3MKZA

Structure of sopb(155-272)-18mer complex, p21 form
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
112
structure length
112
Chain Sequence
PTSAYERGQRYASRLQNEFAGNISALADAENISRKIITRCINTAKLPKSVVALFSHPGELSARSGDALQKAFTDKEELLKQQASNLHEQKKAGVIFEADEVITLLTSVLKTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insight into F plasmid DNA segregation revealed by structures of SopB and SopB-DNA complexes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna-binding protein/dna
molecule keywords Protein sopB
total genus 35
structure length 112
sequence length 112
chains with identical sequence B, N, U
ec nomenclature
pdb deposition date 2010-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18090 SoPB_HTH Centromere-binding protein HTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2830 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3mkzA00
1VZ0A 3W2AA 3W3CA 3MKZA 3VWBA 3MKWB 3MKYB
chains in the Genus database with same CATH superfamily
5GAHJ 4XLAA 2DMNA 2XRNA 4C30A 4HSTA 4ESFA 3VOEA 1HQCA 3CUQB 2WAFA 3KEQA 2PMHA 2ZXHA 4NHJA 5HS8A 3BTIA 1LVAA 1P4AA 2YUSA 3M3YJ 1NHAA 1D8JA 2L5QA 1OISA 1OYYA 4HG2A 3DKWA 3PSIA 5C44J 1ZK8A 3TO9A 4CUGA 5E8GA 1S9HA 2BW3A 3BROA 3L2VA 2PFBA 3ZPLA 4LK1F 5FLXK 1E17A 4ZC3A 1WGXA 4G12A 3GMEA 4M3DA 1MH3A 3PUFA 4FASD 2JPBA 1F36A 2BE5F 4CSWA 2DK5A 2RC4A 1ZARA 2MA3A 2CUZA 2GA1A 1MNEA 1ZG5A 3K4BA 4M71A 4HSRA 2ESHA 5E17F 2GXAA 2LH9A 5EGOB 1NG6A 4F55A 4XORA 2QSFX 2G9WA 4UV8A 4BKXA 2GIZA 1RUNA 2I10A 3DLAA 3ABMH 2FUG2 3QP5A 2DODA 1QVUA 3E5UA 1R6RA 4HBLA 4XLCA 3CJTB 1Z1DA 3CCVI 4J00A 5E79C 2JA5J 3WGHA 2HS5A 1VQPI 4B4CA 4N9IA 4IJAA 2L9RA 2IGNA 1AHDP 3LFKA 2A05A 1JKPC 2V1DA 4IHXA 3V42A 5GPCA 2W48A 1X1DA 4KJZA 2BBYA 4A3DJ 3F3XA 3GF2A 1J0RA 2YX4A 3J80K 4AU7A 4HV5A 5EF6A 1S72I 2HTSA 1VQLI 3F6VA 1D0YA 1XGMA 4IHYA 2DA4A 4LD5A 3TOBA 1KQ9A 1X2MA 5GP9A 3O8GA 2EV5A 5HDKA 4NQWA 2EA2A 2MGQA 1DU0A 2ZFUA 1BOAA 4OAYA 4H4KC 5DV5A 4QIWN 5JVTA 5E18F 1IJWC 4HPQA 1Y1WJ 2PN6A 2WV0A 1B59A 2ZKZA 4BH9A 4G6QA 4KFCA 2P7CB 4ENMA 5F1JA 4AIJA 3DFGA 2NVTJ 3IC7A 5E1XA 4YFKF 3KETA 2NAZA 3M07A 4GGGA 4A0XA 1RIOH 1GVJA 5FGMA 2PEXA 3CCRI 2O8KA 3WGIA 5IOYA 3Q3SA 4ENNA 4N0BA 2VBYA 4IEJA 5KAFC 2LP0A 1USTA 1S7EA 3K4JA 3AAFA 2DAOA 3S1NJ 5ICEA 2DLLA 2TDXA 2GZWA 3H9JA 3OS0A 1HSJA 2PMZA 5BQTA 1G3SA 2XROA 1G59A 5J3LA 1NK3P 1MJ9A 1P4WA 1TWGJ 2JQ7A 2GM4A 1D0ZA 2EV6A 3SZTA 3JRHA 1EH6A 1X3ZB 1RKTA 2DYSH 4WWCA 1MBEA 4BDZA 3O3KA 3S3NA 3J81Z 3AL0B 3GEZA 4RGSA 3HRMA 3BZCA 2YU9J 1LB2A 5J1UA 3EUHC 2XGXA 2IAIA 4L9VA 1XSVA 3KYDB 1ETVA 3KP4A 2EZLA 1X3WB 4IOCF 4I01A 4PJMA 4PK4A 3H5NA 3J81K 3ECOA 2L01A 3NQOA 4IHTA 3GTQJ 3BR1A 3BR0A 5LHIA 1W0TA 3CC4I 1ZRCA 1FSHA 1YIOA 3FXQA 1XMKA 4AC0A 1QPIA 3I55I 1WJEA 2IGKA 3ZGKA 3QAHA 1L0OC 2X6XA 3DBLB 3IHUA 1TW3A 3LMMA 3OSGA 2Y9ZA 5ICGA 5JI6A 3HSFA 3M7GA 1O7FA 2HNHA 3QP6A 2K3PA 4HEA2 4RMNA 1DUXC 4JX6A 3SDBA 1WQ2A 1VQ4I 3DPTA 2C6YA 1Z21A 3T8RA 4HV6A 3VYRB 2R0QC 3L00A 1ETKA 4B09A 5IOZA 2PMUA 1Z6RA 1S6LA 1X58A 3ZQGA 3OYKA 3JREA 5E1WA 1YJNI 2W4SA 2QQBA 2G7HA 2X1DA 3SEQA 1D1BA 2ECBA 4ENKA 3I4NJ 2Y9YA 2LVSA 3R0JA 3OYAA 4XSZF 4E7SA 1MSFC 3BCAA 3HKZA 1X3UA 2E1MB 4RA2A 2XKOA 4ZTJA 4YIRX 1R58A 5CLSA 1BL0A 3FHNA 5M5WJ 3X2QH 5KVRA 1O57A 3CMMA 3VYUB 1ZG1A 4KT6A 1T0FC 1LE8B 5DDGA 1YW8A 4OIOF 5IP6A 4FE7A 1EJ9A 2F2EA 3NWSA 3KP5A 3V8KA 4M6VA 4G8XA 4XR6A 1DU6A 4CCLA 5GAEJ 2L4MA 1TQPA 4L5EA 1QZEA 3BG5A 5DD4A 2XKPA 3KZIC 3ZQFA 2R7QA 5CVJA 5J4YA 3HUGA 1KU7A 1CGPA 1TC3C 4HNVA 3QRFF 2P6TA 2JVGA 1X1CA 2DA2A 3BZKA 3BTJA 2HVRA 1W0UA 5F1RA 4KYWA 4IHVA 1BR4A 3TEDA 2CUEA 4IOAF 1YX3A 1Y0NA 2XAUA 3FXKA 5ILSA 1UG0A 1YRNB 5FRNA 1TT0A 1SEUA 1JUMA 3HXLA 4DW6A 5FKKA 1WH5A 3EDPA 2QSHX 1GXPA 2MG4A 3OOUA 3E1SA 2Y69H 1ON1A 3FK6A 3IL2A 3B73A 1Q1VA 4HF1A 2JA7J 3ZOBA 4RM2A 3S3OA 3FDYA 4OIQF 3VB2A 5E3MA 3H5RA 1XX5A 5TRDA 1CQTA 2H1LA 2MYSA 1REPC 2LBFB 4XONA 3N4MA 4FTHA 2HQ5A 4V2FA 4KMUX 2LOOA 2ME6A 2JSCA 3KLNA 1J75A 1X4PA 3V7CA 3CLOA 1A35A 2E2JJ 1HC8A 4B3AA 4C3JJ 2MH2A 1T08B 3WTXC 3U1DA 2DT5A 3CP8A 2WB1A 3PFYA 3WE2A 4RLFA 2D1VA 1R1VA 1FP1D 1YOVB 2MABA 5LBQA 6PAXA 3JAMZ 1WSUA 2QGUA 1KQ0A 4L0YB 3O2PE 2R7OA 2OF7A 2QCOA 2E19A 4D5FA 3SDGA 4I6ZA 4ZDLA 3HBLA 2IGOA 3BG7A 1RR8C 4Y4RA 1DP7P 3BWGA 2IJLA 2L9SA 5HLIA 4XQFA 3JTHA 1EA3A 1R9TJ 3C1DA 2XPWA 1XGSA 3GYHX 1HXDA 4BNCA 2OD5A 2VBZA 3DTEA 2UZKA 4D7MA 1F43A 2RN7A 3E6CC 3JW4A 2B9SA 3FM5A 1RR7A 3F8NA 2M4GA 2I5UA 1ZYRF 5EZGA 4ON0A 2F5EA 4OINF 4CDGA 1EH8A 4A3GJ 2F5CA 5EGOA 1TWFJ 4D5CA 1D3YA 3ZR8X 4CICA 3S17J 4PJ0C 3BC8A 2KMUA 2X9DA 3WTWC 2JA6J 2DOEA 1OFCX 2O03A 2XGDA 3K1MA 1ULYA 1APLC 2GLOA 2R7UA 2HTJA 5J1RA 4P55A 5D8LB 2XB5A 2MLGA 2M8EA 1VQ8I 1HCRA 1T98A 1SVLA 3BT9A 3DTIA 4I99C 4MFEA 2OAZA 1MBKA 1GDTA 1YQAA 4A3FJ 1PDNC 2XV4S 2VPRA 4FHTA 3TMOA 5ILUA 3FMRA 1U5TC 3MZ8A 1LEAA 2RVCA 3PO2J 5F6FA 3GTGJ 2VJ5A 2CV0A 5EG0B 2BOLA 3QYBA 3A01B 3ZMVA 4LLLA 3HTUA 1T8IA 3NEUA 2RNGA 1YW9A 1S29A 1A6IA 3M1EA 4BXFA 4D7NA 3OMYA 3GTOJ 2Q2EA 1QU3A 4A5NA 2IRFG 3OYMA 1B8IB 3H5AA 1ZREA 4FE4A 3K0LA 3OL3A 1XMXA 2XGCA 2DMUA 3E97A 4QWQA 2M34A 1LJ9A 2QQAA 3GCMA 5ICCA 1W7PA 4XBFA 3U9GA 5EDNA 3A4CA 5F04A 2PX9A 2RREA 3I4PA 3FHZA 2HGCA 3J7AO 4A3CJ 2Q1ZB 4G7HF 3DPUA 1Z0XA 2FOWA 1SMTA 3DV8A 5F08A 2QBYB 3HPHA 3K70D 1LPQA 1YIJI 1SC7A 2V79A 5LHHA 3Q0WA 3OYHA 2DA6A 3OSFA 4PJNA 2NS7A 2ZNYA 2R4GA 3JRDA 4LB6B 1YFHA 4CCMA 2DFIA 2Y31A 4QLCU 4PGHA 2YU3A 2ZXJA 4OU0A 4OIRF 3HOTA 2CWEA 3E6DA 1R1UA 1SVMA 4BXUA 3KZYA 3LAJA 1KYWA 4DJAA 2ICWG 3BCBA 4M74A 2Q0OA 1I6HJ 4RAYA 3FZVA 1P92A 3FBNB 4V19K 1O3SA 2NNYA 2R7WA 1VQMI 4WXDA 3BZ6A 2O9LA 1A31A 4DYCA 1SAXA 1W5TA 2Y75A 1D1AA 5FKOA 3H3ZA 1IUFA 3ZQLA 4W1UA 4R8HA 4LIUA 2D5VA 3ZQ7A 2P5VA 3VPRA 1PP7U 2R7DA 2GIVA 3LQQA 3MZYA 2IGMA 2X4HA 1LFBA 2AXTC 1WHUA 3S2WA 4BHBA 1Y39A 5M5XJ 1W5CC 1ZELA 5H6RA 1SVOA 4LOCA 2QQ8A 5LFAA 3CDLA 2HDWA 2XF7A 2BY2A 2CQNA 5DEQA 3KEYA 2XF5A 5FROA 2VODA 2H8WA 1LEBA 3HKZN 3Q5FA 3CMAI 2VBXA 2LF8A 2IP2A 1I3AA 2HXIA 2XPVA 1MSEC 1RZ4A 3V8LA 1OQYA 5F0HA 2A3SA 2NVQJ 4Q47A 1USSA 2VC1A 3KP6A 3LA2A 3H1CA 4PSWA 5L3GA 1V54H 1A04A 3V8JA 1O4XA 4HZFA 3L2WA 2CFXA 3HUGB 1IXSB 1Y8RB 2K9QA 1QBJA 4JBAA 4U7BA 1AWCA 1JI8A 3LSIA 3DBHB 3R0AA 4U0YA 4OOIA 1U8RA 4JX4A 2CUJA 3HSEA 1KZHA 3LAPA 1XGNA 2IT0A 2I8DA 1G3TA 2QF7A 3HRUA 1PUFA 1NH3A 4LG3A 1V5EA 4IVNA 1XPXA 3K10A 1UHMA 3GTPJ 1R23A 5LHGA 2VASA 3DP7A 2ADUA 2Y0SN 3SEZA 2OCCH 1VI0A 1GVDA 4S05A 1UJ8A 2LKPA 1YO5C 1QO0D 1JGGA 2UXXA 2KHMA 4LIVA 2K27A 3JRGA 1TNSA 1FBQA 4AYBA 4EATA 5B1AH 2L7FP 3JR9A 4XLEA 5BOXA 5IP9J 1ETQA 3C2GA 2QQ9A 2KZVA 2H09A 1W36C 2KLOA 3S93A 3LSPA 1YJWI 1MMGA 2VIXA 3ASOH 3CO7C 2ZC2A 2TRTA 2HOAA 3VSLA 4B1RA 3DBRB 4PSXA 4HDVA 1VQ7I 3QU6A 5LGUA 2GXBA 3GFLA 4PGGA 1K78B 1MMAA 1MH4A 3JSOA 4NDLA 4HQEA 3CCLI 3EUAA 2PMZN 3EQLF 1HLVA 2DMTA 2F4IA 4YELA 1MJAA 2O61A 3M8EA 1XN7A 4UUSB 3D5SC 4NBQA 3TL4X 1GV2A 3V4GA 2MLKA 1K83J 4MTDA 1PUFB 2EIKH 1KA8A 2K40A 2L7KA 1UCRA 4M3GA 2EQRA 2IW5A 4I7HA 2M2EA 4IXAA 3OYJA 2OU2A 5AIQA 4AIHA 1TW2A 2LNBA 2DFEA 1MMSA 4RGXA 5DUKA 1QGPA 4IZZA 1Y6IA 1V5GA 2DA7A 4UB8C 1PP8F 3G1LA 2P6SA 1Z05A 3ZQHA 1QHGA 4RAFA 4RDUA 1FNNA 2EK5A 5TISC 3G6EI 5M3FJ 1Z9CA 3JSPA 3S14J 2QUFA 2V26A 3BTLA 2EJRA 3BR5A 2M0MA 4RAZA 3A02A 4BJ5C 2L9VA 3UNGC 4YFXF 3EUHA 1RETA 2AQEA 4D9JA 1XS9A 2VE8A 5E3LA 2HQRA 1IXCA 2VJ4A 3DEWA 3BQZA 5CVRA 1I1SA 2P5KA 2A68F 2KT0A 1MW7A 3IP4B 2Y2ZA 1F9NA 5AIPA 3QQAA 2QKMB 2E34A 4H0EA 4B8XA 1QHHD 2E71A 3CQZJ 1B9NA 5FJ8J 5K5QA 1PUEE 2EFOA 3G71I 3I59B 4ASNA 4HNUA 1UMQA 2X1EA 2EA4A 3ZMUA 3NAUA 4N9HA 5GPAA 3BJOA 3F8FA 1X4OA 1KGSA 2DDBA 1PYVA 4A12A 2VQCA 2EIJH 5J40A 3ZMTA 1CF7B 1R5HA 3MMYB 1I27A 4I02A 4CYDA 5CVVA 1M1EB 1DDNA 2KPMA 5KNLA 1BN5A 4UVAA 1B4AA 4I0AA 4QTRA 2R7ZJ 2P0WA 3P5JA 3QYFA 3ZMSA 2VT2A 2OZ6A 3HB9A 4C3HJ 5IT9K 3FKJA 3LNQA 4XNFA 2LREA 1BJZA 1JKQC 1HKSA 1XB4A 1WJAA 4S04A 1FX7A 1HSTA 4CA0A 4XOPA 5DM7F 3D5RC 3MKLA 1SFXA 2M7BA 3S8PA 2LDUA 2E36A 2FX0A 4Y17A 3CUOA 1MNMC 3O6BB 3GW2A 4B44A 4MQVA 2ACJA 4NNJA 2W85A 2QVOA 4EJOA 5IT3A 1K4SA 1OCCH 5CQGA 2F5DA 2BHYA 3CCYA 3COAC 3G2BA 3ISPA 2V6CA 2JA2A 2PBIA 4O5VA 2GBYA 1BI3A 2HQAA 2K3FA 2VUMJ 4FISA 2BEOA 2AO9A 1DQUA 4Q4ZF 1RI7A 3K4KA 2R5YB 3GZNB 1ZLJA 1IDZA 2IS6A 4CYCA 4L18B 3RCOA 1B72A 4LGWA 4CCOA 4M9XA 4HRIA 4E7HA 4CH7A 2M7AA 3FXMA 2NOJB 4KISA 3PJRA 2ME0A 3OYLA 1FBSA 2L2OA 3PUBA 1X1PA 2FF4A 2ZMEB 2ZSHB 1F4KA 1SFKA 2DOAA 2DXIA 1MD0A 2HZTA 5JHUA 3OYEA 1S8NA 4BACA 2CV1A 2EWNA 2L3DA 2MW8A 1N25A 3Q9VA 2V9PA 1K6YA 2B7EA 1B6AA 4G7ZF 5DD8A 4XLFA 5BNGA 3SXYA 1T38A 2JZYA 3PSFA 3R6SA 4XIDA 2G0EA 3OWTA 2R5ZB 2CQKA 2HZDA 2P81A 1IRFA 3M8FA 5CQEA 4ZTFA 3PM1A 2Z5UA 4CGZA 4KIFA 4HNTA 1E3HA 1U5TA 4AYBN 3TBIA 1WI3A 2WWYA 2V1UA 3TOAA 3CJQB 1NG7A 1MZBA 2DCEA 1OCPA 3A0HC 1ON2A 4E7ZA 3QPSA 3TDZC 1DGWY 3AG3H 4PJJA 2K9LA 4JQFA 4X1EA 2ID6A 3GWZA 1IZ1A 5FKMA 2KJBA 4WXCA 3IV5A 2V6EA 2DI3A 2WADA 3QPLA 4JP0A 2HFHA 1B9MA 4R1HA 4Y52J 2CQQA 3HJEA 2R7SA 4L9NA 2JA8J 1J59A 2M87A 1PJRA 3KE2A 2JSPA 3CCEI 1ORKA 2GA2A 1FP2A 2BYVE 3OS2A 5JHFA 3PNVA 4ZDOA 2O3FA 2LY1A 1F5TA 4C2UA 4U0VA 2RAEA 2Q8KA 3L2RA 4XKBA 2ID3A 2BZTA 1W7PD 3ERMA 3F6OA 1X1BA 2JUCA 5CVUA 2QZ8A 3R4KA 3CCUI 5F0FA 2PQ8A 4MGRA 2E1NA 2VXDA 5E3OA 2HWVA 1JJ6C 5TJJA 2KRCA 5DTDA 5J4VA 1XG1A 4G6TB 3DXJF 2VC0A 2EZKA 2RKHA 1JGSA 4QSHA 1HW5A 2KRFA 5HLHA 3E0JB 2MH9A 2ISYA 4XRMA 3O8HA 1X2NA 1WJCA 3TKYA 2DMPA 2JRMA 4ABZA 4IX7A 2EPFA 2XRLA 3ABLH 3HOYJ 1UFMA 3CCJI 3H92A 3RSNA 2DFHA 3W6VA 1QNTA 1KU9A 3P7NA 2XAHA 1Z67A 2LC2A 2J5PA 4DGWB 3RPQA 1MDMA 2LKXA 2ZXIA 4NC7A 1Y8QB 4UUSA 3WTTC 2MD5A 4M6YA 1ZRDA 3BJ6A 1ETYA 3HEFA 3K70C 4R79A 1TWCJ 3FXLA 3OYDA 5LGTA 1I50J 1OR7C 3RDIA 2E60A 5IPAA 1LFUP 3DKXA 3W2AA 4A6EA 3A0BC 2X0LA 4BHPA 4X0GA 5KHDA 4EVIA 2ZJ2A 3J7YJ 5TGTA 4HYEA 1FT9A 2B63J 3JRFA 2EINH 1VF9A 2QM3A 5ED4A 1V4RA 3K7AJ 3FXOA 4NC6A 1FY7A 4DZJA 5DCFA 3GVAA 2D1HA 4PUSA 2O6GE 3F21A 1U8BA 1U0JA 1AKHB 3KP2A 4XRSA 4LB5A 2LBFA 4M6XA 3QWLA 3QPTA 2WAEA 3ROUA 3OIOA 2BXZA 3FBIB 1KONA 2VQGA 2KP6A 1XCVA 3R61A 5D5XB 3HOWJ 4KA4A 4BAYA 2FOKA 4ZYAA 2ZJPF 2HPIA 2DA5A 3CTAA 1P6RA 1W36D 1A5JA 3IWFA 5KK1A 2K4BA 4BS9A 4JOMA 4MEXF 1ERDA 5E20A 4DYRA 1D1CA 3B02A 1U3EM 2KIFA 2UWMA 2EIMH 3IH3A 4UUVA 4EGZA 3D0SA 2R3SA 3IAS2 4PJLA 1BJAA 2N8GA 3CDIA 3RZDJ 2P8TA 2J5OA 5JVGF 1IO2A 3P9CA 5L3DA 3FKIJ 4RBOA 4A3JJ 1LFPA 2RNJA 2LMDA 2DO7A 3AKZA 3SZGA 3QU3A 1FMWA 2DFFA 2VB6A 2ZB9A 1QA6A 2DU9A 3VEPA 4YIFA 3UKGA 1SAUA 3FX3A 2KL4A 2LSOA 3L2UA 1BR2A 4C3IJ 1HKQA 1TT5B 2P4WA 2AS5F 1GV5A 3LSHA 4CHUA 2FMLA 4P1WA 3C2HA 3HGGA 3E6BA 3LOCA 3QODA 2R7VA 3KCCA 4BQOA 3F8MA 2IA0A 4PZJA 5HNFA 1K61A 3L09A 1JXSA 3RTRA 1WJ5A 1KQ8A 2IEKA 2M8GX 4HOBA 2R7RA 2K9MA 4A3IJ 4UY8I 2HYGD 1V3FA 3HDDA 1TBXA 3EYYA 3H0GJ 3DU5A 2VQLA 5FLXZ 2VE9A 1XTAA 5BS6A 2ETHA 4E7KA 1EKEA 3I9V2 1U9OA 2MD0A 5IYDJ 1FC3A 1D5YA 1OLTA 4E7LA 5JFRA 1SD4A 4E6KG 1YYVA 3RJPA 3ELKA 3MWMA 3L7WA 2L54A 1QVTA 4C2MJ 2VPLA 1HW1A 1ONVA 2K85A 4XKVA 3TW7A 4ESJA 1U5TB 4KN4X 5FD5A 3RI4A 1WKMA 2EILH 4LFUA 4QPOA 3ZN0A 2OQGA 2VJJA 1BOBA 2FE3A 2ELJA 4A69C 2E35A 4A2UA 1IG7A 3F0CA 1G3YA 2VKVA 4YEJA 3TP3A 5HNHA 1ZN2A 2M4KA 2L02A 1IW7F 4QPQA 4MIMA 3I59A 2R7TA 4X6AJ 1ZH5A 1F1ZA 3HRSA 3JRBA 4UUTA 5L3BA 1BC8C 1XMAA 1LNWA 5DUIA 1JTYA 2RQQA 1HA8A 4L5JA 2X51A 5F64A 2WAQN 3MZHA 1AKHA 4O6JA 2CW7A 1FBUA 3H3UA 1LE8A 1IRXA 2HDDA 1BIBA 4BGDA 3CP2A 2E5NA 2DT7B 3RYRA 2HPMA 4HAMA 4XSXF 2VOPA 2FSWA 2NNNA 3G1MA 3ZN1A 5EEGA 1R4NB 3ERED 1B72B 1OCTC 1W1WE 3LFUA 2VXZA 4NC8A 3CCQI 2M45A 3T8TA 4BE2A 2F5VA 4UB6C 1FTZA 1OCRH 3EYIA 2CS3A 4WX9A 1D8KA 1JTXA 4RLQA 4YFNF 2NXNB 5E8IA 3IH4A 5EYRA 4M3EA 1SANA 1FYKA 1R1TA 1SD6A 1R7JA 3G3ZA 4E7IA 4IRHA 1SD7A 3F22A 2BXYA 1LDJA 1RPWA 3BTCA 2F5FA 2V1XA 2NYXA 1JT6A 2W1OA 2HXOA 5JR3A 1N77A 3CLQA 2Y30A 2LD5A 1LVKA 1R71A 3OY9A 4E70A 1VQ5I 2KJCA 1XDSA 2ZFWA 3Q0UA 3OYFA 1XGOA 4ZZLA 1R49A 3HTSB 2A6TA 5DS9A 2G7UA 4C2TA 3IUOA 3DQVC 1P7JA 3PFIA 4JX5A 3OOPA 3E7LA 3K2ZA 2KDZA 1U6GA 2ZSIB 5A2QK 1T0FA 4JYKA 1BM9A 3G73A 3I0TA 1KYZA 1IV8A 1OYWA 4FX4A 3CF5F 2E2HJ 9ANTA 4RB2C 4PCQA 4DZPA 3J7ZI 1ACIA 2X6WA 2X6YA 2FNPA 2CRGA 1J7KA 2O5RA 4AM3A 4IO9F 1K78A 1XCBA 4GXOA 4ZZDA 3KPHA 2E2IJ 3WGGA 4EJWA 1FOWA 4LG0B 1FIPA 3IKVA 3M1CA 4LK0F 3SFZA 1DGRM 3ML6A 2R5ZA 2O0YA 4LG0A 4XN3A 3DF8A 3TGNA 3BLYA 3WTZA 2X85A 2CQXA 1QPMA 3FMQA 1ZTRA 4KNYA 2H8RA 2L0KA 4MHGA 4LLNA 3V7SA 2DN0A 2QLZA 4Y3OA 1TNTA 1JUSA 4RAGA 2QA4I 3BPXA 2CH0A 2IBDA 1FZPB 3CZ6A 3AG1H 3HC7A 1VQ6I 2X1CA 1JUPA 4J19A 2GQQA 1FJLA 4G7OF 4L9TA 5K7FA 3HZJA 1T6SA 4XKCA 4BL0B 1WCMJ 1GXQA 4JK1X 1I39A 4RM3A 3S3MA 3GTMJ 1RNLA 3W6JB 3K4NA 3PNYA 1BI1A 1ETOA 3PNTA 3VYSB 3I4MJ 2PJRB 1DPRA 1UELB 2QEXI 2DQLA 1GLNA 3M4OJ 2JN6A 4ZYEA 1UAAA 1DPUA 1MMNA 4MO7A 1YS7A 3GXOA 4BBSJ 1N75A 2HKXA 2YSRA 4RGUA 1OPCA 2V9VA 2LY2A 3GFIA 1GUUA 5JLXA 1K7AA 2L9NA 4OWRB 5D6EA 2GAUA 3RKWA 2MC4A 3C2BA 4Y7NJ 3WU0A 3ZMZA 3WU2C 4Y13A 1JJ8C 3GFJA 4E4HA 4AVPA 1IGNA 3U2RA 1E3PA 3H9QA 2ZMEA 1G2HA 3FM3A 2DK8A 3HPGA 1H9GA 2D45A 1U78A 3TDUC 2KDOA 3D1NI 3VODA 3BPVA 2M30A 4A5MA 3RKYA 2JPCA 1YS6A 4ZDPA 5K5OA 2IS4A 1MJBA 3PQJA 2VL8A 4GYIA 1WJDA 4ETSA 1FOYA 4KIBA 5FFZA 3FF5A 4F52A 2LKSA 3A03A 2ELKA 2E5ZA 2EZHA 3VWBA 4PFOA 1X1AA 3F23A 2W25A 3KP7A 1NK2P 2GWRA 1UHSA 4N4NB 5HLTA 4GDFA 5FLVA 2Z9OA 2M9HA 2CO5A 5E3NA 3K1NA 1Q1HA 3CMEI 3EUKL 2HEOA 2VONA 3LSTA 1WRJA 1IN5A 5F27A 3FMSA 5ICFA 1N78A 3IAM2 4BQQA 3HHHA 5LEKA 1E0EA 3W3CA 2ZJRF 4AIDA 1ZG3A 5GADJ 3S16J 3C3WA 4U7DA 3OL4A 2NVYJ 2HOEA 3BJAA 1LKXA 2YR2A 2OTJI 4IHWA 4DOZA 1MGTA 5J1YA 2IS2A 1SD5A 3H35A 4Y15A 3W2VA 5IY5H 5CKTA 2WBMA 4AD9A 3OR1C 2DBBA 4IRIA 3DEUA 3FXRA 4DBRA 3I64A 3HSRA 3LSJA 2A6HF 4BU2A 4BYYA 1MMDA 2LLKA 5HS9A 3HM5A 1OR7A 4A3EJ 4RS8A 4ENJA 4TV7A 1WPKA 4HLYA 3MEXA 2K9NA 1FIAA 1VNDA 3GFMA 4EJTA 3KP3A 3DEEA 2OZUA 1SFOJ 3T5XA 5LEJA 3QOPA 3MD2A 1ZGJA 1YI2I 4LJZF 3JCUC 2DT6A 3FWEA 1GHCA 3TO6A 4A93J 2KZGA 1YJ9I 3MAJA 3S2DJ 2CUFA 5HS7A 1IN4A 2XASA 4HW0A 2PI0A 4FT8A 1IN6A 2XPUA 3RKQA 3HOZJ 2Z3YA 3RYPA 2F48A 4G94A 3CMYA 1HBXG 4C9YA 4CCKA 2DDAA 4FQGA 4O3MA 2VKHA 2JT1A 5J8CA 5FKNA 1TWAJ 4KITB 2XIGA 1Z91A 3R60A 4BEHA 3NARA 5L3CA 2RGVA 4B48A 1ZLKA 1K6OA 2OQRA 5LRSA 4EM0B 2HOTA 1Y1VJ 1FLIA 1Z7UA 3LL7A 4M73A 5EJCA 1QZZA 3Q0VA 4IPAA 3OIQA 1MBFA 3HYIA 1H0MA 5AONA 2H27A 3GTKJ 3ULQB 2A61A 3HL2A 4ZYHA 1C0WA 4KDPA 3FISA 3BR6A 3K4LA 1ZHFA 2IXSA 4YIIA 3H0DA 2EBIA 3B6AA 3CJNA 4CCNA 2STTA 5C4JJ 3DTKA 2M1BA 4IKFA 5EEHA 4RB3C 1RRJA 4GRIA 1VQ9I 3DLLF 1Z7LA 2FMYA 1O3RA 1IF1A 2JK3A 4Z6YA 4D1QA 2V9KA 4B43A 3F72A 1R5GA 2WY7Q 3C7JA 3OYNA 2LR8A 1ZR2A 1VZ0A 4N4OB 2AQFA 1HKTA 5DM6F 1TQIA 3LSMA 3I54A 2DJNA 1H88C 2BY3A 5FO5A 4MNUA 4F92B 3HOXJ 1P2FA 1FTTA 5FLMJ 2GOXB 1BA5A 3MKZA 3OS1A 2E1OA 1H89C 4F3QA 1LUJB 3AG2H 1UZCA 3RQIA 2KKOA 4A0ZA 3CCSI 1BR1A 2BY0A 4BHCA 1T2KA 2KQRA 1BW5A 3LSGA 5H6QA 3EPZA 1W7PB 2X48A 3Q9SA 1I6XA 1OJLA 4NUBA 4WCGA 1X19A 1OYIA 2RV8A 1FYMA 3DPLC 4ITVA 2CYYA 5FD6A 2HQNA 2FBHA 3E5XA 4II3A 4LLGF 2Q2EB 1YE9A 1MBHA 4YRVA 2IPQX 3H36A 2WA0A 2GOMA 3BR2A 1OKRA 3JRIA 3KZZA 3G1OA 1TZLA 3DU6A 1P9QC 2R7FA 3M8JA 2AXLA 2JRTA 4FX0A 3ZP5A 5J6XA 4U87A 4EM1A 5HDNA 4LMYA 2LTPA 2FNAA 4F7ZA 3K1PA 2ZJQF 2VOOA 3GZ6A 1BC7C 2Y48A 3GX4X 5L3EA 2XF6A 1G6NA 3UR3C 5GAGJ 4BJTA 1O7LA 3EETA 3KYCB 3F8CA 3GTJJ 2OTLI 2CU7A 1TL8A 1OCZH 4UNOA 1KU3A 3AFHA 5J47A 2XDVA 5M5YJ 4E7JA 1IC8A 4W97A 4ZYGA 3L2QA 3S1MJ 4IF4A 2DQRA 2RQPA 3WTYC 1ZGAA 4BBRJ 4XMYA 1I1GA 2F4MB 2OPTA 3KYLA 4HX4A 2ZO4A 4XL9A 4OIPF 3T1BA 2NS8A 2XUBA 4MQ9F 1IV6A 1S7OA 1Z3XA 1R4MB 5IYCJ 3BDDA 4BY7J 3E5QA 5DCMB 4MEYF 1FYLA 2L7ZA 4FETA 2VQHA 3BR3A 4V2GA 4MFDA 1B1BA 4M3BA 2UV1A 2HKOA 4XRFA 3KFWX 3OYGA 1Z3YA 5KCMA 2XSDC 2NVUB 4ZJZA 4ZYDA 1B8IA 2ESNA 4KUMA 2Z16A 5D8KB 3U21A 3G4SI 4KN7X 1YLFA 3U1KA 1W5SA 3ECHA 2JTVA 2BVLA 4UVBA 1QZYA 4Z2YA 3M9AA 2KRHA 2XAFA 1S7AA 5D4RA 2H6CA 3WG7H 3H9GA 3WHCA 5K7HA 3A01A 3S1QJ 1TQMA 3HG9A 3I3LA 5HODA 2HYFA 2XGEA 1JKOC 3TQNA 3ZMDA 3WHBA 2LF7A 2LFBA 3GLLA 3SYTA 3ZCOA 1H8AC 1MDMB 1UB9A 2JUGA 1IRGA 1FOXA 5BPIA 2DA1A 2XB0X 4IHSA 3ZQCA 2WV1A 3HHGA 5B5EC 1ETWA 2MSYA 4P96A 2ELHA 5FFXA 3F9KA 2WTEA 2YX7A 3ONQA 2FXAA 2LYCA 1YW7A 2E1MC 4CYCB 2NOGA 4M3FA 4HQMA 2QYOA 1STZA 2H94A 3S1RJ 2ZNZA 2B0LA 2VJIA 4GYGA 1WH7A 3I53A 4UV9A 3IKTA 3VDXA 4HDUA 4KMFA 2PJPA 2M5WA 1IUYA 3I71A 3ABKH 3FXUA 4XN0A 4AUXA 2W7NA 2Z33A 3WTSC 1JHFA 5BMZA 1WWXA 4OAZA 2XAJA 3MKYB 2W57A 1K79A 1AU7A 1K4TA 2QKLB 2VBWA 3PO3J 1D0XA 3RKXA 3A2KA 1O3QA 1ZRFA 3V7RA 2WAQA 4EGYA 2COBA 1D5VA 4OMYA 4KICA 1MBJA 1A36A 4WXHA 4IL6C 2FQ3A 5HOOA 5IP7J 3CD6I 4M9SA 1T39A 3VFZA 2DOFA 2MFZA 5CYVA 3S2HJ 1QQIA 3LA7A 5D6FA 3L1PA 2VKEA 2GXGA 1RKWA 3CJRB 2P5LC 2LG4A 1H9TA 2EFPA 2OCEA 3K4CA 2W24A 1ODDA 4K2EA 1ZGWA 2CSOA 4RGRA 2ZMEC 1Y0UA 1XDUA 4J01A 1CF7A 1POGA 2DW4A 3WE3A 5K7ZA 3ZXSA 1G4DA 1ENHA 3OIPA 3BG3A 4II2A 1FSEA 2CQ7A 1J5YA 3AG4H 3WODF 3K4MA 2FEZA 1WI9A 3WTUC 2H6BA 1J09A 4PDKA 5CJ9A 3I56I 4M9ZA 1BI0A 3CDHA 2ECCA 2X6OA 2P7VB 5GTHC 2PJRA 3IWZA 3MFKA 2OA4A 4FCYA 1Y56A 1VFCA 2Y0MA 4IRGA 2K4JA 1S5LC 2K9SA 5EZHA 1BIAA 1VTNC 3GBGA 1KU2A 1FPQA 1A6QA 4M72A 3ZQQA 2ZXWH 5D4SA 1JE8A 1MKMA 3RZOJ 3MN2A 3PQKA 1JHHA 3SFIA 2K02A 4EMSA 4BJ6C 1RUOA 2XAQA 2EB7A 3HGYA 3QOEA 3RQ4A 3GUDA 3I58A 3BG9A 4ANJA 4UVCA 4DIQA 3AL0C 1HOMA 2KIMA 2JJ7A 1FEXA 3K69A 1LDKB 3BP8A 1EH7A 2XSJC 4XICA 1FOKA 1Z6TA 4L0ZB 2KIUA 1ETXA 3E6MA 3MCZA 2VT3A 4IQJA 2IA2A 2VI6A 3BG6A 2KIQA 2EH3A 2K5CA 5IYBJ 4HF2A 1EF4A 3CF2A 5L3FA 1JKRC 4P5OA 1ZR4A 3A1YA 1DP3A 4XLHA 5DCMA 5KAIC 5M3MJ 3LQRA 1HW2A 4WK8F 4DNCA 4I2OA 2JMWA 3T0YA 2Z2SB 1TP4A 2CW8A 4AIKA 4L9JA 3KIOA 1V55H 1HDDC 2O8XA 3D5LA 4P9FA 3OR2C 1IRZA 2A07F 1AA7A 5D5UB 4EJVA 1YRNA 4BUPA 5HDGA 4BE0A 2IVMA 1L3LA 3L9FA 4HX7A 1J2XA 2NRAC 2DA3A 2LRDA 2VLAA 3N05A 3ZRGA 3I5UA 1SFEA 2K86A 5LGNA 2CW0F 3SQNA 5H20A 3RPUD 3CC2I 2IA1A 2QENA 4A0YA 3ASNH 4P9UA 1IAWA 4ZH4F 5K5RA 1HF0A 4DQ2A 5EEAA 4XKWA 4I09A 2CMPA 2FBIA 4I76A 5BPDA 1YITI 4Q5SF 5JLWA 3WTVC 2QWWA 5E1ZB 2DYRH 2UUZA 2OUMA 4DBQA 1SFUA 2Z1DA 3HOVJ 4HF0A 2M0CA 2EZIA 1ZKGA 4ESBA 2JWTA 2Z99A 5D5VB 1JT0A 3PIPF 2HOSA 2BW3B 1EV7A 2XAGA 5LLQA 4EEFG 2A5YB 2WY8Q 4WF2A 1LQ1A 4EQQA 2A69F 5B66C 1QRYA 1TTYA 3N97A 1R22A 2M3AA 3JTGA 2PG4A 2DTZA 1T56A 1R00A 3MQ0A 3GZ5A 1XC5A 2HI3A 2E1CA 3B6CA 1W4MA 2K7LA 1TLHB 3ZQIA 3QPHA 4MLOA 3REOA 2ZCWA 2FD5A 1ZQ3P 2QSGX 3E3VA 5CPRB 3SHFA 4F91B 2YPRA 3GTLJ 4L5IA 1YG2A 2E7WA 1XSDA 2H1KA 4BQNA 2CJJA 3VYTB 1UHWA 2DTRA 1XSXA 2BY1A 2EFQA 1TWHJ 3NRVA 4PFPA 2CFOA 1NTCA 2V1NA 1RC9A 4XK4A 4AVZA 4S0HB 1U2WA 4XLPF 4Q48A 3MKWB 3FIWA 3MVPA 3PL8A 2E7XA 2STWA 4BDYA 1WFXA 4KT5C 2FU4A 2OJED 2LY9A 1G3WA 3S32A 5LD2C 3LSKA 4I0BA 3JRCA 3OYCA 1GT0C 2DPDA 4BQAA 4A3KJ 3K6GA 3IRRA 4XLNF 4XOTA 1WZ2A 1AOYA 4U88A 2FA5A 2CV2A 2BGCA 3LA3A 4F93B 2QBYA 5HLGA 3HOUJ 5IT9Z 2FRHA 2UXNA 3S15J 2A6EF 1IDYA 4GO1A 5C4XJ 5A2QZ 3JAMK 4RB1A 4YG2F 1BI2A 2OBPA 3TW6A 5HVQC 3PIOF 5F0CA 2ZBKA 5FB2A 2O7OA 3CESA 2NVXJ 2CG4A 3CC7I 3P9IA 1PVEA 1YX5A 2FJ1A 2L4AA 4XM3A 2IS1A 1U9NA 2OC6A 1YTYA 1WVRA 1P7IA 4G9YA 4BE1A 3FXJA 3HOSA 5FKLA 2R93J 3OV8A 2XHKA 3BY6A 3CUQA 3SJMA 1XD7A 3CUQC 3KEOA 2MBFA 4U0WA 3HRTA 4EJUA 1WJFA 4GCVA 3ABTA 5K1YA 3IRQA 4IQ4A 3VSKA 1R5ID 3CO6C 4EM2A 1S3JA 5ILVA 2HYJA 4HA8A 2R92J 1G8XA 3DKYA 1UG2A 4DYQA 3DCFA 3OYBA 1HDPA 5ERIA 3RIRA 2V4JC 3L2CA 4BY1J 1FWZA 2EV0A 2AHQA 1OMIA 1V5FA 5H2FC 2VN2A 1MNDA 5D5WB 2DPUA 2HDCA 3W2WA 3J7AY 2R7XA 3ABUA 2HVQA 1T33A 2PLYA 3GO5A 2BVMA 4OMZA 3TP0A 3KLOA 2W82A 4D0PA 2MC3A 5CVIA 3DWLE 2HR3A 3NWTA 4G6DA 4NQWB 4MTEA 2R5YA 3LWFA 4BXXJ 4A3LJ 2COMA 1O3TA 2F4OB 4UHTA 2BHZA 2KISA 5FRMA 4GFBA 4RB0A 4B3XA 2HU9A 3TO7A 4BEHB 3H3VK 5EG0A 3JRAA 2Y0SA 2EFWA 2EFNA 5J8FA 3F8BA 4CXFA 2F6CA 3HIFA 1OCOH 2VKDA 2DJIA 1MIJA 1ZAOA 4A3MJ 1J9IA 3K9TA 2HVSA 1MBGA 4CZZA 5B3SH 3KX2A 2V7FA 3FK7A 2TCTA 3IH2A 4XRSG 1VQKI 1I3QJ 1IN7A 2A5WA 2LK2A 2W84A 5LRRA 3C18A 3P9KA 1RESA 4NB5A 4A3BJ 5DYMA 2KFDA 2NS0A 1YHQI 3CCMI 1VQNI 4CCJA 1VQOI 3OYIA 2XC7A 4HLXA 1ITYA 3W6KB 2L7MP 1P4XA 2OV7A 3QYEA 5B1BH 2YS9A 2BV6A 2FBKA 5C3EJ 2FQ4A 2JVHA 4I98B 4KIGA 1T95A 1BBYA 4CZCA 1FMVA 2WC2A 3LSRA 1WJBA 1IXRC 4HX8A 2D2WA 4Y33A 2CGPA 1IN8A 1BW6A 3BQYA 2RDPA 4A6DA 5GTIC 3J80Z 1SMYF 3RPUA 3GLXA 3WU1B 3BOQA 4B47A 1R36A 1LDDA 1E2XA 3K2AA 2XVCA 4LITA 4UXNA 3SZPA 4AWXB 2WB1N 4EV0A 4CO8A 3ESWB 1E3OC 1I5ZA 2ISZA 1Z77A 2DMQA 3WG9A 2W00A
chains in the Genus database with same CATH topology
4BJTA 4XLAA 4C30A 4HSTA 4BQOA 1ZELA 3AFHA 5HNFA 2XDVA 4E7JA 2WAFA 3L2QA 3RTRA 1WJ5A 2ZXHA 5LFAA 2HDWA 2R7RA 2K9MA 2XF7A 4XMYA 5FROA 3KEYA 2XF5A 3DU5A 2VQLA 3KYLA 4E7KA 3I9V2 2L5QA 2MD0A 4XL9A 4HG2A 3PSIA 1OLTA 4E7LA 4E6KG 1Z3XA 4CUGA 1S9HA 2BW3A 3L2VA 4PSWA 4ZC3A 2VPLA 4FETA 2VQHA 4XKVA 3L2WA 3HUGB 4FASD 2UV1A 4CSWA 4U7BA 1Z3YA 5KCMA 3OYGA 1JI8A 3LSIA 4QPOA 4ZJZA 2CUZA 2VJJA 1MNEA 1BOBA 3K4BA 2CUJA 2Z16A 4HSRA 2ELJA 2LH9A 2I8DA 3U21A 1NG6A 4LG3A 4F55A 4XORA 1V5EA 4YEJA 2BVLA 5HNHA 2M4KA 3K10A 3DLAA 2FUG2 4QPQA 4XLCA 1R6RA 2KRHA 3H9GA 4J00A 2R7TA 2VASA 3HG9A 3I3LA 3SEZA 2IGNA 3V42A 3SYTA 2RQQA 1X1DA 4KJZA 3ZCOA 1HA8A 2X51A 4LIVA 2KHMA 2CW7A 4AU7A 2JUGA 1IRXA 4AYBA 4EATA 1D0YA 4BGDA 3CP2A 4XLEA 2E5NA 2DT7B 2HPMA 3F9KA 3C2GA 2KZVA 3ONQA 2ZFUA 1W36C 2LYCA 2KLOA 4H4KC 4OAYA 3S93A 1MMGA 2E1MC 2VXZA 2VIXA 3LFUA 4NC8A 4HPQA 4BE2A 2F5VA 2CS3A 2VJIA 4RLQA 3VSLA 4PSXA 3VDXA 1MMAA 4XN0A 3EUAA 2W7NA 4E7IA 2F4IA 4YELA 4OAZA 3MKYB 3D5SC 3TL4X 2QKLB 1D0XA 3A2KA 2W1OA 2WAQA 1N77A 3K4JA 1LVKA 3OY9A 5HOOA 2L7KA 3OYFA 3H9JA 2A6TA 2MFZA 3OS0A 4C2TA 3IUOA 3OYJA 3DQVC 2PMZA 1G59A 2ZSIB 3CJRB 2LG4A 3K4CA 1D0ZA 4IZZA 1Y6IA 4J01A 1V5GA 3ZXSA 1QHGA 4BDZA 3S3NA 3AL0B 3OIPA 4II2A 2V26A 2M0MA 3K4MA 2X6WA 2X6YA 4BJ5C 2R7VA 3EUHC 3UNGC 1J09A 2AQEA 2O5RA 2PJRA 4D9JA 4PJMA 4PK4A 1Y56A 3H5NA 2VJ4A 3M1CA 3IP4B 1MW7A 3GBGA 1DGRM 2QKMB 4XN3A 3ZQQA 1WJEA 3BLYA 2IGKA 1QHHD 2X85A 3ZGKA 4BJ6C 2X6XA 3LMMA 3QOEA 3RQ4A 4HNUA 4Y3OA 2X1EA 2HNHA 4ANJA 2K3PA 4HEA2 1X4OA 2CH0A 4DIQA 3AL0C 1PYVA 3CZ6A 4RMNA 3HC7A 2VQCA 1LDKB 2X1CA 2XSJC 3SDBA 3MMYB 3DPTA 1Z21A 2KPMA 3VYRB 5KNLA 4IQJA 4XKCA 3BG6A 4BL0B 2P0WA 2K5CA 3S3MA 3QYFA 4RM3A 3K4NA 3PNYA 3PNTA 3OYKA 3VYSB 3CF2A 2PJRB 1UELB 3FKJA 2W4SA 2X1DA 4P5OA 4XNFA 3SEQA 3A1YA 2LREA 1D1BA 1DP3A 1GLNA 4XLHA 1UAAA 1WJAA 4CA0A 1MMNA 4XOPA 3OYAA 4E7SA 3D5RC 1N75A 3BCAA 3HKZA 2M7BA 2E1MB 3S8PA 4ZTJA 2LY2A 2Z2SB 2L9NA 4OWRB 2CW8A 4B44A 4NNJA 2MC4A 3FHNA 5CQGA 3D5LA 3OR2C 3CMMA 3VYUB 4E4HA 4KT6A 1T0FC 3G2BA 1AA7A 2JA2A 3H9QA 2HQAA 4BUPA 4BE0A 3NWSA 3HPGA 2LRDA 1DQUA 3K4KA 2VLAA 2KDOA 3N05A 3ZRGA 4XR6A 4CCLA 4ZDPA 3RPUD 2IS4A 2IS6A 2VL8A 3RCOA 1WJDA 2R7QA 4CCOA 4F52A 4HRIA 4E7HA 2JVGA 4XKWA 1X1CA 2E5ZA 4CH7A 3VWBA 2CMPA 4PFOA 2M7AA 2NOJB 1X1AA 2HVRA 4KISA 2UUZA 3PJRA 3OYLA 1BR4A 2OUMA 4DBQA 1YX3A 2XAUA 2Z1DA 2L2OA 4N4NB 5HLTA 3PUBA 1UG0A 2ZSHB 5FRNA 1SFKA 2DOAA 2DXIA 3OYEA 1TT0A 3EUKL 4BACA 2BW3B 3HXLA 2CV1A 3OOUA 2WY8Q 1K6YA 3E1SA 1N78A 3IAM2 4BQQA 4XLFA 1E0EA 3W3CA 2M3AA 4RM2A 3S3OA 3FDYA 3PSFA 3OL4A 3OWTA 2HZDA 1LKXA 5CQEA 4ZTFA 3H5RA 4DOZA 2IS2A 4HNTA 3H35A 2MYSA 3W2VA 3TBIA 5CKTA 4MLOA 4XONA 2LBFB 2WBMA 3OR1C 3CJQB 5CPRB 4F91B 1NG7A 2DCEA 2LOOA 4DBRA 1X4PA 4E7ZA 4BU2A 1DGWY 4BQNA 4PJJA 1MMDA 2K9LA 4JQFA 3VYTB 2V6EA 3CP8A 2WADA 2WB1A 3PFYA 4PFPA 4RLFA 2CFOA 2V1NA 2R7SA 4AVZA 2MABA 1PJRA 3DEEA 2JSPA 3OS2A 3MKWB 5JHFA 2R7OA 3PNVA 3PL8A 4ZDOA 2LY1A 3MD2A 4BDYA 1WFXA 4ZDLA 4C2UA 2IGOA 3BG7A 3S32A 4Y4RA 5LD2C 2DT6A 3LSKA 3OYCA 4XKBA 3L2RA 3K6GA 2L9SA 1X1BA 4XOTA 4XQFA 1EA3A 2CV2A 2VXDA 2KRCA 4F93B 3DTEA 4G6TB 5HVQC 2M4GA 4C9YA 4CCKA 3CESA 2VKHA 3E0JB 2IS1A 1YX5A 4XM3A 2OC6A 3ZR8X 4KITB 1WJCA 2KMUA 3BC8A 4BE1A 4BEHA 3HOSA 4IX7A 4B48A 2R7UA 3RSNA 1WJFA 2LC2A 3DTIA 3LL7A 4IQ4A 3VSKA 4DGWB 3OIQA 2ZXIA 3TMOA 4NC7A 1G8XA 3DKYA 3OYBA 3HL2A 2VJ5A 2CV0A 2BOLA 3QYBA 2V4JC 3K4LA 2IXSA 3K70C 4R79A 3H0DA 3OYDA 4CCNA 1V5FA 1OR7C 1MNDA 3W2AA 2E60A 2RNGA 3DTKA 3DKXA 4IKFA 3W2WA 3J7AY 4GRIA 2R7XA 2HVQA 4X0GA 1Z7LA 5KHDA 4BXFA 4D1QA 3OMYA 2V9KA 2BVMA 4B43A 1QU3A 5TGTA 3OYMA 2WY7Q 2W82A 3H5AA 3OYNA 3OL3A 1VZ0A 4N4OB 2AQFA 3DWLE 3NWTA 4NQWB 3LSMA 4F92B 5FRMA 3A4CA 4PUSA 2RREA 4B3XA 2HU9A 4BEHB 1U0JA 2Y0SA 2Q1ZB 2F6CA 3DPUA 2GOXB 3MKZA 3OS1A 3HPHA 3K70D 2VKDA 2LBFA 2DJIA 4F3QA 2HVSA 2WAEA 3OYHA 3KX2A 2V7FA 1KONA 3FBIB 2VQGA 2KP6A 2A5WA 1BR1A 4PJNA 2R4GA 4ZYAA 2HPIA 1W36D 2KQRA 4CCMA 3LSGA 3EPZA 4BS9A 4JOMA 1ERDA 4CCJA 3OYIA 4NUBA 1D1CA 1X19A 2XC7A 3DPLC 3HOTA 4ITVA 2UWMA 3QYEA 2OV7A 4II3A 2Q2EB 3IAS2 4PJLA 1YE9A 4YRVA 4DJAA 2JVHA 3BCBA 1T95A 2WA0A 4CZCA 2GOMA 1FMVA 1LFPA 1WJBA 3AKZA 3SZGA 1TZLA 3FBNB 1FMWA 2VB6A 3DU6A 1P9QC 3M8JA 2R7WA 4Y33A 1SAUA 4U87A 2KL4A 1D1AA 3L2UA 4B47A 1BR2A 4LITA 4LIUA 3LSHA 4P1WA 3C2HA 2IGMA 2XF6A 3QODA 3UR3C 2W00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VZ0 A;  3W2A A;  3W3C A;  3MKZ A;  3VWB A;  3MKW B;  3MKY B; 
#chains in the Genus database with same CATH topology
 5GAH J;  4XLA A;  2DMN A;  2XRN A;  4C30 A;  4HST A;  4ESF A;  3VOE A;  1HQC A;  3CUQ B;  2WAF A;  3KEQ A;  2PMH A;  2ZXH A;  4NHJ A;  5HS8 A;  3BTI A;  1LVA A;  1P4A A;  2YUS A;  3M3Y J;  1NHA A;  1D8J A;  2L5Q A;  1OIS A;  1OYY A;  4HG2 A;  3DKW A;  3PSI A;  5C44 J;  1ZK8 A;  3TO9 A;  4CUG A;  5E8G A;  1S9H A;  2BW3 A;  3BRO A;  3L2V A;  2PFB A;  3ZPL A;  4LK1 F;  5FLX K;  1E17 A;  4ZC3 A;  1WGX A;  4G12 A;  3GME A;  4M3D A;  1MH3 A;  3PUF A;  4FAS D;  2JPB A;  1F36 A;  2BE5 F;  4CSW A;  2DK5 A;  2RC4 A;  1ZAR A;  2MA3 A;  2CUZ A;  2GA1 A;  1MNE A;  1ZG5 A;  3K4B A;  4M71 A;  4HSR A;  2ESH A;  5E17 F;  2GXA A;  2LH9 A;  5EGO B;  1NG6 A;  4F55 A;  4XOR A;  2QSF X;  2G9W A;  4UV8 A;  4BKX A;  2GIZ A;  1RUN A;  2I10 A;  3DLA A;  3ABM H;  2FUG 2;  3QP5 A;  2DOD A;  1QVU A;  3E5U A;  1R6R A;  4HBL A;  4XLC A;  3CJT B;  1Z1D A;  3CCV I;  4J00 A;  5E79 C;  2JA5 J;  3WGH A;  2HS5 A;  1VQP I;  4B4C A;  4N9I A;  4IJA A;  2L9R A;  2IGN A;  1AHD P;  3LFK A;  2A05 A;  1JKP C;  2V1D A;  4IHX A;  3V42 A;  5GPC A;  2W48 A;  1X1D A;  4KJZ A;  2BBY A;  4A3D J;  3F3X A;  3GF2 A;  1J0R A;  2YX4 A;  3J80 K;  4AU7 A;  4HV5 A;  5EF6 A;  1S72 I;  2HTS A;  1VQL I;  3F6V A;  1D0Y A;  1XGM A;  4IHY A;  2DA4 A;  4LD5 A;  3TOB A;  1KQ9 A;  1X2M A;  5GP9 A;  3O8G A;  2EV5 A;  5HDK A;  4NQW A;  2EA2 A;  2MGQ A;  1DU0 A;  2ZFU A;  1BOA A;  4OAY A;  4H4K C;  5DV5 A;  4QIW N;  5JVT A;  5E18 F;  1IJW C;  4HPQ A;  1Y1W J;  2PN6 A;  2WV0 A;  1B59 A;  2ZKZ A;  4BH9 A;  4G6Q A;  4KFC A;  2P7C B;  4ENM A;  5F1J A;  4AIJ A;  3DFG A;  2NVT J;  3IC7 A;  5E1X A;  4YFK F;  3KET A;  2NAZ A;  3M07 A;  4GGG A;  4A0X A;  1RIO H;  1GVJ A;  5FGM A;  2PEX A;  3CCR I;  2O8K A;  3WGI A;  5IOY A;  3Q3S A;  4ENN A;  4N0B A;  2VBY A;  4IEJ A;  5KAF C;  2LP0 A;  1UST A;  1S7E A;  3K4J A;  3AAF A;  2DAO A;  3S1N J;  5ICE A;  2DLL A;  2TDX A;  2GZW A;  3H9J A;  3OS0 A;  1HSJ A;  2PMZ A;  5BQT A;  1G3S A;  2XRO A;  1G59 A;  5J3L A;  1NK3 P;  1MJ9 A;  1P4W A;  1TWG J;  2JQ7 A;  2GM4 A;  1D0Z A;  2EV6 A;  3SZT A;  3JRH A;  1EH6 A;  1X3Z B;  1RKT A;  2DYS H;  4WWC A;  1MBE A;  4BDZ A;  3O3K A;  3S3N A;  3J81 Z;  3AL0 B;  3GEZ A;  4RGS A;  3HRM A;  3BZC A;  2YU9 J;  1LB2 A;  5J1U A;  3EUH C;  2XGX A;  2IAI A;  4L9V A;  1XSV A;  3KYD B;  1ETV A;  3KP4 A;  2EZL A;  1X3W B;  4IOC F;  4I01 A;  4PJM A;  4PK4 A;  3H5N A;  3J81 K;  3ECO A;  2L01 A;  3NQO A;  4IHT A;  3GTQ J;  3BR1 A;  3BR0 A;  5LHI A;  1W0T A;  3CC4 I;  1ZRC A;  1FSH A;  1YIO A;  3FXQ A;  1XMK A;  4AC0 A;  1QPI A;  3I55 I;  1WJE A;  2IGK A;  3ZGK A;  3QAH A;  1L0O C;  2X6X A;  3DBL B;  3IHU A;  1TW3 A;  3LMM A;  3OSG A;  2Y9Z A;  5ICG A;  5JI6 A;  3HSF A;  3M7G A;  1O7F A;  2HNH A;  3QP6 A;  2K3P A;  4HEA 2;  4RMN A;  1DUX C;  4JX6 A;  3SDB A;  1WQ2 A;  1VQ4 I;  3DPT A;  2C6Y A;  1Z21 A;  3T8R A;  4HV6 A;  3VYR B;  2R0Q C;  3L00 A;  1ETK A;  4B09 A;  5IOZ A;  2PMU A;  1Z6R A;  1S6L A;  1X58 A;  3ZQG A;  3OYK A;  3JRE A;  5E1W A;  1YJN I;  2W4S A;  2QQB A;  2G7H A;  2X1D A;  3SEQ A;  1D1B A;  2ECB A;  4ENK A;  3I4N J;  2Y9Y A;  2LVS A;  3R0J A;  3OYA A;  4XSZ F;  4E7S A;  1MSF C;  3BCA A;  3HKZ A;  1X3U A;  2E1M B;  4RA2 A;  2XKO A;  4ZTJ A;  4YIR X;  1R58 A;  5CLS A;  1BL0 A;  3FHN A;  5M5W J;  3X2Q H;  5KVR A;  1O57 A;  3CMM A;  3VYU B;  1ZG1 A;  4KT6 A;  1T0F C;  1LE8 B;  5DDG A;  1YW8 A;  4OIO F;  5IP6 A;  4FE7 A;  1EJ9 A;  2F2E A;  3NWS A;  3KP5 A;  3V8K A;  4M6V A;  4G8X A;  4XR6 A;  1DU6 A;  4CCL A;  5GAE J;  2L4M A;  1TQP A;  4L5E A;  1QZE A;  3BG5 A;  5DD4 A;  2XKP A;  3KZI C;  3ZQF A;  2R7Q A;  5CVJ A;  5J4Y A;  3HUG A;  1KU7 A;  1CGP A;  1TC3 C;  4HNV A;  3QRF F;  2P6T A;  2JVG A;  1X1C A;  2DA2 A;  3BZK A;  3BTJ A;  2HVR A;  1W0U A;  5F1R A;  4KYW A;  4IHV A;  1BR4 A;  3TED A;  2CUE A;  4IOA F;  1YX3 A;  1Y0N A;  2XAU A;  3FXK A;  5ILS A;  1UG0 A;  1YRN B;  5FRN A;  1TT0 A;  1SEU A;  1JUM A;  3HXL A;  4DW6 A;  5FKK A;  1WH5 A;  3EDP A;  2QSH X;  1GXP A;  2MG4 A;  3OOU A;  3E1S A;  2Y69 H;  1ON1 A;  3FK6 A;  3IL2 A;  3B73 A;  1Q1V A;  4HF1 A;  2JA7 J;  3ZOB A;  4RM2 A;  3S3O A;  3FDY A;  4OIQ F;  3VB2 A;  5E3M A;  3H5R A;  1XX5 A;  5TRD A;  1CQT A;  2H1L A;  2MYS A;  1REP C;  2LBF B;  4XON A;  3N4M A;  4FTH A;  2HQ5 A;  4V2F A;  4KMU X;  2LOO A;  2ME6 A;  2JSC A;  3KLN A;  1J75 A;  1X4P A;  3V7C A;  3CLO A;  1A35 A;  2E2J J;  1HC8 A;  4B3A A;  4C3J J;  2MH2 A;  1T08 B;  3WTX C;  3U1D A;  2DT5 A;  3CP8 A;  2WB1 A;  3PFY A;  3WE2 A;  4RLF A;  2D1V A;  1R1V A;  1FP1 D;  1YOV B;  2MAB A;  5LBQ A;  6PAX A;  3JAM Z;  1WSU A;  2QGU A;  1KQ0 A;  4L0Y B;  3O2P E;  2R7O A;  2OF7 A;  2QCO A;  2E19 A;  4D5F A;  3SDG A;  4I6Z A;  4ZDL A;  3HBL A;  2IGO A;  3BG7 A;  1RR8 C;  4Y4R A;  1DP7 P;  3BWG A;  2IJL A;  2L9S A;  5HLI A;  4XQF A;  3JTH A;  1EA3 A;  1R9T J;  3C1D A;  2XPW A;  1XGS A;  3GYH X;  1HXD A;  4BNC A;  2OD5 A;  2VBZ A;  3DTE A;  2UZK A;  4D7M A;  1F43 A;  2RN7 A;  3E6C C;  3JW4 A;  2B9S A;  3FM5 A;  1RR7 A;  3F8N A;  2M4G A;  2I5U A;  1ZYR F;  5EZG A;  4ON0 A;  2F5E A;  4OIN F;  4CDG A;  1EH8 A;  4A3G J;  2F5C A;  5EGO A;  1TWF J;  4D5C A;  1D3Y A;  3ZR8 X;  4CIC A;  3S17 J;  4PJ0 C;  3BC8 A;  2KMU A;  2X9D A;  3WTW C;  2JA6 J;  2DOE A;  1OFC X;  2O03 A;  2XGD A;  3K1M A;  1ULY A;  1APL C;  2GLO A;  2R7U A;  2HTJ A;  5J1R A;  4P55 A;  5D8L B;  2XB5 A;  2MLG A;  2M8E A;  1VQ8 I;  1HCR A;  1T98 A;  1SVL A;  3BT9 A;  3DTI A;  4I99 C;  4MFE A;  2OAZ A;  1MBK A;  1GDT A;  1YQA A;  4A3F J;  1PDN C;  2XV4 S;  2VPR A;  4FHT A;  3TMO A;  5ILU A;  3FMR A;  1U5T C;  3MZ8 A;  1LEA A;  2RVC A;  3PO2 J;  5F6F A;  3GTG J;  2VJ5 A;  2CV0 A;  5EG0 B;  2BOL A;  3QYB A;  3A01 B;  3ZMV A;  4LLL A;  3HTU A;  1T8I A;  3NEU A;  2RNG A;  1YW9 A;  1S29 A;  1A6I A;  3M1E A;  4BXF A;  4D7N A;  3OMY A;  3GTO J;  2Q2E A;  1QU3 A;  4A5N A;  2IRF G;  3OYM A;  1B8I B;  3H5A A;  1ZRE A;  4FE4 A;  3K0L A;  3OL3 A;  1XMX A;  2XGC A;  2DMU A;  3E97 A;  4QWQ A;  2M34 A;  1LJ9 A;  2QQA A;  3GCM A;  5ICC A;  1W7P A;  4XBF A;  3U9G A;  5EDN A;  3A4C A;  5F04 A;  2PX9 A;  2RRE A;  3I4P A;  3FHZ A;  2HGC A;  3J7A O;  4A3C J;  2Q1Z B;  4G7H F;  3DPU A;  1Z0X A;  2FOW A;  1SMT A;  3DV8 A;  5F08 A;  2QBY B;  3HPH A;  3K70 D;  1LPQ A;  1YIJ I;  1SC7 A;  2V79 A;  5LHH A;  3Q0W A;  3OYH A;  2DA6 A;  3OSF A;  4PJN A;  2NS7 A;  2ZNY A;  2R4G A;  3JRD A;  4LB6 B;  1YFH A;  4CCM A;  2DFI A;  2Y31 A;  4QLC U;  4PGH A;  2YU3 A;  2ZXJ A;  4OU0 A;  4OIR F;  3HOT A;  2CWE A;  3E6D A;  1R1U A;  1SVM A;  4BXU A;  3KZY A;  3LAJ A;  1KYW A;  4DJA A;  2ICW G;  3BCB A;  4M74 A;  2Q0O A;  1I6H J;  4RAY A;  3FZV A;  1P92 A;  3FBN B;  4V19 K;  1O3S A;  2NNY A;  2R7W A;  1VQM I;  4WXD A;  3BZ6 A;  2O9L A;  1A31 A;  4DYC A;  1SAX A;  1W5T A;  2Y75 A;  1D1A A;  5FKO A;  3H3Z A;  1IUF A;  3ZQL A;  4W1U A;  4R8H A;  4LIU A;  2D5V A;  3ZQ7 A;  2P5V A;  3VPR A;  1PP7 U;  2R7D A;  2GIV A;  3LQQ A;  3MZY A;  2IGM A;  2X4H A;  1LFB A;  2AXT C;  1WHU A;  3S2W A;  4BHB A;  1Y39 A;  5M5X J;  1W5C C;  1ZEL A;  5H6R A;  1SVO A;  4LOC A;  2QQ8 A;  5LFA A;  3CDL A;  2HDW A;  2XF7 A;  2BY2 A;  2CQN A;  5DEQ A;  3KEY A;  2XF5 A;  5FRO A;  2VOD A;  2H8W A;  1LEB A;  3HKZ N;  3Q5F A;  3CMA I;  2VBX A;  2LF8 A;  2IP2 A;  1I3A A;  2HXI A;  2XPV A;  1MSE C;  1RZ4 A;  3V8L A;  1OQY A;  5F0H A;  2A3S A;  2NVQ J;  4Q47 A;  1USS A;  2VC1 A;  3KP6 A;  3LA2 A;  3H1C A;  4PSW A;  5L3G A;  1V54 H;  1A04 A;  3V8J A;  1O4X A;  4HZF A;  3L2W A;  2CFX A;  3HUG B;  1IXS B;  1Y8R B;  2K9Q A;  1QBJ A;  4JBA A;  4U7B A;  1AWC A;  1JI8 A;  3LSI A;  3DBH B;  3R0A A;  4U0Y A;  4OOI A;  1U8R A;  4JX4 A;  2CUJ A;  3HSE A;  1KZH A;  3LAP A;  1XGN A;  2IT0 A;  2I8D A;  1G3T A;  2QF7 A;  3HRU A;  1PUF A;  1NH3 A;  4LG3 A;  1V5E A;  4IVN A;  1XPX A;  3K10 A;  1UHM A;  3GTP J;  1R23 A;  5LHG A;  2VAS A;  3DP7 A;  2ADU A;  2Y0S N;  3SEZ A;  2OCC H;  1VI0 A;  1GVD A;  4S05 A;  1UJ8 A;  2LKP A;  1YO5 C;  1QO0 D;  1JGG A;  2UXX A;  2KHM A;  4LIV A;  2K27 A;  3JRG A;  1TNS A;  1FBQ A;  4AYB A;  4EAT A;  5B1A H;  2L7F P;  3JR9 A;  4XLE A;  5BOX A;  5IP9 J;  1ETQ A;  3C2G A;  2QQ9 A;  2KZV A;  2H09 A;  1W36 C;  2KLO A;  3S93 A;  3LSP A;  1YJW I;  1MMG A;  2VIX A;  3ASO H;  3CO7 C;  2ZC2 A;  2TRT A;  2HOA A;  3VSL A;  4B1R A;  3DBR B;  4PSX A;  4HDV A;  1VQ7 I;  3QU6 A;  5LGU A;  2GXB A;  3GFL A;  4PGG A;  1K78 B;  1MMA A;  1MH4 A;  3JSO A;  4NDL A;  4HQE A;  3CCL I;  3EUA A;  2PMZ N;  3EQL F;  1HLV A;  2DMT A;  2F4I A;  4YEL A;  1MJA A;  2O61 A;  3M8E A;  1XN7 A;  4UUS B;  3D5S C;  4NBQ A;  3TL4 X;  1GV2 A;  3V4G A;  2MLK A;  1K83 J;  4MTD A;  1PUF B;  2EIK H;  1KA8 A;  2K40 A;  2L7K A;  1UCR A;  4M3G A;  2EQR A;  2IW5 A;  4I7H A;  2M2E A;  4IXA A;  3OYJ A;  2OU2 A;  5AIQ A;  4AIH A;  1TW2 A;  2LNB A;  2DFE A;  1MMS A;  4RGX A;  5DUK A;  1QGP A;  4IZZ A;  1Y6I A;  1V5G A;  2DA7 A;  4UB8 C;  1PP8 F;  3G1L A;  2P6S A;  1Z05 A;  3ZQH A;  1QHG A;  4RAF A;  4RDU A;  1FNN A;  2EK5 A;  5TIS C;  3G6E I;  5M3F J;  1Z9C A;  3JSP A;  3S14 J;  2QUF A;  2V26 A;  3BTL A;  2EJR A;  3BR5 A;  2M0M A;  4RAZ A;  3A02 A;  4BJ5 C;  2L9V A;  3UNG C;  4YFX F;  3EUH A;  1RET A;  2AQE A;  4D9J A;  1XS9 A;  2VE8 A;  5E3L A;  2HQR A;  1IXC A;  2VJ4 A;  3DEW A;  3BQZ A;  5CVR A;  1I1S A;  2P5K A;  2A68 F;  2KT0 A;  1MW7 A;  3IP4 B;  2Y2Z A;  1F9N A;  5AIP A;  3QQA A;  2QKM B;  2E34 A;  4H0E A;  4B8X A;  1QHH D;  2E71 A;  3CQZ J;  1B9N A;  5FJ8 J;  5K5Q A;  1PUE E;  2EFO A;  3G71 I;  3I59 B;  4ASN A;  4HNU A;  1UMQ A;  2X1E A;  2EA4 A;  3ZMU A;  3NAU A;  4N9H A;  5GPA A;  3BJO A;  3F8F A;  1X4O A;  1KGS A;  2DDB A;  1PYV A;  4A12 A;  2VQC A;  2EIJ H;  5J40 A;  3ZMT A;  1CF7 B;  1R5H A;  3MMY B;  1I27 A;  4I02 A;  4CYD A;  5CVV A;  1M1E B;  1DDN A;  2KPM A;  5KNL A;  1BN5 A;  4UVA A;  1B4A A;  4I0A A;  4QTR A;  2R7Z J;  2P0W A;  3P5J A;  3QYF A;  3ZMS A;  2VT2 A;  2OZ6 A;  3HB9 A;  4C3H J;  5IT9 K;  3FKJ A;  3LNQ A;  4XNF A;  2LRE A;  1BJZ A;  1JKQ C;  1HKS A;  1XB4 A;  1WJA A;  4S04 A;  1FX7 A;  1HST A;  4CA0 A;  4XOP A;  5DM7 F;  3D5R C;  3MKL A;  1SFX A;  2M7B A;  3S8P A;  2LDU A;  2E36 A;  2FX0 A;  4Y17 A;  3CUO A;  1MNM C;  3O6B B;  3GW2 A;  4B44 A;  4MQV A;  2ACJ A;  4NNJ A;  2W85 A;  2QVO A;  4EJO A;  5IT3 A;  1K4S A;  1OCC H;  5CQG A;  2F5D A;  2BHY A;  3CCY A;  3COA C;  3G2B A;  3ISP A;  2V6C A;  2JA2 A;  2PBI A;  4O5V A;  2GBY A;  1BI3 A;  2HQA A;  2K3F A;  2VUM J;  4FIS A;  2BEO A;  2AO9 A;  1DQU A;  4Q4Z F;  1RI7 A;  3K4K A;  2R5Y B;  3GZN B;  1ZLJ A;  1IDZ A;  2IS6 A;  4CYC A;  4L18 B;  3RCO A;  1B72 A;  4LGW A;  4CCO A;  4M9X A;  4HRI A;  4E7H A;  4CH7 A;  2M7A A;  3FXM A;  2NOJ B;  4KIS A;  3PJR A;  2ME0 A;  3OYL A;  1FBS A;  2L2O A;  3PUB A;  1X1P A;  2FF4 A;  2ZME B;  2ZSH B;  1F4K A;  1SFK A;  2DOA A;  2DXI A;  1MD0 A;  2HZT A;  5JHU A;  3OYE A;  1S8N A;  4BAC A;  2CV1 A;  2EWN A;  2L3D A;  2MW8 A;  1N25 A;  3Q9V A;  2V9P A;  1K6Y A;  2B7E A;  1B6A A;  4G7Z F;  5DD8 A;  4XLF A;  5BNG A;  3SXY A;  1T38 A;  2JZY A;  3PSF A;  3R6S A;  4XID A;  2G0E A;  3OWT A;  2R5Z B;  2CQK A;  2HZD A;  2P81 A;  1IRF A;  3M8F A;  5CQE A;  4ZTF A;  3PM1 A;  2Z5U A;  4CGZ A;  4KIF A;  4HNT A;  1E3H A;  1U5T A;  4AYB N;  3TBI A;  1WI3 A;  2WWY A;  2V1U A;  3TOA A;  3CJQ B;  1NG7 A;  1MZB A;  2DCE A;  1OCP A;  3A0H C;  1ON2 A;  4E7Z A;  3QPS A;  3TDZ C;  1DGW Y;  3AG3 H;  4PJJ A;  2K9L A;  4JQF A;  4X1E A;  2ID6 A;  3GWZ A;  1IZ1 A;  5FKM A;  2KJB A;  4WXC A;  3IV5 A;  2V6E A;  2DI3 A;  2WAD A;  3QPL A;  4JP0 A;  2HFH A;  1B9M A;  4R1H A;  4Y52 J;  2CQQ A;  3HJE A;  2R7S A;  4L9N A;  2JA8 J;  1J59 A;  2M87 A;  1PJR A;  3KE2 A;  2JSP A;  3CCE I;  1ORK A;  2GA2 A;  1FP2 A;  2BYV E;  3OS2 A;  5JHF A;  3PNV A;  4ZDO A;  2O3F A;  2LY1 A;  1F5T A;  4C2U A;  4U0V A;  2RAE A;  2Q8K A;  3L2R A;  4XKB A;  2ID3 A;  2BZT A;  1W7P D;  3ERM A;  3F6O A;  1X1B A;  2JUC A;  5CVU A;  2QZ8 A;  3R4K A;  3CCU I;  5F0F A;  2PQ8 A;  4MGR A;  2E1N A;  2VXD A;  5E3O A;  2HWV A;  1JJ6 C;  5TJJ A;  2KRC A;  5DTD A;  5J4V A;  1XG1 A;  4G6T B;  3DXJ F;  2VC0 A;  2EZK A;  2RKH A;  1JGS A;  4QSH A;  1HW5 A;  2KRF A;  5HLH A;  3E0J B;  2MH9 A;  2ISY A;  4XRM A;  3O8H A;  1X2N A;  1WJC A;  3TKY A;  2DMP A;  2JRM A;  4ABZ A;  4IX7 A;  2EPF A;  2XRL A;  3ABL H;  3HOY J;  1UFM A;  3CCJ I;  3H92 A;  3RSN A;  2DFH A;  3W6V A;  1QNT A;  1KU9 A;  3P7N A;  2XAH A;  1Z67 A;  2LC2 A;  2J5P A;  4DGW B;  3RPQ A;  1MDM A;  2LKX A;  2ZXI A;  4NC7 A;  1Y8Q B;  4UUS A;  3WTT C;  2MD5 A;  4M6Y A;  1ZRD A;  3BJ6 A;  1ETY A;  3HEF A;  3K70 C;  4R79 A;  1TWC J;  3FXL A;  3OYD A;  5LGT A;  1I50 J;  1OR7 C;  3RDI A;  2E60 A;  5IPA A;  1LFU P;  3DKX A;  3W2A A;  4A6E A;  3A0B C;  2X0L A;  4BHP A;  4X0G A;  5KHD A;  4EVI A;  2ZJ2 A;  3J7Y J;  5TGT A;  4HYE A;  1FT9 A;  2B63 J;  3JRF A;  2EIN H;  1VF9 A;  2QM3 A;  5ED4 A;  1V4R A;  3K7A J;  3FXO A;  4NC6 A;  1FY7 A;  4DZJ A;  5DCF A;  3GVA A;  2D1H A;  4PUS A;  2O6G E;  3F21 A;  1U8B A;  1U0J A;  1AKH B;  3KP2 A;  4XRS A;  4LB5 A;  2LBF A;  4M6X A;  3QWL A;  3QPT A;  2WAE A;  3ROU A;  3OIO A;  2BXZ A;  3FBI B;  1KON A;  2VQG A;  2KP6 A;  1XCV A;  3R61 A;  5D5X B;  3HOW J;  4KA4 A;  4BAY A;  2FOK A;  4ZYA A;  2ZJP F;  2HPI A;  2DA5 A;  3CTA A;  1P6R A;  1W36 D;  1A5J A;  3IWF A;  5KK1 A;  2K4B A;  4BS9 A;  4JOM A;  4MEX F;  1ERD A;  5E20 A;  4DYR A;  1D1C A;  3B02 A;  1U3E M;  2KIF A;  2UWM A;  2EIM H;  3IH3 A;  4UUV A;  4EGZ A;  3D0S A;  2R3S A;  3IAS 2;  4PJL A;  1BJA A;  2N8G A;  3CDI A;  3RZD J;  2P8T A;  2J5O A;  5JVG F;  1IO2 A;  3P9C A;  5L3D A;  3FKI J;  4RBO A;  4A3J J;  1LFP A;  2RNJ A;  2LMD A;  2DO7 A;  3AKZ A;  3SZG A;  3QU3 A;  1FMW A;  2DFF A;  2VB6 A;  2ZB9 A;  1QA6 A;  2DU9 A;  3VEP A;  4YIF A;  3UKG A;  1SAU A;  3FX3 A;  2KL4 A;  2LSO A;  3L2U A;  1BR2 A;  4C3I J;  1HKQ A;  1TT5 B;  2P4W A;  2AS5 F;  1GV5 A;  3LSH A;  4CHU A;  2FML A;  4P1W A;  3C2H A;  3HGG A;  3E6B A;  3LOC A;  3QOD A;  2R7V A;  3KCC A;  4BQO A;  3F8M A;  2IA0 A;  4PZJ A;  5HNF A;  1K61 A;  3L09 A;  1JXS A;  3RTR A;  1WJ5 A;  1KQ8 A;  2IEK A;  2M8G X;  4HOB A;  2R7R A;  2K9M A;  4A3I J;  4UY8 I;  2HYG D;  1V3F A;  3HDD A;  1TBX A;  3EYY A;  3H0G J;  3DU5 A;  2VQL A;  5FLX Z;  2VE9 A;  1XTA A;  5BS6 A;  2ETH A;  4E7K A;  1EKE A;  3I9V 2;  1U9O A;  2MD0 A;  5IYD J;  1FC3 A;  1D5Y A;  1OLT A;  4E7L A;  5JFR A;  1SD4 A;  4E6K G;  1YYV A;  3RJP A;  3ELK A;  3MWM A;  3L7W A;  2L54 A;  1QVT A;  4C2M J;  2VPL A;  1HW1 A;  1ONV A;  2K85 A;  4XKV A;  3TW7 A;  4ESJ A;  1U5T B;  4KN4 X;  5FD5 A;  3RI4 A;  1WKM A;  2EIL H;  4LFU A;  4QPO A;  3ZN0 A;  2OQG A;  2VJJ A;  1BOB A;  2FE3 A;  2ELJ A;  4A69 C;  2E35 A;  4A2U A;  1IG7 A;  3F0C A;  1G3Y A;  2VKV A;  4YEJ A;  3TP3 A;  5HNH A;  1ZN2 A;  2M4K A;  2L02 A;  1IW7 F;  4QPQ A;  4MIM A;  3I59 A;  2R7T A;  4X6A J;  1ZH5 A;  1F1Z A;  3HRS A;  3JRB A;  4UUT A;  5L3B A;  1BC8 C;  1XMA A;  1LNW A;  5DUI A;  1JTY A;  2RQQ A;  1HA8 A;  4L5J A;  2X51 A;  5F64 A;  2WAQ N;  3MZH A;  1AKH A;  4O6J A;  2CW7 A;  1FBU A;  3H3U A;  1LE8 A;  1IRX A;  2HDD A;  1BIB A;  4BGD A;  3CP2 A;  2E5N A;  2DT7 B;  3RYR A;  2HPM A;  4HAM A;  4XSX F;  2VOP A;  2FSW A;  2NNN A;  3G1M A;  3ZN1 A;  5EEG A;  1R4N B;  3ERE D;  1B72 B;  1OCT C;  1W1W E;  3LFU A;  2VXZ A;  4NC8 A;  3CCQ I;  2M45 A;  3T8T A;  4BE2 A;  2F5V A;  4UB6 C;  1FTZ A;  1OCR H;  3EYI A;  2CS3 A;  4WX9 A;  1D8K A;  1JTX A;  4RLQ A;  4YFN F;  2NXN B;  5E8I A;  3IH4 A;  5EYR A;  4M3E A;  1SAN A;  1FYK A;  1R1T A;  1SD6 A;  1R7J A;  3G3Z A;  4E7I A;  4IRH A;  1SD7 A;  3F22 A;  2BXY A;  1LDJ A;  1RPW A;  3BTC A;  2F5F A;  2V1X A;  2NYX A;  1JT6 A;  2W1O A;  2HXO A;  5JR3 A;  1N77 A;  3CLQ A;  2Y30 A;  2LD5 A;  1LVK A;  1R71 A;  3OY9 A;  4E70 A;  1VQ5 I;  2KJC A;  1XDS A;  2ZFW A;  3Q0U A;  3OYF A;  1XGO A;  4ZZL A;  1R49 A;  3HTS B;  2A6T A;  5DS9 A;  2G7U A;  4C2T A;  3IUO A;  3DQV C;  1P7J A;  3PFI A;  4JX5 A;  3OOP A;  3E7L A;  3K2Z A;  2KDZ A;  1U6G A;  2ZSI B;  5A2Q K;  1T0F A;  4JYK A;  1BM9 A;  3G73 A;  3I0T A;  1KYZ A;  1IV8 A;  1OYW A;  4FX4 A;  3CF5 F;  2E2H J;  9ANT A;  4RB2 C;  4PCQ A;  4DZP A;  3J7Z I;  1ACI A;  2X6W A;  2X6Y A;  2FNP A;  2CRG A;  1J7K A;  2O5R A;  4AM3 A;  4IO9 F;  1K78 A;  1XCB A;  4GXO A;  4ZZD A;  3KPH A;  2E2I J;  3WGG A;  4EJW A;  1FOW A;  4LG0 B;  1FIP A;  3IKV A;  3M1C A;  4LK0 F;  3SFZ A;  1DGR M;  3ML6 A;  2R5Z A;  2O0Y A;  4LG0 A;  4XN3 A;  3DF8 A;  3TGN A;  3BLY A;  3WTZ A;  2X85 A;  2CQX A;  1QPM A;  3FMQ A;  1ZTR A;  4KNY A;  2H8R A;  2L0K A;  4MHG A;  4LLN A;  3V7S A;  2DN0 A;  2QLZ A;  4Y3O A;  1TNT A;  1JUS A;  4RAG A;  2QA4 I;  3BPX A;  2CH0 A;  2IBD A;  1FZP B;  3CZ6 A;  3AG1 H;  3HC7 A;  1VQ6 I;  2X1C A;  1JUP A;  4J19 A;  2GQQ A;  1FJL A;  4G7O F;  4L9T A;  5K7F A;  3HZJ A;  1T6S A;  4XKC A;  4BL0 B;  1WCM J;  1GXQ A;  4JK1 X;  1I39 A;  4RM3 A;  3S3M A;  3GTM J;  1RNL A;  3W6J B;  3K4N A;  3PNY A;  1BI1 A;  1ETO A;  3PNT A;  3VYS B;  3I4M J;  2PJR B;  1DPR A;  1UEL B;  2QEX I;  2DQL A;  1GLN A;  3M4O J;  2JN6 A;  4ZYE A;  1UAA A;  1DPU A;  1MMN A;  4MO7 A;  1YS7 A;  3GXO A;  4BBS J;  1N75 A;  2HKX A;  2YSR A;  4RGU A;  1OPC A;  2V9V A;  2LY2 A;  3GFI A;  1GUU A;  5JLX A;  1K7A A;  2L9N A;  4OWR B;  5D6E A;  2GAU A;  3RKW A;  2MC4 A;  3C2B A;  4Y7N J;  3WU0 A;  3ZMZ A;  3WU2 C;  4Y13 A;  1JJ8 C;  3GFJ A;  4E4H A;  4AVP A;  1IGN A;  3U2R A;  1E3P A;  3H9Q A;  2ZME A;  1G2H A;  3FM3 A;  2DK8 A;  3HPG A;  1H9G A;  2D45 A;  1U78 A;  3TDU C;  2KDO A;  3D1N I;  3VOD A;  3BPV A;  2M30 A;  4A5M A;  3RKY A;  2JPC A;  1YS6 A;  4ZDP A;  5K5O A;  2IS4 A;  1MJB A;  3PQJ A;  2VL8 A;  4GYI A;  1WJD A;  4ETS A;  1FOY A;  4KIB A;  5FFZ A;  3FF5 A;  4F52 A;  2LKS A;  3A03 A;  2ELK A;  2E5Z A;  2EZH A;  3VWB A;  4PFO A;  1X1A A;  3F23 A;  2W25 A;  3KP7 A;  1NK2 P;  2GWR A;  1UHS A;  4N4N B;  5HLT A;  4GDF A;  5FLV A;  2Z9O A;  2M9H A;  2CO5 A;  5E3N A;  3K1N A;  1Q1H A;  3CME I;  3EUK L;  2HEO A;  2VON A;  3LST A;  1WRJ A;  1IN5 A;  5F27 A;  3FMS A;  5ICF A;  1N78 A;  3IAM 2;  4BQQ A;  3HHH A;  5LEK A;  1E0E A;  3W3C A;  2ZJR F;  4AID A;  1ZG3 A;  5GAD J;  3S16 J;  3C3W A;  4U7D A;  3OL4 A;  2NVY J;  2HOE A;  3BJA A;  1LKX A;  2YR2 A;  2OTJ I;  4IHW A;  4DOZ A;  1MGT A;  5J1Y A;  2IS2 A;  1SD5 A;  3H35 A;  4Y15 A;  3W2V A;  5IY5 H;  5CKT A;  2WBM A;  4AD9 A;  3OR1 C;  2DBB A;  4IRI A;  3DEU A;  3FXR A;  4DBR A;  3I64 A;  3HSR A;  3LSJ A;  2A6H F;  4BU2 A;  4BYY A;  1MMD A;  2LLK A;  5HS9 A;  3HM5 A;  1OR7 A;  4A3E J;  4RS8 A;  4ENJ A;  4TV7 A;  1WPK A;  4HLY A;  3MEX A;  2K9N A;  1FIA A;  1VND A;  3GFM A;  4EJT A;  3KP3 A;  3DEE A;  2OZU A;  1SFO J;  3T5X A;  5LEJ A;  3QOP A;  3MD2 A;  1ZGJ A;  1YI2 I;  4LJZ F;  3JCU C;  2DT6 A;  3FWE A;  1GHC A;  3TO6 A;  4A93 J;  2KZG A;  1YJ9 I;  3MAJ A;  3S2D J;  2CUF A;  5HS7 A;  1IN4 A;  2XAS A;  4HW0 A;  2PI0 A;  4FT8 A;  1IN6 A;  2XPU A;  3RKQ A;  3HOZ J;  2Z3Y A;  3RYP A;  2F48 A;  4G94 A;  3CMY A;  1HBX G;  4C9Y A;  4CCK A;  2DDA A;  4FQG A;  4O3M A;  2VKH A;  2JT1 A;  5J8C A;  5FKN A;  1TWA J;  4KIT B;  2XIG A;  1Z91 A;  3R60 A;  4BEH A;  3NAR A;  5L3C A;  2RGV A;  4B48 A;  1ZLK A;  1K6O A;  2OQR A;  5LRS A;  4EM0 B;  2HOT A;  1Y1V J;  1FLI A;  1Z7U A;  3LL7 A;  4M73 A;  5EJC A;  1QZZ A;  3Q0V A;  4IPA A;  3OIQ A;  1MBF A;  3HYI A;  1H0M A;  5AON A;  2H27 A;  3GTK J;  3ULQ B;  2A61 A;  3HL2 A;  4ZYH A;  1C0W A;  4KDP A;  3FIS A;  3BR6 A;  3K4L A;  1ZHF A;  2IXS A;  4YII A;  3H0D A;  2EBI A;  3B6A A;  3CJN A;  4CCN A;  2STT A;  5C4J J;  3DTK A;  2M1B A;  4IKF A;  5EEH A;  4RB3 C;  1RRJ A;  4GRI A;  1VQ9 I;  3DLL F;  1Z7L A;  2FMY A;  1O3R A;  1IF1 A;  2JK3 A;  4Z6Y A;  4D1Q A;  2V9K A;  4B43 A;  3F72 A;  1R5G A;  2WY7 Q;  3C7J A;  3OYN A;  2LR8 A;  1ZR2 A;  1VZ0 A;  4N4O B;  2AQF A;  1HKT A;  5DM6 F;  1TQI A;  3LSM A;  3I54 A;  2DJN A;  1H88 C;  2BY3 A;  5FO5 A;  4MNU A;  4F92 B;  3HOX J;  1P2F A;  1FTT A;  5FLM J;  2GOX B;  1BA5 A;  3MKZ A;  3OS1 A;  2E1O A;  1H89 C;  4F3Q A;  1LUJ B;  3AG2 H;  1UZC A;  3RQI A;  2KKO A;  4A0Z A;  3CCS I;  1BR1 A;  2BY0 A;  4BHC A;  1T2K A;  2KQR A;  1BW5 A;  3LSG A;  5H6Q A;  3EPZ A;  1W7P B;  2X48 A;  3Q9S A;  1I6X A;  1OJL A;  4NUB A;  4WCG A;  1X19 A;  1OYI A;  2RV8 A;  1FYM A;  3DPL C;  4ITV A;  2CYY A;  5FD6 A;  2HQN A;  2FBH A;  3E5X A;  4II3 A;  4LLG F;  2Q2E B;  1YE9 A;  1MBH A;  4YRV A;  2IPQ X;  3H36 A;  2WA0 A;  2GOM A;  3BR2 A;  1OKR A;  3JRI A;  3KZZ A;  3G1O A;  1TZL A;  3DU6 A;  1P9Q C;  2R7F A;  3M8J A;  2AXL A;  2JRT A;  4FX0 A;  3ZP5 A;  5J6X A;  4U87 A;  4EM1 A;  5HDN A;  4LMY A;  2LTP A;  2FNA A;  4F7Z A;  3K1P A;  2ZJQ F;  2VOO A;  3GZ6 A;  1BC7 C;  2Y48 A;  3GX4 X;  5L3E A;  2XF6 A;  1G6N A;  3UR3 C;  5GAG J;  4BJT A;  1O7L A;  3EET A;  3KYC B;  3F8C A;  3GTJ J;  2OTL I;  2CU7 A;  1TL8 A;  1OCZ H;  4UNO A;  1KU3 A;  3AFH A;  5J47 A;  2XDV A;  5M5Y J;  4E7J A;  1IC8 A;  4W97 A;  4ZYG A;  3L2Q A;  3S1M J;  4IF4 A;  2DQR A;  2RQP A;  3WTY C;  1ZGA A;  4BBR J;  4XMY A;  1I1G A;  2F4M B;  2OPT A;  3KYL A;  4HX4 A;  2ZO4 A;  4XL9 A;  4OIP F;  3T1B A;  2NS8 A;  2XUB A;  4MQ9 F;  1IV6 A;  1S7O A;  1Z3X A;  1R4M B;  5IYC J;  3BDD A;  4BY7 J;  3E5Q A;  5DCM B;  4MEY F;  1FYL A;  2L7Z A;  4FET A;  2VQH A;  3BR3 A;  4V2G A;  4MFD A;  1B1B A;  4M3B A;  2UV1 A;  2HKO A;  4XRF A;  3KFW X;  3OYG A;  1Z3Y A;  5KCM A;  2XSD C;  2NVU B;  4ZJZ A;  4ZYD A;  1B8I A;  2ESN A;  4KUM A;  2Z16 A;  5D8K B;  3U21 A;  3G4S I;  4KN7 X;  1YLF A;  3U1K A;  1W5S A;  3ECH A;  2JTV A;  2BVL A;  4UVB A;  1QZY A;  4Z2Y A;  3M9A A;  2KRH A;  2XAF A;  1S7A A;  5D4R A;  2H6C A;  3WG7 H;  3H9G A;  3WHC A;  5K7H A;  3A01 A;  3S1Q J;  1TQM A;  3HG9 A;  3I3L A;  5HOD A;  2HYF A;  2XGE A;  1JKO C;  3TQN A;  3ZMD A;  3WHB A;  2LF7 A;  2LFB A;  3GLL A;  3SYT A;  3ZCO A;  1H8A C;  1MDM B;  1UB9 A;  2JUG A;  1IRG A;  1FOX A;  5BPI A;  2DA1 A;  2XB0 X;  4IHS A;  3ZQC A;  2WV1 A;  3HHG A;  5B5E C;  1ETW A;  2MSY A;  4P96 A;  2ELH A;  5FFX A;  3F9K A;  2WTE A;  2YX7 A;  3ONQ A;  2FXA A;  2LYC A;  1YW7 A;  2E1M C;  4CYC B;  2NOG A;  4M3F A;  4HQM A;  2QYO A;  1STZ A;  2H94 A;  3S1R J;  2ZNZ A;  2B0L A;  2VJI A;  4GYG A;  1WH7 A;  3I53 A;  4UV9 A;  3IKT A;  3VDX A;  4HDU A;  4KMF A;  2PJP A;  2M5W A;  1IUY A;  3I71 A;  3ABK H;  3FXU A;  4XN0 A;  4AUX A;  2W7N A;  2Z33 A;  3WTS C;  1JHF A;  5BMZ A;  1WWX A;  4OAZ A;  2XAJ A;  3MKY B;  2W57 A;  1K79 A;  1AU7 A;  1K4T A;  2QKL B;  2VBW A;  3PO3 J;  1D0X A;  3RKX A;  3A2K A;  1O3Q A;  1ZRF A;  3V7R A;  2WAQ A;  4EGY A;  2COB A;  1D5V A;  4OMY A;  4KIC A;  1MBJ A;  1A36 A;  4WXH A;  4IL6 C;  2FQ3 A;  5HOO A;  5IP7 J;  3CD6 I;  4M9S A;  1T39 A;  3VFZ A;  2DOF A;  2MFZ A;  5CYV A;  3S2H J;  1QQI A;  3LA7 A;  5D6F A;  3L1P A;  2VKE A;  2GXG A;  1RKW A;  3CJR B;  2P5L C;  2LG4 A;  1H9T A;  2EFP A;  2OCE A;  3K4C A;  2W24 A;  1ODD A;  4K2E A;  1ZGW A;  2CSO A;  4RGR A;  2ZME C;  1Y0U A;  1XDU A;  4J01 A;  1CF7 A;  1POG A;  2DW4 A;  3WE3 A;  5K7Z A;  3ZXS A;  1G4D A;  1ENH A;  3OIP A;  3BG3 A;  4II2 A;  1FSE A;  2CQ7 A;  1J5Y A;  3AG4 H;  3WOD F;  3K4M A;  2FEZ A;  1WI9 A;  3WTU C;  2H6B A;  1J09 A;  4PDK A;  5CJ9 A;  3I56 I;  4M9Z A;  1BI0 A;  3CDH A;  2ECC A;  2X6O A;  2P7V B;  5GTH C;  2PJR A;  3IWZ A;  3MFK A;  2OA4 A;  4FCY A;  1Y56 A;  1VFC A;  2Y0M A;  4IRG A;  2K4J A;  1S5L C;  2K9S A;  5EZH A;  1BIA A;  1VTN C;  3GBG A;  1KU2 A;  1FPQ A;  1A6Q A;  4M72 A;  3ZQQ A;  2ZXW H;  5D4S A;  1JE8 A;  1MKM A;  3RZO J;  3MN2 A;  3PQK A;  1JHH A;  3SFI A;  2K02 A;  4EMS A;  4BJ6 C;  1RUO A;  2XAQ A;  2EB7 A;  3HGY A;  3QOE A;  3RQ4 A;  3GUD A;  3I58 A;  3BG9 A;  4ANJ A;  4UVC A;  4DIQ A;  3AL0 C;  1HOM A;  2KIM A;  2JJ7 A;  1FEX A;  3K69 A;  1LDK B;  3BP8 A;  1EH7 A;  2XSJ C;  4XIC A;  1FOK A;  1Z6T A;  4L0Z B;  2KIU A;  1ETX A;  3E6M A;  3MCZ A;  2VT3 A;  4IQJ A;  2IA2 A;  2VI6 A;  3BG6 A;  2KIQ A;  2EH3 A;  2K5C A;  5IYB J;  4HF2 A;  1EF4 A;  3CF2 A;  5L3F A;  1JKR C;  4P5O A;  1ZR4 A;  3A1Y A;  1DP3 A;  4XLH A;  5DCM A;  5KAI C;  5M3M J;  3LQR A;  1HW2 A;  4WK8 F;  4DNC A;  4I2O A;  2JMW A;  3T0Y A;  2Z2S B;  1TP4 A;  2CW8 A;  4AIK A;  4L9J A;  3KIO A;  1V55 H;  1HDD C;  2O8X A;  3D5L A;  4P9F A;  3OR2 C;  1IRZ A;  2A07 F;  1AA7 A;  5D5U B;  4EJV A;  1YRN A;  4BUP A;  5HDG A;  4BE0 A;  2IVM A;  1L3L A;  3L9F A;  4HX7 A;  1J2X A;  2NRA C;  2DA3 A;  2LRD A;  2VLA A;  3N05 A;  3ZRG A;  3I5U A;  1SFE A;  2K86 A;  5LGN A;  2CW0 F;  3SQN A;  5H20 A;  3RPU D;  3CC2 I;  2IA1 A;  2QEN A;  4A0Y A;  3ASN H;  4P9U A;  1IAW A;  4ZH4 F;  5K5R A;  1HF0 A;  4DQ2 A;  5EEA A;  4XKW A;  4I09 A;  2CMP A;  2FBI A;  4I76 A;  5BPD A;  1YIT I;  4Q5S F;  5JLW A;  3WTV C;  2QWW A;  5E1Z B;  2DYR H;  2UUZ A;  2OUM A;  4DBQ A;  1SFU A;  2Z1D A;  3HOV J;  4HF0 A;  2M0C A;  2EZI A;  1ZKG A;  4ESB A;  2JWT A;  2Z99 A;  5D5V B;  1JT0 A;  3PIP F;  2HOS A;  2BW3 B;  1EV7 A;  2XAG A;  5LLQ A;  4EEF G;  2A5Y B;  2WY8 Q;  4WF2 A;  1LQ1 A;  4EQQ A;  2A69 F;  5B66 C;  1QRY A;  1TTY A;  3N97 A;  1R22 A;  2M3A A;  3JTG A;  2PG4 A;  2DTZ A;  1T56 A;  1R00 A;  3MQ0 A;  3GZ5 A;  1XC5 A;  2HI3 A;  2E1C A;  3B6C A;  1W4M A;  2K7L A;  1TLH B;  3ZQI A;  3QPH A;  4MLO A;  3REO A;  2ZCW A;  2FD5 A;  1ZQ3 P;  2QSG X;  3E3V A;  5CPR B;  3SHF A;  4F91 B;  2YPR A;  3GTL J;  4L5I A;  1YG2 A;  2E7W A;  1XSD A;  2H1K A;  4BQN A;  2CJJ A;  3VYT B;  1UHW A;  2DTR A;  1XSX A;  2BY1 A;  2EFQ A;  1TWH J;  3NRV A;  4PFP A;  2CFO A;  1NTC A;  2V1N A;  1RC9 A;  4XK4 A;  4AVZ A;  4S0H B;  1U2W A;  4XLP F;  4Q48 A;  3MKW B;  3FIW A;  3MVP A;  3PL8 A;  2E7X A;  2STW A;  4BDY A;  1WFX A;  4KT5 C;  2FU4 A;  2OJE D;  2LY9 A;  1G3W A;  3S32 A;  5LD2 C;  3LSK A;  4I0B A;  3JRC A;  3OYC A;  1GT0 C;  2DPD A;  4BQA A;  4A3K J;  3K6G A;  3IRR A;  4XLN F;  4XOT A;  1WZ2 A;  1AOY A;  4U88 A;  2FA5 A;  2CV2 A;  2BGC A;  3LA3 A;  4F93 B;  2QBY A;  5HLG A;  3HOU J;  5IT9 Z;  2FRH A;  2UXN A;  3S15 J;  2A6E F;  1IDY A;  4GO1 A;  5C4X J;  5A2Q Z;  3JAM K;  4RB1 A;  4YG2 F;  1BI2 A;  2OBP A;  3TW6 A;  5HVQ C;  3PIO F;  5F0C A;  2ZBK A;  5FB2 A;  2O7O A;  3CES A;  2NVX J;  2CG4 A;  3CC7 I;  3P9I A;  1PVE A;  1YX5 A;  2FJ1 A;  2L4A A;  4XM3 A;  2IS1 A;  1U9N A;  2OC6 A;  1YTY A;  1WVR A;  1P7I A;  4G9Y A;  4BE1 A;  3FXJ A;  3HOS A;  5FKL A;  2R93 J;  3OV8 A;  2XHK A;  3BY6 A;  3CUQ A;  3SJM A;  1XD7 A;  3CUQ C;  3KEO A;  2MBF A;  4U0W A;  3HRT A;  4EJU A;  1WJF A;  4GCV A;  3ABT A;  5K1Y A;  3IRQ A;  4IQ4 A;  3VSK A;  1R5I D;  3CO6 C;  4EM2 A;  1S3J A;  5ILV A;  2HYJ A;  4HA8 A;  2R92 J;  1G8X A;  3DKY A;  1UG2 A;  4DYQ A;  3DCF A;  3OYB A;  1HDP A;  5ERI A;  3RIR A;  2V4J C;  3L2C A;  4BY1 J;  1FWZ A;  2EV0 A;  2AHQ A;  1OMI A;  1V5F A;  5H2F C;  2VN2 A;  1MND A;  5D5W B;  2DPU A;  2HDC A;  3W2W A;  3J7A Y;  2R7X A;  3ABU A;  2HVQ A;  1T33 A;  2PLY A;  3GO5 A;  2BVM A;  4OMZ A;  3TP0 A;  3KLO A;  2W82 A;  4D0P A;  2MC3 A;  5CVI A;  3DWL E;  2HR3 A;  3NWT A;  4G6D A;  4NQW B;  4MTE A;  2R5Y A;  3LWF A;  4BXX J;  4A3L J;  2COM A;  1O3T A;  2F4O B;  4UHT A;  2BHZ A;  2KIS A;  5FRM A;  4GFB A;  4RB0 A;  4B3X A;  2HU9 A;  3TO7 A;  4BEH B;  3H3V K;  5EG0 A;  3JRA A;  2Y0S A;  2EFW A;  2EFN A;  5J8F A;  3F8B A;  4CXF A;  2F6C A;  3HIF A;  1OCO H;  2VKD A;  2DJI A;  1MIJ A;  1ZAO A;  4A3M J;  1J9I A;  3K9T A;  2HVS A;  1MBG A;  4CZZ A;  5B3S H;  3KX2 A;  2V7F A;  3FK7 A;  2TCT A;  3IH2 A;  4XRS G;  1VQK I;  1I3Q J;  1IN7 A;  2A5W A;  2LK2 A;  2W84 A;  5LRR A;  3C18 A;  3P9K A;  1RES A;  4NB5 A;  4A3B J;  5DYM A;  2KFD A;  2NS0 A;  1YHQ I;  3CCM I;  1VQN I;  4CCJ A;  1VQO I;  3OYI A;  2XC7 A;  4HLX A;  1ITY A;  3W6K B;  2L7M P;  1P4X A;  2OV7 A;  3QYE A;  5B1B H;  2YS9 A;  2BV6 A;  2FBK A;  5C3E J;  2FQ4 A;  2JVH A;  4I98 B;  4KIG A;  1T95 A;  1BBY A;  4CZC A;  1FMV A;  2WC2 A;  3LSR A;  1WJB A;  1IXR C;  4HX8 A;  2D2W A;  4Y33 A;  2CGP A;  1IN8 A;  1BW6 A;  3BQY A;  2RDP A;  4A6D A;  5GTI C;  3J80 Z;  1SMY F;  3RPU A;  3GLX A;  3WU1 B;  3BOQ A;  4B47 A;  1R36 A;  1LDD A;  1E2X A;  3K2A A;  2XVC A;  4LIT A;  4UXN A;  3SZP A;  4AWX B;  2WB1 N;  4EV0 A;  4CO8 A;  3ESW B;  1E3O C;  1I5Z A;  2ISZ A;  1Z77 A;  2DMQ A;  3WG9 A;  2W00 A; 
#chains in the Genus database with same CATH homology
 4BJT A;  4XLA A;  4C30 A;  4HST A;  4BQO A;  1ZEL A;  3AFH A;  5HNF A;  2XDV A;  4E7J A;  2WAF A;  3L2Q A;  3RTR A;  1WJ5 A;  2ZXH A;  5LFA A;  2HDW A;  2R7R A;  2K9M A;  2XF7 A;  4XMY A;  5FRO A;  3KEY A;  2XF5 A;  3DU5 A;  2VQL A;  3KYL A;  4E7K A;  3I9V 2;  2L5Q A;  2MD0 A;  4XL9 A;  4HG2 A;  3PSI A;  1OLT A;  4E7L A;  4E6K G;  1Z3X A;  4CUG A;  1S9H A;  2BW3 A;  3L2V A;  4PSW A;  4ZC3 A;  2VPL A;  4FET A;  2VQH A;  4XKV A;  3L2W A;  3HUG B;  4FAS D;  2UV1 A;  4CSW A;  4U7B A;  1Z3Y A;  5KCM A;  3OYG A;  1JI8 A;  3LSI A;  4QPO A;  4ZJZ A;  2CUZ A;  2VJJ A;  1MNE A;  1BOB A;  3K4B A;  2CUJ A;  2Z16 A;  4HSR A;  2ELJ A;  2LH9 A;  2I8D A;  3U21 A;  1NG6 A;  4LG3 A;  4F55 A;  4XOR A;  1V5E A;  4YEJ A;  2BVL A;  5HNH A;  2M4K A;  3K10 A;  3DLA A;  2FUG 2;  4QPQ A;  4XLC A;  1R6R A;  2KRH A;  3H9G A;  4J00 A;  2R7T A;  2VAS A;  3HG9 A;  3I3L A;  3SEZ A;  2IGN A;  3V42 A;  3SYT A;  2RQQ A;  1X1D A;  4KJZ A;  3ZCO A;  1HA8 A;  2X51 A;  4LIV A;  2KHM A;  2CW7 A;  4AU7 A;  2JUG A;  1IRX A;  4AYB A;  4EAT A;  1D0Y A;  4BGD A;  3CP2 A;  4XLE A;  2E5N A;  2DT7 B;  2HPM A;  3F9K A;  3C2G A;  2KZV A;  3ONQ A;  2ZFU A;  1W36 C;  2LYC A;  2KLO A;  4H4K C;  4OAY A;  3S93 A;  1MMG A;  2E1M C;  2VXZ A;  2VIX A;  3LFU A;  4NC8 A;  4HPQ A;  4BE2 A;  2F5V A;  2CS3 A;  2VJI A;  4RLQ A;  3VSL A;  4PSX A;  3VDX A;  1MMA A;  4XN0 A;  3EUA A;  2W7N A;  4E7I A;  2F4I A;  4YEL A;  4OAZ A;  3MKY B;  3D5S C;  3TL4 X;  2QKL B;  1D0X A;  3A2K A;  2W1O A;  2WAQ A;  1N77 A;  3K4J A;  1LVK A;  3OY9 A;  5HOO A;  2L7K A;  3OYF A;  3H9J A;  2A6T A;  2MFZ A;  3OS0 A;  4C2T A;  3IUO A;  3OYJ A;  3DQV C;  2PMZ A;  1G59 A;  2ZSI B;  3CJR B;  2LG4 A;  3K4C A;  1D0Z A;  4IZZ A;  1Y6I A;  4J01 A;  1V5G A;  3ZXS A;  1QHG A;  4BDZ A;  3S3N A;  3AL0 B;  3OIP A;  4II2 A;  2V26 A;  2M0M A;  3K4M A;  2X6W A;  2X6Y A;  4BJ5 C;  2R7V A;  3EUH C;  3UNG C;  1J09 A;  2AQE A;  2O5R A;  2PJR A;  4D9J A;  4PJM A;  4PK4 A;  1Y56 A;  3H5N A;  2VJ4 A;  3M1C A;  3IP4 B;  1MW7 A;  3GBG A;  1DGR M;  2QKM B;  4XN3 A;  3ZQQ A;  1WJE A;  3BLY A;  2IGK A;  1QHH D;  2X85 A;  3ZGK A;  4BJ6 C;  2X6X A;  3LMM A;  3QOE A;  3RQ4 A;  4HNU A;  4Y3O A;  2X1E A;  2HNH A;  4ANJ A;  2K3P A;  4HEA 2;  1X4O A;  2CH0 A;  4DIQ A;  3AL0 C;  1PYV A;  3CZ6 A;  4RMN A;  3HC7 A;  2VQC A;  1LDK B;  2X1C A;  2XSJ C;  3SDB A;  3MMY B;  3DPT A;  1Z21 A;  2KPM A;  3VYR B;  5KNL A;  4IQJ A;  4XKC A;  3BG6 A;  4BL0 B;  2P0W A;  2K5C A;  3S3M A;  3QYF A;  4RM3 A;  3K4N A;  3PNY A;  3PNT A;  3OYK A;  3VYS B;  3CF2 A;  2PJR B;  1UEL B;  3FKJ A;  2W4S A;  2X1D A;  4P5O A;  4XNF A;  3SEQ A;  3A1Y A;  2LRE A;  1D1B A;  1DP3 A;  1GLN A;  4XLH A;  1UAA A;  1WJA A;  4CA0 A;  1MMN A;  4XOP A;  3OYA A;  4E7S A;  3D5R C;  1N75 A;  3BCA A;  3HKZ A;  2M7B A;  2E1M B;  3S8P A;  4ZTJ A;  2LY2 A;  2Z2S B;  2L9N A;  4OWR B;  2CW8 A;  4B44 A;  4NNJ A;  2MC4 A;  3FHN A;  5CQG A;  3D5L A;  3OR2 C;  3CMM A;  3VYU B;  4E4H A;  4KT6 A;  1T0F C;  3G2B A;  1AA7 A;  2JA2 A;  3H9Q A;  2HQA A;  4BUP A;  4BE0 A;  3NWS A;  3HPG A;  2LRD A;  1DQU A;  3K4K A;  2VLA A;  2KDO A;  3N05 A;  3ZRG A;  4XR6 A;  4CCL A;  4ZDP A;  3RPU D;  2IS4 A;  2IS6 A;  2VL8 A;  3RCO A;  1WJD A;  2R7Q A;  4CCO A;  4F52 A;  4HRI A;  4E7H A;  2JVG A;  4XKW A;  1X1C A;  2E5Z A;  4CH7 A;  3VWB A;  2CMP A;  4PFO A;  2M7A A;  2NOJ B;  1X1A A;  2HVR A;  4KIS A;  2UUZ A;  3PJR A;  3OYL A;  1BR4 A;  2OUM A;  4DBQ A;  1YX3 A;  2XAU A;  2Z1D A;  2L2O A;  4N4N B;  5HLT A;  3PUB A;  1UG0 A;  2ZSH B;  5FRN A;  1SFK A;  2DOA A;  2DXI A;  3OYE A;  1TT0 A;  3EUK L;  4BAC A;  2BW3 B;  3HXL A;  2CV1 A;  3OOU A;  2WY8 Q;  1K6Y A;  3E1S A;  1N78 A;  3IAM 2;  4BQQ A;  4XLF A;  1E0E A;  3W3C A;  2M3A A;  4RM2 A;  3S3O A;  3FDY A;  3PSF A;  3OL4 A;  3OWT A;  2HZD A;  1LKX A;  5CQE A;  4ZTF A;  3H5R A;  4DOZ A;  2IS2 A;  4HNT A;  3H35 A;  2MYS A;  3W2V A;  3TBI A;  5CKT A;  4MLO A;  4XON A;  2LBF B;  2WBM A;  3OR1 C;  3CJQ B;  5CPR B;  4F91 B;  1NG7 A;  2DCE A;  2LOO A;  4DBR A;  1X4P A;  4E7Z A;  4BU2 A;  1DGW Y;  4BQN A;  4PJJ A;  1MMD A;  2K9L A;  4JQF A;  3VYT B;  2V6E A;  3CP8 A;  2WAD A;  2WB1 A;  3PFY A;  4PFP A;  4RLF A;  2CFO A;  2V1N A;  2R7S A;  4AVZ A;  2MAB A;  1PJR A;  3DEE A;  2JSP A;  3OS2 A;  3MKW B;  5JHF A;  2R7O A;  3PNV A;  3PL8 A;  4ZDO A;  2LY1 A;  3MD2 A;  4BDY A;  1WFX A;  4ZDL A;  4C2U A;  2IGO A;  3BG7 A;  3S32 A;  4Y4R A;  5LD2 C;  2DT6 A;  3LSK A;  3OYC A;  4XKB A;  3L2R A;  3K6G A;  2L9S A;  1X1B A;  4XOT A;  4XQF A;  1EA3 A;  2CV2 A;  2VXD A;  2KRC A;  4F93 B;  3DTE A;  4G6T B;  5HVQ C;  2M4G A;  4C9Y A;  4CCK A;  3CES A;  2VKH A;  3E0J B;  2IS1 A;  1YX5 A;  4XM3 A;  2OC6 A;  3ZR8 X;  4KIT B;  1WJC A;  2KMU A;  3BC8 A;  4BE1 A;  4BEH A;  3HOS A;  4IX7 A;  4B48 A;  2R7U A;  3RSN A;  1WJF A;  2LC2 A;  3DTI A;  3LL7 A;  4IQ4 A;  3VSK A;  4DGW B;  3OIQ A;  2ZXI A;  3TMO A;  4NC7 A;  1G8X A;  3DKY A;  3OYB A;  3HL2 A;  2VJ5 A;  2CV0 A;  2BOL A;  3QYB A;  2V4J C;  3K4L A;  2IXS A;  3K70 C;  4R79 A;  3H0D A;  3OYD A;  4CCN A;  1V5F A;  1OR7 C;  1MND A;  3W2A A;  2E60 A;  2RNG A;  3DTK A;  3DKX A;  4IKF A;  3W2W A;  3J7A Y;  4GRI A;  2R7X A;  2HVQ A;  4X0G A;  1Z7L A;  5KHD A;  4BXF A;  4D1Q A;  3OMY A;  2V9K A;  2BVM A;  4B43 A;  1QU3 A;  5TGT A;  3OYM A;  2WY7 Q;  2W82 A;  3H5A A;  3OYN A;  3OL3 A;  1VZ0 A;  4N4O B;  2AQF A;  3DWL E;  3NWT A;  4NQW B;  3LSM A;  4F92 B;  5FRM A;  3A4C A;  4PUS A;  2RRE A;  4B3X A;  2HU9 A;  4BEH B;  1U0J A;  2Y0S A;  2Q1Z B;  2F6C A;  3DPU A;  2GOX B;  3MKZ A;  3OS1 A;  3HPH A;  3K70 D;  2VKD A;  2LBF A;  2DJI A;  4F3Q A;  2HVS A;  2WAE A;  3OYH A;  3KX2 A;  2V7F A;  1KON A;  3FBI B;  2VQG A;  2KP6 A;  2A5W A;  1BR1 A;  4PJN A;  2R4G A;  4ZYA A;  2HPI A;  1W36 D;  2KQR A;  4CCM A;  3LSG A;  3EPZ A;  4BS9 A;  4JOM A;  1ERD A;  4CCJ A;  3OYI A;  4NUB A;  1D1C A;  1X19 A;  2XC7 A;  3DPL C;  3HOT A;  4ITV A;  2UWM A;  3QYE A;  2OV7 A;  4II3 A;  2Q2E B;  3IAS 2;  4PJL A;  1YE9 A;  4YRV A;  4DJA A;  2JVH A;  3BCB A;  1T95 A;  2WA0 A;  4CZC A;  2GOM A;  1FMV A;  1LFP A;  1WJB A;  3AKZ A;  3SZG A;  1TZL A;  3FBN B;  1FMW A;  2VB6 A;  3DU6 A;  1P9Q C;  3M8J A;  2R7W A;  4Y33 A;  1SAU A;  4U87 A;  2KL4 A;  1D1A A;  3L2U A;  4B47 A;  1BR2 A;  4LIT A;  4LIU A;  3LSH A;  4P1W A;  3C2H A;  2IGM A;  2XF6 A;  3QOD A;  3UR3 C;  2W00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...