1WJFA

Solution structure of h12c mutant of the n-terminal zn binding domain of hiv-1 integrase complexed to cadmium, nmr, 40 structures
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
55
structure length
55
Chain Sequence
FLDGIDKAQEECEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Zn-binding protein
molecule keywords HIV-1 INTEGRASE
publication title Solution structure of the His12 --> Cys mutant of the N-terminal zinc binding domain of HIV-1 integrase complexed to cadmium.
pubmed rcsb
source organism Human immunodeficiency virus 1
total genus 13
structure length 55
sequence length 55
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02022 Integrase_Zn Integrase Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1wjfA00
1WJBA 3HPGA 1K6YA 1WJEA 1WJCA 1WJDA 1KONA 3F9KA 3HPHA 1E0EA 4F3QA 1MW7A 1WJAA 1WJFA 1LFPA
chains in the Genus database with same CATH superfamily
3SZTA 4LG3A 4W97A 2PJRA 5K7ZA 5C4JJ 2GOMA 3HOSA 2LY2A 2V1UA 1WPKA 4P9FA 2ZJQF 1X58A 5L3EA 4QLCU 4PFOA 1U5TB 2BVLA 4UXNA 2ZFUA 1Z21A 3DTEA 1L3LA 3S17J 5TJJA 4LIUA 1WI3A 2KJBA 3HTUA 5F1RA 2EIMH 3A0BC 3W2VA 3FX3A 1BA5A 2NS8A 2IGKA 2LKSA 4KN4X 3IH4A 1LJ9A 2A69F 2DO7A 1JGGA 3OS2A 1IN6A 1YW9A 2VUMJ 2LY1A 2YX7A 1XTAA 1IC8A 5DD4A 3BPVA 2X48A 1C0WA 1KQ8A 3SEQA 2H8WA 5CLSA 2JVGA 4RLFA 1FJLA 1ZG1A 3M1CA 1FOYA 2RREA 3QP6A 5H6RA 3CCSI 2NAZA 5H20A 2K9SA 3KX2A 4YIRX 4MEXF 1MH4A 3OYAA 3U21A 5J3LA 1HBXG 3EYYA 5F0CA 1BBYA 2BXZA 2BV6A 2CQXA 4HV5A 4A3JJ 2PEXA 4HOBA 2ME6A 3WGHA 1J5YA 2Z3YA 4FX4A 2VQLA 4M3GA 1R49A 1Y1WJ 3FDYA 1CGPA 4BKXA 1GVDA 1O3RA 2UWMA 3S32A 4ZZLA 3PQJA 4ANJA 1X4PA 3WODF 4U87A 3TOBA 1KQ0A 4B1RA 3X2QH 1E3OC 5JLWA 1OJLA 5IP7J 3M1EA 5EG0B 4EVIA 1D1CA 5LEKA 1VQMI 3LNQA 2M0CA 2CRGA 2QSFX 3CDIA 3LSRA 1QO0D 2HGCA 4QWQA 5DD8A 5F6FA 2NXNB 4BXXJ 2V7FA 3BZCA 5HS7A 4C3IJ 3I56I 4JYKA 2NOGA 3I55I 2MH9A 4HYEA 5DCFA 1K4SA 1IZ1A 1R4MB 4FE7A 3BZKA 3BG3A 4AC0A 2RN7A 2XAGA 4H0EA 3MVPA 5B66C 3IP4B 4D5CA 3BT9A 2Y0SN 1QVUA 3S8PA 2AQEA 1OKRA 3D1NI 5K7HA 3ZN0A 1P4XA 4IKFA 5ILSA 3MZ8A 4II2A 1ZHFA 1EH8A 2WV0A 2RKHA 3V7CA 2CV2A 3S2DJ 4XKBA 4W1UA 2DT5A 4CYCB 1A31A 3ZN1A 1RR7A 2X1EA 3KYCB 3HRSA 4IHXA 2EZIA 2OV7A 3WHCA 1V54H 4FETA 1ETVA 4BEHA 2YSRA 2FOKA 3ABTA 4FE4A 3BR3A 2HQNA 4XLAA 1HOMA 1GHCA 4X1EA 2W1OA 1TC3C 1MGTA 3PNYA 1R5GA 3EPZA 1MDMB 2E2HJ 1ZREA 3O2PE 4XICA 2QBYB 1ZRDA 4UV8A 4LB6B 3S1RJ 4G7ZF 1X3UA 4AVZA 2JQ7A 2L9VA 2DQLA 2L7MP 5DCMA 2YR2A 4EM2A 1USSA 3IRQA 4DJAA 2P5LC 5EJCA 1IG7A 1OQYA 3BC8A 2BW3B 2DJIA 1KU3A 3PJRA 2P5VA 1SFUA 3HOWJ 4RS8A 1R22A 2GXAA 1RESA 1BR2A 1MSFC 1OCZH 3OYNA 1XMAA 3L2WA 2BY0A 2H6BA 2PMHA 4DZPA 3EDPA 1U5TA 3LFUA 2Y48A 4L9VA 2L2OA 2HTSA 2OQRA 2ADUA 4XIDA 3Q0UA 1VNDA 1LDDA 1SC7A 3KP4A 1QBJA 3FF5A 1Z0XA 3DTKA 3HBLA 4KITB 2WB1N 1BW6A 4KT6A 2WTEA 2KQRA 5BS6A 2WWYA 4L0YB 3L2QA 3GTKJ 5L3CA 1MIJA 2E36A 2F6CA 2X6OA 5F1JA 3DLLF 1UCRA 5K5QA 3Q5FA 2EV5A 4GRIA 4Q5SF 4OINF 4L9TA 3KIOA 5JR3A 1RIOH 1TT5B 2GIZA 1P2FA 1FT9A 1SAUA 5EGOB 1HW2A 3T5XA 3R61A 4YG2F 4A6EA 4HSTA 3JR9A 4ENJA 3M7GA 1MNMC 4HNVA 2LKPA 2M5WA 4XLCA 5IYDJ 1FMWA 1GV5A 2BHZA 5E8GA 1HA8A 4ETSA 2ID3A 2JK3A 2A05A 5GTIC 2JN6A 4WXDA 4D0PA 1D5YA 2VKVA 1Z6TA 2L54A 4XLPF 4D9JA 1B9NA 1VTNC 4OIPF 2O7OA 2M87A 3UNGC 3BTCA 4XN0A 1KQ9A 3LA2A 2WY7Q 3HUGB 2QEXI 4KNYA 3H35A 1BI3A 3T8TA 3SFZA 4XLNF 3GW2A 1T33A 4I98B 2VJ5A 1YE9A 4XNFA 2AXTC 3DWLE 4IO9F 3WTWC 1CF7B 3CCEI 2QENA 3OOUA 3GFIA 3LL7A 4XLHA 3OR1C 2R4GA 2D5VA 1UMQA 2WY8Q 4XSXF 3HKZN 3DXJF 5FD5A 5K1YA 2EBIA 4M74A 3VYSB 1YLFA 2BVMA 1BI0A 2M7AA 2ZC2A 3F0CA 4WK8F 1FYKA 1K79A 4UNOA 4I0BA 4IJAA 2PFBA 1K6OA 4GYIA 4LITA 4XRFA 5L3GA 1I5ZA 3F3XA 3K4JA 4BY7J 5FKKA 3G73A 2OZ6A 2FU4A 1KU9A 1IDYA 3BR6A 4BU2A 1JGSA 2ETHA 4E7KA 1ZH5A 1FC3A 2XDVA 3DBLB 3OV8A 4CYCA 1MSEC 3BTIA 1ETQA 4NC7A 3ESWB 1U78A 4IHSA 1FY7A 2FMYA 2EZHA 1P4AA 5FKNA 2JPBA 2VKHA 4A0YA 3A01B 4YFKF 3CJRB 1MBJA 3R0AA 2HQAA 2FMLA 2HYJA 3R60A 1W0UA 4ZTFA 3G71I 1R9TJ 3GMEA 4Y33A 1OMIA 2Z1DA 2QQBA 5FRMA 2QBYA 1YW8A 4BY1J 5DDGA 2I10A 1J9IA 3W6VA 4N4NB 2ZBKA 4PFPA 1RR8C 2XASA 3RI4A 2O03A 1BL0A 3F8CA 3AAFA 5CVVA 2YU3A 1POGA 2V9KA 2LKXA 1IGNA 2CH0A 2BW3A 2E7XA 2RNJA 2VPLA 3L2VA 2KISA 2QVOA 3DKWA 2XF7A 3SZPA 2MC3A 1OCPA 2Z9OA 3S3MA 2Q2EB 1UHSA 3FZVA 3M07A 3MKWB 4D1QA 3CC7I 5L3DA 2QKMB 3M8FA 4M6XA 2FE3A 1O57A 3HRMA 1JE8A 1VQLI 2CWEA 1AOYA 2K4BA 1A6QA 4DNCA 2P7VB 2H09A 4XOTA 5IP6A 3Q9VA 3NARA 3V8JA 3OYMA 2XGEA 2HOTA 2L02A 3QP5A 4HEA2 3ZRGA 2VBWA 3CCQI 1UB9A 5C44J 2LDUA 5BQTA 5EYRA 3EETA 2LR8A 4FT8A 4NB5A 1D8KA 4HDVA 2X4HA 2OZUA 2E2IJ 4XRSG 1IV8A 4I99C 4S0HB 5EGOA 2R7XA 4PDKA 4RM2A 2CQ7A 1UHWA 2WA0A 3I3LA 3CCRI 3K70C 2XB5A 2QF7A 5E1ZB 2HDCA 1U3EM 4DOZA 4LK0F 3S15J 3M3YJ 4X0GA 4LG0B 1R6RA 1Y8RB 2FSWA 1E17A 5GPCA 3TQNA 4BE0A 2EILH 4ABZA 2QZ8A 5FLVA 3FBNB 1ZLKA 4BACA 3KE2A 3Q3SA 4S05A 3OOPA 2PBIA 1OPCA 2GAUA 3HUGA 4NQWB 5JLXA 3QPTA 1FPQA 2V26A 1UG0A 2LRDA 1BN5A 2VI6A 1D0YA 5DUKA 2VE8A 2CW7A 2HQRA 1XPXA 4FCYA 2CV1A 1IRZA 2NVYJ 4B3AA 3IV5A 2DMQA 5K7FA 3ECOA 3HOTA 3VYUB 1X3WB 2R7SA 1QQIA 1CF7A 3SDGA 2A6TA 2AQFA 4H4KC 4CICA 3EUHC 3ABKH 3VYRB 2X1CA 4PGHA 1BOBA 1WI9A 2V79A 5HODA 3J81Z 3KZYA 3I54A 5D5XB 2VIXA 4IHTA 2VOOA 3V4GA 3K4CA 2P6TA 2O8XA 4RGSA 2HOAA 2LYCA 2JSPA 1FEXA 2OD5A 1LNWA 4PSXA 2JA8J 2R93J 1M1EB 1JUMA 5F04A 3HGGA 1WJBA 2E71A 4YFXF 3LSHA 4HLYA 2BEOA 3CMAI 3HHHA 3RKQA 3OYGA 1QRYA 1HCRA 5TRDA 2MW8A 3FM3A 2B63J 2DTZA 4U0VA 2IW5A 4AYBA 2TDXA 2KIUA 2WAEA 3WGIA 3N4MA 3GEZA 2YS9A 2A68F 2DODA 3TL4X 2HS5A 5AIQA 4Y15A 4CGZA 5KHDA 3MZYA 3TBIA 3VDXA 1Z91A 3HOUJ 4ZDLA 4PJ0C 3OYHA 1ZRFA 3CP8A 3K4NA 1MJAA 5DTDA 5FD6A 1ZN2A 2VC0A 1IRGA 4RA2A 1TL8A 4UV9A 2R5YB 3SZGA 4EJTA 4OAYA 2Q2EA 3SXYA 2LF8A 3LOCA 5CPRB 3TGNA 4UY8I 2F5DA 2N8GA 1D5VA 3M4OJ 4RAFA 1JTXA 1ZGJA 1S72I 2W82A 2DMTA 1JT0A 2VT3A 3FM5A 4BS9A 2G0EA 4RMNA 2DA7A 4A3LJ 4C2UA 1P7IA 2DLLA 4U7BA 2ISZA 2COBA 3HOVJ 1SD7A 2EFOA 1WJ5A 2KL4A 1UELB 2X85A 2F5EA 1QHGA 4L5IA 1K7AA 2JWTA 2MGQA 3OL3A 1LFBA 3S2WA 2LH9A 2ZKZA 1SMYF 2WAFA 2M7BA 2E1OA 2GLOA 3GX4X 5TISC 1FBSA 3CCVI 2HXIA 4IRHA 3GTLJ 2DN0A 5E1WA 4F91B 1Z3YA 3N97A 3HIFA 1FBUA 1EJ9A 1EH6A 2BY3A 1KZHA 5HOOA 4YEJA 3DBRB 4KISA 2V6CA 4XRMA 2CFOA 2DAOA 3ZOBA 1FIPA 3TOAA 2QLZA 1G8XA 2QKLB 4C2MJ 3EUHA 2HVRA 1B1BA 1TWAJ 2OUMA 4HLXA 4JQFA 1A04A 1I39A 1Y6IA 4LG0A 4ENKA 4EJOA 3BG7A 3D5SC 2F4OB 3K7AJ 1HW1A 1HXDA 5JHFA 1K78B 2QWWA 3H5AA 3HKZA 3KEQA 1BM9A 4KDPA 3PIPF 1S6LA 3CF2A 2DA5A 2QQAA 1X2MA 1MBKA 2XV4S 3BG6A 3I4PA 3I4NJ 2FQ3A 4QPOA 5H2FC 1QA6A 2QQ9A 1WWXA 5FLXK 3PQKA 3PO2J 3F23A 4A12A 3JAMZ 5DYMA 3ZQIA 4HF2A 3A2KA 3DP7A 3BR1A 2L7KA 2EWNA 3E6MA 2IEKA 2ELHA 2HDDA 2Y9ZA 4IRGA 2P4WA 5JHUA 4XOPA 2MC4A 3ASNH 4HQEA 4BEHB 1YW7A 2R7VA 1P7JA 3F22A 1ZR2A 1RETA 4CUGA 1OR7A 2XVCA 3NEUA 1FOKA 1W36C 4G6DA 4XONA 2DA3A 4B4CA 1W5TA 4R1HA 4Q48A 4WXHA 3NRVA 1XD7A 2Y9YA 2IGNA 4EQQA 3E6BA 4XR6A 3RDIA 4JX5A 4Y3OA 2LFBA 1G59A 2V1NA 2VBZA 2EZLA 5CVJA 4RM3A 4ENNA 3GCMA 2V1DA 1KYZA 1Y1VJ 4PGGA 5J1UA 2KHMA 3S93A 2M1BA 2PI0A 2XAJA 1FIAA 2ZXIA 2LP0A 3PSIA 3QPLA 1ACIA 2Y75A 3H9JA 3K4LA 3JREA 3GYHX 5IPAA 2L9NA 2DA4A 2W7NA 2RVCA 2CV0A 2EJRA 2K9QA 3K2AA 4BE1A 3OYDA 4IOCF 1T0FA 3ELKA 1USTA 5J8CA 1A36A 2VJ4A 4HBLA 3DBHB 2R5YA 1XGSA 2IVMA 2K02A 2F5VA 2LF7A 3S1NJ 2XB0X 5BPIA 4AUXA 3ABLH 4A3EJ 4UUVA 1P4WA 4GYGA 3I0TA 2E5ZA 1DP7P 2VB6A 3MKZA 4XK4A 1R1VA 2EFNA 3BJ6A 2ZXWH 3AKZA 1PVEA 3K1NA 4HW0A 5IYBJ 5FRNA 2DMNA 3WTSC 4LGWA 2FD5A 5HDKA 4RB1A 4II3A 5EZGA 3SDBA 1Y0NA 3VSKA 1YTYA 5CVUA 2IJLA 2MH2A 2D1HA 5E18F 1WCMJ 1W0TA 3CO7C 2DOFA 1XDUA 3TP0A 2IS4A 5M3FJ 2XAQA 3RKXA 2P81A 3KP3A 2Y2ZA 1KU7A 3OYLA 2G7HA 5TGTA 1S29A 2XSDC 2QGUA 2FUG2 3FBIB 1EF4A 1MMSA 5BNGA 3E7LA 3I9V2 5D5UB 2ZJPF 1ETOA 4F55A 1JJ6C 1S3JA 2I5UA 3LQQA 1X2NA 3GWZA 4PJJA 2IS2A 2BOLA 1J2XA 2YPRA 3I5UA 1SD4A 2IA0A 1WRJA 4TV7A 4NNJA 3Q9SA 1TLHB 4WCGA 2UXXA 4ZJZA 2K27A 3MFKA 1O3TA 2H6CA 4IZZA 4UB6C 2CQQA 1K78A 2CUEA 4JK1X 4AM3A 2VOPA 4KFCA 2M45A 3CCJI 3BWGA 3HDDA 1W36D 1DU0A 3HEFA 5D4RA 3K9TA 1ODDA 3FHNA 4GCVA 4M3EA 1LVAA 4EGZA 4Y4RA 1KU2A 1NG6A 2XPWA 3CZ6A 2LMDA 1FZPB 4P55A 1I50J 1FP2A 4R79A 2E7WA 3OL4A 4Y13A 1YIJI 1XMKA 2KLOA 5FLXZ 2MYSA 3IWFA 2ID6A 1YJ9I 2J5OA 4B44A 4EMSA 1Z7LA 2XKOA 3UR3C 4HZFA 4PZJA 1HSJA 1TWCJ 2ECBA 4D7NA 1E3HA 2EZKA 1Y0UA 3GTOJ 2IA1A 2OA4A 3JTHA 2VN2A 1VQ6I 2IXSA 4EM0B 2K9MA 2HZDA 1D3YA 4B8XA 3CD6I 2JSCA 5LEJA 3OYEA 1G6NA 5DM7F 1MBHA 5D8LB 4BQQA 1DPUA 3NQOA 2GOXB 5LHHA 4BJTA 4ASNA 2UUZA 2UZKA 1LVKA 2KIQA 4S04A 3OYIA 2VLAA 4CZZA 2JRMA 3I71A 4J00A 4XKCA 2BHYA 4EJVA 1U9OA 4DBRA 4ZC3A 1XMXA 4XSZF 1F9NA 1Y56A 3P9IA 3RKYA 1GT0C 2KIFA 3CMMA 2JZYA 2BE5F 1TBXA 3MQ0A 1XGOA 4UUTA 3AL0C 1V5FA 4FISA 1BR4A 1W5SA 2W24A 4AYBN 4IX7A 2EV0A 2ISYA 5C3EJ 2VKEA 1MBEA 3IUOA 1QU3A 4M6YA 5CQEA 2DFHA 3I58A 3RKWA 1VFCA 3BCAA 2X51A 4IQJA 3BR2A 2RGVA 4RAZA 5JVGF 2HI3A 3HZJA 3A1YA 3WTXC 2KP6A 1YRNB 4DIQA 3F8NA 5E3LA 1WJCA 4G7HF 1JT6A 4N4OB 1B6AA 2L4MA 2GA2A 2RNGA 2XIGA 3VYTB 3ERMA 2FXAA 4Q4ZF 2M9HA 3FXMA 3JRGA 2EIJH 2VASA 1J59A 3U1DA 1IO2A 4R8HA 4ZDOA 2K40A 1W4MA 1IJWC 4AVPA 2ZSIB 3CJTB 1WGXA 4YIIA 3FXQA 1FWZA 3BP8A 1GUUA 3DTIA 1O7FA 4DBQA 1GLNA 1WFXA 2KT0A 1OCOH 2AHQA 1D1BA 4BXUA 5HLHA 1LKXA 2UXNA 4EJWA 1Z9CA 4DYCA 5L3BA 1Z1DA 4A3BJ 1HSTA 1I3QJ 5ICEA 4IVNA 1KGSA 2VQHA 5LGNA 4G6TB 3TDUC 2DMPA 3MD2A 3AG3H 1ERDA 2ME0A 2LD5A 3J81K 4BHCA 1U8RA 4HX8A 3KYLA 3KP6A 2W25A 3OS0A 1V4RA 4MHGA 5IOYA 3F9KA 1B72B 2DT6A 2CO5A 2E1MC 3IH3A 2GZWA 5FB2A 4BXFA 3JW4A 4ZYHA 5KNLA 3HTSB 1K83J 3DKXA 4A0ZA 3BDDA 4KIBA 3FHZA 1N77A 4GXOA 2HPMA 3PSFA 4WXCA 4D7MA 3F8MA 1X1BA 1N25A 2CG4A 5HS8A 4UUSA 4UVBA 2A3SA 4Q47A 1ETKA 4PJNA 2JA6J 4KUMA 2DFEA 3WE2A 5GAGJ 4F93B 3RQIA 4GDFA 4HDUA 3LSMA 2M30A 1LFPA 1TT0A 3C1DA 4HQMA 3PO3J 3KZIC 5CYVA 3V8KA 2Z33A 3TW6A 1MMDA 3OMYA 2F48A 5EF6A 2XPUA 2HOEA 2XPVA 3QPHA 2XAUA 4E4HA 3OYBA 3BZ6A 4CHUA 1D0XA 4M71A 3I53A 2MD0A 3EUAA 2KKOA 4WWCA 2FBKA 3DV8A 1FX7A 2D2WA 3ABMH 3G3ZA 4A3MJ 3OSFA 4P1WA 1QPMA 1G4DA 2EH3A 1F36A 1FTZA 2KRHA 4MEYF 4CO8A 5GAHJ 2B9SA 3U1KA 1IN5A 3RYPA 2Y0MA 3F6OA 4V2FA 1VZ0A 3H1CA 3CDHA 3NAUA 1TTYA 2ZMEB 5JFRA 2HPIA 3JRBA 2K3FA 2PMUA 4OIQF 3GUDA 3E97A 3ONQA 2A5WA 3W2AA 3ASOH 5EDNA 4J19A 3JRHA 3CMYA 4M3DA 1IXRC 1SFXA 5IYCJ 2A07F 1BJAA 2R3SA 3ZQFA 3E1SA 4L0ZB 3K0LA 1NK2P 3REOA 1K61A 1HLVA 2VQCA 1FYMA 2RC4A 4IRIA 3L00A 4OIRF 5J6XA 4MNUA 2Q1ZB 1HF0A 3GFMA 4UVCA 4P96A 4Z6YA 1YRNA 1BW5A 4BL0B 2H1KA 5DS9A 4CCMA 3K4MA 1IRXA 2LREA 3MMYB 3L2UA 1ZRCA 2DT7B 5HLTA 2CMPA 4F52A 1VQ4I 1TZLA 4A5MA 2ZMEC 3LA7A 1X4OA 4IEJA 2FF4A 4IHYA 1TQPA 1YX5A 3VWBA 2OCEA 1OCCH 3FK6A 1MD0A 4E6KG 2X0LA 3A02A 3KLNA 2NVUB 4RB0A 5F08A 4GO1A 4ZYGA 1T39A 2WBMA 1IAWA 5D5VB 4NUBA 3ZQQA 3CUQC 2JA7J 4XBFA 1AWCA 4E7IA 2EK5A 5ICGA 5LHGA 2GWRA 5FKOA 1BJZA 3AG1H 2GXGA 5CKTA 3BQZA 3D0SA 4C3JJ 4BYYA 1WKMA 1PP7U 4DW6A 3IL2A 2FRHA 3I59A 3ERED 2BY2A 3IAS2 3GFJA 2LOOA 2XHKA 4I0AA 2DA6A 2PMZA 3J80Z 1EH7A 2IA2A 4PJLA 1P6RA 3DU5A 1VQOI 1FOWA 2L7FP 1SFEA 2LTPA 3IAM2 2MSYA 2VQGA 4CZCA 3JAMK 1G3YA 3QYFA 1PUEE 1VQNI 4A3GJ 3JSOA 5FFXA 1RNLA 4KIFA 3CF5F 1JKOC 2VXZA 1RKWA 3ZQCA 1AKHB 2DTRA 2IRFG 4BDZA 2V9VA 1B72A 2NRAC 3D5LA 3KEOA 1H8AC 3FIWA 3WHBA 4E7HA 1MNDA 2VODA 4I09A 3EQLF 3RCOA 4A3DJ 1X1CA 4N9HA 3RIRA 2XROA 4BBSJ 4ZYEA 2O0YA 2L3DA 3LSTA 3S16J 5BPDA 2GA1A 5E3MA 2BYVE 4XQFA 1TWFJ 4IL6C 3CCUI 2STTA 3QU6A 3RSNA 2DU9A 5HDNA 3LA3A 3VEPA 1IDZA 1JI8A 3BY6A 5E1XA 1ORKA 1HKQA 2JJ7A 4HF1A 3FXKA 1RC9A 5ICFA 2STWA 1OCRH 4G6QA 4L9NA 5CVIA 2OAZA 3HC7A 2CYYA 3IH2A 1NG7A 2VJJA 3OYJA 2E5NA 2DI3A 2ZXJA 2QYOA 4I01A 1YJNI 1LQ1A 2F5CA 5EEHA 1AU7A 2IS1A 1IN8A 1MBGA 1SVOA 3MAJA 1ZLJA 3P9CA 4LJZF 2LC2A 4FHTA 4XRSA 2CUJA 4JBAA 5LGTA 3L1PA 1K4TA 1A6IA 2CW0F 2Q8KA 1I6HJ 2DBBA 2FX0A 2LG4A 2FNAA 1ZR4A 3OY9A 2QUFA 4JOMA 4MQ9F 3U2RA 3K6GA 4E7JA 1G3TA 3S2HJ 5IP9J 2NNNA 4ITVA 2ZMEA 3CJQB 1YOVB 1IW7F 3H36A 1MJ9A 2RDPA 5D6FA 3J7AY 1LEAA 1W1WE 3W3CA 2R7UA 2OQGA 2XSJC 3O8GA 3CLQA 4ZDPA 1G3SA 4CYDA 2O3FA 5K5RA 5FKLA 3K70D 1BOAA 2NVQJ 2GIVA 2OPTA 2VBXA 4EATA 3LAJA 5M5XJ 2JPCA 4Z2YA 2VE9A 3GLXA 2A6EF 4KA4A 1VQ5I 2LSOA 3HSRA 4KJZA 1TQMA 1R23A 2YX4A 3E3VA 2TCTA 2AXLA 4C2TA 3M9AA 3KYDB 1W7PA 3RTRA 2NYXA 2FEZA 1QZEA 1SD5A 5BMZA 5LLQA 4A3KJ 2W00A 3GTPJ 4NBQA 1JUPA 4XKWA 3HL2A 1JKRC 2VJIA 1OYWA 2JUCA 3ZCOA 2DPDA 2ZNYA 1PP8F 2GXBA 2O5RA 1R5ID 1X1DA 2HU9A 2MLKA 3VSLA 2VC1A 2DOEA 3DPTA 2O61A 2DA2A 3GO5A 3V8LA 4M3FA 1UG2A 3CC2I 3BR5A 3P5JA 1ZARA 2AS5F 4BH9A 4AIDA 1WVRA 4CCKA 3RPUD 4E70A 3S1MJ 3RPUA 4A3FJ 4LB5A 2NVXJ 3ZXSA 4HX4A 1V5EA 3PFIA 2XC7A 2NNYA 1I1SA 4CH7A 4IHWA 3FXUA 1X19A 3WG7H 1DP3A 1IUFA 2CJJA 2CUFA 1Z67A 5F64A 2H27A 3QU3A 4ESFA 4B43A 3N05A 1AKHA 2XAFA 3MN2A 3HSFA 3TO9A 2WC2A 5BOXA 2MA3A 2DYSH 1B59A 4CCLA 4M3BA 2O6GE 2E35A 2IS6A 1HKSA 2A5YB 1A5JA 1HW5A 3LFKA 3V42A 1QGPA 1ON2A 3KP5A 5IT3A 5J1RA 2DMUA 3UKGA 2WADA 4O3MA 1T38A 1FMVA 4I76A 3ZMTA 4J01A 4KMFA 4EM1A 1MJBA 4MO7A 3LSKA 3TO6A 4BGDA 2A6HF 5B1BH 4YFNF 3HRTA 5HDGA 1IV6A 3OIPA 4RAYA 2DQRA 3JRIA 5E3NA 4V19K 3SQNA 4V2GA 1IRFA 1JXSA 2RQPA 2MBFA 4I7HA 4Y17A 4BQNA 1IN7A 4XORA 3FKIJ 2CS3A 3W2WA 4RGRA 4A2UA 1Z77A 5HS9A 2DCEA 3O8HA 2P8TA 1GVJA 2M2EA 2Y30A 3OIQA 3JRAA 2DDBA 4M9XA 1B8IB 1R36A 2DFIA 1BIBA 2EA2A 2ESNA 3RYRA 3TDZC 1O3QA 3AG2H 2JVHA 3OYCA 5HNHA 1RI7A 3HPGA 4ENMA 4RBOA 4E7LA 2R7QA 3DEUA 5E20A 3G6EI 2NVTJ 5AONA 2DK8A 1EV7A 4WF2A 2FA5A 2KRCA 3Q0WA 3RJPA 2VPRA 2XF6A 2Z16A 3HPHA 3BG9A 2EFWA 1R1UA 4A6DA 1A35A 2F4IA 2KPMA 4OMZA 1XC5A 4F92B 3VPRA 1LPQA 5DM6F 3WTYC 2O9LA 2KRFA 4HPQA 1XDSA 2Y31A 1T8IA 3PM1A 1AA7A 3BROA 2MLGA 3DEEA 3BQYA 4G8XA 5LGUA 3QQAA 1VI0A 4PCQA 1XCBA 3TKYA 2HKOA 3HRUA 2TRTA 4U7DA 3MKLA 1MMGA 3HGYA 1ULYA 3S3OA 5K5OA 2IT0A 4M72A 2L01A 1APLC 1I27A 4BQAA 1ZG5A 3IHUA 4E7SA 4L5EA 3C2GA 3FMSA 1OYYA 3J7ZI 1PJRA 2ZXHA 4A3IJ 3G4SI 2HFHA 5F27A 5ILVA 4KMUX 2EFQA 2GM4A 5J4VA 3F6VA 2XGDA 1EA3A 2L9SA 3C2HA 1ZKGA 2CFXA 3SYTA 3CMEI 1R7JA 1SFOJ 2BGCA 3L9FA 2IGMA 2CQKA 5LD2C 1U0JA 3HSEA 1UAAA 3GLLA 1UZCA 2COMA 1SANA 3RQ4A 3SJMA 5KK1A 3GTQJ 3KETA 4M6VA 3V7SA 4B3XA 5L3FA 4OIOF 5A2QZ 3W6KB 4A0XA 1REPC 2KIMA 1U5TC 2HTJA 3ZMSA 4ESJA 1NK3P 1ZGWA 1MNEA 3JRCA 2LBFB 3GTGJ 3CO6C 2OJED 3WG9A 4XM3A 3FK7A 2ZB9A 2M3AA 2V6EA 3L2CA 2M4KA 2HEOA 2L0KA 1BI1A 2HQ5A 3BCBA 3K69A 4O5VA 4N9IA 3JCUC 1LFUP 3C3WA 3CUOA 4BHPA 2FBHA 1MZBA 2BXYA 4ON0A 2PMZN 5EEGA 3B6AA 4BQOA 3WE3A 2B0LA 1MH3A 3WTTC 1ITYA 2B7EA 2EINH 4MIMA 2JT1A 3C7JA 5KAFC 1SVLA 3B73A 4KIGA 3LAPA 3MZHA 4UUSB 4U88A 3ECHA 1XS9A 1HKTA 3BJOA 1G2HA 4AIHA 1WZ2A 3F21A 1X1AA 4PUSA 4MTEA 3BTJA 2Z2SB 3FMRA 4EGYA 4HAMA 4JX6A 1Z6RA 2R7ZJ 4OOIA 4IPAA 4CCOA 1FYLA 5GTHC 1DPRA 4JP0A 4LLLA 2VBYA 3L2RA 4LOCA 3ROUA 3F8BA 4XL9A 2EA4A 3GF2A 3AL0B 1W5CC 2QQ8A 3AG4H 3NWSA 2F5FA 3QYBA 3R4KA 3T8RA 1XX5A 2CSOA 5F0HA 3H92A 1QZZA 5CVRA 4BBRJ 2DDAA 3JRDA 3GZ6A 1YHQI 1LEBA 3FXLA 1WH7A 3KZZA 2K5CA 5ILUA 1O7LA 2EB7A 4DQ2A 1U9NA 2KZGA 4M9ZA 2VXDA 3RZDJ 3RZOJ 1SVMA 2PX9A 1J7KA 3ZQ7A 3BG5A 4RGUA 3M8JA 1IXCA 3PUBA 2IAIA 2M34A 3T1BA 1FSEA 2JTVA 5FROA 2R0QC 5H6QA 1O4XA 1H0MA 4HX7A 3MEXA 3COAC 1TWGJ 1B8IA 4QPQA 2M4GA 4BJ6C 2DA1A 4MFDA 3JTGA 2R7DA 5LRSA 4AIKA 1HQCA 2OBPA 3A03A 2P0WA 5HNFA 2H8RA 1STZA 1LE8B 2R7RA 4G7OF 5B1AH 1Z7UA 3DLAA 4LK1F 1BC8C 4MTDA 5D4SA 3K10A 2DW4A 1HC8A 1HDDC 1L0OC 1Z05A 4HSRA 3CP2A 4D5FA 3JSPA 3TW7A 1XSDA 2L4AA 5CQGA 1VQ8I 1F43A 3H9QA 4BAYA 4LMYA 5IT9Z 2X1DA 1QVTA 1J0RA 1ONVA 4ZTJA 1V3FA 3K2ZA 4G12A 3ZMZA 2J5PA 5FLMJ 1BI2A 3HJEA 2FOWA 4AD9A 4U0YA 1BC7C 4X6AJ 1Y8QB 3A0HC 4AWXB 4FX0A 4F7ZA 2P5KA 4CCNA 2P7CB 3OIOA 1R00A 3VODA 3ZMDA 4RLQA 1WJDA 3HOXJ 3TP3A 2LNBA 3IKTA 2E34A 1X3ZB 2IPQX 5KCMA 1TNSA 3GTJJ 2W84A 2HVSA 2E1MB 3H3VK 1RUOA 2P6SA 4OMYA 1B4AA 4ESBA 3J80K 3PIOF 5M5WJ 1H88C 3KP2A 3I59B 3E5UA 3LSJA 3NWTA 1MKMA 1D0ZA 3VOEA 2WAQN 3I4MJ 1S7EA 3S14J 3H0GJ 1YI2I 1X1PA 3JRFA 3WU2C 5GPAA 5D6EA 1IF1A 2E1CA 1AHDP 2FJ1A 2FQ4A 2XF5A 9ANTA 1R4NB 2E19A 1NH3A 4KN7X 2LBFA 3DEWA 4DGWB 5IOZA 4CDGA 3H3ZA 3E6DA 3O6BB 3SEZA 3ZQHA 1PUFB 3H3UA 3U9GA 2I8DA 4P9UA 3OS1A 3PL8A 2QA4I 2D45A 2OCCH 3KP7A 3OR2C 4EV0A 1H89C 1V55H 2DPUA 2K3PA 1ZTRA 5GADJ 2Z5UA 3BR0A 3K4BA 4B48A 2OC6A 3AFHA 3GXOA 5F0FA 1R71A 1YFHA 2ELKA 3GVAA 2A61A 4YIFA 2C6YA 1WQ2A 5GAEJ 2FBIA 1J75A 5DUIA 5EG0A 1XN7A 2HYGD 5HLGA 1V5GA 2YUSA 2QSGX 1ON1A 4L5JA 3H0DA 1VQ7I 2XUBA 2OF7A 3CJNA 1KONA 1T98A 4M9SA 2IP2A 2HXOA 3LSPA 1YIOA 1LUJB 1OCTC 2LY9A 1K6YA 5HLIA 3LQRA 1OYIA 3R6SA 3ULQB 1ETYA 1DDNA 2ESHA 4WX9A 3QODA 2ELJA 2E2JJ 1ENHA 3BOQA 2E60A 3KLOA 5ICCA 5J4YA 4IHVA 4DYQA 4YRVA 3MCZA 3BPXA 1WH5A 2V1XA 1JKPC 3DPUA 1YJWI 1BR1A 3L7WA 3MKYB 3H5RA 1SD6A 1H9GA 3ZP5A 5M3MJ 1UFMA 2PQ8A 2BZTA 2X9DA 3ZPLA 3DCFA 2R7WA 1P92A 2CU7A 2ZJRF 2HNHA 3QYEA 4I6ZA 2X6YA 3CTAA 1I1GA 2QM3A 2ZSHB 3IWZA 5C4XJ 1FTTA 1YX3A 3CCYA 4MFEA 1T2KA 1SEUA 3FXRA 1DGWY 3Q0VA 1PYVA 1LDKB 1QNTA 2M0MA 3PNTA 2XRLA 1MDMA 1S5LC 4FQGA 2DYRH 1TW3A 2G7UA 4I02A 4N0BA 3K1MA 4BDYA 1LE8A 3J7AO 2VKDA 4QSHA 3CUQB 4XKVA 1ETXA 4QTRA 5J47A 5E3OA 2KJCA 5FFZA 1FNNA 4YELA 5KVRA 3WTZA 4HNUA 3B02A 1GDTA 1WJAA 2JUGA 3DU6A 2W57A 5IY5H 4RB2C 1NHAA 1G3WA 2DJNA 1S9HA 2HR3A 2JRTA 3DFGA 4F3QA 1TP4A 1E3PA 1GXPA 4GGGA 1S7AA 4IOAF 1EKEA 3I64A 5E17F 2DK5A 2ZNZA 2CGPA 1W7PB 4O6JA 3GFLA 1E0EA 3MWMA 1F4KA 3D5RC 2K7LA 4EJUA 3FKJA 1ETWA 2Z99A 3DQVC 1ZG3A 3E5XA 2KDOA 3G2BA 3H9GA 2K9NA 1MW7A 3L09A 2DFFA 3OYKA 1FOXA 1ZYRF 3KCCA 5B3SH 2LVSA 2KMUA 4UHTA 1VQPI 3ZR8X 2GQQA 3ZGKA 1Q1HA 3E6CC 2X6WA 4XMYA 4PJMA 1R58A 4BJ5C 1YO5C 4BNCA 2O8KA 4PK4A 1P9QC 4IXAA 2F4MB 2XGXA 3K4KA 1T6SA 4G94A 3CDLA 1RZ4A 4UVAA 1O3SA 3WTVC 3ABUA 3E5QA 2WV1A 1S8NA 3F8FA 2JMWA 3GBGA 3LMMA 4ZYDA 4Y7NJ 2ACJA 3TMOA 4B09A 4L18B 1T08B 1D8JA 1SMTA 1Q1VA 2R5ZB 1OLTA 4XLFA 3O3KA 2KDZA 2BBYA 2DXIA 2ZFWA 1PUFA 4KYWA 3FXJA 5EZHA 3HXLA 2D1VA 1WJFA 3GZNB 1Z3XA 1XSVA 3DKYA 2OTJI 2ZO4A 2Y0SA 2YU9J 1ZELA 1XCVA 1U6GA 2MG4A 5ED4A 4HNTA 1MBFA 1N75A 2VT2A 1DQUA 1BIAA 4NDLA 3QOEA 2V4JC 2H1LA 4LLGF 4CXFA 1IXSB 4C9YA 1R1TA 3B6CA 2HOSA 3CLOA 2JA5J 4NC8A 5JVTA 3ML6A 1MMNA 1XSXA 3LSGA 4OWRB 2OU2A 1RPWA 2NOJB 4KT5C 3WU0A 5ERIA 1CQTA 1TNTA 1QHHD 3ZQGA 4RAGA 3OWTA 2G9WA 2CUZA 5LRRA 1R5HA 3QOPA 4IF4A 5DEQA 4K2EA 2F2EA 2PG4A 4OAZA 3KPHA 3M8EA 3RPQA 2XAHA 6PAXA 3HG9A 3WTUC 1I3AA 4EEFG 2K85A 4HRIA 1FLIA 4JX4A 4GFBA 3ZMUA 4PSWA 4CSWA 2HYFA 3IC7A 3ISPA 3FISA 2VONA 2EFPA 5LHIA 4L9JA 1D1AA 4LLNA 3G1MA 5JI6A 2L9RA 4MLOA 4U0WA 2XGCA 2ZJ2A 1YITI 1MMAA 3A01A 2K86A 4RGXA 3ZQLA 1T56A 2W85A 3E0JB 4I2OA 4HG2A 2KZVA 3CESA 5FGMA 5KAIC 4LD5A 1KYWA 3T0YA 4AU7A 1U8BA 2L5QA 2PJRB 1JHFA 3CUQA 3QWLA 3BTLA 2PLYA 2W48A 1OR7C 5D8KB 5D5WB 1I6XA 1DGRM 2WB1A 1ZAOA 1LB2A 4FASD 3QAHA 5J40A 4OU0A 5LFAA 3F72A 3PNVA 3HOZJ 1FSHA 1WJEA 3G1OA 3J7YJ 3VFZA 1QZYA 1J09A 4ZH4F 5FJ8J 1VQ9I 5M5YJ 1DU6A 4RDUA 2MFZA 1W7PD 3A4CA 3OSGA 2H94A 5AIPA 1T95A 1ZGAA 3DPLC 4KICA 1VQKI 2WAQA 4BHBA 1IN4A 4MQVA 3KFWX 2R7OA 2OTLI 3TO7A 4IQ4A 4C3HJ 5A2QK 3EUKL 1DUXC 3FMQA 3GZ5A 4HV6A 2CQNA 2XKPA 1YG2A 4B47A 2BY1A 3P7NA 2M8GX 2HDWA 5E79C 3IRRA 3S3NA 2QCOA 5J1YA 2ICWG 5HVQC 3W6JB 1JKQC 1JJ8C 1SFKA 1YS6A 2MABA 3HOYJ 3DF8A 2E1NA 4RB3C 1XGMA 5LBQA 5FO5A 4XN3A 2GBYA 1T0FC 3GTMJ 3IKVA 1B9MA 1TQIA 1H9TA 4AIJA 1OISA 2FNPA 2IGOA 4NHJA 2L7ZA 1XG1A 1QPIA 3OYFA 4M73A 4ZZDA 2EQRA 3KEYA 2M8EA 1U2WA 1XB4A 3HHGA 3CCMI 1PDNC 4QIWN 4MGRA 3ZMVA 2R5ZA 3QRFF 1WSUA 1IUYA 5GP9A 1F1ZA 1S7OA 2V9PA 4BUPA 4BE2A 2R92J 1ZQ3P 1UJ8A 1RKTA 4DYRA 2HWVA 1JTYA 3SFIA 1JUSA 2XRNA 2UV1A 2NS7A 1NTCA 1VF9A 3LWFA 1TW2A 1TWHJ 3SHFA 3WGGA 4FTHA 4Y52J 2NS0A 4NQWA 3S1QJ 1JHHA 2R7TA 1XGNA 3V7RA 2RQQA 3EYIA 2ECCA 3H5NA 1LDJA 2K9LA 2AO9A 1OFCX 4A5NA 4DZJA 2W4SA 4CA0A 3BJAA 1F5TA 3CCLI 2EPFA 4ZYAA 3FWEA 5E8IA 2ZCWA 1RUNA 5DV5A 3HB9A 5B5EC 2LK2A 2JA2A 3TEDA 2PN6A 3P9KA 1YYVA 4G9YA 1FBQA 2MD5A 1UHMA 5FKMA 4NC6A 3K1PA 1GV2A 3HM5A 2PJPA 2DOAA 3PUFA 3VB2A 1SAXA 4A3CJ 5EEAA 4LIVA 5CJ9A 2HZTA 2LLKA 1WHUA 4C30A 3CC4I 3R0JA 2RV8A 4HA8A 2CW8A 4CCJA 5J8FA 3WU1B 1RRJA 4A69C 2K4JA 1E2XA 3QPSA 2HKXA 1KA8A 2R7FA 4LFUA 2VL8A 1GXQA 5IT9K 1ZK8A 2HVQA 3BLYA 2KFDA 4E7ZA 3LSIA 5DCMB 1Y39A 4P5OA 2RAEA 3HYIA 4XLEA 2EIKH 3C2BA 2QSHX 1YS7A 3PFYA 1N78A 4UB8C 2Q0OA 2EV6A 2IBDA 4A93J 3C18A 1FP1D 3FXOA 2X6XA 3CQZJ 4HF0A 2Y69H 1YQAA 1HDPA 3G1LA
chains in the Genus database with same CATH topology
4ZDLA 3CP2A 2PJRA 4LG3A 3OYHA 2GOMA 3CP8A 3K4NA 2LY2A 5CQGA 3HOSA 3H9QA 3E1SA 2X1DA 2VQCA 4ZTJA 4PFOA 3SZGA 2BVLA 2ZFUA 1Z21A 2Q1ZB 4OAYA 5CPRB 3DTEA 4BL0B 4LIUA 4CCMA 3K4MA 1IRXA 2LREA 3MMYB 3L2UA 3W2VA 4CCNA 2DT7B 2IGKA 2W82A 2CMPA 5HLTA 4RLQA 1WJDA 4F52A 1TZLA 1X4OA 4BS9A 3OS2A 4RMNA 1YX5A 3VWBA 5KCMA 4C2UA 2LY1A 4U7BA 4E6KG 2HVSA 2E1MB 1WJ5A 2KL4A 1UELB 2X85A 3SEQA 1QHGA 2JVGA 2WBMA 4RLFA 3OL3A 3M1CA 2LH9A 2RREA 4NUBA 2WAFA 2M7BA 3ZQQA 3KX2A 4E7IA 3NWTA 3OYAA 3U21A 1D0ZA 5CKTA 4F91B 1Z3YA 5HOOA 4YEJA 4KISA 2CFOA 1G8XA 2QKLB 3IAS2 2VQLA 2LOOA 3FDYA 2HVRA 2XF5A 2PMZA 2OUMA 2UWMA 3S32A 4PJLA 3DU5A 2LBFA 4DGWB 4JQFA 4ANJA 1X4PA 4U87A 3IAM2 1Y6IA 2VQGA 3BG7A 4CZCA 3D5SC 3QYFA 3SEZA 5JHFA 3H5AA 3HKZA 2I8DA 3CF2A 3BG6A 2VXZA 3PL8A 3OS1A 1D1CA 3OR2C 4QPOA 4BDZA 2K3PA 4B48A 3K4BA 2OC6A 3AFHA 3D5LA 2V7FA 4E7HA 1MNDA 1V5GA 3RCOA 1X1CA 3H0DA 3IP4B 3A2KA 1KONA 2L7KA 3S8PA 2AQEA 4IKFA 4XQFA 1K6YA 4II2A 3RSNA 4XOPA 2MC4A 3QODA 2ELJA 1JI8A 4BEHB 2R7VA 2CV2A 2E60A 4CUGA 4XKBA 1W36C 4XONA 4YRVA 2X1EA 3HC7A 3OYJA 1NG7A 2VJJA 2E5NA 2OV7A 4FETA 4BEHA 3DPUA 1BR1A 3MKYB 3H5RA 2IS1A 4XLAA 2W1OA 2LC2A 2IGNA 2CUJA 3PNYA 2R7WA 4XR6A 4Y3OA 2HNHA 3QYEA 2X6YA 3EPZA 2ZSHB 2LG4A 1G59A 2V1NA 1YX3A 4RM3A 3OY9A 1DGWY 4JOMA 1PYVA 1LDKB 2KHMA 4AVZA 3S93A 3K6GA 4E7JA 2M0MA 3PNTA 2ZXIA 4ITVA 3CJQB 4DJAA 3PSIA 4BDYA 3H9JA 2VKDA 3K4LA 3BC8A 2BW3B 4XKVA 2DJIA 2L9NA 2W7NA 3PJRA 2CV0A 4YELA 3J7AY 4HNUA 1WJAA 1BR2A 2JUGA 3DU6A 3W3CA 4BE1A 3OYDA 2XSJC 2R7UA 1S9HA 4ZDPA 3OYNA 4F3QA 3K70D 3L2WA 2VJ4A 3LFUA 2L2OA 4EATA 2F5VA 3DTKA 4KJZA 4KITB 2E5ZA 4KT6A 2VB6A 1E0EA 3D5RC 3MKZA 3FKJA 3DQVC 3AKZA 4C2TA 2KQRA 2KDOA 3G2BA 3H9GA 5FRNA 1MW7A 3RTRA 3L2QA 3OYKA 2F6CA 4II3A 2W00A 3SDBA 3VSKA 2KMUA 4XKWA 3ZR8X 3HL2A 4GRIA 3ZGKA 2VJIA 2X6WA 4XMYA 4PJMA 4BJ5C 2IS4A 3ZCOA 1SAUA 2O5RA 4PK4A 1X1DA 1P9QC 2HU9A 3VSLA 3OYLA 4HSTA 3K4KA 5TGTA 3DPTA 2FUG2 3FBIB 4XLCA 1FMWA 1HA8A 3I9V2 4F55A 3GBGA 3LMMA 4PJJA 4CCKA 4D9JA 3RPUD 3TMOA 2IS2A 2BOLA 3ZXSA 4NNJA 3UNGC 1V5EA 4XN0A 4ZJZA 1OLTA 4XLFA 2XC7A 4CH7A 2WY7Q 3HUGB 3H35A 1X19A 4IZZA 2DXIA 1DP3A 3HXLA 4B43A 3N05A 1WJFA 1Z3XA 2VJ5A 1YE9A 3DKYA 1W36D 2Y0SA 4XNFA 3DWLE 1ZELA 3FHNA 4CCLA 4HNTA 1N75A 2IS6A 1DQUA 3OOUA 3LL7A 3V42A 3QOEA 4XLHA 4Y4RA 3OR1C 1NG6A 2R4GA 3CZ6A 2V4JC 2WY8Q 4C9YA 2WADA 3OL4A 4R79A 1FMVA 4J01A 2KLOA 4NC8A 3VYSB 2MYSA 2BVMA 2M7AA 3LSKA 4BGDA 4B44A 1MMNA 1Z7LA 3LSGA 3UR3C 4OWRB 2NOJB 4LITA 3OIPA 3K4JA 1QHHD 3OWTA 2IXSA 2K9MA 2HZDA 4BU2A 2CUZA 4E7KA 2XDVA 3OYEA 4OAZA 4BQNA 4XORA 4BQQA 4NC7A 3HG9A 2CS3A 2GOXB 3W2WA 4HRIA 4BJTA 2UUZA 2DCEA 4PSWA 1LVKA 2VKHA 4CSWA 3OIQA 3CJRB 2HQAA 3OYIA 2VLAA 3OYCA 2JVHA 4ZTFA 1D1AA 5HNHA 3HPGA 4Y33A 4E7LA 2Z1DA 2R7QA 4J00A 4MLOA 4XKCA 1MMAA 5FRMA 4DBRA 4ZC3A 2KRCA 1Y56A 3E0JB 2XF6A 2Z16A 3CMMA 3HPHA 2KZVA 3CESA 4HG2A 4N4NB 2F4IA 2KPMA 4PFPA 4F92B 3AL0C 4AU7A 1V5FA 1BR4A 4IX7A 4HPQA 2L5QA 2V9KA 2PJRB 1AA7A 3IUOA 2CH0A 1QU3A 2BW3A 5CQEA 3DEEA 4IQJA 3BCAA 2X51A 1OR7C 2VPLA 3L2VA 1DGRM 2WB1A 4FASD 2XF7A 3A1YA 1MMGA 5LFAA 3PNVA 3S3MA 2Q2EB 2KP6A 3S3OA 1WJEA 4DIQA 3MKWB 4D1QA 1J09A 2QKMB 2MFZA 4E7SA 1WJCA 3A4CA 3C2GA 4N4OB 1T95A 3DPLC 1PJRA 2RNGA 2WAQA 2ZXHA 3VYTB 2R7OA 2VASA 4IQ4A 4XOTA 3EUKL 4ZDOA 1EA3A 3OYMA 2L9SA 3C2HA 4HEA2 4B47A 3ZRGA 2ZSIB 3SYTA 2HDWA 3S3NA 2IGMA 5LD2C 1U0JA 5HVQC 3DTIA 1UAAA 4DBQA 1GLNA 1SFKA 3RQ4A 1WFXA 2MABA 1D1BA 2R7XA 1LKXA 4XN3A 1T0FC 4RM2A 2WA0A 3I3LA 4B3XA 3K70C 2IGOA 1MNEA 2VQHA 2LBFB 4DOZA 4G6TB 4XM3A 4X0GA 1R6RA 2M3AA 3OYFA 3MD2A 2V6EA 2M4KA 3KEYA 4BE0A 3BCBA 3FBNB 1ERDA 4BACA 4BE2A 4BUPA 4NQWB 3KYLA 2V26A 3OS0A 1UG0A 3F9KA 4BQOA 2DT6A 2LRDA 2E1MC 2UV1A 1D0YA 2CW7A 4BXFA 2CV1A 5KNLA 3DKXA 3HOTA 3VYUB 2R7SA 2HPMA 1N77A 2R7TA 3PSFA 2RQQA 3H5NA 2A6TA 2AQFA 4H4KC 1X1AA 3EUHC 1X1BA 4PUSA 2K9LA 3VYRB 2X1CA 1BOBA 2Z2SB 2W4SA 4PJNA 4CCOA 4CA0A 2VIXA 4F93B 4ZYAA 3L2RA 3K4CA 3LSMA 1LFPA 1TT0A 4XL9A 3AL0B 3NWSA 1MMDA 3OMYA 3QYBA 2JA2A 2LYCA 2JSPA 2XAUA 4E4HA 3OYBA 1D0XA 4PSXA 2DOAA 2K5CA 2MD0A 3EUAA 4LIVA 1WJBA 2VXDA 4C30A 3LSHA 4P1WA 3M8JA 3PUBA 3OYGA 5FROA 2CW8A 2KRHA 4CCJA 4AYBA 4QPQA 2M4GA 4BJ6C 2VL8A 2HVQA 2WAEA 1VZ0A 3BLYA 3LSIA 4E7ZA 4P5OA 3TL4X 4XLEA 2HPIA 2P0WA 5HNFA 3PFYA 1N78A 2R7RA 5KHDA 3DLAA 3ONQA 3K10A 2A5WA 2X6XA 3TBIA 3VDXA 3W2AA 4HSRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJB A;  3HPG A;  1K6Y A;  1WJE A;  1WJC A;  1WJD A;  1KON A;  3F9K A;  3HPH A;  1E0E A;  4F3Q A;  1MW7 A;  1WJA A;  1WJF A;  1LFP A; 
#chains in the Genus database with same CATH topology
 3SZT A;  4LG3 A;  4W97 A;  2PJR A;  5K7Z A;  5C4J J;  2GOM A;  3HOS A;  2LY2 A;  2V1U A;  1WPK A;  4P9F A;  2ZJQ F;  1X58 A;  5L3E A;  4QLC U;  4PFO A;  1U5T B;  2BVL A;  4UXN A;  2ZFU A;  1Z21 A;  3DTE A;  1L3L A;  3S17 J;  5TJJ A;  4LIU A;  1WI3 A;  2KJB A;  3HTU A;  5F1R A;  2EIM H;  3A0B C;  3W2V A;  3FX3 A;  1BA5 A;  2NS8 A;  2IGK A;  2LKS A;  4KN4 X;  3IH4 A;  1LJ9 A;  2A69 F;  2DO7 A;  1JGG A;  3OS2 A;  1IN6 A;  1YW9 A;  2VUM J;  2LY1 A;  2YX7 A;  1XTA A;  1IC8 A;  5DD4 A;  3BPV A;  2X48 A;  1C0W A;  1KQ8 A;  3SEQ A;  2H8W A;  5CLS A;  2JVG A;  4RLF A;  1FJL A;  1ZG1 A;  3M1C A;  1FOY A;  2RRE A;  3QP6 A;  5H6R A;  3CCS I;  2NAZ A;  5H20 A;  2K9S A;  3KX2 A;  4YIR X;  4MEX F;  1MH4 A;  3OYA A;  3U21 A;  5J3L A;  1HBX G;  3EYY A;  5F0C A;  1BBY A;  2BXZ A;  2BV6 A;  2CQX A;  4HV5 A;  4A3J J;  2PEX A;  4HOB A;  2ME6 A;  3WGH A;  1J5Y A;  2Z3Y A;  4FX4 A;  2VQL A;  4M3G A;  1R49 A;  1Y1W J;  3FDY A;  1CGP A;  4BKX A;  1GVD A;  1O3R A;  2UWM A;  3S32 A;  4ZZL A;  3PQJ A;  4ANJ A;  1X4P A;  3WOD F;  4U87 A;  3TOB A;  1KQ0 A;  4B1R A;  3X2Q H;  1E3O C;  5JLW A;  1OJL A;  5IP7 J;  3M1E A;  5EG0 B;  4EVI A;  1D1C A;  5LEK A;  1VQM I;  3LNQ A;  2M0C A;  2CRG A;  2QSF X;  3CDI A;  3LSR A;  1QO0 D;  2HGC A;  4QWQ A;  5DD8 A;  5F6F A;  2NXN B;  4BXX J;  2V7F A;  3BZC A;  5HS7 A;  4C3I J;  3I56 I;  4JYK A;  2NOG A;  3I55 I;  2MH9 A;  4HYE A;  5DCF A;  1K4S A;  1IZ1 A;  1R4M B;  4FE7 A;  3BZK A;  3BG3 A;  4AC0 A;  2RN7 A;  2XAG A;  4H0E A;  3MVP A;  5B66 C;  3IP4 B;  4D5C A;  3BT9 A;  2Y0S N;  1QVU A;  3S8P A;  2AQE A;  1OKR A;  3D1N I;  5K7H A;  3ZN0 A;  1P4X A;  4IKF A;  5ILS A;  3MZ8 A;  4II2 A;  1ZHF A;  1EH8 A;  2WV0 A;  2RKH A;  3V7C A;  2CV2 A;  3S2D J;  4XKB A;  4W1U A;  2DT5 A;  4CYC B;  1A31 A;  3ZN1 A;  1RR7 A;  2X1E A;  3KYC B;  3HRS A;  4IHX A;  2EZI A;  2OV7 A;  3WHC A;  1V54 H;  4FET A;  1ETV A;  4BEH A;  2YSR A;  2FOK A;  3ABT A;  4FE4 A;  3BR3 A;  2HQN A;  4XLA A;  1HOM A;  1GHC A;  4X1E A;  2W1O A;  1TC3 C;  1MGT A;  3PNY A;  1R5G A;  3EPZ A;  1MDM B;  2E2H J;  1ZRE A;  3O2P E;  4XIC A;  2QBY B;  1ZRD A;  4UV8 A;  4LB6 B;  3S1R J;  4G7Z F;  1X3U A;  4AVZ A;  2JQ7 A;  2L9V A;  2DQL A;  2L7M P;  5DCM A;  2YR2 A;  4EM2 A;  1USS A;  3IRQ A;  4DJA A;  2P5L C;  5EJC A;  1IG7 A;  1OQY A;  3BC8 A;  2BW3 B;  2DJI A;  1KU3 A;  3PJR A;  2P5V A;  1SFU A;  3HOW J;  4RS8 A;  1R22 A;  2GXA A;  1RES A;  1BR2 A;  1MSF C;  1OCZ H;  3OYN A;  1XMA A;  3L2W A;  2BY0 A;  2H6B A;  2PMH A;  4DZP A;  3EDP A;  1U5T A;  3LFU A;  2Y48 A;  4L9V A;  2L2O A;  2HTS A;  2OQR A;  2ADU A;  4XID A;  3Q0U A;  1VND A;  1LDD A;  1SC7 A;  3KP4 A;  1QBJ A;  3FF5 A;  1Z0X A;  3DTK A;  3HBL A;  4KIT B;  2WB1 N;  1BW6 A;  4KT6 A;  2WTE A;  2KQR A;  5BS6 A;  2WWY A;  4L0Y B;  3L2Q A;  3GTK J;  5L3C A;  1MIJ A;  2E36 A;  2F6C A;  2X6O A;  5F1J A;  3DLL F;  1UCR A;  5K5Q A;  3Q5F A;  2EV5 A;  4GRI A;  4Q5S F;  4OIN F;  4L9T A;  3KIO A;  5JR3 A;  1RIO H;  1TT5 B;  2GIZ A;  1P2F A;  1FT9 A;  1SAU A;  5EGO B;  1HW2 A;  3T5X A;  3R61 A;  4YG2 F;  4A6E A;  4HST A;  3JR9 A;  4ENJ A;  3M7G A;  1MNM C;  4HNV A;  2LKP A;  2M5W A;  4XLC A;  5IYD J;  1FMW A;  1GV5 A;  2BHZ A;  5E8G A;  1HA8 A;  4ETS A;  2ID3 A;  2JK3 A;  2A05 A;  5GTI C;  2JN6 A;  4WXD A;  4D0P A;  1D5Y A;  2VKV A;  1Z6T A;  2L54 A;  4XLP F;  4D9J A;  1B9N A;  1VTN C;  4OIP F;  2O7O A;  2M87 A;  3UNG C;  3BTC A;  4XN0 A;  1KQ9 A;  3LA2 A;  2WY7 Q;  3HUG B;  2QEX I;  4KNY A;  3H35 A;  1BI3 A;  3T8T A;  3SFZ A;  4XLN F;  3GW2 A;  1T33 A;  4I98 B;  2VJ5 A;  1YE9 A;  4XNF A;  2AXT C;  3DWL E;  4IO9 F;  3WTW C;  1CF7 B;  3CCE I;  2QEN A;  3OOU A;  3GFI A;  3LL7 A;  4XLH A;  3OR1 C;  2R4G A;  2D5V A;  1UMQ A;  2WY8 Q;  4XSX F;  3HKZ N;  3DXJ F;  5FD5 A;  5K1Y A;  2EBI A;  4M74 A;  3VYS B;  1YLF A;  2BVM A;  1BI0 A;  2M7A A;  2ZC2 A;  3F0C A;  4WK8 F;  1FYK A;  1K79 A;  4UNO A;  4I0B A;  4IJA A;  2PFB A;  1K6O A;  4GYI A;  4LIT A;  4XRF A;  5L3G A;  1I5Z A;  3F3X A;  3K4J A;  4BY7 J;  5FKK A;  3G73 A;  2OZ6 A;  2FU4 A;  1KU9 A;  1IDY A;  3BR6 A;  4BU2 A;  1JGS A;  2ETH A;  4E7K A;  1ZH5 A;  1FC3 A;  2XDV A;  3DBL B;  3OV8 A;  4CYC A;  1MSE C;  3BTI A;  1ETQ A;  4NC7 A;  3ESW B;  1U78 A;  4IHS A;  1FY7 A;  2FMY A;  2EZH A;  1P4A A;  5FKN A;  2JPB A;  2VKH A;  4A0Y A;  3A01 B;  4YFK F;  3CJR B;  1MBJ A;  3R0A A;  2HQA A;  2FML A;  2HYJ A;  3R60 A;  1W0U A;  4ZTF A;  3G71 I;  1R9T J;  3GME A;  4Y33 A;  1OMI A;  2Z1D A;  2QQB A;  5FRM A;  2QBY A;  1YW8 A;  4BY1 J;  5DDG A;  2I10 A;  1J9I A;  3W6V A;  4N4N B;  2ZBK A;  4PFP A;  1RR8 C;  2XAS A;  3RI4 A;  2O03 A;  1BL0 A;  3F8C A;  3AAF A;  5CVV A;  2YU3 A;  1POG A;  2V9K A;  2LKX A;  1IGN A;  2CH0 A;  2BW3 A;  2E7X A;  2RNJ A;  2VPL A;  3L2V A;  2KIS A;  2QVO A;  3DKW A;  2XF7 A;  3SZP A;  2MC3 A;  1OCP A;  2Z9O A;  3S3M A;  2Q2E B;  1UHS A;  3FZV A;  3M07 A;  3MKW B;  4D1Q A;  3CC7 I;  5L3D A;  2QKM B;  3M8F A;  4M6X A;  2FE3 A;  1O57 A;  3HRM A;  1JE8 A;  1VQL I;  2CWE A;  1AOY A;  2K4B A;  1A6Q A;  4DNC A;  2P7V B;  2H09 A;  4XOT A;  5IP6 A;  3Q9V A;  3NAR A;  3V8J A;  3OYM A;  2XGE A;  2HOT A;  2L02 A;  3QP5 A;  4HEA 2;  3ZRG A;  2VBW A;  3CCQ I;  1UB9 A;  5C44 J;  2LDU A;  5BQT A;  5EYR A;  3EET A;  2LR8 A;  4FT8 A;  4NB5 A;  1D8K A;  4HDV A;  2X4H A;  2OZU A;  2E2I J;  4XRS G;  1IV8 A;  4I99 C;  4S0H B;  5EGO A;  2R7X A;  4PDK A;  4RM2 A;  2CQ7 A;  1UHW A;  2WA0 A;  3I3L A;  3CCR I;  3K70 C;  2XB5 A;  2QF7 A;  5E1Z B;  2HDC A;  1U3E M;  4DOZ A;  4LK0 F;  3S15 J;  3M3Y J;  4X0G A;  4LG0 B;  1R6R A;  1Y8R B;  2FSW A;  1E17 A;  5GPC A;  3TQN A;  4BE0 A;  2EIL H;  4ABZ A;  2QZ8 A;  5FLV A;  3FBN B;  1ZLK A;  4BAC A;  3KE2 A;  3Q3S A;  4S05 A;  3OOP A;  2PBI A;  1OPC A;  2GAU A;  3HUG A;  4NQW B;  5JLX A;  3QPT A;  1FPQ A;  2V26 A;  1UG0 A;  2LRD A;  1BN5 A;  2VI6 A;  1D0Y A;  5DUK A;  2VE8 A;  2CW7 A;  2HQR A;  1XPX A;  4FCY A;  2CV1 A;  1IRZ A;  2NVY J;  4B3A A;  3IV5 A;  2DMQ A;  5K7F A;  3ECO A;  3HOT A;  3VYU B;  1X3W B;  2R7S A;  1QQI A;  1CF7 A;  3SDG A;  2A6T A;  2AQF A;  4H4K C;  4CIC A;  3EUH C;  3ABK H;  3VYR B;  2X1C A;  4PGH A;  1BOB A;  1WI9 A;  2V79 A;  5HOD A;  3J81 Z;  3KZY A;  3I54 A;  5D5X B;  2VIX A;  4IHT A;  2VOO A;  3V4G A;  3K4C A;  2P6T A;  2O8X A;  4RGS A;  2HOA A;  2LYC A;  2JSP A;  1FEX A;  2OD5 A;  1LNW A;  4PSX A;  2JA8 J;  2R93 J;  1M1E B;  1JUM A;  5F04 A;  3HGG A;  1WJB A;  2E71 A;  4YFX F;  3LSH A;  4HLY A;  2BEO A;  3CMA I;  3HHH A;  3RKQ A;  3OYG A;  1QRY A;  1HCR A;  5TRD A;  2MW8 A;  3FM3 A;  2B63 J;  2DTZ A;  4U0V A;  2IW5 A;  4AYB A;  2TDX A;  2KIU A;  2WAE A;  3WGI A;  3N4M A;  3GEZ A;  2YS9 A;  2A68 F;  2DOD A;  3TL4 X;  2HS5 A;  5AIQ A;  4Y15 A;  4CGZ A;  5KHD A;  3MZY A;  3TBI A;  3VDX A;  1Z91 A;  3HOU J;  4ZDL A;  4PJ0 C;  3OYH A;  1ZRF A;  3CP8 A;  3K4N A;  1MJA A;  5DTD A;  5FD6 A;  1ZN2 A;  2VC0 A;  1IRG A;  4RA2 A;  1TL8 A;  4UV9 A;  2R5Y B;  3SZG A;  4EJT A;  4OAY A;  2Q2E A;  3SXY A;  2LF8 A;  3LOC A;  5CPR B;  3TGN A;  4UY8 I;  2F5D A;  2N8G A;  1D5V A;  3M4O J;  4RAF A;  1JTX A;  1ZGJ A;  1S72 I;  2W82 A;  2DMT A;  1JT0 A;  2VT3 A;  3FM5 A;  4BS9 A;  2G0E A;  4RMN A;  2DA7 A;  4A3L J;  4C2U A;  1P7I A;  2DLL A;  4U7B A;  2ISZ A;  2COB A;  3HOV J;  1SD7 A;  2EFO A;  1WJ5 A;  2KL4 A;  1UEL B;  2X85 A;  2F5E A;  1QHG A;  4L5I A;  1K7A A;  2JWT A;  2MGQ A;  3OL3 A;  1LFB A;  3S2W A;  2LH9 A;  2ZKZ A;  1SMY F;  2WAF A;  2M7B A;  2E1O A;  2GLO A;  3GX4 X;  5TIS C;  1FBS A;  3CCV I;  2HXI A;  4IRH A;  3GTL J;  2DN0 A;  5E1W A;  4F91 B;  1Z3Y A;  3N97 A;  3HIF A;  1FBU A;  1EJ9 A;  1EH6 A;  2BY3 A;  1KZH A;  5HOO A;  4YEJ A;  3DBR B;  4KIS A;  2V6C A;  4XRM A;  2CFO A;  2DAO A;  3ZOB A;  1FIP A;  3TOA A;  2QLZ A;  1G8X A;  2QKL B;  4C2M J;  3EUH A;  2HVR A;  1B1B A;  1TWA J;  2OUM A;  4HLX A;  4JQF A;  1A04 A;  1I39 A;  1Y6I A;  4LG0 A;  4ENK A;  4EJO A;  3BG7 A;  3D5S C;  2F4O B;  3K7A J;  1HW1 A;  1HXD A;  5JHF A;  1K78 B;  2QWW A;  3H5A A;  3HKZ A;  3KEQ A;  1BM9 A;  4KDP A;  3PIP F;  1S6L A;  3CF2 A;  2DA5 A;  2QQA A;  1X2M A;  1MBK A;  2XV4 S;  3BG6 A;  3I4P A;  3I4N J;  2FQ3 A;  4QPO A;  5H2F C;  1QA6 A;  2QQ9 A;  1WWX A;  5FLX K;  3PQK A;  3PO2 J;  3F23 A;  4A12 A;  3JAM Z;  5DYM A;  3ZQI A;  4HF2 A;  3A2K A;  3DP7 A;  3BR1 A;  2L7K A;  2EWN A;  3E6M A;  2IEK A;  2ELH A;  2HDD A;  2Y9Z A;  4IRG A;  2P4W A;  5JHU A;  4XOP A;  2MC4 A;  3ASN H;  4HQE A;  4BEH B;  1YW7 A;  2R7V A;  1P7J A;  3F22 A;  1ZR2 A;  1RET A;  4CUG A;  1OR7 A;  2XVC A;  3NEU A;  1FOK A;  1W36 C;  4G6D A;  4XON A;  2DA3 A;  4B4C A;  1W5T A;  4R1H A;  4Q48 A;  4WXH A;  3NRV A;  1XD7 A;  2Y9Y A;  2IGN A;  4EQQ A;  3E6B A;  4XR6 A;  3RDI A;  4JX5 A;  4Y3O A;  2LFB A;  1G59 A;  2V1N A;  2VBZ A;  2EZL A;  5CVJ A;  4RM3 A;  4ENN A;  3GCM A;  2V1D A;  1KYZ A;  1Y1V J;  4PGG A;  5J1U A;  2KHM A;  3S93 A;  2M1B A;  2PI0 A;  2XAJ A;  1FIA A;  2ZXI A;  2LP0 A;  3PSI A;  3QPL A;  1ACI A;  2Y75 A;  3H9J A;  3K4L A;  3JRE A;  3GYH X;  5IPA A;  2L9N A;  2DA4 A;  2W7N A;  2RVC A;  2CV0 A;  2EJR A;  2K9Q A;  3K2A A;  4BE1 A;  3OYD A;  4IOC F;  1T0F A;  3ELK A;  1UST A;  5J8C A;  1A36 A;  2VJ4 A;  4HBL A;  3DBH B;  2R5Y A;  1XGS A;  2IVM A;  2K02 A;  2F5V A;  2LF7 A;  3S1N J;  2XB0 X;  5BPI A;  4AUX A;  3ABL H;  4A3E J;  4UUV A;  1P4W A;  4GYG A;  3I0T A;  2E5Z A;  1DP7 P;  2VB6 A;  3MKZ A;  4XK4 A;  1R1V A;  2EFN A;  3BJ6 A;  2ZXW H;  3AKZ A;  1PVE A;  3K1N A;  4HW0 A;  5IYB J;  5FRN A;  2DMN A;  3WTS C;  4LGW A;  2FD5 A;  5HDK A;  4RB1 A;  4II3 A;  5EZG A;  3SDB A;  1Y0N A;  3VSK A;  1YTY A;  5CVU A;  2IJL A;  2MH2 A;  2D1H A;  5E18 F;  1WCM J;  1W0T A;  3CO7 C;  2DOF A;  1XDU A;  3TP0 A;  2IS4 A;  5M3F J;  2XAQ A;  3RKX A;  2P81 A;  3KP3 A;  2Y2Z A;  1KU7 A;  3OYL A;  2G7H A;  5TGT A;  1S29 A;  2XSD C;  2QGU A;  2FUG 2;  3FBI B;  1EF4 A;  1MMS A;  5BNG A;  3E7L A;  3I9V 2;  5D5U B;  2ZJP F;  1ETO A;  4F55 A;  1JJ6 C;  1S3J A;  2I5U A;  3LQQ A;  1X2N A;  3GWZ A;  4PJJ A;  2IS2 A;  2BOL A;  1J2X A;  2YPR A;  3I5U A;  1SD4 A;  2IA0 A;  1WRJ A;  4TV7 A;  4NNJ A;  3Q9S A;  1TLH B;  4WCG A;  2UXX A;  4ZJZ A;  2K27 A;  3MFK A;  1O3T A;  2H6C A;  4IZZ A;  4UB6 C;  2CQQ A;  1K78 A;  2CUE A;  4JK1 X;  4AM3 A;  2VOP A;  4KFC A;  2M45 A;  3CCJ I;  3BWG A;  3HDD A;  1W36 D;  1DU0 A;  3HEF A;  5D4R A;  3K9T A;  1ODD A;  3FHN A;  4GCV A;  4M3E A;  1LVA A;  4EGZ A;  4Y4R A;  1KU2 A;  1NG6 A;  2XPW A;  3CZ6 A;  2LMD A;  1FZP B;  4P55 A;  1I50 J;  1FP2 A;  4R79 A;  2E7W A;  3OL4 A;  4Y13 A;  1YIJ I;  1XMK A;  2KLO A;  5FLX Z;  2MYS A;  3IWF A;  2ID6 A;  1YJ9 I;  2J5O A;  4B44 A;  4EMS A;  1Z7L A;  2XKO A;  3UR3 C;  4HZF A;  4PZJ A;  1HSJ A;  1TWC J;  2ECB A;  4D7N A;  1E3H A;  2EZK A;  1Y0U A;  3GTO J;  2IA1 A;  2OA4 A;  3JTH A;  2VN2 A;  1VQ6 I;  2IXS A;  4EM0 B;  2K9M A;  2HZD A;  1D3Y A;  4B8X A;  3CD6 I;  2JSC A;  5LEJ A;  3OYE A;  1G6N A;  5DM7 F;  1MBH A;  5D8L B;  4BQQ A;  1DPU A;  3NQO A;  2GOX B;  5LHH A;  4BJT A;  4ASN A;  2UUZ A;  2UZK A;  1LVK A;  2KIQ A;  4S04 A;  3OYI A;  2VLA A;  4CZZ A;  2JRM A;  3I71 A;  4J00 A;  4XKC A;  2BHY A;  4EJV A;  1U9O A;  4DBR A;  4ZC3 A;  1XMX A;  4XSZ F;  1F9N A;  1Y56 A;  3P9I A;  3RKY A;  1GT0 C;  2KIF A;  3CMM A;  2JZY A;  2BE5 F;  1TBX A;  3MQ0 A;  1XGO A;  4UUT A;  3AL0 C;  1V5F A;  4FIS A;  1BR4 A;  1W5S A;  2W24 A;  4AYB N;  4IX7 A;  2EV0 A;  2ISY A;  5C3E J;  2VKE A;  1MBE A;  3IUO A;  1QU3 A;  4M6Y A;  5CQE A;  2DFH A;  3I58 A;  3RKW A;  1VFC A;  3BCA A;  2X51 A;  4IQJ A;  3BR2 A;  2RGV A;  4RAZ A;  5JVG F;  2HI3 A;  3HZJ A;  3A1Y A;  3WTX C;  2KP6 A;  1YRN B;  4DIQ A;  3F8N A;  5E3L A;  1WJC A;  4G7H F;  1JT6 A;  4N4O B;  1B6A A;  2L4M A;  2GA2 A;  2RNG A;  2XIG A;  3VYT B;  3ERM A;  2FXA A;  4Q4Z F;  2M9H A;  3FXM A;  3JRG A;  2EIJ H;  2VAS A;  1J59 A;  3U1D A;  1IO2 A;  4R8H A;  4ZDO A;  2K40 A;  1W4M A;  1IJW C;  4AVP A;  2ZSI B;  3CJT B;  1WGX A;  4YII A;  3FXQ A;  1FWZ A;  3BP8 A;  1GUU A;  3DTI A;  1O7F A;  4DBQ A;  1GLN A;  1WFX A;  2KT0 A;  1OCO H;  2AHQ A;  1D1B A;  4BXU A;  5HLH A;  1LKX A;  2UXN A;  4EJW A;  1Z9C A;  4DYC A;  5L3B A;  1Z1D A;  4A3B J;  1HST A;  1I3Q J;  5ICE A;  4IVN A;  1KGS A;  2VQH A;  5LGN A;  4G6T B;  3TDU C;  2DMP A;  3MD2 A;  3AG3 H;  1ERD A;  2ME0 A;  2LD5 A;  3J81 K;  4BHC A;  1U8R A;  4HX8 A;  3KYL A;  3KP6 A;  2W25 A;  3OS0 A;  1V4R A;  4MHG A;  5IOY A;  3F9K A;  1B72 B;  2DT6 A;  2CO5 A;  2E1M C;  3IH3 A;  2GZW A;  5FB2 A;  4BXF A;  3JW4 A;  4ZYH A;  5KNL A;  3HTS B;  1K83 J;  3DKX A;  4A0Z A;  3BDD A;  4KIB A;  3FHZ A;  1N77 A;  4GXO A;  2HPM A;  3PSF A;  4WXC A;  4D7M A;  3F8M A;  1X1B A;  1N25 A;  2CG4 A;  5HS8 A;  4UUS A;  4UVB A;  2A3S A;  4Q47 A;  1ETK A;  4PJN A;  2JA6 J;  4KUM A;  2DFE A;  3WE2 A;  5GAG J;  4F93 B;  3RQI A;  4GDF A;  4HDU A;  3LSM A;  2M30 A;  1LFP A;  1TT0 A;  3C1D A;  4HQM A;  3PO3 J;  3KZI C;  5CYV A;  3V8K A;  2Z33 A;  3TW6 A;  1MMD A;  3OMY A;  2F48 A;  5EF6 A;  2XPU A;  2HOE A;  2XPV A;  3QPH A;  2XAU A;  4E4H A;  3OYB A;  3BZ6 A;  4CHU A;  1D0X A;  4M71 A;  3I53 A;  2MD0 A;  3EUA A;  2KKO A;  4WWC A;  2FBK A;  3DV8 A;  1FX7 A;  2D2W A;  3ABM H;  3G3Z A;  4A3M J;  3OSF A;  4P1W A;  1QPM A;  1G4D A;  2EH3 A;  1F36 A;  1FTZ A;  2KRH A;  4MEY F;  4CO8 A;  5GAH J;  2B9S A;  3U1K A;  1IN5 A;  3RYP A;  2Y0M A;  3F6O A;  4V2F A;  1VZ0 A;  3H1C A;  3CDH A;  3NAU A;  1TTY A;  2ZME B;  5JFR A;  2HPI A;  3JRB A;  2K3F A;  2PMU A;  4OIQ F;  3GUD A;  3E97 A;  3ONQ A;  2A5W A;  3W2A A;  3ASO H;  5EDN A;  4J19 A;  3JRH A;  3CMY A;  4M3D A;  1IXR C;  1SFX A;  5IYC J;  2A07 F;  1BJA A;  2R3S A;  3ZQF A;  3E1S A;  4L0Z B;  3K0L A;  1NK2 P;  3REO A;  1K61 A;  1HLV A;  2VQC A;  1FYM A;  2RC4 A;  4IRI A;  3L00 A;  4OIR F;  5J6X A;  4MNU A;  2Q1Z B;  1HF0 A;  3GFM A;  4UVC A;  4P96 A;  4Z6Y A;  1YRN A;  1BW5 A;  4BL0 B;  2H1K A;  5DS9 A;  4CCM A;  3K4M A;  1IRX A;  2LRE A;  3MMY B;  3L2U A;  1ZRC A;  2DT7 B;  5HLT A;  2CMP A;  4F52 A;  1VQ4 I;  1TZL A;  4A5M A;  2ZME C;  3LA7 A;  1X4O A;  4IEJ A;  2FF4 A;  4IHY A;  1TQP A;  1YX5 A;  3VWB A;  2OCE A;  1OCC H;  3FK6 A;  1MD0 A;  4E6K G;  2X0L A;  3A02 A;  3KLN A;  2NVU B;  4RB0 A;  5F08 A;  4GO1 A;  4ZYG A;  1T39 A;  2WBM A;  1IAW A;  5D5V B;  4NUB A;  3ZQQ A;  3CUQ C;  2JA7 J;  4XBF A;  1AWC A;  4E7I A;  2EK5 A;  5ICG A;  5LHG A;  2GWR A;  5FKO A;  1BJZ A;  3AG1 H;  2GXG A;  5CKT A;  3BQZ A;  3D0S A;  4C3J J;  4BYY A;  1WKM A;  1PP7 U;  4DW6 A;  3IL2 A;  2FRH A;  3I59 A;  3ERE D;  2BY2 A;  3IAS 2;  3GFJ A;  2LOO A;  2XHK A;  4I0A A;  2DA6 A;  2PMZ A;  3J80 Z;  1EH7 A;  2IA2 A;  4PJL A;  1P6R A;  3DU5 A;  1VQO I;  1FOW A;  2L7F P;  1SFE A;  2LTP A;  3IAM 2;  2MSY A;  2VQG A;  4CZC A;  3JAM K;  1G3Y A;  3QYF A;  1PUE E;  1VQN I;  4A3G J;  3JSO A;  5FFX A;  1RNL A;  4KIF A;  3CF5 F;  1JKO C;  2VXZ A;  1RKW A;  3ZQC A;  1AKH B;  2DTR A;  2IRF G;  4BDZ A;  2V9V A;  1B72 A;  2NRA C;  3D5L A;  3KEO A;  1H8A C;  3FIW A;  3WHB A;  4E7H A;  1MND A;  2VOD A;  4I09 A;  3EQL F;  3RCO A;  4A3D J;  1X1C A;  4N9H A;  3RIR A;  2XRO A;  4BBS J;  4ZYE A;  2O0Y A;  2L3D A;  3LST A;  3S16 J;  5BPD A;  2GA1 A;  5E3M A;  2BYV E;  4XQF A;  1TWF J;  4IL6 C;  3CCU I;  2STT A;  3QU6 A;  3RSN A;  2DU9 A;  5HDN A;  3LA3 A;  3VEP A;  1IDZ A;  1JI8 A;  3BY6 A;  5E1X A;  1ORK A;  1HKQ A;  2JJ7 A;  4HF1 A;  3FXK A;  1RC9 A;  5ICF A;  2STW A;  1OCR H;  4G6Q A;  4L9N A;  5CVI A;  2OAZ A;  3HC7 A;  2CYY A;  3IH2 A;  1NG7 A;  2VJJ A;  3OYJ A;  2E5N A;  2DI3 A;  2ZXJ A;  2QYO A;  4I01 A;  1YJN I;  1LQ1 A;  2F5C A;  5EEH A;  1AU7 A;  2IS1 A;  1IN8 A;  1MBG A;  1SVO A;  3MAJ A;  1ZLJ A;  3P9C A;  4LJZ F;  2LC2 A;  4FHT A;  4XRS A;  2CUJ A;  4JBA A;  5LGT A;  3L1P A;  1K4T A;  1A6I A;  2CW0 F;  2Q8K A;  1I6H J;  2DBB A;  2FX0 A;  2LG4 A;  2FNA A;  1ZR4 A;  3OY9 A;  2QUF A;  4JOM A;  4MQ9 F;  3U2R A;  3K6G A;  4E7J A;  1G3T A;  3S2H J;  5IP9 J;  2NNN A;  4ITV A;  2ZME A;  3CJQ B;  1YOV B;  1IW7 F;  3H36 A;  1MJ9 A;  2RDP A;  5D6F A;  3J7A Y;  1LEA A;  1W1W E;  3W3C A;  2R7U A;  2OQG A;  2XSJ C;  3O8G A;  3CLQ A;  4ZDP A;  1G3S A;  4CYD A;  2O3F A;  5K5R A;  5FKL A;  3K70 D;  1BOA A;  2NVQ J;  2GIV A;  2OPT A;  2VBX A;  4EAT A;  3LAJ A;  5M5X J;  2JPC A;  4Z2Y A;  2VE9 A;  3GLX A;  2A6E F;  4KA4 A;  1VQ5 I;  2LSO A;  3HSR A;  4KJZ A;  1TQM A;  1R23 A;  2YX4 A;  3E3V A;  2TCT A;  2AXL A;  4C2T A;  3M9A A;  3KYD B;  1W7P A;  3RTR A;  2NYX A;  2FEZ A;  1QZE A;  1SD5 A;  5BMZ A;  5LLQ A;  4A3K J;  2W00 A;  3GTP J;  4NBQ A;  1JUP A;  4XKW A;  3HL2 A;  1JKR C;  2VJI A;  1OYW A;  2JUC A;  3ZCO A;  2DPD A;  2ZNY A;  1PP8 F;  2GXB A;  2O5R A;  1R5I D;  1X1D A;  2HU9 A;  2MLK A;  3VSL A;  2VC1 A;  2DOE A;  3DPT A;  2O61 A;  2DA2 A;  3GO5 A;  3V8L A;  4M3F A;  1UG2 A;  3CC2 I;  3BR5 A;  3P5J A;  1ZAR A;  2AS5 F;  4BH9 A;  4AID A;  1WVR A;  4CCK A;  3RPU D;  4E70 A;  3S1M J;  3RPU A;  4A3F J;  4LB5 A;  2NVX J;  3ZXS A;  4HX4 A;  1V5E A;  3PFI A;  2XC7 A;  2NNY A;  1I1S A;  4CH7 A;  4IHW A;  3FXU A;  1X19 A;  3WG7 H;  1DP3 A;  1IUF A;  2CJJ A;  2CUF A;  1Z67 A;  5F64 A;  2H27 A;  3QU3 A;  4ESF A;  4B43 A;  3N05 A;  1AKH A;  2XAF A;  3MN2 A;  3HSF A;  3TO9 A;  2WC2 A;  5BOX A;  2MA3 A;  2DYS H;  1B59 A;  4CCL A;  4M3B A;  2O6G E;  2E35 A;  2IS6 A;  1HKS A;  2A5Y B;  1A5J A;  1HW5 A;  3LFK A;  3V42 A;  1QGP A;  1ON2 A;  3KP5 A;  5IT3 A;  5J1R A;  2DMU A;  3UKG A;  2WAD A;  4O3M A;  1T38 A;  1FMV A;  4I76 A;  3ZMT A;  4J01 A;  4KMF A;  4EM1 A;  1MJB A;  4MO7 A;  3LSK A;  3TO6 A;  4BGD A;  2A6H F;  5B1B H;  4YFN F;  3HRT A;  5HDG A;  1IV6 A;  3OIP A;  4RAY A;  2DQR A;  3JRI A;  5E3N A;  4V19 K;  3SQN A;  4V2G A;  1IRF A;  1JXS A;  2RQP A;  2MBF A;  4I7H A;  4Y17 A;  4BQN A;  1IN7 A;  4XOR A;  3FKI J;  2CS3 A;  3W2W A;  4RGR A;  4A2U A;  1Z77 A;  5HS9 A;  2DCE A;  3O8H A;  2P8T A;  1GVJ A;  2M2E A;  2Y30 A;  3OIQ A;  3JRA A;  2DDB A;  4M9X A;  1B8I B;  1R36 A;  2DFI A;  1BIB A;  2EA2 A;  2ESN A;  3RYR A;  3TDZ C;  1O3Q A;  3AG2 H;  2JVH A;  3OYC A;  5HNH A;  1RI7 A;  3HPG A;  4ENM A;  4RBO A;  4E7L A;  2R7Q A;  3DEU A;  5E20 A;  3G6E I;  2NVT J;  5AON A;  2DK8 A;  1EV7 A;  4WF2 A;  2FA5 A;  2KRC A;  3Q0W A;  3RJP A;  2VPR A;  2XF6 A;  2Z16 A;  3HPH A;  3BG9 A;  2EFW A;  1R1U A;  4A6D A;  1A35 A;  2F4I A;  2KPM A;  4OMZ A;  1XC5 A;  4F92 B;  3VPR A;  1LPQ A;  5DM6 F;  3WTY C;  2O9L A;  2KRF A;  4HPQ A;  1XDS A;  2Y31 A;  1T8I A;  3PM1 A;  1AA7 A;  3BRO A;  2MLG A;  3DEE A;  3BQY A;  4G8X A;  5LGU A;  3QQA A;  1VI0 A;  4PCQ A;  1XCB A;  3TKY A;  2HKO A;  3HRU A;  2TRT A;  4U7D A;  3MKL A;  1MMG A;  3HGY A;  1ULY A;  3S3O A;  5K5O A;  2IT0 A;  4M72 A;  2L01 A;  1APL C;  1I27 A;  4BQA A;  1ZG5 A;  3IHU A;  4E7S A;  4L5E A;  3C2G A;  3FMS A;  1OYY A;  3J7Z I;  1PJR A;  2ZXH A;  4A3I J;  3G4S I;  2HFH A;  5F27 A;  5ILV A;  4KMU X;  2EFQ A;  2GM4 A;  5J4V A;  3F6V A;  2XGD A;  1EA3 A;  2L9S A;  3C2H A;  1ZKG A;  2CFX A;  3SYT A;  3CME I;  1R7J A;  1SFO J;  2BGC A;  3L9F A;  2IGM A;  2CQK A;  5LD2 C;  1U0J A;  3HSE A;  1UAA A;  3GLL A;  1UZC A;  2COM A;  1SAN A;  3RQ4 A;  3SJM A;  5KK1 A;  3GTQ J;  3KET A;  4M6V A;  3V7S A;  4B3X A;  5L3F A;  4OIO F;  5A2Q Z;  3W6K B;  4A0X A;  1REP C;  2KIM A;  1U5T C;  2HTJ A;  3ZMS A;  4ESJ A;  1NK3 P;  1ZGW A;  1MNE A;  3JRC A;  2LBF B;  3GTG J;  3CO6 C;  2OJE D;  3WG9 A;  4XM3 A;  3FK7 A;  2ZB9 A;  2M3A A;  2V6E A;  3L2C A;  2M4K A;  2HEO A;  2L0K A;  1BI1 A;  2HQ5 A;  3BCB A;  3K69 A;  4O5V A;  4N9I A;  3JCU C;  1LFU P;  3C3W A;  3CUO A;  4BHP A;  2FBH A;  1MZB A;  2BXY A;  4ON0 A;  2PMZ N;  5EEG A;  3B6A A;  4BQO A;  3WE3 A;  2B0L A;  1MH3 A;  3WTT C;  1ITY A;  2B7E A;  2EIN H;  4MIM A;  2JT1 A;  3C7J A;  5KAF C;  1SVL A;  3B73 A;  4KIG A;  3LAP A;  3MZH A;  4UUS B;  4U88 A;  3ECH A;  1XS9 A;  1HKT A;  3BJO A;  1G2H A;  4AIH A;  1WZ2 A;  3F21 A;  1X1A A;  4PUS A;  4MTE A;  3BTJ A;  2Z2S B;  3FMR A;  4EGY A;  4HAM A;  4JX6 A;  1Z6R A;  2R7Z J;  4OOI A;  4IPA A;  4CCO A;  1FYL A;  5GTH C;  1DPR A;  4JP0 A;  4LLL A;  2VBY A;  3L2R A;  4LOC A;  3ROU A;  3F8B A;  4XL9 A;  2EA4 A;  3GF2 A;  3AL0 B;  1W5C C;  2QQ8 A;  3AG4 H;  3NWS A;  2F5F A;  3QYB A;  3R4K A;  3T8R A;  1XX5 A;  2CSO A;  5F0H A;  3H92 A;  1QZZ A;  5CVR A;  4BBR J;  2DDA A;  3JRD A;  3GZ6 A;  1YHQ I;  1LEB A;  3FXL A;  1WH7 A;  3KZZ A;  2K5C A;  5ILU A;  1O7L A;  2EB7 A;  4DQ2 A;  1U9N A;  2KZG A;  4M9Z A;  2VXD A;  3RZD J;  3RZO J;  1SVM A;  2PX9 A;  1J7K A;  3ZQ7 A;  3BG5 A;  4RGU A;  3M8J A;  1IXC A;  3PUB A;  2IAI A;  2M34 A;  3T1B A;  1FSE A;  2JTV A;  5FRO A;  2R0Q C;  5H6Q A;  1O4X A;  1H0M A;  4HX7 A;  3MEX A;  3COA C;  1TWG J;  1B8I A;  4QPQ A;  2M4G A;  4BJ6 C;  2DA1 A;  4MFD A;  3JTG A;  2R7D A;  5LRS A;  4AIK A;  1HQC A;  2OBP A;  3A03 A;  2P0W A;  5HNF A;  2H8R A;  1STZ A;  1LE8 B;  2R7R A;  4G7O F;  5B1A H;  1Z7U A;  3DLA A;  4LK1 F;  1BC8 C;  4MTD A;  5D4S A;  3K10 A;  2DW4 A;  1HC8 A;  1HDD C;  1L0O C;  1Z05 A;  4HSR A;  3CP2 A;  4D5F A;  3JSP A;  3TW7 A;  1XSD A;  2L4A A;  5CQG A;  1VQ8 I;  1F43 A;  3H9Q A;  4BAY A;  4LMY A;  5IT9 Z;  2X1D A;  1QVT A;  1J0R A;  1ONV A;  4ZTJ A;  1V3F A;  3K2Z A;  4G12 A;  3ZMZ A;  2J5P A;  5FLM J;  1BI2 A;  3HJE A;  2FOW A;  4AD9 A;  4U0Y A;  1BC7 C;  4X6A J;  1Y8Q B;  3A0H C;  4AWX B;  4FX0 A;  4F7Z A;  2P5K A;  4CCN A;  2P7C B;  3OIO A;  1R00 A;  3VOD A;  3ZMD A;  4RLQ A;  1WJD A;  3HOX J;  3TP3 A;  2LNB A;  3IKT A;  2E34 A;  1X3Z B;  2IPQ X;  5KCM A;  1TNS A;  3GTJ J;  2W84 A;  2HVS A;  2E1M B;  3H3V K;  1RUO A;  2P6S A;  4OMY A;  1B4A A;  4ESB A;  3J80 K;  3PIO F;  5M5W J;  1H88 C;  3KP2 A;  3I59 B;  3E5U A;  3LSJ A;  3NWT A;  1MKM A;  1D0Z A;  3VOE A;  2WAQ N;  3I4M J;  1S7E A;  3S14 J;  3H0G J;  1YI2 I;  1X1P A;  3JRF A;  3WU2 C;  5GPA A;  5D6E A;  1IF1 A;  2E1C A;  1AHD P;  2FJ1 A;  2FQ4 A;  2XF5 A;  9ANT A;  1R4N B;  2E19 A;  1NH3 A;  4KN7 X;  2LBF A;  3DEW A;  4DGW B;  5IOZ A;  4CDG A;  3H3Z A;  3E6D A;  3O6B B;  3SEZ A;  3ZQH A;  1PUF B;  3H3U A;  3U9G A;  2I8D A;  4P9U A;  3OS1 A;  3PL8 A;  2QA4 I;  2D45 A;  2OCC H;  3KP7 A;  3OR2 C;  4EV0 A;  1H89 C;  1V55 H;  2DPU A;  2K3P A;  1ZTR A;  5GAD J;  2Z5U A;  3BR0 A;  3K4B A;  4B48 A;  2OC6 A;  3AFH A;  3GXO A;  5F0F A;  1R71 A;  1YFH A;  2ELK A;  3GVA A;  2A61 A;  4YIF A;  2C6Y A;  1WQ2 A;  5GAE J;  2FBI A;  1J75 A;  5DUI A;  5EG0 A;  1XN7 A;  2HYG D;  5HLG A;  1V5G A;  2YUS A;  2QSG X;  1ON1 A;  4L5J A;  3H0D A;  1VQ7 I;  2XUB A;  2OF7 A;  3CJN A;  1KON A;  1T98 A;  4M9S A;  2IP2 A;  2HXO A;  3LSP A;  1YIO A;  1LUJ B;  1OCT C;  2LY9 A;  1K6Y A;  5HLI A;  3LQR A;  1OYI A;  3R6S A;  3ULQ B;  1ETY A;  1DDN A;  2ESH A;  4WX9 A;  3QOD A;  2ELJ A;  2E2J J;  1ENH A;  3BOQ A;  2E60 A;  3KLO A;  5ICC A;  5J4Y A;  4IHV A;  4DYQ A;  4YRV A;  3MCZ A;  3BPX A;  1WH5 A;  2V1X A;  1JKP C;  3DPU A;  1YJW I;  1BR1 A;  3L7W A;  3MKY B;  3H5R A;  1SD6 A;  1H9G A;  3ZP5 A;  5M3M J;  1UFM A;  2PQ8 A;  2BZT A;  2X9D A;  3ZPL A;  3DCF A;  2R7W A;  1P92 A;  2CU7 A;  2ZJR F;  2HNH A;  3QYE A;  4I6Z A;  2X6Y A;  3CTA A;  1I1G A;  2QM3 A;  2ZSH B;  3IWZ A;  5C4X J;  1FTT A;  1YX3 A;  3CCY A;  4MFE A;  1T2K A;  1SEU A;  3FXR A;  1DGW Y;  3Q0V A;  1PYV A;  1LDK B;  1QNT A;  2M0M A;  3PNT A;  2XRL A;  1MDM A;  1S5L C;  4FQG A;  2DYR H;  1TW3 A;  2G7U A;  4I02 A;  4N0B A;  3K1M A;  4BDY A;  1LE8 A;  3J7A O;  2VKD A;  4QSH A;  3CUQ B;  4XKV A;  1ETX A;  4QTR A;  5J47 A;  5E3O A;  2KJC A;  5FFZ A;  1FNN A;  4YEL A;  5KVR A;  3WTZ A;  4HNU A;  3B02 A;  1GDT A;  1WJA A;  2JUG A;  3DU6 A;  2W57 A;  5IY5 H;  4RB2 C;  1NHA A;  1G3W A;  2DJN A;  1S9H A;  2HR3 A;  2JRT A;  3DFG A;  4F3Q A;  1TP4 A;  1E3P A;  1GXP A;  4GGG A;  1S7A A;  4IOA F;  1EKE A;  3I64 A;  5E17 F;  2DK5 A;  2ZNZ A;  2CGP A;  1W7P B;  4O6J A;  3GFL A;  1E0E A;  3MWM A;  1F4K A;  3D5R C;  2K7L A;  4EJU A;  3FKJ A;  1ETW A;  2Z99 A;  3DQV C;  1ZG3 A;  3E5X A;  2KDO A;  3G2B A;  3H9G A;  2K9N A;  1MW7 A;  3L09 A;  2DFF A;  3OYK A;  1FOX A;  1ZYR F;  3KCC A;  5B3S H;  2LVS A;  2KMU A;  4UHT A;  1VQP I;  3ZR8 X;  2GQQ A;  3ZGK A;  1Q1H A;  3E6C C;  2X6W A;  4XMY A;  4PJM A;  1R58 A;  4BJ5 C;  1YO5 C;  4BNC A;  2O8K A;  4PK4 A;  1P9Q C;  4IXA A;  2F4M B;  2XGX A;  3K4K A;  1T6S A;  4G94 A;  3CDL A;  1RZ4 A;  4UVA A;  1O3S A;  3WTV C;  3ABU A;  3E5Q A;  2WV1 A;  1S8N A;  3F8F A;  2JMW A;  3GBG A;  3LMM A;  4ZYD A;  4Y7N J;  2ACJ A;  3TMO A;  4B09 A;  4L18 B;  1T08 B;  1D8J A;  1SMT A;  1Q1V A;  2R5Z B;  1OLT A;  4XLF A;  3O3K A;  2KDZ A;  2BBY A;  2DXI A;  2ZFW A;  1PUF A;  4KYW A;  3FXJ A;  5EZH A;  3HXL A;  2D1V A;  1WJF A;  3GZN B;  1Z3X A;  1XSV A;  3DKY A;  2OTJ I;  2ZO4 A;  2Y0S A;  2YU9 J;  1ZEL A;  1XCV A;  1U6G A;  2MG4 A;  5ED4 A;  4HNT A;  1MBF A;  1N75 A;  2VT2 A;  1DQU A;  1BIA A;  4NDL A;  3QOE A;  2V4J C;  2H1L A;  4LLG F;  4CXF A;  1IXS B;  4C9Y A;  1R1T A;  3B6C A;  2HOS A;  3CLO A;  2JA5 J;  4NC8 A;  5JVT A;  3ML6 A;  1MMN A;  1XSX A;  3LSG A;  4OWR B;  2OU2 A;  1RPW A;  2NOJ B;  4KT5 C;  3WU0 A;  5ERI A;  1CQT A;  1TNT A;  1QHH D;  3ZQG A;  4RAG A;  3OWT A;  2G9W A;  2CUZ A;  5LRR A;  1R5H A;  3QOP A;  4IF4 A;  5DEQ A;  4K2E A;  2F2E A;  2PG4 A;  4OAZ A;  3KPH A;  3M8E A;  3RPQ A;  2XAH A;  6PAX A;  3HG9 A;  3WTU C;  1I3A A;  4EEF G;  2K85 A;  4HRI A;  1FLI A;  4JX4 A;  4GFB A;  3ZMU A;  4PSW A;  4CSW A;  2HYF A;  3IC7 A;  3ISP A;  3FIS A;  2VON A;  2EFP A;  5LHI A;  4L9J A;  1D1A A;  4LLN A;  3G1M A;  5JI6 A;  2L9R A;  4MLO A;  4U0W A;  2XGC A;  2ZJ2 A;  1YIT I;  1MMA A;  3A01 A;  2K86 A;  4RGX A;  3ZQL A;  1T56 A;  2W85 A;  3E0J B;  4I2O A;  4HG2 A;  2KZV A;  3CES A;  5FGM A;  5KAI C;  4LD5 A;  1KYW A;  3T0Y A;  4AU7 A;  1U8B A;  2L5Q A;  2PJR B;  1JHF A;  3CUQ A;  3QWL A;  3BTL A;  2PLY A;  2W48 A;  1OR7 C;  5D8K B;  5D5W B;  1I6X A;  1DGR M;  2WB1 A;  1ZAO A;  1LB2 A;  4FAS D;  3QAH A;  5J40 A;  4OU0 A;  5LFA A;  3F72 A;  3PNV A;  3HOZ J;  1FSH A;  1WJE A;  3G1O A;  3J7Y J;  3VFZ A;  1QZY A;  1J09 A;  4ZH4 F;  5FJ8 J;  1VQ9 I;  5M5Y J;  1DU6 A;  4RDU A;  2MFZ A;  1W7P D;  3A4C A;  3OSG A;  2H94 A;  5AIP A;  1T95 A;  1ZGA A;  3DPL C;  4KIC A;  1VQK I;  2WAQ A;  4BHB A;  1IN4 A;  4MQV A;  3KFW X;  2R7O A;  2OTL I;  3TO7 A;  4IQ4 A;  4C3H J;  5A2Q K;  3EUK L;  1DUX C;  3FMQ A;  3GZ5 A;  4HV6 A;  2CQN A;  2XKP A;  1YG2 A;  4B47 A;  2BY1 A;  3P7N A;  2M8G X;  2HDW A;  5E79 C;  3IRR A;  3S3N A;  2QCO A;  5J1Y A;  2ICW G;  5HVQ C;  3W6J B;  1JKQ C;  1JJ8 C;  1SFK A;  1YS6 A;  2MAB A;  3HOY J;  3DF8 A;  2E1N A;  4RB3 C;  1XGM A;  5LBQ A;  5FO5 A;  4XN3 A;  2GBY A;  1T0F C;  3GTM J;  3IKV A;  1B9M A;  1TQI A;  1H9T A;  4AIJ A;  1OIS A;  2FNP A;  2IGO A;  4NHJ A;  2L7Z A;  1XG1 A;  1QPI A;  3OYF A;  4M73 A;  4ZZD A;  2EQR A;  3KEY A;  2M8E A;  1U2W A;  1XB4 A;  3HHG A;  3CCM I;  1PDN C;  4QIW N;  4MGR A;  3ZMV A;  2R5Z A;  3QRF F;  1WSU A;  1IUY A;  5GP9 A;  1F1Z A;  1S7O A;  2V9P A;  4BUP A;  4BE2 A;  2R92 J;  1ZQ3 P;  1UJ8 A;  1RKT A;  4DYR A;  2HWV A;  1JTY A;  3SFI A;  1JUS A;  2XRN A;  2UV1 A;  2NS7 A;  1NTC A;  1VF9 A;  3LWF A;  1TW2 A;  1TWH J;  3SHF A;  3WGG A;  4FTH A;  4Y52 J;  2NS0 A;  4NQW A;  3S1Q J;  1JHH A;  2R7T A;  1XGN A;  3V7R A;  2RQQ A;  3EYI A;  2ECC A;  3H5N A;  1LDJ A;  2K9L A;  2AO9 A;  1OFC X;  4A5N A;  4DZJ A;  2W4S A;  4CA0 A;  3BJA A;  1F5T A;  3CCL I;  2EPF A;  4ZYA A;  3FWE A;  5E8I A;  2ZCW A;  1RUN A;  5DV5 A;  3HB9 A;  5B5E C;  2LK2 A;  2JA2 A;  3TED A;  2PN6 A;  3P9K A;  1YYV A;  4G9Y A;  1FBQ A;  2MD5 A;  1UHM A;  5FKM A;  4NC6 A;  3K1P A;  1GV2 A;  3HM5 A;  2PJP A;  2DOA A;  3PUF A;  3VB2 A;  1SAX A;  4A3C J;  5EEA A;  4LIV A;  5CJ9 A;  2HZT A;  2LLK A;  1WHU A;  4C30 A;  3CC4 I;  3R0J A;  2RV8 A;  4HA8 A;  2CW8 A;  4CCJ A;  5J8F A;  3WU1 B;  1RRJ A;  4A69 C;  2K4J A;  1E2X A;  3QPS A;  2HKX A;  1KA8 A;  2R7F A;  4LFU A;  2VL8 A;  1GXQ A;  5IT9 K;  1ZK8 A;  2HVQ A;  3BLY A;  2KFD A;  4E7Z A;  3LSI A;  5DCM B;  1Y39 A;  4P5O A;  2RAE A;  3HYI A;  4XLE A;  2EIK H;  3C2B A;  2QSH X;  1YS7 A;  3PFY A;  1N78 A;  4UB8 C;  2Q0O A;  2EV6 A;  2IBD A;  4A93 J;  3C18 A;  1FP1 D;  3FXO A;  2X6X A;  3CQZ J;  4HF0 A;  2Y69 H;  1YQA A;  1HDP A;  3G1L A; 
#chains in the Genus database with same CATH homology
 4ZDL A;  3CP2 A;  2PJR A;  4LG3 A;  3OYH A;  2GOM A;  3CP8 A;  3K4N A;  2LY2 A;  5CQG A;  3HOS A;  3H9Q A;  3E1S A;  2X1D A;  2VQC A;  4ZTJ A;  4PFO A;  3SZG A;  2BVL A;  2ZFU A;  1Z21 A;  2Q1Z B;  4OAY A;  5CPR B;  3DTE A;  4BL0 B;  4LIU A;  4CCM A;  3K4M A;  1IRX A;  2LRE A;  3MMY B;  3L2U A;  3W2V A;  4CCN A;  2DT7 B;  2IGK A;  2W82 A;  2CMP A;  5HLT A;  4RLQ A;  1WJD A;  4F52 A;  1TZL A;  1X4O A;  4BS9 A;  3OS2 A;  4RMN A;  1YX5 A;  3VWB A;  5KCM A;  4C2U A;  2LY1 A;  4U7B A;  4E6K G;  2HVS A;  2E1M B;  1WJ5 A;  2KL4 A;  1UEL B;  2X85 A;  3SEQ A;  1QHG A;  2JVG A;  2WBM A;  4RLF A;  3OL3 A;  3M1C A;  2LH9 A;  2RRE A;  4NUB A;  2WAF A;  2M7B A;  3ZQQ A;  3KX2 A;  4E7I A;  3NWT A;  3OYA A;  3U21 A;  1D0Z A;  5CKT A;  4F91 B;  1Z3Y A;  5HOO A;  4YEJ A;  4KIS A;  2CFO A;  1G8X A;  2QKL B;  3IAS 2;  2VQL A;  2LOO A;  3FDY A;  2HVR A;  2XF5 A;  2PMZ A;  2OUM A;  2UWM A;  3S32 A;  4PJL A;  3DU5 A;  2LBF A;  4DGW B;  4JQF A;  4ANJ A;  1X4P A;  4U87 A;  3IAM 2;  1Y6I A;  2VQG A;  3BG7 A;  4CZC A;  3D5S C;  3QYF A;  3SEZ A;  5JHF A;  3H5A A;  3HKZ A;  2I8D A;  3CF2 A;  3BG6 A;  2VXZ A;  3PL8 A;  3OS1 A;  1D1C A;  3OR2 C;  4QPO A;  4BDZ A;  2K3P A;  4B48 A;  3K4B A;  2OC6 A;  3AFH A;  3D5L A;  2V7F A;  4E7H A;  1MND A;  1V5G A;  3RCO A;  1X1C A;  3H0D A;  3IP4 B;  3A2K A;  1KON A;  2L7K A;  3S8P A;  2AQE A;  4IKF A;  4XQF A;  1K6Y A;  4II2 A;  3RSN A;  4XOP A;  2MC4 A;  3QOD A;  2ELJ A;  1JI8 A;  4BEH B;  2R7V A;  2CV2 A;  2E60 A;  4CUG A;  4XKB A;  1W36 C;  4XON A;  4YRV A;  2X1E A;  3HC7 A;  3OYJ A;  1NG7 A;  2VJJ A;  2E5N A;  2OV7 A;  4FET A;  4BEH A;  3DPU A;  1BR1 A;  3MKY B;  3H5R A;  2IS1 A;  4XLA A;  2W1O A;  2LC2 A;  2IGN A;  2CUJ A;  3PNY A;  2R7W A;  4XR6 A;  4Y3O A;  2HNH A;  3QYE A;  2X6Y A;  3EPZ A;  2ZSH B;  2LG4 A;  1G59 A;  2V1N A;  1YX3 A;  4RM3 A;  3OY9 A;  1DGW Y;  4JOM A;  1PYV A;  1LDK B;  2KHM A;  4AVZ A;  3S93 A;  3K6G A;  4E7J A;  2M0M A;  3PNT A;  2ZXI A;  4ITV A;  3CJQ B;  4DJA A;  3PSI A;  4BDY A;  3H9J A;  2VKD A;  3K4L A;  3BC8 A;  2BW3 B;  4XKV A;  2DJI A;  2L9N A;  2W7N A;  3PJR A;  2CV0 A;  4YEL A;  3J7A Y;  4HNU A;  1WJA A;  1BR2 A;  2JUG A;  3DU6 A;  3W3C A;  4BE1 A;  3OYD A;  2XSJ C;  2R7U A;  1S9H A;  4ZDP A;  3OYN A;  4F3Q A;  3K70 D;  3L2W A;  2VJ4 A;  3LFU A;  2L2O A;  4EAT A;  2F5V A;  3DTK A;  4KJZ A;  4KIT B;  2E5Z A;  4KT6 A;  2VB6 A;  1E0E A;  3D5R C;  3MKZ A;  3FKJ A;  3DQV C;  3AKZ A;  4C2T A;  2KQR A;  2KDO A;  3G2B A;  3H9G A;  5FRN A;  1MW7 A;  3RTR A;  3L2Q A;  3OYK A;  2F6C A;  4II3 A;  2W00 A;  3SDB A;  3VSK A;  2KMU A;  4XKW A;  3ZR8 X;  3HL2 A;  4GRI A;  3ZGK A;  2VJI A;  2X6W A;  4XMY A;  4PJM A;  4BJ5 C;  2IS4 A;  3ZCO A;  1SAU A;  2O5R A;  4PK4 A;  1X1D A;  1P9Q C;  2HU9 A;  3VSL A;  3OYL A;  4HST A;  3K4K A;  5TGT A;  3DPT A;  2FUG 2;  3FBI B;  4XLC A;  1FMW A;  1HA8 A;  3I9V 2;  4F55 A;  3GBG A;  3LMM A;  4PJJ A;  4CCK A;  4D9J A;  3RPU D;  3TMO A;  2IS2 A;  2BOL A;  3ZXS A;  4NNJ A;  3UNG C;  1V5E A;  4XN0 A;  4ZJZ A;  1OLT A;  4XLF A;  2XC7 A;  4CH7 A;  2WY7 Q;  3HUG B;  3H35 A;  1X19 A;  4IZZ A;  2DXI A;  1DP3 A;  3HXL A;  4B43 A;  3N05 A;  1WJF A;  1Z3X A;  2VJ5 A;  1YE9 A;  3DKY A;  1W36 D;  2Y0S A;  4XNF A;  3DWL E;  1ZEL A;  3FHN A;  4CCL A;  4HNT A;  1N75 A;  2IS6 A;  1DQU A;  3OOU A;  3LL7 A;  3V42 A;  3QOE A;  4XLH A;  4Y4R A;  3OR1 C;  1NG6 A;  2R4G A;  3CZ6 A;  2V4J C;  2WY8 Q;  4C9Y A;  2WAD A;  3OL4 A;  4R79 A;  1FMV A;  4J01 A;  2KLO A;  4NC8 A;  3VYS B;  2MYS A;  2BVM A;  2M7A A;  3LSK A;  4BGD A;  4B44 A;  1MMN A;  1Z7L A;  3LSG A;  3UR3 C;  4OWR B;  2NOJ B;  4LIT A;  3OIP A;  3K4J A;  1QHH D;  3OWT A;  2IXS A;  2K9M A;  2HZD A;  4BU2 A;  2CUZ A;  4E7K A;  2XDV A;  3OYE A;  4OAZ A;  4BQN A;  4XOR A;  4BQQ A;  4NC7 A;  3HG9 A;  2CS3 A;  2GOX B;  3W2W A;  4HRI A;  4BJT A;  2UUZ A;  2DCE A;  4PSW A;  1LVK A;  2VKH A;  4CSW A;  3OIQ A;  3CJR B;  2HQA A;  3OYI A;  2VLA A;  3OYC A;  2JVH A;  4ZTF A;  1D1A A;  5HNH A;  3HPG A;  4Y33 A;  4E7L A;  2Z1D A;  2R7Q A;  4J00 A;  4MLO A;  4XKC A;  1MMA A;  5FRM A;  4DBR A;  4ZC3 A;  2KRC A;  1Y56 A;  3E0J B;  2XF6 A;  2Z16 A;  3CMM A;  3HPH A;  2KZV A;  3CES A;  4HG2 A;  4N4N B;  2F4I A;  2KPM A;  4PFP A;  4F92 B;  3AL0 C;  4AU7 A;  1V5F A;  1BR4 A;  4IX7 A;  4HPQ A;  2L5Q A;  2V9K A;  2PJR B;  1AA7 A;  3IUO A;  2CH0 A;  1QU3 A;  2BW3 A;  5CQE A;  3DEE A;  4IQJ A;  3BCA A;  2X51 A;  1OR7 C;  2VPL A;  3L2V A;  1DGR M;  2WB1 A;  4FAS D;  2XF7 A;  3A1Y A;  1MMG A;  5LFA A;  3PNV A;  3S3M A;  2Q2E B;  2KP6 A;  3S3O A;  1WJE A;  4DIQ A;  3MKW B;  4D1Q A;  1J09 A;  2QKM B;  2MFZ A;  4E7S A;  1WJC A;  3A4C A;  3C2G A;  4N4O B;  1T95 A;  3DPL C;  1PJR A;  2RNG A;  2WAQ A;  2ZXH A;  3VYT B;  2R7O A;  2VAS A;  4IQ4 A;  4XOT A;  3EUK L;  4ZDO A;  1EA3 A;  3OYM A;  2L9S A;  3C2H A;  4HEA 2;  4B47 A;  3ZRG A;  2ZSI B;  3SYT A;  2HDW A;  3S3N A;  2IGM A;  5LD2 C;  1U0J A;  5HVQ C;  3DTI A;  1UAA A;  4DBQ A;  1GLN A;  1SFK A;  3RQ4 A;  1WFX A;  2MAB A;  1D1B A;  2R7X A;  1LKX A;  4XN3 A;  1T0F C;  4RM2 A;  2WA0 A;  3I3L A;  4B3X A;  3K70 C;  2IGO A;  1MNE A;  2VQH A;  2LBF B;  4DOZ A;  4G6T B;  4XM3 A;  4X0G A;  1R6R A;  2M3A A;  3OYF A;  3MD2 A;  2V6E A;  2M4K A;  3KEY A;  4BE0 A;  3BCB A;  3FBN B;  1ERD A;  4BAC A;  4BE2 A;  4BUP A;  4NQW B;  3KYL A;  2V26 A;  3OS0 A;  1UG0 A;  3F9K A;  4BQO A;  2DT6 A;  2LRD A;  2E1M C;  2UV1 A;  1D0Y A;  2CW7 A;  4BXF A;  2CV1 A;  5KNL A;  3DKX A;  3HOT A;  3VYU B;  2R7S A;  2HPM A;  1N77 A;  2R7T A;  3PSF A;  2RQQ A;  3H5N A;  2A6T A;  2AQF A;  4H4K C;  1X1A A;  3EUH C;  1X1B A;  4PUS A;  2K9L A;  3VYR B;  2X1C A;  1BOB A;  2Z2S B;  2W4S A;  4PJN A;  4CCO A;  4CA0 A;  2VIX A;  4F93 B;  4ZYA A;  3L2R A;  3K4C A;  3LSM A;  1LFP A;  1TT0 A;  4XL9 A;  3AL0 B;  3NWS A;  1MMD A;  3OMY A;  3QYB A;  2JA2 A;  2LYC A;  2JSP A;  2XAU A;  4E4H A;  3OYB A;  1D0X A;  4PSX A;  2DOA A;  2K5C A;  2MD0 A;  3EUA A;  4LIV A;  1WJB A;  2VXD A;  4C30 A;  3LSH A;  4P1W A;  3M8J A;  3PUB A;  3OYG A;  5FRO A;  2CW8 A;  2KRH A;  4CCJ A;  4AYB A;  4QPQ A;  2M4G A;  4BJ6 C;  2VL8 A;  2HVQ A;  2WAE A;  1VZ0 A;  3BLY A;  3LSI A;  4E7Z A;  4P5O A;  3TL4 X;  4XLE A;  2HPI A;  2P0W A;  5HNF A;  3PFY A;  1N78 A;  2R7R A;  5KHD A;  3DLA A;  3ONQ A;  3K10 A;  2A5W A;  2X6X A;  3TBI A;  3VDX A;  3W2A A;  4HSR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...