3GFJA

Crystal structure of the st1710 mutant (r89a) protein
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
141
structure length
141
Chain Sequence
ENRIQIMSTIAKIYRAMSRELNRRLGELNLSYLDFLVLRATSDGPKTMAYLANRYFVTQSAITASVDKLEEMGLVVRVRDREDARKILIEITEKGLETFNKGIEIYKKLANEVTGDLSEDEVILVLDKISKILKRIEEISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 146aa long hypothetical transcriptional regulator
publication title ST1710-DNA complex crystal structure reveals the DNA binding mechanism of the MarR family of regulators.
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Transcription
total genus 55
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2009-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3gfjA00
2RC4A 3P9IA 2XUBA 4AIJA 1RZ4A 3EYIA 4L9VA 4A0ZA 1SFEA 2O0YA 3ECHA 2HKXA 4YG2F 1L3LA 2O8XA 5L3EA 4IHTA 4UNOA 1P4XA 3Q9SA 5ERIA 1W7PA 4M72A 2UZKA 3C7JA 3JSOA 2DLLA 2AS5F 1S29A 1Y0UA 1CF7B 5DUIA 3KP4A 1X3UA 2DI3A 2IRFG 1FP2A 3E97A 3EQLF 2DK8A 4OIRF 2P5VA 5J8CA 4R1HA 4KIBA 2RN7A 5D5WB 1XCVA 4QWQA 3GO5A 1FOKA 3C1DA 5BS6A 3VB2A 2JRTA 4MEYF 2ZMEA 3KLOA 5HLHA 5F1RA 4RAZA 2EWNA 4ETSA 4HX4A 4M6XA 4WF2A 1QPMA 6PAXA 1D8KA 4EM0B 4YFXF 3F72A 5LBQA 1YW9A 3IC7A 4F7ZA 3P9CA 2O6GE 5HDKA 1DDNA 1RUOA 1BOAA 5L3CA 5JR3A 3ZMUA 4Y15A 4BHCA 2FMYA 3CDHA 4GYGA 1FWZA 2KKOA 3MWMA 1B9MA 3REOA 3QRFF 4I2OA 2IPQX 4HYEA 1MKMA 1FYKA 3TDZC 1TNTA 4XSZF 2ETHA 1SFXA 4ENJA 3GWZA 1G4DA 3T8RA 3WGHA 4HLYA 2BEOA 4WXCA 4M71A 3HTUA 1ZRCA 5JVTA 5FLXZ 5DUKA 1O57A 5HDNA 2GXGA 4HLXA 4ZYEA 5BPDA 3TKYA 3ZQ7A 4AWXB 5CYVA 3D0SA 4YFNF 4XRFA 5A2QZ 1J9IA 5K5RA 2G7UA 2VT3A 1CGPA 4GYIA 2WC2A 3ROUA 4CGZA 1ZAOA 2QENA 3ZPLA 1W4MA 1S8NA 2GIVA 5JI6A 5FLXK 4EJOA 1F5TA 2DFIA 4BQAA 4ENNA 2HS5A 1W7PB 1UFMA 2P5LC 4ON0A 2JPCA 1J5YA 5K5OA 3QU3A 5ICGA 4P96A 5A2QK 4OIQF 3E6DA 4LMYA 3P9KA 1G3YA 3BPXA 5K5QA 2LF7A 3ABTA 3TQNA 1FNNA 2KJBA 2IVMA 3H3UA 1XDUA 4ZZDA 4PCQA 4N9IA 2DK5A 4HX8A 3FM3A 3CUOA 4CZZA 4A0XA 1LJ9A 2ZMEB 1FYMA 3LFKA 2IT0A 2VE8A 3J80Z 2A61A 4HQEA 4JK1X 5KVRA 2FXAA 4LB6B 1IN5A 1LDKB 5LGNA 3V8KA 2F5CA 3PQKA 2M1BA 3GW2A 3BZ6A 2FOKA 1K7AA 2OU2A 2BBYA 4WX9A 3V8JA 5FFXA 1J7KA 1GXPA 3B73A 3O3KA 4L5JA 2JPBA 3WTYC 3HIFA 1IAWA 1R00A 1R1TA 3ZN1A 3IWFA 3WTVC 1MJAA 5D4SA 1BI2A 3I4PA 1J59A 2L54A 3IHUA 4A2UA 3E6BA 3T0YA 1O3QA 1U5TB 3HOTA 2V1DA 1SAXA 4BHPA 1YW8A 4IVNA 4MEXF 3NQOA 1I1GA 2KIUA 2L3DA 2O03A 1G3TA 5BPIA 2GQQA 1D5VA 5K1YA 1V4RA 2NRAC 4CHUA 4G94A 4HW0A 1BI0A 3EETA 3PQJA 3FMRA 3B02A 3LA3A 2ISZA 3TO7A 4HV6A 4M9ZA 1W5TA 1XGSA 2G7HA 4ZYDA 4RAYA 2A6EF 1G3WA 4I98B 2BE5F 2UWMA 5ICFA 3MFKA 2YR2A 3MZHA 2CQKA 1TQIA 1OYIA 2DPDA 1O3SA 1TNSA 1YG2A 2YSRA 1KU9A 2Q8KA 5E1WA 1WRJA 1J2XA 2XAJA 1TW2A 1XSDA 3TO6A 2MH2A 3ZMDA 3DPLC 5H6QA 2XVCA 3RJPA 3IKVA 4CICA 1J0RA 2XAGA 2OZ6A 1W7PD 1HKTA 4Y13A 3R61A 2Z99A 2P6TA 3K1MA 5LGTA 2V1XA 3LSTA 1ULYA 4JQFA 2KJCA 2ZNYA 1AWCA 3F8CA 2O3FA 1OPCA 2EJRA 4UUVA 3GLXA 3U2RA 1RUNA 4I0AA 2W25A 4XLNF 1XGMA 4WXDA 1FC3A 5D6EA 1OR7A 1EH6A 5AIPA 4B8XA 5DYMA 3E6CC 2H6BA 1BIAA 3E6MA 1YO5C 3GFLA 1HW5A 3M8FA 2O61A 1T6SA 4LLNA 2EK5A 4EGZA 4IRGA 2RV8A 3VFZA 5D5XB 2EA4A 1KA8A 2DBBA 2F2EA 2VODA 2K7LA 2QQ9A 5EEGA 1EH7A 2XROA 5D4RA 3DEUA 5TJJA 2Z33A 1I6XA 4HQMA 5E8GA 4RGRA 2MBFA 3WGIA 4EJTA 3I53A 2QYOA 3MZYA 1BJAA 2NS0A 2EA2A 3ECOA 3KCCA 2GA1A 3GUDA 5D6FA 1Z6TA 1ON1A 3FXRA 4U0YA 1BN5A 2OBPA 2XAFA 3KLNA 4BYYA 2IW5A 2KIMA 4AVPA 2X4HA 2XKOA 2P7CB 3LA7A 3I59A 1DPRA 2MLKA 1YW7A 5DCMB 1FSHA 4EVIA 4U88A 1IN8A 4OMZA 1D8JA 3WODF 3L09A 3BDDA 1PDNC 2OA4A 2OZUA 4RB3C 2F5DA 2RDPA 3J7AO 1IUYA 1SD5A 2CWEA 4ZZLA 3RYPA 5CVJA 4OOIA 4EJVA 1S6LA 5LHGA 4HBLA 4BNCA 4L9TA 4HDUA 1LVAA 3L7WA 3HTSB 1KGSA 3WE2A 3V7SA 3QPHA 1Q1HA 4L0ZB 2QZ8A 2D1VA 3KP2A 3SQNA 4GCVA 3WTTC 1I1SA 4B09A 1KQ0A 1GVJA 4P55A 3RKXA 3RDIA 5CLSA 4KDPA 2QQBA 2ZJ2A 2XKPA 3OV8A 3ABUA 1R22A 1OYWA 3G3ZA 3KP3A 1L0OC 3MAJA 3VOEA 5H6RA 1PP7U 4G7ZF 4LLGF 3QOPA 5E8IA 1KU2A 3R0AA 1KQ9A 4MQVA 2PQ8A 5LEJA 3F23A 2FRHA 1YTYA 1IXRC 3QAHA 2B0LA 3CJNA 3OOPA 1FP1D 3LAJA 1F9NA 1TTYA 4MTDA 3LA2A 1ZG1A 5HDGA 3SFZA 2PMUA 1W5SA 4RB2C 4Y17A 2CSOA 4ZH4F 4PGGA 3BJOA 4IRIA 1B6AA 2MLGA 1S7AA 2VE9A 4HOBA 2EFNA 4IJAA 4L9NA 3VEPA 5DDGA 4U7BA 1U8RA 4FHTA 4YIFA 4HA8A 1KU3A 2ESHA 1A04A 5J8FA 1QGPA 2M87A 3FWEA 2VONA 2RQPA 2VC1A 1XSXA 5IT9Z 1HKQA 3ZN0A 2RVCA 2VBXA 4BHBA 1XSVA 2L4AA 3KZYA 1HKSA 2LDUA 3LWFA 1SD6A 2YPRA 1UHWA 2AXLA 4XLPF 4KICA 3I0TA 5E20A 4UXNA 4KYWA 4L18B 5IT9K 1FLIA 2EFPA 1H9TA 3GFJA 3F8FA 3HHGA 4GXOA 3RYRA 1H9GA 3CO7C 2BV6A 2HYFA 3CUQC 3BROA 4EM2A 2D1HA 4KIGA 1VTNC 2K4BA 4A6EA 3L9FA 5E18F 3S2WA 3WU0A 2ZCWA 1USTA 1NHAA 2GWRA 5LGUA 2HR3A 4MGRA 3DFGA 1XN7A 1P2FA 4A12A 2M5WA 4XSXF 4G9YA 1FT9A 3G73A 1R58A 1Z9CA 2F5FA 2DTRA 4MHGA 4M9SA 1STZA 1XMAA 4WCGA 2FBIA 1ON2A 3DKWA 4HZFA 3DV8A 4S05A 3HSEA 2FNAA 4WXHA 3WTSC 2STTA 3M1EA 2VOPA 4GGGA 2HZTA 3KFWX 1ZG3A 3HRSA 4UVAA 2EV5A 4N9HA 4E70A 1GHCA 2QVOA 1T98A 4HX7A 2EB7A 3JTHA 5HS9A 1T38A 2W84A 1XGNA 2QM3A 3GVAA 3GF2A 5BOXA 5HVQC 4EJUA 3ZMTA 3NEUA 3KP7A 2HYGD 3K69A 1ZG5A 1BM9A 3EDPA 3HRMA 1KQ8A 4G7OF 3GYHX 5HLIA 4A0YA 3WGGA 5FD6A 1V3FA 4R79A 1FBQA 1B4AA 2IA0A 1B59A 4OIPF 2QBYA 3HSFA 3V4GA 4A5NA 1IZ1A 4Q5SF 3I54A 4M9XA 5L3FA 3F8BA 3N97A 3F6VA 4CXFA 5HOOA 1LB2A 2R7FA 1DPUA 1R1UA 2PI0A 1OYYA 3PFIA 1D3YA 4KNYA 2L4MA 1UB9A 2HWVA 1P92A 5ILSA 2H27A 1MJBA 4Q48A 4M73A 1BBYA 1BI1A 4FT8A 1Z1DA 2Q0OA 2STWA 3FM5A 3QU6A 1T0FA 2ADUA 2HDCA 2W57A 1USSA 5LHHA 3RKYA 2PLYA 4LFUA 3RI4A 2LKPA 3GFMA 1B9NA 5AONA 3H92A 4ZYHA 2DAOA 1MD0A 5ICCA 4HF1A 2PFBA 5CVRA 3BPVA 1WWXA 4ENKA 4L9JA 5FO5A 1HSTA 2K02A 5DV5A 1QO0D 3IKTA 3R0JA 1QZYA 4EQQA 1U5TC 3BWGA 3M9AA 1LDJA 4LK0F 3IL2A 1WKMA 3COAC 2UXNA 2PJPA 2PEXA 3U1DA 3RIRA 3ZMVA 1OKRA 2DW4A 3FX3A 5HS8A 1XB4A 1QQIA 2ZFWA 3WTUC 3WTWC 1SFUA 2IA2A 3K1NA 2A68F 3F22A 4CYDA 2OQGA 2FBHA 2VBYA 3E5QA 4L0YB 4O6JA 4OMYA 2V1UA 2EFWA 1B1BA 1R5HA 1IN6A 1P6RA 5HLGA 3CO6C 1MDMA 4S04A 3LQQA 1DUXC 4JBAA 3FXQA 3I5UA 3RTRA 4G7HF 2QQAA 1CF7A 4IPAA 1SD4A 3F8NA 5BMZA 3HSRA 1WSUA 4P9UA 2QBYB 1C0WA 5L3DA 4LK1F 2Z5UA 3H3ZA 1FSEA 1BC7C 1TQPA 5F64A 2ELHA 2C6YA 4KIFA 1ZLKA 2M30A 1WI9A 3I71A 5ED4A 3WE3A 4D0PA 2LNBA 2P8TA 3E3VA 2CGPA 1U3EM 5D5UB 1BIBA 3GZ6A 4HF0A 3CUQA 1AOYA 2UXXA 4CO8A 1TQMA 5HS7A 1XMKA 1P4AA 3TOBA 2FU4A 4KUMA 1S7OA 2QLZA 1IXCA 4KMUX 2FF4A 2HOEA 2Q2EA 1ZRFA 4RB0A 5ILUA 2NYXA 3GEZA 5TRDA 3QP6A 1TW3A 4NQWA 4BAYA 1QZZA 3V8LA 3HYIA 4GO1A 3RPQA 4ESBA 4ASNA 1T2KA 2COMA 3MEXA 3R6SA 1IRGA 2YX4A 3D5LA 1XDSA 2K4JA 3KETA 1G3SA 1ODDA 1GXQA 1K78A 1IN7A 5D5VB 4IXAA 1O3RA 4AIHA 4PZJA 5E1XA 1O3TA 2ZNZA 2K27A 1RIOH 2DT5A 2RNJA 5F6FA 5D8LB 5FFZA 1IRFA 2NNYA 5CJ9A 1SMTA 4R8HA 4LG0A 1P4WA 3BJAA 2VXZA 3FZVA 2D2WA 1Z91A 5ICEA 1JHFA 3HOSA 2WTEA 3W6KB 4UVCA 4EJWA 3FXUA 3U9GA 3ML6A 1ZARA 5CVIA 1MDMB 1G6NA 4K2EA 4RGSA 3KP6A 1YFHA 1IW7F 3ZMSA 2MC3A 4NB5A 4HV5A 4KN4X 1XD7A 3JAMZ 4HDVA 1FZPB 1MJ9A 2IA1A 3DXJF 3R4KA 1FPQA 3T8TA 5FGMA 5DEQA 4O5VA 4YIIA 4UVBA 4I09A 3WTXC 2H6CA 2P4WA 2J5PA 3RKWA 3K1PA 2EFOA 3SZTA 2HTSA 3QP5A 3JAMK 2ESNA 3F8MA 5L3BA 2BGCA 3ELKA 3T1BA 5JFRA 2GA2A 1R7JA 4H0EA 2OD5A 2TDXA 1Z7UA 2E7XA 3CUQB 4CDGA 4OU0A 3I59B 3IWZA 4NHJA 4G6DA 2Y0MA 4DNCA 3ERED 1YS7A 3SZPA 2MD5A 3EYYA 5D8KB 1LQ1A 2PG4A 5IT3A 1HSJA 1Z05A 2GAUA 1K6OA 3Q5FA 4KFCA 1K78B 2Y48A 2A6HF 2X0LA 2JT1A 2P6SA 5CVVA 4G6QA 1MGTA 2DQLA 3WTZA 2XIGA 1U5TA 2W24A 2XV4S 2K86A 2HKOA 3LQRA 2HGCA 4O3MA 2VT2A 4LG0B 1WQ2A 2VBWA 2VBZA 2QWWA 2P7VB 4FX4A 2P5KA 1FBUA 2JTVA 1ZHFA 2R7DA 2VN2A 1PP8F 4I7HA 2H09A 1EH8A 1BC8C 3K9TA 4ESFA 3IRRA 5DCFA 2ISYA 3K0LA 2OQRA 1H0MA 4LJZF 4RS8A 3JSPA 1R1VA 5LHIA 2NNNA 2PMHA 4P9FA 1SMYF 1U78A 2WWYA 3GZ5A 3FMQA 3HUGA 2CW0F 2KRFA 4G8XA 3W6JB 2DPUA 2XAQA 1IN4A 3Q9VA 1XGOA 2ZXJA 3ULQB 4BXUA 1S3JA 2M8EA 4WWCA 2EV0A 3DPTA 2CYYA 4RGUA 1UCRA 4KN7X 2E7WA 3JW4A 1ZYRF 1LDDA 1ZGAA 3BY6A 3NRVA 2FE3A 5CVUA 2VOOA 2OAZA 1F1ZA 1FYLA 1RI7A 4UHTA 1O7LA 2XGXA 3TOAA 4RB1A 3F3XA 3WG9A 5J6XA 1JE8A 3KEOA 4I01A 4U7DA 2R3SA 3FF5A 3MCZA 4AIKA 1HXDA 3IRQA 2E1CA 5E17F 2XHKA 1FY7A 1J75A 4L5IA 2Z3YA 3L2CA 3KEQA 2IJLA 1TLHB 1XCBA 2QUFA 3KP5A 4AD9A 2V79A 1OMIA 2WV0A 1KYWA 3O2PE 1U2WA 2LSOA 2ZKZA 3V7CA 2MH9A 3JTGA 3J80K 1RNLA 3WU1B 3MQ0A 3E5XA 3FMSA 2H94A 2JZYA 3HRUA 4EM1A 5BQTA 4RGXA 5LRSA 2J5OA 2IP2A 3M8EA 3M7GA 2ZO4A 2EFQA 2PBIA 4IF4A 3C3WA 4HAMA 4ESJA 1ZN2A 3J81Z 2GXBA 1YQAA 4LGWA 5E1ZB 1KU7A 4LD5A 4UV9A 3TDUC 4N0BA 2KIFA 5H20A 2XAHA 3SHFA 1K79A 2A3SA 1HW2A 1HBXG 4PGHA 1YYVA 1UHMA 2L02A 1FX7A 1ZRDA 2JSCA 3J81K 3I64A 2A69F 2BYVE 5LEKA 3CLOA 2G9WA 4BH9A 2FSWA 1IXSB 4P5OA 3I58A 4Z2YA 5KK1A 4LLLA 1EV7A 3ZP5A 1JXSA 1LEAA 1O7FA 3BOQA 3DQVC 1LNWA 5DCMA 1I27A 1ONVA 3LAPA 2F5EA 5AIQA 2YU3A 1TBXA 1PUEE 4Q4ZF 2PN6A 2HTJA 1FBSA 3E5UA 1LEBA 1YS6A 5LRRA 2A5YB 3R60A 3KZZA 1KYZA 2Y75A 2V6CA 2V9VA 5L3GA 4WK8F 5FD5A 3KE2A 4A5MA 1QNTA 4FX0A 3DF8A 4M74A 1YLFA 2HQNA 4TV7A 2YX7A 1I5ZA 3SXYA 3GFIA 2FNPA 2FQ3A 4U0WA 5ILVA 3TO9A 2HQRA 4PDKA 3FHZA 1JHHA 2A07F 5EEHA 1T39A 1R5GA 4M6YA 4QLCU 4KMFA 3QPTA 3HHHA 1DP7P 4XBFA 1R36A 2EV6A 4MNUA 2MA3A 4MQ9F 3BP8A 3O6BB 4I0BA 1E17A 5LLQA 5DD8A 2VC0A 1YIOA 4KA4A 3CTAA 2FMLA 2D45A 4EV0A 3ZMZA 3RPUA 4EGYA 2DO7A 2E1NA 2DQRA 2FEZA 2GZWA 1HQCA 3ISPA 4OINF 4LB5A 4UV8A 1ZGJA 2RGVA 2HEOA 4MTEA 3AAFA 5DD4A 4ENMA 2HFHA 1ZH5A 1QBJA 1BI3A 2ACJA 2XASA 2M45A 3P7NA 3N4MA 2CFXA 1SD7A 1U6GA 2XRNA 4EMSA 2L01A 1ZREA 4I02A 1Z6RA 3GXOA 2FA5A 3HRTA 3F6OA 4YFKF 2DU9A 3F21A 4DQ2A 3T5XA 4U0VA 3K2ZA 3C18A 4OIOF 3TGNA 1HW1A 2CG4A 2RKHA 4KT5C 3EUHA 1E2XA 4ZYGA 3L00A 2ZBKA 4HF2A 1JGSA 2Z9OA 1MZBA 4Q47A 3VODA 1ZLJA 2NAZA 1F4KA 1REPC 2LF8A 1R23A 5JHUA 2CO5A 4IHSA 3V7RA 4A6DA 3DP7A 3GX4X 1IF1A 3BJ6A 2W85A 2FBKA 5FB2A 4IRHA
chains in the Genus database with same CATH superfamily
2RC4A 3JRIA 3P9IA 2YS9A 5GPAA 2XUBA 2ZC2A 4AIJA 1RZ4A 2IS2A 3HOVJ 3EYIA 4L9VA 4A0ZA 1SFEA 3S1RJ 2O0YA 2NVXJ 4CCMA 5C4XJ 3ECHA 2HKXA 4B48A 4YG2F 1L3LA 2O8XA 4H4KC 5L3EA 3OOUA 4IHTA 4UNOA 1P4XA 1Z21A 3Q9SA 5ERIA 1W7PA 3A01A 4M72A 1UMQA 2UZKA 1VQMI 3C7JA 3CF2A 4HPQA 3JSOA 2PJRA 2DLLA 2AS5F 1PUFA 1S29A 1Y0UA 3IH2A 3H9JA 5GAHJ 1NH3A 2FX0A 1VQ5I 4IEJA 1CF7B 1T0FC 4E6KG 4EATA 5DUIA 1K4TA 3KP4A 1PYVA 1X3UA 2HVSA 2DI3A 2HOAA 2IRFG 1FP2A 1F36A 3H5AA 3E97A 3PSIA 3ABMH 3EQLF 2DK8A 4OIRF 2P5VA 5J8CA 4R1HA 2M0CA 2CJJA 1D0ZA 4FASD 2CU7A 1HCRA 4KIBA 2RN7A 4IKFA 3OS2A 3LSGA 1YE9A 5D5WB 1XCVA 2RQQA 1ERDA 3MKYB 4QWQA 1RKTA 3GO5A 1FOKA 4GDFA 3C1DA 3OIPA 5BS6A 4M6VA 3VB2A 1AU7A 2JRTA 4MEYF 4CCLA 2ZMEA 2MC4A 3KLOA 5HLHA 1OFCX 5F1RA 3MN2A 4RAZA 4FE4A 1UG0A 2IGKA 2EWNA 3JRBA 4ETSA 3TEDA 3K4BA 2IGNA 1MNEA 1Z0XA 4HX4A 2LD5A 4M6XA 4WF2A 1QPMA 6PAXA 1D8KA 2L9VA 4EM0B 4YFXF 1VQPI 1SAUA 3F72A 5LBQA 3PNVA 1X3ZB 1YW9A 3IC7A 4OWRB 4F7ZA 3P9CA 2O6GE 1WCMJ 5HDKA 4XKWA 1DDNA 1RUOA 1ETXA 3BLYA 4A3JJ 1BOAA 2E5NA 5L3CA 3D5RC 5JR3A 2EIKH 3ZMUA 4Y15A 4L5EA 4BHCA 4ZDOA 3UR3C 2FMYA 3CDHA 4GYGA 1FWZA 1TWCJ 2KKOA 3MWMA 4QPQA 1OR7C 5FB2A 4HSRA 1B9MA 1YJWI 2HNHA 3REOA 3ZQFA 3CMEI 3QRFF 4I2OA 2WAEA 4BDYA 2IPQX 2E60A 1VQ9I 2IXSA 3OYIA 2IS1A 4HYEA 1MKMA 3LSKA 5EGOA 3H0DA 1FYKA 1R4MB 1ZKGA 1WH5A 3PIOF 3PIPF 2K85A 3JRHA 3F9KA 3H36A 1VQNI 3DTEA 3TDZC 2V6EA 2EZHA 3QODA 2Q1ZB 1TNTA 1TZLA 2X6YA 4XSZF 2ETHA 1SFXA 3OL3A 4ENJA 4IOCF 3GWZA 3PNYA 1G4DA 4DJAA 3T8RA 3WGHA 4HLYA 3KEYA 2KRCA 3RKQA 2BEOA 1AA7A 4WXCA 4M71A 1Y39A 3FK6A 3HTUA 1TL8A 1ZRCA 5JVTA 5FLXZ 4LIVA 1DQUA 3OMYA 5DUKA 3VYTB 3SZGA 1O57A 5HDNA 2GXGA 4HLXA 4ZYEA 5BPDA 3TKYA 3ZQ7A 4AWXB 5CYVA 3D0SA 4XK4A 4YFNF 4XRFA 5A2QZ 5CKTA 1J9IA 5K5RA 1JKOC 2G7UA 1ZGWA 2VT3A 1CGPA 4GYIA 2WC2A 4ZC3A 4CSWA 4KITB 3ROUA 4CGZA 1ZAOA 2QENA 1Y8QB 3OR2C 3ZPLA 1W4MA 1S8NA 3BR0A 4X1EA 2GIVA 4I76A 2DMPA 2VB6A 5JI6A 5FLXK 4EJOA 1HA8A 1F5TA 2DFIA 1SANA 4BQAA 4ENNA 2HS5A 1W7PB 3CP8A 1UFMA 1GUUA 2P81A 1D0YA 2P5LC 2PJRB 4ON0A 2KZVA 2JPCA 1J5YA 5K5OA 2LLKA 3QU3A 5ICGA 4P96A 3CJQB 5A2QK 1ZR2A 4OIQF 3E6DA 4LMYA 2KDZA 3P9KA 1G3YA 1TWFJ 1X2NA 2JMWA 2EILH 3BPXA 4QIWN 5K5QA 2LF7A 2LG4A 2MW8A 1OCTC 3ABTA 4HSTA 5E3NA 3TQNA 1FNNA 2KJBA 1BR2A 2IVMA 3H3UA 1XDUA 3D5SC 3AG2H 4ZZDA 4PCQA 4N9IA 2DK5A 4HX8A 3FM3A 3CUOA 2LP0A 1QZEA 4CZZA 3K4LA 2DA3A 2QQ8A 4A0XA 2BY1A 1LJ9A 2BZTA 2ZMEB 1FYMA 1OCPA 1V54H 4YRVA 3LFKA 2M7AA 4GRIA 2IT0A 2VE8A 4BEHA 2O9LA 3J80Z 2A61A 4HQEA 4JK1X 5KVRA 2FXAA 5B5EC 2O5RA 3DTIA 4LB6B 3MKLA 1IN5A 1LDKB 5LGNA 3CCLI 3V8KA 2F5CA 3PQKA 3KPHA 2M1BA 3GW2A 2WB1A 3BZ6A 2DMNA 2FOKA 2LVSA 1K7AA 2OU2A 2BBYA 4WX9A 1MIJA 1IDZA 3MD2A 3V8JA 5FFXA 1X4PA 2X1CA 4A3FJ 1J7KA 1GXPA 3RPUD 3HKZN 3B73A 5J47A 2H1LA 3O3KA 1A6QA 4L5JA 1XS9A 2GXAA 2JPBA 4E4HA 3G6EI 3WTYC 1E0EA 3HIFA 1IAWA 1R71A 3S1MJ 1R00A 1R1TA 3ZN1A 2YUSA 3IWFA 3IUOA 2VQCA 3BG6A 3WTVC 1Z67A 2JVGA 1MJAA 2VLAA 2KDOA 3E1SA 4LOCA 3PUFA 2XPUA 1ETYA 4X0GA 5HLTA 5D4SA 1BI2A 1WJBA 5E79C 3OYKA 2DT7B 3I4PA 1J59A 2L54A 3BR1A 3IHUA 4A2UA 3E6BA 3I4MJ 1YITI 2F48A 3T0YA 1O3QA 2O8KA 1EKEA 3LSMA 2VL8A 1U5TB 3ABLH 3HOTA 1WVRA 2V1DA 3LSHA 1SAXA 3H0GJ 1FMWA 3QPLA 4XLFA 3PO3J 4PJNA 4BHPA 1YW8A 4IVNA 4MEXF 3NQOA 1I1GA 2KIUA 2L3DA 2O03A 3BR6A 5CQGA 5E3MA 1G3TA 2W7NA 1TWHJ 3G71I 5BPIA 3BR2A 2GQQA 5IP7J 3A0HC 5EF6A 3K2AA 1D5VA 5K1YA 1V4RA 4XL9A 2NRAC 1V5EA 2OC6A 4G6TB 4CHUA 4G94A 1VQ4I 4HW0A 5B66C 1BI0A 2MSYA 2EIJH 1Z3YA 3EETA 5JHFA 3PQJA 4BQQA 2WBMA 3K4JA 3FMRA 3B02A 3LA3A 2ISZA 2WADA 4RM2A 1ZK8A 3FXMA 3TO7A 4HV6A 2HVRA 4M9ZA 2VUMJ 1W5TA 1JGGA 1XGSA 3FKIJ 2G7HA 1D1CA 1MMGA 4F91B 4ZYDA 4RAYA 4ZJZA 2A6EF 2BHYA 2LOOA 1G3WA 2E34A 4I98B 3SEQA 5J4YA 1YIJI 2BE5F 4UB8C 4FETA 2UWMA 5ICFA 4PSWA 3MFKA 3BCAA 2YR2A 4MLOA 3MZHA 4M3BA 4IQ4A 4MO7A 2CQKA 1TQIA 4LIUA 1OYIA 2DPDA 2LTPA 5F0CA 1O3SA 1MBJA 3D1NI 1TNSA 3I56I 1YG2A 3OYCA 4A3LJ 2B63J 2YSRA 1KU9A 2Q8KA 1TT5B 4B3AA 3W3CA 5E1WA 1WRJA 1J2XA 2XAJA 1TW2A 1XSDA 4IQJA 2OV7A 3TO6A 2F5VA 2CUJA 5B3SH 2KP6A 2DA4A 2XF6A 1SEUA 2MH2A 2DDBA 3ZMDA 3MVPA 3DPLC 4BEHB 5H6QA 2XVCA 2VKEA 3RJPA 3H3VK 3IKVA 2CMPA 4CICA 1DU0A 2E2JJ 1J0RA 2K40A 2XAGA 2PMZN 2M3AA 1W7PD 2OZ6A 1AKHB 1HKTA 1MH3A 4A3BJ 5FKMA 4Y13A 3R61A 2Z99A 2P6TA 2JUGA 3K1MA 5LGTA 3AL0B 3FBNB 2BVMA 2CQXA 2BW3A 2V1XA 3LSTA 2IAIA 1ULYA 5EZGA 4W1UA 4JQFA 2KJCA 2ZNYA 1AWCA 3F8CA 2O3FA 3DEEA 1OPCA 2VJ4A 3ZQGA 2EJRA 3X2QH 3LNQA 1Y6IA 5GADJ 4BE2A 3ZQLA 3GLXA 3U2RA 4UUVA 1RUNA 1RPWA 4I0AA 2CUZA 2W25A 4XLNF 1XGMA 1TWGJ 1WI3A 4WXDA 1K4SA 3DWLE 1FC3A 4MIMA 5D6EA 2IEKA 1OR7A 1EH6A 5AIPA 4B8XA 4NC8A 5DYMA 3E6CC 2H6BA 1BIAA 4V2FA 3ABKH 3L2QA 3E6MA 1YO5C 3OYDA 3GFLA 2NOGA 1ITYA 1HW5A 2QSGX 3M8FA 3S2DJ 3CJRB 3C2GA 3S3NA 2K3FA 3OY9A 2O61A 1T6SA 3RZOJ 1X1PA 4LLNA 2EK5A 4EGZA 2X1DA 3CCYA 2LY2A 4IRGA 3SJMA 2RV8A 3VFZA 1UZCA 5D5XB 2EA4A 2G0EA 3IH4A 1KA8A 4XLEA 3KYDB 3ASNH 2DBBA 2F6CA 2F2EA 4EEFG 2CW8A 2VODA 2K7LA 2QQ9A 1OISA 2K9SA 5EEGA 4V19K 2R5YA 1EH7A 1I39A 2W4SA 2XROA 4RLQA 3CP2A 2DYRH 5D4RA 2EPFA 3DEUA 3FISA 4D5FA 2MD0A 5TJJA 2JA2A 4XRSA 4E7KA 2Z33A 1BJZA 4D7MA 1I6XA 4HQMA 4YEJA 4IHVA 5E8GA 4M3DA 4RGRA 3MKZA 2MBFA 3WGIA 4EJTA 2E19A 1BOBA 3HB9A 1NTCA 3I53A 2QYOA 5EDNA 2KPMA 4PJMA 2R7TA 1DU6A 3MZYA 1VNDA 3S93A 2FUG2 1TP4A 1BJAA 2NS0A 1Y1VJ 4HG2A 1MSEC 2EA2A 3ECOA 3KCCA 2GA1A 3BTLA 3GUDA 5D6FA 1Z6TA 4Y7NJ 2K9MA 1Z3XA 3L2RA 1ON1A 2NOJB 3BZKA 2LC2A 3L2WA 3CCSI 1FIAA 4E7SA 5F04A 1BL0A 3FXRA 4U0YA 3O8HA 1BN5A 2OBPA 2XAFA 2ZXIA 5M5YJ 3KLNA 2R4GA 3DCFA 4BYYA 1YI2I 1R9TJ 2WV1A 3SYTA 5FLVA 2IW5A 1QVUA 2KIMA 3FXJA 4AVPA 2X4HA 2XKOA 2P7CB 2RAEA 1Z7LA 3CDIA 3BR3A 1VQKI 2Y0SN 1LKXA 3LA7A 3I59A 3SFIA 3GLLA 4P1WA 3UNGC 1DPRA 2MLKA 2XPVA 5IYCJ 1YW7A 2JWTA 5DCMB 3LOCA 2VQLA 3S3OA 4X6AJ 5KAFC 4F55A 1JUPA 1FSHA 2R7XA 3QPSA 4EVIA 4U88A 3K6GA 1QPIA 4A3CJ 1EF4A 1X3WB 2DTZA 1IN8A 4OMZA 3NARA 3OIQA 1QRYA 3WODF 3L09A 1D8JA 3HZJA 1MMAA 3BDDA 2HPMA 2OTJI 2EH3A 2OA4A 2OZUA 4RB3C 1PDNC 3SDGA 4A3IJ 5KNLA 2F5DA 2RDPA 4RA2A 3AKZA 3J7AO 1N78A 1IUYA 3OIOA 1SD5A 2BXYA 2CWEA 4ZZLA 3CD6I 3RYPA 3W2AA 5CVJA 2NVQJ 4OOIA 2A5WA 4EJVA 1S6LA 2KIQA 2XF7A 1EJ9A 5LHGA 2E1MC 4HBLA 5JLXA 4BNCA 2CQ7A 2X51A 4M3FA 4L9TA 2CW7A 3V42A 3OR1C 4HDUA 1B8IA 1LVAA 3GBGA 3L7WA 2WY8Q 3HTSB 1KGSA 3WE2A 4BE1A 3IV5A 4N4NB 3V7SA 3QPHA 4E7JA 1Q1HA 4L0ZB 4PJLA 5J4VA 2QZ8A 2ID6A 1ORKA 2D1VA 2DJNA 3KP2A 3SQNA 4GCVA 1FIPA 3RSNA 3HOZJ 3WTTC 5FROA 1I1SA 2KHMA 4B09A 1KQ0A 1MH4A 1GVJA 2BW3B 4P55A 3ZGKA 1JKPC 3RKXA 4DBQA 3RDIA 5CLSA 1HC8A 4KDPA 2QQBA 5M5WJ 1QA6A 2ZJ2A 2XKPA 2R7OA 3OV8A 5DTDA 1FOWA 3AG4H 3ABUA 5E3LA 5GTHC 4N4OB 1R22A 1OYWA 2DMUA 2QSFX 3G3ZA 4BUPA 4NBQA 4AVZA 2Y9ZA 3KP3A 1L0OC 2DDAA 1WJFA 2XAUA 3MAJA 3VOEA 4F93B 5H6RA 4S0HB 1PP7U 2BHZA 3SEZA 1S9HA 4G7ZF 2HYJA 4LLGF 3QOPA 5E8IA 1KU2A 3R0AA 1KQ9A 4MQVA 3K70D 3ZCOA 1RKWA 2PQ8A 4BXXJ 5LEJA 2H8WA 3SDBA 3F23A 2FRHA 1YTYA 3WHCA 1IXRC 3QAHA 1A36A 3S2HJ 2KISA 1MNDA 3CJNA 2B0LA 3OOPA 2WA0A 1FP1D 3LSJA 3QQAA 3LAJA 2R5YB 1F9NA 3A1YA 4IHWA 1GT0C 2IS6A 4BBRJ 1TTYA 4MTDA 3FXLA 3OS1A 1WHUA 2ZXHA 1JKQC 3LA2A 2FJ1A 4XN3A 1W0UA 1ZG1A 5M5XJ 5HDGA 4AUXA 1YJNI 1LE8B 3SFZA 5HNHA 2PMUA 1W5SA 4RB2C 4Y17A 2CSOA 3Q0WA 1D5YA 2VQGA 4ZH4F 5DM7F 2TCTA 4PGGA 3BJOA 3J7ZI 4IRIA 1B6AA 1Y8RB 2MLGA 3HM5A 2DN0A 1S7AA 4D9JA 5LFAA 2VE9A 4A69C 4HOBA 2EFNA 4IJAA 4L9NA 3VEPA 3JR9A 1TWAJ 5DDGA 1DGWY 2OJED 4U7BA 1LFPA 2XF5A 1U8RA 4FHTA 1K61A 1U0JA 2Y30A 2QKMB 5GAEJ 4YIFA 4HA8A 1KU3A 2ESHA 2ZSIB 1A04A 1P7JA 5J8FA 2CV2A 4JX6A 1QGPA 2M87A 3FWEA 5EEAA 1X1BA 3QYFA 5EG0B 2VONA 2RQPA 2VC1A 1XSXA 1LPQA 1UAAA 3CCVI 3CC7I 2H8RA 1QU3A 5CPRB 3S16J 2JJ7A 2LK2A 1M1EB 1HKQA 1MNMC 5IT9Z 4KISA 3TL4X 3ZN0A 3GTMJ 2RVCA 2VBXA 4BHBA 5IOZA 2F4IA 1XSVA 2L4AA 4C3IJ 3PO2J 1D0XA 3KZYA 1HKSA 2LDUA 3VYRB 3LWFA 1OJLA 1SD6A 2YPRA 1UHWA 2AXLA 4XLPF 2KT0A 4UUTA 1B8IB 3G1LA 3GTKJ 4KICA 3I0TA 5E20A 2V4JC 1HOMA 2LY9A 4UXNA 2QEXI 4HNVA 4KYWA 4L18B 5IT9K 1FLIA 2EFPA 2R93J 2PMZA 1H9TA 3GFJA 2IGMA 4W97A 4BU2A 2XGEA 3F8FA 1BW5A 2K3PA 2KLOA 3HHGA 4GXOA 3S32A 4AYBA 3JCUC 1H9GA 3RYRA 3CO7C 2R7UA 2BV6A 3H5RA 1OCZH 4CH7A 3QWLA 2HYFA 3KX2A 3CUQC 3FK7A 3BROA 4NC6A 1D1AA 4EM2A 2D1HA 2R0QC 2NVUB 4JYKA 2TRTA 3G2BA 4KIGA 3A01B 4ZDLA 1VTNC 2K4BA 4A6EA 2K9LA 3L9FA 5E18F 1PUFB 3S2WA 2JA5J 3WU0A 4B43A 5F0FA 2ZCWA 1USTA 2R7ZJ 1NHAA 2GWRA 5LGUA 2HR3A 2RNGA 2XSJC 2VASA 4MGRA 4CCOA 2EQRA 4C2MJ 2ZJQF 3DFGA 1XN7A 4PJJA 1F43A 3KIOA 1P2FA 4A12A 2JN6A 3CC2I 2L5QA 2R92J 2M5WA 3KYCB 4XSXF 1VFCA 4G9YA 1FT9A 3G73A 1R58A 1Z9CA 2F5FA 2DTRA 4MHGA 4M9SA 3B6CA 1STZA 1GV2A 1XMAA 4WCGA 2R5ZA 2Z16A 2FBIA 3HEFA 4FQGA 1SVLA 3G1OA 2K9QA 2R7WA 2I5UA 3EUHC 1ON2A 4BY1J 1ETKA 1ZTRA 3DKXA 1GVDA 3DKWA 3K4KA 3TBIA 4HZFA 1JTYA 3WHBA 2R7RA 3DV8A 4S05A 2JK3A 3HSEA 1H8AC 2FNAA 2V26A 4WXHA 3WTSC 1TC3C 2STTA 2L9SA 3M1EA 4HEA2 2QA4I 2V9PA 3DBHB 3I3LA 3BG9A 4BBSJ 2VOPA 4GGGA 2IS4A 3GMEA 2CQNA 2HZTA 3KFWX 2M8GX 1ZG3A 2KQRA 2M9HA 3H9QA 3ZQHA 4IHXA 4ABZA 1MBFA 3HRSA 5K7HA 1NG6A 1XX5A 2EV5A 4UVAA 2BOLA 4XIDA 2HXOA 4N9HA 4E70A 3PUBA 1GHCA 2QVOA 4B44A 3DU6A 4C9YA 4F52A 4BACA 1T98A 4HX7A 3OSFA 2EB7A 3JTHA 5HS9A 1T38A 2W84A 3GCMA 3CDLA 1XGNA 2LKSA 1KZHA 2QM3A 3I9V2 4HRIA 3GVAA 5DM6F 3GF2A 2UV1A 5BOXA 5HVQC 5IP9J 3OSGA 4EJUA 2N8GA 3BG7A 3ZMTA 1RETA 3NEUA 3KP7A 4IHYA 2R7VA 2HYGD 3K69A 4F3QA 3ZRGA 1ZG5A 2CS3A 3KYLA 1IC8A 3AG3H 3RQIA 5EGOB 1BM9A 3EDPA 3HRMA 1KQ8A 4A93J 4G7OF 2A6TA 3GYHX 2VPRA 4YELA 1ZELA 5HLIA 2DOEA 4A0YA 3WGGA 5FD6A 3PL8A 1V3FA 4R79A 1FBQA 1Y56A 3GTJJ 3FDYA 2MFZA 3A2KA 1B4AA 3ERMA 2IA0A 3H35A 4AU7A 3LMMA 1B59A 2L7MP 4OIPF 3VDXA 3A4CA 2QBYA 4C3JJ 3TW7A 1J09A 3HSFA 1JJ6C 3V4GA 4ANJA 1YJ9I 2EIMH 2HOTA 2K5CA 4A5NA 1IZ1A 4A3MJ 4Q5SF 1W5CC 3I54A 2XGDA 2EZIA 4M9XA 3CESA 1R5ID 5L3FA 4KT6A 2BVLA 2ZJRF 2EBIA 2HU9A 4IX7A 2HVQA 2ZMEC 3F8BA 3N97A 4FCYA 2VI6A 3F6VA 4CXFA 5HOOA 4BJ5C 4DOZA 1W36D 1T33A 5KCMA 1LB2A 4PK4A 2R7FA 2X48A 4QTRA 1DPUA 1R1UA 1B72A 2PI0A 3DTKA 1OYYA 3PFIA 1D3YA 1FOYA 4KNYA 2L4MA 1UB9A 2HWVA 2ZJPF 1P92A 1S5LC 1P7IA 5ILSA 4BGDA 2H27A 1MJBA 4Q48A 3OYEA 4M73A 1YX5A 3GTPJ 1BBYA 3VWBA 1BI1A 4FT8A 1I3QJ 1Z1DA 2Q0OA 2STWA 1WJAA 3FM5A 3QU6A 1T0FA 2ADUA 2HDCA 2W57A 1USSA 5LHHA 3RKYA 2PLYA 1WH7A 3HOUJ 5B1AH 2OTLI 4LFUA 4AM3A 3HDDA 5TGTA 2MGQA 3OYBA 4UB6C 1VQLI 3RI4A 2LKPA 3GFMA 1B9NA 2L7ZA 1WZ2A 4V2GA 5AONA 1DP3A 3H92A 4ZYHA 2DAOA 2QF7A 1MD0A 5ICCA 4HF1A 4NDLA 2DODA 2PFBA 3U21A 2R5ZB 3OYJA 4A3GJ 1WJ5A 5CVRA 3M1CA 4XLHA 3BPVA 1WWXA 4ENKA 2COBA 4L9JA 5FO5A 1HSTA 2K02A 5IP6A 2M4KA 5DV5A 4C3HJ 3FXOA 1QO0D 2GOXB 3OYFA 3IKTA 1VQOI 3HOWJ 1A5JA 3R0JA 4DYQA 1QZYA 4EQQA 3IAS2 2GLOA 4F92B 2DT6A 2DYSH 1U5TC 5TISC 3BWGA 3M9AA 1LDJA 3GTGJ 4LK0F 3IL2A 1IRZA 2FQ4A 1WKMA 9ANTA 3COAC 2UXNA 1Y0NA 2PJPA 2PEXA 3U1DA 2JVHA 3RIRA 3ZMVA 1OKRA 2DA5A 2DW4A 3FX3A 4XKCA 5FLMJ 5HS8A 1XB4A 5DS9A 1QQIA 2ECCA 2DFFA 2ZFWA 4LITA 5J1UA 4B47A 3WTUC 2DA1A 3WTWC 3S14J 1SFUA 2IA2A 4IL6C 3K1NA 2A68F 3L2VA 3F22A 4CYDA 2OQGA 2Z1DA 2FBHA 2VBYA 1R6RA 3E5QA 2OUMA 2CV1A 5E3OA 4L0YB 2UUZA 4O6JA 4OMYA 2CFOA 5KHDA 2V1UA 3ASOH 1RESA 2EFWA 2B9SA 1O4XA 2DFHA 1IJWC 1B1BA 2DFEA 2DJIA 1R5HA 3W6VA 1IN6A 1P6RA 5F27A 5J1RA 5C3EJ 5HLGA 4JX5A 3CO6C 1MDMA 3DEWA 2E36A 2DCEA 4S04A 3LQQA 1DUXC 4JBAA 4BJ6C 3JREA 1WJCA 2XGCA 3O8GA 3FXQA 3I5UA 3RTRA 4G7HF 3FHNA 1OLTA 2XB5A 2QQAA 1BR4A 1SVMA 2HI3A 1CF7A 5EYRA 1LFUP 4IPAA 1XG1A 4E7LA 1SD4A 2X1EA 3F8NA 5BMZA 3HSRA 3IH3A 3L1PA 2VQHA 1WSUA 4P9UA 1ETOA 2QBYB 1G2HA 2L7FP 1C0WA 5L3DA 2HOSA 1IO2A 4LK1F 2Z5UA 3H3ZA 1FSEA 2F4OB 2CRGA 1IV6A 1BC7C 1TQPA 3FIWA 5F64A 3ESWB 2ELHA 2PX9A 2C6YA 4KIFA 1ZLKA 3EUAA 2M30A 1WI9A 3I71A 2JUCA 1MBHA 5ED4A 3WE3A 2HQAA 4D0PA 4A3KJ 2LNBA 2P8TA 2LKXA 3GTOJ 3RCOA 3E3VA 3HG9A 3HXLA 2KZGA 4XOPA 2CGPA 5GAGJ 2LFBA 1U3EM 1KONA 5D5UB 5CQEA 1BIBA 1QVTA 5IYBJ 4C30A 3GZ6A 4HF0A 3CUQA 2WB1N 1AOYA 2LBFA 2NVTJ 2UXXA 4CO8A 1TQMA 1GDTA 5HS7A 1TT0A 3A02A 1XMKA 1P4AA 4B1RA 3TOBA 2FU4A 4KUMA 1S7OA 3BQZA 2AQEA 2QLZA 1IXCA 4KMUX 5JLWA 1Q1VA 3ZQCA 2ME6A 4UY8I 2FF4A 2HOEA 2Q2EA 1ZRFA 4RB0A 5ILUA 3M8JA 1FTZA 2NYXA 3GEZA 3J7AY 2ECBA 1JT0A 5TRDA 3QP6A 1TW3A 4NQWA 3ONQA 2HDWA 3ZQIA 4BAYA 2X6OA 2I8DA 1QZZA 3NWTA 5IPAA 2DOAA 3H9GA 3V8LA 3HYIA 3OYMA 4CYCA 4GO1A 3RPQA 4DYCA 4ESBA 4RBOA 4ASNA 1OQYA 1ETVA 3PJRA 1T2KA 2COMA 3MEXA 4Y4RA 3R6SA 1IRGA 2HXIA 2VKHA 3D5LA 1XDSA 2K4JA 2YX4A 3C2BA 3KETA 1G3SA 1ODDA 1FEXA 2WAQN 1GXQA 1K78A 3FBIB 1IN7A 5D5VB 1JUSA 4IXAA 1O3RA 4XM3A 2IBDA 3S8PA 3BTIA 1Y1WJ 4AIHA 2DXIA 4PZJA 2LY1A 5E1XA 1O3TA 4MFEA 2MYSA 2ZNZA 2K27A 1RIOH 2KFDA 2DT5A 2JRMA 3K4NA 2R7QA 2RNJA 3AFHA 5F6FA 5D8LB 5FFZA 2VKVA 4XICA 1IRFA 2EINH 2NNYA 2L7KA 2NS8A 5GPCA 5CJ9A 2LH9A 2BXZA 1RR7A 1SMTA 4R8HA 4LG0A 5EZHA 1P9QC 4XLAA 1P4WA 3HPHA 1IDYA 3LSRA 3BJAA 2H1KA 4PFPA 1UELB 4Y52J 2VXZA 2AXTC 4NC7A 4BDZA 3HOYJ 3U1KA 3DPUA 3FZVA 3TP0A 1D1BA 2D2WA 1XC5A 1Z91A 5ICEA 1JHFA 1VQ6I 3HKZA 4XMYA 3HOSA 3CF5F 2M2EA 3WG7H 4E7IA 2WTEA 5FRNA 2OPTA 3W6KB 4UVCA 4EJWA 3JRFA 3FXUA 4ZYAA 3U9GA 3E7LA 3ML6A 1VF9A 1ZARA 5CVIA 5F0HA 1MDMB 1G6NA 3GTQJ 4K2EA 4RGSA 3CC4I 2X9DA 3KP6A 1YFHA 1IW7F 1S7EA 3ZMSA 2MC3A 4NB5A 4HV5A 2E1OA 4Z6YA 4KN4X 2L9RA 1XD7A 1BR1A 1A6IA 4ZDPA 3JAMZ 1UJ8A 4HDVA 3ZXSA 4CZCA 1FZPB 1POGA 2BY2A 1MJ9A 1MBEA 2IA1A 5F1JA 3M4OJ 3DXJF 3R4KA 1FPQA 5LD2C 1JJ8C 3T8TA 5FGMA 4J00A 5DEQA 4O5VA 1YX3A 1X4OA 3IP4B 4YIIA 3PM1A 4OAYA 4UVBA 4I09A 3WTXC 2CV0A 1S72I 2H6CA 4PFOA 2BY0A 2P4WA 2J5PA 3RKWA 3K1PA 3UKGA 4DIQA 4BL0B 3FKJA 2LMDA 3OYLA 4J19A 2ZB9A 2EFOA 4RAFA 3SZTA 2HTSA 1IV8A 2V1NA 3QP5A 3VYSB 3JAMK 1UHSA 2ESNA 1VQ8I 3F8MA 3HGGA 3EUKL 5L3BA 2BGCA 3ELKA 3T1BA 5JFRA 4M3GA 2GA2A 1SC7A 1PJRA 2Y31A 1R7JA 4H0EA 2OD5A 2DMTA 3GZNB 2TDXA 1Z7UA 2E7XA 3MZ8A 3BT9A 3CUQB 3OS0A 4DW6A 2LBFB 4RM3A 4CDGA 4OU0A 3K4CA 5FKKA 3I59B 2DA7A 3IWZA 3OWTA 4NHJA 2VJIA 4G6DA 2Y0MA 1MMSA 1FMVA 2HQ5A 2JA6J 3I4NJ 2Q2EB 2ME0A 2W00A 3DLAA 4DNCA 1YRNA 3ERED 4II2A 1ETQA 1YS7A 2L9NA 3SZPA 4XKVA 5JVGF 2MD5A 4C2UA 3EYYA 4NQWB 4FTHA 3JRCA 4CA0A 2HDDA 5D8KB 1LQ1A 2VPLA 2PG4A 1SFKA 1FJLA 3DBLB 5BNGA 2LREA 3HC7A 1U8BA 1NK3P 4CYCB 5IT3A 1HSJA 1Z05A 3MKWB 2MG4A 2GAUA 1K6OA 2JQ7A 2X6XA 2Y2ZA 2QKLB 3Q5FA 4KFCA 1K78B 1I6HJ 2Y48A 3H5NA 2A6HF 2LYCA 2X0LA 2Z2SB 2OF7A 4CUGA 1X19A 2JT1A 2P6SA 1X1CA 2LRDA 5CVVA 4G6QA 1MGTA 2DQLA 3WTZA 4DBRA 2XIGA 1U5TA 1N77A 2W24A 2XV4S 4E7HA 2W48A 2AHQA 3KZIC 2VKDA 2K86A 3PFYA 3S1NJ 2HKOA 4RLFA 3LQRA 2HGCA 4O3MA 4C2TA 2VT2A 3DKYA 4LG0B 1WQ2A 2VBWA 2VBZA 3BR5A 2QWWA 2P7VB 4PSXA 4FX4A 5EJCA 2P5KA 1FBUA 1JUMA 3WU2C 2JTVA 3LSIA 1ZHFA 2R7DA 5FKLA 1LVKA 2VN2A 1PP8F 4I7HA 1V55H 2H09A 1EH8A 1MW7A 1BC8C 1BA5A 1JT6A 1XTAA 3OYHA 4Y33A 4Y3OA 3K9TA 4ESFA 1ETWA 2K9NA 3IRRA 3HJEA 3JRGA 2VJ5A 5DCFA 2M4GA 2ISYA 3K0LA 2OQRA 2ICWG 1R4NB 1H0MA 4LJZF 3A0BC 4RS8A 5FKNA 1H89C 3JSPA 1R1VA 1HLVA 1VQ7I 2WY7Q 5LHIA 2ID3A 3VYUB 2NNNA 2PMHA 4P9FA 2DA6A 1SMYF 1U78A 2GIZA 2WWYA 3GZ5A 1W36C 2ELJA 3BCBA 3FMQA 3HUGA 4BXFA 1LFBA 1MMNA 1JI8A 4KJZA 5KAIC 2CW0F 5HODA 5F08A 2KRFA 3CMYA 4G8XA 4FE7A 2YU9J 2FOWA 3W6JB 2DPUA 3TMOA 3CCJI 2XAQA 1IN4A 3Q9VA 5GP9A 4CCNA 1XGOA 2ZXJA 1RR8C 1WJEA 3ULQB 1S3JA 2EZKA 2M8EA 3BG5A 3H1CA 4BXUA 4WWCA 1VI0A 2EV0A 3CCEI 3MMYB 4ZTFA 2KRHA 3GTLJ 1NK2P 3QOEA 3DPTA 2CYYA 3J7YJ 4DZJA 4RGUA 3EPZA 4A3DJ 1MBGA 1LUJB 1UCRA 4KN7X 1I50J 2E7WA 1VZ0A 3JW4A 1ZYRF 2DMQA 1LDDA 1ZGAA 3BY6A 2E5ZA 2W82A 2FE3A 3NRVA 4OAZA 1YHQI 2VXDA 4E7ZA 5CVUA 2E2HJ 3S17J 3W2WA 2VOOA 2OAZA 1F1ZA 1XPXA 1R49A 3JRDA 1FYLA 1T56A 4IOAF 1RI7A 3BG3A 2LR8A 2XB0X 4UHTA 1ENHA 1O7LA 2XGXA 3TOAA 4RB1A 3F3XA 3WG9A 5J6XA 4BY7J 1JE8A 3KEOA 4I01A 2XC7A 3G4SI 2I10A 4U7DA 1AKHA 2R3SA 2V7FA 3FF5A 5FKOA 3MCZA 4AIKA 1HXDA 3IRQA 3DBRB 2E1CA 3W2VA 3OL4A 5E17F 2XHKA 1FY7A 1J75A 4L5IA 1W1WE 1T08B 4XN0A 2Z3YA 3L2CA 3G1MA 3KEQA 3CMAI 2IJLA 2W1OA 2Y0SA 1TLHB 1XCBA 1MMDA 2CUFA 2GOMA 1WGXA 2QUFA 3BTCA 3KP5A 2V79A 3HGYA 3P5JA 4AD9A 1OMIA 2WV0A 3NWSA 1KYWA 1A35A 3O2PE 1U2WA 2LSOA 2ZKZA 3V7CA 2MH9A 1GV5A 3JTGA 3J80K 1YRNB 1RNLA 1JTXA 2DA2A 2XPWA 3B6AA 3S1QJ 2OCCH 1OCCH 3PNTA 3WU1B 5H2FC 3MQ0A 3E5XA 3FMSA 4GFBA 2H94A 2JZYA 3HRUA 4EM1A 2NVYJ 3N05A 5BQTA 4RGXA 5LRSA 2JA8J 2J5OA 2IP2A 3M8EA 4JOMA 3M7GA 3VSKA 4UUSA 3RQ4A 2ZO4A 3CMMA 2EFQA 2PBIA 2WAQA 4IF4A 3ZR8X 3C3WA 4HAMA 4YIRX 4ESJA 1FOXA 1ZN2A 5M3MJ 3J81Z 2GXBA 1YQAA 4J01A 1NG7A 4LGWA 5E1ZB 1KU7A 2MABA 4LD5A 1K83J 4UV9A 4RDUA 1AHDP 2O7OA 3TDUC 3BZCA 3CQZJ 5HNFA 2OCEA 4N0BA 3QYBA 5C44J 2KIFA 5H20A 2XAHA 3SHFA 2AQFA 1ZQ3P 1IUFA 4XORA 2A3SA 1K79A 1HW2A 1HBXG 1QHGA 4PGHA 1YYVA 1UHMA 2L02A 1DGRM 4AIDA 5J3LA 1FX7A 3K4MA 2HZDA 5IYDJ 1IGNA 1ZRDA 2JSCA 3J81K 1RRJA 4DYRA 3I64A 2A69F 2BYVE 5LEKA 5J1YA 2GM4A 3CLOA 2G9WA 3CCMI 5C4JJ 4BH9A 2FSWA 3Q0VA 1IXSB 3A03A 2WAFA 5B1BH 4IO9F 4P5OA 3I58A 4Z2YA 4JP0A 5KK1A 4LLLA 5M3FJ 1EA3A 4XONA 1HF0A 4DGWB 2M34A 1EV7A 3ZP5A 1JXSA 1LEAA 1T8IA 1O7FA 3BOQA 1UG2A 1X58A 3DQVC 3FXKA 3HUGB 4RAGA 4B4CA 2P0WA 1LNWA 5DCMA 1I27A 4LG3A 1ONVA 3LAPA 1PVEA 2F5EA 2NXNB 5AIQA 2E71A 3CCQI 1SFOJ 2YU3A 3CCRI 1TBXA 3DU5A 1V5FA 2CH0A 3C2HA 2A05A 2PN6A 4Q4ZF 1PUEE 2ZSHB 1G59A 4QPOA 1FTTA 2HTJA 3K7AJ 1FBSA 4NUBA 3LFUA 3E5UA 1LEBA 1U9OA 1YS6A 3HL2A 5LRRA 2A5YB 4M3EA 3Q0UA 3R60A 3E0JB 3DLLF 3KZZA 1KYZA 2Y75A 2QSHX 3S15J 2V6CA 3OYNA 3TW6A 2V9VA 5L3GA 4WK8F 2AO9A 3CJTB 4BQNA 2CQQA 4XKBA 5FD5A 3KE2A 1N25A 4A5MA 1QNTA 1Z77A 4FX0A 2ZFUA 4ITVA 2L0KA 3DF8A 4M74A 2B7EA 2Y9YA 1YLFA 2HQNA 4TV7A 2YX7A 4PJ0C 1I5ZA 4XLCA 1K6YA 3SXYA 3GFIA 2FNPA 1GLNA 5GTIC 2FQ3A 1E3OC 1MBKA 2E35A 4U0WA 1W0TA 5ILVA 4B3XA 3TO9A 3I55I 2HQRA 4PDKA 2M7BA 1ACIA 3FHZA 1JHHA 2A07F 5EEHA 2Y69H 4D5CA 1R5GA 4AYBN 1T39A 5IY5H 1X1DA 4M6YA 3OYAA 4QLCU 2X85A 4KMFA 1APLC 1U9NA 3QPTA 3HHHA 4AC0A 1DP7P 4XBFA 2XSDC 3S3MA 1R36A 2EV6A 3HBLA 4MNUA 2MA3A 4MQ9F 3BP8A 3O6BB 4I0BA 3AG1H 1E17A 1HDDC 5LLQA 3NAUA 1OCRH 2QGUA 5J40A 5DD8A 4XQFA 4JX4A 2VC0A 1YIOA 1WJDA 1ZR4A 4D7NA 1E3HA 2X6WA 4KA4A 1WPKA 3CTAA 2FMLA 2L2OA 2D45A 4EV0A 3ZMZA 1T95A 3TP3A 2HPIA 3PSFA 3RPUA 2E1MB 4UUSB 4EGYA 2GBYA 3LSPA 1N75A 2KL4A 2V9KA 4II3A 2DO7A 4BQOA 2DQRA 1E3PA 2E1NA 5K7FA 3HOXJ 4IZZA 1QHHD 2FEZA 2GZWA 1HQCA 3ISPA 2QCOA 4XRSG 1A31A 4OINF 3ZQQA 3JRAA 1CQTA 4UV8A 4LB5A 4XOTA 3IAM2 1ZGJA 3K70C 2RGVA 4RMNA 2EZLA 2XRLA 4BKXA 2HEOA 4MTEA 3AAFA 4HNUA 5DD4A 1LE8A 4ENMA 2HFHA 1YOVB 1B72B 1ZH5A 1QBJA 1BI3A 2ACJA 2XASA 2M45A 3P7NA 1X2MA 3AL0C 3K10A 3N4MA 4NNJA 3VPRA 2ELKA 2CFXA 1SD7A 1U6GA 2XRNA 3CZ6A 2KMUA 4EMSA 3BQYA 3BC8A 3L2UA 4I6ZA 2L01A 1ZREA 1BW6A 2VIXA 2M0MA 4I02A 2IGOA 4ZTJA 2DOFA 1Z6RA 4CCKA 3GXOA 2FA5A 5K7ZA 3HRTA 3F6OA 4MFDA 4YFKF 2DU9A 4D1QA 3F21A 1WFXA 3F0CA 1RC9A 4DQ2A 2NS7A 3CCUI 2D5VA 3T5XA 4U0VA 4QSHA 1HDPA 3K2ZA 4PUSA 4G12A 1IRXA 2BY3A 4BJTA 3C18A 1I3AA 3CLQA 1G8XA 1V5GA 4U87A 1H88C 4OIOF 3TGNA 4A3EJ 3M3YJ 1HW1A 1SVOA 2CUEA 3QYEA 2CG4A 4XNFA 5FRMA 5IOYA 5EG0A 2JA7J 2FD5A 4HNTA 2RKHA 4KT5C 1JKRC 3BTJA 3EUHA 4I99C 1E2XA 3HPGA 4ZYGA 1OCOH 3L00A 2E2IJ 2ZBKA 4BE0A 1X1AA 3LL7A 4HF2A 1JGSA 2Z9OA 3VSLA 1MZBA 4CCJA 4Q47A 1MSFC 2JSPA 3VODA 1XMXA 1ZLJA 4FISA 3M07A 3RZDJ 2NAZA 1F4KA 1REPC 2RREA 4BS9A 2R7SA 2LF8A 1R23A 2F4MB 5JHUA 2CO5A 3ZOBA 3OYGA 5FJ8J 2ZXWH 4IHSA 1IG7A 3V7RA 4A6DA 2XDVA 3DP7A 2VJJA 3Q3SA 3GX4X 1IF1A 3BJ6A 4DZPA 2W85A 4XRMA 2FBKA 4XR6A 4IRHA
chains in the Genus database with same CATH topology
2RC4A 3P9IA 2XUBA 4AIJA 1RZ4A 3EYIA 4L9VA 4A0ZA 1SFEA 2O0YA 3ECHA 2HKXA 4YG2F 1L3LA 2O8XA 5L3EA 4IHTA 4UNOA 1P4XA 3Q9SA 5ERIA 1W7PA 4M72A 2UZKA 3C7JA 3JSOA 2DLLA 2AS5F 1S29A 1Y0UA 1CF7B 5DUIA 3KP4A 1X3UA 2DI3A 2IRFG 1FP2A 3E97A 3EQLF 2DK8A 4OIRF 2P5VA 5J8CA 4R1HA 4KIBA 2RN7A 5D5WB 1XCVA 4QWQA 3GO5A 1FOKA 3C1DA 5BS6A 3VB2A 2JRTA 4MEYF 2ZMEA 3KLOA 5HLHA 5F1RA 4RAZA 2EWNA 4ETSA 4HX4A 4M6XA 4WF2A 1QPMA 6PAXA 1D8KA 4EM0B 4YFXF 3F72A 5LBQA 1YW9A 3IC7A 4F7ZA 3P9CA 2O6GE 5HDKA 1DDNA 1RUOA 1BOAA 5L3CA 5JR3A 3ZMUA 4Y15A 4BHCA 2FMYA 3CDHA 4GYGA 1FWZA 2KKOA 3MWMA 1B9MA 3REOA 3QRFF 4I2OA 2IPQX 4HYEA 1MKMA 1FYKA 3TDZC 1TNTA 4XSZF 2ETHA 1SFXA 4ENJA 3GWZA 1G4DA 3T8RA 3WGHA 4HLYA 2BEOA 4WXCA 4M71A 3HTUA 1ZRCA 5JVTA 5FLXZ 5DUKA 1O57A 5HDNA 2GXGA 4HLXA 4ZYEA 5BPDA 3TKYA 3ZQ7A 4AWXB 5CYVA 3D0SA 4YFNF 4XRFA 5A2QZ 1J9IA 5K5RA 2G7UA 2VT3A 1CGPA 4GYIA 2WC2A 3ROUA 4CGZA 1ZAOA 2QENA 3ZPLA 1W4MA 1S8NA 2GIVA 5JI6A 5FLXK 4EJOA 1F5TA 2DFIA 4BQAA 4ENNA 2HS5A 1W7PB 1UFMA 2P5LC 4ON0A 2JPCA 1J5YA 5K5OA 3QU3A 5ICGA 4P96A 5A2QK 4OIQF 3E6DA 4LMYA 3P9KA 1G3YA 3BPXA 5K5QA 2LF7A 3ABTA 3TQNA 1FNNA 2KJBA 2IVMA 3H3UA 1XDUA 4ZZDA 4PCQA 4N9IA 2DK5A 4HX8A 3FM3A 3CUOA 4CZZA 4A0XA 1LJ9A 2ZMEB 1FYMA 3LFKA 2IT0A 2VE8A 3J80Z 2A61A 4HQEA 4JK1X 5KVRA 2FXAA 4LB6B 1IN5A 1LDKB 5LGNA 3V8KA 2F5CA 3PQKA 2M1BA 3GW2A 3BZ6A 2FOKA 1K7AA 2OU2A 2BBYA 4WX9A 3V8JA 5FFXA 1J7KA 1GXPA 3B73A 3O3KA 4L5JA 2JPBA 3WTYC 3HIFA 1IAWA 1R00A 1R1TA 3ZN1A 3IWFA 3WTVC 1MJAA 5D4SA 1BI2A 3I4PA 1J59A 2L54A 3IHUA 4A2UA 3E6BA 3T0YA 1O3QA 1U5TB 3HOTA 2V1DA 1SAXA 4BHPA 1YW8A 4IVNA 4MEXF 3NQOA 1I1GA 2KIUA 2L3DA 2O03A 1G3TA 5BPIA 2GQQA 1D5VA 5K1YA 1V4RA 2NRAC 4CHUA 4G94A 4HW0A 1BI0A 3EETA 3PQJA 3FMRA 3B02A 3LA3A 2ISZA 3TO7A 4HV6A 4M9ZA 1W5TA 1XGSA 2G7HA 4ZYDA 4RAYA 2A6EF 1G3WA 4I98B 2BE5F 2UWMA 5ICFA 3MFKA 2YR2A 3MZHA 2CQKA 1TQIA 1OYIA 2DPDA 1O3SA 1TNSA 1YG2A 2YSRA 1KU9A 2Q8KA 5E1WA 1WRJA 1J2XA 2XAJA 1TW2A 1XSDA 3TO6A 2MH2A 3ZMDA 3DPLC 5H6QA 2XVCA 3RJPA 3IKVA 4CICA 1J0RA 2XAGA 2OZ6A 1W7PD 1HKTA 4Y13A 3R61A 2Z99A 2P6TA 3K1MA 5LGTA 2V1XA 3LSTA 1ULYA 4JQFA 2KJCA 2ZNYA 1AWCA 3F8CA 2O3FA 1OPCA 2EJRA 4UUVA 3GLXA 3U2RA 1RUNA 4I0AA 2W25A 4XLNF 1XGMA 4WXDA 1FC3A 5D6EA 1OR7A 1EH6A 5AIPA 4B8XA 5DYMA 3E6CC 2H6BA 1BIAA 3E6MA 1YO5C 3GFLA 1HW5A 3M8FA 2O61A 1T6SA 4LLNA 2EK5A 4EGZA 4IRGA 2RV8A 3VFZA 5D5XB 2EA4A 1KA8A 2DBBA 2F2EA 2VODA 2K7LA 2QQ9A 5EEGA 1EH7A 2XROA 5D4RA 3DEUA 5TJJA 2Z33A 1I6XA 4HQMA 5E8GA 4RGRA 2MBFA 3WGIA 4EJTA 3I53A 2QYOA 3MZYA 1BJAA 2NS0A 2EA2A 3ECOA 3KCCA 2GA1A 3GUDA 5D6FA 1Z6TA 1ON1A 3FXRA 4U0YA 1BN5A 2OBPA 2XAFA 3KLNA 4BYYA 2IW5A 2KIMA 4AVPA 2X4HA 2XKOA 2P7CB 3LA7A 3I59A 1DPRA 2MLKA 1YW7A 5DCMB 1FSHA 4EVIA 4U88A 1IN8A 4OMZA 1D8JA 3WODF 3L09A 3BDDA 1PDNC 2OA4A 2OZUA 4RB3C 2F5DA 2RDPA 3J7AO 1IUYA 1SD5A 2CWEA 4ZZLA 3RYPA 5CVJA 4OOIA 4EJVA 1S6LA 5LHGA 4HBLA 4BNCA 4L9TA 4HDUA 1LVAA 3L7WA 3HTSB 1KGSA 3WE2A 3V7SA 3QPHA 1Q1HA 4L0ZB 2QZ8A 2D1VA 3KP2A 3SQNA 4GCVA 3WTTC 1I1SA 4B09A 1KQ0A 1GVJA 4P55A 3RKXA 3RDIA 5CLSA 4KDPA 2QQBA 2ZJ2A 2XKPA 3OV8A 3ABUA 1R22A 1OYWA 3G3ZA 3KP3A 1L0OC 3MAJA 3VOEA 5H6RA 1PP7U 4G7ZF 4LLGF 3QOPA 5E8IA 1KU2A 3R0AA 1KQ9A 4MQVA 2PQ8A 5LEJA 3F23A 2FRHA 1YTYA 1IXRC 3QAHA 2B0LA 3CJNA 3OOPA 1FP1D 3LAJA 1F9NA 1TTYA 4MTDA 3LA2A 1ZG1A 5HDGA 3SFZA 2PMUA 1W5SA 4RB2C 4Y17A 2CSOA 4ZH4F 4PGGA 3BJOA 4IRIA 1B6AA 2MLGA 1S7AA 2VE9A 4HOBA 2EFNA 4IJAA 4L9NA 3VEPA 5DDGA 4U7BA 1U8RA 4FHTA 4YIFA 4HA8A 1KU3A 2ESHA 1A04A 5J8FA 1QGPA 2M87A 3FWEA 2VONA 2RQPA 2VC1A 1XSXA 5IT9Z 1HKQA 3ZN0A 2RVCA 2VBXA 4BHBA 1XSVA 2L4AA 3KZYA 1HKSA 2LDUA 3LWFA 1SD6A 2YPRA 1UHWA 2AXLA 4XLPF 4KICA 3I0TA 5E20A 4UXNA 4KYWA 4L18B 5IT9K 1FLIA 2EFPA 1H9TA 3GFJA 3F8FA 3HHGA 4GXOA 3RYRA 1H9GA 3CO7C 2BV6A 2HYFA 3CUQC 3BROA 4EM2A 2D1HA 4KIGA 1VTNC 2K4BA 4A6EA 3L9FA 5E18F 3S2WA 3WU0A 2ZCWA 1USTA 1NHAA 2GWRA 5LGUA 2HR3A 4MGRA 3DFGA 1XN7A 1P2FA 4A12A 2M5WA 4XSXF 4G9YA 1FT9A 3G73A 1R58A 1Z9CA 2F5FA 2DTRA 4MHGA 4M9SA 1STZA 1XMAA 4WCGA 2FBIA 1ON2A 3DKWA 4HZFA 3DV8A 4S05A 3HSEA 2FNAA 4WXHA 3WTSC 2STTA 3M1EA 2VOPA 4GGGA 2HZTA 3KFWX 1ZG3A 3HRSA 4UVAA 2EV5A 4N9HA 4E70A 1GHCA 2QVOA 1T98A 4HX7A 2EB7A 3JTHA 5HS9A 1T38A 2W84A 1XGNA 2QM3A 3GVAA 3GF2A 5BOXA 5HVQC 4EJUA 3ZMTA 3NEUA 3KP7A 2HYGD 3K69A 1ZG5A 1BM9A 3EDPA 3HRMA 1KQ8A 4G7OF 3GYHX 5HLIA 4A0YA 3WGGA 5FD6A 1V3FA 4R79A 1FBQA 1B4AA 2IA0A 1B59A 4OIPF 2QBYA 3HSFA 3V4GA 4A5NA 1IZ1A 4Q5SF 3I54A 4M9XA 5L3FA 3F8BA 3N97A 3F6VA 4CXFA 5HOOA 1LB2A 2R7FA 1DPUA 1R1UA 2PI0A 1OYYA 3PFIA 1D3YA 4KNYA 2L4MA 1UB9A 2HWVA 1P92A 5ILSA 2H27A 1MJBA 4Q48A 4M73A 1BBYA 1BI1A 4FT8A 1Z1DA 2Q0OA 2STWA 3FM5A 3QU6A 1T0FA 2ADUA 2HDCA 2W57A 1USSA 5LHHA 3RKYA 2PLYA 4LFUA 3RI4A 2LKPA 3GFMA 1B9NA 5AONA 3H92A 4ZYHA 2DAOA 1MD0A 5ICCA 4HF1A 2PFBA 5CVRA 3BPVA 1WWXA 4ENKA 4L9JA 5FO5A 1HSTA 2K02A 5DV5A 1QO0D 3IKTA 3R0JA 1QZYA 4EQQA 1U5TC 3BWGA 3M9AA 1LDJA 4LK0F 3IL2A 1WKMA 3COAC 2UXNA 2PJPA 2PEXA 3U1DA 3RIRA 3ZMVA 1OKRA 2DW4A 3FX3A 5HS8A 1XB4A 1QQIA 2ZFWA 3WTUC 3WTWC 1SFUA 2IA2A 3K1NA 2A68F 3F22A 4CYDA 2OQGA 2FBHA 2VBYA 3E5QA 4L0YB 4O6JA 4OMYA 2V1UA 2EFWA 1B1BA 1R5HA 1IN6A 1P6RA 5HLGA 3CO6C 1MDMA 4S04A 3LQQA 1DUXC 4JBAA 3FXQA 3I5UA 3RTRA 4G7HF 2QQAA 1CF7A 4IPAA 1SD4A 3F8NA 5BMZA 3HSRA 1WSUA 4P9UA 2QBYB 1C0WA 5L3DA 4LK1F 2Z5UA 3H3ZA 1FSEA 1BC7C 1TQPA 5F64A 2ELHA 2C6YA 4KIFA 1ZLKA 2M30A 1WI9A 3I71A 5ED4A 3WE3A 4D0PA 2LNBA 2P8TA 3E3VA 2CGPA 1U3EM 5D5UB 1BIBA 3GZ6A 4HF0A 3CUQA 1AOYA 2UXXA 4CO8A 1TQMA 5HS7A 1XMKA 1P4AA 3TOBA 2FU4A 4KUMA 1S7OA 2QLZA 1IXCA 4KMUX 2FF4A 2HOEA 2Q2EA 1ZRFA 4RB0A 5ILUA 2NYXA 3GEZA 5TRDA 3QP6A 1TW3A 4NQWA 4BAYA 1QZZA 3V8LA 3HYIA 4GO1A 3RPQA 4ESBA 4ASNA 1T2KA 2COMA 3MEXA 3R6SA 1IRGA 2YX4A 3D5LA 1XDSA 2K4JA 3KETA 1G3SA 1ODDA 1GXQA 1K78A 1IN7A 5D5VB 4IXAA 1O3RA 4AIHA 4PZJA 5E1XA 1O3TA 2ZNZA 2K27A 1RIOH 2DT5A 2RNJA 5F6FA 5D8LB 5FFZA 1IRFA 2NNYA 5CJ9A 1SMTA 4R8HA 4LG0A 1P4WA 3BJAA 2VXZA 3FZVA 2D2WA 1Z91A 5ICEA 1JHFA 3HOSA 2WTEA 3W6KB 4UVCA 4EJWA 3FXUA 3U9GA 3ML6A 1ZARA 5CVIA 1MDMB 1G6NA 4K2EA 4RGSA 3KP6A 1YFHA 1IW7F 3ZMSA 2MC3A 4NB5A 4HV5A 4KN4X 1XD7A 3JAMZ 4HDVA 1FZPB 1MJ9A 2IA1A 3DXJF 3R4KA 1FPQA 3T8TA 5FGMA 5DEQA 4O5VA 4YIIA 4UVBA 4I09A 3WTXC 2H6CA 2P4WA 2J5PA 3RKWA 3K1PA 2EFOA 3SZTA 2HTSA 3QP5A 3JAMK 2ESNA 3F8MA 5L3BA 2BGCA 3ELKA 3T1BA 5JFRA 2GA2A 1R7JA 4H0EA 2OD5A 2TDXA 1Z7UA 2E7XA 3CUQB 4CDGA 4OU0A 3I59B 3IWZA 4NHJA 4G6DA 2Y0MA 4DNCA 3ERED 1YS7A 3SZPA 2MD5A 3EYYA 5D8KB 1LQ1A 2PG4A 5IT3A 1HSJA 1Z05A 2GAUA 1K6OA 3Q5FA 4KFCA 1K78B 2Y48A 2A6HF 2X0LA 2JT1A 2P6SA 5CVVA 4G6QA 1MGTA 2DQLA 3WTZA 2XIGA 1U5TA 2W24A 2XV4S 2K86A 2HKOA 3LQRA 2HGCA 4O3MA 2VT2A 4LG0B 1WQ2A 2VBWA 2VBZA 2QWWA 2P7VB 4FX4A 2P5KA 1FBUA 2JTVA 1ZHFA 2R7DA 2VN2A 1PP8F 4I7HA 2H09A 1EH8A 1BC8C 3K9TA 4ESFA 3IRRA 5DCFA 2ISYA 3K0LA 2OQRA 1H0MA 4LJZF 4RS8A 3JSPA 1R1VA 5LHIA 2NNNA 2PMHA 4P9FA 1SMYF 1U78A 2WWYA 3GZ5A 3FMQA 3HUGA 2CW0F 2KRFA 4G8XA 3W6JB 2DPUA 2XAQA 1IN4A 3Q9VA 1XGOA 2ZXJA 3ULQB 4BXUA 1S3JA 2M8EA 4WWCA 2EV0A 3DPTA 2CYYA 4RGUA 1UCRA 4KN7X 2E7WA 3JW4A 1ZYRF 1LDDA 1ZGAA 3BY6A 3NRVA 2FE3A 5CVUA 2VOOA 2OAZA 1F1ZA 1FYLA 1RI7A 4UHTA 1O7LA 2XGXA 3TOAA 4RB1A 3F3XA 3WG9A 5J6XA 1JE8A 3KEOA 4I01A 4U7DA 2R3SA 3FF5A 3MCZA 4AIKA 1HXDA 3IRQA 2E1CA 5E17F 2XHKA 1FY7A 1J75A 4L5IA 2Z3YA 3L2CA 3KEQA 2IJLA 1TLHB 1XCBA 2QUFA 3KP5A 4AD9A 2V79A 1OMIA 2WV0A 1KYWA 3O2PE 1U2WA 2LSOA 2ZKZA 3V7CA 2MH9A 3JTGA 3J80K 1RNLA 3WU1B 3MQ0A 3E5XA 3FMSA 2H94A 2JZYA 3HRUA 4EM1A 5BQTA 4RGXA 5LRSA 2J5OA 2IP2A 3M8EA 3M7GA 2ZO4A 2EFQA 2PBIA 4IF4A 3C3WA 4HAMA 4ESJA 1ZN2A 3J81Z 2GXBA 1YQAA 4LGWA 5E1ZB 1KU7A 4LD5A 4UV9A 3TDUC 4N0BA 2KIFA 5H20A 2XAHA 3SHFA 1K79A 2A3SA 1HW2A 1HBXG 4PGHA 1YYVA 1UHMA 2L02A 1FX7A 1ZRDA 2JSCA 3J81K 3I64A 2A69F 2BYVE 5LEKA 3CLOA 2G9WA 4BH9A 2FSWA 1IXSB 4P5OA 3I58A 4Z2YA 5KK1A 4LLLA 1EV7A 3ZP5A 1JXSA 1LEAA 1O7FA 3BOQA 3DQVC 1LNWA 5DCMA 1I27A 1ONVA 3LAPA 2F5EA 5AIQA 2YU3A 1TBXA 1PUEE 4Q4ZF 2PN6A 2HTJA 1FBSA 3E5UA 1LEBA 1YS6A 5LRRA 2A5YB 3R60A 3KZZA 1KYZA 2Y75A 2V6CA 2V9VA 5L3GA 4WK8F 5FD5A 3KE2A 4A5MA 1QNTA 4FX0A 3DF8A 4M74A 1YLFA 2HQNA 4TV7A 2YX7A 1I5ZA 3SXYA 3GFIA 2FNPA 2FQ3A 4U0WA 5ILVA 3TO9A 2HQRA 4PDKA 3FHZA 1JHHA 2A07F 5EEHA 1T39A 1R5GA 4M6YA 4QLCU 4KMFA 3QPTA 3HHHA 1DP7P 4XBFA 1R36A 2EV6A 4MNUA 2MA3A 4MQ9F 3BP8A 3O6BB 4I0BA 1E17A 5LLQA 5DD8A 2VC0A 1YIOA 4KA4A 3CTAA 2FMLA 2D45A 4EV0A 3ZMZA 3RPUA 4EGYA 2DO7A 2E1NA 2DQRA 2FEZA 2GZWA 1HQCA 3ISPA 4OINF 4LB5A 4UV8A 1ZGJA 2RGVA 2HEOA 4MTEA 3AAFA 5DD4A 4ENMA 2HFHA 1ZH5A 1QBJA 1BI3A 2ACJA 2XASA 2M45A 3P7NA 3N4MA 2CFXA 1SD7A 1U6GA 2XRNA 4EMSA 2L01A 1ZREA 4I02A 1Z6RA 3GXOA 2FA5A 3HRTA 3F6OA 4YFKF 2DU9A 3F21A 4DQ2A 3T5XA 4U0VA 3K2ZA 3C18A 4OIOF 3TGNA 1HW1A 2CG4A 2RKHA 4KT5C 3EUHA 1E2XA 4ZYGA 3L00A 2ZBKA 4HF2A 1JGSA 2Z9OA 1MZBA 4Q47A 3VODA 1ZLJA 2NAZA 1F4KA 1REPC 2LF8A 1R23A 5JHUA 2CO5A 4IHSA 3V7RA 4A6DA 3DP7A 3GX4X 1IF1A 3BJ6A 2W85A 2FBKA 5FB2A 4IRHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RC4 A;  3P9I A;  2XUB A;  4AIJ A;  1RZ4 A;  3EYI A;  4L9V A;  4A0Z A;  1SFE A;  2O0Y A;  3ECH A;  2HKX A;  4YG2 F;  1L3L A;  2O8X A;  5L3E A;  4IHT A;  4UNO A;  1P4X A;  3Q9S A;  5ERI A;  1W7P A;  4M72 A;  2UZK A;  3C7J A;  3JSO A;  2DLL A;  2AS5 F;  1S29 A;  1Y0U A;  1CF7 B;  5DUI A;  3KP4 A;  1X3U A;  2DI3 A;  2IRF G;  1FP2 A;  3E97 A;  3EQL F;  2DK8 A;  4OIR F;  2P5V A;  5J8C A;  4R1H A;  4KIB A;  2RN7 A;  5D5W B;  1XCV A;  4QWQ A;  3GO5 A;  1FOK A;  3C1D A;  5BS6 A;  3VB2 A;  2JRT A;  4MEY F;  2ZME A;  3KLO A;  5HLH A;  5F1R A;  4RAZ A;  2EWN A;  4ETS A;  4HX4 A;  4M6X A;  4WF2 A;  1QPM A;  6PAX A;  1D8K A;  4EM0 B;  4YFX F;  3F72 A;  5LBQ A;  1YW9 A;  3IC7 A;  4F7Z A;  3P9C A;  2O6G E;  5HDK A;  1DDN A;  1RUO A;  1BOA A;  5L3C A;  5JR3 A;  3ZMU A;  4Y15 A;  4BHC A;  2FMY A;  3CDH A;  4GYG A;  1FWZ A;  2KKO A;  3MWM A;  1B9M A;  3REO A;  3QRF F;  4I2O A;  2IPQ X;  4HYE A;  1MKM A;  1FYK A;  3TDZ C;  1TNT A;  4XSZ F;  2ETH A;  1SFX A;  4ENJ A;  3GWZ A;  1G4D A;  3T8R A;  3WGH A;  4HLY A;  2BEO A;  4WXC A;  4M71 A;  3HTU A;  1ZRC A;  5JVT A;  5FLX Z;  5DUK A;  1O57 A;  5HDN A;  2GXG A;  4HLX A;  4ZYE A;  5BPD A;  3TKY A;  3ZQ7 A;  4AWX B;  5CYV A;  3D0S A;  4YFN F;  4XRF A;  5A2Q Z;  1J9I A;  5K5R A;  2G7U A;  2VT3 A;  1CGP A;  4GYI A;  2WC2 A;  3ROU A;  4CGZ A;  1ZAO A;  2QEN A;  3ZPL A;  1W4M A;  1S8N A;  2GIV A;  5JI6 A;  5FLX K;  4EJO A;  1F5T A;  2DFI A;  4BQA A;  4ENN A;  2HS5 A;  1W7P B;  1UFM A;  2P5L C;  4ON0 A;  2JPC A;  1J5Y A;  5K5O A;  3QU3 A;  5ICG A;  4P96 A;  5A2Q K;  4OIQ F;  3E6D A;  4LMY A;  3P9K A;  1G3Y A;  3BPX A;  5K5Q A;  2LF7 A;  3ABT A;  3TQN A;  1FNN A;  2KJB A;  2IVM A;  3H3U A;  1XDU A;  4ZZD A;  4PCQ A;  4N9I A;  2DK5 A;  4HX8 A;  3FM3 A;  3CUO A;  4CZZ A;  4A0X A;  1LJ9 A;  2ZME B;  1FYM A;  3LFK A;  2IT0 A;  2VE8 A;  3J80 Z;  2A61 A;  4HQE A;  4JK1 X;  5KVR A;  2FXA A;  4LB6 B;  1IN5 A;  1LDK B;  5LGN A;  3V8K A;  2F5C A;  3PQK A;  2M1B A;  3GW2 A;  3BZ6 A;  2FOK A;  1K7A A;  2OU2 A;  2BBY A;  4WX9 A;  3V8J A;  5FFX A;  1J7K A;  1GXP A;  3B73 A;  3O3K A;  4L5J A;  2JPB A;  3WTY C;  3HIF A;  1IAW A;  1R00 A;  1R1T A;  3ZN1 A;  3IWF A;  3WTV C;  1MJA A;  5D4S A;  1BI2 A;  3I4P A;  1J59 A;  2L54 A;  3IHU A;  4A2U A;  3E6B A;  3T0Y A;  1O3Q A;  1U5T B;  3HOT A;  2V1D A;  1SAX A;  4BHP A;  1YW8 A;  4IVN A;  4MEX F;  3NQO A;  1I1G A;  2KIU A;  2L3D A;  2O03 A;  1G3T A;  5BPI A;  2GQQ A;  1D5V A;  5K1Y A;  1V4R A;  2NRA C;  4CHU A;  4G94 A;  4HW0 A;  1BI0 A;  3EET A;  3PQJ A;  3FMR A;  3B02 A;  3LA3 A;  2ISZ A;  3TO7 A;  4HV6 A;  4M9Z A;  1W5T A;  1XGS A;  2G7H A;  4ZYD A;  4RAY A;  2A6E F;  1G3W A;  4I98 B;  2BE5 F;  2UWM A;  5ICF A;  3MFK A;  2YR2 A;  3MZH A;  2CQK A;  1TQI A;  1OYI A;  2DPD A;  1O3S A;  1TNS A;  1YG2 A;  2YSR A;  1KU9 A;  2Q8K A;  5E1W A;  1WRJ A;  1J2X A;  2XAJ A;  1TW2 A;  1XSD A;  3TO6 A;  2MH2 A;  3ZMD A;  3DPL C;  5H6Q A;  2XVC A;  3RJP A;  3IKV A;  4CIC A;  1J0R A;  2XAG A;  2OZ6 A;  1W7P D;  1HKT A;  4Y13 A;  3R61 A;  2Z99 A;  2P6T A;  3K1M A;  5LGT A;  2V1X A;  3LST A;  1ULY A;  4JQF A;  2KJC A;  2ZNY A;  1AWC A;  3F8C A;  2O3F A;  1OPC A;  2EJR A;  4UUV A;  3GLX A;  3U2R A;  1RUN A;  4I0A A;  2W25 A;  4XLN F;  1XGM A;  4WXD A;  1FC3 A;  5D6E A;  1OR7 A;  1EH6 A;  5AIP A;  4B8X A;  5DYM A;  3E6C C;  2H6B A;  1BIA A;  3E6M A;  1YO5 C;  3GFL A;  1HW5 A;  3M8F A;  2O61 A;  1T6S A;  4LLN A;  2EK5 A;  4EGZ A;  4IRG A;  2RV8 A;  3VFZ A;  5D5X B;  2EA4 A;  1KA8 A;  2DBB A;  2F2E A;  2VOD A;  2K7L A;  2QQ9 A;  5EEG A;  1EH7 A;  2XRO A;  5D4R A;  3DEU A;  5TJJ A;  2Z33 A;  1I6X A;  4HQM A;  5E8G A;  4RGR A;  2MBF A;  3WGI A;  4EJT A;  3I53 A;  2QYO A;  3MZY A;  1BJA A;  2NS0 A;  2EA2 A;  3ECO A;  3KCC A;  2GA1 A;  3GUD A;  5D6F A;  1Z6T A;  1ON1 A;  3FXR A;  4U0Y A;  1BN5 A;  2OBP A;  2XAF A;  3KLN A;  4BYY A;  2IW5 A;  2KIM A;  4AVP A;  2X4H A;  2XKO A;  2P7C B;  3LA7 A;  3I59 A;  1DPR A;  2MLK A;  1YW7 A;  5DCM B;  1FSH A;  4EVI A;  4U88 A;  1IN8 A;  4OMZ A;  1D8J A;  3WOD F;  3L09 A;  3BDD A;  1PDN C;  2OA4 A;  2OZU A;  4RB3 C;  2F5D A;  2RDP A;  3J7A O;  1IUY A;  1SD5 A;  2CWE A;  4ZZL A;  3RYP A;  5CVJ A;  4OOI A;  4EJV A;  1S6L A;  5LHG A;  4HBL A;  4BNC A;  4L9T A;  4HDU A;  1LVA A;  3L7W A;  3HTS B;  1KGS A;  3WE2 A;  3V7S A;  3QPH A;  1Q1H A;  4L0Z B;  2QZ8 A;  2D1V A;  3KP2 A;  3SQN A;  4GCV A;  3WTT C;  1I1S A;  4B09 A;  1KQ0 A;  1GVJ A;  4P55 A;  3RKX A;  3RDI A;  5CLS A;  4KDP A;  2QQB A;  2ZJ2 A;  2XKP A;  3OV8 A;  3ABU A;  1R22 A;  1OYW A;  3G3Z A;  3KP3 A;  1L0O C;  3MAJ A;  3VOE A;  5H6R A;  1PP7 U;  4G7Z F;  4LLG F;  3QOP A;  5E8I A;  1KU2 A;  3R0A A;  1KQ9 A;  4MQV A;  2PQ8 A;  5LEJ A;  3F23 A;  2FRH A;  1YTY A;  1IXR C;  3QAH A;  2B0L A;  3CJN A;  3OOP A;  1FP1 D;  3LAJ A;  1F9N A;  1TTY A;  4MTD A;  3LA2 A;  1ZG1 A;  5HDG A;  3SFZ A;  2PMU A;  1W5S A;  4RB2 C;  4Y17 A;  2CSO A;  4ZH4 F;  4PGG A;  3BJO A;  4IRI A;  1B6A A;  2MLG A;  1S7A A;  2VE9 A;  4HOB A;  2EFN A;  4IJA A;  4L9N A;  3VEP A;  5DDG A;  4U7B A;  1U8R A;  4FHT A;  4YIF A;  4HA8 A;  1KU3 A;  2ESH A;  1A04 A;  5J8F A;  1QGP A;  2M87 A;  3FWE A;  2VON A;  2RQP A;  2VC1 A;  1XSX A;  5IT9 Z;  1HKQ A;  3ZN0 A;  2RVC A;  2VBX A;  4BHB A;  1XSV A;  2L4A A;  3KZY A;  1HKS A;  2LDU A;  3LWF A;  1SD6 A;  2YPR A;  1UHW A;  2AXL A;  4XLP F;  4KIC A;  3I0T A;  5E20 A;  4UXN A;  4KYW A;  4L18 B;  5IT9 K;  1FLI A;  2EFP A;  1H9T A;  3GFJ A;  3F8F A;  3HHG A;  4GXO A;  3RYR A;  1H9G A;  3CO7 C;  2BV6 A;  2HYF A;  3CUQ C;  3BRO A;  4EM2 A;  2D1H A;  4KIG A;  1VTN C;  2K4B A;  4A6E A;  3L9F A;  5E18 F;  3S2W A;  3WU0 A;  2ZCW A;  1UST A;  1NHA A;  2GWR A;  5LGU A;  2HR3 A;  4MGR A;  3DFG A;  1XN7 A;  1P2F A;  4A12 A;  2M5W A;  4XSX F;  4G9Y A;  1FT9 A;  3G73 A;  1R58 A;  1Z9C A;  2F5F A;  2DTR A;  4MHG A;  4M9S A;  1STZ A;  1XMA A;  4WCG A;  2FBI A;  1ON2 A;  3DKW A;  4HZF A;  3DV8 A;  4S05 A;  3HSE A;  2FNA A;  4WXH A;  3WTS C;  2STT A;  3M1E A;  2VOP A;  4GGG A;  2HZT A;  3KFW X;  1ZG3 A;  3HRS A;  4UVA A;  2EV5 A;  4N9H A;  4E70 A;  1GHC A;  2QVO A;  1T98 A;  4HX7 A;  2EB7 A;  3JTH A;  5HS9 A;  1T38 A;  2W84 A;  1XGN A;  2QM3 A;  3GVA A;  3GF2 A;  5BOX A;  5HVQ C;  4EJU A;  3ZMT A;  3NEU A;  3KP7 A;  2HYG D;  3K69 A;  1ZG5 A;  1BM9 A;  3EDP A;  3HRM A;  1KQ8 A;  4G7O F;  3GYH X;  5HLI A;  4A0Y A;  3WGG A;  5FD6 A;  1V3F A;  4R79 A;  1FBQ A;  1B4A A;  2IA0 A;  1B59 A;  4OIP F;  2QBY A;  3HSF A;  3V4G A;  4A5N A;  1IZ1 A;  4Q5S F;  3I54 A;  4M9X A;  5L3F A;  3F8B A;  3N97 A;  3F6V A;  4CXF A;  5HOO A;  1LB2 A;  2R7F A;  1DPU A;  1R1U A;  2PI0 A;  1OYY A;  3PFI A;  1D3Y A;  4KNY A;  2L4M A;  1UB9 A;  2HWV A;  1P92 A;  5ILS A;  2H27 A;  1MJB A;  4Q48 A;  4M73 A;  1BBY A;  1BI1 A;  4FT8 A;  1Z1D A;  2Q0O A;  2STW A;  3FM5 A;  3QU6 A;  1T0F A;  2ADU A;  2HDC A;  2W57 A;  1USS A;  5LHH A;  3RKY A;  2PLY A;  4LFU A;  3RI4 A;  2LKP A;  3GFM A;  1B9N A;  5AON A;  3H92 A;  4ZYH A;  2DAO A;  1MD0 A;  5ICC A;  4HF1 A;  2PFB A;  5CVR A;  3BPV A;  1WWX A;  4ENK A;  4L9J A;  5FO5 A;  1HST A;  2K02 A;  5DV5 A;  1QO0 D;  3IKT A;  3R0J A;  1QZY A;  4EQQ A;  1U5T C;  3BWG A;  3M9A A;  1LDJ A;  4LK0 F;  3IL2 A;  1WKM A;  3COA C;  2UXN A;  2PJP A;  2PEX A;  3U1D A;  3RIR A;  3ZMV A;  1OKR A;  2DW4 A;  3FX3 A;  5HS8 A;  1XB4 A;  1QQI A;  2ZFW A;  3WTU C;  3WTW C;  1SFU A;  2IA2 A;  3K1N A;  2A68 F;  3F22 A;  4CYD A;  2OQG A;  2FBH A;  2VBY A;  3E5Q A;  4L0Y B;  4O6J A;  4OMY A;  2V1U A;  2EFW A;  1B1B A;  1R5H A;  1IN6 A;  1P6R A;  5HLG A;  3CO6 C;  1MDM A;  4S04 A;  3LQQ A;  1DUX C;  4JBA A;  3FXQ A;  3I5U A;  3RTR A;  4G7H F;  2QQA A;  1CF7 A;  4IPA A;  1SD4 A;  3F8N A;  5BMZ A;  3HSR A;  1WSU A;  4P9U A;  2QBY B;  1C0W A;  5L3D A;  4LK1 F;  2Z5U A;  3H3Z A;  1FSE A;  1BC7 C;  1TQP A;  5F64 A;  2ELH A;  2C6Y A;  4KIF A;  1ZLK A;  2M30 A;  1WI9 A;  3I71 A;  5ED4 A;  3WE3 A;  4D0P A;  2LNB A;  2P8T A;  3E3V A;  2CGP A;  1U3E M;  5D5U B;  1BIB A;  3GZ6 A;  4HF0 A;  3CUQ A;  1AOY A;  2UXX A;  4CO8 A;  1TQM A;  5HS7 A;  1XMK A;  1P4A A;  3TOB A;  2FU4 A;  4KUM A;  1S7O A;  2QLZ A;  1IXC A;  4KMU X;  2FF4 A;  2HOE A;  2Q2E A;  1ZRF A;  4RB0 A;  5ILU A;  2NYX A;  3GEZ A;  5TRD A;  3QP6 A;  1TW3 A;  4NQW A;  4BAY A;  1QZZ A;  3V8L A;  3HYI A;  4GO1 A;  3RPQ A;  4ESB A;  4ASN A;  1T2K A;  2COM A;  3MEX A;  3R6S A;  1IRG A;  2YX4 A;  3D5L A;  1XDS A;  2K4J A;  3KET A;  1G3S A;  1ODD A;  1GXQ A;  1K78 A;  1IN7 A;  5D5V B;  4IXA A;  1O3R A;  4AIH A;  4PZJ A;  5E1X A;  1O3T A;  2ZNZ A;  2K27 A;  1RIO H;  2DT5 A;  2RNJ A;  5F6F A;  5D8L B;  5FFZ A;  1IRF A;  2NNY A;  5CJ9 A;  1SMT A;  4R8H A;  4LG0 A;  1P4W A;  3BJA A;  2VXZ A;  3FZV A;  2D2W A;  1Z91 A;  5ICE A;  1JHF A;  3HOS A;  2WTE A;  3W6K B;  4UVC A;  4EJW A;  3FXU A;  3U9G A;  3ML6 A;  1ZAR A;  5CVI A;  1MDM B;  1G6N A;  4K2E A;  4RGS A;  3KP6 A;  1YFH A;  1IW7 F;  3ZMS A;  2MC3 A;  4NB5 A;  4HV5 A;  4KN4 X;  1XD7 A;  3JAM Z;  4HDV A;  1FZP B;  1MJ9 A;  2IA1 A;  3DXJ F;  3R4K A;  1FPQ A;  3T8T A;  5FGM A;  5DEQ A;  4O5V A;  4YII A;  4UVB A;  4I09 A;  3WTX C;  2H6C A;  2P4W A;  2J5P A;  3RKW A;  3K1P A;  2EFO A;  3SZT A;  2HTS A;  3QP5 A;  3JAM K;  2ESN A;  3F8M A;  5L3B A;  2BGC A;  3ELK A;  3T1B A;  5JFR A;  2GA2 A;  1R7J A;  4H0E A;  2OD5 A;  2TDX A;  1Z7U A;  2E7X A;  3CUQ B;  4CDG A;  4OU0 A;  3I59 B;  3IWZ A;  4NHJ A;  4G6D A;  2Y0M A;  4DNC A;  3ERE D;  1YS7 A;  3SZP A;  2MD5 A;  3EYY A;  5D8K B;  1LQ1 A;  2PG4 A;  5IT3 A;  1HSJ A;  1Z05 A;  2GAU A;  1K6O A;  3Q5F A;  4KFC A;  1K78 B;  2Y48 A;  2A6H F;  2X0L A;  2JT1 A;  2P6S A;  5CVV A;  4G6Q A;  1MGT A;  2DQL A;  3WTZ A;  2XIG A;  1U5T A;  2W24 A;  2XV4 S;  2K86 A;  2HKO A;  3LQR A;  2HGC A;  4O3M A;  2VT2 A;  4LG0 B;  1WQ2 A;  2VBW A;  2VBZ A;  2QWW A;  2P7V B;  4FX4 A;  2P5K A;  1FBU A;  2JTV A;  1ZHF A;  2R7D A;  2VN2 A;  1PP8 F;  4I7H A;  2H09 A;  1EH8 A;  1BC8 C;  3K9T A;  4ESF A;  3IRR A;  5DCF A;  2ISY A;  3K0L A;  2OQR A;  1H0M A;  4LJZ F;  4RS8 A;  3JSP A;  1R1V A;  5LHI A;  2NNN A;  2PMH A;  4P9F A;  1SMY F;  1U78 A;  2WWY A;  3GZ5 A;  3FMQ A;  3HUG A;  2CW0 F;  2KRF A;  4G8X A;  3W6J B;  2DPU A;  2XAQ A;  1IN4 A;  3Q9V A;  1XGO A;  2ZXJ A;  3ULQ B;  4BXU A;  1S3J A;  2M8E A;  4WWC A;  2EV0 A;  3DPT A;  2CYY A;  4RGU A;  1UCR A;  4KN7 X;  2E7W A;  3JW4 A;  1ZYR F;  1LDD A;  1ZGA A;  3BY6 A;  3NRV A;  2FE3 A;  5CVU A;  2VOO A;  2OAZ A;  1F1Z A;  1FYL A;  1RI7 A;  4UHT A;  1O7L A;  2XGX A;  3TOA A;  4RB1 A;  3F3X A;  3WG9 A;  5J6X A;  1JE8 A;  3KEO A;  4I01 A;  4U7D A;  2R3S A;  3FF5 A;  3MCZ A;  4AIK A;  1HXD A;  3IRQ A;  2E1C A;  5E17 F;  2XHK A;  1FY7 A;  1J75 A;  4L5I A;  2Z3Y A;  3L2C A;  3KEQ A;  2IJL A;  1TLH B;  1XCB A;  2QUF A;  3KP5 A;  4AD9 A;  2V79 A;  1OMI A;  2WV0 A;  1KYW A;  3O2P E;  1U2W A;  2LSO A;  2ZKZ A;  3V7C A;  2MH9 A;  3JTG A;  3J80 K;  1RNL A;  3WU1 B;  3MQ0 A;  3E5X A;  3FMS A;  2H94 A;  2JZY A;  3HRU A;  4EM1 A;  5BQT A;  4RGX A;  5LRS A;  2J5O A;  2IP2 A;  3M8E A;  3M7G A;  2ZO4 A;  2EFQ A;  2PBI A;  4IF4 A;  3C3W A;  4HAM A;  4ESJ A;  1ZN2 A;  3J81 Z;  2GXB A;  1YQA A;  4LGW A;  5E1Z B;  1KU7 A;  4LD5 A;  4UV9 A;  3TDU C;  4N0B A;  2KIF A;  5H20 A;  2XAH A;  3SHF A;  1K79 A;  2A3S A;  1HW2 A;  1HBX G;  4PGH A;  1YYV A;  1UHM A;  2L02 A;  1FX7 A;  1ZRD A;  2JSC A;  3J81 K;  3I64 A;  2A69 F;  2BYV E;  5LEK A;  3CLO A;  2G9W A;  4BH9 A;  2FSW A;  1IXS B;  4P5O A;  3I58 A;  4Z2Y A;  5KK1 A;  4LLL A;  1EV7 A;  3ZP5 A;  1JXS A;  1LEA A;  1O7F A;  3BOQ A;  3DQV C;  1LNW A;  5DCM A;  1I27 A;  1ONV A;  3LAP A;  2F5E A;  5AIQ A;  2YU3 A;  1TBX A;  1PUE E;  4Q4Z F;  2PN6 A;  2HTJ A;  1FBS A;  3E5U A;  1LEB A;  1YS6 A;  5LRR A;  2A5Y B;  3R60 A;  3KZZ A;  1KYZ A;  2Y75 A;  2V6C A;  2V9V A;  5L3G A;  4WK8 F;  5FD5 A;  3KE2 A;  4A5M A;  1QNT A;  4FX0 A;  3DF8 A;  4M74 A;  1YLF A;  2HQN A;  4TV7 A;  2YX7 A;  1I5Z A;  3SXY A;  3GFI A;  2FNP A;  2FQ3 A;  4U0W A;  5ILV A;  3TO9 A;  2HQR A;  4PDK A;  3FHZ A;  1JHH A;  2A07 F;  5EEH A;  1T39 A;  1R5G A;  4M6Y A;  4QLC U;  4KMF A;  3QPT A;  3HHH A;  1DP7 P;  4XBF A;  1R36 A;  2EV6 A;  4MNU A;  2MA3 A;  4MQ9 F;  3BP8 A;  3O6B B;  4I0B A;  1E17 A;  5LLQ A;  5DD8 A;  2VC0 A;  1YIO A;  4KA4 A;  3CTA A;  2FML A;  2D45 A;  4EV0 A;  3ZMZ A;  3RPU A;  4EGY A;  2DO7 A;  2E1N A;  2DQR A;  2FEZ A;  2GZW A;  1HQC A;  3ISP A;  4OIN F;  4LB5 A;  4UV8 A;  1ZGJ A;  2RGV A;  2HEO A;  4MTE A;  3AAF A;  5DD4 A;  4ENM A;  2HFH A;  1ZH5 A;  1QBJ A;  1BI3 A;  2ACJ A;  2XAS A;  2M45 A;  3P7N A;  3N4M A;  2CFX A;  1SD7 A;  1U6G A;  2XRN A;  4EMS A;  2L01 A;  1ZRE A;  4I02 A;  1Z6R A;  3GXO A;  2FA5 A;  3HRT A;  3F6O A;  4YFK F;  2DU9 A;  3F21 A;  4DQ2 A;  3T5X A;  4U0V A;  3K2Z A;  3C18 A;  4OIO F;  3TGN A;  1HW1 A;  2CG4 A;  2RKH A;  4KT5 C;  3EUH A;  1E2X A;  4ZYG A;  3L00 A;  2ZBK A;  4HF2 A;  1JGS A;  2Z9O A;  1MZB A;  4Q47 A;  3VOD A;  1ZLJ A;  2NAZ A;  1F4K A;  1REP C;  2LF8 A;  1R23 A;  5JHU A;  2CO5 A;  4IHS A;  3V7R A;  4A6D A;  3DP7 A;  3GX4 X;  1IF1 A;  3BJ6 A;  2W85 A;  2FBK A;  5FB2 A;  4IRH A; 
#chains in the Genus database with same CATH topology
 2RC4 A;  3JRI A;  3P9I A;  2YS9 A;  5GPA A;  2XUB A;  2ZC2 A;  4AIJ A;  1RZ4 A;  2IS2 A;  3HOV J;  3EYI A;  4L9V A;  4A0Z A;  1SFE A;  3S1R J;  2O0Y A;  2NVX J;  4CCM A;  5C4X J;  3ECH A;  2HKX A;  4B48 A;  4YG2 F;  1L3L A;  2O8X A;  4H4K C;  5L3E A;  3OOU A;  4IHT A;  4UNO A;  1P4X A;  1Z21 A;  3Q9S A;  5ERI A;  1W7P A;  3A01 A;  4M72 A;  1UMQ A;  2UZK A;  1VQM I;  3C7J A;  3CF2 A;  4HPQ A;  3JSO A;  2PJR A;  2DLL A;  2AS5 F;  1PUF A;  1S29 A;  1Y0U A;  3IH2 A;  3H9J A;  5GAH J;  1NH3 A;  2FX0 A;  1VQ5 I;  4IEJ A;  1CF7 B;  1T0F C;  4E6K G;  4EAT A;  5DUI A;  1K4T A;  3KP4 A;  1PYV A;  1X3U A;  2HVS A;  2DI3 A;  2HOA A;  2IRF G;  1FP2 A;  1F36 A;  3H5A A;  3E97 A;  3PSI A;  3ABM H;  3EQL F;  2DK8 A;  4OIR F;  2P5V A;  5J8C A;  4R1H A;  2M0C A;  2CJJ A;  1D0Z A;  4FAS D;  2CU7 A;  1HCR A;  4KIB A;  2RN7 A;  4IKF A;  3OS2 A;  3LSG A;  1YE9 A;  5D5W B;  1XCV A;  2RQQ A;  1ERD A;  3MKY B;  4QWQ A;  1RKT A;  3GO5 A;  1FOK A;  4GDF A;  3C1D A;  3OIP A;  5BS6 A;  4M6V A;  3VB2 A;  1AU7 A;  2JRT A;  4MEY F;  4CCL A;  2ZME A;  2MC4 A;  3KLO A;  5HLH A;  1OFC X;  5F1R A;  3MN2 A;  4RAZ A;  4FE4 A;  1UG0 A;  2IGK A;  2EWN A;  3JRB A;  4ETS A;  3TED A;  3K4B A;  2IGN A;  1MNE A;  1Z0X A;  4HX4 A;  2LD5 A;  4M6X A;  4WF2 A;  1QPM A;  6PAX A;  1D8K A;  2L9V A;  4EM0 B;  4YFX F;  1VQP I;  1SAU A;  3F72 A;  5LBQ A;  3PNV A;  1X3Z B;  1YW9 A;  3IC7 A;  4OWR B;  4F7Z A;  3P9C A;  2O6G E;  1WCM J;  5HDK A;  4XKW A;  1DDN A;  1RUO A;  1ETX A;  3BLY A;  4A3J J;  1BOA A;  2E5N A;  5L3C A;  3D5R C;  5JR3 A;  2EIK H;  3ZMU A;  4Y15 A;  4L5E A;  4BHC A;  4ZDO A;  3UR3 C;  2FMY A;  3CDH A;  4GYG A;  1FWZ A;  1TWC J;  2KKO A;  3MWM A;  4QPQ A;  1OR7 C;  5FB2 A;  4HSR A;  1B9M A;  1YJW I;  2HNH A;  3REO A;  3ZQF A;  3CME I;  3QRF F;  4I2O A;  2WAE A;  4BDY A;  2IPQ X;  2E60 A;  1VQ9 I;  2IXS A;  3OYI A;  2IS1 A;  4HYE A;  1MKM A;  3LSK A;  5EGO A;  3H0D A;  1FYK A;  1R4M B;  1ZKG A;  1WH5 A;  3PIO F;  3PIP F;  2K85 A;  3JRH A;  3F9K A;  3H36 A;  1VQN I;  3DTE A;  3TDZ C;  2V6E A;  2EZH A;  3QOD A;  2Q1Z B;  1TNT A;  1TZL A;  2X6Y A;  4XSZ F;  2ETH A;  1SFX A;  3OL3 A;  4ENJ A;  4IOC F;  3GWZ A;  3PNY A;  1G4D A;  4DJA A;  3T8R A;  3WGH A;  4HLY A;  3KEY A;  2KRC A;  3RKQ A;  2BEO A;  1AA7 A;  4WXC A;  4M71 A;  1Y39 A;  3FK6 A;  3HTU A;  1TL8 A;  1ZRC A;  5JVT A;  5FLX Z;  4LIV A;  1DQU A;  3OMY A;  5DUK A;  3VYT B;  3SZG A;  1O57 A;  5HDN A;  2GXG A;  4HLX A;  4ZYE A;  5BPD A;  3TKY A;  3ZQ7 A;  4AWX B;  5CYV A;  3D0S A;  4XK4 A;  4YFN F;  4XRF A;  5A2Q Z;  5CKT A;  1J9I A;  5K5R A;  1JKO C;  2G7U A;  1ZGW A;  2VT3 A;  1CGP A;  4GYI A;  2WC2 A;  4ZC3 A;  4CSW A;  4KIT B;  3ROU A;  4CGZ A;  1ZAO A;  2QEN A;  1Y8Q B;  3OR2 C;  3ZPL A;  1W4M A;  1S8N A;  3BR0 A;  4X1E A;  2GIV A;  4I76 A;  2DMP A;  2VB6 A;  5JI6 A;  5FLX K;  4EJO A;  1HA8 A;  1F5T A;  2DFI A;  1SAN A;  4BQA A;  4ENN A;  2HS5 A;  1W7P B;  3CP8 A;  1UFM A;  1GUU A;  2P81 A;  1D0Y A;  2P5L C;  2PJR B;  4ON0 A;  2KZV A;  2JPC A;  1J5Y A;  5K5O A;  2LLK A;  3QU3 A;  5ICG A;  4P96 A;  3CJQ B;  5A2Q K;  1ZR2 A;  4OIQ F;  3E6D A;  4LMY A;  2KDZ A;  3P9K A;  1G3Y A;  1TWF J;  1X2N A;  2JMW A;  2EIL H;  3BPX A;  4QIW N;  5K5Q A;  2LF7 A;  2LG4 A;  2MW8 A;  1OCT C;  3ABT A;  4HST A;  5E3N A;  3TQN A;  1FNN A;  2KJB A;  1BR2 A;  2IVM A;  3H3U A;  1XDU A;  3D5S C;  3AG2 H;  4ZZD A;  4PCQ A;  4N9I A;  2DK5 A;  4HX8 A;  3FM3 A;  3CUO A;  2LP0 A;  1QZE A;  4CZZ A;  3K4L A;  2DA3 A;  2QQ8 A;  4A0X A;  2BY1 A;  1LJ9 A;  2BZT A;  2ZME B;  1FYM A;  1OCP A;  1V54 H;  4YRV A;  3LFK A;  2M7A A;  4GRI A;  2IT0 A;  2VE8 A;  4BEH A;  2O9L A;  3J80 Z;  2A61 A;  4HQE A;  4JK1 X;  5KVR A;  2FXA A;  5B5E C;  2O5R A;  3DTI A;  4LB6 B;  3MKL A;  1IN5 A;  1LDK B;  5LGN A;  3CCL I;  3V8K A;  2F5C A;  3PQK A;  3KPH A;  2M1B A;  3GW2 A;  2WB1 A;  3BZ6 A;  2DMN A;  2FOK A;  2LVS A;  1K7A A;  2OU2 A;  2BBY A;  4WX9 A;  1MIJ A;  1IDZ A;  3MD2 A;  3V8J A;  5FFX A;  1X4P A;  2X1C A;  4A3F J;  1J7K A;  1GXP A;  3RPU D;  3HKZ N;  3B73 A;  5J47 A;  2H1L A;  3O3K A;  1A6Q A;  4L5J A;  1XS9 A;  2GXA A;  2JPB A;  4E4H A;  3G6E I;  3WTY C;  1E0E A;  3HIF A;  1IAW A;  1R71 A;  3S1M J;  1R00 A;  1R1T A;  3ZN1 A;  2YUS A;  3IWF A;  3IUO A;  2VQC A;  3BG6 A;  3WTV C;  1Z67 A;  2JVG A;  1MJA A;  2VLA A;  2KDO A;  3E1S A;  4LOC A;  3PUF A;  2XPU A;  1ETY A;  4X0G A;  5HLT A;  5D4S A;  1BI2 A;  1WJB A;  5E79 C;  3OYK A;  2DT7 B;  3I4P A;  1J59 A;  2L54 A;  3BR1 A;  3IHU A;  4A2U A;  3E6B A;  3I4M J;  1YIT I;  2F48 A;  3T0Y A;  1O3Q A;  2O8K A;  1EKE A;  3LSM A;  2VL8 A;  1U5T B;  3ABL H;  3HOT A;  1WVR A;  2V1D A;  3LSH A;  1SAX A;  3H0G J;  1FMW A;  3QPL A;  4XLF A;  3PO3 J;  4PJN A;  4BHP A;  1YW8 A;  4IVN A;  4MEX F;  3NQO A;  1I1G A;  2KIU A;  2L3D A;  2O03 A;  3BR6 A;  5CQG A;  5E3M A;  1G3T A;  2W7N A;  1TWH J;  3G71 I;  5BPI A;  3BR2 A;  2GQQ A;  5IP7 J;  3A0H C;  5EF6 A;  3K2A A;  1D5V A;  5K1Y A;  1V4R A;  4XL9 A;  2NRA C;  1V5E A;  2OC6 A;  4G6T B;  4CHU A;  4G94 A;  1VQ4 I;  4HW0 A;  5B66 C;  1BI0 A;  2MSY A;  2EIJ H;  1Z3Y A;  3EET A;  5JHF A;  3PQJ A;  4BQQ A;  2WBM A;  3K4J A;  3FMR A;  3B02 A;  3LA3 A;  2ISZ A;  2WAD A;  4RM2 A;  1ZK8 A;  3FXM A;  3TO7 A;  4HV6 A;  2HVR A;  4M9Z A;  2VUM J;  1W5T A;  1JGG A;  1XGS A;  3FKI J;  2G7H A;  1D1C A;  1MMG A;  4F91 B;  4ZYD A;  4RAY A;  4ZJZ A;  2A6E F;  2BHY A;  2LOO A;  1G3W A;  2E34 A;  4I98 B;  3SEQ A;  5J4Y A;  1YIJ I;  2BE5 F;  4UB8 C;  4FET A;  2UWM A;  5ICF A;  4PSW A;  3MFK A;  3BCA A;  2YR2 A;  4MLO A;  3MZH A;  4M3B A;  4IQ4 A;  4MO7 A;  2CQK A;  1TQI A;  4LIU A;  1OYI A;  2DPD A;  2LTP A;  5F0C A;  1O3S A;  1MBJ A;  3D1N I;  1TNS A;  3I56 I;  1YG2 A;  3OYC A;  4A3L J;  2B63 J;  2YSR A;  1KU9 A;  2Q8K A;  1TT5 B;  4B3A A;  3W3C A;  5E1W A;  1WRJ A;  1J2X A;  2XAJ A;  1TW2 A;  1XSD A;  4IQJ A;  2OV7 A;  3TO6 A;  2F5V A;  2CUJ A;  5B3S H;  2KP6 A;  2DA4 A;  2XF6 A;  1SEU A;  2MH2 A;  2DDB A;  3ZMD A;  3MVP A;  3DPL C;  4BEH B;  5H6Q A;  2XVC A;  2VKE A;  3RJP A;  3H3V K;  3IKV A;  2CMP A;  4CIC A;  1DU0 A;  2E2J J;  1J0R A;  2K40 A;  2XAG A;  2PMZ N;  2M3A A;  1W7P D;  2OZ6 A;  1AKH B;  1HKT A;  1MH3 A;  4A3B J;  5FKM A;  4Y13 A;  3R61 A;  2Z99 A;  2P6T A;  2JUG A;  3K1M A;  5LGT A;  3AL0 B;  3FBN B;  2BVM A;  2CQX A;  2BW3 A;  2V1X A;  3LST A;  2IAI A;  1ULY A;  5EZG A;  4W1U A;  4JQF A;  2KJC A;  2ZNY A;  1AWC A;  3F8C A;  2O3F A;  3DEE A;  1OPC A;  2VJ4 A;  3ZQG A;  2EJR A;  3X2Q H;  3LNQ A;  1Y6I A;  5GAD J;  4BE2 A;  3ZQL A;  3GLX A;  3U2R A;  4UUV A;  1RUN A;  1RPW A;  4I0A A;  2CUZ A;  2W25 A;  4XLN F;  1XGM A;  1TWG J;  1WI3 A;  4WXD A;  1K4S A;  3DWL E;  1FC3 A;  4MIM A;  5D6E A;  2IEK A;  1OR7 A;  1EH6 A;  5AIP A;  4B8X A;  4NC8 A;  5DYM A;  3E6C C;  2H6B A;  1BIA A;  4V2F A;  3ABK H;  3L2Q A;  3E6M A;  1YO5 C;  3OYD A;  3GFL A;  2NOG A;  1ITY A;  1HW5 A;  2QSG X;  3M8F A;  3S2D J;  3CJR B;  3C2G A;  3S3N A;  2K3F A;  3OY9 A;  2O61 A;  1T6S A;  3RZO J;  1X1P A;  4LLN A;  2EK5 A;  4EGZ A;  2X1D A;  3CCY A;  2LY2 A;  4IRG A;  3SJM A;  2RV8 A;  3VFZ A;  1UZC A;  5D5X B;  2EA4 A;  2G0E A;  3IH4 A;  1KA8 A;  4XLE A;  3KYD B;  3ASN H;  2DBB A;  2F6C A;  2F2E A;  4EEF G;  2CW8 A;  2VOD A;  2K7L A;  2QQ9 A;  1OIS A;  2K9S A;  5EEG A;  4V19 K;  2R5Y A;  1EH7 A;  1I39 A;  2W4S A;  2XRO A;  4RLQ A;  3CP2 A;  2DYR H;  5D4R A;  2EPF A;  3DEU A;  3FIS A;  4D5F A;  2MD0 A;  5TJJ A;  2JA2 A;  4XRS A;  4E7K A;  2Z33 A;  1BJZ A;  4D7M A;  1I6X A;  4HQM A;  4YEJ A;  4IHV A;  5E8G A;  4M3D A;  4RGR A;  3MKZ A;  2MBF A;  3WGI A;  4EJT A;  2E19 A;  1BOB A;  3HB9 A;  1NTC A;  3I53 A;  2QYO A;  5EDN A;  2KPM A;  4PJM A;  2R7T A;  1DU6 A;  3MZY A;  1VND A;  3S93 A;  2FUG 2;  1TP4 A;  1BJA A;  2NS0 A;  1Y1V J;  4HG2 A;  1MSE C;  2EA2 A;  3ECO A;  3KCC A;  2GA1 A;  3BTL A;  3GUD A;  5D6F A;  1Z6T A;  4Y7N J;  2K9M A;  1Z3X A;  3L2R A;  1ON1 A;  2NOJ B;  3BZK A;  2LC2 A;  3L2W A;  3CCS I;  1FIA A;  4E7S A;  5F04 A;  1BL0 A;  3FXR A;  4U0Y A;  3O8H A;  1BN5 A;  2OBP A;  2XAF A;  2ZXI A;  5M5Y J;  3KLN A;  2R4G A;  3DCF A;  4BYY A;  1YI2 I;  1R9T J;  2WV1 A;  3SYT A;  5FLV A;  2IW5 A;  1QVU A;  2KIM A;  3FXJ A;  4AVP A;  2X4H A;  2XKO A;  2P7C B;  2RAE A;  1Z7L A;  3CDI A;  3BR3 A;  1VQK I;  2Y0S N;  1LKX A;  3LA7 A;  3I59 A;  3SFI A;  3GLL A;  4P1W A;  3UNG C;  1DPR A;  2MLK A;  2XPV A;  5IYC J;  1YW7 A;  2JWT A;  5DCM B;  3LOC A;  2VQL A;  3S3O A;  4X6A J;  5KAF C;  4F55 A;  1JUP A;  1FSH A;  2R7X A;  3QPS A;  4EVI A;  4U88 A;  3K6G A;  1QPI A;  4A3C J;  1EF4 A;  1X3W B;  2DTZ A;  1IN8 A;  4OMZ A;  3NAR A;  3OIQ A;  1QRY A;  3WOD F;  3L09 A;  1D8J A;  3HZJ A;  1MMA A;  3BDD A;  2HPM A;  2OTJ I;  2EH3 A;  2OA4 A;  2OZU A;  4RB3 C;  1PDN C;  3SDG A;  4A3I J;  5KNL A;  2F5D A;  2RDP A;  4RA2 A;  3AKZ A;  3J7A O;  1N78 A;  1IUY A;  3OIO A;  1SD5 A;  2BXY A;  2CWE A;  4ZZL A;  3CD6 I;  3RYP A;  3W2A A;  5CVJ A;  2NVQ J;  4OOI A;  2A5W A;  4EJV A;  1S6L A;  2KIQ A;  2XF7 A;  1EJ9 A;  5LHG A;  2E1M C;  4HBL A;  5JLX A;  4BNC A;  2CQ7 A;  2X51 A;  4M3F A;  4L9T A;  2CW7 A;  3V42 A;  3OR1 C;  4HDU A;  1B8I A;  1LVA A;  3GBG A;  3L7W A;  2WY8 Q;  3HTS B;  1KGS A;  3WE2 A;  4BE1 A;  3IV5 A;  4N4N B;  3V7S A;  3QPH A;  4E7J A;  1Q1H A;  4L0Z B;  4PJL A;  5J4V A;  2QZ8 A;  2ID6 A;  1ORK A;  2D1V A;  2DJN A;  3KP2 A;  3SQN A;  4GCV A;  1FIP A;  3RSN A;  3HOZ J;  3WTT C;  5FRO A;  1I1S A;  2KHM A;  4B09 A;  1KQ0 A;  1MH4 A;  1GVJ A;  2BW3 B;  4P55 A;  3ZGK A;  1JKP C;  3RKX A;  4DBQ A;  3RDI A;  5CLS A;  1HC8 A;  4KDP A;  2QQB A;  5M5W J;  1QA6 A;  2ZJ2 A;  2XKP A;  2R7O A;  3OV8 A;  5DTD A;  1FOW A;  3AG4 H;  3ABU A;  5E3L A;  5GTH C;  4N4O B;  1R22 A;  1OYW A;  2DMU A;  2QSF X;  3G3Z A;  4BUP A;  4NBQ A;  4AVZ A;  2Y9Z A;  3KP3 A;  1L0O C;  2DDA A;  1WJF A;  2XAU A;  3MAJ A;  3VOE A;  4F93 B;  5H6R A;  4S0H B;  1PP7 U;  2BHZ A;  3SEZ A;  1S9H A;  4G7Z F;  2HYJ A;  4LLG F;  3QOP A;  5E8I A;  1KU2 A;  3R0A A;  1KQ9 A;  4MQV A;  3K70 D;  3ZCO A;  1RKW A;  2PQ8 A;  4BXX J;  5LEJ A;  2H8W A;  3SDB A;  3F23 A;  2FRH A;  1YTY A;  3WHC A;  1IXR C;  3QAH A;  1A36 A;  3S2H J;  2KIS A;  1MND A;  3CJN A;  2B0L A;  3OOP A;  2WA0 A;  1FP1 D;  3LSJ A;  3QQA A;  3LAJ A;  2R5Y B;  1F9N A;  3A1Y A;  4IHW A;  1GT0 C;  2IS6 A;  4BBR J;  1TTY A;  4MTD A;  3FXL A;  3OS1 A;  1WHU A;  2ZXH A;  1JKQ C;  3LA2 A;  2FJ1 A;  4XN3 A;  1W0U A;  1ZG1 A;  5M5X J;  5HDG A;  4AUX A;  1YJN I;  1LE8 B;  3SFZ A;  5HNH A;  2PMU A;  1W5S A;  4RB2 C;  4Y17 A;  2CSO A;  3Q0W A;  1D5Y A;  2VQG A;  4ZH4 F;  5DM7 F;  2TCT A;  4PGG A;  3BJO A;  3J7Z I;  4IRI A;  1B6A A;  1Y8R B;  2MLG A;  3HM5 A;  2DN0 A;  1S7A A;  4D9J A;  5LFA A;  2VE9 A;  4A69 C;  4HOB A;  2EFN A;  4IJA A;  4L9N A;  3VEP A;  3JR9 A;  1TWA J;  5DDG A;  1DGW Y;  2OJE D;  4U7B A;  1LFP A;  2XF5 A;  1U8R A;  4FHT A;  1K61 A;  1U0J A;  2Y30 A;  2QKM B;  5GAE J;  4YIF A;  4HA8 A;  1KU3 A;  2ESH A;  2ZSI B;  1A04 A;  1P7J A;  5J8F A;  2CV2 A;  4JX6 A;  1QGP A;  2M87 A;  3FWE A;  5EEA A;  1X1B A;  3QYF A;  5EG0 B;  2VON A;  2RQP A;  2VC1 A;  1XSX A;  1LPQ A;  1UAA A;  3CCV I;  3CC7 I;  2H8R A;  1QU3 A;  5CPR B;  3S16 J;  2JJ7 A;  2LK2 A;  1M1E B;  1HKQ A;  1MNM C;  5IT9 Z;  4KIS A;  3TL4 X;  3ZN0 A;  3GTM J;  2RVC A;  2VBX A;  4BHB A;  5IOZ A;  2F4I A;  1XSV A;  2L4A A;  4C3I J;  3PO2 J;  1D0X A;  3KZY A;  1HKS A;  2LDU A;  3VYR B;  3LWF A;  1OJL A;  1SD6 A;  2YPR A;  1UHW A;  2AXL A;  4XLP F;  2KT0 A;  4UUT A;  1B8I B;  3G1L A;  3GTK J;  4KIC A;  3I0T A;  5E20 A;  2V4J C;  1HOM A;  2LY9 A;  4UXN A;  2QEX I;  4HNV A;  4KYW A;  4L18 B;  5IT9 K;  1FLI A;  2EFP A;  2R93 J;  2PMZ A;  1H9T A;  3GFJ A;  2IGM A;  4W97 A;  4BU2 A;  2XGE A;  3F8F A;  1BW5 A;  2K3P A;  2KLO A;  3HHG A;  4GXO A;  3S32 A;  4AYB A;  3JCU C;  1H9G A;  3RYR A;  3CO7 C;  2R7U A;  2BV6 A;  3H5R A;  1OCZ H;  4CH7 A;  3QWL A;  2HYF A;  3KX2 A;  3CUQ C;  3FK7 A;  3BRO A;  4NC6 A;  1D1A A;  4EM2 A;  2D1H A;  2R0Q C;  2NVU B;  4JYK A;  2TRT A;  3G2B A;  4KIG A;  3A01 B;  4ZDL A;  1VTN C;  2K4B A;  4A6E A;  2K9L A;  3L9F A;  5E18 F;  1PUF B;  3S2W A;  2JA5 J;  3WU0 A;  4B43 A;  5F0F A;  2ZCW A;  1UST A;  2R7Z J;  1NHA A;  2GWR A;  5LGU A;  2HR3 A;  2RNG A;  2XSJ C;  2VAS A;  4MGR A;  4CCO A;  2EQR A;  4C2M J;  2ZJQ F;  3DFG A;  1XN7 A;  4PJJ A;  1F43 A;  3KIO A;  1P2F A;  4A12 A;  2JN6 A;  3CC2 I;  2L5Q A;  2R92 J;  2M5W A;  3KYC B;  4XSX F;  1VFC A;  4G9Y A;  1FT9 A;  3G73 A;  1R58 A;  1Z9C A;  2F5F A;  2DTR A;  4MHG A;  4M9S A;  3B6C A;  1STZ A;  1GV2 A;  1XMA A;  4WCG A;  2R5Z A;  2Z16 A;  2FBI A;  3HEF A;  4FQG A;  1SVL A;  3G1O A;  2K9Q A;  2R7W A;  2I5U A;  3EUH C;  1ON2 A;  4BY1 J;  1ETK A;  1ZTR A;  3DKX A;  1GVD A;  3DKW A;  3K4K A;  3TBI A;  4HZF A;  1JTY A;  3WHB A;  2R7R A;  3DV8 A;  4S05 A;  2JK3 A;  3HSE A;  1H8A C;  2FNA A;  2V26 A;  4WXH A;  3WTS C;  1TC3 C;  2STT A;  2L9S A;  3M1E A;  4HEA 2;  2QA4 I;  2V9P A;  3DBH B;  3I3L A;  3BG9 A;  4BBS J;  2VOP A;  4GGG A;  2IS4 A;  3GME A;  2CQN A;  2HZT A;  3KFW X;  2M8G X;  1ZG3 A;  2KQR A;  2M9H A;  3H9Q A;  3ZQH A;  4IHX A;  4ABZ A;  1MBF A;  3HRS A;  5K7H A;  1NG6 A;  1XX5 A;  2EV5 A;  4UVA A;  2BOL A;  4XID A;  2HXO A;  4N9H A;  4E70 A;  3PUB A;  1GHC A;  2QVO A;  4B44 A;  3DU6 A;  4C9Y A;  4F52 A;  4BAC A;  1T98 A;  4HX7 A;  3OSF A;  2EB7 A;  3JTH A;  5HS9 A;  1T38 A;  2W84 A;  3GCM A;  3CDL A;  1XGN A;  2LKS A;  1KZH A;  2QM3 A;  3I9V 2;  4HRI A;  3GVA A;  5DM6 F;  3GF2 A;  2UV1 A;  5BOX A;  5HVQ C;  5IP9 J;  3OSG A;  4EJU A;  2N8G A;  3BG7 A;  3ZMT A;  1RET A;  3NEU A;  3KP7 A;  4IHY A;  2R7V A;  2HYG D;  3K69 A;  4F3Q A;  3ZRG A;  1ZG5 A;  2CS3 A;  3KYL A;  1IC8 A;  3AG3 H;  3RQI A;  5EGO B;  1BM9 A;  3EDP A;  3HRM A;  1KQ8 A;  4A93 J;  4G7O F;  2A6T A;  3GYH X;  2VPR A;  4YEL A;  1ZEL A;  5HLI A;  2DOE A;  4A0Y A;  3WGG A;  5FD6 A;  3PL8 A;  1V3F A;  4R79 A;  1FBQ A;  1Y56 A;  3GTJ J;  3FDY A;  2MFZ A;  3A2K A;  1B4A A;  3ERM A;  2IA0 A;  3H35 A;  4AU7 A;  3LMM A;  1B59 A;  2L7M P;  4OIP F;  3VDX A;  3A4C A;  2QBY A;  4C3J J;  3TW7 A;  1J09 A;  3HSF A;  1JJ6 C;  3V4G A;  4ANJ A;  1YJ9 I;  2EIM H;  2HOT A;  2K5C A;  4A5N A;  1IZ1 A;  4A3M J;  4Q5S F;  1W5C C;  3I54 A;  2XGD A;  2EZI A;  4M9X A;  3CES A;  1R5I D;  5L3F A;  4KT6 A;  2BVL A;  2ZJR F;  2EBI A;  2HU9 A;  4IX7 A;  2HVQ A;  2ZME C;  3F8B A;  3N97 A;  4FCY A;  2VI6 A;  3F6V A;  4CXF A;  5HOO A;  4BJ5 C;  4DOZ A;  1W36 D;  1T33 A;  5KCM A;  1LB2 A;  4PK4 A;  2R7F A;  2X48 A;  4QTR A;  1DPU A;  1R1U A;  1B72 A;  2PI0 A;  3DTK A;  1OYY A;  3PFI A;  1D3Y A;  1FOY A;  4KNY A;  2L4M A;  1UB9 A;  2HWV A;  2ZJP F;  1P92 A;  1S5L C;  1P7I A;  5ILS A;  4BGD A;  2H27 A;  1MJB A;  4Q48 A;  3OYE A;  4M73 A;  1YX5 A;  3GTP J;  1BBY A;  3VWB A;  1BI1 A;  4FT8 A;  1I3Q J;  1Z1D A;  2Q0O A;  2STW A;  1WJA A;  3FM5 A;  3QU6 A;  1T0F A;  2ADU A;  2HDC A;  2W57 A;  1USS A;  5LHH A;  3RKY A;  2PLY A;  1WH7 A;  3HOU J;  5B1A H;  2OTL I;  4LFU A;  4AM3 A;  3HDD A;  5TGT A;  2MGQ A;  3OYB A;  4UB6 C;  1VQL I;  3RI4 A;  2LKP A;  3GFM A;  1B9N A;  2L7Z A;  1WZ2 A;  4V2G A;  5AON A;  1DP3 A;  3H92 A;  4ZYH A;  2DAO A;  2QF7 A;  1MD0 A;  5ICC A;  4HF1 A;  4NDL A;  2DOD A;  2PFB A;  3U21 A;  2R5Z B;  3OYJ A;  4A3G J;  1WJ5 A;  5CVR A;  3M1C A;  4XLH A;  3BPV A;  1WWX A;  4ENK A;  2COB A;  4L9J A;  5FO5 A;  1HST A;  2K02 A;  5IP6 A;  2M4K A;  5DV5 A;  4C3H J;  3FXO A;  1QO0 D;  2GOX B;  3OYF A;  3IKT A;  1VQO I;  3HOW J;  1A5J A;  3R0J A;  4DYQ A;  1QZY A;  4EQQ A;  3IAS 2;  2GLO A;  4F92 B;  2DT6 A;  2DYS H;  1U5T C;  5TIS C;  3BWG A;  3M9A A;  1LDJ A;  3GTG J;  4LK0 F;  3IL2 A;  1IRZ A;  2FQ4 A;  1WKM A;  9ANT A;  3COA C;  2UXN A;  1Y0N A;  2PJP A;  2PEX A;  3U1D A;  2JVH A;  3RIR A;  3ZMV A;  1OKR A;  2DA5 A;  2DW4 A;  3FX3 A;  4XKC A;  5FLM J;  5HS8 A;  1XB4 A;  5DS9 A;  1QQI A;  2ECC A;  2DFF A;  2ZFW A;  4LIT A;  5J1U A;  4B47 A;  3WTU C;  2DA1 A;  3WTW C;  3S14 J;  1SFU A;  2IA2 A;  4IL6 C;  3K1N A;  2A68 F;  3L2V A;  3F22 A;  4CYD A;  2OQG A;  2Z1D A;  2FBH A;  2VBY A;  1R6R A;  3E5Q A;  2OUM A;  2CV1 A;  5E3O A;  4L0Y B;  2UUZ A;  4O6J A;  4OMY A;  2CFO A;  5KHD A;  2V1U A;  3ASO H;  1RES A;  2EFW A;  2B9S A;  1O4X A;  2DFH A;  1IJW C;  1B1B A;  2DFE A;  2DJI A;  1R5H A;  3W6V A;  1IN6 A;  1P6R A;  5F27 A;  5J1R A;  5C3E J;  5HLG A;  4JX5 A;  3CO6 C;  1MDM A;  3DEW A;  2E36 A;  2DCE A;  4S04 A;  3LQQ A;  1DUX C;  4JBA A;  4BJ6 C;  3JRE A;  1WJC A;  2XGC A;  3O8G A;  3FXQ A;  3I5U A;  3RTR A;  4G7H F;  3FHN A;  1OLT A;  2XB5 A;  2QQA A;  1BR4 A;  1SVM A;  2HI3 A;  1CF7 A;  5EYR A;  1LFU P;  4IPA A;  1XG1 A;  4E7L A;  1SD4 A;  2X1E A;  3F8N A;  5BMZ A;  3HSR A;  3IH3 A;  3L1P A;  2VQH A;  1WSU A;  4P9U A;  1ETO A;  2QBY B;  1G2H A;  2L7F P;  1C0W A;  5L3D A;  2HOS A;  1IO2 A;  4LK1 F;  2Z5U A;  3H3Z A;  1FSE A;  2F4O B;  2CRG A;  1IV6 A;  1BC7 C;  1TQP A;  3FIW A;  5F64 A;  3ESW B;  2ELH A;  2PX9 A;  2C6Y A;  4KIF A;  1ZLK A;  3EUA A;  2M30 A;  1WI9 A;  3I71 A;  2JUC A;  1MBH A;  5ED4 A;  3WE3 A;  2HQA A;  4D0P A;  4A3K J;  2LNB A;  2P8T A;  2LKX A;  3GTO J;  3RCO A;  3E3V A;  3HG9 A;  3HXL A;  2KZG A;  4XOP A;  2CGP A;  5GAG J;  2LFB A;  1U3E M;  1KON A;  5D5U B;  5CQE A;  1BIB A;  1QVT A;  5IYB J;  4C30 A;  3GZ6 A;  4HF0 A;  3CUQ A;  2WB1 N;  1AOY A;  2LBF A;  2NVT J;  2UXX A;  4CO8 A;  1TQM A;  1GDT A;  5HS7 A;  1TT0 A;  3A02 A;  1XMK A;  1P4A A;  4B1R A;  3TOB A;  2FU4 A;  4KUM A;  1S7O A;  3BQZ A;  2AQE A;  2QLZ A;  1IXC A;  4KMU X;  5JLW A;  1Q1V A;  3ZQC A;  2ME6 A;  4UY8 I;  2FF4 A;  2HOE A;  2Q2E A;  1ZRF A;  4RB0 A;  5ILU A;  3M8J A;  1FTZ A;  2NYX A;  3GEZ A;  3J7A Y;  2ECB A;  1JT0 A;  5TRD A;  3QP6 A;  1TW3 A;  4NQW A;  3ONQ A;  2HDW A;  3ZQI A;  4BAY A;  2X6O A;  2I8D A;  1QZZ A;  3NWT A;  5IPA A;  2DOA A;  3H9G A;  3V8L A;  3HYI A;  3OYM A;  4CYC A;  4GO1 A;  3RPQ A;  4DYC A;  4ESB A;  4RBO A;  4ASN A;  1OQY A;  1ETV A;  3PJR A;  1T2K A;  2COM A;  3MEX A;  4Y4R A;  3R6S A;  1IRG A;  2HXI A;  2VKH A;  3D5L A;  1XDS A;  2K4J A;  2YX4 A;  3C2B A;  3KET A;  1G3S A;  1ODD A;  1FEX A;  2WAQ N;  1GXQ A;  1K78 A;  3FBI B;  1IN7 A;  5D5V B;  1JUS A;  4IXA A;  1O3R A;  4XM3 A;  2IBD A;  3S8P A;  3BTI A;  1Y1W J;  4AIH A;  2DXI A;  4PZJ A;  2LY1 A;  5E1X A;  1O3T A;  4MFE A;  2MYS A;  2ZNZ A;  2K27 A;  1RIO H;  2KFD A;  2DT5 A;  2JRM A;  3K4N A;  2R7Q A;  2RNJ A;  3AFH A;  5F6F A;  5D8L B;  5FFZ A;  2VKV A;  4XIC A;  1IRF A;  2EIN H;  2NNY A;  2L7K A;  2NS8 A;  5GPC A;  5CJ9 A;  2LH9 A;  2BXZ A;  1RR7 A;  1SMT A;  4R8H A;  4LG0 A;  5EZH A;  1P9Q C;  4XLA A;  1P4W A;  3HPH A;  1IDY A;  3LSR A;  3BJA A;  2H1K A;  4PFP A;  1UEL B;  4Y52 J;  2VXZ A;  2AXT C;  4NC7 A;  4BDZ A;  3HOY J;  3U1K A;  3DPU A;  3FZV A;  3TP0 A;  1D1B A;  2D2W A;  1XC5 A;  1Z91 A;  5ICE A;  1JHF A;  1VQ6 I;  3HKZ A;  4XMY A;  3HOS A;  3CF5 F;  2M2E A;  3WG7 H;  4E7I A;  2WTE A;  5FRN A;  2OPT A;  3W6K B;  4UVC A;  4EJW A;  3JRF A;  3FXU A;  4ZYA A;  3U9G A;  3E7L A;  3ML6 A;  1VF9 A;  1ZAR A;  5CVI A;  5F0H A;  1MDM B;  1G6N A;  3GTQ J;  4K2E A;  4RGS A;  3CC4 I;  2X9D A;  3KP6 A;  1YFH A;  1IW7 F;  1S7E A;  3ZMS A;  2MC3 A;  4NB5 A;  4HV5 A;  2E1O A;  4Z6Y A;  4KN4 X;  2L9R A;  1XD7 A;  1BR1 A;  1A6I A;  4ZDP A;  3JAM Z;  1UJ8 A;  4HDV A;  3ZXS A;  4CZC A;  1FZP B;  1POG A;  2BY2 A;  1MJ9 A;  1MBE A;  2IA1 A;  5F1J A;  3M4O J;  3DXJ F;  3R4K A;  1FPQ A;  5LD2 C;  1JJ8 C;  3T8T A;  5FGM A;  4J00 A;  5DEQ A;  4O5V A;  1YX3 A;  1X4O A;  3IP4 B;  4YII A;  3PM1 A;  4OAY A;  4UVB A;  4I09 A;  3WTX C;  2CV0 A;  1S72 I;  2H6C A;  4PFO A;  2BY0 A;  2P4W A;  2J5P A;  3RKW A;  3K1P A;  3UKG A;  4DIQ A;  4BL0 B;  3FKJ A;  2LMD A;  3OYL A;  4J19 A;  2ZB9 A;  2EFO A;  4RAF A;  3SZT A;  2HTS A;  1IV8 A;  2V1N A;  3QP5 A;  3VYS B;  3JAM K;  1UHS A;  2ESN A;  1VQ8 I;  3F8M A;  3HGG A;  3EUK L;  5L3B A;  2BGC A;  3ELK A;  3T1B A;  5JFR A;  4M3G A;  2GA2 A;  1SC7 A;  1PJR A;  2Y31 A;  1R7J A;  4H0E A;  2OD5 A;  2DMT A;  3GZN B;  2TDX A;  1Z7U A;  2E7X A;  3MZ8 A;  3BT9 A;  3CUQ B;  3OS0 A;  4DW6 A;  2LBF B;  4RM3 A;  4CDG A;  4OU0 A;  3K4C A;  5FKK A;  3I59 B;  2DA7 A;  3IWZ A;  3OWT A;  4NHJ A;  2VJI A;  4G6D A;  2Y0M A;  1MMS A;  1FMV A;  2HQ5 A;  2JA6 J;  3I4N J;  2Q2E B;  2ME0 A;  2W00 A;  3DLA A;  4DNC A;  1YRN A;  3ERE D;  4II2 A;  1ETQ A;  1YS7 A;  2L9N A;  3SZP A;  4XKV A;  5JVG F;  2MD5 A;  4C2U A;  3EYY A;  4NQW B;  4FTH A;  3JRC A;  4CA0 A;  2HDD A;  5D8K B;  1LQ1 A;  2VPL A;  2PG4 A;  1SFK A;  1FJL A;  3DBL B;  5BNG A;  2LRE A;  3HC7 A;  1U8B A;  1NK3 P;  4CYC B;  5IT3 A;  1HSJ A;  1Z05 A;  3MKW B;  2MG4 A;  2GAU A;  1K6O A;  2JQ7 A;  2X6X A;  2Y2Z A;  2QKL B;  3Q5F A;  4KFC A;  1K78 B;  1I6H J;  2Y48 A;  3H5N A;  2A6H F;  2LYC A;  2X0L A;  2Z2S B;  2OF7 A;  4CUG A;  1X19 A;  2JT1 A;  2P6S A;  1X1C A;  2LRD A;  5CVV A;  4G6Q A;  1MGT A;  2DQL A;  3WTZ A;  4DBR A;  2XIG A;  1U5T A;  1N77 A;  2W24 A;  2XV4 S;  4E7H A;  2W48 A;  2AHQ A;  3KZI C;  2VKD A;  2K86 A;  3PFY A;  3S1N J;  2HKO A;  4RLF A;  3LQR A;  2HGC A;  4O3M A;  4C2T A;  2VT2 A;  3DKY A;  4LG0 B;  1WQ2 A;  2VBW A;  2VBZ A;  3BR5 A;  2QWW A;  2P7V B;  4PSX A;  4FX4 A;  5EJC A;  2P5K A;  1FBU A;  1JUM A;  3WU2 C;  2JTV A;  3LSI A;  1ZHF A;  2R7D A;  5FKL A;  1LVK A;  2VN2 A;  1PP8 F;  4I7H A;  1V55 H;  2H09 A;  1EH8 A;  1MW7 A;  1BC8 C;  1BA5 A;  1JT6 A;  1XTA A;  3OYH A;  4Y33 A;  4Y3O A;  3K9T A;  4ESF A;  1ETW A;  2K9N A;  3IRR A;  3HJE A;  3JRG A;  2VJ5 A;  5DCF A;  2M4G A;  2ISY A;  3K0L A;  2OQR A;  2ICW G;  1R4N B;  1H0M A;  4LJZ F;  3A0B C;  4RS8 A;  5FKN A;  1H89 C;  3JSP A;  1R1V A;  1HLV A;  1VQ7 I;  2WY7 Q;  5LHI A;  2ID3 A;  3VYU B;  2NNN A;  2PMH A;  4P9F A;  2DA6 A;  1SMY F;  1U78 A;  2GIZ A;  2WWY A;  3GZ5 A;  1W36 C;  2ELJ A;  3BCB A;  3FMQ A;  3HUG A;  4BXF A;  1LFB A;  1MMN A;  1JI8 A;  4KJZ A;  5KAI C;  2CW0 F;  5HOD A;  5F08 A;  2KRF A;  3CMY A;  4G8X A;  4FE7 A;  2YU9 J;  2FOW A;  3W6J B;  2DPU A;  3TMO A;  3CCJ I;  2XAQ A;  1IN4 A;  3Q9V A;  5GP9 A;  4CCN A;  1XGO A;  2ZXJ A;  1RR8 C;  1WJE A;  3ULQ B;  1S3J A;  2EZK A;  2M8E A;  3BG5 A;  3H1C A;  4BXU A;  4WWC A;  1VI0 A;  2EV0 A;  3CCE I;  3MMY B;  4ZTF A;  2KRH A;  3GTL J;  1NK2 P;  3QOE A;  3DPT A;  2CYY A;  3J7Y J;  4DZJ A;  4RGU A;  3EPZ A;  4A3D J;  1MBG A;  1LUJ B;  1UCR A;  4KN7 X;  1I50 J;  2E7W A;  1VZ0 A;  3JW4 A;  1ZYR F;  2DMQ A;  1LDD A;  1ZGA A;  3BY6 A;  2E5Z A;  2W82 A;  2FE3 A;  3NRV A;  4OAZ A;  1YHQ I;  2VXD A;  4E7Z A;  5CVU A;  2E2H J;  3S17 J;  3W2W A;  2VOO A;  2OAZ A;  1F1Z A;  1XPX A;  1R49 A;  3JRD A;  1FYL A;  1T56 A;  4IOA F;  1RI7 A;  3BG3 A;  2LR8 A;  2XB0 X;  4UHT A;  1ENH A;  1O7L A;  2XGX A;  3TOA A;  4RB1 A;  3F3X A;  3WG9 A;  5J6X A;  4BY7 J;  1JE8 A;  3KEO A;  4I01 A;  2XC7 A;  3G4S I;  2I10 A;  4U7D A;  1AKH A;  2R3S A;  2V7F A;  3FF5 A;  5FKO A;  3MCZ A;  4AIK A;  1HXD A;  3IRQ A;  3DBR B;  2E1C A;  3W2V A;  3OL4 A;  5E17 F;  2XHK A;  1FY7 A;  1J75 A;  4L5I A;  1W1W E;  1T08 B;  4XN0 A;  2Z3Y A;  3L2C A;  3G1M A;  3KEQ A;  3CMA I;  2IJL A;  2W1O A;  2Y0S A;  1TLH B;  1XCB A;  1MMD A;  2CUF A;  2GOM A;  1WGX A;  2QUF A;  3BTC A;  3KP5 A;  2V79 A;  3HGY A;  3P5J A;  4AD9 A;  1OMI A;  2WV0 A;  3NWS A;  1KYW A;  1A35 A;  3O2P E;  1U2W A;  2LSO A;  2ZKZ A;  3V7C A;  2MH9 A;  1GV5 A;  3JTG A;  3J80 K;  1YRN B;  1RNL A;  1JTX A;  2DA2 A;  2XPW A;  3B6A A;  3S1Q J;  2OCC H;  1OCC H;  3PNT A;  3WU1 B;  5H2F C;  3MQ0 A;  3E5X A;  3FMS A;  4GFB A;  2H94 A;  2JZY A;  3HRU A;  4EM1 A;  2NVY J;  3N05 A;  5BQT A;  4RGX A;  5LRS A;  2JA8 J;  2J5O A;  2IP2 A;  3M8E A;  4JOM A;  3M7G A;  3VSK A;  4UUS A;  3RQ4 A;  2ZO4 A;  3CMM A;  2EFQ A;  2PBI A;  2WAQ A;  4IF4 A;  3ZR8 X;  3C3W A;  4HAM A;  4YIR X;  4ESJ A;  1FOX A;  1ZN2 A;  5M3M J;  3J81 Z;  2GXB A;  1YQA A;  4J01 A;  1NG7 A;  4LGW A;  5E1Z B;  1KU7 A;  2MAB A;  4LD5 A;  1K83 J;  4UV9 A;  4RDU A;  1AHD P;  2O7O A;  3TDU C;  3BZC A;  3CQZ J;  5HNF A;  2OCE A;  4N0B A;  3QYB A;  5C44 J;  2KIF A;  5H20 A;  2XAH A;  3SHF A;  2AQF A;  1ZQ3 P;  1IUF A;  4XOR A;  2A3S A;  1K79 A;  1HW2 A;  1HBX G;  1QHG A;  4PGH A;  1YYV A;  1UHM A;  2L02 A;  1DGR M;  4AID A;  5J3L A;  1FX7 A;  3K4M A;  2HZD A;  5IYD J;  1IGN A;  1ZRD A;  2JSC A;  3J81 K;  1RRJ A;  4DYR A;  3I64 A;  2A69 F;  2BYV E;  5LEK A;  5J1Y A;  2GM4 A;  3CLO A;  2G9W A;  3CCM I;  5C4J J;  4BH9 A;  2FSW A;  3Q0V A;  1IXS B;  3A03 A;  2WAF A;  5B1B H;  4IO9 F;  4P5O A;  3I58 A;  4Z2Y A;  4JP0 A;  5KK1 A;  4LLL A;  5M3F J;  1EA3 A;  4XON A;  1HF0 A;  4DGW B;  2M34 A;  1EV7 A;  3ZP5 A;  1JXS A;  1LEA A;  1T8I A;  1O7F A;  3BOQ A;  1UG2 A;  1X58 A;  3DQV C;  3FXK A;  3HUG B;  4RAG A;  4B4C A;  2P0W A;  1LNW A;  5DCM A;  1I27 A;  4LG3 A;  1ONV A;  3LAP A;  1PVE A;  2F5E A;  2NXN B;  5AIQ A;  2E71 A;  3CCQ I;  1SFO J;  2YU3 A;  3CCR I;  1TBX A;  3DU5 A;  1V5F A;  2CH0 A;  3C2H A;  2A05 A;  2PN6 A;  4Q4Z F;  1PUE E;  2ZSH B;  1G59 A;  4QPO A;  1FTT A;  2HTJ A;  3K7A J;  1FBS A;  4NUB A;  3LFU A;  3E5U A;  1LEB A;  1U9O A;  1YS6 A;  3HL2 A;  5LRR A;  2A5Y B;  4M3E A;  3Q0U A;  3R60 A;  3E0J B;  3DLL F;  3KZZ A;  1KYZ A;  2Y75 A;  2QSH X;  3S15 J;  2V6C A;  3OYN A;  3TW6 A;  2V9V A;  5L3G A;  4WK8 F;  2AO9 A;  3CJT B;  4BQN A;  2CQQ A;  4XKB A;  5FD5 A;  3KE2 A;  1N25 A;  4A5M A;  1QNT A;  1Z77 A;  4FX0 A;  2ZFU A;  4ITV A;  2L0K A;  3DF8 A;  4M74 A;  2B7E A;  2Y9Y A;  1YLF A;  2HQN A;  4TV7 A;  2YX7 A;  4PJ0 C;  1I5Z A;  4XLC A;  1K6Y A;  3SXY A;  3GFI A;  2FNP A;  1GLN A;  5GTI C;  2FQ3 A;  1E3O C;  1MBK A;  2E35 A;  4U0W A;  1W0T A;  5ILV A;  4B3X A;  3TO9 A;  3I55 I;  2HQR A;  4PDK A;  2M7B A;  1ACI A;  3FHZ A;  1JHH A;  2A07 F;  5EEH A;  2Y69 H;  4D5C A;  1R5G A;  4AYB N;  1T39 A;  5IY5 H;  1X1D A;  4M6Y A;  3OYA A;  4QLC U;  2X85 A;  4KMF A;  1APL C;  1U9N A;  3QPT A;  3HHH A;  4AC0 A;  1DP7 P;  4XBF A;  2XSD C;  3S3M A;  1R36 A;  2EV6 A;  3HBL A;  4MNU A;  2MA3 A;  4MQ9 F;  3BP8 A;  3O6B B;  4I0B A;  3AG1 H;  1E17 A;  1HDD C;  5LLQ A;  3NAU A;  1OCR H;  2QGU A;  5J40 A;  5DD8 A;  4XQF A;  4JX4 A;  2VC0 A;  1YIO A;  1WJD A;  1ZR4 A;  4D7N A;  1E3H A;  2X6W A;  4KA4 A;  1WPK A;  3CTA A;  2FML A;  2L2O A;  2D45 A;  4EV0 A;  3ZMZ A;  1T95 A;  3TP3 A;  2HPI A;  3PSF A;  3RPU A;  2E1M B;  4UUS B;  4EGY A;  2GBY A;  3LSP A;  1N75 A;  2KL4 A;  2V9K A;  4II3 A;  2DO7 A;  4BQO A;  2DQR A;  1E3P A;  2E1N A;  5K7F A;  3HOX J;  4IZZ A;  1QHH D;  2FEZ A;  2GZW A;  1HQC A;  3ISP A;  2QCO A;  4XRS G;  1A31 A;  4OIN F;  3ZQQ A;  3JRA A;  1CQT A;  4UV8 A;  4LB5 A;  4XOT A;  3IAM 2;  1ZGJ A;  3K70 C;  2RGV A;  4RMN A;  2EZL A;  2XRL A;  4BKX A;  2HEO A;  4MTE A;  3AAF A;  4HNU A;  5DD4 A;  1LE8 A;  4ENM A;  2HFH A;  1YOV B;  1B72 B;  1ZH5 A;  1QBJ A;  1BI3 A;  2ACJ A;  2XAS A;  2M45 A;  3P7N A;  1X2M A;  3AL0 C;  3K10 A;  3N4M A;  4NNJ A;  3VPR A;  2ELK A;  2CFX A;  1SD7 A;  1U6G A;  2XRN A;  3CZ6 A;  2KMU A;  4EMS A;  3BQY A;  3BC8 A;  3L2U A;  4I6Z A;  2L01 A;  1ZRE A;  1BW6 A;  2VIX A;  2M0M A;  4I02 A;  2IGO A;  4ZTJ A;  2DOF A;  1Z6R A;  4CCK A;  3GXO A;  2FA5 A;  5K7Z A;  3HRT A;  3F6O A;  4MFD A;  4YFK F;  2DU9 A;  4D1Q A;  3F21 A;  1WFX A;  3F0C A;  1RC9 A;  4DQ2 A;  2NS7 A;  3CCU I;  2D5V A;  3T5X A;  4U0V A;  4QSH A;  1HDP A;  3K2Z A;  4PUS A;  4G12 A;  1IRX A;  2BY3 A;  4BJT A;  3C18 A;  1I3A A;  3CLQ A;  1G8X A;  1V5G A;  4U87 A;  1H88 C;  4OIO F;  3TGN A;  4A3E J;  3M3Y J;  1HW1 A;  1SVO A;  2CUE A;  3QYE A;  2CG4 A;  4XNF A;  5FRM A;  5IOY A;  5EG0 A;  2JA7 J;  2FD5 A;  4HNT A;  2RKH A;  4KT5 C;  1JKR C;  3BTJ A;  3EUH A;  4I99 C;  1E2X A;  3HPG A;  4ZYG A;  1OCO H;  3L00 A;  2E2I J;  2ZBK A;  4BE0 A;  1X1A A;  3LL7 A;  4HF2 A;  1JGS A;  2Z9O A;  3VSL A;  1MZB A;  4CCJ A;  4Q47 A;  1MSF C;  2JSP A;  3VOD A;  1XMX A;  1ZLJ A;  4FIS A;  3M07 A;  3RZD J;  2NAZ A;  1F4K A;  1REP C;  2RRE A;  4BS9 A;  2R7S A;  2LF8 A;  1R23 A;  2F4M B;  5JHU A;  2CO5 A;  3ZOB A;  3OYG A;  5FJ8 J;  2ZXW H;  4IHS A;  1IG7 A;  3V7R A;  4A6D A;  2XDV A;  3DP7 A;  2VJJ A;  3Q3S A;  3GX4 X;  1IF1 A;  3BJ6 A;  4DZP A;  2W85 A;  4XRM A;  2FBK A;  4XR6 A;  4IRH A; 
#chains in the Genus database with same CATH homology
 2RC4 A;  3P9I A;  2XUB A;  4AIJ A;  1RZ4 A;  3EYI A;  4L9V A;  4A0Z A;  1SFE A;  2O0Y A;  3ECH A;  2HKX A;  4YG2 F;  1L3L A;  2O8X A;  5L3E A;  4IHT A;  4UNO A;  1P4X A;  3Q9S A;  5ERI A;  1W7P A;  4M72 A;  2UZK A;  3C7J A;  3JSO A;  2DLL A;  2AS5 F;  1S29 A;  1Y0U A;  1CF7 B;  5DUI A;  3KP4 A;  1X3U A;  2DI3 A;  2IRF G;  1FP2 A;  3E97 A;  3EQL F;  2DK8 A;  4OIR F;  2P5V A;  5J8C A;  4R1H A;  4KIB A;  2RN7 A;  5D5W B;  1XCV A;  4QWQ A;  3GO5 A;  1FOK A;  3C1D A;  5BS6 A;  3VB2 A;  2JRT A;  4MEY F;  2ZME A;  3KLO A;  5HLH A;  5F1R A;  4RAZ A;  2EWN A;  4ETS A;  4HX4 A;  4M6X A;  4WF2 A;  1QPM A;  6PAX A;  1D8K A;  4EM0 B;  4YFX F;  3F72 A;  5LBQ A;  1YW9 A;  3IC7 A;  4F7Z A;  3P9C A;  2O6G E;  5HDK A;  1DDN A;  1RUO A;  1BOA A;  5L3C A;  5JR3 A;  3ZMU A;  4Y15 A;  4BHC A;  2FMY A;  3CDH A;  4GYG A;  1FWZ A;  2KKO A;  3MWM A;  1B9M A;  3REO A;  3QRF F;  4I2O A;  2IPQ X;  4HYE A;  1MKM A;  1FYK A;  3TDZ C;  1TNT A;  4XSZ F;  2ETH A;  1SFX A;  4ENJ A;  3GWZ A;  1G4D A;  3T8R A;  3WGH A;  4HLY A;  2BEO A;  4WXC A;  4M71 A;  3HTU A;  1ZRC A;  5JVT A;  5FLX Z;  5DUK A;  1O57 A;  5HDN A;  2GXG A;  4HLX A;  4ZYE A;  5BPD A;  3TKY A;  3ZQ7 A;  4AWX B;  5CYV A;  3D0S A;  4YFN F;  4XRF A;  5A2Q Z;  1J9I A;  5K5R A;  2G7U A;  2VT3 A;  1CGP A;  4GYI A;  2WC2 A;  3ROU A;  4CGZ A;  1ZAO A;  2QEN A;  3ZPL A;  1W4M A;  1S8N A;  2GIV A;  5JI6 A;  5FLX K;  4EJO A;  1F5T A;  2DFI A;  4BQA A;  4ENN A;  2HS5 A;  1W7P B;  1UFM A;  2P5L C;  4ON0 A;  2JPC A;  1J5Y A;  5K5O A;  3QU3 A;  5ICG A;  4P96 A;  5A2Q K;  4OIQ F;  3E6D A;  4LMY A;  3P9K A;  1G3Y A;  3BPX A;  5K5Q A;  2LF7 A;  3ABT A;  3TQN A;  1FNN A;  2KJB A;  2IVM A;  3H3U A;  1XDU A;  4ZZD A;  4PCQ A;  4N9I A;  2DK5 A;  4HX8 A;  3FM3 A;  3CUO A;  4CZZ A;  4A0X A;  1LJ9 A;  2ZME B;  1FYM A;  3LFK A;  2IT0 A;  2VE8 A;  3J80 Z;  2A61 A;  4HQE A;  4JK1 X;  5KVR A;  2FXA A;  4LB6 B;  1IN5 A;  1LDK B;  5LGN A;  3V8K A;  2F5C A;  3PQK A;  2M1B A;  3GW2 A;  3BZ6 A;  2FOK A;  1K7A A;  2OU2 A;  2BBY A;  4WX9 A;  3V8J A;  5FFX A;  1J7K A;  1GXP A;  3B73 A;  3O3K A;  4L5J A;  2JPB A;  3WTY C;  3HIF A;  1IAW A;  1R00 A;  1R1T A;  3ZN1 A;  3IWF A;  3WTV C;  1MJA A;  5D4S A;  1BI2 A;  3I4P A;  1J59 A;  2L54 A;  3IHU A;  4A2U A;  3E6B A;  3T0Y A;  1O3Q A;  1U5T B;  3HOT A;  2V1D A;  1SAX A;  4BHP A;  1YW8 A;  4IVN A;  4MEX F;  3NQO A;  1I1G A;  2KIU A;  2L3D A;  2O03 A;  1G3T A;  5BPI A;  2GQQ A;  1D5V A;  5K1Y A;  1V4R A;  2NRA C;  4CHU A;  4G94 A;  4HW0 A;  1BI0 A;  3EET A;  3PQJ A;  3FMR A;  3B02 A;  3LA3 A;  2ISZ A;  3TO7 A;  4HV6 A;  4M9Z A;  1W5T A;  1XGS A;  2G7H A;  4ZYD A;  4RAY A;  2A6E F;  1G3W A;  4I98 B;  2BE5 F;  2UWM A;  5ICF A;  3MFK A;  2YR2 A;  3MZH A;  2CQK A;  1TQI A;  1OYI A;  2DPD A;  1O3S A;  1TNS A;  1YG2 A;  2YSR A;  1KU9 A;  2Q8K A;  5E1W A;  1WRJ A;  1J2X A;  2XAJ A;  1TW2 A;  1XSD A;  3TO6 A;  2MH2 A;  3ZMD A;  3DPL C;  5H6Q A;  2XVC A;  3RJP A;  3IKV A;  4CIC A;  1J0R A;  2XAG A;  2OZ6 A;  1W7P D;  1HKT A;  4Y13 A;  3R61 A;  2Z99 A;  2P6T A;  3K1M A;  5LGT A;  2V1X A;  3LST A;  1ULY A;  4JQF A;  2KJC A;  2ZNY A;  1AWC A;  3F8C A;  2O3F A;  1OPC A;  2EJR A;  4UUV A;  3GLX A;  3U2R A;  1RUN A;  4I0A A;  2W25 A;  4XLN F;  1XGM A;  4WXD A;  1FC3 A;  5D6E A;  1OR7 A;  1EH6 A;  5AIP A;  4B8X A;  5DYM A;  3E6C C;  2H6B A;  1BIA A;  3E6M A;  1YO5 C;  3GFL A;  1HW5 A;  3M8F A;  2O61 A;  1T6S A;  4LLN A;  2EK5 A;  4EGZ A;  4IRG A;  2RV8 A;  3VFZ A;  5D5X B;  2EA4 A;  1KA8 A;  2DBB A;  2F2E A;  2VOD A;  2K7L A;  2QQ9 A;  5EEG A;  1EH7 A;  2XRO A;  5D4R A;  3DEU A;  5TJJ A;  2Z33 A;  1I6X A;  4HQM A;  5E8G A;  4RGR A;  2MBF A;  3WGI A;  4EJT A;  3I53 A;  2QYO A;  3MZY A;  1BJA A;  2NS0 A;  2EA2 A;  3ECO A;  3KCC A;  2GA1 A;  3GUD A;  5D6F A;  1Z6T A;  1ON1 A;  3FXR A;  4U0Y A;  1BN5 A;  2OBP A;  2XAF A;  3KLN A;  4BYY A;  2IW5 A;  2KIM A;  4AVP A;  2X4H A;  2XKO A;  2P7C B;  3LA7 A;  3I59 A;  1DPR A;  2MLK A;  1YW7 A;  5DCM B;  1FSH A;  4EVI A;  4U88 A;  1IN8 A;  4OMZ A;  1D8J A;  3WOD F;  3L09 A;  3BDD A;  1PDN C;  2OA4 A;  2OZU A;  4RB3 C;  2F5D A;  2RDP A;  3J7A O;  1IUY A;  1SD5 A;  2CWE A;  4ZZL A;  3RYP A;  5CVJ A;  4OOI A;  4EJV A;  1S6L A;  5LHG A;  4HBL A;  4BNC A;  4L9T A;  4HDU A;  1LVA A;  3L7W A;  3HTS B;  1KGS A;  3WE2 A;  3V7S A;  3QPH A;  1Q1H A;  4L0Z B;  2QZ8 A;  2D1V A;  3KP2 A;  3SQN A;  4GCV A;  3WTT C;  1I1S A;  4B09 A;  1KQ0 A;  1GVJ A;  4P55 A;  3RKX A;  3RDI A;  5CLS A;  4KDP A;  2QQB A;  2ZJ2 A;  2XKP A;  3OV8 A;  3ABU A;  1R22 A;  1OYW A;  3G3Z A;  3KP3 A;  1L0O C;  3MAJ A;  3VOE A;  5H6R A;  1PP7 U;  4G7Z F;  4LLG F;  3QOP A;  5E8I A;  1KU2 A;  3R0A A;  1KQ9 A;  4MQV A;  2PQ8 A;  5LEJ A;  3F23 A;  2FRH A;  1YTY A;  1IXR C;  3QAH A;  2B0L A;  3CJN A;  3OOP A;  1FP1 D;  3LAJ A;  1F9N A;  1TTY A;  4MTD A;  3LA2 A;  1ZG1 A;  5HDG A;  3SFZ A;  2PMU A;  1W5S A;  4RB2 C;  4Y17 A;  2CSO A;  4ZH4 F;  4PGG A;  3BJO A;  4IRI A;  1B6A A;  2MLG A;  1S7A A;  2VE9 A;  4HOB A;  2EFN A;  4IJA A;  4L9N A;  3VEP A;  5DDG A;  4U7B A;  1U8R A;  4FHT A;  4YIF A;  4HA8 A;  1KU3 A;  2ESH A;  1A04 A;  5J8F A;  1QGP A;  2M87 A;  3FWE A;  2VON A;  2RQP A;  2VC1 A;  1XSX A;  5IT9 Z;  1HKQ A;  3ZN0 A;  2RVC A;  2VBX A;  4BHB A;  1XSV A;  2L4A A;  3KZY A;  1HKS A;  2LDU A;  3LWF A;  1SD6 A;  2YPR A;  1UHW A;  2AXL A;  4XLP F;  4KIC A;  3I0T A;  5E20 A;  4UXN A;  4KYW A;  4L18 B;  5IT9 K;  1FLI A;  2EFP A;  1H9T A;  3GFJ A;  3F8F A;  3HHG A;  4GXO A;  3RYR A;  1H9G A;  3CO7 C;  2BV6 A;  2HYF A;  3CUQ C;  3BRO A;  4EM2 A;  2D1H A;  4KIG A;  1VTN C;  2K4B A;  4A6E A;  3L9F A;  5E18 F;  3S2W A;  3WU0 A;  2ZCW A;  1UST A;  1NHA A;  2GWR A;  5LGU A;  2HR3 A;  4MGR A;  3DFG A;  1XN7 A;  1P2F A;  4A12 A;  2M5W A;  4XSX F;  4G9Y A;  1FT9 A;  3G73 A;  1R58 A;  1Z9C A;  2F5F A;  2DTR A;  4MHG A;  4M9S A;  1STZ A;  1XMA A;  4WCG A;  2FBI A;  1ON2 A;  3DKW A;  4HZF A;  3DV8 A;  4S05 A;  3HSE A;  2FNA A;  4WXH A;  3WTS C;  2STT A;  3M1E A;  2VOP A;  4GGG A;  2HZT A;  3KFW X;  1ZG3 A;  3HRS A;  4UVA A;  2EV5 A;  4N9H A;  4E70 A;  1GHC A;  2QVO A;  1T98 A;  4HX7 A;  2EB7 A;  3JTH A;  5HS9 A;  1T38 A;  2W84 A;  1XGN A;  2QM3 A;  3GVA A;  3GF2 A;  5BOX A;  5HVQ C;  4EJU A;  3ZMT A;  3NEU A;  3KP7 A;  2HYG D;  3K69 A;  1ZG5 A;  1BM9 A;  3EDP A;  3HRM A;  1KQ8 A;  4G7O F;  3GYH X;  5HLI A;  4A0Y A;  3WGG A;  5FD6 A;  1V3F A;  4R79 A;  1FBQ A;  1B4A A;  2IA0 A;  1B59 A;  4OIP F;  2QBY A;  3HSF A;  3V4G A;  4A5N A;  1IZ1 A;  4Q5S F;  3I54 A;  4M9X A;  5L3F A;  3F8B A;  3N97 A;  3F6V A;  4CXF A;  5HOO A;  1LB2 A;  2R7F A;  1DPU A;  1R1U A;  2PI0 A;  1OYY A;  3PFI A;  1D3Y A;  4KNY A;  2L4M A;  1UB9 A;  2HWV A;  1P92 A;  5ILS A;  2H27 A;  1MJB A;  4Q48 A;  4M73 A;  1BBY A;  1BI1 A;  4FT8 A;  1Z1D A;  2Q0O A;  2STW A;  3FM5 A;  3QU6 A;  1T0F A;  2ADU A;  2HDC A;  2W57 A;  1USS A;  5LHH A;  3RKY A;  2PLY A;  4LFU A;  3RI4 A;  2LKP A;  3GFM A;  1B9N A;  5AON A;  3H92 A;  4ZYH A;  2DAO A;  1MD0 A;  5ICC A;  4HF1 A;  2PFB A;  5CVR A;  3BPV A;  1WWX A;  4ENK A;  4L9J A;  5FO5 A;  1HST A;  2K02 A;  5DV5 A;  1QO0 D;  3IKT A;  3R0J A;  1QZY A;  4EQQ A;  1U5T C;  3BWG A;  3M9A A;  1LDJ A;  4LK0 F;  3IL2 A;  1WKM A;  3COA C;  2UXN A;  2PJP A;  2PEX A;  3U1D A;  3RIR A;  3ZMV A;  1OKR A;  2DW4 A;  3FX3 A;  5HS8 A;  1XB4 A;  1QQI A;  2ZFW A;  3WTU C;  3WTW C;  1SFU A;  2IA2 A;  3K1N A;  2A68 F;  3F22 A;  4CYD A;  2OQG A;  2FBH A;  2VBY A;  3E5Q A;  4L0Y B;  4O6J A;  4OMY A;  2V1U A;  2EFW A;  1B1B A;  1R5H A;  1IN6 A;  1P6R A;  5HLG A;  3CO6 C;  1MDM A;  4S04 A;  3LQQ A;  1DUX C;  4JBA A;  3FXQ A;  3I5U A;  3RTR A;  4G7H F;  2QQA A;  1CF7 A;  4IPA A;  1SD4 A;  3F8N A;  5BMZ A;  3HSR A;  1WSU A;  4P9U A;  2QBY B;  1C0W A;  5L3D A;  4LK1 F;  2Z5U A;  3H3Z A;  1FSE A;  1BC7 C;  1TQP A;  5F64 A;  2ELH A;  2C6Y A;  4KIF A;  1ZLK A;  2M30 A;  1WI9 A;  3I71 A;  5ED4 A;  3WE3 A;  4D0P A;  2LNB A;  2P8T A;  3E3V A;  2CGP A;  1U3E M;  5D5U B;  1BIB A;  3GZ6 A;  4HF0 A;  3CUQ A;  1AOY A;  2UXX A;  4CO8 A;  1TQM A;  5HS7 A;  1XMK A;  1P4A A;  3TOB A;  2FU4 A;  4KUM A;  1S7O A;  2QLZ A;  1IXC A;  4KMU X;  2FF4 A;  2HOE A;  2Q2E A;  1ZRF A;  4RB0 A;  5ILU A;  2NYX A;  3GEZ A;  5TRD A;  3QP6 A;  1TW3 A;  4NQW A;  4BAY A;  1QZZ A;  3V8L A;  3HYI A;  4GO1 A;  3RPQ A;  4ESB A;  4ASN A;  1T2K A;  2COM A;  3MEX A;  3R6S A;  1IRG A;  2YX4 A;  3D5L A;  1XDS A;  2K4J A;  3KET A;  1G3S A;  1ODD A;  1GXQ A;  1K78 A;  1IN7 A;  5D5V B;  4IXA A;  1O3R A;  4AIH A;  4PZJ A;  5E1X A;  1O3T A;  2ZNZ A;  2K27 A;  1RIO H;  2DT5 A;  2RNJ A;  5F6F A;  5D8L B;  5FFZ A;  1IRF A;  2NNY A;  5CJ9 A;  1SMT A;  4R8H A;  4LG0 A;  1P4W A;  3BJA A;  2VXZ A;  3FZV A;  2D2W A;  1Z91 A;  5ICE A;  1JHF A;  3HOS A;  2WTE A;  3W6K B;  4UVC A;  4EJW A;  3FXU A;  3U9G A;  3ML6 A;  1ZAR A;  5CVI A;  1MDM B;  1G6N A;  4K2E A;  4RGS A;  3KP6 A;  1YFH A;  1IW7 F;  3ZMS A;  2MC3 A;  4NB5 A;  4HV5 A;  4KN4 X;  1XD7 A;  3JAM Z;  4HDV A;  1FZP B;  1MJ9 A;  2IA1 A;  3DXJ F;  3R4K A;  1FPQ A;  3T8T A;  5FGM A;  5DEQ A;  4O5V A;  4YII A;  4UVB A;  4I09 A;  3WTX C;  2H6C A;  2P4W A;  2J5P A;  3RKW A;  3K1P A;  2EFO A;  3SZT A;  2HTS A;  3QP5 A;  3JAM K;  2ESN A;  3F8M A;  5L3B A;  2BGC A;  3ELK A;  3T1B A;  5JFR A;  2GA2 A;  1R7J A;  4H0E A;  2OD5 A;  2TDX A;  1Z7U A;  2E7X A;  3CUQ B;  4CDG A;  4OU0 A;  3I59 B;  3IWZ A;  4NHJ A;  4G6D A;  2Y0M A;  4DNC A;  3ERE D;  1YS7 A;  3SZP A;  2MD5 A;  3EYY A;  5D8K B;  1LQ1 A;  2PG4 A;  5IT3 A;  1HSJ A;  1Z05 A;  2GAU A;  1K6O A;  3Q5F A;  4KFC A;  1K78 B;  2Y48 A;  2A6H F;  2X0L A;  2JT1 A;  2P6S A;  5CVV A;  4G6Q A;  1MGT A;  2DQL A;  3WTZ A;  2XIG A;  1U5T A;  2W24 A;  2XV4 S;  2K86 A;  2HKO A;  3LQR A;  2HGC A;  4O3M A;  2VT2 A;  4LG0 B;  1WQ2 A;  2VBW A;  2VBZ A;  2QWW A;  2P7V B;  4FX4 A;  2P5K A;  1FBU A;  2JTV A;  1ZHF A;  2R7D A;  2VN2 A;  1PP8 F;  4I7H A;  2H09 A;  1EH8 A;  1BC8 C;  3K9T A;  4ESF A;  3IRR A;  5DCF A;  2ISY A;  3K0L A;  2OQR A;  1H0M A;  4LJZ F;  4RS8 A;  3JSP A;  1R1V A;  5LHI A;  2NNN A;  2PMH A;  4P9F A;  1SMY F;  1U78 A;  2WWY A;  3GZ5 A;  3FMQ A;  3HUG A;  2CW0 F;  2KRF A;  4G8X A;  3W6J B;  2DPU A;  2XAQ A;  1IN4 A;  3Q9V A;  1XGO A;  2ZXJ A;  3ULQ B;  4BXU A;  1S3J A;  2M8E A;  4WWC A;  2EV0 A;  3DPT A;  2CYY A;  4RGU A;  1UCR A;  4KN7 X;  2E7W A;  3JW4 A;  1ZYR F;  1LDD A;  1ZGA A;  3BY6 A;  3NRV A;  2FE3 A;  5CVU A;  2VOO A;  2OAZ A;  1F1Z A;  1FYL A;  1RI7 A;  4UHT A;  1O7L A;  2XGX A;  3TOA A;  4RB1 A;  3F3X A;  3WG9 A;  5J6X A;  1JE8 A;  3KEO A;  4I01 A;  4U7D A;  2R3S A;  3FF5 A;  3MCZ A;  4AIK A;  1HXD A;  3IRQ A;  2E1C A;  5E17 F;  2XHK A;  1FY7 A;  1J75 A;  4L5I A;  2Z3Y A;  3L2C A;  3KEQ A;  2IJL A;  1TLH B;  1XCB A;  2QUF A;  3KP5 A;  4AD9 A;  2V79 A;  1OMI A;  2WV0 A;  1KYW A;  3O2P E;  1U2W A;  2LSO A;  2ZKZ A;  3V7C A;  2MH9 A;  3JTG A;  3J80 K;  1RNL A;  3WU1 B;  3MQ0 A;  3E5X A;  3FMS A;  2H94 A;  2JZY A;  3HRU A;  4EM1 A;  5BQT A;  4RGX A;  5LRS A;  2J5O A;  2IP2 A;  3M8E A;  3M7G A;  2ZO4 A;  2EFQ A;  2PBI A;  4IF4 A;  3C3W A;  4HAM A;  4ESJ A;  1ZN2 A;  3J81 Z;  2GXB A;  1YQA A;  4LGW A;  5E1Z B;  1KU7 A;  4LD5 A;  4UV9 A;  3TDU C;  4N0B A;  2KIF A;  5H20 A;  2XAH A;  3SHF A;  1K79 A;  2A3S A;  1HW2 A;  1HBX G;  4PGH A;  1YYV A;  1UHM A;  2L02 A;  1FX7 A;  1ZRD A;  2JSC A;  3J81 K;  3I64 A;  2A69 F;  2BYV E;  5LEK A;  3CLO A;  2G9W A;  4BH9 A;  2FSW A;  1IXS B;  4P5O A;  3I58 A;  4Z2Y A;  5KK1 A;  4LLL A;  1EV7 A;  3ZP5 A;  1JXS A;  1LEA A;  1O7F A;  3BOQ A;  3DQV C;  1LNW A;  5DCM A;  1I27 A;  1ONV A;  3LAP A;  2F5E A;  5AIQ A;  2YU3 A;  1TBX A;  1PUE E;  4Q4Z F;  2PN6 A;  2HTJ A;  1FBS A;  3E5U A;  1LEB A;  1YS6 A;  5LRR A;  2A5Y B;  3R60 A;  3KZZ A;  1KYZ A;  2Y75 A;  2V6C A;  2V9V A;  5L3G A;  4WK8 F;  5FD5 A;  3KE2 A;  4A5M A;  1QNT A;  4FX0 A;  3DF8 A;  4M74 A;  1YLF A;  2HQN A;  4TV7 A;  2YX7 A;  1I5Z A;  3SXY A;  3GFI A;  2FNP A;  2FQ3 A;  4U0W A;  5ILV A;  3TO9 A;  2HQR A;  4PDK A;  3FHZ A;  1JHH A;  2A07 F;  5EEH A;  1T39 A;  1R5G A;  4M6Y A;  4QLC U;  4KMF A;  3QPT A;  3HHH A;  1DP7 P;  4XBF A;  1R36 A;  2EV6 A;  4MNU A;  2MA3 A;  4MQ9 F;  3BP8 A;  3O6B B;  4I0B A;  1E17 A;  5LLQ A;  5DD8 A;  2VC0 A;  1YIO A;  4KA4 A;  3CTA A;  2FML A;  2D45 A;  4EV0 A;  3ZMZ A;  3RPU A;  4EGY A;  2DO7 A;  2E1N A;  2DQR A;  2FEZ A;  2GZW A;  1HQC A;  3ISP A;  4OIN F;  4LB5 A;  4UV8 A;  1ZGJ A;  2RGV A;  2HEO A;  4MTE A;  3AAF A;  5DD4 A;  4ENM A;  2HFH A;  1ZH5 A;  1QBJ A;  1BI3 A;  2ACJ A;  2XAS A;  2M45 A;  3P7N A;  3N4M A;  2CFX A;  1SD7 A;  1U6G A;  2XRN A;  4EMS A;  2L01 A;  1ZRE A;  4I02 A;  1Z6R A;  3GXO A;  2FA5 A;  3HRT A;  3F6O A;  4YFK F;  2DU9 A;  3F21 A;  4DQ2 A;  3T5X A;  4U0V A;  3K2Z A;  3C18 A;  4OIO F;  3TGN A;  1HW1 A;  2CG4 A;  2RKH A;  4KT5 C;  3EUH A;  1E2X A;  4ZYG A;  3L00 A;  2ZBK A;  4HF2 A;  1JGS A;  2Z9O A;  1MZB A;  4Q47 A;  3VOD A;  1ZLJ A;  2NAZ A;  1F4K A;  1REP C;  2LF8 A;  1R23 A;  5JHU A;  2CO5 A;  4IHS A;  3V7R A;  4A6D A;  3DP7 A;  3GX4 X;  1IF1 A;  3BJ6 A;  2W85 A;  2FBK A;  5FB2 A;  4IRH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...