3GFJA

Crystal structure of the st1710 mutant (r89a) protein
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
141
structure length
141
Chain Sequence
ENRIQIMSTIAKIYRAMSRELNRRLGELNLSYLDFLVLRATSDGPKTMAYLANRYFVTQSAITASVDKLEEMGLVVRVRDREDARKILIEITEKGLETFNKGIEIYKKLANEVTGDLSEDEVILVLDKISKILKRIEEISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 146aa long hypothetical transcriptional regulator
publication title ST1710-DNA complex crystal structure reveals the DNA binding mechanism of the MarR family of regulators.
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Transcription
total genus 55
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2009-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3gfjA00
1PDNC 3EQLF 3E97A 2O61A 1B6AA 1GXPA 4KMFA 5L3CA 2HEOA 3R0JA 4LMYA 4Q47A 2P7VB 4KN7X 3ECHA 1J0RA 1P6RA 3GXOA 4EJOA 4ZYGA 1OYYA 1XCBA 3WTVC 1R00A 3RI4A 1HKTA 1TLHB 4HW0A 4JK1X 1FPQA 2FOKA 4KA4A 4WX9A 2DW4A 1IN7A 2CG4A 1ZRDA 3ROUA 1YO5C 2HQNA 1UCRA 1QGPA 2XVCA 3Q9VA 4CICA 2V79A 2ZXJA 5CVIA 3P7NA 1I1GA 4UNOA 1TBXA 2TDXA 2GA2A 3U1DA 3DQVC 3LAJA 1W5SA 1MJ9A 1LB2A 3P9IA 2O3FA 4AVPA 2D1VA 3EDPA 1QNTA 4MNUA 1LVAA 2ESNA 2BBYA 4M74A 2XV4S 2QBYB 4RB1A 3CLOA 3WTUC 3AAFA 2VE9A 2GAUA 4P9FA 4BHBA 3N4MA 4OOIA 3R4KA 2VBXA 2PBIA 3QP6A 3J7AO 4RS8A 2EV6A 4XRFA 2P5LC 2ZBKA 2CQKA 3D5LA 4MHGA 3KP7A 1JHFA 4LJZF 2Z5UA 1YW8A 2OU2A 2NNNA 4YG2F 3C7JA 2QBYA 1XN7A 2F5EA 2IP2A 3I59A 4YFNF 3KCCA 5FD6A 1W7PD 4M6XA 3DPLC 3HOTA 1G3SA 2LSOA 3BJAA 1GVJA 2OBPA 3VB2A 2H6BA 2VBYA 3BY6A 4ESBA 3DXJF 2HTJA 2OQGA 4HQMA 4N9HA 3RKWA 1B9NA 2CYYA 4G6QA 3TOAA 2EFNA 2EFOA 2YR2A 3FXQA 4UVAA 4ZYDA 3ZMVA 4L9VA 2Q0OA 4NB5A 3T8RA 1SD6A 4EGYA 1P2FA 4D0PA 4HV5A 4KNYA 2FRHA 4A0YA 2P8TA 2QWWA 2RN7A 4TV7A 4HLXA 4HZFA 1Z7UA 2E1NA 4UXNA 4ENJA 1FC3A 1R58A 3B02A 5BQTA 1E2XA 1KU2A 3IKVA 2M8EA 4MQVA 5BOXA 1T6SA 4A6DA 2PMHA 4M73A 3IWFA 1SMTA 2O0YA 5CVJA 1FSEA 1YYVA 4EV0A 5LEJA 5JHUA 5HOOA 2HGCA 5HVQC 2EFQA 1LQ1A 2ISYA 3KP2A 5FO5A 3DEUA 1MJBA 4U0WA 3KETA 3CUOA 1ZRCA 4PCQA 2FMLA 4L9NA 1HKSA 4M71A 1AWCA 5FGMA 2HKOA 5CLSA 4IVNA 2YSRA 1SMYF 1TTYA 2VXZA 2PJPA 2JRTA 3F8BA 1Z6RA 2OAZA 1KU3A 4KIBA 2HTSA 2XAHA 1S7OA 1U2WA 1HW1A 3M8EA 4G9YA 4U0YA 1SFXA 3KLOA 3ZMSA 1ULYA 1D8KA 5E18F 1QO0D 1S6LA 2KIFA 1WQ2A 1V4RA 2VOPA 3GO5A 1PP7U 3VODA 3MQ0A 4WXCA 5LHHA 1WSUA 3BDDA 2KRFA 3IL2A 1G3WA 1S29A 5E8GA 2W24A 1MJAA 2Q8KA 3HIFA 4N9IA 1HBXG 2FE3A 4WXDA 3ZN0A 3L9FA 3C18A 2WWYA 4HF0A 4RAYA 4UHTA 4B09A 1F5TA 1OR7A 2STWA 4RGXA 4B8XA 4RGRA 5HLGA 4PDKA 3H3UA 2XAFA 2QQBA 3GFMA 4U0VA 2J5OA 4HYEA 4FT8A 2RC4A 2GWRA 3GZ6A 3E6BA 1YTYA 3M1EA 3ECOA 3I58A 2HS5A 3WU1B 3FZVA 3TOBA 3EETA 4P9UA 1P4XA 2W84A 3E5UA 3SFZA 5D8LB 3GZ5A 3C1DA 1PP8F 3LAPA 5A2QZ 1BC8C 5LGUA 3ZP5A 5FFZA 1FT9A 4OIOF 2VBWA 1JHHA 3E3VA 4H0EA 3FWEA 2FBHA 5A2QK 1J59A 5K5OA 2F2EA 1Z1DA 3DF8A 5DD4A 4G7HF 1HSJA 5DYMA 1R23A 2HYFA 1HSTA 3U9GA 3ZMDA 4RGSA 2AS5F 2DLLA 4AIKA 1PUEE 1QBJA 1ZHFA 5CYVA 4XBFA 1ZN2A 3COAC 3SZTA 1WI9A 3E6CC 2F5FA 5HS7A 1R1TA 1QPMA 2K27A 2EK5A 1DP7P 2FSWA 3B73A 1IN4A 3I64A 3WGIA 2GXGA 3HTSB 4RB0A 1HXDA 4KMUX 2KIMA 1KQ8A 2ZNZA 3E5QA 3I4PA 2DK5A 5D4RA 4WXHA 3SXYA 4EJUA 5BPDA 2BGCA 2A69F 3RDIA 1O7LA 3MCZA 2JT1A 1K78B 2FU4A 1K7AA 4HAMA 4AIJA 3FHZA 2LKPA 3Q9SA 4BAYA 1UFMA 1D5VA 4M6YA 3KP4A 4IPAA 2QQ9A 5JFRA 5LBQA 5ICEA 2EFWA 1A04A 5E8IA 1XMAA 3J80Z 4EMSA 3CUQB 5E1ZB 3E5XA 3CO7C 2DFIA 2COMA 1XGOA 1P92A 3F6VA 5HDKA 3J80K 3J81Z 3RPQA 1BJAA 4Y17A 1K78A 4IRIA 4S05A 3O2PE 3J81K 3F8MA 1ZG5A 5ED4A 1MDMB 4BXUA 2GQQA 1L0OC 3NRVA 2HZTA 1OMIA 2W57A 1YW9A 1LDKB 5FLXZ 1BI3A 3ULQB 2WC2A 3IRQA 3L2CA 2IW5A 4PGGA 1XMKA 3BROA 3BOQA 2PEXA 5FLXK 1IZ1A 3TO9A 1XD7A 1ZH5A 3D0SA 1R7JA 1RI7A 3IWZA 2ZO4A 4IRHA 4KICA 1MDMA 4EJWA 1KU7A 3I0TA 4BHPA 4UVCA 3JAMZ 3F23A 4EM0B 3CJNA 2FBIA 4I09A 4BHCA 1IUYA 4N0BA 1KA8A 2RDPA 2OQRA 3MEXA 4R1HA 4DQ2A 3K1NA 3JAMK 5HLHA 2DAOA 3MAJA 1R5HA 1Z05A 5D5VB 3GFIA 5H6QA 3S2WA 3U2RA 2YPRA 2HQRA 2KKOA 1STZA 3FX3A 1BI0A 3TDZC 2VN2A 4BYYA 3LA2A 2R7FA 3TKYA 2DU9A 2Y48A 3DKWA 5EEHA 3BP8A 4ENMA 1EV7A 2NRAC 1B59A 2AXLA 1G6NA 5BS6A 1L3LA 4KIGA 1H0MA 3GFJA 2ZJ2A 1KGSA 1SD7A 5D8KB 2NYXA 3K69A 2FEZA 2W25A 3GFLA 4Z2YA 3PQJA 4LG0B 5E1XA 4HF2A 1RZ4A 1U6GA 4LK0F 3G73A 5H6RA 3I59B 4ETSA 4ON0A 1W7PA 4XSXF 5J8CA 2M45A 2STTA 4K2EA 2Y75A 2ZCWA 5JR3A 3WG9A 1V3FA 3CUQC 1ZGAA 4EJTA 1YLFA 3KP6A 3T5XA 4IF4A 2OZ6A 3ZMTA 2PG4A 5IT9Z 2GXBA 2IA1A 3HSFA 2ZMEA 3KP5A 3I53A 4L5IA 5AIPA 5J6XA 2D2WA 2IA2A 1U5TB 1G3TA 2BEOA 2NS0A 3V8LA 2PQ8A 2FF4A 3MZHA 1FY7A 5IT9K 3V8JA 4G7OF 4LK1F 4LG0A 5K5RA 4KDPA 2UXNA 3RYPA 4F7ZA 3RKYA 3H92A 2B0LA 5HLIA 4KFCA 2YX7A 3WGGA 1R36A 4Q5SF 3VOEA 3V4GA 1GHCA 1J2XA 4NQWA 1KU9A 2A61A 3QOPA 1UHWA 3LA7A 5DDGA 2FXAA 2DTRA 1U5TA 1DDNA 4A12A 3DPTA 3JSOA 4MTDA 2RVCA 2M5WA 3PQKA 4AD9A 2DPUA 2DBBA 4ENKA 1USTA 5E20A 1IXSB 3QU6A 1FLIA 5DUIA 1DPUA 3F8NA 4M9SA 4HV6A 3MFKA 2P6SA 2E7XA 2A6HF 3F8FA 2CGPA 1F4KA 4IJAA 5KVRA 2CW0F 1T98A 2NNYA 1IRGA 5FFXA 3BJ6A 4FX0A 3V8KA 3K1PA 2WV0A 1FYMA 1YG2A 3EYYA 1SFEA 3JTHA 4ZZDA 1YIOA 4OMYA 1FBUA 2FQ3A 2RQPA 2F5DA 4LFUA 3SHFA 3P9KA 1FYLA 2CFXA 4LLGF 4KYWA 4KUMA 2HFHA 3TDUC 5ILVA 1LEAA 2ADUA 4LD5A 1O3RA 2IPQX 4WCGA 3T8TA 1RIOH 2RGVA 4XSZF 4EJVA 1U3EM 2K7LA 1J75A 3RIRA 4LB6B 1R1VA 3KZZA 2MC3A 3HTUA 5HS8A 5H20A 3HUGA 1FOKA 3K0LA 2L4AA 1YFHA 3V7CA 2H94A 4OIPF 2EWNA 4DNCA 2W85A 3WODF 1GXQA 3FF5A 1Z9CA 3R6SA 4QWQA 4XLPF 4LLNA 2V1UA 5L3EA 1U5TC 2DQLA 1D8JA 1MKMA 3RTRA 2QM3A 5L3FA 1U8RA 3HHGA 4FHTA 4Y15A 2ESHA 2Z99A 3QRFF 3HRUA 3HRMA 3JSPA 2IRFG 4I0AA 3W6JB 3SQNA 1LEBA 4I02A 5D6FA 1O3SA 3FMRA 3HOSA 2VT3A 1I27A 4R79A 5F6FA 4UVBA 2ZNYA 2VT2A 1FWZA 3FXUA 2UWMA 4RB2C 1W5TA 1IAWA 4MGRA 3IRRA 3ZN1A 5L3GA 4GO1A 1ZG3A 4ZH4F 1WKMA 3MWMA 4HX8A 1XCVA 4MQ9F 4A0XA 1YS6A 3VEPA 2XASA 2OZUA 2M30A 1IRFA 1J7KA 4JQFA 4A5NA 2L02A 1TW2A 1XGNA 2P5KA 3KE2A 3GX4X 1Y0UA 2MA3A 2WTEA 2VONA 3GVAA 3WTSC 2PI0A 1R1UA 4CYDA 1IXRC 2DT5A 4CZZA 2J5PA 1I5ZA 3CO6C 4UV8A 1Z6TA 1EH7A 1R22A 2EA2A 4U7BA 4EM1A 2XAJA 1ZRFA 1KYZA 2FA5A 4GYIA 5KK1A 1P4AA 3TO6A 2K4JA 5D5UB 2RV8A 3RKXA 4A2UA 2IT0A 1XSDA 5ICGA 2V1XA 4HDVA 3I5UA 3RJPA 4MEYF 1F9NA 3LA3A 5DUKA 4M9ZA 1H9TA 1IN6A 1LDDA 4ESJA 2P7CB 2IA0A 1TNSA 3WTTC 4L0ZB 2DO7A 2L3DA 1W4MA 3GUDA 4L9TA 2BYVE 5AONA 1J5YA 3HSRA 1XGSA 2V6CA 2XIGA 2VOOA 2KIUA 1FSHA 3V7RA 4ASNA 1FP2A 1QZZA 2D1HA 4HF1A 4OIRF 1OYIA 4HX7A 1MGTA 1WWXA 2EB7A 5TJJA 3T1BA 1BIBA 4HDUA 3BZ6A 1T2KA 1ZYRF 4GXOA 3ZMUA 2K4BA 3GW2A 1BBYA 2DI3A 3KLNA 2UZKA 3TGNA 4I2OA 2QQAA 2QUFA 3KP3A 4LGWA 3CDHA 3ELKA 4CDGA 3TQNA 1MZBA 2ELHA 4P5OA 3WTZA 5ERIA 1O7FA 2XHKA 4OINF 5D4SA 4E70A 2UXXA 3HYIA 4GGGA 4L18B 1IN8A 2GIVA 3K1MA 2E1CA 1FX7A 3ABTA 2FMYA 4G6DA 3IC7A 5E17F 3IKTA 3GEZA 3SZPA 1UB9A 4U88A 4NHJA 5L3BA 1FP1D 1MD0A 3K2ZA 2IJLA 2MH9A 5D5XB 4PZJA 5BMZA 1JGSA 2MLGA 4JBAA 1BM9A 4I98B 4IRGA 4P96A 4RAZA 1WRJA 4IHSA 4OU0A 1XDUA 2FBKA 5CVRA 1UHMA 2PFBA 3O3KA 2HYGD 1IW7F 5DEQA 2VC1A 2HR3A 3N97A 3ZPLA 1ZG1A 1EH8A 4O6JA 3GWZA 5JI6A 3BPVA 1ON1A 3EUHA 2V9VA 5D6EA 4AWXB 1W7PB 4ZYHA 1LJ9A 2MD5A 3WTYC 3IHUA 2OD5A 1S3JA 3F22A 2F5CA 2K86A 2ACJA 1FYKA 1AOYA 2ZMEB 3ZQ7A 4QLCU 3F8CA 4G94A 2A68F 1C0WA 2X0LA 2GA1A 2LDUA 1QQIA 2VBZA 3OOPA 4M72A 2RKHA 4YIFA 3EYIA 1LNWA 3G3ZA 3FM5A 4XLNF 3V7SA 1B9MA 4PGHA 4CO8A 2L4MA 3PFIA 3RPUA 1B1BA 3I71A 1ZARA 2A07F 5D5WB 1CGPA 1U78A 5TRDA 5LEKA 4ESFA 5J8FA 3WE3A 2VC0A 1ON2A 4EM2A 1ODDA 4Q48A 1J9IA 3GF2A 2DQRA 1IN5A 4L5JA 1YQAA 3WE2A 5K5QA 5IT3A 5LLQA 4G8XA 4A0ZA 3L7WA 2KJBA 3LWFA 2JPBA 5HDGA 2LF8A 1XSXA 3CTAA 1FBSA 4HQEA 2FNPA 3Q5FA 3LQQA 3H3ZA 3ERED 3HRSA 1HW5A 6PAXA 1ZREA 2CWEA 4ZZLA 3QPHA 1T0FA 1RUOA 1EH6A 1BN5A 3M7GA 5HS9A 3BWGA 4CXFA 2O03A 3FM3A 5ILSA 4BH9A 2JZYA 1F1ZA 2BE5F 3E6DA 2X4HA 1HW2A 3F6OA 3KFWX 3GLXA 1TQIA 4HA8A 3RYRA 3ISPA 2E7WA 2XKPA 4KT5C 1BI1A 2VE8A 2G9WA 3LQRA 4AIHA 2P6TA 2K02A 3HRTA 2NAZA 2QZ8A 2PLYA 1R5GA 5CVUA 2FNAA 1P4WA 1DPRA 2GZWA 1XGMA 4I7HA 2P5VA 4GCVA 2H27A 2XAQA 4ZYEA 2QYOA 5DCFA 1SAXA 1CF7B 1ZLKA 2O6GE 1D3YA 2MLKA 2Y0MA 4Q4ZF 1Z91A 4O5VA 1OPCA 5BPIA 5EEGA 4LLLA 4L0YB 3P9CA 1ONVA 1E17A 3C3WA 1YW7A 5E1WA 2QLZA 2PN6A 2DPDA 2M1BA 1FNNA 1I6XA 1FZPB 2Z9OA 1SFUA 2EV5A 3R60A 5LRRA 2CSOA 1OKRA 2HDCA 1S8NA 4RB3C 1KYWA 5LGNA 1CF7A 1TQPA 3QU3A 2EJRA 3OV8A 3DFGA 2A5YB 2XUBA 3ML6A 5HDNA 4Y13A 1IXCA 3TO7A 1K6OA 1XB4A 3L09A 5LHIA 5DCMB 1JE8A 4I01A 4MEXF 4BQAA 5L3DA 3NEUA 3M9AA 1DUXC 5DV5A 5ICFA 1ZGJA 3MZYA 5AIQA 1KQ0A 2OA4A 5FB2A 4A6EA 3FMQA 1X3UA 2H09A 4FX4A 2IVMA 2JTVA 1HQCA 3W6KB 1Q1HA 5DCMA 2Z33A 1ZLJA 3T0YA 2QVOA 4EQQA 3HHHA 4MTEA 1O3QA 3KEQA 4WK8F 1S7AA 1TNTA 3WGHA 4OMZA 4WWCA 4EVIA 4WF2A 4P55A 4HOBA 1BI2A 5CVVA 1TW3A 5LGTA 3L00A 3ZMZA 1QZYA 2XROA 2XGXA 4M9XA 3HSEA 2ETHA 5ICCA 3R61A 1USSA 2QENA 1O3TA 3JW4A 4YFKF 1KQ9A 2R3SA 1BIAA 2XKOA 1T38A 4HBLA 2LNBA 3ABUA 1IF1A 2EA4A 3E6MA 1G4DA 1REPC 2L54A 1RNLA 5ILUA 1BOAA 2XRNA 2M87A 4RGUA 4LB5A 4S04A 2XAGA 2VODA 3GYHX 2CO5A 1TQMA 4A5MA 3DP7A 4KIFA 1I1SA 3WTWC 2Z3YA 4U7DA 1BC7C 1VTNC 2V1DA 5LRSA 5F64A 4CHUA 3F72A 3O6BB 2JSCA 1HKQA 5JVTA 3FXRA 4ENNA 5F1RA 3KZYA 2G7HA 4YIIA 4L9JA 1OYWA 3F3XA 1G3YA 1SD5A 4OIQF 3WTXC 2H6CA 2C6YA 2HOEA 3QPTA 4BNCA 5DD8A 3VFZA 4O3MA 4HX4A 1LDJA 2HKXA 2O8XA 3QP5A 4HLYA 3LSTA 4YFXF 2MH2A 2Q2EA 4GYGA 4IHTA 2ZKZA 5LHGA 1ZAOA 2HWVA 4UUVA 3NQOA 1B4AA 1K79A 2LF7A 1SD4A 2A6EF 1O57A 2YX4A 1NHAA 3M8FA 3BPXA 1YS7A 1T39A 2L01A 3LFKA 2ZFWA 2MBFA 3I54A 1RUNA 3KEOA 4UV9A 2G7UA 3DV8A 5K1YA 4I0BA 4CGZA 3R0AA 2BV6A 4G7ZF 4KN4X 2YU3A 5FD5A 1FBQA 3FMSA 2R7DA 2P4WA 1H9GA 3K9TA 3QAHA 3F21A 1JXSA 2RNJA 3CUQA 3WU0A 5CJ9A 2PMUA 4IXAA 2EFPA 3JTGA 2KJCA 4R8HA 3BJOA 2A3SA 3REOA 2JPCA 2ISZA 2DK8A 2EV0A 1XSVA 1XDSA 2D45A 4EGZA
chains in the Genus database with same CATH superfamily
1EKEA 1PDNC 2UV1A 3OYGA 3EQLF 3E97A 2O61A 1B6AA 1MH4A 2L5QA 4OAYA 4E7KA 1GXPA 4KMFA 5L3CA 2HEOA 3MMYB 3R0JA 3OSFA 4LMYA 4Q47A 2DA2A 2P7VB 4KN7X 3ECHA 5E79C 1QVUA 3OYHA 1J0RA 1P6RA 3GXOA 1V5FA 3OWTA 5DM7F 4AIDA 4EJOA 4KITB 4NC7A 4ZYGA 3KYCB 1OYYA 1XCBA 3WTVC 1R00A 2QEXI 3RI4A 1HKTA 1TLHB 1SVMA 2VKVA 2QSGX 5CPRB 4HW0A 4JK1X 3JRAA 1ZK8A 3I3LA 1FPQA 2FOKA 4KA4A 1OFCX 4WX9A 1Y6IA 1VQPI 2LKSA 3NWSA 2R7RA 4XLEA 2DW4A 3Q0WA 1IN7A 4W1UA 3D1NI 2CG4A 1H88C 3ASOH 1VF9A 4MO7A 3ROUA 1ZRDA 1D1AA 1YO5C 2HQNA 1UCRA 1QGPA 2MFZA 2XVCA 2L9VA 2E1MB 3H9JA 1A6QA 4UUSB 5EF6A 1D1BA 2LK2A 3Q9VA 1Y1VJ 2V79A 4CICA 2ZXJA 3LSKA 2X6WA 3H5AA 3LSMA 5CVIA 2M3AA 3P7NA 1I1GA 3VYTB 1TBXA 4UNOA 2TDXA 2X48A 4J19A 2GA2A 2KDOA 2X51A 3U1DA 1ZKGA 3DQVC 3LAJA 4B48A 1W5SA 1MJ9A 2EINH 1LB2A 3P9IA 2O3FA 2XGCA 1ZQ3P 3HOXJ 2LD5A 1QPIA 2IS2A 2R7TA 3CQZJ 2ECBA 3CDLA 4AVPA 2HNHA 3FHNA 1ETVA 2EZHA 5FKMA 1WJBA 3SZGA 4CH7A 2D1VA 2LR8A 3EDPA 1QNTA 4A3JJ 2EZKA 4MNUA 3DTIA 1LVAA 2ESNA 2GBYA 2BBYA 4M74A 2WA0A 2XV4S 2QBYB 4RB1A 4QTRA 3CCMI 2IS4A 2ZSIB 2ZJQF 3VYSB 3CLOA 3WTUC 3AAFA 2VE9A 4GDFA 2GAUA 4P9FA 5EG0B 4BHBA 3N4MA 4OOIA 4IHYA 2V9KA 3R4KA 2VBXA 1D0ZA 1MBKA 2PBIA 3QP6A 3J7AO 5K7FA 4RS8A 1ENHA 2EV6A 4XRFA 2HVQA 2P5LC 3GTLJ 2ZBKA 2CQKA 1MMNA 3BR5A 4P1WA 2MG4A 3D5LA 2FJ1A 2HXIA 3OR1C 4DGWB 5GAHJ 4MHGA 3KP7A 3BTJA 1JHFA 4LJZF 5FRNA 4XLHA 2Z5UA 1YW8A 2OU2A 2NNNA 4YG2F 1X19A 3C7JA 2QBYA 3TEDA 1XN7A 2F5EA 2NVQJ 2IP2A 1U9NA 3I59A 3KCCA 4YFNF 5FD6A 1W7PD 2JA2A 4M6XA 3DPLC 5GAEJ 2M0CA 2KIQA 3HOTA 1TP4A 5EG0A 5GP9A 1TWHJ 1G3SA 1NK2P 2LSOA 4UY8I 1W5CC 3BJAA 1GVJA 2CW8A 2I5UA 2OBPA 3VB2A 3BTLA 2UUZA 3D5RC 2H6BA 2A05A 2VBYA 3BY6A 2R5ZB 4ESBA 3DXJF 5FROA 1ZELA 2EIMH 2HTJA 2W48A 2JA7J 3HOZJ 1G59A 2OQGA 3C2BA 4HQMA 4N9HA 1BW5A 1LFBA 3B6CA 1B9NA 3RKWA 3CCRI 2CYYA 3HBLA 4G6QA 2R92J 4IHVA 3IH4A 3TOAA 3BR0A 3LSRA 1Y1WJ 2EFNA 3M3YJ 2EFOA 2NVXJ 2YR2A 3FXQA 4ITVA 2IS1A 1VQ5I 3GBGA 3G4SI 1IG7A 4UVAA 1CQTA 3CC2I 4ZYDA 3S3MA 4X6AJ 4F3QA 3ZMVA 1ETWA 4L9VA 2Q0OA 2OV7A 4NB5A 5FKOA 5FKKA 3T8RA 3OYFA 1SD6A 4EGYA 2RAEA 3E7LA 1P2FA 4D0PA 4HV5A 4KNYA 4C30A 3CP2A 2FRHA 1OCPA 4A0YA 1T95A 2V4JC 1T56A 2P8TA 2QWWA 2RN7A 3VYUB 4TV7A 4HLXA 1A35A 3SEZA 1OCZH 1GLNA 2NVYJ 4HZFA 1Z7UA 5M5YJ 2E1NA 3ZRGA 1VNDA 4UXNA 2E1MC 2FUG2 4ENJA 1I6HJ 1FC3A 1R58A 3B02A 5BQTA 3HOVJ 2VL8A 1E2XA 1KU2A 3IKVA 2M8EA 4MQVA 4DYCA 1VFCA 1MSFC 2R7UA 5BOXA 1V54H 1T6SA 2JSPA 1Q1VA 4A6DA 3FBIB 2Y2ZA 2PMHA 5HLTA 4M73A 3OMYA 1BW6A 3IWFA 1SMTA 2O0YA 3ZQFA 1MMAA 5CVJA 3LL7A 1FSEA 1LUJB 2JVHA 1RKWA 1YYVA 4E7JA 5E3NA 3KIOA 4EV0A 5LEJA 1TL8A 2CUJA 1J09A 3FISA 4D7MA 2EZIA 5JHUA 4XIDA 3PIOF 3H35A 1FOYA 5HOOA 2HGCA 5HVQC 2EFQA 3OSGA 4XM3A 3CMMA 1LQ1A 2ISYA 1VQ4I 3H9QA 3KP2A 4S0HB 5FO5A 3OYCA 3DEUA 4C9YA 5KNLA 1MJBA 4U0WA 2XSDC 2IGOA 3BTCA 3KETA 3CUOA 1R4MB 1ZRCA 3ZXSA 4PCQA 4A93J 2FMLA 4L9NA 5IP7J 1HKSA 2XB5A 2DYRH 3HXLA 1JKRC 4M71A 1AWCA 5FGMA 1FJLA 3H0DA 2HKOA 5CLSA 1T0FC 4IVNA 2MD0A 2YSRA 1SMYF 4M3FA 2R7VA 1TTYA 3K7AJ 2VXZA 1JUMA 2BXYA 2PJPA 2H1KA 3HOUJ 2JRTA 3F8BA 1FTZA 1WJDA 2XRLA 1Z6RA 1GVDA 1F36A 3NAUA 2OAZA 2X85A 1SVOA 1KU3A 4KIBA 2HTSA 2XAHA 1S7OA 1U2WA 1HW1A 3M8EA 4G9YA 4CA0A 4U0YA 1SFXA 3KLOA 3ZMSA 4BDYA 1ULYA 1D8KA 2YUSA 3OL3A 2B63J 2TCTA 5F0HA 2WBMA 2DMPA 1IUFA 4Y7NJ 2V7FA 1EF4A 5E18F 2DFEA 4IKFA 1QO0D 1T08B 1S6LA 1ZR4A 4HEA2 1RETA 1X3ZB 2KIFA 1WQ2A 1V4RA 2VOPA 3GO5A 1PP7U 1AA7A 3VODA 3MQ0A 4WXCA 4FISA 4JP0A 4UB8C 3MKZA 5LHHA 1WSUA 2CV2A 4LITA 2HOTA 3DTKA 3BDDA 2KRFA 3IL2A 1JI8A 1G3WA 1S29A 3M07A 2F4IA 2W24A 5E8GA 1MJAA 3KYDB 2Q8KA 3VSLA 3HIFA 1W0TA 4N9IA 2W7NA 3CCQI 1HBXG 3HPHA 2FE3A 4WXDA 3FXMA 5DTDA 3ZN0A 3OS2A 4ZTFA 3L9FA 1MIJA 3C18A 4ZJZA 3AG1H 2WWYA 4HF0A 1A5JA 2KDZA 4RAYA 5KCMA 4UHTA 4B09A 1F5TA 1OR7A 1LKXA 2CFOA 1XX5A 3AL0B 2STWA 4RGXA 4B8XA 4RGRA 5HLGA 4PDKA 1AKHB 3H3UA 3LFUA 1OCRH 3VYRB 2XAFA 3J7ZI 1UJ8A 2QQBA 3GFMA 4U0VA 3ABLH 1WJAA 2Z2SB 1Y56A 2J5OA 4HYEA 4FT8A 2RC4A 2GWRA 3GZ6A 3E6BA 1YTYA 1ETYA 3M1EA 3ECOA 4B3AA 4AM3A 3CJTB 3I58A 2HS5A 3QODA 3GTJJ 3WU1B 4J01A 3FZVA 1RR8C 3TOBA 4JX4A 3IP4B 3DEWA 2ZJPF 3EETA 4P9UA 1P4XA 2W84A 3E5UA 3SFZA 5D8LB 3GZ5A 3U21A 3C1DA 1B8IA 1PP8F 4CCLA 4CYCB 3TW6A 3LAPA 2V26A 5A2QZ 3JRFA 1BC8C 2DFFA 5LGUA 3ZP5A 5FRMA 5F04A 5FFZA 1FT9A 4OIOF 2VBWA 1JHHA 2PJRA 3E3VA 2ZFUA 4H0EA 4YELA 4F91B 3HC7A 3FWEA 2LC2A 2FBHA 5C4XJ 5A2QK 1N75A 2R7WA 1W36D 2LLKA 2PX9A 2L7MP 1J59A 4BE1A 5K5OA 1YJ9I 2F2EA 1Z1DA 3DF8A 3PUBA 1UMQA 5DD4A 1VQ9I 4G7HF 1HSJA 5DYMA 1R23A 2HYFA 4F55A 1HSTA 3U9GA 3ZMDA 4N4NB 3OYAA 5KHDA 3PUFA 4RGSA 2AS5F 2DLLA 3DEEA 3FKIJ 4AIKA 1PUEE 4XICA 1QBJA 2X1EA 1ZHFA 4E4HA 3Q0UA 2Q2EB 5CYVA 2X6YA 4BBRJ 2EILH 4XBFA 1X1PA 1ZN2A 3K70C 3COAC 1DU0A 3SZTA 2KQRA 5LFAA 1WI9A 4IX7A 3E6CC 2F5FA 1APLC 5HS7A 1R1TA 4XOTA 1QPMA 4J00A 1VQKI 5FKNA 2K27A 3FXOA 2EK5A 1DP7P 2FSWA 3B73A 1IN4A 3I64A 3WGIA 2GXGA 3HTSB 4RB0A 4JX6A 1HXDA 2E5ZA 4KMUX 2KIMA 1KQ8A 2ZNZA 3E5QA 3I4PA 2LKXA 2DK5A 5D4RA 4WXHA 3SXYA 4EJUA 5BPDA 3W6VA 2BGCA 3GTGJ 1IRZA 2A69F 3RDIA 1O7LA 1MSEC 3MCZA 2HXOA 2JT1A 4AUXA 2O9LA 2GOXB 1K78B 2FU4A 2XPUA 1K7AA 5FLVA 4A3FJ 4HAMA 1X2NA 4AIJA 3FHZA 3IV5A 3QYEA 1LFUP 2LKPA 3Q9SA 4CSWA 3MKYB 4BAYA 4HRIA 1UFMA 1D5VA 3BZKA 4M6YA 2BHYA 3KP4A 5GAGJ 4IPAA 2QQ9A 5JFRA 4CCMA 4A3LJ 5LBQA 1WVRA 1OCCH 1O4XA 3BG9A 4XMYA 5ICEA 2EFWA 1A04A 2Y0SA 1XMAA 5E8IA 2E71A 1QHGA 2VUMJ 3J80Z 3BG5A 4BE2A 2JMWA 4EMSA 3CUQB 5E1ZB 3GTKJ 1JKPC 2IXSA 4DBRA 3CF2A 3E5XA 5M5WJ 3CO7C 2DFIA 2COMA 2DMUA 1XGOA 1WFXA 4D5FA 1P92A 3F6VA 5HDKA 4CUGA 3J80K 2F4OB 3IUOA 4A3MJ 3J81Z 2VQHA 2WAQA 1MNEA 3RPQA 3G71I 1PUFB 1BJAA 4Y17A 3K4MA 3UNGC 4BQOA 1K78A 2NOJB 4IRIA 1ETXA 4S05A 3O2PE 2OF7A 1JTXA 3I4MJ 3J81K 4A3EJ 2HOAA 2M2EA 3AL0C 1P7JA 3CD6I 1K83J 1LVKA 3F8MA 5ED4A 1ZG5A 1MDMB 2ME0A 4BXUA 2GQQA 1VQMI 2IGNA 3A2KA 4HSTA 1MNDA 3O8HA 1S72I 2WB1A 1YX3A 1L0OC 3NRVA 2HZTA 3W2AA 1OMIA 2R7SA 1KONA 2W57A 1YW9A 2ELJA 3GMEA 1LDKB 3EUAA 5FLXZ 5EEAA 2QKLB 3G6EI 3Q0VA 3QPSA 4PJLA 3SJMA 2HVSA 2E60A 3S3OA 1BI3A 3KZIC 2V9PA 1Z3XA 2WC2A 3ULQB 2IW5A 2LP0A 3IRQA 2R4GA 3L2CA 4PGGA 2Y30A 4CZCA 1XMKA 3BROA 3BOQA 3F9KA 4FE4A 3HEFA 4JOMA 2PEXA 5J47A 5FLXK 4D7NA 4KISA 1IZ1A 3TO9A 1XD7A 2LTPA 5FKLA 3LSJA 4CCKA 4IZZA 1ZH5A 1KZHA 2BY1A 3D0SA 1R7JA 3KYLA 1JJ6C 2EQRA 1RPWA 4PJMA 4YRVA 1RI7A 2VPLA 2WADA 2OC6A 2O5RA 2NXNB 1FMWA 3IWZA 2DOFA 4PFPA 2ZO4A 4IRHA 2VJJA 4KICA 1MDMA 3OIOA 4EJWA 1KU7A 3I0TA 4BHPA 3QOEA 2X6XA 2BHZA 2K40A 3RZOJ 4UVCA 2OTJI 3JAMZ 3F23A 1X1AA 1FEXA 4EM0B 3CJNA 2FBIA 3HGYA 4I09A 4BHCA 1IUYA 4KJZA 1I50J 4ZDOA 4N0BA 5TGTA 1KA8A 2RDPA 2OQRA 5J1YA 2BY0A 3FK7A 3QPLA 3MEXA 4R1HA 4DQ2A 2JA8J 3K1NA 4C2UA 3JAMK 5HLHA 1NTCA 2CU7A 2DAOA 3MAJA 4ZDPA 2I8DA 1X1BA 1BL0A 1FTTA 1R5HA 1Z05A 3AKZA 5D5VB 2KP6A 3GFIA 2E34A 5H6QA 3S2WA 3U2RA 2YPRA 2HQRA 2KKOA 1YHQI 3G1OA 1STZA 3FX3A 1BI0A 3AG3H 3TDZC 2VN2A 4BYYA 3LA2A 4E7ZA 1X4PA 2ELKA 2R7FA 4W97A 5F08A 3TKYA 5LD2C 1JKQC 2DU9A 2K9SA 2Y48A 4M6VA 4MFEA 4XK4A 2M7AA 3DKWA 1PVEA 5EEHA 2R7XA 3BP8A 2BVMA 4ENMA 3PO2J 2NVTJ 1EV7A 2NRAC 3HG9A 1B59A 2AXLA 2DA1A 1G6NA 5BS6A 5IOYA 1L3LA 4KIGA 1H0MA 3GFJA 3ZQQA 1SC7A 1HDPA 2ZJ2A 1RESA 1KGSA 1SD7A 5D8KB 3HZJA 2K9NA 5JLXA 4I76A 2NYXA 3K69A 4PSXA 3C2HA 2FEZA 2W25A 3GFLA 4Z2YA 2FOWA 3PQJA 1MBJA 4LG0B 1V5GA 2VXDA 5E1XA 2XF7A 4B3XA 2JA5J 4OWRB 4HF2A 1PJRA 1RZ4A 3FBNB 4D1QA 2JK3A 1U6GA 4QIWN 2A5WA 1WHUA 4LK0F 1WJCA 2EIJH 3IAS2 5H6RA 3I59B 4PSWA 3X2QH 4ETSA 3G73A 3CCVI 4ON0A 1OCTC 1YJNI 1W7PA 1YITI 1IDZA 4XSXF 5J8CA 2M45A 2LY1A 2STTA 4K2EA 2Y75A 2ZCWA 5JR3A 4RAGA 3WG9A 1V3FA 3CUQC 1ZGAA 2ZSHB 1ACIA 4EJTA 1YLFA 3KP6A 4BBSJ 3T5XA 4NQWB 4IF4A 2OZ6A 3ZMTA 2PG4A 3H5RA 5IT9Z 1WH7A 2K85A 2GXBA 2IA1A 3HSFA 2DFHA 2ZMEA 2HDDA 3KP5A 2HVRA 3JRDA 3I53A 4L5IA 5AIPA 5J6XA 2D2WA 3SDBA 2IA2A 1U5TB 1G3TA 2BEOA 2NS0A 3V8LA 2PQ8A 2FF4A 3MZHA 2CQQA 2O7OA 1FY7A 5IT9K 3V8JA 4G7OF 3S32A 3W2VA 4LK1F 4LG0A 5K5RA 1YI2I 3PM1A 4BY1J 1FIAA 2B9SA 4KDPA 2UXNA 3BR3A 3HKZN 3RYPA 4N4OB 4F7ZA 3E1SA 3CC4I 3RKYA 2Y9YA 3LSIA 2VIXA 2CV0A 3BG6A 3D5SC 3H92A 2B0LA 3RPUD 5HLIA 4KFCA 4PK4A 2IAIA 3OYKA 2YX7A 5DS9A 3WGGA 3N05A 1R36A 5K7HA 3OYBA 3ERMA 1ETQA 2ZJRF 1SEUA 2BY2A 3A01B 2L7KA 2Y0SN 3CC7I 4Q5SF 4G12A 3VOEA 2R93J 3V4GA 1GHCA 1J2XA 3DKXA 4NQWA 1KU9A 2A61A 3QOPA 2BVLA 1UHWA 2XAUA 2O8KA 3LA7A 5DDGA 2FXAA 2DTRA 1U5TA 4X1EA 2X1CA 1DDNA 4A12A 3DPTA 3RQIA 1E0EA 3JSOA 4MTDA 2DCEA 2RVCA 3BQYA 2COBA 2WAQN 2M5WA 3PQKA 4AD9A 2DPUA 2DBBA 2ID3A 4ENKA 1USTA 4FETA 5E20A 1IXSB 2KPMA 3QU6A 2XDVA 2KMUA 2YS9A 1FLIA 4YIRX 5DUIA 4IQ4A 1DPUA 3F8NA 3A4CA 2JQ7A 1SVLA 4M9SA 3VDXA 4ZYAA 4HV6A 3A0BC 3MFKA 1X1CA 1AHDP 2P6SA 2E7XA 1K61A 3BG7A 2M8GX 2A6HF 3A02A 3F8FA 4XRSA 2CGPA 5JHFA 1F4KA 4IJAA 5KVRA 1V55H 2CQXA 2XF6A 1GV5A 2CW0F 1T98A 2WB1N 4A69C 2NNYA 1X58A 1IRGA 5FFXA 3A01A 3BJ6A 4FX0A 3V8KA 2W82A 4PJNA 3PL8A 3ZQHA 3K1PA 2CS3A 1EA3A 2WV1A 1YG2A 2HI3A 2WV0A 1FYMA 3DKYA 4DBQA 3EYYA 1OJLA 3GTOJ 1SFEA 3JTHA 4F52A 3HUGB 4RLQA 1FOXA 4ZZDA 1YE9A 2CUZA 1D5YA 1YIOA 2F48A 4FQGA 4OMYA 1FBUA 2FQ3A 3DBHB 2RQPA 2WY7Q 2F5DA 2QF7A 4LFUA 3SHFA 3P9KA 4DZJA 1FYLA 2CFXA 2I10A 4B44A 4LLGF 1DGWY 5JVGF 4KUMA 4KYWA 3K6GA 2M34A 2W00A 2D5VA 2CUFA 2HFHA 3TDUC 3Q3SA 5ILVA 1LEAA 2ADUA 4LD5A 5GPCA 1O3RA 2IPQX 3L2QA 4WCGA 5M5XJ 3T8TA 4M3DA 1RIOH 2RGVA 4XSZF 4EJVA 1U3EM 2K7LA 3S15J 1J75A 2NS8A 3S14J 3RIRA 4LB6B 1UG2A 2DA4A 1R1VA 2HDWA 3FK6A 3WG7H 3KZZA 3KX2A 3TP3A 3J7YJ 4AVZA 2MC3A 2VLAA 3HTUA 3OYIA 3GTMJ 5HS8A 5H20A 3CLQA 2VJIA 3HUGA 5J4YA 4XKVA 2VQLA 1FOKA 2AQFA 4XLCA 4FCYA 1NG7A 2PMZN 3JRHA 3K0LA 4NUBA 2L4AA 3ONQA 2E19A 2KISA 1YFHA 3V7CA 2H94A 4OIPF 1JUSA 4H4KC 2EWNA 4DNCA 2W85A 3WODF 3L2RA 1GXQA 3FKJA 2CV1A 4XN3A 3FF5A 4HG2A 3L2VA 1Z9CA 3R6SA 2X9DA 4QWQA 3HL2A 4XLPF 4LLNA 3FDYA 2V1UA 2M4GA 1D0XA 5L3EA 1U5TC 2DQLA 3MKWB 1D8JA 1Z0XA 5BNGA 1MKMA 4UUTA 4CCNA 1I3AA 3RTRA 4QPOA 2G0EA 2QM3A 5L3FA 1R4NB 1U8RA 3HHGA 4FHTA 4Y15A 2ESHA 2Z99A 3QRFF 1RRJA 1YIJI 2BW3A 3HRUA 3NWTA 3HRMA 2DTZA 1U9OA 4NC8A 2OJED 3JSPA 2GLOA 1ZTRA 3I55I 3BR2A 2IRFG 4XN0A 3OOUA 4I0AA 2F5VA 3AG4H 3W6JB 4CCOA 3SQNA 3CMYA 4MFDA 1LEBA 4I02A 5D6FA 1R49A 2Y9ZA 1O3SA 3FMRA 3S8PA 3HOSA 2VT3A 3BC8A 1I27A 3ZOBA 2CRGA 4R79A 5F6FA 2DA6A 1SFKA 3K4CA 4UVBA 1H8AC 2M4KA 4NDLA 2XPVA 4XR6A 1SFOJ 2VQGA 2ZNYA 3J7AY 2VT2A 3DBLB 1B8IB 2JWTA 1FWZA 3H36A 3FXUA 2UWMA 1QU3A 4RA2A 4RB2C 1ETOA 1W5TA 4RBOA 1IAWA 4MGRA 1TC3C 2CJJA 3IRRA 3ZN1A 2PJRB 2H8WA 5L3GA 3I56I 5GTIC 4GO1A 4DIQA 3ZQLA 1ZG3A 2L2OA 4ZH4F 1WKMA 3MWMA 4XNFA 4HX8A 1XCVA 4MQ9F 2DJNA 4A0XA 4UB6C 3AFHA 4HNUA 1YS6A 2BY3A 3VEPA 2XASA 2OZUA 2M30A 2BOLA 4NC6A 1IRFA 1UZCA 2Z16A 3K70D 1J7KA 3SDGA 2E2IJ 5IYBJ 2CQ7A 2OCCH 4JQFA 3PSFA 1RR7A 2OCEA 4A5NA 1TWFJ 4ZC3A 2L02A 1TW2A 1XGNA 2P5KA 5IYDJ 3KE2A 5EYRA 3GX4X 1G8XA 1Y0UA 2MA3A 1TWAJ 2VJ5A 2WTEA 2VONA 2F6CA 3GVAA 3WTSC 4A3BJ 2PI0A 5HODA 1R71A 1TT0A 1PYVA 1R1UA 3OR2C 4CYDA 4XRSG 1QRYA 4V19K 1A6IA 1IXRC 3S1NJ 2DT5A 4BE0A 4CZZA 1UHSA 2B7EA 2J5PA 1I5ZA 3K10A 3CO6C 2R7ZJ 5TISC 1HLVA 1WGXA 4E6KG 5IOZA 4CCJA 4UV8A 1Z6TA 1EH7A 1IV8A 4RM3A 1IJWC 4C3IJ 1R22A 1OCOH 3CCLI 2LY9A 2EA2A 5C44J 4U7BA 5GTHC 1BR1A 4EM1A 1YJWI 3OIQA 2XAJA 1ZRFA 1KYZA 2FA5A 5IP6A 2XSJC 3H9GA 4GYIA 5KK1A 2P0WA 4FE7A 3LMMA 1P4AA 3TO6A 1UAAA 3GTQJ 2K4JA 5D5UB 1S5LC 2RV8A 3RKXA 4A2UA 4G6TB 2IT0A 4BJTA 3OYMA 1XSDA 2AXTC 3BR1A 5ICGA 1E3PA 2V1XA 4NBQA 4HDVA 3ZQGA 3I5UA 2L7FP 1DQUA 1V5EA 2AO9A 1DU6A 2LY2A 4NNJA 3RJPA 4MEYF 3KPHA 3A1YA 3DCFA 1F9NA 4RM2A 3LA3A 5DUKA 4M9ZA 1H9TA 1IN6A 1LDDA 1QHHD 4ESJA 1WJEA 1SANA 4V2FA 2P7CB 3QWLA 2IA0A 3RSNA 1T8IA 1TNSA 3WTTC 3BQZA 5EZHA 4L0ZB 2DO7A 2L3DA 1W4MA 3GUDA 4L9TA 2BYVE 5AONA 2DOAA 1J5YA 1I39A 1MBEA 1N77A 3HSRA 1XGSA 2EPFA 1E3OC 2V6CA 2WAEA 3HKZA 1OR7C 2XIGA 2VOOA 2KIUA 2HQAA 1FSHA 2DODA 2KRHA 3V7RA 4ASNA 2ID6A 3JRCA 1FP2A 1Y39A 4XORA 4RAFA 1QZZA 1XMXA 2D1HA 1XG1A 3MD2A 4HF1A 2XB0X 4OIRF 2R5YB 4B43A 3CZ6A 1OYIA 2LYCA 1SAUA 2L9NA 2QCOA 4HX7A 3JRBA 1MGTA 3DU6A 5KAIC 1WWXA 1YX5A 2EB7A 5HNHA 5F0FA 3VPRA 2GOMA 5TJJA 4C3HJ 3T1BA 2DA3A 1BIBA 4HDUA 3V42A 3BZ6A 1T2KA 1VQNI 1ZYRF 3K2AA 4KT6A 3PJRA 5F0CA 4GXOA 3ZMUA 1BR2A 2K4BA 3GW2A 3M8JA 1BBYA 3OS1A 2DI3A 2KZGA 3KLNA 3DWLE 3L1PA 2UZKA 5E3OA 1JGGA 3S3NA 3CCUI 1WZ2A 3TGNA 4I2OA 2QQAA 5C3EJ 2QUFA 4BQNA 3OL4A 3KP3A 4LGWA 3CDHA 3DTEA 3ELKA 3TP0A 4CDGA 3TQNA 1MZBA 2DMTA 2ELHA 3H0GJ 4P5OA 3WTZA 5ERIA 1O7FA 1T33A 2XHKA 4OINF 4DJAA 1M1EB 5D4SA 4BACA 4E7SA 5IP9J 1IV6A 2EH3A 4E70A 1IGNA 2UXXA 2R5YA 3M4OJ 3HYIA 4GGGA 4L18B 1IN8A 2GIVA 3K1MA 1HF0A 2E1CA 4BGDA 3RCOA 1FX7A 3ABTA 3OYNA 2FMYA 3EPZA 4G6DA 3HJEA 3IC7A 2DA7A 5E17F 1ZR2A 1XPXA 3IKTA 3GEZA 3H5NA 4IO9F 2QQ8A 3SZPA 1UB9A 1ORKA 1VQ7I 2DMNA 4U88A 4NHJA 5L3BA 2LOOA 1YRNA 4C2TA 1FP1D 1MD0A 3K2ZA 1XS9A 4XL9A 1IC8A 2IJLA 2MH9A 1K4TA 5D5XB 4PZJA 3TW7A 1S7EA 3ABKH 2L9SA 5BMZA 3PO3J 2IGMA 2ZXWH 1JGSA 2MLGA 1A31A 2M7BA 2MSYA 4JBAA 4BS9A 2K3PA 2VASA 1BM9A 3BZCA 2DT6A 4I98B 4IRGA 4IL6C 4P96A 4RAZA 3DLLF 1VQ6I 1HC8A 1R9TJ 1WRJA 2XGDA 3ZQIA 4IHSA 4OU0A 1D1CA 1OISA 2KT0A 1XDUA 2JA6J 2FBKA 5CVRA 1UHMA 2M0MA 2RQQA 3WHBA 2PFBA 1OQYA 3O3KA 2HYGD 4B1RA 1IW7F 5DEQA 2VC1A 2JN6A 2HR3A 3N97A 5M3FJ 1LE8A 3ZPLA 2MGQA 1ZG1A 2LREA 1G2HA 1EH8A 3CCSI 3BT9A 3F0CA 3GWZA 4O6JA 5JI6A 3BPVA 1ON1A 4ZDLA 4IHXA 2PMZA 4GFBA 3EUHA 4XOPA 3G1LA 3I4NJ 2V9VA 5D6EA 3MVPA 3QYFA 1B72A 2GM4A 3PFYA 4AWXB 1W7PB 4AYBA 4F92B 1Y0NA 2OTLI 4ZYHA 3QQAA 1YOVB 1LJ9A 1GV2A 1N78A 2MD5A 3HPGA 4BQQA 3WTYC 3IHUA 4LIUA 2DJIA 2OD5A 1S3JA 2ZB9A 4ANJA 2IBDA 3F22A 3S17J 2F5CA 2K86A 2ACJA 1FYKA 5B5EC 4XLAA 1AOYA 2ZMEB 2HU9A 3U1KA 3ZQ7A 4QLCU 3F8CA 4G94A 2A68F 3TBIA 4XKCA 1C0WA 2X0LA 1IO2A 2GA1A 1IRXA 1N25A 1QQIA 2LDUA 3CJRB 3H1CA 3H3VK 2VBZA 2LMDA 5EGOB 3OOPA 4L5EA 1BR4A 4HPQA 4M72A 2RKHA 2WY8Q 3K4BA 4YIFA 4PJ0C 3EYIA 1LNWA 3P5JA 2VPRA 2R7QA 5J40A 1K4SA 3G3ZA 5B1AH 5JLWA 3FM5A 3LSPA 4XLNF 3V7SA 1B9MA 3IH2A 3HM5A 4PGHA 5CQEA 4CO8A 2L4MA 3B6AA 3PFIA 3RPUA 3ZCOA 1B1BA 3I71A 3W2WA 1WJ5A 1ZARA 1BJZA 4LIVA 2A07F 5D5WB 3BR6A 2H1LA 2KRCA 4IOAF 2EBIA 4RMNA 1CGPA 2Q1ZB 3NARA 1U78A 5TRDA 3BLYA 5LEKA 4ESFA 4BL0B 1I3QJ 5M3MJ 4UUSA 5J8FA 3WE3A 2VC0A 4XKBA 4BKXA 3UR3C 1ON2A 4EM2A 3GZNB 4M3GA 5EGOA 1ODDA 2DT7B 3MKLA 4Q48A 1J9IA 2OUMA 3GF2A 4II3A 4AU7A 1HA8A 2DQRA 5KAFC 3BCBA 1UELB 4DW6A 1IN5A 4L5JA 1RKTA 1YQAA 3WE2A 1GUUA 1POGA 2E2JJ 4LOCA 5K5QA 5IT3A 5LLQA 2QSHX 4G8XA 2ME6A 4MIMA 4BDZA 4A0ZA 4U87A 5B1BH 3L7WA 4A3GJ 2KJBA 3GCMA 1H89C 2IGKA 2CW7A 3LWFA 2JPBA 3ZQCA 5HDGA 1WJFA 2LF8A 3OIPA 1XSXA 3CTAA 3TL4X 1FBSA 4HQEA 2FNPA 3AG2H 3Q5FA 3CMAI 4HNTA 1X2MA 1Z67A 3H3ZA 3LQQA 3ERED 3HRSA 1HW5A 6PAXA 2CUEA 3EUHC 1ZREA 2CWEA 3A0HC 4XKWA 1U8BA 4ZZLA 3QPHA 1T0FA 2VKHA 1EH6A 4AC0A 1RUOA 2CQNA 2LH9A 2ZXHA 1BN5A 4E7LA 2KFDA 3O8GA 3M7GA 5E3LA 5HS9A 3BWGA 4CXFA 2O03A 3FM3A 3CJQB 1HCRA 5ILSA 4X0GA 4BY7J 3VSKA 4BH9A 2JZYA 1F1ZA 2HPMA 2LRDA 1WI3A 3FXJA 2BE5F 3E6DA 2X4HA 2BZTA 4LG3A 3G2BA 3WHCA 2TRTA 5J1UA 2VJ4A 4JYKA 1HW2A 3E0JB 3F6OA 3KFWX 4IOCF 3GLXA 1TQIA 2KZVA 4HA8A 4Y4RA 5E3MA 1VQOI 3RYRA 3HOWJ 3CCJI 1Y8RB 2E7WA 2XKPA 3ISPA 3TMOA 3FIWA 2FQ4A 2HPIA 4KT5C 1BI1A 5DM6F 2ECCA 2VE8A 1MBHA 2G9WA 1ETKA 3LQRA 4AIHA 2R7OA 1X3WB 2P6TA 2K9QA 2K02A 3GLLA 2DMQA 2E36A 2KL4A 3ZGKA 3CF5F 4QSHA 3HRTA 2DOEA 2NAZA 2QZ8A 2PLYA 2K9MA 1R5GA 5CVUA 2R5ZA 3S16J 2FNAA 3S93A 2Y31A 1P4WA 2E2HJ 2JUGA 1DPRA 2GZWA 3HDDA 2ZMEC 1XGMA 2MW8A 2BXZA 4I7HA 4D5CA 2P5VA 3HOYJ 4GCVA 5IPAA 2NOGA 4GRIA 2QA4I 2H27A 4V2GA 4A3CJ 9ANTA 2XAQA 4ZYEA 5IYCJ 2QYOA 5C4JJ 5DCFA 1SAXA 2L0KA 1CF7B 1ZLKA 2O6GE 1U0JA 1D3YA 3K4JA 2MLKA 3PNTA 2Y0MA 2BW3B 4Q4ZF 1AU7A 1R6RA 3FXLA 3M1CA 1NH3A 1Z91A 1Y8QB 2HOSA 4II2A 4RDUA 3GTPJ 4O5VA 1OPCA 5BPIA 5EEGA 4LLLA 4L0YB 1NK3P 3P9CA 1ONVA 2DXIA 1LPQA 1E17A 3C3WA 1YW7A 5E1WA 2QLZA 4AYBN 2PN6A 3BCAA 2DPDA 2Z1DA 2M1BA 1FNNA 3LOCA 3RQ4A 2QKMB 1I6XA 1FZPB 2DA5A 1VQLI 2Z9OA 1SFUA 3ABMH 1MMDA 1FIPA 2EV5A 4Y3OA 3PSIA 5CQGA 3R60A 3CP8A 3RZDJ 5LRRA 1VI0A 4I6ZA 3I9V2 4DYQA 2FX0A 2CSOA 1W0UA 2JVGA 1OKRA 2HDCA 1JKOC 1S8NA 2QSFX 2E1OA 5EZGA 4RB3C 1KYWA 1MH3A 5LGNA 2H8RA 2JUCA 1CF7A 1X4OA 1TQPA 3QU3A 2EJRA 3DLAA 2JJ7A 3OV8A 5J4VA 3DFGA 2DDAA 2A5YB 3OYEA 4YEJA 2XUBA 3ML6A 5HDNA 1P7IA 2N8GA 2XPWA 2IEKA 1IXCA 3TO7A 4Y13A 3LNQA 2E5NA 1K6OA 5GADJ 5J3LA 3WU2C 1XB4A 3L09A 5F27A 5LHIA 5DCMB 2LBFB 2A6TA 3K4KA 3DPUA 5FLMJ 1JE8A 4I01A 4XLFA 2KHMA 2V6EA 2CMPA 1GT0C 4MEXF 4BQAA 5L3DA 3NEUA 3M9AA 3S1MJ 5J1RA 3L2WA 5DV5A 1DUXC 5ICFA 1ZGJA 4QPQA 5B66C 4BJ5C 5HNFA 3MZYA 5K7ZA 1P9QC 4HNVA 5AIQA 1KQ0A 4IHWA 4PJJA 5EDNA 1QA6A 2OA4A 5FB2A 1Z77A 4A6EA 3FMQA 1XC5A 3C2GA 1X3UA 2H09A 4FX4A 2IVMA 2XC7A 4ABZA 2JTVA 3S1RJ 3K4NA 1HQCA 3W6KB 3KEYA 2XF5A 3LSGA 5H2FC 4DYRA 4RLFA 1Q1HA 5DCMA 2Z33A 1ZLJA 2LBFA 3S1QJ 3CMEI 1X1DA 3T0YA 1EJ9A 4I99C 5F1JA 2QVOA 4EQQA 3HHHA 4MTEA 1O3QA 3KEQA 1ERDA 4WK8F 1S7AA 1TNTA 2F4MB 3WGHA 4OMZA 4HSRA 4WWCA 4DOZA 2QGUA 1BOBA 3JR9A 4EVIA 2EZLA 1WPKA 4D9JA 3S2HJ 4WF2A 4P55A 1LFPA 4Y52J 3G1MA 2GXAA 4HOBA 1BI2A 5CVVA 1TW3A 5LGTA 1WCMJ 2ZC2A 3L00A 2R0QC 4BXFA 4OAZA 3QYBA 4BXXJ 2NVUB 1QZYA 3ZMZA 1Z21A 2XGXA 2XROA 4M9XA 1RC9A 3SEQA 1W1WE 2RREA 3RKQA 3OYLA 3HSEA 3FXKA 1NG6A 2VQCA 2ETHA 5ICCA 3R61A 2AQEA 3JCUC 1USSA 2QENA 1O3TA 5IY5H 3JW4A 4YFKF 4EATA 1KQ9A 3CESA 3IH3A 2R3SA 3DBRB 2X1DA 1VQ8I 1BIAA 2XKOA 1IDYA 3JRIA 1T38A 4HBLA 1ZGWA 2LNBA 2LVSA 4BUPA 3ABUA 2JRMA 1IF1A 2EA4A 3E6MA 4Z6YA 1G4DA 1AKHA 1REPC 2L54A 1RNLA 2P81A 5ILUA 1BOAA 2XRNA 2M87A 4RGUA 4LB5A 4S04A 2XAGA 2VODA 3GYHX 1K6YA 2CO5A 4IQJA 1DGRM 1TQMA 4A5MA 3DP7A 4KIFA 1I1SA 3WTWC 1Z7LA 2Z3YA 4BU2A 1GDTA 1Z3YA 4U7DA 1BC7C 2L7ZA 3SYTA 4XRMA 1VTNC 2V1DA 2W4SA 2XGEA 4PUSA 4BEHB 1A36A 5LRSA 5F64A 2M9HA 3F72A 4CHUA 3O6BB 1OLTA 1TWGJ 2JSCA 1FOWA 1HKQA 4BJ6C 4FASD 5JVTA 3FXRA 1E3HA 3CCYA 4MLOA 4ENNA 4CYCA 5F1RA 1FMVA 3KZYA 3MN2A 2G7HA 3ESWB 4EEFG 4YIIA 2HYJA 4L9JA 1QZEA 2HZDA 1OYWA 4C2MJ 3L2UA 1VZ0A 2KLOA 3F3XA 4E7HA 1TT5B 1DP3A 1G3YA 2ICWG 2ZXIA 1SD5A 3JREA 3DU5A 4OIQF 2OPTA 3WTXC 3BG3A 2H6CA 2C6YA 1WH5A 1MMGA 4JX5A 1R5ID 2HOEA 4M3BA 3PNVA 2DDBA 3QPTA 3ASNH 4BNCA 5DD8A 2VI6A 4PFOA 1W36C 3VFZA 4O3MA 2VKEA 4HX4A 1LDJA 3S2DJ 4BEHA 2LG4A 2HKXA 2MABA 2O8XA 3QP5A 4HLYA 2DYSH 2NS7A 3CCEI 3HB9A 1ITYA 3LSTA 4YFXF 2MH2A 4XQFA 2Q2EA 3SFIA 4GYGA 5GPAA 4IHTA 1XTAA 2V1NA 2ZKZA 5LHGA 1ZAOA 2HWVA 1JJ8C 4UUVA 3NQOA 3OS0A 3PNYA 2HQ5A 1MNMC 3K4LA 1B4AA 1K79A 3EUKL 1S9HA 2YU9J 2LF7A 1D0YA 4DZPA 1QVTA 1YRNB 5B3SH 3BTIA 1MW7A 4A3KJ 1BA5A 1SD4A 2E35A 3A03A 3MZ8A 2A6EF 3W3CA 1O57A 2Y69H 4A3DJ 2K9LA 4IEJA 2YX4A 1NHAA 1JT0A 3M8FA 3BPXA 2AHQA 4F93B 1YS7A 2MYSA 2L01A 1T39A 3OY9A 4A3IJ 3LFKA 2ZFWA 2WAFA 1JTYA 2MBFA 3I54A 1HOMA 2LFBA 1RUNA 4FTHA 3VWBA 1TZLA 3KEOA 3OYJA 4UV9A 4B47A 5EJCA 2G7UA 3DV8A 5K1YA 4Y33A 4ZTJA 2DN0A 1F43A 2FD5A 4I0BA 4CGZA 3R0AA 2GIZA 1TWCJ 2BV6A 4XONA 2MC4A 4E7IA 2CH0A 4G7ZF 2X6OA 4KN4X 2YU3A 5FD5A 1LE8B 1MBFA 1FBQA 2RNGA 5FJ8J 3FMSA 3JRGA 2EIKH 2R7DA 2P4WA 2K3FA 1H9GA 1JUPA 3K9TA 3PIPF 3QAHA 3F21A 3OYDA 1JXSA 4M3EA 3UKGA 4B4CA 2K5CA 3LSHA 2RNJA 2VB6A 3CUQA 1B72B 3WU0A 5CJ9A 3ZR8X 2PMUA 1MBGA 2L9RA 1JT6A 2EFPA 4IXAA 2W1OA 3IAM2 2KJCA 3JTGA 4R8HA 3BJOA 2A3SA 3REOA 2JPCA 2ISZA 4C3JJ 1HDDC 2DK8A 2EV0A 3HGGA 1MMSA 1XSVA 2IS6A 3CDIA 2VKDA 1XDSA 5CKTA 2D45A 4EGZA 1PUFA 1UG0A
chains in the Genus database with same CATH topology
1PDNC 3EQLF 3E97A 2O61A 1B6AA 1GXPA 4KMFA 5L3CA 2HEOA 3R0JA 4LMYA 4Q47A 2P7VB 4KN7X 3ECHA 1J0RA 1P6RA 3GXOA 4EJOA 4ZYGA 1OYYA 1XCBA 3WTVC 1R00A 3RI4A 1HKTA 1TLHB 4HW0A 4JK1X 1FPQA 2FOKA 4KA4A 4WX9A 2DW4A 1IN7A 2CG4A 1ZRDA 3ROUA 1YO5C 2HQNA 1UCRA 1QGPA 2XVCA 3Q9VA 4CICA 2V79A 2ZXJA 5CVIA 3P7NA 1I1GA 4UNOA 1TBXA 2TDXA 2GA2A 3U1DA 3DQVC 3LAJA 1W5SA 1MJ9A 1LB2A 3P9IA 2O3FA 4AVPA 2D1VA 3EDPA 1QNTA 4MNUA 1LVAA 2ESNA 2BBYA 4M74A 2XV4S 2QBYB 4RB1A 3CLOA 3WTUC 3AAFA 2VE9A 2GAUA 4P9FA 4BHBA 3N4MA 4OOIA 3R4KA 2VBXA 2PBIA 3QP6A 3J7AO 4RS8A 2EV6A 4XRFA 2P5LC 2ZBKA 2CQKA 3D5LA 4MHGA 3KP7A 1JHFA 4LJZF 2Z5UA 1YW8A 2OU2A 2NNNA 4YG2F 3C7JA 2QBYA 1XN7A 2F5EA 2IP2A 3I59A 4YFNF 3KCCA 5FD6A 1W7PD 4M6XA 3DPLC 3HOTA 1G3SA 2LSOA 3BJAA 1GVJA 2OBPA 3VB2A 2H6BA 2VBYA 3BY6A 4ESBA 3DXJF 2HTJA 2OQGA 4HQMA 4N9HA 3RKWA 1B9NA 2CYYA 4G6QA 3TOAA 2EFNA 2EFOA 2YR2A 3FXQA 4UVAA 4ZYDA 3ZMVA 4L9VA 2Q0OA 4NB5A 3T8RA 1SD6A 4EGYA 1P2FA 4D0PA 4HV5A 4KNYA 2FRHA 4A0YA 2P8TA 2QWWA 2RN7A 4TV7A 4HLXA 4HZFA 1Z7UA 2E1NA 4UXNA 4ENJA 1FC3A 1R58A 3B02A 5BQTA 1E2XA 1KU2A 3IKVA 2M8EA 4MQVA 5BOXA 1T6SA 4A6DA 2PMHA 4M73A 3IWFA 1SMTA 2O0YA 5CVJA 1FSEA 1YYVA 4EV0A 5LEJA 5JHUA 5HOOA 2HGCA 5HVQC 2EFQA 1LQ1A 2ISYA 3KP2A 5FO5A 3DEUA 1MJBA 4U0WA 3KETA 3CUOA 1ZRCA 4PCQA 2FMLA 4L9NA 1HKSA 4M71A 1AWCA 5FGMA 2HKOA 5CLSA 4IVNA 2YSRA 1SMYF 1TTYA 2VXZA 2PJPA 2JRTA 3F8BA 1Z6RA 2OAZA 1KU3A 4KIBA 2HTSA 2XAHA 1S7OA 1U2WA 1HW1A 3M8EA 4G9YA 4U0YA 1SFXA 3KLOA 3ZMSA 1ULYA 1D8KA 5E18F 1QO0D 1S6LA 2KIFA 1WQ2A 1V4RA 2VOPA 3GO5A 1PP7U 3VODA 3MQ0A 4WXCA 5LHHA 1WSUA 3BDDA 2KRFA 3IL2A 1G3WA 1S29A 5E8GA 2W24A 1MJAA 2Q8KA 3HIFA 4N9IA 1HBXG 2FE3A 4WXDA 3ZN0A 3L9FA 3C18A 2WWYA 4HF0A 4RAYA 4UHTA 4B09A 1F5TA 1OR7A 2STWA 4RGXA 4B8XA 4RGRA 5HLGA 4PDKA 3H3UA 2XAFA 2QQBA 3GFMA 4U0VA 2J5OA 4HYEA 4FT8A 2RC4A 2GWRA 3GZ6A 3E6BA 1YTYA 3M1EA 3ECOA 3I58A 2HS5A 3WU1B 3FZVA 3TOBA 3EETA 4P9UA 1P4XA 2W84A 3E5UA 3SFZA 5D8LB 3GZ5A 3C1DA 1PP8F 3LAPA 5A2QZ 1BC8C 5LGUA 3ZP5A 5FFZA 1FT9A 4OIOF 2VBWA 1JHHA 3E3VA 4H0EA 3FWEA 2FBHA 5A2QK 1J59A 5K5OA 2F2EA 1Z1DA 3DF8A 5DD4A 4G7HF 1HSJA 5DYMA 1R23A 2HYFA 1HSTA 3U9GA 3ZMDA 4RGSA 2AS5F 2DLLA 4AIKA 1PUEE 1QBJA 1ZHFA 5CYVA 4XBFA 1ZN2A 3COAC 3SZTA 1WI9A 3E6CC 2F5FA 5HS7A 1R1TA 1QPMA 2K27A 2EK5A 1DP7P 2FSWA 3B73A 1IN4A 3I64A 3WGIA 2GXGA 3HTSB 4RB0A 1HXDA 4KMUX 2KIMA 1KQ8A 2ZNZA 3E5QA 3I4PA 2DK5A 5D4RA 4WXHA 3SXYA 4EJUA 5BPDA 2BGCA 2A69F 3RDIA 1O7LA 3MCZA 2JT1A 1K78B 2FU4A 1K7AA 4HAMA 4AIJA 3FHZA 2LKPA 3Q9SA 4BAYA 1UFMA 1D5VA 4M6YA 3KP4A 4IPAA 2QQ9A 5JFRA 5LBQA 5ICEA 2EFWA 1A04A 5E8IA 1XMAA 3J80Z 4EMSA 3CUQB 5E1ZB 3E5XA 3CO7C 2DFIA 2COMA 1XGOA 1P92A 3F6VA 5HDKA 3J80K 3J81Z 3RPQA 1BJAA 4Y17A 1K78A 4IRIA 4S05A 3O2PE 3J81K 3F8MA 1ZG5A 5ED4A 1MDMB 4BXUA 2GQQA 1L0OC 3NRVA 2HZTA 1OMIA 2W57A 1YW9A 1LDKB 5FLXZ 1BI3A 3ULQB 2WC2A 3IRQA 3L2CA 2IW5A 4PGGA 1XMKA 3BROA 3BOQA 2PEXA 5FLXK 1IZ1A 3TO9A 1XD7A 1ZH5A 3D0SA 1R7JA 1RI7A 3IWZA 2ZO4A 4IRHA 4KICA 1MDMA 4EJWA 1KU7A 3I0TA 4BHPA 4UVCA 3JAMZ 3F23A 4EM0B 3CJNA 2FBIA 4I09A 4BHCA 1IUYA 4N0BA 1KA8A 2RDPA 2OQRA 3MEXA 4R1HA 4DQ2A 3K1NA 3JAMK 5HLHA 2DAOA 3MAJA 1R5HA 1Z05A 5D5VB 3GFIA 5H6QA 3S2WA 3U2RA 2YPRA 2HQRA 2KKOA 1STZA 3FX3A 1BI0A 3TDZC 2VN2A 4BYYA 3LA2A 2R7FA 3TKYA 2DU9A 2Y48A 3DKWA 5EEHA 3BP8A 4ENMA 1EV7A 2NRAC 1B59A 2AXLA 1G6NA 5BS6A 1L3LA 4KIGA 1H0MA 3GFJA 2ZJ2A 1KGSA 1SD7A 5D8KB 2NYXA 3K69A 2FEZA 2W25A 3GFLA 4Z2YA 3PQJA 4LG0B 5E1XA 4HF2A 1RZ4A 1U6GA 4LK0F 3G73A 5H6RA 3I59B 4ETSA 4ON0A 1W7PA 4XSXF 5J8CA 2M45A 2STTA 4K2EA 2Y75A 2ZCWA 5JR3A 3WG9A 1V3FA 3CUQC 1ZGAA 4EJTA 1YLFA 3KP6A 3T5XA 4IF4A 2OZ6A 3ZMTA 2PG4A 5IT9Z 2GXBA 2IA1A 3HSFA 2ZMEA 3KP5A 3I53A 4L5IA 5AIPA 5J6XA 2D2WA 2IA2A 1U5TB 1G3TA 2BEOA 2NS0A 3V8LA 2PQ8A 2FF4A 3MZHA 1FY7A 5IT9K 3V8JA 4G7OF 4LK1F 4LG0A 5K5RA 4KDPA 2UXNA 3RYPA 4F7ZA 3RKYA 3H92A 2B0LA 5HLIA 4KFCA 2YX7A 3WGGA 1R36A 4Q5SF 3VOEA 3V4GA 1GHCA 1J2XA 4NQWA 1KU9A 2A61A 3QOPA 1UHWA 3LA7A 5DDGA 2FXAA 2DTRA 1U5TA 1DDNA 4A12A 3DPTA 3JSOA 4MTDA 2RVCA 2M5WA 3PQKA 4AD9A 2DPUA 2DBBA 4ENKA 1USTA 5E20A 1IXSB 3QU6A 1FLIA 5DUIA 1DPUA 3F8NA 4M9SA 4HV6A 3MFKA 2P6SA 2E7XA 2A6HF 3F8FA 2CGPA 1F4KA 4IJAA 5KVRA 2CW0F 1T98A 2NNYA 1IRGA 5FFXA 3BJ6A 4FX0A 3V8KA 3K1PA 2WV0A 1FYMA 1YG2A 3EYYA 1SFEA 3JTHA 4ZZDA 1YIOA 4OMYA 1FBUA 2FQ3A 2RQPA 2F5DA 4LFUA 3SHFA 3P9KA 1FYLA 2CFXA 4LLGF 4KYWA 4KUMA 2HFHA 3TDUC 5ILVA 1LEAA 2ADUA 4LD5A 1O3RA 2IPQX 4WCGA 3T8TA 1RIOH 2RGVA 4XSZF 4EJVA 1U3EM 2K7LA 1J75A 3RIRA 4LB6B 1R1VA 3KZZA 2MC3A 3HTUA 5HS8A 5H20A 3HUGA 1FOKA 3K0LA 2L4AA 1YFHA 3V7CA 2H94A 4OIPF 2EWNA 4DNCA 2W85A 3WODF 1GXQA 3FF5A 1Z9CA 3R6SA 4QWQA 4XLPF 4LLNA 2V1UA 5L3EA 1U5TC 2DQLA 1D8JA 1MKMA 3RTRA 2QM3A 5L3FA 1U8RA 3HHGA 4FHTA 4Y15A 2ESHA 2Z99A 3QRFF 3HRUA 3HRMA 3JSPA 2IRFG 4I0AA 3W6JB 3SQNA 1LEBA 4I02A 5D6FA 1O3SA 3FMRA 3HOSA 2VT3A 1I27A 4R79A 5F6FA 4UVBA 2ZNYA 2VT2A 1FWZA 3FXUA 2UWMA 4RB2C 1W5TA 1IAWA 4MGRA 3IRRA 3ZN1A 5L3GA 4GO1A 1ZG3A 4ZH4F 1WKMA 3MWMA 4HX8A 1XCVA 4MQ9F 4A0XA 1YS6A 3VEPA 2XASA 2OZUA 2M30A 1IRFA 1J7KA 4JQFA 4A5NA 2L02A 1TW2A 1XGNA 2P5KA 3KE2A 3GX4X 1Y0UA 2MA3A 2WTEA 2VONA 3GVAA 3WTSC 2PI0A 1R1UA 4CYDA 1IXRC 2DT5A 4CZZA 2J5PA 1I5ZA 3CO6C 4UV8A 1Z6TA 1EH7A 1R22A 2EA2A 4U7BA 4EM1A 2XAJA 1ZRFA 1KYZA 2FA5A 4GYIA 5KK1A 1P4AA 3TO6A 2K4JA 5D5UB 2RV8A 3RKXA 4A2UA 2IT0A 1XSDA 5ICGA 2V1XA 4HDVA 3I5UA 3RJPA 4MEYF 1F9NA 3LA3A 5DUKA 4M9ZA 1H9TA 1IN6A 1LDDA 4ESJA 2P7CB 2IA0A 1TNSA 3WTTC 4L0ZB 2DO7A 2L3DA 1W4MA 3GUDA 4L9TA 2BYVE 5AONA 1J5YA 3HSRA 1XGSA 2V6CA 2XIGA 2VOOA 2KIUA 1FSHA 3V7RA 4ASNA 1FP2A 1QZZA 2D1HA 4HF1A 4OIRF 1OYIA 4HX7A 1MGTA 1WWXA 2EB7A 5TJJA 3T1BA 1BIBA 4HDUA 3BZ6A 1T2KA 1ZYRF 4GXOA 3ZMUA 2K4BA 3GW2A 1BBYA 2DI3A 3KLNA 2UZKA 3TGNA 4I2OA 2QQAA 2QUFA 3KP3A 4LGWA 3CDHA 3ELKA 4CDGA 3TQNA 1MZBA 2ELHA 4P5OA 3WTZA 5ERIA 1O7FA 2XHKA 4OINF 5D4SA 4E70A 2UXXA 3HYIA 4GGGA 4L18B 1IN8A 2GIVA 3K1MA 2E1CA 1FX7A 3ABTA 2FMYA 4G6DA 3IC7A 5E17F 3IKTA 3GEZA 3SZPA 1UB9A 4U88A 4NHJA 5L3BA 1FP1D 1MD0A 3K2ZA 2IJLA 2MH9A 5D5XB 4PZJA 5BMZA 1JGSA 2MLGA 4JBAA 1BM9A 4I98B 4IRGA 4P96A 4RAZA 1WRJA 4IHSA 4OU0A 1XDUA 2FBKA 5CVRA 1UHMA 2PFBA 3O3KA 2HYGD 1IW7F 5DEQA 2VC1A 2HR3A 3N97A 3ZPLA 1ZG1A 1EH8A 4O6JA 3GWZA 5JI6A 3BPVA 1ON1A 3EUHA 2V9VA 5D6EA 4AWXB 1W7PB 4ZYHA 1LJ9A 2MD5A 3WTYC 3IHUA 2OD5A 1S3JA 3F22A 2F5CA 2K86A 2ACJA 1FYKA 1AOYA 2ZMEB 3ZQ7A 4QLCU 3F8CA 4G94A 2A68F 1C0WA 2X0LA 2GA1A 2LDUA 1QQIA 2VBZA 3OOPA 4M72A 2RKHA 4YIFA 3EYIA 1LNWA 3G3ZA 3FM5A 4XLNF 3V7SA 1B9MA 4PGHA 4CO8A 2L4MA 3PFIA 3RPUA 1B1BA 3I71A 1ZARA 2A07F 5D5WB 1CGPA 1U78A 5TRDA 5LEKA 4ESFA 5J8FA 3WE3A 2VC0A 1ON2A 4EM2A 1ODDA 4Q48A 1J9IA 3GF2A 2DQRA 1IN5A 4L5JA 1YQAA 3WE2A 5K5QA 5IT3A 5LLQA 4G8XA 4A0ZA 3L7WA 2KJBA 3LWFA 2JPBA 5HDGA 2LF8A 1XSXA 3CTAA 1FBSA 4HQEA 2FNPA 3Q5FA 3LQQA 3H3ZA 3ERED 3HRSA 1HW5A 6PAXA 1ZREA 2CWEA 4ZZLA 3QPHA 1T0FA 1RUOA 1EH6A 1BN5A 3M7GA 5HS9A 3BWGA 4CXFA 2O03A 3FM3A 5ILSA 4BH9A 2JZYA 1F1ZA 2BE5F 3E6DA 2X4HA 1HW2A 3F6OA 3KFWX 3GLXA 1TQIA 4HA8A 3RYRA 3ISPA 2E7WA 2XKPA 4KT5C 1BI1A 2VE8A 2G9WA 3LQRA 4AIHA 2P6TA 2K02A 3HRTA 2NAZA 2QZ8A 2PLYA 1R5GA 5CVUA 2FNAA 1P4WA 1DPRA 2GZWA 1XGMA 4I7HA 2P5VA 4GCVA 2H27A 2XAQA 4ZYEA 2QYOA 5DCFA 1SAXA 1CF7B 1ZLKA 2O6GE 1D3YA 2MLKA 2Y0MA 4Q4ZF 1Z91A 4O5VA 1OPCA 5BPIA 5EEGA 4LLLA 4L0YB 3P9CA 1ONVA 1E17A 3C3WA 1YW7A 5E1WA 2QLZA 2PN6A 2DPDA 2M1BA 1FNNA 1I6XA 1FZPB 2Z9OA 1SFUA 2EV5A 3R60A 5LRRA 2CSOA 1OKRA 2HDCA 1S8NA 4RB3C 1KYWA 5LGNA 1CF7A 1TQPA 3QU3A 2EJRA 3OV8A 3DFGA 2A5YB 2XUBA 3ML6A 5HDNA 4Y13A 1IXCA 3TO7A 1K6OA 1XB4A 3L09A 5LHIA 5DCMB 1JE8A 4I01A 4MEXF 4BQAA 5L3DA 3NEUA 3M9AA 1DUXC 5DV5A 5ICFA 1ZGJA 3MZYA 5AIQA 1KQ0A 2OA4A 5FB2A 4A6EA 3FMQA 1X3UA 2H09A 4FX4A 2IVMA 2JTVA 1HQCA 3W6KB 1Q1HA 5DCMA 2Z33A 1ZLJA 3T0YA 2QVOA 4EQQA 3HHHA 4MTEA 1O3QA 3KEQA 4WK8F 1S7AA 1TNTA 3WGHA 4OMZA 4WWCA 4EVIA 4WF2A 4P55A 4HOBA 1BI2A 5CVVA 1TW3A 5LGTA 3L00A 3ZMZA 1QZYA 2XROA 2XGXA 4M9XA 3HSEA 2ETHA 5ICCA 3R61A 1USSA 2QENA 1O3TA 3JW4A 4YFKF 1KQ9A 2R3SA 1BIAA 2XKOA 1T38A 4HBLA 2LNBA 3ABUA 1IF1A 2EA4A 3E6MA 1G4DA 1REPC 2L54A 1RNLA 5ILUA 1BOAA 2XRNA 2M87A 4RGUA 4LB5A 4S04A 2XAGA 2VODA 3GYHX 2CO5A 1TQMA 4A5MA 3DP7A 4KIFA 1I1SA 3WTWC 2Z3YA 4U7DA 1BC7C 1VTNC 2V1DA 5LRSA 5F64A 4CHUA 3F72A 3O6BB 2JSCA 1HKQA 5JVTA 3FXRA 4ENNA 5F1RA 3KZYA 2G7HA 4YIIA 4L9JA 1OYWA 3F3XA 1G3YA 1SD5A 4OIQF 3WTXC 2H6CA 2C6YA 2HOEA 3QPTA 4BNCA 5DD8A 3VFZA 4O3MA 4HX4A 1LDJA 2HKXA 2O8XA 3QP5A 4HLYA 3LSTA 4YFXF 2MH2A 2Q2EA 4GYGA 4IHTA 2ZKZA 5LHGA 1ZAOA 2HWVA 4UUVA 3NQOA 1B4AA 1K79A 2LF7A 1SD4A 2A6EF 1O57A 2YX4A 1NHAA 3M8FA 3BPXA 1YS7A 1T39A 2L01A 3LFKA 2ZFWA 2MBFA 3I54A 1RUNA 3KEOA 4UV9A 2G7UA 3DV8A 5K1YA 4I0BA 4CGZA 3R0AA 2BV6A 4G7ZF 4KN4X 2YU3A 5FD5A 1FBQA 3FMSA 2R7DA 2P4WA 1H9GA 3K9TA 3QAHA 3F21A 1JXSA 2RNJA 3CUQA 3WU0A 5CJ9A 2PMUA 4IXAA 2EFPA 3JTGA 2KJCA 4R8HA 3BJOA 2A3SA 3REOA 2JPCA 2ISZA 2DK8A 2EV0A 1XSVA 1XDSA 2D45A 4EGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PDN C;  3EQL F;  3E97 A;  2O61 A;  1B6A A;  1GXP A;  4KMF A;  5L3C A;  2HEO A;  3R0J A;  4LMY A;  4Q47 A;  2P7V B;  4KN7 X;  3ECH A;  1J0R A;  1P6R A;  3GXO A;  4EJO A;  4ZYG A;  1OYY A;  1XCB A;  3WTV C;  1R00 A;  3RI4 A;  1HKT A;  1TLH B;  4HW0 A;  4JK1 X;  1FPQ A;  2FOK A;  4KA4 A;  4WX9 A;  2DW4 A;  1IN7 A;  2CG4 A;  1ZRD A;  3ROU A;  1YO5 C;  2HQN A;  1UCR A;  1QGP A;  2XVC A;  3Q9V A;  4CIC A;  2V79 A;  2ZXJ A;  5CVI A;  3P7N A;  1I1G A;  4UNO A;  1TBX A;  2TDX A;  2GA2 A;  3U1D A;  3DQV C;  3LAJ A;  1W5S A;  1MJ9 A;  1LB2 A;  3P9I A;  2O3F A;  4AVP A;  2D1V A;  3EDP A;  1QNT A;  4MNU A;  1LVA A;  2ESN A;  2BBY A;  4M74 A;  2XV4 S;  2QBY B;  4RB1 A;  3CLO A;  3WTU C;  3AAF A;  2VE9 A;  2GAU A;  4P9F A;  4BHB A;  3N4M A;  4OOI A;  3R4K A;  2VBX A;  2PBI A;  3QP6 A;  3J7A O;  4RS8 A;  2EV6 A;  4XRF A;  2P5L C;  2ZBK A;  2CQK A;  3D5L A;  4MHG A;  3KP7 A;  1JHF A;  4LJZ F;  2Z5U A;  1YW8 A;  2OU2 A;  2NNN A;  4YG2 F;  3C7J A;  2QBY A;  1XN7 A;  2F5E A;  2IP2 A;  3I59 A;  4YFN F;  3KCC A;  5FD6 A;  1W7P D;  4M6X A;  3DPL C;  3HOT A;  1G3S A;  2LSO A;  3BJA A;  1GVJ A;  2OBP A;  3VB2 A;  2H6B A;  2VBY A;  3BY6 A;  4ESB A;  3DXJ F;  2HTJ A;  2OQG A;  4HQM A;  4N9H A;  3RKW A;  1B9N A;  2CYY A;  4G6Q A;  3TOA A;  2EFN A;  2EFO A;  2YR2 A;  3FXQ A;  4UVA A;  4ZYD A;  3ZMV A;  4L9V A;  2Q0O A;  4NB5 A;  3T8R A;  1SD6 A;  4EGY A;  1P2F A;  4D0P A;  4HV5 A;  4KNY A;  2FRH A;  4A0Y A;  2P8T A;  2QWW A;  2RN7 A;  4TV7 A;  4HLX A;  4HZF A;  1Z7U A;  2E1N A;  4UXN A;  4ENJ A;  1FC3 A;  1R58 A;  3B02 A;  5BQT A;  1E2X A;  1KU2 A;  3IKV A;  2M8E A;  4MQV A;  5BOX A;  1T6S A;  4A6D A;  2PMH A;  4M73 A;  3IWF A;  1SMT A;  2O0Y A;  5CVJ A;  1FSE A;  1YYV A;  4EV0 A;  5LEJ A;  5JHU A;  5HOO A;  2HGC A;  5HVQ C;  2EFQ A;  1LQ1 A;  2ISY A;  3KP2 A;  5FO5 A;  3DEU A;  1MJB A;  4U0W A;  3KET A;  3CUO A;  1ZRC A;  4PCQ A;  2FML A;  4L9N A;  1HKS A;  4M71 A;  1AWC A;  5FGM A;  2HKO A;  5CLS A;  4IVN A;  2YSR A;  1SMY F;  1TTY A;  2VXZ A;  2PJP A;  2JRT A;  3F8B A;  1Z6R A;  2OAZ A;  1KU3 A;  4KIB A;  2HTS A;  2XAH A;  1S7O A;  1U2W A;  1HW1 A;  3M8E A;  4G9Y A;  4U0Y A;  1SFX A;  3KLO A;  3ZMS A;  1ULY A;  1D8K A;  5E18 F;  1QO0 D;  1S6L A;  2KIF A;  1WQ2 A;  1V4R A;  2VOP A;  3GO5 A;  1PP7 U;  3VOD A;  3MQ0 A;  4WXC A;  5LHH A;  1WSU A;  3BDD A;  2KRF A;  3IL2 A;  1G3W A;  1S29 A;  5E8G A;  2W24 A;  1MJA A;  2Q8K A;  3HIF A;  4N9I A;  1HBX G;  2FE3 A;  4WXD A;  3ZN0 A;  3L9F A;  3C18 A;  2WWY A;  4HF0 A;  4RAY A;  4UHT A;  4B09 A;  1F5T A;  1OR7 A;  2STW A;  4RGX A;  4B8X A;  4RGR A;  5HLG A;  4PDK A;  3H3U A;  2XAF A;  2QQB A;  3GFM A;  4U0V A;  2J5O A;  4HYE A;  4FT8 A;  2RC4 A;  2GWR A;  3GZ6 A;  3E6B A;  1YTY A;  3M1E A;  3ECO A;  3I58 A;  2HS5 A;  3WU1 B;  3FZV A;  3TOB A;  3EET A;  4P9U A;  1P4X A;  2W84 A;  3E5U A;  3SFZ A;  5D8L B;  3GZ5 A;  3C1D A;  1PP8 F;  3LAP A;  5A2Q Z;  1BC8 C;  5LGU A;  3ZP5 A;  5FFZ A;  1FT9 A;  4OIO F;  2VBW A;  1JHH A;  3E3V A;  4H0E A;  3FWE A;  2FBH A;  5A2Q K;  1J59 A;  5K5O A;  2F2E A;  1Z1D A;  3DF8 A;  5DD4 A;  4G7H F;  1HSJ A;  5DYM A;  1R23 A;  2HYF A;  1HST A;  3U9G A;  3ZMD A;  4RGS A;  2AS5 F;  2DLL A;  4AIK A;  1PUE E;  1QBJ A;  1ZHF A;  5CYV A;  4XBF A;  1ZN2 A;  3COA C;  3SZT A;  1WI9 A;  3E6C C;  2F5F A;  5HS7 A;  1R1T A;  1QPM A;  2K27 A;  2EK5 A;  1DP7 P;  2FSW A;  3B73 A;  1IN4 A;  3I64 A;  3WGI A;  2GXG A;  3HTS B;  4RB0 A;  1HXD A;  4KMU X;  2KIM A;  1KQ8 A;  2ZNZ A;  3E5Q A;  3I4P A;  2DK5 A;  5D4R A;  4WXH A;  3SXY A;  4EJU A;  5BPD A;  2BGC A;  2A69 F;  3RDI A;  1O7L A;  3MCZ A;  2JT1 A;  1K78 B;  2FU4 A;  1K7A A;  4HAM A;  4AIJ A;  3FHZ A;  2LKP A;  3Q9S A;  4BAY A;  1UFM A;  1D5V A;  4M6Y A;  3KP4 A;  4IPA A;  2QQ9 A;  5JFR A;  5LBQ A;  5ICE A;  2EFW A;  1A04 A;  5E8I A;  1XMA A;  3J80 Z;  4EMS A;  3CUQ B;  5E1Z B;  3E5X A;  3CO7 C;  2DFI A;  2COM A;  1XGO A;  1P92 A;  3F6V A;  5HDK A;  3J80 K;  3J81 Z;  3RPQ A;  1BJA A;  4Y17 A;  1K78 A;  4IRI A;  4S05 A;  3O2P E;  3J81 K;  3F8M A;  1ZG5 A;  5ED4 A;  1MDM B;  4BXU A;  2GQQ A;  1L0O C;  3NRV A;  2HZT A;  1OMI A;  2W57 A;  1YW9 A;  1LDK B;  5FLX Z;  1BI3 A;  3ULQ B;  2WC2 A;  3IRQ A;  3L2C A;  2IW5 A;  4PGG A;  1XMK A;  3BRO A;  3BOQ A;  2PEX A;  5FLX K;  1IZ1 A;  3TO9 A;  1XD7 A;  1ZH5 A;  3D0S A;  1R7J A;  1RI7 A;  3IWZ A;  2ZO4 A;  4IRH A;  4KIC A;  1MDM A;  4EJW A;  1KU7 A;  3I0T A;  4BHP A;  4UVC A;  3JAM Z;  3F23 A;  4EM0 B;  3CJN A;  2FBI A;  4I09 A;  4BHC A;  1IUY A;  4N0B A;  1KA8 A;  2RDP A;  2OQR A;  3MEX A;  4R1H A;  4DQ2 A;  3K1N A;  3JAM K;  5HLH A;  2DAO A;  3MAJ A;  1R5H A;  1Z05 A;  5D5V B;  3GFI A;  5H6Q A;  3S2W A;  3U2R A;  2YPR A;  2HQR A;  2KKO A;  1STZ A;  3FX3 A;  1BI0 A;  3TDZ C;  2VN2 A;  4BYY A;  3LA2 A;  2R7F A;  3TKY A;  2DU9 A;  2Y48 A;  3DKW A;  5EEH A;  3BP8 A;  4ENM A;  1EV7 A;  2NRA C;  1B59 A;  2AXL A;  1G6N A;  5BS6 A;  1L3L A;  4KIG A;  1H0M A;  3GFJ A;  2ZJ2 A;  1KGS A;  1SD7 A;  5D8K B;  2NYX A;  3K69 A;  2FEZ A;  2W25 A;  3GFL A;  4Z2Y A;  3PQJ A;  4LG0 B;  5E1X A;  4HF2 A;  1RZ4 A;  1U6G A;  4LK0 F;  3G73 A;  5H6R A;  3I59 B;  4ETS A;  4ON0 A;  1W7P A;  4XSX F;  5J8C A;  2M45 A;  2STT A;  4K2E A;  2Y75 A;  2ZCW A;  5JR3 A;  3WG9 A;  1V3F A;  3CUQ C;  1ZGA A;  4EJT A;  1YLF A;  3KP6 A;  3T5X A;  4IF4 A;  2OZ6 A;  3ZMT A;  2PG4 A;  5IT9 Z;  2GXB A;  2IA1 A;  3HSF A;  2ZME A;  3KP5 A;  3I53 A;  4L5I A;  5AIP A;  5J6X A;  2D2W A;  2IA2 A;  1U5T B;  1G3T A;  2BEO A;  2NS0 A;  3V8L A;  2PQ8 A;  2FF4 A;  3MZH A;  1FY7 A;  5IT9 K;  3V8J A;  4G7O F;  4LK1 F;  4LG0 A;  5K5R A;  4KDP A;  2UXN A;  3RYP A;  4F7Z A;  3RKY A;  3H92 A;  2B0L A;  5HLI A;  4KFC A;  2YX7 A;  3WGG A;  1R36 A;  4Q5S F;  3VOE A;  3V4G A;  1GHC A;  1J2X A;  4NQW A;  1KU9 A;  2A61 A;  3QOP A;  1UHW A;  3LA7 A;  5DDG A;  2FXA A;  2DTR A;  1U5T A;  1DDN A;  4A12 A;  3DPT A;  3JSO A;  4MTD A;  2RVC A;  2M5W A;  3PQK A;  4AD9 A;  2DPU A;  2DBB A;  4ENK A;  1UST A;  5E20 A;  1IXS B;  3QU6 A;  1FLI A;  5DUI A;  1DPU A;  3F8N A;  4M9S A;  4HV6 A;  3MFK A;  2P6S A;  2E7X A;  2A6H F;  3F8F A;  2CGP A;  1F4K A;  4IJA A;  5KVR A;  2CW0 F;  1T98 A;  2NNY A;  1IRG A;  5FFX A;  3BJ6 A;  4FX0 A;  3V8K A;  3K1P A;  2WV0 A;  1FYM A;  1YG2 A;  3EYY A;  1SFE A;  3JTH A;  4ZZD A;  1YIO A;  4OMY A;  1FBU A;  2FQ3 A;  2RQP A;  2F5D A;  4LFU A;  3SHF A;  3P9K A;  1FYL A;  2CFX A;  4LLG F;  4KYW A;  4KUM A;  2HFH A;  3TDU C;  5ILV A;  1LEA A;  2ADU A;  4LD5 A;  1O3R A;  2IPQ X;  4WCG A;  3T8T A;  1RIO H;  2RGV A;  4XSZ F;  4EJV A;  1U3E M;  2K7L A;  1J75 A;  3RIR A;  4LB6 B;  1R1V A;  3KZZ A;  2MC3 A;  3HTU A;  5HS8 A;  5H20 A;  3HUG A;  1FOK A;  3K0L A;  2L4A A;  1YFH A;  3V7C A;  2H94 A;  4OIP F;  2EWN A;  4DNC A;  2W85 A;  3WOD F;  1GXQ A;  3FF5 A;  1Z9C A;  3R6S A;  4QWQ A;  4XLP F;  4LLN A;  2V1U A;  5L3E A;  1U5T C;  2DQL A;  1D8J A;  1MKM A;  3RTR A;  2QM3 A;  5L3F A;  1U8R A;  3HHG A;  4FHT A;  4Y15 A;  2ESH A;  2Z99 A;  3QRF F;  3HRU A;  3HRM A;  3JSP A;  2IRF G;  4I0A A;  3W6J B;  3SQN A;  1LEB A;  4I02 A;  5D6F A;  1O3S A;  3FMR A;  3HOS A;  2VT3 A;  1I27 A;  4R79 A;  5F6F A;  4UVB A;  2ZNY A;  2VT2 A;  1FWZ A;  3FXU A;  2UWM A;  4RB2 C;  1W5T A;  1IAW A;  4MGR A;  3IRR A;  3ZN1 A;  5L3G A;  4GO1 A;  1ZG3 A;  4ZH4 F;  1WKM A;  3MWM A;  4HX8 A;  1XCV A;  4MQ9 F;  4A0X A;  1YS6 A;  3VEP A;  2XAS A;  2OZU A;  2M30 A;  1IRF A;  1J7K A;  4JQF A;  4A5N A;  2L02 A;  1TW2 A;  1XGN A;  2P5K A;  3KE2 A;  3GX4 X;  1Y0U A;  2MA3 A;  2WTE A;  2VON A;  3GVA A;  3WTS C;  2PI0 A;  1R1U A;  4CYD A;  1IXR C;  2DT5 A;  4CZZ A;  2J5P A;  1I5Z A;  3CO6 C;  4UV8 A;  1Z6T A;  1EH7 A;  1R22 A;  2EA2 A;  4U7B A;  4EM1 A;  2XAJ A;  1ZRF A;  1KYZ A;  2FA5 A;  4GYI A;  5KK1 A;  1P4A A;  3TO6 A;  2K4J A;  5D5U B;  2RV8 A;  3RKX A;  4A2U A;  2IT0 A;  1XSD A;  5ICG A;  2V1X A;  4HDV A;  3I5U A;  3RJP A;  4MEY F;  1F9N A;  3LA3 A;  5DUK A;  4M9Z A;  1H9T A;  1IN6 A;  1LDD A;  4ESJ A;  2P7C B;  2IA0 A;  1TNS A;  3WTT C;  4L0Z B;  2DO7 A;  2L3D A;  1W4M A;  3GUD A;  4L9T A;  2BYV E;  5AON A;  1J5Y A;  3HSR A;  1XGS A;  2V6C A;  2XIG A;  2VOO A;  2KIU A;  1FSH A;  3V7R A;  4ASN A;  1FP2 A;  1QZZ A;  2D1H A;  4HF1 A;  4OIR F;  1OYI A;  4HX7 A;  1MGT A;  1WWX A;  2EB7 A;  5TJJ A;  3T1B A;  1BIB A;  4HDU A;  3BZ6 A;  1T2K A;  1ZYR F;  4GXO A;  3ZMU A;  2K4B A;  3GW2 A;  1BBY A;  2DI3 A;  3KLN A;  2UZK A;  3TGN A;  4I2O A;  2QQA A;  2QUF A;  3KP3 A;  4LGW A;  3CDH A;  3ELK A;  4CDG A;  3TQN A;  1MZB A;  2ELH A;  4P5O A;  3WTZ A;  5ERI A;  1O7F A;  2XHK A;  4OIN F;  5D4S A;  4E70 A;  2UXX A;  3HYI A;  4GGG A;  4L18 B;  1IN8 A;  2GIV A;  3K1M A;  2E1C A;  1FX7 A;  3ABT A;  2FMY A;  4G6D A;  3IC7 A;  5E17 F;  3IKT A;  3GEZ A;  3SZP A;  1UB9 A;  4U88 A;  4NHJ A;  5L3B A;  1FP1 D;  1MD0 A;  3K2Z A;  2IJL A;  2MH9 A;  5D5X B;  4PZJ A;  5BMZ A;  1JGS A;  2MLG A;  4JBA A;  1BM9 A;  4I98 B;  4IRG A;  4P96 A;  4RAZ A;  1WRJ A;  4IHS A;  4OU0 A;  1XDU A;  2FBK A;  5CVR A;  1UHM A;  2PFB A;  3O3K A;  2HYG D;  1IW7 F;  5DEQ A;  2VC1 A;  2HR3 A;  3N97 A;  3ZPL A;  1ZG1 A;  1EH8 A;  4O6J A;  3GWZ A;  5JI6 A;  3BPV A;  1ON1 A;  3EUH A;  2V9V A;  5D6E A;  4AWX B;  1W7P B;  4ZYH A;  1LJ9 A;  2MD5 A;  3WTY C;  3IHU A;  2OD5 A;  1S3J A;  3F22 A;  2F5C A;  2K86 A;  2ACJ A;  1FYK A;  1AOY A;  2ZME B;  3ZQ7 A;  4QLC U;  3F8C A;  4G94 A;  2A68 F;  1C0W A;  2X0L A;  2GA1 A;  2LDU A;  1QQI A;  2VBZ A;  3OOP A;  4M72 A;  2RKH A;  4YIF A;  3EYI A;  1LNW A;  3G3Z A;  3FM5 A;  4XLN F;  3V7S A;  1B9M A;  4PGH A;  4CO8 A;  2L4M A;  3PFI A;  3RPU A;  1B1B A;  3I71 A;  1ZAR A;  2A07 F;  5D5W B;  1CGP A;  1U78 A;  5TRD A;  5LEK A;  4ESF A;  5J8F A;  3WE3 A;  2VC0 A;  1ON2 A;  4EM2 A;  1ODD A;  4Q48 A;  1J9I A;  3GF2 A;  2DQR A;  1IN5 A;  4L5J A;  1YQA A;  3WE2 A;  5K5Q A;  5IT3 A;  5LLQ A;  4G8X A;  4A0Z A;  3L7W A;  2KJB A;  3LWF A;  2JPB A;  5HDG A;  2LF8 A;  1XSX A;  3CTA A;  1FBS A;  4HQE A;  2FNP A;  3Q5F A;  3LQQ A;  3H3Z A;  3ERE D;  3HRS A;  1HW5 A;  6PAX A;  1ZRE A;  2CWE A;  4ZZL A;  3QPH A;  1T0F A;  1RUO A;  1EH6 A;  1BN5 A;  3M7G A;  5HS9 A;  3BWG A;  4CXF A;  2O03 A;  3FM3 A;  5ILS A;  4BH9 A;  2JZY A;  1F1Z A;  2BE5 F;  3E6D A;  2X4H A;  1HW2 A;  3F6O A;  3KFW X;  3GLX A;  1TQI A;  4HA8 A;  3RYR A;  3ISP A;  2E7W A;  2XKP A;  4KT5 C;  1BI1 A;  2VE8 A;  2G9W A;  3LQR A;  4AIH A;  2P6T A;  2K02 A;  3HRT A;  2NAZ A;  2QZ8 A;  2PLY A;  1R5G A;  5CVU A;  2FNA A;  1P4W A;  1DPR A;  2GZW A;  1XGM A;  4I7H A;  2P5V A;  4GCV A;  2H27 A;  2XAQ A;  4ZYE A;  2QYO A;  5DCF A;  1SAX A;  1CF7 B;  1ZLK A;  2O6G E;  1D3Y A;  2MLK A;  2Y0M A;  4Q4Z F;  1Z91 A;  4O5V A;  1OPC A;  5BPI A;  5EEG A;  4LLL A;  4L0Y B;  3P9C A;  1ONV A;  1E17 A;  3C3W A;  1YW7 A;  5E1W A;  2QLZ A;  2PN6 A;  2DPD A;  2M1B A;  1FNN A;  1I6X A;  1FZP B;  2Z9O A;  1SFU A;  2EV5 A;  3R60 A;  5LRR A;  2CSO A;  1OKR A;  2HDC A;  1S8N A;  4RB3 C;  1KYW A;  5LGN A;  1CF7 A;  1TQP A;  3QU3 A;  2EJR A;  3OV8 A;  3DFG A;  2A5Y B;  2XUB A;  3ML6 A;  5HDN A;  4Y13 A;  1IXC A;  3TO7 A;  1K6O A;  1XB4 A;  3L09 A;  5LHI A;  5DCM B;  1JE8 A;  4I01 A;  4MEX F;  4BQA A;  5L3D A;  3NEU A;  3M9A A;  1DUX C;  5DV5 A;  5ICF A;  1ZGJ A;  3MZY A;  5AIQ A;  1KQ0 A;  2OA4 A;  5FB2 A;  4A6E A;  3FMQ A;  1X3U A;  2H09 A;  4FX4 A;  2IVM A;  2JTV A;  1HQC A;  3W6K B;  1Q1H A;  5DCM A;  2Z33 A;  1ZLJ A;  3T0Y A;  2QVO A;  4EQQ A;  3HHH A;  4MTE A;  1O3Q A;  3KEQ A;  4WK8 F;  1S7A A;  1TNT A;  3WGH A;  4OMZ A;  4WWC A;  4EVI A;  4WF2 A;  4P55 A;  4HOB A;  1BI2 A;  5CVV A;  1TW3 A;  5LGT A;  3L00 A;  3ZMZ A;  1QZY A;  2XRO A;  2XGX A;  4M9X A;  3HSE A;  2ETH A;  5ICC A;  3R61 A;  1USS A;  2QEN A;  1O3T A;  3JW4 A;  4YFK F;  1KQ9 A;  2R3S A;  1BIA A;  2XKO A;  1T38 A;  4HBL A;  2LNB A;  3ABU A;  1IF1 A;  2EA4 A;  3E6M A;  1G4D A;  1REP C;  2L54 A;  1RNL A;  5ILU A;  1BOA A;  2XRN A;  2M87 A;  4RGU A;  4LB5 A;  4S04 A;  2XAG A;  2VOD A;  3GYH X;  2CO5 A;  1TQM A;  4A5M A;  3DP7 A;  4KIF A;  1I1S A;  3WTW C;  2Z3Y A;  4U7D A;  1BC7 C;  1VTN C;  2V1D A;  5LRS A;  5F64 A;  4CHU A;  3F72 A;  3O6B B;  2JSC A;  1HKQ A;  5JVT A;  3FXR A;  4ENN A;  5F1R A;  3KZY A;  2G7H A;  4YII A;  4L9J A;  1OYW A;  3F3X A;  1G3Y A;  1SD5 A;  4OIQ F;  3WTX C;  2H6C A;  2C6Y A;  2HOE A;  3QPT A;  4BNC A;  5DD8 A;  3VFZ A;  4O3M A;  4HX4 A;  1LDJ A;  2HKX A;  2O8X A;  3QP5 A;  4HLY A;  3LST A;  4YFX F;  2MH2 A;  2Q2E A;  4GYG A;  4IHT A;  2ZKZ A;  5LHG A;  1ZAO A;  2HWV A;  4UUV A;  3NQO A;  1B4A A;  1K79 A;  2LF7 A;  1SD4 A;  2A6E F;  1O57 A;  2YX4 A;  1NHA A;  3M8F A;  3BPX A;  1YS7 A;  1T39 A;  2L01 A;  3LFK A;  2ZFW A;  2MBF A;  3I54 A;  1RUN A;  3KEO A;  4UV9 A;  2G7U A;  3DV8 A;  5K1Y A;  4I0B A;  4CGZ A;  3R0A A;  2BV6 A;  4G7Z F;  4KN4 X;  2YU3 A;  5FD5 A;  1FBQ A;  3FMS A;  2R7D A;  2P4W A;  1H9G A;  3K9T A;  3QAH A;  3F21 A;  1JXS A;  2RNJ A;  3CUQ A;  3WU0 A;  5CJ9 A;  2PMU A;  4IXA A;  2EFP A;  3JTG A;  2KJC A;  4R8H A;  3BJO A;  2A3S A;  3REO A;  2JPC A;  2ISZ A;  2DK8 A;  2EV0 A;  1XSV A;  1XDS A;  2D45 A;  4EGZ A; 
#chains in the Genus database with same CATH topology
 1EKE A;  1PDN C;  2UV1 A;  3OYG A;  3EQL F;  3E97 A;  2O61 A;  1B6A A;  1MH4 A;  2L5Q A;  4OAY A;  4E7K A;  1GXP A;  4KMF A;  5L3C A;  2HEO A;  3MMY B;  3R0J A;  3OSF A;  4LMY A;  4Q47 A;  2DA2 A;  2P7V B;  4KN7 X;  3ECH A;  5E79 C;  1QVU A;  3OYH A;  1J0R A;  1P6R A;  3GXO A;  1V5F A;  3OWT A;  5DM7 F;  4AID A;  4EJO A;  4KIT B;  4NC7 A;  4ZYG A;  3KYC B;  1OYY A;  1XCB A;  3WTV C;  1R00 A;  2QEX I;  3RI4 A;  1HKT A;  1TLH B;  1SVM A;  2VKV A;  2QSG X;  5CPR B;  4HW0 A;  4JK1 X;  3JRA A;  1ZK8 A;  3I3L A;  1FPQ A;  2FOK A;  4KA4 A;  1OFC X;  4WX9 A;  1Y6I A;  1VQP I;  2LKS A;  3NWS A;  2R7R A;  4XLE A;  2DW4 A;  3Q0W A;  1IN7 A;  4W1U A;  3D1N I;  2CG4 A;  1H88 C;  3ASO H;  1VF9 A;  4MO7 A;  3ROU A;  1ZRD A;  1D1A A;  1YO5 C;  2HQN A;  1UCR A;  1QGP A;  2MFZ A;  2XVC A;  2L9V A;  2E1M B;  3H9J A;  1A6Q A;  4UUS B;  5EF6 A;  1D1B A;  2LK2 A;  3Q9V A;  1Y1V J;  2V79 A;  4CIC A;  2ZXJ A;  3LSK A;  2X6W A;  3H5A A;  3LSM A;  5CVI A;  2M3A A;  3P7N A;  1I1G A;  3VYT B;  1TBX A;  4UNO A;  2TDX A;  2X48 A;  4J19 A;  2GA2 A;  2KDO A;  2X51 A;  3U1D A;  1ZKG A;  3DQV C;  3LAJ A;  4B48 A;  1W5S A;  1MJ9 A;  2EIN H;  1LB2 A;  3P9I A;  2O3F A;  2XGC A;  1ZQ3 P;  3HOX J;  2LD5 A;  1QPI A;  2IS2 A;  2R7T A;  3CQZ J;  2ECB A;  3CDL A;  4AVP A;  2HNH A;  3FHN A;  1ETV A;  2EZH A;  5FKM A;  1WJB A;  3SZG A;  4CH7 A;  2D1V A;  2LR8 A;  3EDP A;  1QNT A;  4A3J J;  2EZK A;  4MNU A;  3DTI A;  1LVA A;  2ESN A;  2GBY A;  2BBY A;  4M74 A;  2WA0 A;  2XV4 S;  2QBY B;  4RB1 A;  4QTR A;  3CCM I;  2IS4 A;  2ZSI B;  2ZJQ F;  3VYS B;  3CLO A;  3WTU C;  3AAF A;  2VE9 A;  4GDF A;  2GAU A;  4P9F A;  5EG0 B;  4BHB A;  3N4M A;  4OOI A;  4IHY A;  2V9K A;  3R4K A;  2VBX A;  1D0Z A;  1MBK A;  2PBI A;  3QP6 A;  3J7A O;  5K7F A;  4RS8 A;  1ENH A;  2EV6 A;  4XRF A;  2HVQ A;  2P5L C;  3GTL J;  2ZBK A;  2CQK A;  1MMN A;  3BR5 A;  4P1W A;  2MG4 A;  3D5L A;  2FJ1 A;  2HXI A;  3OR1 C;  4DGW B;  5GAH J;  4MHG A;  3KP7 A;  3BTJ A;  1JHF A;  4LJZ F;  5FRN A;  4XLH A;  2Z5U A;  1YW8 A;  2OU2 A;  2NNN A;  4YG2 F;  1X19 A;  3C7J A;  2QBY A;  3TED A;  1XN7 A;  2F5E A;  2NVQ J;  2IP2 A;  1U9N A;  3I59 A;  3KCC A;  4YFN F;  5FD6 A;  1W7P D;  2JA2 A;  4M6X A;  3DPL C;  5GAE J;  2M0C A;  2KIQ A;  3HOT A;  1TP4 A;  5EG0 A;  5GP9 A;  1TWH J;  1G3S A;  1NK2 P;  2LSO A;  4UY8 I;  1W5C C;  3BJA A;  1GVJ A;  2CW8 A;  2I5U A;  2OBP A;  3VB2 A;  3BTL A;  2UUZ A;  3D5R C;  2H6B A;  2A05 A;  2VBY A;  3BY6 A;  2R5Z B;  4ESB A;  3DXJ F;  5FRO A;  1ZEL A;  2EIM H;  2HTJ A;  2W48 A;  2JA7 J;  3HOZ J;  1G59 A;  2OQG A;  3C2B A;  4HQM A;  4N9H A;  1BW5 A;  1LFB A;  3B6C A;  1B9N A;  3RKW A;  3CCR I;  2CYY A;  3HBL A;  4G6Q A;  2R92 J;  4IHV A;  3IH4 A;  3TOA A;  3BR0 A;  3LSR A;  1Y1W J;  2EFN A;  3M3Y J;  2EFO A;  2NVX J;  2YR2 A;  3FXQ A;  4ITV A;  2IS1 A;  1VQ5 I;  3GBG A;  3G4S I;  1IG7 A;  4UVA A;  1CQT A;  3CC2 I;  4ZYD A;  3S3M A;  4X6A J;  4F3Q A;  3ZMV A;  1ETW A;  4L9V A;  2Q0O A;  2OV7 A;  4NB5 A;  5FKO A;  5FKK A;  3T8R A;  3OYF A;  1SD6 A;  4EGY A;  2RAE A;  3E7L A;  1P2F A;  4D0P A;  4HV5 A;  4KNY A;  4C30 A;  3CP2 A;  2FRH A;  1OCP A;  4A0Y A;  1T95 A;  2V4J C;  1T56 A;  2P8T A;  2QWW A;  2RN7 A;  3VYU B;  4TV7 A;  4HLX A;  1A35 A;  3SEZ A;  1OCZ H;  1GLN A;  2NVY J;  4HZF A;  1Z7U A;  5M5Y J;  2E1N A;  3ZRG A;  1VND A;  4UXN A;  2E1M C;  2FUG 2;  4ENJ A;  1I6H J;  1FC3 A;  1R58 A;  3B02 A;  5BQT A;  3HOV J;  2VL8 A;  1E2X A;  1KU2 A;  3IKV A;  2M8E A;  4MQV A;  4DYC A;  1VFC A;  1MSF C;  2R7U A;  5BOX A;  1V54 H;  1T6S A;  2JSP A;  1Q1V A;  4A6D A;  3FBI B;  2Y2Z A;  2PMH A;  5HLT A;  4M73 A;  3OMY A;  1BW6 A;  3IWF A;  1SMT A;  2O0Y A;  3ZQF A;  1MMA A;  5CVJ A;  3LL7 A;  1FSE A;  1LUJ B;  2JVH A;  1RKW A;  1YYV A;  4E7J A;  5E3N A;  3KIO A;  4EV0 A;  5LEJ A;  1TL8 A;  2CUJ A;  1J09 A;  3FIS A;  4D7M A;  2EZI A;  5JHU A;  4XID A;  3PIO F;  3H35 A;  1FOY A;  5HOO A;  2HGC A;  5HVQ C;  2EFQ A;  3OSG A;  4XM3 A;  3CMM A;  1LQ1 A;  2ISY A;  1VQ4 I;  3H9Q A;  3KP2 A;  4S0H B;  5FO5 A;  3OYC A;  3DEU A;  4C9Y A;  5KNL A;  1MJB A;  4U0W A;  2XSD C;  2IGO A;  3BTC A;  3KET A;  3CUO A;  1R4M B;  1ZRC A;  3ZXS A;  4PCQ A;  4A93 J;  2FML A;  4L9N A;  5IP7 J;  1HKS A;  2XB5 A;  2DYR H;  3HXL A;  1JKR C;  4M71 A;  1AWC A;  5FGM A;  1FJL A;  3H0D A;  2HKO A;  5CLS A;  1T0F C;  4IVN A;  2MD0 A;  2YSR A;  1SMY F;  4M3F A;  2R7V A;  1TTY A;  3K7A J;  2VXZ A;  1JUM A;  2BXY A;  2PJP A;  2H1K A;  3HOU J;  2JRT A;  3F8B A;  1FTZ A;  1WJD A;  2XRL A;  1Z6R A;  1GVD A;  1F36 A;  3NAU A;  2OAZ A;  2X85 A;  1SVO A;  1KU3 A;  4KIB A;  2HTS A;  2XAH A;  1S7O A;  1U2W A;  1HW1 A;  3M8E A;  4G9Y A;  4CA0 A;  4U0Y A;  1SFX A;  3KLO A;  3ZMS A;  4BDY A;  1ULY A;  1D8K A;  2YUS A;  3OL3 A;  2B63 J;  2TCT A;  5F0H A;  2WBM A;  2DMP A;  1IUF A;  4Y7N J;  2V7F A;  1EF4 A;  5E18 F;  2DFE A;  4IKF A;  1QO0 D;  1T08 B;  1S6L A;  1ZR4 A;  4HEA 2;  1RET A;  1X3Z B;  2KIF A;  1WQ2 A;  1V4R A;  2VOP A;  3GO5 A;  1PP7 U;  1AA7 A;  3VOD A;  3MQ0 A;  4WXC A;  4FIS A;  4JP0 A;  4UB8 C;  3MKZ A;  5LHH A;  1WSU A;  2CV2 A;  4LIT A;  2HOT A;  3DTK A;  3BDD A;  2KRF A;  3IL2 A;  1JI8 A;  1G3W A;  1S29 A;  3M07 A;  2F4I A;  2W24 A;  5E8G A;  1MJA A;  3KYD B;  2Q8K A;  3VSL A;  3HIF A;  1W0T A;  4N9I A;  2W7N A;  3CCQ I;  1HBX G;  3HPH A;  2FE3 A;  4WXD A;  3FXM A;  5DTD A;  3ZN0 A;  3OS2 A;  4ZTF A;  3L9F A;  1MIJ A;  3C18 A;  4ZJZ A;  3AG1 H;  2WWY A;  4HF0 A;  1A5J A;  2KDZ A;  4RAY A;  5KCM A;  4UHT A;  4B09 A;  1F5T A;  1OR7 A;  1LKX A;  2CFO A;  1XX5 A;  3AL0 B;  2STW A;  4RGX A;  4B8X A;  4RGR A;  5HLG A;  4PDK A;  1AKH B;  3H3U A;  3LFU A;  1OCR H;  3VYR B;  2XAF A;  3J7Z I;  1UJ8 A;  2QQB A;  3GFM A;  4U0V A;  3ABL H;  1WJA A;  2Z2S B;  1Y56 A;  2J5O A;  4HYE A;  4FT8 A;  2RC4 A;  2GWR A;  3GZ6 A;  3E6B A;  1YTY A;  1ETY A;  3M1E A;  3ECO A;  4B3A A;  4AM3 A;  3CJT B;  3I58 A;  2HS5 A;  3QOD A;  3GTJ J;  3WU1 B;  4J01 A;  3FZV A;  1RR8 C;  3TOB A;  4JX4 A;  3IP4 B;  3DEW A;  2ZJP F;  3EET A;  4P9U A;  1P4X A;  2W84 A;  3E5U A;  3SFZ A;  5D8L B;  3GZ5 A;  3U21 A;  3C1D A;  1B8I A;  1PP8 F;  4CCL A;  4CYC B;  3TW6 A;  3LAP A;  2V26 A;  5A2Q Z;  3JRF A;  1BC8 C;  2DFF A;  5LGU A;  3ZP5 A;  5FRM A;  5F04 A;  5FFZ A;  1FT9 A;  4OIO F;  2VBW A;  1JHH A;  2PJR A;  3E3V A;  2ZFU A;  4H0E A;  4YEL A;  4F91 B;  3HC7 A;  3FWE A;  2LC2 A;  2FBH A;  5C4X J;  5A2Q K;  1N75 A;  2R7W A;  1W36 D;  2LLK A;  2PX9 A;  2L7M P;  1J59 A;  4BE1 A;  5K5O A;  1YJ9 I;  2F2E A;  1Z1D A;  3DF8 A;  3PUB A;  1UMQ A;  5DD4 A;  1VQ9 I;  4G7H F;  1HSJ A;  5DYM A;  1R23 A;  2HYF A;  4F55 A;  1HST A;  3U9G A;  3ZMD A;  4N4N B;  3OYA A;  5KHD A;  3PUF A;  4RGS A;  2AS5 F;  2DLL A;  3DEE A;  3FKI J;  4AIK A;  1PUE E;  4XIC A;  1QBJ A;  2X1E A;  1ZHF A;  4E4H A;  3Q0U A;  2Q2E B;  5CYV A;  2X6Y A;  4BBR J;  2EIL H;  4XBF A;  1X1P A;  1ZN2 A;  3K70 C;  3COA C;  1DU0 A;  3SZT A;  2KQR A;  5LFA A;  1WI9 A;  4IX7 A;  3E6C C;  2F5F A;  1APL C;  5HS7 A;  1R1T A;  4XOT A;  1QPM A;  4J00 A;  1VQK I;  5FKN A;  2K27 A;  3FXO A;  2EK5 A;  1DP7 P;  2FSW A;  3B73 A;  1IN4 A;  3I64 A;  3WGI A;  2GXG A;  3HTS B;  4RB0 A;  4JX6 A;  1HXD A;  2E5Z A;  4KMU X;  2KIM A;  1KQ8 A;  2ZNZ A;  3E5Q A;  3I4P A;  2LKX A;  2DK5 A;  5D4R A;  4WXH A;  3SXY A;  4EJU A;  5BPD A;  3W6V A;  2BGC A;  3GTG J;  1IRZ A;  2A69 F;  3RDI A;  1O7L A;  1MSE C;  3MCZ A;  2HXO A;  2JT1 A;  4AUX A;  2O9L A;  2GOX B;  1K78 B;  2FU4 A;  2XPU A;  1K7A A;  5FLV A;  4A3F J;  4HAM A;  1X2N A;  4AIJ A;  3FHZ A;  3IV5 A;  3QYE A;  1LFU P;  2LKP A;  3Q9S A;  4CSW A;  3MKY B;  4BAY A;  4HRI A;  1UFM A;  1D5V A;  3BZK A;  4M6Y A;  2BHY A;  3KP4 A;  5GAG J;  4IPA A;  2QQ9 A;  5JFR A;  4CCM A;  4A3L J;  5LBQ A;  1WVR A;  1OCC H;  1O4X A;  3BG9 A;  4XMY A;  5ICE A;  2EFW A;  1A04 A;  2Y0S A;  1XMA A;  5E8I A;  2E71 A;  1QHG A;  2VUM J;  3J80 Z;  3BG5 A;  4BE2 A;  2JMW A;  4EMS A;  3CUQ B;  5E1Z B;  3GTK J;  1JKP C;  2IXS A;  4DBR A;  3CF2 A;  3E5X A;  5M5W J;  3CO7 C;  2DFI A;  2COM A;  2DMU A;  1XGO A;  1WFX A;  4D5F A;  1P92 A;  3F6V A;  5HDK A;  4CUG A;  3J80 K;  2F4O B;  3IUO A;  4A3M J;  3J81 Z;  2VQH A;  2WAQ A;  1MNE A;  3RPQ A;  3G71 I;  1PUF B;  1BJA A;  4Y17 A;  3K4M A;  3UNG C;  4BQO A;  1K78 A;  2NOJ B;  4IRI A;  1ETX A;  4S05 A;  3O2P E;  2OF7 A;  1JTX A;  3I4M J;  3J81 K;  4A3E J;  2HOA A;  2M2E A;  3AL0 C;  1P7J A;  3CD6 I;  1K83 J;  1LVK A;  3F8M A;  5ED4 A;  1ZG5 A;  1MDM B;  2ME0 A;  4BXU A;  2GQQ A;  1VQM I;  2IGN A;  3A2K A;  4HST A;  1MND A;  3O8H A;  1S72 I;  2WB1 A;  1YX3 A;  1L0O C;  3NRV A;  2HZT A;  3W2A A;  1OMI A;  2R7S A;  1KON A;  2W57 A;  1YW9 A;  2ELJ A;  3GME A;  1LDK B;  3EUA A;  5FLX Z;  5EEA A;  2QKL B;  3G6E I;  3Q0V A;  3QPS A;  4PJL A;  3SJM A;  2HVS A;  2E60 A;  3S3O A;  1BI3 A;  3KZI C;  2V9P A;  1Z3X A;  2WC2 A;  3ULQ B;  2IW5 A;  2LP0 A;  3IRQ A;  2R4G A;  3L2C A;  4PGG A;  2Y30 A;  4CZC A;  1XMK A;  3BRO A;  3BOQ A;  3F9K A;  4FE4 A;  3HEF A;  4JOM A;  2PEX A;  5J47 A;  5FLX K;  4D7N A;  4KIS A;  1IZ1 A;  3TO9 A;  1XD7 A;  2LTP A;  5FKL A;  3LSJ A;  4CCK A;  4IZZ A;  1ZH5 A;  1KZH A;  2BY1 A;  3D0S A;  1R7J A;  3KYL A;  1JJ6 C;  2EQR A;  1RPW A;  4PJM A;  4YRV A;  1RI7 A;  2VPL A;  2WAD A;  2OC6 A;  2O5R A;  2NXN B;  1FMW A;  3IWZ A;  2DOF A;  4PFP A;  2ZO4 A;  4IRH A;  2VJJ A;  4KIC A;  1MDM A;  3OIO A;  4EJW A;  1KU7 A;  3I0T A;  4BHP A;  3QOE A;  2X6X A;  2BHZ A;  2K40 A;  3RZO J;  4UVC A;  2OTJ I;  3JAM Z;  3F23 A;  1X1A A;  1FEX A;  4EM0 B;  3CJN A;  2FBI A;  3HGY A;  4I09 A;  4BHC A;  1IUY A;  4KJZ A;  1I50 J;  4ZDO A;  4N0B A;  5TGT A;  1KA8 A;  2RDP A;  2OQR A;  5J1Y A;  2BY0 A;  3FK7 A;  3QPL A;  3MEX A;  4R1H A;  4DQ2 A;  2JA8 J;  3K1N A;  4C2U A;  3JAM K;  5HLH A;  1NTC A;  2CU7 A;  2DAO A;  3MAJ A;  4ZDP A;  2I8D A;  1X1B A;  1BL0 A;  1FTT A;  1R5H A;  1Z05 A;  3AKZ A;  5D5V B;  2KP6 A;  3GFI A;  2E34 A;  5H6Q A;  3S2W A;  3U2R A;  2YPR A;  2HQR A;  2KKO A;  1YHQ I;  3G1O A;  1STZ A;  3FX3 A;  1BI0 A;  3AG3 H;  3TDZ C;  2VN2 A;  4BYY A;  3LA2 A;  4E7Z A;  1X4P A;  2ELK A;  2R7F A;  4W97 A;  5F08 A;  3TKY A;  5LD2 C;  1JKQ C;  2DU9 A;  2K9S A;  2Y48 A;  4M6V A;  4MFE A;  4XK4 A;  2M7A A;  3DKW A;  1PVE A;  5EEH A;  2R7X A;  3BP8 A;  2BVM A;  4ENM A;  3PO2 J;  2NVT J;  1EV7 A;  2NRA C;  3HG9 A;  1B59 A;  2AXL A;  2DA1 A;  1G6N A;  5BS6 A;  5IOY A;  1L3L A;  4KIG A;  1H0M A;  3GFJ A;  3ZQQ A;  1SC7 A;  1HDP A;  2ZJ2 A;  1RES A;  1KGS A;  1SD7 A;  5D8K B;  3HZJ A;  2K9N A;  5JLX A;  4I76 A;  2NYX A;  3K69 A;  4PSX A;  3C2H A;  2FEZ A;  2W25 A;  3GFL A;  4Z2Y A;  2FOW A;  3PQJ A;  1MBJ A;  4LG0 B;  1V5G A;  2VXD A;  5E1X A;  2XF7 A;  4B3X A;  2JA5 J;  4OWR B;  4HF2 A;  1PJR A;  1RZ4 A;  3FBN B;  4D1Q A;  2JK3 A;  1U6G A;  4QIW N;  2A5W A;  1WHU A;  4LK0 F;  1WJC A;  2EIJ H;  3IAS 2;  5H6R A;  3I59 B;  4PSW A;  3X2Q H;  4ETS A;  3G73 A;  3CCV I;  4ON0 A;  1OCT C;  1YJN I;  1W7P A;  1YIT I;  1IDZ A;  4XSX F;  5J8C A;  2M45 A;  2LY1 A;  2STT A;  4K2E A;  2Y75 A;  2ZCW A;  5JR3 A;  4RAG A;  3WG9 A;  1V3F A;  3CUQ C;  1ZGA A;  2ZSH B;  1ACI A;  4EJT A;  1YLF A;  3KP6 A;  4BBS J;  3T5X A;  4NQW B;  4IF4 A;  2OZ6 A;  3ZMT A;  2PG4 A;  3H5R A;  5IT9 Z;  1WH7 A;  2K85 A;  2GXB A;  2IA1 A;  3HSF A;  2DFH A;  2ZME A;  2HDD A;  3KP5 A;  2HVR A;  3JRD A;  3I53 A;  4L5I A;  5AIP A;  5J6X A;  2D2W A;  3SDB A;  2IA2 A;  1U5T B;  1G3T A;  2BEO A;  2NS0 A;  3V8L A;  2PQ8 A;  2FF4 A;  3MZH A;  2CQQ A;  2O7O A;  1FY7 A;  5IT9 K;  3V8J A;  4G7O F;  3S32 A;  3W2V A;  4LK1 F;  4LG0 A;  5K5R A;  1YI2 I;  3PM1 A;  4BY1 J;  1FIA A;  2B9S A;  4KDP A;  2UXN A;  3BR3 A;  3HKZ N;  3RYP A;  4N4O B;  4F7Z A;  3E1S A;  3CC4 I;  3RKY A;  2Y9Y A;  3LSI A;  2VIX A;  2CV0 A;  3BG6 A;  3D5S C;  3H92 A;  2B0L A;  3RPU D;  5HLI A;  4KFC A;  4PK4 A;  2IAI A;  3OYK A;  2YX7 A;  5DS9 A;  3WGG A;  3N05 A;  1R36 A;  5K7H A;  3OYB A;  3ERM A;  1ETQ A;  2ZJR F;  1SEU A;  2BY2 A;  3A01 B;  2L7K A;  2Y0S N;  3CC7 I;  4Q5S F;  4G12 A;  3VOE A;  2R93 J;  3V4G A;  1GHC A;  1J2X A;  3DKX A;  4NQW A;  1KU9 A;  2A61 A;  3QOP A;  2BVL A;  1UHW A;  2XAU A;  2O8K A;  3LA7 A;  5DDG A;  2FXA A;  2DTR A;  1U5T A;  4X1E A;  2X1C A;  1DDN A;  4A12 A;  3DPT A;  3RQI A;  1E0E A;  3JSO A;  4MTD A;  2DCE A;  2RVC A;  3BQY A;  2COB A;  2WAQ N;  2M5W A;  3PQK A;  4AD9 A;  2DPU A;  2DBB A;  2ID3 A;  4ENK A;  1UST A;  4FET A;  5E20 A;  1IXS B;  2KPM A;  3QU6 A;  2XDV A;  2KMU A;  2YS9 A;  1FLI A;  4YIR X;  5DUI A;  4IQ4 A;  1DPU A;  3F8N A;  3A4C A;  2JQ7 A;  1SVL A;  4M9S A;  3VDX A;  4ZYA A;  4HV6 A;  3A0B C;  3MFK A;  1X1C A;  1AHD P;  2P6S A;  2E7X A;  1K61 A;  3BG7 A;  2M8G X;  2A6H F;  3A02 A;  3F8F A;  4XRS A;  2CGP A;  5JHF A;  1F4K A;  4IJA A;  5KVR A;  1V55 H;  2CQX A;  2XF6 A;  1GV5 A;  2CW0 F;  1T98 A;  2WB1 N;  4A69 C;  2NNY A;  1X58 A;  1IRG A;  5FFX A;  3A01 A;  3BJ6 A;  4FX0 A;  3V8K A;  2W82 A;  4PJN A;  3PL8 A;  3ZQH A;  3K1P A;  2CS3 A;  1EA3 A;  2WV1 A;  1YG2 A;  2HI3 A;  2WV0 A;  1FYM A;  3DKY A;  4DBQ A;  3EYY A;  1OJL A;  3GTO J;  1SFE A;  3JTH A;  4F52 A;  3HUG B;  4RLQ A;  1FOX A;  4ZZD A;  1YE9 A;  2CUZ A;  1D5Y A;  1YIO A;  2F48 A;  4FQG A;  4OMY A;  1FBU A;  2FQ3 A;  3DBH B;  2RQP A;  2WY7 Q;  2F5D A;  2QF7 A;  4LFU A;  3SHF A;  3P9K A;  4DZJ A;  1FYL A;  2CFX A;  2I10 A;  4B44 A;  4LLG F;  1DGW Y;  5JVG F;  4KUM A;  4KYW A;  3K6G A;  2M34 A;  2W00 A;  2D5V A;  2CUF A;  2HFH A;  3TDU C;  3Q3S A;  5ILV A;  1LEA A;  2ADU A;  4LD5 A;  5GPC A;  1O3R A;  2IPQ X;  3L2Q A;  4WCG A;  5M5X J;  3T8T A;  4M3D A;  1RIO H;  2RGV A;  4XSZ F;  4EJV A;  1U3E M;  2K7L A;  3S15 J;  1J75 A;  2NS8 A;  3S14 J;  3RIR A;  4LB6 B;  1UG2 A;  2DA4 A;  1R1V A;  2HDW A;  3FK6 A;  3WG7 H;  3KZZ A;  3KX2 A;  3TP3 A;  3J7Y J;  4AVZ A;  2MC3 A;  2VLA A;  3HTU A;  3OYI A;  3GTM J;  5HS8 A;  5H20 A;  3CLQ A;  2VJI A;  3HUG A;  5J4Y A;  4XKV A;  2VQL A;  1FOK A;  2AQF A;  4XLC A;  4FCY A;  1NG7 A;  2PMZ N;  3JRH A;  3K0L A;  4NUB A;  2L4A A;  3ONQ A;  2E19 A;  2KIS A;  1YFH A;  3V7C A;  2H94 A;  4OIP F;  1JUS A;  4H4K C;  2EWN A;  4DNC A;  2W85 A;  3WOD F;  3L2R A;  1GXQ A;  3FKJ A;  2CV1 A;  4XN3 A;  3FF5 A;  4HG2 A;  3L2V A;  1Z9C A;  3R6S A;  2X9D A;  4QWQ A;  3HL2 A;  4XLP F;  4LLN A;  3FDY A;  2V1U A;  2M4G A;  1D0X A;  5L3E A;  1U5T C;  2DQL A;  3MKW B;  1D8J A;  1Z0X A;  5BNG A;  1MKM A;  4UUT A;  4CCN A;  1I3A A;  3RTR A;  4QPO A;  2G0E A;  2QM3 A;  5L3F A;  1R4N B;  1U8R A;  3HHG A;  4FHT A;  4Y15 A;  2ESH A;  2Z99 A;  3QRF F;  1RRJ A;  1YIJ I;  2BW3 A;  3HRU A;  3NWT A;  3HRM A;  2DTZ A;  1U9O A;  4NC8 A;  2OJE D;  3JSP A;  2GLO A;  1ZTR A;  3I55 I;  3BR2 A;  2IRF G;  4XN0 A;  3OOU A;  4I0A A;  2F5V A;  3AG4 H;  3W6J B;  4CCO A;  3SQN A;  3CMY A;  4MFD A;  1LEB A;  4I02 A;  5D6F A;  1R49 A;  2Y9Z A;  1O3S A;  3FMR A;  3S8P A;  3HOS A;  2VT3 A;  3BC8 A;  1I27 A;  3ZOB A;  2CRG A;  4R79 A;  5F6F A;  2DA6 A;  1SFK A;  3K4C A;  4UVB A;  1H8A C;  2M4K A;  4NDL A;  2XPV A;  4XR6 A;  1SFO J;  2VQG A;  2ZNY A;  3J7A Y;  2VT2 A;  3DBL B;  1B8I B;  2JWT A;  1FWZ A;  3H36 A;  3FXU A;  2UWM A;  1QU3 A;  4RA2 A;  4RB2 C;  1ETO A;  1W5T A;  4RBO A;  1IAW A;  4MGR A;  1TC3 C;  2CJJ A;  3IRR A;  3ZN1 A;  2PJR B;  2H8W A;  5L3G A;  3I56 I;  5GTI C;  4GO1 A;  4DIQ A;  3ZQL A;  1ZG3 A;  2L2O A;  4ZH4 F;  1WKM A;  3MWM A;  4XNF A;  4HX8 A;  1XCV A;  4MQ9 F;  2DJN A;  4A0X A;  4UB6 C;  3AFH A;  4HNU A;  1YS6 A;  2BY3 A;  3VEP A;  2XAS A;  2OZU A;  2M30 A;  2BOL A;  4NC6 A;  1IRF A;  1UZC A;  2Z16 A;  3K70 D;  1J7K A;  3SDG A;  2E2I J;  5IYB J;  2CQ7 A;  2OCC H;  4JQF A;  3PSF A;  1RR7 A;  2OCE A;  4A5N A;  1TWF J;  4ZC3 A;  2L02 A;  1TW2 A;  1XGN A;  2P5K A;  5IYD J;  3KE2 A;  5EYR A;  3GX4 X;  1G8X A;  1Y0U A;  2MA3 A;  1TWA J;  2VJ5 A;  2WTE A;  2VON A;  2F6C A;  3GVA A;  3WTS C;  4A3B J;  2PI0 A;  5HOD A;  1R71 A;  1TT0 A;  1PYV A;  1R1U A;  3OR2 C;  4CYD A;  4XRS G;  1QRY A;  4V19 K;  1A6I A;  1IXR C;  3S1N J;  2DT5 A;  4BE0 A;  4CZZ A;  1UHS A;  2B7E A;  2J5P A;  1I5Z A;  3K10 A;  3CO6 C;  2R7Z J;  5TIS C;  1HLV A;  1WGX A;  4E6K G;  5IOZ A;  4CCJ A;  4UV8 A;  1Z6T A;  1EH7 A;  1IV8 A;  4RM3 A;  1IJW C;  4C3I J;  1R22 A;  1OCO H;  3CCL I;  2LY9 A;  2EA2 A;  5C44 J;  4U7B A;  5GTH C;  1BR1 A;  4EM1 A;  1YJW I;  3OIQ A;  2XAJ A;  1ZRF A;  1KYZ A;  2FA5 A;  5IP6 A;  2XSJ C;  3H9G A;  4GYI A;  5KK1 A;  2P0W A;  4FE7 A;  3LMM A;  1P4A A;  3TO6 A;  1UAA A;  3GTQ J;  2K4J A;  5D5U B;  1S5L C;  2RV8 A;  3RKX A;  4A2U A;  4G6T B;  2IT0 A;  4BJT A;  3OYM A;  1XSD A;  2AXT C;  3BR1 A;  5ICG A;  1E3P A;  2V1X A;  4NBQ A;  4HDV A;  3ZQG A;  3I5U A;  2L7F P;  1DQU A;  1V5E A;  2AO9 A;  1DU6 A;  2LY2 A;  4NNJ A;  3RJP A;  4MEY F;  3KPH A;  3A1Y A;  3DCF A;  1F9N A;  4RM2 A;  3LA3 A;  5DUK A;  4M9Z A;  1H9T A;  1IN6 A;  1LDD A;  1QHH D;  4ESJ A;  1WJE A;  1SAN A;  4V2F A;  2P7C B;  3QWL A;  2IA0 A;  3RSN A;  1T8I A;  1TNS A;  3WTT C;  3BQZ A;  5EZH A;  4L0Z B;  2DO7 A;  2L3D A;  1W4M A;  3GUD A;  4L9T A;  2BYV E;  5AON A;  2DOA A;  1J5Y A;  1I39 A;  1MBE A;  1N77 A;  3HSR A;  1XGS A;  2EPF A;  1E3O C;  2V6C A;  2WAE A;  3HKZ A;  1OR7 C;  2XIG A;  2VOO A;  2KIU A;  2HQA A;  1FSH A;  2DOD A;  2KRH A;  3V7R A;  4ASN A;  2ID6 A;  3JRC A;  1FP2 A;  1Y39 A;  4XOR A;  4RAF A;  1QZZ A;  1XMX A;  2D1H A;  1XG1 A;  3MD2 A;  4HF1 A;  2XB0 X;  4OIR F;  2R5Y B;  4B43 A;  3CZ6 A;  1OYI A;  2LYC A;  1SAU A;  2L9N A;  2QCO A;  4HX7 A;  3JRB A;  1MGT A;  3DU6 A;  5KAI C;  1WWX A;  1YX5 A;  2EB7 A;  5HNH A;  5F0F A;  3VPR A;  2GOM A;  5TJJ A;  4C3H J;  3T1B A;  2DA3 A;  1BIB A;  4HDU A;  3V42 A;  3BZ6 A;  1T2K A;  1VQN I;  1ZYR F;  3K2A A;  4KT6 A;  3PJR A;  5F0C A;  4GXO A;  3ZMU A;  1BR2 A;  2K4B A;  3GW2 A;  3M8J A;  1BBY A;  3OS1 A;  2DI3 A;  2KZG A;  3KLN A;  3DWL E;  3L1P A;  2UZK A;  5E3O A;  1JGG A;  3S3N A;  3CCU I;  1WZ2 A;  3TGN A;  4I2O A;  2QQA A;  5C3E J;  2QUF A;  4BQN A;  3OL4 A;  3KP3 A;  4LGW A;  3CDH A;  3DTE A;  3ELK A;  3TP0 A;  4CDG A;  3TQN A;  1MZB A;  2DMT A;  2ELH A;  3H0G J;  4P5O A;  3WTZ A;  5ERI A;  1O7F A;  1T33 A;  2XHK A;  4OIN F;  4DJA A;  1M1E B;  5D4S A;  4BAC A;  4E7S A;  5IP9 J;  1IV6 A;  2EH3 A;  4E70 A;  1IGN A;  2UXX A;  2R5Y A;  3M4O J;  3HYI A;  4GGG A;  4L18 B;  1IN8 A;  2GIV A;  3K1M A;  1HF0 A;  2E1C A;  4BGD A;  3RCO A;  1FX7 A;  3ABT A;  3OYN A;  2FMY A;  3EPZ A;  4G6D A;  3HJE A;  3IC7 A;  2DA7 A;  5E17 F;  1ZR2 A;  1XPX A;  3IKT A;  3GEZ A;  3H5N A;  4IO9 F;  2QQ8 A;  3SZP A;  1UB9 A;  1ORK A;  1VQ7 I;  2DMN A;  4U88 A;  4NHJ A;  5L3B A;  2LOO A;  1YRN A;  4C2T A;  1FP1 D;  1MD0 A;  3K2Z A;  1XS9 A;  4XL9 A;  1IC8 A;  2IJL A;  2MH9 A;  1K4T A;  5D5X B;  4PZJ A;  3TW7 A;  1S7E A;  3ABK H;  2L9S A;  5BMZ A;  3PO3 J;  2IGM A;  2ZXW H;  1JGS A;  2MLG A;  1A31 A;  2M7B A;  2MSY A;  4JBA A;  4BS9 A;  2K3P A;  2VAS A;  1BM9 A;  3BZC A;  2DT6 A;  4I98 B;  4IRG A;  4IL6 C;  4P96 A;  4RAZ A;  3DLL F;  1VQ6 I;  1HC8 A;  1R9T J;  1WRJ A;  2XGD A;  3ZQI A;  4IHS A;  4OU0 A;  1D1C A;  1OIS A;  2KT0 A;  1XDU A;  2JA6 J;  2FBK A;  5CVR A;  1UHM A;  2M0M A;  2RQQ A;  3WHB A;  2PFB A;  1OQY A;  3O3K A;  2HYG D;  4B1R A;  1IW7 F;  5DEQ A;  2VC1 A;  2JN6 A;  2HR3 A;  3N97 A;  5M3F J;  1LE8 A;  3ZPL A;  2MGQ A;  1ZG1 A;  2LRE A;  1G2H A;  1EH8 A;  3CCS I;  3BT9 A;  3F0C A;  3GWZ A;  4O6J A;  5JI6 A;  3BPV A;  1ON1 A;  4ZDL A;  4IHX A;  2PMZ A;  4GFB A;  3EUH A;  4XOP A;  3G1L A;  3I4N J;  2V9V A;  5D6E A;  3MVP A;  3QYF A;  1B72 A;  2GM4 A;  3PFY A;  4AWX B;  1W7P B;  4AYB A;  4F92 B;  1Y0N A;  2OTL I;  4ZYH A;  3QQA A;  1YOV B;  1LJ9 A;  1GV2 A;  1N78 A;  2MD5 A;  3HPG A;  4BQQ A;  3WTY C;  3IHU A;  4LIU A;  2DJI A;  2OD5 A;  1S3J A;  2ZB9 A;  4ANJ A;  2IBD A;  3F22 A;  3S17 J;  2F5C A;  2K86 A;  2ACJ A;  1FYK A;  5B5E C;  4XLA A;  1AOY A;  2ZME B;  2HU9 A;  3U1K A;  3ZQ7 A;  4QLC U;  3F8C A;  4G94 A;  2A68 F;  3TBI A;  4XKC A;  1C0W A;  2X0L A;  1IO2 A;  2GA1 A;  1IRX A;  1N25 A;  1QQI A;  2LDU A;  3CJR B;  3H1C A;  3H3V K;  2VBZ A;  2LMD A;  5EGO B;  3OOP A;  4L5E A;  1BR4 A;  4HPQ A;  4M72 A;  2RKH A;  2WY8 Q;  3K4B A;  4YIF A;  4PJ0 C;  3EYI A;  1LNW A;  3P5J A;  2VPR A;  2R7Q A;  5J40 A;  1K4S A;  3G3Z A;  5B1A H;  5JLW A;  3FM5 A;  3LSP A;  4XLN F;  3V7S A;  1B9M A;  3IH2 A;  3HM5 A;  4PGH A;  5CQE A;  4CO8 A;  2L4M A;  3B6A A;  3PFI A;  3RPU A;  3ZCO A;  1B1B A;  3I71 A;  3W2W A;  1WJ5 A;  1ZAR A;  1BJZ A;  4LIV A;  2A07 F;  5D5W B;  3BR6 A;  2H1L A;  2KRC A;  4IOA F;  2EBI A;  4RMN A;  1CGP A;  2Q1Z B;  3NAR A;  1U78 A;  5TRD A;  3BLY A;  5LEK A;  4ESF A;  4BL0 B;  1I3Q J;  5M3M J;  4UUS A;  5J8F A;  3WE3 A;  2VC0 A;  4XKB A;  4BKX A;  3UR3 C;  1ON2 A;  4EM2 A;  3GZN B;  4M3G A;  5EGO A;  1ODD A;  2DT7 B;  3MKL A;  4Q48 A;  1J9I A;  2OUM A;  3GF2 A;  4II3 A;  4AU7 A;  1HA8 A;  2DQR A;  5KAF C;  3BCB A;  1UEL B;  4DW6 A;  1IN5 A;  4L5J A;  1RKT A;  1YQA A;  3WE2 A;  1GUU A;  1POG A;  2E2J J;  4LOC A;  5K5Q A;  5IT3 A;  5LLQ A;  2QSH X;  4G8X A;  2ME6 A;  4MIM A;  4BDZ A;  4A0Z A;  4U87 A;  5B1B H;  3L7W A;  4A3G J;  2KJB A;  3GCM A;  1H89 C;  2IGK A;  2CW7 A;  3LWF A;  2JPB A;  3ZQC A;  5HDG A;  1WJF A;  2LF8 A;  3OIP A;  1XSX A;  3CTA A;  3TL4 X;  1FBS A;  4HQE A;  2FNP A;  3AG2 H;  3Q5F A;  3CMA I;  4HNT A;  1X2M A;  1Z67 A;  3H3Z A;  3LQQ A;  3ERE D;  3HRS A;  1HW5 A;  6PAX A;  2CUE A;  3EUH C;  1ZRE A;  2CWE A;  3A0H C;  4XKW A;  1U8B A;  4ZZL A;  3QPH A;  1T0F A;  2VKH A;  1EH6 A;  4AC0 A;  1RUO A;  2CQN A;  2LH9 A;  2ZXH A;  1BN5 A;  4E7L A;  2KFD A;  3O8G A;  3M7G A;  5E3L A;  5HS9 A;  3BWG A;  4CXF A;  2O03 A;  3FM3 A;  3CJQ B;  1HCR A;  5ILS A;  4X0G A;  4BY7 J;  3VSK A;  4BH9 A;  2JZY A;  1F1Z A;  2HPM A;  2LRD A;  1WI3 A;  3FXJ A;  2BE5 F;  3E6D A;  2X4H A;  2BZT A;  4LG3 A;  3G2B A;  3WHC A;  2TRT A;  5J1U A;  2VJ4 A;  4JYK A;  1HW2 A;  3E0J B;  3F6O A;  3KFW X;  4IOC F;  3GLX A;  1TQI A;  2KZV A;  4HA8 A;  4Y4R A;  5E3M A;  1VQO I;  3RYR A;  3HOW J;  3CCJ I;  1Y8R B;  2E7W A;  2XKP A;  3ISP A;  3TMO A;  3FIW A;  2FQ4 A;  2HPI A;  4KT5 C;  1BI1 A;  5DM6 F;  2ECC A;  2VE8 A;  1MBH A;  2G9W A;  1ETK A;  3LQR A;  4AIH A;  2R7O A;  1X3W B;  2P6T A;  2K9Q A;  2K02 A;  3GLL A;  2DMQ A;  2E36 A;  2KL4 A;  3ZGK A;  3CF5 F;  4QSH A;  3HRT A;  2DOE A;  2NAZ A;  2QZ8 A;  2PLY A;  2K9M A;  1R5G A;  5CVU A;  2R5Z A;  3S16 J;  2FNA A;  3S93 A;  2Y31 A;  1P4W A;  2E2H J;  2JUG A;  1DPR A;  2GZW A;  3HDD A;  2ZME C;  1XGM A;  2MW8 A;  2BXZ A;  4I7H A;  4D5C A;  2P5V A;  3HOY J;  4GCV A;  5IPA A;  2NOG A;  4GRI A;  2QA4 I;  2H27 A;  4V2G A;  4A3C J;  9ANT A;  2XAQ A;  4ZYE A;  5IYC J;  2QYO A;  5C4J J;  5DCF A;  1SAX A;  2L0K A;  1CF7 B;  1ZLK A;  2O6G E;  1U0J A;  1D3Y A;  3K4J A;  2MLK A;  3PNT A;  2Y0M A;  2BW3 B;  4Q4Z F;  1AU7 A;  1R6R A;  3FXL A;  3M1C A;  1NH3 A;  1Z91 A;  1Y8Q B;  2HOS A;  4II2 A;  4RDU A;  3GTP J;  4O5V A;  1OPC A;  5BPI A;  5EEG A;  4LLL A;  4L0Y B;  1NK3 P;  3P9C A;  1ONV A;  2DXI A;  1LPQ A;  1E17 A;  3C3W A;  1YW7 A;  5E1W A;  2QLZ A;  4AYB N;  2PN6 A;  3BCA A;  2DPD A;  2Z1D A;  2M1B A;  1FNN A;  3LOC A;  3RQ4 A;  2QKM B;  1I6X A;  1FZP B;  2DA5 A;  1VQL I;  2Z9O A;  1SFU A;  3ABM H;  1MMD A;  1FIP A;  2EV5 A;  4Y3O A;  3PSI A;  5CQG A;  3R60 A;  3CP8 A;  3RZD J;  5LRR A;  1VI0 A;  4I6Z A;  3I9V 2;  4DYQ A;  2FX0 A;  2CSO A;  1W0U A;  2JVG A;  1OKR A;  2HDC A;  1JKO C;  1S8N A;  2QSF X;  2E1O A;  5EZG A;  4RB3 C;  1KYW A;  1MH3 A;  5LGN A;  2H8R A;  2JUC A;  1CF7 A;  1X4O A;  1TQP A;  3QU3 A;  2EJR A;  3DLA A;  2JJ7 A;  3OV8 A;  5J4V A;  3DFG A;  2DDA A;  2A5Y B;  3OYE A;  4YEJ A;  2XUB A;  3ML6 A;  5HDN A;  1P7I A;  2N8G A;  2XPW A;  2IEK A;  1IXC A;  3TO7 A;  4Y13 A;  3LNQ A;  2E5N A;  1K6O A;  5GAD J;  5J3L A;  3WU2 C;  1XB4 A;  3L09 A;  5F27 A;  5LHI A;  5DCM B;  2LBF B;  2A6T A;  3K4K A;  3DPU A;  5FLM J;  1JE8 A;  4I01 A;  4XLF A;  2KHM A;  2V6E A;  2CMP A;  1GT0 C;  4MEX F;  4BQA A;  5L3D A;  3NEU A;  3M9A A;  3S1M J;  5J1R A;  3L2W A;  5DV5 A;  1DUX C;  5ICF A;  1ZGJ A;  4QPQ A;  5B66 C;  4BJ5 C;  5HNF A;  3MZY A;  5K7Z A;  1P9Q C;  4HNV A;  5AIQ A;  1KQ0 A;  4IHW A;  4PJJ A;  5EDN A;  1QA6 A;  2OA4 A;  5FB2 A;  1Z77 A;  4A6E A;  3FMQ A;  1XC5 A;  3C2G A;  1X3U A;  2H09 A;  4FX4 A;  2IVM A;  2XC7 A;  4ABZ A;  2JTV A;  3S1R J;  3K4N A;  1HQC A;  3W6K B;  3KEY A;  2XF5 A;  3LSG A;  5H2F C;  4DYR A;  4RLF A;  1Q1H A;  5DCM A;  2Z33 A;  1ZLJ A;  2LBF A;  3S1Q J;  3CME I;  1X1D A;  3T0Y A;  1EJ9 A;  4I99 C;  5F1J A;  2QVO A;  4EQQ A;  3HHH A;  4MTE A;  1O3Q A;  3KEQ A;  1ERD A;  4WK8 F;  1S7A A;  1TNT A;  2F4M B;  3WGH A;  4OMZ A;  4HSR A;  4WWC A;  4DOZ A;  2QGU A;  1BOB A;  3JR9 A;  4EVI A;  2EZL A;  1WPK A;  4D9J A;  3S2H J;  4WF2 A;  4P55 A;  1LFP A;  4Y52 J;  3G1M A;  2GXA A;  4HOB A;  1BI2 A;  5CVV A;  1TW3 A;  5LGT A;  1WCM J;  2ZC2 A;  3L00 A;  2R0Q C;  4BXF A;  4OAZ A;  3QYB A;  4BXX J;  2NVU B;  1QZY A;  3ZMZ A;  1Z21 A;  2XGX A;  2XRO A;  4M9X A;  1RC9 A;  3SEQ A;  1W1W E;  2RRE A;  3RKQ A;  3OYL A;  3HSE A;  3FXK A;  1NG6 A;  2VQC A;  2ETH A;  5ICC A;  3R61 A;  2AQE A;  3JCU C;  1USS A;  2QEN A;  1O3T A;  5IY5 H;  3JW4 A;  4YFK F;  4EAT A;  1KQ9 A;  3CES A;  3IH3 A;  2R3S A;  3DBR B;  2X1D A;  1VQ8 I;  1BIA A;  2XKO A;  1IDY A;  3JRI A;  1T38 A;  4HBL A;  1ZGW A;  2LNB A;  2LVS A;  4BUP A;  3ABU A;  2JRM A;  1IF1 A;  2EA4 A;  3E6M A;  4Z6Y A;  1G4D A;  1AKH A;  1REP C;  2L54 A;  1RNL A;  2P81 A;  5ILU A;  1BOA A;  2XRN A;  2M87 A;  4RGU A;  4LB5 A;  4S04 A;  2XAG A;  2VOD A;  3GYH X;  1K6Y A;  2CO5 A;  4IQJ A;  1DGR M;  1TQM A;  4A5M A;  3DP7 A;  4KIF A;  1I1S A;  3WTW C;  1Z7L A;  2Z3Y A;  4BU2 A;  1GDT A;  1Z3Y A;  4U7D A;  1BC7 C;  2L7Z A;  3SYT A;  4XRM A;  1VTN C;  2V1D A;  2W4S A;  2XGE A;  4PUS A;  4BEH B;  1A36 A;  5LRS A;  5F64 A;  2M9H A;  3F72 A;  4CHU A;  3O6B B;  1OLT A;  1TWG J;  2JSC A;  1FOW A;  1HKQ A;  4BJ6 C;  4FAS D;  5JVT A;  3FXR A;  1E3H A;  3CCY A;  4MLO A;  4ENN A;  4CYC A;  5F1R A;  1FMV A;  3KZY A;  3MN2 A;  2G7H A;  3ESW B;  4EEF G;  4YII A;  2HYJ A;  4L9J A;  1QZE A;  2HZD A;  1OYW A;  4C2M J;  3L2U A;  1VZ0 A;  2KLO A;  3F3X A;  4E7H A;  1TT5 B;  1DP3 A;  1G3Y A;  2ICW G;  2ZXI A;  1SD5 A;  3JRE A;  3DU5 A;  4OIQ F;  2OPT A;  3WTX C;  3BG3 A;  2H6C A;  2C6Y A;  1WH5 A;  1MMG A;  4JX5 A;  1R5I D;  2HOE A;  4M3B A;  3PNV A;  2DDB A;  3QPT A;  3ASN H;  4BNC A;  5DD8 A;  2VI6 A;  4PFO A;  1W36 C;  3VFZ A;  4O3M A;  2VKE A;  4HX4 A;  1LDJ A;  3S2D J;  4BEH A;  2LG4 A;  2HKX A;  2MAB A;  2O8X A;  3QP5 A;  4HLY A;  2DYS H;  2NS7 A;  3CCE I;  3HB9 A;  1ITY A;  3LST A;  4YFX F;  2MH2 A;  4XQF A;  2Q2E A;  3SFI A;  4GYG A;  5GPA A;  4IHT A;  1XTA A;  2V1N A;  2ZKZ A;  5LHG A;  1ZAO A;  2HWV A;  1JJ8 C;  4UUV A;  3NQO A;  3OS0 A;  3PNY A;  2HQ5 A;  1MNM C;  3K4L A;  1B4A A;  1K79 A;  3EUK L;  1S9H A;  2YU9 J;  2LF7 A;  1D0Y A;  4DZP A;  1QVT A;  1YRN B;  5B3S H;  3BTI A;  1MW7 A;  4A3K J;  1BA5 A;  1SD4 A;  2E35 A;  3A03 A;  3MZ8 A;  2A6E F;  3W3C A;  1O57 A;  2Y69 H;  4A3D J;  2K9L A;  4IEJ A;  2YX4 A;  1NHA A;  1JT0 A;  3M8F A;  3BPX A;  2AHQ A;  4F93 B;  1YS7 A;  2MYS A;  2L01 A;  1T39 A;  3OY9 A;  4A3I J;  3LFK A;  2ZFW A;  2WAF A;  1JTY A;  2MBF A;  3I54 A;  1HOM A;  2LFB A;  1RUN A;  4FTH A;  3VWB A;  1TZL A;  3KEO A;  3OYJ A;  4UV9 A;  4B47 A;  5EJC A;  2G7U A;  3DV8 A;  5K1Y A;  4Y33 A;  4ZTJ A;  2DN0 A;  1F43 A;  2FD5 A;  4I0B A;  4CGZ A;  3R0A A;  2GIZ A;  1TWC J;  2BV6 A;  4XON A;  2MC4 A;  4E7I A;  2CH0 A;  4G7Z F;  2X6O A;  4KN4 X;  2YU3 A;  5FD5 A;  1LE8 B;  1MBF A;  1FBQ A;  2RNG A;  5FJ8 J;  3FMS A;  3JRG A;  2EIK H;  2R7D A;  2P4W A;  2K3F A;  1H9G A;  1JUP A;  3K9T A;  3PIP F;  3QAH A;  3F21 A;  3OYD A;  1JXS A;  4M3E A;  3UKG A;  4B4C A;  2K5C A;  3LSH A;  2RNJ A;  2VB6 A;  3CUQ A;  1B72 B;  3WU0 A;  5CJ9 A;  3ZR8 X;  2PMU A;  1MBG A;  2L9R A;  1JT6 A;  2EFP A;  4IXA A;  2W1O A;  3IAM 2;  2KJC A;  3JTG A;  4R8H A;  3BJO A;  2A3S A;  3REO A;  2JPC A;  2ISZ A;  4C3J J;  1HDD C;  2DK8 A;  2EV0 A;  3HGG A;  1MMS A;  1XSV A;  2IS6 A;  3CDI A;  2VKD A;  1XDS A;  5CKT A;  2D45 A;  4EGZ A;  1PUF A;  1UG0 A; 
#chains in the Genus database with same CATH homology
 1PDN C;  3EQL F;  3E97 A;  2O61 A;  1B6A A;  1GXP A;  4KMF A;  5L3C A;  2HEO A;  3R0J A;  4LMY A;  4Q47 A;  2P7V B;  4KN7 X;  3ECH A;  1J0R A;  1P6R A;  3GXO A;  4EJO A;  4ZYG A;  1OYY A;  1XCB A;  3WTV C;  1R00 A;  3RI4 A;  1HKT A;  1TLH B;  4HW0 A;  4JK1 X;  1FPQ A;  2FOK A;  4KA4 A;  4WX9 A;  2DW4 A;  1IN7 A;  2CG4 A;  1ZRD A;  3ROU A;  1YO5 C;  2HQN A;  1UCR A;  1QGP A;  2XVC A;  3Q9V A;  4CIC A;  2V79 A;  2ZXJ A;  5CVI A;  3P7N A;  1I1G A;  4UNO A;  1TBX A;  2TDX A;  2GA2 A;  3U1D A;  3DQV C;  3LAJ A;  1W5S A;  1MJ9 A;  1LB2 A;  3P9I A;  2O3F A;  4AVP A;  2D1V A;  3EDP A;  1QNT A;  4MNU A;  1LVA A;  2ESN A;  2BBY A;  4M74 A;  2XV4 S;  2QBY B;  4RB1 A;  3CLO A;  3WTU C;  3AAF A;  2VE9 A;  2GAU A;  4P9F A;  4BHB A;  3N4M A;  4OOI A;  3R4K A;  2VBX A;  2PBI A;  3QP6 A;  3J7A O;  4RS8 A;  2EV6 A;  4XRF A;  2P5L C;  2ZBK A;  2CQK A;  3D5L A;  4MHG A;  3KP7 A;  1JHF A;  4LJZ F;  2Z5U A;  1YW8 A;  2OU2 A;  2NNN A;  4YG2 F;  3C7J A;  2QBY A;  1XN7 A;  2F5E A;  2IP2 A;  3I59 A;  4YFN F;  3KCC A;  5FD6 A;  1W7P D;  4M6X A;  3DPL C;  3HOT A;  1G3S A;  2LSO A;  3BJA A;  1GVJ A;  2OBP A;  3VB2 A;  2H6B A;  2VBY A;  3BY6 A;  4ESB A;  3DXJ F;  2HTJ A;  2OQG A;  4HQM A;  4N9H A;  3RKW A;  1B9N A;  2CYY A;  4G6Q A;  3TOA A;  2EFN A;  2EFO A;  2YR2 A;  3FXQ A;  4UVA A;  4ZYD A;  3ZMV A;  4L9V A;  2Q0O A;  4NB5 A;  3T8R A;  1SD6 A;  4EGY A;  1P2F A;  4D0P A;  4HV5 A;  4KNY A;  2FRH A;  4A0Y A;  2P8T A;  2QWW A;  2RN7 A;  4TV7 A;  4HLX A;  4HZF A;  1Z7U A;  2E1N A;  4UXN A;  4ENJ A;  1FC3 A;  1R58 A;  3B02 A;  5BQT A;  1E2X A;  1KU2 A;  3IKV A;  2M8E A;  4MQV A;  5BOX A;  1T6S A;  4A6D A;  2PMH A;  4M73 A;  3IWF A;  1SMT A;  2O0Y A;  5CVJ A;  1FSE A;  1YYV A;  4EV0 A;  5LEJ A;  5JHU A;  5HOO A;  2HGC A;  5HVQ C;  2EFQ A;  1LQ1 A;  2ISY A;  3KP2 A;  5FO5 A;  3DEU A;  1MJB A;  4U0W A;  3KET A;  3CUO A;  1ZRC A;  4PCQ A;  2FML A;  4L9N A;  1HKS A;  4M71 A;  1AWC A;  5FGM A;  2HKO A;  5CLS A;  4IVN A;  2YSR A;  1SMY F;  1TTY A;  2VXZ A;  2PJP A;  2JRT A;  3F8B A;  1Z6R A;  2OAZ A;  1KU3 A;  4KIB A;  2HTS A;  2XAH A;  1S7O A;  1U2W A;  1HW1 A;  3M8E A;  4G9Y A;  4U0Y A;  1SFX A;  3KLO A;  3ZMS A;  1ULY A;  1D8K A;  5E18 F;  1QO0 D;  1S6L A;  2KIF A;  1WQ2 A;  1V4R A;  2VOP A;  3GO5 A;  1PP7 U;  3VOD A;  3MQ0 A;  4WXC A;  5LHH A;  1WSU A;  3BDD A;  2KRF A;  3IL2 A;  1G3W A;  1S29 A;  5E8G A;  2W24 A;  1MJA A;  2Q8K A;  3HIF A;  4N9I A;  1HBX G;  2FE3 A;  4WXD A;  3ZN0 A;  3L9F A;  3C18 A;  2WWY A;  4HF0 A;  4RAY A;  4UHT A;  4B09 A;  1F5T A;  1OR7 A;  2STW A;  4RGX A;  4B8X A;  4RGR A;  5HLG A;  4PDK A;  3H3U A;  2XAF A;  2QQB A;  3GFM A;  4U0V A;  2J5O A;  4HYE A;  4FT8 A;  2RC4 A;  2GWR A;  3GZ6 A;  3E6B A;  1YTY A;  3M1E A;  3ECO A;  3I58 A;  2HS5 A;  3WU1 B;  3FZV A;  3TOB A;  3EET A;  4P9U A;  1P4X A;  2W84 A;  3E5U A;  3SFZ A;  5D8L B;  3GZ5 A;  3C1D A;  1PP8 F;  3LAP A;  5A2Q Z;  1BC8 C;  5LGU A;  3ZP5 A;  5FFZ A;  1FT9 A;  4OIO F;  2VBW A;  1JHH A;  3E3V A;  4H0E A;  3FWE A;  2FBH A;  5A2Q K;  1J59 A;  5K5O A;  2F2E A;  1Z1D A;  3DF8 A;  5DD4 A;  4G7H F;  1HSJ A;  5DYM A;  1R23 A;  2HYF A;  1HST A;  3U9G A;  3ZMD A;  4RGS A;  2AS5 F;  2DLL A;  4AIK A;  1PUE E;  1QBJ A;  1ZHF A;  5CYV A;  4XBF A;  1ZN2 A;  3COA C;  3SZT A;  1WI9 A;  3E6C C;  2F5F A;  5HS7 A;  1R1T A;  1QPM A;  2K27 A;  2EK5 A;  1DP7 P;  2FSW A;  3B73 A;  1IN4 A;  3I64 A;  3WGI A;  2GXG A;  3HTS B;  4RB0 A;  1HXD A;  4KMU X;  2KIM A;  1KQ8 A;  2ZNZ A;  3E5Q A;  3I4P A;  2DK5 A;  5D4R A;  4WXH A;  3SXY A;  4EJU A;  5BPD A;  2BGC A;  2A69 F;  3RDI A;  1O7L A;  3MCZ A;  2JT1 A;  1K78 B;  2FU4 A;  1K7A A;  4HAM A;  4AIJ A;  3FHZ A;  2LKP A;  3Q9S A;  4BAY A;  1UFM A;  1D5V A;  4M6Y A;  3KP4 A;  4IPA A;  2QQ9 A;  5JFR A;  5LBQ A;  5ICE A;  2EFW A;  1A04 A;  5E8I A;  1XMA A;  3J80 Z;  4EMS A;  3CUQ B;  5E1Z B;  3E5X A;  3CO7 C;  2DFI A;  2COM A;  1XGO A;  1P92 A;  3F6V A;  5HDK A;  3J80 K;  3J81 Z;  3RPQ A;  1BJA A;  4Y17 A;  1K78 A;  4IRI A;  4S05 A;  3O2P E;  3J81 K;  3F8M A;  1ZG5 A;  5ED4 A;  1MDM B;  4BXU A;  2GQQ A;  1L0O C;  3NRV A;  2HZT A;  1OMI A;  2W57 A;  1YW9 A;  1LDK B;  5FLX Z;  1BI3 A;  3ULQ B;  2WC2 A;  3IRQ A;  3L2C A;  2IW5 A;  4PGG A;  1XMK A;  3BRO A;  3BOQ A;  2PEX A;  5FLX K;  1IZ1 A;  3TO9 A;  1XD7 A;  1ZH5 A;  3D0S A;  1R7J A;  1RI7 A;  3IWZ A;  2ZO4 A;  4IRH A;  4KIC A;  1MDM A;  4EJW A;  1KU7 A;  3I0T A;  4BHP A;  4UVC A;  3JAM Z;  3F23 A;  4EM0 B;  3CJN A;  2FBI A;  4I09 A;  4BHC A;  1IUY A;  4N0B A;  1KA8 A;  2RDP A;  2OQR A;  3MEX A;  4R1H A;  4DQ2 A;  3K1N A;  3JAM K;  5HLH A;  2DAO A;  3MAJ A;  1R5H A;  1Z05 A;  5D5V B;  3GFI A;  5H6Q A;  3S2W A;  3U2R A;  2YPR A;  2HQR A;  2KKO A;  1STZ A;  3FX3 A;  1BI0 A;  3TDZ C;  2VN2 A;  4BYY A;  3LA2 A;  2R7F A;  3TKY A;  2DU9 A;  2Y48 A;  3DKW A;  5EEH A;  3BP8 A;  4ENM A;  1EV7 A;  2NRA C;  1B59 A;  2AXL A;  1G6N A;  5BS6 A;  1L3L A;  4KIG A;  1H0M A;  3GFJ A;  2ZJ2 A;  1KGS A;  1SD7 A;  5D8K B;  2NYX A;  3K69 A;  2FEZ A;  2W25 A;  3GFL A;  4Z2Y A;  3PQJ A;  4LG0 B;  5E1X A;  4HF2 A;  1RZ4 A;  1U6G A;  4LK0 F;  3G73 A;  5H6R A;  3I59 B;  4ETS A;  4ON0 A;  1W7P A;  4XSX F;  5J8C A;  2M45 A;  2STT A;  4K2E A;  2Y75 A;  2ZCW A;  5JR3 A;  3WG9 A;  1V3F A;  3CUQ C;  1ZGA A;  4EJT A;  1YLF A;  3KP6 A;  3T5X A;  4IF4 A;  2OZ6 A;  3ZMT A;  2PG4 A;  5IT9 Z;  2GXB A;  2IA1 A;  3HSF A;  2ZME A;  3KP5 A;  3I53 A;  4L5I A;  5AIP A;  5J6X A;  2D2W A;  2IA2 A;  1U5T B;  1G3T A;  2BEO A;  2NS0 A;  3V8L A;  2PQ8 A;  2FF4 A;  3MZH A;  1FY7 A;  5IT9 K;  3V8J A;  4G7O F;  4LK1 F;  4LG0 A;  5K5R A;  4KDP A;  2UXN A;  3RYP A;  4F7Z A;  3RKY A;  3H92 A;  2B0L A;  5HLI A;  4KFC A;  2YX7 A;  3WGG A;  1R36 A;  4Q5S F;  3VOE A;  3V4G A;  1GHC A;  1J2X A;  4NQW A;  1KU9 A;  2A61 A;  3QOP A;  1UHW A;  3LA7 A;  5DDG A;  2FXA A;  2DTR A;  1U5T A;  1DDN A;  4A12 A;  3DPT A;  3JSO A;  4MTD A;  2RVC A;  2M5W A;  3PQK A;  4AD9 A;  2DPU A;  2DBB A;  4ENK A;  1UST A;  5E20 A;  1IXS B;  3QU6 A;  1FLI A;  5DUI A;  1DPU A;  3F8N A;  4M9S A;  4HV6 A;  3MFK A;  2P6S A;  2E7X A;  2A6H F;  3F8F A;  2CGP A;  1F4K A;  4IJA A;  5KVR A;  2CW0 F;  1T98 A;  2NNY A;  1IRG A;  5FFX A;  3BJ6 A;  4FX0 A;  3V8K A;  3K1P A;  2WV0 A;  1FYM A;  1YG2 A;  3EYY A;  1SFE A;  3JTH A;  4ZZD A;  1YIO A;  4OMY A;  1FBU A;  2FQ3 A;  2RQP A;  2F5D A;  4LFU A;  3SHF A;  3P9K A;  1FYL A;  2CFX A;  4LLG F;  4KYW A;  4KUM A;  2HFH A;  3TDU C;  5ILV A;  1LEA A;  2ADU A;  4LD5 A;  1O3R A;  2IPQ X;  4WCG A;  3T8T A;  1RIO H;  2RGV A;  4XSZ F;  4EJV A;  1U3E M;  2K7L A;  1J75 A;  3RIR A;  4LB6 B;  1R1V A;  3KZZ A;  2MC3 A;  3HTU A;  5HS8 A;  5H20 A;  3HUG A;  1FOK A;  3K0L A;  2L4A A;  1YFH A;  3V7C A;  2H94 A;  4OIP F;  2EWN A;  4DNC A;  2W85 A;  3WOD F;  1GXQ A;  3FF5 A;  1Z9C A;  3R6S A;  4QWQ A;  4XLP F;  4LLN A;  2V1U A;  5L3E A;  1U5T C;  2DQL A;  1D8J A;  1MKM A;  3RTR A;  2QM3 A;  5L3F A;  1U8R A;  3HHG A;  4FHT A;  4Y15 A;  2ESH A;  2Z99 A;  3QRF F;  3HRU A;  3HRM A;  3JSP A;  2IRF G;  4I0A A;  3W6J B;  3SQN A;  1LEB A;  4I02 A;  5D6F A;  1O3S A;  3FMR A;  3HOS A;  2VT3 A;  1I27 A;  4R79 A;  5F6F A;  4UVB A;  2ZNY A;  2VT2 A;  1FWZ A;  3FXU A;  2UWM A;  4RB2 C;  1W5T A;  1IAW A;  4MGR A;  3IRR A;  3ZN1 A;  5L3G A;  4GO1 A;  1ZG3 A;  4ZH4 F;  1WKM A;  3MWM A;  4HX8 A;  1XCV A;  4MQ9 F;  4A0X A;  1YS6 A;  3VEP A;  2XAS A;  2OZU A;  2M30 A;  1IRF A;  1J7K A;  4JQF A;  4A5N A;  2L02 A;  1TW2 A;  1XGN A;  2P5K A;  3KE2 A;  3GX4 X;  1Y0U A;  2MA3 A;  2WTE A;  2VON A;  3GVA A;  3WTS C;  2PI0 A;  1R1U A;  4CYD A;  1IXR C;  2DT5 A;  4CZZ A;  2J5P A;  1I5Z A;  3CO6 C;  4UV8 A;  1Z6T A;  1EH7 A;  1R22 A;  2EA2 A;  4U7B A;  4EM1 A;  2XAJ A;  1ZRF A;  1KYZ A;  2FA5 A;  4GYI A;  5KK1 A;  1P4A A;  3TO6 A;  2K4J A;  5D5U B;  2RV8 A;  3RKX A;  4A2U A;  2IT0 A;  1XSD A;  5ICG A;  2V1X A;  4HDV A;  3I5U A;  3RJP A;  4MEY F;  1F9N A;  3LA3 A;  5DUK A;  4M9Z A;  1H9T A;  1IN6 A;  1LDD A;  4ESJ A;  2P7C B;  2IA0 A;  1TNS A;  3WTT C;  4L0Z B;  2DO7 A;  2L3D A;  1W4M A;  3GUD A;  4L9T A;  2BYV E;  5AON A;  1J5Y A;  3HSR A;  1XGS A;  2V6C A;  2XIG A;  2VOO A;  2KIU A;  1FSH A;  3V7R A;  4ASN A;  1FP2 A;  1QZZ A;  2D1H A;  4HF1 A;  4OIR F;  1OYI A;  4HX7 A;  1MGT A;  1WWX A;  2EB7 A;  5TJJ A;  3T1B A;  1BIB A;  4HDU A;  3BZ6 A;  1T2K A;  1ZYR F;  4GXO A;  3ZMU A;  2K4B A;  3GW2 A;  1BBY A;  2DI3 A;  3KLN A;  2UZK A;  3TGN A;  4I2O A;  2QQA A;  2QUF A;  3KP3 A;  4LGW A;  3CDH A;  3ELK A;  4CDG A;  3TQN A;  1MZB A;  2ELH A;  4P5O A;  3WTZ A;  5ERI A;  1O7F A;  2XHK A;  4OIN F;  5D4S A;  4E70 A;  2UXX A;  3HYI A;  4GGG A;  4L18 B;  1IN8 A;  2GIV A;  3K1M A;  2E1C A;  1FX7 A;  3ABT A;  2FMY A;  4G6D A;  3IC7 A;  5E17 F;  3IKT A;  3GEZ A;  3SZP A;  1UB9 A;  4U88 A;  4NHJ A;  5L3B A;  1FP1 D;  1MD0 A;  3K2Z A;  2IJL A;  2MH9 A;  5D5X B;  4PZJ A;  5BMZ A;  1JGS A;  2MLG A;  4JBA A;  1BM9 A;  4I98 B;  4IRG A;  4P96 A;  4RAZ A;  1WRJ A;  4IHS A;  4OU0 A;  1XDU A;  2FBK A;  5CVR A;  1UHM A;  2PFB A;  3O3K A;  2HYG D;  1IW7 F;  5DEQ A;  2VC1 A;  2HR3 A;  3N97 A;  3ZPL A;  1ZG1 A;  1EH8 A;  4O6J A;  3GWZ A;  5JI6 A;  3BPV A;  1ON1 A;  3EUH A;  2V9V A;  5D6E A;  4AWX B;  1W7P B;  4ZYH A;  1LJ9 A;  2MD5 A;  3WTY C;  3IHU A;  2OD5 A;  1S3J A;  3F22 A;  2F5C A;  2K86 A;  2ACJ A;  1FYK A;  1AOY A;  2ZME B;  3ZQ7 A;  4QLC U;  3F8C A;  4G94 A;  2A68 F;  1C0W A;  2X0L A;  2GA1 A;  2LDU A;  1QQI A;  2VBZ A;  3OOP A;  4M72 A;  2RKH A;  4YIF A;  3EYI A;  1LNW A;  3G3Z A;  3FM5 A;  4XLN F;  3V7S A;  1B9M A;  4PGH A;  4CO8 A;  2L4M A;  3PFI A;  3RPU A;  1B1B A;  3I71 A;  1ZAR A;  2A07 F;  5D5W B;  1CGP A;  1U78 A;  5TRD A;  5LEK A;  4ESF A;  5J8F A;  3WE3 A;  2VC0 A;  1ON2 A;  4EM2 A;  1ODD A;  4Q48 A;  1J9I A;  3GF2 A;  2DQR A;  1IN5 A;  4L5J A;  1YQA A;  3WE2 A;  5K5Q A;  5IT3 A;  5LLQ A;  4G8X A;  4A0Z A;  3L7W A;  2KJB A;  3LWF A;  2JPB A;  5HDG A;  2LF8 A;  1XSX A;  3CTA A;  1FBS A;  4HQE A;  2FNP A;  3Q5F A;  3LQQ A;  3H3Z A;  3ERE D;  3HRS A;  1HW5 A;  6PAX A;  1ZRE A;  2CWE A;  4ZZL A;  3QPH A;  1T0F A;  1RUO A;  1EH6 A;  1BN5 A;  3M7G A;  5HS9 A;  3BWG A;  4CXF A;  2O03 A;  3FM3 A;  5ILS A;  4BH9 A;  2JZY A;  1F1Z A;  2BE5 F;  3E6D A;  2X4H A;  1HW2 A;  3F6O A;  3KFW X;  3GLX A;  1TQI A;  4HA8 A;  3RYR A;  3ISP A;  2E7W A;  2XKP A;  4KT5 C;  1BI1 A;  2VE8 A;  2G9W A;  3LQR A;  4AIH A;  2P6T A;  2K02 A;  3HRT A;  2NAZ A;  2QZ8 A;  2PLY A;  1R5G A;  5CVU A;  2FNA A;  1P4W A;  1DPR A;  2GZW A;  1XGM A;  4I7H A;  2P5V A;  4GCV A;  2H27 A;  2XAQ A;  4ZYE A;  2QYO A;  5DCF A;  1SAX A;  1CF7 B;  1ZLK A;  2O6G E;  1D3Y A;  2MLK A;  2Y0M A;  4Q4Z F;  1Z91 A;  4O5V A;  1OPC A;  5BPI A;  5EEG A;  4LLL A;  4L0Y B;  3P9C A;  1ONV A;  1E17 A;  3C3W A;  1YW7 A;  5E1W A;  2QLZ A;  2PN6 A;  2DPD A;  2M1B A;  1FNN A;  1I6X A;  1FZP B;  2Z9O A;  1SFU A;  2EV5 A;  3R60 A;  5LRR A;  2CSO A;  1OKR A;  2HDC A;  1S8N A;  4RB3 C;  1KYW A;  5LGN A;  1CF7 A;  1TQP A;  3QU3 A;  2EJR A;  3OV8 A;  3DFG A;  2A5Y B;  2XUB A;  3ML6 A;  5HDN A;  4Y13 A;  1IXC A;  3TO7 A;  1K6O A;  1XB4 A;  3L09 A;  5LHI A;  5DCM B;  1JE8 A;  4I01 A;  4MEX F;  4BQA A;  5L3D A;  3NEU A;  3M9A A;  1DUX C;  5DV5 A;  5ICF A;  1ZGJ A;  3MZY A;  5AIQ A;  1KQ0 A;  2OA4 A;  5FB2 A;  4A6E A;  3FMQ A;  1X3U A;  2H09 A;  4FX4 A;  2IVM A;  2JTV A;  1HQC A;  3W6K B;  1Q1H A;  5DCM A;  2Z33 A;  1ZLJ A;  3T0Y A;  2QVO A;  4EQQ A;  3HHH A;  4MTE A;  1O3Q A;  3KEQ A;  4WK8 F;  1S7A A;  1TNT A;  3WGH A;  4OMZ A;  4WWC A;  4EVI A;  4WF2 A;  4P55 A;  4HOB A;  1BI2 A;  5CVV A;  1TW3 A;  5LGT A;  3L00 A;  3ZMZ A;  1QZY A;  2XRO A;  2XGX A;  4M9X A;  3HSE A;  2ETH A;  5ICC A;  3R61 A;  1USS A;  2QEN A;  1O3T A;  3JW4 A;  4YFK F;  1KQ9 A;  2R3S A;  1BIA A;  2XKO A;  1T38 A;  4HBL A;  2LNB A;  3ABU A;  1IF1 A;  2EA4 A;  3E6M A;  1G4D A;  1REP C;  2L54 A;  1RNL A;  5ILU A;  1BOA A;  2XRN A;  2M87 A;  4RGU A;  4LB5 A;  4S04 A;  2XAG A;  2VOD A;  3GYH X;  2CO5 A;  1TQM A;  4A5M A;  3DP7 A;  4KIF A;  1I1S A;  3WTW C;  2Z3Y A;  4U7D A;  1BC7 C;  1VTN C;  2V1D A;  5LRS A;  5F64 A;  4CHU A;  3F72 A;  3O6B B;  2JSC A;  1HKQ A;  5JVT A;  3FXR A;  4ENN A;  5F1R A;  3KZY A;  2G7H A;  4YII A;  4L9J A;  1OYW A;  3F3X A;  1G3Y A;  1SD5 A;  4OIQ F;  3WTX C;  2H6C A;  2C6Y A;  2HOE A;  3QPT A;  4BNC A;  5DD8 A;  3VFZ A;  4O3M A;  4HX4 A;  1LDJ A;  2HKX A;  2O8X A;  3QP5 A;  4HLY A;  3LST A;  4YFX F;  2MH2 A;  2Q2E A;  4GYG A;  4IHT A;  2ZKZ A;  5LHG A;  1ZAO A;  2HWV A;  4UUV A;  3NQO A;  1B4A A;  1K79 A;  2LF7 A;  1SD4 A;  2A6E F;  1O57 A;  2YX4 A;  1NHA A;  3M8F A;  3BPX A;  1YS7 A;  1T39 A;  2L01 A;  3LFK A;  2ZFW A;  2MBF A;  3I54 A;  1RUN A;  3KEO A;  4UV9 A;  2G7U A;  3DV8 A;  5K1Y A;  4I0B A;  4CGZ A;  3R0A A;  2BV6 A;  4G7Z F;  4KN4 X;  2YU3 A;  5FD5 A;  1FBQ A;  3FMS A;  2R7D A;  2P4W A;  1H9G A;  3K9T A;  3QAH A;  3F21 A;  1JXS A;  2RNJ A;  3CUQ A;  3WU0 A;  5CJ9 A;  2PMU A;  4IXA A;  2EFP A;  3JTG A;  2KJC A;  4R8H A;  3BJO A;  2A3S A;  3REO A;  2JPC A;  2ISZ A;  2DK8 A;  2EV0 A;  1XSV A;  1XDS A;  2D45 A;  4EGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...