4A93J

Rna polymerase ii elongation complex containing a cpd lesion
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Mechanism of Translesion Transcription by RNA Polymerase II and its Role in Cellular Resistance to DNA Damage.
pubmed doi rcsb
total genus 17
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4a93J00
2XRLA 2E2JJ 4XRSG 1X2NA 2EZIA 4MO7A 1FTTA 2NS7A 1OFCX 4M3DA 2LY9A 2WB1N 2TRTA 3HGGA 3JRGA 4IHYA 2M34A 3BT9A 1RKTA 3NAUA 3FIWA 3FK6A 3JR9A 1ETOA 3K2AA 5M3FJ 2CUEA 1JKQC 1Y1WJ 3FKIJ 3CQZJ 1LFUP 4LOCA 1AHDP 3Q0VA 4ABZA 3GTQJ 4QSHA 2DMTA 4W1UA 4FTHA 3I4NJ 3BTIA 3H0GJ 3S14J 3CDLA 2E2HJ 4BBSJ 3BG3A 4BY1J 5M3MJ 1HCRA 3BTCA 2MGQA 4XK4A 1R9TJ 1FIPA 2LLKA 3HM5A 4A93J 3Q0WA 4QIWN 3IH2A 3BR6A 2TCTA 5E3NA 3F0CA 2AO9A 2GM4A 3BTJA 2LTPA 2ME0A 1BW6A 1LFBA 1VI0A 4S0HB 1I50J 2ECBA 2QCOA 3HOXJ 1WH7A 4RBOA 3HOYJ 3K7AJ 1YRNA 3BQZA 1GT0C 2VI6A 1IGNA 1APLC 2IAIA 1UG2A 2XB0X 4DYQA 3HOVJ 2DA2A 1ETXA 2PMZN 2O8KA 2ECCA 2K40A 5EGOB 1H88C 2K9SA 2CRGA 2HOAA 3RQIA 2DA5A 3S1RJ 2NVXJ 2K9NA 5EF6A 3IV5A 2H8RA 1JUMA 2YS9A 2GLOA 1ZKGA 4IHWA 4M3BA 2XB5A 1TWGJ 3QQAA 2JA8J 1G2HA 1HDPA 1PUFB 3A02A 3HKZN 3SFIA 1WI3A 2HOSA 4MLOA 5IOYA 2VPRA 5J3LA 2XGCA 4BY7J 4QTRA 1JJ8C 1OCTC 3GTPJ 2M2EA 3S1QJ 3OSFA 3MN2A 5DS9A 2COBA 4FE4A 2LR8A 3I4MJ 1ETWA 3JREA 4AC0A 3S16J 4CYCB 2M9HA 3BQYA 2X6OA 3QPLA 2DMQA 2VKVA 4GFBA 5F27A 4D7NA 5FJ8J 1K61A 2X9DA 4IHXA 3LSGA 2JK3A 2P81A 2RAEA 1AKHB 4BXXJ 3S1MJ 5F08A 2NVTJ 3ZQIA 3NARA 4Y7NJ 2MW8A 5M5YJ 1IJWC 1ORKA 1IDZA 2NVYJ 3MKLA 4BKXA 2CQXA 3PO3J 1DU6A 4BBRJ 2D5VA 2DMNA 4AUXA 4A69C 3A01A 3JRBA 4X6AJ 2DMUA 3ZQFA 3HOWJ 2DA1A 3OOUA 3GTJJ 4B3AA 1JUPA 2R5YB 3QPSA 2NVQJ 1ETQA 2XSDC 4C3HJ 1JTYA 4DW6A 1EF4A 2WAQN 3Q3SA 2CQQA 1GDTA 3LSJA 4I76A 4M3FA 3S17J 1JGGA 1RR7A 5IYBJ 3G1LA 2XPWA 3BR3A 2DA6A 2EBIA 4J19A 3CCYA 2YUSA 9ANTA 1BL0A 5C4XJ 2IEKA 1X2MA 2DA4A 1B72B 1FJLA 3JRDA 3PM1A 3BR0A 1FTZA 1LE8A 2R5ZA 2HI3A 3FK7A 3GTGJ 3TP3A 4L5EA 1H8AC 4A3KJ 1ENHA 1U9OA 2ID3A 1MBKA 4A3GJ 1MH4A 2NS8A 2Y30A 2JA5J 2DMPA 4V2FA 3TW7A 1Y1VJ 1WGXA 4EEFG 2EZHA 3IH3A 1I3QJ 3Q0UA 3HB9A 5DTDA 1QVUA 1ZR2A 2KDZA 1S7EA 1U8BA 2HOTA 2HQ5A 4MIMA 5IP6A 1ZGWA 2M8GX 2Y9YA 4FE7A 1H89C 2OPTA 2HXIA 2JMWA 4NDLA 4XRMA 3BR5A 2B63J 1GVDA 5C44J 4M3EA 2ELKA 4DYRA 1XC5A 1JT6A 3C2BA 1NK3P 4JYKA 5C4JJ 5K7HA 1HOMA 1P7IA 1IC8A 2EQRA 1T56A 3B6CA 3W6VA 5F04A 4DZJA 1XS9A 1TC3C 1HLVA 5IP7J 5EDNA 5E3MA 2ME6A 1Q1VA 5IOZA 2I10A 4A3MJ 3HOUJ 4M3GA 3B6AA 5J1RA 3VPRA 4G12A 3FISA 1W0UA 4A3LJ 1JKRC 2R5YA 3JRIA 3ZQGA 1VF9A 1WCMJ 2L9RA 2FX0A 1MSEC 5FKMA 1T33A 4A3IJ 2JN6A 5FKNA 3E7LA 4B1RA 1ETYA 2DJNA 3DCFA 4X1EA 3D1NI 4FISA 1BA5A 5JLXA 3ZOBA 5EEAA 1JT0A 2XGDA 2Y2ZA 1SFOJ 3BG9A 5FKOA 1MBGA 4D7MA 3LSPA 2EZKA 1JKOC 1DU0A 2OF7A 3BG5A 5F1JA 1K83J 3G1MA 3WHBA 3OSGA 3BR2A 2Y0SN 5IYDJ 3HEFA 2ZB9A 5GP9A 3GTOJ 3O8GA 1D5YA 1GUUA 1ZK8A 2EH3A 2ID6A 2R7ZJ 1AU7A 1NK2P 5F0HA 1UMQA 1VNDA 1CQTA 1TWAJ 3HBLA 1JJ6C 1MH3A 5F0FA 2O9LA 5BNGA 5GPCA 1MBFA 3LNQA 2CJJA 3SDGA 4HNVA 4AYBN 1NTCA 1QRYA 4V2GA 3TW6A 2KT0A 1GV2A 3LSRA 2JJ7A 1IDYA 2L0KA 2M0CA 1WH5A 3SJMA 2XGEA 3JRAA 2LVSA 1HF0A 2HYJA 1MSFC 1IRZA 1U9NA 3GBGA 5FKKA 3TP0A 5EGOA 1GV5A 1O4XA 1MBHA 3HGYA 5F0CA 1POGA 3TEDA 3JRCA 4JX5A 5FKLA 3M3YJ 2CUFA 2O7OA 1IV6A 5J1UA 4XIDA 1MBEA 5IPAA 2XPVA 1PUFA 1OCPA 2CU7A 3G1OA 3S15J 2JA7J 1B8IB 2WV1A 5JLWA 3ZQCA 4JX6A 2DN0A 3LOCA 3BR1A 3O8HA 4UUTA 4MFEA 1JTXA 3S2HJ 3L1PA 4C3IJ 4DYCA 4A3EJ 3RZOJ 2FD5A 4IHVA 2YU9J 5EG0B 1ZQ3P 2LP0A 4CYCA 4B4CA 3JRFA 1ITYA 1MBJA 2K9QA 5EZHA 1X58A 1W0TA 1ETVA 1E3OC 3ZQLA 2AHQA 4UUSB 2R92J 2G0EA 3A01B 4JX4A 4MFDA 4A3FJ 4A3DJ 1P7JA 1RETA 2IBDA 1AKHA 3MVPA 1WPKA 2MG4A 2XPUA 3BTLA 4IEJA 3WHCA 5FLMJ 2MSYA 1F43A 1JKPC 2L7FP 1VFCA 3IH4A 4C2MJ 5K7FA 4I6ZA 3GTLJ 2NOGA 2FJ1A 3RKQA 2GBYA 2LD5A 4A3BJ 2W48A 3GTMJ 2E19A 1BJZA 1FEXA 3DEWA 5C3EJ 5J1YA 4RDUA 2H1KA 3H3VK 1Z0XA 4W97A 1U78A 2R93J 2Y31A 5GPAA 5M5XJ 1LE8B 2R5ZB 4A3CJ 4A3JJ 2L7ZA 5EYRA 3RZDJ 1FIAA 2VKEA 1B72A 2LKXA 5M5WJ 3UKGA 2R0QC 3S1NJ 2DTZA 1HDDC 4D5FA 1MNMC 1QPIA 1TWHJ 1RPWA 1I6HJ 3HDDA 2Y9ZA 1A5JA 3OIOA 5K7ZA 2FQ4A 1A6IA 2LFBA 2VUMJ 4DZPA 1RKWA 1RESA 1JUSA 1TWCJ 3ZQHA 2E2IJ 2L7MP 5E3LA 3CMYA 4Y52J 1Z77A 5EZGA 3M4OJ 3S2DJ 1B8IA 2HDDA 3HOZJ 3PO2J 1TWFJ 1QVTA 4FCYA 3A03A 2JWTA 1IG7A 2N8GA 1YRNB 1F36A 2HXOA 4XRSA 2QF7A 5IP9J 1OJLA 2DA7A 5IYCJ 5EG0A 2DA3A 2X48A 5E3OA 3GTKJ 4JP0A 4UUSA 2EZLA 5FLVA 1UHSA 2E1OA 4XICA 1ZR4A 2JA6J 1ZTRA 1ETKA 5HODA 2LK2A 4M6VA 1SANA 1XG1A 1BW5A 1IUFA 4D5CA 3JRHA 4C3JJ
chains in the Genus database with same CATH superfamily
2COMA 2E2JJ 4XRSG 1PVEA 2EZIA 2PN6A 1YJWI 1VZ0A 2X4HA 5LGUA 2ZBKA 3I59A 3IAS2 3L2UA 3I64A 3JR9A 2F4OB 1NG7A 5M3FJ 2YPRA 2V6EA 2VE8A 3B02A 1X1AA 3AAFA 3CQZJ 5FLXZ 3U1KA 2VJ5A 4LOCA 1T6SA 4I98B 3JCUC 4XLEA 3CCMI 2CFOA 2L3DA 2GAUA 4IRGA 3PL8A 3G73A 4W1UA 3WGIA 3I4NJ 2CUJA 1FOWA 2K4JA 3BTIA 3S14J 3CP8A 4E7IA 4BE1A 4BY1J 1HCRA 3HPGA 4XL9A 5B1AH 2LLKA 3DKYA 3CCRI 2VQHA 2F4IA 3NQOA 1K4TA 2TCTA 3H9JA 4UVBA 3ABLH 4ZYDA 2QGUA 1MKMA 1B4AA 1LEAA 3F21A 4KN7X 3RPUD 2LTPA 3KP6A 6PAXA 4LK0F 3KEOA 1G59A 2FBIA 4Q47A 2ZFWA 1O3QA 3HOXJ 1WJEA 2O8XA 3KPHA 5DM7F 4LB5A 1J09A 3WTSC 3BROA 1ODDA 1OPCA 2IAIA 2VBZA 2BE5F 3NEUA 1KU3A 3BLYA 2DA2A 4IXAA 2V9KA 2NS0A 3IWFA 5HS7A 4M74A 4PFOA 3CF5F 2K40A 2XRNA 3U21A 2CRGA 2HOAA 4RLQA 3PFIA 3S1RJ 1FSEA 2NVXJ 2DAOA 1YITI 5EF6A 1E3HA 2YS9A 1SFKA 2ISYA 1XGMA 2GLOA 3NWTA 2XB5A 4PJMA 4LIVA 3BCBA 1OLTA 2HOSA 5D5VB 1KU9A 4A0ZA 1MIJA 3D5SC 1ZGJA 5IOYA 4BXUA 5J3LA 1FC3A 3IL2A 3S1QJ 4P5OA 3MN2A 3LSTA 4IF4A 2QSFX 2P0WA 2R3SA 1ETWA 1OYWA 2A61A 2AQEA 5GADJ 3BQYA 5CQGA 2X6OA 4DIQA 1KONA 2VKVA 1Z6RA 3MKWB 4D7NA 2A5YB 2R7RA 4WF2A 4IHXA 2LF7A 2K27A 3DTKA 3RPUA 4OWRB 2ZKZA 2JRTA 4M72A 4BXXJ 3ECOA 5F08A 2HVQA 5DV5A 3RYPA 1IUYA 5J4YA 2NVYJ 1U3EM 2GA2A 2V1NA 2WV0A 4BKXA 3ERMA 3OR2C 1YW7A 3JAMZ 4Z2YA 2DMNA 4AUXA 1DP7P 5JFRA 4X6AJ 5LGNA 2ZJPF 3IWZA 1P6RA 5B3SH 5JVTA 4KFCA 3GTJJ 3DU5A 3QPSA 2XSDC 3CC4I 2AXTC 4DW6A 2ZCWA 2HQRA 2CQQA 4M3FA 3S17J 2VBXA 1DPUA 2VASA 4UY8I 1RR7A 1YJNI 2EBIA 3DFGA 2M1BA 3F22A 2QLZA 1BL0A 1A36A 2K4BA 4NB5A 4F93B 5L3EA 1R00A 5FB2A 1B72B 2P7CB 3GCMA 3DPTA 2K85A 1U2WA 3LL7A 2QSGX 3PM1A 3CJNA 1FTZA 4EGZA 1LE8A 2R5ZA 5E8IA 3GTGJ 3ABUA 5ILUA 3QPHA 3K1MA 1ENHA 1QA6A 1MJBA 1U9OA 5EEHA 2ID3A 4BNCA 1TQPA 4JOMA 3GFIA 2DMPA 4Q5SF 3FWEA 3TW7A 2FUG2 5LBQA 2X1EA 3HRMA 3ZGKA 1ZLKA 1DP3A 2L4AA 3IH3A 5HLIA 2QZ8A 3R6SA 2H6BA 4Y13A 3HB9A 3Q0UA 4ON0A 1RZ4A 5DTDA 1ZR2A 1Y6IA 3L2RA 2WY7Q 1DDNA 3CCEI 5J4VA 1R5HA 1YW9A 2LOOA 1RRJA 5IP6A 3EDPA 1OYYA 2E34A 3I5UA 2M8GX 4N4OB 2OCEA 4QPOA 1U6GA 4HPQA 3SEQA 1WSUA 2VT3A 1Y56A 2GZWA 4HZFA 1R36A 1JT6A 2LBFB 4XKBA 4EGYA 4ZYHA 3UNGC 2L54A 1RUNA 1HBXG 1USTA 1I39A 1QGPA 4XLCA 2DW4A 1BC7C 4DZJA 3CUQB 3PQJA 2KZGA 3W2WA 1LB2A 1DQUA 5EDNA 2OUMA 5E3MA 4HNUA 2LG4A 2CG4A 3HOUJ 4A0YA 4M3GA 4U0VA 3FHZA 3DBRB 3VPRA 1WQ2A 1PJRA 2EV0A 3JRIA 3ZQGA 1VF9A 1U5TC 1OCOH 2A5WA 4CUGA 1WCMJ 2L9RA 3S93A 4GGGA 2M4KA 5EJCA 2M7BA 4LITA 2FX0A 3K69A 4UV9A 4HSTA 3PIPF 1MSEC 4XLFA 1T33A 4LIUA 2JN6A 5FKNA 2IA1A 4B1RA 5A2QZ 2DJNA 3GF2A 1A35A 2EIJH 2NAZA 1VQ8I 2Z3YA 1ZH5A 4X1EA 3LSIA 2XROA 5JLXA 1YTYA 3HOSA 3A1YA 3ZOBA 2LY2A 2PBIA 2Y2ZA 3BG9A 5KNLA 2ZMEC 1LQ1A 1MBGA 3A4CA 2BGCA 1QBJA 5F1JA 1R6RA 2EK5A 4LG3A 4NC8A 1BJAA 5IYDJ 4HW0A 1K6OA 5GP9A 5KAIC 3GTOJ 1D5YA 4L9TA 4PJLA 4E70A 2VB6A 3F3XA 3TO9A 3VYUB 3JTGA 3SYTA 3CP2A 2CW7A 4NBQA 5CVJA 5TISC 5F0HA 3BJOA 5JHUA 2ZFUA 3GFLA 4CHUA 3E3VA 3HBLA 1IXRC 5F0FA 5B1BH 4CCJA 4ZDLA 3KEYA 2VLAA 3FXUA 4RA2A 1P4AA 4OIOF 2F5EA 3TQNA 1TNTA 4V2GA 4B44A 4YFXF 3IP4B 2R7TA 3OYIA 3DEUA 1IDYA 1WVRA 2FRHA 3PNVA 1J2XA 2IGKA 2LKPA 2XGEA 3FXOA 4J01A 3RSNA 1UAAA 1GVJA 2MA3A 4CZCA 3HZJA 2O3FA 1O7LA 3DQVC 3AG4H 1MSFC 4E4HA 2ZXJA 2ZNZA 4IOCF 3KX2A 3M8EA 5HLTA 2WWYA 4BEHB 2CQKA 3CCJI 3G4SI 3R0AA 1KQ0A 4K2EA 1MBHA 3QRFF 4FQGA 5DCMA 3TEDA 3C7JA 3I0TA 1XTAA 1JI8A 2R4GA 3N4MA 5LHHA 1OKRA 5IPAA 1XCVA 3ONQA 1IN5A 2P8TA 1XCBA 5KAFC 4S05A 5LFAA 5JLWA 2M45A 1OR7C 4XONA 3ZQCA 4A5MA 1S29A 4N9HA 1FBQA 4MFEA 1VQLI 4C3IJ 3OYAA 4AWXB 2PJPA 4EJVA 2YU9J 5EG0B 3JSOA 3V8JA 2LP0A 1L0OC 2HQNA 3QAHA 1QO0D 1OYIA 4XN0A 2IS4A 1X58A 3FXJA 4HA8A 3ZQLA 4UUSB 4IPAA 4HRIA 4EVIA 3A01B 4YIRX 4UVAA 5F6FA 4A3DJ 2UZKA 2VPLA 3KZIC 2FA5A 3WTXC 2FOKA 2FBKA 1WPKA 2QQ9A 3VWBA 3W6KB 2MSYA 1F43A 3L09A 1VFCA 5K7FA 2WADA 3OYLA 3GXOA 2JSPA 1LDJA 2E19A 1BJZA 2K7LA 1WRJA 1SAXA 1FEXA 2L7KA 3DEWA 3K9TA 2W25A 2Q8KA 5D4SA 4BDZA 5J47A 4LJZF 4ENKA 2KFDA 4W97A 1LEBA 4MQ9F 4B48A 1T0FC 4XOPA 3OIPA 2JPCA 4PZJA 1YJ9I 4P96A 4A3CJ 2LSOA 3PSIA 3KE2A 3F8FA 5EYRA 3ZMUA 1OISA 2CGPA 4Q4ZF 4RAYA 4HSRA 2ZC2A 5L3CA 1B72A 4RGRA 3OYDA 5M5WJ 3WG7H 4IHSA 1ZAOA 2A6HF 4HLXA 5KVRA 2ZNYA 1BIBA 1D1CA 1H0MA 2EINH 2JTVA 1I6HJ 2W1OA 3MKZA 1XMAA 1A5JA 4GO1A 1B1BA 1P9QC 2E5ZA 3QYFA 2FQ4A 2WB1A 2LFBA 3IKVA 4IL6C 5K7ZA 1Y39A 2CMPA 1ZRCA 2BYVE 3ZQHA 3ROUA 2QUFA 3F8NA 1Z77A 5EZGA 2OTJI 4M9ZA 4OMYA 1IN6A 4AVPA 3H9QA 1B8IA 2AXLA 1N77A 2KPMA 4LFUA 2RKHA 5GAGJ 1VQ9I 1QVTA 4FX0A 2DU9A 4MTEA 1IG7A 4C9YA 1OQYA 1F36A 3H36A 4ZYAA 4CCMA 4IX7A 1YHQI 2HS5A 3R61A 4ZYEA 1OJLA 2DA7A 2DA3A 4A2UA 3VDXA 1O3SA 1FNNA 3IRRA 2EILH 1E0EA 2W84A 4PCQA 5FLVA 1UHSA 2E1OA 3MD2A 1ZR4A 3IRQA 3HL2A 5HLGA 3I71A 3CUQA 2EIKH 4J00A 2QYOA 2XRLA 4S04A 3ERED 1X2NA 4MO7A 2HPIA 2OA4A 1MGTA 3J81K 1G3TA 1WFXA 3J80K 3PJRA 1LDKB 1FTTA 4IHYA 2Y69H 3JTHA 3BT9A 1TW3A 4DQ2A 3NAUA 3LMMA 5ICFA 2XAQA 2A6EF 2BZTA 4C2TA 2IP2A 3CCVI 5D6FA 1JKQC 3TO7A 3F6OA 1QZYA 4FHTA 3L2WA 3MZ8A 1H9TA 2CV1A 4CSWA 1LFUP 2VOOA 2RVCA 3Q0VA 3GLLA 4U0YA 3GTQJ 2DXIA 1KQ8A 1FPQA 3HKZA 1BI3A 1P92A 1FY7A 4BE2A 3EUKL 2E2HJ 4XSZF 1XD7A 5K5RA 3BG3A 2XAUA 1T08B 3EQLF 5H6RA 2LF8A 5FO5A 1R9TJ 3HM5A 1MD0A 4IRHA 2Z16A 2VIXA 3HJEA 2KISA 3F8BA 3I58A 3FXMA 4CICA 1WHUA 2GIZA 4ZYGA 1FX7A 2HFHA 2K9LA 2F5DA 3QOEA 1MW7A 3MMYB 4NC6A 4AVZA 2O6GE 1VI0A 2XF7A 3CUOA 2QCOA 2XDVA 4HOBA 1W36C 5CVRA 1O7FA 3K7AJ 1S7OA 1YRNA 2E5NA 1UJ8A 5EEGA 3QP6A 2VI6A 5KCMA 1IGNA 1UG2A 1I27A 2XB0X 3C2GA 3H35A 2HNHA 3E6DA 2K9SA 2Q2EB 2Q0OA 2GOMA 3H5NA 3GYHX 1K78B 1UHMA 3ZCOA 2KIUA 3IV5A 2OV7A 2H8RA 3AKZA 1FSHA 1JUMA 4G94A 1Q1HA 1ZKGA 4OMZA 1QNTA 1QU3A 4M3BA 2X1CA 4DBQA 3ZXSA 2ESHA 4X0GA 1PUFB 4BEHA 5BMZA 1HXDA 1C0WA 1SFXA 3OYBA 2VPRA 5ICGA 5K5OA 1IW7F 4U7BA 2XGCA 2FMLA 1OCTC 3GTPJ 4E7JA 3OSFA 2RNJA 5DS9A 4ENJA 3I4MJ 2LR8A 1KGSA 2OJED 4ETSA 2L02A 3JREA 3V8LA 3S16J 2R7XA 2ZSHB 3ZR8X 3KZZA 2QKLB 5F27A 3MWMA 2IT0A 4L5IA 1IRGA 2YX7A 1YIJI 3LSGA 4BQNA 3HTSB 4WWCA 4IQJA 2E1MC 5HDGA 5LHGA 1B9MA 4PDKA 1AKHB 1IAWA 2QQ8A 3NARA 1IJWC 3CMAI 2MH9A 1IDZA 3JSPA 3MKLA 3Q9SA 3BZCA 4ZTJA 2D5VA 3A01A 3F8CA 4A69C 1R22A 2C6YA 2WTEA 3ZQFA 3AL0C 3Q9VA 4HYEA 1A6QA 3HOWJ 2DA1A 2PMHA 3K10A 4B3AA 1JUPA 1Z9CA 1N78A 1GXQA 3DKXA 5IT3A 3D5RC 3WTYC 1EF4A 2WAQN 1GDTA 3LSJA 4BJ5C 1XGSA 5DUKA 3SZTA 1D8KA 3CCYA 4G6DA 1WJBA 2FE3A 1O57A 3S32A 4DBRA 4Q48A 1FJLA 2OD5A 2QBYB 1V5EA 1F4KA 4PJJA 4IKFA 3JRDA 1EH8A 4XRFA 3BR0A 4OIRF 3F8MA 4IHTA 1G3SA 2MC3A 3TP3A 4L5EA 1T39A 3TKYA 1WWXA 2EA2A 1MBKA 2EWNA 4A3GJ 1S7AA 1MH4A 2LMDA 2VT2A 2Y30A 2JA5J 2DFHA 4LD5A 1Y1VJ 3NWSA 4I09A 1VQNI 3T0YA 2BW3B 2EZHA 3BWGA 3ECHA 3SHFA 3I3LA 4KISA 2P5LC 1S5LC 5D8LB 1S7EA 1U8BA 1FYLA 1FBUA 2KJCA 4BACA 4EATA 3R0JA 2DPDA 1ZELA 2HQ5A 3M8FA 1B59A 1LJ9A 2MD0A 1Y0UA 2KL4A 4OAYA 1VTNC 3OMYA 2QA4I 1AOYA 2OPTA 2HXIA 4RGUA 1V5FA 2G7HA 4HEA2 2OZ6A 2B0LA 4OOIA 2XGXA 3PFYA 1EA3A 2XAFA 3CLQA 1ZYRF 5E1WA 2ELKA 1FLIA 3QP5A 4IO9F 1ZG3A 3DU6A 2WA0A 1NK3P 2PI0A 3F23A 3RI4A 1KU2A 5K7HA 2JUGA 1N25A 3K4MA 3OYHA 4Y4RA 1VQMI 2OTLI 1W4MA 3E0JB 1IC8A 1ACIA 1IV8A 1YYVA 4LLLA 1T56A 5CVVA 1FBSA 2UXXA 3CCSI 1XS9A 5IT9K 2PMUA 3OOPA 4Y15A 5IP7J 3OL4A 2DK8A 2IS6A 4I02A 1Q1VA 5IOZA 1QZZA 2I10A 1HSJA 3CLOA 5FFZA 5LEJA 2YR2A 1J75A 2JZYA 5DCMB 4WCGA 4G12A 4ZJZA 3PQKA 3IUOA 1YX5A 1JXSA 4C2UA 4RB2C 3ZMVA 2GXBA 1XSXA 3ABMH 2E7XA 1Z3YA 2P5KA 3M8JA 5LEKA 3DCFA 1HKQA 3KCCA 2WAFA 2XGDA 4YEJA 4H4KC 2W4SA 5AONA 2NNYA 5FROA 1PP8F 2Z99A 2OF7A 4RM2A 1ZN2A 1T38A 2DT5A 2FQ3A 2EV5A 1VQ4I 4RAFA 2Y0SN 3LAJA 2GWRA 3HEFA 3L9FA 3W2AA 1ON2A 2IPQX 4LK1F 1ZK8A 2IGMA 2GXGA 2BVLA 4XN3A 2R7ZJ 2OC6A 3I55I 3QPTA 1NK2P 1LUJB 4CZZA 5CVIA 3RKWA 4FT8A 1VNDA 5J8CA 2DT6A 1W7PD 3DPLC 3OR1C 3OYEA 4I99C 2F5VA 2YX4A 3RIRA 2M3AA 1J59A 4M6YA 1MBFA 4U87A 3LNQA 1MMGA 5GTIC 3LFKA 3OYKA 5H2FC 4AYBN 1J9IA 2JVHA 2VQLA 1NTCA 1G3WA 1QRYA 3TW6A 4FASD 4V19K 4U0WA 1KA8A 3G6EI 2KT0A 4O5VA 4KIBA 1Z6TA 2OAZA 3F6VA 1AWCA 2XSJC 3G3ZA 3TO6A 4A6DA 3FXKA 3DWLE 3SJMA 3DTEA 2EPFA 2LVSA 3KYLA 4PUSA 2HYJA 3CC2I 1IN8A 1IRZA 2Z5UA 1D1BA 3GBGA 3SDBA 2FMYA 4UNOA 3O3KA 1GV5A 2Q2EA 3P9CA 1K78A 3TL4X 4IRIA 2VJ4A 2CUFA 1FP2A 1G3YA 4XIDA 3OYGA 2KIQA 1PUFA 4C30A 2CW8A 1X1PA 3S15J 2JA7J 1B8IB 1FT9A 4JQFA 1HW2A 2WV1A 1YI2I 2DN0A 2BXYA 3O8HA 1SC7A 4CDGA 4EJOA 3L1PA 1CGPA 4DYCA 4A3EJ 3RZOJ 2DFEA 2ELHA 2FD5A 4IHVA 1IZ1A 4XLHA 1K79A 5E1ZB 3LFUA 4RB1A 1NG6A 5EZHA 1W0TA 1TP4A 1ETVA 2E60A 2HZDA 2HR3A 2A3SA 4OAZA 2BVMA 2GOXB 4MFDA 2FNPA 2CV0A 1P7JA 5H6QA 2H8WA 1DGWY 3KYDB 2IBDA 1AKHA 3MVPA 2XPUA 3WHCA 4GRIA 5FLMJ 3BZ6A 4MHGA 1JKPC 1D1AA 1ZLJA 4HV6A 3IH4A 2XF5A 3KLOA 2P6SA 1T8IA 3AG3H 2NOGA 4I0BA 1XSVA 1ONVA 3V4GA 3KP4A 2P6TA 2OU2A 3ZN0A 4FETA 3GTMJ 2BV6A 1W5TA 5AIPA 3R60A 3SQNA 4RDUA 3K1NA 5HS9A 3H3VK 1B6AA 4BUPA 4YFKF 2ESNA 2XC7A 4Y17A 1U78A 2R93J 2Y48A 2Y31A 3FXLA 3ZPLA 1FP1D 5E20A 1FYMA 2LYCA 1VQ5I 4MNUA 3VOEA 2F5CA 2GA1A 3HIFA 5ED4A 2QBYA 4G8XA 3BY6A 3SXYA 3TDUC 2LKXA 4NC7A 2NNNA 2I8DA 4A0XA 2R0QC 3S1NJ 2DTZA 5GAEJ 5HDNA 5LHIA 3DP7A 1YS7A 5GTHC 4BQAA 5D6EA 4NNJA 3H3UA 2XF6A 1A6IA 2K9MA 2KRHA 2R7QA 4KITB 2V7FA 2VE9A 4M71A 3S2WA 3SFZA 2V1UA 2B9SA 1JUSA 1TWCJ 2VJJA 2E2IJ 2HOEA 2L7MP 5J40A 3CMYA 3K4KA 4HV5A 2BW3A 3C1DA 1ZRFA 1D0XA 1WJCA 5BS6A 1SFEA 3T1BA 2HZTA 1SD5A 3M07A 4RGSA 3HOZJ 3PO2J 2DOFA 4EMSA 3IAM2 5CQEA 3WTZA 5IT9Z 1TWFJ 4FCYA 1YRNB 2O03A 1Z7LA 2LNBA 4F52A 1A31A 4XKCA 3CJRB 4D9JA 2L9VA 2LDUA 2V4JC 3O2PE 4N9IA 5BOXA 2MYSA 2JRMA 5E3OA 2EZLA 3DEEA 1QPMA 3CTAA 1XSDA 2KJBA 4FX4A 1RUOA 2XUBA 1FOXA 4R8HA 1ZTRA 1K4SA 1Y8RB 2LK2A 4F55A 2FOWA 1E3PA 5DD8A 3PNYA 1SANA 2VBWA 1XG1A 2VN2A 1IUFA 3FXRA 4PSXA 3BC8A 4C3JJ 2OQGA 3FZVA 4RLFA 3RJPA 3KLNA 1IRXA 2NS7A 2DQLA 2NXNB 2ELJA 1OFCX 3HGGA 4LMYA 3E6BA 4G7OF 1XMKA 3KP3A 2M34A 1RKTA 1BR2A 1U0JA 3FIWA 2HPMA 2BBYA 3K2AA 2H6CA 3BG6A 2CUEA 4CO8A 1Y1WJ 3GW2A 3H5AA 5CYVA 4UXNA 2XAJA 2LH9A 4F91B 4WK8F 3K70C 1MDMB 1W1WE 2AQFA 4KMFA 4N0BA 4QSHA 2QQAA 3CCQI 3H5RA 1USSA 2DMTA 2E36A 4XLAA 4FTHA 1I1GA 3HUGB 3SEZA 4BBSJ 3HSEA 5ICCA 2O5RA 5M3MJ 3GFJA 1R4MB 2MGQA 4XK4A 2XASA 1P4XA 3M1EA 3Q0WA 4QIWN 4PJ0C 1ZARA 2RQQA 3HG9A 5D4RA 2FNAA 3LA3A 4HX8A 4L9VA 3H1CA 4KIGA 1JGSA 1G4DA 1CF7B 3L7WA 3GFMA 2A69F 3HXLA 2ME0A 2YSRA 1HKSA 2V79A 1FYKA 5ILSA 4S0HB 3KZYA 1P2FA 3FX3A 5F64A 3OS2A 1IN7A 1FMVA 5K5QA 3OS1A 1SVMA 3V7SA 1WH7A 4RBOA 3HOYJ 2Z2SB 5E79C 3BQZA 1GT0C 4AIDA 5BPDA 4XNFA 1APLC 3ZN1A 4DYQA 3HOVJ 4M9XA 3ZMTA 3CUQC 2W7NA 4LG0B 1J5YA 1SMYF 3EETA 2O8KA 2ECCA 5D5WB 5ILVA 3DPUA 4QPQA 4HF2A 4YELA 3L2QA 1EH6A 2DA5A 4GXOA 4HAMA 1IXSB 3FKJA 4DJAA 3PSFA 4KICA 2CYYA 1TW2A 3KETA 3KP7A 4B43A 2DCEA 2I5UA 1GLNA 3OY9A 4XORA 1TWGJ 2Q1ZB 3PUBA 3ZMSA 3SZGA 1FMWA 5DCFA 2IRFG 3VB2A 2QSHX 4BY7J 3W6JB 4RAZA 1LFPA 1KYZA 5H20A 4ZDPA 5DUIA 2O61A 3DV8A 4AC0A 2UUZA 3ZRGA 4CYCB 3I56I 4HX7A 3BPVA 4ZTFA 2DMQA 2Y75A 3WODF 1HA8A 4GFBA 4NQWA 4AD9A 1K61A 2X9DA 1X19A 1F9NA 3WTTC 1Z1DA 2IVMA 3FF5A 1MMSA 2JK3A 2P81A 1DPRA 2RAEA 5D5XB 3WU2C 2X0LA 2W85A 4AIHA 2OQRA 4ESBA 4HDVA 2EIMH 1Z67A 3PO3J 1DU6A 3I54A 3D0SA 4BBRJ 2RNGA 4IVNA 2WAEA 2VQGA 3K4NA 4HDUA 3OS0A 3N05A 3OOUA 3OYJA 4XMYA 4C3HJ 2QM3A 3ZQQA 1JTYA 3GWZA 3DXJF 3Q3SA 1F1ZA 4UB6C 2CO5A 1JGGA 4YIFA 2E71A 5IYBJ 2XPWA 2DA6A 3ABKH 2HGCA 1F5TA 1ZHFA 2YUSA 4NUBA 3DLAA 2IEKA 1X2MA 2NYXA 2DA4A 4E6KG 1X4PA 2NOJB 5HNHA 2FXAA 1QZEA 2RGVA 2LKSA 1I1SA 2PMZA 1E17A 4BU2A 2P4WA 4XKVA 3RCOA 1VQPI 5L3GA 3H92A 4IJAA 3V7RA 2A07F 1XMXA 4MQVA 1YS6A 1VQ6I 2M5WA 2QENA 3KYCB 1SFUA 3GMEA 1SEUA 4CCLA 1D0ZA 3OYFA 1X1BA 3DTIA 3ASNH 3TOBA 2Z33A 2KP6A 3MAJA 4HG2A 1B9NA 4PK4A 5FFXA 2KDZA 1O3TA 3HSFA 4BAYA 4I01A 4BH9A 2G9WA 4BXFA 1ZGWA 2V1DA 2Y9YA 4WX9A 1AA7A 1ZGAA 2KKOA 1H89C 2KDOA 2JMWA 1E2XA 3H3ZA 4BDYA 4NDLA 4XRMA 3V42A 3CESA 1GVDA 1YO5C 3OV8A 2Z1DA 1HC8A 5LGTA 4G7HF 3VEPA 2VKHA 3C2BA 1PUEE 2QQBA 2UWMA 3CMEI 1UB9A 4E7ZA 1HOMA 1P7IA 3U2RA 3JW4A 1R5ID 3B6CA 2CW0F 3W6VA 2HTSA 5F04A 1EJ9A 1HLVA 3EUHA 2UXNA 5E1XA 1WKMA 1I5ZA 4MEYF 2ME6A 1PDNC 2L01A 3FBIB 1LKXA 1WJAA 4D1QA 3B6AA 1BR4A 5J1RA 1N75A 3FISA 4A5NA 1TL8A 4A3LJ 1JKRC 4RMNA 2R5YA 5TRDA 1W36D 3P9KA 4O6JA 3JAMK 2VC0A 3DBLB 4I2OA 1Z91A 3ABTA 2HYFA 5FKMA 1RIOH 3CF2A 4LB6B 4LLGF 4GYIA 1SMTA 1BI0A 3E7LA 4YIIA 2PEXA 1ETYA 4M73A 2ICWG 3A0BC 3D1NI 2H09A 4L0ZB 1BA5A 2JT1A 4WXCA 1W7PB 1R7JA 2L9SA 3E5QA 5EEAA 1STZA 2DI3A 1JT0A 3VSKA 2CS3A 5B5EC 2EZKA 3LSPA 2VONA 1JKOC 3BG5A 2X6YA 2R7FA 3OSGA 4UUVA 1K7AA 3BR2A 1D0YA 1HQCA 4M6XA 1MDMA 1FZPB 4BE0A 3Q5FA 2VL8A 3ISPA 1X4OA 1WJ5A 3S3OA 4XSXF 1IN4A 1AU7A 3OWTA 3HUGA 3R4KA 2J5OA 5E8GA 1V3FA 3L2CA 4ENNA 2OZUA 1UMQA 4GYGA 2P5VA 1CQTA 3I9V2 1JJ6C 1R5GA 4CCOA 4EJWA 2O9LA 2V26A 1TLHB 1HW1A 5GPCA 3VYTB 2CJJA 4II3A 1LVAA 4G9YA 4HNVA 2K3FA 4B47A 2ZXIA 3DLLF 4H0EA 1CF7A 4CH7A 3P9IA 3REOA 2DO7A 4KT5C 1UFMA 3BOQA 1EKEA 4UVCA 3QODA 2X6XA 4MTDA 3P5JA 5JHFA 2CQNA 3JRAA 4ZZLA 1HKTA 3BPXA 4F92B 4CCKA 1LPQA 1HF0A 1V55H 2XHKA 2HU9A 1UZCA 3LAPA 4ZDOA 4LG0A 3K4JA 1YQAA 3S8PA 1VQ7I 4BS9A 3TP0A 3OYNA 3BCAA 2KIMA 2D45A 1O3RA 1MJ9A 3HGYA 5F0CA 4EM1A 1POGA 5FKLA 2O7OA 4BQQA 2X85A 5J1UA 2KIFA 4KYWA 1Y8QB 1R4NB 3VYSB 3LOCA 1WJDA 4UUTA 1BR1A 1JTXA 2JPBA 3K0LA 3WTVC 1JE8A 3S2HJ 4BHBA 4CCNA 1JHFA 1DGRM 4EJTA 3LQRA 1IO2A 2WBMA 5DEQA 1ZQ3P 4CYCA 3BJAA 4I7HA 3JRFA 2LREA 1ITYA 2K9QA 2K86A 1MMDA 3WU1B 2YU3A 4OINF 2X6WA 5A2QK 3BP8A 2R92J 2G0EA 3CD6I 2EFPA 4JX4A 3QOPA 4A3FJ 1W5SA 1XGOA 4DGWB 1RETA 2DQRA 1MMAA 2MG4A 1Z3XA 2MLKA 3BTLA 3J80Z 4IEJA 3J81Z 3HPHA 3G71I 1UCRA 2L7FP 1XDUA 1QHGA 4C2MJ 4I6ZA 2K02A 1SD4A 2DBBA 3GTLJ 3PNTA 2FJ1A 2IXSA 4Z6YA 2D1HA 1T2KA 2IJLA 4L0YB 4A3BJ 2W48A 2KHMA 1ERDA 1X3ZB 1TQMA 2KQRA 2RREA 1MMNA 5TGTA 5JI6A 4IZZA 5J1YA 3S3MA 2D1VA 2QWWA 1U5TB 2MH2A 4PJNA 1TTYA 1TQIA 2HVSA 5M5XJ 3D5LA 2QVOA 3CC7I 2PJRA 2MD5A 2A05A 1Y0NA 4RB3C 2L7ZA 5JR3A 2R7UA 4I0AA 1BI2A 3WE3A 3I4PA 3L00A 1I3AA 5FD6A 2LC2A 4AU7A 2ACJA 2L2OA 2STWA 1BM9A 1X1DA 1HDDC 4D5FA 1MNMC 2ZMEB 1QPIA 1A04A 3HTUA 4UB8C 3FBNB 4EM0B 4XBFA 2XIGA 4KN4X 1JHHA 3GZNB 3LSHA 3OIOA 4Y3OA 1S72I 2BXZA 2GXAA 4MGRA 4DZPA 4JK1X 2JQ7A 2MBFA 2DPUA 1ULYA 5E3LA 4Y52J 3K1PA 5J6XA 1SAUA 3M4OJ 3S2DJ 3VODA 3FM3A 4ESFA 3A03A 2JWTA 5L3FA 4BJTA 2IGNA 3G2BA 2OBPA 1OCCH 4E7HA 5LD2C 5HOOA 4AM3A 4HQEA 1S3JA 3GO5A 3WTUC 2FU4A 1IRFA 3W2VA 4A6EA 2M7AA 4BYYA 1SVOA 3ZMZA 4XKWA 1FOKA 4JP0A 1P4WA 2J5PA 4KNYA 2VC1A 5TJJA 3T5XA 1YG2A 2L5QA 3GX4X 3T8TA 1EV7A 4M6VA 1TT5B 2QEXI 1BW5A 1R1VA 3QWLA 3IKTA 4F7ZA 2K3PA 4ASNA 5HS8A 4OIQF 4D5CA 3JRHA 3L2VA 2DDBA 1BIAA 2EFNA 1YIOA 2H94A 2GIVA 1LNWA 3U9GA 3K4BA 3J7ZI 5DYMA 4M3DA 2LY9A 2WB1N 2TRTA 1SD6A 4D0PA 3JRGA 3OIQA 3NRVA 4GCVA 4KUMA 4N4NB 5CKTA 1DUXC 1YOVB 2F2EA 3FK6A 5D8KB 3KEQA 1BOBA 1ETOA 3F9KA 3KP5A 4YRVA 4NQWB 3FKIJ 2O0YA 4HLYA 1R23A 4EV0A 1AHDP 2V9PA 2ZSIB 3HSRA 1XN7A 3VSLA 4ABZA 1U8RA 2BY2A 4BQOA 1W7PA 2F6CA 4XOTA 5K1YA 3OYMA 3CJQB 3HC7A 4HF1A 3H0GJ 1XX5A 3CDLA 3K4LA 4RS8A 2IGOA 5LLQA 3QYBA 3BTCA 3ML6A 4YG2F 3C18A 1SD7A 4L5JA 2HVRA 1FIPA 4A93J 3IH2A 4A12A 1QQIA 3BR6A 3HOTA 1R49A 2HDWA 5E3NA 4ESJA 3F0CA 2AO9A 2GM4A 2VXZA 3BTJA 1BBYA 3HRSA 1BW6A 1LFBA 2E35A 1I50J 4HBLA 2G7UA 2ECBA 2ZO4A 3I53A 2GQQA 5BQTA 1R71A 4BJ6C 3LA7A 4WXHA 5FGMA 1K6YA 4DOZA 2EV6A 1R1UA 3BZKA 2BEOA 2CH0A 4BGDA 2VQCA 1WZ2A 4B09A 1ETXA 2PMZN 1WI9A 1S9HA 2R7DA 5L3DA 5EGOB 4XM3A 3GEZA 1H88C 4EM2A 3RQIA 1G8XA 2EB7A 1PP7U 1S6LA 2HQAA 2K9NA 1ZRDA 2NRAC 1X3UA 2A6TA 3AFHA 5DM6F 1UG0A 2F48A 3DKWA 3TGNA 3QU3A 2DYSH 2WAQA 4YFNF 1X1CA 2D2WA 4IHWA 4E7SA 1ZG1A 3ESWB 3QQAA 2JA8J 1G2HA 1HDPA 2DLLA 3A02A 3HKZN 3SFIA 1UELB 1WI3A 2ADUA 3E5UA 4MLOA 2IS1A 3CMMA 2CQ7A 3C3WA 3TOAA 4QTRA 1JJ8C 3DBHB 2M2EA 2RV8A 5J8FA 2COBA 3CDHA 4FE4A 1UHWA 4PGGA 2CUZA 5ERIA 2HWVA 3BG7A 3LWFA 2EA4A 2V6CA 1KQ9A 2M9HA 3E6MA 3V8KA 2STTA 4II2A 3WU0A 3QPLA 3HRTA 1LDDA 2KRCA 3KFWX 5FJ8J 2PFBA 4BHCA 5ICEA 4LGWA 3CCUI 1TNSA 3M1CA 4PGHA 3S1MJ 4XLNF 2NVTJ 1FWZA 3ZQIA 4Y7NJ 4ENMA 2MW8A 5M5YJ 3A2KA 1ORKA 5DDGA 4AIKA 2VOPA 3K4CA 4IOAF 2BHZA 4NHJA 2CQXA 4IQ4A 3JRBA 2HEOA 2R7WA 2DMUA 2KRFA 4CXFA 3IHUA 5B66C 2R5YB 2HKXA 4RAGA 2NVQJ 1ETQA 4M9SA 1GHCA 2XAGA 2FEZA 3HRUA 4I76A 2FSWA 4KT6A 5HDKA 2V9VA 2PQ8A 3G1LA 3BR3A 1MNEA 2DOEA 3TDZC 4J19A 3WE2A 3J7AO 4RB0A 9ANTA 5C4XJ 2RQPA 2XVCA 2ZJ2A 3EPZA 3VYRB 1REPC 2X1DA 2DFIA 1U5TA 1BOAA 2R7OA 1BC8C 3WGGA 2HKOA 2JVGA 2MC4A 3J7AY 2HI3A 2PX9A 3FK7A 3ZQ7A 2BY0A 4U88A 3RPQA 1H8AC 4A3KJ 3FMSA 5E17F 2ZJRF 2NS8A 2DYRH 2XKOA 3CJTB 4V2FA 2UV1A 3LA2A 3EUAA 1WGXA 2R7SA 2L9NA 2VODA 2ZMEA 1PYVA 4EEFG 1BN5A 2MABA 5D5UB 1I3QJ 2DJIA 2HTJA 3S3NA 1QVUA 2IA0A 3CO6C 1YFHA 3E97A 3KIOA 1V54H 1ZREA 2CV2A 3ELKA 2HOTA 2BY3A 4JBAA 2BY1A 4CA0A 4MIMA 3MKYB 4L9NA 2E1NA 3MFKA 4FE7A 1MZBA 3EYIA 3HYIA 4Y33A 2RN7A 3K70D 3ZP5A 3BR5A 2B63J 5C44J 2CWEA 4M3EA 2Y0SA 4DYRA 4E7KA 1RI7A 1XC5A 2XAHA 2LRDA 1RC9A 4JYKA 2DOAA 5KHDA 4G6TB 5C4JJ 2W57A 2LY1A 4ZC3A 2EQRA 2XV4S 1IXCA 2RC4A 5FRNA 1TC3C 4A3MJ 5F1RA 1YLFA 1QHHD 2PLYA 1W0UA 4AYBA 3I59B 2VJIA 1WJFA 5AIQA 1D5VA 3F72A 4F3QA 2ZJQF 3GUDA 1R58A 3CZ6A 1L3LA 4A3IJ 3ASOH 4ANJA 3K6GA 1KYWA 4ITVA 2FF4A 4FISA 4GDFA 1RR8C 4CYDA 2F4MB 2IW5A 1SFOJ 1T95A 5FKOA 2OCCH 2ZXWH 1LVKA 3GLXA 1J7KA 1MNDA 4D7MA 3CCLI 1DU0A 3RDIA 2FBHA 5HNFA 1K83J 1OR7A 3G1MA 2DK5A 3WHBA 1KU7A 2A68F 4TV7A 1MJAA 5LRSA 3QYEA 3PUFA 2ZB9A 3O8GA 1GUUA 2E1MB 2WC2A 5HVQC 1H9GA 5FD5A 2JSCA 2EH3A 2ID6A 1V5GA 3CO7C 4P9UA 5FLXK 1D8JA 4UHTA 1YE9A 3W3CA 4EQQA 2EFWA 5L3BA 2VKDA 1YX3A 1G6NA 1TWAJ 3RQ4A 2W82A 1MH3A 4BHPA 3OYCA 2TDXA 1XDSA 1M1EB 1S8NA 1ON1A 2HYGD 5BNGA 4QLCU 2H27A 2HDCA 5BPIA 3AL0B 3COAC 2EFOA 2CFXA 3SDGA 3MZHA 1NHAA 4OU0A 4O3MA 2M8EA 4HX4A 4KMUX 4DNCA 2IA2A 5HLHA 1XGNA 3EUHC 2PJRB 1GV2A 3LSRA 2EFQA 2JA2A 2JJ7A 3ULQB 2RDPA 2KLOA 2L0KA 2VXDA 1FOYA 2M0CA 4RM3A 1WH5A 2LBFA 3O6BB 5CPRB 1YW8A 2V1XA 4KIFA 3SZPA 2E7WA 4ZH4F 3K2ZA 3WGHA 1TBXA 5LRRA 5KK1A 1T0FA 4XQFA 2ETHA 2W24A 1U9NA 4HNTA 5FKKA 1R1TA 5EGOA 4P55A 1O4XA 5FRMA 4PSWA 4XLPF 3DF8A 1ZG5A 1EH7A 4HQMA 3J7YJ 2DTRA 3FMRA 3LSKA 4JX5A 3JRCA 3M3YJ 4BL0B 1IV6A 1MBEA 2XPVA 2L4MA 1OCPA 2CU7A 3G1OA 4G7ZF 3EYYA 1OCZH 4KDPA 4JX6A 1Z21A 4CGZA 3BR1A 1XB4A 2M4GA 3OL3A 5E18F 1OCRH 3B73A 4AIJA 3X2QH 2ZXHA 1IF1A 1HW5A 4OIPF 3IC7A 4B4CA 2WY8Q 4P1WA 2E1CA 3CDIA 3MZYA 1MBJA 1E3OC 2AHQA 3AG1H 3LSMA 3E1SA 4EJUA 2BHYA 5DD4A 3RKXA 2DFFA 4KA4A 4G6QA 3MEXA 1XPXA 2IS2A 2DT7B 3GZ5A 3UR3C 4L18B 3M9AA 3WTWC 4QWQA 2F5FA 1T98A 3PIOF 3RKQA 2GBYA 3N97A 2LD5A 4R1HA 3WG9A 3H0DA 3RTRA 5C3EJ 3FMQA 2ISZA 2H1KA 1J0RA 4PFPA 2DODA 3P7NA 2Y0MA 1TZLA 1Z0XA 3GVAA 3TMOA 4P9FA 2H1LA 2KZVA 2Z9OA 1Z7UA 5GPAA 1LE8B 2R5ZB 4B3XA 3GZ6A 1I6XA 1HSTA 3V7CA 3E6CC 3QU6A 4A3JJ 1OMIA 2JUCA 3BDDA 4KJZA 3RZDJ 1FIAA 1X3WB 2VKEA 3KP2A 2M0MA 2BOLA 3BJ6A 4RGXA 3RYRA 1KZHA 3UKGA 1W5CC 1RNLA 2R7VA 3LQQA 1TT0A 1TWHJ 1RPWA 2B7EA 1VQKI 2XKPA 1D3YA 1V4RA 3HDDA 3FXQA 2EJRA 1Z05A 5CLSA 2Y9ZA 5CJ9A 3H9GA 2VUMJ 3C2HA 5IY5H 3MCZA 2DDAA 3MQ0A 1RKWA 1RESA 4L9JA 3ZMDA 3AG2H 5CVUA 2M87A 2MLGA 1SVLA 3U1DA 3M7GA 2KMUA 2K5CA 2HDDA 4LLNA 3A0HC 2CSOA 1NH3A 2MFZA 4HF0A 3TBIA 2QKMB 3T8RA 3VFZA 2N8GA 4B8XA 3FDYA 2HXOA 2PG4A 4XRSA 2QF7A 5IP9J 2VBYA 5IYCJ 5EG0A 1GXPA 2X51A 4MEXF 1BI1A 2X48A 4XR6A 1VQOI 3HHHA 4U7DA 3GTKJ 4UUSA 5JVGF 3FM5A 3RKYA 4XICA 2JA6J 4E7LA 2M30A 3HHGA 1ETKA 4UV8A 5HODA 4R79A 5GAHJ 4ZZDA 2AS5F 3FHNA 2W00A 2NVUB 4WXDA 3E5XA 2P7VB
chains in the Genus database with same CATH topology
2XRLA 2E2JJ 4XRSG 1X2NA 2EZIA 4MO7A 1FTTA 2NS7A 1OFCX 4M3DA 2LY9A 2WB1N 2TRTA 3HGGA 3JRGA 4IHYA 2M34A 3BT9A 1RKTA 3NAUA 3FIWA 3FK6A 3JR9A 1ETOA 3K2AA 5M3FJ 2CUEA 1JKQC 1Y1WJ 3FKIJ 3CQZJ 1LFUP 4LOCA 1AHDP 3Q0VA 4ABZA 3GTQJ 4QSHA 2DMTA 4W1UA 4FTHA 3I4NJ 3BTIA 3H0GJ 3S14J 3CDLA 2E2HJ 4BBSJ 3BG3A 4BY1J 5M3MJ 1HCRA 3BTCA 2MGQA 4XK4A 1R9TJ 1FIPA 2LLKA 3HM5A 4A93J 3Q0WA 4QIWN 3IH2A 3BR6A 2TCTA 5E3NA 3F0CA 2AO9A 2GM4A 3BTJA 2LTPA 2ME0A 1BW6A 1LFBA 1VI0A 4S0HB 1I50J 2ECBA 2QCOA 3HOXJ 1WH7A 4RBOA 3HOYJ 3K7AJ 1YRNA 3BQZA 1GT0C 2VI6A 1IGNA 1APLC 2IAIA 1UG2A 2XB0X 4DYQA 3HOVJ 2DA2A 1ETXA 2PMZN 2O8KA 2ECCA 2K40A 5EGOB 1H88C 2K9SA 2CRGA 2HOAA 3RQIA 2DA5A 3S1RJ 2NVXJ 2K9NA 5EF6A 3IV5A 2H8RA 1JUMA 2YS9A 2GLOA 1ZKGA 4IHWA 4M3BA 2XB5A 1TWGJ 3QQAA 2JA8J 1G2HA 1HDPA 1PUFB 3A02A 3HKZN 3SFIA 1WI3A 2HOSA 4MLOA 5IOYA 2VPRA 5J3LA 2XGCA 4BY7J 4QTRA 1JJ8C 1OCTC 3GTPJ 2M2EA 3S1QJ 3OSFA 3MN2A 5DS9A 2COBA 4FE4A 2LR8A 3I4MJ 1ETWA 3JREA 4AC0A 3S16J 4CYCB 2M9HA 3BQYA 2X6OA 3QPLA 2DMQA 2VKVA 4GFBA 5F27A 4D7NA 5FJ8J 1K61A 2X9DA 4IHXA 3LSGA 2JK3A 2P81A 2RAEA 1AKHB 4BXXJ 3S1MJ 5F08A 2NVTJ 3ZQIA 3NARA 4Y7NJ 2MW8A 5M5YJ 1IJWC 1ORKA 1IDZA 2NVYJ 3MKLA 4BKXA 2CQXA 3PO3J 1DU6A 4BBRJ 2D5VA 2DMNA 4AUXA 4A69C 3A01A 3JRBA 4X6AJ 2DMUA 3ZQFA 3HOWJ 2DA1A 3OOUA 3GTJJ 4B3AA 1JUPA 2R5YB 3QPSA 2NVQJ 1ETQA 2XSDC 4C3HJ 1JTYA 4DW6A 1EF4A 2WAQN 3Q3SA 2CQQA 1GDTA 3LSJA 4I76A 4M3FA 3S17J 1JGGA 1RR7A 5IYBJ 3G1LA 2XPWA 3BR3A 2DA6A 2EBIA 4J19A 3CCYA 2YUSA 9ANTA 1BL0A 5C4XJ 2IEKA 1X2MA 2DA4A 1B72B 1FJLA 3JRDA 3PM1A 3BR0A 1FTZA 1LE8A 2R5ZA 2HI3A 3FK7A 3GTGJ 3TP3A 4L5EA 1H8AC 4A3KJ 1ENHA 1U9OA 2ID3A 1MBKA 4A3GJ 1MH4A 2NS8A 2Y30A 2JA5J 2DMPA 4V2FA 3TW7A 1Y1VJ 1WGXA 4EEFG 2EZHA 3IH3A 1I3QJ 3Q0UA 3HB9A 5DTDA 1QVUA 1ZR2A 2KDZA 1S7EA 1U8BA 2HOTA 2HQ5A 4MIMA 5IP6A 1ZGWA 2M8GX 2Y9YA 4FE7A 1H89C 2OPTA 2HXIA 2JMWA 4NDLA 4XRMA 3BR5A 2B63J 1GVDA 5C44J 4M3EA 2ELKA 4DYRA 1XC5A 1JT6A 3C2BA 1NK3P 4JYKA 5C4JJ 5K7HA 1HOMA 1P7IA 1IC8A 2EQRA 1T56A 3B6CA 3W6VA 5F04A 4DZJA 1XS9A 1TC3C 1HLVA 5IP7J 5EDNA 5E3MA 2ME6A 1Q1VA 5IOZA 2I10A 4A3MJ 3HOUJ 4M3GA 3B6AA 5J1RA 3VPRA 4G12A 3FISA 1W0UA 4A3LJ 1JKRC 2R5YA 3JRIA 3ZQGA 1VF9A 1WCMJ 2L9RA 2FX0A 1MSEC 5FKMA 1T33A 4A3IJ 2JN6A 5FKNA 3E7LA 4B1RA 1ETYA 2DJNA 3DCFA 4X1EA 3D1NI 4FISA 1BA5A 5JLXA 3ZOBA 5EEAA 1JT0A 2XGDA 2Y2ZA 1SFOJ 3BG9A 5FKOA 1MBGA 4D7MA 3LSPA 2EZKA 1JKOC 1DU0A 2OF7A 3BG5A 5F1JA 1K83J 3G1MA 3WHBA 3OSGA 3BR2A 2Y0SN 5IYDJ 3HEFA 2ZB9A 5GP9A 3GTOJ 3O8GA 1D5YA 1GUUA 1ZK8A 2EH3A 2ID6A 2R7ZJ 1AU7A 1NK2P 5F0HA 1UMQA 1VNDA 1CQTA 1TWAJ 3HBLA 1JJ6C 1MH3A 5F0FA 2O9LA 5BNGA 5GPCA 1MBFA 3LNQA 2CJJA 3SDGA 4HNVA 4AYBN 1NTCA 1QRYA 4V2GA 3TW6A 2KT0A 1GV2A 3LSRA 2JJ7A 1IDYA 2L0KA 2M0CA 1WH5A 3SJMA 2XGEA 3JRAA 2LVSA 1HF0A 2HYJA 1MSFC 1IRZA 1U9NA 3GBGA 5FKKA 3TP0A 5EGOA 1GV5A 1O4XA 1MBHA 3HGYA 5F0CA 1POGA 3TEDA 3JRCA 4JX5A 5FKLA 3M3YJ 2CUFA 2O7OA 1IV6A 5J1UA 4XIDA 1MBEA 5IPAA 2XPVA 1PUFA 1OCPA 2CU7A 3G1OA 3S15J 2JA7J 1B8IB 2WV1A 5JLWA 3ZQCA 4JX6A 2DN0A 3LOCA 3BR1A 3O8HA 4UUTA 4MFEA 1JTXA 3S2HJ 3L1PA 4C3IJ 4DYCA 4A3EJ 3RZOJ 2FD5A 4IHVA 2YU9J 5EG0B 1ZQ3P 2LP0A 4CYCA 4B4CA 3JRFA 1ITYA 1MBJA 2K9QA 5EZHA 1X58A 1W0TA 1ETVA 1E3OC 3ZQLA 2AHQA 4UUSB 2R92J 2G0EA 3A01B 4JX4A 4MFDA 4A3FJ 4A3DJ 1P7JA 1RETA 2IBDA 1AKHA 3MVPA 1WPKA 2MG4A 2XPUA 3BTLA 4IEJA 3WHCA 5FLMJ 2MSYA 1F43A 1JKPC 2L7FP 1VFCA 3IH4A 4C2MJ 5K7FA 4I6ZA 3GTLJ 2NOGA 2FJ1A 3RKQA 2GBYA 2LD5A 4A3BJ 2W48A 3GTMJ 2E19A 1BJZA 1FEXA 3DEWA 5C3EJ 5J1YA 4RDUA 2H1KA 3H3VK 1Z0XA 4W97A 1U78A 2R93J 2Y31A 5GPAA 5M5XJ 1LE8B 2R5ZB 4A3CJ 4A3JJ 2L7ZA 5EYRA 3RZDJ 1FIAA 2VKEA 1B72A 2LKXA 5M5WJ 3UKGA 2R0QC 3S1NJ 2DTZA 1HDDC 4D5FA 1MNMC 1QPIA 1TWHJ 1RPWA 1I6HJ 3HDDA 2Y9ZA 1A5JA 3OIOA 5K7ZA 2FQ4A 1A6IA 2LFBA 2VUMJ 4DZPA 1RKWA 1RESA 1JUSA 1TWCJ 3ZQHA 2E2IJ 2L7MP 5E3LA 3CMYA 4Y52J 1Z77A 5EZGA 3M4OJ 3S2DJ 1B8IA 2HDDA 3HOZJ 3PO2J 1TWFJ 1QVTA 4FCYA 3A03A 2JWTA 1IG7A 2N8GA 1YRNB 1F36A 2HXOA 4XRSA 2QF7A 5IP9J 1OJLA 2DA7A 5IYCJ 5EG0A 2DA3A 2X48A 5E3OA 3GTKJ 4JP0A 4UUSA 2EZLA 5FLVA 1UHSA 2E1OA 4XICA 1ZR4A 2JA6J 1ZTRA 1ETKA 5HODA 2LK2A 4M6VA 1SANA 1XG1A 1BW5A 1IUFA 4D5CA 3JRHA 4C3JJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XRL A;  2E2J J;  4XRS G;  1X2N A;  2EZI A;  4MO7 A;  1FTT A;  2NS7 A;  1OFC X;  4M3D A;  2LY9 A;  2WB1 N;  2TRT A;  3HGG A;  3JRG A;  4IHY A;  2M34 A;  3BT9 A;  1RKT A;  3NAU A;  3FIW A;  3FK6 A;  3JR9 A;  1ETO A;  3K2A A;  5M3F J;  2CUE A;  1JKQ C;  1Y1W J;  3FKI J;  3CQZ J;  1LFU P;  4LOC A;  1AHD P;  3Q0V A;  4ABZ A;  3GTQ J;  4QSH A;  2DMT A;  4W1U A;  4FTH A;  3I4N J;  3BTI A;  3H0G J;  3S14 J;  3CDL A;  2E2H J;  4BBS J;  3BG3 A;  4BY1 J;  5M3M J;  1HCR A;  3BTC A;  2MGQ A;  4XK4 A;  1R9T J;  1FIP A;  2LLK A;  3HM5 A;  4A93 J;  3Q0W A;  4QIW N;  3IH2 A;  3BR6 A;  2TCT A;  5E3N A;  3F0C A;  2AO9 A;  2GM4 A;  3BTJ A;  2LTP A;  2ME0 A;  1BW6 A;  1LFB A;  1VI0 A;  4S0H B;  1I50 J;  2ECB A;  2QCO A;  3HOX J;  1WH7 A;  4RBO A;  3HOY J;  3K7A J;  1YRN A;  3BQZ A;  1GT0 C;  2VI6 A;  1IGN A;  1APL C;  2IAI A;  1UG2 A;  2XB0 X;  4DYQ A;  3HOV J;  2DA2 A;  1ETX A;  2PMZ N;  2O8K A;  2ECC A;  2K40 A;  5EGO B;  1H88 C;  2K9S A;  2CRG A;  2HOA A;  3RQI A;  2DA5 A;  3S1R J;  2NVX J;  2K9N A;  5EF6 A;  3IV5 A;  2H8R A;  1JUM A;  2YS9 A;  2GLO A;  1ZKG A;  4IHW A;  4M3B A;  2XB5 A;  1TWG J;  3QQA A;  2JA8 J;  1G2H A;  1HDP A;  1PUF B;  3A02 A;  3HKZ N;  3SFI A;  1WI3 A;  2HOS A;  4MLO A;  5IOY A;  2VPR A;  5J3L A;  2XGC A;  4BY7 J;  4QTR A;  1JJ8 C;  1OCT C;  3GTP J;  2M2E A;  3S1Q J;  3OSF A;  3MN2 A;  5DS9 A;  2COB A;  4FE4 A;  2LR8 A;  3I4M J;  1ETW A;  3JRE A;  4AC0 A;  3S16 J;  4CYC B;  2M9H A;  3BQY A;  2X6O A;  3QPL A;  2DMQ A;  2VKV A;  4GFB A;  5F27 A;  4D7N A;  5FJ8 J;  1K61 A;  2X9D A;  4IHX A;  3LSG A;  2JK3 A;  2P81 A;  2RAE A;  1AKH B;  4BXX J;  3S1M J;  5F08 A;  2NVT J;  3ZQI A;  3NAR A;  4Y7N J;  2MW8 A;  5M5Y J;  1IJW C;  1ORK A;  1IDZ A;  2NVY J;  3MKL A;  4BKX A;  2CQX A;  3PO3 J;  1DU6 A;  4BBR J;  2D5V A;  2DMN A;  4AUX A;  4A69 C;  3A01 A;  3JRB A;  4X6A J;  2DMU A;  3ZQF A;  3HOW J;  2DA1 A;  3OOU A;  3GTJ J;  4B3A A;  1JUP A;  2R5Y B;  3QPS A;  2NVQ J;  1ETQ A;  2XSD C;  4C3H J;  1JTY A;  4DW6 A;  1EF4 A;  2WAQ N;  3Q3S A;  2CQQ A;  1GDT A;  3LSJ A;  4I76 A;  4M3F A;  3S17 J;  1JGG A;  1RR7 A;  5IYB J;  3G1L A;  2XPW A;  3BR3 A;  2DA6 A;  2EBI A;  4J19 A;  3CCY A;  2YUS A;  9ANT A;  1BL0 A;  5C4X J;  2IEK A;  1X2M A;  2DA4 A;  1B72 B;  1FJL A;  3JRD A;  3PM1 A;  3BR0 A;  1FTZ A;  1LE8 A;  2R5Z A;  2HI3 A;  3FK7 A;  3GTG J;  3TP3 A;  4L5E A;  1H8A C;  4A3K J;  1ENH A;  1U9O A;  2ID3 A;  1MBK A;  4A3G J;  1MH4 A;  2NS8 A;  2Y30 A;  2JA5 J;  2DMP A;  4V2F A;  3TW7 A;  1Y1V J;  1WGX A;  4EEF G;  2EZH A;  3IH3 A;  1I3Q J;  3Q0U A;  3HB9 A;  5DTD A;  1QVU A;  1ZR2 A;  2KDZ A;  1S7E A;  1U8B A;  2HOT A;  2HQ5 A;  4MIM A;  5IP6 A;  1ZGW A;  2M8G X;  2Y9Y A;  4FE7 A;  1H89 C;  2OPT A;  2HXI A;  2JMW A;  4NDL A;  4XRM A;  3BR5 A;  2B63 J;  1GVD A;  5C44 J;  4M3E A;  2ELK A;  4DYR A;  1XC5 A;  1JT6 A;  3C2B A;  1NK3 P;  4JYK A;  5C4J J;  5K7H A;  1HOM A;  1P7I A;  1IC8 A;  2EQR A;  1T56 A;  3B6C A;  3W6V A;  5F04 A;  4DZJ A;  1XS9 A;  1TC3 C;  1HLV A;  5IP7 J;  5EDN A;  5E3M A;  2ME6 A;  1Q1V A;  5IOZ A;  2I10 A;  4A3M J;  3HOU J;  4M3G A;  3B6A A;  5J1R A;  3VPR A;  4G12 A;  3FIS A;  1W0U A;  4A3L J;  1JKR C;  2R5Y A;  3JRI A;  3ZQG A;  1VF9 A;  1WCM J;  2L9R A;  2FX0 A;  1MSE C;  5FKM A;  1T33 A;  4A3I J;  2JN6 A;  5FKN A;  3E7L A;  4B1R A;  1ETY A;  2DJN A;  3DCF A;  4X1E A;  3D1N I;  4FIS A;  1BA5 A;  5JLX A;  3ZOB A;  5EEA A;  1JT0 A;  2XGD A;  2Y2Z A;  1SFO J;  3BG9 A;  5FKO A;  1MBG A;  4D7M A;  3LSP A;  2EZK A;  1JKO C;  1DU0 A;  2OF7 A;  3BG5 A;  5F1J A;  1K83 J;  3G1M A;  3WHB A;  3OSG A;  3BR2 A;  2Y0S N;  5IYD J;  3HEF A;  2ZB9 A;  5GP9 A;  3GTO J;  3O8G A;  1D5Y A;  1GUU A;  1ZK8 A;  2EH3 A;  2ID6 A;  2R7Z J;  1AU7 A;  1NK2 P;  5F0H A;  1UMQ A;  1VND A;  1CQT A;  1TWA J;  3HBL A;  1JJ6 C;  1MH3 A;  5F0F A;  2O9L A;  5BNG A;  5GPC A;  1MBF A;  3LNQ A;  2CJJ A;  3SDG A;  4HNV A;  4AYB N;  1NTC A;  1QRY A;  4V2G A;  3TW6 A;  2KT0 A;  1GV2 A;  3LSR A;  2JJ7 A;  1IDY A;  2L0K A;  2M0C A;  1WH5 A;  3SJM A;  2XGE A;  3JRA A;  2LVS A;  1HF0 A;  2HYJ A;  1MSF C;  1IRZ A;  1U9N A;  3GBG A;  5FKK A;  3TP0 A;  5EGO A;  1GV5 A;  1O4X A;  1MBH A;  3HGY A;  5F0C A;  1POG A;  3TED A;  3JRC A;  4JX5 A;  5FKL A;  3M3Y J;  2CUF A;  2O7O A;  1IV6 A;  5J1U A;  4XID A;  1MBE A;  5IPA A;  2XPV A;  1PUF A;  1OCP A;  2CU7 A;  3G1O A;  3S15 J;  2JA7 J;  1B8I B;  2WV1 A;  5JLW A;  3ZQC A;  4JX6 A;  2DN0 A;  3LOC A;  3BR1 A;  3O8H A;  4UUT A;  4MFE A;  1JTX A;  3S2H J;  3L1P A;  4C3I J;  4DYC A;  4A3E J;  3RZO J;  2FD5 A;  4IHV A;  2YU9 J;  5EG0 B;  1ZQ3 P;  2LP0 A;  4CYC A;  4B4C A;  3JRF A;  1ITY A;  1MBJ A;  2K9Q A;  5EZH A;  1X58 A;  1W0T A;  1ETV A;  1E3O C;  3ZQL A;  2AHQ A;  4UUS B;  2R92 J;  2G0E A;  3A01 B;  4JX4 A;  4MFD A;  4A3F J;  4A3D J;  1P7J A;  1RET A;  2IBD A;  1AKH A;  3MVP A;  1WPK A;  2MG4 A;  2XPU A;  3BTL A;  4IEJ A;  3WHC A;  5FLM J;  2MSY A;  1F43 A;  1JKP C;  2L7F P;  1VFC A;  3IH4 A;  4C2M J;  5K7F A;  4I6Z A;  3GTL J;  2NOG A;  2FJ1 A;  3RKQ A;  2GBY A;  2LD5 A;  4A3B J;  2W48 A;  3GTM J;  2E19 A;  1BJZ A;  1FEX A;  3DEW A;  5C3E J;  5J1Y A;  4RDU A;  2H1K A;  3H3V K;  1Z0X A;  4W97 A;  1U78 A;  2R93 J;  2Y31 A;  5GPA A;  5M5X J;  1LE8 B;  2R5Z B;  4A3C J;  4A3J J;  2L7Z A;  5EYR A;  3RZD J;  1FIA A;  2VKE A;  1B72 A;  2LKX A;  5M5W J;  3UKG A;  2R0Q C;  3S1N J;  2DTZ A;  1HDD C;  4D5F A;  1MNM C;  1QPI A;  1TWH J;  1RPW A;  1I6H J;  3HDD A;  2Y9Z A;  1A5J A;  3OIO A;  5K7Z A;  2FQ4 A;  1A6I A;  2LFB A;  2VUM J;  4DZP A;  1RKW A;  1RES A;  1JUS A;  1TWC J;  3ZQH A;  2E2I J;  2L7M P;  5E3L A;  3CMY A;  4Y52 J;  1Z77 A;  5EZG A;  3M4O J;  3S2D J;  1B8I A;  2HDD A;  3HOZ J;  3PO2 J;  1TWF J;  1QVT A;  4FCY A;  3A03 A;  2JWT A;  1IG7 A;  2N8G A;  1YRN B;  1F36 A;  2HXO A;  4XRS A;  2QF7 A;  5IP9 J;  1OJL A;  2DA7 A;  5IYC J;  5EG0 A;  2DA3 A;  2X48 A;  5E3O A;  3GTK J;  4JP0 A;  4UUS A;  2EZL A;  5FLV A;  1UHS A;  2E1O A;  4XIC A;  1ZR4 A;  2JA6 J;  1ZTR A;  1ETK A;  5HOD A;  2LK2 A;  4M6V A;  1SAN A;  1XG1 A;  1BW5 A;  1IUF A;  4D5C A;  3JRH A;  4C3J J; 
#chains in the Genus database with same CATH topology
 2COM A;  2E2J J;  4XRS G;  1PVE A;  2EZI A;  2PN6 A;  1YJW I;  1VZ0 A;  2X4H A;  5LGU A;  2ZBK A;  3I59 A;  3IAS 2;  3L2U A;  3I64 A;  3JR9 A;  2F4O B;  1NG7 A;  5M3F J;  2YPR A;  2V6E A;  2VE8 A;  3B02 A;  1X1A A;  3AAF A;  3CQZ J;  5FLX Z;  3U1K A;  2VJ5 A;  4LOC A;  1T6S A;  4I98 B;  3JCU C;  4XLE A;  3CCM I;  2CFO A;  2L3D A;  2GAU A;  4IRG A;  3PL8 A;  3G73 A;  4W1U A;  3WGI A;  3I4N J;  2CUJ A;  1FOW A;  2K4J A;  3BTI A;  3S14 J;  3CP8 A;  4E7I A;  4BE1 A;  4BY1 J;  1HCR A;  3HPG A;  4XL9 A;  5B1A H;  2LLK A;  3DKY A;  3CCR I;  2VQH A;  2F4I A;  3NQO A;  1K4T A;  2TCT A;  3H9J A;  4UVB A;  3ABL H;  4ZYD A;  2QGU A;  1MKM A;  1B4A A;  1LEA A;  3F21 A;  4KN7 X;  3RPU D;  2LTP A;  3KP6 A;  6PAX A;  4LK0 F;  3KEO A;  1G59 A;  2FBI A;  4Q47 A;  2ZFW A;  1O3Q A;  3HOX J;  1WJE A;  2O8X A;  3KPH A;  5DM7 F;  4LB5 A;  1J09 A;  3WTS C;  3BRO A;  1ODD A;  1OPC A;  2IAI A;  2VBZ A;  2BE5 F;  3NEU A;  1KU3 A;  3BLY A;  2DA2 A;  4IXA A;  2V9K A;  2NS0 A;  3IWF A;  5HS7 A;  4M74 A;  4PFO A;  3CF5 F;  2K40 A;  2XRN A;  3U21 A;  2CRG A;  2HOA A;  4RLQ A;  3PFI A;  3S1R J;  1FSE A;  2NVX J;  2DAO A;  1YIT I;  5EF6 A;  1E3H A;  2YS9 A;  1SFK A;  2ISY A;  1XGM A;  2GLO A;  3NWT A;  2XB5 A;  4PJM A;  4LIV A;  3BCB A;  1OLT A;  2HOS A;  5D5V B;  1KU9 A;  4A0Z A;  1MIJ A;  3D5S C;  1ZGJ A;  5IOY A;  4BXU A;  5J3L A;  1FC3 A;  3IL2 A;  3S1Q J;  4P5O A;  3MN2 A;  3LST A;  4IF4 A;  2QSF X;  2P0W A;  2R3S A;  1ETW A;  1OYW A;  2A61 A;  2AQE A;  5GAD J;  3BQY A;  5CQG A;  2X6O A;  4DIQ A;  1KON A;  2VKV A;  1Z6R A;  3MKW B;  4D7N A;  2A5Y B;  2R7R A;  4WF2 A;  4IHX A;  2LF7 A;  2K27 A;  3DTK A;  3RPU A;  4OWR B;  2ZKZ A;  2JRT A;  4M72 A;  4BXX J;  3ECO A;  5F08 A;  2HVQ A;  5DV5 A;  3RYP A;  1IUY A;  5J4Y A;  2NVY J;  1U3E M;  2GA2 A;  2V1N A;  2WV0 A;  4BKX A;  3ERM A;  3OR2 C;  1YW7 A;  3JAM Z;  4Z2Y A;  2DMN A;  4AUX A;  1DP7 P;  5JFR A;  4X6A J;  5LGN A;  2ZJP F;  3IWZ A;  1P6R A;  5B3S H;  5JVT A;  4KFC A;  3GTJ J;  3DU5 A;  3QPS A;  2XSD C;  3CC4 I;  2AXT C;  4DW6 A;  2ZCW A;  2HQR A;  2CQQ A;  4M3F A;  3S17 J;  2VBX A;  1DPU A;  2VAS A;  4UY8 I;  1RR7 A;  1YJN I;  2EBI A;  3DFG A;  2M1B A;  3F22 A;  2QLZ A;  1BL0 A;  1A36 A;  2K4B A;  4NB5 A;  4F93 B;  5L3E A;  1R00 A;  5FB2 A;  1B72 B;  2P7C B;  3GCM A;  3DPT A;  2K85 A;  1U2W A;  3LL7 A;  2QSG X;  3PM1 A;  3CJN A;  1FTZ A;  4EGZ A;  1LE8 A;  2R5Z A;  5E8I A;  3GTG J;  3ABU A;  5ILU A;  3QPH A;  3K1M A;  1ENH A;  1QA6 A;  1MJB A;  1U9O A;  5EEH A;  2ID3 A;  4BNC A;  1TQP A;  4JOM A;  3GFI A;  2DMP A;  4Q5S F;  3FWE A;  3TW7 A;  2FUG 2;  5LBQ A;  2X1E A;  3HRM A;  3ZGK A;  1ZLK A;  1DP3 A;  2L4A A;  3IH3 A;  5HLI A;  2QZ8 A;  3R6S A;  2H6B A;  4Y13 A;  3HB9 A;  3Q0U A;  4ON0 A;  1RZ4 A;  5DTD A;  1ZR2 A;  1Y6I A;  3L2R A;  2WY7 Q;  1DDN A;  3CCE I;  5J4V A;  1R5H A;  1YW9 A;  2LOO A;  1RRJ A;  5IP6 A;  3EDP A;  1OYY A;  2E34 A;  3I5U A;  2M8G X;  4N4O B;  2OCE A;  4QPO A;  1U6G A;  4HPQ A;  3SEQ A;  1WSU A;  2VT3 A;  1Y56 A;  2GZW A;  4HZF A;  1R36 A;  1JT6 A;  2LBF B;  4XKB A;  4EGY A;  4ZYH A;  3UNG C;  2L54 A;  1RUN A;  1HBX G;  1UST A;  1I39 A;  1QGP A;  4XLC A;  2DW4 A;  1BC7 C;  4DZJ A;  3CUQ B;  3PQJ A;  2KZG A;  3W2W A;  1LB2 A;  1DQU A;  5EDN A;  2OUM A;  5E3M A;  4HNU A;  2LG4 A;  2CG4 A;  3HOU J;  4A0Y A;  4M3G A;  4U0V A;  3FHZ A;  3DBR B;  3VPR A;  1WQ2 A;  1PJR A;  2EV0 A;  3JRI A;  3ZQG A;  1VF9 A;  1U5T C;  1OCO H;  2A5W A;  4CUG A;  1WCM J;  2L9R A;  3S93 A;  4GGG A;  2M4K A;  5EJC A;  2M7B A;  4LIT A;  2FX0 A;  3K69 A;  4UV9 A;  4HST A;  3PIP F;  1MSE C;  4XLF A;  1T33 A;  4LIU A;  2JN6 A;  5FKN A;  2IA1 A;  4B1R A;  5A2Q Z;  2DJN A;  3GF2 A;  1A35 A;  2EIJ H;  2NAZ A;  1VQ8 I;  2Z3Y A;  1ZH5 A;  4X1E A;  3LSI A;  2XRO A;  5JLX A;  1YTY A;  3HOS A;  3A1Y A;  3ZOB A;  2LY2 A;  2PBI A;  2Y2Z A;  3BG9 A;  5KNL A;  2ZME C;  1LQ1 A;  1MBG A;  3A4C A;  2BGC A;  1QBJ A;  5F1J A;  1R6R A;  2EK5 A;  4LG3 A;  4NC8 A;  1BJA A;  5IYD J;  4HW0 A;  1K6O A;  5GP9 A;  5KAI C;  3GTO J;  1D5Y A;  4L9T A;  4PJL A;  4E70 A;  2VB6 A;  3F3X A;  3TO9 A;  3VYU B;  3JTG A;  3SYT A;  3CP2 A;  2CW7 A;  4NBQ A;  5CVJ A;  5TIS C;  5F0H A;  3BJO A;  5JHU A;  2ZFU A;  3GFL A;  4CHU A;  3E3V A;  3HBL A;  1IXR C;  5F0F A;  5B1B H;  4CCJ A;  4ZDL A;  3KEY A;  2VLA A;  3FXU A;  4RA2 A;  1P4A A;  4OIO F;  2F5E A;  3TQN A;  1TNT A;  4V2G A;  4B44 A;  4YFX F;  3IP4 B;  2R7T A;  3OYI A;  3DEU A;  1IDY A;  1WVR A;  2FRH A;  3PNV A;  1J2X A;  2IGK A;  2LKP A;  2XGE A;  3FXO A;  4J01 A;  3RSN A;  1UAA A;  1GVJ A;  2MA3 A;  4CZC A;  3HZJ A;  2O3F A;  1O7L A;  3DQV C;  3AG4 H;  1MSF C;  4E4H A;  2ZXJ A;  2ZNZ A;  4IOC F;  3KX2 A;  3M8E A;  5HLT A;  2WWY A;  4BEH B;  2CQK A;  3CCJ I;  3G4S I;  3R0A A;  1KQ0 A;  4K2E A;  1MBH A;  3QRF F;  4FQG A;  5DCM A;  3TED A;  3C7J A;  3I0T A;  1XTA A;  1JI8 A;  2R4G A;  3N4M A;  5LHH A;  1OKR A;  5IPA A;  1XCV A;  3ONQ A;  1IN5 A;  2P8T A;  1XCB A;  5KAF C;  4S05 A;  5LFA A;  5JLW A;  2M45 A;  1OR7 C;  4XON A;  3ZQC A;  4A5M A;  1S29 A;  4N9H A;  1FBQ A;  4MFE A;  1VQL I;  4C3I J;  3OYA A;  4AWX B;  2PJP A;  4EJV A;  2YU9 J;  5EG0 B;  3JSO A;  3V8J A;  2LP0 A;  1L0O C;  2HQN A;  3QAH A;  1QO0 D;  1OYI A;  4XN0 A;  2IS4 A;  1X58 A;  3FXJ A;  4HA8 A;  3ZQL A;  4UUS B;  4IPA A;  4HRI A;  4EVI A;  3A01 B;  4YIR X;  4UVA A;  5F6F A;  4A3D J;  2UZK A;  2VPL A;  3KZI C;  2FA5 A;  3WTX C;  2FOK A;  2FBK A;  1WPK A;  2QQ9 A;  3VWB A;  3W6K B;  2MSY A;  1F43 A;  3L09 A;  1VFC A;  5K7F A;  2WAD A;  3OYL A;  3GXO A;  2JSP A;  1LDJ A;  2E19 A;  1BJZ A;  2K7L A;  1WRJ A;  1SAX A;  1FEX A;  2L7K A;  3DEW A;  3K9T A;  2W25 A;  2Q8K A;  5D4S A;  4BDZ A;  5J47 A;  4LJZ F;  4ENK A;  2KFD A;  4W97 A;  1LEB A;  4MQ9 F;  4B48 A;  1T0F C;  4XOP A;  3OIP A;  2JPC A;  4PZJ A;  1YJ9 I;  4P96 A;  4A3C J;  2LSO A;  3PSI A;  3KE2 A;  3F8F A;  5EYR A;  3ZMU A;  1OIS A;  2CGP A;  4Q4Z F;  4RAY A;  4HSR A;  2ZC2 A;  5L3C A;  1B72 A;  4RGR A;  3OYD A;  5M5W J;  3WG7 H;  4IHS A;  1ZAO A;  2A6H F;  4HLX A;  5KVR A;  2ZNY A;  1BIB A;  1D1C A;  1H0M A;  2EIN H;  2JTV A;  1I6H J;  2W1O A;  3MKZ A;  1XMA A;  1A5J A;  4GO1 A;  1B1B A;  1P9Q C;  2E5Z A;  3QYF A;  2FQ4 A;  2WB1 A;  2LFB A;  3IKV A;  4IL6 C;  5K7Z A;  1Y39 A;  2CMP A;  1ZRC A;  2BYV E;  3ZQH A;  3ROU A;  2QUF A;  3F8N A;  1Z77 A;  5EZG A;  2OTJ I;  4M9Z A;  4OMY A;  1IN6 A;  4AVP A;  3H9Q A;  1B8I A;  2AXL A;  1N77 A;  2KPM A;  4LFU A;  2RKH A;  5GAG J;  1VQ9 I;  1QVT A;  4FX0 A;  2DU9 A;  4MTE A;  1IG7 A;  4C9Y A;  1OQY A;  1F36 A;  3H36 A;  4ZYA A;  4CCM A;  4IX7 A;  1YHQ I;  2HS5 A;  3R61 A;  4ZYE A;  1OJL A;  2DA7 A;  2DA3 A;  4A2U A;  3VDX A;  1O3S A;  1FNN A;  3IRR A;  2EIL H;  1E0E A;  2W84 A;  4PCQ A;  5FLV A;  1UHS A;  2E1O A;  3MD2 A;  1ZR4 A;  3IRQ A;  3HL2 A;  5HLG A;  3I71 A;  3CUQ A;  2EIK H;  4J00 A;  2QYO A;  2XRL A;  4S04 A;  3ERE D;  1X2N A;  4MO7 A;  2HPI A;  2OA4 A;  1MGT A;  3J81 K;  1G3T A;  1WFX A;  3J80 K;  3PJR A;  1LDK B;  1FTT A;  4IHY A;  2Y69 H;  3JTH A;  3BT9 A;  1TW3 A;  4DQ2 A;  3NAU A;  3LMM A;  5ICF A;  2XAQ A;  2A6E F;  2BZT A;  4C2T A;  2IP2 A;  3CCV I;  5D6F A;  1JKQ C;  3TO7 A;  3F6O A;  1QZY A;  4FHT A;  3L2W A;  3MZ8 A;  1H9T A;  2CV1 A;  4CSW A;  1LFU P;  2VOO A;  2RVC A;  3Q0V A;  3GLL A;  4U0Y A;  3GTQ J;  2DXI A;  1KQ8 A;  1FPQ A;  3HKZ A;  1BI3 A;  1P92 A;  1FY7 A;  4BE2 A;  3EUK L;  2E2H J;  4XSZ F;  1XD7 A;  5K5R A;  3BG3 A;  2XAU A;  1T08 B;  3EQL F;  5H6R A;  2LF8 A;  5FO5 A;  1R9T J;  3HM5 A;  1MD0 A;  4IRH A;  2Z16 A;  2VIX A;  3HJE A;  2KIS A;  3F8B A;  3I58 A;  3FXM A;  4CIC A;  1WHU A;  2GIZ A;  4ZYG A;  1FX7 A;  2HFH A;  2K9L A;  2F5D A;  3QOE A;  1MW7 A;  3MMY B;  4NC6 A;  4AVZ A;  2O6G E;  1VI0 A;  2XF7 A;  3CUO A;  2QCO A;  2XDV A;  4HOB A;  1W36 C;  5CVR A;  1O7F A;  3K7A J;  1S7O A;  1YRN A;  2E5N A;  1UJ8 A;  5EEG A;  3QP6 A;  2VI6 A;  5KCM A;  1IGN A;  1UG2 A;  1I27 A;  2XB0 X;  3C2G A;  3H35 A;  2HNH A;  3E6D A;  2K9S A;  2Q2E B;  2Q0O A;  2GOM A;  3H5N A;  3GYH X;  1K78 B;  1UHM A;  3ZCO A;  2KIU A;  3IV5 A;  2OV7 A;  2H8R A;  3AKZ A;  1FSH A;  1JUM A;  4G94 A;  1Q1H A;  1ZKG A;  4OMZ A;  1QNT A;  1QU3 A;  4M3B A;  2X1C A;  4DBQ A;  3ZXS A;  2ESH A;  4X0G A;  1PUF B;  4BEH A;  5BMZ A;  1HXD A;  1C0W A;  1SFX A;  3OYB A;  2VPR A;  5ICG A;  5K5O A;  1IW7 F;  4U7B A;  2XGC A;  2FML A;  1OCT C;  3GTP J;  4E7J A;  3OSF A;  2RNJ A;  5DS9 A;  4ENJ A;  3I4M J;  2LR8 A;  1KGS A;  2OJE D;  4ETS A;  2L02 A;  3JRE A;  3V8L A;  3S16 J;  2R7X A;  2ZSH B;  3ZR8 X;  3KZZ A;  2QKL B;  5F27 A;  3MWM A;  2IT0 A;  4L5I A;  1IRG A;  2YX7 A;  1YIJ I;  3LSG A;  4BQN A;  3HTS B;  4WWC A;  4IQJ A;  2E1M C;  5HDG A;  5LHG A;  1B9M A;  4PDK A;  1AKH B;  1IAW A;  2QQ8 A;  3NAR A;  1IJW C;  3CMA I;  2MH9 A;  1IDZ A;  3JSP A;  3MKL A;  3Q9S A;  3BZC A;  4ZTJ A;  2D5V A;  3A01 A;  3F8C A;  4A69 C;  1R22 A;  2C6Y A;  2WTE A;  3ZQF A;  3AL0 C;  3Q9V A;  4HYE A;  1A6Q A;  3HOW J;  2DA1 A;  2PMH A;  3K10 A;  4B3A A;  1JUP A;  1Z9C A;  1N78 A;  1GXQ A;  3DKX A;  5IT3 A;  3D5R C;  3WTY C;  1EF4 A;  2WAQ N;  1GDT A;  3LSJ A;  4BJ5 C;  1XGS A;  5DUK A;  3SZT A;  1D8K A;  3CCY A;  4G6D A;  1WJB A;  2FE3 A;  1O57 A;  3S32 A;  4DBR A;  4Q48 A;  1FJL A;  2OD5 A;  2QBY B;  1V5E A;  1F4K A;  4PJJ A;  4IKF A;  3JRD A;  1EH8 A;  4XRF A;  3BR0 A;  4OIR F;  3F8M A;  4IHT A;  1G3S A;  2MC3 A;  3TP3 A;  4L5E A;  1T39 A;  3TKY A;  1WWX A;  2EA2 A;  1MBK A;  2EWN A;  4A3G J;  1S7A A;  1MH4 A;  2LMD A;  2VT2 A;  2Y30 A;  2JA5 J;  2DFH A;  4LD5 A;  1Y1V J;  3NWS A;  4I09 A;  1VQN I;  3T0Y A;  2BW3 B;  2EZH A;  3BWG A;  3ECH A;  3SHF A;  3I3L A;  4KIS A;  2P5L C;  1S5L C;  5D8L B;  1S7E A;  1U8B A;  1FYL A;  1FBU A;  2KJC A;  4BAC A;  4EAT A;  3R0J A;  2DPD A;  1ZEL A;  2HQ5 A;  3M8F A;  1B59 A;  1LJ9 A;  2MD0 A;  1Y0U A;  2KL4 A;  4OAY A;  1VTN C;  3OMY A;  2QA4 I;  1AOY A;  2OPT A;  2HXI A;  4RGU A;  1V5F A;  2G7H A;  4HEA 2;  2OZ6 A;  2B0L A;  4OOI A;  2XGX A;  3PFY A;  1EA3 A;  2XAF A;  3CLQ A;  1ZYR F;  5E1W A;  2ELK A;  1FLI A;  3QP5 A;  4IO9 F;  1ZG3 A;  3DU6 A;  2WA0 A;  1NK3 P;  2PI0 A;  3F23 A;  3RI4 A;  1KU2 A;  5K7H A;  2JUG A;  1N25 A;  3K4M A;  3OYH A;  4Y4R A;  1VQM I;  2OTL I;  1W4M A;  3E0J B;  1IC8 A;  1ACI A;  1IV8 A;  1YYV A;  4LLL A;  1T56 A;  5CVV A;  1FBS A;  2UXX A;  3CCS I;  1XS9 A;  5IT9 K;  2PMU A;  3OOP A;  4Y15 A;  5IP7 J;  3OL4 A;  2DK8 A;  2IS6 A;  4I02 A;  1Q1V A;  5IOZ A;  1QZZ A;  2I10 A;  1HSJ A;  3CLO A;  5FFZ A;  5LEJ A;  2YR2 A;  1J75 A;  2JZY A;  5DCM B;  4WCG A;  4G12 A;  4ZJZ A;  3PQK A;  3IUO A;  1YX5 A;  1JXS A;  4C2U A;  4RB2 C;  3ZMV A;  2GXB A;  1XSX A;  3ABM H;  2E7X A;  1Z3Y A;  2P5K A;  3M8J A;  5LEK A;  3DCF A;  1HKQ A;  3KCC A;  2WAF A;  2XGD A;  4YEJ A;  4H4K C;  2W4S A;  5AON A;  2NNY A;  5FRO A;  1PP8 F;  2Z99 A;  2OF7 A;  4RM2 A;  1ZN2 A;  1T38 A;  2DT5 A;  2FQ3 A;  2EV5 A;  1VQ4 I;  4RAF A;  2Y0S N;  3LAJ A;  2GWR A;  3HEF A;  3L9F A;  3W2A A;  1ON2 A;  2IPQ X;  4LK1 F;  1ZK8 A;  2IGM A;  2GXG A;  2BVL A;  4XN3 A;  2R7Z J;  2OC6 A;  3I55 I;  3QPT A;  1NK2 P;  1LUJ B;  4CZZ A;  5CVI A;  3RKW A;  4FT8 A;  1VND A;  5J8C A;  2DT6 A;  1W7P D;  3DPL C;  3OR1 C;  3OYE A;  4I99 C;  2F5V A;  2YX4 A;  3RIR A;  2M3A A;  1J59 A;  4M6Y A;  1MBF A;  4U87 A;  3LNQ A;  1MMG A;  5GTI C;  3LFK A;  3OYK A;  5H2F C;  4AYB N;  1J9I A;  2JVH A;  2VQL A;  1NTC A;  1G3W A;  1QRY A;  3TW6 A;  4FAS D;  4V19 K;  4U0W A;  1KA8 A;  3G6E I;  2KT0 A;  4O5V A;  4KIB A;  1Z6T A;  2OAZ A;  3F6V A;  1AWC A;  2XSJ C;  3G3Z A;  3TO6 A;  4A6D A;  3FXK A;  3DWL E;  3SJM A;  3DTE A;  2EPF A;  2LVS A;  3KYL A;  4PUS A;  2HYJ A;  3CC2 I;  1IN8 A;  1IRZ A;  2Z5U A;  1D1B A;  3GBG A;  3SDB A;  2FMY A;  4UNO A;  3O3K A;  1GV5 A;  2Q2E A;  3P9C A;  1K78 A;  3TL4 X;  4IRI A;  2VJ4 A;  2CUF A;  1FP2 A;  1G3Y A;  4XID A;  3OYG A;  2KIQ A;  1PUF A;  4C30 A;  2CW8 A;  1X1P A;  3S15 J;  2JA7 J;  1B8I B;  1FT9 A;  4JQF A;  1HW2 A;  2WV1 A;  1YI2 I;  2DN0 A;  2BXY A;  3O8H A;  1SC7 A;  4CDG A;  4EJO A;  3L1P A;  1CGP A;  4DYC A;  4A3E J;  3RZO J;  2DFE A;  2ELH A;  2FD5 A;  4IHV A;  1IZ1 A;  4XLH A;  1K79 A;  5E1Z B;  3LFU A;  4RB1 A;  1NG6 A;  5EZH A;  1W0T A;  1TP4 A;  1ETV A;  2E60 A;  2HZD A;  2HR3 A;  2A3S A;  4OAZ A;  2BVM A;  2GOX B;  4MFD A;  2FNP A;  2CV0 A;  1P7J A;  5H6Q A;  2H8W A;  1DGW Y;  3KYD B;  2IBD A;  1AKH A;  3MVP A;  2XPU A;  3WHC A;  4GRI A;  5FLM J;  3BZ6 A;  4MHG A;  1JKP C;  1D1A A;  1ZLJ A;  4HV6 A;  3IH4 A;  2XF5 A;  3KLO A;  2P6S A;  1T8I A;  3AG3 H;  2NOG A;  4I0B A;  1XSV A;  1ONV A;  3V4G A;  3KP4 A;  2P6T A;  2OU2 A;  3ZN0 A;  4FET A;  3GTM J;  2BV6 A;  1W5T A;  5AIP A;  3R60 A;  3SQN A;  4RDU A;  3K1N A;  5HS9 A;  3H3V K;  1B6A A;  4BUP A;  4YFK F;  2ESN A;  2XC7 A;  4Y17 A;  1U78 A;  2R93 J;  2Y48 A;  2Y31 A;  3FXL A;  3ZPL A;  1FP1 D;  5E20 A;  1FYM A;  2LYC A;  1VQ5 I;  4MNU A;  3VOE A;  2F5C A;  2GA1 A;  3HIF A;  5ED4 A;  2QBY A;  4G8X A;  3BY6 A;  3SXY A;  3TDU C;  2LKX A;  4NC7 A;  2NNN A;  2I8D A;  4A0X A;  2R0Q C;  3S1N J;  2DTZ A;  5GAE J;  5HDN A;  5LHI A;  3DP7 A;  1YS7 A;  5GTH C;  4BQA A;  5D6E A;  4NNJ A;  3H3U A;  2XF6 A;  1A6I A;  2K9M A;  2KRH A;  2R7Q A;  4KIT B;  2V7F A;  2VE9 A;  4M71 A;  3S2W A;  3SFZ A;  2V1U A;  2B9S A;  1JUS A;  1TWC J;  2VJJ A;  2E2I J;  2HOE A;  2L7M P;  5J40 A;  3CMY A;  3K4K A;  4HV5 A;  2BW3 A;  3C1D A;  1ZRF A;  1D0X A;  1WJC A;  5BS6 A;  1SFE A;  3T1B A;  2HZT A;  1SD5 A;  3M07 A;  4RGS A;  3HOZ J;  3PO2 J;  2DOF A;  4EMS A;  3IAM 2;  5CQE A;  3WTZ A;  5IT9 Z;  1TWF J;  4FCY A;  1YRN B;  2O03 A;  1Z7L A;  2LNB A;  4F52 A;  1A31 A;  4XKC A;  3CJR B;  4D9J A;  2L9V A;  2LDU A;  2V4J C;  3O2P E;  4N9I A;  5BOX A;  2MYS A;  2JRM A;  5E3O A;  2EZL A;  3DEE A;  1QPM A;  3CTA A;  1XSD A;  2KJB A;  4FX4 A;  1RUO A;  2XUB A;  1FOX A;  4R8H A;  1ZTR A;  1K4S A;  1Y8R B;  2LK2 A;  4F55 A;  2FOW A;  1E3P A;  5DD8 A;  3PNY A;  1SAN A;  2VBW A;  1XG1 A;  2VN2 A;  1IUF A;  3FXR A;  4PSX A;  3BC8 A;  4C3J J;  2OQG A;  3FZV A;  4RLF A;  3RJP A;  3KLN A;  1IRX A;  2NS7 A;  2DQL A;  2NXN B;  2ELJ A;  1OFC X;  3HGG A;  4LMY A;  3E6B A;  4G7O F;  1XMK A;  3KP3 A;  2M34 A;  1RKT A;  1BR2 A;  1U0J A;  3FIW A;  2HPM A;  2BBY A;  3K2A A;  2H6C A;  3BG6 A;  2CUE A;  4CO8 A;  1Y1W J;  3GW2 A;  3H5A A;  5CYV A;  4UXN A;  2XAJ A;  2LH9 A;  4F91 B;  4WK8 F;  3K70 C;  1MDM B;  1W1W E;  2AQF A;  4KMF A;  4N0B A;  4QSH A;  2QQA A;  3CCQ I;  3H5R A;  1USS A;  2DMT A;  2E36 A;  4XLA A;  4FTH A;  1I1G A;  3HUG B;  3SEZ A;  4BBS J;  3HSE A;  5ICC A;  2O5R A;  5M3M J;  3GFJ A;  1R4M B;  2MGQ A;  4XK4 A;  2XAS A;  1P4X A;  3M1E A;  3Q0W A;  4QIW N;  4PJ0 C;  1ZAR A;  2RQQ A;  3HG9 A;  5D4R A;  2FNA A;  3LA3 A;  4HX8 A;  4L9V A;  3H1C A;  4KIG A;  1JGS A;  1G4D A;  1CF7 B;  3L7W A;  3GFM A;  2A69 F;  3HXL A;  2ME0 A;  2YSR A;  1HKS A;  2V79 A;  1FYK A;  5ILS A;  4S0H B;  3KZY A;  1P2F A;  3FX3 A;  5F64 A;  3OS2 A;  1IN7 A;  1FMV A;  5K5Q A;  3OS1 A;  1SVM A;  3V7S A;  1WH7 A;  4RBO A;  3HOY J;  2Z2S B;  5E79 C;  3BQZ A;  1GT0 C;  4AID A;  5BPD A;  4XNF A;  1APL C;  3ZN1 A;  4DYQ A;  3HOV J;  4M9X A;  3ZMT A;  3CUQ C;  2W7N A;  4LG0 B;  1J5Y A;  1SMY F;  3EET A;  2O8K A;  2ECC A;  5D5W B;  5ILV A;  3DPU A;  4QPQ A;  4HF2 A;  4YEL A;  3L2Q A;  1EH6 A;  2DA5 A;  4GXO A;  4HAM A;  1IXS B;  3FKJ A;  4DJA A;  3PSF A;  4KIC A;  2CYY A;  1TW2 A;  3KET A;  3KP7 A;  4B43 A;  2DCE A;  2I5U A;  1GLN A;  3OY9 A;  4XOR A;  1TWG J;  2Q1Z B;  3PUB A;  3ZMS A;  3SZG A;  1FMW A;  5DCF A;  2IRF G;  3VB2 A;  2QSH X;  4BY7 J;  3W6J B;  4RAZ A;  1LFP A;  1KYZ A;  5H20 A;  4ZDP A;  5DUI A;  2O61 A;  3DV8 A;  4AC0 A;  2UUZ A;  3ZRG A;  4CYC B;  3I56 I;  4HX7 A;  3BPV A;  4ZTF A;  2DMQ A;  2Y75 A;  3WOD F;  1HA8 A;  4GFB A;  4NQW A;  4AD9 A;  1K61 A;  2X9D A;  1X19 A;  1F9N A;  3WTT C;  1Z1D A;  2IVM A;  3FF5 A;  1MMS A;  2JK3 A;  2P81 A;  1DPR A;  2RAE A;  5D5X B;  3WU2 C;  2X0L A;  2W85 A;  4AIH A;  2OQR A;  4ESB A;  4HDV A;  2EIM H;  1Z67 A;  3PO3 J;  1DU6 A;  3I54 A;  3D0S A;  4BBR J;  2RNG A;  4IVN A;  2WAE A;  2VQG A;  3K4N A;  4HDU A;  3OS0 A;  3N05 A;  3OOU A;  3OYJ A;  4XMY A;  4C3H J;  2QM3 A;  3ZQQ A;  1JTY A;  3GWZ A;  3DXJ F;  3Q3S A;  1F1Z A;  4UB6 C;  2CO5 A;  1JGG A;  4YIF A;  2E71 A;  5IYB J;  2XPW A;  2DA6 A;  3ABK H;  2HGC A;  1F5T A;  1ZHF A;  2YUS A;  4NUB A;  3DLA A;  2IEK A;  1X2M A;  2NYX A;  2DA4 A;  4E6K G;  1X4P A;  2NOJ B;  5HNH A;  2FXA A;  1QZE A;  2RGV A;  2LKS A;  1I1S A;  2PMZ A;  1E17 A;  4BU2 A;  2P4W A;  4XKV A;  3RCO A;  1VQP I;  5L3G A;  3H92 A;  4IJA A;  3V7R A;  2A07 F;  1XMX A;  4MQV A;  1YS6 A;  1VQ6 I;  2M5W A;  2QEN A;  3KYC B;  1SFU A;  3GME A;  1SEU A;  4CCL A;  1D0Z A;  3OYF A;  1X1B A;  3DTI A;  3ASN H;  3TOB A;  2Z33 A;  2KP6 A;  3MAJ A;  4HG2 A;  1B9N A;  4PK4 A;  5FFX A;  2KDZ A;  1O3T A;  3HSF A;  4BAY A;  4I01 A;  4BH9 A;  2G9W A;  4BXF A;  1ZGW A;  2V1D A;  2Y9Y A;  4WX9 A;  1AA7 A;  1ZGA A;  2KKO A;  1H89 C;  2KDO A;  2JMW A;  1E2X A;  3H3Z A;  4BDY A;  4NDL A;  4XRM A;  3V42 A;  3CES A;  1GVD A;  1YO5 C;  3OV8 A;  2Z1D A;  1HC8 A;  5LGT A;  4G7H F;  3VEP A;  2VKH A;  3C2B A;  1PUE E;  2QQB A;  2UWM A;  3CME I;  1UB9 A;  4E7Z A;  1HOM A;  1P7I A;  3U2R A;  3JW4 A;  1R5I D;  3B6C A;  2CW0 F;  3W6V A;  2HTS A;  5F04 A;  1EJ9 A;  1HLV A;  3EUH A;  2UXN A;  5E1X A;  1WKM A;  1I5Z A;  4MEY F;  2ME6 A;  1PDN C;  2L01 A;  3FBI B;  1LKX A;  1WJA A;  4D1Q A;  3B6A A;  1BR4 A;  5J1R A;  1N75 A;  3FIS A;  4A5N A;  1TL8 A;  4A3L J;  1JKR C;  4RMN A;  2R5Y A;  5TRD A;  1W36 D;  3P9K A;  4O6J A;  3JAM K;  2VC0 A;  3DBL B;  4I2O A;  1Z91 A;  3ABT A;  2HYF A;  5FKM A;  1RIO H;  3CF2 A;  4LB6 B;  4LLG F;  4GYI A;  1SMT A;  1BI0 A;  3E7L A;  4YII A;  2PEX A;  1ETY A;  4M73 A;  2ICW G;  3A0B C;  3D1N I;  2H09 A;  4L0Z B;  1BA5 A;  2JT1 A;  4WXC A;  1W7P B;  1R7J A;  2L9S A;  3E5Q A;  5EEA A;  1STZ A;  2DI3 A;  1JT0 A;  3VSK A;  2CS3 A;  5B5E C;  2EZK A;  3LSP A;  2VON A;  1JKO C;  3BG5 A;  2X6Y A;  2R7F A;  3OSG A;  4UUV A;  1K7A A;  3BR2 A;  1D0Y A;  1HQC A;  4M6X A;  1MDM A;  1FZP B;  4BE0 A;  3Q5F A;  2VL8 A;  3ISP A;  1X4O A;  1WJ5 A;  3S3O A;  4XSX F;  1IN4 A;  1AU7 A;  3OWT A;  3HUG A;  3R4K A;  2J5O A;  5E8G A;  1V3F A;  3L2C A;  4ENN A;  2OZU A;  1UMQ A;  4GYG A;  2P5V A;  1CQT A;  3I9V 2;  1JJ6 C;  1R5G A;  4CCO A;  4EJW A;  2O9L A;  2V26 A;  1TLH B;  1HW1 A;  5GPC A;  3VYT B;  2CJJ A;  4II3 A;  1LVA A;  4G9Y A;  4HNV A;  2K3F A;  4B47 A;  2ZXI A;  3DLL F;  4H0E A;  1CF7 A;  4CH7 A;  3P9I A;  3REO A;  2DO7 A;  4KT5 C;  1UFM A;  3BOQ A;  1EKE A;  4UVC A;  3QOD A;  2X6X A;  4MTD A;  3P5J A;  5JHF A;  2CQN A;  3JRA A;  4ZZL A;  1HKT A;  3BPX A;  4F92 B;  4CCK A;  1LPQ A;  1HF0 A;  1V55 H;  2XHK A;  2HU9 A;  1UZC A;  3LAP A;  4ZDO A;  4LG0 A;  3K4J A;  1YQA A;  3S8P A;  1VQ7 I;  4BS9 A;  3TP0 A;  3OYN A;  3BCA A;  2KIM A;  2D45 A;  1O3R A;  1MJ9 A;  3HGY A;  5F0C A;  4EM1 A;  1POG A;  5FKL A;  2O7O A;  4BQQ A;  2X85 A;  5J1U A;  2KIF A;  4KYW A;  1Y8Q B;  1R4N B;  3VYS B;  3LOC A;  1WJD A;  4UUT A;  1BR1 A;  1JTX A;  2JPB A;  3K0L A;  3WTV C;  1JE8 A;  3S2H J;  4BHB A;  4CCN A;  1JHF A;  1DGR M;  4EJT A;  3LQR A;  1IO2 A;  2WBM A;  5DEQ A;  1ZQ3 P;  4CYC A;  3BJA A;  4I7H A;  3JRF A;  2LRE A;  1ITY A;  2K9Q A;  2K86 A;  1MMD A;  3WU1 B;  2YU3 A;  4OIN F;  2X6W A;  5A2Q K;  3BP8 A;  2R92 J;  2G0E A;  3CD6 I;  2EFP A;  4JX4 A;  3QOP A;  4A3F J;  1W5S A;  1XGO A;  4DGW B;  1RET A;  2DQR A;  1MMA A;  2MG4 A;  1Z3X A;  2MLK A;  3BTL A;  3J80 Z;  4IEJ A;  3J81 Z;  3HPH A;  3G71 I;  1UCR A;  2L7F P;  1XDU A;  1QHG A;  4C2M J;  4I6Z A;  2K02 A;  1SD4 A;  2DBB A;  3GTL J;  3PNT A;  2FJ1 A;  2IXS A;  4Z6Y A;  2D1H A;  1T2K A;  2IJL A;  4L0Y B;  4A3B J;  2W48 A;  2KHM A;  1ERD A;  1X3Z B;  1TQM A;  2KQR A;  2RRE A;  1MMN A;  5TGT A;  5JI6 A;  4IZZ A;  5J1Y A;  3S3M A;  2D1V A;  2QWW A;  1U5T B;  2MH2 A;  4PJN A;  1TTY A;  1TQI A;  2HVS A;  5M5X J;  3D5L A;  2QVO A;  3CC7 I;  2PJR A;  2MD5 A;  2A05 A;  1Y0N A;  4RB3 C;  2L7Z A;  5JR3 A;  2R7U A;  4I0A A;  1BI2 A;  3WE3 A;  3I4P A;  3L00 A;  1I3A A;  5FD6 A;  2LC2 A;  4AU7 A;  2ACJ A;  2L2O A;  2STW A;  1BM9 A;  1X1D A;  1HDD C;  4D5F A;  1MNM C;  2ZME B;  1QPI A;  1A04 A;  3HTU A;  4UB8 C;  3FBN B;  4EM0 B;  4XBF A;  2XIG A;  4KN4 X;  1JHH A;  3GZN B;  3LSH A;  3OIO A;  4Y3O A;  1S72 I;  2BXZ A;  2GXA A;  4MGR A;  4DZP A;  4JK1 X;  2JQ7 A;  2MBF A;  2DPU A;  1ULY A;  5E3L A;  4Y52 J;  3K1P A;  5J6X A;  1SAU A;  3M4O J;  3S2D J;  3VOD A;  3FM3 A;  4ESF A;  3A03 A;  2JWT A;  5L3F A;  4BJT A;  2IGN A;  3G2B A;  2OBP A;  1OCC H;  4E7H A;  5LD2 C;  5HOO A;  4AM3 A;  4HQE A;  1S3J A;  3GO5 A;  3WTU C;  2FU4 A;  1IRF A;  3W2V A;  4A6E A;  2M7A A;  4BYY A;  1SVO A;  3ZMZ A;  4XKW A;  1FOK A;  4JP0 A;  1P4W A;  2J5P A;  4KNY A;  2VC1 A;  5TJJ A;  3T5X A;  1YG2 A;  2L5Q A;  3GX4 X;  3T8T A;  1EV7 A;  4M6V A;  1TT5 B;  2QEX I;  1BW5 A;  1R1V A;  3QWL A;  3IKT A;  4F7Z A;  2K3P A;  4ASN A;  5HS8 A;  4OIQ F;  4D5C A;  3JRH A;  3L2V A;  2DDB A;  1BIA A;  2EFN A;  1YIO A;  2H94 A;  2GIV A;  1LNW A;  3U9G A;  3K4B A;  3J7Z I;  5DYM A;  4M3D A;  2LY9 A;  2WB1 N;  2TRT A;  1SD6 A;  4D0P A;  3JRG A;  3OIQ A;  3NRV A;  4GCV A;  4KUM A;  4N4N B;  5CKT A;  1DUX C;  1YOV B;  2F2E A;  3FK6 A;  5D8K B;  3KEQ A;  1BOB A;  1ETO A;  3F9K A;  3KP5 A;  4YRV A;  4NQW B;  3FKI J;  2O0Y A;  4HLY A;  1R23 A;  4EV0 A;  1AHD P;  2V9P A;  2ZSI B;  3HSR A;  1XN7 A;  3VSL A;  4ABZ A;  1U8R A;  2BY2 A;  4BQO A;  1W7P A;  2F6C A;  4XOT A;  5K1Y A;  3OYM A;  3CJQ B;  3HC7 A;  4HF1 A;  3H0G J;  1XX5 A;  3CDL A;  3K4L A;  4RS8 A;  2IGO A;  5LLQ A;  3QYB A;  3BTC A;  3ML6 A;  4YG2 F;  3C18 A;  1SD7 A;  4L5J A;  2HVR A;  1FIP A;  4A93 J;  3IH2 A;  4A12 A;  1QQI A;  3BR6 A;  3HOT A;  1R49 A;  2HDW A;  5E3N A;  4ESJ A;  3F0C A;  2AO9 A;  2GM4 A;  2VXZ A;  3BTJ A;  1BBY A;  3HRS A;  1BW6 A;  1LFB A;  2E35 A;  1I50 J;  4HBL A;  2G7U A;  2ECB A;  2ZO4 A;  3I53 A;  2GQQ A;  5BQT A;  1R71 A;  4BJ6 C;  3LA7 A;  4WXH A;  5FGM A;  1K6Y A;  4DOZ A;  2EV6 A;  1R1U A;  3BZK A;  2BEO A;  2CH0 A;  4BGD A;  2VQC A;  1WZ2 A;  4B09 A;  1ETX A;  2PMZ N;  1WI9 A;  1S9H A;  2R7D A;  5L3D A;  5EGO B;  4XM3 A;  3GEZ A;  1H88 C;  4EM2 A;  3RQI A;  1G8X A;  2EB7 A;  1PP7 U;  1S6L A;  2HQA A;  2K9N A;  1ZRD A;  2NRA C;  1X3U A;  2A6T A;  3AFH A;  5DM6 F;  1UG0 A;  2F48 A;  3DKW A;  3TGN A;  3QU3 A;  2DYS H;  2WAQ A;  4YFN F;  1X1C A;  2D2W A;  4IHW A;  4E7S A;  1ZG1 A;  3ESW B;  3QQA A;  2JA8 J;  1G2H A;  1HDP A;  2DLL A;  3A02 A;  3HKZ N;  3SFI A;  1UEL B;  1WI3 A;  2ADU A;  3E5U A;  4MLO A;  2IS1 A;  3CMM A;  2CQ7 A;  3C3W A;  3TOA A;  4QTR A;  1JJ8 C;  3DBH B;  2M2E A;  2RV8 A;  5J8F A;  2COB A;  3CDH A;  4FE4 A;  1UHW A;  4PGG A;  2CUZ A;  5ERI A;  2HWV A;  3BG7 A;  3LWF A;  2EA4 A;  2V6C A;  1KQ9 A;  2M9H A;  3E6M A;  3V8K A;  2STT A;  4II2 A;  3WU0 A;  3QPL A;  3HRT A;  1LDD A;  2KRC A;  3KFW X;  5FJ8 J;  2PFB A;  4BHC A;  5ICE A;  4LGW A;  3CCU I;  1TNS A;  3M1C A;  4PGH A;  3S1M J;  4XLN F;  2NVT J;  1FWZ A;  3ZQI A;  4Y7N J;  4ENM A;  2MW8 A;  5M5Y J;  3A2K A;  1ORK A;  5DDG A;  4AIK A;  2VOP A;  3K4C A;  4IOA F;  2BHZ A;  4NHJ A;  2CQX A;  4IQ4 A;  3JRB A;  2HEO A;  2R7W A;  2DMU A;  2KRF A;  4CXF A;  3IHU A;  5B66 C;  2R5Y B;  2HKX A;  4RAG A;  2NVQ J;  1ETQ A;  4M9S A;  1GHC A;  2XAG A;  2FEZ A;  3HRU A;  4I76 A;  2FSW A;  4KT6 A;  5HDK A;  2V9V A;  2PQ8 A;  3G1L A;  3BR3 A;  1MNE A;  2DOE A;  3TDZ C;  4J19 A;  3WE2 A;  3J7A O;  4RB0 A;  9ANT A;  5C4X J;  2RQP A;  2XVC A;  2ZJ2 A;  3EPZ A;  3VYR B;  1REP C;  2X1D A;  2DFI A;  1U5T A;  1BOA A;  2R7O A;  1BC8 C;  3WGG A;  2HKO A;  2JVG A;  2MC4 A;  3J7A Y;  2HI3 A;  2PX9 A;  3FK7 A;  3ZQ7 A;  2BY0 A;  4U88 A;  3RPQ A;  1H8A C;  4A3K J;  3FMS A;  5E17 F;  2ZJR F;  2NS8 A;  2DYR H;  2XKO A;  3CJT B;  4V2F A;  2UV1 A;  3LA2 A;  3EUA A;  1WGX A;  2R7S A;  2L9N A;  2VOD A;  2ZME A;  1PYV A;  4EEF G;  1BN5 A;  2MAB A;  5D5U B;  1I3Q J;  2DJI A;  2HTJ A;  3S3N A;  1QVU A;  2IA0 A;  3CO6 C;  1YFH A;  3E97 A;  3KIO A;  1V54 H;  1ZRE A;  2CV2 A;  3ELK A;  2HOT A;  2BY3 A;  4JBA A;  2BY1 A;  4CA0 A;  4MIM A;  3MKY B;  4L9N A;  2E1N A;  3MFK A;  4FE7 A;  1MZB A;  3EYI A;  3HYI A;  4Y33 A;  2RN7 A;  3K70 D;  3ZP5 A;  3BR5 A;  2B63 J;  5C44 J;  2CWE A;  4M3E A;  2Y0S A;  4DYR A;  4E7K A;  1RI7 A;  1XC5 A;  2XAH A;  2LRD A;  1RC9 A;  4JYK A;  2DOA A;  5KHD A;  4G6T B;  5C4J J;  2W57 A;  2LY1 A;  4ZC3 A;  2EQR A;  2XV4 S;  1IXC A;  2RC4 A;  5FRN A;  1TC3 C;  4A3M J;  5F1R A;  1YLF A;  1QHH D;  2PLY A;  1W0U A;  4AYB A;  3I59 B;  2VJI A;  1WJF A;  5AIQ A;  1D5V A;  3F72 A;  4F3Q A;  2ZJQ F;  3GUD A;  1R58 A;  3CZ6 A;  1L3L A;  4A3I J;  3ASO H;  4ANJ A;  3K6G A;  1KYW A;  4ITV A;  2FF4 A;  4FIS A;  4GDF A;  1RR8 C;  4CYD A;  2F4M B;  2IW5 A;  1SFO J;  1T95 A;  5FKO A;  2OCC H;  2ZXW H;  1LVK A;  3GLX A;  1J7K A;  1MND A;  4D7M A;  3CCL I;  1DU0 A;  3RDI A;  2FBH A;  5HNF A;  1K83 J;  1OR7 A;  3G1M A;  2DK5 A;  3WHB A;  1KU7 A;  2A68 F;  4TV7 A;  1MJA A;  5LRS A;  3QYE A;  3PUF A;  2ZB9 A;  3O8G A;  1GUU A;  2E1M B;  2WC2 A;  5HVQ C;  1H9G A;  5FD5 A;  2JSC A;  2EH3 A;  2ID6 A;  1V5G A;  3CO7 C;  4P9U A;  5FLX K;  1D8J A;  4UHT A;  1YE9 A;  3W3C A;  4EQQ A;  2EFW A;  5L3B A;  2VKD A;  1YX3 A;  1G6N A;  1TWA J;  3RQ4 A;  2W82 A;  1MH3 A;  4BHP A;  3OYC A;  2TDX A;  1XDS A;  1M1E B;  1S8N A;  1ON1 A;  2HYG D;  5BNG A;  4QLC U;  2H27 A;  2HDC A;  5BPI A;  3AL0 B;  3COA C;  2EFO A;  2CFX A;  3SDG A;  3MZH A;  1NHA A;  4OU0 A;  4O3M A;  2M8E A;  4HX4 A;  4KMU X;  4DNC A;  2IA2 A;  5HLH A;  1XGN A;  3EUH C;  2PJR B;  1GV2 A;  3LSR A;  2EFQ A;  2JA2 A;  2JJ7 A;  3ULQ B;  2RDP A;  2KLO A;  2L0K A;  2VXD A;  1FOY A;  2M0C A;  4RM3 A;  1WH5 A;  2LBF A;  3O6B B;  5CPR B;  1YW8 A;  2V1X A;  4KIF A;  3SZP A;  2E7W A;  4ZH4 F;  3K2Z A;  3WGH A;  1TBX A;  5LRR A;  5KK1 A;  1T0F A;  4XQF A;  2ETH A;  2W24 A;  1U9N A;  4HNT A;  5FKK A;  1R1T A;  5EGO A;  4P55 A;  1O4X A;  5FRM A;  4PSW A;  4XLP F;  3DF8 A;  1ZG5 A;  1EH7 A;  4HQM A;  3J7Y J;  2DTR A;  3FMR A;  3LSK A;  4JX5 A;  3JRC A;  3M3Y J;  4BL0 B;  1IV6 A;  1MBE A;  2XPV A;  2L4M A;  1OCP A;  2CU7 A;  3G1O A;  4G7Z F;  3EYY A;  1OCZ H;  4KDP A;  4JX6 A;  1Z21 A;  4CGZ A;  3BR1 A;  1XB4 A;  2M4G A;  3OL3 A;  5E18 F;  1OCR H;  3B73 A;  4AIJ A;  3X2Q H;  2ZXH A;  1IF1 A;  1HW5 A;  4OIP F;  3IC7 A;  4B4C A;  2WY8 Q;  4P1W A;  2E1C A;  3CDI A;  3MZY A;  1MBJ A;  1E3O C;  2AHQ A;  3AG1 H;  3LSM A;  3E1S A;  4EJU A;  2BHY A;  5DD4 A;  3RKX A;  2DFF A;  4KA4 A;  4G6Q A;  3MEX A;  1XPX A;  2IS2 A;  2DT7 B;  3GZ5 A;  3UR3 C;  4L18 B;  3M9A A;  3WTW C;  4QWQ A;  2F5F A;  1T98 A;  3PIO F;  3RKQ A;  2GBY A;  3N97 A;  2LD5 A;  4R1H A;  3WG9 A;  3H0D A;  3RTR A;  5C3E J;  3FMQ A;  2ISZ A;  2H1K A;  1J0R A;  4PFP A;  2DOD A;  3P7N A;  2Y0M A;  1TZL A;  1Z0X A;  3GVA A;  3TMO A;  4P9F A;  2H1L A;  2KZV A;  2Z9O A;  1Z7U A;  5GPA A;  1LE8 B;  2R5Z B;  4B3X A;  3GZ6 A;  1I6X A;  1HST A;  3V7C A;  3E6C C;  3QU6 A;  4A3J J;  1OMI A;  2JUC A;  3BDD A;  4KJZ A;  3RZD J;  1FIA A;  1X3W B;  2VKE A;  3KP2 A;  2M0M A;  2BOL A;  3BJ6 A;  4RGX A;  3RYR A;  1KZH A;  3UKG A;  1W5C C;  1RNL A;  2R7V A;  3LQQ A;  1TT0 A;  1TWH J;  1RPW A;  2B7E A;  1VQK I;  2XKP A;  1D3Y A;  1V4R A;  3HDD A;  3FXQ A;  2EJR A;  1Z05 A;  5CLS A;  2Y9Z A;  5CJ9 A;  3H9G A;  2VUM J;  3C2H A;  5IY5 H;  3MCZ A;  2DDA A;  3MQ0 A;  1RKW A;  1RES A;  4L9J A;  3ZMD A;  3AG2 H;  5CVU A;  2M87 A;  2MLG A;  1SVL A;  3U1D A;  3M7G A;  2KMU A;  2K5C A;  2HDD A;  4LLN A;  3A0H C;  2CSO A;  1NH3 A;  2MFZ A;  4HF0 A;  3TBI A;  2QKM B;  3T8R A;  3VFZ A;  2N8G A;  4B8X A;  3FDY A;  2HXO A;  2PG4 A;  4XRS A;  2QF7 A;  5IP9 J;  2VBY A;  5IYC J;  5EG0 A;  1GXP A;  2X51 A;  4MEX F;  1BI1 A;  2X48 A;  4XR6 A;  1VQO I;  3HHH A;  4U7D A;  3GTK J;  4UUS A;  5JVG F;  3FM5 A;  3RKY A;  4XIC A;  2JA6 J;  4E7L A;  2M30 A;  3HHG A;  1ETK A;  4UV8 A;  5HOD A;  4R79 A;  5GAH J;  4ZZD A;  2AS5 F;  3FHN A;  2W00 A;  2NVU B;  4WXD A;  3E5X A;  2P7V B; 
#chains in the Genus database with same CATH homology
 2XRL A;  2E2J J;  4XRS G;  1X2N A;  2EZI A;  4MO7 A;  1FTT A;  2NS7 A;  1OFC X;  4M3D A;  2LY9 A;  2WB1 N;  2TRT A;  3HGG A;  3JRG A;  4IHY A;  2M34 A;  3BT9 A;  1RKT A;  3NAU A;  3FIW A;  3FK6 A;  3JR9 A;  1ETO A;  3K2A A;  5M3F J;  2CUE A;  1JKQ C;  1Y1W J;  3FKI J;  3CQZ J;  1LFU P;  4LOC A;  1AHD P;  3Q0V A;  4ABZ A;  3GTQ J;  4QSH A;  2DMT A;  4W1U A;  4FTH A;  3I4N J;  3BTI A;  3H0G J;  3S14 J;  3CDL A;  2E2H J;  4BBS J;  3BG3 A;  4BY1 J;  5M3M J;  1HCR A;  3BTC A;  2MGQ A;  4XK4 A;  1R9T J;  1FIP A;  2LLK A;  3HM5 A;  4A93 J;  3Q0W A;  4QIW N;  3IH2 A;  3BR6 A;  2TCT A;  5E3N A;  3F0C A;  2AO9 A;  2GM4 A;  3BTJ A;  2LTP A;  2ME0 A;  1BW6 A;  1LFB A;  1VI0 A;  4S0H B;  1I50 J;  2ECB A;  2QCO A;  3HOX J;  1WH7 A;  4RBO A;  3HOY J;  3K7A J;  1YRN A;  3BQZ A;  1GT0 C;  2VI6 A;  1IGN A;  1APL C;  2IAI A;  1UG2 A;  2XB0 X;  4DYQ A;  3HOV J;  2DA2 A;  1ETX A;  2PMZ N;  2O8K A;  2ECC A;  2K40 A;  5EGO B;  1H88 C;  2K9S A;  2CRG A;  2HOA A;  3RQI A;  2DA5 A;  3S1R J;  2NVX J;  2K9N A;  5EF6 A;  3IV5 A;  2H8R A;  1JUM A;  2YS9 A;  2GLO A;  1ZKG A;  4IHW A;  4M3B A;  2XB5 A;  1TWG J;  3QQA A;  2JA8 J;  1G2H A;  1HDP A;  1PUF B;  3A02 A;  3HKZ N;  3SFI A;  1WI3 A;  2HOS A;  4MLO A;  5IOY A;  2VPR A;  5J3L A;  2XGC A;  4BY7 J;  4QTR A;  1JJ8 C;  1OCT C;  3GTP J;  2M2E A;  3S1Q J;  3OSF A;  3MN2 A;  5DS9 A;  2COB A;  4FE4 A;  2LR8 A;  3I4M J;  1ETW A;  3JRE A;  4AC0 A;  3S16 J;  4CYC B;  2M9H A;  3BQY A;  2X6O A;  3QPL A;  2DMQ A;  2VKV A;  4GFB A;  5F27 A;  4D7N A;  5FJ8 J;  1K61 A;  2X9D A;  4IHX A;  3LSG A;  2JK3 A;  2P81 A;  2RAE A;  1AKH B;  4BXX J;  3S1M J;  5F08 A;  2NVT J;  3ZQI A;  3NAR A;  4Y7N J;  2MW8 A;  5M5Y J;  1IJW C;  1ORK A;  1IDZ A;  2NVY J;  3MKL A;  4BKX A;  2CQX A;  3PO3 J;  1DU6 A;  4BBR J;  2D5V A;  2DMN A;  4AUX A;  4A69 C;  3A01 A;  3JRB A;  4X6A J;  2DMU A;  3ZQF A;  3HOW J;  2DA1 A;  3OOU A;  3GTJ J;  4B3A A;  1JUP A;  2R5Y B;  3QPS A;  2NVQ J;  1ETQ A;  2XSD C;  4C3H J;  1JTY A;  4DW6 A;  1EF4 A;  2WAQ N;  3Q3S A;  2CQQ A;  1GDT A;  3LSJ A;  4I76 A;  4M3F A;  3S17 J;  1JGG A;  1RR7 A;  5IYB J;  3G1L A;  2XPW A;  3BR3 A;  2DA6 A;  2EBI A;  4J19 A;  3CCY A;  2YUS A;  9ANT A;  1BL0 A;  5C4X J;  2IEK A;  1X2M A;  2DA4 A;  1B72 B;  1FJL A;  3JRD A;  3PM1 A;  3BR0 A;  1FTZ A;  1LE8 A;  2R5Z A;  2HI3 A;  3FK7 A;  3GTG J;  3TP3 A;  4L5E A;  1H8A C;  4A3K J;  1ENH A;  1U9O A;  2ID3 A;  1MBK A;  4A3G J;  1MH4 A;  2NS8 A;  2Y30 A;  2JA5 J;  2DMP A;  4V2F A;  3TW7 A;  1Y1V J;  1WGX A;  4EEF G;  2EZH A;  3IH3 A;  1I3Q J;  3Q0U A;  3HB9 A;  5DTD A;  1QVU A;  1ZR2 A;  2KDZ A;  1S7E A;  1U8B A;  2HOT A;  2HQ5 A;  4MIM A;  5IP6 A;  1ZGW A;  2M8G X;  2Y9Y A;  4FE7 A;  1H89 C;  2OPT A;  2HXI A;  2JMW A;  4NDL A;  4XRM A;  3BR5 A;  2B63 J;  1GVD A;  5C44 J;  4M3E A;  2ELK A;  4DYR A;  1XC5 A;  1JT6 A;  3C2B A;  1NK3 P;  4JYK A;  5C4J J;  5K7H A;  1HOM A;  1P7I A;  1IC8 A;  2EQR A;  1T56 A;  3B6C A;  3W6V A;  5F04 A;  4DZJ A;  1XS9 A;  1TC3 C;  1HLV A;  5IP7 J;  5EDN A;  5E3M A;  2ME6 A;  1Q1V A;  5IOZ A;  2I10 A;  4A3M J;  3HOU J;  4M3G A;  3B6A A;  5J1R A;  3VPR A;  4G12 A;  3FIS A;  1W0U A;  4A3L J;  1JKR C;  2R5Y A;  3JRI A;  3ZQG A;  1VF9 A;  1WCM J;  2L9R A;  2FX0 A;  1MSE C;  5FKM A;  1T33 A;  4A3I J;  2JN6 A;  5FKN A;  3E7L A;  4B1R A;  1ETY A;  2DJN A;  3DCF A;  4X1E A;  3D1N I;  4FIS A;  1BA5 A;  5JLX A;  3ZOB A;  5EEA A;  1JT0 A;  2XGD A;  2Y2Z A;  1SFO J;  3BG9 A;  5FKO A;  1MBG A;  4D7M A;  3LSP A;  2EZK A;  1JKO C;  1DU0 A;  2OF7 A;  3BG5 A;  5F1J A;  1K83 J;  3G1M A;  3WHB A;  3OSG A;  3BR2 A;  2Y0S N;  5IYD J;  3HEF A;  2ZB9 A;  5GP9 A;  3GTO J;  3O8G A;  1D5Y A;  1GUU A;  1ZK8 A;  2EH3 A;  2ID6 A;  2R7Z J;  1AU7 A;  1NK2 P;  5F0H A;  1UMQ A;  1VND A;  1CQT A;  1TWA J;  3HBL A;  1JJ6 C;  1MH3 A;  5F0F A;  2O9L A;  5BNG A;  5GPC A;  1MBF A;  3LNQ A;  2CJJ A;  3SDG A;  4HNV A;  4AYB N;  1NTC A;  1QRY A;  4V2G A;  3TW6 A;  2KT0 A;  1GV2 A;  3LSR A;  2JJ7 A;  1IDY A;  2L0K A;  2M0C A;  1WH5 A;  3SJM A;  2XGE A;  3JRA A;  2LVS A;  1HF0 A;  2HYJ A;  1MSF C;  1IRZ A;  1U9N A;  3GBG A;  5FKK A;  3TP0 A;  5EGO A;  1GV5 A;  1O4X A;  1MBH A;  3HGY A;  5F0C A;  1POG A;  3TED A;  3JRC A;  4JX5 A;  5FKL A;  3M3Y J;  2CUF A;  2O7O A;  1IV6 A;  5J1U A;  4XID A;  1MBE A;  5IPA A;  2XPV A;  1PUF A;  1OCP A;  2CU7 A;  3G1O A;  3S15 J;  2JA7 J;  1B8I B;  2WV1 A;  5JLW A;  3ZQC A;  4JX6 A;  2DN0 A;  3LOC A;  3BR1 A;  3O8H A;  4UUT A;  4MFE A;  1JTX A;  3S2H J;  3L1P A;  4C3I J;  4DYC A;  4A3E J;  3RZO J;  2FD5 A;  4IHV A;  2YU9 J;  5EG0 B;  1ZQ3 P;  2LP0 A;  4CYC A;  4B4C A;  3JRF A;  1ITY A;  1MBJ A;  2K9Q A;  5EZH A;  1X58 A;  1W0T A;  1ETV A;  1E3O C;  3ZQL A;  2AHQ A;  4UUS B;  2R92 J;  2G0E A;  3A01 B;  4JX4 A;  4MFD A;  4A3F J;  4A3D J;  1P7J A;  1RET A;  2IBD A;  1AKH A;  3MVP A;  1WPK A;  2MG4 A;  2XPU A;  3BTL A;  4IEJ A;  3WHC A;  5FLM J;  2MSY A;  1F43 A;  1JKP C;  2L7F P;  1VFC A;  3IH4 A;  4C2M J;  5K7F A;  4I6Z A;  3GTL J;  2NOG A;  2FJ1 A;  3RKQ A;  2GBY A;  2LD5 A;  4A3B J;  2W48 A;  3GTM J;  2E19 A;  1BJZ A;  1FEX A;  3DEW A;  5C3E J;  5J1Y A;  4RDU A;  2H1K A;  3H3V K;  1Z0X A;  4W97 A;  1U78 A;  2R93 J;  2Y31 A;  5GPA A;  5M5X J;  1LE8 B;  2R5Z B;  4A3C J;  4A3J J;  2L7Z A;  5EYR A;  3RZD J;  1FIA A;  2VKE A;  1B72 A;  2LKX A;  5M5W J;  3UKG A;  2R0Q C;  3S1N J;  2DTZ A;  1HDD C;  4D5F A;  1MNM C;  1QPI A;  1TWH J;  1RPW A;  1I6H J;  3HDD A;  2Y9Z A;  1A5J A;  3OIO A;  5K7Z A;  2FQ4 A;  1A6I A;  2LFB A;  2VUM J;  4DZP A;  1RKW A;  1RES A;  1JUS A;  1TWC J;  3ZQH A;  2E2I J;  2L7M P;  5E3L A;  3CMY A;  4Y52 J;  1Z77 A;  5EZG A;  3M4O J;  3S2D J;  1B8I A;  2HDD A;  3HOZ J;  3PO2 J;  1TWF J;  1QVT A;  4FCY A;  3A03 A;  2JWT A;  1IG7 A;  2N8G A;  1YRN B;  1F36 A;  2HXO A;  4XRS A;  2QF7 A;  5IP9 J;  1OJL A;  2DA7 A;  5IYC J;  5EG0 A;  2DA3 A;  2X48 A;  5E3O A;  3GTK J;  4JP0 A;  4UUS A;  2EZL A;  5FLV A;  1UHS A;  2E1O A;  4XIC A;  1ZR4 A;  2JA6 J;  1ZTR A;  1ETK A;  5HOD A;  2LK2 A;  4M6V A;  1SAN A;  1XG1 A;  1BW5 A;  1IUF A;  4D5C A;  3JRH A;  4C3J J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...