1WJFA

Solution structure of h12c mutant of the n-terminal zn binding domain of hiv-1 integrase complexed to cadmium, nmr, 40 structures
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
55
structure length
55
Chain Sequence
FLDGIDKAQEECEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 INTEGRASE
publication title Solution structure of the His12 --> Cys mutant of the N-terminal zinc binding domain of HIV-1 integrase complexed to cadmium.
pubmed rcsb
source organism Human immunodeficiency virus 1
molecule tags Zn-binding protein
total genus 13
structure length 55
sequence length 55
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02022 Integrase_Zn Integrase Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1wjfA00
1WJAA 3HPHA 3HPGA 1WJCA 1WJBA 1WJDA 1MW7A 1LFPA 1WJEA 1K6YA 1KONA 1WJFA 4F3QA 3F9KA 1E0EA
chains in the Genus database with same CATH superfamily
1E17A 2DFHA 1EA3A 3JTHA 4MFDA 3HC7A 1EJ9A 2V9PA 5F27A 1XN7A 4ZYDA 1I5ZA 4F52A 1UAAA 2F4MB 4ESFA 3SXYA 4CSWA 3W2WA 2VKDA 1Z3YA 2HOSA 3RKXA 2YU3A 3OMYA 1OPCA 3RKYA 1IF1A 4FX4A 1OFCX 3BP8A 1TNTA 2KQRA 1ZGAA 1UB9A 5D4RA 2DJNA 3MQ0A 4XRMA 4PJNA 1T2KA 3QWLA 4LLLA 2EZLA 1GUUA 3ABUA 2X6OA 4XN3A 5L3CA 4RBOA 4BYYA 1ETYA 5DM6F 2E35A 2V4JC 3MKZA 4HDVA 5KAIC 2XKOA 4R79A 4V2FA 3VYSB 3I3LA 4HV6A 1R00A 4PJ0C 1EH7A 1ZLJA 4HBLA 4M3EA 3V7RA 2MFZA 1FTTA 5DM7F 4N9IA 1O3RA 4YRVA 2HWVA 3LSIA 4HX8A 4DW6A 2HFHA 3ERMA 2W82A 5K1YA 1FIAA 1R5ID 3J7AO 1TT0A 1W7PD 4EJUA 2JVGA 3FM5A 4KDPA 3BR1A 4BU2A 4ZDOA 3Q5FA 1Z0XA 3HRMA 3K4CA 2FX0A 3L9FA 1Z6RA 1T08B 1SMTA 3GFJA 3GUDA 1SFOJ 3IKVA 5BQTA 1CQTA 3QYBA 1BIAA 1XSXA 1VQ8I 2G9WA 3VPRA 4C3JJ 2YR2A 2OCEA 3QOEA 3LL7A 5FJ8J 5D5XB 4HLXA 1RESA 1XTAA 2F4IA 2LSOA 4P5OA 4Y3OA 5F0CA 4C30A 2QBYA 2RKHA 5B1AH 2A69F 5ICCA 1ZQ3P 1PUFA 4LB5A 4J19A 1X3WB 3ZMSA 2E1OA 3MFKA 2M1BA 1PVEA 2XRNA 3GWZA 4IHXA 4KICA 2E36A 3MN2A 4YEJA 2P7CB 1MMGA 3CMMA 1FYLA 5EZHA 4R1HA 1IN7A 1Z05A 2ADUA 4BJTA 2VODA 5TJJA 3HBLA 2BW3B 1OMIA 4KT6A 2HQRA 2H1KA 2KIQA 2KL4A 2XF7A 3F21A 5FD6A 2VOOA 2ZJPF 3AG3H 2W57A 1OR7A 2DMUA 2B0LA 2FOKA 1FWZA 5JVTA 4HAMA 1T33A 2B7EA 3W3CA 3B02A 4U7DA 4E7LA 2MG4A 1HBXG 3E97A 1X3UA 5HS8A 4MEXF 5LEKA 2M34A 1DQUA 2DOAA 4QTRA 2NS7A 1V4RA 2R7XA 1T95A 1YITI 1B8IB 5ED4A 3UR3C 2WAFA 3KP7A 3SEQA 1OCOH 1XDUA 3E6BA 5CVJA 2CQQA 1KU7A 3FXOA 2DJIA 2DYSH 4G8XA 3DEEA 1SAXA 1DU6A 2QLZA 1FNNA 2ZKZA 4HX4A 3E7LA 1YW8A 1A6QA 5BPDA 3BQZA 3DKWA 4BDYA 3CP8A 1DUXC 3CO6C 3C1DA 3WTVC 4MTEA 1B4AA 4IJAA 5CYVA 2R7WA 3CCEI 2LBFA 2AXTC 3V7CA 2M9HA 4CCKA 4XKVA 3WTUC 5JLXA 3CD6I 1WFXA 1S72I 1NK3P 3PSIA 3CUOA 1XGSA 1Y39A 4V2GA 4F3QA 4FTHA 4UB6C 5AIQA 5D5UB 1K83J 1XX5A 3BTLA 5ICGA 1YOVB 1IDZA 2O5RA 3ZOBA 5ILSA 1V3FA 1G4DA 4OIRF 1B9NA 2QF7A 3WU0A 4HDUA 5B3SH 5BS6A 2LG4A 2MW8A 2LYCA 4CYCA 5EEGA 1RUOA 1KA8A 1YX5A 5L3EA 1QHHD 2MH2A 3G3ZA 3GZ5A 2VBWA 4FHTA 3FHZA 1R4NB 3X2QH 4BY1J 1XGMA 3LSMA 3H0GJ 1SVMA 3D5SC 3PUBA 1NG6A 3DCFA 5GTIC 1JT0A 1CF7A 1S5LC 2J5OA 3GLLA 1Z1DA 2Z33A 2BGCA 1FYMA 5DCMB 4Q5SF 2DOFA 2ZXWH 3AL0C 1DPRA 3P7NA 5J1UA 1MJAA 1YIOA 1I3QJ 1VQ4I 1ZH5A 2ELHA 1IRZA 3QYEA 5DUKA 4E7HA 2IW5A 2PBIA 3U2RA 1FYKA 1X1PA 2A05A 2RC4A 3GO5A 1YI2I 4PGGA 5FRNA 1IDYA 3QRFF 1W5CC 2VKHA 2FA5A 2WB1A 2GXAA 2JPBA 2LK2A 2R5YB 2K02A 4BQNA 1J59A 2PMUA 4PUSA 3KYLA 4E7SA 4NBQA 4I02A 3RI4A 4L9JA 4IQJA 2DQRA 3SZPA 1VQ5I 1YW7A 3F8CA 1W5TA 2FU4A 2ISYA 3DU5A 3M8EA 5IOYA 4KFCA 5HODA 2YSRA 2M0MA 2IA0A 2UWMA 3KEYA 3VOEA 3K2AA 4AVZA 2V9KA 5H2FC 3M1CA 2ZXIA 2JRMA 1NTCA 4MNUA 3FMQA 1X3ZB 3I5UA 4BUPA 2CRGA 2MGQA 3HOYJ 3ZMDA 1FPQA 1F43A 2FMLA 3WTYC 4PJJA 2W4SA 2VJ5A 3TGNA 1W7PB 1NG7A 2ZJRF 2L4MA 5DTDA 3J7YJ 4V19K 2DT7B 1XGNA 2P0WA 3FK6A 1G3TA 4PSXA 1G6NA 4IRGA 2W24A 3N97A 2HOTA 4GO1A 2ECBA 5IP6A 3C2HA 3O6BB 4EEFG 5DV5A 2DLLA 4A3IJ 3M7GA 3IP4B 2X4HA 3OL4A 2XGCA 4DNCA 2XSDC 4IHVA 1X1CA 4ZJZA 1WJAA 2ZSHB 3FXJA 3H5RA 3F8FA 4JX4A 3FF5A 4N4NB 2TDXA 1R49A 4HQMA 3OYDA 2ZMEB 1U9NA 1QPMA 2KP6A 3H5NA 3Q9SA 3JAMK 2DPDA 4FQGA 3PO3J 4XLFA 1LVAA 3CZ6A 3KX2A 1ON2A 2HYJA 3F72A 1VQMI 1MBHA 2NVXJ 3TEDA 1PDNC 2FBHA 4CICA 3ZP5A 2JRTA 2VASA 1USSA 3CQZJ 1BJZA 3GVAA 2IT0A 4B44A 3BT9A 2GOMA 1DDNA 4IHTA 3CCSI 4EVIA 3P9KA 1SFXA 2EWNA 3OR1C 3TBIA 1HSJA 4YFXF 4UY8I 1YW9A 1ACIA 1RNLA 5CLSA 2VC0A 3A01A 1QO0D 1YTYA 3V7SA 2E1MB 4UV8A 3EUHA 2BY3A 1MDMB 5KNLA 3GXOA 3GLXA 2AHQA 3M9AA 4AVPA 1WHUA 2XAHA 3KCCA 3CJTB 4AYBA 4UVAA 1OCTC 1QRYA 3LAJA 3HUGA 4UVCA 4XL9A 2JWTA 5K5OA 2D1VA 4Z6YA 3CLOA 2JN6A 3HXLA 2K9LA 2PX9A 2BY1A 4Q4ZF 3K4MA 1XMKA 1SMYF 3K70D 2I10A 1K7AA 3PSFA 2L7ZA 3FHNA 1LE8B 2BV6A 1OKRA 2L5QA 4FCYA 2K9SA 2QVOA 5AIPA 4A0XA 3BR0A 4OIPF 3HG9A 2VB6A 3LNQA 1W36C 1BI3A 3PNTA 4ZYHA 1DP7P 1OCRH 3CJRB 2IS4A 2NVTJ 1S7OA 3CCYA 1N77A 3AG2H 3BZ6A 1WVRA 2DA5A 3LA2A 1A04A 2P5LC 3ZPLA 3VDXA 1B9MA 2RDPA 1FBQA 2AQFA 5LHHA 5IYDJ 5J6XA 2XF5A 3MKLA 2IA2A 5D8KB 1EH8A 5FO5A 1S7AA 5LHIA 3S93A 4M72A 1P92A 5J8CA 1IG7A 2PEXA 4XKCA 1N25A 2F4OB 2R7FA 3O3KA 1R4MB 3ECHA 3AG1H 3TP0A 4P9FA 2VKVA 3TW6A 5K5QA 4BGDA 4JK1X 3FXMA 1WPKA 1WJ5A 1A36A 4A3LJ 3S3MA 4XKWA 3RZOJ 1TW3A 2NS0A 2NOJB 5EGOA 2PG4A 2DBBA 4B3AA 1O3TA 3D1NI 3CTAA 4E7ZA 2WC2A 3I59A 1XSDA 3H3ZA 3WODF 3LSKA 1F1ZA 2DMTA 3FISA 2LREA 2EZHA 1BW6A 3HRSA 2OPTA 1O7LA 4IOAF 1ZELA 4CCMA 4R8HA 3RJPA 4CH7A 1XB4A 2L9VA 1Y1WJ 2YPRA 3K0LA 2VE8A 4Y52J 3TQNA 1TBXA 3S14J 1BBYA 5EG0B 5K7ZA 1UZCA 3MD2A 4RLFA 4PGHA 5E3LA 1ZGWA 4LG3A 3MMYB 4DBQA 2GIVA 3NEUA 4MGRA 4ETSA 2LD5A 1X1AA 2R92J 4YFKF 5JFRA 2A5YB 3IUOA 2I5UA 3ABKH 3EUHC 4DBRA 2R7VA 3DPLC 2IGKA 1D8JA 2LRDA 1S7EA 3BR2A 2XPUA 4LG0B 2VC1A 3CMEI 2R7QA 2Q1ZB 1IJWC 4JBAA 3AG4H 3JRGA 3IHUA 3L1PA 1AOYA 2JSCA 3ZQ7A 5JHFA 1ETQA 5ILUA 1LEBA 3BJOA 4BHCA 1JKRC 3F8NA 4ABZA 1YRNA 2A6TA 4RB1A 1O3SA 3GTMJ 3JRFA 3OYHA 5E79C 2ZJQF 2Q2EB 2CFXA 3HYIA 2CV0A 2ELKA 1TQMA 1SFEA 4L5JA 1E2XA 3GW2A 5F1JA 3IH2A 1P2FA 1R1VA 1R1TA 2EV0A 1FTZA 2LTPA 4RAFA 1IXCA 1ETXA 2RQQA 5H20A 3CCLI 3TO6A 2JT1A 3CLQA 2L02A 4UHTA 1YE9A 4LGWA 1ZGJA 5JI6A 1DP3A 4RAGA 1D1AA 2A68F 5FROA 4MEYF 3GTQJ 2FNPA 2WTEA 5J47A 4MQ9F 2M4GA 1DGRM 3HTUA 4QWQA 1ORKA 3CDLA 1YJWI 1EV7A 3KP4A 4A69C 4I99C 4ZC3A 2ZNYA 4AIDA 4OIQF 2RN7A 5DEQA 3MKYB 4A3FJ 4EV0A 1FMVA 3TP3A 2HYGD 4UXNA 4N4OB 1O3QA 2M45A 3M4OJ 4XK4A 2LVSA 4KIBA 3IAS2 1ZYRF 4IL6C 5H6RA 4BQOA 1KQ0A 1R1UA 2PJRB 3GTGJ 5IY5H 1IW7F 1Y56A 3ABMH 2R5ZA 1OJLA 1FC3A 3ABTA 1R36A 1MNEA 2MBFA 5HLHA 2MYSA 2ZMEC 3I9V2 2K3FA 2Z99A 4LK0F 2ME0A 4RB3C 5LRRA 1QZZA 3A0HC 2BHZA 4GYIA 4IF4A 5EEHA 4OMZA 1ZLKA 1H9GA 1D3YA 3F3XA 1VQPI 4NQWA 1S8NA 1J09A 2BE5F 2HPMA 1IXSB 3MAJA 4DQ2A 2DXIA 1U9OA 3P5JA 3NWTA 5FLVA 1Z7LA 5E3OA 4GXOA 2PQ8A 1K78B 3F22A 5FLMJ 1C0WA 4M3FA 3KYDB 1R23A 1T56A 3K69A 1IN4A 1WJBA 2LF7A 1QHGA 1QNTA 2WB1N 5M3FJ 2Z9OA 1J9IA 3DPTA 2E1MC 5E17F 3M1EA 2EB7A 2XB5A 4CO8A 3HOUJ 3JRCA 5J4VA 4BNCA 3HRTA 4S05A 3FBNB 5IP9J 3F6OA 1XS9A 4UUSA 1MMDA 4IPAA 3S2DJ 3J7ZI 3LSJA 2XDVA 1P9QC 4BDZA 4XQFA 2D1HA 2XRLA 3V8LA 4L0YB 2X1DA 2K9MA 4CCNA 1IN6A 2CQXA 2OV7A 5FKMA 2UXNA 3JRHA 5D6EA 4EJTA 1OISA 3KPHA 4LIUA 1Z21A 2XGEA 5LBQA 4ON0A 1R58A 4TV7A 3ZQQA 3D0SA 1YYVA 2DN0A 1ITYA 3HRUA 2ZFWA 5DCFA 4HOBA 3WTSC 4RM3A 2C6YA 1P4WA 1A6IA 4UV9A 3C2GA 3WG7H 2EH3A 2CSOA 2PMZA 5C4JJ 4BE2A 2R7DA 1ZR4A 3CF5F 1EF4A 3OS2A 1HQCA 4EQQA 3QPLA 2ESNA 1BM9A 1QA6A 2AS5F 4A3EJ 3A2KA 1GV5A 4KITB 1MBKA 1JUPA 4DJAA 2CUEA 3K6GA 3WGGA 5EDNA 1VQ6I 2KISA 1TC3C 4UNOA 2KIMA 3OOPA 2O3FA 3RCOA 4B3XA 2EIMH 3DPUA 3RIRA 4XOTA 1KGSA 4M9ZA 4PK4A 1U3EM 2IVMA 2QCOA 2R7ZJ 2K40A 3BR3A 4XLPF 5HOOA 1B72B 4D9JA 2CV1A 1ON1A 4IHYA 3LQRA 2AO9A 1D1CA 4FE4A 4A3BJ 4IKFA 2EQRA 4KISA 3SFZA 1MBFA 4BL0B 2F48A 3OYIA 2YU9J 3OL3A 4ANJA 4G9YA 2COBA 2L7KA 5FKLA 2DO7A 2IAIA 1YFHA 2WWYA 3PO2J 4ESBA 3IAM2 3ZN1A 4ENJA 2Q0OA 1JUSA 2X85A 5HVQC 1FIPA 1QVUA 4NC7A 4AYBN 3ZN0A 4GGGA 4LD5A 1P6RA 5ICEA 1RUNA 2ZBKA 2W84A 3BROA 3IH4A 2ZXJA 4CCJA 4BS9A 1J5YA 4BXXJ 4EM0B 3FX3A 1JJ6C 4BXFA 1I39A 2KRFA 4RAZA 1JKOC 4I76A 1MH4A 1FSEA 2WA0A 4II2A 2P81A 1OCZH 3KZIC 1OLTA 3VYUB 2H8RA 1IAWA 2DPUA 3PNYA 2V6EA 1LFUP 2HNHA 1JGSA 3EUKL 2FBKA 2WV0A 2F5FA 3ZGKA 2V1NA 1IUYA 1STZA 1KU2A 2JUGA 4U88A 1B59A 2H1LA 3HGGA 1IGNA 3LA3A 2RREA 2DA6A 4ZYGA 1ETOA 2CMPA 5LEJA 1HKSA 2H6BA 2LR8A 3OY9A 4G6DA 2FOWA 5KAFC 2V1XA 3EYIA 2DA2A 3EQLF 2NNYA 1TLHB 3ML6A 1BI0A 4ZDPA 3BG5A 2EILH 2GXGA 1H88C 1FJLA 1YG2A 2MSYA 3CCJI 3OYJA 2M5WA 1ZR2A 2R7RA 1MGTA 2NOGA 2E1CA 1ETKA 3FIWA 2XB0X 2F2EA 3K4JA 1K4SA 3WTXC 3JRDA 2NVQJ 3DBLB 2VIXA 1R9TJ 4FISA 2M8GX 5E1ZB 4HQEA 2H27A 1WZ2A 5E20A 4E6KG 1D0ZA 3HZJA 5GTHC 3MZHA 2D45A 4A3MJ 5FKNA 2IEKA 4IQ4A 4XORA 4HLYA 1QPIA 4PFPA 4AU7A 2BXZA 2JVHA 3GYHX 4O6JA 1TT5B 3H1CA 4U87A 2W00A 5BNGA 4NHJA 2KZGA 3F6VA 3RQ4A 2IJLA 2DMPA 1UHMA 2VBYA 3LMMA 3O2PE 5CQGA 3V4GA 2KIUA 5C44J 2FF4A 2V6CA 3A1YA 2XC7A 4YIFA 3RYRA 2HVSA 3U21A 2QKMB 3JSOA 2HOAA 2GLOA 1GXPA 3GFLA 2MLGA 3C7JA 3WHBA 3FMSA 4ZYAA 1X4OA 3R4KA 1G3WA 1TP4A 2RGVA 3BG7A 3FK7A 3VB2A 2MLKA 3K70C 1LB2A 2E1NA 3CCVI 3VEPA 3G4SI 2DA7A 2WADA 3GTKJ 2YUSA 1WJFA 3UNGC 1F9NA 3GTJJ 3DKXA 2OZUA 1Z3XA 3CUQB 5HNFA 2XSJC 4PZJA 5L3BA 2RVCA 2KRHA 1V5FA 2NVYJ 2NAZA 4BEHB 1MD0A 1ZRDA 2YS9A 3H35A 2DQLA 3D5LA 3GTPJ 1WRJA 2EJRA 3OIOA 5FLXK 1D5VA 3FMRA 3L2VA 2V79A 3F0CA 2JUCA 3RYPA 1WH7A 3LSRA 2QUFA 3KP5A 5GPAA 4WK8F 1TL8A 2QQ9A 5DD4A 1EKEA 5DUIA 3L7WA 3HEFA 3JW4A 2R4GA 5LGNA 3LFUA 2KRCA 3W6VA 1ZTRA 2VQLA 4HYEA 4FETA 3E0JB 4XRSG 2CQKA 1MNMC 4W97A 2KJBA 2EZKA 3R6SA 4D1QA 1FY7A 1Z67A 1O4XA 1MNDA 3ZMUA 2IS6A 2BW3A 1LUJB 3ISPA 4HSRA 2EV5A 4M9XA 5E1XA 3GFMA 4YELA 3BCAA 4A0YA 5HDNA 1F4KA 1VNDA 3H36A 2EA2A 4HNVA 5LFAA 3L09A 2VUMJ 3ULQB 2CH0A 1V54H 2CJJA 3KEOA 3OYCA 2Z3YA 2HXOA 1FMWA 4MLOA 4X1EA 4JQFA 1YLFA 1QZYA 1BOAA 2CUJA 3B6AA 3RPUA 4A0ZA 1B8IA 3GTOJ 4RM2A 3T8TA 1U5TB 2A07F 3GEZA 1SFUA 4M6XA 4D7NA 2FD5A 2P7VB 3QODA 2Y31A 2KLOA 3HDDA 4ZZLA 1WKMA 1JHFA 1YQAA 1KU3A 3F8BA 5J1RA 2MABA 2XF6A 5B5EC 4AWXB 3JTGA 5K7HA 4EM2A 4X0GA 4BBRJ 3ZMTA 1BW5A 4CGZA 4XLNF 3BLYA 5IOZA 2ELJA 3K4BA 2JZYA 2YX4A 3H92A 3HPHA 2O8KA 4AM3A 3ZQCA 3WTTC 4KN7X 1P4XA 1X2MA 3AFHA 2VQHA 1UFMA 4OAYA 4XN0A 1D8KA 1ZG5A 3MEXA 2VL8A 4XNFA 1FX7A 4P55A 1LDJA 1PUEE 2CUZA 2XUBA 3JSPA 4NNJA 3CMYA 2MH9A 4M73A 1QQIA 3SDBA 2QSGX 4UUVA 1ZG3A 1TWCJ 3DBHB 2AXLA 1FOKA 3IKTA 2B9SA 1UG0A 2COMA 3OSGA 3SZTA 1JI8A 2R7OA 4B43A 2LC2A 2DDAA 3QU6A 2PMZN 3S2WA 2HVRA 3CF2A 2IGNA 2XPVA 3SQNA 2FNAA 4A3DJ 4IRHA 5HLIA 5HNHA 3HSRA 1POGA 4OU0A 3ZMVA 5LLQA 1FZPB 5HS9A 2E5NA 3FKJA 3CC4I 1VFCA 2KHMA 5DCMA 4U7BA 4I0AA 4B09A 1R6RA 2K7LA 1K4TA 3H3VK 3U1KA 2JA6J 1R5HA 2F5VA 1HDPA 2OJED 2Y48A 3LA7A 2ZSIB 3HJEA 2OUMA 4IHWA 1KZHA 3F23A 2PLYA 3QAHA 3AKZA 4PJMA 5IPAA 1RPWA 2F5EA 4E7JA 2VKEA 3VWBA 3EPZA 1S3JA 2NVUB 5FLXZ 1WGXA 2QQAA 1OQYA 1HF0A 4DZPA 1VQNI 4A5MA 2R5YA 1GT0C 3BPXA 4HX7A 3U1DA 2VLAA 4GYGA 4UUTA 2DODA 5J8FA 3S1RJ 2CYYA 3PM1A 4BQAA 3PJRA 2L9SA 1PP7U 2XIGA 1LDDA 2F5CA 1L0OC 1EH6A 1XDSA 2ID6A 2ZFUA 3OYNA 3S3OA 2E71A 3LSHA 2NXNB 3I54A 4RS8A 1AKHB 4C2TA 2BEOA 2CU7A 1XCBA 9ANTA 4I0BA 5KK1A 1OCPA 2DI3A 3WE2A 4RGUA 3WHCA 1YJNI 1MJBA 4M6YA 2QENA 5JLWA 2JJ7A 1I27A 4EMSA 1BA5A 3BG6A 3S17J 4FT8A 3QP6A 4HW0A 2DYRH 1TWGJ 2QKLB 1W7PA 4EGZA 3A03A 5B1BH 2BYVE 3JR9A 4RGSA 2E34A 2VQGA 1Z6TA 3ASNH 5CVRA 3IRQA 1AU7A 4QLCU 1GV2A 3H3UA 3ESWB 1KQ9A 2L54A 4G7OF 1TNSA 1QGPA 4D0PA 5JR3A 1BR4A 4XLHA 1WH5A 1XD7A 2LLKA 2XAFA 1X1BA 2TRTA 1XG1A 3DTEA 3K1MA 1PP8F 1BL0A 4C2MJ 2ECCA 3N05A 4BJ5C 4BH9A 1LNWA 3CUQC 4XIDA 4NUBA 3V8KA 4AD9A 1HSTA 2ZMEA 1LJ9A 1YJ9I 2OF7A 2Z1DA 2LKPA 3KYCB 4Y15A 3OSFA 4IHSA 2EPFA 1UG2A 5FD5A 2Y75A 1P4AA 2RNJA 4BE1A 2A61A 1UMQA 3T8RA 4CDGA 1KU9A 3BG9A 3I64A 4QSHA 2L4AA 2M2EA 1X1DA 2DT5A 3TKYA 4JP0A 4YFNF 1H0MA 2XROA 4KA4A 1Q1VA 1E3HA 2EFOA 1UCRA 3R0JA 5F0FA 1QVTA 2VBZA 2WAEA 3KLNA 1HW2A 1IN8A 1J2XA 2V1DA 3G1LA 2E2IJ 2V9VA 1U8BA 3JCUC 3QOPA 5L3DA 3CO7C 2QYOA 3K1NA 3E5QA 5IYCJ 2DFFA 1VTNC 3ZR8X 3K1PA 2ZC2A 3BQYA 5FRMA 3MCZA 1LDKB 1MDMA 4YIIA 2JSPA 3BDDA 4LOCA 3HOZJ 3JAMZ 5E18F 4WXHA 4P9UA 3IRRA 5EF6A 1RKTA 1RRJA 3I56I 2FUG2 4CCLA 1ZKGA 4OMYA 3HB9A 1YO5C 1T8IA 3G71I 3NWSA 2LDUA 4AIKA 1DU0A 4HRIA 2HZDA 3E5UA 1LE8A 4DGWB 5CVVA 4A3CJ 5GPCA 2NS8A 2PJPA 4BBSJ 5KHDA 1E3PA 2FSWA 4EJOA 1U5TC 2Y0MA 3ONQA 1P7IA 2HXIA 2LF8A 1ZRFA 1ZN2A 3GCMA 4BHBA 2FXAA 1JTYA 1T0FC 3KZZA 1ODDA 3H0DA 3IWFA 2L01A 1UELB 3FDYA 1IV6A 1BIBA 3RTRA 4N0BA 3KETA 1HC8A 3TL4X 4HNUA 4WXDA 4X6AJ 4RB2C 2P4WA 4A93J 2KDOA 2IS1A 2QEXI 3N4MA 2X9DA 2GIZA 4FX0A 4BXUA 4C3IJ 1HKQA 2EFNA 2KMUA 1L3LA 4IEJA 1APLC 2CFOA 1ZK8A 3K2ZA 3GZNB 1G2HA 2GBYA 5F1RA 3TO7A 1TQPA 3ASOH 3VYTB 5D5VB 1TWAJ 4XRSA 2UXXA 3DF8A 3ERED 4KNYA 2K5CA 3BZKA 2IGOA 4ZH4F 3E6DA 3W2AA 3A4CA 3BG3A 2EFWA 2E19A 3BJAA 3S16J 1PJRA 3H9JA 4ZTFA 3G2BA 4GRIA 3AAFA 4M3GA 2HU9A 2X1CA 1RETA 5ILVA 1VQ7I 4XLCA 3OV8A 1JHHA 2E7XA 1DGWY 3L00A 4N9HA 3WGHA 5EG0A 2NRAC 1BN5A 4CZCA 5GP9A 4WF2A 1LEAA 4XICA 2O0YA 1IXRC 5J40A 1TQIA 5ERIA 1LQ1A 1S6LA 2ETHA 4LK1F 1D0XA 5LD2C 2DT6A 3C3WA 3TO9A 4OOIA 3M8FA 4JX6A 4LG0A 4PDKA 4UB8C 4M3BA 3E3VA 3S1MJ 5BOXA 2EIJH 4S0HB 5GAEJ 2VN2A 1ETWA 2L7FP 3Q0UA 2DA3A 1MBEA 2E60A 4RB0A 2HTSA 1TW2A 3PIOF 4GFBA 3K7AJ 4D5CA 2DFIA 3IV5A 1R7JA 3ELKA 3LFKA 4LLGF 1V5GA 2Q2EA 1S9HA 2H6CA 2HTJA 2QGUA 3BZCA 2X6XA 3G73A 2Y0SN 3SZGA 3OS1A 3G1OA 1KYWA 5L3GA 3NARA 1WI3A 1HDDC 3WU2C 3KP3A 4Y7NJ 2HZTA 1VZ0A 1HW5A 2ZCWA 1WQ2A 1SFKA 2NNNA 4NC8A 1MBJA 2O03A 3WTZA 2HPIA 1BI2A 6PAXA 4BY7J 2JTVA 1Z7UA 4MQVA 2E2HJ 3PFYA 1LFBA 2HDWA 3ZRGA 3C18A 3ZMZA 1E3OC 3J7AY 4E7KA 3CJNA 2WAQA 1JE8A 2DTRA 5FKKA 1VI0A 2CV2A 4J00A 4G7ZF 5L3FA 4Y33A 3HOVJ 4Q47A 5F0HA 2VI6A 2QA4I 1FP1D 4KJZA 2PJRA 2QBYB 2M87A 1U78A 1MSEC 2STTA 2XVCA 4IX7A 1YX3A 2K4JA 4G12A 1PUFB 1CGPA 3HTSB 3Q3SA 1GXQA 1U2WA 2UV1A 2KJCA 4AC0A 3OYKA 4DYCA 2JPCA 3BWGA 3S15J 1Q1HA 3OOUA 2JA7J 4UVBA 3FXUA 3LOCA 3DV8A 1M1EB 2G0EA 4ITVA 4I01A 1OYWA 3CDHA 4RMNA 3L2RA 4AUXA 1N78A 1HA8A 3HOSA 2X48A 3ABLH 1A5JA 1DPUA 5KCMA 4B4CA 3PIPF 1P7JA 2W25A 1K78A 1XSVA 3REOA 1SVLA 5LGUA 1B1BA 3HKZA 2H94A 2L7MP 3M07A 2XV4S 5CJ9A 3O8HA 3CDIA 3I55I 4F93B 3CCRI 4IXAA 2OZ6A 4WXCA 2WBMA 3TOAA 3KZYA 1FOWA 2DU9A 4BJ6C 4BHPA 2CW7A 2LH9A 3M3YJ 2A5WA 5E3MA 4CZZA 3WGIA 3OYFA 3S3NA 1I50J 1N75A 1FLIA 3P9IA 1V5EA 2MC3A 1H89C 2DMNA 3LWFA 1X58A 2PN6A 2LY2A 3G6EI 1SANA 2E7WA 3CESA 3VSLA 2FQ4A 1A31A 1G59A 4L0ZB 1JJ8C 1XMXA 5FFXA 1BR1A 1BJAA 2KZVA 3JRBA 2OAZA 3BJ6A 1GHCA 1QZEA 4M6VA 5EZGA 4AIHA 3CMAI 3KIOA 2FRHA 3WTWC 1MH3A 2QWWA 2OD5A 3FXRA 2LBFB 3OYLA 2RAEA 2QZ8A 5IT3A 1OYYA 3HHHA 1RI7A 4EGYA 5BMZA 1K61A 2VPLA 2IS2A 3I71A 5M3MJ 2BXYA 1FOYA 5M5XJ 2B63J 2XAJA 4ZDLA 3PL8A 1SD6A 3U9GA 3J80K 5TRDA 3GMEA 2LKXA 1Z91A 1Y8QB 3CJQB 2DAOA 3OIQA 4MIMA 3WG9A 3QYFA 2QSHX 1R5GA 2ISZA 2R7SA 4LMYA 1XCVA 2XGDA 4CYCB 1T39A 2GOXB 1WJEA 2R3SA 3DP7A 3BTJA 2STWA 4F91B 2CUFA 1HLVA 4PSWA 2L3DA 4G6TB 4DYQA 2VJJA 1UHSA 2Y9YA 3E6MA 1B72A 1XMAA 1JTXA 1TZLA 2KPMA 4JX5A 1MJ9A 1I1SA 3QPSA 1X2NA 3A02A 4XBFA 4A6EA 1CF7B 5GAHJ 2K9QA 3LSPA 3COAC 1W4MA 2P5KA 5DDGA 5DS9A 2PFBA 4O3MA 1G3SA 1RIOH 2K3PA 5EEAA 1KQ8A 1U6GA 2EFPA 2DA4A 4RAYA 4A6DA 5J4YA 4GDFA 2LY1A 3OYGA 2IBDA 1HKTA 5K5RA 1BI1A 3KP6A 3W6KB 3GFIA 2IPQX 4ESJA 2LFBA 4RGRA 2DK8A 3NAUA 3LAPA 3HSFA 2GQQA 4A3GJ 1R22A 2VONA 2OTJI 3R0AA 1UJ8A 2M30A 1Y6IA 5HLGA 1MKMA 4BKXA 1GVDA 4ENKA 2O6GE 5E3NA 2XAGA 2FE3A 3VYRB 3IL2A 2HDCA 2FJ1A 5GADJ 3OIPA 3PNVA 4F92B 2K27A 2DOEA 1H8AC 2I8DA 1JGGA 1JKPC 4KMUX 3RKWA 3HPGA 4Y4RA 5IYBJ 3L2QA 2VOPA 2L9NA 2W85A 5K7FA 4F55A 2HI3A 1YS7A 2EIKH 2HKXA 4RDUA 1FEXA 3ZQGA 4M9SA 2WY8Q 4XOPA 1WI9A 1W0UA 4XMYA 1BC8C 1IV8A 2FBIA 4XR6A 3HHGA 3J81K 3HOWJ 2EA4A 2JA5J 4A3KJ 3CCUI 3ZQIA 3CP2A 2OBPA 3LSTA 5IP7J 2BBYA 3SEZA 5KVRA 2VXZA 4OWRB 4QPOA 4YG2F 3WE3A 1F5TA 2ZJ2A 5CVUA 3SJMA 2BHYA 2CWEA 4FE7A 3MVPA 1MMNA 1XGOA 1G3YA 3S2HJ 4U0WA 1Y0UA 2P8TA 4LIVA 2N8GA 3K4NA 4L9TA 2F5DA 2BOLA 2RV8A 1B6AA 4IVNA 5FGMA 2X0LA 4D7MA 2RQPA 3M8JA 5JHUA 2VT3A 2VT2A 1SAUA 5JVGF 2UUZA 4KT5C 4RA2A 2Z16A 4B47A 4L5EA 1Z9CA 1S29A 5J1YA 4II3A 1YHQI 4LITA 5E1WA 1KONA 3H5AA 5F08A 2CGPA 2RNGA 3PQKA 2Y30A 3A01B 1J0RA 5IT9K 3J80Z 3L2WA 2OA4A 3IWZA 2ACJA 2XASA 2M4KA 3ZQFA 3OYMA 2XKPA 1Y0NA 2WY7Q 4A2UA 3GX4X 2E5ZA 4WWCA 4HF1A 3Q0WA 4KN4X 5TISC 1D5YA 4EJVA 2XGXA 3DQVC 2O8XA 2EK5A 4HA8A 3HUGB 3QQAA 4B8XA 1OR7C 1Y1VJ 2OC6A 2ME6A 1Z77A 5GAGJ 2Y0SA 2A3SA 2V7FA 3FXQA 1AHDP 1H9TA 2D2WA 1F36A 5HDGA 2ID3A 2LKSA 3S32A 3JREA 3BOQA 3DTIA 2DA1A 5LGTA 3S1NJ 3QPHA 1IRFA 4FASD 4H0EA 4HSTA 4OAZA 3TMOA 4CXFA 4BQQA 1T98A 2BY2A 3R60A 2K85A 3KE2A 5A2QK 4CCOA 1IZ1A 3I58A 3CUQA 3RKQA 2CW0F 3GF2A 1VQLI 4D5FA 3FBIB 5EJCA 1O57A 1TTYA 4BEHA 2YX7A 1J7KA 5CVIA 4EJWA 3K10A 2R7TA 3ZCOA 3GBGA 2GZWA 3V8JA 2IA1A 1WCMJ 4KIGA 5F64A 2A6HF 2V1UA 2AQEA 3JRAA 2VE9A 3DLLF 4ASNA 2H09A 3JRIA 3VSKA 3L2CA 3BR5A 3ZQLA 2P5VA 2HDDA 5EYRA 2BZTA 3S1QJ 2PI0A 2WAQN 1ZAOA 3MKWB 3OR2C 2HQ5A 3DTKA 3DXJF 4ENNA 3HIFA 4KIFA 2O9LA 4BACA 5EGOB 1ETVA 1FP2A 5M5WJ 2OU2A 3RPQA 1NHAA 3BPVA 4ZZDA 2EBIA 2ESHA 3KFWX 3I59B 2P6TA 3BY6A 3GZ6A 3DEWA 5TGTA 2VJIA 2FMYA 2HQAA 3PFIA 3QU3A 1K79A 1MSFC 4BE0A 4RLQA 2DMQA 1LFPA 1GVJA 3ECOA 4YIRX 1REPC 5LRSA 3RZDJ 1FT9A 1I6HJ 1SD5A 3QPTA 4QPQA 4C2UA 3J81Z 1HW1A 2IXSA 4EM1A 2GXBA 2IRFG 4Z2YA 1OYIA 1O7FA 2Y2ZA 3DWLE 4HZFA 4LFUA 3GTLJ 4M71A 1ERDA 2DW4A 4G7HF 2HYFA 2VJ4A 4O5VA 3FXLA 3CCQI 4P1WA 3EDPA 4U0VA 1U8RA 1ZARA 2CG4A 1WSUA 2DK5A 4HNTA 4XLEA 3V42A 2JQ7A 4IZZA 1VQKI 1QU3A 4OINF 3HKZN 3SYTA 2L9RA 2Y69H 3E5XA 3H9GA 2X51A 3BTCA 1U5TA 4L9VA 5F6FA 5H6QA 3BC8A 4NB5A 4P96A 3DLAA 4ZTJA 2LNBA 1T0FA 3MZ8A 1T38A 4LLNA 4IOCF 3C2BA 4IO9F 1R71A 1TWFJ 1RC9A 3DEUA 4KUMA 2BVLA 2FEZA 4DIQA 1YRNB 2M3AA 4B48A 1NH3A 1SEUA 3PUFA 1LPQA 3OS0A 2JA8J 2W48A 5IT9Z 2Z2SB 1SVOA 4XSXF 5C3EJ 2LY9A 1YS6A 5LHGA 2G7HA 3T0YA 1LKXA 1Y8RB 3HSEA 2R0QC 1JKQC 2K9NA 1HOMA 3DBRB 2HVQA 3I53A 4M3DA 5HS7A 2L0KA 4I6ZA 1W0TA 1ENHA 2MD5A 2PMHA 4MFEA 4Q48A 1LVKA 4ZYEA 2KFDA 4MO7A 1WJDA 1FBSA 1JUMA 2E2JJ 2BY0A 1K6OA 2GA1A 2CO5A 1TWHJ 2DCEA 2HS5A 1WJCA 3BTIA 1SD7A 4A12A 2J5PA 4CHUA 4C9YA 3ROUA 1D1BA 1HXDA 1ONVA 4MTDA 3SFIA 3W2VA 1D0YA 3MWMA 3O8GA 3T1BA 4KYWA 3EYYA 2FQ3A 4CUGA 2M7AA 1MZBA 1UHWA 3DKYA 1ZG1A 4HEA2 1T6SA 4AIJA 1MMSA 4NC6A 1XPXA 1MBGA 4L5IA 4E4HA 5A2QZ 3HL2A 2R5ZB 3FZVA 5M5YJ 3TOBA 4U0YA 3K9TA 3E6CC 5BPIA 1G8XA 1RR8C 2DFEA 1FBUA 1JXSA 1IO2A 2M0CA 1SC7A 2H8WA 3CC2I 4NQWB 4L9NA 1MIJA 1RR7A 2MC4A 5CKTA 4S04A 4Y13A 2ZNZA 3FM3A 3SHFA 2XAUA 3CCMI 5FFZA 4DZJA 2CW8A 3RDIA 2GM4A 4C3HJ 2M8EA 4XKBA 2M7BA 1IRXA 3DU6A 4ENMA 1AKHA 2NYXA 2VBXA 1J75A 1ZHFA 3B73A 2ZXHA 3NQOA 2OTLI 1VQOI 4E7IA 1BC7C 2Y9ZA 2DDBA 2VQCA 4CYDA 4L18B 2GA2A 4UUSB 4JOMA 1FOXA 2XAQA 4PFOA 1WWXA 2IP2A 2JA2A 5F04A 2LMDA 2VXDA 3HGYA 4MHGA 4A5NA 2JMWA 2JK3A 4HG2A 1GLNA 1IN5A 2W1OA 2K86A 2HOEA 5CQEA 1I1GA 1AA7A 1AWCA 2GAUA 3TDZC 3I4MJ 2R93J 5J3LA 3KLOA 2EV6A 2LOOA 3A0BC 3LSGA 3RSNA 3CC7I 4M74A 1MMAA 1MW7A 5HLTA 3ZXSA 2HKOA 3W6JB 1X19A 3LQQA 2Z5UA 2KT0A 1RZ4A 2IGMA 2L2OA 3G1MA 4PCQA 4E70A 1OCCH 1SD4A 2UZKA 1I6XA 3DFGA 3EUAA 3HOXJ 3NRVA 3ZQHA 2KIFA 1PYVA 3D5RC 4HF2A 4HF0A 1ZREA 4XLAA 3FKIJ 1U0JA 3FXKA 2O61A 3WU1B 4G6QA 2G7UA 5FKOA 4QIWN 2BVMA 1K6YA 2OQRA 1RKWA 2OQGA 3HOTA 4DOZA 2ICWG 4JYKA 3FWEA 2R7UA 5C4XJ 2CS3A 1A35A 2CQNA 4BAYA 3OYEA 3OYAA 1ULYA 4K2EA 2X6YA 1XC5A 2HQNA 2Q8KA 2QSFX 1VF9A 1NK2P 3RQIA 4GCVA 2TCTA 2V26A 4F7ZA 3T5XA 3S8PA 3IC7A 4KMFA 4I7HA 2ZB9A 3I4NJ 4PJLA 1JT6A 1YIJI 2MD0A 1I3AA 3E1SA 2P6SA 2D5VA 2A6EF 4XM3A 5D4SA 5FB2A 5AONA 1VQ9I 2QQBA 3I4PA 3TDUC 3VFZA 1FSHA 4WCGA 4LJZF 1GDTA 3F8MA 3RPUD 4G94A 1IRGA 2MA3A 3F9KA 1QBJA 3Q9VA 1W36D 1IC8A 4NDLA 3OYBA 5CPRB 4J01A 2CQ7A 3QP5A 4W1UA 5D8LB 4XRFA 2XPWA 2HEOA 2F6CA 3OWTA 2ZO4A 2DTZA 4A3JJ 3KEQA 2K4BA 3B6CA 3BCBA 4I98B 1USTA 2W7NA 3VODA 2O7OA 4HV5A 1IUFA 2KDZA 1X4PA 2LP0A 4I2OA 4B1RA 4HPQA 4RGXA 2X6WA 4EATA 2QM3A 4WX9A 1V55H 3K4LA 4IRIA 2WV1A 2GWRA 5DYMA 3MZYA 4CA0A 1ZRCA 4XSZF 2EINH 3UKGA 2HR3A 3H9QA 5ICFA 1E0EA 1HCRA 5D5WB 1KYZA 1W1WE 2OCCH 3R61A 3L2UA 3BR6A 3KP2A 3K4KA 5E8GA 1BOBA 3Q0VA 4LB6B 4Y17A 5DD8A 1W5SA 2XHKA 4H4KC 3SDGA 2QQ8A 3P9CA 4OIOF 5D6FA 3I0TA 3EETA 3IH3A 3AL0B 2X1EA 5B66C 5E8IA 1BR2A 2VPRA 4DYRA 2EZIA 3PQJA 4XONA 3TW7A 3HM5A 4I09A 2HGCA 5HDKA 2KKOA 2EFQA
chains in the Genus database with same CATH topology
3HPGA 4Y4RA 3L2QA 2CV0A 2F5VA 1EA3A 2L9NA 2ZSIB 2OUMA 4F55A 3HC7A 3AKZA 2RQQA 2WY8Q 4PJMA 4XOPA 4F52A 1UAAA 4E7JA 3VWBA 3EPZA 4XMYA 1YE9A 4XR6A 4CSWA 3W2WA 1DP3A 2VKDA 1D1AA 1Z3YA 5FROA 2VLAA 3CP2A 2M4GA 1DGRM 3OMYA 3SEZA 3PJRA 2KQRA 2VXZA 4OWRB 4ZC3A 2L9SA 4QPOA 2ZFUA 3MKYB 1FMVA 3OYNA 3S3OA 3LSHA 4C2TA 4N4OB 1MMNA 4PJNA 3IAS2 4XN3A 4BQOA 2V4JC 3MKZA 4LIVA 2PJRB 3K4NA 1Y56A 4R79A 3VYSB 2BOLA 3I3LA 3BG6A 2MFZA 1MNEA 2MYSA 3M8JA 3I9V2 4YRVA 1SAUA 2QKLB 3LSIA 2UUZA 2W82A 2VQGA 2Z16A 4B47A 1TT0A 2JVGA 1J09A 4II3A 2HPMA 4BU2A 4ZDOA 4LITA 1KONA 3H5AA 2DXIA 3NWTA 1BR4A 1Z7LA 2RNGA 3K4CA 4XLHA 1X1BA 3DTEA 3L2WA 2M4KA 3QYBA 1WJBA 3OYMA 2WY7Q 3N05A 4BJ5C 2E5ZA 4U7BA 1QHGA 3DQVC 4NUBA 3QOEA 3LL7A 3HUGB 3DPTA 2E1MC 1OR7C 2F4IA 2Z1DA 2OC6A 4P5OA 4Y3OA 4C30A 2Y0SA 2V7FA 3FBNB 4BE1A 3S32A 1MMDA 3DTIA 2XDVA 1P9QC 1X1DA 4BDZA 4YEJA 4XQFA 1MMGA 3CMMA 4FASD 4HSTA 4OAZA 3TMOA 2WAEA 2X1DA 2K9MA 4CCNA 4BQQA 4BJTA 2OV7A 2BW3B 4CCOA 4KT6A 2XF7A 2KL4A 3ZR8X 3FBIB 4LIUA 5FRMA 1Z21A 1LDKB 2JSPA 3ZQQA 4BEHA 3K10A 3W3CA 2R7TA 4E7LA 3ZCOA 3GBGA 4RM3A 3C2GA 2FUG2 2PMZA 2AQEA 4BE2A 4CCLA 1DQUA 2DOAA 3VSKA 3OS2A 3A2KA 4KITB 2R7XA 3NWSA 1T95A 3MKWB 4HRIA 3OR2C 3UR3C 2HZDA 3DTKA 4DJAA 2WAFA 3K6GA 3SEQA 4DGWB 4BACA 2DJIA 3RCOA 4B3XA 5KHDA 3DEEA 3DPUA 4XOTA 3ONQA 4PK4A 5TGTA 2VJIA 2HQAA 3CP8A 4BDYA 4BE0A 4RLQA 5HOOA 2R7WA 1LFPA 4D9JA 2CV1A 2LBFA 1T0FC 4QPQA 3H0DA 4C2UA 2IXSA 4CCKA 1UELB 4XKVA 3FDYA 1D1CA 3DWLE 1WFXA 3RTRA 1ERDA 4IKFA 3PSIA 2VJ4A 3TL4X 4HNUA 4KISA 4BL0B 4P1WA 3OYIA 2KDOA 2IS1A 3OL3A 4F3QA 4ANJA 2KMUA 2L7KA 4HNTA 4XLEA 3V42A 4IZZA 1QU3A 2CFOA 3IAM2 3SYTA 3H9GA 2O5RA 2X51A 2X85A 5HVQC 4NC7A 3BC8A 3VYTB 2LG4A 3DLAA 4ZTJA 2LYCA 4CCJA 4BS9A 2K5CA 4BXFA 1YX5A 2IGOA 1QHHD 3W2AA 3A4CA 2WA0A 4II2A 1PJRA 3H9JA 4ZTFA 3LSMA 3G2BA 3D5SC 3PUBA 4GRIA 1OLTA 1NG6A 2BVLA 3VYUB 4DIQA 3PNYA 2M3AA 2V6EA 4B48A 2HU9A 2X1CA 2HNHA 3EUKL 4XLCA 3AL0C 3OS0A 3ZGKA 2V1NA 1DGWY 2JUGA 2Z2SB 4CZCA 1LKXA 3QYEA 4E7HA 2HVQA 2RREA 5FRNA 2CMPA 2WB1A 1LVKA 2VKHA 1WJDA 1D0XA 5LD2C 3OY9A 4BQNA 4PUSA 3KYLA 2DT6A 2DCEA 1WJCA 4E7SA 4C9YA 4IQJA 1D1BA 4ZDPA 3W2VA 1D0YA 3DU5A 2E60A 3OYJA 4CUGA 2M0MA 2M7AA 3DKYA 2UWMA 3KEYA 2R7RA 4AVZA 2V9KA 3M1CA 2ZXIA 4HEA2 1V5GA 1S9HA 3K4JA 4BUPA 4E4HA 3HL2A 2VIXA 2X6XA 4PJJA 2W4SA 3SZGA 3OS1A 2VJ5A 1G8XA 1NG7A 4E6KG 1D0ZA 1VZ0A 2DT7B 2P0WA 4PSXA 4NQWB 4IQ4A 4XORA 1SFKA 4NC8A 2MC4A 4PFPA 4AU7A 2JVHA 2HPIA 4U87A 5CKTA 2W00A 3C2HA 3IP4B 3RQ4A 3PFYA 2HDWA 3OL4A 3ZRGA 3J7AY 3LMMA 5CQGA 2XAUA 4E7KA 2WAQA 1X1CA 4ZJZA 2CV2A 1WJAA 2CW8A 4J00A 2ZSHB 3H5RA 4XKBA 2M7BA 4Y33A 1IRXA 3DU6A 3A1YA 4N4NB 2XC7A 2HVSA 3U21A 3OYDA 2QKMB 2KP6A 3H5NA 4KJZA 2ZXHA 4XLFA 2PJRA 3CZ6A 4E7IA 4IX7A 3KX2A 1YX3A 2VQCA 4ZYAA 1X4OA 4JOMA 2UV1A 4PFOA 3BG7A 2JA2A 2VASA 3OYKA 3K70C 2VXDA 3OOUA 4B44A 2WADA 4HG2A 2GOMA 4ITVA 1WJFA 4RMNA 3UNGC 1GLNA 3L2RA 1N78A 2W1OA 3OR1C 3TBIA 3DKXA 3HOSA 1Z3XA 1HA8A 5CQEA 5KCMA 5HNFA 1AA7A 2XSJC 2E1MB 2KRHA 3HKZA 1V5FA 2LOOA 3LSGA 3RSNA 4BEHB 5KNLA 1MMAA 1MW7A 3H35A 5HLTA 3D5LA 3ZXSA 4F93B 1X19A 4AYBA 3L2VA 2WBMA 4XL9A 2IGMA 2L2OA 4BJ6C 2CW7A 2LH9A 3EUAA 3HXLA 2K9LA 1PYVA 2A5WA 3D5RC 3K4MA 3OYFA 3S3NA 2R4GA 1N75A 3LFUA 4XLAA 2KRCA 1U0JA 2VQLA 1V5EA 3K70D 3PSFA 4FETA 3FHNA 2LY2A 2L5QA 3E0JB 2BVMA 1K6YA 3CESA 3VSLA 4D1QA 3HOTA 1G59A 4DOZA 3HG9A 2VB6A 1W36C 1BR1A 2KZVA 2R7UA 3PNTA 1MNDA 2IS6A 2CS3A 2BW3A 3CJRB 2IS4A 3OYEA 4HSRA 1N77A 3OYAA 4YELA 3BCAA 2X6YA 2LBFB 3OYLA 3VDXA 2V26A 5LFAA 3S8PA 2CH0A 2AQFA 2VPLA 3OYCA 2IS2A 4PJLA 2XF5A 2MD0A 3E1SA 3S93A 1FMWA 4MLOA 4XM3A 4XKCA 4ZDLA 4JQFA 3PL8A 2CUJA 4BGDA 4RM2A 1WJ5A 3CJQB 3OIQA 3RPUD 4XKWA 3S3MA 2NOJB 3QYFA 3QODA 2KLOA 3F9KA 2R7SA 1W36D 4E7ZA 3OYBA 5CPRB 4J01A 2GOXB 1WJEA 2MABA 2XF6A 4F91B 3LSKA 2F6CA 3OWTA 4G6TB 4PSWA 4X0GA 2VJJA 3BCBA 2LREA 1TZLA 2KPMA 3BLYA 1ZELA 2ELJA 3K4BA 4CCMA 3HPHA 2W7NA 4CH7A 1X4PA 3AFHA 4HPQA 2VQHA 2X6WA 4EATA 4OAYA 4XN0A 3K4LA 2VL8A 4XNFA 2K3PA 3MD2A 4CA0A 2CUZA 4RLFA 4LG3A 4NNJA 3MMYB 2LY1A 4DBQA 3OYGA 3H9QA 3SDBA 1X1AA 1E0EA 1UG0A 3L2UA 3IUOA 4DBRA 3EUHC 2R7VA 1JI8A 2R7OA 2IGKA 3DPLC 2LC2A 1BOBA 2LRDA 3K4KA 4B43A 2R7QA 2Q1ZB 2HVRA 4H4KC 3CF2A 2IGNA 5JHFA 1Y6IA 5HNHA 3AL0B 2X1EA 3VYRB 1BR2A 3OIPA 2A6TA 3PNVA 4F92B 3OYHA 2E5NA 3FKJA 4XONA 2KHMA 2I8DA 2Q2EB 1R6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJA A;  3HPH A;  3HPG A;  1WJC A;  1WJB A;  1WJD A;  1MW7 A;  1LFP A;  1WJE A;  1K6Y A;  1KON A;  1WJF A;  4F3Q A;  3F9K A;  1E0E A; 
#chains in the Genus database with same CATH topology
 1E17 A;  2DFH A;  1EA3 A;  3JTH A;  4MFD A;  3HC7 A;  1EJ9 A;  2V9P A;  5F27 A;  1XN7 A;  4ZYD A;  1I5Z A;  4F52 A;  1UAA A;  2F4M B;  4ESF A;  3SXY A;  4CSW A;  3W2W A;  2VKD A;  1Z3Y A;  2HOS A;  3RKX A;  2YU3 A;  3OMY A;  1OPC A;  3RKY A;  1IF1 A;  4FX4 A;  1OFC X;  3BP8 A;  1TNT A;  2KQR A;  1ZGA A;  1UB9 A;  5D4R A;  2DJN A;  3MQ0 A;  4XRM A;  4PJN A;  1T2K A;  3QWL A;  4LLL A;  2EZL A;  1GUU A;  3ABU A;  2X6O A;  4XN3 A;  5L3C A;  4RBO A;  4BYY A;  1ETY A;  5DM6 F;  2E35 A;  2V4J C;  3MKZ A;  4HDV A;  5KAI C;  2XKO A;  4R79 A;  4V2F A;  3VYS B;  3I3L A;  4HV6 A;  1R00 A;  4PJ0 C;  1EH7 A;  1ZLJ A;  4HBL A;  4M3E A;  3V7R A;  2MFZ A;  1FTT A;  5DM7 F;  4N9I A;  1O3R A;  4YRV A;  2HWV A;  3LSI A;  4HX8 A;  4DW6 A;  2HFH A;  3ERM A;  2W82 A;  5K1Y A;  1FIA A;  1R5I D;  3J7A O;  1TT0 A;  1W7P D;  4EJU A;  2JVG A;  3FM5 A;  4KDP A;  3BR1 A;  4BU2 A;  4ZDO A;  3Q5F A;  1Z0X A;  3HRM A;  3K4C A;  2FX0 A;  3L9F A;  1Z6R A;  1T08 B;  1SMT A;  3GFJ A;  3GUD A;  1SFO J;  3IKV A;  5BQT A;  1CQT A;  3QYB A;  1BIA A;  1XSX A;  1VQ8 I;  2G9W A;  3VPR A;  4C3J J;  2YR2 A;  2OCE A;  3QOE A;  3LL7 A;  5FJ8 J;  5D5X B;  4HLX A;  1RES A;  1XTA A;  2F4I A;  2LSO A;  4P5O A;  4Y3O A;  5F0C A;  4C30 A;  2QBY A;  2RKH A;  5B1A H;  2A69 F;  5ICC A;  1ZQ3 P;  1PUF A;  4LB5 A;  4J19 A;  1X3W B;  3ZMS A;  2E1O A;  3MFK A;  2M1B A;  1PVE A;  2XRN A;  3GWZ A;  4IHX A;  4KIC A;  2E36 A;  3MN2 A;  4YEJ A;  2P7C B;  1MMG A;  3CMM A;  1FYL A;  5EZH A;  4R1H A;  1IN7 A;  1Z05 A;  2ADU A;  4BJT A;  2VOD A;  5TJJ A;  3HBL A;  2BW3 B;  1OMI A;  4KT6 A;  2HQR A;  2H1K A;  2KIQ A;  2KL4 A;  2XF7 A;  3F21 A;  5FD6 A;  2VOO A;  2ZJP F;  3AG3 H;  2W57 A;  1OR7 A;  2DMU A;  2B0L A;  2FOK A;  1FWZ A;  5JVT A;  4HAM A;  1T33 A;  2B7E A;  3W3C A;  3B02 A;  4U7D A;  4E7L A;  2MG4 A;  1HBX G;  3E97 A;  1X3U A;  5HS8 A;  4MEX F;  5LEK A;  2M34 A;  1DQU A;  2DOA A;  4QTR A;  2NS7 A;  1V4R A;  2R7X A;  1T95 A;  1YIT I;  1B8I B;  5ED4 A;  3UR3 C;  2WAF A;  3KP7 A;  3SEQ A;  1OCO H;  1XDU A;  3E6B A;  5CVJ A;  2CQQ A;  1KU7 A;  3FXO A;  2DJI A;  2DYS H;  4G8X A;  3DEE A;  1SAX A;  1DU6 A;  2QLZ A;  1FNN A;  2ZKZ A;  4HX4 A;  3E7L A;  1YW8 A;  1A6Q A;  5BPD A;  3BQZ A;  3DKW A;  4BDY A;  3CP8 A;  1DUX C;  3CO6 C;  3C1D A;  3WTV C;  4MTE A;  1B4A A;  4IJA A;  5CYV A;  2R7W A;  3CCE I;  2LBF A;  2AXT C;  3V7C A;  2M9H A;  4CCK A;  4XKV A;  3WTU C;  5JLX A;  3CD6 I;  1WFX A;  1S72 I;  1NK3 P;  3PSI A;  3CUO A;  1XGS A;  1Y39 A;  4V2G A;  4F3Q A;  4FTH A;  4UB6 C;  5AIQ A;  5D5U B;  1K83 J;  1XX5 A;  3BTL A;  5ICG A;  1YOV B;  1IDZ A;  2O5R A;  3ZOB A;  5ILS A;  1V3F A;  1G4D A;  4OIR F;  1B9N A;  2QF7 A;  3WU0 A;  4HDU A;  5B3S H;  5BS6 A;  2LG4 A;  2MW8 A;  2LYC A;  4CYC A;  5EEG A;  1RUO A;  1KA8 A;  1YX5 A;  5L3E A;  1QHH D;  2MH2 A;  3G3Z A;  3GZ5 A;  2VBW A;  4FHT A;  3FHZ A;  1R4N B;  3X2Q H;  4BY1 J;  1XGM A;  3LSM A;  3H0G J;  1SVM A;  3D5S C;  3PUB A;  1NG6 A;  3DCF A;  5GTI C;  1JT0 A;  1CF7 A;  1S5L C;  2J5O A;  3GLL A;  1Z1D A;  2Z33 A;  2BGC A;  1FYM A;  5DCM B;  4Q5S F;  2DOF A;  2ZXW H;  3AL0 C;  1DPR A;  3P7N A;  5J1U A;  1MJA A;  1YIO A;  1I3Q J;  1VQ4 I;  1ZH5 A;  2ELH A;  1IRZ A;  3QYE A;  5DUK A;  4E7H A;  2IW5 A;  2PBI A;  3U2R A;  1FYK A;  1X1P A;  2A05 A;  2RC4 A;  3GO5 A;  1YI2 I;  4PGG A;  5FRN A;  1IDY A;  3QRF F;  1W5C C;  2VKH A;  2FA5 A;  2WB1 A;  2GXA A;  2JPB A;  2LK2 A;  2R5Y B;  2K02 A;  4BQN A;  1J59 A;  2PMU A;  4PUS A;  3KYL A;  4E7S A;  4NBQ A;  4I02 A;  3RI4 A;  4L9J A;  4IQJ A;  2DQR A;  3SZP A;  1VQ5 I;  1YW7 A;  3F8C A;  1W5T A;  2FU4 A;  2ISY A;  3DU5 A;  3M8E A;  5IOY A;  4KFC A;  5HOD A;  2YSR A;  2M0M A;  2IA0 A;  2UWM A;  3KEY A;  3VOE A;  3K2A A;  4AVZ A;  2V9K A;  5H2F C;  3M1C A;  2ZXI A;  2JRM A;  1NTC A;  4MNU A;  3FMQ A;  1X3Z B;  3I5U A;  4BUP A;  2CRG A;  2MGQ A;  3HOY J;  3ZMD A;  1FPQ A;  1F43 A;  2FML A;  3WTY C;  4PJJ A;  2W4S A;  2VJ5 A;  3TGN A;  1W7P B;  1NG7 A;  2ZJR F;  2L4M A;  5DTD A;  3J7Y J;  4V19 K;  2DT7 B;  1XGN A;  2P0W A;  3FK6 A;  1G3T A;  4PSX A;  1G6N A;  4IRG A;  2W24 A;  3N97 A;  2HOT A;  4GO1 A;  2ECB A;  5IP6 A;  3C2H A;  3O6B B;  4EEF G;  5DV5 A;  2DLL A;  4A3I J;  3M7G A;  3IP4 B;  2X4H A;  3OL4 A;  2XGC A;  4DNC A;  2XSD C;  4IHV A;  1X1C A;  4ZJZ A;  1WJA A;  2ZSH B;  3FXJ A;  3H5R A;  3F8F A;  4JX4 A;  3FF5 A;  4N4N B;  2TDX A;  1R49 A;  4HQM A;  3OYD A;  2ZME B;  1U9N A;  1QPM A;  2KP6 A;  3H5N A;  3Q9S A;  3JAM K;  2DPD A;  4FQG A;  3PO3 J;  4XLF A;  1LVA A;  3CZ6 A;  3KX2 A;  1ON2 A;  2HYJ A;  3F72 A;  1VQM I;  1MBH A;  2NVX J;  3TED A;  1PDN C;  2FBH A;  4CIC A;  3ZP5 A;  2JRT A;  2VAS A;  1USS A;  3CQZ J;  1BJZ A;  3GVA A;  2IT0 A;  4B44 A;  3BT9 A;  2GOM A;  1DDN A;  4IHT A;  3CCS I;  4EVI A;  3P9K A;  1SFX A;  2EWN A;  3OR1 C;  3TBI A;  1HSJ A;  4YFX F;  4UY8 I;  1YW9 A;  1ACI A;  1RNL A;  5CLS A;  2VC0 A;  3A01 A;  1QO0 D;  1YTY A;  3V7S A;  2E1M B;  4UV8 A;  3EUH A;  2BY3 A;  1MDM B;  5KNL A;  3GXO A;  3GLX A;  2AHQ A;  3M9A A;  4AVP A;  1WHU A;  2XAH A;  3KCC A;  3CJT B;  4AYB A;  4UVA A;  1OCT C;  1QRY A;  3LAJ A;  3HUG A;  4UVC A;  4XL9 A;  2JWT A;  5K5O A;  2D1V A;  4Z6Y A;  3CLO A;  2JN6 A;  3HXL A;  2K9L A;  2PX9 A;  2BY1 A;  4Q4Z F;  3K4M A;  1XMK A;  1SMY F;  3K70 D;  2I10 A;  1K7A A;  3PSF A;  2L7Z A;  3FHN A;  1LE8 B;  2BV6 A;  1OKR A;  2L5Q A;  4FCY A;  2K9S A;  2QVO A;  5AIP A;  4A0X A;  3BR0 A;  4OIP F;  3HG9 A;  2VB6 A;  3LNQ A;  1W36 C;  1BI3 A;  3PNT A;  4ZYH A;  1DP7 P;  1OCR H;  3CJR B;  2IS4 A;  2NVT J;  1S7O A;  3CCY A;  1N77 A;  3AG2 H;  3BZ6 A;  1WVR A;  2DA5 A;  3LA2 A;  1A04 A;  2P5L C;  3ZPL A;  3VDX A;  1B9M A;  2RDP A;  1FBQ A;  2AQF A;  5LHH A;  5IYD J;  5J6X A;  2XF5 A;  3MKL A;  2IA2 A;  5D8K B;  1EH8 A;  5FO5 A;  1S7A A;  5LHI A;  3S93 A;  4M72 A;  1P92 A;  5J8C A;  1IG7 A;  2PEX A;  4XKC A;  1N25 A;  2F4O B;  2R7F A;  3O3K A;  1R4M B;  3ECH A;  3AG1 H;  3TP0 A;  4P9F A;  2VKV A;  3TW6 A;  5K5Q A;  4BGD A;  4JK1 X;  3FXM A;  1WPK A;  1WJ5 A;  1A36 A;  4A3L J;  3S3M A;  4XKW A;  3RZO J;  1TW3 A;  2NS0 A;  2NOJ B;  5EGO A;  2PG4 A;  2DBB A;  4B3A A;  1O3T A;  3D1N I;  3CTA A;  4E7Z A;  2WC2 A;  3I59 A;  1XSD A;  3H3Z A;  3WOD F;  3LSK A;  1F1Z A;  2DMT A;  3FIS A;  2LRE A;  2EZH A;  1BW6 A;  3HRS A;  2OPT A;  1O7L A;  4IOA F;  1ZEL A;  4CCM A;  4R8H A;  3RJP A;  4CH7 A;  1XB4 A;  2L9V A;  1Y1W J;  2YPR A;  3K0L A;  2VE8 A;  4Y52 J;  3TQN A;  1TBX A;  3S14 J;  1BBY A;  5EG0 B;  5K7Z A;  1UZC A;  3MD2 A;  4RLF A;  4PGH A;  5E3L A;  1ZGW A;  4LG3 A;  3MMY B;  4DBQ A;  2GIV A;  3NEU A;  4MGR A;  4ETS A;  2LD5 A;  1X1A A;  2R92 J;  4YFK F;  5JFR A;  2A5Y B;  3IUO A;  2I5U A;  3ABK H;  3EUH C;  4DBR A;  2R7V A;  3DPL C;  2IGK A;  1D8J A;  2LRD A;  1S7E A;  3BR2 A;  2XPU A;  4LG0 B;  2VC1 A;  3CME I;  2R7Q A;  2Q1Z B;  1IJW C;  4JBA A;  3AG4 H;  3JRG A;  3IHU A;  3L1P A;  1AOY A;  2JSC A;  3ZQ7 A;  5JHF A;  1ETQ A;  5ILU A;  1LEB A;  3BJO A;  4BHC A;  1JKR C;  3F8N A;  4ABZ A;  1YRN A;  2A6T A;  4RB1 A;  1O3S A;  3GTM J;  3JRF A;  3OYH A;  5E79 C;  2ZJQ F;  2Q2E B;  2CFX A;  3HYI A;  2CV0 A;  2ELK A;  1TQM A;  1SFE A;  4L5J A;  1E2X A;  3GW2 A;  5F1J A;  3IH2 A;  1P2F A;  1R1V A;  1R1T A;  2EV0 A;  1FTZ A;  2LTP A;  4RAF A;  1IXC A;  1ETX A;  2RQQ A;  5H20 A;  3CCL I;  3TO6 A;  2JT1 A;  3CLQ A;  2L02 A;  4UHT A;  1YE9 A;  4LGW A;  1ZGJ A;  5JI6 A;  1DP3 A;  4RAG A;  1D1A A;  2A68 F;  5FRO A;  4MEY F;  3GTQ J;  2FNP A;  2WTE A;  5J47 A;  4MQ9 F;  2M4G A;  1DGR M;  3HTU A;  4QWQ A;  1ORK A;  3CDL A;  1YJW I;  1EV7 A;  3KP4 A;  4A69 C;  4I99 C;  4ZC3 A;  2ZNY A;  4AID A;  4OIQ F;  2RN7 A;  5DEQ A;  3MKY B;  4A3F J;  4EV0 A;  1FMV A;  3TP3 A;  2HYG D;  4UXN A;  4N4O B;  1O3Q A;  2M45 A;  3M4O J;  4XK4 A;  2LVS A;  4KIB A;  3IAS 2;  1ZYR F;  4IL6 C;  5H6R A;  4BQO A;  1KQ0 A;  1R1U A;  2PJR B;  3GTG J;  5IY5 H;  1IW7 F;  1Y56 A;  3ABM H;  2R5Z A;  1OJL A;  1FC3 A;  3ABT A;  1R36 A;  1MNE A;  2MBF A;  5HLH A;  2MYS A;  2ZME C;  3I9V 2;  2K3F A;  2Z99 A;  4LK0 F;  2ME0 A;  4RB3 C;  5LRR A;  1QZZ A;  3A0H C;  2BHZ A;  4GYI A;  4IF4 A;  5EEH A;  4OMZ A;  1ZLK A;  1H9G A;  1D3Y A;  3F3X A;  1VQP I;  4NQW A;  1S8N A;  1J09 A;  2BE5 F;  2HPM A;  1IXS B;  3MAJ A;  4DQ2 A;  2DXI A;  1U9O A;  3P5J A;  3NWT A;  5FLV A;  1Z7L A;  5E3O A;  4GXO A;  2PQ8 A;  1K78 B;  3F22 A;  5FLM J;  1C0W A;  4M3F A;  3KYD B;  1R23 A;  1T56 A;  3K69 A;  1IN4 A;  1WJB A;  2LF7 A;  1QHG A;  1QNT A;  2WB1 N;  5M3F J;  2Z9O A;  1J9I A;  3DPT A;  2E1M C;  5E17 F;  3M1E A;  2EB7 A;  2XB5 A;  4CO8 A;  3HOU J;  3JRC A;  5J4V A;  4BNC A;  3HRT A;  4S05 A;  3FBN B;  5IP9 J;  3F6O A;  1XS9 A;  4UUS A;  1MMD A;  4IPA A;  3S2D J;  3J7Z I;  3LSJ A;  2XDV A;  1P9Q C;  4BDZ A;  4XQF A;  2D1H A;  2XRL A;  3V8L A;  4L0Y B;  2X1D A;  2K9M A;  4CCN A;  1IN6 A;  2CQX A;  2OV7 A;  5FKM A;  2UXN A;  3JRH A;  5D6E A;  4EJT A;  1OIS A;  3KPH A;  4LIU A;  1Z21 A;  2XGE A;  5LBQ A;  4ON0 A;  1R58 A;  4TV7 A;  3ZQQ A;  3D0S A;  1YYV A;  2DN0 A;  1ITY A;  3HRU A;  2ZFW A;  5DCF A;  4HOB A;  3WTS C;  4RM3 A;  2C6Y A;  1P4W A;  1A6I A;  4UV9 A;  3C2G A;  3WG7 H;  2EH3 A;  2CSO A;  2PMZ A;  5C4J J;  4BE2 A;  2R7D A;  1ZR4 A;  3CF5 F;  1EF4 A;  3OS2 A;  1HQC A;  4EQQ A;  3QPL A;  2ESN A;  1BM9 A;  1QA6 A;  2AS5 F;  4A3E J;  3A2K A;  1GV5 A;  4KIT B;  1MBK A;  1JUP A;  4DJA A;  2CUE A;  3K6G A;  3WGG A;  5EDN A;  1VQ6 I;  2KIS A;  1TC3 C;  4UNO A;  2KIM A;  3OOP A;  2O3F A;  3RCO A;  4B3X A;  2EIM H;  3DPU A;  3RIR A;  4XOT A;  1KGS A;  4M9Z A;  4PK4 A;  1U3E M;  2IVM A;  2QCO A;  2R7Z J;  2K40 A;  3BR3 A;  4XLP F;  5HOO A;  1B72 B;  4D9J A;  2CV1 A;  1ON1 A;  4IHY A;  3LQR A;  2AO9 A;  1D1C A;  4FE4 A;  4A3B J;  4IKF A;  2EQR A;  4KIS A;  3SFZ A;  1MBF A;  4BL0 B;  2F48 A;  3OYI A;  2YU9 J;  3OL3 A;  4ANJ A;  4G9Y A;  2COB A;  2L7K A;  5FKL A;  2DO7 A;  2IAI A;  1YFH A;  2WWY A;  3PO2 J;  4ESB A;  3IAM 2;  3ZN1 A;  4ENJ A;  2Q0O A;  1JUS A;  2X85 A;  5HVQ C;  1FIP A;  1QVU A;  4NC7 A;  4AYB N;  3ZN0 A;  4GGG A;  4LD5 A;  1P6R A;  5ICE A;  1RUN A;  2ZBK A;  2W84 A;  3BRO A;  3IH4 A;  2ZXJ A;  4CCJ A;  4BS9 A;  1J5Y A;  4BXX J;  4EM0 B;  3FX3 A;  1JJ6 C;  4BXF A;  1I39 A;  2KRF A;  4RAZ A;  1JKO C;  4I76 A;  1MH4 A;  1FSE A;  2WA0 A;  4II2 A;  2P81 A;  1OCZ H;  3KZI C;  1OLT A;  3VYU B;  2H8R A;  1IAW A;  2DPU A;  3PNY A;  2V6E A;  1LFU P;  2HNH A;  1JGS A;  3EUK L;  2FBK A;  2WV0 A;  2F5F A;  3ZGK A;  2V1N A;  1IUY A;  1STZ A;  1KU2 A;  2JUG A;  4U88 A;  1B59 A;  2H1L A;  3HGG A;  1IGN A;  3LA3 A;  2RRE A;  2DA6 A;  4ZYG A;  1ETO A;  2CMP A;  5LEJ A;  1HKS A;  2H6B A;  2LR8 A;  3OY9 A;  4G6D A;  2FOW A;  5KAF C;  2V1X A;  3EYI A;  2DA2 A;  3EQL F;  2NNY A;  1TLH B;  3ML6 A;  1BI0 A;  4ZDP A;  3BG5 A;  2EIL H;  2GXG A;  1H88 C;  1FJL A;  1YG2 A;  2MSY A;  3CCJ I;  3OYJ A;  2M5W A;  1ZR2 A;  2R7R A;  1MGT A;  2NOG A;  2E1C A;  1ETK A;  3FIW A;  2XB0 X;  2F2E A;  3K4J A;  1K4S A;  3WTX C;  3JRD A;  2NVQ J;  3DBL B;  2VIX A;  1R9T J;  4FIS A;  2M8G X;  5E1Z B;  4HQE A;  2H27 A;  1WZ2 A;  5E20 A;  4E6K G;  1D0Z A;  3HZJ A;  5GTH C;  3MZH A;  2D45 A;  4A3M J;  5FKN A;  2IEK A;  4IQ4 A;  4XOR A;  4HLY A;  1QPI A;  4PFP A;  4AU7 A;  2BXZ A;  2JVH A;  3GYH X;  4O6J A;  1TT5 B;  3H1C A;  4U87 A;  2W00 A;  5BNG A;  4NHJ A;  2KZG A;  3F6V A;  3RQ4 A;  2IJL A;  2DMP A;  1UHM A;  2VBY A;  3LMM A;  3O2P E;  5CQG A;  3V4G A;  2KIU A;  5C44 J;  2FF4 A;  2V6C A;  3A1Y A;  2XC7 A;  4YIF A;  3RYR A;  2HVS A;  3U21 A;  2QKM B;  3JSO A;  2HOA A;  2GLO A;  1GXP A;  3GFL A;  2MLG A;  3C7J A;  3WHB A;  3FMS A;  4ZYA A;  1X4O A;  3R4K A;  1G3W A;  1TP4 A;  2RGV A;  3BG7 A;  3FK7 A;  3VB2 A;  2MLK A;  3K70 C;  1LB2 A;  2E1N A;  3CCV I;  3VEP A;  3G4S I;  2DA7 A;  2WAD A;  3GTK J;  2YUS A;  1WJF A;  3UNG C;  1F9N A;  3GTJ J;  3DKX A;  2OZU A;  1Z3X A;  3CUQ B;  5HNF A;  2XSJ C;  4PZJ A;  5L3B A;  2RVC A;  2KRH A;  1V5F A;  2NVY J;  2NAZ A;  4BEH B;  1MD0 A;  1ZRD A;  2YS9 A;  3H35 A;  2DQL A;  3D5L A;  3GTP J;  1WRJ A;  2EJR A;  3OIO A;  5FLX K;  1D5V A;  3FMR A;  3L2V A;  2V79 A;  3F0C A;  2JUC A;  3RYP A;  1WH7 A;  3LSR A;  2QUF A;  3KP5 A;  5GPA A;  4WK8 F;  1TL8 A;  2QQ9 A;  5DD4 A;  1EKE A;  5DUI A;  3L7W A;  3HEF A;  3JW4 A;  2R4G A;  5LGN A;  3LFU A;  2KRC A;  3W6V A;  1ZTR A;  2VQL A;  4HYE A;  4FET A;  3E0J B;  4XRS G;  2CQK A;  1MNM C;  4W97 A;  2KJB A;  2EZK A;  3R6S A;  4D1Q A;  1FY7 A;  1Z67 A;  1O4X A;  1MND A;  3ZMU A;  2IS6 A;  2BW3 A;  1LUJ B;  3ISP A;  4HSR A;  2EV5 A;  4M9X A;  5E1X A;  3GFM A;  4YEL A;  3BCA A;  4A0Y A;  5HDN A;  1F4K A;  1VND A;  3H36 A;  2EA2 A;  4HNV A;  5LFA A;  3L09 A;  2VUM J;  3ULQ B;  2CH0 A;  1V54 H;  2CJJ A;  3KEO A;  3OYC A;  2Z3Y A;  2HXO A;  1FMW A;  4MLO A;  4X1E A;  4JQF A;  1YLF A;  1QZY A;  1BOA A;  2CUJ A;  3B6A A;  3RPU A;  4A0Z A;  1B8I A;  3GTO J;  4RM2 A;  3T8T A;  1U5T B;  2A07 F;  3GEZ A;  1SFU A;  4M6X A;  4D7N A;  2FD5 A;  2P7V B;  3QOD A;  2Y31 A;  2KLO A;  3HDD A;  4ZZL A;  1WKM A;  1JHF A;  1YQA A;  1KU3 A;  3F8B A;  5J1R A;  2MAB A;  2XF6 A;  5B5E C;  4AWX B;  3JTG A;  5K7H A;  4EM2 A;  4X0G A;  4BBR J;  3ZMT A;  1BW5 A;  4CGZ A;  4XLN F;  3BLY A;  5IOZ A;  2ELJ A;  3K4B A;  2JZY A;  2YX4 A;  3H92 A;  3HPH A;  2O8K A;  4AM3 A;  3ZQC A;  3WTT C;  4KN7 X;  1P4X A;  1X2M A;  3AFH A;  2VQH A;  1UFM A;  4OAY A;  4XN0 A;  1D8K A;  1ZG5 A;  3MEX A;  2VL8 A;  4XNF A;  1FX7 A;  4P55 A;  1LDJ A;  1PUE E;  2CUZ A;  2XUB A;  3JSP A;  4NNJ A;  3CMY A;  2MH9 A;  4M73 A;  1QQI A;  3SDB A;  2QSG X;  4UUV A;  1ZG3 A;  1TWC J;  3DBH B;  2AXL A;  1FOK A;  3IKT A;  2B9S A;  1UG0 A;  2COM A;  3OSG A;  3SZT A;  1JI8 A;  2R7O A;  4B43 A;  2LC2 A;  2DDA A;  3QU6 A;  2PMZ N;  3S2W A;  2HVR A;  3CF2 A;  2IGN A;  2XPV A;  3SQN A;  2FNA A;  4A3D J;  4IRH A;  5HLI A;  5HNH A;  3HSR A;  1POG A;  4OU0 A;  3ZMV A;  5LLQ A;  1FZP B;  5HS9 A;  2E5N A;  3FKJ A;  3CC4 I;  1VFC A;  2KHM A;  5DCM A;  4U7B A;  4I0A A;  4B09 A;  1R6R A;  2K7L A;  1K4T A;  3H3V K;  3U1K A;  2JA6 J;  1R5H A;  2F5V A;  1HDP A;  2OJE D;  2Y48 A;  3LA7 A;  2ZSI B;  3HJE A;  2OUM A;  4IHW A;  1KZH A;  3F23 A;  2PLY A;  3QAH A;  3AKZ A;  4PJM A;  5IPA A;  1RPW A;  2F5E A;  4E7J A;  2VKE A;  3VWB A;  3EPZ A;  1S3J A;  2NVU B;  5FLX Z;  1WGX A;  2QQA A;  1OQY A;  1HF0 A;  4DZP A;  1VQN I;  4A5M A;  2R5Y A;  1GT0 C;  3BPX A;  4HX7 A;  3U1D A;  2VLA A;  4GYG A;  4UUT A;  2DOD A;  5J8F A;  3S1R J;  2CYY A;  3PM1 A;  4BQA A;  3PJR A;  2L9S A;  1PP7 U;  2XIG A;  1LDD A;  2F5C A;  1L0O C;  1EH6 A;  1XDS A;  2ID6 A;  2ZFU A;  3OYN A;  3S3O A;  2E71 A;  3LSH A;  2NXN B;  3I54 A;  4RS8 A;  1AKH B;  4C2T A;  2BEO A;  2CU7 A;  1XCB A;  9ANT A;  4I0B A;  5KK1 A;  1OCP A;  2DI3 A;  3WE2 A;  4RGU A;  3WHC A;  1YJN I;  1MJB A;  4M6Y A;  2QEN A;  5JLW A;  2JJ7 A;  1I27 A;  4EMS A;  1BA5 A;  3BG6 A;  3S17 J;  4FT8 A;  3QP6 A;  4HW0 A;  2DYR H;  1TWG J;  2QKL B;  1W7P A;  4EGZ A;  3A03 A;  5B1B H;  2BYV E;  3JR9 A;  4RGS A;  2E34 A;  2VQG A;  1Z6T A;  3ASN H;  5CVR A;  3IRQ A;  1AU7 A;  4QLC U;  1GV2 A;  3H3U A;  3ESW B;  1KQ9 A;  2L54 A;  4G7O F;  1TNS A;  1QGP A;  4D0P A;  5JR3 A;  1BR4 A;  4XLH A;  1WH5 A;  1XD7 A;  2LLK A;  2XAF A;  1X1B A;  2TRT A;  1XG1 A;  3DTE A;  3K1M A;  1PP8 F;  1BL0 A;  4C2M J;  2ECC A;  3N05 A;  4BJ5 C;  4BH9 A;  1LNW A;  3CUQ C;  4XID A;  4NUB A;  3V8K A;  4AD9 A;  1HST A;  2ZME A;  1LJ9 A;  1YJ9 I;  2OF7 A;  2Z1D A;  2LKP A;  3KYC B;  4Y15 A;  3OSF A;  4IHS A;  2EPF A;  1UG2 A;  5FD5 A;  2Y75 A;  1P4A A;  2RNJ A;  4BE1 A;  2A61 A;  1UMQ A;  3T8R A;  4CDG A;  1KU9 A;  3BG9 A;  3I64 A;  4QSH A;  2L4A A;  2M2E A;  1X1D A;  2DT5 A;  3TKY A;  4JP0 A;  4YFN F;  1H0M A;  2XRO A;  4KA4 A;  1Q1V A;  1E3H A;  2EFO A;  1UCR A;  3R0J A;  5F0F A;  1QVT A;  2VBZ A;  2WAE A;  3KLN A;  1HW2 A;  1IN8 A;  1J2X A;  2V1D A;  3G1L A;  2E2I J;  2V9V A;  1U8B A;  3JCU C;  3QOP A;  5L3D A;  3CO7 C;  2QYO A;  3K1N A;  3E5Q A;  5IYC J;  2DFF A;  1VTN C;  3ZR8 X;  3K1P A;  2ZC2 A;  3BQY A;  5FRM A;  3MCZ A;  1LDK B;  1MDM A;  4YII A;  2JSP A;  3BDD A;  4LOC A;  3HOZ J;  3JAM Z;  5E18 F;  4WXH A;  4P9U A;  3IRR A;  5EF6 A;  1RKT A;  1RRJ A;  3I56 I;  2FUG 2;  4CCL A;  1ZKG A;  4OMY A;  3HB9 A;  1YO5 C;  1T8I A;  3G71 I;  3NWS A;  2LDU A;  4AIK A;  1DU0 A;  4HRI A;  2HZD A;  3E5U A;  1LE8 A;  4DGW B;  5CVV A;  4A3C J;  5GPC A;  2NS8 A;  2PJP A;  4BBS J;  5KHD A;  1E3P A;  2FSW A;  4EJO A;  1U5T C;  2Y0M A;  3ONQ A;  1P7I A;  2HXI A;  2LF8 A;  1ZRF A;  1ZN2 A;  3GCM A;  4BHB A;  2FXA A;  1JTY A;  1T0F C;  3KZZ A;  1ODD A;  3H0D A;  3IWF A;  2L01 A;  1UEL B;  3FDY A;  1IV6 A;  1BIB A;  3RTR A;  4N0B A;  3KET A;  1HC8 A;  3TL4 X;  4HNU A;  4WXD A;  4X6A J;  4RB2 C;  2P4W A;  4A93 J;  2KDO A;  2IS1 A;  2QEX I;  3N4M A;  2X9D A;  2GIZ A;  4FX0 A;  4BXU A;  4C3I J;  1HKQ A;  2EFN A;  2KMU A;  1L3L A;  4IEJ A;  1APL C;  2CFO A;  1ZK8 A;  3K2Z A;  3GZN B;  1G2H A;  2GBY A;  5F1R A;  3TO7 A;  1TQP A;  3ASO H;  3VYT B;  5D5V B;  1TWA J;  4XRS A;  2UXX A;  3DF8 A;  3ERE D;  4KNY A;  2K5C A;  3BZK A;  2IGO A;  4ZH4 F;  3E6D A;  3W2A A;  3A4C A;  3BG3 A;  2EFW A;  2E19 A;  3BJA A;  3S16 J;  1PJR A;  3H9J A;  4ZTF A;  3G2B A;  4GRI A;  3AAF A;  4M3G A;  2HU9 A;  2X1C A;  1RET A;  5ILV A;  1VQ7 I;  4XLC A;  3OV8 A;  1JHH A;  2E7X A;  1DGW Y;  3L00 A;  4N9H A;  3WGH A;  5EG0 A;  2NRA C;  1BN5 A;  4CZC A;  5GP9 A;  4WF2 A;  1LEA A;  4XIC A;  2O0Y A;  1IXR C;  5J40 A;  1TQI A;  5ERI A;  1LQ1 A;  1S6L A;  2ETH A;  4LK1 F;  1D0X A;  5LD2 C;  2DT6 A;  3C3W A;  3TO9 A;  4OOI A;  3M8F A;  4JX6 A;  4LG0 A;  4PDK A;  4UB8 C;  4M3B A;  3E3V A;  3S1M J;  5BOX A;  2EIJ H;  4S0H B;  5GAE J;  2VN2 A;  1ETW A;  2L7F P;  3Q0U A;  2DA3 A;  1MBE A;  2E60 A;  4RB0 A;  2HTS A;  1TW2 A;  3PIO F;  4GFB A;  3K7A J;  4D5C A;  2DFI A;  3IV5 A;  1R7J A;  3ELK A;  3LFK A;  4LLG F;  1V5G A;  2Q2E A;  1S9H A;  2H6C A;  2HTJ A;  2QGU A;  3BZC A;  2X6X A;  3G73 A;  2Y0S N;  3SZG A;  3OS1 A;  3G1O A;  1KYW A;  5L3G A;  3NAR A;  1WI3 A;  1HDD C;  3WU2 C;  3KP3 A;  4Y7N J;  2HZT A;  1VZ0 A;  1HW5 A;  2ZCW A;  1WQ2 A;  1SFK A;  2NNN A;  4NC8 A;  1MBJ A;  2O03 A;  3WTZ A;  2HPI A;  1BI2 A;  6PAX A;  4BY7 J;  2JTV A;  1Z7U A;  4MQV A;  2E2H J;  3PFY A;  1LFB A;  2HDW A;  3ZRG A;  3C18 A;  3ZMZ A;  1E3O C;  3J7A Y;  4E7K A;  3CJN A;  2WAQ A;  1JE8 A;  2DTR A;  5FKK A;  1VI0 A;  2CV2 A;  4J00 A;  4G7Z F;  5L3F A;  4Y33 A;  3HOV J;  4Q47 A;  5F0H A;  2VI6 A;  2QA4 I;  1FP1 D;  4KJZ A;  2PJR A;  2QBY B;  2M87 A;  1U78 A;  1MSE C;  2STT A;  2XVC A;  4IX7 A;  1YX3 A;  2K4J A;  4G12 A;  1PUF B;  1CGP A;  3HTS B;  3Q3S A;  1GXQ A;  1U2W A;  2UV1 A;  2KJC A;  4AC0 A;  3OYK A;  4DYC A;  2JPC A;  3BWG A;  3S15 J;  1Q1H A;  3OOU A;  2JA7 J;  4UVB A;  3FXU A;  3LOC A;  3DV8 A;  1M1E B;  2G0E A;  4ITV A;  4I01 A;  1OYW A;  3CDH A;  4RMN A;  3L2R A;  4AUX A;  1N78 A;  1HA8 A;  3HOS A;  2X48 A;  3ABL H;  1A5J A;  1DPU A;  5KCM A;  4B4C A;  3PIP F;  1P7J A;  2W25 A;  1K78 A;  1XSV A;  3REO A;  1SVL A;  5LGU A;  1B1B A;  3HKZ A;  2H94 A;  2L7M P;  3M07 A;  2XV4 S;  5CJ9 A;  3O8H A;  3CDI A;  3I55 I;  4F93 B;  3CCR I;  4IXA A;  2OZ6 A;  4WXC A;  2WBM A;  3TOA A;  3KZY A;  1FOW A;  2DU9 A;  4BJ6 C;  4BHP A;  2CW7 A;  2LH9 A;  3M3Y J;  2A5W A;  5E3M A;  4CZZ A;  3WGI A;  3OYF A;  3S3N A;  1I50 J;  1N75 A;  1FLI A;  3P9I A;  1V5E A;  2MC3 A;  1H89 C;  2DMN A;  3LWF A;  1X58 A;  2PN6 A;  2LY2 A;  3G6E I;  1SAN A;  2E7W A;  3CES A;  3VSL A;  2FQ4 A;  1A31 A;  1G59 A;  4L0Z B;  1JJ8 C;  1XMX A;  5FFX A;  1BR1 A;  1BJA A;  2KZV A;  3JRB A;  2OAZ A;  3BJ6 A;  1GHC A;  1QZE A;  4M6V A;  5EZG A;  4AIH A;  3CMA I;  3KIO A;  2FRH A;  3WTW C;  1MH3 A;  2QWW A;  2OD5 A;  3FXR A;  2LBF B;  3OYL A;  2RAE A;  2QZ8 A;  5IT3 A;  1OYY A;  3HHH A;  1RI7 A;  4EGY A;  5BMZ A;  1K61 A;  2VPL A;  2IS2 A;  3I71 A;  5M3M J;  2BXY A;  1FOY A;  5M5X J;  2B63 J;  2XAJ A;  4ZDL A;  3PL8 A;  1SD6 A;  3U9G A;  3J80 K;  5TRD A;  3GME A;  2LKX A;  1Z91 A;  1Y8Q B;  3CJQ B;  2DAO A;  3OIQ A;  4MIM A;  3WG9 A;  3QYF A;  2QSH X;  1R5G A;  2ISZ A;  2R7S A;  4LMY A;  1XCV A;  2XGD A;  4CYC B;  1T39 A;  2GOX B;  1WJE A;  2R3S A;  3DP7 A;  3BTJ A;  2STW A;  4F91 B;  2CUF A;  1HLV A;  4PSW A;  2L3D A;  4G6T B;  4DYQ A;  2VJJ A;  1UHS A;  2Y9Y A;  3E6M A;  1B72 A;  1XMA A;  1JTX A;  1TZL A;  2KPM A;  4JX5 A;  1MJ9 A;  1I1S A;  3QPS A;  1X2N A;  3A02 A;  4XBF A;  4A6E A;  1CF7 B;  5GAH J;  2K9Q A;  3LSP A;  3COA C;  1W4M A;  2P5K A;  5DDG A;  5DS9 A;  2PFB A;  4O3M A;  1G3S A;  1RIO H;  2K3P A;  5EEA A;  1KQ8 A;  1U6G A;  2EFP A;  2DA4 A;  4RAY A;  4A6D A;  5J4Y A;  4GDF A;  2LY1 A;  3OYG A;  2IBD A;  1HKT A;  5K5R A;  1BI1 A;  3KP6 A;  3W6K B;  3GFI A;  2IPQ X;  4ESJ A;  2LFB A;  4RGR A;  2DK8 A;  3NAU A;  3LAP A;  3HSF A;  2GQQ A;  4A3G J;  1R22 A;  2VON A;  2OTJ I;  3R0A A;  1UJ8 A;  2M30 A;  1Y6I A;  5HLG A;  1MKM A;  4BKX A;  1GVD A;  4ENK A;  2O6G E;  5E3N A;  2XAG A;  2FE3 A;  3VYR B;  3IL2 A;  2HDC A;  2FJ1 A;  5GAD J;  3OIP A;  3PNV A;  4F92 B;  2K27 A;  2DOE A;  1H8A C;  2I8D A;  1JGG A;  1JKP C;  4KMU X;  3RKW A;  3HPG A;  4Y4R A;  5IYB J;  3L2Q A;  2VOP A;  2L9N A;  2W85 A;  5K7F A;  4F55 A;  2HI3 A;  1YS7 A;  2EIK H;  2HKX A;  4RDU A;  1FEX A;  3ZQG A;  4M9S A;  2WY8 Q;  4XOP A;  1WI9 A;  1W0U A;  4XMY A;  1BC8 C;  1IV8 A;  2FBI A;  4XR6 A;  3HHG A;  3J81 K;  3HOW J;  2EA4 A;  2JA5 J;  4A3K J;  3CCU I;  3ZQI A;  3CP2 A;  2OBP A;  3LST A;  5IP7 J;  2BBY A;  3SEZ A;  5KVR A;  2VXZ A;  4OWR B;  4QPO A;  4YG2 F;  3WE3 A;  1F5T A;  2ZJ2 A;  5CVU A;  3SJM A;  2BHY A;  2CWE A;  4FE7 A;  3MVP A;  1MMN A;  1XGO A;  1G3Y A;  3S2H J;  4U0W A;  1Y0U A;  2P8T A;  4LIV A;  2N8G A;  3K4N A;  4L9T A;  2F5D A;  2BOL A;  2RV8 A;  1B6A A;  4IVN A;  5FGM A;  2X0L A;  4D7M A;  2RQP A;  3M8J A;  5JHU A;  2VT3 A;  2VT2 A;  1SAU A;  5JVG F;  2UUZ A;  4KT5 C;  4RA2 A;  2Z16 A;  4B47 A;  4L5E A;  1Z9C A;  1S29 A;  5J1Y A;  4II3 A;  1YHQ I;  4LIT A;  5E1W A;  1KON A;  3H5A A;  5F08 A;  2CGP A;  2RNG A;  3PQK A;  2Y30 A;  3A01 B;  1J0R A;  5IT9 K;  3J80 Z;  3L2W A;  2OA4 A;  3IWZ A;  2ACJ A;  2XAS A;  2M4K A;  3ZQF A;  3OYM A;  2XKP A;  1Y0N A;  2WY7 Q;  4A2U A;  3GX4 X;  2E5Z A;  4WWC A;  4HF1 A;  3Q0W A;  4KN4 X;  5TIS C;  1D5Y A;  4EJV A;  2XGX A;  3DQV C;  2O8X A;  2EK5 A;  4HA8 A;  3HUG B;  3QQA A;  4B8X A;  1OR7 C;  1Y1V J;  2OC6 A;  2ME6 A;  1Z77 A;  5GAG J;  2Y0S A;  2A3S A;  2V7F A;  3FXQ A;  1AHD P;  1H9T A;  2D2W A;  1F36 A;  5HDG A;  2ID3 A;  2LKS A;  3S32 A;  3JRE A;  3BOQ A;  3DTI A;  2DA1 A;  5LGT A;  3S1N J;  3QPH A;  1IRF A;  4FAS D;  4H0E A;  4HST A;  4OAZ A;  3TMO A;  4CXF A;  4BQQ A;  1T98 A;  2BY2 A;  3R60 A;  2K85 A;  3KE2 A;  5A2Q K;  4CCO A;  1IZ1 A;  3I58 A;  3CUQ A;  3RKQ A;  2CW0 F;  3GF2 A;  1VQL I;  4D5F A;  3FBI B;  5EJC A;  1O57 A;  1TTY A;  4BEH A;  2YX7 A;  1J7K A;  5CVI A;  4EJW A;  3K10 A;  2R7T A;  3ZCO A;  3GBG A;  2GZW A;  3V8J A;  2IA1 A;  1WCM J;  4KIG A;  5F64 A;  2A6H F;  2V1U A;  2AQE A;  3JRA A;  2VE9 A;  3DLL F;  4ASN A;  2H09 A;  3JRI A;  3VSK A;  3L2C A;  3BR5 A;  3ZQL A;  2P5V A;  2HDD A;  5EYR A;  2BZT A;  3S1Q J;  2PI0 A;  2WAQ N;  1ZAO A;  3MKW B;  3OR2 C;  2HQ5 A;  3DTK A;  3DXJ F;  4ENN A;  3HIF A;  4KIF A;  2O9L A;  4BAC A;  5EGO B;  1ETV A;  1FP2 A;  5M5W J;  2OU2 A;  3RPQ A;  1NHA A;  3BPV A;  4ZZD A;  2EBI A;  2ESH A;  3KFW X;  3I59 B;  2P6T A;  3BY6 A;  3GZ6 A;  3DEW A;  5TGT A;  2VJI A;  2FMY A;  2HQA A;  3PFI A;  3QU3 A;  1K79 A;  1MSF C;  4BE0 A;  4RLQ A;  2DMQ A;  1LFP A;  1GVJ A;  3ECO A;  4YIR X;  1REP C;  5LRS A;  3RZD J;  1FT9 A;  1I6H J;  1SD5 A;  3QPT A;  4QPQ A;  4C2U A;  3J81 Z;  1HW1 A;  2IXS A;  4EM1 A;  2GXB A;  2IRF G;  4Z2Y A;  1OYI A;  1O7F A;  2Y2Z A;  3DWL E;  4HZF A;  4LFU A;  3GTL J;  4M71 A;  1ERD A;  2DW4 A;  4G7H F;  2HYF A;  2VJ4 A;  4O5V A;  3FXL A;  3CCQ I;  4P1W A;  3EDP A;  4U0V A;  1U8R A;  1ZAR A;  2CG4 A;  1WSU A;  2DK5 A;  4HNT A;  4XLE A;  3V42 A;  2JQ7 A;  4IZZ A;  1VQK I;  1QU3 A;  4OIN F;  3HKZ N;  3SYT A;  2L9R A;  2Y69 H;  3E5X A;  3H9G A;  2X51 A;  3BTC A;  1U5T A;  4L9V A;  5F6F A;  5H6Q A;  3BC8 A;  4NB5 A;  4P96 A;  3DLA A;  4ZTJ A;  2LNB A;  1T0F A;  3MZ8 A;  1T38 A;  4LLN A;  4IOC F;  3C2B A;  4IO9 F;  1R71 A;  1TWF J;  1RC9 A;  3DEU A;  4KUM A;  2BVL A;  2FEZ A;  4DIQ A;  1YRN B;  2M3A A;  4B48 A;  1NH3 A;  1SEU A;  3PUF A;  1LPQ A;  3OS0 A;  2JA8 J;  2W48 A;  5IT9 Z;  2Z2S B;  1SVO A;  4XSX F;  5C3E J;  2LY9 A;  1YS6 A;  5LHG A;  2G7H A;  3T0Y A;  1LKX A;  1Y8R B;  3HSE A;  2R0Q C;  1JKQ C;  2K9N A;  1HOM A;  3DBR B;  2HVQ A;  3I53 A;  4M3D A;  5HS7 A;  2L0K A;  4I6Z A;  1W0T A;  1ENH A;  2MD5 A;  2PMH A;  4MFE A;  4Q48 A;  1LVK A;  4ZYE A;  2KFD A;  4MO7 A;  1WJD A;  1FBS A;  1JUM A;  2E2J J;  2BY0 A;  1K6O A;  2GA1 A;  2CO5 A;  1TWH J;  2DCE A;  2HS5 A;  1WJC A;  3BTI A;  1SD7 A;  4A12 A;  2J5P A;  4CHU A;  4C9Y A;  3ROU A;  1D1B A;  1HXD A;  1ONV A;  4MTD A;  3SFI A;  3W2V A;  1D0Y A;  3MWM A;  3O8G A;  3T1B A;  4KYW A;  3EYY A;  2FQ3 A;  4CUG A;  2M7A A;  1MZB A;  1UHW A;  3DKY A;  1ZG1 A;  4HEA 2;  1T6S A;  4AIJ A;  1MMS A;  4NC6 A;  1XPX A;  1MBG A;  4L5I A;  4E4H A;  5A2Q Z;  3HL2 A;  2R5Z B;  3FZV A;  5M5Y J;  3TOB A;  4U0Y A;  3K9T A;  3E6C C;  5BPI A;  1G8X A;  1RR8 C;  2DFE A;  1FBU A;  1JXS A;  1IO2 A;  2M0C A;  1SC7 A;  2H8W A;  3CC2 I;  4NQW B;  4L9N A;  1MIJ A;  1RR7 A;  2MC4 A;  5CKT A;  4S04 A;  4Y13 A;  2ZNZ A;  3FM3 A;  3SHF A;  2XAU A;  3CCM I;  5FFZ A;  4DZJ A;  2CW8 A;  3RDI A;  2GM4 A;  4C3H J;  2M8E A;  4XKB A;  2M7B A;  1IRX A;  3DU6 A;  4ENM A;  1AKH A;  2NYX A;  2VBX A;  1J75 A;  1ZHF A;  3B73 A;  2ZXH A;  3NQO A;  2OTL I;  1VQO I;  4E7I A;  1BC7 C;  2Y9Z A;  2DDB A;  2VQC A;  4CYD A;  4L18 B;  2GA2 A;  4UUS B;  4JOM A;  1FOX A;  2XAQ A;  4PFO A;  1WWX A;  2IP2 A;  2JA2 A;  5F04 A;  2LMD A;  2VXD A;  3HGY A;  4MHG A;  4A5N A;  2JMW A;  2JK3 A;  4HG2 A;  1GLN A;  1IN5 A;  2W1O A;  2K86 A;  2HOE A;  5CQE A;  1I1G A;  1AA7 A;  1AWC A;  2GAU A;  3TDZ C;  3I4M J;  2R93 J;  5J3L A;  3KLO A;  2EV6 A;  2LOO A;  3A0B C;  3LSG A;  3RSN A;  3CC7 I;  4M74 A;  1MMA A;  1MW7 A;  5HLT A;  3ZXS A;  2HKO A;  3W6J B;  1X19 A;  3LQQ A;  2Z5U A;  2KT0 A;  1RZ4 A;  2IGM A;  2L2O A;  3G1M A;  4PCQ A;  4E70 A;  1OCC H;  1SD4 A;  2UZK A;  1I6X A;  3DFG A;  3EUA A;  3HOX J;  3NRV A;  3ZQH A;  2KIF A;  1PYV A;  3D5R C;  4HF2 A;  4HF0 A;  1ZRE A;  4XLA A;  3FKI J;  1U0J A;  3FXK A;  2O61 A;  3WU1 B;  4G6Q A;  2G7U A;  5FKO A;  4QIW N;  2BVM A;  1K6Y A;  2OQR A;  1RKW A;  2OQG A;  3HOT A;  4DOZ A;  2ICW G;  4JYK A;  3FWE A;  2R7U A;  5C4X J;  2CS3 A;  1A35 A;  2CQN A;  4BAY A;  3OYE A;  3OYA A;  1ULY A;  4K2E A;  2X6Y A;  1XC5 A;  2HQN A;  2Q8K A;  2QSF X;  1VF9 A;  1NK2 P;  3RQI A;  4GCV A;  2TCT A;  2V26 A;  4F7Z A;  3T5X A;  3S8P A;  3IC7 A;  4KMF A;  4I7H A;  2ZB9 A;  3I4N J;  4PJL A;  1JT6 A;  1YIJ I;  2MD0 A;  1I3A A;  3E1S A;  2P6S A;  2D5V A;  2A6E F;  4XM3 A;  5D4S A;  5FB2 A;  5AON A;  1VQ9 I;  2QQB A;  3I4P A;  3TDU C;  3VFZ A;  1FSH A;  4WCG A;  4LJZ F;  1GDT A;  3F8M A;  3RPU D;  4G94 A;  1IRG A;  2MA3 A;  3F9K A;  1QBJ A;  3Q9V A;  1W36 D;  1IC8 A;  4NDL A;  3OYB A;  5CPR B;  4J01 A;  2CQ7 A;  3QP5 A;  4W1U A;  5D8L B;  4XRF A;  2XPW A;  2HEO A;  2F6C A;  3OWT A;  2ZO4 A;  2DTZ A;  4A3J J;  3KEQ A;  2K4B A;  3B6C A;  3BCB A;  4I98 B;  1UST A;  2W7N A;  3VOD A;  2O7O A;  4HV5 A;  1IUF A;  2KDZ A;  1X4P A;  2LP0 A;  4I2O A;  4B1R A;  4HPQ A;  4RGX A;  2X6W A;  4EAT A;  2QM3 A;  4WX9 A;  1V55 H;  3K4L A;  4IRI A;  2WV1 A;  2GWR A;  5DYM A;  3MZY A;  4CA0 A;  1ZRC A;  4XSZ F;  2EIN H;  3UKG A;  2HR3 A;  3H9Q A;  5ICF A;  1E0E A;  1HCR A;  5D5W B;  1KYZ A;  1W1W E;  2OCC H;  3R61 A;  3L2U A;  3BR6 A;  3KP2 A;  3K4K A;  5E8G A;  1BOB A;  3Q0V A;  4LB6 B;  4Y17 A;  5DD8 A;  1W5S A;  2XHK A;  4H4K C;  3SDG A;  2QQ8 A;  3P9C A;  4OIO F;  5D6F A;  3I0T A;  3EET A;  3IH3 A;  3AL0 B;  2X1E A;  5B66 C;  5E8I A;  1BR2 A;  2VPR A;  4DYR A;  2EZI A;  3PQJ A;  4XON A;  3TW7 A;  3HM5 A;  4I09 A;  2HGC A;  5HDK A;  2KKO A;  2EFQ A; 
#chains in the Genus database with same CATH homology
 3HPG A;  4Y4R A;  3L2Q A;  2CV0 A;  2F5V A;  1EA3 A;  2L9N A;  2ZSI B;  2OUM A;  4F55 A;  3HC7 A;  3AKZ A;  2RQQ A;  2WY8 Q;  4PJM A;  4XOP A;  4F52 A;  1UAA A;  4E7J A;  3VWB A;  3EPZ A;  4XMY A;  1YE9 A;  4XR6 A;  4CSW A;  3W2W A;  1DP3 A;  2VKD A;  1D1A A;  1Z3Y A;  5FRO A;  2VLA A;  3CP2 A;  2M4G A;  1DGR M;  3OMY A;  3SEZ A;  3PJR A;  2KQR A;  2VXZ A;  4OWR B;  4ZC3 A;  2L9S A;  4QPO A;  2ZFU A;  3MKY B;  1FMV A;  3OYN A;  3S3O A;  3LSH A;  4C2T A;  4N4O B;  1MMN A;  4PJN A;  3IAS 2;  4XN3 A;  4BQO A;  2V4J C;  3MKZ A;  4LIV A;  2PJR B;  3K4N A;  1Y56 A;  4R79 A;  3VYS B;  2BOL A;  3I3L A;  3BG6 A;  2MFZ A;  1MNE A;  2MYS A;  3M8J A;  3I9V 2;  4YRV A;  1SAU A;  2QKL B;  3LSI A;  2UUZ A;  2W82 A;  2VQG A;  2Z16 A;  4B47 A;  1TT0 A;  2JVG A;  1J09 A;  4II3 A;  2HPM A;  4BU2 A;  4ZDO A;  4LIT A;  1KON A;  3H5A A;  2DXI A;  3NWT A;  1BR4 A;  1Z7L A;  2RNG A;  3K4C A;  4XLH A;  1X1B A;  3DTE A;  3L2W A;  2M4K A;  3QYB A;  1WJB A;  3OYM A;  2WY7 Q;  3N05 A;  4BJ5 C;  2E5Z A;  4U7B A;  1QHG A;  3DQV C;  4NUB A;  3QOE A;  3LL7 A;  3HUG B;  3DPT A;  2E1M C;  1OR7 C;  2F4I A;  2Z1D A;  2OC6 A;  4P5O A;  4Y3O A;  4C30 A;  2Y0S A;  2V7F A;  3FBN B;  4BE1 A;  3S32 A;  1MMD A;  3DTI A;  2XDV A;  1P9Q C;  1X1D A;  4BDZ A;  4YEJ A;  4XQF A;  1MMG A;  3CMM A;  4FAS D;  4HST A;  4OAZ A;  3TMO A;  2WAE A;  2X1D A;  2K9M A;  4CCN A;  4BQQ A;  4BJT A;  2OV7 A;  2BW3 B;  4CCO A;  4KT6 A;  2XF7 A;  2KL4 A;  3ZR8 X;  3FBI B;  4LIU A;  5FRM A;  1Z21 A;  1LDK B;  2JSP A;  3ZQQ A;  4BEH A;  3K10 A;  3W3C A;  2R7T A;  4E7L A;  3ZCO A;  3GBG A;  4RM3 A;  3C2G A;  2FUG 2;  2PMZ A;  2AQE A;  4BE2 A;  4CCL A;  1DQU A;  2DOA A;  3VSK A;  3OS2 A;  3A2K A;  4KIT B;  2R7X A;  3NWS A;  1T95 A;  3MKW B;  4HRI A;  3OR2 C;  3UR3 C;  2HZD A;  3DTK A;  4DJA A;  2WAF A;  3K6G A;  3SEQ A;  4DGW B;  4BAC A;  2DJI A;  3RCO A;  4B3X A;  5KHD A;  3DEE A;  3DPU A;  4XOT A;  3ONQ A;  4PK4 A;  5TGT A;  2VJI A;  2HQA A;  3CP8 A;  4BDY A;  4BE0 A;  4RLQ A;  5HOO A;  2R7W A;  1LFP A;  4D9J A;  2CV1 A;  2LBF A;  1T0F C;  4QPQ A;  3H0D A;  4C2U A;  2IXS A;  4CCK A;  1UEL B;  4XKV A;  3FDY A;  1D1C A;  3DWL E;  1WFX A;  3RTR A;  1ERD A;  4IKF A;  3PSI A;  2VJ4 A;  3TL4 X;  4HNU A;  4KIS A;  4BL0 B;  4P1W A;  3OYI A;  2KDO A;  2IS1 A;  3OL3 A;  4F3Q A;  4ANJ A;  2KMU A;  2L7K A;  4HNT A;  4XLE A;  3V42 A;  4IZZ A;  1QU3 A;  2CFO A;  3IAM 2;  3SYT A;  3H9G A;  2O5R A;  2X51 A;  2X85 A;  5HVQ C;  4NC7 A;  3BC8 A;  3VYT B;  2LG4 A;  3DLA A;  4ZTJ A;  2LYC A;  4CCJ A;  4BS9 A;  2K5C A;  4BXF A;  1YX5 A;  2IGO A;  1QHH D;  3W2A A;  3A4C A;  2WA0 A;  4II2 A;  1PJR A;  3H9J A;  4ZTF A;  3LSM A;  3G2B A;  3D5S C;  3PUB A;  4GRI A;  1OLT A;  1NG6 A;  2BVL A;  3VYU B;  4DIQ A;  3PNY A;  2M3A A;  2V6E A;  4B48 A;  2HU9 A;  2X1C A;  2HNH A;  3EUK L;  4XLC A;  3AL0 C;  3OS0 A;  3ZGK A;  2V1N A;  1DGW Y;  2JUG A;  2Z2S B;  4CZC A;  1LKX A;  3QYE A;  4E7H A;  2HVQ A;  2RRE A;  5FRN A;  2CMP A;  2WB1 A;  1LVK A;  2VKH A;  1WJD A;  1D0X A;  5LD2 C;  3OY9 A;  4BQN A;  4PUS A;  3KYL A;  2DT6 A;  2DCE A;  1WJC A;  4E7S A;  4C9Y A;  4IQJ A;  1D1B A;  4ZDP A;  3W2V A;  1D0Y A;  3DU5 A;  2E60 A;  3OYJ A;  4CUG A;  2M0M A;  2M7A A;  3DKY A;  2UWM A;  3KEY A;  2R7R A;  4AVZ A;  2V9K A;  3M1C A;  2ZXI A;  4HEA 2;  1V5G A;  1S9H A;  3K4J A;  4BUP A;  4E4H A;  3HL2 A;  2VIX A;  2X6X A;  4PJJ A;  2W4S A;  3SZG A;  3OS1 A;  2VJ5 A;  1G8X A;  1NG7 A;  4E6K G;  1D0Z A;  1VZ0 A;  2DT7 B;  2P0W A;  4PSX A;  4NQW B;  4IQ4 A;  4XOR A;  1SFK A;  4NC8 A;  2MC4 A;  4PFP A;  4AU7 A;  2JVH A;  2HPI A;  4U87 A;  5CKT A;  2W00 A;  3C2H A;  3IP4 B;  3RQ4 A;  3PFY A;  2HDW A;  3OL4 A;  3ZRG A;  3J7A Y;  3LMM A;  5CQG A;  2XAU A;  4E7K A;  2WAQ A;  1X1C A;  4ZJZ A;  2CV2 A;  1WJA A;  2CW8 A;  4J00 A;  2ZSH B;  3H5R A;  4XKB A;  2M7B A;  4Y33 A;  1IRX A;  3DU6 A;  3A1Y A;  4N4N B;  2XC7 A;  2HVS A;  3U21 A;  3OYD A;  2QKM B;  2KP6 A;  3H5N A;  4KJZ A;  2ZXH A;  4XLF A;  2PJR A;  3CZ6 A;  4E7I A;  4IX7 A;  3KX2 A;  1YX3 A;  2VQC A;  4ZYA A;  1X4O A;  4JOM A;  2UV1 A;  4PFO A;  3BG7 A;  2JA2 A;  2VAS A;  3OYK A;  3K70 C;  2VXD A;  3OOU A;  4B44 A;  2WAD A;  4HG2 A;  2GOM A;  4ITV A;  1WJF A;  4RMN A;  3UNG C;  1GLN A;  3L2R A;  1N78 A;  2W1O A;  3OR1 C;  3TBI A;  3DKX A;  3HOS A;  1Z3X A;  1HA8 A;  5CQE A;  5KCM A;  5HNF A;  1AA7 A;  2XSJ C;  2E1M B;  2KRH A;  3HKZ A;  1V5F A;  2LOO A;  3LSG A;  3RSN A;  4BEH B;  5KNL A;  1MMA A;  1MW7 A;  3H35 A;  5HLT A;  3D5L A;  3ZXS A;  4F93 B;  1X19 A;  4AYB A;  3L2V A;  2WBM A;  4XL9 A;  2IGM A;  2L2O A;  4BJ6 C;  2CW7 A;  2LH9 A;  3EUA A;  3HXL A;  2K9L A;  1PYV A;  2A5W A;  3D5R C;  3K4M A;  3OYF A;  3S3N A;  2R4G A;  1N75 A;  3LFU A;  4XLA A;  2KRC A;  1U0J A;  2VQL A;  1V5E A;  3K70 D;  3PSF A;  4FET A;  3FHN A;  2LY2 A;  2L5Q A;  3E0J B;  2BVM A;  1K6Y A;  3CES A;  3VSL A;  4D1Q A;  3HOT A;  1G59 A;  4DOZ A;  3HG9 A;  2VB6 A;  1W36 C;  1BR1 A;  2KZV A;  2R7U A;  3PNT A;  1MND A;  2IS6 A;  2CS3 A;  2BW3 A;  3CJR B;  2IS4 A;  3OYE A;  4HSR A;  1N77 A;  3OYA A;  4YEL A;  3BCA A;  2X6Y A;  2LBF B;  3OYL A;  3VDX A;  2V26 A;  5LFA A;  3S8P A;  2CH0 A;  2AQF A;  2VPL A;  3OYC A;  2IS2 A;  4PJL A;  2XF5 A;  2MD0 A;  3E1S A;  3S93 A;  1FMW A;  4MLO A;  4XM3 A;  4XKC A;  4ZDL A;  4JQF A;  3PL8 A;  2CUJ A;  4BGD A;  4RM2 A;  1WJ5 A;  3CJQ B;  3OIQ A;  3RPU D;  4XKW A;  3S3M A;  2NOJ B;  3QYF A;  3QOD A;  2KLO A;  3F9K A;  2R7S A;  1W36 D;  4E7Z A;  3OYB A;  5CPR B;  4J01 A;  2GOX B;  1WJE A;  2MAB A;  2XF6 A;  4F91 B;  3LSK A;  2F6C A;  3OWT A;  4G6T B;  4PSW A;  4X0G A;  2VJJ A;  3BCB A;  2LRE A;  1TZL A;  2KPM A;  3BLY A;  1ZEL A;  2ELJ A;  3K4B A;  4CCM A;  3HPH A;  2W7N A;  4CH7 A;  1X4P A;  3AFH A;  4HPQ A;  2VQH A;  2X6W A;  4EAT A;  4OAY A;  4XN0 A;  3K4L A;  2VL8 A;  4XNF A;  2K3P A;  3MD2 A;  4CA0 A;  2CUZ A;  4RLF A;  4LG3 A;  4NNJ A;  3MMY B;  2LY1 A;  4DBQ A;  3OYG A;  3H9Q A;  3SDB A;  1X1A A;  1E0E A;  1UG0 A;  3L2U A;  3IUO A;  4DBR A;  3EUH C;  2R7V A;  1JI8 A;  2R7O A;  2IGK A;  3DPL C;  2LC2 A;  1BOB A;  2LRD A;  3K4K A;  4B43 A;  2R7Q A;  2Q1Z B;  2HVR A;  4H4K C;  3CF2 A;  2IGN A;  5JHF A;  1Y6I A;  5HNH A;  3AL0 B;  2X1E A;  3VYR B;  1BR2 A;  3OIP A;  2A6T A;  3PNV A;  4F92 B;  3OYH A;  2E5N A;  3FKJ A;  4XON A;  2KHM A;  2I8D A;  2Q2E B;  1R6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...