3MKZA

Structure of sopb(155-272)-18mer complex, p21 form
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
112
structure length
112
Chain Sequence
b'PTSAYERGQRYASRLQNEFAGNISALADAENISRKIITRCINTAKLPKSVVALFSHPGELSARSGDALQKAFTDKEELLKQQASNLHEQKKAGVIFEADEVITLLTSVLKTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein sopB
publication title Insight into F plasmid DNA segregation revealed by structures of SopB and SopB-DNA complexes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna-binding protein/dna
total genus 35
structure length 112
sequence length 112
chains with identical sequence B, N, U
ec nomenclature
pdb deposition date 2010-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18090 SoPB_HTH Centromere-binding protein HTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2830 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3mkzA00
3W2AA 3MKYB 1VZ0A 3MKZA 3W3CA 3MKWB 3VWBA
chains in the Genus database with same CATH superfamily
2EIJH 3ZQLA 3MWMA 2R7QA 1ETXA 2VT2A 3D1NI 1X1PA 5DCMA 3WHBA 3JTGA 3K70C 3LQRA 2E2IJ 1U5TA 3TEDA 2Y0MA 2HQAA 3WTYC 1WI3A 4C9YA 3DTIA 4AIKA 5EZGA 3GTJJ 2RQQA 5EEGA 2FJ1A 1XB4A 5KAIC 2PN6A 4CICA 3K4JA 3FXMA 1OCTC 5FD6A 5J8FA 1W1WE 3OR2C 2O8XA 2CQKA 3TL4X 4ZYEA 3G1OA 3K4LA 4L9NA 2FBHA 4GYIA 3DTKA 3FBIB 1S8NA 2RAEA 3KZZA 4M3BA 1GLNA 3F8NA 2EA2A 5D6EA 2V1DA 2XASA 4K2EA 2OAZA 4BHCA 3MN2A 4IX7A 1BJAA 2EK5A 1FTTA 4M71A 2MD5A 2EPFA 1K4TA 3K4BA 1MJ9A 4MGRA 2VODA 2Z9OA 3SZTA 5K5OA 1BIBA 3RPUD 5M5WJ 1BOBA 1IJWC 1J9IA 5HOOA 1B8IA 1RRJA 2YX4A 3ZMDA 3ZQHA 1KONA 4XSZF 1SFOJ 1SD5A 2XKPA 4V2FA 2H8WA 1GXPA 4S0HB 3V8KA 1LKXA 1PJRA 2TRTA 4B3XA 4N4OB 3DBRB 4D5CA 4BJ5C 3DFGA 1E2XA 4C3JJ 1S9HA 4F3QA 4EJTA 2XC7A 1X2MA 3GEZA 1GV5A 2M2EA 2LF7A 1SMYF 2ME0A 2Y0SN 2DMTA 3JR9A 4JX4A 1U5TC 1WZ2A 4FQGA 1VQLI 2AS5F 4PJMA 4NC7A 5TRDA 4A5MA 3HB9A 3WGGA 4J00A 4AD9A 2ZO4A 2F4MB 4JBAA 3KP5A 3HOZJ 1ZG3A 4XMYA 3H9JA 1G6NA 1OCZH 1T08B 3PNTA 2FOWA 1XD7A 2FMYA 4EM0B 3IAM2 4C2TA 2R7SA 2CG4A 5E79C 5IP6A 1KQ9A 4L9VA 3OYLA 2DFHA 2KDZA 2BYVE 3J80K 4N9HA 1X1AA 1WVRA 3DEWA 4MTEA 1XDUA 4XLHA 3WG7H 5CPRB 2CV2A 3I3LA 1W5SA 5LHHA 2H09A 2NVQJ 4I99C 1J7KA 2CW8A 3BOQA 3ZN1A 1SAXA 4DBRA 3CUQA 1W5TA 4H4KC 1WJ5A 2KFDA 2Y69H 4DIQA 4JP0A 1XS9A 2R7OA 2QQ8A 3DBLB 3ONQA 3RYPA 2PFBA 3OYHA 1Y8QB 4JX5A 1WH5A 2L7FP 1DP7P 3BG3A 3M8EA 4ASNA 2WV0A 5GTIC 1PUFB 4I0BA 1E3HA 1TQMA 2LR8A 2QQ9A 2K9MA 3W3CA 4HF2A 2L9RA 4M6YA 3FHZA 3QP6A 2NS8A 4CYCA 4OMZA 5F0FA 1HW1A 1GV2A 2KDOA 2VIXA 2A61A 3GZ6A 1MBEA 2HKOA 3LSIA 2X4HA 2ZMEB 4L5JA 5H2FC 2KQRA 2Y30A 2ETHA 3K1PA 1LUJB 4A6EA 1AU7A 5GAHJ 4RAFA 2X48A 4OIPF 5GPCA 2M7AA 5IYBJ 3R61A 1LQ1A 2GOXB 1YE9A 1Z9CA 2V6EA 1K7AA 3Q0UA 3PO2J 3K4CA 4HPQA 1KQ0A 4DW6A 5K7FA 2DOAA 1AHDP 2ISZA 4PJLA 3BCBA 2R7FA 4A3LJ 2NVXJ 4XOTA 5J8CA 4CUGA 3IC7A 1FC3A 4LLLA 1MNMC 2EIMH 3LSRA 1OMIA 2NVTJ 1FTZA 4WX9A 1LJ9A 1K61A 2ECCA 4XRMA 4UUSB 2K4BA 4BJ6C 3D5RC 2LC2A 2CGPA 1MBKA 5B3SH 2L0KA 2QF7A 3TP0A 4PGHA 5CVRA 1FLIA 1SVOA 1D0YA 2E36A 2HTSA 4F7ZA 1T98A 2QWWA 2Z99A 2FUG2 5FROA 2CUEA 5HLIA 1Z6TA 3T5XA 3E6CC 4DYQA 2AQEA 4XM3A 2MBFA 3TO9A 2MLKA 4HSTA 5J3LA 4ON0A 4BUPA 2LY2A 2GOMA 3CLOA 3V8JA 4JOMA 2HXIA 3VOEA 3L2QA 5E1XA 2LD5A 2CUFA 4Y17A 4CZCA 3K70D 2JWTA 2DCEA 1Z1DA 2L4MA 2BVMA 4MFDA 2E5NA 3BG7A 2CQQA 5CVVA 4CCKA 4M6XA 1V4RA 1UMQA 3ZQQA 2OQRA 1XGOA 1Z77A 5HLTA 3QPTA 3I0TA 1NK3P 2P5LC 3OL4A 2IP2A 4L18B 1QO0D 1WJCA 1KU3A 1O3QA 3S93A 4M9ZA 2JK3A 1TNTA 1M1EB 5M3FJ 1B9MA 5BOXA 5BQTA 2KL4A 1WQ2A 3HL2A 4BAYA 3E7LA 2HFHA 4GXOA 3BQYA 1TWGJ 2H1KA 2OTJI 1MMDA 3OYNA 5ICCA 4HQEA 2JSCA 1ODDA 2KPMA 1TC3C 4R79A 4AYBA 2XKOA 4GGGA 1MJAA 2XB5A 3JRDA 2M9HA 2K7LA 2JUGA 2KJBA 2MH2A 1G8XA 4UB8C 4ENKA 3OWTA 5CQGA 3W6KB 3NQOA 4MO7A 3BG9A 3OSGA 3S2HJ 5KVRA 2WAFA 1KYWA 2FOKA 2DODA 4A12A 2I10A 5H6RA 1X1CA 2MGQA 4ZH4F 3F8CA 4MEYF 1POGA 2V1XA 3RZOJ 1T39A 4DNCA 5LGUA 2A68F 4KN4X 3CO6C 5GAGJ 1TW3A 4DYRA 2NNNA 3BTIA 4KT5C 2VQHA 2G0EA 3TOBA 3FXOA 4CCOA 1FBSA 1Y6IA 1MDMB 3VYSB 2JJ7A 1HKQA 2M87A 1ENHA 5ERIA 3OYJA 2QQAA 4G6QA 2KISA 2P8TA 1UJ8A 3FM5A 1ZLKA 5FLXK 2PMZN 1QPMA 1R1TA 1WJAA 4EVIA 1VFCA 2AHQA 2ZJPF 3ZMUA 5JVTA 4OIOF 3WTVC 5CVIA 4YRVA 2FNPA 4RAGA 3ZQIA 5EJCA 5D8KB 3HRTA 3BROA 4HAMA 1L0OC 2DTRA 4ITVA 1REPC 3HUGB 3VEPA 3BJAA 1K6OA 1QU3A 2IGMA 2PBIA 4F92B 2LLKA 1FWZA 1PUFA 2IA1A 3GBGA 1I1SA 2XDVA 1T6SA 3VPRA 3S15J 3W2AA 1WFXA 2ZSIB 2C6YA 3DPUA 1DUXC 2ZMEA 4RM3A 3TOAA 2XAQA 1JHHA 3EYYA 4XK4A 2XGEA 4JYKA 4ZYHA 1ZK8A 1R5ID 4IHYA 3I56I 3CCEI 1P6RA 4Z2YA 3DLAA 2HR3A 2XRNA 2X0LA 4U0WA 1BR4A 1DP3A 1Z7LA 3KYDB 3CC4I 2KMUA 2VJJA 3FXJA 1O7LA 1HSTA 1O7FA 3H9QA 3HM5A 3FK7A 1TQPA 4LK0F 5CKTA 1RIOH 3AG2H 1D1BA 2O6GE 3K69A 2D1VA 1H88C 4ZJZA 3RQIA 5HLGA 3RCOA 1WHUA 1MBJA 4CA0A 1JT6A 3GF2A 2KP6A 1D8KA 3ASNH 1QZZA 1TL8A 1R23A 1MIJA 2CSOA 1F1ZA 1B6AA 3MKLA 1U2WA 5FKOA 2A6EF 3TDZC 4RM2A 4RB0A 3RPUA 1H9GA 4GO1A 4CCNA 1BW5A 2R7UA 1T2KA 2DK5A 2WV1A 4WWCA 3GWZA 5J1UA 3QPLA 1F36A 1X19A 3I4NJ 2DPUA 2ELKA 3F9KA 3NAUA 2MLGA 3FKIJ 3V4GA 2LMDA 3JSOA 1I39A 3FDYA 3TKYA 5HS9A 3P9IA 4IL6C 4OINF 2KRFA 2DT5A 3LL7A 2BW3B 2X6WA 1S5LC 2E1OA 3FXLA 2XGCA 1S7EA 3K10A 4ANJA 2G9WA 2YS9A 2A3SA 1W0UA 2LBFB 2WWYA 1D5VA 4RA2A 3M1EA 2FD5A 3PSIA 5EYRA 3IRRA 2EFNA 2WA0A 3L2RA 2K9SA 2LREA 3IRQA 3S1RJ 2X6XA 5A2QK 5LFAA 1UB9A 2Q2EB 4DOZA 3N97A 1DPUA 4YELA 4CSWA 5FKKA 2GAUA 3CO7C 2CW7A 4IOCF 2HU9A 4A3GJ 4UV8A 5IP9J 3GTMJ 1MMSA 2DYSH 3HKZN 1LE8B 2VPRA 3KIOA 2F5CA 3P5JA 3EUHA 3FMRA 2R5ZB 1JJ6C 3K1NA 2ZCWA 1RKWA 5TISC 3MFKA 3PUBA 3OV8A 1OR7A 1CGPA 1F4KA 1OISA 1I3AA 1XCVA 5ICEA 3A02A 4FASD 2EH3A 3M1CA 3SZGA 4IQJA 4WK8F 3MZYA 3TGNA 4V2GA 5ICFA 2HPMA 2HOEA 2ICWG 2IJLA 4UUVA 1HQCA 2P0WA 3QOEA 3HG9A 1IGNA 1QGPA 2CRGA 2DA5A 2BZTA 3ABMH 4EM1A 3JSPA 2AXLA 1TP4A 2OQGA 4Z6YA 2CS3A 4E6KG 3J7ZI 2O61A 2L7MP 3CP2A 1G3WA 1YW8A 2E5ZA 1GHCA 4KICA 1R71A 3N05A 3W2VA 3G1MA 3IHUA 5F1RA 4WCGA 4LIVA 3HZJA 4P96A 1MDMA 3CCRI 1UAAA 1R49A 1I6XA 3K4KA 2WAEA 2ISYA 3CMYA 1FY7A 3BZKA 3GO5A 3QP5A 1F5TA 1SD7A 2YPRA 1MMGA 4B4CA 3S1NJ 4RGRA 1NG6A 2E1MB 3SXYA 4GCVA 2WC2A 1Y0NA 2WB1N 2DFIA 4ZZDA 2B0LA 5GTHC 4ZTJA 5K5QA 1BI3A 3JAMZ 4Y13A 1YS7A 3S2DJ 4UNOA 4KMFA 1FSHA 2GM4A 1A31A 5GADJ 2HZTA 5DDGA 3MVPA 2BHZA 3QYBA 5J47A 2EFQA 5F04A 1T0FA 3KZIC 1GDTA 2DT7B 3QWLA 3HOUJ 1L3LA 5F0HA 2HYGD 4XR6A 3RIRA 4BH9A 2DQLA 4KT6A 1JKRC 3NWTA 1IC8A 2DFFA 5EG0B 1K4SA 2DA3A 4M74A 4OMYA 2DTZA 2DBBA 3F3XA 4AWXB 4Y7NJ 3HOTA 2M30A 2CFXA 3DCFA 1HDPA 2N8GA 2VE9A 5DEQA 2LG4A 1K83J 4HF1A 4XL9A 4AUXA 1WH7A 1IN6A 2FQ3A 1ETQA 3MCZA 2JRMA 3AG4H 2HXOA 4XOPA 2GIZA 1YHQI 1UHMA 1X3ZB 2MD0A 2K3PA 1I27A 4IO9F 3LA2A 5LRRA 4P5OA 3LSMA 1YRNB 2DA1A 2MW8A 2V1NA 3HEFA 1V3FA 2LK2A 5CQEA 1R58A 4CDGA 3NRVA 3ABUA 2VKVA 2R7DA 3HRUA 3P7NA 3BZCA 1A6QA 3HOWJ 3A4CA 5ILSA 1T95A 5J4VA 3E6MA 4B47A 2W84A 2LH9A 1K79A 1LPQA 4PJ0C 4RLFA 5HDGA 2MH9A 2VQGA 3JRFA 3E5QA 3DU5A 1WJFA 2BY3A 2BHYA 5EGOB 2VC1A 2X51A 1SFUA 1P92A 2BW3A 2H6CA 2H6BA 1IDZA 2OUMA 2DI3A 4XN3A 2OTLI 3OR1C 4RAZA 4B1RA 3CCYA 3Q3SA 2DOEA 1RUNA 1JUMA 1OQYA 1PVEA 1D8JA 2LBFA 2V6CA 2VBWA 3BR6A 2KRCA 2A6TA 1SD4A 1T0FC 2L4AA 1U3EM 2HGCA 2K4JA 2DPDA 4P9FA 3SFZA 1XSXA 1YLFA 2E34A 3O8GA 3ZOBA 1XPXA 2Q2EA 3OIPA 3MKYB 4ENJA 3RI4A 1X3UA 3LSHA 3GTKJ 1QHGA 2BVLA 3HOSA 2HYFA 5DM7F 3QRFF 4C2MJ 3GMEA 5LBQA 2DO7A 4Q4ZF 1LE8A 1IUYA 2F5VA 1ONVA 2Y48A 4IPAA 1S7OA 1SANA 2HTJA 5EZHA 1ZLJA 3GW2A 2R5ZA 4XSXF 1AKHB 2EZIA 3VFZA 1I6HJ 1IN5A 4IZZA 2P5VA 1FMVA 1OKRA 1YJNI 3ZMZA 2DA4A 1UG2A 2EA4A 2W00A 2FA5A 3SEZA 4QTRA 2MYSA 3RJPA 4J01A 3QU6A 2EWNA 2EZHA 4LD5A 2VONA 1HW2A 4CCMA 1FOYA 4WXCA 1ON2A 1UZCA 2OU2A 3A0BC 3OY9A 1JT0A 2Z33A 3E1SA 3C18A 4BDZA 2E71A 2JT1A 2ZJRF 4UXNA 2DK8A 3BR0A 1XN7A 5D4RA 1W5CC 5H6QA 4DJAA 3CMEI 4YEJA 5AIPA 4FETA 4XLAA 3CCMI 2ZJ2A 1ETYA 2Z2SB 1ZRCA 2VQCA 3C2GA 3GZNB 5F27A 4B43A 4G6DA 2IA2A 2O9LA 3GYHX 3C2BA 1ZGJA 2BY0A 2LFBA 3CC2I 4UUTA 2JN6A 1MSEC 2D5VA 2HQNA 2HOAA 3S32A 1OYWA 1B9NA 2ZXWH 2VN2A 2DDAA 3TMOA 2X9DA 1J2XA 2ZJQF 2EFPA 3PNYA 3S2WA 2R92J 3HSFA 1R36A 2QLZA 3FWEA 1FMWA 5FO5A 5DUIA 1XCBA 5F1JA 4BBSJ 3ZMVA 2R93J 1KU7A 4RS8A 1ETOA 4DQ2A 1I3QJ 3L2VA 1I5ZA 4BE1A 2BEOA 4AVPA 1GUUA 5E3OA 2L7KA 2E1NA 5EG0A 2Z3YA 4Q5SF 2FNAA 2PJPA 4ABZA 2HPIA 1IO2A 4EEFG 2VBYA 2E7XA 1G3TA 2DU9A 3FXKA 3ABKH 1LDKB 4B48A 5BPDA 2KIFA 2KZVA 3HJEA 2GA2A 4B8XA 4EM2A 3JW4A 4FT8A 3OSFA 3FIWA 3TW6A 4HZFA 1HA8A 3IAS2 3DP7A 2QQBA 3WU0A 4GYGA 2UUZA 3DU6A 2COBA 1OFCX 4I02A 4RB3C 5DD8A 1K6YA 1HCRA 2VPLA 1MH3A 2G7UA 1SMTA 4F93B 2A07F 4II2A 4XRSA 4CCLA 3I5UA 1YRNA 3H3UA 2EJRA 3TBIA 3H5AA 4GDFA 2AXTC 2FMLA 2DAOA 1N78A 1QVUA 2QENA 1IAWA 2F48A 4LG0B 4R1HA 3J81K 4JX6A 1YG2A 4G8XA 1P7JA 3BG5A 2JZYA 1LEBA 4KYWA 2BBYA 3EDPA 3ZP5A 1JUPA 2MFZA 3N4MA 3HOVJ 1PUEE 1TQIA 1N25A 1ZHFA 4TV7A 2L01A 3T1BA 1LNWA 3RKWA 2EV6A 4A5NA 2W1OA 3ABTA 2JA6J 1V5FA 2XGXA 4ZYGA 4BY7J 5LGTA 5EGOA 4A2UA 2E1MC 3CMMA 1YOVB 4YIFA 2R7XA 3CLQA 4II3A 3HSRA 1W7PD 3ZMSA 3H92A 5M5XJ 5E8IA 5L3CA 4D9JA 5HDKA 3CJNA 4BBRJ 3F8MA 5L3FA 3FZVA 4XONA 4ESFA 1JE8A 4OU0A 3H5RA 4G6TB 3KP3A 2MSYA 2ID3A 5CJ9A 5KK1A 3PFIA 2DA7A 4HX8A 5IYCJ 2K9QA 3DLLF 1YIJI 2ZFWA 3CJTB 1OYYA 3U21A 3LWFA 4NB5A 5BMZA 1FBQA 1GVDA 4X1EA 3L00A 3CMAI 3GLXA 2IRFG 3SDBA 1ZAOA 3PM1A 4E7HA 1AKHA 4BGDA 4E7KA 2RDPA 1RPWA 4PZJA 1U9NA 4AIHA 1Y8RB 4BQOA 4QPQA 2L9SA 3IWZA 4F91B 2NVUB 5LHGA 2AO9A 4XQFA 3GVAA 3HOXJ 4LB5A 2JA2A 3SZPA 3SEQA 4X0GA 4PUSA 2RQPA 4HQMA 4E7SA 5FKLA 3H3ZA 4MLOA 3WE3A 2GZWA 2RV8A 1VQ9I 2HKXA 4PJNA 2XRLA 3KLNA 4YFNF 3CC7I 2QUFA 2Q1ZB 2ZSHB 3VDXA 4M9SA 2V7FA 4U0VA 1VNDA 1OCOH 3LFUA 4HSRA 1G59A 3HSEA 1O3TA 5C3EJ 4ENNA 3GXOA 1SVMA 1KGSA 2R7ZJ 4E70A 4PGGA 1JKQC 2Y31A 1BR1A 3LOCA 4KMUX 1LVAA 1WGXA 3DWLE 3PQJA 2XV4S 3MZHA 4BQAA 2Z16A 3DEEA 2K9NA 3GFJA 2HWVA 3PIOF 3BC8A 3MZ8A 2OBPA 2UXNA 5ICGA 3BWGA 3DQVC 4F55A 5IP7J 1OYIA 2OZUA 1QRYA 3QU3A 1U0JA 4M3FA 3WODF 1RUOA 3VYUB 1Z0XA 3FHNA 1FIAA 2HNHA 5GPAA 1ZR2A 3E97A 1SEUA 2KLOA 2DN0A 2LY1A 3QYFA 4R8HA 4XLFA 4OIRF 1FP1D 2BE5F 2K5CA 1E3OC 2L7ZA 1TNSA 3DBHB 2A69F 1VF9A 2MABA 5E8GA 2FX0A 2BGCA 1ETVA 1X4OA 4HEA2 4HOBA 4L0ZB 1KU9A 4CO8A 3OYBA 4PFOA 2ZNZA 2E7WA 4L5EA 1G2HA 2R4GA 3DEUA 5CVUA 1BW6A 4LIUA 1FSEA 4NDLA 2NS7A 3AFHA 2LF8A 1FYMA 3BR5A 1DPRA 5HDNA 4HNUA 1MKMA 2X6YA 2QBYB 2ECBA 1X2NA 3BT9A 1R5GA 3ERED 4EV0A 1BI1A 3A1YA 3WTXC 1R4MB 1MBFA 1NG7A 1J75A 2XPWA 2HVRA 3UNGC 4BQQA 5HLHA 5H20A 5IOZA 1B1BA 2KIUA 2D45A 2PMZA 2HDDA 3VYTB 5JHFA 3A01B 3TO7A 1JGGA 1JI8A 2VB6A 1H9TA 5FD5A 1YIOA 2X6OA 2DQRA 4CCJA 4KIBA 1PP8F 1W7PB 2DDBA 2V9VA 3QPHA 2XAGA 3CDLA 3ABLH 4HLXA 4MNUA 1VQ6I 2DLLA 4I0AA 1ULYA 1IW7F 3JTHA 3U1KA 3RQ4A 2XAJA 5C4JJ 2E2HJ 4LG0A 1DQUA 2KKOA 3EUAA 3FISA 2M8EA 3H0GJ 1P4AA 3K4MA 3KFWX 3BTLA 1H89C 3I4MJ 5E18F 1R7JA 1D1CA 1B59A 2VJIA 4HV5A 5JHUA 3PNVA 2VLAA 1X3WB 3CQZJ 2ADUA 3K7AJ 4IRGA 3U2RA 2KJCA 4G7OF 2FSWA 5DYMA 4YFKF 3K2ZA 5BPIA 4P55A 2GXAA 4IKFA 1RI7A 3PUFA 4IRHA 3FK6A 1E0EA 2X1CA 3I59B 1ZYRF 1Y1WJ 2XF5A 2EIKH 3OYKA 2FBIA 2TCTA 4IXAA 4Q47A 1A6IA 3MD2A 1MMAA 4IF4A 2DA6A 3EPZA 1WI9A 5HODA 2R5YB 3GTPJ 3BZ6A 3M8JA 4A3FJ 1HSJA 3OOPA 4Y4RA 3KP4A 2CQ7A 3LMMA 2ESHA 2RVCA 2CJJA 3HTUA 3TDUC 1VQNI 4M3EA 1XGNA 2UZKA 3OL3A 1WSUA 2BV6A 1UG0A 4E7JA 4Y33A 1TBXA 2F4OB 1I50J 2VKHA 3AG3H 4FTHA 1WWXA 1XDSA 4RLQA 5DUKA 5L3DA 1NK2P 3EETA 4RDUA 4L9TA 4S05A 5DD4A 3U9GA 3ZXSA 4BEHB 3OYAA 2DJIA 2QGUA 3RPQA 2XPVA 4UUSA 1WJEA 1FOKA 1KU2A 4O6JA 2L9VA 2VE8A 1F43A 1JXSA 3FXUA 5DS9A 1UFMA 4F52A 4G7ZF 4RBOA 1YITI 2IS2A 4XRSG 4BQNA 4ETSA 1VQ7I 4LMYA 1HLVA 2F5FA 3GFLA 3WTZA 1O57A 3I53A 4D0PA 3MAJA 2X1EA 3KCCA 2XUBA 4FHTA 2EBIA 1QBJA 3F21A 4IOAF 4XLCA 1LDDA 2RC4A 3OYIA 2CYYA 2M0MA 2VXZA 2BOLA 2FE3A 4Y3OA 4A3KJ 3C7JA 2O0YA 3AL0B 4RGXA 2VC0A 1USSA 2W85A 3B02A 2W25A 4BXFA 1BA5A 4XORA 3HKZA 3WGIA 3GFMA 2OZ6A 4D7MA 2GIVA 1QZEA 5D5XB 4P1WA 3T0YA 1R6RA 2H8RA 1AA7A 2IA0A 1Y1VJ 2MG4A 3KE2A 4MFEA 4HX7A 4E7ZA 1NTCA 3OIQA 3AAFA 1MH4A 4XLNF 3IP4B 1BBYA 3ECOA 1F9NA 2IS6A 3H1CA 4U87A 4MQVA 4UVBA 2K02A 1JKOC 2Z5UA 5ILUA 4I7HA 3OYGA 3JRBA 2IS4A 1OCCH 4OOIA 3OMYA 2EFWA 4G7HF 3B6CA 2V9KA 6PAXA 1CF7B 1TT0A 3CJQB 2K3FA 3M4OJ 2RNGA 2DXIA 4A3MJ 4FE7A 3PIPF 4BXXJ 3TP3A 3V8LA 3JRCA 1Y56A 1T8IA 3IH3A 2QBYA 2RKHA 2HEOA 1BM9A 5IT9Z 3VSLA 3BTJA 1YW7A 4RGSA 5J40A 2CV1A 5D6FA 3HDDA 4UB6C 3JCUC 4HRIA 1UCRA 4HBLA 5E1WA 1YW9A 4UVCA 1N77A 2VOOA 5JLXA 2UV1A 4QWQA 5IOYA 1TW2A 4BHPA 5EDNA 5FLVA 2VQLA 4WF2A 5A2QZ 3WU2C 2XB0X 3A01A 1R1UA 4CHUA 3AG1H 4E7LA 4NHJA 3VB2A 2UXXA 3BG6A 4O3MA 3QYEA 3BPXA 2R7WA 2BY1A 1UHSA 2IGOA 1Q1VA 3TO6A 3HPGA 1W7PA 3JAMK 2HOTA 4B3AA 1PYVA 2I8DA 2WB1A 2LDUA 2L2OA 2YSRA 1Z3XA 2OC6A 3BR3A 4IHTA 4QLCU 4KNYA 3QOPA 2COMA 4QPOA 4BHBA 2PJRB 3S1MJ 1U6GA 2XAUA 2YUSA 4HA8A 3FXQA 2YX7A 5K1YA 4GRIA 3CCLI 3JRIA 3R0AA 2XAFA 4LGWA 4BU2A 1OJLA 3ZQCA 2K27A 5JVGF 2HVSA 3HUGA 1KQ8A 4PSXA 2PMUA 3E6DA 2B7EA 1PDNC 3BLYA 1XGSA 4NC8A 1KYZA 3BDDA 3L2WA 4N4NB 1MNDA 3F22A 4L9JA 2WAQN 2CMPA 3I59A 3M8FA 1G3SA 1S7AA 4WXDA 3ZQ7A 2PLYA 2A6HF 1Z21A 3F8FA 4V19K 2WTEA 1RZ4A 3JREA 1TLHB 2KT0A 5J4YA 4E7IA 1KA8A 4C2UA 1FIPA 3KEOA 5D5WB 2R5YA 2IBDA 4CZZA 1FNNA 1ZN2A 2FBKA 4LLNA 1XMAA 3I71A 3HOYJ 2IS1A 4LITA 1P7IA 1X1DA 4G94A 1OCRH 4LOCA 5BNGA 4CGZA 2HYJA 1IUFA 4RGUA 1W4MA 3CZ6A 5E3MA 2XROA 4Y15A 2QKLB 3A0HC 2W48A 4BEHA 1YS6A 2CO5A 2ZFUA 4XLEA 1J0RA 5ILVA 2XSDC 3GX4X 4KIGA 1IN4A 3I55I 1YYVA 1SAUA 3WTWC 4OWRB 4HV6A 2IVMA 3K1MA 1LFUP 1A04A 4KN7X 5F0CA 1IRGA 1BJZA 4JQFA 4C3IJ 2FF4A 2Z1DA 4FISA 1YJ9I 2O8KA 1MD0A 5GAEJ 1K78B 3EQLF 3CCQI 2WBMA 3UR3C 5M3MJ 4KISA 2RN7A 1VQMI 2X85A 1ACIA 3JRHA 2M34A 2ACJA 2KIMA 3JRGA 4W1UA 3BQZA 4M6VA 3WGHA 2I5UA 3Q5FA 2Y75A 1OCPA 4M73A 3IKTA 1XMKA 1ZH5A 5E17F 2VASA 2QM3A 3R4KA 5J6XA 5C4XJ 2PEXA 1QPIA 2QSHX 1FX7A 1I1GA 1ZELA 1AOYA 2LOOA 4IHSA 1DDNA 1XSDA 5D5UB 3GTQJ 4PSWA 4AU7A 2QKMB 4EJUA 4A3CJ 4ZC3A 3E3VA 5HNHA 1SFXA 3ZGKA 2IT0A 2STTA 2Y9ZA 3QODA 5BS6A 3SFIA 2H1LA 1S29A 2ZC2A 4A69C 1FYLA 2QSFX 1WKMA 4EGYA 2GXBA 3R60A 1MBHA 3HHHA 3PJRA 4PK4A 1FT9A 5FRMA 5LEJA 2EINH 4IJAA 3OYCA 1OPCA 1IV6A 5JR3A 1CF7A 1Y39A 4IEJA 1U8BA 3FMSA 3HPHA 3RZDJ 2CQXA 2J5PA 1D0ZA 3BR1A 5DM6F 3KYLA 1Z3YA 2P5KA 1Z7UA 2M8GX 2OPTA 1BN5A 4B09A 1LFPA 2NNYA 2R7RA 2ME6A 4X6AJ 1ZTRA 2LNBA 1V5EA 1J09A 2F5EA 4W97A 1J59A 2EZKA 2EQRA 4XRFA 5K7ZA 1ZARA 3RKYA 1USTA 2VL8A 3MKWB 1Z6RA 3WTUC 1SFEA 2G7HA 5FB2A 1HBXG 2E19A 4JK1X 4FX0A 5DTDA 3SHFA 1T33A 2HVQA 2NXNB 3ERMA 2ELHA 3W2WA 1VQOI 3G2BA 1FOWA 5IY5H 4FCYA 2QSGX 3V7RA 3FF5A 3CCUI 4XKVA 5D5VB 3AL0C 4XIDA 3KETA 2NVYJ 5L3GA 3M07A 2F2EA 2OF7A 2ZBKA 3U1DA 2A05A 1LDJA 1VQPI 2PJRA 4RB2C 3ESWB 4I01A 5DCFA 2L02A 2O3FA 3M3YJ 5GP9A 3ZPLA 5IPAA 1MBGA 2R7VA 2Y0SA 1J5YA 3J7YJ 1P2FA 1TTYA 2D2WA 2CQNA 1JHFA 2EV5A 2L54A 3OS0A 3AKZA 3KLOA 3A2KA 1IN7A 3O6BB 5B1BH 1O3RA 4XICA 4HG2A 2L9NA 3G71I 2OA4A 2IW5A 1YQAA 2MA3A 3KX2A 3BJOA 2E1CA 4CYDA 3HC7A 3DKWA 3ZRGA 3NEUA 3ZN0A 3K4NA 3J7AO 3E6BA 2WY8Q 3KPHA 2K40A 1JKPC 3K0LA 2HDCA 1MW7A 2O03A 4ZZLA 2PG4A 2PMHA 2O7OA 3LFKA 2PX9A 2QCOA 4EJVA 3E0JB 1Y0UA 1G3YA 1ON1A 4ZTFA 4DYCA 2MC4A 3F6OA 4IVNA 3E5UA 2DT6A 1ZG5A 1R00A 1RETA 4I2OA 1HDDC 1RNLA 3W6JB 3DKXA 1O3SA 3LNQA 3Q0VA 3REOA 3F0CA 5KNLA 3P9CA 4YG2F 1IRFA 3CDHA 4M3DA 3HTSB 3DTEA 3L9FA 4AVZA 5HS7A 1ZRDA 3A03A 2JRTA 5LHIA 1X58A 1DGWY 3CUOA 2B63J 3Q9VA 2A5YB 2MC3A 4BKXA 1FEXA 1GXQA 4ZYAA 1JTYA 3ULQB 1K78A 2KRHA 3FBNB 1Z91A 4YFXF 5HVQC 1ERDA 3RKXA 4AIDA 1LVKA 2PI0A 1R5HA 2W24A 3OYDA 3MKZA 3LA3A 5FJ8J 5ED4A 3OS1A 1R9TJ 4LB6B 5EF6A 2DJNA 3PFYA 2OCCH 1W0TA 2XIGA 5FKNA 3HYIA 4CH7A 3CJRB 4OAYA 4M72A 1WJBA 3VSKA 4A3JJ 3GTOJ 4AM3A 2W82A 2YU3A 2ZB9A 1PP7U 4ZDPA 2VI6A 4NC6A 3BP8A 2STWA 3J80Z 4ESJA 4NQWB 2KHMA 4UV9A 4EQQA 2PQ8A 3GUDA 3J81Z 4I98B 5EEAA 2W4SA 3OOUA 3GTLJ 3S16J 3I58A 4S04A 2XVCA 3OYFA 1VQKI 1X1BA 1TT5B 4I6ZA 2UWMA 1MGTA 2XF7A 5J1RA 3L2UA 2ID6A 3LSGA 1P9QC 4LLGF 3SQNA 3QQAA 3KP6A 3QAHA 5E3LA 4PFPA 9ANTA 1HKTA 4KJZA 3GTGJ 3V42A 1ETWA 4QIWN 5FKMA 5D4SA 3HXLA 5LD2C 4KUMA 1EH7A 3O3KA 4YIIA 2JTVA 3HIFA 3H9GA 3GLLA 1B72B 5B5EC 2FEZA 4DZJA 3IH2A 3LAJA 1RR8C 3ZQFA 3H35A 1RC9A 3S3MA 2JVHA 3L1PA 1FZPB 1EKEA 2YR2A 2V26A 2XGDA 3L09A 2BY2A 3LQQA 1P4WA 4NBQA 2HS5A 3T8RA 5JLWA 3S14J 3CP8A 4XN0A 5KHDA 2OJED 5E20A 1HF0A 2NOJB 2XAHA 3DPLC 4M3GA 3GZ5A 3IUOA 2M5WA 4BJTA 3ZCOA 2HOSA 3CUQC 5LGNA 1TZLA 3D5SC 1ORKA 2OCEA 5AIQA 1YTYA 1SD6A 1ZG1A 3IWFA 4RMNA 4KDPA 4BNCA 2LSOA 3F6VA 1UELB 1Z05A 4KFCA 3J7AY 2RGVA 4BE0A 1RESA 3D5LA 5M5YJ 4ZDOA 3L2CA 3LA7A 3FM3A 3RDIA 3BJ6A 2KIQA 5FRNA 1QHHD 1JTXA 4PJJA 1DU6A 4A3IJ 3ISPA 4A0XA 5D8LB 4HX4A 3G4SI 1WPKA 1ZREA 3KEYA 1BOAA 3QPSA 2IGKA 2E2JJ 4A3DJ 1BIAA 1X4PA 3TQNA 3CDIA 1ZGAA 4A0YA 5E3NA 1JJ8C 3BR2A 3V7CA 1VZ0A 1MMNA 4LJZF 4L5IA 4BS9A 3T8TA 3NWSA 4D7NA 1STZA 2XF6A 3ECHA 1MNEA 2F4IA 3OS2A 3FMQA 1EA3A 1IF1A 1IXRC 3E5XA 2F6CA 3IL2A 3RKQA 5TJJA 2H27A 2M0CA 2M3AA 1P4XA 3BCAA 4BACA 1YX3A 3S3NA 1IRZA 3C1DA 4DGWB 2VXDA 3KEQA 4I09A 2HZDA 4BYYA 4N9IA 2XHKA 1R1VA 5F6FA 5HNFA 4AYBN 1VTNC 4EGZA 2JVGA 2TDXA 2EB7A 4N0BA 1S3JA 2Q0OA 3WG9A 3SYTA 3CCJI 1LB2A 2JA5J 3CCVI 4Y52J 2M4KA 4XKBA 4BDYA 1YJWI 1UHWA 2P6TA 3LSPA 3ASOH 3H0DA 2VBXA 1ITYA 4HDUA 1BC8C 1C0WA 2JSPA 5FFZA 3B6AA 2LY9A 1BC7C 3OYMA 2ELJA 2L5QA 3P9KA 4IHWA 2IXSA 2DYRH 4ENMA 1ZQ3P 2FQ4A 4PCQA 1H0MA 1OLTA 2HQ5A 2XPUA 4G12A 1EV7A 3BTCA 1E3PA 3O2PE 3BPVA 4NQWA 2DOFA 2K9LA 4HNVA 3ROUA 1U8RA 2JA7J 3GFIA 2Q8KA 5FLXZ 1MJBA 4RAYA 1XG1A 2P7CB 1XTAA 1ETKA 5K7HA 1A36A 2LTPA 3W6VA 3RSNA 3KP2A 2QA4I 3KP7A 4EJWA 4A6DA 3S8PA 1YX5A 2Y2ZA 2OV7A 4FE4A 4MIMA 4UHTA 2P6SA 3UKGA 2WY7Q 3K2AA 1EH6A 3G1LA 1IZ1A 1O4XA 2YU9J 5JFRA 2ZKZA 4MEXF 4HF0A 1WCMJ 3F23A 3GCMA 2LP0A 4C30A 1NHAA 1A35A 4IRIA 2CU7A 1EH8A 2V4JC 4P9UA 1RKTA 2W57A 3CESA 2O5RA 4ZDLA 1B72A 3G6EI 3D0SA 2VJ5A 2A5WA 3S3OA 3VODA 2M1BA 2X1DA 1SVLA 1A5JA 3MMYB 2L3DA 2NAZA 3FX3A 5B1AH 3WU1B 1VQ8I 4AIJA 2M4GA 2AQFA 2VJ4A 4KITB 2M7BA 5K5RA 1FPQA 4XKWA 3CD6I 4QSHA 2E60A 2JMWA 4U0YA 1W36C 2JA8J 3S17J 2ZXJA 5LEKA 3Q9SA 2XSJC 3HHGA 1EJ9A 2P7VB 4OIQF 2DW4A 3PL8A 5IT9K 4A3EJ 1GVJA 1V5GA 2RREA 5E1ZB 4D1QA 2DFEA 4NUBA 5LLQA 1XGMA 2R3SA 1R4NB 1V54H 4A0ZA 1HOMA 2ZXIA 4CXFA 5LRSA 3H36A 1U9OA 3BY6A 2DMQA 3CF2A 3X2QH 3HBLA 4EATA 4H0EA 2JPBA 1TWCJ 5CVJA 2IPQX 2CUJA 2VKEA 3L7WA 3O8HA 5EEHA 3ZQGA 2W7NA 3PO3J 1NH3A 2LRDA 2DA2A 2DMNA 5FFXA 2ZMEC 3I64A 4AC0A 2JUCA 2B9SA 2ZNYA 4J19A 2R7TA 2V1UA 2IEKA 1ZRFA 4IHXA 1IXCA 3WTSC 3IKVA 4FX4A 2DMUA 3M7GA 1LFBA 4ZYDA 2J5OA 5J1YA 1JUSA 1RR7A 2D1HA 3LSTA 5DCMB 1IXSB 4EJOA 5HS8A 2GLOA 4E4HA 3RYRA 2QYOA 3Q0WA 1BL0A 2K85A 3ML6A 5FGMA 1HKSA 4EMSA 3OIOA 1U5TB 2NYXA 1IRXA 2CUZA 1T38A 4RB1A 4HLYA 1ZR4A 3DV8A 3DF8A 3OYEA 4U7BA 2VOPA 2IGNA 1QVTA 3I9V2 3KYCB 4C3HJ 3ZR8X 4XBFA 1YO5C 2HQRA 4OAZA 4PDKA 5L3EA 4NNJA 4U88A 4KIFA 2LKSA 1FBUA 3WTTC 2WAQA 5IT3A 2VT3A 2KZGA 3SJMA 1MZBA 1BI0A 1U78A 2LKPA 1CQTA 3R6SA 1VQ4I 5KCMA 3DKYA 2K86A 2RNJA 1KZHA 4IQ4A 1ZKGA 2LKXA 4I76A 4BY1J 1Z67A 5JI6A 3B73A 1QZYA 1APLC 3C2HA 3I54A 2EV0A 2BXYA 5TGTA 4DBQA 4YIRX 1SC7A 4KA4A 1GT0C 4XLPF 3MQ0A 2EFOA 2IAIA 1B8IB 1XMXA 2HI3A 1FYKA 1VQ5I 2F5DA 2CWEA 1IV8A 2V9PA 2JPCA 3LSJA 5C44J 3VYRB 3DXJF 1HXDA 4LG3A 1H8AC 1YI2I 1IG7A 1FP2A 2P81A 4LFUA 3FKJA 3LSKA 4MHGA 1R22A 3WHCA 4B44A 3K9TA 2FXAA 3R0JA 2V79A 3EUHC 3G73A 3MEXA 4O5VA 2FU4A 3HRSA 4HDVA 3S1QJ 3SDGA 1OR7C 3PQKA 3FXRA 2P4WA 3IV5A 3LAPA 1XX5A 3HGGA 4BL0B 4U7DA 1TWFJ 1G4DA 3EYIA 1D1AA 2EZLA 2FRHA 4A93J 3COAC 3DPTA 2QVOA 2QEXI 4D5FA 2GXGA 1AWCA 4GFBA 5DV5A 1D5YA 4G9YA 1XC5A 2CH0A 3RTRA 1QNTA 3KZYA 2VBZA 3TW7A 5B66C 3CF5F 2GBYA 1LEAA 4XKCA 1FJLA 5IYDJ 2GQQA 4HYEA 1HC8A 5FLMJ 5F08A 2LVSA 2VKDA 3F8BA 1HW5A 5F64A 3HRMA 4IHVA 5CYVA 1V55H 1YFHA 4XNFA 3HGYA 2CV0A 4BXUA 2BXZA 2M45A 4L0YB 1WJDA 3ZMTA 3C3WA 3I4PA 1SFKA 1MSFC 3CCSI 3F72A 4DZPA 4BE2A 4HNTA 4ESBA 3NARA 2E35A 3CUQB 4Q48A 3V7SA 2CW0F 2NRAC 2CFOA 1FOXA 1T56A 3CTAA 1VI0A 1S6LA 3VWBA 2JQ7A 2DMPA 5AONA 1DGRM 2WADA 5KAFC 4UY8I 3H3VK 3EUKL 1BI2A 1IN8A 2ZXHA 3WE2A 1TWAJ 4HW0A 2NS0A 3G3ZA 1JGSA 1D3YA 4UVAA 2OD5A 3ELKA 1Q1HA 3M9AA 4CYCB 1S72I 3K6GA 2VUMJ 2R0QC 2QZ8A 2HDWA 2ESNA 2GA1A 2NOGA 1XSVA 4M9XA 1ZGWA 2EILH 1QA6A 4LK1F 1D0XA 1N75A 2H94A 1W36D 1WRJA 1DU0A 2Y9YA 2GWRA 2LYCA 3PSFA 1QQIA 3IH4A 1EF4A 1B4AA 1E17A 5CLSA 1TWHJ 1IDYA 4A3BJ 4MQ9F 4MTDA 3JRAA 4WXHA 1BR2A 5L3BA 3H5NA
chains in the Genus database with same CATH topology
2CS3A 4E6KG 3CP2A 2R7QA 2E5ZA 2W4SA 3OOUA 3N05A 3W2VA 3OYFA 4IKFA 1X1BA 4LIVA 2UWMA 2XF7A 1E0EA 3K70C 2X1CA 1UAAA 3K4KA 2WAEA 2XF5A 2HQAA 3OYKA 4C9YA 3L2UA 3LSGA 1P9QC 3MD2A 1MMAA 3DTIA 2RQQA 3EPZA 4PFPA 4KJZA 1MMGA 3V42A 3M8JA 1NG6A 2E1MB 3K4JA 3HXLA 4Y4RA 5LD2C 3OR2C 3TL4X 3LMMA 3K4LA 4ZTJA 3H9GA 3DTKA 3FBIB 3OL3A 1GLNA 1UG0A 4E7JA 4Y33A 2VKHA 3QYBA 3H35A 4RLQA 3S3MA 2DT7B 2JVHA 4BEHB 4XR6A 3ZXSA 4IX7A 3OYAA 2V26A 2DJIA 4KT6A 1WJEA 3NWTA 3CP8A 3K4BA 4XN0A 5KHDA 3HOTA 4F52A 3RPUD 2NOJB 3DPLC 2IS2A 1BOBA 4BQNA 5HOOA 3IUOA 4BJTA 2LG4A 3ZCOA 1KONA 4XL9A 1TZLA 2X1EA 3D5SC 4XLCA 4XOPA 1LKXA 3OYIA 1PJRA 4B3XA 2M0MA 4N4OB 4RMNA 4BJ5C 2MD0A 2VXZA 2BOLA 4Y3OA 2K3PA 1S9HA 3AL0B 4F3QA 4P5OA 3LSMA 2V1NA 1UELB 2XC7A 3J7AY 4BXFA 4XORA 3HKZA 5CQEA 4BE0A 4ZDOA 3D5LA 4P1WA 1R6RA 3A4CA 1AA7A 1T95A 5FRNA 1QHHD 4B47A 4PJJA 4E7ZA 4PJMA 4NC7A 2LH9A 3OIQA 4RLFA 3IP4B 3KEYA 4J00A 2VQGA 2IGKA 2IS6A 3DU5A 4XMYA 1WJFA 3H9JA 1X4PA 4U87A 3PNTA 4C2TA 3IAM2 2R7SA 1VZ0A 2X51A 3OYLA 3OYGA 1MMNA 2BW3A 2IS4A 2OUMA 4BS9A 3NWSA 3OMYA 2XF6A 4XN3A 2V9KA 1MNEA 3OR1C 1X1AA 2F4IA 3OS2A 1EA3A 1TT0A 3CJQB 2F6CA 2RNGA 4XLHA 2LBFA 2DXIA 5CPRB 2CV2A 2M3AA 3I3LA 2KRCA 3BCAA 2A6TA 1YX3A 4BACA 1Y56A 3S3NA 1T0FC 4DGWB 2VXDA 2CW8A 2HZDA 3VSLA 4DBRA 3OIPA 3MKYB 3LSHA 4H4KC 1QHGA 5HNFA 2BVLA 1WJ5A 2CV1A 3HOSA 4DIQA 2JVGA 2R7OA 3ONQA 3OYHA 4HRIA 1N77A 2F5VA 2UV1A 3SYTA 2VQLA 4E7LA 2M4KA 2K9MA 3W3CA 4XKBA 3BG6A 4BDYA 3QYEA 2R7WA 3H0DA 2IGOA 3HPGA 4IZZA 1FMVA 2JSPA 1PYVA 2I8DA 2KDOA 2VIXA 2WB1A 2W00A 3SEZA 3OYMA 4J01A 2ELJA 2L5QA 2MYSA 3LSIA 2IXSA 2KQRA 2L2OA 1Z3XA 4CCMA 2OC6A 3OY9A 3E1SA 2M7AA 4BDZA 2GOXB 4QPOA 1YE9A 2PJRB 1OLTA 2V6EA 2XAUA 3K4CA 4HPQA 2DOAA 4GRIA 4PJLA 3BCBA 4XOTA 4BU2A 4DJAA 4CUGA 2K9LA 4YEJA 2HVSA 4PSXA 4FETA 3BLYA 4NC8A 4XLAA 3RSNA 3L2WA 4BJ6C 2Z2SB 3D5RC 4N4NB 1MNDA 2LC2A 2VQCA 3C2GA 2CMPA 4B43A 3S8PA 1YX5A 2OV7A 1Z21A 1D0YA 2WY7Q 2FUG2 5FROA 4E7IA 4C2UA 3S32A 4C30A 2AQEA 4XM3A 4HSTA 4BUPA 2LY2A 2GOMA 2IS1A 4LITA 2V4JC 4JOMA 1X1DA 3L2QA 3CESA 4ZDLA 2O5RA 3TMOA 3K70D 4CZCA 2VJ5A 2A5WA 3S3OA 2DCEA 3CZ6A 2X1DA 2BVMA 3PNYA 2QKLB 3MMYB 2E5NA 3BG7A 1FMWA 4CCKA 2M4GA 2AQFA 4BEHA 2VJ4A 4KITB 2M7BA 2ZFUA 3L2VA 3ZQQA 4XKWA 4XLEA 4BE1A 2L7KA 5HLTA 2E60A 1SAUA 3OL4A 2HPIA 1W36C 4OWRB 1WJCA 1LDKB 4B48A 3S93A 4JQFA 2KZVA 2XSJC 2Z1DA 2KL4A 3HL2A 3PL8A 1HA8A 1V5GA 3IAS2 2RREA 2WBMA 2UUZA 3DU6A 3UR3C 4D1QA 4KISA 1K6YA 4NUBA 2VPLA 1MMDA 3OYNA 2X85A 4F93B 2ZXIA 4II2A 2KPMA 4R79A 4CCLA 4AYBA 3CF2A 2VASA 4EATA 3TBIA 3H5AA 2JUGA 2CUJA 1N78A 1G8XA 2W7NA 1ZELA 3OWTA 5CQGA 2LOOA 2LRDA 2WAFA 4PSWA 2MFZA 4AU7A 2QKMB 2R7TA 1X1CA 4ZC3A 5HNHA 3ZGKA 2W1OA 3QODA 1V5FA 2E1MC 2VQHA 4E4HA 3CMMA 3PJRA 4PK4A 4CCOA 5FRMA 2R7XA 1Y6IA 4II3A 3VYSB 3OYCA 3OYJA 1IRXA 2CUZA 4D9JA 3HPHA 3OYEA 4U7BA 1D0ZA 4XONA 2IGNA 1WJAA 1Z3YA 3I9V2 3KYLA 3H5RA 4G6TB 3ZR8X 4OAZA 4YRVA 4NNJA 1LFPA 2R7RA 2WAQA 1V5EA 1J09A 3U21A 4ITVA 3HUGB 1QU3A 2IGMA 2VL8A 3MKWB 5KCMA 3DKYA 4F92B 3SDBA 4E7HA 4BGDA 4IQ4A 3GBGA 4E7KA 2XDVA 4BQOA 4QPQA 2L9SA 4F91B 3C2HA 3W2AA 1WFXA 2ZSIB 2HVQA 4XQFA 2JA2A 5TGTA 3SEQA 3DPUA 3G2BA 3W2WA 4PUSA 4DBQA 4X0GA 4RM3A 4E7SA 4XKVA 3AL0C 4MLOA 4PJNA 2PJRA 2Q1ZB 2ZSHB 3VDXA 3DLAA 3VYRB 1DP3A 1BR4A 2V7FA 4HSRA 3LFUA 1Z7LA 1G59A 4LG3A 2KMUA 2VJJA 3FKJA 3H9QA 3LSKA 2R7VA 5CKTA 4B44A 2Y0SA 1D1BA 3EUHC 1BR1A 4ZJZA 3DWLE 3OS0A 3RCOA 2Z16A 3DEEA 3AKZA 4CA0A 3A2KA 2KP6A 3BC8A 1OR7C 4HG2A 2L9NA 3DQVC 4F55A 3KX2A 4BL0B 1U0JA 3VYUB 3HC7A 3FHNA 3ZRGA 4RM2A 1D1AA 4CCNA 2HNHA 2R7UA 3K4NA 3DPTA 2KLOA 2LY1A 2WY8Q 3QYFA 4XLFA 1X19A 2K5CA 1MW7A 3F9KA 2CH0A 3RTRA 3FDYA 4XKCA 3E0JB 2MABA 3LL7A 2BW3B 2X6WA 4ZTFA 1X4OA 4HEA2 3K10A 2MC4A 4ANJA 2VKDA 3OYBA 4PFOA 2DT6A 2LBFB 2R4GA 4XNFA 3PSIA 2CV0A 4LIUA 3DKXA 2WA0A 3L2RA 2LREA 1WJDA 3AFHA 1SFKA 2X6YA 2X6XA 4HNUA 5KNLA 4BE2A 4HNTA 5LFAA 2Q2EB 4DOZA 4YELA 2CFOA 3A1YA 3DTEA 4AVZA 4CSWA 2CW7A 1NG7A 3VWBA 2HU9A 2HVRA 1DGRM 3UNGC 1DGWY 2WADA 4BQQA 3EUKL 4ZYAA 2PMZA 2ZXHA 3VYTB 5JHFA 2KRHA 1JI8A 3FBNB 2VB6A 3PUBA 5HVQC 1ERDA 1LVKA 4CCJA 3K6GA 3OYDA 3MKZA 2HDWA 3OS1A 3PFYA 4FASD 4CH7A 3CJRB 1D0XA 1N75A 3M1CA 1W36D 3SZGA 4IQJA 4OAYA 3RQ4A 2LYCA 1WJBA 1DQUA 3VSKA 2HPMA 3EUAA 3PSFA 2W82A 4ZDPA 2P0WA 3QOEA 3K4MA 3HG9A 2VLAA 1D1CA 2VJIA 3PNVA 1BR2A 3H5NA 4NQWB 2KHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W2A A;  3MKY B;  1VZ0 A;  3MKZ A;  3W3C A;  3MKW B;  3VWB A; 
#chains in the Genus database with same CATH topology
 2EIJ H;  3ZQL A;  3MWM A;  2R7Q A;  1ETX A;  2VT2 A;  3D1N I;  1X1P A;  5DCM A;  3WHB A;  3JTG A;  3K70 C;  3LQR A;  2E2I J;  1U5T A;  3TED A;  2Y0M A;  2HQA A;  3WTY C;  1WI3 A;  4C9Y A;  3DTI A;  4AIK A;  5EZG A;  3GTJ J;  2RQQ A;  5EEG A;  2FJ1 A;  1XB4 A;  5KAI C;  2PN6 A;  4CIC A;  3K4J A;  3FXM A;  1OCT C;  5FD6 A;  5J8F A;  1W1W E;  3OR2 C;  2O8X A;  2CQK A;  3TL4 X;  4ZYE A;  3G1O A;  3K4L A;  4L9N A;  2FBH A;  4GYI A;  3DTK A;  3FBI B;  1S8N A;  2RAE A;  3KZZ A;  4M3B A;  1GLN A;  3F8N A;  2EA2 A;  5D6E A;  2V1D A;  2XAS A;  4K2E A;  2OAZ A;  4BHC A;  3MN2 A;  4IX7 A;  1BJA A;  2EK5 A;  1FTT A;  4M71 A;  2MD5 A;  2EPF A;  1K4T A;  3K4B A;  1MJ9 A;  4MGR A;  2VOD A;  2Z9O A;  3SZT A;  5K5O A;  1BIB A;  3RPU D;  5M5W J;  1BOB A;  1IJW C;  1J9I A;  5HOO A;  1B8I A;  1RRJ A;  2YX4 A;  3ZMD A;  3ZQH A;  1KON A;  4XSZ F;  1SFO J;  1SD5 A;  2XKP A;  4V2F A;  2H8W A;  1GXP A;  4S0H B;  3V8K A;  1LKX A;  1PJR A;  2TRT A;  4B3X A;  4N4O B;  3DBR B;  4D5C A;  4BJ5 C;  3DFG A;  1E2X A;  4C3J J;  1S9H A;  4F3Q A;  4EJT A;  2XC7 A;  1X2M A;  3GEZ A;  1GV5 A;  2M2E A;  2LF7 A;  1SMY F;  2ME0 A;  2Y0S N;  2DMT A;  3JR9 A;  4JX4 A;  1U5T C;  1WZ2 A;  4FQG A;  1VQL I;  2AS5 F;  4PJM A;  4NC7 A;  5TRD A;  4A5M A;  3HB9 A;  3WGG A;  4J00 A;  4AD9 A;  2ZO4 A;  2F4M B;  4JBA A;  3KP5 A;  3HOZ J;  1ZG3 A;  4XMY A;  3H9J A;  1G6N A;  1OCZ H;  1T08 B;  3PNT A;  2FOW A;  1XD7 A;  2FMY A;  4EM0 B;  3IAM 2;  4C2T A;  2R7S A;  2CG4 A;  5E79 C;  5IP6 A;  1KQ9 A;  4L9V A;  3OYL A;  2DFH A;  2KDZ A;  2BYV E;  3J80 K;  4N9H A;  1X1A A;  1WVR A;  3DEW A;  4MTE A;  1XDU A;  4XLH A;  3WG7 H;  5CPR B;  2CV2 A;  3I3L A;  1W5S A;  5LHH A;  2H09 A;  2NVQ J;  4I99 C;  1J7K A;  2CW8 A;  3BOQ A;  3ZN1 A;  1SAX A;  4DBR A;  3CUQ A;  1W5T A;  4H4K C;  1WJ5 A;  2KFD A;  2Y69 H;  4DIQ A;  4JP0 A;  1XS9 A;  2R7O A;  2QQ8 A;  3DBL B;  3ONQ A;  3RYP A;  2PFB A;  3OYH A;  1Y8Q B;  4JX5 A;  1WH5 A;  2L7F P;  1DP7 P;  3BG3 A;  3M8E A;  4ASN A;  2WV0 A;  5GTI C;  1PUF B;  4I0B A;  1E3H A;  1TQM A;  2LR8 A;  2QQ9 A;  2K9M A;  3W3C A;  4HF2 A;  2L9R A;  4M6Y A;  3FHZ A;  3QP6 A;  2NS8 A;  4CYC A;  4OMZ A;  5F0F A;  1HW1 A;  1GV2 A;  2KDO A;  2VIX A;  2A61 A;  3GZ6 A;  1MBE A;  2HKO A;  3LSI A;  2X4H A;  2ZME B;  4L5J A;  5H2F C;  2KQR A;  2Y30 A;  2ETH A;  3K1P A;  1LUJ B;  4A6E A;  1AU7 A;  5GAH J;  4RAF A;  2X48 A;  4OIP F;  5GPC A;  2M7A A;  5IYB J;  3R61 A;  1LQ1 A;  2GOX B;  1YE9 A;  1Z9C A;  2V6E A;  1K7A A;  3Q0U A;  3PO2 J;  3K4C A;  4HPQ A;  1KQ0 A;  4DW6 A;  5K7F A;  2DOA A;  1AHD P;  2ISZ A;  4PJL A;  3BCB A;  2R7F A;  4A3L J;  2NVX J;  4XOT A;  5J8C A;  4CUG A;  3IC7 A;  1FC3 A;  4LLL A;  1MNM C;  2EIM H;  3LSR A;  1OMI A;  2NVT J;  1FTZ A;  4WX9 A;  1LJ9 A;  1K61 A;  2ECC A;  4XRM A;  4UUS B;  2K4B A;  4BJ6 C;  3D5R C;  2LC2 A;  2CGP A;  1MBK A;  5B3S H;  2L0K A;  2QF7 A;  3TP0 A;  4PGH A;  5CVR A;  1FLI A;  1SVO A;  1D0Y A;  2E36 A;  2HTS A;  4F7Z A;  1T98 A;  2QWW A;  2Z99 A;  2FUG 2;  5FRO A;  2CUE A;  5HLI A;  1Z6T A;  3T5X A;  3E6C C;  4DYQ A;  2AQE A;  4XM3 A;  2MBF A;  3TO9 A;  2MLK A;  4HST A;  5J3L A;  4ON0 A;  4BUP A;  2LY2 A;  2GOM A;  3CLO A;  3V8J A;  4JOM A;  2HXI A;  3VOE A;  3L2Q A;  5E1X A;  2LD5 A;  2CUF A;  4Y17 A;  4CZC A;  3K70 D;  2JWT A;  2DCE A;  1Z1D A;  2L4M A;  2BVM A;  4MFD A;  2E5N A;  3BG7 A;  2CQQ A;  5CVV A;  4CCK A;  4M6X A;  1V4R A;  1UMQ A;  3ZQQ A;  2OQR A;  1XGO A;  1Z77 A;  5HLT A;  3QPT A;  3I0T A;  1NK3 P;  2P5L C;  3OL4 A;  2IP2 A;  4L18 B;  1QO0 D;  1WJC A;  1KU3 A;  1O3Q A;  3S93 A;  4M9Z A;  2JK3 A;  1TNT A;  1M1E B;  5M3F J;  1B9M A;  5BOX A;  5BQT A;  2KL4 A;  1WQ2 A;  3HL2 A;  4BAY A;  3E7L A;  2HFH A;  4GXO A;  3BQY A;  1TWG J;  2H1K A;  2OTJ I;  1MMD A;  3OYN A;  5ICC A;  4HQE A;  2JSC A;  1ODD A;  2KPM A;  1TC3 C;  4R79 A;  4AYB A;  2XKO A;  4GGG A;  1MJA A;  2XB5 A;  3JRD A;  2M9H A;  2K7L A;  2JUG A;  2KJB A;  2MH2 A;  1G8X A;  4UB8 C;  4ENK A;  3OWT A;  5CQG A;  3W6K B;  3NQO A;  4MO7 A;  3BG9 A;  3OSG A;  3S2H J;  5KVR A;  2WAF A;  1KYW A;  2FOK A;  2DOD A;  4A12 A;  2I10 A;  5H6R A;  1X1C A;  2MGQ A;  4ZH4 F;  3F8C A;  4MEY F;  1POG A;  2V1X A;  3RZO J;  1T39 A;  4DNC A;  5LGU A;  2A68 F;  4KN4 X;  3CO6 C;  5GAG J;  1TW3 A;  4DYR A;  2NNN A;  3BTI A;  4KT5 C;  2VQH A;  2G0E A;  3TOB A;  3FXO A;  4CCO A;  1FBS A;  1Y6I A;  1MDM B;  3VYS B;  2JJ7 A;  1HKQ A;  2M87 A;  1ENH A;  5ERI A;  3OYJ A;  2QQA A;  4G6Q A;  2KIS A;  2P8T A;  1UJ8 A;  3FM5 A;  1ZLK A;  5FLX K;  2PMZ N;  1QPM A;  1R1T A;  1WJA A;  4EVI A;  1VFC A;  2AHQ A;  2ZJP F;  3ZMU A;  5JVT A;  4OIO F;  3WTV C;  5CVI A;  4YRV A;  2FNP A;  4RAG A;  3ZQI A;  5EJC A;  5D8K B;  3HRT A;  3BRO A;  4HAM A;  1L0O C;  2DTR A;  4ITV A;  1REP C;  3HUG B;  3VEP A;  3BJA A;  1K6O A;  1QU3 A;  2IGM A;  2PBI A;  4F92 B;  2LLK A;  1FWZ A;  1PUF A;  2IA1 A;  3GBG A;  1I1S A;  2XDV A;  1T6S A;  3VPR A;  3S15 J;  3W2A A;  1WFX A;  2ZSI B;  2C6Y A;  3DPU A;  1DUX C;  2ZME A;  4RM3 A;  3TOA A;  2XAQ A;  1JHH A;  3EYY A;  4XK4 A;  2XGE A;  4JYK A;  4ZYH A;  1ZK8 A;  1R5I D;  4IHY A;  3I56 I;  3CCE I;  1P6R A;  4Z2Y A;  3DLA A;  2HR3 A;  2XRN A;  2X0L A;  4U0W A;  1BR4 A;  1DP3 A;  1Z7L A;  3KYD B;  3CC4 I;  2KMU A;  2VJJ A;  3FXJ A;  1O7L A;  1HST A;  1O7F A;  3H9Q A;  3HM5 A;  3FK7 A;  1TQP A;  4LK0 F;  5CKT A;  1RIO H;  3AG2 H;  1D1B A;  2O6G E;  3K69 A;  2D1V A;  1H88 C;  4ZJZ A;  3RQI A;  5HLG A;  3RCO A;  1WHU A;  1MBJ A;  4CA0 A;  1JT6 A;  3GF2 A;  2KP6 A;  1D8K A;  3ASN H;  1QZZ A;  1TL8 A;  1R23 A;  1MIJ A;  2CSO A;  1F1Z A;  1B6A A;  3MKL A;  1U2W A;  5FKO A;  2A6E F;  3TDZ C;  4RM2 A;  4RB0 A;  3RPU A;  1H9G A;  4GO1 A;  4CCN A;  1BW5 A;  2R7U A;  1T2K A;  2DK5 A;  2WV1 A;  4WWC A;  3GWZ A;  5J1U A;  3QPL A;  1F36 A;  1X19 A;  3I4N J;  2DPU A;  2ELK A;  3F9K A;  3NAU A;  2MLG A;  3FKI J;  3V4G A;  2LMD A;  3JSO A;  1I39 A;  3FDY A;  3TKY A;  5HS9 A;  3P9I A;  4IL6 C;  4OIN F;  2KRF A;  2DT5 A;  3LL7 A;  2BW3 B;  2X6W A;  1S5L C;  2E1O A;  3FXL A;  2XGC A;  1S7E A;  3K10 A;  4ANJ A;  2G9W A;  2YS9 A;  2A3S A;  1W0U A;  2LBF B;  2WWY A;  1D5V A;  4RA2 A;  3M1E A;  2FD5 A;  3PSI A;  5EYR A;  3IRR A;  2EFN A;  2WA0 A;  3L2R A;  2K9S A;  2LRE A;  3IRQ A;  3S1R J;  2X6X A;  5A2Q K;  5LFA A;  1UB9 A;  2Q2E B;  4DOZ A;  3N97 A;  1DPU A;  4YEL A;  4CSW A;  5FKK A;  2GAU A;  3CO7 C;  2CW7 A;  4IOC F;  2HU9 A;  4A3G J;  4UV8 A;  5IP9 J;  3GTM J;  1MMS A;  2DYS H;  3HKZ N;  1LE8 B;  2VPR A;  3KIO A;  2F5C A;  3P5J A;  3EUH A;  3FMR A;  2R5Z B;  1JJ6 C;  3K1N A;  2ZCW A;  1RKW A;  5TIS C;  3MFK A;  3PUB A;  3OV8 A;  1OR7 A;  1CGP A;  1F4K A;  1OIS A;  1I3A A;  1XCV A;  5ICE A;  3A02 A;  4FAS D;  2EH3 A;  3M1C A;  3SZG A;  4IQJ A;  4WK8 F;  3MZY A;  3TGN A;  4V2G A;  5ICF A;  2HPM A;  2HOE A;  2ICW G;  2IJL A;  4UUV A;  1HQC A;  2P0W A;  3QOE A;  3HG9 A;  1IGN A;  1QGP A;  2CRG A;  2DA5 A;  2BZT A;  3ABM H;  4EM1 A;  3JSP A;  2AXL A;  1TP4 A;  2OQG A;  4Z6Y A;  2CS3 A;  4E6K G;  3J7Z I;  2O61 A;  2L7M P;  3CP2 A;  1G3W A;  1YW8 A;  2E5Z A;  1GHC A;  4KIC A;  1R71 A;  3N05 A;  3W2V A;  3G1M A;  3IHU A;  5F1R A;  4WCG A;  4LIV A;  3HZJ A;  4P96 A;  1MDM A;  3CCR I;  1UAA A;  1R49 A;  1I6X A;  3K4K A;  2WAE A;  2ISY A;  3CMY A;  1FY7 A;  3BZK A;  3GO5 A;  3QP5 A;  1F5T A;  1SD7 A;  2YPR A;  1MMG A;  4B4C A;  3S1N J;  4RGR A;  1NG6 A;  2E1M B;  3SXY A;  4GCV A;  2WC2 A;  1Y0N A;  2WB1 N;  2DFI A;  4ZZD A;  2B0L A;  5GTH C;  4ZTJ A;  5K5Q A;  1BI3 A;  3JAM Z;  4Y13 A;  1YS7 A;  3S2D J;  4UNO A;  4KMF A;  1FSH A;  2GM4 A;  1A31 A;  5GAD J;  2HZT A;  5DDG A;  3MVP A;  2BHZ A;  3QYB A;  5J47 A;  2EFQ A;  5F04 A;  1T0F A;  3KZI C;  1GDT A;  2DT7 B;  3QWL A;  3HOU J;  1L3L A;  5F0H A;  2HYG D;  4XR6 A;  3RIR A;  4BH9 A;  2DQL A;  4KT6 A;  1JKR C;  3NWT A;  1IC8 A;  2DFF A;  5EG0 B;  1K4S A;  2DA3 A;  4M74 A;  4OMY A;  2DTZ A;  2DBB A;  3F3X A;  4AWX B;  4Y7N J;  3HOT A;  2M30 A;  2CFX A;  3DCF A;  1HDP A;  2N8G A;  2VE9 A;  5DEQ A;  2LG4 A;  1K83 J;  4HF1 A;  4XL9 A;  4AUX A;  1WH7 A;  1IN6 A;  2FQ3 A;  1ETQ A;  3MCZ A;  2JRM A;  3AG4 H;  2HXO A;  4XOP A;  2GIZ A;  1YHQ I;  1UHM A;  1X3Z B;  2MD0 A;  2K3P A;  1I27 A;  4IO9 F;  3LA2 A;  5LRR A;  4P5O A;  3LSM A;  1YRN B;  2DA1 A;  2MW8 A;  2V1N A;  3HEF A;  1V3F A;  2LK2 A;  5CQE A;  1R58 A;  4CDG A;  3NRV A;  3ABU A;  2VKV A;  2R7D A;  3HRU A;  3P7N A;  3BZC A;  1A6Q A;  3HOW J;  3A4C A;  5ILS A;  1T95 A;  5J4V A;  3E6M A;  4B47 A;  2W84 A;  2LH9 A;  1K79 A;  1LPQ A;  4PJ0 C;  4RLF A;  5HDG A;  2MH9 A;  2VQG A;  3JRF A;  3E5Q A;  3DU5 A;  1WJF A;  2BY3 A;  2BHY A;  5EGO B;  2VC1 A;  2X51 A;  1SFU A;  1P92 A;  2BW3 A;  2H6C A;  2H6B A;  1IDZ A;  2OUM A;  2DI3 A;  4XN3 A;  2OTL I;  3OR1 C;  4RAZ A;  4B1R A;  3CCY A;  3Q3S A;  2DOE A;  1RUN A;  1JUM A;  1OQY A;  1PVE A;  1D8J A;  2LBF A;  2V6C A;  2VBW A;  3BR6 A;  2KRC A;  2A6T A;  1SD4 A;  1T0F C;  2L4A A;  1U3E M;  2HGC A;  2K4J A;  2DPD A;  4P9F A;  3SFZ A;  1XSX A;  1YLF A;  2E34 A;  3O8G A;  3ZOB A;  1XPX A;  2Q2E A;  3OIP A;  3MKY B;  4ENJ A;  3RI4 A;  1X3U A;  3LSH A;  3GTK J;  1QHG A;  2BVL A;  3HOS A;  2HYF A;  5DM7 F;  3QRF F;  4C2M J;  3GME A;  5LBQ A;  2DO7 A;  4Q4Z F;  1LE8 A;  1IUY A;  2F5V A;  1ONV A;  2Y48 A;  4IPA A;  1S7O A;  1SAN A;  2HTJ A;  5EZH A;  1ZLJ A;  3GW2 A;  2R5Z A;  4XSX F;  1AKH B;  2EZI A;  3VFZ A;  1I6H J;  1IN5 A;  4IZZ A;  2P5V A;  1FMV A;  1OKR A;  1YJN I;  3ZMZ A;  2DA4 A;  1UG2 A;  2EA4 A;  2W00 A;  2FA5 A;  3SEZ A;  4QTR A;  2MYS A;  3RJP A;  4J01 A;  3QU6 A;  2EWN A;  2EZH A;  4LD5 A;  2VON A;  1HW2 A;  4CCM A;  1FOY A;  4WXC A;  1ON2 A;  1UZC A;  2OU2 A;  3A0B C;  3OY9 A;  1JT0 A;  2Z33 A;  3E1S A;  3C18 A;  4BDZ A;  2E71 A;  2JT1 A;  2ZJR F;  4UXN A;  2DK8 A;  3BR0 A;  1XN7 A;  5D4R A;  1W5C C;  5H6Q A;  4DJA A;  3CME I;  4YEJ A;  5AIP A;  4FET A;  4XLA A;  3CCM I;  2ZJ2 A;  1ETY A;  2Z2S B;  1ZRC A;  2VQC A;  3C2G A;  3GZN B;  5F27 A;  4B43 A;  4G6D A;  2IA2 A;  2O9L A;  3GYH X;  3C2B A;  1ZGJ A;  2BY0 A;  2LFB A;  3CC2 I;  4UUT A;  2JN6 A;  1MSE C;  2D5V A;  2HQN A;  2HOA A;  3S32 A;  1OYW A;  1B9N A;  2ZXW H;  2VN2 A;  2DDA A;  3TMO A;  2X9D A;  1J2X A;  2ZJQ F;  2EFP A;  3PNY A;  3S2W A;  2R92 J;  3HSF A;  1R36 A;  2QLZ A;  3FWE A;  1FMW A;  5FO5 A;  5DUI A;  1XCB A;  5F1J A;  4BBS J;  3ZMV A;  2R93 J;  1KU7 A;  4RS8 A;  1ETO A;  4DQ2 A;  1I3Q J;  3L2V A;  1I5Z A;  4BE1 A;  2BEO A;  4AVP A;  1GUU A;  5E3O A;  2L7K A;  2E1N A;  5EG0 A;  2Z3Y A;  4Q5S F;  2FNA A;  2PJP A;  4ABZ A;  2HPI A;  1IO2 A;  4EEF G;  2VBY A;  2E7X A;  1G3T A;  2DU9 A;  3FXK A;  3ABK H;  1LDK B;  4B48 A;  5BPD A;  2KIF A;  2KZV A;  3HJE A;  2GA2 A;  4B8X A;  4EM2 A;  3JW4 A;  4FT8 A;  3OSF A;  3FIW A;  3TW6 A;  4HZF A;  1HA8 A;  3IAS 2;  3DP7 A;  2QQB A;  3WU0 A;  4GYG A;  2UUZ A;  3DU6 A;  2COB A;  1OFC X;  4I02 A;  4RB3 C;  5DD8 A;  1K6Y A;  1HCR A;  2VPL A;  1MH3 A;  2G7U A;  1SMT A;  4F93 B;  2A07 F;  4II2 A;  4XRS A;  4CCL A;  3I5U A;  1YRN A;  3H3U A;  2EJR A;  3TBI A;  3H5A A;  4GDF A;  2AXT C;  2FML A;  2DAO A;  1N78 A;  1QVU A;  2QEN A;  1IAW A;  2F48 A;  4LG0 B;  4R1H A;  3J81 K;  4JX6 A;  1YG2 A;  4G8X A;  1P7J A;  3BG5 A;  2JZY A;  1LEB A;  4KYW A;  2BBY A;  3EDP A;  3ZP5 A;  1JUP A;  2MFZ A;  3N4M A;  3HOV J;  1PUE E;  1TQI A;  1N25 A;  1ZHF A;  4TV7 A;  2L01 A;  3T1B A;  1LNW A;  3RKW A;  2EV6 A;  4A5N A;  2W1O A;  3ABT A;  2JA6 J;  1V5F A;  2XGX A;  4ZYG A;  4BY7 J;  5LGT A;  5EGO A;  4A2U A;  2E1M C;  3CMM A;  1YOV B;  4YIF A;  2R7X A;  3CLQ A;  4II3 A;  3HSR A;  1W7P D;  3ZMS A;  3H92 A;  5M5X J;  5E8I A;  5L3C A;  4D9J A;  5HDK A;  3CJN A;  4BBR J;  3F8M A;  5L3F A;  3FZV A;  4XON A;  4ESF A;  1JE8 A;  4OU0 A;  3H5R A;  4G6T B;  3KP3 A;  2MSY A;  2ID3 A;  5CJ9 A;  5KK1 A;  3PFI A;  2DA7 A;  4HX8 A;  5IYC J;  2K9Q A;  3DLL F;  1YIJ I;  2ZFW A;  3CJT B;  1OYY A;  3U21 A;  3LWF A;  4NB5 A;  5BMZ A;  1FBQ A;  1GVD A;  4X1E A;  3L00 A;  3CMA I;  3GLX A;  2IRF G;  3SDB A;  1ZAO A;  3PM1 A;  4E7H A;  1AKH A;  4BGD A;  4E7K A;  2RDP A;  1RPW A;  4PZJ A;  1U9N A;  4AIH A;  1Y8R B;  4BQO A;  4QPQ A;  2L9S A;  3IWZ A;  4F91 B;  2NVU B;  5LHG A;  2AO9 A;  4XQF A;  3GVA A;  3HOX J;  4LB5 A;  2JA2 A;  3SZP A;  3SEQ A;  4X0G A;  4PUS A;  2RQP A;  4HQM A;  4E7S A;  5FKL A;  3H3Z A;  4MLO A;  3WE3 A;  2GZW A;  2RV8 A;  1VQ9 I;  2HKX A;  4PJN A;  2XRL A;  3KLN A;  4YFN F;  3CC7 I;  2QUF A;  2Q1Z B;  2ZSH B;  3VDX A;  4M9S A;  2V7F A;  4U0V A;  1VND A;  1OCO H;  3LFU A;  4HSR A;  1G59 A;  3HSE A;  1O3T A;  5C3E J;  4ENN A;  3GXO A;  1SVM A;  1KGS A;  2R7Z J;  4E70 A;  4PGG A;  1JKQ C;  2Y31 A;  1BR1 A;  3LOC A;  4KMU X;  1LVA A;  1WGX A;  3DWL E;  3PQJ A;  2XV4 S;  3MZH A;  4BQA A;  2Z16 A;  3DEE A;  2K9N A;  3GFJ A;  2HWV A;  3PIO F;  3BC8 A;  3MZ8 A;  2OBP A;  2UXN A;  5ICG A;  3BWG A;  3DQV C;  4F55 A;  5IP7 J;  1OYI A;  2OZU A;  1QRY A;  3QU3 A;  1U0J A;  4M3F A;  3WOD F;  1RUO A;  3VYU B;  1Z0X A;  3FHN A;  1FIA A;  2HNH A;  5GPA A;  1ZR2 A;  3E97 A;  1SEU A;  2KLO A;  2DN0 A;  2LY1 A;  3QYF A;  4R8H A;  4XLF A;  4OIR F;  1FP1 D;  2BE5 F;  2K5C A;  1E3O C;  2L7Z A;  1TNS A;  3DBH B;  2A69 F;  1VF9 A;  2MAB A;  5E8G A;  2FX0 A;  2BGC A;  1ETV A;  1X4O A;  4HEA 2;  4HOB A;  4L0Z B;  1KU9 A;  4CO8 A;  3OYB A;  4PFO A;  2ZNZ A;  2E7W A;  4L5E A;  1G2H A;  2R4G A;  3DEU A;  5CVU A;  1BW6 A;  4LIU A;  1FSE A;  4NDL A;  2NS7 A;  3AFH A;  2LF8 A;  1FYM A;  3BR5 A;  1DPR A;  5HDN A;  4HNU A;  1MKM A;  2X6Y A;  2QBY B;  2ECB A;  1X2N A;  3BT9 A;  1R5G A;  3ERE D;  4EV0 A;  1BI1 A;  3A1Y A;  3WTX C;  1R4M B;  1MBF A;  1NG7 A;  1J75 A;  2XPW A;  2HVR A;  3UNG C;  4BQQ A;  5HLH A;  5H20 A;  5IOZ A;  1B1B A;  2KIU A;  2D45 A;  2PMZ A;  2HDD A;  3VYT B;  5JHF A;  3A01 B;  3TO7 A;  1JGG A;  1JI8 A;  2VB6 A;  1H9T A;  5FD5 A;  1YIO A;  2X6O A;  2DQR A;  4CCJ A;  4KIB A;  1PP8 F;  1W7P B;  2DDB A;  2V9V A;  3QPH A;  2XAG A;  3CDL A;  3ABL H;  4HLX A;  4MNU A;  1VQ6 I;  2DLL A;  4I0A A;  1ULY A;  1IW7 F;  3JTH A;  3U1K A;  3RQ4 A;  2XAJ A;  5C4J J;  2E2H J;  4LG0 A;  1DQU A;  2KKO A;  3EUA A;  3FIS A;  2M8E A;  3H0G J;  1P4A A;  3K4M A;  3KFW X;  3BTL A;  1H89 C;  3I4M J;  5E18 F;  1R7J A;  1D1C A;  1B59 A;  2VJI A;  4HV5 A;  5JHU A;  3PNV A;  2VLA A;  1X3W B;  3CQZ J;  2ADU A;  3K7A J;  4IRG A;  3U2R A;  2KJC A;  4G7O F;  2FSW A;  5DYM A;  4YFK F;  3K2Z A;  5BPI A;  4P55 A;  2GXA A;  4IKF A;  1RI7 A;  3PUF A;  4IRH A;  3FK6 A;  1E0E A;  2X1C A;  3I59 B;  1ZYR F;  1Y1W J;  2XF5 A;  2EIK H;  3OYK A;  2FBI A;  2TCT A;  4IXA A;  4Q47 A;  1A6I A;  3MD2 A;  1MMA A;  4IF4 A;  2DA6 A;  3EPZ A;  1WI9 A;  5HOD A;  2R5Y B;  3GTP J;  3BZ6 A;  3M8J A;  4A3F J;  1HSJ A;  3OOP A;  4Y4R A;  3KP4 A;  2CQ7 A;  3LMM A;  2ESH A;  2RVC A;  2CJJ A;  3HTU A;  3TDU C;  1VQN I;  4M3E A;  1XGN A;  2UZK A;  3OL3 A;  1WSU A;  2BV6 A;  1UG0 A;  4E7J A;  4Y33 A;  1TBX A;  2F4O B;  1I50 J;  2VKH A;  3AG3 H;  4FTH A;  1WWX A;  1XDS A;  4RLQ A;  5DUK A;  5L3D A;  1NK2 P;  3EET A;  4RDU A;  4L9T A;  4S05 A;  5DD4 A;  3U9G A;  3ZXS A;  4BEH B;  3OYA A;  2DJI A;  2QGU A;  3RPQ A;  2XPV A;  4UUS A;  1WJE A;  1FOK A;  1KU2 A;  4O6J A;  2L9V A;  2VE8 A;  1F43 A;  1JXS A;  3FXU A;  5DS9 A;  1UFM A;  4F52 A;  4G7Z F;  4RBO A;  1YIT I;  2IS2 A;  4XRS G;  4BQN A;  4ETS A;  1VQ7 I;  4LMY A;  1HLV A;  2F5F A;  3GFL A;  3WTZ A;  1O57 A;  3I53 A;  4D0P A;  3MAJ A;  2X1E A;  3KCC A;  2XUB A;  4FHT A;  2EBI A;  1QBJ A;  3F21 A;  4IOA F;  4XLC A;  1LDD A;  2RC4 A;  3OYI A;  2CYY A;  2M0M A;  2VXZ A;  2BOL A;  2FE3 A;  4Y3O A;  4A3K J;  3C7J A;  2O0Y A;  3AL0 B;  4RGX A;  2VC0 A;  1USS A;  2W85 A;  3B02 A;  2W25 A;  4BXF A;  1BA5 A;  4XOR A;  3HKZ A;  3WGI A;  3GFM A;  2OZ6 A;  4D7M A;  2GIV A;  1QZE A;  5D5X B;  4P1W A;  3T0Y A;  1R6R A;  2H8R A;  1AA7 A;  2IA0 A;  1Y1V J;  2MG4 A;  3KE2 A;  4MFE A;  4HX7 A;  4E7Z A;  1NTC A;  3OIQ A;  3AAF A;  1MH4 A;  4XLN F;  3IP4 B;  1BBY A;  3ECO A;  1F9N A;  2IS6 A;  3H1C A;  4U87 A;  4MQV A;  4UVB A;  2K02 A;  1JKO C;  2Z5U A;  5ILU A;  4I7H A;  3OYG A;  3JRB A;  2IS4 A;  1OCC H;  4OOI A;  3OMY A;  2EFW A;  4G7H F;  3B6C A;  2V9K A;  6PAX A;  1CF7 B;  1TT0 A;  3CJQ B;  2K3F A;  3M4O J;  2RNG A;  2DXI A;  4A3M J;  4FE7 A;  3PIP F;  4BXX J;  3TP3 A;  3V8L A;  3JRC A;  1Y56 A;  1T8I A;  3IH3 A;  2QBY A;  2RKH A;  2HEO A;  1BM9 A;  5IT9 Z;  3VSL A;  3BTJ A;  1YW7 A;  4RGS A;  5J40 A;  2CV1 A;  5D6F A;  3HDD A;  4UB6 C;  3JCU C;  4HRI A;  1UCR A;  4HBL A;  5E1W A;  1YW9 A;  4UVC A;  1N77 A;  2VOO A;  5JLX A;  2UV1 A;  4QWQ A;  5IOY A;  1TW2 A;  4BHP A;  5EDN A;  5FLV A;  2VQL A;  4WF2 A;  5A2Q Z;  3WU2 C;  2XB0 X;  3A01 A;  1R1U A;  4CHU A;  3AG1 H;  4E7L A;  4NHJ A;  3VB2 A;  2UXX A;  3BG6 A;  4O3M A;  3QYE A;  3BPX A;  2R7W A;  2BY1 A;  1UHS A;  2IGO A;  1Q1V A;  3TO6 A;  3HPG A;  1W7P A;  3JAM K;  2HOT A;  4B3A A;  1PYV A;  2I8D A;  2WB1 A;  2LDU A;  2L2O A;  2YSR A;  1Z3X A;  2OC6 A;  3BR3 A;  4IHT A;  4QLC U;  4KNY A;  3QOP A;  2COM A;  4QPO A;  4BHB A;  2PJR B;  3S1M J;  1U6G A;  2XAU A;  2YUS A;  4HA8 A;  3FXQ A;  2YX7 A;  5K1Y A;  4GRI A;  3CCL I;  3JRI A;  3R0A A;  2XAF A;  4LGW A;  4BU2 A;  1OJL A;  3ZQC A;  2K27 A;  5JVG F;  2HVS A;  3HUG A;  1KQ8 A;  4PSX A;  2PMU A;  3E6D A;  2B7E A;  1PDN C;  3BLY A;  1XGS A;  4NC8 A;  1KYZ A;  3BDD A;  3L2W A;  4N4N B;  1MND A;  3F22 A;  4L9J A;  2WAQ N;  2CMP A;  3I59 A;  3M8F A;  1G3S A;  1S7A A;  4WXD A;  3ZQ7 A;  2PLY A;  2A6H F;  1Z21 A;  3F8F A;  4V19 K;  2WTE A;  1RZ4 A;  3JRE A;  1TLH B;  2KT0 A;  5J4Y A;  4E7I A;  1KA8 A;  4C2U A;  1FIP A;  3KEO A;  5D5W B;  2R5Y A;  2IBD A;  4CZZ A;  1FNN A;  1ZN2 A;  2FBK A;  4LLN A;  1XMA A;  3I71 A;  3HOY J;  2IS1 A;  4LIT A;  1P7I A;  1X1D A;  4G94 A;  1OCR H;  4LOC A;  5BNG A;  4CGZ A;  2HYJ A;  1IUF A;  4RGU A;  1W4M A;  3CZ6 A;  5E3M A;  2XRO A;  4Y15 A;  2QKL B;  3A0H C;  2W48 A;  4BEH A;  1YS6 A;  2CO5 A;  2ZFU A;  4XLE A;  1J0R A;  5ILV A;  2XSD C;  3GX4 X;  4KIG A;  1IN4 A;  3I55 I;  1YYV A;  1SAU A;  3WTW C;  4OWR B;  4HV6 A;  2IVM A;  3K1M A;  1LFU P;  1A04 A;  4KN7 X;  5F0C A;  1IRG A;  1BJZ A;  4JQF A;  4C3I J;  2FF4 A;  2Z1D A;  4FIS A;  1YJ9 I;  2O8K A;  1MD0 A;  5GAE J;  1K78 B;  3EQL F;  3CCQ I;  2WBM A;  3UR3 C;  5M3M J;  4KIS A;  2RN7 A;  1VQM I;  2X85 A;  1ACI A;  3JRH A;  2M34 A;  2ACJ A;  2KIM A;  3JRG A;  4W1U A;  3BQZ A;  4M6V A;  3WGH A;  2I5U A;  3Q5F A;  2Y75 A;  1OCP A;  4M73 A;  3IKT A;  1XMK A;  1ZH5 A;  5E17 F;  2VAS A;  2QM3 A;  3R4K A;  5J6X A;  5C4X J;  2PEX A;  1QPI A;  2QSH X;  1FX7 A;  1I1G A;  1ZEL A;  1AOY A;  2LOO A;  4IHS A;  1DDN A;  1XSD A;  5D5U B;  3GTQ J;  4PSW A;  4AU7 A;  2QKM B;  4EJU A;  4A3C J;  4ZC3 A;  3E3V A;  5HNH A;  1SFX A;  3ZGK A;  2IT0 A;  2STT A;  2Y9Z A;  3QOD A;  5BS6 A;  3SFI A;  2H1L A;  1S29 A;  2ZC2 A;  4A69 C;  1FYL A;  2QSF X;  1WKM A;  4EGY A;  2GXB A;  3R60 A;  1MBH A;  3HHH A;  3PJR A;  4PK4 A;  1FT9 A;  5FRM A;  5LEJ A;  2EIN H;  4IJA A;  3OYC A;  1OPC A;  1IV6 A;  5JR3 A;  1CF7 A;  1Y39 A;  4IEJ A;  1U8B A;  3FMS A;  3HPH A;  3RZD J;  2CQX A;  2J5P A;  1D0Z A;  3BR1 A;  5DM6 F;  3KYL A;  1Z3Y A;  2P5K A;  1Z7U A;  2M8G X;  2OPT A;  1BN5 A;  4B09 A;  1LFP A;  2NNY A;  2R7R A;  2ME6 A;  4X6A J;  1ZTR A;  2LNB A;  1V5E A;  1J09 A;  2F5E A;  4W97 A;  1J59 A;  2EZK A;  2EQR A;  4XRF A;  5K7Z A;  1ZAR A;  3RKY A;  1UST A;  2VL8 A;  3MKW B;  1Z6R A;  3WTU C;  1SFE A;  2G7H A;  5FB2 A;  1HBX G;  2E19 A;  4JK1 X;  4FX0 A;  5DTD A;  3SHF A;  1T33 A;  2HVQ A;  2NXN B;  3ERM A;  2ELH A;  3W2W A;  1VQO I;  3G2B A;  1FOW A;  5IY5 H;  4FCY A;  2QSG X;  3V7R A;  3FF5 A;  3CCU I;  4XKV A;  5D5V B;  3AL0 C;  4XID A;  3KET A;  2NVY J;  5L3G A;  3M07 A;  2F2E A;  2OF7 A;  2ZBK A;  3U1D A;  2A05 A;  1LDJ A;  1VQP I;  2PJR A;  4RB2 C;  3ESW B;  4I01 A;  5DCF A;  2L02 A;  2O3F A;  3M3Y J;  5GP9 A;  3ZPL A;  5IPA A;  1MBG A;  2R7V A;  2Y0S A;  1J5Y A;  3J7Y J;  1P2F A;  1TTY A;  2D2W A;  2CQN A;  1JHF A;  2EV5 A;  2L54 A;  3OS0 A;  3AKZ A;  3KLO A;  3A2K A;  1IN7 A;  3O6B B;  5B1B H;  1O3R A;  4XIC A;  4HG2 A;  2L9N A;  3G71 I;  2OA4 A;  2IW5 A;  1YQA A;  2MA3 A;  3KX2 A;  3BJO A;  2E1C A;  4CYD A;  3HC7 A;  3DKW A;  3ZRG A;  3NEU A;  3ZN0 A;  3K4N A;  3J7A O;  3E6B A;  2WY8 Q;  3KPH A;  2K40 A;  1JKP C;  3K0L A;  2HDC A;  1MW7 A;  2O03 A;  4ZZL A;  2PG4 A;  2PMH A;  2O7O A;  3LFK A;  2PX9 A;  2QCO A;  4EJV A;  3E0J B;  1Y0U A;  1G3Y A;  1ON1 A;  4ZTF A;  4DYC A;  2MC4 A;  3F6O A;  4IVN A;  3E5U A;  2DT6 A;  1ZG5 A;  1R00 A;  1RET A;  4I2O A;  1HDD C;  1RNL A;  3W6J B;  3DKX A;  1O3S A;  3LNQ A;  3Q0V A;  3REO A;  3F0C A;  5KNL A;  3P9C A;  4YG2 F;  1IRF A;  3CDH A;  4M3D A;  3HTS B;  3DTE A;  3L9F A;  4AVZ A;  5HS7 A;  1ZRD A;  3A03 A;  2JRT A;  5LHI A;  1X58 A;  1DGW Y;  3CUO A;  2B63 J;  3Q9V A;  2A5Y B;  2MC3 A;  4BKX A;  1FEX A;  1GXQ A;  4ZYA A;  1JTY A;  3ULQ B;  1K78 A;  2KRH A;  3FBN B;  1Z91 A;  4YFX F;  5HVQ C;  1ERD A;  3RKX A;  4AID A;  1LVK A;  2PI0 A;  1R5H A;  2W24 A;  3OYD A;  3MKZ A;  3LA3 A;  5FJ8 J;  5ED4 A;  3OS1 A;  1R9T J;  4LB6 B;  5EF6 A;  2DJN A;  3PFY A;  2OCC H;  1W0T A;  2XIG A;  5FKN A;  3HYI A;  4CH7 A;  3CJR B;  4OAY A;  4M72 A;  1WJB A;  3VSK A;  4A3J J;  3GTO J;  4AM3 A;  2W82 A;  2YU3 A;  2ZB9 A;  1PP7 U;  4ZDP A;  2VI6 A;  4NC6 A;  3BP8 A;  2STW A;  3J80 Z;  4ESJ A;  4NQW B;  2KHM A;  4UV9 A;  4EQQ A;  2PQ8 A;  3GUD A;  3J81 Z;  4I98 B;  5EEA A;  2W4S A;  3OOU A;  3GTL J;  3S16 J;  3I58 A;  4S04 A;  2XVC A;  3OYF A;  1VQK I;  1X1B A;  1TT5 B;  4I6Z A;  2UWM A;  1MGT A;  2XF7 A;  5J1R A;  3L2U A;  2ID6 A;  3LSG A;  1P9Q C;  4LLG F;  3SQN A;  3QQA A;  3KP6 A;  3QAH A;  5E3L A;  4PFP A;  9ANT A;  1HKT A;  4KJZ A;  3GTG J;  3V42 A;  1ETW A;  4QIW N;  5FKM A;  5D4S A;  3HXL A;  5LD2 C;  4KUM A;  1EH7 A;  3O3K A;  4YII A;  2JTV A;  3HIF A;  3H9G A;  3GLL A;  1B72 B;  5B5E C;  2FEZ A;  4DZJ A;  3IH2 A;  3LAJ A;  1RR8 C;  3ZQF A;  3H35 A;  1RC9 A;  3S3M A;  2JVH A;  3L1P A;  1FZP B;  1EKE A;  2YR2 A;  2V26 A;  2XGD A;  3L09 A;  2BY2 A;  3LQQ A;  1P4W A;  4NBQ A;  2HS5 A;  3T8R A;  5JLW A;  3S14 J;  3CP8 A;  4XN0 A;  5KHD A;  2OJE D;  5E20 A;  1HF0 A;  2NOJ B;  2XAH A;  3DPL C;  4M3G A;  3GZ5 A;  3IUO A;  2M5W A;  4BJT A;  3ZCO A;  2HOS A;  3CUQ C;  5LGN A;  1TZL A;  3D5S C;  1ORK A;  2OCE A;  5AIQ A;  1YTY A;  1SD6 A;  1ZG1 A;  3IWF A;  4RMN A;  4KDP A;  4BNC A;  2LSO A;  3F6V A;  1UEL B;  1Z05 A;  4KFC A;  3J7A Y;  2RGV A;  4BE0 A;  1RES A;  3D5L A;  5M5Y J;  4ZDO A;  3L2C A;  3LA7 A;  3FM3 A;  3RDI A;  3BJ6 A;  2KIQ A;  5FRN A;  1QHH D;  1JTX A;  4PJJ A;  1DU6 A;  4A3I J;  3ISP A;  4A0X A;  5D8L B;  4HX4 A;  3G4S I;  1WPK A;  1ZRE A;  3KEY A;  1BOA A;  3QPS A;  2IGK A;  2E2J J;  4A3D J;  1BIA A;  1X4P A;  3TQN A;  3CDI A;  1ZGA A;  4A0Y A;  5E3N A;  1JJ8 C;  3BR2 A;  3V7C A;  1VZ0 A;  1MMN A;  4LJZ F;  4L5I A;  4BS9 A;  3T8T A;  3NWS A;  4D7N A;  1STZ A;  2XF6 A;  3ECH A;  1MNE A;  2F4I A;  3OS2 A;  3FMQ A;  1EA3 A;  1IF1 A;  1IXR C;  3E5X A;  2F6C A;  3IL2 A;  3RKQ A;  5TJJ A;  2H27 A;  2M0C A;  2M3A A;  1P4X A;  3BCA A;  4BAC A;  1YX3 A;  3S3N A;  1IRZ A;  3C1D A;  4DGW B;  2VXD A;  3KEQ A;  4I09 A;  2HZD A;  4BYY A;  4N9I A;  2XHK A;  1R1V A;  5F6F A;  5HNF A;  4AYB N;  1VTN C;  4EGZ A;  2JVG A;  2TDX A;  2EB7 A;  4N0B A;  1S3J A;  2Q0O A;  3WG9 A;  3SYT A;  3CCJ I;  1LB2 A;  2JA5 J;  3CCV I;  4Y52 J;  2M4K A;  4XKB A;  4BDY A;  1YJW I;  1UHW A;  2P6T A;  3LSP A;  3ASO H;  3H0D A;  2VBX A;  1ITY A;  4HDU A;  1BC8 C;  1C0W A;  2JSP A;  5FFZ A;  3B6A A;  2LY9 A;  1BC7 C;  3OYM A;  2ELJ A;  2L5Q A;  3P9K A;  4IHW A;  2IXS A;  2DYR H;  4ENM A;  1ZQ3 P;  2FQ4 A;  4PCQ A;  1H0M A;  1OLT A;  2HQ5 A;  2XPU A;  4G12 A;  1EV7 A;  3BTC A;  1E3P A;  3O2P E;  3BPV A;  4NQW A;  2DOF A;  2K9L A;  4HNV A;  3ROU A;  1U8R A;  2JA7 J;  3GFI A;  2Q8K A;  5FLX Z;  1MJB A;  4RAY A;  1XG1 A;  2P7C B;  1XTA A;  1ETK A;  5K7H A;  1A36 A;  2LTP A;  3W6V A;  3RSN A;  3KP2 A;  2QA4 I;  3KP7 A;  4EJW A;  4A6D A;  3S8P A;  1YX5 A;  2Y2Z A;  2OV7 A;  4FE4 A;  4MIM A;  4UHT A;  2P6S A;  3UKG A;  2WY7 Q;  3K2A A;  1EH6 A;  3G1L A;  1IZ1 A;  1O4X A;  2YU9 J;  5JFR A;  2ZKZ A;  4MEX F;  4HF0 A;  1WCM J;  3F23 A;  3GCM A;  2LP0 A;  4C30 A;  1NHA A;  1A35 A;  4IRI A;  2CU7 A;  1EH8 A;  2V4J C;  4P9U A;  1RKT A;  2W57 A;  3CES A;  2O5R A;  4ZDL A;  1B72 A;  3G6E I;  3D0S A;  2VJ5 A;  2A5W A;  3S3O A;  3VOD A;  2M1B A;  2X1D A;  1SVL A;  1A5J A;  3MMY B;  2L3D A;  2NAZ A;  3FX3 A;  5B1A H;  3WU1 B;  1VQ8 I;  4AIJ A;  2M4G A;  2AQF A;  2VJ4 A;  4KIT B;  2M7B A;  5K5R A;  1FPQ A;  4XKW A;  3CD6 I;  4QSH A;  2E60 A;  2JMW A;  4U0Y A;  1W36 C;  2JA8 J;  3S17 J;  2ZXJ A;  5LEK A;  3Q9S A;  2XSJ C;  3HHG A;  1EJ9 A;  2P7V B;  4OIQ F;  2DW4 A;  3PL8 A;  5IT9 K;  4A3E J;  1GVJ A;  1V5G A;  2RRE A;  5E1Z B;  4D1Q A;  2DFE A;  4NUB A;  5LLQ A;  1XGM A;  2R3S A;  1R4N B;  1V54 H;  4A0Z A;  1HOM A;  2ZXI A;  4CXF A;  5LRS A;  3H36 A;  1U9O A;  3BY6 A;  2DMQ A;  3CF2 A;  3X2Q H;  3HBL A;  4EAT A;  4H0E A;  2JPB A;  1TWC J;  5CVJ A;  2IPQ X;  2CUJ A;  2VKE A;  3L7W A;  3O8H A;  5EEH A;  3ZQG A;  2W7N A;  3PO3 J;  1NH3 A;  2LRD A;  2DA2 A;  2DMN A;  5FFX A;  2ZME C;  3I64 A;  4AC0 A;  2JUC A;  2B9S A;  2ZNY A;  4J19 A;  2R7T A;  2V1U A;  2IEK A;  1ZRF A;  4IHX A;  1IXC A;  3WTS C;  3IKV A;  4FX4 A;  2DMU A;  3M7G A;  1LFB A;  4ZYD A;  2J5O A;  5J1Y A;  1JUS A;  1RR7 A;  2D1H A;  3LST A;  5DCM B;  1IXS B;  4EJO A;  5HS8 A;  2GLO A;  4E4H A;  3RYR A;  2QYO A;  3Q0W A;  1BL0 A;  2K85 A;  3ML6 A;  5FGM A;  1HKS A;  4EMS A;  3OIO A;  1U5T B;  2NYX A;  1IRX A;  2CUZ A;  1T38 A;  4RB1 A;  4HLY A;  1ZR4 A;  3DV8 A;  3DF8 A;  3OYE A;  4U7B A;  2VOP A;  2IGN A;  1QVT A;  3I9V 2;  3KYC B;  4C3H J;  3ZR8 X;  4XBF A;  1YO5 C;  2HQR A;  4OAZ A;  4PDK A;  5L3E A;  4NNJ A;  4U88 A;  4KIF A;  2LKS A;  1FBU A;  3WTT C;  2WAQ A;  5IT3 A;  2VT3 A;  2KZG A;  3SJM A;  1MZB A;  1BI0 A;  1U78 A;  2LKP A;  1CQT A;  3R6S A;  1VQ4 I;  5KCM A;  3DKY A;  2K86 A;  2RNJ A;  1KZH A;  4IQ4 A;  1ZKG A;  2LKX A;  4I76 A;  4BY1 J;  1Z67 A;  5JI6 A;  3B73 A;  1QZY A;  1APL C;  3C2H A;  3I54 A;  2EV0 A;  2BXY A;  5TGT A;  4DBQ A;  4YIR X;  1SC7 A;  4KA4 A;  1GT0 C;  4XLP F;  3MQ0 A;  2EFO A;  2IAI A;  1B8I B;  1XMX A;  2HI3 A;  1FYK A;  1VQ5 I;  2F5D A;  2CWE A;  1IV8 A;  2V9P A;  2JPC A;  3LSJ A;  5C44 J;  3VYR B;  3DXJ F;  1HXD A;  4LG3 A;  1H8A C;  1YI2 I;  1IG7 A;  1FP2 A;  2P81 A;  4LFU A;  3FKJ A;  3LSK A;  4MHG A;  1R22 A;  3WHC A;  4B44 A;  3K9T A;  2FXA A;  3R0J A;  2V79 A;  3EUH C;  3G73 A;  3MEX A;  4O5V A;  2FU4 A;  3HRS A;  4HDV A;  3S1Q J;  3SDG A;  1OR7 C;  3PQK A;  3FXR A;  2P4W A;  3IV5 A;  3LAP A;  1XX5 A;  3HGG A;  4BL0 B;  4U7D A;  1TWF J;  1G4D A;  3EYI A;  1D1A A;  2EZL A;  2FRH A;  4A93 J;  3COA C;  3DPT A;  2QVO A;  2QEX I;  4D5F A;  2GXG A;  1AWC A;  4GFB A;  5DV5 A;  1D5Y A;  4G9Y A;  1XC5 A;  2CH0 A;  3RTR A;  1QNT A;  3KZY A;  2VBZ A;  3TW7 A;  5B66 C;  3CF5 F;  2GBY A;  1LEA A;  4XKC A;  1FJL A;  5IYD J;  2GQQ A;  4HYE A;  1HC8 A;  5FLM J;  5F08 A;  2LVS A;  2VKD A;  3F8B A;  1HW5 A;  5F64 A;  3HRM A;  4IHV A;  5CYV A;  1V55 H;  1YFH A;  4XNF A;  3HGY A;  2CV0 A;  4BXU A;  2BXZ A;  2M45 A;  4L0Y B;  1WJD A;  3ZMT A;  3C3W A;  3I4P A;  1SFK A;  1MSF C;  3CCS I;  3F72 A;  4DZP A;  4BE2 A;  4HNT A;  4ESB A;  3NAR A;  2E35 A;  3CUQ B;  4Q48 A;  3V7S A;  2CW0 F;  2NRA C;  2CFO A;  1FOX A;  1T56 A;  3CTA A;  1VI0 A;  1S6L A;  3VWB A;  2JQ7 A;  2DMP A;  5AON A;  1DGR M;  2WAD A;  5KAF C;  4UY8 I;  3H3V K;  3EUK L;  1BI2 A;  1IN8 A;  2ZXH A;  3WE2 A;  1TWA J;  4HW0 A;  2NS0 A;  3G3Z A;  1JGS A;  1D3Y A;  4UVA A;  2OD5 A;  3ELK A;  1Q1H A;  3M9A A;  4CYC B;  1S72 I;  3K6G A;  2VUM J;  2R0Q C;  2QZ8 A;  2HDW A;  2ESN A;  2GA1 A;  2NOG A;  1XSV A;  4M9X A;  1ZGW A;  2EIL H;  1QA6 A;  4LK1 F;  1D0X A;  1N75 A;  2H94 A;  1W36 D;  1WRJ A;  1DU0 A;  2Y9Y A;  2GWR A;  2LYC A;  3PSF A;  1QQI A;  3IH4 A;  1EF4 A;  1B4A A;  1E17 A;  5CLS A;  1TWH J;  1IDY A;  4A3B J;  4MQ9 F;  4MTD A;  3JRA A;  4WXH A;  1BR2 A;  5L3B A;  3H5N A; 
#chains in the Genus database with same CATH homology
 2CS3 A;  4E6K G;  3CP2 A;  2R7Q A;  2E5Z A;  2W4S A;  3OOU A;  3N05 A;  3W2V A;  3OYF A;  4IKF A;  1X1B A;  4LIV A;  2UWM A;  2XF7 A;  1E0E A;  3K70 C;  2X1C A;  1UAA A;  3K4K A;  2WAE A;  2XF5 A;  2HQA A;  3OYK A;  4C9Y A;  3L2U A;  3LSG A;  1P9Q C;  3MD2 A;  1MMA A;  3DTI A;  2RQQ A;  3EPZ A;  4PFP A;  4KJZ A;  1MMG A;  3V42 A;  3M8J A;  1NG6 A;  2E1M B;  3K4J A;  3HXL A;  4Y4R A;  5LD2 C;  3OR2 C;  3TL4 X;  3LMM A;  3K4L A;  4ZTJ A;  3H9G A;  3DTK A;  3FBI B;  3OL3 A;  1GLN A;  1UG0 A;  4E7J A;  4Y33 A;  2VKH A;  3QYB A;  3H35 A;  4RLQ A;  3S3M A;  2DT7 B;  2JVH A;  4BEH B;  4XR6 A;  3ZXS A;  4IX7 A;  3OYA A;  2V26 A;  2DJI A;  4KT6 A;  1WJE A;  3NWT A;  3CP8 A;  3K4B A;  4XN0 A;  5KHD A;  3HOT A;  4F52 A;  3RPU D;  2NOJ B;  3DPL C;  2IS2 A;  1BOB A;  4BQN A;  5HOO A;  3IUO A;  4BJT A;  2LG4 A;  3ZCO A;  1KON A;  4XL9 A;  1TZL A;  2X1E A;  3D5S C;  4XLC A;  4XOP A;  1LKX A;  3OYI A;  1PJR A;  4B3X A;  2M0M A;  4N4O B;  4RMN A;  4BJ5 C;  2MD0 A;  2VXZ A;  2BOL A;  4Y3O A;  2K3P A;  1S9H A;  3AL0 B;  4F3Q A;  4P5O A;  3LSM A;  2V1N A;  1UEL B;  2XC7 A;  3J7A Y;  4BXF A;  4XOR A;  3HKZ A;  5CQE A;  4BE0 A;  4ZDO A;  3D5L A;  4P1W A;  1R6R A;  3A4C A;  1AA7 A;  1T95 A;  5FRN A;  1QHH D;  4B47 A;  4PJJ A;  4E7Z A;  4PJM A;  4NC7 A;  2LH9 A;  3OIQ A;  4RLF A;  3IP4 B;  3KEY A;  4J00 A;  2VQG A;  2IGK A;  2IS6 A;  3DU5 A;  4XMY A;  1WJF A;  3H9J A;  1X4P A;  4U87 A;  3PNT A;  4C2T A;  3IAM 2;  2R7S A;  1VZ0 A;  2X51 A;  3OYL A;  3OYG A;  1MMN A;  2BW3 A;  2IS4 A;  2OUM A;  4BS9 A;  3NWS A;  3OMY A;  2XF6 A;  4XN3 A;  2V9K A;  1MNE A;  3OR1 C;  1X1A A;  2F4I A;  3OS2 A;  1EA3 A;  1TT0 A;  3CJQ B;  2F6C A;  2RNG A;  4XLH A;  2LBF A;  2DXI A;  5CPR B;  2CV2 A;  2M3A A;  3I3L A;  2KRC A;  3BCA A;  2A6T A;  1YX3 A;  4BAC A;  1Y56 A;  3S3N A;  1T0F C;  4DGW B;  2VXD A;  2CW8 A;  2HZD A;  3VSL A;  4DBR A;  3OIP A;  3MKY B;  3LSH A;  4H4K C;  1QHG A;  5HNF A;  2BVL A;  1WJ5 A;  2CV1 A;  3HOS A;  4DIQ A;  2JVG A;  2R7O A;  3ONQ A;  3OYH A;  4HRI A;  1N77 A;  2F5V A;  2UV1 A;  3SYT A;  2VQL A;  4E7L A;  2M4K A;  2K9M A;  3W3C A;  4XKB A;  3BG6 A;  4BDY A;  3QYE A;  2R7W A;  3H0D A;  2IGO A;  3HPG A;  4IZZ A;  1FMV A;  2JSP A;  1PYV A;  2I8D A;  2KDO A;  2VIX A;  2WB1 A;  2W00 A;  3SEZ A;  3OYM A;  4J01 A;  2ELJ A;  2L5Q A;  2MYS A;  3LSI A;  2IXS A;  2KQR A;  2L2O A;  1Z3X A;  4CCM A;  2OC6 A;  3OY9 A;  3E1S A;  2M7A A;  4BDZ A;  2GOX B;  4QPO A;  1YE9 A;  2PJR B;  1OLT A;  2V6E A;  2XAU A;  3K4C A;  4HPQ A;  2DOA A;  4GRI A;  4PJL A;  3BCB A;  4XOT A;  4BU2 A;  4DJA A;  4CUG A;  2K9L A;  4YEJ A;  2HVS A;  4PSX A;  4FET A;  3BLY A;  4NC8 A;  4XLA A;  3RSN A;  3L2W A;  4BJ6 C;  2Z2S B;  3D5R C;  4N4N B;  1MND A;  2LC2 A;  2VQC A;  3C2G A;  2CMP A;  4B43 A;  3S8P A;  1YX5 A;  2OV7 A;  1Z21 A;  1D0Y A;  2WY7 Q;  2FUG 2;  5FRO A;  4E7I A;  4C2U A;  3S32 A;  4C30 A;  2AQE A;  4XM3 A;  4HST A;  4BUP A;  2LY2 A;  2GOM A;  2IS1 A;  4LIT A;  2V4J C;  4JOM A;  1X1D A;  3L2Q A;  3CES A;  4ZDL A;  2O5R A;  3TMO A;  3K70 D;  4CZC A;  2VJ5 A;  2A5W A;  3S3O A;  2DCE A;  3CZ6 A;  2X1D A;  2BVM A;  3PNY A;  2QKL B;  3MMY B;  2E5N A;  3BG7 A;  1FMW A;  4CCK A;  2M4G A;  2AQF A;  4BEH A;  2VJ4 A;  4KIT B;  2M7B A;  2ZFU A;  3L2V A;  3ZQQ A;  4XKW A;  4XLE A;  4BE1 A;  2L7K A;  5HLT A;  2E60 A;  1SAU A;  3OL4 A;  2HPI A;  1W36 C;  4OWR B;  1WJC A;  1LDK B;  4B48 A;  3S93 A;  4JQF A;  2KZV A;  2XSJ C;  2Z1D A;  2KL4 A;  3HL2 A;  3PL8 A;  1HA8 A;  1V5G A;  3IAS 2;  2RRE A;  2WBM A;  2UUZ A;  3DU6 A;  3UR3 C;  4D1Q A;  4KIS A;  1K6Y A;  4NUB A;  2VPL A;  1MMD A;  3OYN A;  2X85 A;  4F93 B;  2ZXI A;  4II2 A;  2KPM A;  4R79 A;  4CCL A;  4AYB A;  3CF2 A;  2VAS A;  4EAT A;  3TBI A;  3H5A A;  2JUG A;  2CUJ A;  1N78 A;  1G8X A;  2W7N A;  1ZEL A;  3OWT A;  5CQG A;  2LOO A;  2LRD A;  2WAF A;  4PSW A;  2MFZ A;  4AU7 A;  2QKM B;  2R7T A;  1X1C A;  4ZC3 A;  5HNH A;  3ZGK A;  2W1O A;  3QOD A;  1V5F A;  2E1M C;  2VQH A;  4E4H A;  3CMM A;  3PJR A;  4PK4 A;  4CCO A;  5FRM A;  2R7X A;  1Y6I A;  4II3 A;  3VYS B;  3OYC A;  3OYJ A;  1IRX A;  2CUZ A;  4D9J A;  3HPH A;  3OYE A;  4U7B A;  1D0Z A;  4XON A;  2IGN A;  1WJA A;  1Z3Y A;  3I9V 2;  3KYL A;  3H5R A;  4G6T B;  3ZR8 X;  4OAZ A;  4YRV A;  4NNJ A;  1LFP A;  2R7R A;  2WAQ A;  1V5E A;  1J09 A;  3U21 A;  4ITV A;  3HUG B;  1QU3 A;  2IGM A;  2VL8 A;  3MKW B;  5KCM A;  3DKY A;  4F92 B;  3SDB A;  4E7H A;  4BGD A;  4IQ4 A;  3GBG A;  4E7K A;  2XDV A;  4BQO A;  4QPQ A;  2L9S A;  4F91 B;  3C2H A;  3W2A A;  1WFX A;  2ZSI B;  2HVQ A;  4XQF A;  2JA2 A;  5TGT A;  3SEQ A;  3DPU A;  3G2B A;  3W2W A;  4PUS A;  4DBQ A;  4X0G A;  4RM3 A;  4E7S A;  4XKV A;  3AL0 C;  4MLO A;  4PJN A;  2PJR A;  2Q1Z B;  2ZSH B;  3VDX A;  3DLA A;  3VYR B;  1DP3 A;  1BR4 A;  2V7F A;  4HSR A;  3LFU A;  1Z7L A;  1G59 A;  4LG3 A;  2KMU A;  2VJJ A;  3FKJ A;  3H9Q A;  3LSK A;  2R7V A;  5CKT A;  4B44 A;  2Y0S A;  1D1B A;  3EUH C;  1BR1 A;  4ZJZ A;  3DWL E;  3OS0 A;  3RCO A;  2Z16 A;  3DEE A;  3AKZ A;  4CA0 A;  3A2K A;  2KP6 A;  3BC8 A;  1OR7 C;  4HG2 A;  2L9N A;  3DQV C;  4F55 A;  3KX2 A;  4BL0 B;  1U0J A;  3VYU B;  3HC7 A;  3FHN A;  3ZRG A;  4RM2 A;  1D1A A;  4CCN A;  2HNH A;  2R7U A;  3K4N A;  3DPT A;  2KLO A;  2LY1 A;  2WY8 Q;  3QYF A;  4XLF A;  1X19 A;  2K5C A;  1MW7 A;  3F9K A;  2CH0 A;  3RTR A;  3FDY A;  4XKC A;  3E0J B;  2MAB A;  3LL7 A;  2BW3 B;  2X6W A;  4ZTF A;  1X4O A;  4HEA 2;  3K10 A;  2MC4 A;  4ANJ A;  2VKD A;  3OYB A;  4PFO A;  2DT6 A;  2LBF B;  2R4G A;  4XNF A;  3PSI A;  2CV0 A;  4LIU A;  3DKX A;  2WA0 A;  3L2R A;  2LRE A;  1WJD A;  3AFH A;  1SFK A;  2X6Y A;  2X6X A;  4HNU A;  5KNL A;  4BE2 A;  4HNT A;  5LFA A;  2Q2E B;  4DOZ A;  4YEL A;  2CFO A;  3A1Y A;  3DTE A;  4AVZ A;  4CSW A;  2CW7 A;  1NG7 A;  3VWB A;  2HU9 A;  2HVR A;  1DGR M;  3UNG C;  1DGW Y;  2WAD A;  4BQQ A;  3EUK L;  4ZYA A;  2PMZ A;  2ZXH A;  3VYT B;  5JHF A;  2KRH A;  1JI8 A;  3FBN B;  2VB6 A;  3PUB A;  5HVQ C;  1ERD A;  1LVK A;  4CCJ A;  3K6G A;  3OYD A;  3MKZ A;  2HDW A;  3OS1 A;  3PFY A;  4FAS D;  4CH7 A;  3CJR B;  1D0X A;  1N75 A;  3M1C A;  1W36 D;  3SZG A;  4IQJ A;  4OAY A;  3RQ4 A;  2LYC A;  1WJB A;  1DQU A;  3VSK A;  2HPM A;  3EUA A;  3PSF A;  2W82 A;  4ZDP A;  2P0W A;  3QOE A;  3K4M A;  3HG9 A;  2VLA A;  1D1C A;  2VJI A;  3PNV A;  1BR2 A;  3H5N A;  4NQW B;  2KHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...