L3D A;  3K2A A;  1SD6 A;  1D5Y A;  2VOP A;  1FMW A;  1FIA A;  2ECC A;  4M9Z A;  2ZNZ A;  3P7N A;  1Y39 A;  3ZMS A;  2G7H A;  1UST A;  4NB5 A;  3ZQG A;  2JN6 A;  3GLX A;  1MD0 A;  2DK8 A;  4Y3O A;  1XCV A;  5BNG A;  4HQE A;  2X48 A;  3TW7 A;  4ZDO A;  3Q0V A;  5BMZ A;  2NVX J;  2UV1 A;  1XD7 A;  3F9K A;  3QP5 A;  5J40 A;  5EG0 A;  1OCZ H;  1HBX G;  3C3W A;  1I50 J;  1MNE A;  1OCP A;  2K5C A;  3H9Q A;  1JHF A;  4QLC U;  5D6F A;  3DQV C;  4KUM A;  5F04 A;  4MEX F;  2E35 A;  2R5Y B;  1K6O A;  3RYP A;  4UNO A;  2HYF A;  4XRS A;  4BQO A;  3WHB A;  4IX7 A;  3SEZ A;  1ETX A;  1P4W A;  1OYW A;  3OSG A;  1TC3 C;  3BG7 A;  4WX9 A;  3U9G A;  4EAT A;  1K83 J;  2O61 A;  3GXO A;  2V1N A;  1FYK A;  3G1L A;  3L2Q A;  2V9P A;  5D5U B;  4YFN F;  1MMA A;  4E7L A;  2HOS A;  2JSC A;  1XCB A;  1DUX C;  5L3C A;  1J2X A;  1GUU A;  4EGZ A;  1X58 A;  5ED4 A;  4FAS D;  1R1U A;  3BCA A;  4IRH A;  2BY1 A;  4IHY A;  3H9G A;  3W6J B;  1TL8 A;  1UG0 A;  1W7P D;  5ICG A;  5IPA A;  3H5N A;  4X1E A;  3HDD A;  1MSF C;  4IPA A;  1MMN A;  3TO9 A;  4QSH A;  1YE9 A;  1LEA A;  1NG6 A;  3IHU A;  2LLK A;  2ZFU A;  1WH5 A;  2HDW A;  3H0G J;  2DTR A;  4L18 B;  1FMV A;  3CP2 A;  1YLF A;  1I27 A;  1TWH J;  2DFF A;  3QPH A;  1Y1V J;  4E7I A;  1IN5 A;  3ZMT A;  4LIT A;  1A36 A;  2V9V A;  1X4O A;  3H5A A;  1KQ8 A;  2JRT A;  1ZGW A;  2H8R A;  1OYY A;  3P5J A;  1HSJ A;  1MW7 A;  2LNB A;  3M1C A;  5F08 A;  2KJC A;  2XKO A;  1AU7 A;  3BRO A;  1ETY A;  4NBQ A;  2V26 A;  2JPB A;  1TWG J;  2FA5 A;  3PJR A;  2W82 A;  3J7Y J;  2WY8 Q;  1TQM A;  5HNH A;  2ELK A;  3HTU A;  5FJ8 J;  2JA8 J;  3E6M A;  2VLA A;  1HOM A;  5IOZ A;  2BOL A;  2KQR A;  3OOP A;  2CSO A;  2COB A;  1B9M A;  1U5T C;  2F4O B;  4EEF G;  3MD2 A;  4WXC A;  4E7J A;  3FHN A;  2CQK A;  3TGN A;  3IAS 2;  4Y52 J;  3E6B A;  4C2U A;  2LY9 A;  1FOX A;  2XDV A;  4I2O A;  3C2B A;  2JSP A;  2CU7 A;  4XKC A;  3K10 A;  1IAW A;  1OCC H;  1DGR M;  2VN2 A;  4PK4 A;  1FOY A;  1IUF A;  4RM3 A;  4U0W A;  2M9H A;  5ILU A;  1VQ8 I;  3I71 A;  4HF1 A;  3M4O J;  4B3X A;  3HKZ A;  3AAF A;  3OYN A;  2FML A;  1ZYR F;  1ODD A;  2YPR A;  1JKR C;  4N9H A;  2WV1 A;  3WU0 A;  2LSO A;  1QBJ A;  4ESF A;  2B9S A;  2AO9 A;  2HFH A;  3N97 A;  4XLH A;  3RKQ A;  4UVB A;  2PJR B;  5FLV A;  3GZ5 A;  3MCZ A;  5KAI C;  3H3U A;  3H35 A;  2OZ6 A;  5KNL A;  2ME0 A;  1JI8 A;  2K4B A;  3M1E A;  2MYS A;  3LAJ A;  3ECO A;  3ERE D;  2GBY A;  2P6S A;  1MJB A;  5GTH C;  2IEK A;  2EFO A;  4IJA A;  2NVU B;  3WGI A;  4UXN A;  2A69 F;  1WVR A;  1JKP C;  4RLF A;  3H36 A;  1QA6 A;  1X2M A;  2FSW A;  1P7J A;  2KMU A;  1R23 A;  1GDT A;  1OCO H;  1MZB A;  1WRJ A;  1ZRF A;  5KK1 A;  5E17 F;  3JTH A;  4HLX A;  2R0Q C;  4EVI A;  2MH9 A;  4XM3 A;  3VSK A;  2JT1 A;  2ZME A;  3V4G A;  3FXQ A;  3OOU A;  5JVG F;  4Q5S F;  2X6X A;  3CCS I;  4BBR J;  3BT9 A;  3B6C A;  5DCF A;  3PUB A;  3EQL F;  4BUP A;  3HM5 A;  3WU2 C;  2QQ9 A;  4RLQ A;  4CDG A;  5GPC A;  1B59 A;  4M71 A;  5LRR A;  3S2D J;  1B1B A;  2MLG A;  2PMU A;  1E17 A;  4ZH4 F;  4EGY A;  1Y0U A;  4CYC A;  2Y0S A;  3JCU C;  2Y2Z A;  1JUS A;  3CCY A;  4BQQ A;  1MMD A;  3IKT A;  3GF2 A;  1BR1 A;  2O9L A;  2OV7 A;  1Z21 A;  3QOE A;  3ZQL A;  1XS9 A;  4RMN A;  3CJT B;  3CC4 I;  1TQI A;  5BPI A;  3S93 A;  2F6C A;  5LFA A;  4KNY A;  4HNV A;  5KVR A;  4P9U A;  3VDX A;  3K6G A;  1S7E A;  3RSN A;  4DIQ A;  4EJV A;  2KJB A;  2LOO A;  1VQ4 I;  1Z6R A;  3TBI A;  3LWF A;  1USS A;  1QZE A;  5K7F A;  2EFW A;  3C18 A;  4HX4 A;  3ZMV A;  3CDI A;  3L2C A;  3HOY J;  2WB1 N;  3BG5 A;  3V8K A;  2ZXJ A;  1P2F A;  3HB9 A;  5E20 A;  2VBX A;  3CO7 C;  4PSX A;  1CGP A;  2OAZ A;  3VOD A;  2GIZ A;  3H0D A;  1LB2 A;  5K7Z A;  3GTK J;  1KYZ A;  4HPQ A;  3PIP F;  3K0L A;  5J4Y A;  4I98 B;  3RKW A;  4GO1 A;  2YU3 A;  2QBY A;  4AVP A;  5A2Q K;  5BPD A;  3M8J A;  4OAY A;  1ETK A;  1F43 A;  3HIF A;  1T08 B;  1OCR H;  5LHH A;  4AID A;  2HKO A;  1QNT A;  1V54 H;  3U1K A;  3GWZ A;  3HEF A;  3EUH A;  2PMZ N;  5FRN A;  4XN0 A;  1LVK A;  2HZT A;  1VQK I;  4HRI A;  1R5G A;  2V6E A;  2Z2S B;  2OQG A;  3I59 A;  3K4M A;  2H1L A;  4LK0 F;  4KDP A;  3CUQ A;  1WJB A;  2YX7 A;  3FK6 A;  3OL3 A;  3U2R A;  3SHF A;  2YU9 J;  3JSP A;  3S1Q J;  2Q1Z B;  1SEU A;  3MAJ A;  5H6R A;  4DYQ A;  3CQZ J;  1LFU P;  2PBI A;  3VYR B;  1BM9 A;  3K4C A;  4BE1 A;  4E7S A;  1TWC J;  4L9V A;  3R6S A;  2KIF A;  5EEG A;  4MO7 A;  3LQQ A;  3HOX J;  4OIQ F;  3CJQ B;  2FMY A;  1YW8 A;  5GAG J;  2DOF A;  3HOT A;  2JA2 A;  4AIK A;  1YIO A;  4A3D J;  2NXN B;  2HI3 A;  3CCM I;  3LSK A;  4D7N A;  1V3F A;  4HOB A;  3TOB A;  3SEQ A;  1J09 A;  4HAM A;  3DCF A;  4RGX A;  4CCK A;  3CF2 A;  4G7H F;  3QU6 A;  1JUM A;  3G71 I;  5M3F J;  1XC5 A;  4CCO A;  4ESJ A;  4D9J A;  4KMF A;  4JBA A;  4F52 A;  3R60 A;  1T39 A;  3B6A A;  4I02 A;  1R1T A;  1J59 A;  4A3G J;  4HLY A;  2FX0 A;  3DTE A;  2D2W A;  2H1K A;  1OR7 C;  2R7O A;  1XDU A;  2KL4 A;  1VQ6 I;  3LSM A;  2XUB A;  4KIB A;  1OCT C;  1HQC A;  3GFJ A;  1QZZ A;  1D0Y A;  2I5U A;  1D8K A;  2P7C B;  5CQG A;  2IGM A;  1XMA A;  3HPG A;  1PUF A;  3LA7 A;  5ICF A;  1H0M A;  2XGX A;  4KIS A;  2DA2 A;  4HZF A;  3ZXS A;  4LK1 F;  1IN6 A;  5IP6 A;  5EGO A;  3LST A;  4GYI A;  2ZXH A;  2RGV A;  5E1X A;  2JA5 J;  2EIK H;  2NVT J;  2OTL I;  4PFP A;  1TLH B;  2BHZ A;  2YX4 A;  2HXI A;  2J5P A;  3HC7 A;  4PZJ A;  4G12 A;  4MEY F;  5E1Z B;  3OR1 C;  2MC3 A;  2RN7 A;  2QWW A;  1IN8 A;  1KU7 A;  4E70 A;  4AVZ A;  5L3B A;  1W5S A;  3I0T A;  4OAZ A;  3RPQ A;  2RQQ A;  4XR6 A;  2EBI A;  3IRR A;  2L7F P;  1GVJ A;  2LC2 A;  3AG4 H;  3KLO A;  1ZR2 A;  1BIB A;  2L54 A;  1R7J A;  1T56 A;  1ZAR A;  2M8G X;  2RC4 A;  1IZ1 A;  2XF7 A;  3D5R C;  1UHM A;  2VI6 A;  3GZ6 A;  5JVT A;  4EMS A;  4J01 A;  1L0O C;  1IXC A;  1OJL A;  2LRE A;  3ZCO A;  3I55 I;  2MFZ A;  1Q1H A;  2EB7 A;  4GXO A;  4JP0 A;  4BL0 B;  2FBK A;  1D0X A;  2L0K A;  1YO5 C;  1XMK A;  5C44 J;  1Z05 A;  4ZZD A;  5JR3 A;  1Y6I A;  2OC6 A;  3ML6 A;  2IP2 A;  3V7R A;  2K86 A;  1DQU A;  4O6J A;  2XRO A;  3BTJ A;  1X1B A;  4I09 A;  3VYU B;  1KQ0 A;  1YX5 A;  3G1M A;  3SZG A;  3T1B A;  5D5X B;  3HSR A;  2ZCW A;  5LHI A;  2RKH A;  3QQA A;  4WXH A;  3OV8 A;  5JHF A;  3HRU A;  3ZRG A;  4ASN A;  4CYC B;  2NS7 A;  3KE2 A;  4H0E A;  5FKK A;  2DW4 A;  3ZOB A;  1DP3 A;  2B7E A;  3DF8 A;  1PDN C;  3QU3 A;  1Y56 A;  4NC6 A;  1UEL B;  4RB1 A;  2XVC A;  1YG2 A;  3QYF A;  3PSF A;  1O3T A;  1MMS A;  4WF2 A;  3NWT A;  3AL0 B;  5JI6 A;  2VJ4 A;  1CF7 B;  3M3Y J;  3BCB A;  1FTT A;  3KLN A;  3LSI A;  3OIQ A;  1G3W A;  3UNG C;  4NQW A;  1LQ1 A;  4L0Z B;  2XHK A;  1XDS A;  4E4H A;  4BEH B;  2LR8 A;  5CJ9 A;  3V7S A;  2MAB A;  2CH0 A;  3JRC A;  1TZL A;  1KA8 A;  1K78 A;  2H94 A;  2ICW G;  3B73 A;  1PYV A;  4C3H J;  2XAS A;  4EJO A;  2W1O A;  1LFP A;  1R1V A;  3HOW J;  1R4N B;  1WHU A;  3ZMZ A;  5FLX Z;  4HNU A;  1KU2 A;  3F22 A;  4MTE A;  1FJL A;  1ZRC A;  3DTI A;  5ERI A;  1ON1 A;  3ZN0 A;  4MQ9 F;  2V7F A;  5CKT A;  1MBK A;  3GYH X;  1V5G A;  3E1S A;  2KPM A;  4PJN A;  1XMX A;  2DCE A;  2K27 A;  3ZMD A;  1U9N A;  3CES A;  1U9O A;  3I59 B;  1MBF A;  3F8F A;  3NWS A;  3SFI A;  2H09 A;  2VT3 A;  4DZJ A;  2GA2 A;  1QGP A;  4IXA A;  2ID6 A;  1FOK A;  1QVU A;  2R7D A;  1TWF J;  2XPW A;  2R7F A;  4M3F A;  2XPV A;  4IHS A;  2JUG A;  2OU2 A;  2ME6 A;  5HOD A;  4OIO F;  5E8G A;  1YS7 A;  4B3A A;  3CZ6 A;  2E71 A;  4B43 A;  3GBG A;  5F27 A;  2CGP A;  2A5W A;  3M9A A;  3B02 A;  3RKY A;  1IO2 A;  3REO A;  5L3F A;  2V4J C;  4UV9 A;  4KA4 A;  1YI2 I;  3I3L A;  3GFI A;  3V7C A;  3KYL A;  3ZQ7 A;  3DBL B;  2K02 A;  2DMN A;  2M5W A;  4BQN A;  1T0F C;  3CO6 C;  1NTC A;  3A0B C;  5HLH A;  4HYE A;  1BI1 A;  3CDL A;  4OWR B;  2IBD A;  2DOD A;  2FRH A;  2ZSI B;  3KZI C;  4YEJ A;  3BTI A;  2QF7 A;  1U0J A;  2HVQ A;  2GXA A;  3S2W A;  1B72 A;  2NOG A;  1LPQ A;  1A6I A;  1S8N A;  2K3P A;  3P9I A;  3QOP A;  3CD6 I;  4O5V A;  2JQ7 A;  2XAG A;  2COM A;  2QYO A;  4UUS A;  3HOS A;  4HV6 A;  1PUE E;  3FBN B;  2R5Z A;  1IRG A;  2RRE A;  2RDP A;  3NQO A;  2IJL A;  2VQG A;  2STT A;  1T33 A;  1IG7 A;  5FFZ A;  1O3Q A;  1HXD A;  3D5S C;  5K5O A;  3CCR I;  1H89 C;  2NOJ B;  2KZV A;  3FK7 A;  3BY6 A;  3FIS A;  4JOM A;  3FXL A;  1MSE C;  1PUF B;  4LFU A;  3ZQC A;  2M1B A;  4N4O B;  3VEP A;  2W7N A;  2DYS H;  3QP6 A;  1N75 A;  2MBF A;  3CC7 I;  3OYB A;  3K1M A;  2QKL B;  3J80 Z;  3BJA A;  2V9K A;  2FNP A;  3H92 A;  2LVS A;  1VQ7 I;  1T95 A;  1K79 A;  2V1U A;  3ULQ B;  5LLQ A;  1IC8 A;  4H4K C;  4LLG F;  2BGC A;  1T38 A;  2DT7 B;  2E1C A;  1W0T A;  2CV2 A;  3RZD J;  4FHT A;  5FO5 A;  4J19 A;  4E7H A;  3TP0 A;  2G9W A;  3PQK A;  5F64 A;  1NK2 P;  4CO8 A;  5IYC J;  2WB1 A;  2ELJ A;  2LTP A;  1WJA A;  3LSH A;  1MH3 A;  4HX7 A;  1YIT I;  2PEX A;  3ABM H;  5LEJ A;  1FIP A;  2O5R A;  4JK1 X;  4YEL A;  1FC3 A;  3GME A;  2OJE D;  4W1U A;  4XON A;  1ZG5 A;  4E7K A;  2DQR A;  2DPU A;  2GLO A;  4RAZ A;  2YS9 A;  1FSH A;  3I56 I;  5HS7 A;  3OYH A;  1XTA A;  4GDF A;  1KZH A;  3BR5 A;  2XRN A;  3SDG A;  4B47 A;  2E2H J;  1X4P A;  3CC2 I;  3L2V A;  1XSX A;  1U8R A;  3FXM A;  3SJM A;  1WKM A;  2QGU A;  1VI0 A;  4LD5 A;  2A68 F;  2CWE A;  1S29 A;  2M0C A;  3K1N A;  4EJW A;  2UXX A;  2GZW A;  1SAU A;  2E7W A;  3E3V A;  3VFZ A;  4A0Z A;  1K4S A;  2K9S A;  2R7Z J;  4FX0 A;  4BDY A;  1XSD A;  3S8P A;  3ZPL A;  4BJT A;  3L2U A;  2MLK A;  2AQE A;  3DU5 A;  2ZFW A;  4NDL A;  1V4R A;  3SQN A;  4HNT A;  4ZTJ A;  1HKQ A;  4B1R A;  5IT9 K;  1FNN A;  4IRI A;  3KP6 A;  2E19 A;  5AIP A;  2ETH A;  1M1E B;  4IOC F;  2JA7 J;  2BXZ A;  1FLI A;  1QPI A;  4ZYE A;  4M6V A;  4XOT A;  2VPL A;  1F36 A;  1YJ9 I;  4G6D A;  3CJN A;  1V5E A;  5CVJ A;  4F91 B;  2MD0 A;  4M6X A;  3SZP A;  5JHU A;  2PI0 A;  5HLT A;  3PNT A;  4A6D A;  3DXJ F;  4DNC A;  2PJP A;  1R4M B;  2CS3 A;  3ABT A;  2DN0 A;  3P9K A;  1UHS A;  3LSJ A;  4ZZL A;  2M4G A;  2KKO A;  2KT0 A;  3N05 A;  4KIG A;  2QA4 I;  2A6T A;  1WJ5 A;  1K78 B;  5H20 A;  3CP8 A;  3I64 A;  5AON A;  3O6B B;  1Z1D A;  2CUJ A;  1YFH A;  3FKJ A;  3AL0 C;  5DM7 F;  1BI2 A;  3PUF A;  3OYL A;  3BG6 A;  4I6Z A;  3JRA A;  1T98 A;  1YW7 A;  4ETS A;  5DCM B;  1EH8 A;  1QU3 A;  3QRF F;  2GAU A;  3TKY A;  2HVR A;  5B3S H;  2M3A A;  3E5Q A;  2L01 A;  5IT3 A;  3KEQ A;  4GYG A;  1SC7 A;  3CDH A;  4HW0 A;  2R7W A;  2V79 A;  5DUI A;  4RB2 C;  1P92 A;  2WBM A;  2W84 A;  3RZO J;  3WTT C;  3DKY A;  4LLN A;  4G6Q A;  2RAE A;  4ZYD A;  4TV7 A;  2OBP A;  2W4S A;  2XKP A;  2MG4 A;  4A3M J;  3BDD A;  2HNH A;  4N4N B;  2V6C A;  4Y4R A;  2L4M A;  4XIC A;  3EUH C;  1D8J A;  1O7L A;  1XGS A;  4L9N A;  2LD5 A;  1BJA A;  4CGZ A;  2DK5 A;  2XSJ C;  3IWF A;  2NS8 A;  3J7Z I;  1IW7 F;  1SAN A;  1JXS A;  4ENK A;  2M45 A;  2M7A A;  3DV8 A;  1A31 A;  1RKT A;  4D0P A;  3PL8 A;  3FZV A;  4DOZ A;  4BBS J;  1I3Q J;  1BI3 A;  2KP6 A;  5E18 F;  2WAD A;  2LDU A;  3ZP5 A;  2LKS A;  2DI3 A;  2HQA A;  1RET A;  4ZTF A;  1YYV A;  4KN4 X;  4BE0 A;  2IS6 A;  2AXT C;  3EYI A;  3DPT A;  4A3E J;  3Q5F A;  3BPX A;  5EF6 A;  5D6E A;  1Z0X A;  1ERD A;  2F5D A;  3TO7 A;  1YHQ I;  3W2W A;  4KIF A;  2TCT A;  1UFM A;  2VC0 A;  2VT2 A;  3W6V A;  2DMT A;  2Z1D A;  1OMI A;  1EKE A;  2OUM A;  3KIO A;  4UUS B;  2X0L A;  2XB0 X;  2G0E A;  2IAI A;  2R5Z B;  1WJC A;  4RB0 A;  2EH3 A;  1BL0 A;  3BTL A;  2WY7 Q;  1LFB A;  1KON A;  3MKL A;  2JUC A;  4KT5 C;  2K9Q A;  3PFI A;  3Q9V A;  3HL2 A;  1JT0 A;  2E1O A;  4EM0 B;  3KZY A;  4UB6 C;  1VQM I;  1Y8Q B;  3FKI J;  4KN7 X;  4IHW A;  4A3J J;  3W2V A;  4AD9 A;  2W00 A;  2R7X A;  1W5T A;  3DEU A;  4OU0 A;  4B48 A;  2GXG A;  2XF6 A;  1BW6 A;  2DJI A;  1QHH D;  3EPZ A;  5AIQ A;  2IVM A;  3UR3 C;  1UAA A;  2DJN A;  2GXB A;  3SXY A;  4MNU A;  1FYM A;  2R3S A;  5M3M J;  5GAE J;  5K7H A;  3F6V A;  4Q48 A;  4C2T A;  3ISP A;  3F8B A;  3KYD B;  1SFK A;  4EV0 A;  4AIJ A;  1NK3 P;  1VQ9 I;  2H8W A;  3RCO A;  3FXO A;  2LBF A;  3T8T A;  2MC4 A;  2P8T A;  3H9J A;  3OYI A;  3DKW A;  3F8C A;  3NRV A;  1XGO A;  4A3I J;  3S1N J;  1GHC A;  4QPQ A;  4I7H A;  3CLQ A;  4AWX B;  4RAY A;  4Q4Z F;  3LFK A;  2EJR A;  3WTY C;  5KAF C;  3R61 A;  1AKH A;  1JGG A;  3C2H A;  3JAM K;  1ZTR A;  1R71 A;  2QQB A;  2E7X A;  2HTJ A;  3T0Y A;  2DFI A;  2IW5 A;  2HS5 A;  3IRQ A;  5GTI C;  2A3S A;  2N8G A;  4PJJ A;  2LFB A;  1BN5 A;  1MIJ A;  4U0Y A;  4IZZ A;  4NNJ A;  2XAQ A;  3A0H C;  2GIV A;  3ZN1 A;  2EFQ A;  2JK3 A;  4LB6 B;  3OYA A;  4IL6 C;  3AKZ A;  2HDD A;  4BAC A;  2J5O A;  4BXU A;  3D1N I;  1TQP A;  5LGU A;  3RTR A;  4IOA F;  2DA6 A;  3F8M A;  5TJJ A;  3GEZ A;  3OS2 A;  1PP7 U;  4XQF A;  3IP4 B;  2QSG X;  1X1P A;  1IXR C;  4HV5 A;  5D8K B;  1K6Y A;  4KIT B;  2OCE A;  5EG0 B;  1HKS A;  1P4A A;  4RDU A;  3M7G A;  3ZMU A;  2LY2 A;  3PO2 J;  2FNA A;  1JKQ C;  2HTS A;  2HU9 A;  2K9L A;  3W3C A;  3BOQ A;  5FGM A;  1B8I A;  4KYW A;  2R92 J;  4IHV A;  4BHC A;  4X6A J;  4LIU A;  3HRS A;  3WE3 A;  2JJ7 A;  2LF8 A;  2D5V A;  2EWN A;  1RI7 A;  4UHT A;  3BR2 A;  3CUO A;  1WFX A;  3FM3 A;  4EM1 A;  4CZC A;  1MMG A;  1KYW A;  4FTH A;  4RAF A;  2DA5 A;  1XGM A;  4ZDP A;  3WG7 H;  1W36 C;  2DA1 A;  2GA1 A;  1IV6 A;  2QZ8 A;  2ZO4 A;  4V2F A;  2HZD A;  4XLE A;  2I8D A;  2MW8 A;  3ZGK A;  2EA4 A;  4A2U A;  3VOE A;  1A6Q A;  1FZP B;  1E2X A;  1OQY A;  1QZY A;  2DQL A;  3D0S A;  1Q1V A;  4ABZ A;  4BU2 A;  4KT6 A;  4LGW A;  1OKR A;  3BPV A;  2FBH A;  2MH2 A;  1XG1 A;  4DZP A;  3C2G A;  1C0W A;  3COA C;  3K70 C;  3LFU A;  1LJ9 A;  2BXY A;  3OYD A;  1YIJ I;  2JVG A;  1OLT A;  5HOO A;  1I5Z A;  1DDN A;  2STW A;  3S3N A;  3JRF A;  1ZGA A;  3S17 J;  3FXJ A;  4UB8 C;  5FRO A;  3KET A;  1SVM A;  2M4K A;  4RM2 A;  3OYF A;  1H9G A;  1S7O A;  1GXQ A;  3EUA A;  3GZN B;  4D5F A;  5CVI A;  4GGG A;  3WG9 A;  3LOC A;  4QPO A;  5HLG A;  3OS1 A;  1FYL A;  1SD4 A;  4JX6 A;  1X3Z B;  2IGK A;  5D5V B;  3MKW B;  4YRV A;  3K4B A;  3H5R A;  2IS1 A;  2KHM A;  3GW2 A;  4D1Q A;  4OIP F;  3S1M J;  1T6S A;  3PNY A;  2R7R A;  4GFB A;  3JRB A;  2EIL H;  4A93 J;  3DBR B;  1U6G A;  3JRD A;  2YUS A;  1RR8 C;  1QO0 D;  1TT0 A;  2PMH A;  5CVV A;  4C9Y A;  2XRL A;  1WH7 A;  4U87 A;  2QEX I;  3L1P A;  2LKX A;  1LE8 A;  4IO9 F;  1EF4 A;  5FRM A;  1OFC X;  1IJW C;  4N9I A;  2VL8 A;  4RS8 A;  1ZG3 A;  1UMQ A;  3GLL A;  1ZLK A;  3HXL A;  4P9F A;  3BTC A;  3CMA I;  1R9T J;  4F55 A;  2KFD A;  2NS0 A;  5DYM A;  1D3Y A;  5E8I A;  3WTZ A;  2EFN A;  2AHQ A;  3BJO A;  4M3D A;  1P9Q C;  5EEH A;  4XRF A;  1HW1 A;  4BGD A;  1YRN A;  3GTJ J;  2B63 J;  5F0F A;  1TBX A;  3FM5 A;  4IF4 A;  4U0V A;  3OYC A;  5FKL A;  1MH4 A;  2HDC A;  4PUS A;  4ZJZ A;  4M3B A;  1IN7 A;  4M9S A;  1K61 A;  1LUJ B;  4XLP F;  4BDZ A;  1IUY A;  1RR7 A;  2HXO A;  5EJC A;  2L9N A;  2M30 A;  1YW9 A;  3TP3 A;  3OR2 C;  1RUO A;  1SFU A;  2EZH A;  4HF0 A;  3OIP A;  1MGT A;  1SFX A;  4U7D A;  4W97 A;  4R8H A;  3LMM A;  2M34 A;  4RGS A;  3HUG A;  4XOP A;  3DBH B;  4XID A;  2BV6 A;  4CA0 A;  1YTY A;  3J80 K;  1X1D A;  2UXN A;  2A6H F;  1UZC A;  2ZJ2 A;  3ROU A;  3CMM A;  4M6Y A;  3TED A;  1FX7 A;  4S0H B;  4WK8 F;  3VPR A;  4DQ2 A;  3OYK A;  1TNT A;  5JLW A;  5H6Q A;  1S6L A;  3WTS C;  4NC8 A;  2ZME B;  4RAG A;  3H3V K;  4XLN F;  3DWL E;  4P55 A;  3A02 A;  2EV6 A;  2Y9Y A;  4U88 A;  5FKN A;  5J1Y A;  3S3M A;  1POG A;  4WCG A;  1RKW A;  4C30 A;  1RPW A;  3GO5 A;  3MWM A;  3MKZ A;  4N0B A;  1QPM A;  3HGY A;  2TRT A;  3K9T A;  4Y17 A;  4FCY A;  2IS4 A;  5CVR A;  1G3T A;  2ZJR F;  3KX2 A;  2MD5 A;  3LNQ A;  1R6R A;  1HW5 A;  1ETV A;  2FOW A;  3K4J A;  2L4A A;  3BC8 A;  3SFZ A;  2KRF A;  2IXS A;  1ULY A;  5E1W A;  2DAO A;  4WXD A;  3FXK A;  2BHY A;  2QCO A;  2VQL A;  1J5Y A;  2R4G A;  2G7U A;  2ELH A;  1KGS A;  2Y69 H;  4PSW A;  2IPQ X;  2E1M B;  4XSZ F;  2D1V A;  2WA0 A;  2FQ3 A;  3QOD A;  4XNF A;  4IHT A;  1R00 A;  5HDN A;  1MJ9 A;  4OOI A;  4BYY A;  1JTX A;  4CCM A;  3PO3 J;  1IN4 A;  4CXF A;  2LH9 A;  3Q0W A;  3CCV I;  1B8I B;  3MZH A;  2Y31 A;  1BW5 A;  5A2Q Z;  4RB3 C;  1JUP A;  2EQR A;  2FOK A;  2UZK A;  1YQA A;  2ID3 A;  1APL C;  4BHP A;  1TNS A;  3BG9 A;  3DEE A;  5K5R A;  1BOB A;  2XAU A;  2L7M P;  3DP7 A;  2QBY B;  3HJE A;  1ZRD A;  2XAH A;  3S2H J;  1U8B A;  5IY5 H;  1FSE A;  2E36 A;  2GOM A;  3D5L A;  3BR0 A;  3L9F A;  4AIH A;  1UB9 A;  1LDK B;  1LDD A;  1FBQ A;  4DGW B;  3HPH A;  3TQN A;  1Z3X A;  1YJN I;  1XX5 A;  2R7T A;  3CCE I;  4XKB A;  1GV5 A;  4ZYG A;  2NNN A;  5FKM A;  1NH3 A;  4PJ0 C;  4V2G A;  4B09 A;  5HLI A;  4O3M A;  3CUQ B;  3FMR A;  2I10 A;  1QRY A;  2AXL A;  3K2Z A;  1VQP I;  1JHH A;  2E5N A;  2JTV A;  2L2O A;  2QQ8 A;  2HVS A;  3KP4 A;  4IHX A;  1MKM A;  2KIQ A;  3DFG A;  2DA3 A;  2XGE A;  5E3O A;  4LIV A;  1O3S A;  4JYK A;  1XGN A;  4A0X A;  5LGN A;  4KJZ A;  1BA5 A;  4G9Y A;  1GT0 C;  5L3G A;  1DPU A;  2KLO A;  3F8N A;  2CUZ A;  1SFO J;  4A3L J;  2EA2 A;  2X9D A;  1ON2 A;  1FEX A;  3E7L A;  2OPT A;  4BE2 A;  3CCL I;  5LBQ A;  2VKV A;  1RUN A;  1Z6T A;  2WC2 A;  3VSL A;  2RNG A;  3IV5 A;  2DU9 A;  3E0J B;  2KIU A;  1G8X A;  4AYB N;  2DLL A;  3OSF A;  4GRI A;  3EUK L;  3RJP A;  2VE8 A;  1BJZ A;  1LKX A;  1GV2 A;  2VKE A;  3FX3 A;  3HRT A;  1Z9C A;  2IS2 A;  3I54 A;  3ABU A;  4CCN A;  3S32 A;  5DDG A;  3CME I;  3VYS B;  5M5X J;  4P5O A;  5B66 C;  3CLO A;  3ABL H;  2QSH X;  2VQC A;  5M5W J;  1ZGJ A;  3HSE A;  2XGC A;  2QSF X;  4HST A;  3O2P E;  1RES A;  1P6R A;  3DU6 A;  3RIR A;  1T2K A;  4XLA A;  2O8K A;  4YG2 F;  4OMY A;  2QVO A;  3A03 A;  1XPX A;  1X2N A;  2F5V A;  3GTG J;  2Y9Z A;  1E0E A;  2FQ4 A;  4G94 A;  2WAQ N;  4CSW A;  2R93 J;  3BR3 A;  3MKY B;  1LE8 B;  2H27 A;  3WGH A;  1HKT A;  3EYY A;  3HBL A;  2JWT A;  3HZJ A;  4B8X A;  1DU6 A;  2ESH A;  3T5X A;  1NHA A;  2V1D A;  2JRM A;  3ASO H;  4QTR A;  4I76 A;  2W24 A;  2DTZ A;  3R4K A;  2VJ5 A;  3DEW A;  2B0L A;  2NVQ J;  4R79 A;  2IA2 A;  1W7P A;  2Q2E A;  5FLM J;  5EGO B;  2CRG A;  2Y75 A;  4Y15 A;  3QYB A;  1YRN B;  2KZG A;  5IP9 J;  1WI3 A;  1JTY A;  1RNL A;  1RC9 A;  1HF0 A;  3O8H A;  2CUF A;  3GTO J;  1A04 A;  4BH9 A;  5FB2 A;  4FT8 A;  5EEA A;  3GCM A;  5GPA A;  2M8E A;  2P81 A;  2BY0 A;  1IXS B;  2K7L A;  3F23 A;  2JA6 J;  1WQ2 A;  1P4X A;  4M72 A;  4DBQ A;  2DT6 A;  1H9T A;  4Y33 A;  1AOY A;  2CQ7 A;  1DPR A;  2V1X A;  1VTN C;  2CV1 A;  3VB2 A;  1ZEL A;  1EV7 A;  2P6T A;  3JRG A;  4A3C J;  4E6K G;  3HUG B;  1JGS A;  3G2B A;  5E3M A;  5L3E A;  3AFH A; 
#chains in the Genus database with same CATH homology
 1KU3 A;  2OZU A;  4CIC A;  4RGU A;  4KFC A;  1I6X A;  2VE9 A;  5HS9 A;  2GWR A;  3J81 Z;  2YSR A;  2CFX A;  1LDJ A;  2NAZ A;  2HQN A;  2CG4 A;  3U1D A;  2QEN A;  4BHB A;  2VON A;  4OIN F;  1XSV A;  1GXP A;  5K5Q A;  3GVA A;  3HHH A;  4ENJ A;  4L0Y B;  1MJA A;  1ONV A;  2O3F A;  3GFM A;  2IA0 A;  4BQA A;  3JSO A;  3HRM A;  3C1D A;  3KP7 A;  3JW4 A;  4EJT A;  1I1S A;  4EJU A;  1KQ9 A;  1RIO H;  1F4K A;  4PCQ A;  1WI9 A;  4UVC A;  3MFK A;  2PN6 A;  5CYV A;  1J0R A;  3T8R A;  2ACJ A;  3BP8 A;  4BAY A;  4I0A A;  4S05 A;  3KP5 A;  3IKV A;  3FWE A;  2A5Y B;  1XN7 A;  4MHG A;  2WWY A;  4P96 A;  2PLY A;  1ZAO A;  2HOE A;  2X4H A;  3TO6 A;  4PGH A;  5HVQ C;  2BBY A;  2P5K A;  3GUD A;  3R0A A;  3FMS A;  1FWZ A;  4EQQ A;  5FFX A;  1R36 A;  2IRF G;  5J8C A;  2VBW A;  2XAJ A;  1ZN2 A;  2LF7 A;  2VOO A;  5D4S A;  1FP2 A;  1WWX A;  5K1Y A;  1T0F A;  3L09 A;  4UUV A;  3CUQ C;  2F2E A;  2PFB A;  1SD5 A;  3L00 A;  2FEZ A;  1FBU A;  5ICC A;  2W57 A;  3KP3 A;  4LJZ F;  2O0Y A;  4ZYH A;  2QUF A;  2F5F A;  2CO5 A;  5F6F A;  3CTA A;  2DPD A;  1J9I A;  2HWV A;  4LG0 A;  2PG4 A;  2Q0O A;  1PP8 F;  2DO7 A;  1JE8 A;  2VC1 A;  4LB5 A;  2Z99 A;  2O03 A;  1O3R A;  2IT0 A;  3K1P A;  3QPT A;  2EFP A;  4HX8 A;  3FHZ A;  2BEO A;  1W7P B;  4YFK F;  1TW3 A;  3WTW C;  3M8F A;  1XB4 A;  3LQR A;  4HF2 A;  4A5N A;  1OPC A;  3DPL C;  1IRF A;  4Q47 A;  3E6D A;  1L3L A;  1F5T A;  2W25 A;  1F9N A;  4PDK A;  3HTS B;  3HHG A;  1SMY F;  3KZZ A;  2K4J A;  3IWZ A;  4HQM A;  5D5W B;  3LAP A;  3TOA A;  2Y0M A;  4ENM A;  3ECH A;  2P5L C;  4XSX F;  3F72 A;  2ZBK A;  1HST A;  4OMZ A;  5HDG A;  3F21 A;  1FP1 D;  4S04 A;  2RQP A;  4I01 A;  1ZG1 A;  4QWQ A;  5IT9 Z;  2JPC A;  3V8L A;  1QQI A;  1BOA A;  4A5M A;  1SAX A;  1BBY A;  4FX4 A;  1MDM A;  5LRS A;  3G73 A;  4G8X A;  3FXR A;  5J6X A;  2XAF A;  1I1G A;  4L9J A;  2VBY A;  3FXU A;  2AS5 F;  4LLL A;  1FT9 A;  1B9N A;  5ICE A;  2KIM A;  1CF7 A;  3JTG A;  3WOD F;  6PAX A;  1FY7 A;  4ON0 A;  3W6K B;  3NEU A;  3R0J A;  1F1Z A;  2Q8K A;  1BI0 A;  2NYX A;  3RYR A;  3BZ6 A;  4I0B A;  3WTU C;  3I4P A;  3MZY A;  2TDX A;  2WTE A;  4GCV A;  2FBI A;  3HSF A;  1Z7U A;  4HDU A;  3FMQ A;  2D45 A;  5F1R A;  3GX4 X;  5FLX K;  2BYV E;  5HDK A;  1FPQ A;  5D4R A;  2ISY A;  4XBF A;  5ILV A;  3SZT A;  1UCR A;  1REP C;  1AWC A;  3F3X A;  2QLZ A;  2JZY A;  3IC7 A;  5D8L B;  2WV0 A;  4A12 A;  3RI4 A;  2ESN A;  2A61 A;  1ZH5 A;  2D1H A;  2H6C A;  3M8E A;  3E97 A;  4CZZ A;  4KIC A;  1EH7 A;  1U5T A;  2VBZ A;  1FBS A;  2RV8 A;  3LA2 A;  5BOX A;  3MQ0 A;  1HW2 A;  2RVC A;  3IL2 A;  5DD8 A;  1G4D A;  2QQA A;  2CW0 F;  5DEQ A;  4LG0 B;  2UWM A;  3Q9S A;  2GQQ A;  3GFL A;  4L9T A;  1K7A A;  1STZ A;  3FF5 A;  2Z3Y A;  2H6B A;  2OA4 A;  2P5V A;  2P7V B;  2HYG D;  1R5H A;  4K2E A;  3BJ6 A;  4YII A;  2Z9O A;  1EH6 A;  4YFX F;  2IA1 A;  4Y13 A;  1X3U A;  2PQ8 A;  2A07 F;  3E5X A;  2XV4 S;  4UVA A;  2OD5 A;  2QM3 A;  5HS8 A;  2DT5 A;  1DP7 P;  3EET A;  3C7J A;  3JAM Z;  4KMU X;  4G7Z F;  3LA3 A;  4JQF A;  1W4M A;  2O6G E;  4MQV A;  4G7O F;  4HDV A;  3F6O A;  1LNW A;  3I58 A;  2W85 A;  1IF1 A;  2E1N A;  2ZKZ A;  2VOD A;  4PGG A;  1RZ4 A;  1G3S A;  1D5V A;  1ZRE A;  1G3Y A;  1S7A A;  3J81 K;  5CVU A;  3L7W A;  2FE3 A;  5LGT A;  1OYI A;  2HR3 A;  2OQR A;  1LVA A;  3K69 A;  3RKX A;  3TDZ C;  1MDM B;  1U3E M;  5LHG A;  2LKP A;  3WTX C;  2YR2 A;  1ZLJ A;  3P9C A;  4ESB A;  3WU1 B;  4UV8 A;  3I5U A;  4R1H A;  1J7K A;  5ILS A;  1U2W A;  2F5E A;  2EV0 A;  2HGC A;  1R58 A;  5LEK A;  4L5I A;  2Z33 A;  2A6E F;  4NHJ A;  2EV5 A;  2RNJ A;  1ZHF A;  1BC8 C;  2XIG A;  1TW2 A;  1LEB A;  5CLS A;  4M73 A;  4ENN A;  5DCM A;  3N4M A;  5BQT A;  2DBB A;  4HBL A;  3KP2 A;  4A6E A;  1TTY A;  4F7Z A;  1B6A A;  1YS6 A;  3MEX A;  3PQJ A;  5FD6 A;  3KFW X;  1BIA A;  1U78 A;  2FXA A;  2HQR A;  4EM2 A;  1KU9 A;  3I53 A;  1UHW A;  1O57 A;  2ISZ A;  3KEO A;  1G6N A;  4BNC A;  2P4W A;  2L3D A;  1U5T B;  1Z91 A;  4MGR A;  1SMT A;  1OR7 A;  2HEO A;  1BC7 C;  4MTD A;  4Z2Y A;  3J7A O;  4U7B A;  2Y48 A;  1R22 A;  4CHU A;  2O8X A;  1SFE A;  3KCC A;  2BE5 F;  2F5C A;  2FF4 A;  4YIF A;  4A0Y A;  2CYY A;  3RDI A;  2L02 A;  3ELK A;  5TRD A;  5J8F A;  5FD5 A;  2NRA C;  4RGR A;  3O3K A;  3EDP A;  3TDU C;  1WSU A;  1B4A A;  5DV5 A;  2ZNY A;  2HKX A;  2ADU A;  5BS6 A;  2VXZ A;  1O7F A;  3QAH A;  4HA8 A;  2NNY A;  3WE2 A;  5DUK A;  3V8J A;  3HYI A;  3E6C C;  1J75 A;  2MA3 A;  4M74 A;  3G3Z A;  2FU4 A;  4LMY A;  1S3J A;  4IVN A;  5DD4 A;  2Z5U A;  3H3Z A;  3RPU A;  3WTV C;  3BWG A;  3E5U A;  2EK5 A;  5JFR A;  2C6Y A;  1SD7 A;  3WGG A;  4L5J A;  4OIR F;  4WWC A;  2M87 A;  4IRG A;  4M9X A;  4CYD A;  5L3D A;  1SD6 A;  2VOP A;  4M9Z A;  2ZNZ A;  3P7N A;  3ZMS A;  2G7H A;  1UST A;  4NB5 A;  3GLX A;  1MD0 A;  2DK8 A;  1XCV A;  4HQE A;  5BMZ A;  1XD7 A;  3QP5 A;  1HBX G;  3C3W A;  1JHF A;  4QLC U;  5D6F A;  3DQV C;  4KUM A;  4MEX F;  1K6O A;  3RYP A;  4UNO A;  2HYF A;  1P4W A;  1OYW A;  4WX9 A;  3U9G A;  2O61 A;  3GXO A;  1FYK A;  5D5U B;  4YFN F;  2JSC A;  1XCB A;  1DUX C;  5L3C A;  1J2X A;  4EGZ A;  5ED4 A;  1R1U A;  4IRH A;  3W6J B;  1W7P D;  5ICG A;  4IPA A;  3TO9 A;  1LEA A;  3IHU A;  2DTR A;  4L18 B;  1YLF A;  1I27 A;  3QPH A;  1IN5 A;  3ZMT A;  2V9V A;  1KQ8 A;  2JRT A;  1OYY A;  1HSJ A;  2LNB A;  2KJC A;  2XKO A;  3BRO A;  2JPB A;  2FA5 A;  1TQM A;  3HTU A;  3E6M A;  3OOP A;  2CSO A;  1B9M A;  1U5T C;  4WXC A;  2CQK A;  3TGN A;  3E6B A;  4I2O A;  1IAW A;  2VN2 A;  4U0W A;  4HF1 A;  5ILU A;  3I71 A;  3AAF A;  2FML A;  1ZYR F;  1ODD A;  2YPR A;  4N9H A;  3WU0 A;  2LSO A;  1QBJ A;  4ESF A;  2HFH A;  3N97 A;  4UVB A;  3GZ5 A;  3MCZ A;  3H3U A;  2OZ6 A;  2K4B A;  3M1E A;  3LAJ A;  3ECO A;  3ERE D;  2P6S A;  1MJB A;  2EFO A;  4IJA A;  3WGI A;  4UXN A;  2A69 F;  2FSW A;  1R23 A;  1MZB A;  1WRJ A;  1ZRF A;  5KK1 A;  5E17 F;  3JTH A;  4HLX A;  4EVI A;  2MH9 A;  2JT1 A;  2ZME A;  3V4G A;  3FXQ A;  4Q5S F;  5DCF A;  3EQL F;  2QQ9 A;  4CDG A;  1B59 A;  5LRR A;  4M71 A;  1B1B A;  2MLG A;  2PMU A;  1E17 A;  4ZH4 F;  4EGY A;  1Y0U A;  3IKT A;  3GF2 A;  1TQI A;  5BPI A;  4KNY A;  5KVR A;  4P9U A;  4EJV A;  2KJB A;  1Z6R A;  3LWF A;  1USS A;  2EFW A;  3C18 A;  4HX4 A;  3ZMV A;  3L2C A;  3V8K A;  2ZXJ A;  1P2F A;  5E20 A;  2VBX A;  3CO7 C;  1CGP A;  2OAZ A;  3VOD A;  1LB2 A;  1KYZ A;  3K0L A;  4I98 B;  3RKW A;  4GO1 A;  2YU3 A;  2QBY A;  4AVP A;  5A2Q K;  5BPD A;  3HIF A;  5LHH A;  2HKO A;  1QNT A;  3GWZ A;  3EUH A;  2HZT A;  1R5G A;  2OQG A;  3I59 A;  4LK0 F;  4KDP A;  3CUQ A;  2YX7 A;  3U2R A;  3SHF A;  3JSP A;  3MAJ A;  5H6R A;  2PBI A;  1BM9 A;  4L9V A;  3R6S A;  2KIF A;  5EEG A;  3LQQ A;  4OIQ F;  2FMY A;  1YW8 A;  3HOT A;  4AIK A;  1YIO A;  1V3F A;  4HOB A;  3TOB A;  4HAM A;  4RGX A;  4G7H F;  3QU6 A;  4ESJ A;  4KMF A;  4JBA A;  1T39 A;  3R60 A;  4I02 A;  1R1T A;  1J59 A;  4HLY A;  2D2W A;  1XDU A;  2XUB A;  4KIB A;  1HQC A;  3GFJ A;  1QZZ A;  1D8K A;  2P7C B;  1XMA A;  3LA7 A;  5ICF A;  1H0M A;  2XGX A;  4HZF A;  4LK1 F;  1IN6 A;  3LST A;  4GYI A;  2RGV A;  5E1X A;  1TLH B;  2YX4 A;  2J5P A;  4PZJ A;  4MEY F;  5E1Z B;  2MC3 A;  2RN7 A;  2QWW A;  1IN8 A;  1KU7 A;  4E70 A;  5L3B A;  1W5S A;  3I0T A;  3RPQ A;  3IRR A;  1GVJ A;  3KLO A;  1BIB A;  2L54 A;  1R7J A;  1ZAR A;  2RC4 A;  1IZ1 A;  1UHM A;  3GZ6 A;  5JVT A;  4EMS A;  1L0O C;  1IXC A;  1Q1H A;  2EB7 A;  4GXO A;  2FBK A;  1YO5 C;  1XMK A;  1Z05 A;  4ZZD A;  5JR3 A;  3ML6 A;  2IP2 A;  3V7R A;  2K86 A;  4O6J A;  2XRO A;  4I09 A;  1KQ0 A;  3T1B A;  5D5X B;  3HSR A;  2ZCW A;  5LHI A;  2RKH A;  4WXH A;  3OV8 A;  3HRU A;  4ASN A;  4H0E A;  3KE2 A;  2DW4 A;  3DF8 A;  1PDN C;  3QU3 A;  4RB1 A;  2XVC A;  1YG2 A;  1O3T A;  4WF2 A;  5JI6 A;  1CF7 B;  3KLN A;  1G3W A;  4NQW A;  1LQ1 A;  4L0Z B;  2XHK A;  1XDS A;  5CJ9 A;  3V7S A;  1KA8 A;  1K78 A;  2H94 A;  3B73 A;  2XAS A;  4EJO A;  1R1V A;  3ZMZ A;  5FLX Z;  1KU2 A;  3F22 A;  4MTE A;  1ZRC A;  5ERI A;  1ON1 A;  3ZN0 A;  4MQ9 F;  3GYH X;  2K27 A;  3ZMD A;  3I59 B;  3F8F A;  2H09 A;  2VT3 A;  2GA2 A;  1QGP A;  4IXA A;  1FOK A;  2R7D A;  2R7F A;  4IHS A;  2OU2 A;  4OIO F;  5E8G A;  1YS7 A;  2CGP A;  3M9A A;  3B02 A;  3RKY A;  3REO A;  5L3F A;  4UV9 A;  4KA4 A;  3GFI A;  3V7C A;  3ZQ7 A;  2K02 A;  2M5W A;  3CO6 C;  5HLH A;  4HYE A;  1BI1 A;  2FRH A;  3S2W A;  1S8N A;  3P9I A;  3QOP A;  4O5V A;  2XAG A;  2COM A;  2QYO A;  3HOS A;  4HV6 A;  1PUE E;  1IRG A;  2RDP A;  3NQO A;  2IJL A;  2STT A;  5FFZ A;  1O3Q A;  1HXD A;  5K5O A;  3BY6 A;  4LFU A;  2M1B A;  3VEP A;  3QP6 A;  2MBF A;  3K1M A;  3J80 Z;  3BJA A;  2FNP A;  3H92 A;  1K79 A;  2V1U A;  3ULQ B;  5LLQ A;  4LLG F;  2BGC A;  1T38 A;  2E1C A;  4FHT A;  5FO5 A;  2G9W A;  3PQK A;  5F64 A;  4CO8 A;  4HX7 A;  2PEX A;  5LEJ A;  4JK1 X;  1FC3 A;  2DPU A;  1ZG5 A;  2DQR A;  4RAZ A;  1FSH A;  5HS7 A;  2XRN A;  1XSX A;  1U8R A;  1WKM A;  4LD5 A;  2A68 F;  2CWE A;  1S29 A;  3K1N A;  4EJW A;  2UXX A;  3VFZ A;  4A0Z A;  2GZW A;  2E7W A;  3E3V A;  4FX0 A;  1XSD A;  3ZPL A;  2MLK A;  2ZFW A;  1V4R A;  3SQN A;  1HKQ A;  5IT9 K;  1FNN A;  4IRI A;  3KP6 A;  5AIP A;  2ETH A;  1FLI A;  4ZYE A;  4G6D A;  3CJN A;  5CVJ A;  4M6X A;  3SZP A;  5JHU A;  2PI0 A;  4A6D A;  3DXJ F;  4DNC A;  2PJP A;  3ABT A;  3P9K A;  4ZZL A;  2KKO A;  4KIG A;  1K78 B;  5H20 A;  3I64 A;  5AON A;  3O6B B;  1Z1D A;  1YFH A;  1BI2 A;  1T98 A;  1YW7 A;  4ETS A;  5DCM B;  1EH8 A;  3QRF F;  2GAU A;  3TKY A;  3E5Q A;  2L01 A;  5IT3 A;  3KEQ A;  4GYG A;  3CDH A;  4HW0 A;  2V79 A;  5DUI A;  4RB2 C;  1P92 A;  2W84 A;  3WTT C;  4LLN A;  4G6Q A;  4ZYD A;  4TV7 A;  2OBP A;  2XKP A;  3BDD A;  2V6C A;  2L4M A;  1D8J A;  1O7L A;  1XGS A;  4L9N A;  1BJA A;  4CGZ A;  2DK5 A;  3IWF A;  1IW7 F;  1JXS A;  4ENK A;  2M45 A;  3DV8 A;  4D0P A;  3FZV A;  1BI3 A;  5E18 F;  2LDU A;  3ZP5 A;  2DI3 A;  1YYV A;  4KN4 X;  3EYI A;  3DPT A;  3Q5F A;  3BPX A;  5D6E A;  2F5D A;  3TO7 A;  4KIF A;  2VC0 A;  1UFM A;  2VT2 A;  1OMI A;  2X0L A;  4RB0 A;  4KT5 C;  3PFI A;  3Q9V A;  4EM0 B;  3KZY A;  4KN7 X;  4AD9 A;  1W5T A;  3DEU A;  4OU0 A;  2GXG A;  5AIQ A;  2IVM A;  2GXB A;  3SXY A;  4MNU A;  1FYM A;  2R3S A;  3F6V A;  4Q48 A;  3ISP A;  3F8B A;  4EV0 A;  4AIJ A;  3T8T A;  2P8T A;  1GHC A;  3DKW A;  3F8C A;  3NRV A;  1XGO A;  4I7H A;  4AWX B;  4Q4Z F;  4RAY A;  3LFK A;  2EJR A;  3WTY C;  3R61 A;  3JAM K;  2QQB A;  2E7X A;  2HTJ A;  3T0Y A;  2DFI A;  2IW5 A;  2HS5 A;  3IRQ A;  2A3S A;  1BN5 A;  4U0Y A;  2XAQ A;  2GIV A;  3ZN1 A;  2EFQ A;  4LB6 B;  2J5O A;  4BXU A;  1TQP A;  5LGU A;  3RTR A;  3F8M A;  5TJJ A;  3GEZ A;  1PP7 U;  1IXR C;  4HV5 A;  5D8K B;  1HKS A;  1P4A A;  3M7G A;  3ZMU A;  2FNA A;  2HTS A;  3BOQ A;  5FGM A;  4KYW A;  4BHC A;  3HRS A;  3WE3 A;  2LF8 A;  2EWN A;  1RI7 A;  4UHT A;  3CUO A;  3FM3 A;  4EM1 A;  1KYW A;  1XGM A;  2GA1 A;  2QZ8 A;  2ZO4 A;  2EA4 A;  4A2U A;  3VOE A;  1FZP B;  1E2X A;  1QZY A;  2DQL A;  3D0S A;  4LGW A;  1OKR A;  3BPV A;  2FBH A;  2MH2 A;  1C0W A;  3COA C;  1LJ9 A;  5HOO A;  1I5Z A;  1DDN A;  2STW A;  1ZGA A;  3KET A;  1H9G A;  1S7O A;  1GXQ A;  5CVI A;  4GGG A;  3WG9 A;  5HLG A;  1FYL A;  1SD4 A;  5D5V B;  3GW2 A;  4OIP F;  1T6S A;  1U6G A;  1QO0 D;  2PMH A;  5CVV A;  4N9I A;  4RS8 A;  1ZG3 A;  1ZLK A;  4P9F A;  5DYM A;  2NS0 A;  1D3Y A;  5E8I A;  3WTZ A;  2EFN A;  3BJO A;  5EEH A;  4XRF A;  1HW1 A;  1TBX A;  3FM5 A;  4IF4 A;  4U0V A;  2HDC A;  1IN7 A;  4M9S A;  4XLP F;  1IUY A;  2M30 A;  1YW9 A;  1RUO A;  1SFU A;  4HF0 A;  1MGT A;  1SFX A;  4U7D A;  4R8H A;  4RGS A;  3HUG A;  2BV6 A;  1YTY A;  3J80 K;  2UXN A;  2A6H F;  2ZJ2 A;  3ROU A;  4M6Y A;  1FX7 A;  4WK8 F;  4DQ2 A;  1TNT A;  5H6Q A;  1S6L A;  3WTS C;  2ZME B;  4XLN F;  4P55 A;  2EV6 A;  4U88 A;  4WCG A;  3MWM A;  3GO5 A;  4N0B A;  1QPM A;  3K9T A;  4Y17 A;  5CVR A;  1G3T A;  2MD5 A;  1HW5 A;  3SFZ A;  2L4A A;  2KRF A;  1ULY A;  5E1W A;  2DAO A;  4WXD A;  1J5Y A;  2G7U A;  2ELH A;  1KGS A;  2IPQ X;  4XSZ F;  2D1V A;  2FQ3 A;  4IHT A;  5HDN A;  1R00 A;  1MJ9 A;  4OOI A;  4BYY A;  1IN4 A;  4CXF A;  3MZH A;  5A2Q Z;  4RB3 C;  2FOK A;  2UZK A;  1YQA A;  4BHP A;  1TNS A;  5K5R A;  3DP7 A;  2QBY B;  1ZRD A;  2XAH A;  1FSE A;  3D5L A;  4AIH A;  3L9F A;  1UB9 A;  1LDK B;  1LDD A;  1FBQ A;  3TQN A;  4ZYG A;  2NNN A;  4B09 A;  5HLI A;  4O3M A;  3CUQ B;  3FMR A;  2AXL A;  3K2Z A;  1JHH A;  2JTV A;  3KP4 A;  1MKM A;  3DFG A;  1O3S A;  1XGN A;  4A0X A;  5LGN A;  4G9Y A;  1DPU A;  5L3G A;  3F8N A;  2EA2 A;  1ON2 A;  5LBQ A;  1RUN A;  1Z6T A;  2WC2 A;  2DU9 A;  2KIU A;  2DLL A;  3RJP A;  2VE8 A;  3HRT A;  3FX3 A;  1Z9C A;  3I54 A;  3ABU A;  5DDG A;  4P5O A;  3CLO A;  1ZGJ A;  3HSE A;  3O2P E;  1P6R A;  3RIR A;  1T2K A;  4YG2 F;  4OMY A;  2QVO A;  4G94 A;  2H27 A;  3WGH A;  1HKT A;  3EYY A;  4B8X A;  2ESH A;  3T5X A;  1NHA A;  2V1D A;  2W24 A;  3R4K A;  2B0L A;  4R79 A;  2IA2 A;  1W7P A;  2Q2E A;  2Y75 A;  4Y15 A;  1RNL A;  1A04 A;  4BH9 A;  5FB2 A;  4FT8 A;  2M8E A;  1IXS B;  2K7L A;  3F23 A;  1WQ2 A;  1P4X A;  4M72 A;  1H9T A;  1AOY A;  1DPR A;  2V1X A;  1VTN C;  3VB2 A;  1EV7 A;  2P6T A;  1JGS A;  5L3E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...