1TBXA

Crystal structure of ssv1 f-93
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
94
structure length
94
Chain Sequence
b'STPFFYPEAIVLAYLYDNEGIATYDLYKKVNAEFPMSTATFYDAKKFLIQEGFVKERQERGEKRLYLTEKGKLFAISLKTAIETYKQIKKRHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical 11.0 kDa protein
publication title Crystal structure of F-93 from Sulfolobus spindle-shaped virus 1, a winged-helix DNA binding protein.
pubmed doi rcsb
source organism Sulfolobus virus 1
molecule tags Viral protein
total genus 33
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1tbxA00
4Q48A 3C7JA 2Z9OA 1ZG5A 2F2EA 3FM5A 4N9HA 1FYLA 4ZYDA 4I98B 3GO5A 1IRFA 2H6CA 3MCZA 1WWXA 1YS7A 4L9NA 3TQNA 1UHMA 3JSOA 2M8EA 5D5UB 5LRSA 2KJBA 1F9NA 3QPTA 3CDHA 4R79A 4RB1A 4MQVA 3NEUA 2QWWA 2ZO4A 3U2RA 4H0EA 2GA1A 3KP2A 3PFIA 3FX3A 4MTEA 4LGWA 5E20A 2MA3A 2EA2A 4EMSA 3MEXA 1U5TA 3SHFA 1I1SA 4NHJA 3QU3A 4HAMA 5E1ZB 5DUKA 3WU0A 5BQTA 1KQ8A 2P7VB 1EH6A 5ICEA 1YO5C 2V1XA 3V8LA 4KA4A 1YYVA 1XCBA 2HZTA 1U5TB 1KU7A 1IN6A 4ZZLA 2GA2A 4A2UA 1I5ZA 5CVIA 2OA4A 2FE3A 5HLIA 1CF7A 5J8CA 1GXQA 3GFIA 2DK5A 2FBHA 3I54A 3ERED 1RUOA 2OBPA 4CXFA 5D6FA 1TBXA 5LEKA 3K1PA 4JBAA 1QNTA 1OYIA 1BI3A 2GQQA 3HUGA 3TGNA 5L3EA 1S8NA 1CF7B 3BROA 5AIQA 2JPBA 3LA2A 4XSXF 2EFPA 2GZWA 2OD5A 3GFLA 5DEQA 4UXNA 4EV0A 4AD9A 1D3YA 4EJUA 5IT9K 2NAZA 2L4AA 2G7UA 1YS6A 3TO7A 3V7RA 3WTTC 3M8EA 4UNOA 3E6DA 4YG2F 3TDUC 3J81K 4UVBA 2VXZA 4OU0A 1I1GA 2OU2A 3I71A 3R60A 2DTRA 1MGTA 3MZYA 3WTWC 1P92A 2VE8A 2CW0F 3P9KA 3HHGA 4CZZA 4EM0B 4MTDA 2HYGD 2DPDA 3ROUA 2A07F 1F4KA 4EGZA 5D6EA 2A6EF 3VODA 4NQWA 4ON0A 3N97A 1L0OC 4CO8A 3HRMA 4KIFA 4AIHA 5E18F 4L9VA 4UHTA 2CG4A 3V7SA 2ZMEA 1XMAA 5HS7A 1TQPA 2FBIA 1UCRA 3QPHA 3RYRA 2XV4S 2R7FA 2M1BA 5ERIA 2EV5A 2CO5A 2EFWA 5BPDA 2OZUA 2ZMEB 4G6QA 2QQ9A 3C18A 4HX8A 4S05A 1PP7U 3E5XA 3DPTA 2UXXA 3K1MA 2L02A 3E97A 2VBZA 2NNYA 4IRHA 1O3SA 1BC8C 4I7HA 2KIFA 3BJ6A 4RS8A 4EJWA 2HYFA 4YFKF 2M5WA 4I2OA 1ZRFA 4Y13A 4K2EA 4CICA 3ZMDA 4A0ZA 3KLNA 2V1DA 2JTVA 5HDNA 2PEXA 1W7PA 2EWNA 4RAZA 5D5VB 1GVJA 2IA1A 3LSTA 2L3DA 1IAWA 1XSXA 2W57A 2A5YB 3BOQA 4M71A 1LEAA 2CYYA 3Q9VA 2DFIA 4ENJA 1R1TA 1J7KA 2O6GE 2A61A 4ESJA 1LVAA 2W84A 4JK1X 2PI0A 4XRFA 3GZ6A 2VC0A 4IHTA 1S6LA 3JTGA 1O7FA 3DKWA 4RB0A 1D5VA 4OIQF 1YLFA 1B4AA 3QP6A 3WE2A 3FM3A 4L0ZB 4N9IA 1IXRC 2RN7A 2JRTA 3LA3A 2XAQA 3RI4A 2K4BA 4QWQA 3WTYC 1XSVA 3J80Z 3BWGA 5FD6A 1HXDA 4FT8A 4HF2A 4KICA 3GUDA 5E1XA 4WF2A 3T5XA 2HDCA 2P4WA 4P9UA 2P5VA 1HW5A 5FLXZ 2CSOA 2LKPA 3PQJA 1ZG3A 1FP2A 4KNYA 4M72A 1FOKA 3M8FA 1L3LA 3P9IA 1FX7A 5D4SA 4KMUX 2ZCWA 2XRNA 4A0YA 2OAZA 2M87A 1R00A 3FZVA 2MLGA 1P6RA 3FXQA 4OINF 4LLLA 4BHPA 4B09A 3M1EA 4HV6A 1ZN2A 3ECOA 2RNJA 2GAUA 1J75A 3FMRA 3LQQA 2FEZA 2CQKA 1OKRA 2C6YA 1J2XA 4P55A 3L9FA 2H27A 3O6BB 1LJ9A 5AIPA 5DUIA 5K5RA 4GCVA 1TNSA 5HS8A 1RI7A 5LLQA 1BC7C 5KVRA 3WTSC 3HHHA 4UV9A 6PAXA 2ZXJA 1OYYA 2Y75A 5EEHA 2X4HA 1XMKA 1K6OA 1JE8A 1TLHB 1G4DA 3H3ZA 2ZNYA 2DT5A 3FXRA 1S29A 4JQFA 3EQLF 5J6XA 3SFZA 4PGHA 1ZH5A 2BBYA 2QZ8A 4YFNF 3KZZA 2NRAC 1Z6RA 4L9TA 1YW7A 1IZ1A 1SFEA 5LGTA 5HLGA 2IA2A 1LB2A 4CGZA 1XD7A 1XGOA 3EETA 1R23A 1FBSA 4KT5C 3VOEA 3DPLC 1IUYA 4DQ2A 3F8MA 1YQAA 5CLSA 5CVRA 1ZHFA 3CUQC 2H94A 1BJAA 5F6FA 4M9ZA 2MD5A 1BOAA 1FBUA 2HS5A 2NNNA 4ETSA 2XHKA 2DI3A 1HSJA 2VBYA 2GXBA 2MBFA 4HQMA 2F5CA 1RIOH 5LBQA 1T38A 1H9GA 2QYOA 3SXYA 3JTHA 1B9MA 1FYKA 4RGSA 1FZPB 3P7NA 3ML6A 2M30A 3I58A 1T2KA 2FRHA 4HX4A 1DPRA 1ZLJA 4RAYA 2IRFG 3EYIA 4KN7X 2MLKA 5L3GA 1SAXA 1U5TC 1MJBA 3WU1B 3F23A 1P4WA 5A2QK 5CVVA 1B59A 2RGVA 1SD7A 3GF2A 4FX4A 1FSEA 4OIOF 3LQRA 2DBBA 4HW0A 4HQEA 3CUQB 3FXUA 1DP7P 1LDDA 3WTUC 1STZA 4Q5SF 1R1UA 1SFUA 1BN5A 3KEOA 2QQBA 4IF4A 4ESFA 4QLCU 2KRFA 3E6BA 5FFZA 2FNPA 4I0BA 5TRDA 1XGMA 4P9FA 4LB6B 3KP6A 1HQCA 4OIPF 4Q47A 2PN6A 4ENMA 3QOPA 2OQGA 3CJNA 3O3KA 1Y0UA 3IKTA 2EV0A 4HBLA 3I53A 1HKSA 3O2PE 3KLOA 2IP2A 3JAMZ 5J8FA 1Q1HA 1LEBA 1EH7A 4L5JA 1H0MA 1IXSB 4PCQA 1ZRDA 1XDSA 1YG2A 3IL2A 1HKTA 4HDVA 2D45A 4RGRA 4EM2A 4IPAA 3CUOA 4LB5A 1ZYRF 5FFXA 1P4XA 2KKOA 1SD5A 4AWXB 1FYMA 3VFZA 2FXAA 2FMYA 4EGYA 2P5KA 2QBYA 1XDUA 3S2WA 2HR3A 1FLIA 2JT1A 2FSWA 1KQ0A 4KDPA 3OOPA 3KFWX 3T8TA 1HKQA 2IVMA 3ZMSA 5D4RA 1J9IA 4IVNA 3WODF 2AXLA 3GXOA 4BNCA 3HSFA 1NHAA 5DCFA 2PLYA 1DPUA 3HRSA 3K69A 1TTYA 3ZPLA 3MAJA 3P9CA 5HDKA 1O7LA 4RB3C 2YR2A 3HIFA 2OQRA 2BV6A 4U7BA 4L5IA 1Z7UA 2P5LC 2HEOA 1HW2A 4XBFA 3HSEA 2YU3A 4ZYGA 2ESNA 4UV8A 1B6AA 1VTNC 1USSA 4YIFA 1YTYA 3CTAA 4LD5A 3FMSA 2XUBA 1XN7A 1WQ2A 3DQVC 2P6TA 2TDXA 4EJOA 3F8CA 3BJAA 3TOBA 5HDGA 3EYYA 4U0WA 2LF8A 2DO7A 1KA8A 3BPXA 2XVCA 3BJOA 1MJ9A 2FBKA 5FGMA 2E7XA 3LAJA 3V8KA 3ELKA 1QGPA 2VE9A 3HTUA 1JGSA 4L9JA 2STWA 4G7HF 3GWZA 1WSUA 1XSDA 3F21A 4GYIA 3MQ0A 1JXSA 4G94A 5DD8A 4KFCA 1PP8F 2VBXA 2ZKZA 3FHZA 3GZ5A 1MJAA 3FWEA 3WGHA 4P96A 4Q4ZF 2K4JA 2CWEA 4PGGA 3BZ6A 3LFKA 3BY6A 3TO9A 1BI0A 1XCVA 1W7PB 5FB2A 4A5MA 1W5TA 3K9TA 4GYGA 1K79A 5HLHA 1HSTA 5L3DA 2QENA 1S3JA 5AONA 1SD4A 5LHIA 2STTA 2FQ3A 3GW2A 4BAYA 5DYMA 3IRRA 3U9GA 1QBJA 2AS5F 2UWMA 1CGPA 1B1BA 4WXHA 4IJAA 1I27A 4MHGA 3JSPA 3VEPA 3EUHA 2YX7A 2O3FA 2J5OA 2ZBKA 2D1HA 2R3SA 4CDGA 3GVAA 2EJRA 2HQRA 3GFJA 5FD5A 1FP1D 1FY7A 4FX0A 4M74A 1Z6TA 2COMA 2EFQA 3TO6A 3Q5FA 2HWVA 4RGUA 2Q8KA 1W7PD 2Q2EA 2D1VA 2EFOA 4MQ9F 5L3BA 4G9YA 2PJPA 4M6YA 1DDNA 3E6MA 3ZMUA 5ICFA 4O6JA 4I01A 3DV8A 5DCMA 3SZTA 5HOOA 2O0YA 4ENKA 2EV6A 1Z91A 3B02A 1ZAOA 4M6XA 2K7LA 3ABUA 2LDUA 1J59A 5ILVA 2XROA 4XLNF 4ASNA 2EK5A 1HW1A 3F6OA 5DCMB 3WTZA 2KIMA 1H9TA 2FOKA 3F8NA 4PDKA 2A68F 3ZN1A 1W4MA 2XASA 4WXDA 1T98A 3RKWA 3I64A 2XAJA 4WXCA 5LGNA 2RVCA 2FMLA 2EA4A 1F1ZA 4ZH4F 4HV5A 1BIAA 5L3FA 5ICGA 2LF7A 3R4KA 4HYEA 1X3UA 3M9AA 3NRVA 3U1DA 1FPQA 4MNUA 2XAGA 1W5SA 2WWYA 2YX4A 4G7ZF 2JZYA 4O5VA 5D5WB 2ZNZA 2RDPA 1IN7A 1BBYA 4AVPA 2XAHA 2HQNA 4U7DA 2W25A 1SMTA 5IT9Z 1MZBA 2ESHA 4UVAA 1R7JA 1FSHA 5EEGA 2EB7A 2XGXA 2HKOA 2Y0MA 3TDZC 3Q9SA 2XKPA 3KP4A 3B73A 4S04A 2QVOA 3J81Z 3L00A 2FNAA 1LNWA 1MKMA 2P7CB 2XIGA 3WG9A 3MFKA 3W6JB 3J7AO 3GLXA 2VONA 3C3WA 2ZJ2A 1ZG1A 4ZYEA 1QO0D 3RIRA 3OV8A 5L3CA 1ON1A 1ODDA 3REOA 1R1VA 3I5UA 4ENNA 5JFRA 1TNTA 3HSRA 5DDGA 4L0YB 3ZN0A 2LSOA 3H92A 1FT9A 2BYVE 1R5GA 4M9SA 2JSCA 5ICCA 5E17F 1ZGAA 2BEOA 3WGGA 2HKXA 5H6QA 3MWMA 1QZYA 4A0XA 3R0AA 1U2WA 2DQRA 1P2FA 2WTEA 5LEJA 2YPRA 2BE5F 3ECHA 2P6SA 4FHTA 2DQLA 4OOIA 1KGSA 4G6DA 2IW5A 4GO1A 3RKXA 1IF1A 4HZFA 4LJZF 1TQMA 2W85A 2VT2A 1T6SA 3VB2A 4E70A 5K1YA 2XAFA 3ZP5A 1HBXG 5CVUA 2D2WA 3K2ZA 1O3TA 1E17A 1IN5A 1WRJA 2CGPA 1ULYA 2O61A 2O8XA 5JVTA 3J80K 2IT0A 5K5OA 1R36A 3ISPA 3V8JA 3KP5A 2X0LA 4OIRF 1C0WA 2G9WA 5E8IA 3D0SA 3BPVA 2HOEA 4M73A 1K78A 3LA7A 3TOAA 2A3SA 3IHUA 2E1CA 2NYXA 5FLXK 2NS0A 1BIBA 3DFGA 1PUEE 2FA5A 1U6GA 4L18B 4F7ZA 3KE2A 4BH9A 2R7DA 5DV5A 1ZGJA 1K78B 2ACJA 1ON2A 1LDKB 1XGNA 1IN4A 3DP7A 5LHGA 2B0LA 1MDMA 2FF4A 4MEXF 4KN4X 2K86A 4HLXA 1O3RA 2F5FA 2RQPA 3T1BA 3WTXC 4BHCA 2PQ8A 5JHUA 4LMYA 3E3VA 1D8KA 3F72A 5CVJA 3ZMTA 3CO6C 3RJPA 1J5YA 4O3MA 1MDMB 5D8LB 1LQ1A 1G3YA 5ILUA 1FBQA 2JPCA 1JHHA 3F8BA 4HDUA 2V1UA 3N4MA 3ABTA 2VOPA 3MZHA 2QBYB 1SD6A 2IPQX 3R6SA 4IRGA 3M7GA 5BMZA 3RYPA 5ED4A 2IA0A 3E5UA 3LAPA 5HVQC 4TV7A 2DK8A 3CLOA 3V4GA 3EDPA 4EQQA 2G7HA 4AIJA 2PMHA 5H20A 3F8FA 2Z33A 4MEYF 1ZREA 2IJLA 1G3WA 3KZYA 5JR3A 3RPUA 3G3ZA 2MC3A 2OZ6A 1FNNA 3SQNA 2PMUA 1R58A 1OYWA 3HRTA 2ELHA 3QAHA 5KK1A 1T39A 4UUVA 3R0JA 4OMYA 1YW8A 2KJCA 1P4AA 4XSZF 2UZKA 3HRUA 1MD0A 1AWCA 3ZMVA 3QRFF 4BXUA 1V3FA 4LK1F 1YFHA 5CJ9A 3C1DA 1XGSA 1OR7A 3T8RA 1G3TA 2EFNA 2E7WA 5LGUA 2PBIA 4LLGF 1ZLKA 4N0BA 1I6XA 2PG4A 2GIVA 3K0LA 3E5QA 2A69F 1Z9CA 2K27A 3AAFA 4I02A 2QQAA 2M45A 2DLLA 1RZ4A 1BI1A 3G73A 1UFMA 3F22A 2A6HF 4Y15A 3ULQB 4BHBA 2PFBA 2HGCA 3ZQ7A 2WC2A 3KP7A 1FC3A 4EJVA 3COAC 3R61A 1G6NA 2V79A 3DXJF 1PDNC 3E6CC 3BP8A 5CYVA 4A6EA 1KU9A 5JI6A 3BDDA 4RB2C 1RNLA 3KP3A 3DEUA 4LK0F 4XLPF 1BM9A 1ZRCA 3HOTA 2ISYA 5D8KB 3T0YA 3I4PA 3WE3A 3IRQA 4IXAA 3HOSA 1G3SA 2DW4A 5D5XB 2H09A 1IN8A 1WI9A 2F5DA 1E2XA 2DPUA 2MH9A 1EH8A 4ZYHA 4A5NA 4HF1A 1TQIA 4RGXA 4AIKA 3PQKA 3GX4X 4KIGA 4ZZDA 1IW7F 3I0TA 4DNCA 1GXPA 1TW3A 2WV0A 4HF0A 3I59A 1IRGA 3W6KB 2LNBA 4HA8A 4ESBA 1BI2A 4U88A 1YIOA 2XKOA 2GWRA 2ADUA 1KU2A 5FO5A 2UXNA 3IC7A 1OPCA 2V9VA 2HTJA 3JAMK 2E1NA 2ETHA 2W24A 4LG0A 3I59B 2Q0OA 3RTRA 5A2QZ 4HOBA 1KQ9A 3F3XA 2CFXA 3LWFA 2Z3YA 2P8TA 3DF8A 4LLNA 3QP5A 4Y17A 4R1HA 4LG0B 3FF5A 1QPMA 1R22A 4BQAA 3K1NA 4D0PA 1YW9A 1QZZA 3L2CA 1S7AA 3GYHX 4HLYA 5F64A 2H6BA 1SFXA 1GHCA 2YSRA 1IXCA 4HX7A 2VN2A 3IWZA 5BPIA 1A04A 1KYWA 5K5QA 4GXOA 4KIBA 4IHSA 5ILSA 4YFXF 1OMIA 3FMQA 3H3UA 2K02A 4R8HA 3L7WA 4OMZA 3HTSB 4LFUA 4UVCA 2Z99A 1SMYF 3SZPA 2BGCA 1UB9A 4BYYA 4CHUA 3F6VA 4WCGA 5LRRA 1U78A 3IKVA 2HFHA 3KEQA 2VT3A 1XB4A 2DAOA 1KU3A 4WX9A 3KCCA 2Y48A 4EJTA 5E1WA 5IT3A 4EM1A 3QU6A 2L01A 3RKYA 3JW4A 1UHWA 4M9XA 1LDJA 5E8GA 4P5OA 1O57A 1T0FA 5LHHA 2VC1A 3KETA 2QUFA 3GFMA 2L54A 1K7AA 4IRIA 2VOOA 3L09A 2HTSA 4YIIA 2DU9A 1U8RA 1QQIA 2VBWA 1U3EM 4KYWA 4A6DA 5DD4A 1REPC 2GXGA 5HS9A 2QLZA 4MGRA 1KYZA 2FU4A 2J5PA 1ZARA 4WK8F 3ZMZA 4EVIA 1TW2A 4I09A 1V4RA 3V7CA 3WGIA 1J0RA 4B8XA 1R5HA 4G8XA 1B9NA 3RDIA 2ZFWA 1AOYA 1Z1DA 1ONVA 3CO7C 5F1RA 1FWZA 1O3QA 2L4MA 3RPQA 5H6RA 2O03A 4NB5A 5TJJA 4WWCA 4G7OF 1DUXC 4PZJA 4KUMA 4U0VA 1JHFA 2MH2A 2RKHA 2V6CA 3IWFA 1RUNA 5BOXA 1F5TA 2RV8A 2RC4A 1EV7A 5BS6A 3WTVC 1USTA 4KMFA 2VODA 2F5EA 2QM3A 1Z05A 2KIUA 3GEZA 4I0AA 3HYIA 2Z5UA 3NQOA 4Z2YA 4A12A 1D8JA 3D5LA 2ISZA 4CYDA 1S7OA 4GGGA 3TKYA 3CUQA 4U0YA 1WKMA
chains in the Genus database with same CATH superfamily
3W3CA 3BTIA 1MBGA 4JYKA 4Q48A 3C7JA 2Z9OA 5C4JJ 1ZG5A 5EEAA 2F2EA 2HOAA 3FM5A 4A3CJ 2ECCA 4N9HA 1FYLA 3OS1A 4ZYDA 1G8XA 3I4MJ 4I98B 3GO5A 1TWHJ 1IRFA 2H6CA 1WZ2A 3MKZA 3MCZA 5M5WJ 1WWXA 2WAQN 3L2UA 3JRBA 1W0TA 2P81A 2NVUB 1YS7A 4L9NA 2M7BA 3PFYA 3TQNA 1UHMA 3JSOA 3NAUA 2A6TA 2M8EA 5D5UB 4CCLA 1WJ5A 4PJJA 1TP4A 3OY9A 5LRSA 2VQCA 5JLXA 1Y56A 1IV8A 2KJBA 3K7AJ 1F9NA 3QPTA 3CDHA 4R79A 5EDNA 1D1AA 1V5FA 5DM7F 2HOTA 4RB1A 1AHDP 1EA3A 3CMMA 3M07A 4MQVA 3NEUA 2QWWA 2ZO4A 3U2RA 2QGUA 2XF6A 2GA1A 3KP2A 3PFIA 3FX3A 3KEYA 4H0EA 3K10A 4MTEA 4LGWA 2HVQA 5E20A 2R7ZJ 2MA3A 3OS0A 1JKQC 3S93A 2EA2A 1X1AA 1D0XA 3OMYA 4EMSA 2R7SA 2ZXHA 3OSGA 4RAFA 3HPGA 3MEXA 1U5TA 5IOZA 1WJFA 3M4OJ 3A03A 3SHFA 1I1SA 4W1UA 4NHJA 3NWSA 3QU3A 4HAMA 3CMYA 5E1ZB 5DUKA 4D1QA 1AKHA 3WU0A 1MNEA 5BQTA 2R92J 1Y1VJ 1KQ8A 2P7VB 1EH6A 4XKWA 5ICEA 1HCRA 3K4NA 2MG4A 2IS6A 1YO5C 2V1XA 4D5CA 3V8LA 3LSPA 1BW5A 1Y1WJ 4KA4A 1YYVA 3QYBA 1XCBA 3FBIB 2HZTA 1U5TB 1KU7A 1IN6A 3OYKA 4ZZLA 2GA2A 4A2UA 1I5ZA 5CVIA 2OA4A 3FIWA 4EEFG 2FE3A 3CCSI 5HLIA 4BGDA 1MBJA 1CF7A 4FCYA 5J8CA 1GXQA 3GFIA 2XPWA 2DK5A 2FBHA 3I54A 2IEKA 3ERED 1RUOA 5M5YJ 2OBPA 2E35A 3BLYA 3HM5A 4CXFA 5D6FA 1TBXA 5LEKA 1HDPA 3K1PA 3D5SC 4JBAA 1QNTA 1OYIA 4BEHA 4IOCF 1BI3A 4V19K 2GQQA 4ZDLA 3ZXSA 2V6EA 4NC6A 3HUGA 3TGNA 5L3EA 1S8NA 2CUFA 3S16J 1CF7B 3BROA 5AIQA 2JPBA 2VKEA 3LA2A 3BZKA 4XSXF 4YEJA 2EFPA 2GZWA 2LG4A 4A69C 1VQNI 2DMPA 3HC7A 3S1QJ 2OD5A 1X1CA 3BTLA 3GFLA 1OR7C 5DEQA 4UXNA 5HLTA 4EV0A 2GBYA 1APLC 1A5JA 2DODA 1V54H 4AD9A 1D3YA 4BEHB 4EJUA 2NAZA 5IT9K 1F43A 2L4AA 2XSJC 1R6RA 2G7UA 3IH3A 4HSTA 5FRNA 3MN2A 2WY8Q 5E3NA 1YS6A 1RKWA 5GP9A 3TO7A 4BL0B 3V7RA 3L2VA 4D5FA 4A3IJ 3WTTC 2HYJA 3M8EA 4UNOA 1JTYA 3E6DA 4YG2F 3TDUC 3J81K 4UVBA 3CJRB 2VXZA 4OU0A 1I1GA 1BOBA 2OU2A 3I71A 2KT0A 2DTRA 3R60A 1ETQA 1MGTA 3MZYA 5C44J 3WTWC 5LFAA 1P92A 2VE8A 2CW0F 3P9KA 3HHGA 4CZZA 2L7KA 4EM0B 4MTDA 1OCZH 2HU9A 3A1YA 2JRMA 2HYGD 3S8PA 2DPDA 3ROUA 2A07F 1F4KA 1J09A 2TRTA 5EYRA 4CUGA 3NWTA 4EGZA 4AUXA 1XG1A 5D6EA 2A6EF 3VODA 4NQWA 4ON0A 3N97A 2W4SA 1L0OC 4CO8A 3HRMA 4XLAA 4KIFA 2EZHA 4AIHA 1JT6A 4L9VA 5E18F 2DT7B 4C3IJ 2IS4A 3QPSA 4UHTA 4KITB 2MGQA 2CG4A 1VNDA 3V7SA 4XMYA 2M7AA 4LOCA 2ZMEA 1JI8A 1XMAA 5HS7A 3CF2A 1VQ8I 2R0QC 1TQPA 2KMUA 2I8DA 1LKXA 2HVRA 2VASA 2F6CA 2FBIA 3PUBA 1UCRA 3QPHA 2L9NA 3RYRA 3GTLJ 1HDDC 2XV4S 1ZK8A 2R7FA 4NQWB 4FE4A 2M1BA 2ZJQF 5ERIA 2XDVA 1UHSA 1UMQA 3OYEA 2VKHA 1H88C 2EV5A 2X9DA 2CO5A 2EFWA 2BOLA 5BPDA 4F91B 2OZUA 1IDYA 2G0EA 2ZMEB 3JRIA 4G6QA 2QQ9A 3C18A 4MIMA 4HX8A 2UUZA 2RAEA 4S05A 3EUAA 4DBRA 1PP7U 2B7EA 3E5XA 3DPTA 3MKYB 1QZEA 1WPKA 2UXXA 3VDXA 3K1MA 1SANA 2L02A 1Z67A 3E97A 1FMVA 2XF7A 2VBZA 2NNYA 1R4NB 2KPMA 1MBFA 4IRHA 3A2KA 1O3SA 1OCRH 3VYUB 1BC8C 4I7HA 5KAIC 5BNGA 3AL0B 2FX0A 2KIFA 1ETKA 4MO7A 1X1BA 3BJ6A 3H5AA 4RS8A 4EJWA 2EILH 2HYFA 3PL8A 4YFKF 2M5WA 4I2OA 3FHNA 1ZRFA 3DBHB 1X4PA 2JMWA 4Y13A 4K2EA 4CICA 1YX3A 3ZMDA 4A0ZA 3KLNA 2V1DA 2JA6J 2O7OA 3LSMA 2JTVA 3RSNA 3SEZA 4I99C 5HDNA 2PEXA 1W7PA 2EWNA 4RAZA 5D5VB 2LFBA 5J1RA 2UV1A 2CV2A 1GVJA 3AKZA 2IA1A 3W6VA 2MABA 2L3DA 3LSTA 3ZCOA 1IAWA 2E2JJ 1XSXA 2W57A 2R7QA 2E19A 4RBOA 2A5YB 3BOQA 4M71A 1LEAA 5GAGJ 3HL2A 5FLVA 2CYYA 1VQKI 3Q9VA 4CCKA 2DFIA 4ENJA 4E7JA 1R1TA 1J7KA 2QKMB 2O6GE 3HOWJ 2A61A 3A02A 1LE8B 1H8AC 3PJRA 3ONQA 1TWAJ 3G1LA 2IAIA 1LVAA 2W84A 2KDZA 4ESJA 4JK1X 2PI0A 3CDLA 4XRFA 5B1BH 2V26A 3GZ6A 1WI3A 3C2BA 2DYRH 2CW7A 3ASNH 5JVGF 1TC3C 2VC0A 4ABZA 5E3OA 3H9QA 4C9YA 4FASD 4IHTA 2DA4A 1S6LA 3SYTA 3JTGA 5J40A 2IS1A 1O7FA 3DKWA 4DBQA 2IXSA 4RB0A 2ID3A 2JA2A 1D5VA 4OIQF 1YLFA 2JUGA 2X6XA 1B4AA 3QP6A 1IJWC 1IC8A 3WE2A 3FM3A 4L0ZB 4N9IA 1ETYA 2BW3A 1IXRC 5E3MA 2RN7A 2JRTA 3VYRB 3LA3A 4BKXA 1Y8QB 3S3MA 2XAQA 5FKNA 5KHDA 5HODA 2HI3A 3RI4A 4XN0A 1WFXA 2WAQA 2K4BA 2CMPA 4QWQA 3WTYC 2KL4A 1XSVA 3BC8A 5F0HA 2E1MB 4IHWA 3J80Z 3BWGA 4XLFA 3K4LA 5FD6A 1HXDA 5EZHA 3HGYA 1KZHA 4FT8A 5C4XJ 4HF2A 4KICA 1W0UA 3BR6A 3GUDA 5CKTA 4F92B 2DT6A 1I3QJ 3S3NA 1YX5A 1Z0XA 5E1XA 4E4HA 3PIPF 1OCTC 1T33A 3F0CA 4WF2A 3T5XA 5FKKA 2HDCA 2P4WA 3S3OA 2PJRA 4P9UA 2P5VA 3Q0VA 1HW5A 1XX5A 5FLXZ 2CSOA 3BR2A 2R5ZA 4JOMA 2LKPA 3PQJA 3GTPJ 1ZG3A 3OYGA 5DM6F 3CC7I 1FP2A 3AG1H 2EZKA 4KNYA 4M72A 1T0FC 2L7FP 1HOMA 3DTIA 2MSYA 1FOKA 1NTCA 1PJRA 1QVUA 3M8FA 3HKZN 4XQFA 1EF4A 2PJRB 4A3GJ 4PFOA 1L3LA 3CLQA 3P9IA 1FX7A 5D4SA 3OYJA 2AHQA 2R5ZB 2ELKA 3FXJA 4KMUX 1FIPA 4E7KA 2ZCWA 2XRNA 2ID6A 4A0YA 2XAUA 2OAZA 2M87A 4XKBA 1R00A 3FZVA 2VL8A 2MLGA 1P6RA 1ZGWA 3FXQA 4OINF 4LLLA 1E3OC 4BHPA 3C2HA 2JVHA 4B09A 2DOEA 3M1EA 3S17J 5IYDJ 4HV6A 3OYMA 3DPUA 5B1AH 4NBQA 1ZN2A 5IYBJ 2EPFA 4UB8C 3S14J 3ECOA 4BQNA 4YIRX 2RNJA 2ZC2A 2GAUA 1J75A 2H8WA 4EATA 3FMRA 3LQQA 1JT0A 2FEZA 2CQKA 1OKRA 4GDFA 2X6WA 2C6YA 1J2XA 3CCQI 4P55A 3HOUJ 3L9FA 2H27A 4AU7A 3O6BB 1LJ9A 5AIPA 3CDIA 5DUIA 5K5RA 4GCVA 1TNSA 5HS8A 1RI7A 5LLQA 5F27A 1BC7C 5KVRA 3WTSC 3HHHA 2I10A 3A0HC 1IUFA 4UV9A 6PAXA 2ZXJA 2R7WA 1XS9A 1OYYA 2KZGA 2Y75A 3CMAI 5EEHA 2X4HA 3B6AA 3FISA 1U0JA 4GRIA 2WY7Q 2M9HA 1XMKA 1K6OA 1JE8A 2WB1N 1TLHB 3SZGA 1G4DA 1JKRC 3H3ZA 2ZNYA 2DTZA 2DT5A 4A3FJ 3FXRA 3CD6I 1S29A 4JQFA 3EQLF 4PFPA 2GM4A 4ZDPA 5J6XA 3SFZA 2XSDC 4PGHA 1ZH5A 2BBYA 2QZ8A 4YFNF 3KZZA 2NRAC 3ESWB 1Z6RA 3E1SA 1YW7A 2LP0A 1IZ1A 1SFEA 4L9TA 5LGTA 3GTQJ 5HLGA 4IEJA 2IA2A 1LB2A 3IP4B 1WJEA 2OPTA 2VPRA 1XD7A 4CGZA 1XGOA 2XB5A 3K4MA 2E2HJ 2DDAA 3EETA 1R23A 1FBSA 2KHMA 4KT5C 3DPLC 3VOEA 2HVSA 4DQ2A 1IUYA 2B63J 1VFCA 3F8MA 1YQAA 1K83J 4UUSA 2O8KA 3KYCB 5CLSA 2X1CA 4B1RA 5CVRA 3ZQIA 1FEXA 1ZHFA 1UJ8A 4QPQA 3SDGA 3CUQC 2E71A 3IAS2 2H94A 4CCMA 1X2MA 2LREA 1BJAA 2LR8A 4UY8I 5F6FA 4M9ZA 1T95A 4CA0A 5J47A 2MD5A 2BHZA 1BOAA 4M3BA 2CQQA 1FBUA 1B72A 2HS5A 1ACIA 5HNHA 2NNNA 4UUSB 3JR9A 2LY9A 1XMXA 4ETSA 1A36A 5E79C 1XTAA 2XHKA 4BBRJ 2VJIA 2DI3A 2Y2ZA 1VQLI 1HSJA 2VBYA 2GXBA 3BTJA 2MBFA 4HQMA 2K5CA 2F5CA 2LYCA 3ZQCA 3I55I 5HNFA 1RIOH 5LBQA 3K70D 3OR1C 1PYVA 2DA6A 1T38A 1H9GA 1GT0C 1X2NA 2QYOA 3SXYA 3JTHA 1B9MA 1FYKA 4RGSA 5E3LA 1FZPB 1MBHA 3P7NA 3LNQA 4KISA 3ML6A 3I4NJ 2M30A 3I58A 3LL7A 1T2KA 2FRHA 3K4JA 1DPRA 4HX4A 4JX4A 3DWLE 1ZLJA 3LSJA 4PJ0C 4PJNA 4RAYA 1QRYA 2IRFG 3KX2A 3G4SI 3EYIA 4KN7X 2MLKA 1QPIA 5L3GA 1SAXA 1U5TC 4CSWA 2R7TA 4HSRA 1MJBA 2H8RA 3WU1B 2KDOA 3GTJJ 3F23A 2KRHA 1A6QA 1P4WA 3IUOA 3U21A 5A2QK 1TL8A 5F0CA 5CVVA 4I76A 1B59A 3S1NJ 3HDDA 2RGVA 2BVMA 1SD7A 3GF2A 5H2FC 2QCOA 4II3A 2CQXA 4G6TB 4FX4A 4XLHA 1W5CC 2R5YA 1LFPA 1FSEA 2Z16A 1R5ID 4OIOF 3LQRA 5FKLA 2DBBA 5K7ZA 4HW0A 4HQEA 3BR5A 2VUMJ 3CESA 3CUQB 3WHBA 3NARA 3FXUA 1DP7P 3PNVA 4U87A 5JHFA 1LDDA 3WTUC 2CV1A 1STZA 2BXYA 4Q5SF 1MBKA 1R1UA 5J1UA 1TT5B 2YU9J 4ZYAA 1SFUA 1BN5A 3KEOA 4DYRA 3HEFA 2QQBA 4IF4A 4ESFA 3E7LA 4OAZA 4BE1A 1D5YA 4QLCU 3QPLA 1H89C 4XRSG 1BR2A 3BG3A 2OUMA 2KRFA 3K6GA 3LMMA 3E6BA 3P5JA 1VQ4I 3CJTB 2Z2SB 3Q3SA 5FFZA 2FNPA 4I0BA 5TRDA 4RM3A 3FDYA 1XGMA 3OYBA 4P9FA 2GOMA 4LB6B 3S2DJ 2V4JC 2A5WA 3KP6A 2E2IJ 1HQCA 4OIPF 4Q47A 2PN6A 3IV5A 3VWBA 1ZELA 4ENMA 4B48A 3RZOJ 3QOPA 2OQGA 3CJNA 1OLTA 3FKJA 3I9V2 3HBLA 3O3KA 1Y0UA 4AVZA 3IKTA 2EV0A 1Y6IA 1MMGA 3KYDB 4BQQA 4HBLA 3I53A 1HKSA 3O2PE 3KLOA 2IP2A 2Y31A 3DU6A 4LITA 2BHYA 3JAMZ 5J8FA 2QSHX 3OOUA 1Q1HA 3WG7H 1LEBA 1EH7A 3IAM2 3MVPA 1IXSB 4L5JA 4PCQA 3ZQGA 1TWGJ 1H0MA 1PVEA 3H35A 1XDSA 1YG2A 2BY2A 3TP0A 3IL2A 2YUSA 4HDVA 2D45A 1HKTA 4RGRA 4EM2A 3H5NA 2ZJPF 4RLFA 1AKHB 5GADJ 4IPAA 5FJ8J 3CUOA 1YITI 4LB5A 1ZYRF 1DGWY 1OJLA 5FFXA 1P4XA 2KKOA 1SD5A 2FD5A 4AWXB 1FYMA 1VF9A 3VFZA 2FXAA 4C2UA 3SFIA 2FMYA 4EGYA 2P5KA 3L1PA 2QBYA 2LY2A 3RCOA 1XDUA 4A3DJ 3S2WA 1POGA 1CQTA 2HR3A 2ICWG 3QYFA 2RREA 3JRFA 1FLIA 2K85A 3CCJI 2JT1A 3H0DA 2HDDA 2LD5A 1ZR4A 2FSWA 2TCTA 1KQ0A 4E6KG 5F0FA 1DGRM 3OOPA 3KFWX 4KDPA 3T8TA 3FK6A 1E0EA 3H9GA 2L9VA 2F5VA 1HKQA 2KLOA 3GZNB 3OIOA 2IVMA 3HKZA 1SFOJ 3ZMSA 5D4RA 2CRGA 2VLAA 1YJWI 1J9IA 3FXLA 3RQIA 2CS3A 4IVNA 2ZMEC 1K4SA 2LRDA 3WODF 2AXLA 4BE2A 3GXOA 3MD2A 3HSFA 4BNCA 3HUGB 1NHAA 1BW6A 5DCFA 1OCCH 2PLYA 2EIMH 2M0MA 1D0ZA 2FUG2 1DPUA 3G1MA 3HRSA 3BG7A 3K69A 4KT6A 1TTYA 2X48A 3ZPLA 3MAJA 4Y3OA 3P9CA 5HDKA 1O7LA 4RB3C 2YR2A 1N75A 4ANJA 2RQQA 3HIFA 2OQRA 3AL0C 3JRGA 1IO2A 2BV6A 4PUSA 4FTHA 3A01A 3ZOBA 2Z1DA 3AG2H 1X19A 4U7BA 4L5IA 1Z7UA 2ZFUA 3ZQLA 2P5LC 4PSXA 2HEOA 4W97A 2E1OA 4M3EA 1HW2A 4XKVA 2X6OA 3BG9A 4XBFA 3KZIC 3HSEA 2YU3A 3FXOA 4ZYGA 2ESNA 1FOWA 4ZC3A 4UV8A 1B6AA 1VTNC 1USSA 2EBIA 4YIFA 1YTYA 3CTAA 4LD5A 3FMSA 1MH3A 4IOAF 1NK3P 2XUBA 1XN7A 5IY5H 2EIKH 1WQ2A 3DQVC 4C3JJ 2P6TA 2TDXA 4EJOA 2R93J 3F8CA 3BJAA 1YE9A 3TOBA 2ELJA 5HDGA 4B4CA 4C3HJ 4G12A 3EYYA 3DBRB 3PNTA 4U0WA 3BQZA 4CCOA 2WB1A 2LF8A 2MD0A 3CCMI 2DO7A 1KA8A 2CUZA 2F4MB 3BPXA 1VQ7I 2DXIA 2HOSA 1MMSA 1E3PA 2XVCA 3BJOA 1MJ9A 2FBKA 5TISC 4IHVA 3FK7A 5CPRB 5FGMA 2E7XA 3S32A 3LAJA 3V8KA 3ELKA 1QGPA 1S7EA 2LKXA 1U8BA 4XONA 5GTHC 2VE9A 3H5RA 1I3AA 2JN6A 5C3EJ 3HTUA 1JGSA 2QEXI 3ABMH 4L9JA 2STWA 2WAFA 1WCMJ 3G1OA 3GCMA 4G7HF 1JUMA 3GWZA 1WSUA 1XSDA 3F21A 1Z77A 4GYIA 3MQ0A 3OR2C 2OF7A 3BZCA 1JXSA 2QQ8A 4RLQA 4G94A 5DD8A 4KFCA 1TZLA 1PP8F 4KJZA 2KFDA 2VBXA 2ZKZA 3FHZA 2VKVA 4NDLA 2BZTA 3GZ5A 2E1MC 1LFBA 3BCAA 2FJ1A 3K2AA 4MFEA 2M4GA 1V55H 1MJAA 3O8GA 3FWEA 4IHXA 3GTGJ 2DOAA 2IS2A 3WGHA 4A3BJ 2VPLA 4P96A 4Q4ZF 5K7FA 2K4JA 1P7JA 2CWEA 1PUFA 4PGGA 3BZ6A 1OCPA 4Y4RA 4YRVA 3LFKA 3BY6A 4BS9A 1A31A 5FKMA 3TO9A 1BI0A 2ECBA 1XCVA 1W7PB 2EZLA 2L5QA 3L2RA 5FB2A 4CYCA 4A5MA 1W5TA 4DIQA 4E7IA 3DEWA 3K9TA 4LIUA 4GYGA 1K79A 5HLHA 2E5ZA 3DCFA 2R7RA 1BA5A 1HSTA 5L3DA 2QENA 4Y52J 5EF6A 1PUFB 1S3JA 2X6YA 2CJJA 1SD4A 5AONA 1ITYA 3HOYJ 3UKGA 5IP6A 5LHIA 2STTA 3B6CA 2FQ3A 4X6AJ 3BG5A 2JUCA 1IRZA 3GW2A 4BAYA 5DYMA 3IRRA 3U9GA 1QBJA 1UG2A 2AS5F 4CYCB 2UWMA 1XPXA 3BG6A 3LSIA 1CGPA 1B1BA 3Q0UA 4N4OB 4WXHA 3OYFA 1YI2I 4IJAA 3TW6A 1I27A 4MHGA 3DBLB 3JSPA 3VEPA 2X51A 4I6ZA 3EUHA 2DN0A 2HNHA 2YX7A 2WADA 2ZXIA 2O3FA 5GPAA 2J5OA 2ZBKA 3CP2A 4B44A 4A3EJ 2D1HA 2R3SA 1MIJA 1Q1VA 4CDGA 3GVAA 2EJRA 1RESA 3KYLA 1M1EB 1W1WE 2HQRA 1JTXA 3OL4A 2WV1A 2LTPA 3GFJA 1GLNA 1AA7A 2E5NA 5FD5A 2BW3B 1FP1D 1I6HJ 1FY7A 4FX0A 2KP6A 2EZIA 4QPOA 4Z6YA 4M74A 3PIOF 4GFBA 5FRMA 5JLWA 2V9PA 3I3LA 3J7AY 1Z6TA 2ZJRF 2COMA 3H9JA 5KNLA 2EFQA 3TO6A 3Q5FA 2HWVA 2PX9A 4RGUA 4BQOA 2Q8KA 1W7PD 2Q2EA 5DTDA 1JKOC 2Y9YA 2D1VA 2DFFA 2EFOA 4MQ9F 5L3BA 1B8IA 2M4KA 4G9YA 2PJPA 2X1DA 4M6YA 1DDNA 3E6MA 3ZMUA 1IGNA 5ICFA 4O6JA 4I01A 3DV8A 5DCMA 3SZTA 3VSKA 5HOOA 2O0YA 4ENKA 2LKSA 2EV6A 1Z91A 2LBFA 3B02A 4QIWN 3QWLA 1ZAOA 1LVKA 2K7LA 4M6XA 2CQ7A 2K3FA 3ABUA 2LDUA 1J59A 5ILVA 3K70C 1F36A 1WJDA 1QHGA 2NOJB 2Q2EB 9ANTA 2EQRA 2XROA 4A3MJ 4XLNF 1B8IB 4ASNA 4XKCA 2COBA 2P0WA 3D5RC 4JX5A 2EK5A 3TP3A 3CCEI 1HW1A 3F6OA 2ZSHB 3KPHA 5DCMB 3WTZA 2KIMA 1H9TA 2FOKA 3F8NA 2K9NA 2R4GA 2V7FA 3PNYA 4PDKA 2A68F 3ZN1A 3WHCA 4AYBN 1W4MA 3DLLF 2IGNA 2XASA 4WXDA 5GAHJ 3OIPA 4NC7A 5EZGA 1T98A 4XIDA 1N78A 3OWTA 3RKWA 3I64A 2XGCA 2V9KA 3VYTB 1K4TA 1ZQ3P 2VJ4A 2XAJA 3KIOA 4WXCA 4BJTA 5LGNA 4DZPA 5GAEJ 2QF7A 3DEEA 1Z7LA 2F48A 2O5RA 2RVCA 2FMLA 4PK4A 2EA4A 3G6EI 3HOXJ 1F1ZA 4ZH4F 4HV5A 1ERDA 2VQLA 1BIAA 5L3FA 2W82A 1OISA 3QYEA 2XGEA 5ICGA 1WJAA 1RR7A 2LF7A 3DLAA 1QVTA 1UELB 1VQPI 3R4KA 4HYEA 1X3UA 2M34A 4F3QA 2KISA 4IQJA 3M9AA 2FOWA 2K9MA 3NRVA 3U1DA 1FPQA 4MNUA 3AG4H 2YS9A 2XAGA 1W5SA 2WWYA 1YOVB 2ZB9A 2YX4A 5FLMJ 2ME6A 4G7ZF 1WJBA 2JZYA 4O5VA 5D5WB 1RR8C 2L9SA 1JUPA 2ZNZA 2L2OA 2RDPA 1IN7A 1BBYA 4AVPA 2AQFA 2XAHA 2HQNA 3DU5A 3LSHA 2FQ4A 4U7DA 2W25A 1VZ0A 1SMTA 5J3LA 5IT9Z 1MZBA 3OYCA 2ESHA 4V2GA 1A35A 3OS2A 4UVAA 1R7JA 1T56A 1FSHA 5EEGA 2EB7A 3FKIJ 2XGXA 4OAYA 5J4VA 4F55A 2HKOA 3S15J 2Y0MA 3TDZC 4DYCA 3Q9SA 2XKPA 2NVQJ 3KP4A 3B73A 4BACA 2KIQA 2H1LA 1Z3YA 2QVOA 4S04A 3J81Z 5J1YA 4NNJA 3L00A 2M2EA 2MW8A 3GBGA 4BY7J 2FNAA 1E3HA 3GTMJ 3J7ZI 1R71A 5F04A 3GTKJ 1YIJI 4HNVA 3MZ8A 4IO9F 1LNWA 4XOPA 1OQYA 5KAFC 4RA2A 2DJNA 2XB0X 1KONA 1MKMA 1P7IA 2XIGA 3WG9A 2P7CB 3MFKA 1P9QC 2NVXJ 1RETA 3W6JB 3J7AO 1NG6A 3DTKA 2M3AA 3GLXA 4E7SA 3QODA 2Y30A 1R9TJ 3C3WA 5M3FJ 2VONA 1GV2A 2ZJ2A 1ZG1A 2EIJH 1D1BA 4CCJA 4ZYEA 4NC8A 5EG0A 2LOOA 5CQGA 1QO0D 4CCNA 3RIRA 3OV8A 1MSEC 4L5EA 5L3CA 2CQNA 1ON1A 2DOFA 1ODDA 2Y0SN 3REOA 1VQ9I 1R1VA 3I5UA 4ENNA 5JFRA 3H36A 1D1CA 4ZDOA 1SVLA 4IHYA 1TNTA 3HSRA 5DDGA 2DMTA 4L0YB 3ZN0A 2LSOA 2ZXWH 2KQRA 3BT9A 3CP8A 3H92A 4BDYA 1FT9A 1FMWA 2BYVE 4QSHA 3W2WA 4E7ZA 1R5GA 4HG2A 4M9SA 5EG0B 2OV7A 2JSCA 5ICCA 2XPVA 4CH7A 1ZGAA 5E17F 2BEOA 3WGGA 2HKXA 5H6QA 3MWMA 3TW7A 1QZYA 3DKXA 4A0XA 2MFZA 1IV6A 4XICA 1B72B 1SAUA 4Y33A 2HZDA 1YHQI 2X1EA 2R7OA 3R0AA 2DA7A 1U2WA 2DQRA 1P2FA 3ABKH 2WTEA 3H1CA 5LEJA 2YPRA 3PSIA 1ZR2A 1DP3A 2BE5F 3SEQA 3ECHA 2P6SA 4FHTA 2DQLA 3EPZA 4OOIA 1KGSA 1ETVA 2R7VA 4G6DA 3M8JA 2IW5A 4GO1A 3RKXA 1IF1A 1VQ5I 1DQUA 4D9JA 1T08B 5IYCJ 1UZCA 4HZFA 4LJZF 1TQMA 4DGWB 4BU2A 2W85A 1MNMC 2VT2A 4C2MJ 1T6SA 4PSWA 1VI0A 2BY0A 2W1OA 3IH4A 3IH2A 2BVLA 3HB9A 3VB2A 4E70A 4IKFA 4UB6C 5K1YA 2XAFA 2MC4A 2PMZN 2X85A 3LSGA 1LPQA 3ZP5A 3VPRA 3WU2C 1HBXG 4M3DA 5CVUA 2D2WA 1U9NA 5K7HA 1MH4A 3K2ZA 4NUBA 1O3TA 1E17A 1IN5A 2OCCH 4BJ5C 2IGMA 1WRJA 2CGPA 1ULYA 2O61A 1WGXA 3AG3H 3FXMA 2O8XA 5JVTA 3OYDA 3J80K 2DYSH 3RQ4A 2IT0A 5K5OA 1R36A 3ISPA 2VIXA 3V8JA 3G71I 3KP5A 2X0LA 4OIRF 1N25A 2DMQA 4Y7NJ 1X3ZB 2F4IA 1FOXA 1BR1A 3ZGKA 1C0WA 4A3LJ 2G9WA 5E8IA 4DW6A 2R5YB 2F4OB 3D0SA 1SVMA 3BPVA 2HOEA 4M73A 1K78A 3LA7A 3TOAA 2A3SA 3MKLA 1QHHD 2K9QA 3IHUA 1T8IA 3EUKL 2E1CA 2NYXA 5FLXK 2NS0A 1Y8RB 1BIBA 3DFGA 3O8HA 1PUEE 2FA5A 1EKEA 1U6GA 4L18B 4F7ZA 1WH5A 1EJ9A 2JJ7A 1ETOA 4RMNA 3KE2A 2E60A 4BH9A 2R7DA 5DV5A 1ZGJA 2QA4I 1K78B 4LG3A 3GMEA 3BCBA 2ACJA 1RKTA 3FBNB 2O9LA 1ON2A 1LDKB 1XGNA 1IN4A 3DP7A 5LHGA 2GXAA 2NS7A 2B0LA 3BR0A 1MDMA 2FF4A 4MEXF 1QU3A 3HPHA 1A6IA 4KN4X 1MSFC 2K86A 4HLXA 1O3RA 1MW7A 2F5FA 1TWCJ 2RQPA 3DKYA 3T1BA 3CC4I 3WTXC 4BHCA 4BXFA 2PQ8A 5JHUA 1W36C 4LMYA 2M8GX 3E3VA 1I39A 4ZJZA 4BBSJ 1D8KA 3F72A 2LY1A 5CVJA 3ZMTA 3CO6C 4P1WA 1ETWA 3RJPA 2Y9ZA 1J5YA 3N05A 4O3MA 1MDMB 5D8LB 3MMYB 4BXXJ 1LQ1A 1G3YA 2VB6A 2IGOA 5ILUA 1JKPC 2QSGX 1FBQA 2HQ5A 2KRCA 2JPCA 1JHHA 2IBDA 3JRCA 2DCEA 1NG7A 3F8BA 2N8GA 1Y39A 4HDUA 1S5LC 2DFHA 3E0JB 2V1UA 3N4MA 3ABTA 3OYIA 1R4MB 2VOPA 3M1CA 4ZTJA 4J19A 3MZHA 3W2VA 2VJ5A 2QBYB 2H1KA 1SD6A 2IPQX 2JQ7A 1ORKA 4M3GA 3R6SA 3BQYA 4IRGA 3CC2I 3M7GA 4J01A 5BMZA 4XLCA 3RYPA 5ED4A 2IA0A 3LSKA 3E5UA 3PUFA 3LAPA 1Z3XA 5HVQC 1X1PA 1YJ9I 4AYBA 4TV7A 2DK8A 4BUPA 1ETXA 4XM3A 3HOVJ 3CLOA 3V4GA 2K9SA 3EDPA 4EQQA 3HJEA 2G7HA 2BY3A 4AIJA 5KCMA 2PMHA 3ZQFA 5H20A 1DU0A 3F8FA 2Z33A 1ZRDA 1FTTA 4MEYF 2R7XA 1ZREA 2E36A 2CH0A 4HPQA 2IJLA 1G3WA 1V5GA 4B3AA 3KZYA 2I5UA 4RDUA 5JR3A 3RPUA 3G3ZA 2MC3A 4A3KJ 2OZ6A 3GTOJ 3CF5F 1FNNA 3SQNA 2PMUA 4D7MA 1R58A 1OYWA 2DDBA 1I50J 3HRTA 1ZTRA 2ELHA 3QAHA 5KK1A 3A01B 1T39A 4XRSA 4UUVA 3J7YJ 3R0JA 4OMYA 3ERMA 1YW8A 2KJCA 4FE7A 1K61A 1P4AA 4XSZF 3K4BA 2UZKA 1UG0A 3HRUA 1MD0A 1AWCA 3ZMVA 1D0YA 3QRFF 4YELA 4LIVA 3CCLI 2K9LA 4XR6A 5FROA 4BXUA 1V3FA 4LK1F 1YFHA 5CJ9A 3V42A 2CUJA 3C1DA 2VQGA 4B3XA 1XGSA 3HZJA 1OR7A 5IOYA 3T8RA 1WHUA 1G3TA 1ZKGA 2EFNA 2E7WA 5LGUA 2PBIA 4XN3A 4LLGF 3F9KA 3TBIA 1ZLKA 2CW8A 1I6XA 1S9HA 4N0BA 1N77A 1TT0A 2PG4A 2GIVA 3K0LA 1NK2P 2LH9A 3VSLA 4FETA 3E5QA 2JA5J 2A69F 2B9SA 1Z9CA 2K27A 3AAFA 2OC6A 1BJZA 2RNGA 3Q0WA 4I02A 2QQAA 2D5VA 2M45A 4DYQA 4XOTA 2DLLA 1RZ4A 1BI1A 3BR3A 2L7MP 3G73A 1UFMA 3F22A 1LFUP 2A6HF 4Y15A 4DOZA 3ULQB 3JCUC 2PFBA 4BHBA 2DA2A 4QTRA 2HGCA 3H3VK 3ZQ7A 2DMUA 3W2AA 2XPUA 5F08A 1AU7A 1QA6A 3FXKA 2WC2A 1GUUA 3KP7A 1FC3A 4EJVA 3COAC 3R61A 3JRDA 1W36D 1G6NA 3X2QH 2V79A 3DXJF 1PDNC 3BR1A 3EUHC 3E6CC 2IGKA 3CQZJ 2XC7A 4E7LA 4IQ4A 3BP8A 4RM2A 2Y69H 1ENHA 2Y0SA 5CYVA 2LMDA 1G59A 3MKWB 4A6EA 1KU9A 2JSPA 3TL4X 5JI6A 3BDDA 4RB2C 3L2WA 1RNLA 3KP3A 3DEUA 1JGGA 4LK0F 4XLPF 2AO9A 2XGDA 1BM9A 1ZRCA 3HOTA 3RPUD 2ISYA 1V5EA 4IL6C 1Z21A 3T0YA 3I4PA 5D8KB 1LE8A 3QOEA 3WE3A 2E34A 1MMAA 3IRQA 2HXOA 4IXAA 3HOSA 1G3SA 2DW4A 1HLVA 3CJQB 4AM3A 5D5XB 1FOYA 2BXZA 3JRAA 2H09A 1IN8A 1WI9A 2F5DA 1E2XA 5DS9A 4HNUA 2DPUA 2Q1ZB 2WAEA 2MH9A 1EH8A 4ZYHA 2ME0A 4A5NA 4FISA 4HF1A 2VXDA 1TQIA 4RGXA 4AIKA 2CU7A 2HPIA 4HRIA 2R7UA 4J00A 3PQKA 1IDZA 3CCYA 3OYHA 3GX4X 3HOZJ 4KIGA 4HNTA 4ZZDA 5IP9J 1IW7F 3I0TA 4DNCA 1GXPA 1TW3A 2DJIA 4XLEA 1NH3A 2JA8J 1RRJA 2WV0A 2CFOA 1R49A 4HF0A 3I59A 3LOCA 4V2FA 2LNBA 4HA8A 3W6KB 1IRGA 4ESBA 1BI2A 4U88A 1YIOA 2W7NA 2XKOA 2GWRA 2ADUA 1KU2A 2JVGA 2NVYJ 3A0BC 5FO5A 3CMEI 2PMZA 4B47A 2UXNA 2NOGA 3IC7A 1OPCA 2ZSIB 5EGOA 2V9VA 2HTJA 1RPWA 3C2GA 2LVSA 4AC0A 3JAMK 3ZQHA 3OSFA 2E1NA 2ETHA 2W24A 4LG0A 3K4CA 3I59B 2Q0OA 3OL3A 3RTRA 5A2QZ 4HOBA 2GOXB 1KQ9A 3PO2J 3F3XA 2AXTC 2CFXA 2GIZA 4ZTFA 3LWFA 2Z3YA 4N4NB 2VKDA 5M5XJ 5EGOB 2M0CA 2P8TA 3DF8A 4LLNA 1OFCX 2JK3A 3QP5A 4Y17A 5EJCA 1X1DA 4BY1J 3SDBA 2L7ZA 4MLOA 4R1HA 4M6VA 2WA0A 2VQHA 4LG0B 3FF5A 3PM1A 3U1KA 1QPMA 4D7NA 1R22A 3CZ6A 4BQAA 4IX7A 4XK4A 3K1NA 4D0PA 4IZZA 1YW9A 1X58A 1QZZA 5B5EC 3L2CA 1S7AA 1XC5A 3GYHX 4HLYA 5F64A 2H6BA 1SFXA 4C2TA 4H4KC 2LC2A 1GHCA 3UNGC 2L0KA 2YSRA 4XL9A 1IXCA 4HX7A 2DMNA 2VN2A 3IWZA 4S0HB 3TEDA 5BPIA 1HA8A 1A04A 1KYWA 3S1RJ 1JUSA 2W48A 5K5QA 4GXOA 3VYSB 4KIBA 1UAAA 2LBFB 4PJMA 3JREA 4IHSA 3HXLA 1Y0NA 5ILSA 3A4CA 2NVTJ 4YFXF 1OMIA 4BDZA 2HXIA 3FMQA 3ZRGA 5LD2C 3HG9A 4DZJA 1FIAA 3H3UA 2K02A 4R8HA 2L9RA 5B3SH 3G2BA 3L7WA 4OWRB 3DTEA 2MYSA 2V1NA 3S1MJ 4OMZA 4PJLA 3HTSB 4HEA2 4LFUA 1GVDA 2Z99A 4UVCA 2DA5A 1SMYF 3SZPA 4E7HA 2CUEA 4A3JJ 2BGCA 2BY1A 2JA7J 1UB9A 5IP7J 1MMNA 3TMOA 4BYYA 1SEUA 4CHUA 3F6VA 4WCGA 5LRRA 5GTIC 1U78A 3IKVA 3I56I 2HFHA 3KEQA 2VT3A 1JJ8C 1YRNA 1XB4A 2DAOA 1KU3A 4WX9A 3SJMA 3KCCA 2Y48A 4EJTA 5E1WA 5CQEA 5IT3A 3LFUA 4EM1A 2VI6A 3QU6A 1O4XA 1WJCA 2L01A 3RKYA 4A93J 3JW4A 1UHWA 1G2HA 4M9XA 4XNFA 1LDJA 5E8GA 4P5OA 1K6YA 1O57A 1T0FA 4FQGA 5LHHA 2VC1A 3KETA 1MMDA 2QUFA 3GFMA 2L54A 3OYAA 3UR3C 1K7AA 1VQOI 3OIQA 4IRIA 2K40A 2VOOA 1YRNB 3L09A 3BTCA 3QQAA 2HTSA 4YIIA 2DU9A 1U8RA 3PSFA 4B43A 1QQIA 2VBWA 2EH3A 3OYLA 1HC8A 3H0GJ 1U3EM 1LUJB 4KYWA 4A6DA 5DD4A 3CCVI 1REPC 3AFHA 2GXGA 2DA1A 5HS9A 2NXNB 1U9OA 2AQEA 2QLZA 4MGRA 3D1NI 1VQMI 4C30A 5IPAA 1KYZA 2FU4A 2J5PA 1ZARA 3CCUI 4UUTA 4WK8F 3PO3J 4X1EA 3ZMZA 1BL0A 4EVIA 1TW2A 4I09A 2W00A 3GLLA 1V4RA 3V7CA 3WGIA 1J0RA 2OTLI 2HQAA 3ZR8X 4BE0A 1SFKA 1DU6A 2XF5A 4B8XA 3RKQA 1R5HA 1IG7A 4G8XA 1B9NA 3RDIA 1OCOH 2QSFX 1IRXA 2ZFWA 4M3FA 5GPCA 1X3WB 4X0GA 2HPMA 4XORA 1VQ6I 2OJED 1AOYA 1Z1DA 1ONVA 1X4OA 3CO7C 2LLKA 5F1RA 1FWZA 4ITVA 4BJ6C 1O3QA 2L4MA 3RPQA 1MBEA 5H6RA 2O03A 1GV5A 2DA3A 1WH7A 4NB5A 5TGTA 3S2HJ 5TJJA 1JJ6C 2HDWA 2OCEA 4WWCA 1HF0A 3L2QA 2LK2A 3ABLH 4G7OF 2VJJA 1SVOA 4F93B 2CV0A 1DUXC 2K3PA 4PZJA 4KUMA 3HGGA 1YJNI 2WBMA 2QKLB 4U0VA 3M3YJ 1GDTA 1JHFA 2MH2A 2RKHA 2V6CA 3IWFA 1RUNA 4CZCA 2OTJI 5BOXA 1F5TA 5F1JA 1RC9A 5FKOA 5J4YA 3ASOH 2RV8A 3RZDJ 3LSRA 2NS8A 2RC4A 1EV7A 4DJAA 3JRHA 5BS6A 2A05A 3WTVC 4JP0A 1MNDA 2JWTA 2GLOA 1USTA 1WVRA 4KMFA 2VODA 2F5EA 2QM3A 1SC7A 1Z05A 5M3MJ 1FTZA 4F52A 2KIUA 3GEZA 4I0AA 3HYIA 2EINH 1S72I 2Z5UA 3ZQQA 3NQOA 4Z2YA 4A12A 1D8JA 4JX6A 2XRLA 2KZVA 4XRMA 3D5LA 1FJLA 2ISZA 2DFEA 5B66C 3CCRI 4CYDA 4II2A 4RAGA 1S7OA 4GGGA 4MFDA 3TKYA 1TWFJ 3K4KA 3OYNA 4AIDA 1BR4A 3CUQA 4U0YA 1WKMA
chains in the Genus database with same CATH topology
4Q48A 3C7JA 2Z9OA 1ZG5A 2F2EA 3FM5A 4N9HA 1FYLA 4ZYDA 4I98B 3GO5A 1IRFA 2H6CA 3MCZA 1WWXA 1YS7A 4L9NA 3TQNA 1UHMA 3JSOA 2M8EA 5D5UB 5LRSA 2KJBA 1F9NA 3QPTA 3CDHA 4R79A 4RB1A 4MQVA 3NEUA 2QWWA 2ZO4A 3U2RA 4H0EA 2GA1A 3KP2A 3PFIA 3FX3A 4MTEA 4LGWA 5E20A 2MA3A 2EA2A 4EMSA 3MEXA 1U5TA 3SHFA 1I1SA 4NHJA 3QU3A 4HAMA 5E1ZB 5DUKA 3WU0A 5BQTA 1KQ8A 2P7VB 1EH6A 5ICEA 1YO5C 2V1XA 3V8LA 4KA4A 1YYVA 1XCBA 2HZTA 1U5TB 1KU7A 1IN6A 4ZZLA 2GA2A 4A2UA 1I5ZA 5CVIA 2OA4A 2FE3A 5HLIA 1CF7A 5J8CA 1GXQA 3GFIA 2DK5A 2FBHA 3I54A 3ERED 1RUOA 2OBPA 4CXFA 5D6FA 1TBXA 5LEKA 3K1PA 4JBAA 1QNTA 1OYIA 1BI3A 2GQQA 3HUGA 3TGNA 5L3EA 1S8NA 1CF7B 3BROA 5AIQA 2JPBA 3LA2A 4XSXF 2EFPA 2GZWA 2OD5A 3GFLA 5DEQA 4UXNA 4EV0A 4AD9A 1D3YA 4EJUA 5IT9K 2NAZA 2L4AA 2G7UA 1YS6A 3TO7A 3V7RA 3WTTC 3M8EA 4UNOA 3E6DA 4YG2F 3TDUC 3J81K 4UVBA 2VXZA 4OU0A 1I1GA 2OU2A 3I71A 3R60A 2DTRA 1MGTA 3MZYA 3WTWC 1P92A 2VE8A 2CW0F 3P9KA 3HHGA 4CZZA 4EM0B 4MTDA 2HYGD 2DPDA 3ROUA 2A07F 1F4KA 4EGZA 5D6EA 2A6EF 3VODA 4NQWA 4ON0A 3N97A 1L0OC 4CO8A 3HRMA 4KIFA 4AIHA 5E18F 4L9VA 4UHTA 2CG4A 3V7SA 2ZMEA 1XMAA 5HS7A 1TQPA 2FBIA 1UCRA 3QPHA 3RYRA 2XV4S 2R7FA 2M1BA 5ERIA 2EV5A 2CO5A 2EFWA 5BPDA 2OZUA 2ZMEB 4G6QA 2QQ9A 3C18A 4HX8A 4S05A 1PP7U 3E5XA 3DPTA 2UXXA 3K1MA 2L02A 3E97A 2VBZA 2NNYA 4IRHA 1O3SA 1BC8C 4I7HA 2KIFA 3BJ6A 4RS8A 4EJWA 2HYFA 4YFKF 2M5WA 4I2OA 1ZRFA 4Y13A 4K2EA 4CICA 3ZMDA 4A0ZA 3KLNA 2V1DA 2JTVA 5HDNA 2PEXA 1W7PA 2EWNA 4RAZA 5D5VB 1GVJA 2IA1A 3LSTA 2L3DA 1IAWA 1XSXA 2W57A 2A5YB 3BOQA 4M71A 1LEAA 2CYYA 3Q9VA 2DFIA 4ENJA 1R1TA 1J7KA 2O6GE 2A61A 4ESJA 1LVAA 2W84A 4JK1X 2PI0A 4XRFA 3GZ6A 2VC0A 4IHTA 1S6LA 3JTGA 1O7FA 3DKWA 4RB0A 1D5VA 4OIQF 1YLFA 1B4AA 3QP6A 3WE2A 3FM3A 4L0ZB 4N9IA 1IXRC 2RN7A 2JRTA 3LA3A 2XAQA 3RI4A 2K4BA 4QWQA 3WTYC 1XSVA 3J80Z 3BWGA 5FD6A 1HXDA 4FT8A 4HF2A 4KICA 3GUDA 5E1XA 4WF2A 3T5XA 2HDCA 2P4WA 4P9UA 2P5VA 1HW5A 5FLXZ 2CSOA 2LKPA 3PQJA 1ZG3A 1FP2A 4KNYA 4M72A 1FOKA 3M8FA 1L3LA 3P9IA 1FX7A 5D4SA 4KMUX 2ZCWA 2XRNA 4A0YA 2OAZA 2M87A 1R00A 3FZVA 2MLGA 1P6RA 3FXQA 4OINF 4LLLA 4BHPA 4B09A 3M1EA 4HV6A 1ZN2A 3ECOA 2RNJA 2GAUA 1J75A 3FMRA 3LQQA 2FEZA 2CQKA 1OKRA 2C6YA 1J2XA 4P55A 3L9FA 2H27A 3O6BB 1LJ9A 5AIPA 5DUIA 5K5RA 4GCVA 1TNSA 5HS8A 1RI7A 5LLQA 1BC7C 5KVRA 3WTSC 3HHHA 4UV9A 6PAXA 2ZXJA 1OYYA 2Y75A 5EEHA 2X4HA 1XMKA 1K6OA 1JE8A 1TLHB 1G4DA 3H3ZA 2ZNYA 2DT5A 3FXRA 1S29A 4JQFA 3EQLF 5J6XA 3SFZA 4PGHA 1ZH5A 2BBYA 2QZ8A 4YFNF 3KZZA 2NRAC 1Z6RA 4L9TA 1YW7A 1IZ1A 1SFEA 5LGTA 5HLGA 2IA2A 1LB2A 4CGZA 1XD7A 1XGOA 3EETA 1R23A 1FBSA 4KT5C 3VOEA 3DPLC 1IUYA 4DQ2A 3F8MA 1YQAA 5CLSA 5CVRA 1ZHFA 3CUQC 2H94A 1BJAA 5F6FA 4M9ZA 2MD5A 1BOAA 1FBUA 2HS5A 2NNNA 4ETSA 2XHKA 2DI3A 1HSJA 2VBYA 2GXBA 2MBFA 4HQMA 2F5CA 1RIOH 5LBQA 1T38A 1H9GA 2QYOA 3SXYA 3JTHA 1B9MA 1FYKA 4RGSA 1FZPB 3P7NA 3ML6A 2M30A 3I58A 1T2KA 2FRHA 4HX4A 1DPRA 1ZLJA 4RAYA 2IRFG 3EYIA 4KN7X 2MLKA 5L3GA 1SAXA 1U5TC 1MJBA 3WU1B 3F23A 1P4WA 5A2QK 5CVVA 1B59A 2RGVA 1SD7A 3GF2A 4FX4A 1FSEA 4OIOF 3LQRA 2DBBA 4HW0A 4HQEA 3CUQB 3FXUA 1DP7P 1LDDA 3WTUC 1STZA 4Q5SF 1R1UA 1SFUA 1BN5A 3KEOA 2QQBA 4IF4A 4ESFA 4QLCU 2KRFA 3E6BA 5FFZA 2FNPA 4I0BA 5TRDA 1XGMA 4P9FA 4LB6B 3KP6A 1HQCA 4OIPF 4Q47A 2PN6A 4ENMA 3QOPA 2OQGA 3CJNA 3O3KA 1Y0UA 3IKTA 2EV0A 4HBLA 3I53A 1HKSA 3O2PE 3KLOA 2IP2A 3JAMZ 5J8FA 1Q1HA 1LEBA 1EH7A 4L5JA 1H0MA 1IXSB 4PCQA 1ZRDA 1XDSA 1YG2A 3IL2A 1HKTA 4HDVA 2D45A 4RGRA 4EM2A 4IPAA 3CUOA 4LB5A 1ZYRF 5FFXA 1P4XA 2KKOA 1SD5A 4AWXB 1FYMA 3VFZA 2FXAA 2FMYA 4EGYA 2P5KA 2QBYA 1XDUA 3S2WA 2HR3A 1FLIA 2JT1A 2FSWA 1KQ0A 4KDPA 3OOPA 3KFWX 3T8TA 1HKQA 2IVMA 3ZMSA 5D4RA 1J9IA 4IVNA 3WODF 2AXLA 3GXOA 4BNCA 3HSFA 1NHAA 5DCFA 2PLYA 1DPUA 3HRSA 3K69A 1TTYA 3ZPLA 3MAJA 3P9CA 5HDKA 1O7LA 4RB3C 2YR2A 3HIFA 2OQRA 2BV6A 4U7BA 4L5IA 1Z7UA 2P5LC 2HEOA 1HW2A 4XBFA 3HSEA 2YU3A 4ZYGA 2ESNA 4UV8A 1B6AA 1VTNC 1USSA 4YIFA 1YTYA 3CTAA 4LD5A 3FMSA 2XUBA 1XN7A 1WQ2A 3DQVC 2P6TA 2TDXA 4EJOA 3F8CA 3BJAA 3TOBA 5HDGA 3EYYA 4U0WA 2LF8A 2DO7A 1KA8A 3BPXA 2XVCA 3BJOA 1MJ9A 2FBKA 5FGMA 2E7XA 3LAJA 3V8KA 3ELKA 1QGPA 2VE9A 3HTUA 1JGSA 4L9JA 2STWA 4G7HF 3GWZA 1WSUA 1XSDA 3F21A 4GYIA 3MQ0A 1JXSA 4G94A 5DD8A 4KFCA 1PP8F 2VBXA 2ZKZA 3FHZA 3GZ5A 1MJAA 3FWEA 3WGHA 4P96A 4Q4ZF 2K4JA 2CWEA 4PGGA 3BZ6A 3LFKA 3BY6A 3TO9A 1BI0A 1XCVA 1W7PB 5FB2A 4A5MA 1W5TA 3K9TA 4GYGA 1K79A 5HLHA 1HSTA 5L3DA 2QENA 1S3JA 5AONA 1SD4A 5LHIA 2STTA 2FQ3A 3GW2A 4BAYA 5DYMA 3IRRA 3U9GA 1QBJA 2AS5F 2UWMA 1CGPA 1B1BA 4WXHA 4IJAA 1I27A 4MHGA 3JSPA 3VEPA 3EUHA 2YX7A 2O3FA 2J5OA 2ZBKA 2D1HA 2R3SA 4CDGA 3GVAA 2EJRA 2HQRA 3GFJA 5FD5A 1FP1D 1FY7A 4FX0A 4M74A 1Z6TA 2COMA 2EFQA 3TO6A 3Q5FA 2HWVA 4RGUA 2Q8KA 1W7PD 2Q2EA 2D1VA 2EFOA 4MQ9F 5L3BA 4G9YA 2PJPA 4M6YA 1DDNA 3E6MA 3ZMUA 5ICFA 4O6JA 4I01A 3DV8A 5DCMA 3SZTA 5HOOA 2O0YA 4ENKA 2EV6A 1Z91A 3B02A 1ZAOA 4M6XA 2K7LA 3ABUA 2LDUA 1J59A 5ILVA 2XROA 4XLNF 4ASNA 2EK5A 1HW1A 3F6OA 5DCMB 3WTZA 2KIMA 1H9TA 2FOKA 3F8NA 4PDKA 2A68F 3ZN1A 1W4MA 2XASA 4WXDA 1T98A 3RKWA 3I64A 2XAJA 4WXCA 5LGNA 2RVCA 2FMLA 2EA4A 1F1ZA 4ZH4F 4HV5A 1BIAA 5L3FA 5ICGA 2LF7A 3R4KA 4HYEA 1X3UA 3M9AA 3NRVA 3U1DA 1FPQA 4MNUA 2XAGA 1W5SA 2WWYA 2YX4A 4G7ZF 2JZYA 4O5VA 5D5WB 2ZNZA 2RDPA 1IN7A 1BBYA 4AVPA 2XAHA 2HQNA 4U7DA 2W25A 1SMTA 5IT9Z 1MZBA 2ESHA 4UVAA 1R7JA 1FSHA 5EEGA 2EB7A 2XGXA 2HKOA 2Y0MA 3TDZC 3Q9SA 2XKPA 3KP4A 3B73A 4S04A 2QVOA 3J81Z 3L00A 2FNAA 1LNWA 1MKMA 2P7CB 2XIGA 3WG9A 3MFKA 3W6JB 3J7AO 3GLXA 2VONA 3C3WA 2ZJ2A 1ZG1A 4ZYEA 1QO0D 3RIRA 3OV8A 5L3CA 1ON1A 1ODDA 3REOA 1R1VA 3I5UA 4ENNA 5JFRA 1TNTA 3HSRA 5DDGA 4L0YB 3ZN0A 2LSOA 3H92A 1FT9A 2BYVE 1R5GA 4M9SA 2JSCA 5ICCA 5E17F 1ZGAA 2BEOA 3WGGA 2HKXA 5H6QA 3MWMA 1QZYA 4A0XA 3R0AA 1U2WA 2DQRA 1P2FA 2WTEA 5LEJA 2YPRA 2BE5F 3ECHA 2P6SA 4FHTA 2DQLA 4OOIA 1KGSA 4G6DA 2IW5A 4GO1A 3RKXA 1IF1A 4HZFA 4LJZF 1TQMA 2W85A 2VT2A 1T6SA 3VB2A 4E70A 5K1YA 2XAFA 3ZP5A 1HBXG 5CVUA 2D2WA 3K2ZA 1O3TA 1E17A 1IN5A 1WRJA 2CGPA 1ULYA 2O61A 2O8XA 5JVTA 3J80K 2IT0A 5K5OA 1R36A 3ISPA 3V8JA 3KP5A 2X0LA 4OIRF 1C0WA 2G9WA 5E8IA 3D0SA 3BPVA 2HOEA 4M73A 1K78A 3LA7A 3TOAA 2A3SA 3IHUA 2E1CA 2NYXA 5FLXK 2NS0A 1BIBA 3DFGA 1PUEE 2FA5A 1U6GA 4L18B 4F7ZA 3KE2A 4BH9A 2R7DA 5DV5A 1ZGJA 1K78B 2ACJA 1ON2A 1LDKB 1XGNA 1IN4A 3DP7A 5LHGA 2B0LA 1MDMA 2FF4A 4MEXF 4KN4X 2K86A 4HLXA 1O3RA 2F5FA 2RQPA 3T1BA 3WTXC 4BHCA 2PQ8A 5JHUA 4LMYA 3E3VA 1D8KA 3F72A 5CVJA 3ZMTA 3CO6C 3RJPA 1J5YA 4O3MA 1MDMB 5D8LB 1LQ1A 1G3YA 5ILUA 1FBQA 2JPCA 1JHHA 3F8BA 4HDUA 2V1UA 3N4MA 3ABTA 2VOPA 3MZHA 2QBYB 1SD6A 2IPQX 3R6SA 4IRGA 3M7GA 5BMZA 3RYPA 5ED4A 2IA0A 3E5UA 3LAPA 5HVQC 4TV7A 2DK8A 3CLOA 3V4GA 3EDPA 4EQQA 2G7HA 4AIJA 2PMHA 5H20A 3F8FA 2Z33A 4MEYF 1ZREA 2IJLA 1G3WA 3KZYA 5JR3A 3RPUA 3G3ZA 2MC3A 2OZ6A 1FNNA 3SQNA 2PMUA 1R58A 1OYWA 3HRTA 2ELHA 3QAHA 5KK1A 1T39A 4UUVA 3R0JA 4OMYA 1YW8A 2KJCA 1P4AA 4XSZF 2UZKA 3HRUA 1MD0A 1AWCA 3ZMVA 3QRFF 4BXUA 1V3FA 4LK1F 1YFHA 5CJ9A 3C1DA 1XGSA 1OR7A 3T8RA 1G3TA 2EFNA 2E7WA 5LGUA 2PBIA 4LLGF 1ZLKA 4N0BA 1I6XA 2PG4A 2GIVA 3K0LA 3E5QA 2A69F 1Z9CA 2K27A 3AAFA 4I02A 2QQAA 2M45A 2DLLA 1RZ4A 1BI1A 3G73A 1UFMA 3F22A 2A6HF 4Y15A 3ULQB 4BHBA 2PFBA 2HGCA 3ZQ7A 2WC2A 3KP7A 1FC3A 4EJVA 3COAC 3R61A 1G6NA 2V79A 3DXJF 1PDNC 3E6CC 3BP8A 5CYVA 4A6EA 1KU9A 5JI6A 3BDDA 4RB2C 1RNLA 3KP3A 3DEUA 4LK0F 4XLPF 1BM9A 1ZRCA 3HOTA 2ISYA 5D8KB 3T0YA 3I4PA 3WE3A 3IRQA 4IXAA 3HOSA 1G3SA 2DW4A 5D5XB 2H09A 1IN8A 1WI9A 2F5DA 1E2XA 2DPUA 2MH9A 1EH8A 4ZYHA 4A5NA 4HF1A 1TQIA 4RGXA 4AIKA 3PQKA 3GX4X 4KIGA 4ZZDA 1IW7F 3I0TA 4DNCA 1GXPA 1TW3A 2WV0A 4HF0A 3I59A 1IRGA 3W6KB 2LNBA 4HA8A 4ESBA 1BI2A 4U88A 1YIOA 2XKOA 2GWRA 2ADUA 1KU2A 5FO5A 2UXNA 3IC7A 1OPCA 2V9VA 2HTJA 3JAMK 2E1NA 2ETHA 2W24A 4LG0A 3I59B 2Q0OA 3RTRA 5A2QZ 4HOBA 1KQ9A 3F3XA 2CFXA 3LWFA 2Z3YA 2P8TA 3DF8A 4LLNA 3QP5A 4Y17A 4R1HA 4LG0B 3FF5A 1QPMA 1R22A 4BQAA 3K1NA 4D0PA 1YW9A 1QZZA 3L2CA 1S7AA 3GYHX 4HLYA 5F64A 2H6BA 1SFXA 1GHCA 2YSRA 1IXCA 4HX7A 2VN2A 3IWZA 5BPIA 1A04A 1KYWA 5K5QA 4GXOA 4KIBA 4IHSA 5ILSA 4YFXF 1OMIA 3FMQA 3H3UA 2K02A 4R8HA 3L7WA 4OMZA 3HTSB 4LFUA 4UVCA 2Z99A 1SMYF 3SZPA 2BGCA 1UB9A 4BYYA 4CHUA 3F6VA 4WCGA 5LRRA 1U78A 3IKVA 2HFHA 3KEQA 2VT3A 1XB4A 2DAOA 1KU3A 4WX9A 3KCCA 2Y48A 4EJTA 5E1WA 5IT3A 4EM1A 3QU6A 2L01A 3RKYA 3JW4A 1UHWA 4M9XA 1LDJA 5E8GA 4P5OA 1O57A 1T0FA 5LHHA 2VC1A 3KETA 2QUFA 3GFMA 2L54A 1K7AA 4IRIA 2VOOA 3L09A 2HTSA 4YIIA 2DU9A 1U8RA 1QQIA 2VBWA 1U3EM 4KYWA 4A6DA 5DD4A 1REPC 2GXGA 5HS9A 2QLZA 4MGRA 1KYZA 2FU4A 2J5PA 1ZARA 4WK8F 3ZMZA 4EVIA 1TW2A 4I09A 1V4RA 3V7CA 3WGIA 1J0RA 4B8XA 1R5HA 4G8XA 1B9NA 3RDIA 2ZFWA 1AOYA 1Z1DA 1ONVA 3CO7C 5F1RA 1FWZA 1O3QA 2L4MA 3RPQA 5H6RA 2O03A 4NB5A 5TJJA 4WWCA 4G7OF 1DUXC 4PZJA 4KUMA 4U0VA 1JHFA 2MH2A 2RKHA 2V6CA 3IWFA 1RUNA 5BOXA 1F5TA 2RV8A 2RC4A 1EV7A 5BS6A 3WTVC 1USTA 4KMFA 2VODA 2F5EA 2QM3A 1Z05A 2KIUA 3GEZA 4I0AA 3HYIA 2Z5UA 3NQOA 4Z2YA 4A12A 1D8JA 3D5LA 2ISZA 4CYDA 1S7OA 4GGGA 3TKYA 3CUQA 4U0YA 1WKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q48 A;  3C7J A;  2Z9O A;  1ZG5 A;  2F2E A;  3FM5 A;  4N9H A;  1FYL A;  4ZYD A;  4I98 B;  3GO5 A;  1IRF A;  2H6C A;  3MCZ A;  1WWX A;  1YS7 A;  4L9N A;  3TQN A;  1UHM A;  3JSO A;  2M8E A;  5D5U B;  5LRS A;  2KJB A;  1F9N A;  3QPT A;  3CDH A;  4R79 A;  4RB1 A;  4MQV A;  3NEU A;  2QWW A;  2ZO4 A;  3U2R A;  4H0E A;  2GA1 A;  3KP2 A;  3PFI A;  3FX3 A;  4MTE A;  4LGW A;  5E20 A;  2MA3 A;  2EA2 A;  4EMS A;  3MEX A;  1U5T A;  3SHF A;  1I1S A;  4NHJ A;  3QU3 A;  4HAM A;  5E1Z B;  5DUK A;  3WU0 A;  5BQT A;  1KQ8 A;  2P7V B;  1EH6 A;  5ICE A;  1YO5 C;  2V1X A;  3V8L A;  4KA4 A;  1YYV A;  1XCB A;  2HZT A;  1U5T B;  1KU7 A;  1IN6 A;  4ZZL A;  2GA2 A;  4A2U A;  1I5Z A;  5CVI A;  2OA4 A;  2FE3 A;  5HLI A;  1CF7 A;  5J8C A;  1GXQ A;  3GFI A;  2DK5 A;  2FBH A;  3I54 A;  3ERE D;  1RUO A;  2OBP A;  4CXF A;  5D6F A;  1TBX A;  5LEK A;  3K1P A;  4JBA A;  1QNT A;  1OYI A;  1BI3 A;  2GQQ A;  3HUG A;  3TGN A;  5L3E A;  1S8N A;  1CF7 B;  3BRO A;  5AIQ A;  2JPB A;  3LA2 A;  4XSX F;  2EFP A;  2GZW A;  2OD5 A;  3GFL A;  5DEQ A;  4UXN A;  4EV0 A;  4AD9 A;  1D3Y A;  4EJU A;  5IT9 K;  2NAZ A;  2L4A A;  2G7U A;  1YS6 A;  3TO7 A;  3V7R A;  3WTT C;  3M8E A;  4UNO A;  3E6D A;  4YG2 F;  3TDU C;  3J81 K;  4UVB A;  2VXZ A;  4OU0 A;  1I1G A;  2OU2 A;  3I71 A;  3R60 A;  2DTR A;  1MGT A;  3MZY A;  3WTW C;  1P92 A;  2VE8 A;  2CW0 F;  3P9K A;  3HHG A;  4CZZ A;  4EM0 B;  4MTD A;  2HYG D;  2DPD A;  3ROU A;  2A07 F;  1F4K A;  4EGZ A;  5D6E A;  2A6E F;  3VOD A;  4NQW A;  4ON0 A;  3N97 A;  1L0O C;  4CO8 A;  3HRM A;  4KIF A;  4AIH A;  5E18 F;  4L9V A;  4UHT A;  2CG4 A;  3V7S A;  2ZME A;  1XMA A;  5HS7 A;  1TQP A;  2FBI A;  1UCR A;  3QPH A;  3RYR A;  2XV4 S;  2R7F A;  2M1B A;  5ERI A;  2EV5 A;  2CO5 A;  2EFW A;  5BPD A;  2OZU A;  2ZME B;  4G6Q A;  2QQ9 A;  3C18 A;  4HX8 A;  4S05 A;  1PP7 U;  3E5X A;  3DPT A;  2UXX A;  3K1M A;  2L02 A;  3E97 A;  2VBZ A;  2NNY A;  4IRH A;  1O3S A;  1BC8 C;  4I7H A;  2KIF A;  3BJ6 A;  4RS8 A;  4EJW A;  2HYF A;  4YFK F;  2M5W A;  4I2O A;  1ZRF A;  4Y13 A;  4K2E A;  4CIC A;  3ZMD A;  4A0Z A;  3KLN A;  2V1D A;  2JTV A;  5HDN A;  2PEX A;  1W7P A;  2EWN A;  4RAZ A;  5D5V B;  1GVJ A;  2IA1 A;  3LST A;  2L3D A;  1IAW A;  1XSX A;  2W57 A;  2A5Y B;  3BOQ A;  4M71 A;  1LEA A;  2CYY A;  3Q9V A;  2DFI A;  4ENJ A;  1R1T A;  1J7K A;  2O6G E;  2A61 A;  4ESJ A;  1LVA A;  2W84 A;  4JK1 X;  2PI0 A;  4XRF A;  3GZ6 A;  2VC0 A;  4IHT A;  1S6L A;  3JTG A;  1O7F A;  3DKW A;  4RB0 A;  1D5V A;  4OIQ F;  1YLF A;  1B4A A;  3QP6 A;  3WE2 A;  3FM3 A;  4L0Z B;  4N9I A;  1IXR C;  2RN7 A;  2JRT A;  3LA3 A;  2XAQ A;  3RI4 A;  2K4B A;  4QWQ A;  3WTY C;  1XSV A;  3J80 Z;  3BWG A;  5FD6 A;  1HXD A;  4FT8 A;  4HF2 A;  4KIC A;  3GUD A;  5E1X A;  4WF2 A;  3T5X A;  2HDC A;  2P4W A;  4P9U A;  2P5V A;  1HW5 A;  5FLX Z;  2CSO A;  2LKP A;  3PQJ A;  1ZG3 A;  1FP2 A;  4KNY A;  4M72 A;  1FOK A;  3M8F A;  1L3L A;  3P9I A;  1FX7 A;  5D4S A;  4KMU X;  2ZCW A;  2XRN A;  4A0Y A;  2OAZ A;  2M87 A;  1R00 A;  3FZV A;  2MLG A;  1P6R A;  3FXQ A;  4OIN F;  4LLL A;  4BHP A;  4B09 A;  3M1E A;  4HV6 A;  1ZN2 A;  3ECO A;  2RNJ A;  2GAU A;  1J75 A;  3FMR A;  3LQQ A;  2FEZ A;  2CQK A;  1OKR A;  2C6Y A;  1J2X A;  4P55 A;  3L9F A;  2H27 A;  3O6B B;  1LJ9 A;  5AIP A;  5DUI A;  5K5R A;  4GCV A;  1TNS A;  5HS8 A;  1RI7 A;  5LLQ A;  1BC7 C;  5KVR A;  3WTS C;  3HHH A;  4UV9 A;  6PAX A;  2ZXJ A;  1OYY A;  2Y75 A;  5EEH A;  2X4H A;  1XMK A;  1K6O A;  1JE8 A;  1TLH B;  1G4D A;  3H3Z A;  2ZNY A;  2DT5 A;  3FXR A;  1S29 A;  4JQF A;  3EQL F;  5J6X A;  3SFZ A;  4PGH A;  1ZH5 A;  2BBY A;  2QZ8 A;  4YFN F;  3KZZ A;  2NRA C;  1Z6R A;  4L9T A;  1YW7 A;  1IZ1 A;  1SFE A;  5LGT A;  5HLG A;  2IA2 A;  1LB2 A;  4CGZ A;  1XD7 A;  1XGO A;  3EET A;  1R23 A;  1FBS A;  4KT5 C;  3VOE A;  3DPL C;  1IUY A;  4DQ2 A;  3F8M A;  1YQA A;  5CLS A;  5CVR A;  1ZHF A;  3CUQ C;  2H94 A;  1BJA A;  5F6F A;  4M9Z A;  2MD5 A;  1BOA A;  1FBU A;  2HS5 A;  2NNN A;  4ETS A;  2XHK A;  2DI3 A;  1HSJ A;  2VBY A;  2GXB A;  2MBF A;  4HQM A;  2F5C A;  1RIO H;  5LBQ A;  1T38 A;  1H9G A;  2QYO A;  3SXY A;  3JTH A;  1B9M A;  1FYK A;  4RGS A;  1FZP B;  3P7N A;  3ML6 A;  2M30 A;  3I58 A;  1T2K A;  2FRH A;  4HX4 A;  1DPR A;  1ZLJ A;  4RAY A;  2IRF G;  3EYI A;  4KN7 X;  2MLK A;  5L3G A;  1SAX A;  1U5T C;  1MJB A;  3WU1 B;  3F23 A;  1P4W A;  5A2Q K;  5CVV A;  1B59 A;  2RGV A;  1SD7 A;  3GF2 A;  4FX4 A;  1FSE A;  4OIO F;  3LQR A;  2DBB A;  4HW0 A;  4HQE A;  3CUQ B;  3FXU A;  1DP7 P;  1LDD A;  3WTU C;  1STZ A;  4Q5S F;  1R1U A;  1SFU A;  1BN5 A;  3KEO A;  2QQB A;  4IF4 A;  4ESF A;  4QLC U;  2KRF A;  3E6B A;  5FFZ A;  2FNP A;  4I0B A;  5TRD A;  1XGM A;  4P9F A;  4LB6 B;  3KP6 A;  1HQC A;  4OIP F;  4Q47 A;  2PN6 A;  4ENM A;  3QOP A;  2OQG A;  3CJN A;  3O3K A;  1Y0U A;  3IKT A;  2EV0 A;  4HBL A;  3I53 A;  1HKS A;  3O2P E;  3KLO A;  2IP2 A;  3JAM Z;  5J8F A;  1Q1H A;  1LEB A;  1EH7 A;  4L5J A;  1H0M A;  1IXS B;  4PCQ A;  1ZRD A;  1XDS A;  1YG2 A;  3IL2 A;  1HKT A;  4HDV A;  2D45 A;  4RGR A;  4EM2 A;  4IPA A;  3CUO A;  4LB5 A;  1ZYR F;  5FFX A;  1P4X A;  2KKO A;  1SD5 A;  4AWX B;  1FYM A;  3VFZ A;  2FXA A;  2FMY A;  4EGY A;  2P5K A;  2QBY A;  1XDU A;  3S2W A;  2HR3 A;  1FLI A;  2JT1 A;  2FSW A;  1KQ0 A;  4KDP A;  3OOP A;  3KFW X;  3T8T A;  1HKQ A;  2IVM A;  3ZMS A;  5D4R A;  1J9I A;  4IVN A;  3WOD F;  2AXL A;  3GXO A;  4BNC A;  3HSF A;  1NHA A;  5DCF A;  2PLY A;  1DPU A;  3HRS A;  3K69 A;  1TTY A;  3ZPL A;  3MAJ A;  3P9C A;  5HDK A;  1O7L A;  4RB3 C;  2YR2 A;  3HIF A;  2OQR A;  2BV6 A;  4U7B A;  4L5I A;  1Z7U A;  2P5L C;  2HEO A;  1HW2 A;  4XBF A;  3HSE A;  2YU3 A;  4ZYG A;  2ESN A;  4UV8 A;  1B6A A;  1VTN C;  1USS A;  4YIF A;  1YTY A;  3CTA A;  4LD5 A;  3FMS A;  2XUB A;  1XN7 A;  1WQ2 A;  3DQV C;  2P6T A;  2TDX A;  4EJO A;  3F8C A;  3BJA A;  3TOB A;  5HDG A;  3EYY A;  4U0W A;  2LF8 A;  2DO7 A;  1KA8 A;  3BPX A;  2XVC A;  3BJO A;  1MJ9 A;  2FBK A;  5FGM A;  2E7X A;  3LAJ A;  3V8K A;  3ELK A;  1QGP A;  2VE9 A;  3HTU A;  1JGS A;  4L9J A;  2STW A;  4G7H F;  3GWZ A;  1WSU A;  1XSD A;  3F21 A;  4GYI A;  3MQ0 A;  1JXS A;  4G94 A;  5DD8 A;  4KFC A;  1PP8 F;  2VBX A;  2ZKZ A;  3FHZ A;  3GZ5 A;  1MJA A;  3FWE A;  3WGH A;  4P96 A;  4Q4Z F;  2K4J A;  2CWE A;  4PGG A;  3BZ6 A;  3LFK A;  3BY6 A;  3TO9 A;  1BI0 A;  1XCV A;  1W7P B;  5FB2 A;  4A5M A;  1W5T A;  3K9T A;  4GYG A;  1K79 A;  5HLH A;  1HST A;  5L3D A;  2QEN A;  1S3J A;  5AON A;  1SD4 A;  5LHI A;  2STT A;  2FQ3 A;  3GW2 A;  4BAY A;  5DYM A;  3IRR A;  3U9G A;  1QBJ A;  2AS5 F;  2UWM A;  1CGP A;  1B1B A;  4WXH A;  4IJA A;  1I27 A;  4MHG A;  3JSP A;  3VEP A;  3EUH A;  2YX7 A;  2O3F A;  2J5O A;  2ZBK A;  2D1H A;  2R3S A;  4CDG A;  3GVA A;  2EJR A;  2HQR A;  3GFJ A;  5FD5 A;  1FP1 D;  1FY7 A;  4FX0 A;  4M74 A;  1Z6T A;  2COM A;  2EFQ A;  3TO6 A;  3Q5F A;  2HWV A;  4RGU A;  2Q8K A;  1W7P D;  2Q2E A;  2D1V A;  2EFO A;  4MQ9 F;  5L3B A;  4G9Y A;  2PJP A;  4M6Y A;  1DDN A;  3E6M A;  3ZMU A;  5ICF A;  4O6J A;  4I01 A;  3DV8 A;  5DCM A;  3SZT A;  5HOO A;  2O0Y A;  4ENK A;  2EV6 A;  1Z91 A;  3B02 A;  1ZAO A;  4M6X A;  2K7L A;  3ABU A;  2LDU A;  1J59 A;  5ILV A;  2XRO A;  4XLN F;  4ASN A;  2EK5 A;  1HW1 A;  3F6O A;  5DCM B;  3WTZ A;  2KIM A;  1H9T A;  2FOK A;  3F8N A;  4PDK A;  2A68 F;  3ZN1 A;  1W4M A;  2XAS A;  4WXD A;  1T98 A;  3RKW A;  3I64 A;  2XAJ A;  4WXC A;  5LGN A;  2RVC A;  2FML A;  2EA4 A;  1F1Z A;  4ZH4 F;  4HV5 A;  1BIA A;  5L3F A;  5ICG A;  2LF7 A;  3R4K A;  4HYE A;  1X3U A;  3M9A A;  3NRV A;  3U1D A;  1FPQ A;  4MNU A;  2XAG A;  1W5S A;  2WWY A;  2YX4 A;  4G7Z F;  2JZY A;  4O5V A;  5D5W B;  2ZNZ A;  2RDP A;  1IN7 A;  1BBY A;  4AVP A;  2XAH A;  2HQN A;  4U7D A;  2W25 A;  1SMT A;  5IT9 Z;  1MZB A;  2ESH A;  4UVA A;  1R7J A;  1FSH A;  5EEG A;  2EB7 A;  2XGX A;  2HKO A;  2Y0M A;  3TDZ C;  3Q9S A;  2XKP A;  3KP4 A;  3B73 A;  4S04 A;  2QVO A;  3J81 Z;  3L00 A;  2FNA A;  1LNW A;  1MKM A;  2P7C B;  2XIG A;  3WG9 A;  3MFK A;  3W6J B;  3J7A O;  3GLX A;  2VON A;  3C3W A;  2ZJ2 A;  1ZG1 A;  4ZYE A;  1QO0 D;  3RIR A;  3OV8 A;  5L3C A;  1ON1 A;  1ODD A;  3REO A;  1R1V A;  3I5U A;  4ENN A;  5JFR A;  1TNT A;  3HSR A;  5DDG A;  4L0Y B;  3ZN0 A;  2LSO A;  3H92 A;  1FT9 A;  2BYV E;  1R5G A;  4M9S A;  2JSC A;  5ICC A;  5E17 F;  1ZGA A;  2BEO A;  3WGG A;  2HKX A;  5H6Q A;  3MWM A;  1QZY A;  4A0X A;  3R0A A;  1U2W A;  2DQR A;  1P2F A;  2WTE A;  5LEJ A;  2YPR A;  2BE5 F;  3ECH A;  2P6S A;  4FHT A;  2DQL A;  4OOI A;  1KGS A;  4G6D A;  2IW5 A;  4GO1 A;  3RKX A;  1IF1 A;  4HZF A;  4LJZ F;  1TQM A;  2W85 A;  2VT2 A;  1T6S A;  3VB2 A;  4E70 A;  5K1Y A;  2XAF A;  3ZP5 A;  1HBX G;  5CVU A;  2D2W A;  3K2Z A;  1O3T A;  1E17 A;  1IN5 A;  1WRJ A;  2CGP A;  1ULY A;  2O61 A;  2O8X A;  5JVT A;  3J80 K;  2IT0 A;  5K5O A;  1R36 A;  3ISP A;  3V8J A;  3KP5 A;  2X0L A;  4OIR F;  1C0W A;  2G9W A;  5E8I A;  3D0S A;  3BPV A;  2HOE A;  4M73 A;  1K78 A;  3LA7 A;  3TOA A;  2A3S A;  3IHU A;  2E1C A;  2NYX A;  5FLX K;  2NS0 A;  1BIB A;  3DFG A;  1PUE E;  2FA5 A;  1U6G A;  4L18 B;  4F7Z A;  3KE2 A;  4BH9 A;  2R7D A;  5DV5 A;  1ZGJ A;  1K78 B;  2ACJ A;  1ON2 A;  1LDK B;  1XGN A;  1IN4 A;  3DP7 A;  5LHG A;  2B0L A;  1MDM A;  2FF4 A;  4MEX F;  4KN4 X;  2K86 A;  4HLX A;  1O3R A;  2F5F A;  2RQP A;  3T1B A;  3WTX C;  4BHC A;  2PQ8 A;  5JHU A;  4LMY A;  3E3V A;  1D8K A;  3F72 A;  5CVJ A;  3ZMT A;  3CO6 C;  3RJP A;  1J5Y A;  4O3M A;  1MDM B;  5D8L B;  1LQ1 A;  1G3Y A;  5ILU A;  1FBQ A;  2JPC A;  1JHH A;  3F8B A;  4HDU A;  2V1U A;  3N4M A;  3ABT A;  2VOP A;  3MZH A;  2QBY B;  1SD6 A;  2IPQ X;  3R6S A;  4IRG A;  3M7G A;  5BMZ A;  3RYP A;  5ED4 A;  2IA0 A;  3E5U A;  3LAP A;  5HVQ C;  4TV7 A;  2DK8 A;  3CLO A;  3V4G A;  3EDP A;  4EQQ A;  2G7H A;  4AIJ A;  2PMH A;  5H20 A;  3F8F A;  2Z33 A;  4MEY F;  1ZRE A;  2IJL A;  1G3W A;  3KZY A;  5JR3 A;  3RPU A;  3G3Z A;  2MC3 A;  2OZ6 A;  1FNN A;  3SQN A;  2PMU A;  1R58 A;  1OYW A;  3HRT A;  2ELH A;  3QAH A;  5KK1 A;  1T39 A;  4UUV A;  3R0J A;  4OMY A;  1YW8 A;  2KJC A;  1P4A A;  4XSZ F;  2UZK A;  3HRU A;  1MD0 A;  1AWC A;  3ZMV A;  3QRF F;  4BXU A;  1V3F A;  4LK1 F;  1YFH A;  5CJ9 A;  3C1D A;  1XGS A;  1OR7 A;  3T8R A;  1G3T A;  2EFN A;  2E7W A;  5LGU A;  2PBI A;  4LLG F;  1ZLK A;  4N0B A;  1I6X A;  2PG4 A;  2GIV A;  3K0L A;  3E5Q A;  2A69 F;  1Z9C A;  2K27 A;  3AAF A;  4I02 A;  2QQA A;  2M45 A;  2DLL A;  1RZ4 A;  1BI1 A;  3G73 A;  1UFM A;  3F22 A;  2A6H F;  4Y15 A;  3ULQ B;  4BHB A;  2PFB A;  2HGC A;  3ZQ7 A;  2WC2 A;  3KP7 A;  1FC3 A;  4EJV A;  3COA C;  3R61 A;  1G6N A;  2V79 A;  3DXJ F;  1PDN C;  3E6C C;  3BP8 A;  5CYV A;  4A6E A;  1KU9 A;  5JI6 A;  3BDD A;  4RB2 C;  1RNL A;  3KP3 A;  3DEU A;  4LK0 F;  4XLP F;  1BM9 A;  1ZRC A;  3HOT A;  2ISY A;  5D8K B;  3T0Y A;  3I4P A;  3WE3 A;  3IRQ A;  4IXA A;  3HOS A;  1G3S A;  2DW4 A;  5D5X B;  2H09 A;  1IN8 A;  1WI9 A;  2F5D A;  1E2X A;  2DPU A;  2MH9 A;  1EH8 A;  4ZYH A;  4A5N A;  4HF1 A;  1TQI A;  4RGX A;  4AIK A;  3PQK A;  3GX4 X;  4KIG A;  4ZZD A;  1IW7 F;  3I0T A;  4DNC A;  1GXP A;  1TW3 A;  2WV0 A;  4HF0 A;  3I59 A;  1IRG A;  3W6K B;  2LNB A;  4HA8 A;  4ESB A;  1BI2 A;  4U88 A;  1YIO A;  2XKO A;  2GWR A;  2ADU A;  1KU2 A;  5FO5 A;  2UXN A;  3IC7 A;  1OPC A;  2V9V A;  2HTJ A;  3JAM K;  2E1N A;  2ETH A;  2W24 A;  4LG0 A;  3I59 B;  2Q0O A;  3RTR A;  5A2Q Z;  4HOB A;  1KQ9 A;  3F3X A;  2CFX A;  3LWF A;  2Z3Y A;  2P8T A;  3DF8 A;  4LLN A;  3QP5 A;  4Y17 A;  4R1H A;  4LG0 B;  3FF5 A;  1QPM A;  1R22 A;  4BQA A;  3K1N A;  4D0P A;  1YW9 A;  1QZZ A;  3L2C A;  1S7A A;  3GYH X;  4HLY A;  5F64 A;  2H6B A;  1SFX A;  1GHC A;  2YSR A;  1IXC A;  4HX7 A;  2VN2 A;  3IWZ A;  5BPI A;  1A04 A;  1KYW A;  5K5Q A;  4GXO A;  4KIB A;  4IHS A;  5ILS A;  4YFX F;  1OMI A;  3FMQ A;  3H3U A;  2K02 A;  4R8H A;  3L7W A;  4OMZ A;  3HTS B;  4LFU A;  4UVC A;  2Z99 A;  1SMY F;  3SZP A;  2BGC A;  1UB9 A;  4BYY A;  4CHU A;  3F6V A;  4WCG A;  5LRR A;  1U78 A;  3IKV A;  2HFH A;  3KEQ A;  2VT3 A;  1XB4 A;  2DAO A;  1KU3 A;  4WX9 A;  3KCC A;  2Y48 A;  4EJT A;  5E1W A;  5IT3 A;  4EM1 A;  3QU6 A;  2L01 A;  3RKY A;  3JW4 A;  1UHW A;  4M9X A;  1LDJ A;  5E8G A;  4P5O A;  1O57 A;  1T0F A;  5LHH A;  2VC1 A;  3KET A;  2QUF A;  3GFM A;  2L54 A;  1K7A A;  4IRI A;  2VOO A;  3L09 A;  2HTS A;  4YII A;  2DU9 A;  1U8R A;  1QQI A;  2VBW A;  1U3E M;  4KYW A;  4A6D A;  5DD4 A;  1REP C;  2GXG A;  5HS9 A;  2QLZ A;  4MGR A;  1KYZ A;  2FU4 A;  2J5P A;  1ZAR A;  4WK8 F;  3ZMZ A;  4EVI A;  1TW2 A;  4I09 A;  1V4R A;  3V7C A;  3WGI A;  1J0R A;  4B8X A;  1R5H A;  4G8X A;  1B9N A;  3RDI A;  2ZFW A;  1AOY A;  1Z1D A;  1ONV A;  3CO7 C;  5F1R A;  1FWZ A;  1O3Q A;  2L4M A;  3RPQ A;  5H6R A;  2O03 A;  4NB5 A;  5TJJ A;  4WWC A;  4G7O F;  1DUX C;  4PZJ A;  4KUM A;  4U0V A;  1JHF A;  2MH2 A;  2RKH A;  2V6C A;  3IWF A;  1RUN A;  5BOX A;  1F5T A;  2RV8 A;  2RC4 A;  1EV7 A;  5BS6 A;  3WTV C;  1UST A;  4KMF A;  2VOD A;  2F5E A;  2QM3 A;  1Z05 A;  2KIU A;  3GEZ A;  4I0A A;  3HYI A;  2Z5U A;  3NQO A;  4Z2Y A;  4A12 A;  1D8J A;  3D5L A;  2ISZ A;  4CYD A;  1S7O A;  4GGG A;  3TKY A;  3CUQ A;  4U0Y A;  1WKM A; 
#chains in the Genus database with same CATH topology
 3W3C A;  3BTI A;  1MBG A;  4JYK A;  4Q48 A;  3C7J A;  2Z9O A;  5C4J J;  1ZG5 A;  5EEA A;  2F2E A;  2HOA A;  3FM5 A;  4A3C J;  2ECC A;  4N9H A;  1FYL A;  3OS1 A;  4ZYD A;  1G8X A;  3I4M J;  4I98 B;  3GO5 A;  1TWH J;  1IRF A;  2H6C A;  1WZ2 A;  3MKZ A;  3MCZ A;  5M5W J;  1WWX A;  2WAQ N;  3L2U A;  3JRB A;  1W0T A;  2P81 A;  2NVU B;  1YS7 A;  4L9N A;  2M7B A;  3PFY A;  3TQN A;  1UHM A;  3JSO A;  3NAU A;  2A6T A;  2M8E A;  5D5U B;  4CCL A;  1WJ5 A;  4PJJ A;  1TP4 A;  3OY9 A;  5LRS A;  2VQC A;  5JLX A;  1Y56 A;  1IV8 A;  2KJB A;  3K7A J;  1F9N A;  3QPT A;  3CDH A;  4R79 A;  5EDN A;  1D1A A;  1V5F A;  5DM7 F;  2HOT A;  4RB1 A;  1AHD P;  1EA3 A;  3CMM A;  3M07 A;  4MQV A;  3NEU A;  2QWW A;  2ZO4 A;  3U2R A;  2QGU A;  2XF6 A;  2GA1 A;  3KP2 A;  3PFI A;  3FX3 A;  3KEY A;  4H0E A;  3K10 A;  4MTE A;  4LGW A;  2HVQ A;  5E20 A;  2R7Z J;  2MA3 A;  3OS0 A;  1JKQ C;  3S93 A;  2EA2 A;  1X1A A;  1D0X A;  3OMY A;  4EMS A;  2R7S A;  2ZXH A;  3OSG A;  4RAF A;  3HPG A;  3MEX A;  1U5T A;  5IOZ A;  1WJF A;  3M4O J;  3A03 A;  3SHF A;  1I1S A;  4W1U A;  4NHJ A;  3NWS A;  3QU3 A;  4HAM A;  3CMY A;  5E1Z B;  5DUK A;  4D1Q A;  1AKH A;  3WU0 A;  1MNE A;  5BQT A;  2R92 J;  1Y1V J;  1KQ8 A;  2P7V B;  1EH6 A;  4XKW A;  5ICE A;  1HCR A;  3K4N A;  2MG4 A;  2IS6 A;  1YO5 C;  2V1X A;  4D5C A;  3V8L A;  3LSP A;  1BW5 A;  1Y1W J;  4KA4 A;  1YYV A;  3QYB A;  1XCB A;  3FBI B;  2HZT A;  1U5T B;  1KU7 A;  1IN6 A;  3OYK A;  4ZZL A;  2GA2 A;  4A2U A;  1I5Z A;  5CVI A;  2OA4 A;  3FIW A;  4EEF G;  2FE3 A;  3CCS I;  5HLI A;  4BGD A;  1MBJ A;  1CF7 A;  4FCY A;  5J8C A;  1GXQ A;  3GFI A;  2XPW A;  2DK5 A;  2FBH A;  3I54 A;  2IEK A;  3ERE D;  1RUO A;  5M5Y J;  2OBP A;  2E35 A;  3BLY A;  3HM5 A;  4CXF A;  5D6F A;  1TBX A;  5LEK A;  1HDP A;  3K1P A;  3D5S C;  4JBA A;  1QNT A;  1OYI A;  4BEH A;  4IOC F;  1BI3 A;  4V19 K;  2GQQ A;  4ZDL A;  3ZXS A;  2V6E A;  4NC6 A;  3HUG A;  3TGN A;  5L3E A;  1S8N A;  2CUF A;  3S16 J;  1CF7 B;  3BRO A;  5AIQ A;  2JPB A;  2VKE A;  3LA2 A;  3BZK A;  4XSX F;  4YEJ A;  2EFP A;  2GZW A;  2LG4 A;  4A69 C;  1VQN I;  2DMP A;  3HC7 A;  3S1Q J;  2OD5 A;  1X1C A;  3BTL A;  3GFL A;  1OR7 C;  5DEQ A;  4UXN A;  5HLT A;  4EV0 A;  2GBY A;  1APL C;  1A5J A;  2DOD A;  1V54 H;  4AD9 A;  1D3Y A;  4BEH B;  4EJU A;  2NAZ A;  5IT9 K;  1F43 A;  2L4A A;  2XSJ C;  1R6R A;  2G7U A;  3IH3 A;  4HST A;  5FRN A;  3MN2 A;  2WY8 Q;  5E3N A;  1YS6 A;  1RKW A;  5GP9 A;  3TO7 A;  4BL0 B;  3V7R A;  3L2V A;  4D5F A;  4A3I J;  3WTT C;  2HYJ A;  3M8E A;  4UNO A;  1JTY A;  3E6D A;  4YG2 F;  3TDU C;  3J81 K;  4UVB A;  3CJR B;  2VXZ A;  4OU0 A;  1I1G A;  1BOB A;  2OU2 A;  3I71 A;  2KT0 A;  2DTR A;  3R60 A;  1ETQ A;  1MGT A;  3MZY A;  5C44 J;  3WTW C;  5LFA A;  1P92 A;  2VE8 A;  2CW0 F;  3P9K A;  3HHG A;  4CZZ A;  2L7K A;  4EM0 B;  4MTD A;  1OCZ H;  2HU9 A;  3A1Y A;  2JRM A;  2HYG D;  3S8P A;  2DPD A;  3ROU A;  2A07 F;  1F4K A;  1J09 A;  2TRT A;  5EYR A;  4CUG A;  3NWT A;  4EGZ A;  4AUX A;  1XG1 A;  5D6E A;  2A6E F;  3VOD A;  4NQW A;  4ON0 A;  3N97 A;  2W4S A;  1L0O C;  4CO8 A;  3HRM A;  4XLA A;  4KIF A;  2EZH A;  4AIH A;  1JT6 A;  4L9V A;  5E18 F;  2DT7 B;  4C3I J;  2IS4 A;  3QPS A;  4UHT A;  4KIT B;  2MGQ A;  2CG4 A;  1VND A;  3V7S A;  4XMY A;  2M7A A;  4LOC A;  2ZME A;  1JI8 A;  1XMA A;  5HS7 A;  3CF2 A;  1VQ8 I;  2R0Q C;  1TQP A;  2KMU A;  2I8D A;  1LKX A;  2HVR A;  2VAS A;  2F6C A;  2FBI A;  3PUB A;  1UCR A;  3QPH A;  2L9N A;  3RYR A;  3GTL J;  1HDD C;  2XV4 S;  1ZK8 A;  2R7F A;  4NQW B;  4FE4 A;  2M1B A;  2ZJQ F;  5ERI A;  2XDV A;  1UHS A;  1UMQ A;  3OYE A;  2VKH A;  1H88 C;  2EV5 A;  2X9D A;  2CO5 A;  2EFW A;  2BOL A;  5BPD A;  4F91 B;  2OZU A;  1IDY A;  2G0E A;  2ZME B;  3JRI A;  4G6Q A;  2QQ9 A;  3C18 A;  4MIM A;  4HX8 A;  2UUZ A;  2RAE A;  4S05 A;  3EUA A;  4DBR A;  1PP7 U;  2B7E A;  3E5X A;  3DPT A;  3MKY B;  1QZE A;  1WPK A;  2UXX A;  3VDX A;  3K1M A;  1SAN A;  2L02 A;  1Z67 A;  3E97 A;  1FMV A;  2XF7 A;  2VBZ A;  2NNY A;  1R4N B;  2KPM A;  1MBF A;  4IRH A;  3A2K A;  1O3S A;  1OCR H;  3VYU B;  1BC8 C;  4I7H A;  5KAI C;  5BNG A;  3AL0 B;  2FX0 A;  2KIF A;  1ETK A;  4MO7 A;  1X1B A;  3BJ6 A;  3H5A A;  4RS8 A;  4EJW A;  2EIL H;  2HYF A;  3PL8 A;  4YFK F;  2M5W A;  4I2O A;  3FHN A;  1ZRF A;  3DBH B;  1X4P A;  2JMW A;  4Y13 A;  4K2E A;  4CIC A;  1YX3 A;  3ZMD A;  4A0Z A;  3KLN A;  2V1D A;  2JA6 J;  2O7O A;  3LSM A;  2JTV A;  3RSN A;  3SEZ A;  4I99 C;  5HDN A;  2PEX A;  1W7P A;  2EWN A;  4RAZ A;  5D5V B;  2LFB A;  5J1R A;  2UV1 A;  2CV2 A;  1GVJ A;  3AKZ A;  2IA1 A;  3W6V A;  2MAB A;  2L3D A;  3LST A;  3ZCO A;  1IAW A;  2E2J J;  1XSX A;  2W57 A;  2R7Q A;  2E19 A;  4RBO A;  2A5Y B;  3BOQ A;  4M71 A;  1LEA A;  5GAG J;  3HL2 A;  5FLV A;  2CYY A;  1VQK I;  3Q9V A;  4CCK A;  2DFI A;  4ENJ A;  4E7J A;  1R1T A;  1J7K A;  2QKM B;  2O6G E;  3HOW J;  2A61 A;  3A02 A;  1LE8 B;  1H8A C;  3PJR A;  3ONQ A;  1TWA J;  3G1L A;  2IAI A;  1LVA A;  2W84 A;  2KDZ A;  4ESJ A;  4JK1 X;  2PI0 A;  3CDL A;  4XRF A;  5B1B H;  2V26 A;  3GZ6 A;  1WI3 A;  3C2B A;  2DYR H;  2CW7 A;  3ASN H;  5JVG F;  1TC3 C;  2VC0 A;  4ABZ A;  5E3O A;  3H9Q A;  4C9Y A;  4FAS D;  4IHT A;  2DA4 A;  1S6L A;  3SYT A;  3JTG A;  5J40 A;  2IS1 A;  1O7F A;  3DKW A;  4DBQ A;  2IXS A;  4RB0 A;  2ID3 A;  2JA2 A;  1D5V A;  4OIQ F;  1YLF A;  2JUG A;  2X6X A;  1B4A A;  3QP6 A;  1IJW C;  1IC8 A;  3WE2 A;  3FM3 A;  4L0Z B;  4N9I A;  1ETY A;  2BW3 A;  1IXR C;  5E3M A;  2RN7 A;  2JRT A;  3VYR B;  3LA3 A;  4BKX A;  1Y8Q B;  3S3M A;  2XAQ A;  5FKN A;  5KHD A;  5HOD A;  2HI3 A;  3RI4 A;  4XN0 A;  1WFX A;  2WAQ A;  2K4B A;  2CMP A;  4QWQ A;  3WTY C;  2KL4 A;  1XSV A;  3BC8 A;  5F0H A;  2E1M B;  4IHW A;  3J80 Z;  3BWG A;  4XLF A;  3K4L A;  5FD6 A;  1HXD A;  5EZH A;  3HGY A;  1KZH A;  4FT8 A;  5C4X J;  4HF2 A;  4KIC A;  1W0U A;  3BR6 A;  3GUD A;  5CKT A;  4F92 B;  2DT6 A;  1I3Q J;  3S3N A;  1YX5 A;  1Z0X A;  5E1X A;  4E4H A;  3PIP F;  1OCT C;  1T33 A;  3F0C A;  4WF2 A;  3T5X A;  5FKK A;  2HDC A;  2P4W A;  3S3O A;  2PJR A;  4P9U A;  2P5V A;  3Q0V A;  1HW5 A;  1XX5 A;  5FLX Z;  2CSO A;  3BR2 A;  2R5Z A;  4JOM A;  2LKP A;  3PQJ A;  3GTP J;  1ZG3 A;  3OYG A;  5DM6 F;  3CC7 I;  1FP2 A;  3AG1 H;  2EZK A;  4KNY A;  4M72 A;  1T0F C;  2L7F P;  1HOM A;  3DTI A;  2MSY A;  1FOK A;  1NTC A;  1PJR A;  1QVU A;  3M8F A;  3HKZ N;  4XQF A;  1EF4 A;  2PJR B;  4A3G J;  4PFO A;  1L3L A;  3CLQ A;  3P9I A;  1FX7 A;  5D4S A;  3OYJ A;  2AHQ A;  2R5Z B;  2ELK A;  3FXJ A;  4KMU X;  1FIP A;  4E7K A;  2ZCW A;  2XRN A;  2ID6 A;  4A0Y A;  2XAU A;  2OAZ A;  2M87 A;  4XKB A;  1R00 A;  3FZV A;  2VL8 A;  2MLG A;  1P6R A;  1ZGW A;  3FXQ A;  4OIN F;  4LLL A;  1E3O C;  4BHP A;  3C2H A;  2JVH A;  4B09 A;  2DOE A;  3M1E A;  3S17 J;  5IYD J;  4HV6 A;  3OYM A;  3DPU A;  5B1A H;  4NBQ A;  1ZN2 A;  5IYB J;  2EPF A;  4UB8 C;  3S14 J;  3ECO A;  4BQN A;  4YIR X;  2RNJ A;  2ZC2 A;  2GAU A;  1J75 A;  2H8W A;  4EAT A;  3FMR A;  3LQQ A;  1JT0 A;  2FEZ A;  2CQK A;  1OKR A;  4GDF A;  2X6W A;  2C6Y A;  1J2X A;  3CCQ I;  4P55 A;  3HOU J;  3L9F A;  2H27 A;  4AU7 A;  3O6B B;  1LJ9 A;  5AIP A;  3CDI A;  5DUI A;  5K5R A;  4GCV A;  1TNS A;  5HS8 A;  1RI7 A;  5LLQ A;  5F27 A;  1BC7 C;  5KVR A;  3WTS C;  3HHH A;  2I10 A;  3A0H C;  1IUF A;  4UV9 A;  6PAX A;  2ZXJ A;  2R7W A;  1XS9 A;  1OYY A;  2KZG A;  2Y75 A;  3CMA I;  5EEH A;  2X4H A;  3B6A A;  3FIS A;  1U0J A;  4GRI A;  2WY7 Q;  2M9H A;  1XMK A;  1K6O A;  1JE8 A;  2WB1 N;  1TLH B;  3SZG A;  1G4D A;  1JKR C;  3H3Z A;  2ZNY A;  2DTZ A;  2DT5 A;  4A3F J;  3FXR A;  3CD6 I;  1S29 A;  4JQF A;  3EQL F;  4PFP A;  2GM4 A;  4ZDP A;  5J6X A;  3SFZ A;  2XSD C;  4PGH A;  1ZH5 A;  2BBY A;  2QZ8 A;  4YFN F;  3KZZ A;  2NRA C;  3ESW B;  1Z6R A;  3E1S A;  1YW7 A;  2LP0 A;  1IZ1 A;  1SFE A;  4L9T A;  5LGT A;  3GTQ J;  5HLG A;  4IEJ A;  2IA2 A;  1LB2 A;  3IP4 B;  1WJE A;  2OPT A;  2VPR A;  1XD7 A;  4CGZ A;  1XGO A;  2XB5 A;  3K4M A;  2E2H J;  2DDA A;  3EET A;  1R23 A;  1FBS A;  2KHM A;  4KT5 C;  3DPL C;  3VOE A;  2HVS A;  4DQ2 A;  1IUY A;  2B63 J;  1VFC A;  3F8M A;  1YQA A;  1K83 J;  4UUS A;  2O8K A;  3KYC B;  5CLS A;  2X1C A;  4B1R A;  5CVR A;  3ZQI A;  1FEX A;  1ZHF A;  1UJ8 A;  4QPQ A;  3SDG A;  3CUQ C;  2E71 A;  3IAS 2;  2H94 A;  4CCM A;  1X2M A;  2LRE A;  1BJA A;  2LR8 A;  4UY8 I;  5F6F A;  4M9Z A;  1T95 A;  4CA0 A;  5J47 A;  2MD5 A;  2BHZ A;  1BOA A;  4M3B A;  2CQQ A;  1FBU A;  1B72 A;  2HS5 A;  1ACI A;  5HNH A;  2NNN A;  4UUS B;  3JR9 A;  2LY9 A;  1XMX A;  4ETS A;  1A36 A;  5E79 C;  1XTA A;  2XHK A;  4BBR J;  2VJI A;  2DI3 A;  2Y2Z A;  1VQL I;  1HSJ A;  2VBY A;  2GXB A;  3BTJ A;  2MBF A;  4HQM A;  2K5C A;  2F5C A;  2LYC A;  3ZQC A;  3I55 I;  5HNF A;  1RIO H;  5LBQ A;  3K70 D;  3OR1 C;  1PYV A;  2DA6 A;  1T38 A;  1H9G A;  1GT0 C;  1X2N A;  2QYO A;  3SXY A;  3JTH A;  1B9M A;  1FYK A;  4RGS A;  5E3L A;  1FZP B;  1MBH A;  3P7N A;  3LNQ A;  4KIS A;  3ML6 A;  3I4N J;  2M30 A;  3I58 A;  3LL7 A;  1T2K A;  2FRH A;  3K4J A;  1DPR A;  4HX4 A;  4JX4 A;  3DWL E;  1ZLJ A;  3LSJ A;  4PJ0 C;  4PJN A;  4RAY A;  1QRY A;  2IRF G;  3KX2 A;  3G4S I;  3EYI A;  4KN7 X;  2MLK A;  1QPI A;  5L3G A;  1SAX A;  1U5T C;  4CSW A;  2R7T A;  4HSR A;  1MJB A;  2H8R A;  3WU1 B;  2KDO A;  3GTJ J;  3F23 A;  2KRH A;  1A6Q A;  1P4W A;  3IUO A;  3U21 A;  5A2Q K;  1TL8 A;  5F0C A;  5CVV A;  4I76 A;  1B59 A;  3S1N J;  3HDD A;  2RGV A;  2BVM A;  1SD7 A;  3GF2 A;  5H2F C;  2QCO A;  4II3 A;  2CQX A;  4G6T B;  4FX4 A;  4XLH A;  1W5C C;  2R5Y A;  1LFP A;  1FSE A;  2Z16 A;  1R5I D;  4OIO F;  3LQR A;  5FKL A;  2DBB A;  5K7Z A;  4HW0 A;  4HQE A;  3BR5 A;  2VUM J;  3CES A;  3CUQ B;  3WHB A;  3NAR A;  3FXU A;  1DP7 P;  3PNV A;  4U87 A;  5JHF A;  1LDD A;  3WTU C;  2CV1 A;  1STZ A;  2BXY A;  4Q5S F;  1MBK A;  1R1U A;  5J1U A;  1TT5 B;  2YU9 J;  4ZYA A;  1SFU A;  1BN5 A;  3KEO A;  4DYR A;  3HEF A;  2QQB A;  4IF4 A;  4ESF A;  3E7L A;  4OAZ A;  4BE1 A;  1D5Y A;  4QLC U;  3QPL A;  1H89 C;  4XRS G;  1BR2 A;  3BG3 A;  2OUM A;  2KRF A;  3K6G A;  3LMM A;  3E6B A;  3P5J A;  1VQ4 I;  3CJT B;  2Z2S B;  3Q3S A;  5FFZ A;  2FNP A;  4I0B A;  5TRD A;  4RM3 A;  3FDY A;  1XGM A;  3OYB A;  4P9F A;  2GOM A;  4LB6 B;  3S2D J;  2V4J C;  2A5W A;  3KP6 A;  2E2I J;  1HQC A;  4OIP F;  4Q47 A;  2PN6 A;  3IV5 A;  3VWB A;  1ZEL A;  4ENM A;  4B48 A;  3RZO J;  3QOP A;  2OQG A;  3CJN A;  1OLT A;  3FKJ A;  3I9V 2;  3HBL A;  3O3K A;  1Y0U A;  4AVZ A;  3IKT A;  2EV0 A;  1Y6I A;  1MMG A;  3KYD B;  4BQQ A;  4HBL A;  3I53 A;  1HKS A;  3O2P E;  3KLO A;  2IP2 A;  2Y31 A;  3DU6 A;  4LIT A;  2BHY A;  3JAM Z;  5J8F A;  2QSH X;  3OOU A;  1Q1H A;  3WG7 H;  1LEB A;  1EH7 A;  3IAM 2;  3MVP A;  1IXS B;  4L5J A;  4PCQ A;  3ZQG A;  1TWG J;  1H0M A;  1PVE A;  3H35 A;  1XDS A;  1YG2 A;  2BY2 A;  3TP0 A;  3IL2 A;  2YUS A;  4HDV A;  2D45 A;  1HKT A;  4RGR A;  4EM2 A;  3H5N A;  2ZJP F;  4RLF A;  1AKH B;  5GAD J;  4IPA A;  5FJ8 J;  3CUO A;  1YIT I;  4LB5 A;  1ZYR F;  1DGW Y;  1OJL A;  5FFX A;  1P4X A;  2KKO A;  1SD5 A;  2FD5 A;  4AWX B;  1FYM A;  1VF9 A;  3VFZ A;  2FXA A;  4C2U A;  3SFI A;  2FMY A;  4EGY A;  2P5K A;  3L1P A;  2QBY A;  2LY2 A;  3RCO A;  1XDU A;  4A3D J;  3S2W A;  1POG A;  1CQT A;  2HR3 A;  2ICW G;  3QYF A;  2RRE A;  3JRF A;  1FLI A;  2K85 A;  3CCJ I;  2JT1 A;  3H0D A;  2HDD A;  2LD5 A;  1ZR4 A;  2FSW A;  2TCT A;  1KQ0 A;  4E6K G;  5F0F A;  1DGR M;  3OOP A;  3KFW X;  4KDP A;  3T8T A;  3FK6 A;  1E0E A;  3H9G A;  2L9V A;  2F5V A;  1HKQ A;  2KLO A;  3GZN B;  3OIO A;  2IVM A;  3HKZ A;  1SFO J;  3ZMS A;  5D4R A;  2CRG A;  2VLA A;  1YJW I;  1J9I A;  3FXL A;  3RQI A;  2CS3 A;  4IVN A;  2ZME C;  1K4S A;  2LRD A;  3WOD F;  2AXL A;  4BE2 A;  3GXO A;  3MD2 A;  3HSF A;  4BNC A;  3HUG B;  1NHA A;  1BW6 A;  5DCF A;  1OCC H;  2PLY A;  2EIM H;  2M0M A;  1D0Z A;  2FUG 2;  1DPU A;  3G1M A;  3HRS A;  3BG7 A;  3K69 A;  4KT6 A;  1TTY A;  2X48 A;  3ZPL A;  3MAJ A;  4Y3O A;  3P9C A;  5HDK A;  1O7L A;  4RB3 C;  2YR2 A;  1N75 A;  4ANJ A;  2RQQ A;  3HIF A;  2OQR A;  3AL0 C;  3JRG A;  1IO2 A;  2BV6 A;  4PUS A;  4FTH A;  3A01 A;  3ZOB A;  2Z1D A;  3AG2 H;  1X19 A;  4U7B A;  4L5I A;  1Z7U A;  2ZFU A;  3ZQL A;  2P5L C;  4PSX A;  2HEO A;  4W97 A;  2E1O A;  4M3E A;  1HW2 A;  4XKV A;  2X6O A;  3BG9 A;  4XBF A;  3KZI C;  3HSE A;  2YU3 A;  3FXO A;  4ZYG A;  2ESN A;  1FOW A;  4ZC3 A;  4UV8 A;  1B6A A;  1VTN C;  1USS A;  2EBI A;  4YIF A;  1YTY A;  3CTA A;  4LD5 A;  3FMS A;  1MH3 A;  4IOA F;  1NK3 P;  2XUB A;  1XN7 A;  5IY5 H;  2EIK H;  1WQ2 A;  3DQV C;  4C3J J;  2P6T A;  2TDX A;  4EJO A;  2R93 J;  3F8C A;  3BJA A;  1YE9 A;  3TOB A;  2ELJ A;  5HDG A;  4B4C A;  4C3H J;  4G12 A;  3EYY A;  3DBR B;  3PNT A;  4U0W A;  3BQZ A;  4CCO A;  2WB1 A;  2LF8 A;  2MD0 A;  3CCM I;  2DO7 A;  1KA8 A;  2CUZ A;  2F4M B;  3BPX A;  1VQ7 I;  2DXI A;  2HOS A;  1MMS A;  1E3P A;  2XVC A;  3BJO A;  1MJ9 A;  2FBK A;  5TIS C;  4IHV A;  3FK7 A;  5CPR B;  5FGM A;  2E7X A;  3S32 A;  3LAJ A;  3V8K A;  3ELK A;  1QGP A;  1S7E A;  2LKX A;  1U8B A;  4XON A;  5GTH C;  2VE9 A;  3H5R A;  1I3A A;  2JN6 A;  5C3E J;  3HTU A;  1JGS A;  2QEX I;  3ABM H;  4L9J A;  2STW A;  2WAF A;  1WCM J;  3G1O A;  3GCM A;  4G7H F;  1JUM A;  3GWZ A;  1WSU A;  1XSD A;  3F21 A;  1Z77 A;  4GYI A;  3MQ0 A;  3OR2 C;  2OF7 A;  3BZC A;  1JXS A;  2QQ8 A;  4RLQ A;  4G94 A;  5DD8 A;  4KFC A;  1TZL A;  1PP8 F;  4KJZ A;  2KFD A;  2VBX A;  2ZKZ A;  3FHZ A;  2VKV A;  4NDL A;  2BZT A;  3GZ5 A;  2E1M C;  1LFB A;  3BCA A;  2FJ1 A;  3K2A A;  4MFE A;  2M4G A;  1V55 H;  1MJA A;  3O8G A;  3FWE A;  4IHX A;  3GTG J;  2DOA A;  2IS2 A;  3WGH A;  4A3B J;  2VPL A;  4P96 A;  4Q4Z F;  5K7F A;  2K4J A;  1P7J A;  2CWE A;  1PUF A;  4PGG A;  3BZ6 A;  1OCP A;  4Y4R A;  4YRV A;  3LFK A;  3BY6 A;  4BS9 A;  1A31 A;  5FKM A;  3TO9 A;  1BI0 A;  2ECB A;  1XCV A;  1W7P B;  2EZL A;  2L5Q A;  3L2R A;  5FB2 A;  4CYC A;  4A5M A;  1W5T A;  4DIQ A;  4E7I A;  3DEW A;  3K9T A;  4LIU A;  4GYG A;  1K79 A;  5HLH A;  2E5Z A;  3DCF A;  2R7R A;  1BA5 A;  1HST A;  5L3D A;  2QEN A;  4Y52 J;  5EF6 A;  1PUF B;  1S3J A;  2X6Y A;  2CJJ A;  1SD4 A;  5AON A;  1ITY A;  3HOY J;  3UKG A;  5IP6 A;  5LHI A;  2STT A;  3B6C A;  2FQ3 A;  4X6A J;  3BG5 A;  2JUC A;  1IRZ A;  3GW2 A;  4BAY A;  5DYM A;  3IRR A;  3U9G A;  1QBJ A;  1UG2 A;  2AS5 F;  4CYC B;  2UWM A;  1XPX A;  3BG6 A;  3LSI A;  1CGP A;  1B1B A;  3Q0U A;  4N4O B;  4WXH A;  3OYF A;  1YI2 I;  4IJA A;  3TW6 A;  1I27 A;  4MHG A;  3DBL B;  3JSP A;  3VEP A;  2X51 A;  4I6Z A;  3EUH A;  2DN0 A;  2HNH A;  2YX7 A;  2WAD A;  2ZXI A;  2O3F A;  5GPA A;  2J5O A;  2ZBK A;  3CP2 A;  4B44 A;  4A3E J;  2D1H A;  2R3S A;  1MIJ A;  1Q1V A;  4CDG A;  3GVA A;  2EJR A;  1RES A;  3KYL A;  1M1E B;  1W1W E;  2HQR A;  1JTX A;  3OL4 A;  2WV1 A;  2LTP A;  3GFJ A;  1GLN A;  1AA7 A;  2E5N A;  5FD5 A;  2BW3 B;  1FP1 D;  1I6H J;  1FY7 A;  4FX0 A;  2KP6 A;  2EZI A;  4QPO A;  4Z6Y A;  4M74 A;  3PIO F;  4GFB A;  5FRM A;  5JLW A;  2V9P A;  3I3L A;  3J7A Y;  1Z6T A;  2ZJR F;  2COM A;  3H9J A;  5KNL A;  2EFQ A;  3TO6 A;  3Q5F A;  2HWV A;  2PX9 A;  4RGU A;  4BQO A;  2Q8K A;  1W7P D;  2Q2E A;  5DTD A;  1JKO C;  2Y9Y A;  2D1V A;  2DFF A;  2EFO A;  4MQ9 F;  5L3B A;  1B8I A;  2M4K A;  4G9Y A;  2PJP A;  2X1D A;  4M6Y A;  1DDN A;  3E6M A;  3ZMU A;  1IGN A;  5ICF A;  4O6J A;  4I01 A;  3DV8 A;  5DCM A;  3SZT A;  3VSK A;  5HOO A;  2O0Y A;  4ENK A;  2LKS A;  2EV6 A;  1Z91 A;  2LBF A;  3B02 A;  4QIW N;  3QWL A;  1ZAO A;  1LVK A;  2K7L A;  4M6X A;  2CQ7 A;  2K3F A;  3ABU A;  2LDU A;  1J59 A;  5ILV A;  3K70 C;  1F36 A;  1WJD A;  1QHG A;  2NOJ B;  2Q2E B;  9ANT A;  2EQR A;  2XRO A;  4A3M J;  4XLN F;  1B8I B;  4ASN A;  4XKC A;  2COB A;  2P0W A;  3D5R C;  4JX5 A;  2EK5 A;  3TP3 A;  3CCE I;  1HW1 A;  3F6O A;  2ZSH B;  3KPH A;  5DCM B;  3WTZ A;  2KIM A;  1H9T A;  2FOK A;  3F8N A;  2K9N A;  2R4G A;  2V7F A;  3PNY A;  4PDK A;  2A68 F;  3ZN1 A;  3WHC A;  4AYB N;  1W4M A;  3DLL F;  2IGN A;  2XAS A;  4WXD A;  5GAH J;  3OIP A;  4NC7 A;  5EZG A;  1T98 A;  4XID A;  1N78 A;  3OWT A;  3RKW A;  3I64 A;  2XGC A;  2V9K A;  3VYT B;  1K4T A;  1ZQ3 P;  2VJ4 A;  2XAJ A;  3KIO A;  4WXC A;  4BJT A;  5LGN A;  4DZP A;  5GAE J;  2QF7 A;  3DEE A;  1Z7L A;  2F48 A;  2O5R A;  2RVC A;  2FML A;  4PK4 A;  2EA4 A;  3G6E I;  3HOX J;  1F1Z A;  4ZH4 F;  4HV5 A;  1ERD A;  2VQL A;  1BIA A;  5L3F A;  2W82 A;  1OIS A;  3QYE A;  2XGE A;  5ICG A;  1WJA A;  1RR7 A;  2LF7 A;  3DLA A;  1QVT A;  1UEL B;  1VQP I;  3R4K A;  4HYE A;  1X3U A;  2M34 A;  4F3Q A;  2KIS A;  4IQJ A;  3M9A A;  2FOW A;  2K9M A;  3NRV A;  3U1D A;  1FPQ A;  4MNU A;  3AG4 H;  2YS9 A;  2XAG A;  1W5S A;  2WWY A;  1YOV B;  2ZB9 A;  2YX4 A;  5FLM J;  2ME6 A;  4G7Z F;  1WJB A;  2JZY A;  4O5V A;  5D5W B;  1RR8 C;  2L9S A;  1JUP A;  2ZNZ A;  2L2O A;  2RDP A;  1IN7 A;  1BBY A;  4AVP A;  2AQF A;  2XAH A;  2HQN A;  3DU5 A;  3LSH A;  2FQ4 A;  4U7D A;  2W25 A;  1VZ0 A;  1SMT A;  5J3L A;  5IT9 Z;  1MZB A;  3OYC A;  2ESH A;  4V2G A;  1A35 A;  3OS2 A;  4UVA A;  1R7J A;  1T56 A;  1FSH A;  5EEG A;  2EB7 A;  3FKI J;  2XGX A;  4OAY A;  5J4V A;  4F55 A;  2HKO A;  3S15 J;  2Y0M A;  3TDZ C;  4DYC A;  3Q9S A;  2XKP A;  2NVQ J;  3KP4 A;  3B73 A;  4BAC A;  2KIQ A;  2H1L A;  1Z3Y A;  2QVO A;  4S04 A;  3J81 Z;  5J1Y A;  4NNJ A;  3L00 A;  2M2E A;  2MW8 A;  3GBG A;  4BY7 J;  2FNA A;  1E3H A;  3GTM J;  3J7Z I;  1R71 A;  5F04 A;  3GTK J;  1YIJ I;  4HNV A;  3MZ8 A;  4IO9 F;  1LNW A;  4XOP A;  1OQY A;  5KAF C;  4RA2 A;  2DJN A;  2XB0 X;  1KON A;  1MKM A;  1P7I A;  2XIG A;  3WG9 A;  2P7C B;  3MFK A;  1P9Q C;  2NVX J;  1RET A;  3W6J B;  3J7A O;  1NG6 A;  3DTK A;  2M3A A;  3GLX A;  4E7S A;  3QOD A;  2Y30 A;  1R9T J;  3C3W A;  5M3F J;  2VON A;  1GV2 A;  2ZJ2 A;  1ZG1 A;  2EIJ H;  1D1B A;  4CCJ A;  4ZYE A;  4NC8 A;  5EG0 A;  2LOO A;  5CQG A;  1QO0 D;  4CCN A;  3RIR A;  3OV8 A;  1MSE C;  4L5E A;  5L3C A;  2CQN A;  1ON1 A;  2DOF A;  1ODD A;  2Y0S N;  3REO A;  1VQ9 I;  1R1V A;  3I5U A;  4ENN A;  5JFR A;  3H36 A;  1D1C A;  4ZDO A;  1SVL A;  4IHY A;  1TNT A;  3HSR A;  5DDG A;  2DMT A;  4L0Y B;  3ZN0 A;  2LSO A;  2ZXW H;  2KQR A;  3BT9 A;  3CP8 A;  3H92 A;  4BDY A;  1FT9 A;  1FMW A;  2BYV E;  4QSH A;  3W2W A;  4E7Z A;  1R5G A;  4HG2 A;  4M9S A;  5EG0 B;  2OV7 A;  2JSC A;  5ICC A;  2XPV A;  4CH7 A;  1ZGA A;  5E17 F;  2BEO A;  3WGG A;  2HKX A;  5H6Q A;  3MWM A;  3TW7 A;  1QZY A;  3DKX A;  4A0X A;  2MFZ A;  1IV6 A;  4XIC A;  1B72 B;  1SAU A;  4Y33 A;  2HZD A;  1YHQ I;  2X1E A;  2R7O A;  3R0A A;  2DA7 A;  1U2W A;  2DQR A;  1P2F A;  3ABK H;  2WTE A;  3H1C A;  5LEJ A;  2YPR A;  3PSI A;  1ZR2 A;  1DP3 A;  2BE5 F;  3SEQ A;  3ECH A;  2P6S A;  4FHT A;  2DQL A;  3EPZ A;  4OOI A;  1KGS A;  1ETV A;  2R7V A;  4G6D A;  3M8J A;  2IW5 A;  4GO1 A;  3RKX A;  1IF1 A;  1VQ5 I;  1DQU A;  4D9J A;  1T08 B;  5IYC J;  1UZC A;  4HZF A;  4LJZ F;  1TQM A;  4DGW B;  4BU2 A;  2W85 A;  1MNM C;  2VT2 A;  4C2M J;  1T6S A;  4PSW A;  1VI0 A;  2BY0 A;  2W1O A;  3IH4 A;  3IH2 A;  2BVL A;  3HB9 A;  3VB2 A;  4E70 A;  4IKF A;  4UB6 C;  5K1Y A;  2XAF A;  2MC4 A;  2PMZ N;  2X85 A;  3LSG A;  1LPQ A;  3ZP5 A;  3VPR A;  3WU2 C;  1HBX G;  4M3D A;  5CVU A;  2D2W A;  1U9N A;  5K7H A;  1MH4 A;  3K2Z A;  4NUB A;  1O3T A;  1E17 A;  1IN5 A;  2OCC H;  4BJ5 C;  2IGM A;  1WRJ A;  2CGP A;  1ULY A;  2O61 A;  1WGX A;  3AG3 H;  3FXM A;  2O8X A;  5JVT A;  3OYD A;  3J80 K;  2DYS H;  3RQ4 A;  2IT0 A;  5K5O A;  1R36 A;  3ISP A;  2VIX A;  3V8J A;  3G71 I;  3KP5 A;  2X0L A;  4OIR F;  1N25 A;  2DMQ A;  4Y7N J;  1X3Z B;  2F4I A;  1FOX A;  1BR1 A;  3ZGK A;  1C0W A;  4A3L J;  2G9W A;  5E8I A;  4DW6 A;  2R5Y B;  2F4O B;  3D0S A;  1SVM A;  3BPV A;  2HOE A;  4M73 A;  1K78 A;  3LA7 A;  3TOA A;  2A3S A;  3MKL A;  1QHH D;  2K9Q A;  3IHU A;  1T8I A;  3EUK L;  2E1C A;  2NYX A;  5FLX K;  2NS0 A;  1Y8R B;  1BIB A;  3DFG A;  3O8H A;  1PUE E;  2FA5 A;  1EKE A;  1U6G A;  4L18 B;  4F7Z A;  1WH5 A;  1EJ9 A;  2JJ7 A;  1ETO A;  4RMN A;  3KE2 A;  2E60 A;  4BH9 A;  2R7D A;  5DV5 A;  1ZGJ A;  2QA4 I;  1K78 B;  4LG3 A;  3GME A;  3BCB A;  2ACJ A;  1RKT A;  3FBN B;  2O9L A;  1ON2 A;  1LDK B;  1XGN A;  1IN4 A;  3DP7 A;  5LHG A;  2GXA A;  2NS7 A;  2B0L A;  3BR0 A;  1MDM A;  2FF4 A;  4MEX F;  1QU3 A;  3HPH A;  1A6I A;  4KN4 X;  1MSF C;  2K86 A;  4HLX A;  1O3R A;  1MW7 A;  2F5F A;  1TWC J;  2RQP A;  3DKY A;  3T1B A;  3CC4 I;  3WTX C;  4BHC A;  4BXF A;  2PQ8 A;  5JHU A;  1W36 C;  4LMY A;  2M8G X;  3E3V A;  1I39 A;  4ZJZ A;  4BBS J;  1D8K A;  3F72 A;  2LY1 A;  5CVJ A;  3ZMT A;  3CO6 C;  4P1W A;  1ETW A;  3RJP A;  2Y9Z A;  1J5Y A;  3N05 A;  4O3M A;  1MDM B;  5D8L B;  3MMY B;  4BXX J;  1LQ1 A;  1G3Y A;  2VB6 A;  2IGO A;  5ILU A;  1JKP C;  2QSG X;  1FBQ A;  2HQ5 A;  2KRC A;  2JPC A;  1JHH A;  2IBD A;  3JRC A;  2DCE A;  1NG7 A;  3F8B A;  2N8G A;  1Y39 A;  4HDU A;  1S5L C;  2DFH A;  3E0J B;  2V1U A;  3N4M A;  3ABT A;  3OYI A;  1R4M B;  2VOP A;  3M1C A;  4ZTJ A;  4J19 A;  3MZH A;  3W2V A;  2VJ5 A;  2QBY B;  2H1K A;  1SD6 A;  2IPQ X;  2JQ7 A;  1ORK A;  4M3G A;  3R6S A;  3BQY A;  4IRG A;  3CC2 I;  3M7G A;  4J01 A;  5BMZ A;  4XLC A;  3RYP A;  5ED4 A;  2IA0 A;  3LSK A;  3E5U A;  3PUF A;  3LAP A;  1Z3X A;  5HVQ C;  1X1P A;  1YJ9 I;  4AYB A;  4TV7 A;  2DK8 A;  4BUP A;  1ETX A;  4XM3 A;  3HOV J;  3CLO A;  3V4G A;  2K9S A;  3EDP A;  4EQQ A;  3HJE A;  2G7H A;  2BY3 A;  4AIJ A;  5KCM A;  2PMH A;  3ZQF A;  5H20 A;  1DU0 A;  3F8F A;  2Z33 A;  1ZRD A;  1FTT A;  4MEY F;  2R7X A;  1ZRE A;  2E36 A;  2CH0 A;  4HPQ A;  2IJL A;  1G3W A;  1V5G A;  4B3A A;  3KZY A;  2I5U A;  4RDU A;  5JR3 A;  3RPU A;  3G3Z A;  2MC3 A;  4A3K J;  2OZ6 A;  3GTO J;  3CF5 F;  1FNN A;  3SQN A;  2PMU A;  4D7M A;  1R58 A;  1OYW A;  2DDB A;  1I50 J;  3HRT A;  1ZTR A;  2ELH A;  3QAH A;  5KK1 A;  3A01 B;  1T39 A;  4XRS A;  4UUV A;  3J7Y J;  3R0J A;  4OMY A;  3ERM A;  1YW8 A;  2KJC A;  4FE7 A;  1K61 A;  1P4A A;  4XSZ F;  3K4B A;  2UZK A;  1UG0 A;  3HRU A;  1MD0 A;  1AWC A;  3ZMV A;  1D0Y A;  3QRF F;  4YEL A;  4LIV A;  3CCL I;  2K9L A;  4XR6 A;  5FRO A;  4BXU A;  1V3F A;  4LK1 F;  1YFH A;  5CJ9 A;  3V42 A;  2CUJ A;  3C1D A;  2VQG A;  4B3X A;  1XGS A;  3HZJ A;  1OR7 A;  5IOY A;  3T8R A;  1WHU A;  1G3T A;  1ZKG A;  2EFN A;  2E7W A;  5LGU A;  2PBI A;  4XN3 A;  4LLG F;  3F9K A;  3TBI A;  1ZLK A;  2CW8 A;  1I6X A;  1S9H A;  4N0B A;  1N77 A;  1TT0 A;  2PG4 A;  2GIV A;  3K0L A;  1NK2 P;  2LH9 A;  3VSL A;  4FET A;  3E5Q A;  2JA5 J;  2A69 F;  2B9S A;  1Z9C A;  2K27 A;  3AAF A;  2OC6 A;  1BJZ A;  2RNG A;  3Q0W A;  4I02 A;  2QQA A;  2D5V A;  2M45 A;  4DYQ A;  4XOT A;  2DLL A;  1RZ4 A;  1BI1 A;  3BR3 A;  2L7M P;  3G73 A;  1UFM A;  3F22 A;  1LFU P;  2A6H F;  4Y15 A;  4DOZ A;  3ULQ B;  3JCU C;  2PFB A;  4BHB A;  2DA2 A;  4QTR A;  2HGC A;  3H3V K;  3ZQ7 A;  2DMU A;  3W2A A;  2XPU A;  5F08 A;  1AU7 A;  1QA6 A;  3FXK A;  2WC2 A;  1GUU A;  3KP7 A;  1FC3 A;  4EJV A;  3COA C;  3R61 A;  3JRD A;  1W36 D;  1G6N A;  3X2Q H;  2V79 A;  3DXJ F;  1PDN C;  3BR1 A;  3EUH C;  3E6C C;  2IGK A;  3CQZ J;  2XC7 A;  4E7L A;  4IQ4 A;  3BP8 A;  4RM2 A;  2Y69 H;  1ENH A;  2Y0S A;  5CYV A;  2LMD A;  1G59 A;  3MKW B;  4A6E A;  1KU9 A;  2JSP A;  3TL4 X;  5JI6 A;  3BDD A;  4RB2 C;  3L2W A;  1RNL A;  3KP3 A;  3DEU A;  1JGG A;  4LK0 F;  4XLP F;  2AO9 A;  2XGD A;  1BM9 A;  1ZRC A;  3HOT A;  3RPU D;  2ISY A;  1V5E A;  4IL6 C;  1Z21 A;  3T0Y A;  3I4P A;  5D8K B;  1LE8 A;  3QOE A;  3WE3 A;  2E34 A;  1MMA A;  3IRQ A;  2HXO A;  4IXA A;  3HOS A;  1G3S A;  2DW4 A;  1HLV A;  3CJQ B;  4AM3 A;  5D5X B;  1FOY A;  2BXZ A;  3JRA A;  2H09 A;  1IN8 A;  1WI9 A;  2F5D A;  1E2X A;  5DS9 A;  4HNU A;  2DPU A;  2Q1Z B;  2WAE A;  2MH9 A;  1EH8 A;  4ZYH A;  2ME0 A;  4A5N A;  4FIS A;  4HF1 A;  2VXD A;  1TQI A;  4RGX A;  4AIK A;  2CU7 A;  2HPI A;  4HRI A;  2R7U A;  4J00 A;  3PQK A;  1IDZ A;  3CCY A;  3OYH A;  3GX4 X;  3HOZ J;  4KIG A;  4HNT A;  4ZZD A;  5IP9 J;  1IW7 F;  3I0T A;  4DNC A;  1GXP A;  1TW3 A;  2DJI A;  4XLE A;  1NH3 A;  2JA8 J;  1RRJ A;  2WV0 A;  2CFO A;  1R49 A;  4HF0 A;  3I59 A;  3LOC A;  4V2F A;  2LNB A;  4HA8 A;  3W6K B;  1IRG A;  4ESB A;  1BI2 A;  4U88 A;  1YIO A;  2W7N A;  2XKO A;  2GWR A;  2ADU A;  1KU2 A;  2JVG A;  2NVY J;  3A0B C;  5FO5 A;  3CME I;  2PMZ A;  4B47 A;  2UXN A;  2NOG A;  3IC7 A;  1OPC A;  2ZSI B;  5EGO A;  2V9V A;  2HTJ A;  1RPW A;  3C2G A;  2LVS A;  4AC0 A;  3JAM K;  3ZQH A;  3OSF A;  2E1N A;  2ETH A;  2W24 A;  4LG0 A;  3K4C A;  3I59 B;  2Q0O A;  3OL3 A;  3RTR A;  5A2Q Z;  4HOB A;  2GOX B;  1KQ9 A;  3PO2 J;  3F3X A;  2AXT C;  2CFX A;  2GIZ A;  4ZTF A;  3LWF A;  2Z3Y A;  4N4N B;  2VKD A;  5M5X J;  5EGO B;  2M0C A;  2P8T A;  3DF8 A;  4LLN A;  1OFC X;  2JK3 A;  3QP5 A;  4Y17 A;  5EJC A;  1X1D A;  4BY1 J;  3SDB A;  2L7Z A;  4MLO A;  4R1H A;  4M6V A;  2WA0 A;  2VQH A;  4LG0 B;  3FF5 A;  3PM1 A;  3U1K A;  1QPM A;  4D7N A;  1R22 A;  3CZ6 A;  4BQA A;  4IX7 A;  4XK4 A;  3K1N A;  4D0P A;  4IZZ A;  1YW9 A;  1X58 A;  1QZZ A;  5B5E C;  3L2C A;  1S7A A;  1XC5 A;  3GYH X;  4HLY A;  5F64 A;  2H6B A;  1SFX A;  4C2T A;  4H4K C;  2LC2 A;  1GHC A;  3UNG C;  2L0K A;  2YSR A;  4XL9 A;  1IXC A;  4HX7 A;  2DMN A;  2VN2 A;  3IWZ A;  4S0H B;  3TED A;  5BPI A;  1HA8 A;  1A04 A;  1KYW A;  3S1R J;  1JUS A;  2W48 A;  5K5Q A;  4GXO A;  3VYS B;  4KIB A;  1UAA A;  2LBF B;  4PJM A;  3JRE A;  4IHS A;  3HXL A;  1Y0N A;  5ILS A;  3A4C A;  2NVT J;  4YFX F;  1OMI A;  4BDZ A;  2HXI A;  3FMQ A;  3ZRG A;  5LD2 C;  3HG9 A;  4DZJ A;  1FIA A;  3H3U A;  2K02 A;  4R8H A;  2L9R A;  5B3S H;  3G2B A;  3L7W A;  4OWR B;  3DTE A;  2MYS A;  2V1N A;  3S1M J;  4OMZ A;  4PJL A;  3HTS B;  4HEA 2;  4LFU A;  1GVD A;  2Z99 A;  4UVC A;  2DA5 A;  1SMY F;  3SZP A;  4E7H A;  2CUE A;  4A3J J;  2BGC A;  2BY1 A;  2JA7 J;  1UB9 A;  5IP7 J;  1MMN A;  3TMO A;  4BYY A;  1SEU A;  4CHU A;  3F6V A;  4WCG A;  5LRR A;  5GTI C;  1U78 A;  3IKV A;  3I56 I;  2HFH A;  3KEQ A;  2VT3 A;  1JJ8 C;  1YRN A;  1XB4 A;  2DAO A;  1KU3 A;  4WX9 A;  3SJM A;  3KCC A;  2Y48 A;  4EJT A;  5E1W A;  5CQE A;  5IT3 A;  3LFU A;  4EM1 A;  2VI6 A;  3QU6 A;  1O4X A;  1WJC A;  2L01 A;  3RKY A;  4A93 J;  3JW4 A;  1UHW A;  1G2H A;  4M9X A;  4XNF A;  1LDJ A;  5E8G A;  4P5O A;  1K6Y A;  1O57 A;  1T0F A;  4FQG A;  5LHH A;  2VC1 A;  3KET A;  1MMD A;  2QUF A;  3GFM A;  2L54 A;  3OYA A;  3UR3 C;  1K7A A;  1VQO I;  3OIQ A;  4IRI A;  2K40 A;  2VOO A;  1YRN B;  3L09 A;  3BTC A;  3QQA A;  2HTS A;  4YII A;  2DU9 A;  1U8R A;  3PSF A;  4B43 A;  1QQI A;  2VBW A;  2EH3 A;  3OYL A;  1HC8 A;  3H0G J;  1U3E M;  1LUJ B;  4KYW A;  4A6D A;  5DD4 A;  3CCV I;  1REP C;  3AFH A;  2GXG A;  2DA1 A;  5HS9 A;  2NXN B;  1U9O A;  2AQE A;  2QLZ A;  4MGR A;  3D1N I;  1VQM I;  4C30 A;  5IPA A;  1KYZ A;  2FU4 A;  2J5P A;  1ZAR A;  3CCU I;  4UUT A;  4WK8 F;  3PO3 J;  4X1E A;  3ZMZ A;  1BL0 A;  4EVI A;  1TW2 A;  4I09 A;  2W00 A;  3GLL A;  1V4R A;  3V7C A;  3WGI A;  1J0R A;  2OTL I;  2HQA A;  3ZR8 X;  4BE0 A;  1SFK A;  1DU6 A;  2XF5 A;  4B8X A;  3RKQ A;  1R5H A;  1IG7 A;  4G8X A;  1B9N A;  3RDI A;  1OCO H;  2QSF X;  1IRX A;  2ZFW A;  4M3F A;  5GPC A;  1X3W B;  4X0G A;  2HPM A;  4XOR A;  1VQ6 I;  2OJE D;  1AOY A;  1Z1D A;  1ONV A;  1X4O A;  3CO7 C;  2LLK A;  5F1R A;  1FWZ A;  4ITV A;  4BJ6 C;  1O3Q A;  2L4M A;  3RPQ A;  1MBE A;  5H6R A;  2O03 A;  1GV5 A;  2DA3 A;  1WH7 A;  4NB5 A;  5TGT A;  3S2H J;  5TJJ A;  1JJ6 C;  2HDW A;  2OCE A;  4WWC A;  1HF0 A;  3L2Q A;  2LK2 A;  3ABL H;  4G7O F;  2VJJ A;  1SVO A;  4F93 B;  2CV0 A;  1DUX C;  2K3P A;  4PZJ A;  4KUM A;  3HGG A;  1YJN I;  2WBM A;  2QKL B;  4U0V A;  3M3Y J;  1GDT A;  1JHF A;  2MH2 A;  2RKH A;  2V6C A;  3IWF A;  1RUN A;  4CZC A;  2OTJ I;  5BOX A;  1F5T A;  5F1J A;  1RC9 A;  5FKO A;  5J4Y A;  3ASO H;  2RV8 A;  3RZD J;  3LSR A;  2NS8 A;  2RC4 A;  1EV7 A;  4DJA A;  3JRH A;  5BS6 A;  2A05 A;  3WTV C;  4JP0 A;  1MND A;  2JWT A;  2GLO A;  1UST A;  1WVR A;  4KMF A;  2VOD A;  2F5E A;  2QM3 A;  1SC7 A;  1Z05 A;  5M3M J;  1FTZ A;  4F52 A;  2KIU A;  3GEZ A;  4I0A A;  3HYI A;  2EIN H;  1S72 I;  2Z5U A;  3ZQQ A;  3NQO A;  4Z2Y A;  4A12 A;  1D8J A;  4JX6 A;  2XRL A;  2KZV A;  4XRM A;  3D5L A;  1FJL A;  2ISZ A;  2DFE A;  5B66 C;  3CCR I;  4CYD A;  4II2 A;  4RAG A;  1S7O A;  4GGG A;  4MFD A;  3TKY A;  1TWF J;  3K4K A;  3OYN A;  4AID A;  1BR4 A;  3CUQ A;  4U0Y A;  1WKM A; 
#chains in the Genus database with same CATH homology
 4Q48 A;  3C7J A;  2Z9O A;  1ZG5 A;  2F2E A;  3FM5 A;  4N9H A;  1FYL A;  4ZYD A;  4I98 B;  3GO5 A;  1IRF A;  2H6C A;  3MCZ A;  1WWX A;  1YS7 A;  4L9N A;  3TQN A;  1UHM A;  3JSO A;  2M8E A;  5D5U B;  5LRS A;  2KJB A;  1F9N A;  3QPT A;  3CDH A;  4R79 A;  4RB1 A;  4MQV A;  3NEU A;  2QWW A;  2ZO4 A;  3U2R A;  4H0E A;  2GA1 A;  3KP2 A;  3PFI A;  3FX3 A;  4MTE A;  4LGW A;  5E20 A;  2MA3 A;  2EA2 A;  4EMS A;  3MEX A;  1U5T A;  3SHF A;  1I1S A;  4NHJ A;  3QU3 A;  4HAM A;  5E1Z B;  5DUK A;  3WU0 A;  5BQT A;  1KQ8 A;  2P7V B;  1EH6 A;  5ICE A;  1YO5 C;  2V1X A;  3V8L A;  4KA4 A;  1YYV A;  1XCB A;  2HZT A;  1U5T B;  1KU7 A;  1IN6 A;  4ZZL A;  2GA2 A;  4A2U A;  1I5Z A;  5CVI A;  2OA4 A;  2FE3 A;  5HLI A;  1CF7 A;  5J8C A;  1GXQ A;  3GFI A;  2DK5 A;  2FBH A;  3I54 A;  3ERE D;  1RUO A;  2OBP A;  4CXF A;  5D6F A;  1TBX A;  5LEK A;  3K1P A;  4JBA A;  1QNT A;  1OYI A;  1BI3 A;  2GQQ A;  3HUG A;  3TGN A;  5L3E A;  1S8N A;  1CF7 B;  3BRO A;  5AIQ A;  2JPB A;  3LA2 A;  4XSX F;  2EFP A;  2GZW A;  2OD5 A;  3GFL A;  5DEQ A;  4UXN A;  4EV0 A;  4AD9 A;  1D3Y A;  4EJU A;  5IT9 K;  2NAZ A;  2L4A A;  2G7U A;  1YS6 A;  3TO7 A;  3V7R A;  3WTT C;  3M8E A;  4UNO A;  3E6D A;  4YG2 F;  3TDU C;  3J81 K;  4UVB A;  2VXZ A;  4OU0 A;  1I1G A;  2OU2 A;  3I71 A;  3R60 A;  2DTR A;  1MGT A;  3MZY A;  3WTW C;  1P92 A;  2VE8 A;  2CW0 F;  3P9K A;  3HHG A;  4CZZ A;  4EM0 B;  4MTD A;  2HYG D;  2DPD A;  3ROU A;  2A07 F;  1F4K A;  4EGZ A;  5D6E A;  2A6E F;  3VOD A;  4NQW A;  4ON0 A;  3N97 A;  1L0O C;  4CO8 A;  3HRM A;  4KIF A;  4AIH A;  5E18 F;  4L9V A;  4UHT A;  2CG4 A;  3V7S A;  2ZME A;  1XMA A;  5HS7 A;  1TQP A;  2FBI A;  1UCR A;  3QPH A;  3RYR A;  2XV4 S;  2R7F A;  2M1B A;  5ERI A;  2EV5 A;  2CO5 A;  2EFW A;  5BPD A;  2OZU A;  2ZME B;  4G6Q A;  2QQ9 A;  3C18 A;  4HX8 A;  4S05 A;  1PP7 U;  3E5X A;  3DPT A;  2UXX A;  3K1M A;  2L02 A;  3E97 A;  2VBZ A;  2NNY A;  4IRH A;  1O3S A;  1BC8 C;  4I7H A;  2KIF A;  3BJ6 A;  4RS8 A;  4EJW A;  2HYF A;  4YFK F;  2M5W A;  4I2O A;  1ZRF A;  4Y13 A;  4K2E A;  4CIC A;  3ZMD A;  4A0Z A;  3KLN A;  2V1D A;  2JTV A;  5HDN A;  2PEX A;  1W7P A;  2EWN A;  4RAZ A;  5D5V B;  1GVJ A;  2IA1 A;  3LST A;  2L3D A;  1IAW A;  1XSX A;  2W57 A;  2A5Y B;  3BOQ A;  4M71 A;  1LEA A;  2CYY A;  3Q9V A;  2DFI A;  4ENJ A;  1R1T A;  1J7K A;  2O6G E;  2A61 A;  4ESJ A;  1LVA A;  2W84 A;  4JK1 X;  2PI0 A;  4XRF A;  3GZ6 A;  2VC0 A;  4IHT A;  1S6L A;  3JTG A;  1O7F A;  3DKW A;  4RB0 A;  1D5V A;  4OIQ F;  1YLF A;  1B4A A;  3QP6 A;  3WE2 A;  3FM3 A;  4L0Z B;  4N9I A;  1IXR C;  2RN7 A;  2JRT A;  3LA3 A;  2XAQ A;  3RI4 A;  2K4B A;  4QWQ A;  3WTY C;  1XSV A;  3J80 Z;  3BWG A;  5FD6 A;  1HXD A;  4FT8 A;  4HF2 A;  4KIC A;  3GUD A;  5E1X A;  4WF2 A;  3T5X A;  2HDC A;  2P4W A;  4P9U A;  2P5V A;  1HW5 A;  5FLX Z;  2CSO A;  2LKP A;  3PQJ A;  1ZG3 A;  1FP2 A;  4KNY A;  4M72 A;  1FOK A;  3M8F A;  1L3L A;  3P9I A;  1FX7 A;  5D4S A;  4KMU X;  2ZCW A;  2XRN A;  4A0Y A;  2OAZ A;  2M87 A;  1R00 A;  3FZV A;  2MLG A;  1P6R A;  3FXQ A;  4OIN F;  4LLL A;  4BHP A;  4B09 A;  3M1E A;  4HV6 A;  1ZN2 A;  3ECO A;  2RNJ A;  2GAU A;  1J75 A;  3FMR A;  3LQQ A;  2FEZ A;  2CQK A;  1OKR A;  2C6Y A;  1J2X A;  4P55 A;  3L9F A;  2H27 A;  3O6B B;  1LJ9 A;  5AIP A;  5DUI A;  5K5R A;  4GCV A;  1TNS A;  5HS8 A;  1RI7 A;  5LLQ A;  1BC7 C;  5KVR A;  3WTS C;  3HHH A;  4UV9 A;  6PAX A;  2ZXJ A;  1OYY A;  2Y75 A;  5EEH A;  2X4H A;  1XMK A;  1K6O A;  1JE8 A;  1TLH B;  1G4D A;  3H3Z A;  2ZNY A;  2DT5 A;  3FXR A;  1S29 A;  4JQF A;  3EQL F;  5J6X A;  3SFZ A;  4PGH A;  1ZH5 A;  2BBY A;  2QZ8 A;  4YFN F;  3KZZ A;  2NRA C;  1Z6R A;  4L9T A;  1YW7 A;  1IZ1 A;  1SFE A;  5LGT A;  5HLG A;  2IA2 A;  1LB2 A;  4CGZ A;  1XD7 A;  1XGO A;  3EET A;  1R23 A;  1FBS A;  4KT5 C;  3VOE A;  3DPL C;  1IUY A;  4DQ2 A;  3F8M A;  1YQA A;  5CLS A;  5CVR A;  1ZHF A;  3CUQ C;  2H94 A;  1BJA A;  5F6F A;  4M9Z A;  2MD5 A;  1BOA A;  1FBU A;  2HS5 A;  2NNN A;  4ETS A;  2XHK A;  2DI3 A;  1HSJ A;  2VBY A;  2GXB A;  2MBF A;  4HQM A;  2F5C A;  1RIO H;  5LBQ A;  1T38 A;  1H9G A;  2QYO A;  3SXY A;  3JTH A;  1B9M A;  1FYK A;  4RGS A;  1FZP B;  3P7N A;  3ML6 A;  2M30 A;  3I58 A;  1T2K A;  2FRH A;  4HX4 A;  1DPR A;  1ZLJ A;  4RAY A;  2IRF G;  3EYI A;  4KN7 X;  2MLK A;  5L3G A;  1SAX A;  1U5T C;  1MJB A;  3WU1 B;  3F23 A;  1P4W A;  5A2Q K;  5CVV A;  1B59 A;  2RGV A;  1SD7 A;  3GF2 A;  4FX4 A;  1FSE A;  4OIO F;  3LQR A;  2DBB A;  4HW0 A;  4HQE A;  3CUQ B;  3FXU A;  1DP7 P;  1LDD A;  3WTU C;  1STZ A;  4Q5S F;  1R1U A;  1SFU A;  1BN5 A;  3KEO A;  2QQB A;  4IF4 A;  4ESF A;  4QLC U;  2KRF A;  3E6B A;  5FFZ A;  2FNP A;  4I0B A;  5TRD A;  1XGM A;  4P9F A;  4LB6 B;  3KP6 A;  1HQC A;  4OIP F;  4Q47 A;  2PN6 A;  4ENM A;  3QOP A;  2OQG A;  3CJN A;  3O3K A;  1Y0U A;  3IKT A;  2EV0 A;  4HBL A;  3I53 A;  1HKS A;  3O2P E;  3KLO A;  2IP2 A;  3JAM Z;  5J8F A;  1Q1H A;  1LEB A;  1EH7 A;  4L5J A;  1H0M A;  1IXS B;  4PCQ A;  1ZRD A;  1XDS A;  1YG2 A;  3IL2 A;  1HKT A;  4HDV A;  2D45 A;  4RGR A;  4EM2 A;  4IPA A;  3CUO A;  4LB5 A;  1ZYR F;  5FFX A;  1P4X A;  2KKO A;  1SD5 A;  4AWX B;  1FYM A;  3VFZ A;  2FXA A;  2FMY A;  4EGY A;  2P5K A;  2QBY A;  1XDU A;  3S2W A;  2HR3 A;  1FLI A;  2JT1 A;  2FSW A;  1KQ0 A;  4KDP A;  3OOP A;  3KFW X;  3T8T A;  1HKQ A;  2IVM A;  3ZMS A;  5D4R A;  1J9I A;  4IVN A;  3WOD F;  2AXL A;  3GXO A;  4BNC A;  3HSF A;  1NHA A;  5DCF A;  2PLY A;  1DPU A;  3HRS A;  3K69 A;  1TTY A;  3ZPL A;  3MAJ A;  3P9C A;  5HDK A;  1O7L A;  4RB3 C;  2YR2 A;  3HIF A;  2OQR A;  2BV6 A;  4U7B A;  4L5I A;  1Z7U A;  2P5L C;  2HEO A;  1HW2 A;  4XBF A;  3HSE A;  2YU3 A;  4ZYG A;  2ESN A;  4UV8 A;  1B6A A;  1VTN C;  1USS A;  4YIF A;  1YTY A;  3CTA A;  4LD5 A;  3FMS A;  2XUB A;  1XN7 A;  1WQ2 A;  3DQV C;  2P6T A;  2TDX A;  4EJO A;  3F8C A;  3BJA A;  3TOB A;  5HDG A;  3EYY A;  4U0W A;  2LF8 A;  2DO7 A;  1KA8 A;  3BPX A;  2XVC A;  3BJO A;  1MJ9 A;  2FBK A;  5FGM A;  2E7X A;  3LAJ A;  3V8K A;  3ELK A;  1QGP A;  2VE9 A;  3HTU A;  1JGS A;  4L9J A;  2STW A;  4G7H F;  3GWZ A;  1WSU A;  1XSD A;  3F21 A;  4GYI A;  3MQ0 A;  1JXS A;  4G94 A;  5DD8 A;  4KFC A;  1PP8 F;  2VBX A;  2ZKZ A;  3FHZ A;  3GZ5 A;  1MJA A;  3FWE A;  3WGH A;  4P96 A;  4Q4Z F;  2K4J A;  2CWE A;  4PGG A;  3BZ6 A;  3LFK A;  3BY6 A;  3TO9 A;  1BI0 A;  1XCV A;  1W7P B;  5FB2 A;  4A5M A;  1W5T A;  3K9T A;  4GYG A;  1K79 A;  5HLH A;  1HST A;  5L3D A;  2QEN A;  1S3J A;  5AON A;  1SD4 A;  5LHI A;  2STT A;  2FQ3 A;  3GW2 A;  4BAY A;  5DYM A;  3IRR A;  3U9G A;  1QBJ A;  2AS5 F;  2UWM A;  1CGP A;  1B1B A;  4WXH A;  4IJA A;  1I27 A;  4MHG A;  3JSP A;  3VEP A;  3EUH A;  2YX7 A;  2O3F A;  2J5O A;  2ZBK A;  2D1H A;  2R3S A;  4CDG A;  3GVA A;  2EJR A;  2HQR A;  3GFJ A;  5FD5 A;  1FP1 D;  1FY7 A;  4FX0 A;  4M74 A;  1Z6T A;  2COM A;  2EFQ A;  3TO6 A;  3Q5F A;  2HWV A;  4RGU A;  2Q8K A;  1W7P D;  2Q2E A;  2D1V A;  2EFO A;  4MQ9 F;  5L3B A;  4G9Y A;  2PJP A;  4M6Y A;  1DDN A;  3E6M A;  3ZMU A;  5ICF A;  4O6J A;  4I01 A;  3DV8 A;  5DCM A;  3SZT A;  5HOO A;  2O0Y A;  4ENK A;  2EV6 A;  1Z91 A;  3B02 A;  1ZAO A;  4M6X A;  2K7L A;  3ABU A;  2LDU A;  1J59 A;  5ILV A;  2XRO A;  4XLN F;  4ASN A;  2EK5 A;  1HW1 A;  3F6O A;  5DCM B;  3WTZ A;  2KIM A;  1H9T A;  2FOK A;  3F8N A;  4PDK A;  2A68 F;  3ZN1 A;  1W4M A;  2XAS A;  4WXD A;  1T98 A;  3RKW A;  3I64 A;  2XAJ A;  4WXC A;  5LGN A;  2RVC A;  2FML A;  2EA4 A;  1F1Z A;  4ZH4 F;  4HV5 A;  1BIA A;  5L3F A;  5ICG A;  2LF7 A;  3R4K A;  4HYE A;  1X3U A;  3M9A A;  3NRV A;  3U1D A;  1FPQ A;  4MNU A;  2XAG A;  1W5S A;  2WWY A;  2YX4 A;  4G7Z F;  2JZY A;  4O5V A;  5D5W B;  2ZNZ A;  2RDP A;  1IN7 A;  1BBY A;  4AVP A;  2XAH A;  2HQN A;  4U7D A;  2W25 A;  1SMT A;  5IT9 Z;  1MZB A;  2ESH A;  4UVA A;  1R7J A;  1FSH A;  5EEG A;  2EB7 A;  2XGX A;  2HKO A;  2Y0M A;  3TDZ C;  3Q9S A;  2XKP A;  3KP4 A;  3B73 A;  4S04 A;  2QVO A;  3J81 Z;  3L00 A;  2FNA A;  1LNW A;  1MKM A;  2P7C B;  2XIG A;  3WG9 A;  3MFK A;  3W6J B;  3J7A O;  3GLX A;  2VON A;  3C3W A;  2ZJ2 A;  1ZG1 A;  4ZYE A;  1QO0 D;  3RIR A;  3OV8 A;  5L3C A;  1ON1 A;  1ODD A;  3REO A;  1R1V A;  3I5U A;  4ENN A;  5JFR A;  1TNT A;  3HSR A;  5DDG A;  4L0Y B;  3ZN0 A;  2LSO A;  3H92 A;  1FT9 A;  2BYV E;  1R5G A;  4M9S A;  2JSC A;  5ICC A;  5E17 F;  1ZGA A;  2BEO A;  3WGG A;  2HKX A;  5H6Q A;  3MWM A;  1QZY A;  4A0X A;  3R0A A;  1U2W A;  2DQR A;  1P2F A;  2WTE A;  5LEJ A;  2YPR A;  2BE5 F;  3ECH A;  2P6S A;  4FHT A;  2DQL A;  4OOI A;  1KGS A;  4G6D A;  2IW5 A;  4GO1 A;  3RKX A;  1IF1 A;  4HZF A;  4LJZ F;  1TQM A;  2W85 A;  2VT2 A;  1T6S A;  3VB2 A;  4E70 A;  5K1Y A;  2XAF A;  3ZP5 A;  1HBX G;  5CVU A;  2D2W A;  3K2Z A;  1O3T A;  1E17 A;  1IN5 A;  1WRJ A;  2CGP A;  1ULY A;  2O61 A;  2O8X A;  5JVT A;  3J80 K;  2IT0 A;  5K5O A;  1R36 A;  3ISP A;  3V8J A;  3KP5 A;  2X0L A;  4OIR F;  1C0W A;  2G9W A;  5E8I A;  3D0S A;  3BPV A;  2HOE A;  4M73 A;  1K78 A;  3LA7 A;  3TOA A;  2A3S A;  3IHU A;  2E1C A;  2NYX A;  5FLX K;  2NS0 A;  1BIB A;  3DFG A;  1PUE E;  2FA5 A;  1U6G A;  4L18 B;  4F7Z A;  3KE2 A;  4BH9 A;  2R7D A;  5DV5 A;  1ZGJ A;  1K78 B;  2ACJ A;  1ON2 A;  1LDK B;  1XGN A;  1IN4 A;  3DP7 A;  5LHG A;  2B0L A;  1MDM A;  2FF4 A;  4MEX F;  4KN4 X;  2K86 A;  4HLX A;  1O3R A;  2F5F A;  2RQP A;  3T1B A;  3WTX C;  4BHC A;  2PQ8 A;  5JHU A;  4LMY A;  3E3V A;  1D8K A;  3F72 A;  5CVJ A;  3ZMT A;  3CO6 C;  3RJP A;  1J5Y A;  4O3M A;  1MDM B;  5D8L B;  1LQ1 A;  1G3Y A;  5ILU A;  1FBQ A;  2JPC A;  1JHH A;  3F8B A;  4HDU A;  2V1U A;  3N4M A;  3ABT A;  2VOP A;  3MZH A;  2QBY B;  1SD6 A;  2IPQ X;  3R6S A;  4IRG A;  3M7G A;  5BMZ A;  3RYP A;  5ED4 A;  2IA0 A;  3E5U A;  3LAP A;  5HVQ C;  4TV7 A;  2DK8 A;  3CLO A;  3V4G A;  3EDP A;  4EQQ A;  2G7H A;  4AIJ A;  2PMH A;  5H20 A;  3F8F A;  2Z33 A;  4MEY F;  1ZRE A;  2IJL A;  1G3W A;  3KZY A;  5JR3 A;  3RPU A;  3G3Z A;  2MC3 A;  2OZ6 A;  1FNN A;  3SQN A;  2PMU A;  1R58 A;  1OYW A;  3HRT A;  2ELH A;  3QAH A;  5KK1 A;  1T39 A;  4UUV A;  3R0J A;  4OMY A;  1YW8 A;  2KJC A;  1P4A A;  4XSZ F;  2UZK A;  3HRU A;  1MD0 A;  1AWC A;  3ZMV A;  3QRF F;  4BXU A;  1V3F A;  4LK1 F;  1YFH A;  5CJ9 A;  3C1D A;  1XGS A;  1OR7 A;  3T8R A;  1G3T A;  2EFN A;  2E7W A;  5LGU A;  2PBI A;  4LLG F;  1ZLK A;  4N0B A;  1I6X A;  2PG4 A;  2GIV A;  3K0L A;  3E5Q A;  2A69 F;  1Z9C A;  2K27 A;  3AAF A;  4I02 A;  2QQA A;  2M45 A;  2DLL A;  1RZ4 A;  1BI1 A;  3G73 A;  1UFM A;  3F22 A;  2A6H F;  4Y15 A;  3ULQ B;  4BHB A;  2PFB A;  2HGC A;  3ZQ7 A;  2WC2 A;  3KP7 A;  1FC3 A;  4EJV A;  3COA C;  3R61 A;  1G6N A;  2V79 A;  3DXJ F;  1PDN C;  3E6C C;  3BP8 A;  5CYV A;  4A6E A;  1KU9 A;  5JI6 A;  3BDD A;  4RB2 C;  1RNL A;  3KP3 A;  3DEU A;  4LK0 F;  4XLP F;  1BM9 A;  1ZRC A;  3HOT A;  2ISY A;  5D8K B;  3T0Y A;  3I4P A;  3WE3 A;  3IRQ A;  4IXA A;  3HOS A;  1G3S A;  2DW4 A;  5D5X B;  2H09 A;  1IN8 A;  1WI9 A;  2F5D A;  1E2X A;  2DPU A;  2MH9 A;  1EH8 A;  4ZYH A;  4A5N A;  4HF1 A;  1TQI A;  4RGX A;  4AIK A;  3PQK A;  3GX4 X;  4KIG A;  4ZZD A;  1IW7 F;  3I0T A;  4DNC A;  1GXP A;  1TW3 A;  2WV0 A;  4HF0 A;  3I59 A;  1IRG A;  3W6K B;  2LNB A;  4HA8 A;  4ESB A;  1BI2 A;  4U88 A;  1YIO A;  2XKO A;  2GWR A;  2ADU A;  1KU2 A;  5FO5 A;  2UXN A;  3IC7 A;  1OPC A;  2V9V A;  2HTJ A;  3JAM K;  2E1N A;  2ETH A;  2W24 A;  4LG0 A;  3I59 B;  2Q0O A;  3RTR A;  5A2Q Z;  4HOB A;  1KQ9 A;  3F3X A;  2CFX A;  3LWF A;  2Z3Y A;  2P8T A;  3DF8 A;  4LLN A;  3QP5 A;  4Y17 A;  4R1H A;  4LG0 B;  3FF5 A;  1QPM A;  1R22 A;  4BQA A;  3K1N A;  4D0P A;  1YW9 A;  1QZZ A;  3L2C A;  1S7A A;  3GYH X;  4HLY A;  5F64 A;  2H6B A;  1SFX A;  1GHC A;  2YSR A;  1IXC A;  4HX7 A;  2VN2 A;  3IWZ A;  5BPI A;  1A04 A;  1KYW A;  5K5Q A;  4GXO A;  4KIB A;  4IHS A;  5ILS A;  4YFX F;  1OMI A;  3FMQ A;  3H3U A;  2K02 A;  4R8H A;  3L7W A;  4OMZ A;  3HTS B;  4LFU A;  4UVC A;  2Z99 A;  1SMY F;  3SZP A;  2BGC A;  1UB9 A;  4BYY A;  4CHU A;  3F6V A;  4WCG A;  5LRR A;  1U78 A;  3IKV A;  2HFH A;  3KEQ A;  2VT3 A;  1XB4 A;  2DAO A;  1KU3 A;  4WX9 A;  3KCC A;  2Y48 A;  4EJT A;  5E1W A;  5IT3 A;  4EM1 A;  3QU6 A;  2L01 A;  3RKY A;  3JW4 A;  1UHW A;  4M9X A;  1LDJ A;  5E8G A;  4P5O A;  1O57 A;  1T0F A;  5LHH A;  2VC1 A;  3KET A;  2QUF A;  3GFM A;  2L54 A;  1K7A A;  4IRI A;  2VOO A;  3L09 A;  2HTS A;  4YII A;  2DU9 A;  1U8R A;  1QQI A;  2VBW A;  1U3E M;  4KYW A;  4A6D A;  5DD4 A;  1REP C;  2GXG A;  5HS9 A;  2QLZ A;  4MGR A;  1KYZ A;  2FU4 A;  2J5P A;  1ZAR A;  4WK8 F;  3ZMZ A;  4EVI A;  1TW2 A;  4I09 A;  1V4R A;  3V7C A;  3WGI A;  1J0R A;  4B8X A;  1R5H A;  4G8X A;  1B9N A;  3RDI A;  2ZFW A;  1AOY A;  1Z1D A;  1ONV A;  3CO7 C;  5F1R A;  1FWZ A;  1O3Q A;  2L4M A;  3RPQ A;  5H6R A;  2O03 A;  4NB5 A;  5TJJ A;  4WWC A;  4G7O F;  1DUX C;  4PZJ A;  4KUM A;  4U0V A;  1JHF A;  2MH2 A;  2RKH A;  2V6C A;  3IWF A;  1RUN A;  5BOX A;  1F5T A;  2RV8 A;  2RC4 A;  1EV7 A;  5BS6 A;  3WTV C;  1UST A;  4KMF A;  2VOD A;  2F5E A;  2QM3 A;  1Z05 A;  2KIU A;  3GEZ A;  4I0A A;  3HYI A;  2Z5U A;  3NQO A;  4Z2Y A;  4A12 A;  1D8J A;  3D5L A;  2ISZ A;  4CYD A;  1S7O A;  4GGG A;  3TKY A;  3CUQ A;  4U0Y A;  1WKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...