2CRGA

Solution structure of the myb-like dna-binding domain of mouse mta3 protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
70
structure length
70
Chain Sequence
GSSGSSGMEEWSASEACLFEEALEKYGKDFNDIRQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metastasis associated protein MTA3
publication title Solution structure of the myb-like DNA-binding domain of mouse MTA3 protein
rcsb
source organism Mus musculus
molecule tags Gene regulation
total genus 12
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2crgA00
2XPWA 2Y9YA 2H1KA 4A3FJ 2IEKA 4M3GA 3JRIA 1MBKA 1ETQA 2XRLA 1WCMJ 5EG0A 3ZQIA 1WH5A 2XGDA 1JUSA 3IV5A 2FD5A 1S7EA 4A3DJ 1YRNA 2HYJA 1FEXA 2I10A 3BR5A 2P81A 2R0QC 3I4NJ 1VFCA 1ZQ3P 4QSHA 5F04A 1VI0A 3BTCA 3PO2J 4IHXA 9ANTA 4W97A 5C4JJ 4A3JJ 2EZLA 2WV1A 4DYQA 3E7LA 4M3EA 2DA4A 3PO3J 1TWHJ 2L7ZA 2QF7A 1IJWC 1LE8B 4D5FA 3TW6A 2FQ4A 4B4CA 5FKKA 3CMYA 4W1UA 1BA5A 2IAIA 4DZJA 4C2MJ 1VNDA 2LP0A 2HOTA 4AUXA 1MBHA 1Z77A 1WI3A 2FJ1A 5EYRA 5F0FA 3LOCA 1FTTA 1ITYA 1X2MA 2DA1A 4M3FA 2YS9A 1HOMA 3ZQFA 2CQXA 2JJ7A 1UHSA 1W0UA 1H89C 2K9QA 4FTHA 3FK7A 5EEAA 2OPTA 1IGNA 4C3JJ 1AU7A 3L1PA 1GV5A 1RKWA 2MSYA 5FLMJ 2DN0A 3GBGA 1U9NA 3JREA 2MG4A 3F0CA 2IBDA 4QTRA 2VPRA 2HOAA 2AHQA 2CRGA 1GV2A 1WPKA 2VI6A 3BR6A 4M3DA 5BNGA 1HLVA 3ZQHA 4G12A 2X9DA 3FK6A 4DYCA 4I6ZA 3HBLA 5IYBJ 1FJLA 4JX6A 3S15J 4BKXA 1RESA 4BBSJ 4JP0A 2VKEA 3FIWA 3M4OJ 1MBGA 3Q0WA 4FE7A 4S0HB 4DW6A 2ECCA 4B3AA 2GLOA 2E1OA 3MVPA 2M2EA 2HDDA 3JRAA 2XPUA 1HDPA 3ZQCA 4BY1J 5EG0B 1F43A 3S1RJ 2EBIA 4LOCA 2DMTA 1IDZA 2Y30A 3HB9A 1MNMC 1ETXA 1T56A 5EGOB 2HI3A 1I50J 1X58A 1NK2P 1HCRA 5E3NA 1YRNB 1DU0A 3S2HJ 1K83J 4L5EA 1Q1VA 1SANA 2M34A 2WAQN 5HODA 2ME6A 1RPWA 1AHDP 1RETA 4UUSB 3BT9A 1XG1A 3G1MA 3GTGJ 5C4XJ 3TP3A 5M5WJ 3NARA 1PUFB 2CUFA 1HDDC 1MSEC 2Y2ZA 3HDDA 1ETOA 3Q3SA 1ETYA 1TWAJ 2LK2A 1WH7A 1I3QJ 3MKLA 5K7HA 5E3OA 5FLVA 3BQYA 5EGOA 2DA7A 3JRGA 4A3GJ 1BW6A 3TP0A 2MW8A 3S1NJ 3LSRA 4Y52J 3K2AA 1BW5A 1FIPA 3BQZA 2RAEA 2LLKA 1FTZA 3K7AJ 5E3MA 1JKQC 1AKHB 2X48A 4DZPA 5F0HA 4RDUA 4IHVA 4UUSA 2KDZA 3S17J 2E2JJ 1EF4A 1G2HA 2EZIA 4FISA 3CCYA 3RQIA 5J1RA 4MFDA 3SDGA 4DYRA 5IPAA 2HXIA 2NS8A 2R5ZB 1PUFA 2CJJA 2D5VA 3M3YJ 2LTPA 3BR0A 1LFBA 2WB1N 5F0CA 1MH4A 3HOUJ 3HGGA 2YU9J 3S2DJ 3RZDJ 1JKPC 3BR1A 5M3FJ 1JTXA 1U8BA 2O9LA 1QVTA 2R5YB 3BG9A 1TWCJ 1POGA 5IYCJ 2H8RA 3O8HA 3HOYJ 3GTJJ 1IDYA 2EZHA 4BBRJ 1JJ8C 3SFIA 1Z0XA 1AKHA 4MFEA 1P7IA 1CQTA 2JWTA 1MBFA 2VKVA 5IP7J 2L7MP 5DTDA 1MBEA 1D5YA 2R5ZA 3TEDA 3A01B 1LFUP 4A3KJ 1BL0A 4MLOA 4J19A 4XRSG 2JA6J 1ZTRA 2NVQJ 3HOVJ 1T33A 2LD5A 5M5YJ 4A3LJ 5IOZA 1GT0C 2HXOA 5IP9J 5J1YA 1GVDA 2JA5J 1ORKA 2HOSA 3GTPJ 3S14J 2R5YA 1ETWA 2Y31A 4A69C 3OSFA 2LFBA 4V2GA 5EF6A 1IC8A 1NK3P 2JK3A 1MSFC 4EEFG 1A6IA 4GFBA 1JT6A 2DMNA 4ABZA 4X6AJ 1F36A 2NOGA 5EZGA 5DS9A 1QRYA 3O8GA 1ZK8A 4MO7A 3H3VK 3A01A 2Y9ZA 1P7JA 2ZB9A 1JGGA 1JUMA 5FKOA 1QVUA 5F27A 3BR3A 2FX0A 4IHYA 2COBA 1A5JA 4D7MA 2R7ZJ 2N8GA 3BG5A 5IYDJ 1H88C 4V2FA 2ID6A 3IH3A 2PMZN 1JKRC 4FCYA 2NVYJ 3RKQA 2EQRA 4NDLA 3WHCA 2K9NA 2GBYA 1IV6A 2W48A 3BTLA 3G1OA 1OFCX 3HGYA 1MH3A 3A03A 2L9RA 1ZR2A 1JUPA 2DMUA 3TW7A 3VPRA 3FISA 1Y1VJ 5JLWA 2DMQA 1RR7A 2NS7A 3GTOJ 3WHBA 1XC5A 3FKIJ 4C3IJ 1NTCA 2LR8A 4MIMA 5EZHA 4A3EJ 2NVXJ 1XS9A 2ID3A 2B63J 4A93J 3G1LA 1ZR4A 2CQQA 2E2IJ 3JRHA 3GTLJ 1MBJA 2G0EA 4XRMA 2M8GX 3B6AA 1JT0A 5K7ZA 5FJ8J 4CYCA 1OCPA 3BG3A 2DA6A 2DA3A 1ZKGA 4XIDA 3Q0UA 2L7FP 4IEJA 5FKMA 2VUMJ 3A02A 1FIAA 3GTKJ 1TC3C 3NAUA 3BTIA 3ZQLA 4BY7J 2OF7A 4HNVA 3MN2A 2EZKA 2ELKA 1ETKA 5M5XJ 1JJ6C 1JKOC 2XB0X 3DCFA 2LVSA 2E2HJ 3LSJA 3JRBA 1UMQA 3BR2A 4XK4A 1U9OA 3JRCA 2CU7A 2O7OA 4X1EA 2YUSA 3S16J 2JMWA 2GM4A 5IP6A 2R93J 4BXXJ 2K40A 3W6VA 5M3MJ 1RKTA 4C3HJ 4XRSA 1QPIA 2LKXA 2XGEA 2ECBA 1GUUA 4A3IJ 3CQZJ 2XPVA 1W0TA 2L0KA 3HOXJ 2M0CA 4A3CJ 3GTMJ 1O4XA 4D7NA 3GTQJ 4A3BJ 3IH2A 1H8AC 2DTZA 5EDNA 3D1NI 3S1QJ 1UG2A 3ZQGA 1DU6A 3LNQA 1TWGJ 1IUFA 2XGCA 5F08A 1OJLA 3B6CA 2HQ5A 2CUEA 5FKLA 3HOZJ 1SFOJ 1WGXA 3LSPA 5IOYA 1TWFJ 2M9HA 2NVTJ 1R9TJ 2TRTA 1I6HJ 2JN6A 3HEFA 2JA7J 5J1UA 5E3LA 3SJMA 2QCOA 4JX5A 3QQAA 1B72B 3RZOJ 1LE8A 4AYBN 2DA5A 4M6VA 4B1RA 2LY9A 1IRZA 3QPLA 1ENHA 4RBOA 3LSGA 5C3EJ 3JR9A 1K61A 2AO9A 1OCTC 4M3BA 3CDLA 1B8IB 4IHWA 1X2NA 2TCTA 3JRFA 2DA2A 2DMPA 2ME0A 3OIOA 2K9SA 4QIWN 5GP9A 4A3MJ 2R92J 1ETVA 2X6OA 5K7FA 4CYCB 3HM5A 2XSDC 3PM1A 1VF9A 4UUTA 1HF0A 3I4MJ 3OOUA 5J3LA 2XB5A 1B72A 4Y7NJ 3S1MJ 1IG7A 3Q0VA 3IH4A 4XICA 1JTYA 5GPAA 3HOWJ 3ZOBA 2E19A 1U78A 1BJZA 1GDTA 3C2BA 5GPCA 4FE4A 1ZGWA 1B8IA 4JYKA 5FKNA 2KT0A 5C44J 2MGQA 4D5CA 3JRDA 3OSGA 5F1JA 1Y1WJ 1APLC 4JX4A 4AC0A 2O8KA 2Y0SN 1E3OC 3DEWA 2DJNA 3BTJA 3H0GJ 3HKZN 2EH3A 3UKGA 2JA8J 5JLXA 3QPSA 4I76A
chains in the Genus database with same CATH superfamily
2R4GA 2XPWA 1EH6A 4PJJA 2IEKA 4M3GA 5EG0A 1X3UA 1G3SA 1WH5A 2XGDA 4CYDA 1J0RA 1Y39A 1JUSA 1S6LA 3DKYA 2H09A 2IS6A 1RUOA 1SAUA 4BHPA 4PZJA 3BR5A 3T8RA 4EM1A 1YHQI 3OYKA 4F52A 1TBXA 3GF2A 3ABKH 4FETA 1YIOA 2M8EA 1USSA 4B09A 1W7PA 3SDBA 3E7LA 4HNUA 5L3CA 1REPC 1FBQA 4OWRB 3G71I 2A5WA 2DA4A 3ZMDA 2B9SA 3LA2A 2QF7A 1WJBA 1T0FA 1YG2A 4D5FA 1EH8A 5FKKA 4W1UA 3WTUC 2HVSA 2F6CA 3RYPA 4AUXA 3WU1B 2VBWA 2NXNB 3CCJI 2JSPA 1SD7A 5EYRA 3LAPA 1VQPI 1S8NA 1O3QA 3L2WA 2RKHA 1FTTA 2M4KA 1ITYA 3CCRI 4CH7A 2DA1A 4ZDPA 2BY1A 4LG3A 2J5PA 2YS9A 3PNYA 3WG9A 2NVUB 3FK7A 3PIOF 2LMDA 1ZREA 2QKMB 1N25A 3L1PA 4B48A 1FOWA 1YX3A 2V6EA 1LDKB 2MSYA 5FLMJ 1U9NA 2MG4A 2VQLA 4F93B 3HOSA 2O03A 2R7DA 3GFIA 1R1UA 1A36A 3BR6A 4XLEA 3J7ZI 3HUGA 5A2QZ 1HLVA 4TV7A 1WJAA 4HYEA 4BH9A 1TQPA 3GX4X 3HBLA 1VQNI 5KAIC 2HYFA 3IL2A 4EJUA 4EGYA 1S5LC 4GRIA 4BKXA 2EA2A 2HQNA 2ZXIA 3VYTB 1ONVA 2ZSIB 4UVCA 1MBGA 3M4OJ 4B3AA 2E60A 2E1OA 2OA4A 2QQ8A 3E0JB 2M2EA 2HDDA 4NNJA 4CZCA 2XPUA 2EFNA 4BY1J 5EG0B 5DEQA 1U5TA 5E8GA 2EBIA 3TKYA 2DMTA 4XORA 4E7KA 2P0WA 2VT2A 2BOLA 2CQ7A 3C2GA 1NK2P 1X58A 3J7YJ 2HQRA 2VE9A 1S9HA 1G8XA 4RB1A 1W36C 3S2HJ 1D0ZA 2WAQA 2Y69H 1K83J 5D5XB 1W5TA 2DOEA 2WV0A 2M34A 2WAQN 2IP2A 5GAGJ 3U21A 1G4DA 2F4OB 4PSXA 1P2FA 3F8CA 2QM3A 1E17A 1IN7A 2LDUA 3FM5A 4BYYA 3TP3A 3O3KA 3VB2A 3EETA 2MD0A 3WGHA 4BJ5C 3ZMSA 1PUFB 2CUFA 1HDDC 2CUZA 1YE9A 3JSOA 1FP1D 1BI0A 3OYDA 2DODA 1ETYA 2DBBA 3Q3SA 3PNVA 4BJTA 1B9NA 4KDPA 4AIKA 2JA2A 4BDYA 2M7BA 1UHMA 2NNNA 1FYLA 1QZYA 3KP4A 3WTWC 2XAHA 2JTVA 2DA7A 3JRGA 3TP0A 2MW8A 3DPTA 3K70C 4RA2A 1Y56A 2CG4A 1BW5A 1FTZA 2LLKA 4L0YB 3FZVA 1WJDA 1AKHB 1RNLA 4DZPA 5F0HA 3J81K 1R23A 2KDZA 3S17J 2E2JJ 2ESNA 2DFIA 3NQOA 4P5OA 4D9JA 1OISA 2VC1A 2A61A 2XKOA 4XL9A 3L09A 4DYRA 2NS8A 3R0AA 1SFEA 2CJJA 2B0LA 4Y33A 2W84A 2BY2A 3LFUA 3VYRB 3WE3A 1FPQA 5CLSA 3HOUJ 3HGGA 1H9TA 2CS3A 3TGNA 1JHHA 1YFHA 3BR1A 5M3FJ 1SVLA 3H36A 1JTXA 3CP8A 3LSTA 1U8BA 1FZPB 2FRHA 4C9YA 1IRFA 2JQ7A 5B5EC 3GTJJ 4UB6C 4BBRJ 4U7DA 3I9V2 2K3FA 2KKOA 2QENA 1X4OA 1MDMA 2IA1A 4BL0B 2CWEA 3I71A 1O3SA 5IP7J 1YI2I 1WSUA 4M6YA 5DTDA 1MBEA 3OYAA 4M6XA 2EFQA 2ZMEC 1QBJA 1BL0A 4MLOA 3PIPF 3FWEA 2GIZA 2VOOA 2WBMA 1PVEA 3X2QH 1OKRA 2EWNA 3OV8A 1ZRFA 4LD5A 4A3LJ 2RVCA 4PJMA 1U5TB 1GVDA 2W4SA 1OR7C 1FT9A 1TT0A 3C3WA 2HZDA 2HOSA 3VWBA 2FEZA 2Y31A 3EUAA 3WGIA 1TQIA 2W57A 3T8TA 1IC8A 4DGWB 5LEKA 1MNDA 1U3EM 4N9HA 4EATA 4PJLA 2O5RA 3AG1H 1RR8C 4Q47A 3L9FA 2YSRA 1QRYA 3H35A 2V79A 2F5CA 1EKEA 3KEYA 2UXNA 3VDXA 2E36A 5JI6A 4U0YA 1P7JA 3A01A 1X3WB 5KHDA 3V7SA 4EJWA 1QVUA 2FX0A 1BBYA 3A1YA 4GDFA 4WK8F 5E20A 1P92A 3VSKA 4B3XA 2JSCA 2ID6A 2NOJB 2UV1A 4CZZA 4HPQA 3CC2I 2W82A 3F8NA 5B66C 3OYGA 2K9NA 1TNTA 3MKZA 1YJ9I 2ZXJA 1IV6A 2A05A 4YIFA 4RB2C 3I64A 2PJRA 1X1CA 2W48A 3CTAA 4XLNF 5ICGA 3SZPA 3DPUA 3G1OA 1OFCX 4XNFA 4IJAA 4L9TA 2WADA 1NG6A 3QU3A 1JI8A 4BE0A 4PCQA 3K4JA 4I7HA 2DMQA 1RR7A 5ERIA 2NS7A 2G7UA 3TQNA 3NWSA 3DBHB 4OAZA 3K6GA 1D0XA 1MW7A 2ACJA 3E97A 2LR8A 2F5EA 4MIMA 4MQVA 5FFXA 2B63J 2PMUA 2WC2A 1FP2A 3I54A 3ESWB 2V4JC 3KP6A 3FXMA 1H9GA 4Y4RA 3GO5A 4ZDLA 2DA6A 5IT9K 2ZXWH 4XQFA 1USTA 3K1PA 3R61A 4KA4A 2CW8A 3MZ8A 2L7FP 3Q0UA 4LLLA 4XIDA 4IZZA 1FIAA 1WQ2A 3JW4A 2LOOA 3KCCA 5JHFA 4H4KC 3BTIA 3E1SA 4HNVA 2ELKA 1ETKA 1KONA 3R60A 5LLQA 4LK1F 3DCFA 3LSJA 2DK8A 2P8TA 3P9KA 4XK4A 3OYEA 2CFOA 4ZYGA 3ASNH 3S16J 4DQ2A 2GM4A 5IP6A 1W36D 1JGSA 3LQQA 3MKWB 5LD2C 4GYIA 4ZYAA 1XSXA 1WJFA 5FD6A 3HG9A 1GUUA 1D1CA 2DAOA 2BGCA 2ZNYA 2XPVA 2L0KA 4CICA 5JHUA 4O5VA 4F3QA 3GTQJ 1H8AC 5BPIA 1K78A 4KFCA 4RAZA 4XM3A 3PNTA 3OS1A 2HDCA 2O8XA 1IUFA 2ZO4A 1OJLA 4L18B 4OMYA 3B6CA 3K4LA 2PEXA 5CVRA 1TQMA 2CUEA 5FKLA 4WCGA 3K70D 1SFOJ 1N78A 4M73A 4EJVA 1KQ0A 4RAYA 1T38A 5IOYA 2MC4A 2KQRA 1I6HJ 3IWFA 3OYLA 3PL8A 4NQWA 2A68F 3SJMA 1FNNA 2HYGD 2PJRB 2FXAA 2OUMA 4JX5A 3P9CA 2VKHA 3QQAA 3OOPA 1B72B 3W6KB 1I27A 1HSTA 1PUEE 2QVOA 2FSWA 3ABUA 4B1RA 2CW0F 2LY9A 3E5XA 5D4SA 5K5RA 3FXRA 2DK5A 5ILUA 2COMA 4LLNA 4RBOA 5C3EJ 2LREA 1MKMA 3FKJA 1UG0A 1K61A 2XV4S 2P6TA 4OU0A 4HQMA 4PFOA 1Y8RB 3CDLA 4KJZA 4YFNF 3DLLF 2L9SA 1DUXC 1Y0NA 1R36A 5A2QK 2I5UA 3PFYA 2DMPA 1TW3A 2M0MA 4UXNA 2K9SA 3FXUA 3WG7H 3KZIC 1BN5A 1WVRA 2X6OA 4YELA 1KQ9A 2IT0A 1N77A 1LVAA 4M9ZA 3HM5A 3DLAA 4UUTA 1HF0A 1ZRDA 3OOUA 5J3LA 2XB5A 2CH0A 5CJ9A 3RTRA 4Y7NJ 4HX8A 3S1MJ 3Q0VA 2P5VA 4Y15A 4EMSA 2KP6A 3IH4A 1S3JA 4K2EA 1LVKA 4I99C 3HOWJ 3ZOBA 4G6DA 3OS2A 1BR4A 1UCRA 2O0YA 1LDJA 1BJZA 1C0WA 3G2BA 3BY6A 3GEZA 4FE4A 2OU2A 5F1RA 3ZMVA 5LEJA 2Y0SA 3JRDA 1APLC 3RPUA 4IPAA 5AIQA 3KPHA 2O8KA 2HOEA 2Y0SN 1J59A 4LB5A 2DJNA 3BTJA 3G6EI 1EA3A 2EH3A 4KIFA 3BDDA 4B8XA 1XD7A 4I0AA 2JA8J 3DBLB 4LMYA 3AL0B 3GFJA 4GXOA 3F6VA 5E1WA 2H1KA 4A3FJ 2STTA 1XCBA 2XRLA 1LQ1A 1O3TA 4A5NA 2C6YA 4BS9A 3IV5A 4YIIA 2MYSA 2FD5A 5DYMA 4QLCU 3HJEA 4F92B 3TMOA 4RAGA 2ZJQF 2NRAC 3DQVC 3MCZA 1BC8C 1YRNA 2HYJA 2P6SA 3ML6A 3HL2A 3MZYA 3ZCOA 3MEXA 4UV9A 1Z21A 4QSHA 1UFMA 2ELJA 5F04A 1VI0A 1QGPA 2BYVE 3BTCA 2R7WA 1L3LA 3GUDA 3EPZA 5C4JJ 3GXOA 4BDZA 2WV1A 4IRIA 1YLFA 4M3EA 2WB1A 4MEXF 4NQWB 3ZMTA 2CV2A 2HTJA 3PO3J 2M5WA 3GFMA 3V7CA 1TWHJ 2L7ZA 4HX4A 1AA7A 3JSPA 2ISZA 2A6EF 2HDWA 3RKYA 3TW6A 2FQ4A 5H20A 4B4CA 1G59A 3A2KA 2XF6A 2LG4A 2Y75A 2IAIA 1DPRA 2OZ6A 2DXIA 2Z1DA 2CSOA 4F91B 5F0FA 3LOCA 4KMFA 3ERMA 5JVTA 5GAEJ 1SEUA 1HKTA 1W1WE 2OV7A 1FOYA 3KFWX 1OMIA 4RGXA 2VQGA 1HOMA 3VYSB 2JJ7A 3JAMZ 1W0UA 1FX7A 1G3YA 2OPTA 2LKSA 2KIQA 1W5SA 2L9NA 1R00A 2L3DA 3K9TA 3FDYA 4G6QA 4HG2A 1RKWA 3OS0A 2MLGA 3G3ZA 4UV8A 2DN0A 5HDNA 1ACIA 2F2EA 3H3UA 4II2A 2MH9A 1F1ZA 3F0CA 4A0XA 3CZ6A 3DWLE 3T0YA 1HSJA 2VI6A 3TBIA 2EIKH 2XAJA 3FMRA 4RLQA 2CYYA 3T5XA 2X0LA 4EM2A 3F8BA 3CF2A 2DO7A 1FLIA 4MEYF 4HV6A 2BVLA 2FMLA 3FHZA 3S15J 6PAXA 1Y6IA 2DT5A 1FOKA 5TRDA 4JP0A 4BBSJ 3Q0WA 4S0HB 2K9LA 2XROA 3BP8A 2ECCA 2GLOA 1AOYA 2FA5A 4ZJZA 4QPOA 3JRAA 4IHTA 1IZ1A 3D5RC 3S1RJ 5HNFA 3CCQI 4LOCA 2X6WA 3E3VA 4Y3OA 1NG7A 2K02A 3HB9A 1OCOH 2IVMA 1T56A 5EGOB 2HI3A 1S7AA 1HCRA 5KVRA 2R7VA 4ESBA 1YRNB 2M4GA 1DU0A 2VL8A 2YPRA 1FSEA 5D6EA 3R4KA 5FLXZ 1BI3A 2KISA 3WTSC 1X1BA 4YFXF 5LHIA 3MMYB 1Q1VA 1XMXA 1SANA 5LFAA 5HODA 1RPWA 1AHDP 1RETA 4UUSB 2VQHA 3BT9A 1XG1A 2DU9A 3IKVA 5J6XA 3W2VA 5M5WJ 2EPFA 3BG6A 1LJ9A 5J47A 3DV8A 2DT7B 3WTYC 4MHGA 4HAMA 1BJAA 4G9YA 4LB6B 2W25A 3VEPA 3EDPA 4HF2A 5E3OA 5FLVA 1VQKI 1OYWA 3BQYA 3KZZA 2VJJA 5CVUA 2IS2A 4PFPA 2FOKA 4HDUA 4Y13A 5HDKA 4UNOA 4IOAF 1ZHFA 3LSRA 3HSRA 1XTAA 2ZJ2A 1Z1DA 4PDKA 2LY1A 5E3MA 1MJAA 1MNEA 3D0SA 2HZTA 1R6RA 2EILH 2GIVA 4GO1A 4NC6A 4RDUA 4OIQF 4LFUA 1RRJA 3CCYA 1BIAA 3K1MA 2Z33A 4MFDA 3SDGA 3TDZC 2Z9OA 2W85A 3CCVI 3IRRA 1AWCA 1PUFA 2D5VA 5EEHA 3I5UA 1WJCA 4ZZDA 3GLXA 1MMDA 4HF0A 2DLLA 2ZC2A 5ICFA 3SEZA 4I2OA 1Z6RA 2YU9J 1JKPC 3OYCA 4I0BA 5E8IA 3H92A 1QVTA 2R5YB 3BG9A 3CC7I 3LA3A 3HHHA 1VQ9I 2HWVA 2A3SA 3OIQA 3SZTA 3KYLA 1IDYA 4IOCF 1BR2A 2R7FA 3LL7A 3SFIA 1Z0XA 1AKHA 1SVMA 4MFEA 2VODA 1P7IA 2JWTA 4DOZA 3SHFA 4N4OB 1JE8A 4XMYA 1R4NB 3KLNA 1D5YA 1UHWA 1Y8QB 3TEDA 4YG2F 1QQIA 2JA6J 1ZTRA 3K4KA 3RDIA 1KU9A 4P1WA 5LHHA 5M5YJ 5CKTA 2Q1ZB 4M74A 5E18F 4KIGA 2BXYA 1B4AA 3M8EA 4A69C 3SXYA 3CCUI 2LFBA 3GYHX 2JUCA 3S3OA 3PQJA 1MSFC 4GFBA 1GXPA 1JT6A 2DMNA 1J2XA 3M8FA 4X6AJ 2P5KA 3P9IA 1SFXA 4KYWA 3AFHA 3BZ6A 2JRMA 2NOGA 5DS9A 2KRCA 1W4MA 2E71A 3A4CA 1MIJA 3IAM2 2ZB9A 4UVAA 2E5ZA 1JUMA 3MD2A 5FKOA 3RIRA 3BOQA 3HTSB 2CFXA 4D7MA 2R7ZJ 2N8GA 5IYDJ 4YFKF 2RQPA 2RREA 3CUQC 3BZKA 2LYCA 1S29A 4A6DA 4N4NB 2M3AA 1Z3YA 1M1EB 4HBLA 1UJ8A 4CUGA 4L9NA 3I53A 1ZG5A 4KT6A 2PFBA 1QNTA 3S3NA 4KISA 5TJJA 3Q9SA 4MTDA 3MFKA 1R1TA 4BQOA 2VB6A 2K3PA 3OYBA 3AG3H 3F8FA 3CMMA 5L3DA 3GCMA 3QPTA 1MMSA 3HGYA 2FBIA 2VBYA 1XN7A 2KDOA 1ZR2A 1ON2A 5DCFA 3TW7A 3A0HC 3OR1C 5JLWA 1TTYA 2O3FA 4IQJA 3CLOA 2GXAA 3AG4H 4GCVA 1NTCA 2YX4A 5EZHA 4A3EJ 1XS9A 4E70A 3G1LA 1WJEA 3WU0A 2ICWG 5L3FA 4FQGA 2CQQA 1P4XA 1IRGA 3GLLA 4E7LA 1MBJA 2G0EA 3CDHA 4XRMA 2R7TA 2M8GX 2V1UA 3B6AA 1JT0A 1YW8A 3EYIA 1OCPA 1Z3XA 5KNLA 4CSWA 2DA3A 4IX7A 3EQLF 3HYIA 3A02A 4KUMA 2VUMJ 5EJCA 3NAUA 3QYFA 3S93A 3EUHC 3BJ6A 4XKCA 4BY7J 2CQKA 4WWCA 3MN2A 1V4RA 2EZKA 4LJZF 1JJ6C 4WF2A 2XB0X 3CDIA 1P4AA 2E2HJ 5L3GA 2QZ8A 3BR2A 1SVOA 1U9OA 3JRCA 2CU7A 1Z7LA 2O7OA 2XAUA 3I58A 3OYFA 3QYBA 4E7ZA 1K79A 2MFZA 2JMWA 4FHTA 2RDPA 3KZYA 4N9IA 3K69A 3WU2C 2CMPA 1RKTA 4ITVA 2KL4A 4C3HJ 1EV7A 1UB9A 3WTZA 1X3ZB 5D5UB 1GHCA 2XGEA 1RZ4A 3F8MA 3BCAA 1F9NA 3M1CA 3IHUA 3LAJA 3GZ6A 1W0TA 1V5GA 1ZG3A 5JFRA 3HOXJ 5J8CA 4HEA2 3WTTC 1K6OA 4A3CJ 4BACA 3QP5A 3C7JA 1PJRA 1HXDA 3HRUA 1XDUA 3IH2A 2DDBA 4HZFA 5KAFC 2EINH 4GGGA 2BXZA 3M7GA 4NC8A 2IPQX 2JZYA 4Q5SF 1WJ5A 2QYOA 2XGXA 4NUBA 2HPIA 1LEBA 3K1NA 1LPQA 2D1HA 2PX9A 1WGXA 2GOMA 1ZH5A 1ZAOA 2Q2EB 4KIBA 3LSPA 2IJLA 3K2ZA 1TWFJ 2M9HA 3L2QA 2NVTJ 3C2HA 4OINF 3F23A 4KN7X 3HEFA 3E5QA 1WWXA 2BBYA 5HNHA 2JA7J 5J1UA 3JAMK 5E3LA 1SC7A 3E6CC 1R7JA 3ZP5A 3KYCB 4AYBA 2V9KA 1YTYA 3I4PA 4XKVA 5H2FC 4FT8A 5F64A 1X19A 4AIDA 4AYBN 3CLQA 4M6VA 3Q5FA 1LE8A 1VQLI 1V3FA 1N75A 2PI0A 3QPLA 1VQ7I 1E0EA 2K4BA 3LSGA 3PQKA 5ICCA 3JR9A 2XUBA 2AO9A 2VJ4A 3HTUA 2XASA 5HOOA 2TCTA 3M1EA 1D8JA 5GP9A 4IL6C 4A3MJ 2F4MB 3D5SC 1VTNC 4OMZA 1PP7U 1P9QC 3MWMA 4BQNA 5K7FA 2WY7Q 5D4RA 3DU6A 3CMEI 2FQ3A 2XKPA 3ZQ7A 1YX5A 3HIFA 1U6GA 3IP4B 3EUKL 1B72A 3KE2A 1QHHD 3ZQQA 2X1CA 1T0FC 2ZJPF 2O6GE 2R7OA 3LSIA 1V5EA 1I6XA 4XICA 1HW5A 4I02A 1JTYA 4O6JA 5GPAA 4ENMA 3U1KA 4M9XA 1CF7A 5DUIA 2L5QA 2Z2SB 2H94A 5B1BH 1OQYA 3C2BA 4R79A 1R1VA 3DPLC 2DQRA 2VBZA 2A6HF 2V6CA 4JYKA 2CW7A 5FKNA 4CCOA 2KT0A 1FWZA 2MGQA 1T6SA 1Z6TA 3HSFA 4HV5A 3VSLA 5FRNA 2OCEA 1FYMA 1RC9A 5FLXK 2EV0A 3BPVA 2BEOA 2QQ9A 3CUOA 3KEOA 2JVGA 3DEWA 3H0GJ 3RQ4A 1DDNA 2VBXA 1LDDA 1OCZH 1KA8A 4C30A 2MA3A 5HVQC 1QO0D 2CGPA 3JRIA 2DPUA 3C18A 3GMEA 3ZQIA 4A2UA 3H5AA 2E1MB 1BC7C 3I0TA 5DCMB 2DOFA 2LBFA 3MQ0A 2R7RA 4EM0B 4PJ0C 2EA4A 5CVVA 1FEXA 5J4VA 2NAZA 2AXLA 1VFCA 1F5TA 2K86A 3DEUA 2PJPA 3RSNA 2K9MA 4M72A 3PO2J 1XCVA 3RYRA 5ED4A 1MD0A 2EZLA 3FXJA 2ZFWA 1IN8A 2RGVA 4ZYDA 2OQRA 3I56I 1BOAA 1MMNA 5L3BA 1U5TC 3O6BB 1YW9A 1SFUA 2IGMA 4ZYHA 1LE8B 1BM9A 5JVGF 3FF5A 2W7NA 2HNHA 1IXSB 3FHNA 1BA5A 4IO9F 1YS6A 2LP0A 4DNCA 5BPDA 4IRGA 1MBHA 2HKOA 3L2UA 3E5UA 1YYVA 2LY2A 4P55A 1WI3A 4BAYA 5DM6F 2LNBA 2A69F 1X2MA 1TW2A 2WA0A 2BVMA 3PFIA 3H0DA 2LC2A 4M3FA 3QU6A 3ZQFA 2CQXA 3IRQA 1UHSA 1HKSA 1VQMI 5EEAA 4HW0A 5AIPA 1XDSA 1BOBA 1O7LA 2VIXA 1GV5A 3T1BA 1P4WA 4J00A 5ILSA 1UZCA 2PQ8A 1A35A 3BROA 3GBGA 3E6DA 3JREA 1DGRM 4PGGA 3S3MA 2IBDA 2MLKA 4QTRA 1Z9CA 1CF7B 3ONQA 2X6YA 2AHQA 5LRRA 2KIUA 1GV2A 1WPKA 3GWZA 3JTGA 5BNGA 4LGWA 3VYUB 3TO6A 3F21A 4G12A 4IXAA 5E1XA 1KU3A 2X9DA 3FK6A 4I6ZA 4RMNA 1FJLA 2VE8A 3DF8A 4ENNA 1DP3A 1GLNA 3L2VA 3A0BC 5HLHA 4RAFA 4ZYEA 1RESA 2IRFG 2F4IA 1NH3A 4FE7A 3MVPA 4AM3A 2VJ5A 1HDPA 1F43A 3L00A 3VODA 1FOXA 1IRXA 4YIRX 1DPUA 5H6RA 1IDZA 4FX0A 2GQQA 1V5FA 4AU7A 1MNMC 2OBPA 4P9FA 3SEQA 2LBFB 2XF5A 5FO5A 2ZXHA 2V1XA 2FBHA 2Z5UA 2A6TA 2OJED 4XLCA 1XGOA 4G8XA 2DDAA 2KFDA 5B1AH 2IGOA 4RGUA 3CCEI 4XRFA 2ME6A 2Q8KA 3ERED 3ECOA 3HSEA 3G1MA 2M30A 3GTGJ 5C4XJ 1IN4A 4P96A 3OR2C 3COAC 1MSEC 1SMTA 2H8WA 2E7WA 2Y2ZA 1FMWA 2P7VB 5BQTA 1YIJI 1ETOA 1IAWA 3HDDA 3GZ5A 3ISPA 2PN6A 2LK2A 4RGRA 3CCLI 1YOVB 4ESJA 3FX3A 1I3QJ 3DFGA 3MKLA 1HW1A 4ZTFA 5K7HA 4LK0F 2ZNZA 1IUYA 3CCMI 4EV0A 1RI7A 5EGOA 1JHFA 4N0BA 3PSIA 1W7PD 1J75A 4HNTA 1BW6A 3S1NJ 2E1NA 2MABA 3ELKA 5TGTA 2QSGX 3TOBA 1FC3A 1FIPA 3BQZA 3J7AO 1I39A 4PK4A 1R49A 3HHGA 4R8HA 1JKQC 2X48A 3LFKA 5DUKA 4IHVA 4UUSA 1ZGJA 3OMYA 1TT5B 1J9IA 3FXLA 1MGTA 5IPAA 4XBFA 2HXIA 5IT3A 2R5ZB 4E7HA 2JRTA 3M3YJ 2FF4A 2LTPA 1F4KA 2F5DA 1LFBA 2WB1N 4BGDA 4XN0A 5F0CA 1Y0UA 3IUOA 1U0JA 1MH4A 4CHUA 1QZZA 4OIOF 3S2DJ 2IGKA 2P4WA 2BY0A 5DD4A 4RS8A 1XGNA 3VOEA 5D8LB 1TWCJ 2H8RA 3O8HA 3HOYJ 2EZHA 2LF8A 2DW4A 3M8JA 3CO7C 1IN6A 2GAUA 3CJQB 3DTEA 1MBFA 2GOXB 2VKVA 4WXCA 4UHTA 2DYRH 4U88A 3RPQA 3VFZA 3H9GA 4IHSA 4IRHA 1LFUP 3ABLH 5FFZA 4J19A 2BHYA 1V55H 1VQ6I 2RN7A 1R5HA 2LD5A 3RI4A 1R5ID 1OYIA 2HXOA 3BJAA 2JA5J 1A31A 1ORKA 4DJAA 3FXOA 3QOEA 2BY3A 2IGNA 4AD9A 3S14J 1J09A 2R5YA 2WY8Q 4YRVA 1X4PA 4HX7A 4DIQA 1TP4A 5EF6A 1NK3P 1DGWY 4EEFG 1A6IA 1Q1HA 3HRTA 2L01A 4ABZA 1VZ0A 1T39A 3K0LA 1XB4A 4JOMA 5EZGA 3R6SA 2L4MA 3O8GA 4ESFA 2VJIA 5D5WB 4MO7A 1K4SA 3ZPLA 2Y48A 4C2TA 4HQEA 3NEUA 4BHCA 4IHYA 2AQEA 2YX7A 2JUGA 3BG5A 2W24A 2DPDA 4L9JA 4LIVA 4BQAA 1H88C 5FRMA 1HQCA 3ASOH 2HTSA 3UR3C 1JKRC 1UAAA 1ZG1A 1WZ2A 4FCYA 4NDLA 4AIJA 1VQ4I 2DJIA 3RCOA 4E7IA 1G3WA 2GBYA 3AL0C 5CQEA 1J5YA 3W2WA 4ENKA 1R58A 3CF5F 4CXFA 1D5VA 1YITI 1MH3A 4A6EA 2OTLI 1TLHB 2DMUA 3V8KA 1EH7A 2IS4A 2KZGA 3V7RA 2AXTC 2ZMEA 3PSFA 2EV6A 3IC7A 1XC5A 4I98B 2QBYA 5HS8A 4C3IJ 2ISYA 2NVXJ 2K27A 2ID3A 4A93J 4E6KG 2QLZA 1QPMA 3BZCA 4PJNA 3KP7A 3CUQB 3OL4A 1ZR4A 2L9VA 2X6XA 1OR7A 2E2IJ 2OZUA 2EB7A 1ZN2A 3CJTB 2RQQA 2V7FA 2HVRA 1SD4A 3BG3A 4KNYA 4L0ZB 4ZC3A 2KPMA 4Y17A 3REOA 1ZKGA 4LITA 4XN3A 4D0PA 3C1DA 1T08B 1T98A 1TC3C 3H5RA 3CESA 5HLIA 2Z3YA 1D3YA 3BWGA 2OF7A 1KYZA 4EGZA 5M5XJ 1IF1A 4BXUA 2LVSA 2V1NA 3GW2A 3JRBA 1LKXA 5CVIA 1VQ5I 4MQ9F 3E6BA 2YUSA 4RB0A 4P9UA 2XAFA 2R93J 3ROUA 1D1BA 3AKZA 4HA8A 3W6VA 5M3MJ 3J80Z 4MTEA 2P5LC 2CO5A 3H3ZA 1HA8A 4HLXA 3V8JA 2LKXA 2VQCA 4XKWA 1A04A 1B6AA 2ETHA 4HRIA 3F9KA 4EJTA 2M0CA 4RM3A 2EFWA 3GTMJ 2FU4A 4E7JA 2OTJI 1O4XA 4A3BJ 3BG7A 2XRNA 2DQLA 2BE5F 3GZNB 1QU3A 3DTIA 2QEXI 4Q4ZF 2F5VA 3D1NI 1T8IA 3S1QJ 2Z99A 3ZQGA 4D1QA 3N4MA 3LNQA 5HLGA 3I59B 3ZN0A 3FXKA 2KJBA 2HKXA 2XGCA 3I3LA 5F08A 2XHKA 3V4GA 4I09A 4Q48A 3HOZJ 2QKLB 4CA0A 3QAHA 4UVBA 3J7AY 3TO7A 1WKMA 2X1DA 2TRTA 3CJNA 3PUFA 4JQFA 3ECHA 4YEJA 1X1AA 3K10A 1XSVA 4M71A 2OCCH 2L7KA 4L9VA 2CV1A 2DA5A 4XSZF 3G73A 2QQBA 1Z91A 1ENHA 3DEEA 1T95A 2BHZA 1LFPA 1QHGA 2ZMEB 5D8KB 1JXSA 2D45A 2QBYB 4G6TB 3HOTA 4M3BA 1OCTC 2PG4A 1B8IB 2E1CA 4IHWA 2RC4A 1XX5A 1X2NA 2HGCA 3U9GA 2Q2EA 4KMUX 3JTHA 5GADJ 2DA2A 3JRFA 1L0OC 2ELHA 1VQOI 1ETVA 2G9WA 3NWTA 1I3AA 1YW7A 2XSDC 3I4MJ 3DTKA 2OQGA 1IG7A 3HXLA 3CCSI 3QYEA 4BE2A 2WAFA 2E19A 1ULYA 1U78A 1FBUA 2ESHA 2WTEA 5GPCA 1KQ8A 2V9PA 2M1BA 4WX9A 4L5IA 3BPXA 2IA0A 1PDNC 4D5CA 3OSGA 1O3RA 5F1JA 2E5NA 1BIBA 2UZKA 4JX4A 4U87A 4AC0A 1E3OC 3W6JB 1FMVA 1S72I 1W7PB 1BR1A 3QRFF 1ZYRF 3UKGA 2QUFA 4B43A 1U2WA 3ULQB 1OLTA 1Z05A 1TNSA 4AIHA 3RKXA 4FX4A 1YO5C 3QPSA 5GTIC 2KZVA 2Y9YA 4XSXF 4RB3C 5EEGA 3M07A 1MBKA 1ETQA 1WCMJ 4ASNA 1XGMA 3OY9A 4XLAA 2E34A 3WGGA 2UXXA 4CCJA 4S04A 2NNYA 2G7HA 1FBSA 3PUBA 4BJ6C 1S7EA 2XAQA 4A3DJ 1YQAA 4IF4A 2CQNA 5D6FA 2I10A 2P81A 2HFHA 3QP6A 2R0QC 3I4NJ 1K7AA 2IXSA 1ZQ3P 1FSHA 3KLOA 1WI9A 3LWFA 2VONA 5FB2A 2H6BA 3KP2A 4MNUA 2HEOA 3FMQA 4IHXA 9ANTA 4W97A 3K4BA 1P6RA 3SZGA 4A3JJ 3OYMA 4DYQA 2L02A 3DKXA 5AONA 4G94A 4ZH4F 2VPLA 2L4AA 4G7OF 1HW2A 3TDUC 2TDXA 3DU5A 3RKWA 1E3HA 4CDGA 1IJWC 2KHMA 5DCMA 1ZELA 2FOWA 4QPQA 3CMYA 4XLHA 2E35A 1WHUA 2V9VA 2WAEA 1IN5A 3QOPA 4XKBA 4DZJA 1FY7A 4C2MJ 1VNDA 3HUGB 2HOTA 1KYWA 3ZRGA 2KRHA 1IW7F 2STWA 1Z77A 2FJ1A 5GTHC 2X85A 3DXJF 3SYTA 5ILVA 2R7SA 1S7OA 1GXQA 1HBXG 3ZGKA 4IQ4A 2RNGA 3W3CA 1H89C 2K9QA 4FTHA 2XAGA 4CCNA 1IGNA 2AS5F 1X1DA 4C3JJ 3I55I 1E3PA 1RIOH 1AU7A 1H0MA 2XSJC 3TO9A 3BC8A 4HDVA 2V1DA 1LNWA 1HC8A 2VPRA 2HOAA 5BMZA 2P7CB 3QODA 1MJ9A 2FNPA 2CRGA 1W5CC 2X1EA 4M3DA 4CCKA 2PMHA 1A6QA 3ZQHA 5J8FA 4HSTA 1IXCA 4DYCA 5IYBJ 5K5OA 4A12A 3GVAA 5JR3A 4JX6A 1T2KA 2LSOA 4IKFA 2PLYA 2PBIA 5KK1A 4UY8I 2FNAA 2QWWA 3LSHA 4OOIA 1SFKA 3IWZA 3S8PA 5K1YA 2VKEA 3FIWA 4EJOA 3KIOA 5E79C 4DW6A 4ETSA 4DBQA 4DBRA 2IA2A 1XGSA 3IAS2 4BEHA 2W00A 2OC6A 2KIMA 4XLPF 3ZQCA 3MKYB 2Y0MA 5DV5A 2Y30A 2R7QA 4IVNA 2A07F 1ETXA 1OPCA 2K7LA 4MGRA 3RPUD 1I5ZA 3JCUC 4QWQA 1I50J 5BS6A 2M45A 2ZSHB 5E3NA 4F7ZA 4ZDOA 3KEQA 1LUJB 4A5MA 4L5EA 1KU2A 3ABMH 2KIFA 1K6YA 2VOPA 2DCEA 2CUJA 4XR6A 1SMYF 4U0VA 2R7XA 3FMSA 4EVIA 1RUNA 2DTRA 2K85A 3OYIA 3BCBA 3N05A 3NARA 3WODF 2VASA 1STZA 5FD5A 2DYSH 1R4MB 2E7XA 1MMGA 3ZN1A 4S05A 1U8RA 2KJCA 1TWAJ 1D8KA 3OYHA 1WH7A 2VN2A 3U2RA 2FUG2 5LGUA 3SQNA 3H1CA 1IO2A 1B9MA 5D5VB 4A3GJ 3LSMA 2QA4I 2XVCA 4Y52J 3K2AA 3K4MA 2MH2A 4XOTA 1LB2A 2RAEA 3HPGA 3K7AJ 2QSHX 2VXZA 2RV8A 5GAHJ 2K4JA 5E17F 4U7BA 1TZLA 1MDMB 1EF4A 1OCRH 1G2HA 2EZIA 4FISA 3RQIA 1B1BA 5J1RA 4O3MA 5LGNA 5LHGA 4UUVA 3HC7A 1EJ9A 4XONA 2DI3A 1HKQA 1R22A 2W1OA 3L2RA 3BR0A 1R71A 1NHAA 4CCLA 4WXHA 5K5QA 3Q9VA 4LG0A 1V54H 2MD5A 1YJNI 3FBIB 5J40A 3L2CA 2ZJRF 1X1PA 4KN4X 5E1ZB 3RZDJ 2HS5A 1YS7A 2M87A 3RJPA 2O9LA 1ZLJA 2GXGA 2M7AA 1POGA 2JPCA 5IYCJ 4HLYA 3J80K 4HOBA 1JJ8C 2VC0A 5L3EA 1CQTA 4OIPF 4CO8A 3E6MA 2LRDA 4BHBA 2JVHA 5IY5H 2L7MP 1XMKA 3O2PE 2GWRA 3HRMA 2R5ZA 4E7SA 2YU3A 3V42A 3A01B 1O57A 4A3KJ 4AVZA 4XRSG 4CGZA 4BEHB 2NVQJ 3HOVJ 2NS0A 4OIRF 1T33A 4A0ZA 4E4HA 1XPXA 2QQAA 5IOZA 2L2OA 1GT0C 2EFOA 1QA6A 2KLOA 5IP9J 1R5GA 5J1YA 3DBRB 1I1SA 2OD5A 2H1LA 2Z16A 3FXQA 3GTPJ 3TOAA 1ETWA 3OSFA 1ZLKA 3ABTA 3SFZA 4V2GA 4Z2YA 3ZXSA 2JK3A 3H5NA 2FMYA 2K5CA 2OAZA 4JBAA 2DFFA 4NBQA 4G7HF 1F36A 1Z7UA 2Q0OA 2ZFUA 2R3SA 3GFLA 3KETA 1FYKA 2BW3A 1PYVA 3AG2H 1ZK8A 3H3VK 4RLFA 1WRJA 2Y9ZA 1JGGA 4ANJA 1D0YA 5F27A 2I8DA 3BR3A 2D2WA 2COBA 1A5JA 2KRFA 4J01A 2HQAA 3OWTA 2PMZA 3PJRA 4V2FA 3F22A 3IH3A 2PMZN 5DDGA 3ZMUA 1IXRC 2HU9A 2NVYJ 3P7NA 1TL8A 1MJBA 4NHJA 3RKQA 1WFXA 2EQRA 2QSFX 4GYGA 5TISC 1XMAA 3WHCA 3CJRB 1SAXA 4V19K 3HZJA 2H27A 5CPRB 2DT6A 2AQFA 3BTLA 2XC7A 1ODDA 2VKDA 4AWXB 2CV0A 1J7KA 3ZMZA 1KGSA 2E1MC 3FM3A 4ZZLA 3A03A 1VQ8I 1KZHA 2L9RA 1JUPA 3VPRA 2VT3A 3FISA 1Y1VJ 2HR3A 3G4SI 3GTOJ 3WHBA 3FKIJ 1MMAA 2UWMA 2XIGA 4BUPA 1GVJA 4LG0B 3CD6I 2J5OA 4II3A 3DP7A 1ERDA 1SD6A 1DQUA 3FBNB 1LEAA 3V8LA 4B47A 3JRHA 3GTLJ 2O61A 5FGMA 4BQQA 5HDGA 2D1VA 2IW5A 3QPHA 5K7ZA 2GXBA 5FJ8J 4CYCA 1E2XA 4NC7A 4AVPA 2EK5A 2MC3A 4M9SA 5KCMA 4EQQA 4G7ZF 4R1HA 3J81Z 3IKTA 2IS1A 4IEJA 5FKMA 3OYNA 1I1GA 4KITB 2WWYA 2HPMA 3GTKJ 3LSKA 3ZQLA 1ZGAA 2GA1A 1BI2A 2XF7A 5CQGA 2LKPA 4H0EA 3B02A 3KP3A 4X0GA 2ZKZA 1K78B 3D5LA 1JKOC 4HF1A 2XDVA 3K4CA 3HPHA 1UMQA 1D1AA 4X1EA 3HRSA 3H9QA 5HS7A 3CUQA 2B7EA 2RNJA 4BXXJ 2X51A 4Z6YA 2K40A 3KX2A 1XSDA 2VLAA 3DKWA 5DM7F 3K4NA 4OAYA 1OCCH 4XRSA 3U1DA 4PSWA 1QPIA 5F6FA 4RM2A 2V26A 2ECBA 2DFEA 2GZWA 4A3IJ 2EV5A 2H6CA 3CQZJ 4LIUA 2EIJH 3OIPA 1BI1A 4A0YA 4UB8C 5LRSA 3F6OA 4I01A 2X4HA 4PGHA 5BOXA 1MZBA 4D7NA 4CCMA 5CYVA 3CC4I 2BW3B 3S2WA 2DTZA 4LLGF 5EDNA 1QZEA 1UG2A 1YJWI 1DU6A 1TWGJ 1G6NA 2DFHA 3F72A 3WTXC 5B3SH 2HQ5A 2QGUA 3S32A 2FBKA 3P5JA 5H6QA 1ZARA 3F3XA 1O7FA 1R9TJ 5CVJA 2JN6A 4JK1X 4RGSA 2EFPA 4F55A 3B73A 2F5FA 1CGPA 5HS9A 2A5YB 2YR2A 2QCOA 3NRVA 4WXDA 2BV6A 3RZOJ 3N97A 2LF7A 2L54A 3OYJA 2F48A 4NB5A 3EUHA 2R7UA 3LMMA 2LH9A 1IRZA 1G3TA 3BLYA 3I59A 1IV8A 2EJRA 3KYDB 3M9AA 2BZTA 2UUZA 5LGTA 1K4TA 2FE3A 4BU2A 3CMAI 4BE1A 1ON1A 3OIOA 2ME0A 5ICEA 1OYYA 3WTVC 3AAFA 3MZHA 3EYYA 4QIWN 4FASD 1KU7A 4HSRA 4L5JA 4KT5C 5LBQA 2R92J 2DOAA 3MAJA 3ZR8X 5J4YA 2ADUA 2MBFA 1B59A 5HLTA 4KICA 4BXFA 4CYCB 3H9JA 5FROA 3PM1A 1VF9A 3LA7A 1ZRCA 3WE2A 3QWLA 4XOPA 2JPBA 1SD5A 3CO6C 3UNGC 2NYXA 3W2AA 1UELB 1GDTA 2VXDA 3BJOA 4XLFA 3TL4X 2ZCWA 2GA2A 4BNCA 4U0WA 1ZGWA 1B8IA 3KP5A 3CP2A 3LQRA 5C44J 4ON0A 4B44A 1Y1WJ 3HKZA 4C2UA 3L7WA 5DD8A 1PP8F 2EIMH 3R0JA 4ZTJA 2KMUA 1DP7P 3HKZN 4ENJA 3OL3A 5IT9Z 2JT1A 4PUSA 2ZBKA 5JLXA 2HVQA 1Z67A 4I76A
chains in the Genus database with same CATH topology
2XPWA 2Y9YA 2H1KA 4A3FJ 2IEKA 4M3GA 3JRIA 1MBKA 1ETQA 2XRLA 1WCMJ 5EG0A 3ZQIA 1WH5A 2XGDA 1JUSA 3IV5A 2FD5A 1S7EA 4A3DJ 1YRNA 2HYJA 1FEXA 2I10A 3BR5A 2P81A 2R0QC 3I4NJ 1VFCA 1ZQ3P 4QSHA 5F04A 1VI0A 3BTCA 3PO2J 4IHXA 9ANTA 4W97A 5C4JJ 4A3JJ 2EZLA 2WV1A 4DYQA 3E7LA 4M3EA 2DA4A 3PO3J 1TWHJ 2L7ZA 2QF7A 1IJWC 1LE8B 4D5FA 3TW6A 2FQ4A 4B4CA 5FKKA 3CMYA 4W1UA 1BA5A 2IAIA 4DZJA 4C2MJ 1VNDA 2LP0A 2HOTA 4AUXA 1MBHA 1Z77A 1WI3A 2FJ1A 5EYRA 5F0FA 3LOCA 1FTTA 1ITYA 1X2MA 2DA1A 4M3FA 2YS9A 1HOMA 3ZQFA 2CQXA 2JJ7A 1UHSA 1W0UA 1H89C 2K9QA 4FTHA 3FK7A 5EEAA 2OPTA 1IGNA 4C3JJ 1AU7A 3L1PA 1GV5A 1RKWA 2MSYA 5FLMJ 2DN0A 3GBGA 1U9NA 3JREA 2MG4A 3F0CA 2IBDA 4QTRA 2VPRA 2HOAA 2AHQA 2CRGA 1GV2A 1WPKA 2VI6A 3BR6A 4M3DA 5BNGA 1HLVA 3ZQHA 4G12A 2X9DA 3FK6A 4DYCA 4I6ZA 3HBLA 5IYBJ 1FJLA 4JX6A 3S15J 4BKXA 1RESA 4BBSJ 4JP0A 2VKEA 3FIWA 3M4OJ 1MBGA 3Q0WA 4FE7A 4S0HB 4DW6A 2ECCA 4B3AA 2GLOA 2E1OA 3MVPA 2M2EA 2HDDA 3JRAA 2XPUA 1HDPA 3ZQCA 4BY1J 5EG0B 1F43A 3S1RJ 2EBIA 4LOCA 2DMTA 1IDZA 2Y30A 3HB9A 1MNMC 1ETXA 1T56A 5EGOB 2HI3A 1I50J 1X58A 1NK2P 1HCRA 5E3NA 1YRNB 1DU0A 3S2HJ 1K83J 4L5EA 1Q1VA 1SANA 2M34A 2WAQN 5HODA 2ME6A 1RPWA 1AHDP 1RETA 4UUSB 3BT9A 1XG1A 3G1MA 3GTGJ 5C4XJ 3TP3A 5M5WJ 3NARA 1PUFB 2CUFA 1HDDC 1MSEC 2Y2ZA 3HDDA 1ETOA 3Q3SA 1ETYA 1TWAJ 2LK2A 1WH7A 1I3QJ 3MKLA 5K7HA 5E3OA 5FLVA 3BQYA 5EGOA 2DA7A 3JRGA 4A3GJ 1BW6A 3TP0A 2MW8A 3S1NJ 3LSRA 4Y52J 3K2AA 1BW5A 1FIPA 3BQZA 2RAEA 2LLKA 1FTZA 3K7AJ 5E3MA 1JKQC 1AKHB 2X48A 4DZPA 5F0HA 4RDUA 4IHVA 4UUSA 2KDZA 3S17J 2E2JJ 1EF4A 1G2HA 2EZIA 4FISA 3CCYA 3RQIA 5J1RA 4MFDA 3SDGA 4DYRA 5IPAA 2HXIA 2NS8A 2R5ZB 1PUFA 2CJJA 2D5VA 3M3YJ 2LTPA 3BR0A 1LFBA 2WB1N 5F0CA 1MH4A 3HOUJ 3HGGA 2YU9J 3S2DJ 3RZDJ 1JKPC 3BR1A 5M3FJ 1JTXA 1U8BA 2O9LA 1QVTA 2R5YB 3BG9A 1TWCJ 1POGA 5IYCJ 2H8RA 3O8HA 3HOYJ 3GTJJ 1IDYA 2EZHA 4BBRJ 1JJ8C 3SFIA 1Z0XA 1AKHA 4MFEA 1P7IA 1CQTA 2JWTA 1MBFA 2VKVA 5IP7J 2L7MP 5DTDA 1MBEA 1D5YA 2R5ZA 3TEDA 3A01B 1LFUP 4A3KJ 1BL0A 4MLOA 4J19A 4XRSG 2JA6J 1ZTRA 2NVQJ 3HOVJ 1T33A 2LD5A 5M5YJ 4A3LJ 5IOZA 1GT0C 2HXOA 5IP9J 5J1YA 1GVDA 2JA5J 1ORKA 2HOSA 3GTPJ 3S14J 2R5YA 1ETWA 2Y31A 4A69C 3OSFA 2LFBA 4V2GA 5EF6A 1IC8A 1NK3P 2JK3A 1MSFC 4EEFG 1A6IA 4GFBA 1JT6A 2DMNA 4ABZA 4X6AJ 1F36A 2NOGA 5EZGA 5DS9A 1QRYA 3O8GA 1ZK8A 4MO7A 3H3VK 3A01A 2Y9ZA 1P7JA 2ZB9A 1JGGA 1JUMA 5FKOA 1QVUA 5F27A 3BR3A 2FX0A 4IHYA 2COBA 1A5JA 4D7MA 2R7ZJ 2N8GA 3BG5A 5IYDJ 1H88C 4V2FA 2ID6A 3IH3A 2PMZN 1JKRC 4FCYA 2NVYJ 3RKQA 2EQRA 4NDLA 3WHCA 2K9NA 2GBYA 1IV6A 2W48A 3BTLA 3G1OA 1OFCX 3HGYA 1MH3A 3A03A 2L9RA 1ZR2A 1JUPA 2DMUA 3TW7A 3VPRA 3FISA 1Y1VJ 5JLWA 2DMQA 1RR7A 2NS7A 3GTOJ 3WHBA 1XC5A 3FKIJ 4C3IJ 1NTCA 2LR8A 4MIMA 5EZHA 4A3EJ 2NVXJ 1XS9A 2ID3A 2B63J 4A93J 3G1LA 1ZR4A 2CQQA 2E2IJ 3JRHA 3GTLJ 1MBJA 2G0EA 4XRMA 2M8GX 3B6AA 1JT0A 5K7ZA 5FJ8J 4CYCA 1OCPA 3BG3A 2DA6A 2DA3A 1ZKGA 4XIDA 3Q0UA 2L7FP 4IEJA 5FKMA 2VUMJ 3A02A 1FIAA 3GTKJ 1TC3C 3NAUA 3BTIA 3ZQLA 4BY7J 2OF7A 4HNVA 3MN2A 2EZKA 2ELKA 1ETKA 5M5XJ 1JJ6C 1JKOC 2XB0X 3DCFA 2LVSA 2E2HJ 3LSJA 3JRBA 1UMQA 3BR2A 4XK4A 1U9OA 3JRCA 2CU7A 2O7OA 4X1EA 2YUSA 3S16J 2JMWA 2GM4A 5IP6A 2R93J 4BXXJ 2K40A 3W6VA 5M3MJ 1RKTA 4C3HJ 4XRSA 1QPIA 2LKXA 2XGEA 2ECBA 1GUUA 4A3IJ 3CQZJ 2XPVA 1W0TA 2L0KA 3HOXJ 2M0CA 4A3CJ 3GTMJ 1O4XA 4D7NA 3GTQJ 4A3BJ 3IH2A 1H8AC 2DTZA 5EDNA 3D1NI 3S1QJ 1UG2A 3ZQGA 1DU6A 3LNQA 1TWGJ 1IUFA 2XGCA 5F08A 1OJLA 3B6CA 2HQ5A 2CUEA 5FKLA 3HOZJ 1SFOJ 1WGXA 3LSPA 5IOYA 1TWFJ 2M9HA 2NVTJ 1R9TJ 2TRTA 1I6HJ 2JN6A 3HEFA 2JA7J 5J1UA 5E3LA 3SJMA 2QCOA 4JX5A 3QQAA 1B72B 3RZOJ 1LE8A 4AYBN 2DA5A 4M6VA 4B1RA 2LY9A 1IRZA 3QPLA 1ENHA 4RBOA 3LSGA 5C3EJ 3JR9A 1K61A 2AO9A 1OCTC 4M3BA 3CDLA 1B8IB 4IHWA 1X2NA 2TCTA 3JRFA 2DA2A 2DMPA 2ME0A 3OIOA 2K9SA 4QIWN 5GP9A 4A3MJ 2R92J 1ETVA 2X6OA 5K7FA 4CYCB 3HM5A 2XSDC 3PM1A 1VF9A 4UUTA 1HF0A 3I4MJ 3OOUA 5J3LA 2XB5A 1B72A 4Y7NJ 3S1MJ 1IG7A 3Q0VA 3IH4A 4XICA 1JTYA 5GPAA 3HOWJ 3ZOBA 2E19A 1U78A 1BJZA 1GDTA 3C2BA 5GPCA 4FE4A 1ZGWA 1B8IA 4JYKA 5FKNA 2KT0A 5C44J 2MGQA 4D5CA 3JRDA 3OSGA 5F1JA 1Y1WJ 1APLC 4JX4A 4AC0A 2O8KA 2Y0SN 1E3OC 3DEWA 2DJNA 3BTJA 3H0GJ 3HKZN 2EH3A 3UKGA 2JA8J 5JLXA 3QPSA 4I76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XPW A;  2Y9Y A;  2H1K A;  4A3F J;  2IEK A;  4M3G A;  3JRI A;  1MBK A;  1ETQ A;  2XRL A;  1WCM J;  5EG0 A;  3ZQI A;  1WH5 A;  2XGD A;  1JUS A;  3IV5 A;  2FD5 A;  1S7E A;  4A3D J;  1YRN A;  2HYJ A;  1FEX A;  2I10 A;  3BR5 A;  2P81 A;  2R0Q C;  3I4N J;  1VFC A;  1ZQ3 P;  4QSH A;  5F04 A;  1VI0 A;  3BTC A;  3PO2 J;  4IHX A;  9ANT A;  4W97 A;  5C4J J;  4A3J J;  2EZL A;  2WV1 A;  4DYQ A;  3E7L A;  4M3E A;  2DA4 A;  3PO3 J;  1TWH J;  2L7Z A;  2QF7 A;  1IJW C;  1LE8 B;  4D5F A;  3TW6 A;  2FQ4 A;  4B4C A;  5FKK A;  3CMY A;  4W1U A;  1BA5 A;  2IAI A;  4DZJ A;  4C2M J;  1VND A;  2LP0 A;  2HOT A;  4AUX A;  1MBH A;  1Z77 A;  1WI3 A;  2FJ1 A;  5EYR A;  5F0F A;  3LOC A;  1FTT A;  1ITY A;  1X2M A;  2DA1 A;  4M3F A;  2YS9 A;  1HOM A;  3ZQF A;  2CQX A;  2JJ7 A;  1UHS A;  1W0U A;  1H89 C;  2K9Q A;  4FTH A;  3FK7 A;  5EEA A;  2OPT A;  1IGN A;  4C3J J;  1AU7 A;  3L1P A;  1GV5 A;  1RKW A;  2MSY A;  5FLM J;  2DN0 A;  3GBG A;  1U9N A;  3JRE A;  2MG4 A;  3F0C A;  2IBD A;  4QTR A;  2VPR A;  2HOA A;  2AHQ A;  2CRG A;  1GV2 A;  1WPK A;  2VI6 A;  3BR6 A;  4M3D A;  5BNG A;  1HLV A;  3ZQH A;  4G12 A;  2X9D A;  3FK6 A;  4DYC A;  4I6Z A;  3HBL A;  5IYB J;  1FJL A;  4JX6 A;  3S15 J;  4BKX A;  1RES A;  4BBS J;  4JP0 A;  2VKE A;  3FIW A;  3M4O J;  1MBG A;  3Q0W A;  4FE7 A;  4S0H B;  4DW6 A;  2ECC A;  4B3A A;  2GLO A;  2E1O A;  3MVP A;  2M2E A;  2HDD A;  3JRA A;  2XPU A;  1HDP A;  3ZQC A;  4BY1 J;  5EG0 B;  1F43 A;  3S1R J;  2EBI A;  4LOC A;  2DMT A;  1IDZ A;  2Y30 A;  3HB9 A;  1MNM C;  1ETX A;  1T56 A;  5EGO B;  2HI3 A;  1I50 J;  1X58 A;  1NK2 P;  1HCR A;  5E3N A;  1YRN B;  1DU0 A;  3S2H J;  1K83 J;  4L5E A;  1Q1V A;  1SAN A;  2M34 A;  2WAQ N;  5HOD A;  2ME6 A;  1RPW A;  1AHD P;  1RET A;  4UUS B;  3BT9 A;  1XG1 A;  3G1M A;  3GTG J;  5C4X J;  3TP3 A;  5M5W J;  3NAR A;  1PUF B;  2CUF A;  1HDD C;  1MSE C;  2Y2Z A;  3HDD A;  1ETO A;  3Q3S A;  1ETY A;  1TWA J;  2LK2 A;  1WH7 A;  1I3Q J;  3MKL A;  5K7H A;  5E3O A;  5FLV A;  3BQY A;  5EGO A;  2DA7 A;  3JRG A;  4A3G J;  1BW6 A;  3TP0 A;  2MW8 A;  3S1N J;  3LSR A;  4Y52 J;  3K2A A;  1BW5 A;  1FIP A;  3BQZ A;  2RAE A;  2LLK A;  1FTZ A;  3K7A J;  5E3M A;  1JKQ C;  1AKH B;  2X48 A;  4DZP A;  5F0H A;  4RDU A;  4IHV A;  4UUS A;  2KDZ A;  3S17 J;  2E2J J;  1EF4 A;  1G2H A;  2EZI A;  4FIS A;  3CCY A;  3RQI A;  5J1R A;  4MFD A;  3SDG A;  4DYR A;  5IPA A;  2HXI A;  2NS8 A;  2R5Z B;  1PUF A;  2CJJ A;  2D5V A;  3M3Y J;  2LTP A;  3BR0 A;  1LFB A;  2WB1 N;  5F0C A;  1MH4 A;  3HOU J;  3HGG A;  2YU9 J;  3S2D J;  3RZD J;  1JKP C;  3BR1 A;  5M3F J;  1JTX A;  1U8B A;  2O9L A;  1QVT A;  2R5Y B;  3BG9 A;  1TWC J;  1POG A;  5IYC J;  2H8R A;  3O8H A;  3HOY J;  3GTJ J;  1IDY A;  2EZH A;  4BBR J;  1JJ8 C;  3SFI A;  1Z0X A;  1AKH A;  4MFE A;  1P7I A;  1CQT A;  2JWT A;  1MBF A;  2VKV A;  5IP7 J;  2L7M P;  5DTD A;  1MBE A;  1D5Y A;  2R5Z A;  3TED A;  3A01 B;  1LFU P;  4A3K J;  1BL0 A;  4MLO A;  4J19 A;  4XRS G;  2JA6 J;  1ZTR A;  2NVQ J;  3HOV J;  1T33 A;  2LD5 A;  5M5Y J;  4A3L J;  5IOZ A;  1GT0 C;  2HXO A;  5IP9 J;  5J1Y A;  1GVD A;  2JA5 J;  1ORK A;  2HOS A;  3GTP J;  3S14 J;  2R5Y A;  1ETW A;  2Y31 A;  4A69 C;  3OSF A;  2LFB A;  4V2G A;  5EF6 A;  1IC8 A;  1NK3 P;  2JK3 A;  1MSF C;  4EEF G;  1A6I A;  4GFB A;  1JT6 A;  2DMN A;  4ABZ A;  4X6A J;  1F36 A;  2NOG A;  5EZG A;  5DS9 A;  1QRY A;  3O8G A;  1ZK8 A;  4MO7 A;  3H3V K;  3A01 A;  2Y9Z A;  1P7J A;  2ZB9 A;  1JGG A;  1JUM A;  5FKO A;  1QVU A;  5F27 A;  3BR3 A;  2FX0 A;  4IHY A;  2COB A;  1A5J A;  4D7M A;  2R7Z J;  2N8G A;  3BG5 A;  5IYD J;  1H88 C;  4V2F A;  2ID6 A;  3IH3 A;  2PMZ N;  1JKR C;  4FCY A;  2NVY J;  3RKQ A;  2EQR A;  4NDL A;  3WHC A;  2K9N A;  2GBY A;  1IV6 A;  2W48 A;  3BTL A;  3G1O A;  1OFC X;  3HGY A;  1MH3 A;  3A03 A;  2L9R A;  1ZR2 A;  1JUP A;  2DMU A;  3TW7 A;  3VPR A;  3FIS A;  1Y1V J;  5JLW A;  2DMQ A;  1RR7 A;  2NS7 A;  3GTO J;  3WHB A;  1XC5 A;  3FKI J;  4C3I J;  1NTC A;  2LR8 A;  4MIM A;  5EZH A;  4A3E J;  2NVX J;  1XS9 A;  2ID3 A;  2B63 J;  4A93 J;  3G1L A;  1ZR4 A;  2CQQ A;  2E2I J;  3JRH A;  3GTL J;  1MBJ A;  2G0E A;  4XRM A;  2M8G X;  3B6A A;  1JT0 A;  5K7Z A;  5FJ8 J;  4CYC A;  1OCP A;  3BG3 A;  2DA6 A;  2DA3 A;  1ZKG A;  4XID A;  3Q0U A;  2L7F P;  4IEJ A;  5FKM A;  2VUM J;  3A02 A;  1FIA A;  3GTK J;  1TC3 C;  3NAU A;  3BTI A;  3ZQL A;  4BY7 J;  2OF7 A;  4HNV A;  3MN2 A;  2EZK A;  2ELK A;  1ETK A;  5M5X J;  1JJ6 C;  1JKO C;  2XB0 X;  3DCF A;  2LVS A;  2E2H J;  3LSJ A;  3JRB A;  1UMQ A;  3BR2 A;  4XK4 A;  1U9O A;  3JRC A;  2CU7 A;  2O7O A;  4X1E A;  2YUS A;  3S16 J;  2JMW A;  2GM4 A;  5IP6 A;  2R93 J;  4BXX J;  2K40 A;  3W6V A;  5M3M J;  1RKT A;  4C3H J;  4XRS A;  1QPI A;  2LKX A;  2XGE A;  2ECB A;  1GUU A;  4A3I J;  3CQZ J;  2XPV A;  1W0T A;  2L0K A;  3HOX J;  2M0C A;  4A3C J;  3GTM J;  1O4X A;  4D7N A;  3GTQ J;  4A3B J;  3IH2 A;  1H8A C;  2DTZ A;  5EDN A;  3D1N I;  3S1Q J;  1UG2 A;  3ZQG A;  1DU6 A;  3LNQ A;  1TWG J;  1IUF A;  2XGC A;  5F08 A;  1OJL A;  3B6C A;  2HQ5 A;  2CUE A;  5FKL A;  3HOZ J;  1SFO J;  1WGX A;  3LSP A;  5IOY A;  1TWF J;  2M9H A;  2NVT J;  1R9T J;  2TRT A;  1I6H J;  2JN6 A;  3HEF A;  2JA7 J;  5J1U A;  5E3L A;  3SJM A;  2QCO A;  4JX5 A;  3QQA A;  1B72 B;  3RZO J;  1LE8 A;  4AYB N;  2DA5 A;  4M6V A;  4B1R A;  2LY9 A;  1IRZ A;  3QPL A;  1ENH A;  4RBO A;  3LSG A;  5C3E J;  3JR9 A;  1K61 A;  2AO9 A;  1OCT C;  4M3B A;  3CDL A;  1B8I B;  4IHW A;  1X2N A;  2TCT A;  3JRF A;  2DA2 A;  2DMP A;  2ME0 A;  3OIO A;  2K9S A;  4QIW N;  5GP9 A;  4A3M J;  2R92 J;  1ETV A;  2X6O A;  5K7F A;  4CYC B;  3HM5 A;  2XSD C;  3PM1 A;  1VF9 A;  4UUT A;  1HF0 A;  3I4M J;  3OOU A;  5J3L A;  2XB5 A;  1B72 A;  4Y7N J;  3S1M J;  1IG7 A;  3Q0V A;  3IH4 A;  4XIC A;  1JTY A;  5GPA A;  3HOW J;  3ZOB A;  2E19 A;  1U78 A;  1BJZ A;  1GDT A;  3C2B A;  5GPC A;  4FE4 A;  1ZGW A;  1B8I A;  4JYK A;  5FKN A;  2KT0 A;  5C44 J;  2MGQ A;  4D5C A;  3JRD A;  3OSG A;  5F1J A;  1Y1W J;  1APL C;  4JX4 A;  4AC0 A;  2O8K A;  2Y0S N;  1E3O C;  3DEW A;  2DJN A;  3BTJ A;  3H0G J;  3HKZ N;  2EH3 A;  3UKG A;  2JA8 J;  5JLX A;  3QPS A;  4I76 A; 
#chains in the Genus database with same CATH topology
 2R4G A;  2XPW A;  1EH6 A;  4PJJ A;  2IEK A;  4M3G A;  5EG0 A;  1X3U A;  1G3S A;  1WH5 A;  2XGD A;  4CYD A;  1J0R A;  1Y39 A;  1JUS A;  1S6L A;  3DKY A;  2H09 A;  2IS6 A;  1RUO A;  1SAU A;  4BHP A;  4PZJ A;  3BR5 A;  3T8R A;  4EM1 A;  1YHQ I;  3OYK A;  4F52 A;  1TBX A;  3GF2 A;  3ABK H;  4FET A;  1YIO A;  2M8E A;  1USS A;  4B09 A;  1W7P A;  3SDB A;  3E7L A;  4HNU A;  5L3C A;  1REP C;  1FBQ A;  4OWR B;  3G71 I;  2A5W A;  2DA4 A;  3ZMD A;  2B9S A;  3LA2 A;  2QF7 A;  1WJB A;  1T0F A;  1YG2 A;  4D5F A;  1EH8 A;  5FKK A;  4W1U A;  3WTU C;  2HVS A;  2F6C A;  3RYP A;  4AUX A;  3WU1 B;  2VBW A;  2NXN B;  3CCJ I;  2JSP A;  1SD7 A;  5EYR A;  3LAP A;  1VQP I;  1S8N A;  1O3Q A;  3L2W A;  2RKH A;  1FTT A;  2M4K A;  1ITY A;  3CCR I;  4CH7 A;  2DA1 A;  4ZDP A;  2BY1 A;  4LG3 A;  2J5P A;  2YS9 A;  3PNY A;  3WG9 A;  2NVU B;  3FK7 A;  3PIO F;  2LMD A;  1ZRE A;  2QKM B;  1N25 A;  3L1P A;  4B48 A;  1FOW A;  1YX3 A;  2V6E A;  1LDK B;  2MSY A;  5FLM J;  1U9N A;  2MG4 A;  2VQL A;  4F93 B;  3HOS A;  2O03 A;  2R7D A;  3GFI A;  1R1U A;  1A36 A;  3BR6 A;  4XLE A;  3J7Z I;  3HUG A;  5A2Q Z;  1HLV A;  4TV7 A;  1WJA A;  4HYE A;  4BH9 A;  1TQP A;  3GX4 X;  3HBL A;  1VQN I;  5KAI C;  2HYF A;  3IL2 A;  4EJU A;  4EGY A;  1S5L C;  4GRI A;  4BKX A;  2EA2 A;  2HQN A;  2ZXI A;  3VYT B;  1ONV A;  2ZSI B;  4UVC A;  1MBG A;  3M4O J;  4B3A A;  2E60 A;  2E1O A;  2OA4 A;  2QQ8 A;  3E0J B;  2M2E A;  2HDD A;  4NNJ A;  4CZC A;  2XPU A;  2EFN A;  4BY1 J;  5EG0 B;  5DEQ A;  1U5T A;  5E8G A;  2EBI A;  3TKY A;  2DMT A;  4XOR A;  4E7K A;  2P0W A;  2VT2 A;  2BOL A;  2CQ7 A;  3C2G A;  1NK2 P;  1X58 A;  3J7Y J;  2HQR A;  2VE9 A;  1S9H A;  1G8X A;  4RB1 A;  1W36 C;  3S2H J;  1D0Z A;  2WAQ A;  2Y69 H;  1K83 J;  5D5X B;  1W5T A;  2DOE A;  2WV0 A;  2M34 A;  2WAQ N;  2IP2 A;  5GAG J;  3U21 A;  1G4D A;  2F4O B;  4PSX A;  1P2F A;  3F8C A;  2QM3 A;  1E17 A;  1IN7 A;  2LDU A;  3FM5 A;  4BYY A;  3TP3 A;  3O3K A;  3VB2 A;  3EET A;  2MD0 A;  3WGH A;  4BJ5 C;  3ZMS A;  1PUF B;  2CUF A;  1HDD C;  2CUZ A;  1YE9 A;  3JSO A;  1FP1 D;  1BI0 A;  3OYD A;  2DOD A;  1ETY A;  2DBB A;  3Q3S A;  3PNV A;  4BJT A;  1B9N A;  4KDP A;  4AIK A;  2JA2 A;  4BDY A;  2M7B A;  1UHM A;  2NNN A;  1FYL A;  1QZY A;  3KP4 A;  3WTW C;  2XAH A;  2JTV A;  2DA7 A;  3JRG A;  3TP0 A;  2MW8 A;  3DPT A;  3K70 C;  4RA2 A;  1Y56 A;  2CG4 A;  1BW5 A;  1FTZ A;  2LLK A;  4L0Y B;  3FZV A;  1WJD A;  1AKH B;  1RNL A;  4DZP A;  5F0H A;  3J81 K;  1R23 A;  2KDZ A;  3S17 J;  2E2J J;  2ESN A;  2DFI A;  3NQO A;  4P5O A;  4D9J A;  1OIS A;  2VC1 A;  2A61 A;  2XKO A;  4XL9 A;  3L09 A;  4DYR A;  2NS8 A;  3R0A A;  1SFE A;  2CJJ A;  2B0L A;  4Y33 A;  2W84 A;  2BY2 A;  3LFU A;  3VYR B;  3WE3 A;  1FPQ A;  5CLS A;  3HOU J;  3HGG A;  1H9T A;  2CS3 A;  3TGN A;  1JHH A;  1YFH A;  3BR1 A;  5M3F J;  1SVL A;  3H36 A;  1JTX A;  3CP8 A;  3LST A;  1U8B A;  1FZP B;  2FRH A;  4C9Y A;  1IRF A;  2JQ7 A;  5B5E C;  3GTJ J;  4UB6 C;  4BBR J;  4U7D A;  3I9V 2;  2K3F A;  2KKO A;  2QEN A;  1X4O A;  1MDM A;  2IA1 A;  4BL0 B;  2CWE A;  3I71 A;  1O3S A;  5IP7 J;  1YI2 I;  1WSU A;  4M6Y A;  5DTD A;  1MBE A;  3OYA A;  4M6X A;  2EFQ A;  2ZME C;  1QBJ A;  1BL0 A;  4MLO A;  3PIP F;  3FWE A;  2GIZ A;  2VOO A;  2WBM A;  1PVE A;  3X2Q H;  1OKR A;  2EWN A;  3OV8 A;  1ZRF A;  4LD5 A;  4A3L J;  2RVC A;  4PJM A;  1U5T B;  1GVD A;  2W4S A;  1OR7 C;  1FT9 A;  1TT0 A;  3C3W A;  2HZD A;  2HOS A;  3VWB A;  2FEZ A;  2Y31 A;  3EUA A;  3WGI A;  1TQI A;  2W57 A;  3T8T A;  1IC8 A;  4DGW B;  5LEK A;  1MND A;  1U3E M;  4N9H A;  4EAT A;  4PJL A;  2O5R A;  3AG1 H;  1RR8 C;  4Q47 A;  3L9F A;  2YSR A;  1QRY A;  3H35 A;  2V79 A;  2F5C A;  1EKE A;  3KEY A;  2UXN A;  3VDX A;  2E36 A;  5JI6 A;  4U0Y A;  1P7J A;  3A01 A;  1X3W B;  5KHD A;  3V7S A;  4EJW A;  1QVU A;  2FX0 A;  1BBY A;  3A1Y A;  4GDF A;  4WK8 F;  5E20 A;  1P92 A;  3VSK A;  4B3X A;  2JSC A;  2ID6 A;  2NOJ B;  2UV1 A;  4CZZ A;  4HPQ A;  3CC2 I;  2W82 A;  3F8N A;  5B66 C;  3OYG A;  2K9N A;  1TNT A;  3MKZ A;  1YJ9 I;  2ZXJ A;  1IV6 A;  2A05 A;  4YIF A;  4RB2 C;  3I64 A;  2PJR A;  1X1C A;  2W48 A;  3CTA A;  4XLN F;  5ICG A;  3SZP A;  3DPU A;  3G1O A;  1OFC X;  4XNF A;  4IJA A;  4L9T A;  2WAD A;  1NG6 A;  3QU3 A;  1JI8 A;  4BE0 A;  4PCQ A;  3K4J A;  4I7H A;  2DMQ A;  1RR7 A;  5ERI A;  2NS7 A;  2G7U A;  3TQN A;  3NWS A;  3DBH B;  4OAZ A;  3K6G A;  1D0X A;  1MW7 A;  2ACJ A;  3E97 A;  2LR8 A;  2F5E A;  4MIM A;  4MQV A;  5FFX A;  2B63 J;  2PMU A;  2WC2 A;  1FP2 A;  3I54 A;  3ESW B;  2V4J C;  3KP6 A;  3FXM A;  1H9G A;  4Y4R A;  3GO5 A;  4ZDL A;  2DA6 A;  5IT9 K;  2ZXW H;  4XQF A;  1UST A;  3K1P A;  3R61 A;  4KA4 A;  2CW8 A;  3MZ8 A;  2L7F P;  3Q0U A;  4LLL A;  4XID A;  4IZZ A;  1FIA A;  1WQ2 A;  3JW4 A;  2LOO A;  3KCC A;  5JHF A;  4H4K C;  3BTI A;  3E1S A;  4HNV A;  2ELK A;  1ETK A;  1KON A;  3R60 A;  5LLQ A;  4LK1 F;  3DCF A;  3LSJ A;  2DK8 A;  2P8T A;  3P9K A;  4XK4 A;  3OYE A;  2CFO A;  4ZYG A;  3ASN H;  3S16 J;  4DQ2 A;  2GM4 A;  5IP6 A;  1W36 D;  1JGS A;  3LQQ A;  3MKW B;  5LD2 C;  4GYI A;  4ZYA A;  1XSX A;  1WJF A;  5FD6 A;  3HG9 A;  1GUU A;  1D1C A;  2DAO A;  2BGC A;  2ZNY A;  2XPV A;  2L0K A;  4CIC A;  5JHU A;  4O5V A;  4F3Q A;  3GTQ J;  1H8A C;  5BPI A;  1K78 A;  4KFC A;  4RAZ A;  4XM3 A;  3PNT A;  3OS1 A;  2HDC A;  2O8X A;  1IUF A;  2ZO4 A;  1OJL A;  4L18 B;  4OMY A;  3B6C A;  3K4L A;  2PEX A;  5CVR A;  1TQM A;  2CUE A;  5FKL A;  4WCG A;  3K70 D;  1SFO J;  1N78 A;  4M73 A;  4EJV A;  1KQ0 A;  4RAY A;  1T38 A;  5IOY A;  2MC4 A;  2KQR A;  1I6H J;  3IWF A;  3OYL A;  3PL8 A;  4NQW A;  2A68 F;  3SJM A;  1FNN A;  2HYG D;  2PJR B;  2FXA A;  2OUM A;  4JX5 A;  3P9C A;  2VKH A;  3QQA A;  3OOP A;  1B72 B;  3W6K B;  1I27 A;  1HST A;  1PUE E;  2QVO A;  2FSW A;  3ABU A;  4B1R A;  2CW0 F;  2LY9 A;  3E5X A;  5D4S A;  5K5R A;  3FXR A;  2DK5 A;  5ILU A;  2COM A;  4LLN A;  4RBO A;  5C3E J;  2LRE A;  1MKM A;  3FKJ A;  1UG0 A;  1K61 A;  2XV4 S;  2P6T A;  4OU0 A;  4HQM A;  4PFO A;  1Y8R B;  3CDL A;  4KJZ A;  4YFN F;  3DLL F;  2L9S A;  1DUX C;  1Y0N A;  1R36 A;  5A2Q K;  2I5U A;  3PFY A;  2DMP A;  1TW3 A;  2M0M A;  4UXN A;  2K9S A;  3FXU A;  3WG7 H;  3KZI C;  1BN5 A;  1WVR A;  2X6O A;  4YEL A;  1KQ9 A;  2IT0 A;  1N77 A;  1LVA A;  4M9Z A;  3HM5 A;  3DLA A;  4UUT A;  1HF0 A;  1ZRD A;  3OOU A;  5J3L A;  2XB5 A;  2CH0 A;  5CJ9 A;  3RTR A;  4Y7N J;  4HX8 A;  3S1M J;  3Q0V A;  2P5V A;  4Y15 A;  4EMS A;  2KP6 A;  3IH4 A;  1S3J A;  4K2E A;  1LVK A;  4I99 C;  3HOW J;  3ZOB A;  4G6D A;  3OS2 A;  1BR4 A;  1UCR A;  2O0Y A;  1LDJ A;  1BJZ A;  1C0W A;  3G2B A;  3BY6 A;  3GEZ A;  4FE4 A;  2OU2 A;  5F1R A;  3ZMV A;  5LEJ A;  2Y0S A;  3JRD A;  1APL C;  3RPU A;  4IPA A;  5AIQ A;  3KPH A;  2O8K A;  2HOE A;  2Y0S N;  1J59 A;  4LB5 A;  2DJN A;  3BTJ A;  3G6E I;  1EA3 A;  2EH3 A;  4KIF A;  3BDD A;  4B8X A;  1XD7 A;  4I0A A;  2JA8 J;  3DBL B;  4LMY A;  3AL0 B;  3GFJ A;  4GXO A;  3F6V A;  5E1W A;  2H1K A;  4A3F J;  2STT A;  1XCB A;  2XRL A;  1LQ1 A;  1O3T A;  4A5N A;  2C6Y A;  4BS9 A;  3IV5 A;  4YII A;  2MYS A;  2FD5 A;  5DYM A;  4QLC U;  3HJE A;  4F92 B;  3TMO A;  4RAG A;  2ZJQ F;  2NRA C;  3DQV C;  3MCZ A;  1BC8 C;  1YRN A;  2HYJ A;  2P6S A;  3ML6 A;  3HL2 A;  3MZY A;  3ZCO A;  3MEX A;  4UV9 A;  1Z21 A;  4QSH A;  1UFM A;  2ELJ A;  5F04 A;  1VI0 A;  1QGP A;  2BYV E;  3BTC A;  2R7W A;  1L3L A;  3GUD A;  3EPZ A;  5C4J J;  3GXO A;  4BDZ A;  2WV1 A;  4IRI A;  1YLF A;  4M3E A;  2WB1 A;  4MEX F;  4NQW B;  3ZMT A;  2CV2 A;  2HTJ A;  3PO3 J;  2M5W A;  3GFM A;  3V7C A;  1TWH J;  2L7Z A;  4HX4 A;  1AA7 A;  3JSP A;  2ISZ A;  2A6E F;  2HDW A;  3RKY A;  3TW6 A;  2FQ4 A;  5H20 A;  4B4C A;  1G59 A;  3A2K A;  2XF6 A;  2LG4 A;  2Y75 A;  2IAI A;  1DPR A;  2OZ6 A;  2DXI A;  2Z1D A;  2CSO A;  4F91 B;  5F0F A;  3LOC A;  4KMF A;  3ERM A;  5JVT A;  5GAE J;  1SEU A;  1HKT A;  1W1W E;  2OV7 A;  1FOY A;  3KFW X;  1OMI A;  4RGX A;  2VQG A;  1HOM A;  3VYS B;  2JJ7 A;  3JAM Z;  1W0U A;  1FX7 A;  1G3Y A;  2OPT A;  2LKS A;  2KIQ A;  1W5S A;  2L9N A;  1R00 A;  2L3D A;  3K9T A;  3FDY A;  4G6Q A;  4HG2 A;  1RKW A;  3OS0 A;  2MLG A;  3G3Z A;  4UV8 A;  2DN0 A;  5HDN A;  1ACI A;  2F2E A;  3H3U A;  4II2 A;  2MH9 A;  1F1Z A;  3F0C A;  4A0X A;  3CZ6 A;  3DWL E;  3T0Y A;  1HSJ A;  2VI6 A;  3TBI A;  2EIK H;  2XAJ A;  3FMR A;  4RLQ A;  2CYY A;  3T5X A;  2X0L A;  4EM2 A;  3F8B A;  3CF2 A;  2DO7 A;  1FLI A;  4MEY F;  4HV6 A;  2BVL A;  2FML A;  3FHZ A;  3S15 J;  6PAX A;  1Y6I A;  2DT5 A;  1FOK A;  5TRD A;  4JP0 A;  4BBS J;  3Q0W A;  4S0H B;  2K9L A;  2XRO A;  3BP8 A;  2ECC A;  2GLO A;  1AOY A;  2FA5 A;  4ZJZ A;  4QPO A;  3JRA A;  4IHT A;  1IZ1 A;  3D5R C;  3S1R J;  5HNF A;  3CCQ I;  4LOC A;  2X6W A;  3E3V A;  4Y3O A;  1NG7 A;  2K02 A;  3HB9 A;  1OCO H;  2IVM A;  1T56 A;  5EGO B;  2HI3 A;  1S7A A;  1HCR A;  5KVR A;  2R7V A;  4ESB A;  1YRN B;  2M4G A;  1DU0 A;  2VL8 A;  2YPR A;  1FSE A;  5D6E A;  3R4K A;  5FLX Z;  1BI3 A;  2KIS A;  3WTS C;  1X1B A;  4YFX F;  5LHI A;  3MMY B;  1Q1V A;  1XMX A;  1SAN A;  5LFA A;  5HOD A;  1RPW A;  1AHD P;  1RET A;  4UUS B;  2VQH A;  3BT9 A;  1XG1 A;  2DU9 A;  3IKV A;  5J6X A;  3W2V A;  5M5W J;  2EPF A;  3BG6 A;  1LJ9 A;  5J47 A;  3DV8 A;  2DT7 B;  3WTY C;  4MHG A;  4HAM A;  1BJA A;  4G9Y A;  4LB6 B;  2W25 A;  3VEP A;  3EDP A;  4HF2 A;  5E3O A;  5FLV A;  1VQK I;  1OYW A;  3BQY A;  3KZZ A;  2VJJ A;  5CVU A;  2IS2 A;  4PFP A;  2FOK A;  4HDU A;  4Y13 A;  5HDK A;  4UNO A;  4IOA F;  1ZHF A;  3LSR A;  3HSR A;  1XTA A;  2ZJ2 A;  1Z1D A;  4PDK A;  2LY1 A;  5E3M A;  1MJA A;  1MNE A;  3D0S A;  2HZT A;  1R6R A;  2EIL H;  2GIV A;  4GO1 A;  4NC6 A;  4RDU A;  4OIQ F;  4LFU A;  1RRJ A;  3CCY A;  1BIA A;  3K1M A;  2Z33 A;  4MFD A;  3SDG A;  3TDZ C;  2Z9O A;  2W85 A;  3CCV I;  3IRR A;  1AWC A;  1PUF A;  2D5V A;  5EEH A;  3I5U A;  1WJC A;  4ZZD A;  3GLX A;  1MMD A;  4HF0 A;  2DLL A;  2ZC2 A;  5ICF A;  3SEZ A;  4I2O A;  1Z6R A;  2YU9 J;  1JKP C;  3OYC A;  4I0B A;  5E8I A;  3H92 A;  1QVT A;  2R5Y B;  3BG9 A;  3CC7 I;  3LA3 A;  3HHH A;  1VQ9 I;  2HWV A;  2A3S A;  3OIQ A;  3SZT A;  3KYL A;  1IDY A;  4IOC F;  1BR2 A;  2R7F A;  3LL7 A;  3SFI A;  1Z0X A;  1AKH A;  1SVM A;  4MFE A;  2VOD A;  1P7I A;  2JWT A;  4DOZ A;  3SHF A;  4N4O B;  1JE8 A;  4XMY A;  1R4N B;  3KLN A;  1D5Y A;  1UHW A;  1Y8Q B;  3TED A;  4YG2 F;  1QQI A;  2JA6 J;  1ZTR A;  3K4K A;  3RDI A;  1KU9 A;  4P1W A;  5LHH A;  5M5Y J;  5CKT A;  2Q1Z B;  4M74 A;  5E18 F;  4KIG A;  2BXY A;  1B4A A;  3M8E A;  4A69 C;  3SXY A;  3CCU I;  2LFB A;  3GYH X;  2JUC A;  3S3O A;  3PQJ A;  1MSF C;  4GFB A;  1GXP A;  1JT6 A;  2DMN A;  1J2X A;  3M8F A;  4X6A J;  2P5K A;  3P9I A;  1SFX A;  4KYW A;  3AFH A;  3BZ6 A;  2JRM A;  2NOG A;  5DS9 A;  2KRC A;  1W4M A;  2E71 A;  3A4C A;  1MIJ A;  3IAM 2;  2ZB9 A;  4UVA A;  2E5Z A;  1JUM A;  3MD2 A;  5FKO A;  3RIR A;  3BOQ A;  3HTS B;  2CFX A;  4D7M A;  2R7Z J;  2N8G A;  5IYD J;  4YFK F;  2RQP A;  2RRE A;  3CUQ C;  3BZK A;  2LYC A;  1S29 A;  4A6D A;  4N4N B;  2M3A A;  1Z3Y A;  1M1E B;  4HBL A;  1UJ8 A;  4CUG A;  4L9N A;  3I53 A;  1ZG5 A;  4KT6 A;  2PFB A;  1QNT A;  3S3N A;  4KIS A;  5TJJ A;  3Q9S A;  4MTD A;  3MFK A;  1R1T A;  4BQO A;  2VB6 A;  2K3P A;  3OYB A;  3AG3 H;  3F8F A;  3CMM A;  5L3D A;  3GCM A;  3QPT A;  1MMS A;  3HGY A;  2FBI A;  2VBY A;  1XN7 A;  2KDO A;  1ZR2 A;  1ON2 A;  5DCF A;  3TW7 A;  3A0H C;  3OR1 C;  5JLW A;  1TTY A;  2O3F A;  4IQJ A;  3CLO A;  2GXA A;  3AG4 H;  4GCV A;  1NTC A;  2YX4 A;  5EZH A;  4A3E J;  1XS9 A;  4E70 A;  3G1L A;  1WJE A;  3WU0 A;  2ICW G;  5L3F A;  4FQG A;  2CQQ A;  1P4X A;  1IRG A;  3GLL A;  4E7L A;  1MBJ A;  2G0E A;  3CDH A;  4XRM A;  2R7T A;  2M8G X;  2V1U A;  3B6A A;  1JT0 A;  1YW8 A;  3EYI A;  1OCP A;  1Z3X A;  5KNL A;  4CSW A;  2DA3 A;  4IX7 A;  3EQL F;  3HYI A;  3A02 A;  4KUM A;  2VUM J;  5EJC A;  3NAU A;  3QYF A;  3S93 A;  3EUH C;  3BJ6 A;  4XKC A;  4BY7 J;  2CQK A;  4WWC A;  3MN2 A;  1V4R A;  2EZK A;  4LJZ F;  1JJ6 C;  4WF2 A;  2XB0 X;  3CDI A;  1P4A A;  2E2H J;  5L3G A;  2QZ8 A;  3BR2 A;  1SVO A;  1U9O A;  3JRC A;  2CU7 A;  1Z7L A;  2O7O A;  2XAU A;  3I58 A;  3OYF A;  3QYB A;  4E7Z A;  1K79 A;  2MFZ A;  2JMW A;  4FHT A;  2RDP A;  3KZY A;  4N9I A;  3K69 A;  3WU2 C;  2CMP A;  1RKT A;  4ITV A;  2KL4 A;  4C3H J;  1EV7 A;  1UB9 A;  3WTZ A;  1X3Z B;  5D5U B;  1GHC A;  2XGE A;  1RZ4 A;  3F8M A;  3BCA A;  1F9N A;  3M1C A;  3IHU A;  3LAJ A;  3GZ6 A;  1W0T A;  1V5G A;  1ZG3 A;  5JFR A;  3HOX J;  5J8C A;  4HEA 2;  3WTT C;  1K6O A;  4A3C J;  4BAC A;  3QP5 A;  3C7J A;  1PJR A;  1HXD A;  3HRU A;  1XDU A;  3IH2 A;  2DDB A;  4HZF A;  5KAF C;  2EIN H;  4GGG A;  2BXZ A;  3M7G A;  4NC8 A;  2IPQ X;  2JZY A;  4Q5S F;  1WJ5 A;  2QYO A;  2XGX A;  4NUB A;  2HPI A;  1LEB A;  3K1N A;  1LPQ A;  2D1H A;  2PX9 A;  1WGX A;  2GOM A;  1ZH5 A;  1ZAO A;  2Q2E B;  4KIB A;  3LSP A;  2IJL A;  3K2Z A;  1TWF J;  2M9H A;  3L2Q A;  2NVT J;  3C2H A;  4OIN F;  3F23 A;  4KN7 X;  3HEF A;  3E5Q A;  1WWX A;  2BBY A;  5HNH A;  2JA7 J;  5J1U A;  3JAM K;  5E3L A;  1SC7 A;  3E6C C;  1R7J A;  3ZP5 A;  3KYC B;  4AYB A;  2V9K A;  1YTY A;  3I4P A;  4XKV A;  5H2F C;  4FT8 A;  5F64 A;  1X19 A;  4AID A;  4AYB N;  3CLQ A;  4M6V A;  3Q5F A;  1LE8 A;  1VQL I;  1V3F A;  1N75 A;  2PI0 A;  3QPL A;  1VQ7 I;  1E0E A;  2K4B A;  3LSG A;  3PQK A;  5ICC A;  3JR9 A;  2XUB A;  2AO9 A;  2VJ4 A;  3HTU A;  2XAS A;  5HOO A;  2TCT A;  3M1E A;  1D8J A;  5GP9 A;  4IL6 C;  4A3M J;  2F4M B;  3D5S C;  1VTN C;  4OMZ A;  1PP7 U;  1P9Q C;  3MWM A;  4BQN A;  5K7F A;  2WY7 Q;  5D4R A;  3DU6 A;  3CME I;  2FQ3 A;  2XKP A;  3ZQ7 A;  1YX5 A;  3HIF A;  1U6G A;  3IP4 B;  3EUK L;  1B72 A;  3KE2 A;  1QHH D;  3ZQQ A;  2X1C A;  1T0F C;  2ZJP F;  2O6G E;  2R7O A;  3LSI A;  1V5E A;  1I6X A;  4XIC A;  1HW5 A;  4I02 A;  1JTY A;  4O6J A;  5GPA A;  4ENM A;  3U1K A;  4M9X A;  1CF7 A;  5DUI A;  2L5Q A;  2Z2S B;  2H94 A;  5B1B H;  1OQY A;  3C2B A;  4R79 A;  1R1V A;  3DPL C;  2DQR A;  2VBZ A;  2A6H F;  2V6C A;  4JYK A;  2CW7 A;  5FKN A;  4CCO A;  2KT0 A;  1FWZ A;  2MGQ A;  1T6S A;  1Z6T A;  3HSF A;  4HV5 A;  3VSL A;  5FRN A;  2OCE A;  1FYM A;  1RC9 A;  5FLX K;  2EV0 A;  3BPV A;  2BEO A;  2QQ9 A;  3CUO A;  3KEO A;  2JVG A;  3DEW A;  3H0G J;  3RQ4 A;  1DDN A;  2VBX A;  1LDD A;  1OCZ H;  1KA8 A;  4C30 A;  2MA3 A;  5HVQ C;  1QO0 D;  2CGP A;  3JRI A;  2DPU A;  3C18 A;  3GME A;  3ZQI A;  4A2U A;  3H5A A;  2E1M B;  1BC7 C;  3I0T A;  5DCM B;  2DOF A;  2LBF A;  3MQ0 A;  2R7R A;  4EM0 B;  4PJ0 C;  2EA4 A;  5CVV A;  1FEX A;  5J4V A;  2NAZ A;  2AXL A;  1VFC A;  1F5T A;  2K86 A;  3DEU A;  2PJP A;  3RSN A;  2K9M A;  4M72 A;  3PO2 J;  1XCV A;  3RYR A;  5ED4 A;  1MD0 A;  2EZL A;  3FXJ A;  2ZFW A;  1IN8 A;  2RGV A;  4ZYD A;  2OQR A;  3I56 I;  1BOA A;  1MMN A;  5L3B A;  1U5T C;  3O6B B;  1YW9 A;  1SFU A;  2IGM A;  4ZYH A;  1LE8 B;  1BM9 A;  5JVG F;  3FF5 A;  2W7N A;  2HNH A;  1IXS B;  3FHN A;  1BA5 A;  4IO9 F;  1YS6 A;  2LP0 A;  4DNC A;  5BPD A;  4IRG A;  1MBH A;  2HKO A;  3L2U A;  3E5U A;  1YYV A;  2LY2 A;  4P55 A;  1WI3 A;  4BAY A;  5DM6 F;  2LNB A;  2A69 F;  1X2M A;  1TW2 A;  2WA0 A;  2BVM A;  3PFI A;  3H0D A;  2LC2 A;  4M3F A;  3QU6 A;  3ZQF A;  2CQX A;  3IRQ A;  1UHS A;  1HKS A;  1VQM I;  5EEA A;  4HW0 A;  5AIP A;  1XDS A;  1BOB A;  1O7L A;  2VIX A;  1GV5 A;  3T1B A;  1P4W A;  4J00 A;  5ILS A;  1UZC A;  2PQ8 A;  1A35 A;  3BRO A;  3GBG A;  3E6D A;  3JRE A;  1DGR M;  4PGG A;  3S3M A;  2IBD A;  2MLK A;  4QTR A;  1Z9C A;  1CF7 B;  3ONQ A;  2X6Y A;  2AHQ A;  5LRR A;  2KIU A;  1GV2 A;  1WPK A;  3GWZ A;  3JTG A;  5BNG A;  4LGW A;  3VYU B;  3TO6 A;  3F21 A;  4G12 A;  4IXA A;  5E1X A;  1KU3 A;  2X9D A;  3FK6 A;  4I6Z A;  4RMN A;  1FJL A;  2VE8 A;  3DF8 A;  4ENN A;  1DP3 A;  1GLN A;  3L2V A;  3A0B C;  5HLH A;  4RAF A;  4ZYE A;  1RES A;  2IRF G;  2F4I A;  1NH3 A;  4FE7 A;  3MVP A;  4AM3 A;  2VJ5 A;  1HDP A;  1F43 A;  3L00 A;  3VOD A;  1FOX A;  1IRX A;  4YIR X;  1DPU A;  5H6R A;  1IDZ A;  4FX0 A;  2GQQ A;  1V5F A;  4AU7 A;  1MNM C;  2OBP A;  4P9F A;  3SEQ A;  2LBF B;  2XF5 A;  5FO5 A;  2ZXH A;  2V1X A;  2FBH A;  2Z5U A;  2A6T A;  2OJE D;  4XLC A;  1XGO A;  4G8X A;  2DDA A;  2KFD A;  5B1A H;  2IGO A;  4RGU A;  3CCE I;  4XRF A;  2ME6 A;  2Q8K A;  3ERE D;  3ECO A;  3HSE A;  3G1M A;  2M30 A;  3GTG J;  5C4X J;  1IN4 A;  4P96 A;  3OR2 C;  3COA C;  1MSE C;  1SMT A;  2H8W A;  2E7W A;  2Y2Z A;  1FMW A;  2P7V B;  5BQT A;  1YIJ I;  1ETO A;  1IAW A;  3HDD A;  3GZ5 A;  3ISP A;  2PN6 A;  2LK2 A;  4RGR A;  3CCL I;  1YOV B;  4ESJ A;  3FX3 A;  1I3Q J;  3DFG A;  3MKL A;  1HW1 A;  4ZTF A;  5K7H A;  4LK0 F;  2ZNZ A;  1IUY A;  3CCM I;  4EV0 A;  1RI7 A;  5EGO A;  1JHF A;  4N0B A;  3PSI A;  1W7P D;  1J75 A;  4HNT A;  1BW6 A;  3S1N J;  2E1N A;  2MAB A;  3ELK A;  5TGT A;  2QSG X;  3TOB A;  1FC3 A;  1FIP A;  3BQZ A;  3J7A O;  1I39 A;  4PK4 A;  1R49 A;  3HHG A;  4R8H A;  1JKQ C;  2X48 A;  3LFK A;  5DUK A;  4IHV A;  4UUS A;  1ZGJ A;  3OMY A;  1TT5 B;  1J9I A;  3FXL A;  1MGT A;  5IPA A;  4XBF A;  2HXI A;  5IT3 A;  2R5Z B;  4E7H A;  2JRT A;  3M3Y J;  2FF4 A;  2LTP A;  1F4K A;  2F5D A;  1LFB A;  2WB1 N;  4BGD A;  4XN0 A;  5F0C A;  1Y0U A;  3IUO A;  1U0J A;  1MH4 A;  4CHU A;  1QZZ A;  4OIO F;  3S2D J;  2IGK A;  2P4W A;  2BY0 A;  5DD4 A;  4RS8 A;  1XGN A;  3VOE A;  5D8L B;  1TWC J;  2H8R A;  3O8H A;  3HOY J;  2EZH A;  2LF8 A;  2DW4 A;  3M8J A;  3CO7 C;  1IN6 A;  2GAU A;  3CJQ B;  3DTE A;  1MBF A;  2GOX B;  2VKV A;  4WXC A;  4UHT A;  2DYR H;  4U88 A;  3RPQ A;  3VFZ A;  3H9G A;  4IHS A;  4IRH A;  1LFU P;  3ABL H;  5FFZ A;  4J19 A;  2BHY A;  1V55 H;  1VQ6 I;  2RN7 A;  1R5H A;  2LD5 A;  3RI4 A;  1R5I D;  1OYI A;  2HXO A;  3BJA A;  2JA5 J;  1A31 A;  1ORK A;  4DJA A;  3FXO A;  3QOE A;  2BY3 A;  2IGN A;  4AD9 A;  3S14 J;  1J09 A;  2R5Y A;  2WY8 Q;  4YRV A;  1X4P A;  4HX7 A;  4DIQ A;  1TP4 A;  5EF6 A;  1NK3 P;  1DGW Y;  4EEF G;  1A6I A;  1Q1H A;  3HRT A;  2L01 A;  4ABZ A;  1VZ0 A;  1T39 A;  3K0L A;  1XB4 A;  4JOM A;  5EZG A;  3R6S A;  2L4M A;  3O8G A;  4ESF A;  2VJI A;  5D5W B;  4MO7 A;  1K4S A;  3ZPL A;  2Y48 A;  4C2T A;  4HQE A;  3NEU A;  4BHC A;  4IHY A;  2AQE A;  2YX7 A;  2JUG A;  3BG5 A;  2W24 A;  2DPD A;  4L9J A;  4LIV A;  4BQA A;  1H88 C;  5FRM A;  1HQC A;  3ASO H;  2HTS A;  3UR3 C;  1JKR C;  1UAA A;  1ZG1 A;  1WZ2 A;  4FCY A;  4NDL A;  4AIJ A;  1VQ4 I;  2DJI A;  3RCO A;  4E7I A;  1G3W A;  2GBY A;  3AL0 C;  5CQE A;  1J5Y A;  3W2W A;  4ENK A;  1R58 A;  3CF5 F;  4CXF A;  1D5V A;  1YIT I;  1MH3 A;  4A6E A;  2OTL I;  1TLH B;  2DMU A;  3V8K A;  1EH7 A;  2IS4 A;  2KZG A;  3V7R A;  2AXT C;  2ZME A;  3PSF A;  2EV6 A;  3IC7 A;  1XC5 A;  4I98 B;  2QBY A;  5HS8 A;  4C3I J;  2ISY A;  2NVX J;  2K27 A;  2ID3 A;  4A93 J;  4E6K G;  2QLZ A;  1QPM A;  3BZC A;  4PJN A;  3KP7 A;  3CUQ B;  3OL4 A;  1ZR4 A;  2L9V A;  2X6X A;  1OR7 A;  2E2I J;  2OZU A;  2EB7 A;  1ZN2 A;  3CJT B;  2RQQ A;  2V7F A;  2HVR A;  1SD4 A;  3BG3 A;  4KNY A;  4L0Z B;  4ZC3 A;  2KPM A;  4Y17 A;  3REO A;  1ZKG A;  4LIT A;  4XN3 A;  4D0P A;  3C1D A;  1T08 B;  1T98 A;  1TC3 C;  3H5R A;  3CES A;  5HLI A;  2Z3Y A;  1D3Y A;  3BWG A;  2OF7 A;  1KYZ A;  4EGZ A;  5M5X J;  1IF1 A;  4BXU A;  2LVS A;  2V1N A;  3GW2 A;  3JRB A;  1LKX A;  5CVI A;  1VQ5 I;  4MQ9 F;  3E6B A;  2YUS A;  4RB0 A;  4P9U A;  2XAF A;  2R93 J;  3ROU A;  1D1B A;  3AKZ A;  4HA8 A;  3W6V A;  5M3M J;  3J80 Z;  4MTE A;  2P5L C;  2CO5 A;  3H3Z A;  1HA8 A;  4HLX A;  3V8J A;  2LKX A;  2VQC A;  4XKW A;  1A04 A;  1B6A A;  2ETH A;  4HRI A;  3F9K A;  4EJT A;  2M0C A;  4RM3 A;  2EFW A;  3GTM J;  2FU4 A;  4E7J A;  2OTJ I;  1O4X A;  4A3B J;  3BG7 A;  2XRN A;  2DQL A;  2BE5 F;  3GZN B;  1QU3 A;  3DTI A;  2QEX I;  4Q4Z F;  2F5V A;  3D1N I;  1T8I A;  3S1Q J;  2Z99 A;  3ZQG A;  4D1Q A;  3N4M A;  3LNQ A;  5HLG A;  3I59 B;  3ZN0 A;  3FXK A;  2KJB A;  2HKX A;  2XGC A;  3I3L A;  5F08 A;  2XHK A;  3V4G A;  4I09 A;  4Q48 A;  3HOZ J;  2QKL B;  4CA0 A;  3QAH A;  4UVB A;  3J7A Y;  3TO7 A;  1WKM A;  2X1D A;  2TRT A;  3CJN A;  3PUF A;  4JQF A;  3ECH A;  4YEJ A;  1X1A A;  3K10 A;  1XSV A;  4M71 A;  2OCC H;  2L7K A;  4L9V A;  2CV1 A;  2DA5 A;  4XSZ F;  3G73 A;  2QQB A;  1Z91 A;  1ENH A;  3DEE A;  1T95 A;  2BHZ A;  1LFP A;  1QHG A;  2ZME B;  5D8K B;  1JXS A;  2D45 A;  2QBY B;  4G6T B;  3HOT A;  4M3B A;  1OCT C;  2PG4 A;  1B8I B;  2E1C A;  4IHW A;  2RC4 A;  1XX5 A;  1X2N A;  2HGC A;  3U9G A;  2Q2E A;  4KMU X;  3JTH A;  5GAD J;  2DA2 A;  3JRF A;  1L0O C;  2ELH A;  1VQO I;  1ETV A;  2G9W A;  3NWT A;  1I3A A;  1YW7 A;  2XSD C;  3I4M J;  3DTK A;  2OQG A;  1IG7 A;  3HXL A;  3CCS I;  3QYE A;  4BE2 A;  2WAF A;  2E19 A;  1ULY A;  1U78 A;  1FBU A;  2ESH A;  2WTE A;  5GPC A;  1KQ8 A;  2V9P A;  2M1B A;  4WX9 A;  4L5I A;  3BPX A;  2IA0 A;  1PDN C;  4D5C A;  3OSG A;  1O3R A;  5F1J A;  2E5N A;  1BIB A;  2UZK A;  4JX4 A;  4U87 A;  4AC0 A;  1E3O C;  3W6J B;  1FMV A;  1S72 I;  1W7P B;  1BR1 A;  3QRF F;  1ZYR F;  3UKG A;  2QUF A;  4B43 A;  1U2W A;  3ULQ B;  1OLT A;  1Z05 A;  1TNS A;  4AIH A;  3RKX A;  4FX4 A;  1YO5 C;  3QPS A;  5GTI C;  2KZV A;  2Y9Y A;  4XSX F;  4RB3 C;  5EEG A;  3M07 A;  1MBK A;  1ETQ A;  1WCM J;  4ASN A;  1XGM A;  3OY9 A;  4XLA A;  2E34 A;  3WGG A;  2UXX A;  4CCJ A;  4S04 A;  2NNY A;  2G7H A;  1FBS A;  3PUB A;  4BJ6 C;  1S7E A;  2XAQ A;  4A3D J;  1YQA A;  4IF4 A;  2CQN A;  5D6F A;  2I10 A;  2P81 A;  2HFH A;  3QP6 A;  2R0Q C;  3I4N J;  1K7A A;  2IXS A;  1ZQ3 P;  1FSH A;  3KLO A;  1WI9 A;  3LWF A;  2VON A;  5FB2 A;  2H6B A;  3KP2 A;  4MNU A;  2HEO A;  3FMQ A;  4IHX A;  9ANT A;  4W97 A;  3K4B A;  1P6R A;  3SZG A;  4A3J J;  3OYM A;  4DYQ A;  2L02 A;  3DKX A;  5AON A;  4G94 A;  4ZH4 F;  2VPL A;  2L4A A;  4G7O F;  1HW2 A;  3TDU C;  2TDX A;  3DU5 A;  3RKW A;  1E3H A;  4CDG A;  1IJW C;  2KHM A;  5DCM A;  1ZEL A;  2FOW A;  4QPQ A;  3CMY A;  4XLH A;  2E35 A;  1WHU A;  2V9V A;  2WAE A;  1IN5 A;  3QOP A;  4XKB A;  4DZJ A;  1FY7 A;  4C2M J;  1VND A;  3HUG B;  2HOT A;  1KYW A;  3ZRG A;  2KRH A;  1IW7 F;  2STW A;  1Z77 A;  2FJ1 A;  5GTH C;  2X85 A;  3DXJ F;  3SYT A;  5ILV A;  2R7S A;  1S7O A;  1GXQ A;  1HBX G;  3ZGK A;  4IQ4 A;  2RNG A;  3W3C A;  1H89 C;  2K9Q A;  4FTH A;  2XAG A;  4CCN A;  1IGN A;  2AS5 F;  1X1D A;  4C3J J;  3I55 I;  1E3P A;  1RIO H;  1AU7 A;  1H0M A;  2XSJ C;  3TO9 A;  3BC8 A;  4HDV A;  2V1D A;  1LNW A;  1HC8 A;  2VPR A;  2HOA A;  5BMZ A;  2P7C B;  3QOD A;  1MJ9 A;  2FNP A;  2CRG A;  1W5C C;  2X1E A;  4M3D A;  4CCK A;  2PMH A;  1A6Q A;  3ZQH A;  5J8F A;  4HST A;  1IXC A;  4DYC A;  5IYB J;  5K5O A;  4A12 A;  3GVA A;  5JR3 A;  4JX6 A;  1T2K A;  2LSO A;  4IKF A;  2PLY A;  2PBI A;  5KK1 A;  4UY8 I;  2FNA A;  2QWW A;  3LSH A;  4OOI A;  1SFK A;  3IWZ A;  3S8P A;  5K1Y A;  2VKE A;  3FIW A;  4EJO A;  3KIO A;  5E79 C;  4DW6 A;  4ETS A;  4DBQ A;  4DBR A;  2IA2 A;  1XGS A;  3IAS 2;  4BEH A;  2W00 A;  2OC6 A;  2KIM A;  4XLP F;  3ZQC A;  3MKY B;  2Y0M A;  5DV5 A;  2Y30 A;  2R7Q A;  4IVN A;  2A07 F;  1ETX A;  1OPC A;  2K7L A;  4MGR A;  3RPU D;  1I5Z A;  3JCU C;  4QWQ A;  1I50 J;  5BS6 A;  2M45 A;  2ZSH B;  5E3N A;  4F7Z A;  4ZDO A;  3KEQ A;  1LUJ B;  4A5M A;  4L5E A;  1KU2 A;  3ABM H;  2KIF A;  1K6Y A;  2VOP A;  2DCE A;  2CUJ A;  4XR6 A;  1SMY F;  4U0V A;  2R7X A;  3FMS A;  4EVI A;  1RUN A;  2DTR A;  2K85 A;  3OYI A;  3BCB A;  3N05 A;  3NAR A;  3WOD F;  2VAS A;  1STZ A;  5FD5 A;  2DYS H;  1R4M B;  2E7X A;  1MMG A;  3ZN1 A;  4S05 A;  1U8R A;  2KJC A;  1TWA J;  1D8K A;  3OYH A;  1WH7 A;  2VN2 A;  3U2R A;  2FUG 2;  5LGU A;  3SQN A;  3H1C A;  1IO2 A;  1B9M A;  5D5V B;  4A3G J;  3LSM A;  2QA4 I;  2XVC A;  4Y52 J;  3K2A A;  3K4M A;  2MH2 A;  4XOT A;  1LB2 A;  2RAE A;  3HPG A;  3K7A J;  2QSH X;  2VXZ A;  2RV8 A;  5GAH J;  2K4J A;  5E17 F;  4U7B A;  1TZL A;  1MDM B;  1EF4 A;  1OCR H;  1G2H A;  2EZI A;  4FIS A;  3RQI A;  1B1B A;  5J1R A;  4O3M A;  5LGN A;  5LHG A;  4UUV A;  3HC7 A;  1EJ9 A;  4XON A;  2DI3 A;  1HKQ A;  1R22 A;  2W1O A;  3L2R A;  3BR0 A;  1R71 A;  1NHA A;  4CCL A;  4WXH A;  5K5Q A;  3Q9V A;  4LG0 A;  1V54 H;  2MD5 A;  1YJN I;  3FBI B;  5J40 A;  3L2C A;  2ZJR F;  1X1P A;  4KN4 X;  5E1Z B;  3RZD J;  2HS5 A;  1YS7 A;  2M87 A;  3RJP A;  2O9L A;  1ZLJ A;  2GXG A;  2M7A A;  1POG A;  2JPC A;  5IYC J;  4HLY A;  3J80 K;  4HOB A;  1JJ8 C;  2VC0 A;  5L3E A;  1CQT A;  4OIP F;  4CO8 A;  3E6M A;  2LRD A;  4BHB A;  2JVH A;  5IY5 H;  2L7M P;  1XMK A;  3O2P E;  2GWR A;  3HRM A;  2R5Z A;  4E7S A;  2YU3 A;  3V42 A;  3A01 B;  1O57 A;  4A3K J;  4AVZ A;  4XRS G;  4CGZ A;  4BEH B;  2NVQ J;  3HOV J;  2NS0 A;  4OIR F;  1T33 A;  4A0Z A;  4E4H A;  1XPX A;  2QQA A;  5IOZ A;  2L2O A;  1GT0 C;  2EFO A;  1QA6 A;  2KLO A;  5IP9 J;  1R5G A;  5J1Y A;  3DBR B;  1I1S A;  2OD5 A;  2H1L A;  2Z16 A;  3FXQ A;  3GTP J;  3TOA A;  1ETW A;  3OSF A;  1ZLK A;  3ABT A;  3SFZ A;  4V2G A;  4Z2Y A;  3ZXS A;  2JK3 A;  3H5N A;  2FMY A;  2K5C A;  2OAZ A;  4JBA A;  2DFF A;  4NBQ A;  4G7H F;  1F36 A;  1Z7U A;  2Q0O A;  2ZFU A;  2R3S A;  3GFL A;  3KET A;  1FYK A;  2BW3 A;  1PYV A;  3AG2 H;  1ZK8 A;  3H3V K;  4RLF A;  1WRJ A;  2Y9Z A;  1JGG A;  4ANJ A;  1D0Y A;  5F27 A;  2I8D A;  3BR3 A;  2D2W A;  2COB A;  1A5J A;  2KRF A;  4J01 A;  2HQA A;  3OWT A;  2PMZ A;  3PJR A;  4V2F A;  3F22 A;  3IH3 A;  2PMZ N;  5DDG A;  3ZMU A;  1IXR C;  2HU9 A;  2NVY J;  3P7N A;  1TL8 A;  1MJB A;  4NHJ A;  3RKQ A;  1WFX A;  2EQR A;  2QSF X;  4GYG A;  5TIS C;  1XMA A;  3WHC A;  3CJR B;  1SAX A;  4V19 K;  3HZJ A;  2H27 A;  5CPR B;  2DT6 A;  2AQF A;  3BTL A;  2XC7 A;  1ODD A;  2VKD A;  4AWX B;  2CV0 A;  1J7K A;  3ZMZ A;  1KGS A;  2E1M C;  3FM3 A;  4ZZL A;  3A03 A;  1VQ8 I;  1KZH A;  2L9R A;  1JUP A;  3VPR A;  2VT3 A;  3FIS A;  1Y1V J;  2HR3 A;  3G4S I;  3GTO J;  3WHB A;  3FKI J;  1MMA A;  2UWM A;  2XIG A;  4BUP A;  1GVJ A;  4LG0 B;  3CD6 I;  2J5O A;  4II3 A;  3DP7 A;  1ERD A;  1SD6 A;  1DQU A;  3FBN B;  1LEA A;  3V8L A;  4B47 A;  3JRH A;  3GTL J;  2O61 A;  5FGM A;  4BQQ A;  5HDG A;  2D1V A;  2IW5 A;  3QPH A;  5K7Z A;  2GXB A;  5FJ8 J;  4CYC A;  1E2X A;  4NC7 A;  4AVP A;  2EK5 A;  2MC3 A;  4M9S A;  5KCM A;  4EQQ A;  4G7Z F;  4R1H A;  3J81 Z;  3IKT A;  2IS1 A;  4IEJ A;  5FKM A;  3OYN A;  1I1G A;  4KIT B;  2WWY A;  2HPM A;  3GTK J;  3LSK A;  3ZQL A;  1ZGA A;  2GA1 A;  1BI2 A;  2XF7 A;  5CQG A;  2LKP A;  4H0E A;  3B02 A;  3KP3 A;  4X0G A;  2ZKZ A;  1K78 B;  3D5L A;  1JKO C;  4HF1 A;  2XDV A;  3K4C A;  3HPH A;  1UMQ A;  1D1A A;  4X1E A;  3HRS A;  3H9Q A;  5HS7 A;  3CUQ A;  2B7E A;  2RNJ A;  4BXX J;  2X51 A;  4Z6Y A;  2K40 A;  3KX2 A;  1XSD A;  2VLA A;  3DKW A;  5DM7 F;  3K4N A;  4OAY A;  1OCC H;  4XRS A;  3U1D A;  4PSW A;  1QPI A;  5F6F A;  4RM2 A;  2V26 A;  2ECB A;  2DFE A;  2GZW A;  4A3I J;  2EV5 A;  2H6C A;  3CQZ J;  4LIU A;  2EIJ H;  3OIP A;  1BI1 A;  4A0Y A;  4UB8 C;  5LRS A;  3F6O A;  4I01 A;  2X4H A;  4PGH A;  5BOX A;  1MZB A;  4D7N A;  4CCM A;  5CYV A;  3CC4 I;  2BW3 B;  3S2W A;  2DTZ A;  4LLG F;  5EDN A;  1QZE A;  1UG2 A;  1YJW I;  1DU6 A;  1TWG J;  1G6N A;  2DFH A;  3F72 A;  3WTX C;  5B3S H;  2HQ5 A;  2QGU A;  3S32 A;  2FBK A;  3P5J A;  5H6Q A;  1ZAR A;  3F3X A;  1O7F A;  1R9T J;  5CVJ A;  2JN6 A;  4JK1 X;  4RGS A;  2EFP A;  4F55 A;  3B73 A;  2F5F A;  1CGP A;  5HS9 A;  2A5Y B;  2YR2 A;  2QCO A;  3NRV A;  4WXD A;  2BV6 A;  3RZO J;  3N97 A;  2LF7 A;  2L54 A;  3OYJ A;  2F48 A;  4NB5 A;  3EUH A;  2R7U A;  3LMM A;  2LH9 A;  1IRZ A;  1G3T A;  3BLY A;  3I59 A;  1IV8 A;  2EJR A;  3KYD B;  3M9A A;  2BZT A;  2UUZ A;  5LGT A;  1K4T A;  2FE3 A;  4BU2 A;  3CMA I;  4BE1 A;  1ON1 A;  3OIO A;  2ME0 A;  5ICE A;  1OYY A;  3WTV C;  3AAF A;  3MZH A;  3EYY A;  4QIW N;  4FAS D;  1KU7 A;  4HSR A;  4L5J A;  4KT5 C;  5LBQ A;  2R92 J;  2DOA A;  3MAJ A;  3ZR8 X;  5J4Y A;  2ADU A;  2MBF A;  1B59 A;  5HLT A;  4KIC A;  4BXF A;  4CYC B;  3H9J A;  5FRO A;  3PM1 A;  1VF9 A;  3LA7 A;  1ZRC A;  3WE2 A;  3QWL A;  4XOP A;  2JPB A;  1SD5 A;  3CO6 C;  3UNG C;  2NYX A;  3W2A A;  1UEL B;  1GDT A;  2VXD A;  3BJO A;  4XLF A;  3TL4 X;  2ZCW A;  2GA2 A;  4BNC A;  4U0W A;  1ZGW A;  1B8I A;  3KP5 A;  3CP2 A;  3LQR A;  5C44 J;  4ON0 A;  4B44 A;  1Y1W J;  3HKZ A;  4C2U A;  3L7W A;  5DD8 A;  1PP8 F;  2EIM H;  3R0J A;  4ZTJ A;  2KMU A;  1DP7 P;  3HKZ N;  4ENJ A;  3OL3 A;  5IT9 Z;  2JT1 A;  4PUS A;  2ZBK A;  5JLX A;  2HVQ A;  1Z67 A;  4I76 A; 
#chains in the Genus database with same CATH homology
 2XPW A;  2Y9Y A;  2H1K A;  4A3F J;  2IEK A;  4M3G A;  3JRI A;  1MBK A;  1ETQ A;  2XRL A;  1WCM J;  5EG0 A;  3ZQI A;  1WH5 A;  2XGD A;  1JUS A;  3IV5 A;  2FD5 A;  1S7E A;  4A3D J;  1YRN A;  2HYJ A;  1FEX A;  2I10 A;  3BR5 A;  2P81 A;  2R0Q C;  3I4N J;  1VFC A;  1ZQ3 P;  4QSH A;  5F04 A;  1VI0 A;  3BTC A;  3PO2 J;  4IHX A;  9ANT A;  4W97 A;  5C4J J;  4A3J J;  2EZL A;  2WV1 A;  4DYQ A;  3E7L A;  4M3E A;  2DA4 A;  3PO3 J;  1TWH J;  2L7Z A;  2QF7 A;  1IJW C;  1LE8 B;  4D5F A;  3TW6 A;  2FQ4 A;  4B4C A;  5FKK A;  3CMY A;  4W1U A;  1BA5 A;  2IAI A;  4DZJ A;  4C2M J;  1VND A;  2LP0 A;  2HOT A;  4AUX A;  1MBH A;  1Z77 A;  1WI3 A;  2FJ1 A;  5EYR A;  5F0F A;  3LOC A;  1FTT A;  1ITY A;  1X2M A;  2DA1 A;  4M3F A;  2YS9 A;  1HOM A;  3ZQF A;  2CQX A;  2JJ7 A;  1UHS A;  1W0U A;  1H89 C;  2K9Q A;  4FTH A;  3FK7 A;  5EEA A;  2OPT A;  1IGN A;  4C3J J;  1AU7 A;  3L1P A;  1GV5 A;  1RKW A;  2MSY A;  5FLM J;  2DN0 A;  3GBG A;  1U9N A;  3JRE A;  2MG4 A;  3F0C A;  2IBD A;  4QTR A;  2VPR A;  2HOA A;  2AHQ A;  2CRG A;  1GV2 A;  1WPK A;  2VI6 A;  3BR6 A;  4M3D A;  5BNG A;  1HLV A;  3ZQH A;  4G12 A;  2X9D A;  3FK6 A;  4DYC A;  4I6Z A;  3HBL A;  5IYB J;  1FJL A;  4JX6 A;  3S15 J;  4BKX A;  1RES A;  4BBS J;  4JP0 A;  2VKE A;  3FIW A;  3M4O J;  1MBG A;  3Q0W A;  4FE7 A;  4S0H B;  4DW6 A;  2ECC A;  4B3A A;  2GLO A;  2E1O A;  3MVP A;  2M2E A;  2HDD A;  3JRA A;  2XPU A;  1HDP A;  3ZQC A;  4BY1 J;  5EG0 B;  1F43 A;  3S1R J;  2EBI A;  4LOC A;  2DMT A;  1IDZ A;  2Y30 A;  3HB9 A;  1MNM C;  1ETX A;  1T56 A;  5EGO B;  2HI3 A;  1I50 J;  1X58 A;  1NK2 P;  1HCR A;  5E3N A;  1YRN B;  1DU0 A;  3S2H J;  1K83 J;  4L5E A;  1Q1V A;  1SAN A;  2M34 A;  2WAQ N;  5HOD A;  2ME6 A;  1RPW A;  1AHD P;  1RET A;  4UUS B;  3BT9 A;  1XG1 A;  3G1M A;  3GTG J;  5C4X J;  3TP3 A;  5M5W J;  3NAR A;  1PUF B;  2CUF A;  1HDD C;  1MSE C;  2Y2Z A;  3HDD A;  1ETO A;  3Q3S A;  1ETY A;  1TWA J;  2LK2 A;  1WH7 A;  1I3Q J;  3MKL A;  5K7H A;  5E3O A;  5FLV A;  3BQY A;  5EGO A;  2DA7 A;  3JRG A;  4A3G J;  1BW6 A;  3TP0 A;  2MW8 A;  3S1N J;  3LSR A;  4Y52 J;  3K2A A;  1BW5 A;  1FIP A;  3BQZ A;  2RAE A;  2LLK A;  1FTZ A;  3K7A J;  5E3M A;  1JKQ C;  1AKH B;  2X48 A;  4DZP A;  5F0H A;  4RDU A;  4IHV A;  4UUS A;  2KDZ A;  3S17 J;  2E2J J;  1EF4 A;  1G2H A;  2EZI A;  4FIS A;  3CCY A;  3RQI A;  5J1R A;  4MFD A;  3SDG A;  4DYR A;  5IPA A;  2HXI A;  2NS8 A;  2R5Z B;  1PUF A;  2CJJ A;  2D5V A;  3M3Y J;  2LTP A;  3BR0 A;  1LFB A;  2WB1 N;  5F0C A;  1MH4 A;  3HOU J;  3HGG A;  2YU9 J;  3S2D J;  3RZD J;  1JKP C;  3BR1 A;  5M3F J;  1JTX A;  1U8B A;  2O9L A;  1QVT A;  2R5Y B;  3BG9 A;  1TWC J;  1POG A;  5IYC J;  2H8R A;  3O8H A;  3HOY J;  3GTJ J;  1IDY A;  2EZH A;  4BBR J;  1JJ8 C;  3SFI A;  1Z0X A;  1AKH A;  4MFE A;  1P7I A;  1CQT A;  2JWT A;  1MBF A;  2VKV A;  5IP7 J;  2L7M P;  5DTD A;  1MBE A;  1D5Y A;  2R5Z A;  3TED A;  3A01 B;  1LFU P;  4A3K J;  1BL0 A;  4MLO A;  4J19 A;  4XRS G;  2JA6 J;  1ZTR A;  2NVQ J;  3HOV J;  1T33 A;  2LD5 A;  5M5Y J;  4A3L J;  5IOZ A;  1GT0 C;  2HXO A;  5IP9 J;  5J1Y A;  1GVD A;  2JA5 J;  1ORK A;  2HOS A;  3GTP J;  3S14 J;  2R5Y A;  1ETW A;  2Y31 A;  4A69 C;  3OSF A;  2LFB A;  4V2G A;  5EF6 A;  1IC8 A;  1NK3 P;  2JK3 A;  1MSF C;  4EEF G;  1A6I A;  4GFB A;  1JT6 A;  2DMN A;  4ABZ A;  4X6A J;  1F36 A;  2NOG A;  5EZG A;  5DS9 A;  1QRY A;  3O8G A;  1ZK8 A;  4MO7 A;  3H3V K;  3A01 A;  2Y9Z A;  1P7J A;  2ZB9 A;  1JGG A;  1JUM A;  5FKO A;  1QVU A;  5F27 A;  3BR3 A;  2FX0 A;  4IHY A;  2COB A;  1A5J A;  4D7M A;  2R7Z J;  2N8G A;  3BG5 A;  5IYD J;  1H88 C;  4V2F A;  2ID6 A;  3IH3 A;  2PMZ N;  1JKR C;  4FCY A;  2NVY J;  3RKQ A;  2EQR A;  4NDL A;  3WHC A;  2K9N A;  2GBY A;  1IV6 A;  2W48 A;  3BTL A;  3G1O A;  1OFC X;  3HGY A;  1MH3 A;  3A03 A;  2L9R A;  1ZR2 A;  1JUP A;  2DMU A;  3TW7 A;  3VPR A;  3FIS A;  1Y1V J;  5JLW A;  2DMQ A;  1RR7 A;  2NS7 A;  3GTO J;  3WHB A;  1XC5 A;  3FKI J;  4C3I J;  1NTC A;  2LR8 A;  4MIM A;  5EZH A;  4A3E J;  2NVX J;  1XS9 A;  2ID3 A;  2B63 J;  4A93 J;  3G1L A;  1ZR4 A;  2CQQ A;  2E2I J;  3JRH A;  3GTL J;  1MBJ A;  2G0E A;  4XRM A;  2M8G X;  3B6A A;  1JT0 A;  5K7Z A;  5FJ8 J;  4CYC A;  1OCP A;  3BG3 A;  2DA6 A;  2DA3 A;  1ZKG A;  4XID A;  3Q0U A;  2L7F P;  4IEJ A;  5FKM A;  2VUM J;  3A02 A;  1FIA A;  3GTK J;  1TC3 C;  3NAU A;  3BTI A;  3ZQL A;  4BY7 J;  2OF7 A;  4HNV A;  3MN2 A;  2EZK A;  2ELK A;  1ETK A;  5M5X J;  1JJ6 C;  1JKO C;  2XB0 X;  3DCF A;  2LVS A;  2E2H J;  3LSJ A;  3JRB A;  1UMQ A;  3BR2 A;  4XK4 A;  1U9O A;  3JRC A;  2CU7 A;  2O7O A;  4X1E A;  2YUS A;  3S16 J;  2JMW A;  2GM4 A;  5IP6 A;  2R93 J;  4BXX J;  2K40 A;  3W6V A;  5M3M J;  1RKT A;  4C3H J;  4XRS A;  1QPI A;  2LKX A;  2XGE A;  2ECB A;  1GUU A;  4A3I J;  3CQZ J;  2XPV A;  1W0T A;  2L0K A;  3HOX J;  2M0C A;  4A3C J;  3GTM J;  1O4X A;  4D7N A;  3GTQ J;  4A3B J;  3IH2 A;  1H8A C;  2DTZ A;  5EDN A;  3D1N I;  3S1Q J;  1UG2 A;  3ZQG A;  1DU6 A;  3LNQ A;  1TWG J;  1IUF A;  2XGC A;  5F08 A;  1OJL A;  3B6C A;  2HQ5 A;  2CUE A;  5FKL A;  3HOZ J;  1SFO J;  1WGX A;  3LSP A;  5IOY A;  1TWF J;  2M9H A;  2NVT J;  1R9T J;  2TRT A;  1I6H J;  2JN6 A;  3HEF A;  2JA7 J;  5J1U A;  5E3L A;  3SJM A;  2QCO A;  4JX5 A;  3QQA A;  1B72 B;  3RZO J;  1LE8 A;  4AYB N;  2DA5 A;  4M6V A;  4B1R A;  2LY9 A;  1IRZ A;  3QPL A;  1ENH A;  4RBO A;  3LSG A;  5C3E J;  3JR9 A;  1K61 A;  2AO9 A;  1OCT C;  4M3B A;  3CDL A;  1B8I B;  4IHW A;  1X2N A;  2TCT A;  3JRF A;  2DA2 A;  2DMP A;  2ME0 A;  3OIO A;  2K9S A;  4QIW N;  5GP9 A;  4A3M J;  2R92 J;  1ETV A;  2X6O A;  5K7F A;  4CYC B;  3HM5 A;  2XSD C;  3PM1 A;  1VF9 A;  4UUT A;  1HF0 A;  3I4M J;  3OOU A;  5J3L A;  2XB5 A;  1B72 A;  4Y7N J;  3S1M J;  1IG7 A;  3Q0V A;  3IH4 A;  4XIC A;  1JTY A;  5GPA A;  3HOW J;  3ZOB A;  2E19 A;  1U78 A;  1BJZ A;  1GDT A;  3C2B A;  5GPC A;  4FE4 A;  1ZGW A;  1B8I A;  4JYK A;  5FKN A;  2KT0 A;  5C44 J;  2MGQ A;  4D5C A;  3JRD A;  3OSG A;  5F1J A;  1Y1W J;  1APL C;  4JX4 A;  4AC0 A;  2O8K A;  2Y0S N;  1E3O C;  3DEW A;  2DJN A;  3BTJ A;  3H0G J;  3HKZ N;  2EH3 A;  3UKG A;  2JA8 J;  5JLX A;  3QPS A;  4I76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...