2M4GA

Solution structure of the core domain (11-85) of the murine norovirus vpg protein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
75
structure length
75
Chain Sequence
b'GRPGVFRTRGLTDEEYDEFKKRRESRGGKYSIDDYLADREREEELLERDEEEAIFGDGFGLKATRRSRKAERAKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Murine Norovirus VPg protein
publication title Structures of the Compact Helical Core Domains of Feline Calicivirus and Murine Norovirus VPg Proteins.
pubmed doi rcsb
source organism Murine norovirus 1
molecule tags Viral protein
total genus 17
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2013-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1910 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2m4gA00
2M4GA
chains in the Genus database with same CATH superfamily
2VOOA 1T0FA 4B48A 5LHHA 3R4KA 4EM2A 4U0VA 1F43A 1V5GA 4G8XA 1RRJA 2DMUA 2NYXA 2HVSA 1HSJA 3B02A 2WBMA 1OQYA 2IJLA 3BTLA 1O7LA 3WHCA 2BHZA 1WJ5A 3HOXJ 2DA3A 3A1YA 1V5FA 5DD4A 5E1XA 5CLSA 3WHBA 3CCYA 1SD5A 2VASA 3E5XA 4M3BA 1ZKGA 4I01A 1IO2A 3WTUC 5D6EA 1YYVA 5HDNA 1R23A 1RC9A 1U9NA 4IRHA 2VJ4A 2P5VA 3GF2A 5LHGA 1Z91A 4H4KC 5AONA 4N9IA 1ETKA 3CMYA 4BYYA 4A93J 3GMEA 4IHYA 1XDSA 3HUGA 1GVJA 5HS7A 3NEUA 3I3LA 1ZARA 2ZNYA 2DOEA 3K4CA 2VLAA 4QTRA 2E1NA 3DPTA 4HNUA 1E17A 2Q2EB 2MC3A 5EZHA 2R7VA 1B4AA 3MZ8A 4A2UA 4E7ZA 1VI0A 3H1CA 1FYKA 1UAAA 2VJ5A 1MBJA 2DMTA 2UWMA 3EUHC 4CCMA 2DPUA 2X6WA 2BW3A 1XC5A 2KHMA 3FHZA 4GRIA 3ROUA 4CCOA 1CF7B 3FM5A 2ISZA 2QEXI 1G3WA 1N78A 1OCTC 3QYBA 1D8JA 3SYTA 1OISA 3BT9A 3CMEI 3JSOA 2QQBA 1HW1A 2EFQA 5DYMA 3KX2A 4JYKA 1BN5A 5D4SA 4ETSA 2NNNA 3VPRA 2IGKA 3LSKA 4N0BA 2UV1A 3K9TA 1I3QJ 2W48A 3F0CA 4PDKA 4XSXF 1D1BA 5K7HA 4KT6A 2EK5A 1UG0A 1QZEA 4A3KJ 1LDDA 1J59A 1HW5A 1QGPA 4IO9F 2VOPA 3T0YA 2KJCA 2ME6A 1REPC 2GZWA 4LGWA 2G9WA 1X1BA 2DW4A 3GZ6A 4ITVA 2DLLA 3HEFA 3RZOJ 3DKYA 2CV2A 1JHFA 2KQRA 4IHSA 4QSHA 1A04A 1FT9A 5CQEA 1YITI 4XMYA 1GDTA 4BJTA 1R58A 1Y6IA 3L09A 4Q48A 4YIFA 4DYRA 4F55A 2M45A 2K9SA 3E6CC 2EV5A 1J5YA 2JWTA 5E8IA 2FBKA 2W25A 4XR6A 2A61A 2HVQA 2ZXHA 2KKOA 3FXUA 3P9CA 2ELJA 5E3LA 1BIAA 2DFFA 2Y9YA 4AIDA 4OU0A 1OFCX 4AM3A 2RGVA 1E3HA 1UJ8A 4JOMA 2DTRA 1U6GA 5FLXZ 2GBYA 3AG3H 3C1DA 4W97A 1MMNA 5KCMA 4EJTA 2M3AA 4LD5A 4YRVA 2O61A 3EDPA 1W5SA 2YSRA 4ZZDA 5TRDA 1K7AA 5GPCA 4JQFA 1BL0A 2HS5A 2QUFA 2A07F 3RCOA 1BOAA 1AA7A 4LIUA 1UHWA 4LG3A 2BEOA 5C3EJ 3S14J 5FFZA 2XC7A 4B4CA 3L2VA 1LVKA 2LKPA 3GX4X 3O2PE 1G3TA 2CQNA 2R7DA 2A6HF 3EUHA 2RV8A 3E0JB 3HHGA 2RNJA 1BW6A 2L0KA 3IUOA 3X2QH 1ZAOA 3W2AA 5K7ZA 1LUJB 1U8BA 5IP9J 2HWVA 2EA2A 5HLTA 2W00A 1R7JA 2OAZA 4KMUX 4LK0F 4PFOA 3J80K 3GTLJ 3WE3A 4MQVA 4Y15A 5GAGJ 5JLWA 2LBFB 3V8LA 2CUZA 2FX0A 1E0EA 3TL4X 1VZ0A 4A12A 1HW2A 2DJNA 5ICGA 2EIKH 4RDUA 3R61A 5FROA 5EGOA 1WJFA 1BC8C 1I6HJ 3FMRA 4YG2F 1S29A 2HYGD 2NOGA 3V8KA 2E1OA 3FDYA 4BJ6C 1T33A 5L3GA 1K61A 2Y0SA 2BHYA 2F2EA 4KITB 2KJBA 1JKRC 2K02A 3BPXA 2KT0A 1BI0A 3H5RA 2A68F 4RAYA 3F8NA 3RKWA 3DTIA 4CZCA 2UXXA 2XHKA 4UV9A 1VQNI 5IP7J 2F4OB 4I0AA 1HOMA 4NHJA 2K5CA 3CDLA 3HM5A 1XSDA 2BXZA 4FE7A 1V3FA 3ZQHA 4IRIA 1BI1A 2ZXJA 3CCSI 2BE5F 1Q1VA 4ENJA 3PQJA 2R7OA 2LRDA 3HXLA 4E7SA 3BTCA 5IYCJ 2KP6A 1PUEE 5C4JJ 1TC3C 2QCOA 2ZMEB 3BROA 5FKKA 4Y52J 2ZFWA 2ZCWA 3ZR8X 3JSPA 1POGA 3GLXA 3OYLA 2JRTA 2KZVA 4RM2A 1STZA 2EH3A 3TQNA 5M3MJ 4V2GA 4C2TA 5GTIC 4ZYEA 4WF2A 3JRBA 3K10A 2XGDA 3K7AJ 1MJAA 2BBYA 1LJ9A 3KPHA 4RAZA 4KA4A 1ZG3A 3WU2C 2AQFA 2VODA 2P81A 4UB8C 2DYRH 3Q0UA 5C4XJ 3HRSA 2VKDA 5ICCA 4DZJA 1ZG5A 5F64A 4FQGA 3JRAA 4EQQA 2Q2EA 2P8TA 1BJAA 4ENNA 1FOXA 3ABMH 2D2WA 1H0MA 1UG2A 2K4JA 2KPMA 4Z6YA 5JR3A 4OIPF 3PO2J 2VT2A 1FWZA 4I99C 4Y4RA 2VE9A 2MW8A 1SFUA 3LOCA 2QQAA 4BKXA 2Q0OA 2G7UA 1HSTA 2WAQA 3HKZA 5LHIA 3L2QA 2A6TA 2RC4A 3S3MA 2DK5A 2PFBA 2VQGA 1G6NA 3OIQA 1X2NA 1CF7A 5J4YA 4JP0A 1O4XA 1XTAA 3M1CA 1FIAA 3LAPA 5KAFC 5FD5A 1NK2P 3QP5A 2ISYA 2AO9A 1YO5C 3KZZA 3DLAA 3MKWB 1NG6A 4KIGA 4D7NA 2V9VA 1F4KA 3PM1A 4U88A 5M5WJ 2D45A 2XGEA 3IV5A 2CFOA 3JW4A 4HLYA 2BZTA 3RKXA 3TO9A 2H8WA 1LFUP 1J75A 3GTOJ 2XAUA 3B73A 4KMFA 4KJZA 3ZMTA 5BMZA 1MDMB 2NRAC 1SAUA 4HV6A 3PIOF 2HDCA 2VQCA 3HRTA 1TQPA 2IGNA 2V1XA 3QYFA 1ZQ3P 2B7EA 4IOAF 2EV6A 3CP2A 1KU2A 3OYEA 1EH8A 2WB1A 3BTJA 4XRMA 4DBQA 4OIOF 3ZMDA 2VPLA 3SQNA 3K1NA 3OV8A 4OOIA 5C44J 1JE8A 1HCRA 3AKZA 2Z1DA 3HDDA 2L2OA 3ZQQA 3CCVI 1ETYA 2R5ZB 5HDGA 1ZGWA 3TKYA 2R7SA 4PSWA 5HS8A 3OSGA 4AIHA 1T56A 1OPCA 2W4SA 1WRJA 1XGNA 4HNVA 3Q3SA 5D5XB 5HNHA 2PN6A 1FX7A 2ZMEC 4BXXJ 3SZGA 2CFXA 3OYHA 1QU3A 2XAQA 2H1KA 2WAQN 3HKZN 4L9VA 1W36D 4X1EA 3FIWA 1MJBA 4L0ZB 2JPCA 2ECCA 2H94A 4XRSA 2F5EA 3OYKA 2JTVA 3BY6A 4M72A 2DFHA 5J8FA 1H9GA 5E8GA 2X85A 2VBZA 3LSIA 3V42A 4MFDA 3HHHA 3K4MA 2XSDC 1AKHB 2AHQA 1V4RA 1Y0UA 4IRGA 2ZJQF 4A3MJ 4UY8I 2VI6A 1BI3A 3GCMA 1GV5A 2LFBA 4RA2A 2HQRA 4HPQA 4L5JA 3E5QA 3U9GA 1K79A 4MNUA 4B1RA 1IXSB 3ASNH 4R1HA 3AG1H 3ZP5A 4IPAA 4F52A 1R71A 1IXCA 1K6YA 3CZ6A 1QA6A 3WE2A 1PUFB 1QO0D 1T95A 2BOLA 1LB2A 2K3PA 1QPMA 2L02A 4KUMA 3EETA 4XL9A 1A36A 4LLNA 1A5JA 3JRFA 4G6TB 3TOBA 4CYCB 4NDLA 2IGMA 5CVUA 3HOYJ 4UUSB 2WB1N 1YOVB 4N4NB 4ZH4F 3LL7A 3DEWA 3COAC 3OYIA 3ZXSA 2QA4I 3W6VA 3L2RA 2CV0A 2B9SA 2LR8A 3U1DA 1FC3A 1U2WA 2LBFA 2KRCA 3JR9A 1Z0XA 1FSEA 4RM3A 4QLCU 3CQZJ 2HDDA 2E7XA 3JRDA 4XN3A 2FD5A 1XS9A 1JI8A 1B72B 5IYDJ 5KHDA 2X6XA 2CMPA 3FKIJ 1QQIA 2MABA 2MBFA 3TP3A 3GYHX 2X48A 4IOCF 2ZO4A 3IC7A 1B9NA 2LG4A 1MBEA 4XKBA 2X1CA 3NARA 4ZYHA 2NAZA 3CJNA 4NC7A 4U7DA 2XVCA 1WH5A 1OMIA 3E7LA 4EMSA 4MEXF 4M74A 3SJMA 1FOKA 4BNCA 4BACA 3KP7A 2MH9A 2DA2A 2LF7A 3BWGA 4BQOA 3OS2A 3FK7A 5IPAA 2DU9A 3DPUA 1LEAA 4JK1X 3ZQGA 3F21A 2HOAA 1WVRA 4FETA 2JUGA 3DKXA 2YR2A 3BR5A 4MTEA 4BHCA 4YIRX 4BEHB 2VC0A 4E7JA 4B8XA 1A35A 1NG7A 2R7XA 3LQQA 1IG7A 2H27A 1B9MA 2L54A 4HLXA 3LSJA 1AHDP 1FNNA 2MH2A 2PLYA 4A3FJ 3HGGA 4GYIA 2FQ4A 4MO7A 4M6XA 2LSOA 2J5PA 3H5AA 1ZR4A 1FPQA 5L3DA 1OYWA 4B44A 3OYJA 2NXNB 1R36A 3S3NA 1RUNA 3MAJA 3S1NJ 4NC6A 4XOTA 4PK4A 2UZKA 2CGPA 4AVZA 2F5VA 3QOPA 4S0HB 5EF6A 3MMYB 4XKVA 3TO7A 3TMOA 5LLQA 3CCQI 4UHTA 4BGDA 2QKLB 4O3MA 4QPQA 2PI0A 2VKVA 4ZYAA 3TW6A 4OMZA 2DTZA 2L7FP 1SFXA 5LRRA 1O7FA 3RKYA 3N05A 3SZPA 1U9OA 2Y75A 2XPVA 1W36C 4PSXA 2QQ9A 1MJ9A 2QWWA 5A2QZ 3LMMA 1ETQA 2PG4A 1E3PA 4F7ZA 2JMWA 4KIFA 4Z2YA 1MIJA 2HPMA 4M6YA 5CVJA 4AU7A 4XLEA 4RGXA 4PJ0C 5J1UA 4A6DA 4ZTFA 1DGWY 4XOPA 2DT7B 1MDMA 2CW0F 3HOSA 4RB3C 1RIOH 2EZKA 2RQQA 1BR1A 1XN7A 2Y30A 1IRGA 2QKMB 2OF7A 4BH9A 2DN0A 1JTXA 1OKRA 2FU4A 2HR3A 1SVLA 4BAYA 1YE9A 3E6MA 2XB5A 5IT3A 4XLCA 3RYRA 2V9KA 2R7WA 5D5UB 5CQGA 5FRNA 5HLGA 1S7OA 3BR6A 2I10A 1WKMA 1K6OA 2DMQA 3BG6A 3G1LA 4BY7J 3ZMZA 5J1RA 2V1UA 2XUBA 2OV7A 4P1WA 1R9TJ 2R5ZA 2L5QA 9ANTA 2IA2A 1KQ0A 2BVMA 2RKHA 2M8EA 3GFMA 3NRVA 1XCVA 5HOOA 3MN2A 4HNTA 2F5DA 1CQTA 2JQ7A 3E3VA 3FXMA 3JTHA 5HNFA 3CMAI 3RQIA 2I5UA 4LIVA 1G2HA 1X1AA 1VQMI 1JJ6C 1HXDA 1R1UA 4HZFA 1LE8B 3ZMSA 2IS2A 2CUJA 1ON2A 4EGZA 4A3BJ 3KP3A 3KP5A 2Z99A 1D0XA 3U1KA 3G6EI 1IF1A 2LTPA 4DYCA 2R7FA 3V7CA 5HVQC 2M1BA 5F0HA 1YX3A 4CDGA 4DYQA 3RPUD 2DAOA 1X1PA 2PMHA 2RVCA 4W1UA 5DUKA 5LBQA 1RR8C 1AKHA 3HTSB 2FRHA 5L3BA 1TLHB 2FUG2 2HQ5A 3B6CA 3EQLF 3L9FA 3NWSA 2A3SA 2GWRA 4A69C 3O3KA 1MNEA 3ECOA 2VPRA 3K4NA 3ZN0A 2KMUA 4KICA 2LOOA 4A3CJ 2LVSA 1PUFA 1NHAA 3ZQLA 1U0JA 4BHBA 2O7OA 4II2A 4IKFA 5EZGA 1HF0A 1I1SA 2X9DA 3H9JA 2E19A 4UUSA 4ZJZA 3Q0WA 2ELKA 2DFEA 2DQRA 5FFXA 3PJRA 3O8GA 1RETA 4IJAA 1PYVA 3C3WA 2VQLA 3FISA 2FJ1A 3DQVC 3KYDB 4P9UA 4S05A 2C6YA 5KAIC 3BZCA 4C3IJ 4HX4A 5EG0B 5D8KB 3WU1B 3D5LA 2R7ZJ 2HEOA 1XSXA 1BIBA 1IUFA 2K9NA 3KEOA 4RLQA 3LWFA 1Y0NA 2UUZA 2DDAA 1EF4A 2OBPA 3GEZA 2X1DA 3M07A 4DQ2A 1NK3P 4CXFA 3GTKJ 5ICEA 2VN2A 2VT3A 1B72A 2L7KA 2F5FA 3F8BA 3QYEA 2WWYA 3GVAA 3S32A 2GIVA 4D5CA 3G4SI 1K83J 3GTQJ 3IKTA 3OOUA 2O8KA 3BG9A 3BR0A 3VYRB 4BDYA 2VBWA 4OINF 1ZELA 4HSTA 4EATA 3NWTA 2RN7A 5E3NA 2CG4A 2GXGA 2P4WA 3IKVA 2R7TA 2L4MA 3LSPA 3J80Z 4G6QA 1FOWA 2XF7A 2W85A 2L3DA 3OY9A 3ZMVA 2M5WA 5A2QK 2CO5A 4DOZA 3FF5A 1XGSA 1PVEA 3VODA 2JA6J 5F0CA 5M5XJ 5JI6A 4BEHA 3DKWA 4LG0B 1XSVA 4CCKA 1LPQA 1B1BA 5GPAA 1BI2A 2WAEA 4V2FA 3K1MA 1Y56A 3K69A 4PGHA 3IP4B 2JJ7A 1SFEA 2Y0MA 3DEUA 4E4HA 2XPWA 4HX7A 3WTSC 1MGTA 2DI3A 2FEZA 2QSFX 2A6EF 3E1SA 2JSCA 4GGGA 4A0YA 5HLIA 1YIOA 4D7MA 1G3YA 1SAXA 1MD0A 2V1DA 3LFKA 4M6VA 3ABLH 3GFLA 1SVMA 2G0EA 1PP7U 1BC7C 3DFGA 2M0CA 1R1TA 1QRYA 4CO8A 2ZJPF 2QYOA 2HZDA 3RSNA 5LEKA 1KONA 3FX3A 1O3QA 2VBXA 1FY7A 3IL2A 1ETVA 2E5ZA 3I64A 3OIPA 1NH3A 1FBQA 4N9HA 2ZSIB 1YLFA 1Z3XA 2DDBA 4CGZA 4EJOA 3HOVJ 2ZJ2A 4D9JA 3S1RJ 3WGIA 4CCNA 4DZPA 3I0TA 3S8PA 3Q0VA 3KP4A 4A5NA 5K1YA 1IZ1A 5FLVA 3F22A 1XD7A 3PFYA 4HEA2 5CVIA 1WI9A 2ESNA 1V5EA 2P6SA 3DLLF 1BA5A 3JCUC 3H0GJ 4XLHA 1DDNA 4P9FA 3D1NI 1QVUA 3LSRA 3JAMZ 3IRQA 1D1AA 2PEXA 1U3EM 4HW0A 3PFIA 2FNPA 3OYCA 2W7NA 1U5TB 4RS8A 1YJ9I 1GHCA 3ABTA 2K40A 2ZXWH 4MQ9F 3CCJI 2GOMA 2VJIA 2DODA 3ELKA 1HKQA 3RQ4A 3DV8A 3BG7A 3O8HA 5K5OA 4PFPA 5GP9A 4NUBA 2BY2A 5DM6F 3OYMA 1Z1DA 2DMPA 4DIQA 2GLOA 2DK8A 3GTGJ 2BY0A 4L9TA 1LE8A 1IN5A 4HSRA 1ZLJA 2MD5A 4A3IJ 4XRSG 1TWCJ 1V55H 2EIMH 3QWLA 3PUBA 4OIQF 2X0LA 1OCOH 2R92J 1LVAA 5E3OA 2Z33A 3KE2A 5LGNA 3FXKA 1IV8A 3ML6A 4I6ZA 2IRFG 2EFPA 3E5UA 2VJJA 1APLC 1TT0A 3AG2H 2IA0A 2JN6A 1GT0C 4P55A 2F6CA 1FBUA 2K86A 5J40A 1VQOI 1FOYA 1K78B 4IEJA 3I58A 1ERDA 2KRFA 2JVGA 2IBDA 1R00A 2JA7J 2EFOA 3CC4I 2CW8A 5IP6A 2RQPA 3S2DJ 2GA1A 3P7NA 1EA3A 2OD5A 1AU7A 3SXYA 3AL0C 1KA8A 4OAYA 4G7OF 2I8DA 2CSOA 5J6XA 3SZTA 1BOBA 2QSGX 4UVAA 3QU6A 2IS6A 3MEXA 2XV4S 1ETOA 3VYUB 1MH3A 5HODA 5EG0A 4AC0A 3L1PA 3H9QA 3RPUA 1EJ9A 3WGHA 2WV1A 4A0XA 4OIRF 3S93A 1U8RA 1CGPA 2G7HA 2LY2A 3WTZA 4A5MA 3KLOA 1Y39A 1ETXA 1ODDA 5FD6A 3FKJA 4OWRB 2CQXA 2XF5A 3CD6I 3LAJA 3MQ0A 3V7RA 2IW5A 4DGWB 3KP2A 2GA2A 2LKSA 4O5VA 4M9ZA 1JT0A 3F8MA 4ESJA 4U7BA 4C3HJ 1U5TC 2PMZN 5B1BH 5E3MA 3I54A 5K5QA 3ERED 4ZDPA 3CCUI 1TP4A 1FTZA 1IN4A 1YW9A 1SC7A 4J00A 3MCZA 3KEQA 1WQ2A 4DW6A 3A01B 1D0ZA 5LRSA 4IHTA 4GCVA 2E71A 1H88C 2DXIA 1QZZA 1RZ4A 2QF7A 4LG0A 1DP3A 3RZDJ 3NQOA 1DPUA 3F6VA 2VL8A 3BR2A 1XG1A 1X1DA 3A2KA 1XGMA 2VXZA 2E36A 3G71I 2EZIA 3CLOA 2H8RA 3J7AO 3CDIA 1HBXG 2STTA 4EM1A 1WWXA 4I02A 1F36A 4BU2A 1IN7A 4MEYF 1IXRC 4RB0A 3JAMK 1BR4A 1X4OA 1Z77A 3OS0A 3A02A 2O9LA 3JRCA 2VUMJ 1HKSA 4HG2A 2CYYA 3M1EA 3HC7A 4UUVA 2YX7A 2L01A 2ZFUA 1A6IA 4EV0A 5ERIA 3CF2A 1WFXA 2MA3A 2H6CA 2KISA 3ESWB 1FMWA 2L4AA 3Q9SA 4C2UA 3V4GA 5DUIA 2EFWA 4FASD 2K9LA 3FXLA 3E6DA 1MH4A 4C9YA 4XSZF 2O03A 3PNVA 5EYRA 1IN6A 4E7LA 4L5IA 3OL3A 1T38A 3DEEA 5L3EA 4G7ZF 1XMAA 1S9HA 3HSRA 3LQRA 3CJRB 3MKZA 2E35A 2DMNA 5TISC 2A69F 3CCEI 1YQAA 2JZYA 3FMSA 1L0OC 4Y13A 3A03A 1R4NB 2ECBA 1KQ9A 3WU0A 1X19A 5DD8A 2E34A 2Z5UA 3VB2A 2K9QA 2K85A 3HTUA 5D5WB 3HYIA 1H89C 4G94A 2ELHA 2R7RA 1ONVA 3C2GA 5JHFA 4CCJA 2DPDA 3F8FA 5CJ9A 4ON0A 1R1VA 4DJAA 1Z67A 3EPZA 1R22A 1U5TA 2AXTC 3HIFA 1FIPA 1G3SA 2BY1A 1M1EB 2ESHA 2W84A 3CC7I 1LDKB 2VKEA 4KFCA 1WI3A 2A5YB 1ORKA 1SFKA 2KIUA 2FNAA 3RYPA 2EZHA 3ZOBA 3T5XA 2DA5A 1SD4A 1WGXA 2P6TA 4RB2C 3Q9VA 1RUOA 1JXSA 3W3CA 4JX4A 3LA7A 2VXDA 3WG7H 2LDUA 4U0YA 2KIMA 2Y31A 4DBRA 3GXOA 2YUSA 3J7ZI 1ZTRA 2DYSH 4IZZA 2D1VA 3K2ZA 1TW3A 3GWZA 3KCCA 1SD7A 3JRHA 1S72I 2HPIA 2MGQA 2TCTA 4HRIA 1MBFA 2R7UA 4JX6A 4BE1A 2E60A 1BBYA 3LA3A 2XGXA 5FKMA 1OLTA 3L2CA 3CCMI 5J3LA 2ID3A 1HDPA 1VTNC 1MZBA 1I27A 3F8CA 4BE0A 1K78A 4HDUA 4FCYA 4S04A 4BXUA 5H6QA 1BR2A 2L9NA 2AS5F 2D5VA 2B63J 3VSLA 3IH3A 1VQ9I 1IRZA 2NS8A 1P92A 4B43A 5M5YJ 3JRGA 4ENKA 4M73A 2GIZA 5IOYA 3F3XA 3DBLB 3H3ZA 4M3DA 3I71A 2HOTA 2P7VB 2GQQA 4ESBA 4RMNA 5B1AH 2KRHA 1S8NA 3ZMUA 2LYCA 5F1JA 1P4AA 3CUQB 1XCBA 1MMSA 3UKGA 3KEYA 3VYTB 3SEQA 4BQAA 2M4KA 3BTIA 1FP1D 2O0YA 4PJJA 2E1CA 3OL4A 1DPRA 1I3AA 1P4WA 2XKPA 1MW7A 3I9V2 1Y1WJ 2YU3A 2OTJI 1JUPA 2PBIA 4WXCA 2MFZA 4LLLA 4A6EA 2IS4A 4JBAA 1K4SA 2ZMEA 5H6RA 2DT5A 1P6RA 5K7FA 3RIRA 3VEPA 1X3WB 3HSFA 4PJNA 2ZKZA 1KU7A 3BLYA 1QZYA 2HOSA 2HU9A 1YJWI 1YG2A 5ILSA 3QODA 1YFHA 5E1ZB 2O5RA 1P7IA 3UNGC 1J9IA 3TDZC 3A01A 5E79C 4YFNF 3HBLA 2LC2A 4AIKA 2V6CA 2VQHA 2MSYA 4Q4ZF 1EKEA 3R6SA 3BR1A 1KZHA 2V9PA 2DOFA 4HDVA 4N4OB 5CYVA 2DA1A 3TGNA 2FSWA 2MC4A 4LLGF 5IYBJ 5CVRA 2QQ8A 3M9AA 3JREA 2X1EA 1WPKA 1IRXA 3VFZA 5DCFA 4BDZA 1WH7A 5FKOA 3FBNB 4HA8A 4FX4A 1OCPA 4X6AJ 2OZUA 4C30A 2CV1A 2WY8Q 3K4LA 2FXAA 3OYAA 2KIFA 1QPIA 3DTKA 3DBHB 3VSKA 1MKMA 1G8XA 4XLAA 2HQNA 2V6EA 2DQLA 2EZLA 3K4KA 3J7AY 2XAGA 2IAIA 4MLOA 3CCRI 4F3QA 5FKNA 1FSHA 3TOAA 3GFJA 2HTJA 3T1BA 2ZJRF 1YJNI 1W0UA 1ZREA 4EJWA 4AYBN 4HV5A 3HRMA 2B0LA 2JSPA 2FMYA 2KLOA 1ZK8A 4M9XA 3JTGA 5ILUA 3S16J 3BOQA 3J7YJ 3DBRB 1DUXC 2GM4A 2DFIA 3H36A 2NVXJ 1QNTA 2MG4A 3E97A 3H3UA 3REOA 3CUQC 3OYDA 5FJ8J 1DU0A 4FE4A 2R93J 1R49A 3H35A 2Y9ZA 5EEAA 4LB6B 5D5VB 2WY7Q 1I39A 3S2HJ 3QQAA 1Z7UA 2CWEA 4KNYA 4BL0B 1E2XA 2BV6A 4B3XA 3P5JA 1ZG1A 1GLNA 2VE8A 4NQWB 2GAUA 3AAFA 2KIQA 4GFBA 2E1MB 3EUAA 4IHWA 3L00A 3LFUA 4L9NA 3I55I 3LNQA 2OU2A 1WJCA 5AIQA 2CS3A 1KYZA 5HDKA 3HGYA 4CHUA 4ZDLA 2GOXB 2L7ZA 3QU3A 1X2MA 1Z6RA 4HBLA 3BQYA 5TJJA 4QIWN 1WSUA 3TDUC 4PGGA 3K4BA 1DQUA 2LP0A 2BVLA 3MKLA 1TNSA 1RPWA 3K70D 5DS9A 4ZDOA 1ZH5A 2K9MA 3WTTC 1HC8A 4F91B 4A3EJ 2YS9A 4FHTA 1JHHA 3J81K 1S6LA 2OTLI 2JPBA 1IAWA 2FBIA 1KGSA 2EB7A 2A05A 4AD9A 3N97A 4E70A 1DP7P 3A4CA 1ZN2A 4BY1J 1AOYA 2LLKA 1YS6A 2M7AA 3QPHA 1Z9CA 4A0ZA 5B66C 3WTYC 2LD5A 2FE3A 2IT0A 5B3SH 1MNMC 1TL8A 2ID6A 2JK3A 3SHFA 1EH7A 2TDXA 3WODF 4CYCA 3CCLI 4UXNA 4WWCA 5H20A 2CW7A 3PQKA 3AFHA 3QAHA 1TWHJ 4HQEA 2ME0A 1A31A 2ZB9A 3VWBA 4YIIA 1S7EA 2CUEA 1P2FA 4GDFA 3RDIA 1T2KA 2HKXA 1RKWA 4LK1F 1YRNB 4AUXA 3F6OA 3F9KA 2LMDA 4WXHA 3O6BB 1XB4A 4UNOA 1HA8A 2E5NA 2H1LA 4BBSJ 1D5YA 2PX9A 3HOTA 1TWGJ 1U78A 4AWXB 2BXYA 2V7FA 2WC2A 1W5TA 3MKYB 3D0SA 3CUQA 1WHUA 3JRIA 1N25A 4LOCA 2WTEA 4BJ5C 5DM7F 2IVMA 2V1NA 5GADJ 2D1HA 3M3YJ 1I5ZA 4E7IA 5LD2C 2RNGA 3FXJA 2XAJA 4I76A 4D5FA 2XROA 1XDUA 1W5CC 3ZQIA 3K6GA 3I59B 3P9IA 2E1MC 2KZGA 4KT5C 1MSFC 4AIJA 3RTRA 2BY3A 3CJQB 4BE2A 2MLKA 2O3FA 2VONA 5LEJA 2GXBA 3QPSA 1MMAA 5JVGF 3GLLA 4XONA 1FZPB 3L2WA 3FHNA 4EJVA 4RGUA 1KYWA 3WTVC 3PIPF 2WA0A 1FEXA 3HZJA 4ABZA 3AG4H 2PQ8A 5J8CA 2EBIA 3ISPA 4NNJA 3MZHA 3UR3C 2NVYJ 4HOBA 2OA4A 4BBRJ 3OR2C 4IVNA 4FT8A 5CKTA 1T39A 3TBIA 4XORA 2FA5A 4OAZA 1FYMA 3PNYA 1IW7F 5E20A 4A3JJ 3W2WA 2K27A 3FXOA 1ZRFA 4MFEA 3ZQ7A 2HDWA 4Y7NJ 2OQRA 1Y8RB 2RDPA 2M87A 2EFNA 1YTYA 4CYDA 1C0WA 1R5ID 4YFXF 3SEZA 4Y17A 3AL0B 4HYEA 1TWFJ 5K5RA 3KETA 1B6AA 1B59A 2M7BA 4IHVA 1BM9A 2LF8A 4M3EA 2XAFA 4FTHA 1LKXA 2ADUA 1L3LA 4F93B 2JVHA 4G7HF 3DPLC 5BPIA 3EUKL 5EDNA 1UZCA 3K70C 5E17F 3PSFA 3BCBA 4CZZA 2DA6A 2P5LC 2P0WA 2DO7A 3HG9A 5JVTA 2Z2SB 5L3CA 4OMYA 1Y1VJ 4A3DJ 3FXQA 4C3JJ 2DT6A 3CO6C 1TNTA 4RLFA 3HPHA 4HF2A 2LY9A 4IQJA 4EJUA 1XX5A 4KDPA 4PCQA 3T8RA 2LNBA 2EJRA 3CF5F 1ZGJA 3PO3J 3S17J 2M34A 2CQ7A 1J7KA 5ICFA 1WCMJ 1OYIA 1Z6TA 4IQ4A 3GTPJ 3GTJJ 2MYSA 2XIGA 1Z21A 4NQWA 2OC6A 1O3TA 4WX9A 5E1WA 4I09A 3IWZA 2K7LA 2DOAA 1TTYA 3FXRA 2PJRB 2YPRA 1RI7A 1XMKA 3ERMA 1UHMA 1TW2A 3GZ5A 2L9VA 3H5NA 5J47A 1EH6A 3WG9A 1ENHA 1WJEA 3KIOA 5BS6A 2HI3A 5IT9Z 2EWNA 1IGNA 1TBXA 2HOEA 3IH4A 2JA2A 5J1YA 3OS1A 1VFCA 2PMZA 2OPTA 1AWCA 1MMGA 1FBSA 4XKCA 1BW5A 4ANJA 2NVQJ 4PJMA 1X3UA 1OCZH 3A0HC 1T08B 1JJ8C 4NC8A 4G12A 3WTXC 1SANA 1J2XA 3ABUA 3BZ6A 3DTEA 2F4IA 1ETWA 1USSA 4E6KG 3QPLA 5E18F 1Q1HA 1D8KA 2DA7A 4R8HA 1X4PA 3GZNB 1QHGA 3H3VK 2E2IJ 3Q5FA 1PP8F 1O57A 1Z3YA 3M7GA 5BNGA 1JGSA 1YX5A 3R0JA 1N75A 2A5WA 2QSHX 3FM3A 3BJAA 1LFPA 4CUGA 2HTSA 5F1RA 3IHUA 2YU9J 3TP0A 1FJLA 1QBJA 1R5HA 4KN7X 1P4XA 4A3GJ 4E7HA 1GXPA 1B8IB 2R5YB 2YX4A 4LJZF 2EA4A 1IC8A 5F27A 2QBYB 2M8GX 3RJPA 1YRNA 1BJZA 3C18A 4ZC3A 4CH7A 1F5TA 3IAS2 1VQ8I 2ACJA 4EM0B 1UMQA 1HLVA 1XPXA 1V54H 2XF6A 3W2VA 4XIDA 3PSIA 2EILH 4XM3A 5F08A 2JA5J 1WZ2A 4AVPA 3C7JA 4XQFA 2O6GE 2R7QA 4HQMA 3KYCB 3VYSB 5DCMB 2COBA 4C2MJ 5GAHJ 2VBYA 3H9GA 2HVRA 1TQMA 3OMYA 2P7CB 5KK1A 5KNLA 4KIBA 1MBHA 4RBOA 1LFBA 2QENA 3BCAA 2FOWA 3V8JA 4CA0A 4V19K 3DU6A 2WADA 1TWAJ 3I59A 2ZBKA 3GFIA 1UHSA 4EGYA 3HL2A 1HDDC 2NOJB 4XLNF 3G3ZA 3DWLE 3SDGA 3GTMJ 2UXNA 2Y2ZA 5JLXA 2BYVE 2NVUB 3L7WA 2EPFA 2HGCA 5D4RA 2HYJA 4XLFA 1VQLI 1JT6A 1T6SA 3H0DA 3IAM2 3BDDA 1W7PD 1J09A 4ZYGA 4HF0A 2CRGA 3RKQA 4XK4A 5FGMA 2R0QC 3QRFF 3M8EA 4XBFA 4U0WA 1JUMA 1TQIA 3KP6A 2LREA 1H9TA 2XKOA 4BUPA 1X3ZB 4ZYDA 2OQGA 3DP7A 4I98B 1ZRCA 4XICA 2W82A 1QHHD 2MLGA 2F4MB 2NS7A 3OYBA 4KISA 3HB9A 3S15J 2VB6A 2FF4A 1I1GA 2V79A 3ZQFA 2CU7A 2HXOA 4DNCA 3HJEA 3I4PA 5DDGA 1YI2I 3PUFA 4IXAA 3I4NJ 2Y0SN 1JUSA 5DTDA 4BQQA 5D8LB 2KDZA 5F6FA 4QPOA 4IHXA 1VQKI 1KU3A 2XGCA 4D1QA 1JKQC 2EIJH 3I4MJ 4CSWA 2LKXA 1IDZA 1W7PB 4YFKF 2Z16A 2NNYA 5FLXK 2R4GA 4HAMA 2X6OA 3GO5A 3ZN1A 2VIXA 1VQ4I 2STWA 5IT9K 3QP6A 2IXSA 3ONQA 2ETHA 5LGUA 1HKTA 2N8GA 3DF8A 3KZIC 2DA4A 2TRTA 4WCGA 1UCRA 3FK6A 2HKOA 4IX7A 1ZYRF 2VC1A 4U87A 1J0RA 4G9YA 1YIJI 1MSEC 4PJLA 2KL4A 3HSEA 2CUFA 2HNHA 3LSHA 2L7MP 3MFKA 3S3OA 4Q47A 3M4OJ 2X4HA 4BXFA 2PMUA 3G2BA 1W0TA 2LY1A 3MZYA 5BQTA 4TV7A 4WXDA 4CICA 4II3A 2AQEA 2IGOA 2R3SA 1W1WE 1JKPC 2ZC2A 2F48A 1WJDA 3BJ6A 3HOWJ 1MNDA 3B6AA 3R60A 2PJRA 3IH2A 1YW7A 1Z05A 1H8AC 3K0LA 1LEBA 4UVCA 5CVVA 5L3FA 4H0EA 4P5OA 1IJWC 4X0GA 3M8FA 1ON1A 1TT5B 1ULYA 2WAFA 1W4MA 4R79A 1LNWA 4IL6C 2KFDA 2IPQX 3ABKH 3TEDA 5F04A 1GV2A 2M2EA 3EYYA 3HOZJ 1DGRM 1Y8QB 4MHGA 1D1CA 4M3FA 3DU5A 5BOXA 1FYLA 2PJPA 3FMQA 3GBGA 4NBQA 3CLQA 3T8TA 2L9SA 1FLIA 2XAHA 1SMYF 4KN4X 3VDXA 2E7WA 3CUOA 3MD2A 3OSFA 4HF1A 1OCCH 5FLMJ 3SDBA 1IV6A 2FOKA 3ECHA 2OJED 5GAEJ 2OUMA 3KFWX 3KYLA 3OYFA 2EQRA 1FMVA 2HFHA 1XMXA 3FBIB 3BQZA 1KQ8A 2CQQA 3CJTB 4RAFA 1MBKA 3VOEA 4G6DA 1YHQI 4ENMA 3HPGA 4MGRA 3SFIA 1T8IA 1D5VA 2FQ3A 2QM3A 1RESA 3J81Z 3IRRA 1B8IA 4XRFA 2O8XA 5EJCA 2R5YA 2QVOA 2JT1A 3LSTA 5FB2A 2RAEA 3FWEA 5DEQA 4RGRA 4BS9A 2QBYA 5B5EC 3M8JA 2WV0A 3BPVA 1P9QC 1IRFA 2KDOA 2XPUA 5AIPA 4J19A 1EV7A 2DCEA 3GUDA 1YW8A 3BG3A 2ZNZA 5H2FC 1JGGA 4F92B 1SMTA 4AYBA 1NTCA 1VF9A 5F0FA 3EYIA 4HX8A 2M30A 1ITYA 3WGGA 2CH0A 3IWFA 3BG5A 3OOPA 4WK8F 2H09A 1OCRH 4UV8A 1IN8A 1ZGAA 1S7AA 3ZRGA 3LSMA 4PZJA 5DCMA 2EINH 1TZLA 4I7HA 4LITA 4KYWA 3CDHA 3FZVA 3HRUA 2H6BA 2HZTA 3CO7C 3G1MA 3CTAA 5DV5A 4NB5A 5HS9A 3HUGB 3RPQA 2X6YA 1OYYA 1SVOA 5EEGA 4BHPA 1LDJA 5M3FJ 1N77A 1WJAA 5FRMA 1S3JA 2FMLA 3CMMA 2JUCA 2XRNA 1SEUA 2COMA 2IEKA 1IDYA 4GO1A 4M3GA 3S2WA 2Y69H 3ZGKA 2CJJA 2XB0X 1VQ5I 1O3SA 4P96A 1G4DA 2K3FA 3KZYA 5ILVA 5LGTA 3DXJF 2QZ8A 2JA8J 2BW3B 3OIOA 4QWQA 4B47A 4Y3OA 1RNLA 2F5CA 4UUTA 3BJOA 4ZZLA 1ZLKA 1R6RA 2ICWG 3I53A 4UVBA 1JKOC 2Q1ZB 3C2BA 4ESFA 5FKLA 2XSJC 5ED4A 3BR3A 2OZ6A 3R0AA 4LFUA 4L9JA 1P7JA 1DU6A 2NS0A 2Y48A 5D6FA 1USTA 2M9HA 3K1PA 1LQ1A 4M71A 4XKWA 2NVTJ 2Z3YA 1YS7A 4J01A 2P5KA 3S1MJ 5J4VA 1E3OC 2IS1A 1ZRDA 4GXOA 1I6XA 2HXIA 2QLZA 2LH9A 2GXAA 1ACIA 4I0BA 2RREA 2M4GA 2J5OA 2QGUA 4Q5SF 2BGCA 2IP2A 3DCFA 4D0PA 1W7PA 4L5EA 2EV0A 2Z9OA 2IA1A 4Y33A 1ZR2A 1HQCA 5EEHA 1OR7C 3QPTA 3W6KB 3BZKA 1T0FC 3V7SA 5FO5A 3F72A 1GXQA 2Q8KA 1PJRA 1G59A 1OJLA 5IY5H 2LK2A 1IUYA 3S1QJ 1FTTA 1GVDA 3OYNA 4JX5A 2W1OA 3K2AA 2XDVA 2ZSHB 3SFZA 4BQNA 1R4MB 3NAUA 5LFAA 1T98A 2W24A 1JTYA 2OCCH 3LA2A 3OWTA 5TGTA 1SD6A 1K4TA 2XASA 4L18B 3G1OA 4K2EA 4E7KA 3BC8A 3CP8A 2XRLA 3KLNA 3CC2I 4EVIA 1S5LC 1R5GA 1D3YA 4EEFG 4RGSA 1KU9A 3CESA 2AXLA 3MVPA 4GYGA 1UB9A 2V4JC 3D5RC 4ZTJA 1MBGA 3ZCOA 4ASNA 1I50J 5HLHA 4FISA 2JRMA 3U2RA 3F23A 2VKHA 4XN0A 1UFMA 3ULQB 1O3RA 3RI4A 1ZHFA 3PL8A 4YELA 2K4BA 1FP2A 2CQKA 4M9SA 1XGOA 4L0YB 2DJIA 3L2UA 3ASOH 3OR1C 3I5UA 3HOUJ 4XNFA 1VQ6I 3LSGA 1X1CA 1F1ZA 3U21A 3OYGA 4MIMA 2V26A 1D0YA 4B09A 4MTDA 3C2HA 3D5SC 3K4JA 4PUSA 1UELB 1Z7LA 1VNDA 3I56I 3E6BA 2E2HJ 1MMDA 2W57A 4LMYA 3W6JB 3WTWC 5BPDA 4YEJA 2L9RA 3ZPLA 1QVTA 4LB5A 5IOZA 1WJBA 3BP8A 1GUUA 2MD0A 3GW2A 2FBHA 3TO6A 1VQ7I 1F9NA 1VQPI 3P9KA 2E2JJ 5GTHC 4XLPF 3N4MA 4I2OA 2HYFA 1X58A 4FX0A 3TW7A 5CPRB 4A3LJ 5EGOB 3MWMA 1RR7A 4CCLA 3QOEA 3G73A 1PDNC 2X51A 3PNTA 4RAGA 1SFOJ 5JFRA 4B3AA 3A0BC 4O6JA 1A6QA 3ZQCA 2OCEA 5JHUA 1RKTA 2HQAA 2DBBA 5KVRA 2ZXIA 4UB6C 4RB1A 4IF4A 2M0MA 3H92A 1OR7A 6PAXA
chains in the Genus database with same CATH topology
3H5AA 4PJMA 4NC8A 4B44A 4B48A 3OYJA 3S3NA 1V5GA 2HVSA 4XOTA 4PK4A 2WBMA 4AVZA 2F5VA 3DTEA 2F4IA 1X19A 4E6KG 3MMYB 4XKVA 3TMOA 1WJ5A 4BGDA 2QKLB 1X4PA 3C2GA 4QPQA 3A1YA 4CCJA 1V5FA 4ZYAA 5JHFA 4DJAA 2R7RA 2VASA 1QHGA 3EPZA 1Z3YA 3N05A 1YX5A 1N75A 2A5WA 1W36C 1LFPA 4PSXA 4CUGA 1LDKB 2VJ4A 3LMMA 4H4KC 1SFKA 2HPMA 4E7HA 3I3LA 4AU7A 4XLEA 3K4CA 2VLAA 4ZTFA 4HNUA 3DPTA 1DGWY 3W3CA 2Q2EB 4ZC3A 4XOPA 2DT7B 4CH7A 2R7VA 3HOSA 2VXDA 4E7ZA 2RQQA 3IAS2 1BR1A 2QKMB 1UAAA 4DBRA 2VJ5A 2XF6A 3W2VA 4IZZA 2UWMA 3EUHC 3PSIA 4CCMA 2X6WA 1YE9A 2BW3A 4XM3A 2KHMA 4XLCA 2V9KA 2R7WA 2HPIA 5CQGA 4GRIA 4XQFA 4CCOA 5FRNA 4HRIA 1N78A 2R7QA 3VYSB 2R7UA 4BE1A 2E60A 3BG6A 3H9GA 2HVRA 3QYBA 3OMYA 5KNLA 3SYTA 1OLTA 2OV7A 4P1WA 2L5QA 3BCAA 4CA0A 4BE0A 3DU6A 2WADA 2BVMA 1BR2A 2L9NA 3KX2A 5HOOA 3VSLA 4HNTA 3HL2A 5HNFA 2IGKA 3LSKA 4LIVA 1X1AA 2NOJB 2UV1A 3DWLE 4B43A 1D1BA 4KT6A 2IS2A 1UG0A 2CUJA 4XLFA 1D0XA 3H0DA 3IAM2 4RMNA 1J09A 2KRHA 2LYCA 5HVQC 1X1BA 1YX3A 4ITVA 3KEYA 3RPUD 3SEQA 3VYTB 2LREA 3DKYA 2CV2A 2KQRA 2M4KA 4BUPA 2FUG2 3NWSA 4PJJA 4XMYA 5CQEA 4BJTA 1Y6IA 2W82A 3OL4A 1QHHD 4F55A 3OYBA 1MNEA 4KISA 1MW7A 2VB6A 3I9V2 3K4NA 2KMUA 4XR6A 2LOOA 2ZXHA 2HVQA 2MFZA 2IS4A 1U0JA 4IKFA 4II2A 2ELJA 3H9JA 4BQQA 4QPOA 4ZJZA 4JOMA 4PJNA 4D1QA 3BLYA 3PJRA 2HU9A 3QODA 1PYVA 1MMNA 5KCMA 2O5RA 2M3AA 4CSWA 4YRVA 2VQLA 3UNGC 2Z16A 3DQVC 2R4GA 2VIXA 4JQFA 3D5LA 2IXSA 3ONQA 4RLQA 2LC2A 2VQHA 3RCOA 2UUZA 1AA7A 4LIUA 4LG3A 2X1DA 2XC7A 4N4OB 3L2VA 4IX7A 2L7KA 1LVKA 4U87A 3QYEA 2MC4A 3S32A 4PJLA 2KL4A 2X1EA 1IRXA 3OOUA 3VYRB 4BDYA 4BDZA 2HNHA 3E0JB 1ZELA 3LSHA 4HSTA 3NWTA 3FBNB 4EATA 3IUOA 3S3OA 4BXFA 2R7TA 4C30A 3G2BA 2CV1A 3W2AA 2WY8Q 2LY1A 3K4LA 3OYAA 2XF7A 4II3A 3DTKA 5HLTA 2AQEA 2W00A 3VSKA 2IGOA 4PFOA 3OY9A 1G8XA 4XLAA 2V6EA 3K4KA 1WJDA 3J7AY 4MLOA 1MNDA 4DOZA 2LBFB 4F3QA 2PJRA 2CUZA 1E0EA 3TL4X 4BEHA 1VZ0A 4CCKA 5FROA 4P5OA 4X0GA 2WAEA 2KLOA 2JSPA 1WJFA 1Y56A 2WAFA 3IP4B 4R79A 3FDYA 4BJ6C 4E4HA 2Y0SA 4KITB 3E1SA 3H5RA 3OYDA 3DTIA 1DGRM 4CZCA 1D1CA 3H35A 3DU5A 3GBGA 2WY7Q 2K5CA 2L9SA 4BL0B 4B3XA 1GLNA 4NQWB 2HZDA 2R7OA 2LRDA 3HXLA 3MD2A 3RSNA 3VDXA 4E7SA 1KONA 2E1MB 2KP6A 3EUAA 3LFUA 3SDBA 1WJCA 2CS3A 2OUMA 2E5ZA 3ZR8X 3KYLA 4ZDLA 2GOXB 3OYFA 3OIPA 3OYLA 1FMVA 2KZVA 3FBIB 4RM2A 2ZSIB 4C2TA 1Z3XA 3K4BA 3K10A 1DQUA 2BVLA 3HPGA 4D9JA 4CCNA 2AQFA 3S8PA 3K70D 4ZDOA 2VKDA 2K9MA 4F91B 4BS9A 3M8JA 3PFYA 4HEA2 1P9QC 2KDOA 1V5EA 4XLHA 2DCEA 2KPMA 3A4CA 4XKCA 2M7AA 4Y4RA 4AYBA 4F92B 1D1AA 2WAQA 3HKZA 3L2QA 2A6TA 3S3MA 2CH0A 2VQGA 3OYCA 2W7NA 3OIQA 3ZRGA 3LSMA 2CW7A 3M1CA 1TZLA 3AFHA 4LITA 2GOMA 2VJIA 3DLAA 3MKWB 1NG6A 3RQ4A 3VWBA 3BG7A 2CFOA 3HUGB 4PFPA 2X6YA 4NUBA 1N77A 3OYMA 1WJAA 4DIQA 5FRMA 3CMMA 2XAUA 3F9KA 4KJZA 1SAUA 4HSRA 1HA8A 2E5NA 2VQCA 2IGNA 3HOTA 3QYFA 3ZGKA 3PUBA 2V7FA 3CP2A 3MKYB 3OYEA 2BW3B 2WB1A 4DBQA 4B47A 2VPLA 4Y3OA 2VJJA 1R6RA 1TT0A 4BJ5C 3AKZA 2Z1DA 2Q1ZB 2L2OA 2V1NA 3ZQQA 2F6CA 4E7IA 2XSJC 5LD2C 2RNGA 2R7SA 4PSWA 3K6GA 1ERDA 2E1MC 2JVGA 5HNHA 2W4SA 3RTRA 2CW8A 3CJQB 4XKWA 4BE2A 3SZGA 4J01A 3OYHA 1QU3A 1EA3A 1MMAA 1W36D 2IS1A 4XONA 3AL0C 4OAYA 3L2WA 2I8DA 3FHNA 2LH9A 1BOBA 3OYKA 2RREA 2M4GA 2WA0A 2IS6A 4Y33A 3VYUB 2X85A 3LSIA 3V42A 4NNJA 1OR7C 3K4MA 1T0FC 3H9QA 3UR3C 3OR2C 1PJRA 1G59A 5CKTA 3S93A 3TBIA 4XORA 4HPQA 4OAZA 2LY2A 3PNYA 3W2WA 3OYNA 3FKJA 2W1OA 4OWRB 4F52A 2XDVA 2HDWA 2XF5A 1K6YA 2ZSHB 3CZ6A 4BQNA 5LFAA 4DGWB 1T95A 2BOLA 3OWTA 5TGTA 2K3PA 4XL9A 4E7KA 4G6TB 3BC8A 3CP8A 4U7BA 2IGMA 3SEZA 4N4NB 3LL7A 3AL0B 3CESA 4ZDPA 3OYIA 2V4JC 3D5RC 3ZXSA 2M7BA 4ZTJA 3ZCOA 4J00A 3L2RA 2CV0A 1LKXA 2VKHA 4XN0A 4F93B 2JVHA 1D0ZA 2LBFA 3DPLC 2KRCA 4RM3A 3EUKL 2DXIA 3K70C 3PSFA 3BCBA 3PL8A 1DP3A 2P0WA 4YELA 3HG9A 4XN3A 2VL8A 2Z2SB 1X1DA 1JI8A 5KHDA 2X6XA 2CMPA 2DJIA 3A2KA 3L2UA 2MABA 2VXZA 2DT6A 3OR1C 4RLFA 4XNFA 2LG4A 3HPHA 4IQJA 3LSGA 1X1CA 4XKBA 3U21A 2X1CA 3OYGA 2V26A 4BU2A 1D0YA 4NC7A 3C2HA 3D5SC 1BR4A 3K4JA 4PUSA 1UELB 1Z7LA 1X4OA 3OS0A 1MMDA 4BACA 4YEJA 4BQOA 4HG2A 4IQ4A 3HC7A 3OS2A 2MYSA 2ZFUA 1Z21A 1WJBA 2OC6A 3DPUA 2MD0A 2DOAA 3CF2A 1WFXA 4FETA 2PJRB 2JUGA 3DKXA 1FMWA 4BEHB 4C2UA 4E7JA 5CPRB 4FASD 4CCLA 2K9LA 3QOEA 3H5NA 2X51A 3PNTA 1NG7A 2R7XA 4C9YA 1WJEA 3PNVA 4E7LA 2HQAA 2JA2A 3OL3A 2ZXIA 3DEEA 3OS1A 2PMZA 1MMGA 1S9HA 2M0MA 3CJRB 3MKZA 4ANJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M4G A; 
#chains in the Genus database with same CATH topology
 2VOO A;  1T0F A;  4B48 A;  5LHH A;  3R4K A;  4EM2 A;  4U0V A;  1F43 A;  1V5G A;  4G8X A;  1RRJ A;  2DMU A;  2NYX A;  2HVS A;  1HSJ A;  3B02 A;  2WBM A;  1OQY A;  2IJL A;  3BTL A;  1O7L A;  3WHC A;  2BHZ A;  1WJ5 A;  3HOX J;  2DA3 A;  3A1Y A;  1V5F A;  5DD4 A;  5E1X A;  5CLS A;  3WHB A;  3CCY A;  1SD5 A;  2VAS A;  3E5X A;  4M3B A;  1ZKG A;  4I01 A;  1IO2 A;  3WTU C;  5D6E A;  1YYV A;  5HDN A;  1R23 A;  1RC9 A;  1U9N A;  4IRH A;  2VJ4 A;  2P5V A;  3GF2 A;  5LHG A;  1Z91 A;  4H4K C;  5AON A;  4N9I A;  1ETK A;  3CMY A;  4BYY A;  4A93 J;  3GME A;  4IHY A;  1XDS A;  3HUG A;  1GVJ A;  5HS7 A;  3NEU A;  3I3L A;  1ZAR A;  2ZNY A;  2DOE A;  3K4C A;  2VLA A;  4QTR A;  2E1N A;  3DPT A;  4HNU A;  1E17 A;  2Q2E B;  2MC3 A;  5EZH A;  2R7V A;  1B4A A;  3MZ8 A;  4A2U A;  4E7Z A;  1VI0 A;  3H1C A;  1FYK A;  1UAA A;  2VJ5 A;  1MBJ A;  2DMT A;  2UWM A;  3EUH C;  4CCM A;  2DPU A;  2X6W A;  2BW3 A;  1XC5 A;  2KHM A;  3FHZ A;  4GRI A;  3ROU A;  4CCO A;  1CF7 B;  3FM5 A;  2ISZ A;  2QEX I;  1G3W A;  1N78 A;  1OCT C;  3QYB A;  1D8J A;  3SYT A;  1OIS A;  3BT9 A;  3CME I;  3JSO A;  2QQB A;  1HW1 A;  2EFQ A;  5DYM A;  3KX2 A;  4JYK A;  1BN5 A;  5D4S A;  4ETS A;  2NNN A;  3VPR A;  2IGK A;  3LSK A;  4N0B A;  2UV1 A;  3K9T A;  1I3Q J;  2W48 A;  3F0C A;  4PDK A;  4XSX F;  1D1B A;  5K7H A;  4KT6 A;  2EK5 A;  1UG0 A;  1QZE A;  4A3K J;  1LDD A;  1J59 A;  1HW5 A;  1QGP A;  4IO9 F;  2VOP A;  3T0Y A;  2KJC A;  2ME6 A;  1REP C;  2GZW A;  4LGW A;  2G9W A;  1X1B A;  2DW4 A;  3GZ6 A;  4ITV A;  2DLL A;  3HEF A;  3RZO J;  3DKY A;  2CV2 A;  1JHF A;  2KQR A;  4IHS A;  4QSH A;  1A04 A;  1FT9 A;  5CQE A;  1YIT I;  4XMY A;  1GDT A;  4BJT A;  1R58 A;  1Y6I A;  3L09 A;  4Q48 A;  4YIF A;  4DYR A;  4F55 A;  2M45 A;  2K9S A;  3E6C C;  2EV5 A;  1J5Y A;  2JWT A;  5E8I A;  2FBK A;  2W25 A;  4XR6 A;  2A61 A;  2HVQ A;  2ZXH A;  2KKO A;  3FXU A;  3P9C A;  2ELJ A;  5E3L A;  1BIA A;  2DFF A;  2Y9Y A;  4AID A;  4OU0 A;  1OFC X;  4AM3 A;  2RGV A;  1E3H A;  1UJ8 A;  4JOM A;  2DTR A;  1U6G A;  5FLX Z;  2GBY A;  3AG3 H;  3C1D A;  4W97 A;  1MMN A;  5KCM A;  4EJT A;  2M3A A;  4LD5 A;  4YRV A;  2O61 A;  3EDP A;  1W5S A;  2YSR A;  4ZZD A;  5TRD A;  1K7A A;  5GPC A;  4JQF A;  1BL0 A;  2HS5 A;  2QUF A;  2A07 F;  3RCO A;  1BOA A;  1AA7 A;  4LIU A;  1UHW A;  4LG3 A;  2BEO A;  5C3E J;  3S14 J;  5FFZ A;  2XC7 A;  4B4C A;  3L2V A;  1LVK A;  2LKP A;  3GX4 X;  3O2P E;  1G3T A;  2CQN A;  2R7D A;  2A6H F;  3EUH A;  2RV8 A;  3E0J B;  3HHG A;  2RNJ A;  1BW6 A;  2L0K A;  3IUO A;  3X2Q H;  1ZAO A;  3W2A A;  5K7Z A;  1LUJ B;  1U8B A;  5IP9 J;  2HWV A;  2EA2 A;  5HLT A;  2W00 A;  1R7J A;  2OAZ A;  4KMU X;  4LK0 F;  4PFO A;  3J80 K;  3GTL J;  3WE3 A;  4MQV A;  4Y15 A;  5GAG J;  5JLW A;  2LBF B;  3V8L A;  2CUZ A;  2FX0 A;  1E0E A;  3TL4 X;  1VZ0 A;  4A12 A;  1HW2 A;  2DJN A;  5ICG A;  2EIK H;  4RDU A;  3R61 A;  5FRO A;  5EGO A;  1WJF A;  1BC8 C;  1I6H J;  3FMR A;  4YG2 F;  1S29 A;  2HYG D;  2NOG A;  3V8K A;  2E1O A;  3FDY A;  4BJ6 C;  1T33 A;  5L3G A;  1K61 A;  2Y0S A;  2BHY A;  2F2E A;  4KIT B;  2KJB A;  1JKR C;  2K02 A;  3BPX A;  2KT0 A;  1BI0 A;  3H5R A;  2A68 F;  4RAY A;  3F8N A;  3RKW A;  3DTI A;  4CZC A;  2UXX A;  2XHK A;  4UV9 A;  1VQN I;  5IP7 J;  2F4O B;  4I0A A;  1HOM A;  4NHJ A;  2K5C A;  3CDL A;  3HM5 A;  1XSD A;  2BXZ A;  4FE7 A;  1V3F A;  3ZQH A;  4IRI A;  1BI1 A;  2ZXJ A;  3CCS I;  2BE5 F;  1Q1V A;  4ENJ A;  3PQJ A;  2R7O A;  2LRD A;  3HXL A;  4E7S A;  3BTC A;  5IYC J;  2KP6 A;  1PUE E;  5C4J J;  1TC3 C;  2QCO A;  2ZME B;  3BRO A;  5FKK A;  4Y52 J;  2ZFW A;  2ZCW A;  3ZR8 X;  3JSP A;  1POG A;  3GLX A;  3OYL A;  2JRT A;  2KZV A;  4RM2 A;  1STZ A;  2EH3 A;  3TQN A;  5M3M J;  4V2G A;  4C2T A;  5GTI C;  4ZYE A;  4WF2 A;  3JRB A;  3K10 A;  2XGD A;  3K7A J;  1MJA A;  2BBY A;  1LJ9 A;  3KPH A;  4RAZ A;  4KA4 A;  1ZG3 A;  3WU2 C;  2AQF A;  2VOD A;  2P81 A;  4UB8 C;  2DYR H;  3Q0U A;  5C4X J;  3HRS A;  2VKD A;  5ICC A;  4DZJ A;  1ZG5 A;  5F64 A;  4FQG A;  3JRA A;  4EQQ A;  2Q2E A;  2P8T A;  1BJA A;  4ENN A;  1FOX A;  3ABM H;  2D2W A;  1H0M A;  1UG2 A;  2K4J A;  2KPM A;  4Z6Y A;  5JR3 A;  4OIP F;  3PO2 J;  2VT2 A;  1FWZ A;  4I99 C;  4Y4R A;  2VE9 A;  2MW8 A;  1SFU A;  3LOC A;  2QQA A;  4BKX A;  2Q0O A;  2G7U A;  1HST A;  2WAQ A;  3HKZ A;  5LHI A;  3L2Q A;  2A6T A;  2RC4 A;  3S3M A;  2DK5 A;  2PFB A;  2VQG A;  1G6N A;  3OIQ A;  1X2N A;  1CF7 A;  5J4Y A;  4JP0 A;  1O4X A;  1XTA A;  3M1C A;  1FIA A;  3LAP A;  5KAF C;  5FD5 A;  1NK2 P;  3QP5 A;  2ISY A;  2AO9 A;  1YO5 C;  3KZZ A;  3DLA A;  3MKW B;  1NG6 A;  4KIG A;  4D7N A;  2V9V A;  1F4K A;  3PM1 A;  4U88 A;  5M5W J;  2D45 A;  2XGE A;  3IV5 A;  2CFO A;  3JW4 A;  4HLY A;  2BZT A;  3RKX A;  3TO9 A;  2H8W A;  1LFU P;  1J75 A;  3GTO J;  2XAU A;  3B73 A;  4KMF A;  4KJZ A;  3ZMT A;  5BMZ A;  1MDM B;  2NRA C;  1SAU A;  4HV6 A;  3PIO F;  2HDC A;  2VQC A;  3HRT A;  1TQP A;  2IGN A;  2V1X A;  3QYF A;  1ZQ3 P;  2B7E A;  4IOA F;  2EV6 A;  3CP2 A;  1KU2 A;  3OYE A;  1EH8 A;  2WB1 A;  3BTJ A;  4XRM A;  4DBQ A;  4OIO F;  3ZMD A;  2VPL A;  3SQN A;  3K1N A;  3OV8 A;  4OOI A;  5C44 J;  1JE8 A;  1HCR A;  3AKZ A;  2Z1D A;  3HDD A;  2L2O A;  3ZQQ A;  3CCV I;  1ETY A;  2R5Z B;  5HDG A;  1ZGW A;  3TKY A;  2R7S A;  4PSW A;  5HS8 A;  3OSG A;  4AIH A;  1T56 A;  1OPC A;  2W4S A;  1WRJ A;  1XGN A;  4HNV A;  3Q3S A;  5D5X B;  5HNH A;  2PN6 A;  1FX7 A;  2ZME C;  4BXX J;  3SZG A;  2CFX A;  3OYH A;  1QU3 A;  2XAQ A;  2H1K A;  2WAQ N;  3HKZ N;  4L9V A;  1W36 D;  4X1E A;  3FIW A;  1MJB A;  4L0Z B;  2JPC A;  2ECC A;  2H94 A;  4XRS A;  2F5E A;  3OYK A;  2JTV A;  3BY6 A;  4M72 A;  2DFH A;  5J8F A;  1H9G A;  5E8G A;  2X85 A;  2VBZ A;  3LSI A;  3V42 A;  4MFD A;  3HHH A;  3K4M A;  2XSD C;  1AKH B;  2AHQ A;  1V4R A;  1Y0U A;  4IRG A;  2ZJQ F;  4A3M J;  4UY8 I;  2VI6 A;  1BI3 A;  3GCM A;  1GV5 A;  2LFB A;  4RA2 A;  2HQR A;  4HPQ A;  4L5J A;  3E5Q A;  3U9G A;  1K79 A;  4MNU A;  4B1R A;  1IXS B;  3ASN H;  4R1H A;  3AG1 H;  3ZP5 A;  4IPA A;  4F52 A;  1R71 A;  1IXC A;  1K6Y A;  3CZ6 A;  1QA6 A;  3WE2 A;  1PUF B;  1QO0 D;  1T95 A;  2BOL A;  1LB2 A;  2K3P A;  1QPM A;  2L02 A;  4KUM A;  3EET A;  4XL9 A;  1A36 A;  4LLN A;  1A5J A;  3JRF A;  4G6T B;  3TOB A;  4CYC B;  4NDL A;  2IGM A;  5CVU A;  3HOY J;  4UUS B;  2WB1 N;  1YOV B;  4N4N B;  4ZH4 F;  3LL7 A;  3DEW A;  3COA C;  3OYI A;  3ZXS A;  2QA4 I;  3W6V A;  3L2R A;  2CV0 A;  2B9S A;  2LR8 A;  3U1D A;  1FC3 A;  1U2W A;  2LBF A;  2KRC A;  3JR9 A;  1Z0X A;  1FSE A;  4RM3 A;  4QLC U;  3CQZ J;  2HDD A;  2E7X A;  3JRD A;  4XN3 A;  2FD5 A;  1XS9 A;  1JI8 A;  1B72 B;  5IYD J;  5KHD A;  2X6X A;  2CMP A;  3FKI J;  1QQI A;  2MAB A;  2MBF A;  3TP3 A;  3GYH X;  2X48 A;  4IOC F;  2ZO4 A;  3IC7 A;  1B9N A;  2LG4 A;  1MBE A;  4XKB A;  2X1C A;  3NAR A;  4ZYH A;  2NAZ A;  3CJN A;  4NC7 A;  4U7D A;  2XVC A;  1WH5 A;  1OMI A;  3E7L A;  4EMS A;  4MEX F;  4M74 A;  3SJM A;  1FOK A;  4BNC A;  4BAC A;  3KP7 A;  2MH9 A;  2DA2 A;  2LF7 A;  3BWG A;  4BQO A;  3OS2 A;  3FK7 A;  5IPA A;  2DU9 A;  3DPU A;  1LEA A;  4JK1 X;  3ZQG A;  3F21 A;  2HOA A;  1WVR A;  4FET A;  2JUG A;  3DKX A;  2YR2 A;  3BR5 A;  4MTE A;  4BHC A;  4YIR X;  4BEH B;  2VC0 A;  4E7J A;  4B8X A;  1A35 A;  1NG7 A;  2R7X A;  3LQQ A;  1IG7 A;  2H27 A;  1B9M A;  2L54 A;  4HLX A;  3LSJ A;  1AHD P;  1FNN A;  2MH2 A;  2PLY A;  4A3F J;  3HGG A;  4GYI A;  2FQ4 A;  4MO7 A;  4M6X A;  2LSO A;  2J5P A;  3H5A A;  1ZR4 A;  1FPQ A;  5L3D A;  1OYW A;  4B44 A;  3OYJ A;  2NXN B;  1R36 A;  3S3N A;  1RUN A;  3MAJ A;  3S1N J;  4NC6 A;  4XOT A;  4PK4 A;  2UZK A;  2CGP A;  4AVZ A;  2F5V A;  3QOP A;  4S0H B;  5EF6 A;  3MMY B;  4XKV A;  3TO7 A;  3TMO A;  5LLQ A;  3CCQ I;  4UHT A;  4BGD A;  2QKL B;  4O3M A;  4QPQ A;  2PI0 A;  2VKV A;  4ZYA A;  3TW6 A;  4OMZ A;  2DTZ A;  2L7F P;  1SFX A;  5LRR A;  1O7F A;  3RKY A;  3N05 A;  3SZP A;  1U9O A;  2Y75 A;  2XPV A;  1W36 C;  4PSX A;  2QQ9 A;  1MJ9 A;  2QWW A;  5A2Q Z;  3LMM A;  1ETQ A;  2PG4 A;  1E3P A;  4F7Z A;  2JMW A;  4KIF A;  4Z2Y A;  1MIJ A;  2HPM A;  4M6Y A;  5CVJ A;  4AU7 A;  4XLE A;  4RGX A;  4PJ0 C;  5J1U A;  4A6D A;  4ZTF A;  1DGW Y;  4XOP A;  2DT7 B;  1MDM A;  2CW0 F;  3HOS A;  4RB3 C;  1RIO H;  2EZK A;  2RQQ A;  1BR1 A;  1XN7 A;  2Y30 A;  1IRG A;  2QKM B;  2OF7 A;  4BH9 A;  2DN0 A;  1JTX A;  1OKR A;  2FU4 A;  2HR3 A;  1SVL A;  4BAY A;  1YE9 A;  3E6M A;  2XB5 A;  5IT3 A;  4XLC A;  3RYR A;  2V9K A;  2R7W A;  5D5U B;  5CQG A;  5FRN A;  5HLG A;  1S7O A;  3BR6 A;  2I10 A;  1WKM A;  1K6O A;  2DMQ A;  3BG6 A;  3G1L A;  4BY7 J;  3ZMZ A;  5J1R A;  2V1U A;  2XUB A;  2OV7 A;  4P1W A;  1R9T J;  2R5Z A;  2L5Q A;  9ANT A;  2IA2 A;  1KQ0 A;  2BVM A;  2RKH A;  2M8E A;  3GFM A;  3NRV A;  1XCV A;  5HOO A;  3MN2 A;  4HNT A;  2F5D A;  1CQT A;  2JQ7 A;  3E3V A;  3FXM A;  3JTH A;  5HNF A;  3CMA I;  3RQI A;  2I5U A;  4LIV A;  1G2H A;  1X1A A;  1VQM I;  1JJ6 C;  1HXD A;  1R1U A;  4HZF A;  1LE8 B;  3ZMS A;  2IS2 A;  2CUJ A;  1ON2 A;  4EGZ A;  4A3B J;  3KP3 A;  3KP5 A;  2Z99 A;  1D0X A;  3U1K A;  3G6E I;  1IF1 A;  2LTP A;  4DYC A;  2R7F A;  3V7C A;  5HVQ C;  2M1B A;  5F0H A;  1YX3 A;  4CDG A;  4DYQ A;  3RPU D;  2DAO A;  1X1P A;  2PMH A;  2RVC A;  4W1U A;  5DUK A;  5LBQ A;  1RR8 C;  1AKH A;  3HTS B;  2FRH A;  5L3B A;  1TLH B;  2FUG 2;  2HQ5 A;  3B6C A;  3EQL F;  3L9F A;  3NWS A;  2A3S A;  2GWR A;  4A69 C;  3O3K A;  1MNE A;  3ECO A;  2VPR A;  3K4N A;  3ZN0 A;  2KMU A;  4KIC A;  2LOO A;  4A3C J;  2LVS A;  1PUF A;  1NHA A;  3ZQL A;  1U0J A;  4BHB A;  2O7O A;  4II2 A;  4IKF A;  5EZG A;  1HF0 A;  1I1S A;  2X9D A;  3H9J A;  2E19 A;  4UUS A;  4ZJZ A;  3Q0W A;  2ELK A;  2DFE A;  2DQR A;  5FFX A;  3PJR A;  3O8G A;  1RET A;  4IJA A;  1PYV A;  3C3W A;  2VQL A;  3FIS A;  2FJ1 A;  3DQV C;  3KYD B;  4P9U A;  4S05 A;  2C6Y A;  5KAI C;  3BZC A;  4C3I J;  4HX4 A;  5EG0 B;  5D8K B;  3WU1 B;  3D5L A;  2R7Z J;  2HEO A;  1XSX A;  1BIB A;  1IUF A;  2K9N A;  3KEO A;  4RLQ A;  3LWF A;  1Y0N A;  2UUZ A;  2DDA A;  1EF4 A;  2OBP A;  3GEZ A;  2X1D A;  3M07 A;  4DQ2 A;  1NK3 P;  4CXF A;  3GTK J;  5ICE A;  2VN2 A;  2VT3 A;  1B72 A;  2L7K A;  2F5F A;  3F8B A;  3QYE A;  2WWY A;  3GVA A;  3S32 A;  2GIV A;  4D5C A;  3G4S I;  1K83 J;  3GTQ J;  3IKT A;  3OOU A;  2O8K A;  3BG9 A;  3BR0 A;  3VYR B;  4BDY A;  2VBW A;  4OIN F;  1ZEL A;  4HST A;  4EAT A;  3NWT A;  2RN7 A;  5E3N A;  2CG4 A;  2GXG A;  2P4W A;  3IKV A;  2R7T A;  2L4M A;  3LSP A;  3J80 Z;  4G6Q A;  1FOW A;  2XF7 A;  2W85 A;  2L3D A;  3OY9 A;  3ZMV A;  2M5W A;  5A2Q K;  2CO5 A;  4DOZ A;  3FF5 A;  1XGS A;  1PVE A;  3VOD A;  2JA6 J;  5F0C A;  5M5X J;  5JI6 A;  4BEH A;  3DKW A;  4LG0 B;  1XSV A;  4CCK A;  1LPQ A;  1B1B A;  5GPA A;  1BI2 A;  2WAE A;  4V2F A;  3K1M A;  1Y56 A;  3K69 A;  4PGH A;  3IP4 B;  2JJ7 A;  1SFE A;  2Y0M A;  3DEU A;  4E4H A;  2XPW A;  4HX7 A;  3WTS C;  1MGT A;  2DI3 A;  2FEZ A;  2QSF X;  2A6E F;  3E1S A;  2JSC A;  4GGG A;  4A0Y A;  5HLI A;  1YIO A;  4D7M A;  1G3Y A;  1SAX A;  1MD0 A;  2V1D A;  3LFK A;  4M6V A;  3ABL H;  3GFL A;  1SVM A;  2G0E A;  1PP7 U;  1BC7 C;  3DFG A;  2M0C A;  1R1T A;  1QRY A;  4CO8 A;  2ZJP F;  2QYO A;  2HZD A;  3RSN A;  5LEK A;  1KON A;  3FX3 A;  1O3Q A;  2VBX A;  1FY7 A;  3IL2 A;  1ETV A;  2E5Z A;  3I64 A;  3OIP A;  1NH3 A;  1FBQ A;  4N9H A;  2ZSI B;  1YLF A;  1Z3X A;  2DDB A;  4CGZ A;  4EJO A;  3HOV J;  2ZJ2 A;  4D9J A;  3S1R J;  3WGI A;  4CCN A;  4DZP A;  3I0T A;  3S8P A;  3Q0V A;  3KP4 A;  4A5N A;  5K1Y A;  1IZ1 A;  5FLV A;  3F22 A;  1XD7 A;  3PFY A;  4HEA 2;  5CVI A;  1WI9 A;  2ESN A;  1V5E A;  2P6S A;  3DLL F;  1BA5 A;  3JCU C;  3H0G J;  4XLH A;  1DDN A;  4P9F A;  3D1N I;  1QVU A;  3LSR A;  3JAM Z;  3IRQ A;  1D1A A;  2PEX A;  1U3E M;  4HW0 A;  3PFI A;  2FNP A;  3OYC A;  2W7N A;  1U5T B;  4RS8 A;  1YJ9 I;  1GHC A;  3ABT A;  2K40 A;  2ZXW H;  4MQ9 F;  3CCJ I;  2GOM A;  2VJI A;  2DOD A;  3ELK A;  1HKQ A;  3RQ4 A;  3DV8 A;  3BG7 A;  3O8H A;  5K5O A;  4PFP A;  5GP9 A;  4NUB A;  2BY2 A;  5DM6 F;  3OYM A;  1Z1D A;  2DMP A;  4DIQ A;  2GLO A;  2DK8 A;  3GTG J;  2BY0 A;  4L9T A;  1LE8 A;  1IN5 A;  4HSR A;  1ZLJ A;  2MD5 A;  4A3I J;  4XRS G;  1TWC J;  1V55 H;  2EIM H;  3QWL A;  3PUB A;  4OIQ F;  2X0L A;  1OCO H;  2R92 J;  1LVA A;  5E3O A;  2Z33 A;  3KE2 A;  5LGN A;  3FXK A;  1IV8 A;  3ML6 A;  4I6Z A;  2IRF G;  2EFP A;  3E5U A;  2VJJ A;  1APL C;  1TT0 A;  3AG2 H;  2IA0 A;  2JN6 A;  1GT0 C;  4P55 A;  2F6C A;  1FBU A;  2K86 A;  5J40 A;  1VQO I;  1FOY A;  1K78 B;  4IEJ A;  3I58 A;  1ERD A;  2KRF A;  2JVG A;  2IBD A;  1R00 A;  2JA7 J;  2EFO A;  3CC4 I;  2CW8 A;  5IP6 A;  2RQP A;  3S2D J;  2GA1 A;  3P7N A;  1EA3 A;  2OD5 A;  1AU7 A;  3SXY A;  3AL0 C;  1KA8 A;  4OAY A;  4G7O F;  2I8D A;  2CSO A;  5J6X A;  3SZT A;  1BOB A;  2QSG X;  4UVA A;  3QU6 A;  2IS6 A;  3MEX A;  2XV4 S;  1ETO A;  3VYU B;  1MH3 A;  5HOD A;  5EG0 A;  4AC0 A;  3L1P A;  3H9Q A;  3RPU A;  1EJ9 A;  3WGH A;  2WV1 A;  4A0X A;  4OIR F;  3S93 A;  1U8R A;  1CGP A;  2G7H A;  2LY2 A;  3WTZ A;  4A5M A;  3KLO A;  1Y39 A;  1ETX A;  1ODD A;  5FD6 A;  3FKJ A;  4OWR B;  2CQX A;  2XF5 A;  3CD6 I;  3LAJ A;  3MQ0 A;  3V7R A;  2IW5 A;  4DGW B;  3KP2 A;  2GA2 A;  2LKS A;  4O5V A;  4M9Z A;  1JT0 A;  3F8M A;  4ESJ A;  4U7B A;  4C3H J;  1U5T C;  2PMZ N;  5B1B H;  5E3M A;  3I54 A;  5K5Q A;  3ERE D;  4ZDP A;  3CCU I;  1TP4 A;  1FTZ A;  1IN4 A;  1YW9 A;  1SC7 A;  4J00 A;  3MCZ A;  3KEQ A;  1WQ2 A;  4DW6 A;  3A01 B;  1D0Z A;  5LRS A;  4IHT A;  4GCV A;  2E71 A;  1H88 C;  2DXI A;  1QZZ A;  1RZ4 A;  2QF7 A;  4LG0 A;  1DP3 A;  3RZD J;  3NQO A;  1DPU A;  3F6V A;  2VL8 A;  3BR2 A;  1XG1 A;  1X1D A;  3A2K A;  1XGM A;  2VXZ A;  2E36 A;  3G71 I;  2EZI A;  3CLO A;  2H8R A;  3J7A O;  3CDI A;  1HBX G;  2STT A;  4EM1 A;  1WWX A;  4I02 A;  1F36 A;  4BU2 A;  1IN7 A;  4MEY F;  1IXR C;  4RB0 A;  3JAM K;  1BR4 A;  1X4O A;  1Z77 A;  3OS0 A;  3A02 A;  2O9L A;  3JRC A;  2VUM J;  1HKS A;  4HG2 A;  2CYY A;  3M1E A;  3HC7 A;  4UUV A;  2YX7 A;  2L01 A;  2ZFU A;  1A6I A;  4EV0 A;  5ERI A;  3CF2 A;  1WFX A;  2MA3 A;  2H6C A;  2KIS A;  3ESW B;  1FMW A;  2L4A A;  3Q9S A;  4C2U A;  3V4G A;  5DUI A;  2EFW A;  4FAS D;  2K9L A;  3FXL A;  3E6D A;  1MH4 A;  4C9Y A;  4XSZ F;  2O03 A;  3PNV A;  5EYR A;  1IN6 A;  4E7L A;  4L5I A;  3OL3 A;  1T38 A;  3DEE A;  5L3E A;  4G7Z F;  1XMA A;  1S9H A;  3HSR A;  3LQR A;  3CJR B;  3MKZ A;  2E35 A;  2DMN A;  5TIS C;  2A69 F;  3CCE I;  1YQA A;  2JZY A;  3FMS A;  1L0O C;  4Y13 A;  3A03 A;  1R4N B;  2ECB A;  1KQ9 A;  3WU0 A;  1X19 A;  5DD8 A;  2E34 A;  2Z5U A;  3VB2 A;  2K9Q A;  2K85 A;  3HTU A;  5D5W B;  3HYI A;  1H89 C;  4G94 A;  2ELH A;  2R7R A;  1ONV A;  3C2G A;  5JHF A;  4CCJ A;  2DPD A;  3F8F A;  5CJ9 A;  4ON0 A;  1R1V A;  4DJA A;  1Z67 A;  3EPZ A;  1R22 A;  1U5T A;  2AXT C;  3HIF A;  1FIP A;  1G3S A;  2BY1 A;  1M1E B;  2ESH A;  2W84 A;  3CC7 I;  1LDK B;  2VKE A;  4KFC A;  1WI3 A;  2A5Y B;  1ORK A;  1SFK A;  2KIU A;  2FNA A;  3RYP A;  2EZH A;  3ZOB A;  3T5X A;  2DA5 A;  1SD4 A;  1WGX A;  2P6T A;  4RB2 C;  3Q9V A;  1RUO A;  1JXS A;  3W3C A;  4JX4 A;  3LA7 A;  2VXD A;  3WG7 H;  2LDU A;  4U0Y A;  2KIM A;  2Y31 A;  4DBR A;  3GXO A;  2YUS A;  3J7Z I;  1ZTR A;  2DYS H;  4IZZ A;  2D1V A;  3K2Z A;  1TW3 A;  3GWZ A;  3KCC A;  1SD7 A;  3JRH A;  1S72 I;  2HPI A;  2MGQ A;  2TCT A;  4HRI A;  1MBF A;  2R7U A;  4JX6 A;  4BE1 A;  2E60 A;  1BBY A;  3LA3 A;  2XGX A;  5FKM A;  1OLT A;  3L2C A;  3CCM I;  5J3L A;  2ID3 A;  1HDP A;  1VTN C;  1MZB A;  1I27 A;  3F8C A;  4BE0 A;  1K78 A;  4HDU A;  4FCY A;  4S04 A;  4BXU A;  5H6Q A;  1BR2 A;  2L9N A;  2AS5 F;  2D5V A;  2B63 J;  3VSL A;  3IH3 A;  1VQ9 I;  1IRZ A;  2NS8 A;  1P92 A;  4B43 A;  5M5Y J;  3JRG A;  4ENK A;  4M73 A;  2GIZ A;  5IOY A;  3F3X A;  3DBL B;  3H3Z A;  4M3D A;  3I71 A;  2HOT A;  2P7V B;  2GQQ A;  4ESB A;  4RMN A;  5B1A H;  2KRH A;  1S8N A;  3ZMU A;  2LYC A;  5F1J A;  1P4A A;  3CUQ B;  1XCB A;  1MMS A;  3UKG A;  3KEY A;  3VYT B;  3SEQ A;  4BQA A;  2M4K A;  3BTI A;  1FP1 D;  2O0Y A;  4PJJ A;  2E1C A;  3OL4 A;  1DPR A;  1I3A A;  1P4W A;  2XKP A;  1MW7 A;  3I9V 2;  1Y1W J;  2YU3 A;  2OTJ I;  1JUP A;  2PBI A;  4WXC A;  2MFZ A;  4LLL A;  4A6E A;  2IS4 A;  4JBA A;  1K4S A;  2ZME A;  5H6R A;  2DT5 A;  1P6R A;  5K7F A;  3RIR A;  3VEP A;  1X3W B;  3HSF A;  4PJN A;  2ZKZ A;  1KU7 A;  3BLY A;  1QZY A;  2HOS A;  2HU9 A;  1YJW I;  1YG2 A;  5ILS A;  3QOD A;  1YFH A;  5E1Z B;  2O5R A;  1P7I A;  3UNG C;  1J9I A;  3TDZ C;  3A01 A;  5E79 C;  4YFN F;  3HBL A;  2LC2 A;  4AIK A;  2V6C A;  2VQH A;  2MSY A;  4Q4Z F;  1EKE A;  3R6S A;  3BR1 A;  1KZH A;  2V9P A;  2DOF A;  4HDV A;  4N4O B;  5CYV A;  2DA1 A;  3TGN A;  2FSW A;  2MC4 A;  4LLG F;  5IYB J;  5CVR A;  2QQ8 A;  3M9A A;  3JRE A;  2X1E A;  1WPK A;  1IRX A;  3VFZ A;  5DCF A;  4BDZ A;  1WH7 A;  5FKO A;  3FBN B;  4HA8 A;  4FX4 A;  1OCP A;  4X6A J;  2OZU A;  4C30 A;  2CV1 A;  2WY8 Q;  3K4L A;  2FXA A;  3OYA A;  2KIF A;  1QPI A;  3DTK A;  3DBH B;  3VSK A;  1MKM A;  1G8X A;  4XLA A;  2HQN A;  2V6E A;  2DQL A;  2EZL A;  3K4K A;  3J7A Y;  2XAG A;  2IAI A;  4MLO A;  3CCR I;  4F3Q A;  5FKN A;  1FSH A;  3TOA A;  3GFJ A;  2HTJ A;  3T1B A;  2ZJR F;  1YJN I;  1W0U A;  1ZRE A;  4EJW A;  4AYB N;  4HV5 A;  3HRM A;  2B0L A;  2JSP A;  2FMY A;  2KLO A;  1ZK8 A;  4M9X A;  3JTG A;  5ILU A;  3S16 J;  3BOQ A;  3J7Y J;  3DBR B;  1DUX C;  2GM4 A;  2DFI A;  3H36 A;  2NVX J;  1QNT A;  2MG4 A;  3E97 A;  3H3U A;  3REO A;  3CUQ C;  3OYD A;  5FJ8 J;  1DU0 A;  4FE4 A;  2R93 J;  1R49 A;  3H35 A;  2Y9Z A;  5EEA A;  4LB6 B;  5D5V B;  2WY7 Q;  1I39 A;  3S2H J;  3QQA A;  1Z7U A;  2CWE A;  4KNY A;  4BL0 B;  1E2X A;  2BV6 A;  4B3X A;  3P5J A;  1ZG1 A;  1GLN A;  2VE8 A;  4NQW B;  2GAU A;  3AAF A;  2KIQ A;  4GFB A;  2E1M B;  3EUA A;  4IHW A;  3L00 A;  3LFU A;  4L9N A;  3I55 I;  3LNQ A;  2OU2 A;  1WJC A;  5AIQ A;  2CS3 A;  1KYZ A;  5HDK A;  3HGY A;  4CHU A;  4ZDL A;  2GOX B;  2L7Z A;  3QU3 A;  1X2M A;  1Z6R A;  4HBL A;  3BQY A;  5TJJ A;  4QIW N;  1WSU A;  3TDU C;  4PGG A;  3K4B A;  1DQU A;  2LP0 A;  2BVL A;  3MKL A;  1TNS A;  1RPW A;  3K70 D;  5DS9 A;  4ZDO A;  1ZH5 A;  2K9M A;  3WTT C;  1HC8 A;  4F91 B;  4A3E J;  2YS9 A;  4FHT A;  1JHH A;  3J81 K;  1S6L A;  2OTL I;  2JPB A;  1IAW A;  2FBI A;  1KGS A;  2EB7 A;  2A05 A;  4AD9 A;  3N97 A;  4E70 A;  1DP7 P;  3A4C A;  1ZN2 A;  4BY1 J;  1AOY A;  2LLK A;  1YS6 A;  2M7A A;  3QPH A;  1Z9C A;  4A0Z A;  5B66 C;  3WTY C;  2LD5 A;  2FE3 A;  2IT0 A;  5B3S H;  1MNM C;  1TL8 A;  2ID6 A;  2JK3 A;  3SHF A;  1EH7 A;  2TDX A;  3WOD F;  4CYC A;  3CCL I;  4UXN A;  4WWC A;  5H20 A;  2CW7 A;  3PQK A;  3AFH A;  3QAH A;  1TWH J;  4HQE A;  2ME0 A;  1A31 A;  2ZB9 A;  3VWB A;  4YII A;  1S7E A;  2CUE A;  1P2F A;  4GDF A;  3RDI A;  1T2K A;  2HKX A;  1RKW A;  4LK1 F;  1YRN B;  4AUX A;  3F6O A;  3F9K A;  2LMD A;  4WXH A;  3O6B B;  1XB4 A;  4UNO A;  1HA8 A;  2E5N A;  2H1L A;  4BBS J;  1D5Y A;  2PX9 A;  3HOT A;  1TWG J;  1U78 A;  4AWX B;  2BXY A;  2V7F A;  2WC2 A;  1W5T A;  3MKY B;  3D0S A;  3CUQ A;  1WHU A;  3JRI A;  1N25 A;  4LOC A;  2WTE A;  4BJ5 C;  5DM7 F;  2IVM A;  2V1N A;  5GAD J;  2D1H A;  3M3Y J;  1I5Z A;  4E7I A;  5LD2 C;  2RNG A;  3FXJ A;  2XAJ A;  4I76 A;  4D5F A;  2XRO A;  1XDU A;  1W5C C;  3ZQI A;  3K6G A;  3I59 B;  3P9I A;  2E1M C;  2KZG A;  4KT5 C;  1MSF C;  4AIJ A;  3RTR A;  2BY3 A;  3CJQ B;  4BE2 A;  2MLK A;  2O3F A;  2VON A;  5LEJ A;  2GXB A;  3QPS A;  1MMA A;  5JVG F;  3GLL A;  4XON A;  1FZP B;  3L2W A;  3FHN A;  4EJV A;  4RGU A;  1KYW A;  3WTV C;  3PIP F;  2WA0 A;  1FEX A;  3HZJ A;  4ABZ A;  3AG4 H;  2PQ8 A;  5J8C A;  2EBI A;  3ISP A;  4NNJ A;  3MZH A;  3UR3 C;  2NVY J;  4HOB A;  2OA4 A;  4BBR J;  3OR2 C;  4IVN A;  4FT8 A;  5CKT A;  1T39 A;  3TBI A;  4XOR A;  2FA5 A;  4OAZ A;  1FYM A;  3PNY A;  1IW7 F;  5E20 A;  4A3J J;  3W2W A;  2K27 A;  3FXO A;  1ZRF A;  4MFE A;  3ZQ7 A;  2HDW A;  4Y7N J;  2OQR A;  1Y8R B;  2RDP A;  2M87 A;  2EFN A;  1YTY A;  4CYD A;  1C0W A;  1R5I D;  4YFX F;  3SEZ A;  4Y17 A;  3AL0 B;  4HYE A;  1TWF J;  5K5R A;  3KET A;  1B6A A;  1B59 A;  2M7B A;  4IHV A;  1BM9 A;  2LF8 A;  4M3E A;  2XAF A;  4FTH A;  1LKX A;  2ADU A;  1L3L A;  4F93 B;  2JVH A;  4G7H F;  3DPL C;  5BPI A;  3EUK L;  5EDN A;  1UZC A;  3K70 C;  5E17 F;  3PSF A;  3BCB A;  4CZZ A;  2DA6 A;  2P5L C;  2P0W A;  2DO7 A;  3HG9 A;  5JVT A;  2Z2S B;  5L3C A;  4OMY A;  1Y1V J;  4A3D J;  3FXQ A;  4C3J J;  2DT6 A;  3CO6 C;  1TNT A;  4RLF A;  3HPH A;  4HF2 A;  2LY9 A;  4IQJ A;  4EJU A;  1XX5 A;  4KDP A;  4PCQ A;  3T8R A;  2LNB A;  2EJR A;  3CF5 F;  1ZGJ A;  3PO3 J;  3S17 J;  2M34 A;  2CQ7 A;  1J7K A;  5ICF A;  1WCM J;  1OYI A;  1Z6T A;  4IQ4 A;  3GTP J;  3GTJ J;  2MYS A;  2XIG A;  1Z21 A;  4NQW A;  2OC6 A;  1O3T A;  4WX9 A;  5E1W A;  4I09 A;  3IWZ A;  2K7L A;  2DOA A;  1TTY A;  3FXR A;  2PJR B;  2YPR A;  1RI7 A;  1XMK A;  3ERM A;  1UHM A;  1TW2 A;  3GZ5 A;  2L9V A;  3H5N A;  5J47 A;  1EH6 A;  3WG9 A;  1ENH A;  1WJE A;  3KIO A;  5BS6 A;  2HI3 A;  5IT9 Z;  2EWN A;  1IGN A;  1TBX A;  2HOE A;  3IH4 A;  2JA2 A;  5J1Y A;  3OS1 A;  1VFC A;  2PMZ A;  2OPT A;  1AWC A;  1MMG A;  1FBS A;  4XKC A;  1BW5 A;  4ANJ A;  2NVQ J;  4PJM A;  1X3U A;  1OCZ H;  3A0H C;  1T08 B;  1JJ8 C;  4NC8 A;  4G12 A;  3WTX C;  1SAN A;  1J2X A;  3ABU A;  3BZ6 A;  3DTE A;  2F4I A;  1ETW A;  1USS A;  4E6K G;  3QPL A;  5E18 F;  1Q1H A;  1D8K A;  2DA7 A;  4R8H A;  1X4P A;  3GZN B;  1QHG A;  3H3V K;  2E2I J;  3Q5F A;  1PP8 F;  1O57 A;  1Z3Y A;  3M7G A;  5BNG A;  1JGS A;  1YX5 A;  3R0J A;  1N75 A;  2A5W A;  2QSH X;  3FM3 A;  3BJA A;  1LFP A;  4CUG A;  2HTS A;  5F1R A;  3IHU A;  2YU9 J;  3TP0 A;  1FJL A;  1QBJ A;  1R5H A;  4KN7 X;  1P4X A;  4A3G J;  4E7H A;  1GXP A;  1B8I B;  2R5Y B;  2YX4 A;  4LJZ F;  2EA4 A;  1IC8 A;  5F27 A;  2QBY B;  2M8G X;  3RJP A;  1YRN A;  1BJZ A;  3C18 A;  4ZC3 A;  4CH7 A;  1F5T A;  3IAS 2;  1VQ8 I;  2ACJ A;  4EM0 B;  1UMQ A;  1HLV A;  1XPX A;  1V54 H;  2XF6 A;  3W2V A;  4XID A;  3PSI A;  2EIL H;  4XM3 A;  5F08 A;  2JA5 J;  1WZ2 A;  4AVP A;  3C7J A;  4XQF A;  2O6G E;  2R7Q A;  4HQM A;  3KYC B;  3VYS B;  5DCM B;  2COB A;  4C2M J;  5GAH J;  2VBY A;  3H9G A;  2HVR A;  1TQM A;  3OMY A;  2P7C B;  5KK1 A;  5KNL A;  4KIB A;  1MBH A;  4RBO A;  1LFB A;  2QEN A;  3BCA A;  2FOW A;  3V8J A;  4CA0 A;  4V19 K;  3DU6 A;  2WAD A;  1TWA J;  3I59 A;  2ZBK A;  3GFI A;  1UHS A;  4EGY A;  3HL2 A;  1HDD C;  2NOJ B;  4XLN F;  3G3Z A;  3DWL E;  3SDG A;  3GTM J;  2UXN A;  2Y2Z A;  5JLX A;  2BYV E;  2NVU B;  3L7W A;  2EPF A;  2HGC A;  5D4R A;  2HYJ A;  4XLF A;  1VQL I;  1JT6 A;  1T6S A;  3H0D A;  3IAM 2;  3BDD A;  1W7P D;  1J09 A;  4ZYG A;  4HF0 A;  2CRG A;  3RKQ A;  4XK4 A;  5FGM A;  2R0Q C;  3QRF F;  3M8E A;  4XBF A;  4U0W A;  1JUM A;  1TQI A;  3KP6 A;  2LRE A;  1H9T A;  2XKO A;  4BUP A;  1X3Z B;  4ZYD A;  2OQG A;  3DP7 A;  4I98 B;  1ZRC A;  4XIC A;  2W82 A;  1QHH D;  2MLG A;  2F4M B;  2NS7 A;  3OYB A;  4KIS A;  3HB9 A;  3S15 J;  2VB6 A;  2FF4 A;  1I1G A;  2V79 A;  3ZQF A;  2CU7 A;  2HXO A;  4DNC A;  3HJE A;  3I4P A;  5DDG A;  1YI2 I;  3PUF A;  4IXA A;  3I4N J;  2Y0S N;  1JUS A;  5DTD A;  4BQQ A;  5D8L B;  2KDZ A;  5F6F A;  4QPO A;  4IHX A;  1VQK I;  1KU3 A;  2XGC A;  4D1Q A;  1JKQ C;  2EIJ H;  3I4M J;  4CSW A;  2LKX A;  1IDZ A;  1W7P B;  4YFK F;  2Z16 A;  2NNY A;  5FLX K;  2R4G A;  4HAM A;  2X6O A;  3GO5 A;  3ZN1 A;  2VIX A;  1VQ4 I;  2STW A;  5IT9 K;  3QP6 A;  2IXS A;  3ONQ A;  2ETH A;  5LGU A;  1HKT A;  2N8G A;  3DF8 A;  3KZI C;  2DA4 A;  2TRT A;  4WCG A;  1UCR A;  3FK6 A;  2HKO A;  4IX7 A;  1ZYR F;  2VC1 A;  4U87 A;  1J0R A;  4G9Y A;  1YIJ I;  1MSE C;  4PJL A;  2KL4 A;  3HSE A;  2CUF A;  2HNH A;  3LSH A;  2L7M P;  3MFK A;  3S3O A;  4Q47 A;  3M4O J;  2X4H A;  4BXF A;  2PMU A;  3G2B A;  1W0T A;  2LY1 A;  3MZY A;  5BQT A;  4TV7 A;  4WXD A;  4CIC A;  4II3 A;  2AQE A;  2IGO A;  2R3S A;  1W1W E;  1JKP C;  2ZC2 A;  2F48 A;  1WJD A;  3BJ6 A;  3HOW J;  1MND A;  3B6A A;  3R60 A;  2PJR A;  3IH2 A;  1YW7 A;  1Z05 A;  1H8A C;  3K0L A;  1LEB A;  4UVC A;  5CVV A;  5L3F A;  4H0E A;  4P5O A;  1IJW C;  4X0G A;  3M8F A;  1ON1 A;  1TT5 B;  1ULY A;  2WAF A;  1W4M A;  4R79 A;  1LNW A;  4IL6 C;  2KFD A;  2IPQ X;  3ABK H;  3TED A;  5F04 A;  1GV2 A;  2M2E A;  3EYY A;  3HOZ J;  1DGR M;  1Y8Q B;  4MHG A;  1D1C A;  4M3F A;  3DU5 A;  5BOX A;  1FYL A;  2PJP A;  3FMQ A;  3GBG A;  4NBQ A;  3CLQ A;  3T8T A;  2L9S A;  1FLI A;  2XAH A;  1SMY F;  4KN4 X;  3VDX A;  2E7W A;  3CUO A;  3MD2 A;  3OSF A;  4HF1 A;  1OCC H;  5FLM J;  3SDB A;  1IV6 A;  2FOK A;  3ECH A;  2OJE D;  5GAE J;  2OUM A;  3KFW X;  3KYL A;  3OYF A;  2EQR A;  1FMV A;  2HFH A;  1XMX A;  3FBI B;  3BQZ A;  1KQ8 A;  2CQQ A;  3CJT B;  4RAF A;  1MBK A;  3VOE A;  4G6D A;  1YHQ I;  4ENM A;  3HPG A;  4MGR A;  3SFI A;  1T8I A;  1D5V A;  2FQ3 A;  2QM3 A;  1RES A;  3J81 Z;  3IRR A;  1B8I A;  4XRF A;  2O8X A;  5EJC A;  2R5Y A;  2QVO A;  2JT1 A;  3LST A;  5FB2 A;  2RAE A;  3FWE A;  5DEQ A;  4RGR A;  4BS9 A;  2QBY A;  5B5E C;  3M8J A;  2WV0 A;  3BPV A;  1P9Q C;  1IRF A;  2KDO A;  2XPU A;  5AIP A;  4J19 A;  1EV7 A;  2DCE A;  3GUD A;  1YW8 A;  3BG3 A;  2ZNZ A;  5H2F C;  1JGG A;  4F92 B;  1SMT A;  4AYB A;  1NTC A;  1VF9 A;  5F0F A;  3EYI A;  4HX8 A;  2M30 A;  1ITY A;  3WGG A;  2CH0 A;  3IWF A;  3BG5 A;  3OOP A;  4WK8 F;  2H09 A;  1OCR H;  4UV8 A;  1IN8 A;  1ZGA A;  1S7A A;  3ZRG A;  3LSM A;  4PZJ A;  5DCM A;  2EIN H;  1TZL A;  4I7H A;  4LIT A;  4KYW A;  3CDH A;  3FZV A;  3HRU A;  2H6B A;  2HZT A;  3CO7 C;  3G1M A;  3CTA A;  5DV5 A;  4NB5 A;  5HS9 A;  3HUG B;  3RPQ A;  2X6Y A;  1OYY A;  1SVO A;  5EEG A;  4BHP A;  1LDJ A;  5M3F J;  1N77 A;  1WJA A;  5FRM A;  1S3J A;  2FML A;  3CMM A;  2JUC A;  2XRN A;  1SEU A;  2COM A;  2IEK A;  1IDY A;  4GO1 A;  4M3G A;  3S2W A;  2Y69 H;  3ZGK A;  2CJJ A;  2XB0 X;  1VQ5 I;  1O3S A;  4P96 A;  1G4D A;  2K3F A;  3KZY A;  5ILV A;  5LGT A;  3DXJ F;  2QZ8 A;  2JA8 J;  2BW3 B;  3OIO A;  4QWQ A;  4B47 A;  4Y3O A;  1RNL A;  2F5C A;  4UUT A;  3BJO A;  4ZZL A;  1ZLK A;  1R6R A;  2ICW G;  3I53 A;  4UVB A;  1JKO C;  2Q1Z B;  3C2B A;  4ESF A;  5FKL A;  2XSJ C;  5ED4 A;  3BR3 A;  2OZ6 A;  3R0A A;  4LFU A;  4L9J A;  1P7J A;  1DU6 A;  2NS0 A;  2Y48 A;  5D6F A;  1UST A;  2M9H A;  3K1P A;  1LQ1 A;  4M71 A;  4XKW A;  2NVT J;  2Z3Y A;  1YS7 A;  4J01 A;  2P5K A;  3S1M J;  5J4V A;  1E3O C;  2IS1 A;  1ZRD A;  4GXO A;  1I6X A;  2HXI A;  2QLZ A;  2LH9 A;  2GXA A;  1ACI A;  4I0B A;  2RRE A;  2M4G A;  2J5O A;  2QGU A;  4Q5S F;  2BGC A;  2IP2 A;  3DCF A;  4D0P A;  1W7P A;  4L5E A;  2EV0 A;  2Z9O A;  2IA1 A;  4Y33 A;  1ZR2 A;  1HQC A;  5EEH A;  1OR7 C;  3QPT A;  3W6K B;  3BZK A;  1T0F C;  3V7S A;  5FO5 A;  3F72 A;  1GXQ A;  2Q8K A;  1PJR A;  1G59 A;  1OJL A;  5IY5 H;  2LK2 A;  1IUY A;  3S1Q J;  1FTT A;  1GVD A;  3OYN A;  4JX5 A;  2W1O A;  3K2A A;  2XDV A;  2ZSH B;  3SFZ A;  4BQN A;  1R4M B;  3NAU A;  5LFA A;  1T98 A;  2W24 A;  1JTY A;  2OCC H;  3LA2 A;  3OWT A;  5TGT A;  1SD6 A;  1K4T A;  2XAS A;  4L18 B;  3G1O A;  4K2E A;  4E7K A;  3BC8 A;  3CP8 A;  2XRL A;  3KLN A;  3CC2 I;  4EVI A;  1S5L C;  1R5G A;  1D3Y A;  4EEF G;  4RGS A;  1KU9 A;  3CES A;  2AXL A;  3MVP A;  4GYG A;  1UB9 A;  2V4J C;  3D5R C;  4ZTJ A;  1MBG A;  3ZCO A;  4ASN A;  1I50 J;  5HLH A;  4FIS A;  2JRM A;  3U2R A;  3F23 A;  2VKH A;  4XN0 A;  1UFM A;  3ULQ B;  1O3R A;  3RI4 A;  1ZHF A;  3PL8 A;  4YEL A;  2K4B A;  1FP2 A;  2CQK A;  4M9S A;  1XGO A;  4L0Y B;  2DJI A;  3L2U A;  3ASO H;  3OR1 C;  3I5U A;  3HOU J;  4XNF A;  1VQ6 I;  3LSG A;  1X1C A;  1F1Z A;  3U21 A;  3OYG A;  4MIM A;  2V26 A;  1D0Y A;  4B09 A;  4MTD A;  3C2H A;  3D5S C;  3K4J A;  4PUS A;  1UEL B;  1Z7L A;  1VND A;  3I56 I;  3E6B A;  2E2H J;  1MMD A;  2W57 A;  4LMY A;  3W6J B;  3WTW C;  5BPD A;  4YEJ A;  2L9R A;  3ZPL A;  1QVT A;  4LB5 A;  5IOZ A;  1WJB A;  3BP8 A;  1GUU A;  2MD0 A;  3GW2 A;  2FBH A;  3TO6 A;  1VQ7 I;  1F9N A;  1VQP I;  3P9K A;  2E2J J;  5GTH C;  4XLP F;  3N4M A;  4I2O A;  2HYF A;  1X58 A;  4FX0 A;  3TW7 A;  5CPR B;  4A3L J;  5EGO B;  3MWM A;  1RR7 A;  4CCL A;  3QOE A;  3G73 A;  1PDN C;  2X51 A;  3PNT A;  4RAG A;  1SFO J;  5JFR A;  4B3A A;  3A0B C;  4O6J A;  1A6Q A;  3ZQC A;  2OCE A;  5JHU A;  1RKT A;  2HQA A;  2DBB A;  5KVR A;  2ZXI A;  4UB6 C;  4RB1 A;  4IF4 A;  2M0M A;  3H92 A;  1OR7 A;  6PAX A; 
#chains in the Genus database with same CATH homology
 3H5A A;  4PJM A;  4NC8 A;  4B44 A;  4B48 A;  3OYJ A;  3S3N A;  1V5G A;  2HVS A;  4XOT A;  4PK4 A;  2WBM A;  4AVZ A;  2F5V A;  3DTE A;  2F4I A;  1X19 A;  4E6K G;  3MMY B;  4XKV A;  3TMO A;  1WJ5 A;  4BGD A;  2QKL B;  1X4P A;  3C2G A;  4QPQ A;  3A1Y A;  4CCJ A;  1V5F A;  4ZYA A;  5JHF A;  4DJA A;  2R7R A;  2VAS A;  1QHG A;  3EPZ A;  1Z3Y A;  3N05 A;  1YX5 A;  1N75 A;  2A5W A;  1W36 C;  1LFP A;  4PSX A;  4CUG A;  1LDK B;  2VJ4 A;  3LMM A;  4H4K C;  1SFK A;  2HPM A;  4E7H A;  3I3L A;  4AU7 A;  4XLE A;  3K4C A;  2VLA A;  4ZTF A;  4HNU A;  3DPT A;  1DGW Y;  3W3C A;  2Q2E B;  4ZC3 A;  4XOP A;  2DT7 B;  4CH7 A;  2R7V A;  3HOS A;  2VXD A;  4E7Z A;  2RQQ A;  3IAS 2;  1BR1 A;  2QKM B;  1UAA A;  4DBR A;  2VJ5 A;  2XF6 A;  3W2V A;  4IZZ A;  2UWM A;  3EUH C;  3PSI A;  4CCM A;  2X6W A;  1YE9 A;  2BW3 A;  4XM3 A;  2KHM A;  4XLC A;  2V9K A;  2R7W A;  2HPI A;  5CQG A;  4GRI A;  4XQF A;  4CCO A;  5FRN A;  4HRI A;  1N78 A;  2R7Q A;  3VYS B;  2R7U A;  4BE1 A;  2E60 A;  3BG6 A;  3H9G A;  2HVR A;  3QYB A;  3OMY A;  5KNL A;  3SYT A;  1OLT A;  2OV7 A;  4P1W A;  2L5Q A;  3BCA A;  4CA0 A;  4BE0 A;  3DU6 A;  2WAD A;  2BVM A;  1BR2 A;  2L9N A;  3KX2 A;  5HOO A;  3VSL A;  4HNT A;  3HL2 A;  5HNF A;  2IGK A;  3LSK A;  4LIV A;  1X1A A;  2NOJ B;  2UV1 A;  3DWL E;  4B43 A;  1D1B A;  4KT6 A;  2IS2 A;  1UG0 A;  2CUJ A;  4XLF A;  1D0X A;  3H0D A;  3IAM 2;  4RMN A;  1J09 A;  2KRH A;  2LYC A;  5HVQ C;  1X1B A;  1YX3 A;  4ITV A;  3KEY A;  3RPU D;  3SEQ A;  3VYT B;  2LRE A;  3DKY A;  2CV2 A;  2KQR A;  2M4K A;  4BUP A;  2FUG 2;  3NWS A;  4PJJ A;  4XMY A;  5CQE A;  4BJT A;  1Y6I A;  2W82 A;  3OL4 A;  1QHH D;  4F55 A;  3OYB A;  1MNE A;  4KIS A;  1MW7 A;  2VB6 A;  3I9V 2;  3K4N A;  2KMU A;  4XR6 A;  2LOO A;  2ZXH A;  2HVQ A;  2MFZ A;  2IS4 A;  1U0J A;  4IKF A;  4II2 A;  2ELJ A;  3H9J A;  4BQQ A;  4QPO A;  4ZJZ A;  4JOM A;  4PJN A;  4D1Q A;  3BLY A;  3PJR A;  2HU9 A;  3QOD A;  1PYV A;  1MMN A;  5KCM A;  2O5R A;  2M3A A;  4CSW A;  4YRV A;  2VQL A;  3UNG C;  2Z16 A;  3DQV C;  2R4G A;  2VIX A;  4JQF A;  3D5L A;  2IXS A;  3ONQ A;  4RLQ A;  2LC2 A;  2VQH A;  3RCO A;  2UUZ A;  1AA7 A;  4LIU A;  4LG3 A;  2X1D A;  2XC7 A;  4N4O B;  3L2V A;  4IX7 A;  2L7K A;  1LVK A;  4U87 A;  3QYE A;  2MC4 A;  3S32 A;  4PJL A;  2KL4 A;  2X1E A;  1IRX A;  3OOU A;  3VYR B;  4BDY A;  4BDZ A;  2HNH A;  3E0J B;  1ZEL A;  3LSH A;  4HST A;  3NWT A;  3FBN B;  4EAT A;  3IUO A;  3S3O A;  4BXF A;  2R7T A;  4C30 A;  3G2B A;  2CV1 A;  3W2A A;  2WY8 Q;  2LY1 A;  3K4L A;  3OYA A;  2XF7 A;  4II3 A;  3DTK A;  5HLT A;  2AQE A;  2W00 A;  3VSK A;  2IGO A;  4PFO A;  3OY9 A;  1G8X A;  4XLA A;  2V6E A;  3K4K A;  1WJD A;  3J7A Y;  4MLO A;  1MND A;  4DOZ A;  2LBF B;  4F3Q A;  2PJR A;  2CUZ A;  1E0E A;  3TL4 X;  4BEH A;  1VZ0 A;  4CCK A;  5FRO A;  4P5O A;  4X0G A;  2WAE A;  2KLO A;  2JSP A;  1WJF A;  1Y56 A;  2WAF A;  3IP4 B;  4R79 A;  3FDY A;  4BJ6 C;  4E4H A;  2Y0S A;  4KIT B;  3E1S A;  3H5R A;  3OYD A;  3DTI A;  1DGR M;  4CZC A;  1D1C A;  3H35 A;  3DU5 A;  3GBG A;  2WY7 Q;  2K5C A;  2L9S A;  4BL0 B;  4B3X A;  1GLN A;  4NQW B;  2HZD A;  2R7O A;  2LRD A;  3HXL A;  3MD2 A;  3RSN A;  3VDX A;  4E7S A;  1KON A;  2E1M B;  2KP6 A;  3EUA A;  3LFU A;  3SDB A;  1WJC A;  2CS3 A;  2OUM A;  2E5Z A;  3ZR8 X;  3KYL A;  4ZDL A;  2GOX B;  3OYF A;  3OIP A;  3OYL A;  1FMV A;  2KZV A;  3FBI B;  4RM2 A;  2ZSI B;  4C2T A;  1Z3X A;  3K4B A;  3K10 A;  1DQU A;  2BVL A;  3HPG A;  4D9J A;  4CCN A;  2AQF A;  3S8P A;  3K70 D;  4ZDO A;  2VKD A;  2K9M A;  4F91 B;  4BS9 A;  3M8J A;  3PFY A;  4HEA 2;  1P9Q C;  2KDO A;  1V5E A;  4XLH A;  2DCE A;  2KPM A;  3A4C A;  4XKC A;  2M7A A;  4Y4R A;  4AYB A;  4F92 B;  1D1A A;  2WAQ A;  3HKZ A;  3L2Q A;  2A6T A;  3S3M A;  2CH0 A;  2VQG A;  3OYC A;  2W7N A;  3OIQ A;  3ZRG A;  3LSM A;  2CW7 A;  3M1C A;  1TZL A;  3AFH A;  4LIT A;  2GOM A;  2VJI A;  3DLA A;  3MKW B;  1NG6 A;  3RQ4 A;  3VWB A;  3BG7 A;  2CFO A;  3HUG B;  4PFP A;  2X6Y A;  4NUB A;  1N77 A;  3OYM A;  1WJA A;  4DIQ A;  5FRM A;  3CMM A;  2XAU A;  3F9K A;  4KJZ A;  1SAU A;  4HSR A;  1HA8 A;  2E5N A;  2VQC A;  2IGN A;  3HOT A;  3QYF A;  3ZGK A;  3PUB A;  2V7F A;  3CP2 A;  3MKY B;  3OYE A;  2BW3 B;  2WB1 A;  4DBQ A;  4B47 A;  2VPL A;  4Y3O A;  2VJJ A;  1R6R A;  1TT0 A;  4BJ5 C;  3AKZ A;  2Z1D A;  2Q1Z B;  2L2O A;  2V1N A;  3ZQQ A;  2F6C A;  4E7I A;  2XSJ C;  5LD2 C;  2RNG A;  2R7S A;  4PSW A;  3K6G A;  1ERD A;  2E1M C;  2JVG A;  5HNH A;  2W4S A;  3RTR A;  2CW8 A;  3CJQ B;  4XKW A;  4BE2 A;  3SZG A;  4J01 A;  3OYH A;  1QU3 A;  1EA3 A;  1MMA A;  1W36 D;  2IS1 A;  4XON A;  3AL0 C;  4OAY A;  3L2W A;  2I8D A;  3FHN A;  2LH9 A;  1BOB A;  3OYK A;  2RRE A;  2M4G A;  2WA0 A;  2IS6 A;  4Y33 A;  3VYU B;  2X85 A;  3LSI A;  3V42 A;  4NNJ A;  1OR7 C;  3K4M A;  1T0F C;  3H9Q A;  3UR3 C;  3OR2 C;  1PJR A;  1G59 A;  5CKT A;  3S93 A;  3TBI A;  4XOR A;  4HPQ A;  4OAZ A;  2LY2 A;  3PNY A;  3W2W A;  3OYN A;  3FKJ A;  2W1O A;  4OWR B;  4F52 A;  2XDV A;  2HDW A;  2XF5 A;  1K6Y A;  2ZSH B;  3CZ6 A;  4BQN A;  5LFA A;  4DGW B;  1T95 A;  2BOL A;  3OWT A;  5TGT A;  2K3P A;  4XL9 A;  4E7K A;  4G6T B;  3BC8 A;  3CP8 A;  4U7B A;  2IGM A;  3SEZ A;  4N4N B;  3LL7 A;  3AL0 B;  3CES A;  4ZDP A;  3OYI A;  2V4J C;  3D5R C;  3ZXS A;  2M7B A;  4ZTJ A;  3ZCO A;  4J00 A;  3L2R A;  2CV0 A;  1LKX A;  2VKH A;  4XN0 A;  4F93 B;  2JVH A;  1D0Z A;  2LBF A;  3DPL C;  2KRC A;  4RM3 A;  3EUK L;  2DXI A;  3K70 C;  3PSF A;  3BCB A;  3PL8 A;  1DP3 A;  2P0W A;  4YEL A;  3HG9 A;  4XN3 A;  2VL8 A;  2Z2S B;  1X1D A;  1JI8 A;  5KHD A;  2X6X A;  2CMP A;  2DJI A;  3A2K A;  3L2U A;  2MAB A;  2VXZ A;  2DT6 A;  3OR1 C;  4RLF A;  4XNF A;  2LG4 A;  3HPH A;  4IQJ A;  3LSG A;  1X1C A;  4XKB A;  3U21 A;  2X1C A;  3OYG A;  2V26 A;  4BU2 A;  1D0Y A;  4NC7 A;  3C2H A;  3D5S C;  1BR4 A;  3K4J A;  4PUS A;  1UEL B;  1Z7L A;  1X4O A;  3OS0 A;  1MMD A;  4BAC A;  4YEJ A;  4BQO A;  4HG2 A;  4IQ4 A;  3HC7 A;  3OS2 A;  2MYS A;  2ZFU A;  1Z21 A;  1WJB A;  2OC6 A;  3DPU A;  2MD0 A;  2DOA A;  3CF2 A;  1WFX A;  4FET A;  2PJR B;  2JUG A;  3DKX A;  1FMW A;  4BEH B;  4C2U A;  4E7J A;  5CPR B;  4FAS D;  4CCL A;  2K9L A;  3QOE A;  3H5N A;  2X51 A;  3PNT A;  1NG7 A;  2R7X A;  4C9Y A;  1WJE A;  3PNV A;  4E7L A;  2HQA A;  2JA2 A;  3OL3 A;  2ZXI A;  3DEE A;  3OS1 A;  2PMZ A;  1MMG A;  1S9H A;  2M0M A;  3CJR B;  3MKZ A;  4ANJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...