2M4GA

Solution structure of the core domain (11-85) of the murine norovirus vpg protein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
75
structure length
75
Chain Sequence
GRPGVFRTRGLTDEEYDEFKKRRESRGGKYSIDDYLADREREEELLERDEEEAIFGDGFGLKATRRSRKAERAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Murine Norovirus VPg protein
publication title Structures of the Compact Helical Core Domains of Feline Calicivirus and Murine Norovirus VPg Proteins.
pubmed doi rcsb
source organism Murine norovirus 1
total genus 17
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2013-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1910 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2m4gA00
2M4GA
chains in the Genus database with same CATH superfamily
2NS7A 4C2UA 1S29A 3FM3A 1MJBA 3EUHC 4CCNA 5GAEJ 4W1UA 4N9HA 1Z67A 4IO9F 2PX9A 4CYCA 4MEYF 1XGNA 3HDDA 4AUXA 2HVSA 2R5YB 1VQPI 1IV6A 1HKTA 2KQRA 1VF9A 2VE9A 2XAFA 1A04A 2DTZA 3TGNA 1FYMA 4CGZA 1OJLA 1SEUA 4A3LJ 1QRYA 5CVVA 3QPHA 1X3WB 1Y1VJ 2OCCH 5B5EC 2RN7A 3HOXJ 1EH6A 1AKHA 5F1JA 5C44J 4YG2F 1YI2I 4UHTA 2Q1ZB 3FBNB 4G12A 4XNFA 2Y75A 2BBYA 4EJOA 4L0YB 1UAAA 3L2VA 2TRTA 4ESBA 4RLQA 2OD5A 3SFZA 1ZN2A 2L5QA 4AC0A 1SANA 2HDCA 2W57A 3ZMSA 1U8BA 2VKVA 4NUBA 1FX7A 4BAYA 4B47A 3JRBA 5CPRB 3BZCA 1U8RA 5C4XJ 4GGGA 2OQRA 1V54H 1UELB 3QAHA 3CMAI 3S1RJ 2GM4A 2ISYA 1X1BA 2PG4A 3R61A 1DPUA 3D5LA 4ESFA 4NNJA 2ZXHA 4A12A 2M7AA 3FXQA 4G6QA 2WB1A 4U0VA 5EG0A 1O57A 1XTAA 3JRHA 2LK2A 3HOSA 2WBMA 4CXFA 4XM3A 1LE8A 4C3IJ 2LKSA 2V1XA 3PSFA 1F43A 1I5ZA 3BG9A 2YUSA 3CJRB 3TO6A 2IGNA 4PFPA 5DYMA 2VQHA 4I6ZA 1YW8A 2XC7A 4IOCF 2JA5J 2ZC2A 4KN7X 3HBLA 3ZR8X 1Z6RA 5EGOA 4HRIA 2LKXA 2YU9J 5TJJA 1XD7A 4IHYA 2W25A 3CDHA 4O6JA 1UHWA 1IDZA 2QA4I 3VSLA 2HEOA 5CQGA 5EF6A 3CMYA 3OYBA 1IN5A 1FTTA 3BG6A 5AIPA 3C2BA 2FNPA 1QBJA 3LQQA 5LLQA 4I02A 2ZFUA 3ONQA 1IJWC 4PK4A 4IRGA 1G3WA 2HOSA 3TP3A 1LDDA 1I1GA 4B3AA 4BGDA 3MMYB 1ETVA 3M4OJ 4PUSA 2K9MA 1HCRA 3BR2A 2L01A 1YG2A 1D0XA 1K78A 4OMYA 1ZKGA 3HM5A 3I4NJ 4IEJA 3HPHA 1KYZA 2QBYB 1N78A 3G2BA 2WAQN 2LBFA 2LVSA 1BL0A 3MD2A 1ORKA 4E7SA 3DU6A 2F5EA 4BQNA 1WJDA 2W85A 1WFXA 4IZZA 4HDUA 5GP9A 4XBFA 4D9JA 1NTCA 2FNAA 3ZPLA 3HOWJ 2E1MC 4P9FA 4RGRA 2EZLA 2QLZA 3AG1H 5KHDA 4QIWN 3HJEA 5C3EJ 1SFOJ 2YS9A 1WRJA 5DV5A 1YHQI 1IUFA 4U7DA 2HYFA 3QQAA 1R5GA 4J19A 4U88A 4KICA 1P7IA 2IT0A 5L3DA 1MH4A 3RYRA 2CUZA 4IJAA 1SFKA 2K5CA 3HUGB 2ZKZA 1UFMA 3E6CC 2P6SA 4FTHA 3RJPA 4ZYHA 2M5WA 3HRMA 2HQNA 3K1NA 2M0MA 4RS8A 1V5FA 1PP7U 2JPBA 3RQIA 1BM9A 4OOIA 1BA5A 3I64A 4G7HF 2E2IJ 2DODA 3N97A 3BTIA 4RMNA 5EEGA 1BC8C 3TOAA 2PJPA 2BGCA 2R7SA 1KONA 3CUQB 1OYIA 2V9KA 1YS6A 3R4KA 1U9OA 3W6VA 1O7FA 1J59A 2BOLA 5F6FA 1LQ1A 2F4MB 5LGUA 5ICEA 3JSOA 1RETA 2LC2A 3JAMZ 5IY5H 1LPQA 2HPIA 3BT9A 3F8FA 3WTUC 4A5NA 1XG1A 3PFYA 2L7ZA 3MKLA 3IH4A 2HOEA 1JJ6C 2GA1A 3S1NJ 2O9LA 2FX0A 1RZ4A 2K4BA 3KYDB 5D6EA 2KL4A 4HSRA 2FQ3A 3ZN0A 1G4DA 1P92A 3K6GA 2K9LA 3BJAA 2ZCWA 2XPVA 2Z3YA 5DCMA 1W5CC 1RUNA 2V7FA 1MH3A 1BR1A 3T8RA 1SD6A 4CCKA 2J5PA 3H3VK 4ENJA 1TWCJ 2CFXA 2JA6J 2ZXIA 4I7HA 2VQCA 3GBGA 1Y56A 2RV8A 1W36C 5DUIA 2LSOA 1JUSA 1XCVA 4G7OF 1RESA 4I76A 2IGMA 3S2WA 1S3JA 2LY2A 2KZGA 2GXBA 3ZP5A 4XKBA 5JR3A 5ILVA 1JT0A 1HSTA 2QSHX 1KQ9A 3SDBA 4BU2A 3KLOA 4XQFA 2B9SA 3DTIA 2X1EA 4G9YA 1JHHA 2VONA 1A6IA 1J5YA 2Y30A 3GFLA 2PMUA 1Z21A 1ZG1A 1GXQA 1IAWA 1T0FA 1S72I 4LITA 3V8JA 3PFIA 4BDZA 1YJ9I 2KHMA 2VLAA 1VZ0A 4GYGA 4D5CA 5K7HA 4HV6A 1MDMA 4EEFG 4DQ2A 1X1CA 2H6BA 2XUBA 3OYEA 2JSCA 2P6TA 2Z2SB 4XMYA 2G7HA 4L5IA 3WTTC 3QP5A 2BE5F 3Q3SA 4D5FA 2QKLB 3SEZA 2XF6A 3HRUA 2EINH 4KA4A 4A3JJ 3LWFA 2HVRA 3P9CA 3OYGA 2A5WA 5D5WB 2PBIA 3RI4A 1ZREA 2ZNZA 2K9QA 1NG6A 5L3CA 2X9DA 2EFNA 2IA1A 2HS5A 4Y7NJ 4KISA 4M3GA 1BI3A 1UJ8A 3WGGA 2M30A 1MMNA 3BY6A 2YX4A 3LAJA 3SDGA 4UV8A 2BXZA 3HPGA 1EH8A 1KGSA 2M7BA 1Z05A 2VXDA 2KPMA 2Y9YA 1ETXA 2QZ8A 3GTJJ 4Q5SF 1IUYA 4CCJA 4BJ5C 4M6VA 4XK4A 3U1KA 3LNQA 4Q48A 1HW5A 4H4KC 2NS0A 2XKOA 4D1QA 4FQGA 1HKSA 1U6GA 2EJRA 4JYKA 4F91B 2FMLA 2DFIA 3SJMA 1ZG5A 2DOFA 3S3NA 2QSFX 2E35A 2VQLA 3CDLA 3FF5A 1FOKA 1MBFA 1SAUA 1DU0A 3C18A 4QSHA 1WGXA 1VQOI 3CC2I 1X2NA 4L9NA 5LGTA 4PJLA 4PJMA 4KIBA 5TISC 1RC9A 4RB3C 1ZR4A 3BC8A 1I27A 5FD5A 3MFKA 2VJIA 3B73A 1G3YA 3HGGA 4I99C 1APLC 1TTYA 1VQLI 1MKMA 4QPQA 4XRMA 1R71A 5K5QA 3M8EA 4ENNA 3QP6A 4QWQA 4XORA 2DJNA 2NXNB 3K4NA 2CG4A 3ZMVA 1SVMA 2VPRA 4L18B 3IP4B 3PIPF 1B8IB 1O3RA 3PQJA 4MLOA 2CW0F 3PNTA 1IN7A 2GIVA 2IS4A 2BW3A 1YE9A 1HKQA 2Q2EA 4M74A 4BE0A 2EWNA 1JUMA 4P96A 1FOYA 2CW8A 1FP2A 3CUOA 2DA1A 3QYBA 3I55I 2X51A 2GZWA 4MFDA 2LD5A 4CA0A 3RQ4A 3CCUI 4XLCA 4C30A 3K4KA 1S5LC 2DXIA 2K27A 2JRTA 1ZLJA 3HB9A 4RAZA 4LLLA 4B09A 2IRFG 2L9RA 3ABMH 3I59B 1TT0A 2LY1A 3QOPA 2PMZA 4RM3A 2WV1A 2KMUA 3H5NA 3SXYA 3S8PA 1K6YA 2HQAA 4LK1F 4NC6A 2GIZA 1XMAA 4IL6C 5ILSA 3H5AA 3MCZA 1S7EA 3HOTA 4KMFA 3DXJF 3ECOA 1E17A 1ZGJA 4YEJA 3TDZC 3HOYJ 1V5EA 2L0KA 3V7CA 2MABA 3K4BA 3EETA 2MW8A 1Z1DA 4ENMA 4NC7A 3F8MA 4XLHA 3HHGA 4CZZA 5AIQA 3TKYA 3CC7I 2GA2A 2NVQJ 2OV7A 2O8KA 1PVEA 1IZ1A 3JREA 3T1BA 2XAQA 2Z33A 4IHSA 1QHGA 1X1DA 1WJEA 2A6HF 4OIRF 3L2WA 1WI3A 2JWTA 2RQQA 3Q0VA 1V4RA 4EATA 1MBEA 4BE1A 4B43A 3MZYA 3FXJA 4JP0A 1HDDC 3G6EI 2CQKA 2M4GA 4LFUA 4D0PA 3VFZA 1FBSA 5CVUA 5HLTA 1W7PA 4ZDOA 2V79A 3GTPJ 3C1DA 4I2OA 2E7XA 4HQEA 1FTZA 4Y33A 2WC2A 1WJ5A 5FO5A 1J9IA 1BI0A 2HKOA 3DP7A 2IGOA 5EJCA 3L2CA 2J5OA 1BIBA 5F04A 4N4OB 2Z9OA 4FX4A 3BR6A 3O6BB 4RB2C 1P4XA 1B59A 4CCOA 2RGVA 2JRMA 2K9NA 3B6CA 3DLAA 4GRIA 1BI2A 1BR2A 2DDAA 3SFIA 3SEQA 1SFEA 5L3FA 3S3OA 4HF1A 3ULQB 1U3EM 2AHQA 2Z1DA 3W6KB 4HZFA 5ERIA 1RKTA 2ZJQF 2NVTJ 3S2HJ 1Z0XA 2JT1A 1MZBA 3JTGA 4PGGA 3IKTA 3T0YA 2EA2A 4BBSJ 1ZARA 2V26A 4UUSA 2BY1A 2H1LA 4OIPF 2HXOA 1JKQC 2Z5UA 5LHHA 1H0MA 2VUMJ 4F93B 2YPRA 2IS2A 1N75A 3S15J 4XSZF 2UXXA 2HKXA 3GXOA 5IP9J 5M3MJ 2HTSA 3CUQC 2NAZA 1IDYA 4B44A 1LB2A 3N05A 3I0TA 3GWZA 3CJQB 5FLXK 1T6SA 1KU7A 3GFJA 4BHCA 4G7ZF 4E6KG 3Q5FA 1TQPA 1DPRA 4U0YA 3GLLA 3ABLH 1TWHJ 2ME6A 2AQFA 1MBGA 2W1OA 4ZZLA 5K5RA 1H89C 1TT5B 3SQNA 2B63J 3VOEA 3P9KA 2M8EA 3NRVA 2XDVA 1MJAA 2QM3A 2VXZA 1DGWY 2ECCA 1OQYA 1TWFJ 5HS8A 2MH9A 1ZH5A 1R22A 1ZAOA 2MYSA 5FLVA 3ZQIA 5DTDA 2JA7J 5LBQA 1RUOA 2DYSH 1QA6A 1MBHA 2ZJ2A 4LLNA 4IHTA 2F2EA 3BR3A 2VOPA 3F23A 4A93J 5A2QK 3CP8A 3PUFA 1O3QA 4I01A 4RB1A 2ZBKA 2K9SA 3WTXC 1U2WA 2L9NA 5IYDJ 1FIAA 4A0ZA 3BTCA 5J47A 1FJLA 1FSHA 2IXSA 1GHCA 4ITVA 3FHZA 3I56I 2QQ8A 2E5ZA 1I3AA 2LLKA 2L54A 4KIFA 1KU3A 1HBXG 4I09A 3JTHA 1N25A 4IX7A 2C6YA 4A3FJ 4P55A 3W2WA 1QU3A 5E20A 1XGOA 1KU9A 3K1PA 2WWYA 2CYYA 3HRTA 2VASA 2KJBA 4E7JA 3B02A 1W0UA 1TZLA 2OZUA 2COMA 2JMWA 2DT6A 2O8XA 3CLOA 1V55H 2XF5A 2CO5A 4EV0A 2DA5A 3F6OA 3RKYA 3ECHA 1YRNA 3L09A 2EV6A 3IAM2 2CSOA 2O0YA 1GLNA 3OWTA 1FC3A 2ZJPF 2VKEA 1XS9A 1IW7F 1XPXA 1K79A 3B6AA 2WB1N 2CUEA 3R0AA 3F9KA 3IWZA 2V1NA 4LOCA 4UUVA 2PLYA 3CP2A 3QOEA 1T95A 1R4NB 2ECBA 2XGXA 5B66C 3G1LA 1UB9A 4B48A 1TLHB 2BYVE 5D8KB 1PP8F 1OFCX 2HTJA 2YU3A 5E1ZB 1X4OA 3OYDA 2IPQX 3QPTA 2H6CA 2MA3A 3AAFA 2A3SA 1P4AA 2FBKA 2XRNA 1J0RA 1HDPA 3BR5A 3ML6A 3OMYA 4ZYAA 3IL2A 3DTKA 1NH3A 5IT9Z 2HXIA 3GLXA 4QPOA 2EZIA 3QODA 2R7TA 5GAGJ 3CCMI 1U9NA 4OAZA 1X2MA 2ZXWH 4LB6B 5LD2C 3GTLJ 3DWLE 2NNNA 2RAEA 3GZNB 2KLOA 1FLIA 1MMAA 2HOAA 4GO1A 1RI7A 1FNNA 2W4SA 2CQXA 2IP2A 4BJTA 3AG3H 3QWLA 2DTRA 2Y9ZA 1LFBA 1MMGA 2TDXA 4M3EA 5K1YA 1MD0A 2ZO4A 3CD6I 1QPMA 3KX2A 3C3WA 2E1NA 1X1PA 1SAXA 3GF2A 3WU2C 1R6RA 4EJUA 1AWCA 2M0CA 4E7LA 1QNTA 2DT7B 1KQ8A 1ZK8A 3ZQGA 2DN0A 1SD4A 5D8LB 2R5YA 4R79A 1FEXA 4IOAF 1R4MB 2VKHA 2PN6A 1E2XA 3GCMA 5EDNA 1FOWA 9ANTA 4U87A 4ENKA 2VJ4A 1IO2A 4BQAA 4BYYA 1LDJA 2HPMA 1O7LA 2UV1A 2LH9A 2XGCA 3JRFA 2E1OA 2L2OA 3FMQA 5E3NA 2LR8A 1QQIA 4BACA 2YX7A 3GTKJ 4B4CA 3IH2A 3IWFA 4IHWA 4BXFA 1K7AA 1MSEC 3DKYA 5F08A 2QQ9A 1P6RA 4XRFA 2CQQA 2GLOA 3TW7A 2R7UA 2FA5A 2EB7A 5LHGA 4MQVA 3HZJA 3GX4X 1WJCA 1N77A 3RYPA 3FXOA 3UR3C 4A0YA 3OS1A 1G8XA 3KP5A 2OAZA 4WWCA 4NQWB 2IA0A 1MNDA 2JK3A 2F48A 2VIXA 5FROA 4BJ6C 2E36A 4E70A 2DA6A 3V7SA 1F36A 2GXGA 4DZJA 1JI8A 3BTLA 4ZTFA 4WK8F 1SC7A 3J80K 3FXLA 4LG0A 1A36A 2X1DA 1H88C 5HLHA 2X1CA 2CQ7A 1R1VA 1A6QA 1WVRA 4FT8A 4ZH4F 4MEXF 4CDGA 3I9V2 3S16J 1RRJA 3MEXA 2Z16A 1R5HA 1JHFA 1ZRDA 2LREA 1TQMA 1YX5A 2AO9A 4XIDA 3CESA 3RKXA 4C2TA 4X1EA 3HTUA 1IN4A 3BOQA 4BHBA 1U0JA 3FKIJ 4X0GA 2DBBA 2GOXB 4A0XA 1HOMA 1L0OC 4PDKA 2XSJC 1S7OA 1ETQA 2ESHA 3KZIC 1XN7A 3FWEA 2XGEA 4M9ZA 4EVIA 3CF2A 5H2FC 2PJRB 3GFIA 3FX3A 1QVUA 5F64A 2QBYA 3CCSI 3EYIA 4HOBA 3PIOF 2M4KA 3GTMJ 1GV5A 4BUPA 2VJJA 3GZ6A 3M9AA 2BVLA 2V1DA 5HDGA 1X4PA 2F4IA 1ZLKA 1NG7A 1QZEA 3EPZA 5EEHA 2LDUA 3X2QH 2EFQA 5E1WA 1AHDP 3HOUJ 1UMQA 3DKWA 4XLAA 4XN0A 4YRVA 3RPQA 1FBUA 1X1AA 4BQQA 2UZKA 2EFOA 2KIFA 1E3OC 4DBQA 2E60A 3M1EA 2CFOA 2DOAA 2XPWA 4KJZA 1Y1WJ 4A3CJ 2B0LA 2X6WA 1FMWA 2KZVA 3BLYA 2EIMH 3BTJA 4U7BA 1IN6A 2A6TA 2ZMEB 1XX5A 1EV7A 1VQ6I 4FCYA 4AIDA 2HZDA 1D1AA 2EPFA 4JQFA 4XKVA 1HLVA 1B9NA 3EYYA 1P7JA 2BY2A 2DOEA 5TGTA 4DBRA 5EYRA 4BXXJ 3H9JA 1Z77A 4RBOA 3CUQA 4IQJA 3CO7C 2VBWA 5JLWA 2FOKA 4M72A 5D5UB 1XMXA 3OYHA 1F4KA 3GTQJ 2V9PA 4Y17A 1F9NA 4CYDA 4PSXA 5DD4A 1VQNI 2DMNA 5LRRA 3UNGC 2DI3A 1FMVA 4LB5A 4FASD 1BW5A 2MH2A 3JSPA 5FKNA 3C7JA 5KCMA 1B6AA 3CC4I 2EZHA 3RZDJ 1VTNC 3QU6A 3ABTA 3SZTA 2FQ4A 2DDBA 3E3VA 4OIOF 3LSMA 1ETYA 5BNGA 4KN4X 4KT6A 4RDUA 3KP2A 3PO2J 1O3SA 2O7OA 1SVOA 5IPAA 1BW6A 4Y4RA 5D4RA 4WCGA 1UG2A 2WY7Q 2XGDA 4JBAA 5JVTA 1DUXC 1VNDA 1OPCA 3TQNA 4AM3A 5L3GA 5KVRA 2ZSHB 3JCUC 1ZRFA 1BOBA 1W1WE 4UB6C 4RGXA 4Y15A 4A3EJ 4WXCA 1TL8A 3LL7A 4II3A 2STTA 4BEHB 3O8HA 1EJ9A 3W2VA 1ENHA 2XAJA 1OR7C 4S05A 2DMPA 2R0QC 3DKXA 3FDYA 2KFDA 2XIGA 4HAMA 1MW7A 4NC8A 4MHGA 3HTSB 2LNBA 4ZJZA 3MKYB 2JQ7A 2DFEA 3DBLB 5BS6A 2HOTA 4ETSA 1SD7A 3TOBA 1CF7B 4Y52J 1AU7A 3MVPA 4RB0A 2O3FA 3JRIA 1HW1A 2ICWG 2BVMA 2P7VB 4PGHA 4BBRJ 2HQRA 3BQZA 3F8CA 2FU4A 3E97A 3BROA 4KNYA 1HC8A 3KYCB 1IXSB 2MFZA 2WTEA 2KP6A 2I5UA 3K7AJ 4JOMA 2PMZN 4BQOA 5GPCA 4L5JA 2NOJB 3JR9A 1KU2A 2DMQA 3LQRA 2IS1A 2KIMA 1IRFA 2AXTC 3HYIA 3OOPA 4ESJA 1TW3A 2Y2ZA 4OWRB 5FFZA 3DU5A 2Y69H 4HSTA 2QENA 4YFXF 2W7NA 5D4SA 4UNOA 2H8RA 3BG7A 3KPHA 4EGYA 3BG5A 1YW9A 3QPSA 1RR8C 3LOCA 3K10A 6PAXA 3A0BC 3H9GA 3ZGKA 1LFPA 4MIMA 3RKQA 3S3MA 1G59A 1W7PD 1YLFA 3LSRA 5JFRA 4C3JJ 2P5LC 2MG4A 1PUFB 4LJZF 1RR7A 2XHKA 2QSGX 2O61A 1DQUA 1MNEA 4RAYA 4MTDA 4E7HA 2CGPA 4YFNF 3A03A 3H1CA 3RPUA 5FLMJ 2GWRA 3LSKA 4MGRA 3DQVC 2VJ5A 3N4MA 3IH3A 3A0HC 1X3UA 1VQ8I 4DYQA 1Y39A 2OBPA 4PCQA 3D5SC 3MKWB 1WJFA 3PSIA 3AG2H 1YW7A 3E6MA 2R93J 3GO5A 3M3YJ 5F0FA 5M5XJ 3OS2A 2JPCA 1VQ9I 3LFKA 4F55A 3FXUA 3ZCOA 3K2ZA 3V8LA 1KQ0A 4ABZA 2E2JJ 3VSKA 3DV8A 1TWGJ 1R49A 3I4PA 1LKXA 1UZCA 5L3EA 2O6GE 2XAGA 2Y31A 2XAHA 3FMRA 3Q9SA 1X58A 4UV9A 4CO8A 2BEOA 1BI1A 1JKOC 2F5CA 3OL3A 4FX0A 2LRDA 3VYSB 4HG2A 3RDIA 3NWSA 4N4NB 3HHHA 5HODA 1B8IA 2R7OA 3KETA 4A3KJ 2OTJI 3DPUA 2RNJA 2CU7A 5FFXA 5GADJ 3E5UA 4D7MA 4QLCU 2OF7A 2M87A 4ZYGA 5BPDA 2K02A 3WTSC 5J1YA 4UUTA 1OCCH 4Y13A 4RAFA 5F27A 3JRDA 3K70C 5DM7F 2L7MP 4I0AA 4XLFA 3DBRB 3OYLA 1J75A 2HDWA 4HA8A 3FISA 3U9GA 3HL2A 2Q2EB 3OR1C 4CHUA 2KJCA 2DPDA 3J81K 1BR4A 1UHSA 2EIJH 1IRZA 1ACIA 1Y8QB 3I59A 2WA0A 3C2HA 3TP0A 2CW7A 4L9JA 4NB5A 5CVJA 3HG9A 2N8GA 1TBXA 3PJRA 1D8KA 1V3FA 3E1SA 2E19A 5B1BH 3TW6A 2FOWA 3Q9VA 3KEOA 3ESWB 1T39A 5E1XA 4KIGA 4ZYEA 3OYMA 3RKWA 3ZQCA 2VPLA 2NS8A 2FJ1A 2DA4A 2IA2A 2V4JC 1RKWA 1WI9A 2EV5A 2XKPA 1S8NA 3LSIA 2FSWA 2KKOA 2ETHA 4U0WA 4E7ZA 1OISA 4AWXB 4YIFA 4ASNA 3BPXA 3ZQQA 1Y0UA 3WTVC 1GVDA 1F1ZA 4IQ4A 1W36D 3BZ6A 4QTRA 5CKTA 1XGMA 1R5ID 1OYYA 1R23A 3E0JB 3K1MA 3F21A 3MAJA 5FJ8J 1IGNA 5GAHJ 3VYUB 2BY3A 4FETA 1ZHFA 3CMMA 4HF2A 3OYAA 3H9QA 2PFBA 1G3TA 2P0WA 3L9FA 2H8WA 2X6OA 2XASA 2VT2A 4XSXF 2NOGA 2O03A 5DD8A 4ANJA 3AKZA 4A5MA 1VQMI 3MN2A 1REPC 3ZMTA 4HX8A 5IT3A 1R1UA 2P8TA 2IJLA 3RSNA 4PZJA 4AIJA 2M34A 1KA8A 5CYVA 1JE8A 1WH5A 5M5WJ 3S93A 2DK8A 3HSFA 2IVMA 1FYKA 1GDTA 2XF7A 3F3XA 2P5VA 2WV0A 4AD9A 3H0DA 3GFMA 1DU6A 3HSEA 2NVYJ 4M3FA 2M2EA 4NDLA 3ISPA 2PMHA 1JUPA 3V7RA 3KLNA 4EMSA 2Y0SA 4AIKA 3E7LA 3KP7A 1FY7A 1IRXA 4YIIA 3MZHA 4V2GA 3KYLA 1JXSA 1ETWA 3FZVA 4F92B 3J7AY 2JA2A 1JGGA 4L5EA 2R7FA 3OV8A 3SYTA 2VKDA 3KP4A 2ME0A 4A2UA 1CGPA 4ZZDA 3FHNA 1D8JA 4IPAA 4F52A 2IGKA 5J4VA 1MMDA 5JI6A 3DLLF 3GTGJ 2OPTA 1Z9CA 2DT5A 3F72A 5M3FJ 4BKXA 4UY8I 4M6XA 1HXDA 3U21A 5K5OA 5JLXA 1BIAA 3CO6C 4LG3A 2DA7A 2X6XA 1SD5A 2R92J 4HQMA 5BQTA 4OIQF 4A3BJ 2E5NA 2V9VA 3DPLC 4K2EA 5ICGA 1JTXA 3K4CA 4BHPA 4DNCA 5ICCA 3VWBA 3LA3A 3WODF 3A01B 3GTOJ 1I1SA 1RIOH 3PNVA 5BOXA 1JT6A 1ZGAA 2DO7A 4BS9A 1YX3A 3GUDA 3GVAA 3CCRI 3FK7A 4JX4A 3HRSA 2KRHA 3CLQA 3EDPA 4EGZA 1H8AC 2KDZA 1WPKA 1OCRH 1WJBA 2I10A 1PDNC 2ELHA 3ZQ7A 3D5RC 3ELKA 4GXOA 1TNTA 1LUJB 1ON1A 5E18F 2XVCA 1OMIA 5HNHA 2HWVA 1YTYA 3CCYA 1JTYA 2ZXJA 1IG7A 1ODDA 5EEAA 1OR7A 2WAEA 2DA2A 1MNMC 1B72B 3BZKA 1UG0A 4A3MJ 3CJTB 1R7JA 2FEZA 3H0GJ 3CJNA 3P9IA 3TEDA 2FRHA 5A2QZ 3KP3A 2D45A 1B9MA 1FSEA 2ADUA 3OY9A 2DK5A 4WXDA 3F8BA 2FBIA 1T98A 2LYCA 3H5RA 2CQNA 1EH7A 2A5YB 2IEKA 4PSWA 4J01A 4A3DJ 4A3IJ 4CICA 4BY7J 5J8CA 3OS0A 1ETKA 5F0HA 2RDPA 3S1MJ 4E7IA 2P81A 4EM0B 2A07F 3ZOBA 3M1CA 4AIHA 4RLFA 3G4SI 1H9TA 1X19A 1MGTA 1LEBA 2W48A 5TRDA 3F8NA 4E7KA 5FKLA 5H20A 3DEUA 3PUBA 1UCRA 2VT3A 1U5TB 4A69C 1JKRC 2COBA 2QVOA 3Q0WA 4LK0F 2VQGA 4B3XA 1J09A 2RC4A 2GXAA 4ZTJA 4I98B 3MWMA 4M3DA 1Y0NA 4HV5A 4HEA2 3TDUC 3S1QJ 1PYVA 5DUKA 3V4GA 1LVAA 3DEEA 2KISA 2XRLA 1MJ9A 1YYVA 1T33A 5IP6A 2R5ZB 2YR2A 3DF8A 4XOTA 5E8GA 2X6YA 5D5VB 3HOVJ 4G6TB 2K4JA 1FYLA 4HX7A 4KDPA 1R9TJ 2IBDA 3U1DA 1YIOA 2DLLA 2E71A 2O5RA 4Z2YA 1QZYA 1WZ2A 1A35A 1W5TA 2ID3A 2L7FP 3OYKA 2GAUA 2QYOA 3L2QA 3OYJA 2R4GA 2MBFA 4CYCB 4II2A 3A02A 2H09A 2L4MA 3H3UA 4YFKF 4Y3OA 4DJAA 1OKRA 2MC3A 4RGUA 3HXLA 4DIQA 4M71A 2VBZA 3ZMZA 1NHAA 1SMYF 2JUCA 3E6DA 4PJNA 4RA2A 5ILUA 1AKHB 1QGPA 2MLGA 4OMZA 3FBIB 2LP0A 4UXNA 3HKZA 5FKOA 2OC6A 3LSHA 1B1BA 3F0CA 5FKKA 3BWGA 3ROUA 4FE4A 1A31A 2LOOA 1GV2A 3JW4A 3OL4A 1O3TA 4N9IA 3BR0A 5F0CA 3AFHA 4OINF 1GT0C 4GFBA 3NEUA 4C2MJ 1I50J 4FE7A 3COAC 4XLPF 2VC1A 3T5XA 1ON2A 3QU3A 4NQWA 1FIPA 2JUGA 2X4HA 1WWXA 3K0LA 5IYCJ 5KNLA 3E5QA 1V5GA 4BE2A 1VQ5I 3L2UA 1Z7LA 1Z6TA 3P5JA 3RZOJ 5EG0B 4C9YA 2VE8A 2KDOA 2PI0A 1LE8B 1LFUP 5FRNA 2VBYA 4MO7A 3TL4X 2HGCA 4D7NA 1SMTA 4A6EA 3PO3J 3LA7A 2R7VA 2MC4A 1EKEA 2MGQA 3JRCA 2L4AA 2BV6A 4HYEA 5GTHC 4G94A 2CV0A 1TW2A 2R7XA 2RVCA 4LIUA 3MKZA 4BH9A 2XB5A 4OU0A 5EGOB 4LG0B 3PQKA 5HDKA 2HR3A 3T8TA 3A2KA 4J00A 1K61A 2ESNA 1Y6IA 3IAS2 4BL0B 3J7AO 2VI6A 4HPQA 3CZ6A 4ZYDA 3TBIA 1FOXA 3WGIA 3DEWA 1QVTA 1LEAA 5HS9A 1X3ZB 3G73A 1G6NA 3C2GA 1VQ4I 1FPQA 3J80Z 1T08B 2D2WA 3K2AA 2OQGA 1E3PA 2WADA 3FK6A 3REOA 1ULYA 4XOPA 4A6DA 1JJ8C 4XLNF 2K7LA 3FKJA 1BN5A 4AYBA 2PJRA 1P4WA 1RPWA 2A68F 4C3HJ 2ACJA 3FM5A 3S14J 1OCPA 4W97A 2OUMA 3HGYA 2GQQA 1K78B 3DCFA 1G2HA 3NWTA 4XKWA 3WG9A 4CH7A 4LLGF 3WHCA 3SZPA 2RKHA 5K7ZA 2DAOA 2LBFB 4H0EA 4DW6A 3I4MJ 4BNCA 2LF7A 1WSUA 3EQLF 3KE2A 2CS3A 4EJTA 2CMPA 1U78A 2UUZA 2CUJA 4GDFA 1Y8RB 1R58A 3TO7A 3MQ0A 5J8FA 5EZHA 3L2RA 1GUUA 1OCOH 3HUGA 2R7QA 3QYEA 2ZFWA 3OIQA 2I8DA 3CMEI 1IF1A 5IOZA 1IXCA 4G6DA 1XMKA 3K69A 2JTVA 2L02A 4YIRX 4CSWA 1W5SA 3TO9A 4KMUX 3JAMK 2EFWA 4B8XA 5HVQC 2ZMEA 4IF4A 1XGSA 1XSXA 2K3FA 2M45A 3RPUD 3WGHA 4X6AJ 3U2RA 3R6SA 2MD0A 3ZXSA 4HW0A 3V42A 1S9HA 4M9XA 1YO5C 5B1AH 1Z3XA 2IW5A 4HNTA 1QHHD 4IXAA 4DYCA 2L9VA 5DCFA 5J6XA 3QRFF 1TC3C 2CV2A 3ASOH 2QGUA 2A6EF 2L3DA 3VEPA 2FXAA 3BDDA 2LF8A 3BP8A 4RAGA 4IHXA 1STZA 4FISA 1C0WA 3HC7A 4Z6YA 2GOMA 3ZQFA 1FP1D 4IRIA 5H6RA 3AG4H 5AONA 3V8KA 3CDIA 4M9SA 1PJRA 2DYRH 5M5YJ 4IHVA 1TP4A 3RTRA 2ZJRF 1TQIA 3K4MA 5HLIA 1SFUA 3H92A 2R7RA 1LJ9A 2CJJA 2HFHA 4BDYA 1OCZH 3D1NI 2EFPA 3E5XA 3LFUA 1USTA 2NVXJ 3WHBA 1I39A 2KRFA 2BZTA 1BJAA 2FE3A 2LKPA 3M8FA 3DBHB 2JN6A 1NK3P 3W6JB 1LVKA 5DCMB 4BEHA 3K4JA 2IS6A 3CF5F 2VB6A 4LD5A 3I53A 4UB8C 1ZGWA 4S04A 1A5JA 5J4YA 4P5OA 4IKFA 5FGMA 1ZRCA 3LSPA 3CTAA 3VDXA 3CQZJ 4JX6A 1YOVB 1CF7A 2EQRA 2HZTA 4PJJA 1GXPA 2TCTA 2PQ8A 2WAQA 1DGRM 2QQAA 4G8XA 3WTWC 1DDNA 2K40A 5LEKA 2DJIA 5DM6F 1R00A 1D1CA 4ZDLA 1YJWI 2V6CA 2UXNA 3CCJI 3FIWA 1BC7C 2ZSIB 5GPAA 5JHFA 1ONVA 2F5VA 4XR6A 3WTZA 3CCLI 1BJZA 3M7GA 4HNVA 5EZGA 3AL0B 2WY8Q 2QQBA 1ZYRF 1MDMB 1ETOA 2CUFA 3WTYC 1U5TC 1IRGA 2CWEA 3IUOA 1WJAA 4XRSA 3VODA 3DFGA 1YQAA 4P9UA 1LNWA 3ZQHA 5ICFA 1TWAJ 1BOAA 2A61A 2H94A 4V2FA 2YSRA 2AS5F 1LDKB 4WF2A 2DFHA 5KK1A 3OYIA 4M3BA 4TV7A 2VL8A 3GEZA 2FMYA 3A4CA 2FF4A 4UVCA 5J40A 4R8HA 2K3PA 1USSA 5E8IA 3WU1B 1PUFA 2ISZA 2XPUA 1VFCA 1MBKA 1J2XA 1ZG3A 3L1PA 1MBJA 1ITYA 4MNUA 1RNLA 2FD5A 5E17F 4CZCA 1QPIA 5F1RA 4UVBA 2MD5A 3OYCA 5FD6A 3OOUA 4S0HB 5LGNA 2B7EA 2HNHA 4N0BA 4YELA 3JRAA 2VODA 3IV5A 1HF0A 2HYJA 5D6FA 3K9TA 1ZR2A 3VYRB 2F6CA 3H36A 1PUEE 4PFOA 1HW2A 3L7WA 2CV1A 3ERMA 1AA7A 2LG4A 1Z91A 5JHUA 4XN3A 4CUGA 3GZ5A 3LSGA 4XONA 2QUFA 1D1BA 2XV4S 1Z7UA 5J3LA 5IYBJ 1I6XA 5BMZA 3G3ZA 1T2KA 2A05A 4HX4A 3S17J 3J7YJ 2HQ5A 3OYFA 4DGWB 5LEJA 3IRRA 3EUHA 2E1CA 2K85A 2VBXA 5E3OA 2BY0A 2OU2A 1S6LA 3GMEA 4WX9A 1I6HJ 1O4XA 2JZYA 3OIPA 2W84A 4EM1A 2LTPA 4F7ZA 1I3QJ 4EJWA 1K4TA 2VOOA 1POGA 1EF4A 1NK2P 1VI0A 5E3LA 2Y0SN 4UVAA 1KZHA 3IRQA 2BW3B 2QCOA 3GW2A 4DYRA 3LSTA 4RM2A 2Q0OA 2R7DA 2LMDA 1YJNI 2AQEA 2F5FA 2FUG2 1HA8A 4EQQA 2DU9A 4XICA 2X85A 4V19K 2X48A 1GVJA 2R7ZJ 4E4HA 3F6VA 3BCAA 4MTEA 4CCMA 1IXRC 3CCVI 4OAYA 3M07A 2WAFA 3PNYA 1IC8A 1HSJA 2P4WA 3LMMA 2DMUA 2G9WA 3KIOA 1OYWA 4O3MA 4WXHA 5JVGF 4NHJA 4AVZA 2XSDC 3DPTA 4KUMA 2UWMA 2D1HA 1YIJI 5K7FA 3ASNH 3BJOA 1K83J 3SHFA 2KIUA 3HOZJ 3EUAA 2LFBA 1P9QC 5HNFA 1WQ2A 3R0JA 5CVRA 3BPVA 3HIFA 1YITI 3IC7A 4O5VA 3J81Z 2ELJA 2H1KA 1WH7A 4HLXA 1JGSA 4AVPA 3FXKA 4MFEA 1R36A 3PL8A 4B1RA 5C4JJ 3HSRA 2BHYA 2Y0MA 2NVUB 2P7CB 1FT9A 1WKMA 4Q4ZF 3K4LA 5FKMA 3WE3A 2KRCA 3G1OA 4MQ9F 3EUKL 3O3KA 3W2AA 5ED4A 1FBQA 3ABUA 2EH3A 1BBYA 2M9HA 2A69F 2ID6A 2NYXA 4HDVA 5DEQA 4HNUA 3QYFA 1AOYA 1XDSA 1H9GA 3DTEA 2HI3A 4XRSG 2V6EA 2P5KA 2R7WA 2EILH 4M6YA 1W7PB 1T38A 2RQPA 2ZB9A 3NQOA 3KZZA 3BQYA 1J7KA 3BG3A 5IP7J 2M8GX 3OSGA 1K4SA 1E3HA 5LRSA 2X0LA 1W4MA 2OCEA 3OSFA 5E3MA 4LGWA 5LHIA 1VQKI 1MMSA 1IN8A 2RNGA 1DP3A 4XLEA 3ZRGA 3KP6A 1R1TA 2PEXA 3WG7H 4KITB 4HLYA 2E7WA 3FXMA 3H3ZA 4JK1X 1P2FA 1M1EB 2ZMEC 4IVNA 4BY1J 2L7KA 4Q47A 3ZMDA 4EJVA 3IKVA 3BCBA 2XB0X 3RCOA 3L00A 2E1MB 1WCMJ 3OIOA 2W82A 3WU0A 2KIQA 3LAPA 4BXUA 3H35A 5LFAA 4DZPA 4KFCA 3A1YA 4EM2A 4UUSB 2JVGA 4HBLA 5HOOA 3ERED 4XKCA 5J1RA 1ZTRA 1T8IA 4F3QA 1MSFC 2GBYA 3I54A 2QEXI 1HQCA 3ZQLA 1OLTA 5HS7A 3MZ8A 1Q1HA 3JRGA 3NARA 4L0ZB 1S7AA 1F5TA 5DDGA 3GYHX 2CRGA 1SFXA 2AXLA 3ZN1A 2OJED 1UHMA 5HDNA 4I0BA 4JX5A 2ZNYA 2Y48A 2D5VA 4R1HA 4GYIA 5J1UA 2CH0A 1CQTA 4RGSA 3BR1A 2VC0A 2W00A 4DOZA 3G71I 1D0ZA 1JKPC 2EZKA 2E2HJ 2W24A 2DW4A 2EA4A 3IHUA 5FB2A 2OZ6A 4CCLA 4ZDPA 4XL9A 4IRHA 2XAUA 3WE2A 1K6OA 3A01A 3E6BA 5BPIA 2DPUA 5FLXZ 3G1MA 2K86A 3I5UA 3QPLA 2VN2A 3Q0UA 3S32A 4KYWA 3D0SA 4GCVA 3ABKH 2XROA 3R60A 5L3BA 5DS9A 1B4AA 1MIJA 1XSVA 3OYNA 5GTIC 1D0YA 3UKGA 2LY9A 1KYWA 2EV0A 1D5YA 1D3YA 2F5DA 2FBHA 4M73A 5CVIA 3RIRA 3CCEI 1EA3A 2Q8KA 3M8JA 2E34A 1XB4A 1YS7A 2STWA 1QO0D 2DCEA 2M3AA 3K70D 2BXYA 1Q1VA 2V1UA 3KEYA 1B72A 3HEFA 3I71A 1W0TA 4ON0A 2D1VA 2JJ7A 3KZYA 3CCQI 3HKZN 3SZGA 2R3SA 2QWWA 2JVHA 3OR2C 2ELKA 1L3LA 5FRMA 2QKMB 3KCCA 2HYGD 1T0FC 3PM1A 4ZC3A 5D5XB 1Z3YA 5KAFC 2NNYA 2QF7A 3O8GA 1ZQ3P 2OA4A 3FXRA 3AL0C 5IT9K 4L9TA 2EIKH 2KT0A 1WHUA 2BHZA 4L9VA 1YRNB 2JA8J 3KEQA 5CQEA 1QZZA 1FZPB 3LSJA 3O2PE 2L9SA 2DMTA 4KT5C 4LIVA 1VQ7I 5E79C 3KFWX 2EBIA 1XC5A 4FHTA 4NBQA 2DQRA 2G7UA 2IAIA 3P7NA 4LMYA 1U5TA 3I3LA 2DQLA 2Z99A 3FMSA 1TNSA 5CJ9A 3VYTB 3BJ6A 1IV8A 2DFFA 4A3GJ 2HU9A 2MSYA 1D5VA 1XCBA 2JSPA 5B3SH 5KAIC 4AU7A 3J7ZI 2HDDA 1FWZA 2H27A 1G3SA 2DA3A 3NAUA 3ZMUA 3W3CA 5HLGA 5CLSA 1T56A 5H6QA 1DP7P 2RREA 2HVQA 2R5ZA 4P1WA 3VB2A 1XDUA 2F4OB 2OTLI 1OCTC 2M1BA 2MLKA 3VPRA 4HF0A 1XSDA 2EK5A 3F22A 1E0EA 1ERDA 4AYBN 2NRAC 4PJ0C 3LA2A 1ZELA 1YFHA 2G0EA 1SVLA 3S2DJ 5IOYA 3I58A 3TMOA
chains in the Genus database with same CATH topology
4F55A 3RPUD 3ZCOA 4F93B 4C2UA 2IS2A 1N75A 2MD0A 3EUHC 3ZXSA 3VSKA 4CCNA 3V42A 1S9HA 4B44A 1LKXA 3N05A 1Z3XA 2HVSA 3CJQB 2KQRA 4HNTA 1QHHD 2CV2A 4E6KG 3OL3A 2LRDA 3VYSB 4HG2A 3NWSA 4N4NB 2AQFA 2W1OA 2R7OA 3HC7A 2Q1ZB 3FBNB 3DPUA 2GOMA 4XNFA 2XDVA 2VXZA 1UAAA 1DGWY 3L2VA 4RLQA 1PJRA 2L5QA 2MYSA 3RTRA 3K4MA 3K70C 2R7RA 4NUBA 3OYLA 4XLFA 4BDYA 4B47A 2HDWA 5CPRB 3LFUA 3HL2A 2Q2EB 3OR1C 1UELB 3CP8A 1X1BA 1BR4A 3D5LA 2L9NA 4NNJA 2WA0A 3C2HA 2ZXHA 2CW7A 2M7AA 2WB1A 2IXSA 3HG9A 1LVKA 4ITVA 4BEHA 3HOSA 3K4JA 2E5ZA 3PJRA 2IS6A 2WBMA 2VB6A 4XM3A 3E1SA 3PSFA 3CJRB 4P5OA 4IX7A 4IKFA 2IGNA 3W2WA 1QU3A 4PFPA 2VQHA 3OYMA 2XC7A 3VDXA 2VPLA 2VASA 2V4JC 4E7JA 4PJJA 1TZLA 3LSIA 3ZR8X 2WAQA 1DGRM 4HRIA 2DT6A 4E7ZA 2DJIA 2XF5A 3ZQQA 1D1CA 4ZDLA 4IQ4A 1W36D 3IAM2 3VSLA 5CKTA 2ZSIB 1GLNA 3OWTA 3E0JB 5CQGA 5JHFA 2F5VA 3OYBA 4XR6A 3F9KA 3AL0B 2V1NA 3BG6A 2WY8Q 3VYUB 2ZFUA 3ONQA 3CP2A 3QOEA 4FETA 1T95A 3CMMA 4PK4A 4BGDA 3MMYB 4B48A 3OYAA 3H9QA 4PUSA 2K9MA 3IUOA 1WJAA 2P0WA 1X4OA 1D0XA 3OYDA 4ANJA 3AKZA 3HPHA 1N78A 3G2BA 2LBFA 3OMYA 4ZYAA 1LDKB 3DTKA 3MD2A 3OYIA 4E7SA 3DU6A 4QPOA 2VL8A 3RSNA 4BQNA 1WJDA 3A4CA 3QODA 2R7TA 4IZZA 1WFXA 2K3PA 4OAZA 4D9JA 5LD2C 3S93A 3DWLE 2E1MC 2KLOA 2XF7A 1MMAA 5KHDA 2W4SA 3H0DA 4BJTA 4CZCA 3OYCA 1MMGA 3OOUA 2HNHA 4YELA 2Y0SA 2CUZA 3KX2A 1SFKA 2K5CA 3HUGB 1IRXA 3KYLA 3VYRB 1R6RA 2F6CA 4F92B 4PFOA 4E7LA 3J7AY 2DT7B 2CV1A 2JA2A 1AA7A 2LG4A 2M0MA 3SYTA 2VKDA 1V5FA 4XN3A 4CUGA 3LSGA 4XONA 4R79A 1D1BA 2VKHA 3FHNA 4F52A 2IGKA 1MMDA 4RMNA 2R7SA 4U87A 1KONA 2VJ4A 3OYFA 4DGWB 2V9KA 2HPMA 2UV1A 2LH9A 2L2OA 4BACA 2BOLA 3OIPA 3U21A 4LG3A 2X6XA 2LC2A 2HPIA 4BXFA 3DKYA 3PFYA 2E5NA 3DPLC 2BW3B 3K4CA 4RM2A 3VWBA 2AQEA 2FUG2 2R7UA 1HA8A 2KL4A 3PNVA 4HSRA 3K6GA 1WJCA 2X85A 2K9LA 1N77A 3UR3C 4BS9A 1YX3A 1G8XA 3OS1A 4E4HA 4NQWB 3BCAA 1MNDA 4CCMA 2KRHA 2V7FA 2VIXA 5FROA 4OAYA 1BR1A 4BJ6C 2WAFA 3PNYA 1WJBA 4CCKA 3D5RC 3LMMA 2ZXIA 1JI8A 3GBGA 2VQCA 1Y56A 1W36C 5HNHA 4ZTFA 4AVZA 2IGMA 2LY2A 3DPTA 2UWMA 2WAEA 1UG0A 4XKBA 2X1DA 3SDBA 4BU2A 2X1CA 4XQFA 3EUAA 1P9QC 5HNFA 3DTIA 2X1EA 3I9V2 2ELJA 1Z21A 2Z16A 3PL8A 3OY9A 2LREA 4LITA 1YX5A 4BDZA 2LYCA 2KHMA 3CESA 3H5RA 4C2TA 2VLAA 1VZ0A 3K4LA 4PSWA 4J01A 2KRCA 1U0JA 3EUKL 4X0GA 3OS0A 3W2AA 2GOXB 1X1CA 3OYEA 2Z2SB 4XMYA 4E7IA 3M1CA 4RLFA 2XSJC 4HNUA 1X19A 3QYFA 2QKLB 3DTEA 3SEZA 2XF6A 2V6EA 4E7KA 2R7WA 3CF2A 3PUBA 2PJRB 2HVRA 3OYGA 2A5WA 2M4KA 1NG6A 2VJJA 4BUPA 2BVLA 2VQGA 4B3XA 1J09A 1X4PA 2F4IA 4KISA 1NG7A 2RNGA 1DP3A 3EPZA 4XLEA 4ZTJA 3ZRGA 4KITB 1MMNA 4XN0A 4XLAA 4YRVA 4HEA2 1PYVA 3DEEA 1X1AA 4BQQA 3HPGA 2L7KA 2M7BA 3BCBA 2VXDA 3RCOA 4DBQA 2KPMA 2E60A 2CFOA 2DOAA 2E1MB 4XOTA 4KJZA 2W82A 4BJ5C 4CCJA 2X6YA 4D1QA 2X6WA 4H4KC 3H35A 1FMWA 5LFAA 4G6TB 2KZVA 3A1YA 3BLYA 4F91B 4U7BA 2JVGA 5HOOA 2A6TA 3S3NA 4XKCA 2O5RA 2VQLA 1SAUA 1D1AA 2HZDA 4JQFA 4XKVA 4F3QA 3OYKA 4PJLA 4PJMA 1OLTA 3L2QA 3OYJA 2R4GA 3BC8A 5TGTA 4DBRA 3H9JA 4II2A 4IQJA 2VJIA 4Y3OA 3OYHA 4DJAA 4QPQA 4PSXA 3HXLA 4DIQA 4XORA 3UNGC 1FMVA 4FASD 3K4NA 2CH0A 2W00A 4DOZA 1D0ZA 3IP4B 5KCMA 4PJNA 4MLOA 3PNTA 4CCLA 3FBIB 4ZDPA 4XL9A 2IS4A 2BW3A 1YE9A 4BE0A 3HKZA 3LSMA 2XAUA 2OC6A 3LSHA 2CW8A 4KT6A 2LOOA 3OL4A 3QYBA 3AFHA 2X51A 4CA0A 4Y4RA 3RQ4A 4XLCA 4C30A 3S32A 3K4KA 2WY7Q 2DXIA 3OYNA 2JUGA 1D0YA 2ZSHB 5KNLA 1BOBA 1V5GA 4BE2A 3L2UA 1Z7LA 1EA3A 1TT0A 2LY1A 3M8JA 2PMZA 3LL7A 4RM3A 4II3A 2KMUA 3H5NA 2DCEA 2M3AA 4BEHB 4C9YA 2KDOA 3S8PA 3K70D 1K6YA 2HQAA 3W2VA 1OR7C 5FRNA 3KEYA 3TL4X 3H5AA 3DKXA 3HOTA 3FDYA 1MW7A 4NC8A 2R7VA 4YEJA 2MC4A 1V5EA 3SZGA 2MABA 3K4BA 3OR2C 2JVHA 4ZJZA 3MKYB 5FRMA 2QKMB 4NC7A 4XLHA 2CV0A 2R7XA 4LIUA 1T0FC 4ZC3A 3MKZA 1Z3YA 2OV7A 2BVMA 3A2KA 4J00A 3AL0C 3IAS2 1Y6IA 4BL0B 4HPQA 3CZ6A 1QHGA 3TBIA 1X1DA 1WJEA 5CQEA 2MFZA 2KP6A 3L2WA 4JOMA 2L9SA 2RQQA 4LIVA 4EATA 4BQOA 4BE1A 3C2GA 4B43A 2NOJB 2IS1A 2WADA 2M4GA 4XOPA 3FKJA 4AYBA 5HLTA 2PJRA 4ZDOA 4OWRB 3DU5A 3I3LA 4HSTA 2W7NA 4Y33A 2OUMA 3BG7A 1WJ5A 3NWTA 3VYTB 4XKWA 3K10A 2HU9A 2IGOA 4CH7A 3H9GA 2LBFB 3ZGKA 4N4OB 1LFPA 3S3MA 2JSPA 1G59A 2CS3A 4AU7A 2CMPA 2UUZA 2CUJA 4CCOA 3W3CA 3DLAA 3L2RA 1DQUA 1MNEA 4GRIA 4E7HA 1BR2A 2RREA 2HVQA 3S3OA 3SEQA 4P1WA 2R7QA 3QYEA 3OIQA 2I8DA 3LSKA 3DQVC 2Z1DA 2VJ5A 4CSWA 1E0EA 3D5SC 1ERDA 3MKWB 1WJFA 3PSIA 2V26A 1ZELA 5HVQC 3OS2A 3TMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M4G A; 
#chains in the Genus database with same CATH topology
 2NS7 A;  4C2U A;  1S29 A;  3FM3 A;  1MJB A;  3EUH C;  4CCN A;  5GAE J;  4W1U A;  4N9H A;  1Z67 A;  4IO9 F;  2PX9 A;  4CYC A;  4MEY F;  1XGN A;  3HDD A;  4AUX A;  2HVS A;  2R5Y B;  1VQP I;  1IV6 A;  1HKT A;  2KQR A;  1VF9 A;  2VE9 A;  2XAF A;  1A04 A;  2DTZ A;  3TGN A;  1FYM A;  4CGZ A;  1OJL A;  1SEU A;  4A3L J;  1QRY A;  5CVV A;  3QPH A;  1X3W B;  1Y1V J;  2OCC H;  5B5E C;  2RN7 A;  3HOX J;  1EH6 A;  1AKH A;  5F1J A;  5C44 J;  4YG2 F;  1YI2 I;  4UHT A;  2Q1Z B;  3FBN B;  4G12 A;  4XNF A;  2Y75 A;  2BBY A;  4EJO A;  4L0Y B;  1UAA A;  3L2V A;  2TRT A;  4ESB A;  4RLQ A;  2OD5 A;  3SFZ A;  1ZN2 A;  2L5Q A;  4AC0 A;  1SAN A;  2HDC A;  2W57 A;  3ZMS A;  1U8B A;  2VKV A;  4NUB A;  1FX7 A;  4BAY A;  4B47 A;  3JRB A;  5CPR B;  3BZC A;  1U8R A;  5C4X J;  4GGG A;  2OQR A;  1V54 H;  1UEL B;  3QAH A;  3CMA I;  3S1R J;  2GM4 A;  2ISY A;  1X1B A;  2PG4 A;  3R61 A;  1DPU A;  3D5L A;  4ESF A;  4NNJ A;  2ZXH A;  4A12 A;  2M7A A;  3FXQ A;  4G6Q A;  2WB1 A;  4U0V A;  5EG0 A;  1O57 A;  1XTA A;  3JRH A;  2LK2 A;  3HOS A;  2WBM A;  4CXF A;  4XM3 A;  1LE8 A;  4C3I J;  2LKS A;  2V1X A;  3PSF A;  1F43 A;  1I5Z A;  3BG9 A;  2YUS A;  3CJR B;  3TO6 A;  2IGN A;  4PFP A;  5DYM A;  2VQH A;  4I6Z A;  1YW8 A;  2XC7 A;  4IOC F;  2JA5 J;  2ZC2 A;  4KN7 X;  3HBL A;  3ZR8 X;  1Z6R A;  5EGO A;  4HRI A;  2LKX A;  2YU9 J;  5TJJ A;  1XD7 A;  4IHY A;  2W25 A;  3CDH A;  4O6J A;  1UHW A;  1IDZ A;  2QA4 I;  3VSL A;  2HEO A;  5CQG A;  5EF6 A;  3CMY A;  3OYB A;  1IN5 A;  1FTT A;  3BG6 A;  5AIP A;  3C2B A;  2FNP A;  1QBJ A;  3LQQ A;  5LLQ A;  4I02 A;  2ZFU A;  3ONQ A;  1IJW C;  4PK4 A;  4IRG A;  1G3W A;  2HOS A;  3TP3 A;  1LDD A;  1I1G A;  4B3A A;  4BGD A;  3MMY B;  1ETV A;  3M4O J;  4PUS A;  2K9M A;  1HCR A;  3BR2 A;  2L01 A;  1YG2 A;  1D0X A;  1K78 A;  4OMY A;  1ZKG A;  3HM5 A;  3I4N J;  4IEJ A;  3HPH A;  1KYZ A;  2QBY B;  1N78 A;  3G2B A;  2WAQ N;  2LBF A;  2LVS A;  1BL0 A;  3MD2 A;  1ORK A;  4E7S A;  3DU6 A;  2F5E A;  4BQN A;  1WJD A;  2W85 A;  1WFX A;  4IZZ A;  4HDU A;  5GP9 A;  4XBF A;  4D9J A;  1NTC A;  2FNA A;  3ZPL A;  3HOW J;  2E1M C;  4P9F A;  4RGR A;  2EZL A;  2QLZ A;  3AG1 H;  5KHD A;  4QIW N;  3HJE A;  5C3E J;  1SFO J;  2YS9 A;  1WRJ A;  5DV5 A;  1YHQ I;  1IUF A;  4U7D A;  2HYF A;  3QQA A;  1R5G A;  4J19 A;  4U88 A;  4KIC A;  1P7I A;  2IT0 A;  5L3D A;  1MH4 A;  3RYR A;  2CUZ A;  4IJA A;  1SFK A;  2K5C A;  3HUG B;  2ZKZ A;  1UFM A;  3E6C C;  2P6S A;  4FTH A;  3RJP A;  4ZYH A;  2M5W A;  3HRM A;  2HQN A;  3K1N A;  2M0M A;  4RS8 A;  1V5F A;  1PP7 U;  2JPB A;  3RQI A;  1BM9 A;  4OOI A;  1BA5 A;  3I64 A;  4G7H F;  2E2I J;  2DOD A;  3N97 A;  3BTI A;  4RMN A;  5EEG A;  1BC8 C;  3TOA A;  2PJP A;  2BGC A;  2R7S A;  1KON A;  3CUQ B;  1OYI A;  2V9K A;  1YS6 A;  3R4K A;  1U9O A;  3W6V A;  1O7F A;  1J59 A;  2BOL A;  5F6F A;  1LQ1 A;  2F4M B;  5LGU A;  5ICE A;  3JSO A;  1RET A;  2LC2 A;  3JAM Z;  5IY5 H;  1LPQ A;  2HPI A;  3BT9 A;  3F8F A;  3WTU C;  4A5N A;  1XG1 A;  3PFY A;  2L7Z A;  3MKL A;  3IH4 A;  2HOE A;  1JJ6 C;  2GA1 A;  3S1N J;  2O9L A;  2FX0 A;  1RZ4 A;  2K4B A;  3KYD B;  5D6E A;  2KL4 A;  4HSR A;  2FQ3 A;  3ZN0 A;  1G4D A;  1P92 A;  3K6G A;  2K9L A;  3BJA A;  2ZCW A;  2XPV A;  2Z3Y A;  5DCM A;  1W5C C;  1RUN A;  2V7F A;  1MH3 A;  1BR1 A;  3T8R A;  1SD6 A;  4CCK A;  2J5P A;  3H3V K;  4ENJ A;  1TWC J;  2CFX A;  2JA6 J;  2ZXI A;  4I7H A;  2VQC A;  3GBG A;  1Y56 A;  2RV8 A;  1W36 C;  5DUI A;  2LSO A;  1JUS A;  1XCV A;  4G7O F;  1RES A;  4I76 A;  2IGM A;  3S2W A;  1S3J A;  2LY2 A;  2KZG A;  2GXB A;  3ZP5 A;  4XKB A;  5JR3 A;  5ILV A;  1JT0 A;  1HST A;  2QSH X;  1KQ9 A;  3SDB A;  4BU2 A;  3KLO A;  4XQF A;  2B9S A;  3DTI A;  2X1E A;  4G9Y A;  1JHH A;  2VON A;  1A6I A;  1J5Y A;  2Y30 A;  3GFL A;  2PMU A;  1Z21 A;  1ZG1 A;  1GXQ A;  1IAW A;  1T0F A;  1S72 I;  4LIT A;  3V8J A;  3PFI A;  4BDZ A;  1YJ9 I;  2KHM A;  2VLA A;  1VZ0 A;  4GYG A;  4D5C A;  5K7H A;  4HV6 A;  1MDM A;  4EEF G;  4DQ2 A;  1X1C A;  2H6B A;  2XUB A;  3OYE A;  2JSC A;  2P6T A;  2Z2S B;  4XMY A;  2G7H A;  4L5I A;  3WTT C;  3QP5 A;  2BE5 F;  3Q3S A;  4D5F A;  2QKL B;  3SEZ A;  2XF6 A;  3HRU A;  2EIN H;  4KA4 A;  4A3J J;  3LWF A;  2HVR A;  3P9C A;  3OYG A;  2A5W A;  5D5W B;  2PBI A;  3RI4 A;  1ZRE A;  2ZNZ A;  2K9Q A;  1NG6 A;  5L3C A;  2X9D A;  2EFN A;  2IA1 A;  2HS5 A;  4Y7N J;  4KIS A;  4M3G A;  1BI3 A;  1UJ8 A;  3WGG A;  2M30 A;  1MMN A;  3BY6 A;  2YX4 A;  3LAJ A;  3SDG A;  4UV8 A;  2BXZ A;  3HPG A;  1EH8 A;  1KGS A;  2M7B A;  1Z05 A;  2VXD A;  2KPM A;  2Y9Y A;  1ETX A;  2QZ8 A;  3GTJ J;  4Q5S F;  1IUY A;  4CCJ A;  4BJ5 C;  4M6V A;  4XK4 A;  3U1K A;  3LNQ A;  4Q48 A;  1HW5 A;  4H4K C;  2NS0 A;  2XKO A;  4D1Q A;  4FQG A;  1HKS A;  1U6G A;  2EJR A;  4JYK A;  4F91 B;  2FML A;  2DFI A;  3SJM A;  1ZG5 A;  2DOF A;  3S3N A;  2QSF X;  2E35 A;  2VQL A;  3CDL A;  3FF5 A;  1FOK A;  1MBF A;  1SAU A;  1DU0 A;  3C18 A;  4QSH A;  1WGX A;  1VQO I;  3CC2 I;  1X2N A;  4L9N A;  5LGT A;  4PJL A;  4PJM A;  4KIB A;  5TIS C;  1RC9 A;  4RB3 C;  1ZR4 A;  3BC8 A;  1I27 A;  5FD5 A;  3MFK A;  2VJI A;  3B73 A;  1G3Y A;  3HGG A;  4I99 C;  1APL C;  1TTY A;  1VQL I;  1MKM A;  4QPQ A;  4XRM A;  1R71 A;  5K5Q A;  3M8E A;  4ENN A;  3QP6 A;  4QWQ A;  4XOR A;  2DJN A;  2NXN B;  3K4N A;  2CG4 A;  3ZMV A;  1SVM A;  2VPR A;  4L18 B;  3IP4 B;  3PIP F;  1B8I B;  1O3R A;  3PQJ A;  4MLO A;  2CW0 F;  3PNT A;  1IN7 A;  2GIV A;  2IS4 A;  2BW3 A;  1YE9 A;  1HKQ A;  2Q2E A;  4M74 A;  4BE0 A;  2EWN A;  1JUM A;  4P96 A;  1FOY A;  2CW8 A;  1FP2 A;  3CUO A;  2DA1 A;  3QYB A;  3I55 I;  2X51 A;  2GZW A;  4MFD A;  2LD5 A;  4CA0 A;  3RQ4 A;  3CCU I;  4XLC A;  4C30 A;  3K4K A;  1S5L C;  2DXI A;  2K27 A;  2JRT A;  1ZLJ A;  3HB9 A;  4RAZ A;  4LLL A;  4B09 A;  2IRF G;  2L9R A;  3ABM H;  3I59 B;  1TT0 A;  2LY1 A;  3QOP A;  2PMZ A;  4RM3 A;  2WV1 A;  2KMU A;  3H5N A;  3SXY A;  3S8P A;  1K6Y A;  2HQA A;  4LK1 F;  4NC6 A;  2GIZ A;  1XMA A;  4IL6 C;  5ILS A;  3H5A A;  3MCZ A;  1S7E A;  3HOT A;  4KMF A;  3DXJ F;  3ECO A;  1E17 A;  1ZGJ A;  4YEJ A;  3TDZ C;  3HOY J;  1V5E A;  2L0K A;  3V7C A;  2MAB A;  3K4B A;  3EET A;  2MW8 A;  1Z1D A;  4ENM A;  4NC7 A;  3F8M A;  4XLH A;  3HHG A;  4CZZ A;  5AIQ A;  3TKY A;  3CC7 I;  2GA2 A;  2NVQ J;  2OV7 A;  2O8K A;  1PVE A;  1IZ1 A;  3JRE A;  3T1B A;  2XAQ A;  2Z33 A;  4IHS A;  1QHG A;  1X1D A;  1WJE A;  2A6H F;  4OIR F;  3L2W A;  1WI3 A;  2JWT A;  2RQQ A;  3Q0V A;  1V4R A;  4EAT A;  1MBE A;  4BE1 A;  4B43 A;  3MZY A;  3FXJ A;  4JP0 A;  1HDD C;  3G6E I;  2CQK A;  2M4G A;  4LFU A;  4D0P A;  3VFZ A;  1FBS A;  5CVU A;  5HLT A;  1W7P A;  4ZDO A;  2V79 A;  3GTP J;  3C1D A;  4I2O A;  2E7X A;  4HQE A;  1FTZ A;  4Y33 A;  2WC2 A;  1WJ5 A;  5FO5 A;  1J9I A;  1BI0 A;  2HKO A;  3DP7 A;  2IGO A;  5EJC A;  3L2C A;  2J5O A;  1BIB A;  5F04 A;  4N4O B;  2Z9O A;  4FX4 A;  3BR6 A;  3O6B B;  4RB2 C;  1P4X A;  1B59 A;  4CCO A;  2RGV A;  2JRM A;  2K9N A;  3B6C A;  3DLA A;  4GRI A;  1BI2 A;  1BR2 A;  2DDA A;  3SFI A;  3SEQ A;  1SFE A;  5L3F A;  3S3O A;  4HF1 A;  3ULQ B;  1U3E M;  2AHQ A;  2Z1D A;  3W6K B;  4HZF A;  5ERI A;  1RKT A;  2ZJQ F;  2NVT J;  3S2H J;  1Z0X A;  2JT1 A;  1MZB A;  3JTG A;  4PGG A;  3IKT A;  3T0Y A;  2EA2 A;  4BBS J;  1ZAR A;  2V26 A;  4UUS A;  2BY1 A;  2H1L A;  4OIP F;  2HXO A;  1JKQ C;  2Z5U A;  5LHH A;  1H0M A;  2VUM J;  4F93 B;  2YPR A;  2IS2 A;  1N75 A;  3S15 J;  4XSZ F;  2UXX A;  2HKX A;  3GXO A;  5IP9 J;  5M3M J;  2HTS A;  3CUQ C;  2NAZ A;  1IDY A;  4B44 A;  1LB2 A;  3N05 A;  3I0T A;  3GWZ A;  3CJQ B;  5FLX K;  1T6S A;  1KU7 A;  3GFJ A;  4BHC A;  4G7Z F;  4E6K G;  3Q5F A;  1TQP A;  1DPR A;  4U0Y A;  3GLL A;  3ABL H;  1TWH J;  2ME6 A;  2AQF A;  1MBG A;  2W1O A;  4ZZL A;  5K5R A;  1H89 C;  1TT5 B;  3SQN A;  2B63 J;  3VOE A;  3P9K A;  2M8E A;  3NRV A;  2XDV A;  1MJA A;  2QM3 A;  2VXZ A;  1DGW Y;  2ECC A;  1OQY A;  1TWF J;  5HS8 A;  2MH9 A;  1ZH5 A;  1R22 A;  1ZAO A;  2MYS A;  5FLV A;  3ZQI A;  5DTD A;  2JA7 J;  5LBQ A;  1RUO A;  2DYS H;  1QA6 A;  1MBH A;  2ZJ2 A;  4LLN A;  4IHT A;  2F2E A;  3BR3 A;  2VOP A;  3F23 A;  4A93 J;  5A2Q K;  3CP8 A;  3PUF A;  1O3Q A;  4I01 A;  4RB1 A;  2ZBK A;  2K9S A;  3WTX C;  1U2W A;  2L9N A;  5IYD J;  1FIA A;  4A0Z A;  3BTC A;  5J47 A;  1FJL A;  1FSH A;  2IXS A;  1GHC A;  4ITV A;  3FHZ A;  3I56 I;  2QQ8 A;  2E5Z A;  1I3A A;  2LLK A;  2L54 A;  4KIF A;  1KU3 A;  1HBX G;  4I09 A;  3JTH A;  1N25 A;  4IX7 A;  2C6Y A;  4A3F J;  4P55 A;  3W2W A;  1QU3 A;  5E20 A;  1XGO A;  1KU9 A;  3K1P A;  2WWY A;  2CYY A;  3HRT A;  2VAS A;  2KJB A;  4E7J A;  3B02 A;  1W0U A;  1TZL A;  2OZU A;  2COM A;  2JMW A;  2DT6 A;  2O8X A;  3CLO A;  1V55 H;  2XF5 A;  2CO5 A;  4EV0 A;  2DA5 A;  3F6O A;  3RKY A;  3ECH A;  1YRN A;  3L09 A;  2EV6 A;  3IAM 2;  2CSO A;  2O0Y A;  1GLN A;  3OWT A;  1FC3 A;  2ZJP F;  2VKE A;  1XS9 A;  1IW7 F;  1XPX A;  1K79 A;  3B6A A;  2WB1 N;  2CUE A;  3R0A A;  3F9K A;  3IWZ A;  2V1N A;  4LOC A;  4UUV A;  2PLY A;  3CP2 A;  3QOE A;  1T95 A;  1R4N B;  2ECB A;  2XGX A;  5B66 C;  3G1L A;  1UB9 A;  4B48 A;  1TLH B;  2BYV E;  5D8K B;  1PP8 F;  1OFC X;  2HTJ A;  2YU3 A;  5E1Z B;  1X4O A;  3OYD A;  2IPQ X;  3QPT A;  2H6C A;  2MA3 A;  3AAF A;  2A3S A;  1P4A A;  2FBK A;  2XRN A;  1J0R A;  1HDP A;  3BR5 A;  3ML6 A;  3OMY A;  4ZYA A;  3IL2 A;  3DTK A;  1NH3 A;  5IT9 Z;  2HXI A;  3GLX A;  4QPO A;  2EZI A;  3QOD A;  2R7T A;  5GAG J;  3CCM I;  1U9N A;  4OAZ A;  1X2M A;  2ZXW H;  4LB6 B;  5LD2 C;  3GTL J;  3DWL E;  2NNN A;  2RAE A;  3GZN B;  2KLO A;  1FLI A;  1MMA A;  2HOA A;  4GO1 A;  1RI7 A;  1FNN A;  2W4S A;  2CQX A;  2IP2 A;  4BJT A;  3AG3 H;  3QWL A;  2DTR A;  2Y9Z A;  1LFB A;  1MMG A;  2TDX A;  4M3E A;  5K1Y A;  1MD0 A;  2ZO4 A;  3CD6 I;  1QPM A;  3KX2 A;  3C3W A;  2E1N A;  1X1P A;  1SAX A;  3GF2 A;  3WU2 C;  1R6R A;  4EJU A;  1AWC A;  2M0C A;  4E7L A;  1QNT A;  2DT7 B;  1KQ8 A;  1ZK8 A;  3ZQG A;  2DN0 A;  1SD4 A;  5D8L B;  2R5Y A;  4R79 A;  1FEX A;  4IOA F;  1R4M B;  2VKH A;  2PN6 A;  1E2X A;  3GCM A;  5EDN A;  1FOW A;  9ANT A;  4U87 A;  4ENK A;  2VJ4 A;  1IO2 A;  4BQA A;  4BYY A;  1LDJ A;  2HPM A;  1O7L A;  2UV1 A;  2LH9 A;  2XGC A;  3JRF A;  2E1O A;  2L2O A;  3FMQ A;  5E3N A;  2LR8 A;  1QQI A;  4BAC A;  2YX7 A;  3GTK J;  4B4C A;  3IH2 A;  3IWF A;  4IHW A;  4BXF A;  1K7A A;  1MSE C;  3DKY A;  5F08 A;  2QQ9 A;  1P6R A;  4XRF A;  2CQQ A;  2GLO A;  3TW7 A;  2R7U A;  2FA5 A;  2EB7 A;  5LHG A;  4MQV A;  3HZJ A;  3GX4 X;  1WJC A;  1N77 A;  3RYP A;  3FXO A;  3UR3 C;  4A0Y A;  3OS1 A;  1G8X A;  3KP5 A;  2OAZ A;  4WWC A;  4NQW B;  2IA0 A;  1MND A;  2JK3 A;  2F48 A;  2VIX A;  5FRO A;  4BJ6 C;  2E36 A;  4E70 A;  2DA6 A;  3V7S A;  1F36 A;  2GXG A;  4DZJ A;  1JI8 A;  3BTL A;  4ZTF A;  4WK8 F;  1SC7 A;  3J80 K;  3FXL A;  4LG0 A;  1A36 A;  2X1D A;  1H88 C;  5HLH A;  2X1C A;  2CQ7 A;  1R1V A;  1A6Q A;  1WVR A;  4FT8 A;  4ZH4 F;  4MEX F;  4CDG A;  3I9V 2;  3S16 J;  1RRJ A;  3MEX A;  2Z16 A;  1R5H A;  1JHF A;  1ZRD A;  2LRE A;  1TQM A;  1YX5 A;  2AO9 A;  4XID A;  3CES A;  3RKX A;  4C2T A;  4X1E A;  3HTU A;  1IN4 A;  3BOQ A;  4BHB A;  1U0J A;  3FKI J;  4X0G A;  2DBB A;  2GOX B;  4A0X A;  1HOM A;  1L0O C;  4PDK A;  2XSJ C;  1S7O A;  1ETQ A;  2ESH A;  3KZI C;  1XN7 A;  3FWE A;  2XGE A;  4M9Z A;  4EVI A;  3CF2 A;  5H2F C;  2PJR B;  3GFI A;  3FX3 A;  1QVU A;  5F64 A;  2QBY A;  3CCS I;  3EYI A;  4HOB A;  3PIO F;  2M4K A;  3GTM J;  1GV5 A;  4BUP A;  2VJJ A;  3GZ6 A;  3M9A A;  2BVL A;  2V1D A;  5HDG A;  1X4P A;  2F4I A;  1ZLK A;  1NG7 A;  1QZE A;  3EPZ A;  5EEH A;  2LDU A;  3X2Q H;  2EFQ A;  5E1W A;  1AHD P;  3HOU J;  1UMQ A;  3DKW A;  4XLA A;  4XN0 A;  4YRV A;  3RPQ A;  1FBU A;  1X1A A;  4BQQ A;  2UZK A;  2EFO A;  2KIF A;  1E3O C;  4DBQ A;  2E60 A;  3M1E A;  2CFO A;  2DOA A;  2XPW A;  4KJZ A;  1Y1W J;  4A3C J;  2B0L A;  2X6W A;  1FMW A;  2KZV A;  3BLY A;  2EIM H;  3BTJ A;  4U7B A;  1IN6 A;  2A6T A;  2ZME B;  1XX5 A;  1EV7 A;  1VQ6 I;  4FCY A;  4AID A;  2HZD A;  1D1A A;  2EPF A;  4JQF A;  4XKV A;  1HLV A;  1B9N A;  3EYY A;  1P7J A;  2BY2 A;  2DOE A;  5TGT A;  4DBR A;  5EYR A;  4BXX J;  3H9J A;  1Z77 A;  4RBO A;  3CUQ A;  4IQJ A;  3CO7 C;  2VBW A;  5JLW A;  2FOK A;  4M72 A;  5D5U B;  1XMX A;  3OYH A;  1F4K A;  3GTQ J;  2V9P A;  4Y17 A;  1F9N A;  4CYD A;  4PSX A;  5DD4 A;  1VQN I;  2DMN A;  5LRR A;  3UNG C;  2DI3 A;  1FMV A;  4LB5 A;  4FAS D;  1BW5 A;  2MH2 A;  3JSP A;  5FKN A;  3C7J A;  5KCM A;  1B6A A;  3CC4 I;  2EZH A;  3RZD J;  1VTN C;  3QU6 A;  3ABT A;  3SZT A;  2FQ4 A;  2DDB A;  3E3V A;  4OIO F;  3LSM A;  1ETY A;  5BNG A;  4KN4 X;  4KT6 A;  4RDU A;  3KP2 A;  3PO2 J;  1O3S A;  2O7O A;  1SVO A;  5IPA A;  1BW6 A;  4Y4R A;  5D4R A;  4WCG A;  1UG2 A;  2WY7 Q;  2XGD A;  4JBA A;  5JVT A;  1DUX C;  1VND A;  1OPC A;  3TQN A;  4AM3 A;  5L3G A;  5KVR A;  2ZSH B;  3JCU C;  1ZRF A;  1BOB A;  1W1W E;  4UB6 C;  4RGX A;  4Y15 A;  4A3E J;  4WXC A;  1TL8 A;  3LL7 A;  4II3 A;  2STT A;  4BEH B;  3O8H A;  1EJ9 A;  3W2V A;  1ENH A;  2XAJ A;  1OR7 C;  4S05 A;  2DMP A;  2R0Q C;  3DKX A;  3FDY A;  2KFD A;  2XIG A;  4HAM A;  1MW7 A;  4NC8 A;  4MHG A;  3HTS B;  2LNB A;  4ZJZ A;  3MKY B;  2JQ7 A;  2DFE A;  3DBL B;  5BS6 A;  2HOT A;  4ETS A;  1SD7 A;  3TOB A;  1CF7 B;  4Y52 J;  1AU7 A;  3MVP A;  4RB0 A;  2O3F A;  3JRI A;  1HW1 A;  2ICW G;  2BVM A;  2P7V B;  4PGH A;  4BBR J;  2HQR A;  3BQZ A;  3F8C A;  2FU4 A;  3E97 A;  3BRO A;  4KNY A;  1HC8 A;  3KYC B;  1IXS B;  2MFZ A;  2WTE A;  2KP6 A;  2I5U A;  3K7A J;  4JOM A;  2PMZ N;  4BQO A;  5GPC A;  4L5J A;  2NOJ B;  3JR9 A;  1KU2 A;  2DMQ A;  3LQR A;  2IS1 A;  2KIM A;  1IRF A;  2AXT C;  3HYI A;  3OOP A;  4ESJ A;  1TW3 A;  2Y2Z A;  4OWR B;  5FFZ A;  3DU5 A;  2Y69 H;  4HST A;  2QEN A;  4YFX F;  2W7N A;  5D4S A;  4UNO A;  2H8R A;  3BG7 A;  3KPH A;  4EGY A;  3BG5 A;  1YW9 A;  3QPS A;  1RR8 C;  3LOC A;  3K10 A;  6PAX A;  3A0B C;  3H9G A;  3ZGK A;  1LFP A;  4MIM A;  3RKQ A;  3S3M A;  1G59 A;  1W7P D;  1YLF A;  3LSR A;  5JFR A;  4C3J J;  2P5L C;  2MG4 A;  1PUF B;  4LJZ F;  1RR7 A;  2XHK A;  2QSG X;  2O61 A;  1DQU A;  1MNE A;  4RAY A;  4MTD A;  4E7H A;  2CGP A;  4YFN F;  3A03 A;  3H1C A;  3RPU A;  5FLM J;  2GWR A;  3LSK A;  4MGR A;  3DQV C;  2VJ5 A;  3N4M A;  3IH3 A;  3A0H C;  1X3U A;  1VQ8 I;  4DYQ A;  1Y39 A;  2OBP A;  4PCQ A;  3D5S C;  3MKW B;  1WJF A;  3PSI A;  3AG2 H;  1YW7 A;  3E6M A;  2R93 J;  3GO5 A;  3M3Y J;  5F0F A;  5M5X J;  3OS2 A;  2JPC A;  1VQ9 I;  3LFK A;  4F55 A;  3FXU A;  3ZCO A;  3K2Z A;  3V8L A;  1KQ0 A;  4ABZ A;  2E2J J;  3VSK A;  3DV8 A;  1TWG J;  1R49 A;  3I4P A;  1LKX A;  1UZC A;  5L3E A;  2O6G E;  2XAG A;  2Y31 A;  2XAH A;  3FMR A;  3Q9S A;  1X58 A;  4UV9 A;  4CO8 A;  2BEO A;  1BI1 A;  1JKO C;  2F5C A;  3OL3 A;  4FX0 A;  2LRD A;  3VYS B;  4HG2 A;  3RDI A;  3NWS A;  4N4N B;  3HHH A;  5HOD A;  1B8I A;  2R7O A;  3KET A;  4A3K J;  2OTJ I;  3DPU A;  2RNJ A;  2CU7 A;  5FFX A;  5GAD J;  3E5U A;  4D7M A;  4QLC U;  2OF7 A;  2M87 A;  4ZYG A;  5BPD A;  2K02 A;  3WTS C;  5J1Y A;  4UUT A;  1OCC H;  4Y13 A;  4RAF A;  5F27 A;  3JRD A;  3K70 C;  5DM7 F;  2L7M P;  4I0A A;  4XLF A;  3DBR B;  3OYL A;  1J75 A;  2HDW A;  4HA8 A;  3FIS A;  3U9G A;  3HL2 A;  2Q2E B;  3OR1 C;  4CHU A;  2KJC A;  2DPD A;  3J81 K;  1BR4 A;  1UHS A;  2EIJ H;  1IRZ A;  1ACI A;  1Y8Q B;  3I59 A;  2WA0 A;  3C2H A;  3TP0 A;  2CW7 A;  4L9J A;  4NB5 A;  5CVJ A;  3HG9 A;  2N8G A;  1TBX A;  3PJR A;  1D8K A;  1V3F A;  3E1S A;  2E19 A;  5B1B H;  3TW6 A;  2FOW A;  3Q9V A;  3KEO A;  3ESW B;  1T39 A;  5E1X A;  4KIG A;  4ZYE A;  3OYM A;  3RKW A;  3ZQC A;  2VPL A;  2NS8 A;  2FJ1 A;  2DA4 A;  2IA2 A;  2V4J C;  1RKW A;  1WI9 A;  2EV5 A;  2XKP A;  1S8N A;  3LSI A;  2FSW A;  2KKO A;  2ETH A;  4U0W A;  4E7Z A;  1OIS A;  4AWX B;  4YIF A;  4ASN A;  3BPX A;  3ZQQ A;  1Y0U A;  3WTV C;  1GVD A;  1F1Z A;  4IQ4 A;  1W36 D;  3BZ6 A;  4QTR A;  5CKT A;  1XGM A;  1R5I D;  1OYY A;  1R23 A;  3E0J B;  3K1M A;  3F21 A;  3MAJ A;  5FJ8 J;  1IGN A;  5GAH J;  3VYU B;  2BY3 A;  4FET A;  1ZHF A;  3CMM A;  4HF2 A;  3OYA A;  3H9Q A;  2PFB A;  1G3T A;  2P0W A;  3L9F A;  2H8W A;  2X6O A;  2XAS A;  2VT2 A;  4XSX F;  2NOG A;  2O03 A;  5DD8 A;  4ANJ A;  3AKZ A;  4A5M A;  1VQM I;  3MN2 A;  1REP C;  3ZMT A;  4HX8 A;  5IT3 A;  1R1U A;  2P8T A;  2IJL A;  3RSN A;  4PZJ A;  4AIJ A;  2M34 A;  1KA8 A;  5CYV A;  1JE8 A;  1WH5 A;  5M5W J;  3S93 A;  2DK8 A;  3HSF A;  2IVM A;  1FYK A;  1GDT A;  2XF7 A;  3F3X A;  2P5V A;  2WV0 A;  4AD9 A;  3H0D A;  3GFM A;  1DU6 A;  3HSE A;  2NVY J;  4M3F A;  2M2E A;  4NDL A;  3ISP A;  2PMH A;  1JUP A;  3V7R A;  3KLN A;  4EMS A;  2Y0S A;  4AIK A;  3E7L A;  3KP7 A;  1FY7 A;  1IRX A;  4YII A;  3MZH A;  4V2G A;  3KYL A;  1JXS A;  1ETW A;  3FZV A;  4F92 B;  3J7A Y;  2JA2 A;  1JGG A;  4L5E A;  2R7F A;  3OV8 A;  3SYT A;  2VKD A;  3KP4 A;  2ME0 A;  4A2U A;  1CGP A;  4ZZD A;  3FHN A;  1D8J A;  4IPA A;  4F52 A;  2IGK A;  5J4V A;  1MMD A;  5JI6 A;  3DLL F;  3GTG J;  2OPT A;  1Z9C A;  2DT5 A;  3F72 A;  5M3F J;  4BKX A;  4UY8 I;  4M6X A;  1HXD A;  3U21 A;  5K5O A;  5JLX A;  1BIA A;  3CO6 C;  4LG3 A;  2DA7 A;  2X6X A;  1SD5 A;  2R92 J;  4HQM A;  5BQT A;  4OIQ F;  4A3B J;  2E5N A;  2V9V A;  3DPL C;  4K2E A;  5ICG A;  1JTX A;  3K4C A;  4BHP A;  4DNC A;  5ICC A;  3VWB A;  3LA3 A;  3WOD F;  3A01 B;  3GTO J;  1I1S A;  1RIO H;  3PNV A;  5BOX A;  1JT6 A;  1ZGA A;  2DO7 A;  4BS9 A;  1YX3 A;  3GUD A;  3GVA A;  3CCR I;  3FK7 A;  4JX4 A;  3HRS A;  2KRH A;  3CLQ A;  3EDP A;  4EGZ A;  1H8A C;  2KDZ A;  1WPK A;  1OCR H;  1WJB A;  2I10 A;  1PDN C;  2ELH A;  3ZQ7 A;  3D5R C;  3ELK A;  4GXO A;  1TNT A;  1LUJ B;  1ON1 A;  5E18 F;  2XVC A;  1OMI A;  5HNH A;  2HWV A;  1YTY A;  3CCY A;  1JTY A;  2ZXJ A;  1IG7 A;  1ODD A;  5EEA A;  1OR7 A;  2WAE A;  2DA2 A;  1MNM C;  1B72 B;  3BZK A;  1UG0 A;  4A3M J;  3CJT B;  1R7J A;  2FEZ A;  3H0G J;  3CJN A;  3P9I A;  3TED A;  2FRH A;  5A2Q Z;  3KP3 A;  2D45 A;  1B9M A;  1FSE A;  2ADU A;  3OY9 A;  2DK5 A;  4WXD A;  3F8B A;  2FBI A;  1T98 A;  2LYC A;  3H5R A;  2CQN A;  1EH7 A;  2A5Y B;  2IEK A;  4PSW A;  4J01 A;  4A3D J;  4A3I J;  4CIC A;  4BY7 J;  5J8C A;  3OS0 A;  1ETK A;  5F0H A;  2RDP A;  3S1M J;  4E7I A;  2P81 A;  4EM0 B;  2A07 F;  3ZOB A;  3M1C A;  4AIH A;  4RLF A;  3G4S I;  1H9T A;  1X19 A;  1MGT A;  1LEB A;  2W48 A;  5TRD A;  3F8N A;  4E7K A;  5FKL A;  5H20 A;  3DEU A;  3PUB A;  1UCR A;  2VT3 A;  1U5T B;  4A69 C;  1JKR C;  2COB A;  2QVO A;  3Q0W A;  4LK0 F;  2VQG A;  4B3X A;  1J09 A;  2RC4 A;  2GXA A;  4ZTJ A;  4I98 B;  3MWM A;  4M3D A;  1Y0N A;  4HV5 A;  4HEA 2;  3TDU C;  3S1Q J;  1PYV A;  5DUK A;  3V4G A;  1LVA A;  3DEE A;  2KIS A;  2XRL A;  1MJ9 A;  1YYV A;  1T33 A;  5IP6 A;  2R5Z B;  2YR2 A;  3DF8 A;  4XOT A;  5E8G A;  2X6Y A;  5D5V B;  3HOV J;  4G6T B;  2K4J A;  1FYL A;  4HX7 A;  4KDP A;  1R9T J;  2IBD A;  3U1D A;  1YIO A;  2DLL A;  2E71 A;  2O5R A;  4Z2Y A;  1QZY A;  1WZ2 A;  1A35 A;  1W5T A;  2ID3 A;  2L7F P;  3OYK A;  2GAU A;  2QYO A;  3L2Q A;  3OYJ A;  2R4G A;  2MBF A;  4CYC B;  4II2 A;  3A02 A;  2H09 A;  2L4M A;  3H3U A;  4YFK F;  4Y3O A;  4DJA A;  1OKR A;  2MC3 A;  4RGU A;  3HXL A;  4DIQ A;  4M71 A;  2VBZ A;  3ZMZ A;  1NHA A;  1SMY F;  2JUC A;  3E6D A;  4PJN A;  4RA2 A;  5ILU A;  1AKH B;  1QGP A;  2MLG A;  4OMZ A;  3FBI B;  2LP0 A;  4UXN A;  3HKZ A;  5FKO A;  2OC6 A;  3LSH A;  1B1B A;  3F0C A;  5FKK A;  3BWG A;  3ROU A;  4FE4 A;  1A31 A;  2LOO A;  1GV2 A;  3JW4 A;  3OL4 A;  1O3T A;  4N9I A;  3BR0 A;  5F0C A;  3AFH A;  4OIN F;  1GT0 C;  4GFB A;  3NEU A;  4C2M J;  1I50 J;  4FE7 A;  3COA C;  4XLP F;  2VC1 A;  3T5X A;  1ON2 A;  3QU3 A;  4NQW A;  1FIP A;  2JUG A;  2X4H A;  1WWX A;  3K0L A;  5IYC J;  5KNL A;  3E5Q A;  1V5G A;  4BE2 A;  1VQ5 I;  3L2U A;  1Z7L A;  1Z6T A;  3P5J A;  3RZO J;  5EG0 B;  4C9Y A;  2VE8 A;  2KDO A;  2PI0 A;  1LE8 B;  1LFU P;  5FRN A;  2VBY A;  4MO7 A;  3TL4 X;  2HGC A;  4D7N A;  1SMT A;  4A6E A;  3PO3 J;  3LA7 A;  2R7V A;  2MC4 A;  1EKE A;  2MGQ A;  3JRC A;  2L4A A;  2BV6 A;  4HYE A;  5GTH C;  4G94 A;  2CV0 A;  1TW2 A;  2R7X A;  2RVC A;  4LIU A;  3MKZ A;  4BH9 A;  2XB5 A;  4OU0 A;  5EGO B;  4LG0 B;  3PQK A;  5HDK A;  2HR3 A;  3T8T A;  3A2K A;  4J00 A;  1K61 A;  2ESN A;  1Y6I A;  3IAS 2;  4BL0 B;  3J7A O;  2VI6 A;  4HPQ A;  3CZ6 A;  4ZYD A;  3TBI A;  1FOX A;  3WGI A;  3DEW A;  1QVT A;  1LEA A;  5HS9 A;  1X3Z B;  3G73 A;  1G6N A;  3C2G A;  1VQ4 I;  1FPQ A;  3J80 Z;  1T08 B;  2D2W A;  3K2A A;  2OQG A;  1E3P A;  2WAD A;  3FK6 A;  3REO A;  1ULY A;  4XOP A;  4A6D A;  1JJ8 C;  4XLN F;  2K7L A;  3FKJ A;  1BN5 A;  4AYB A;  2PJR A;  1P4W A;  1RPW A;  2A68 F;  4C3H J;  2ACJ A;  3FM5 A;  3S14 J;  1OCP A;  4W97 A;  2OUM A;  3HGY A;  2GQQ A;  1K78 B;  3DCF A;  1G2H A;  3NWT A;  4XKW A;  3WG9 A;  4CH7 A;  4LLG F;  3WHC A;  3SZP A;  2RKH A;  5K7Z A;  2DAO A;  2LBF B;  4H0E A;  4DW6 A;  3I4M J;  4BNC A;  2LF7 A;  1WSU A;  3EQL F;  3KE2 A;  2CS3 A;  4EJT A;  2CMP A;  1U78 A;  2UUZ A;  2CUJ A;  4GDF A;  1Y8R B;  1R58 A;  3TO7 A;  3MQ0 A;  5J8F A;  5EZH A;  3L2R A;  1GUU A;  1OCO H;  3HUG A;  2R7Q A;  3QYE A;  2ZFW A;  3OIQ A;  2I8D A;  3CME I;  1IF1 A;  5IOZ A;  1IXC A;  4G6D A;  1XMK A;  3K69 A;  2JTV A;  2L02 A;  4YIR X;  4CSW A;  1W5S A;  3TO9 A;  4KMU X;  3JAM K;  2EFW A;  4B8X A;  5HVQ C;  2ZME A;  4IF4 A;  1XGS A;  1XSX A;  2K3F A;  2M45 A;  3RPU D;  3WGH A;  4X6A J;  3U2R A;  3R6S A;  2MD0 A;  3ZXS A;  4HW0 A;  3V42 A;  1S9H A;  4M9X A;  1YO5 C;  5B1A H;  1Z3X A;  2IW5 A;  4HNT A;  1QHH D;  4IXA A;  4DYC A;  2L9V A;  5DCF A;  5J6X A;  3QRF F;  1TC3 C;  2CV2 A;  3ASO H;  2QGU A;  2A6E F;  2L3D A;  3VEP A;  2FXA A;  3BDD A;  2LF8 A;  3BP8 A;  4RAG A;  4IHX A;  1STZ A;  4FIS A;  1C0W A;  3HC7 A;  4Z6Y A;  2GOM A;  3ZQF A;  1FP1 D;  4IRI A;  5H6R A;  3AG4 H;  5AON A;  3V8K A;  3CDI A;  4M9S A;  1PJR A;  2DYR H;  5M5Y J;  4IHV A;  1TP4 A;  3RTR A;  2ZJR F;  1TQI A;  3K4M A;  5HLI A;  1SFU A;  3H92 A;  2R7R A;  1LJ9 A;  2CJJ A;  2HFH A;  4BDY A;  1OCZ H;  3D1N I;  2EFP A;  3E5X A;  3LFU A;  1UST A;  2NVX J;  3WHB A;  1I39 A;  2KRF A;  2BZT A;  1BJA A;  2FE3 A;  2LKP A;  3M8F A;  3DBH B;  2JN6 A;  1NK3 P;  3W6J B;  1LVK A;  5DCM B;  4BEH A;  3K4J A;  2IS6 A;  3CF5 F;  2VB6 A;  4LD5 A;  3I53 A;  4UB8 C;  1ZGW A;  4S04 A;  1A5J A;  5J4Y A;  4P5O A;  4IKF A;  5FGM A;  1ZRC A;  3LSP A;  3CTA A;  3VDX A;  3CQZ J;  4JX6 A;  1YOV B;  1CF7 A;  2EQR A;  2HZT A;  4PJJ A;  1GXP A;  2TCT A;  2PQ8 A;  2WAQ A;  1DGR M;  2QQA A;  4G8X A;  3WTW C;  1DDN A;  2K40 A;  5LEK A;  2DJI A;  5DM6 F;  1R00 A;  1D1C A;  4ZDL A;  1YJW I;  2V6C A;  2UXN A;  3CCJ I;  3FIW A;  1BC7 C;  2ZSI B;  5GPA A;  5JHF A;  1ONV A;  2F5V A;  4XR6 A;  3WTZ A;  3CCL I;  1BJZ A;  3M7G A;  4HNV A;  5EZG A;  3AL0 B;  2WY8 Q;  2QQB A;  1ZYR F;  1MDM B;  1ETO A;  2CUF A;  3WTY C;  1U5T C;  1IRG A;  2CWE A;  3IUO A;  1WJA A;  4XRS A;  3VOD A;  3DFG A;  1YQA A;  4P9U A;  1LNW A;  3ZQH A;  5ICF A;  1TWA J;  1BOA A;  2A61 A;  2H94 A;  4V2F A;  2YSR A;  2AS5 F;  1LDK B;  4WF2 A;  2DFH A;  5KK1 A;  3OYI A;  4M3B A;  4TV7 A;  2VL8 A;  3GEZ A;  2FMY A;  3A4C A;  2FF4 A;  4UVC A;  5J40 A;  4R8H A;  2K3P A;  1USS A;  5E8I A;  3WU1 B;  1PUF A;  2ISZ A;  2XPU A;  1VFC A;  1MBK A;  1J2X A;  1ZG3 A;  3L1P A;  1MBJ A;  1ITY A;  4MNU A;  1RNL A;  2FD5 A;  5E17 F;  4CZC A;  1QPI A;  5F1R A;  4UVB A;  2MD5 A;  3OYC A;  5FD6 A;  3OOU A;  4S0H B;  5LGN A;  2B7E A;  2HNH A;  4N0B A;  4YEL A;  3JRA A;  2VOD A;  3IV5 A;  1HF0 A;  2HYJ A;  5D6F A;  3K9T A;  1ZR2 A;  3VYR B;  2F6C A;  3H36 A;  1PUE E;  4PFO A;  1HW2 A;  3L7W A;  2CV1 A;  3ERM A;  1AA7 A;  2LG4 A;  1Z91 A;  5JHU A;  4XN3 A;  4CUG A;  3GZ5 A;  3LSG A;  4XON A;  2QUF A;  1D1B A;  2XV4 S;  1Z7U A;  5J3L A;  5IYB J;  1I6X A;  5BMZ A;  3G3Z A;  1T2K A;  2A05 A;  4HX4 A;  3S17 J;  3J7Y J;  2HQ5 A;  3OYF A;  4DGW B;  5LEJ A;  3IRR A;  3EUH A;  2E1C A;  2K85 A;  2VBX A;  5E3O A;  2BY0 A;  2OU2 A;  1S6L A;  3GME A;  4WX9 A;  1I6H J;  1O4X A;  2JZY A;  3OIP A;  2W84 A;  4EM1 A;  2LTP A;  4F7Z A;  1I3Q J;  4EJW A;  1K4T A;  2VOO A;  1POG A;  1EF4 A;  1NK2 P;  1VI0 A;  5E3L A;  2Y0S N;  4UVA A;  1KZH A;  3IRQ A;  2BW3 B;  2QCO A;  3GW2 A;  4DYR A;  3LST A;  4RM2 A;  2Q0O A;  2R7D A;  2LMD A;  1YJN I;  2AQE A;  2F5F A;  2FUG 2;  1HA8 A;  4EQQ A;  2DU9 A;  4XIC A;  2X85 A;  4V19 K;  2X48 A;  1GVJ A;  2R7Z J;  4E4H A;  3F6V A;  3BCA A;  4MTE A;  4CCM A;  1IXR C;  3CCV I;  4OAY A;  3M07 A;  2WAF A;  3PNY A;  1IC8 A;  1HSJ A;  2P4W A;  3LMM A;  2DMU A;  2G9W A;  3KIO A;  1OYW A;  4O3M A;  4WXH A;  5JVG F;  4NHJ A;  4AVZ A;  2XSD C;  3DPT A;  4KUM A;  2UWM A;  2D1H A;  1YIJ I;  5K7F A;  3ASN H;  3BJO A;  1K83 J;  3SHF A;  2KIU A;  3HOZ J;  3EUA A;  2LFB A;  1P9Q C;  5HNF A;  1WQ2 A;  3R0J A;  5CVR A;  3BPV A;  3HIF A;  1YIT I;  3IC7 A;  4O5V A;  3J81 Z;  2ELJ A;  2H1K A;  1WH7 A;  4HLX A;  1JGS A;  4AVP A;  3FXK A;  4MFE A;  1R36 A;  3PL8 A;  4B1R A;  5C4J J;  3HSR A;  2BHY A;  2Y0M A;  2NVU B;  2P7C B;  1FT9 A;  1WKM A;  4Q4Z F;  3K4L A;  5FKM A;  3WE3 A;  2KRC A;  3G1O A;  4MQ9 F;  3EUK L;  3O3K A;  3W2A A;  5ED4 A;  1FBQ A;  3ABU A;  2EH3 A;  1BBY A;  2M9H A;  2A69 F;  2ID6 A;  2NYX A;  4HDV A;  5DEQ A;  4HNU A;  3QYF A;  1AOY A;  1XDS A;  1H9G A;  3DTE A;  2HI3 A;  4XRS G;  2V6E A;  2P5K A;  2R7W A;  2EIL H;  4M6Y A;  1W7P B;  1T38 A;  2RQP A;  2ZB9 A;  3NQO A;  3KZZ A;  3BQY A;  1J7K A;  3BG3 A;  5IP7 J;  2M8G X;  3OSG A;  1K4S A;  1E3H A;  5LRS A;  2X0L A;  1W4M A;  2OCE A;  3OSF A;  5E3M A;  4LGW A;  5LHI A;  1VQK I;  1MMS A;  1IN8 A;  2RNG A;  1DP3 A;  4XLE A;  3ZRG A;  3KP6 A;  1R1T A;  2PEX A;  3WG7 H;  4KIT B;  4HLY A;  2E7W A;  3FXM A;  3H3Z A;  4JK1 X;  1P2F A;  1M1E B;  2ZME C;  4IVN A;  4BY1 J;  2L7K A;  4Q47 A;  3ZMD A;  4EJV A;  3IKV A;  3BCB A;  2XB0 X;  3RCO A;  3L00 A;  2E1M B;  1WCM J;  3OIO A;  2W82 A;  3WU0 A;  2KIQ A;  3LAP A;  4BXU A;  3H35 A;  5LFA A;  4DZP A;  4KFC A;  3A1Y A;  4EM2 A;  4UUS B;  2JVG A;  4HBL A;  5HOO A;  3ERE D;  4XKC A;  5J1R A;  1ZTR A;  1T8I A;  4F3Q A;  1MSF C;  2GBY A;  3I54 A;  2QEX I;  1HQC A;  3ZQL A;  1OLT A;  5HS7 A;  3MZ8 A;  1Q1H A;  3JRG A;  3NAR A;  4L0Z B;  1S7A A;  1F5T A;  5DDG A;  3GYH X;  2CRG A;  1SFX A;  2AXL A;  3ZN1 A;  2OJE D;  1UHM A;  5HDN A;  4I0B A;  4JX5 A;  2ZNY A;  2Y48 A;  2D5V A;  4R1H A;  4GYI A;  5J1U A;  2CH0 A;  1CQT A;  4RGS A;  3BR1 A;  2VC0 A;  2W00 A;  4DOZ A;  3G71 I;  1D0Z A;  1JKP C;  2EZK A;  2E2H J;  2W24 A;  2DW4 A;  2EA4 A;  3IHU A;  5FB2 A;  2OZ6 A;  4CCL A;  4ZDP A;  4XL9 A;  4IRH A;  2XAU A;  3WE2 A;  1K6O A;  3A01 A;  3E6B A;  5BPI A;  2DPU A;  5FLX Z;  3G1M A;  2K86 A;  3I5U A;  3QPL A;  2VN2 A;  3Q0U A;  3S32 A;  4KYW A;  3D0S A;  4GCV A;  3ABK H;  2XRO A;  3R60 A;  5L3B A;  5DS9 A;  1B4A A;  1MIJ A;  1XSV A;  3OYN A;  5GTI C;  1D0Y A;  3UKG A;  2LY9 A;  1KYW A;  2EV0 A;  1D5Y A;  1D3Y A;  2F5D A;  2FBH A;  4M73 A;  5CVI A;  3RIR A;  3CCE I;  1EA3 A;  2Q8K A;  3M8J A;  2E34 A;  1XB4 A;  1YS7 A;  2STW A;  1QO0 D;  2DCE A;  2M3A A;  3K70 D;  2BXY A;  1Q1V A;  2V1U A;  3KEY A;  1B72 A;  3HEF A;  3I71 A;  1W0T A;  4ON0 A;  2D1V A;  2JJ7 A;  3KZY A;  3CCQ I;  3HKZ N;  3SZG A;  2R3S A;  2QWW A;  2JVH A;  3OR2 C;  2ELK A;  1L3L A;  5FRM A;  2QKM B;  3KCC A;  2HYG D;  1T0F C;  3PM1 A;  4ZC3 A;  5D5X B;  1Z3Y A;  5KAF C;  2NNY A;  2QF7 A;  3O8G A;  1ZQ3 P;  2OA4 A;  3FXR A;  3AL0 C;  5IT9 K;  4L9T A;  2EIK H;  2KT0 A;  1WHU A;  2BHZ A;  4L9V A;  1YRN B;  2JA8 J;  3KEQ A;  5CQE A;  1QZZ A;  1FZP B;  3LSJ A;  3O2P E;  2L9S A;  2DMT A;  4KT5 C;  4LIV A;  1VQ7 I;  5E79 C;  3KFW X;  2EBI A;  1XC5 A;  4FHT A;  4NBQ A;  2DQR A;  2G7U A;  2IAI A;  3P7N A;  4LMY A;  1U5T A;  3I3L A;  2DQL A;  2Z99 A;  3FMS A;  1TNS A;  5CJ9 A;  3VYT B;  3BJ6 A;  1IV8 A;  2DFF A;  4A3G J;  2HU9 A;  2MSY A;  1D5V A;  1XCB A;  2JSP A;  5B3S H;  5KAI C;  4AU7 A;  3J7Z I;  2HDD A;  1FWZ A;  2H27 A;  1G3S A;  2DA3 A;  3NAU A;  3ZMU A;  3W3C A;  5HLG A;  5CLS A;  1T56 A;  5H6Q A;  1DP7 P;  2RRE A;  2HVQ A;  2R5Z A;  4P1W A;  3VB2 A;  1XDU A;  2F4O B;  2OTL I;  1OCT C;  2M1B A;  2MLK A;  3VPR A;  4HF0 A;  1XSD A;  2EK5 A;  3F22 A;  1E0E A;  1ERD A;  4AYB N;  2NRA C;  4PJ0 C;  3LA2 A;  1ZEL A;  1YFH A;  2G0E A;  1SVL A;  3S2D J;  5IOY A;  3I58 A;  3TMO A; 
#chains in the Genus database with same CATH homology
 4F55 A;  3RPU D;  3ZCO A;  4F93 B;  4C2U A;  2IS2 A;  1N75 A;  2MD0 A;  3EUH C;  3ZXS A;  3VSK A;  4CCN A;  3V42 A;  1S9H A;  4B44 A;  1LKX A;  3N05 A;  1Z3X A;  2HVS A;  3CJQ B;  2KQR A;  4HNT A;  1QHH D;  2CV2 A;  4E6K G;  3OL3 A;  2LRD A;  3VYS B;  4HG2 A;  3NWS A;  4N4N B;  2AQF A;  2W1O A;  2R7O A;  3HC7 A;  2Q1Z B;  3FBN B;  3DPU A;  2GOM A;  4XNF A;  2XDV A;  2VXZ A;  1UAA A;  1DGW Y;  3L2V A;  4RLQ A;  1PJR A;  2L5Q A;  2MYS A;  3RTR A;  3K4M A;  3K70 C;  2R7R A;  4NUB A;  3OYL A;  4XLF A;  4BDY A;  4B47 A;  2HDW A;  5CPR B;  3LFU A;  3HL2 A;  2Q2E B;  3OR1 C;  1UEL B;  3CP8 A;  1X1B A;  1BR4 A;  3D5L A;  2L9N A;  4NNJ A;  2WA0 A;  3C2H A;  2ZXH A;  2CW7 A;  2M7A A;  2WB1 A;  2IXS A;  3HG9 A;  1LVK A;  4ITV A;  4BEH A;  3HOS A;  3K4J A;  2E5Z A;  3PJR A;  2IS6 A;  2WBM A;  2VB6 A;  4XM3 A;  3E1S A;  3PSF A;  3CJR B;  4P5O A;  4IX7 A;  4IKF A;  2IGN A;  3W2W A;  1QU3 A;  4PFP A;  2VQH A;  3OYM A;  2XC7 A;  3VDX A;  2VPL A;  2VAS A;  2V4J C;  4E7J A;  4PJJ A;  1TZL A;  3LSI A;  3ZR8 X;  2WAQ A;  1DGR M;  4HRI A;  2DT6 A;  4E7Z A;  2DJI A;  2XF5 A;  3ZQQ A;  1D1C A;  4ZDL A;  4IQ4 A;  1W36 D;  3IAM 2;  3VSL A;  5CKT A;  2ZSI B;  1GLN A;  3OWT A;  3E0J B;  5CQG A;  5JHF A;  2F5V A;  3OYB A;  4XR6 A;  3F9K A;  3AL0 B;  2V1N A;  3BG6 A;  2WY8 Q;  3VYU B;  2ZFU A;  3ONQ A;  3CP2 A;  3QOE A;  4FET A;  1T95 A;  3CMM A;  4PK4 A;  4BGD A;  3MMY B;  4B48 A;  3OYA A;  3H9Q A;  4PUS A;  2K9M A;  3IUO A;  1WJA A;  2P0W A;  1X4O A;  1D0X A;  3OYD A;  4ANJ A;  3AKZ A;  3HPH A;  1N78 A;  3G2B A;  2LBF A;  3OMY A;  4ZYA A;  1LDK B;  3DTK A;  3MD2 A;  3OYI A;  4E7S A;  3DU6 A;  4QPO A;  2VL8 A;  3RSN A;  4BQN A;  1WJD A;  3A4C A;  3QOD A;  2R7T A;  4IZZ A;  1WFX A;  2K3P A;  4OAZ A;  4D9J A;  5LD2 C;  3S93 A;  3DWL E;  2E1M C;  2KLO A;  2XF7 A;  1MMA A;  5KHD A;  2W4S A;  3H0D A;  4BJT A;  4CZC A;  3OYC A;  1MMG A;  3OOU A;  2HNH A;  4YEL A;  2Y0S A;  2CUZ A;  3KX2 A;  1SFK A;  2K5C A;  3HUG B;  1IRX A;  3KYL A;  3VYR B;  1R6R A;  2F6C A;  4F92 B;  4PFO A;  4E7L A;  3J7A Y;  2DT7 B;  2CV1 A;  2JA2 A;  1AA7 A;  2LG4 A;  2M0M A;  3SYT A;  2VKD A;  1V5F A;  4XN3 A;  4CUG A;  3LSG A;  4XON A;  4R79 A;  1D1B A;  2VKH A;  3FHN A;  4F52 A;  2IGK A;  1MMD A;  4RMN A;  2R7S A;  4U87 A;  1KON A;  2VJ4 A;  3OYF A;  4DGW B;  2V9K A;  2HPM A;  2UV1 A;  2LH9 A;  2L2O A;  4BAC A;  2BOL A;  3OIP A;  3U21 A;  4LG3 A;  2X6X A;  2LC2 A;  2HPI A;  4BXF A;  3DKY A;  3PFY A;  2E5N A;  3DPL C;  2BW3 B;  3K4C A;  4RM2 A;  3VWB A;  2AQE A;  2FUG 2;  2R7U A;  1HA8 A;  2KL4 A;  3PNV A;  4HSR A;  3K6G A;  1WJC A;  2X85 A;  2K9L A;  1N77 A;  3UR3 C;  4BS9 A;  1YX3 A;  1G8X A;  3OS1 A;  4E4H A;  4NQW B;  3BCA A;  1MND A;  4CCM A;  2KRH A;  2V7F A;  2VIX A;  5FRO A;  4OAY A;  1BR1 A;  4BJ6 C;  2WAF A;  3PNY A;  1WJB A;  4CCK A;  3D5R C;  3LMM A;  2ZXI A;  1JI8 A;  3GBG A;  2VQC A;  1Y56 A;  1W36 C;  5HNH A;  4ZTF A;  4AVZ A;  2IGM A;  2LY2 A;  3DPT A;  2UWM A;  2WAE A;  1UG0 A;  4XKB A;  2X1D A;  3SDB A;  4BU2 A;  2X1C A;  4XQF A;  3EUA A;  1P9Q C;  5HNF A;  3DTI A;  2X1E A;  3I9V 2;  2ELJ A;  1Z21 A;  2Z16 A;  3PL8 A;  3OY9 A;  2LRE A;  4LIT A;  1YX5 A;  4BDZ A;  2LYC A;  2KHM A;  3CES A;  3H5R A;  4C2T A;  2VLA A;  1VZ0 A;  3K4L A;  4PSW A;  4J01 A;  2KRC A;  1U0J A;  3EUK L;  4X0G A;  3OS0 A;  3W2A A;  2GOX B;  1X1C A;  3OYE A;  2Z2S B;  4XMY A;  4E7I A;  3M1C A;  4RLF A;  2XSJ C;  4HNU A;  1X19 A;  3QYF A;  2QKL B;  3DTE A;  3SEZ A;  2XF6 A;  2V6E A;  4E7K A;  2R7W A;  3CF2 A;  3PUB A;  2PJR B;  2HVR A;  3OYG A;  2A5W A;  2M4K A;  1NG6 A;  2VJJ A;  4BUP A;  2BVL A;  2VQG A;  4B3X A;  1J09 A;  1X4P A;  2F4I A;  4KIS A;  1NG7 A;  2RNG A;  1DP3 A;  3EPZ A;  4XLE A;  4ZTJ A;  3ZRG A;  4KIT B;  1MMN A;  4XN0 A;  4XLA A;  4YRV A;  4HEA 2;  1PYV A;  3DEE A;  1X1A A;  4BQQ A;  3HPG A;  2L7K A;  2M7B A;  3BCB A;  2VXD A;  3RCO A;  4DBQ A;  2KPM A;  2E60 A;  2CFO A;  2DOA A;  2E1M B;  4XOT A;  4KJZ A;  2W82 A;  4BJ5 C;  4CCJ A;  2X6Y A;  4D1Q A;  2X6W A;  4H4K C;  3H35 A;  1FMW A;  5LFA A;  4G6T B;  2KZV A;  3A1Y A;  3BLY A;  4F91 B;  4U7B A;  2JVG A;  5HOO A;  2A6T A;  3S3N A;  4XKC A;  2O5R A;  2VQL A;  1SAU A;  1D1A A;  2HZD A;  4JQF A;  4XKV A;  4F3Q A;  3OYK A;  4PJL A;  4PJM A;  1OLT A;  3L2Q A;  3OYJ A;  2R4G A;  3BC8 A;  5TGT A;  4DBR A;  3H9J A;  4II2 A;  4IQJ A;  2VJI A;  4Y3O A;  3OYH A;  4DJA A;  4QPQ A;  4PSX A;  3HXL A;  4DIQ A;  4XOR A;  3UNG C;  1FMV A;  4FAS D;  3K4N A;  2CH0 A;  2W00 A;  4DOZ A;  1D0Z A;  3IP4 B;  5KCM A;  4PJN A;  4MLO A;  3PNT A;  4CCL A;  3FBI B;  4ZDP A;  4XL9 A;  2IS4 A;  2BW3 A;  1YE9 A;  4BE0 A;  3HKZ A;  3LSM A;  2XAU A;  2OC6 A;  3LSH A;  2CW8 A;  4KT6 A;  2LOO A;  3OL4 A;  3QYB A;  3AFH A;  2X51 A;  4CA0 A;  4Y4R A;  3RQ4 A;  4XLC A;  4C30 A;  3S32 A;  3K4K A;  2WY7 Q;  2DXI A;  3OYN A;  2JUG A;  1D0Y A;  2ZSH B;  5KNL A;  1BOB A;  1V5G A;  4BE2 A;  3L2U A;  1Z7L A;  1EA3 A;  1TT0 A;  2LY1 A;  3M8J A;  2PMZ A;  3LL7 A;  4RM3 A;  4II3 A;  2KMU A;  3H5N A;  2DCE A;  2M3A A;  4BEH B;  4C9Y A;  2KDO A;  3S8P A;  3K70 D;  1K6Y A;  2HQA A;  3W2V A;  1OR7 C;  5FRN A;  3KEY A;  3TL4 X;  3H5A A;  3DKX A;  3HOT A;  3FDY A;  1MW7 A;  4NC8 A;  2R7V A;  4YEJ A;  2MC4 A;  1V5E A;  3SZG A;  2MAB A;  3K4B A;  3OR2 C;  2JVH A;  4ZJZ A;  3MKY B;  5FRM A;  2QKM B;  4NC7 A;  4XLH A;  2CV0 A;  2R7X A;  4LIU A;  1T0F C;  4ZC3 A;  3MKZ A;  1Z3Y A;  2OV7 A;  2BVM A;  3A2K A;  4J00 A;  3AL0 C;  3IAS 2;  1Y6I A;  4BL0 B;  4HPQ A;  3CZ6 A;  1QHG A;  3TBI A;  1X1D A;  1WJE A;  5CQE A;  2MFZ A;  2KP6 A;  3L2W A;  4JOM A;  2L9S A;  2RQQ A;  4LIV A;  4EAT A;  4BQO A;  4BE1 A;  3C2G A;  4B43 A;  2NOJ B;  2IS1 A;  2WAD A;  2M4G A;  4XOP A;  3FKJ A;  4AYB A;  5HLT A;  2PJR A;  4ZDO A;  4OWR B;  3DU5 A;  3I3L A;  4HST A;  2W7N A;  4Y33 A;  2OUM A;  3BG7 A;  1WJ5 A;  3NWT A;  3VYT B;  4XKW A;  3K10 A;  2HU9 A;  2IGO A;  4CH7 A;  3H9G A;  2LBF B;  3ZGK A;  4N4O B;  1LFP A;  3S3M A;  2JSP A;  1G59 A;  2CS3 A;  4AU7 A;  2CMP A;  2UUZ A;  2CUJ A;  4CCO A;  3W3C A;  3DLA A;  3L2R A;  1DQU A;  1MNE A;  4GRI A;  4E7H A;  1BR2 A;  2RRE A;  2HVQ A;  3S3O A;  3SEQ A;  4P1W A;  2R7Q A;  3QYE A;  3OIQ A;  2I8D A;  3LSK A;  3DQV C;  2Z1D A;  2VJ5 A;  4CSW A;  1E0E A;  3D5S C;  1ERD A;  3MKW B;  1WJF A;  3PSI A;  2V26 A;  1ZEL A;  5HVQ C;  3OS2 A;  3TMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...