1F36A

The crystal structure of fis mutant k36e reveals that the transactivation region of the fis protein contains extended mobile beta-hairpin arms
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
89
structure length
89
Chain Sequence
VLTVSTVNSQDQVTQKPLRDSVKQALENYFAQLNGQDVNDLYELVLAEVEQPLLDMVMQYTRGNQTRAALMMGINRGTLRKKLKKYGMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transactivation region
molecule keywords FIS
publication title The transactivation region of the fis protein that controls site-specific DNA inversion contains extended mobile beta-hairpin arms.
pubmed doi rcsb
source organism Escherichia coli
total genus 25
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1f36A00
4DYQA 2L0KA 2R93J 2M34A 1F36A 1TWCJ 2E19A 4QSHA 2Y31A 5IYCJ 3RQIA 1ZK8A 1JUSA 4QIWN 1X2NA 1UMQA 5BNGA 4A3JJ 3BTLA 3BTCA 1WCMJ 5FJ8J 1JTYA 3HGYA 2JMWA 2QCOA 3BR6A 1EF4A 3BR1A 1MBEA 2ID3A 5J1UA 3SJMA 2K40A 1QPIA 2QF7A 2XB0X 1W0TA 9ANTA 3HKZN 1LE8B 3S17J 2GLOA 4C3HJ 1D5YA 4JP0A 4D5FA 5J3LA 5E3MA 1RKTA 1X2MA 5J1RA 2HYJA 2NVYJ 2FX0A 4B4CA 1AKHB 3GTQJ 2LKXA 2L7FP 3MN2A 5EZHA 2E1OA 4AUXA 1BA5A 1HDPA 2ID6A 4M3EA 3D1NI 1YRNB 2CUFA 3FK6A 4MO7A 1B8IA 2YU9J 2DA6A 3JRIA 1RKWA 1G2HA 1OFCX 3DCFA 1IUFA 3Q0VA 3H0GJ 3FK7A 4A3MJ 3JRFA 1UG2A 5GPCA 3M3YJ 2K9QA 4UUSB 1QRYA 5IP9J 3A02A 2DA7A 1ETVA 2DMPA 1HCRA 3GTKJ 1ZTRA 1SFOJ 2NVXJ 3VPRA 4BY7J 1TWAJ 2DJNA 1E3OC 2R5YB 2M0CA 3RKQA 3HOWJ 2GM4A 4A3BJ 1FJLA 2W48A 1MSFC 4DYRA 2R0QC 2ME6A 5K7ZA 1ZR4A 1RPWA 1Y1VJ 2XGEA 2MG4A 3QPLA 4M3BA 3ZQGA 3IH2A 3CMYA 3GBGA 2DMTA 3A01A 4J19A 4X1EA 1IGNA 1I3QJ 3FKIJ 2NVTJ 2VI6A 4EEFG 2RAEA 4FCYA 5FKLA 3BTJA 1APLC 5EGOA 2CJJA 3PO2J 1ZQ3P 4MFEA 2Y9ZA 4RDUA 1JT6A 3QQAA 3E7LA 3S2HJ 2COBA 5J1YA 1TC3C 3F0CA 4V2GA 5F08A 3GTOJ 2IBDA 4Y52J 4W1UA 1X58A 1XS9A 4JX6A 1AU7A 3S1QJ 3M4OJ 1ETOA 2FQ4A 3BQZA 3IH4A 4GFBA 3JRAA 1U78A 3BT9A 2DA4A 2GBYA 5FKOA 4IHXA 2B63J 3L1PA 2R92J 1QVTA 1WPKA 1ETQA 1B8IB 1POGA 2XPWA 2KT0A 1IV6A 5M3MJ 2CQXA 4L5EA 4M6VA 4CYCA 1PUFA 1ENHA 5EG0A 3HBLA 3K7AJ 3S15J 4V2FA 3S1MJ 2TCTA 5IP7J 3Q0UA 2DA1A 2XB5A 4MIMA 1GV2A 2R7ZJ 2HXOA 4XRSA 1ETKA 3I4NJ 1CQTA 1JUPA 2H8RA 2TRTA 1JKQC 2FD5A 2HQ5A 5K7HA 2CUEA 4DZJA 1VFCA 2FJ1A 5E3LA 4XK4A 2EQRA 1T33A 1B72A 2MGQA 2L9RA 5C4XJ 4NDLA 3NARA 3NAUA 4M3DA 3PM1A 4A3LJ 3HM5A 2WAQN 4DZPA 1SANA 1MH4A 1O4XA 2Y9YA 1OCTC 1IG7A 2L7ZA 1JJ8C 1ITYA 1RR7A 2KDZA 2P81A 2DTZA 4IHVA 4A3IJ 5K7FA 4XRMA 5M5YJ 2MW8A 5C44J 2XPVA 2JA7J 3LSJA 2N8GA 3HOVJ 1FTZA 2CRGA 2ECCA 3WHBA 1MBGA 2I10A 2JWTA 3LSPA 1JKOC 1HF0A 1A5JA 2E2JJ 3GTPJ 1ZR2A 1MBHA 2HDDA 5F0HA 4BY1J 2JA5J 3HOUJ 3TW7A 2R5ZA 3RZDJ 2O8KA 3JRGA 1TWHJ 1GUUA 3B6AA 4D7NA 4G12A 2OF7A 2DMNA 2LY9A 3HB9A 4AC0A 2EH3A 2JK3A 2XGDA 3BQYA 2X9DA 1AHDP 4HNVA 4A69C 1HLVA 1MSEC 3UKGA 1TWFJ 3S1NJ 4AYBN 2Y2ZA 5F0CA 1VI0A 2VPRA 3C2BA 1GT0C 5EZGA 2NVQJ 4MLOA 5IYBJ 5IP6A 2HI3A 4A93J 2DA2A 2VKEA 3LOCA 2M2EA 2OPTA 1K61A 3HOYJ 1WH5A 2MSYA 4XIDA 4A3EJ 5JLXA 2LLKA 3FIWA 2ECBA 5F04A 5IYDJ 5C4JJ 5F27A 1WH7A 1QVUA 5C3EJ 2ZB9A 1T56A 4BXXJ 2XPUA 1H89C 1GDTA 1Y1WJ 1BJZA 3PO3J 4I76A 1Z0XA 1VNDA 1LE8A 3O8GA 4I6ZA 2D5VA 3SFIA 4B1RA 4BBSJ 4IEJA 4A3FJ 2DMUA 5GP9A 1JKPC 1DU0A 2WV1A 2CQQA 1MH3A 4FTHA 4A3KJ 3TP3A 1FTTA 2YS9A 2DA5A 3CDLA 1IDYA 3ZQCA 1K83J 1ZKGA 1WGXA 2AO9A 3MVPA 1YRNA 5DTDA 2XGCA 1H8AC 3TEDA 2O7OA 3HGGA 3S16J 3ZQLA 4MFDA 3GTJJ 2K9NA 5GPAA 1HOMA 3FISA 5FLMJ 1FIPA 2Y30A 4W97A 4FE7A 4Y7NJ 4XICA 1ORKA 4UUSA 2X48A 2L7MP 3B6CA 1Z77A 5FKNA 5M5XJ 2HOSA 3CCYA 5EEAA 1W0UA 2AHQA 5FKMA 3HEFA 2EZHA 2LK2A 3K2AA 2R5YA 2HOAA 4C2MJ 3RZOJ 2IEKA 5IPAA 3GTGJ 3GTLJ 1GV5A 3H3VK 4A3GJ 1UHSA 2DN0A 4JX5A 3JRCA 4IHWA 2E2HJ 2X6OA 3HOXJ 4BKXA 2ME0A 5DS9A 3OIOA 4QTRA 1ZGWA 1JKRC 4UUTA 4LOCA 2G0EA 3A01B 4DW6A 3LSGA 2EZKA 1BL0A 4JX4A 1MNMC 3BR2A 4BBRJ 5EGOB 5M5WJ 2EZIA 4X6AJ 4C3IJ 3BR3A 2LVSA 2IAIA 1A6IA 1I50J 1VF9A 3Q3SA 4C3JJ 5IOYA 2XSDC 1HDDC 3SDGA 1RETA 3OOUA 1LFUP 3JREA 3ZQIA 3IH3A 1XG1A 1F43A 3IV5A 2E2IJ 3S2DJ 1JGGA 3BG9A 1OJLA 1MBKA 2JA8J 1MBJA 3CQZJ 3JRDA 5HODA 1NTCA 2WB1N 3GTMJ 1FIAA 3G1OA 1JT0A 1BW5A 5FLVA 3I4MJ 2NS7A 3BR0A 4CYCB 3OSGA 1PUFB 5EG0B 1NK2P 4DYCA 3DEWA 1DU6A 4XRSG 1XC5A 2LTPA 3OSFA 4FE4A 3G1MA 2DMQA 4S0HB 4IHYA 2H1KA 1S7EA 1Q1VA 4RBOA 2O9LA 2EBIA 1IJWC 5EDNA 4A3DJ 2NOGA 2CU7A 3BG3A 4B3AA 5F0FA 3TW6A 4M3FA 1P7JA 1GVDA 5F1JA 3W6VA 1MBFA 1JTXA 1NK3P 3MKLA 2LR8A 1B72B 2PMZN 5EF6A 4D5CA 3BR5A 1I6HJ 1ETXA 1IC8A 1BW6A 2YUSA 5JLWA 5M3FJ 2M9HA 1ETYA 2EZLA 2LFBA 1H88C 3HOZJ 2VKVA 2HXIA 2JN6A 2JA6J 2LP0A 2ELKA 2LD5A 1R9TJ 3JRBA 3O8HA 1OCPA 3S1RJ 4FISA 2NS8A 5EYRA 3JRHA 1AKHA 3S14J 2DA3A 3ZQHA 3QPSA 3Q0WA 4M3GA 3WHCA 4D7MA 1LFBA 3HDDA 3A03A 1IDZA 1JJ6C 1P7IA 4A3CJ 5FKKA 2K9SA 3JR9A 2HOTA 1U9OA 5IOZA 1RESA 1U8BA 4JYKA 1JUMA 1TWGJ 1U9NA 3G1LA 4ABZA 1ETWA 1WI3A 3TP0A 3BTIA 1FEXA 2R5ZB 2JJ7A 2VUMJ 3ZQFA 3LSRA 5E3NA 1IRZA 3ZOBA 2XRLA 3BG5A 2Y0SN 5E3OA 2M8GX 3LNQA
chains in the Genus database with same CATH superfamily
4DYQA 3BZKA 1I39A 2DPUA 2M4KA 3Q9SA 4EJWA 3K0LA 1IN5A 3IUOA 5IYCJ 4G7ZF 4D1QA 2DDBA 1KQ9A 2D1HA 4CSWA 4A3JJ 1X2NA 2OCEA 3CO7C 3LA2A 3PIOF 5FD6A 2V9VA 4BE2A 2F5DA 2JRTA 5BS6A 2QCOA 3QWLA 3BR1A 4AIKA 3F9KA 5LBQA 2JA2A 3F22A 1Z21A 3QRFF 2H1LA 3MAJA 3OYEA 2EINH 4LD5A 1MKMA 3A1YA 4YEJA 5KAIC 4KITB 3S17J 3ML6A 2CUZA 3BOQA 4UHTA 1XSDA 1D5YA 2COMA 4JP0A 3EUAA 3GZ6A 3UR3C 3A0HC 4D5FA 5L3FA 4MEYF 4LG0A 1EA3A 1WWXA 2Y0SA 4Z2YA 3BY6A 4YFNF 5J1RA 3P9CA 4E7SA 3H9QA 4L5IA 4B4CA 3V7CA 4D0PA 5CLSA 2PLYA 3GTQJ 3MN2A 1SVOA 2E1OA 1BA5A 3F8NA 2L02A 1YRNB 3FK6A 1D1BA 2MYSA 2E1CA 2YU9J 1R5ID 3HPHA 2DA6A 3JRIA 1CF7A 5E17F 4BXUA 4CA0A 4MHGA 3Q0VA 3DTKA 2WAEA 3H0GJ 4U7DA 2K02A 1MMGA 3JRFA 2ZXHA 1MMDA 5GPCA 4GGGA 3GEZA 4UUSB 1QRYA 1RC9A 1J75A 2DMPA 3D5LA 3GTKJ 2F48A 3H3UA 3ZPLA 1ZTRA 1E3OC 2R5YB 4AM3A 2GM4A 4A3BJ 1W5TA 4G8XA 3WGIA 2CFOA 1SFEA 3IRRA 1G8XA 4YFXF 2X6XA 3OYMA 5BPDA 4XKVA 3T0YA 4C30A 4LLGF 1MIJA 2HPIA 4Y17A 2VXDA 3ZQGA 1D8KA 2VBWA 5LRSA 3CMYA 1YW9A 2XVCA 4J19A 1IGNA 1Y0NA 3FKIJ 5DCFA 4L9JA 5ICFA 2BY3A 3AG2H 5HDKA 2DQLA 2Z1DA 3QYBA 2Y9ZA 4RDUA 3DTEA 3OYFA 4LG3A 1BR2A 2COBA 4H0EA 1U0JA 1OR7C 3GTOJ 3GMEA 3OYDA 3KEQA 2O61A 1JGSA 5F64A 3CUQC 2CFXA 2MH2A 2QEXI 2PI0A 1TL8A 4GFBA 4B3XA 1Z7LA 1S6LA 2L5QA 2K3PA 4HF0A 1X4PA 3J81K 3CJQB 4IVNA 1WJEA 5FD5A 4OAZA 3DKWA 1HW1A 2RGVA 4DIQA 3JTHA 2DTRA 4L9TA 3K4CA 4J00A 2KT0A 4L5EA 4B09A 3LL7A 1ZGJA 1PUFA 4I01A 3DP7A 1I1GA 2CS3A 3ZMVA 3L2CA 3SDBA 2XB5A 5J4VA 3U21A 2OZUA 2R7ZJ 1P4WA 1HQCA 2HR3A 1UZCA 1FYLA 1D1AA 2TRTA 2LBFB 4U0YA 4DZJA 2FJ1A 1UHMA 5K5OA 4ESBA 2EQRA 3D0SA 4ITVA 5LGUA 4HAMA 4G7OF 3PM1A 4LK0F 2OBPA 3HM5A 1QZZA 2WAQN 2XDVA 3OYKA 4DZPA 1SANA 3PFIA 1IG7A 2PBIA 5CYVA 1RR7A 5TGTA 1XCBA 5HLHA 2P81A 2DTZA 4KT5C 5E79C 3K1PA 5K7FA 5EEGA 4JOMA 5ED4A 3CJRB 2XPVA 4F55A 2JA7J 1FTZA 2CRGA 4FETA 4IHSA 4GRIA 4KIBA 1SFUA 3WU0A 3BLYA 2W82A 1MBHA 3CMMA 3PSIA 4RLFA 2L4MA 2O6GE 2G7HA 2V1UA 5F0HA 1FY7A 1RRJA 4BY1J 1HKSA 2JA5J 4GCVA 1D1CA 3KZIC 4OMZA 3RZDJ 1TNSA 1GUUA 1R58A 2QENA 3B6AA 3HZJA 1FBQA 3MCZA 2DMNA 4F52A 4KISA 4CCLA 1GHCA 1IN7A 3CF5F 3FHNA 3QP6A 4HNVA 4NC8A 1XGNA 1HLVA 3HJEA 5D5WB 2WAQA 1REPC 1MSEC 2Y2ZA 1RZ4A 5F0CA 3WE3A 3OWTA 1NG6A 1VI0A 5LFAA 4HRIA 1I3AA 2CW7A 5EZGA 4MLOA 4RB3C 4U0WA 5IYBJ 1UFMA 4IXAA 1LNWA 2ZBKA 3CLOA 4A93J 1FOYA 4A0ZA 3NWSA 1FOKA 3LOCA 1T6SA 2ZXJA 3FIWA 2Q1ZB 3OYAA 2O03A 3BG6A 4P9UA 3P7NA 5FLXK 1OLTA 1RUNA 4OIRF 5C4JJ 3E1SA 1SAXA 1WH7A 4LITA 4UV9A 4RMNA 1BOAA 1H89C 1BJZA 1X4OA 1HC8A 1O57A 1Z0XA 2EK5A 2LMDA 2XAHA 1VNDA 2XKPA 4HZFA 4IEJA 1JKPC 2L2OA 3IRQA 3IC7A 4KYWA 4HX8A 3F21A 1R4MB 1MH3A 3I56I 3BROA 3L2RA 4RB2C 2L9NA 1IDYA 1XGMA 2MA3A 3WTYC 2MC4A 3ONQA 2P7CB 1FP2A 1ZKGA 3RKWA 5HLTA 3MVPA 2NNNA 1YRNA 1RR8C 3VYTB 3WG7H 4EMSA 1YJNI 2KIMA 1V5FA 1ZN2A 1RUOA 4WXCA 4MGRA 3ZQLA 4MFDA 4IOAF 1QZEA 5GPAA 4IL6C 3HRTA 2RN7A 2Y30A 4CCKA 1ERDA 3GFIA 1YITI 5K1YA 2QKMB 2GXGA 4I99C 4XLAA 4UUSA 1VZ0A 2IA0A 1FOXA 2L7MP 5E8IA 5FKNA 2HOSA 4BJTA 3GF2A 5EEAA 5E1ZB 1W0UA 5FKMA 3HEFA 4MQ9F 2R5YA 2K85A 1V54H 2NXNB 3KP2A 4Y13A 2X6WA 4CUGA 2E2HJ 3H3ZA 2QGUA 2Y0MA 2X6OA 2FA5A 3HOXJ 4PCQA 3CUOA 2JVGA 4M6YA 1B1BA 4ENJA 3OIOA 2M45A 2V9PA 4M72A 4IO9F 4EVIA 3BP8A 1GLNA 4ZYEA 1ZGWA 3HTSB 1HW2A 5DM6F 4NB5A 1BI3A 1MZBA 1BL0A 3C2GA 5HLGA 1MNMC 2JQ7A 2H09A 5B66C 1Z9CA 3LSMA 3RTRA 2ZMEA 3M1EA 2LF7A 3BR3A 2QSFX 4BGDA 1FC3A 2QBYB 2IAIA 1I50J 1OISA 2VJ4A 1HDDC 2MC3A 3SDGA 4D9JA 1F4KA 1SAUA 3QYEA 4JQFA 3IWZA 2XASA 3JREA 5B3SH 1LDJA 2HVRA 4ZYDA 2E2IJ 1JGGA 2M1BA 2L3DA 1O7FA 2XROA 2ZC2A 4HF2A 4DBRA 3SFZA 1S29A 3J7YJ 2QA4I 5LEJA 4DJAA 3GZNB 1K6OA 1FOWA 1NG7A 1JT0A 3H1CA 5FLVA 3I4MJ 5B1AH 1QU3A 3BR0A 4HG2A 1QBJA 4BAYA 2G7UA 2HGCA 2CV2A 1A35A 3K1MA 2G9WA 1MMNA 2IS4A 1MGTA 1AA7A 3GFLA 5A2QZ 1VQMI 2DMQA 5CVJA 1QNTA 2IXSA 2BY1A 1S7EA 1Q1VA 4RBOA 2IT0A 1P9QC 2EBIA 2V1DA 1WJAA 1BM9A 2CU7A 2LBFA 3I4PA 1IXRC 5F0FA 2P6TA 4BDZA 3TW6A 2D45A 1BJAA 1UELB 1GVDA 5AIQA 4BNCA 5F1JA 1EH6A 4YIRX 3ZMTA 2GIZA 2WBMA 4V19K 1F9NA 5HS8A 5EF6A 1Y0UA 4D5CA 3P9IA 2VOOA 1IC8A 2EZLA 3VYSB 4Q5SF 2VKVA 2BE5F 2JN6A 2JA6J 2LP0A 2UXXA 3PL8A 3O8HA 1OCPA 4M74A 4LB5A 1G3YA 3LFKA 3S14J 3ZQHA 4A0XA 1LUJB 3S3MA 4D7MA 1LFBA 3F8FA 2GOXB 2KRCA 3CLQA 1J0RA 4OMYA 2KJCA 1S5LC 1JJ6C 1P7IA 2FXAA 3ZMSA 4HDUA 1RI7A 2Q0OA 2F5VA 2EV6A 1U9OA 3D5SC 3CTAA 3OYIA 3QP5A 1U8BA 1XGSA 4G6DA 2K27A 4H4KC 4I7HA 4EJUA 3BZ6A 4JYKA 1FWZA 1JUMA 4O6JA 3V7RA 2L9VA 5B1BH 3WG9A 1LQ1A 2BV6A 3G1LA 1WI3A 3WODF 4ABZA 3AL0B 2QWWA 2F4OB 3TP0A 2R5ZB 1HW5A 2BY2A 3BG7A 2CQKA 3OL3A 3TDUC 4HPQA 5DCMB 2HEOA 4CCOA 1HA8A 2VC1A 4A0YA 1LVKA 3LA3A 3WU1B 2Q2EA 4I0AA 2RREA 2L0KA 4ENKA 2X1CA 1J59A 2E19A 4BYYA 3RCOA 2LDUA 4OAYA 3H5RA 3V4GA 5JVTA 2VJJA 5FFZA 1YS7A 4TV7A 1DP7P 3RQIA 2EFWA 1JUSA 1YHQI 2OZ6A 5BNGA 2EIKH 1JI8A 1KU9A 2YX4A 2Z33A 3BTLA 3BTCA 2P4WA 3B73A 5ERIA 3PUFA 2LYCA 4WXDA 3L2VA 1IXSB 4FHTA 3FXMA 2JMWA 4CCJA 1EF4A 4HQEA 3CCRI 1MBEA 4N0BA 3ZQ7A 1ZGAA 2ID3A 5J1UA 1LEAA 1R5HA 2K40A 5ILSA 4BUPA 1QPIA 2R7WA 4F92B 2XB0X 1VQ5I 9ANTA 3F8MA 3G3ZA 3L2QA 4BJ6C 5LD2C 4HNUA 5E18F 1FBSA 4I02A 2FMLA 4XSZF 1VQLI 1QZYA 5CPRB 1OYWA 2KFDA 2HYJA 2BOLA 3ESWB 1TT0A 2FX0A 1AKHB 2AXLA 5EZHA 1KONA 2B7EA 2P7VB 2ZCWA 4M3EA 1H0MA 3D1NI 4P96A 2CUFA 4MO7A 4BACA 1B8IA 1TTYA 2A6HF 1FPQA 1Z91A 4M71A 2E7XA 2OV7A 3ZCOA 1YE9A 3RYRA 1Z7UA 2CV0A 4PUSA 3BJOA 2V6EA 4UVCA 4MNUA 2OU2A 4L0ZB 4ESJA 4RGUA 5FB2A 2KZVA 3MZ8A 3A02A 3FX3A 1ETVA 2FEZA 4OIPF 2UXNA 1J7KA 2OD5A 1R49A 4BY7J 1TWAJ 2DJNA 3M8JA 3J81Z 2M0CA 3E97A 2PMUA 2FE3A 3RKXA 1HKQA 2W48A 3KE2A 5FROA 2HPMA 2DODA 1MSFC 1ZREA 3P9KA 4DYRA 2R7DA 4WK8F 3HOTA 4J01A 2GXBA 2XGEA 3KETA 4F7ZA 3I5UA 5D5XB 2MG4A 1SMYF 2P0WA 3QPLA 3IH2A 5HLIA 2J5PA 4X1EA 2DXIA 2NVTJ 4EEFG 4HBLA 3RI4A 1UG0A 1D8JA 2W84A 4FASD 3TGNA 5CVUA 3PO2J 5FRMA 1XMAA 2QBYA 1T95A 3F0CA 3I64A 3WTXC 2R7XA 5F08A 1GXPA 2IBDA 1WFXA 2HKOA 4A12A 4Y52J 4W1UA 1X58A 5ICEA 1AU7A 2W57A 2RDPA 1ETOA 3OOPA 3I0TA 3BQZA 2IS1A 2QYOA 2V7FA 5E1XA 3UNGC 2M8EA 3W2AA 1U78A 3HSEA 4MEXF 2QKLB 2DW4A 3MFKA 3GLXA 2B63J 2LNBA 3L1PA 4MTDA 2R92J 3FXRA 1TBXA 1WPKA 1R1UA 4XLEA 3K70C 3S15J 3I71A 2O0YA 4V2FA 2HZTA 5IP7J 1BC8C 3K4NA 3GW2A 4FX0A 2O3FA 4M73A 4ASNA 4EJOA 1IAWA 2ZJ2A 4XLHA 1SVMA 2E1MC 2CQNA 4MIMA 4RAGA 1ETKA 1CQTA 3WTUC 1JUPA 1QO0D 1WJFA 2HQ5A 5K7HA 5E3LA 1VQOI 1A6QA 1R1VA 1XGOA 3NRVA 4WXHA 3LAPA 3LSKA 4BXFA 1FT9A 4U88A 2K86A 2GWRA 3TMOA 1AOYA 4EJTA 1DQUA 5ILVA 1Z3YA 5GAGJ 4S05A 3IL2A 4L0YB 4HLXA 1MH4A 3DKXA 2QZ8A 2CW8A 2Y9YA 4RAYA 1G59A 1OCTC 4AIHA 1JJ8C 3SEQA 1ITYA 1N77A 2NOJB 1ZARA 4CO8A 2ESNA 1DP3A 4UVBA 5CVRA 4PFOA 3CD6I 3ERMA 5C44J 1ZRCA 2VPLA 2N8GA 4F93B 3ULQB 1IN8A 4OINF 2ECCA 4AIDA 1USTA 5CKTA 1HF0A 3CUQB 2A07F 2E2JJ 3QU3A 1ZR2A 1Z6TA 1W7PB 2EWNA 2BBYA 2HDDA 5JVGF 2KMUA 2H6BA 2WV0A 3KEYA 1NH3A 2OTLI 2A5WA 1BN5A 2ADUA 2Y69H 3HOUJ 3TW7A 2A6TA 2R5ZA 2O8KA 4MQVA 2PJRA 3JRGA 1TWHJ 2MH9A 3SHFA 3LWFA 4G12A 5DCMA 2IS2A 2OF7A 3HB9A 4AC0A 4PJMA 2EH3A 1LPQA 2X9DA 3J7AO 4M9SA 4E7JA 2H6CA 3OYJA 2BGCA 2ZO4A 3ERED 3U9GA 1CGPA 2DT6A 2GQQA 1FSEA 3T1BA 1A31A 2QQBA 2WTEA 1GT0C 3EPZA 2M5WA 3EQLF 4YIIA 2BEOA 5FRNA 1MJBA 3MKYB 1Z1DA 2DA2A 4Y15A 2VKEA 1PDNC 1K61A 4XIDA 1PUEE 3H5AA 4BJ5C 2ECBA 3K10A 4PJLA 1UJ8A 1C0WA 5F27A 3V8LA 5K5RA 3MQ0A 4YRVA 4RGXA 3CMEI 5C3EJ 2ZB9A 1T56A 4A6DA 1DGWY 1ODDA 2DOEA 3R4KA 4Y4RA 4B48A 1A36A 2L9SA 3RPQA 1BOBA 2DFFA 2QVOA 3GZ5A 3SFIA 4L9VA 4B1RA 2GA2A 4BBSJ 4A3FJ 2DMUA 5GP9A 1Y56A 4FTHA 3OYBA 1FTTA 1U2WA 2YS9A 1OCZH 3OS0A 2AQEA 3CDLA 2R7RA 2LY1A 2A69F 1K83J 1PP7U 4BU2A 1I5ZA 2KIFA 2M7BA 2E71A 2XAFA 2K3FA 3E3VA 2A3SA 3GXOA 2YPRA 3WGGA 3DQVC 3O6BB 3HGGA 3OS2A 3S16J 1KGSA 1MD0A 5L3CA 3GWZA 3CP8A 1HOMA 4HQMA 5FLMJ 3TDZC 5DDGA 2F5CA 2D2WA 4YIFA 4Y7NJ 2GZWA 2X1DA 2X48A 4PJ0C 2DCEA 1XPXA 3QODA 3LSIA 2AHQA 2DDAA 2M87A 1QA6A 3J7AY 3K2AA 3OYLA 2HOAA 1ZLKA 4C2MJ 1XMKA 4PK4A 2IEKA 5E8GA 1VQ4I 4WX9A 2HS5A 3GTGJ 2AXTC 4A3GJ 1GV5A 3ABMH 2DN0A 2H8WA 1BC7C 2EIMH 1XDSA 1P92A 2DOAA 4BKXA 2QLZA 2VL8A 5DS9A 2P8TA 1T0FA 1R7JA 1KYWA 1E2XA 4X0GA 4UUTA 1YX3A 2G0EA 3W6JB 5H6RA 1DGRM 1IO2A 1OQYA 3MD2A 1ZG3A 5ICGA 2FBIA 1X19A 4O3MA 2EILH 1LKXA 3IAM2 4X6AJ 3TOBA 5J40A 2EA2A 2ZMEC 4KUMA 1YYVA 1VF9A 2BVMA 3KYDB 4II2A 1X3UA 3DF8A 4A5NA 2XF6A 4IQJA 2RVCA 1LFUP 1T8IA 1Z3XA 5ICCA 1U5TB 1IRXA 1WI9A 3ZQIA 3IH3A 4G6TB 3X2QH 2E7WA 1F43A 2FUG2 2HU9A 5TISC 3S8PA 4FT8A 4HDVA 2EA4A 2RQPA 3BG9A 5B5EC 2PG4A 4PFPA 3BDDA 4LK1F 1QGPA 5J6XA 2A05A 2JA8J 5JR3A 3CQZJ 3JRDA 2DFHA 5D5UB 4IOCF 1H9GA 2HDWA 1SMTA 2QSGX 1X1BA 1OYIA 1TQMA 4U7BA 4BS9A 3FMRA 4CYCB 3COAC 3OSGA 2FBHA 5EG0B 5HS9A 4DYCA 3DEWA 2R7QA 1YFHA 1OPCA 1DU6A 1Y8RB 1E3PA 3OSFA 3OR1C 2O5RA 2MFZA 3HG9A 3ELKA 1FNNA 4XL9A 1XMXA 1OCCH 4S0HB 5AONA 1XX5A 1IJWC 1K78B 4G6QA 5EDNA 3K70D 4XN3A 1R1TA 2STWA 2B0LA 3I3LA 1TNTA 4F3QA 1P7JA 5JFRA 3BJAA 3IHUA 1H9TA 2LR8A 1JHHA 3ZMZA 4YG2F 1HKTA 5JLWA 2YUSA 1KYZA 3HHGA 3TQNA 1ETYA 5M3FJ 4LIVA 1YG2A 1QHHD 3HRUA 4HW0A 5D4RA 1R9TJ 2BXZA 1P6RA 2FNAA 4HA8A 1X1PA 2MBFA 2EFOA 1Z67A 4M9XA 2IRFG 2GIVA 2DA3A 4M3GA 3TL4X 4O5VA 3O3KA 4UV8A 1F5TA 3MMYB 4RB0A 3FXOA 2ZSHB 4E6KG 4R1HA 2Y48A 2IPQX 4XONA 3VDXA 5IOZA 1KU3A 1W7PA 3BWGA 3KEOA 5LLQA 2Y75A 3FXKA 4NUBA 2KKOA 3BPXA 3M8FA 2V6CA 1FX7A 3FXQA 1YLFA 2QSHX 2W1OA 1FSHA 3HOSA 4UY8I 1FEXA 2VUMJ 2JT1A 2R7SA 3H9GA 5FGMA 2WADA 4LFUA 5JI6A 3E0JB 4ZYAA 2PMHA 4RS8A 2L54A 4JBAA 3ZXSA 2HYGD 3LNQA 2RQQA 4ZJZA 2FF4A 1R36A 2FOKA 2M34A 1TWCJ 4UNOA 2OC6A 4QSHA 2Y31A 2HTJA 3KFWX 2ZJQF 4WWCA 1J5YA 3EUKL 1ZK8A 4QIWN 1UMQA 2ZNYA 3P5JA 1YO5C 4ZZDA 3OIPA 1WCMJ 2DI3A 5TRDA 1V5EA 3WTSC 1XDUA 2VBXA 2V79A 3HGYA 3IWFA 3BR6A 4N9IA 2VASA 2L4AA 2X6YA 4LLLA 2M30A 1BI2A 3SJMA 3TKYA 2F6CA 4E4HA 3ROUA 1FMWA 2HTSA 4A6EA 3I53A 1DUXC 3G2BA 3DKYA 3K4LA 1W0TA 2OTJI 3HKZN 1DPRA 5L3EA 4KIFA 4C3HJ 3SZTA 3ECOA 3LQQA 1SFXA 1STZA 2DJIA 5J3LA 1RKTA 2OQRA 4XNFA 5DUKA 4HV6A 1VQ6I 4XOPA 2VT2A 2MD0A 3L2UA 3FXLA 5L3BA 2VQCA 1IN6A 2L7FP 3SZPA 3REOA 4AUXA 1HDPA 2ID6A 2XF7A 4IJAA 2CSOA 2VBYA 4I98B 2RC4A 1IUFA 1U6GA 3DCFA 3FKJA 3GFJA 3I59B 2UZKA 2P6SA 1R23A 3ZN0A 2XKOA 2KDOA 1Q1HA 1UG2A 2NS0A 3M3YJ 3F72A 5DV5A 5E20A 4M6XA 1K4TA 2ACJA 2QM3A 3CCSI 3V8JA 1HCRA 4C9YA 2NVXJ 3HKZA 2LKSA 1OYYA 2O8XA 2ZKZA 4ZDPA 2IS6A 5J4YA 1FJLA 1DPUA 2V26A 3FMSA 3G4SI 2R0QC 2AS5F 4HOBA 1ZR4A 4E7ZA 3JTGA 2HWVA 3R6SA 4NQWB 3BPVA 1TQPA 5DM7F 3FBIB 2DT5A 3ZQQA 3HXLA 3IKVA 2ESHA 3N05A 1YJ9I 2VONA 2RAEA 4FCYA 1APLC 4ZYGA 3IKTA 3ZRGA 1I27A 3I58A 1X3WB 2WWYA 1B9NA 4MFEA 2PEXA 1JT6A 3DLAA 3E7LA 3QQAA 1IUYA 4I2OA 5J1YA 1P4AA 3CDIA 4G7HF 1LB2A 4UXNA 1SVLA 2CQ7A 3GCMA 4NBQA 2I8DA 4JX6A 3S1QJ 1U5TA 4IQ4A 1IZ1A 2ELHA 2R7VA 3JRAA 4RB1A 3FDYA 2XRNA 3BT9A 3TO6A 2KQRA 2V1NA 3CO6C 2GBYA 5FKOA 3O2PE 1ONVA 4IHXA 1ZRFA 1QVTA 1E3HA 2VT3A 3AG4H 2OA4A 3DXJF 4HLYA 2XPWA 3ZR8X 1S7OA 5M3MJ 1N25A 2CQXA 4CYCA 2MABA 5EG0A 3OIQA 3HBLA 4N9HA 2VJIA 3PNYA 3Q9VA 3K6GA 1Y39A 1SD5A 1V5GA 4RAFA 2ICWG 2EFQA 4PGGA 1NHAA 3HRSA 2DT7B 3L7WA 1GV2A 2OUMA 3CP2A 3EYYA 4RA2A 3HHHA 2HXOA 1K78A 3ECHA 5L3DA 3AFHA 3SXYA 5DD4A 3I4NJ 3JAMK 3KP3A 4IX7A 2Z2SB 1JKQC 2FD5A 1VFCA 2CUEA 4P5OA 4XK4A 3G73A 3HPGA 1TLHB 4BHPA 1T33A 1D5VA 3EETA 3K4JA 2L9RA 1EH8A 4NDLA 5C4XJ 2OQGA 3NAUA 2CMPA 4M3DA 2B9SA 4A3LJ 3DPLC 3QYFA 4IRGA 3K9TA 2KISA 1MDMB 2A5YB 1WRJA 2BYVE 2FMYA 1PVEA 5FO5A 3PJRA 1W5CC 2KRFA 3WTTC 1LEBA 2KDZA 2NNYA 5BMZA 2V1XA 3HSRA 3N97A 5HS7A 5KK1A 2RNJA 4PGHA 1WVRA 3QU6A 4ZDLA 3S32A 3MZHA 3LSJA 4DBQA 3GO5A 3GFMA 3VB2A 1ZHFA 5E1WA 3OS1A 2LF8A 3WHBA 3K1NA 2JWTA 1A5JA 3K4KA 2HFHA 2ZFUA 1WHUA 4UB6C 3GTPJ 3H9JA 1GVJA 4AD9A 2DQRA 2Z99A 3ABUA 1R4NB 2VKDA 4WCGA 1B9MA 2QUFA 3R60A 1HSJA 3DU5A 3BJ6A 3V7SA 4OOIA 1B59A 3OMYA 3L00A 1D0XA 2LY9A 2LOOA 3BQYA 2ZSIB 1JHFA 3MKWB 1U8RA 3HYIA 4GYGA 3SEZA 5HOOA 4YFKF 1VQKI 1J09A 2GAUA 1A04A 1PJRA 1TWFJ 2HKXA 1QPMA 4AYBN 4M9ZA 4R79A 3CCLI 4NC7A 3HRMA 3C2BA 4ESFA 1YQAA 1V4RA 3T8TA 2NVQJ 4UVAA 3U1DA 4EM0B 5IP6A 2E1MB 5HNFA 5KHDA 2FBKA 3PNVA 5HDNA 2R7FA 2IGKA 2M2EA 2OPTA 2P5VA 3TBIA 1WH5A 2VC0A 4A3EJ 1O3QA 5JLXA 2LLKA 6PAXA 2DU9A 4EM1A 1YW7A 5F04A 4BHBA 5IYDJ 2V9KA 2E36A 3NQOA 1QVUA 2STTA 4WF2A 5IT9K 4NHJA 4BXXJ 2XPUA 1K6YA 4KN4X 2LH9A 2M3AA 2UUZA 3PO3J 4I76A 2CO5A 2A68F 2DFIA 4MTEA 4B44A 4CDGA 2GOMA 3O8GA 4I6ZA 2DOFA 3OYHA 1WZ2A 4IKFA 1DU0A 2WV1A 2CQQA 4FQGA 1TQIA 4G9YA 2H94A 3KYLA 3DLLF 1VTNC 4A3KJ 2E5ZA 4Y33A 2K5CA 4AYBA 2M0MA 1TW2A 2W4SA 1WJ5A 2EFPA 3KCCA 3F6OA 4KJZA 1WGXA 5DTDA 3R0AA 5H2FC 4OU0A 2VQHA 1ZH5A 5D6EA 2EV5A 2XGCA 1KQ0A 3ASOH 3KP4A 4XKCA 4EM2A 2O7OA 1S8NA 5CQEA 3T5XA 3S93A 1SFKA 4AWXB 5A2QK 2HZDA 3PUBA 4KT6A 3DPUA 1IN4A 1FIPA 2JSPA 4BEHB 1B4AA 1ZAOA 4L5JA 4II3A 2FRHA 3E5QA 4XICA 2XAUA 1W1WE 3ABLH 4Q47A 4CGZA 3B6CA 2AQFA 5M5XJ 4ENNA 2X85A 4LJZF 3CCYA 4KA4A 4HX4A 2VN2A 3QAHA 4NNJA 5LEKA 1FLIA 4EGYA 1MJAA 4QPQA 4UUVA 4XLPF 1SD6A 5IPAA 4ENMA 3N4MA 3GTLJ 5CVVA 4CH7A 4IHWA 4S04A 1QQIA 3AAFA 3CF2A 4NQWA 3MZYA 3RYPA 1G3WA 1MNDA 1ON1A 3DWLE 3QPHA 3WTVC 3PNTA 4A2UA 1T0FC 4CCMA 3MWMA 4LOCA 3A01B 5HVQC 5LGTA 1L0OC 1UHWA 4DW6A 4OIQF 1X1DA 3M1CA 2I5UA 2EZKA 3LSGA 4XORA 4RAZA 3TOAA 3DBHB 3OV8A 5TJJA 4Y3OA 5EGOB 3GX4X 1OKRA 4OWRB 1SD7A 3SZGA 4C3IJ 2LVSA 3DEEA 2L7KA 5FLXZ 1KQ8A 4IPAA 3RJPA 3LQRA 5IOYA 3TO7A 2XSDC 1RETA 3AKZA 4PJJA 3OYGA 3D5RC 1J2XA 2WA0A 3DFGA 4BE0A 2HQRA 2M4GA 4BDYA 5GTIC 1G3SA 1OJLA 3E5UA 2R7TA 4JK1X 1MBKA 2MLKA 3FF5A 3PIPF 1MBJA 3K69A 5J8CA 2BHZA 2WB1N 2BZTA 4L18B 4ZTFA 2D1VA 1WJBA 3G1OA 3A0BC 3VYUB 1BW5A 2CUJA 3RSNA 2NS7A 1YIJI 3KYCB 1R00A 2YX7A 2Z16A 1WKMA 1XD7A 1PP8F 1TP4A 3SYTA 1ZYRF 2HNHA 4XM3A 1XB4A 2LTPA 2BXYA 2VB6A 2V4JC 5BOXA 3G1MA 1VQ7I 5H6QA 1N75A 4QPOA 4IHYA 3W6KB 3V42A 4A3DJ 1W36C 1MNEA 4B3AA 2DLLA 1E17A 2ETHA 2W25A 4M3FA 1Y6IA 4DOZA 3RQ4A 1ZRDA 2KP6A 4P55A 3KP7A 1OCRH 2Z9OA 1MBFA 1JTXA 4AVZA 3W6VA 2JVHA 2MLGA 3MKLA 1B72B 4R8HA 5IY5H 3RDIA 2E1NA 3BR5A 1NK3P 2IA1A 1BW6A 3HOZJ 4A5MA 2M9HA 1TZLA 1H88C 3E5XA 1MDMA 2LD5A 2YR2A 1USSA 4BH9A 3JRBA 2R7UA 2JPBA 3EUHA 3S1RJ 1MJ9A 3HL2A 2WB1A 1VQPI 3HUGB 2NS8A 1WQ2A 5EYRA 3JRHA 2BW3B 1AKHA 2IW5A 4BE1A 4U0VA 3Q0WA 3T8RA 2L01A 4CCNA 4HYEA 2EIJH 1ZLJA 2ZMEB 4F91B 1IDZA 4I09A 4K2EA 4A3CJ 3GLLA 1ON2A 2W00A 1Y8QB 5DEQA 2K9SA 5FKKA 1X1AA 3K4MA 3JR9A 4LIUA 2IJLA 1S9HA 3VFZA 1BR1A 2LRDA 4KDPA 3J80K 4ZTJA 2BY0A 3ZGKA 3GVAA 2DK8A 3BTIA 3HIFA 2A6EF 1DDNA 3W2VA 2HYFA 2VKHA 4NC6A 3BZCA 2X51A 5JHUA 5E3NA 1IRZA 4KN7X 3B02A 3DBLB 2XRLA 3FBNB 1G6NA 2KJBA 3ZOBA 4CYDA 3BG5A 3S3OA 1HBXG 2BHYA 3CCQI 2HVQA 2M8GX 1RESA 3GUDA 1FYMA 2JRMA 2ZXIA 2R93J 2PQ8A 3FZVA 4LB6B 1F36A 3NWTA 2DFEA 2Z5UA 3BCAA 4C2UA 4EQQA 1WSUA 5CQGA 2FOWA 3CC7I 3HSFA 2VODA 5FJ8J 1LDKB 1JTYA 1UCRA 5KVRA 2VE9A 3PQKA 2WY8Q 2A61A 3F8BA 3QPTA 2JTVA 3WGHA 1LDDA 3KP5A 2JSCA 2QF7A 2K4BA 3RKYA 1BI1A 2EPFA 1LE8B 2QQ9A 2RV8A 5H20A 3ZMUA 3OYCA 3ZP5A 2GLOA 1V3FA 5CVIA 4C2TA 2R7OA 3DPTA 1R71A 1YW8A 1SEUA 5E3MA 1KU2A 1Z05A 2XHKA 1BR4A 5LHGA 1X2MA 3M9AA 5KCMA 5KNLA 2NVYJ 1SD4A 3JCUC 2VJ5A 3CJTB 2LKXA 3OL4A 1S72I 4IHTA 2CG4A 2IGMA 3QOPA 2VQGA 2WAFA 2F5EA 1LJ9A 1YOVB 1J9IA 1RKWA 2ELJA 1G2HA 1OFCX 2CV1A 1EKEA 4PDKA 2F5FA 2W85A 4RM3A 3FK7A 4BEHA 3JSOA 4A3MJ 4BQNA 2XGXA 1M1EB 4BQOA 3LSHA 4EV0A 1KU7A 2K9QA 5IP9J 2DA7A 4E7IA 1SFOJ 1OCOH 4XLNF 4AU7A 3CZ6A 3VPRA 2JUGA 2IVMA 2CYYA 4XOTA 1BIBA 1UB9A 3RKQA 2PJPA 3HOWJ 3ZN1A 3KX2A 3R0JA 1JXSA 2E5NA 2Q2EB 1O7LA 1R22A 2ME6A 5K7ZA 1RPWA 4KMFA 1T98A 1Y1VJ 2KIUA 4HX7A 5HDGA 1S3JA 2CH0A 4M3BA 3GBGA 2DMTA 3A01A 1FZPB 1I3QJ 3U1KA 3RPUA 2VI6A 3FXJA 1O3TA 5FKLA 3BTJA 2GXAA 5EGOA 2CJJA 3E6BA 1ZQ3P 1OR7A 4XKWA 4XMYA 3S2HJ 3JAMZ 4XQFA 1TC3C 3KP6A 3PFYA 4RM2A 4V2GA 3CUQA 3LMMA 3RIRA 2FSWA 1HSTA 1XS9A 4RLQA 2FQ4A 4IF4A 2MD5A 3M4OJ 2CGPA 2TDXA 2HVSA 4U87A 3IH4A 1IRFA 3M8EA 1U5TC 4YELA 3WE2A 3C2HA 3DEUA 3E6CC 2DPDA 2DA4A 2GA1A 1W4MA 2CW0F 2YU3A 4BQAA 1X3ZB 5F1RA 3S2WA 1LFPA 1MMAA 1FYKA 3ABTA 4PSWA 2KPMA 2ISZA 1ETQA 1B8IB 1L3LA 1POGA 1IV6A 4M6VA 2ZXWH 1VQ9I 3CC4I 1ENHA 1XSXA 4E70A 3K7AJ 5GADJ 3A2KA 2VIXA 3G6EI 3VODA 3WTZA 2NYXA 3S1MJ 2TCTA 2XF5A 2QQ8A 1XSVA 2VXZA 5GAHJ 3Q0UA 5BQTA 3PQJA 3LA7A 2DA1A 1T39A 1EH7A 3W3CA 1XN7A 2DYRH 3FM3A 1EJ9A 3OR2C 3L2WA 4XRSA 3L09A 3U2RA 2EB7A 4P9FA 1TW3A 3K4BA 2H8RA 2HOEA 1P4XA 4HSRA 5LRRA 3FXUA 1F1ZA 2KLOA 4Q4ZF 1B72A 1MW7A 2MGQA 3FMQA 5K5QA 2Q8KA 5ILUA 3NARA 2VQLA 2BVLA 3F6VA 3C1DA 4UB8C 4P1WA 4CHUA 5D8LB 4XBFA 1W36D 4XKBA 1O4XA 1W5SA 4KNYA 2JZYA 2VOPA 2L7ZA 1IW7F 2K9LA 2WC2A 3HUGA 3L9FA 1B6AA 4AIJA 2PN6A 2BW3A 2DBBA 2JPCA 2QQAA 3CDHA 3CESA 2H27A 4IHVA 4A3IJ 1N78A 4XRMA 1D3YA 4XR6A 5M5YJ 3EDPA 2MW8A 4DQ2A 3VEPA 3FHZA 4AVPA 3HOVJ 2EFNA 1R5GA 5L3GA 3VSKA 1T38A 1MBGA 2I10A 3LSPA 1JKOC 2XAQA 5KAFC 5DYMA 5IT9Z 1SC7A 4PJNA 3RPUD 4FX4A 4XRFA 1I1SA 1LVAA 3PSFA 3CJNA 3CCJI 3OY9A 2CWEA 2F4MB 4D7NA 2LSOA 3G71I 2HQNA 3K2ZA 5FFXA 2NRAC 2NAZA 4BHCA 4B43A 2XGDA 2JK3A 1AHDP 4RGSA 4A69C 1IV8A 4HF1A 1IRGA 4XLCA 1KZHA 1W7PD 3UKGA 4ZZLA 1ZELA 3S1NJ 4B47A 1FP1D 2VPRA 4L9NA 4KMUX 1GXQA 2XAJA 2DYSH 5JHFA 1R6RA 4CZZA 2HI3A 5J47A 4N4OB 1WJDA 2DAOA 4Z6YA 2W7NA 5EJCA 2JUCA 3KZZA 3HOYJ 2MSYA 4DGWB 2EJRA 5CJ9A 4HNTA 5LHIA 4Q48A 4XSXF 2X4HA 2KL4A 2LKPA 4EGZA 2FQ3A 2XAGA 1HXDA 4XN0A 3SQNA 1G4DA 1GDTA 1Y1WJ 4CXFA 1LE8A 1BBYA 4RGRA 2D5VA 2ZFWA 1TT5B 3DU6A 1EV7A 5J8FA 1XTAA 2DK5A 4HSTA 2XC7A 4LG0B 3C7JA 3HC7A 3M07A 3TP3A 2RNGA 3KPHA 1K79A 2Z3YA 3I54A 1T2KA 2DA5A 3ZQCA 5HNHA 2W24A 3BCBA 3F8CA 2AO9A 3H0DA 4HV5A 2NVUB 2XUBA 2X0LA 1O3SA 1FMVA 4KICA 2DO7A 1H8AC 3AG1H 3DBRB 3TEDA 2IP2A 2E35A 1CF7B 3QOEA 3GTJJ 2K9NA 3FISA 3V8KA 4ZDOA 3WTWC 3OYNA 3NEUA 2VE8A 2HDCA 4EATA 4W97A 1D0ZA 4FE7A 3LFUA 5GAEJ 1ORKA 4QWQA 2F2EA 2PJRB 4E7HA 1Z77A 2IGOA 1UAAA 2OCCH 3AG3H 2R4GA 2EZHA 2LK2A 3LSTA 3GYHX 5GTHC 1WJCA 3RZOJ 2YSRA 5EEHA 1YTYA 2F4IA 1YJWI 4GDFA 1OMIA 3H3VK 1UHSA 4JX5A 3JRCA 3A4CA 1E0EA 4LGWA 1AWCA 3MEXA 2ME0A 3ASNH 3VOEA 5D4SA 4QTRA 3MKZA 3E6DA 3H92A 5DD8A 1RNLA 2XIGA 1RIOH 1JKRC 3CCEI 3F23A 1G3TA 2FU4A 4JX4A 4QLCU 3BR2A 4BBRJ 5M5WJ 2VLAA 4ON0A 4DNCA 2EZIA 4ZYHA 2UWMA 2P5KA 3JW4A 2ZJRF 3CCUI 1O3RA 2C6YA 1MMSA 3F3XA 1A6IA 3Q3SA 1Z6RA 2EV0A 3VSLA 4C3JJ 1S7AA 2ISYA 3H35A 3OOUA 2FNPA 4LMYA 3R61A 1JE8A 1X1CA 1VQNI 3C18A 5DUIA 1XG1A 1IF1A 3S3NA 2E34A 3IV5A 3S2DJ 4E7LA 1QHGA 4G94A 3AL0C 1BI0A 1D0YA 3IP4B 2WY7Q 2LG4A 4ANJA 5LGNA 3E6MA 2HQAA 1ULYA 4PZJA 1U3EM 5HODA 1YI2I 4XLFA 5D8KB 4KFCA 1NTCA 3ISPA 3GTMJ 1FIAA 1VQ8I 2ZJPF 3ZMDA 3Q5FA 3H5NA 3CCMI 1PUFB 2LREA 3FM5A 1V55H 3DTIA 1NK2P 4I0BA 2ZNZA 2KHMA 4XRSG 1XC5A 4ZH4F 4CZCA 4BQQA 4GXOA 1YX5A 3JSPA 4FE4A 4CICA 3J80Z 4IZZA 5D6FA 2VBZA 2H1KA 2PFBA 2KRHA 2O9LA 2J5OA 1K4SA 2NOGA 3BC8A 3IAS2 3BG3A 4N4NB 2K9MA 3FWEA 1YS6A 2IGNA 2E60A 4LLNA 5IT3A 4B8XA 2KIQA 3VWBA 1I6HJ 2PMZN 5F6FA 2RKHA 3CMAI 1ETXA 5BPIA 2P5LC 1I6XA 3I9V2 1ZG1A 2LFBA 4ZC3A 5LHHA 2HXIA 3J7ZI 3KIOA 2ELKA 2LC2A 2UV1A 1FBUA 2XSJC 4BL0B 4FISA 4PSXA 5D5VB 4ETSA 2M7AA 3WU2C 3EUHC 3QPSA 3WHCA 3KLNA 1P2FA 2IA2A 3HDDA 2K4JA 5AIPA 1XCVA 2OAZA 4KIGA 2X1EA 3A03A 3EYIA 2R3SA 1ACIA 3KZYA 2HOTA 2KZGA 4IRHA 3ABKH 3I59A 4GYIA 4OIOF 4E7KA 3TO9A 4HEA2 3DV8A 1PYVA 1TWGJ 3CC2I 2PX9A 3LAJA 1KA8A 1T08B 1U9NA 1ETWA 4IRIA 1IXCA 4EJVA 2JJ7A 3H36A 3ZQFA 3LSRA 1BIAA 2XV4S 3CCVI 2OJED 2PMZA 3HTUA 3W2WA 1K7AA 2K7LA 3M7GA 2Y0SN 1ZG5A 3C3WA 4GO1A 1YIOA 3I55I 5E3OA 2LY2A 3KLOA 3VYRB
chains in the Genus database with same CATH topology
4DYQA 2L0KA 2R93J 2M34A 1F36A 1TWCJ 2E19A 4QSHA 2Y31A 5IYCJ 3RQIA 1ZK8A 1JUSA 4QIWN 1X2NA 1UMQA 5BNGA 4A3JJ 3BTLA 3BTCA 1WCMJ 5FJ8J 1JTYA 3HGYA 2JMWA 2QCOA 3BR6A 1EF4A 3BR1A 1MBEA 2ID3A 5J1UA 3SJMA 2K40A 1QPIA 2QF7A 2XB0X 1W0TA 9ANTA 3HKZN 1LE8B 3S17J 2GLOA 4C3HJ 1D5YA 4JP0A 4D5FA 5J3LA 5E3MA 1RKTA 1X2MA 5J1RA 2HYJA 2NVYJ 2FX0A 4B4CA 1AKHB 3GTQJ 2LKXA 2L7FP 3MN2A 5EZHA 2E1OA 4AUXA 1BA5A 1HDPA 2ID6A 4M3EA 3D1NI 1YRNB 2CUFA 3FK6A 4MO7A 1B8IA 2YU9J 2DA6A 3JRIA 1RKWA 1G2HA 1OFCX 3DCFA 1IUFA 3Q0VA 3H0GJ 3FK7A 4A3MJ 3JRFA 1UG2A 5GPCA 3M3YJ 2K9QA 4UUSB 1QRYA 5IP9J 3A02A 2DA7A 1ETVA 2DMPA 1HCRA 3GTKJ 1ZTRA 1SFOJ 2NVXJ 3VPRA 4BY7J 1TWAJ 2DJNA 1E3OC 2R5YB 2M0CA 3RKQA 3HOWJ 2GM4A 4A3BJ 1FJLA 2W48A 1MSFC 4DYRA 2R0QC 2ME6A 5K7ZA 1ZR4A 1RPWA 1Y1VJ 2XGEA 2MG4A 3QPLA 4M3BA 3ZQGA 3IH2A 3CMYA 3GBGA 2DMTA 3A01A 4J19A 4X1EA 1IGNA 1I3QJ 3FKIJ 2NVTJ 2VI6A 4EEFG 2RAEA 4FCYA 5FKLA 3BTJA 1APLC 5EGOA 2CJJA 3PO2J 1ZQ3P 4MFEA 2Y9ZA 4RDUA 1JT6A 3QQAA 3E7LA 3S2HJ 2COBA 5J1YA 1TC3C 3F0CA 4V2GA 5F08A 3GTOJ 2IBDA 4Y52J 4W1UA 1X58A 1XS9A 4JX6A 1AU7A 3S1QJ 3M4OJ 1ETOA 2FQ4A 3BQZA 3IH4A 4GFBA 3JRAA 1U78A 3BT9A 2DA4A 2GBYA 5FKOA 4IHXA 2B63J 3L1PA 2R92J 1QVTA 1WPKA 1ETQA 1B8IB 1POGA 2XPWA 2KT0A 1IV6A 5M3MJ 2CQXA 4L5EA 4M6VA 4CYCA 1PUFA 1ENHA 5EG0A 3HBLA 3K7AJ 3S15J 4V2FA 3S1MJ 2TCTA 5IP7J 3Q0UA 2DA1A 2XB5A 4MIMA 1GV2A 2R7ZJ 2HXOA 4XRSA 1ETKA 3I4NJ 1CQTA 1JUPA 2H8RA 2TRTA 1JKQC 2FD5A 2HQ5A 5K7HA 2CUEA 4DZJA 1VFCA 2FJ1A 5E3LA 4XK4A 2EQRA 1T33A 1B72A 2MGQA 2L9RA 5C4XJ 4NDLA 3NARA 3NAUA 4M3DA 3PM1A 4A3LJ 3HM5A 2WAQN 4DZPA 1SANA 1MH4A 1O4XA 2Y9YA 1OCTC 1IG7A 2L7ZA 1JJ8C 1ITYA 1RR7A 2KDZA 2P81A 2DTZA 4IHVA 4A3IJ 5K7FA 4XRMA 5M5YJ 2MW8A 5C44J 2XPVA 2JA7J 3LSJA 2N8GA 3HOVJ 1FTZA 2CRGA 2ECCA 3WHBA 1MBGA 2I10A 2JWTA 3LSPA 1JKOC 1HF0A 1A5JA 2E2JJ 3GTPJ 1ZR2A 1MBHA 2HDDA 5F0HA 4BY1J 2JA5J 3HOUJ 3TW7A 2R5ZA 3RZDJ 2O8KA 3JRGA 1TWHJ 1GUUA 3B6AA 4D7NA 4G12A 2OF7A 2DMNA 2LY9A 3HB9A 4AC0A 2EH3A 2JK3A 2XGDA 3BQYA 2X9DA 1AHDP 4HNVA 4A69C 1HLVA 1MSEC 3UKGA 1TWFJ 3S1NJ 4AYBN 2Y2ZA 5F0CA 1VI0A 2VPRA 3C2BA 1GT0C 5EZGA 2NVQJ 4MLOA 5IYBJ 5IP6A 2HI3A 4A93J 2DA2A 2VKEA 3LOCA 2M2EA 2OPTA 1K61A 3HOYJ 1WH5A 2MSYA 4XIDA 4A3EJ 5JLXA 2LLKA 3FIWA 2ECBA 5F04A 5IYDJ 5C4JJ 5F27A 1WH7A 1QVUA 5C3EJ 2ZB9A 1T56A 4BXXJ 2XPUA 1H89C 1GDTA 1Y1WJ 1BJZA 3PO3J 4I76A 1Z0XA 1VNDA 1LE8A 3O8GA 4I6ZA 2D5VA 3SFIA 4B1RA 4BBSJ 4IEJA 4A3FJ 2DMUA 5GP9A 1JKPC 1DU0A 2WV1A 2CQQA 1MH3A 4FTHA 4A3KJ 3TP3A 1FTTA 2YS9A 2DA5A 3CDLA 1IDYA 3ZQCA 1K83J 1ZKGA 1WGXA 2AO9A 3MVPA 1YRNA 5DTDA 2XGCA 1H8AC 3TEDA 2O7OA 3HGGA 3S16J 3ZQLA 4MFDA 3GTJJ 2K9NA 5GPAA 1HOMA 3FISA 5FLMJ 1FIPA 2Y30A 4W97A 4FE7A 4Y7NJ 4XICA 1ORKA 4UUSA 2X48A 2L7MP 3B6CA 1Z77A 5FKNA 5M5XJ 2HOSA 3CCYA 5EEAA 1W0UA 2AHQA 5FKMA 3HEFA 2EZHA 2LK2A 3K2AA 2R5YA 2HOAA 4C2MJ 3RZOJ 2IEKA 5IPAA 3GTGJ 3GTLJ 1GV5A 3H3VK 4A3GJ 1UHSA 2DN0A 4JX5A 3JRCA 4IHWA 2E2HJ 2X6OA 3HOXJ 4BKXA 2ME0A 5DS9A 3OIOA 4QTRA 1ZGWA 1JKRC 4UUTA 4LOCA 2G0EA 3A01B 4DW6A 3LSGA 2EZKA 1BL0A 4JX4A 1MNMC 3BR2A 4BBRJ 5EGOB 5M5WJ 2EZIA 4X6AJ 4C3IJ 3BR3A 2LVSA 2IAIA 1A6IA 1I50J 1VF9A 3Q3SA 4C3JJ 5IOYA 2XSDC 1HDDC 3SDGA 1RETA 3OOUA 1LFUP 3JREA 3ZQIA 3IH3A 1XG1A 1F43A 3IV5A 2E2IJ 3S2DJ 1JGGA 3BG9A 1OJLA 1MBKA 2JA8J 1MBJA 3CQZJ 3JRDA 5HODA 1NTCA 2WB1N 3GTMJ 1FIAA 3G1OA 1JT0A 1BW5A 5FLVA 3I4MJ 2NS7A 3BR0A 4CYCB 3OSGA 1PUFB 5EG0B 1NK2P 4DYCA 3DEWA 1DU6A 4XRSG 1XC5A 2LTPA 3OSFA 4FE4A 3G1MA 2DMQA 4S0HB 4IHYA 2H1KA 1S7EA 1Q1VA 4RBOA 2O9LA 2EBIA 1IJWC 5EDNA 4A3DJ 2NOGA 2CU7A 3BG3A 4B3AA 5F0FA 3TW6A 4M3FA 1P7JA 1GVDA 5F1JA 3W6VA 1MBFA 1JTXA 1NK3P 3MKLA 2LR8A 1B72B 2PMZN 5EF6A 4D5CA 3BR5A 1I6HJ 1ETXA 1IC8A 1BW6A 2YUSA 5JLWA 5M3FJ 2M9HA 1ETYA 2EZLA 2LFBA 1H88C 3HOZJ 2VKVA 2HXIA 2JN6A 2JA6J 2LP0A 2ELKA 2LD5A 1R9TJ 3JRBA 3O8HA 1OCPA 3S1RJ 4FISA 2NS8A 5EYRA 3JRHA 1AKHA 3S14J 2DA3A 3ZQHA 3QPSA 3Q0WA 4M3GA 3WHCA 4D7MA 1LFBA 3HDDA 3A03A 1IDZA 1JJ6C 1P7IA 4A3CJ 5FKKA 2K9SA 3JR9A 2HOTA 1U9OA 5IOZA 1RESA 1U8BA 4JYKA 1JUMA 1TWGJ 1U9NA 3G1LA 4ABZA 1ETWA 1WI3A 3TP0A 3BTIA 1FEXA 2R5ZB 2JJ7A 2VUMJ 3ZQFA 3LSRA 5E3NA 1IRZA 3ZOBA 2XRLA 3BG5A 2Y0SN 5E3OA 2M8GX 3LNQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DYQ A;  2L0K A;  2R93 J;  2M34 A;  1F36 A;  1TWC J;  2E19 A;  4QSH A;  2Y31 A;  5IYC J;  3RQI A;  1ZK8 A;  1JUS A;  4QIW N;  1X2N A;  1UMQ A;  5BNG A;  4A3J J;  3BTL A;  3BTC A;  1WCM J;  5FJ8 J;  1JTY A;  3HGY A;  2JMW A;  2QCO A;  3BR6 A;  1EF4 A;  3BR1 A;  1MBE A;  2ID3 A;  5J1U A;  3SJM A;  2K40 A;  1QPI A;  2QF7 A;  2XB0 X;  1W0T A;  9ANT A;  3HKZ N;  1LE8 B;  3S17 J;  2GLO A;  4C3H J;  1D5Y A;  4JP0 A;  4D5F A;  5J3L A;  5E3M A;  1RKT A;  1X2M A;  5J1R A;  2HYJ A;  2NVY J;  2FX0 A;  4B4C A;  1AKH B;  3GTQ J;  2LKX A;  2L7F P;  3MN2 A;  5EZH A;  2E1O A;  4AUX A;  1BA5 A;  1HDP A;  2ID6 A;  4M3E A;  3D1N I;  1YRN B;  2CUF A;  3FK6 A;  4MO7 A;  1B8I A;  2YU9 J;  2DA6 A;  3JRI A;  1RKW A;  1G2H A;  1OFC X;  3DCF A;  1IUF A;  3Q0V A;  3H0G J;  3FK7 A;  4A3M J;  3JRF A;  1UG2 A;  5GPC A;  3M3Y J;  2K9Q A;  4UUS B;  1QRY A;  5IP9 J;  3A02 A;  2DA7 A;  1ETV A;  2DMP A;  1HCR A;  3GTK J;  1ZTR A;  1SFO J;  2NVX J;  3VPR A;  4BY7 J;  1TWA J;  2DJN A;  1E3O C;  2R5Y B;  2M0C A;  3RKQ A;  3HOW J;  2GM4 A;  4A3B J;  1FJL A;  2W48 A;  1MSF C;  4DYR A;  2R0Q C;  2ME6 A;  5K7Z A;  1ZR4 A;  1RPW A;  1Y1V J;  2XGE A;  2MG4 A;  3QPL A;  4M3B A;  3ZQG A;  3IH2 A;  3CMY A;  3GBG A;  2DMT A;  3A01 A;  4J19 A;  4X1E A;  1IGN A;  1I3Q J;  3FKI J;  2NVT J;  2VI6 A;  4EEF G;  2RAE A;  4FCY A;  5FKL A;  3BTJ A;  1APL C;  5EGO A;  2CJJ A;  3PO2 J;  1ZQ3 P;  4MFE A;  2Y9Z A;  4RDU A;  1JT6 A;  3QQA A;  3E7L A;  3S2H J;  2COB A;  5J1Y A;  1TC3 C;  3F0C A;  4V2G A;  5F08 A;  3GTO J;  2IBD A;  4Y52 J;  4W1U A;  1X58 A;  1XS9 A;  4JX6 A;  1AU7 A;  3S1Q J;  3M4O J;  1ETO A;  2FQ4 A;  3BQZ A;  3IH4 A;  4GFB A;  3JRA A;  1U78 A;  3BT9 A;  2DA4 A;  2GBY A;  5FKO A;  4IHX A;  2B63 J;  3L1P A;  2R92 J;  1QVT A;  1WPK A;  1ETQ A;  1B8I B;  1POG A;  2XPW A;  2KT0 A;  1IV6 A;  5M3M J;  2CQX A;  4L5E A;  4M6V A;  4CYC A;  1PUF A;  1ENH A;  5EG0 A;  3HBL A;  3K7A J;  3S15 J;  4V2F A;  3S1M J;  2TCT A;  5IP7 J;  3Q0U A;  2DA1 A;  2XB5 A;  4MIM A;  1GV2 A;  2R7Z J;  2HXO A;  4XRS A;  1ETK A;  3I4N J;  1CQT A;  1JUP A;  2H8R A;  2TRT A;  1JKQ C;  2FD5 A;  2HQ5 A;  5K7H A;  2CUE A;  4DZJ A;  1VFC A;  2FJ1 A;  5E3L A;  4XK4 A;  2EQR A;  1T33 A;  1B72 A;  2MGQ A;  2L9R A;  5C4X J;  4NDL A;  3NAR A;  3NAU A;  4M3D A;  3PM1 A;  4A3L J;  3HM5 A;  2WAQ N;  4DZP A;  1SAN A;  1MH4 A;  1O4X A;  2Y9Y A;  1OCT C;  1IG7 A;  2L7Z A;  1JJ8 C;  1ITY A;  1RR7 A;  2KDZ A;  2P81 A;  2DTZ A;  4IHV A;  4A3I J;  5K7F A;  4XRM A;  5M5Y J;  2MW8 A;  5C44 J;  2XPV A;  2JA7 J;  3LSJ A;  2N8G A;  3HOV J;  1FTZ A;  2CRG A;  2ECC A;  3WHB A;  1MBG A;  2I10 A;  2JWT A;  3LSP A;  1JKO C;  1HF0 A;  1A5J A;  2E2J J;  3GTP J;  1ZR2 A;  1MBH A;  2HDD A;  5F0H A;  4BY1 J;  2JA5 J;  3HOU J;  3TW7 A;  2R5Z A;  3RZD J;  2O8K A;  3JRG A;  1TWH J;  1GUU A;  3B6A A;  4D7N A;  4G12 A;  2OF7 A;  2DMN A;  2LY9 A;  3HB9 A;  4AC0 A;  2EH3 A;  2JK3 A;  2XGD A;  3BQY A;  2X9D A;  1AHD P;  4HNV A;  4A69 C;  1HLV A;  1MSE C;  3UKG A;  1TWF J;  3S1N J;  4AYB N;  2Y2Z A;  5F0C A;  1VI0 A;  2VPR A;  3C2B A;  1GT0 C;  5EZG A;  2NVQ J;  4MLO A;  5IYB J;  5IP6 A;  2HI3 A;  4A93 J;  2DA2 A;  2VKE A;  3LOC A;  2M2E A;  2OPT A;  1K61 A;  3HOY J;  1WH5 A;  2MSY A;  4XID A;  4A3E J;  5JLX A;  2LLK A;  3FIW A;  2ECB A;  5F04 A;  5IYD J;  5C4J J;  5F27 A;  1WH7 A;  1QVU A;  5C3E J;  2ZB9 A;  1T56 A;  4BXX J;  2XPU A;  1H89 C;  1GDT A;  1Y1W J;  1BJZ A;  3PO3 J;  4I76 A;  1Z0X A;  1VND A;  1LE8 A;  3O8G A;  4I6Z A;  2D5V A;  3SFI A;  4B1R A;  4BBS J;  4IEJ A;  4A3F J;  2DMU A;  5GP9 A;  1JKP C;  1DU0 A;  2WV1 A;  2CQQ A;  1MH3 A;  4FTH A;  4A3K J;  3TP3 A;  1FTT A;  2YS9 A;  2DA5 A;  3CDL A;  1IDY A;  3ZQC A;  1K83 J;  1ZKG A;  1WGX A;  2AO9 A;  3MVP A;  1YRN A;  5DTD A;  2XGC A;  1H8A C;  3TED A;  2O7O A;  3HGG A;  3S16 J;  3ZQL A;  4MFD A;  3GTJ J;  2K9N A;  5GPA A;  1HOM A;  3FIS A;  5FLM J;  1FIP A;  2Y30 A;  4W97 A;  4FE7 A;  4Y7N J;  4XIC A;  1ORK A;  4UUS A;  2X48 A;  2L7M P;  3B6C A;  1Z77 A;  5FKN A;  5M5X J;  2HOS A;  3CCY A;  5EEA A;  1W0U A;  2AHQ A;  5FKM A;  3HEF A;  2EZH A;  2LK2 A;  3K2A A;  2R5Y A;  2HOA A;  4C2M J;  3RZO J;  2IEK A;  5IPA A;  3GTG J;  3GTL J;  1GV5 A;  3H3V K;  4A3G J;  1UHS A;  2DN0 A;  4JX5 A;  3JRC A;  4IHW A;  2E2H J;  2X6O A;  3HOX J;  4BKX A;  2ME0 A;  5DS9 A;  3OIO A;  4QTR A;  1ZGW A;  1JKR C;  4UUT A;  4LOC A;  2G0E A;  3A01 B;  4DW6 A;  3LSG A;  2EZK A;  1BL0 A;  4JX4 A;  1MNM C;  3BR2 A;  4BBR J;  5EGO B;  5M5W J;  2EZI A;  4X6A J;  4C3I J;  3BR3 A;  2LVS A;  2IAI A;  1A6I A;  1I50 J;  1VF9 A;  3Q3S A;  4C3J J;  5IOY A;  2XSD C;  1HDD C;  3SDG A;  1RET A;  3OOU A;  1LFU P;  3JRE A;  3ZQI A;  3IH3 A;  1XG1 A;  1F43 A;  3IV5 A;  2E2I J;  3S2D J;  1JGG A;  3BG9 A;  1OJL A;  1MBK A;  2JA8 J;  1MBJ A;  3CQZ J;  3JRD A;  5HOD A;  1NTC A;  2WB1 N;  3GTM J;  1FIA A;  3G1O A;  1JT0 A;  1BW5 A;  5FLV A;  3I4M J;  2NS7 A;  3BR0 A;  4CYC B;  3OSG A;  1PUF B;  5EG0 B;  1NK2 P;  4DYC A;  3DEW A;  1DU6 A;  4XRS G;  1XC5 A;  2LTP A;  3OSF A;  4FE4 A;  3G1M A;  2DMQ A;  4S0H B;  4IHY A;  2H1K A;  1S7E A;  1Q1V A;  4RBO A;  2O9L A;  2EBI A;  1IJW C;  5EDN A;  4A3D J;  2NOG A;  2CU7 A;  3BG3 A;  4B3A A;  5F0F A;  3TW6 A;  4M3F A;  1P7J A;  1GVD A;  5F1J A;  3W6V A;  1MBF A;  1JTX A;  1NK3 P;  3MKL A;  2LR8 A;  1B72 B;  2PMZ N;  5EF6 A;  4D5C A;  3BR5 A;  1I6H J;  1ETX A;  1IC8 A;  1BW6 A;  2YUS A;  5JLW A;  5M3F J;  2M9H A;  1ETY A;  2EZL A;  2LFB A;  1H88 C;  3HOZ J;  2VKV A;  2HXI A;  2JN6 A;  2JA6 J;  2LP0 A;  2ELK A;  2LD5 A;  1R9T J;  3JRB A;  3O8H A;  1OCP A;  3S1R J;  4FIS A;  2NS8 A;  5EYR A;  3JRH A;  1AKH A;  3S14 J;  2DA3 A;  3ZQH A;  3QPS A;  3Q0W A;  4M3G A;  3WHC A;  4D7M A;  1LFB A;  3HDD A;  3A03 A;  1IDZ A;  1JJ6 C;  1P7I A;  4A3C J;  5FKK A;  2K9S A;  3JR9 A;  2HOT A;  1U9O A;  5IOZ A;  1RES A;  1U8B A;  4JYK A;  1JUM A;  1TWG J;  1U9N A;  3G1L A;  4ABZ A;  1ETW A;  1WI3 A;  3TP0 A;  3BTI A;  1FEX A;  2R5Z B;  2JJ7 A;  2VUM J;  3ZQF A;  3LSR A;  5E3N A;  1IRZ A;  3ZOB A;  2XRL A;  3BG5 A;  2Y0S N;  5E3O A;  2M8G X;  3LNQ A; 
#chains in the Genus database with same CATH topology
 4DYQ A;  3BZK A;  1I39 A;  2DPU A;  2M4K A;  3Q9S A;  4EJW A;  3K0L A;  1IN5 A;  3IUO A;  5IYC J;  4G7Z F;  4D1Q A;  2DDB A;  1KQ9 A;  2D1H A;  4CSW A;  4A3J J;  1X2N A;  2OCE A;  3CO7 C;  3LA2 A;  3PIO F;  5FD6 A;  2V9V A;  4BE2 A;  2F5D A;  2JRT A;  5BS6 A;  2QCO A;  3QWL A;  3BR1 A;  4AIK A;  3F9K A;  5LBQ A;  2JA2 A;  3F22 A;  1Z21 A;  3QRF F;  2H1L A;  3MAJ A;  3OYE A;  2EIN H;  4LD5 A;  1MKM A;  3A1Y A;  4YEJ A;  5KAI C;  4KIT B;  3S17 J;  3ML6 A;  2CUZ A;  3BOQ A;  4UHT A;  1XSD A;  1D5Y A;  2COM A;  4JP0 A;  3EUA A;  3GZ6 A;  3UR3 C;  3A0H C;  4D5F A;  5L3F A;  4MEY F;  4LG0 A;  1EA3 A;  1WWX A;  2Y0S A;  4Z2Y A;  3BY6 A;  4YFN F;  5J1R A;  3P9C A;  4E7S A;  3H9Q A;  4L5I A;  4B4C A;  3V7C A;  4D0P A;  5CLS A;  2PLY A;  3GTQ J;  3MN2 A;  1SVO A;  2E1O A;  1BA5 A;  3F8N A;  2L02 A;  1YRN B;  3FK6 A;  1D1B A;  2MYS A;  2E1C A;  2YU9 J;  1R5I D;  3HPH A;  2DA6 A;  3JRI A;  1CF7 A;  5E17 F;  4BXU A;  4CA0 A;  4MHG A;  3Q0V A;  3DTK A;  2WAE A;  3H0G J;  4U7D A;  2K02 A;  1MMG A;  3JRF A;  2ZXH A;  1MMD A;  5GPC A;  4GGG A;  3GEZ A;  4UUS B;  1QRY A;  1RC9 A;  1J75 A;  2DMP A;  3D5L A;  3GTK J;  2F48 A;  3H3U A;  3ZPL A;  1ZTR A;  1E3O C;  2R5Y B;  4AM3 A;  2GM4 A;  4A3B J;  1W5T A;  4G8X A;  3WGI A;  2CFO A;  1SFE A;  3IRR A;  1G8X A;  4YFX F;  2X6X A;  3OYM A;  5BPD A;  4XKV A;  3T0Y A;  4C30 A;  4LLG F;  1MIJ A;  2HPI A;  4Y17 A;  2VXD A;  3ZQG A;  1D8K A;  2VBW A;  5LRS A;  3CMY A;  1YW9 A;  2XVC A;  4J19 A;  1IGN A;  1Y0N A;  3FKI J;  5DCF A;  4L9J A;  5ICF A;  2BY3 A;  3AG2 H;  5HDK A;  2DQL A;  2Z1D A;  3QYB A;  2Y9Z A;  4RDU A;  3DTE A;  3OYF A;  4LG3 A;  1BR2 A;  2COB A;  4H0E A;  1U0J A;  1OR7 C;  3GTO J;  3GME A;  3OYD A;  3KEQ A;  2O61 A;  1JGS A;  5F64 A;  3CUQ C;  2CFX A;  2MH2 A;  2QEX I;  2PI0 A;  1TL8 A;  4GFB A;  4B3X A;  1Z7L A;  1S6L A;  2L5Q A;  2K3P A;  4HF0 A;  1X4P A;  3J81 K;  3CJQ B;  4IVN A;  1WJE A;  5FD5 A;  4OAZ A;  3DKW A;  1HW1 A;  2RGV A;  4DIQ A;  3JTH A;  2DTR A;  4L9T A;  3K4C A;  4J00 A;  2KT0 A;  4L5E A;  4B09 A;  3LL7 A;  1ZGJ A;  1PUF A;  4I01 A;  3DP7 A;  1I1G A;  2CS3 A;  3ZMV A;  3L2C A;  3SDB A;  2XB5 A;  5J4V A;  3U21 A;  2OZU A;  2R7Z J;  1P4W A;  1HQC A;  2HR3 A;  1UZC A;  1FYL A;  1D1A A;  2TRT A;  2LBF B;  4U0Y A;  4DZJ A;  2FJ1 A;  1UHM A;  5K5O A;  4ESB A;  2EQR A;  3D0S A;  4ITV A;  5LGU A;  4HAM A;  4G7O F;  3PM1 A;  4LK0 F;  2OBP A;  3HM5 A;  1QZZ A;  2WAQ N;  2XDV A;  3OYK A;  4DZP A;  1SAN A;  3PFI A;  1IG7 A;  2PBI A;  5CYV A;  1RR7 A;  5TGT A;  1XCB A;  5HLH A;  2P81 A;  2DTZ A;  4KT5 C;  5E79 C;  3K1P A;  5K7F A;  5EEG A;  4JOM A;  5ED4 A;  3CJR B;  2XPV A;  4F55 A;  2JA7 J;  1FTZ A;  2CRG A;  4FET A;  4IHS A;  4GRI A;  4KIB A;  1SFU A;  3WU0 A;  3BLY A;  2W82 A;  1MBH A;  3CMM A;  3PSI A;  4RLF A;  2L4M A;  2O6G E;  2G7H A;  2V1U A;  5F0H A;  1FY7 A;  1RRJ A;  4BY1 J;  1HKS A;  2JA5 J;  4GCV A;  1D1C A;  3KZI C;  4OMZ A;  3RZD J;  1TNS A;  1GUU A;  1R58 A;  2QEN A;  3B6A A;  3HZJ A;  1FBQ A;  3MCZ A;  2DMN A;  4F52 A;  4KIS A;  4CCL A;  1GHC A;  1IN7 A;  3CF5 F;  3FHN A;  3QP6 A;  4HNV A;  4NC8 A;  1XGN A;  1HLV A;  3HJE A;  5D5W B;  2WAQ A;  1REP C;  1MSE C;  2Y2Z A;  1RZ4 A;  5F0C A;  3WE3 A;  3OWT A;  1NG6 A;  1VI0 A;  5LFA A;  4HRI A;  1I3A A;  2CW7 A;  5EZG A;  4MLO A;  4RB3 C;  4U0W A;  5IYB J;  1UFM A;  4IXA A;  1LNW A;  2ZBK A;  3CLO A;  4A93 J;  1FOY A;  4A0Z A;  3NWS A;  1FOK A;  3LOC A;  1T6S A;  2ZXJ A;  3FIW A;  2Q1Z B;  3OYA A;  2O03 A;  3BG6 A;  4P9U A;  3P7N A;  5FLX K;  1OLT A;  1RUN A;  4OIR F;  5C4J J;  3E1S A;  1SAX A;  1WH7 A;  4LIT A;  4UV9 A;  4RMN A;  1BOA A;  1H89 C;  1BJZ A;  1X4O A;  1HC8 A;  1O57 A;  1Z0X A;  2EK5 A;  2LMD A;  2XAH A;  1VND A;  2XKP A;  4HZF A;  4IEJ A;  1JKP C;  2L2O A;  3IRQ A;  3IC7 A;  4KYW A;  4HX8 A;  3F21 A;  1R4M B;  1MH3 A;  3I56 I;  3BRO A;  3L2R A;  4RB2 C;  2L9N A;  1IDY A;  1XGM A;  2MA3 A;  3WTY C;  2MC4 A;  3ONQ A;  2P7C B;  1FP2 A;  1ZKG A;  3RKW A;  5HLT A;  3MVP A;  2NNN A;  1YRN A;  1RR8 C;  3VYT B;  3WG7 H;  4EMS A;  1YJN I;  2KIM A;  1V5F A;  1ZN2 A;  1RUO A;  4WXC A;  4MGR A;  3ZQL A;  4MFD A;  4IOA F;  1QZE A;  5GPA A;  4IL6 C;  3HRT A;  2RN7 A;  2Y30 A;  4CCK A;  1ERD A;  3GFI A;  1YIT I;  5K1Y A;  2QKM B;  2GXG A;  4I99 C;  4XLA A;  4UUS A;  1VZ0 A;  2IA0 A;  1FOX A;  2L7M P;  5E8I A;  5FKN A;  2HOS A;  4BJT A;  3GF2 A;  5EEA A;  5E1Z B;  1W0U A;  5FKM A;  3HEF A;  4MQ9 F;  2R5Y A;  2K85 A;  1V54 H;  2NXN B;  3KP2 A;  4Y13 A;  2X6W A;  4CUG A;  2E2H J;  3H3Z A;  2QGU A;  2Y0M A;  2X6O A;  2FA5 A;  3HOX J;  4PCQ A;  3CUO A;  2JVG A;  4M6Y A;  1B1B A;  4ENJ A;  3OIO A;  2M45 A;  2V9P A;  4M72 A;  4IO9 F;  4EVI A;  3BP8 A;  1GLN A;  4ZYE A;  1ZGW A;  3HTS B;  1HW2 A;  5DM6 F;  4NB5 A;  1BI3 A;  1MZB A;  1BL0 A;  3C2G A;  5HLG A;  1MNM C;  2JQ7 A;  2H09 A;  5B66 C;  1Z9C A;  3LSM A;  3RTR A;  2ZME A;  3M1E A;  2LF7 A;  3BR3 A;  2QSF X;  4BGD A;  1FC3 A;  2QBY B;  2IAI A;  1I50 J;  1OIS A;  2VJ4 A;  1HDD C;  2MC3 A;  3SDG A;  4D9J A;  1F4K A;  1SAU A;  3QYE A;  4JQF A;  3IWZ A;  2XAS A;  3JRE A;  5B3S H;  1LDJ A;  2HVR A;  4ZYD A;  2E2I J;  1JGG A;  2M1B A;  2L3D A;  1O7F A;  2XRO A;  2ZC2 A;  4HF2 A;  4DBR A;  3SFZ A;  1S29 A;  3J7Y J;  2QA4 I;  5LEJ A;  4DJA A;  3GZN B;  1K6O A;  1FOW A;  1NG7 A;  1JT0 A;  3H1C A;  5FLV A;  3I4M J;  5B1A H;  1QU3 A;  3BR0 A;  4HG2 A;  1QBJ A;  4BAY A;  2G7U A;  2HGC A;  2CV2 A;  1A35 A;  3K1M A;  2G9W A;  1MMN A;  2IS4 A;  1MGT A;  1AA7 A;  3GFL A;  5A2Q Z;  1VQM I;  2DMQ A;  5CVJ A;  1QNT A;  2IXS A;  2BY1 A;  1S7E A;  1Q1V A;  4RBO A;  2IT0 A;  1P9Q C;  2EBI A;  2V1D A;  1WJA A;  1BM9 A;  2CU7 A;  2LBF A;  3I4P A;  1IXR C;  5F0F A;  2P6T A;  4BDZ A;  3TW6 A;  2D45 A;  1BJA A;  1UEL B;  1GVD A;  5AIQ A;  4BNC A;  5F1J A;  1EH6 A;  4YIR X;  3ZMT A;  2GIZ A;  2WBM A;  4V19 K;  1F9N A;  5HS8 A;  5EF6 A;  1Y0U A;  4D5C A;  3P9I A;  2VOO A;  1IC8 A;  2EZL A;  3VYS B;  4Q5S F;  2VKV A;  2BE5 F;  2JN6 A;  2JA6 J;  2LP0 A;  2UXX A;  3PL8 A;  3O8H A;  1OCP A;  4M74 A;  4LB5 A;  1G3Y A;  3LFK A;  3S14 J;  3ZQH A;  4A0X A;  1LUJ B;  3S3M A;  4D7M A;  1LFB A;  3F8F A;  2GOX B;  2KRC A;  3CLQ A;  1J0R A;  4OMY A;  2KJC A;  1S5L C;  1JJ6 C;  1P7I A;  2FXA A;  3ZMS A;  4HDU A;  1RI7 A;  2Q0O A;  2F5V A;  2EV6 A;  1U9O A;  3D5S C;  3CTA A;  3OYI A;  3QP5 A;  1U8B A;  1XGS A;  4G6D A;  2K27 A;  4H4K C;  4I7H A;  4EJU A;  3BZ6 A;  4JYK A;  1FWZ A;  1JUM A;  4O6J A;  3V7R A;  2L9V A;  5B1B H;  3WG9 A;  1LQ1 A;  2BV6 A;  3G1L A;  1WI3 A;  3WOD F;  4ABZ A;  3AL0 B;  2QWW A;  2F4O B;  3TP0 A;  2R5Z B;  1HW5 A;  2BY2 A;  3BG7 A;  2CQK A;  3OL3 A;  3TDU C;  4HPQ A;  5DCM B;  2HEO A;  4CCO A;  1HA8 A;  2VC1 A;  4A0Y A;  1LVK A;  3LA3 A;  3WU1 B;  2Q2E A;  4I0A A;  2RRE A;  2L0K A;  4ENK A;  2X1C A;  1J59 A;  2E19 A;  4BYY A;  3RCO A;  2LDU A;  4OAY A;  3H5R A;  3V4G A;  5JVT A;  2VJJ A;  5FFZ A;  1YS7 A;  4TV7 A;  1DP7 P;  3RQI A;  2EFW A;  1JUS A;  1YHQ I;  2OZ6 A;  5BNG A;  2EIK H;  1JI8 A;  1KU9 A;  2YX4 A;  2Z33 A;  3BTL A;  3BTC A;  2P4W A;  3B73 A;  5ERI A;  3PUF A;  2LYC A;  4WXD A;  3L2V A;  1IXS B;  4FHT A;  3FXM A;  2JMW A;  4CCJ A;  1EF4 A;  4HQE A;  3CCR I;  1MBE A;  4N0B A;  3ZQ7 A;  1ZGA A;  2ID3 A;  5J1U A;  1LEA A;  1R5H A;  2K40 A;  5ILS A;  4BUP A;  1QPI A;  2R7W A;  4F92 B;  2XB0 X;  1VQ5 I;  9ANT A;  3F8M A;  3G3Z A;  3L2Q A;  4BJ6 C;  5LD2 C;  4HNU A;  5E18 F;  1FBS A;  4I02 A;  2FML A;  4XSZ F;  1VQL I;  1QZY A;  5CPR B;  1OYW A;  2KFD A;  2HYJ A;  2BOL A;  3ESW B;  1TT0 A;  2FX0 A;  1AKH B;  2AXL A;  5EZH A;  1KON A;  2B7E A;  2P7V B;  2ZCW A;  4M3E A;  1H0M A;  3D1N I;  4P96 A;  2CUF A;  4MO7 A;  4BAC A;  1B8I A;  1TTY A;  2A6H F;  1FPQ A;  1Z91 A;  4M71 A;  2E7X A;  2OV7 A;  3ZCO A;  1YE9 A;  3RYR A;  1Z7U A;  2CV0 A;  4PUS A;  3BJO A;  2V6E A;  4UVC A;  4MNU A;  2OU2 A;  4L0Z B;  4ESJ A;  4RGU A;  5FB2 A;  2KZV A;  3MZ8 A;  3A02 A;  3FX3 A;  1ETV A;  2FEZ A;  4OIP F;  2UXN A;  1J7K A;  2OD5 A;  1R49 A;  4BY7 J;  1TWA J;  2DJN A;  3M8J A;  3J81 Z;  2M0C A;  3E97 A;  2PMU A;  2FE3 A;  3RKX A;  1HKQ A;  2W48 A;  3KE2 A;  5FRO A;  2HPM A;  2DOD A;  1MSF C;  1ZRE A;  3P9K A;  4DYR A;  2R7D A;  4WK8 F;  3HOT A;  4J01 A;  2GXB A;  2XGE A;  3KET A;  4F7Z A;  3I5U A;  5D5X B;  2MG4 A;  1SMY F;  2P0W A;  3QPL A;  3IH2 A;  5HLI A;  2J5P A;  4X1E A;  2DXI A;  2NVT J;  4EEF G;  4HBL A;  3RI4 A;  1UG0 A;  1D8J A;  2W84 A;  4FAS D;  3TGN A;  5CVU A;  3PO2 J;  5FRM A;  1XMA A;  2QBY A;  1T95 A;  3F0C A;  3I64 A;  3WTX C;  2R7X A;  5F08 A;  1GXP A;  2IBD A;  1WFX A;  2HKO A;  4A12 A;  4Y52 J;  4W1U A;  1X58 A;  5ICE A;  1AU7 A;  2W57 A;  2RDP A;  1ETO A;  3OOP A;  3I0T A;  3BQZ A;  2IS1 A;  2QYO A;  2V7F A;  5E1X A;  3UNG C;  2M8E A;  3W2A A;  1U78 A;  3HSE A;  4MEX F;  2QKL B;  2DW4 A;  3MFK A;  3GLX A;  2B63 J;  2LNB A;  3L1P A;  4MTD A;  2R92 J;  3FXR A;  1TBX A;  1WPK A;  1R1U A;  4XLE A;  3K70 C;  3S15 J;  3I71 A;  2O0Y A;  4V2F A;  2HZT A;  5IP7 J;  1BC8 C;  3K4N A;  3GW2 A;  4FX0 A;  2O3F A;  4M73 A;  4ASN A;  4EJO A;  1IAW A;  2ZJ2 A;  4XLH A;  1SVM A;  2E1M C;  2CQN A;  4MIM A;  4RAG A;  1ETK A;  1CQT A;  3WTU C;  1JUP A;  1QO0 D;  1WJF A;  2HQ5 A;  5K7H A;  5E3L A;  1VQO I;  1A6Q A;  1R1V A;  1XGO A;  3NRV A;  4WXH A;  3LAP A;  3LSK A;  4BXF A;  1FT9 A;  4U88 A;  2K86 A;  2GWR A;  3TMO A;  1AOY A;  4EJT A;  1DQU A;  5ILV A;  1Z3Y A;  5GAG J;  4S05 A;  3IL2 A;  4L0Y B;  4HLX A;  1MH4 A;  3DKX A;  2QZ8 A;  2CW8 A;  2Y9Y A;  4RAY A;  1G59 A;  1OCT C;  4AIH A;  1JJ8 C;  3SEQ A;  1ITY A;  1N77 A;  2NOJ B;  1ZAR A;  4CO8 A;  2ESN A;  1DP3 A;  4UVB A;  5CVR A;  4PFO A;  3CD6 I;  3ERM A;  5C44 J;  1ZRC A;  2VPL A;  2N8G A;  4F93 B;  3ULQ B;  1IN8 A;  4OIN F;  2ECC A;  4AID A;  1UST A;  5CKT A;  1HF0 A;  3CUQ B;  2A07 F;  2E2J J;  3QU3 A;  1ZR2 A;  1Z6T A;  1W7P B;  2EWN A;  2BBY A;  2HDD A;  5JVG F;  2KMU A;  2H6B A;  2WV0 A;  3KEY A;  1NH3 A;  2OTL I;  2A5W A;  1BN5 A;  2ADU A;  2Y69 H;  3HOU J;  3TW7 A;  2A6T A;  2R5Z A;  2O8K A;  4MQV A;  2PJR A;  3JRG A;  1TWH J;  2MH9 A;  3SHF A;  3LWF A;  4G12 A;  5DCM A;  2IS2 A;  2OF7 A;  3HB9 A;  4AC0 A;  4PJM A;  2EH3 A;  1LPQ A;  2X9D A;  3J7A O;  4M9S A;  4E7J A;  2H6C A;  3OYJ A;  2BGC A;  2ZO4 A;  3ERE D;  3U9G A;  1CGP A;  2DT6 A;  2GQQ A;  1FSE A;  3T1B A;  1A31 A;  2QQB A;  2WTE A;  1GT0 C;  3EPZ A;  2M5W A;  3EQL F;  4YII A;  2BEO A;  5FRN A;  1MJB A;  3MKY B;  1Z1D A;  2DA2 A;  4Y15 A;  2VKE A;  1PDN C;  1K61 A;  4XID A;  1PUE E;  3H5A A;  4BJ5 C;  2ECB A;  3K10 A;  4PJL A;  1UJ8 A;  1C0W A;  5F27 A;  3V8L A;  5K5R A;  3MQ0 A;  4YRV A;  4RGX A;  3CME I;  5C3E J;  2ZB9 A;  1T56 A;  4A6D A;  1DGW Y;  1ODD A;  2DOE A;  3R4K A;  4Y4R A;  4B48 A;  1A36 A;  2L9S A;  3RPQ A;  1BOB A;  2DFF A;  2QVO A;  3GZ5 A;  3SFI A;  4L9V A;  4B1R A;  2GA2 A;  4BBS J;  4A3F J;  2DMU A;  5GP9 A;  1Y56 A;  4FTH A;  3OYB A;  1FTT A;  1U2W A;  2YS9 A;  1OCZ H;  3OS0 A;  2AQE A;  3CDL A;  2R7R A;  2LY1 A;  2A69 F;  1K83 J;  1PP7 U;  4BU2 A;  1I5Z A;  2KIF A;  2M7B A;  2E71 A;  2XAF A;  2K3F A;  3E3V A;  2A3S A;  3GXO A;  2YPR A;  3WGG A;  3DQV C;  3O6B B;  3HGG A;  3OS2 A;  3S16 J;  1KGS A;  1MD0 A;  5L3C A;  3GWZ A;  3CP8 A;  1HOM A;  4HQM A;  5FLM J;  3TDZ C;  5DDG A;  2F5C A;  2D2W A;  4YIF A;  4Y7N J;  2GZW A;  2X1D A;  2X48 A;  4PJ0 C;  2DCE A;  1XPX A;  3QOD A;  3LSI A;  2AHQ A;  2DDA A;  2M87 A;  1QA6 A;  3J7A Y;  3K2A A;  3OYL A;  2HOA A;  1ZLK A;  4C2M J;  1XMK A;  4PK4 A;  2IEK A;  5E8G A;  1VQ4 I;  4WX9 A;  2HS5 A;  3GTG J;  2AXT C;  4A3G J;  1GV5 A;  3ABM H;  2DN0 A;  2H8W A;  1BC7 C;  2EIM H;  1XDS A;  1P92 A;  2DOA A;  4BKX A;  2QLZ A;  2VL8 A;  5DS9 A;  2P8T A;  1T0F A;  1R7J A;  1KYW A;  1E2X A;  4X0G A;  4UUT A;  1YX3 A;  2G0E A;  3W6J B;  5H6R A;  1DGR M;  1IO2 A;  1OQY A;  3MD2 A;  1ZG3 A;  5ICG A;  2FBI A;  1X19 A;  4O3M A;  2EIL H;  1LKX A;  3IAM 2;  4X6A J;  3TOB A;  5J40 A;  2EA2 A;  2ZME C;  4KUM A;  1YYV A;  1VF9 A;  2BVM A;  3KYD B;  4II2 A;  1X3U A;  3DF8 A;  4A5N A;  2XF6 A;  4IQJ A;  2RVC A;  1LFU P;  1T8I A;  1Z3X A;  5ICC A;  1U5T B;  1IRX A;  1WI9 A;  3ZQI A;  3IH3 A;  4G6T B;  3X2Q H;  2E7W A;  1F43 A;  2FUG 2;  2HU9 A;  5TIS C;  3S8P A;  4FT8 A;  4HDV A;  2EA4 A;  2RQP A;  3BG9 A;  5B5E C;  2PG4 A;  4PFP A;  3BDD A;  4LK1 F;  1QGP A;  5J6X A;  2A05 A;  2JA8 J;  5JR3 A;  3CQZ J;  3JRD A;  2DFH A;  5D5U B;  4IOC F;  1H9G A;  2HDW A;  1SMT A;  2QSG X;  1X1B A;  1OYI A;  1TQM A;  4U7B A;  4BS9 A;  3FMR A;  4CYC B;  3COA C;  3OSG A;  2FBH A;  5EG0 B;  5HS9 A;  4DYC A;  3DEW A;  2R7Q A;  1YFH A;  1OPC A;  1DU6 A;  1Y8R B;  1E3P A;  3OSF A;  3OR1 C;  2O5R A;  2MFZ A;  3HG9 A;  3ELK A;  1FNN A;  4XL9 A;  1XMX A;  1OCC H;  4S0H B;  5AON A;  1XX5 A;  1IJW C;  1K78 B;  4G6Q A;  5EDN A;  3K70 D;  4XN3 A;  1R1T A;  2STW A;  2B0L A;  3I3L A;  1TNT A;  4F3Q A;  1P7J A;  5JFR A;  3BJA A;  3IHU A;  1H9T A;  2LR8 A;  1JHH A;  3ZMZ A;  4YG2 F;  1HKT A;  5JLW A;  2YUS A;  1KYZ A;  3HHG A;  3TQN A;  1ETY A;  5M3F J;  4LIV A;  1YG2 A;  1QHH D;  3HRU A;  4HW0 A;  5D4R A;  1R9T J;  2BXZ A;  1P6R A;  2FNA A;  4HA8 A;  1X1P A;  2MBF A;  2EFO A;  1Z67 A;  4M9X A;  2IRF G;  2GIV A;  2DA3 A;  4M3G A;  3TL4 X;  4O5V A;  3O3K A;  4UV8 A;  1F5T A;  3MMY B;  4RB0 A;  3FXO A;  2ZSH B;  4E6K G;  4R1H A;  2Y48 A;  2IPQ X;  4XON A;  3VDX A;  5IOZ A;  1KU3 A;  1W7P A;  3BWG A;  3KEO A;  5LLQ A;  2Y75 A;  3FXK A;  4NUB A;  2KKO A;  3BPX A;  3M8F A;  2V6C A;  1FX7 A;  3FXQ A;  1YLF A;  2QSH X;  2W1O A;  1FSH A;  3HOS A;  4UY8 I;  1FEX A;  2VUM J;  2JT1 A;  2R7S A;  3H9G A;  5FGM A;  2WAD A;  4LFU A;  5JI6 A;  3E0J B;  4ZYA A;  2PMH A;  4RS8 A;  2L54 A;  4JBA A;  3ZXS A;  2HYG D;  3LNQ A;  2RQQ A;  4ZJZ A;  2FF4 A;  1R36 A;  2FOK A;  2M34 A;  1TWC J;  4UNO A;  2OC6 A;  4QSH A;  2Y31 A;  2HTJ A;  3KFW X;  2ZJQ F;  4WWC A;  1J5Y A;  3EUK L;  1ZK8 A;  4QIW N;  1UMQ A;  2ZNY A;  3P5J A;  1YO5 C;  4ZZD A;  3OIP A;  1WCM J;  2DI3 A;  5TRD A;  1V5E A;  3WTS C;  1XDU A;  2VBX A;  2V79 A;  3HGY A;  3IWF A;  3BR6 A;  4N9I A;  2VAS A;  2L4A A;  2X6Y A;  4LLL A;  2M30 A;  1BI2 A;  3SJM A;  3TKY A;  2F6C A;  4E4H A;  3ROU A;  1FMW A;  2HTS A;  4A6E A;  3I53 A;  1DUX C;  3G2B A;  3DKY A;  3K4L A;  1W0T A;  2OTJ I;  3HKZ N;  1DPR A;  5L3E A;  4KIF A;  4C3H J;  3SZT A;  3ECO A;  3LQQ A;  1SFX A;  1STZ A;  2DJI A;  5J3L A;  1RKT A;  2OQR A;  4XNF A;  5DUK A;  4HV6 A;  1VQ6 I;  4XOP A;  2VT2 A;  2MD0 A;  3L2U A;  3FXL A;  5L3B A;  2VQC A;  1IN6 A;  2L7F P;  3SZP A;  3REO A;  4AUX A;  1HDP A;  2ID6 A;  2XF7 A;  4IJA A;  2CSO A;  2VBY A;  4I98 B;  2RC4 A;  1IUF A;  1U6G A;  3DCF A;  3FKJ A;  3GFJ A;  3I59 B;  2UZK A;  2P6S A;  1R23 A;  3ZN0 A;  2XKO A;  2KDO A;  1Q1H A;  1UG2 A;  2NS0 A;  3M3Y J;  3F72 A;  5DV5 A;  5E20 A;  4M6X A;  1K4T A;  2ACJ A;  2QM3 A;  3CCS I;  3V8J A;  1HCR A;  4C9Y A;  2NVX J;  3HKZ A;  2LKS A;  1OYY A;  2O8X A;  2ZKZ A;  4ZDP A;  2IS6 A;  5J4Y A;  1FJL A;  1DPU A;  2V26 A;  3FMS A;  3G4S I;  2R0Q C;  2AS5 F;  4HOB A;  1ZR4 A;  4E7Z A;  3JTG A;  2HWV A;  3R6S A;  4NQW B;  3BPV A;  1TQP A;  5DM7 F;  3FBI B;  2DT5 A;  3ZQQ A;  3HXL A;  3IKV A;  2ESH A;  3N05 A;  1YJ9 I;  2VON A;  2RAE A;  4FCY A;  1APL C;  4ZYG A;  3IKT A;  3ZRG A;  1I27 A;  3I58 A;  1X3W B;  2WWY A;  1B9N A;  4MFE A;  2PEX A;  1JT6 A;  3DLA A;  3E7L A;  3QQA A;  1IUY A;  4I2O A;  5J1Y A;  1P4A A;  3CDI A;  4G7H F;  1LB2 A;  4UXN A;  1SVL A;  2CQ7 A;  3GCM A;  4NBQ A;  2I8D A;  4JX6 A;  3S1Q J;  1U5T A;  4IQ4 A;  1IZ1 A;  2ELH A;  2R7V A;  3JRA A;  4RB1 A;  3FDY A;  2XRN A;  3BT9 A;  3TO6 A;  2KQR A;  2V1N A;  3CO6 C;  2GBY A;  5FKO A;  3O2P E;  1ONV A;  4IHX A;  1ZRF A;  1QVT A;  1E3H A;  2VT3 A;  3AG4 H;  2OA4 A;  3DXJ F;  4HLY A;  2XPW A;  3ZR8 X;  1S7O A;  5M3M J;  1N25 A;  2CQX A;  4CYC A;  2MAB A;  5EG0 A;  3OIQ A;  3HBL A;  4N9H A;  2VJI A;  3PNY A;  3Q9V A;  3K6G A;  1Y39 A;  1SD5 A;  1V5G A;  4RAF A;  2ICW G;  2EFQ A;  4PGG A;  1NHA A;  3HRS A;  2DT7 B;  3L7W A;  1GV2 A;  2OUM A;  3CP2 A;  3EYY A;  4RA2 A;  3HHH A;  2HXO A;  1K78 A;  3ECH A;  5L3D A;  3AFH A;  3SXY A;  5DD4 A;  3I4N J;  3JAM K;  3KP3 A;  4IX7 A;  2Z2S B;  1JKQ C;  2FD5 A;  1VFC A;  2CUE A;  4P5O A;  4XK4 A;  3G73 A;  3HPG A;  1TLH B;  4BHP A;  1T33 A;  1D5V A;  3EET A;  3K4J A;  2L9R A;  1EH8 A;  4NDL A;  5C4X J;  2OQG A;  3NAU A;  2CMP A;  4M3D A;  2B9S A;  4A3L J;  3DPL C;  3QYF A;  4IRG A;  3K9T A;  2KIS A;  1MDM B;  2A5Y B;  1WRJ A;  2BYV E;  2FMY A;  1PVE A;  5FO5 A;  3PJR A;  1W5C C;  2KRF A;  3WTT C;  1LEB A;  2KDZ A;  2NNY A;  5BMZ A;  2V1X A;  3HSR A;  3N97 A;  5HS7 A;  5KK1 A;  2RNJ A;  4PGH A;  1WVR A;  3QU6 A;  4ZDL A;  3S32 A;  3MZH A;  3LSJ A;  4DBQ A;  3GO5 A;  3GFM A;  3VB2 A;  1ZHF A;  5E1W A;  3OS1 A;  2LF8 A;  3WHB A;  3K1N A;  2JWT A;  1A5J A;  3K4K A;  2HFH A;  2ZFU A;  1WHU A;  4UB6 C;  3GTP J;  3H9J A;  1GVJ A;  4AD9 A;  2DQR A;  2Z99 A;  3ABU A;  1R4N B;  2VKD A;  4WCG A;  1B9M A;  2QUF A;  3R60 A;  1HSJ A;  3DU5 A;  3BJ6 A;  3V7S A;  4OOI A;  1B59 A;  3OMY A;  3L00 A;  1D0X A;  2LY9 A;  2LOO A;  3BQY A;  2ZSI B;  1JHF A;  3MKW B;  1U8R A;  3HYI A;  4GYG A;  3SEZ A;  5HOO A;  4YFK F;  1VQK I;  1J09 A;  2GAU A;  1A04 A;  1PJR A;  1TWF J;  2HKX A;  1QPM A;  4AYB N;  4M9Z A;  4R79 A;  3CCL I;  4NC7 A;  3HRM A;  3C2B A;  4ESF A;  1YQA A;  1V4R A;  3T8T A;  2NVQ J;  4UVA A;  3U1D A;  4EM0 B;  5IP6 A;  2E1M B;  5HNF A;  5KHD A;  2FBK A;  3PNV A;  5HDN A;  2R7F A;  2IGK A;  2M2E A;  2OPT A;  2P5V A;  3TBI A;  1WH5 A;  2VC0 A;  4A3E J;  1O3Q A;  5JLX A;  2LLK A;  6PAX A;  2DU9 A;  4EM1 A;  1YW7 A;  5F04 A;  4BHB A;  5IYD J;  2V9K A;  2E36 A;  3NQO A;  1QVU A;  2STT A;  4WF2 A;  5IT9 K;  4NHJ A;  4BXX J;  2XPU A;  1K6Y A;  4KN4 X;  2LH9 A;  2M3A A;  2UUZ A;  3PO3 J;  4I76 A;  2CO5 A;  2A68 F;  2DFI A;  4MTE A;  4B44 A;  4CDG A;  2GOM A;  3O8G A;  4I6Z A;  2DOF A;  3OYH A;  1WZ2 A;  4IKF A;  1DU0 A;  2WV1 A;  2CQQ A;  4FQG A;  1TQI A;  4G9Y A;  2H94 A;  3KYL A;  3DLL F;  1VTN C;  4A3K J;  2E5Z A;  4Y33 A;  2K5C A;  4AYB A;  2M0M A;  1TW2 A;  2W4S A;  1WJ5 A;  2EFP A;  3KCC A;  3F6O A;  4KJZ A;  1WGX A;  5DTD A;  3R0A A;  5H2F C;  4OU0 A;  2VQH A;  1ZH5 A;  5D6E A;  2EV5 A;  2XGC A;  1KQ0 A;  3ASO H;  3KP4 A;  4XKC A;  4EM2 A;  2O7O A;  1S8N A;  5CQE A;  3T5X A;  3S93 A;  1SFK A;  4AWX B;  5A2Q K;  2HZD A;  3PUB A;  4KT6 A;  3DPU A;  1IN4 A;  1FIP A;  2JSP A;  4BEH B;  1B4A A;  1ZAO A;  4L5J A;  4II3 A;  2FRH A;  3E5Q A;  4XIC A;  2XAU A;  1W1W E;  3ABL H;  4Q47 A;  4CGZ A;  3B6C A;  2AQF A;  5M5X J;  4ENN A;  2X85 A;  4LJZ F;  3CCY A;  4KA4 A;  4HX4 A;  2VN2 A;  3QAH A;  4NNJ A;  5LEK A;  1FLI A;  4EGY A;  1MJA A;  4QPQ A;  4UUV A;  4XLP F;  1SD6 A;  5IPA A;  4ENM A;  3N4M A;  3GTL J;  5CVV A;  4CH7 A;  4IHW A;  4S04 A;  1QQI A;  3AAF A;  3CF2 A;  4NQW A;  3MZY A;  3RYP A;  1G3W A;  1MND A;  1ON1 A;  3DWL E;  3QPH A;  3WTV C;  3PNT A;  4A2U A;  1T0F C;  4CCM A;  3MWM A;  4LOC A;  3A01 B;  5HVQ C;  5LGT A;  1L0O C;  1UHW A;  4DW6 A;  4OIQ F;  1X1D A;  3M1C A;  2I5U A;  2EZK A;  3LSG A;  4XOR A;  4RAZ A;  3TOA A;  3DBH B;  3OV8 A;  5TJJ A;  4Y3O A;  5EGO B;  3GX4 X;  1OKR A;  4OWR B;  1SD7 A;  3SZG A;  4C3I J;  2LVS A;  3DEE A;  2L7K A;  5FLX Z;  1KQ8 A;  4IPA A;  3RJP A;  3LQR A;  5IOY A;  3TO7 A;  2XSD C;  1RET A;  3AKZ A;  4PJJ A;  3OYG A;  3D5R C;  1J2X A;  2WA0 A;  3DFG A;  4BE0 A;  2HQR A;  2M4G A;  4BDY A;  5GTI C;  1G3S A;  1OJL A;  3E5U A;  2R7T A;  4JK1 X;  1MBK A;  2MLK A;  3FF5 A;  3PIP F;  1MBJ A;  3K69 A;  5J8C A;  2BHZ A;  2WB1 N;  2BZT A;  4L18 B;  4ZTF A;  2D1V A;  1WJB A;  3G1O A;  3A0B C;  3VYU B;  1BW5 A;  2CUJ A;  3RSN A;  2NS7 A;  1YIJ I;  3KYC B;  1R00 A;  2YX7 A;  2Z16 A;  1WKM A;  1XD7 A;  1PP8 F;  1TP4 A;  3SYT A;  1ZYR F;  2HNH A;  4XM3 A;  1XB4 A;  2LTP A;  2BXY A;  2VB6 A;  2V4J C;  5BOX A;  3G1M A;  1VQ7 I;  5H6Q A;  1N75 A;  4QPO A;  4IHY A;  3W6K B;  3V42 A;  4A3D J;  1W36 C;  1MNE A;  4B3A A;  2DLL A;  1E17 A;  2ETH A;  2W25 A;  4M3F A;  1Y6I A;  4DOZ A;  3RQ4 A;  1ZRD A;  2KP6 A;  4P55 A;  3KP7 A;  1OCR H;  2Z9O A;  1MBF A;  1JTX A;  4AVZ A;  3W6V A;  2JVH A;  2MLG A;  3MKL A;  1B72 B;  4R8H A;  5IY5 H;  3RDI A;  2E1N A;  3BR5 A;  1NK3 P;  2IA1 A;  1BW6 A;  3HOZ J;  4A5M A;  2M9H A;  1TZL A;  1H88 C;  3E5X A;  1MDM A;  2LD5 A;  2YR2 A;  1USS A;  4BH9 A;  3JRB A;  2R7U A;  2JPB A;  3EUH A;  3S1R J;  1MJ9 A;  3HL2 A;  2WB1 A;  1VQP I;  3HUG B;  2NS8 A;  1WQ2 A;  5EYR A;  3JRH A;  2BW3 B;  1AKH A;  2IW5 A;  4BE1 A;  4U0V A;  3Q0W A;  3T8R A;  2L01 A;  4CCN A;  4HYE A;  2EIJ H;  1ZLJ A;  2ZME B;  4F91 B;  1IDZ A;  4I09 A;  4K2E A;  4A3C J;  3GLL A;  1ON2 A;  2W00 A;  1Y8Q B;  5DEQ A;  2K9S A;  5FKK A;  1X1A A;  3K4M A;  3JR9 A;  4LIU A;  2IJL A;  1S9H A;  3VFZ A;  1BR1 A;  2LRD A;  4KDP A;  3J80 K;  4ZTJ A;  2BY0 A;  3ZGK A;  3GVA A;  2DK8 A;  3BTI A;  3HIF A;  2A6E F;  1DDN A;  3W2V A;  2HYF A;  2VKH A;  4NC6 A;  3BZC A;  2X51 A;  5JHU A;  5E3N A;  1IRZ A;  4KN7 X;  3B02 A;  3DBL B;  2XRL A;  3FBN B;  1G6N A;  2KJB A;  3ZOB A;  4CYD A;  3BG5 A;  3S3O A;  1HBX G;  2BHY A;  3CCQ I;  2HVQ A;  2M8G X;  1RES A;  3GUD A;  1FYM A;  2JRM A;  2ZXI A;  2R93 J;  2PQ8 A;  3FZV A;  4LB6 B;  1F36 A;  3NWT A;  2DFE A;  2Z5U A;  3BCA A;  4C2U A;  4EQQ A;  1WSU A;  5CQG A;  2FOW A;  3CC7 I;  3HSF A;  2VOD A;  5FJ8 J;  1LDK B;  1JTY A;  1UCR A;  5KVR A;  2VE9 A;  3PQK A;  2WY8 Q;  2A61 A;  3F8B A;  3QPT A;  2JTV A;  3WGH A;  1LDD A;  3KP5 A;  2JSC A;  2QF7 A;  2K4B A;  3RKY A;  1BI1 A;  2EPF A;  1LE8 B;  2QQ9 A;  2RV8 A;  5H20 A;  3ZMU A;  3OYC A;  3ZP5 A;  2GLO A;  1V3F A;  5CVI A;  4C2T A;  2R7O A;  3DPT A;  1R71 A;  1YW8 A;  1SEU A;  5E3M A;  1KU2 A;  1Z05 A;  2XHK A;  1BR4 A;  5LHG A;  1X2M A;  3M9A A;  5KCM A;  5KNL A;  2NVY J;  1SD4 A;  3JCU C;  2VJ5 A;  3CJT B;  2LKX A;  3OL4 A;  1S72 I;  4IHT A;  2CG4 A;  2IGM A;  3QOP A;  2VQG A;  2WAF A;  2F5E A;  1LJ9 A;  1YOV B;  1J9I A;  1RKW A;  2ELJ A;  1G2H A;  1OFC X;  2CV1 A;  1EKE A;  4PDK A;  2F5F A;  2W85 A;  4RM3 A;  3FK7 A;  4BEH A;  3JSO A;  4A3M J;  4BQN A;  2XGX A;  1M1E B;  4BQO A;  3LSH A;  4EV0 A;  1KU7 A;  2K9Q A;  5IP9 J;  2DA7 A;  4E7I A;  1SFO J;  1OCO H;  4XLN F;  4AU7 A;  3CZ6 A;  3VPR A;  2JUG A;  2IVM A;  2CYY A;  4XOT A;  1BIB A;  1UB9 A;  3RKQ A;  2PJP A;  3HOW J;  3ZN1 A;  3KX2 A;  3R0J A;  1JXS A;  2E5N A;  2Q2E B;  1O7L A;  1R22 A;  2ME6 A;  5K7Z A;  1RPW A;  4KMF A;  1T98 A;  1Y1V J;  2KIU A;  4HX7 A;  5HDG A;  1S3J A;  2CH0 A;  4M3B A;  3GBG A;  2DMT A;  3A01 A;  1FZP B;  1I3Q J;  3U1K A;  3RPU A;  2VI6 A;  3FXJ A;  1O3T A;  5FKL A;  3BTJ A;  2GXA A;  5EGO A;  2CJJ A;  3E6B A;  1ZQ3 P;  1OR7 A;  4XKW A;  4XMY A;  3S2H J;  3JAM Z;  4XQF A;  1TC3 C;  3KP6 A;  3PFY A;  4RM2 A;  4V2G A;  3CUQ A;  3LMM A;  3RIR A;  2FSW A;  1HST A;  1XS9 A;  4RLQ A;  2FQ4 A;  4IF4 A;  2MD5 A;  3M4O J;  2CGP A;  2TDX A;  2HVS A;  4U87 A;  3IH4 A;  1IRF A;  3M8E A;  1U5T C;  4YEL A;  3WE2 A;  3C2H A;  3DEU A;  3E6C C;  2DPD A;  2DA4 A;  2GA1 A;  1W4M A;  2CW0 F;  2YU3 A;  4BQA A;  1X3Z B;  5F1R A;  3S2W A;  1LFP A;  1MMA A;  1FYK A;  3ABT A;  4PSW A;  2KPM A;  2ISZ A;  1ETQ A;  1B8I B;  1L3L A;  1POG A;  1IV6 A;  4M6V A;  2ZXW H;  1VQ9 I;  3CC4 I;  1ENH A;  1XSX A;  4E70 A;  3K7A J;  5GAD J;  3A2K A;  2VIX A;  3G6E I;  3VOD A;  3WTZ A;  2NYX A;  3S1M J;  2TCT A;  2XF5 A;  2QQ8 A;  1XSV A;  2VXZ A;  5GAH J;  3Q0U A;  5BQT A;  3PQJ A;  3LA7 A;  2DA1 A;  1T39 A;  1EH7 A;  3W3C A;  1XN7 A;  2DYR H;  3FM3 A;  1EJ9 A;  3OR2 C;  3L2W A;  4XRS A;  3L09 A;  3U2R A;  2EB7 A;  4P9F A;  1TW3 A;  3K4B A;  2H8R A;  2HOE A;  1P4X A;  4HSR A;  5LRR A;  3FXU A;  1F1Z A;  2KLO A;  4Q4Z F;  1B72 A;  1MW7 A;  2MGQ A;  3FMQ A;  5K5Q A;  2Q8K A;  5ILU A;  3NAR A;  2VQL A;  2BVL A;  3F6V A;  3C1D A;  4UB8 C;  4P1W A;  4CHU A;  5D8L B;  4XBF A;  1W36 D;  4XKB A;  1O4X A;  1W5S A;  4KNY A;  2JZY A;  2VOP A;  2L7Z A;  1IW7 F;  2K9L A;  2WC2 A;  3HUG A;  3L9F A;  1B6A A;  4AIJ A;  2PN6 A;  2BW3 A;  2DBB A;  2JPC A;  2QQA A;  3CDH A;  3CES A;  2H27 A;  4IHV A;  4A3I J;  1N78 A;  4XRM A;  1D3Y A;  4XR6 A;  5M5Y J;  3EDP A;  2MW8 A;  4DQ2 A;  3VEP A;  3FHZ A;  4AVP A;  3HOV J;  2EFN A;  1R5G A;  5L3G A;  3VSK A;  1T38 A;  1MBG A;  2I10 A;  3LSP A;  1JKO C;  2XAQ A;  5KAF C;  5DYM A;  5IT9 Z;  1SC7 A;  4PJN A;  3RPU D;  4FX4 A;  4XRF A;  1I1S A;  1LVA A;  3PSF A;  3CJN A;  3CCJ I;  3OY9 A;  2CWE A;  2F4M B;  4D7N A;  2LSO A;  3G71 I;  2HQN A;  3K2Z A;  5FFX A;  2NRA C;  2NAZ A;  4BHC A;  4B43 A;  2XGD A;  2JK3 A;  1AHD P;  4RGS A;  4A69 C;  1IV8 A;  4HF1 A;  1IRG A;  4XLC A;  1KZH A;  1W7P D;  3UKG A;  4ZZL A;  1ZEL A;  3S1N J;  4B47 A;  1FP1 D;  2VPR A;  4L9N A;  4KMU X;  1GXQ A;  2XAJ A;  2DYS H;  5JHF A;  1R6R A;  4CZZ A;  2HI3 A;  5J47 A;  4N4O B;  1WJD A;  2DAO A;  4Z6Y A;  2W7N A;  5EJC A;  2JUC A;  3KZZ A;  3HOY J;  2MSY A;  4DGW B;  2EJR A;  5CJ9 A;  4HNT A;  5LHI A;  4Q48 A;  4XSX F;  2X4H A;  2KL4 A;  2LKP A;  4EGZ A;  2FQ3 A;  2XAG A;  1HXD A;  4XN0 A;  3SQN A;  1G4D A;  1GDT A;  1Y1W J;  4CXF A;  1LE8 A;  1BBY A;  4RGR A;  2D5V A;  2ZFW A;  1TT5 B;  3DU6 A;  1EV7 A;  5J8F A;  1XTA A;  2DK5 A;  4HST A;  2XC7 A;  4LG0 B;  3C7J A;  3HC7 A;  3M07 A;  3TP3 A;  2RNG A;  3KPH A;  1K79 A;  2Z3Y A;  3I54 A;  1T2K A;  2DA5 A;  3ZQC A;  5HNH A;  2W24 A;  3BCB A;  3F8C A;  2AO9 A;  3H0D A;  4HV5 A;  2NVU B;  2XUB A;  2X0L A;  1O3S A;  1FMV A;  4KIC A;  2DO7 A;  1H8A C;  3AG1 H;  3DBR B;  3TED A;  2IP2 A;  2E35 A;  1CF7 B;  3QOE A;  3GTJ J;  2K9N A;  3FIS A;  3V8K A;  4ZDO A;  3WTW C;  3OYN A;  3NEU A;  2VE8 A;  2HDC A;  4EAT A;  4W97 A;  1D0Z A;  4FE7 A;  3LFU A;  5GAE J;  1ORK A;  4QWQ A;  2F2E A;  2PJR B;  4E7H A;  1Z77 A;  2IGO A;  1UAA A;  2OCC H;  3AG3 H;  2R4G A;  2EZH A;  2LK2 A;  3LST A;  3GYH X;  5GTH C;  1WJC A;  3RZO J;  2YSR A;  5EEH A;  1YTY A;  2F4I A;  1YJW I;  4GDF A;  1OMI A;  3H3V K;  1UHS A;  4JX5 A;  3JRC A;  3A4C A;  1E0E A;  4LGW A;  1AWC A;  3MEX A;  2ME0 A;  3ASN H;  3VOE A;  5D4S A;  4QTR A;  3MKZ A;  3E6D A;  3H92 A;  5DD8 A;  1RNL A;  2XIG A;  1RIO H;  1JKR C;  3CCE I;  3F23 A;  1G3T A;  2FU4 A;  4JX4 A;  4QLC U;  3BR2 A;  4BBR J;  5M5W J;  2VLA A;  4ON0 A;  4DNC A;  2EZI A;  4ZYH A;  2UWM A;  2P5K A;  3JW4 A;  2ZJR F;  3CCU I;  1O3R A;  2C6Y A;  1MMS A;  3F3X A;  1A6I A;  3Q3S A;  1Z6R A;  2EV0 A;  3VSL A;  4C3J J;  1S7A A;  2ISY A;  3H35 A;  3OOU A;  2FNP A;  4LMY A;  3R61 A;  1JE8 A;  1X1C A;  1VQN I;  3C18 A;  5DUI A;  1XG1 A;  1IF1 A;  3S3N A;  2E34 A;  3IV5 A;  3S2D J;  4E7L A;  1QHG A;  4G94 A;  3AL0 C;  1BI0 A;  1D0Y A;  3IP4 B;  2WY7 Q;  2LG4 A;  4ANJ A;  5LGN A;  3E6M A;  2HQA A;  1ULY A;  4PZJ A;  1U3E M;  5HOD A;  1YI2 I;  4XLF A;  5D8K B;  4KFC A;  1NTC A;  3ISP A;  3GTM J;  1FIA A;  1VQ8 I;  2ZJP F;  3ZMD A;  3Q5F A;  3H5N A;  3CCM I;  1PUF B;  2LRE A;  3FM5 A;  1V55 H;  3DTI A;  1NK2 P;  4I0B A;  2ZNZ A;  2KHM A;  4XRS G;  1XC5 A;  4ZH4 F;  4CZC A;  4BQQ A;  4GXO A;  1YX5 A;  3JSP A;  4FE4 A;  4CIC A;  3J80 Z;  4IZZ A;  5D6F A;  2VBZ A;  2H1K A;  2PFB A;  2KRH A;  2O9L A;  2J5O A;  1K4S A;  2NOG A;  3BC8 A;  3IAS 2;  3BG3 A;  4N4N B;  2K9M A;  3FWE A;  1YS6 A;  2IGN A;  2E60 A;  4LLN A;  5IT3 A;  4B8X A;  2KIQ A;  3VWB A;  1I6H J;  2PMZ N;  5F6F A;  2RKH A;  3CMA I;  1ETX A;  5BPI A;  2P5L C;  1I6X A;  3I9V 2;  1ZG1 A;  2LFB A;  4ZC3 A;  5LHH A;  2HXI A;  3J7Z I;  3KIO A;  2ELK A;  2LC2 A;  2UV1 A;  1FBU A;  2XSJ C;  4BL0 B;  4FIS A;  4PSX A;  5D5V B;  4ETS A;  2M7A A;  3WU2 C;  3EUH C;  3QPS A;  3WHC A;  3KLN A;  1P2F A;  2IA2 A;  3HDD A;  2K4J A;  5AIP A;  1XCV A;  2OAZ A;  4KIG A;  2X1E A;  3A03 A;  3EYI A;  2R3S A;  1ACI A;  3KZY A;  2HOT A;  2KZG A;  4IRH A;  3ABK H;  3I59 A;  4GYI A;  4OIO F;  4E7K A;  3TO9 A;  4HEA 2;  3DV8 A;  1PYV A;  1TWG J;  3CC2 I;  2PX9 A;  3LAJ A;  1KA8 A;  1T08 B;  1U9N A;  1ETW A;  4IRI A;  1IXC A;  4EJV A;  2JJ7 A;  3H36 A;  3ZQF A;  3LSR A;  1BIA A;  2XV4 S;  3CCV I;  2OJE D;  2PMZ A;  3HTU A;  3W2W A;  1K7A A;  2K7L A;  3M7G A;  2Y0S N;  1ZG5 A;  3C3W A;  4GO1 A;  1YIO A;  3I55 I;  5E3O A;  2LY2 A;  3KLO A;  3VYR B; 
#chains in the Genus database with same CATH homology
 4DYQ A;  2L0K A;  2R93 J;  2M34 A;  1F36 A;  1TWC J;  2E19 A;  4QSH A;  2Y31 A;  5IYC J;  3RQI A;  1ZK8 A;  1JUS A;  4QIW N;  1X2N A;  1UMQ A;  5BNG A;  4A3J J;  3BTL A;  3BTC A;  1WCM J;  5FJ8 J;  1JTY A;  3HGY A;  2JMW A;  2QCO A;  3BR6 A;  1EF4 A;  3BR1 A;  1MBE A;  2ID3 A;  5J1U A;  3SJM A;  2K40 A;  1QPI A;  2QF7 A;  2XB0 X;  1W0T A;  9ANT A;  3HKZ N;  1LE8 B;  3S17 J;  2GLO A;  4C3H J;  1D5Y A;  4JP0 A;  4D5F A;  5J3L A;  5E3M A;  1RKT A;  1X2M A;  5J1R A;  2HYJ A;  2NVY J;  2FX0 A;  4B4C A;  1AKH B;  3GTQ J;  2LKX A;  2L7F P;  3MN2 A;  5EZH A;  2E1O A;  4AUX A;  1BA5 A;  1HDP A;  2ID6 A;  4M3E A;  3D1N I;  1YRN B;  2CUF A;  3FK6 A;  4MO7 A;  1B8I A;  2YU9 J;  2DA6 A;  3JRI A;  1RKW A;  1G2H A;  1OFC X;  3DCF A;  1IUF A;  3Q0V A;  3H0G J;  3FK7 A;  4A3M J;  3JRF A;  1UG2 A;  5GPC A;  3M3Y J;  2K9Q A;  4UUS B;  1QRY A;  5IP9 J;  3A02 A;  2DA7 A;  1ETV A;  2DMP A;  1HCR A;  3GTK J;  1ZTR A;  1SFO J;  2NVX J;  3VPR A;  4BY7 J;  1TWA J;  2DJN A;  1E3O C;  2R5Y B;  2M0C A;  3RKQ A;  3HOW J;  2GM4 A;  4A3B J;  1FJL A;  2W48 A;  1MSF C;  4DYR A;  2R0Q C;  2ME6 A;  5K7Z A;  1ZR4 A;  1RPW A;  1Y1V J;  2XGE A;  2MG4 A;  3QPL A;  4M3B A;  3ZQG A;  3IH2 A;  3CMY A;  3GBG A;  2DMT A;  3A01 A;  4J19 A;  4X1E A;  1IGN A;  1I3Q J;  3FKI J;  2NVT J;  2VI6 A;  4EEF G;  2RAE A;  4FCY A;  5FKL A;  3BTJ A;  1APL C;  5EGO A;  2CJJ A;  3PO2 J;  1ZQ3 P;  4MFE A;  2Y9Z A;  4RDU A;  1JT6 A;  3QQA A;  3E7L A;  3S2H J;  2COB A;  5J1Y A;  1TC3 C;  3F0C A;  4V2G A;  5F08 A;  3GTO J;  2IBD A;  4Y52 J;  4W1U A;  1X58 A;  1XS9 A;  4JX6 A;  1AU7 A;  3S1Q J;  3M4O J;  1ETO A;  2FQ4 A;  3BQZ A;  3IH4 A;  4GFB A;  3JRA A;  1U78 A;  3BT9 A;  2DA4 A;  2GBY A;  5FKO A;  4IHX A;  2B63 J;  3L1P A;  2R92 J;  1QVT A;  1WPK A;  1ETQ A;  1B8I B;  1POG A;  2XPW A;  2KT0 A;  1IV6 A;  5M3M J;  2CQX A;  4L5E A;  4M6V A;  4CYC A;  1PUF A;  1ENH A;  5EG0 A;  3HBL A;  3K7A J;  3S15 J;  4V2F A;  3S1M J;  2TCT A;  5IP7 J;  3Q0U A;  2DA1 A;  2XB5 A;  4MIM A;  1GV2 A;  2R7Z J;  2HXO A;  4XRS A;  1ETK A;  3I4N J;  1CQT A;  1JUP A;  2H8R A;  2TRT A;  1JKQ C;  2FD5 A;  2HQ5 A;  5K7H A;  2CUE A;  4DZJ A;  1VFC A;  2FJ1 A;  5E3L A;  4XK4 A;  2EQR A;  1T33 A;  1B72 A;  2MGQ A;  2L9R A;  5C4X J;  4NDL A;  3NAR A;  3NAU A;  4M3D A;  3PM1 A;  4A3L J;  3HM5 A;  2WAQ N;  4DZP A;  1SAN A;  1MH4 A;  1O4X A;  2Y9Y A;  1OCT C;  1IG7 A;  2L7Z A;  1JJ8 C;  1ITY A;  1RR7 A;  2KDZ A;  2P81 A;  2DTZ A;  4IHV A;  4A3I J;  5K7F A;  4XRM A;  5M5Y J;  2MW8 A;  5C44 J;  2XPV A;  2JA7 J;  3LSJ A;  2N8G A;  3HOV J;  1FTZ A;  2CRG A;  2ECC A;  3WHB A;  1MBG A;  2I10 A;  2JWT A;  3LSP A;  1JKO C;  1HF0 A;  1A5J A;  2E2J J;  3GTP J;  1ZR2 A;  1MBH A;  2HDD A;  5F0H A;  4BY1 J;  2JA5 J;  3HOU J;  3TW7 A;  2R5Z A;  3RZD J;  2O8K A;  3JRG A;  1TWH J;  1GUU A;  3B6A A;  4D7N A;  4G12 A;  2OF7 A;  2DMN A;  2LY9 A;  3HB9 A;  4AC0 A;  2EH3 A;  2JK3 A;  2XGD A;  3BQY A;  2X9D A;  1AHD P;  4HNV A;  4A69 C;  1HLV A;  1MSE C;  3UKG A;  1TWF J;  3S1N J;  4AYB N;  2Y2Z A;  5F0C A;  1VI0 A;  2VPR A;  3C2B A;  1GT0 C;  5EZG A;  2NVQ J;  4MLO A;  5IYB J;  5IP6 A;  2HI3 A;  4A93 J;  2DA2 A;  2VKE A;  3LOC A;  2M2E A;  2OPT A;  1K61 A;  3HOY J;  1WH5 A;  2MSY A;  4XID A;  4A3E J;  5JLX A;  2LLK A;  3FIW A;  2ECB A;  5F04 A;  5IYD J;  5C4J J;  5F27 A;  1WH7 A;  1QVU A;  5C3E J;  2ZB9 A;  1T56 A;  4BXX J;  2XPU A;  1H89 C;  1GDT A;  1Y1W J;  1BJZ A;  3PO3 J;  4I76 A;  1Z0X A;  1VND A;  1LE8 A;  3O8G A;  4I6Z A;  2D5V A;  3SFI A;  4B1R A;  4BBS J;  4IEJ A;  4A3F J;  2DMU A;  5GP9 A;  1JKP C;  1DU0 A;  2WV1 A;  2CQQ A;  1MH3 A;  4FTH A;  4A3K J;  3TP3 A;  1FTT A;  2YS9 A;  2DA5 A;  3CDL A;  1IDY A;  3ZQC A;  1K83 J;  1ZKG A;  1WGX A;  2AO9 A;  3MVP A;  1YRN A;  5DTD A;  2XGC A;  1H8A C;  3TED A;  2O7O A;  3HGG A;  3S16 J;  3ZQL A;  4MFD A;  3GTJ J;  2K9N A;  5GPA A;  1HOM A;  3FIS A;  5FLM J;  1FIP A;  2Y30 A;  4W97 A;  4FE7 A;  4Y7N J;  4XIC A;  1ORK A;  4UUS A;  2X48 A;  2L7M P;  3B6C A;  1Z77 A;  5FKN A;  5M5X J;  2HOS A;  3CCY A;  5EEA A;  1W0U A;  2AHQ A;  5FKM A;  3HEF A;  2EZH A;  2LK2 A;  3K2A A;  2R5Y A;  2HOA A;  4C2M J;  3RZO J;  2IEK A;  5IPA A;  3GTG J;  3GTL J;  1GV5 A;  3H3V K;  4A3G J;  1UHS A;  2DN0 A;  4JX5 A;  3JRC A;  4IHW A;  2E2H J;  2X6O A;  3HOX J;  4BKX A;  2ME0 A;  5DS9 A;  3OIO A;  4QTR A;  1ZGW A;  1JKR C;  4UUT A;  4LOC A;  2G0E A;  3A01 B;  4DW6 A;  3LSG A;  2EZK A;  1BL0 A;  4JX4 A;  1MNM C;  3BR2 A;  4BBR J;  5EGO B;  5M5W J;  2EZI A;  4X6A J;  4C3I J;  3BR3 A;  2LVS A;  2IAI A;  1A6I A;  1I50 J;  1VF9 A;  3Q3S A;  4C3J J;  5IOY A;  2XSD C;  1HDD C;  3SDG A;  1RET A;  3OOU A;  1LFU P;  3JRE A;  3ZQI A;  3IH3 A;  1XG1 A;  1F43 A;  3IV5 A;  2E2I J;  3S2D J;  1JGG A;  3BG9 A;  1OJL A;  1MBK A;  2JA8 J;  1MBJ A;  3CQZ J;  3JRD A;  5HOD A;  1NTC A;  2WB1 N;  3GTM J;  1FIA A;  3G1O A;  1JT0 A;  1BW5 A;  5FLV A;  3I4M J;  2NS7 A;  3BR0 A;  4CYC B;  3OSG A;  1PUF B;  5EG0 B;  1NK2 P;  4DYC A;  3DEW A;  1DU6 A;  4XRS G;  1XC5 A;  2LTP A;  3OSF A;  4FE4 A;  3G1M A;  2DMQ A;  4S0H B;  4IHY A;  2H1K A;  1S7E A;  1Q1V A;  4RBO A;  2O9L A;  2EBI A;  1IJW C;  5EDN A;  4A3D J;  2NOG A;  2CU7 A;  3BG3 A;  4B3A A;  5F0F A;  3TW6 A;  4M3F A;  1P7J A;  1GVD A;  5F1J A;  3W6V A;  1MBF A;  1JTX A;  1NK3 P;  3MKL A;  2LR8 A;  1B72 B;  2PMZ N;  5EF6 A;  4D5C A;  3BR5 A;  1I6H J;  1ETX A;  1IC8 A;  1BW6 A;  2YUS A;  5JLW A;  5M3F J;  2M9H A;  1ETY A;  2EZL A;  2LFB A;  1H88 C;  3HOZ J;  2VKV A;  2HXI A;  2JN6 A;  2JA6 J;  2LP0 A;  2ELK A;  2LD5 A;  1R9T J;  3JRB A;  3O8H A;  1OCP A;  3S1R J;  4FIS A;  2NS8 A;  5EYR A;  3JRH A;  1AKH A;  3S14 J;  2DA3 A;  3ZQH A;  3QPS A;  3Q0W A;  4M3G A;  3WHC A;  4D7M A;  1LFB A;  3HDD A;  3A03 A;  1IDZ A;  1JJ6 C;  1P7I A;  4A3C J;  5FKK A;  2K9S A;  3JR9 A;  2HOT A;  1U9O A;  5IOZ A;  1RES A;  1U8B A;  4JYK A;  1JUM A;  1TWG J;  1U9N A;  3G1L A;  4ABZ A;  1ETW A;  1WI3 A;  3TP0 A;  3BTI A;  1FEX A;  2R5Z B;  2JJ7 A;  2VUM J;  3ZQF A;  3LSR A;  5E3N A;  1IRZ A;  3ZOB A;  2XRL A;  3BG5 A;  2Y0S N;  5E3O A;  2M8G X;  3LNQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...