2CRGA

Solution structure of the myb-like dna-binding domain of mouse mta3 protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
70
structure length
70
Chain Sequence
GSSGSSGMEEWSASEACLFEEALEKYGKDFNDIRQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords Metastasis associated protein MTA3
publication title Solution structure of the myb-like DNA-binding domain of mouse MTA3 protein
rcsb
source organism Mus musculus
total genus 12
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2crgA00
5GP9A 1Y1VJ 2D5VA 4Y52J 3JREA 5M3MJ 2XB5A 5K7FA 5F1JA 2L7ZA 3VPRA 1MH4A 2HYJA 1U9OA 3BR0A 3JRHA 2R0QC 2M2EA 3NAUA 2EZKA 1IDZA 1YRNB 3FISA 3BR5A 3OIOA 4IHYA 2Y2ZA 2NVXJ 4C3IJ 5C4JJ 4BY1J 1ETKA 4BBRJ 1LE8B 3PO2J 2MGQA 3I4NJ 4I6ZA 4M3BA 3HOVJ 3JR9A 2VKEA 3D1NI 1JJ8C 2B63J 3HOYJ 5J1UA 1ZK8A 4QIWN 2DTZA 1RKTA 4AC0A 4BBSJ 2DA2A 2DMQA 3W6VA 3BG3A 2LKXA 3HGYA 2HOTA 2R7ZJ 1OCPA 3TEDA 2KDZA 5F0HA 2JA7J 1HOMA 2R93J 1RESA 3HB9A 3TP3A 2DA5A 1WI3A 1ETOA 2VI6A 4J19A 3Q3SA 1QVTA 3H3VK 2HI3A 2DA4A 1JUSA 4C2MJ 3BG9A 2H1KA 2EZLA 2ID3A 1Z77A 5E3OA 3A01B 2QF7A 3IH4A 1B8IB 3HOXJ 4GFBA 1MNMC 2M34A 1B72B 4QSHA 5EG0A 1TWAJ 3TW7A 2CUEA 2CUFA 4A3LJ 5DS9A 1RETA 5K7ZA 2HXOA 1UHSA 4V2FA 1JKOC 2TRTA 3GTJJ 1APLC 3RQIA 3HOWJ 2I10A 3SJMA 1MBFA 5EGOB 3Q0UA 1QPIA 1JKQC 3HM5A 3NARA 9ANTA 1TC3C 1FTZA 4BY7J 2CQXA 2NOGA 1ITYA 5K7HA 3Q0VA 3BR6A 1U9NA 3HDDA 5FKKA 3A03A 4FE4A 4MFDA 5FLVA 3HOUJ 1ORKA 4XRSA 1VI0A 2CRGA 3FK6A 3HOZJ 3JRDA 3S15J 1ETVA 4XK4A 1BJZA 2MW8A 2LD5A 3B6CA 4G12A 2FD5A 2N8GA 2QCOA 2H8RA 4UUTA 2DMTA 3C2BA 3TW6A 1VFCA 3FIWA 4A3MJ 1B72A 2L0KA 1TWCJ 3QPSA 2LP0A 2L7FP 1GV2A 2WAQN 1NK3P 4JX5A 2YU9J 1F36A 5JLXA 1GT0C 3LSGA 4A3CJ 4A93J 5EGOA 3FKIJ 1PUFB 4FISA 3BR2A 2YUSA 3E7LA 2E2IJ 3ZQCA 2Y9ZA 5GPCA 1X58A 2FX0A 5IP9J 2EQRA 2NS8A 2JA8J 1AHDP 2PMZN 3A02A 4A3EJ 2FQ4A 1UMQA 4DZJA 5IYDJ 1WGXA 4AYBN 2LR8A 4C3JJ 4FTHA 2R5ZB 1F43A 1D5YA 2HXIA 3BTJA 1FJLA 4X6AJ 5HODA 1HLVA 1FIAA 1S7EA 2DJNA 1ZR2A 2JJ7A 1BA5A 2K9QA 1I3QJ 4DW6A 3S1QJ 4HNVA 3GTOJ 2EZIA 1ENHA 1GDTA 1JKPC 4IHWA 3S14J 1WCMJ 1JGGA 3BR1A 1MBEA 2L7MP 2XB0X 4NDLA 1QRYA 2LK2A 4BKXA 3GBGA 1MBHA 2JK3A 4IHVA 3HBLA 1WH5A 1OFCX 2CU7A 5FKLA 4ABZA 3S2HJ 1PUFA 1HDDC 5C4XJ 5E3NA 1JKRC 2CQQA 2XPVA 1AKHB 4B3AA 2K9SA 1CQTA 2XSDC 4RBOA 4A3GJ 1U8BA 2DMNA 3LSPA 3OSFA 1I6HJ 1W0UA 1K61A 1W0TA 3LNQA 1X2MA 2ELKA 4V2GA 2ID6A 2WB1N 2E2JJ 3I4MJ 2Y31A 5E3MA 1ZR4A 3CDLA 1TWFJ 3ZQFA 1YRNA 3PO3J 1XC5A 1HCRA 5IP6A 1IGNA 1JT6A 1WPKA 1ETYA 4XRSG 3M4OJ 2FJ1A 2DA1A 1LE8A 1EF4A 3LOCA 2MG4A 5F08A 2VUMJ 3WHBA 2G0EA 5FLMJ 1ZTRA 2E19A 3Q0WA 4C3HJ 1H8AC 1Q1VA 3SDGA 1JUPA 1T56A 2HOSA 3BTLA 2IAIA 3DCFA 2EBIA 4D5FA 2LVSA 4IEJA 1SANA 3GTGJ 1DU6A 3OOUA 5IPAA 2ECCA 1SFOJ 2JWTA 1TWHJ 4AUXA 4DYQA 1FEXA 5EZHA 2CJJA 1RPWA 1IUFA 1GVDA 1JJ6C 2X9DA 2E1OA 4D5CA 2M8GX 1ETXA 2VPRA 1MBJA 1XG1A 3S17J 5IOYA 2ME6A 3A01A 5IYCJ 1B8IA 1DU0A 2Y30A 3MVPA 2XPWA 2NVYJ 4M6VA 1IRZA 5FJ8J 4A3IJ 2ME0A 1A6IA 3RKQA 2VKVA 5M5XJ 2NVQJ 4M3EA 2K9NA 5DTDA 4JP0A 1Z0XA 3JRBA 2EZHA 3QPLA 1P7JA 3HKZN 3S2DJ 1VNDA 4MO7A 4D7NA 2ECBA 1BW5A 1R9TJ 2COBA 1FIPA 1JT0A 3GTLJ 4XICA 1MH3A 1ETWA 1Y1WJ 4D7MA 2IBDA 5F04A 4IHXA 4L5EA 3G1MA 2HQ5A 3LSRA 3S16J 1JUMA 3BG5A 5EF6A 3UKGA 1T33A 3DEWA 1WH7A 1MSEC 3O8GA 5F0CA 2Y9YA 4RDUA 4EEFG 1OCTC 3ZQGA 2ZB9A 3G1OA 2M0CA 3OSGA 2GM4A 1I50J 2JN6A 3BQZA 2OPTA 3PM1A 1ETQA 1GUUA 3L1PA 4XIDA 3S1RJ 2DMUA 4JX4A 5C44J 5IP7J 1POGA 2XRLA 2DA7A 3K2AA 1X2NA 2W48A 1P7IA 3ZQLA 1MBGA 1MBKA 1VF9A 5EDNA 2GLOA 4S0HB 2YS9A 2DA3A 2OF7A 2MSYA 5J1RA 3JRGA 2NS7A 2DA6A 4QTRA 3RZOJ 3JRAA 1IC8A 2NVTJ 2M9HA 2R5ZA 1FTTA 5F0FA 1XS9A 2E2HJ 5EG0B 2IEKA 3BR3A 3O8HA 3JRIA 3K7AJ 5GPAA 5FKMA 1H88C 2LFBA 2RAEA 1ZGWA 2R5YB 2Y0SN 3ZQHA 1QVUA 1ZQ3P 3CMYA 3SFIA 2R92J 5BNGA 4B4CA 4DZPA 4Y7NJ 2XGCA 4DYRA 1BL0A 2XPUA 4W97A 1MSFC 1LFBA 2XGEA 4FE7A 5IYBJ 4UUSB 2X48A 1G2HA 3G1LA 4MIMA 1RKWA 3S1NJ 1NTCA 4MFEA 5M5YJ 3JRCA 1HF0A 1AKHA 3HEFA 2DN0A 2TCTA 2XGDA 3ZOBA 4FCYA 3GTKJ 4JX6A 4A3KJ 4JYKA 3CCYA 1K83J 1OJLA 4B1RA 1U78A 4A3BJ 2LLKA 4XRMA 5J3LA 1H89C 5JLWA 1RR7A 3RZDJ 3BT9A 1AU7A 1A5JA 4A3JJ 3WHCA 2R5YA 3ZQIA 2P81A 4CYCB 1O4XA 4LOCA 2JA6J 3BQYA 4A3DJ 3M3YJ 5F27A 2GBYA 1JTXA 3F0CA 1BW6A 5C3EJ 4DYCA 3IH3A 2O9LA 1GV5A 2DMPA 3BTIA 5J1YA 5FKOA 2KT0A 4UUSA 1LFUP 5M5WJ 5EEAA 3FK7A 5IOZA 3CQZJ 2O8KA 4M3DA 3B6AA 3MKLA 2HOAA 3LSJA 4W1UA 3BTCA 2JA5J 1HDPA 3MN2A 3IH2A 2JMWA 4X1EA 2X6OA 1TWGJ 3IV5A 5EYRA 1UG2A 1ZKGA 2HDDA 3QQAA 1NK2P 3JRFA 2K40A 2AHQA 4MLOA 1IG7A 2O7OA 2EH3A 2LY9A 5E3LA 4A3FJ 4I76A 4M3GA 2LTPA 2AO9A 5FKNA 2WV1A 4BXXJ 3TP0A 3HGGA 4A69C 4CYCA 3S1MJ 2L9RA 1E3OC 1IV6A 3GTQJ 3H0GJ 5EZGA 3GTMJ 5M3FJ 1JTYA 3GTPJ 1IJWC 4M3FA 1IDYA
chains in the Genus database with same CATH superfamily
5LHHA 1QNTA 3KP4A 1Y1VJ 2D5VA 2YU3A 2H94A 3M1CA 2XSJC 4KMUX 1L0OC 1EH6A 1W7PD 1RI7A 3VPRA 1ZYRF 2D1VA 4AIJA 4HSRA 3WG7H 3JRHA 3R60A 2R0QC 1IDZA 3KFWX 4AIKA 3KLOA 3OIOA 4BDZA 2HDCA 4MQ9F 3OYEA 3DXJF 1KA8A 1J9IA 3KZYA 4I99C 5ED4A 5DCMB 5EEGA 4YFNF 2VT3A 4BBRJ 4ZYHA 1LE8B 3ERED 1USTA 2XGXA 2PG4A 4R79A 1VQ4I 5DM6F 3TOBA 1JJ8C 2B63J 1FBSA 2GIZA 5DEQA 5J1UA 2BXZA 1RKTA 1G4DA 4BBSJ 5J4YA 2HQAA 4G7HF 2PMUA 3KP7A 2E5NA 3W2WA 4AVPA 3ASNH 2DMQA 4Q48A 1ZLKA 1QZZA 1IXSB 2FEZA 3HGYA 1O3SA 2Z33A 1USSA 4L5IA 4AYBA 3HHHA 4OAZA 2RNGA 3D5RC 3H3UA 4PZJA 3TOAA 5F0HA 3VSLA 1VQPI 3BC8A 1RESA 2W00A 3TP3A 1E2XA 1QHHD 2VT2A 4P9FA 3CLQA 3WTVC 2V6CA 5J6XA 1QVTA 3EUKL 4HW0A 2ID3A 1EH7A 3Q9SA 4AU7A 5E3OA 3JSPA 3K1NA 3A0HC 1UJ8A 4ZYAA 3ZXSA 5JHUA 4B47A 1MNMC 4PJJA 4I0AA 1OCRH 1QZEA 3DF8A 3F8MA 3DTIA 1RETA 3E0JB 2MABA 4BQNA 5K7ZA 1JKOC 2LF7A 3GTJJ 2CQ7A 3RQIA 4IQJA 1D0ZA 2I10A 5D8KB 1MBFA 3SJMA 1OISA 1TLHB 1QPIA 1JKQC 3HM5A 1TC3C 2AS5F 3K4CA 1XGMA 2ZMEC 4I09A 2A5WA 1ZG5A 2NOGA 2HYFA 4YRVA 3BR6A 3HDDA 4FT8A 5FKKA 3ABKH 4HQMA 4EM1A 2KISA 3ESWB 5FLVA 3HOUJ 1U5TB 4I01A 3TO6A 1BJAA 3TKYA 3ZN1A 1KYWA 2CRGA 4AIDA 2E7WA 5FD5A 4ESFA 3I53A 1RUNA 1ETVA 2KJCA 3WODF 4EJUA 2N8GA 3T5XA 5TJJA 1I3AA 2QCOA 4BJ6C 3ASOH 2H8RA 4XSZF 2HZTA 3C2BA 3TW6A 2LREA 2P7CB 3PFIA 3I71A 4A3MJ 2L0KA 1XTAA 2W84A 1XMKA 4LK1F 3QPSA 4XONA 3OYKA 4R1HA 1HW1A 5L3FA 1GV2A 3VB2A 4ZDPA 2WAQN 1ZHFA 3TDZC 1Z67A 2ZNZA 4JX5A 5HS7A 4RAFA 1MMAA 4A93J 1HKTA 4BE2A 2E2IJ 4YEJA 2HTSA 2F48A 5GPCA 4IHSA 2IS1A 1XCBA 2FX0A 2A3SA 4OMYA 1H9TA 3IKTA 4LLNA 2ELHA 2QSGX 1UMQA 4EJTA 5IYDJ 1U5TA 3DPTA 1WGXA 2A69F 3ROUA 3GFJA 3KP2A 3PIOF 2ETHA 3HTSB 4C3JJ 3RDIA 5D4SA 1FJLA 4YG2F 2MD0A 5LEKA 5CKTA 4HDVA 5TGTA 3WG9A 5CQEA 3WTYC 2UV1A 5GAEJ 4LB5A 3S1QJ 1O3QA 1NHAA 1DUXC 3RQ4A 3S32A 4A0YA 3M8JA 1JKPC 3VSKA 4IHWA 4H4KC 1R00A 4OINF 1SFKA 1EKEA 1OKRA 2AQEA 1JGGA 1XN7A 3CP8A 3FWEA 3BLYA 3GBGA 2DOAA 3CUQB 3HBLA 2GXBA 1OFCX 2RQQA 5FKLA 3KYDB 4RM2A 5HNFA 1HDDC 5E3NA 1JKRC 5KVRA 2FOWA 2VBYA 4LMYA 4HEA2 3ZN0A 4AWXB 3OMYA 1CQTA 2VASA 3RSNA 3RYRA 4AD9A 3HRSA 4BJ5C 3V7RA 3OSFA 4PJNA 2VC1A 3P9CA 1W0TA 3LNQA 1HA8A 2ELKA 3PNVA 2X6YA 3MEXA 1HBXG 2NNNA 4RAGA 1XDUA 4Z2YA 5CVRA 4HAMA 3EYYA 2WAFA 4JK1X 3CDLA 4ZH4F 4F52A 3ZQFA 1YRNA 1UFMA 3GZNB 3AL0B 2UUZA 1XC5A 1MW7A 1QQIA 5IP6A 5K1YA 2C6YA 1WPKA 3QP6A 3R4KA 4XRSG 2YX7A 4WWCA 3DQVC 2DTRA 3WTXC 5FB2A 3DBHB 5CYVA 2EWNA 2F4IA 2G0EA 1FSEA 3ECOA 1S9HA 1MMNA 1U8RA 1TW2A 2DXIA 3A2KA 3SDGA 3HHGA 3HZJA 2CUZA 1RR8C 2VXDA 2W7NA 2V4JC 3BTLA 3BY6A 2EBIA 1PYVA 2ESHA 1J5YA 1YYVA 4D5FA 4HRIA 4WCGA 2KPMA 2HYGD 3TL4X 4CXFA 4BQQA 5IPAA 3RIRA 2ECCA 4XLHA 2VOOA 2JWTA 1TWHJ 2CQKA 1GVDA 4JQFA 1I5ZA 3QOPA 4F92B 2WADA 4V19K 3H36A 2O0YA 1Y8RB 2BGCA 5IT3A 2X9DA 2E1OA 3H92A 4XKBA 5E1ZB 3OV8A 2VPRA 3G73A 1KQ0A 5L3EA 3DBRB 5L3GA 2JTVA 5IOYA 1WJBA 2YPRA 2VQHA 1U6GA 2MC4A 3GVAA 1B8IA 2J5PA 4KUMA 4M6VA 5E8IA 4A3IJ 1JE8A 2IW5A 1XSDA 1W5TA 2VKVA 2Z2SB 2PLYA 2MFZA 5DTDA 3OYCA 3JRBA 1J59A 1UG0A 2DDAA 3IAM2 4CZCA 2EZHA 1ZG1A 2R7UA 3CTAA 2RV8A 1H0MA 3F6VA 1ZARA 4HV5A 1BW5A 5J40A 1YIJI 5HLHA 4C2UA 3E5XA 2KHMA 4XICA 3G71I 2L2OA 2Y75A 4NC8A 1Y1WJ 2A6EF 2F5CA 5HNHA 1U3EM 3CDIA 3OYMA 2DJIA 5GTIC 2HPIA 1V3FA 3RJPA 3VWBA 2HQ5A 1JUMA 3LAPA 5EF6A 3GW2A 2KIQA 4IRGA 3DEWA 3QYBA 3LSMA 3OIQA 2Y9YA 3ULQB 4HZFA 1OCTC 1LVAA 4B43A 1ZGAA 2EFWA 1I50J 1ACIA 1RUOA 3PM1A 1R49A 1GUUA 4A0XA 4QPOA 2DMUA 4XLNF 2AXLA 5IP7J 5HDGA 5KK1A 1BOBA 1X2NA 2HVRA 4BQOA 1QHGA 2WBMA 2CUJA 2CV2A 3KP3A 2OCCH 4A2UA 2DDBA 4FQGA 2QKMB 2ICWG 5FD6A 2HR3A 2BEOA 2RVCA 3JRGA 1TQMA 1BI0A 2DA6A 2FBHA 3ZRGA 3K6GA 2WAQA 2B7EA 2P6SA 2XAFA 4XN0A 3RKWA 4E4HA 3OS2A 2M9HA 2MD5A 4GYIA 3OYIA 3GFIA 4EJWA 3J80Z 3K7AJ 5FKMA 1H88C 1A31A 2X6WA 1ZGWA 3FXJA 3W2AA 3K4NA 1J09A 4ZDOA 2Y0SN 1QVUA 5LGUA 2V79A 3CMYA 1PDNC 1FLIA 2GOMA 4C9YA 3H1CA 3I58A 4DZPA 5DD8A 2NYXA 4YIFA 3G3ZA 4DIQA 2XGCA 2H6BA 1IXCA 1R4NB 2PJRB 2PBIA 2TDXA 3CLOA 4FE7A 5IYBJ 3F6OA 2FNAA 1OYYA 3M8FA 3BG6A 2BVMA 1IN5A 2ZXIA 4HV6A 2XASA 1IRFA 2X85A 3RCOA 4UNOA 4FCYA 2Q1ZB 1IN8A 4JX6A 1HSTA 4JYKA 3L2VA 1K83J 1U78A 2K02A 2R3SA 2V9VA 3RKXA 3KCCA 3U21A 2CFXA 3PSIA 2A61A 4HBLA 4EGZA 5FRNA 2JRTA 2COMA 4CDGA 2DQLA 3BT9A 1S7AA 3FXLA 2LNBA 4DBQA 4OIPF 3V7SA 2OZUA 4G7ZF 3WU0A 2Z16A 1SAXA 4DJAA 1QZYA 3S8PA 2JA6J 1A35A 2ZBKA 1VQ5I 3M3YJ 1E3HA 3F0CA 1X1DA 3TO7A 2PJRA 5KCMA 3EDPA 3GWZA 2GOXB 3IH3A 4KIBA 2KT0A 2W1OA 5M5WJ 4J01A 3V8JA 5IOZA 3CCJI 4M9XA 3B6AA 1O7LA 3K4BA 3MKLA 2HOAA 2FOKA 4W1UA 4OIQF 4R8HA 3ZR8X 1K6OA 1ZRFA 4HF0A 4X1EA 3IV5A 4XM3A 3IUOA 1MNDA 1HSJA 4RB3C 1ONVA 1OR7C 1ODDA 5JVTA 2DFHA 4XMYA 2XC7A 3JRFA 1P4WA 2K40A 3E1SA 4U0YA 4EVIA 4CICA 3AFHA 2EH3A 4PUSA 3SDBA 1R4MB 2O03A 2EA2A 3LA2A 4M3GA 2O6GE 4BXXJ 1F1ZA 1A6QA 4ON0A 3HGGA 1W7PB 2ZC2A 3GXOA 3H0GJ 5EZGA 2OUMA 5JI6A 4BXFA 2GIVA 5CVVA 1YIOA 2M8EA 1HQCA 4Y4RA 1VQLI 5GP9A 4UB8C 1YTYA 3DV8A 3P9IA 5CPRB 3PJRA 1J0RA 3PL8A 2HVSA 3EUHC 2Y69H 1X1AA 1YFHA 5F1JA 2L7ZA 2KZGA 2UXXA 3F8FA 1LEBA 1WJFA 3WTUC 3GYHX 2LH9A 4FX4A 3EYIA 1G59A 1RNLA 3F22A 2Q2EB 2QVOA 4C3IJ 2DI3A 2JRMA 4L0ZB 3DU5A 1SVLA 1IZ1A 3T8TA 4EGYA 3CO6C 1QA6A 1WJEA 3R61A 3BDDA 2QENA 3I4NJ 2RDPA 3OYBA 4LG0B 4G7OF 1WQ2A 1XMXA 1ULYA 1MJAA 2VKEA 4M3BA 4IX7A 3HOVJ 3HOYJ 4ENMA 4AC0A 3ELKA 2KL4A 4ZYGA 1YO5C 1K78B 2OU2A 4BUPA 4U7DA 4HLYA 1FC3A 2DODA 1FBUA 2K85A 2BOLA 2H09A 4L5JA 4BDYA 2B0LA 3MMYB 1OCPA 3TEDA 2R7TA 3VYUB 1FMVA 4EQQA 3IWFA 2VBXA 1WI3A 1ETOA 2QYOA 3CP2A 1BI1A 6PAXA 2HI3A 3M1EA 2LY2A 2Q2EA 2CFOA 4C2MJ 2R7DA 2IXSA 2ZXHA 4LLLA 5JHFA 1X1CA 3V8LA 3A01B 3IH4A 3C2HA 4HQEA 5EG0A 1V55H 2CUFA 1R23A 5A2QZ 1YJWI 2O8XA 2QZ8A 3GCMA 4GXOA 3UR3C 3HOWJ 5KAFC 2BE5F 4IF4A 5CQGA 2CMPA 1C0WA 2RKHA 5AONA 4UV9A 2F4MB 2QUFA 4KDPA 1SD7A 2MYSA 4NHJA 2NNYA 2L9NA 1R6RA 3Q0VA 2WB1A 1QO0D 2BW3B 4U87A 3FBNB 1LKXA 4BJTA 2QM3A 2KDOA 2VQCA 1Z9CA 2Y0SA 2QQ9A 3U1KA 4CSWA 5KHDA 3WU1B 1X3ZB 2K4JA 3L2UA 2FD5A 1CGPA 1MDMB 5A2QK 1CF7B 2XVCA 3FIWA 4AIHA 3VODA 3DPLC 1ZGJA 1TWCJ 2LP0A 1VQMI 1YX3A 2R7VA 1XPXA 2L7FP 2F5EA 2LMDA 4II3A 4KFCA 1FOWA 2OTLI 4IKFA 4FX0A 2EV6A 2YU9J 1F36A 1YOVB 1GT0C 2R7OA 3LSGA 4A3CJ 2E1NA 1GLNA 3FKIJ 2L9SA 2G9WA 2R7RA 4PFOA 3CF2A 5IP9J 5HOOA 2NS8A 4LIUA 3MD2A 2MA3A 5D5XB 2RN7A 3HIFA 2FE3A 4BU2A 1WHUA 4A3EJ 3DEUA 2FQ4A 5KAIC 4LIVA 2CV1A 4ENKA 1ZLJA 2CH0A 4FTHA 3T0YA 2R5ZB 1WZ2A 1D5YA 2JUCA 3QAHA 2CYYA 1S7EA 1PVEA 1G3WA 2XROA 2K9QA 1MDMA 1VQOI 1I3QJ 4DW6A 1FYKA 3GTOJ 2EZIA 4YFXF 1ENHA 2RQPA 5EJCA 4A0ZA 1ZH5A 4QPQA 4NQWA 4G6DA 4GRIA 4KIFA 3F3XA 3BR1A 5LHGA 2L7MP 1AA7A 4OMZA 1DP3A 4BKXA 5E18F 3CCVI 4IHVA 1EH8A 3OYDA 3S2HJ 4ABZA 1T08B 1R1UA 5ILUA 4Q47A 1AKHB 2X0LA 5ERIA 3HRMA 4OIOF 4RBOA 2JA2A 3ERMA 1U8BA 2DMNA 3LSPA 1O57A 3KETA 4GYGA 2KIMA 2K27A 3A1YA 1RRJA 2ZCWA 5EEHA 1LB2A 3HL2A 1D5VA 2DO7A 2ID6A 3H35A 2E1MB 4ITVA 3CESA 3AAFA 2JVGA 2Y31A 2NVUB 4HSTA 2CQNA 5FGMA 2WY8Q 1R22A 1K4TA 2XHKA 4KT6A 3FXUA 1YJNI 1HCRA 2KRCA 3E6BA 1AWCA 2STWA 5FFXA 1ETYA 5DCMA 2VN2A 1JI8A 2NXNB 1REPC 1LE8A 2AQFA 4GDFA 2XAQA 2MG4A 5BPIA 2FMYA 2RNJA 1IW7F 1YQAA 3KIOA 5FLMJ 4Y13A 3CC4I 1ZTRA 2E19A 4U7BA 3J7ZI 3MZYA 3WTZA 5J4VA 1H8AC 2DLLA 1T56A 4XN3A 3CCUI 3QYEA 3DKYA 2IAIA 3HC7A 4EJVA 2ISZA 1Y8QB 2DFFA 3MWMA 3O6BB 3ZQ7A 4F93B 4IEJA 2CW0F 4CCLA 1SANA 3GTGJ 3OOUA 4OWRB 2WC2A 3B73A 3BCAA 4NNJA 1YITI 3OYFA 5EZHA 2CJJA 1RPWA 2GWRA 2VXZA 2JVHA 1IN6A 2V1DA 4DBRA 3AG4H 1O3TA 4M9SA 5HDNA 2I8DA 2K7LA 4D5CA 3BZ6A 3FHZA 3KEYA 1MBJA 5J8CA 2VOPA 3BPXA 3CZ6A 1SVMA 1D0XA 1WVRA 3L09A 2ME6A 3ZMSA 1UCRA 1VQKI 5IYCJ 4ESJA 1DU0A 3HJEA 4E7KA 3MVPA 4PCQA 3K0LA 4N4NB 1Y6IA 4II2A 1VQ8I 2M3AA 2V26A 4HA8A 4XLFA 5FJ8J 1K6YA 5AIPA 3JW4A 3KZZA 1B9NA 3RKQA 4XNFA 3IAS2 2K9NA 1Z0XA 3SYTA 3S2DJ 3RPUA 4MO7A 2KIUA 3QODA 4D7NA 2PI0A 2BBYA 1PUEE 1HW5A 2E36A 4BHCA 1FIPA 4HLXA 1JT0A 1Z1DA 3K4LA 1OMIA 1ETWA 1PP7U 1FP2A 3ZQQA 3PIPF 3SQNA 2IBDA 1FYLA 4MQVA 2EIKH 3FXOA 3ONQA 2F5FA 3BG5A 3UKGA 4UY8I 2FBKA 1U2WA 5F0CA 3GZ6A 4UV8A 2LF8A 2QKLB 4LK0F 2IA0A 2JPCA 2ZB9A 4WK8F 3OSGA 1HKQA 2JN6A 1X1BA 1OYWA 1ETQA 2HQNA 3HSEA 4BE1A 4KISA 3L1PA 4ENNA 4XIDA 2DAOA 2M45A 3NWTA 3H9GA 4JX4A 5C44J 3KYLA 4N4OB 5L3CA 2W25A 2R7XA 3K2AA 2G7UA 1QPMA 1TNTA 3E6DA 4I0BA 3ZQLA 2EFPA 4IVNA 2KLOA 1HW2A 1ON1A 1MBKA 1VF9A 3GUDA 5EDNA 3IWZA 4S0HB 4HX7A 2W4SA 3Q5FA 2MSYA 2ZKZA 3C7JA 5J1RA 2VONA 5CJ9A 2DCEA 3PNYA 3WGGA 2DFEA 1DGRM 2NS7A 4HF2A 1V54H 3RZOJ 1GVJA 2L4AA 4M9ZA 5F1RA 1D8JA 2NVTJ 4RAYA 1FTTA 3JCUC 5DUKA 2IEKA 2CG4A 2KIFA 3O8HA 4B44A 3JRIA 4FASD 3H9JA 3K10A 2HEOA 3MZHA 5GPAA 2FA5A 3KP5A 4HG2A 3QPTA 1WFXA 1SFXA 2ADUA 2RGVA 1N77A 2D45A 1T39A 1ZQ3P 2HKXA 1FWZA 5J47A 2R92J 4AVZA 5ICEA 4I02A 2PX9A 1T0FC 4PJ0C 3BWGA 2DK5A 2OA4A 3K4KA 2GA2A 4E7HA 3G6EI 1BL0A 1MSFC 3CUQA 2FF4A 1H9GA 1G2HA 4M73A 4M71A 3G1LA 4MIMA 3JRCA 2BY0A 1G6NA 3HUGB 3OR1C 5LFAA 3WTTC 3FM5A 2L7KA 2M1BA 4A3KJ 2KRHA 1WKMA 3W3CA 1YJ9I 1X4OA 2VJ5A 4KIGA 2VKDA 2E60A 2K9MA 1WWXA 1YHQI 2HNHA 1BR2A 1QGPA 1AU7A 2K86A 3WHCA 3J7AO 3U1DA 3ZQIA 5D8LB 2P81A 3SZPA 1O4XA 5E20A 4PSWA 1HKSA 2EFQA 2EV5A 4A3DJ 2GBYA 3OR2C 1BW6A 2OQGA 4DYCA 2O9LA 1GV5A 2DMPA 4KYWA 3J7AY 1LFUP 4BACA 1SMYF 3LFUA 3CQZJ 2IGOA 1X4PA 4M3DA 3HUGA 3OYHA 1L3LA 2Z1DA 1GXQA 2P4WA 3RTRA 1JHFA 2X6OA 2J5OA 4A5NA 2K4BA 2ZFWA 3MFKA 1IV8A 1NG6A 3HSRA 1ZG3A 4IHTA 1UG2A 2HDDA 5DDGA 1IRXA 3S2WA 4IO9F 1NK2P 1FOKA 2O7OA 1F5TA 5E3LA 4I76A 1TQPA 1JGSA 1V5GA 1Z7LA 2DQRA 2DYRH 5FKNA 1FY7A 3V7CA 1DGWY 2WA0A 1IV6A 3MQ0A 4IL6C 1BBYA 3GO5A 2QA4I 2IP2A 4UVCA 5JFRA 3HOSA 1HDPA 2PQ8A 2HFHA 2RC4A 4Y52J 5CVUA 3JREA 5M3MJ 3J81Z 1F9NA 2EA4A 2XB5A 2DOFA 4Q4ZF 4LG3A 1U0JA 3TBIA 1J7KA 4XLEA 1VQ7I 2ZNYA 2MLKA 2KP6A 2HYJA 2E7XA 1U9OA 2QGUA 2M2EA 3NAUA 3Q9VA 3GFLA 1R36A 4WXHA 1YS6A 3FISA 2OCEA 3NRVA 1ZRCA 5GTHC 4IHYA 5LBQA 5F6FA 1MJBA 3N05A 4BY1J 1ETKA 3UNGC 2BZTA 1FBQA 2HZDA 3I59B 1W4MA 3E5UA 3HYIA 2Z99A 3PUFA 3W6KB 3CC7I 4I6ZA 3I3LA 2JSCA 1O7FA 3E3VA 4MEYF 4FHTA 3ZMVA 3J81K 4DGWB 4ESBA 1IF1A 2A05A 3SZTA 2XDVA 3DEEA 4BH9A 2LKXA 2EFOA 4MEXF 2Y48A 3L00A 1G8XA 1XCVA 4U0VA 1HOMA 2JA7J 5F64A 3QRFF 2UWMA 4CA0A 3H9QA 2VC0A 5DM7F 4BL0B 1T8IA 2DA5A 5HS8A 2VI6A 4ANJA 4J19A 3IRRA 1SEUA 3LSTA 2OD5A 4YIRX 1IN7A 3Q3SA 3H3VK 2FXAA 1JUSA 5TRDA 3FMQA 3BG9A 5LRSA 5ICCA 2EZLA 3L9FA 1XB4A 1SD6A 4GFBA 3AG1H 2QF7A 2H1LA 3IP4B 4C30A 3WGHA 5B1AH 4WX9A 3J80K 1Y0UA 1B4AA 2L5QA 1XSXA 2M34A 1B72B 1K7AA 3DTEA 5K5OA 3TW7A 2CUEA 4A3LJ 3E97A 1TBXA 2HXOA 3I0TA 1U5TC 4V2FA 2ACJA 2TRTA 4N9HA 3RYPA 4P9UA 2X4HA 3IHUA 1Z21A 4KT5C 4J00A 9ANTA 2CW8A 2W24A 1X3UA 4NBQA 1EA3A 3R0AA 4BY7J 4EM0B 3DKWA 3R6SA 1Z05A 2CQXA 3EPZA 2FUG2 1FP1D 1YX5A 2QEXI 1U9NA 1MIJA 3A03A 1TQIA 4CZZA 3CD6I 2HOEA 5E79C 4MFDA 1ORKA 4XRSA 4UVAA 1E17A 1RC9A 3HOZJ 5HVQC 3BJAA 4XK4A 1FMWA 1I1SA 2MW8A 5KNLA 2ZMEB 2K5CA 4RAZA 2HQRA 2K3PA 3EETA 4Z6YA 2PJPA 2DU9A 3OYLA 5D5UB 1B72A 3LMMA 3WTSC 2LC2A 4UUVA 3ABTA 4CCNA 5DD4A 2OAZA 1NK3P 4HYEA 2BVLA 2ZJQF 5B5EC 1UELB 1ON2A 1KU7A 5FO5A 1JXSA 2VJ4A 1PUFB 2DFIA 3BR2A 3ECHA 2HVQA 2YUSA 3E7LA 2PEXA 2GXGA 2BYVE 3DBLB 3FF5A 1W5CC 4CCOA 1KYZA 1LDKB 2VJJA 3BG7A 1WJCA 3I9V2 2PMZN 2XF7A 3LWFA 1SD4A 4DZJA 3A4CA 2IS4A 1IO2A 2A68F 4CCKA 4AYBN 1WI9A 4NB5A 2LR8A 1O3RA 1F4KA 3P5JA 2FRHA 1G3TA 2Y0MA 1F43A 2HXIA 3BTJA 4BS9A 3FDYA 5HODA 1HLVA 1FIAA 2DJNA 2ZMEA 1BA5A 3IC7A 4HNVA 1GDTA 2OC6A 3S14J 1HC8A 4ZYEA 4Q5SF 1WCMJ 4JBAA 1IAWA 1MBEA 2XB0X 2IA1A 4NDLA 5FFZA 2WTEA 3M7GA 3FM3A 5B3SH 5FROA 3F21A 1BI3A 4PGGA 1W7PA 4P96A 2XAHA 1PUFA 2NAZA 5D6EA 2R7WA 4XR6A 1FT9A 2CQQA 4YFKF 2KZVA 2NOJB 2XPVA 3D5SC 4B3AA 4NC6A 4M72A 3F9KA 3AL0C 2K9SA 1X3WB 2XSDC 2P5VA 4PFPA 4RA2A 3SXYA 3DWLE 4EMSA 1I6HJ 2VKHA 1W0UA 1K61A 4KITB 3H5NA 5J8FA 2R7QA 4LGWA 1VZ0A 4JOMA 3I4MJ 4ZJZA 2BY2A 2XV4S 2LRDA 3MKYB 5ICGA 2VBWA 4F3QA 5E3MA 2ZXJA 3CJQB 4B09A 2EB7A 2O5RA 3EQLF 2QLZA 3PO3J 1Z91A 3LA3A 1B6AA 5DUIA 1PJRA 4S04A 2BV6A 1IGNA 1OCZH 3F8NA 4Y3OA 2OZ6A 3RKYA 3AG3H 3LOCA 4Y17A 3WHBA 1OPCA 1IXRC 1ERDA 4C2TA 1D1BA 2P8TA 4LG0A 4RB1A 2EIMH 1UHMA 2ZSIB 2E5ZA 3C2GA 3RPQA 4IOAF 3WE3A 1Q1VA 3DU6A 1B59A 2M0MA 4B3XA 1K78A 2GQQA 3F8BA 3FX3A 2V1NA 3L2CA 4F7ZA 4LITA 1S3JA 4RGXA 1UZCA 2DW4A 2LVSA 3TGNA 1VQNI 5K5RA 1IN4A 4DYQA 2X6XA 3CC2I 3H0DA 3WU2C 3GMEA 1JJ6C 3MKWB 2XRNA 1ETXA 1FZPB 2BHZA 3S17J 4HDUA 2IGNA 1BM9A 4MTDA 3A01A 5IT9Z 2Y30A 4HF1A 3I4PA 2XPWA 2E34A 1IRZA 2L9VA 2PFBA 1UHWA 3PQJA 2DPUA 1N25A 3FZVA 2DK8A 2L54A 3HPHA 5M5XJ 2L4MA 2IT0A 2NVQJ 3F8CA 4JP0A 2A6TA 4E70A 3HKZN 3DP7A 2ECBA 2R7FA 4EV0A 2F5VA 3GTLJ 2ISYA 3W6JB 5H6QA 2LG4A 2BW3A 4KJZA 3E6MA 3PQKA 2KKOA 3I56I 3ABMH 5GADJ 2XKOA 4E7ZA 2VJIA 2EINH 4IHXA 2IA2A 4ZZDA 3ZMDA 2DBBA 5IT9K 2NS0A 3BPVA 2BY3A 2KQRA 3DFGA 3OYJA 3LSRA 4HPQA 3V42A 1T33A 1DDNA 2EJRA 3GLXA 1WH7A 1W5SA 1S72I 4DQ2A 1CF7A 4EEFG 2JT1A 1R5ID 3OWTA 3N4MA 2GM4A 2LDUA 3LQQA 2OPTA 4ETSA 1MJ9A 2Q0OA 1M1EB 1V5EA 4E6KG 3S1RJ 4F91B 2VLAA 2ZXWH 1N78A 1YW7A 1PP8F 1LPQA 3HPGA 3GFMA 4XBFA 4BEHB 1LJ9A 3ZGKA 3FXKA 2DA3A 2OF7A 1MD0A 4IJAA 4ASNA 2KJBA 4E7LA 2VPLA 3K69A 2VODA 3GLLA 4UXNA 2KFDA 3ZMUA 3OY9A 4IOCF 4ENJA 2P6TA 1YS7A 1P6RA 3NQOA 3JRAA 1IC8A 4CO8A 2KRFA 2R5ZA 2M7BA 4NC7A 5F0FA 3CF5F 3BR3A 2OV7A 4IXAA 4ZYDA 1GXPA 1R1VA 1OLTA 3LQRA 1Z7UA 2R7SA 3JTHA 1HXDA 3ZQHA 2OJED 1R71A 2PMZA 4MNUA 3OIPA 5CLSA 2LYCA 1MGTA 4BXUA 3TMOA 4Y7NJ 5E17F 4XORA 2Z3YA 4E7JA 4DYRA 2XPUA 3OYNA 2QSFX 1LFBA 2ZFUA 3F72A 1J2XA 2GA1A 4BEHA 1T2KA 3S1NJ 3CJTB 1NTCA 4MTEA 2P5LC 2X51A 4XOPA 3HEFA 1FOYA 3CMAI 1AKHA 2DN0A 1XX5A 2UZKA 2XGDA 3ZOBA 3GTKJ 3ABUA 1SFEA 1RZ4A 1V4RA 3KYCB 2EPFA 1Z3XA 2HS5A 2D2WA 4I7HA 2XKPA 4B1RA 3I64A 2VL8A 2DT7B 2LLKA 4XRMA 4LD5A 5LGNA 2QBYB 3O2PE 1J75A 5J3LA 1BIAA 3P9KA 2QQBA 5BPDA 1R1TA 5GAHJ 2VBZA 3CMMA 3FBIB 1BN5A 2AXTC 4LOCA 1E0EA 4KICA 3BQYA 3DLLF 3M8EA 3ZCOA 1EV7A 1JTXA 1R7JA 1X19A 4BQAA 3TDUC 5C3EJ 2F4OB 2HWVA 2WV0A 1KU2A 4H0EA 1D1CA 2ZJPF 1SAUA 5FKOA 2FU4A 4E7IA 5EEAA 3FK7A 1W36D 4WF2A 1T95A 5ILVA 2O8KA 2CS3A 5D5VB 1D8KA 3BTCA 4BHPA 2D1HA 1UAAA 2QSHX 3IH2A 2JMWA 3K70D 4MHGA 4S05A 1TWGJ 3MAJA 3QPHA 3OL3A 1ZKGA 1UB9A 3K4MA 5LD2C 1G3SA 3QQAA 2QBYA 1KU3A 2V1UA 1S5LC 2AHQA 1LDJA 4MLOA 1IG7A 2HU9A 1A04A 2YR2A 2DT5A 4P5OA 2LTPA 1MZBA 2AO9A 3G2BA 3M9AA 4XLPF 3DKXA 3S1MJ 1FNNA 2L9RA 3BROA 2ZSHB 4G8XA 1E3OC 3GTQJ 2EV0A 3GTMJ 5M3FJ 3J7YJ 1OCCH 2WAEA 4I2OA 2W57A 4A12A 2H6CA 1JTYA 4L0YB 3GTPJ 1IJWC 1K79A 4M3FA 1IDYA 1S7OA 3TQNA 5L3BA 1OQYA 2LSOA 4XL9A 3I54A 3H5RA 2X1EA 4DOZA 5K7FA 2FNPA 3QU6A 1MH4A 5BS6A 3BR0A 2CWEA 3KP6A 4HOBA 5AIQA 2EZKA 1KZHA 4GGGA 1YRNB 3HG9A 3BR5A 5DV5A 2Y2ZA 4DNCA 2NVXJ 5C4JJ 3CCLI 1BR1A 3HTUA 2G7HA 4U88A 3SEQA 3PO2J 2MGQA 4OAYA 1S8NA 2HTJA 3VOEA 3C3WA 4EM2A 1DPUA 1P9QC 1STZA 4XRFA 1LUJB 1MMDA 1TNSA 1WJAA 2L01A 3JR9A 3D1NI 1K4SA 3HKZA 4RGRA 1ZK8A 4QIWN 2DTZA 4CYDA 4XOTA 2CV0A 1OR7A 2DA2A 5JVGF 2EK5A 4D9JA 5LRRA 3W6VA 3BG3A 5LHIA 2HOTA 1S29A 4LFUA 4QWQA 2R7ZJ 2V6EA 2KDZA 3LSHA 3IRQA 2R93J 2IS2A 3ABLH 5ICFA 4BNCA 3GF2A 3HB9A 4PJLA 4N9IA 2IRFG 3HXLA 1W36C 5FLXZ 3BCBA 2CW7A 4YELA 3R0JA 4BE0A 2XF6A 4HX8A 3VYRB 1ZAOA 3W2VA 2IVMA 2DA4A 1BC7C 4Y33A 4P55A 2H1KA 2DOEA 3ZP5A 3K70C 2OTJI 1BR4A 1Z77A 2L02A 4N0BA 4PJMA 1B8IB 3EUHA 3LA7A 3QP5A 1TT0A 3HOXJ 1XGNA 3K1MA 1BC8C 4QSHA 1TWAJ 3KE2A 2MLGA 3SFZA 3CMEI 4CHUA 2LBFB 3V8KA 5IY5H 5DS9A 2K3FA 2P0WA 1UHSA 2M87A 5HLIA 3N97A 1APLC 3NEUA 1NG7A 5EGOB 2HPMA 3Q0UA 3OOPA 3NARA 2O3FA 4XQFA 2MC3A 5GAGJ 1FTZA 1WJ5A 1TW3A 1IRGA 2H8WA 4U0WA 1MMGA 3WGIA 1QBJA 2FSWA 4KN7X 2EFNA 3CJRB 1KU9A 5K7HA 5FLXK 2VIXA 3VEPA 1ITYA 2VQGA 2IJLA 2CSOA 4FE4A 1TTYA 2F6CA 3JAMZ 3S3MA 1VI0A 3FK6A 3JRDA 4O5VA 3S15J 3BOQA 2V1XA 1BJZA 2LD5A 3B6CA 3RPUD 2W82A 4G12A 4O6JA 4E7SA 2FQ3A 4IQ4A 3ZPLA 4UUTA 2DMTA 3BP8A 1VFCA 3EUAA 4GO1A 1T38A 3K4JA 1SD5A 2Z9OA 4BAYA 5HLGA 3VDXA 1OCOH 4L9VA 2LBFA 2MBFA 2XF5A 1I1GA 3P7NA 5JLXA 1EJ9A 4M74A 5EGOA 5LLQA 4FISA 3CJNA 2JQ7A 1I6XA 3ZQCA 3C1DA 2M7AA 1X1PA 2Y9ZA 1A36A 2MH2A 2ZJRF 1X58A 1Z6TA 3I5UA 2EQRA 2JA8J 1OYIA 1AHDP 3JAMK 3OYGA 2PN6A 3A02A 3AKZA 1D0YA 2H27A 3BZKA 4ZZLA 5L3DA 5DCFA 1ZREA 1DPRA 1KONA 3DTKA 2PMHA 1LQ1A 2QWWA 2M4KA 3LL7A 4X6AJ 3CCEI 3QOEA 1VQ9I 3FKJA 4KA4A 2LY1A 4HNTA 1ZR2A 2IS6A 2JJ7A 1Z3YA 3BJ6A 2A5YB 4OIRF 1YW9A 3CO7C 2UXNA 3KEOA 3MZ8A 4RLQA 2GXAA 5D5WB 1Z6RA 3F23A 2YSRA 2CGPA 5CVIA 2M30A 4CGZA 5E8GA 1QRYA 2LK2A 1MBHA 1ZN2A 2JK3A 4I98B 1WH5A 2CU7A 4PK4A 2E1MC 2E35A 1YLFA 1MMSA 5C4XJ 3NWSA 1DQUA 4ZTFA 3B02A 1MKMA 5BOXA 4A3GJ 2W85A 1B1BA 5TISC 5LEJA 3SZGA 4B48A 4RGUA 1X2MA 4V2GA 2GZWA 3V4GA 1LFPA 4L9NA 4UVBA 2QQAA 5BQTA 3VFZA 2WB1N 4CH7A 4PDKA 2E2JJ 4G6QA 2OQRA 1I27A 3LAJA 1ZR4A 4XLCA 1TWFJ 2JUGA 3WTWC 2LOOA 4G9YA 2KMUA 2JZYA 3ML6A 4KMFA 4NUBA 2P5KA 1JT6A 1WRJA 2X1CA 3HRUA 4OOIA 1TL8A 1AOYA 5D6FA 3CCRI 3M4OJ 2FJ1A 4KN4X 2DA1A 1EF4A 2E71A 2A6HF 3I59A 5F08A 2VUMJ 1P4AA 5B1BH 2BY1A 2WWYA 1T6SA 2BHYA 3H5AA 4EATA 3C18A 3Q0WA 3FXRA 4C3HJ 2Q8KA 1JUPA 4OU0A 2HGCA 2HOSA 4RLFA 4P1WA 3GX4X 4G94A 2HDWA 3DCFA 2O61A 4G6TB 2JSPA 2CO5A 5FRMA 1JHHA 2HKOA 2VE9A 1DU6A 1P92A 1TT5B 4HNUA 3MKZA 2F2EA 1SFOJ 1I39A 4A6DA 4AUXA 3T1BA 5D4RA 1FEXA 1XGOA 1IUFA 1WJDA 5E1XA 3QU3A 2ZO4A 3QWLA 3VYTB 1FOXA 2M8GX 4CCJA 3AG2H 1XD7A 1XG1A 3X2QH 1R58A 3L2WA 4ZC3A 4RB0A 2DPDA 2RREA 2FBIA 1D1AA 4WXDA 1R5GA 3K2ZA 2NRAC 4YIIA 2NVYJ 2VE8A 4XKCA 1YE9A 1YG2A 1YW8A 2YX4A 2ME0A 3KEQA 3L7WA 5ILSA 4BHBA 1A6IA 4CCMA 2VB6A 5E1WA 4M3EA 3IKVA 3S3OA 5H20A 1XDSA 4QLCU 4XKWA 3IL2A 1KQ9A 1SMTA 3FMRA 1KGSA 3K1PA 4LJZF 1SC7A 1VQ6I 3QPLA 3S3NA 4B8XA 1VNDA 3L2RA 1LNWA 2IGMA 1R9TJ 1XMAA 2COBA 2GAUA 4FETA 2F5DA 1FX7A 1MH3A 2V7FA 1MNEA 3CUOA 1G3YA 2M4GA 4RMNA 3KZIC 3T8RA 3PNTA 4D7MA 3E6CC 5F04A 4XLAA 3CUQC 3LSIA 2IGKA 4AM3A 4L5EA 3G1MA 3S16J 3U2RA 4L9TA 3MCZA 3D5LA 4IRHA 1MSEC 3O8GA 4RDUA 2X1DA 5BMZA 4IRIA 3GEZA 4K2EA 3ZQGA 3HRTA 3WE2A 1Q1HA 3OL4A 2ELJA 3G1OA 2M0CA 3BQZA 1N75A 3HSFA 2M5WA 3SHFA 3CCQI 3JSOA 1YI2I 1POGA 2MH9A 2XRLA 3KLNA 2DA7A 2LKSA 3I55I 4IPAA 4RB2C 1FSHA 1TP4A 2R4GA 2W48A 3FXQA 1P7IA 1MBGA 2V9PA 3ZMTA 1RIOH 2GLOA 2YS9A 2L3DA 2B9SA 4UHTA 3TO9A 3KX2A 1SVOA 1XSVA 3ZMZA 1BI2A 2XUBA 4EJOA 4F55A 2BXYA 2IPQX 4QTRA 4M6YA 4PGHA 3VYSB 4CUGA 4L18B 2I5UA 1QU3A 4X0GA 2DT6A 3RI4A 3OYAA 3OS1A 4A5MA 4L9JA 1XS9A 2E2HJ 4IZZA 5EG0B 2LKPA 4MGRA 3U9GA 5K5QA 2XAGA 2LFBA 1Y0NA 2RAEA 4ZDLA 2R5YB 1B9MA 1DP7P 3QYFA 3SFIA 5HDKA 4D1QA 5BNGA 3DPUA 2QQ8A 4B4CA 3KPHA 1LEAA 4LLGF 2E1CA 1NH3A 3LSKA 2XIGA 3JTGA 4D0PA 2EILH 3FMSA 4W97A 4ZTJA 2XGEA 1FYMA 2EIJH 4RM3A 2X48A 3S93A 4UUSB 3CCSI 2K9LA 3G4SI 5H2FC 1P4XA 1RKWA 1TZLA 3A0BC 1HF0A 4MFEA 1LDDA 5M5YJ 2XAJA 1S6LA 2TCTA 2FMLA 4GCVA 1BOAA 3CCYA 3L2QA 1OJLA 4RGSA 3REOA 1R5HA 2DYSH 4A3BJ 1XGSA 3FHNA 1D3YA 5H6RA 4TV7A 4BGDA 3HOTA 1E3PA 1H89C 5JLWA 3BZCA 1RR7A 3RZDJ 1A5JA 2JPBA 2VQLA 4A3JJ 2R5YA 3K9TA 5LGTA 3CDHA 3BJOA 4CYCB 1IUYA 3FXMA 4RS8A 1BIBA 5F27A 1W1WE 1ZELA 4HX4A 4KNYA 1FPQA 3GZ5A 3M07A 4XSXF 1GHCA 3BTIA 5J1YA 4O3MA 3PFYA 4UUSA 1Y39A 1T98A 1LVKA 2XAUA 4PSXA 3COAC 1Y56A 3LSJA 3PSFA 2Z5UA 5B66C 2JA5J 2ZJ2A 1WSUA 3MN2A 3LFKA 4WXCA 4Y15A 3CCMI 1T0FA 2P7VB 1P2FA 3SEZA 2V9KA 5EYRA 4LB6B 3E5QA 3PUBA 1SFUA 1VTNC 4M6XA 5DYMA 3H3ZA 1KQ8A 2A07F 4A6EA 4NQWB 5CVJA 2ESNA 2LY9A 4A3FJ 4XKVA 3OS0A 1V5FA 2WV1A 3TP0A 2OBPA 2STTA 4A69C 3ISPA 4CYCA 5JR3A 3DLAA 5HS9A 4BYYA 4UB6C 3D0SA 5HLTA 2WY7Q 1ZRDA 1P7JA 3O3KA
chains in the Genus database with same CATH topology
5GP9A 1Y1VJ 2D5VA 4Y52J 3JREA 5M3MJ 2XB5A 5K7FA 5F1JA 2L7ZA 3VPRA 1MH4A 2HYJA 1U9OA 3BR0A 3JRHA 2R0QC 2M2EA 3NAUA 2EZKA 1IDZA 1YRNB 3FISA 3BR5A 3OIOA 4IHYA 2Y2ZA 2NVXJ 4C3IJ 5C4JJ 4BY1J 1ETKA 4BBRJ 1LE8B 3PO2J 2MGQA 3I4NJ 4I6ZA 4M3BA 3HOVJ 3JR9A 2VKEA 3D1NI 1JJ8C 2B63J 3HOYJ 5J1UA 1ZK8A 4QIWN 2DTZA 1RKTA 4AC0A 4BBSJ 2DA2A 2DMQA 3W6VA 3BG3A 2LKXA 3HGYA 2HOTA 2R7ZJ 1OCPA 3TEDA 2KDZA 5F0HA 2JA7J 1HOMA 2R93J 1RESA 3HB9A 3TP3A 2DA5A 1WI3A 1ETOA 2VI6A 4J19A 3Q3SA 1QVTA 3H3VK 2HI3A 2DA4A 1JUSA 4C2MJ 3BG9A 2H1KA 2EZLA 2ID3A 1Z77A 5E3OA 3A01B 2QF7A 3IH4A 1B8IB 3HOXJ 4GFBA 1MNMC 2M34A 1B72B 4QSHA 5EG0A 1TWAJ 3TW7A 2CUEA 2CUFA 4A3LJ 5DS9A 1RETA 5K7ZA 2HXOA 1UHSA 4V2FA 1JKOC 2TRTA 3GTJJ 1APLC 3RQIA 3HOWJ 2I10A 3SJMA 1MBFA 5EGOB 3Q0UA 1QPIA 1JKQC 3HM5A 3NARA 9ANTA 1TC3C 1FTZA 4BY7J 2CQXA 2NOGA 1ITYA 5K7HA 3Q0VA 3BR6A 1U9NA 3HDDA 5FKKA 3A03A 4FE4A 4MFDA 5FLVA 3HOUJ 1ORKA 4XRSA 1VI0A 2CRGA 3FK6A 3HOZJ 3JRDA 3S15J 1ETVA 4XK4A 1BJZA 2MW8A 2LD5A 3B6CA 4G12A 2FD5A 2N8GA 2QCOA 2H8RA 4UUTA 2DMTA 3C2BA 3TW6A 1VFCA 3FIWA 4A3MJ 1B72A 2L0KA 1TWCJ 3QPSA 2LP0A 2L7FP 1GV2A 2WAQN 1NK3P 4JX5A 2YU9J 1F36A 5JLXA 1GT0C 3LSGA 4A3CJ 4A93J 5EGOA 3FKIJ 1PUFB 4FISA 3BR2A 2YUSA 3E7LA 2E2IJ 3ZQCA 2Y9ZA 5GPCA 1X58A 2FX0A 5IP9J 2EQRA 2NS8A 2JA8J 1AHDP 2PMZN 3A02A 4A3EJ 2FQ4A 1UMQA 4DZJA 5IYDJ 1WGXA 4AYBN 2LR8A 4C3JJ 4FTHA 2R5ZB 1F43A 1D5YA 2HXIA 3BTJA 1FJLA 4X6AJ 5HODA 1HLVA 1FIAA 1S7EA 2DJNA 1ZR2A 2JJ7A 1BA5A 2K9QA 1I3QJ 4DW6A 3S1QJ 4HNVA 3GTOJ 2EZIA 1ENHA 1GDTA 1JKPC 4IHWA 3S14J 1WCMJ 1JGGA 3BR1A 1MBEA 2L7MP 2XB0X 4NDLA 1QRYA 2LK2A 4BKXA 3GBGA 1MBHA 2JK3A 4IHVA 3HBLA 1WH5A 1OFCX 2CU7A 5FKLA 4ABZA 3S2HJ 1PUFA 1HDDC 5C4XJ 5E3NA 1JKRC 2CQQA 2XPVA 1AKHB 4B3AA 2K9SA 1CQTA 2XSDC 4RBOA 4A3GJ 1U8BA 2DMNA 3LSPA 3OSFA 1I6HJ 1W0UA 1K61A 1W0TA 3LNQA 1X2MA 2ELKA 4V2GA 2ID6A 2WB1N 2E2JJ 3I4MJ 2Y31A 5E3MA 1ZR4A 3CDLA 1TWFJ 3ZQFA 1YRNA 3PO3J 1XC5A 1HCRA 5IP6A 1IGNA 1JT6A 1WPKA 1ETYA 4XRSG 3M4OJ 2FJ1A 2DA1A 1LE8A 1EF4A 3LOCA 2MG4A 5F08A 2VUMJ 3WHBA 2G0EA 5FLMJ 1ZTRA 2E19A 3Q0WA 4C3HJ 1H8AC 1Q1VA 3SDGA 1JUPA 1T56A 2HOSA 3BTLA 2IAIA 3DCFA 2EBIA 4D5FA 2LVSA 4IEJA 1SANA 3GTGJ 1DU6A 3OOUA 5IPAA 2ECCA 1SFOJ 2JWTA 1TWHJ 4AUXA 4DYQA 1FEXA 5EZHA 2CJJA 1RPWA 1IUFA 1GVDA 1JJ6C 2X9DA 2E1OA 4D5CA 2M8GX 1ETXA 2VPRA 1MBJA 1XG1A 3S17J 5IOYA 2ME6A 3A01A 5IYCJ 1B8IA 1DU0A 2Y30A 3MVPA 2XPWA 2NVYJ 4M6VA 1IRZA 5FJ8J 4A3IJ 2ME0A 1A6IA 3RKQA 2VKVA 5M5XJ 2NVQJ 4M3EA 2K9NA 5DTDA 4JP0A 1Z0XA 3JRBA 2EZHA 3QPLA 1P7JA 3HKZN 3S2DJ 1VNDA 4MO7A 4D7NA 2ECBA 1BW5A 1R9TJ 2COBA 1FIPA 1JT0A 3GTLJ 4XICA 1MH3A 1ETWA 1Y1WJ 4D7MA 2IBDA 5F04A 4IHXA 4L5EA 3G1MA 2HQ5A 3LSRA 3S16J 1JUMA 3BG5A 5EF6A 3UKGA 1T33A 3DEWA 1WH7A 1MSEC 3O8GA 5F0CA 2Y9YA 4RDUA 4EEFG 1OCTC 3ZQGA 2ZB9A 3G1OA 2M0CA 3OSGA 2GM4A 1I50J 2JN6A 3BQZA 2OPTA 3PM1A 1ETQA 1GUUA 3L1PA 4XIDA 3S1RJ 2DMUA 4JX4A 5C44J 5IP7J 1POGA 2XRLA 2DA7A 3K2AA 1X2NA 2W48A 1P7IA 3ZQLA 1MBGA 1MBKA 1VF9A 5EDNA 2GLOA 4S0HB 2YS9A 2DA3A 2OF7A 2MSYA 5J1RA 3JRGA 2NS7A 2DA6A 4QTRA 3RZOJ 3JRAA 1IC8A 2NVTJ 2M9HA 2R5ZA 1FTTA 5F0FA 1XS9A 2E2HJ 5EG0B 2IEKA 3BR3A 3O8HA 3JRIA 3K7AJ 5GPAA 5FKMA 1H88C 2LFBA 2RAEA 1ZGWA 2R5YB 2Y0SN 3ZQHA 1QVUA 1ZQ3P 3CMYA 3SFIA 2R92J 5BNGA 4B4CA 4DZPA 4Y7NJ 2XGCA 4DYRA 1BL0A 2XPUA 4W97A 1MSFC 1LFBA 2XGEA 4FE7A 5IYBJ 4UUSB 2X48A 1G2HA 3G1LA 4MIMA 1RKWA 3S1NJ 1NTCA 4MFEA 5M5YJ 3JRCA 1HF0A 1AKHA 3HEFA 2DN0A 2TCTA 2XGDA 3ZOBA 4FCYA 3GTKJ 4JX6A 4A3KJ 4JYKA 3CCYA 1K83J 1OJLA 4B1RA 1U78A 4A3BJ 2LLKA 4XRMA 5J3LA 1H89C 5JLWA 1RR7A 3RZDJ 3BT9A 1AU7A 1A5JA 4A3JJ 3WHCA 2R5YA 3ZQIA 2P81A 4CYCB 1O4XA 4LOCA 2JA6J 3BQYA 4A3DJ 3M3YJ 5F27A 2GBYA 1JTXA 3F0CA 1BW6A 5C3EJ 4DYCA 3IH3A 2O9LA 1GV5A 2DMPA 3BTIA 5J1YA 5FKOA 2KT0A 4UUSA 1LFUP 5M5WJ 5EEAA 3FK7A 5IOZA 3CQZJ 2O8KA 4M3DA 3B6AA 3MKLA 2HOAA 3LSJA 4W1UA 3BTCA 2JA5J 1HDPA 3MN2A 3IH2A 2JMWA 4X1EA 2X6OA 1TWGJ 3IV5A 5EYRA 1UG2A 1ZKGA 2HDDA 3QQAA 1NK2P 3JRFA 2K40A 2AHQA 4MLOA 1IG7A 2O7OA 2EH3A 2LY9A 5E3LA 4A3FJ 4I76A 4M3GA 2LTPA 2AO9A 5FKNA 2WV1A 4BXXJ 3TP0A 3HGGA 4A69C 4CYCA 3S1MJ 2L9RA 1E3OC 1IV6A 3GTQJ 3H0GJ 5EZGA 3GTMJ 5M3FJ 1JTYA 3GTPJ 1IJWC 4M3FA 1IDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GP9 A;  1Y1V J;  2D5V A;  4Y52 J;  3JRE A;  5M3M J;  2XB5 A;  5K7F A;  5F1J A;  2L7Z A;  3VPR A;  1MH4 A;  2HYJ A;  1U9O A;  3BR0 A;  3JRH A;  2R0Q C;  2M2E A;  3NAU A;  2EZK A;  1IDZ A;  1YRN B;  3FIS A;  3BR5 A;  3OIO A;  4IHY A;  2Y2Z A;  2NVX J;  4C3I J;  5C4J J;  4BY1 J;  1ETK A;  4BBR J;  1LE8 B;  3PO2 J;  2MGQ A;  3I4N J;  4I6Z A;  4M3B A;  3HOV J;  3JR9 A;  2VKE A;  3D1N I;  1JJ8 C;  2B63 J;  3HOY J;  5J1U A;  1ZK8 A;  4QIW N;  2DTZ A;  1RKT A;  4AC0 A;  4BBS J;  2DA2 A;  2DMQ A;  3W6V A;  3BG3 A;  2LKX A;  3HGY A;  2HOT A;  2R7Z J;  1OCP A;  3TED A;  2KDZ A;  5F0H A;  2JA7 J;  1HOM A;  2R93 J;  1RES A;  3HB9 A;  3TP3 A;  2DA5 A;  1WI3 A;  1ETO A;  2VI6 A;  4J19 A;  3Q3S A;  1QVT A;  3H3V K;  2HI3 A;  2DA4 A;  1JUS A;  4C2M J;  3BG9 A;  2H1K A;  2EZL A;  2ID3 A;  1Z77 A;  5E3O A;  3A01 B;  2QF7 A;  3IH4 A;  1B8I B;  3HOX J;  4GFB A;  1MNM C;  2M34 A;  1B72 B;  4QSH A;  5EG0 A;  1TWA J;  3TW7 A;  2CUE A;  2CUF A;  4A3L J;  5DS9 A;  1RET A;  5K7Z A;  2HXO A;  1UHS A;  4V2F A;  1JKO C;  2TRT A;  3GTJ J;  1APL C;  3RQI A;  3HOW J;  2I10 A;  3SJM A;  1MBF A;  5EGO B;  3Q0U A;  1QPI A;  1JKQ C;  3HM5 A;  3NAR A;  9ANT A;  1TC3 C;  1FTZ A;  4BY7 J;  2CQX A;  2NOG A;  1ITY A;  5K7H A;  3Q0V A;  3BR6 A;  1U9N A;  3HDD A;  5FKK A;  3A03 A;  4FE4 A;  4MFD A;  5FLV A;  3HOU J;  1ORK A;  4XRS A;  1VI0 A;  2CRG A;  3FK6 A;  3HOZ J;  3JRD A;  3S15 J;  1ETV A;  4XK4 A;  1BJZ A;  2MW8 A;  2LD5 A;  3B6C A;  4G12 A;  2FD5 A;  2N8G A;  2QCO A;  2H8R A;  4UUT A;  2DMT A;  3C2B A;  3TW6 A;  1VFC A;  3FIW A;  4A3M J;  1B72 A;  2L0K A;  1TWC J;  3QPS A;  2LP0 A;  2L7F P;  1GV2 A;  2WAQ N;  1NK3 P;  4JX5 A;  2YU9 J;  1F36 A;  5JLX A;  1GT0 C;  3LSG A;  4A3C J;  4A93 J;  5EGO A;  3FKI J;  1PUF B;  4FIS A;  3BR2 A;  2YUS A;  3E7L A;  2E2I J;  3ZQC A;  2Y9Z A;  5GPC A;  1X58 A;  2FX0 A;  5IP9 J;  2EQR A;  2NS8 A;  2JA8 J;  1AHD P;  2PMZ N;  3A02 A;  4A3E J;  2FQ4 A;  1UMQ A;  4DZJ A;  5IYD J;  1WGX A;  4AYB N;  2LR8 A;  4C3J J;  4FTH A;  2R5Z B;  1F43 A;  1D5Y A;  2HXI A;  3BTJ A;  1FJL A;  4X6A J;  5HOD A;  1HLV A;  1FIA A;  1S7E A;  2DJN A;  1ZR2 A;  2JJ7 A;  1BA5 A;  2K9Q A;  1I3Q J;  4DW6 A;  3S1Q J;  4HNV A;  3GTO J;  2EZI A;  1ENH A;  1GDT A;  1JKP C;  4IHW A;  3S14 J;  1WCM J;  1JGG A;  3BR1 A;  1MBE A;  2L7M P;  2XB0 X;  4NDL A;  1QRY A;  2LK2 A;  4BKX A;  3GBG A;  1MBH A;  2JK3 A;  4IHV A;  3HBL A;  1WH5 A;  1OFC X;  2CU7 A;  5FKL A;  4ABZ A;  3S2H J;  1PUF A;  1HDD C;  5C4X J;  5E3N A;  1JKR C;  2CQQ A;  2XPV A;  1AKH B;  4B3A A;  2K9S A;  1CQT A;  2XSD C;  4RBO A;  4A3G J;  1U8B A;  2DMN A;  3LSP A;  3OSF A;  1I6H J;  1W0U A;  1K61 A;  1W0T A;  3LNQ A;  1X2M A;  2ELK A;  4V2G A;  2ID6 A;  2WB1 N;  2E2J J;  3I4M J;  2Y31 A;  5E3M A;  1ZR4 A;  3CDL A;  1TWF J;  3ZQF A;  1YRN A;  3PO3 J;  1XC5 A;  1HCR A;  5IP6 A;  1IGN A;  1JT6 A;  1WPK A;  1ETY A;  4XRS G;  3M4O J;  2FJ1 A;  2DA1 A;  1LE8 A;  1EF4 A;  3LOC A;  2MG4 A;  5F08 A;  2VUM J;  3WHB A;  2G0E A;  5FLM J;  1ZTR A;  2E19 A;  3Q0W A;  4C3H J;  1H8A C;  1Q1V A;  3SDG A;  1JUP A;  1T56 A;  2HOS A;  3BTL A;  2IAI A;  3DCF A;  2EBI A;  4D5F A;  2LVS A;  4IEJ A;  1SAN A;  3GTG J;  1DU6 A;  3OOU A;  5IPA A;  2ECC A;  1SFO J;  2JWT A;  1TWH J;  4AUX A;  4DYQ A;  1FEX A;  5EZH A;  2CJJ A;  1RPW A;  1IUF A;  1GVD A;  1JJ6 C;  2X9D A;  2E1O A;  4D5C A;  2M8G X;  1ETX A;  2VPR A;  1MBJ A;  1XG1 A;  3S17 J;  5IOY A;  2ME6 A;  3A01 A;  5IYC J;  1B8I A;  1DU0 A;  2Y30 A;  3MVP A;  2XPW A;  2NVY J;  4M6V A;  1IRZ A;  5FJ8 J;  4A3I J;  2ME0 A;  1A6I A;  3RKQ A;  2VKV A;  5M5X J;  2NVQ J;  4M3E A;  2K9N A;  5DTD A;  4JP0 A;  1Z0X A;  3JRB A;  2EZH A;  3QPL A;  1P7J A;  3HKZ N;  3S2D J;  1VND A;  4MO7 A;  4D7N A;  2ECB A;  1BW5 A;  1R9T J;  2COB A;  1FIP A;  1JT0 A;  3GTL J;  4XIC A;  1MH3 A;  1ETW A;  1Y1W J;  4D7M A;  2IBD A;  5F04 A;  4IHX A;  4L5E A;  3G1M A;  2HQ5 A;  3LSR A;  3S16 J;  1JUM A;  3BG5 A;  5EF6 A;  3UKG A;  1T33 A;  3DEW A;  1WH7 A;  1MSE C;  3O8G A;  5F0C A;  2Y9Y A;  4RDU A;  4EEF G;  1OCT C;  3ZQG A;  2ZB9 A;  3G1O A;  2M0C A;  3OSG A;  2GM4 A;  1I50 J;  2JN6 A;  3BQZ A;  2OPT A;  3PM1 A;  1ETQ A;  1GUU A;  3L1P A;  4XID A;  3S1R J;  2DMU A;  4JX4 A;  5C44 J;  5IP7 J;  1POG A;  2XRL A;  2DA7 A;  3K2A A;  1X2N A;  2W48 A;  1P7I A;  3ZQL A;  1MBG A;  1MBK A;  1VF9 A;  5EDN A;  2GLO A;  4S0H B;  2YS9 A;  2DA3 A;  2OF7 A;  2MSY A;  5J1R A;  3JRG A;  2NS7 A;  2DA6 A;  4QTR A;  3RZO J;  3JRA A;  1IC8 A;  2NVT J;  2M9H A;  2R5Z A;  1FTT A;  5F0F A;  1XS9 A;  2E2H J;  5EG0 B;  2IEK A;  3BR3 A;  3O8H A;  3JRI A;  3K7A J;  5GPA A;  5FKM A;  1H88 C;  2LFB A;  2RAE A;  1ZGW A;  2R5Y B;  2Y0S N;  3ZQH A;  1QVU A;  1ZQ3 P;  3CMY A;  3SFI A;  2R92 J;  5BNG A;  4B4C A;  4DZP A;  4Y7N J;  2XGC A;  4DYR A;  1BL0 A;  2XPU A;  4W97 A;  1MSF C;  1LFB A;  2XGE A;  4FE7 A;  5IYB J;  4UUS B;  2X48 A;  1G2H A;  3G1L A;  4MIM A;  1RKW A;  3S1N J;  1NTC A;  4MFE A;  5M5Y J;  3JRC A;  1HF0 A;  1AKH A;  3HEF A;  2DN0 A;  2TCT A;  2XGD A;  3ZOB A;  4FCY A;  3GTK J;  4JX6 A;  4A3K J;  4JYK A;  3CCY A;  1K83 J;  1OJL A;  4B1R A;  1U78 A;  4A3B J;  2LLK A;  4XRM A;  5J3L A;  1H89 C;  5JLW A;  1RR7 A;  3RZD J;  3BT9 A;  1AU7 A;  1A5J A;  4A3J J;  3WHC A;  2R5Y A;  3ZQI A;  2P81 A;  4CYC B;  1O4X A;  4LOC A;  2JA6 J;  3BQY A;  4A3D J;  3M3Y J;  5F27 A;  2GBY A;  1JTX A;  3F0C A;  1BW6 A;  5C3E J;  4DYC A;  3IH3 A;  2O9L A;  1GV5 A;  2DMP A;  3BTI A;  5J1Y A;  5FKO A;  2KT0 A;  4UUS A;  1LFU P;  5M5W J;  5EEA A;  3FK7 A;  5IOZ A;  3CQZ J;  2O8K A;  4M3D A;  3B6A A;  3MKL A;  2HOA A;  3LSJ A;  4W1U A;  3BTC A;  2JA5 J;  1HDP A;  3MN2 A;  3IH2 A;  2JMW A;  4X1E A;  2X6O A;  1TWG J;  3IV5 A;  5EYR A;  1UG2 A;  1ZKG A;  2HDD A;  3QQA A;  1NK2 P;  3JRF A;  2K40 A;  2AHQ A;  4MLO A;  1IG7 A;  2O7O A;  2EH3 A;  2LY9 A;  5E3L A;  4A3F J;  4I76 A;  4M3G A;  2LTP A;  2AO9 A;  5FKN A;  2WV1 A;  4BXX J;  3TP0 A;  3HGG A;  4A69 C;  4CYC A;  3S1M J;  2L9R A;  1E3O C;  1IV6 A;  3GTQ J;  3H0G J;  5EZG A;  3GTM J;  5M3F J;  1JTY A;  3GTP J;  1IJW C;  4M3F A;  1IDY A; 
#chains in the Genus database with same CATH topology
 5LHH A;  1QNT A;  3KP4 A;  1Y1V J;  2D5V A;  2YU3 A;  2H94 A;  3M1C A;  2XSJ C;  4KMU X;  1L0O C;  1EH6 A;  1W7P D;  1RI7 A;  3VPR A;  1ZYR F;  2D1V A;  4AIJ A;  4HSR A;  3WG7 H;  3JRH A;  3R60 A;  2R0Q C;  1IDZ A;  3KFW X;  4AIK A;  3KLO A;  3OIO A;  4BDZ A;  2HDC A;  4MQ9 F;  3OYE A;  3DXJ F;  1KA8 A;  1J9I A;  3KZY A;  4I99 C;  5ED4 A;  5DCM B;  5EEG A;  4YFN F;  2VT3 A;  4BBR J;  4ZYH A;  1LE8 B;  3ERE D;  1UST A;  2XGX A;  2PG4 A;  4R79 A;  1VQ4 I;  5DM6 F;  3TOB A;  1JJ8 C;  2B63 J;  1FBS A;  2GIZ A;  5DEQ A;  5J1U A;  2BXZ A;  1RKT A;  1G4D A;  4BBS J;  5J4Y A;  2HQA A;  4G7H F;  2PMU A;  3KP7 A;  2E5N A;  3W2W A;  4AVP A;  3ASN H;  2DMQ A;  4Q48 A;  1ZLK A;  1QZZ A;  1IXS B;  2FEZ A;  3HGY A;  1O3S A;  2Z33 A;  1USS A;  4L5I A;  4AYB A;  3HHH A;  4OAZ A;  2RNG A;  3D5R C;  3H3U A;  4PZJ A;  3TOA A;  5F0H A;  3VSL A;  1VQP I;  3BC8 A;  1RES A;  2W00 A;  3TP3 A;  1E2X A;  1QHH D;  2VT2 A;  4P9F A;  3CLQ A;  3WTV C;  2V6C A;  5J6X A;  1QVT A;  3EUK L;  4HW0 A;  2ID3 A;  1EH7 A;  3Q9S A;  4AU7 A;  5E3O A;  3JSP A;  3K1N A;  3A0H C;  1UJ8 A;  4ZYA A;  3ZXS A;  5JHU A;  4B47 A;  1MNM C;  4PJJ A;  4I0A A;  1OCR H;  1QZE A;  3DF8 A;  3F8M A;  3DTI A;  1RET A;  3E0J B;  2MAB A;  4BQN A;  5K7Z A;  1JKO C;  2LF7 A;  3GTJ J;  2CQ7 A;  3RQI A;  4IQJ A;  1D0Z A;  2I10 A;  5D8K B;  1MBF A;  3SJM A;  1OIS A;  1TLH B;  1QPI A;  1JKQ C;  3HM5 A;  1TC3 C;  2AS5 F;  3K4C A;  1XGM A;  2ZME C;  4I09 A;  2A5W A;  1ZG5 A;  2NOG A;  2HYF A;  4YRV A;  3BR6 A;  3HDD A;  4FT8 A;  5FKK A;  3ABK H;  4HQM A;  4EM1 A;  2KIS A;  3ESW B;  5FLV A;  3HOU J;  1U5T B;  4I01 A;  3TO6 A;  1BJA A;  3TKY A;  3ZN1 A;  1KYW A;  2CRG A;  4AID A;  2E7W A;  5FD5 A;  4ESF A;  3I53 A;  1RUN A;  1ETV A;  2KJC A;  3WOD F;  4EJU A;  2N8G A;  3T5X A;  5TJJ A;  1I3A A;  2QCO A;  4BJ6 C;  3ASO H;  2H8R A;  4XSZ F;  2HZT A;  3C2B A;  3TW6 A;  2LRE A;  2P7C B;  3PFI A;  3I71 A;  4A3M J;  2L0K A;  1XTA A;  2W84 A;  1XMK A;  4LK1 F;  3QPS A;  4XON A;  3OYK A;  4R1H A;  1HW1 A;  5L3F A;  1GV2 A;  3VB2 A;  4ZDP A;  2WAQ N;  1ZHF A;  3TDZ C;  1Z67 A;  2ZNZ A;  4JX5 A;  5HS7 A;  4RAF A;  1MMA A;  4A93 J;  1HKT A;  4BE2 A;  2E2I J;  4YEJ A;  2HTS A;  2F48 A;  5GPC A;  4IHS A;  2IS1 A;  1XCB A;  2FX0 A;  2A3S A;  4OMY A;  1H9T A;  3IKT A;  4LLN A;  2ELH A;  2QSG X;  1UMQ A;  4EJT A;  5IYD J;  1U5T A;  3DPT A;  1WGX A;  2A69 F;  3ROU A;  3GFJ A;  3KP2 A;  3PIO F;  2ETH A;  3HTS B;  4C3J J;  3RDI A;  5D4S A;  1FJL A;  4YG2 F;  2MD0 A;  5LEK A;  5CKT A;  4HDV A;  5TGT A;  3WG9 A;  5CQE A;  3WTY C;  2UV1 A;  5GAE J;  4LB5 A;  3S1Q J;  1O3Q A;  1NHA A;  1DUX C;  3RQ4 A;  3S32 A;  4A0Y A;  3M8J A;  1JKP C;  3VSK A;  4IHW A;  4H4K C;  1R00 A;  4OIN F;  1SFK A;  1EKE A;  1OKR A;  2AQE A;  1JGG A;  1XN7 A;  3CP8 A;  3FWE A;  3BLY A;  3GBG A;  2DOA A;  3CUQ B;  3HBL A;  2GXB A;  1OFC X;  2RQQ A;  5FKL A;  3KYD B;  4RM2 A;  5HNF A;  1HDD C;  5E3N A;  1JKR C;  5KVR A;  2FOW A;  2VBY A;  4LMY A;  4HEA 2;  3ZN0 A;  4AWX B;  3OMY A;  1CQT A;  2VAS A;  3RSN A;  3RYR A;  4AD9 A;  3HRS A;  4BJ5 C;  3V7R A;  3OSF A;  4PJN A;  2VC1 A;  3P9C A;  1W0T A;  3LNQ A;  1HA8 A;  2ELK A;  3PNV A;  2X6Y A;  3MEX A;  1HBX G;  2NNN A;  4RAG A;  1XDU A;  4Z2Y A;  5CVR A;  4HAM A;  3EYY A;  2WAF A;  4JK1 X;  3CDL A;  4ZH4 F;  4F52 A;  3ZQF A;  1YRN A;  1UFM A;  3GZN B;  3AL0 B;  2UUZ A;  1XC5 A;  1MW7 A;  1QQI A;  5IP6 A;  5K1Y A;  2C6Y A;  1WPK A;  3QP6 A;  3R4K A;  4XRS G;  2YX7 A;  4WWC A;  3DQV C;  2DTR A;  3WTX C;  5FB2 A;  3DBH B;  5CYV A;  2EWN A;  2F4I A;  2G0E A;  1FSE A;  3ECO A;  1S9H A;  1MMN A;  1U8R A;  1TW2 A;  2DXI A;  3A2K A;  3SDG A;  3HHG A;  3HZJ A;  2CUZ A;  1RR8 C;  2VXD A;  2W7N A;  2V4J C;  3BTL A;  3BY6 A;  2EBI A;  1PYV A;  2ESH A;  1J5Y A;  1YYV A;  4D5F A;  4HRI A;  4WCG A;  2KPM A;  2HYG D;  3TL4 X;  4CXF A;  4BQQ A;  5IPA A;  3RIR A;  2ECC A;  4XLH A;  2VOO A;  2JWT A;  1TWH J;  2CQK A;  1GVD A;  4JQF A;  1I5Z A;  3QOP A;  4F92 B;  2WAD A;  4V19 K;  3H36 A;  2O0Y A;  1Y8R B;  2BGC A;  5IT3 A;  2X9D A;  2E1O A;  3H92 A;  4XKB A;  5E1Z B;  3OV8 A;  2VPR A;  3G73 A;  1KQ0 A;  5L3E A;  3DBR B;  5L3G A;  2JTV A;  5IOY A;  1WJB A;  2YPR A;  2VQH A;  1U6G A;  2MC4 A;  3GVA A;  1B8I A;  2J5P A;  4KUM A;  4M6V A;  5E8I A;  4A3I J;  1JE8 A;  2IW5 A;  1XSD A;  1W5T A;  2VKV A;  2Z2S B;  2PLY A;  2MFZ A;  5DTD A;  3OYC A;  3JRB A;  1J59 A;  1UG0 A;  2DDA A;  3IAM 2;  4CZC A;  2EZH A;  1ZG1 A;  2R7U A;  3CTA A;  2RV8 A;  1H0M A;  3F6V A;  1ZAR A;  4HV5 A;  1BW5 A;  5J40 A;  1YIJ I;  5HLH A;  4C2U A;  3E5X A;  2KHM A;  4XIC A;  3G71 I;  2L2O A;  2Y75 A;  4NC8 A;  1Y1W J;  2A6E F;  2F5C A;  5HNH A;  1U3E M;  3CDI A;  3OYM A;  2DJI A;  5GTI C;  2HPI A;  1V3F A;  3RJP A;  3VWB A;  2HQ5 A;  1JUM A;  3LAP A;  5EF6 A;  3GW2 A;  2KIQ A;  4IRG A;  3DEW A;  3QYB A;  3LSM A;  3OIQ A;  2Y9Y A;  3ULQ B;  4HZF A;  1OCT C;  1LVA A;  4B43 A;  1ZGA A;  2EFW A;  1I50 J;  1ACI A;  1RUO A;  3PM1 A;  1R49 A;  1GUU A;  4A0X A;  4QPO A;  2DMU A;  4XLN F;  2AXL A;  5IP7 J;  5HDG A;  5KK1 A;  1BOB A;  1X2N A;  2HVR A;  4BQO A;  1QHG A;  2WBM A;  2CUJ A;  2CV2 A;  3KP3 A;  2OCC H;  4A2U A;  2DDB A;  4FQG A;  2QKM B;  2ICW G;  5FD6 A;  2HR3 A;  2BEO A;  2RVC A;  3JRG A;  1TQM A;  1BI0 A;  2DA6 A;  2FBH A;  3ZRG A;  3K6G A;  2WAQ A;  2B7E A;  2P6S A;  2XAF A;  4XN0 A;  3RKW A;  4E4H A;  3OS2 A;  2M9H A;  2MD5 A;  4GYI A;  3OYI A;  3GFI A;  4EJW A;  3J80 Z;  3K7A J;  5FKM A;  1H88 C;  1A31 A;  2X6W A;  1ZGW A;  3FXJ A;  3W2A A;  3K4N A;  1J09 A;  4ZDO A;  2Y0S N;  1QVU A;  5LGU A;  2V79 A;  3CMY A;  1PDN C;  1FLI A;  2GOM A;  4C9Y A;  3H1C A;  3I58 A;  4DZP A;  5DD8 A;  2NYX A;  4YIF A;  3G3Z A;  4DIQ A;  2XGC A;  2H6B A;  1IXC A;  1R4N B;  2PJR B;  2PBI A;  2TDX A;  3CLO A;  4FE7 A;  5IYB J;  3F6O A;  2FNA A;  1OYY A;  3M8F A;  3BG6 A;  2BVM A;  1IN5 A;  2ZXI A;  4HV6 A;  2XAS A;  1IRF A;  2X85 A;  3RCO A;  4UNO A;  4FCY A;  2Q1Z B;  1IN8 A;  4JX6 A;  1HST A;  4JYK A;  3L2V A;  1K83 J;  1U78 A;  2K02 A;  2R3S A;  2V9V A;  3RKX A;  3KCC A;  3U21 A;  2CFX A;  3PSI A;  2A61 A;  4HBL A;  4EGZ A;  5FRN A;  2JRT A;  2COM A;  4CDG A;  2DQL A;  3BT9 A;  1S7A A;  3FXL A;  2LNB A;  4DBQ A;  4OIP F;  3V7S A;  2OZU A;  4G7Z F;  3WU0 A;  2Z16 A;  1SAX A;  4DJA A;  1QZY A;  3S8P A;  2JA6 J;  1A35 A;  2ZBK A;  1VQ5 I;  3M3Y J;  1E3H A;  3F0C A;  1X1D A;  3TO7 A;  2PJR A;  5KCM A;  3EDP A;  3GWZ A;  2GOX B;  3IH3 A;  4KIB A;  2KT0 A;  2W1O A;  5M5W J;  4J01 A;  3V8J A;  5IOZ A;  3CCJ I;  4M9X A;  3B6A A;  1O7L A;  3K4B A;  3MKL A;  2HOA A;  2FOK A;  4W1U A;  4OIQ F;  4R8H A;  3ZR8 X;  1K6O A;  1ZRF A;  4HF0 A;  4X1E A;  3IV5 A;  4XM3 A;  3IUO A;  1MND A;  1HSJ A;  4RB3 C;  1ONV A;  1OR7 C;  1ODD A;  5JVT A;  2DFH A;  4XMY A;  2XC7 A;  3JRF A;  1P4W A;  2K40 A;  3E1S A;  4U0Y A;  4EVI A;  4CIC A;  3AFH A;  2EH3 A;  4PUS A;  3SDB A;  1R4M B;  2O03 A;  2EA2 A;  3LA2 A;  4M3G A;  2O6G E;  4BXX J;  1F1Z A;  1A6Q A;  4ON0 A;  3HGG A;  1W7P B;  2ZC2 A;  3GXO A;  3H0G J;  5EZG A;  2OUM A;  5JI6 A;  4BXF A;  2GIV A;  5CVV A;  1YIO A;  2M8E A;  1HQC A;  4Y4R A;  1VQL I;  5GP9 A;  4UB8 C;  1YTY A;  3DV8 A;  3P9I A;  5CPR B;  3PJR A;  1J0R A;  3PL8 A;  2HVS A;  3EUH C;  2Y69 H;  1X1A A;  1YFH A;  5F1J A;  2L7Z A;  2KZG A;  2UXX A;  3F8F A;  1LEB A;  1WJF A;  3WTU C;  3GYH X;  2LH9 A;  4FX4 A;  3EYI A;  1G59 A;  1RNL A;  3F22 A;  2Q2E B;  2QVO A;  4C3I J;  2DI3 A;  2JRM A;  4L0Z B;  3DU5 A;  1SVL A;  1IZ1 A;  3T8T A;  4EGY A;  3CO6 C;  1QA6 A;  1WJE A;  3R61 A;  3BDD A;  2QEN A;  3I4N J;  2RDP A;  3OYB A;  4LG0 B;  4G7O F;  1WQ2 A;  1XMX A;  1ULY A;  1MJA A;  2VKE A;  4M3B A;  4IX7 A;  3HOV J;  3HOY J;  4ENM A;  4AC0 A;  3ELK A;  2KL4 A;  4ZYG A;  1YO5 C;  1K78 B;  2OU2 A;  4BUP A;  4U7D A;  4HLY A;  1FC3 A;  2DOD A;  1FBU A;  2K85 A;  2BOL A;  2H09 A;  4L5J A;  4BDY A;  2B0L A;  3MMY B;  1OCP A;  3TED A;  2R7T A;  3VYU B;  1FMV A;  4EQQ A;  3IWF A;  2VBX A;  1WI3 A;  1ETO A;  2QYO A;  3CP2 A;  1BI1 A;  6PAX A;  2HI3 A;  3M1E A;  2LY2 A;  2Q2E A;  2CFO A;  4C2M J;  2R7D A;  2IXS A;  2ZXH A;  4LLL A;  5JHF A;  1X1C A;  3V8L A;  3A01 B;  3IH4 A;  3C2H A;  4HQE A;  5EG0 A;  1V55 H;  2CUF A;  1R23 A;  5A2Q Z;  1YJW I;  2O8X A;  2QZ8 A;  3GCM A;  4GXO A;  3UR3 C;  3HOW J;  5KAF C;  2BE5 F;  4IF4 A;  5CQG A;  2CMP A;  1C0W A;  2RKH A;  5AON A;  4UV9 A;  2F4M B;  2QUF A;  4KDP A;  1SD7 A;  2MYS A;  4NHJ A;  2NNY A;  2L9N A;  1R6R A;  3Q0V A;  2WB1 A;  1QO0 D;  2BW3 B;  4U87 A;  3FBN B;  1LKX A;  4BJT A;  2QM3 A;  2KDO A;  2VQC A;  1Z9C A;  2Y0S A;  2QQ9 A;  3U1K A;  4CSW A;  5KHD A;  3WU1 B;  1X3Z B;  2K4J A;  3L2U A;  2FD5 A;  1CGP A;  1MDM B;  5A2Q K;  1CF7 B;  2XVC A;  3FIW A;  4AIH A;  3VOD A;  3DPL C;  1ZGJ A;  1TWC J;  2LP0 A;  1VQM I;  1YX3 A;  2R7V A;  1XPX A;  2L7F P;  2F5E A;  2LMD A;  4II3 A;  4KFC A;  1FOW A;  2OTL I;  4IKF A;  4FX0 A;  2EV6 A;  2YU9 J;  1F36 A;  1YOV B;  1GT0 C;  2R7O A;  3LSG A;  4A3C J;  2E1N A;  1GLN A;  3FKI J;  2L9S A;  2G9W A;  2R7R A;  4PFO A;  3CF2 A;  5IP9 J;  5HOO A;  2NS8 A;  4LIU A;  3MD2 A;  2MA3 A;  5D5X B;  2RN7 A;  3HIF A;  2FE3 A;  4BU2 A;  1WHU A;  4A3E J;  3DEU A;  2FQ4 A;  5KAI C;  4LIV A;  2CV1 A;  4ENK A;  1ZLJ A;  2CH0 A;  4FTH A;  3T0Y A;  2R5Z B;  1WZ2 A;  1D5Y A;  2JUC A;  3QAH A;  2CYY A;  1S7E A;  1PVE A;  1G3W A;  2XRO A;  2K9Q A;  1MDM A;  1VQO I;  1I3Q J;  4DW6 A;  1FYK A;  3GTO J;  2EZI A;  4YFX F;  1ENH A;  2RQP A;  5EJC A;  4A0Z A;  1ZH5 A;  4QPQ A;  4NQW A;  4G6D A;  4GRI A;  4KIF A;  3F3X A;  3BR1 A;  5LHG A;  2L7M P;  1AA7 A;  4OMZ A;  1DP3 A;  4BKX A;  5E18 F;  3CCV I;  4IHV A;  1EH8 A;  3OYD A;  3S2H J;  4ABZ A;  1T08 B;  1R1U A;  5ILU A;  4Q47 A;  1AKH B;  2X0L A;  5ERI A;  3HRM A;  4OIO F;  4RBO A;  2JA2 A;  3ERM A;  1U8B A;  2DMN A;  3LSP A;  1O57 A;  3KET A;  4GYG A;  2KIM A;  2K27 A;  3A1Y A;  1RRJ A;  2ZCW A;  5EEH A;  1LB2 A;  3HL2 A;  1D5V A;  2DO7 A;  2ID6 A;  3H35 A;  2E1M B;  4ITV A;  3CES A;  3AAF A;  2JVG A;  2Y31 A;  2NVU B;  4HST A;  2CQN A;  5FGM A;  2WY8 Q;  1R22 A;  1K4T A;  2XHK A;  4KT6 A;  3FXU A;  1YJN I;  1HCR A;  2KRC A;  3E6B A;  1AWC A;  2STW A;  5FFX A;  1ETY A;  5DCM A;  2VN2 A;  1JI8 A;  2NXN B;  1REP C;  1LE8 A;  2AQF A;  4GDF A;  2XAQ A;  2MG4 A;  5BPI A;  2FMY A;  2RNJ A;  1IW7 F;  1YQA A;  3KIO A;  5FLM J;  4Y13 A;  3CC4 I;  1ZTR A;  2E19 A;  4U7B A;  3J7Z I;  3MZY A;  3WTZ A;  5J4V A;  1H8A C;  2DLL A;  1T56 A;  4XN3 A;  3CCU I;  3QYE A;  3DKY A;  2IAI A;  3HC7 A;  4EJV A;  2ISZ A;  1Y8Q B;  2DFF A;  3MWM A;  3O6B B;  3ZQ7 A;  4F93 B;  4IEJ A;  2CW0 F;  4CCL A;  1SAN A;  3GTG J;  3OOU A;  4OWR B;  2WC2 A;  3B73 A;  3BCA A;  4NNJ A;  1YIT I;  3OYF A;  5EZH A;  2CJJ A;  1RPW A;  2GWR A;  2VXZ A;  2JVH A;  1IN6 A;  2V1D A;  4DBR A;  3AG4 H;  1O3T A;  4M9S A;  5HDN A;  2I8D A;  2K7L A;  4D5C A;  3BZ6 A;  3FHZ A;  3KEY A;  1MBJ A;  5J8C A;  2VOP A;  3BPX A;  3CZ6 A;  1SVM A;  1D0X A;  1WVR A;  3L09 A;  2ME6 A;  3ZMS A;  1UCR A;  1VQK I;  5IYC J;  4ESJ A;  1DU0 A;  3HJE A;  4E7K A;  3MVP A;  4PCQ A;  3K0L A;  4N4N B;  1Y6I A;  4II2 A;  1VQ8 I;  2M3A A;  2V26 A;  4HA8 A;  4XLF A;  5FJ8 J;  1K6Y A;  5AIP A;  3JW4 A;  3KZZ A;  1B9N A;  3RKQ A;  4XNF A;  3IAS 2;  2K9N A;  1Z0X A;  3SYT A;  3S2D J;  3RPU A;  4MO7 A;  2KIU A;  3QOD A;  4D7N A;  2PI0 A;  2BBY A;  1PUE E;  1HW5 A;  2E36 A;  4BHC A;  1FIP A;  4HLX A;  1JT0 A;  1Z1D A;  3K4L A;  1OMI A;  1ETW A;  1PP7 U;  1FP2 A;  3ZQQ A;  3PIP F;  3SQN A;  2IBD A;  1FYL A;  4MQV A;  2EIK H;  3FXO A;  3ONQ A;  2F5F A;  3BG5 A;  3UKG A;  4UY8 I;  2FBK A;  1U2W A;  5F0C A;  3GZ6 A;  4UV8 A;  2LF8 A;  2QKL B;  4LK0 F;  2IA0 A;  2JPC A;  2ZB9 A;  4WK8 F;  3OSG A;  1HKQ A;  2JN6 A;  1X1B A;  1OYW A;  1ETQ A;  2HQN A;  3HSE A;  4BE1 A;  4KIS A;  3L1P A;  4ENN A;  4XID A;  2DAO A;  2M45 A;  3NWT A;  3H9G A;  4JX4 A;  5C44 J;  3KYL A;  4N4O B;  5L3C A;  2W25 A;  2R7X A;  3K2A A;  2G7U A;  1QPM A;  1TNT A;  3E6D A;  4I0B A;  3ZQL A;  2EFP A;  4IVN A;  2KLO A;  1HW2 A;  1ON1 A;  1MBK A;  1VF9 A;  3GUD A;  5EDN A;  3IWZ A;  4S0H B;  4HX7 A;  2W4S A;  3Q5F A;  2MSY A;  2ZKZ A;  3C7J A;  5J1R A;  2VON A;  5CJ9 A;  2DCE A;  3PNY A;  3WGG A;  2DFE A;  1DGR M;  2NS7 A;  4HF2 A;  1V54 H;  3RZO J;  1GVJ A;  2L4A A;  4M9Z A;  5F1R A;  1D8J A;  2NVT J;  4RAY A;  1FTT A;  3JCU C;  5DUK A;  2IEK A;  2CG4 A;  2KIF A;  3O8H A;  4B44 A;  3JRI A;  4FAS D;  3H9J A;  3K10 A;  2HEO A;  3MZH A;  5GPA A;  2FA5 A;  3KP5 A;  4HG2 A;  3QPT A;  1WFX A;  1SFX A;  2ADU A;  2RGV A;  1N77 A;  2D45 A;  1T39 A;  1ZQ3 P;  2HKX A;  1FWZ A;  5J47 A;  2R92 J;  4AVZ A;  5ICE A;  4I02 A;  2PX9 A;  1T0F C;  4PJ0 C;  3BWG A;  2DK5 A;  2OA4 A;  3K4K A;  2GA2 A;  4E7H A;  3G6E I;  1BL0 A;  1MSF C;  3CUQ A;  2FF4 A;  1H9G A;  1G2H A;  4M73 A;  4M71 A;  3G1L A;  4MIM A;  3JRC A;  2BY0 A;  1G6N A;  3HUG B;  3OR1 C;  5LFA A;  3WTT C;  3FM5 A;  2L7K A;  2M1B A;  4A3K J;  2KRH A;  1WKM A;  3W3C A;  1YJ9 I;  1X4O A;  2VJ5 A;  4KIG A;  2VKD A;  2E60 A;  2K9M A;  1WWX A;  1YHQ I;  2HNH A;  1BR2 A;  1QGP A;  1AU7 A;  2K86 A;  3WHC A;  3J7A O;  3U1D A;  3ZQI A;  5D8L B;  2P81 A;  3SZP A;  1O4X A;  5E20 A;  4PSW A;  1HKS A;  2EFQ A;  2EV5 A;  4A3D J;  2GBY A;  3OR2 C;  1BW6 A;  2OQG A;  4DYC A;  2O9L A;  1GV5 A;  2DMP A;  4KYW A;  3J7A Y;  1LFU P;  4BAC A;  1SMY F;  3LFU A;  3CQZ J;  2IGO A;  1X4P A;  4M3D A;  3HUG A;  3OYH A;  1L3L A;  2Z1D A;  1GXQ A;  2P4W A;  3RTR A;  1JHF A;  2X6O A;  2J5O A;  4A5N A;  2K4B A;  2ZFW A;  3MFK A;  1IV8 A;  1NG6 A;  3HSR A;  1ZG3 A;  4IHT A;  1UG2 A;  2HDD A;  5DDG A;  1IRX A;  3S2W A;  4IO9 F;  1NK2 P;  1FOK A;  2O7O A;  1F5T A;  5E3L A;  4I76 A;  1TQP A;  1JGS A;  1V5G A;  1Z7L A;  2DQR A;  2DYR H;  5FKN A;  1FY7 A;  3V7C A;  1DGW Y;  2WA0 A;  1IV6 A;  3MQ0 A;  4IL6 C;  1BBY A;  3GO5 A;  2QA4 I;  2IP2 A;  4UVC A;  5JFR A;  3HOS A;  1HDP A;  2PQ8 A;  2HFH A;  2RC4 A;  4Y52 J;  5CVU A;  3JRE A;  5M3M J;  3J81 Z;  1F9N A;  2EA4 A;  2XB5 A;  2DOF A;  4Q4Z F;  4LG3 A;  1U0J A;  3TBI A;  1J7K A;  4XLE A;  1VQ7 I;  2ZNY A;  2MLK A;  2KP6 A;  2HYJ A;  2E7X A;  1U9O A;  2QGU A;  2M2E A;  3NAU A;  3Q9V A;  3GFL A;  1R36 A;  4WXH A;  1YS6 A;  3FIS A;  2OCE A;  3NRV A;  1ZRC A;  5GTH C;  4IHY A;  5LBQ A;  5F6F A;  1MJB A;  3N05 A;  4BY1 J;  1ETK A;  3UNG C;  2BZT A;  1FBQ A;  2HZD A;  3I59 B;  1W4M A;  3E5U A;  3HYI A;  2Z99 A;  3PUF A;  3W6K B;  3CC7 I;  4I6Z A;  3I3L A;  2JSC A;  1O7F A;  3E3V A;  4MEY F;  4FHT A;  3ZMV A;  3J81 K;  4DGW B;  4ESB A;  1IF1 A;  2A05 A;  3SZT A;  2XDV A;  3DEE A;  4BH9 A;  2LKX A;  2EFO A;  4MEX F;  2Y48 A;  3L00 A;  1G8X A;  1XCV A;  4U0V A;  1HOM A;  2JA7 J;  5F64 A;  3QRF F;  2UWM A;  4CA0 A;  3H9Q A;  2VC0 A;  5DM7 F;  4BL0 B;  1T8I A;  2DA5 A;  5HS8 A;  2VI6 A;  4ANJ A;  4J19 A;  3IRR A;  1SEU A;  3LST A;  2OD5 A;  4YIR X;  1IN7 A;  3Q3S A;  3H3V K;  2FXA A;  1JUS A;  5TRD A;  3FMQ A;  3BG9 A;  5LRS A;  5ICC A;  2EZL A;  3L9F A;  1XB4 A;  1SD6 A;  4GFB A;  3AG1 H;  2QF7 A;  2H1L A;  3IP4 B;  4C30 A;  3WGH A;  5B1A H;  4WX9 A;  3J80 K;  1Y0U A;  1B4A A;  2L5Q A;  1XSX A;  2M34 A;  1B72 B;  1K7A A;  3DTE A;  5K5O A;  3TW7 A;  2CUE A;  4A3L J;  3E97 A;  1TBX A;  2HXO A;  3I0T A;  1U5T C;  4V2F A;  2ACJ A;  2TRT A;  4N9H A;  3RYP A;  4P9U A;  2X4H A;  3IHU A;  1Z21 A;  4KT5 C;  4J00 A;  9ANT A;  2CW8 A;  2W24 A;  1X3U A;  4NBQ A;  1EA3 A;  3R0A A;  4BY7 J;  4EM0 B;  3DKW A;  3R6S A;  1Z05 A;  2CQX A;  3EPZ A;  2FUG 2;  1FP1 D;  1YX5 A;  2QEX I;  1U9N A;  1MIJ A;  3A03 A;  1TQI A;  4CZZ A;  3CD6 I;  2HOE A;  5E79 C;  4MFD A;  1ORK A;  4XRS A;  4UVA A;  1E17 A;  1RC9 A;  3HOZ J;  5HVQ C;  3BJA A;  4XK4 A;  1FMW A;  1I1S A;  2MW8 A;  5KNL A;  2ZME B;  2K5C A;  4RAZ A;  2HQR A;  2K3P A;  3EET A;  4Z6Y A;  2PJP A;  2DU9 A;  3OYL A;  5D5U B;  1B72 A;  3LMM A;  3WTS C;  2LC2 A;  4UUV A;  3ABT A;  4CCN A;  5DD4 A;  2OAZ A;  1NK3 P;  4HYE A;  2BVL A;  2ZJQ F;  5B5E C;  1UEL B;  1ON2 A;  1KU7 A;  5FO5 A;  1JXS A;  2VJ4 A;  1PUF B;  2DFI A;  3BR2 A;  3ECH A;  2HVQ A;  2YUS A;  3E7L A;  2PEX A;  2GXG A;  2BYV E;  3DBL B;  3FF5 A;  1W5C C;  4CCO A;  1KYZ A;  1LDK B;  2VJJ A;  3BG7 A;  1WJC A;  3I9V 2;  2PMZ N;  2XF7 A;  3LWF A;  1SD4 A;  4DZJ A;  3A4C A;  2IS4 A;  1IO2 A;  2A68 F;  4CCK A;  4AYB N;  1WI9 A;  4NB5 A;  2LR8 A;  1O3R A;  1F4K A;  3P5J A;  2FRH A;  1G3T A;  2Y0M A;  1F43 A;  2HXI A;  3BTJ A;  4BS9 A;  3FDY A;  5HOD A;  1HLV A;  1FIA A;  2DJN A;  2ZME A;  1BA5 A;  3IC7 A;  4HNV A;  1GDT A;  2OC6 A;  3S14 J;  1HC8 A;  4ZYE A;  4Q5S F;  1WCM J;  4JBA A;  1IAW A;  1MBE A;  2XB0 X;  2IA1 A;  4NDL A;  5FFZ A;  2WTE A;  3M7G A;  3FM3 A;  5B3S H;  5FRO A;  3F21 A;  1BI3 A;  4PGG A;  1W7P A;  4P96 A;  2XAH A;  1PUF A;  2NAZ A;  5D6E A;  2R7W A;  4XR6 A;  1FT9 A;  2CQQ A;  4YFK F;  2KZV A;  2NOJ B;  2XPV A;  3D5S C;  4B3A A;  4NC6 A;  4M72 A;  3F9K A;  3AL0 C;  2K9S A;  1X3W B;  2XSD C;  2P5V A;  4PFP A;  4RA2 A;  3SXY A;  3DWL E;  4EMS A;  1I6H J;  2VKH A;  1W0U A;  1K61 A;  4KIT B;  3H5N A;  5J8F A;  2R7Q A;  4LGW A;  1VZ0 A;  4JOM A;  3I4M J;  4ZJZ A;  2BY2 A;  2XV4 S;  2LRD A;  3MKY B;  5ICG A;  2VBW A;  4F3Q A;  5E3M A;  2ZXJ A;  3CJQ B;  4B09 A;  2EB7 A;  2O5R A;  3EQL F;  2QLZ A;  3PO3 J;  1Z91 A;  3LA3 A;  1B6A A;  5DUI A;  1PJR A;  4S04 A;  2BV6 A;  1IGN A;  1OCZ H;  3F8N A;  4Y3O A;  2OZ6 A;  3RKY A;  3AG3 H;  3LOC A;  4Y17 A;  3WHB A;  1OPC A;  1IXR C;  1ERD A;  4C2T A;  1D1B A;  2P8T A;  4LG0 A;  4RB1 A;  2EIM H;  1UHM A;  2ZSI B;  2E5Z A;  3C2G A;  3RPQ A;  4IOA F;  3WE3 A;  1Q1V A;  3DU6 A;  1B59 A;  2M0M A;  4B3X A;  1K78 A;  2GQQ A;  3F8B A;  3FX3 A;  2V1N A;  3L2C A;  4F7Z A;  4LIT A;  1S3J A;  4RGX A;  1UZC A;  2DW4 A;  2LVS A;  3TGN A;  1VQN I;  5K5R A;  1IN4 A;  4DYQ A;  2X6X A;  3CC2 I;  3H0D A;  3WU2 C;  3GME A;  1JJ6 C;  3MKW B;  2XRN A;  1ETX A;  1FZP B;  2BHZ A;  3S17 J;  4HDU A;  2IGN A;  1BM9 A;  4MTD A;  3A01 A;  5IT9 Z;  2Y30 A;  4HF1 A;  3I4P A;  2XPW A;  2E34 A;  1IRZ A;  2L9V A;  2PFB A;  1UHW A;  3PQJ A;  2DPU A;  1N25 A;  3FZV A;  2DK8 A;  2L54 A;  3HPH A;  5M5X J;  2L4M A;  2IT0 A;  2NVQ J;  3F8C A;  4JP0 A;  2A6T A;  4E70 A;  3HKZ N;  3DP7 A;  2ECB A;  2R7F A;  4EV0 A;  2F5V A;  3GTL J;  2ISY A;  3W6J B;  5H6Q A;  2LG4 A;  2BW3 A;  4KJZ A;  3E6M A;  3PQK A;  2KKO A;  3I56 I;  3ABM H;  5GAD J;  2XKO A;  4E7Z A;  2VJI A;  2EIN H;  4IHX A;  2IA2 A;  4ZZD A;  3ZMD A;  2DBB A;  5IT9 K;  2NS0 A;  3BPV A;  2BY3 A;  2KQR A;  3DFG A;  3OYJ A;  3LSR A;  4HPQ A;  3V42 A;  1T33 A;  1DDN A;  2EJR A;  3GLX A;  1WH7 A;  1W5S A;  1S72 I;  4DQ2 A;  1CF7 A;  4EEF G;  2JT1 A;  1R5I D;  3OWT A;  3N4M A;  2GM4 A;  2LDU A;  3LQQ A;  2OPT A;  4ETS A;  1MJ9 A;  2Q0O A;  1M1E B;  1V5E A;  4E6K G;  3S1R J;  4F91 B;  2VLA A;  2ZXW H;  1N78 A;  1YW7 A;  1PP8 F;  1LPQ A;  3HPG A;  3GFM A;  4XBF A;  4BEH B;  1LJ9 A;  3ZGK A;  3FXK A;  2DA3 A;  2OF7 A;  1MD0 A;  4IJA A;  4ASN A;  2KJB A;  4E7L A;  2VPL A;  3K69 A;  2VOD A;  3GLL A;  4UXN A;  2KFD A;  3ZMU A;  3OY9 A;  4IOC F;  4ENJ A;  2P6T A;  1YS7 A;  1P6R A;  3NQO A;  3JRA A;  1IC8 A;  4CO8 A;  2KRF A;  2R5Z A;  2M7B A;  4NC7 A;  5F0F A;  3CF5 F;  3BR3 A;  2OV7 A;  4IXA A;  4ZYD A;  1GXP A;  1R1V A;  1OLT A;  3LQR A;  1Z7U A;  2R7S A;  3JTH A;  1HXD A;  3ZQH A;  2OJE D;  1R71 A;  2PMZ A;  4MNU A;  3OIP A;  5CLS A;  2LYC A;  1MGT A;  4BXU A;  3TMO A;  4Y7N J;  5E17 F;  4XOR A;  2Z3Y A;  4E7J A;  4DYR A;  2XPU A;  3OYN A;  2QSF X;  1LFB A;  2ZFU A;  3F72 A;  1J2X A;  2GA1 A;  4BEH A;  1T2K A;  3S1N J;  3CJT B;  1NTC A;  4MTE A;  2P5L C;  2X51 A;  4XOP A;  3HEF A;  1FOY A;  3CMA I;  1AKH A;  2DN0 A;  1XX5 A;  2UZK A;  2XGD A;  3ZOB A;  3GTK J;  3ABU A;  1SFE A;  1RZ4 A;  1V4R A;  3KYC B;  2EPF A;  1Z3X A;  2HS5 A;  2D2W A;  4I7H A;  2XKP A;  4B1R A;  3I64 A;  2VL8 A;  2DT7 B;  2LLK A;  4XRM A;  4LD5 A;  5LGN A;  2QBY B;  3O2P E;  1J75 A;  5J3L A;  1BIA A;  3P9K A;  2QQB A;  5BPD A;  1R1T A;  5GAH J;  2VBZ A;  3CMM A;  3FBI B;  1BN5 A;  2AXT C;  4LOC A;  1E0E A;  4KIC A;  3BQY A;  3DLL F;  3M8E A;  3ZCO A;  1EV7 A;  1JTX A;  1R7J A;  1X19 A;  4BQA A;  3TDU C;  5C3E J;  2F4O B;  2HWV A;  2WV0 A;  1KU2 A;  4H0E A;  1D1C A;  2ZJP F;  1SAU A;  5FKO A;  2FU4 A;  4E7I A;  5EEA A;  3FK7 A;  1W36 D;  4WF2 A;  1T95 A;  5ILV A;  2O8K A;  2CS3 A;  5D5V B;  1D8K A;  3BTC A;  4BHP A;  2D1H A;  1UAA A;  2QSH X;  3IH2 A;  2JMW A;  3K70 D;  4MHG A;  4S05 A;  1TWG J;  3MAJ A;  3QPH A;  3OL3 A;  1ZKG A;  1UB9 A;  3K4M A;  5LD2 C;  1G3S A;  3QQA A;  2QBY A;  1KU3 A;  2V1U A;  1S5L C;  2AHQ A;  1LDJ A;  4MLO A;  1IG7 A;  2HU9 A;  1A04 A;  2YR2 A;  2DT5 A;  4P5O A;  2LTP A;  1MZB A;  2AO9 A;  3G2B A;  3M9A A;  4XLP F;  3DKX A;  3S1M J;  1FNN A;  2L9R A;  3BRO A;  2ZSH B;  4G8X A;  1E3O C;  3GTQ J;  2EV0 A;  3GTM J;  5M3F J;  3J7Y J;  1OCC H;  2WAE A;  4I2O A;  2W57 A;  4A12 A;  2H6C A;  1JTY A;  4L0Y B;  3GTP J;  1IJW C;  1K79 A;  4M3F A;  1IDY A;  1S7O A;  3TQN A;  5L3B A;  1OQY A;  2LSO A;  4XL9 A;  3I54 A;  3H5R A;  2X1E A;  4DOZ A;  5K7F A;  2FNP A;  3QU6 A;  1MH4 A;  5BS6 A;  3BR0 A;  2CWE A;  3KP6 A;  4HOB A;  5AIQ A;  2EZK A;  1KZH A;  4GGG A;  1YRN B;  3HG9 A;  3BR5 A;  5DV5 A;  2Y2Z A;  4DNC A;  2NVX J;  5C4J J;  3CCL I;  1BR1 A;  3HTU A;  2G7H A;  4U88 A;  3SEQ A;  3PO2 J;  2MGQ A;  4OAY A;  1S8N A;  2HTJ A;  3VOE A;  3C3W A;  4EM2 A;  1DPU A;  1P9Q C;  1STZ A;  4XRF A;  1LUJ B;  1MMD A;  1TNS A;  1WJA A;  2L01 A;  3JR9 A;  3D1N I;  1K4S A;  3HKZ A;  4RGR A;  1ZK8 A;  4QIW N;  2DTZ A;  4CYD A;  4XOT A;  2CV0 A;  1OR7 A;  2DA2 A;  5JVG F;  2EK5 A;  4D9J A;  5LRR A;  3W6V A;  3BG3 A;  5LHI A;  2HOT A;  1S29 A;  4LFU A;  4QWQ A;  2R7Z J;  2V6E A;  2KDZ A;  3LSH A;  3IRQ A;  2R93 J;  2IS2 A;  3ABL H;  5ICF A;  4BNC A;  3GF2 A;  3HB9 A;  4PJL A;  4N9I A;  2IRF G;  3HXL A;  1W36 C;  5FLX Z;  3BCB A;  2CW7 A;  4YEL A;  3R0J A;  4BE0 A;  2XF6 A;  4HX8 A;  3VYR B;  1ZAO A;  3W2V A;  2IVM A;  2DA4 A;  1BC7 C;  4Y33 A;  4P55 A;  2H1K A;  2DOE A;  3ZP5 A;  3K70 C;  2OTJ I;  1BR4 A;  1Z77 A;  2L02 A;  4N0B A;  4PJM A;  1B8I B;  3EUH A;  3LA7 A;  3QP5 A;  1TT0 A;  3HOX J;  1XGN A;  3K1M A;  1BC8 C;  4QSH A;  1TWA J;  3KE2 A;  2MLG A;  3SFZ A;  3CME I;  4CHU A;  2LBF B;  3V8K A;  5IY5 H;  5DS9 A;  2K3F A;  2P0W A;  1UHS A;  2M87 A;  5HLI A;  3N97 A;  1APL C;  3NEU A;  1NG7 A;  5EGO B;  2HPM A;  3Q0U A;  3OOP A;  3NAR A;  2O3F A;  4XQF A;  2MC3 A;  5GAG J;  1FTZ A;  1WJ5 A;  1TW3 A;  1IRG A;  2H8W A;  4U0W A;  1MMG A;  3WGI A;  1QBJ A;  2FSW A;  4KN7 X;  2EFN A;  3CJR B;  1KU9 A;  5K7H A;  5FLX K;  2VIX A;  3VEP A;  1ITY A;  2VQG A;  2IJL A;  2CSO A;  4FE4 A;  1TTY A;  2F6C A;  3JAM Z;  3S3M A;  1VI0 A;  3FK6 A;  3JRD A;  4O5V A;  3S15 J;  3BOQ A;  2V1X A;  1BJZ A;  2LD5 A;  3B6C A;  3RPU D;  2W82 A;  4G12 A;  4O6J A;  4E7S A;  2FQ3 A;  4IQ4 A;  3ZPL A;  4UUT A;  2DMT A;  3BP8 A;  1VFC A;  3EUA A;  4GO1 A;  1T38 A;  3K4J A;  1SD5 A;  2Z9O A;  4BAY A;  5HLG A;  3VDX A;  1OCO H;  4L9V A;  2LBF A;  2MBF A;  2XF5 A;  1I1G A;  3P7N A;  5JLX A;  1EJ9 A;  4M74 A;  5EGO A;  5LLQ A;  4FIS A;  3CJN A;  2JQ7 A;  1I6X A;  3ZQC A;  3C1D A;  2M7A A;  1X1P A;  2Y9Z A;  1A36 A;  2MH2 A;  2ZJR F;  1X58 A;  1Z6T A;  3I5U A;  2EQR A;  2JA8 J;  1OYI A;  1AHD P;  3JAM K;  3OYG A;  2PN6 A;  3A02 A;  3AKZ A;  1D0Y A;  2H27 A;  3BZK A;  4ZZL A;  5L3D A;  5DCF A;  1ZRE A;  1DPR A;  1KON A;  3DTK A;  2PMH A;  1LQ1 A;  2QWW A;  2M4K A;  3LL7 A;  4X6A J;  3CCE I;  3QOE A;  1VQ9 I;  3FKJ A;  4KA4 A;  2LY1 A;  4HNT A;  1ZR2 A;  2IS6 A;  2JJ7 A;  1Z3Y A;  3BJ6 A;  2A5Y B;  4OIR F;  1YW9 A;  3CO7 C;  2UXN A;  3KEO A;  3MZ8 A;  4RLQ A;  2GXA A;  5D5W B;  1Z6R A;  3F23 A;  2YSR A;  2CGP A;  5CVI A;  2M30 A;  4CGZ A;  5E8G A;  1QRY A;  2LK2 A;  1MBH A;  1ZN2 A;  2JK3 A;  4I98 B;  1WH5 A;  2CU7 A;  4PK4 A;  2E1M C;  2E35 A;  1YLF A;  1MMS A;  5C4X J;  3NWS A;  1DQU A;  4ZTF A;  3B02 A;  1MKM A;  5BOX A;  4A3G J;  2W85 A;  1B1B A;  5TIS C;  5LEJ A;  3SZG A;  4B48 A;  4RGU A;  1X2M A;  4V2G A;  2GZW A;  3V4G A;  1LFP A;  4L9N A;  4UVB A;  2QQA A;  5BQT A;  3VFZ A;  2WB1 N;  4CH7 A;  4PDK A;  2E2J J;  4G6Q A;  2OQR A;  1I27 A;  3LAJ A;  1ZR4 A;  4XLC A;  1TWF J;  2JUG A;  3WTW C;  2LOO A;  4G9Y A;  2KMU A;  2JZY A;  3ML6 A;  4KMF A;  4NUB A;  2P5K A;  1JT6 A;  1WRJ A;  2X1C A;  3HRU A;  4OOI A;  1TL8 A;  1AOY A;  5D6F A;  3CCR I;  3M4O J;  2FJ1 A;  4KN4 X;  2DA1 A;  1EF4 A;  2E71 A;  2A6H F;  3I59 A;  5F08 A;  2VUM J;  1P4A A;  5B1B H;  2BY1 A;  2WWY A;  1T6S A;  2BHY A;  3H5A A;  4EAT A;  3C18 A;  3Q0W A;  3FXR A;  4C3H J;  2Q8K A;  1JUP A;  4OU0 A;  2HGC A;  2HOS A;  4RLF A;  4P1W A;  3GX4 X;  4G94 A;  2HDW A;  3DCF A;  2O61 A;  4G6T B;  2JSP A;  2CO5 A;  5FRM A;  1JHH A;  2HKO A;  2VE9 A;  1DU6 A;  1P92 A;  1TT5 B;  4HNU A;  3MKZ A;  2F2E A;  1SFO J;  1I39 A;  4A6D A;  4AUX A;  3T1B A;  5D4R A;  1FEX A;  1XGO A;  1IUF A;  1WJD A;  5E1X A;  3QU3 A;  2ZO4 A;  3QWL A;  3VYT B;  1FOX A;  2M8G X;  4CCJ A;  3AG2 H;  1XD7 A;  1XG1 A;  3X2Q H;  1R58 A;  3L2W A;  4ZC3 A;  4RB0 A;  2DPD A;  2RRE A;  2FBI A;  1D1A A;  4WXD A;  1R5G A;  3K2Z A;  2NRA C;  4YII A;  2NVY J;  2VE8 A;  4XKC A;  1YE9 A;  1YG2 A;  1YW8 A;  2YX4 A;  2ME0 A;  3KEQ A;  3L7W A;  5ILS A;  4BHB A;  1A6I A;  4CCM A;  2VB6 A;  5E1W A;  4M3E A;  3IKV A;  3S3O A;  5H20 A;  1XDS A;  4QLC U;  4XKW A;  3IL2 A;  1KQ9 A;  1SMT A;  3FMR A;  1KGS A;  3K1P A;  4LJZ F;  1SC7 A;  1VQ6 I;  3QPL A;  3S3N A;  4B8X A;  1VND A;  3L2R A;  1LNW A;  2IGM A;  1R9T J;  1XMA A;  2COB A;  2GAU A;  4FET A;  2F5D A;  1FX7 A;  1MH3 A;  2V7F A;  1MNE A;  3CUO A;  1G3Y A;  2M4G A;  4RMN A;  3KZI C;  3T8R A;  3PNT A;  4D7M A;  3E6C C;  5F04 A;  4XLA A;  3CUQ C;  3LSI A;  2IGK A;  4AM3 A;  4L5E A;  3G1M A;  3S16 J;  3U2R A;  4L9T A;  3MCZ A;  3D5L A;  4IRH A;  1MSE C;  3O8G A;  4RDU A;  2X1D A;  5BMZ A;  4IRI A;  3GEZ A;  4K2E A;  3ZQG A;  3HRT A;  3WE2 A;  1Q1H A;  3OL4 A;  2ELJ A;  3G1O A;  2M0C A;  3BQZ A;  1N75 A;  3HSF A;  2M5W A;  3SHF A;  3CCQ I;  3JSO A;  1YI2 I;  1POG A;  2MH9 A;  2XRL A;  3KLN A;  2DA7 A;  2LKS A;  3I55 I;  4IPA A;  4RB2 C;  1FSH A;  1TP4 A;  2R4G A;  2W48 A;  3FXQ A;  1P7I A;  1MBG A;  2V9P A;  3ZMT A;  1RIO H;  2GLO A;  2YS9 A;  2L3D A;  2B9S A;  4UHT A;  3TO9 A;  3KX2 A;  1SVO A;  1XSV A;  3ZMZ A;  1BI2 A;  2XUB A;  4EJO A;  4F55 A;  2BXY A;  2IPQ X;  4QTR A;  4M6Y A;  4PGH A;  3VYS B;  4CUG A;  4L18 B;  2I5U A;  1QU3 A;  4X0G A;  2DT6 A;  3RI4 A;  3OYA A;  3OS1 A;  4A5M A;  4L9J A;  1XS9 A;  2E2H J;  4IZZ A;  5EG0 B;  2LKP A;  4MGR A;  3U9G A;  5K5Q A;  2XAG A;  2LFB A;  1Y0N A;  2RAE A;  4ZDL A;  2R5Y B;  1B9M A;  1DP7 P;  3QYF A;  3SFI A;  5HDK A;  4D1Q A;  5BNG A;  3DPU A;  2QQ8 A;  4B4C A;  3KPH A;  1LEA A;  4LLG F;  2E1C A;  1NH3 A;  3LSK A;  2XIG A;  3JTG A;  4D0P A;  2EIL H;  3FMS A;  4W97 A;  4ZTJ A;  2XGE A;  1FYM A;  2EIJ H;  4RM3 A;  2X48 A;  3S93 A;  4UUS B;  3CCS I;  2K9L A;  3G4S I;  5H2F C;  1P4X A;  1RKW A;  1TZL A;  3A0B C;  1HF0 A;  4MFE A;  1LDD A;  5M5Y J;  2XAJ A;  1S6L A;  2TCT A;  2FML A;  4GCV A;  1BOA A;  3CCY A;  3L2Q A;  1OJL A;  4RGS A;  3REO A;  1R5H A;  2DYS H;  4A3B J;  1XGS A;  3FHN A;  1D3Y A;  5H6R A;  4TV7 A;  4BGD A;  3HOT A;  1E3P A;  1H89 C;  5JLW A;  3BZC A;  1RR7 A;  3RZD J;  1A5J A;  2JPB A;  2VQL A;  4A3J J;  2R5Y A;  3K9T A;  5LGT A;  3CDH A;  3BJO A;  4CYC B;  1IUY A;  3FXM A;  4RS8 A;  1BIB A;  5F27 A;  1W1W E;  1ZEL A;  4HX4 A;  4KNY A;  1FPQ A;  3GZ5 A;  3M07 A;  4XSX F;  1GHC A;  3BTI A;  5J1Y A;  4O3M A;  3PFY A;  4UUS A;  1Y39 A;  1T98 A;  1LVK A;  2XAU A;  4PSX A;  3COA C;  1Y56 A;  3LSJ A;  3PSF A;  2Z5U A;  5B66 C;  2JA5 J;  2ZJ2 A;  1WSU A;  3MN2 A;  3LFK A;  4WXC A;  4Y15 A;  3CCM I;  1T0F A;  2P7V B;  1P2F A;  3SEZ A;  2V9K A;  5EYR A;  4LB6 B;  3E5Q A;  3PUB A;  1SFU A;  1VTN C;  4M6X A;  5DYM A;  3H3Z A;  1KQ8 A;  2A07 F;  4A6E A;  4NQW B;  5CVJ A;  2ESN A;  2LY9 A;  4A3F J;  4XKV A;  3OS0 A;  1V5F A;  2WV1 A;  3TP0 A;  2OBP A;  2STT A;  4A69 C;  3ISP A;  4CYC A;  5JR3 A;  3DLA A;  5HS9 A;  4BYY A;  4UB6 C;  3D0S A;  5HLT A;  2WY7 Q;  1ZRD A;  1P7J A;  3O3K A; 
#chains in the Genus database with same CATH homology
 5GP9 A;  1Y1V J;  2D5V A;  4Y52 J;  3JRE A;  5M3M J;  2XB5 A;  5K7F A;  5F1J A;  2L7Z A;  3VPR A;  1MH4 A;  2HYJ A;  1U9O A;  3BR0 A;  3JRH A;  2R0Q C;  2M2E A;  3NAU A;  2EZK A;  1IDZ A;  1YRN B;  3FIS A;  3BR5 A;  3OIO A;  4IHY A;  2Y2Z A;  2NVX J;  4C3I J;  5C4J J;  4BY1 J;  1ETK A;  4BBR J;  1LE8 B;  3PO2 J;  2MGQ A;  3I4N J;  4I6Z A;  4M3B A;  3HOV J;  3JR9 A;  2VKE A;  3D1N I;  1JJ8 C;  2B63 J;  3HOY J;  5J1U A;  1ZK8 A;  4QIW N;  2DTZ A;  1RKT A;  4AC0 A;  4BBS J;  2DA2 A;  2DMQ A;  3W6V A;  3BG3 A;  2LKX A;  3HGY A;  2HOT A;  2R7Z J;  1OCP A;  3TED A;  2KDZ A;  5F0H A;  2JA7 J;  1HOM A;  2R93 J;  1RES A;  3HB9 A;  3TP3 A;  2DA5 A;  1WI3 A;  1ETO A;  2VI6 A;  4J19 A;  3Q3S A;  1QVT A;  3H3V K;  2HI3 A;  2DA4 A;  1JUS A;  4C2M J;  3BG9 A;  2H1K A;  2EZL A;  2ID3 A;  1Z77 A;  5E3O A;  3A01 B;  2QF7 A;  3IH4 A;  1B8I B;  3HOX J;  4GFB A;  1MNM C;  2M34 A;  1B72 B;  4QSH A;  5EG0 A;  1TWA J;  3TW7 A;  2CUE A;  2CUF A;  4A3L J;  5DS9 A;  1RET A;  5K7Z A;  2HXO A;  1UHS A;  4V2F A;  1JKO C;  2TRT A;  3GTJ J;  1APL C;  3RQI A;  3HOW J;  2I10 A;  3SJM A;  1MBF A;  5EGO B;  3Q0U A;  1QPI A;  1JKQ C;  3HM5 A;  3NAR A;  9ANT A;  1TC3 C;  1FTZ A;  4BY7 J;  2CQX A;  2NOG A;  1ITY A;  5K7H A;  3Q0V A;  3BR6 A;  1U9N A;  3HDD A;  5FKK A;  3A03 A;  4FE4 A;  4MFD A;  5FLV A;  3HOU J;  1ORK A;  4XRS A;  1VI0 A;  2CRG A;  3FK6 A;  3HOZ J;  3JRD A;  3S15 J;  1ETV A;  4XK4 A;  1BJZ A;  2MW8 A;  2LD5 A;  3B6C A;  4G12 A;  2FD5 A;  2N8G A;  2QCO A;  2H8R A;  4UUT A;  2DMT A;  3C2B A;  3TW6 A;  1VFC A;  3FIW A;  4A3M J;  1B72 A;  2L0K A;  1TWC J;  3QPS A;  2LP0 A;  2L7F P;  1GV2 A;  2WAQ N;  1NK3 P;  4JX5 A;  2YU9 J;  1F36 A;  5JLX A;  1GT0 C;  3LSG A;  4A3C J;  4A93 J;  5EGO A;  3FKI J;  1PUF B;  4FIS A;  3BR2 A;  2YUS A;  3E7L A;  2E2I J;  3ZQC A;  2Y9Z A;  5GPC A;  1X58 A;  2FX0 A;  5IP9 J;  2EQR A;  2NS8 A;  2JA8 J;  1AHD P;  2PMZ N;  3A02 A;  4A3E J;  2FQ4 A;  1UMQ A;  4DZJ A;  5IYD J;  1WGX A;  4AYB N;  2LR8 A;  4C3J J;  4FTH A;  2R5Z B;  1F43 A;  1D5Y A;  2HXI A;  3BTJ A;  1FJL A;  4X6A J;  5HOD A;  1HLV A;  1FIA A;  1S7E A;  2DJN A;  1ZR2 A;  2JJ7 A;  1BA5 A;  2K9Q A;  1I3Q J;  4DW6 A;  3S1Q J;  4HNV A;  3GTO J;  2EZI A;  1ENH A;  1GDT A;  1JKP C;  4IHW A;  3S14 J;  1WCM J;  1JGG A;  3BR1 A;  1MBE A;  2L7M P;  2XB0 X;  4NDL A;  1QRY A;  2LK2 A;  4BKX A;  3GBG A;  1MBH A;  2JK3 A;  4IHV A;  3HBL A;  1WH5 A;  1OFC X;  2CU7 A;  5FKL A;  4ABZ A;  3S2H J;  1PUF A;  1HDD C;  5C4X J;  5E3N A;  1JKR C;  2CQQ A;  2XPV A;  1AKH B;  4B3A A;  2K9S A;  1CQT A;  2XSD C;  4RBO A;  4A3G J;  1U8B A;  2DMN A;  3LSP A;  3OSF A;  1I6H J;  1W0U A;  1K61 A;  1W0T A;  3LNQ A;  1X2M A;  2ELK A;  4V2G A;  2ID6 A;  2WB1 N;  2E2J J;  3I4M J;  2Y31 A;  5E3M A;  1ZR4 A;  3CDL A;  1TWF J;  3ZQF A;  1YRN A;  3PO3 J;  1XC5 A;  1HCR A;  5IP6 A;  1IGN A;  1JT6 A;  1WPK A;  1ETY A;  4XRS G;  3M4O J;  2FJ1 A;  2DA1 A;  1LE8 A;  1EF4 A;  3LOC A;  2MG4 A;  5F08 A;  2VUM J;  3WHB A;  2G0E A;  5FLM J;  1ZTR A;  2E19 A;  3Q0W A;  4C3H J;  1H8A C;  1Q1V A;  3SDG A;  1JUP A;  1T56 A;  2HOS A;  3BTL A;  2IAI A;  3DCF A;  2EBI A;  4D5F A;  2LVS A;  4IEJ A;  1SAN A;  3GTG J;  1DU6 A;  3OOU A;  5IPA A;  2ECC A;  1SFO J;  2JWT A;  1TWH J;  4AUX A;  4DYQ A;  1FEX A;  5EZH A;  2CJJ A;  1RPW A;  1IUF A;  1GVD A;  1JJ6 C;  2X9D A;  2E1O A;  4D5C A;  2M8G X;  1ETX A;  2VPR A;  1MBJ A;  1XG1 A;  3S17 J;  5IOY A;  2ME6 A;  3A01 A;  5IYC J;  1B8I A;  1DU0 A;  2Y30 A;  3MVP A;  2XPW A;  2NVY J;  4M6V A;  1IRZ A;  5FJ8 J;  4A3I J;  2ME0 A;  1A6I A;  3RKQ A;  2VKV A;  5M5X J;  2NVQ J;  4M3E A;  2K9N A;  5DTD A;  4JP0 A;  1Z0X A;  3JRB A;  2EZH A;  3QPL A;  1P7J A;  3HKZ N;  3S2D J;  1VND A;  4MO7 A;  4D7N A;  2ECB A;  1BW5 A;  1R9T J;  2COB A;  1FIP A;  1JT0 A;  3GTL J;  4XIC A;  1MH3 A;  1ETW A;  1Y1W J;  4D7M A;  2IBD A;  5F04 A;  4IHX A;  4L5E A;  3G1M A;  2HQ5 A;  3LSR A;  3S16 J;  1JUM A;  3BG5 A;  5EF6 A;  3UKG A;  1T33 A;  3DEW A;  1WH7 A;  1MSE C;  3O8G A;  5F0C A;  2Y9Y A;  4RDU A;  4EEF G;  1OCT C;  3ZQG A;  2ZB9 A;  3G1O A;  2M0C A;  3OSG A;  2GM4 A;  1I50 J;  2JN6 A;  3BQZ A;  2OPT A;  3PM1 A;  1ETQ A;  1GUU A;  3L1P A;  4XID A;  3S1R J;  2DMU A;  4JX4 A;  5C44 J;  5IP7 J;  1POG A;  2XRL A;  2DA7 A;  3K2A A;  1X2N A;  2W48 A;  1P7I A;  3ZQL A;  1MBG A;  1MBK A;  1VF9 A;  5EDN A;  2GLO A;  4S0H B;  2YS9 A;  2DA3 A;  2OF7 A;  2MSY A;  5J1R A;  3JRG A;  2NS7 A;  2DA6 A;  4QTR A;  3RZO J;  3JRA A;  1IC8 A;  2NVT J;  2M9H A;  2R5Z A;  1FTT A;  5F0F A;  1XS9 A;  2E2H J;  5EG0 B;  2IEK A;  3BR3 A;  3O8H A;  3JRI A;  3K7A J;  5GPA A;  5FKM A;  1H88 C;  2LFB A;  2RAE A;  1ZGW A;  2R5Y B;  2Y0S N;  3ZQH A;  1QVU A;  1ZQ3 P;  3CMY A;  3SFI A;  2R92 J;  5BNG A;  4B4C A;  4DZP A;  4Y7N J;  2XGC A;  4DYR A;  1BL0 A;  2XPU A;  4W97 A;  1MSF C;  1LFB A;  2XGE A;  4FE7 A;  5IYB J;  4UUS B;  2X48 A;  1G2H A;  3G1L A;  4MIM A;  1RKW A;  3S1N J;  1NTC A;  4MFE A;  5M5Y J;  3JRC A;  1HF0 A;  1AKH A;  3HEF A;  2DN0 A;  2TCT A;  2XGD A;  3ZOB A;  4FCY A;  3GTK J;  4JX6 A;  4A3K J;  4JYK A;  3CCY A;  1K83 J;  1OJL A;  4B1R A;  1U78 A;  4A3B J;  2LLK A;  4XRM A;  5J3L A;  1H89 C;  5JLW A;  1RR7 A;  3RZD J;  3BT9 A;  1AU7 A;  1A5J A;  4A3J J;  3WHC A;  2R5Y A;  3ZQI A;  2P81 A;  4CYC B;  1O4X A;  4LOC A;  2JA6 J;  3BQY A;  4A3D J;  3M3Y J;  5F27 A;  2GBY A;  1JTX A;  3F0C A;  1BW6 A;  5C3E J;  4DYC A;  3IH3 A;  2O9L A;  1GV5 A;  2DMP A;  3BTI A;  5J1Y A;  5FKO A;  2KT0 A;  4UUS A;  1LFU P;  5M5W J;  5EEA A;  3FK7 A;  5IOZ A;  3CQZ J;  2O8K A;  4M3D A;  3B6A A;  3MKL A;  2HOA A;  3LSJ A;  4W1U A;  3BTC A;  2JA5 J;  1HDP A;  3MN2 A;  3IH2 A;  2JMW A;  4X1E A;  2X6O A;  1TWG J;  3IV5 A;  5EYR A;  1UG2 A;  1ZKG A;  2HDD A;  3QQA A;  1NK2 P;  3JRF A;  2K40 A;  2AHQ A;  4MLO A;  1IG7 A;  2O7O A;  2EH3 A;  2LY9 A;  5E3L A;  4A3F J;  4I76 A;  4M3G A;  2LTP A;  2AO9 A;  5FKN A;  2WV1 A;  4BXX J;  3TP0 A;  3HGG A;  4A69 C;  4CYC A;  3S1M J;  2L9R A;  1E3O C;  1IV6 A;  3GTQ J;  3H0G J;  5EZG A;  3GTM J;  5M3F J;  1JTY A;  3GTP J;  1IJW C;  4M3F A;  1IDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...