3GFJA

Crystal structure of the st1710 mutant (r89a) protein
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
141
structure length
141
Chain Sequence
ENRIQIMSTIAKIYRAMSRELNRRLGELNLSYLDFLVLRATSDGPKTMAYLANRYFVTQSAITASVDKLEEMGLVVRVRDREDARKILIEITEKGLETFNKGIEIYKKLANEVTGDLSEDEVILVLDKISKILKRIEEISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords 146aa long hypothetical transcriptional regulator
publication title ST1710-DNA complex crystal structure reveals the DNA binding mechanism of the MarR family of regulators.
pubmed doi rcsb
source organism Sulfolobus tokodaii
total genus 55
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2009-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3gfjA00
3WTZA 1Q1HA 2UXXA 1KU7A 1FP2A 2CWEA 3SHFA 3N4MA 1IN4A 4RGUA 3MFKA 5F6FA 1FYMA 1B4AA 2X4HA 2DK8A 1EH6A 5EEGA 5FFXA 1G4DA 1UB9A 4IXAA 3WTTC 2PMHA 2UZKA 4UV9A 1XN7A 2J5OA 4IPAA 1R7JA 2RDPA 1R23A 3NRVA 4N0BA 1U8RA 1XGOA 3WGIA 1IN5A 2DLLA 2QVOA 5KK1A 4FX0A 3M9AA 3V8KA 2M1BA 3WGGA 3RYPA 3FX3A 3SQNA 4OIOF 1DP7P 1L3LA 4M72A 4LMYA 4MQ9F 3WTXC 4LFUA 4A2UA 4Z2YA 4M74A 4ESBA 4Y17A 2P7CB 3DXJF 3R0JA 3CLOA 2HWVA 3RIRA 2P7VB 1R1VA 4EJTA 4L5IA 2FQ3A 3BOQA 2VE8A 4G6QA 3JAMK 2QQBA 4GYGA 2JTVA 3BJ6A 3C1DA 1K7AA 3V7RA 2EJRA 3SZPA 3LA2A 2DBBA 3LA3A 2VODA 4G94A 3MZYA 2XAFA 2FSWA 4HF2A 5DUKA 1J2XA 4HLXA 1L0OC 4I0AA 4A12A 1LDKB 4R8HA 2QUFA 3MEXA 1J5YA 3GZ5A 2CGPA 4UXNA 5K5QA 2V1UA 2V9VA 3GVAA 1MD0A 3VFZA 1GVJA 3BDDA 4G6DA 3WE3A 4S04A 4G7OF 4KFCA 1FSHA 2BV6A 2Q0OA 3E97A 2MBFA 2STTA 2JSCA 3S2WA 3EDPA 1SD6A 2CSOA 5IT9Z 3IC7A 5LRRA 2NAZA 1SD5A 1B9NA 3PFIA 2KKOA 2ISYA 3TOBA 4HDVA 5H6QA 2FMYA 3WE2A 2K4JA 2L3DA 4Q48A 3FXRA 4DNCA 4M71A 2A68F 2ZBKA 3F8CA 4YIFA 3L7WA 1QPMA 1S3JA 4I01A 4A0XA 5ILUA 3CUQA 3R0AA 3V8JA 1BC8C 2LF8A 3BROA 3ELKA 3MQ0A 4HA8A 1Z91A 1FYKA 4NHJA 5H20A 3HRTA 3U2RA 4HYEA 4BYYA 2WWYA 3I58A 3GFJA 5ICCA 4MHGA 5BPIA 1SAXA 1IZ1A 2V79A 5E8IA 2GAUA 5LEJA 3CDHA 3K1NA 3HHHA 3VOEA 3CUQB 3MWMA 5F64A 1R36A 2HTJA 4ENKA 1ZRDA 2XASA 5J6XA 4EM1A 1KU3A 3CUQC 1RNLA 1KQ0A 1IUYA 5FD5A 3LWFA 3WTSC 4L9TA 1KQ9A 3KFWX 3DPLC 1G3WA 2OQGA 1OR7A 1RIOH 4I0BA 4WK8F 4MQVA 4ZYGA 2COMA 3TO9A 4XLPF 1IRGA 3R6SA 1ZAOA 2PLYA 4IRGA 2F5EA 2H09A 1B59A 3K69A 3P7NA 4RS8A 4L18B 1QBJA 3J81K 4LK0F 1LEBA 2VXZA 1SD4A 2EFNA 4KIFA 4HX8A 3DFGA 4UHTA 2E1CA 5LLQA 3WTUC 3N97A 3IL2A 1BI3A 1AWCA 1XGMA 1GXQA 3GUDA 2CO5A 5DCMA 2DU9A 1I5ZA 1JHHA 1PP7U 1P4WA 1XB4A 3I54A 2OA4A 1C0WA 2O3FA 3P9KA 1S8NA 5J8CA 2L54A 1SFXA 1TQMA 2QLZA 2P4WA 2FBKA 3IWZA 1XDSA 3KLNA 1QZZA 4AD9A 5DCMB 2EWNA 1D3YA 2M45A 2EFOA 1P4XA 1K79A 1J75A 2FMLA 5CVIA 2QBYB 2OAZA 1YLFA 2HDCA 4KT5C 4FT8A 1JE8A 1QQIA 5D5VB 3BJAA 2BE5F 1Z05A 1ZRFA 3BPXA 3GLXA 4Q47A 1NHAA 3L9FA 1BOAA 4KDPA 1MJAA 2XVCA 2L4MA 1PUEE 1BJAA 1W7PA 2BGCA 2XAJA 1WKMA 2ISZA 1UHWA 4BH9A 3BPVA 2MH2A 2ZXJA 4EJWA 2QWWA 2XGXA 4I02A 4WF2A 2KIFA 1R5HA 3P9IA 3VODA 2M5WA 3WTVC 4GO1A 4EJUA 5BMZA 2FF4A 3EUHA 3CUOA 1KYZA 4U88A 3JTGA 1R22A 1W7PB 3VB2A 1REPC 5ICGA 3ML6A 2VBWA 1LQ1A 4CO8A 1ZGAA 3HTSB 1UCRA 2FA5A 2NRAC 1FT9A 2GWRA 4IRIA 1TLHB 3HIFA 4CHUA 2V6CA 1ZN2A 2MD5A 3JAMZ 1FBSA 3F8NA 1YYVA 5D4RA 2GA1A 1XD7A 3M8EA 4EM2A 2QZ8A 2OU2A 4RAZA 3K1PA 2QYOA 3RYRA 3T0YA 3CO6C 1BI2A 1W5SA 1SD7A 3HRMA 4B09A 1IXRC 5D5WB 1H9GA 3V8LA 1PP8F 5FLXK 2LF7A 1KGSA 2WTEA 1KA8A 1E2XA 3R60A 3HYIA 3WU0A 1T6SA 3FM3A 1W4MA 3KE2A 1S7AA 2F5CA 4WCGA 2K4BA 4M6YA 1HXDA 3ZP5A 2K27A 2G7HA 2AS5F 2DO7A 5HOOA 4UV8A 1I1GA 4HX7A 3WODF 2YX7A 1MDMA 1CF7B 2DK5A 4RB0A 4KN4X 3MCZA 2B0LA 3D0SA 1HQCA 4DQ2A 2HS5A 4YG2F 1ZRCA 1IRFA 1SMTA 2O6GE 3ZMSA 3HRSA 1V4RA 3BY6A 2ZJ2A 3T8RA 3WTYC 3GFLA 2ZNZA 4G7HF 1F9NA 1WQ2A 1MDMB 3E6BA 4L0ZB 1H0MA 5E1WA 1Z7UA 1XSVA 4D0PA 2MC3A 2GZWA 2ETHA 3T8TA 3F23A 3FWEA 4A6DA 1CGPA 4WX9A 2FBHA 3C7JA 1D8KA 3IHUA 5CJ9A 2VC1A 5LBQA 1HW1A 4IVNA 3OOPA 1O3RA 3EYYA 5DV5A 3F3XA 3FF5A 3IRQA 5K5OA 2P8TA 2G7UA 2KJCA 4LLGF 1P4AA 3QPHA 3T5XA 4BHPA 4JK1X 4LD5A 3JW4A 1S29A 2ZO4A 4A5NA 3QU6A 4IHTA 3MZHA 4IF4A 1DUXC 4ENJA 5D4SA 5D8LB 3L2CA 2L02A 1Z9CA 4RB1A 3TKYA 4XBFA 3GO5A 2LNBA 1ONVA 2W84A 2XKOA 4GCVA 3H92A 4AWXB 2ZNYA 2HQRA 1QZYA 2XV4S 2Q2EA 2PBIA 2D1HA 1LDJA 2WV0A 2DTRA 2IT0A 5HS7A 1BN5A 1IF1A 4OMYA 2XAHA 2JT1A 4KUMA 4HV5A 1F5TA 1OPCA 1ZREA 3PQKA 3J80Z 1RI7A 1J9IA 5CVRA 1OKRA 2G9WA 4I2OA 4BXUA 1IN8A 2PN6A 3ZMVA 1RUOA 2K7LA 3TO7A 3D5LA 3IKTA 2DAOA 5D5XB 1OYIA 2BEOA 3P9CA 4KNYA 3GWZA 5A2QZ 2ACJA 5K5RA 3W6KB 2J5PA 3J7AO 1H9TA 2KIUA 3TGNA 2R7FA 2MLGA 2K86A 2VBZA 2Y48A 3HSRA 5TRDA 3L09A 3RKWA 2W24A 5F1RA 4AVPA 2MH9A 4M9XA 2VT2A 1ZGJA 2OQRA 1ZG5A 1G3TA 4PGGA 3E6DA 4RB3C 4YIIA 1UHMA 1P6RA 1O7LA 3KP4A 3V7CA 4AIKA 1J0RA 2XAGA 4WXDA 4XSZF 3HSFA 4RGSA 5BPDA 3F8BA 4HF1A 3HHGA 4I09A 4NB5A 4HOBA 4N9IA 3KP2A 3I4PA 1ZYRF 1TNSA 3HSEA 1O57A 3Q9SA 2RC4A 5HLIA 3I71A 2RV8A 1FWZA 4UNOA 3M1EA 3ZN1A 3GW2A 2ZKZA 3GX4X 4HX4A 2GQQA 3TDZC 2M8EA 1I27A 2R3SA 4XRFA 2FNPA 3KP3A 1Y0UA 1ZH5A 3IWFA 5LGTA 3ABUA 3KETA 4HLYA 1XMAA 1U6GA 2VONA 3JTHA 3ERED 1B9MA 3LA7A 2CFXA 3I0TA 2P5LC 2CG4A 2UWMA 2QM3A 3ULQB 3QRFF 2QQ9A 4EGZA 2RNJA 3QOPA 1MJ9A 3JSPA 1YW8A 1EH8A 1BIAA 4A6EA 4PZJA 3F22A 1R1TA 2ELHA 4HZFA 3FHZA 2A5YB 2GIVA 1XMKA 1TNTA 4HBLA 3B02A 5IT9K 5ERIA 4QWQA 2IPQX 2RQPA 2VT3A 3KZZA 1P92A 3SFZA 1J7KA 1EH7A 1BIBA 3E6MA 5FLXZ 4WXHA 3HOSA 5AIPA 2JPCA 3F72A 2VOPA 2JRTA 4R79A 5CVVA 1U3EM 1Z6RA 5KVRA 4EJOA 2P6SA 2YR2A 4CICA 5AONA 2CW0F 3FMQA 5CVJA 1B1BA 2XUBA 3I59A 2D1VA 4OIRF 5HDNA 4GXOA 4MTDA 3RI4A 1O3SA 2LDUA 1O7FA 5L3CA 1RUNA 4EV0A 1ON2A 2EB7A 2PEXA 1LJ9A 1IXCA 2MA3A 1RZ4A 2VE9A 1JXSA 4ESJA 1BM9A 1FSEA 2H94A 3O6BB 4NQWA 4MNUA 1ZHFA 5BOXA 1TQIA 2HOEA 2Q8KA 1IN7A 2L4AA 2OD5A 3B73A 4KMFA 4M9ZA 3LQQA 3I59B 3RPQA 5LEKA 5K1YA 1SFUA 2PMUA 2PQ8A 1GHCA 4ENMA 1W5TA 4MEYF 3G73A 1HW5A 1I1SA 5D6EA 4CDGA 4O5VA 1LDDA 2GA2A 4M6XA 3DPTA 1TBXA 1BI0A 2M30A 4ASNA 5L3GA 2KIMA 2A6HF 4ZH4F 2HYGD 1S7OA 4HW0A 4BAYA 3GYHX 2O8XA 4EGYA 2VBYA 2W25A 1ZLKA 4TV7A 4YFXF 3K9TA 3AAFA 4CYDA 3M7GA 4ZZLA 1D5VA 2Z99A 4ZYDA 2YSRA 1X3UA 4A5MA 5DEQA 1T2KA 3GFIA 1S6LA 1TQPA 4LB6B 2FNAA 4ON0A 6PAXA 2XKPA 4LGWA 2HYFA 4OU0A 1F1ZA 3GXOA 1DDNA 1T98A 5LHGA 4B8XA 1W7PD 3KP6A 2FRHA 5AIQA 2NYXA 1WSUA 1MKMA 3ZN0A 2Z3YA 3QPTA 1U78A 2P5VA 1LEAA 1YO5C 4JQFA 3BZ6A 3L00A 2HKXA 2BBYA 1YG2A 1UFMA 4BHBA 2IW5A 4LG0A 2GXBA 4LLNA 5CLSA 1FY7A 5FFZA 2VBXA 1K6OA 5IT3A 3FXUA 1FC3A 3U9GA 1IN6A 2HZTA 4OIQF 1FNNA 5D5UB 3R61A 1TTYA 5HLGA 2DQLA 4N9HA 2C6YA 2NNYA 5JVTA 5ED4A 1XDUA 4JBAA 3ECOA 2Z9OA 2AXLA 2W57A 1ZG3A 4YFKF 3KP7A 2EV0A 5DDGA 1YIOA 2LSOA 1V3FA 5LGUA 3SXYA 3DP7A 4IHSA 2EA2A 1Z1DA 3C18A 2NS0A 1T0FA 3K1MA 1KU2A 3K0LA 3KZYA 2NNNA 1WWXA 3EYIA 5LRSA 3BJOA 2XAQA 5JFRA 2JPBA 3DEUA 2V1DA 4MGRA 4LB5A 4UUVA 3SZTA 3NQOA 3JSOA 3IKVA 4G8XA 4XSXF 5H6RA 4L9VA 5DUIA 2D2WA 4A0YA 3T1BA 5HS9A 4AIJA 3WG9A 4CGZA 3RPUA 2PFBA 1BBYA 3GFMA 5J8FA 3K2ZA 2OZ6A 1R5GA 2IA1A 4QLCU 2E7XA 3COAC 3O3KA 5DD8A 3F6OA 4BQAA 1FLIA 3HUGA 2EV5A 4G7ZF 4P96A 4OINF 2A6EF 1XGSA 4U7BA 2ESHA 2OZUA 1MGTA 4H0EA 4PGHA 1FOKA 1QNTA 2QENA 4ZZDA 5FD6A 4HV6A 2R7DA 4FX4A 5FO5A 2HR3A 4HAMA 3TDUC 3O2PE 3QAHA 4HQMA 3GF2A 3J81Z 2JZYA 5E17F 2F2EA 2CQKA 4HF0A 3FXQA 4KICA 5EEHA 1YS7A 3DF8A 3E5UA 4L9JA 3TOAA 1OYWA 3IRRA 1R58A 1U5TA 3RTRA 5JR3A 4EQQA 5FGMA 2ADUA 4KIBA 4LK1F 3WTWC 1YFHA 1XSXA 3ZMDA 2KJBA 2UXNA 4MTEA 1LNWA 4EVIA 1FBQA 3E5XA 5D8KB 4ZYEA 4IJAA 3ISPA 5TJJA 3E6CC 4KN7X 2O0YA 3KEOA 1HSTA 3KCCA 1AOYA 3LAJA 2A3SA 4WXCA 3CO7C 3ECHA 1G3SA 1T38A 5E1XA 1USTA 3V4GA 1U5TB 1K78A 2DPUA 1U2WA 4FHTA 1Z6TA 3OV8A 1XGNA 3FMRA 1JHFA 2IP2A 1U5TC 2WC2A 2XRNA 4GGGA 4PCQA 1GXPA 2O03A 5HS8A 3RJPA 4U0YA 2HGCA 1T39A 2XHKA 1TW3A 5D6FA 1DPUA 1SMYF 1KU9A 2TDXA 2IRFG 1K78B 3FZVA 4RAYA 2VOOA 5BQTA 3C3WA 3QP5A 1D8JA 4U7DA 4RGRA 2A69F 2LKPA 1TW2A 3BWGA 2ZCWA 4O6JA 1HSJA 1FPQA 3ZMTA 3I64A 5DYMA 1ZARA 2HKOA 2P5KA 4ZYHA 1LVAA 2MLKA 1STZA 3U1DA 1USSA 2ZMEA 3LFKA 4P5OA 2RGVA 5HLHA 4CXFA 4KIGA 1BI1A 2DFIA 2YU3A 4CZZA 2E1NA 4EM0B 4I7HA 1YW7A 1WRJA 2ESNA 3V7SA 2HQNA 4K2EA 2A07F 1YW9A 5HDKA 4A0ZA 2HFHA 3E5QA 2ZMEB 4GYIA 3F21A 4UVBA 3RDIA 5E18F 2PJPA 3CTAA 4Q5SF 1YTYA 3ZQ7A 4R1HA 3I53A 1A04A 4ENNA 2BYVE 2Z33A 2VN2A 3J80K 4AIHA 4WWCA 5ILVA 3I5UA 3H3UA 3LQRA 5JHUA 1HW2A 2RKHA 2Y0MA 3TQNA 3R4KA 5L3FA 2DW4A 3RKYA 1KQ8A 1XCVA 2O61A 5DCFA 5E20A 2P6TA 3DKWA 4OOIA 3ROUA 3QP6A 4YFNF 2EFPA 2VC0A 4RGXA 1YS6A 1HKSA 5A2QK 5L3DA 2L01A 5FB2A 1F4KA 2RN7A 1EV7A 2QBYA 2OBPA 3Q5FA 2H6CA 2XIGA 5HVQC 2CYYA 2EV6A 1QGPA 3LSTA 3NEUA 4ESFA 3PQJA 2KRFA 5E8GA 1JGSA 3QU3A 2IA0A 2RVCA 1MJBA 3WU1B 5ILSA 2GXGA 3VEPA 1R00A 3LAPA 1J59A 4EMSA 4HDUA 4Y13A 5CYVA 4MEXF 4KMUX 1O3TA 3ZPLA 2HTSA 3M8FA 2M87A 5ICFA 2QQAA 1G6NA 3CJNA 2ZFWA 5LHIA 4P9FA 2V1XA 4PDKA 1KYWA 4Y15A 1B6AA 4ETSA 2IA2A 2EFQA 2STWA 1SFEA 4L0YB 3GZ6A 1FBUA 4XLNF 3DQVC 2PI0A 3FM5A 3FMSA 1E17A 1HKTA 1YQAA 2EFWA 2YX4A 4UVCA 1QO0D 3WGHA 1G3YA 1HKQA 4BNCA 3KP5A 3G3ZA 2HEOA 3TO6A 2EA4A 4M9SA 1ON1A 2FU4A 4G9YA 2F5FA 1OMIA 4U0VA 5HDGA 1XCBA 4F7ZA 4Q4ZF 3F8MA 4IRHA 4E70A 3F8FA 1OYYA 3F6VA 2FE3A 1FX7A 2X0LA 4LJZF 1R1UA 1FP1D 1ULYA 3KEQA 1XSDA 1IW7F 2Y75A 2IJLA 1PDNC 4LLLA 2E7WA 1FYLA 5E1ZB 1ODDA 2FBIA 3REOA 5BS6A 1FZPB 3Q9VA 1HBXG 4I98B 4KYWA 4L9NA 1IXSB 1MZBA 3HTUA 2Z5UA 1LB2A 4BHCA 4O3MA 5JI6A 3W6JB 3EETA 3ZMZA 2IVMA 3BP8A 2F5DA 2DPDA 1IAWA 2K02A 2DI3A 5ICEA 3HRUA 4M73A 1CF7A 2FEZA 4L5JA 5LGNA 1WI9A 3HOTA 1P2FA 1DPRA 1BC7C 4HQEA 4OIPF 3KLOA 1ZG1A 2H27A 3H3ZA 4RB2C 3ABTA 4EJVA 3GEZA 5DD4A 5L3BA 2PG4A 5CVUA 1ZLJA 2H6BA 4P9UA 2D45A 4KA4A 3DV8A 2DQRA 1I6XA 4OMZA 2FOKA 1VTNC 3EQLF 3MAJA 2A61A 1O3QA 4P55A 4U0WA 2W85A 2YPRA 2FXAA 5LHHA 5L3EA 2XROA 3E3VA 2DT5A 4LG0B 3ZMUA 2EK5A 3RKXA 4UVAA 4S05A
chains in the Genus database with same CATH superfamily
3WTZA 2CJJA 1Q1HA 2UXXA 2VQHA 1KU7A 1FP2A 2X6OA 2CWEA 3SHFA 3N4MA 1IN4A 4RGUA 3MFKA 5F6FA 4ANJA 1FMWA 1FYMA 1B4AA 2X4HA 2DK8A 1EH6A 5EEGA 5FFXA 5KNLA 2VI6A 4B44A 1G4DA 1UB9A 4IXAA 3WTTC 2PMHA 2UZKA 4UV9A 1XN7A 2R7UA 2J5OA 3LNQA 4IPAA 1R7JA 2WV1A 2RDPA 1R23A 3NRVA 2R7OA 4N0BA 1U8RA 1LVKA 1XGOA 4BS9A 4PSXA 3WGIA 1IDZA 1IN5A 3FXOA 3H3VK 5E3LA 2B63J 2DLLA 2QVOA 3DEWA 5KK1A 4FX0A 2H1KA 2WA0A 1GDTA 2L9RA 3M9AA 3V8KA 2M1BA 2D5VA 1XPXA 3WGGA 1JJ8C 1GVDA 3RYPA 4A3LJ 3FX3A 3SQNA 4OIOF 2K9NA 1DP7P 4B43A 1L3LA 2MD0A 4M72A 2VQGA 1DP3A 3H0GJ 2ZC2A 4LMYA 4MQ9F 2F48A 5J1UA 4LFUA 4XQFA 3WTXC 3LSKA 3ZQLA 4A2UA 1BJZA 4Z2YA 4M74A 4ESBA 3HDDA 2XB0X 2V7FA 3PIOF 3PO3J 4Y17A 5GTIC 3RQIA 3O8HA 2P7CB 1ETXA 3J7AY 2HZDA 3DXJF 3R0JA 3CLOA 4BE2A 3CCUI 2HWVA 2QKLB 3RIRA 4CCNA 2P7VB 1W5CC 1R1VA 3CCVI 4EJTA 3BR5A 3BCBA 2LKSA 1LFBA 1TZLA 4L5IA 2FQ3A 2XF5A 2KFDA 2RNGA 3BOQA 3DBHB 4UB8C 2VE8A 5HODA 3A2KA 4G6QA 3JAMK 2QQBA 3C2BA 1UG2A 4GYGA 3G71I 3BTCA 4F93B 1ORKA 2JTVA 4XOPA 1RETA 4FQGA 3BJ6A 3C1DA 1G2HA 1K7AA 1VQOI 2NS7A 3MN2A 3V7RA 3HKZN 3WG7H 2EJRA 1MMSA 3SZPA 3LA2A 2DBBA 3LA3A 2VODA 4G94A 1SVOA 2I8DA 2EPFA 2HXIA 3MZYA 2LKXA 2K3FA 2XAFA 2FSWA 3HUGB 4HF2A 3QYEA 5DUKA 5J3LA 1J2XA 4HLXA 2KHMA 1L0OC 4I0AA 4A12A 5FKKA 1LDKB 1G8XA 1WPKA 1MH4A 4R8HA 1GV2A 2QUFA 2IGOA 3MEXA 1J5YA 2DN0A 3GZ5A 4HSRA 1D5YA 2CGPA 2XGDA 4UXNA 5K5QA 2V1UA 1BR1A 1D0YA 2IAIA 2V9VA 3CF2A 1VI0A 3GVAA 3JREA 2Y31A 4RBOA 1XS9A 4H4KC 1MD0A 4JX6A 3VFZA 1GVJA 2OJED 3BDDA 3PNYA 4G6DA 3WE3A 4S04A 1X19A 2OV7A 4G7OF 3OYFA 2DA5A 3FIWA 3NARA 4KFCA 1FSHA 2BV6A 2DJIA 2Q0OA 3K4BA 1S72I 3E97A 2MBFA 2STTA 1I39A 2JSCA 3UNGC 2NXNB 3S2WA 1SFOJ 2EH3A 3EDPA 1SD6A 2CSOA 5IT9Z 3IC7A 3PSFA 5LRRA 4BACA 1SEUA 2NAZA 3S32A 4F91B 1SD5A 3PFYA 1B9NA 2KRHA 2BY3A 3PFIA 3GTJJ 2KKOA 1G59A 2ISYA 3CD6I 3RZOJ 3M4OJ 3TOBA 4HDVA 5H6QA 2FMYA 3VYSB 3WE2A 3OYBA 1U9NA 2K4JA 2L3DA 4Q48A 3FXRA 4DNCA 4M71A 3HBLA 4HNVA 2A68F 1AKHA 1MSFC 2W1OA 3L2QA 4LG3A 2ZBKA 3G4SI 3F8CA 4YIFA 3L7WA 4BDZA 2COBA 1PUFB 1QPMA 1S3JA 1Z3XA 4I01A 4A0XA 2HVRA 4QSHA 5ILUA 3CUQA 3R0AA 3V8JA 1BC8C 2LF8A 3BROA 3ELKA 3MQ0A 4C2UA 4U87A 4HA8A 1Z91A 1FYKA 2JA6J 4NHJA 3K4CA 3HRTA 5H20A 1MNEA 2L9NA 2N8GA 2M34A 3U2RA 3M07A 4HYEA 2W4SA 2LVSA 4BYYA 2CV1A 1R5ID 2BVLA 1WJBA 4RAGA 2BW3A 3I58A 2WWYA 1MNMC 1AKHB 3GFJA 4LITA 4MHGA 5ICCA 1VFCA 5BPIA 5FJ8J 1SAXA 3K4JA 1IZ1A 2V79A 3QODA 2Y9YA 4EEFG 2L2OA 5E8IA 2JA5J 2GAUA 2HYJA 3FKIJ 4B3AA 5LEJA 3CDHA 2RAEA 3K1NA 3HHHA 3VOEA 2DDBA 3B6CA 1MNDA 3CUQB 3H1CA 3MWMA 1EF4A 2GOXB 1MBKA 5F64A 4PFOA 1R36A 2HTJA 3CP2A 4BY7J 4ENKA 1ZRDA 3KIOA 2XASA 1TP4A 2VJJA 2M3AA 5J6XA 2MG4A 2XRLA 4EM1A 1KU3A 1YE9A 1APLC 3CUQC 2DJNA 2JSPA 1RNLA 1KQ0A 3X2QH 2QCOA 1IUYA 5FD5A 3LWFA 2DT7B 3BG7A 3JRFA 3HOUJ 2BW3B 3WTSC 1X2MA 4L9TA 2EIKH 1KQ9A 3KFWX 4NC8A 3DPLC 1TWGJ 2O9LA 4RM2A 3DWLE 5IP9J 1G3WA 2OQGA 1HC8A 1RKTA 4II3A 2HI3A 4FE4A 4RLFA 3W3CA 2IS1A 1SC7A 1RC9A 2AHQA 1OR7A 4W97A 3S1NJ 1RIOH 4I0BA 3BTJA 4WK8F 4MQVA 3LSHA 3ASNH 4ZYGA 2COMA 3GTLJ 4BU2A 3TO9A 4XLPF 1IRGA 3JCUC 3R6SA 3GTGJ 1ZAOA 2KDOA 1ERDA 2PLYA 1TT0A 2LY1A 4IRGA 1ETVA 2F5EA 2H09A 1B59A 3RKQA 3H5RA 3K69A 4D5FA 3P7NA 4RS8A 5C3EJ 5M3MJ 4L18B 1QBJA 3J81K 4LK0F 3F9KA 1LEBA 2VXZA 4LIUA 4E7SA 4ZTFA 1SD4A 1W0UA 1HLVA 2I10A 2EFNA 4HNUA 2X51A 4KIFA 4HX8A 3DFGA 2KQRA 4UHTA 1QVUA 2DFFA 2E1CA 4IX7A 4YELA 2LMDA 2VKVA 2DT6A 5LLQA 4J19A 4DYQA 1POGA 3DKXA 3ZQGA 5EZHA 3S8PA 3WTUC 3N97A 3IL2A 4A3IJ 1BI3A 3PUBA 5KAIC 1AWCA 1OR7C 1HF0A 4DYCA 1XGMA 1GXQA 4YIRX 2CV2A 2CMPA 1N77A 3GUDA 4V2GA 1VZ0A 2R5ZA 3PL8A 2KDZA 2HU9A 2CO5A 4CSWA 2JWTA 4HEA2 5DCMA 3LL7A 1VQ7I 2DU9A 1RPWA 2GXAA 4XICA 1I5ZA 1JHHA 1PP7U 2R7TA 1P4WA 2DOFA 3AG1H 1YIJI 1XB4A 3I54A 1MMDA 2OA4A 1C0WA 2O3FA 2PJRA 1QA6A 2K9SA 3P9KA 2E34A 4BJ5C 1XMXA 1S8NA 3RQ4A 2VKDA 5J8CA 2EIJH 2L54A 2CU7A 1SFXA 1X3ZB 4PFPA 1TQMA 2QLZA 3S1RJ 1Z77A 3GTKJ 1V54H 3JRAA 2JMWA 2P4WA 2FBKA 3MMYB 3IWZA 2HVQA 1XDSA 3AG3H 4NBQA 5EZGA 3KLNA 1QZZA 4AD9A 5DCMB 3TP3A 4D1QA 3K2AA 2EWNA 2NVTJ 5B1AH 1UG0A 3QWLA 1V5GA 1ZGWA 1D3YA 2M45A 2EFOA 3CJQB 1P4XA 1K79A 1J75A 2PJRB 1YX5A 2FMLA 4E7ZA 3QPSA 3OL4A 4XLHA 4OAZA 5BNGA 3CJTB 5CVIA 1DU0A 1JKQC 3HXLA 3VSLA 3OS0A 1RKWA 2ME0A 2QBYB 2OAZA 2BY0A 2JQ7A 4CZCA 1R9TJ 1YLFA 2HDCA 3FK6A 3BT9A 4KT5C 4FT8A 3I9V2 2VKEA 2DDAA 1JE8A 4CA0A 1QQIA 4A3BJ 5D5VB 4X0GA 3V42A 2FUG2 1ZTRA 1P7JA 5LFAA 4HRIA 1LFPA 3BJAA 2BE5F 1P7IA 1Z05A 1ZRFA 3BPXA 4II2A 3GLXA 4Q47A 5KCMA 3L2UA 2E2HJ 1NHAA 4JYKA 2VKHA 3L9FA 1BOAA 4PJJA 4KDPA 1MJAA 2XVCA 4Y4RA 3FXJA 2L4MA 4C30A 1PUEE 3L2WA 2DMTA 2LBFA 1MW7A 1BJAA 1W7PA 2BGCA 3G2BA 2DA2A 2XAJA 1WKMA 3JRCA 1UHWA 2ISZA 4BH9A 1RR8C 3BPVA 4GRIA 2O7OA 2MH2A 3OOUA 2JA8J 3CCQI 1D1CA 2ZXJA 2FOWA 4EJWA 2QWWA 1VNDA 2XGXA 4I02A 4WF2A 1NTCA 3KYLA 3ZRGA 2KIFA 1D0ZA 1IRXA 1R5HA 3P9IA 2OTLI 3OYNA 1WJDA 2E1MB 2Y9ZA 2CUFA 1Z0XA 3FBNB 4A3JJ 3VODA 2M5WA 1WI3A 3WTVC 1IJWC 4GO1A 4EJUA 5BMZA 2FF4A 3EUHA 3BLYA 2XSJC 4UY8I 2E1MC 3CUOA 3JRIA 1KYZA 2OUMA 2BHYA 3OS1A 4U88A 3JTGA 2EZHA 5FRMA 1HDPA 1R22A 1W7PB 1Y6IA 3QQAA 2DA3A 5C4JJ 3VB2A 5F27A 5M5WJ 4UUSA 1REPC 5ICGA 1K4SA 4M3GA 3LSMA 2M2EA 3ML6A 2M0CA 2DA6A 2VBWA 4PSWA 1LQ1A 4CO8A 1ZGAA 3HTSB 1TWAJ 1UCRA 1Q1VA 2FA5A 3CMEI 2NRAC 2NVUB 1FT9A 1YHQI 4RMNA 3OYIA 2GWRA 2XDVA 4FISA 3CC2I 4IRIA 2OTJI 4AVZA 1TLHB 3HIFA 4CHUA 2V6CA 5EYRA 4XR6A 1ZN2A 3DCFA 1DQUA 1MBEA 2MD5A 1R49A 3JAMZ 1FBSA 1K6YA 1YYVA 3F8NA 5D4RA 1F43A 2GA1A 2X6WA 1XD7A 3M8EA 4EM2A 2QZ8A 4UUSB 1WJFA 2OU2A 3EUHC 4BQOA 2V4JC 1JGGA 1JKOC 4RAZA 3K1PA 2QYOA 4LOCA 1R4NB 3RYRA 3T0YA 5DTDA 3CO6C 1BI2A 1GLNA 1IDYA 1W5SA 1SD7A 3HRMA 4B09A 2R7RA 1T95A 1VQ9I 1IXRC 5D5WB 3QYBA 2DOAA 4PUSA 1H9GA 3V8LA 4IKFA 2NOGA 1PP8F 3KYDB 5FLXK 2LF7A 1KGSA 3SEQA 2WTEA 1S7EA 1KA8A 1UMQA 2KZGA 1E2XA 3R60A 2A6TA 1V5FA 3HYIA 3GCMA 3WU0A 1I50J 1T6SA 1W4MA 3ERMA 3FM3A 2GIZA 3KE2A 1S7AA 2F5CA 2R7VA 4WCGA 4IO9F 2K4BA 2F4OB 4M6YA 1HXDA 3QYFA 5J1YA 2K27A 3ZP5A 2JN6A 2OF7A 2G7HA 4A3FJ 2AS5F 2DO7A 4B4CA 4C2MJ 1U9OA 2VPLA 2DCEA 5HOOA 2CW7A 4UV8A 1I1GA 4HX7A 2RREA 4F55A 3WODF 3CLQA 2YX7A 1PVEA 1MDMA 1CF7B 2DK5A 5FKOA 1X1AA 4RB0A 4KISA 4KN4X 3MCZA 1I3AA 2B0LA 3D0SA 3S2HJ 1HQCA 1MMAA 4DQ2A 4CCMA 2HS5A 4YG2F 2ZJRF 1ZRCA 2OCCH 4IHXA 3CDIA 2ZXWH 2VASA 4KT6A 1HA8A 4XONA 3A0BC 2Z1DA 1IRFA 1SMTA 1WH5A 4MO7A 3CC4I 5GAHJ 2CS3A 4XN3A 2O6GE 1T08B 1XC5A 3G1LA 3HOXJ 1VQPI 3ZMSA 3HRSA 1V4RA 3BY6A 1DGWY 2ZJ2A 3HPHA 3T8RA 5EF6A 5IOYA 3WTYC 4KITB 3GFLA 2ZNZA 1R71A 4G7HF 1F9NA 1WQ2A 1MDMB 4A3GJ 2EINH 3E6BA 1OCOH 1X4PA 4L0ZB 1H0MA 5E1WA 1Z7UA 1VQMI 4A3KJ 1XSVA 4D0PA 2LR8A 3Q0UA 2MC3A 2GZWA 3BG6A 2ETHA 3S3MA 3ABMH 3T8TA 3F23A 3FWEA 4A6DA 1CGPA 3GBGA 2ICWG 1EKEA 4WX9A 3DBLB 2FBHA 3C7JA 1D8KA 1ZELA 3IHUA 5CJ9A 4DZPA 1BW5A 4PK4A 1U0JA 4L5EA 2VQLA 3K70D 4XKVA 1W36C 2VC1A 3FBIB 1HW1A 5LBQA 4IVNA 3ZQIA 4Y33A 1XX5A 3OOPA 3LSIA 1O3RA 3EYYA 4D9JA 4BE1A 1JKPC 3Q0WA 1OISA 2IS2A 5DV5A 2F4MB 1TWCJ 3F3XA 2JVHA 3FF5A 3TW6A 3IRQA 3BTIA 5K5OA 2P8TA 2ECCA 3M3YJ 4XRSA 1H8AC 4EATA 2G7UA 2KJCA 3DTEA 1VQ4I 3I56I 4LLGF 1P4AA 3QPHA 3T5XA 4BHPA 4JK1X 4LD5A 3LSJA 3JW4A 4XKWA 2B9SA 4M6VA 1S29A 2ZO4A 2CW8A 4A5NA 3IAS2 1MH3A 2QQ8A 3QU6A 4IHTA 4C9YA 3MZHA 1TL8A 4IF4A 1BW6A 3N05A 4XMYA 3VYUB 1DUXC 4ENJA 4BBRJ 2IGNA 5D4SA 5D8LB 3L2CA 2L7FP 4XKBA 2K40A 2L02A 4QPOA 3PNTA 1Z9CA 4RB1A 3TKYA 4XBFA 4BXFA 2I5UA 3GO5A 2LNBA 3W6VA 1OCZH 1ONVA 2W84A 3FXKA 1X4OA 1YJWI 2XKOA 4GCVA 3JRDA 3H92A 4AWXB 2ZNYA 2HQRA 5GAEJ 4IL6C 2HPMA 3UKGA 1QZYA 2XV4S 3CESA 1SANA 2Q2EA 2NS8A 3TBIA 1Y0NA 3AG2H 2KZVA 2D1HA 2PBIA 2W82A 4MIMA 1LDJA 2DOEA 2WV0A 2DTRA 3W2AA 2IT0A 5HS7A 4BJ6C 5K7ZA 4A3EJ 1BN5A 1IF1A 1QRYA 2E2IJ 4OMYA 2JA7J 2XAHA 1RR7A 2JT1A 3A02A 3TL4X 4KUMA 4FCYA 4HV5A 1F5TA 2B7EA 2O5RA 4BDYA 2F5VA 1FTTA 1OPCA 5EG0A 1ZREA 1QPIA 3PQKA 3RZDJ 2LLKA 4JP0A 3J80Z 2VIXA 5EEAA 5EGOA 3ESWB 1FIPA 4AIDA 1RI7A 1HDDC 2KMUA 1J9IA 3KX2A 5CVRA 1OKRA 2G9WA 4I2OA 1N25A 4HG2A 4BXUA 3CQZJ 3UR3C 4Y52J 4GDFA 1IN8A 2Q2EB 3AKZA 3OY9A 2PN6A 3LOCA 3ZMVA 4A3CJ 1RUOA 1JTYA 2DMNA 2HOSA 1YJNI 4D5CA 2K7LA 3HEFA 3TO7A 3O8GA 1ETWA 1S5LC 3BCAA 3D5LA 3IKTA 3AL0B 2QSGX 2DAOA 3K4NA 5D5XB 1I6HJ 1YI2I 1OYIA 2BEOA 1T56A 3DBRB 3P9CA 2HVSA 1A35A 4KNYA 3GWZA 5A2QZ 2ACJA 5K5RA 3W6KB 2J5PA 3CC7I 3J7AO 1H9TA 3AL0C 2KIUA 1FIAA 5EGOB 3MKLA 1XTAA 4BQQA 2NVXJ 3TGNA 4M3DA 1WJEA 2R7FA 2MLGA 3SDGA 2K86A 2VBZA 3MKWB 3PNVA 2Y48A 3HSRA 5TRDA 3L09A 3RKWA 2LOOA 5B3SH 2W24A 1U8BA 2YU9J 1IRZA 3IUOA 1FEXA 5F1RA 4AVPA 3S15J 3OYKA 2MH9A 3DTIA 2UUZA 4M9XA 2DMQA 2CH0A 4B1RA 2VT2A 1ZGJA 2OQRA 1ZG5A 1IC8A 1G3TA 4PGGA 1Y8RB 4Z6YA 3CF5F 4C2TA 5E3NA 3E6DA 4RB3C 2DA4A 2K9QA 4YIIA 1UHMA 1P6RA 3B6AA 1O7LA 5KHDA 3KP4A 2A5WA 3V7CA 3FXMA 2L0KA 2MSYA 4AIKA 3I4MJ 2JJ7A 1J0RA 1YITI 4JX4A 2XAGA 4WXDA 4XSZF 3HSFA 1FMVA 3VYRB 1NG6A 4RGSA 5IPAA 3F8BA 5BPDA 4HF1A 2WAFA 3HHGA 4I09A 4NB5A 1AHDP 4A3DJ 4HOBA 4NC6A 4N9IA 3KP2A 3FHNA 3BR3A 3ZQQA 3CP8A 3I4PA 2DXIA 1ZYRF 2LTPA 1BA5A 1TNSA 1IG7A 3HSEA 1O57A 3A1YA 3I3LA 2RC4A 3Q9SA 3S16J 5FROA 5HLIA 3I71A 2RV8A 1FWZA 4UNOA 1Y1VJ 3M1EA 3ZN1A 3GW2A 2ZKZA 3GX4X 4HX4A 1IUFA 4G12A 3GMEA 3PO2J 1JTXA 4FASD 2GQQA 3TDZC 2M8EA 4CCKA 1I27A 5JLWA 3EUAA 2R3SA 4XRFA 1XG1A 3OSFA 2FNPA 3KP3A 1Y0UA 2TCTA 5K7HA 1ZH5A 2A05A 3IWFA 5LGTA 5IOZA 3ABUA 3NWSA 1X1DA 3KETA 4HLYA 2CQQA 2Y2ZA 1XMAA 2M9HA 1U6GA 2R7WA 1GUUA 1A36A 2VONA 2E5ZA 5FKMA 1VQLI 3JTHA 3ERED 3IH2A 1B9MA 3LA7A 2MC4A 3CCSI 3TEDA 2CFXA 3OIQA 2DYRH 2DA7A 3I0TA 3A0HC 3PJRA 2P5LC 4ZC3A 2CG4A 2Z2SB 2UWMA 4AM3A 2R5YA 1QZEA 2QM3A 3DLAA 1X58A 3ULQB 2QF7A 3QRFF 4D7NA 1OCTC 2QQ9A 4BE0A 4EGZA 2M4KA 4BXXJ 2FJ1A 3BG9A 2DYSH 5M5YJ 2RNJA 1SAUA 2M4GA 3QOPA 3G6EI 2HOTA 1MJ9A 3JSPA 3IH4A 5E3OA 1YW8A 1EH8A 4IOAF 1BIAA 4A6EA 2QKMB 4PZJA 2VXDA 1W1WE 1R1TA 3IAM2 3F22A 2ELHA 4HZFA 2JA2A 4F92B 2LY9A 4W1UA 1GV5A 3FHZA 4M3BA 2A5YB 2GIVA 1XMKA 1TNTA 1Z3YA 4YEJA 2R7ZJ 3PSIA 3SEZA 3TW7A 4HBLA 5F1JA 3Q3SA 3B02A 5IT9K 5ERIA 1K61A 2R5YB 2CV0A 4QWQA 2IPQX 2RQPA 4X1EA 2VT3A 1AU7A 3MZ8A 2KRCA 2L7KA 1JKRC 3KZZA 3OL3A 2Q1ZB 1R4MB 1X1CA 2ID3A 2M7AA 1P92A 1T8IA 1A31A 3F0CA 3SFZA 1J7KA 1EH7A 2XPWA 2PMZN 1BIBA 4BQNA 3JRGA 2E36A 2DFEA 3ZR8X 2XC7A 3E6MA 2CUZA 2CQXA 2E1OA 3H36A 5FLXZ 3SJMA 2UV1A 4WXHA 3JRHA 3HOSA 1IO2A 3L2VA 5AIPA 4BEHA 3JRBA 2JPCA 1ITYA 2R5ZB 4PJ0C 3F72A 3H0DA 2VOPA 1WH7A 4XNFA 2JRTA 4R79A 5CVVA 1U3EM 4LIVA 1Z6RA 2R7XA 2VJ5A 4FETA 5KVRA 4EJOA 5E79C 2P6SA 2YR2A 3MKYB 3H35A 1QHHD 5AONA 4CICA 2ME6A 2ZJQF 2CW0F 2X1DA 1X3WB 5FRNA 2K3PA 4Y3OA 3FMQA 3HG9A 5CVJA 1B1BA 2XUBA 3I59A 2D1VA 4OIRF 5HDNA 4GXOA 4MTDA 3RI4A 1MBHA 1O3SA 1T33A 2LDUA 1O7FA 3LMMA 5L3CA 2RQQA 3DKYA 3ONQA 2QA4I 3BZKA 1RUNA 3GTPJ 4BEHB 4XLAA 1TT5B 4EV0A 1ON2A 2EB7A 2PEXA 1LJ9A 1IXCA 3SFIA 2MA3A 1RZ4A 2VE9A 1JXSA 5KAFC 4ESJA 4A3MJ 1BM9A 1FSEA 2H94A 2K85A 5HNFA 5M3FJ 2E5NA 3O6BB 4NQWA 1ETKA 1ZHFA 4MNUA 5BOXA 1TQIA 3H9JA 4DOZA 2HOEA 2FQ4A 5J4YA 2Q8KA 5FLMJ 1IN7A 2BXZA 2L4AA 2OD5A 3B73A 4KMFA 3ASOH 2E35A 4M9ZA 4ZDLA 3LQQA 4DBRA 5C4XJ 3I59B 4I76A 3BZCA 1RRJA 3RPQA 5LEKA 5K1YA 4CCOA 1SFUA 2PMUA 1Z67A 2PQ8A 1A6QA 4XLFA 1GHCA 4ENMA 3GTOJ 4AU7A 1W5TA 4MEYF 2JK3A 3G73A 2BZTA 1HW5A 2KIQA 1I1SA 5D6EA 4CDGA 4F52A 1YRNA 4O5VA 2K9MA 1LDDA 2GA2A 4BJTA 4M6XA 1YJ9I 3BR0A 3D5SC 3DPTA 1TBXA 4E7JA 1BI0A 2M30A 4ASNA 4X6AJ 1LFUP 5L3GA 2VL8A 2ELKA 2LBFB 2KIMA 2A6HF 4ZH4F 2CUEA 2HYGD 4A69C 1S7OA 4HW0A 4BAYA 3GYHX 2O8XA 4EGYA 3KZIC 2VBYA 5H2FC 2W25A 1ZLKA 4QPQA 3OYDA 1CQTA 4FE7A 2LH9A 1X1BA 4TV7A 4YFXF 2BY2A 3OYAA 3BC8A 3K9TA 3K7AJ 1JUMA 3AAFA 4CYDA 2WB1A 3M7GA 4ZZLA 3AG4H 1D5VA 2Z99A 1YOVB 4ZYDA 3FK7A 1YRNB 2YSRA 1X3UA 3H5AA 4DYRA 3HOVJ 4A5MA 3CCJI 1OCPA 5DEQA 3E1SA 4E4HA 2OC6A 4ZJZA 1T2KA 2HNHA 3GFIA 1K83J 1S6LA 1TQPA 3HC7A 4LB6B 4CYCA 2FNAA 4ON0A 4J00A 3BR6A 1W0TA 3HGYA 6PAXA 2IGMA 2Z16A 3KPHA 2DA1A 4I6ZA 3P5JA 4BKXA 2XKPA 4BY1J 4LGWA 2HYFA 1VQ5I 4OU0A 4E7IA 1F1ZA 1ENHA 3GXOA 1DDNA 1A5JA 1T98A 5LHGA 3OYHA 4B8XA 3S3OA 2PMZA 1I3QJ 2X48A 1W7PD 2XAUA 3KP6A 2FRHA 5AIQA 2NYXA 4IZZA 1MKMA 1WSUA 3ZN0A 2L9VA 3BR1A 4YRVA 3C2GA 2ZFUA 2JUCA 2Z3YA 3QPTA 1U78A 2P81A 2YS9A 2P5VA 3HZJA 1LEAA 1YO5C 3VDXA 5DS9A 1N78A 4JQFA 1FOYA 3BZ6A 2LK2A 1KZHA 3L00A 2HKXA 1PYVA 4KJZA 2BBYA 1YG2A 1FTZA 3CMMA 1UFMA 4BHBA 1TWFJ 2DFHA 2IW5A 2LG4A 4LG0A 2GXBA 4MFDA 3TMOA 1VQ8I 2XPUA 4LLNA 5CLSA 1FY7A 2DTZA 1OLTA 5FFZA 2VBXA 2V26A 4V19K 1K6OA 2R92J 4J01A 1PJRA 5IT3A 3LSPA 3FXUA 1FC3A 3U9GA 2WY8Q 3QPLA 2KT0A 1IN6A 2HZTA 2XSDC 2QGUA 3IP4B 1B8IA 2V9PA 4OIQF 1FNNA 2Y0SN 5D5UB 4RA2A 3R61A 3GTMJ 1TTYA 1Z21A 5HLGA 5B1BH 4RLQA 2DQLA 4N9HA 2R0QC 2C6YA 2NNYA 5IYDJ 5JVTA 5ED4A 1UHSA 3OS2A 2VJ4A 1XDUA 4JBAA 3VWBA 3ECOA 2Z9OA 2AXLA 2W57A 5F0FA 1MSEC 3OYGA 1ZG3A 4YFKF 3KP7A 2EV0A 5DDGA 1YIOA 2LSOA 2EZLA 2W00A 1V3FA 5IP7J 5LGUA 3SXYA 3DP7A 1X2NA 3OR2C 5B5EC 3W2VA 4IHSA 2EA2A 1Z1DA 3C18A 1NG7A 2AQEA 2NS0A 1B8IB 1T0FA 3DU6A 3K1MA 5GADJ 3HOWJ 1KU2A 3H9QA 2ID6A 3K0LA 3KZYA 4C3JJ 1UELB 5J4VA 2NNNA 1WWXA 2WADA 3EYIA 5LRSA 3BJOA 2G0EA 5J40A 2XAQA 5JFRA 1B72A 3H5NA 1LKXA 2JPBA 2V1DA 3DEUA 4MGRA 4LB5A 3ZXSA 4UUVA 3SZTA 3NQOA 3JSOA 1LPQA 1E3PA 1SVMA 2BHZA 3IKVA 4BL0B 4G8XA 4XSXF 5H6RA 4L9VA 3ZQFA 3OYMA 4XORA 2TRTA 2WY7Q 3VYTB 4V2FA 2D2WA 2EZIA 5DUIA 1JJ6C 2OCEA 3HL2A 1VQKI 4Y7NJ 2DODA 4A0YA 4IEJA 3T1BA 3BR2A 4AYBN 5HS9A 3S3NA 4AIJA 2KISA 3WG9A 4CGZA 3MKZA 3RPUA 2PFBA 2IXSA 1BBYA 3GFMA 5J8FA 4DBQA 4PJMA 3K2ZA 2OZ6A 3DPUA 4BUPA 1R5GA 2LD5A 4B48A 1B72B 1T0FC 2IA1A 4QLCU 4XK4A 2E7XA 1UAAA 1QU3A 3COAC 3O3KA 1P9QC 5DD8A 3F6OA 4BQAA 1FLIA 1W36D 1H89C 2V6EA 3HUGA 2EV5A 4UUTA 4G7ZF 4P96A 5M5XJ 4OINF 5FKNA 4NDLA 2A6EF 1XGSA 4U7BA 3ZQCA 1RESA 2ESHA 2HDWA 2OZUA 1MGTA 4H0EA 2HDDA 1QHGA 2GBYA 4PGHA 1FOKA 2EBIA 2P0WA 3DU5A 1QNTA 1N75A 2QENA 3K4KA 3Q0VA 4ZZDA 1QVTA 5FD6A 2CFOA 5GTHC 4HV6A 2R7DA 4FX4A 5FO5A 1OCRH 4IOCF 1AA7A 2X1EA 3PM1A 2HR3A 3MVPA 3OR1C 2ZJPF 4HAMA 4JX5A 1ETQA 3TDUC 3O2PE 3QAHA 4HQMA 3GF2A 2V1NA 2JZYA 3J81Z 2VJIA 5E17F 2F2EA 2CQKA 1TWHJ 4HF0A 1WJAA 3FXQA 2PX9A 4KICA 5EEHA 1YS7A 2AO9A 3DF8A 4B47A 1DGRM 4NUBA 3E5UA 2HQAA 2VPRA 4L9JA 2LFBA 2E2JJ 5FKLA 5IYCJ 4FTHA 3TOAA 1OYWA 1R58A 3IRRA 2EIMH 1OJLA 1U5TA 3RTRA 5JR3A 4XRMA 1VQ6I 4EQQA 5FGMA 2ADUA 3SYTA 2Y30A 5K7FA 2FD5A 4KIBA 4LK1F 4XN0A 3WTWC 1YFHA 1XSXA 3MD2A 2KJBA 5CQGA 3ZMDA 1D1AA 2UXNA 1NH3A 4MTEA 2L9SA 1H88C 1LNWA 4EVIA 1FOWA 4IQJA 1FBQA 4DZJA 3E5XA 5J1RA 3S93A 2Y69H 2DMPA 5D8KB 2CUJA 4ZYEA 1WZ2A 4IJAA 3ISPA 4MFEA 5TJJA 4KN7X 3ZCOA 2NOJB 3E6CC 2O0YA 3KEOA 2Y0SA 1PUFA 3S1MJ 1HSTA 4AC0A 5IYBJ 3RPUD 2IS4A 3KCCA 1AOYA 4AUXA 3LAJA 4XKCA 2L7ZA 2IBDA 2A3SA 4WXCA 5EG0B 3CO7C 4A93J 3ECHA 1G3SA 3EPZA 3SZGA 1T38A 5E1XA 3CZ6A 4E7LA 1USTA 3V4GA 1U5TB 1K78A 2DPUA 2K9LA 1U2WA 4FHTA 3VSKA 1EJ9A 4QTRA 2R7SA 1F36A 1Z6TA 3OV8A 1E3HA 5TISC 4S0HB 2MFZA 1XGNA 4CUGA 3FMRA 3L1PA 1JHFA 2IP2A 1U5TC 4N4NB 2IS6A 2WC2A 2XRNA 4GGGA 1Y1WJ 5HLTA 2WAEA 4PCQA 1GXPA 1WVRA 2O03A 3GTQJ 5HS8A 3RJPA 4U0YA 2HGCA 1T39A 2XHKA 5FLVA 1TW3A 5D6FA 5GAGJ 2HXOA 2EZKA 2OPTA 3NAUA 1SMYF 3D5RC 3ZOBA 1DPUA 2JUGA 2X6XA 1KU9A 2TDXA 3ABLH 3CCYA 2GOMA 2IRFG 3L2RA 1K78B 1OCCH 2E60A 3RCOA 3GLLA 3FZVA 4RAYA 2VOOA 5BQTA 2EILH 4IHWA 4DIQA 3C3WA 3HPGA 3QP5A 4N4OB 1ZR4A 4BBSJ 1D8JA 4U7DA 2F4IA 4AYBA 3HB9A 2LY2A 4RGRA 2GLOA 5CPRB 2KL4A 4I99C 2A69F 2LKPA 1MIJA 1TW2A 3BWGA 3H9GA 3LSRA 3S1QJ 3RSNA 5LD2C 2ZCWA 4O6JA 1HSJA 1FPQA 2XB5A 5EJCA 2ZXHA 2M8GX 1BR2A 3ZMTA 3I64A 2WAQN 1ZARA 5DYMA 2HKOA 4P1WA 2P5KA 2K5CA 4ZYHA 2JRMA 1LVAA 1BL0A 2MLKA 2LP0A 3WHCA 1STZA 3U1DA 1USSA 2ZMEA 3LFKA 3OIOA 4BGDA 4P5OA 1VQNI 2GM4A 2QEXI 1A6IA 2RGVA 2XGEA 5HLHA 3VPRA 4CXFA 1IV6A 1WCMJ 3CDLA 3ZGKA 3OMYA 2M7BA 4KIGA 1BI1A 2BY1A 1Y56A 2DFIA 3BQZA 2H8RA 3CJRB 1WHUA 4MLOA 2XGCA 2FX0A 5E3MA 4D7MA 2YU3A 2L7MP 4RM3A 4CZZA 4HNTA 2E1NA 5TGTA 2DMUA 3HKZA 4I7HA 4EM0B 3AFHA 5F0CA 2ELJA 1YW7A 1WRJA 2ESNA 3G1MA 3FKJA 1ZK8A 4ZDPA 3V7SA 2HQNA 4XIDA 1ZQ3P 4K2EA 2A07F 1YW9A 5HDKA 2MYSA 1V5EA 2HFHA 4A0ZA 3E5QA 2E19A 2ZMEB 3GZNB 1JUSA 4GYIA 4IHVA 3F21A 2QSHX 4UVBA 3RDIA 5E18F 2X6YA 2PJPA 5DM6F 2WB1N 3CTAA 4Q5SF 2WBMA 2VQCA 3EUKL 1YTYA 3D1NI 2ZMEC 3FDYA 3ZQ7A 3M1CA 3C2HA 4R1HA 3I53A 1A04A 4NC7A 3WU2C 4ENNA 5JHFA 2BYVE 1LUJB 2EQRA 3HJEA 4DGWB 2Z33A 2VN2A 3J80K 4OAYA 4AIHA 4WWCA 5ILVA 3I5UA 1UZCA 5JLXA 4DJAA 4C3IJ 3J7YJ 2H8WA 3H3UA 2R4GA 3FISA 5B66C 3LQRA 5JHUA 1HW2A 2RKHA 2Y0MA 3TQNA 2BOLA 2X9DA 1JI8A 2BXYA 3R4KA 5L3FA 2DW4A 3RKYA 1KQ8A 1XCVA 3CCEI 1WGXA 5JVGF 3G1OA 2O61A 5DCFA 5E20A 2YUSA 2CQNA 2P6TA 3DKWA 4OOIA 3ROUA 3QP6A 2H1LA 4YFNF 2EFPA 2V9KA 2NVQJ 2VC0A 4RGXA 3S17J 2HOAA 4GFBA 1YS6A 1HKSA 1ZKGA 1FJLA 4G6TB 2W7NA 5A2QK 5L3DA 2M0MA 2L01A 4M3FA 5GP9A 1JT6A 5FB2A 4F3QA 2ZXIA 1R6RA 3PUFA 3K4MA 5J47A 1F4KA 2RN7A 1EV7A 2QBYA 2OBPA 2R93J 1V55H 4UB6C 3Q5FA 3S14J 4C3HJ 4XL9A 2H6CA 5IY5H 2XIGA 5HVQC 2CYYA 2EV6A 1QGPA 3LSTA 3DEEA 3NEUA 4ESFA 1OFCX 3SDBA 3PQJA 2KRFA 4OWRB 5E8GA 5C44J 3A01A 1JGSA 3QU3A 2IA0A 4B3XA 2RVCA 1MJBA 5F04A 2QSFX 3K6GA 3WU1B 5ILSA 2GXGA 3VEPA 9ANTA 1R00A 3LAPA 1J59A 2KPMA 3S2DJ 4EMSA 4HDUA 4Y13A 3IH3A 5CYVA 4MEXF 1JUPA 1J09A 4KMUX 1O3TA 3ZPLA 1MBJA 3OSGA 2HTSA 3M8FA 2M87A 2HPIA 1WFXA 5ICFA 2QQAA 1G6NA 3ABKH 2WAQA 3CJNA 2ZFWA 3HOZJ 2ZB9A 5LHIA 3A01B 1UJ8A 4P9FA 2V1XA 2HQ5A 3CMAI 4PJLA 1HOMA 1KONA 4PDKA 2BVMA 2X85A 1KYWA 4Y15A 1B6AA 3OWTA 3BG5A 2XPVA 4ETSA 1OQYA 2IA2A 3CMYA 1DU6A 2EFQA 2STWA 1SFEA 4L0YB 4DW6A 3W2WA 3GZ6A 4NQWB 1FBUA 4XLNF 1HCRA 2X1CA 3DTKA 1SVLA 3DQVC 2PI0A 2F6CA 3FM5A 3FMSA 4ZDOA 1E17A 1HKTA 4RAFA 1YQAA 2EFWA 2JVGA 2YX4A 1TC3C 4UVCA 1QO0D 3CCRI 2NVYJ 3WGHA 1G3YA 4E6KG 4RDUA 4XLCA 3BTLA 5IP6A 1IGNA 5F0HA 2E71A 1HKQA 4BNCA 1FOXA 3KP5A 4XOTA 3G3ZA 3KEYA 4ZTJA 2CQ7A 2HEOA 2AQFA 3TO6A 3I4NJ 2EA4A 4M9SA 1BOBA 3LFUA 1S9HA 1ON1A 1BR4A 1ETOA 2FU4A 1NK3P 4G9YA 3BQYA 1VF9A 4HPQA 2MW8A 2F5FA 3U1KA 1OMIA 4XLEA 4U0VA 3OYEA 3OIPA 5HDGA 1XCBA 1Z7LA 4F7ZA 4Q4ZF 2VLAA 4IHYA 1X1PA 3F8MA 4IRHA 4E70A 3F8FA 2MGQA 1OYYA 1LE8A 2R7QA 3PIPF 3HM5A 2LREA 3IV5A 2LYCA 3F6VA 3K10A 4HSTA 1MBGA 2FE3A 1FX7A 5EDNA 2MABA 2X0LA 4LJZF 1R1UA 4JOMA 1FP1D 1ULYA 1ETYA 3KEQA 1XSDA 1IW7F 1YX3A 2Y75A 2ZSIB 1WJ5A 1MMGA 2IJLA 1PDNC 4LLLA 3OYLA 2E7WA 4ITVA 2CRGA 1E0EA 1FYLA 5DM7F 3FXLA 3OYJA 3NWTA 5E1ZB 1ODDA 2FBIA 3QOEA 3E7LA 3REOA 5BS6A 1FZPB 3Q9VA 3U21A 3J7ZI 1HBXG 4I98B 4CH7A 4KYWA 3E0JB 1IXSB 4L9NA 1MZBA 2XF7A 3HTUA 5GPAA 2Z5UA 1LB2A 4BHCA 4O3MA 5JI6A 3W6JB 1MBFA 4ABZA 1Y8QB 3EETA 1LE8B 3ZMZA 2IVMA 3BP8A 3I55I 2LC2A 2F5DA 4CYCB 1O4XA 2DPDA 1IAWA 2K02A 2VB6A 5HNHA 2IEKA 4NNJA 2DI3A 4XRSG 1EA3A 5ICEA 3ZQHA 3HRUA 4M73A 1CF7A 2FEZA 4E7KA 4L5JA 5LGNA 3LSGA 1WI9A 5CKTA 3CCMI 2KP6A 3HGGA 3A4CA 3HOTA 1P2FA 1DPRA 1BC7C 4HQEA 1SFKA 3K4LA 3TP0A 4OIPF 2VUMJ 3KLOA 1JT0A 1WJCA 3WHBA 1ZG1A 2H27A 1ACIA 3H3ZA 4XM3A 4RB2C 2KLOA 3ABTA 4EJVA 1M1EB 4M3EA 3GEZA 2ZSHB 1D1BA 3M8JA 5DD4A 5L3BA 2PG4A 5CVUA 1NK2P 1ZLJA 5CQEA 1K4TA 2H6BA 3CCLI 4P9UA 2D45A 4KA4A 3DV8A 3A03A 2DQRA 4CCLA 3JR9A 3OYCA 1I6XA 4OMZA 4ZYAA 2FOKA 3DLLF 1VTNC 3EQLF 1E3OC 3MAJA 3KYCB 2O8KA 4IQ4A 3BG3A 2A61A 1MMNA 3HOYJ 1O3QA 1D0XA 5GPCA 4PJNA 1GT0C 4E7HA 4P55A 2W85A 4U0WA 2L5QA 2YPRA 1Y39A 2FXAA 2ECBA 4CCJA 5LHHA 5L3EA 4QIWN 2XROA 2AXTC 3E3VA 2DT5A 4LG0B 3ZMUA 5F08A 2EK5A 3K70C 3RKXA 2W48A 2LRDA 2IGKA 1ZR2A 2XF6A 1IV8A 4UVAA 4S05A
chains in the Genus database with same CATH topology
3WTZA 1Q1HA 2UXXA 1KU7A 1FP2A 2CWEA 3SHFA 3N4MA 1IN4A 4RGUA 3MFKA 5F6FA 1FYMA 1B4AA 2X4HA 2DK8A 1EH6A 5EEGA 5FFXA 1G4DA 1UB9A 4IXAA 3WTTC 2PMHA 2UZKA 4UV9A 1XN7A 2J5OA 4IPAA 1R7JA 2RDPA 1R23A 3NRVA 4N0BA 1U8RA 1XGOA 3WGIA 1IN5A 2DLLA 2QVOA 5KK1A 4FX0A 3M9AA 3V8KA 2M1BA 3WGGA 3RYPA 3FX3A 3SQNA 4OIOF 1DP7P 1L3LA 4M72A 4LMYA 4MQ9F 3WTXC 4LFUA 4A2UA 4Z2YA 4M74A 4ESBA 4Y17A 2P7CB 3DXJF 3R0JA 3CLOA 2HWVA 3RIRA 2P7VB 1R1VA 4EJTA 4L5IA 2FQ3A 3BOQA 2VE8A 4G6QA 3JAMK 2QQBA 4GYGA 2JTVA 3BJ6A 3C1DA 1K7AA 3V7RA 2EJRA 3SZPA 3LA2A 2DBBA 3LA3A 2VODA 4G94A 3MZYA 2XAFA 2FSWA 4HF2A 5DUKA 1J2XA 4HLXA 1L0OC 4I0AA 4A12A 1LDKB 4R8HA 2QUFA 3MEXA 1J5YA 3GZ5A 2CGPA 4UXNA 5K5QA 2V1UA 2V9VA 3GVAA 1MD0A 3VFZA 1GVJA 3BDDA 4G6DA 3WE3A 4S04A 4G7OF 4KFCA 1FSHA 2BV6A 2Q0OA 3E97A 2MBFA 2STTA 2JSCA 3S2WA 3EDPA 1SD6A 2CSOA 5IT9Z 3IC7A 5LRRA 2NAZA 1SD5A 1B9NA 3PFIA 2KKOA 2ISYA 3TOBA 4HDVA 5H6QA 2FMYA 3WE2A 2K4JA 2L3DA 4Q48A 3FXRA 4DNCA 4M71A 2A68F 2ZBKA 3F8CA 4YIFA 3L7WA 1QPMA 1S3JA 4I01A 4A0XA 5ILUA 3CUQA 3R0AA 3V8JA 1BC8C 2LF8A 3BROA 3ELKA 3MQ0A 4HA8A 1Z91A 1FYKA 4NHJA 5H20A 3HRTA 3U2RA 4HYEA 4BYYA 2WWYA 3I58A 3GFJA 5ICCA 4MHGA 5BPIA 1SAXA 1IZ1A 2V79A 5E8IA 2GAUA 5LEJA 3CDHA 3K1NA 3HHHA 3VOEA 3CUQB 3MWMA 5F64A 1R36A 2HTJA 4ENKA 1ZRDA 2XASA 5J6XA 4EM1A 1KU3A 3CUQC 1RNLA 1KQ0A 1IUYA 5FD5A 3LWFA 3WTSC 4L9TA 1KQ9A 3KFWX 3DPLC 1G3WA 2OQGA 1OR7A 1RIOH 4I0BA 4WK8F 4MQVA 4ZYGA 2COMA 3TO9A 4XLPF 1IRGA 3R6SA 1ZAOA 2PLYA 4IRGA 2F5EA 2H09A 1B59A 3K69A 3P7NA 4RS8A 4L18B 1QBJA 3J81K 4LK0F 1LEBA 2VXZA 1SD4A 2EFNA 4KIFA 4HX8A 3DFGA 4UHTA 2E1CA 5LLQA 3WTUC 3N97A 3IL2A 1BI3A 1AWCA 1XGMA 1GXQA 3GUDA 2CO5A 5DCMA 2DU9A 1I5ZA 1JHHA 1PP7U 1P4WA 1XB4A 3I54A 2OA4A 1C0WA 2O3FA 3P9KA 1S8NA 5J8CA 2L54A 1SFXA 1TQMA 2QLZA 2P4WA 2FBKA 3IWZA 1XDSA 3KLNA 1QZZA 4AD9A 5DCMB 2EWNA 1D3YA 2M45A 2EFOA 1P4XA 1K79A 1J75A 2FMLA 5CVIA 2QBYB 2OAZA 1YLFA 2HDCA 4KT5C 4FT8A 1JE8A 1QQIA 5D5VB 3BJAA 2BE5F 1Z05A 1ZRFA 3BPXA 3GLXA 4Q47A 1NHAA 3L9FA 1BOAA 4KDPA 1MJAA 2XVCA 2L4MA 1PUEE 1BJAA 1W7PA 2BGCA 2XAJA 1WKMA 2ISZA 1UHWA 4BH9A 3BPVA 2MH2A 2ZXJA 4EJWA 2QWWA 2XGXA 4I02A 4WF2A 2KIFA 1R5HA 3P9IA 3VODA 2M5WA 3WTVC 4GO1A 4EJUA 5BMZA 2FF4A 3EUHA 3CUOA 1KYZA 4U88A 3JTGA 1R22A 1W7PB 3VB2A 1REPC 5ICGA 3ML6A 2VBWA 1LQ1A 4CO8A 1ZGAA 3HTSB 1UCRA 2FA5A 2NRAC 1FT9A 2GWRA 4IRIA 1TLHB 3HIFA 4CHUA 2V6CA 1ZN2A 2MD5A 3JAMZ 1FBSA 3F8NA 1YYVA 5D4RA 2GA1A 1XD7A 3M8EA 4EM2A 2QZ8A 2OU2A 4RAZA 3K1PA 2QYOA 3RYRA 3T0YA 3CO6C 1BI2A 1W5SA 1SD7A 3HRMA 4B09A 1IXRC 5D5WB 1H9GA 3V8LA 1PP8F 5FLXK 2LF7A 1KGSA 2WTEA 1KA8A 1E2XA 3R60A 3HYIA 3WU0A 1T6SA 3FM3A 1W4MA 3KE2A 1S7AA 2F5CA 4WCGA 2K4BA 4M6YA 1HXDA 3ZP5A 2K27A 2G7HA 2AS5F 2DO7A 5HOOA 4UV8A 1I1GA 4HX7A 3WODF 2YX7A 1MDMA 1CF7B 2DK5A 4RB0A 4KN4X 3MCZA 2B0LA 3D0SA 1HQCA 4DQ2A 2HS5A 4YG2F 1ZRCA 1IRFA 1SMTA 2O6GE 3ZMSA 3HRSA 1V4RA 3BY6A 2ZJ2A 3T8RA 3WTYC 3GFLA 2ZNZA 4G7HF 1F9NA 1WQ2A 1MDMB 3E6BA 4L0ZB 1H0MA 5E1WA 1Z7UA 1XSVA 4D0PA 2MC3A 2GZWA 2ETHA 3T8TA 3F23A 3FWEA 4A6DA 1CGPA 4WX9A 2FBHA 3C7JA 1D8KA 3IHUA 5CJ9A 2VC1A 5LBQA 1HW1A 4IVNA 3OOPA 1O3RA 3EYYA 5DV5A 3F3XA 3FF5A 3IRQA 5K5OA 2P8TA 2G7UA 2KJCA 4LLGF 1P4AA 3QPHA 3T5XA 4BHPA 4JK1X 4LD5A 3JW4A 1S29A 2ZO4A 4A5NA 3QU6A 4IHTA 3MZHA 4IF4A 1DUXC 4ENJA 5D4SA 5D8LB 3L2CA 2L02A 1Z9CA 4RB1A 3TKYA 4XBFA 3GO5A 2LNBA 1ONVA 2W84A 2XKOA 4GCVA 3H92A 4AWXB 2ZNYA 2HQRA 1QZYA 2XV4S 2Q2EA 2PBIA 2D1HA 1LDJA 2WV0A 2DTRA 2IT0A 5HS7A 1BN5A 1IF1A 4OMYA 2XAHA 2JT1A 4KUMA 4HV5A 1F5TA 1OPCA 1ZREA 3PQKA 3J80Z 1RI7A 1J9IA 5CVRA 1OKRA 2G9WA 4I2OA 4BXUA 1IN8A 2PN6A 3ZMVA 1RUOA 2K7LA 3TO7A 3D5LA 3IKTA 2DAOA 5D5XB 1OYIA 2BEOA 3P9CA 4KNYA 3GWZA 5A2QZ 2ACJA 5K5RA 3W6KB 2J5PA 3J7AO 1H9TA 2KIUA 3TGNA 2R7FA 2MLGA 2K86A 2VBZA 2Y48A 3HSRA 5TRDA 3L09A 3RKWA 2W24A 5F1RA 4AVPA 2MH9A 4M9XA 2VT2A 1ZGJA 2OQRA 1ZG5A 1G3TA 4PGGA 3E6DA 4RB3C 4YIIA 1UHMA 1P6RA 1O7LA 3KP4A 3V7CA 4AIKA 1J0RA 2XAGA 4WXDA 4XSZF 3HSFA 4RGSA 5BPDA 3F8BA 4HF1A 3HHGA 4I09A 4NB5A 4HOBA 4N9IA 3KP2A 3I4PA 1ZYRF 1TNSA 3HSEA 1O57A 3Q9SA 2RC4A 5HLIA 3I71A 2RV8A 1FWZA 4UNOA 3M1EA 3ZN1A 3GW2A 2ZKZA 3GX4X 4HX4A 2GQQA 3TDZC 2M8EA 1I27A 2R3SA 4XRFA 2FNPA 3KP3A 1Y0UA 1ZH5A 3IWFA 5LGTA 3ABUA 3KETA 4HLYA 1XMAA 1U6GA 2VONA 3JTHA 3ERED 1B9MA 3LA7A 2CFXA 3I0TA 2P5LC 2CG4A 2UWMA 2QM3A 3ULQB 3QRFF 2QQ9A 4EGZA 2RNJA 3QOPA 1MJ9A 3JSPA 1YW8A 1EH8A 1BIAA 4A6EA 4PZJA 3F22A 1R1TA 2ELHA 4HZFA 3FHZA 2A5YB 2GIVA 1XMKA 1TNTA 4HBLA 3B02A 5IT9K 5ERIA 4QWQA 2IPQX 2RQPA 2VT3A 3KZZA 1P92A 3SFZA 1J7KA 1EH7A 1BIBA 3E6MA 5FLXZ 4WXHA 3HOSA 5AIPA 2JPCA 3F72A 2VOPA 2JRTA 4R79A 5CVVA 1U3EM 1Z6RA 5KVRA 4EJOA 2P6SA 2YR2A 4CICA 5AONA 2CW0F 3FMQA 5CVJA 1B1BA 2XUBA 3I59A 2D1VA 4OIRF 5HDNA 4GXOA 4MTDA 3RI4A 1O3SA 2LDUA 1O7FA 5L3CA 1RUNA 4EV0A 1ON2A 2EB7A 2PEXA 1LJ9A 1IXCA 2MA3A 1RZ4A 2VE9A 1JXSA 4ESJA 1BM9A 1FSEA 2H94A 3O6BB 4NQWA 4MNUA 1ZHFA 5BOXA 1TQIA 2HOEA 2Q8KA 1IN7A 2L4AA 2OD5A 3B73A 4KMFA 4M9ZA 3LQQA 3I59B 3RPQA 5LEKA 5K1YA 1SFUA 2PMUA 2PQ8A 1GHCA 4ENMA 1W5TA 4MEYF 3G73A 1HW5A 1I1SA 5D6EA 4CDGA 4O5VA 1LDDA 2GA2A 4M6XA 3DPTA 1TBXA 1BI0A 2M30A 4ASNA 5L3GA 2KIMA 2A6HF 4ZH4F 2HYGD 1S7OA 4HW0A 4BAYA 3GYHX 2O8XA 4EGYA 2VBYA 2W25A 1ZLKA 4TV7A 4YFXF 3K9TA 3AAFA 4CYDA 3M7GA 4ZZLA 1D5VA 2Z99A 4ZYDA 2YSRA 1X3UA 4A5MA 5DEQA 1T2KA 3GFIA 1S6LA 1TQPA 4LB6B 2FNAA 4ON0A 6PAXA 2XKPA 4LGWA 2HYFA 4OU0A 1F1ZA 3GXOA 1DDNA 1T98A 5LHGA 4B8XA 1W7PD 3KP6A 2FRHA 5AIQA 2NYXA 1WSUA 1MKMA 3ZN0A 2Z3YA 3QPTA 1U78A 2P5VA 1LEAA 1YO5C 4JQFA 3BZ6A 3L00A 2HKXA 2BBYA 1YG2A 1UFMA 4BHBA 2IW5A 4LG0A 2GXBA 4LLNA 5CLSA 1FY7A 5FFZA 2VBXA 1K6OA 5IT3A 3FXUA 1FC3A 3U9GA 1IN6A 2HZTA 4OIQF 1FNNA 5D5UB 3R61A 1TTYA 5HLGA 2DQLA 4N9HA 2C6YA 2NNYA 5JVTA 5ED4A 1XDUA 4JBAA 3ECOA 2Z9OA 2AXLA 2W57A 1ZG3A 4YFKF 3KP7A 2EV0A 5DDGA 1YIOA 2LSOA 1V3FA 5LGUA 3SXYA 3DP7A 4IHSA 2EA2A 1Z1DA 3C18A 2NS0A 1T0FA 3K1MA 1KU2A 3K0LA 3KZYA 2NNNA 1WWXA 3EYIA 5LRSA 3BJOA 2XAQA 5JFRA 2JPBA 3DEUA 2V1DA 4MGRA 4LB5A 4UUVA 3SZTA 3NQOA 3JSOA 3IKVA 4G8XA 4XSXF 5H6RA 4L9VA 5DUIA 2D2WA 4A0YA 3T1BA 5HS9A 4AIJA 3WG9A 4CGZA 3RPUA 2PFBA 1BBYA 3GFMA 5J8FA 3K2ZA 2OZ6A 1R5GA 2IA1A 4QLCU 2E7XA 3COAC 3O3KA 5DD8A 3F6OA 4BQAA 1FLIA 3HUGA 2EV5A 4G7ZF 4P96A 4OINF 2A6EF 1XGSA 4U7BA 2ESHA 2OZUA 1MGTA 4H0EA 4PGHA 1FOKA 1QNTA 2QENA 4ZZDA 5FD6A 4HV6A 2R7DA 4FX4A 5FO5A 2HR3A 4HAMA 3TDUC 3O2PE 3QAHA 4HQMA 3GF2A 3J81Z 2JZYA 5E17F 2F2EA 2CQKA 4HF0A 3FXQA 4KICA 5EEHA 1YS7A 3DF8A 3E5UA 4L9JA 3TOAA 1OYWA 3IRRA 1R58A 1U5TA 3RTRA 5JR3A 4EQQA 5FGMA 2ADUA 4KIBA 4LK1F 3WTWC 1YFHA 1XSXA 3ZMDA 2KJBA 2UXNA 4MTEA 1LNWA 4EVIA 1FBQA 3E5XA 5D8KB 4ZYEA 4IJAA 3ISPA 5TJJA 3E6CC 4KN7X 2O0YA 3KEOA 1HSTA 3KCCA 1AOYA 3LAJA 2A3SA 4WXCA 3CO7C 3ECHA 1G3SA 1T38A 5E1XA 1USTA 3V4GA 1U5TB 1K78A 2DPUA 1U2WA 4FHTA 1Z6TA 3OV8A 1XGNA 3FMRA 1JHFA 2IP2A 1U5TC 2WC2A 2XRNA 4GGGA 4PCQA 1GXPA 2O03A 5HS8A 3RJPA 4U0YA 2HGCA 1T39A 2XHKA 1TW3A 5D6FA 1DPUA 1SMYF 1KU9A 2TDXA 2IRFG 1K78B 3FZVA 4RAYA 2VOOA 5BQTA 3C3WA 3QP5A 1D8JA 4U7DA 4RGRA 2A69F 2LKPA 1TW2A 3BWGA 2ZCWA 4O6JA 1HSJA 1FPQA 3ZMTA 3I64A 5DYMA 1ZARA 2HKOA 2P5KA 4ZYHA 1LVAA 2MLKA 1STZA 3U1DA 1USSA 2ZMEA 3LFKA 4P5OA 2RGVA 5HLHA 4CXFA 4KIGA 1BI1A 2DFIA 2YU3A 4CZZA 2E1NA 4EM0B 4I7HA 1YW7A 1WRJA 2ESNA 3V7SA 2HQNA 4K2EA 2A07F 1YW9A 5HDKA 4A0ZA 2HFHA 3E5QA 2ZMEB 4GYIA 3F21A 4UVBA 3RDIA 5E18F 2PJPA 3CTAA 4Q5SF 1YTYA 3ZQ7A 4R1HA 3I53A 1A04A 4ENNA 2BYVE 2Z33A 2VN2A 3J80K 4AIHA 4WWCA 5ILVA 3I5UA 3H3UA 3LQRA 5JHUA 1HW2A 2RKHA 2Y0MA 3TQNA 3R4KA 5L3FA 2DW4A 3RKYA 1KQ8A 1XCVA 2O61A 5DCFA 5E20A 2P6TA 3DKWA 4OOIA 3ROUA 3QP6A 4YFNF 2EFPA 2VC0A 4RGXA 1YS6A 1HKSA 5A2QK 5L3DA 2L01A 5FB2A 1F4KA 2RN7A 1EV7A 2QBYA 2OBPA 3Q5FA 2H6CA 2XIGA 5HVQC 2CYYA 2EV6A 1QGPA 3LSTA 3NEUA 4ESFA 3PQJA 2KRFA 5E8GA 1JGSA 3QU3A 2IA0A 2RVCA 1MJBA 3WU1B 5ILSA 2GXGA 3VEPA 1R00A 3LAPA 1J59A 4EMSA 4HDUA 4Y13A 5CYVA 4MEXF 4KMUX 1O3TA 3ZPLA 2HTSA 3M8FA 2M87A 5ICFA 2QQAA 1G6NA 3CJNA 2ZFWA 5LHIA 4P9FA 2V1XA 4PDKA 1KYWA 4Y15A 1B6AA 4ETSA 2IA2A 2EFQA 2STWA 1SFEA 4L0YB 3GZ6A 1FBUA 4XLNF 3DQVC 2PI0A 3FM5A 3FMSA 1E17A 1HKTA 1YQAA 2EFWA 2YX4A 4UVCA 1QO0D 3WGHA 1G3YA 1HKQA 4BNCA 3KP5A 3G3ZA 2HEOA 3TO6A 2EA4A 4M9SA 1ON1A 2FU4A 4G9YA 2F5FA 1OMIA 4U0VA 5HDGA 1XCBA 4F7ZA 4Q4ZF 3F8MA 4IRHA 4E70A 3F8FA 1OYYA 3F6VA 2FE3A 1FX7A 2X0LA 4LJZF 1R1UA 1FP1D 1ULYA 3KEQA 1XSDA 1IW7F 2Y75A 2IJLA 1PDNC 4LLLA 2E7WA 1FYLA 5E1ZB 1ODDA 2FBIA 3REOA 5BS6A 1FZPB 3Q9VA 1HBXG 4I98B 4KYWA 4L9NA 1IXSB 1MZBA 3HTUA 2Z5UA 1LB2A 4BHCA 4O3MA 5JI6A 3W6JB 3EETA 3ZMZA 2IVMA 3BP8A 2F5DA 2DPDA 1IAWA 2K02A 2DI3A 5ICEA 3HRUA 4M73A 1CF7A 2FEZA 4L5JA 5LGNA 1WI9A 3HOTA 1P2FA 1DPRA 1BC7C 4HQEA 4OIPF 3KLOA 1ZG1A 2H27A 3H3ZA 4RB2C 3ABTA 4EJVA 3GEZA 5DD4A 5L3BA 2PG4A 5CVUA 1ZLJA 2H6BA 4P9UA 2D45A 4KA4A 3DV8A 2DQRA 1I6XA 4OMZA 2FOKA 1VTNC 3EQLF 3MAJA 2A61A 1O3QA 4P55A 4U0WA 2W85A 2YPRA 2FXAA 5LHHA 5L3EA 2XROA 3E3VA 2DT5A 4LG0B 3ZMUA 2EK5A 3RKXA 4UVAA 4S05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WTZ A;  1Q1H A;  2UXX A;  1KU7 A;  1FP2 A;  2CWE A;  3SHF A;  3N4M A;  1IN4 A;  4RGU A;  3MFK A;  5F6F A;  1FYM A;  1B4A A;  2X4H A;  2DK8 A;  1EH6 A;  5EEG A;  5FFX A;  1G4D A;  1UB9 A;  4IXA A;  3WTT C;  2PMH A;  2UZK A;  4UV9 A;  1XN7 A;  2J5O A;  4IPA A;  1R7J A;  2RDP A;  1R23 A;  3NRV A;  4N0B A;  1U8R A;  1XGO A;  3WGI A;  1IN5 A;  2DLL A;  2QVO A;  5KK1 A;  4FX0 A;  3M9A A;  3V8K A;  2M1B A;  3WGG A;  3RYP A;  3FX3 A;  3SQN A;  4OIO F;  1DP7 P;  1L3L A;  4M72 A;  4LMY A;  4MQ9 F;  3WTX C;  4LFU A;  4A2U A;  4Z2Y A;  4M74 A;  4ESB A;  4Y17 A;  2P7C B;  3DXJ F;  3R0J A;  3CLO A;  2HWV A;  3RIR A;  2P7V B;  1R1V A;  4EJT A;  4L5I A;  2FQ3 A;  3BOQ A;  2VE8 A;  4G6Q A;  3JAM K;  2QQB A;  4GYG A;  2JTV A;  3BJ6 A;  3C1D A;  1K7A A;  3V7R A;  2EJR A;  3SZP A;  3LA2 A;  2DBB A;  3LA3 A;  2VOD A;  4G94 A;  3MZY A;  2XAF A;  2FSW A;  4HF2 A;  5DUK A;  1J2X A;  4HLX A;  1L0O C;  4I0A A;  4A12 A;  1LDK B;  4R8H A;  2QUF A;  3MEX A;  1J5Y A;  3GZ5 A;  2CGP A;  4UXN A;  5K5Q A;  2V1U A;  2V9V A;  3GVA A;  1MD0 A;  3VFZ A;  1GVJ A;  3BDD A;  4G6D A;  3WE3 A;  4S04 A;  4G7O F;  4KFC A;  1FSH A;  2BV6 A;  2Q0O A;  3E97 A;  2MBF A;  2STT A;  2JSC A;  3S2W A;  3EDP A;  1SD6 A;  2CSO A;  5IT9 Z;  3IC7 A;  5LRR A;  2NAZ A;  1SD5 A;  1B9N A;  3PFI A;  2KKO A;  2ISY A;  3TOB A;  4HDV A;  5H6Q A;  2FMY A;  3WE2 A;  2K4J A;  2L3D A;  4Q48 A;  3FXR A;  4DNC A;  4M71 A;  2A68 F;  2ZBK A;  3F8C A;  4YIF A;  3L7W A;  1QPM A;  1S3J A;  4I01 A;  4A0X A;  5ILU A;  3CUQ A;  3R0A A;  3V8J A;  1BC8 C;  2LF8 A;  3BRO A;  3ELK A;  3MQ0 A;  4HA8 A;  1Z91 A;  1FYK A;  4NHJ A;  5H20 A;  3HRT A;  3U2R A;  4HYE A;  4BYY A;  2WWY A;  3I58 A;  3GFJ A;  5ICC A;  4MHG A;  5BPI A;  1SAX A;  1IZ1 A;  2V79 A;  5E8I A;  2GAU A;  5LEJ A;  3CDH A;  3K1N A;  3HHH A;  3VOE A;  3CUQ B;  3MWM A;  5F64 A;  1R36 A;  2HTJ A;  4ENK A;  1ZRD A;  2XAS A;  5J6X A;  4EM1 A;  1KU3 A;  3CUQ C;  1RNL A;  1KQ0 A;  1IUY A;  5FD5 A;  3LWF A;  3WTS C;  4L9T A;  1KQ9 A;  3KFW X;  3DPL C;  1G3W A;  2OQG A;  1OR7 A;  1RIO H;  4I0B A;  4WK8 F;  4MQV A;  4ZYG A;  2COM A;  3TO9 A;  4XLP F;  1IRG A;  3R6S A;  1ZAO A;  2PLY A;  4IRG A;  2F5E A;  2H09 A;  1B59 A;  3K69 A;  3P7N A;  4RS8 A;  4L18 B;  1QBJ A;  3J81 K;  4LK0 F;  1LEB A;  2VXZ A;  1SD4 A;  2EFN A;  4KIF A;  4HX8 A;  3DFG A;  4UHT A;  2E1C A;  5LLQ A;  3WTU C;  3N97 A;  3IL2 A;  1BI3 A;  1AWC A;  1XGM A;  1GXQ A;  3GUD A;  2CO5 A;  5DCM A;  2DU9 A;  1I5Z A;  1JHH A;  1PP7 U;  1P4W A;  1XB4 A;  3I54 A;  2OA4 A;  1C0W A;  2O3F A;  3P9K A;  1S8N A;  5J8C A;  2L54 A;  1SFX A;  1TQM A;  2QLZ A;  2P4W A;  2FBK A;  3IWZ A;  1XDS A;  3KLN A;  1QZZ A;  4AD9 A;  5DCM B;  2EWN A;  1D3Y A;  2M45 A;  2EFO A;  1P4X A;  1K79 A;  1J75 A;  2FML A;  5CVI A;  2QBY B;  2OAZ A;  1YLF A;  2HDC A;  4KT5 C;  4FT8 A;  1JE8 A;  1QQI A;  5D5V B;  3BJA A;  2BE5 F;  1Z05 A;  1ZRF A;  3BPX A;  3GLX A;  4Q47 A;  1NHA A;  3L9F A;  1BOA A;  4KDP A;  1MJA A;  2XVC A;  2L4M A;  1PUE E;  1BJA A;  1W7P A;  2BGC A;  2XAJ A;  1WKM A;  2ISZ A;  1UHW A;  4BH9 A;  3BPV A;  2MH2 A;  2ZXJ A;  4EJW A;  2QWW A;  2XGX A;  4I02 A;  4WF2 A;  2KIF A;  1R5H A;  3P9I A;  3VOD A;  2M5W A;  3WTV C;  4GO1 A;  4EJU A;  5BMZ A;  2FF4 A;  3EUH A;  3CUO A;  1KYZ A;  4U88 A;  3JTG A;  1R22 A;  1W7P B;  3VB2 A;  1REP C;  5ICG A;  3ML6 A;  2VBW A;  1LQ1 A;  4CO8 A;  1ZGA A;  3HTS B;  1UCR A;  2FA5 A;  2NRA C;  1FT9 A;  2GWR A;  4IRI A;  1TLH B;  3HIF A;  4CHU A;  2V6C A;  1ZN2 A;  2MD5 A;  3JAM Z;  1FBS A;  3F8N A;  1YYV A;  5D4R A;  2GA1 A;  1XD7 A;  3M8E A;  4EM2 A;  2QZ8 A;  2OU2 A;  4RAZ A;  3K1P A;  2QYO A;  3RYR A;  3T0Y A;  3CO6 C;  1BI2 A;  1W5S A;  1SD7 A;  3HRM A;  4B09 A;  1IXR C;  5D5W B;  1H9G A;  3V8L A;  1PP8 F;  5FLX K;  2LF7 A;  1KGS A;  2WTE A;  1KA8 A;  1E2X A;  3R60 A;  3HYI A;  3WU0 A;  1T6S A;  3FM3 A;  1W4M A;  3KE2 A;  1S7A A;  2F5C A;  4WCG A;  2K4B A;  4M6Y A;  1HXD A;  3ZP5 A;  2K27 A;  2G7H A;  2AS5 F;  2DO7 A;  5HOO A;  4UV8 A;  1I1G A;  4HX7 A;  3WOD F;  2YX7 A;  1MDM A;  1CF7 B;  2DK5 A;  4RB0 A;  4KN4 X;  3MCZ A;  2B0L A;  3D0S A;  1HQC A;  4DQ2 A;  2HS5 A;  4YG2 F;  1ZRC A;  1IRF A;  1SMT A;  2O6G E;  3ZMS A;  3HRS A;  1V4R A;  3BY6 A;  2ZJ2 A;  3T8R A;  3WTY C;  3GFL A;  2ZNZ A;  4G7H F;  1F9N A;  1WQ2 A;  1MDM B;  3E6B A;  4L0Z B;  1H0M A;  5E1W A;  1Z7U A;  1XSV A;  4D0P A;  2MC3 A;  2GZW A;  2ETH A;  3T8T A;  3F23 A;  3FWE A;  4A6D A;  1CGP A;  4WX9 A;  2FBH A;  3C7J A;  1D8K A;  3IHU A;  5CJ9 A;  2VC1 A;  5LBQ A;  1HW1 A;  4IVN A;  3OOP A;  1O3R A;  3EYY A;  5DV5 A;  3F3X A;  3FF5 A;  3IRQ A;  5K5O A;  2P8T A;  2G7U A;  2KJC A;  4LLG F;  1P4A A;  3QPH A;  3T5X A;  4BHP A;  4JK1 X;  4LD5 A;  3JW4 A;  1S29 A;  2ZO4 A;  4A5N A;  3QU6 A;  4IHT A;  3MZH A;  4IF4 A;  1DUX C;  4ENJ A;  5D4S A;  5D8L B;  3L2C A;  2L02 A;  1Z9C A;  4RB1 A;  3TKY A;  4XBF A;  3GO5 A;  2LNB A;  1ONV A;  2W84 A;  2XKO A;  4GCV A;  3H92 A;  4AWX B;  2ZNY A;  2HQR A;  1QZY A;  2XV4 S;  2Q2E A;  2PBI A;  2D1H A;  1LDJ A;  2WV0 A;  2DTR A;  2IT0 A;  5HS7 A;  1BN5 A;  1IF1 A;  4OMY A;  2XAH A;  2JT1 A;  4KUM A;  4HV5 A;  1F5T A;  1OPC A;  1ZRE A;  3PQK A;  3J80 Z;  1RI7 A;  1J9I A;  5CVR A;  1OKR A;  2G9W A;  4I2O A;  4BXU A;  1IN8 A;  2PN6 A;  3ZMV A;  1RUO A;  2K7L A;  3TO7 A;  3D5L A;  3IKT A;  2DAO A;  5D5X B;  1OYI A;  2BEO A;  3P9C A;  4KNY A;  3GWZ A;  5A2Q Z;  2ACJ A;  5K5R A;  3W6K B;  2J5P A;  3J7A O;  1H9T A;  2KIU A;  3TGN A;  2R7F A;  2MLG A;  2K86 A;  2VBZ A;  2Y48 A;  3HSR A;  5TRD A;  3L09 A;  3RKW A;  2W24 A;  5F1R A;  4AVP A;  2MH9 A;  4M9X A;  2VT2 A;  1ZGJ A;  2OQR A;  1ZG5 A;  1G3T A;  4PGG A;  3E6D A;  4RB3 C;  4YII A;  1UHM A;  1P6R A;  1O7L A;  3KP4 A;  3V7C A;  4AIK A;  1J0R A;  2XAG A;  4WXD A;  4XSZ F;  3HSF A;  4RGS A;  5BPD A;  3F8B A;  4HF1 A;  3HHG A;  4I09 A;  4NB5 A;  4HOB A;  4N9I A;  3KP2 A;  3I4P A;  1ZYR F;  1TNS A;  3HSE A;  1O57 A;  3Q9S A;  2RC4 A;  5HLI A;  3I71 A;  2RV8 A;  1FWZ A;  4UNO A;  3M1E A;  3ZN1 A;  3GW2 A;  2ZKZ A;  3GX4 X;  4HX4 A;  2GQQ A;  3TDZ C;  2M8E A;  1I27 A;  2R3S A;  4XRF A;  2FNP A;  3KP3 A;  1Y0U A;  1ZH5 A;  3IWF A;  5LGT A;  3ABU A;  3KET A;  4HLY A;  1XMA A;  1U6G A;  2VON A;  3JTH A;  3ERE D;  1B9M A;  3LA7 A;  2CFX A;  3I0T A;  2P5L C;  2CG4 A;  2UWM A;  2QM3 A;  3ULQ B;  3QRF F;  2QQ9 A;  4EGZ A;  2RNJ A;  3QOP A;  1MJ9 A;  3JSP A;  1YW8 A;  1EH8 A;  1BIA A;  4A6E A;  4PZJ A;  3F22 A;  1R1T A;  2ELH A;  4HZF A;  3FHZ A;  2A5Y B;  2GIV A;  1XMK A;  1TNT A;  4HBL A;  3B02 A;  5IT9 K;  5ERI A;  4QWQ A;  2IPQ X;  2RQP A;  2VT3 A;  3KZZ A;  1P92 A;  3SFZ A;  1J7K A;  1EH7 A;  1BIB A;  3E6M A;  5FLX Z;  4WXH A;  3HOS A;  5AIP A;  2JPC A;  3F72 A;  2VOP A;  2JRT A;  4R79 A;  5CVV A;  1U3E M;  1Z6R A;  5KVR A;  4EJO A;  2P6S A;  2YR2 A;  4CIC A;  5AON A;  2CW0 F;  3FMQ A;  5CVJ A;  1B1B A;  2XUB A;  3I59 A;  2D1V A;  4OIR F;  5HDN A;  4GXO A;  4MTD A;  3RI4 A;  1O3S A;  2LDU A;  1O7F A;  5L3C A;  1RUN A;  4EV0 A;  1ON2 A;  2EB7 A;  2PEX A;  1LJ9 A;  1IXC A;  2MA3 A;  1RZ4 A;  2VE9 A;  1JXS A;  4ESJ A;  1BM9 A;  1FSE A;  2H94 A;  3O6B B;  4NQW A;  4MNU A;  1ZHF A;  5BOX A;  1TQI A;  2HOE A;  2Q8K A;  1IN7 A;  2L4A A;  2OD5 A;  3B73 A;  4KMF A;  4M9Z A;  3LQQ A;  3I59 B;  3RPQ A;  5LEK A;  5K1Y A;  1SFU A;  2PMU A;  2PQ8 A;  1GHC A;  4ENM A;  1W5T A;  4MEY F;  3G73 A;  1HW5 A;  1I1S A;  5D6E A;  4CDG A;  4O5V A;  1LDD A;  2GA2 A;  4M6X A;  3DPT A;  1TBX A;  1BI0 A;  2M30 A;  4ASN A;  5L3G A;  2KIM A;  2A6H F;  4ZH4 F;  2HYG D;  1S7O A;  4HW0 A;  4BAY A;  3GYH X;  2O8X A;  4EGY A;  2VBY A;  2W25 A;  1ZLK A;  4TV7 A;  4YFX F;  3K9T A;  3AAF A;  4CYD A;  3M7G A;  4ZZL A;  1D5V A;  2Z99 A;  4ZYD A;  2YSR A;  1X3U A;  4A5M A;  5DEQ A;  1T2K A;  3GFI A;  1S6L A;  1TQP A;  4LB6 B;  2FNA A;  4ON0 A;  6PAX A;  2XKP A;  4LGW A;  2HYF A;  4OU0 A;  1F1Z A;  3GXO A;  1DDN A;  1T98 A;  5LHG A;  4B8X A;  1W7P D;  3KP6 A;  2FRH A;  5AIQ A;  2NYX A;  1WSU A;  1MKM A;  3ZN0 A;  2Z3Y A;  3QPT A;  1U78 A;  2P5V A;  1LEA A;  1YO5 C;  4JQF A;  3BZ6 A;  3L00 A;  2HKX A;  2BBY A;  1YG2 A;  1UFM A;  4BHB A;  2IW5 A;  4LG0 A;  2GXB A;  4LLN A;  5CLS A;  1FY7 A;  5FFZ A;  2VBX A;  1K6O A;  5IT3 A;  3FXU A;  1FC3 A;  3U9G A;  1IN6 A;  2HZT A;  4OIQ F;  1FNN A;  5D5U B;  3R61 A;  1TTY A;  5HLG A;  2DQL A;  4N9H A;  2C6Y A;  2NNY A;  5JVT A;  5ED4 A;  1XDU A;  4JBA A;  3ECO A;  2Z9O A;  2AXL A;  2W57 A;  1ZG3 A;  4YFK F;  3KP7 A;  2EV0 A;  5DDG A;  1YIO A;  2LSO A;  1V3F A;  5LGU A;  3SXY A;  3DP7 A;  4IHS A;  2EA2 A;  1Z1D A;  3C18 A;  2NS0 A;  1T0F A;  3K1M A;  1KU2 A;  3K0L A;  3KZY A;  2NNN A;  1WWX A;  3EYI A;  5LRS A;  3BJO A;  2XAQ A;  5JFR A;  2JPB A;  3DEU A;  2V1D A;  4MGR A;  4LB5 A;  4UUV A;  3SZT A;  3NQO A;  3JSO A;  3IKV A;  4G8X A;  4XSX F;  5H6R A;  4L9V A;  5DUI A;  2D2W A;  4A0Y A;  3T1B A;  5HS9 A;  4AIJ A;  3WG9 A;  4CGZ A;  3RPU A;  2PFB A;  1BBY A;  3GFM A;  5J8F A;  3K2Z A;  2OZ6 A;  1R5G A;  2IA1 A;  4QLC U;  2E7X A;  3COA C;  3O3K A;  5DD8 A;  3F6O A;  4BQA A;  1FLI A;  3HUG A;  2EV5 A;  4G7Z F;  4P96 A;  4OIN F;  2A6E F;  1XGS A;  4U7B A;  2ESH A;  2OZU A;  1MGT A;  4H0E A;  4PGH A;  1FOK A;  1QNT A;  2QEN A;  4ZZD A;  5FD6 A;  4HV6 A;  2R7D A;  4FX4 A;  5FO5 A;  2HR3 A;  4HAM A;  3TDU C;  3O2P E;  3QAH A;  4HQM A;  3GF2 A;  3J81 Z;  2JZY A;  5E17 F;  2F2E A;  2CQK A;  4HF0 A;  3FXQ A;  4KIC A;  5EEH A;  1YS7 A;  3DF8 A;  3E5U A;  4L9J A;  3TOA A;  1OYW A;  3IRR A;  1R58 A;  1U5T A;  3RTR A;  5JR3 A;  4EQQ A;  5FGM A;  2ADU A;  4KIB A;  4LK1 F;  3WTW C;  1YFH A;  1XSX A;  3ZMD A;  2KJB A;  2UXN A;  4MTE A;  1LNW A;  4EVI A;  1FBQ A;  3E5X A;  5D8K B;  4ZYE A;  4IJA A;  3ISP A;  5TJJ A;  3E6C C;  4KN7 X;  2O0Y A;  3KEO A;  1HST A;  3KCC A;  1AOY A;  3LAJ A;  2A3S A;  4WXC A;  3CO7 C;  3ECH A;  1G3S A;  1T38 A;  5E1X A;  1UST A;  3V4G A;  1U5T B;  1K78 A;  2DPU A;  1U2W A;  4FHT A;  1Z6T A;  3OV8 A;  1XGN A;  3FMR A;  1JHF A;  2IP2 A;  1U5T C;  2WC2 A;  2XRN A;  4GGG A;  4PCQ A;  1GXP A;  2O03 A;  5HS8 A;  3RJP A;  4U0Y A;  2HGC A;  1T39 A;  2XHK A;  1TW3 A;  5D6F A;  1DPU A;  1SMY F;  1KU9 A;  2TDX A;  2IRF G;  1K78 B;  3FZV A;  4RAY A;  2VOO A;  5BQT A;  3C3W A;  3QP5 A;  1D8J A;  4U7D A;  4RGR A;  2A69 F;  2LKP A;  1TW2 A;  3BWG A;  2ZCW A;  4O6J A;  1HSJ A;  1FPQ A;  3ZMT A;  3I64 A;  5DYM A;  1ZAR A;  2HKO A;  2P5K A;  4ZYH A;  1LVA A;  2MLK A;  1STZ A;  3U1D A;  1USS A;  2ZME A;  3LFK A;  4P5O A;  2RGV A;  5HLH A;  4CXF A;  4KIG A;  1BI1 A;  2DFI A;  2YU3 A;  4CZZ A;  2E1N A;  4EM0 B;  4I7H A;  1YW7 A;  1WRJ A;  2ESN A;  3V7S A;  2HQN A;  4K2E A;  2A07 F;  1YW9 A;  5HDK A;  4A0Z A;  2HFH A;  3E5Q A;  2ZME B;  4GYI A;  3F21 A;  4UVB A;  3RDI A;  5E18 F;  2PJP A;  3CTA A;  4Q5S F;  1YTY A;  3ZQ7 A;  4R1H A;  3I53 A;  1A04 A;  4ENN A;  2BYV E;  2Z33 A;  2VN2 A;  3J80 K;  4AIH A;  4WWC A;  5ILV A;  3I5U A;  3H3U A;  3LQR A;  5JHU A;  1HW2 A;  2RKH A;  2Y0M A;  3TQN A;  3R4K A;  5L3F A;  2DW4 A;  3RKY A;  1KQ8 A;  1XCV A;  2O61 A;  5DCF A;  5E20 A;  2P6T A;  3DKW A;  4OOI A;  3ROU A;  3QP6 A;  4YFN F;  2EFP A;  2VC0 A;  4RGX A;  1YS6 A;  1HKS A;  5A2Q K;  5L3D A;  2L01 A;  5FB2 A;  1F4K A;  2RN7 A;  1EV7 A;  2QBY A;  2OBP A;  3Q5F A;  2H6C A;  2XIG A;  5HVQ C;  2CYY A;  2EV6 A;  1QGP A;  3LST A;  3NEU A;  4ESF A;  3PQJ A;  2KRF A;  5E8G A;  1JGS A;  3QU3 A;  2IA0 A;  2RVC A;  1MJB A;  3WU1 B;  5ILS A;  2GXG A;  3VEP A;  1R00 A;  3LAP A;  1J59 A;  4EMS A;  4HDU A;  4Y13 A;  5CYV A;  4MEX F;  4KMU X;  1O3T A;  3ZPL A;  2HTS A;  3M8F A;  2M87 A;  5ICF A;  2QQA A;  1G6N A;  3CJN A;  2ZFW A;  5LHI A;  4P9F A;  2V1X A;  4PDK A;  1KYW A;  4Y15 A;  1B6A A;  4ETS A;  2IA2 A;  2EFQ A;  2STW A;  1SFE A;  4L0Y B;  3GZ6 A;  1FBU A;  4XLN F;  3DQV C;  2PI0 A;  3FM5 A;  3FMS A;  1E17 A;  1HKT A;  1YQA A;  2EFW A;  2YX4 A;  4UVC A;  1QO0 D;  3WGH A;  1G3Y A;  1HKQ A;  4BNC A;  3KP5 A;  3G3Z A;  2HEO A;  3TO6 A;  2EA4 A;  4M9S A;  1ON1 A;  2FU4 A;  4G9Y A;  2F5F A;  1OMI A;  4U0V A;  5HDG A;  1XCB A;  4F7Z A;  4Q4Z F;  3F8M A;  4IRH A;  4E70 A;  3F8F A;  1OYY A;  3F6V A;  2FE3 A;  1FX7 A;  2X0L A;  4LJZ F;  1R1U A;  1FP1 D;  1ULY A;  3KEQ A;  1XSD A;  1IW7 F;  2Y75 A;  2IJL A;  1PDN C;  4LLL A;  2E7W A;  1FYL A;  5E1Z B;  1ODD A;  2FBI A;  3REO A;  5BS6 A;  1FZP B;  3Q9V A;  1HBX G;  4I98 B;  4KYW A;  4L9N A;  1IXS B;  1MZB A;  3HTU A;  2Z5U A;  1LB2 A;  4BHC A;  4O3M A;  5JI6 A;  3W6J B;  3EET A;  3ZMZ A;  2IVM A;  3BP8 A;  2F5D A;  2DPD A;  1IAW A;  2K02 A;  2DI3 A;  5ICE A;  3HRU A;  4M73 A;  1CF7 A;  2FEZ A;  4L5J A;  5LGN A;  1WI9 A;  3HOT A;  1P2F A;  1DPR A;  1BC7 C;  4HQE A;  4OIP F;  3KLO A;  1ZG1 A;  2H27 A;  3H3Z A;  4RB2 C;  3ABT A;  4EJV A;  3GEZ A;  5DD4 A;  5L3B A;  2PG4 A;  5CVU A;  1ZLJ A;  2H6B A;  4P9U A;  2D45 A;  4KA4 A;  3DV8 A;  2DQR A;  1I6X A;  4OMZ A;  2FOK A;  1VTN C;  3EQL F;  3MAJ A;  2A61 A;  1O3Q A;  4P55 A;  4U0W A;  2W85 A;  2YPR A;  2FXA A;  5LHH A;  5L3E A;  2XRO A;  3E3V A;  2DT5 A;  4LG0 B;  3ZMU A;  2EK5 A;  3RKX A;  4UVA A;  4S05 A; 
#chains in the Genus database with same CATH topology
 3WTZ A;  2CJJ A;  1Q1H A;  2UXX A;  2VQH A;  1KU7 A;  1FP2 A;  2X6O A;  2CWE A;  3SHF A;  3N4M A;  1IN4 A;  4RGU A;  3MFK A;  5F6F A;  4ANJ A;  1FMW A;  1FYM A;  1B4A A;  2X4H A;  2DK8 A;  1EH6 A;  5EEG A;  5FFX A;  5KNL A;  2VI6 A;  4B44 A;  1G4D A;  1UB9 A;  4IXA A;  3WTT C;  2PMH A;  2UZK A;  4UV9 A;  1XN7 A;  2R7U A;  2J5O A;  3LNQ A;  4IPA A;  1R7J A;  2WV1 A;  2RDP A;  1R23 A;  3NRV A;  2R7O A;  4N0B A;  1U8R A;  1LVK A;  1XGO A;  4BS9 A;  4PSX A;  3WGI A;  1IDZ A;  1IN5 A;  3FXO A;  3H3V K;  5E3L A;  2B63 J;  2DLL A;  2QVO A;  3DEW A;  5KK1 A;  4FX0 A;  2H1K A;  2WA0 A;  1GDT A;  2L9R A;  3M9A A;  3V8K A;  2M1B A;  2D5V A;  1XPX A;  3WGG A;  1JJ8 C;  1GVD A;  3RYP A;  4A3L J;  3FX3 A;  3SQN A;  4OIO F;  2K9N A;  1DP7 P;  4B43 A;  1L3L A;  2MD0 A;  4M72 A;  2VQG A;  1DP3 A;  3H0G J;  2ZC2 A;  4LMY A;  4MQ9 F;  2F48 A;  5J1U A;  4LFU A;  4XQF A;  3WTX C;  3LSK A;  3ZQL A;  4A2U A;  1BJZ A;  4Z2Y A;  4M74 A;  4ESB A;  3HDD A;  2XB0 X;  2V7F A;  3PIO F;  3PO3 J;  4Y17 A;  5GTI C;  3RQI A;  3O8H A;  2P7C B;  1ETX A;  3J7A Y;  2HZD A;  3DXJ F;  3R0J A;  3CLO A;  4BE2 A;  3CCU I;  2HWV A;  2QKL B;  3RIR A;  4CCN A;  2P7V B;  1W5C C;  1R1V A;  3CCV I;  4EJT A;  3BR5 A;  3BCB A;  2LKS A;  1LFB A;  1TZL A;  4L5I A;  2FQ3 A;  2XF5 A;  2KFD A;  2RNG A;  3BOQ A;  3DBH B;  4UB8 C;  2VE8 A;  5HOD A;  3A2K A;  4G6Q A;  3JAM K;  2QQB A;  3C2B A;  1UG2 A;  4GYG A;  3G71 I;  3BTC A;  4F93 B;  1ORK A;  2JTV A;  4XOP A;  1RET A;  4FQG A;  3BJ6 A;  3C1D A;  1G2H A;  1K7A A;  1VQO I;  2NS7 A;  3MN2 A;  3V7R A;  3HKZ N;  3WG7 H;  2EJR A;  1MMS A;  3SZP A;  3LA2 A;  2DBB A;  3LA3 A;  2VOD A;  4G94 A;  1SVO A;  2I8D A;  2EPF A;  2HXI A;  3MZY A;  2LKX A;  2K3F A;  2XAF A;  2FSW A;  3HUG B;  4HF2 A;  3QYE A;  5DUK A;  5J3L A;  1J2X A;  4HLX A;  2KHM A;  1L0O C;  4I0A A;  4A12 A;  5FKK A;  1LDK B;  1G8X A;  1WPK A;  1MH4 A;  4R8H A;  1GV2 A;  2QUF A;  2IGO A;  3MEX A;  1J5Y A;  2DN0 A;  3GZ5 A;  4HSR A;  1D5Y A;  2CGP A;  2XGD A;  4UXN A;  5K5Q A;  2V1U A;  1BR1 A;  1D0Y A;  2IAI A;  2V9V A;  3CF2 A;  1VI0 A;  3GVA A;  3JRE A;  2Y31 A;  4RBO A;  1XS9 A;  4H4K C;  1MD0 A;  4JX6 A;  3VFZ A;  1GVJ A;  2OJE D;  3BDD A;  3PNY A;  4G6D A;  3WE3 A;  4S04 A;  1X19 A;  2OV7 A;  4G7O F;  3OYF A;  2DA5 A;  3FIW A;  3NAR A;  4KFC A;  1FSH A;  2BV6 A;  2DJI A;  2Q0O A;  3K4B A;  1S72 I;  3E97 A;  2MBF A;  2STT A;  1I39 A;  2JSC A;  3UNG C;  2NXN B;  3S2W A;  1SFO J;  2EH3 A;  3EDP A;  1SD6 A;  2CSO A;  5IT9 Z;  3IC7 A;  3PSF A;  5LRR A;  4BAC A;  1SEU A;  2NAZ A;  3S32 A;  4F91 B;  1SD5 A;  3PFY A;  1B9N A;  2KRH A;  2BY3 A;  3PFI A;  3GTJ J;  2KKO A;  1G59 A;  2ISY A;  3CD6 I;  3RZO J;  3M4O J;  3TOB A;  4HDV A;  5H6Q A;  2FMY A;  3VYS B;  3WE2 A;  3OYB A;  1U9N A;  2K4J A;  2L3D A;  4Q48 A;  3FXR A;  4DNC A;  4M71 A;  3HBL A;  4HNV A;  2A68 F;  1AKH A;  1MSF C;  2W1O A;  3L2Q A;  4LG3 A;  2ZBK A;  3G4S I;  3F8C A;  4YIF A;  3L7W A;  4BDZ A;  2COB A;  1PUF B;  1QPM A;  1S3J A;  1Z3X A;  4I01 A;  4A0X A;  2HVR A;  4QSH A;  5ILU A;  3CUQ A;  3R0A A;  3V8J A;  1BC8 C;  2LF8 A;  3BRO A;  3ELK A;  3MQ0 A;  4C2U A;  4U87 A;  4HA8 A;  1Z91 A;  1FYK A;  2JA6 J;  4NHJ A;  3K4C A;  3HRT A;  5H20 A;  1MNE A;  2L9N A;  2N8G A;  2M34 A;  3U2R A;  3M07 A;  4HYE A;  2W4S A;  2LVS A;  4BYY A;  2CV1 A;  1R5I D;  2BVL A;  1WJB A;  4RAG A;  2BW3 A;  3I58 A;  2WWY A;  1MNM C;  1AKH B;  3GFJ A;  4LIT A;  4MHG A;  5ICC A;  1VFC A;  5BPI A;  5FJ8 J;  1SAX A;  3K4J A;  1IZ1 A;  2V79 A;  3QOD A;  2Y9Y A;  4EEF G;  2L2O A;  5E8I A;  2JA5 J;  2GAU A;  2HYJ A;  3FKI J;  4B3A A;  5LEJ A;  3CDH A;  2RAE A;  3K1N A;  3HHH A;  3VOE A;  2DDB A;  3B6C A;  1MND A;  3CUQ B;  3H1C A;  3MWM A;  1EF4 A;  2GOX B;  1MBK A;  5F64 A;  4PFO A;  1R36 A;  2HTJ A;  3CP2 A;  4BY7 J;  4ENK A;  1ZRD A;  3KIO A;  2XAS A;  1TP4 A;  2VJJ A;  2M3A A;  5J6X A;  2MG4 A;  2XRL A;  4EM1 A;  1KU3 A;  1YE9 A;  1APL C;  3CUQ C;  2DJN A;  2JSP A;  1RNL A;  1KQ0 A;  3X2Q H;  2QCO A;  1IUY A;  5FD5 A;  3LWF A;  2DT7 B;  3BG7 A;  3JRF A;  3HOU J;  2BW3 B;  3WTS C;  1X2M A;  4L9T A;  2EIK H;  1KQ9 A;  3KFW X;  4NC8 A;  3DPL C;  1TWG J;  2O9L A;  4RM2 A;  3DWL E;  5IP9 J;  1G3W A;  2OQG A;  1HC8 A;  1RKT A;  4II3 A;  2HI3 A;  4FE4 A;  4RLF A;  3W3C A;  2IS1 A;  1SC7 A;  1RC9 A;  2AHQ A;  1OR7 A;  4W97 A;  3S1N J;  1RIO H;  4I0B A;  3BTJ A;  4WK8 F;  4MQV A;  3LSH A;  3ASN H;  4ZYG A;  2COM A;  3GTL J;  4BU2 A;  3TO9 A;  4XLP F;  1IRG A;  3JCU C;  3R6S A;  3GTG J;  1ZAO A;  2KDO A;  1ERD A;  2PLY A;  1TT0 A;  2LY1 A;  4IRG A;  1ETV A;  2F5E A;  2H09 A;  1B59 A;  3RKQ A;  3H5R A;  3K69 A;  4D5F A;  3P7N A;  4RS8 A;  5C3E J;  5M3M J;  4L18 B;  1QBJ A;  3J81 K;  4LK0 F;  3F9K A;  1LEB A;  2VXZ A;  4LIU A;  4E7S A;  4ZTF A;  1SD4 A;  1W0U A;  1HLV A;  2I10 A;  2EFN A;  4HNU A;  2X51 A;  4KIF A;  4HX8 A;  3DFG A;  2KQR A;  4UHT A;  1QVU A;  2DFF A;  2E1C A;  4IX7 A;  4YEL A;  2LMD A;  2VKV A;  2DT6 A;  5LLQ A;  4J19 A;  4DYQ A;  1POG A;  3DKX A;  3ZQG A;  5EZH A;  3S8P A;  3WTU C;  3N97 A;  3IL2 A;  4A3I J;  1BI3 A;  3PUB A;  5KAI C;  1AWC A;  1OR7 C;  1HF0 A;  4DYC A;  1XGM A;  1GXQ A;  4YIR X;  2CV2 A;  2CMP A;  1N77 A;  3GUD A;  4V2G A;  1VZ0 A;  2R5Z A;  3PL8 A;  2KDZ A;  2HU9 A;  2CO5 A;  4CSW A;  2JWT A;  4HEA 2;  5DCM A;  3LL7 A;  1VQ7 I;  2DU9 A;  1RPW A;  2GXA A;  4XIC A;  1I5Z A;  1JHH A;  1PP7 U;  2R7T A;  1P4W A;  2DOF A;  3AG1 H;  1YIJ I;  1XB4 A;  3I54 A;  1MMD A;  2OA4 A;  1C0W A;  2O3F A;  2PJR A;  1QA6 A;  2K9S A;  3P9K A;  2E34 A;  4BJ5 C;  1XMX A;  1S8N A;  3RQ4 A;  2VKD A;  5J8C A;  2EIJ H;  2L54 A;  2CU7 A;  1SFX A;  1X3Z B;  4PFP A;  1TQM A;  2QLZ A;  3S1R J;  1Z77 A;  3GTK J;  1V54 H;  3JRA A;  2JMW A;  2P4W A;  2FBK A;  3MMY B;  3IWZ A;  2HVQ A;  1XDS A;  3AG3 H;  4NBQ A;  5EZG A;  3KLN A;  1QZZ A;  4AD9 A;  5DCM B;  3TP3 A;  4D1Q A;  3K2A A;  2EWN A;  2NVT J;  5B1A H;  1UG0 A;  3QWL A;  1V5G A;  1ZGW A;  1D3Y A;  2M45 A;  2EFO A;  3CJQ B;  1P4X A;  1K79 A;  1J75 A;  2PJR B;  1YX5 A;  2FML A;  4E7Z A;  3QPS A;  3OL4 A;  4XLH A;  4OAZ A;  5BNG A;  3CJT B;  5CVI A;  1DU0 A;  1JKQ C;  3HXL A;  3VSL A;  3OS0 A;  1RKW A;  2ME0 A;  2QBY B;  2OAZ A;  2BY0 A;  2JQ7 A;  4CZC A;  1R9T J;  1YLF A;  2HDC A;  3FK6 A;  3BT9 A;  4KT5 C;  4FT8 A;  3I9V 2;  2VKE A;  2DDA A;  1JE8 A;  4CA0 A;  1QQI A;  4A3B J;  5D5V B;  4X0G A;  3V42 A;  2FUG 2;  1ZTR A;  1P7J A;  5LFA A;  4HRI A;  1LFP A;  3BJA A;  2BE5 F;  1P7I A;  1Z05 A;  1ZRF A;  3BPX A;  4II2 A;  3GLX A;  4Q47 A;  5KCM A;  3L2U A;  2E2H J;  1NHA A;  4JYK A;  2VKH A;  3L9F A;  1BOA A;  4PJJ A;  4KDP A;  1MJA A;  2XVC A;  4Y4R A;  3FXJ A;  2L4M A;  4C30 A;  1PUE E;  3L2W A;  2DMT A;  2LBF A;  1MW7 A;  1BJA A;  1W7P A;  2BGC A;  3G2B A;  2DA2 A;  2XAJ A;  1WKM A;  3JRC A;  1UHW A;  2ISZ A;  4BH9 A;  1RR8 C;  3BPV A;  4GRI A;  2O7O A;  2MH2 A;  3OOU A;  2JA8 J;  3CCQ I;  1D1C A;  2ZXJ A;  2FOW A;  4EJW A;  2QWW A;  1VND A;  2XGX A;  4I02 A;  4WF2 A;  1NTC A;  3KYL A;  3ZRG A;  2KIF A;  1D0Z A;  1IRX A;  1R5H A;  3P9I A;  2OTL I;  3OYN A;  1WJD A;  2E1M B;  2Y9Z A;  2CUF A;  1Z0X A;  3FBN B;  4A3J J;  3VOD A;  2M5W A;  1WI3 A;  3WTV C;  1IJW C;  4GO1 A;  4EJU A;  5BMZ A;  2FF4 A;  3EUH A;  3BLY A;  2XSJ C;  4UY8 I;  2E1M C;  3CUO A;  3JRI A;  1KYZ A;  2OUM A;  2BHY A;  3OS1 A;  4U88 A;  3JTG A;  2EZH A;  5FRM A;  1HDP A;  1R22 A;  1W7P B;  1Y6I A;  3QQA A;  2DA3 A;  5C4J J;  3VB2 A;  5F27 A;  5M5W J;  4UUS A;  1REP C;  5ICG A;  1K4S A;  4M3G A;  3LSM A;  2M2E A;  3ML6 A;  2M0C A;  2DA6 A;  2VBW A;  4PSW A;  1LQ1 A;  4CO8 A;  1ZGA A;  3HTS B;  1TWA J;  1UCR A;  1Q1V A;  2FA5 A;  3CME I;  2NRA C;  2NVU B;  1FT9 A;  1YHQ I;  4RMN A;  3OYI A;  2GWR A;  2XDV A;  4FIS A;  3CC2 I;  4IRI A;  2OTJ I;  4AVZ A;  1TLH B;  3HIF A;  4CHU A;  2V6C A;  5EYR A;  4XR6 A;  1ZN2 A;  3DCF A;  1DQU A;  1MBE A;  2MD5 A;  1R49 A;  3JAM Z;  1FBS A;  1K6Y A;  1YYV A;  3F8N A;  5D4R A;  1F43 A;  2GA1 A;  2X6W A;  1XD7 A;  3M8E A;  4EM2 A;  2QZ8 A;  4UUS B;  1WJF A;  2OU2 A;  3EUH C;  4BQO A;  2V4J C;  1JGG A;  1JKO C;  4RAZ A;  3K1P A;  2QYO A;  4LOC A;  1R4N B;  3RYR A;  3T0Y A;  5DTD A;  3CO6 C;  1BI2 A;  1GLN A;  1IDY A;  1W5S A;  1SD7 A;  3HRM A;  4B09 A;  2R7R A;  1T95 A;  1VQ9 I;  1IXR C;  5D5W B;  3QYB A;  2DOA A;  4PUS A;  1H9G A;  3V8L A;  4IKF A;  2NOG A;  1PP8 F;  3KYD B;  5FLX K;  2LF7 A;  1KGS A;  3SEQ A;  2WTE A;  1S7E A;  1KA8 A;  1UMQ A;  2KZG A;  1E2X A;  3R60 A;  2A6T A;  1V5F A;  3HYI A;  3GCM A;  3WU0 A;  1I50 J;  1T6S A;  1W4M A;  3ERM A;  3FM3 A;  2GIZ A;  3KE2 A;  1S7A A;  2F5C A;  2R7V A;  4WCG A;  4IO9 F;  2K4B A;  2F4O B;  4M6Y A;  1HXD A;  3QYF A;  5J1Y A;  2K27 A;  3ZP5 A;  2JN6 A;  2OF7 A;  2G7H A;  4A3F J;  2AS5 F;  2DO7 A;  4B4C A;  4C2M J;  1U9O A;  2VPL A;  2DCE A;  5HOO A;  2CW7 A;  4UV8 A;  1I1G A;  4HX7 A;  2RRE A;  4F55 A;  3WOD F;  3CLQ A;  2YX7 A;  1PVE A;  1MDM A;  1CF7 B;  2DK5 A;  5FKO A;  1X1A A;  4RB0 A;  4KIS A;  4KN4 X;  3MCZ A;  1I3A A;  2B0L A;  3D0S A;  3S2H J;  1HQC A;  1MMA A;  4DQ2 A;  4CCM A;  2HS5 A;  4YG2 F;  2ZJR F;  1ZRC A;  2OCC H;  4IHX A;  3CDI A;  2ZXW H;  2VAS A;  4KT6 A;  1HA8 A;  4XON A;  3A0B C;  2Z1D A;  1IRF A;  1SMT A;  1WH5 A;  4MO7 A;  3CC4 I;  5GAH J;  2CS3 A;  4XN3 A;  2O6G E;  1T08 B;  1XC5 A;  3G1L A;  3HOX J;  1VQP I;  3ZMS A;  3HRS A;  1V4R A;  3BY6 A;  1DGW Y;  2ZJ2 A;  3HPH A;  3T8R A;  5EF6 A;  5IOY A;  3WTY C;  4KIT B;  3GFL A;  2ZNZ A;  1R71 A;  4G7H F;  1F9N A;  1WQ2 A;  1MDM B;  4A3G J;  2EIN H;  3E6B A;  1OCO H;  1X4P A;  4L0Z B;  1H0M A;  5E1W A;  1Z7U A;  1VQM I;  4A3K J;  1XSV A;  4D0P A;  2LR8 A;  3Q0U A;  2MC3 A;  2GZW A;  3BG6 A;  2ETH A;  3S3M A;  3ABM H;  3T8T A;  3F23 A;  3FWE A;  4A6D A;  1CGP A;  3GBG A;  2ICW G;  1EKE A;  4WX9 A;  3DBL B;  2FBH A;  3C7J A;  1D8K A;  1ZEL A;  3IHU A;  5CJ9 A;  4DZP A;  1BW5 A;  4PK4 A;  1U0J A;  4L5E A;  2VQL A;  3K70 D;  4XKV A;  1W36 C;  2VC1 A;  3FBI B;  1HW1 A;  5LBQ A;  4IVN A;  3ZQI A;  4Y33 A;  1XX5 A;  3OOP A;  3LSI A;  1O3R A;  3EYY A;  4D9J A;  4BE1 A;  1JKP C;  3Q0W A;  1OIS A;  2IS2 A;  5DV5 A;  2F4M B;  1TWC J;  3F3X A;  2JVH A;  3FF5 A;  3TW6 A;  3IRQ A;  3BTI A;  5K5O A;  2P8T A;  2ECC A;  3M3Y J;  4XRS A;  1H8A C;  4EAT A;  2G7U A;  2KJC A;  3DTE A;  1VQ4 I;  3I56 I;  4LLG F;  1P4A A;  3QPH A;  3T5X A;  4BHP A;  4JK1 X;  4LD5 A;  3LSJ A;  3JW4 A;  4XKW A;  2B9S A;  4M6V A;  1S29 A;  2ZO4 A;  2CW8 A;  4A5N A;  3IAS 2;  1MH3 A;  2QQ8 A;  3QU6 A;  4IHT A;  4C9Y A;  3MZH A;  1TL8 A;  4IF4 A;  1BW6 A;  3N05 A;  4XMY A;  3VYU B;  1DUX C;  4ENJ A;  4BBR J;  2IGN A;  5D4S A;  5D8L B;  3L2C A;  2L7F P;  4XKB A;  2K40 A;  2L02 A;  4QPO A;  3PNT A;  1Z9C A;  4RB1 A;  3TKY A;  4XBF A;  4BXF A;  2I5U A;  3GO5 A;  2LNB A;  3W6V A;  1OCZ H;  1ONV A;  2W84 A;  3FXK A;  1X4O A;  1YJW I;  2XKO A;  4GCV A;  3JRD A;  3H92 A;  4AWX B;  2ZNY A;  2HQR A;  5GAE J;  4IL6 C;  2HPM A;  3UKG A;  1QZY A;  2XV4 S;  3CES A;  1SAN A;  2Q2E A;  2NS8 A;  3TBI A;  1Y0N A;  3AG2 H;  2KZV A;  2D1H A;  2PBI A;  2W82 A;  4MIM A;  1LDJ A;  2DOE A;  2WV0 A;  2DTR A;  3W2A A;  2IT0 A;  5HS7 A;  4BJ6 C;  5K7Z A;  4A3E J;  1BN5 A;  1IF1 A;  1QRY A;  2E2I J;  4OMY A;  2JA7 J;  2XAH A;  1RR7 A;  2JT1 A;  3A02 A;  3TL4 X;  4KUM A;  4FCY A;  4HV5 A;  1F5T A;  2B7E A;  2O5R A;  4BDY A;  2F5V A;  1FTT A;  1OPC A;  5EG0 A;  1ZRE A;  1QPI A;  3PQK A;  3RZD J;  2LLK A;  4JP0 A;  3J80 Z;  2VIX A;  5EEA A;  5EGO A;  3ESW B;  1FIP A;  4AID A;  1RI7 A;  1HDD C;  2KMU A;  1J9I A;  3KX2 A;  5CVR A;  1OKR A;  2G9W A;  4I2O A;  1N25 A;  4HG2 A;  4BXU A;  3CQZ J;  3UR3 C;  4Y52 J;  4GDF A;  1IN8 A;  2Q2E B;  3AKZ A;  3OY9 A;  2PN6 A;  3LOC A;  3ZMV A;  4A3C J;  1RUO A;  1JTY A;  2DMN A;  2HOS A;  1YJN I;  4D5C A;  2K7L A;  3HEF A;  3TO7 A;  3O8G A;  1ETW A;  1S5L C;  3BCA A;  3D5L A;  3IKT A;  3AL0 B;  2QSG X;  2DAO A;  3K4N A;  5D5X B;  1I6H J;  1YI2 I;  1OYI A;  2BEO A;  1T56 A;  3DBR B;  3P9C A;  2HVS A;  1A35 A;  4KNY A;  3GWZ A;  5A2Q Z;  2ACJ A;  5K5R A;  3W6K B;  2J5P A;  3CC7 I;  3J7A O;  1H9T A;  3AL0 C;  2KIU A;  1FIA A;  5EGO B;  3MKL A;  1XTA A;  4BQQ A;  2NVX J;  3TGN A;  4M3D A;  1WJE A;  2R7F A;  2MLG A;  3SDG A;  2K86 A;  2VBZ A;  3MKW B;  3PNV A;  2Y48 A;  3HSR A;  5TRD A;  3L09 A;  3RKW A;  2LOO A;  5B3S H;  2W24 A;  1U8B A;  2YU9 J;  1IRZ A;  3IUO A;  1FEX A;  5F1R A;  4AVP A;  3S15 J;  3OYK A;  2MH9 A;  3DTI A;  2UUZ A;  4M9X A;  2DMQ A;  2CH0 A;  4B1R A;  2VT2 A;  1ZGJ A;  2OQR A;  1ZG5 A;  1IC8 A;  1G3T A;  4PGG A;  1Y8R B;  4Z6Y A;  3CF5 F;  4C2T A;  5E3N A;  3E6D A;  4RB3 C;  2DA4 A;  2K9Q A;  4YII A;  1UHM A;  1P6R A;  3B6A A;  1O7L A;  5KHD A;  3KP4 A;  2A5W A;  3V7C A;  3FXM A;  2L0K A;  2MSY A;  4AIK A;  3I4M J;  2JJ7 A;  1J0R A;  1YIT I;  4JX4 A;  2XAG A;  4WXD A;  4XSZ F;  3HSF A;  1FMV A;  3VYR B;  1NG6 A;  4RGS A;  5IPA A;  3F8B A;  5BPD A;  4HF1 A;  2WAF A;  3HHG A;  4I09 A;  4NB5 A;  1AHD P;  4A3D J;  4HOB A;  4NC6 A;  4N9I A;  3KP2 A;  3FHN A;  3BR3 A;  3ZQQ A;  3CP8 A;  3I4P A;  2DXI A;  1ZYR F;  2LTP A;  1BA5 A;  1TNS A;  1IG7 A;  3HSE A;  1O57 A;  3A1Y A;  3I3L A;  2RC4 A;  3Q9S A;  3S16 J;  5FRO A;  5HLI A;  3I71 A;  2RV8 A;  1FWZ A;  4UNO A;  1Y1V J;  3M1E A;  3ZN1 A;  3GW2 A;  2ZKZ A;  3GX4 X;  4HX4 A;  1IUF A;  4G12 A;  3GME A;  3PO2 J;  1JTX A;  4FAS D;  2GQQ A;  3TDZ C;  2M8E A;  4CCK A;  1I27 A;  5JLW A;  3EUA A;  2R3S A;  4XRF A;  1XG1 A;  3OSF A;  2FNP A;  3KP3 A;  1Y0U A;  2TCT A;  5K7H A;  1ZH5 A;  2A05 A;  3IWF A;  5LGT A;  5IOZ A;  3ABU A;  3NWS A;  1X1D A;  3KET A;  4HLY A;  2CQQ A;  2Y2Z A;  1XMA A;  2M9H A;  1U6G A;  2R7W A;  1GUU A;  1A36 A;  2VON A;  2E5Z A;  5FKM A;  1VQL I;  3JTH A;  3ERE D;  3IH2 A;  1B9M A;  3LA7 A;  2MC4 A;  3CCS I;  3TED A;  2CFX A;  3OIQ A;  2DYR H;  2DA7 A;  3I0T A;  3A0H C;  3PJR A;  2P5L C;  4ZC3 A;  2CG4 A;  2Z2S B;  2UWM A;  4AM3 A;  2R5Y A;  1QZE A;  2QM3 A;  3DLA A;  1X58 A;  3ULQ B;  2QF7 A;  3QRF F;  4D7N A;  1OCT C;  2QQ9 A;  4BE0 A;  4EGZ A;  2M4K A;  4BXX J;  2FJ1 A;  3BG9 A;  2DYS H;  5M5Y J;  2RNJ A;  1SAU A;  2M4G A;  3QOP A;  3G6E I;  2HOT A;  1MJ9 A;  3JSP A;  3IH4 A;  5E3O A;  1YW8 A;  1EH8 A;  4IOA F;  1BIA A;  4A6E A;  2QKM B;  4PZJ A;  2VXD A;  1W1W E;  1R1T A;  3IAM 2;  3F22 A;  2ELH A;  4HZF A;  2JA2 A;  4F92 B;  2LY9 A;  4W1U A;  1GV5 A;  3FHZ A;  4M3B A;  2A5Y B;  2GIV A;  1XMK A;  1TNT A;  1Z3Y A;  4YEJ A;  2R7Z J;  3PSI A;  3SEZ A;  3TW7 A;  4HBL A;  5F1J A;  3Q3S A;  3B02 A;  5IT9 K;  5ERI A;  1K61 A;  2R5Y B;  2CV0 A;  4QWQ A;  2IPQ X;  2RQP A;  4X1E A;  2VT3 A;  1AU7 A;  3MZ8 A;  2KRC A;  2L7K A;  1JKR C;  3KZZ A;  3OL3 A;  2Q1Z B;  1R4M B;  1X1C A;  2ID3 A;  2M7A A;  1P92 A;  1T8I A;  1A31 A;  3F0C A;  3SFZ A;  1J7K A;  1EH7 A;  2XPW A;  2PMZ N;  1BIB A;  4BQN A;  3JRG A;  2E36 A;  2DFE A;  3ZR8 X;  2XC7 A;  3E6M A;  2CUZ A;  2CQX A;  2E1O A;  3H36 A;  5FLX Z;  3SJM A;  2UV1 A;  4WXH A;  3JRH A;  3HOS A;  1IO2 A;  3L2V A;  5AIP A;  4BEH A;  3JRB A;  2JPC A;  1ITY A;  2R5Z B;  4PJ0 C;  3F72 A;  3H0D A;  2VOP A;  1WH7 A;  4XNF A;  2JRT A;  4R79 A;  5CVV A;  1U3E M;  4LIV A;  1Z6R A;  2R7X A;  2VJ5 A;  4FET A;  5KVR A;  4EJO A;  5E79 C;  2P6S A;  2YR2 A;  3MKY B;  3H35 A;  1QHH D;  5AON A;  4CIC A;  2ME6 A;  2ZJQ F;  2CW0 F;  2X1D A;  1X3W B;  5FRN A;  2K3P A;  4Y3O A;  3FMQ A;  3HG9 A;  5CVJ A;  1B1B A;  2XUB A;  3I59 A;  2D1V A;  4OIR F;  5HDN A;  4GXO A;  4MTD A;  3RI4 A;  1MBH A;  1O3S A;  1T33 A;  2LDU A;  1O7F A;  3LMM A;  5L3C A;  2RQQ A;  3DKY A;  3ONQ A;  2QA4 I;  3BZK A;  1RUN A;  3GTP J;  4BEH B;  4XLA A;  1TT5 B;  4EV0 A;  1ON2 A;  2EB7 A;  2PEX A;  1LJ9 A;  1IXC A;  3SFI A;  2MA3 A;  1RZ4 A;  2VE9 A;  1JXS A;  5KAF C;  4ESJ A;  4A3M J;  1BM9 A;  1FSE A;  2H94 A;  2K85 A;  5HNF A;  5M3F J;  2E5N A;  3O6B B;  4NQW A;  1ETK A;  1ZHF A;  4MNU A;  5BOX A;  1TQI A;  3H9J A;  4DOZ A;  2HOE A;  2FQ4 A;  5J4Y A;  2Q8K A;  5FLM J;  1IN7 A;  2BXZ A;  2L4A A;  2OD5 A;  3B73 A;  4KMF A;  3ASO H;  2E35 A;  4M9Z A;  4ZDL A;  3LQQ A;  4DBR A;  5C4X J;  3I59 B;  4I76 A;  3BZC A;  1RRJ A;  3RPQ A;  5LEK A;  5K1Y A;  4CCO A;  1SFU A;  2PMU A;  1Z67 A;  2PQ8 A;  1A6Q A;  4XLF A;  1GHC A;  4ENM A;  3GTO J;  4AU7 A;  1W5T A;  4MEY F;  2JK3 A;  3G73 A;  2BZT A;  1HW5 A;  2KIQ A;  1I1S A;  5D6E A;  4CDG A;  4F52 A;  1YRN A;  4O5V A;  2K9M A;  1LDD A;  2GA2 A;  4BJT A;  4M6X A;  1YJ9 I;  3BR0 A;  3D5S C;  3DPT A;  1TBX A;  4E7J A;  1BI0 A;  2M30 A;  4ASN A;  4X6A J;  1LFU P;  5L3G A;  2VL8 A;  2ELK A;  2LBF B;  2KIM A;  2A6H F;  4ZH4 F;  2CUE A;  2HYG D;  4A69 C;  1S7O A;  4HW0 A;  4BAY A;  3GYH X;  2O8X A;  4EGY A;  3KZI C;  2VBY A;  5H2F C;  2W25 A;  1ZLK A;  4QPQ A;  3OYD A;  1CQT A;  4FE7 A;  2LH9 A;  1X1B A;  4TV7 A;  4YFX F;  2BY2 A;  3OYA A;  3BC8 A;  3K9T A;  3K7A J;  1JUM A;  3AAF A;  4CYD A;  2WB1 A;  3M7G A;  4ZZL A;  3AG4 H;  1D5V A;  2Z99 A;  1YOV B;  4ZYD A;  3FK7 A;  1YRN B;  2YSR A;  1X3U A;  3H5A A;  4DYR A;  3HOV J;  4A5M A;  3CCJ I;  1OCP A;  5DEQ A;  3E1S A;  4E4H A;  2OC6 A;  4ZJZ A;  1T2K A;  2HNH A;  3GFI A;  1K83 J;  1S6L A;  1TQP A;  3HC7 A;  4LB6 B;  4CYC A;  2FNA A;  4ON0 A;  4J00 A;  3BR6 A;  1W0T A;  3HGY A;  6PAX A;  2IGM A;  2Z16 A;  3KPH A;  2DA1 A;  4I6Z A;  3P5J A;  4BKX A;  2XKP A;  4BY1 J;  4LGW A;  2HYF A;  1VQ5 I;  4OU0 A;  4E7I A;  1F1Z A;  1ENH A;  3GXO A;  1DDN A;  1A5J A;  1T98 A;  5LHG A;  3OYH A;  4B8X A;  3S3O A;  2PMZ A;  1I3Q J;  2X48 A;  1W7P D;  2XAU A;  3KP6 A;  2FRH A;  5AIQ A;  2NYX A;  4IZZ A;  1MKM A;  1WSU A;  3ZN0 A;  2L9V A;  3BR1 A;  4YRV A;  3C2G A;  2ZFU A;  2JUC A;  2Z3Y A;  3QPT A;  1U78 A;  2P81 A;  2YS9 A;  2P5V A;  3HZJ A;  1LEA A;  1YO5 C;  3VDX A;  5DS9 A;  1N78 A;  4JQF A;  1FOY A;  3BZ6 A;  2LK2 A;  1KZH A;  3L00 A;  2HKX A;  1PYV A;  4KJZ A;  2BBY A;  1YG2 A;  1FTZ A;  3CMM A;  1UFM A;  4BHB A;  1TWF J;  2DFH A;  2IW5 A;  2LG4 A;  4LG0 A;  2GXB A;  4MFD A;  3TMO A;  1VQ8 I;  2XPU A;  4LLN A;  5CLS A;  1FY7 A;  2DTZ A;  1OLT A;  5FFZ A;  2VBX A;  2V26 A;  4V19 K;  1K6O A;  2R92 J;  4J01 A;  1PJR A;  5IT3 A;  3LSP A;  3FXU A;  1FC3 A;  3U9G A;  2WY8 Q;  3QPL A;  2KT0 A;  1IN6 A;  2HZT A;  2XSD C;  2QGU A;  3IP4 B;  1B8I A;  2V9P A;  4OIQ F;  1FNN A;  2Y0S N;  5D5U B;  4RA2 A;  3R61 A;  3GTM J;  1TTY A;  1Z21 A;  5HLG A;  5B1B H;  4RLQ A;  2DQL A;  4N9H A;  2R0Q C;  2C6Y A;  2NNY A;  5IYD J;  5JVT A;  5ED4 A;  1UHS A;  3OS2 A;  2VJ4 A;  1XDU A;  4JBA A;  3VWB A;  3ECO A;  2Z9O A;  2AXL A;  2W57 A;  5F0F A;  1MSE C;  3OYG A;  1ZG3 A;  4YFK F;  3KP7 A;  2EV0 A;  5DDG A;  1YIO A;  2LSO A;  2EZL A;  2W00 A;  1V3F A;  5IP7 J;  5LGU A;  3SXY A;  3DP7 A;  1X2N A;  3OR2 C;  5B5E C;  3W2V A;  4IHS A;  2EA2 A;  1Z1D A;  3C18 A;  1NG7 A;  2AQE A;  2NS0 A;  1B8I B;  1T0F A;  3DU6 A;  3K1M A;  5GAD J;  3HOW J;  1KU2 A;  3H9Q A;  2ID6 A;  3K0L A;  3KZY A;  4C3J J;  1UEL B;  5J4V A;  2NNN A;  1WWX A;  2WAD A;  3EYI A;  5LRS A;  3BJO A;  2G0E A;  5J40 A;  2XAQ A;  5JFR A;  1B72 A;  3H5N A;  1LKX A;  2JPB A;  2V1D A;  3DEU A;  4MGR A;  4LB5 A;  3ZXS A;  4UUV A;  3SZT A;  3NQO A;  3JSO A;  1LPQ A;  1E3P A;  1SVM A;  2BHZ A;  3IKV A;  4BL0 B;  4G8X A;  4XSX F;  5H6R A;  4L9V A;  3ZQF A;  3OYM A;  4XOR A;  2TRT A;  2WY7 Q;  3VYT B;  4V2F A;  2D2W A;  2EZI A;  5DUI A;  1JJ6 C;  2OCE A;  3HL2 A;  1VQK I;  4Y7N J;  2DOD A;  4A0Y A;  4IEJ A;  3T1B A;  3BR2 A;  4AYB N;  5HS9 A;  3S3N A;  4AIJ A;  2KIS A;  3WG9 A;  4CGZ A;  3MKZ A;  3RPU A;  2PFB A;  2IXS A;  1BBY A;  3GFM A;  5J8F A;  4DBQ A;  4PJM A;  3K2Z A;  2OZ6 A;  3DPU A;  4BUP A;  1R5G A;  2LD5 A;  4B48 A;  1B72 B;  1T0F C;  2IA1 A;  4QLC U;  4XK4 A;  2E7X A;  1UAA A;  1QU3 A;  3COA C;  3O3K A;  1P9Q C;  5DD8 A;  3F6O A;  4BQA A;  1FLI A;  1W36 D;  1H89 C;  2V6E A;  3HUG A;  2EV5 A;  4UUT A;  4G7Z F;  4P96 A;  5M5X J;  4OIN F;  5FKN A;  4NDL A;  2A6E F;  1XGS A;  4U7B A;  3ZQC A;  1RES A;  2ESH A;  2HDW A;  2OZU A;  1MGT A;  4H0E A;  2HDD A;  1QHG A;  2GBY A;  4PGH A;  1FOK A;  2EBI A;  2P0W A;  3DU5 A;  1QNT A;  1N75 A;  2QEN A;  3K4K A;  3Q0V A;  4ZZD A;  1QVT A;  5FD6 A;  2CFO A;  5GTH C;  4HV6 A;  2R7D A;  4FX4 A;  5FO5 A;  1OCR H;  4IOC F;  1AA7 A;  2X1E A;  3PM1 A;  2HR3 A;  3MVP A;  3OR1 C;  2ZJP F;  4HAM A;  4JX5 A;  1ETQ A;  3TDU C;  3O2P E;  3QAH A;  4HQM A;  3GF2 A;  2V1N A;  2JZY A;  3J81 Z;  2VJI A;  5E17 F;  2F2E A;  2CQK A;  1TWH J;  4HF0 A;  1WJA A;  3FXQ A;  2PX9 A;  4KIC A;  5EEH A;  1YS7 A;  2AO9 A;  3DF8 A;  4B47 A;  1DGR M;  4NUB A;  3E5U A;  2HQA A;  2VPR A;  4L9J A;  2LFB A;  2E2J J;  5FKL A;  5IYC J;  4FTH A;  3TOA A;  1OYW A;  1R58 A;  3IRR A;  2EIM H;  1OJL A;  1U5T A;  3RTR A;  5JR3 A;  4XRM A;  1VQ6 I;  4EQQ A;  5FGM A;  2ADU A;  3SYT A;  2Y30 A;  5K7F A;  2FD5 A;  4KIB A;  4LK1 F;  4XN0 A;  3WTW C;  1YFH A;  1XSX A;  3MD2 A;  2KJB A;  5CQG A;  3ZMD A;  1D1A A;  2UXN A;  1NH3 A;  4MTE A;  2L9S A;  1H88 C;  1LNW A;  4EVI A;  1FOW A;  4IQJ A;  1FBQ A;  4DZJ A;  3E5X A;  5J1R A;  3S93 A;  2Y69 H;  2DMP A;  5D8K B;  2CUJ A;  4ZYE A;  1WZ2 A;  4IJA A;  3ISP A;  4MFE A;  5TJJ A;  4KN7 X;  3ZCO A;  2NOJ B;  3E6C C;  2O0Y A;  3KEO A;  2Y0S A;  1PUF A;  3S1M J;  1HST A;  4AC0 A;  5IYB J;  3RPU D;  2IS4 A;  3KCC A;  1AOY A;  4AUX A;  3LAJ A;  4XKC A;  2L7Z A;  2IBD A;  2A3S A;  4WXC A;  5EG0 B;  3CO7 C;  4A93 J;  3ECH A;  1G3S A;  3EPZ A;  3SZG A;  1T38 A;  5E1X A;  3CZ6 A;  4E7L A;  1UST A;  3V4G A;  1U5T B;  1K78 A;  2DPU A;  2K9L A;  1U2W A;  4FHT A;  3VSK A;  1EJ9 A;  4QTR A;  2R7S A;  1F36 A;  1Z6T A;  3OV8 A;  1E3H A;  5TIS C;  4S0H B;  2MFZ A;  1XGN A;  4CUG A;  3FMR A;  3L1P A;  1JHF A;  2IP2 A;  1U5T C;  4N4N B;  2IS6 A;  2WC2 A;  2XRN A;  4GGG A;  1Y1W J;  5HLT A;  2WAE A;  4PCQ A;  1GXP A;  1WVR A;  2O03 A;  3GTQ J;  5HS8 A;  3RJP A;  4U0Y A;  2HGC A;  1T39 A;  2XHK A;  5FLV A;  1TW3 A;  5D6F A;  5GAG J;  2HXO A;  2EZK A;  2OPT A;  3NAU A;  1SMY F;  3D5R C;  3ZOB A;  1DPU A;  2JUG A;  2X6X A;  1KU9 A;  2TDX A;  3ABL H;  3CCY A;  2GOM A;  2IRF G;  3L2R A;  1K78 B;  1OCC H;  2E60 A;  3RCO A;  3GLL A;  3FZV A;  4RAY A;  2VOO A;  5BQT A;  2EIL H;  4IHW A;  4DIQ A;  3C3W A;  3HPG A;  3QP5 A;  4N4O B;  1ZR4 A;  4BBS J;  1D8J A;  4U7D A;  2F4I A;  4AYB A;  3HB9 A;  2LY2 A;  4RGR A;  2GLO A;  5CPR B;  2KL4 A;  4I99 C;  2A69 F;  2LKP A;  1MIJ A;  1TW2 A;  3BWG A;  3H9G A;  3LSR A;  3S1Q J;  3RSN A;  5LD2 C;  2ZCW A;  4O6J A;  1HSJ A;  1FPQ A;  2XB5 A;  5EJC A;  2ZXH A;  2M8G X;  1BR2 A;  3ZMT A;  3I64 A;  2WAQ N;  1ZAR A;  5DYM A;  2HKO A;  4P1W A;  2P5K A;  2K5C A;  4ZYH A;  2JRM A;  1LVA A;  1BL0 A;  2MLK A;  2LP0 A;  3WHC A;  1STZ A;  3U1D A;  1USS A;  2ZME A;  3LFK A;  3OIO A;  4BGD A;  4P5O A;  1VQN I;  2GM4 A;  2QEX I;  1A6I A;  2RGV A;  2XGE A;  5HLH A;  3VPR A;  4CXF A;  1IV6 A;  1WCM J;  3CDL A;  3ZGK A;  3OMY A;  2M7B A;  4KIG A;  1BI1 A;  2BY1 A;  1Y56 A;  2DFI A;  3BQZ A;  2H8R A;  3CJR B;  1WHU A;  4MLO A;  2XGC A;  2FX0 A;  5E3M A;  4D7M A;  2YU3 A;  2L7M P;  4RM3 A;  4CZZ A;  4HNT A;  2E1N A;  5TGT A;  2DMU A;  3HKZ A;  4I7H A;  4EM0 B;  3AFH A;  5F0C A;  2ELJ A;  1YW7 A;  1WRJ A;  2ESN A;  3G1M A;  3FKJ A;  1ZK8 A;  4ZDP A;  3V7S A;  2HQN A;  4XID A;  1ZQ3 P;  4K2E A;  2A07 F;  1YW9 A;  5HDK A;  2MYS A;  1V5E A;  2HFH A;  4A0Z A;  3E5Q A;  2E19 A;  2ZME B;  3GZN B;  1JUS A;  4GYI A;  4IHV A;  3F21 A;  2QSH X;  4UVB A;  3RDI A;  5E18 F;  2X6Y A;  2PJP A;  5DM6 F;  2WB1 N;  3CTA A;  4Q5S F;  2WBM A;  2VQC A;  3EUK L;  1YTY A;  3D1N I;  2ZME C;  3FDY A;  3ZQ7 A;  3M1C A;  3C2H A;  4R1H A;  3I53 A;  1A04 A;  4NC7 A;  3WU2 C;  4ENN A;  5JHF A;  2BYV E;  1LUJ B;  2EQR A;  3HJE A;  4DGW B;  2Z33 A;  2VN2 A;  3J80 K;  4OAY A;  4AIH A;  4WWC A;  5ILV A;  3I5U A;  1UZC A;  5JLX A;  4DJA A;  4C3I J;  3J7Y J;  2H8W A;  3H3U A;  2R4G A;  3FIS A;  5B66 C;  3LQR A;  5JHU A;  1HW2 A;  2RKH A;  2Y0M A;  3TQN A;  2BOL A;  2X9D A;  1JI8 A;  2BXY A;  3R4K A;  5L3F A;  2DW4 A;  3RKY A;  1KQ8 A;  1XCV A;  3CCE I;  1WGX A;  5JVG F;  3G1O A;  2O61 A;  5DCF A;  5E20 A;  2YUS A;  2CQN A;  2P6T A;  3DKW A;  4OOI A;  3ROU A;  3QP6 A;  2H1L A;  4YFN F;  2EFP A;  2V9K A;  2NVQ J;  2VC0 A;  4RGX A;  3S17 J;  2HOA A;  4GFB A;  1YS6 A;  1HKS A;  1ZKG A;  1FJL A;  4G6T B;  2W7N A;  5A2Q K;  5L3D A;  2M0M A;  2L01 A;  4M3F A;  5GP9 A;  1JT6 A;  5FB2 A;  4F3Q A;  2ZXI A;  1R6R A;  3PUF A;  3K4M A;  5J47 A;  1F4K A;  2RN7 A;  1EV7 A;  2QBY A;  2OBP A;  2R93 J;  1V55 H;  4UB6 C;  3Q5F A;  3S14 J;  4C3H J;  4XL9 A;  2H6C A;  5IY5 H;  2XIG A;  5HVQ C;  2CYY A;  2EV6 A;  1QGP A;  3LST A;  3DEE A;  3NEU A;  4ESF A;  1OFC X;  3SDB A;  3PQJ A;  2KRF A;  4OWR B;  5E8G A;  5C44 J;  3A01 A;  1JGS A;  3QU3 A;  2IA0 A;  4B3X A;  2RVC A;  1MJB A;  5F04 A;  2QSF X;  3K6G A;  3WU1 B;  5ILS A;  2GXG A;  3VEP A;  9ANT A;  1R00 A;  3LAP A;  1J59 A;  2KPM A;  3S2D J;  4EMS A;  4HDU A;  4Y13 A;  3IH3 A;  5CYV A;  4MEX F;  1JUP A;  1J09 A;  4KMU X;  1O3T A;  3ZPL A;  1MBJ A;  3OSG A;  2HTS A;  3M8F A;  2M87 A;  2HPI A;  1WFX A;  5ICF A;  2QQA A;  1G6N A;  3ABK H;  2WAQ A;  3CJN A;  2ZFW A;  3HOZ J;  2ZB9 A;  5LHI A;  3A01 B;  1UJ8 A;  4P9F A;  2V1X A;  2HQ5 A;  3CMA I;  4PJL A;  1HOM A;  1KON A;  4PDK A;  2BVM A;  2X85 A;  1KYW A;  4Y15 A;  1B6A A;  3OWT A;  3BG5 A;  2XPV A;  4ETS A;  1OQY A;  2IA2 A;  3CMY A;  1DU6 A;  2EFQ A;  2STW A;  1SFE A;  4L0Y B;  4DW6 A;  3W2W A;  3GZ6 A;  4NQW B;  1FBU A;  4XLN F;  1HCR A;  2X1C A;  3DTK A;  1SVL A;  3DQV C;  2PI0 A;  2F6C A;  3FM5 A;  3FMS A;  4ZDO A;  1E17 A;  1HKT A;  4RAF A;  1YQA A;  2EFW A;  2JVG A;  2YX4 A;  1TC3 C;  4UVC A;  1QO0 D;  3CCR I;  2NVY J;  3WGH A;  1G3Y A;  4E6K G;  4RDU A;  4XLC A;  3BTL A;  5IP6 A;  1IGN A;  5F0H A;  2E71 A;  1HKQ A;  4BNC A;  1FOX A;  3KP5 A;  4XOT A;  3G3Z A;  3KEY A;  4ZTJ A;  2CQ7 A;  2HEO A;  2AQF A;  3TO6 A;  3I4N J;  2EA4 A;  4M9S A;  1BOB A;  3LFU A;  1S9H A;  1ON1 A;  1BR4 A;  1ETO A;  2FU4 A;  1NK3 P;  4G9Y A;  3BQY A;  1VF9 A;  4HPQ A;  2MW8 A;  2F5F A;  3U1K A;  1OMI A;  4XLE A;  4U0V A;  3OYE A;  3OIP A;  5HDG A;  1XCB A;  1Z7L A;  4F7Z A;  4Q4Z F;  2VLA A;  4IHY A;  1X1P A;  3F8M A;  4IRH A;  4E70 A;  3F8F A;  2MGQ A;  1OYY A;  1LE8 A;  2R7Q A;  3PIP F;  3HM5 A;  2LRE A;  3IV5 A;  2LYC A;  3F6V A;  3K10 A;  4HST A;  1MBG A;  2FE3 A;  1FX7 A;  5EDN A;  2MAB A;  2X0L A;  4LJZ F;  1R1U A;  4JOM A;  1FP1 D;  1ULY A;  1ETY A;  3KEQ A;  1XSD A;  1IW7 F;  1YX3 A;  2Y75 A;  2ZSI B;  1WJ5 A;  1MMG A;  2IJL A;  1PDN C;  4LLL A;  3OYL A;  2E7W A;  4ITV A;  2CRG A;  1E0E A;  1FYL A;  5DM7 F;  3FXL A;  3OYJ A;  3NWT A;  5E1Z B;  1ODD A;  2FBI A;  3QOE A;  3E7L A;  3REO A;  5BS6 A;  1FZP B;  3Q9V A;  3U21 A;  3J7Z I;  1HBX G;  4I98 B;  4CH7 A;  4KYW A;  3E0J B;  1IXS B;  4L9N A;  1MZB A;  2XF7 A;  3HTU A;  5GPA A;  2Z5U A;  1LB2 A;  4BHC A;  4O3M A;  5JI6 A;  3W6J B;  1MBF A;  4ABZ A;  1Y8Q B;  3EET A;  1LE8 B;  3ZMZ A;  2IVM A;  3BP8 A;  3I55 I;  2LC2 A;  2F5D A;  4CYC B;  1O4X A;  2DPD A;  1IAW A;  2K02 A;  2VB6 A;  5HNH A;  2IEK A;  4NNJ A;  2DI3 A;  4XRS G;  1EA3 A;  5ICE A;  3ZQH A;  3HRU A;  4M73 A;  1CF7 A;  2FEZ A;  4E7K A;  4L5J A;  5LGN A;  3LSG A;  1WI9 A;  5CKT A;  3CCM I;  2KP6 A;  3HGG A;  3A4C A;  3HOT A;  1P2F A;  1DPR A;  1BC7 C;  4HQE A;  1SFK A;  3K4L A;  3TP0 A;  4OIP F;  2VUM J;  3KLO A;  1JT0 A;  1WJC A;  3WHB A;  1ZG1 A;  2H27 A;  1ACI A;  3H3Z A;  4XM3 A;  4RB2 C;  2KLO A;  3ABT A;  4EJV A;  1M1E B;  4M3E A;  3GEZ A;  2ZSH B;  1D1B A;  3M8J A;  5DD4 A;  5L3B A;  2PG4 A;  5CVU A;  1NK2 P;  1ZLJ A;  5CQE A;  1K4T A;  2H6B A;  3CCL I;  4P9U A;  2D45 A;  4KA4 A;  3DV8 A;  3A03 A;  2DQR A;  4CCL A;  3JR9 A;  3OYC A;  1I6X A;  4OMZ A;  4ZYA A;  2FOK A;  3DLL F;  1VTN C;  3EQL F;  1E3O C;  3MAJ A;  3KYC B;  2O8K A;  4IQ4 A;  3BG3 A;  2A61 A;  1MMN A;  3HOY J;  1O3Q A;  1D0X A;  5GPC A;  4PJN A;  1GT0 C;  4E7H A;  4P55 A;  2W85 A;  4U0W A;  2L5Q A;  2YPR A;  1Y39 A;  2FXA A;  2ECB A;  4CCJ A;  5LHH A;  5L3E A;  4QIW N;  2XRO A;  2AXT C;  3E3V A;  2DT5 A;  4LG0 B;  3ZMU A;  5F08 A;  2EK5 A;  3K70 C;  3RKX A;  2W48 A;  2LRD A;  2IGK A;  1ZR2 A;  2XF6 A;  1IV8 A;  4UVA A;  4S05 A; 
#chains in the Genus database with same CATH homology
 3WTZ A;  1Q1H A;  2UXX A;  1KU7 A;  1FP2 A;  2CWE A;  3SHF A;  3N4M A;  1IN4 A;  4RGU A;  3MFK A;  5F6F A;  1FYM A;  1B4A A;  2X4H A;  2DK8 A;  1EH6 A;  5EEG A;  5FFX A;  1G4D A;  1UB9 A;  4IXA A;  3WTT C;  2PMH A;  2UZK A;  4UV9 A;  1XN7 A;  2J5O A;  4IPA A;  1R7J A;  2RDP A;  1R23 A;  3NRV A;  4N0B A;  1U8R A;  1XGO A;  3WGI A;  1IN5 A;  2DLL A;  2QVO A;  5KK1 A;  4FX0 A;  3M9A A;  3V8K A;  2M1B A;  3WGG A;  3RYP A;  3FX3 A;  3SQN A;  4OIO F;  1DP7 P;  1L3L A;  4M72 A;  4LMY A;  4MQ9 F;  3WTX C;  4LFU A;  4A2U A;  4Z2Y A;  4M74 A;  4ESB A;  4Y17 A;  2P7C B;  3DXJ F;  3R0J A;  3CLO A;  2HWV A;  3RIR A;  2P7V B;  1R1V A;  4EJT A;  4L5I A;  2FQ3 A;  3BOQ A;  2VE8 A;  4G6Q A;  3JAM K;  2QQB A;  4GYG A;  2JTV A;  3BJ6 A;  3C1D A;  1K7A A;  3V7R A;  2EJR A;  3SZP A;  3LA2 A;  2DBB A;  3LA3 A;  2VOD A;  4G94 A;  3MZY A;  2XAF A;  2FSW A;  4HF2 A;  5DUK A;  1J2X A;  4HLX A;  1L0O C;  4I0A A;  4A12 A;  1LDK B;  4R8H A;  2QUF A;  3MEX A;  1J5Y A;  3GZ5 A;  2CGP A;  4UXN A;  5K5Q A;  2V1U A;  2V9V A;  3GVA A;  1MD0 A;  3VFZ A;  1GVJ A;  3BDD A;  4G6D A;  3WE3 A;  4S04 A;  4G7O F;  4KFC A;  1FSH A;  2BV6 A;  2Q0O A;  3E97 A;  2MBF A;  2STT A;  2JSC A;  3S2W A;  3EDP A;  1SD6 A;  2CSO A;  5IT9 Z;  3IC7 A;  5LRR A;  2NAZ A;  1SD5 A;  1B9N A;  3PFI A;  2KKO A;  2ISY A;  3TOB A;  4HDV A;  5H6Q A;  2FMY A;  3WE2 A;  2K4J A;  2L3D A;  4Q48 A;  3FXR A;  4DNC A;  4M71 A;  2A68 F;  2ZBK A;  3F8C A;  4YIF A;  3L7W A;  1QPM A;  1S3J A;  4I01 A;  4A0X A;  5ILU A;  3CUQ A;  3R0A A;  3V8J A;  1BC8 C;  2LF8 A;  3BRO A;  3ELK A;  3MQ0 A;  4HA8 A;  1Z91 A;  1FYK A;  4NHJ A;  5H20 A;  3HRT A;  3U2R A;  4HYE A;  4BYY A;  2WWY A;  3I58 A;  3GFJ A;  5ICC A;  4MHG A;  5BPI A;  1SAX A;  1IZ1 A;  2V79 A;  5E8I A;  2GAU A;  5LEJ A;  3CDH A;  3K1N A;  3HHH A;  3VOE A;  3CUQ B;  3MWM A;  5F64 A;  1R36 A;  2HTJ A;  4ENK A;  1ZRD A;  2XAS A;  5J6X A;  4EM1 A;  1KU3 A;  3CUQ C;  1RNL A;  1KQ0 A;  1IUY A;  5FD5 A;  3LWF A;  3WTS C;  4L9T A;  1KQ9 A;  3KFW X;  3DPL C;  1G3W A;  2OQG A;  1OR7 A;  1RIO H;  4I0B A;  4WK8 F;  4MQV A;  4ZYG A;  2COM A;  3TO9 A;  4XLP F;  1IRG A;  3R6S A;  1ZAO A;  2PLY A;  4IRG A;  2F5E A;  2H09 A;  1B59 A;  3K69 A;  3P7N A;  4RS8 A;  4L18 B;  1QBJ A;  3J81 K;  4LK0 F;  1LEB A;  2VXZ A;  1SD4 A;  2EFN A;  4KIF A;  4HX8 A;  3DFG A;  4UHT A;  2E1C A;  5LLQ A;  3WTU C;  3N97 A;  3IL2 A;  1BI3 A;  1AWC A;  1XGM A;  1GXQ A;  3GUD A;  2CO5 A;  5DCM A;  2DU9 A;  1I5Z A;  1JHH A;  1PP7 U;  1P4W A;  1XB4 A;  3I54 A;  2OA4 A;  1C0W A;  2O3F A;  3P9K A;  1S8N A;  5J8C A;  2L54 A;  1SFX A;  1TQM A;  2QLZ A;  2P4W A;  2FBK A;  3IWZ A;  1XDS A;  3KLN A;  1QZZ A;  4AD9 A;  5DCM B;  2EWN A;  1D3Y A;  2M45 A;  2EFO A;  1P4X A;  1K79 A;  1J75 A;  2FML A;  5CVI A;  2QBY B;  2OAZ A;  1YLF A;  2HDC A;  4KT5 C;  4FT8 A;  1JE8 A;  1QQI A;  5D5V B;  3BJA A;  2BE5 F;  1Z05 A;  1ZRF A;  3BPX A;  3GLX A;  4Q47 A;  1NHA A;  3L9F A;  1BOA A;  4KDP A;  1MJA A;  2XVC A;  2L4M A;  1PUE E;  1BJA A;  1W7P A;  2BGC A;  2XAJ A;  1WKM A;  2ISZ A;  1UHW A;  4BH9 A;  3BPV A;  2MH2 A;  2ZXJ A;  4EJW A;  2QWW A;  2XGX A;  4I02 A;  4WF2 A;  2KIF A;  1R5H A;  3P9I A;  3VOD A;  2M5W A;  3WTV C;  4GO1 A;  4EJU A;  5BMZ A;  2FF4 A;  3EUH A;  3CUO A;  1KYZ A;  4U88 A;  3JTG A;  1R22 A;  1W7P B;  3VB2 A;  1REP C;  5ICG A;  3ML6 A;  2VBW A;  1LQ1 A;  4CO8 A;  1ZGA A;  3HTS B;  1UCR A;  2FA5 A;  2NRA C;  1FT9 A;  2GWR A;  4IRI A;  1TLH B;  3HIF A;  4CHU A;  2V6C A;  1ZN2 A;  2MD5 A;  3JAM Z;  1FBS A;  3F8N A;  1YYV A;  5D4R A;  2GA1 A;  1XD7 A;  3M8E A;  4EM2 A;  2QZ8 A;  2OU2 A;  4RAZ A;  3K1P A;  2QYO A;  3RYR A;  3T0Y A;  3CO6 C;  1BI2 A;  1W5S A;  1SD7 A;  3HRM A;  4B09 A;  1IXR C;  5D5W B;  1H9G A;  3V8L A;  1PP8 F;  5FLX K;  2LF7 A;  1KGS A;  2WTE A;  1KA8 A;  1E2X A;  3R60 A;  3HYI A;  3WU0 A;  1T6S A;  3FM3 A;  1W4M A;  3KE2 A;  1S7A A;  2F5C A;  4WCG A;  2K4B A;  4M6Y A;  1HXD A;  3ZP5 A;  2K27 A;  2G7H A;  2AS5 F;  2DO7 A;  5HOO A;  4UV8 A;  1I1G A;  4HX7 A;  3WOD F;  2YX7 A;  1MDM A;  1CF7 B;  2DK5 A;  4RB0 A;  4KN4 X;  3MCZ A;  2B0L A;  3D0S A;  1HQC A;  4DQ2 A;  2HS5 A;  4YG2 F;  1ZRC A;  1IRF A;  1SMT A;  2O6G E;  3ZMS A;  3HRS A;  1V4R A;  3BY6 A;  2ZJ2 A;  3T8R A;  3WTY C;  3GFL A;  2ZNZ A;  4G7H F;  1F9N A;  1WQ2 A;  1MDM B;  3E6B A;  4L0Z B;  1H0M A;  5E1W A;  1Z7U A;  1XSV A;  4D0P A;  2MC3 A;  2GZW A;  2ETH A;  3T8T A;  3F23 A;  3FWE A;  4A6D A;  1CGP A;  4WX9 A;  2FBH A;  3C7J A;  1D8K A;  3IHU A;  5CJ9 A;  2VC1 A;  5LBQ A;  1HW1 A;  4IVN A;  3OOP A;  1O3R A;  3EYY A;  5DV5 A;  3F3X A;  3FF5 A;  3IRQ A;  5K5O A;  2P8T A;  2G7U A;  2KJC A;  4LLG F;  1P4A A;  3QPH A;  3T5X A;  4BHP A;  4JK1 X;  4LD5 A;  3JW4 A;  1S29 A;  2ZO4 A;  4A5N A;  3QU6 A;  4IHT A;  3MZH A;  4IF4 A;  1DUX C;  4ENJ A;  5D4S A;  5D8L B;  3L2C A;  2L02 A;  1Z9C A;  4RB1 A;  3TKY A;  4XBF A;  3GO5 A;  2LNB A;  1ONV A;  2W84 A;  2XKO A;  4GCV A;  3H92 A;  4AWX B;  2ZNY A;  2HQR A;  1QZY A;  2XV4 S;  2Q2E A;  2PBI A;  2D1H A;  1LDJ A;  2WV0 A;  2DTR A;  2IT0 A;  5HS7 A;  1BN5 A;  1IF1 A;  4OMY A;  2XAH A;  2JT1 A;  4KUM A;  4HV5 A;  1F5T A;  1OPC A;  1ZRE A;  3PQK A;  3J80 Z;  1RI7 A;  1J9I A;  5CVR A;  1OKR A;  2G9W A;  4I2O A;  4BXU A;  1IN8 A;  2PN6 A;  3ZMV A;  1RUO A;  2K7L A;  3TO7 A;  3D5L A;  3IKT A;  2DAO A;  5D5X B;  1OYI A;  2BEO A;  3P9C A;  4KNY A;  3GWZ A;  5A2Q Z;  2ACJ A;  5K5R A;  3W6K B;  2J5P A;  3J7A O;  1H9T A;  2KIU A;  3TGN A;  2R7F A;  2MLG A;  2K86 A;  2VBZ A;  2Y48 A;  3HSR A;  5TRD A;  3L09 A;  3RKW A;  2W24 A;  5F1R A;  4AVP A;  2MH9 A;  4M9X A;  2VT2 A;  1ZGJ A;  2OQR A;  1ZG5 A;  1G3T A;  4PGG A;  3E6D A;  4RB3 C;  4YII A;  1UHM A;  1P6R A;  1O7L A;  3KP4 A;  3V7C A;  4AIK A;  1J0R A;  2XAG A;  4WXD A;  4XSZ F;  3HSF A;  4RGS A;  5BPD A;  3F8B A;  4HF1 A;  3HHG A;  4I09 A;  4NB5 A;  4HOB A;  4N9I A;  3KP2 A;  3I4P A;  1ZYR F;  1TNS A;  3HSE A;  1O57 A;  3Q9S A;  2RC4 A;  5HLI A;  3I71 A;  2RV8 A;  1FWZ A;  4UNO A;  3M1E A;  3ZN1 A;  3GW2 A;  2ZKZ A;  3GX4 X;  4HX4 A;  2GQQ A;  3TDZ C;  2M8E A;  1I27 A;  2R3S A;  4XRF A;  2FNP A;  3KP3 A;  1Y0U A;  1ZH5 A;  3IWF A;  5LGT A;  3ABU A;  3KET A;  4HLY A;  1XMA A;  1U6G A;  2VON A;  3JTH A;  3ERE D;  1B9M A;  3LA7 A;  2CFX A;  3I0T A;  2P5L C;  2CG4 A;  2UWM A;  2QM3 A;  3ULQ B;  3QRF F;  2QQ9 A;  4EGZ A;  2RNJ A;  3QOP A;  1MJ9 A;  3JSP A;  1YW8 A;  1EH8 A;  1BIA A;  4A6E A;  4PZJ A;  3F22 A;  1R1T A;  2ELH A;  4HZF A;  3FHZ A;  2A5Y B;  2GIV A;  1XMK A;  1TNT A;  4HBL A;  3B02 A;  5IT9 K;  5ERI A;  4QWQ A;  2IPQ X;  2RQP A;  2VT3 A;  3KZZ A;  1P92 A;  3SFZ A;  1J7K A;  1EH7 A;  1BIB A;  3E6M A;  5FLX Z;  4WXH A;  3HOS A;  5AIP A;  2JPC A;  3F72 A;  2VOP A;  2JRT A;  4R79 A;  5CVV A;  1U3E M;  1Z6R A;  5KVR A;  4EJO A;  2P6S A;  2YR2 A;  4CIC A;  5AON A;  2CW0 F;  3FMQ A;  5CVJ A;  1B1B A;  2XUB A;  3I59 A;  2D1V A;  4OIR F;  5HDN A;  4GXO A;  4MTD A;  3RI4 A;  1O3S A;  2LDU A;  1O7F A;  5L3C A;  1RUN A;  4EV0 A;  1ON2 A;  2EB7 A;  2PEX A;  1LJ9 A;  1IXC A;  2MA3 A;  1RZ4 A;  2VE9 A;  1JXS A;  4ESJ A;  1BM9 A;  1FSE A;  2H94 A;  3O6B B;  4NQW A;  4MNU A;  1ZHF A;  5BOX A;  1TQI A;  2HOE A;  2Q8K A;  1IN7 A;  2L4A A;  2OD5 A;  3B73 A;  4KMF A;  4M9Z A;  3LQQ A;  3I59 B;  3RPQ A;  5LEK A;  5K1Y A;  1SFU A;  2PMU A;  2PQ8 A;  1GHC A;  4ENM A;  1W5T A;  4MEY F;  3G73 A;  1HW5 A;  1I1S A;  5D6E A;  4CDG A;  4O5V A;  1LDD A;  2GA2 A;  4M6X A;  3DPT A;  1TBX A;  1BI0 A;  2M30 A;  4ASN A;  5L3G A;  2KIM A;  2A6H F;  4ZH4 F;  2HYG D;  1S7O A;  4HW0 A;  4BAY A;  3GYH X;  2O8X A;  4EGY A;  2VBY A;  2W25 A;  1ZLK A;  4TV7 A;  4YFX F;  3K9T A;  3AAF A;  4CYD A;  3M7G A;  4ZZL A;  1D5V A;  2Z99 A;  4ZYD A;  2YSR A;  1X3U A;  4A5M A;  5DEQ A;  1T2K A;  3GFI A;  1S6L A;  1TQP A;  4LB6 B;  2FNA A;  4ON0 A;  6PAX A;  2XKP A;  4LGW A;  2HYF A;  4OU0 A;  1F1Z A;  3GXO A;  1DDN A;  1T98 A;  5LHG A;  4B8X A;  1W7P D;  3KP6 A;  2FRH A;  5AIQ A;  2NYX A;  1WSU A;  1MKM A;  3ZN0 A;  2Z3Y A;  3QPT A;  1U78 A;  2P5V A;  1LEA A;  1YO5 C;  4JQF A;  3BZ6 A;  3L00 A;  2HKX A;  2BBY A;  1YG2 A;  1UFM A;  4BHB A;  2IW5 A;  4LG0 A;  2GXB A;  4LLN A;  5CLS A;  1FY7 A;  5FFZ A;  2VBX A;  1K6O A;  5IT3 A;  3FXU A;  1FC3 A;  3U9G A;  1IN6 A;  2HZT A;  4OIQ F;  1FNN A;  5D5U B;  3R61 A;  1TTY A;  5HLG A;  2DQL A;  4N9H A;  2C6Y A;  2NNY A;  5JVT A;  5ED4 A;  1XDU A;  4JBA A;  3ECO A;  2Z9O A;  2AXL A;  2W57 A;  1ZG3 A;  4YFK F;  3KP7 A;  2EV0 A;  5DDG A;  1YIO A;  2LSO A;  1V3F A;  5LGU A;  3SXY A;  3DP7 A;  4IHS A;  2EA2 A;  1Z1D A;  3C18 A;  2NS0 A;  1T0F A;  3K1M A;  1KU2 A;  3K0L A;  3KZY A;  2NNN A;  1WWX A;  3EYI A;  5LRS A;  3BJO A;  2XAQ A;  5JFR A;  2JPB A;  3DEU A;  2V1D A;  4MGR A;  4LB5 A;  4UUV A;  3SZT A;  3NQO A;  3JSO A;  3IKV A;  4G8X A;  4XSX F;  5H6R A;  4L9V A;  5DUI A;  2D2W A;  4A0Y A;  3T1B A;  5HS9 A;  4AIJ A;  3WG9 A;  4CGZ A;  3RPU A;  2PFB A;  1BBY A;  3GFM A;  5J8F A;  3K2Z A;  2OZ6 A;  1R5G A;  2IA1 A;  4QLC U;  2E7X A;  3COA C;  3O3K A;  5DD8 A;  3F6O A;  4BQA A;  1FLI A;  3HUG A;  2EV5 A;  4G7Z F;  4P96 A;  4OIN F;  2A6E F;  1XGS A;  4U7B A;  2ESH A;  2OZU A;  1MGT A;  4H0E A;  4PGH A;  1FOK A;  1QNT A;  2QEN A;  4ZZD A;  5FD6 A;  4HV6 A;  2R7D A;  4FX4 A;  5FO5 A;  2HR3 A;  4HAM A;  3TDU C;  3O2P E;  3QAH A;  4HQM A;  3GF2 A;  3J81 Z;  2JZY A;  5E17 F;  2F2E A;  2CQK A;  4HF0 A;  3FXQ A;  4KIC A;  5EEH A;  1YS7 A;  3DF8 A;  3E5U A;  4L9J A;  3TOA A;  1OYW A;  3IRR A;  1R58 A;  1U5T A;  3RTR A;  5JR3 A;  4EQQ A;  5FGM A;  2ADU A;  4KIB A;  4LK1 F;  3WTW C;  1YFH A;  1XSX A;  3ZMD A;  2KJB A;  2UXN A;  4MTE A;  1LNW A;  4EVI A;  1FBQ A;  3E5X A;  5D8K B;  4ZYE A;  4IJA A;  3ISP A;  5TJJ A;  3E6C C;  4KN7 X;  2O0Y A;  3KEO A;  1HST A;  3KCC A;  1AOY A;  3LAJ A;  2A3S A;  4WXC A;  3CO7 C;  3ECH A;  1G3S A;  1T38 A;  5E1X A;  1UST A;  3V4G A;  1U5T B;  1K78 A;  2DPU A;  1U2W A;  4FHT A;  1Z6T A;  3OV8 A;  1XGN A;  3FMR A;  1JHF A;  2IP2 A;  1U5T C;  2WC2 A;  2XRN A;  4GGG A;  4PCQ A;  1GXP A;  2O03 A;  5HS8 A;  3RJP A;  4U0Y A;  2HGC A;  1T39 A;  2XHK A;  1TW3 A;  5D6F A;  1DPU A;  1SMY F;  1KU9 A;  2TDX A;  2IRF G;  1K78 B;  3FZV A;  4RAY A;  2VOO A;  5BQT A;  3C3W A;  3QP5 A;  1D8J A;  4U7D A;  4RGR A;  2A69 F;  2LKP A;  1TW2 A;  3BWG A;  2ZCW A;  4O6J A;  1HSJ A;  1FPQ A;  3ZMT A;  3I64 A;  5DYM A;  1ZAR A;  2HKO A;  2P5K A;  4ZYH A;  1LVA A;  2MLK A;  1STZ A;  3U1D A;  1USS A;  2ZME A;  3LFK A;  4P5O A;  2RGV A;  5HLH A;  4CXF A;  4KIG A;  1BI1 A;  2DFI A;  2YU3 A;  4CZZ A;  2E1N A;  4EM0 B;  4I7H A;  1YW7 A;  1WRJ A;  2ESN A;  3V7S A;  2HQN A;  4K2E A;  2A07 F;  1YW9 A;  5HDK A;  4A0Z A;  2HFH A;  3E5Q A;  2ZME B;  4GYI A;  3F21 A;  4UVB A;  3RDI A;  5E18 F;  2PJP A;  3CTA A;  4Q5S F;  1YTY A;  3ZQ7 A;  4R1H A;  3I53 A;  1A04 A;  4ENN A;  2BYV E;  2Z33 A;  2VN2 A;  3J80 K;  4AIH A;  4WWC A;  5ILV A;  3I5U A;  3H3U A;  3LQR A;  5JHU A;  1HW2 A;  2RKH A;  2Y0M A;  3TQN A;  3R4K A;  5L3F A;  2DW4 A;  3RKY A;  1KQ8 A;  1XCV A;  2O61 A;  5DCF A;  5E20 A;  2P6T A;  3DKW A;  4OOI A;  3ROU A;  3QP6 A;  4YFN F;  2EFP A;  2VC0 A;  4RGX A;  1YS6 A;  1HKS A;  5A2Q K;  5L3D A;  2L01 A;  5FB2 A;  1F4K A;  2RN7 A;  1EV7 A;  2QBY A;  2OBP A;  3Q5F A;  2H6C A;  2XIG A;  5HVQ C;  2CYY A;  2EV6 A;  1QGP A;  3LST A;  3NEU A;  4ESF A;  3PQJ A;  2KRF A;  5E8G A;  1JGS A;  3QU3 A;  2IA0 A;  2RVC A;  1MJB A;  3WU1 B;  5ILS A;  2GXG A;  3VEP A;  1R00 A;  3LAP A;  1J59 A;  4EMS A;  4HDU A;  4Y13 A;  5CYV A;  4MEX F;  4KMU X;  1O3T A;  3ZPL A;  2HTS A;  3M8F A;  2M87 A;  5ICF A;  2QQA A;  1G6N A;  3CJN A;  2ZFW A;  5LHI A;  4P9F A;  2V1X A;  4PDK A;  1KYW A;  4Y15 A;  1B6A A;  4ETS A;  2IA2 A;  2EFQ A;  2STW A;  1SFE A;  4L0Y B;  3GZ6 A;  1FBU A;  4XLN F;  3DQV C;  2PI0 A;  3FM5 A;  3FMS A;  1E17 A;  1HKT A;  1YQA A;  2EFW A;  2YX4 A;  4UVC A;  1QO0 D;  3WGH A;  1G3Y A;  1HKQ A;  4BNC A;  3KP5 A;  3G3Z A;  2HEO A;  3TO6 A;  2EA4 A;  4M9S A;  1ON1 A;  2FU4 A;  4G9Y A;  2F5F A;  1OMI A;  4U0V A;  5HDG A;  1XCB A;  4F7Z A;  4Q4Z F;  3F8M A;  4IRH A;  4E70 A;  3F8F A;  1OYY A;  3F6V A;  2FE3 A;  1FX7 A;  2X0L A;  4LJZ F;  1R1U A;  1FP1 D;  1ULY A;  3KEQ A;  1XSD A;  1IW7 F;  2Y75 A;  2IJL A;  1PDN C;  4LLL A;  2E7W A;  1FYL A;  5E1Z B;  1ODD A;  2FBI A;  3REO A;  5BS6 A;  1FZP B;  3Q9V A;  1HBX G;  4I98 B;  4KYW A;  4L9N A;  1IXS B;  1MZB A;  3HTU A;  2Z5U A;  1LB2 A;  4BHC A;  4O3M A;  5JI6 A;  3W6J B;  3EET A;  3ZMZ A;  2IVM A;  3BP8 A;  2F5D A;  2DPD A;  1IAW A;  2K02 A;  2DI3 A;  5ICE A;  3HRU A;  4M73 A;  1CF7 A;  2FEZ A;  4L5J A;  5LGN A;  1WI9 A;  3HOT A;  1P2F A;  1DPR A;  1BC7 C;  4HQE A;  4OIP F;  3KLO A;  1ZG1 A;  2H27 A;  3H3Z A;  4RB2 C;  3ABT A;  4EJV A;  3GEZ A;  5DD4 A;  5L3B A;  2PG4 A;  5CVU A;  1ZLJ A;  2H6B A;  4P9U A;  2D45 A;  4KA4 A;  3DV8 A;  2DQR A;  1I6X A;  4OMZ A;  2FOK A;  1VTN C;  3EQL F;  3MAJ A;  2A61 A;  1O3Q A;  4P55 A;  4U0W A;  2W85 A;  2YPR A;  2FXA A;  5LHH A;  5L3E A;  2XRO A;  3E3V A;  2DT5 A;  4LG0 B;  3ZMU A;  2EK5 A;  3RKX A;  4UVA A;  4S05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...