1F36A

The crystal structure of fis mutant k36e reveals that the transactivation region of the fis protein contains extended mobile beta-hairpin arms
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
89
structure length
89
Chain Sequence
VLTVSTVNSQDQVTQKPLRDSVKQALENYFAQLNGQDVNDLYELVLAEVEQPLLDMVMQYTRGNQTRAALMMGINRGTLRKKLKKYGMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIS
publication title The transactivation region of the fis protein that controls site-specific DNA inversion contains extended mobile beta-hairpin arms.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transactivation region
total genus 25
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1f36A00
3LOCA 1MBEA 3O8HA 3RKQA 1HF0A 5BNGA 5DS9A 2VKEA 2M8GX 1H8AC 1OJLA 1X2NA 3GTOJ 1RKWA 5F04A 5FKNA 1OFCX 5FKOA 1H88C 2DA6A 2JA5J 2NVXJ 1ZTRA 3M4OJ 1IUFA 4A3EJ 2YUSA 1QVUA 1MBHA 1JKRC 2EBIA 1GVDA 5J1RA 4LOCA 3BTLA 3B6CA 1AU7A 1IJWC 3S1QJ 4C2MJ 1AKHB 5EG0A 5EZHA 1IGNA 1RR7A 4V2FA 3F0CA 1ETWA 3W6VA 3IV5A 1APLC 1UMQA 3S15J 1Z0XA 2HDDA 5IOYA 1ETQA 3B6AA 4NDLA 1JUPA 3HBLA 4DYRA 3JRFA 4B3AA 2W48A 1POGA 2R0QC 2VKVA 2CUEA 2QCOA 2CQXA 3QQAA 3HOVJ 2Y2ZA 4JX4A 2K9QA 2CQQA 1TC3C 5FKKA 2DMQA 5K7FA 1FTTA 3VPRA 3JR9A 3GTJJ 5FLVA 5J1UA 1VFCA 2VUMJ 2EZLA 4BKXA 3LSRA 1SANA 1PUFA 1BW6A 3HOUJ 2HXOA 4HNVA 2ID6A 2VI6A 2YS9A 4BY7J 2B63J 5IYDJ 3CCYA 5C4JJ 3GTLJ 2JA6J 1Y1VJ 2LFBA 5F1JA 2DN0A 3FKIJ 1MBJA 3PO2J 1RPWA 5GPAA 2HI3A 3CQZJ 4J19A 2X6OA 1G2HA 2LD5A 3BR5A 2PMZN 3JRDA 1WPKA 1FEXA 5FLMJ 4IHVA 2EZKA 1K61A 2E2IJ 2X48A 2IEKA 3LSGA 1OCTC 1IRZA 1IC8A 4G12A 1W0UA 1ZKGA 5HODA 5IP6A 3RQIA 3SDGA 1TWCJ 1MBGA 2M2EA 4JP0A 1JTXA 3SFIA 3GTGJ 2DTZA 2KDZA 2Y9ZA 1ITYA 2XPUA 1VF9A 1DU0A 4A3BJ 5EEAA 5IYBJ 3GTQJ 1MH4A 3Q0VA 3JRAA 2LK2A 1JGGA 2HXIA 3WHCA 2EZHA 3TW7A 2LKXA 3HOYJ 4Y52J 1GV5A 3H0GJ 4D7MA 3HEFA 4DYCA 4DYQA 1B8IA 2ME0A 4CYCB 3GTKJ 1FJLA 2EZIA 3Q0WA 2GM4A 2XB5A 2ME6A 3LNQA 5JLWA 5EDNA 2L9RA 2EH3A 2ECBA 1P7JA 3K2AA 1R9TJ 4A3CJ 5E3NA 5IYCJ 4A3IJ 2R7ZJ 1WCMJ 2LR8A 4C3IJ 3ZQLA 4QIWN 5EGOA 1EF4A 2R5YB 3QPLA 3JRCA 2AO9A 1X58A 4M3DA 5FJ8J 1IDYA 1ETYA 2K9SA 2HQ5A 1UG2A 2JN6A 1JKOC 1IV6A 2WB1N 2ECCA 5C4XJ 5FKLA 2R5ZB 3IH3A 5IPAA 2E1OA 3L1PA 3E7LA 1ZGWA 4M6VA 2JA7J 4B4CA 2FD5A 2HOTA 1U8BA 2JMWA 1T33A 2R5ZA 3C2BA 1QRYA 3ZQGA 5IOZA 2Y9YA 2O9LA 3ZOBA 4QSHA 1AKHA 2DMUA 2Y30A 2DMPA 2NOGA 3JRBA 1QPIA 3HOXJ 3S16J 5JLXA 3OOUA 3A01B 4MIMA 1WH5A 2TCTA 3BTJA 2VPRA 3G1MA 3HGYA 5F08A 3OSFA 3G1OA 2MG4A 1HCRA 1K83J 3D1NI 2M0CA 2P81A 4D5CA 1BA5A 2XRLA 2XGCA 5M5XJ 1FIAA 2EQRA 3FK6A 3JREA 2JK3A 2LVSA 4M3GA 2TRTA 2DMNA 4ABZA 2LLKA 2FQ4A 2LTPA 3GTMJ 3S2DJ 2E2JJ 4A69C 4Y7NJ 3BR6A 9ANTA 1U9NA 3HB9A 3ZQHA 1E3OC 1MH3A 1WH7A 5IP9J 3BR1A 2DA1A 4B1RA 4XICA 1TWAJ 1WI3A 2Y31A 2XGDA 3DEWA 2CJJA 3BG3A 3FISA 4XRSA 3S1MJ 1TWFJ 1JJ6C 4FCYA 1ORKA 5E3MA 5C44J 2GBYA 3ZQCA 4A3KJ 2X9DA 4AYBN 1TWHJ 3GBGA 1QVTA 1ETXA 1JUMA 3Q3SA 4W1UA 1MBFA 2E19A 3BG9A 1RKTA 4EEFG 1LFUP 4I76A 1GV2A 2HOAA 2Y0SN 3M3YJ 2O7OA 1DU6A 1ENHA 3MVPA 3BR3A 4DZPA 5GPCA 4FISA 1ETKA 4IHWA 2R93J 3JRGA 3TP3A 4BBSJ 1JKQC 1I50J 3FK7A 4A3DJ 3SJMA 5E3OA 4M3FA 4BXXJ 5FKMA 2M34A 1U9OA 3MKLA 1Q1VA 4CYCA 5EF6A 1RETA 5GP9A 2XSDC 1JUSA 1JJ8C 1MSFC 4XRMA 1FTZA 3I4NJ 2M9HA 3RZOJ 5F27A 1LE8B 4AC0A 1Y1WJ 1ETVA 2L7ZA 3HOWJ 2MGQA 3A03A 2FX0A 1MNMC 3JRHA 2HOSA 5M5WJ 1UHSA 2NS8A 1VI0A 1YRNB 3BR2A 4DZJA 3RZDJ 3I4MJ 2IAIA 2CU7A 2DJNA 3K7AJ 2R5YA 2CUFA 1BL0A 4RDUA 3GTPJ 1GT0C 5EZGA 1YRNA 3BTCA 4D5FA 5J1YA 1O4XA 1HDDC 1F43A 5F0CA 2XPVA 2ZB9A 3CDLA 1GUUA 1F36A 3FIWA 5M3MJ 2MSYA 2E2HJ 1JT6A 3ZQIA 2L0KA 3QPSA 2NVTJ 2MW8A 1BJZA 4X6AJ 2DA2A 4IHXA 2DA3A 1NK3P 3TP0A 4FE4A 3NARA 5EYRA 2YU9J 4DW6A 2GLOA 5EG0B 2JA8J 2RAEA 1A5JA 1S7EA 4AUXA 4C3HJ 4I6ZA 2DA5A 2WAQN 4MFEA 1B72B 2NS7A 2CRGA 1T56A 4W97A 2OPTA 4A3FJ 1ZR4A 3A01A 2XB0X 4A93J 1WGXA 4M3BA 1ZR2A 3MN2A 2D5VA 2O8KA 4UUTA 1B72A 1NK2P 2K40A 2DA7A 2DA4A 2XGEA 4FTHA 3HOZJ 3PM1A 4UUSB 3HGGA 4QTRA 2JJ7A 2JWTA 2LP0A 1IG7A 1CQTA 1I6HJ 3S14J 1PUFB 4UUSA 4JX5A 4JYKA 3TEDA 2WV1A 2H8RA 1P7IA 1AHDP 4XK4A 2L7FP 2QF7A 3BQZA 1HOMA 4BY1J 1ETOA 4V2GA 3NAUA 1I3QJ 3CMYA 4XIDA 3A02A 1GDTA 3ZQFA 5IP7J 4MO7A 5M3FJ 4IEJA 4A3JJ 4A3MJ 2ELKA 3OSGA 4GFBA 1HDPA 1NTCA 3HDDA 3OIOA 3S1RJ 2NVQJ 1XS9A 3BT9A 3LSPA 1JKPC 4JX6A 1JT0A 5M5YJ 1U78A 1Z77A 3TW6A 3JRIA 3O8GA 1JTYA 5K7ZA 2ID3A 3IH2A 3UKGA 4MFDA 3S1NJ 3IH4A 3PO3J 3S17J 4XRSG 3HKZN 2KT0A 1XC5A 1MSEC 2I10A 5K7HA 5F0HA 1D5YA 3BR0A 1H89C 4M3EA 1OCPA 2L7MP 5J3LA 4IHYA 2K9NA 3BTIA 5E3LA 1IDZA 4S0HB 2NVYJ 2AHQA 1ZK8A 2XPWA 3S2HJ 1RESA 2HYJA 3Q0UA 4C3JJ 1VNDA 4X1EA 4D7NA 1B8IB 2G0EA 4BBRJ 3G1LA 1HLVA 1MBKA 1LFBA 3H3VK 1A6IA 3BQYA 1X2MA 4A3LJ 4L5EA 3DCFA 2FJ1A 1SFOJ 1XG1A 2H1KA 2N8GA 2DMTA 1FIPA 5DTDA 4MLOA 3BG5A 1LE8A 4RBOA 5F0FA 2LY9A 4A3GJ 3HM5A 2R92J 1TWGJ 5C3EJ 2COBA 1W0TA 1BW5A 2OF7A 3WHBA 5EGOB 2IBDA 1ZQ3P 4FE7A 3LSJA
chains in the Genus database with same CATH superfamily
1REPC 2KISA 3O8HA 3HSEA 1XD7A 1HA8A 2XF5A 1FBUA 2VC0A 1VQ4I 2VKEA 4E70A 4OIQF 1UCRA 2M3AA 4ENKA 2DYSH 2V4JC 3VWBA 3GTOJ 4HX8A 2FF4A 1QZEA 1TL8A 2DA6A 2RQQA 2BY1A 3HRUA 1BOAA 3W2WA 1MJAA 1ZGJA 1IUFA 3CP8A 2A68F 4ZTJA 2F4IA 1YOVB 3TO6A 3K6GA 3VYUB 1MBHA 4L9VA 3MKWB 2JRMA 3B6CA 3HRSA 1AU7A 1IJWC 1N25A 2KFDA 2KIMA 3QWLA 5DM6F 1YLFA 5EZHA 3CCQI 1RR7A 4V2FA 2PMHA 3LSKA 3W6VA 1S3JA 1APLC 2LOOA 2P6SA 1P6RA 1Q1HA 3EDPA 2BOLA 2ZNYA 4NDLA 1NH3A 1X1CA 2EFPA 1EA3A 4BAYA 1WKMA 4LK1F 4IQJA 2CQXA 1R5ID 3TQNA 2XAFA 4JX4A 4LK0F 3GZ6A 2V79A 1V54H 1TC3C 2DMQA 4HX7A 3AAFA 3VPRA 4EV0A 2DAOA 2ESNA 2VUMJ 3KEOA 2KDOA 1VFCA 2O5RA 2M7AA 1AA7A 3RCOA 1BW6A 2HWVA 4HNVA 3L2VA 5B1AH 3EUKL 4BY7J 2YS9A 2E1MB 5HNFA 3CCYA 5J4VA 3HTUA 1WFXA 1HW5A 2Z99A 1WWXA 4HG2A 3ESWB 1IXRC 4XLEA 3GX4X 3ZMZA 2DN0A 2P7VB 3GVAA 4KIGA 3PO2J 3K1MA 2HI3A 3Q5FA 4JBAA 1T39A 2RQPA 4IHVA 2EZKA 4ENJA 1T8IA 4OIOF 3ERMA 2LY2A 3JTGA 2XF6A 4BJTA 5HODA 2Q1ZB 2RDPA 1FOKA 4YEJA 2PN6A 1TLHB 1UZCA 2F6CA 2M2EA 4XBFA 4A6DA 3ULQB 3CUQC 3SFIA 4KNYA 3ISPA 3VODA 1OKRA 3HTSB 4DJAA 1VF9A 3U21A 1DU0A 1PUEE 2CQKA 1ZRCA 4A3BJ 2PX9A 1Z05A 1YO5C 1MKMA 3GTQJ 1WJAA 5H6RA 3VYRB 5FO5A 3PNTA 4RGUA 2LH9A 3OL3A 3TMOA 3BJ6A 4UV9A 2XIGA 4N0BA 4WXDA 1XDUA 3H0GJ 2IP2A 1G4DA 3SDBA 4D7MA 3HEFA 3ABKH 5HLGA 3OYMA 2IS1A 2ISYA 1B8IA 2ME0A 4CYCB 3BC8A 5LRSA 3R4KA 5FROA 3DTIA 3H92A 2GM4A 2ME6A 2OQGA 1QA6A 1WJCA 1YFHA 3KETA 2XKOA 3RKYA 5EDNA 4UVAA 2JTVA 3K2AA 5J47A 3Q9SA 1R9TJ 2K02A 4FHTA 4XORA 3H9QA 1ZYRF 5AONA 2OUMA 3M1EA 4O3MA 3QYEA 1TT5B 5GTIC 2LDUA 3CCLI 4QIWN 3ZQLA 3JTHA 2HZTA 3OYKA 3QPLA 2P6TA 1XDSA 2ZJRF 2K9SA 5LEJA 2H09A 2HQ5A 1WJDA 3WTXC 1UG2A 4L5IA 3HG9A 4BH9A 2WB1N 4CYDA 4EJUA 5JHUA 2WBMA 4XKWA 4ZDLA 2OQRA 3IH3A 5IPAA 2E1OA 4HDUA 2OTJI 3LSHA 1TQIA 4RGXA 3LSIA 3LAJA 1T33A 5IOZA 3FBIB 3K4JA 4R8HA 3ABLH 4B44A 2M45A 3MZ8A 3HOXJ 2CW0F 4RLFA 1Z7UA 3SZGA 3A01B 4BUPA 3LQRA 2JSCA 4M74A 1NG7A 2X85A 2QZ8A 2VPRA 5FFXA 4U7BA 3HIFA 4D5CA 1HXDA 3DPTA 5FLXK 1VQLI 2CFXA 2XRLA 2Y48A 2NOJB 5E1XA 5JHFA 3GXOA 4CCKA 4XMYA 3IAM2 2MA3A 1C0WA 2CWEA 1R58A 4P9UA 4RLQA 1CGPA 3EUHC 1IN7A 4ABZA 3GF2A 4KISA 4YG2F 2F5FA 1LB2A 5EEHA 3NQOA 1OCCH 1FP1D 2RV8A 4EM0B 4RGRA 5F6FA 1D3YA 4PGGA 2Q8KA 3S8PA 2XF7A 3PNYA 3ZMDA 1FWZA 3HB9A 3ZQHA 3T1BA 3RKWA 1E3OC 2HVSA 2Z33A 1AOYA 4WXHA 1MH3A 4PJNA 3SEZA 4B1RA 1YG2A 1RNLA 4QWQA 3F6VA 4CCOA 4IZZA 1WI3A 2K3FA 2XGDA 3OIQA 4PK4A 2ZJPF 3T8TA 4XRSA 3S1MJ 1WI9A 3IRQA 4HSRA 5TJJA 1ORKA 2JVHA 3VB2A 3EETA 4A3KJ 5JFRA 3ZGKA 3FMRA 1TWHJ 5CVJA 1QVTA 4V19K 2CMPA 3BG9A 2E19A 1RKTA 1T0FC 2VB6A 1LFUP 3KP6A 3CJQB 2MD0A 4AIHA 5LGUA 1K6YA 2KRHA 2R93J 2LBFA 1D5VA 1FBQA 4XLNF 4EJWA 1XSVA 3K10A 3QAHA 3U1KA 3FK7A 3BZ6A 3M8JA 3SJMA 2EA4A 2RKHA 4M3FA 3IWFA 4I09A 4IOAF 1W7PD 2DK8A 2F4MB 3DQVC 2XKPA 3FHZA 2TDXA 2MABA 5EF6A 1JUSA 1BI2A 4RB2C 1JJ8C 2LMDA 1D8KA 3WTYC 4I2OA 4E7JA 2WAEA 4R1HA 3RZOJ 2X6XA 2M87A 1TNTA 1XMXA 1P2FA 3RPUD 4B09A 1PP8F 5HDKA 4RB1A 1B6AA 3FXMA 5D6EA 1P9QC 3J81Z 2R7VA 2A61A 1W5CC 2ADUA 2HOEA 2CQ7A 3A1YA 3I4MJ 2IAIA 3R60A 2IJLA 2DFFA 1KQ8A 3K7AJ 2CUFA 3GMEA 4RDUA 1GT0C 1TT0A 3E5UA 3GZNB 5LFAA 4RA2A 3CDLA 3AG4H 5K1YA 2JSPA 1GUUA 2GXAA 2X51A 4MGRA 3K4KA 1YI2I 2FMLA 2CUZA 2WY8Q 2Q2EB 1VQ5I 5F64A 4KMFA 4X6AJ 1YW9A 4O6JA 1U3EM 2DA2A 3TP0A 2FBHA 1FPQA 1MDMB 2VQHA 4C3HJ 2A5WA 2DA5A 3I3LA 4C2TA 5KAFC 1OYYA 1W5TA 3KP5A 3JAMK 1BR4A 3QOEA 1IRXA 2ZXHA 5FRMA 2CRGA 1USSA 4W97A 3DBLB 1R1VA 2E7XA 4AWXB 1ZR4A 2XB0X 1WGXA 1A6QA 1ZR2A 3MN2A 4U7DA 1ZH5A 2O8KA 4RAGA 1NK2P 2K40A 2H6BA 2XGEA 2K27A 3RI4A 2DPUA 2Y75A 3AFHA 3I56I 3RPQA 1XCBA 3HGGA 1ZLKA 4PDKA 4Y4RA 1QU3A 3X2QH 2JJ7A 3DWLE 4IXAA 1VZ0A 3W6JB 1IG7A 6PAXA 2VKDA 1I6HJ 1PUFB 4Z2YA 1Y39A 3V8JA 1L0OC 3CC2I 3KLOA 4JX5A 2ACJA 3OYGA 2HYFA 4XK4A 3O2PE 1R4MB 1WVRA 5TRDA 4V2GA 3H3ZA 1OCOH 4HPQA 2M4GA 2P5KA 1IF1A 5FFZA 4XSXF 4GDFA 5IP7J 5KVRA 3IC7A 4A3JJ 1HDPA 1NTCA 3HDDA 1OCZH 3OIOA 4YIIA 5H6QA 3CD6I 4CUGA 4P1WA 4CSWA 5CJ9A 2NVQJ 3LSPA 4LLGF 4JX6A 3G3ZA 3KZIC 3K4BA 1HKQA 5LLQA 4G7HF 3S3MA 2G7HA 1U78A 2IA2A 4GO1A 5K7ZA 2ID3A 1OR7A 1OR7C 2RNJA 1QBJA 5L3GA 1ZG3A 2OJED 1K4TA 2IRFG 4M9XA 1CF7B 1G3TA 1MGTA 3FZVA 3GFLA 3K4NA 5AIQA 5J3LA 2R7DA 4S0HB 2PJRB 3QPHA 3CF2A 2VJJA 3RDIA 2XPWA 2YPRA 4AYBA 2HYJA 2FRHA 4AD9A 2IPQX 3Q0UA 1VNDA 2QBYA 4CHUA 1FOYA 4Y15A 4NB5A 1XSXA 3I54A 3G1LA 3OS0A 2QEXI 2Y0SA 1LFBA 1OQYA 4NQWB 4DGWB 2W82A 3IHUA 2DXIA 5J40A 1X19A 3GFJA 2W85A 2DMTA 4BE2A 1MIJA 3DPUA 2Z16A 1LE8A 2EILH 1LVKA 2KLOA 2XAGA 3HM5A 4KIFA 1TWGJ 1P4AA 2BYVE 2V9PA 3SXYA 4F3QA 2CG4A 4IF4A 3WHBA 2IBDA 2MBFA 4GYGA 4IJAA 4ZZDA 4XKBA 5ICCA 3F6OA 3CF5F 5TGTA 1MBEA 2B7EA 1BIBA 4ZYAA 2M5WA 4XLCA 5CVUA 1XX5A 2R7RA 5FKNA 5FKOA 1H88C 2NVXJ 3R0JA 1XMAA 4ZH4F 1QVUA 3ERED 2E1NA 3K2ZA 5DCMA 1ONVA 1JKRC 2EBIA 2HQRA 3ZXSA 2BW3B 5LBQA 4LOCA 3WODF 1STZA 3TL4X 3E5XA 3S1QJ 1FYKA 3S3OA 3WTWC 5EG0A 1I39A 4MTDA 3I55I 4IKFA 3F0CA 3ZMSA 2K3PA 4H0EA 3G4SI 3ZMUA 1MMDA 3MD2A 4H4KC 1Z0XA 1Y0UA 4OU0A 1ETQA 2IS6A 1JUPA 1K78A 2OTLI 3DP7A 4L9NA 4GXOA 3T8RA 1R36A 2R0QC 2R7XA 2QCOA 3PQJA 5HLHA 1OLTA 3WGGA 2K9QA 4FT8A 4PFPA 2UZKA 3F22A 3QODA 5K7FA 1FTTA 3JR9A 1MMSA 2QUFA 1WJBA 4BKXA 4F55A 3AL0B 4II3A 4XN0A 3LSRA 2HS5A 4EJTA 3E0JB 3HOUJ 2O6GE 4XLAA 2EFNA 2BGCA 4S05A 5C4JJ 2DTRA 5DM7F 1ZARA 2HPIA 2MFZA 2LFBA 4UY8I 1UAAA 2E1MC 1FBSA 1MBJA 5GPAA 1FYLA 1HQCA 4XN3A 4XNFA 4J19A 4FX4A 3O6BB 2ZXJA 4HDVA 1WPKA 1R4NB 4L9TA 3JW4A 2BXZA 1XGOA 2A05A 2XAUA 4XLPF 2MH2A 1OCTC 1XCVA 1IC8A 4G12A 2BY0A 2C6YA 2W57A 2QSHX 5IP6A 3RQIA 1N78A 3G73A 1TWCJ 1K6OA 4EQQA 1MBGA 3GUDA 1JTXA 4A12A 3JCUC 4ESFA 3JAMZ 4NNJA 2Y9ZA 2A5YB 3GYHX 4ZC3A 2QKMB 3HRTA 5EEAA 5IYBJ 3Q0VA 3JRAA 2E34A 4KUMA 4CZZA 2LK2A 3F8BA 1IN8A 1KA8A 2EZHA 4I01A 3HHGA 5ILVA 3E6CC 1FSEA 1GV5A 4BEHA 4KICA 1LFPA 2MD5A 4XLHA 1QGPA 2GXGA 3GTKJ 3KEYA 3IL2A 3KP7A 2GA1A 2XB5A 2NVUB 3LNQA 5JLWA 2CYYA 2XRNA 3DPLC 4NC6A 2PJPA 4GYIA 4AIDA 3RIRA 2L9RA 3C18A 2ECBA 4L0YB 2L2OA 4IO9F 3A2KA 1T08B 4N9IA 5J6XA 4A3CJ 2QYOA 4ENNA 4MEXF 5DEQA 3L09A 3FXOA 4R79A 5EGOA 3WG9A 4UB6C 2AO9A 3H0DA 4L18B 3HUGB 3OV8A 3OL4A 2V26A 2MYSA 3KE2A 1ETYA 2E60A 1FOWA 1YS6A 1S8NA 2JN6A 4BS9A 1R6RA 4AIKA 2BXYA 2F5EA 2K5CA 3DTEA 5HDGA 1KGSA 3G2BA 4M6VA 3AKZA 4A5MA 4LB6B 2FD5A 2HOTA 3CLOA 2JMWA 4C9YA 2LC2A 5GAGJ 3DBHB 1SFEA 4FETA 1AKHA 2KP6A 2B9SA 1ERDA 3HPHA 4I99C 2NOGA 2EV0A 2JZYA 1QPIA 3ZPLA 1E3PA 3SYTA 2PMUA 3MQ0A 1A04A 5ICFA 1Y8QB 1RC9A 3FF5A 2WC2A 1Z91A 2O8XA 2ZXIA 3BTJA 3HGYA 3OSFA 2K4BA 5BMZA 3G1OA 2MG4A 4EGYA 2R7SA 3K4LA 1T98A 1K83J 5B1BH 2P81A 5LRRA 3PIPF 3J7AO 4PJJA 1IV8A 3OYBA 4PJMA 5CQEA 2XGCA 4M9SA 1J09A 3M07A 1D1BA 2VN2A 3QP5A 5CVVA 2FBIA 2STTA 3HOTA 1WRJA 3E97A 3DEEA 3WTTC 2HDWA 3ZCOA 3S2DJ 4RB3C 2EIJH 2R7FA 1BOBA 4Y7NJ 2ELHA 2M1BA 2DT5A 3BR6A 3I53A 1U9NA 9ANTA 2MLGA 3FXLA 1ZG1A 2NYXA 4LLNA 1I3AA 5IP9J 4AVZA 4KN7X 1DUXC 1D8JA 5CYVA 2KIQA 4XICA 3PFYA 1ZRDA 2OA4A 4I7HA 4OINF 1H9TA 4UVBA 1GXQA 4E7LA 4OMYA 1TWFJ 2VBYA 5HLTA 4LB5A 2XAHA 3J7AY 2QQ9A 3CUQA 5DDGA 5DCFA 2HYGD 2LNBA 3GBGA 3PNVA 3S2WA 1SD4A 3GWZA 5D4SA 1Y6IA 3K70D 3E3VA 2PMZA 4HV5A 1F9NA 2HNHA 2RVCA 4G6DA 1BJAA 2CW7A 4I76A 4MTEA 1GV2A 2HOAA 1Z67A 2OZ6A 2MC4A 2RNGA 1HSTA 3MVPA 2GXBA 1ETKA 1LDDA 2WTEA 4IHWA 3JRGA 2VT2A 2ETHA 1ULYA 3TP3A 4CCLA 4BBSJ 2KIUA 1TQMA 3P9KA 2FU4A 3MFKA 1R71A 3ZR8X 4C2UA 3MWMA 5CVRA 1S29A 3E5QA 1JXSA 2JT1A 4L5JA 1B4AA 3OS1A 2ZMEB 1HBXG 2UXNA 3K70C 3J7ZI 3MZHA 3CLQA 3MKLA 3EQLF 4LMYA 1RETA 3H9GA 1UHWA 2LREA 2VBZA 3DEUA 1Y1WJ 2NAZA 2L7ZA 3K1NA 2COMA 3HOWJ 3RTRA 1DPUA 1B1BA 1MD0A 3ML6A 3JRHA 2HOSA 2NNNA 3C7JA 1LVAA 3BR2A 5HVQC 3P9IA 3RZDJ 3ZN1A 1S72I 3OS2A 2KL4A 3IUOA 3VDXA 2ZSHB 2DO7A 2R5YA 4G6TB 2DFEA 1L3LA 3BTCA 5KCMA 3RQ4A 2P5LC 3Q9VA 1S7AA 5HOOA 3CESA 2XPVA 5HS7A 3I59A 2FUG2 1TW3A 3MCZA 3LWFA 2E2HJ 2X4HA 1R23A 2MW8A 3CUOA 4IHXA 2DA3A 2LF7A 5K5RA 1NK3P 3FXRA 2L9VA 4BE1A 3QU3A 1SFKA 4CH7A 2D2WA 2YU9J 5LHIA 1A5JA 1F1ZA 1Y0NA 2RAEA 3S32A 2JA8J 2X1EA 1XGNA 3FX3A 2H1LA 3GEZA 3UNGC 3LA7A 5LD2C 2OBPA 1B9MA 5LGNA 1XTAA 2F5VA 1QQIA 2KJBA 2DQRA 1R1TA 4MFEA 1SEUA 1SD7A 5FD6A 2NS7A 3HYIA 3HSFA 1O3SA 4A3FJ 2A07F 3EYIA 4P55A 1G3WA 2O03A 1YHQI 2MLKA 2VIXA 5FGMA 4A93J 4OAYA 1Z6RA 1OCRH 2D5VA 5D6FA 1BC8C 2M7BA 2DA7A 3KX2A 3CZ6A 2DI3A 2HZDA 2W24A 4UUSB 4U0YA 2XSJC 3TDZC 3GLXA 4ZDPA 5KHDA 2R7UA 5ICEA 2KRCA 3EUHA 3KCCA 4ITVA 3EUAA 4HLXA 3S14J 2L9SA 1WQ2A 2GQQA 2FE3A 4JYKA 4XSZF 5E17F 3PSFA 2K86A 4Q48A 3KYDB 2CFOA 1HOMA 1WJEA 3BDDA 4G7ZF 3NAUA 5JI6A 2OCEA 5ILUA 3CMYA 4XIDA 3A02A 2KZVA 4U87A 1VQKI 3KLNA 1X3UA 2W7NA 4RAFA 2EWNA 2QM3A 5M3FJ 4BDYA 2L3DA 2ELKA 2JUGA 3GFIA 3OSGA 1QPMA 3E6DA 3OOPA 4PJ0C 2KPMA 2YR2A 3QP6A 1MZBA 3CCJI 2X1CA 1JT0A 4BQNA 5M5YJ 1BC7C 1MNEA 3PUFA 4U88A 3LA2A 3IH2A 4RAZA 1T0FA 2LKSA 4CO8A 2VQCA 1ZREA 3PO3J 2KKOA 3HC7A 1XC5A 1FMVA 3MZYA 1FYMA 2DODA 3CMEI 1MMNA 1MSEC 1DDNA 2I10A 1ON2A 2QSFX 4Y17A 4BXUA 1D5YA 2HEOA 5IT9K 2STWA 4M3EA 3F3XA 4Q47A 1OCPA 4IHYA 1IDZA 2PG4A 2EPFA 2K4JA 1FP2A 1RESA 4PGHA 2BE5F 3VSKA 4UNOA 3J80K 3H5NA 5EEGA 3CJTB 1O3QA 4X1EA 4D7NA 1RRJA 2QSGX 1B8IB 4RB0A 3L2UA 1HLVA 3H3VK 2EIMH 4L5EA 3DCFA 3FXQA 3KPHA 4HV6A 3JSOA 2N8GA 1FLIA 1FIPA 1JHFA 5DTDA 4XKCA 1SAUA 1X1AA 3BG5A 5LEKA 4PSXA 3IKTA 1W7PA 1U5TA 1U5TC 2R92J 4ASNA 2VE9A 1VQPI 3ROUA 1W0TA 1QZYA 3ABTA 1IN4A 2VL8A 2M8EA 4KITB 2HGCA 1PJRA 2WAFA 2AXTC 1WHUA 3ZP5A 3LSJA 3LOCA 4YRVA 3L2RA 2MH9A 5DD4A 3RPUA 3RKQA 1HF0A 5E8IA 4Y33A 2M8GX 4IOCF 1H8AC 1OPCA 1MJ9A 2XDVA 1RKWA 3O3KA 4KJZA 2VQLA 3U2RA 2JA5J 1ZTRA 2F2EA 2F48A 3CCMI 5GAEJ 2YUSA 3C3WA 1KONA 1XMKA 4A0YA 4KFCA 4HF1A 2P8TA 3TOAA 4F92B 3BTLA 1DP7P 3PJRA 3ZMTA 4C2MJ 1B9NA 1J0RA 1FZPB 1RR8C 1KU2A 1IGNA 1ETWA 4MQ9F 3OWTA 2VQGA 3IV5A 4HOBA 1UMQA 3S15J 5IOYA 3OYCA 4HEA2 1U0JA 3EPZA 3HBLA 4DYRA 3JRFA 4HSTA 4B3AA 1W36D 2JUCA 1ODDA 3QQAA 4PJLA 3CMAI 4XLFA 5FB2A 1AWCA 3MMYB 1F5TA 2WAQA 2VKHA 4KT5C 3V7RA 5FKKA 2GOMA 1F4KA 3WE2A 4PZJA 2XVCA 3ZN0A 4DNCA 1QNTA 4EJOA 1Z6TA 1SANA 2HXOA 5KK1A 2OC6A 3CTAA 4N4NB 2VI6A 2CV0A 2B63J 4F91B 3H36A 4Y3OA 2VLAA 3AL0C 5FRNA 3BLYA 2V9VA 3BG7A 1VQ6I 2DJIA 1Y1VJ 2EV6A 4OWRB 1ZAOA 3IKVA 4WK8F 3FKIJ 1XSDA 1ZN2A 1P4WA 1V3FA 2X6OA 3VFZA 2LD5A 3BR5A 1G2HA 3UR3C 3JRDA 2OAZA 5FLMJ 3DU6A 1UHMA 2IEKA 1I27A 2BZTA 1IRZA 3GW2A 1S6LA 1UFMA 4BACA 4HF2A 2JRTA 2Q0OA 2VONA 2D1HA 1R7JA 3DXJF 4LD5A 1K7AA 3F8FA 2AQEA 4BJ6C 1IXSB 4JP0A 2CO5A 3VYSB 3GTGJ 2KDZA 2JQ7A 2Z3YA 2XPUA 3ZRGA 2QVOA 2JPCA 5FLXZ 2LBFB 4U0WA 4CA0A 3HZJA 4QLCU 2J5PA 3T0YA 1D0YA 1HC8A 5H2FC 1N77A 5HS9A 1Z1DA 1OYIA 3ABUA 1JGGA 2HXIA 3WHCA 2LKXA 4GGGA 4B3XA 3ECHA 1WSUA 4DYQA 5A2QK 1FOXA 4BYYA 3U1DA 1XGMA 4BJ5C 3V7SA 2EZIA 3OYEA 2V1UA 2W00A 3A0HC 2RN7A 3SHFA 5E1WA 3OYLA 3AG3H 2EFOA 2VJ5A 3KIOA 3CDIA 1OMIA 1P7JA 2NRAC 3OYHA 4KIBA 4A3IJ 3F23A 2D45A 1LEAA 1EF4A 1J5YA 3DKXA 4KDPA 3JRCA 1QHGA 1X58A 1PP7U 2B0LA 1KQ0A 3P9CA 1IDYA 5FJ8J 4HYEA 4A0XA 1YITI 3HJEA 2QGUA 4UHTA 4EMSA 4L9JA 4IPAA 5E1ZB 2EV5A 4ANJA 2QLZA 1Z21A 4ON0A 2KQRA 4ZZLA 5C4XJ 4E6KG 5FKLA 2R5ZB 3L1PA 1ZGWA 2IT0A 3VEPA 2BY3A 4LITA 1S9HA 3WTZA 2DT7B 2JA7J 4N9HA 4B4CA 1U8BA 1T6SA 3R6SA 1R1UA 2CV2A 2Y9YA 4HA8A 1PDNC 3DTKA 2O9LA 2V6EA 4QSHA 1E3HA 1YYVA 3FHNA 5LHHA 2Y30A 4GRIA 4WX9A 3JRBA 3ZQQA 3D5SC 3M7GA 3S16J 2DBBA 1U2WA 3V8KA 3OOUA 3A0BC 5JR3A 4MIMA 3DFGA 4G7OF 2HPMA 5D8LB 2L5QA 1TBXA 2OU2A 3G1MA 2VPLA 1BM9A 3WU2C 1KQ9A 4F7ZA 4HNUA 3KFWX 3D1NI 2V1DA 2L02A 1HCRA 1MMAA 4M72A 1E2XA 1EJ9A 4CGZA 3E6MA 4KT6A 2UXXA 4LJZF 2UUZA 3P5JA 4JQFA 2HVQA 4LG3A 3FK6A 4LGWA 3JREA 2LVSA 3FM3A 2Z5UA 1O3TA 2PQ8A 3LSMA 3OR2C 1MNDA 2FQ4A 2LTPA 3IP4B 2WADA 4M6YA 3TBIA 3TDUC 2E2JJ 2W4SA 1Y8RB 3ASOH 4A69C 3DLLF 1GXPA 2GZWA 2VBWA 1O7LA 4GCVA 2ZSIB 2P4WA 2HR3A 4E7KA 2DA1A 1ZLJA 2ZC2A 2BHZA 4XR6A 2M4KA 2VODA 2JPBA 3DEWA 2CJJA 1YTYA 3BG3A 2XGXA 3QRFF 3S93A 3KP3A 5C44J 2GBYA 4EVIA 3K9TA 2H6CA 2X9DA 4AYBN 2ISZA 1ETXA 4W1UA 3CC7I 1ACIA 1MBFA 4NC7A 3FXKA 3FWEA 4EEFG 5CVIA 2Y0SN 3M3YJ 1ENHA 4LIUA 2W25A 3V4GA 2DFIA 1G3SA 4NUBA 5HS8A 3MEXA 2K9LA 3ONQA 1JKQC 3FDYA 1DGRM 4LIVA 4QPOA 4A3DJ 2QBYB 4C30A 5E3OA 4ESJA 3OYIA 2FNAA 1YW7A 5FKMA 1YJNI 3M9AA 1V4RA 1VQMI 2M34A 4BQQA 1KU9A 1V5GA 1Y56A 4IL6C 4CYCA 4XQFA 4Z6YA 4NBQA 5GP9A 4BGDA 2XSDC 3N4MA 1MSFC 3GCMA 5BS6A 5HNHA 1FTZA 2ZMEC 3J7YJ 1LE8B 4RAYA 4AC0A 3TGNA 1ETVA 1J75A 2VOPA 4LFUA 2BBYA 2FX0A 3I4PA 2EB7A 2O61A 5M5WJ 1I5ZA 1UHSA 2NS8A 3D5LA 1YRNB 5B66C 1T95A 3QYFA 3BG6A 3FKJA 3WTSC 2G7UA 1BL0A 4LG0B 2A6TA 5BOXA 5EZGA 3G71I 4Q5SF 1WJ5A 3C1DA 4UV8A 3HPGA 1O4XA 2K7LA 3CP2A 1DQUA 3LL7A 4IHSA 4CICA 5L3EA 2FSWA 3N97A 3M1CA 4XOTA 5DYMA 2MSYA 1JT6A 2L0KA 1EV7A 4KA4A 1MMGA 3WTVC 3B73A 2IW5A 5DUIA 2NVTJ 2X1DA 5DCMB 1YJ9I 1X4OA 2EA2A 2R7OA 5CPRB 3NARA 1BN5A 5EYRA 1BI3A 5EG0B 1LDKB 3FM5A 2GLOA 4BNCA 2PLYA 1S7EA 2WB1A 3CCUI 1A31A 3L2WA 3M8FA 4DOZA 2DPDA 1JGSA 2EFQA 1PYVA 2LY1A 3U9GA 1FY7A 4OOIA 3BWGA 2AQFA 2BVLA 2R7QA 1B72B 1X4PA 4XM3A 2OPTA 5A2QZ 1K78B 2R7TA 3A01A 3B02A 1XPXA 3DKYA 1O7FA 1YS7A 3I64A 2QQ8A 2WY7Q 3L00A 1G59A 3COAC 5J4YA 5D5WB 1RIOH 3OYFA 4RM2A 4XRFA 3OR1C 1GHCA 2PBIA 5HDNA 2JWTA 2HKXA 4M9ZA 2I8DA 4UUSA 1FMWA 2WV1A 2H8RA 1P7IA 1DPRA 1LQ1A 2YX4A 1YIOA 1YE9A 2IGMA 4FX0A 3BQZA 4BY1J 1BR2A 3BZCA 4EGZA 1I3QJ 3BOQA 1WJFA 4ZJZA 4WWCA 1WZ2A 1IRGA 4UVCA 3C2GA 3ZQFA 2KJCA 4RS8A 1NHAA 4IEJA 4A3MJ 4GFBA 1I1SA 4HBLA 2CUJA 3BJOA 3BPXA 1GLNA 3J81K 1TTYA 3VYTB 3CMMA 2Z9OA 2X0LA 5GTHC 2ELJA 1XS9A 1JKPC 1KZHA 2GIVA 2ZJ2A 1DGWY 3ELKA 3CCVI 1LUJB 1Z77A 4UXNA 3NRVA 3O8GA 1JTYA 2BY2A 3UKGA 1H9GA 3GLLA 3K0LA 4UB8C 3F72A 3S1NJ 2HU9A 3IAS2 3KP2A 2ZFWA 4EATA 3QYBA 3S17J 4XRSG 4A6EA 4F93B 4WCGA 2KT0A 1SMYF 5ICGA 1X1BA 1D0XA 3CCEI 5K7HA 3GO5A 2L7KA 4HX4A 2LSOA 3LAPA 1GVJA 3BR0A 1SFUA 1H89C 2H27A 3OYNA 4DQ2A 2BHYA 1IW7F 2K9NA 5E3LA 3L7WA 2KMUA 2AHQA 1Z7LA 3ASNH 2ZBKA 1S5LC 1OYWA 2CW8A 3BZKA 3IWZA 4CCJA 1J59A 2F4OB 1B59A 1D1AA 3SEQA 2GIZA 1VQ8I 4BDZA 2EIKH 3DBRB 4BEHB 1TNSA 3CJRB 2QA4I 4PFOA 1BIAA 2G0EA 4BBRJ 1MBKA 5L3DA 2A69F 1FT9A 1QHHD 1X2MA 5D5XB 3IRRA 5HLIA 4A3LJ 2IS2A 2WA0A 4E7SA 3WU1B 2HTSA 2ZKZA 4P5OA 2H1KA 3CDHA 2P5VA 4U0VA 2XV4S 1RUOA 4AU7A 1JI8A 2LY9A 2O0YA 3QOPA 4HRIA 4D1QA 3RYPA 3HOSA 2K85A 2COBA 3K1PA 5EGOB 1FNNA 2AXLA 5JVTA 3BCAA 3MAJA 2M0MA 2DK5A 4BHBA 2DQLA 5BNGA 4TV7A 2X6WA 5DS9A 5D4RA 1RI7A 1OJLA 4G6QA 1X2NA 2OCCH 2EINH 3OYJA 3LFUA 1W5SA 2GWRA 3W2AA 2I5UA 5F04A 4DIQA 3V8LA 2E7WA 1SAXA 1OFCX 2HFHA 3F8MA 3TO7A 3LFKA 4BHCA 2P0WA 4JOMA 3M4OJ 4J00A 4A3EJ 2Q2EA 2IVMA 2ZNZA 3WGIA 3VSLA 4BU2A 2DU9A 1FX7A 5DV5A 1GVDA 2Y0MA 5B5EC 4HNTA 5J1RA 2JVGA 4JK1X 2ICWG 4MQVA 2O3FA 3WTUC 2XUBA 5F1RA 1AKHB 2QKLB 1MDMA 4BHPA 2FBKA 3TOBA 5LHGA 2LRDA 2ZJQF 2QWWA 1D0ZA 1YX3A 1U8RA 2PFBA 5ERIA 3FXJA 3JSPA 2HDDA 1QZZA 3B6AA 4HQMA 5TISC 2PI0A 4AVPA 2UV1A 5CQGA 2W48A 1J2XA 3CO7C 1POGA 2VKVA 3H9JA 1IUYA 2CUEA 2QQAA 4HF0A 4A5NA 3HOVJ 2Y2ZA 4G9YA 4ZDOA 3V42A 1H0MA 2CQQA 3LSTA 4HZFA 5J8FA 1LNWA 4HW0A 2VXDA 3GTJJ 2ZCWA 4O5VA 5FLVA 5J1UA 1BBYA 1UELB 2EZLA 1SC7A 1PUFA 2BEOA 1J9IA 2VASA 1U6GA 1N75A 2ID6A 1VQNI 4BQOA 5IYDJ 2RREA 5L3FA 2A3SA 3GTLJ 2JA6J 3E6BA 1FSHA 3PSIA 3SQNA 3I5UA 1ZRFA 5F1JA 3I71A 2NXNB 2VXZA 1RPWA 4B43A 5E18F 1P4XA 3CQZJ 3HRMA 4RMNA 4CCMA 4E7ZA 1G6NA 2PMZN 3C2HA 1SVLA 2ESHA 2IA0A 4HLYA 1FEXA 1Z3YA 1K61A 3KEQA 1LEBA 3BCBA 2E2IJ 4ENMA 2X48A 3V7CA 4IQ4A 1VQ7I 3HL2A 3E1SA 2BVMA 3CUQB 3LSGA 5BPDA 2G9WA 4XL9A 1W0UA 1G8XA 1ZKGA 4UUVA 2W1OA 5L3BA 1EKEA 3H5RA 2WWYA 3SDGA 2FNPA 1CF7A 2QENA 2L54A 4MEYF 2DTZA 1ITYA 3DKWA 1HW2A 5J8CA 2NS0A 1MH4A 2PJRA 2GOXB 4BXFA 3HOYJ 3TW7A 4Y52J 3BJAA 1SVMA 4DYCA 3MKYB 1KYWA 2V1XA 1ZHFA 4X0GA 3CC4I 1FJLA 3Q0WA 4NQWA 4NHJA 2L01A 4AIJA 2VOOA 4IVNA 2LKPA 1R5HA 2NNYA 2ZO4A 4FQGA 2EH3A 2FXAA 2DOFA 3RKXA 4E7IA 4P96A 5D5UB 3D0SA 3PQKA 2F5CA 3MKZA 1UB9A 4DBRA 2DFHA 5E3NA 3L9FA 5IYCJ 4ZTFA 2R7ZJ 1WCMJ 2LR8A 1KU3A 2GA2A 5AIPA 3W2VA 4C3IJ 5GAHJ 3REOA 2R5YB 2FA5A 3ABMH 1T2KA 4FASD 4LLLA 5K5QA 4M3DA 2JA2A 1YX5A 5GADJ 4YFXF 3SFZA 1DP3A 2XAQA 2Y69H 3SZPA 4RGSA 3I59B 1JKOC 5DD8A 1IV6A 2V7FA 2ECCA 1V5EA 2DT6A 4YIFA 3S3NA 2L4MA 2KRFA 2HVRA 2XASA 2DYRH 3E7LA 1E0EA 2ZXWH 4PCQA 4YELA 3GFMA 1R5GA 3SZTA 4AM3A 3FBNB 2VJ4A 2IGKA 1EH8A 1YQAA 2XAJA 2R5ZA 3C2BA 2J5OA 1QRYA 2BW3A 3OYAA 3OYDA 1RUNA 2AS5F 2V9KA 3ZQGA 4NC8A 4P9FA 3ZOBA 4XOPA 2WV0A 5CLSA 4ZYHA 1LPQA 1UG0A 1RZ4A 1SD5A 1YJWI 4OIPF 3ECOA 2A6EF 2DMUA 3FXUA 2DMPA 2ZFUA 1YIJI 3BY6A 3ZQ7A 1Z3XA 4OIRF 4B48A 1BI0A 5JLXA 3FMSA 4I02A 3P7NA 1WH5A 3KP4A 2GAUA 4EJVA 2HQNA 2TCTA 1X3ZB 2V6CA 2DLLA 5F08A 4E7HA 1IO2A 2MC3A 3RJPA 3H35A 1O57A 2OV7A 4IHTA 1HKSA 2M0CA 3KZZA 3HXLA 2IGOA 5BPIA 1IZ1A 1BA5A 4MNUA 3FMQA 2VT3A 3LQQA 5M5XJ 1E17A 1FIAA 1V5FA 2BV6A 2EQRA 1SVOA 5B3SH 3G6EI 3WU0A 2JK3A 3I9V2 2L9NA 5KNLA 1TP4A 4Q4ZF 2E36A 4M3GA 2TRTA 4IRGA 4HQEA 2DMNA 1W36C 4IRIA 2F5DA 1JE8A 2LLKA 2LG4A 5D8KB 2FOWA 4A0ZA 1ZELA 3GTMJ 1V55H 2FQ3A 2FMYA 2HTJA 3F21A 1J7KA 5K5OA 2L4AA 3L2CA 3CCRI 4CCNA 3ZMVA 1WH7A 2A6HF 4M73A 3BR1A 3CJNA 3K69A 2DOAA 3DV8A 4KN4X 3D5RC 2D1VA 4XONA 4J01A 1TWAJ 2Y31A 1XB4A 3K4MA 3FISA 3QPTA 3OIPA 2DDBA 1D1CA 4I0BA 1JJ6C 4FCYA 3NWTA 3T5XA 5E3MA 3ZQCA 4BQAA 1IAWA 3H3UA 4RM3A 5KAIC 4KYWA 1M1EB 1HSJA 5DUKA 5D5VB 3DF8A 1I1GA 1W4MA 2HQAA 1JUMA 3Q3SA 5E79C 2M30A 3WGHA 2DW4A 2W84A 2YSRA 3R0AA 1LKXA 4QPQA 1K79A 4EM2A 2O7OA 1DU6A 2VJIA 3BR3A 4S04A 3TO9A 4DZPA 4FISA 5GPCA 1BR1A 5E20A 3HKZA 3WE3A 4M6XA 5IT3A 1I50J 1ON1A 3LMMA 3RYRA 2FOKA 1A36A 3A4CA 2VE8A 2IGNA 4BXXJ 2E71A 1U9OA 4B8XA 1Q1VA 2K9MA 2Z1DA 2CV1A 4IX7A 1X1PA 3W3CA 4ZYDA 4XRMA 3I4NJ 2M9HA 3H5AA 5F27A 3DLAA 5FD5A 2CS3A 1W7PB 1U5TB 2MGQA 3A03A 3GZ5A 1MNMC 2IXSA 3BPVA 1VI0A 1NG6A 3QU6A 1R49A 4DZJA 2HKOA 4EM1A 3PUBA 2CU7A 4WXCA 2RGVA 2DJNA 2OZUA 4II2A 3PIOF 1X3WB 3CCSI 2E35A 3NWSA 5CKTA 3RSNA 3GTPJ 3HUGA 1YRNA 1USTA 2R3SA 4D5FA 5J1YA 2LYCA 1HDDC 1X1DA 1F43A 4G8XA 5F0CA 4Y13A 2OD5A 2ZB9A 4CXFA 4LG0A 1EH7A 1S7OA 1F36A 2LF8A 3FIWA 5M3MJ 3F8CA 5ILSA 4N4OB 4E4HA 3ZQIA 5IT9Z 1VQOI 3QPSA 4D0PA 4ESBA 4PUSA 2KHMA 1BJZA 1G3YA 5BQTA 4I98B 4ZYEA 1TZLA 3HHHA 2P7CB 4YIRX 3F8NA 4G94A 4FE4A 1MJBA 3EYYA 4YFNF 3PL8A 3J80Z 4DW6A 4WF2A 2R4GA 4AUXA 2E5ZA 1XN7A 1ZGAA 4I6ZA 2CGPA 5LGTA 1VQ9I 1VTNC 5E8GA 3W6KB 4MHGA 2WAQN 1SFXA 2DOEA 1R00A 1T56A 2PEXA 1Z9CA 2KZGA 1P92A 2E5NA 2YX7A 2RC4A 2FEZA 3NEUA 4M3BA 4CDGA 4UUTA 1B72A 2DA4A 4FTHA 3HOZJ 4YFKF 1ZG5A 3PM1A 1QO0D 1T38A 4QTRA 2EFWA 1UJ8A 2E1CA 2LP0A 5H20A 4D9JA 3KYLA 2YU3A 1CQTA 2VC1A 3BP8A 4BL0B 2UWMA 4XKVA 3WG7H 2IS4A 3TEDA 3I0TA 3KYCB 3VOEA 4F52A 4A2UA 1AHDP 1EH6A 1K4SA 2L7FP 2V1NA 5IY5H 2QF7A 4DBQA 3TKYA 1KYZA 1ETOA 2EK5A 2EJRA 3PFIA 2H8WA 3HSRA 1KU7A 2HDCA 1SMTA 3KZYA 1I6XA 1GDTA 4OAZA 4MO7A 3S1RJ 2XHKA 4HAMA 2Z2SB 2DCEA 3BT9A 4OMZA 1BI1A 1JHHA 1FC3A 1TW2A 1OISA 3TW6A 3JRIA 1IXCA 1HKTA 3CO6C 3M8EA 1YW8A 4MFDA 3IH4A 2DDAA 1A35A 1R22A 3DU5A 3HKZN 2IA1A 2R7WA 1IN5A 4PSWA 1O3RA 3AG2H 4M71A 4BE0A 1LDJA 5F0HA 1IN6A 2L7MP 3BTIA 5ED4A 2NVYJ 1PVEA 2XC7A 3L2QA 1ZK8A 3F9KA 3S2HJ 2QQBA 3OMYA 1TQPA 3BROA 3H1CA 3N05A 1LJ9A 2CQNA 2CSOA 4C3JJ 5L3CA 1HW1A 4L0ZB 1MW7A 2VBXA 1IRFA 2ZMEA 4KMUX 1A6IA 3BQYA 5JVGF 2H94A 2FJ1A 3R61A 3OY9A 4K2EA 5EJCA 1XG1A 1SFOJ 2CH0A 4MLOA 2X6YA 4IRHA 4ZYGA 1W1WE 3K4CA 4RBOA 1SD6A 5F0FA 4ETSA 4A3GJ 3AG1H 2KIFA 3LA3A 5C3EJ 1BW5A 2OF7A 4CZCA 1XGSA 4B47A 2XROA 1ZQ3P 4I0AA 4FE7A 3I58A
chains in the Genus database with same CATH topology
3LOCA 1MBEA 3O8HA 3RKQA 1HF0A 5BNGA 5DS9A 2VKEA 2M8GX 1H8AC 1OJLA 1X2NA 3GTOJ 1RKWA 5F04A 5FKNA 1OFCX 5FKOA 1H88C 2DA6A 2JA5J 2NVXJ 1ZTRA 3M4OJ 1IUFA 4A3EJ 2YUSA 1QVUA 1MBHA 1JKRC 2EBIA 1GVDA 5J1RA 4LOCA 3BTLA 3B6CA 1AU7A 1IJWC 3S1QJ 4C2MJ 1AKHB 5EG0A 5EZHA 1IGNA 1RR7A 4V2FA 3F0CA 1ETWA 3W6VA 3IV5A 1APLC 1UMQA 3S15J 1Z0XA 2HDDA 5IOYA 1ETQA 3B6AA 4NDLA 1JUPA 3HBLA 4DYRA 3JRFA 4B3AA 2W48A 1POGA 2R0QC 2VKVA 2CUEA 2QCOA 2CQXA 3QQAA 3HOVJ 2Y2ZA 4JX4A 2K9QA 2CQQA 1TC3C 5FKKA 2DMQA 5K7FA 1FTTA 3VPRA 3JR9A 3GTJJ 5FLVA 5J1UA 1VFCA 2VUMJ 2EZLA 4BKXA 3LSRA 1SANA 1PUFA 1BW6A 3HOUJ 2HXOA 4HNVA 2ID6A 2VI6A 2YS9A 4BY7J 2B63J 5IYDJ 3CCYA 5C4JJ 3GTLJ 2JA6J 1Y1VJ 2LFBA 5F1JA 2DN0A 3FKIJ 1MBJA 3PO2J 1RPWA 5GPAA 2HI3A 3CQZJ 4J19A 2X6OA 1G2HA 2LD5A 3BR5A 2PMZN 3JRDA 1WPKA 1FEXA 5FLMJ 4IHVA 2EZKA 1K61A 2E2IJ 2X48A 2IEKA 3LSGA 1OCTC 1IRZA 1IC8A 4G12A 1W0UA 1ZKGA 5HODA 5IP6A 3RQIA 3SDGA 1TWCJ 1MBGA 2M2EA 4JP0A 1JTXA 3SFIA 3GTGJ 2DTZA 2KDZA 2Y9ZA 1ITYA 2XPUA 1VF9A 1DU0A 4A3BJ 5EEAA 5IYBJ 3GTQJ 1MH4A 3Q0VA 3JRAA 2LK2A 1JGGA 2HXIA 3WHCA 2EZHA 3TW7A 2LKXA 3HOYJ 4Y52J 1GV5A 3H0GJ 4D7MA 3HEFA 4DYCA 4DYQA 1B8IA 2ME0A 4CYCB 3GTKJ 1FJLA 2EZIA 3Q0WA 2GM4A 2XB5A 2ME6A 3LNQA 5JLWA 5EDNA 2L9RA 2EH3A 2ECBA 1P7JA 3K2AA 1R9TJ 4A3CJ 5E3NA 5IYCJ 4A3IJ 2R7ZJ 1WCMJ 2LR8A 4C3IJ 3ZQLA 4QIWN 5EGOA 1EF4A 2R5YB 3QPLA 3JRCA 2AO9A 1X58A 4M3DA 5FJ8J 1IDYA 1ETYA 2K9SA 2HQ5A 1UG2A 2JN6A 1JKOC 1IV6A 2WB1N 2ECCA 5C4XJ 5FKLA 2R5ZB 3IH3A 5IPAA 2E1OA 3L1PA 3E7LA 1ZGWA 4M6VA 2JA7J 4B4CA 2FD5A 2HOTA 1U8BA 2JMWA 1T33A 2R5ZA 3C2BA 1QRYA 3ZQGA 5IOZA 2Y9YA 2O9LA 3ZOBA 4QSHA 1AKHA 2DMUA 2Y30A 2DMPA 2NOGA 3JRBA 1QPIA 3HOXJ 3S16J 5JLXA 3OOUA 3A01B 4MIMA 1WH5A 2TCTA 3BTJA 2VPRA 3G1MA 3HGYA 5F08A 3OSFA 3G1OA 2MG4A 1HCRA 1K83J 3D1NI 2M0CA 2P81A 4D5CA 1BA5A 2XRLA 2XGCA 5M5XJ 1FIAA 2EQRA 3FK6A 3JREA 2JK3A 2LVSA 4M3GA 2TRTA 2DMNA 4ABZA 2LLKA 2FQ4A 2LTPA 3GTMJ 3S2DJ 2E2JJ 4A69C 4Y7NJ 3BR6A 9ANTA 1U9NA 3HB9A 3ZQHA 1E3OC 1MH3A 1WH7A 5IP9J 3BR1A 2DA1A 4B1RA 4XICA 1TWAJ 1WI3A 2Y31A 2XGDA 3DEWA 2CJJA 3BG3A 3FISA 4XRSA 3S1MJ 1TWFJ 1JJ6C 4FCYA 1ORKA 5E3MA 5C44J 2GBYA 3ZQCA 4A3KJ 2X9DA 4AYBN 1TWHJ 3GBGA 1QVTA 1ETXA 1JUMA 3Q3SA 4W1UA 1MBFA 2E19A 3BG9A 1RKTA 4EEFG 1LFUP 4I76A 1GV2A 2HOAA 2Y0SN 3M3YJ 2O7OA 1DU6A 1ENHA 3MVPA 3BR3A 4DZPA 5GPCA 4FISA 1ETKA 4IHWA 2R93J 3JRGA 3TP3A 4BBSJ 1JKQC 1I50J 3FK7A 4A3DJ 3SJMA 5E3OA 4M3FA 4BXXJ 5FKMA 2M34A 1U9OA 3MKLA 1Q1VA 4CYCA 5EF6A 1RETA 5GP9A 2XSDC 1JUSA 1JJ8C 1MSFC 4XRMA 1FTZA 3I4NJ 2M9HA 3RZOJ 5F27A 1LE8B 4AC0A 1Y1WJ 1ETVA 2L7ZA 3HOWJ 2MGQA 3A03A 2FX0A 1MNMC 3JRHA 2HOSA 5M5WJ 1UHSA 2NS8A 1VI0A 1YRNB 3BR2A 4DZJA 3RZDJ 3I4MJ 2IAIA 2CU7A 2DJNA 3K7AJ 2R5YA 2CUFA 1BL0A 4RDUA 3GTPJ 1GT0C 5EZGA 1YRNA 3BTCA 4D5FA 5J1YA 1O4XA 1HDDC 1F43A 5F0CA 2XPVA 2ZB9A 3CDLA 1GUUA 1F36A 3FIWA 5M3MJ 2MSYA 2E2HJ 1JT6A 3ZQIA 2L0KA 3QPSA 2NVTJ 2MW8A 1BJZA 4X6AJ 2DA2A 4IHXA 2DA3A 1NK3P 3TP0A 4FE4A 3NARA 5EYRA 2YU9J 4DW6A 2GLOA 5EG0B 2JA8J 2RAEA 1A5JA 1S7EA 4AUXA 4C3HJ 4I6ZA 2DA5A 2WAQN 4MFEA 1B72B 2NS7A 2CRGA 1T56A 4W97A 2OPTA 4A3FJ 1ZR4A 3A01A 2XB0X 4A93J 1WGXA 4M3BA 1ZR2A 3MN2A 2D5VA 2O8KA 4UUTA 1B72A 1NK2P 2K40A 2DA7A 2DA4A 2XGEA 4FTHA 3HOZJ 3PM1A 4UUSB 3HGGA 4QTRA 2JJ7A 2JWTA 2LP0A 1IG7A 1CQTA 1I6HJ 3S14J 1PUFB 4UUSA 4JX5A 4JYKA 3TEDA 2WV1A 2H8RA 1P7IA 1AHDP 4XK4A 2L7FP 2QF7A 3BQZA 1HOMA 4BY1J 1ETOA 4V2GA 3NAUA 1I3QJ 3CMYA 4XIDA 3A02A 1GDTA 3ZQFA 5IP7J 4MO7A 5M3FJ 4IEJA 4A3JJ 4A3MJ 2ELKA 3OSGA 4GFBA 1HDPA 1NTCA 3HDDA 3OIOA 3S1RJ 2NVQJ 1XS9A 3BT9A 3LSPA 1JKPC 4JX6A 1JT0A 5M5YJ 1U78A 1Z77A 3TW6A 3JRIA 3O8GA 1JTYA 5K7ZA 2ID3A 3IH2A 3UKGA 4MFDA 3S1NJ 3IH4A 3PO3J 3S17J 4XRSG 3HKZN 2KT0A 1XC5A 1MSEC 2I10A 5K7HA 5F0HA 1D5YA 3BR0A 1H89C 4M3EA 1OCPA 2L7MP 5J3LA 4IHYA 2K9NA 3BTIA 5E3LA 1IDZA 4S0HB 2NVYJ 2AHQA 1ZK8A 2XPWA 3S2HJ 1RESA 2HYJA 3Q0UA 4C3JJ 1VNDA 4X1EA 4D7NA 1B8IB 2G0EA 4BBRJ 3G1LA 1HLVA 1MBKA 1LFBA 3H3VK 1A6IA 3BQYA 1X2MA 4A3LJ 4L5EA 3DCFA 2FJ1A 1SFOJ 1XG1A 2H1KA 2N8GA 2DMTA 1FIPA 5DTDA 4MLOA 3BG5A 1LE8A 4RBOA 5F0FA 2LY9A 4A3GJ 3HM5A 2R92J 1TWGJ 5C3EJ 2COBA 1W0TA 1BW5A 2OF7A 3WHBA 5EGOB 2IBDA 1ZQ3P 4FE7A 3LSJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LOC A;  1MBE A;  3O8H A;  3RKQ A;  1HF0 A;  5BNG A;  5DS9 A;  2VKE A;  2M8G X;  1H8A C;  1OJL A;  1X2N A;  3GTO J;  1RKW A;  5F04 A;  5FKN A;  1OFC X;  5FKO A;  1H88 C;  2DA6 A;  2JA5 J;  2NVX J;  1ZTR A;  3M4O J;  1IUF A;  4A3E J;  2YUS A;  1QVU A;  1MBH A;  1JKR C;  2EBI A;  1GVD A;  5J1R A;  4LOC A;  3BTL A;  3B6C A;  1AU7 A;  1IJW C;  3S1Q J;  4C2M J;  1AKH B;  5EG0 A;  5EZH A;  1IGN A;  1RR7 A;  4V2F A;  3F0C A;  1ETW A;  3W6V A;  3IV5 A;  1APL C;  1UMQ A;  3S15 J;  1Z0X A;  2HDD A;  5IOY A;  1ETQ A;  3B6A A;  4NDL A;  1JUP A;  3HBL A;  4DYR A;  3JRF A;  4B3A A;  2W48 A;  1POG A;  2R0Q C;  2VKV A;  2CUE A;  2QCO A;  2CQX A;  3QQA A;  3HOV J;  2Y2Z A;  4JX4 A;  2K9Q A;  2CQQ A;  1TC3 C;  5FKK A;  2DMQ A;  5K7F A;  1FTT A;  3VPR A;  3JR9 A;  3GTJ J;  5FLV A;  5J1U A;  1VFC A;  2VUM J;  2EZL A;  4BKX A;  3LSR A;  1SAN A;  1PUF A;  1BW6 A;  3HOU J;  2HXO A;  4HNV A;  2ID6 A;  2VI6 A;  2YS9 A;  4BY7 J;  2B63 J;  5IYD J;  3CCY A;  5C4J J;  3GTL J;  2JA6 J;  1Y1V J;  2LFB A;  5F1J A;  2DN0 A;  3FKI J;  1MBJ A;  3PO2 J;  1RPW A;  5GPA A;  2HI3 A;  3CQZ J;  4J19 A;  2X6O A;  1G2H A;  2LD5 A;  3BR5 A;  2PMZ N;  3JRD A;  1WPK A;  1FEX A;  5FLM J;  4IHV A;  2EZK A;  1K61 A;  2E2I J;  2X48 A;  2IEK A;  3LSG A;  1OCT C;  1IRZ A;  1IC8 A;  4G12 A;  1W0U A;  1ZKG A;  5HOD A;  5IP6 A;  3RQI A;  3SDG A;  1TWC J;  1MBG A;  2M2E A;  4JP0 A;  1JTX A;  3SFI A;  3GTG J;  2DTZ A;  2KDZ A;  2Y9Z A;  1ITY A;  2XPU A;  1VF9 A;  1DU0 A;  4A3B J;  5EEA A;  5IYB J;  3GTQ J;  1MH4 A;  3Q0V A;  3JRA A;  2LK2 A;  1JGG A;  2HXI A;  3WHC A;  2EZH A;  3TW7 A;  2LKX A;  3HOY J;  4Y52 J;  1GV5 A;  3H0G J;  4D7M A;  3HEF A;  4DYC A;  4DYQ A;  1B8I A;  2ME0 A;  4CYC B;  3GTK J;  1FJL A;  2EZI A;  3Q0W A;  2GM4 A;  2XB5 A;  2ME6 A;  3LNQ A;  5JLW A;  5EDN A;  2L9R A;  2EH3 A;  2ECB A;  1P7J A;  3K2A A;  1R9T J;  4A3C J;  5E3N A;  5IYC J;  4A3I J;  2R7Z J;  1WCM J;  2LR8 A;  4C3I J;  3ZQL A;  4QIW N;  5EGO A;  1EF4 A;  2R5Y B;  3QPL A;  3JRC A;  2AO9 A;  1X58 A;  4M3D A;  5FJ8 J;  1IDY A;  1ETY A;  2K9S A;  2HQ5 A;  1UG2 A;  2JN6 A;  1JKO C;  1IV6 A;  2WB1 N;  2ECC A;  5C4X J;  5FKL A;  2R5Z B;  3IH3 A;  5IPA A;  2E1O A;  3L1P A;  3E7L A;  1ZGW A;  4M6V A;  2JA7 J;  4B4C A;  2FD5 A;  2HOT A;  1U8B A;  2JMW A;  1T33 A;  2R5Z A;  3C2B A;  1QRY A;  3ZQG A;  5IOZ A;  2Y9Y A;  2O9L A;  3ZOB A;  4QSH A;  1AKH A;  2DMU A;  2Y30 A;  2DMP A;  2NOG A;  3JRB A;  1QPI A;  3HOX J;  3S16 J;  5JLX A;  3OOU A;  3A01 B;  4MIM A;  1WH5 A;  2TCT A;  3BTJ A;  2VPR A;  3G1M A;  3HGY A;  5F08 A;  3OSF A;  3G1O A;  2MG4 A;  1HCR A;  1K83 J;  3D1N I;  2M0C A;  2P81 A;  4D5C A;  1BA5 A;  2XRL A;  2XGC A;  5M5X J;  1FIA A;  2EQR A;  3FK6 A;  3JRE A;  2JK3 A;  2LVS A;  4M3G A;  2TRT A;  2DMN A;  4ABZ A;  2LLK A;  2FQ4 A;  2LTP A;  3GTM J;  3S2D J;  2E2J J;  4A69 C;  4Y7N J;  3BR6 A;  9ANT A;  1U9N A;  3HB9 A;  3ZQH A;  1E3O C;  1MH3 A;  1WH7 A;  5IP9 J;  3BR1 A;  2DA1 A;  4B1R A;  4XIC A;  1TWA J;  1WI3 A;  2Y31 A;  2XGD A;  3DEW A;  2CJJ A;  3BG3 A;  3FIS A;  4XRS A;  3S1M J;  1TWF J;  1JJ6 C;  4FCY A;  1ORK A;  5E3M A;  5C44 J;  2GBY A;  3ZQC A;  4A3K J;  2X9D A;  4AYB N;  1TWH J;  3GBG A;  1QVT A;  1ETX A;  1JUM A;  3Q3S A;  4W1U A;  1MBF A;  2E19 A;  3BG9 A;  1RKT A;  4EEF G;  1LFU P;  4I76 A;  1GV2 A;  2HOA A;  2Y0S N;  3M3Y J;  2O7O A;  1DU6 A;  1ENH A;  3MVP A;  3BR3 A;  4DZP A;  5GPC A;  4FIS A;  1ETK A;  4IHW A;  2R93 J;  3JRG A;  3TP3 A;  4BBS J;  1JKQ C;  1I50 J;  3FK7 A;  4A3D J;  3SJM A;  5E3O A;  4M3F A;  4BXX J;  5FKM A;  2M34 A;  1U9O A;  3MKL A;  1Q1V A;  4CYC A;  5EF6 A;  1RET A;  5GP9 A;  2XSD C;  1JUS A;  1JJ8 C;  1MSF C;  4XRM A;  1FTZ A;  3I4N J;  2M9H A;  3RZO J;  5F27 A;  1LE8 B;  4AC0 A;  1Y1W J;  1ETV A;  2L7Z A;  3HOW J;  2MGQ A;  3A03 A;  2FX0 A;  1MNM C;  3JRH A;  2HOS A;  5M5W J;  1UHS A;  2NS8 A;  1VI0 A;  1YRN B;  3BR2 A;  4DZJ A;  3RZD J;  3I4M J;  2IAI A;  2CU7 A;  2DJN A;  3K7A J;  2R5Y A;  2CUF A;  1BL0 A;  4RDU A;  3GTP J;  1GT0 C;  5EZG A;  1YRN A;  3BTC A;  4D5F A;  5J1Y A;  1O4X A;  1HDD C;  1F43 A;  5F0C A;  2XPV A;  2ZB9 A;  3CDL A;  1GUU A;  1F36 A;  3FIW A;  5M3M J;  2MSY A;  2E2H J;  1JT6 A;  3ZQI A;  2L0K A;  3QPS A;  2NVT J;  2MW8 A;  1BJZ A;  4X6A J;  2DA2 A;  4IHX A;  2DA3 A;  1NK3 P;  3TP0 A;  4FE4 A;  3NAR A;  5EYR A;  2YU9 J;  4DW6 A;  2GLO A;  5EG0 B;  2JA8 J;  2RAE A;  1A5J A;  1S7E A;  4AUX A;  4C3H J;  4I6Z A;  2DA5 A;  2WAQ N;  4MFE A;  1B72 B;  2NS7 A;  2CRG A;  1T56 A;  4W97 A;  2OPT A;  4A3F J;  1ZR4 A;  3A01 A;  2XB0 X;  4A93 J;  1WGX A;  4M3B A;  1ZR2 A;  3MN2 A;  2D5V A;  2O8K A;  4UUT A;  1B72 A;  1NK2 P;  2K40 A;  2DA7 A;  2DA4 A;  2XGE A;  4FTH A;  3HOZ J;  3PM1 A;  4UUS B;  3HGG A;  4QTR A;  2JJ7 A;  2JWT A;  2LP0 A;  1IG7 A;  1CQT A;  1I6H J;  3S14 J;  1PUF B;  4UUS A;  4JX5 A;  4JYK A;  3TED A;  2WV1 A;  2H8R A;  1P7I A;  1AHD P;  4XK4 A;  2L7F P;  2QF7 A;  3BQZ A;  1HOM A;  4BY1 J;  1ETO A;  4V2G A;  3NAU A;  1I3Q J;  3CMY A;  4XID A;  3A02 A;  1GDT A;  3ZQF A;  5IP7 J;  4MO7 A;  5M3F J;  4IEJ A;  4A3J J;  4A3M J;  2ELK A;  3OSG A;  4GFB A;  1HDP A;  1NTC A;  3HDD A;  3OIO A;  3S1R J;  2NVQ J;  1XS9 A;  3BT9 A;  3LSP A;  1JKP C;  4JX6 A;  1JT0 A;  5M5Y J;  1U78 A;  1Z77 A;  3TW6 A;  3JRI A;  3O8G A;  1JTY A;  5K7Z A;  2ID3 A;  3IH2 A;  3UKG A;  4MFD A;  3S1N J;  3IH4 A;  3PO3 J;  3S17 J;  4XRS G;  3HKZ N;  2KT0 A;  1XC5 A;  1MSE C;  2I10 A;  5K7H A;  5F0H A;  1D5Y A;  3BR0 A;  1H89 C;  4M3E A;  1OCP A;  2L7M P;  5J3L A;  4IHY A;  2K9N A;  3BTI A;  5E3L A;  1IDZ A;  4S0H B;  2NVY J;  2AHQ A;  1ZK8 A;  2XPW A;  3S2H J;  1RES A;  2HYJ A;  3Q0U A;  4C3J J;  1VND A;  4X1E A;  4D7N A;  1B8I B;  2G0E A;  4BBR J;  3G1L A;  1HLV A;  1MBK A;  1LFB A;  3H3V K;  1A6I A;  3BQY A;  1X2M A;  4A3L J;  4L5E A;  3DCF A;  2FJ1 A;  1SFO J;  1XG1 A;  2H1K A;  2N8G A;  2DMT A;  1FIP A;  5DTD A;  4MLO A;  3BG5 A;  1LE8 A;  4RBO A;  5F0F A;  2LY9 A;  4A3G J;  3HM5 A;  2R92 J;  1TWG J;  5C3E J;  2COB A;  1W0T A;  1BW5 A;  2OF7 A;  3WHB A;  5EGO B;  2IBD A;  1ZQ3 P;  4FE7 A;  3LSJ A; 
#chains in the Genus database with same CATH topology
 1REP C;  2KIS A;  3O8H A;  3HSE A;  1XD7 A;  1HA8 A;  2XF5 A;  1FBU A;  2VC0 A;  1VQ4 I;  2VKE A;  4E70 A;  4OIQ F;  1UCR A;  2M3A A;  4ENK A;  2DYS H;  2V4J C;  3VWB A;  3GTO J;  4HX8 A;  2FF4 A;  1QZE A;  1TL8 A;  2DA6 A;  2RQQ A;  2BY1 A;  3HRU A;  1BOA A;  3W2W A;  1MJA A;  1ZGJ A;  1IUF A;  3CP8 A;  2A68 F;  4ZTJ A;  2F4I A;  1YOV B;  3TO6 A;  3K6G A;  3VYU B;  1MBH A;  4L9V A;  3MKW B;  2JRM A;  3B6C A;  3HRS A;  1AU7 A;  1IJW C;  1N25 A;  2KFD A;  2KIM A;  3QWL A;  5DM6 F;  1YLF A;  5EZH A;  3CCQ I;  1RR7 A;  4V2F A;  2PMH A;  3LSK A;  3W6V A;  1S3J A;  1APL C;  2LOO A;  2P6S A;  1P6R A;  1Q1H A;  3EDP A;  2BOL A;  2ZNY A;  4NDL A;  1NH3 A;  1X1C A;  2EFP A;  1EA3 A;  4BAY A;  1WKM A;  4LK1 F;  4IQJ A;  2CQX A;  1R5I D;  3TQN A;  2XAF A;  4JX4 A;  4LK0 F;  3GZ6 A;  2V79 A;  1V54 H;  1TC3 C;  2DMQ A;  4HX7 A;  3AAF A;  3VPR A;  4EV0 A;  2DAO A;  2ESN A;  2VUM J;  3KEO A;  2KDO A;  1VFC A;  2O5R A;  2M7A A;  1AA7 A;  3RCO A;  1BW6 A;  2HWV A;  4HNV A;  3L2V A;  5B1A H;  3EUK L;  4BY7 J;  2YS9 A;  2E1M B;  5HNF A;  3CCY A;  5J4V A;  3HTU A;  1WFX A;  1HW5 A;  2Z99 A;  1WWX A;  4HG2 A;  3ESW B;  1IXR C;  4XLE A;  3GX4 X;  3ZMZ A;  2DN0 A;  2P7V B;  3GVA A;  4KIG A;  3PO2 J;  3K1M A;  2HI3 A;  3Q5F A;  4JBA A;  1T39 A;  2RQP A;  4IHV A;  2EZK A;  4ENJ A;  1T8I A;  4OIO F;  3ERM A;  2LY2 A;  3JTG A;  2XF6 A;  4BJT A;  5HOD A;  2Q1Z B;  2RDP A;  1FOK A;  4YEJ A;  2PN6 A;  1TLH B;  1UZC A;  2F6C A;  2M2E A;  4XBF A;  4A6D A;  3ULQ B;  3CUQ C;  3SFI A;  4KNY A;  3ISP A;  3VOD A;  1OKR A;  3HTS B;  4DJA A;  1VF9 A;  3U21 A;  1DU0 A;  1PUE E;  2CQK A;  1ZRC A;  4A3B J;  2PX9 A;  1Z05 A;  1YO5 C;  1MKM A;  3GTQ J;  1WJA A;  5H6R A;  3VYR B;  5FO5 A;  3PNT A;  4RGU A;  2LH9 A;  3OL3 A;  3TMO A;  3BJ6 A;  4UV9 A;  2XIG A;  4N0B A;  4WXD A;  1XDU A;  3H0G J;  2IP2 A;  1G4D A;  3SDB A;  4D7M A;  3HEF A;  3ABK H;  5HLG A;  3OYM A;  2IS1 A;  2ISY A;  1B8I A;  2ME0 A;  4CYC B;  3BC8 A;  5LRS A;  3R4K A;  5FRO A;  3DTI A;  3H92 A;  2GM4 A;  2ME6 A;  2OQG A;  1QA6 A;  1WJC A;  1YFH A;  3KET A;  2XKO A;  3RKY A;  5EDN A;  4UVA A;  2JTV A;  3K2A A;  5J47 A;  3Q9S A;  1R9T J;  2K02 A;  4FHT A;  4XOR A;  3H9Q A;  1ZYR F;  5AON A;  2OUM A;  3M1E A;  4O3M A;  3QYE A;  1TT5 B;  5GTI C;  2LDU A;  3CCL I;  4QIW N;  3ZQL A;  3JTH A;  2HZT A;  3OYK A;  3QPL A;  2P6T A;  1XDS A;  2ZJR F;  2K9S A;  5LEJ A;  2H09 A;  2HQ5 A;  1WJD A;  3WTX C;  1UG2 A;  4L5I A;  3HG9 A;  4BH9 A;  2WB1 N;  4CYD A;  4EJU A;  5JHU A;  2WBM A;  4XKW A;  4ZDL A;  2OQR A;  3IH3 A;  5IPA A;  2E1O A;  4HDU A;  2OTJ I;  3LSH A;  1TQI A;  4RGX A;  3LSI A;  3LAJ A;  1T33 A;  5IOZ A;  3FBI B;  3K4J A;  4R8H A;  3ABL H;  4B44 A;  2M45 A;  3MZ8 A;  3HOX J;  2CW0 F;  4RLF A;  1Z7U A;  3SZG A;  3A01 B;  4BUP A;  3LQR A;  2JSC A;  4M74 A;  1NG7 A;  2X85 A;  2QZ8 A;  2VPR A;  5FFX A;  4U7B A;  3HIF A;  4D5C A;  1HXD A;  3DPT A;  5FLX K;  1VQL I;  2CFX A;  2XRL A;  2Y48 A;  2NOJ B;  5E1X A;  5JHF A;  3GXO A;  4CCK A;  4XMY A;  3IAM 2;  2MA3 A;  1C0W A;  2CWE A;  1R58 A;  4P9U A;  4RLQ A;  1CGP A;  3EUH C;  1IN7 A;  4ABZ A;  3GF2 A;  4KIS A;  4YG2 F;  2F5F A;  1LB2 A;  5EEH A;  3NQO A;  1OCC H;  1FP1 D;  2RV8 A;  4EM0 B;  4RGR A;  5F6F A;  1D3Y A;  4PGG A;  2Q8K A;  3S8P A;  2XF7 A;  3PNY A;  3ZMD A;  1FWZ A;  3HB9 A;  3ZQH A;  3T1B A;  3RKW A;  1E3O C;  2HVS A;  2Z33 A;  1AOY A;  4WXH A;  1MH3 A;  4PJN A;  3SEZ A;  4B1R A;  1YG2 A;  1RNL A;  4QWQ A;  3F6V A;  4CCO A;  4IZZ A;  1WI3 A;  2K3F A;  2XGD A;  3OIQ A;  4PK4 A;  2ZJP F;  3T8T A;  4XRS A;  3S1M J;  1WI9 A;  3IRQ A;  4HSR A;  5TJJ A;  1ORK A;  2JVH A;  3VB2 A;  3EET A;  4A3K J;  5JFR A;  3ZGK A;  3FMR A;  1TWH J;  5CVJ A;  1QVT A;  4V19 K;  2CMP A;  3BG9 A;  2E19 A;  1RKT A;  1T0F C;  2VB6 A;  1LFU P;  3KP6 A;  3CJQ B;  2MD0 A;  4AIH A;  5LGU A;  1K6Y A;  2KRH A;  2R93 J;  2LBF A;  1D5V A;  1FBQ A;  4XLN F;  4EJW A;  1XSV A;  3K10 A;  3QAH A;  3U1K A;  3FK7 A;  3BZ6 A;  3M8J A;  3SJM A;  2EA4 A;  2RKH A;  4M3F A;  3IWF A;  4I09 A;  4IOA F;  1W7P D;  2DK8 A;  2F4M B;  3DQV C;  2XKP A;  3FHZ A;  2TDX A;  2MAB A;  5EF6 A;  1JUS A;  1BI2 A;  4RB2 C;  1JJ8 C;  2LMD A;  1D8K A;  3WTY C;  4I2O A;  4E7J A;  2WAE A;  4R1H A;  3RZO J;  2X6X A;  2M87 A;  1TNT A;  1XMX A;  1P2F A;  3RPU D;  4B09 A;  1PP8 F;  5HDK A;  4RB1 A;  1B6A A;  3FXM A;  5D6E A;  1P9Q C;  3J81 Z;  2R7V A;  2A61 A;  1W5C C;  2ADU A;  2HOE A;  2CQ7 A;  3A1Y A;  3I4M J;  2IAI A;  3R60 A;  2IJL A;  2DFF A;  1KQ8 A;  3K7A J;  2CUF A;  3GME A;  4RDU A;  1GT0 C;  1TT0 A;  3E5U A;  3GZN B;  5LFA A;  4RA2 A;  3CDL A;  3AG4 H;  5K1Y A;  2JSP A;  1GUU A;  2GXA A;  2X51 A;  4MGR A;  3K4K A;  1YI2 I;  2FML A;  2CUZ A;  2WY8 Q;  2Q2E B;  1VQ5 I;  5F64 A;  4KMF A;  4X6A J;  1YW9 A;  4O6J A;  1U3E M;  2DA2 A;  3TP0 A;  2FBH A;  1FPQ A;  1MDM B;  2VQH A;  4C3H J;  2A5W A;  2DA5 A;  3I3L A;  4C2T A;  5KAF C;  1OYY A;  1W5T A;  3KP5 A;  3JAM K;  1BR4 A;  3QOE A;  1IRX A;  2ZXH A;  5FRM A;  2CRG A;  1USS A;  4W97 A;  3DBL B;  1R1V A;  2E7X A;  4AWX B;  1ZR4 A;  2XB0 X;  1WGX A;  1A6Q A;  1ZR2 A;  3MN2 A;  4U7D A;  1ZH5 A;  2O8K A;  4RAG A;  1NK2 P;  2K40 A;  2H6B A;  2XGE A;  2K27 A;  3RI4 A;  2DPU A;  2Y75 A;  3AFH A;  3I56 I;  3RPQ A;  1XCB A;  3HGG A;  1ZLK A;  4PDK A;  4Y4R A;  1QU3 A;  3X2Q H;  2JJ7 A;  3DWL E;  4IXA A;  1VZ0 A;  3W6J B;  1IG7 A;  6PAX A;  2VKD A;  1I6H J;  1PUF B;  4Z2Y A;  1Y39 A;  3V8J A;  1L0O C;  3CC2 I;  3KLO A;  4JX5 A;  2ACJ A;  3OYG A;  2HYF A;  4XK4 A;  3O2P E;  1R4M B;  1WVR A;  5TRD A;  4V2G A;  3H3Z A;  1OCO H;  4HPQ A;  2M4G A;  2P5K A;  1IF1 A;  5FFZ A;  4XSX F;  4GDF A;  5IP7 J;  5KVR A;  3IC7 A;  4A3J J;  1HDP A;  1NTC A;  3HDD A;  1OCZ H;  3OIO A;  4YII A;  5H6Q A;  3CD6 I;  4CUG A;  4P1W A;  4CSW A;  5CJ9 A;  2NVQ J;  3LSP A;  4LLG F;  4JX6 A;  3G3Z A;  3KZI C;  3K4B A;  1HKQ A;  5LLQ A;  4G7H F;  3S3M A;  2G7H A;  1U78 A;  2IA2 A;  4GO1 A;  5K7Z A;  2ID3 A;  1OR7 A;  1OR7 C;  2RNJ A;  1QBJ A;  5L3G A;  1ZG3 A;  2OJE D;  1K4T A;  2IRF G;  4M9X A;  1CF7 B;  1G3T A;  1MGT A;  3FZV A;  3GFL A;  3K4N A;  5AIQ A;  5J3L A;  2R7D A;  4S0H B;  2PJR B;  3QPH A;  3CF2 A;  2VJJ A;  3RDI A;  2XPW A;  2YPR A;  4AYB A;  2HYJ A;  2FRH A;  4AD9 A;  2IPQ X;  3Q0U A;  1VND A;  2QBY A;  4CHU A;  1FOY A;  4Y15 A;  4NB5 A;  1XSX A;  3I54 A;  3G1L A;  3OS0 A;  2QEX I;  2Y0S A;  1LFB A;  1OQY A;  4NQW B;  4DGW B;  2W82 A;  3IHU A;  2DXI A;  5J40 A;  1X19 A;  3GFJ A;  2W85 A;  2DMT A;  4BE2 A;  1MIJ A;  3DPU A;  2Z16 A;  1LE8 A;  2EIL H;  1LVK A;  2KLO A;  2XAG A;  3HM5 A;  4KIF A;  1TWG J;  1P4A A;  2BYV E;  2V9P A;  3SXY A;  4F3Q A;  2CG4 A;  4IF4 A;  3WHB A;  2IBD A;  2MBF A;  4GYG A;  4IJA A;  4ZZD A;  4XKB A;  5ICC A;  3F6O A;  3CF5 F;  5TGT A;  1MBE A;  2B7E A;  1BIB A;  4ZYA A;  2M5W A;  4XLC A;  5CVU A;  1XX5 A;  2R7R A;  5FKN A;  5FKO A;  1H88 C;  2NVX J;  3R0J A;  1XMA A;  4ZH4 F;  1QVU A;  3ERE D;  2E1N A;  3K2Z A;  5DCM A;  1ONV A;  1JKR C;  2EBI A;  2HQR A;  3ZXS A;  2BW3 B;  5LBQ A;  4LOC A;  3WOD F;  1STZ A;  3TL4 X;  3E5X A;  3S1Q J;  1FYK A;  3S3O A;  3WTW C;  5EG0 A;  1I39 A;  4MTD A;  3I55 I;  4IKF A;  3F0C A;  3ZMS A;  2K3P A;  4H0E A;  3G4S I;  3ZMU A;  1MMD A;  3MD2 A;  4H4K C;  1Z0X A;  1Y0U A;  4OU0 A;  1ETQ A;  2IS6 A;  1JUP A;  1K78 A;  2OTL I;  3DP7 A;  4L9N A;  4GXO A;  3T8R A;  1R36 A;  2R0Q C;  2R7X A;  2QCO A;  3PQJ A;  5HLH A;  1OLT A;  3WGG A;  2K9Q A;  4FT8 A;  4PFP A;  2UZK A;  3F22 A;  3QOD A;  5K7F A;  1FTT A;  3JR9 A;  1MMS A;  2QUF A;  1WJB A;  4BKX A;  4F55 A;  3AL0 B;  4II3 A;  4XN0 A;  3LSR A;  2HS5 A;  4EJT A;  3E0J B;  3HOU J;  2O6G E;  4XLA A;  2EFN A;  2BGC A;  4S05 A;  5C4J J;  2DTR A;  5DM7 F;  1ZAR A;  2HPI A;  2MFZ A;  2LFB A;  4UY8 I;  1UAA A;  2E1M C;  1FBS A;  1MBJ A;  5GPA A;  1FYL A;  1HQC A;  4XN3 A;  4XNF A;  4J19 A;  4FX4 A;  3O6B B;  2ZXJ A;  4HDV A;  1WPK A;  1R4N B;  4L9T A;  3JW4 A;  2BXZ A;  1XGO A;  2A05 A;  2XAU A;  4XLP F;  2MH2 A;  1OCT C;  1XCV A;  1IC8 A;  4G12 A;  2BY0 A;  2C6Y A;  2W57 A;  2QSH X;  5IP6 A;  3RQI A;  1N78 A;  3G73 A;  1TWC J;  1K6O A;  4EQQ A;  1MBG A;  3GUD A;  1JTX A;  4A12 A;  3JCU C;  4ESF A;  3JAM Z;  4NNJ A;  2Y9Z A;  2A5Y B;  3GYH X;  4ZC3 A;  2QKM B;  3HRT A;  5EEA A;  5IYB J;  3Q0V A;  3JRA A;  2E34 A;  4KUM A;  4CZZ A;  2LK2 A;  3F8B A;  1IN8 A;  1KA8 A;  2EZH A;  4I01 A;  3HHG A;  5ILV A;  3E6C C;  1FSE A;  1GV5 A;  4BEH A;  4KIC A;  1LFP A;  2MD5 A;  4XLH A;  1QGP A;  2GXG A;  3GTK J;  3KEY A;  3IL2 A;  3KP7 A;  2GA1 A;  2XB5 A;  2NVU B;  3LNQ A;  5JLW A;  2CYY A;  2XRN A;  3DPL C;  4NC6 A;  2PJP A;  4GYI A;  4AID A;  3RIR A;  2L9R A;  3C18 A;  2ECB A;  4L0Y B;  2L2O A;  4IO9 F;  3A2K A;  1T08 B;  4N9I A;  5J6X A;  4A3C J;  2QYO A;  4ENN A;  4MEX F;  5DEQ A;  3L09 A;  3FXO A;  4R79 A;  5EGO A;  3WG9 A;  4UB6 C;  2AO9 A;  3H0D A;  4L18 B;  3HUG B;  3OV8 A;  3OL4 A;  2V26 A;  2MYS A;  3KE2 A;  1ETY A;  2E60 A;  1FOW A;  1YS6 A;  1S8N A;  2JN6 A;  4BS9 A;  1R6R A;  4AIK A;  2BXY A;  2F5E A;  2K5C A;  3DTE A;  5HDG A;  1KGS A;  3G2B A;  4M6V A;  3AKZ A;  4A5M A;  4LB6 B;  2FD5 A;  2HOT A;  3CLO A;  2JMW A;  4C9Y A;  2LC2 A;  5GAG J;  3DBH B;  1SFE A;  4FET A;  1AKH A;  2KP6 A;  2B9S A;  1ERD A;  3HPH A;  4I99 C;  2NOG A;  2EV0 A;  2JZY A;  1QPI A;  3ZPL A;  1E3P A;  3SYT A;  2PMU A;  3MQ0 A;  1A04 A;  5ICF A;  1Y8Q B;  1RC9 A;  3FF5 A;  2WC2 A;  1Z91 A;  2O8X A;  2ZXI A;  3BTJ A;  3HGY A;  3OSF A;  2K4B A;  5BMZ A;  3G1O A;  2MG4 A;  4EGY A;  2R7S A;  3K4L A;  1T98 A;  1K83 J;  5B1B H;  2P81 A;  5LRR A;  3PIP F;  3J7A O;  4PJJ A;  1IV8 A;  3OYB A;  4PJM A;  5CQE A;  2XGC A;  4M9S A;  1J09 A;  3M07 A;  1D1B A;  2VN2 A;  3QP5 A;  5CVV A;  2FBI A;  2STT A;  3HOT A;  1WRJ A;  3E97 A;  3DEE A;  3WTT C;  2HDW A;  3ZCO A;  3S2D J;  4RB3 C;  2EIJ H;  2R7F A;  1BOB A;  4Y7N J;  2ELH A;  2M1B A;  2DT5 A;  3BR6 A;  3I53 A;  1U9N A;  9ANT A;  2MLG A;  3FXL A;  1ZG1 A;  2NYX A;  4LLN A;  1I3A A;  5IP9 J;  4AVZ A;  4KN7 X;  1DUX C;  1D8J A;  5CYV A;  2KIQ A;  4XIC A;  3PFY A;  1ZRD A;  2OA4 A;  4I7H A;  4OIN F;  1H9T A;  4UVB A;  1GXQ A;  4E7L A;  4OMY A;  1TWF J;  2VBY A;  5HLT A;  4LB5 A;  2XAH A;  3J7A Y;  2QQ9 A;  3CUQ A;  5DDG A;  5DCF A;  2HYG D;  2LNB A;  3GBG A;  3PNV A;  3S2W A;  1SD4 A;  3GWZ A;  5D4S A;  1Y6I A;  3K70 D;  3E3V A;  2PMZ A;  4HV5 A;  1F9N A;  2HNH A;  2RVC A;  4G6D A;  1BJA A;  2CW7 A;  4I76 A;  4MTE A;  1GV2 A;  2HOA A;  1Z67 A;  2OZ6 A;  2MC4 A;  2RNG A;  1HST A;  3MVP A;  2GXB A;  1ETK A;  1LDD A;  2WTE A;  4IHW A;  3JRG A;  2VT2 A;  2ETH A;  1ULY A;  3TP3 A;  4CCL A;  4BBS J;  2KIU A;  1TQM A;  3P9K A;  2FU4 A;  3MFK A;  1R71 A;  3ZR8 X;  4C2U A;  3MWM A;  5CVR A;  1S29 A;  3E5Q A;  1JXS A;  2JT1 A;  4L5J A;  1B4A A;  3OS1 A;  2ZME B;  1HBX G;  2UXN A;  3K70 C;  3J7Z I;  3MZH A;  3CLQ A;  3MKL A;  3EQL F;  4LMY A;  1RET A;  3H9G A;  1UHW A;  2LRE A;  2VBZ A;  3DEU A;  1Y1W J;  2NAZ A;  2L7Z A;  3K1N A;  2COM A;  3HOW J;  3RTR A;  1DPU A;  1B1B A;  1MD0 A;  3ML6 A;  3JRH A;  2HOS A;  2NNN A;  3C7J A;  1LVA A;  3BR2 A;  5HVQ C;  3P9I A;  3RZD J;  3ZN1 A;  1S72 I;  3OS2 A;  2KL4 A;  3IUO A;  3VDX A;  2ZSH B;  2DO7 A;  2R5Y A;  4G6T B;  2DFE A;  1L3L A;  3BTC A;  5KCM A;  3RQ4 A;  2P5L C;  3Q9V A;  1S7A A;  5HOO A;  3CES A;  2XPV A;  5HS7 A;  3I59 A;  2FUG 2;  1TW3 A;  3MCZ A;  3LWF A;  2E2H J;  2X4H A;  1R23 A;  2MW8 A;  3CUO A;  4IHX A;  2DA3 A;  2LF7 A;  5K5R A;  1NK3 P;  3FXR A;  2L9V A;  4BE1 A;  3QU3 A;  1SFK A;  4CH7 A;  2D2W A;  2YU9 J;  5LHI A;  1A5J A;  1F1Z A;  1Y0N A;  2RAE A;  3S32 A;  2JA8 J;  2X1E A;  1XGN A;  3FX3 A;  2H1L A;  3GEZ A;  3UNG C;  3LA7 A;  5LD2 C;  2OBP A;  1B9M A;  5LGN A;  1XTA A;  2F5V A;  1QQI A;  2KJB A;  2DQR A;  1R1T A;  4MFE A;  1SEU A;  1SD7 A;  5FD6 A;  2NS7 A;  3HYI A;  3HSF A;  1O3S A;  4A3F J;  2A07 F;  3EYI A;  4P55 A;  1G3W A;  2O03 A;  1YHQ I;  2MLK A;  2VIX A;  5FGM A;  4A93 J;  4OAY A;  1Z6R A;  1OCR H;  2D5V A;  5D6F A;  1BC8 C;  2M7B A;  2DA7 A;  3KX2 A;  3CZ6 A;  2DI3 A;  2HZD A;  2W24 A;  4UUS B;  4U0Y A;  2XSJ C;  3TDZ C;  3GLX A;  4ZDP A;  5KHD A;  2R7U A;  5ICE A;  2KRC A;  3EUH A;  3KCC A;  4ITV A;  3EUA A;  4HLX A;  3S14 J;  2L9S A;  1WQ2 A;  2GQQ A;  2FE3 A;  4JYK A;  4XSZ F;  5E17 F;  3PSF A;  2K86 A;  4Q48 A;  3KYD B;  2CFO A;  1HOM A;  1WJE A;  3BDD A;  4G7Z F;  3NAU A;  5JI6 A;  2OCE A;  5ILU A;  3CMY A;  4XID A;  3A02 A;  2KZV A;  4U87 A;  1VQK I;  3KLN A;  1X3U A;  2W7N A;  4RAF A;  2EWN A;  2QM3 A;  5M3F J;  4BDY A;  2L3D A;  2ELK A;  2JUG A;  3GFI A;  3OSG A;  1QPM A;  3E6D A;  3OOP A;  4PJ0 C;  2KPM A;  2YR2 A;  3QP6 A;  1MZB A;  3CCJ I;  2X1C A;  1JT0 A;  4BQN A;  5M5Y J;  1BC7 C;  1MNE A;  3PUF A;  4U88 A;  3LA2 A;  3IH2 A;  4RAZ A;  1T0F A;  2LKS A;  4CO8 A;  2VQC A;  1ZRE A;  3PO3 J;  2KKO A;  3HC7 A;  1XC5 A;  1FMV A;  3MZY A;  1FYM A;  2DOD A;  3CME I;  1MMN A;  1MSE C;  1DDN A;  2I10 A;  1ON2 A;  2QSF X;  4Y17 A;  4BXU A;  1D5Y A;  2HEO A;  5IT9 K;  2STW A;  4M3E A;  3F3X A;  4Q47 A;  1OCP A;  4IHY A;  1IDZ A;  2PG4 A;  2EPF A;  2K4J A;  1FP2 A;  1RES A;  4PGH A;  2BE5 F;  3VSK A;  4UNO A;  3J80 K;  3H5N A;  5EEG A;  3CJT B;  1O3Q A;  4X1E A;  4D7N A;  1RRJ A;  2QSG X;  1B8I B;  4RB0 A;  3L2U A;  1HLV A;  3H3V K;  2EIM H;  4L5E A;  3DCF A;  3FXQ A;  3KPH A;  4HV6 A;  3JSO A;  2N8G A;  1FLI A;  1FIP A;  1JHF A;  5DTD A;  4XKC A;  1SAU A;  1X1A A;  3BG5 A;  5LEK A;  4PSX A;  3IKT A;  1W7P A;  1U5T A;  1U5T C;  2R92 J;  4ASN A;  2VE9 A;  1VQP I;  3ROU A;  1W0T A;  1QZY A;  3ABT A;  1IN4 A;  2VL8 A;  2M8E A;  4KIT B;  2HGC A;  1PJR A;  2WAF A;  2AXT C;  1WHU A;  3ZP5 A;  3LSJ A;  3LOC A;  4YRV A;  3L2R A;  2MH9 A;  5DD4 A;  3RPU A;  3RKQ A;  1HF0 A;  5E8I A;  4Y33 A;  2M8G X;  4IOC F;  1H8A C;  1OPC A;  1MJ9 A;  2XDV A;  1RKW A;  3O3K A;  4KJZ A;  2VQL A;  3U2R A;  2JA5 J;  1ZTR A;  2F2E A;  2F48 A;  3CCM I;  5GAE J;  2YUS A;  3C3W A;  1KON A;  1XMK A;  4A0Y A;  4KFC A;  4HF1 A;  2P8T A;  3TOA A;  4F92 B;  3BTL A;  1DP7 P;  3PJR A;  3ZMT A;  4C2M J;  1B9N A;  1J0R A;  1FZP B;  1RR8 C;  1KU2 A;  1IGN A;  1ETW A;  4MQ9 F;  3OWT A;  2VQG A;  3IV5 A;  4HOB A;  1UMQ A;  3S15 J;  5IOY A;  3OYC A;  4HEA 2;  1U0J A;  3EPZ A;  3HBL A;  4DYR A;  3JRF A;  4HST A;  4B3A A;  1W36 D;  2JUC A;  1ODD A;  3QQA A;  4PJL A;  3CMA I;  4XLF A;  5FB2 A;  1AWC A;  3MMY B;  1F5T A;  2WAQ A;  2VKH A;  4KT5 C;  3V7R A;  5FKK A;  2GOM A;  1F4K A;  3WE2 A;  4PZJ A;  2XVC A;  3ZN0 A;  4DNC A;  1QNT A;  4EJO A;  1Z6T A;  1SAN A;  2HXO A;  5KK1 A;  2OC6 A;  3CTA A;  4N4N B;  2VI6 A;  2CV0 A;  2B63 J;  4F91 B;  3H36 A;  4Y3O A;  2VLA A;  3AL0 C;  5FRN A;  3BLY A;  2V9V A;  3BG7 A;  1VQ6 I;  2DJI A;  1Y1V J;  2EV6 A;  4OWR B;  1ZAO A;  3IKV A;  4WK8 F;  3FKI J;  1XSD A;  1ZN2 A;  1P4W A;  1V3F A;  2X6O A;  3VFZ A;  2LD5 A;  3BR5 A;  1G2H A;  3UR3 C;  3JRD A;  2OAZ A;  5FLM J;  3DU6 A;  1UHM A;  2IEK A;  1I27 A;  2BZT A;  1IRZ A;  3GW2 A;  1S6L A;  1UFM A;  4BAC A;  4HF2 A;  2JRT A;  2Q0O A;  2VON A;  2D1H A;  1R7J A;  3DXJ F;  4LD5 A;  1K7A A;  3F8F A;  2AQE A;  4BJ6 C;  1IXS B;  4JP0 A;  2CO5 A;  3VYS B;  3GTG J;  2KDZ A;  2JQ7 A;  2Z3Y A;  2XPU A;  3ZRG A;  2QVO A;  2JPC A;  5FLX Z;  2LBF B;  4U0W A;  4CA0 A;  3HZJ A;  4QLC U;  2J5P A;  3T0Y A;  1D0Y A;  1HC8 A;  5H2F C;  1N77 A;  5HS9 A;  1Z1D A;  1OYI A;  3ABU A;  1JGG A;  2HXI A;  3WHC A;  2LKX A;  4GGG A;  4B3X A;  3ECH A;  1WSU A;  4DYQ A;  5A2Q K;  1FOX A;  4BYY A;  3U1D A;  1XGM A;  4BJ5 C;  3V7S A;  2EZI A;  3OYE A;  2V1U A;  2W00 A;  3A0H C;  2RN7 A;  3SHF A;  5E1W A;  3OYL A;  3AG3 H;  2EFO A;  2VJ5 A;  3KIO A;  3CDI A;  1OMI A;  1P7J A;  2NRA C;  3OYH A;  4KIB A;  4A3I J;  3F23 A;  2D45 A;  1LEA A;  1EF4 A;  1J5Y A;  3DKX A;  4KDP A;  3JRC A;  1QHG A;  1X58 A;  1PP7 U;  2B0L A;  1KQ0 A;  3P9C A;  1IDY A;  5FJ8 J;  4HYE A;  4A0X A;  1YIT I;  3HJE A;  2QGU A;  4UHT A;  4EMS A;  4L9J A;  4IPA A;  5E1Z B;  2EV5 A;  4ANJ A;  2QLZ A;  1Z21 A;  4ON0 A;  2KQR A;  4ZZL A;  5C4X J;  4E6K G;  5FKL A;  2R5Z B;  3L1P A;  1ZGW A;  2IT0 A;  3VEP A;  2BY3 A;  4LIT A;  1S9H A;  3WTZ A;  2DT7 B;  2JA7 J;  4N9H A;  4B4C A;  1U8B A;  1T6S A;  3R6S A;  1R1U A;  2CV2 A;  2Y9Y A;  4HA8 A;  1PDN C;  3DTK A;  2O9L A;  2V6E A;  4QSH A;  1E3H A;  1YYV A;  3FHN A;  5LHH A;  2Y30 A;  4GRI A;  4WX9 A;  3JRB A;  3ZQQ A;  3D5S C;  3M7G A;  3S16 J;  2DBB A;  1U2W A;  3V8K A;  3OOU A;  3A0B C;  5JR3 A;  4MIM A;  3DFG A;  4G7O F;  2HPM A;  5D8L B;  2L5Q A;  1TBX A;  2OU2 A;  3G1M A;  2VPL A;  1BM9 A;  3WU2 C;  1KQ9 A;  4F7Z A;  4HNU A;  3KFW X;  3D1N I;  2V1D A;  2L02 A;  1HCR A;  1MMA A;  4M72 A;  1E2X A;  1EJ9 A;  4CGZ A;  3E6M A;  4KT6 A;  2UXX A;  4LJZ F;  2UUZ A;  3P5J A;  4JQF A;  2HVQ A;  4LG3 A;  3FK6 A;  4LGW A;  3JRE A;  2LVS A;  3FM3 A;  2Z5U A;  1O3T A;  2PQ8 A;  3LSM A;  3OR2 C;  1MND A;  2FQ4 A;  2LTP A;  3IP4 B;  2WAD A;  4M6Y A;  3TBI A;  3TDU C;  2E2J J;  2W4S A;  1Y8R B;  3ASO H;  4A69 C;  3DLL F;  1GXP A;  2GZW A;  2VBW A;  1O7L A;  4GCV A;  2ZSI B;  2P4W A;  2HR3 A;  4E7K A;  2DA1 A;  1ZLJ A;  2ZC2 A;  2BHZ A;  4XR6 A;  2M4K A;  2VOD A;  2JPB A;  3DEW A;  2CJJ A;  1YTY A;  3BG3 A;  2XGX A;  3QRF F;  3S93 A;  3KP3 A;  5C44 J;  2GBY A;  4EVI A;  3K9T A;  2H6C A;  2X9D A;  4AYB N;  2ISZ A;  1ETX A;  4W1U A;  3CC7 I;  1ACI A;  1MBF A;  4NC7 A;  3FXK A;  3FWE A;  4EEF G;  5CVI A;  2Y0S N;  3M3Y J;  1ENH A;  4LIU A;  2W25 A;  3V4G A;  2DFI A;  1G3S A;  4NUB A;  5HS8 A;  3MEX A;  2K9L A;  3ONQ A;  1JKQ C;  3FDY A;  1DGR M;  4LIV A;  4QPO A;  4A3D J;  2QBY B;  4C30 A;  5E3O A;  4ESJ A;  3OYI A;  2FNA A;  1YW7 A;  5FKM A;  1YJN I;  3M9A A;  1V4R A;  1VQM I;  2M34 A;  4BQQ A;  1KU9 A;  1V5G A;  1Y56 A;  4IL6 C;  4CYC A;  4XQF A;  4Z6Y A;  4NBQ A;  5GP9 A;  4BGD A;  2XSD C;  3N4M A;  1MSF C;  3GCM A;  5BS6 A;  5HNH A;  1FTZ A;  2ZME C;  3J7Y J;  1LE8 B;  4RAY A;  4AC0 A;  3TGN A;  1ETV A;  1J75 A;  2VOP A;  4LFU A;  2BBY A;  2FX0 A;  3I4P A;  2EB7 A;  2O61 A;  5M5W J;  1I5Z A;  1UHS A;  2NS8 A;  3D5L A;  1YRN B;  5B66 C;  1T95 A;  3QYF A;  3BG6 A;  3FKJ A;  3WTS C;  2G7U A;  1BL0 A;  4LG0 B;  2A6T A;  5BOX A;  5EZG A;  3G71 I;  4Q5S F;  1WJ5 A;  3C1D A;  4UV8 A;  3HPG A;  1O4X A;  2K7L A;  3CP2 A;  1DQU A;  3LL7 A;  4IHS A;  4CIC A;  5L3E A;  2FSW A;  3N97 A;  3M1C A;  4XOT A;  5DYM A;  2MSY A;  1JT6 A;  2L0K A;  1EV7 A;  4KA4 A;  1MMG A;  3WTV C;  3B73 A;  2IW5 A;  5DUI A;  2NVT J;  2X1D A;  5DCM B;  1YJ9 I;  1X4O A;  2EA2 A;  2R7O A;  5CPR B;  3NAR A;  1BN5 A;  5EYR A;  1BI3 A;  5EG0 B;  1LDK B;  3FM5 A;  2GLO A;  4BNC A;  2PLY A;  1S7E A;  2WB1 A;  3CCU I;  1A31 A;  3L2W A;  3M8F A;  4DOZ A;  2DPD A;  1JGS A;  2EFQ A;  1PYV A;  2LY1 A;  3U9G A;  1FY7 A;  4OOI A;  3BWG A;  2AQF A;  2BVL A;  2R7Q A;  1B72 B;  1X4P A;  4XM3 A;  2OPT A;  5A2Q Z;  1K78 B;  2R7T A;  3A01 A;  3B02 A;  1XPX A;  3DKY A;  1O7F A;  1YS7 A;  3I64 A;  2QQ8 A;  2WY7 Q;  3L00 A;  1G59 A;  3COA C;  5J4Y A;  5D5W B;  1RIO H;  3OYF A;  4RM2 A;  4XRF A;  3OR1 C;  1GHC A;  2PBI A;  5HDN A;  2JWT A;  2HKX A;  4M9Z A;  2I8D A;  4UUS A;  1FMW A;  2WV1 A;  2H8R A;  1P7I A;  1DPR A;  1LQ1 A;  2YX4 A;  1YIO A;  1YE9 A;  2IGM A;  4FX0 A;  3BQZ A;  4BY1 J;  1BR2 A;  3BZC A;  4EGZ A;  1I3Q J;  3BOQ A;  1WJF A;  4ZJZ A;  4WWC A;  1WZ2 A;  1IRG A;  4UVC A;  3C2G A;  3ZQF A;  2KJC A;  4RS8 A;  1NHA A;  4IEJ A;  4A3M J;  4GFB A;  1I1S A;  4HBL A;  2CUJ A;  3BJO A;  3BPX A;  1GLN A;  3J81 K;  1TTY A;  3VYT B;  3CMM A;  2Z9O A;  2X0L A;  5GTH C;  2ELJ A;  1XS9 A;  1JKP C;  1KZH A;  2GIV A;  2ZJ2 A;  1DGW Y;  3ELK A;  3CCV I;  1LUJ B;  1Z77 A;  4UXN A;  3NRV A;  3O8G A;  1JTY A;  2BY2 A;  3UKG A;  1H9G A;  3GLL A;  3K0L A;  4UB8 C;  3F72 A;  3S1N J;  2HU9 A;  3IAS 2;  3KP2 A;  2ZFW A;  4EAT A;  3QYB A;  3S17 J;  4XRS G;  4A6E A;  4F93 B;  4WCG A;  2KT0 A;  1SMY F;  5ICG A;  1X1B A;  1D0X A;  3CCE I;  5K7H A;  3GO5 A;  2L7K A;  4HX4 A;  2LSO A;  3LAP A;  1GVJ A;  3BR0 A;  1SFU A;  1H89 C;  2H27 A;  3OYN A;  4DQ2 A;  2BHY A;  1IW7 F;  2K9N A;  5E3L A;  3L7W A;  2KMU A;  2AHQ A;  1Z7L A;  3ASN H;  2ZBK A;  1S5L C;  1OYW A;  2CW8 A;  3BZK A;  3IWZ A;  4CCJ A;  1J59 A;  2F4O B;  1B59 A;  1D1A A;  3SEQ A;  2GIZ A;  1VQ8 I;  4BDZ A;  2EIK H;  3DBR B;  4BEH B;  1TNS A;  3CJR B;  2QA4 I;  4PFO A;  1BIA A;  2G0E A;  4BBR J;  1MBK A;  5L3D A;  2A69 F;  1FT9 A;  1QHH D;  1X2M A;  5D5X B;  3IRR A;  5HLI A;  4A3L J;  2IS2 A;  2WA0 A;  4E7S A;  3WU1 B;  2HTS A;  2ZKZ A;  4P5O A;  2H1K A;  3CDH A;  2P5V A;  4U0V A;  2XV4 S;  1RUO A;  4AU7 A;  1JI8 A;  2LY9 A;  2O0Y A;  3QOP A;  4HRI A;  4D1Q A;  3RYP A;  3HOS A;  2K85 A;  2COB A;  3K1P A;  5EGO B;  1FNN A;  2AXL A;  5JVT A;  3BCA A;  3MAJ A;  2M0M A;  2DK5 A;  4BHB A;  2DQL A;  5BNG A;  4TV7 A;  2X6W A;  5DS9 A;  5D4R A;  1RI7 A;  1OJL A;  4G6Q A;  1X2N A;  2OCC H;  2EIN H;  3OYJ A;  3LFU A;  1W5S A;  2GWR A;  3W2A A;  2I5U A;  5F04 A;  4DIQ A;  3V8L A;  2E7W A;  1SAX A;  1OFC X;  2HFH A;  3F8M A;  3TO7 A;  3LFK A;  4BHC A;  2P0W A;  4JOM A;  3M4O J;  4J00 A;  4A3E J;  2Q2E A;  2IVM A;  2ZNZ A;  3WGI A;  3VSL A;  4BU2 A;  2DU9 A;  1FX7 A;  5DV5 A;  1GVD A;  2Y0M A;  5B5E C;  4HNT A;  5J1R A;  2JVG A;  4JK1 X;  2ICW G;  4MQV A;  2O3F A;  3WTU C;  2XUB A;  5F1R A;  1AKH B;  2QKL B;  1MDM A;  4BHP A;  2FBK A;  3TOB A;  5LHG A;  2LRD A;  2ZJQ F;  2QWW A;  1D0Z A;  1YX3 A;  1U8R A;  2PFB A;  5ERI A;  3FXJ A;  3JSP A;  2HDD A;  1QZZ A;  3B6A A;  4HQM A;  5TIS C;  2PI0 A;  4AVP A;  2UV1 A;  5CQG A;  2W48 A;  1J2X A;  3CO7 C;  1POG A;  2VKV A;  3H9J A;  1IUY A;  2CUE A;  2QQA A;  4HF0 A;  4A5N A;  3HOV J;  2Y2Z A;  4G9Y A;  4ZDO A;  3V42 A;  1H0M A;  2CQQ A;  3LST A;  4HZF A;  5J8F A;  1LNW A;  4HW0 A;  2VXD A;  3GTJ J;  2ZCW A;  4O5V A;  5FLV A;  5J1U A;  1BBY A;  1UEL B;  2EZL A;  1SC7 A;  1PUF A;  2BEO A;  1J9I A;  2VAS A;  1U6G A;  1N75 A;  2ID6 A;  1VQN I;  4BQO A;  5IYD J;  2RRE A;  5L3F A;  2A3S A;  3GTL J;  2JA6 J;  3E6B A;  1FSH A;  3PSI A;  3SQN A;  3I5U A;  1ZRF A;  5F1J A;  3I71 A;  2NXN B;  2VXZ A;  1RPW A;  4B43 A;  5E18 F;  1P4X A;  3CQZ J;  3HRM A;  4RMN A;  4CCM A;  4E7Z A;  1G6N A;  2PMZ N;  3C2H A;  1SVL A;  2ESH A;  2IA0 A;  4HLY A;  1FEX A;  1Z3Y A;  1K61 A;  3KEQ A;  1LEB A;  3BCB A;  2E2I J;  4ENM A;  2X48 A;  3V7C A;  4IQ4 A;  1VQ7 I;  3HL2 A;  3E1S A;  2BVM A;  3CUQ B;  3LSG A;  5BPD A;  2G9W A;  4XL9 A;  1W0U A;  1G8X A;  1ZKG A;  4UUV A;  2W1O A;  5L3B A;  1EKE A;  3H5R A;  2WWY A;  3SDG A;  2FNP A;  1CF7 A;  2QEN A;  2L54 A;  4MEY F;  2DTZ A;  1ITY A;  3DKW A;  1HW2 A;  5J8C A;  2NS0 A;  1MH4 A;  2PJR A;  2GOX B;  4BXF A;  3HOY J;  3TW7 A;  4Y52 J;  3BJA A;  1SVM A;  4DYC A;  3MKY B;  1KYW A;  2V1X A;  1ZHF A;  4X0G A;  3CC4 I;  1FJL A;  3Q0W A;  4NQW A;  4NHJ A;  2L01 A;  4AIJ A;  2VOO A;  4IVN A;  2LKP A;  1R5H A;  2NNY A;  2ZO4 A;  4FQG A;  2EH3 A;  2FXA A;  2DOF A;  3RKX A;  4E7I A;  4P96 A;  5D5U B;  3D0S A;  3PQK A;  2F5C A;  3MKZ A;  1UB9 A;  4DBR A;  2DFH A;  5E3N A;  3L9F A;  5IYC J;  4ZTF A;  2R7Z J;  1WCM J;  2LR8 A;  1KU3 A;  2GA2 A;  5AIP A;  3W2V A;  4C3I J;  5GAH J;  3REO A;  2R5Y B;  2FA5 A;  3ABM H;  1T2K A;  4FAS D;  4LLL A;  5K5Q A;  4M3D A;  2JA2 A;  1YX5 A;  5GAD J;  4YFX F;  3SFZ A;  1DP3 A;  2XAQ A;  2Y69 H;  3SZP A;  4RGS A;  3I59 B;  1JKO C;  5DD8 A;  1IV6 A;  2V7F A;  2ECC A;  1V5E A;  2DT6 A;  4YIF A;  3S3N A;  2L4M A;  2KRF A;  2HVR A;  2XAS A;  2DYR H;  3E7L A;  1E0E A;  2ZXW H;  4PCQ A;  4YEL A;  3GFM A;  1R5G A;  3SZT A;  4AM3 A;  3FBN B;  2VJ4 A;  2IGK A;  1EH8 A;  1YQA A;  2XAJ A;  2R5Z A;  3C2B A;  2J5O A;  1QRY A;  2BW3 A;  3OYA A;  3OYD A;  1RUN A;  2AS5 F;  2V9K A;  3ZQG A;  4NC8 A;  4P9F A;  3ZOB A;  4XOP A;  2WV0 A;  5CLS A;  4ZYH A;  1LPQ A;  1UG0 A;  1RZ4 A;  1SD5 A;  1YJW I;  4OIP F;  3ECO A;  2A6E F;  2DMU A;  3FXU A;  2DMP A;  2ZFU A;  1YIJ I;  3BY6 A;  3ZQ7 A;  1Z3X A;  4OIR F;  4B48 A;  1BI0 A;  5JLX A;  3FMS A;  4I02 A;  3P7N A;  1WH5 A;  3KP4 A;  2GAU A;  4EJV A;  2HQN A;  2TCT A;  1X3Z B;  2V6C A;  2DLL A;  5F08 A;  4E7H A;  1IO2 A;  2MC3 A;  3RJP A;  3H35 A;  1O57 A;  2OV7 A;  4IHT A;  1HKS A;  2M0C A;  3KZZ A;  3HXL A;  2IGO A;  5BPI A;  1IZ1 A;  1BA5 A;  4MNU A;  3FMQ A;  2VT3 A;  3LQQ A;  5M5X J;  1E17 A;  1FIA A;  1V5F A;  2BV6 A;  2EQR A;  1SVO A;  5B3S H;  3G6E I;  3WU0 A;  2JK3 A;  3I9V 2;  2L9N A;  5KNL A;  1TP4 A;  4Q4Z F;  2E36 A;  4M3G A;  2TRT A;  4IRG A;  4HQE A;  2DMN A;  1W36 C;  4IRI A;  2F5D A;  1JE8 A;  2LLK A;  2LG4 A;  5D8K B;  2FOW A;  4A0Z A;  1ZEL A;  3GTM J;  1V55 H;  2FQ3 A;  2FMY A;  2HTJ A;  3F21 A;  1J7K A;  5K5O A;  2L4A A;  3L2C A;  3CCR I;  4CCN A;  3ZMV A;  1WH7 A;  2A6H F;  4M73 A;  3BR1 A;  3CJN A;  3K69 A;  2DOA A;  3DV8 A;  4KN4 X;  3D5R C;  2D1V A;  4XON A;  4J01 A;  1TWA J;  2Y31 A;  1XB4 A;  3K4M A;  3FIS A;  3QPT A;  3OIP A;  2DDB A;  1D1C A;  4I0B A;  1JJ6 C;  4FCY A;  3NWT A;  3T5X A;  5E3M A;  3ZQC A;  4BQA A;  1IAW A;  3H3U A;  4RM3 A;  5KAI C;  4KYW A;  1M1E B;  1HSJ A;  5DUK A;  5D5V B;  3DF8 A;  1I1G A;  1W4M A;  2HQA A;  1JUM A;  3Q3S A;  5E79 C;  2M30 A;  3WGH A;  2DW4 A;  2W84 A;  2YSR A;  3R0A A;  1LKX A;  4QPQ A;  1K79 A;  4EM2 A;  2O7O A;  1DU6 A;  2VJI A;  3BR3 A;  4S04 A;  3TO9 A;  4DZP A;  4FIS A;  5GPC A;  1BR1 A;  5E20 A;  3HKZ A;  3WE3 A;  4M6X A;  5IT3 A;  1I50 J;  1ON1 A;  3LMM A;  3RYR A;  2FOK A;  1A36 A;  3A4C A;  2VE8 A;  2IGN A;  4BXX J;  2E71 A;  1U9O A;  4B8X A;  1Q1V A;  2K9M A;  2Z1D A;  2CV1 A;  4IX7 A;  1X1P A;  3W3C A;  4ZYD A;  4XRM A;  3I4N J;  2M9H A;  3H5A A;  5F27 A;  3DLA A;  5FD5 A;  2CS3 A;  1W7P B;  1U5T B;  2MGQ A;  3A03 A;  3GZ5 A;  1MNM C;  2IXS A;  3BPV A;  1VI0 A;  1NG6 A;  3QU6 A;  1R49 A;  4DZJ A;  2HKO A;  4EM1 A;  3PUB A;  2CU7 A;  4WXC A;  2RGV A;  2DJN A;  2OZU A;  4II2 A;  3PIO F;  1X3W B;  3CCS I;  2E35 A;  3NWS A;  5CKT A;  3RSN A;  3GTP J;  3HUG A;  1YRN A;  1UST A;  2R3S A;  4D5F A;  5J1Y A;  2LYC A;  1HDD C;  1X1D A;  1F43 A;  4G8X A;  5F0C A;  4Y13 A;  2OD5 A;  2ZB9 A;  4CXF A;  4LG0 A;  1EH7 A;  1S7O A;  1F36 A;  2LF8 A;  3FIW A;  5M3M J;  3F8C A;  5ILS A;  4N4O B;  4E4H A;  3ZQI A;  5IT9 Z;  1VQO I;  3QPS A;  4D0P A;  4ESB A;  4PUS A;  2KHM A;  1BJZ A;  1G3Y A;  5BQT A;  4I98 B;  4ZYE A;  1TZL A;  3HHH A;  2P7C B;  4YIR X;  3F8N A;  4G94 A;  4FE4 A;  1MJB A;  3EYY A;  4YFN F;  3PL8 A;  3J80 Z;  4DW6 A;  4WF2 A;  2R4G A;  4AUX A;  2E5Z A;  1XN7 A;  1ZGA A;  4I6Z A;  2CGP A;  5LGT A;  1VQ9 I;  1VTN C;  5E8G A;  3W6K B;  4MHG A;  2WAQ N;  1SFX A;  2DOE A;  1R00 A;  1T56 A;  2PEX A;  1Z9C A;  2KZG A;  1P92 A;  2E5N A;  2YX7 A;  2RC4 A;  2FEZ A;  3NEU A;  4M3B A;  4CDG A;  4UUT A;  1B72 A;  2DA4 A;  4FTH A;  3HOZ J;  4YFK F;  1ZG5 A;  3PM1 A;  1QO0 D;  1T38 A;  4QTR A;  2EFW A;  1UJ8 A;  2E1C A;  2LP0 A;  5H20 A;  4D9J A;  3KYL A;  2YU3 A;  1CQT A;  2VC1 A;  3BP8 A;  4BL0 B;  2UWM A;  4XKV A;  3WG7 H;  2IS4 A;  3TED A;  3I0T A;  3KYC B;  3VOE A;  4F52 A;  4A2U A;  1AHD P;  1EH6 A;  1K4S A;  2L7F P;  2V1N A;  5IY5 H;  2QF7 A;  4DBQ A;  3TKY A;  1KYZ A;  1ETO A;  2EK5 A;  2EJR A;  3PFI A;  2H8W A;  3HSR A;  1KU7 A;  2HDC A;  1SMT A;  3KZY A;  1I6X A;  1GDT A;  4OAZ A;  4MO7 A;  3S1R J;  2XHK A;  4HAM A;  2Z2S B;  2DCE A;  3BT9 A;  4OMZ A;  1BI1 A;  1JHH A;  1FC3 A;  1TW2 A;  1OIS A;  3TW6 A;  3JRI A;  1IXC A;  1HKT A;  3CO6 C;  3M8E A;  1YW8 A;  4MFD A;  3IH4 A;  2DDA A;  1A35 A;  1R22 A;  3DU5 A;  3HKZ N;  2IA1 A;  2R7W A;  1IN5 A;  4PSW A;  1O3R A;  3AG2 H;  4M71 A;  4BE0 A;  1LDJ A;  5F0H A;  1IN6 A;  2L7M P;  3BTI A;  5ED4 A;  2NVY J;  1PVE A;  2XC7 A;  3L2Q A;  1ZK8 A;  3F9K A;  3S2H J;  2QQB A;  3OMY A;  1TQP A;  3BRO A;  3H1C A;  3N05 A;  1LJ9 A;  2CQN A;  2CSO A;  4C3J J;  5L3C A;  1HW1 A;  4L0Z B;  1MW7 A;  2VBX A;  1IRF A;  2ZME A;  4KMU X;  1A6I A;  3BQY A;  5JVG F;  2H94 A;  2FJ1 A;  3R61 A;  3OY9 A;  4K2E A;  5EJC A;  1XG1 A;  1SFO J;  2CH0 A;  4MLO A;  2X6Y A;  4IRH A;  4ZYG A;  1W1W E;  3K4C A;  4RBO A;  1SD6 A;  5F0F A;  4ETS A;  4A3G J;  3AG1 H;  2KIF A;  3LA3 A;  5C3E J;  1BW5 A;  2OF7 A;  4CZC A;  1XGS A;  4B47 A;  2XRO A;  1ZQ3 P;  4I0A A;  4FE7 A;  3I58 A; 
#chains in the Genus database with same CATH homology
 3LOC A;  1MBE A;  3O8H A;  3RKQ A;  1HF0 A;  5BNG A;  5DS9 A;  2VKE A;  2M8G X;  1H8A C;  1OJL A;  1X2N A;  3GTO J;  1RKW A;  5F04 A;  5FKN A;  1OFC X;  5FKO A;  1H88 C;  2DA6 A;  2JA5 J;  2NVX J;  1ZTR A;  3M4O J;  1IUF A;  4A3E J;  2YUS A;  1QVU A;  1MBH A;  1JKR C;  2EBI A;  1GVD A;  5J1R A;  4LOC A;  3BTL A;  3B6C A;  1AU7 A;  1IJW C;  3S1Q J;  4C2M J;  1AKH B;  5EG0 A;  5EZH A;  1IGN A;  1RR7 A;  4V2F A;  3F0C A;  1ETW A;  3W6V A;  3IV5 A;  1APL C;  1UMQ A;  3S15 J;  1Z0X A;  2HDD A;  5IOY A;  1ETQ A;  3B6A A;  4NDL A;  1JUP A;  3HBL A;  4DYR A;  3JRF A;  4B3A A;  2W48 A;  1POG A;  2R0Q C;  2VKV A;  2CUE A;  2QCO A;  2CQX A;  3QQA A;  3HOV J;  2Y2Z A;  4JX4 A;  2K9Q A;  2CQQ A;  1TC3 C;  5FKK A;  2DMQ A;  5K7F A;  1FTT A;  3VPR A;  3JR9 A;  3GTJ J;  5FLV A;  5J1U A;  1VFC A;  2VUM J;  2EZL A;  4BKX A;  3LSR A;  1SAN A;  1PUF A;  1BW6 A;  3HOU J;  2HXO A;  4HNV A;  2ID6 A;  2VI6 A;  2YS9 A;  4BY7 J;  2B63 J;  5IYD J;  3CCY A;  5C4J J;  3GTL J;  2JA6 J;  1Y1V J;  2LFB A;  5F1J A;  2DN0 A;  3FKI J;  1MBJ A;  3PO2 J;  1RPW A;  5GPA A;  2HI3 A;  3CQZ J;  4J19 A;  2X6O A;  1G2H A;  2LD5 A;  3BR5 A;  2PMZ N;  3JRD A;  1WPK A;  1FEX A;  5FLM J;  4IHV A;  2EZK A;  1K61 A;  2E2I J;  2X48 A;  2IEK A;  3LSG A;  1OCT C;  1IRZ A;  1IC8 A;  4G12 A;  1W0U A;  1ZKG A;  5HOD A;  5IP6 A;  3RQI A;  3SDG A;  1TWC J;  1MBG A;  2M2E A;  4JP0 A;  1JTX A;  3SFI A;  3GTG J;  2DTZ A;  2KDZ A;  2Y9Z A;  1ITY A;  2XPU A;  1VF9 A;  1DU0 A;  4A3B J;  5EEA A;  5IYB J;  3GTQ J;  1MH4 A;  3Q0V A;  3JRA A;  2LK2 A;  1JGG A;  2HXI A;  3WHC A;  2EZH A;  3TW7 A;  2LKX A;  3HOY J;  4Y52 J;  1GV5 A;  3H0G J;  4D7M A;  3HEF A;  4DYC A;  4DYQ A;  1B8I A;  2ME0 A;  4CYC B;  3GTK J;  1FJL A;  2EZI A;  3Q0W A;  2GM4 A;  2XB5 A;  2ME6 A;  3LNQ A;  5JLW A;  5EDN A;  2L9R A;  2EH3 A;  2ECB A;  1P7J A;  3K2A A;  1R9T J;  4A3C J;  5E3N A;  5IYC J;  4A3I J;  2R7Z J;  1WCM J;  2LR8 A;  4C3I J;  3ZQL A;  4QIW N;  5EGO A;  1EF4 A;  2R5Y B;  3QPL A;  3JRC A;  2AO9 A;  1X58 A;  4M3D A;  5FJ8 J;  1IDY A;  1ETY A;  2K9S A;  2HQ5 A;  1UG2 A;  2JN6 A;  1JKO C;  1IV6 A;  2WB1 N;  2ECC A;  5C4X J;  5FKL A;  2R5Z B;  3IH3 A;  5IPA A;  2E1O A;  3L1P A;  3E7L A;  1ZGW A;  4M6V A;  2JA7 J;  4B4C A;  2FD5 A;  2HOT A;  1U8B A;  2JMW A;  1T33 A;  2R5Z A;  3C2B A;  1QRY A;  3ZQG A;  5IOZ A;  2Y9Y A;  2O9L A;  3ZOB A;  4QSH A;  1AKH A;  2DMU A;  2Y30 A;  2DMP A;  2NOG A;  3JRB A;  1QPI A;  3HOX J;  3S16 J;  5JLX A;  3OOU A;  3A01 B;  4MIM A;  1WH5 A;  2TCT A;  3BTJ A;  2VPR A;  3G1M A;  3HGY A;  5F08 A;  3OSF A;  3G1O A;  2MG4 A;  1HCR A;  1K83 J;  3D1N I;  2M0C A;  2P81 A;  4D5C A;  1BA5 A;  2XRL A;  2XGC A;  5M5X J;  1FIA A;  2EQR A;  3FK6 A;  3JRE A;  2JK3 A;  2LVS A;  4M3G A;  2TRT A;  2DMN A;  4ABZ A;  2LLK A;  2FQ4 A;  2LTP A;  3GTM J;  3S2D J;  2E2J J;  4A69 C;  4Y7N J;  3BR6 A;  9ANT A;  1U9N A;  3HB9 A;  3ZQH A;  1E3O C;  1MH3 A;  1WH7 A;  5IP9 J;  3BR1 A;  2DA1 A;  4B1R A;  4XIC A;  1TWA J;  1WI3 A;  2Y31 A;  2XGD A;  3DEW A;  2CJJ A;  3BG3 A;  3FIS A;  4XRS A;  3S1M J;  1TWF J;  1JJ6 C;  4FCY A;  1ORK A;  5E3M A;  5C44 J;  2GBY A;  3ZQC A;  4A3K J;  2X9D A;  4AYB N;  1TWH J;  3GBG A;  1QVT A;  1ETX A;  1JUM A;  3Q3S A;  4W1U A;  1MBF A;  2E19 A;  3BG9 A;  1RKT A;  4EEF G;  1LFU P;  4I76 A;  1GV2 A;  2HOA A;  2Y0S N;  3M3Y J;  2O7O A;  1DU6 A;  1ENH A;  3MVP A;  3BR3 A;  4DZP A;  5GPC A;  4FIS A;  1ETK A;  4IHW A;  2R93 J;  3JRG A;  3TP3 A;  4BBS J;  1JKQ C;  1I50 J;  3FK7 A;  4A3D J;  3SJM A;  5E3O A;  4M3F A;  4BXX J;  5FKM A;  2M34 A;  1U9O A;  3MKL A;  1Q1V A;  4CYC A;  5EF6 A;  1RET A;  5GP9 A;  2XSD C;  1JUS A;  1JJ8 C;  1MSF C;  4XRM A;  1FTZ A;  3I4N J;  2M9H A;  3RZO J;  5F27 A;  1LE8 B;  4AC0 A;  1Y1W J;  1ETV A;  2L7Z A;  3HOW J;  2MGQ A;  3A03 A;  2FX0 A;  1MNM C;  3JRH A;  2HOS A;  5M5W J;  1UHS A;  2NS8 A;  1VI0 A;  1YRN B;  3BR2 A;  4DZJ A;  3RZD J;  3I4M J;  2IAI A;  2CU7 A;  2DJN A;  3K7A J;  2R5Y A;  2CUF A;  1BL0 A;  4RDU A;  3GTP J;  1GT0 C;  5EZG A;  1YRN A;  3BTC A;  4D5F A;  5J1Y A;  1O4X A;  1HDD C;  1F43 A;  5F0C A;  2XPV A;  2ZB9 A;  3CDL A;  1GUU A;  1F36 A;  3FIW A;  5M3M J;  2MSY A;  2E2H J;  1JT6 A;  3ZQI A;  2L0K A;  3QPS A;  2NVT J;  2MW8 A;  1BJZ A;  4X6A J;  2DA2 A;  4IHX A;  2DA3 A;  1NK3 P;  3TP0 A;  4FE4 A;  3NAR A;  5EYR A;  2YU9 J;  4DW6 A;  2GLO A;  5EG0 B;  2JA8 J;  2RAE A;  1A5J A;  1S7E A;  4AUX A;  4C3H J;  4I6Z A;  2DA5 A;  2WAQ N;  4MFE A;  1B72 B;  2NS7 A;  2CRG A;  1T56 A;  4W97 A;  2OPT A;  4A3F J;  1ZR4 A;  3A01 A;  2XB0 X;  4A93 J;  1WGX A;  4M3B A;  1ZR2 A;  3MN2 A;  2D5V A;  2O8K A;  4UUT A;  1B72 A;  1NK2 P;  2K40 A;  2DA7 A;  2DA4 A;  2XGE A;  4FTH A;  3HOZ J;  3PM1 A;  4UUS B;  3HGG A;  4QTR A;  2JJ7 A;  2JWT A;  2LP0 A;  1IG7 A;  1CQT A;  1I6H J;  3S14 J;  1PUF B;  4UUS A;  4JX5 A;  4JYK A;  3TED A;  2WV1 A;  2H8R A;  1P7I A;  1AHD P;  4XK4 A;  2L7F P;  2QF7 A;  3BQZ A;  1HOM A;  4BY1 J;  1ETO A;  4V2G A;  3NAU A;  1I3Q J;  3CMY A;  4XID A;  3A02 A;  1GDT A;  3ZQF A;  5IP7 J;  4MO7 A;  5M3F J;  4IEJ A;  4A3J J;  4A3M J;  2ELK A;  3OSG A;  4GFB A;  1HDP A;  1NTC A;  3HDD A;  3OIO A;  3S1R J;  2NVQ J;  1XS9 A;  3BT9 A;  3LSP A;  1JKP C;  4JX6 A;  1JT0 A;  5M5Y J;  1U78 A;  1Z77 A;  3TW6 A;  3JRI A;  3O8G A;  1JTY A;  5K7Z A;  2ID3 A;  3IH2 A;  3UKG A;  4MFD A;  3S1N J;  3IH4 A;  3PO3 J;  3S17 J;  4XRS G;  3HKZ N;  2KT0 A;  1XC5 A;  1MSE C;  2I10 A;  5K7H A;  5F0H A;  1D5Y A;  3BR0 A;  1H89 C;  4M3E A;  1OCP A;  2L7M P;  5J3L A;  4IHY A;  2K9N A;  3BTI A;  5E3L A;  1IDZ A;  4S0H B;  2NVY J;  2AHQ A;  1ZK8 A;  2XPW A;  3S2H J;  1RES A;  2HYJ A;  3Q0U A;  4C3J J;  1VND A;  4X1E A;  4D7N A;  1B8I B;  2G0E A;  4BBR J;  3G1L A;  1HLV A;  1MBK A;  1LFB A;  3H3V K;  1A6I A;  3BQY A;  1X2M A;  4A3L J;  4L5E A;  3DCF A;  2FJ1 A;  1SFO J;  1XG1 A;  2H1K A;  2N8G A;  2DMT A;  1FIP A;  5DTD A;  4MLO A;  3BG5 A;  1LE8 A;  4RBO A;  5F0F A;  2LY9 A;  4A3G J;  3HM5 A;  2R92 J;  1TWG J;  5C3E J;  2COB A;  1W0T A;  1BW5 A;  2OF7 A;  3WHB A;  5EGO B;  2IBD A;  1ZQ3 P;  4FE7 A;  3LSJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...