2M4GA

Solution structure of the core domain (11-85) of the murine norovirus vpg protein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
75
structure length
75
Chain Sequence
GRPGVFRTRGLTDEEYDEFKKRRESRGGKYSIDDYLADREREEELLERDEEEAIFGDGFGLKATRRSRKAERAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Murine Norovirus VPg protein
publication title Structures of the Compact Helical Core Domains of Feline Calicivirus and Murine Norovirus VPg Proteins.
pubmed doi rcsb
source organism Murine norovirus 1
molecule tags Viral protein
total genus 17
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2013-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1910 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2m4gA00
2M4GA
chains in the Genus database with same CATH superfamily
3PSFA 3HIFA 1ETYA 1W7PD 3HOSA 1MBFA 4MO7A 3K4BA 1BIBA 2ZMEA 4B8XA 1P9QC 3H5NA 4NBQA 4EJUA 4CCMA 2BXYA 2BHZA 3U9GA 4A3BJ 1ODDA 4CYDA 3QWLA 5LGNA 4XLNF 1L3LA 2NYXA 1X3ZB 3DQVC 1S7OA 3WTWC 1ZELA 4L5JA 3HKZN 1UHWA 5AIPA 4W1UA 2EIMH 1RR7A 4UVCA 5D4RA 1EH7A 2CU7A 2EWNA 2L5QA 5GP9A 2NS0A 1OYYA 1DU0A 3AL0B 4FX4A 4OAZA 4PJLA 3IC7A 3LA3A 3VB2A 2JA8J 3CC4I 4RAFA 2ZJPF 2N8GA 1GDTA 3HRSA 1UHMA 3K2AA 1X1PA 4HRIA 3QP5A 1TWCJ 2EZIA 3FMQA 1R49A 1MH4A 2E2HJ 2H8RA 1FPQA 3TO6A 3ZMTA 1EH6A 3OYMA 5ICEA 3VFZA 1A5JA 5JI6A 4LG3A 3L2WA 4FISA 2E2IJ 4Q4ZF 3JW4A 3RDIA 2GQQA 4O5VA 1FLIA 3WHCA 3CF2A 4FETA 2DA1A 1AU7A 5F08A 2OF7A 3J81Z 3EDPA 4I98B 3VYSB 2ECBA 2UV1A 4BHCA 2XVCA 2R7DA 4XRSA 1GV2A 2DK5A 2HTSA 3PUBA 3CCQI 1IV8A 4R1HA 1LJ9A 2EBIA 3CJNA 3MEXA 4WF2A 1OMIA 2JUCA 1TWHJ 2JJ7A 2X85A 1HOMA 3CLOA 2M9HA 2H27A 4DYCA 3PO3J 3ABKH 4I7HA 3ECOA 3ZQ7A 1TWGJ 2XHKA 1IN6A 3QPSA 5J1UA 5C4JJ 4HPQA 1USSA 2QYOA 3CUQC 3QYEA 3HXLA 3WHBA 3X2QH 1SD7A 3UNGC 1EKEA 1YW9A 2OTJI 3I9V2 5JHFA 1UG2A 1J7KA 3VOEA 3G71I 4UNOA 1ZR2A 3H0GJ 4IL6C 3SEQA 3M07A 3HDDA 1JTYA 3TGNA 2EV5A 3IUOA 2XUBA 4RAGA 2ZXWH 2RV8A 3AAFA 2QBYB 1ZG5A 2LMDA 1JHFA 3IKVA 2Y9ZA 3D5RC 4PJMA 4FX0A 3FX3A 4L9NA 4ENJA 3KLNA 1Y39A 5E3LA 3EUHC 4J19A 1VFCA 2DYSH 3GZ5A 5K5RA 2MW8A 2A07F 2B0LA 2UXXA 3ZN1A 1S29A 2ETHA 4CZZA 4HV6A 2H6BA 3ZMVA 2P5LC 1WH7A 2XAUA 2L02A 3BG9A 1ETOA 4RM3A 1LE8A 1REPC 1DPUA 2W25A 2ZNYA 2O0YA 2CUZA 3KFWX 3C2HA 2EFPA 1ZG3A 1LEAA 1FP1D 2VE9A 2MBFA 4XLFA 1F9NA 4XORA 2R5YB 1T0FA 3SDBA 5ICFA 1HSJA 4KJZA 1IO2A 2XSDC 1JT0A 1QHGA 5EDNA 3W6JB 1YJ9I 1Z3XA 2XF6A 3V7CA 4HF2A 4ESJA 3DBHB 1H0MA 2BW3B 2KZGA 1MMAA 4YIRX 3BG5A 4RDUA 1MNMC 2R4GA 2M45A 5JR3A 2KIQA 2X1CA 5L3FA 4CUGA 3R61A 3UR3C 2JZYA 3DKWA 2O61A 3SYTA 2QCOA 2W84A 2EFOA 4ZYAA 3N97A 4HDUA 4MQ9F 4EJWA 4IQ4A 5BPDA 4BU2A 5EZHA 1MH3A 6PAXA 1ZRCA 3J7AY 4UUVA 4BS9A 3HZJA 4XSZF 1KU7A 4NB5A 3CMMA 5DEQA 4M3EA 4HNTA 2YPRA 5F6FA 4NC7A 4FQGA 4UY8I 3WU0A 5EG0B 3H36A 1IG7A 2M0MA 3ZR8X 4GYIA 2ZB9A 4MFDA 1VQ9I 3MZ8A 1KQ8A 1A6QA 1YYVA 2LY1A 4M9SA 1SANA 2W85A 1V5EA 2NVTJ 3OYAA 1YLFA 1AHDP 1HW1A 3HL2A 1LVAA 2HOTA 1SC7A 5KAIC 2VBYA 4IZZA 1JGSA 5M3MJ 1FYKA 3DF8A 3W2AA 2V79A 2W48A 2E34A 2Y48A 4M73A 4OMZA 1JKOC 1XDSA 1NG6A 1V5FA 1FIPA 2VKVA 3TMOA 4Y7NJ 1JUSA 5CVRA 1ZREA 2WAFA 2YX7A 3FF5A 1JT6A 4A0ZA 3N05A 1BA5A 2M7AA 1MZBA 2KIUA 5EEAA 2JWTA 2X48A 2YU3A 4JQFA 4RGRA 4A6EA 2UZKA 4XOTA 5GAEJ 2ISZA 3EYYA 3HSFA 2EFQA 3TW6A 1X3WB 5LRRA 2BV6A 3FDYA 1X2NA 2EH3A 2OAZA 2Y31A 3PM1A 1ZGJA 3KLOA 4OMYA 1NH3A 1CF7B 2W4SA 2DO7A 1G6NA 3G1MA 1B8IB 2KLOA 3CJRB 5GPCA 5EYRA 3K1MA 3QRFF 1T8IA 1SFKA 4KUMA 2X51A 1Z9CA 5CLSA 1MNEA 1QZEA 2RNGA 3V7RA 3MKLA 1MNDA 1VF9A 5ILSA 2FJ1A 1V54H 2CW7A 1YFHA 1EA3A 5C44J 3F8FA 5M5XJ 1R71A 3CCJI 2QA4I 2QBYA 3OR1C 1WI9A 1P6RA 3GTJJ 2BVLA 3BG6A 1A35A 5FGMA 4RAZA 4BJ5C 2HKOA 5FJ8J 5CYVA 2VN2A 2IS1A 4OWRB 4ZH4F 2LBFB 3ZQQA 2G0EA 3ZQFA 3NRVA 4KA4A 1YRNB 1QRYA 3NWSA 1K4TA 5FD5A 5IPAA 1ZRDA 1I6XA 1ITYA 2DK8A 2V9KA 1R1TA 3V4GA 4F7ZA 1KYZA 3VODA 3BTJA 1IRZA 1I1SA 3J81K 2QVOA 3LOCA 4II2A 1HQCA 4LIVA 4HDVA 3T0YA 3L1PA 2RNJA 2O3FA 4JOMA 4IHYA 4ZTJA 5CVJA 2XAHA 1XD7A 3GW2A 1MDMB 2JSCA 2DODA 3RZDJ 2VIXA 4PFPA 5IT9K 2VLAA 2NS8A 1X3UA 3P5JA 2IA2A 4QSHA 3BLYA 3E0JB 2MH9A 4HQEA 4CHUA 2BW3A 4PSWA 3TEDA 1EJ9A 2NAZA 2PN6A 3K9TA 3LSKA 2XAQA 5FROA 1T33A 1WPKA 2R3SA 5HDNA 4JP0A 1BI2A 2DJIA 1SFEA 1T56A 2DJNA 2NNYA 2EINH 2AXTC 2JVGA 4WCGA 4XOPA 4CZCA 3I0TA 3R0JA 3REOA 1W0UA 5DM7F 2A61A 1UMQA 4YELA 1J59A 2HDWA 5E1WA 1Z7LA 4XM3A 4Q5SF 4JX6A 1DPRA 2E1CA 2Z1DA 4CCNA 4GXOA 3HJEA 4XRMA 2COBA 3IH4A 4IHVA 2GWRA 4XNFA 1FEXA 2OCEA 3M1CA 4XLHA 1ORKA 3BDDA 2ZFWA 3NEUA 3TO7A 2M8GX 1LUJB 4KNYA 3MKYB 5EG0A 3F8MA 2JA2A 1PUFA 2HWVA 2P5VA 3FK7A 2JRTA 5H6QA 3ABTA 3IAS2 1RKWA 2XPVA 5E8IA 2C6YA 2CV0A 4HLXA 3H3VK 1PP8F 5BOXA 2ZMEC 4IOAF 2CQXA 2DCEA 2JRMA 2Q0OA 3HOTA 3RI4A 2Y0SA 3DTEA 3CCLI 1HA8A 3S93A 2K7LA 2PEXA 1R7JA 1JTXA 5JVGF 3SFZA 4N9HA 4BL0B 1PP7U 2XF7A 3MQ0A 2XAGA 1SFOJ 1AA7A 4L0ZB 5B3SH 4N4NB 2I8DA 4MNUA 2ELHA 4AYBN 2F4MB 4F93B 3JCUC 1CF7A 1VI0A 3BG7A 3OYKA 4XKCA 1B8IA 2CQ7A 4G7OF 2Q8KA 1PVEA 1RPWA 3CP2A 2ZXIA 2VI6A 3S3OA 4GCVA 1X2MA 2W00A 3F72A 3JRAA 2DOEA 1FWZA 3G2BA 4A3DJ 4B09A 2CMPA 3BZKA 4IJAA 2X6OA 3CESA 2HYJA 2EJRA 4HA8A 2KHMA 5IOZA 3MMYB 5IYDJ 2DN0A 3HUGA 4LFUA 4C3IJ 3WTUC 2FA5A 2MH2A 1TLHB 4I02A 3AKZA 1S3JA 2EV0A 3A03A 1OYIA 2CRGA 3BCBA 3FZVA 2DA2A 5F04A 2PQ8A 4UV8A 4EQQA 4YIFA 5D8LB 4HYEA 3TOAA 4XQFA 4EV0A 4LK0F 2DXIA 2HR3A 2WAQN 4F91B 3S8PA 4DGWB 1HBXG 1MKMA 2VQHA 3J7YJ 2LBFA 1E17A 1YRNA 5CPRB 5KHDA 1TZLA 1Z67A 3EUKL 2VB6A 5D5XB 3OYLA 4Y52J 4XSXF 2V6CA 1XCVA 5LLQA 2M87A 4LG0B 4BEHB 2M7BA 1RI7A 2VBZA 3CJTB 5DYMA 2V26A 3ERED 4FASD 4PJ0C 2XASA 1RC9A 3M8JA 4LD5A 1MDMA 2XKOA 2WAEA 3O8HA 1E0EA 1K83J 2M4KA 3VEPA 2L3DA 4KN4X 4S0HB 2D2WA 4RA2A 2VBWA 3I55I 4DBQA 1I3QJ 2YX4A 3P9IA 2EIJH 5EGOB 2ZJRF 1G8XA 1MJBA 3RKYA 2QQ8A 3RZOJ 3VSLA 3I53A 2JTVA 3CMYA 3QQAA 3ZCOA 2J5PA 3KP3A 2K4BA 1Z21A 2KDOA 1PJRA 3DPUA 3DTKA 4HBLA 4CCLA 1VQLI 4X6AJ 3L00A 3DXJF 5FLXZ 2EB7A 3F8NA 3HOUJ 1MW7A 2HQAA 1MIJA 3E1SA 2GXBA 1MD0A 1MMGA 1SMTA 3AFHA 1OLTA 2Q1ZB 3TP0A 4ZYDA 2GOMA 2VJ4A 2HI3A 1D0YA 2HOSA 1DU6A 2F2EA 3F8BA 2K3FA 3OYFA 3OYHA 2QUFA 4E7HA 2R7ZJ 1HKTA 3RKWA 4AVPA 3FHZA 3E6DA 1STZA 4G6QA 4XKWA 1DDNA 3F8CA 3ZOBA 5HDGA 4KIGA 4A3KJ 3WTVC 2QZ8A 3S16J 1D3YA 2ISYA 3LMMA 2DQRA 3OYJA 2L54A 2KRHA 2VQLA 2B7EA 2DFFA 1P7JA 2FUG2 1T0FC 2ID3A 4LB5A 3UKGA 2Z2SB 3L09A 3JAMZ 2HQRA 1OCZH 3FK6A 5EEGA 5J3LA 3CDHA 2HPIA 1U2WA 4J00A 4XR6A 3BG3A 3K4CA 3IRRA 1XS9A 2LR8A 5E18F 1E2XA 1QVUA 1TT5B 3P9CA 2DU9A 5CJ9A 4IHSA 3G4SI 4FE7A 3PJRA 1IN8A 1IDZA 4KFCA 3B73A 2JUGA 2OQRA 3M9AA 4WXDA 3ZQHA 5HODA 4P55A 2XGCA 2H1KA 4E7JA 2R7SA 1QHHD 1APLC 4UB6C 1DP7P 3M4OJ 4OU0A 1QPMA 3MWMA 4BE0A 4O3MA 4QIWN 1V55H 3CLQA 1E3PA 4L18B 3AL0C 1D5VA 4IRIA 2IP2A 4G94A 4A0XA 3H92A 2BGCA 4XKVA 5HLTA 4UVAA 3A1YA 2P6TA 3BR3A 2BVMA 4BYYA 3E5UA 3FBIB 2FD5A 5FO5A 1G3WA 1TL8A 1W36C 2LF7A 1D0XA 1JKRC 3RPUA 4BXFA 5E3NA 3GTGJ 1FZPB 1SMYF 2BY1A 2OTLI 2CW8A 1BI0A 1BR1A 1QQIA 2P4WA 2JQ7A 3J7AO 5HNFA 3SEZA 2M0CA 3LSGA 5E1XA 3DV8A 3OS2A 1VTNC 3JRHA 3H5RA 4O6JA 3CCMI 4I01A 4H4KC 4HG2A 2L7ZA 4EM1A 3OS0A 3HOXJ 1YOVB 2ZO4A 4GO1A 5GTIC 3PL8A 2EFWA 3Q9SA 1X1CA 2VASA 4ZDPA 1MMNA 5F0HA 1XSXA 1GV5A 2E5ZA 3D5LA 2CV2A 2PJRA 2EK5A 4BQAA 1GVDA 2JVHA 1RNLA 2WA0A 1QBJA 2X9DA 3ONQA 4LG0A 3O6BB 2L9SA 3V8KA 4I0BA 2K9LA 3IHUA 1U3EM 2KISA 2MSYA 4YFKF 2CH0A 1SFXA 2R7FA 1YTYA 2LKPA 5IP7J 3KYDB 2L0KA 1B72B 2JPCA 3BP8A 2YSRA 4U0VA 1N25A 2J5OA 1ZHFA 3PNVA 4A93J 4XK4A 1IRGA 3I58A 1BBYA 5J1YA 1Z1DA 1BL0A 2IXSA 2GLOA 1Y8QB 4BGDA 1Q1HA 1U8BA 1ETVA 4EGYA 3QYFA 1T95A 1JE8A 1F4KA 3E5XA 1QPIA 3FBNB 4Z6YA 5GPAA 3OS1A 3OYDA 2FOKA 3GFMA 4MTEA 2ACJA 4CICA 3T1BA 3ZQLA 2IW5A 3V42A 4HAMA 4E7KA 3O2PE 2K02A 1IUFA 1KU3A 5CQEA 4L5EA 2KDZA 4UHTA 2OC6A 2FBHA 5LD2C 3CDLA 3ULQB 3IH3A 1Z6TA 4C3JJ 3HB9A 5DD4A 3JRBA 1WRJA 2LC2A 1RUOA 2R93J 1UAAA 2GBYA 2FRHA 2NRAC 3CCUI 4WX9A 1KU9A 1YO5C 2KP6A 2VT2A 2OV7A 2KJCA 2NNNA 3K4LA 4U87A 2H1LA 5FKKA 2K27A 5D4SA 5DS9A 4A3EJ 3FMRA 2V6EA 4M9XA 2FSWA 2F5FA 4EATA 4U7DA 2M2EA 2JA7J 2MD0A 1D5YA 5IYBJ 5DUKA 3DCFA 3JRIA 1ON1A 2X1DA 1R5ID 2GZWA 1MJAA 1YE9A 2HXIA 2HQ5A 4G12A 1YG2A 3S1RJ 3A0HC 3DLLF 1WCMJ 1MBGA 4JK1X 1IRXA 2D45A 4L0YB 3GTMJ 4IEJA 2Y30A 4UUTA 2JN6A 4Q47A 2XV4S 4IHTA 4KISA 2G9WA 2VC1A 2VOOA 5ERIA 2PMHA 3IKTA 5LBQA 1MGTA 2R7UA 2CGPA 3KP7A 3NWTA 1HC8A 2IT0A 3DP7A 5LFAA 3F3XA 2IVMA 2QWWA 1K78B 2IRFG 3BJ6A 2VQCA 4ZYEA 3RQIA 1WJCA 1V5GA 4OAYA 2ZCWA 5DCFA 4DYQA 1LPQA 4ZDLA 5K5OA 1LDKB 3B02A 1ERDA 3TQNA 4UUSB 4XN0A 3LWFA 4ANJA 3RSNA 3F22A 3GFLA 5KNLA 1W7PB 2OU2A 1TBXA 1XTAA 2CO5A 2X6WA 1I5ZA 3G1OA 2DA6A 2PX9A 4HF0A 2I5UA 2NXNB 4CCKA 2X1EA 5JLXA 2F6CA 2VKEA 1FBUA 4BY7J 2EPFA 1S9HA 3T8RA 1R1UA 2A5WA 1IXSB 1A6IA 4XN3A 3Q3SA 1RZ4A 1U6GA 2DDBA 2V1UA 2O8XA 5J47A 2MABA 3BTIA 3ECHA 3BROA 3MAJA 2V9VA 5ICGA 2MYSA 3RYPA 3QPTA 3E7LA 3HKZA 4IX7A 4ABZA 3LL7A 4E7SA 3F6VA 2BY0A 1XX5A 4BBSJ 4RS8A 3LA2A 4AM3A 1UHSA 1MBKA 5CQGA 3WGGA 4LB6B 1HLVA 1SVOA 3HG9A 1X4OA 4HW0A 4IRHA 1CQTA 1FNNA 2KZVA 2DI3A 3Q0WA 2F4IA 4XL9A 3V8JA 1B72A 1H8AC 2K40A 1BI3A 3VYTB 4A3CJ 3OL3A 3OWTA 2LOOA 5LEKA 3FKIJ 3HC7A 4U7BA 5BPIA 4PK4A 2PG4A 5A2QZ 1M1EB 1WJBA 2CQKA 2FX0A 4V19K 1YJWI 2DFIA 2DMTA 1EF4A 3FWEA 3GLLA 3BTCA 5L3CA 2M1BA 4D1QA 3B6CA 5L3EA 2ESHA 4AWXB 3E6MA 1W1WE 1OR7A 2RAEA 4D7MA 3HYIA 4P9FA 4CDGA 2R7WA 2L7MP 3MKWB 3BZ6A 1H9TA 1XB4A 5LHGA 2IS6A 4CXFA 1BOAA 3LQRA 1J09A 3SZTA 1FYLA 3WTYC 5E79C 4G8XA 1J5YA 2CSOA 2CJJA 2A5YB 1IC8A 4OIPF 1K79A 4KT5C 2LSOA 2PMZN 1V3FA 2IAIA 2ICWG 2ADUA 2JT1A 4Y15A 3OIQA 1OQYA 2ZXJA 2F4OB 2PBIA 2EV6A 1J0RA 1F5TA 4EJTA 1R6RA 3KPHA 3LSHA 1I50J 4Q48A 5B5EC 1W0TA 2VJIA 3DFGA 5HLGA 1R00A 2XIGA 5TRDA 1IAWA 5IT3A 3ABMH 3KX2A 4L9TA 1QNTA 1JJ6C 4RLFA 5H6RA 3PIOF 3G1LA 2XB5A 3S14J 2E36A 1K78A 3H5AA 2RVCA 4FT8A 1O3TA 3HOYJ 4IHXA 1P2FA 2IJLA 2CG4A 3KP5A 4HLYA 1L0OC 1HDDC 3QU3A 1FTTA 3K70D 1HW5A 5M3FJ 4C3HJ 3ZMDA 2KIMA 3PQJA 4DYRA 4M71A 1FC3A 3ZP5A 3K70C 2COMA 1BIAA 3QOEA 3FXJA 4UUSA 1XGOA 2XSJC 2F5DA 4XRSG 5ILVA 2WY7Q 9ANTA 4V2GA 3ZMUA 1RRJA 1UZCA 4LLLA 1XGSA 3ML6A 3KYLA 1GXQA 5HS9A 3MCZA 1R22A 4A3GJ 3IV5A 3BR1A 2NVUB 2A05A 5K7ZA 3C3WA 1Y8RB 3EYIA 5E3MA 4IVNA 2DMNA 3OOPA 3K6GA 1D0ZA 1TP4A 2DMPA 1U9OA 4DBRA 2R7QA 2FBIA 2WB1N 2R5YA 1X19A 1ENHA 1FOWA 3LSJA 1D1AA 2L01A 5DV5A 1BI1A 3VYUB 5GTHC 2VKDA 2K9NA 2K9MA 4PUSA 1YQAA 4B4CA 1WJEA 3A0BC 4RLQA 4FHTA 1YX5A 2L7FP 3CCRI 1IJWC 3ROUA 2VXZA 3H1CA 1UB9A 1TQMA 2VJ5A 2UXNA 3K4JA 2O03A 1WFXA 2Z33A 3C18A 4YRVA 5K1YA 1S7AA 1J75A 3OYBA 1KONA 4MHGA 4MTDA 2G7HA 1RKTA 2LD5A 3LFUA 1O3SA 3R60A 5FD6A 1PYVA 1WGXA 3S1QJ 1J2XA 5DUIA 1NG7A 1E3OC 1T6SA 2A3SA 3KP2A 4IPAA 2FQ4A 3H0DA 3M8FA 1OISA 3HBLA 2WV0A 4D5FA 1NK3P 2VQGA 2IS4A 4QLCU 2TDXA 3CUOA 1U5TB 1KQ9A 5TGTA 1XG1A 2ZC2A 1MMSA 2W7NA 4F55A 4KT6A 3QAHA 2HZTA 1R4MB 1MSFC 1WWXA 1JXSA 2BBYA 1NTCA 5J8FA 2MFZA 2L7KA 2PMUA 4NC8A 5HDKA 2FEZA 4I99C 2H8WA 2VJJA 3C7JA 4D0PA 2Z99A 4B1RA 1RETA 4FTHA 1JI8A 5GAGJ 4BUPA 1QU3A 1VQ7I 4ENKA 3GTLJ 2KL4A 4BACA 4LK1F 2ZXHA 3F9KA 2F48A 1OFCX 4YG2F 2LDUA 1RIOH 1JUMA 4NNJA 3HM5A 2OBPA 3SHFA 1FSEA 1LKXA 3KZZA 4U88A 4C2MJ 2K3PA 2Y2ZA 4B48A 5F0CA 2K86A 3HOWJ 4MIMA 3SJMA 4ON0A 1ZG1A 5LHIA 4YEJA 2LYCA 1LDJA 2OQGA 4LOCA 4HEA2 2EZHA 2BOLA 2M30A 3AG4H 1F43A 4ZJZA 3HPHA 4XONA 3CCEI 1GT0C 1YI2I 4ESBA 3LNQA 1ZAOA 2R7OA 4MGRA 1W4MA 4Y13A 4A0YA 3CC7I 5J8CA 2KFDA 2V9PA 1ONVA 3JTHA 2VBXA 4D7NA 2KRFA 5A2QK 2VONA 3P7NA 3KP4A 4DIQA 2HYFA 4MLOA 4RB2C 3L9FA 2EFNA 4RGUA 1QA6A 4AUXA 5BS6A 1JHHA 3GX4X 4NQWB 1JKPC 3KZIC 2QKLB 4D9JA 3E97A 1YS6A 4XIDA 3BR2A 5DM6F 1O7LA 5J6XA 3FISA 2A69F 4PGHA 3DWLE 3ZMSA 5ICCA 4Y3OA 2IA1A 3JSOA 2AQEA 2E7WA 5HVQC 1S5LC 4X1EA 4XRFA 3VWBA 4IXAA 5GAHJ 3KYCB 3GLXA 1EV7A 2B63J 4A3FJ 2X6YA 4XLCA 5JFRA 2I10A 3PFYA 1O4XA 3WE2A 2AO9A 2FU4A 1MSEC 1IW7F 3KCCA 4ZZLA 3M7GA 2MG4A 3BR0A 2DYRH 3FXQA 4HX8A 3RPQA 2GM4A 2P6SA 4OOIA 4A12A 3ZRGA 4BHPA 3HOVJ 2AXLA 4HF1A 2Y9YA 3LAJA 3JR9A 4EMSA 3OV8A 3GFIA 2ID6A 4IOCF 3ESWB 3K4NA 1ZLKA 2CUFA 3I4MJ 2RGVA 1TNTA 2XF5A 3Q0VA 4RB0A 5FLVA 2Z5UA 2UWMA 2P81A 2DT5A 3S2WA 3HOZJ 2W24A 1XMAA 2P5KA 4M6VA 4TV7A 2HVSA 3CC2I 3H3UA 5CVVA 3LAPA 1Y0UA 3PIPF 3S2DJ 3LQQA 1BC8C 2M8EA 3NARA 2FNPA 2H09A 1FSHA 4A3JJ 2XPUA 3U21A 3B6AA 2RC4A 2AQFA 1HF0A 3BOQA 4ZYGA 3QPLA 1G59A 2VPRA 4UV9A 2XKPA 4U0YA 4HNVA 3BC8A 4P5OA 2DMUA 5KAFC 1ETWA 4RGSA 1C0WA 3I56I 3HRMA 3ELKA 1U5TA 3CMAI 4Y4RA 1ZGAA 2P7VB 1DGWY 1I6HJ 1DUXC 2HQNA 2IS2A 3K7AJ 4CYCB 2K4JA 3L2QA 1D8JA 3TDUC 4HX7A 5D5WB 4E7ZA 3P9KA 1VQMI 1BW6A 3K0LA 1Q1VA 2HYGD 3HTSB 3FMSA 4I2OA 1N75A 3BJAA 3CDIA 5E20A 4AYBA 5KVRA 2QSHX 5B1BH 1T08B 2E5NA 2XRNA 4DQ2A 1LFUP 2P7CB 3KEOA 2GOXB 4HX4A 3BT9A 2Z16A 1YJNI 2HS5A 2HXOA 1KZHA 5M5YJ 1ZRFA 4KITB 2HNHA 2QEXI 3S2HJ 4V2FA 5L3DA 1FOYA 2VOPA 5HS8A 3O3KA 3BJOA 1VZ0A 4GGGA 4EVIA 1Y0NA 2IGOA 3OMYA 3OYNA 3LSRA 3WG9A 1KA8A 3PQKA 4AIJA 2W1OA 1B6AA 2ECCA 5D6EA 5EF6A 3S3NA 3RQ4A 2NOGA 4CA0A 3IAM2 1ZGWA 1R4NB 3M3YJ 2LH9A 1B9MA 4CCJA 4L5IA 4EM2A 2FNAA 4UB8C 1W36D 2Y0MA 1OR7C 3GMEA 2WAQA 2BZTA 4M6YA 2F5CA 2E1MB 2KJBA 1BN5A 1G4DA 2PLYA 4P1WA 2HGCA 3K69A 3PSIA 2M4GA 4GDFA 2VT3A 1TC3C 1S72I 1XC5A 2ZSIB 3LFKA 3CCSI 1Z6RA 1A04A 4NQWA 3C1DA 2E19A 3RKXA 4AVZA 5BQTA 3FXRA 2LLKA 1K7AA 3Q0UA 3W2WA 3FM3A 2LP0A 4BNCA 4ZYHA 3VYRB 2GXGA 3IRQA 5HS7A 3ISPA 2M3AA 2RQPA 3DPTA 3AG2H 1WJ5A 4W97A 2CUJA 5FRMA 1WI3A 5B66C 2CV1A 1TQPA 2BY2A 4BEHA 4BKXA 4BQOA 4C2TA 2K9QA 4ENNA 2L9VA 4ESFA 3QODA 2D5VA 1H9GA 4PSXA 2EZLA 3J7ZI 1LNWA 1I27A 5E8GA 1FYMA 2G7UA 2W57A 5CVUA 2ZJ2A 2DAOA 2CUEA 2E1NA 3MFKA 3H9GA 5EGOA 4Y33A 1BW5A 3MKZA 1AOYA 1Z77A 1S8NA 1R5HA 4AC0A 3K2ZA 2ESNA 2V1NA 3CTAA 3MZYA 4M74A 3SZPA 1AKHB 3HSRA 1IN4A 2QSFX 3DKXA 2A68F 4BDYA 1GUUA 4AU7A 1UJ8A 3J80Z 4PJJA 2GXAA 4AD9A 2HVQA 2E7XA 2DPDA 2JMWA 5L3GA 2DDAA 2WBMA 4BJTA 2EZKA 1G3YA 4NUBA 2DOFA 3TO9A 1XPXA 3JRCA 2PFBA 2IPQX 2H6CA 1IDYA 1LFPA 2LK2A 5F64A 2H94A 3GBGA 2QENA 1WSUA 4N9IA 2GIVA 1WZ2A 1XMXA 2HTJA 3G3ZA 1HW2A 4GFBA 4G7HF 3E6BA 4DOZA 2BE5F 2FQ3A 3C2BA 1DQUA 1T39A 2GA1A 4I76A 1PDNC 1TWAJ 2HDCA 1B9NA 2FE3A 3K1NA 1WH5A 4CYCA 4BXUA 2E60A 2F5EA 1VQ5I 3ASOH 2FMLA 4LJZF 1ZLJA 1POGA 2NVXJ 3TBIA 2FBKA 4KMUX 3D5SC 5FFXA 3LSPA 4JYKA 3PNYA 4M3GA 3WE3A 4Z2YA 5F1JA 2ZFUA 2UUZA 2QQAA 3IL2A 2RN7A 2EILH 2LTPA 3EETA 5FKNA 3HHGA 4RBOA 2AHQA 2PJPA 1GVJA 5FRNA 4L9JA 2IA0A 1ETXA 5DCMB 1KQ0A 3CF5F 1H89C 3E5QA 3GF2A 2XAJA 4M6XA 4UVBA 2HDDA 2Z9OA 2LY2A 1G3SA 1S7EA 5LGTA 4XICA 2RQQA 2IGKA 5D6FA 3F23A 3JRGA 3K1PA 1DP3A 3MD2A 5IT9Z 4N4OB 2NS7A 3OYEA 3CCVI 4Y17A 2FF4A 5IY5H 5E3OA 4EGZA 1LEBA 4RGXA 3JTGA 5DD8A 2E71A 2LKSA 2MC3A 2VPLA 2OPTA 1KYWA 1FTZA 1FY7A 2X6XA 1XN7A 1XMKA 1ETKA 1P92A 2DA7A 3DLAA 2MA3A 5H2FC 2WADA 4BBRJ 4ENMA 2F5VA 3WTTC 1SFUA 5FLXK 2DLLA 3CP8A 5JVTA 2D1HA 2QSGX 3PO2J 1Y56A 3HHHA 5IP9J 1YW8A 3VSKA 2LNBA 3I5UA 5EJCA 5E17F 3WGIA 3GWZA 3DU6A 2FXAA 3ZMZA 1Y6IA 2HU9A 3E3VA 1VQNI 5JHUA 1N77A 3DBLB 4WK8F 2R7RA 2IGNA 3K4KA 1IV6A 2VODA 2ZBKA 2D1VA 3I54A 3M8EA 4M3FA 4OIRF 3TOBA 1VQ4I 2CQNA 1QZYA 3A02A 1FIAA 1VQKI 3T5XA 3SZGA 1F1ZA 4M3BA 3SFIA 1FMVA 4UXNA 1YHQI 4BDZA 4HSRA 2ZKZA 1HXDA 2ZSHB 4BAYA 4FCYA 2STTA 1S6LA 1TT0A 3GTOJ 3JAMK 1ZN2A 2XGDA 4J01A 1DGRM 3F21A 2LKXA 1ZR4A 3F6OA 3ZQCA 4CH7A 2O9LA 3PUFA 2OZUA 2YUSA 1IGNA 5IOYA 2LY9A 4F92B 2BYVE 3HGGA 4RB3C 2QKMB 1ZYRF 4DNCA 5AIQA 2JK3A 2WTEA 3G73A 1EH8A 1W5CC 1CGPA 1I39A 1WJDA 2DA4A 4BE2A 3OSGA 3QPHA 2XROA 1GXPA 5ED4A 4R8HA 3FXKA 2MC4A 1W5SA 3LSIA 4N0BA 4L9VA 3HPGA 4XLPF 1IF1A 3A01B 1X1AA 1VQOI 3BZCA 2DT6A 4PCQA 3TDZC 5IYCJ 5FLMJ 3VDXA 1J9IA 5TISC 3OL4A 3L2VA 4RMNA 2L9NA 3GO5A 4I6ZA 2CQQA 1AKHA 1LFBA 4RB1A 1I3AA 1WHUA 1SEUA 1RESA 2MLKA 4OIOF 5E1ZB 3CZ6A 4A2UA 5LEJA 1PUEE 2M34A 5J1RA 2OCCH 1MBHA 5HOOA 2WY8Q 4OIQF 5J4VA 1IXRC 3BPVA 5EEHA 2V1XA 2VKHA 1KGSA 2DPUA 1UCRA 2XAFA 2LREA 3L2RA 4R79A 4DZPA 3HEFA 5K5QA 3KIOA 4EJVA 2DBBA 4XLAA 1SAUA 1ZK8A 3CUQB 2YR2A 2EIKH 5LHHA 3V8LA 3OYGA 4H0EA 1K61A 2YU9J 3TW7A 5FKMA 2ZJQF 1N78A 3Q5FA 4B43A 1R9TJ 2RDPA 4LIUA 3C2GA 4BH9A 1WJAA 4DZJA 2ELJA 1BJAA 1K6YA 4BHBA 4MFEA 3FXUA 3JREA 4LLNA 3WTXC 3GEZA 2OD5A 2OZ6A 5J40A 3U1DA 1U0JA 1XDUA 5TJJA 1VNDA 1PUFB 3CD6I 1WQ2A 2X0LA 3DBRB 2HFHA 4GRIA 3MZHA 4NHJA 2KMUA 1BR2A 4M72A 1G2HA 1HKSA 3LSTA 4IO9F 2V7FA 2A6EF 2OUMA 1WKMA 3HTUA 1FX7A 1P4XA 5DCMA 1I1GA 4ZTFA 2K9SA 1FT9A 3ZQIA 3EPZA 2KRCA 3KETA 1YITI 4AIDA 5H20A 2RKHA 1VQPI 1V4RA 2CWEA 1QZZA 3ABLH 4KIBA 1B1BA 3L7WA 2QF7A 3BY6A 4ASNA 4KIFA 4BQNA 1XSDA 2ZNZA 2R5ZB 1R1VA 1U5TC 4QPOA 5J4YA 2O8KA 2XDVA 1YS7A 1OYWA 1W7PA 4A3LJ 4C9YA 1W5TA 4AIKA 3J80K 4KDPA 4PJNA 2Y0SN 1USTA 3E6CC 1X1DA 1HCRA 3V7SA 2DTRA 4HZFA 3WGHA 2L4MA 1ZQ3P 3K10A 3GUDA 1R58A 4ETSA 3SDGA 2NVQJ 2JA6J 2ELKA 2IGMA 2VE8A 1YW7A 1LVKA 3HUGB 3WG7H 1FP2A 5HNHA 4JX5A 3Q9VA 4DJAA 2M5WA 1B4AA 3TL4X 1T38A 1K4SA 5C4XJ 2ME0A 3RYRA 3KZYA 1OKRA 3D0SA 1XGMA 2LF8A 2VXDA 1SVMA 4IF4A 3W6KB 2HOEA 4F52A 3GTQJ 4EM0B 4KMFA 2HEOA 5CVIA 4RAYA 2R7XA 4BY1J 3GZ6A 4EJOA 1HSTA 3ABUA 2Z3YA 1HDPA 3GXOA 4HV5A 1FOKA 3L2UA 2KPMA 2GIZA 2VL8A 4G6DA 2DW4A 3W3CA 5FKOA 3GVAA 3A01A 4G9YA 3OIOA 2VC0A 3RPUD 1QO0D 2MGQA 1P4WA 2V4JC 3NQOA 4NDLA 3FXMA 5L3BA 2LRDA 3CO6C 4WWCA 1IN5A 4E4HA 3WU2C 3M1EA 3LA7A 2AS5F 3I64A 2PI0A 3KE2A 4C30A 4G7ZF 2BXZA 2PMZA 2LG4A 4XLEA 3COAC 4S05A 2WWYA 5ILUA 3QYBA 4HNUA 3O8GA 3S15J 3RCOA 1U9NA 4EEFG 2A6TA 1P4AA 4K2EA 1R36A 3QOPA 2DT7B 3TKYA 4IQJA 3IWZA 5FFZA 5K7FA 4M3DA 4B3XA 3I4NJ 4FE4A 3CUQA 1HKQA 1ACIA 2HZDA 3IP4B 1TQIA 3ZN0A 2LVSA 3DEUA 5F27A 1O57A 1R5GA 3R6SA 1T98A 1LB2A 5D5VB 5D5UB 4PDKA 3I4PA 5AONA 3CMEI 1JKQC 1OCTC 4A5MA 2TCTA 1O3RA 1ZTRA 2EA4A 4XKBA 1Z05A 2Q2EB 2O5RA 5LGUA 2L4AA 4B44A 1IRFA 2FOWA 4P9UA 4OINF 1RUNA 2HVRA 1BC7C 3FIWA 2O6GE 3EUHA 3I59B 3MVPA 3DTIA 1UFMA 2DA5A 3ZQGA 3W2VA 1O3QA 3JRFA 1ZARA 1OCOH 4MEXF 1MBJA 2O7OA 3FXOA 3JSPA 1UG0A 5K7HA 3S17J 2XGXA 2OA4A 3EQLF 2XPWA 2X4HA 4KYWA 4WXCA 2L9RA 1X4PA 4CGZA 2XC7A 2IEKA 5FB2A 3OOUA 2IBDA 3DU5A 4II3A 4F3QA 3OSFA 3OYCA 1Z3YA 3HSEA 1TWFJ 1YIJI 4BXXJ 2K85A 2GAUA 3F0CA 2YS9A 3K4MA 2R5ZA 2KQRA 1E3HA 4DW6A 1VQ6I 1OCRH 1WJFA 3BWGA 3KEYA 2R0QC 1JJ8C 1XGNA 2KIFA 3DEWA 4B47A 1RR8C 3S1NJ 2WB1A 3QP6A 1OCCH 2CYYA 1Z0XA 3S3MA 1FBQA 4LGWA 1B59A 4I0AA 5EZGA 3BR5A 3I71A 1O7FA 1XCBA 3W6VA 4A3IJ 1ULYA 1BM9A 2CS3A 2E1OA 2P8TA 3ZGKA 4QTRA 1BOBA 1FMWA 1A36A 1NK2P 2QQ9A 3SXYA 2CW0F 1Z7UA 4JBAA 2EQRA 1FJLA 4HOBA 3PNTA 2JSPA 1YX3A 4G6TB 2ME6A 1MJ9A 5BMZA 3ZPLA 4C2UA 1OJLA 2DMQA 1ZH5A 5DTDA 3R0AA 5LRSA 3T8TA 3WU1B 4ZZDA 4E6KG 2EA2A 2PJRB 1U78A 3VPRA 4A3MJ 4PFOA 2CFOA 2OJED 1R23A 3DKYA 2MLGA 2V1DA 2ZMEB 1ETQA 5BNGA 1K6OA 4BQQA 2E1MC 3ZXSA 2Y69H 2JPBA 2R7VA 4U0WA 4A6DA 2HOAA 5FKLA 5F1RA 5M5WJ 4PZJA 4KN7X 2R7TA 5DDGA 5IP6A 3L2CA 1NHAA 4QPQA 3RIRA 3N4MA 2B9SA 3WODF 2DA3A 1IXCA 2LFBA 1JGGA 4QWQA 3KEQA 1FBSA 1ZKGA 3ERMA 5C3EJ 4GYGA 1TNSA 4IKFA 2BY3A 4XBFA 2NOJB 1H88C 1MBEA 3JRDA 4PGGA 4YIIA 2KKOA 3IH2A 3A2KA 1JUPA 3HGYA 5D8KB 1IN7A 2QLZA 1WVRA 3BR6A 1BR4A 1D1BA 3QU6A 2E2JJ 1GLNA 1OCPA 2XGEA 2BEOA 2GA2A 4ZDOA 2QQBA 4A69C 4ITVA 3EUAA 4CO8A 2K5CA 3G6EI 1X1BA 2NVYJ 4LLGF 4HQMA 4A5NA 2XRLA 3GCMA 2TRTA 4LMYA 3RKQA 3NAUA 1SVLA 4M9ZA 3CCYA 3BPXA 2JA5J 3H35A 3FHNA 1A31A 2Q2EA 1T2KA 3OY9A 3DEEA 4YFNF 2DFEA 3D1NI 3BQYA 1TW2A 1D1CA 4E7LA 2STWA 3I59A 3BTLA 2QM3A 1U8RA 5CKTA 2E35A 2HPMA 2KT0A 1VQ8I 4KICA 5KCMA 3BQZA 2L2OA 2A6HF 2HKXA 2WC2A 4D5CA 3OYIA 4IHWA 2DQLA 4E70A 3R4KA 1SD5A 1SD4A 2R92J 4BE1A 2DFHA 1BJZA 4S04A 4HSTA 1GHCA 1F36A 2BHYA 1Y1WJ 4X0GA 4BJ6C 3I3LA 4AIHA 1QVTA 3KP6A 2VUMJ 3PFIA 4ZC3A 3AG1H 4E7IA 1D8KA 4CCOA 5B1AH 3ASNH 3U1KA 3S32A 3A4CA 4CSWA 3WTSC 3GTKJ 1MMDA 3GTPJ 2CFXA 4RM2A 1SAXA 3HRUA 3AG3H 3WTZA 5HLHA 2QGUA 4LITA 3OR2C 3LSMA 1TTYA 1SD6A 1UELB 2P0WA 1YIOA 4I09A 3GZNB 5GADJ 3FKJA 1X58A 2DOAA 3FM5A 1FOXA 3IWFA 3OIPA 4YFXF 3H9JA 4P96A 3U2RA 1Z91A 3TP3A 1XSVA 3FXLA 3S1MJ 3H3ZA 3CO7C 4IRGA 2W82A 2FMYA 1KU2A 3RJPA 5JLWA 1IZ1A 3GFJA 4WXHA 3HRTA 1QGPA 3BCAA 3SQNA 1LQ1A 3DPLC 1LE8B 5F0FA 2Y75A 1AWCA 4XMYA 3CQZJ 1LDDA 2WV1A 1ON2A 1OPCA 3CJQB 1P7IA 4NC6A 4B3AA 3MN2A 3GYHX 5HLIA 1TW3A 2MD5A 1IUYA 5KK1A 1G3TA 3H9QA 2RREA 2DTZA 4JX4A 1Y1VJ 3RTRA 4MEYF 4MQVA 2XB0X
chains in the Genus database with same CATH topology
3HPGA 3M8JA 3PSFA 4RLQA 1YX5A 1X1AA 2WAEA 3HOSA 2VXZA 1E0EA 2M4KA 2DT6A 3K4BA 1P9QC 3H5NA 3VDXA 2VJ5A 4CCMA 3K4JA 4DBQA 1WFXA 3OL4A 3L2VA 4RMNA 4YRVA 2L9NA 3OYBA 1G8XA 1KONA 3DQVC 3LFUA 3VSLA 1PYVA 3CZ6A 1ZELA 3ZCOA 1Z21A 2KDOA 1PJRA 1NG7A 3DPUA 3DTKA 4CCLA 5HOOA 2WY8Q 3H0DA 2L5QA 1MW7A 2VKHA 2HQAA 3AL0B 3E1SA 1MMGA 2LREA 2VQGA 4OAZA 4PJLA 4R79A 3L2RA 3AFHA 1OLTA 2Q1ZB 4XLAA 1SAUA 2GOMA 2VJ4A 5TGTA 1D0YA 3OYFA 3OYHA 3OYGA 4HRIA 2W7NA 4E7HA 1N78A 4F55A 4B43A 4KT6A 4LIUA 3C2GA 4XKWA 1WJAA 3OYMA 2ELJA 1K6YA 2MFZA 3LMMA 2L7KA 4LG3A 4NC8A 3OYJA 3L2WA 2KRHA 2VJJA 2VQLA 2FUG2 1T0FC 3CF2A 2Z2SB 4FETA 1JI8A 1U0JA 4BUPA 1QU3A 2HPIA 2KL4A 4GRIA 4J00A 4BACA 4XR6A 3K4CA 2ZXHA 3F9KA 2KMUA 3VYSB 1BR2A 2UV1A 2V7FA 2OUMA 3PUBA 4NNJA 3PJRA 1LKXA 4ZTFA 2JUGA 2K3PA 4B48A 2X85A 3EPZA 2KRCA 4E7JA 2R7SA 1QHHD 4YEJA 2LYCA 4HEA2 2BOLA 4BE0A 4ZJZA 3HPHA 4XONA 4BQNA 3AL0C 2R7OA 4HPQA 4QPOA 3QYEA 2XDVA 3HXLA 4XKVA 3UNGC 5HLTA 4C9YA 3I9V2 3A1YA 4DIQA 4MLOA 2BVMA 3FBIB 4PJNA 5JHFA 1W36C 1D0XA 1X1DA 3SEQA 3K10A 3IUOA 4BXFA 4NQWB 2QKLB 4D9JA 2CW8A 1BR1A 3D5RC 4PJMA 3DWLE 2IGMA 3SEZA 5HNFA 1LVKA 3HUGB 3LSGA 4Y3OA 5HNHA 3OS2A 2AQEA 5HVQC 3H5RA 4DJAA 3VWBA 3TL4X 4H4KC 3EUHC 2X6YA 4HG2A 2VXDA 4XLCA 3OS0A 3PFYA 4F52A 3PL8A 1X1CA 2VASA 2XAUA 4ZDPA 1MMNA 4RM3A 2E5ZA 2R7XA 3D5LA 3ZRGA 2CUZA 2CV2A 2PJRA 2JVHA 3C2HA 2WA0A 3ONQA 4XLFA 2L9SA 4XORA 2K9LA 3K4NA 3SDBA 3L2UA 2KPMA 2XF5A 2VL8A 2UWMA 4KJZA 3W3CA 2CH0A 1QHGA 3RPUD 1Z3XA 3PNVA 2XF6A 2V4JC 2HVSA 2BW3B 2LRDA 4E4HA 1MMAA 2IXSA 4BGDA 2R4GA 3QYFA 2X1CA 4C30A 1T95A 4CUGA 3U21A 3FBNB 3UR3C 2AQFA 3OS1A 3SYTA 2PMZA 3OYDA 2LG4A 4ZYAA 1G59A 4XLEA 3V42A 4IQ4A 3QYBA 4E7KA 3BC8A 4P5OA 4BU2A 4HNUA 3RCOA 4IQJA 2A6TA 5CQEA 3J7AY 2DT7B 2OC6A 4BS9A 5LD2C 4B3XA 4Y4RA 2HZDA 3IP4B 1DGWY 2LC2A 3CMMA 4HNTA 1UAAA 2IS2A 4NC7A 2KP6A 2OV7A 3L2QA 4U87A 3K4LA 2M0MA 3ZR8X 4E7ZA 2V6EA 2LY1A 4EATA 1N75A 4XKBA 2Q2EB 4AYBA 2O5RA 2MD0A 1V5EA 4B44A 3OYAA 2E5NA 2HVRA 2X1DA 1YE9A 3HL2A 4IZZA 2GOXB 3W2AA 3DTIA 2Z16A 1IRXA 3W2VA 4KITB 1NG6A 1V5FA 3TMOA 2HNHA 1UG0A 2WAFA 4KISA 3N05A 2M7AA 1VZ0A 2IGOA 3OMYA 3OYNA 1X4PA 4JQFA 2W1OA 2R7UA 4XOTA 3NWTA 2XC7A 3OOUA 3S3NA 5LFAA 3RQ4A 3DU5A 4II3A 4CA0A 3IAM2 4F3QA 3OYCA 1Z3YA 2LH9A 4CCJA 2VQCA 3FDYA 1WJCA 1V5GA 4OAYA 1W36D 2W4SA 1OR7C 3K4MA 2WAQA 4ZDLA 2KQRA 2KLOA 3CJRB 1LDKB 2E1MB 1ERDA 1WJFA 3KEYA 4XN0A 1SFKA 2X51A 4P1WA 4ANJA 3RSNA 3PSIA 1MNEA 2RNGA 4B47A 5KNLA 2WB1A 2M4GA 1MNDA 3S3MA 2ZSIB 2CW7A 1EA3A 2X6WA 4AVZA 3OR1C 4CCKA 3W2WA 2X1EA 2BVLA 2F6CA 3BG6A 2CS3A 3VYRB 3ZGKA 4BJ5C 1S9HA 1BOBA 1FMWA 2A5WA 4XN3A 2M3AA 2IS1A 3DPTA 4OWRB 1WJ5A 2LBFB 3ZQQA 3PNTA 2JSPA 1YX3A 2MABA 4G6TB 2CUJA 3NWSA 5FRMA 2CV1A 2MYSA 4C2UA 4BEHA 4BQOA 2V9KA 4C2TA 3HKZA 4IX7A 3QODA 3LL7A 4PSXA 4E7SA 4II2A 4LIVA 4E6KG 4JOMA 2PJRB 4ZTJA 5CQGA 3HG9A 1X4OA 4PFOA 2CFOA 2VIXA 4PFPA 3DKYA 2KZVA 2F4IA 3H9GA 4XL9A 2VLAA 4BQQA 4Y33A 2E1MC 3ZXSA 2IS4A 3VYTB 3MKZA 3OL3A 3BLYA 2R7VA 3E0JB 3OWTA 2LOOA 2BW3A 4PSWA 3HC7A 2V1NA 3LSKA 2R7TA 4U7BA 5FROA 4PK4A 4QPQA 4BDYA 1WJBA 3DKXA 2DJIA 4AU7A 4PJJA 2JVGA 2HVQA 4XOPA 2WBMA 4CZCA 4BJTA 4IKFA 4D1QA 2NOJB 4NUBA 4YELA 2HDWA 3A2KA 1Z7LA 4XM3A 1LFPA 3GBGA 1BR4A 2Z1DA 1D1BA 4CCNA 1GLNA 2R7WA 4DOZA 4ZDOA 3MKWB 4XNFA 1DQUA 2IS6A 4ITVA 4XLHA 3EUAA 3M1CA 2K5CA 1X1BA 1J09A 3MKYB 2E60A 2JA2A 3TBIA 3D5SC 3H35A 3FHNA 3IAS2 3PNYA 3OY9A 3DEEA 2CV0A 3OIQA 2ZFUA 2UUZA 1D1CA 4E7LA 2DCEA 5CKTA 2HPMA 1R6RA 3LSHA 3HOTA 2Y0SA 3DTEA 5KCMA 5FRNA 2L2OA 3OYIA 2VJIA 1HA8A 3S93A 3KX2A 2LY2A 2RQQA 2IGKA 4RLFA 4BE1A 4BL0B 1DP3A 3MD2A 4HSTA 2XF7A 4N4OB 3OYEA 4X0GA 4BJ6C 1AA7A 3I3LA 3H5AA 4N4NB 2I8DA 2VPLA 4ZC3A 2X6XA 4E7IA 4F93B 4CCOA 3DLAA 3K70D 3BG7A 3OYKA 3S32A 3A4CA 4XKCA 4CSWA 2WADA 1MMDA 2F5VA 3K70C 4RM2A 3CP2A 3CP8A 2ZXIA 3QOEA 3S3OA 2W00A 3G2BA 1Y56A 2XSJC 2CMPA 4LITA 3CESA 3OR2C 3VSKA 3LSMA 2KHMA 3MMYB 3DU6A 1UELB 2P0WA 1Y6IA 2HU9A 1N77A 2WY7Q 3AKZA 2R7RA 3FKJA 2IGNA 2DOAA 3BCBA 3K4KA 3OIPA 3H9JA 3KYLA 4XQFA 3SZGA 2DXIA 1FMVA 2W82A 4BDZA 4HSRA 2ZSHB 1TT0A 4F91B 3S8PA 4DGWB 2VQHA 4J01A 1DGRM 2LBFA 4CH7A 3BCAA 5CPRB 3DPLC 5KHDA 1TZLA 3EUKL 3K6GA 1D0ZA 2VB6A 4XMYA 4F92B 3OYLA 2QKMB 4DBRA 2R7QA 3CJQB 1WJDA 1X19A 1D1AA 4BEHB 2M7BA 4BE2A 3VYUB 2VKDA 3H9QA 2V26A 2K9MA 4PUSA 2RREA 2MC4A 3RTRA 1WJEA 4FASD 3LSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M4G A; 
#chains in the Genus database with same CATH topology
 3PSF A;  3HIF A;  1ETY A;  1W7P D;  3HOS A;  1MBF A;  4MO7 A;  3K4B A;  1BIB A;  2ZME A;  4B8X A;  1P9Q C;  3H5N A;  4NBQ A;  4EJU A;  4CCM A;  2BXY A;  2BHZ A;  3U9G A;  4A3B J;  1ODD A;  4CYD A;  3QWL A;  5LGN A;  4XLN F;  1L3L A;  2NYX A;  1X3Z B;  3DQV C;  1S7O A;  3WTW C;  1ZEL A;  4L5J A;  3HKZ N;  1UHW A;  5AIP A;  4W1U A;  2EIM H;  1RR7 A;  4UVC A;  5D4R A;  1EH7 A;  2CU7 A;  2EWN A;  2L5Q A;  5GP9 A;  2NS0 A;  1OYY A;  1DU0 A;  3AL0 B;  4FX4 A;  4OAZ A;  4PJL A;  3IC7 A;  3LA3 A;  3VB2 A;  2JA8 J;  3CC4 I;  4RAF A;  2ZJP F;  2N8G A;  1GDT A;  3HRS A;  1UHM A;  3K2A A;  1X1P A;  4HRI A;  3QP5 A;  1TWC J;  2EZI A;  3FMQ A;  1R49 A;  1MH4 A;  2E2H J;  2H8R A;  1FPQ A;  3TO6 A;  3ZMT A;  1EH6 A;  3OYM A;  5ICE A;  3VFZ A;  1A5J A;  5JI6 A;  4LG3 A;  3L2W A;  4FIS A;  2E2I J;  4Q4Z F;  3JW4 A;  3RDI A;  2GQQ A;  4O5V A;  1FLI A;  3WHC A;  3CF2 A;  4FET A;  2DA1 A;  1AU7 A;  5F08 A;  2OF7 A;  3J81 Z;  3EDP A;  4I98 B;  3VYS B;  2ECB A;  2UV1 A;  4BHC A;  2XVC A;  2R7D A;  4XRS A;  1GV2 A;  2DK5 A;  2HTS A;  3PUB A;  3CCQ I;  1IV8 A;  4R1H A;  1LJ9 A;  2EBI A;  3CJN A;  3MEX A;  4WF2 A;  1OMI A;  2JUC A;  1TWH J;  2JJ7 A;  2X85 A;  1HOM A;  3CLO A;  2M9H A;  2H27 A;  4DYC A;  3PO3 J;  3ABK H;  4I7H A;  3ECO A;  3ZQ7 A;  1TWG J;  2XHK A;  1IN6 A;  3QPS A;  5J1U A;  5C4J J;  4HPQ A;  1USS A;  2QYO A;  3CUQ C;  3QYE A;  3HXL A;  3WHB A;  3X2Q H;  1SD7 A;  3UNG C;  1EKE A;  1YW9 A;  2OTJ I;  3I9V 2;  5JHF A;  1UG2 A;  1J7K A;  3VOE A;  3G71 I;  4UNO A;  1ZR2 A;  3H0G J;  4IL6 C;  3SEQ A;  3M07 A;  3HDD A;  1JTY A;  3TGN A;  2EV5 A;  3IUO A;  2XUB A;  4RAG A;  2ZXW H;  2RV8 A;  3AAF A;  2QBY B;  1ZG5 A;  2LMD A;  1JHF A;  3IKV A;  2Y9Z A;  3D5R C;  4PJM A;  4FX0 A;  3FX3 A;  4L9N A;  4ENJ A;  3KLN A;  1Y39 A;  5E3L A;  3EUH C;  4J19 A;  1VFC A;  2DYS H;  3GZ5 A;  5K5R A;  2MW8 A;  2A07 F;  2B0L A;  2UXX A;  3ZN1 A;  1S29 A;  2ETH A;  4CZZ A;  4HV6 A;  2H6B A;  3ZMV A;  2P5L C;  1WH7 A;  2XAU A;  2L02 A;  3BG9 A;  1ETO A;  4RM3 A;  1LE8 A;  1REP C;  1DPU A;  2W25 A;  2ZNY A;  2O0Y A;  2CUZ A;  3KFW X;  3C2H A;  2EFP A;  1ZG3 A;  1LEA A;  1FP1 D;  2VE9 A;  2MBF A;  4XLF A;  1F9N A;  4XOR A;  2R5Y B;  1T0F A;  3SDB A;  5ICF A;  1HSJ A;  4KJZ A;  1IO2 A;  2XSD C;  1JT0 A;  1QHG A;  5EDN A;  3W6J B;  1YJ9 I;  1Z3X A;  2XF6 A;  3V7C A;  4HF2 A;  4ESJ A;  3DBH B;  1H0M A;  2BW3 B;  2KZG A;  1MMA A;  4YIR X;  3BG5 A;  4RDU A;  1MNM C;  2R4G A;  2M45 A;  5JR3 A;  2KIQ A;  2X1C A;  5L3F A;  4CUG A;  3R61 A;  3UR3 C;  2JZY A;  3DKW A;  2O61 A;  3SYT A;  2QCO A;  2W84 A;  2EFO A;  4ZYA A;  3N97 A;  4HDU A;  4MQ9 F;  4EJW A;  4IQ4 A;  5BPD A;  4BU2 A;  5EZH A;  1MH3 A;  6PAX A;  1ZRC A;  3J7A Y;  4UUV A;  4BS9 A;  3HZJ A;  4XSZ F;  1KU7 A;  4NB5 A;  3CMM A;  5DEQ A;  4M3E A;  4HNT A;  2YPR A;  5F6F A;  4NC7 A;  4FQG A;  4UY8 I;  3WU0 A;  5EG0 B;  3H36 A;  1IG7 A;  2M0M A;  3ZR8 X;  4GYI A;  2ZB9 A;  4MFD A;  1VQ9 I;  3MZ8 A;  1KQ8 A;  1A6Q A;  1YYV A;  2LY1 A;  4M9S A;  1SAN A;  2W85 A;  1V5E A;  2NVT J;  3OYA A;  1YLF A;  1AHD P;  1HW1 A;  3HL2 A;  1LVA A;  2HOT A;  1SC7 A;  5KAI C;  2VBY A;  4IZZ A;  1JGS A;  5M3M J;  1FYK A;  3DF8 A;  3W2A A;  2V79 A;  2W48 A;  2E34 A;  2Y48 A;  4M73 A;  4OMZ A;  1JKO C;  1XDS A;  1NG6 A;  1V5F A;  1FIP A;  2VKV A;  3TMO A;  4Y7N J;  1JUS A;  5CVR A;  1ZRE A;  2WAF A;  2YX7 A;  3FF5 A;  1JT6 A;  4A0Z A;  3N05 A;  1BA5 A;  2M7A A;  1MZB A;  2KIU A;  5EEA A;  2JWT A;  2X48 A;  2YU3 A;  4JQF A;  4RGR A;  4A6E A;  2UZK A;  4XOT A;  5GAE J;  2ISZ A;  3EYY A;  3HSF A;  2EFQ A;  3TW6 A;  1X3W B;  5LRR A;  2BV6 A;  3FDY A;  1X2N A;  2EH3 A;  2OAZ A;  2Y31 A;  3PM1 A;  1ZGJ A;  3KLO A;  4OMY A;  1NH3 A;  1CF7 B;  2W4S A;  2DO7 A;  1G6N A;  3G1M A;  1B8I B;  2KLO A;  3CJR B;  5GPC A;  5EYR A;  3K1M A;  3QRF F;  1T8I A;  1SFK A;  4KUM A;  2X51 A;  1Z9C A;  5CLS A;  1MNE A;  1QZE A;  2RNG A;  3V7R A;  3MKL A;  1MND A;  1VF9 A;  5ILS A;  2FJ1 A;  1V54 H;  2CW7 A;  1YFH A;  1EA3 A;  5C44 J;  3F8F A;  5M5X J;  1R71 A;  3CCJ I;  2QA4 I;  2QBY A;  3OR1 C;  1WI9 A;  1P6R A;  3GTJ J;  2BVL A;  3BG6 A;  1A35 A;  5FGM A;  4RAZ A;  4BJ5 C;  2HKO A;  5FJ8 J;  5CYV A;  2VN2 A;  2IS1 A;  4OWR B;  4ZH4 F;  2LBF B;  3ZQQ A;  2G0E A;  3ZQF A;  3NRV A;  4KA4 A;  1YRN B;  1QRY A;  3NWS A;  1K4T A;  5FD5 A;  5IPA A;  1ZRD A;  1I6X A;  1ITY A;  2DK8 A;  2V9K A;  1R1T A;  3V4G A;  4F7Z A;  1KYZ A;  3VOD A;  3BTJ A;  1IRZ A;  1I1S A;  3J81 K;  2QVO A;  3LOC A;  4II2 A;  1HQC A;  4LIV A;  4HDV A;  3T0Y A;  3L1P A;  2RNJ A;  2O3F A;  4JOM A;  4IHY A;  4ZTJ A;  5CVJ A;  2XAH A;  1XD7 A;  3GW2 A;  1MDM B;  2JSC A;  2DOD A;  3RZD J;  2VIX A;  4PFP A;  5IT9 K;  2VLA A;  2NS8 A;  1X3U A;  3P5J A;  2IA2 A;  4QSH A;  3BLY A;  3E0J B;  2MH9 A;  4HQE A;  4CHU A;  2BW3 A;  4PSW A;  3TED A;  1EJ9 A;  2NAZ A;  2PN6 A;  3K9T A;  3LSK A;  2XAQ A;  5FRO A;  1T33 A;  1WPK A;  2R3S A;  5HDN A;  4JP0 A;  1BI2 A;  2DJI A;  1SFE A;  1T56 A;  2DJN A;  2NNY A;  2EIN H;  2AXT C;  2JVG A;  4WCG A;  4XOP A;  4CZC A;  3I0T A;  3R0J A;  3REO A;  1W0U A;  5DM7 F;  2A61 A;  1UMQ A;  4YEL A;  1J59 A;  2HDW A;  5E1W A;  1Z7L A;  4XM3 A;  4Q5S F;  4JX6 A;  1DPR A;  2E1C A;  2Z1D A;  4CCN A;  4GXO A;  3HJE A;  4XRM A;  2COB A;  3IH4 A;  4IHV A;  2GWR A;  4XNF A;  1FEX A;  2OCE A;  3M1C A;  4XLH A;  1ORK A;  3BDD A;  2ZFW A;  3NEU A;  3TO7 A;  2M8G X;  1LUJ B;  4KNY A;  3MKY B;  5EG0 A;  3F8M A;  2JA2 A;  1PUF A;  2HWV A;  2P5V A;  3FK7 A;  2JRT A;  5H6Q A;  3ABT A;  3IAS 2;  1RKW A;  2XPV A;  5E8I A;  2C6Y A;  2CV0 A;  4HLX A;  3H3V K;  1PP8 F;  5BOX A;  2ZME C;  4IOA F;  2CQX A;  2DCE A;  2JRM A;  2Q0O A;  3HOT A;  3RI4 A;  2Y0S A;  3DTE A;  3CCL I;  1HA8 A;  3S93 A;  2K7L A;  2PEX A;  1R7J A;  1JTX A;  5JVG F;  3SFZ A;  4N9H A;  4BL0 B;  1PP7 U;  2XF7 A;  3MQ0 A;  2XAG A;  1SFO J;  1AA7 A;  4L0Z B;  5B3S H;  4N4N B;  2I8D A;  4MNU A;  2ELH A;  4AYB N;  2F4M B;  4F93 B;  3JCU C;  1CF7 A;  1VI0 A;  3BG7 A;  3OYK A;  4XKC A;  1B8I A;  2CQ7 A;  4G7O F;  2Q8K A;  1PVE A;  1RPW A;  3CP2 A;  2ZXI A;  2VI6 A;  3S3O A;  4GCV A;  1X2M A;  2W00 A;  3F72 A;  3JRA A;  2DOE A;  1FWZ A;  3G2B A;  4A3D J;  4B09 A;  2CMP A;  3BZK A;  4IJA A;  2X6O A;  3CES A;  2HYJ A;  2EJR A;  4HA8 A;  2KHM A;  5IOZ A;  3MMY B;  5IYD J;  2DN0 A;  3HUG A;  4LFU A;  4C3I J;  3WTU C;  2FA5 A;  2MH2 A;  1TLH B;  4I02 A;  3AKZ A;  1S3J A;  2EV0 A;  3A03 A;  1OYI A;  2CRG A;  3BCB A;  3FZV A;  2DA2 A;  5F04 A;  2PQ8 A;  4UV8 A;  4EQQ A;  4YIF A;  5D8L B;  4HYE A;  3TOA A;  4XQF A;  4EV0 A;  4LK0 F;  2DXI A;  2HR3 A;  2WAQ N;  4F91 B;  3S8P A;  4DGW B;  1HBX G;  1MKM A;  2VQH A;  3J7Y J;  2LBF A;  1E17 A;  1YRN A;  5CPR B;  5KHD A;  1TZL A;  1Z67 A;  3EUK L;  2VB6 A;  5D5X B;  3OYL A;  4Y52 J;  4XSX F;  2V6C A;  1XCV A;  5LLQ A;  2M87 A;  4LG0 B;  4BEH B;  2M7B A;  1RI7 A;  2VBZ A;  3CJT B;  5DYM A;  2V26 A;  3ERE D;  4FAS D;  4PJ0 C;  2XAS A;  1RC9 A;  3M8J A;  4LD5 A;  1MDM A;  2XKO A;  2WAE A;  3O8H A;  1E0E A;  1K83 J;  2M4K A;  3VEP A;  2L3D A;  4KN4 X;  4S0H B;  2D2W A;  4RA2 A;  2VBW A;  3I55 I;  4DBQ A;  1I3Q J;  2YX4 A;  3P9I A;  2EIJ H;  5EGO B;  2ZJR F;  1G8X A;  1MJB A;  3RKY A;  2QQ8 A;  3RZO J;  3VSL A;  3I53 A;  2JTV A;  3CMY A;  3QQA A;  3ZCO A;  2J5P A;  3KP3 A;  2K4B A;  1Z21 A;  2KDO A;  1PJR A;  3DPU A;  3DTK A;  4HBL A;  4CCL A;  1VQL I;  4X6A J;  3L00 A;  3DXJ F;  5FLX Z;  2EB7 A;  3F8N A;  3HOU J;  1MW7 A;  2HQA A;  1MIJ A;  3E1S A;  2GXB A;  1MD0 A;  1MMG A;  1SMT A;  3AFH A;  1OLT A;  2Q1Z B;  3TP0 A;  4ZYD A;  2GOM A;  2VJ4 A;  2HI3 A;  1D0Y A;  2HOS A;  1DU6 A;  2F2E A;  3F8B A;  2K3F A;  3OYF A;  3OYH A;  2QUF A;  4E7H A;  2R7Z J;  1HKT A;  3RKW A;  4AVP A;  3FHZ A;  3E6D A;  1STZ A;  4G6Q A;  4XKW A;  1DDN A;  3F8C A;  3ZOB A;  5HDG A;  4KIG A;  4A3K J;  3WTV C;  2QZ8 A;  3S16 J;  1D3Y A;  2ISY A;  3LMM A;  2DQR A;  3OYJ A;  2L54 A;  2KRH A;  2VQL A;  2B7E A;  2DFF A;  1P7J A;  2FUG 2;  1T0F C;  2ID3 A;  4LB5 A;  3UKG A;  2Z2S B;  3L09 A;  3JAM Z;  2HQR A;  1OCZ H;  3FK6 A;  5EEG A;  5J3L A;  3CDH A;  2HPI A;  1U2W A;  4J00 A;  4XR6 A;  3BG3 A;  3K4C A;  3IRR A;  1XS9 A;  2LR8 A;  5E18 F;  1E2X A;  1QVU A;  1TT5 B;  3P9C A;  2DU9 A;  5CJ9 A;  4IHS A;  3G4S I;  4FE7 A;  3PJR A;  1IN8 A;  1IDZ A;  4KFC A;  3B73 A;  2JUG A;  2OQR A;  3M9A A;  4WXD A;  3ZQH A;  5HOD A;  4P55 A;  2XGC A;  2H1K A;  4E7J A;  2R7S A;  1QHH D;  1APL C;  4UB6 C;  1DP7 P;  3M4O J;  4OU0 A;  1QPM A;  3MWM A;  4BE0 A;  4O3M A;  4QIW N;  1V55 H;  3CLQ A;  1E3P A;  4L18 B;  3AL0 C;  1D5V A;  4IRI A;  2IP2 A;  4G94 A;  4A0X A;  3H92 A;  2BGC A;  4XKV A;  5HLT A;  4UVA A;  3A1Y A;  2P6T A;  3BR3 A;  2BVM A;  4BYY A;  3E5U A;  3FBI B;  2FD5 A;  5FO5 A;  1G3W A;  1TL8 A;  1W36 C;  2LF7 A;  1D0X A;  1JKR C;  3RPU A;  4BXF A;  5E3N A;  3GTG J;  1FZP B;  1SMY F;  2BY1 A;  2OTL I;  2CW8 A;  1BI0 A;  1BR1 A;  1QQI A;  2P4W A;  2JQ7 A;  3J7A O;  5HNF A;  3SEZ A;  2M0C A;  3LSG A;  5E1X A;  3DV8 A;  3OS2 A;  1VTN C;  3JRH A;  3H5R A;  4O6J A;  3CCM I;  4I01 A;  4H4K C;  4HG2 A;  2L7Z A;  4EM1 A;  3OS0 A;  3HOX J;  1YOV B;  2ZO4 A;  4GO1 A;  5GTI C;  3PL8 A;  2EFW A;  3Q9S A;  1X1C A;  2VAS A;  4ZDP A;  1MMN A;  5F0H A;  1XSX A;  1GV5 A;  2E5Z A;  3D5L A;  2CV2 A;  2PJR A;  2EK5 A;  4BQA A;  1GVD A;  2JVH A;  1RNL A;  2WA0 A;  1QBJ A;  2X9D A;  3ONQ A;  4LG0 A;  3O6B B;  2L9S A;  3V8K A;  4I0B A;  2K9L A;  3IHU A;  1U3E M;  2KIS A;  2MSY A;  4YFK F;  2CH0 A;  1SFX A;  2R7F A;  1YTY A;  2LKP A;  5IP7 J;  3KYD B;  2L0K A;  1B72 B;  2JPC A;  3BP8 A;  2YSR A;  4U0V A;  1N25 A;  2J5O A;  1ZHF A;  3PNV A;  4A93 J;  4XK4 A;  1IRG A;  3I58 A;  1BBY A;  5J1Y A;  1Z1D A;  1BL0 A;  2IXS A;  2GLO A;  1Y8Q B;  4BGD A;  1Q1H A;  1U8B A;  1ETV A;  4EGY A;  3QYF A;  1T95 A;  1JE8 A;  1F4K A;  3E5X A;  1QPI A;  3FBN B;  4Z6Y A;  5GPA A;  3OS1 A;  3OYD A;  2FOK A;  3GFM A;  4MTE A;  2ACJ A;  4CIC A;  3T1B A;  3ZQL A;  2IW5 A;  3V42 A;  4HAM A;  4E7K A;  3O2P E;  2K02 A;  1IUF A;  1KU3 A;  5CQE A;  4L5E A;  2KDZ A;  4UHT A;  2OC6 A;  2FBH A;  5LD2 C;  3CDL A;  3ULQ B;  3IH3 A;  1Z6T A;  4C3J J;  3HB9 A;  5DD4 A;  3JRB A;  1WRJ A;  2LC2 A;  1RUO A;  2R93 J;  1UAA A;  2GBY A;  2FRH A;  2NRA C;  3CCU I;  4WX9 A;  1KU9 A;  1YO5 C;  2KP6 A;  2VT2 A;  2OV7 A;  2KJC A;  2NNN A;  3K4L A;  4U87 A;  2H1L A;  5FKK A;  2K27 A;  5D4S A;  5DS9 A;  4A3E J;  3FMR A;  2V6E A;  4M9X A;  2FSW A;  2F5F A;  4EAT A;  4U7D A;  2M2E A;  2JA7 J;  2MD0 A;  1D5Y A;  5IYB J;  5DUK A;  3DCF A;  3JRI A;  1ON1 A;  2X1D A;  1R5I D;  2GZW A;  1MJA A;  1YE9 A;  2HXI A;  2HQ5 A;  4G12 A;  1YG2 A;  3S1R J;  3A0H C;  3DLL F;  1WCM J;  1MBG A;  4JK1 X;  1IRX A;  2D45 A;  4L0Y B;  3GTM J;  4IEJ A;  2Y30 A;  4UUT A;  2JN6 A;  4Q47 A;  2XV4 S;  4IHT A;  4KIS A;  2G9W A;  2VC1 A;  2VOO A;  5ERI A;  2PMH A;  3IKT A;  5LBQ A;  1MGT A;  2R7U A;  2CGP A;  3KP7 A;  3NWT A;  1HC8 A;  2IT0 A;  3DP7 A;  5LFA A;  3F3X A;  2IVM A;  2QWW A;  1K78 B;  2IRF G;  3BJ6 A;  2VQC A;  4ZYE A;  3RQI A;  1WJC A;  1V5G A;  4OAY A;  2ZCW A;  5DCF A;  4DYQ A;  1LPQ A;  4ZDL A;  5K5O A;  1LDK B;  3B02 A;  1ERD A;  3TQN A;  4UUS B;  4XN0 A;  3LWF A;  4ANJ A;  3RSN A;  3F22 A;  3GFL A;  5KNL A;  1W7P B;  2OU2 A;  1TBX A;  1XTA A;  2CO5 A;  2X6W A;  1I5Z A;  3G1O A;  2DA6 A;  2PX9 A;  4HF0 A;  2I5U A;  2NXN B;  4CCK A;  2X1E A;  5JLX A;  2F6C A;  2VKE A;  1FBU A;  4BY7 J;  2EPF A;  1S9H A;  3T8R A;  1R1U A;  2A5W A;  1IXS B;  1A6I A;  4XN3 A;  3Q3S A;  1RZ4 A;  1U6G A;  2DDB A;  2V1U A;  2O8X A;  5J47 A;  2MAB A;  3BTI A;  3ECH A;  3BRO A;  3MAJ A;  2V9V A;  5ICG A;  2MYS A;  3RYP A;  3QPT A;  3E7L A;  3HKZ A;  4IX7 A;  4ABZ A;  3LL7 A;  4E7S A;  3F6V A;  2BY0 A;  1XX5 A;  4BBS J;  4RS8 A;  3LA2 A;  4AM3 A;  1UHS A;  1MBK A;  5CQG A;  3WGG A;  4LB6 B;  1HLV A;  1SVO A;  3HG9 A;  1X4O A;  4HW0 A;  4IRH A;  1CQT A;  1FNN A;  2KZV A;  2DI3 A;  3Q0W A;  2F4I A;  4XL9 A;  3V8J A;  1B72 A;  1H8A C;  2K40 A;  1BI3 A;  3VYT B;  4A3C J;  3OL3 A;  3OWT A;  2LOO A;  5LEK A;  3FKI J;  3HC7 A;  4U7B A;  5BPI A;  4PK4 A;  2PG4 A;  5A2Q Z;  1M1E B;  1WJB A;  2CQK A;  2FX0 A;  4V19 K;  1YJW I;  2DFI A;  2DMT A;  1EF4 A;  3FWE A;  3GLL A;  3BTC A;  5L3C A;  2M1B A;  4D1Q A;  3B6C A;  5L3E A;  2ESH A;  4AWX B;  3E6M A;  1W1W E;  1OR7 A;  2RAE A;  4D7M A;  3HYI A;  4P9F A;  4CDG A;  2R7W A;  2L7M P;  3MKW B;  3BZ6 A;  1H9T A;  1XB4 A;  5LHG A;  2IS6 A;  4CXF A;  1BOA A;  3LQR A;  1J09 A;  3SZT A;  1FYL A;  3WTY C;  5E79 C;  4G8X A;  1J5Y A;  2CSO A;  2CJJ A;  2A5Y B;  1IC8 A;  4OIP F;  1K79 A;  4KT5 C;  2LSO A;  2PMZ N;  1V3F A;  2IAI A;  2ICW G;  2ADU A;  2JT1 A;  4Y15 A;  3OIQ A;  1OQY A;  2ZXJ A;  2F4O B;  2PBI A;  2EV6 A;  1J0R A;  1F5T A;  4EJT A;  1R6R A;  3KPH A;  3LSH A;  1I50 J;  4Q48 A;  5B5E C;  1W0T A;  2VJI A;  3DFG A;  5HLG A;  1R00 A;  2XIG A;  5TRD A;  1IAW A;  5IT3 A;  3ABM H;  3KX2 A;  4L9T A;  1QNT A;  1JJ6 C;  4RLF A;  5H6R A;  3PIO F;  3G1L A;  2XB5 A;  3S14 J;  2E36 A;  1K78 A;  3H5A A;  2RVC A;  4FT8 A;  1O3T A;  3HOY J;  4IHX A;  1P2F A;  2IJL A;  2CG4 A;  3KP5 A;  4HLY A;  1L0O C;  1HDD C;  3QU3 A;  1FTT A;  3K70 D;  1HW5 A;  5M3F J;  4C3H J;  3ZMD A;  2KIM A;  3PQJ A;  4DYR A;  4M71 A;  1FC3 A;  3ZP5 A;  3K70 C;  2COM A;  1BIA A;  3QOE A;  3FXJ A;  4UUS A;  1XGO A;  2XSJ C;  2F5D A;  4XRS G;  5ILV A;  2WY7 Q;  9ANT A;  4V2G A;  3ZMU A;  1RRJ A;  1UZC A;  4LLL A;  1XGS A;  3ML6 A;  3KYL A;  1GXQ A;  5HS9 A;  3MCZ A;  1R22 A;  4A3G J;  3IV5 A;  3BR1 A;  2NVU B;  2A05 A;  5K7Z A;  3C3W A;  1Y8R B;  3EYI A;  5E3M A;  4IVN A;  2DMN A;  3OOP A;  3K6G A;  1D0Z A;  1TP4 A;  2DMP A;  1U9O A;  4DBR A;  2R7Q A;  2FBI A;  2WB1 N;  2R5Y A;  1X19 A;  1ENH A;  1FOW A;  3LSJ A;  1D1A A;  2L01 A;  5DV5 A;  1BI1 A;  3VYU B;  5GTH C;  2VKD A;  2K9N A;  2K9M A;  4PUS A;  1YQA A;  4B4C A;  1WJE A;  3A0B C;  4RLQ A;  4FHT A;  1YX5 A;  2L7F P;  3CCR I;  1IJW C;  3ROU A;  2VXZ A;  3H1C A;  1UB9 A;  1TQM A;  2VJ5 A;  2UXN A;  3K4J A;  2O03 A;  1WFX A;  2Z33 A;  3C18 A;  4YRV A;  5K1Y A;  1S7A A;  1J75 A;  3OYB A;  1KON A;  4MHG A;  4MTD A;  2G7H A;  1RKT A;  2LD5 A;  3LFU A;  1O3S A;  3R60 A;  5FD6 A;  1PYV A;  1WGX A;  3S1Q J;  1J2X A;  5DUI A;  1NG7 A;  1E3O C;  1T6S A;  2A3S A;  3KP2 A;  4IPA A;  2FQ4 A;  3H0D A;  3M8F A;  1OIS A;  3HBL A;  2WV0 A;  4D5F A;  1NK3 P;  2VQG A;  2IS4 A;  4QLC U;  2TDX A;  3CUO A;  1U5T B;  1KQ9 A;  5TGT A;  1XG1 A;  2ZC2 A;  1MMS A;  2W7N A;  4F55 A;  4KT6 A;  3QAH A;  2HZT A;  1R4M B;  1MSF C;  1WWX A;  1JXS A;  2BBY A;  1NTC A;  5J8F A;  2MFZ A;  2L7K A;  2PMU A;  4NC8 A;  5HDK A;  2FEZ A;  4I99 C;  2H8W A;  2VJJ A;  3C7J A;  4D0P A;  2Z99 A;  4B1R A;  1RET A;  4FTH A;  1JI8 A;  5GAG J;  4BUP A;  1QU3 A;  1VQ7 I;  4ENK A;  3GTL J;  2KL4 A;  4BAC A;  4LK1 F;  2ZXH A;  3F9K A;  2F48 A;  1OFC X;  4YG2 F;  2LDU A;  1RIO H;  1JUM A;  4NNJ A;  3HM5 A;  2OBP A;  3SHF A;  1FSE A;  1LKX A;  3KZZ A;  4U88 A;  4C2M J;  2K3P A;  2Y2Z A;  4B48 A;  5F0C A;  2K86 A;  3HOW J;  4MIM A;  3SJM A;  4ON0 A;  1ZG1 A;  5LHI A;  4YEJ A;  2LYC A;  1LDJ A;  2OQG A;  4LOC A;  4HEA 2;  2EZH A;  2BOL A;  2M30 A;  3AG4 H;  1F43 A;  4ZJZ A;  3HPH A;  4XON A;  3CCE I;  1GT0 C;  1YI2 I;  4ESB A;  3LNQ A;  1ZAO A;  2R7O A;  4MGR A;  1W4M A;  4Y13 A;  4A0Y A;  3CC7 I;  5J8C A;  2KFD A;  2V9P A;  1ONV A;  3JTH A;  2VBX A;  4D7N A;  2KRF A;  5A2Q K;  2VON A;  3P7N A;  3KP4 A;  4DIQ A;  2HYF A;  4MLO A;  4RB2 C;  3L9F A;  2EFN A;  4RGU A;  1QA6 A;  4AUX A;  5BS6 A;  1JHH A;  3GX4 X;  4NQW B;  1JKP C;  3KZI C;  2QKL B;  4D9J A;  3E97 A;  1YS6 A;  4XID A;  3BR2 A;  5DM6 F;  1O7L A;  5J6X A;  3FIS A;  2A69 F;  4PGH A;  3DWL E;  3ZMS A;  5ICC A;  4Y3O A;  2IA1 A;  3JSO A;  2AQE A;  2E7W A;  5HVQ C;  1S5L C;  4X1E A;  4XRF A;  3VWB A;  4IXA A;  5GAH J;  3KYC B;  3GLX A;  1EV7 A;  2B63 J;  4A3F J;  2X6Y A;  4XLC A;  5JFR A;  2I10 A;  3PFY A;  1O4X A;  3WE2 A;  2AO9 A;  2FU4 A;  1MSE C;  1IW7 F;  3KCC A;  4ZZL A;  3M7G A;  2MG4 A;  3BR0 A;  2DYR H;  3FXQ A;  4HX8 A;  3RPQ A;  2GM4 A;  2P6S A;  4OOI A;  4A12 A;  3ZRG A;  4BHP A;  3HOV J;  2AXL A;  4HF1 A;  2Y9Y A;  3LAJ A;  3JR9 A;  4EMS A;  3OV8 A;  3GFI A;  2ID6 A;  4IOC F;  3ESW B;  3K4N A;  1ZLK A;  2CUF A;  3I4M J;  2RGV A;  1TNT A;  2XF5 A;  3Q0V A;  4RB0 A;  5FLV A;  2Z5U A;  2UWM A;  2P81 A;  2DT5 A;  3S2W A;  3HOZ J;  2W24 A;  1XMA A;  2P5K A;  4M6V A;  4TV7 A;  2HVS A;  3CC2 I;  3H3U A;  5CVV A;  3LAP A;  1Y0U A;  3PIP F;  3S2D J;  3LQQ A;  1BC8 C;  2M8E A;  3NAR A;  2FNP A;  2H09 A;  1FSH A;  4A3J J;  2XPU A;  3U21 A;  3B6A A;  2RC4 A;  2AQF A;  1HF0 A;  3BOQ A;  4ZYG A;  3QPL A;  1G59 A;  2VPR A;  4UV9 A;  2XKP A;  4U0Y A;  4HNV A;  3BC8 A;  4P5O A;  2DMU A;  5KAF C;  1ETW A;  4RGS A;  1C0W A;  3I56 I;  3HRM A;  3ELK A;  1U5T A;  3CMA I;  4Y4R A;  1ZGA A;  2P7V B;  1DGW Y;  1I6H J;  1DUX C;  2HQN A;  2IS2 A;  3K7A J;  4CYC B;  2K4J A;  3L2Q A;  1D8J A;  3TDU C;  4HX7 A;  5D5W B;  4E7Z A;  3P9K A;  1VQM I;  1BW6 A;  3K0L A;  1Q1V A;  2HYG D;  3HTS B;  3FMS A;  4I2O A;  1N75 A;  3BJA A;  3CDI A;  5E20 A;  4AYB A;  5KVR A;  2QSH X;  5B1B H;  1T08 B;  2E5N A;  2XRN A;  4DQ2 A;  1LFU P;  2P7C B;  3KEO A;  2GOX B;  4HX4 A;  3BT9 A;  2Z16 A;  1YJN I;  2HS5 A;  2HXO A;  1KZH A;  5M5Y J;  1ZRF A;  4KIT B;  2HNH A;  2QEX I;  3S2H J;  4V2F A;  5L3D A;  1FOY A;  2VOP A;  5HS8 A;  3O3K A;  3BJO A;  1VZ0 A;  4GGG A;  4EVI A;  1Y0N A;  2IGO A;  3OMY A;  3OYN A;  3LSR A;  3WG9 A;  1KA8 A;  3PQK A;  4AIJ A;  2W1O A;  1B6A A;  2ECC A;  5D6E A;  5EF6 A;  3S3N A;  3RQ4 A;  2NOG A;  4CA0 A;  3IAM 2;  1ZGW A;  1R4N B;  3M3Y J;  2LH9 A;  1B9M A;  4CCJ A;  4L5I A;  4EM2 A;  2FNA A;  4UB8 C;  1W36 D;  2Y0M A;  1OR7 C;  3GME A;  2WAQ A;  2BZT A;  4M6Y A;  2F5C A;  2E1M B;  2KJB A;  1BN5 A;  1G4D A;  2PLY A;  4P1W A;  2HGC A;  3K69 A;  3PSI A;  2M4G A;  4GDF A;  2VT3 A;  1TC3 C;  1S72 I;  1XC5 A;  2ZSI B;  3LFK A;  3CCS I;  1Z6R A;  1A04 A;  4NQW A;  3C1D A;  2E19 A;  3RKX A;  4AVZ A;  5BQT A;  3FXR A;  2LLK A;  1K7A A;  3Q0U A;  3W2W A;  3FM3 A;  2LP0 A;  4BNC A;  4ZYH A;  3VYR B;  2GXG A;  3IRQ A;  5HS7 A;  3ISP A;  2M3A A;  2RQP A;  3DPT A;  3AG2 H;  1WJ5 A;  4W97 A;  2CUJ A;  5FRM A;  1WI3 A;  5B66 C;  2CV1 A;  1TQP A;  2BY2 A;  4BEH A;  4BKX A;  4BQO A;  4C2T A;  2K9Q A;  4ENN A;  2L9V A;  4ESF A;  3QOD A;  2D5V A;  1H9G A;  4PSX A;  2EZL A;  3J7Z I;  1LNW A;  1I27 A;  5E8G A;  1FYM A;  2G7U A;  2W57 A;  5CVU A;  2ZJ2 A;  2DAO A;  2CUE A;  2E1N A;  3MFK A;  3H9G A;  5EGO A;  4Y33 A;  1BW5 A;  3MKZ A;  1AOY A;  1Z77 A;  1S8N A;  1R5H A;  4AC0 A;  3K2Z A;  2ESN A;  2V1N A;  3CTA A;  3MZY A;  4M74 A;  3SZP A;  1AKH B;  3HSR A;  1IN4 A;  2QSF X;  3DKX A;  2A68 F;  4BDY A;  1GUU A;  4AU7 A;  1UJ8 A;  3J80 Z;  4PJJ A;  2GXA A;  4AD9 A;  2HVQ A;  2E7X A;  2DPD A;  2JMW A;  5L3G A;  2DDA A;  2WBM A;  4BJT A;  2EZK A;  1G3Y A;  4NUB A;  2DOF A;  3TO9 A;  1XPX A;  3JRC A;  2PFB A;  2IPQ X;  2H6C A;  1IDY A;  1LFP A;  2LK2 A;  5F64 A;  2H94 A;  3GBG A;  2QEN A;  1WSU A;  4N9I A;  2GIV A;  1WZ2 A;  1XMX A;  2HTJ A;  3G3Z A;  1HW2 A;  4GFB A;  4G7H F;  3E6B A;  4DOZ A;  2BE5 F;  2FQ3 A;  3C2B A;  1DQU A;  1T39 A;  2GA1 A;  4I76 A;  1PDN C;  1TWA J;  2HDC A;  1B9N A;  2FE3 A;  3K1N A;  1WH5 A;  4CYC A;  4BXU A;  2E60 A;  2F5E A;  1VQ5 I;  3ASO H;  2FML A;  4LJZ F;  1ZLJ A;  1POG A;  2NVX J;  3TBI A;  2FBK A;  4KMU X;  3D5S C;  5FFX A;  3LSP A;  4JYK A;  3PNY A;  4M3G A;  3WE3 A;  4Z2Y A;  5F1J A;  2ZFU A;  2UUZ A;  2QQA A;  3IL2 A;  2RN7 A;  2EIL H;  2LTP A;  3EET A;  5FKN A;  3HHG A;  4RBO A;  2AHQ A;  2PJP A;  1GVJ A;  5FRN A;  4L9J A;  2IA0 A;  1ETX A;  5DCM B;  1KQ0 A;  3CF5 F;  1H89 C;  3E5Q A;  3GF2 A;  2XAJ A;  4M6X A;  4UVB A;  2HDD A;  2Z9O A;  2LY2 A;  1G3S A;  1S7E A;  5LGT A;  4XIC A;  2RQQ A;  2IGK A;  5D6F A;  3F23 A;  3JRG A;  3K1P A;  1DP3 A;  3MD2 A;  5IT9 Z;  4N4O B;  2NS7 A;  3OYE A;  3CCV I;  4Y17 A;  2FF4 A;  5IY5 H;  5E3O A;  4EGZ A;  1LEB A;  4RGX A;  3JTG A;  5DD8 A;  2E71 A;  2LKS A;  2MC3 A;  2VPL A;  2OPT A;  1KYW A;  1FTZ A;  1FY7 A;  2X6X A;  1XN7 A;  1XMK A;  1ETK A;  1P92 A;  2DA7 A;  3DLA A;  2MA3 A;  5H2F C;  2WAD A;  4BBR J;  4ENM A;  2F5V A;  3WTT C;  1SFU A;  5FLX K;  2DLL A;  3CP8 A;  5JVT A;  2D1H A;  2QSG X;  3PO2 J;  1Y56 A;  3HHH A;  5IP9 J;  1YW8 A;  3VSK A;  2LNB A;  3I5U A;  5EJC A;  5E17 F;  3WGI A;  3GWZ A;  3DU6 A;  2FXA A;  3ZMZ A;  1Y6I A;  2HU9 A;  3E3V A;  1VQN I;  5JHU A;  1N77 A;  3DBL B;  4WK8 F;  2R7R A;  2IGN A;  3K4K A;  1IV6 A;  2VOD A;  2ZBK A;  2D1V A;  3I54 A;  3M8E A;  4M3F A;  4OIR F;  3TOB A;  1VQ4 I;  2CQN A;  1QZY A;  3A02 A;  1FIA A;  1VQK I;  3T5X A;  3SZG A;  1F1Z A;  4M3B A;  3SFI A;  1FMV A;  4UXN A;  1YHQ I;  4BDZ A;  4HSR A;  2ZKZ A;  1HXD A;  2ZSH B;  4BAY A;  4FCY A;  2STT A;  1S6L A;  1TT0 A;  3GTO J;  3JAM K;  1ZN2 A;  2XGD A;  4J01 A;  1DGR M;  3F21 A;  2LKX A;  1ZR4 A;  3F6O A;  3ZQC A;  4CH7 A;  2O9L A;  3PUF A;  2OZU A;  2YUS A;  1IGN A;  5IOY A;  2LY9 A;  4F92 B;  2BYV E;  3HGG A;  4RB3 C;  2QKM B;  1ZYR F;  4DNC A;  5AIQ A;  2JK3 A;  2WTE A;  3G73 A;  1EH8 A;  1W5C C;  1CGP A;  1I39 A;  1WJD A;  2DA4 A;  4BE2 A;  3OSG A;  3QPH A;  2XRO A;  1GXP A;  5ED4 A;  4R8H A;  3FXK A;  2MC4 A;  1W5S A;  3LSI A;  4N0B A;  4L9V A;  3HPG A;  4XLP F;  1IF1 A;  3A01 B;  1X1A A;  1VQO I;  3BZC A;  2DT6 A;  4PCQ A;  3TDZ C;  5IYC J;  5FLM J;  3VDX A;  1J9I A;  5TIS C;  3OL4 A;  3L2V A;  4RMN A;  2L9N A;  3GO5 A;  4I6Z A;  2CQQ A;  1AKH A;  1LFB A;  4RB1 A;  1I3A A;  1WHU A;  1SEU A;  1RES A;  2MLK A;  4OIO F;  5E1Z B;  3CZ6 A;  4A2U A;  5LEJ A;  1PUE E;  2M34 A;  5J1R A;  2OCC H;  1MBH A;  5HOO A;  2WY8 Q;  4OIQ F;  5J4V A;  1IXR C;  3BPV A;  5EEH A;  2V1X A;  2VKH A;  1KGS A;  2DPU A;  1UCR A;  2XAF A;  2LRE A;  3L2R A;  4R79 A;  4DZP A;  3HEF A;  5K5Q A;  3KIO A;  4EJV A;  2DBB A;  4XLA A;  1SAU A;  1ZK8 A;  3CUQ B;  2YR2 A;  2EIK H;  5LHH A;  3V8L A;  3OYG A;  4H0E A;  1K61 A;  2YU9 J;  3TW7 A;  5FKM A;  2ZJQ F;  1N78 A;  3Q5F A;  4B43 A;  1R9T J;  2RDP A;  4LIU A;  3C2G A;  4BH9 A;  1WJA A;  4DZJ A;  2ELJ A;  1BJA A;  1K6Y A;  4BHB A;  4MFE A;  3FXU A;  3JRE A;  4LLN A;  3WTX C;  3GEZ A;  2OD5 A;  2OZ6 A;  5J40 A;  3U1D A;  1U0J A;  1XDU A;  5TJJ A;  1VND A;  1PUF B;  3CD6 I;  1WQ2 A;  2X0L A;  3DBR B;  2HFH A;  4GRI A;  3MZH A;  4NHJ A;  2KMU A;  1BR2 A;  4M72 A;  1G2H A;  1HKS A;  3LST A;  4IO9 F;  2V7F A;  2A6E F;  2OUM A;  1WKM A;  3HTU A;  1FX7 A;  1P4X A;  5DCM A;  1I1G A;  4ZTF A;  2K9S A;  1FT9 A;  3ZQI A;  3EPZ A;  2KRC A;  3KET A;  1YIT I;  4AID A;  5H20 A;  2RKH A;  1VQP I;  1V4R A;  2CWE A;  1QZZ A;  3ABL H;  4KIB A;  1B1B A;  3L7W A;  2QF7 A;  3BY6 A;  4ASN A;  4KIF A;  4BQN A;  1XSD A;  2ZNZ A;  2R5Z B;  1R1V A;  1U5T C;  4QPO A;  5J4Y A;  2O8K A;  2XDV A;  1YS7 A;  1OYW A;  1W7P A;  4A3L J;  4C9Y A;  1W5T A;  4AIK A;  3J80 K;  4KDP A;  4PJN A;  2Y0S N;  1UST A;  3E6C C;  1X1D A;  1HCR A;  3V7S A;  2DTR A;  4HZF A;  3WGH A;  2L4M A;  1ZQ3 P;  3K10 A;  3GUD A;  1R58 A;  4ETS A;  3SDG A;  2NVQ J;  2JA6 J;  2ELK A;  2IGM A;  2VE8 A;  1YW7 A;  1LVK A;  3HUG B;  3WG7 H;  1FP2 A;  5HNH A;  4JX5 A;  3Q9V A;  4DJA A;  2M5W A;  1B4A A;  3TL4 X;  1T38 A;  1K4S A;  5C4X J;  2ME0 A;  3RYR A;  3KZY A;  1OKR A;  3D0S A;  1XGM A;  2LF8 A;  2VXD A;  1SVM A;  4IF4 A;  3W6K B;  2HOE A;  4F52 A;  3GTQ J;  4EM0 B;  4KMF A;  2HEO A;  5CVI A;  4RAY A;  2R7X A;  4BY1 J;  3GZ6 A;  4EJO A;  1HST A;  3ABU A;  2Z3Y A;  1HDP A;  3GXO A;  4HV5 A;  1FOK A;  3L2U A;  2KPM A;  2GIZ A;  2VL8 A;  4G6D A;  2DW4 A;  3W3C A;  5FKO A;  3GVA A;  3A01 A;  4G9Y A;  3OIO A;  2VC0 A;  3RPU D;  1QO0 D;  2MGQ A;  1P4W A;  2V4J C;  3NQO A;  4NDL A;  3FXM A;  5L3B A;  2LRD A;  3CO6 C;  4WWC A;  1IN5 A;  4E4H A;  3WU2 C;  3M1E A;  3LA7 A;  2AS5 F;  3I64 A;  2PI0 A;  3KE2 A;  4C30 A;  4G7Z F;  2BXZ A;  2PMZ A;  2LG4 A;  4XLE A;  3COA C;  4S05 A;  2WWY A;  5ILU A;  3QYB A;  4HNU A;  3O8G A;  3S15 J;  3RCO A;  1U9N A;  4EEF G;  2A6T A;  1P4A A;  4K2E A;  1R36 A;  3QOP A;  2DT7 B;  3TKY A;  4IQJ A;  3IWZ A;  5FFZ A;  5K7F A;  4M3D A;  4B3X A;  3I4N J;  4FE4 A;  3CUQ A;  1HKQ A;  1ACI A;  2HZD A;  3IP4 B;  1TQI A;  3ZN0 A;  2LVS A;  3DEU A;  5F27 A;  1O57 A;  1R5G A;  3R6S A;  1T98 A;  1LB2 A;  5D5V B;  5D5U B;  4PDK A;  3I4P A;  5AON A;  3CME I;  1JKQ C;  1OCT C;  4A5M A;  2TCT A;  1O3R A;  1ZTR A;  2EA4 A;  4XKB A;  1Z05 A;  2Q2E B;  2O5R A;  5LGU A;  2L4A A;  4B44 A;  1IRF A;  2FOW A;  4P9U A;  4OIN F;  1RUN A;  2HVR A;  1BC7 C;  3FIW A;  2O6G E;  3EUH A;  3I59 B;  3MVP A;  3DTI A;  1UFM A;  2DA5 A;  3ZQG A;  3W2V A;  1O3Q A;  3JRF A;  1ZAR A;  1OCO H;  4MEX F;  1MBJ A;  2O7O A;  3FXO A;  3JSP A;  1UG0 A;  5K7H A;  3S17 J;  2XGX A;  2OA4 A;  3EQL F;  2XPW A;  2X4H A;  4KYW A;  4WXC A;  2L9R A;  1X4P A;  4CGZ A;  2XC7 A;  2IEK A;  5FB2 A;  3OOU A;  2IBD A;  3DU5 A;  4II3 A;  4F3Q A;  3OSF A;  3OYC A;  1Z3Y A;  3HSE A;  1TWF J;  1YIJ I;  4BXX J;  2K85 A;  2GAU A;  3F0C A;  2YS9 A;  3K4M A;  2R5Z A;  2KQR A;  1E3H A;  4DW6 A;  1VQ6 I;  1OCR H;  1WJF A;  3BWG A;  3KEY A;  2R0Q C;  1JJ8 C;  1XGN A;  2KIF A;  3DEW A;  4B47 A;  1RR8 C;  3S1N J;  2WB1 A;  3QP6 A;  1OCC H;  2CYY A;  1Z0X A;  3S3M A;  1FBQ A;  4LGW A;  1B59 A;  4I0A A;  5EZG A;  3BR5 A;  3I71 A;  1O7F A;  1XCB A;  3W6V A;  4A3I J;  1ULY A;  1BM9 A;  2CS3 A;  2E1O A;  2P8T A;  3ZGK A;  4QTR A;  1BOB A;  1FMW A;  1A36 A;  1NK2 P;  2QQ9 A;  3SXY A;  2CW0 F;  1Z7U A;  4JBA A;  2EQR A;  1FJL A;  4HOB A;  3PNT A;  2JSP A;  1YX3 A;  4G6T B;  2ME6 A;  1MJ9 A;  5BMZ A;  3ZPL A;  4C2U A;  1OJL A;  2DMQ A;  1ZH5 A;  5DTD A;  3R0A A;  5LRS A;  3T8T A;  3WU1 B;  4ZZD A;  4E6K G;  2EA2 A;  2PJR B;  1U78 A;  3VPR A;  4A3M J;  4PFO A;  2CFO A;  2OJE D;  1R23 A;  3DKY A;  2MLG A;  2V1D A;  2ZME B;  1ETQ A;  5BNG A;  1K6O A;  4BQQ A;  2E1M C;  3ZXS A;  2Y69 H;  2JPB A;  2R7V A;  4U0W A;  4A6D A;  2HOA A;  5FKL A;  5F1R A;  5M5W J;  4PZJ A;  4KN7 X;  2R7T A;  5DDG A;  5IP6 A;  3L2C A;  1NHA A;  4QPQ A;  3RIR A;  3N4M A;  2B9S A;  3WOD F;  2DA3 A;  1IXC A;  2LFB A;  1JGG A;  4QWQ A;  3KEQ A;  1FBS A;  1ZKG A;  3ERM A;  5C3E J;  4GYG A;  1TNS A;  4IKF A;  2BY3 A;  4XBF A;  2NOJ B;  1H88 C;  1MBE A;  3JRD A;  4PGG A;  4YII A;  2KKO A;  3IH2 A;  3A2K A;  1JUP A;  3HGY A;  5D8K B;  1IN7 A;  2QLZ A;  1WVR A;  3BR6 A;  1BR4 A;  1D1B A;  3QU6 A;  2E2J J;  1GLN A;  1OCP A;  2XGE A;  2BEO A;  2GA2 A;  4ZDO A;  2QQB A;  4A69 C;  4ITV A;  3EUA A;  4CO8 A;  2K5C A;  3G6E I;  1X1B A;  2NVY J;  4LLG F;  4HQM A;  4A5N A;  2XRL A;  3GCM A;  2TRT A;  4LMY A;  3RKQ A;  3NAU A;  1SVL A;  4M9Z A;  3CCY A;  3BPX A;  2JA5 J;  3H35 A;  3FHN A;  1A31 A;  2Q2E A;  1T2K A;  3OY9 A;  3DEE A;  4YFN F;  2DFE A;  3D1N I;  3BQY A;  1TW2 A;  1D1C A;  4E7L A;  2STW A;  3I59 A;  3BTL A;  2QM3 A;  1U8R A;  5CKT A;  2E35 A;  2HPM A;  2KT0 A;  1VQ8 I;  4KIC A;  5KCM A;  3BQZ A;  2L2O A;  2A6H F;  2HKX A;  2WC2 A;  4D5C A;  3OYI A;  4IHW A;  2DQL A;  4E70 A;  3R4K A;  1SD5 A;  1SD4 A;  2R92 J;  4BE1 A;  2DFH A;  1BJZ A;  4S04 A;  4HST A;  1GHC A;  1F36 A;  2BHY A;  1Y1W J;  4X0G A;  4BJ6 C;  3I3L A;  4AIH A;  1QVT A;  3KP6 A;  2VUM J;  3PFI A;  4ZC3 A;  3AG1 H;  4E7I A;  1D8K A;  4CCO A;  5B1A H;  3ASN H;  3U1K A;  3S32 A;  3A4C A;  4CSW A;  3WTS C;  3GTK J;  1MMD A;  3GTP J;  2CFX A;  4RM2 A;  1SAX A;  3HRU A;  3AG3 H;  3WTZ A;  5HLH A;  2QGU A;  4LIT A;  3OR2 C;  3LSM A;  1TTY A;  1SD6 A;  1UEL B;  2P0W A;  1YIO A;  4I09 A;  3GZN B;  5GAD J;  3FKJ A;  1X58 A;  2DOA A;  3FM5 A;  1FOX A;  3IWF A;  3OIP A;  4YFX F;  3H9J A;  4P96 A;  3U2R A;  1Z91 A;  3TP3 A;  1XSV A;  3FXL A;  3S1M J;  3H3Z A;  3CO7 C;  4IRG A;  2W82 A;  2FMY A;  1KU2 A;  3RJP A;  5JLW A;  1IZ1 A;  3GFJ A;  4WXH A;  3HRT A;  1QGP A;  3BCA A;  3SQN A;  1LQ1 A;  3DPL C;  1LE8 B;  5F0F A;  2Y75 A;  1AWC A;  4XMY A;  3CQZ J;  1LDD A;  2WV1 A;  1ON2 A;  1OPC A;  3CJQ B;  1P7I A;  4NC6 A;  4B3A A;  3MN2 A;  3GYH X;  5HLI A;  1TW3 A;  2MD5 A;  1IUY A;  5KK1 A;  1G3T A;  3H9Q A;  2RRE A;  2DTZ A;  4JX4 A;  1Y1V J;  3RTR A;  4MEY F;  4MQV A;  2XB0 X; 
#chains in the Genus database with same CATH homology
 3HPG A;  3M8J A;  3PSF A;  4RLQ A;  1YX5 A;  1X1A A;  2WAE A;  3HOS A;  2VXZ A;  1E0E A;  2M4K A;  2DT6 A;  3K4B A;  1P9Q C;  3H5N A;  3VDX A;  2VJ5 A;  4CCM A;  3K4J A;  4DBQ A;  1WFX A;  3OL4 A;  3L2V A;  4RMN A;  4YRV A;  2L9N A;  3OYB A;  1G8X A;  1KON A;  3DQV C;  3LFU A;  3VSL A;  1PYV A;  3CZ6 A;  1ZEL A;  3ZCO A;  1Z21 A;  2KDO A;  1PJR A;  1NG7 A;  3DPU A;  3DTK A;  4CCL A;  5HOO A;  2WY8 Q;  3H0D A;  2L5Q A;  1MW7 A;  2VKH A;  2HQA A;  3AL0 B;  3E1S A;  1MMG A;  2LRE A;  2VQG A;  4OAZ A;  4PJL A;  4R79 A;  3L2R A;  3AFH A;  1OLT A;  2Q1Z B;  4XLA A;  1SAU A;  2GOM A;  2VJ4 A;  5TGT A;  1D0Y A;  3OYF A;  3OYH A;  3OYG A;  4HRI A;  2W7N A;  4E7H A;  1N78 A;  4F55 A;  4B43 A;  4KT6 A;  4LIU A;  3C2G A;  4XKW A;  1WJA A;  3OYM A;  2ELJ A;  1K6Y A;  2MFZ A;  3LMM A;  2L7K A;  4LG3 A;  4NC8 A;  3OYJ A;  3L2W A;  2KRH A;  2VJJ A;  2VQL A;  2FUG 2;  1T0F C;  3CF2 A;  2Z2S B;  4FET A;  1JI8 A;  1U0J A;  4BUP A;  1QU3 A;  2HPI A;  2KL4 A;  4GRI A;  4J00 A;  4BAC A;  4XR6 A;  3K4C A;  2ZXH A;  3F9K A;  2KMU A;  3VYS B;  1BR2 A;  2UV1 A;  2V7F A;  2OUM A;  3PUB A;  4NNJ A;  3PJR A;  1LKX A;  4ZTF A;  2JUG A;  2K3P A;  4B48 A;  2X85 A;  3EPZ A;  2KRC A;  4E7J A;  2R7S A;  1QHH D;  4YEJ A;  2LYC A;  4HEA 2;  2BOL A;  4BE0 A;  4ZJZ A;  3HPH A;  4XON A;  4BQN A;  3AL0 C;  2R7O A;  4HPQ A;  4QPO A;  3QYE A;  2XDV A;  3HXL A;  4XKV A;  3UNG C;  5HLT A;  4C9Y A;  3I9V 2;  3A1Y A;  4DIQ A;  4MLO A;  2BVM A;  3FBI B;  4PJN A;  5JHF A;  1W36 C;  1D0X A;  1X1D A;  3SEQ A;  3K10 A;  3IUO A;  4BXF A;  4NQW B;  2QKL B;  4D9J A;  2CW8 A;  1BR1 A;  3D5R C;  4PJM A;  3DWL E;  2IGM A;  3SEZ A;  5HNF A;  1LVK A;  3HUG B;  3LSG A;  4Y3O A;  5HNH A;  3OS2 A;  2AQE A;  5HVQ C;  3H5R A;  4DJA A;  3VWB A;  3TL4 X;  4H4K C;  3EUH C;  2X6Y A;  4HG2 A;  2VXD A;  4XLC A;  3OS0 A;  3PFY A;  4F52 A;  3PL8 A;  1X1C A;  2VAS A;  2XAU A;  4ZDP A;  1MMN A;  4RM3 A;  2E5Z A;  2R7X A;  3D5L A;  3ZRG A;  2CUZ A;  2CV2 A;  2PJR A;  2JVH A;  3C2H A;  2WA0 A;  3ONQ A;  4XLF A;  2L9S A;  4XOR A;  2K9L A;  3K4N A;  3SDB A;  3L2U A;  2KPM A;  2XF5 A;  2VL8 A;  2UWM A;  4KJZ A;  3W3C A;  2CH0 A;  1QHG A;  3RPU D;  1Z3X A;  3PNV A;  2XF6 A;  2V4J C;  2HVS A;  2BW3 B;  2LRD A;  4E4H A;  1MMA A;  2IXS A;  4BGD A;  2R4G A;  3QYF A;  2X1C A;  4C30 A;  1T95 A;  4CUG A;  3U21 A;  3FBN B;  3UR3 C;  2AQF A;  3OS1 A;  3SYT A;  2PMZ A;  3OYD A;  2LG4 A;  4ZYA A;  1G59 A;  4XLE A;  3V42 A;  4IQ4 A;  3QYB A;  4E7K A;  3BC8 A;  4P5O A;  4BU2 A;  4HNU A;  3RCO A;  4IQJ A;  2A6T A;  5CQE A;  3J7A Y;  2DT7 B;  2OC6 A;  4BS9 A;  5LD2 C;  4B3X A;  4Y4R A;  2HZD A;  3IP4 B;  1DGW Y;  2LC2 A;  3CMM A;  4HNT A;  1UAA A;  2IS2 A;  4NC7 A;  2KP6 A;  2OV7 A;  3L2Q A;  4U87 A;  3K4L A;  2M0M A;  3ZR8 X;  4E7Z A;  2V6E A;  2LY1 A;  4EAT A;  1N75 A;  4XKB A;  2Q2E B;  4AYB A;  2O5R A;  2MD0 A;  1V5E A;  4B44 A;  3OYA A;  2E5N A;  2HVR A;  2X1D A;  1YE9 A;  3HL2 A;  4IZZ A;  2GOX B;  3W2A A;  3DTI A;  2Z16 A;  1IRX A;  3W2V A;  4KIT B;  1NG6 A;  1V5F A;  3TMO A;  2HNH A;  1UG0 A;  2WAF A;  4KIS A;  3N05 A;  2M7A A;  1VZ0 A;  2IGO A;  3OMY A;  3OYN A;  1X4P A;  4JQF A;  2W1O A;  2R7U A;  4XOT A;  3NWT A;  2XC7 A;  3OOU A;  3S3N A;  5LFA A;  3RQ4 A;  3DU5 A;  4II3 A;  4CA0 A;  3IAM 2;  4F3Q A;  3OYC A;  1Z3Y A;  2LH9 A;  4CCJ A;  2VQC A;  3FDY A;  1WJC A;  1V5G A;  4OAY A;  1W36 D;  2W4S A;  1OR7 C;  3K4M A;  2WAQ A;  4ZDL A;  2KQR A;  2KLO A;  3CJR B;  1LDK B;  2E1M B;  1ERD A;  1WJF A;  3KEY A;  4XN0 A;  1SFK A;  2X51 A;  4P1W A;  4ANJ A;  3RSN A;  3PSI A;  1MNE A;  2RNG A;  4B47 A;  5KNL A;  2WB1 A;  2M4G A;  1MND A;  3S3M A;  2ZSI B;  2CW7 A;  1EA3 A;  2X6W A;  4AVZ A;  3OR1 C;  4CCK A;  3W2W A;  2X1E A;  2BVL A;  2F6C A;  3BG6 A;  2CS3 A;  3VYR B;  3ZGK A;  4BJ5 C;  1S9H A;  1BOB A;  1FMW A;  2A5W A;  4XN3 A;  2M3A A;  2IS1 A;  3DPT A;  4OWR B;  1WJ5 A;  2LBF B;  3ZQQ A;  3PNT A;  2JSP A;  1YX3 A;  2MAB A;  4G6T B;  2CUJ A;  3NWS A;  5FRM A;  2CV1 A;  2MYS A;  4C2U A;  4BEH A;  4BQO A;  2V9K A;  4C2T A;  3HKZ A;  4IX7 A;  3QOD A;  3LL7 A;  4PSX A;  4E7S A;  4II2 A;  4LIV A;  4E6K G;  4JOM A;  2PJR B;  4ZTJ A;  5CQG A;  3HG9 A;  1X4O A;  4PFO A;  2CFO A;  2VIX A;  4PFP A;  3DKY A;  2KZV A;  2F4I A;  3H9G A;  4XL9 A;  2VLA A;  4BQQ A;  4Y33 A;  2E1M C;  3ZXS A;  2IS4 A;  3VYT B;  3MKZ A;  3OL3 A;  3BLY A;  2R7V A;  3E0J B;  3OWT A;  2LOO A;  2BW3 A;  4PSW A;  3HC7 A;  2V1N A;  3LSK A;  2R7T A;  4U7B A;  5FRO A;  4PK4 A;  4QPQ A;  4BDY A;  1WJB A;  3DKX A;  2DJI A;  4AU7 A;  4PJJ A;  2JVG A;  2HVQ A;  4XOP A;  2WBM A;  4CZC A;  4BJT A;  4IKF A;  4D1Q A;  2NOJ B;  4NUB A;  4YEL A;  2HDW A;  3A2K A;  1Z7L A;  4XM3 A;  1LFP A;  3GBG A;  1BR4 A;  2Z1D A;  1D1B A;  4CCN A;  1GLN A;  2R7W A;  4DOZ A;  4ZDO A;  3MKW B;  4XNF A;  1DQU A;  2IS6 A;  4ITV A;  4XLH A;  3EUA A;  3M1C A;  2K5C A;  1X1B A;  1J09 A;  3MKY B;  2E60 A;  2JA2 A;  3TBI A;  3D5S C;  3H35 A;  3FHN A;  3IAS 2;  3PNY A;  3OY9 A;  3DEE A;  2CV0 A;  3OIQ A;  2ZFU A;  2UUZ A;  1D1C A;  4E7L A;  2DCE A;  5CKT A;  2HPM A;  1R6R A;  3LSH A;  3HOT A;  2Y0S A;  3DTE A;  5KCM A;  5FRN A;  2L2O A;  3OYI A;  2VJI A;  1HA8 A;  3S93 A;  3KX2 A;  2LY2 A;  2RQQ A;  2IGK A;  4RLF A;  4BE1 A;  4BL0 B;  1DP3 A;  3MD2 A;  4HST A;  2XF7 A;  4N4O B;  3OYE A;  4X0G A;  4BJ6 C;  1AA7 A;  3I3L A;  3H5A A;  4N4N B;  2I8D A;  2VPL A;  4ZC3 A;  2X6X A;  4E7I A;  4F93 B;  4CCO A;  3DLA A;  3K70 D;  3BG7 A;  3OYK A;  3S32 A;  3A4C A;  4XKC A;  4CSW A;  2WAD A;  1MMD A;  2F5V A;  3K70 C;  4RM2 A;  3CP2 A;  3CP8 A;  2ZXI A;  3QOE A;  3S3O A;  2W00 A;  3G2B A;  1Y56 A;  2XSJ C;  2CMP A;  4LIT A;  3CES A;  3OR2 C;  3VSK A;  3LSM A;  2KHM A;  3MMY B;  3DU6 A;  1UEL B;  2P0W A;  1Y6I A;  2HU9 A;  1N77 A;  2WY7 Q;  3AKZ A;  2R7R A;  3FKJ A;  2IGN A;  2DOA A;  3BCB A;  3K4K A;  3OIP A;  3H9J A;  3KYL A;  4XQF A;  3SZG A;  2DXI A;  1FMV A;  2W82 A;  4BDZ A;  4HSR A;  2ZSH B;  1TT0 A;  4F91 B;  3S8P A;  4DGW B;  2VQH A;  4J01 A;  1DGR M;  2LBF A;  4CH7 A;  3BCA A;  5CPR B;  3DPL C;  5KHD A;  1TZL A;  3EUK L;  3K6G A;  1D0Z A;  2VB6 A;  4XMY A;  4F92 B;  3OYL A;  2QKM B;  4DBR A;  2R7Q A;  3CJQ B;  1WJD A;  1X19 A;  1D1A A;  4BEH B;  2M7B A;  4BE2 A;  3VYU B;  2VKD A;  3H9Q A;  2V26 A;  2K9M A;  4PUS A;  2RRE A;  2MC4 A;  3RTR A;  1WJE A;  4FAS D;  3LSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...