3MKZA

Structure of sopb(155-272)-18mer complex, p21 form
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
112
structure length
112
Chain Sequence
PTSAYERGQRYASRLQNEFAGNISALADAENISRKIITRCINTAKLPKSVVALFSHPGELSARSGDALQKAFTDKEELLKQQASNLHEQKKAGVIFEADEVITLLTSVLKTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein sopB
publication title Insight into F plasmid DNA segregation revealed by structures of SopB and SopB-DNA complexes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna-binding protein/dna
total genus 35
structure length 112
sequence length 112
chains with identical sequence B, N, U
ec nomenclature
pdb deposition date 2010-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18090 SoPB_HTH Centromere-binding protein HTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2830 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3mkzA00
3MKWB 3VWBA 3W2AA 3MKZA 3W3CA 1VZ0A 3MKYB
chains in the Genus database with same CATH superfamily
2GOMA 3L2VA 2E1CA 4Y33A 2LF7A 4E70A 2QA4I 3BT9A 4KUMA 5FFZA 2FE3A 5FRMA 3GTQJ 2PMUA 3B02A 5EGOB 2LF8A 2EA4A 5JLXA 2HXIA 1Y39A 2PJRB 4DBQA 2E1OA 1I6HJ 2EIKH 4IRGA 1JE8A 1HA8A 2ZJRF 4C3IJ 2WTEA 3CO7C 3FXQA 2P7VB 2MYSA 1G3SA 2K3FA 1X19A 3CCLI 1ETYA 1B9NA 4UUSB 3HM5A 5E18F 3KETA 2X6OA 3HRMA 4A3EJ 2QBYA 2K9LA 2ZJPF 5IYDJ 1IRZA 1VQKI 1JUSA 1Y8QB 3BDDA 2XRLA 5F04A 4ZYEA 1R23A 1K4SA 4JYKA 2GA1A 4HDUA 2V9KA 2WAEA 1IN6A 1V55H 3I71A 4XL9A 3MWMA 4BDYA 5K7HA 4EGYA 2XPVA 1H9GA 3PSFA 2OCEA 1YJ9I 4M3EA 3GCMA 4B44A 3CZ6A 2C6YA 2IA1A 3WU1B 3OS1A 2VN2A 2OUMA 2ISYA 2E1MC 3LNQA 3F9KA 3HIFA 4ABZA 1Z7LA 5B1BH 2P7CB 4KA4A 4IHYA 1Z6TA 2A6HF 1ZRDA 3LSJA 4FETA 2XGCA 2AXLA 1HW2A 3ZPLA 4L0YB 5HNHA 2PI0A 2DTZA 4BBRJ 4AD9A 2HI3A 2MSYA 4N0BA 3J7ZI 4L5EA 1MBFA 2FQ3A 3S15J 1FPQA 1I1GA 3E6DA 4PDKA 3LSPA 1QU3A 4G6QA 3CCSI 2B63J 1P4WA 2QF7A 1BIAA 3C2GA 2V4JC 3E1SA 1J5YA 4P96A 1BM9A 3W6VA 1MBGA 2HQRA 4R8HA 3BWGA 4BEHA 1VF9A 2Q1ZB 3Q9SA 2XAQA 3S2WA 4NUBA 3V8LA 5M5XJ 4B4CA 3G2BA 5BNGA 2UWMA 4BDZA 3SEQA 3AL0C 2QQ9A 1V54H 3ZMUA 5FLXZ 2DA2A 4AIJA 1A6IA 2HNHA 3H36A 4DZJA 2VQGA 2XKPA 1MD0A 3K69A 4LLLA 5ICCA 1VQ7I 3I59B 1D8JA 4IEJA 1A6QA 1VQNI 3S14J 4C30A 2L9SA 4Y13A 3KP3A 2KISA 2G7HA 2W82A 3CMAI 4RM2A 4AVPA 3CCMI 4XLFA 2ID6A 5K7ZA 1UCRA 2LBFA 2FBKA 4UB8C 4CHUA 1IF1A 4WWCA 3I4PA 4O6JA 3T8TA 2PMZA 3I0TA 3RPQA 4LLNA 4OAZA 2WWYA 2VONA 4A0XA 3PL8A 1YFHA 2KZGA 2VC1A 4YFXF 5IT3A 2IXSA 3QOPA 2IS1A 2W00A 2EFNA 1AOYA 2CW7A 3KZZA 1TNSA 5ICFA 2JTVA 3DKWA 1H9TA 4IHSA 2H09A 5K1YA 4NNJA 1LUJB 2Y0MA 2KT0A 4UV8A 3CJQB 3OYLA 5DCMA 2FXAA 2O7OA 2MD5A 2K5CA 3VYUB 3JRHA 3K70C 2QBYB 1T2KA 2ZJQF 3LA3A 1BC8C 4E7IA 3UNGC 3FHNA 4IJAA 3ZQGA 2QSFX 3S8PA 5HLHA 2OBPA 3RYRA 4A3BJ 1Z9CA 1ZLJA 4E7JA 1LFPA 4ZYHA 2FOKA 2QQBA 3AFHA 1UHWA 1XG1A 3MMYB 2HOTA 1ZG3A 4RB1A 3G1LA 4XLHA 4N9HA 1O7LA 2LFBA 3NARA 5L3DA 1W36D 4A93J 3HOUJ 2MH2A 1UELB 2XGEA 3BTCA 4P55A 1G3YA 3IAM2 5FKOA 3L00A 5F0CA 2KJCA 1S72I 2M30A 2VT3A 3P9KA 4IX7A 3B6AA 1GLNA 3QODA 2CYYA 1WCMJ 1FYLA 2RKHA 2CV1A 4KMFA 2HYGD 2PLYA 2MW8A 3FXLA 3EUHA 3OOPA 3LSTA 1TT0A 1HSTA 2OU2A 1JTXA 2L7FP 1KQ9A 3BR3A 4DZPA 2PMHA 1SVOA 5H6QA 2R5YA 1MZBA 1OISA 3CCVI 1MMNA 1Z91A 3K4LA 1BW6A 4RAYA 3DXJF 3GW2A 4HG2A 4IQ4A 2QGUA 3ESWB 1J59A 2R7FA 3H5NA 2VOPA 3BR6A 4Z6YA 1V5FA 4EJWA 3TMOA 1WGXA 2WAFA 4WX9A 3F21A 4BEHB 1R1VA 3BLYA 1ZARA 2EZKA 2K9MA 2F5VA 1Y0NA 2O61A 1VQ5I 2WA0A 2W57A 2Z16A 1XMAA 2Z2SB 4ASNA 4HAMA 3G73A 2Q8KA 2FQ4A 3L09A 1FMWA 1QZYA 1B6AA 3EDPA 3DTIA 2MABA 1TQMA 4KFCA 4IKFA 3LSGA 2V79A 2R7QA 3H5RA 1OCPA 4RM3A 3HOWJ 3OYMA 3S1NJ 3OY9A 3HPHA 2CFOA 2LDUA 2XSDC 3R61A 3DFGA 3S32A 2JT1A 2X1CA 1Y56A 5M3FJ 3CF2A 4GDFA 2AO9A 2LBFB 3OIPA 4XKVA 2GZWA 4ESBA 3GF2A 3BPXA 3DF8A 2V26A 3HKZN 5EDNA 1WJCA 2JQ7A 1MIJA 1RR7A 2H8WA 2IA0A 2Y31A 2YU9J 4MFDA 4A3KJ 2XKOA 1TC3C 2IW5A 2ADUA 4NDLA 2A6TA 2P5VA 2YS9A 3KLOA 4OIOF 2JUGA 2WAQA 1YHQI 2L7KA 1QZEA 5LGTA 2OQRA 1MDMA 2EK5A 1XMKA 2W4SA 3RQIA 1BI2A 5DCMB 2ZFUA 1K83J 3OYBA 2CUEA 2JPBA 3GMEA 5J8FA 1X3WB 4AWXB 3BZ6A 1GUUA 2R7RA 4LD5A 1H0MA 4OIPF 1YOVB 2R93J 5GAGJ 2N8GA 2HKXA 2BHZA 3VWBA 3SZTA 3CMYA 1QBJA 2RN7A 3IC7A 4S05A 1JI8A 2F6CA 1FC3A 4MNUA 1HCRA 1QZZA 2Q2EA 5CVVA 1LVKA 1ETVA 2KKOA 2AS5F 1R36A 1TWCJ 2NRAC 3OV8A 4BJ5C 2FEZA 5C4JJ 4M3BA 1PUEE 1REPC 2QSGX 2XC7A 2M0CA 5FO5A 5DM7F 5FKLA 2YR2A 1IN7A 3MKYB 4BYYA 3RI4A 1MW7A 4A0ZA 4G8XA 1T98A 3BTIA 2H8RA 4LLGF 3DU6A 1J0RA 1OQYA 1R49A 2MFZA 2GIVA 5F64A 2A6EF 4F52A 3F8BA 2R5YB 1S9HA 1ZTRA 4D7NA 1N78A 1ITYA 3BZKA 3E6MA 4XK4A 1ZH5A 2R7UA 1JGSA 1KU2A 5JFRA 1XSVA 5B1AH 2IVMA 2ZXHA 1BL0A 1MSFC 2DO7A 3TGNA 2TCTA 1IO2A 2W85A 1IN5A 2NVQJ 1Z1DA 3F23A 2ME6A 2BVLA 1T95A 2RQPA 3K1PA 4S0HB 1BBYA 3DLAA 3OYFA 3FM5A 3PUFA 3U1KA 1DDNA 2CU7A 2COBA 4WXHA 4A69C 4HBLA 4OU0A 4FCYA 2GAUA 2VJIA 3MKWB 3COAC 1ZGAA 2ZB9A 4I98B 2KIUA 1SMTA 4CA0A 4BNCA 1FWZA 1T6SA 3QPSA 5L3FA 2OTLI 3WU2C 4C2MJ 3C3WA 3G71I 3HPGA 3GLXA 5DUKA 5FB2A 4RAGA 3MCZA 3W3CA 1YS7A 4V19K 2M8GX 4KICA 4PJJA 3R0AA 3H0GJ 2XPWA 2HVRA 1H88C 3K6GA 3JRAA 4XN3A 2H1LA 3F0CA 3JSOA 3CLQA 2CV0A 2NXNB 2DA1A 3FDYA 5DUIA 4ZC3A 2MD0A 1JHFA 3NWSA 2CQXA 2EFPA 3R60A 1VQ9I 4AIDA 1MNEA 2Y9YA 3A02A 1OYIA 2EBIA 4DYQA 1MDMB 3Q3SA 3GO5A 2V6EA 3KYCB 1SD5A 3PQJA 3HSRA 3LWFA 3Q9VA 3HOVJ 1E0EA 3J81Z 4PK4A 3V8JA 2LH9A 4IZZA 1IZ1A 2F4MB 1A5JA 3Q0UA 3VODA 1BOBA 1G3TA 2VT2A 2HKOA 2KJBA 2CQKA 2ZXIA 1G6NA 1X3ZB 2ZXJA 3IP4B 3MAJA 3QPHA 2Y0SA 2KMUA 4L9JA 3RKYA 1IJWC 3DEWA 4HQMA 2VXDA 3CQZJ 1PP7U 4G9YA 3JRFA 3GTJJ 3RDIA 1YYVA 2F5DA 2M4KA 5EZGA 3CDLA 2Q2EB 1V4RA 3E5QA 2NS7A 3E3VA 3M4OJ 4FASD 1D0ZA 4IF4A 1KA8A 3JSPA 1ETWA 4JX6A 4Q47A 5ILUA 2L9VA 4PFPA 2DU9A 4FE7A 5IT9K 3PNVA 4ETSA 3MVPA 4AYBA 1VQOI 4RGXA 2DI3A 1R5GA 1X2MA 1J7KA 3WG9A 4LMYA 2ZKZA 2LVSA 4UVBA 2BVMA 2ZSHB 4V2GA 2F48A 3FBIB 1DP3A 3CDIA 4CZCA 3LOCA 1M1EB 3SFZA 2ZO4A 3NAUA 5IY5H 3TQNA 3ZXSA 2EZLA 1YJNI 1ZR4A 1SEUA 4C9YA 4P9UA 2CJJA 1SFKA 1X4PA 2DAOA 2BYVE 3PQKA 3IH3A 3A1YA 2GXAA 4BE2A 9ANTA 2DPDA 3PUBA 3TL4X 2FF4A 2JWTA 2E7WA 3I5UA 4BU2A 3QYBA 4CGZA 1Y1VJ 4A3GJ 2MA3A 1XDSA 4PZJA 5GAEJ 4JOMA 3ROUA 2ELKA 4E7ZA 3BCBA 3VDXA 1WFXA 3C1DA 2X1EA 2CQNA 2KRFA 1XGOA 2PFBA 1HC8A 3QPTA 4RLQA 4LFUA 1KU7A 1ZLKA 3HGGA 2EZIA 2DDAA 1WH5A 2QCOA 1QHGA 5J1UA 4EV0A 3F8CA 3ERED 2P5LC 1IUYA 2EZHA 2BY3A 1BN5A 5E1ZB 5LHHA 3FIWA 3AL0B 3LSMA 4QPOA 3H3UA 2DA5A 3L2QA 5BMZA 5F0HA 2LTPA 2EILH 4HPQA 3IH4A 1N25A 2R92J 2L0KA 1UMQA 1ODDA 4FT8A 2W25A 2VOOA 5CVIA 1WJAA 2E34A 4XRMA 5L3BA 3WTTC 2DDBA 3HXLA 1AA7A 1D1CA 3OYAA 3BR1A 2WV0A 2XSJC 2LY2A 4ESJA 1MJBA 3BJOA 2DQRA 5D5UB 1BI0A 1OCTC 2E7XA 4KJZA 5IYBJ 4IRHA 4LK0F 4CCJA 1JJ8C 2MLGA 3RCOA 2LD5A 4R79A 1I5ZA 2QEXI 3BJAA 1WSUA 1XC5A 5K5RA 3ZGKA 3CCJI 1EF4A 5E3LA 2R7OA 1FZPB 2XUBA 3CC2I 1Y6IA 3SZPA 5AIQA 4X6AJ 4LOCA 1GHCA 4M9SA 1BOAA 2BEOA 2PN6A 2OF7A 2EH3A 4M73A 4PUSA 4E6KG 1E3PA 4RB2C 3CDHA 1ETXA 4B3AA 2FJ1A 4IRIA 5C4XJ 1GXQA 2Z9OA 4UHTA 3F6OA 1FBSA 1P2FA 2BXYA 3HC7A 2E71A 2FMYA 4LK1F 1W5CC 3G3ZA 1FMVA 4BE1A 3TKYA 3FBNB 2ISZA 3LFUA 1HW5A 1WJDA 4LGWA 4ZYAA 2R7WA 1O3QA 2H27A 3K2AA 3VPRA 1Z77A 2EPFA 1U2WA 3KLNA 4V2FA 4DOZA 4YELA 4JX4A 4ZJZA 1VQ4I 1MGTA 2GA2A 5EG0A 1BJAA 2BGCA 4OOIA 2OD5A 5E8IA 1LQ1A 5JVGF 4M6VA 2DMPA 4PGHA 3PFYA 3KEOA 3ZQQA 1HXDA 1SFXA 2DA6A 5EEHA 4F93B 3M3YJ 3K4MA 2W84A 3F6VA 5CQEA 2VPRA 2QYOA 2DYRH 4JK1X 5IYCJ 4BL0B 3TO9A 1TWFJ 2QZ8A 3GUDA 2R0QC 1MNDA 2DYSH 4KDPA 2VBWA 4AU7A 2CQQA 3CMEI 1P7JA 4YIIA 4YFKF 1FOYA 2CWEA 4B3XA 4KT6A 5D6FA 4ESFA 2CRGA 3BTLA 1RR8C 2JVHA 2J5OA 3OYIA 4NBQA 1P9QC 3G1OA 1IDYA 1IW7F 2UXXA 3A03A 4W97A 1ZG1A 3KE2A 2W1OA 5FKNA 1WH7A 2LK2A 2FNAA 5KNLA 4F7ZA 2FSWA 2HVQA 4LB5A 3DEEA 1UB9A 4I02A 3WE2A 5LFAA 2R7SA 5KAIC 4CXFA 3ZQCA 2EA2A 3IH2A 3E6BA 3SEZA 3P7NA 4Q4ZF 1Z0XA 5B5EC 3ZQ7A 1EV7A 1FSHA 1DGRM 3W2VA 3GYHX 2EQRA 2FBHA 2V1DA 3GFIA 4IL6C 4A3IJ 4BUPA 2M87A 5J8CA 1WZ2A 3A0HC 4H4KC 1P7IA 1QNTA 4A6DA 2V1XA 1BI3A 4M3GA 3ZMVA 1F5TA 4XNFA 4KISA 1HF0A 2VQCA 2A68F 3RIRA 2H6BA 2JSPA 5BQTA 3C18A 1GXPA 2HDCA 2E5NA 4CCLA 2JN6A 1YRNA 5FLXK 3WHCA 2VBZA 2M8EA 3C7JA 4LG3A 4WXDA 3J80Z 3K70D 1AKHA 2L9NA 1TL8A 2ECCA 5M5WJ 2HQ5A 2VODA 1OPCA 4UNOA 1DUXC 2P8TA 3DU5A 2RGVA 3HHGA 3MZHA 4CCKA 4KT5C 4G94A 4XM3A 3DLLF 4E4HA 3OSGA 2K4BA 4DNCA 1YS6A 1Z3YA 3ZN1A 3SXYA 3GVAA 2F2EA 3WTWC 4L18B 1HDPA 3PIPF 3F22A 3PNYA 1FBQA 3GTLJ 4UXNA 4G6DA 4FQGA 1X58A 2P6SA 1G59A 3S1RJ 4U0WA 3I53A 4JX5A 3DBRB 4IVNA 3CC4I 1IAWA 1ZQ3P 2HOAA 4B8XA 1TTYA 1W7PA 2RNGA 2E60A 4XLCA 3GTGJ 4BQAA 3FHZA 3ZCOA 2Y9ZA 4HLYA 2KRCA 2M1BA 1ERDA 3W6JB 5J1YA 1RUOA 3CJNA 3LMMA 4BHCA 4QIWN 1JKOC 2ZJ2A 3KZIC 2FRHA 4BHPA 2QWWA 5JHUA 2R7TA 1LDJA 5DV5A 1LFBA 3N97A 2Z99A 4BQQA 3WODF 1ZK8A 5EG0B 1JUPA 2XB0X 3U9GA 2VXZA 2IS6A 4PCQA 1D5YA 3ABLH 3R4KA 1LJ9A 2JA6J 5HOOA 2DA7A 2E5ZA 1BW5A 4HX8A 3KCCA 3WTUC 3BR2A 2HU9A 3ZQIA 3ZR8X 3R0JA 4U88A 4KYWA 2R7VA 2Z1DA 2YPRA 1XB4A 2FNPA 2H1KA 2IBDA 3LSHA 1J9IA 1VTNC 1ZKGA 3W2WA 3CUOA 4CCOA 1T56A 3QU6A 1DQUA 1LB2A 2DMQA 2IJLA 1X4OA 1GDTA 4EJVA 2G7UA 4MHGA 2CMPA 5FLVA 4RAZA 3H5AA 3GZ6A 3AG4H 4Y17A 3O8HA 2JUCA 3S1QJ 2D1VA 1RKTA 5CVUA 5D5VB 2V6CA 1WQ2A 5ILSA 3V8KA 4ANJA 1OCRH 3IWZA 3MEXA 4ZZDA 1YW7A 2JRMA 5HODA 1UHMA 3B73A 3K4CA 1WJFA 2K7LA 2KLOA 2X48A 5LRRA 3ZRGA 1SANA 1I39A 2PG4A 3LSIA 4N4OB 2EWNA 1OFCX 4QSHA 4OIQF 2VKVA 5D4SA 1TZLA 3HJEA 3OYCA 4UY8I 1E3OC 1IV6A 5IP7J 2HEOA 1UAAA 1IN8A 1R00A 1K79A 3DTEA 5LEKA 2A07F 2M2EA 3K9TA 1JUMA 1YRNB 4NB5A 2HXOA 3SHFA 4LIUA 3DBHB 1AKHB 2PX9A 1RI7A 3HBLA 1RKWA 1CGPA 2I10A 3ZQHA 3KPHA 1D0YA 1UZCA 1Y0UA 1U9NA 2KPMA 2LC2A 2IPQX 5FLMJ 4M3FA 1HKTA 1POGA 1BR2A 3RKXA 2IS2A 2PMZN 2HDWA 3HB9A 2DK5A 5CKTA 3UR3C 2YX7A 3TOAA 5LD2C 3FF5A 2X4HA 2NVTJ 1Y1WJ 5H6RA 1PJRA 3BR0A 2QSHX 1T8IA 1QVTA 4A3MJ 3VFZA 4Y3OA 3IWFA 1AU7A 4F91B 3OL3A 4A3CJ 1FTZA 4AIHA 3L9FA 3WG7H 2MLKA 2OA4A 2XIGA 3TP0A 4IHXA 5KK1A 5DDGA 3PO3J 3EYYA 1D8KA 4KMUX 3LSKA 2M9HA 1OCCH 2B0LA 4ZDLA 1HDDC 1FBUA 3I56I 3E5XA 5FKKA 1W7PB 5BS6A 4BY1J 2L5QA 2DXIA 4CO8A 4D0PA 3CF5F 1V5GA 4A2UA 1R7JA 2IP2A 3W6KB 4C2TA 4ZYDA 2VASA 5A2QZ 2JVGA 4BAYA 4XRSA 3IAS2 2QQAA 2FUG2 3E5UA 2HZDA 5J40A 4NC8A 2VI6A 2DOEA 2JA7J 1A04A 4WCGA 3HEFA 4Y7NJ 3RYPA 2QKMB 2BW3A 2WV1A 1YW9A 5E20A 3K1NA 4PSXA 2LR8A 2DQLA 4DYRA 1V3FA 4JQFA 1BJZA 5ICEA 5E3NA 3WGHA 2K9NA 4AUXA 1SMYF 4ZH4F 2KFDA 2HWVA 1TNTA 2GIZA 4IHWA 2HPIA 1VQMI 1WJBA 3TO6A 2OC6A 2RQQA 2VLAA 2LNBA 3H9GA 1MBJA 5E79C 1H8AC 2VIXA 3IRRA 3H9QA 3OS0A 5DEQA 2OZUA 2X1DA 3AG1H 3FM3A 2ME0A 5E1XA 3OYNA 4A3FJ 2LREA 3KX2A 4AC0A 1I3QJ 1YO5C 1WI9A 3MZ8A 2LSOA 4OWRB 4HLXA 1OKRA 2RVCA 2IRFG 5J4YA 2R3SA 1S5LC 5K5OA 5GP9A 1XN7A 3E7LA 1XCBA 3QOEA 4C3JJ 5K7FA 3I9V2 5ED4A 2LKXA 4A6EA 3OL4A 3TBIA 4CDGA 5KAFC 3OIQA 2MC4A 1XSDA 1T0FA 4B43A 2WB1A 3WTVC 3JREA 5GAHJ 1CQTA 2J5PA 2XGDA 2FMLA 4WF2A 1EA3A 1RPWA 1W4MA 1R71A 2RREA 2X6XA 3CP8A 2JA2A 1D3YA 3F3XA 4EMSA 1SFEA 5IP9J 5KHDA 2HZTA 1HSJA 4OINF 1APLC 3J7AY 3CTAA 1UFMA 1JT0A 3T1BA 2GLOA 3E97A 1OYYA 2A5WA 4J01A 4RBOA 5B3SH 3DEUA 1BA5A 1SD7A 2KIMA 4XIDA 2K4JA 4P1WA 1Z67A 4LB6B 2HVSA 3S1MJ 3OYEA 4I6ZA 3DPUA 2MH9A 2JA5J 2VPLA 4DGWB 4DIQA 2CW8A 1YLFA 4MEYF 1WJEA 1W0TA 2XAHA 4BJ6C 3H3ZA 5DD8A 4IXAA 1SFOJ 2W24A 1SD6A 3MFKA 2NVYJ 4RB0A 2WAQN 1RUNA 1TWHJ 2V7FA 4XONA 3CMMA 2KIFA 2MGQA 2YU3A 3DV8A 3M9AA 3SZGA 5EEAA 2H6CA 2ZNYA 5C3EJ 4MQVA 3FKJA 3HOYJ 3WE3A 2DLLA 5DCFA 2V9VA 3O2PE 3QYEA 4BY7J 4M74A 3BPVA 3H1CA 2F4OB 2OAZA 4KIFA 3S3NA 4HV5A 2L4MA 2HPMA 3J81K 1LEAA 5GPCA 1B4AA 2FBIA 4E7KA 3HTSB 3ZN0A 2I8DA 3ZMTA 3O8GA 3T0YA 2VBXA 3ECOA 3LSRA 4A3DJ 5D6EA 2DK8A 2NNNA 2HQAA 1KYWA 2UUZA 2XVCA 4TV7A 2BW3B 2VJJA 1B59A 1R6RA 3K4BA 4B47A 2A5YB 3F8MA 5HLTA 2EIJH 3T5XA 4F55A 4L9NA 3GFMA 5K5QA 5J3LA 1KQ8A 4HEA2 1BR1A 1BC7C 5HS9A 2GQQA 2VKEA 3MD2A 2X6YA 1HKSA 3N05A 5E3MA 1MMSA 3IRQA 2VKHA 2VL8A 1XS9A 3UKGA 2VUMJ 1DPRA 1MH3A 1Y8RB 2QM3A 3M7GA 2AXTC 2QLZA 2STWA 3BP8A 4UUVA 3SDGA 1UHSA 4QWQA 5HVQC 2IGOA 2F5EA 3JAMZ 4PFOA 1SD4A 3W2AA 3D0SA 4Y52J 5GTHC 1IGNA 3H3VK 1FOWA 2Y2ZA 2DW4A 3HRUA 1E2XA 3SJMA 3D5SC 2P4WA 2XF5A 2LMDA 2LG4A 2XAGA 4MFEA 3WTXC 3MQ0A 1NK3P 1T39A 2DOFA 3VSLA 4EM2A 4KIBA 3OR1C 2FX0A 1TW3A 2OCCH 1DU6A 1EJ9A 2CV2A 1W1WE 3ZQLA 4HOBA 3M8JA 3GLLA 3MKZA 3IKTA 1LFUP 2E19A 4XKCA 2CW0F 4U7BA 2LOOA 3S16J 1PDNC 4OMYA 4OAYA 3O6BB 3V7RA 3BG5A 1DPUA 2D5VA 4L0ZB 4YIRX 4M3DA 1QO0D 1X3UA 1F43A 2K27A 3ULQB 4HSTA 5TRDA 5LGNA 3HYIA 2V1NA 3K0LA 1ZYRF 2E1NA 3WHBA 2OPTA 4XN0A 3N4MA 3HRSA 3RZOJ 1ZHFA 2JJ7A 2ZNZA 3VEPA 3S3OA 3EUKL 1K6OA 2CGPA 3RSNA 3DP7A 3D5RC 3FXMA 1WHUA 1Z21A 4RLFA 4I2OA 2VQHA 4EJUA 1B9MA 1NTCA 3ML6A 1ZGWA 1XMXA 2CUJA 5JHFA 2W7NA 1B1BA 3PNTA 3IL2A 1JGGA 2Z5UA 1FP1D 2VE8A 2XV4S 4C3HJ 1IC8A 1JT6A 2ACJA 4E7SA 4G7ZF 4MQ9F 5J4VA 4EVIA 4BXUA 3ASOH 2QUFA 3A0BC 2R5ZA 3LFKA 3G6EI 4I0BA 4XKBA 4L5IA 4XOPA 2EFWA 2BY1A 1O57A 3HOXJ 1MH4A 2WADA 1Q1VA 2ZBKA 4YFNF 4EJOA 2Y0SN 1U8RA 1N77A 4BGDA 1T38A 4CYCA 4CCNA 2DMUA 3H35A 2O5RA 2GXGA 1DP7P 1R5HA 2IEKA 2UZKA 2L3DA 1P6RA 4KN7X 3IHUA 1MMGA 1ONVA 3TW6A 1B72A 4XLPF 1IRFA 1XPXA 4M9XA 1ETOA 4AYBN 2DMNA 3MZYA 5FRNA 4GO1A 2ELJA 2KZVA 3DPTA 3DBLB 2E36A 5IP6A 3L2CA 1X1CA 4FTHA 1ZAOA 1R4MB 2Q0OA 5JVTA 2K02A 1O4XA 3QP6A 4YEJA 1DGWY 1ZELA 4I7HA 2HR3A 1MBHA 3RTRA 1RESA 2XDVA 3ABUA 5JR3A 4U7DA 3C2BA 4BXFA 2K85A 1R9TJ 5BOXA 5CYVA 1J75A 4XLAA 3TDUC 4II3A 1MNMC 4A3LJ 5FROA 1C0WA 1FJLA 1MBKA 4L9TA 4BKXA 1GV5A 1KONA 2LYCA 2Y30A 1IXRC 4GYGA 4YG2F 1FIAA 1X2NA 5BPIA 3CCRI 1N75A 3GWZA 4D5CA 2IGKA 4PSWA 5BPDA 4HQEA 1ZR2A 3I55I 1I6XA 4MLOA 2YX4A 4B48A 4ENKA 3SQNA 2DPUA 3DKXA 2XASA 3ELKA 1OR7A 2VBYA 3CP2A 2K3PA 3ABKH 4XSZF 3ZP5A 1XGMA 5D5XB 3CCYA 3Q0VA 2MG4A 1G4DA 3TW7A 2CG4A 1YI2I 4ZTJA 4MGRA 3P9IA 5F27A 1YW8A 1SAXA 3QU3A 1S7OA 1TBXA 2LY1A 3FK7A 1U8BA 1ETKA 3KP2A 2R7ZJ 1U5TA 3AAFA 1KU3A 2IAIA 2VQLA 4GXOA 4X1EA 3G4SI 1D1AA 3ERMA 4PJMA 2COMA 4D1QA 5E17F 4XICA 4UB6C 5C44J 3BQZA 2G9WA 3LAPA 2HOSA 1OCOH 3ZMZA 4QTRA 3SFIA 5LHIA 4FE4A 1X1PA 3ZMDA 3BG3A 3ZMSA 1FNNA 3CO6C 1T0FC 1YJWI 2R5ZB 1RRJA 2ESHA 4U0YA 1QRYA 3NRVA 1AWCA 2A3SA 3BJ6A 1R58A 3NEUA 3J80K 2OQGA 1LE8A 4XKWA 1K78A 3OYDA 2XROA 1PVEA 1MJ9A 5F1RA 2ZCWA 3QP5A 2ECBA 4ZYGA 2V9PA 3A01A 4BBSJ 4F92B 1FYMA 5DTDA 3S93A 5HNFA 4CYCB 2A61A 3JR9A 3DQVC 1IG7A 1W0UA 2L4AA 2O0YA 5TGTA 4G7HF 4II2A 4EM0B 4RAFA 5ILVA 4H0EA 4ENMA 1IXCA 2ETHA 2YUSA 3GTKJ 1Z05A 3GEZA 3VYSB 2KDZA 1TW2A 1TLHB 1B72B 2LKSA 2BXZA 2EV5A 1NHAA 3BG9A 4KN4X 3K4NA 2P0WA 5HDGA 2EFOA 4HYEA 3M8EA 1RC9A 3F8FA 4BQNA 1ON1A 2HFHA 1D0XA 4BXXJ 1UG0A 4NHJA 1YQAA 1XSXA 1KGSA 3U21A 2Y48A 5DYMA 3RQ4A 4BH9A 2IS4A 2GBYA 3I4NJ 3ABTA 3NWTA 3HOSA 4BACA 1K6YA 2BOLA 3S3MA 1MMDA 5HDNA 5F1JA 1R22A 2IGMA 4G12A 2JA8J 3U1DA 4OIRF 2KHMA 4XRSG 2Z3YA 1X1BA 2HTSA 1E3HA 2P5KA 3GTPJ 2BE5F 2AQFA 1A35A 2PJPA 5JLWA 1YTYA 2PQ8A 4M9ZA 1KZHA 2NVUB 3HTUA 1P92A 3CUQC 2GXBA 4L5JA 2ZC2A 3OOUA 1U78A 1IRGA 3IV5A 4N9IA 2WC2A 3BZCA 1WVRA 1RZ4A 4ZDPA 1TWAJ 4A5NA 2XRNA 2BY2A 3G1MA 2BV6A 2DA4A 1ON2A 2LY9A 4M6XA 3J7YJ 1G2HA 1BR4A 1QPMA 5B66C 1E17A 1S7AA 1XD7A 2HDDA 2BBYA 4GCVA 3BC8A 5L3EA 1YIOA 2M7AA 3WTSC 2YSRA 3REOA 4XSXF 5FKMA 4L9VA 2JZYA 1FSEA 2XB5A 1U5TB 4B1RA 2M4GA 1LKXA 2STTA 2HS5A 1KQ0A 1TQPA 2XF7A 2GM4A 1K4TA 1ZREA 3SYTA 2Y69H 4XLNF 3BOQA 4IQJA 4Q48A 3T8RA 3D5LA 2K40A 2NAZA 1I27A 1JXSA 2X9DA 5EJCA 4EM1A 2R4GA 2HQNA 3KP5A 3RZDJ 4RGRA 3KZYA 4DYCA 1RNLA 4R1HA 3QRFF 2UXNA 2XAJA 4I01A 1QHHD 2ZMEC 1R5ID 4LG0A 1MKMA 1G3WA 1F4KA 3S2DJ 1WI3A 3ZOBA 1LE8B 1ACIA 1K78B 4RS8A 4I99C 1PP8F 1GVDA 4CSWA 4ENJA 1FTTA 2DA3A 3FWEA 1YIJI 3A01B 4AVZA 2EINH 2VC0A 1SAUA 4YRVA 1LPQA 1R1UA 1S6LA 1J09A 1S29A 3B6CA 2W48A 3MKLA 2JMWA 5LGUA 5HLGA 3CCQI 3HKZA 1VQ8I 4FISA 5GADJ 4PJLA 3EPZA 4KITB 2A69F 4B09A 4ENNA 3CLOA 3QQAA 5HLIA 1SVLA 3E6CC 3RPUA 1SFUA 3ASNH 3LQQA 3BTJA 4HF0A 2X51A 1IRXA 4CZZA 1NG7A 3FX3A 3TEDA 5CLSA 1I50J 3DTKA 3A2KA 1SC7A 3RJPA 1KU9A 4RDUA 1Z7UA 3JRDA 1VFCA 2O03A 1J2XA 2NS8A 4HX7A 3K10A 5FD5A 3TOBA 1STZA 4BJTA 2DCEA 5JI6A 1PUFA 1D1BA 5DS9A 4ON0A 2O8XA 2DFEA 2XPUA 3BR5A 1BI1A 5CPRB 5A2QK 1FX7A 2QVOA 2ZSIB 2P81A 1SVMA 4OMZA 3JRCA 2P6TA 4BS9A 2BY0A 2OTJI 1S8NA 2F5CA 3GBGA 4HA8A 1FIPA 2ELHA 4FHTA 3TO7A 2RAEA 1LDKB 3BQYA 5KCMA 2QENA 1HBXG 5LEJA 3FXOA 2ICWG 1B8IA 1XDUA 5E8GA 2FA5A 2R7DA 2O8KA 4HF1A 3LAJA 4D9JA 2FU4A 1JJ6C 2D2WA 1TQIA 4AM3A 3FXUA 4XBFA 2KDOA 3TP3A 4GYIA 3KP4A 4NC7A 3VYTB 1IN4A 2L02A 2DOAA 1FY7A 3F8NA 4XLEA 2X6WA 4IO9F 3Q0WA 1HQCA 1VQ6I 5DM6F 2X85A 1NH3A 2V1UA 5AONA 5GTIC 1T33A 3FK6A 3GFLA 1HLVA 1RIOH 1TP4A 3CD6I 1U6GA 4MTEA 2E2HJ 4DQ2A 1PYVA 2FD5A 4UVCA 1FLIA 1ORKA 4F3QA 1O7FA 1V5EA 1EH8A 1O3TA 4IHTA 3IKVA 3DCFA 1VZ0A 1WKMA 1FYKA 3LL7A 2EIMH 3I64A 1TWGJ 1CF7A 1R1TA 1XX5A 3GZ5A 4BE0A 2DJNA 3K2ZA 4FX0A 1W36C 2RC4A 1FOKA 1IUFA 4CH7A 2EV6A 2JRTA 2DT5A 5EF6A 3HRTA 3RKQA 1LNWA 2E2JJ 3CESA 5IPAA 2IA2A 4HW0A 1OYWA 1T08B 1YX3A 4ZZLA 1KYZA 2DT6A 2XGXA 1L3LA 3HG9A 1X1AA 4HX4A 3HDDA 4Q5SF 3PM1A 5TJJA 4DJAA 3FXRA 4LG0B 2K9SA 3KYDB 1GVJA 5E1WA 1ZN2A 4NQWA 1D5VA 1MJAA 2BZTA 2DFHA 3KFWX 5F08A 2NNYA 6PAXA 4CICA 1OR7C 3OYHA 4HNUA 5D8KB 5ICGA 1XTAA 2F5FA 2F4IA 5CQGA 5LRSA 3CJRB 3PJRA 1O3RA 2JPCA 4Y4RA 2KL4A 3HUGA 4M72A 2NS0A 4I76A 3BG7A 1MSEC 2NOJB 3BG6A 1TT5B 5FGMA 1X1DA 2L9RA 2K9QA 4HZFA 4Y15A 2DMTA 3VYRB 5M3MJ 4A0YA 1U5TC 4S04A 2DT7B 3BCAA 4J00A 4YIFA 1VQLI 2O6GE 2NYXA 1FT9A 2RNJA 1O3SA 1W7PD 3CCEI 3S2HJ 1XCVA 2DODA 2G0EA 2R7XA 2FOWA 1GT0C 1U0JA 2VB6A 5LLQA 2QKLB 3FMRA 5HS8A 3JCUC 2EFQA 3AKZA 3HSEA 2H94A 3PFIA 1PUFB 2KP6A 2M7BA 3QWLA 2Z33A 2GOXB 5AIPA 4GFBA 2DJIA 2NOGA 1P4XA 1YG2A 3K4JA 2ZFWA 4MEXF 2HTJA 4EATA 2AQEA 3WU0A 1VQPI 2RDPA 3KIOA 4NC6A 2CFXA 3P5JA 3S17J 4G7OF 3QYFA 3FMSA 2I5UA 3I4MJ 1AHDP 3KP6A 1B8IB 1I1SA 4DBRA 4AIKA 1OLTA 3ISPA 5IOYA 3HOZJ 3JRGA 5D8LB 3HHHA 2ZXWH 3LA7A 5CVJA 4EQQA 4MO7A 3ZQFA 2VJ5A 1W5TA 3WGIA 2EV0A 3EUAA 3WTZA 3KEQA 4U0VA 2L54A 3OYGA 4W1UA 1S7EA 1JTYA 2O3FA 2CUFA 3QPLA 5EEGA 4KIGA 1UG2A 2L7ZA 3OYKA 4EJTA 4CUGA 1ZRCA 2KIQA 3FXKA 4EEFG 3CUQA 3JAMK 3FZVA 4XQFA 5HDKA 1QA6A 5L3GA 2Y75A 1OJLA 4DW6A 1DU0A 3BY6A 4LITA 1S3JA 3CCUI 2GWRA 4E7LA 3WGGA 3JTHA 2DN0A 4ZTFA 1CF7B 5EYRA 1OMIA 5TISC 1A36A 5KVRA 3SDBA 2L01A 2LP0A 4UVAA 1L0OC 1ZG5A 5LBQA 2WB1N 2D1HA 2B7EA 2CO5A 2M3AA 4PJNA 1JKRC 5DD4A 1W5SA 1VI0A 4PJ0C 3GTMJ 5FJ8J 2CSOA 3H92A 2WY7Q 1WPKA 5M5YJ 3RPUD 1JHHA 3CJTB 3OSFA 5HS7A 1Z6RA 1F36A 3HSFA 2LLKA 4HRIA 4MTDA 2TDXA 5GPAA 4HDVA 5IOZA 2DTRA 3ECHA 2JSCA 1ZGJA 4P9FA 2MBFA 3HZJA 4NQWB 4MIMA 4UUTA 3D1NI 4C2UA 2BHYA 2UV1A 2VJ4A 5CVRA 5D4RA 3PO2J 2E2IJ 4U87A 2VE9A 3AG2H 3L2UA 3MN2A 1WJ5A 2DFIA 4IOCF 4JBAA 4BHBA 3M07A 4ZDOA 3K4KA 3HUGB 4E7HA 2PBIA 1F9NA 4X0GA 4A12A 2ZMEA 3GX4X 4GRIA 4RGUA 1JKPC 4GGGA 3HGYA 3I54A 4RB3C 1ETQA 3JRBA 5ERIA 4M6YA 4O5VA 4A5MA 1JKQC 2O9LA 2DBBA 3HOTA 3L7WA 4CCMA 1K7AA 4D7MA 4RA2A 2IGNA 3EYIA 1VNDA 5F0FA 3GZNB 1FOXA 4N4NB 3RKWA 2X0LA 1U9OA 1HKQA 4UV9A 3AG3H 4I09A 1Z3XA 3EQLF 3ONQA 4ITVA 2ESNA 3A4CA 4HSRA 3JTGA 2LRDA 2VKDA 5H20A 4RGSA 1EH6A 1OCZH 1IDZA 5EGOA 1EKEA 2CQ7A 2E1MB 3R6SA 3LQRA 1QPIA 2PJRA 4XORA 2KQRA 1HOMA 3DPLC 4P5OA 5IT9Z 2XF6A 2K86A 4XRFA 4HNTA 4IHVA 1YITI 4HF2A 1R4NB 3BROA 3E0JB 5L3CA 4PGGA 3L2RA 1QGPA 2ID3A 5J47A 4D5FA 2QQ8A 1XGSA 4UUSA 3ABMH 5F6FA 2HGCA 1U3EM 3WTYC 2CH0A 3LA2A 1A31A 1HW1A 3H9JA 3VOEA 3FMQA 1G8XA 4KNYA 3DWLE 1MMAA 3M8FA 1H89C 2L2OA 1FEXA 3EETA 1BIBA 3V42A 3KEYA 4XR6A 1FP2A 2OJED 3CUQB 1Q1HA 3EUHC 3K1MA 4BQOA 1YX5A 4J19A 4LIVA 3V4GA 4LJZF 3JRIA 3OYJA 3U2RA 2WBMA 1EH7A 3OR2C 1USTA 3GFJA 1MBEA 3H0DA 2JK3A 3CC7I 2AHQA 1IXSB 4M71A 3X2QH 2EB7A 2B9SA 2M0MA 3M1CA 3OIOA 4JP0A 3TDZC 3K7AJ 4HNVA 3OS2A 3J7AO 1LVAA 5J6XA 5J1RA 4O3MA 2M45A 3FISA 2KRHA 1UJ8A 3GTOJ 2DFFA 3OMYA 2OV7A 4WXCA 2HYJA 4QPQA 4IOAF 3OWTA 1K61A 5FD6A 4A3JJ 3GXOA 3I58A 3L2WA 3FXJA 1ULYA 2HOEA 3JW4A 1ENHA 5CJ9A 1YE9A 2CUZA 1ZRFA 2NVXJ 3VSKA 3DKYA 2LKPA 1GV2A 1IV8A 2WY8Q 3HL2A 4CYDA 1NK2P 2CS3A 4WK8F 3PSIA 1LDDA 1QVUA 3O3KA 2RV8A 3FKIJ 2M34A 1LEBA 4K2EA 2PEXA 5H2FC 1WRJA 1F1ZA 2E35A 4IPAA 4QLCU 2HYFA 5FFXA 3M1EA 3V7CA 3V7SA 2TRTA 4EGZA 1RETA 5LHGA 2ZMEB 4G6TB 4I0AA 1USSA 1NG6A 5EZHA 2D45A 1XGNA 3F72A 3KYLA 4XMYA 4FX4A 2XAUA 3I59A 2XHKA 3PIOF 4Z2YA 1I3AA 1P4AA 3QAHA 3VB2A 2EJRA 5D5WB 3IUOA 3NQOA 3KP7A 2M5WA 1QQIA 3I3LA 2L7MP 3Q5FA 3C2HA 4XOTA 1WWXA 2OZ6A 3L1PA 2A05A 4HV6A 2IT0A 2XAFA 3P9CA 2MC3A 5E3OA 4RMNA
chains in the Genus database with same CATH topology
2GOMA 2R4GA 4AYBA 3L2VA 4Y33A 5FRMA 1QHHD 3QOEA 2BVMA 2ZSHB 3I9V2 2PJRB 3FBIB 4DBQA 1DP3A 4CZCA 1HA8A 3OL4A 3TBIA 3OIQA 2MC4A 4CSWA 4B43A 2WB1A 2MYSA 4AVZA 3ZXSA 1SAUA 1EA3A 1X19A 4C9YA 2RREA 4YRVA 2X6XA 3CP8A 1J09A 2JA2A 1SFKA 1X4PA 5KHDA 3HKZA 2K9LA 3A1YA 3J7AY 4BE2A 3PUBA 3TL4X 4PJLA 2A5WA 3EPZA 4KITB 4J01A 4BU2A 3QYBA 2V9KA 2WAEA 4JOMA 4XL9A 4BDYA 2X51A 1IRXA 4E7ZA 4P1WA 3BCBA 3VDXA 2HVSA 1NG7A 1WFXA 3DTKA 2X1EA 3OYEA 3DPUA 3PSFA 3A2KA 2VPLA 4DGWB 4RLQA 4DIQA 2CW8A 4B44A 1WJEA 3CZ6A 4BJ6C 3OS1A 3K10A 1QHGA 2OUMA 4BJTA 2DCEA 2E1MC 3F9KA 1Z7LA 1D1BA 2V7FA 3AL0B 4XONA 3LSMA 3CMMA 4QPOA 3L2QA 4FETA 3SZGA 4HPQA 5CPRB 5HNHA 2ZSIB 3FKJA 4BS9A 3QYEA 3GBGA 1WJAA 3HXLA 1AA7A 3S3NA 1D1CA 3OYAA 1LDKB 2HPMA 2XSJC 5KCMA 2LY2A 1QU3A 3C2GA 2V4JC 3E1SA 4D9JA 4E7KA 2I8DA 4KJZA 4CCJA 2KDOA 3RCOA 4R79A 4BEHA 4NC7A 2Q1ZB 3VYTB 2DOAA 2HQAA 2UUZA 2X6WA 4XLEA 4NUBA 2BW3B 2VJJA 1R6RA 3G2BA 2X85A 3K4BA 4B47A 3ZGKA 4BDZA 3SEQA 3AL0C 2UWMA 2R7OA 5HLTA 1Y6IA 4F55A 2HNHA 1PYVA 4HEA2 1BR1A 2VQGA 4F3QA 3MD2A 1V5EA 2X6YA 3N05A 2VKHA 2VL8A 4PUSA 1VZ0A 4E6KG 3LL7A 5HVQC 4BE0A 2IGOA 1W36C 4C30A 2L9SA 4PFOA 3W2AA 2W82A 4CH7A 3HC7A 4RM2A 4XLFA 2LBFA 3CESA 1FMVA 4BE1A 1YX3A 3D5SC 2XF5A 3FBNB 2PMZA 2LG4A 2DT6A 3LFUA 4OAZA 1WJDA 4ZYAA 2R7WA 3HG9A 3PL8A 1X1AA 3VSLA 2IXSA 2IS1A 2W00A 3OR1C 4DJAA 4DOZA 2CW7A 4YELA 4ZJZA 2CV2A 1OR7C 3M8JA 3OYHA 4HNUA 3MKZA 4NNJA 3OYLA 3PFYA 3CJQB 4XKCA 2F4IA 3ZQQA 4U7BA 5CQGA 4F93B 2LOOA 3CJRB 3PJRA 3K4MA 5CQEA 4OAYA 4Y4RA 2KL4A 2K5CA 3VYUB 3K70C 4BL0B 3BG7A 2NOJB 3BG6A 4E7IA 3UNGC 1MNDA 1X1DA 3FHNA 3VYRB 4AU7A 4HSTA 3S8PA 4B3XA 4KT6A 2V1NA 2DT7B 2JVHA 3BCAA 4E7JA 1LFPA 3OYIA 4J00A 1P9QC 4XN0A 3AFHA 3MMYB 3S3OA 2W1OA 3EUKL 4XLHA 3RSNA 5KNLA 1W36D 3D5RC 1UELB 1Z21A 2HVQA 2R7XA 3IAM2 4RLFA 3DEEA 1U0JA 2VB6A 5LFAA 2R7SA 2VQHA 2QKLB 3AKZA 2CUJA 3SEZA 5JHFA 2W7NA 2KP6A 2M7BA 3PNTA 4IX7A 2GOXB 1GLNA 3QODA 2DJIA 1DGRM 3W2VA 3K4JA 4E7SA 2CV1A 4EATA 2AQEA 4BUPA 1TT0A 4H4KC 4XKBA 3QYFA 4XOPA 4XNFA 4KISA 1MMNA 3K4LA 2WADA 2VQCA 4HG2A 4IQ4A 2JSPA 4DBRA 1N77A 1OLTA 4BGDA 2E5NA 4CCLA 3H5NA 4CCNA 1V5FA 3K70D 4LG3A 3TMOA 3H35A 2L9NA 2O5RA 2WAFA 4BEHB 3BLYA 2K9MA 2F5VA 2VJ5A 2WA0A 2Z16A 3DU5A 3EUAA 2Z2SB 1MMGA 3OYGA 4CCKA 1FMWA 4XM3A 3DTIA 2MABA 3OYKA 4CUGA 4IKFA 5FRNA 4E4HA 2ELJA 3LSGA 4XQFA 2R7QA 3H5RA 2KZVA 3DPTA 4RM3A 1Z3YA 1X1CA 3OYMA 4LITA 4E7LA 3OY9A 3HPHA 2CFOA 4ZTFA 3SDBA 4YEJA 3S32A 1DGWY 1ZELA 3PNYA 2X1CA 3RTRA 1Y56A 2XDVA 1G59A 2M3AA 3CF2A 4PJNA 4BXFA 2LBFB 3OIPA 4XKVA 2RNGA 2E60A 2V26A 4XLAA 4XLCA 4II3A 5FROA 3ZCOA 1WJCA 2WY7Q 3RPUD 2KRCA 1ERDA 1KONA 2LYCA 3LMMA 4HRIA 2R7TA 4BQQA 4NQWB 2A6TA 4C2UA 2UV1A 1N75A 2VJ4A 2JUGA 2WAQA 4U87A 2L7KA 3L2UA 2VXZA 2IS6A 1WJ5A 2IGKA 4PSWA 2W4SA 4MLOA 4B48A 5HOOA 2ZFUA 2E5ZA 3OYBA 3DKXA 4ZDOA 3K4KA 3HUGB 4E7HA 2R7RA 3CP2A 2K3PA 4X0GA 4GRIA 2HU9A 3ZR8X 2R7VA 2Z1DA 3VWBA 3LSHA 3HOTA 4ZTJA 1JI8A 4CCMA 3W2WA 4CCOA 2F6CA 2LY1A 1DQUA 2IGNA 1X4OA 1LVKA 2CMPA 3H5AA 2VQLA 4N4NB 1D1AA 4BJ5C 4PJMA 4D1QA 1Z3XA 3ONQA 4ITVA 2XC7A 3A4CA 4ANJA 4HSRA 2LRDA 3MKYB 2VKDA 3K4CA 1MW7A 1WJFA 2KLOA 3ZRGA 3LSIA 4N4OB 1T0FC 3DU6A 2E1MB 2PJRA 4XORA 2MFZA 2KQRA 3DPLC 4P5OA 4F52A 1S9HA 4XKWA 2XF6A 3OYDA 1TZLA 3OYCA 4HNTA 1N78A 2R7UA 1UAAA 3E0JB 4F92B 3DTEA 2ZXHA 3S93A 3L2RA 5HNFA 4LIUA 3DQVC 5TGTA 2BVLA 4II2A 2CH0A 1T95A 1D0YA 3DLAA 3OYFA 2KPMA 2LC2A 3H9JA 1G8XA 3VYSB 1BR2A 3DWLE 1MMAA 2IS2A 2L2OA 3K4NA 2HDWA 2P0WA 3V42A 2VJIA 3KEYA 5CKTA 3UR3C 4XR6A 3EUHC 4BQOA 3MKWB 5LD2C 4BQNA 1YX5A 1D0XA 4LIVA 1PJRA 3OYJA 4Y3OA 4F91B 2WBMA 1UG0A 3OL3A 3OR2C 4CA0A 3H0DA 3U21A 3RQ4A 2IS4A 2M0MA 3M1CA 3HPGA 3NWTA 3HOSA 4BACA 3OS2A 3LSKA 4ZDLA 3W3CA 1K6YA 2BOLA 3S3MA 1MMDA 4PJJA 2KRHA 2IGMA 3OMYA 2KHMA 2HVRA 1X1BA 2OV7A 3K6GA 4XN3A 2L5QA 4QPQA 2DXIA 3OWTA 2AQFA 1V5GA 4C2TA 3L2WA 2CV0A 2VASA 3FDYA 4ZC3A 2JVGA 2MD0A 3IAS2 3NWSA 1YE9A 2CUZA 1MNEA 2FUG2 3VSKA 2HZDA 3DKYA 4NC8A 3OOUA 2WY8Q 3HL2A 2CS3A 3PSIA 2V6EA 4ZDPA 2QKMB 1E0EA 2BW3A 4PK4A 2LH9A 4IZZA 4PSXA 1BR4A 4JQFA 4G6TB 1BOBA 1NG6A 2ZXIA 3BC8A 3IP4B 3KYLA 4XMYA 2HPIA 1WJBA 2KMUA 2M7AA 2XAUA 2Y0SA 2OC6A 2RQQA 2VLAA 2VXDA 3H9GA 2VIXA 3IUOA 3H9QA 2M4KA 3OS0A 2Q2EB 2M4GA 1LKXA 4FASD 2X1DA 1D0ZA 2XF7A 3I3LA 3SYTA 3OYNA 2LREA 3KX2A 3C2HA 4IQJA 4XOTA 4PFPA 3D5LA 4OWRB 3PNVA 4RMNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MKW B;  3VWB A;  3W2A A;  3MKZ A;  3W3C A;  1VZ0 A;  3MKY B; 
#chains in the Genus database with same CATH topology
 2GOM A;  3L2V A;  2E1C A;  4Y33 A;  2LF7 A;  4E70 A;  2QA4 I;  3BT9 A;  4KUM A;  5FFZ A;  2FE3 A;  5FRM A;  3GTQ J;  2PMU A;  3B02 A;  5EGO B;  2LF8 A;  2EA4 A;  5JLX A;  2HXI A;  1Y39 A;  2PJR B;  4DBQ A;  2E1O A;  1I6H J;  2EIK H;  4IRG A;  1JE8 A;  1HA8 A;  2ZJR F;  4C3I J;  2WTE A;  3CO7 C;  3FXQ A;  2P7V B;  2MYS A;  1G3S A;  2K3F A;  1X19 A;  3CCL I;  1ETY A;  1B9N A;  4UUS B;  3HM5 A;  5E18 F;  3KET A;  2X6O A;  3HRM A;  4A3E J;  2QBY A;  2K9L A;  2ZJP F;  5IYD J;  1IRZ A;  1VQK I;  1JUS A;  1Y8Q B;  3BDD A;  2XRL A;  5F04 A;  4ZYE A;  1R23 A;  1K4S A;  4JYK A;  2GA1 A;  4HDU A;  2V9K A;  2WAE A;  1IN6 A;  1V55 H;  3I71 A;  4XL9 A;  3MWM A;  4BDY A;  5K7H A;  4EGY A;  2XPV A;  1H9G A;  3PSF A;  2OCE A;  1YJ9 I;  4M3E A;  3GCM A;  4B44 A;  3CZ6 A;  2C6Y A;  2IA1 A;  3WU1 B;  3OS1 A;  2VN2 A;  2OUM A;  2ISY A;  2E1M C;  3LNQ A;  3F9K A;  3HIF A;  4ABZ A;  1Z7L A;  5B1B H;  2P7C B;  4KA4 A;  4IHY A;  1Z6T A;  2A6H F;  1ZRD A;  3LSJ A;  4FET A;  2XGC A;  2AXL A;  1HW2 A;  3ZPL A;  4L0Y B;  5HNH A;  2PI0 A;  2DTZ A;  4BBR J;  4AD9 A;  2HI3 A;  2MSY A;  4N0B A;  3J7Z I;  4L5E A;  1MBF A;  2FQ3 A;  3S15 J;  1FPQ A;  1I1G A;  3E6D A;  4PDK A;  3LSP A;  1QU3 A;  4G6Q A;  3CCS I;  2B63 J;  1P4W A;  2QF7 A;  1BIA A;  3C2G A;  2V4J C;  3E1S A;  1J5Y A;  4P96 A;  1BM9 A;  3W6V A;  1MBG A;  2HQR A;  4R8H A;  3BWG A;  4BEH A;  1VF9 A;  2Q1Z B;  3Q9S A;  2XAQ A;  3S2W A;  4NUB A;  3V8L A;  5M5X J;  4B4C A;  3G2B A;  5BNG A;  2UWM A;  4BDZ A;  3SEQ A;  3AL0 C;  2QQ9 A;  1V54 H;  3ZMU A;  5FLX Z;  2DA2 A;  4AIJ A;  1A6I A;  2HNH A;  3H36 A;  4DZJ A;  2VQG A;  2XKP A;  1MD0 A;  3K69 A;  4LLL A;  5ICC A;  1VQ7 I;  3I59 B;  1D8J A;  4IEJ A;  1A6Q A;  1VQN I;  3S14 J;  4C30 A;  2L9S A;  4Y13 A;  3KP3 A;  2KIS A;  2G7H A;  2W82 A;  3CMA I;  4RM2 A;  4AVP A;  3CCM I;  4XLF A;  2ID6 A;  5K7Z A;  1UCR A;  2LBF A;  2FBK A;  4UB8 C;  4CHU A;  1IF1 A;  4WWC A;  3I4P A;  4O6J A;  3T8T A;  2PMZ A;  3I0T A;  3RPQ A;  4LLN A;  4OAZ A;  2WWY A;  2VON A;  4A0X A;  3PL8 A;  1YFH A;  2KZG A;  2VC1 A;  4YFX F;  5IT3 A;  2IXS A;  3QOP A;  2IS1 A;  2W00 A;  2EFN A;  1AOY A;  2CW7 A;  3KZZ A;  1TNS A;  5ICF A;  2JTV A;  3DKW A;  1H9T A;  4IHS A;  2H09 A;  5K1Y A;  4NNJ A;  1LUJ B;  2Y0M A;  2KT0 A;  4UV8 A;  3CJQ B;  3OYL A;  5DCM A;  2FXA A;  2O7O A;  2MD5 A;  2K5C A;  3VYU B;  3JRH A;  3K70 C;  2QBY B;  1T2K A;  2ZJQ F;  3LA3 A;  1BC8 C;  4E7I A;  3UNG C;  3FHN A;  4IJA A;  3ZQG A;  2QSF X;  3S8P A;  5HLH A;  2OBP A;  3RYR A;  4A3B J;  1Z9C A;  1ZLJ A;  4E7J A;  1LFP A;  4ZYH A;  2FOK A;  2QQB A;  3AFH A;  1UHW A;  1XG1 A;  3MMY B;  2HOT A;  1ZG3 A;  4RB1 A;  3G1L A;  4XLH A;  4N9H A;  1O7L A;  2LFB A;  3NAR A;  5L3D A;  1W36 D;  4A93 J;  3HOU J;  2MH2 A;  1UEL B;  2XGE A;  3BTC A;  4P55 A;  1G3Y A;  3IAM 2;  5FKO A;  3L00 A;  5F0C A;  2KJC A;  1S72 I;  2M30 A;  2VT3 A;  3P9K A;  4IX7 A;  3B6A A;  1GLN A;  3QOD A;  2CYY A;  1WCM J;  1FYL A;  2RKH A;  2CV1 A;  4KMF A;  2HYG D;  2PLY A;  2MW8 A;  3FXL A;  3EUH A;  3OOP A;  3LST A;  1TT0 A;  1HST A;  2OU2 A;  1JTX A;  2L7F P;  1KQ9 A;  3BR3 A;  4DZP A;  2PMH A;  1SVO A;  5H6Q A;  2R5Y A;  1MZB A;  1OIS A;  3CCV I;  1MMN A;  1Z91 A;  3K4L A;  1BW6 A;  4RAY A;  3DXJ F;  3GW2 A;  4HG2 A;  4IQ4 A;  2QGU A;  3ESW B;  1J59 A;  2R7F A;  3H5N A;  2VOP A;  3BR6 A;  4Z6Y A;  1V5F A;  4EJW A;  3TMO A;  1WGX A;  2WAF A;  4WX9 A;  3F21 A;  4BEH B;  1R1V A;  3BLY A;  1ZAR A;  2EZK A;  2K9M A;  2F5V A;  1Y0N A;  2O61 A;  1VQ5 I;  2WA0 A;  2W57 A;  2Z16 A;  1XMA A;  2Z2S B;  4ASN A;  4HAM A;  3G73 A;  2Q8K A;  2FQ4 A;  3L09 A;  1FMW A;  1QZY A;  1B6A A;  3EDP A;  3DTI A;  2MAB A;  1TQM A;  4KFC A;  4IKF A;  3LSG A;  2V79 A;  2R7Q A;  3H5R A;  1OCP A;  4RM3 A;  3HOW J;  3OYM A;  3S1N J;  3OY9 A;  3HPH A;  2CFO A;  2LDU A;  2XSD C;  3R61 A;  3DFG A;  3S32 A;  2JT1 A;  2X1C A;  1Y56 A;  5M3F J;  3CF2 A;  4GDF A;  2AO9 A;  2LBF B;  3OIP A;  4XKV A;  2GZW A;  4ESB A;  3GF2 A;  3BPX A;  3DF8 A;  2V26 A;  3HKZ N;  5EDN A;  1WJC A;  2JQ7 A;  1MIJ A;  1RR7 A;  2H8W A;  2IA0 A;  2Y31 A;  2YU9 J;  4MFD A;  4A3K J;  2XKO A;  1TC3 C;  2IW5 A;  2ADU A;  4NDL A;  2A6T A;  2P5V A;  2YS9 A;  3KLO A;  4OIO F;  2JUG A;  2WAQ A;  1YHQ I;  2L7K A;  1QZE A;  5LGT A;  2OQR A;  1MDM A;  2EK5 A;  1XMK A;  2W4S A;  3RQI A;  1BI2 A;  5DCM B;  2ZFU A;  1K83 J;  3OYB A;  2CUE A;  2JPB A;  3GME A;  5J8F A;  1X3W B;  4AWX B;  3BZ6 A;  1GUU A;  2R7R A;  4LD5 A;  1H0M A;  4OIP F;  1YOV B;  2R93 J;  5GAG J;  2N8G A;  2HKX A;  2BHZ A;  3VWB A;  3SZT A;  3CMY A;  1QBJ A;  2RN7 A;  3IC7 A;  4S05 A;  1JI8 A;  2F6C A;  1FC3 A;  4MNU A;  1HCR A;  1QZZ A;  2Q2E A;  5CVV A;  1LVK A;  1ETV A;  2KKO A;  2AS5 F;  1R36 A;  1TWC J;  2NRA C;  3OV8 A;  4BJ5 C;  2FEZ A;  5C4J J;  4M3B A;  1PUE E;  1REP C;  2QSG X;  2XC7 A;  2M0C A;  5FO5 A;  5DM7 F;  5FKL A;  2YR2 A;  1IN7 A;  3MKY B;  4BYY A;  3RI4 A;  1MW7 A;  4A0Z A;  4G8X A;  1T98 A;  3BTI A;  2H8R A;  4LLG F;  3DU6 A;  1J0R A;  1OQY A;  1R49 A;  2MFZ A;  2GIV A;  5F64 A;  2A6E F;  4F52 A;  3F8B A;  2R5Y B;  1S9H A;  1ZTR A;  4D7N A;  1N78 A;  1ITY A;  3BZK A;  3E6M A;  4XK4 A;  1ZH5 A;  2R7U A;  1JGS A;  1KU2 A;  5JFR A;  1XSV A;  5B1A H;  2IVM A;  2ZXH A;  1BL0 A;  1MSF C;  2DO7 A;  3TGN A;  2TCT A;  1IO2 A;  2W85 A;  1IN5 A;  2NVQ J;  1Z1D A;  3F23 A;  2ME6 A;  2BVL A;  1T95 A;  2RQP A;  3K1P A;  4S0H B;  1BBY A;  3DLA A;  3OYF A;  3FM5 A;  3PUF A;  3U1K A;  1DDN A;  2CU7 A;  2COB A;  4WXH A;  4A69 C;  4HBL A;  4OU0 A;  4FCY A;  2GAU A;  2VJI A;  3MKW B;  3COA C;  1ZGA A;  2ZB9 A;  4I98 B;  2KIU A;  1SMT A;  4CA0 A;  4BNC A;  1FWZ A;  1T6S A;  3QPS A;  5L3F A;  2OTL I;  3WU2 C;  4C2M J;  3C3W A;  3G71 I;  3HPG A;  3GLX A;  5DUK A;  5FB2 A;  4RAG A;  3MCZ A;  3W3C A;  1YS7 A;  4V19 K;  2M8G X;  4KIC A;  4PJJ A;  3R0A A;  3H0G J;  2XPW A;  2HVR A;  1H88 C;  3K6G A;  3JRA A;  4XN3 A;  2H1L A;  3F0C A;  3JSO A;  3CLQ A;  2CV0 A;  2NXN B;  2DA1 A;  3FDY A;  5DUI A;  4ZC3 A;  2MD0 A;  1JHF A;  3NWS A;  2CQX A;  2EFP A;  3R60 A;  1VQ9 I;  4AID A;  1MNE A;  2Y9Y A;  3A02 A;  1OYI A;  2EBI A;  4DYQ A;  1MDM B;  3Q3S A;  3GO5 A;  2V6E A;  3KYC B;  1SD5 A;  3PQJ A;  3HSR A;  3LWF A;  3Q9V A;  3HOV J;  1E0E A;  3J81 Z;  4PK4 A;  3V8J A;  2LH9 A;  4IZZ A;  1IZ1 A;  2F4M B;  1A5J A;  3Q0U A;  3VOD A;  1BOB A;  1G3T A;  2VT2 A;  2HKO A;  2KJB A;  2CQK A;  2ZXI A;  1G6N A;  1X3Z B;  2ZXJ A;  3IP4 B;  3MAJ A;  3QPH A;  2Y0S A;  2KMU A;  4L9J A;  3RKY A;  1IJW C;  3DEW A;  4HQM A;  2VXD A;  3CQZ J;  1PP7 U;  4G9Y A;  3JRF A;  3GTJ J;  3RDI A;  1YYV A;  2F5D A;  2M4K A;  5EZG A;  3CDL A;  2Q2E B;  1V4R A;  3E5Q A;  2NS7 A;  3E3V A;  3M4O J;  4FAS D;  1D0Z A;  4IF4 A;  1KA8 A;  3JSP A;  1ETW A;  4JX6 A;  4Q47 A;  5ILU A;  2L9V A;  4PFP A;  2DU9 A;  4FE7 A;  5IT9 K;  3PNV A;  4ETS A;  3MVP A;  4AYB A;  1VQO I;  4RGX A;  2DI3 A;  1R5G A;  1X2M A;  1J7K A;  3WG9 A;  4LMY A;  2ZKZ A;  2LVS A;  4UVB A;  2BVM A;  2ZSH B;  4V2G A;  2F48 A;  3FBI B;  1DP3 A;  3CDI A;  4CZC A;  3LOC A;  1M1E B;  3SFZ A;  2ZO4 A;  3NAU A;  5IY5 H;  3TQN A;  3ZXS A;  2EZL A;  1YJN I;  1ZR4 A;  1SEU A;  4C9Y A;  4P9U A;  2CJJ A;  1SFK A;  1X4P A;  2DAO A;  2BYV E;  3PQK A;  3IH3 A;  3A1Y A;  2GXA A;  4BE2 A;  9ANT A;  2DPD A;  3PUB A;  3TL4 X;  2FF4 A;  2JWT A;  2E7W A;  3I5U A;  4BU2 A;  3QYB A;  4CGZ A;  1Y1V J;  4A3G J;  2MA3 A;  1XDS A;  4PZJ A;  5GAE J;  4JOM A;  3ROU A;  2ELK A;  4E7Z A;  3BCB A;  3VDX A;  1WFX A;  3C1D A;  2X1E A;  2CQN A;  2KRF A;  1XGO A;  2PFB A;  1HC8 A;  3QPT A;  4RLQ A;  4LFU A;  1KU7 A;  1ZLK A;  3HGG A;  2EZI A;  2DDA A;  1WH5 A;  2QCO A;  1QHG A;  5J1U A;  4EV0 A;  3F8C A;  3ERE D;  2P5L C;  1IUY A;  2EZH A;  2BY3 A;  1BN5 A;  5E1Z B;  5LHH A;  3FIW A;  3AL0 B;  3LSM A;  4QPO A;  3H3U A;  2DA5 A;  3L2Q A;  5BMZ A;  5F0H A;  2LTP A;  2EIL H;  4HPQ A;  3IH4 A;  1N25 A;  2R92 J;  2L0K A;  1UMQ A;  1ODD A;  4FT8 A;  2W25 A;  2VOO A;  5CVI A;  1WJA A;  2E34 A;  4XRM A;  5L3B A;  3WTT C;  2DDB A;  3HXL A;  1AA7 A;  1D1C A;  3OYA A;  3BR1 A;  2WV0 A;  2XSJ C;  2LY2 A;  4ESJ A;  1MJB A;  3BJO A;  2DQR A;  5D5U B;  1BI0 A;  1OCT C;  2E7X A;  4KJZ A;  5IYB J;  4IRH A;  4LK0 F;  4CCJ A;  1JJ8 C;  2MLG A;  3RCO A;  2LD5 A;  4R79 A;  1I5Z A;  2QEX I;  3BJA A;  1WSU A;  1XC5 A;  5K5R A;  3ZGK A;  3CCJ I;  1EF4 A;  5E3L A;  2R7O A;  1FZP B;  2XUB A;  3CC2 I;  1Y6I A;  3SZP A;  5AIQ A;  4X6A J;  4LOC A;  1GHC A;  4M9S A;  1BOA A;  2BEO A;  2PN6 A;  2OF7 A;  2EH3 A;  4M73 A;  4PUS A;  4E6K G;  1E3P A;  4RB2 C;  3CDH A;  1ETX A;  4B3A A;  2FJ1 A;  4IRI A;  5C4X J;  1GXQ A;  2Z9O A;  4UHT A;  3F6O A;  1FBS A;  1P2F A;  2BXY A;  3HC7 A;  2E71 A;  2FMY A;  4LK1 F;  1W5C C;  3G3Z A;  1FMV A;  4BE1 A;  3TKY A;  3FBN B;  2ISZ A;  3LFU A;  1HW5 A;  1WJD A;  4LGW A;  4ZYA A;  2R7W A;  1O3Q A;  2H27 A;  3K2A A;  3VPR A;  1Z77 A;  2EPF A;  1U2W A;  3KLN A;  4V2F A;  4DOZ A;  4YEL A;  4JX4 A;  4ZJZ A;  1VQ4 I;  1MGT A;  2GA2 A;  5EG0 A;  1BJA A;  2BGC A;  4OOI A;  2OD5 A;  5E8I A;  1LQ1 A;  5JVG F;  4M6V A;  2DMP A;  4PGH A;  3PFY A;  3KEO A;  3ZQQ A;  1HXD A;  1SFX A;  2DA6 A;  5EEH A;  4F93 B;  3M3Y J;  3K4M A;  2W84 A;  3F6V A;  5CQE A;  2VPR A;  2QYO A;  2DYR H;  4JK1 X;  5IYC J;  4BL0 B;  3TO9 A;  1TWF J;  2QZ8 A;  3GUD A;  2R0Q C;  1MND A;  2DYS H;  4KDP A;  2VBW A;  4AU7 A;  2CQQ A;  3CME I;  1P7J A;  4YII A;  4YFK F;  1FOY A;  2CWE A;  4B3X A;  4KT6 A;  5D6F A;  4ESF A;  2CRG A;  3BTL A;  1RR8 C;  2JVH A;  2J5O A;  3OYI A;  4NBQ A;  1P9Q C;  3G1O A;  1IDY A;  1IW7 F;  2UXX A;  3A03 A;  4W97 A;  1ZG1 A;  3KE2 A;  2W1O A;  5FKN A;  1WH7 A;  2LK2 A;  2FNA A;  5KNL A;  4F7Z A;  2FSW A;  2HVQ A;  4LB5 A;  3DEE A;  1UB9 A;  4I02 A;  3WE2 A;  5LFA A;  2R7S A;  5KAI C;  4CXF A;  3ZQC A;  2EA2 A;  3IH2 A;  3E6B A;  3SEZ A;  3P7N A;  4Q4Z F;  1Z0X A;  5B5E C;  3ZQ7 A;  1EV7 A;  1FSH A;  1DGR M;  3W2V A;  3GYH X;  2EQR A;  2FBH A;  2V1D A;  3GFI A;  4IL6 C;  4A3I J;  4BUP A;  2M87 A;  5J8C A;  1WZ2 A;  3A0H C;  4H4K C;  1P7I A;  1QNT A;  4A6D A;  2V1X A;  1BI3 A;  4M3G A;  3ZMV A;  1F5T A;  4XNF A;  4KIS A;  1HF0 A;  2VQC A;  2A68 F;  3RIR A;  2H6B A;  2JSP A;  5BQT A;  3C18 A;  1GXP A;  2HDC A;  2E5N A;  4CCL A;  2JN6 A;  1YRN A;  5FLX K;  3WHC A;  2VBZ A;  2M8E A;  3C7J A;  4LG3 A;  4WXD A;  3J80 Z;  3K70 D;  1AKH A;  2L9N A;  1TL8 A;  2ECC A;  5M5W J;  2HQ5 A;  2VOD A;  1OPC A;  4UNO A;  1DUX C;  2P8T A;  3DU5 A;  2RGV A;  3HHG A;  3MZH A;  4CCK A;  4KT5 C;  4G94 A;  4XM3 A;  3DLL F;  4E4H A;  3OSG A;  2K4B A;  4DNC A;  1YS6 A;  1Z3Y A;  3ZN1 A;  3SXY A;  3GVA A;  2F2E A;  3WTW C;  4L18 B;  1HDP A;  3PIP F;  3F22 A;  3PNY A;  1FBQ A;  3GTL J;  4UXN A;  4G6D A;  4FQG A;  1X58 A;  2P6S A;  1G59 A;  3S1R J;  4U0W A;  3I53 A;  4JX5 A;  3DBR B;  4IVN A;  3CC4 I;  1IAW A;  1ZQ3 P;  2HOA A;  4B8X A;  1TTY A;  1W7P A;  2RNG A;  2E60 A;  4XLC A;  3GTG J;  4BQA A;  3FHZ A;  3ZCO A;  2Y9Z A;  4HLY A;  2KRC A;  2M1B A;  1ERD A;  3W6J B;  5J1Y A;  1RUO A;  3CJN A;  3LMM A;  4BHC A;  4QIW N;  1JKO C;  2ZJ2 A;  3KZI C;  2FRH A;  4BHP A;  2QWW A;  5JHU A;  2R7T A;  1LDJ A;  5DV5 A;  1LFB A;  3N97 A;  2Z99 A;  4BQQ A;  3WOD F;  1ZK8 A;  5EG0 B;  1JUP A;  2XB0 X;  3U9G A;  2VXZ A;  2IS6 A;  4PCQ A;  1D5Y A;  3ABL H;  3R4K A;  1LJ9 A;  2JA6 J;  5HOO A;  2DA7 A;  2E5Z A;  1BW5 A;  4HX8 A;  3KCC A;  3WTU C;  3BR2 A;  2HU9 A;  3ZQI A;  3ZR8 X;  3R0J A;  4U88 A;  4KYW A;  2R7V A;  2Z1D A;  2YPR A;  1XB4 A;  2FNP A;  2H1K A;  2IBD A;  3LSH A;  1J9I A;  1VTN C;  1ZKG A;  3W2W A;  3CUO A;  4CCO A;  1T56 A;  3QU6 A;  1DQU A;  1LB2 A;  2DMQ A;  2IJL A;  1X4O A;  1GDT A;  4EJV A;  2G7U A;  4MHG A;  2CMP A;  5FLV A;  4RAZ A;  3H5A A;  3GZ6 A;  3AG4 H;  4Y17 A;  3O8H A;  2JUC A;  3S1Q J;  2D1V A;  1RKT A;  5CVU A;  5D5V B;  2V6C A;  1WQ2 A;  5ILS A;  3V8K A;  4ANJ A;  1OCR H;  3IWZ A;  3MEX A;  4ZZD A;  1YW7 A;  2JRM A;  5HOD A;  1UHM A;  3B73 A;  3K4C A;  1WJF A;  2K7L A;  2KLO A;  2X48 A;  5LRR A;  3ZRG A;  1SAN A;  1I39 A;  2PG4 A;  3LSI A;  4N4O B;  2EWN A;  1OFC X;  4QSH A;  4OIQ F;  2VKV A;  5D4S A;  1TZL A;  3HJE A;  3OYC A;  4UY8 I;  1E3O C;  1IV6 A;  5IP7 J;  2HEO A;  1UAA A;  1IN8 A;  1R00 A;  1K79 A;  3DTE A;  5LEK A;  2A07 F;  2M2E A;  3K9T A;  1JUM A;  1YRN B;  4NB5 A;  2HXO A;  3SHF A;  4LIU A;  3DBH B;  1AKH B;  2PX9 A;  1RI7 A;  3HBL A;  1RKW A;  1CGP A;  2I10 A;  3ZQH A;  3KPH A;  1D0Y A;  1UZC A;  1Y0U A;  1U9N A;  2KPM A;  2LC2 A;  2IPQ X;  5FLM J;  4M3F A;  1HKT A;  1POG A;  1BR2 A;  3RKX A;  2IS2 A;  2PMZ N;  2HDW A;  3HB9 A;  2DK5 A;  5CKT A;  3UR3 C;  2YX7 A;  3TOA A;  5LD2 C;  3FF5 A;  2X4H A;  2NVT J;  1Y1W J;  5H6R A;  1PJR A;  3BR0 A;  2QSH X;  1T8I A;  1QVT A;  4A3M J;  3VFZ A;  4Y3O A;  3IWF A;  1AU7 A;  4F91 B;  3OL3 A;  4A3C J;  1FTZ A;  4AIH A;  3L9F A;  3WG7 H;  2MLK A;  2OA4 A;  2XIG A;  3TP0 A;  4IHX A;  5KK1 A;  5DDG A;  3PO3 J;  3EYY A;  1D8K A;  4KMU X;  3LSK A;  2M9H A;  1OCC H;  2B0L A;  4ZDL A;  1HDD C;  1FBU A;  3I56 I;  3E5X A;  5FKK A;  1W7P B;  5BS6 A;  4BY1 J;  2L5Q A;  2DXI A;  4CO8 A;  4D0P A;  3CF5 F;  1V5G A;  4A2U A;  1R7J A;  2IP2 A;  3W6K B;  4C2T A;  4ZYD A;  2VAS A;  5A2Q Z;  2JVG A;  4BAY A;  4XRS A;  3IAS 2;  2QQA A;  2FUG 2;  3E5U A;  2HZD A;  5J40 A;  4NC8 A;  2VI6 A;  2DOE A;  2JA7 J;  1A04 A;  4WCG A;  3HEF A;  4Y7N J;  3RYP A;  2QKM B;  2BW3 A;  2WV1 A;  1YW9 A;  5E20 A;  3K1N A;  4PSX A;  2LR8 A;  2DQL A;  4DYR A;  1V3F A;  4JQF A;  1BJZ A;  5ICE A;  5E3N A;  3WGH A;  2K9N A;  4AUX A;  1SMY F;  4ZH4 F;  2KFD A;  2HWV A;  1TNT A;  2GIZ A;  4IHW A;  2HPI A;  1VQM I;  1WJB A;  3TO6 A;  2OC6 A;  2RQQ A;  2VLA A;  2LNB A;  3H9G A;  1MBJ A;  5E79 C;  1H8A C;  2VIX A;  3IRR A;  3H9Q A;  3OS0 A;  5DEQ A;  2OZU A;  2X1D A;  3AG1 H;  3FM3 A;  2ME0 A;  5E1X A;  3OYN A;  4A3F J;  2LRE A;  3KX2 A;  4AC0 A;  1I3Q J;  1YO5 C;  1WI9 A;  3MZ8 A;  2LSO A;  4OWR B;  4HLX A;  1OKR A;  2RVC A;  2IRF G;  5J4Y A;  2R3S A;  1S5L C;  5K5O A;  5GP9 A;  1XN7 A;  3E7L A;  1XCB A;  3QOE A;  4C3J J;  5K7F A;  3I9V 2;  5ED4 A;  2LKX A;  4A6E A;  3OL4 A;  3TBI A;  4CDG A;  5KAF C;  3OIQ A;  2MC4 A;  1XSD A;  1T0F A;  4B43 A;  2WB1 A;  3WTV C;  3JRE A;  5GAH J;  1CQT A;  2J5P A;  2XGD A;  2FML A;  4WF2 A;  1EA3 A;  1RPW A;  1W4M A;  1R71 A;  2RRE A;  2X6X A;  3CP8 A;  2JA2 A;  1D3Y A;  3F3X A;  4EMS A;  1SFE A;  5IP9 J;  5KHD A;  2HZT A;  1HSJ A;  4OIN F;  1APL C;  3J7A Y;  3CTA A;  1UFM A;  1JT0 A;  3T1B A;  2GLO A;  3E97 A;  1OYY A;  2A5W A;  4J01 A;  4RBO A;  5B3S H;  3DEU A;  1BA5 A;  1SD7 A;  2KIM A;  4XID A;  2K4J A;  4P1W A;  1Z67 A;  4LB6 B;  2HVS A;  3S1M J;  3OYE A;  4I6Z A;  3DPU A;  2MH9 A;  2JA5 J;  2VPL A;  4DGW B;  4DIQ A;  2CW8 A;  1YLF A;  4MEY F;  1WJE A;  1W0T A;  2XAH A;  4BJ6 C;  3H3Z A;  5DD8 A;  4IXA A;  1SFO J;  2W24 A;  1SD6 A;  3MFK A;  2NVY J;  4RB0 A;  2WAQ N;  1RUN A;  1TWH J;  2V7F A;  4XON A;  3CMM A;  2KIF A;  2MGQ A;  2YU3 A;  3DV8 A;  3M9A A;  3SZG A;  5EEA A;  2H6C A;  2ZNY A;  5C3E J;  4MQV A;  3FKJ A;  3HOY J;  3WE3 A;  2DLL A;  5DCF A;  2V9V A;  3O2P E;  3QYE A;  4BY7 J;  4M74 A;  3BPV A;  3H1C A;  2F4O B;  2OAZ A;  4KIF A;  3S3N A;  4HV5 A;  2L4M A;  2HPM A;  3J81 K;  1LEA A;  5GPC A;  1B4A A;  2FBI A;  4E7K A;  3HTS B;  3ZN0 A;  2I8D A;  3ZMT A;  3O8G A;  3T0Y A;  2VBX A;  3ECO A;  3LSR A;  4A3D J;  5D6E A;  2DK8 A;  2NNN A;  2HQA A;  1KYW A;  2UUZ A;  2XVC A;  4TV7 A;  2BW3 B;  2VJJ A;  1B59 A;  1R6R A;  3K4B A;  4B47 A;  2A5Y B;  3F8M A;  5HLT A;  2EIJ H;  3T5X A;  4F55 A;  4L9N A;  3GFM A;  5K5Q A;  5J3L A;  1KQ8 A;  4HEA 2;  1BR1 A;  1BC7 C;  5HS9 A;  2GQQ A;  2VKE A;  3MD2 A;  2X6Y A;  1HKS A;  3N05 A;  5E3M A;  1MMS A;  3IRQ A;  2VKH A;  2VL8 A;  1XS9 A;  3UKG A;  2VUM J;  1DPR A;  1MH3 A;  1Y8R B;  2QM3 A;  3M7G A;  2AXT C;  2QLZ A;  2STW A;  3BP8 A;  4UUV A;  3SDG A;  1UHS A;  4QWQ A;  5HVQ C;  2IGO A;  2F5E A;  3JAM Z;  4PFO A;  1SD4 A;  3W2A A;  3D0S A;  4Y52 J;  5GTH C;  1IGN A;  3H3V K;  1FOW A;  2Y2Z A;  2DW4 A;  3HRU A;  1E2X A;  3SJM A;  3D5S C;  2P4W A;  2XF5 A;  2LMD A;  2LG4 A;  2XAG A;  4MFE A;  3WTX C;  3MQ0 A;  1NK3 P;  1T39 A;  2DOF A;  3VSL A;  4EM2 A;  4KIB A;  3OR1 C;  2FX0 A;  1TW3 A;  2OCC H;  1DU6 A;  1EJ9 A;  2CV2 A;  1W1W E;  3ZQL A;  4HOB A;  3M8J A;  3GLL A;  3MKZ A;  3IKT A;  1LFU P;  2E19 A;  4XKC A;  2CW0 F;  4U7B A;  2LOO A;  3S16 J;  1PDN C;  4OMY A;  4OAY A;  3O6B B;  3V7R A;  3BG5 A;  1DPU A;  2D5V A;  4L0Z B;  4YIR X;  4M3D A;  1QO0 D;  1X3U A;  1F43 A;  2K27 A;  3ULQ B;  4HST A;  5TRD A;  5LGN A;  3HYI A;  2V1N A;  3K0L A;  1ZYR F;  2E1N A;  3WHB A;  2OPT A;  4XN0 A;  3N4M A;  3HRS A;  3RZO J;  1ZHF A;  2JJ7 A;  2ZNZ A;  3VEP A;  3S3O A;  3EUK L;  1K6O A;  2CGP A;  3RSN A;  3DP7 A;  3D5R C;  3FXM A;  1WHU A;  1Z21 A;  4RLF A;  4I2O A;  2VQH A;  4EJU A;  1B9M A;  1NTC A;  3ML6 A;  1ZGW A;  1XMX A;  2CUJ A;  5JHF A;  2W7N A;  1B1B A;  3PNT A;  3IL2 A;  1JGG A;  2Z5U A;  1FP1 D;  2VE8 A;  2XV4 S;  4C3H J;  1IC8 A;  1JT6 A;  2ACJ A;  4E7S A;  4G7Z F;  4MQ9 F;  5J4V A;  4EVI A;  4BXU A;  3ASO H;  2QUF A;  3A0B C;  2R5Z A;  3LFK A;  3G6E I;  4I0B A;  4XKB A;  4L5I A;  4XOP A;  2EFW A;  2BY1 A;  1O57 A;  3HOX J;  1MH4 A;  2WAD A;  1Q1V A;  2ZBK A;  4YFN F;  4EJO A;  2Y0S N;  1U8R A;  1N77 A;  4BGD A;  1T38 A;  4CYC A;  4CCN A;  2DMU A;  3H35 A;  2O5R A;  2GXG A;  1DP7 P;  1R5H A;  2IEK A;  2UZK A;  2L3D A;  1P6R A;  4KN7 X;  3IHU A;  1MMG A;  1ONV A;  3TW6 A;  1B72 A;  4XLP F;  1IRF A;  1XPX A;  4M9X A;  1ETO A;  4AYB N;  2DMN A;  3MZY A;  5FRN A;  4GO1 A;  2ELJ A;  2KZV A;  3DPT A;  3DBL B;  2E36 A;  5IP6 A;  3L2C A;  1X1C A;  4FTH A;  1ZAO A;  1R4M B;  2Q0O A;  5JVT A;  2K02 A;  1O4X A;  3QP6 A;  4YEJ A;  1DGW Y;  1ZEL A;  4I7H A;  2HR3 A;  1MBH A;  3RTR A;  1RES A;  2XDV A;  3ABU A;  5JR3 A;  4U7D A;  3C2B A;  4BXF A;  2K85 A;  1R9T J;  5BOX A;  5CYV A;  1J75 A;  4XLA A;  3TDU C;  4II3 A;  1MNM C;  4A3L J;  5FRO A;  1C0W A;  1FJL A;  1MBK A;  4L9T A;  4BKX A;  1GV5 A;  1KON A;  2LYC A;  2Y30 A;  1IXR C;  4GYG A;  4YG2 F;  1FIA A;  1X2N A;  5BPI A;  3CCR I;  1N75 A;  3GWZ A;  4D5C A;  2IGK A;  4PSW A;  5BPD A;  4HQE A;  1ZR2 A;  3I55 I;  1I6X A;  4MLO A;  2YX4 A;  4B48 A;  4ENK A;  3SQN A;  2DPU A;  3DKX A;  2XAS A;  3ELK A;  1OR7 A;  2VBY A;  3CP2 A;  2K3P A;  3ABK H;  4XSZ F;  3ZP5 A;  1XGM A;  5D5X B;  3CCY A;  3Q0V A;  2MG4 A;  1G4D A;  3TW7 A;  2CG4 A;  1YI2 I;  4ZTJ A;  4MGR A;  3P9I A;  5F27 A;  1YW8 A;  1SAX A;  3QU3 A;  1S7O A;  1TBX A;  2LY1 A;  3FK7 A;  1U8B A;  1ETK A;  3KP2 A;  2R7Z J;  1U5T A;  3AAF A;  1KU3 A;  2IAI A;  2VQL A;  4GXO A;  4X1E A;  3G4S I;  1D1A A;  3ERM A;  4PJM A;  2COM A;  4D1Q A;  5E17 F;  4XIC A;  4UB6 C;  5C44 J;  3BQZ A;  2G9W A;  3LAP A;  2HOS A;  1OCO H;  3ZMZ A;  4QTR A;  3SFI A;  5LHI A;  4FE4 A;  1X1P A;  3ZMD A;  3BG3 A;  3ZMS A;  1FNN A;  3CO6 C;  1T0F C;  1YJW I;  2R5Z B;  1RRJ A;  2ESH A;  4U0Y A;  1QRY A;  3NRV A;  1AWC A;  2A3S A;  3BJ6 A;  1R58 A;  3NEU A;  3J80 K;  2OQG A;  1LE8 A;  4XKW A;  1K78 A;  3OYD A;  2XRO A;  1PVE A;  1MJ9 A;  5F1R A;  2ZCW A;  3QP5 A;  2ECB A;  4ZYG A;  2V9P A;  3A01 A;  4BBS J;  4F92 B;  1FYM A;  5DTD A;  3S93 A;  5HNF A;  4CYC B;  2A61 A;  3JR9 A;  3DQV C;  1IG7 A;  1W0U A;  2L4A A;  2O0Y A;  5TGT A;  4G7H F;  4II2 A;  4EM0 B;  4RAF A;  5ILV A;  4H0E A;  4ENM A;  1IXC A;  2ETH A;  2YUS A;  3GTK J;  1Z05 A;  3GEZ A;  3VYS B;  2KDZ A;  1TW2 A;  1TLH B;  1B72 B;  2LKS A;  2BXZ A;  2EV5 A;  1NHA A;  3BG9 A;  4KN4 X;  3K4N A;  2P0W A;  5HDG A;  2EFO A;  4HYE A;  3M8E A;  1RC9 A;  3F8F A;  4BQN A;  1ON1 A;  2HFH A;  1D0X A;  4BXX J;  1UG0 A;  4NHJ A;  1YQA A;  1XSX A;  1KGS A;  3U21 A;  2Y48 A;  5DYM A;  3RQ4 A;  4BH9 A;  2IS4 A;  2GBY A;  3I4N J;  3ABT A;  3NWT A;  3HOS A;  4BAC A;  1K6Y A;  2BOL A;  3S3M A;  1MMD A;  5HDN A;  5F1J A;  1R22 A;  2IGM A;  4G12 A;  2JA8 J;  3U1D A;  4OIR F;  2KHM A;  4XRS G;  2Z3Y A;  1X1B A;  2HTS A;  1E3H A;  2P5K A;  3GTP J;  2BE5 F;  2AQF A;  1A35 A;  2PJP A;  5JLW A;  1YTY A;  2PQ8 A;  4M9Z A;  1KZH A;  2NVU B;  3HTU A;  1P92 A;  3CUQ C;  2GXB A;  4L5J A;  2ZC2 A;  3OOU A;  1U78 A;  1IRG A;  3IV5 A;  4N9I A;  2WC2 A;  3BZC A;  1WVR A;  1RZ4 A;  4ZDP A;  1TWA J;  4A5N A;  2XRN A;  2BY2 A;  3G1M A;  2BV6 A;  2DA4 A;  1ON2 A;  2LY9 A;  4M6X A;  3J7Y J;  1G2H A;  1BR4 A;  1QPM A;  5B66 C;  1E17 A;  1S7A A;  1XD7 A;  2HDD A;  2BBY A;  4GCV A;  3BC8 A;  5L3E A;  1YIO A;  2M7A A;  3WTS C;  2YSR A;  3REO A;  4XSX F;  5FKM A;  4L9V A;  2JZY A;  1FSE A;  2XB5 A;  1U5T B;  4B1R A;  2M4G A;  1LKX A;  2STT A;  2HS5 A;  1KQ0 A;  1TQP A;  2XF7 A;  2GM4 A;  1K4T A;  1ZRE A;  3SYT A;  2Y69 H;  4XLN F;  3BOQ A;  4IQJ A;  4Q48 A;  3T8R A;  3D5L A;  2K40 A;  2NAZ A;  1I27 A;  1JXS A;  2X9D A;  5EJC A;  4EM1 A;  2R4G A;  2HQN A;  3KP5 A;  3RZD J;  4RGR A;  3KZY A;  4DYC A;  1RNL A;  4R1H A;  3QRF F;  2UXN A;  2XAJ A;  4I01 A;  1QHH D;  2ZME C;  1R5I D;  4LG0 A;  1MKM A;  1G3W A;  1F4K A;  3S2D J;  1WI3 A;  3ZOB A;  1LE8 B;  1ACI A;  1K78 B;  4RS8 A;  4I99 C;  1PP8 F;  1GVD A;  4CSW A;  4ENJ A;  1FTT A;  2DA3 A;  3FWE A;  1YIJ I;  3A01 B;  4AVZ A;  2EIN H;  2VC0 A;  1SAU A;  4YRV A;  1LPQ A;  1R1U A;  1S6L A;  1J09 A;  1S29 A;  3B6C A;  2W48 A;  3MKL A;  2JMW A;  5LGU A;  5HLG A;  3CCQ I;  3HKZ A;  1VQ8 I;  4FIS A;  5GAD J;  4PJL A;  3EPZ A;  4KIT B;  2A69 F;  4B09 A;  4ENN A;  3CLO A;  3QQA A;  5HLI A;  1SVL A;  3E6C C;  3RPU A;  1SFU A;  3ASN H;  3LQQ A;  3BTJ A;  4HF0 A;  2X51 A;  1IRX A;  4CZZ A;  1NG7 A;  3FX3 A;  3TED A;  5CLS A;  1I50 J;  3DTK A;  3A2K A;  1SC7 A;  3RJP A;  1KU9 A;  4RDU A;  1Z7U A;  3JRD A;  1VFC A;  2O03 A;  1J2X A;  2NS8 A;  4HX7 A;  3K10 A;  5FD5 A;  3TOB A;  1STZ A;  4BJT A;  2DCE A;  5JI6 A;  1PUF A;  1D1B A;  5DS9 A;  4ON0 A;  2O8X A;  2DFE A;  2XPU A;  3BR5 A;  1BI1 A;  5CPR B;  5A2Q K;  1FX7 A;  2QVO A;  2ZSI B;  2P81 A;  1SVM A;  4OMZ A;  3JRC A;  2P6T A;  4BS9 A;  2BY0 A;  2OTJ I;  1S8N A;  2F5C A;  3GBG A;  4HA8 A;  1FIP A;  2ELH A;  4FHT A;  3TO7 A;  2RAE A;  1LDK B;  3BQY A;  5KCM A;  2QEN A;  1HBX G;  5LEJ A;  3FXO A;  2ICW G;  1B8I A;  1XDU A;  5E8G A;  2FA5 A;  2R7D A;  2O8K A;  4HF1 A;  3LAJ A;  4D9J A;  2FU4 A;  1JJ6 C;  2D2W A;  1TQI A;  4AM3 A;  3FXU A;  4XBF A;  2KDO A;  3TP3 A;  4GYI A;  3KP4 A;  4NC7 A;  3VYT B;  1IN4 A;  2L02 A;  2DOA A;  1FY7 A;  3F8N A;  4XLE A;  2X6W A;  4IO9 F;  3Q0W A;  1HQC A;  1VQ6 I;  5DM6 F;  2X85 A;  1NH3 A;  2V1U A;  5AON A;  5GTI C;  1T33 A;  3FK6 A;  3GFL A;  1HLV A;  1RIO H;  1TP4 A;  3CD6 I;  1U6G A;  4MTE A;  2E2H J;  4DQ2 A;  1PYV A;  2FD5 A;  4UVC A;  1FLI A;  1ORK A;  4F3Q A;  1O7F A;  1V5E A;  1EH8 A;  1O3T A;  4IHT A;  3IKV A;  3DCF A;  1VZ0 A;  1WKM A;  1FYK A;  3LL7 A;  2EIM H;  3I64 A;  1TWG J;  1CF7 A;  1R1T A;  1XX5 A;  3GZ5 A;  4BE0 A;  2DJN A;  3K2Z A;  4FX0 A;  1W36 C;  2RC4 A;  1FOK A;  1IUF A;  4CH7 A;  2EV6 A;  2JRT A;  2DT5 A;  5EF6 A;  3HRT A;  3RKQ A;  1LNW A;  2E2J J;  3CES A;  5IPA A;  2IA2 A;  4HW0 A;  1OYW A;  1T08 B;  1YX3 A;  4ZZL A;  1KYZ A;  2DT6 A;  2XGX A;  1L3L A;  3HG9 A;  1X1A A;  4HX4 A;  3HDD A;  4Q5S F;  3PM1 A;  5TJJ A;  4DJA A;  3FXR A;  4LG0 B;  2K9S A;  3KYD B;  1GVJ A;  5E1W A;  1ZN2 A;  4NQW A;  1D5V A;  1MJA A;  2BZT A;  2DFH A;  3KFW X;  5F08 A;  2NNY A;  6PAX A;  4CIC A;  1OR7 C;  3OYH A;  4HNU A;  5D8K B;  5ICG A;  1XTA A;  2F5F A;  2F4I A;  5CQG A;  5LRS A;  3CJR B;  3PJR A;  1O3R A;  2JPC A;  4Y4R A;  2KL4 A;  3HUG A;  4M72 A;  2NS0 A;  4I76 A;  3BG7 A;  1MSE C;  2NOJ B;  3BG6 A;  1TT5 B;  5FGM A;  1X1D A;  2L9R A;  2K9Q A;  4HZF A;  4Y15 A;  2DMT A;  3VYR B;  5M3M J;  4A0Y A;  1U5T C;  4S04 A;  2DT7 B;  3BCA A;  4J00 A;  4YIF A;  1VQL I;  2O6G E;  2NYX A;  1FT9 A;  2RNJ A;  1O3S A;  1W7P D;  3CCE I;  3S2H J;  1XCV A;  2DOD A;  2G0E A;  2R7X A;  2FOW A;  1GT0 C;  1U0J A;  2VB6 A;  5LLQ A;  2QKL B;  3FMR A;  5HS8 A;  3JCU C;  2EFQ A;  3AKZ A;  3HSE A;  2H94 A;  3PFI A;  1PUF B;  2KP6 A;  2M7B A;  3QWL A;  2Z33 A;  2GOX B;  5AIP A;  4GFB A;  2DJI A;  2NOG A;  1P4X A;  1YG2 A;  3K4J A;  2ZFW A;  4MEX F;  2HTJ A;  4EAT A;  2AQE A;  3WU0 A;  1VQP I;  2RDP A;  3KIO A;  4NC6 A;  2CFX A;  3P5J A;  3S17 J;  4G7O F;  3QYF A;  3FMS A;  2I5U A;  3I4M J;  1AHD P;  3KP6 A;  1B8I B;  1I1S A;  4DBR A;  4AIK A;  1OLT A;  3ISP A;  5IOY A;  3HOZ J;  3JRG A;  5D8L B;  3HHH A;  2ZXW H;  3LA7 A;  5CVJ A;  4EQQ A;  4MO7 A;  3ZQF A;  2VJ5 A;  1W5T A;  3WGI A;  2EV0 A;  3EUA A;  3WTZ A;  3KEQ A;  4U0V A;  2L54 A;  3OYG A;  4W1U A;  1S7E A;  1JTY A;  2O3F A;  2CUF A;  3QPL A;  5EEG A;  4KIG A;  1UG2 A;  2L7Z A;  3OYK A;  4EJT A;  4CUG A;  1ZRC A;  2KIQ A;  3FXK A;  4EEF G;  3CUQ A;  3JAM K;  3FZV A;  4XQF A;  5HDK A;  1QA6 A;  5L3G A;  2Y75 A;  1OJL A;  4DW6 A;  1DU0 A;  3BY6 A;  4LIT A;  1S3J A;  3CCU I;  2GWR A;  4E7L A;  3WGG A;  3JTH A;  2DN0 A;  4ZTF A;  1CF7 B;  5EYR A;  1OMI A;  5TIS C;  1A36 A;  5KVR A;  3SDB A;  2L01 A;  2LP0 A;  4UVA A;  1L0O C;  1ZG5 A;  5LBQ A;  2WB1 N;  2D1H A;  2B7E A;  2CO5 A;  2M3A A;  4PJN A;  1JKR C;  5DD4 A;  1W5S A;  1VI0 A;  4PJ0 C;  3GTM J;  5FJ8 J;  2CSO A;  3H92 A;  2WY7 Q;  1WPK A;  5M5Y J;  3RPU D;  1JHH A;  3CJT B;  3OSF A;  5HS7 A;  1Z6R A;  1F36 A;  3HSF A;  2LLK A;  4HRI A;  4MTD A;  2TDX A;  5GPA A;  4HDV A;  5IOZ A;  2DTR A;  3ECH A;  2JSC A;  1ZGJ A;  4P9F A;  2MBF A;  3HZJ A;  4NQW B;  4MIM A;  4UUT A;  3D1N I;  4C2U A;  2BHY A;  2UV1 A;  2VJ4 A;  5CVR A;  5D4R A;  3PO2 J;  2E2I J;  4U87 A;  2VE9 A;  3AG2 H;  3L2U A;  3MN2 A;  1WJ5 A;  2DFI A;  4IOC F;  4JBA A;  4BHB A;  3M07 A;  4ZDO A;  3K4K A;  3HUG B;  4E7H A;  2PBI A;  1F9N A;  4X0G A;  4A12 A;  2ZME A;  3GX4 X;  4GRI A;  4RGU A;  1JKP C;  4GGG A;  3HGY A;  3I54 A;  4RB3 C;  1ETQ A;  3JRB A;  5ERI A;  4M6Y A;  4O5V A;  4A5M A;  1JKQ C;  2O9L A;  2DBB A;  3HOT A;  3L7W A;  4CCM A;  1K7A A;  4D7M A;  4RA2 A;  2IGN A;  3EYI A;  1VND A;  5F0F A;  3GZN B;  1FOX A;  4N4N B;  3RKW A;  2X0L A;  1U9O A;  1HKQ A;  4UV9 A;  3AG3 H;  4I09 A;  1Z3X A;  3EQL F;  3ONQ A;  4ITV A;  2ESN A;  3A4C A;  4HSR A;  3JTG A;  2LRD A;  2VKD A;  5H20 A;  4RGS A;  1EH6 A;  1OCZ H;  1IDZ A;  5EGO A;  1EKE A;  2CQ7 A;  2E1M B;  3R6S A;  3LQR A;  1QPI A;  2PJR A;  4XOR A;  2KQR A;  1HOM A;  3DPL C;  4P5O A;  5IT9 Z;  2XF6 A;  2K86 A;  4XRF A;  4HNT A;  4IHV A;  1YIT I;  4HF2 A;  1R4N B;  3BRO A;  3E0J B;  5L3C A;  4PGG A;  3L2R A;  1QGP A;  2ID3 A;  5J47 A;  4D5F A;  2QQ8 A;  1XGS A;  4UUS A;  3ABM H;  5F6F A;  2HGC A;  1U3E M;  3WTY C;  2CH0 A;  3LA2 A;  1A31 A;  1HW1 A;  3H9J A;  3VOE A;  3FMQ A;  1G8X A;  4KNY A;  3DWL E;  1MMA A;  3M8F A;  1H89 C;  2L2O A;  1FEX A;  3EET A;  1BIB A;  3V42 A;  3KEY A;  4XR6 A;  1FP2 A;  2OJE D;  3CUQ B;  1Q1H A;  3EUH C;  3K1M A;  4BQO A;  1YX5 A;  4J19 A;  4LIV A;  3V4G A;  4LJZ F;  3JRI A;  3OYJ A;  3U2R A;  2WBM A;  1EH7 A;  3OR2 C;  1UST A;  3GFJ A;  1MBE A;  3H0D A;  2JK3 A;  3CC7 I;  2AHQ A;  1IXS B;  4M71 A;  3X2Q H;  2EB7 A;  2B9S A;  2M0M A;  3M1C A;  3OIO A;  4JP0 A;  3TDZ C;  3K7A J;  4HNV A;  3OS2 A;  3J7A O;  1LVA A;  5J6X A;  5J1R A;  4O3M A;  2M45 A;  3FIS A;  2KRH A;  1UJ8 A;  3GTO J;  2DFF A;  3OMY A;  2OV7 A;  4WXC A;  2HYJ A;  4QPQ A;  4IOA F;  3OWT A;  1K61 A;  5FD6 A;  4A3J J;  3GXO A;  3I58 A;  3L2W A;  3FXJ A;  1ULY A;  2HOE A;  3JW4 A;  1ENH A;  5CJ9 A;  1YE9 A;  2CUZ A;  1ZRF A;  2NVX J;  3VSK A;  3DKY A;  2LKP A;  1GV2 A;  1IV8 A;  2WY8 Q;  3HL2 A;  4CYD A;  1NK2 P;  2CS3 A;  4WK8 F;  3PSI A;  1LDD A;  1QVU A;  3O3K A;  2RV8 A;  3FKI J;  2M34 A;  1LEB A;  4K2E A;  2PEX A;  5H2F C;  1WRJ A;  1F1Z A;  2E35 A;  4IPA A;  4QLC U;  2HYF A;  5FFX A;  3M1E A;  3V7C A;  3V7S A;  2TRT A;  4EGZ A;  1RET A;  5LHG A;  2ZME B;  4G6T B;  4I0A A;  1USS A;  1NG6 A;  5EZH A;  2D45 A;  1XGN A;  3F72 A;  3KYL A;  4XMY A;  4FX4 A;  2XAU A;  3I59 A;  2XHK A;  3PIO F;  4Z2Y A;  1I3A A;  1P4A A;  3QAH A;  3VB2 A;  2EJR A;  5D5W B;  3IUO A;  3NQO A;  3KP7 A;  2M5W A;  1QQI A;  3I3L A;  2L7M P;  3Q5F A;  3C2H A;  4XOT A;  1WWX A;  2OZ6 A;  3L1P A;  2A05 A;  4HV6 A;  2IT0 A;  2XAF A;  3P9C A;  2MC3 A;  5E3O A;  4RMN A; 
#chains in the Genus database with same CATH homology
 2GOM A;  2R4G A;  4AYB A;  3L2V A;  4Y33 A;  5FRM A;  1QHH D;  3QOE A;  2BVM A;  2ZSH B;  3I9V 2;  2PJR B;  3FBI B;  4DBQ A;  1DP3 A;  4CZC A;  1HA8 A;  3OL4 A;  3TBI A;  3OIQ A;  2MC4 A;  4CSW A;  4B43 A;  2WB1 A;  2MYS A;  4AVZ A;  3ZXS A;  1SAU A;  1EA3 A;  1X19 A;  4C9Y A;  2RRE A;  4YRV A;  2X6X A;  3CP8 A;  1J09 A;  2JA2 A;  1SFK A;  1X4P A;  5KHD A;  3HKZ A;  2K9L A;  3A1Y A;  3J7A Y;  4BE2 A;  3PUB A;  3TL4 X;  4PJL A;  2A5W A;  3EPZ A;  4KIT B;  4J01 A;  4BU2 A;  3QYB A;  2V9K A;  2WAE A;  4JOM A;  4XL9 A;  4BDY A;  2X51 A;  1IRX A;  4E7Z A;  4P1W A;  3BCB A;  3VDX A;  2HVS A;  1NG7 A;  1WFX A;  3DTK A;  2X1E A;  3OYE A;  3DPU A;  3PSF A;  3A2K A;  2VPL A;  4DGW B;  4RLQ A;  4DIQ A;  2CW8 A;  4B44 A;  1WJE A;  3CZ6 A;  4BJ6 C;  3OS1 A;  3K10 A;  1QHG A;  2OUM A;  4BJT A;  2DCE A;  2E1M C;  3F9K A;  1Z7L A;  1D1B A;  2V7F A;  3AL0 B;  4XON A;  3LSM A;  3CMM A;  4QPO A;  3L2Q A;  4FET A;  3SZG A;  4HPQ A;  5CPR B;  5HNH A;  2ZSI B;  3FKJ A;  4BS9 A;  3QYE A;  3GBG A;  1WJA A;  3HXL A;  1AA7 A;  3S3N A;  1D1C A;  3OYA A;  1LDK B;  2HPM A;  2XSJ C;  5KCM A;  2LY2 A;  1QU3 A;  3C2G A;  2V4J C;  3E1S A;  4D9J A;  4E7K A;  2I8D A;  4KJZ A;  4CCJ A;  2KDO A;  3RCO A;  4R79 A;  4BEH A;  4NC7 A;  2Q1Z B;  3VYT B;  2DOA A;  2HQA A;  2UUZ A;  2X6W A;  4XLE A;  4NUB A;  2BW3 B;  2VJJ A;  1R6R A;  3G2B A;  2X85 A;  3K4B A;  4B47 A;  3ZGK A;  4BDZ A;  3SEQ A;  3AL0 C;  2UWM A;  2R7O A;  5HLT A;  1Y6I A;  4F55 A;  2HNH A;  1PYV A;  4HEA 2;  1BR1 A;  2VQG A;  4F3Q A;  3MD2 A;  1V5E A;  2X6Y A;  3N05 A;  2VKH A;  2VL8 A;  4PUS A;  1VZ0 A;  4E6K G;  3LL7 A;  5HVQ C;  4BE0 A;  2IGO A;  1W36 C;  4C30 A;  2L9S A;  4PFO A;  3W2A A;  2W82 A;  4CH7 A;  3HC7 A;  4RM2 A;  4XLF A;  2LBF A;  3CES A;  1FMV A;  4BE1 A;  1YX3 A;  3D5S C;  2XF5 A;  3FBN B;  2PMZ A;  2LG4 A;  2DT6 A;  3LFU A;  4OAZ A;  1WJD A;  4ZYA A;  2R7W A;  3HG9 A;  3PL8 A;  1X1A A;  3VSL A;  2IXS A;  2IS1 A;  2W00 A;  3OR1 C;  4DJA A;  4DOZ A;  2CW7 A;  4YEL A;  4ZJZ A;  2CV2 A;  1OR7 C;  3M8J A;  3OYH A;  4HNU A;  3MKZ A;  4NNJ A;  3OYL A;  3PFY A;  3CJQ B;  4XKC A;  2F4I A;  3ZQQ A;  4U7B A;  5CQG A;  4F93 B;  2LOO A;  3CJR B;  3PJR A;  3K4M A;  5CQE A;  4OAY A;  4Y4R A;  2KL4 A;  2K5C A;  3VYU B;  3K70 C;  4BL0 B;  3BG7 A;  2NOJ B;  3BG6 A;  4E7I A;  3UNG C;  1MND A;  1X1D A;  3FHN A;  3VYR B;  4AU7 A;  4HST A;  3S8P A;  4B3X A;  4KT6 A;  2V1N A;  2DT7 B;  2JVH A;  3BCA A;  4E7J A;  1LFP A;  3OYI A;  4J00 A;  1P9Q C;  4XN0 A;  3AFH A;  3MMY B;  3S3O A;  2W1O A;  3EUK L;  4XLH A;  3RSN A;  5KNL A;  1W36 D;  3D5R C;  1UEL B;  1Z21 A;  2HVQ A;  2R7X A;  3IAM 2;  4RLF A;  3DEE A;  1U0J A;  2VB6 A;  5LFA A;  2R7S A;  2VQH A;  2QKL B;  3AKZ A;  2CUJ A;  3SEZ A;  5JHF A;  2W7N A;  2KP6 A;  2M7B A;  3PNT A;  4IX7 A;  2GOX B;  1GLN A;  3QOD A;  2DJI A;  1DGR M;  3W2V A;  3K4J A;  4E7S A;  2CV1 A;  4EAT A;  2AQE A;  4BUP A;  1TT0 A;  4H4K C;  4XKB A;  3QYF A;  4XOP A;  4XNF A;  4KIS A;  1MMN A;  3K4L A;  2WAD A;  2VQC A;  4HG2 A;  4IQ4 A;  2JSP A;  4DBR A;  1N77 A;  1OLT A;  4BGD A;  2E5N A;  4CCL A;  3H5N A;  4CCN A;  1V5F A;  3K70 D;  4LG3 A;  3TMO A;  3H35 A;  2L9N A;  2O5R A;  2WAF A;  4BEH B;  3BLY A;  2K9M A;  2F5V A;  2VJ5 A;  2WA0 A;  2Z16 A;  3DU5 A;  3EUA A;  2Z2S B;  1MMG A;  3OYG A;  4CCK A;  1FMW A;  4XM3 A;  3DTI A;  2MAB A;  3OYK A;  4CUG A;  4IKF A;  5FRN A;  4E4H A;  2ELJ A;  3LSG A;  4XQF A;  2R7Q A;  3H5R A;  2KZV A;  3DPT A;  4RM3 A;  1Z3Y A;  1X1C A;  3OYM A;  4LIT A;  4E7L A;  3OY9 A;  3HPH A;  2CFO A;  4ZTF A;  3SDB A;  4YEJ A;  3S32 A;  1DGW Y;  1ZEL A;  3PNY A;  2X1C A;  3RTR A;  1Y56 A;  2XDV A;  1G59 A;  2M3A A;  3CF2 A;  4PJN A;  4BXF A;  2LBF B;  3OIP A;  4XKV A;  2RNG A;  2E60 A;  2V26 A;  4XLA A;  4XLC A;  4II3 A;  5FRO A;  3ZCO A;  1WJC A;  2WY7 Q;  3RPU D;  2KRC A;  1ERD A;  1KON A;  2LYC A;  3LMM A;  4HRI A;  2R7T A;  4BQQ A;  4NQW B;  2A6T A;  4C2U A;  2UV1 A;  1N75 A;  2VJ4 A;  2JUG A;  2WAQ A;  4U87 A;  2L7K A;  3L2U A;  2VXZ A;  2IS6 A;  1WJ5 A;  2IGK A;  4PSW A;  2W4S A;  4MLO A;  4B48 A;  5HOO A;  2ZFU A;  2E5Z A;  3OYB A;  3DKX A;  4ZDO A;  3K4K A;  3HUG B;  4E7H A;  2R7R A;  3CP2 A;  2K3P A;  4X0G A;  4GRI A;  2HU9 A;  3ZR8 X;  2R7V A;  2Z1D A;  3VWB A;  3LSH A;  3HOT A;  4ZTJ A;  1JI8 A;  4CCM A;  3W2W A;  4CCO A;  2F6C A;  2LY1 A;  1DQU A;  2IGN A;  1X4O A;  1LVK A;  2CMP A;  3H5A A;  2VQL A;  4N4N B;  1D1A A;  4BJ5 C;  4PJM A;  4D1Q A;  1Z3X A;  3ONQ A;  4ITV A;  2XC7 A;  3A4C A;  4ANJ A;  4HSR A;  2LRD A;  3MKY B;  2VKD A;  3K4C A;  1MW7 A;  1WJF A;  2KLO A;  3ZRG A;  3LSI A;  4N4O B;  1T0F C;  3DU6 A;  2E1M B;  2PJR A;  4XOR A;  2MFZ A;  2KQR A;  3DPL C;  4P5O A;  4F52 A;  1S9H A;  4XKW A;  2XF6 A;  3OYD A;  1TZL A;  3OYC A;  4HNT A;  1N78 A;  2R7U A;  1UAA A;  3E0J B;  4F92 B;  3DTE A;  2ZXH A;  3S93 A;  3L2R A;  5HNF A;  4LIU A;  3DQV C;  5TGT A;  2BVL A;  4II2 A;  2CH0 A;  1T95 A;  1D0Y A;  3DLA A;  3OYF A;  2KPM A;  2LC2 A;  3H9J A;  1G8X A;  3VYS B;  1BR2 A;  3DWL E;  1MMA A;  2IS2 A;  2L2O A;  3K4N A;  2HDW A;  2P0W A;  3V42 A;  2VJI A;  3KEY A;  5CKT A;  3UR3 C;  4XR6 A;  3EUH C;  4BQO A;  3MKW B;  5LD2 C;  4BQN A;  1YX5 A;  1D0X A;  4LIV A;  1PJR A;  3OYJ A;  4Y3O A;  4F91 B;  2WBM A;  1UG0 A;  3OL3 A;  3OR2 C;  4CA0 A;  3H0D A;  3U21 A;  3RQ4 A;  2IS4 A;  2M0M A;  3M1C A;  3HPG A;  3NWT A;  3HOS A;  4BAC A;  3OS2 A;  3LSK A;  4ZDL A;  3W3C A;  1K6Y A;  2BOL A;  3S3M A;  1MMD A;  4PJJ A;  2KRH A;  2IGM A;  3OMY A;  2KHM A;  2HVR A;  1X1B A;  2OV7 A;  3K6G A;  4XN3 A;  2L5Q A;  4QPQ A;  2DXI A;  3OWT A;  2AQF A;  1V5G A;  4C2T A;  3L2W A;  2CV0 A;  2VAS A;  3FDY A;  4ZC3 A;  2JVG A;  2MD0 A;  3IAS 2;  3NWS A;  1YE9 A;  2CUZ A;  1MNE A;  2FUG 2;  3VSK A;  2HZD A;  3DKY A;  4NC8 A;  3OOU A;  2WY8 Q;  3HL2 A;  2CS3 A;  3PSI A;  2V6E A;  4ZDP A;  2QKM B;  1E0E A;  2BW3 A;  4PK4 A;  2LH9 A;  4IZZ A;  4PSX A;  1BR4 A;  4JQF A;  4G6T B;  1BOB A;  1NG6 A;  2ZXI A;  3BC8 A;  3IP4 B;  3KYL A;  4XMY A;  2HPI A;  1WJB A;  2KMU A;  2M7A A;  2XAU A;  2Y0S A;  2OC6 A;  2RQQ A;  2VLA A;  2VXD A;  3H9G A;  2VIX A;  3IUO A;  3H9Q A;  2M4K A;  3OS0 A;  2Q2E B;  2M4G A;  1LKX A;  4FAS D;  2X1D A;  1D0Z A;  2XF7 A;  3I3L A;  3SYT A;  3OYN A;  2LRE A;  3KX2 A;  3C2H A;  4IQJ A;  4XOT A;  4PFP A;  3D5L A;  4OWR B;  3PNV A;  4RMN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...