1TBXA

Crystal structure of ssv1 f-93
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
94
structure length
94
Chain Sequence
STPFFYPEAIVLAYLYDNEGIATYDLYKKVNAEFPMSTATFYDAKKFLIQEGFVKERQERGEKRLYLTEKGKLFAISLKTAIETYKQIKKRHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical 11.0 kDa protein
publication title Crystal structure of F-93 from Sulfolobus spindle-shaped virus 1, a winged-helix DNA binding protein.
pubmed doi rcsb
source organism Sulfolobus virus 1
molecule tags Viral protein
total genus 33
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1tbxA00
3H3UA 4M9XA 1O3RA 3WTUC 2GA2A 3I5UA 4N9IA 2P5VA 2XKOA 1R22A 2XASA 4LLGF 1Y0UA 5IT9K 2IRFG 3I0TA 3VODA 3WE3A 4O6JA 2UWMA 3HOSA 1J75A 5FD6A 4Z2YA 1SMTA 1AWCA 2KIMA 4BNCA 1BM9A 3WTTC 2G7HA 4KA4A 2DAOA 1RZ4A 1GVJA 1MJBA 3F8BA 2V1XA 2YX7A 5ED4A 3GWZA 4A5MA 3WGIA 4HV5A 2MD5A 2XAFA 3V8JA 5K5QA 2QQAA 4PDKA 3GZ5A 2WTEA 4UXNA 4HW0A 4EV0A 2QZ8A 1R58A 3GXOA 3JSOA 4WF2A 1T38A 1B1BA 4AWXB 1RUNA 4EJWA 4CO8A 4LFUA 1J0RA 2CQKA 2MLGA 1OYYA 4UVBA 3BPXA 2HR3A 4NQWA 2ZMEB 2FE3A 3COAC 1KYZA 2HWVA 1O3QA 2V79A 1IRFA 1R1TA 2PN6A 3F6VA 2O3FA 5TRDA 1FBQA 2IA0A 2HYGD 5EEGA 3CLOA 4LLNA 3BPVA 3TOBA 4ZYGA 3M8FA 1FP2A 2VBZA 2RGVA 2HKOA 3DF8A 2MC3A 2FBHA 3HRTA 3E97A 4ENNA 2M8EA 1R5GA 1KA8A 1G3TA 4M9SA 1YLFA 2OBPA 2ESHA 1FWZA 1HW5A 1BIBA 1R1VA 3HSFA 3NRVA 3F21A 1XDSA 4LK0F 2YX4A 5FGMA 4CXFA 1FX7A 4EJUA 1QQIA 3V8LA 4EMSA 4P5OA 2F5DA 1R36A 3WE2A 4L9VA 2ISZA 3QAHA 3W6KB 3GFMA 3QPHA 1D8KA 3P9KA 1KQ8A 1DPRA 3MAJA 1XSDA 5HLIA 3KP3A 2P5LC 2JZYA 3LAJA 4A12A 3Q9SA 2VXZA 5H6QA 2D2WA 3IWFA 5CVUA 4O5VA 4UV9A 2R3SA 4MGRA 4KICA 3M9AA 3V4GA 1KU2A 2VE9A 1G6NA 1MDMB 2QENA 2LSOA 4FX4A 2L4AA 5HS9A 2FOKA 3KP5A 1XSVA 1XSXA 5TJJA 3C3WA 4TV7A 5CJ9A 1IW7F 3GFIA 1HKTA 2H6CA 4ASNA 1V4RA 3GZ6A 2B0LA 2O8XA 4O3MA 4R79A 1SAXA 1J5YA 4IRIA 1T98A 4M6XA 1YO5C 2IW5A 4HA8A 5CVVA 2V9VA 2A07F 2IT0A 2O0YA 4OU0A 4IRHA 1E17A 1SD6A 2X0LA 2XAGA 4ZYHA 5A2QZ 3TO7A 2ISYA 1WWXA 4B09A 1LVAA 1HKQA 1IXRC 1L0OC 1D8JA 2GIVA 3HRMA 4ON0A 1IAWA 4AIKA 5DCFA 1F9NA 2OQRA 1QNTA 4EGZA 2K4BA 5JI6A 4P9FA 4L0YB 3V7CA 1W4MA 2XHKA 1FYKA 3MWMA 1LQ1A 2RN7A 4CGZA 2ETHA 4G7OF 4RS8A 2HZTA 5DD4A 5ERIA 3QU6A 2CO5A 5JFRA 3QP6A 1XB4A 3LQRA 3I59A 4YFNF 1FSEA 4WXHA 4YIFA 3HIFA 3RI4A 4OIRF 1BC8C 4FX0A 2F5FA 1VTNC 1IN8A 2GQQA 1PP7U 3NQOA 4HQMA 4OMZA 4KN7X 1B59A 5FD5A 3D0SA 2PFBA 4BXUA 2NNNA 2D1VA 1EH6A 3KFWX 1YQAA 4HLXA 1QZZA 4LJZF 1U6GA 2F5CA 4ZZDA 2CSOA 3IKTA 4BQAA 4EQQA 3GYHX 2UXNA 5F64A 3ROUA 3T0YA 4YIIA 4JBAA 2MH9A 4HX8A 5AIQA 3T8TA 3WGHA 3ECHA 1YW8A 1MGTA 2ZFWA 3WU1B 4WX9A 3FZVA 4M72A 1FNNA 2J5OA 1KU9A 4F7ZA 1T39A 1Z6RA 4AIHA 1UB9A 1IN6A 3BROA 4EM2A 1J2XA 4WK8F 4IRGA 3GX4X 1OYIA 3WTYC 1IRGA 3DKWA 1P4AA 5ILUA 3M1EA 2ZO4A 3R60A 4HZFA 4GO1A 1TBXA 3ML6A 3CUQA 1L3LA 3TDUC 3PFIA 3JW4A 2P7CB 2XV4S 4ENJA 5ICFA 1IN5A 3HTUA 3DXJF 1O3SA 2ZJ2A 2QQ9A 1MD0A 1LDKB 5D5WB 3F6OA 3NEUA 1OKRA 2P6SA 3R4KA 3JAMK 2EV6A 1ZG3A 3K1MA 2FSWA 4U0YA 1MZBA 5BPDA 3BWGA 4KUMA 1WRJA 2DI3A 2P4WA 1SFUA 3MEXA 3T8RA 3ZMDA 2QLZA 5D6EA 1IUYA 3DEUA 3DPTA 5JHUA 2EFWA 1P92A 4KNYA 3DQVC 2VT3A 5HDGA 1ZRFA 2EFNA 4NB5A 2WV0A 1ZREA 1JHFA 3I4PA 2H09A 2RNJA 3HUGA 3V7SA 4RAZA 1W7PB 2DQRA 4DQ2A 1WKMA 1T6SA 1LNWA 4MQVA 2XGXA 1ZN2A 3IKVA 2M45A 1W7PA 1I27A 1O3TA 1YS7A 1ON1A 4GYIA 5H6RA 5H20A 5F6FA 5CYVA 2KJCA 2YSRA 2KIFA 5L3DA 3KCCA 2Y75A 1ZHFA 2STTA 1TQMA 2PJPA 2IPQX 4WCGA 3QU3A 3F8CA 1YW9A 3HSEA 5ICCA 3BZ6A 2FNPA 1X3UA 4I09A 3EUHA 1Z1DA 1BI2A 5AONA 4P9UA 3RIRA 4WXCA 2GZWA 3SQNA 3C7JA 2NS0A 4RB0A 1T0FA 2ESNA 2PI0A 4HDVA 1R7JA 3ZMSA 1P4WA 1HW2A 3G73A 1XN7A 1Z7UA 3D5LA 4IJAA 1XGNA 2QVOA 5LHIA 2LDUA 2L02A 1HQCA 4EJVA 2VE8A 4M9ZA 2VC0A 4MTEA 5HS8A 5LHHA 2ADUA 5CVJA 2UZKA 1F4KA 2K7LA 3CO6C 5E20A 2W85A 4HDUA 2MLKA 1O7FA 2YR2A 4RB3C 2A6HF 2H6BA 2QQBA 2HTSA 4L9NA 4Y13A 4L9JA 4HV6A 4LB5A 1R23A 2A69F 4I7HA 3K1PA 2OU2A 4EM0B 5DCMB 2XIGA 2K27A 5BMZA 2PLYA 5D8KB 4ESBA 3RTRA 3GF2A 3KLNA 1YW7A 2GA1A 4EJTA 3R6SA 3CTAA 4BHCA 2DQLA 1S7OA 3C18A 5IT9Z 5E17F 3T1BA 1IXCA 4KN4X 2DK8A 4HOBA 3ZMTA 2Z3YA 2MH2A 1UHMA 2EFOA 4KDPA 3FX3A 5FFXA 4KYWA 3R0JA 5DUIA 2ZMEA 1OPCA 2O03A 4B8XA 3FMRA 1S8NA 4PCQA 3ZN1A 2CYYA 1HW1A 3TOAA 5D5VB 3OV8A 3J81Z 4IVNA 5JVTA 1GXQA 2XAJA 3M7GA 2Z33A 3F3XA 3FMQA 2VT2A 5HLGA 5FB2A 4PGHA 2XAQA 1I1GA 2QWWA 4KIGA 4ZH4F 2HTJA 2OZUA 1U5TC 4YFKF 3MFKA 2GAUA 3Q9VA 1OYWA 4LK1F 1JXSA 5D4RA 4KMUX 3V8KA 4MEXF 3TO6A 1ZLKA 4FHTA 2AS5F 3K9TA 3VB2A 4IHTA 1KQ0A 4MTDA 2F2EA 4D0PA 2O6GE 3RYPA 5L3CA 1FC3A 5AIPA 1DP7P 2E1NA 2P6TA 2LF7A 2EA2A 1ULYA 2HKXA 2VODA 2Y48A 2FQ3A 1GXPA 3CUQC 1FYLA 4PGGA 1JE8A 2K86A 2R7DA 3JTHA 1K6OA 1G4DA 4OMYA 1XCVA 5A2QK 4G9YA 3BJ6A 6PAXA 3KEOA 1A04A 2FBIA 1TW3A 3RJPA 5LLQA 3R61A 4H0EA 2FU4A 2A68F 1TLHB 3F8NA 3LSTA 1Z05A 1MDMA 1RIOH 4RGXA 2FEZA 1NHAA 4Y15A 4Q47A 4UUVA 4HQEA 1YS6A 2L4MA 3P7NA 1TNTA 2W84A 4RGUA 2D1HA 4N0BA 2CG4A 2QYOA 4KIBA 2CGPA 5BPIA 5BS6A 5D5UB 4G6QA 1STZA 4U0VA 4XRFA 1XGOA 2EJRA 1OMIA 1MJAA 5FO5A 3B73A 1AOYA 2FMLA 3FWEA 4A6DA 3GLXA 1H0MA 5DYMA 5LEJA 2HQRA 3ZN0A 2VBYA 1J59A 5HS7A 2VBXA 3HSRA 3V7RA 4MEYF 1IN7A 2DK5A 2EB7A 1SMYF 2DU9A 1LEAA 2W25A 2BYVE 5L3BA 1R00A 1XMAA 1ZG1A 1U3EM 3B02A 3BDDA 3EQLF 4A0XA 5LBQA 3EYIA 3KP7A 4UV8A 2E1CA 1KGSA 4CYDA 2Z99A 2ZKZA 2GXGA 1QPMA 1WI9A 4G8XA 4L9TA 2K02A 3S2WA 4PZJA 1PUEE 5DEQA 1RUOA 1CF7B 2KJBA 3FXQA 5DDGA 2X4HA 2CWEA 1CF7A 1J7KA 2R7FA 2C6YA 5HOOA 3Q5FA 1USTA 1DPUA 3L09A 2O61A 1W7PD 3WTWC 3J7AO 3LWFA 1P6RA 1DDNA 4UVCA 1LB2A 3QOPA 1LDDA 4L18B 4E70A 3KE2A 1JHHA 5E18F 3RKYA 3RKWA 2OAZA 2L3DA 2E7XA 3E5UA 4DNCA 1DUXC 1F1ZA 4I0AA 3U1DA 4U7BA 1XGMA 2LNBA 1FZPB 3QRFF 1HSTA 5EEHA 1K79A 2COMA 2VBWA 2QM3A 4JK1X 2F5EA 4BHPA 4OIPF 4HX4A 3CDHA 5E8IA 3L7WA 2JT1A 4ZYEA 2V6CA 2ACJA 1R1UA 4OIQF 3PQKA 1I5ZA 4UHTA 1KYWA 1RI7A 5BQTA 5K5RA 3BJAA 3ABUA 4KMFA 4AD9A 5D6FA 3ZMVA 2G7UA 1ON2A 4U88A 4BH9A 2XUBA 2BV6A 3J80K 5E1XA 3I71A 2DO7A 2DPDA 1FT9A 2OZ6A 3WTSC 3O2PE 3GO5A 1ONVA 1RNLA 3TKYA 3WG9A 1XGSA 2PMHA 3HYIA 3P9IA 2EV5A 2HFHA 3E6DA 1TQIA 2KKOA 3KEQA 5J8FA 2M30A 2KIUA 3E5XA 2PG4A 3RKXA 3DFGA 1H9GA 1S3JA 1HBXG 5K5OA 3E3VA 1TQPA 3I54A 2NNYA 3O3KA 1J9IA 1ZH5A 4NHJA 1SFEA 1O7LA 4ZYDA 3KZYA 1K78B 1PDNC 1ZAOA 2MA3A 2EA4A 2EWNA 4ENKA 3L2CA 1BBYA 3QPTA 1ZGJA 4QLCU 4BAYA 1ZRDA 2M1BA 1REPC 2ZNZA 3OOPA 1OR7A 1UCRA 3U2RA 1CGPA 3ZP5A 2IA2A 4P55A 1BJAA 3K1NA 1WSUA 3ISPA 1FP1D 2RDPA 2EFQA 4EM1A 5ILVA 5L3EA 5ICGA 1FYMA 1YTYA 1BN5A 1BOAA 2JTVA 1P2FA 1G3SA 4XSZF 5ICEA 4LG0B 3N97A 2Q2EA 3ZPLA 4ESFA 3AAFA 2DLLA 5JR3A 2BBYA 1I1SA 4S04A 4LG0A 3K69A 1SD5A 2Y0MA 1EV7A 3LA3A 4BHBA 4R1HA 1TW2A 3SZPA 4Q4ZF 2MBFA 4MQ9F 4AIJA 5LEKA 2HGCA 1QO0D 4QWQA 3F72A 5FLXZ 1TNSA 1U78A 3G3ZA 3DV8A 1S6LA 4I01A 1Z91A 1FY7A 2RV8A 1LEBA 1FBSA 2DW4A 5FFZA 1PP8F 2FA5A 2HS5A 3LA7A 3BJOA 4U7DA 2RVCA 2BE5F 3FF5A 4GGGA 4RB1A 4S05A 4Y17A 1IXSB 3HTSB 4GXOA 2ZBKA 5HLHA 5HDNA 3LFKA 1KQ9A 4XBFA 1B6AA 2RQPA 3GUDA 3JSPA 1EH7A 2EFPA 2NAZA 3J81K 3EDPA 5DCMA 1E2XA 2ELHA 3GEZA 5DUKA 2EV0A 2Q8KA 5LRRA 4I2OA 4RGRA 4A2UA 4M74A 5LGTA 3GW2A 3M8EA 3CUOA 3ECOA 1ZARA 4IXAA 4HLYA 2VOPA 5K1YA 2PEXA 1I6XA 3ZQ7A 2VC1A 3KLOA 1TTYA 5HDKA 4G94A 5CVRA 3MCZA 3KZZA 5D5XB 4YFXF 3EYYA 3ELKA 1G3WA 3FMSA 3ZMUA 3BOQA 4LMYA 3K0LA 2JRTA 3E5QA 2WWYA 1R5HA 4R8HA 4A6EA 2VOOA 2P7VB 1QZYA 2J5PA 4A0ZA 4JQFA 1ZYRF 3KP2A 3IWZA 2G9WA 1XDUA 4ETSA 4RB2C 1QBJA 3CJNA 2QBYB 2PMUA 4M71A 2NRAC 1LDJA 1BC7C 2QBYA 2L01A 5LGNA 1B9MA 2K4JA 2L54A 3SHFA 1IN4A 2Z9OA 5D4SA 5CLSA 5LHGA 1XCBA 1HKSA 4KT5C 3SZTA 3DP7A 3IRQA 4CHUA 3QP5A 4L5IA 5BOXA 5DV5A 3ULQB 2FXAA 3MQ0A 1IZ1A 3RPUA 4YG2F 2W57A 3REOA 3E6CC 4XLNF 4G7HF 3F8MA 2IA1A 3IL2A 2A3SA 1SD4A 2A5YB 4XSXF 3WTXC 2BGCA 3E6BA 1ZLJA 2GWRA 3P9CA 3RYRA 1IF1A 1BIAA 4CICA 1MJ9A 4IPAA 4HF2A 2YU3A 3R0AA 3IC7A 3LQQA 4ENMA 3U9GA 2Z5UA 4HX7A 3IRRA 1YIOA 3MZYA 2STWA 3TGNA 2EK5A 1D3YA 3F8FA 2KRFA 5D8LB 2OA4A 1ZRCA 3FM5A 2H94A 3FHZA 1WQ2A 1ODDA 2UXXA 1YFHA 4HBLA 4LB6B 1D5VA 5KK1A 2OD5A 4LLLA 5HVQC 3TQNA 2DPUA 4HF0A 3N4MA 4WXDA 1U8RA 4KIFA 1FSHA 2LKPA 3HRUA 5DD8A 4BYYA 2XAHA 4I98B 2TDXA 3VOEA 2XROA 4HAMA 5J8CA 4ESJA 4M73A 4EGYA 1S7AA 3I59B 3EETA 4P96A 1T2KA 1V3FA 2QUFA 2Q0OA 4L5JA 4I0BA 4UNOA 2IP2A 1U2WA 3CO7C 4HYEA 3HOTA 3WTZA 3LA2A 2RC4A 1BI0A 3F22A 2W24A 3IHUA 2NYXA 3I58A 3WODF 2ZCWA 4L0ZB 3RPQA 1B9NA 1U5TB 3L00A 5L3FA 4ZZLA 2IJLA 2H27A 4Q48A 4WWCA 1U5TA 3HRSA 4A5NA 2P8TA 2HDCA 2E7WA 2OQGA 2FRHA 5CVIA 1EH8A 3ZMZA 3FXUA 3GFJA 5KVRA 1B4AA 2HYFA 1KU3A 2ZNYA 1JGSA 2VN2A 3FM3A 1K7AA 1KU7A 2XVCA 5E1WA 4A0YA 2DTRA 4GCVA 1XMKA 2PQ8A 4IF4A 1W5TA 3CUQB 4IHSA 4LD5A 4OINF 2JSCA 3GVAA 3WU0A 2DT5A 1YYVA 3TO9A 1GHCA 4GYGA 3H3ZA 3SXYA 3F23A 2IVMA 3ABTA 4N9HA 2HQNA 4MNUA 1ZG5A 1O57A 2VONA 1MKMA 1Q1HA 1SD7A 4G7ZF 1FBUA 3ERED 4EJOA 3GFLA 2CW0F 1H9TA 3VEPA 1Z6TA 3L9FA 5LGUA 4RAYA 3BY6A 2JPBA 3T5XA 2DBBA 3KETA 3HHGA 2M87A 5ILSA 5IT3A 4HF1A 2M5WA 2LF8A 3I64A 5F1RA 2XKPA 3PQJA 4AVPA 4M6YA 4MHGA 3TDZC 5J6XA 3MZHA 4K2EA 5E1ZB 1FOKA 1QGPA 3JAMZ 1YG2A 1ZGAA 2GXBA 2A61A 1W5SA 2FBKA 5L3GA 5E8GA 3FXRA 2FNAA 3W6JB 3I53A 3KP6A 3VFZA 2DFIA 1FPQA 4G6DA 2FF4A 1USSA 3LAPA 4FT8A 3SFZA 3E6MA 1UFMA 1K78A 4LGWA 1BI3A 3J80Z 1F5TA 4EVIA 1S29A 3JTGA 4XLPF 1P4XA 2RKHA 3H92A 3RDIA 5FLXK 4Q5SF 2ZXJA 1LJ9A 2FMYA 4KFCA 1Z9CA 1C0WA 3DPLC 3C1DA 1G3YA 4OIOF 4UVAA 1SFXA 2CFXA 2YPRA 5LRSA 3WGGA 3WTVC 2HOEA 1HSJA 1XD7A 2AXLA 3BP8A 2V1DA 4CZZA 2HEOA 2XRNA 2P5KA 4RGSA 4U0WA 4OOIA 2V1UA 2PBIA 1BI1A 3O6BB 4I02A 4CDGA 2BEOA 3HHHA 3K2ZA 1UHWA 2D45A 1HXDA 2A6EF 2WC2A 3KP4A 2JPCA 1FLIA
chains in the Genus database with same CATH superfamily
3HKZA 3H3UA 4C2TA 4M9XA 1FTTA 1WVRA 1O3RA 2M0MA 4NC7A 1N25A 5FROA 2YUSA 3Q0UA 3WTUC 1IGNA 2GA2A 3I5UA 4N9IA 2P5VA 2XKOA 4CCJA 1R22A 2XASA 3K4LA 4LLGF 1Y0UA 2MD0A 5IT9K 2IRFG 3I0TA 3VODA 2HQ5A 2LG4A 3WE3A 1SVLA 1MSFC 1OLTA 2R7WA 1UELB 4O6JA 2UWMA 3HOSA 1J75A 5GTHC 5FD6A 3KPHA 3J7ZI 4Z2YA 1SMTA 1X2NA 1N77A 2JQ7A 2R7QA 1AWCA 2B7EA 2HVRA 1WPKA 3H5RA 2KIMA 4BNCA 3OIQA 1BM9A 3WTTC 2G7HA 2ME0A 1NTCA 4KA4A 2DAOA 1RZ4A 3KYCB 1Y39A 2IEKA 1GVJA 1WCMJ 2BVLA 1MJBA 2BHYA 4XL9A 3OYMA 1IO2A 5EF6A 3F8BA 2V1XA 4NNJA 5FLMJ 1QPIA 3ABKH 3RPUD 2YX7A 3LNQA 3S32A 3OR1C 3CZ6A 5ED4A 3L1PA 3GWZA 4UUSB 2X6WA 4A5MA 3WGIA 3HB9A 4ZDPA 3NARA 2VJIA 2DODA 4HV5A 2MD5A 5LD2C 2V7FA 3ESWB 3U21A 2XAFA 3V8JA 3DCFA 5K5QA 2QQAA 5CPRB 1ZK8A 4PDKA 3GZ5A 2WTEA 4BUPA 4UXNA 3RCOA 4HW0A 1T08B 4EV0A 3PIOF 2QZ8A 3S1QJ 1R58A 1IUFA 3GXOA 3JSOA 1NH3A 2Q1ZB 4WF2A 4BE1A 1T38A 1B1BA 4AWXB 2F5VA 4FQGA 5EZHA 4AUXA 1RUNA 4EJWA 4CO8A 3LSMA 4LFUA 1J0RA 2CQKA 2MLGA 4BXFA 1OYYA 1VQMI 3VWBA 4UVBA 3BPXA 2HR3A 4II3A 2XGEA 3TP0A 4NQWA 3ZQQA 2ZMEB 2FE3A 2ID3A 3DKXA 3COAC 2NVXJ 2AXTC 1KYZA 4C3HJ 3HZJA 1BR1A 2HWVA 1O3QA 3H9JA 3ZQCA 2V79A 1IRFA 4C2UA 1R1TA 3QYFA 5TISC 4MIMA 1D0ZA 2PN6A 3F6VA 2O3FA 5TRDA 3JCUC 3JRAA 1FBQA 1POGA 1XC5A 3OL4A 2IA0A 2HYGD 5EEGA 2NVYJ 3CLOA 4LLNA 3BPVA 3TOBA 4ZYGA 2ZXIA 3CP8A 3M8FA 2QA4I 1FP2A 2VBZA 2VASA 2BHZA 2JMWA 3TEDA 3P5JA 2Y0SN 4JOMA 2MABA 3BZKA 2RGVA 9ANTA 2HKOA 3DF8A 2MC3A 2FBHA 3HRTA 3E97A 4ENNA 1HF0A 2M8EA 1RR8C 3PNYA 1R5GA 1KA8A 1G3TA 4M9SA 1YLFA 2OBPA 5J3LA 1LFPA 1OJLA 2ESHA 1FWZA 4FTHA 1HW5A 1HOMA 3OS1A 1BIBA 1R1VA 3GZNB 2M9HA 2OV7A 3HSFA 3NRVA 1XDSA 4GRIA 2YX4A 4LK0F 3F21A 5FGMA 2E5ZA 1R4NB 2ELJA 4CXFA 1FX7A 4OAZA 4EJUA 1QQIA 3V8LA 4EMSA 1B8IB 4P5OA 5EDNA 2F5DA 1R36A 3FXMA 3WE2A 2L9RA 4L9VA 1A5JA 2ISZA 1X1DA 1B8IA 3QAHA 3W6KB 3JREA 3GFMA 3QPHA 2CQNA 3S3NA 1D8KA 2CUEA 3P9KA 1KQ8A 1OISA 1DPRA 3MAJA 3M1CA 1XSDA 3GTOJ 1IDZA 3N05A 5HLIA 3KP3A 4HNUA 3JRGA 2P5LC 2E1MC 1TZLA 2JZYA 2KZVA 3KEYA 3LAJA 1VQ5I 1JI8A 4A12A 3OYJA 3BZCA 3Q9SA 2VXZA 5H6QA 2OF7A 2D2WA 3TP3A 1DU6A 3QPLA 1TWAJ 2CMPA 3IWFA 1GVDA 1ZTRA 5CVUA 4DZJA 4QTRA 4O5VA 2R0QC 4UV9A 2R3SA 3OSFA 1Y1WJ 4MGRA 4KICA 1AKHA 3M9AA 3V4GA 1KU2A 2VE9A 2XB5A 1G6NA 4C3IJ 1MDMB 2QENA 2LSOA 4RBOA 2ECCA 4FX4A 1JTXA 2L4AA 5HS9A 2FOKA 3KP5A 3K10A 1XSVA 1XSXA 3OWTA 3CDIA 2NVTJ 5TJJA 3H9QA 5E3LA 3A1YA 3C3WA 4TV7A 5CJ9A 4X0GA 1IW7F 3GFIA 1HKTA 2H6CA 4ASNA 1V4RA 1FOXA 3GZ6A 3ZQGA 2B0LA 2O8XA 4CYCB 1JKOC 4R79A 1SAXA 4O3MA 1J5YA 4IRIA 1FMWA 4BDZA 1T98A 4IX7A 4M6XA 3CCRI 4IO9F 1YO5C 2IW5A 4HA8A 3GTGJ 3ABMH 2V9VA 3MZ8A 5CVVA 1FEXA 3H9GA 1X3WB 4QPOA 2GIZA 4XRSG 2DA2A 2A07F 2IT0A 2O0YA 4OU0A 2TCTA 5FKNA 4IRHA 3CESA 1E17A 3VDXA 3K4NA 1SD6A 2X0LA 3DU5A 2XAGA 1MMAA 4ZYHA 5A2QZ 4J01A 3TO7A 2ISYA 1WWXA 4B09A 3S3MA 2IS1A 1LVAA 1UHSA 1HKQA 1IXRC 2ICWG 1L0OC 1D8JA 2WADA 2GIVA 3HRMA 3FDYA 4UB6C 4ON0A 1IAWA 2DA3A 4AIKA 1HDDC 5DCFA 2R7UA 5KAFC 1F9NA 1S72I 2BY1A 4DOZA 4DYRA 2OQRA 4CCNA 1QNTA 4F3QA 3M3YJ 4EGZA 5DM6F 2K4BA 3DTKA 1Z77A 5JI6A 4P9FA 1DGWY 4L0YB 1T95A 3V7CA 5M3FJ 1W4MA 2QEXI 2BZTA 2XHKA 1FYKA 3MWMA 2JA2A 1LQ1A 1IG7A 3PNTA 4RM2A 2RN7A 4A3EJ 4CGZA 2ETHA 2HDWA 4G7OF 1LUJB 3E0JB 4RS8A 2HZTA 4M3FA 3K4BA 2KHMA 5DD4A 1T33A 2COBA 3RQIA 5ERIA 3QU6A 2XPWA 2CO5A 2EZLA 1UG2A 5JFRA 3QP6A 1LFBA 1D0YA 1XB4A 4Y3OA 5C4JJ 3HOWJ 1NK2P 3LQRA 3I59A 4YFNF 2WBMA 1UMQA 1FSEA 4WXHA 1HLVA 4YIFA 4IQ4A 2DFEA 4IQJA 2LY9A 1JT6A 3HIFA 4OIRF 1OR7C 4D7NA 3RI4A 4FX0A 2F5FA 1BC8C 5FKLA 2DMNA 3VSKA 1VTNC 1IN8A 2XSDC 3FXOA 4ZTJA 2GQQA 1PP7U 3NQOA 3CJRB 4HQMA 4OMZA 3EPZA 1IRXA 4KN7X 1B59A 5FD5A 3D0SA 2PFBA 2NNNA 4BXUA 2D1VA 2XSJC 1EH6A 3KFWX 1YQAA 4HLXA 1QZZA 1Y0NA 4LJZF 2A6TA 1U6GA 3IH2A 2F5CA 4ZZDA 3RZOJ 2CSOA 1Q1VA 5M5XJ 3K4MA 3OS0A 3IKTA 1JKRC 5TGTA 4BQAA 4EQQA 3CC7I 2LVSA 2DDAA 2JUCA 2TRTA 4CCKA 3GYHX 5M5WJ 2UXNA 4YIIA 4JBAA 2MH9A 4HX8A 2VQGA 5F64A 3ROUA 3T0YA 5AIQA 3T8TA 3WGHA 3FISA 5GP9A 3ECHA 3HOZJ 1YW8A 2VKDA 4IHYA 2XF5A 1MGTA 3LSRA 2ZFWA 3WU1B 2DYRH 3FZVA 4WX9A 4M72A 1FNNA 2DMUA 2J5OA 2LH9A 1KU9A 4F7ZA 3S17J 1T39A 4PFOA 3MKYB 2YS9A 4IL6C 1Z6RA 3CCQI 3OYBA 5IOZA 1RKTA 4AIHA 2KISA 1UB9A 1IN6A 3BROA 1ZR4A 4EM2A 1J2XA 2M7BA 2BY2A 1R9TJ 1VQ6I 4RAFA 4WK8F 2YU9J 4IRGA 1BW6A 3GX4X 2WAQA 2HXIA 1OYIA 3WTYC 1IRGA 3DKWA 1P4AA 5ILUA 1B72A 1PJRA 4ANJA 2JWTA 2XAUA 2ZO4A 3M1EA 3R60A 3HGYA 4GO1A 4HZFA 1TBXA 3ML6A 3CUQA 1MBEA 4CCMA 1L3LA 4LITA 3TDUC 1X3ZB 1X1AA 3CLQA 3PFIA 3JW4A 2P7CB 2XV4S 4ENJA 2LC2A 5ICFA 3TW7A 1IN5A 3HTUA 3DBLB 2W1OA 3DXJF 5BNGA 4N4NB 1O3SA 2ZJ2A 2HU9A 2QQ9A 1MD0A 1LDKB 1NG7A 5D5WB 3F6OA 3NEUA 1OKRA 2P6SA 3R4KA 4BJ5C 2LKXA 3JAMK 3CC2I 2EV6A 2IGKA 1GUUA 1ZG3A 3G71I 3K1MA 2FSWA 5F0HA 1MZBA 4U0YA 4BACA 1K6YA 1YX3A 3A4CA 4QSHA 3DLLF 2R7ZJ 2Y31A 1F36A 2CW7A 2DFHA 3BWGA 5BPDA 3DTIA 1SFOJ 4KUMA 3W6VA 1WRJA 2HPMA 4XLEA 4IHXA 2DI3A 3DLAA 3LOCA 2VLAA 1S5LC 1ETXA 1SVMA 2P4WA 2KMUA 1SFUA 2GLOA 3MEXA 3T8RA 3ZMDA 2QLZA 5HNFA 2EZKA 5D6EA 1IUYA 4DW6A 3VYRB 1I3QJ 3TL4X 2F6CA 3K4CA 1XS9A 3DEUA 4H4KC 4BJ6C 3DPTA 1P7IA 5EJCA 1T8IA 1WFXA 5JHUA 2EFWA 1MMDA 3ZQLA 3AG1H 2M0CA 1P92A 4KNYA 3DQVC 3GTKJ 2L2OA 3CCUI 2IS2A 2VT3A 5HDGA 4A3KJ 1ZRFA 2ME6A 2EFNA 1HA8A 4NB5A 1VF9A 2F4OB 2HVQA 3JRFA 2WV0A 4RDUA 1ZREA 3LFUA 4IEJA 3S14J 1JHFA 1R5ID 3AL0C 1TT0A 2W82A 3I4PA 2X1CA 3BCAA 2H09A 2VKVA 3BTIA 2RNJA 3HUGA 3V7SA 3C2GA 4RAZA 1W7PB 1TWGJ 3BC8A 2DQRA 4DQ2A 1WKMA 1T6SA 2OCEA 1LNWA 3BR3A 4B3XA 5B5EC 5GTIC 2DOEA 4MQVA 1XPXA 2XGXA 1ZN2A 2KP6A 2BXZA 2OJED 3IKVA 2M45A 1W7PA 1I27A 2V9PA 4BQOA 1O3TA 3LSKA 4MFEA 5KAIC 1YS7A 1ON1A 3IAS2 2ELKA 2KIQA 4C2MJ 3ZQIA 4GYIA 5H6RA 5H20A 5F6FA 5CYVA 1QVTA 2KJCA 2YSRA 2ZB9A 1G2HA 2L0KA 1WJFA 3OY9A 3VSLA 2AQFA 3K7AJ 1MBKA 5IP7J 2KIFA 4DJAA 2CFOA 1A35A 2VQCA 5L3DA 3KCCA 2Y75A 1ZHFA 2WA0A 2OTJI 2H1LA 2STTA 1KONA 1TQMA 4BGDA 2PJPA 3SDBA 3CCJI 3GTLJ 4D7MA 3OYIA 2IPQX 4WCGA 2ZC2A 3QU3A 3ZCOA 3F8CA 1YW9A 3HSEA 5ICCA 3BZ6A 2FNPA 2A05A 1X3UA 4I09A 4Y4RA 1OCZH 3EUHA 3GTJJ 1WGXA 1Z1DA 4W97A 1BI2A 3JRBA 5AONA 4P9UA 2EBIA 3BLYA 1QA6A 2PJRB 3RIRA 3DEEA 4WXCA 2E2HJ 2JN6A 2KPMA 2IGMA 2HPIA 3LSHA 1UG0A 3DWLE 1R49A 1JGGA 3IUOA 2GZWA 1MBGA 3K4JA 3IV5A 1Z21A 4ZYAA 2QF7A 3SQNA 3C7JA 2NS0A 2D5VA 4RB0A 3CDLA 1T0FA 4B3AA 2ESNA 2PI0A 1O4XA 4FISA 1H8AC 2JA8J 4DYCA 1ZQ3P 3RQ4A 2MGQA 3EUKL 4HDVA 1R7JA 4X1EA 3ZMSA 2EPFA 3KZIC 3HOXJ 3A03A 1P4WA 3MMYB 1U0JA 1JT0A 1W36C 1HW2A 3B6CA 3G73A 1XN7A 1Z7UA 3D5LA 2R7RA 2CQ7A 2ZSIB 4IJAA 1FOWA 1XGNA 3FBIB 2QVOA 4QIWN 2O8KA 5LHIA 2LDUA 2JA5J 4I99C 3WG7H 3DBRB 2K9QA 3S93A 2IS4A 3GTQJ 2L02A 1T56A 1VFCA 5CKTA 2QCOA 4IZZA 1HQCA 4EJVA 1VI0A 2VE8A 2E2JJ 4M9ZA 2RAEA 3ASOH 2E2IJ 2VC0A 1WH7A 4MTEA 5DS9A 5E3NA 1SVOA 2K3PA 2X85A 5HS8A 5LHHA 1JJ6C 1WHUA 2ADUA 4D5FA 5J1YA 5CVJA 2UZKA 3W2AA 1F4KA 2K7LA 3CO6C 5E20A 3HXLA 2W85A 4PJMA 5IYCJ 4HDUA 4N4OB 2GM4A 2MLKA 1O7FA 3G6EI 5K7HA 1EKEA 1WH5A 2YR2A 1MNEA 4RB3C 1RKWA 2A6HF 4HG2A 4HPQA 2H6BA 2QQBA 1Y56A 4XIDA 2JVGA 4MLOA 3CCYA 2HTSA 3AFHA 2K3FA 4L9NA 4Y13A 2PX9A 4L9JA 4HV6A 4UUSA 4LB5A 1R23A 3FXKA 2A69F 3BG7A 2WY8Q 2ZXWH 4I7HA 4B43A 3K1PA 2CV0A 2OU2A 3LSJA 4EM0B 3MN2A 3S2HJ 3BQZA 5DCMB 4KJZA 3U1KA 2G0EA 2XIGA 2K27A 5BMZA 2B63J 2VJ4A 2PLYA 2WAEA 3DKYA 5D8KB 4ESBA 3RTRA 4RLQA 3GF2A 3KLNA 1YW7A 2GA1A 4EJTA 3R6SA 3GMEA 2VQLA 3CTAA 4BHCA 2DQLA 3H0DA 1S7OA 4CCOA 2Y30A 1VZ0A 4HSTA 1MBFA 3C18A 1GV5A 4XKWA 3S1RJ 5IT9Z 5E17F 3T1BA 4AIDA 3C2HA 4RA2A 1IXCA 4KN4X 2L7ZA 2DK8A 4HOBA 1DU0A 3ZMTA 2Z3YA 3ZQHA 2MH2A 3DBHB 2K40A 4JX6A 3CF5F 2R93J 1UHMA 2Z2SB 5KNLA 3VYTB 2EFOA 4KDPA 1WJ5A 4A3MJ 3FX3A 5FFXA 4KYWA 3R0JA 1QVUA 5DUIA 2VPLA 2EIMH 2ZMEA 4YIRX 3WU2C 1OPCA 2HXOA 2L7FP 2O03A 4B8XA 4CSWA 3L2WA 4E7KA 2QSHX 3FMRA 1S8NA 1F43A 3BR6A 2BY0A 3H1CA 3MKLA 4PCQA 1Z67A 1WJDA 1VQ7I 3ZN1A 2CYYA 1HW1A 3OYHA 4E7LA 3TOAA 5D5VB 4X6AJ 3OV8A 3KYDB 4IVNA 3J81Z 5JVTA 1GXQA 2XAJA 3M7GA 1UAAA 2Z33A 3F3XA 3FMQA 1QHGA 2VT2A 5HLGA 3AG4H 5FB2A 4M3GA 3A0BC 4PGHA 1D1CA 2XAQA 1D1AA 5IPAA 1I1GA 2QWWA 3V42A 3OYEA 1ETWA 3RSNA 4KIGA 4JX4A 3OYGA 4ZH4F 4E7IA 2HTJA 2HOAA 2OZUA 1U5TC 4YFKF 3MFKA 4ZDOA 1WJBA 3PNVA 4D1QA 2GAUA 3A02A 3Q9VA 1OYWA 3SJMA 4LK1F 1JXSA 1IC8A 5D4RA 4KMUX 3V8KA 2I10A 4MEXF 1I50J 2DDBA 1SC7A 2FUG2 2LFBA 3TO6A 1VQPI 1ZLKA 4FHTA 2AS5F 2BOLA 1U9OA 3K9TA 3VB2A 4DBRA 4IHTA 1KQ0A 4MTDA 1E3HA 1QRYA 2F2EA 4D0PA 4NDLA 1ETOA 3ERMA 3H35A 3BG3A 2O6GE 1BL0A 1AA7A 4A3CJ 3RYPA 5GPCA 1FC3A 2LR8A 5L3CA 5AIPA 1DP7P 3H5AA 2E1NA 5JVGF 5GAHJ 3BR1A 1RC9A 2P6TA 2LF7A 2VJ5A 3JRDA 3A01B 2EA2A 1ULYA 2HKXA 4XN0A 1SEUA 4HRIA 1E0EA 1YITI 2VODA 2Y48A 2FQ3A 1GXPA 3CUQC 2M7AA 4CZCA 2R92J 1E3OC 2DCEA 5J47A 3A01A 2P0WA 2B9SA 1FYLA 3PO3J 4PGGA 3K70D 3F9KA 3FXLA 1JE8A 2K86A 2R7DA 4C30A 3JTHA 1K6OA 1G4DA 4OMYA 1XCVA 2DFFA 5A2QK 4G9YA 3BJ6A 6PAXA 2JA7J 3KEOA 1MNMC 3G1LA 4AC0A 4IKFA 1A04A 1W5CC 2FBIA 2L9VA 5M5YJ 4Y52J 4FE7A 1TW3A 3RJPA 5LLQA 3R61A 4H0EA 4XK4A 2FU4A 2A68F 1TLHB 3HM5A 1ETYA 2LYCA 3F8NA 3LSTA 2LBFB 1MH4A 3AG3H 1Z05A 3I3LA 1MDMA 1RIOH 3ZXSA 4RGXA 2FEZA 1NHAA 4Y15A 4XICA 4BE2A 3FK6A 4GDFA 4Q47A 2P81A 4UUVA 4CUGA 1YHQI 3L2QA 2AQEA 4HQEA 1YS6A 1OFCX 2HDDA 2L4MA 3P7NA 2CRGA 4CYCA 1TNTA 2W84A 3F0CA 4RGUA 2BVMA 2D1HA 4B1RA 2X6YA 2RQQA 2CG4A 2QYOA 2XF7A 4N0BA 4KIBA 3X2QH 2CGPA 2R7OA 5BPIA 4PJJA 2HZDA 5BS6A 5HLTA 5D5UB 4G6QA 1JTYA 1STZA 3ABLH 4U0VA 4XRFA 1XGOA 3H36A 4F52A 2KRCA 2CUZA 4V2GA 2EJRA 4XLAA 1A31A 4UY8I 2HOTA 1OMIA 1TWHJ 2DA4A 1ETQA 1BOBA 4L5EA 2PMZN 5IY5H 1MBHA 1MJAA 5FO5A 3B73A 1MMGA 5GAEJ 4Z6YA 1AOYA 2FMLA 3FWEA 5KCMA 1ENHA 3MD2A 1N75A 2Y0SA 4A6DA 3GLXA 4MO7A 2EZIA 2X9DA 3CCSI 1FIAA 4BQQA 3QYBA 3D1NI 1H0MA 5DYMA 1X4PA 5F08A 5GAGJ 5LEJA 3I55I 1VNDA 4PUSA 1XX5A 2HQRA 3ZN0A 3OR2C 3OYAA 1XTAA 2VBYA 1X1CA 1J59A 1TWFJ 5HS7A 2VBXA 3HSRA 3C2BA 3V7RA 4MEYF 4XONA 1IN7A 1W1WE 2DK5A 2EB7A 1SMYF 2DU9A 2CH0A 1LEAA 3CMYA 3BT9A 2W25A 4ITVA 2Z1DA 1PUFB 2BYVE 5L3BA 2W48A 1R00A 1XMAA 1MIJA 1MW7A 1ZG1A 1U3EM 3B02A 2VKEA 3BDDA 3EQLF 3L2VA 3S3OA 3FHNA 1YJWI 3HC7A 4A0XA 5LBQA 3MKWB 3CCEI 2AO9A 3EYIA 5FRMA 3KP7A 4OAYA 3G1OA 4UV8A 1DP3A 2E1CA 3NWSA 5FJ8J 1KGSA 3S8PA 3PL8A 4CYDA 5CQGA 1BR2A 2XPVA 1EJ9A 2KFDA 2Z99A 2ZKZA 2GXGA 2IAIA 2L5QA 1QPMA 1WI9A 4A93J 4G8XA 4L9TA 2K02A 3S2WA 2DTZA 2L9SA 4PZJA 1PUEE 5DEQA 1RUOA 2IGOA 1CF7B 3QOEA 2KJBA 3EUHC 3PUFA 4XKVA 3CCLI 3FXQA 5DDGA 3QODA 4RMNA 2X4HA 2CWEA 2E1OA 1CF7A 1J7KA 2R7FA 2C6YA 4BL0B 4EATA 2DN0A 1GV2A 3QWLA 4DZPA 2IBDA 5HOOA 1Y8QB 3Q5FA 1USTA 1ETVA 4CCLA 3L09A 2O61A 1DPUA 3CD6I 3ZGKA 1W7PD 3WTWC 3J7AO 3LWFA 1P6RA 3W3CA 1SANA 2R7XA 2M4GA 1DDNA 1IV6A 1YOVB 4UVCA 4XOTA 1LB2A 3QOPA 1IJWC 2HNHA 1LDDA 2K85A 3LMMA 4L18B 4E70A 3KE2A 1Z0XA 3S1NJ 1JHHA 4E7SA 2H1KA 3NWTA 1SFKA 2E60A 5K7FA 3CJTB 5E18F 2QKLB 3RKYA 3RKWA 2OAZA 1WJEA 3QPSA 2L3DA 1MH3A 2E7XA 3E5UA 5F27A 4DNCA 1DUXC 1F1ZA 4I0AA 3U1DA 5EEAA 4U7BA 1JKPC 1XGMA 2LNBA 2X51A 1I39A 4QPQA 1P9QC 4BE0A 1FZPB 1LE8B 3QRFF 5IYBJ 3OYNA 2UV1A 2JJ7A 5M3MJ 3W2VA 1HSTA 5EEHA 2E1MB 1K79A 1R6RA 2COMA 3BR5A 1MMNA 4S0HB 1LE8A 2VBWA 2QM3A 4JK1X 4B48A 3Q0WA 2F5EA 1MMSA 3KYLA 2BW3B 4BY1J 2F48A 2PMZA 4BHPA 4OIPF 2MFZA 4HX4A 1N78A 3I4MJ 2N8GA 2ZJPF 3CDHA 4HSRA 2BW3A 5E8IA 3CCVI 2QQ8A 3L7WA 2JT1A 4ZYEA 2V6CA 2ACJA 1R1UA 3SEQA 4OIQF 3PQKA 2FQ4A 2LRDA 2OTLI 1I5ZA 1VQOI 4A3LJ 2QKMB 4UHTA 1KYWA 3VYUB 5E3MA 3HOVJ 1RI7A 5BQTA 5K5RA 3BJAA 3ABUA 1HCRA 4KMFA 4AD9A 4G6TB 5D6FA 5DM7F 3ZMVA 5C3EJ 2G7UA 1ON2A 2JRMA 4U88A 4BH9A 1JJ8C 1IRZA 3WHCA 2XUBA 3QQAA 2BV6A 3J80K 1UJ8A 5E1XA 4KISA 4XN3A 3I71A 3HOUJ 3HEFA 1DGRM 4U87A 1JKQC 2DO7A 2XGCA 5B3SH 2F4MB 2DPDA 5F0CA 1FT9A 1JUPA 1QU3A 2OZ6A 3QYEA 2V4JC 3WTSC 4P1WA 3PM1A 2MW8A 2NOGA 3O2PE 2MYSA 2DT7B 3GO5A 1ONVA 1RNLA 3TKYA 4A69C 2JUGA 3TMOA 3WG9A 1XGSA 1D1BA 5H2FC 2PMHA 3HYIA 4UB8C 3P9IA 2EV5A 1WJCA 2HFHA 3E6DA 4MFDA 5LFAA 1K61A 1H88C 1TQIA 4XKBA 2KKOA 3KEQA 4RLFA 5J8FA 2HYJA 2M30A 2KIUA 3E5XA 4E7ZA 2XGDA 4IHVA 2PG4A 3RKXA 2XPUA 3DFGA 3HBLA 1H9GA 1S3JA 1HBXG 5K5OA 3E3VA 4G12A 1OCOH 1TQPA 3I54A 3OIPA 2NNYA 2R7VA 1HDPA 3O3KA 4NC6A 4A3BJ 1J9IA 3HOYJ 1Y6IA 1VQ4I 4NHJA 1ZH5A 1SFEA 2KRHA 3E1SA 1O7LA 4ZYDA 3KZYA 2WV1A 1K78B 1PDNC 1TL8A 1ZAOA 2MA3A 3PSFA 1OCRH 2MSYA 2EA4A 1P7JA 2GOMA 3M4OJ 2EWNA 4ENKA 3L2CA 1BBYA 2K5CA 3QPTA 2V9KA 1ZGJA 4QLCU 1A6IA 2VUMJ 4BAYA 1ZRDA 2M1BA 1REPC 1ETKA 3OYDA 1V5FA 2ZNZA 2Y9YA 3OOPA 1OR7A 1UCRA 2X6XA 3U2RA 4E6KG 1CGPA 3ZP5A 4Y7NJ 2IA2A 4P55A 1BJAA 4F92B 3K1NA 1WSUA 3ISPA 2MG4A 2XC7A 1FP1D 2RDPA 2EFQA 4EM1A 1X2MA 2JK3A 4BEHB 3GBGA 3LSGA 1PVEA 4E7JA 1XG1A 5ILVA 5L3EA 5ICGA 2BXYA 1FYMA 2R7TA 3FKJA 5EZGA 2A5WA 1YTYA 2Q2EB 2PJRA 1BN5A 3K2AA 1BOAA 2JTVA 1P2FA 2NXNB 5FKOA 4BEHA 1G3SA 1VQKI 5FLVA 5EGOB 4XSZF 5ICEA 4BXXJ 3SDGA 4A3DJ 1VQLI 4LG0B 3HG9A 3N97A 2Q2EA 3JRCA 3ZPLA 4ESFA 3AAFA 2DLLA 5JR3A 3J7AY 2BBYA 5EGOA 1I1SA 4S04A 4LG0A 3K69A 1RETA 5FRNA 1SD5A 2Y0MA 4BKXA 1EV7A 4XLFA 3LA3A 4BHBA 4R1HA 1TW2A 2EQRA 3SZPA 2M4KA 4Q4ZF 1U8BA 3D5SC 2JA6J 2MBFA 1AHDP 4MQ9F 4AIJA 5JLXA 1OQYA 3PSIA 5LEKA 2QGUA 4HEA2 2ZXHA 2HGCA 1YJ9I 1QO0D 3GCMA 4QWQA 1FJLA 3F72A 1WI3A 3HDDA 5FLXZ 3GTMJ 4B47A 1GLNA 1TNSA 1U78A 1MSEC 3G3ZA 2X48A 2NVUB 2V26A 4A3JJ 3DV8A 3OSGA 4AVZA 1S6LA 4I01A 1Z91A 1FY7A 3SEZA 4PJNA 2RV8A 3CMMA 1S7EA 1LEBA 1FBSA 2DW4A 4FE4A 5FFZA 2OUMA 1PP8F 2FA5A 2HS5A 1WJAA 3LA7A 1V5GA 3BJOA 2FX0A 3BG9A 4U7DA 2JVHA 3S16J 2RVCA 2BE5F 3FF5A 4GGGA 4RB1A 4S05A 2E36A 3BR0A 4Y17A 1IXSB 2M2EA 3HTSB 4GXOA 2ZBKA 4XM3A 5HLHA 2DA6A 5HDNA 3LFKA 1KQ9A 4XBFA 4B44A 1GT0C 3L2UA 2IXSA 4ZJZA 1B6AA 2RQPA 2CV1A 2WAFA 3GUDA 3JSPA 3SFIA 1EH7A 1X4OA 2EFPA 2NAZA 5JLWA 4V19K 3UNGC 3J81K 3EDPA 1W36D 5DCMA 1E2XA 2CW8A 4KT6A 2ELHA 3GEZA 5DUKA 2EV0A 4M3EA 2Q8KA 1ITYA 5LRRA 4J00A 4I2OA 1M1EB 2DOAA 2F4IA 4RGRA 4A2UA 3RKQA 4M74A 5LGTA 3CJQB 3GW2A 3G4SI 2HOSA 3I9V2 3M8EA 3CUOA 2QSGX 3ECOA 1ZARA 4IXAA 2WB1N 2OC6A 4DYQA 4HLYA 2VOPA 5K1YA 2PEXA 1TC3C 1I6XA 3ZQ7A 1Z3YA 1IV8A 3ZR8X 4BU2A 2VC1A 2DYSH 3KLOA 3AL0B 2DA1A 3FXJA 1TTYA 4A3FJ 1MNDA 3W2WA 2E71A 3CF2A 5HDKA 3KIOA 5IP9J 4RM3A 3PO2J 4G94A 3K6GA 2DMQA 5CVRA 4F91B 2Y2ZA 3MCZA 3OYCA 2L7MP 3AKZA 3KZZA 5D5XB 4YFXF 3EYYA 4AYBN 3ELKA 3BQYA 4NQWB 1G3WA 3FMSA 3ZMUA 3BOQA 4LMYA 2HVSA 3OYFA 3K0LA 2MC4A 4BBRJ 4IOAF 1U9NA 3BG5A 5F1JA 2OCCH 4J19A 1W0TA 1OCTC 2ZSHB 2DXIA 2JRTA 2R7SA 3HL2A 3E5QA 2VQHA 2WWYA 3K70C 5EG0B 5F0FA 5C4XJ 1R5HA 4R8HA 4A6EA 2VOOA 1X1BA 4KITB 1K4TA 3A0HC 2P7VB 2K9SA 3PIPF 1QZYA 5EG0A 2J5PA 4A0ZA 2H8RA 4JQFA 1ZYRF 3G2BA 3KP2A 4PJ0C 1CQTA 4A3GJ 3IWZA 4I76A 2G9WA 3S15J 1E3PA 4ABZA 1XDUA 3O8HA 4ETSA 4RB2C 3IP4B 4BQNA 4LG3A 4ZTFA 1ZGWA 1QBJA 3CJNA 2QBYB 1EF4A 1FMVA 2PMUA 3EUAA 3GLLA 3D5RC 1D0XA 4XOPA 4BBSJ 5EYRA 4M71A 2XDVA 2NRAC 3FIWA 1LDJA 1W0UA 1BC7C 3JRHA 2QBYA 2L01A 5LGNA 1B9MA 3LSIA 3M8JA 2K4JA 2L54A 4V2FA 1A36A 5E79C 3SHFA 2CQQA 2LY2A 1IN4A 3GTPJ 1TT5B 2CQXA 2E5NA 4AU7A 3LL7A 4XKCA 2Z9OA 3S2DJ 5D4SA 5CLSA 2CUJA 5LHGA 2K9MA 2ZJRF 1XCBA 2H8WA 1HKSA 4KT5C 3SZTA 3ZRGA 3DP7A 3IRQA 4CHUA 1DQUA 3QP5A 4L5IA 4XRMA 5BOXA 3DEWA 5DV5A 3ULQB 4EEFG 1X1PA 2FXAA 1J09A 2VB6A 3MQ0A 1IZ1A 3RPUA 4YG2F 3B6AA 4HNVA 3BR2A 4D9JA 2W57A 1HC8A 3BCBA 5GPAA 3REOA 3E6CC 4XLNF 4G7HF 2ZFUA 3F8MA 1ZR2A 4A3IJ 4BS9A 2IA1A 4PSXA 3IL2A 3PFYA 2A3SA 3MVPA 4DGWB 1SD4A 4CA0A 4BDYA 1AKHB 2A5YB 3BTCA 4XSXF 3WTXC 4CH7A 2BGCA 1RR7A 5B1BH 3E6BA 1ZLJA 2GWRA 2LBFA 1YIJI 3P9CA 3RYRA 4JYKA 1IF1A 1BIAA 4RAGA 2XF6A 4CICA 1MJ9A 4IPAA 4HF2A 2Y69H 2YU3A 2WB1A 2KZGA 2NOJB 1XMXA 3OYKA 1YI2I 3R0AA 2Z16A 3IC7A 3LQQA 4ENMA 3I4NJ 4II2A 2Z5UA 3U9GA 4HX7A 4IHWA 2DA5A 2HI3A 3IRRA 4FCYA 1YIOA 1AU7A 3MZYA 2STWA 3CP2A 4DIQA 2WAQN 3BTLA 4YEJA 3TGNA 2EK5A 1D3YA 1Y8RB 1YX5A 3DPUA 3FBNB 3F8FA 2KRFA 5D8LB 2OA4A 1VQ9I 1ZRCA 3FM5A 2H94A 4AYBA 4NUBA 3FHZA 1I6HJ 2R5YB 2DA7A 2DJIA 4D5CA 2L7KA 2W4SA 4PSWA 1WQ2A 5KHDA 4XLHA 5B66C 1ODDA 2O9LA 2UXXA 4XR6A 1YFHA 2R5YA 1RESA 4HBLA 3ZQFA 4LB6B 2DJNA 1S9HA 1D5VA 5KK1A 2OD5A 2M34A 3DU6A 4LLLA 3M07A 2LOOA 2DOFA 4F93B 1LPQA 5HVQC 1IDYA 2V1NA 3TQNA 2I8DA 1FOYA 3BTJA 2DPUA 5FKKA 3O8GA 4HF0A 3N4MA 3CQZJ 1ORKA 4WXDA 1JUMA 1V54H 2CU7A 2X1DA 1U8RA 1VQ8I 4BJTA 3IH4A 4KIFA 2VI6A 2LTPA 2LD5A 1FSHA 3HJEA 3CCMI 2LKPA 3HRUA 5DD8A 1YE9A 4F55A 4BYYA 1LVKA 2XAHA 4I98B 2W00A 2TDXA 2OPTA 2VIXA 3VYSB 5HODA 3VOEA 2XROA 1WZ2A 1PUFA 4HAMA 4NBQA 5J8CA 4ESJA 1Z7LA 4M73A 4EGYA 3Q0VA 1S7AA 3I59B 4AM3A 5F04A 3EETA 2EILH 3OOUA 2LKSA 4P96A 4XMYA 2E19A 1V55H 3Q3SA 1ERDA 1T2KA 1V3FA 2QUFA 2Q0OA 4L5JA 3HPGA 4I0BA 4UNOA 3AG2H 2IP2A 5B1AH 5E3OA 1TWCJ 1U2WA 1MBJA 4W1UA 1NG6A 3CO7C 1BJZA 1A6QA 4HYEA 3HOTA 4PFPA 3WTZA 4XQFA 3J7YJ 3TBIA 3LA2A 2NS8A 2RC4A 1BI0A 4ZC3A 3A2KA 2CV2A 5IOYA 2HQAA 4M3BA 3F22A 2W24A 3IHUA 2NYXA 3I58A 3WODF 2RNGA 2ZCWA 4L0ZB 1G59A 3RPQA 3KX2A 1Y1VJ 1B9NA 5DTDA 1U5TB 2Y9ZA 3L00A 5L3FA 1JUSA 3PUBA 4ZZLA 2O7OA 5K7ZA 2IJLA 2H27A 4XNFA 1T0FC 2R4GA 3K4KA 4Q48A 4WWCA 1FTZA 4LIVA 1U5TA 3HRSA 4A5NA 2P8TA 2HDCA 2E7WA 3OYLA 2OQGA 2FRHA 5CVIA 1EH8A 1OCPA 4JX5A 3ZMZA 1K83J 4C3JJ 2KQRA 3FXUA 3GFJA 5CQEA 2R5ZB 5KVRA 1YRNB 2UUZA 1B4AA 1GDTA 2HYFA 1KU3A 3OS2A 2ZNYA 1JGSA 2DMTA 2VN2A 2BY3A 3FM3A 1K7AA 2R5ZA 1YRNA 2W7NA 4FETA 2VXDA 2LMDA 3I56I 1KU7A 2XVCA 5E1WA 4A0YA 4IOCF 2DTRA 4GCVA 1XMKA 2K9LA 3FK7A 1OCCH 1B72B 3CC4I 2PQ8A 2JSPA 4IF4A 2GXAA 3SZGA 2CUFA 1BA5A 1W5TA 3CUQB 4IHSA 2LK2A 3VPRA 1RPWA 2EZHA 4LD5A 1YJNI 4OINF 2LP0A 5J4YA 2JSCA 2VJJA 3UKGA 2V6EA 2ECBA 3RZDJ 2WY7Q 3GVAA 3WU0A 4JP0A 2DT5A 1YYVA 3TO9A 1GHCA 4GYGA 3H3ZA 3SXYA 1G8XA 3F23A 2EIJH 1D5YA 4E4HA 2IVMA 4OWRB 3ABTA 3JR9A 4N9HA 2HQNA 4MNUA 2VL8A 4M6VA 1ZG5A 1O57A 2VONA 1MKMA 3UR3C 1Q1HA 1RRJA 5J1UA 2NS7A 4ZDLA 1PYVA 4LOCA 1X58A 4E7HA 4B4CA 1SD7A 5J4VA 4G7ZF 3BG6A 1FBUA 3ERED 1K4SA 2NVQJ 2CJJA 2DT6A 4EJOA 2EIKH 3S1MJ 3GFLA 2CW0F 3HKZN 1H9TA 4DBQA 3VEPA 3ZOBA 1Z6TA 2XRLA 3L9FA 5LGUA 3NAUA 4RAYA 3BY6A 1Z3XA 2JPBA 2KL4A 2X1EA 3T5XA 2DBBA 4UUTA 4XRSA 1I3AA 3KETA 3HHGA 3CMAI 2EH3A 2M87A 3ONQA 5ILSA 3H5NA 1EA3A 2VPRA 5IT3A 4HF1A 2M5WA 2LF8A 3I64A 4NC8A 5F1RA 2XKPA 2I5UA 2KDOA 3PQJA 4XORA 2DMPA 4AVPA 2ZJQF 2M3AA 4M6YA 4MHGA 3TDZC 3PJRA 2K9NA 5FKMA 5J6XA 1BW5A 3MZHA 4K2EA 2XB0X 4LIUA 5E1ZB 2CS3A 1V5EA 1ZKGA 1FOKA 1QGPA 2KLOA 1UZCA 3G1MA 3JAMZ 1YG2A 1ZGAA 2GXBA 1ACIA 2A61A 1W5SA 1R4MB 3HUGB 3DTEA 4GFBA 1TP4A 2FBKA 5L3GA 2ZMEC 2LY1A 5E8GA 4YELA 3FXRA 2FNAA 5C44J 2EINH 3W6JB 2GBYA 3I53A 3KP6A 3TW6A 2KDZA 3VFZA 2DFIA 1FPQA 4G6DA 2FF4A 3FKIJ 3OMYA 1USSA 3LAPA 4FT8A 4BY7J 1SAUA 5IYDJ 2ID6A 3SFZA 4Y33A 3MKZA 1NK3P 2FJ1A 3E6MA 1UFMA 4FASD 5IP6A 4LGWA 1K78A 2E35A 2M8GX 1BI3A 1BR4A 2RREA 4PJLA 3J80Z 4YRVA 4I6ZA 2E34A 4M3DA 1F5TA 4EVIA 1S29A 3JTGA 4XLPF 2GOXB 2L9NA 3IH3A 1P4XA 4PK4A 1LKXA 2RKHA 3IAM2 5HNHA 1VQNI 2LREA 1FIPA 5J40A 1H89C 5GADJ 3H92A 3RDIA 5FLXK 1QZEA 2IGNA 4Q5SF 1ZELA 2FD5A 2FOWA 2ZXJA 1LJ9A 1KZHA 2FMYA 1R71A 3HGGA 4KFCA 1Z9CA 1C0WA 3DPLC 3C1DA 3E7LA 1G3YA 5JHFA 4OIOF 5J1RA 4UVAA 1SFXA 2CFXA 2YPRA 1X19A 5LRSA 3HPHA 3WGGA 3ASNH 3WTVC 1LFUP 2HOEA 1APLC 3LSPA 1HSJA 1XD7A 2AXLA 3BP8A 2V1DA 2AHQA 4CZZA 2HEOA 2KT0A 3SYTA 2XRNA 2P5KA 3H0GJ 3H3VK 4RGSA 4U0WA 4OOIA 2LLKA 2VKHA 3OIOA 2QSFX 3WHBA 3OL3A 2V1UA 2PBIA 1BI1A 2O5RA 3O6BB 2X6OA 4XLCA 4I02A 3JRIA 3CMEI 4CDGA 3L2RA 2BEOA 3HHHA 3K2ZA 1QHHD 1UHWA 2D45A 1HXDA 4HNTA 2A6EF 2WC2A 2IS6A 3KP4A 2JPCA 1FLIA 4C9YA
chains in the Genus database with same CATH topology
3H3UA 4M9XA 1O3RA 3WTUC 2GA2A 3I5UA 4N9IA 2P5VA 2XKOA 1R22A 2XASA 4LLGF 1Y0UA 5IT9K 2IRFG 3I0TA 3VODA 3WE3A 4O6JA 2UWMA 3HOSA 1J75A 5FD6A 4Z2YA 1SMTA 1AWCA 2KIMA 4BNCA 1BM9A 3WTTC 2G7HA 4KA4A 2DAOA 1RZ4A 1GVJA 1MJBA 3F8BA 2V1XA 2YX7A 5ED4A 3GWZA 4A5MA 3WGIA 4HV5A 2MD5A 2XAFA 3V8JA 5K5QA 2QQAA 4PDKA 3GZ5A 2WTEA 4UXNA 4HW0A 4EV0A 2QZ8A 1R58A 3GXOA 3JSOA 4WF2A 1T38A 1B1BA 4AWXB 1RUNA 4EJWA 4CO8A 4LFUA 1J0RA 2CQKA 2MLGA 1OYYA 4UVBA 3BPXA 2HR3A 4NQWA 2ZMEB 2FE3A 3COAC 1KYZA 2HWVA 1O3QA 2V79A 1IRFA 1R1TA 2PN6A 3F6VA 2O3FA 5TRDA 1FBQA 2IA0A 2HYGD 5EEGA 3CLOA 4LLNA 3BPVA 3TOBA 4ZYGA 3M8FA 1FP2A 2VBZA 2RGVA 2HKOA 3DF8A 2MC3A 2FBHA 3HRTA 3E97A 4ENNA 2M8EA 1R5GA 1KA8A 1G3TA 4M9SA 1YLFA 2OBPA 2ESHA 1FWZA 1HW5A 1BIBA 1R1VA 3HSFA 3NRVA 3F21A 1XDSA 4LK0F 2YX4A 5FGMA 4CXFA 1FX7A 4EJUA 1QQIA 3V8LA 4EMSA 4P5OA 2F5DA 1R36A 3WE2A 4L9VA 2ISZA 3QAHA 3W6KB 3GFMA 3QPHA 1D8KA 3P9KA 1KQ8A 1DPRA 3MAJA 1XSDA 5HLIA 3KP3A 2P5LC 2JZYA 3LAJA 4A12A 3Q9SA 2VXZA 5H6QA 2D2WA 3IWFA 5CVUA 4O5VA 4UV9A 2R3SA 4MGRA 4KICA 3M9AA 3V4GA 1KU2A 2VE9A 1G6NA 1MDMB 2QENA 2LSOA 4FX4A 2L4AA 5HS9A 2FOKA 3KP5A 1XSVA 1XSXA 5TJJA 3C3WA 4TV7A 5CJ9A 1IW7F 3GFIA 1HKTA 2H6CA 4ASNA 1V4RA 3GZ6A 2B0LA 2O8XA 4O3MA 4R79A 1SAXA 1J5YA 4IRIA 1T98A 4M6XA 1YO5C 2IW5A 4HA8A 5CVVA 2V9VA 2A07F 2IT0A 2O0YA 4OU0A 4IRHA 1E17A 1SD6A 2X0LA 2XAGA 4ZYHA 5A2QZ 3TO7A 2ISYA 1WWXA 4B09A 1LVAA 1HKQA 1IXRC 1L0OC 1D8JA 2GIVA 3HRMA 4ON0A 1IAWA 4AIKA 5DCFA 1F9NA 2OQRA 1QNTA 4EGZA 2K4BA 5JI6A 4P9FA 4L0YB 3V7CA 1W4MA 2XHKA 1FYKA 3MWMA 1LQ1A 2RN7A 4CGZA 2ETHA 4G7OF 4RS8A 2HZTA 5DD4A 5ERIA 3QU6A 2CO5A 5JFRA 3QP6A 1XB4A 3LQRA 3I59A 4YFNF 1FSEA 4WXHA 4YIFA 3HIFA 3RI4A 4OIRF 1BC8C 4FX0A 2F5FA 1VTNC 1IN8A 2GQQA 1PP7U 3NQOA 4HQMA 4OMZA 4KN7X 1B59A 5FD5A 3D0SA 2PFBA 4BXUA 2NNNA 2D1VA 1EH6A 3KFWX 1YQAA 4HLXA 1QZZA 4LJZF 1U6GA 2F5CA 4ZZDA 2CSOA 3IKTA 4BQAA 4EQQA 3GYHX 2UXNA 5F64A 3ROUA 3T0YA 4YIIA 4JBAA 2MH9A 4HX8A 5AIQA 3T8TA 3WGHA 3ECHA 1YW8A 1MGTA 2ZFWA 3WU1B 4WX9A 3FZVA 4M72A 1FNNA 2J5OA 1KU9A 4F7ZA 1T39A 1Z6RA 4AIHA 1UB9A 1IN6A 3BROA 4EM2A 1J2XA 4WK8F 4IRGA 3GX4X 1OYIA 3WTYC 1IRGA 3DKWA 1P4AA 5ILUA 3M1EA 2ZO4A 3R60A 4HZFA 4GO1A 1TBXA 3ML6A 3CUQA 1L3LA 3TDUC 3PFIA 3JW4A 2P7CB 2XV4S 4ENJA 5ICFA 1IN5A 3HTUA 3DXJF 1O3SA 2ZJ2A 2QQ9A 1MD0A 1LDKB 5D5WB 3F6OA 3NEUA 1OKRA 2P6SA 3R4KA 3JAMK 2EV6A 1ZG3A 3K1MA 2FSWA 4U0YA 1MZBA 5BPDA 3BWGA 4KUMA 1WRJA 2DI3A 2P4WA 1SFUA 3MEXA 3T8RA 3ZMDA 2QLZA 5D6EA 1IUYA 3DEUA 3DPTA 5JHUA 2EFWA 1P92A 4KNYA 3DQVC 2VT3A 5HDGA 1ZRFA 2EFNA 4NB5A 2WV0A 1ZREA 1JHFA 3I4PA 2H09A 2RNJA 3HUGA 3V7SA 4RAZA 1W7PB 2DQRA 4DQ2A 1WKMA 1T6SA 1LNWA 4MQVA 2XGXA 1ZN2A 3IKVA 2M45A 1W7PA 1I27A 1O3TA 1YS7A 1ON1A 4GYIA 5H6RA 5H20A 5F6FA 5CYVA 2KJCA 2YSRA 2KIFA 5L3DA 3KCCA 2Y75A 1ZHFA 2STTA 1TQMA 2PJPA 2IPQX 4WCGA 3QU3A 3F8CA 1YW9A 3HSEA 5ICCA 3BZ6A 2FNPA 1X3UA 4I09A 3EUHA 1Z1DA 1BI2A 5AONA 4P9UA 3RIRA 4WXCA 2GZWA 3SQNA 3C7JA 2NS0A 4RB0A 1T0FA 2ESNA 2PI0A 4HDVA 1R7JA 3ZMSA 1P4WA 1HW2A 3G73A 1XN7A 1Z7UA 3D5LA 4IJAA 1XGNA 2QVOA 5LHIA 2LDUA 2L02A 1HQCA 4EJVA 2VE8A 4M9ZA 2VC0A 4MTEA 5HS8A 5LHHA 2ADUA 5CVJA 2UZKA 1F4KA 2K7LA 3CO6C 5E20A 2W85A 4HDUA 2MLKA 1O7FA 2YR2A 4RB3C 2A6HF 2H6BA 2QQBA 2HTSA 4L9NA 4Y13A 4L9JA 4HV6A 4LB5A 1R23A 2A69F 4I7HA 3K1PA 2OU2A 4EM0B 5DCMB 2XIGA 2K27A 5BMZA 2PLYA 5D8KB 4ESBA 3RTRA 3GF2A 3KLNA 1YW7A 2GA1A 4EJTA 3R6SA 3CTAA 4BHCA 2DQLA 1S7OA 3C18A 5IT9Z 5E17F 3T1BA 1IXCA 4KN4X 2DK8A 4HOBA 3ZMTA 2Z3YA 2MH2A 1UHMA 2EFOA 4KDPA 3FX3A 5FFXA 4KYWA 3R0JA 5DUIA 2ZMEA 1OPCA 2O03A 4B8XA 3FMRA 1S8NA 4PCQA 3ZN1A 2CYYA 1HW1A 3TOAA 5D5VB 3OV8A 3J81Z 4IVNA 5JVTA 1GXQA 2XAJA 3M7GA 2Z33A 3F3XA 3FMQA 2VT2A 5HLGA 5FB2A 4PGHA 2XAQA 1I1GA 2QWWA 4KIGA 4ZH4F 2HTJA 2OZUA 1U5TC 4YFKF 3MFKA 2GAUA 3Q9VA 1OYWA 4LK1F 1JXSA 5D4RA 4KMUX 3V8KA 4MEXF 3TO6A 1ZLKA 4FHTA 2AS5F 3K9TA 3VB2A 4IHTA 1KQ0A 4MTDA 2F2EA 4D0PA 2O6GE 3RYPA 5L3CA 1FC3A 5AIPA 1DP7P 2E1NA 2P6TA 2LF7A 2EA2A 1ULYA 2HKXA 2VODA 2Y48A 2FQ3A 1GXPA 3CUQC 1FYLA 4PGGA 1JE8A 2K86A 2R7DA 3JTHA 1K6OA 1G4DA 4OMYA 1XCVA 5A2QK 4G9YA 3BJ6A 6PAXA 3KEOA 1A04A 2FBIA 1TW3A 3RJPA 5LLQA 3R61A 4H0EA 2FU4A 2A68F 1TLHB 3F8NA 3LSTA 1Z05A 1MDMA 1RIOH 4RGXA 2FEZA 1NHAA 4Y15A 4Q47A 4UUVA 4HQEA 1YS6A 2L4MA 3P7NA 1TNTA 2W84A 4RGUA 2D1HA 4N0BA 2CG4A 2QYOA 4KIBA 2CGPA 5BPIA 5BS6A 5D5UB 4G6QA 1STZA 4U0VA 4XRFA 1XGOA 2EJRA 1OMIA 1MJAA 5FO5A 3B73A 1AOYA 2FMLA 3FWEA 4A6DA 3GLXA 1H0MA 5DYMA 5LEJA 2HQRA 3ZN0A 2VBYA 1J59A 5HS7A 2VBXA 3HSRA 3V7RA 4MEYF 1IN7A 2DK5A 2EB7A 1SMYF 2DU9A 1LEAA 2W25A 2BYVE 5L3BA 1R00A 1XMAA 1ZG1A 1U3EM 3B02A 3BDDA 3EQLF 4A0XA 5LBQA 3EYIA 3KP7A 4UV8A 2E1CA 1KGSA 4CYDA 2Z99A 2ZKZA 2GXGA 1QPMA 1WI9A 4G8XA 4L9TA 2K02A 3S2WA 4PZJA 1PUEE 5DEQA 1RUOA 1CF7B 2KJBA 3FXQA 5DDGA 2X4HA 2CWEA 1CF7A 1J7KA 2R7FA 2C6YA 5HOOA 3Q5FA 1USTA 1DPUA 3L09A 2O61A 1W7PD 3WTWC 3J7AO 3LWFA 1P6RA 1DDNA 4UVCA 1LB2A 3QOPA 1LDDA 4L18B 4E70A 3KE2A 1JHHA 5E18F 3RKYA 3RKWA 2OAZA 2L3DA 2E7XA 3E5UA 4DNCA 1DUXC 1F1ZA 4I0AA 3U1DA 4U7BA 1XGMA 2LNBA 1FZPB 3QRFF 1HSTA 5EEHA 1K79A 2COMA 2VBWA 2QM3A 4JK1X 2F5EA 4BHPA 4OIPF 4HX4A 3CDHA 5E8IA 3L7WA 2JT1A 4ZYEA 2V6CA 2ACJA 1R1UA 4OIQF 3PQKA 1I5ZA 4UHTA 1KYWA 1RI7A 5BQTA 5K5RA 3BJAA 3ABUA 4KMFA 4AD9A 5D6FA 3ZMVA 2G7UA 1ON2A 4U88A 4BH9A 2XUBA 2BV6A 3J80K 5E1XA 3I71A 2DO7A 2DPDA 1FT9A 2OZ6A 3WTSC 3O2PE 3GO5A 1ONVA 1RNLA 3TKYA 3WG9A 1XGSA 2PMHA 3HYIA 3P9IA 2EV5A 2HFHA 3E6DA 1TQIA 2KKOA 3KEQA 5J8FA 2M30A 2KIUA 3E5XA 2PG4A 3RKXA 3DFGA 1H9GA 1S3JA 1HBXG 5K5OA 3E3VA 1TQPA 3I54A 2NNYA 3O3KA 1J9IA 1ZH5A 4NHJA 1SFEA 1O7LA 4ZYDA 3KZYA 1K78B 1PDNC 1ZAOA 2MA3A 2EA4A 2EWNA 4ENKA 3L2CA 1BBYA 3QPTA 1ZGJA 4QLCU 4BAYA 1ZRDA 2M1BA 1REPC 2ZNZA 3OOPA 1OR7A 1UCRA 3U2RA 1CGPA 3ZP5A 2IA2A 4P55A 1BJAA 3K1NA 1WSUA 3ISPA 1FP1D 2RDPA 2EFQA 4EM1A 5ILVA 5L3EA 5ICGA 1FYMA 1YTYA 1BN5A 1BOAA 2JTVA 1P2FA 1G3SA 4XSZF 5ICEA 4LG0B 3N97A 2Q2EA 3ZPLA 4ESFA 3AAFA 2DLLA 5JR3A 2BBYA 1I1SA 4S04A 4LG0A 3K69A 1SD5A 2Y0MA 1EV7A 3LA3A 4BHBA 4R1HA 1TW2A 3SZPA 4Q4ZF 2MBFA 4MQ9F 4AIJA 5LEKA 2HGCA 1QO0D 4QWQA 3F72A 5FLXZ 1TNSA 1U78A 3G3ZA 3DV8A 1S6LA 4I01A 1Z91A 1FY7A 2RV8A 1LEBA 1FBSA 2DW4A 5FFZA 1PP8F 2FA5A 2HS5A 3LA7A 3BJOA 4U7DA 2RVCA 2BE5F 3FF5A 4GGGA 4RB1A 4S05A 4Y17A 1IXSB 3HTSB 4GXOA 2ZBKA 5HLHA 5HDNA 3LFKA 1KQ9A 4XBFA 1B6AA 2RQPA 3GUDA 3JSPA 1EH7A 2EFPA 2NAZA 3J81K 3EDPA 5DCMA 1E2XA 2ELHA 3GEZA 5DUKA 2EV0A 2Q8KA 5LRRA 4I2OA 4RGRA 4A2UA 4M74A 5LGTA 3GW2A 3M8EA 3CUOA 3ECOA 1ZARA 4IXAA 4HLYA 2VOPA 5K1YA 2PEXA 1I6XA 3ZQ7A 2VC1A 3KLOA 1TTYA 5HDKA 4G94A 5CVRA 3MCZA 3KZZA 5D5XB 4YFXF 3EYYA 3ELKA 1G3WA 3FMSA 3ZMUA 3BOQA 4LMYA 3K0LA 2JRTA 3E5QA 2WWYA 1R5HA 4R8HA 4A6EA 2VOOA 2P7VB 1QZYA 2J5PA 4A0ZA 4JQFA 1ZYRF 3KP2A 3IWZA 2G9WA 1XDUA 4ETSA 4RB2C 1QBJA 3CJNA 2QBYB 2PMUA 4M71A 2NRAC 1LDJA 1BC7C 2QBYA 2L01A 5LGNA 1B9MA 2K4JA 2L54A 3SHFA 1IN4A 2Z9OA 5D4SA 5CLSA 5LHGA 1XCBA 1HKSA 4KT5C 3SZTA 3DP7A 3IRQA 4CHUA 3QP5A 4L5IA 5BOXA 5DV5A 3ULQB 2FXAA 3MQ0A 1IZ1A 3RPUA 4YG2F 2W57A 3REOA 3E6CC 4XLNF 4G7HF 3F8MA 2IA1A 3IL2A 2A3SA 1SD4A 2A5YB 4XSXF 3WTXC 2BGCA 3E6BA 1ZLJA 2GWRA 3P9CA 3RYRA 1IF1A 1BIAA 4CICA 1MJ9A 4IPAA 4HF2A 2YU3A 3R0AA 3IC7A 3LQQA 4ENMA 3U9GA 2Z5UA 4HX7A 3IRRA 1YIOA 3MZYA 2STWA 3TGNA 2EK5A 1D3YA 3F8FA 2KRFA 5D8LB 2OA4A 1ZRCA 3FM5A 2H94A 3FHZA 1WQ2A 1ODDA 2UXXA 1YFHA 4HBLA 4LB6B 1D5VA 5KK1A 2OD5A 4LLLA 5HVQC 3TQNA 2DPUA 4HF0A 3N4MA 4WXDA 1U8RA 4KIFA 1FSHA 2LKPA 3HRUA 5DD8A 4BYYA 2XAHA 4I98B 2TDXA 3VOEA 2XROA 4HAMA 5J8CA 4ESJA 4M73A 4EGYA 1S7AA 3I59B 3EETA 4P96A 1T2KA 1V3FA 2QUFA 2Q0OA 4L5JA 4I0BA 4UNOA 2IP2A 1U2WA 3CO7C 4HYEA 3HOTA 3WTZA 3LA2A 2RC4A 1BI0A 3F22A 2W24A 3IHUA 2NYXA 3I58A 3WODF 2ZCWA 4L0ZB 3RPQA 1B9NA 1U5TB 3L00A 5L3FA 4ZZLA 2IJLA 2H27A 4Q48A 4WWCA 1U5TA 3HRSA 4A5NA 2P8TA 2HDCA 2E7WA 2OQGA 2FRHA 5CVIA 1EH8A 3ZMZA 3FXUA 3GFJA 5KVRA 1B4AA 2HYFA 1KU3A 2ZNYA 1JGSA 2VN2A 3FM3A 1K7AA 1KU7A 2XVCA 5E1WA 4A0YA 2DTRA 4GCVA 1XMKA 2PQ8A 4IF4A 1W5TA 3CUQB 4IHSA 4LD5A 4OINF 2JSCA 3GVAA 3WU0A 2DT5A 1YYVA 3TO9A 1GHCA 4GYGA 3H3ZA 3SXYA 3F23A 2IVMA 3ABTA 4N9HA 2HQNA 4MNUA 1ZG5A 1O57A 2VONA 1MKMA 1Q1HA 1SD7A 4G7ZF 1FBUA 3ERED 4EJOA 3GFLA 2CW0F 1H9TA 3VEPA 1Z6TA 3L9FA 5LGUA 4RAYA 3BY6A 2JPBA 3T5XA 2DBBA 3KETA 3HHGA 2M87A 5ILSA 5IT3A 4HF1A 2M5WA 2LF8A 3I64A 5F1RA 2XKPA 3PQJA 4AVPA 4M6YA 4MHGA 3TDZC 5J6XA 3MZHA 4K2EA 5E1ZB 1FOKA 1QGPA 3JAMZ 1YG2A 1ZGAA 2GXBA 2A61A 1W5SA 2FBKA 5L3GA 5E8GA 3FXRA 2FNAA 3W6JB 3I53A 3KP6A 3VFZA 2DFIA 1FPQA 4G6DA 2FF4A 1USSA 3LAPA 4FT8A 3SFZA 3E6MA 1UFMA 1K78A 4LGWA 1BI3A 3J80Z 1F5TA 4EVIA 1S29A 3JTGA 4XLPF 1P4XA 2RKHA 3H92A 3RDIA 5FLXK 4Q5SF 2ZXJA 1LJ9A 2FMYA 4KFCA 1Z9CA 1C0WA 3DPLC 3C1DA 1G3YA 4OIOF 4UVAA 1SFXA 2CFXA 2YPRA 5LRSA 3WGGA 3WTVC 2HOEA 1HSJA 1XD7A 2AXLA 3BP8A 2V1DA 4CZZA 2HEOA 2XRNA 2P5KA 4RGSA 4U0WA 4OOIA 2V1UA 2PBIA 1BI1A 3O6BB 4I02A 4CDGA 2BEOA 3HHHA 3K2ZA 1UHWA 2D45A 1HXDA 2A6EF 2WC2A 3KP4A 2JPCA 1FLIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H3U A;  4M9X A;  1O3R A;  3WTU C;  2GA2 A;  3I5U A;  4N9I A;  2P5V A;  2XKO A;  1R22 A;  2XAS A;  4LLG F;  1Y0U A;  5IT9 K;  2IRF G;  3I0T A;  3VOD A;  3WE3 A;  4O6J A;  2UWM A;  3HOS A;  1J75 A;  5FD6 A;  4Z2Y A;  1SMT A;  1AWC A;  2KIM A;  4BNC A;  1BM9 A;  3WTT C;  2G7H A;  4KA4 A;  2DAO A;  1RZ4 A;  1GVJ A;  1MJB A;  3F8B A;  2V1X A;  2YX7 A;  5ED4 A;  3GWZ A;  4A5M A;  3WGI A;  4HV5 A;  2MD5 A;  2XAF A;  3V8J A;  5K5Q A;  2QQA A;  4PDK A;  3GZ5 A;  2WTE A;  4UXN A;  4HW0 A;  4EV0 A;  2QZ8 A;  1R58 A;  3GXO A;  3JSO A;  4WF2 A;  1T38 A;  1B1B A;  4AWX B;  1RUN A;  4EJW A;  4CO8 A;  4LFU A;  1J0R A;  2CQK A;  2MLG A;  1OYY A;  4UVB A;  3BPX A;  2HR3 A;  4NQW A;  2ZME B;  2FE3 A;  3COA C;  1KYZ A;  2HWV A;  1O3Q A;  2V79 A;  1IRF A;  1R1T A;  2PN6 A;  3F6V A;  2O3F A;  5TRD A;  1FBQ A;  2IA0 A;  2HYG D;  5EEG A;  3CLO A;  4LLN A;  3BPV A;  3TOB A;  4ZYG A;  3M8F A;  1FP2 A;  2VBZ A;  2RGV A;  2HKO A;  3DF8 A;  2MC3 A;  2FBH A;  3HRT A;  3E97 A;  4ENN A;  2M8E A;  1R5G A;  1KA8 A;  1G3T A;  4M9S A;  1YLF A;  2OBP A;  2ESH A;  1FWZ A;  1HW5 A;  1BIB A;  1R1V A;  3HSF A;  3NRV A;  3F21 A;  1XDS A;  4LK0 F;  2YX4 A;  5FGM A;  4CXF A;  1FX7 A;  4EJU A;  1QQI A;  3V8L A;  4EMS A;  4P5O A;  2F5D A;  1R36 A;  3WE2 A;  4L9V A;  2ISZ A;  3QAH A;  3W6K B;  3GFM A;  3QPH A;  1D8K A;  3P9K A;  1KQ8 A;  1DPR A;  3MAJ A;  1XSD A;  5HLI A;  3KP3 A;  2P5L C;  2JZY A;  3LAJ A;  4A12 A;  3Q9S A;  2VXZ A;  5H6Q A;  2D2W A;  3IWF A;  5CVU A;  4O5V A;  4UV9 A;  2R3S A;  4MGR A;  4KIC A;  3M9A A;  3V4G A;  1KU2 A;  2VE9 A;  1G6N A;  1MDM B;  2QEN A;  2LSO A;  4FX4 A;  2L4A A;  5HS9 A;  2FOK A;  3KP5 A;  1XSV A;  1XSX A;  5TJJ A;  3C3W A;  4TV7 A;  5CJ9 A;  1IW7 F;  3GFI A;  1HKT A;  2H6C A;  4ASN A;  1V4R A;  3GZ6 A;  2B0L A;  2O8X A;  4O3M A;  4R79 A;  1SAX A;  1J5Y A;  4IRI A;  1T98 A;  4M6X A;  1YO5 C;  2IW5 A;  4HA8 A;  5CVV A;  2V9V A;  2A07 F;  2IT0 A;  2O0Y A;  4OU0 A;  4IRH A;  1E17 A;  1SD6 A;  2X0L A;  2XAG A;  4ZYH A;  5A2Q Z;  3TO7 A;  2ISY A;  1WWX A;  4B09 A;  1LVA A;  1HKQ A;  1IXR C;  1L0O C;  1D8J A;  2GIV A;  3HRM A;  4ON0 A;  1IAW A;  4AIK A;  5DCF A;  1F9N A;  2OQR A;  1QNT A;  4EGZ A;  2K4B A;  5JI6 A;  4P9F A;  4L0Y B;  3V7C A;  1W4M A;  2XHK A;  1FYK A;  3MWM A;  1LQ1 A;  2RN7 A;  4CGZ A;  2ETH A;  4G7O F;  4RS8 A;  2HZT A;  5DD4 A;  5ERI A;  3QU6 A;  2CO5 A;  5JFR A;  3QP6 A;  1XB4 A;  3LQR A;  3I59 A;  4YFN F;  1FSE A;  4WXH A;  4YIF A;  3HIF A;  3RI4 A;  4OIR F;  1BC8 C;  4FX0 A;  2F5F A;  1VTN C;  1IN8 A;  2GQQ A;  1PP7 U;  3NQO A;  4HQM A;  4OMZ A;  4KN7 X;  1B59 A;  5FD5 A;  3D0S A;  2PFB A;  4BXU A;  2NNN A;  2D1V A;  1EH6 A;  3KFW X;  1YQA A;  4HLX A;  1QZZ A;  4LJZ F;  1U6G A;  2F5C A;  4ZZD A;  2CSO A;  3IKT A;  4BQA A;  4EQQ A;  3GYH X;  2UXN A;  5F64 A;  3ROU A;  3T0Y A;  4YII A;  4JBA A;  2MH9 A;  4HX8 A;  5AIQ A;  3T8T A;  3WGH A;  3ECH A;  1YW8 A;  1MGT A;  2ZFW A;  3WU1 B;  4WX9 A;  3FZV A;  4M72 A;  1FNN A;  2J5O A;  1KU9 A;  4F7Z A;  1T39 A;  1Z6R A;  4AIH A;  1UB9 A;  1IN6 A;  3BRO A;  4EM2 A;  1J2X A;  4WK8 F;  4IRG A;  3GX4 X;  1OYI A;  3WTY C;  1IRG A;  3DKW A;  1P4A A;  5ILU A;  3M1E A;  2ZO4 A;  3R60 A;  4HZF A;  4GO1 A;  1TBX A;  3ML6 A;  3CUQ A;  1L3L A;  3TDU C;  3PFI A;  3JW4 A;  2P7C B;  2XV4 S;  4ENJ A;  5ICF A;  1IN5 A;  3HTU A;  3DXJ F;  1O3S A;  2ZJ2 A;  2QQ9 A;  1MD0 A;  1LDK B;  5D5W B;  3F6O A;  3NEU A;  1OKR A;  2P6S A;  3R4K A;  3JAM K;  2EV6 A;  1ZG3 A;  3K1M A;  2FSW A;  4U0Y A;  1MZB A;  5BPD A;  3BWG A;  4KUM A;  1WRJ A;  2DI3 A;  2P4W A;  1SFU A;  3MEX A;  3T8R A;  3ZMD A;  2QLZ A;  5D6E A;  1IUY A;  3DEU A;  3DPT A;  5JHU A;  2EFW A;  1P92 A;  4KNY A;  3DQV C;  2VT3 A;  5HDG A;  1ZRF A;  2EFN A;  4NB5 A;  2WV0 A;  1ZRE A;  1JHF A;  3I4P A;  2H09 A;  2RNJ A;  3HUG A;  3V7S A;  4RAZ A;  1W7P B;  2DQR A;  4DQ2 A;  1WKM A;  1T6S A;  1LNW A;  4MQV A;  2XGX A;  1ZN2 A;  3IKV A;  2M45 A;  1W7P A;  1I27 A;  1O3T A;  1YS7 A;  1ON1 A;  4GYI A;  5H6R A;  5H20 A;  5F6F A;  5CYV A;  2KJC A;  2YSR A;  2KIF A;  5L3D A;  3KCC A;  2Y75 A;  1ZHF A;  2STT A;  1TQM A;  2PJP A;  2IPQ X;  4WCG A;  3QU3 A;  3F8C A;  1YW9 A;  3HSE A;  5ICC A;  3BZ6 A;  2FNP A;  1X3U A;  4I09 A;  3EUH A;  1Z1D A;  1BI2 A;  5AON A;  4P9U A;  3RIR A;  4WXC A;  2GZW A;  3SQN A;  3C7J A;  2NS0 A;  4RB0 A;  1T0F A;  2ESN A;  2PI0 A;  4HDV A;  1R7J A;  3ZMS A;  1P4W A;  1HW2 A;  3G73 A;  1XN7 A;  1Z7U A;  3D5L A;  4IJA A;  1XGN A;  2QVO A;  5LHI A;  2LDU A;  2L02 A;  1HQC A;  4EJV A;  2VE8 A;  4M9Z A;  2VC0 A;  4MTE A;  5HS8 A;  5LHH A;  2ADU A;  5CVJ A;  2UZK A;  1F4K A;  2K7L A;  3CO6 C;  5E20 A;  2W85 A;  4HDU A;  2MLK A;  1O7F A;  2YR2 A;  4RB3 C;  2A6H F;  2H6B A;  2QQB A;  2HTS A;  4L9N A;  4Y13 A;  4L9J A;  4HV6 A;  4LB5 A;  1R23 A;  2A69 F;  4I7H A;  3K1P A;  2OU2 A;  4EM0 B;  5DCM B;  2XIG A;  2K27 A;  5BMZ A;  2PLY A;  5D8K B;  4ESB A;  3RTR A;  3GF2 A;  3KLN A;  1YW7 A;  2GA1 A;  4EJT A;  3R6S A;  3CTA A;  4BHC A;  2DQL A;  1S7O A;  3C18 A;  5IT9 Z;  5E17 F;  3T1B A;  1IXC A;  4KN4 X;  2DK8 A;  4HOB A;  3ZMT A;  2Z3Y A;  2MH2 A;  1UHM A;  2EFO A;  4KDP A;  3FX3 A;  5FFX A;  4KYW A;  3R0J A;  5DUI A;  2ZME A;  1OPC A;  2O03 A;  4B8X A;  3FMR A;  1S8N A;  4PCQ A;  3ZN1 A;  2CYY A;  1HW1 A;  3TOA A;  5D5V B;  3OV8 A;  3J81 Z;  4IVN A;  5JVT A;  1GXQ A;  2XAJ A;  3M7G A;  2Z33 A;  3F3X A;  3FMQ A;  2VT2 A;  5HLG A;  5FB2 A;  4PGH A;  2XAQ A;  1I1G A;  2QWW A;  4KIG A;  4ZH4 F;  2HTJ A;  2OZU A;  1U5T C;  4YFK F;  3MFK A;  2GAU A;  3Q9V A;  1OYW A;  4LK1 F;  1JXS A;  5D4R A;  4KMU X;  3V8K A;  4MEX F;  3TO6 A;  1ZLK A;  4FHT A;  2AS5 F;  3K9T A;  3VB2 A;  4IHT A;  1KQ0 A;  4MTD A;  2F2E A;  4D0P A;  2O6G E;  3RYP A;  5L3C A;  1FC3 A;  5AIP A;  1DP7 P;  2E1N A;  2P6T A;  2LF7 A;  2EA2 A;  1ULY A;  2HKX A;  2VOD A;  2Y48 A;  2FQ3 A;  1GXP A;  3CUQ C;  1FYL A;  4PGG A;  1JE8 A;  2K86 A;  2R7D A;  3JTH A;  1K6O A;  1G4D A;  4OMY A;  1XCV A;  5A2Q K;  4G9Y A;  3BJ6 A;  6PAX A;  3KEO A;  1A04 A;  2FBI A;  1TW3 A;  3RJP A;  5LLQ A;  3R61 A;  4H0E A;  2FU4 A;  2A68 F;  1TLH B;  3F8N A;  3LST A;  1Z05 A;  1MDM A;  1RIO H;  4RGX A;  2FEZ A;  1NHA A;  4Y15 A;  4Q47 A;  4UUV A;  4HQE A;  1YS6 A;  2L4M A;  3P7N A;  1TNT A;  2W84 A;  4RGU A;  2D1H A;  4N0B A;  2CG4 A;  2QYO A;  4KIB A;  2CGP A;  5BPI A;  5BS6 A;  5D5U B;  4G6Q A;  1STZ A;  4U0V A;  4XRF A;  1XGO A;  2EJR A;  1OMI A;  1MJA A;  5FO5 A;  3B73 A;  1AOY A;  2FML A;  3FWE A;  4A6D A;  3GLX A;  1H0M A;  5DYM A;  5LEJ A;  2HQR A;  3ZN0 A;  2VBY A;  1J59 A;  5HS7 A;  2VBX A;  3HSR A;  3V7R A;  4MEY F;  1IN7 A;  2DK5 A;  2EB7 A;  1SMY F;  2DU9 A;  1LEA A;  2W25 A;  2BYV E;  5L3B A;  1R00 A;  1XMA A;  1ZG1 A;  1U3E M;  3B02 A;  3BDD A;  3EQL F;  4A0X A;  5LBQ A;  3EYI A;  3KP7 A;  4UV8 A;  2E1C A;  1KGS A;  4CYD A;  2Z99 A;  2ZKZ A;  2GXG A;  1QPM A;  1WI9 A;  4G8X A;  4L9T A;  2K02 A;  3S2W A;  4PZJ A;  1PUE E;  5DEQ A;  1RUO A;  1CF7 B;  2KJB A;  3FXQ A;  5DDG A;  2X4H A;  2CWE A;  1CF7 A;  1J7K A;  2R7F A;  2C6Y A;  5HOO A;  3Q5F A;  1UST A;  1DPU A;  3L09 A;  2O61 A;  1W7P D;  3WTW C;  3J7A O;  3LWF A;  1P6R A;  1DDN A;  4UVC A;  1LB2 A;  3QOP A;  1LDD A;  4L18 B;  4E70 A;  3KE2 A;  1JHH A;  5E18 F;  3RKY A;  3RKW A;  2OAZ A;  2L3D A;  2E7X A;  3E5U A;  4DNC A;  1DUX C;  1F1Z A;  4I0A A;  3U1D A;  4U7B A;  1XGM A;  2LNB A;  1FZP B;  3QRF F;  1HST A;  5EEH A;  1K79 A;  2COM A;  2VBW A;  2QM3 A;  4JK1 X;  2F5E A;  4BHP A;  4OIP F;  4HX4 A;  3CDH A;  5E8I A;  3L7W A;  2JT1 A;  4ZYE A;  2V6C A;  2ACJ A;  1R1U A;  4OIQ F;  3PQK A;  1I5Z A;  4UHT A;  1KYW A;  1RI7 A;  5BQT A;  5K5R A;  3BJA A;  3ABU A;  4KMF A;  4AD9 A;  5D6F A;  3ZMV A;  2G7U A;  1ON2 A;  4U88 A;  4BH9 A;  2XUB A;  2BV6 A;  3J80 K;  5E1X A;  3I71 A;  2DO7 A;  2DPD A;  1FT9 A;  2OZ6 A;  3WTS C;  3O2P E;  3GO5 A;  1ONV A;  1RNL A;  3TKY A;  3WG9 A;  1XGS A;  2PMH A;  3HYI A;  3P9I A;  2EV5 A;  2HFH A;  3E6D A;  1TQI A;  2KKO A;  3KEQ A;  5J8F A;  2M30 A;  2KIU A;  3E5X A;  2PG4 A;  3RKX A;  3DFG A;  1H9G A;  1S3J A;  1HBX G;  5K5O A;  3E3V A;  1TQP A;  3I54 A;  2NNY A;  3O3K A;  1J9I A;  1ZH5 A;  4NHJ A;  1SFE A;  1O7L A;  4ZYD A;  3KZY A;  1K78 B;  1PDN C;  1ZAO A;  2MA3 A;  2EA4 A;  2EWN A;  4ENK A;  3L2C A;  1BBY A;  3QPT A;  1ZGJ A;  4QLC U;  4BAY A;  1ZRD A;  2M1B A;  1REP C;  2ZNZ A;  3OOP A;  1OR7 A;  1UCR A;  3U2R A;  1CGP A;  3ZP5 A;  2IA2 A;  4P55 A;  1BJA A;  3K1N A;  1WSU A;  3ISP A;  1FP1 D;  2RDP A;  2EFQ A;  4EM1 A;  5ILV A;  5L3E A;  5ICG A;  1FYM A;  1YTY A;  1BN5 A;  1BOA A;  2JTV A;  1P2F A;  1G3S A;  4XSZ F;  5ICE A;  4LG0 B;  3N97 A;  2Q2E A;  3ZPL A;  4ESF A;  3AAF A;  2DLL A;  5JR3 A;  2BBY A;  1I1S A;  4S04 A;  4LG0 A;  3K69 A;  1SD5 A;  2Y0M A;  1EV7 A;  3LA3 A;  4BHB A;  4R1H A;  1TW2 A;  3SZP A;  4Q4Z F;  2MBF A;  4MQ9 F;  4AIJ A;  5LEK A;  2HGC A;  1QO0 D;  4QWQ A;  3F72 A;  5FLX Z;  1TNS A;  1U78 A;  3G3Z A;  3DV8 A;  1S6L A;  4I01 A;  1Z91 A;  1FY7 A;  2RV8 A;  1LEB A;  1FBS A;  2DW4 A;  5FFZ A;  1PP8 F;  2FA5 A;  2HS5 A;  3LA7 A;  3BJO A;  4U7D A;  2RVC A;  2BE5 F;  3FF5 A;  4GGG A;  4RB1 A;  4S05 A;  4Y17 A;  1IXS B;  3HTS B;  4GXO A;  2ZBK A;  5HLH A;  5HDN A;  3LFK A;  1KQ9 A;  4XBF A;  1B6A A;  2RQP A;  3GUD A;  3JSP A;  1EH7 A;  2EFP A;  2NAZ A;  3J81 K;  3EDP A;  5DCM A;  1E2X A;  2ELH A;  3GEZ A;  5DUK A;  2EV0 A;  2Q8K A;  5LRR A;  4I2O A;  4RGR A;  4A2U A;  4M74 A;  5LGT A;  3GW2 A;  3M8E A;  3CUO A;  3ECO A;  1ZAR A;  4IXA A;  4HLY A;  2VOP A;  5K1Y A;  2PEX A;  1I6X A;  3ZQ7 A;  2VC1 A;  3KLO A;  1TTY A;  5HDK A;  4G94 A;  5CVR A;  3MCZ A;  3KZZ A;  5D5X B;  4YFX F;  3EYY A;  3ELK A;  1G3W A;  3FMS A;  3ZMU A;  3BOQ A;  4LMY A;  3K0L A;  2JRT A;  3E5Q A;  2WWY A;  1R5H A;  4R8H A;  4A6E A;  2VOO A;  2P7V B;  1QZY A;  2J5P A;  4A0Z A;  4JQF A;  1ZYR F;  3KP2 A;  3IWZ A;  2G9W A;  1XDU A;  4ETS A;  4RB2 C;  1QBJ A;  3CJN A;  2QBY B;  2PMU A;  4M71 A;  2NRA C;  1LDJ A;  1BC7 C;  2QBY A;  2L01 A;  5LGN A;  1B9M A;  2K4J A;  2L54 A;  3SHF A;  1IN4 A;  2Z9O A;  5D4S A;  5CLS A;  5LHG A;  1XCB A;  1HKS A;  4KT5 C;  3SZT A;  3DP7 A;  3IRQ A;  4CHU A;  3QP5 A;  4L5I A;  5BOX A;  5DV5 A;  3ULQ B;  2FXA A;  3MQ0 A;  1IZ1 A;  3RPU A;  4YG2 F;  2W57 A;  3REO A;  3E6C C;  4XLN F;  4G7H F;  3F8M A;  2IA1 A;  3IL2 A;  2A3S A;  1SD4 A;  2A5Y B;  4XSX F;  3WTX C;  2BGC A;  3E6B A;  1ZLJ A;  2GWR A;  3P9C A;  3RYR A;  1IF1 A;  1BIA A;  4CIC A;  1MJ9 A;  4IPA A;  4HF2 A;  2YU3 A;  3R0A A;  3IC7 A;  3LQQ A;  4ENM A;  3U9G A;  2Z5U A;  4HX7 A;  3IRR A;  1YIO A;  3MZY A;  2STW A;  3TGN A;  2EK5 A;  1D3Y A;  3F8F A;  2KRF A;  5D8L B;  2OA4 A;  1ZRC A;  3FM5 A;  2H94 A;  3FHZ A;  1WQ2 A;  1ODD A;  2UXX A;  1YFH A;  4HBL A;  4LB6 B;  1D5V A;  5KK1 A;  2OD5 A;  4LLL A;  5HVQ C;  3TQN A;  2DPU A;  4HF0 A;  3N4M A;  4WXD A;  1U8R A;  4KIF A;  1FSH A;  2LKP A;  3HRU A;  5DD8 A;  4BYY A;  2XAH A;  4I98 B;  2TDX A;  3VOE A;  2XRO A;  4HAM A;  5J8C A;  4ESJ A;  4M73 A;  4EGY A;  1S7A A;  3I59 B;  3EET A;  4P96 A;  1T2K A;  1V3F A;  2QUF A;  2Q0O A;  4L5J A;  4I0B A;  4UNO A;  2IP2 A;  1U2W A;  3CO7 C;  4HYE A;  3HOT A;  3WTZ A;  3LA2 A;  2RC4 A;  1BI0 A;  3F22 A;  2W24 A;  3IHU A;  2NYX A;  3I58 A;  3WOD F;  2ZCW A;  4L0Z B;  3RPQ A;  1B9N A;  1U5T B;  3L00 A;  5L3F A;  4ZZL A;  2IJL A;  2H27 A;  4Q48 A;  4WWC A;  1U5T A;  3HRS A;  4A5N A;  2P8T A;  2HDC A;  2E7W A;  2OQG A;  2FRH A;  5CVI A;  1EH8 A;  3ZMZ A;  3FXU A;  3GFJ A;  5KVR A;  1B4A A;  2HYF A;  1KU3 A;  2ZNY A;  1JGS A;  2VN2 A;  3FM3 A;  1K7A A;  1KU7 A;  2XVC A;  5E1W A;  4A0Y A;  2DTR A;  4GCV A;  1XMK A;  2PQ8 A;  4IF4 A;  1W5T A;  3CUQ B;  4IHS A;  4LD5 A;  4OIN F;  2JSC A;  3GVA A;  3WU0 A;  2DT5 A;  1YYV A;  3TO9 A;  1GHC A;  4GYG A;  3H3Z A;  3SXY A;  3F23 A;  2IVM A;  3ABT A;  4N9H A;  2HQN A;  4MNU A;  1ZG5 A;  1O57 A;  2VON A;  1MKM A;  1Q1H A;  1SD7 A;  4G7Z F;  1FBU A;  3ERE D;  4EJO A;  3GFL A;  2CW0 F;  1H9T A;  3VEP A;  1Z6T A;  3L9F A;  5LGU A;  4RAY A;  3BY6 A;  2JPB A;  3T5X A;  2DBB A;  3KET A;  3HHG A;  2M87 A;  5ILS A;  5IT3 A;  4HF1 A;  2M5W A;  2LF8 A;  3I64 A;  5F1R A;  2XKP A;  3PQJ A;  4AVP A;  4M6Y A;  4MHG A;  3TDZ C;  5J6X A;  3MZH A;  4K2E A;  5E1Z B;  1FOK A;  1QGP A;  3JAM Z;  1YG2 A;  1ZGA A;  2GXB A;  2A61 A;  1W5S A;  2FBK A;  5L3G A;  5E8G A;  3FXR A;  2FNA A;  3W6J B;  3I53 A;  3KP6 A;  3VFZ A;  2DFI A;  1FPQ A;  4G6D A;  2FF4 A;  1USS A;  3LAP A;  4FT8 A;  3SFZ A;  3E6M A;  1UFM A;  1K78 A;  4LGW A;  1BI3 A;  3J80 Z;  1F5T A;  4EVI A;  1S29 A;  3JTG A;  4XLP F;  1P4X A;  2RKH A;  3H92 A;  3RDI A;  5FLX K;  4Q5S F;  2ZXJ A;  1LJ9 A;  2FMY A;  4KFC A;  1Z9C A;  1C0W A;  3DPL C;  3C1D A;  1G3Y A;  4OIO F;  4UVA A;  1SFX A;  2CFX A;  2YPR A;  5LRS A;  3WGG A;  3WTV C;  2HOE A;  1HSJ A;  1XD7 A;  2AXL A;  3BP8 A;  2V1D A;  4CZZ A;  2HEO A;  2XRN A;  2P5K A;  4RGS A;  4U0W A;  4OOI A;  2V1U A;  2PBI A;  1BI1 A;  3O6B B;  4I02 A;  4CDG A;  2BEO A;  3HHH A;  3K2Z A;  1UHW A;  2D45 A;  1HXD A;  2A6E F;  2WC2 A;  3KP4 A;  2JPC A;  1FLI A; 
#chains in the Genus database with same CATH topology
 3HKZ A;  3H3U A;  4C2T A;  4M9X A;  1FTT A;  1WVR A;  1O3R A;  2M0M A;  4NC7 A;  1N25 A;  5FRO A;  2YUS A;  3Q0U A;  3WTU C;  1IGN A;  2GA2 A;  3I5U A;  4N9I A;  2P5V A;  2XKO A;  4CCJ A;  1R22 A;  2XAS A;  3K4L A;  4LLG F;  1Y0U A;  2MD0 A;  5IT9 K;  2IRF G;  3I0T A;  3VOD A;  2HQ5 A;  2LG4 A;  3WE3 A;  1SVL A;  1MSF C;  1OLT A;  2R7W A;  1UEL B;  4O6J A;  2UWM A;  3HOS A;  1J75 A;  5GTH C;  5FD6 A;  3KPH A;  3J7Z I;  4Z2Y A;  1SMT A;  1X2N A;  1N77 A;  2JQ7 A;  2R7Q A;  1AWC A;  2B7E A;  2HVR A;  1WPK A;  3H5R A;  2KIM A;  4BNC A;  3OIQ A;  1BM9 A;  3WTT C;  2G7H A;  2ME0 A;  1NTC A;  4KA4 A;  2DAO A;  1RZ4 A;  3KYC B;  1Y39 A;  2IEK A;  1GVJ A;  1WCM J;  2BVL A;  1MJB A;  2BHY A;  4XL9 A;  3OYM A;  1IO2 A;  5EF6 A;  3F8B A;  2V1X A;  4NNJ A;  5FLM J;  1QPI A;  3ABK H;  3RPU D;  2YX7 A;  3LNQ A;  3S32 A;  3OR1 C;  3CZ6 A;  5ED4 A;  3L1P A;  3GWZ A;  4UUS B;  2X6W A;  4A5M A;  3WGI A;  3HB9 A;  4ZDP A;  3NAR A;  2VJI A;  2DOD A;  4HV5 A;  2MD5 A;  5LD2 C;  2V7F A;  3ESW B;  3U21 A;  2XAF A;  3V8J A;  3DCF A;  5K5Q A;  2QQA A;  5CPR B;  1ZK8 A;  4PDK A;  3GZ5 A;  2WTE A;  4BUP A;  4UXN A;  3RCO A;  4HW0 A;  1T08 B;  4EV0 A;  3PIO F;  2QZ8 A;  3S1Q J;  1R58 A;  1IUF A;  3GXO A;  3JSO A;  1NH3 A;  2Q1Z B;  4WF2 A;  4BE1 A;  1T38 A;  1B1B A;  4AWX B;  2F5V A;  4FQG A;  5EZH A;  4AUX A;  1RUN A;  4EJW A;  4CO8 A;  3LSM A;  4LFU A;  1J0R A;  2CQK A;  2MLG A;  4BXF A;  1OYY A;  1VQM I;  3VWB A;  4UVB A;  3BPX A;  2HR3 A;  4II3 A;  2XGE A;  3TP0 A;  4NQW A;  3ZQQ A;  2ZME B;  2FE3 A;  2ID3 A;  3DKX A;  3COA C;  2NVX J;  2AXT C;  1KYZ A;  4C3H J;  3HZJ A;  1BR1 A;  2HWV A;  1O3Q A;  3H9J A;  3ZQC A;  2V79 A;  1IRF A;  4C2U A;  1R1T A;  3QYF A;  5TIS C;  4MIM A;  1D0Z A;  2PN6 A;  3F6V A;  2O3F A;  5TRD A;  3JCU C;  3JRA A;  1FBQ A;  1POG A;  1XC5 A;  3OL4 A;  2IA0 A;  2HYG D;  5EEG A;  2NVY J;  3CLO A;  4LLN A;  3BPV A;  3TOB A;  4ZYG A;  2ZXI A;  3CP8 A;  3M8F A;  2QA4 I;  1FP2 A;  2VBZ A;  2VAS A;  2BHZ A;  2JMW A;  3TED A;  3P5J A;  2Y0S N;  4JOM A;  2MAB A;  3BZK A;  2RGV A;  9ANT A;  2HKO A;  3DF8 A;  2MC3 A;  2FBH A;  3HRT A;  3E97 A;  4ENN A;  1HF0 A;  2M8E A;  1RR8 C;  3PNY A;  1R5G A;  1KA8 A;  1G3T A;  4M9S A;  1YLF A;  2OBP A;  5J3L A;  1LFP A;  1OJL A;  2ESH A;  1FWZ A;  4FTH A;  1HW5 A;  1HOM A;  3OS1 A;  1BIB A;  1R1V A;  3GZN B;  2M9H A;  2OV7 A;  3HSF A;  3NRV A;  1XDS A;  4GRI A;  2YX4 A;  4LK0 F;  3F21 A;  5FGM A;  2E5Z A;  1R4N B;  2ELJ A;  4CXF A;  1FX7 A;  4OAZ A;  4EJU A;  1QQI A;  3V8L A;  4EMS A;  1B8I B;  4P5O A;  5EDN A;  2F5D A;  1R36 A;  3FXM A;  3WE2 A;  2L9R A;  4L9V A;  1A5J A;  2ISZ A;  1X1D A;  1B8I A;  3QAH A;  3W6K B;  3JRE A;  3GFM A;  3QPH A;  2CQN A;  3S3N A;  1D8K A;  2CUE A;  3P9K A;  1KQ8 A;  1OIS A;  1DPR A;  3MAJ A;  3M1C A;  1XSD A;  3GTO J;  1IDZ A;  3N05 A;  5HLI A;  3KP3 A;  4HNU A;  3JRG A;  2P5L C;  2E1M C;  1TZL A;  2JZY A;  2KZV A;  3KEY A;  3LAJ A;  1VQ5 I;  1JI8 A;  4A12 A;  3OYJ A;  3BZC A;  3Q9S A;  2VXZ A;  5H6Q A;  2OF7 A;  2D2W A;  3TP3 A;  1DU6 A;  3QPL A;  1TWA J;  2CMP A;  3IWF A;  1GVD A;  1ZTR A;  5CVU A;  4DZJ A;  4QTR A;  4O5V A;  2R0Q C;  4UV9 A;  2R3S A;  3OSF A;  1Y1W J;  4MGR A;  4KIC A;  1AKH A;  3M9A A;  3V4G A;  1KU2 A;  2VE9 A;  2XB5 A;  1G6N A;  4C3I J;  1MDM B;  2QEN A;  2LSO A;  4RBO A;  2ECC A;  4FX4 A;  1JTX A;  2L4A A;  5HS9 A;  2FOK A;  3KP5 A;  3K10 A;  1XSV A;  1XSX A;  3OWT A;  3CDI A;  2NVT J;  5TJJ A;  3H9Q A;  5E3L A;  3A1Y A;  3C3W A;  4TV7 A;  5CJ9 A;  4X0G A;  1IW7 F;  3GFI A;  1HKT A;  2H6C A;  4ASN A;  1V4R A;  1FOX A;  3GZ6 A;  3ZQG A;  2B0L A;  2O8X A;  4CYC B;  1JKO C;  4R79 A;  1SAX A;  4O3M A;  1J5Y A;  4IRI A;  1FMW A;  4BDZ A;  1T98 A;  4IX7 A;  4M6X A;  3CCR I;  4IO9 F;  1YO5 C;  2IW5 A;  4HA8 A;  3GTG J;  3ABM H;  2V9V A;  3MZ8 A;  5CVV A;  1FEX A;  3H9G A;  1X3W B;  4QPO A;  2GIZ A;  4XRS G;  2DA2 A;  2A07 F;  2IT0 A;  2O0Y A;  4OU0 A;  2TCT A;  5FKN A;  4IRH A;  3CES A;  1E17 A;  3VDX A;  3K4N A;  1SD6 A;  2X0L A;  3DU5 A;  2XAG A;  1MMA A;  4ZYH A;  5A2Q Z;  4J01 A;  3TO7 A;  2ISY A;  1WWX A;  4B09 A;  3S3M A;  2IS1 A;  1LVA A;  1UHS A;  1HKQ A;  1IXR C;  2ICW G;  1L0O C;  1D8J A;  2WAD A;  2GIV A;  3HRM A;  3FDY A;  4UB6 C;  4ON0 A;  1IAW A;  2DA3 A;  4AIK A;  1HDD C;  5DCF A;  2R7U A;  5KAF C;  1F9N A;  1S72 I;  2BY1 A;  4DOZ A;  4DYR A;  2OQR A;  4CCN A;  1QNT A;  4F3Q A;  3M3Y J;  4EGZ A;  5DM6 F;  2K4B A;  3DTK A;  1Z77 A;  5JI6 A;  4P9F A;  1DGW Y;  4L0Y B;  1T95 A;  3V7C A;  5M3F J;  1W4M A;  2QEX I;  2BZT A;  2XHK A;  1FYK A;  3MWM A;  2JA2 A;  1LQ1 A;  1IG7 A;  3PNT A;  4RM2 A;  2RN7 A;  4A3E J;  4CGZ A;  2ETH A;  2HDW A;  4G7O F;  1LUJ B;  3E0J B;  4RS8 A;  2HZT A;  4M3F A;  3K4B A;  2KHM A;  5DD4 A;  1T33 A;  2COB A;  3RQI A;  5ERI A;  3QU6 A;  2XPW A;  2CO5 A;  2EZL A;  1UG2 A;  5JFR A;  3QP6 A;  1LFB A;  1D0Y A;  1XB4 A;  4Y3O A;  5C4J J;  3HOW J;  1NK2 P;  3LQR A;  3I59 A;  4YFN F;  2WBM A;  1UMQ A;  1FSE A;  4WXH A;  1HLV A;  4YIF A;  4IQ4 A;  2DFE A;  4IQJ A;  2LY9 A;  1JT6 A;  3HIF A;  4OIR F;  1OR7 C;  4D7N A;  3RI4 A;  4FX0 A;  2F5F A;  1BC8 C;  5FKL A;  2DMN A;  3VSK A;  1VTN C;  1IN8 A;  2XSD C;  3FXO A;  4ZTJ A;  2GQQ A;  1PP7 U;  3NQO A;  3CJR B;  4HQM A;  4OMZ A;  3EPZ A;  1IRX A;  4KN7 X;  1B59 A;  5FD5 A;  3D0S A;  2PFB A;  2NNN A;  4BXU A;  2D1V A;  2XSJ C;  1EH6 A;  3KFW X;  1YQA A;  4HLX A;  1QZZ A;  1Y0N A;  4LJZ F;  2A6T A;  1U6G A;  3IH2 A;  2F5C A;  4ZZD A;  3RZO J;  2CSO A;  1Q1V A;  5M5X J;  3K4M A;  3OS0 A;  3IKT A;  1JKR C;  5TGT A;  4BQA A;  4EQQ A;  3CC7 I;  2LVS A;  2DDA A;  2JUC A;  2TRT A;  4CCK A;  3GYH X;  5M5W J;  2UXN A;  4YII A;  4JBA A;  2MH9 A;  4HX8 A;  2VQG A;  5F64 A;  3ROU A;  3T0Y A;  5AIQ A;  3T8T A;  3WGH A;  3FIS A;  5GP9 A;  3ECH A;  3HOZ J;  1YW8 A;  2VKD A;  4IHY A;  2XF5 A;  1MGT A;  3LSR A;  2ZFW A;  3WU1 B;  2DYR H;  3FZV A;  4WX9 A;  4M72 A;  1FNN A;  2DMU A;  2J5O A;  2LH9 A;  1KU9 A;  4F7Z A;  3S17 J;  1T39 A;  4PFO A;  3MKY B;  2YS9 A;  4IL6 C;  1Z6R A;  3CCQ I;  3OYB A;  5IOZ A;  1RKT A;  4AIH A;  2KIS A;  1UB9 A;  1IN6 A;  3BRO A;  1ZR4 A;  4EM2 A;  1J2X A;  2M7B A;  2BY2 A;  1R9T J;  1VQ6 I;  4RAF A;  4WK8 F;  2YU9 J;  4IRG A;  1BW6 A;  3GX4 X;  2WAQ A;  2HXI A;  1OYI A;  3WTY C;  1IRG A;  3DKW A;  1P4A A;  5ILU A;  1B72 A;  1PJR A;  4ANJ A;  2JWT A;  2XAU A;  2ZO4 A;  3M1E A;  3R60 A;  3HGY A;  4GO1 A;  4HZF A;  1TBX A;  3ML6 A;  3CUQ A;  1MBE A;  4CCM A;  1L3L A;  4LIT A;  3TDU C;  1X3Z B;  1X1A A;  3CLQ A;  3PFI A;  3JW4 A;  2P7C B;  2XV4 S;  4ENJ A;  2LC2 A;  5ICF A;  3TW7 A;  1IN5 A;  3HTU A;  3DBL B;  2W1O A;  3DXJ F;  5BNG A;  4N4N B;  1O3S A;  2ZJ2 A;  2HU9 A;  2QQ9 A;  1MD0 A;  1LDK B;  1NG7 A;  5D5W B;  3F6O A;  3NEU A;  1OKR A;  2P6S A;  3R4K A;  4BJ5 C;  2LKX A;  3JAM K;  3CC2 I;  2EV6 A;  2IGK A;  1GUU A;  1ZG3 A;  3G71 I;  3K1M A;  2FSW A;  5F0H A;  1MZB A;  4U0Y A;  4BAC A;  1K6Y A;  1YX3 A;  3A4C A;  4QSH A;  3DLL F;  2R7Z J;  2Y31 A;  1F36 A;  2CW7 A;  2DFH A;  3BWG A;  5BPD A;  3DTI A;  1SFO J;  4KUM A;  3W6V A;  1WRJ A;  2HPM A;  4XLE A;  4IHX A;  2DI3 A;  3DLA A;  3LOC A;  2VLA A;  1S5L C;  1ETX A;  1SVM A;  2P4W A;  2KMU A;  1SFU A;  2GLO A;  3MEX A;  3T8R A;  3ZMD A;  2QLZ A;  5HNF A;  2EZK A;  5D6E A;  1IUY A;  4DW6 A;  3VYR B;  1I3Q J;  3TL4 X;  2F6C A;  3K4C A;  1XS9 A;  3DEU A;  4H4K C;  4BJ6 C;  3DPT A;  1P7I A;  5EJC A;  1T8I A;  1WFX A;  5JHU A;  2EFW A;  1MMD A;  3ZQL A;  3AG1 H;  2M0C A;  1P92 A;  4KNY A;  3DQV C;  3GTK J;  2L2O A;  3CCU I;  2IS2 A;  2VT3 A;  5HDG A;  4A3K J;  1ZRF A;  2ME6 A;  2EFN A;  1HA8 A;  4NB5 A;  1VF9 A;  2F4O B;  2HVQ A;  3JRF A;  2WV0 A;  4RDU A;  1ZRE A;  3LFU A;  4IEJ A;  3S14 J;  1JHF A;  1R5I D;  3AL0 C;  1TT0 A;  2W82 A;  3I4P A;  2X1C A;  3BCA A;  2H09 A;  2VKV A;  3BTI A;  2RNJ A;  3HUG A;  3V7S A;  3C2G A;  4RAZ A;  1W7P B;  1TWG J;  3BC8 A;  2DQR A;  4DQ2 A;  1WKM A;  1T6S A;  2OCE A;  1LNW A;  3BR3 A;  4B3X A;  5B5E C;  5GTI C;  2DOE A;  4MQV A;  1XPX A;  2XGX A;  1ZN2 A;  2KP6 A;  2BXZ A;  2OJE D;  3IKV A;  2M45 A;  1W7P A;  1I27 A;  2V9P A;  4BQO A;  1O3T A;  3LSK A;  4MFE A;  5KAI C;  1YS7 A;  1ON1 A;  3IAS 2;  2ELK A;  2KIQ A;  4C2M J;  3ZQI A;  4GYI A;  5H6R A;  5H20 A;  5F6F A;  5CYV A;  1QVT A;  2KJC A;  2YSR A;  2ZB9 A;  1G2H A;  2L0K A;  1WJF A;  3OY9 A;  3VSL A;  2AQF A;  3K7A J;  1MBK A;  5IP7 J;  2KIF A;  4DJA A;  2CFO A;  1A35 A;  2VQC A;  5L3D A;  3KCC A;  2Y75 A;  1ZHF A;  2WA0 A;  2OTJ I;  2H1L A;  2STT A;  1KON A;  1TQM A;  4BGD A;  2PJP A;  3SDB A;  3CCJ I;  3GTL J;  4D7M A;  3OYI A;  2IPQ X;  4WCG A;  2ZC2 A;  3QU3 A;  3ZCO A;  3F8C A;  1YW9 A;  3HSE A;  5ICC A;  3BZ6 A;  2FNP A;  2A05 A;  1X3U A;  4I09 A;  4Y4R A;  1OCZ H;  3EUH A;  3GTJ J;  1WGX A;  1Z1D A;  4W97 A;  1BI2 A;  3JRB A;  5AON A;  4P9U A;  2EBI A;  3BLY A;  1QA6 A;  2PJR B;  3RIR A;  3DEE A;  4WXC A;  2E2H J;  2JN6 A;  2KPM A;  2IGM A;  2HPI A;  3LSH A;  1UG0 A;  3DWL E;  1R49 A;  1JGG A;  3IUO A;  2GZW A;  1MBG A;  3K4J A;  3IV5 A;  1Z21 A;  4ZYA A;  2QF7 A;  3SQN A;  3C7J A;  2NS0 A;  2D5V A;  4RB0 A;  3CDL A;  1T0F A;  4B3A A;  2ESN A;  2PI0 A;  1O4X A;  4FIS A;  1H8A C;  2JA8 J;  4DYC A;  1ZQ3 P;  3RQ4 A;  2MGQ A;  3EUK L;  4HDV A;  1R7J A;  4X1E A;  3ZMS A;  2EPF A;  3KZI C;  3HOX J;  3A03 A;  1P4W A;  3MMY B;  1U0J A;  1JT0 A;  1W36 C;  1HW2 A;  3B6C A;  3G73 A;  1XN7 A;  1Z7U A;  3D5L A;  2R7R A;  2CQ7 A;  2ZSI B;  4IJA A;  1FOW A;  1XGN A;  3FBI B;  2QVO A;  4QIW N;  2O8K A;  5LHI A;  2LDU A;  2JA5 J;  4I99 C;  3WG7 H;  3DBR B;  2K9Q A;  3S93 A;  2IS4 A;  3GTQ J;  2L02 A;  1T56 A;  1VFC A;  5CKT A;  2QCO A;  4IZZ A;  1HQC A;  4EJV A;  1VI0 A;  2VE8 A;  2E2J J;  4M9Z A;  2RAE A;  3ASO H;  2E2I J;  2VC0 A;  1WH7 A;  4MTE A;  5DS9 A;  5E3N A;  1SVO A;  2K3P A;  2X85 A;  5HS8 A;  5LHH A;  1JJ6 C;  1WHU A;  2ADU A;  4D5F A;  5J1Y A;  5CVJ A;  2UZK A;  3W2A A;  1F4K A;  2K7L A;  3CO6 C;  5E20 A;  3HXL A;  2W85 A;  4PJM A;  5IYC J;  4HDU A;  4N4O B;  2GM4 A;  2MLK A;  1O7F A;  3G6E I;  5K7H A;  1EKE A;  1WH5 A;  2YR2 A;  1MNE A;  4RB3 C;  1RKW A;  2A6H F;  4HG2 A;  4HPQ A;  2H6B A;  2QQB A;  1Y56 A;  4XID A;  2JVG A;  4MLO A;  3CCY A;  2HTS A;  3AFH A;  2K3F A;  4L9N A;  4Y13 A;  2PX9 A;  4L9J A;  4HV6 A;  4UUS A;  4LB5 A;  1R23 A;  3FXK A;  2A69 F;  3BG7 A;  2WY8 Q;  2ZXW H;  4I7H A;  4B43 A;  3K1P A;  2CV0 A;  2OU2 A;  3LSJ A;  4EM0 B;  3MN2 A;  3S2H J;  3BQZ A;  5DCM B;  4KJZ A;  3U1K A;  2G0E A;  2XIG A;  2K27 A;  5BMZ A;  2B63 J;  2VJ4 A;  2PLY A;  2WAE A;  3DKY A;  5D8K B;  4ESB A;  3RTR A;  4RLQ A;  3GF2 A;  3KLN A;  1YW7 A;  2GA1 A;  4EJT A;  3R6S A;  3GME A;  2VQL A;  3CTA A;  4BHC A;  2DQL A;  3H0D A;  1S7O A;  4CCO A;  2Y30 A;  1VZ0 A;  4HST A;  1MBF A;  3C18 A;  1GV5 A;  4XKW A;  3S1R J;  5IT9 Z;  5E17 F;  3T1B A;  4AID A;  3C2H A;  4RA2 A;  1IXC A;  4KN4 X;  2L7Z A;  2DK8 A;  4HOB A;  1DU0 A;  3ZMT A;  2Z3Y A;  3ZQH A;  2MH2 A;  3DBH B;  2K40 A;  4JX6 A;  3CF5 F;  2R93 J;  1UHM A;  2Z2S B;  5KNL A;  3VYT B;  2EFO A;  4KDP A;  1WJ5 A;  4A3M J;  3FX3 A;  5FFX A;  4KYW A;  3R0J A;  1QVU A;  5DUI A;  2VPL A;  2EIM H;  2ZME A;  4YIR X;  3WU2 C;  1OPC A;  2HXO A;  2L7F P;  2O03 A;  4B8X A;  4CSW A;  3L2W A;  4E7K A;  2QSH X;  3FMR A;  1S8N A;  1F43 A;  3BR6 A;  2BY0 A;  3H1C A;  3MKL A;  4PCQ A;  1Z67 A;  1WJD A;  1VQ7 I;  3ZN1 A;  2CYY A;  1HW1 A;  3OYH A;  4E7L A;  3TOA A;  5D5V B;  4X6A J;  3OV8 A;  3KYD B;  4IVN A;  3J81 Z;  5JVT A;  1GXQ A;  2XAJ A;  3M7G A;  1UAA A;  2Z33 A;  3F3X A;  3FMQ A;  1QHG A;  2VT2 A;  5HLG A;  3AG4 H;  5FB2 A;  4M3G A;  3A0B C;  4PGH A;  1D1C A;  2XAQ A;  1D1A A;  5IPA A;  1I1G A;  2QWW A;  3V42 A;  3OYE A;  1ETW A;  3RSN A;  4KIG A;  4JX4 A;  3OYG A;  4ZH4 F;  4E7I A;  2HTJ A;  2HOA A;  2OZU A;  1U5T C;  4YFK F;  3MFK A;  4ZDO A;  1WJB A;  3PNV A;  4D1Q A;  2GAU A;  3A02 A;  3Q9V A;  1OYW A;  3SJM A;  4LK1 F;  1JXS A;  1IC8 A;  5D4R A;  4KMU X;  3V8K A;  2I10 A;  4MEX F;  1I50 J;  2DDB A;  1SC7 A;  2FUG 2;  2LFB A;  3TO6 A;  1VQP I;  1ZLK A;  4FHT A;  2AS5 F;  2BOL A;  1U9O A;  3K9T A;  3VB2 A;  4DBR A;  4IHT A;  1KQ0 A;  4MTD A;  1E3H A;  1QRY A;  2F2E A;  4D0P A;  4NDL A;  1ETO A;  3ERM A;  3H35 A;  3BG3 A;  2O6G E;  1BL0 A;  1AA7 A;  4A3C J;  3RYP A;  5GPC A;  1FC3 A;  2LR8 A;  5L3C A;  5AIP A;  1DP7 P;  3H5A A;  2E1N A;  5JVG F;  5GAH J;  3BR1 A;  1RC9 A;  2P6T A;  2LF7 A;  2VJ5 A;  3JRD A;  3A01 B;  2EA2 A;  1ULY A;  2HKX A;  4XN0 A;  1SEU A;  4HRI A;  1E0E A;  1YIT I;  2VOD A;  2Y48 A;  2FQ3 A;  1GXP A;  3CUQ C;  2M7A A;  4CZC A;  2R92 J;  1E3O C;  2DCE A;  5J47 A;  3A01 A;  2P0W A;  2B9S A;  1FYL A;  3PO3 J;  4PGG A;  3K70 D;  3F9K A;  3FXL A;  1JE8 A;  2K86 A;  2R7D A;  4C30 A;  3JTH A;  1K6O A;  1G4D A;  4OMY A;  1XCV A;  2DFF A;  5A2Q K;  4G9Y A;  3BJ6 A;  6PAX A;  2JA7 J;  3KEO A;  1MNM C;  3G1L A;  4AC0 A;  4IKF A;  1A04 A;  1W5C C;  2FBI A;  2L9V A;  5M5Y J;  4Y52 J;  4FE7 A;  1TW3 A;  3RJP A;  5LLQ A;  3R61 A;  4H0E A;  4XK4 A;  2FU4 A;  2A68 F;  1TLH B;  3HM5 A;  1ETY A;  2LYC A;  3F8N A;  3LST A;  2LBF B;  1MH4 A;  3AG3 H;  1Z05 A;  3I3L A;  1MDM A;  1RIO H;  3ZXS A;  4RGX A;  2FEZ A;  1NHA A;  4Y15 A;  4XIC A;  4BE2 A;  3FK6 A;  4GDF A;  4Q47 A;  2P81 A;  4UUV A;  4CUG A;  1YHQ I;  3L2Q A;  2AQE A;  4HQE A;  1YS6 A;  1OFC X;  2HDD A;  2L4M A;  3P7N A;  2CRG A;  4CYC A;  1TNT A;  2W84 A;  3F0C A;  4RGU A;  2BVM A;  2D1H A;  4B1R A;  2X6Y A;  2RQQ A;  2CG4 A;  2QYO A;  2XF7 A;  4N0B A;  4KIB A;  3X2Q H;  2CGP A;  2R7O A;  5BPI A;  4PJJ A;  2HZD A;  5BS6 A;  5HLT A;  5D5U B;  4G6Q A;  1JTY A;  1STZ A;  3ABL H;  4U0V A;  4XRF A;  1XGO A;  3H36 A;  4F52 A;  2KRC A;  2CUZ A;  4V2G A;  2EJR A;  4XLA A;  1A31 A;  4UY8 I;  2HOT A;  1OMI A;  1TWH J;  2DA4 A;  1ETQ A;  1BOB A;  4L5E A;  2PMZ N;  5IY5 H;  1MBH A;  1MJA A;  5FO5 A;  3B73 A;  1MMG A;  5GAE J;  4Z6Y A;  1AOY A;  2FML A;  3FWE A;  5KCM A;  1ENH A;  3MD2 A;  1N75 A;  2Y0S A;  4A6D A;  3GLX A;  4MO7 A;  2EZI A;  2X9D A;  3CCS I;  1FIA A;  4BQQ A;  3QYB A;  3D1N I;  1H0M A;  5DYM A;  1X4P A;  5F08 A;  5GAG J;  5LEJ A;  3I55 I;  1VND A;  4PUS A;  1XX5 A;  2HQR A;  3ZN0 A;  3OR2 C;  3OYA A;  1XTA A;  2VBY A;  1X1C A;  1J59 A;  1TWF J;  5HS7 A;  2VBX A;  3HSR A;  3C2B A;  3V7R A;  4MEY F;  4XON A;  1IN7 A;  1W1W E;  2DK5 A;  2EB7 A;  1SMY F;  2DU9 A;  2CH0 A;  1LEA A;  3CMY A;  3BT9 A;  2W25 A;  4ITV A;  2Z1D A;  1PUF B;  2BYV E;  5L3B A;  2W48 A;  1R00 A;  1XMA A;  1MIJ A;  1MW7 A;  1ZG1 A;  1U3E M;  3B02 A;  2VKE A;  3BDD A;  3EQL F;  3L2V A;  3S3O A;  3FHN A;  1YJW I;  3HC7 A;  4A0X A;  5LBQ A;  3MKW B;  3CCE I;  2AO9 A;  3EYI A;  5FRM A;  3KP7 A;  4OAY A;  3G1O A;  4UV8 A;  1DP3 A;  2E1C A;  3NWS A;  5FJ8 J;  1KGS A;  3S8P A;  3PL8 A;  4CYD A;  5CQG A;  1BR2 A;  2XPV A;  1EJ9 A;  2KFD A;  2Z99 A;  2ZKZ A;  2GXG A;  2IAI A;  2L5Q A;  1QPM A;  1WI9 A;  4A93 J;  4G8X A;  4L9T A;  2K02 A;  3S2W A;  2DTZ A;  2L9S A;  4PZJ A;  1PUE E;  5DEQ A;  1RUO A;  2IGO A;  1CF7 B;  3QOE A;  2KJB A;  3EUH C;  3PUF A;  4XKV A;  3CCL I;  3FXQ A;  5DDG A;  3QOD A;  4RMN A;  2X4H A;  2CWE A;  2E1O A;  1CF7 A;  1J7K A;  2R7F A;  2C6Y A;  4BL0 B;  4EAT A;  2DN0 A;  1GV2 A;  3QWL A;  4DZP A;  2IBD A;  5HOO A;  1Y8Q B;  3Q5F A;  1UST A;  1ETV A;  4CCL A;  3L09 A;  2O61 A;  1DPU A;  3CD6 I;  3ZGK A;  1W7P D;  3WTW C;  3J7A O;  3LWF A;  1P6R A;  3W3C A;  1SAN A;  2R7X A;  2M4G A;  1DDN A;  1IV6 A;  1YOV B;  4UVC A;  4XOT A;  1LB2 A;  3QOP A;  1IJW C;  2HNH A;  1LDD A;  2K85 A;  3LMM A;  4L18 B;  4E70 A;  3KE2 A;  1Z0X A;  3S1N J;  1JHH A;  4E7S A;  2H1K A;  3NWT A;  1SFK A;  2E60 A;  5K7F A;  3CJT B;  5E18 F;  2QKL B;  3RKY A;  3RKW A;  2OAZ A;  1WJE A;  3QPS A;  2L3D A;  1MH3 A;  2E7X A;  3E5U A;  5F27 A;  4DNC A;  1DUX C;  1F1Z A;  4I0A A;  3U1D A;  5EEA A;  4U7B A;  1JKP C;  1XGM A;  2LNB A;  2X51 A;  1I39 A;  4QPQ A;  1P9Q C;  4BE0 A;  1FZP B;  1LE8 B;  3QRF F;  5IYB J;  3OYN A;  2UV1 A;  2JJ7 A;  5M3M J;  3W2V A;  1HST A;  5EEH A;  2E1M B;  1K79 A;  1R6R A;  2COM A;  3BR5 A;  1MMN A;  4S0H B;  1LE8 A;  2VBW A;  2QM3 A;  4JK1 X;  4B48 A;  3Q0W A;  2F5E A;  1MMS A;  3KYL A;  2BW3 B;  4BY1 J;  2F48 A;  2PMZ A;  4BHP A;  4OIP F;  2MFZ A;  4HX4 A;  1N78 A;  3I4M J;  2N8G A;  2ZJP F;  3CDH A;  4HSR A;  2BW3 A;  5E8I A;  3CCV I;  2QQ8 A;  3L7W A;  2JT1 A;  4ZYE A;  2V6C A;  2ACJ A;  1R1U A;  3SEQ A;  4OIQ F;  3PQK A;  2FQ4 A;  2LRD A;  2OTL I;  1I5Z A;  1VQO I;  4A3L J;  2QKM B;  4UHT A;  1KYW A;  3VYU B;  5E3M A;  3HOV J;  1RI7 A;  5BQT A;  5K5R A;  3BJA A;  3ABU A;  1HCR A;  4KMF A;  4AD9 A;  4G6T B;  5D6F A;  5DM7 F;  3ZMV A;  5C3E J;  2G7U A;  1ON2 A;  2JRM A;  4U88 A;  4BH9 A;  1JJ8 C;  1IRZ A;  3WHC A;  2XUB A;  3QQA A;  2BV6 A;  3J80 K;  1UJ8 A;  5E1X A;  4KIS A;  4XN3 A;  3I71 A;  3HOU J;  3HEF A;  1DGR M;  4U87 A;  1JKQ C;  2DO7 A;  2XGC A;  5B3S H;  2F4M B;  2DPD A;  5F0C A;  1FT9 A;  1JUP A;  1QU3 A;  2OZ6 A;  3QYE A;  2V4J C;  3WTS C;  4P1W A;  3PM1 A;  2MW8 A;  2NOG A;  3O2P E;  2MYS A;  2DT7 B;  3GO5 A;  1ONV A;  1RNL A;  3TKY A;  4A69 C;  2JUG A;  3TMO A;  3WG9 A;  1XGS A;  1D1B A;  5H2F C;  2PMH A;  3HYI A;  4UB8 C;  3P9I A;  2EV5 A;  1WJC A;  2HFH A;  3E6D A;  4MFD A;  5LFA A;  1K61 A;  1H88 C;  1TQI A;  4XKB A;  2KKO A;  3KEQ A;  4RLF A;  5J8F A;  2HYJ A;  2M30 A;  2KIU A;  3E5X A;  4E7Z A;  2XGD A;  4IHV A;  2PG4 A;  3RKX A;  2XPU A;  3DFG A;  3HBL A;  1H9G A;  1S3J A;  1HBX G;  5K5O A;  3E3V A;  4G12 A;  1OCO H;  1TQP A;  3I54 A;  3OIP A;  2NNY A;  2R7V A;  1HDP A;  3O3K A;  4NC6 A;  4A3B J;  1J9I A;  3HOY J;  1Y6I A;  1VQ4 I;  4NHJ A;  1ZH5 A;  1SFE A;  2KRH A;  3E1S A;  1O7L A;  4ZYD A;  3KZY A;  2WV1 A;  1K78 B;  1PDN C;  1TL8 A;  1ZAO A;  2MA3 A;  3PSF A;  1OCR H;  2MSY A;  2EA4 A;  1P7J A;  2GOM A;  3M4O J;  2EWN A;  4ENK A;  3L2C A;  1BBY A;  2K5C A;  3QPT A;  2V9K A;  1ZGJ A;  4QLC U;  1A6I A;  2VUM J;  4BAY A;  1ZRD A;  2M1B A;  1REP C;  1ETK A;  3OYD A;  1V5F A;  2ZNZ A;  2Y9Y A;  3OOP A;  1OR7 A;  1UCR A;  2X6X A;  3U2R A;  4E6K G;  1CGP A;  3ZP5 A;  4Y7N J;  2IA2 A;  4P55 A;  1BJA A;  4F92 B;  3K1N A;  1WSU A;  3ISP A;  2MG4 A;  2XC7 A;  1FP1 D;  2RDP A;  2EFQ A;  4EM1 A;  1X2M A;  2JK3 A;  4BEH B;  3GBG A;  3LSG A;  1PVE A;  4E7J A;  1XG1 A;  5ILV A;  5L3E A;  5ICG A;  2BXY A;  1FYM A;  2R7T A;  3FKJ A;  5EZG A;  2A5W A;  1YTY A;  2Q2E B;  2PJR A;  1BN5 A;  3K2A A;  1BOA A;  2JTV A;  1P2F A;  2NXN B;  5FKO A;  4BEH A;  1G3S A;  1VQK I;  5FLV A;  5EGO B;  4XSZ F;  5ICE A;  4BXX J;  3SDG A;  4A3D J;  1VQL I;  4LG0 B;  3HG9 A;  3N97 A;  2Q2E A;  3JRC A;  3ZPL A;  4ESF A;  3AAF A;  2DLL A;  5JR3 A;  3J7A Y;  2BBY A;  5EGO A;  1I1S A;  4S04 A;  4LG0 A;  3K69 A;  1RET A;  5FRN A;  1SD5 A;  2Y0M A;  4BKX A;  1EV7 A;  4XLF A;  3LA3 A;  4BHB A;  4R1H A;  1TW2 A;  2EQR A;  3SZP A;  2M4K A;  4Q4Z F;  1U8B A;  3D5S C;  2JA6 J;  2MBF A;  1AHD P;  4MQ9 F;  4AIJ A;  5JLX A;  1OQY A;  3PSI A;  5LEK A;  2QGU A;  4HEA 2;  2ZXH A;  2HGC A;  1YJ9 I;  1QO0 D;  3GCM A;  4QWQ A;  1FJL A;  3F72 A;  1WI3 A;  3HDD A;  5FLX Z;  3GTM J;  4B47 A;  1GLN A;  1TNS A;  1U78 A;  1MSE C;  3G3Z A;  2X48 A;  2NVU B;  2V26 A;  4A3J J;  3DV8 A;  3OSG A;  4AVZ A;  1S6L A;  4I01 A;  1Z91 A;  1FY7 A;  3SEZ A;  4PJN A;  2RV8 A;  3CMM A;  1S7E A;  1LEB A;  1FBS A;  2DW4 A;  4FE4 A;  5FFZ A;  2OUM A;  1PP8 F;  2FA5 A;  2HS5 A;  1WJA A;  3LA7 A;  1V5G A;  3BJO A;  2FX0 A;  3BG9 A;  4U7D A;  2JVH A;  3S16 J;  2RVC A;  2BE5 F;  3FF5 A;  4GGG A;  4RB1 A;  4S05 A;  2E36 A;  3BR0 A;  4Y17 A;  1IXS B;  2M2E A;  3HTS B;  4GXO A;  2ZBK A;  4XM3 A;  5HLH A;  2DA6 A;  5HDN A;  3LFK A;  1KQ9 A;  4XBF A;  4B44 A;  1GT0 C;  3L2U A;  2IXS A;  4ZJZ A;  1B6A A;  2RQP A;  2CV1 A;  2WAF A;  3GUD A;  3JSP A;  3SFI A;  1EH7 A;  1X4O A;  2EFP A;  2NAZ A;  5JLW A;  4V19 K;  3UNG C;  3J81 K;  3EDP A;  1W36 D;  5DCM A;  1E2X A;  2CW8 A;  4KT6 A;  2ELH A;  3GEZ A;  5DUK A;  2EV0 A;  4M3E A;  2Q8K A;  1ITY A;  5LRR A;  4J00 A;  4I2O A;  1M1E B;  2DOA A;  2F4I A;  4RGR A;  4A2U A;  3RKQ A;  4M74 A;  5LGT A;  3CJQ B;  3GW2 A;  3G4S I;  2HOS A;  3I9V 2;  3M8E A;  3CUO A;  2QSG X;  3ECO A;  1ZAR A;  4IXA A;  2WB1 N;  2OC6 A;  4DYQ A;  4HLY A;  2VOP A;  5K1Y A;  2PEX A;  1TC3 C;  1I6X A;  3ZQ7 A;  1Z3Y A;  1IV8 A;  3ZR8 X;  4BU2 A;  2VC1 A;  2DYS H;  3KLO A;  3AL0 B;  2DA1 A;  3FXJ A;  1TTY A;  4A3F J;  1MND A;  3W2W A;  2E71 A;  3CF2 A;  5HDK A;  3KIO A;  5IP9 J;  4RM3 A;  3PO2 J;  4G94 A;  3K6G A;  2DMQ A;  5CVR A;  4F91 B;  2Y2Z A;  3MCZ A;  3OYC A;  2L7M P;  3AKZ A;  3KZZ A;  5D5X B;  4YFX F;  3EYY A;  4AYB N;  3ELK A;  3BQY A;  4NQW B;  1G3W A;  3FMS A;  3ZMU A;  3BOQ A;  4LMY A;  2HVS A;  3OYF A;  3K0L A;  2MC4 A;  4BBR J;  4IOA F;  1U9N A;  3BG5 A;  5F1J A;  2OCC H;  4J19 A;  1W0T A;  1OCT C;  2ZSH B;  2DXI A;  2JRT A;  2R7S A;  3HL2 A;  3E5Q A;  2VQH A;  2WWY A;  3K70 C;  5EG0 B;  5F0F A;  5C4X J;  1R5H A;  4R8H A;  4A6E A;  2VOO A;  1X1B A;  4KIT B;  1K4T A;  3A0H C;  2P7V B;  2K9S A;  3PIP F;  1QZY A;  5EG0 A;  2J5P A;  4A0Z A;  2H8R A;  4JQF A;  1ZYR F;  3G2B A;  3KP2 A;  4PJ0 C;  1CQT A;  4A3G J;  3IWZ A;  4I76 A;  2G9W A;  3S15 J;  1E3P A;  4ABZ A;  1XDU A;  3O8H A;  4ETS A;  4RB2 C;  3IP4 B;  4BQN A;  4LG3 A;  4ZTF A;  1ZGW A;  1QBJ A;  3CJN A;  2QBY B;  1EF4 A;  1FMV A;  2PMU A;  3EUA A;  3GLL A;  3D5R C;  1D0X A;  4XOP A;  4BBS J;  5EYR A;  4M71 A;  2XDV A;  2NRA C;  3FIW A;  1LDJ A;  1W0U A;  1BC7 C;  3JRH A;  2QBY A;  2L01 A;  5LGN A;  1B9M A;  3LSI A;  3M8J A;  2K4J A;  2L54 A;  4V2F A;  1A36 A;  5E79 C;  3SHF A;  2CQQ A;  2LY2 A;  1IN4 A;  3GTP J;  1TT5 B;  2CQX A;  2E5N A;  4AU7 A;  3LL7 A;  4XKC A;  2Z9O A;  3S2D J;  5D4S A;  5CLS A;  2CUJ A;  5LHG A;  2K9M A;  2ZJR F;  1XCB A;  2H8W A;  1HKS A;  4KT5 C;  3SZT A;  3ZRG A;  3DP7 A;  3IRQ A;  4CHU A;  1DQU A;  3QP5 A;  4L5I A;  4XRM A;  5BOX A;  3DEW A;  5DV5 A;  3ULQ B;  4EEF G;  1X1P A;  2FXA A;  1J09 A;  2VB6 A;  3MQ0 A;  1IZ1 A;  3RPU A;  4YG2 F;  3B6A A;  4HNV A;  3BR2 A;  4D9J A;  2W57 A;  1HC8 A;  3BCB A;  5GPA A;  3REO A;  3E6C C;  4XLN F;  4G7H F;  2ZFU A;  3F8M A;  1ZR2 A;  4A3I J;  4BS9 A;  2IA1 A;  4PSX A;  3IL2 A;  3PFY A;  2A3S A;  3MVP A;  4DGW B;  1SD4 A;  4CA0 A;  4BDY A;  1AKH B;  2A5Y B;  3BTC A;  4XSX F;  3WTX C;  4CH7 A;  2BGC A;  1RR7 A;  5B1B H;  3E6B A;  1ZLJ A;  2GWR A;  2LBF A;  1YIJ I;  3P9C A;  3RYR A;  4JYK A;  1IF1 A;  1BIA A;  4RAG A;  2XF6 A;  4CIC A;  1MJ9 A;  4IPA A;  4HF2 A;  2Y69 H;  2YU3 A;  2WB1 A;  2KZG A;  2NOJ B;  1XMX A;  3OYK A;  1YI2 I;  3R0A A;  2Z16 A;  3IC7 A;  3LQQ A;  4ENM A;  3I4N J;  4II2 A;  2Z5U A;  3U9G A;  4HX7 A;  4IHW A;  2DA5 A;  2HI3 A;  3IRR A;  4FCY A;  1YIO A;  1AU7 A;  3MZY A;  2STW A;  3CP2 A;  4DIQ A;  2WAQ N;  3BTL A;  4YEJ A;  3TGN A;  2EK5 A;  1D3Y A;  1Y8R B;  1YX5 A;  3DPU A;  3FBN B;  3F8F A;  2KRF A;  5D8L B;  2OA4 A;  1VQ9 I;  1ZRC A;  3FM5 A;  2H94 A;  4AYB A;  4NUB A;  3FHZ A;  1I6H J;  2R5Y B;  2DA7 A;  2DJI A;  4D5C A;  2L7K A;  2W4S A;  4PSW A;  1WQ2 A;  5KHD A;  4XLH A;  5B66 C;  1ODD A;  2O9L A;  2UXX A;  4XR6 A;  1YFH A;  2R5Y A;  1RES A;  4HBL A;  3ZQF A;  4LB6 B;  2DJN A;  1S9H A;  1D5V A;  5KK1 A;  2OD5 A;  2M34 A;  3DU6 A;  4LLL A;  3M07 A;  2LOO A;  2DOF A;  4F93 B;  1LPQ A;  5HVQ C;  1IDY A;  2V1N A;  3TQN A;  2I8D A;  1FOY A;  3BTJ A;  2DPU A;  5FKK A;  3O8G A;  4HF0 A;  3N4M A;  3CQZ J;  1ORK A;  4WXD A;  1JUM A;  1V54 H;  2CU7 A;  2X1D A;  1U8R A;  1VQ8 I;  4BJT A;  3IH4 A;  4KIF A;  2VI6 A;  2LTP A;  2LD5 A;  1FSH A;  3HJE A;  3CCM I;  2LKP A;  3HRU A;  5DD8 A;  1YE9 A;  4F55 A;  4BYY A;  1LVK A;  2XAH A;  4I98 B;  2W00 A;  2TDX A;  2OPT A;  2VIX A;  3VYS B;  5HOD A;  3VOE A;  2XRO A;  1WZ2 A;  1PUF A;  4HAM A;  4NBQ A;  5J8C A;  4ESJ A;  1Z7L A;  4M73 A;  4EGY A;  3Q0V A;  1S7A A;  3I59 B;  4AM3 A;  5F04 A;  3EET A;  2EIL H;  3OOU A;  2LKS A;  4P96 A;  4XMY A;  2E19 A;  1V55 H;  3Q3S A;  1ERD A;  1T2K A;  1V3F A;  2QUF A;  2Q0O A;  4L5J A;  3HPG A;  4I0B A;  4UNO A;  3AG2 H;  2IP2 A;  5B1A H;  5E3O A;  1TWC J;  1U2W A;  1MBJ A;  4W1U A;  1NG6 A;  3CO7 C;  1BJZ A;  1A6Q A;  4HYE A;  3HOT A;  4PFP A;  3WTZ A;  4XQF A;  3J7Y J;  3TBI A;  3LA2 A;  2NS8 A;  2RC4 A;  1BI0 A;  4ZC3 A;  3A2K A;  2CV2 A;  5IOY A;  2HQA A;  4M3B A;  3F22 A;  2W24 A;  3IHU A;  2NYX A;  3I58 A;  3WOD F;  2RNG A;  2ZCW A;  4L0Z B;  1G59 A;  3RPQ A;  3KX2 A;  1Y1V J;  1B9N A;  5DTD A;  1U5T B;  2Y9Z A;  3L00 A;  5L3F A;  1JUS A;  3PUB A;  4ZZL A;  2O7O A;  5K7Z A;  2IJL A;  2H27 A;  4XNF A;  1T0F C;  2R4G A;  3K4K A;  4Q48 A;  4WWC A;  1FTZ A;  4LIV A;  1U5T A;  3HRS A;  4A5N A;  2P8T A;  2HDC A;  2E7W A;  3OYL A;  2OQG A;  2FRH A;  5CVI A;  1EH8 A;  1OCP A;  4JX5 A;  3ZMZ A;  1K83 J;  4C3J J;  2KQR A;  3FXU A;  3GFJ A;  5CQE A;  2R5Z B;  5KVR A;  1YRN B;  2UUZ A;  1B4A A;  1GDT A;  2HYF A;  1KU3 A;  3OS2 A;  2ZNY A;  1JGS A;  2DMT A;  2VN2 A;  2BY3 A;  3FM3 A;  1K7A A;  2R5Z A;  1YRN A;  2W7N A;  4FET A;  2VXD A;  2LMD A;  3I56 I;  1KU7 A;  2XVC A;  5E1W A;  4A0Y A;  4IOC F;  2DTR A;  4GCV A;  1XMK A;  2K9L A;  3FK7 A;  1OCC H;  1B72 B;  3CC4 I;  2PQ8 A;  2JSP A;  4IF4 A;  2GXA A;  3SZG A;  2CUF A;  1BA5 A;  1W5T A;  3CUQ B;  4IHS A;  2LK2 A;  3VPR A;  1RPW A;  2EZH A;  4LD5 A;  1YJN I;  4OIN F;  2LP0 A;  5J4Y A;  2JSC A;  2VJJ A;  3UKG A;  2V6E A;  2ECB A;  3RZD J;  2WY7 Q;  3GVA A;  3WU0 A;  4JP0 A;  2DT5 A;  1YYV A;  3TO9 A;  1GHC A;  4GYG A;  3H3Z A;  3SXY A;  1G8X A;  3F23 A;  2EIJ H;  1D5Y A;  4E4H A;  2IVM A;  4OWR B;  3ABT A;  3JR9 A;  4N9H A;  2HQN A;  4MNU A;  2VL8 A;  4M6V A;  1ZG5 A;  1O57 A;  2VON A;  1MKM A;  3UR3 C;  1Q1H A;  1RRJ A;  5J1U A;  2NS7 A;  4ZDL A;  1PYV A;  4LOC A;  1X58 A;  4E7H A;  4B4C A;  1SD7 A;  5J4V A;  4G7Z F;  3BG6 A;  1FBU A;  3ERE D;  1K4S A;  2NVQ J;  2CJJ A;  2DT6 A;  4EJO A;  2EIK H;  3S1M J;  3GFL A;  2CW0 F;  3HKZ N;  1H9T A;  4DBQ A;  3VEP A;  3ZOB A;  1Z6T A;  2XRL A;  3L9F A;  5LGU A;  3NAU A;  4RAY A;  3BY6 A;  1Z3X A;  2JPB A;  2KL4 A;  2X1E A;  3T5X A;  2DBB A;  4UUT A;  4XRS A;  1I3A A;  3KET A;  3HHG A;  3CMA I;  2EH3 A;  2M87 A;  3ONQ A;  5ILS A;  3H5N A;  1EA3 A;  2VPR A;  5IT3 A;  4HF1 A;  2M5W A;  2LF8 A;  3I64 A;  4NC8 A;  5F1R A;  2XKP A;  2I5U A;  2KDO A;  3PQJ A;  4XOR A;  2DMP A;  4AVP A;  2ZJQ F;  2M3A A;  4M6Y A;  4MHG A;  3TDZ C;  3PJR A;  2K9N A;  5FKM A;  5J6X A;  1BW5 A;  3MZH A;  4K2E A;  2XB0 X;  4LIU A;  5E1Z B;  2CS3 A;  1V5E A;  1ZKG A;  1FOK A;  1QGP A;  2KLO A;  1UZC A;  3G1M A;  3JAM Z;  1YG2 A;  1ZGA A;  2GXB A;  1ACI A;  2A61 A;  1W5S A;  1R4M B;  3HUG B;  3DTE A;  4GFB A;  1TP4 A;  2FBK A;  5L3G A;  2ZME C;  2LY1 A;  5E8G A;  4YEL A;  3FXR A;  2FNA A;  5C44 J;  2EIN H;  3W6J B;  2GBY A;  3I53 A;  3KP6 A;  3TW6 A;  2KDZ A;  3VFZ A;  2DFI A;  1FPQ A;  4G6D A;  2FF4 A;  3FKI J;  3OMY A;  1USS A;  3LAP A;  4FT8 A;  4BY7 J;  1SAU A;  5IYD J;  2ID6 A;  3SFZ A;  4Y33 A;  3MKZ A;  1NK3 P;  2FJ1 A;  3E6M A;  1UFM A;  4FAS D;  5IP6 A;  4LGW A;  1K78 A;  2E35 A;  2M8G X;  1BI3 A;  1BR4 A;  2RRE A;  4PJL A;  3J80 Z;  4YRV A;  4I6Z A;  2E34 A;  4M3D A;  1F5T A;  4EVI A;  1S29 A;  3JTG A;  4XLP F;  2GOX B;  2L9N A;  3IH3 A;  1P4X A;  4PK4 A;  1LKX A;  2RKH A;  3IAM 2;  5HNH A;  1VQN I;  2LRE A;  1FIP A;  5J40 A;  1H89 C;  5GAD J;  3H92 A;  3RDI A;  5FLX K;  1QZE A;  2IGN A;  4Q5S F;  1ZEL A;  2FD5 A;  2FOW A;  2ZXJ A;  1LJ9 A;  1KZH A;  2FMY A;  1R71 A;  3HGG A;  4KFC A;  1Z9C A;  1C0W A;  3DPL C;  3C1D A;  3E7L A;  1G3Y A;  5JHF A;  4OIO F;  5J1R A;  4UVA A;  1SFX A;  2CFX A;  2YPR A;  1X19 A;  5LRS A;  3HPH A;  3WGG A;  3ASN H;  3WTV C;  1LFU P;  2HOE A;  1APL C;  3LSP A;  1HSJ A;  1XD7 A;  2AXL A;  3BP8 A;  2V1D A;  2AHQ A;  4CZZ A;  2HEO A;  2KT0 A;  3SYT A;  2XRN A;  2P5K A;  3H0G J;  3H3V K;  4RGS A;  4U0W A;  4OOI A;  2LLK A;  2VKH A;  3OIO A;  2QSF X;  3WHB A;  3OL3 A;  2V1U A;  2PBI A;  1BI1 A;  2O5R A;  3O6B B;  2X6O A;  4XLC A;  4I02 A;  3JRI A;  3CME I;  4CDG A;  3L2R A;  2BEO A;  3HHH A;  3K2Z A;  1QHH D;  1UHW A;  2D45 A;  1HXD A;  4HNT A;  2A6E F;  2WC2 A;  2IS6 A;  3KP4 A;  2JPC A;  1FLI A;  4C9Y A; 
#chains in the Genus database with same CATH homology
 3H3U A;  4M9X A;  1O3R A;  3WTU C;  2GA2 A;  3I5U A;  4N9I A;  2P5V A;  2XKO A;  1R22 A;  2XAS A;  4LLG F;  1Y0U A;  5IT9 K;  2IRF G;  3I0T A;  3VOD A;  3WE3 A;  4O6J A;  2UWM A;  3HOS A;  1J75 A;  5FD6 A;  4Z2Y A;  1SMT A;  1AWC A;  2KIM A;  4BNC A;  1BM9 A;  3WTT C;  2G7H A;  4KA4 A;  2DAO A;  1RZ4 A;  1GVJ A;  1MJB A;  3F8B A;  2V1X A;  2YX7 A;  5ED4 A;  3GWZ A;  4A5M A;  3WGI A;  4HV5 A;  2MD5 A;  2XAF A;  3V8J A;  5K5Q A;  2QQA A;  4PDK A;  3GZ5 A;  2WTE A;  4UXN A;  4HW0 A;  4EV0 A;  2QZ8 A;  1R58 A;  3GXO A;  3JSO A;  4WF2 A;  1T38 A;  1B1B A;  4AWX B;  1RUN A;  4EJW A;  4CO8 A;  4LFU A;  1J0R A;  2CQK A;  2MLG A;  1OYY A;  4UVB A;  3BPX A;  2HR3 A;  4NQW A;  2ZME B;  2FE3 A;  3COA C;  1KYZ A;  2HWV A;  1O3Q A;  2V79 A;  1IRF A;  1R1T A;  2PN6 A;  3F6V A;  2O3F A;  5TRD A;  1FBQ A;  2IA0 A;  2HYG D;  5EEG A;  3CLO A;  4LLN A;  3BPV A;  3TOB A;  4ZYG A;  3M8F A;  1FP2 A;  2VBZ A;  2RGV A;  2HKO A;  3DF8 A;  2MC3 A;  2FBH A;  3HRT A;  3E97 A;  4ENN A;  2M8E A;  1R5G A;  1KA8 A;  1G3T A;  4M9S A;  1YLF A;  2OBP A;  2ESH A;  1FWZ A;  1HW5 A;  1BIB A;  1R1V A;  3HSF A;  3NRV A;  3F21 A;  1XDS A;  4LK0 F;  2YX4 A;  5FGM A;  4CXF A;  1FX7 A;  4EJU A;  1QQI A;  3V8L A;  4EMS A;  4P5O A;  2F5D A;  1R36 A;  3WE2 A;  4L9V A;  2ISZ A;  3QAH A;  3W6K B;  3GFM A;  3QPH A;  1D8K A;  3P9K A;  1KQ8 A;  1DPR A;  3MAJ A;  1XSD A;  5HLI A;  3KP3 A;  2P5L C;  2JZY A;  3LAJ A;  4A12 A;  3Q9S A;  2VXZ A;  5H6Q A;  2D2W A;  3IWF A;  5CVU A;  4O5V A;  4UV9 A;  2R3S A;  4MGR A;  4KIC A;  3M9A A;  3V4G A;  1KU2 A;  2VE9 A;  1G6N A;  1MDM B;  2QEN A;  2LSO A;  4FX4 A;  2L4A A;  5HS9 A;  2FOK A;  3KP5 A;  1XSV A;  1XSX A;  5TJJ A;  3C3W A;  4TV7 A;  5CJ9 A;  1IW7 F;  3GFI A;  1HKT A;  2H6C A;  4ASN A;  1V4R A;  3GZ6 A;  2B0L A;  2O8X A;  4O3M A;  4R79 A;  1SAX A;  1J5Y A;  4IRI A;  1T98 A;  4M6X A;  1YO5 C;  2IW5 A;  4HA8 A;  5CVV A;  2V9V A;  2A07 F;  2IT0 A;  2O0Y A;  4OU0 A;  4IRH A;  1E17 A;  1SD6 A;  2X0L A;  2XAG A;  4ZYH A;  5A2Q Z;  3TO7 A;  2ISY A;  1WWX A;  4B09 A;  1LVA A;  1HKQ A;  1IXR C;  1L0O C;  1D8J A;  2GIV A;  3HRM A;  4ON0 A;  1IAW A;  4AIK A;  5DCF A;  1F9N A;  2OQR A;  1QNT A;  4EGZ A;  2K4B A;  5JI6 A;  4P9F A;  4L0Y B;  3V7C A;  1W4M A;  2XHK A;  1FYK A;  3MWM A;  1LQ1 A;  2RN7 A;  4CGZ A;  2ETH A;  4G7O F;  4RS8 A;  2HZT A;  5DD4 A;  5ERI A;  3QU6 A;  2CO5 A;  5JFR A;  3QP6 A;  1XB4 A;  3LQR A;  3I59 A;  4YFN F;  1FSE A;  4WXH A;  4YIF A;  3HIF A;  3RI4 A;  4OIR F;  1BC8 C;  4FX0 A;  2F5F A;  1VTN C;  1IN8 A;  2GQQ A;  1PP7 U;  3NQO A;  4HQM A;  4OMZ A;  4KN7 X;  1B59 A;  5FD5 A;  3D0S A;  2PFB A;  4BXU A;  2NNN A;  2D1V A;  1EH6 A;  3KFW X;  1YQA A;  4HLX A;  1QZZ A;  4LJZ F;  1U6G A;  2F5C A;  4ZZD A;  2CSO A;  3IKT A;  4BQA A;  4EQQ A;  3GYH X;  2UXN A;  5F64 A;  3ROU A;  3T0Y A;  4YII A;  4JBA A;  2MH9 A;  4HX8 A;  5AIQ A;  3T8T A;  3WGH A;  3ECH A;  1YW8 A;  1MGT A;  2ZFW A;  3WU1 B;  4WX9 A;  3FZV A;  4M72 A;  1FNN A;  2J5O A;  1KU9 A;  4F7Z A;  1T39 A;  1Z6R A;  4AIH A;  1UB9 A;  1IN6 A;  3BRO A;  4EM2 A;  1J2X A;  4WK8 F;  4IRG A;  3GX4 X;  1OYI A;  3WTY C;  1IRG A;  3DKW A;  1P4A A;  5ILU A;  3M1E A;  2ZO4 A;  3R60 A;  4HZF A;  4GO1 A;  1TBX A;  3ML6 A;  3CUQ A;  1L3L A;  3TDU C;  3PFI A;  3JW4 A;  2P7C B;  2XV4 S;  4ENJ A;  5ICF A;  1IN5 A;  3HTU A;  3DXJ F;  1O3S A;  2ZJ2 A;  2QQ9 A;  1MD0 A;  1LDK B;  5D5W B;  3F6O A;  3NEU A;  1OKR A;  2P6S A;  3R4K A;  3JAM K;  2EV6 A;  1ZG3 A;  3K1M A;  2FSW A;  4U0Y A;  1MZB A;  5BPD A;  3BWG A;  4KUM A;  1WRJ A;  2DI3 A;  2P4W A;  1SFU A;  3MEX A;  3T8R A;  3ZMD A;  2QLZ A;  5D6E A;  1IUY A;  3DEU A;  3DPT A;  5JHU A;  2EFW A;  1P92 A;  4KNY A;  3DQV C;  2VT3 A;  5HDG A;  1ZRF A;  2EFN A;  4NB5 A;  2WV0 A;  1ZRE A;  1JHF A;  3I4P A;  2H09 A;  2RNJ A;  3HUG A;  3V7S A;  4RAZ A;  1W7P B;  2DQR A;  4DQ2 A;  1WKM A;  1T6S A;  1LNW A;  4MQV A;  2XGX A;  1ZN2 A;  3IKV A;  2M45 A;  1W7P A;  1I27 A;  1O3T A;  1YS7 A;  1ON1 A;  4GYI A;  5H6R A;  5H20 A;  5F6F A;  5CYV A;  2KJC A;  2YSR A;  2KIF A;  5L3D A;  3KCC A;  2Y75 A;  1ZHF A;  2STT A;  1TQM A;  2PJP A;  2IPQ X;  4WCG A;  3QU3 A;  3F8C A;  1YW9 A;  3HSE A;  5ICC A;  3BZ6 A;  2FNP A;  1X3U A;  4I09 A;  3EUH A;  1Z1D A;  1BI2 A;  5AON A;  4P9U A;  3RIR A;  4WXC A;  2GZW A;  3SQN A;  3C7J A;  2NS0 A;  4RB0 A;  1T0F A;  2ESN A;  2PI0 A;  4HDV A;  1R7J A;  3ZMS A;  1P4W A;  1HW2 A;  3G73 A;  1XN7 A;  1Z7U A;  3D5L A;  4IJA A;  1XGN A;  2QVO A;  5LHI A;  2LDU A;  2L02 A;  1HQC A;  4EJV A;  2VE8 A;  4M9Z A;  2VC0 A;  4MTE A;  5HS8 A;  5LHH A;  2ADU A;  5CVJ A;  2UZK A;  1F4K A;  2K7L A;  3CO6 C;  5E20 A;  2W85 A;  4HDU A;  2MLK A;  1O7F A;  2YR2 A;  4RB3 C;  2A6H F;  2H6B A;  2QQB A;  2HTS A;  4L9N A;  4Y13 A;  4L9J A;  4HV6 A;  4LB5 A;  1R23 A;  2A69 F;  4I7H A;  3K1P A;  2OU2 A;  4EM0 B;  5DCM B;  2XIG A;  2K27 A;  5BMZ A;  2PLY A;  5D8K B;  4ESB A;  3RTR A;  3GF2 A;  3KLN A;  1YW7 A;  2GA1 A;  4EJT A;  3R6S A;  3CTA A;  4BHC A;  2DQL A;  1S7O A;  3C18 A;  5IT9 Z;  5E17 F;  3T1B A;  1IXC A;  4KN4 X;  2DK8 A;  4HOB A;  3ZMT A;  2Z3Y A;  2MH2 A;  1UHM A;  2EFO A;  4KDP A;  3FX3 A;  5FFX A;  4KYW A;  3R0J A;  5DUI A;  2ZME A;  1OPC A;  2O03 A;  4B8X A;  3FMR A;  1S8N A;  4PCQ A;  3ZN1 A;  2CYY A;  1HW1 A;  3TOA A;  5D5V B;  3OV8 A;  3J81 Z;  4IVN A;  5JVT A;  1GXQ A;  2XAJ A;  3M7G A;  2Z33 A;  3F3X A;  3FMQ A;  2VT2 A;  5HLG A;  5FB2 A;  4PGH A;  2XAQ A;  1I1G A;  2QWW A;  4KIG A;  4ZH4 F;  2HTJ A;  2OZU A;  1U5T C;  4YFK F;  3MFK A;  2GAU A;  3Q9V A;  1OYW A;  4LK1 F;  1JXS A;  5D4R A;  4KMU X;  3V8K A;  4MEX F;  3TO6 A;  1ZLK A;  4FHT A;  2AS5 F;  3K9T A;  3VB2 A;  4IHT A;  1KQ0 A;  4MTD A;  2F2E A;  4D0P A;  2O6G E;  3RYP A;  5L3C A;  1FC3 A;  5AIP A;  1DP7 P;  2E1N A;  2P6T A;  2LF7 A;  2EA2 A;  1ULY A;  2HKX A;  2VOD A;  2Y48 A;  2FQ3 A;  1GXP A;  3CUQ C;  1FYL A;  4PGG A;  1JE8 A;  2K86 A;  2R7D A;  3JTH A;  1K6O A;  1G4D A;  4OMY A;  1XCV A;  5A2Q K;  4G9Y A;  3BJ6 A;  6PAX A;  3KEO A;  1A04 A;  2FBI A;  1TW3 A;  3RJP A;  5LLQ A;  3R61 A;  4H0E A;  2FU4 A;  2A68 F;  1TLH B;  3F8N A;  3LST A;  1Z05 A;  1MDM A;  1RIO H;  4RGX A;  2FEZ A;  1NHA A;  4Y15 A;  4Q47 A;  4UUV A;  4HQE A;  1YS6 A;  2L4M A;  3P7N A;  1TNT A;  2W84 A;  4RGU A;  2D1H A;  4N0B A;  2CG4 A;  2QYO A;  4KIB A;  2CGP A;  5BPI A;  5BS6 A;  5D5U B;  4G6Q A;  1STZ A;  4U0V A;  4XRF A;  1XGO A;  2EJR A;  1OMI A;  1MJA A;  5FO5 A;  3B73 A;  1AOY A;  2FML A;  3FWE A;  4A6D A;  3GLX A;  1H0M A;  5DYM A;  5LEJ A;  2HQR A;  3ZN0 A;  2VBY A;  1J59 A;  5HS7 A;  2VBX A;  3HSR A;  3V7R A;  4MEY F;  1IN7 A;  2DK5 A;  2EB7 A;  1SMY F;  2DU9 A;  1LEA A;  2W25 A;  2BYV E;  5L3B A;  1R00 A;  1XMA A;  1ZG1 A;  1U3E M;  3B02 A;  3BDD A;  3EQL F;  4A0X A;  5LBQ A;  3EYI A;  3KP7 A;  4UV8 A;  2E1C A;  1KGS A;  4CYD A;  2Z99 A;  2ZKZ A;  2GXG A;  1QPM A;  1WI9 A;  4G8X A;  4L9T A;  2K02 A;  3S2W A;  4PZJ A;  1PUE E;  5DEQ A;  1RUO A;  1CF7 B;  2KJB A;  3FXQ A;  5DDG A;  2X4H A;  2CWE A;  1CF7 A;  1J7K A;  2R7F A;  2C6Y A;  5HOO A;  3Q5F A;  1UST A;  1DPU A;  3L09 A;  2O61 A;  1W7P D;  3WTW C;  3J7A O;  3LWF A;  1P6R A;  1DDN A;  4UVC A;  1LB2 A;  3QOP A;  1LDD A;  4L18 B;  4E70 A;  3KE2 A;  1JHH A;  5E18 F;  3RKY A;  3RKW A;  2OAZ A;  2L3D A;  2E7X A;  3E5U A;  4DNC A;  1DUX C;  1F1Z A;  4I0A A;  3U1D A;  4U7B A;  1XGM A;  2LNB A;  1FZP B;  3QRF F;  1HST A;  5EEH A;  1K79 A;  2COM A;  2VBW A;  2QM3 A;  4JK1 X;  2F5E A;  4BHP A;  4OIP F;  4HX4 A;  3CDH A;  5E8I A;  3L7W A;  2JT1 A;  4ZYE A;  2V6C A;  2ACJ A;  1R1U A;  4OIQ F;  3PQK A;  1I5Z A;  4UHT A;  1KYW A;  1RI7 A;  5BQT A;  5K5R A;  3BJA A;  3ABU A;  4KMF A;  4AD9 A;  5D6F A;  3ZMV A;  2G7U A;  1ON2 A;  4U88 A;  4BH9 A;  2XUB A;  2BV6 A;  3J80 K;  5E1X A;  3I71 A;  2DO7 A;  2DPD A;  1FT9 A;  2OZ6 A;  3WTS C;  3O2P E;  3GO5 A;  1ONV A;  1RNL A;  3TKY A;  3WG9 A;  1XGS A;  2PMH A;  3HYI A;  3P9I A;  2EV5 A;  2HFH A;  3E6D A;  1TQI A;  2KKO A;  3KEQ A;  5J8F A;  2M30 A;  2KIU A;  3E5X A;  2PG4 A;  3RKX A;  3DFG A;  1H9G A;  1S3J A;  1HBX G;  5K5O A;  3E3V A;  1TQP A;  3I54 A;  2NNY A;  3O3K A;  1J9I A;  1ZH5 A;  4NHJ A;  1SFE A;  1O7L A;  4ZYD A;  3KZY A;  1K78 B;  1PDN C;  1ZAO A;  2MA3 A;  2EA4 A;  2EWN A;  4ENK A;  3L2C A;  1BBY A;  3QPT A;  1ZGJ A;  4QLC U;  4BAY A;  1ZRD A;  2M1B A;  1REP C;  2ZNZ A;  3OOP A;  1OR7 A;  1UCR A;  3U2R A;  1CGP A;  3ZP5 A;  2IA2 A;  4P55 A;  1BJA A;  3K1N A;  1WSU A;  3ISP A;  1FP1 D;  2RDP A;  2EFQ A;  4EM1 A;  5ILV A;  5L3E A;  5ICG A;  1FYM A;  1YTY A;  1BN5 A;  1BOA A;  2JTV A;  1P2F A;  1G3S A;  4XSZ F;  5ICE A;  4LG0 B;  3N97 A;  2Q2E A;  3ZPL A;  4ESF A;  3AAF A;  2DLL A;  5JR3 A;  2BBY A;  1I1S A;  4S04 A;  4LG0 A;  3K69 A;  1SD5 A;  2Y0M A;  1EV7 A;  3LA3 A;  4BHB A;  4R1H A;  1TW2 A;  3SZP A;  4Q4Z F;  2MBF A;  4MQ9 F;  4AIJ A;  5LEK A;  2HGC A;  1QO0 D;  4QWQ A;  3F72 A;  5FLX Z;  1TNS A;  1U78 A;  3G3Z A;  3DV8 A;  1S6L A;  4I01 A;  1Z91 A;  1FY7 A;  2RV8 A;  1LEB A;  1FBS A;  2DW4 A;  5FFZ A;  1PP8 F;  2FA5 A;  2HS5 A;  3LA7 A;  3BJO A;  4U7D A;  2RVC A;  2BE5 F;  3FF5 A;  4GGG A;  4RB1 A;  4S05 A;  4Y17 A;  1IXS B;  3HTS B;  4GXO A;  2ZBK A;  5HLH A;  5HDN A;  3LFK A;  1KQ9 A;  4XBF A;  1B6A A;  2RQP A;  3GUD A;  3JSP A;  1EH7 A;  2EFP A;  2NAZ A;  3J81 K;  3EDP A;  5DCM A;  1E2X A;  2ELH A;  3GEZ A;  5DUK A;  2EV0 A;  2Q8K A;  5LRR A;  4I2O A;  4RGR A;  4A2U A;  4M74 A;  5LGT A;  3GW2 A;  3M8E A;  3CUO A;  3ECO A;  1ZAR A;  4IXA A;  4HLY A;  2VOP A;  5K1Y A;  2PEX A;  1I6X A;  3ZQ7 A;  2VC1 A;  3KLO A;  1TTY A;  5HDK A;  4G94 A;  5CVR A;  3MCZ A;  3KZZ A;  5D5X B;  4YFX F;  3EYY A;  3ELK A;  1G3W A;  3FMS A;  3ZMU A;  3BOQ A;  4LMY A;  3K0L A;  2JRT A;  3E5Q A;  2WWY A;  1R5H A;  4R8H A;  4A6E A;  2VOO A;  2P7V B;  1QZY A;  2J5P A;  4A0Z A;  4JQF A;  1ZYR F;  3KP2 A;  3IWZ A;  2G9W A;  1XDU A;  4ETS A;  4RB2 C;  1QBJ A;  3CJN A;  2QBY B;  2PMU A;  4M71 A;  2NRA C;  1LDJ A;  1BC7 C;  2QBY A;  2L01 A;  5LGN A;  1B9M A;  2K4J A;  2L54 A;  3SHF A;  1IN4 A;  2Z9O A;  5D4S A;  5CLS A;  5LHG A;  1XCB A;  1HKS A;  4KT5 C;  3SZT A;  3DP7 A;  3IRQ A;  4CHU A;  3QP5 A;  4L5I A;  5BOX A;  5DV5 A;  3ULQ B;  2FXA A;  3MQ0 A;  1IZ1 A;  3RPU A;  4YG2 F;  2W57 A;  3REO A;  3E6C C;  4XLN F;  4G7H F;  3F8M A;  2IA1 A;  3IL2 A;  2A3S A;  1SD4 A;  2A5Y B;  4XSX F;  3WTX C;  2BGC A;  3E6B A;  1ZLJ A;  2GWR A;  3P9C A;  3RYR A;  1IF1 A;  1BIA A;  4CIC A;  1MJ9 A;  4IPA A;  4HF2 A;  2YU3 A;  3R0A A;  3IC7 A;  3LQQ A;  4ENM A;  3U9G A;  2Z5U A;  4HX7 A;  3IRR A;  1YIO A;  3MZY A;  2STW A;  3TGN A;  2EK5 A;  1D3Y A;  3F8F A;  2KRF A;  5D8L B;  2OA4 A;  1ZRC A;  3FM5 A;  2H94 A;  3FHZ A;  1WQ2 A;  1ODD A;  2UXX A;  1YFH A;  4HBL A;  4LB6 B;  1D5V A;  5KK1 A;  2OD5 A;  4LLL A;  5HVQ C;  3TQN A;  2DPU A;  4HF0 A;  3N4M A;  4WXD A;  1U8R A;  4KIF A;  1FSH A;  2LKP A;  3HRU A;  5DD8 A;  4BYY A;  2XAH A;  4I98 B;  2TDX A;  3VOE A;  2XRO A;  4HAM A;  5J8C A;  4ESJ A;  4M73 A;  4EGY A;  1S7A A;  3I59 B;  3EET A;  4P96 A;  1T2K A;  1V3F A;  2QUF A;  2Q0O A;  4L5J A;  4I0B A;  4UNO A;  2IP2 A;  1U2W A;  3CO7 C;  4HYE A;  3HOT A;  3WTZ A;  3LA2 A;  2RC4 A;  1BI0 A;  3F22 A;  2W24 A;  3IHU A;  2NYX A;  3I58 A;  3WOD F;  2ZCW A;  4L0Z B;  3RPQ A;  1B9N A;  1U5T B;  3L00 A;  5L3F A;  4ZZL A;  2IJL A;  2H27 A;  4Q48 A;  4WWC A;  1U5T A;  3HRS A;  4A5N A;  2P8T A;  2HDC A;  2E7W A;  2OQG A;  2FRH A;  5CVI A;  1EH8 A;  3ZMZ A;  3FXU A;  3GFJ A;  5KVR A;  1B4A A;  2HYF A;  1KU3 A;  2ZNY A;  1JGS A;  2VN2 A;  3FM3 A;  1K7A A;  1KU7 A;  2XVC A;  5E1W A;  4A0Y A;  2DTR A;  4GCV A;  1XMK A;  2PQ8 A;  4IF4 A;  1W5T A;  3CUQ B;  4IHS A;  4LD5 A;  4OIN F;  2JSC A;  3GVA A;  3WU0 A;  2DT5 A;  1YYV A;  3TO9 A;  1GHC A;  4GYG A;  3H3Z A;  3SXY A;  3F23 A;  2IVM A;  3ABT A;  4N9H A;  2HQN A;  4MNU A;  1ZG5 A;  1O57 A;  2VON A;  1MKM A;  1Q1H A;  1SD7 A;  4G7Z F;  1FBU A;  3ERE D;  4EJO A;  3GFL A;  2CW0 F;  1H9T A;  3VEP A;  1Z6T A;  3L9F A;  5LGU A;  4RAY A;  3BY6 A;  2JPB A;  3T5X A;  2DBB A;  3KET A;  3HHG A;  2M87 A;  5ILS A;  5IT3 A;  4HF1 A;  2M5W A;  2LF8 A;  3I64 A;  5F1R A;  2XKP A;  3PQJ A;  4AVP A;  4M6Y A;  4MHG A;  3TDZ C;  5J6X A;  3MZH A;  4K2E A;  5E1Z B;  1FOK A;  1QGP A;  3JAM Z;  1YG2 A;  1ZGA A;  2GXB A;  2A61 A;  1W5S A;  2FBK A;  5L3G A;  5E8G A;  3FXR A;  2FNA A;  3W6J B;  3I53 A;  3KP6 A;  3VFZ A;  2DFI A;  1FPQ A;  4G6D A;  2FF4 A;  1USS A;  3LAP A;  4FT8 A;  3SFZ A;  3E6M A;  1UFM A;  1K78 A;  4LGW A;  1BI3 A;  3J80 Z;  1F5T A;  4EVI A;  1S29 A;  3JTG A;  4XLP F;  1P4X A;  2RKH A;  3H92 A;  3RDI A;  5FLX K;  4Q5S F;  2ZXJ A;  1LJ9 A;  2FMY A;  4KFC A;  1Z9C A;  1C0W A;  3DPL C;  3C1D A;  1G3Y A;  4OIO F;  4UVA A;  1SFX A;  2CFX A;  2YPR A;  5LRS A;  3WGG A;  3WTV C;  2HOE A;  1HSJ A;  1XD7 A;  2AXL A;  3BP8 A;  2V1D A;  4CZZ A;  2HEO A;  2XRN A;  2P5K A;  4RGS A;  4U0W A;  4OOI A;  2V1U A;  2PBI A;  1BI1 A;  3O6B B;  4I02 A;  4CDG A;  2BEO A;  3HHH A;  3K2Z A;  1UHW A;  2D45 A;  1HXD A;  2A6E F;  2WC2 A;  3KP4 A;  2JPC A;  1FLI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...