3MKZA

Structure of sopb(155-272)-18mer complex, p21 form
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
112
structure length
112
Chain Sequence
PTSAYERGQRYASRLQNEFAGNISALADAENISRKIITRCINTAKLPKSVVALFSHPGELSARSGDALQKAFTDKEELLKQQASNLHEQKKAGVIFEADEVITLLTSVLKTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna-binding protein/dna
molecule keywords Protein sopB
publication title Insight into F plasmid DNA segregation revealed by structures of SopB and SopB-DNA complexes.
pubmed doi rcsb
source organism Escherichia coli
total genus 35
structure length 112
sequence length 112
chains with identical sequence B, N, U
ec nomenclature
pdb deposition date 2010-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18090 SoPB_HTH Centromere-binding protein HTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2830 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3mkzA00
3MKWB 3VWBA 1VZ0A 3MKZA 3MKYB 3W3CA 3W2AA
chains in the Genus database with same CATH superfamily
5C3EJ 2VQLA 2V6CA 2JA2A 1R23A 2M4GA 1U9NA 4LIUA 3LSIA 1V4RA 4M3FA 2JSPA 1IN6A 2HTSA 3RDIA 2VJIA 4IEJA 3M1EA 1SD7A 4A2UA 3ZQHA 5K5RA 4U7BA 2IAIA 2NVUB 4YRVA 2CH0A 1FJLA 2OZ6A 4BJTA 2P7CB 3RKWA 4IOAF 2DQLA 5BPDA 3F6OA 5EF6A 4JK1X 2EB7A 2L02A 5KVRA 5L3DA 1KONA 1LEBA 2MW8A 4XKCA 3IV5A 4HG2A 5FRNA 2IA2A 5EGOB 3F21A 4M6VA 3HHHA 2HOAA 1JUPA 1P4WA 3MKWB 1NTCA 4G6QA 1AKHB 4OIQF 2W85A 1YW8A 3FM3A 4AVZA 4Y52J 3IWZA 4A3LJ 4BE1A 1ZELA 2E2HJ 4KIFA 4TV7A 2AXTC 1HOMA 4UUSB 2YPRA 3OS2A 1W0UA 3P9IA 3I54A 1HQCA 1A35A 2A6EF 5CVJA 3MWMA 4LB6B 2KQRA 1XS9A 4BBSJ 3A02A 3ZXSA 2LKXA 1R6RA 2R4GA 1HKTA 4NUBA 2DFFA 2MGQA 3RQ4A 4UUVA 3G73A 3F22A 1L3LA 1RI7A 3OYMA 2I8DA 3H92A 1FP1D 5FB2A 2GA1A 3S2HJ 2BY1A 3WGIA 1R7JA 1U6GA 2XPWA 2JSCA 2OTLI 5H2FC 3BJ6A 3EPZA 4ZDLA 4L5JA 4GRIA 1S3JA 2VOPA 1J9IA 1YFHA 1IN4A 2KLOA 2M7AA 2BHYA 1D0XA 3I9V2 3K0LA 1OCRH 2RKHA 3IKVA 2CW0F 2NAZA 2V9VA 2ZC2A 2NVXJ 4BHPA 1SC7A 2PLYA 1VQNI 2R5YB 4HNVA 3ASNH 2DPDA 2KZGA 2M45A 3RQIA 2HFHA 2JVGA 3BG7A 4XICA 2M8EA 3FHZA 2HQNA 4PGHA 2RREA 1OR7A 2DA7A 3HOUJ 3IKTA 1XD7A 4GYIA 3HOSA 4BDZA 3LWFA 1X1BA 4KIGA 5CJ9A 3FISA 1XN7A 3BPVA 1OYWA 3FK6A 1R49A 4NHJA 2K3FA 1WH7A 4BHBA 3JRBA 4HF0A 1D3YA 2XROA 1J2XA 2IS1A 3G1MA 1XMXA 2QCOA 4XLPF 1X1PA 2E1MC 2OAZA 4HSRA 1T8IA 3L2VA 4DIQA 5EEGA 2CQQA 3W3CA 1S7EA 1FBQA 1R58A 4RAYA 4L9NA 2VQCA 3A01B 3L2QA 3VOEA 3H3ZA 1MMGA 1T0FC 4BXUA 1DU0A 2Z2SB 2GA2A 5HLIA 5LGUA 2Y31A 3KE2A 1VTNC 2DFEA 5F1RA 1LUJB 4A3FJ 4Y13A 4KDPA 3S1MJ 4HA8A 1O7LA 4QLCU 2COMA 4KA4A 2E5NA 3EYYA 3J7YJ 1PUFB 3GO5A 3IH3A 3CO6C 2PMZN 2XHKA 1PYVA 1KQ8A 5GADJ 4RS8A 5M5YJ 5BOXA 4MGRA 2VBZA 2KT0A 2R7QA 1FIPA 3RPQA 1J59A 1VQOI 3I59A 3BG9A 2D2WA 2PEXA 3WTZA 2K3PA 3JTHA 1Z6RA 1G3TA 4DGWB 4RGUA 3K70C 3U1DA 1HC8A 4BGDA 3CCUI 2FEZA 2W7NA 5E8IA 3CTAA 3DEEA 1QBJA 3QU6A 2R7FA 2E35A 3PNVA 4R1HA 3BLYA 1QPMA 2JRTA 4IL6C 5D8LB 4YFNF 1VQ4I 1OLTA 2WY8Q 2Z9OA 3F0CA 3KEYA 2GBYA 2DQRA 2A5WA 3GBGA 2DN0A 3WE2A 4AC0A 1T08B 4XM3A 4XLNF 2KPMA 1FIAA 5AIPA 3ZN1A 3E6CC 4IHTA 4HX7A 3OYLA 2Y75A 3A0BC 1W5CC 2L7FP 2WBMA 4X1EA 3O2PE 2OD5A 3KYCB 3VDXA 4XNFA 4ASNA 2VOOA 3HOWJ 4G12A 3ABUA 4CSWA 1FZPB 4KNYA 1JUSA 5FFXA 5FROA 3GZ6A 3E97A 3MKYB 3ZQIA 3D5LA 3C3WA 1Z1DA 3L00A 4L5IA 2HNHA 5E3OA 5TRDA 2WTEA 3PUBA 1ORKA 1MMNA 1U2WA 3JR9A 2LY1A 1GV5A 2HZTA 2L2OA 3P7NA 3CUOA 5FD6A 2VC0A 4IHYA 2JMWA 2P5KA 2JUGA 4XLCA 2QQAA 4FX0A 2QSHX 4ZH4F 3WTTC 2EWNA 1R22A 3MAJA 5DM7F 1NK3P 1IDZA 3KZZA 3ECOA 1G3SA 3MQ0A 2AXLA 1W0TA 1TZLA 1I3AA 5EG0A 3T8RA 2KISA 4BY7J 3V4GA 4E70A 3CDIA 2FQ4A 2YS9A 4I01A 4KFCA 2TRTA 1X2NA 2ELKA 3BJOA 3S93A 4KITB 2XRNA 4RBOA 2KIQA 3K10A 3R61A 2X1DA 4HF2A 3T0YA 2LNBA 1V5FA 2E7WA 1KA8A 3ZQLA 1K61A 1ZHFA 2QKMB 2QM3A 2W4SA 4S05A 1Z3YA 2K9SA 5ICGA 1OCZH 5FKNA 1O3SA 3UR3C 1FWZA 2MLGA 3KLOA 4DYCA 5GAGJ 1XSDA 2IGMA 2PMHA 5DUIA 2P0WA 1T39A 5HDGA 2ZMEB 5B66C 1FTZA 1SFEA 3R4KA 2M0CA 5FJ8J 3E5UA 3TBIA 2RDPA 3WHCA 3VWBA 5J6XA 1SAXA 1MD0A 2KIMA 2LH9A 1JJ8C 2A07F 5J3LA 2XKOA 4R8HA 2EBIA 2ELJA 1BBYA 3KYLA 4ENMA 3COAC 3V8KA 3WG9A 1WRJA 1TC3C 4LB5A 1TNSA 3J7ZI 1UELB 2HVQA 4DBQA 4OMYA 3CJRB 4XRSA 3FXUA 1X4OA 2KL4A 2W1OA 3C1DA 1MNEA 2WV1A 3QODA 1YO5C 1KU3A 2PFBA 4YELA 1OMIA 4M3EA 3R0JA 3GTOJ 3PL8A 1SVMA 2HZDA 4JX6A 2IP2A 1IUYA 3A03A 2JUCA 3DTKA 1TWCJ 1XGMA 3KYDB 2ZMEC 1M1EB 2CV2A 1LPQA 3OIPA 1MMSA 2D1HA 3T5XA 4BU2A 4LK1F 3M4OJ 4UUTA 3R0AA 3TOBA 1OJLA 1U5TA 2ZJ2A 1KU9A 3OV8A 2MFZA 4XKVA 4U7DA 2HDCA 4BEHB 4XRSG 1CF7A 2XAGA 1N78A 1OYYA 1OISA 2H27A 1ZN2A 3D5SC 2FF4A 1Z6TA 4X6AJ 3U1KA 2X6WA 3LOCA 3OWTA 2R0QC 4XMYA 2KDOA 3ULQB 4JYKA 4CH7A 4QWQA 1LE8B 1P92A 2BXYA 4DQ2A 5J8CA 2FOKA 5BNGA 1FOWA 1DP3A 3C2GA 2R7UA 5HLTA 2VASA 4LG0B 4XONA 1HKQA 3KP5A 4A3CJ 3K70D 1XGNA 3OYJA 4BH9A 3HL2A 3BJAA 1W5TA 1WJCA 2Q0OA 3IUOA 1FSHA 3E6DA 4D5FA 2KRHA 1X1DA 2H8RA 2NRAC 3L2UA 2VIXA 4OOIA 1TW2A 4BXXJ 1ZRCA 1ZGWA 1BC8C 4QPQA 2XB0X 2HEOA 3J80K 2X4HA 4ZZLA 3FF5A 4EJWA 3CMMA 3IH2A 3H9GA 1WFXA 3FXLA 3QPTA 4FQGA 4LG3A 4Y15A 4CZCA 1RUNA 2M2EA 4BE0A 1MMDA 2R7VA 3F6VA 3CUQB 3BCBA 4KISA 1F5TA 3ZMUA 3WHBA 2BBYA 4I6ZA 4O6JA 3AKZA 2MH9A 4MFDA 1C0WA 1LB2A 5D5VB 4II2A 3M1CA 3NAUA 4I09A 1P6RA 1VQMI 2Y2ZA 2RVCA 4P55A 2RQPA 4L0YB 5E18F 4C3IJ 3AG4H 5J8FA 4MO7A 1K4TA 1FOYA 2NVYJ 5CPRB 3K4MA 2MC4A 5DM6F 1R36A 4EJVA 4XN3A 2Y0SA 4LLLA 2L3DA 3ZMSA 1P2FA 1FC3A 4HW0A 4ZYAA 1OCTC 5LEKA 3TP0A 3UNGC 3Q9SA 2V9PA 4YEJA 1ACIA 2GIVA 3BQZA 4MHGA 3LSPA 5H6QA 3CUQC 2COBA 3W6VA 4CHUA 3BTJA 1FX7A 1TNTA 5IT9K 2V9KA 2M9HA 2VJJA 2F5FA 1JTYA 2CUFA 4YFKF 3CCVI 2A6HF 5K7FA 3FWEA 3IC7A 4M6XA 1W4MA 3K4NA 3WE3A 3KP7A 2Q8KA 4ZYEA 3MCZA 2EFPA 4CA0A 2LR8A 2DT7B 5DYMA 1ZAOA 1LKXA 2VUMJ 4OIOF 2F5VA 3U2RA 2RGVA 3ZN0A 1B6AA 2P7VB 4BQAA 2HKOA 4A0YA 4D7NA 2QQ8A 2VN2A 3OL4A 1V3FA 5HS9A 4F3QA 4UVCA 2EFOA 3EUHA 1ZKGA 3P5JA 2X48A 2L5QA 5KK1A 2HDDA 1A6QA 3ZP5A 1OYIA 2D45A 4YG2F 1YOVB 3F8CA 4E7ZA 4UXNA 3I56I 3TP3A 4BE2A 1FY7A 1RUOA 1YRNB 2PG4A 4CUGA 3MZYA 4AVPA 3GCMA 1O3RA 1A31A 1YIJI 1UAAA 1RC9A 1OFCX 1K7AA 1Y0UA 1S5LC 1W7PB 2YX4A 2ZFWA 3ROUA 3CC4I 2QUFA 1XSVA 1F9NA 2DA1A 4P5OA 1IJWC 2QQ9A 1G3WA 1H89C 1FT9A 2LBFA 2LMDA 2VI6A 3O8GA 3BR2A 3H5RA 2NYXA 2DA6A 1XMKA 4KMUX 4GCVA 4LJZF 3LA3A 4J00A 1BIBA 1N75A 4BJ5C 2R7RA 1X19A 2L7KA 1GHCA 2G7UA 5AONA 5IOZA 2YR2A 1ENHA 4PSWA 3T8TA 1ITYA 1H88C 1B72B 2TDXA 2XAHA 2EK5A 4A3IJ 2X6OA 4XSXF 1O3TA 2QZ8A 4U0YA 1T98A 2X0LA 4KIBA 5F1JA 1HSTA 2CW8A 3Q0WA 5GAHJ 1MJ9A 2DU9A 2IRFG 3FXJA 4FETA 5C4JJ 4N0BA 4RB0A 3BWGA 3ISPA 3I58A 4EQQA 3KEOA 3GEZA 1MDMB 1O4XA 1HW2A 3CDLA 3HZJA 2LF8A 2KJCA 1WI3A 4FE7A 2WA0A 3MZHA 2DFHA 1VNDA 2G0EA 3TKYA 4B48A 5LD2C 2M5WA 4AD9A 4QTRA 2CW7A 1V5GA 3VYTB 3S14J 5BPIA 1TBXA 4PSXA 2E60A 1J7KA 5LGNA 3C2BA 2K40A 1WJAA 3IP4B 1DGWY 5J1RA 3CESA 5L3CA 3V7RA 2DOAA 3V42A 1IZ1A 5J1YA 1LQ1A 3ESWB 4OWRB 4XRMA 3CF2A 5F08A 1HXDA 4C30A 1QZEA 4HPQA 4BBRJ 3BQYA 2F48A 3DP7A 3Q5FA 1JTXA 2FU4A 1WJDA 2Z5UA 4CCLA 2XAQA 1QPIA 1BL0A 2WB1A 1LDDA 3F8BA 2DCEA 3HRUA 4C2MJ 1SEUA 2WV0A 2BVMA 3ABMH 1ON2A 3E6BA 1JT6A 4HNTA 2JN6A 3W6JB 1U3EM 1LDKB 3FKIJ 2V1DA 2EFQA 2X51A 3JRFA 1PUEE 1WJEA 5CVIA 3WTWC 2VT2A 3JSPA 3CCSI 2FE3A 2DYSH 5TGTA 1YJ9I 3CMYA 2DA4A 3LSHA 1GV2A 2DJIA 2PN6A 5LLQA 1KGSA 2EILH 5DDGA 5EZHA 2VPLA 1SMTA 1T6SA 2DXIA 4EMSA 3PJRA 5DCMB 4YIRX 3DFGA 3P9CA 2IS6A 1E2XA 5JLWA 2Y0SN 2VODA 1TW3A 1OCOH 1J09A 4G7HF 1FNNA 3WU2C 4CDGA 4NBQA 1KYWA 1V54H 4F7ZA 2W48A 3O6BB 3FHNA 2P5LC 4I76A 4UNOA 3KIOA 2F5DA 1Z7UA 2N8GA 3JAMZ 1RKWA 1UFMA 4P96A 3CD6I 3O8HA 3M3YJ 4YFXF 3TO6A 3HJEA 2PBIA 5L3BA 5EDNA 2LVSA 4D7MA 2O9LA 1XGSA 5FLXZ 2OCCH 4E7LA 5FKOA 1MBFA 2MH2A 2FNPA 4HYEA 3V8LA 3K1MA 3E7LA 1PVEA 1X3ZB 4ON0A 2OZUA 1NG7A 5CQGA 3M07A 1K78A 2KDZA 1BOBA 3ZGKA 2BY2A 1FMWA 2VKVA 1JHHA 3ERED 1MKMA 2ZO4A 3S32A 3FZVA 5TJJA 2UXNA 3CZ6A 2UWMA 1YE9A 2ZJRF 2HOTA 1LJ9A 1VF9A 4QIWN 3DKWA 5D4RA 4NDLA 1WHUA 4RGRA 1HDDC 2DTRA 3RKYA 1ETKA 2QEXI 2KZVA 2OJED 4LD5A 4V2GA 4LIVA 2PJPA 1VQ6I 2BV6A 2Z3YA 1Y1WJ 2ZXJA 3I5UA 2KHMA 4IVNA 4Y7NJ 4D9JA 1FLIA 4EM0B 2IT0A 2R7OA 2LP0A 2KKOA 2NOGA 2V79A 3BR6A 4RAGA 4S0HB 3OYAA 4EGYA 1YW9A 1IGNA 1REPC 4A3DJ 5M5WJ 3ZQGA 3K1NA 4B8XA 4G94A 3I53A 1I1GA 5IOYA 3W2AA 3HIFA 2W82A 3DV8A 3OYFA 3G3ZA 3AG2H 2QYOA 3NWSA 1Z77A 3NWTA 2FBHA 5LGTA 2FUG2 3TDZC 2ZNYA 3W6KB 1TP4A 2M1BA 4HDUA 2HDWA 2OUMA 1X3WB 1ETWA 5GTHC 2O03A 5BMZA 1OQYA 1IV8A 3Q9VA 4IXAA 1LEAA 2F2EA 1D5YA 3CMAI 3VYSB 4M3DA 2AO9A 1USSA 4C2UA 2ZJQF 3HRMA 2G7HA 3PUFA 2HQ5A 1A36A 1ZLJA 4HAMA 2IEKA 2DMTA 3FBNB 1TWFJ 3H5NA 2BVLA 2ID3A 2E2JJ 5ICFA 4H0EA 2R7TA 2NXNB 3QWLA 4L5EA 4NC6A 1U8RA 4KMFA 5DTDA 2DA2A 2GXAA 3OIOA 2L7MP 2MD0A 4EJUA 1F1ZA 3GZNB 1W7PD 5JFRA 3H9JA 3I55I 2QF7A 4IKFA 3BG6A 4F55A 2WB1N 1CGPA 2ELHA 5GAEJ 2K9QA 1TT5B 3GTKJ 3KPHA 3ML6A 2JPBA 1I50J 2B63J 5IPAA 2HWVA 2EH3A 1J75A 5IP7J 1RKTA 4B3XA 1WVRA 3BZKA 4PK4A 1WPKA 3ZMZA 1X1AA 1Z67A 2F5CA 2DOFA 4M73A 3D0SA 5HVQC 2NNNA 4M6YA 3DU6A 3SXYA 1Y8RB 2E1CA 2OBPA 1K4SA 4A3BJ 3QRFF 4RLFA 3HM5A 2JA5J 2EZIA 1JUMA 2DO7A 5LRSA 1I27A 5H20A 2M3AA 2M34A 3NARA 4WWCA 1BM9A 2KRFA 1D8KA 3QU3A 5GPAA 2IA0A 5EEAA 3BY6A 5HDKA 3IHUA 1YW7A 1RZ4A 4WXHA 4FHTA 2OU2A 3CCJI 3NRVA 4DBRA 3BZ6A 3ONQA 4PGGA 1FYLA 5FKKA 3BP8A 1BC7C 1HW1A 2IS4A 2LSOA 5HS8A 4ENKA 3WTXC 2GOMA 1R1UA 4PJMA 2L9NA 2YUSA 4EJTA 1WJFA 2K4JA 3B02A 3L09A 4P9UA 1HDPA 4A12A 1POGA 1VZ0A 4XLHA 2DLLA 2F4MB 5K5QA 1R71A 3GWZA 3QP5A 3PQJA 2X1CA 2E7XA 3OSGA 3HOYJ 4B1RA 2BZTA 2XIGA 3KP3A 3A2KA 1UHMA 3ZMDA 4HQMA 2IVMA 1YITI 3S17J 1WQ2A 5JHUA 1IC8A 2ADUA 1NHAA 1P4AA 1O3QA 2CFOA 2MLKA 4ENNA 1QVUA 1MBJA 3ABTA 1D0YA 1U0JA 4Z6YA 2F4IA 5JI6A 4B3AA 3WG7H 1IN8A 4MTDA 3CJQB 2XVCA 2OQGA 4OINF 3H3UA 4IF4A 1TQMA 3FMRA 4DYQA 2HPIA 4RM2A 1SD4A 2DDAA 4ETSA 4I0AA 1HKSA 2CQXA 3AG1H 3HOZJ 2ETHA 2PJRA 3I4MJ 1EA3A 2LTPA 5E17F 1HA8A 4KT6A 4L9JA 1QU3A 2LY2A 4OIRF 3WU0A 2A3SA 4NB5A 1LVKA 4AM3A 3FM5A 3LSGA 4D0PA 2Q2EB 1ZG5A 1IO2A 3BC8A 1BN5A 3C2HA 2ESNA 2XKPA 1EH6A 2O5RA 5EGOA 2VQGA 4G6TB 3OYDA 3K4CA 2BYVE 5F64A 2IW5A 1YTYA 2R93J 3CP2A 2XUBA 1K6OA 4XK4A 2CMPA 1B1BA 3BOQA 3JSOA 1G8XA 1E3HA 3OYEA 1S6LA 1BJAA 2DTZA 1IRGA 4FX4A 2BXZA 3FDYA 3G2BA 3HDDA 4IO9F 3ZQ7A 2XGXA 3CLOA 2B0LA 3H35A 4YIIA 4BXFA 4N4NB 4Q5SF 3FMSA 4P1WA 1ETXA 1UHSA 1I6HJ 1QVTA 1WGXA 4RB2C 3LL7A 3HHGA 5A2QZ 2V4JC 2XPUA 4MEYF 1BI3A 3DPLC 1V5EA 3E5QA 3RYRA 4A3KJ 5KHDA 1YI2I 2ME0A 3H3VK 3CDHA 3CCLI 2LD5A 1K79A 1XG1A 3QPSA 1BI0A 3HSEA 3M9AA 1UCRA 4XLEA 3J7AO 3S1QJ 3I3LA 2CV0A 2R3SA 3FBIB 3C18A 3RPUD 3MMYB 4H4KC 2X85A 1BW5A 1LFBA 2BW3B 3K6GA 1YS7A 2PX9A 3CJNA 4RMNA 4AYBA 2R5YA 2BY3A 4ESFA 2LLKA 4IQ4A 2CFXA 4MIMA 3BR0A 1YJWI 3I64A 3HRTA 2MBFA 2HXOA 5L3GA 2E5ZA 2X1EA 4ZDPA 1S9HA 3JTGA 3CC7I 1T33A 2FJ1A 4Y17A 1WJBA 2HGCA 1T0FA 4L9TA 2ZFUA 1ZRFA 4A3JJ 4OAYA 2K02A 3HBLA 5CVRA 2ME6A 5C44J 4HQEA 2UV1A 1B8IB 3AL0B 3DBHB 1DUXC 2K86A 1OKRA 3FIWA 2KP6A 4YIFA 2QA4I 1J5YA 4PFPA 4LLNA 2IGKA 4BY1J 2XDVA 3OS0A 3K4JA 2IBDA 1Z21A 3LFKA 1Z05A 1HBXG 1FPQA 1ON1A 4W1UA 1R1TA 3F8MA 3HSFA 2VBWA 1BIAA 3PSFA 3L9FA 5CKTA 3LSRA 3WU1B 2M30A 2RQQA 4W97A 3LFUA 1MGTA 5GPCA 2CUZA 2FOWA 3F8NA 3GVAA 5CVUA 1D1BA 4Z2YA 4GO1A 1VQPI 3GTLJ 3AFHA 3DF8A 4Q48A 2LKPA 3H5AA 3QQAA 3JRHA 3CCEI 1EJ9A 4E7HA 5HDNA 4E6KG 4HNUA 3F72A 3OL3A 3E0JB 1PUFA 2GXBA 3F8FA 3DQVC 3HUGA 4NNJA 3BG3A 3M7GA 4ANJA 3IWFA 2R7WA 1IUFA 4DOZA 4U0WA 2GWRA 3JRDA 3N97A 4XKBA 1E0EA 4I7HA 3N4MA 4MLOA 4C3JJ 4HX4A 2HYGD 3E1SA 4BUPA 2MD5A 1R5GA 2YSRA 1Z0XA 5IT3A 5CQEA 5EZGA 1EKEA 2WAEA 4IZZA 3TMOA 3OSFA 2STWA 5KAFC 1Z91A 4EATA 2VE8A 4E7SA 1G4DA 1O7FA 3RSNA 3VYUB 4IHWA 3DKXA 3FXQA 1UG0A 2QBYA 3GTMJ 2JA7J 3DXJF 2J5PA 1I3QJ 4OAZA 3I71A 4CCMA 1R1VA 4HX8A 1B9MA 1SVOA 1I1SA 2O3FA 4I02A 5B1AH 2LRDA 1H9TA 1XCVA 3PO2J 1GDTA 1IN5A 2MABA 1R5ID 3LSKA 5D5UB 4U0VA 2NS0A 4LOCA 3MFKA 1WKMA 4FT8A 3S2WA 1Z7LA 4XIDA 2Y30A 2E2IJ 3SDBA 4HRIA 3PQKA 2H1LA 4HF1A 1TQIA 3EETA 3DTIA 3FXKA 5FGMA 4HZFA 2K85A 4U88A 3IRQA 1APLC 3LQQA 2DMQA 5D5XB 1W36D 2HKXA 1QHGA 3OYBA 2MA3A 1SAUA 5K7ZA 1XCBA 4AWXB 2QKLB 2JPCA 2PQ8A 1U78A 1AA7A 3TW6A 1TLHB 2XSJC 3S1RJ 3HPGA 2JZYA 2DPUA 2UZKA 4PFOA 2E34A 2V7FA 4OU0A 4DYRA 2KIUA 2AHQA 1VQ7I 2VBYA 1Y1VJ 3GX4X 2L7ZA 2VJ4A 4EM2A 4FCYA 5B1BH 3VPRA 5E8GA 2W00A 4DZJA 3WODF 3SJMA 3ZR8X 5J4YA 3OY9A 1QZYA 1G2HA 1YX5A 4IJAA 3CC2I 2TCTA 1S7OA 4AYBN 1LFPA 3LA2A 4ZYHA 1ZK8A 5E1XA 3OOPA 3S3OA 2LFBA 2M7BA 1TWGJ 1QO0D 5HLHA 3IL2A 1O57A 3E6MA 1ZGJA 1SFUA 2O8KA 1SFKA 3GTJJ 1WCMJ 2R7SA 4D1QA 4XBFA 1D1AA 5BQTA 4PCQA 2QENA 5HOOA 1ETYA 4GXOA 5E3LA 4G9YA 2L9SA 3QAHA 3RYPA 5F04A 1FSEA 3QP6A 2EPFA 4HV5A 3EYIA 3RZOJ 3G4SI 3SFZA 4O3MA 2PMUA 4P9FA 3RZDJ 3ZCOA 3KP4A 1A04A 3LQRA 2MG4A 1NG6A 5LRRA 2AQEA 1ONVA 2XSDC 1RETA 1YIOA 2OTJI 2ZMEA 1YLFA 1FTTA 3J81K 4NC8A 3R6SA 3S16J 2BEOA 1B9NA 2L0KA 1W1WE 5ILUA 4PZJA 1RNLA 2EV5A 3LMMA 4ZZDA 3LSTA 3RKQA 4E7KA 1XDSA 2CUJA 1OR7C 4KYWA 3VFZA 3HG9A 5ILVA 4AIHA 3GW2A 4QSHA 1BI2A 2GLOA 4XLAA 3GF2A 1XTAA 5HNHA 1UB9A 4L0ZB 3IAM2 1KQ9A 5FLMJ 1DU6A 2XAUA 1F43A 1X3UA 5GP9A 1R4MB 3DU5A 2CYYA 5AIQA 5E20A 1RESA 3KLNA 2CQNA 4WF2A 2CGPA 1VQ8I 1Y39A 4CCNA 4E7JA 1BI1A 1U8BA 4NQWA 2VXDA 3OYIA 2KJBA 3BCAA 3ZMTA 4F91B 3I59B 3CCYA 1JKOC 4HSTA 4GYGA 4KUMA 2MYSA 5LEJA 1HF0A 1E17A 2E1OA 3RTRA 2DYRH 1HSJA 2ESHA 3GZ5A 1R00A 3TGNA 4EV0A 2VKDA 5M5XJ 2WC2A 2RN7A 2L9VA 2L4MA 5KAIC 2WWYA 1LE8A 3KCCA 1RPWA 2UUZA 3BTCA 1SMYF 1V55H 3BDDA 4XOPA 5F27A 1ZGAA 4JP0A 2HQRA 2CUEA 2ZSIB 5E3MA 3DCFA 4BAYA 2FBKA 1LNWA 3K4BA 1BJZA 3GLXA 3F9KA 4HLXA 4LG0A 2OV7A 2UXXA 3OOUA 2E1NA 3IRRA 2XB5A 1WZ2A 3CF5F 1BW6A 4M72A 3RCOA 3S1NJ 2EJRA 3DTEA 3L2CA 4IHXA 2GIZA 4WXDA 1XPXA 1E3OC 5M3MJ 1S29A 2P5VA 2QVOA 2ZNZA 3TOAA 4LK0F 3OYGA 2HYJA 3VB2A 3L2RA 1DP7P 1SFXA 3MVPA 4PJNA 5IP9J 4M9ZA 3S15J 2BOLA 2FQ3A 3HOXJ 2K9NA 2RV8A 4PDKA 2A05A 3SZGA 5LHIA 1OCPA 2R5ZA 2CV1A 2LOOA 2A69F 2CS3A 4CCJA 5JVGF 1IXRC 4XQFA 2XRLA 3CCMI 5GTIC 2VLAA 2PJRB 3B6AA 1FP2A 2W25A 4PUSA 4UVAA 3CUQA 1RR8C 2WAFA 2ISZA 2VKEA 2V26A 4LITA 2K5CA 4MNUA 1YYVA 2CU7A 2HQAA 4B47A 4CYCA 4MQVA 2ZXIA 4G8XA 2QWWA 4XRFA 1HCRA 2GM4A 1AHDP 1MZBA 1DPRA 5FKLA 1H0MA 2DODA 4AUXA 5BS6A 1BR1A 1MSEC 1VQ9I 2IS2A 3WTSC 2AQFA 3QOPA 5CVVA 1N25A 5EG0B 4ZTJA 2R92J 3NEUA 2FMLA 3W2WA 1TWAJ 1QRYA 5L3FA 2OC6A 3ZRGA 4A3EJ 4RB3C 5EJCA 3PIOF 1KU7A 3GTGJ 3K9TA 3D5RC 1ULYA 4LGWA 2CQKA 2CQ7A 3PNYA 5DV5A 1G59A 5ED4A 3DPUA 3SZPA 3ZMVA 2XPVA 3G1OA 4N4OB 1VQ5I 3F23A 1X4PA 3K2ZA 1NK2P 1SVLA 1ZREA 9ANTA 2NVTJ 1JKPC 1X58A 4JX5A 1WJ5A 2RAEA 4I0BA 5D5WB 4BQOA 3K7AJ 2XGEA 1LDJA 1AU7A 1K6YA 1T95A 2OCEA 2E71A 4B4CA 3ZQQA 3ASOH 1GXPA 4Y3OA 4BL0B 2HI3A 3SDGA 4J19A 4CCKA 2V1NA 4XORA 2OA4A 5D6FA 1F4KA 3JW4A 2XV4S 4BJ6C 2VC1A 2OF7A 2NOJB 3DBLB 2DI3A 3TO7A 4UY8I 1XMAA 3KZYA 2NNYA 1D1CA 2EFWA 2LG4A 2Y69H 4BYYA 2E1MB 1YRNA 5KCMA 3VSKA 4KT5C 2V1XA 5LBQA 3M8FA 2JTVA 2FNAA 3I0TA 1DQUA 2CWEA 4KICA 1KZHA 3E3VA 4E7IA 2Y9YA 2IJLA 3HTSB 2FX0A 3HRSA 1Z3XA 4RAZA 3I4NJ 1KQ0A 1W7PA 2R7XA 4A3GJ 1D8JA 3SZTA 4PJLA 4WX9A 1ZRDA 3LSJA 3PIPF 5LFAA 4PJ0C 2WAQN 2H6BA 4BKXA 2BHZA 1PJRA 5HS7A 3HB9A 4RB1A 3ABKH 4AIJA 1RRJA 1U5TB 3W2VA 3WTYC 2HVRA 1FOXA 3R60A 3BR1A 4CGZA 5FRMA 3ECHA 4HEA2 2HVSA 2EZHA 3LAJA 2L01A 3LSMA 5DUKA 1YJNI 1R5HA 2DMPA 1DGRM 1CF7B 3DPTA 1B72A 2RC4A 2R7ZJ 2W24A 2NS7A 4IQJA 6PAXA 2KFDA 1UG2A 2CJJA 2P8TA 3M8JA 1TQPA 2H6CA 3JRIA 1QA6A 1IXSB 2VB6A 3OR1C 4G7ZF 5J4VA 2K7LA 3PFYA 1MDMA 2VT3A 2JA6J 3JREA 5FFZA 3P9KA 2VKHA 1IW7F 2M8GX 2XF6A 4ZYGA 3Q0UA 4FISA 2E19A 1S7AA 2P4WA 3EUAA 5F6FA 2Y9ZA 2DDBA 2P6TA 1JGSA 3MEXA 2QGUA 1U5TC 2IA1A 2DJNA 4D5CA 4BS9A 3J80Z 3NQOA 4RGSA 5D6EA 3SEQA 3HUGB 2DT6A 5EEHA 2ISYA 2XAFA 5DCFA 3ABLH 3G71I 1MBEA 3MKLA 3GLLA 1YX3A 3HYIA 1YQAA 1BOAA 1TTYA 1YG2A 3RKXA 3OYKA 4EVIA 4EEFG 4CYDA 2XASA 1ZH5A 3LNQA 2XC7A 2ZB9A 2H1KA 2GZWA 1JKRC 3DWLE 4F52A 4IHVA 2VONA 4C2TA 3ZOBA 2GOXB 3SFIA 3QPHA 4PJJA 2X6YA 4AIKA 3JRAA 2LREA 2A68F 3HPHA 4M9XA 4MEXF 5JR3A 1B4AA 2QBYB 3SEZA 3Q3SA 2HPMA 4XSZF 4IRIA 1J0RA 2XF5A 1X2MA 4ITVA 1N77A 1QNTA 1VQKI 3K2AA 4IRHA 5DCMA 3HKZA 5DEQA 1FYMA 2WY7Q 3HXLA 2HS5A 3S3NA 4XN0A 5IT9Z 1MH3A 4R79A 5JHFA 4S04A 2V6EA 2DT5A 4XKWA 5IYCJ 4G7OF 4MFEA 2B7EA 3J7AY 3KX2A 3EUKL 2HU9A 3OYCA 4IPAA 4O5VA 4BQQA 4KN4X 1Y8QB 4KJZA 1H8AC 4I99C 3SHFA 2XGDA 1PDNC 2A61A 3DEWA 1IG7A 2Q1ZB 4JQFA 1CQTA 4CCOA 4HLYA 1W36C 4A5MA 4JX4A 1ETVA 1VFCA 4A69C 4BDYA 1AKHA 3TO9A 3JAMK 1EF4A 4OIPF 3FXRA 4I98B 4M3GA 4C9YA 2K9LA 1EV7A 1GUUA 3ZQCA 4UB8C 1QHHD 3S2DJ 5FLVA 1W5SA 1B59A 3A1YA 4IRGA 1Y6IA 1MH4A 1JGGA 2A5YB 3HEFA 5FLXK 1A5JA 4UUSA 1UJ8A 2FA5A 2YU9J 3GFMA 1YS6A 3N05A 3CLQA 3OR2C 2DK5A 4RAFA 3VEPA 4UV8A 5E79C 2HXIA 4ZC3A 3ZQFA 1BR4A 4UB6C 3WTUC 4KN7X 5F0CA 1STZA 1ZTRA 3OS1A 5KNLA 3JRGA 4IOCF 2KMUA 5JVTA 2DMUA 1QZZA 2O61A 2JWTA 1ZYRF 1ZLKA 4HOBA 3HGGA 1K83J 2O7OA 2FD5A 1OPCA 3DBRB 2ZSHB 1P4XA 3LA7A 1HW5A 1P7JA 3RPUA 5D4SA 4ESBA 3KFWX 3FX3A 5M3FJ 1TWHJ 4BACA 3GMEA 4N9HA 1D0ZA 2EA4A 3J81Z 2C6YA 3FXMA 2EZLA 2LBFB 3TW7A 4X0GA 1QGPA 3EUHC 3FXOA 2F5EA 5LHGA 4B09A 4UHTA 1MNDA 2O0YA 3RIRA 1S8NA 4Y33A 2HYFA 1ZG3A 3F3XA 3TDUC 3SQNA 3SYTA 4F92B 4BQNA 3UKGA 1JE8A 5B3SH 3BR3A 1GT0C 4M3BA 5IY5H 3HC7A 4ESJA 2EQRA 1IDYA 4NC7A 5E1ZB 5FD5A 2JVHA 2V1UA 3X2QH 5F0FA 3S3MA 4GFBA 3KEQA 1FOKA 1XGOA 2FMYA 4ENJA 2M87A 3CCRI 4CXFA 5HLGA 1AWCA 2K9MA 1USTA 2I5UA 3PM1A 4LFUA 2L54A 2EV6A 2VE9A 1QQIA 1GXQA 2IGOA 2JJ7A 3MZ8A 1R4NB 3JCUC 1WI9A 2HOEA 2ZCWA 4Y4RA 4AIDA 2YU3A 4AU7A 4ABZA 1Q1VA 2QLZA 2GAUA 4M71A 5K7HA 1RR7A 2JK3A 1EH8A 2PI0A 2CG4A 4ZJZA 3TL4X 1YHQI 2OQRA 3E5XA 3A01A 2EZKA 5IYDJ 5D8KB 1LVAA 3OIQA 2DA5A 2HOSA 2DBBA 4NQWB 4M74A 5J40A 3HOVJ 2M0MA 2H94A 2JQ7A 4ZYDA 5ICEA 4JOMA 4EM1A 1T38A 1S72I 4I2OA 1NH3A 3AL0C 1MMAA 1GVJA 4Q47A 4XOTA 2O6GE 3GTPJ 3KP6A 3BPXA 4UV9A 4DJAA 1G3YA 4A0XA 3BZCA 2Z1DA 2O8XA 3A0HC 3QYBA 5H6RA 3MKZA 1ZR2A 4BNCA 2X6XA 2ZXWH 4DZPA 2G9WA 2EINH 2HTJA 2IGNA 3HKZN 3ELKA 3PFIA 1XB4A 3K69A 3GFJA 4JBAA 4C3HJ 2ECBA 4ZTFA 1ZG1A 3V8JA 2LYCA 1BA5A 3IH4A 3KETA 2STTA 1JXSA 1SANA 4CZZA 1Y0NA 1IRFA 1Y56A 2MC3A 4RLQA 2LKSA 2ZBKA 1PP8F 4MQ9F 4FASD 2X9DA 1JKQC 4DNCA 4A6EA 1FMVA 2GXGA 2OPTA 1XX5A 3Q0VA 3OYNA 2EIMH 3L7WA 4M9SA 3H1CA 2CSOA 2RNGA 1JHFA 5IYBJ 5K1YA 5FO5A 5C4XJ 3TQNA 2LF7A 2R5ZB 2EV0A 4RDUA 3MN2A 2J5OA 3K4LA 5TISC 1HLVA 1FYKA 2NS8A 4IX7A 4B44A 3BROA 2VXZA 3QYFA 3BT9A 2Z33A 4UVBA 4XLFA 5DD8A 4J01A 3QOEA 3K1PA 3C7JA 4LLGF 3RJPA 3OYHA 1ZR4A 5DD4A 4A0ZA 1MSFC 4HDVA 4CYCB 1K78B 3L1PA 1RIOH 3GFLA 2K4BA 4A93J 3S8PA 4FTHA 2LC2A 2ZJPF 1ETOA 1GLNA 2MSYA 3VYRB 4Q4ZF 4N9IA 2IXSA 4V19K 1GVDA 2D1VA 1TT0A 1MJAA 1P9QC 3K4KA 2VBXA 2XF7A 3VODA 3CCQI 2H09A 1SD6A 1ZQ3P 2IPQX 1U9OA 2CO5A 3EQLF 1FBUA 3DLAA 5J1UA 4U87A 2H8WA 1MBHA 4MTEA 4QPOA 1JJ6C 2Q2EA 1BR2A 4HBLA 2FSWA 5ILSA 4L9VA 1G6NA 5E3NA 2RNJA 3DEUA 2W57A 3DLLF 3PO3J 2DK8A 3GXOA 1F36A 3FMQA 1FEXA 2A6TA 2KRCA 3G1LA 3HSRA 5E1WA 3T1BA 2DW4A 3CQZJ 2Z16A 2QSFX 2Z99A 3PNTA 2ZKZA 1X1CA 2WADA 2ZXHA 2AS5F 4IHSA 1D5VA 1FBSA 1UZCA 2FBIA 2L4AA 3EDPA 4EJOA 3AAFA 2FXAA 5L3EA 1IF1A 1XDUA 4RGXA 1Z9CA 1R9TJ 1PP7U 4A5NA 4CICA 3V7SA 4XR6A 3REOA 3CP8A 2DOEA 1VQLI 2BY0A 2I10A 1WH5A 1LFUP 2LK2A 5JLXA 3JRCA 4ZDOA 3WGHA 1UHWA 5HODA 3ZPLA 3TEDA 2BE5F 3BG5A 5CYVA 1ZARA 1XSXA 2EIJH 1UMQA 1ETQA 3PSIA 3WTVC 1MBGA 3CJTB 2P81A 2YX7A 4XL9A 2LDUA 2F6CA 1T56A 3WGGA 2JA8J 4G6DA 1WSUA 2XGCA 1SD5A 1AOYA 5A2QK 2B9SA 2DAOA 1IRXA 3GUDA 5F0HA 3D1NI 4GGGA 3AG3H 3BTLA 1XC5A 1E3PA 3B6CA 1TL8A 2VQHA 3M8EA 2BW3A 1A6IA 2VPRA 4FE4A 4RM3A 2XAJA 4WXCA 3DKYA 1KYZA 3IAS2 1DPUA 3GTQJ 3H0DA 2KIFA 2EA2A 3V7CA 3H36A 3GFIA 1MIJA 4K2EA 2GQQA 1H9GA 1P7IA 4B43A 4V2FA 3BR5A 4E4HA 4WCGA 3HTUA 1JT0A 1MBKA 2EIKH 5CLSA 1MW7A 3L2WA 1MJBA 1ODDA 3VSLA 2DA3A 3CMEI 1IRZA 3ERMA 5HNFA 1B8IA 2P6SA 1DDNA 2DFIA 2WAQA 4BHCA 1IV6A 1MNMC 1EH7A 2E36A 3CO7C 2Y0MA 4A3MJ 4DW6A 4BEHA 2JRMA 1SFOJ 2ACJA 5LHHA 2VJ5A 3HGYA 2M4KA 5J47A 3GYHX 5IP6A 3FKJA 2NVQJ 4HV6A 2JT1A 2Y48A 4LMYA 2QQBA 3A4CA 1JI8A 4RA2A 4CO8A 1KU2A 2EFNA 2ID6A 1L0OC 3QYEA 3G6EI 1T2KA 3H0GJ 1I5ZA 3B73A 4EGZA 4F93B 5EYRA 3LAPA 2K27A 1Q1HA 3O3KA 2W84A 4II3A 1IXCA 3QPLA 4WK8F 2ICWG 5K5OA 2DMNA 3HOTA 5B5EC 4A6DA 1I39A 2L9RA 1I6XA 5DS9A 3RI4A 2QSGX 3OMYA 4GDFA 1IN7A 1WWXA 2HR3A 1OCCH 3FK7A 5ICCA 4OMZA 2VL8A 3KP2A 2CRGA 2PMZA 3U9GA 4L18B 3KZIC 1VI0A 2FRHA 3H9QA 2LY9A 3U21A 2R7DA 5ERIA 3MD2A 1ERDA 3BTIA 2F4OB 2ECCA 2BGCA 5FKMA 1IAWA 3I4PA 2D5VA
chains in the Genus database with same CATH topology
3EUAA 2VQLA 4RMNA 3K4NA 4AYBA 2JA2A 2M4GA 4CA0A 4IQ4A 2DT7B 4LIUA 4BS9A 3LSIA 1LKXA 2F5VA 2JSPA 3SEQA 2VJIA 3HUGB 2DT6A 2E5ZA 2X1EA 4ZDPA 1S9HA 3OL4A 4U7BA 1WJBA 4YRVA 2ZFUA 2CH0A 4BJTA 4OAYA 4F3QA 1YX3A 2UV1A 3OYKA 1KONA 2L5QA 3AL0B 4XKCA 4HG2A 5FRNA 2XC7A 4E7ZA 4BE2A 2KP6A 3MKWB 4CUGA 3DWLE 4PFPA 4F52A 2IGKA 2XDVA 3OS0A 1UAAA 4C2TA 2GOXB 3K4JA 4PJJA 2X6YA 4AVZA 2LREA 1Z21A 3HPHA 4BE1A 1ZELA 3SEZA 2HPMA 3OS2A 2XF5A 4P5OA 3PSFA 5CKTA 4ITVA 1N77A 2RQQA 2KQRA 2LBFA 3LFUA 2CUZA 1D1BA 3ZXSA 3H5RA 1R6RA 2R4GA 3HKZA 3AFHA 4NUBA 3RQ4A 2WY7Q 3HXLA 3S3NA 4XN0A 3H5AA 5JHFA 4R79A 4J00A 4E7HA 1N75A 4BJ5C 4E6KG 4HNUA 3OL3A 3E0JB 2R7RA 1X19A 2L7KA 4XKWA 3OYMA 2I8DA 3J7AY 4PSWA 3KX2A 3DQVC 3EUKL 4NNJA 2HU9A 4ANJA 3OYCA 4BQQA 2R7WA 2CW8A 4DOZA 4KJZA 4FETA 3EPZA 4XKBA 1E0EA 2Q1ZB 4JQFA 4MLOA 4CCOA 4ZDLA 4GRIA 1W36C 3E1SA 2KLOA 2M7AA 4BUPA 1D0XA 3I9V2 5CQEA 2WAEA 2WA0A 4B48A 4IZZA 3TMOA 5LD2C 4BDYA 4EATA 2CW7A 1V5GA 3VYTB 4E7SA 4C9YA 2K9LA 4PSXA 2E60A 1QHHD 2JVGA 3BG7A 1WJAA 3A1YA 3IP4B 1DGWY 1Y6IA 3RSNA 3CESA 3VYUB 2DOAA 2RREA 3V42A 3DKXA 1UG0A 4OWRB 3CF2A 3HOSA 4C30A 3N05A 4BDZA 4HPQA 3OR2C 1X1BA 4OAZA 1WJDA 4ZC3A 1BR4A 4CCLA 4CCMA 2WB1A 2DCEA 3OS1A 5KNLA 2BVMA 2LRDA 2IS1A 2KMUA 4HNTA 2MABA 1LDKB 3LSKA 2E1MC 2X51A 4HSRA 3L2VA 1WJEA 1Z7LA 4DIQA 3W3CA 2ZSHB 3SDBA 5TGTA 4HRIA 2VQCA 3DTIA 3LSHA 2DJIA 3L2QA 4BACA 1MMGA 1W36D 2VPLA 1D0ZA 1T0FC 2DXIA 1QHGA 3OYBA 2Z2SB 1SAUA 2LBFB 4X0GA 3PJRA 3EUHC 2QKLB 2IS6A 1AA7A 2XSJC 1MNDA 3HPGA 1J09A 4Y33A 2E5NA 4PFOA 3SYTA 2V7FA 4F92B 4BQNA 3FHNA 2VJ4A 3HC7A 4NC7A 1PYVA 2JVHA 3S3MA 2W00A 3ZR8X 3OY9A 1YX5A 2R7QA 2K9MA 1LFPA 4E7LA 3S3OA 2M7BA 2K3PA 2IGOA 4DGWB 1SFKA 3K70C 4Y4RA 4BGDA 2R7SA 4AU7A 4D1QA 2W7NA 1D1AA 3DEEA 1NG7A 5HOOA 5CQGA 4ZJZA 3TL4X 2L9SA 1BOBA 3PNVA 3BLYA 3ZGKA 1FMWA 3OIQA 1OLTA 2WY8Q 4NQWB 3KEYA 3S32A 3ZCOA 2A5WA 2M0MA 3GBGA 3CZ6A 4XM3A 1YE9A 2KPMA 4JOMA 2UWMA 3AL0C 1MMAA 1NG6A 4XOTA 3OYLA 4DJAA 2AQEA 2WBMA 2KZVA 2Z1DA 3VDXA 4XNFA 4LIVA 4NC8A 4CSWA 3QYBA 5FROA 3MKZA 3MKYB 3LMMA 2X6XA 3D5LA 2KHMA 4E7KA 2CUJA 4D9JA 1OR7C 2IGNA 2HNHA 3HG9A 2R7OA 3PUBA 3OYAA 4ZTFA 1MMNA 2LYCA 4XLAA 2LY1A 2L2OA 5HNHA 1Y56A 3W2AA 3IAM2 2W82A 3OYFA 4RLQA 2XAUA 3NWSA 2JUGA 4XLCA 3NWTA 4FASD 3DU5A 2FUG2 1FMVA 2HDWA 2OUMA 3OYNA 4CCNA 4E7JA 2RNGA 1TZLA 3VYSB 2VXDA 3OYIA 3BCAA 4C2UA 3K4LA 4F91B 4IX7A 4HSTA 4B44A 2MYSA 3FBNB 3H5NA 2VXZA 2BVLA 3QYFA 3RTRA 4XLFA 2R7TA 4J01A 3QOEA 3OYHA 2VKDA 3S93A 4KITB 3K10A 2MD0A 2X1DA 3H9JA 3S8PA 2UUZA 2LC2A 4IKFA 1GLNA 1V5FA 3BG6A 3VYRB 4F55A 4XOPA 2IXSA 2QKMB 1TT0A 1P9QC 2W4SA 2ZSIB 1Z3YA 3K4KA 3K4BA 2XF7A 3F9KA 2OV7A 3OOUA 3UR3C 4B3XA 2IGMA 4PK4A 2V6EA 2P0WA 1X1AA 3RCOA 3DTEA 3DLAA 4U87A 5HVQC 4QPOA 1BR2A 3DU6A 3TBIA 3VWBA 3OYGA 2LH9A 3L2RA 4RLFA 4PJNA 2BOLA 2ELJA 2M3AA 3KYLA 3SZGA 2A6TA 2KRCA 2CV1A 2LOOA 2CS3A 4CCJA 4XQFA 3PNTA 2Z16A 1UELB 2HVQA 1X1CA 2WADA 4DBQA 2VLAA 2ZXHA 2PJRB 3CJRB 1X4OA 2KL4A 4PUSA 2WAFA 2W1OA 1MNEA 3QODA 4DBRA 4YELA 3ONQA 2V26A 4LITA 2K5CA 3PL8A 2HZDA 2HQAA 2IS4A 4B47A 3DTKA 2ZXIA 2CV2A 3OIPA 2GOMA 4XR6A 3CP8A 4PJMA 2L9NA 4BU2A 1WJFA 1BR1A 2IS2A 4XLHA 1VZ0A 2AQFA 4ZTJA 2X1CA 4ZDOA 2MFZA 4XKVA 3A2KA 4BEHB 3W2WA 2OC6A 3ZRGA 1N78A 3PSIA 3D5SC 2CFOA 4XL9A 3D5RC 2F6CA 2X6WA 1D0YA 1U0JA 2F4IA 3OWTA 4XMYA 3PNYA 1G59A 2KDOA 3CJQB 4CH7A 1IRXA 3DPUA 4N4OB 1X4PA 2VQHA 2BW3A 2HPIA 4RM2A 1WJ5A 4BQOA 4RM3A 1DP3A 3C2GA 2R7UA 3DKYA 5HLTA 2VASA 2PJRA 4XONA 1EA3A 3IAS2 1K6YA 1T95A 1HA8A 4KT6A 3H0DA 3K70D 1QU3A 3OYJA 3HL2A 2LY2A 3ZQQA 1WJCA 1LVKA 4Y3OA 3IUOA 4B43A 4BL0B 4E4HA 2KRHA 3LSGA 2Q2EB 1X1DA 4CCKA 3L2WA 1MW7A 2V1NA 3L2UA 2VIXA 4XORA 3BC8A 3VSLA 4QPQA 3C2HA 4BJ6C 5HNFA 2NOJB 2O5RA 2WAQA 1D1CA 3CMMA 2LG4A 2VQGA 3H9GA 2E1MB 4G6TB 3OYDA 3K4CA 1WFXA 5KCMA 3VSKA 3CP2A 4LG3A 4BEHA 4CZCA 2CMPA 4BE0A 1DQUA 4E7IA 1MMDA 2VJ5A 2R7VA 2M4KA 3BCBA 1G8XA 3OYEA 1Z3XA 4KISA 3FKJA 2R7XA 3FDYA 3G2BA 3AKZA 3A4CA 4PJLA 1JI8A 3H35A 4BXFA 5LFAA 4N4NB 4II2A 3M1CA 3QYEA 4P1WA 4F93B 1PJRA 3W2VA 2HVRA 5CPRB 3K4MA 2MC4A 4II3A 5FRMA 3LL7A 4HEA2 2HVSA 2V4JC 3DPLC 1V5EA 4XN3A 2Y0SA 5KHDA 3HOTA 3LSMA 4ZYAA 3OMYA 1DGRM 3UNGC 3DPTA 4YEJA 4IQJA 3M8JA 2VL8A 4XLEA 2PMZA 2VB6A 3OR1C 3I3LA 2V9KA 3H9QA 3PFYA 2CV0A 3U21A 2VJJA 3FBIB 1ERDA 3MD2A 3RPUD 3MMYB 4H4KC 2X85A 2VKHA 2XF6A 2BW3B 3K6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MKW B;  3VWB A;  1VZ0 A;  3MKZ A;  3MKY B;  3W3C A;  3W2A A; 
#chains in the Genus database with same CATH topology
 5C3E J;  2VQL A;  2V6C A;  2JA2 A;  1R23 A;  2M4G A;  1U9N A;  4LIU A;  3LSI A;  1V4R A;  4M3F A;  2JSP A;  1IN6 A;  2HTS A;  3RDI A;  2VJI A;  4IEJ A;  3M1E A;  1SD7 A;  4A2U A;  3ZQH A;  5K5R A;  4U7B A;  2IAI A;  2NVU B;  4YRV A;  2CH0 A;  1FJL A;  2OZ6 A;  4BJT A;  2P7C B;  3RKW A;  4IOA F;  2DQL A;  5BPD A;  3F6O A;  5EF6 A;  4JK1 X;  2EB7 A;  2L02 A;  5KVR A;  5L3D A;  1KON A;  1LEB A;  2MW8 A;  4XKC A;  3IV5 A;  4HG2 A;  5FRN A;  2IA2 A;  5EGO B;  3F21 A;  4M6V A;  3HHH A;  2HOA A;  1JUP A;  1P4W A;  3MKW B;  1NTC A;  4G6Q A;  1AKH B;  4OIQ F;  2W85 A;  1YW8 A;  3FM3 A;  4AVZ A;  4Y52 J;  3IWZ A;  4A3L J;  4BE1 A;  1ZEL A;  2E2H J;  4KIF A;  4TV7 A;  2AXT C;  1HOM A;  4UUS B;  2YPR A;  3OS2 A;  1W0U A;  3P9I A;  3I54 A;  1HQC A;  1A35 A;  2A6E F;  5CVJ A;  3MWM A;  4LB6 B;  2KQR A;  1XS9 A;  4BBS J;  3A02 A;  3ZXS A;  2LKX A;  1R6R A;  2R4G A;  1HKT A;  4NUB A;  2DFF A;  2MGQ A;  3RQ4 A;  4UUV A;  3G73 A;  3F22 A;  1L3L A;  1RI7 A;  3OYM A;  2I8D A;  3H92 A;  1FP1 D;  5FB2 A;  2GA1 A;  3S2H J;  2BY1 A;  3WGI A;  1R7J A;  1U6G A;  2XPW A;  2JSC A;  2OTL I;  5H2F C;  3BJ6 A;  3EPZ A;  4ZDL A;  4L5J A;  4GRI A;  1S3J A;  2VOP A;  1J9I A;  1YFH A;  1IN4 A;  2KLO A;  2M7A A;  2BHY A;  1D0X A;  3I9V 2;  3K0L A;  1OCR H;  2RKH A;  3IKV A;  2CW0 F;  2NAZ A;  2V9V A;  2ZC2 A;  2NVX J;  4BHP A;  1SC7 A;  2PLY A;  1VQN I;  2R5Y B;  4HNV A;  3ASN H;  2DPD A;  2KZG A;  2M45 A;  3RQI A;  2HFH A;  2JVG A;  3BG7 A;  4XIC A;  2M8E A;  3FHZ A;  2HQN A;  4PGH A;  2RRE A;  1OR7 A;  2DA7 A;  3HOU J;  3IKT A;  1XD7 A;  4GYI A;  3HOS A;  4BDZ A;  3LWF A;  1X1B A;  4KIG A;  5CJ9 A;  3FIS A;  1XN7 A;  3BPV A;  1OYW A;  3FK6 A;  1R49 A;  4NHJ A;  2K3F A;  1WH7 A;  4BHB A;  3JRB A;  4HF0 A;  1D3Y A;  2XRO A;  1J2X A;  2IS1 A;  3G1M A;  1XMX A;  2QCO A;  4XLP F;  1X1P A;  2E1M C;  2OAZ A;  4HSR A;  1T8I A;  3L2V A;  4DIQ A;  5EEG A;  2CQQ A;  3W3C A;  1S7E A;  1FBQ A;  1R58 A;  4RAY A;  4L9N A;  2VQC A;  3A01 B;  3L2Q A;  3VOE A;  3H3Z A;  1MMG A;  1T0F C;  4BXU A;  1DU0 A;  2Z2S B;  2GA2 A;  5HLI A;  5LGU A;  2Y31 A;  3KE2 A;  1VTN C;  2DFE A;  5F1R A;  1LUJ B;  4A3F J;  4Y13 A;  4KDP A;  3S1M J;  4HA8 A;  1O7L A;  4QLC U;  2COM A;  4KA4 A;  2E5N A;  3EYY A;  3J7Y J;  1PUF B;  3GO5 A;  3IH3 A;  3CO6 C;  2PMZ N;  2XHK A;  1PYV A;  1KQ8 A;  5GAD J;  4RS8 A;  5M5Y J;  5BOX A;  4MGR A;  2VBZ A;  2KT0 A;  2R7Q A;  1FIP A;  3RPQ A;  1J59 A;  1VQO I;  3I59 A;  3BG9 A;  2D2W A;  2PEX A;  3WTZ A;  2K3P A;  3JTH A;  1Z6R A;  1G3T A;  4DGW B;  4RGU A;  3K70 C;  3U1D A;  1HC8 A;  4BGD A;  3CCU I;  2FEZ A;  2W7N A;  5E8I A;  3CTA A;  3DEE A;  1QBJ A;  3QU6 A;  2R7F A;  2E35 A;  3PNV A;  4R1H A;  3BLY A;  1QPM A;  2JRT A;  4IL6 C;  5D8L B;  4YFN F;  1VQ4 I;  1OLT A;  2WY8 Q;  2Z9O A;  3F0C A;  3KEY A;  2GBY A;  2DQR A;  2A5W A;  3GBG A;  2DN0 A;  3WE2 A;  4AC0 A;  1T08 B;  4XM3 A;  4XLN F;  2KPM A;  1FIA A;  5AIP A;  3ZN1 A;  3E6C C;  4IHT A;  4HX7 A;  3OYL A;  2Y75 A;  3A0B C;  1W5C C;  2L7F P;  2WBM A;  4X1E A;  3O2P E;  2OD5 A;  3KYC B;  3VDX A;  4XNF A;  4ASN A;  2VOO A;  3HOW J;  4G12 A;  3ABU A;  4CSW A;  1FZP B;  4KNY A;  1JUS A;  5FFX A;  5FRO A;  3GZ6 A;  3E97 A;  3MKY B;  3ZQI A;  3D5L A;  3C3W A;  1Z1D A;  3L00 A;  4L5I A;  2HNH A;  5E3O A;  5TRD A;  2WTE A;  3PUB A;  1ORK A;  1MMN A;  1U2W A;  3JR9 A;  2LY1 A;  1GV5 A;  2HZT A;  2L2O A;  3P7N A;  3CUO A;  5FD6 A;  2VC0 A;  4IHY A;  2JMW A;  2P5K A;  2JUG A;  4XLC A;  2QQA A;  4FX0 A;  2QSH X;  4ZH4 F;  3WTT C;  2EWN A;  1R22 A;  3MAJ A;  5DM7 F;  1NK3 P;  1IDZ A;  3KZZ A;  3ECO A;  1G3S A;  3MQ0 A;  2AXL A;  1W0T A;  1TZL A;  1I3A A;  5EG0 A;  3T8R A;  2KIS A;  4BY7 J;  3V4G A;  4E70 A;  3CDI A;  2FQ4 A;  2YS9 A;  4I01 A;  4KFC A;  2TRT A;  1X2N A;  2ELK A;  3BJO A;  3S93 A;  4KIT B;  2XRN A;  4RBO A;  2KIQ A;  3K10 A;  3R61 A;  2X1D A;  4HF2 A;  3T0Y A;  2LNB A;  1V5F A;  2E7W A;  1KA8 A;  3ZQL A;  1K61 A;  1ZHF A;  2QKM B;  2QM3 A;  2W4S A;  4S05 A;  1Z3Y A;  2K9S A;  5ICG A;  1OCZ H;  5FKN A;  1O3S A;  3UR3 C;  1FWZ A;  2MLG A;  3KLO A;  4DYC A;  5GAG J;  1XSD A;  2IGM A;  2PMH A;  5DUI A;  2P0W A;  1T39 A;  5HDG A;  2ZME B;  5B66 C;  1FTZ A;  1SFE A;  3R4K A;  2M0C A;  5FJ8 J;  3E5U A;  3TBI A;  2RDP A;  3WHC A;  3VWB A;  5J6X A;  1SAX A;  1MD0 A;  2KIM A;  2LH9 A;  1JJ8 C;  2A07 F;  5J3L A;  2XKO A;  4R8H A;  2EBI A;  2ELJ A;  1BBY A;  3KYL A;  4ENM A;  3COA C;  3V8K A;  3WG9 A;  1WRJ A;  1TC3 C;  4LB5 A;  1TNS A;  3J7Z I;  1UEL B;  2HVQ A;  4DBQ A;  4OMY A;  3CJR B;  4XRS A;  3FXU A;  1X4O A;  2KL4 A;  2W1O A;  3C1D A;  1MNE A;  2WV1 A;  3QOD A;  1YO5 C;  1KU3 A;  2PFB A;  4YEL A;  1OMI A;  4M3E A;  3R0J A;  3GTO J;  3PL8 A;  1SVM A;  2HZD A;  4JX6 A;  2IP2 A;  1IUY A;  3A03 A;  2JUC A;  3DTK A;  1TWC J;  1XGM A;  3KYD B;  2ZME C;  1M1E B;  2CV2 A;  1LPQ A;  3OIP A;  1MMS A;  2D1H A;  3T5X A;  4BU2 A;  4LK1 F;  3M4O J;  4UUT A;  3R0A A;  3TOB A;  1OJL A;  1U5T A;  2ZJ2 A;  1KU9 A;  3OV8 A;  2MFZ A;  4XKV A;  4U7D A;  2HDC A;  4BEH B;  4XRS G;  1CF7 A;  2XAG A;  1N78 A;  1OYY A;  1OIS A;  2H27 A;  1ZN2 A;  3D5S C;  2FF4 A;  1Z6T A;  4X6A J;  3U1K A;  2X6W A;  3LOC A;  3OWT A;  2R0Q C;  4XMY A;  2KDO A;  3ULQ B;  4JYK A;  4CH7 A;  4QWQ A;  1LE8 B;  1P92 A;  2BXY A;  4DQ2 A;  5J8C A;  2FOK A;  5BNG A;  1FOW A;  1DP3 A;  3C2G A;  2R7U A;  5HLT A;  2VAS A;  4LG0 B;  4XON A;  1HKQ A;  3KP5 A;  4A3C J;  3K70 D;  1XGN A;  3OYJ A;  4BH9 A;  3HL2 A;  3BJA A;  1W5T A;  1WJC A;  2Q0O A;  3IUO A;  1FSH A;  3E6D A;  4D5F A;  2KRH A;  1X1D A;  2H8R A;  2NRA C;  3L2U A;  2VIX A;  4OOI A;  1TW2 A;  4BXX J;  1ZRC A;  1ZGW A;  1BC8 C;  4QPQ A;  2XB0 X;  2HEO A;  3J80 K;  2X4H A;  4ZZL A;  3FF5 A;  4EJW A;  3CMM A;  3IH2 A;  3H9G A;  1WFX A;  3FXL A;  3QPT A;  4FQG A;  4LG3 A;  4Y15 A;  4CZC A;  1RUN A;  2M2E A;  4BE0 A;  1MMD A;  2R7V A;  3F6V A;  3CUQ B;  3BCB A;  4KIS A;  1F5T A;  3ZMU A;  3WHB A;  2BBY A;  4I6Z A;  4O6J A;  3AKZ A;  2MH9 A;  4MFD A;  1C0W A;  1LB2 A;  5D5V B;  4II2 A;  3M1C A;  3NAU A;  4I09 A;  1P6R A;  1VQM I;  2Y2Z A;  2RVC A;  4P55 A;  2RQP A;  4L0Y B;  5E18 F;  4C3I J;  3AG4 H;  5J8F A;  4MO7 A;  1K4T A;  1FOY A;  2NVY J;  5CPR B;  3K4M A;  2MC4 A;  5DM6 F;  1R36 A;  4EJV A;  4XN3 A;  2Y0S A;  4LLL A;  2L3D A;  3ZMS A;  1P2F A;  1FC3 A;  4HW0 A;  4ZYA A;  1OCT C;  5LEK A;  3TP0 A;  3UNG C;  3Q9S A;  2V9P A;  4YEJ A;  1ACI A;  2GIV A;  3BQZ A;  4MHG A;  3LSP A;  5H6Q A;  3CUQ C;  2COB A;  3W6V A;  4CHU A;  3BTJ A;  1FX7 A;  1TNT A;  5IT9 K;  2V9K A;  2M9H A;  2VJJ A;  2F5F A;  1JTY A;  2CUF A;  4YFK F;  3CCV I;  2A6H F;  5K7F A;  3FWE A;  3IC7 A;  4M6X A;  1W4M A;  3K4N A;  3WE3 A;  3KP7 A;  2Q8K A;  4ZYE A;  3MCZ A;  2EFP A;  4CA0 A;  2LR8 A;  2DT7 B;  5DYM A;  1ZAO A;  1LKX A;  2VUM J;  4OIO F;  2F5V A;  3U2R A;  2RGV A;  3ZN0 A;  1B6A A;  2P7V B;  4BQA A;  2HKO A;  4A0Y A;  4D7N A;  2QQ8 A;  2VN2 A;  3OL4 A;  1V3F A;  5HS9 A;  4F3Q A;  4UVC A;  2EFO A;  3EUH A;  1ZKG A;  3P5J A;  2X48 A;  2L5Q A;  5KK1 A;  2HDD A;  1A6Q A;  3ZP5 A;  1OYI A;  2D45 A;  4YG2 F;  1YOV B;  3F8C A;  4E7Z A;  4UXN A;  3I56 I;  3TP3 A;  4BE2 A;  1FY7 A;  1RUO A;  1YRN B;  2PG4 A;  4CUG A;  3MZY A;  4AVP A;  3GCM A;  1O3R A;  1A31 A;  1YIJ I;  1UAA A;  1RC9 A;  1OFC X;  1K7A A;  1Y0U A;  1S5L C;  1W7P B;  2YX4 A;  2ZFW A;  3ROU A;  3CC4 I;  2QUF A;  1XSV A;  1F9N A;  2DA1 A;  4P5O A;  1IJW C;  2QQ9 A;  1G3W A;  1H89 C;  1FT9 A;  2LBF A;  2LMD A;  2VI6 A;  3O8G A;  3BR2 A;  3H5R A;  2NYX A;  2DA6 A;  1XMK A;  4KMU X;  4GCV A;  4LJZ F;  3LA3 A;  4J00 A;  1BIB A;  1N75 A;  4BJ5 C;  2R7R A;  1X19 A;  2L7K A;  1GHC A;  2G7U A;  5AON A;  5IOZ A;  2YR2 A;  1ENH A;  4PSW A;  3T8T A;  1ITY A;  1H88 C;  1B72 B;  2TDX A;  2XAH A;  2EK5 A;  4A3I J;  2X6O A;  4XSX F;  1O3T A;  2QZ8 A;  4U0Y A;  1T98 A;  2X0L A;  4KIB A;  5F1J A;  1HST A;  2CW8 A;  3Q0W A;  5GAH J;  1MJ9 A;  2DU9 A;  2IRF G;  3FXJ A;  4FET A;  5C4J J;  4N0B A;  4RB0 A;  3BWG A;  3ISP A;  3I58 A;  4EQQ A;  3KEO A;  3GEZ A;  1MDM B;  1O4X A;  1HW2 A;  3CDL A;  3HZJ A;  2LF8 A;  2KJC A;  1WI3 A;  4FE7 A;  2WA0 A;  3MZH A;  2DFH A;  1VND A;  2G0E A;  3TKY A;  4B48 A;  5LD2 C;  2M5W A;  4AD9 A;  4QTR A;  2CW7 A;  1V5G A;  3VYT B;  3S14 J;  5BPI A;  1TBX A;  4PSX A;  2E60 A;  1J7K A;  5LGN A;  3C2B A;  2K40 A;  1WJA A;  3IP4 B;  1DGW Y;  5J1R A;  3CES A;  5L3C A;  3V7R A;  2DOA A;  3V42 A;  1IZ1 A;  5J1Y A;  1LQ1 A;  3ESW B;  4OWR B;  4XRM A;  3CF2 A;  5F08 A;  1HXD A;  4C30 A;  1QZE A;  4HPQ A;  4BBR J;  3BQY A;  2F48 A;  3DP7 A;  3Q5F A;  1JTX A;  2FU4 A;  1WJD A;  2Z5U A;  4CCL A;  2XAQ A;  1QPI A;  1BL0 A;  2WB1 A;  1LDD A;  3F8B A;  2DCE A;  3HRU A;  4C2M J;  1SEU A;  2WV0 A;  2BVM A;  3ABM H;  1ON2 A;  3E6B A;  1JT6 A;  4HNT A;  2JN6 A;  3W6J B;  1U3E M;  1LDK B;  3FKI J;  2V1D A;  2EFQ A;  2X51 A;  3JRF A;  1PUE E;  1WJE A;  5CVI A;  3WTW C;  2VT2 A;  3JSP A;  3CCS I;  2FE3 A;  2DYS H;  5TGT A;  1YJ9 I;  3CMY A;  2DA4 A;  3LSH A;  1GV2 A;  2DJI A;  2PN6 A;  5LLQ A;  1KGS A;  2EIL H;  5DDG A;  5EZH A;  2VPL A;  1SMT A;  1T6S A;  2DXI A;  4EMS A;  3PJR A;  5DCM B;  4YIR X;  3DFG A;  3P9C A;  2IS6 A;  1E2X A;  5JLW A;  2Y0S N;  2VOD A;  1TW3 A;  1OCO H;  1J09 A;  4G7H F;  1FNN A;  3WU2 C;  4CDG A;  4NBQ A;  1KYW A;  1V54 H;  4F7Z A;  2W48 A;  3O6B B;  3FHN A;  2P5L C;  4I76 A;  4UNO A;  3KIO A;  2F5D A;  1Z7U A;  2N8G A;  3JAM Z;  1RKW A;  1UFM A;  4P96 A;  3CD6 I;  3O8H A;  3M3Y J;  4YFX F;  3TO6 A;  3HJE A;  2PBI A;  5L3B A;  5EDN A;  2LVS A;  4D7M A;  2O9L A;  1XGS A;  5FLX Z;  2OCC H;  4E7L A;  5FKO A;  1MBF A;  2MH2 A;  2FNP A;  4HYE A;  3V8L A;  3K1M A;  3E7L A;  1PVE A;  1X3Z B;  4ON0 A;  2OZU A;  1NG7 A;  5CQG A;  3M07 A;  1K78 A;  2KDZ A;  1BOB A;  3ZGK A;  2BY2 A;  1FMW A;  2VKV A;  1JHH A;  3ERE D;  1MKM A;  2ZO4 A;  3S32 A;  3FZV A;  5TJJ A;  2UXN A;  3CZ6 A;  2UWM A;  1YE9 A;  2ZJR F;  2HOT A;  1LJ9 A;  1VF9 A;  4QIW N;  3DKW A;  5D4R A;  4NDL A;  1WHU A;  4RGR A;  1HDD C;  2DTR A;  3RKY A;  1ETK A;  2QEX I;  2KZV A;  2OJE D;  4LD5 A;  4V2G A;  4LIV A;  2PJP A;  1VQ6 I;  2BV6 A;  2Z3Y A;  1Y1W J;  2ZXJ A;  3I5U A;  2KHM A;  4IVN A;  4Y7N J;  4D9J A;  1FLI A;  4EM0 B;  2IT0 A;  2R7O A;  2LP0 A;  2KKO A;  2NOG A;  2V79 A;  3BR6 A;  4RAG A;  4S0H B;  3OYA A;  4EGY A;  1YW9 A;  1IGN A;  1REP C;  4A3D J;  5M5W J;  3ZQG A;  3K1N A;  4B8X A;  4G94 A;  3I53 A;  1I1G A;  5IOY A;  3W2A A;  3HIF A;  2W82 A;  3DV8 A;  3OYF A;  3G3Z A;  3AG2 H;  2QYO A;  3NWS A;  1Z77 A;  3NWT A;  2FBH A;  5LGT A;  2FUG 2;  3TDZ C;  2ZNY A;  3W6K B;  1TP4 A;  2M1B A;  4HDU A;  2HDW A;  2OUM A;  1X3W B;  1ETW A;  5GTH C;  2O03 A;  5BMZ A;  1OQY A;  1IV8 A;  3Q9V A;  4IXA A;  1LEA A;  2F2E A;  1D5Y A;  3CMA I;  3VYS B;  4M3D A;  2AO9 A;  1USS A;  4C2U A;  2ZJQ F;  3HRM A;  2G7H A;  3PUF A;  2HQ5 A;  1A36 A;  1ZLJ A;  4HAM A;  2IEK A;  2DMT A;  3FBN B;  1TWF J;  3H5N A;  2BVL A;  2ID3 A;  2E2J J;  5ICF A;  4H0E A;  2R7T A;  2NXN B;  3QWL A;  4L5E A;  4NC6 A;  1U8R A;  4KMF A;  5DTD A;  2DA2 A;  2GXA A;  3OIO A;  2L7M P;  2MD0 A;  4EJU A;  1F1Z A;  3GZN B;  1W7P D;  5JFR A;  3H9J A;  3I55 I;  2QF7 A;  4IKF A;  3BG6 A;  4F55 A;  2WB1 N;  1CGP A;  2ELH A;  5GAE J;  2K9Q A;  1TT5 B;  3GTK J;  3KPH A;  3ML6 A;  2JPB A;  1I50 J;  2B63 J;  5IPA A;  2HWV A;  2EH3 A;  1J75 A;  5IP7 J;  1RKT A;  4B3X A;  1WVR A;  3BZK A;  4PK4 A;  1WPK A;  3ZMZ A;  1X1A A;  1Z67 A;  2F5C A;  2DOF A;  4M73 A;  3D0S A;  5HVQ C;  2NNN A;  4M6Y A;  3DU6 A;  3SXY A;  1Y8R B;  2E1C A;  2OBP A;  1K4S A;  4A3B J;  3QRF F;  4RLF A;  3HM5 A;  2JA5 J;  2EZI A;  1JUM A;  2DO7 A;  5LRS A;  1I27 A;  5H20 A;  2M3A A;  2M34 A;  3NAR A;  4WWC A;  1BM9 A;  2KRF A;  1D8K A;  3QU3 A;  5GPA A;  2IA0 A;  5EEA A;  3BY6 A;  5HDK A;  3IHU A;  1YW7 A;  1RZ4 A;  4WXH A;  4FHT A;  2OU2 A;  3CCJ I;  3NRV A;  4DBR A;  3BZ6 A;  3ONQ A;  4PGG A;  1FYL A;  5FKK A;  3BP8 A;  1BC7 C;  1HW1 A;  2IS4 A;  2LSO A;  5HS8 A;  4ENK A;  3WTX C;  2GOM A;  1R1U A;  4PJM A;  2L9N A;  2YUS A;  4EJT A;  1WJF A;  2K4J A;  3B02 A;  3L09 A;  4P9U A;  1HDP A;  4A12 A;  1POG A;  1VZ0 A;  4XLH A;  2DLL A;  2F4M B;  5K5Q A;  1R71 A;  3GWZ A;  3QP5 A;  3PQJ A;  2X1C A;  2E7X A;  3OSG A;  3HOY J;  4B1R A;  2BZT A;  2XIG A;  3KP3 A;  3A2K A;  1UHM A;  3ZMD A;  4HQM A;  2IVM A;  1YIT I;  3S17 J;  1WQ2 A;  5JHU A;  1IC8 A;  2ADU A;  1NHA A;  1P4A A;  1O3Q A;  2CFO A;  2MLK A;  4ENN A;  1QVU A;  1MBJ A;  3ABT A;  1D0Y A;  1U0J A;  4Z6Y A;  2F4I A;  5JI6 A;  4B3A A;  3WG7 H;  1IN8 A;  4MTD A;  3CJQ B;  2XVC A;  2OQG A;  4OIN F;  3H3U A;  4IF4 A;  1TQM A;  3FMR A;  4DYQ A;  2HPI A;  4RM2 A;  1SD4 A;  2DDA A;  4ETS A;  4I0A A;  1HKS A;  2CQX A;  3AG1 H;  3HOZ J;  2ETH A;  2PJR A;  3I4M J;  1EA3 A;  2LTP A;  5E17 F;  1HA8 A;  4KT6 A;  4L9J A;  1QU3 A;  2LY2 A;  4OIR F;  3WU0 A;  2A3S A;  4NB5 A;  1LVK A;  4AM3 A;  3FM5 A;  3LSG A;  4D0P A;  2Q2E B;  1ZG5 A;  1IO2 A;  3BC8 A;  1BN5 A;  3C2H A;  2ESN A;  2XKP A;  1EH6 A;  2O5R A;  5EGO A;  2VQG A;  4G6T B;  3OYD A;  3K4C A;  2BYV E;  5F64 A;  2IW5 A;  1YTY A;  2R93 J;  3CP2 A;  2XUB A;  1K6O A;  4XK4 A;  2CMP A;  1B1B A;  3BOQ A;  3JSO A;  1G8X A;  1E3H A;  3OYE A;  1S6L A;  1BJA A;  2DTZ A;  1IRG A;  4FX4 A;  2BXZ A;  3FDY A;  3G2B A;  3HDD A;  4IO9 F;  3ZQ7 A;  2XGX A;  3CLO A;  2B0L A;  3H35 A;  4YII A;  4BXF A;  4N4N B;  4Q5S F;  3FMS A;  4P1W A;  1ETX A;  1UHS A;  1I6H J;  1QVT A;  1WGX A;  4RB2 C;  3LL7 A;  3HHG A;  5A2Q Z;  2V4J C;  2XPU A;  4MEY F;  1BI3 A;  3DPL C;  1V5E A;  3E5Q A;  3RYR A;  4A3K J;  5KHD A;  1YI2 I;  2ME0 A;  3H3V K;  3CDH A;  3CCL I;  2LD5 A;  1K79 A;  1XG1 A;  3QPS A;  1BI0 A;  3HSE A;  3M9A A;  1UCR A;  4XLE A;  3J7A O;  3S1Q J;  3I3L A;  2CV0 A;  2R3S A;  3FBI B;  3C18 A;  3RPU D;  3MMY B;  4H4K C;  2X85 A;  1BW5 A;  1LFB A;  2BW3 B;  3K6G A;  1YS7 A;  2PX9 A;  3CJN A;  4RMN A;  4AYB A;  2R5Y A;  2BY3 A;  4ESF A;  2LLK A;  4IQ4 A;  2CFX A;  4MIM A;  3BR0 A;  1YJW I;  3I64 A;  3HRT A;  2MBF A;  2HXO A;  5L3G A;  2E5Z A;  2X1E A;  4ZDP A;  1S9H A;  3JTG A;  3CC7 I;  1T33 A;  2FJ1 A;  4Y17 A;  1WJB A;  2HGC A;  1T0F A;  4L9T A;  2ZFU A;  1ZRF A;  4A3J J;  4OAY A;  2K02 A;  3HBL A;  5CVR A;  2ME6 A;  5C44 J;  4HQE A;  2UV1 A;  1B8I B;  3AL0 B;  3DBH B;  1DUX C;  2K86 A;  1OKR A;  3FIW A;  2KP6 A;  4YIF A;  2QA4 I;  1J5Y A;  4PFP A;  4LLN A;  2IGK A;  4BY1 J;  2XDV A;  3OS0 A;  3K4J A;  2IBD A;  1Z21 A;  3LFK A;  1Z05 A;  1HBX G;  1FPQ A;  1ON1 A;  4W1U A;  1R1T A;  3F8M A;  3HSF A;  2VBW A;  1BIA A;  3PSF A;  3L9F A;  5CKT A;  3LSR A;  3WU1 B;  2M30 A;  2RQQ A;  4W97 A;  3LFU A;  1MGT A;  5GPC A;  2CUZ A;  2FOW A;  3F8N A;  3GVA A;  5CVU A;  1D1B A;  4Z2Y A;  4GO1 A;  1VQP I;  3GTL J;  3AFH A;  3DF8 A;  4Q48 A;  2LKP A;  3H5A A;  3QQA A;  3JRH A;  3CCE I;  1EJ9 A;  4E7H A;  5HDN A;  4E6K G;  4HNU A;  3F72 A;  3OL3 A;  3E0J B;  1PUF A;  2GXB A;  3F8F A;  3DQV C;  3HUG A;  4NNJ A;  3BG3 A;  3M7G A;  4ANJ A;  3IWF A;  2R7W A;  1IUF A;  4DOZ A;  4U0W A;  2GWR A;  3JRD A;  3N97 A;  4XKB A;  1E0E A;  4I7H A;  3N4M A;  4MLO A;  4C3J J;  4HX4 A;  2HYG D;  3E1S A;  4BUP A;  2MD5 A;  1R5G A;  2YSR A;  1Z0X A;  5IT3 A;  5CQE A;  5EZG A;  1EKE A;  2WAE A;  4IZZ A;  3TMO A;  3OSF A;  2STW A;  5KAF C;  1Z91 A;  4EAT A;  2VE8 A;  4E7S A;  1G4D A;  1O7F A;  3RSN A;  3VYU B;  4IHW A;  3DKX A;  3FXQ A;  1UG0 A;  2QBY A;  3GTM J;  2JA7 J;  3DXJ F;  2J5P A;  1I3Q J;  4OAZ A;  3I71 A;  4CCM A;  1R1V A;  4HX8 A;  1B9M A;  1SVO A;  1I1S A;  2O3F A;  4I02 A;  5B1A H;  2LRD A;  1H9T A;  1XCV A;  3PO2 J;  1GDT A;  1IN5 A;  2MAB A;  1R5I D;  3LSK A;  5D5U B;  4U0V A;  2NS0 A;  4LOC A;  3MFK A;  1WKM A;  4FT8 A;  3S2W A;  1Z7L A;  4XID A;  2Y30 A;  2E2I J;  3SDB A;  4HRI A;  3PQK A;  2H1L A;  4HF1 A;  1TQI A;  3EET A;  3DTI A;  3FXK A;  5FGM A;  4HZF A;  2K85 A;  4U88 A;  3IRQ A;  1APL C;  3LQQ A;  2DMQ A;  5D5X B;  1W36 D;  2HKX A;  1QHG A;  3OYB A;  2MA3 A;  1SAU A;  5K7Z A;  1XCB A;  4AWX B;  2QKL B;  2JPC A;  2PQ8 A;  1U78 A;  1AA7 A;  3TW6 A;  1TLH B;  2XSJ C;  3S1R J;  3HPG A;  2JZY A;  2DPU A;  2UZK A;  4PFO A;  2E34 A;  2V7F A;  4OU0 A;  4DYR A;  2KIU A;  2AHQ A;  1VQ7 I;  2VBY A;  1Y1V J;  3GX4 X;  2L7Z A;  2VJ4 A;  4EM2 A;  4FCY A;  5B1B H;  3VPR A;  5E8G A;  2W00 A;  4DZJ A;  3WOD F;  3SJM A;  3ZR8 X;  5J4Y A;  3OY9 A;  1QZY A;  1G2H A;  1YX5 A;  4IJA A;  3CC2 I;  2TCT A;  1S7O A;  4AYB N;  1LFP A;  3LA2 A;  4ZYH A;  1ZK8 A;  5E1X A;  3OOP A;  3S3O A;  2LFB A;  2M7B A;  1TWG J;  1QO0 D;  5HLH A;  3IL2 A;  1O57 A;  3E6M A;  1ZGJ A;  1SFU A;  2O8K A;  1SFK A;  3GTJ J;  1WCM J;  2R7S A;  4D1Q A;  4XBF A;  1D1A A;  5BQT A;  4PCQ A;  2QEN A;  5HOO A;  1ETY A;  4GXO A;  5E3L A;  4G9Y A;  2L9S A;  3QAH A;  3RYP A;  5F04 A;  1FSE A;  3QP6 A;  2EPF A;  4HV5 A;  3EYI A;  3RZO J;  3G4S I;  3SFZ A;  4O3M A;  2PMU A;  4P9F A;  3RZD J;  3ZCO A;  3KP4 A;  1A04 A;  3LQR A;  2MG4 A;  1NG6 A;  5LRR A;  2AQE A;  1ONV A;  2XSD C;  1RET A;  1YIO A;  2OTJ I;  2ZME A;  1YLF A;  1FTT A;  3J81 K;  4NC8 A;  3R6S A;  3S16 J;  2BEO A;  1B9N A;  2L0K A;  1W1W E;  5ILU A;  4PZJ A;  1RNL A;  2EV5 A;  3LMM A;  4ZZD A;  3LST A;  3RKQ A;  4E7K A;  1XDS A;  2CUJ A;  1OR7 C;  4KYW A;  3VFZ A;  3HG9 A;  5ILV A;  4AIH A;  3GW2 A;  4QSH A;  1BI2 A;  2GLO A;  4XLA A;  3GF2 A;  1XTA A;  5HNH A;  1UB9 A;  4L0Z B;  3IAM 2;  1KQ9 A;  5FLM J;  1DU6 A;  2XAU A;  1F43 A;  1X3U A;  5GP9 A;  1R4M B;  3DU5 A;  2CYY A;  5AIQ A;  5E20 A;  1RES A;  3KLN A;  2CQN A;  4WF2 A;  2CGP A;  1VQ8 I;  1Y39 A;  4CCN A;  4E7J A;  1BI1 A;  1U8B A;  4NQW A;  2VXD A;  3OYI A;  2KJB A;  3BCA A;  3ZMT A;  4F91 B;  3I59 B;  3CCY A;  1JKO C;  4HST A;  4GYG A;  4KUM A;  2MYS A;  5LEJ A;  1HF0 A;  1E17 A;  2E1O A;  3RTR A;  2DYR H;  1HSJ A;  2ESH A;  3GZ5 A;  1R00 A;  3TGN A;  4EV0 A;  2VKD A;  5M5X J;  2WC2 A;  2RN7 A;  2L9V A;  2L4M A;  5KAI C;  2WWY A;  1LE8 A;  3KCC A;  1RPW A;  2UUZ A;  3BTC A;  1SMY F;  1V55 H;  3BDD A;  4XOP A;  5F27 A;  1ZGA A;  4JP0 A;  2HQR A;  2CUE A;  2ZSI B;  5E3M A;  3DCF A;  4BAY A;  2FBK A;  1LNW A;  3K4B A;  1BJZ A;  3GLX A;  3F9K A;  4HLX A;  4LG0 A;  2OV7 A;  2UXX A;  3OOU A;  2E1N A;  3IRR A;  2XB5 A;  1WZ2 A;  3CF5 F;  1BW6 A;  4M72 A;  3RCO A;  3S1N J;  2EJR A;  3DTE A;  3L2C A;  4IHX A;  2GIZ A;  4WXD A;  1XPX A;  1E3O C;  5M3M J;  1S29 A;  2P5V A;  2QVO A;  2ZNZ A;  3TOA A;  4LK0 F;  3OYG A;  2HYJ A;  3VB2 A;  3L2R A;  1DP7 P;  1SFX A;  3MVP A;  4PJN A;  5IP9 J;  4M9Z A;  3S15 J;  2BOL A;  2FQ3 A;  3HOX J;  2K9N A;  2RV8 A;  4PDK A;  2A05 A;  3SZG A;  5LHI A;  1OCP A;  2R5Z A;  2CV1 A;  2LOO A;  2A69 F;  2CS3 A;  4CCJ A;  5JVG F;  1IXR C;  4XQF A;  2XRL A;  3CCM I;  5GTI C;  2VLA A;  2PJR B;  3B6A A;  1FP2 A;  2W25 A;  4PUS A;  4UVA A;  3CUQ A;  1RR8 C;  2WAF A;  2ISZ A;  2VKE A;  2V26 A;  4LIT A;  2K5C A;  4MNU A;  1YYV A;  2CU7 A;  2HQA A;  4B47 A;  4CYC A;  4MQV A;  2ZXI A;  4G8X A;  2QWW A;  4XRF A;  1HCR A;  2GM4 A;  1AHD P;  1MZB A;  1DPR A;  5FKL A;  1H0M A;  2DOD A;  4AUX A;  5BS6 A;  1BR1 A;  1MSE C;  1VQ9 I;  2IS2 A;  3WTS C;  2AQF A;  3QOP A;  5CVV A;  1N25 A;  5EG0 B;  4ZTJ A;  2R92 J;  3NEU A;  2FML A;  3W2W A;  1TWA J;  1QRY A;  5L3F A;  2OC6 A;  3ZRG A;  4A3E J;  4RB3 C;  5EJC A;  3PIO F;  1KU7 A;  3GTG J;  3K9T A;  3D5R C;  1ULY A;  4LGW A;  2CQK A;  2CQ7 A;  3PNY A;  5DV5 A;  1G59 A;  5ED4 A;  3DPU A;  3SZP A;  3ZMV A;  2XPV A;  3G1O A;  4N4O B;  1VQ5 I;  3F23 A;  1X4P A;  3K2Z A;  1NK2 P;  1SVL A;  1ZRE A;  9ANT A;  2NVT J;  1JKP C;  1X58 A;  4JX5 A;  1WJ5 A;  2RAE A;  4I0B A;  5D5W B;  4BQO A;  3K7A J;  2XGE A;  1LDJ A;  1AU7 A;  1K6Y A;  1T95 A;  2OCE A;  2E71 A;  4B4C A;  3ZQQ A;  3ASO H;  1GXP A;  4Y3O A;  4BL0 B;  2HI3 A;  3SDG A;  4J19 A;  4CCK A;  2V1N A;  4XOR A;  2OA4 A;  5D6F A;  1F4K A;  3JW4 A;  2XV4 S;  4BJ6 C;  2VC1 A;  2OF7 A;  2NOJ B;  3DBL B;  2DI3 A;  3TO7 A;  4UY8 I;  1XMA A;  3KZY A;  2NNY A;  1D1C A;  2EFW A;  2LG4 A;  2Y69 H;  4BYY A;  2E1M B;  1YRN A;  5KCM A;  3VSK A;  4KT5 C;  2V1X A;  5LBQ A;  3M8F A;  2JTV A;  2FNA A;  3I0T A;  1DQU A;  2CWE A;  4KIC A;  1KZH A;  3E3V A;  4E7I A;  2Y9Y A;  2IJL A;  3HTS B;  2FX0 A;  3HRS A;  1Z3X A;  4RAZ A;  3I4N J;  1KQ0 A;  1W7P A;  2R7X A;  4A3G J;  1D8J A;  3SZT A;  4PJL A;  4WX9 A;  1ZRD A;  3LSJ A;  3PIP F;  5LFA A;  4PJ0 C;  2WAQ N;  2H6B A;  4BKX A;  2BHZ A;  1PJR A;  5HS7 A;  3HB9 A;  4RB1 A;  3ABK H;  4AIJ A;  1RRJ A;  1U5T B;  3W2V A;  3WTY C;  2HVR A;  1FOX A;  3R60 A;  3BR1 A;  4CGZ A;  5FRM A;  3ECH A;  4HEA 2;  2HVS A;  2EZH A;  3LAJ A;  2L01 A;  3LSM A;  5DUK A;  1YJN I;  1R5H A;  2DMP A;  1DGR M;  1CF7 B;  3DPT A;  1B72 A;  2RC4 A;  2R7Z J;  2W24 A;  2NS7 A;  4IQJ A;  6PAX A;  2KFD A;  1UG2 A;  2CJJ A;  2P8T A;  3M8J A;  1TQP A;  2H6C A;  3JRI A;  1QA6 A;  1IXS B;  2VB6 A;  3OR1 C;  4G7Z F;  5J4V A;  2K7L A;  3PFY A;  1MDM A;  2VT3 A;  2JA6 J;  3JRE A;  5FFZ A;  3P9K A;  2VKH A;  1IW7 F;  2M8G X;  2XF6 A;  4ZYG A;  3Q0U A;  4FIS A;  2E19 A;  1S7A A;  2P4W A;  3EUA A;  5F6F A;  2Y9Z A;  2DDB A;  2P6T A;  1JGS A;  3MEX A;  2QGU A;  1U5T C;  2IA1 A;  2DJN A;  4D5C A;  4BS9 A;  3J80 Z;  3NQO A;  4RGS A;  5D6E A;  3SEQ A;  3HUG B;  2DT6 A;  5EEH A;  2ISY A;  2XAF A;  5DCF A;  3ABL H;  3G71 I;  1MBE A;  3MKL A;  3GLL A;  1YX3 A;  3HYI A;  1YQA A;  1BOA A;  1TTY A;  1YG2 A;  3RKX A;  3OYK A;  4EVI A;  4EEF G;  4CYD A;  2XAS A;  1ZH5 A;  3LNQ A;  2XC7 A;  2ZB9 A;  2H1K A;  2GZW A;  1JKR C;  3DWL E;  4F52 A;  4IHV A;  2VON A;  4C2T A;  3ZOB A;  2GOX B;  3SFI A;  3QPH A;  4PJJ A;  2X6Y A;  4AIK A;  3JRA A;  2LRE A;  2A68 F;  3HPH A;  4M9X A;  4MEX F;  5JR3 A;  1B4A A;  2QBY B;  3SEZ A;  3Q3S A;  2HPM A;  4XSZ F;  4IRI A;  1J0R A;  2XF5 A;  1X2M A;  4ITV A;  1N77 A;  1QNT A;  1VQK I;  3K2A A;  4IRH A;  5DCM A;  3HKZ A;  5DEQ A;  1FYM A;  2WY7 Q;  3HXL A;  2HS5 A;  3S3N A;  4XN0 A;  5IT9 Z;  1MH3 A;  4R79 A;  5JHF A;  4S04 A;  2V6E A;  2DT5 A;  4XKW A;  5IYC J;  4G7O F;  4MFE A;  2B7E A;  3J7A Y;  3KX2 A;  3EUK L;  2HU9 A;  3OYC A;  4IPA A;  4O5V A;  4BQQ A;  4KN4 X;  1Y8Q B;  4KJZ A;  1H8A C;  4I99 C;  3SHF A;  2XGD A;  1PDN C;  2A61 A;  3DEW A;  1IG7 A;  2Q1Z B;  4JQF A;  1CQT A;  4CCO A;  4HLY A;  1W36 C;  4A5M A;  4JX4 A;  1ETV A;  1VFC A;  4A69 C;  4BDY A;  1AKH A;  3TO9 A;  3JAM K;  1EF4 A;  4OIP F;  3FXR A;  4I98 B;  4M3G A;  4C9Y A;  2K9L A;  1EV7 A;  1GUU A;  3ZQC A;  4UB8 C;  1QHH D;  3S2D J;  5FLV A;  1W5S A;  1B59 A;  3A1Y A;  4IRG A;  1Y6I A;  1MH4 A;  1JGG A;  2A5Y B;  3HEF A;  5FLX K;  1A5J A;  4UUS A;  1UJ8 A;  2FA5 A;  2YU9 J;  3GFM A;  1YS6 A;  3N05 A;  3CLQ A;  3OR2 C;  2DK5 A;  4RAF A;  3VEP A;  4UV8 A;  5E79 C;  2HXI A;  4ZC3 A;  3ZQF A;  1BR4 A;  4UB6 C;  3WTU C;  4KN7 X;  5F0C A;  1STZ A;  1ZTR A;  3OS1 A;  5KNL A;  3JRG A;  4IOC F;  2KMU A;  5JVT A;  2DMU A;  1QZZ A;  2O61 A;  2JWT A;  1ZYR F;  1ZLK A;  4HOB A;  3HGG A;  1K83 J;  2O7O A;  2FD5 A;  1OPC A;  3DBR B;  2ZSH B;  1P4X A;  3LA7 A;  1HW5 A;  1P7J A;  3RPU A;  5D4S A;  4ESB A;  3KFW X;  3FX3 A;  5M3F J;  1TWH J;  4BAC A;  3GME A;  4N9H A;  1D0Z A;  2EA4 A;  3J81 Z;  2C6Y A;  3FXM A;  2EZL A;  2LBF B;  3TW7 A;  4X0G A;  1QGP A;  3EUH C;  3FXO A;  2F5E A;  5LHG A;  4B09 A;  4UHT A;  1MND A;  2O0Y A;  3RIR A;  1S8N A;  4Y33 A;  2HYF A;  1ZG3 A;  3F3X A;  3TDU C;  3SQN A;  3SYT A;  4F92 B;  4BQN A;  3UKG A;  1JE8 A;  5B3S H;  3BR3 A;  1GT0 C;  4M3B A;  5IY5 H;  3HC7 A;  4ESJ A;  2EQR A;  1IDY A;  4NC7 A;  5E1Z B;  5FD5 A;  2JVH A;  2V1U A;  3X2Q H;  5F0F A;  3S3M A;  4GFB A;  3KEQ A;  1FOK A;  1XGO A;  2FMY A;  4ENJ A;  2M87 A;  3CCR I;  4CXF A;  5HLG A;  1AWC A;  2K9M A;  1UST A;  2I5U A;  3PM1 A;  4LFU A;  2L54 A;  2EV6 A;  2VE9 A;  1QQI A;  1GXQ A;  2IGO A;  2JJ7 A;  3MZ8 A;  1R4N B;  3JCU C;  1WI9 A;  2HOE A;  2ZCW A;  4Y4R A;  4AID A;  2YU3 A;  4AU7 A;  4ABZ A;  1Q1V A;  2QLZ A;  2GAU A;  4M71 A;  5K7H A;  1RR7 A;  2JK3 A;  1EH8 A;  2PI0 A;  2CG4 A;  4ZJZ A;  3TL4 X;  1YHQ I;  2OQR A;  3E5X A;  3A01 A;  2EZK A;  5IYD J;  5D8K B;  1LVA A;  3OIQ A;  2DA5 A;  2HOS A;  2DBB A;  4NQW B;  4M74 A;  5J40 A;  3HOV J;  2M0M A;  2H94 A;  2JQ7 A;  4ZYD A;  5ICE A;  4JOM A;  4EM1 A;  1T38 A;  1S72 I;  4I2O A;  1NH3 A;  3AL0 C;  1MMA A;  1GVJ A;  4Q47 A;  4XOT A;  2O6G E;  3GTP J;  3KP6 A;  3BPX A;  4UV9 A;  4DJA A;  1G3Y A;  4A0X A;  3BZC A;  2Z1D A;  2O8X A;  3A0H C;  3QYB A;  5H6R A;  3MKZ A;  1ZR2 A;  4BNC A;  2X6X A;  2ZXW H;  4DZP A;  2G9W A;  2EIN H;  2HTJ A;  2IGN A;  3HKZ N;  3ELK A;  3PFI A;  1XB4 A;  3K69 A;  3GFJ A;  4JBA A;  4C3H J;  2ECB A;  4ZTF A;  1ZG1 A;  3V8J A;  2LYC A;  1BA5 A;  3IH4 A;  3KET A;  2STT A;  1JXS A;  1SAN A;  4CZZ A;  1Y0N A;  1IRF A;  1Y56 A;  2MC3 A;  4RLQ A;  2LKS A;  2ZBK A;  1PP8 F;  4MQ9 F;  4FAS D;  2X9D A;  1JKQ C;  4DNC A;  4A6E A;  1FMV A;  2GXG A;  2OPT A;  1XX5 A;  3Q0V A;  3OYN A;  2EIM H;  3L7W A;  4M9S A;  3H1C A;  2CSO A;  2RNG A;  1JHF A;  5IYB J;  5K1Y A;  5FO5 A;  5C4X J;  3TQN A;  2LF7 A;  2R5Z B;  2EV0 A;  4RDU A;  3MN2 A;  2J5O A;  3K4L A;  5TIS C;  1HLV A;  1FYK A;  2NS8 A;  4IX7 A;  4B44 A;  3BRO A;  2VXZ A;  3QYF A;  3BT9 A;  2Z33 A;  4UVB A;  4XLF A;  5DD8 A;  4J01 A;  3QOE A;  3K1P A;  3C7J A;  4LLG F;  3RJP A;  3OYH A;  1ZR4 A;  5DD4 A;  4A0Z A;  1MSF C;  4HDV A;  4CYC B;  1K78 B;  3L1P A;  1RIO H;  3GFL A;  2K4B A;  4A93 J;  3S8P A;  4FTH A;  2LC2 A;  2ZJP F;  1ETO A;  1GLN A;  2MSY A;  3VYR B;  4Q4Z F;  4N9I A;  2IXS A;  4V19 K;  1GVD A;  2D1V A;  1TT0 A;  1MJA A;  1P9Q C;  3K4K A;  2VBX A;  2XF7 A;  3VOD A;  3CCQ I;  2H09 A;  1SD6 A;  1ZQ3 P;  2IPQ X;  1U9O A;  2CO5 A;  3EQL F;  1FBU A;  3DLA A;  5J1U A;  4U87 A;  2H8W A;  1MBH A;  4MTE A;  4QPO A;  1JJ6 C;  2Q2E A;  1BR2 A;  4HBL A;  2FSW A;  5ILS A;  4L9V A;  1G6N A;  5E3N A;  2RNJ A;  3DEU A;  2W57 A;  3DLL F;  3PO3 J;  2DK8 A;  3GXO A;  1F36 A;  3FMQ A;  1FEX A;  2A6T A;  2KRC A;  3G1L A;  3HSR A;  5E1W A;  3T1B A;  2DW4 A;  3CQZ J;  2Z16 A;  2QSF X;  2Z99 A;  3PNT A;  2ZKZ A;  1X1C A;  2WAD A;  2ZXH A;  2AS5 F;  4IHS A;  1D5V A;  1FBS A;  1UZC A;  2FBI A;  2L4A A;  3EDP A;  4EJO A;  3AAF A;  2FXA A;  5L3E A;  1IF1 A;  1XDU A;  4RGX A;  1Z9C A;  1R9T J;  1PP7 U;  4A5N A;  4CIC A;  3V7S A;  4XR6 A;  3REO A;  3CP8 A;  2DOE A;  1VQL I;  2BY0 A;  2I10 A;  1WH5 A;  1LFU P;  2LK2 A;  5JLX A;  3JRC A;  4ZDO A;  3WGH A;  1UHW A;  5HOD A;  3ZPL A;  3TED A;  2BE5 F;  3BG5 A;  5CYV A;  1ZAR A;  1XSX A;  2EIJ H;  1UMQ A;  1ETQ A;  3PSI A;  3WTV C;  1MBG A;  3CJT B;  2P81 A;  2YX7 A;  4XL9 A;  2LDU A;  2F6C A;  1T56 A;  3WGG A;  2JA8 J;  4G6D A;  1WSU A;  2XGC A;  1SD5 A;  1AOY A;  5A2Q K;  2B9S A;  2DAO A;  1IRX A;  3GUD A;  5F0H A;  3D1N I;  4GGG A;  3AG3 H;  3BTL A;  1XC5 A;  1E3P A;  3B6C A;  1TL8 A;  2VQH A;  3M8E A;  2BW3 A;  1A6I A;  2VPR A;  4FE4 A;  4RM3 A;  2XAJ A;  4WXC A;  3DKY A;  1KYZ A;  3IAS 2;  1DPU A;  3GTQ J;  3H0D A;  2KIF A;  2EA2 A;  3V7C A;  3H36 A;  3GFI A;  1MIJ A;  4K2E A;  2GQQ A;  1H9G A;  1P7I A;  4B43 A;  4V2F A;  3BR5 A;  4E4H A;  4WCG A;  3HTU A;  1JT0 A;  1MBK A;  2EIK H;  5CLS A;  1MW7 A;  3L2W A;  1MJB A;  1ODD A;  3VSL A;  2DA3 A;  3CME I;  1IRZ A;  3ERM A;  5HNF A;  1B8I A;  2P6S A;  1DDN A;  2DFI A;  2WAQ A;  4BHC A;  1IV6 A;  1MNM C;  1EH7 A;  2E36 A;  3CO7 C;  2Y0M A;  4A3M J;  4DW6 A;  4BEH A;  2JRM A;  1SFO J;  2ACJ A;  5LHH A;  2VJ5 A;  3HGY A;  2M4K A;  5J47 A;  3GYH X;  5IP6 A;  3FKJ A;  2NVQ J;  4HV6 A;  2JT1 A;  2Y48 A;  4LMY A;  2QQB A;  3A4C A;  1JI8 A;  4RA2 A;  4CO8 A;  1KU2 A;  2EFN A;  2ID6 A;  1L0O C;  3QYE A;  3G6E I;  1T2K A;  3H0G J;  1I5Z A;  3B73 A;  4EGZ A;  4F93 B;  5EYR A;  3LAP A;  2K27 A;  1Q1H A;  3O3K A;  2W84 A;  4II3 A;  1IXC A;  3QPL A;  4WK8 F;  2ICW G;  5K5O A;  2DMN A;  3HOT A;  5B5E C;  4A6D A;  1I39 A;  2L9R A;  1I6X A;  5DS9 A;  3RI4 A;  2QSG X;  3OMY A;  4GDF A;  1IN7 A;  1WWX A;  2HR3 A;  1OCC H;  3FK7 A;  5ICC A;  4OMZ A;  2VL8 A;  3KP2 A;  2CRG A;  2PMZ A;  3U9G A;  4L18 B;  3KZI C;  1VI0 A;  2FRH A;  3H9Q A;  2LY9 A;  3U21 A;  2R7D A;  5ERI A;  3MD2 A;  1ERD A;  3BTI A;  2F4O B;  2ECC A;  2BGC A;  5FKM A;  1IAW A;  3I4P A;  2D5V A; 
#chains in the Genus database with same CATH homology
 3EUA A;  2VQL A;  4RMN A;  3K4N A;  4AYB A;  2JA2 A;  2M4G A;  4CA0 A;  4IQ4 A;  2DT7 B;  4LIU A;  4BS9 A;  3LSI A;  1LKX A;  2F5V A;  2JSP A;  3SEQ A;  2VJI A;  3HUG B;  2DT6 A;  2E5Z A;  2X1E A;  4ZDP A;  1S9H A;  3OL4 A;  4U7B A;  1WJB A;  4YRV A;  2ZFU A;  2CH0 A;  4BJT A;  4OAY A;  4F3Q A;  1YX3 A;  2UV1 A;  3OYK A;  1KON A;  2L5Q A;  3AL0 B;  4XKC A;  4HG2 A;  5FRN A;  2XC7 A;  4E7Z A;  4BE2 A;  2KP6 A;  3MKW B;  4CUG A;  3DWL E;  4PFP A;  4F52 A;  2IGK A;  2XDV A;  3OS0 A;  1UAA A;  4C2T A;  2GOX B;  3K4J A;  4PJJ A;  2X6Y A;  4AVZ A;  2LRE A;  1Z21 A;  3HPH A;  4BE1 A;  1ZEL A;  3SEZ A;  2HPM A;  3OS2 A;  2XF5 A;  4P5O A;  3PSF A;  5CKT A;  4ITV A;  1N77 A;  2RQQ A;  2KQR A;  2LBF A;  3LFU A;  2CUZ A;  1D1B A;  3ZXS A;  3H5R A;  1R6R A;  2R4G A;  3HKZ A;  3AFH A;  4NUB A;  3RQ4 A;  2WY7 Q;  3HXL A;  3S3N A;  4XN0 A;  3H5A A;  5JHF A;  4R79 A;  4J00 A;  4E7H A;  1N75 A;  4BJ5 C;  4E6K G;  4HNU A;  3OL3 A;  3E0J B;  2R7R A;  1X19 A;  2L7K A;  4XKW A;  3OYM A;  2I8D A;  3J7A Y;  4PSW A;  3KX2 A;  3DQV C;  3EUK L;  4NNJ A;  2HU9 A;  4ANJ A;  3OYC A;  4BQQ A;  2R7W A;  2CW8 A;  4DOZ A;  4KJZ A;  4FET A;  3EPZ A;  4XKB A;  1E0E A;  2Q1Z B;  4JQF A;  4MLO A;  4CCO A;  4ZDL A;  4GRI A;  1W36 C;  3E1S A;  2KLO A;  2M7A A;  4BUP A;  1D0X A;  3I9V 2;  5CQE A;  2WAE A;  2WA0 A;  4B48 A;  4IZZ A;  3TMO A;  5LD2 C;  4BDY A;  4EAT A;  2CW7 A;  1V5G A;  3VYT B;  4E7S A;  4C9Y A;  2K9L A;  4PSX A;  2E60 A;  1QHH D;  2JVG A;  3BG7 A;  1WJA A;  3A1Y A;  3IP4 B;  1DGW Y;  1Y6I A;  3RSN A;  3CES A;  3VYU B;  2DOA A;  2RRE A;  3V42 A;  3DKX A;  1UG0 A;  4OWR B;  3CF2 A;  3HOS A;  4C30 A;  3N05 A;  4BDZ A;  4HPQ A;  3OR2 C;  1X1B A;  4OAZ A;  1WJD A;  4ZC3 A;  1BR4 A;  4CCL A;  4CCM A;  2WB1 A;  2DCE A;  3OS1 A;  5KNL A;  2BVM A;  2LRD A;  2IS1 A;  2KMU A;  4HNT A;  2MAB A;  1LDK B;  3LSK A;  2E1M C;  2X51 A;  4HSR A;  3L2V A;  1WJE A;  1Z7L A;  4DIQ A;  3W3C A;  2ZSH B;  3SDB A;  5TGT A;  4HRI A;  2VQC A;  3DTI A;  3LSH A;  2DJI A;  3L2Q A;  4BAC A;  1MMG A;  1W36 D;  2VPL A;  1D0Z A;  1T0F C;  2DXI A;  1QHG A;  3OYB A;  2Z2S B;  1SAU A;  2LBF B;  4X0G A;  3PJR A;  3EUH C;  2QKL B;  2IS6 A;  1AA7 A;  2XSJ C;  1MND A;  3HPG A;  1J09 A;  4Y33 A;  2E5N A;  4PFO A;  3SYT A;  2V7F A;  4F92 B;  4BQN A;  3FHN A;  2VJ4 A;  3HC7 A;  4NC7 A;  1PYV A;  2JVH A;  3S3M A;  2W00 A;  3ZR8 X;  3OY9 A;  1YX5 A;  2R7Q A;  2K9M A;  1LFP A;  4E7L A;  3S3O A;  2M7B A;  2K3P A;  2IGO A;  4DGW B;  1SFK A;  3K70 C;  4Y4R A;  4BGD A;  2R7S A;  4AU7 A;  4D1Q A;  2W7N A;  1D1A A;  3DEE A;  1NG7 A;  5HOO A;  5CQG A;  4ZJZ A;  3TL4 X;  2L9S A;  1BOB A;  3PNV A;  3BLY A;  3ZGK A;  1FMW A;  3OIQ A;  1OLT A;  2WY8 Q;  4NQW B;  3KEY A;  3S32 A;  3ZCO A;  2A5W A;  2M0M A;  3GBG A;  3CZ6 A;  4XM3 A;  1YE9 A;  2KPM A;  4JOM A;  2UWM A;  3AL0 C;  1MMA A;  1NG6 A;  4XOT A;  3OYL A;  4DJA A;  2AQE A;  2WBM A;  2KZV A;  2Z1D A;  3VDX A;  4XNF A;  4LIV A;  4NC8 A;  4CSW A;  3QYB A;  5FRO A;  3MKZ A;  3MKY B;  3LMM A;  2X6X A;  3D5L A;  2KHM A;  4E7K A;  2CUJ A;  4D9J A;  1OR7 C;  2IGN A;  2HNH A;  3HG9 A;  2R7O A;  3PUB A;  3OYA A;  4ZTF A;  1MMN A;  2LYC A;  4XLA A;  2LY1 A;  2L2O A;  5HNH A;  1Y56 A;  3W2A A;  3IAM 2;  2W82 A;  3OYF A;  4RLQ A;  2XAU A;  3NWS A;  2JUG A;  4XLC A;  3NWT A;  4FAS D;  3DU5 A;  2FUG 2;  1FMV A;  2HDW A;  2OUM A;  3OYN A;  4CCN A;  4E7J A;  2RNG A;  1TZL A;  3VYS B;  2VXD A;  3OYI A;  3BCA A;  4C2U A;  3K4L A;  4F91 B;  4IX7 A;  4HST A;  4B44 A;  2MYS A;  3FBN B;  3H5N A;  2VXZ A;  2BVL A;  3QYF A;  3RTR A;  4XLF A;  2R7T A;  4J01 A;  3QOE A;  3OYH A;  2VKD A;  3S93 A;  4KIT B;  3K10 A;  2MD0 A;  2X1D A;  3H9J A;  3S8P A;  2UUZ A;  2LC2 A;  4IKF A;  1GLN A;  1V5F A;  3BG6 A;  3VYR B;  4F55 A;  4XOP A;  2IXS A;  2QKM B;  1TT0 A;  1P9Q C;  2W4S A;  2ZSI B;  1Z3Y A;  3K4K A;  3K4B A;  2XF7 A;  3F9K A;  2OV7 A;  3OOU A;  3UR3 C;  4B3X A;  2IGM A;  4PK4 A;  2V6E A;  2P0W A;  1X1A A;  3RCO A;  3DTE A;  3DLA A;  4U87 A;  5HVQ C;  4QPO A;  1BR2 A;  3DU6 A;  3TBI A;  3VWB A;  3OYG A;  2LH9 A;  3L2R A;  4RLF A;  4PJN A;  2BOL A;  2ELJ A;  2M3A A;  3KYL A;  3SZG A;  2A6T A;  2KRC A;  2CV1 A;  2LOO A;  2CS3 A;  4CCJ A;  4XQF A;  3PNT A;  2Z16 A;  1UEL B;  2HVQ A;  1X1C A;  2WAD A;  4DBQ A;  2VLA A;  2ZXH A;  2PJR B;  3CJR B;  1X4O A;  2KL4 A;  4PUS A;  2WAF A;  2W1O A;  1MNE A;  3QOD A;  4DBR A;  4YEL A;  3ONQ A;  2V26 A;  4LIT A;  2K5C A;  3PL8 A;  2HZD A;  2HQA A;  2IS4 A;  4B47 A;  3DTK A;  2ZXI A;  2CV2 A;  3OIP A;  2GOM A;  4XR6 A;  3CP8 A;  4PJM A;  2L9N A;  4BU2 A;  1WJF A;  1BR1 A;  2IS2 A;  4XLH A;  1VZ0 A;  2AQF A;  4ZTJ A;  2X1C A;  4ZDO A;  2MFZ A;  4XKV A;  3A2K A;  4BEH B;  3W2W A;  2OC6 A;  3ZRG A;  1N78 A;  3PSI A;  3D5S C;  2CFO A;  4XL9 A;  3D5R C;  2F6C A;  2X6W A;  1D0Y A;  1U0J A;  2F4I A;  3OWT A;  4XMY A;  3PNY A;  1G59 A;  2KDO A;  3CJQ B;  4CH7 A;  1IRX A;  3DPU A;  4N4O B;  1X4P A;  2VQH A;  2BW3 A;  2HPI A;  4RM2 A;  1WJ5 A;  4BQO A;  4RM3 A;  1DP3 A;  3C2G A;  2R7U A;  3DKY A;  5HLT A;  2VAS A;  2PJR A;  4XON A;  1EA3 A;  3IAS 2;  1K6Y A;  1T95 A;  1HA8 A;  4KT6 A;  3H0D A;  3K70 D;  1QU3 A;  3OYJ A;  3HL2 A;  2LY2 A;  3ZQQ A;  1WJC A;  1LVK A;  4Y3O A;  3IUO A;  4B43 A;  4BL0 B;  4E4H A;  2KRH A;  3LSG A;  2Q2E B;  1X1D A;  4CCK A;  3L2W A;  1MW7 A;  2V1N A;  3L2U A;  2VIX A;  4XOR A;  3BC8 A;  3VSL A;  4QPQ A;  3C2H A;  4BJ6 C;  5HNF A;  2NOJ B;  2O5R A;  2WAQ A;  1D1C A;  3CMM A;  2LG4 A;  2VQG A;  3H9G A;  2E1M B;  4G6T B;  3OYD A;  3K4C A;  1WFX A;  5KCM A;  3VSK A;  3CP2 A;  4LG3 A;  4BEH A;  4CZC A;  2CMP A;  4BE0 A;  1DQU A;  4E7I A;  1MMD A;  2VJ5 A;  2R7V A;  2M4K A;  3BCB A;  1G8X A;  3OYE A;  1Z3X A;  4KIS A;  3FKJ A;  2R7X A;  3FDY A;  3G2B A;  3AKZ A;  3A4C A;  4PJL A;  1JI8 A;  3H35 A;  4BXF A;  5LFA A;  4N4N B;  4II2 A;  3M1C A;  3QYE A;  4P1W A;  4F93 B;  1PJR A;  3W2V A;  2HVR A;  5CPR B;  3K4M A;  2MC4 A;  4II3 A;  5FRM A;  3LL7 A;  4HEA 2;  2HVS A;  2V4J C;  3DPL C;  1V5E A;  4XN3 A;  2Y0S A;  5KHD A;  3HOT A;  3LSM A;  4ZYA A;  3OMY A;  1DGR M;  3UNG C;  3DPT A;  4YEJ A;  4IQJ A;  3M8J A;  2VL8 A;  4XLE A;  2PMZ A;  2VB6 A;  3OR1 C;  3I3L A;  2V9K A;  3H9Q A;  3PFY A;  2CV0 A;  3U21 A;  2VJJ A;  3FBI B;  1ERD A;  3MD2 A;  3RPU D;  3MMY B;  4H4K C;  2X85 A;  2VKH A;  2XF6 A;  2BW3 B;  3K6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...