1TBXA

Crystal structure of ssv1 f-93
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
94
structure length
94
Chain Sequence
STPFFYPEAIVLAYLYDNEGIATYDLYKKVNAEFPMSTATFYDAKKFLIQEGFVKERQERGEKRLYLTEKGKLFAISLKTAIETYKQIKKRHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Hypothetical 11.0 kDa protein
publication title Crystal structure of F-93 from Sulfolobus spindle-shaped virus 1, a winged-helix DNA binding protein.
pubmed doi rcsb
source organism Sulfolobus virus 1
total genus 33
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1tbxA00
4H0EA 3WGIA 1U6GA 2IP2A 1VTNC 2K27A 1HW5A 3RI4A 3RIRA 5HOOA 1B9MA 4CYDA 2G7UA 4Q5SF 1IF1A 5KVRA 4WK8F 4KUMA 1IN6A 3S2WA 2RDPA 2VC1A 3GZ5A 5HDGA 2GWRA 2FE3A 1ZGJA 4LJZF 4U7BA 3V8LA 1IRFA 4EJWA 1FX7A 5E1XA 3ZQ7A 1ZG1A 4K2EA 5D5UB 4I09A 2XAHA 3ISPA 4CICA 1BOAA 5D8LB 2CG4A 3E6CC 1TNSA 4U7DA 3QP5A 2CYYA 5JVTA 1OYWA 2W25A 3I4PA 3FXRA 3T5XA 3FXQA 3N4MA 2QQ9A 4WCGA 5J8CA 1KU9A 2DW4A 3P9IA 4HQMA 3F21A 3EUHA 1QGPA 2PG4A 3TO9A 4WXHA 5FD5A 1FY7A 3GF2A 4I02A 5JFRA 2K4BA 1HSJA 3CDHA 3M7GA 5HVQC 4N9HA 4HAMA 5ERIA 2P5VA 3K1PA 5L3DA 1FZPB 4KIBA 1SD4A 3DPTA 3R6SA 4ESJA 1J9IA 3F8FA 1K78A 3O3KA 1FYKA 3IKTA 4FT8A 4S04A 2CSOA 3CUQA 5K5OA 2DQLA 2ISZA 3T8RA 4Q47A 3I0TA 2XASA 4KNYA 3F8CA 4IXAA 3RKXA 1S29A 1ULYA 1BM9A 4LD5A 4EM0B 1J5YA 2GXBA 4G8XA 1B59A 1GHCA 3O6BB 4UXNA 3VODA 3ZMVA 1MD0A 3I54A 5LRSA 2O03A 2VBZA 2Y75A 4OU0A 4UHTA 3CO6C 1BI2A 1G6NA 2JZYA 1MJAA 2VE8A 2IRFG 5ICCA 3V8KA 4EM1A 2M8EA 5E1WA 1KYWA 4LLNA 2E7XA 4MHGA 4YIFA 2GQQA 3KE2A 5HLIA 3BZ6A 2R7DA 2YX4A 4PZJA 1XGSA 1ON1A 1F1ZA 2WV0A 1HW2A 3LA2A 1KU7A 1FPQA 1W4MA 1I5ZA 3RYRA 1Z9CA 3W6JB 4HYEA 4EV0A 4Y15A 3SZTA 1TQMA 4LGWA 2A61A 4GCVA 2Y48A 1O7LA 1ZHFA 1FWZA 2HTSA 3V7SA 1KU3A 1EH6A 4HDVA 2VOPA 2K7LA 1G3SA 1O57A 3IKVA 1TNTA 3TO7A 3GUDA 3ERED 4ZYEA 4MTEA 4A6DA 3CUQC 4G7ZF 1OYIA 4PGGA 3WTTC 1BBYA 1ZGAA 4ENNA 2MLKA 2ZJ2A 5H6RA 3GWZA 4OIPF 2M1BA 2IA0A 4UV8A 1H0MA 2UXXA 3V7CA 1V3FA 2BEOA 1H9GA 5KK1A 1XSVA 1KYZA 2EA2A 2ADUA 1TW2A 3QPHA 4EVIA 3WGGA 1FT9A 4E70A 3D5LA 1FBQA 3VB2A 3LQQA 1R1UA 4EJUA 4Q4ZF 1USTA 1D8KA 1SFXA 3GXOA 4U0YA 4MEXF 4KMFA 2EV5A 2RC4A 1O3TA 3M8FA 1GXPA 2ZNYA 3DQVC 2CWEA 2ACJA 1EH8A 4LK1F 3U2RA 2M30A 2HKOA 1IN7A 2PFBA 1PP8F 4HDUA 4ENMA 4EGYA 4JBAA 5JI6A 2LSOA 4MNUA 3J7AO 5CYVA 1QQIA 4ASNA 1DDNA 1KQ8A 3QP6A 1P4XA 3GLXA 2HR3A 3WTUC 3JSOA 5HS8A 2VC0A 2F5EA 4KMUX 3E97A 2L3DA 2VOOA 4G94A 3FM3A 1FYMA 2ZMEB 1XGMA 5BOXA 2QLZA 1RZ4A 2K4JA 2P7VB 3BJ6A 4GYGA 5DUKA 2HDCA 3GYHX 4M6YA 3HTSB 4OIOF 1SFUA 4BHPA 5FGMA 3ECOA 1WQ2A 4XSXF 2PMUA 2ZKZA 2EFWA 2E1CA 3P9CA 1XCVA 2NS0A 1ZREA 1SD7A 4A5MA 3P7NA 2DT5A 3ZMTA 1XMKA 4OIQF 2ZBKA 4CDGA 1WWXA 5LHIA 2UWMA 1LDJA 2XVCA 3SHFA 4IRGA 4TV7A 2CFXA 1Z05A 3V4GA 4EJOA 4MQVA 2OAZA 2F5DA 5D5WB 1ODDA 5J6XA 4WXCA 1KGSA 3JSPA 2VODA 2Q8KA 3TOAA 1R00A 4ZYHA 4RB3C 1DPRA 4DQ2A 3CUOA 1XGNA 1BI3A 1BIBA 4UUVA 3P9KA 4XRFA 2EWNA 4EMSA 1HBXG 3I59B 3G3ZA 1S8NA 1E2XA 5F1RA 1XD7A 2WTEA 3T0YA 4LK0F 3HRMA 4XLNF 3EETA 4MEYF 4FX4A 2Z3YA 1I6XA 2HKXA 4YFXF 1SFEA 1XSDA 3H3UA 1J0RA 1J7KA 3KP5A 1CGPA 1F4KA 1E17A 2Z99A 2HQNA 4OIRF 2W85A 3K69A 1O7FA 5BQTA 1J75A 3IRQA 3F22A 1XN7A 4RGXA 2O6GE 2JT1A 2Q2EA 2P5KA 1R1TA 2OQRA 1BI0A 3H92A 5DDGA 2ZMEA 3BWGA 2AS5F 4R79A 3FMRA 3WE2A 2ZCWA 5ILVA 2ETHA 2QYOA 2COMA 5JHUA 4KN4X 4HX7A 2QBYB 2L4AA 3I58A 3K1MA 2ESHA 4G9YA 3AAFA 1LEBA 2OZ6A 3HIFA 4YFKF 4RS8A 2P5LC 5FB2A 4IHSA 1FSEA 2YR2A 5D4RA 1JXSA 3KLNA 4QLCU 1OKRA 2M45A 5D5VB 3HHHA 4CHUA 1T39A 1S7OA 2UZKA 1U2WA 3T1BA 1FC3A 4RAZA 1W5TA 5LEKA 3DXJF 4RB1A 2FBKA 5LBQA 4HF2A 3KP6A 1T0FA 1O3SA 1Z1DA 3FWEA 1BC7C 2IPQX 3HUGA 1W5SA 2QQAA 1FP1D 2EV6A 5ED4A 4I0AA 2V6CA 3HTUA 1H9TA 1OYYA 4JQFA 5HDKA 3TQNA 1ZG5A 5FFXA 1P92A 4U0WA 1B9NA 3ZMSA 3I59A 2QENA 3NEUA 2JTVA 3FM5A 4JK1X 3V7RA 1T2KA 2DO7A 4GYIA 4MTDA 1SD5A 3VFZA 1DP7P 2EK5A 3HSEA 2O3FA 2VBXA 3ZMDA 4WX9A 3CLOA 1ZAOA 4G6QA 4HW0A 5L3EA 1FYLA 2M87A 3C1DA 3D0SA 1LNWA 5CVJA 2KIFA 1XCBA 1IN8A 5LEJA 1B4AA 5FFZA 3L09A 2YX7A 1YS7A 2QM3A 2WC2A 4O5VA 2MA3A 2NNNA 4L5IA 4U88A 2RKHA 4LB5A 3BY6A 1Z6TA 3F6VA 5FO5A 2XAQA 1ZARA 2QBYA 4AVPA 1XDSA 2HS5A 3LFKA 2Y0MA 2E1NA 2EB7A 4FHTA 2OQGA 1P2FA 2V79A 4CO8A 3DFGA 3IC7A 2HWVA 3ZN1A 1XB4A 2ELHA 3KEOA 2FU4A 1ZLJA 5D5XB 2A6HF 4I7HA 1KA8A 4UVBA 2V1XA 2PN6A 4LB6B 5DUIA 5CVVA 3GO5A 5CLSA 2XHKA 4BYYA 3MQ0A 1YYVA 3QRFF 3H3ZA 1USSA 2XGXA 3LAPA 2O8XA 2FBIA 3LA7A 2CO5A 3ABUA 5ICFA 3J80K 4OMZA 1Z7UA 1LJ9A 1MJ9A 2UXNA 3I71A 5ICGA 2HYGD 3R0JA 2PMHA 1Y0UA 4KYWA 3U9GA 2GAUA 2DQRA 2FNPA 4BH9A 3Q9VA 2GXGA 4M9XA 2EFNA 2H09A 2RVCA 3WODF 2V1UA 3JTHA 1WRJA 2FQ3A 3E6DA 3K1NA 3IWFA 3L9FA 2LF8A 4UVCA 4N0BA 2B0LA 3BP8A 2PI0A 2L54A 1MDMB 1Z91A 3HRTA 3WTXC 4B09A 1G3TA 4ON0A 5A2QK 2A07F 2R7FA 4RGRA 4WF2A 4M74A 3WTYC 3LAJA 2KRFA 2A5YB 5H20A 3EDPA 2IJLA 3CO7C 2BBYA 2FXAA 1HKQA 5L3GA 3ZMUA 4MGRA 4AIKA 4KT5C 2XAGA 2KJCA 1UCRA 2HOEA 2EFOA 1T98A 3K0LA 2GZWA 2XKPA 5DCFA 4OINF 1LVAA 5FLXK 2GA1A 1LQ1A 4WWCA 4HX8A 5E17F 2JSCA 4A0ZA 2X0LA 3V8JA 5FLXZ 4U0VA 1UB9A 4ZZDA 3FHZA 3F23A 2DK8A 2MH9A 2L01A 2BYVE 2J5PA 2PEXA 2O61A 3QPTA 3F72A 5IT9K 2RN7A 1C0WA 3CJNA 2RQPA 3I53A 5E8GA 1R5HA 4BXUA 5F64A 2CGPA 2EJRA 3KFWX 1S7AA 1FBUA 3I64A 1W7PB 3N97A 1QBJA 1WKMA 4I0BA 2NNYA 2IW5A 1YFHA 1WSUA 4ZYGA 4BAYA 4M9SA 3ABTA 2FMLA 2EA4A 4UVAA 3FMQA 5JR3A 2EFQA 4AD9A 2A69F 1FBSA 1BIAA 3K9TA 2PQ8A 2QZ8A 3E5UA 2CQKA 3BPXA 2IA2A 1ZLKA 4G7HF 3F6OA 3ECHA 1UHWA 1W7PD 2FEZA 3KLOA 3LWFA 2H6BA 1BI1A 5IT3A 3HRUA 5E20A 2V9VA 3KP2A 4YIIA 1OMIA 4B8XA 1S6LA 2DTRA 3RJPA 1JE8A 2ZXJA 2OBPA 4HA8A 3KZYA 1XSXA 2DBBA 1GVJA 5LHGA 1D5VA 3BOQA 1O3RA 4O3MA 2FBHA 2HEOA 2KKOA 5EEGA 1ZN2A 1MDMA 4LLLA 1ZRDA 5HLGA 1CF7B 3IWZA 3DV8A 3HSFA 2LNBA 4LG0B 1IUYA 2R3SA 2KIMA 3E5XA 3ML6A 4PGHA 4A2UA 1R36A 3RTRA 4L9TA 3HOSA 2FNAA 1P6RA 1YS6A 4G7OF 3L00A 4HV5A 4P96A 4I2OA 3GZ6A 2XIGA 3GVAA 1YO5C 3L2CA 2RNJA 1K79A 4ETSA 1R5GA 2VXZA 4A0XA 3QAHA 2HQRA 2ISYA 4OOIA 5LHHA 1R7JA 2FOKA 2D45A 3EYIA 4HF0A 2XROA 4R8HA 3Q9SA 3NQOA 3J81K 1ZRFA 2JRTA 3ZPLA 3J81Z 3JAMK 1B6AA 3ZN0A 1YTYA 4AWXB 3TDUC 3COAC 3JAMZ 3SQNA 2PLYA 2W57A 4PCQA 1PDNC 1G3WA 3C18A 1U78A 2DU9A 1W7PA 2Q0OA 2H6CA 4N9IA 3HOTA 5AONA 1QPMA 2ZO4A 4RB0A 2A3SA 2DAOA 3IRRA 3HYIA 1QNTA 3O2PE 4HBLA 3W6KB 1ZH5A 3MAJA 2VONA 3ZP5A 4KFCA 2HGCA 1F5TA 3LQRA 1YW9A 3MFKA 5BS6A 2D1VA 2XV4S 3F8NA 1ONVA 2IVMA 3GX4X 4L9JA 2YU3A 4YFNF 1O3QA 3E5QA 2AXLA 2FSWA 2H94A 1WI9A 4I01A 3PQJA 2OA4A 1B1BA 3RKYA 2MH2A 4GGGA 2DPDA 5ILUA 3TKYA 5HLHA 4OMYA 3JW4A 4L9VA 3I5UA 3GW2A 1G3YA 4HF1A 2DI3A 3F8BA 2MBFA 3KEQA 3R4KA 3Q5FA 1REPC 4XLPF 5BPDA 1CF7A 4RGUA 6PAXA 4M73A 4LG0A 1QZZA 2D2WA 1J2XA 1IN5A 1IW7F 5E1ZB 3KP7A 1IXRC 3RYPA 1OR7A 3E3VA 1F9NA 1PUEE 1HKSA 2K86A 2MD5A 5J8FA 3TGNA 4L0ZB 1IXSB 4RAYA 4P9FA 3IL2A 3FXUA 3F8MA 1I1GA 1D3YA 3TDZC 2DPUA 1RNLA 2KIUA 2VBWA 4A0YA 1SD6A 3FMSA 1SMYF 1U3EM 3WTZA 5K5RA 3RKWA 1I27A 1U5TB 1STZA 5L3BA 5D6FA 4L18B 4L0YB 3WTVC 3TOBA 3FX3A 2OU2A 3SZPA 3RPQA 2EV0A 1D8JA 4LLGF 4D0PA 3ULQB 5F6FA 2M5WA 2HZTA 2Z9OA 1MJBA 3WTSC 2FRHA 1SMTA 5BMZA 2STWA 2G7HA 2GA2A 3SFZA 2BV6A 1YG2A 2DLLA 3C7JA 2HFHA 4WXDA 2LKPA 5DD4A 1G4DA 4DNCA 5HS9A 4NQWA 5EEHA 3HSRA 3C3WA 1A04A 1TTYA 1L3LA 5AIPA 3FZVA 3VOEA 4HQEA 4LFUA 4M9ZA 1P4WA 3CTAA 1IAWA 2LF7A 2RV8A 1RUOA 2ESNA 1IZ1A 1GXQA 3KETA 2NRAC 4O6JA 3DP7A 2F2EA 3GFLA 4A5NA 3MZHA 3KP3A 1KU2A 3GEZA 2VBYA 5DV5A 1TW3A 2VT2A 2FF4A 5DEQA 2FMYA 4ESFA 1DUXC 1KQ0A 5DYMA 3GFIA 3MWMA 3JTGA 1ZG3A 2ZFWA 1DPUA 2QWWA 2VN2A 4P55A 1YW8A 1EV7A 2EFPA 3WU0A 2ZNZA 4GO1A 1HW1A 1FNNA 3J80Z 3OOPA 1MKMA 3U1DA 4CXFA 3IHUA 2F5FA 2VE9A 1LDKB 1YW7A 1ON2A 3DKWA 4Y17A 4KN7X 4GXOA 4MQ9F 4KICA 4F7ZA 3QU6A 2STTA 4XSZF 1OPCA 2QUFA 4EJTA 2P8TA 3GFMA 2PBIA 3G73A 2QQBA 4BNCA 3WTWC 2FA5A 4L5JA 4PDKA 3REOA 1PP7U 3ROUA 2XUBA 4HX4A 3BDDA 1LDDA 3TO6A 2OZUA 1IN4A 3E6MA 5A2QZ 1U5TA 1LB2A 4ESBA 2NYXA 3LA3A 1I1SA 2HTJA 2DFIA 2P6TA 1T38A 4S05A 2XRNA 2L02A 3QOPA 2NAZA 1JGSA 3NRVA 4NB5A 1QO0D 4P9UA 3OV8A 3L7WA 4BQAA 4IHTA 3KCCA 3KP4A 4IPAA 3MEXA 3DEUA 1AOYA 2IT0A 1RIOH 2C6YA 2E7WA 1MZBA 4M6XA 3K2ZA 2MC3A 1HSTA 5D8KB 1LEAA 1HXDA 2XKOA 4LMYA 3SXYA 5IT9Z 1ZRCA 1BJAA 3BJAA 1HKTA 1R58A 1RI7A 5LGTA 4CGZA 1HQCA 4A6EA 1TQPA 2MLGA 5CVIA 5D4SA 4HLYA 4NHJA 1YIOA 1FSHA 2OD5A 5L3FA 3KZZA 3R61A 3EQLF 2TDXA 1BN5A 2WWYA 3WG9A 1K6OA 4G6DA 4UV9A 3DPLC 2YPRA 3R0AA 3M1EA 3LSTA 1XGOA 3VEPA 3R60A 4AIHA 2X4HA 3GFJA 5FD6A 2HYFA 1P4AA 5DCMB 2V1DA 4KDPA 4EJVA 1S3JA 5LRRA 3BJOA 1U5TC 5L3CA 1RUNA 3MCZA 5CJ9A 5LGNA 2P6SA 4IRHA 2F5CA 4EGZA 3B02A 2XAFA 2GIVA 4BHCA 5K5QA 4R1HA 3MZYA 3E6BA 2K02A 4HOBA 4M71A 4CZZA 5DD8A 5K1YA 3PFIA 4FX0A 1TLHB 5E8IA 1UFMA 1XDUA 2IA1A 1IRGA 2P4WA 2W84A 3HHGA 1X3UA 4HV6A 4KA4A 1XMAA 4YG2F 1TBXA 1NHAA 2VT3A 5LLQA 4UNOA 5D6EA 4IJAA 1R23A 5E18F 3WGHA 1FP2A 1Q1HA 3F3XA 1YLFA 5ICEA 4Q48A 3ZMZA 1FOKA 3T8TA 2QVOA 4I98B 3BROA 4Y13A 3M9AA 2Z5UA 3B73A 2JPCA 2LDUA 2CW0F 5CVUA 4ENJA 4ZH4F 2RGVA 1J59A 5CVRA 4XBFA 2YSRA 2BE5F 2DK5A 1K7AA 3FF5A 5H6QA 3ELKA 4EQQA 1L0OC 4IVNA 3RPUA 2XAJA 4IF4A 4ZYDA 4ZZLA 2KJBA 1FLIA 2D1HA 3HRSA 3M8EA 5ILSA 3EYYA 1ZYRF 1Z6RA 4IRIA 5HS7A 1JHHA 2O0YA 4Z2YA 2H27A 1QZYA 3PQKA 1IXCA 3WU1B 2JPBA 4P5OA 1U8RA 4KIGA 3QU3A 4BHBA 2P7CB 1AWCA 1EH7A 2L4MA 5LGUA 2Z33A 4A12A 3DF8A 1R22A 4ENKA 1KQ9A 1TQIA 1UHMA 1JHFA 2J5OA 1YQAA 1SAXA 3WE3A 4KIFA 4HLXA 3RDIA 4RGSA 2G9WA 5TJJA 1K78B 5DCMA 5AIQA 4HZFA 2W24A 2PJPA 2BGCA 2A6EF 3CUQB 1R1VA 4M72A 4L9NA 5HDNA 4QWQA 4AIJA 4RB2C 1T6SA 1V4RA 1BC8C 5BPIA 1MGTA 4EM2A 2A68F 3BPVA 5TRDA
chains in the Genus database with same CATH superfamily
2JN6A 4H0EA 1OLTA 3WGIA 2ZJRF 2ZSIB 1U6GA 3BTJA 2IP2A 1VTNC 2CV0A 2DODA 2Y9ZA 2WY7Q 5HNFA 3VYRB 2K27A 3DLLF 1HW5A 3RI4A 1S72I 3RIRA 4BQOA 4HSRA 1TT5B 1MNDA 2R7QA 3PUBA 5HOOA 1K83J 1WJAA 1B9MA 2CFOA 4CYDA 5J1RA 5FRNA 2G7UA 2N8GA 4Q5SF 2L0KA 1IF1A 1WH5A 2DYRH 4UY8I 5KVRA 4WK8F 1XTAA 2HDWA 2DFEA 3FXJA 4KUMA 5B1BH 2B63J 1HLVA 1IN6A 4JOMA 5IP9J 2R7WA 3CZ6A 3S2WA 1N77A 4BJ5C 2RDPA 2VC1A 3C2BA 3GZ5A 5HDGA 2GWRA 2M9HA 2FE3A 1YX5A 1ZGJA 1X19A 4LJZF 3V8LA 4CCJA 4U7BA 1HF0A 1IRFA 3SFIA 4EJWA 1FX7A 5E1XA 2XB5A 3ZQ7A 3CMYA 2Y2ZA 4IO9F 4K2EA 5D5UB 1ZG1A 4I09A 2XAHA 4U87A 3ISPA 4CICA 1BOAA 5D8LB 2CG4A 3E6CC 1TNSA 1X2MA 4U7DA 2NVYJ 2EZIA 2O5RA 1MNEA 2M8GX 4XN0A 3OS2A 1QVTA 2CUEA 3MKZA 3OIPA 3QP5A 2VKHA 5B66C 1P7IA 2CYYA 5JVTA 1OYWA 2W25A 2JUCA 1JJ6C 3OR2C 3I4PA 2X85A 1Y1VJ 3FXRA 4N4OB 3T5XA 1FIAA 1LKXA 2LTPA 4LIVA 3FXQA 5J3LA 3N4MA 2QQ9A 4WCGA 5J8CA 2XAUA 1KU9A 2DW4A 3M4OJ 1EKEA 3P9IA 4HQMA 2ZMEC 4L5EA 1ETXA 3F21A 1OCRH 2OPTA 3EUHA 3HGGA 4AM3A 4IL6C 1QGPA 2JVGA 2PG4A 3CCRI 2DMQA 1XC5A 3TO9A 2A05A 1YX3A 4WXHA 4NC8A 5FD5A 2V1NA 1FY7A 3U1KA 5KCMA 3GF2A 5GTIC 4I02A 2K3PA 5JFRA 1IGNA 1ETOA 2K4BA 2ZFUA 4FCYA 2UUZA 3BR3A 1HSJA 3CDHA 3M7GA 5HVQC 4N9HA 4X6AJ 1QU3A 4HAMA 2LBFB 1IV6A 5ERIA 2M7AA 2P5VA 4CSWA 3K1PA 1P9QC 5L3DA 1FZPB 4KIBA 1SD4A 1MBEA 3GMEA 2R7UA 3DPTA 3R6SA 2ZXHA 4BXXJ 5HODA 4ESJA 3VYSB 4F52A 1J9IA 3F8FA 1G2HA 3PO2J 2EPFA 4I76A 1K78A 1SANA 3EUAA 2OTLI 2DN0A 3M8JA 3O3KA 1FYKA 2LFBA 3LSPA 3L2UA 3IKTA 4FT8A 4QPQA 4S04A 3PUFA 2CSOA 4RAFA 3CUQA 5K5OA 4YELA 2V7FA 2DQLA 2ISZA 3CJTB 2H1KA 3T8RA 2HXIA 4FETA 4Q47A 2E1MB 3MKWB 2FX0A 2ID6A 3I0TA 1R4MB 1Y56A 2XASA 3FXKA 4D1QA 2E2JJ 4MFEA 4IHXA 4KNYA 3Q0VA 3F8CA 1MMNA 2XPWA 4IXAA 3RKXA 1S29A 1ULYA 1BM9A 4LD5A 4EM0B 1XMXA 2HOSA 3UR3C 1EJ9A 3HG9A 1J5YA 2CQ7A 2DOAA 2JVHA 4XRSA 2GXBA 4G8XA 3JRAA 1B59A 1GHCA 3O6BB 1U9NA 4UXNA 3I4NJ 3QYBA 3VODA 3K6GA 3ZMVA 1R49A 3AKZA 1MD0A 3I54A 5LRSA 2ZJPF 4A3MJ 2KHMA 2O03A 3H0DA 2VBZA 2Y75A 3S2HJ 1GV5A 4FISA 4OU0A 4UHTA 3CO6C 3S16J 1BI2A 1G6NA 2JZYA 1MJAA 2VE8A 3H5AA 2CV2A 2IRFG 4PJNA 3KYLA 5ICCA 1DGWY 3V8KA 4EM1A 3K4BA 4XLCA 2M8EA 3GTJJ 1OQYA 5E1WA 1KYWA 2PMZA 2E7XA 3GLLA 4LLNA 4MHGA 4FASD 4YIFA 4EEFG 2GQQA 3KE2A 5HLIA 2R7RA 2VJ4A 3BZ6A 2R7DA 2YX4A 4H4KC 1XGSA 4PZJA 4B43A 1ON1A 2JUGA 3FBIB 3OYFA 2ZXWH 3JRHA 1F1ZA 2WV0A 1HW2A 3GTPJ 3LA2A 1KU7A 1FPQA 3EUHC 1W4MA 1I5ZA 1IRXA 1VF9A 5CQEA 3RYRA 4BE0A 1Z9CA 3W6JB 2IEKA 4LITA 1W0UA 5GP9A 4HYEA 5EGOB 4EV0A 1JKPC 4Y15A 3SZTA 1TQMA 4LGWA 1MMAA 2A61A 2ME6A 3L2RA 3CCQI 3K4CA 1Y39A 1Q1VA 5J47A 1HA8A 4GCVA 3CCVI 2Z2SB 2Y48A 1O7LA 1ZHFA 1FWZA 2HTSA 3V7SA 1WPKA 1VQOI 1B72B 5FROA 5KNLA 1KU3A 3ZQCA 3CMEI 1EH6A 5F04A 2JSPA 4HDVA 2IXSA 3PJRA 4XOTA 2VOPA 2K7LA 3JCUC 2XF6A 4DW6A 1G3SA 1O57A 3S2DJ 2IS2A 3IKVA 1ZKGA 1TNTA 1ETVA 4NUBA 5B1AH 1OCTC 3RZOJ 5E79C 2H8RA 2JK3A 3TO7A 3MN2A 2V9KA 2QQ8A 3GUDA 3DEEA 3ERED 4ZYEA 2X48A 2NVQJ 2XGEA 2KZVA 4MTEA 3UNGC 3VDXA 2BY1A 4E7ZA 1RETA 4A6DA 3CUQC 4G7ZF 5KAFC 1OYIA 3BG9A 5K7ZA 2R7SA 4XLAA 1IUFA 2K85A 4PGGA 4XK4A 3HOWJ 3WTTC 1BBYA 1I3QJ 1ZGAA 4ENNA 2MLKA 2ZJ2A 1WCMJ 5H6RA 3GWZA 3DEWA 1POGA 4OIPF 2M1BA 1YRNB 3HDDA 3OIOA 2IA0A 4UV8A 2E5ZA 1H0MA 2UXXA 3V7CA 1V3FA 2BEOA 1H9GA 5KK1A 5IYCJ 1Y8QB 2VPRA 2LRDA 1XSVA 1BL0A 1KYZA 2EA2A 1R9TJ 4BE1A 2ADUA 1TW2A 3QPHA 4EVIA 3WGGA 1FT9A 2R4GA 4E70A 3D5LA 1BJZA 1FBQA 3VB2A 2LBFA 3VYUB 1BW5A 2COBA 3LQQA 1R1UA 1X1PA 4XKBA 5FKOA 4EJUA 4Q4ZF 4B48A 2XGCA 5FKKA 3TL4X 1G59A 1USTA 1D8KA 1SFXA 2MD0A 1A5JA 3GXOA 2DMNA 4D5FA 4U0YA 3KPHA 4MEXF 4KMFA 2EV5A 2RC4A 3ZOBA 1O3TA 3CF5F 3OYLA 3M8FA 3QOEA 1GXPA 2ZNYA 3DQVC 2CWEA 2ACJA 4XQFA 3DPUA 1EH8A 4LK1F 3U2RA 4PFPA 3ERMA 4XIDA 1JGGA 2RQQA 2M30A 2HKOA 1IN7A 2EZKA 2PFBA 1PP8F 4HDUA 4JBAA 4EGYA 4ENMA 5JI6A 3EPZA 3OYAA 5FKLA 2LSOA 4P1WA 4MNUA 3J7AO 2VJIA 2R92J 1ETYA 1SVMA 4KT6A 5CYVA 3NAUA 4D5CA 1QQIA 2H1LA 4ASNA 1DDNA 1KQ8A 3QP6A 1NK3P 1X1CA 2RAEA 2NOGA 3DTIA 2X6OA 1P4XA 3GLXA 2Q2EB 2HR3A 3WTUC 3JSOA 5HS8A 2QCOA 2VC0A 5HLTA 2F5EA 3L1PA 3H1CA 4J01A 4KMUX 3PL8A 3E97A 3CCEI 2L3DA 2VOOA 1A6IA 4G94A 3FM3A 3V42A 1FYMA 2NS8A 2FUG2 2ZMEB 1XGMA 5BOXA 2QLZA 3K70D 4RLFA 2L7FP 4DYQA 1RZ4A 2K4JA 3X2QH 2P7VB 5DM6F 1S7EA 1U0JA 3G71I 1EF4A 4Y33A 3BJ6A 2VPLA 1MW7A 4GYGA 1SVOA 5DUKA 2HDCA 4LOCA 3GYHX 2TCTA 4E4HA 5EGOA 4M6YA 1IV8A 3HTSB 4OIOF 1SFUA 1UG0A 1HC8A 2LH9A 3FKIJ 4BHPA 4XKVA 2BXZA 5FGMA 2HOTA 3ECOA 1WQ2A 4XSXF 4BS9A 2PMUA 2ZKZA 2CUZA 2EFWA 2CW8A 4M3EA 1B72A 2E1CA 3P9CA 1XCVA 2NS0A 2KQRA 2Y0SA 3H0GJ 1ZREA 1TL8A 4A3BJ 4B1RA 3CCLI 1SD7A 5BNGA 4A5MA 2K5CA 1QA6A 2WA0A 1LFPA 3P7NA 2LKSA 2DT5A 2MFZA 3ZMTA 1DU0A 1X4PA 3LSMA 1MIJA 2I10A 2EQRA 2BVLA 4RM2A 1XMKA 4OIQF 2EZLA 2ZBKA 1JJ8C 3L2QA 4CDGA 2MC4A 2Y31A 1WJBA 2M0CA 1WWXA 4CUGA 5LHIA 5J4YA 4XNFA 2UWMA 1LDJA 2K9QA 2XVCA 3SHFA 4IRGA 4ZYAA 3HC7A 4IQ4A 4IHWA 4TV7A 2CFXA 2E1MC 1Z05A 3V4GA 4A3JJ 5M5YJ 3VYTB 3DTKA 2W7NA 1D0ZA 4EJOA 4MQVA 3CC7I 2W4SA 2OAZA 3RZDJ 1YRNA 1LVKA 2F5DA 3HUGB 4NBQA 2L5QA 1ODDA 1T08B 5D5WB 4JYKA 1BR4A 5J6XA 3DWLE 4WXCA 1KGSA 2Y30A 3JSPA 4RLQA 2VODA 2XPVA 2Q8KA 3TOAA 1R00A 4ZYHA 4RB3C 1DPRA 4DQ2A 2FJ1A 2CRGA 3CUOA 4AU7A 1XGNA 1BI3A 1BIBA 1VQLI 2EBIA 3QQAA 5F0CA 1W36D 4UUVA 1BW6A 2IAIA 3P9KA 4XRFA 2ECBA 5EDNA 2LKXA 2EWNA 1H88C 4C2TA 4EMSA 1HBXG 2KP6A 3I59B 3A4CA 2V6EA 3E7LA 3G3ZA 1S8NA 1V54H 1E2XA 5F1RA 1U8BA 1XD7A 3FXOA 5E3NA 2P81A 1Z77A 2WTEA 1MBKA 3T0YA 4LK0F 3BTIA 3HRMA 4XLNF 1VQ9I 2NVTJ 3EETA 1X1BA 4MEYF 4FX4A 2Z3YA 1I6HJ 1RPWA 4BJ6C 1I6XA 3PNTA 4A3EJ 1Z3XA 3K7AJ 2HKXA 4YFXF 5EYRA 1SFEA 2XB0X 4YRVA 1XSDA 3H3UA 2KDZA 1J0RA 1J7KA 3KP5A 1CGPA 1NK2P 1F4KA 2CUFA 1E17A 2Z99A 5F08A 2HQNA 3LSKA 2W85A 3K69A 4OIRF 1O7FA 2X6YA 5BQTA 2NOJB 4DIQA 2E19A 3TMOA 5GAGJ 1J75A 3IRQA 2ELKA 2O9LA 3F22A 1XN7A 4RGXA 2O6GE 2JT1A 2Q2EA 2FD5A 2LG4A 2P5KA 3WG7H 1R1TA 2OQRA 3W2VA 1BI0A 3H92A 3GTGJ 3BLYA 3ZQGA 3S17J 2ZC2A 3JRBA 4W1UA 1JUMA 3H9QA 3HKZN 2ZMEA 3BWGA 5DDGA 2L7ZA 1NTCA 2AS5F 4R79A 4CCOA 3FMRA 3WE2A 2H8WA 5FLVA 2ZCWA 5ILVA 2ETHA 2QYOA 3OR1C 2COMA 5JHUA 4KN4X 4XLEA 4HX7A 3RKQA 2QBYB 2L4AA 2E35A 3I58A 5LFAA 4KJZA 3MKYB 3K1MA 4E6KG 3I56I 2ESHA 3OY9A 4G9YA 3AAFA 3MVPA 1RESA 4E7JA 3VWBA 1Z21A 4M3BA 3TW7A 1LEBA 2OZ6A 2CQQA 3HIFA 3NWSA 2AQFA 4YFKF 4RS8A 3JRDA 4B3AA 2P5LC 2IS1A 5FB2A 3IAM2 1XS9A 4IHSA 1FSEA 1R4NB 3B6CA 4A3CJ 2YR2A 5D4RA 1JXSA 3KLNA 3HOXJ 4PJ0C 2DXIA 4QLCU 2KMUA 1OKRA 2M45A 2O7OA 2WAQA 1IC8A 1QRYA 3JREA 4RA2A 2MABA 4BL0B 1JUSA 3A0HC 5D5VB 3HHHA 4CHUA 3OSGA 1S7OA 1T39A 3GTLJ 2UZKA 1ITYA 1U2WA 2E71A 3T1BA 2VQGA 1FC3A 4RAZA 3AG1H 3WHBA 2AXTC 3S93A 3N05A 4JX5A 1W5TA 5LEKA 3DXJF 4RB1A 3IV5A 3K70C 3I55I 2FBKA 2KDOA 5LBQA 4HF2A 1JKQC 3KP6A 2G0EA 1T0FA 1O3SA 1Z1DA 3FWEA 4PSXA 3BT9A 1BC7C 2IPQX 3HUGA 2LY1A 1W5SA 2LP0A 2QQAA 2BHZA 1FP1D 2DA6A 2EV6A 4PJJA 2E36A 3WU2C 5C4XJ 3CDIA 5ED4A 3FISA 3PM1A 1JTXA 1F36A 1S9HA 2V6CA 2PX9A 4I0AA 1QPIA 3HTUA 1IDZA 4UUSB 1VQNI 1GVDA 1H9TA 1OYYA 3D1NI 3HOUJ 4AYBN 4JQFA 5HDKA 3TQNA 1ZG5A 5FFXA 1P92A 1NG6A 4U0WA 1B9NA 1Z0XA 3ZMSA 3I59A 3VSKA 1ENHA 1GDTA 2B7EA 2QENA 3NEUA 5GAHJ 3FHNA 2OV7A 1B8IB 1W0TA 4II2A 2EIKH 2JTVA 1JI8A 1T33A 3FM5A 2WAEA 4JK1X 3V7RA 2A5WA 1T2KA 2DO7A 4GYIA 2BZTA 2E2HJ 3HPHA 4MTDA 3DKXA 5TISC 1SD5A 1I39A 3VFZA 3FK7A 1DP7P 2EK5A 1VQKI 4RM3A 2YS9A 4QSHA 3W2WA 3OWTA 3HSEA 3ZQHA 2O3FA 2ZXIA 2VBXA 3ZMDA 4WX9A 1Y1WJ 4E7KA 3CLOA 1ZAOA 3OYKA 3RCOA 3H5NA 4G6QA 2DOEA 4C3IJ 4HW0A 2OCEA 3E0JB 5L3EA 1FYLA 2M87A 3C1DA 3D0SA 2LY9A 1HDDC 1LNWA 5CVJA 3WHCA 3CCMI 2KIFA 4JX6A 3SJMA 1XCBA 1TWHJ 1ZELA 1IN8A 1CQTA 1WVRA 5LEJA 1X1AA 2VASA 1B4AA 5LD2C 5FFZA 1FEXA 3L09A 2YX7A 3HOYJ 2M3AA 1YS7A 1N75A 3GTOJ 2KZGA 2QM3A 2WC2A 1ZK8A 4O5VA 3M1CA 3TEDA 4XMYA 1MBJA 1W36C 2MA3A 2NNNA 4L5IA 4U88A 4BJTA 2RKHA 4LB5A 3RQIA 4BDZA 3BY6A 2CV1A 1Z6TA 3F6VA 1D5YA 2VXDA 4BBSJ 3CP8A 5FO5A 4ZDLA 2XAQA 4HSTA 1ZARA 4C3JJ 4BY1J 2QBYA 4AVPA 1T0FC 1GUUA 1HDPA 1XDSA 3ZQQA 2HS5A 3LFKA 4C30A 2F48A 2E1NA 2Y0MA 5GAEJ 1GT0C 3CF2A 2AHQA 2EB7A 1WJFA 2OQGA 1BOBA 4FHTA 4V2GA 1P2FA 2E60A 2V79A 4CO8A 1E0EA 1HOMA 2KRHA 3DFGA 4HG2A 3IC7A 2HWVA 3ZN1A 1XB4A 2ELHA 3ZCOA 4ITVA 2JWTA 3KEOA 2M34A 2FU4A 1ZLJA 2OF7A 2A6HF 4I7HA 5D5XB 3SDBA 1E3HA 1TP4A 2GLOA 2EH3A 1KA8A 4UVBA 5JLWA 5HNHA 2V1XA 1D1BA 2PN6A 4LB6B 4KISA 5DUIA 5CVVA 4FTHA 3GO5A 5CLSA 2XHKA 4BYYA 3MQ0A 4IZZA 1YYVA 2YU9J 3QRFF 3HBLA 2MSYA 2BHYA 3LSHA 3H3ZA 5EF6A 1RKTA 1USSA 1R6RA 2XGXA 3LAPA 2O8XA 1OCCH 2VQHA 3CCJI 2FBIA 3LA7A 3ABUA 2CO5A 2QKLB 2X51A 5ICFA 4OMZA 1Z7UA 3J80K 1LJ9A 1MJ9A 2UXNA 1Z67A 5KAIC 1O4XA 2GM4A 3I71A 5ICGA 2HYGD 3K4MA 3R0JA 1RRJA 2PMHA 1Y0UA 5JHFA 4KYWA 3U9GA 3TW6A 2RREA 3AG2H 2GAUA 2DQRA 3ESWB 2TRTA 2FNPA 3KEYA 4BH9A 3PSFA 3Q9VA 2LREA 2GXGA 4M9XA 1VQ4I 2LYCA 2XF7A 1P7JA 2EZHA 2JQ7A 2EFNA 2H09A 2RVCA 3WODF 3S3OA 3JTHA 1WRJA 2V1UA 2HDDA 2XRLA 2E5NA 4E7HA 3HOVJ 5H2FC 2XSJC 2ZJQF 2HQAA 2FQ3A 3E6DA 3K1NA 3OYDA 3IWFA 3FXMA 4UUSA 3L9FA 2LF8A 2VKDA 4UVCA 3G1OA 4N0BA 2IGMA 2B0LA 3BP8A 2PI0A 2DYSH 2L54A 1MDMB 3Q0WA 1Z91A 1IO2A 3HRTA 4BGDA 1LUJB 3WTXC 4B09A 2X1EA 3CMAI 1MBHA 1G3TA 2BY2A 4ON0A 5A2QK 3OYBA 2A07F 2R7FA 3IH3A 4RGRA 2R5ZB 1PUFB 1B8IA 3O8HA 1E3PA 4WF2A 4M74A 4Y7NJ 2M4KA 3WTYC 3S1RJ 3LAJA 1U9OA 2KRFA 4HEA2 3MZ8A 2HYJA 2A5YB 3BQYA 5H20A 2M0MA 1QVUA 3EDPA 3BG6A 2IJLA 2KISA 3CO7C 2BBYA 3ZQFA 2FXAA 1HKQA 5L3GA 3ZMUA 5DM7F 4MGRA 3BZKA 4AIKA 4KT5C 2XAGA 4CYCB 2KJCA 3SEQA 4M3DA 1UCRA 2HOEA 2KIQA 4BQNA 2EFOA 1T98A 2OC6A 3K0LA 2GZWA 3LFUA 2XKPA 1VQ5I 5DCFA 4OINF 1LVAA 5FLXK 4XL9A 1Z3YA 2GA1A 1LQ1A 4WWCA 4HX8A 1H8AC 1ZR2A 5E17F 2JSCA 2HOAA 5FKMA 2X0LA 4A0ZA 3V8JA 5FLXZ 4U0VA 1QHGA 1UB9A 2JRMA 3K4KA 4ZZDA 1WZ2A 3OSFA 3FHZA 3ZGKA 4BQQA 3F23A 1SFOJ 2DK8A 1IDYA 2MW8A 2MH9A 2L01A 2BYVE 2J5PA 3J7ZI 3JRFA 2PEXA 3BTLA 3OYHA 2O61A 1LE8B 4M6VA 3ZRGA 3UKGA 2PJRB 1W5CC 3QPTA 3F72A 5IT9K 1XX5A 2RN7A 1AA7A 3SEZA 1BA5A 1C0WA 3CJNA 3S8PA 2RQPA 3I53A 5E8GA 1R5HA 4BXUA 5F64A 1ZR4A 2CGPA 3AG4H 5KHDA 2EJRA 3KFWX 3OYJA 1YOVB 1S7AA 2OJED 1FBUA 4E7IA 3I64A 1W7PB 1D1AA 2X9DA 3N97A 1QBJA 3BR6A 3ASNH 1WKMA 4I0BA 4ZTFA 3K4LA 3G6EI 1GV2A 2NNYA 4Y4RA 4E7SA 2IW5A 1YFHA 2NVUB 3KIOA 1WSUA 4A93J 1YJWI 4ZYGA 4MLOA 4BAYA 4M9SA 2DA1A 2VIXA 1LFBA 3ABTA 2FMLA 2EA4A 4UVAA 3FMQA 5JR3A 2EFQA 3B6AA 4AD9A 2CMPA 5J4VA 2A69F 2A6TA 1FBSA 1BIAA 1KONA 9ANTA 3K9TA 2PQ8A 2LC2A 2QZ8A 3E5UA 3GBGA 2CQKA 2E1OA 3BPXA 2IA2A 1BR2A 1ZLKA 4G7HF 2V4JC 3MD2A 3H3VK 3F6OA 4J00A 4RAGA 3S1MJ 3ECHA 5M3MJ 3GZNB 2R7ZJ 1UHWA 1MSFC 1W7PD 2FEZA 4CCMA 1TWCJ 1WJ5A 3KLOA 4BXFA 1R71A 3LWFA 3H35A 3PNYA 2H6BA 1BI1A 1Y6IA 2HU9A 2UV1A 5IT3A 3TBIA 1ZTRA 3HRUA 4UUTA 5E20A 2W48A 2V9VA 3KP2A 4YIIA 4F92B 1OMIA 4B8XA 3HXLA 1S6LA 2DTRA 2M2EA 3RJPA 5B5EC 1JE8A 2ZXJA 2OBPA 4HA8A 4OWRB 3KZYA 1XSXA 2DBBA 3BG7A 1GVJA 5LHGA 1D5VA 2CU7A 1ORKA 2KRCA 2JA8J 3BOQA 1O3RA 4O3MA 2V9PA 1ETQA 2FBHA 3HZJA 2HEOA 2KKOA 3FIWA 5EEGA 5IOYA 4Y3OA 1ZN2A 1OISA 3S1NJ 4DBRA 1MDMA 4OAZA 4LLLA 3KYCB 3CJRB 4XM3A 1ZRDA 1SEUA 5HLGA 1CF7B 3IWZA 1YHQI 3ONQA 5FRMA 3DV8A 1JUPA 2DMPA 2LNBA 3HSFA 4LG0B 1IUYA 2R3SA 2KIMA 3E5XA 2R5ZA 1PUFA 3ML6A 4AVZA 4PGHA 3OYMA 3CQZJ 2VJJA 4A2UA 1R36A 3RTRA 4L9TA 3HOSA 2FNAA 3EUKL 1P6RA 5IPAA 1YS6A 4BU2A 3FXLA 4XRSG 2ME0A 2DOFA 3L00A 4HV5A 1V5FA 4P96A 4DZJA 4I2OA 4G7OF 3PSIA 3GZ6A 2XIGA 2F4IA 3BG3A 3GVAA 1YO5C 1TT0A 4CYCA 3L2CA 1Y0NA 2DA2A 2RNJA 1K79A 1S5LC 4ETSA 1R5GA 2VXZA 4A0XA 3OYCA 4YEJA 2L9RA 3QAHA 2HQRA 2ISYA 2CQXA 4OOIA 1IG7A 1OCOH 5LHHA 1R7JA 2FOKA 2K9SA 2LMDA 1X58A 2D45A 5EZHA 3EYIA 4HF0A 2XROA 1VZ0A 4R8HA 2XGDA 3Q9SA 3NQOA 3J81K 1X1DA 4YIRX 3W6VA 1TWGJ 3CJQB 1T56A 2R7OA 4XOPA 3CC2I 1ZRFA 2W00A 5J1YA 3AL0B 2JRTA 3ZPLA 3VPRA 3J81Z 5M5XJ 3JAMK 1B6AA 3ZN0A 1YTYA 4AWXB 2KPMA 2RNGA 2QEXI 3TDUC 1JKRC 1K6YA 3COAC 4A3IJ 1TWAJ 3JAMZ 3FK6A 3I3LA 1LE8A 2PJRA 3SQNA 4XRMA 2PLYA 2W57A 4PK4A 4PCQA 3OYGA 2HPIA 2KL4A 2HVSA 4X1EA 5GPCA 2BW3B 1PDNC 1UZCA 3KX2A 2MG4A 1G3WA 3CLQA 2Y69H 2IBDA 5K7HA 4QPOA 3C18A 2OUMA 1U78A 2BVMA 2DU9A 1W7PA 2Q0OA 3S1QJ 4I6ZA 4C2UA 4B47A 3M3YJ 1VQ8I 4JP0A 2EILH 2H6CA 4N9IA 4S0HB 3HOTA 5AONA 1QPMA 1WFXA 2ZO4A 4B44A 4RB0A 2A3SA 4IHVA 2CS3A 2L7KA 2DAOA 3IRRA 3HYIA 1QNTA 3O2PE 2VKVA 3H9JA 4HBLA 3W6KB 4GDFA 2R7VA 4NQWB 1ZH5A 2IGKA 3MAJA 3L2VA 4E7LA 1GLNA 5F1JA 4A3DJ 1WJEA 4N4NB 2I5UA 2VONA 4AYBA 5B3SH 3ZP5A 4KFCA 1FTZA 2HGCA 3OMYA 1F5TA 3CDLA 3G1LA 3LQRA 5GTHC 1YW9A 3MFKA 2L9SA 5GPAA 3RQ4A 5BS6A 2D1VA 2KLOA 2XV4S 3F8NA 2QSHX 1ONVA 2IVMA 3GX4X 4L9JA 3BR0A 1DQUA 2X1DA 2DA7A 4BKXA 4HPQA 2YU3A 4YFNF 4QTRA 1O3QA 2WB1N 3E5QA 4ZJZA 3H9GA 2AXLA 3Q3SA 1ZQ3P 1SVLA 2FSWA 4C3HJ 2H94A 1MSEC 1WI9A 2HQ5A 1QZEA 2DA3A 2F4MB 1H89C 1TZLA 4ZDPA 2JA7J 1FOYA 3PQJA 2OA4A 4I01A 1YJNI 1RR7A 4IQJA 2R7XA 2BY0A 1B1BA 3A1YA 3RKYA 3S32A 2MH2A 2HI3A 4RDUA 4GGGA 4M3FA 2DPDA 4HNVA 2WV1A 1VNDA 3TKYA 5ILUA 5HLHA 5F0HA 4OMYA 3JW4A 4L9VA 3I5UA 3GW2A 1G3YA 1BR1A 4AC0A 4HF1A 2DI3A 1D0YA 2MBFA 3F8BA 2XPUA 3KEQA 3R4KA 3Q5FA 1REPC 4XLPF 5BPDA 1CF7A 4RGUA 6PAXA 2I8DA 4M73A 3BCBA 4PFOA 1X3ZB 2D5VA 4LG0A 3A02A 1QZZA 2D2WA 1LFUP 4CCLA 1J2XA 4A3KJ 3HM5A 1IN5A 3BTCA 4D7MA 4HNUA 1IW7F 5E1ZB 3KP7A 2DJIA 3BZCA 1IXRC 3RYPA 1OR7A 2DT6A 4HRIA 3E3VA 1F9NA 1PUEE 3GTMJ 1MMGA 3DU6A 1HKSA 2K86A 2MD5A 3K4NA 2DDAA 5J8FA 1NH3A 2W82A 4C2MJ 1G8XA 1MH3A 3TGNA 4CH7A 2VUMJ 1FJLA 1IXSB 4L0ZB 4CZCA 2CW7A 2XC7A 1JT0A 2LY2A 4RAYA 4P9FA 1IJWC 3IL2A 4MO7A 2HNHA 1AHDP 2GIZA 3FXUA 3F8MA 1I1GA 3H36A 1D3YA 3DBHB 3TDZC 3A0BC 4XN3A 5FLMJ 2DPUA 1RNLA 5M3FJ 2KIUA 2VBWA 1TWFJ 4A0YA 1SD6A 1YIJI 2DFFA 3FMSA 2JA2A 1SMYF 1U3EM 5GADJ 3ZXSA 3WTZA 5K5RA 3RKWA 1I27A 3J7AY 1U5TB 1STZA 1WI3A 2DCEA 1DGRM 3SYTA 5L3BA 5D6FA 4L18B 4L0YB 3WTVC 3TOBA 3A2KA 4UB8C 3VSLA 1ETWA 2VQLA 3FX3A 2K9MA 2OU2A 3SZPA 2L7MP 3QWLA 4XORA 2EV0A 3RPQA 4AIDA 1D8JA 3K4JA 5IP7J 4LLGF 2BW3A 4D0PA 1MMSA 3ULQB 4DYRA 5F6FA 2M5WA 2HZTA 3LNQA 4RBOA 2Z9OA 1MJBA 2QA4I 4Z6YA 2KFDA 3WTSC 2FRHA 1SMTA 5BMZA 2STWA 4PSWA 3QPLA 2G7HA 2GA2A 3M07A 3SFZA 2BV6A 1YG2A 2DLLA 3C7JA 1ETKA 2HFHA 3QODA 4WXDA 2K3FA 2LKPA 5DD4A 2R7TA 1UELB 4FE4A 3TP0A 1G4DA 1DP3A 3BR1A 2IGOA 2B9SA 4DNCA 3OS0A 2VJ5A 5HS9A 2V26A 2L2OA 4NQWA 5EEHA 1UG2A 2WAQN 3HSRA 1X4OA 3K10A 3CP2A 3C3WA 1SC7A 3O8GA 1A04A 3LSIA 1TTYA 1L3LA 4NC7A 5AIPA 3FZVA 1RKWA 2ZB9A 3VOEA 4HQEA 3HEFA 3DU5A 4LFUA 2AO9A 4M9ZA 1K4SA 1P4WA 1FTTA 1YI2I 3CTAA 4F55A 1IAWA 4IHYA 2LF7A 2RV8A 1RUOA 2LD5A 2ESNA 2CJJA 3SZGA 4Y52J 1OR7C 4LG3A 4MIMA 1IZ1A 3S3MA 2HVQA 1GXQA 3KETA 2NRAC 4O6JA 1D1CA 3DP7A 2F2EA 3IH4A 2JJ7A 4W97A 2DT7B 1EA3A 3GFLA 4A5NA 1ACIA 1FIPA 3MZHA 3KP3A 1KU2A 3GEZA 5IY5H 5EJCA 1X2NA 2VBYA 5DV5A 1TW3A 4QIWN 2VT2A 1V55H 4XR6A 4GFBA 1QHHD 1M1EB 2X6WA 2MGQA 2Q1ZB 2FF4A 1MBGA 3AG3H 4NNJA 5DEQA 2FMYA 2F5VA 1WJCA 3CD6I 1OCZH 2KT0A 4ESFA 3DKYA 2GOMA 3KYDB 1DUXC 1KQ0A 5DYMA 3GFIA 3MWMA 3AL0C 3JTGA 4D9JA 1ZG3A 2ZFWA 1DPUA 2QWWA 2VN2A 3LSGA 1YW8A 3BR2A 1XG1A 4P55A 4DBQA 2E2IJ 1WJDA 1EV7A 3DTEA 4PJMA 4DOZA 5K7FA 3PIPF 2FQ4A 2EFPA 4IX7A 1OCPA 3WU0A 2ZNZA 4GO1A 1HW1A 4ABZA 1FNNA 3J80Z 3OOPA 5CKTA 1MKMA 2VQCA 2WBMA 3U1DA 1VQ7I 2NS7A 2P0WA 4CXFA 3IHUA 2F5FA 1APLC 4F93B 2VE9A 3BG5A 2LLKA 1LDKB 1YW7A 1ON2A 3DKWA 5EG0B 4IEJA 4Y17A 2XSDC 4KN7X 4GXOA 5F27A 4AUXA 2HPMA 4MQ9F 4D7NA 4IOAF 4KICA 4M3GA 1JTYA 3QPSA 4F7ZA 2R5YB 3QU6A 2STTA 4BUPA 4XSZF 1OPCA 2QUFA 3GCMA 1VQPI 2P8TA 3BR5A 4EJTA 2K9LA 2R93J 5CQGA 3GTKJ 4J19A 3D5RC 1I50J 3U21A 4A3FJ 1W1WE 1JT6A 3GFMA 2Z16A 2PBIA 3G73A 2QQBA 4HNTA 3D5SC 4BNCA 3OIQA 4B3XA 3WTWC 2FA5A 2DDBA 2E34A 5F0FA 2MYSA 1Z7LA 3ZR8X 2F4OB 3DCFA 4L5JA 4PDKA 3REOA 1PP7U 2X6XA 1A35A 2QKMB 3RSNA 3ROUA 2XUBA 4HX4A 3BDDA 1LDDA 3IUOA 1RC9A 2OZUA 1IN4A 4XKCA 3TO6A 3A01B 4II3A 4BDYA 1N25A 3E6MA 5A2QZ 3I4MJ 1U5TA 2VLAA 5JVGF 2JA5J 3F9KA 1LB2A 3HPGA 4C9YA 2LK2A 4ESBA 3GTQJ 2NYXA 3JRIA 4FE7A 3LA3A 5FJ8J 1I1SA 3AFHA 3JRCA 2HTJA 2DFIA 2P6TA 4BY7J 3OS1A 1PVEA 2ICWG 1T38A 3F0CA 2YUSA 4JX4A 4S05A 2IS4A 2XRNA 2L02A 3G2BA 3QOPA 2NAZA 3LL7A 1JGSA 3G1MA 3NRVA 3OYIA 4NB5A 1QO0D 4P9UA 3OV8A 3L2WA 4ZTJA 3L7WA 4BQAA 3CCUI 4ANJA 2Y9YA 1ZGWA 2QSGX 4IHTA 3KCCA 2DFHA 3DLAA 4BE2A 4DYCA 3KP4A 4IPAA 3MEXA 1SAUA 3DEUA 1AOYA 2PMZN 2IT0A 1VI0A 1UMQA 4NC6A 3CCYA 1RIOH 2C6YA 2E7WA 4PUSA 1MZBA 4M6XA 1ERDA 3K2ZA 1XPXA 2QSFX 2EINH 2MC3A 1LPQA 1HSTA 5E3OA 1UJ8A 4EATA 5D8KB 3G4SI 1LEAA 4F91B 1I3AA 4XONA 1HXDA 2XKOA 1T8IA 4LMYA 3LSRA 3SXYA 5IT9Z 1ZRCA 1BJAA 3BJAA 5J40A 1HKTA 1R58A 1D0XA 1RI7A 5LGTA 4CGZA 1HQCA 3P5JA 4A6EA 3OL4A 1TQPA 2MLGA 5CVIA 5D4SA 4V2FA 4HLYA 4NHJA 4RMNA 1YIOA 3LMMA 1FSHA 2M7BA 2OD5A 3BQZA 4A69C 5L3FA 1AKHB 1OJLA 3KZZA 1IRZA 3RPUD 3R61A 1VQ6I 2ZSHB 3EQLF 2ID3A 2HVRA 1UHSA 2LVSA 2TDXA 4KITB 1BN5A 3J7YJ 2WWYA 1YITI 1WGXA 3WG9A 2JMWA 2Z1DA 1K6OA 3ASOH 4ZDOA 3MKLA 2DJNA 4G6DA 3PNVA 4UV9A 3DPLC 2YPRA 3LOCA 3R0AA 4BEHB 3M1EA 3LSTA 1XGOA 3VEPA 5EEAA 2HZDA 3R60A 4AIHA 2X4HA 3GFJA 2DA5A 5FD6A 1TC3C 2HYFA 1A36A 1J09A 1P4AA 4PJLA 5DCMB 2CUJA 2V1DA 3S3NA 2JA6J 2NVXJ 4KDPA 4EJVA 1S3JA 1WHUA 5LRRA 2GBYA 3BJOA 2W1OA 1U5TC 5L3CA 1RUNA 1T95A 5DTDA 5M5WJ 4OAYA 3MCZA 5CJ9A 4F3QA 5LGNA 2P6SA 2EIJH 4IRHA 2F5CA 2AQEA 3C2GA 1V5GA 1PYVA 4EGZA 3B02A 2XAFA 1RR8C 2GIVA 4BHCA 5K5QA 1V5EA 2IGNA 4R1HA 2R0QC 3MZYA 3E6BA 2K02A 4HOBA 4M71A 4CZZA 5DD8A 5K1YA 3PFIA 4DGWB 4FX0A 1TLHB 4ZC3A 4BACA 3QYEA 3IAS2 5E8IA 5J1UA 1UFMA 5EG0A 3K2AA 2K40A 3IH2A 1XDUA 2IA1A 1IRGA 1MBFA 1HCRA 2VL8A 2R5YA 4G12A 1X3WB 3ZQLA 2P4WA 3FBNB 1NG7A 2W84A 2WY8Q 3HHGA 1X3UA 3FDYA 3ABKH 4HV6A 1XMAA 4KA4A 1UAAA 4YG2F 3JR9A 3CESA 5IYBJ 1TBXA 1SFKA 5C44J 4CCNA 1NHAA 3NWTA 2VT3A 5LLQA 4UNOA 4CA0A 5D6EA 3HKZA 4IJAA 1R23A 5E18F 3WGHA 1FP2A 1Q1HA 3A01A 1VFCA 3FKJA 3F3XA 3PFYA 2ECCA 1YLFA 3SDGA 5ICEA 1FOXA 4XLHA 4Q48A 3ZMZA 5IYDJ 1FOKA 3T8TA 2XDVA 3HGYA 3PIOF 5E3MA 2QVOA 4I98B 3BROA 4XICA 1VQMI 1E3OC 4Y13A 3ABMH 3M9AA 2Z5UA 3ZQIA 3OYEA 4X0GA 3B73A 2JPCA 2WADA 2LDUA 2M4GA 1Y8RB 2CW0F 2WB1A 5CVUA 4ENJA 2DA4A 4ZH4F 1OFCX 2RGVA 3IP4B 4NDLA 4BBRJ 1J59A 4I99C 4G6TB 5CVRA 4XBFA 2HXOA 3HB9A 2YSRA 2X1CA 1YJ9I 2BE5F 2DK5A 3LSJA 2VI6A 1K7AA 5C4JJ 1FOWA 3FF5A 5H6QA 3CC4I 3ELKA 1A6QA 5C3EJ 4DJAA 4EQQA 1L0OC 4IVNA 3RPUA 5E3LA 2XAJA 4IOCF 4IF4A 2XF5A 3HJEA 4ZZLA 4ZYDA 3HOZJ 3TP3A 3S14J 3OL3A 2KJBA 1FLIA 1DU6A 3H5RA 2BXYA 1A31A 2NXNB 1N78A 2D1HA 2QF7A 3HRSA 4UB6C 2VB6A 3M8EA 5ILSA 3EYYA 4IKFA 1ZYRF 2K9NA 3NARA 2DMUA 1F43A 3PO3J 2OCCH 2DMTA 1K4TA 1K61A 5DS9A 1Z6RA 4IRIA 1JKOC 1R5ID 2WAFA 4A3LJ 3DBLB 1JHHA 5HS7A 3HL2A 2CQNA 2O0YA 5FKNA 4Z2YA 2H27A 1QZYA 3PQKA 3W3CA 1IXCA 4B4CA 3WU1B 2FOWA 2JPBA 5CPRB 1AU7A 4P5OA 2GXAA 1U8RA 2ELJA 3KZIC 3DBRB 3QU3A 4KIGA 4LIUA 4BHBA 3ABLH 2P7CB 2DTZA 1AWCA 1EH7A 2VKEA 3OOUA 4CCKA 2L4MA 5LGUA 1MMDA 2Z33A 4A12A 3DF8A 2GOXB 2Y0SN 1AKHA 3QYFA 4V19K 1R22A 1WH7A 3I9V2 4ENKA 4FQGA 1KQ9A 1TQIA 1UHMA 4A3GJ 4DZPA 3MMYB 1JHFA 3C2HA 2J5OA 2L9VA 1YQAA 1SAXA 2O8KA 3WE3A 3OYNA 2EIMH 4KIFA 4HLXA 5IP6A 5JLXA 3RDIA 4RGSA 2LOOA 1PJRA 2F6CA 5EZGA 4BEHA 3CMMA 2QGUA 1MNMC 2G9WA 3E1SA 5TJJA 1K78B 3S15J 5DCMA 2LR8A 4XLFA 4GRIA 4HZFA 5AIQA 2W24A 5IOZA 2PJPA 2BGCA 2OTJI 2A6EF 3Q0UA 3CUQB 4MFDA 1R1VA 3BC8A 4M72A 1KZHA 4L9NA 4XKWA 1MH4A 5HDNA 1FMVA 3A03A 4QWQA 2IS6A 4RB2C 4AIJA 2BY3A 1T6SA 1FMWA 1V4RA 1BC8C 5BPIA 2CH0A 1YE9A 1MGTA 4EM2A 3W2AA 2BOLA 2L9NA 2A68F 3BPVA 5TGTA 5TRDA 3BCAA 3JRGA 3CCSI
chains in the Genus database with same CATH topology
4H0EA 3WGIA 1U6GA 2IP2A 1VTNC 2K27A 1HW5A 3RI4A 3RIRA 5HOOA 1B9MA 4CYDA 2G7UA 4Q5SF 1IF1A 5KVRA 4WK8F 4KUMA 1IN6A 3S2WA 2RDPA 2VC1A 3GZ5A 5HDGA 2GWRA 2FE3A 1ZGJA 4LJZF 4U7BA 3V8LA 1IRFA 4EJWA 1FX7A 5E1XA 3ZQ7A 1ZG1A 4K2EA 5D5UB 4I09A 2XAHA 3ISPA 4CICA 1BOAA 5D8LB 2CG4A 3E6CC 1TNSA 4U7DA 3QP5A 2CYYA 5JVTA 1OYWA 2W25A 3I4PA 3FXRA 3T5XA 3FXQA 3N4MA 2QQ9A 4WCGA 5J8CA 1KU9A 2DW4A 3P9IA 4HQMA 3F21A 3EUHA 1QGPA 2PG4A 3TO9A 4WXHA 5FD5A 1FY7A 3GF2A 4I02A 5JFRA 2K4BA 1HSJA 3CDHA 3M7GA 5HVQC 4N9HA 4HAMA 5ERIA 2P5VA 3K1PA 5L3DA 1FZPB 4KIBA 1SD4A 3DPTA 3R6SA 4ESJA 1J9IA 3F8FA 1K78A 3O3KA 1FYKA 3IKTA 4FT8A 4S04A 2CSOA 3CUQA 5K5OA 2DQLA 2ISZA 3T8RA 4Q47A 3I0TA 2XASA 4KNYA 3F8CA 4IXAA 3RKXA 1S29A 1ULYA 1BM9A 4LD5A 4EM0B 1J5YA 2GXBA 4G8XA 1B59A 1GHCA 3O6BB 4UXNA 3VODA 3ZMVA 1MD0A 3I54A 5LRSA 2O03A 2VBZA 2Y75A 4OU0A 4UHTA 3CO6C 1BI2A 1G6NA 2JZYA 1MJAA 2VE8A 2IRFG 5ICCA 3V8KA 4EM1A 2M8EA 5E1WA 1KYWA 4LLNA 2E7XA 4MHGA 4YIFA 2GQQA 3KE2A 5HLIA 3BZ6A 2R7DA 2YX4A 4PZJA 1XGSA 1ON1A 1F1ZA 2WV0A 1HW2A 3LA2A 1KU7A 1FPQA 1W4MA 1I5ZA 3RYRA 1Z9CA 3W6JB 4HYEA 4EV0A 4Y15A 3SZTA 1TQMA 4LGWA 2A61A 4GCVA 2Y48A 1O7LA 1ZHFA 1FWZA 2HTSA 3V7SA 1KU3A 1EH6A 4HDVA 2VOPA 2K7LA 1G3SA 1O57A 3IKVA 1TNTA 3TO7A 3GUDA 3ERED 4ZYEA 4MTEA 4A6DA 3CUQC 4G7ZF 1OYIA 4PGGA 3WTTC 1BBYA 1ZGAA 4ENNA 2MLKA 2ZJ2A 5H6RA 3GWZA 4OIPF 2M1BA 2IA0A 4UV8A 1H0MA 2UXXA 3V7CA 1V3FA 2BEOA 1H9GA 5KK1A 1XSVA 1KYZA 2EA2A 2ADUA 1TW2A 3QPHA 4EVIA 3WGGA 1FT9A 4E70A 3D5LA 1FBQA 3VB2A 3LQQA 1R1UA 4EJUA 4Q4ZF 1USTA 1D8KA 1SFXA 3GXOA 4U0YA 4MEXF 4KMFA 2EV5A 2RC4A 1O3TA 3M8FA 1GXPA 2ZNYA 3DQVC 2CWEA 2ACJA 1EH8A 4LK1F 3U2RA 2M30A 2HKOA 1IN7A 2PFBA 1PP8F 4HDUA 4ENMA 4EGYA 4JBAA 5JI6A 2LSOA 4MNUA 3J7AO 5CYVA 1QQIA 4ASNA 1DDNA 1KQ8A 3QP6A 1P4XA 3GLXA 2HR3A 3WTUC 3JSOA 5HS8A 2VC0A 2F5EA 4KMUX 3E97A 2L3DA 2VOOA 4G94A 3FM3A 1FYMA 2ZMEB 1XGMA 5BOXA 2QLZA 1RZ4A 2K4JA 2P7VB 3BJ6A 4GYGA 5DUKA 2HDCA 3GYHX 4M6YA 3HTSB 4OIOF 1SFUA 4BHPA 5FGMA 3ECOA 1WQ2A 4XSXF 2PMUA 2ZKZA 2EFWA 2E1CA 3P9CA 1XCVA 2NS0A 1ZREA 1SD7A 4A5MA 3P7NA 2DT5A 3ZMTA 1XMKA 4OIQF 2ZBKA 4CDGA 1WWXA 5LHIA 2UWMA 1LDJA 2XVCA 3SHFA 4IRGA 4TV7A 2CFXA 1Z05A 3V4GA 4EJOA 4MQVA 2OAZA 2F5DA 5D5WB 1ODDA 5J6XA 4WXCA 1KGSA 3JSPA 2VODA 2Q8KA 3TOAA 1R00A 4ZYHA 4RB3C 1DPRA 4DQ2A 3CUOA 1XGNA 1BI3A 1BIBA 4UUVA 3P9KA 4XRFA 2EWNA 4EMSA 1HBXG 3I59B 3G3ZA 1S8NA 1E2XA 5F1RA 1XD7A 2WTEA 3T0YA 4LK0F 3HRMA 4XLNF 3EETA 4MEYF 4FX4A 2Z3YA 1I6XA 2HKXA 4YFXF 1SFEA 1XSDA 3H3UA 1J0RA 1J7KA 3KP5A 1CGPA 1F4KA 1E17A 2Z99A 2HQNA 4OIRF 2W85A 3K69A 1O7FA 5BQTA 1J75A 3IRQA 3F22A 1XN7A 4RGXA 2O6GE 2JT1A 2Q2EA 2P5KA 1R1TA 2OQRA 1BI0A 3H92A 5DDGA 2ZMEA 3BWGA 2AS5F 4R79A 3FMRA 3WE2A 2ZCWA 5ILVA 2ETHA 2QYOA 2COMA 5JHUA 4KN4X 4HX7A 2QBYB 2L4AA 3I58A 3K1MA 2ESHA 4G9YA 3AAFA 1LEBA 2OZ6A 3HIFA 4YFKF 4RS8A 2P5LC 5FB2A 4IHSA 1FSEA 2YR2A 5D4RA 1JXSA 3KLNA 4QLCU 1OKRA 2M45A 5D5VB 3HHHA 4CHUA 1T39A 1S7OA 2UZKA 1U2WA 3T1BA 1FC3A 4RAZA 1W5TA 5LEKA 3DXJF 4RB1A 2FBKA 5LBQA 4HF2A 3KP6A 1T0FA 1O3SA 1Z1DA 3FWEA 1BC7C 2IPQX 3HUGA 1W5SA 2QQAA 1FP1D 2EV6A 5ED4A 4I0AA 2V6CA 3HTUA 1H9TA 1OYYA 4JQFA 5HDKA 3TQNA 1ZG5A 5FFXA 1P92A 4U0WA 1B9NA 3ZMSA 3I59A 2QENA 3NEUA 2JTVA 3FM5A 4JK1X 3V7RA 1T2KA 2DO7A 4GYIA 4MTDA 1SD5A 3VFZA 1DP7P 2EK5A 3HSEA 2O3FA 2VBXA 3ZMDA 4WX9A 3CLOA 1ZAOA 4G6QA 4HW0A 5L3EA 1FYLA 2M87A 3C1DA 3D0SA 1LNWA 5CVJA 2KIFA 1XCBA 1IN8A 5LEJA 1B4AA 5FFZA 3L09A 2YX7A 1YS7A 2QM3A 2WC2A 4O5VA 2MA3A 2NNNA 4L5IA 4U88A 2RKHA 4LB5A 3BY6A 1Z6TA 3F6VA 5FO5A 2XAQA 1ZARA 2QBYA 4AVPA 1XDSA 2HS5A 3LFKA 2Y0MA 2E1NA 2EB7A 4FHTA 2OQGA 1P2FA 2V79A 4CO8A 3DFGA 3IC7A 2HWVA 3ZN1A 1XB4A 2ELHA 3KEOA 2FU4A 1ZLJA 5D5XB 2A6HF 4I7HA 1KA8A 4UVBA 2V1XA 2PN6A 4LB6B 5DUIA 5CVVA 3GO5A 5CLSA 2XHKA 4BYYA 3MQ0A 1YYVA 3QRFF 3H3ZA 1USSA 2XGXA 3LAPA 2O8XA 2FBIA 3LA7A 2CO5A 3ABUA 5ICFA 3J80K 4OMZA 1Z7UA 1LJ9A 1MJ9A 2UXNA 3I71A 5ICGA 2HYGD 3R0JA 2PMHA 1Y0UA 4KYWA 3U9GA 2GAUA 2DQRA 2FNPA 4BH9A 3Q9VA 2GXGA 4M9XA 2EFNA 2H09A 2RVCA 3WODF 2V1UA 3JTHA 1WRJA 2FQ3A 3E6DA 3K1NA 3IWFA 3L9FA 2LF8A 4UVCA 4N0BA 2B0LA 3BP8A 2PI0A 2L54A 1MDMB 1Z91A 3HRTA 3WTXC 4B09A 1G3TA 4ON0A 5A2QK 2A07F 2R7FA 4RGRA 4WF2A 4M74A 3WTYC 3LAJA 2KRFA 2A5YB 5H20A 3EDPA 2IJLA 3CO7C 2BBYA 2FXAA 1HKQA 5L3GA 3ZMUA 4MGRA 4AIKA 4KT5C 2XAGA 2KJCA 1UCRA 2HOEA 2EFOA 1T98A 3K0LA 2GZWA 2XKPA 5DCFA 4OINF 1LVAA 5FLXK 2GA1A 1LQ1A 4WWCA 4HX8A 5E17F 2JSCA 4A0ZA 2X0LA 3V8JA 5FLXZ 4U0VA 1UB9A 4ZZDA 3FHZA 3F23A 2DK8A 2MH9A 2L01A 2BYVE 2J5PA 2PEXA 2O61A 3QPTA 3F72A 5IT9K 2RN7A 1C0WA 3CJNA 2RQPA 3I53A 5E8GA 1R5HA 4BXUA 5F64A 2CGPA 2EJRA 3KFWX 1S7AA 1FBUA 3I64A 1W7PB 3N97A 1QBJA 1WKMA 4I0BA 2NNYA 2IW5A 1YFHA 1WSUA 4ZYGA 4BAYA 4M9SA 3ABTA 2FMLA 2EA4A 4UVAA 3FMQA 5JR3A 2EFQA 4AD9A 2A69F 1FBSA 1BIAA 3K9TA 2PQ8A 2QZ8A 3E5UA 2CQKA 3BPXA 2IA2A 1ZLKA 4G7HF 3F6OA 3ECHA 1UHWA 1W7PD 2FEZA 3KLOA 3LWFA 2H6BA 1BI1A 5IT3A 3HRUA 5E20A 2V9VA 3KP2A 4YIIA 1OMIA 4B8XA 1S6LA 2DTRA 3RJPA 1JE8A 2ZXJA 2OBPA 4HA8A 3KZYA 1XSXA 2DBBA 1GVJA 5LHGA 1D5VA 3BOQA 1O3RA 4O3MA 2FBHA 2HEOA 2KKOA 5EEGA 1ZN2A 1MDMA 4LLLA 1ZRDA 5HLGA 1CF7B 3IWZA 3DV8A 3HSFA 2LNBA 4LG0B 1IUYA 2R3SA 2KIMA 3E5XA 3ML6A 4PGHA 4A2UA 1R36A 3RTRA 4L9TA 3HOSA 2FNAA 1P6RA 1YS6A 4G7OF 3L00A 4HV5A 4P96A 4I2OA 3GZ6A 2XIGA 3GVAA 1YO5C 3L2CA 2RNJA 1K79A 4ETSA 1R5GA 2VXZA 4A0XA 3QAHA 2HQRA 2ISYA 4OOIA 5LHHA 1R7JA 2FOKA 2D45A 3EYIA 4HF0A 2XROA 4R8HA 3Q9SA 3NQOA 3J81K 1ZRFA 2JRTA 3ZPLA 3J81Z 3JAMK 1B6AA 3ZN0A 1YTYA 4AWXB 3TDUC 3COAC 3JAMZ 3SQNA 2PLYA 2W57A 4PCQA 1PDNC 1G3WA 3C18A 1U78A 2DU9A 1W7PA 2Q0OA 2H6CA 4N9IA 3HOTA 5AONA 1QPMA 2ZO4A 4RB0A 2A3SA 2DAOA 3IRRA 3HYIA 1QNTA 3O2PE 4HBLA 3W6KB 1ZH5A 3MAJA 2VONA 3ZP5A 4KFCA 2HGCA 1F5TA 3LQRA 1YW9A 3MFKA 5BS6A 2D1VA 2XV4S 3F8NA 1ONVA 2IVMA 3GX4X 4L9JA 2YU3A 4YFNF 1O3QA 3E5QA 2AXLA 2FSWA 2H94A 1WI9A 4I01A 3PQJA 2OA4A 1B1BA 3RKYA 2MH2A 4GGGA 2DPDA 5ILUA 3TKYA 5HLHA 4OMYA 3JW4A 4L9VA 3I5UA 3GW2A 1G3YA 4HF1A 2DI3A 3F8BA 2MBFA 3KEQA 3R4KA 3Q5FA 1REPC 4XLPF 5BPDA 1CF7A 4RGUA 6PAXA 4M73A 4LG0A 1QZZA 2D2WA 1J2XA 1IN5A 1IW7F 5E1ZB 3KP7A 1IXRC 3RYPA 1OR7A 3E3VA 1F9NA 1PUEE 1HKSA 2K86A 2MD5A 5J8FA 3TGNA 4L0ZB 1IXSB 4RAYA 4P9FA 3IL2A 3FXUA 3F8MA 1I1GA 1D3YA 3TDZC 2DPUA 1RNLA 2KIUA 2VBWA 4A0YA 1SD6A 3FMSA 1SMYF 1U3EM 3WTZA 5K5RA 3RKWA 1I27A 1U5TB 1STZA 5L3BA 5D6FA 4L18B 4L0YB 3WTVC 3TOBA 3FX3A 2OU2A 3SZPA 3RPQA 2EV0A 1D8JA 4LLGF 4D0PA 3ULQB 5F6FA 2M5WA 2HZTA 2Z9OA 1MJBA 3WTSC 2FRHA 1SMTA 5BMZA 2STWA 2G7HA 2GA2A 3SFZA 2BV6A 1YG2A 2DLLA 3C7JA 2HFHA 4WXDA 2LKPA 5DD4A 1G4DA 4DNCA 5HS9A 4NQWA 5EEHA 3HSRA 3C3WA 1A04A 1TTYA 1L3LA 5AIPA 3FZVA 3VOEA 4HQEA 4LFUA 4M9ZA 1P4WA 3CTAA 1IAWA 2LF7A 2RV8A 1RUOA 2ESNA 1IZ1A 1GXQA 3KETA 2NRAC 4O6JA 3DP7A 2F2EA 3GFLA 4A5NA 3MZHA 3KP3A 1KU2A 3GEZA 2VBYA 5DV5A 1TW3A 2VT2A 2FF4A 5DEQA 2FMYA 4ESFA 1DUXC 1KQ0A 5DYMA 3GFIA 3MWMA 3JTGA 1ZG3A 2ZFWA 1DPUA 2QWWA 2VN2A 4P55A 1YW8A 1EV7A 2EFPA 3WU0A 2ZNZA 4GO1A 1HW1A 1FNNA 3J80Z 3OOPA 1MKMA 3U1DA 4CXFA 3IHUA 2F5FA 2VE9A 1LDKB 1YW7A 1ON2A 3DKWA 4Y17A 4KN7X 4GXOA 4MQ9F 4KICA 4F7ZA 3QU6A 2STTA 4XSZF 1OPCA 2QUFA 4EJTA 2P8TA 3GFMA 2PBIA 3G73A 2QQBA 4BNCA 3WTWC 2FA5A 4L5JA 4PDKA 3REOA 1PP7U 3ROUA 2XUBA 4HX4A 3BDDA 1LDDA 3TO6A 2OZUA 1IN4A 3E6MA 5A2QZ 1U5TA 1LB2A 4ESBA 2NYXA 3LA3A 1I1SA 2HTJA 2DFIA 2P6TA 1T38A 4S05A 2XRNA 2L02A 3QOPA 2NAZA 1JGSA 3NRVA 4NB5A 1QO0D 4P9UA 3OV8A 3L7WA 4BQAA 4IHTA 3KCCA 3KP4A 4IPAA 3MEXA 3DEUA 1AOYA 2IT0A 1RIOH 2C6YA 2E7WA 1MZBA 4M6XA 3K2ZA 2MC3A 1HSTA 5D8KB 1LEAA 1HXDA 2XKOA 4LMYA 3SXYA 5IT9Z 1ZRCA 1BJAA 3BJAA 1HKTA 1R58A 1RI7A 5LGTA 4CGZA 1HQCA 4A6EA 1TQPA 2MLGA 5CVIA 5D4SA 4HLYA 4NHJA 1YIOA 1FSHA 2OD5A 5L3FA 3KZZA 3R61A 3EQLF 2TDXA 1BN5A 2WWYA 3WG9A 1K6OA 4G6DA 4UV9A 3DPLC 2YPRA 3R0AA 3M1EA 3LSTA 1XGOA 3VEPA 3R60A 4AIHA 2X4HA 3GFJA 5FD6A 2HYFA 1P4AA 5DCMB 2V1DA 4KDPA 4EJVA 1S3JA 5LRRA 3BJOA 1U5TC 5L3CA 1RUNA 3MCZA 5CJ9A 5LGNA 2P6SA 4IRHA 2F5CA 4EGZA 3B02A 2XAFA 2GIVA 4BHCA 5K5QA 4R1HA 3MZYA 3E6BA 2K02A 4HOBA 4M71A 4CZZA 5DD8A 5K1YA 3PFIA 4FX0A 1TLHB 5E8IA 1UFMA 1XDUA 2IA1A 1IRGA 2P4WA 2W84A 3HHGA 1X3UA 4HV6A 4KA4A 1XMAA 4YG2F 1TBXA 1NHAA 2VT3A 5LLQA 4UNOA 5D6EA 4IJAA 1R23A 5E18F 3WGHA 1FP2A 1Q1HA 3F3XA 1YLFA 5ICEA 4Q48A 3ZMZA 1FOKA 3T8TA 2QVOA 4I98B 3BROA 4Y13A 3M9AA 2Z5UA 3B73A 2JPCA 2LDUA 2CW0F 5CVUA 4ENJA 4ZH4F 2RGVA 1J59A 5CVRA 4XBFA 2YSRA 2BE5F 2DK5A 1K7AA 3FF5A 5H6QA 3ELKA 4EQQA 1L0OC 4IVNA 3RPUA 2XAJA 4IF4A 4ZYDA 4ZZLA 2KJBA 1FLIA 2D1HA 3HRSA 3M8EA 5ILSA 3EYYA 1ZYRF 1Z6RA 4IRIA 5HS7A 1JHHA 2O0YA 4Z2YA 2H27A 1QZYA 3PQKA 1IXCA 3WU1B 2JPBA 4P5OA 1U8RA 4KIGA 3QU3A 4BHBA 2P7CB 1AWCA 1EH7A 2L4MA 5LGUA 2Z33A 4A12A 3DF8A 1R22A 4ENKA 1KQ9A 1TQIA 1UHMA 1JHFA 2J5OA 1YQAA 1SAXA 3WE3A 4KIFA 4HLXA 3RDIA 4RGSA 2G9WA 5TJJA 1K78B 5DCMA 5AIQA 4HZFA 2W24A 2PJPA 2BGCA 2A6EF 3CUQB 1R1VA 4M72A 4L9NA 5HDNA 4QWQA 4AIJA 4RB2C 1T6SA 1V4RA 1BC8C 5BPIA 1MGTA 4EM2A 2A68F 3BPVA 5TRDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H0E A;  3WGI A;  1U6G A;  2IP2 A;  1VTN C;  2K27 A;  1HW5 A;  3RI4 A;  3RIR A;  5HOO A;  1B9M A;  4CYD A;  2G7U A;  4Q5S F;  1IF1 A;  5KVR A;  4WK8 F;  4KUM A;  1IN6 A;  3S2W A;  2RDP A;  2VC1 A;  3GZ5 A;  5HDG A;  2GWR A;  2FE3 A;  1ZGJ A;  4LJZ F;  4U7B A;  3V8L A;  1IRF A;  4EJW A;  1FX7 A;  5E1X A;  3ZQ7 A;  1ZG1 A;  4K2E A;  5D5U B;  4I09 A;  2XAH A;  3ISP A;  4CIC A;  1BOA A;  5D8L B;  2CG4 A;  3E6C C;  1TNS A;  4U7D A;  3QP5 A;  2CYY A;  5JVT A;  1OYW A;  2W25 A;  3I4P A;  3FXR A;  3T5X A;  3FXQ A;  3N4M A;  2QQ9 A;  4WCG A;  5J8C A;  1KU9 A;  2DW4 A;  3P9I A;  4HQM A;  3F21 A;  3EUH A;  1QGP A;  2PG4 A;  3TO9 A;  4WXH A;  5FD5 A;  1FY7 A;  3GF2 A;  4I02 A;  5JFR A;  2K4B A;  1HSJ A;  3CDH A;  3M7G A;  5HVQ C;  4N9H A;  4HAM A;  5ERI A;  2P5V A;  3K1P A;  5L3D A;  1FZP B;  4KIB A;  1SD4 A;  3DPT A;  3R6S A;  4ESJ A;  1J9I A;  3F8F A;  1K78 A;  3O3K A;  1FYK A;  3IKT A;  4FT8 A;  4S04 A;  2CSO A;  3CUQ A;  5K5O A;  2DQL A;  2ISZ A;  3T8R A;  4Q47 A;  3I0T A;  2XAS A;  4KNY A;  3F8C A;  4IXA A;  3RKX A;  1S29 A;  1ULY A;  1BM9 A;  4LD5 A;  4EM0 B;  1J5Y A;  2GXB A;  4G8X A;  1B59 A;  1GHC A;  3O6B B;  4UXN A;  3VOD A;  3ZMV A;  1MD0 A;  3I54 A;  5LRS A;  2O03 A;  2VBZ A;  2Y75 A;  4OU0 A;  4UHT A;  3CO6 C;  1BI2 A;  1G6N A;  2JZY A;  1MJA A;  2VE8 A;  2IRF G;  5ICC A;  3V8K A;  4EM1 A;  2M8E A;  5E1W A;  1KYW A;  4LLN A;  2E7X A;  4MHG A;  4YIF A;  2GQQ A;  3KE2 A;  5HLI A;  3BZ6 A;  2R7D A;  2YX4 A;  4PZJ A;  1XGS A;  1ON1 A;  1F1Z A;  2WV0 A;  1HW2 A;  3LA2 A;  1KU7 A;  1FPQ A;  1W4M A;  1I5Z A;  3RYR A;  1Z9C A;  3W6J B;  4HYE A;  4EV0 A;  4Y15 A;  3SZT A;  1TQM A;  4LGW A;  2A61 A;  4GCV A;  2Y48 A;  1O7L A;  1ZHF A;  1FWZ A;  2HTS A;  3V7S A;  1KU3 A;  1EH6 A;  4HDV A;  2VOP A;  2K7L A;  1G3S A;  1O57 A;  3IKV A;  1TNT A;  3TO7 A;  3GUD A;  3ERE D;  4ZYE A;  4MTE A;  4A6D A;  3CUQ C;  4G7Z F;  1OYI A;  4PGG A;  3WTT C;  1BBY A;  1ZGA A;  4ENN A;  2MLK A;  2ZJ2 A;  5H6R A;  3GWZ A;  4OIP F;  2M1B A;  2IA0 A;  4UV8 A;  1H0M A;  2UXX A;  3V7C A;  1V3F A;  2BEO A;  1H9G A;  5KK1 A;  1XSV A;  1KYZ A;  2EA2 A;  2ADU A;  1TW2 A;  3QPH A;  4EVI A;  3WGG A;  1FT9 A;  4E70 A;  3D5L A;  1FBQ A;  3VB2 A;  3LQQ A;  1R1U A;  4EJU A;  4Q4Z F;  1UST A;  1D8K A;  1SFX A;  3GXO A;  4U0Y A;  4MEX F;  4KMF A;  2EV5 A;  2RC4 A;  1O3T A;  3M8F A;  1GXP A;  2ZNY A;  3DQV C;  2CWE A;  2ACJ A;  1EH8 A;  4LK1 F;  3U2R A;  2M30 A;  2HKO A;  1IN7 A;  2PFB A;  1PP8 F;  4HDU A;  4ENM A;  4EGY A;  4JBA A;  5JI6 A;  2LSO A;  4MNU A;  3J7A O;  5CYV A;  1QQI A;  4ASN A;  1DDN A;  1KQ8 A;  3QP6 A;  1P4X A;  3GLX A;  2HR3 A;  3WTU C;  3JSO A;  5HS8 A;  2VC0 A;  2F5E A;  4KMU X;  3E97 A;  2L3D A;  2VOO A;  4G94 A;  3FM3 A;  1FYM A;  2ZME B;  1XGM A;  5BOX A;  2QLZ A;  1RZ4 A;  2K4J A;  2P7V B;  3BJ6 A;  4GYG A;  5DUK A;  2HDC A;  3GYH X;  4M6Y A;  3HTS B;  4OIO F;  1SFU A;  4BHP A;  5FGM A;  3ECO A;  1WQ2 A;  4XSX F;  2PMU A;  2ZKZ A;  2EFW A;  2E1C A;  3P9C A;  1XCV A;  2NS0 A;  1ZRE A;  1SD7 A;  4A5M A;  3P7N A;  2DT5 A;  3ZMT A;  1XMK A;  4OIQ F;  2ZBK A;  4CDG A;  1WWX A;  5LHI A;  2UWM A;  1LDJ A;  2XVC A;  3SHF A;  4IRG A;  4TV7 A;  2CFX A;  1Z05 A;  3V4G A;  4EJO A;  4MQV A;  2OAZ A;  2F5D A;  5D5W B;  1ODD A;  5J6X A;  4WXC A;  1KGS A;  3JSP A;  2VOD A;  2Q8K A;  3TOA A;  1R00 A;  4ZYH A;  4RB3 C;  1DPR A;  4DQ2 A;  3CUO A;  1XGN A;  1BI3 A;  1BIB A;  4UUV A;  3P9K A;  4XRF A;  2EWN A;  4EMS A;  1HBX G;  3I59 B;  3G3Z A;  1S8N A;  1E2X A;  5F1R A;  1XD7 A;  2WTE A;  3T0Y A;  4LK0 F;  3HRM A;  4XLN F;  3EET A;  4MEY F;  4FX4 A;  2Z3Y A;  1I6X A;  2HKX A;  4YFX F;  1SFE A;  1XSD A;  3H3U A;  1J0R A;  1J7K A;  3KP5 A;  1CGP A;  1F4K A;  1E17 A;  2Z99 A;  2HQN A;  4OIR F;  2W85 A;  3K69 A;  1O7F A;  5BQT A;  1J75 A;  3IRQ A;  3F22 A;  1XN7 A;  4RGX A;  2O6G E;  2JT1 A;  2Q2E A;  2P5K A;  1R1T A;  2OQR A;  1BI0 A;  3H92 A;  5DDG A;  2ZME A;  3BWG A;  2AS5 F;  4R79 A;  3FMR A;  3WE2 A;  2ZCW A;  5ILV A;  2ETH A;  2QYO A;  2COM A;  5JHU A;  4KN4 X;  4HX7 A;  2QBY B;  2L4A A;  3I58 A;  3K1M A;  2ESH A;  4G9Y A;  3AAF A;  1LEB A;  2OZ6 A;  3HIF A;  4YFK F;  4RS8 A;  2P5L C;  5FB2 A;  4IHS A;  1FSE A;  2YR2 A;  5D4R A;  1JXS A;  3KLN A;  4QLC U;  1OKR A;  2M45 A;  5D5V B;  3HHH A;  4CHU A;  1T39 A;  1S7O A;  2UZK A;  1U2W A;  3T1B A;  1FC3 A;  4RAZ A;  1W5T A;  5LEK A;  3DXJ F;  4RB1 A;  2FBK A;  5LBQ A;  4HF2 A;  3KP6 A;  1T0F A;  1O3S A;  1Z1D A;  3FWE A;  1BC7 C;  2IPQ X;  3HUG A;  1W5S A;  2QQA A;  1FP1 D;  2EV6 A;  5ED4 A;  4I0A A;  2V6C A;  3HTU A;  1H9T A;  1OYY A;  4JQF A;  5HDK A;  3TQN A;  1ZG5 A;  5FFX A;  1P92 A;  4U0W A;  1B9N A;  3ZMS A;  3I59 A;  2QEN A;  3NEU A;  2JTV A;  3FM5 A;  4JK1 X;  3V7R A;  1T2K A;  2DO7 A;  4GYI A;  4MTD A;  1SD5 A;  3VFZ A;  1DP7 P;  2EK5 A;  3HSE A;  2O3F A;  2VBX A;  3ZMD A;  4WX9 A;  3CLO A;  1ZAO A;  4G6Q A;  4HW0 A;  5L3E A;  1FYL A;  2M87 A;  3C1D A;  3D0S A;  1LNW A;  5CVJ A;  2KIF A;  1XCB A;  1IN8 A;  5LEJ A;  1B4A A;  5FFZ A;  3L09 A;  2YX7 A;  1YS7 A;  2QM3 A;  2WC2 A;  4O5V A;  2MA3 A;  2NNN A;  4L5I A;  4U88 A;  2RKH A;  4LB5 A;  3BY6 A;  1Z6T A;  3F6V A;  5FO5 A;  2XAQ A;  1ZAR A;  2QBY A;  4AVP A;  1XDS A;  2HS5 A;  3LFK A;  2Y0M A;  2E1N A;  2EB7 A;  4FHT A;  2OQG A;  1P2F A;  2V79 A;  4CO8 A;  3DFG A;  3IC7 A;  2HWV A;  3ZN1 A;  1XB4 A;  2ELH A;  3KEO A;  2FU4 A;  1ZLJ A;  5D5X B;  2A6H F;  4I7H A;  1KA8 A;  4UVB A;  2V1X A;  2PN6 A;  4LB6 B;  5DUI A;  5CVV A;  3GO5 A;  5CLS A;  2XHK A;  4BYY A;  3MQ0 A;  1YYV A;  3QRF F;  3H3Z A;  1USS A;  2XGX A;  3LAP A;  2O8X A;  2FBI A;  3LA7 A;  2CO5 A;  3ABU A;  5ICF A;  3J80 K;  4OMZ A;  1Z7U A;  1LJ9 A;  1MJ9 A;  2UXN A;  3I71 A;  5ICG A;  2HYG D;  3R0J A;  2PMH A;  1Y0U A;  4KYW A;  3U9G A;  2GAU A;  2DQR A;  2FNP A;  4BH9 A;  3Q9V A;  2GXG A;  4M9X A;  2EFN A;  2H09 A;  2RVC A;  3WOD F;  2V1U A;  3JTH A;  1WRJ A;  2FQ3 A;  3E6D A;  3K1N A;  3IWF A;  3L9F A;  2LF8 A;  4UVC A;  4N0B A;  2B0L A;  3BP8 A;  2PI0 A;  2L54 A;  1MDM B;  1Z91 A;  3HRT A;  3WTX C;  4B09 A;  1G3T A;  4ON0 A;  5A2Q K;  2A07 F;  2R7F A;  4RGR A;  4WF2 A;  4M74 A;  3WTY C;  3LAJ A;  2KRF A;  2A5Y B;  5H20 A;  3EDP A;  2IJL A;  3CO7 C;  2BBY A;  2FXA A;  1HKQ A;  5L3G A;  3ZMU A;  4MGR A;  4AIK A;  4KT5 C;  2XAG A;  2KJC A;  1UCR A;  2HOE A;  2EFO A;  1T98 A;  3K0L A;  2GZW A;  2XKP A;  5DCF A;  4OIN F;  1LVA A;  5FLX K;  2GA1 A;  1LQ1 A;  4WWC A;  4HX8 A;  5E17 F;  2JSC A;  4A0Z A;  2X0L A;  3V8J A;  5FLX Z;  4U0V A;  1UB9 A;  4ZZD A;  3FHZ A;  3F23 A;  2DK8 A;  2MH9 A;  2L01 A;  2BYV E;  2J5P A;  2PEX A;  2O61 A;  3QPT A;  3F72 A;  5IT9 K;  2RN7 A;  1C0W A;  3CJN A;  2RQP A;  3I53 A;  5E8G A;  1R5H A;  4BXU A;  5F64 A;  2CGP A;  2EJR A;  3KFW X;  1S7A A;  1FBU A;  3I64 A;  1W7P B;  3N97 A;  1QBJ A;  1WKM A;  4I0B A;  2NNY A;  2IW5 A;  1YFH A;  1WSU A;  4ZYG A;  4BAY A;  4M9S A;  3ABT A;  2FML A;  2EA4 A;  4UVA A;  3FMQ A;  5JR3 A;  2EFQ A;  4AD9 A;  2A69 F;  1FBS A;  1BIA A;  3K9T A;  2PQ8 A;  2QZ8 A;  3E5U A;  2CQK A;  3BPX A;  2IA2 A;  1ZLK A;  4G7H F;  3F6O A;  3ECH A;  1UHW A;  1W7P D;  2FEZ A;  3KLO A;  3LWF A;  2H6B A;  1BI1 A;  5IT3 A;  3HRU A;  5E20 A;  2V9V A;  3KP2 A;  4YII A;  1OMI A;  4B8X A;  1S6L A;  2DTR A;  3RJP A;  1JE8 A;  2ZXJ A;  2OBP A;  4HA8 A;  3KZY A;  1XSX A;  2DBB A;  1GVJ A;  5LHG A;  1D5V A;  3BOQ A;  1O3R A;  4O3M A;  2FBH A;  2HEO A;  2KKO A;  5EEG A;  1ZN2 A;  1MDM A;  4LLL A;  1ZRD A;  5HLG A;  1CF7 B;  3IWZ A;  3DV8 A;  3HSF A;  2LNB A;  4LG0 B;  1IUY A;  2R3S A;  2KIM A;  3E5X A;  3ML6 A;  4PGH A;  4A2U A;  1R36 A;  3RTR A;  4L9T A;  3HOS A;  2FNA A;  1P6R A;  1YS6 A;  4G7O F;  3L00 A;  4HV5 A;  4P96 A;  4I2O A;  3GZ6 A;  2XIG A;  3GVA A;  1YO5 C;  3L2C A;  2RNJ A;  1K79 A;  4ETS A;  1R5G A;  2VXZ A;  4A0X A;  3QAH A;  2HQR A;  2ISY A;  4OOI A;  5LHH A;  1R7J A;  2FOK A;  2D45 A;  3EYI A;  4HF0 A;  2XRO A;  4R8H A;  3Q9S A;  3NQO A;  3J81 K;  1ZRF A;  2JRT A;  3ZPL A;  3J81 Z;  3JAM K;  1B6A A;  3ZN0 A;  1YTY A;  4AWX B;  3TDU C;  3COA C;  3JAM Z;  3SQN A;  2PLY A;  2W57 A;  4PCQ A;  1PDN C;  1G3W A;  3C18 A;  1U78 A;  2DU9 A;  1W7P A;  2Q0O A;  2H6C A;  4N9I A;  3HOT A;  5AON A;  1QPM A;  2ZO4 A;  4RB0 A;  2A3S A;  2DAO A;  3IRR A;  3HYI A;  1QNT A;  3O2P E;  4HBL A;  3W6K B;  1ZH5 A;  3MAJ A;  2VON A;  3ZP5 A;  4KFC A;  2HGC A;  1F5T A;  3LQR A;  1YW9 A;  3MFK A;  5BS6 A;  2D1V A;  2XV4 S;  3F8N A;  1ONV A;  2IVM A;  3GX4 X;  4L9J A;  2YU3 A;  4YFN F;  1O3Q A;  3E5Q A;  2AXL A;  2FSW A;  2H94 A;  1WI9 A;  4I01 A;  3PQJ A;  2OA4 A;  1B1B A;  3RKY A;  2MH2 A;  4GGG A;  2DPD A;  5ILU A;  3TKY A;  5HLH A;  4OMY A;  3JW4 A;  4L9V A;  3I5U A;  3GW2 A;  1G3Y A;  4HF1 A;  2DI3 A;  3F8B A;  2MBF A;  3KEQ A;  3R4K A;  3Q5F A;  1REP C;  4XLP F;  5BPD A;  1CF7 A;  4RGU A;  6PAX A;  4M73 A;  4LG0 A;  1QZZ A;  2D2W A;  1J2X A;  1IN5 A;  1IW7 F;  5E1Z B;  3KP7 A;  1IXR C;  3RYP A;  1OR7 A;  3E3V A;  1F9N A;  1PUE E;  1HKS A;  2K86 A;  2MD5 A;  5J8F A;  3TGN A;  4L0Z B;  1IXS B;  4RAY A;  4P9F A;  3IL2 A;  3FXU A;  3F8M A;  1I1G A;  1D3Y A;  3TDZ C;  2DPU A;  1RNL A;  2KIU A;  2VBW A;  4A0Y A;  1SD6 A;  3FMS A;  1SMY F;  1U3E M;  3WTZ A;  5K5R A;  3RKW A;  1I27 A;  1U5T B;  1STZ A;  5L3B A;  5D6F A;  4L18 B;  4L0Y B;  3WTV C;  3TOB A;  3FX3 A;  2OU2 A;  3SZP A;  3RPQ A;  2EV0 A;  1D8J A;  4LLG F;  4D0P A;  3ULQ B;  5F6F A;  2M5W A;  2HZT A;  2Z9O A;  1MJB A;  3WTS C;  2FRH A;  1SMT A;  5BMZ A;  2STW A;  2G7H A;  2GA2 A;  3SFZ A;  2BV6 A;  1YG2 A;  2DLL A;  3C7J A;  2HFH A;  4WXD A;  2LKP A;  5DD4 A;  1G4D A;  4DNC A;  5HS9 A;  4NQW A;  5EEH A;  3HSR A;  3C3W A;  1A04 A;  1TTY A;  1L3L A;  5AIP A;  3FZV A;  3VOE A;  4HQE A;  4LFU A;  4M9Z A;  1P4W A;  3CTA A;  1IAW A;  2LF7 A;  2RV8 A;  1RUO A;  2ESN A;  1IZ1 A;  1GXQ A;  3KET A;  2NRA C;  4O6J A;  3DP7 A;  2F2E A;  3GFL A;  4A5N A;  3MZH A;  3KP3 A;  1KU2 A;  3GEZ A;  2VBY A;  5DV5 A;  1TW3 A;  2VT2 A;  2FF4 A;  5DEQ A;  2FMY A;  4ESF A;  1DUX C;  1KQ0 A;  5DYM A;  3GFI A;  3MWM A;  3JTG A;  1ZG3 A;  2ZFW A;  1DPU A;  2QWW A;  2VN2 A;  4P55 A;  1YW8 A;  1EV7 A;  2EFP A;  3WU0 A;  2ZNZ A;  4GO1 A;  1HW1 A;  1FNN A;  3J80 Z;  3OOP A;  1MKM A;  3U1D A;  4CXF A;  3IHU A;  2F5F A;  2VE9 A;  1LDK B;  1YW7 A;  1ON2 A;  3DKW A;  4Y17 A;  4KN7 X;  4GXO A;  4MQ9 F;  4KIC A;  4F7Z A;  3QU6 A;  2STT A;  4XSZ F;  1OPC A;  2QUF A;  4EJT A;  2P8T A;  3GFM A;  2PBI A;  3G73 A;  2QQB A;  4BNC A;  3WTW C;  2FA5 A;  4L5J A;  4PDK A;  3REO A;  1PP7 U;  3ROU A;  2XUB A;  4HX4 A;  3BDD A;  1LDD A;  3TO6 A;  2OZU A;  1IN4 A;  3E6M A;  5A2Q Z;  1U5T A;  1LB2 A;  4ESB A;  2NYX A;  3LA3 A;  1I1S A;  2HTJ A;  2DFI A;  2P6T A;  1T38 A;  4S05 A;  2XRN A;  2L02 A;  3QOP A;  2NAZ A;  1JGS A;  3NRV A;  4NB5 A;  1QO0 D;  4P9U A;  3OV8 A;  3L7W A;  4BQA A;  4IHT A;  3KCC A;  3KP4 A;  4IPA A;  3MEX A;  3DEU A;  1AOY A;  2IT0 A;  1RIO H;  2C6Y A;  2E7W A;  1MZB A;  4M6X A;  3K2Z A;  2MC3 A;  1HST A;  5D8K B;  1LEA A;  1HXD A;  2XKO A;  4LMY A;  3SXY A;  5IT9 Z;  1ZRC A;  1BJA A;  3BJA A;  1HKT A;  1R58 A;  1RI7 A;  5LGT A;  4CGZ A;  1HQC A;  4A6E A;  1TQP A;  2MLG A;  5CVI A;  5D4S A;  4HLY A;  4NHJ A;  1YIO A;  1FSH A;  2OD5 A;  5L3F A;  3KZZ A;  3R61 A;  3EQL F;  2TDX A;  1BN5 A;  2WWY A;  3WG9 A;  1K6O A;  4G6D A;  4UV9 A;  3DPL C;  2YPR A;  3R0A A;  3M1E A;  3LST A;  1XGO A;  3VEP A;  3R60 A;  4AIH A;  2X4H A;  3GFJ A;  5FD6 A;  2HYF A;  1P4A A;  5DCM B;  2V1D A;  4KDP A;  4EJV A;  1S3J A;  5LRR A;  3BJO A;  1U5T C;  5L3C A;  1RUN A;  3MCZ A;  5CJ9 A;  5LGN A;  2P6S A;  4IRH A;  2F5C A;  4EGZ A;  3B02 A;  2XAF A;  2GIV A;  4BHC A;  5K5Q A;  4R1H A;  3MZY A;  3E6B A;  2K02 A;  4HOB A;  4M71 A;  4CZZ A;  5DD8 A;  5K1Y A;  3PFI A;  4FX0 A;  1TLH B;  5E8I A;  1UFM A;  1XDU A;  2IA1 A;  1IRG A;  2P4W A;  2W84 A;  3HHG A;  1X3U A;  4HV6 A;  4KA4 A;  1XMA A;  4YG2 F;  1TBX A;  1NHA A;  2VT3 A;  5LLQ A;  4UNO A;  5D6E A;  4IJA A;  1R23 A;  5E18 F;  3WGH A;  1FP2 A;  1Q1H A;  3F3X A;  1YLF A;  5ICE A;  4Q48 A;  3ZMZ A;  1FOK A;  3T8T A;  2QVO A;  4I98 B;  3BRO A;  4Y13 A;  3M9A A;  2Z5U A;  3B73 A;  2JPC A;  2LDU A;  2CW0 F;  5CVU A;  4ENJ A;  4ZH4 F;  2RGV A;  1J59 A;  5CVR A;  4XBF A;  2YSR A;  2BE5 F;  2DK5 A;  1K7A A;  3FF5 A;  5H6Q A;  3ELK A;  4EQQ A;  1L0O C;  4IVN A;  3RPU A;  2XAJ A;  4IF4 A;  4ZYD A;  4ZZL A;  2KJB A;  1FLI A;  2D1H A;  3HRS A;  3M8E A;  5ILS A;  3EYY A;  1ZYR F;  1Z6R A;  4IRI A;  5HS7 A;  1JHH A;  2O0Y A;  4Z2Y A;  2H27 A;  1QZY A;  3PQK A;  1IXC A;  3WU1 B;  2JPB A;  4P5O A;  1U8R A;  4KIG A;  3QU3 A;  4BHB A;  2P7C B;  1AWC A;  1EH7 A;  2L4M A;  5LGU A;  2Z33 A;  4A12 A;  3DF8 A;  1R22 A;  4ENK A;  1KQ9 A;  1TQI A;  1UHM A;  1JHF A;  2J5O A;  1YQA A;  1SAX A;  3WE3 A;  4KIF A;  4HLX A;  3RDI A;  4RGS A;  2G9W A;  5TJJ A;  1K78 B;  5DCM A;  5AIQ A;  4HZF A;  2W24 A;  2PJP A;  2BGC A;  2A6E F;  3CUQ B;  1R1V A;  4M72 A;  4L9N A;  5HDN A;  4QWQ A;  4AIJ A;  4RB2 C;  1T6S A;  1V4R A;  1BC8 C;  5BPI A;  1MGT A;  4EM2 A;  2A68 F;  3BPV A;  5TRD A; 
#chains in the Genus database with same CATH topology
 2JN6 A;  4H0E A;  1OLT A;  3WGI A;  2ZJR F;  2ZSI B;  1U6G A;  3BTJ A;  2IP2 A;  1VTN C;  2CV0 A;  2DOD A;  2Y9Z A;  2WY7 Q;  5HNF A;  3VYR B;  2K27 A;  3DLL F;  1HW5 A;  3RI4 A;  1S72 I;  3RIR A;  4BQO A;  4HSR A;  1TT5 B;  1MND A;  2R7Q A;  3PUB A;  5HOO A;  1K83 J;  1WJA A;  1B9M A;  2CFO A;  4CYD A;  5J1R A;  5FRN A;  2G7U A;  2N8G A;  4Q5S F;  2L0K A;  1IF1 A;  1WH5 A;  2DYR H;  4UY8 I;  5KVR A;  4WK8 F;  1XTA A;  2HDW A;  2DFE A;  3FXJ A;  4KUM A;  5B1B H;  2B63 J;  1HLV A;  1IN6 A;  4JOM A;  5IP9 J;  2R7W A;  3CZ6 A;  3S2W A;  1N77 A;  4BJ5 C;  2RDP A;  2VC1 A;  3C2B A;  3GZ5 A;  5HDG A;  2GWR A;  2M9H A;  2FE3 A;  1YX5 A;  1ZGJ A;  1X19 A;  4LJZ F;  3V8L A;  4CCJ A;  4U7B A;  1HF0 A;  1IRF A;  3SFI A;  4EJW A;  1FX7 A;  5E1X A;  2XB5 A;  3ZQ7 A;  3CMY A;  2Y2Z A;  4IO9 F;  4K2E A;  5D5U B;  1ZG1 A;  4I09 A;  2XAH A;  4U87 A;  3ISP A;  4CIC A;  1BOA A;  5D8L B;  2CG4 A;  3E6C C;  1TNS A;  1X2M A;  4U7D A;  2NVY J;  2EZI A;  2O5R A;  1MNE A;  2M8G X;  4XN0 A;  3OS2 A;  1QVT A;  2CUE A;  3MKZ A;  3OIP A;  3QP5 A;  2VKH A;  5B66 C;  1P7I A;  2CYY A;  5JVT A;  1OYW A;  2W25 A;  2JUC A;  1JJ6 C;  3OR2 C;  3I4P A;  2X85 A;  1Y1V J;  3FXR A;  4N4O B;  3T5X A;  1FIA A;  1LKX A;  2LTP A;  4LIV A;  3FXQ A;  5J3L A;  3N4M A;  2QQ9 A;  4WCG A;  5J8C A;  2XAU A;  1KU9 A;  2DW4 A;  3M4O J;  1EKE A;  3P9I A;  4HQM A;  2ZME C;  4L5E A;  1ETX A;  3F21 A;  1OCR H;  2OPT A;  3EUH A;  3HGG A;  4AM3 A;  4IL6 C;  1QGP A;  2JVG A;  2PG4 A;  3CCR I;  2DMQ A;  1XC5 A;  3TO9 A;  2A05 A;  1YX3 A;  4WXH A;  4NC8 A;  5FD5 A;  2V1N A;  1FY7 A;  3U1K A;  5KCM A;  3GF2 A;  5GTI C;  4I02 A;  2K3P A;  5JFR A;  1IGN A;  1ETO A;  2K4B A;  2ZFU A;  4FCY A;  2UUZ A;  3BR3 A;  1HSJ A;  3CDH A;  3M7G A;  5HVQ C;  4N9H A;  4X6A J;  1QU3 A;  4HAM A;  2LBF B;  1IV6 A;  5ERI A;  2M7A A;  2P5V A;  4CSW A;  3K1P A;  1P9Q C;  5L3D A;  1FZP B;  4KIB A;  1SD4 A;  1MBE A;  3GME A;  2R7U A;  3DPT A;  3R6S A;  2ZXH A;  4BXX J;  5HOD A;  4ESJ A;  3VYS B;  4F52 A;  1J9I A;  3F8F A;  1G2H A;  3PO2 J;  2EPF A;  4I76 A;  1K78 A;  1SAN A;  3EUA A;  2OTL I;  2DN0 A;  3M8J A;  3O3K A;  1FYK A;  2LFB A;  3LSP A;  3L2U A;  3IKT A;  4FT8 A;  4QPQ A;  4S04 A;  3PUF A;  2CSO A;  4RAF A;  3CUQ A;  5K5O A;  4YEL A;  2V7F A;  2DQL A;  2ISZ A;  3CJT B;  2H1K A;  3T8R A;  2HXI A;  4FET A;  4Q47 A;  2E1M B;  3MKW B;  2FX0 A;  2ID6 A;  3I0T A;  1R4M B;  1Y56 A;  2XAS A;  3FXK A;  4D1Q A;  2E2J J;  4MFE A;  4IHX A;  4KNY A;  3Q0V A;  3F8C A;  1MMN A;  2XPW A;  4IXA A;  3RKX A;  1S29 A;  1ULY A;  1BM9 A;  4LD5 A;  4EM0 B;  1XMX A;  2HOS A;  3UR3 C;  1EJ9 A;  3HG9 A;  1J5Y A;  2CQ7 A;  2DOA A;  2JVH A;  4XRS A;  2GXB A;  4G8X A;  3JRA A;  1B59 A;  1GHC A;  3O6B B;  1U9N A;  4UXN A;  3I4N J;  3QYB A;  3VOD A;  3K6G A;  3ZMV A;  1R49 A;  3AKZ A;  1MD0 A;  3I54 A;  5LRS A;  2ZJP F;  4A3M J;  2KHM A;  2O03 A;  3H0D A;  2VBZ A;  2Y75 A;  3S2H J;  1GV5 A;  4FIS A;  4OU0 A;  4UHT A;  3CO6 C;  3S16 J;  1BI2 A;  1G6N A;  2JZY A;  1MJA A;  2VE8 A;  3H5A A;  2CV2 A;  2IRF G;  4PJN A;  3KYL A;  5ICC A;  1DGW Y;  3V8K A;  4EM1 A;  3K4B A;  4XLC A;  2M8E A;  3GTJ J;  1OQY A;  5E1W A;  1KYW A;  2PMZ A;  2E7X A;  3GLL A;  4LLN A;  4MHG A;  4FAS D;  4YIF A;  4EEF G;  2GQQ A;  3KE2 A;  5HLI A;  2R7R A;  2VJ4 A;  3BZ6 A;  2R7D A;  2YX4 A;  4H4K C;  1XGS A;  4PZJ A;  4B43 A;  1ON1 A;  2JUG A;  3FBI B;  3OYF A;  2ZXW H;  3JRH A;  1F1Z A;  2WV0 A;  1HW2 A;  3GTP J;  3LA2 A;  1KU7 A;  1FPQ A;  3EUH C;  1W4M A;  1I5Z A;  1IRX A;  1VF9 A;  5CQE A;  3RYR A;  4BE0 A;  1Z9C A;  3W6J B;  2IEK A;  4LIT A;  1W0U A;  5GP9 A;  4HYE A;  5EGO B;  4EV0 A;  1JKP C;  4Y15 A;  3SZT A;  1TQM A;  4LGW A;  1MMA A;  2A61 A;  2ME6 A;  3L2R A;  3CCQ I;  3K4C A;  1Y39 A;  1Q1V A;  5J47 A;  1HA8 A;  4GCV A;  3CCV I;  2Z2S B;  2Y48 A;  1O7L A;  1ZHF A;  1FWZ A;  2HTS A;  3V7S A;  1WPK A;  1VQO I;  1B72 B;  5FRO A;  5KNL A;  1KU3 A;  3ZQC A;  3CME I;  1EH6 A;  5F04 A;  2JSP A;  4HDV A;  2IXS A;  3PJR A;  4XOT A;  2VOP A;  2K7L A;  3JCU C;  2XF6 A;  4DW6 A;  1G3S A;  1O57 A;  3S2D J;  2IS2 A;  3IKV A;  1ZKG A;  1TNT A;  1ETV A;  4NUB A;  5B1A H;  1OCT C;  3RZO J;  5E79 C;  2H8R A;  2JK3 A;  3TO7 A;  3MN2 A;  2V9K A;  2QQ8 A;  3GUD A;  3DEE A;  3ERE D;  4ZYE A;  2X48 A;  2NVQ J;  2XGE A;  2KZV A;  4MTE A;  3UNG C;  3VDX A;  2BY1 A;  4E7Z A;  1RET A;  4A6D A;  3CUQ C;  4G7Z F;  5KAF C;  1OYI A;  3BG9 A;  5K7Z A;  2R7S A;  4XLA A;  1IUF A;  2K85 A;  4PGG A;  4XK4 A;  3HOW J;  3WTT C;  1BBY A;  1I3Q J;  1ZGA A;  4ENN A;  2MLK A;  2ZJ2 A;  1WCM J;  5H6R A;  3GWZ A;  3DEW A;  1POG A;  4OIP F;  2M1B A;  1YRN B;  3HDD A;  3OIO A;  2IA0 A;  4UV8 A;  2E5Z A;  1H0M A;  2UXX A;  3V7C A;  1V3F A;  2BEO A;  1H9G A;  5KK1 A;  5IYC J;  1Y8Q B;  2VPR A;  2LRD A;  1XSV A;  1BL0 A;  1KYZ A;  2EA2 A;  1R9T J;  4BE1 A;  2ADU A;  1TW2 A;  3QPH A;  4EVI A;  3WGG A;  1FT9 A;  2R4G A;  4E70 A;  3D5L A;  1BJZ A;  1FBQ A;  3VB2 A;  2LBF A;  3VYU B;  1BW5 A;  2COB A;  3LQQ A;  1R1U A;  1X1P A;  4XKB A;  5FKO A;  4EJU A;  4Q4Z F;  4B48 A;  2XGC A;  5FKK A;  3TL4 X;  1G59 A;  1UST A;  1D8K A;  1SFX A;  2MD0 A;  1A5J A;  3GXO A;  2DMN A;  4D5F A;  4U0Y A;  3KPH A;  4MEX F;  4KMF A;  2EV5 A;  2RC4 A;  3ZOB A;  1O3T A;  3CF5 F;  3OYL A;  3M8F A;  3QOE A;  1GXP A;  2ZNY A;  3DQV C;  2CWE A;  2ACJ A;  4XQF A;  3DPU A;  1EH8 A;  4LK1 F;  3U2R A;  4PFP A;  3ERM A;  4XID A;  1JGG A;  2RQQ A;  2M30 A;  2HKO A;  1IN7 A;  2EZK A;  2PFB A;  1PP8 F;  4HDU A;  4JBA A;  4EGY A;  4ENM A;  5JI6 A;  3EPZ A;  3OYA A;  5FKL A;  2LSO A;  4P1W A;  4MNU A;  3J7A O;  2VJI A;  2R92 J;  1ETY A;  1SVM A;  4KT6 A;  5CYV A;  3NAU A;  4D5C A;  1QQI A;  2H1L A;  4ASN A;  1DDN A;  1KQ8 A;  3QP6 A;  1NK3 P;  1X1C A;  2RAE A;  2NOG A;  3DTI A;  2X6O A;  1P4X A;  3GLX A;  2Q2E B;  2HR3 A;  3WTU C;  3JSO A;  5HS8 A;  2QCO A;  2VC0 A;  5HLT A;  2F5E A;  3L1P A;  3H1C A;  4J01 A;  4KMU X;  3PL8 A;  3E97 A;  3CCE I;  2L3D A;  2VOO A;  1A6I A;  4G94 A;  3FM3 A;  3V42 A;  1FYM A;  2NS8 A;  2FUG 2;  2ZME B;  1XGM A;  5BOX A;  2QLZ A;  3K70 D;  4RLF A;  2L7F P;  4DYQ A;  1RZ4 A;  2K4J A;  3X2Q H;  2P7V B;  5DM6 F;  1S7E A;  1U0J A;  3G71 I;  1EF4 A;  4Y33 A;  3BJ6 A;  2VPL A;  1MW7 A;  4GYG A;  1SVO A;  5DUK A;  2HDC A;  4LOC A;  3GYH X;  2TCT A;  4E4H A;  5EGO A;  4M6Y A;  1IV8 A;  3HTS B;  4OIO F;  1SFU A;  1UG0 A;  1HC8 A;  2LH9 A;  3FKI J;  4BHP A;  4XKV A;  2BXZ A;  5FGM A;  2HOT A;  3ECO A;  1WQ2 A;  4XSX F;  4BS9 A;  2PMU A;  2ZKZ A;  2CUZ A;  2EFW A;  2CW8 A;  4M3E A;  1B72 A;  2E1C A;  3P9C A;  1XCV A;  2NS0 A;  2KQR A;  2Y0S A;  3H0G J;  1ZRE A;  1TL8 A;  4A3B J;  4B1R A;  3CCL I;  1SD7 A;  5BNG A;  4A5M A;  2K5C A;  1QA6 A;  2WA0 A;  1LFP A;  3P7N A;  2LKS A;  2DT5 A;  2MFZ A;  3ZMT A;  1DU0 A;  1X4P A;  3LSM A;  1MIJ A;  2I10 A;  2EQR A;  2BVL A;  4RM2 A;  1XMK A;  4OIQ F;  2EZL A;  2ZBK A;  1JJ8 C;  3L2Q A;  4CDG A;  2MC4 A;  2Y31 A;  1WJB A;  2M0C A;  1WWX A;  4CUG A;  5LHI A;  5J4Y A;  4XNF A;  2UWM A;  1LDJ A;  2K9Q A;  2XVC A;  3SHF A;  4IRG A;  4ZYA A;  3HC7 A;  4IQ4 A;  4IHW A;  4TV7 A;  2CFX A;  2E1M C;  1Z05 A;  3V4G A;  4A3J J;  5M5Y J;  3VYT B;  3DTK A;  2W7N A;  1D0Z A;  4EJO A;  4MQV A;  3CC7 I;  2W4S A;  2OAZ A;  3RZD J;  1YRN A;  1LVK A;  2F5D A;  3HUG B;  4NBQ A;  2L5Q A;  1ODD A;  1T08 B;  5D5W B;  4JYK A;  1BR4 A;  5J6X A;  3DWL E;  4WXC A;  1KGS A;  2Y30 A;  3JSP A;  4RLQ A;  2VOD A;  2XPV A;  2Q8K A;  3TOA A;  1R00 A;  4ZYH A;  4RB3 C;  1DPR A;  4DQ2 A;  2FJ1 A;  2CRG A;  3CUO A;  4AU7 A;  1XGN A;  1BI3 A;  1BIB A;  1VQL I;  2EBI A;  3QQA A;  5F0C A;  1W36 D;  4UUV A;  1BW6 A;  2IAI A;  3P9K A;  4XRF A;  2ECB A;  5EDN A;  2LKX A;  2EWN A;  1H88 C;  4C2T A;  4EMS A;  1HBX G;  2KP6 A;  3I59 B;  3A4C A;  2V6E A;  3E7L A;  3G3Z A;  1S8N A;  1V54 H;  1E2X A;  5F1R A;  1U8B A;  1XD7 A;  3FXO A;  5E3N A;  2P81 A;  1Z77 A;  2WTE A;  1MBK A;  3T0Y A;  4LK0 F;  3BTI A;  3HRM A;  4XLN F;  1VQ9 I;  2NVT J;  3EET A;  1X1B A;  4MEY F;  4FX4 A;  2Z3Y A;  1I6H J;  1RPW A;  4BJ6 C;  1I6X A;  3PNT A;  4A3E J;  1Z3X A;  3K7A J;  2HKX A;  4YFX F;  5EYR A;  1SFE A;  2XB0 X;  4YRV A;  1XSD A;  3H3U A;  2KDZ A;  1J0R A;  1J7K A;  3KP5 A;  1CGP A;  1NK2 P;  1F4K A;  2CUF A;  1E17 A;  2Z99 A;  5F08 A;  2HQN A;  3LSK A;  2W85 A;  3K69 A;  4OIR F;  1O7F A;  2X6Y A;  5BQT A;  2NOJ B;  4DIQ A;  2E19 A;  3TMO A;  5GAG J;  1J75 A;  3IRQ A;  2ELK A;  2O9L A;  3F22 A;  1XN7 A;  4RGX A;  2O6G E;  2JT1 A;  2Q2E A;  2FD5 A;  2LG4 A;  2P5K A;  3WG7 H;  1R1T A;  2OQR A;  3W2V A;  1BI0 A;  3H92 A;  3GTG J;  3BLY A;  3ZQG A;  3S17 J;  2ZC2 A;  3JRB A;  4W1U A;  1JUM A;  3H9Q A;  3HKZ N;  2ZME A;  3BWG A;  5DDG A;  2L7Z A;  1NTC A;  2AS5 F;  4R79 A;  4CCO A;  3FMR A;  3WE2 A;  2H8W A;  5FLV A;  2ZCW A;  5ILV A;  2ETH A;  2QYO A;  3OR1 C;  2COM A;  5JHU A;  4KN4 X;  4XLE A;  4HX7 A;  3RKQ A;  2QBY B;  2L4A A;  2E35 A;  3I58 A;  5LFA A;  4KJZ A;  3MKY B;  3K1M A;  4E6K G;  3I56 I;  2ESH A;  3OY9 A;  4G9Y A;  3AAF A;  3MVP A;  1RES A;  4E7J A;  3VWB A;  1Z21 A;  4M3B A;  3TW7 A;  1LEB A;  2OZ6 A;  2CQQ A;  3HIF A;  3NWS A;  2AQF A;  4YFK F;  4RS8 A;  3JRD A;  4B3A A;  2P5L C;  2IS1 A;  5FB2 A;  3IAM 2;  1XS9 A;  4IHS A;  1FSE A;  1R4N B;  3B6C A;  4A3C J;  2YR2 A;  5D4R A;  1JXS A;  3KLN A;  3HOX J;  4PJ0 C;  2DXI A;  4QLC U;  2KMU A;  1OKR A;  2M45 A;  2O7O A;  2WAQ A;  1IC8 A;  1QRY A;  3JRE A;  4RA2 A;  2MAB A;  4BL0 B;  1JUS A;  3A0H C;  5D5V B;  3HHH A;  4CHU A;  3OSG A;  1S7O A;  1T39 A;  3GTL J;  2UZK A;  1ITY A;  1U2W A;  2E71 A;  3T1B A;  2VQG A;  1FC3 A;  4RAZ A;  3AG1 H;  3WHB A;  2AXT C;  3S93 A;  3N05 A;  4JX5 A;  1W5T A;  5LEK A;  3DXJ F;  4RB1 A;  3IV5 A;  3K70 C;  3I55 I;  2FBK A;  2KDO A;  5LBQ A;  4HF2 A;  1JKQ C;  3KP6 A;  2G0E A;  1T0F A;  1O3S A;  1Z1D A;  3FWE A;  4PSX A;  3BT9 A;  1BC7 C;  2IPQ X;  3HUG A;  2LY1 A;  1W5S A;  2LP0 A;  2QQA A;  2BHZ A;  1FP1 D;  2DA6 A;  2EV6 A;  4PJJ A;  2E36 A;  3WU2 C;  5C4X J;  3CDI A;  5ED4 A;  3FIS A;  3PM1 A;  1JTX A;  1F36 A;  1S9H A;  2V6C A;  2PX9 A;  4I0A A;  1QPI A;  3HTU A;  1IDZ A;  4UUS B;  1VQN I;  1GVD A;  1H9T A;  1OYY A;  3D1N I;  3HOU J;  4AYB N;  4JQF A;  5HDK A;  3TQN A;  1ZG5 A;  5FFX A;  1P92 A;  1NG6 A;  4U0W A;  1B9N A;  1Z0X A;  3ZMS A;  3I59 A;  3VSK A;  1ENH A;  1GDT A;  2B7E A;  2QEN A;  3NEU A;  5GAH J;  3FHN A;  2OV7 A;  1B8I B;  1W0T A;  4II2 A;  2EIK H;  2JTV A;  1JI8 A;  1T33 A;  3FM5 A;  2WAE A;  4JK1 X;  3V7R A;  2A5W A;  1T2K A;  2DO7 A;  4GYI A;  2BZT A;  2E2H J;  3HPH A;  4MTD A;  3DKX A;  5TIS C;  1SD5 A;  1I39 A;  3VFZ A;  3FK7 A;  1DP7 P;  2EK5 A;  1VQK I;  4RM3 A;  2YS9 A;  4QSH A;  3W2W A;  3OWT A;  3HSE A;  3ZQH A;  2O3F A;  2ZXI A;  2VBX A;  3ZMD A;  4WX9 A;  1Y1W J;  4E7K A;  3CLO A;  1ZAO A;  3OYK A;  3RCO A;  3H5N A;  4G6Q A;  2DOE A;  4C3I J;  4HW0 A;  2OCE A;  3E0J B;  5L3E A;  1FYL A;  2M87 A;  3C1D A;  3D0S A;  2LY9 A;  1HDD C;  1LNW A;  5CVJ A;  3WHC A;  3CCM I;  2KIF A;  4JX6 A;  3SJM A;  1XCB A;  1TWH J;  1ZEL A;  1IN8 A;  1CQT A;  1WVR A;  5LEJ A;  1X1A A;  2VAS A;  1B4A A;  5LD2 C;  5FFZ A;  1FEX A;  3L09 A;  2YX7 A;  3HOY J;  2M3A A;  1YS7 A;  1N75 A;  3GTO J;  2KZG A;  2QM3 A;  2WC2 A;  1ZK8 A;  4O5V A;  3M1C A;  3TED A;  4XMY A;  1MBJ A;  1W36 C;  2MA3 A;  2NNN A;  4L5I A;  4U88 A;  4BJT A;  2RKH A;  4LB5 A;  3RQI A;  4BDZ A;  3BY6 A;  2CV1 A;  1Z6T A;  3F6V A;  1D5Y A;  2VXD A;  4BBS J;  3CP8 A;  5FO5 A;  4ZDL A;  2XAQ A;  4HST A;  1ZAR A;  4C3J J;  4BY1 J;  2QBY A;  4AVP A;  1T0F C;  1GUU A;  1HDP A;  1XDS A;  3ZQQ A;  2HS5 A;  3LFK A;  4C30 A;  2F48 A;  2E1N A;  2Y0M A;  5GAE J;  1GT0 C;  3CF2 A;  2AHQ A;  2EB7 A;  1WJF A;  2OQG A;  1BOB A;  4FHT A;  4V2G A;  1P2F A;  2E60 A;  2V79 A;  4CO8 A;  1E0E A;  1HOM A;  2KRH A;  3DFG A;  4HG2 A;  3IC7 A;  2HWV A;  3ZN1 A;  1XB4 A;  2ELH A;  3ZCO A;  4ITV A;  2JWT A;  3KEO A;  2M34 A;  2FU4 A;  1ZLJ A;  2OF7 A;  2A6H F;  4I7H A;  5D5X B;  3SDB A;  1E3H A;  1TP4 A;  2GLO A;  2EH3 A;  1KA8 A;  4UVB A;  5JLW A;  5HNH A;  2V1X A;  1D1B A;  2PN6 A;  4LB6 B;  4KIS A;  5DUI A;  5CVV A;  4FTH A;  3GO5 A;  5CLS A;  2XHK A;  4BYY A;  3MQ0 A;  4IZZ A;  1YYV A;  2YU9 J;  3QRF F;  3HBL A;  2MSY A;  2BHY A;  3LSH A;  3H3Z A;  5EF6 A;  1RKT A;  1USS A;  1R6R A;  2XGX A;  3LAP A;  2O8X A;  1OCC H;  2VQH A;  3CCJ I;  2FBI A;  3LA7 A;  3ABU A;  2CO5 A;  2QKL B;  2X51 A;  5ICF A;  4OMZ A;  1Z7U A;  3J80 K;  1LJ9 A;  1MJ9 A;  2UXN A;  1Z67 A;  5KAI C;  1O4X A;  2GM4 A;  3I71 A;  5ICG A;  2HYG D;  3K4M A;  3R0J A;  1RRJ A;  2PMH A;  1Y0U A;  5JHF A;  4KYW A;  3U9G A;  3TW6 A;  2RRE A;  3AG2 H;  2GAU A;  2DQR A;  3ESW B;  2TRT A;  2FNP A;  3KEY A;  4BH9 A;  3PSF A;  3Q9V A;  2LRE A;  2GXG A;  4M9X A;  1VQ4 I;  2LYC A;  2XF7 A;  1P7J A;  2EZH A;  2JQ7 A;  2EFN A;  2H09 A;  2RVC A;  3WOD F;  3S3O A;  3JTH A;  1WRJ A;  2V1U A;  2HDD A;  2XRL A;  2E5N A;  4E7H A;  3HOV J;  5H2F C;  2XSJ C;  2ZJQ F;  2HQA A;  2FQ3 A;  3E6D A;  3K1N A;  3OYD A;  3IWF A;  3FXM A;  4UUS A;  3L9F A;  2LF8 A;  2VKD A;  4UVC A;  3G1O A;  4N0B A;  2IGM A;  2B0L A;  3BP8 A;  2PI0 A;  2DYS H;  2L54 A;  1MDM B;  3Q0W A;  1Z91 A;  1IO2 A;  3HRT A;  4BGD A;  1LUJ B;  3WTX C;  4B09 A;  2X1E A;  3CMA I;  1MBH A;  1G3T A;  2BY2 A;  4ON0 A;  5A2Q K;  3OYB A;  2A07 F;  2R7F A;  3IH3 A;  4RGR A;  2R5Z B;  1PUF B;  1B8I A;  3O8H A;  1E3P A;  4WF2 A;  4M74 A;  4Y7N J;  2M4K A;  3WTY C;  3S1R J;  3LAJ A;  1U9O A;  2KRF A;  4HEA 2;  3MZ8 A;  2HYJ A;  2A5Y B;  3BQY A;  5H20 A;  2M0M A;  1QVU A;  3EDP A;  3BG6 A;  2IJL A;  2KIS A;  3CO7 C;  2BBY A;  3ZQF A;  2FXA A;  1HKQ A;  5L3G A;  3ZMU A;  5DM7 F;  4MGR A;  3BZK A;  4AIK A;  4KT5 C;  2XAG A;  4CYC B;  2KJC A;  3SEQ A;  4M3D A;  1UCR A;  2HOE A;  2KIQ A;  4BQN A;  2EFO A;  1T98 A;  2OC6 A;  3K0L A;  2GZW A;  3LFU A;  2XKP A;  1VQ5 I;  5DCF A;  4OIN F;  1LVA A;  5FLX K;  4XL9 A;  1Z3Y A;  2GA1 A;  1LQ1 A;  4WWC A;  4HX8 A;  1H8A C;  1ZR2 A;  5E17 F;  2JSC A;  2HOA A;  5FKM A;  2X0L A;  4A0Z A;  3V8J A;  5FLX Z;  4U0V A;  1QHG A;  1UB9 A;  2JRM A;  3K4K A;  4ZZD A;  1WZ2 A;  3OSF A;  3FHZ A;  3ZGK A;  4BQQ A;  3F23 A;  1SFO J;  2DK8 A;  1IDY A;  2MW8 A;  2MH9 A;  2L01 A;  2BYV E;  2J5P A;  3J7Z I;  3JRF A;  2PEX A;  3BTL A;  3OYH A;  2O61 A;  1LE8 B;  4M6V A;  3ZRG A;  3UKG A;  2PJR B;  1W5C C;  3QPT A;  3F72 A;  5IT9 K;  1XX5 A;  2RN7 A;  1AA7 A;  3SEZ A;  1BA5 A;  1C0W A;  3CJN A;  3S8P A;  2RQP A;  3I53 A;  5E8G A;  1R5H A;  4BXU A;  5F64 A;  1ZR4 A;  2CGP A;  3AG4 H;  5KHD A;  2EJR A;  3KFW X;  3OYJ A;  1YOV B;  1S7A A;  2OJE D;  1FBU A;  4E7I A;  3I64 A;  1W7P B;  1D1A A;  2X9D A;  3N97 A;  1QBJ A;  3BR6 A;  3ASN H;  1WKM A;  4I0B A;  4ZTF A;  3K4L A;  3G6E I;  1GV2 A;  2NNY A;  4Y4R A;  4E7S A;  2IW5 A;  1YFH A;  2NVU B;  3KIO A;  1WSU A;  4A93 J;  1YJW I;  4ZYG A;  4MLO A;  4BAY A;  4M9S A;  2DA1 A;  2VIX A;  1LFB A;  3ABT A;  2FML A;  2EA4 A;  4UVA A;  3FMQ A;  5JR3 A;  2EFQ A;  3B6A A;  4AD9 A;  2CMP A;  5J4V A;  2A69 F;  2A6T A;  1FBS A;  1BIA A;  1KON A;  9ANT A;  3K9T A;  2PQ8 A;  2LC2 A;  2QZ8 A;  3E5U A;  3GBG A;  2CQK A;  2E1O A;  3BPX A;  2IA2 A;  1BR2 A;  1ZLK A;  4G7H F;  2V4J C;  3MD2 A;  3H3V K;  3F6O A;  4J00 A;  4RAG A;  3S1M J;  3ECH A;  5M3M J;  3GZN B;  2R7Z J;  1UHW A;  1MSF C;  1W7P D;  2FEZ A;  4CCM A;  1TWC J;  1WJ5 A;  3KLO A;  4BXF A;  1R71 A;  3LWF A;  3H35 A;  3PNY A;  2H6B A;  1BI1 A;  1Y6I A;  2HU9 A;  2UV1 A;  5IT3 A;  3TBI A;  1ZTR A;  3HRU A;  4UUT A;  5E20 A;  2W48 A;  2V9V A;  3KP2 A;  4YII A;  4F92 B;  1OMI A;  4B8X A;  3HXL A;  1S6L A;  2DTR A;  2M2E A;  3RJP A;  5B5E C;  1JE8 A;  2ZXJ A;  2OBP A;  4HA8 A;  4OWR B;  3KZY A;  1XSX A;  2DBB A;  3BG7 A;  1GVJ A;  5LHG A;  1D5V A;  2CU7 A;  1ORK A;  2KRC A;  2JA8 J;  3BOQ A;  1O3R A;  4O3M A;  2V9P A;  1ETQ A;  2FBH A;  3HZJ A;  2HEO A;  2KKO A;  3FIW A;  5EEG A;  5IOY A;  4Y3O A;  1ZN2 A;  1OIS A;  3S1N J;  4DBR A;  1MDM A;  4OAZ A;  4LLL A;  3KYC B;  3CJR B;  4XM3 A;  1ZRD A;  1SEU A;  5HLG A;  1CF7 B;  3IWZ A;  1YHQ I;  3ONQ A;  5FRM A;  3DV8 A;  1JUP A;  2DMP A;  2LNB A;  3HSF A;  4LG0 B;  1IUY A;  2R3S A;  2KIM A;  3E5X A;  2R5Z A;  1PUF A;  3ML6 A;  4AVZ A;  4PGH A;  3OYM A;  3CQZ J;  2VJJ A;  4A2U A;  1R36 A;  3RTR A;  4L9T A;  3HOS A;  2FNA A;  3EUK L;  1P6R A;  5IPA A;  1YS6 A;  4BU2 A;  3FXL A;  4XRS G;  2ME0 A;  2DOF A;  3L00 A;  4HV5 A;  1V5F A;  4P96 A;  4DZJ A;  4I2O A;  4G7O F;  3PSI A;  3GZ6 A;  2XIG A;  2F4I A;  3BG3 A;  3GVA A;  1YO5 C;  1TT0 A;  4CYC A;  3L2C A;  1Y0N A;  2DA2 A;  2RNJ A;  1K79 A;  1S5L C;  4ETS A;  1R5G A;  2VXZ A;  4A0X A;  3OYC A;  4YEJ A;  2L9R A;  3QAH A;  2HQR A;  2ISY A;  2CQX A;  4OOI A;  1IG7 A;  1OCO H;  5LHH A;  1R7J A;  2FOK A;  2K9S A;  2LMD A;  1X58 A;  2D45 A;  5EZH A;  3EYI A;  4HF0 A;  2XRO A;  1VZ0 A;  4R8H A;  2XGD A;  3Q9S A;  3NQO A;  3J81 K;  1X1D A;  4YIR X;  3W6V A;  1TWG J;  3CJQ B;  1T56 A;  2R7O A;  4XOP A;  3CC2 I;  1ZRF A;  2W00 A;  5J1Y A;  3AL0 B;  2JRT A;  3ZPL A;  3VPR A;  3J81 Z;  5M5X J;  3JAM K;  1B6A A;  3ZN0 A;  1YTY A;  4AWX B;  2KPM A;  2RNG A;  2QEX I;  3TDU C;  1JKR C;  1K6Y A;  3COA C;  4A3I J;  1TWA J;  3JAM Z;  3FK6 A;  3I3L A;  1LE8 A;  2PJR A;  3SQN A;  4XRM A;  2PLY A;  2W57 A;  4PK4 A;  4PCQ A;  3OYG A;  2HPI A;  2KL4 A;  2HVS A;  4X1E A;  5GPC A;  2BW3 B;  1PDN C;  1UZC A;  3KX2 A;  2MG4 A;  1G3W A;  3CLQ A;  2Y69 H;  2IBD A;  5K7H A;  4QPO A;  3C18 A;  2OUM A;  1U78 A;  2BVM A;  2DU9 A;  1W7P A;  2Q0O A;  3S1Q J;  4I6Z A;  4C2U A;  4B47 A;  3M3Y J;  1VQ8 I;  4JP0 A;  2EIL H;  2H6C A;  4N9I A;  4S0H B;  3HOT A;  5AON A;  1QPM A;  1WFX A;  2ZO4 A;  4B44 A;  4RB0 A;  2A3S A;  4IHV A;  2CS3 A;  2L7K A;  2DAO A;  3IRR A;  3HYI A;  1QNT A;  3O2P E;  2VKV A;  3H9J A;  4HBL A;  3W6K B;  4GDF A;  2R7V A;  4NQW B;  1ZH5 A;  2IGK A;  3MAJ A;  3L2V A;  4E7L A;  1GLN A;  5F1J A;  4A3D J;  1WJE A;  4N4N B;  2I5U A;  2VON A;  4AYB A;  5B3S H;  3ZP5 A;  4KFC A;  1FTZ A;  2HGC A;  3OMY A;  1F5T A;  3CDL A;  3G1L A;  3LQR A;  5GTH C;  1YW9 A;  3MFK A;  2L9S A;  5GPA A;  3RQ4 A;  5BS6 A;  2D1V A;  2KLO A;  2XV4 S;  3F8N A;  2QSH X;  1ONV A;  2IVM A;  3GX4 X;  4L9J A;  3BR0 A;  1DQU A;  2X1D A;  2DA7 A;  4BKX A;  4HPQ A;  2YU3 A;  4YFN F;  4QTR A;  1O3Q A;  2WB1 N;  3E5Q A;  4ZJZ A;  3H9G A;  2AXL A;  3Q3S A;  1ZQ3 P;  1SVL A;  2FSW A;  4C3H J;  2H94 A;  1MSE C;  1WI9 A;  2HQ5 A;  1QZE A;  2DA3 A;  2F4M B;  1H89 C;  1TZL A;  4ZDP A;  2JA7 J;  1FOY A;  3PQJ A;  2OA4 A;  4I01 A;  1YJN I;  1RR7 A;  4IQJ A;  2R7X A;  2BY0 A;  1B1B A;  3A1Y A;  3RKY A;  3S32 A;  2MH2 A;  2HI3 A;  4RDU A;  4GGG A;  4M3F A;  2DPD A;  4HNV A;  2WV1 A;  1VND A;  3TKY A;  5ILU A;  5HLH A;  5F0H A;  4OMY A;  3JW4 A;  4L9V A;  3I5U A;  3GW2 A;  1G3Y A;  1BR1 A;  4AC0 A;  4HF1 A;  2DI3 A;  1D0Y A;  2MBF A;  3F8B A;  2XPU A;  3KEQ A;  3R4K A;  3Q5F A;  1REP C;  4XLP F;  5BPD A;  1CF7 A;  4RGU A;  6PAX A;  2I8D A;  4M73 A;  3BCB A;  4PFO A;  1X3Z B;  2D5V A;  4LG0 A;  3A02 A;  1QZZ A;  2D2W A;  1LFU P;  4CCL A;  1J2X A;  4A3K J;  3HM5 A;  1IN5 A;  3BTC A;  4D7M A;  4HNU A;  1IW7 F;  5E1Z B;  3KP7 A;  2DJI A;  3BZC A;  1IXR C;  3RYP A;  1OR7 A;  2DT6 A;  4HRI A;  3E3V A;  1F9N A;  1PUE E;  3GTM J;  1MMG A;  3DU6 A;  1HKS A;  2K86 A;  2MD5 A;  3K4N A;  2DDA A;  5J8F A;  1NH3 A;  2W82 A;  4C2M J;  1G8X A;  1MH3 A;  3TGN A;  4CH7 A;  2VUM J;  1FJL A;  1IXS B;  4L0Z B;  4CZC A;  2CW7 A;  2XC7 A;  1JT0 A;  2LY2 A;  4RAY A;  4P9F A;  1IJW C;  3IL2 A;  4MO7 A;  2HNH A;  1AHD P;  2GIZ A;  3FXU A;  3F8M A;  1I1G A;  3H36 A;  1D3Y A;  3DBH B;  3TDZ C;  3A0B C;  4XN3 A;  5FLM J;  2DPU A;  1RNL A;  5M3F J;  2KIU A;  2VBW A;  1TWF J;  4A0Y A;  1SD6 A;  1YIJ I;  2DFF A;  3FMS A;  2JA2 A;  1SMY F;  1U3E M;  5GAD J;  3ZXS A;  3WTZ A;  5K5R A;  3RKW A;  1I27 A;  3J7A Y;  1U5T B;  1STZ A;  1WI3 A;  2DCE A;  1DGR M;  3SYT A;  5L3B A;  5D6F A;  4L18 B;  4L0Y B;  3WTV C;  3TOB A;  3A2K A;  4UB8 C;  3VSL A;  1ETW A;  2VQL A;  3FX3 A;  2K9M A;  2OU2 A;  3SZP A;  2L7M P;  3QWL A;  4XOR A;  2EV0 A;  3RPQ A;  4AID A;  1D8J A;  3K4J A;  5IP7 J;  4LLG F;  2BW3 A;  4D0P A;  1MMS A;  3ULQ B;  4DYR A;  5F6F A;  2M5W A;  2HZT A;  3LNQ A;  4RBO A;  2Z9O A;  1MJB A;  2QA4 I;  4Z6Y A;  2KFD A;  3WTS C;  2FRH A;  1SMT A;  5BMZ A;  2STW A;  4PSW A;  3QPL A;  2G7H A;  2GA2 A;  3M07 A;  3SFZ A;  2BV6 A;  1YG2 A;  2DLL A;  3C7J A;  1ETK A;  2HFH A;  3QOD A;  4WXD A;  2K3F A;  2LKP A;  5DD4 A;  2R7T A;  1UEL B;  4FE4 A;  3TP0 A;  1G4D A;  1DP3 A;  3BR1 A;  2IGO A;  2B9S A;  4DNC A;  3OS0 A;  2VJ5 A;  5HS9 A;  2V26 A;  2L2O A;  4NQW A;  5EEH A;  1UG2 A;  2WAQ N;  3HSR A;  1X4O A;  3K10 A;  3CP2 A;  3C3W A;  1SC7 A;  3O8G A;  1A04 A;  3LSI A;  1TTY A;  1L3L A;  4NC7 A;  5AIP A;  3FZV A;  1RKW A;  2ZB9 A;  3VOE A;  4HQE A;  3HEF A;  3DU5 A;  4LFU A;  2AO9 A;  4M9Z A;  1K4S A;  1P4W A;  1FTT A;  1YI2 I;  3CTA A;  4F55 A;  1IAW A;  4IHY A;  2LF7 A;  2RV8 A;  1RUO A;  2LD5 A;  2ESN A;  2CJJ A;  3SZG A;  4Y52 J;  1OR7 C;  4LG3 A;  4MIM A;  1IZ1 A;  3S3M A;  2HVQ A;  1GXQ A;  3KET A;  2NRA C;  4O6J A;  1D1C A;  3DP7 A;  2F2E A;  3IH4 A;  2JJ7 A;  4W97 A;  2DT7 B;  1EA3 A;  3GFL A;  4A5N A;  1ACI A;  1FIP A;  3MZH A;  3KP3 A;  1KU2 A;  3GEZ A;  5IY5 H;  5EJC A;  1X2N A;  2VBY A;  5DV5 A;  1TW3 A;  4QIW N;  2VT2 A;  1V55 H;  4XR6 A;  4GFB A;  1QHH D;  1M1E B;  2X6W A;  2MGQ A;  2Q1Z B;  2FF4 A;  1MBG A;  3AG3 H;  4NNJ A;  5DEQ A;  2FMY A;  2F5V A;  1WJC A;  3CD6 I;  1OCZ H;  2KT0 A;  4ESF A;  3DKY A;  2GOM A;  3KYD B;  1DUX C;  1KQ0 A;  5DYM A;  3GFI A;  3MWM A;  3AL0 C;  3JTG A;  4D9J A;  1ZG3 A;  2ZFW A;  1DPU A;  2QWW A;  2VN2 A;  3LSG A;  1YW8 A;  3BR2 A;  1XG1 A;  4P55 A;  4DBQ A;  2E2I J;  1WJD A;  1EV7 A;  3DTE A;  4PJM A;  4DOZ A;  5K7F A;  3PIP F;  2FQ4 A;  2EFP A;  4IX7 A;  1OCP A;  3WU0 A;  2ZNZ A;  4GO1 A;  1HW1 A;  4ABZ A;  1FNN A;  3J80 Z;  3OOP A;  5CKT A;  1MKM A;  2VQC A;  2WBM A;  3U1D A;  1VQ7 I;  2NS7 A;  2P0W A;  4CXF A;  3IHU A;  2F5F A;  1APL C;  4F93 B;  2VE9 A;  3BG5 A;  2LLK A;  1LDK B;  1YW7 A;  1ON2 A;  3DKW A;  5EG0 B;  4IEJ A;  4Y17 A;  2XSD C;  4KN7 X;  4GXO A;  5F27 A;  4AUX A;  2HPM A;  4MQ9 F;  4D7N A;  4IOA F;  4KIC A;  4M3G A;  1JTY A;  3QPS A;  4F7Z A;  2R5Y B;  3QU6 A;  2STT A;  4BUP A;  4XSZ F;  1OPC A;  2QUF A;  3GCM A;  1VQP I;  2P8T A;  3BR5 A;  4EJT A;  2K9L A;  2R93 J;  5CQG A;  3GTK J;  4J19 A;  3D5R C;  1I50 J;  3U21 A;  4A3F J;  1W1W E;  1JT6 A;  3GFM A;  2Z16 A;  2PBI A;  3G73 A;  2QQB A;  4HNT A;  3D5S C;  4BNC A;  3OIQ A;  4B3X A;  3WTW C;  2FA5 A;  2DDB A;  2E34 A;  5F0F A;  2MYS A;  1Z7L A;  3ZR8 X;  2F4O B;  3DCF A;  4L5J A;  4PDK A;  3REO A;  1PP7 U;  2X6X A;  1A35 A;  2QKM B;  3RSN A;  3ROU A;  2XUB A;  4HX4 A;  3BDD A;  1LDD A;  3IUO A;  1RC9 A;  2OZU A;  1IN4 A;  4XKC A;  3TO6 A;  3A01 B;  4II3 A;  4BDY A;  1N25 A;  3E6M A;  5A2Q Z;  3I4M J;  1U5T A;  2VLA A;  5JVG F;  2JA5 J;  3F9K A;  1LB2 A;  3HPG A;  4C9Y A;  2LK2 A;  4ESB A;  3GTQ J;  2NYX A;  3JRI A;  4FE7 A;  3LA3 A;  5FJ8 J;  1I1S A;  3AFH A;  3JRC A;  2HTJ A;  2DFI A;  2P6T A;  4BY7 J;  3OS1 A;  1PVE A;  2ICW G;  1T38 A;  3F0C A;  2YUS A;  4JX4 A;  4S05 A;  2IS4 A;  2XRN A;  2L02 A;  3G2B A;  3QOP A;  2NAZ A;  3LL7 A;  1JGS A;  3G1M A;  3NRV A;  3OYI A;  4NB5 A;  1QO0 D;  4P9U A;  3OV8 A;  3L2W A;  4ZTJ A;  3L7W A;  4BQA A;  3CCU I;  4ANJ A;  2Y9Y A;  1ZGW A;  2QSG X;  4IHT A;  3KCC A;  2DFH A;  3DLA A;  4BE2 A;  4DYC A;  3KP4 A;  4IPA A;  3MEX A;  1SAU A;  3DEU A;  1AOY A;  2PMZ N;  2IT0 A;  1VI0 A;  1UMQ A;  4NC6 A;  3CCY A;  1RIO H;  2C6Y A;  2E7W A;  4PUS A;  1MZB A;  4M6X A;  1ERD A;  3K2Z A;  1XPX A;  2QSF X;  2EIN H;  2MC3 A;  1LPQ A;  1HST A;  5E3O A;  1UJ8 A;  4EAT A;  5D8K B;  3G4S I;  1LEA A;  4F91 B;  1I3A A;  4XON A;  1HXD A;  2XKO A;  1T8I A;  4LMY A;  3LSR A;  3SXY A;  5IT9 Z;  1ZRC A;  1BJA A;  3BJA A;  5J40 A;  1HKT A;  1R58 A;  1D0X A;  1RI7 A;  5LGT A;  4CGZ A;  1HQC A;  3P5J A;  4A6E A;  3OL4 A;  1TQP A;  2MLG A;  5CVI A;  5D4S A;  4V2F A;  4HLY A;  4NHJ A;  4RMN A;  1YIO A;  3LMM A;  1FSH A;  2M7B A;  2OD5 A;  3BQZ A;  4A69 C;  5L3F A;  1AKH B;  1OJL A;  3KZZ A;  1IRZ A;  3RPU D;  3R61 A;  1VQ6 I;  2ZSH B;  3EQL F;  2ID3 A;  2HVR A;  1UHS A;  2LVS A;  2TDX A;  4KIT B;  1BN5 A;  3J7Y J;  2WWY A;  1YIT I;  1WGX A;  3WG9 A;  2JMW A;  2Z1D A;  1K6O A;  3ASO H;  4ZDO A;  3MKL A;  2DJN A;  4G6D A;  3PNV A;  4UV9 A;  3DPL C;  2YPR A;  3LOC A;  3R0A A;  4BEH B;  3M1E A;  3LST A;  1XGO A;  3VEP A;  5EEA A;  2HZD A;  3R60 A;  4AIH A;  2X4H A;  3GFJ A;  2DA5 A;  5FD6 A;  1TC3 C;  2HYF A;  1A36 A;  1J09 A;  1P4A A;  4PJL A;  5DCM B;  2CUJ A;  2V1D A;  3S3N A;  2JA6 J;  2NVX J;  4KDP A;  4EJV A;  1S3J A;  1WHU A;  5LRR A;  2GBY A;  3BJO A;  2W1O A;  1U5T C;  5L3C A;  1RUN A;  1T95 A;  5DTD A;  5M5W J;  4OAY A;  3MCZ A;  5CJ9 A;  4F3Q A;  5LGN A;  2P6S A;  2EIJ H;  4IRH A;  2F5C A;  2AQE A;  3C2G A;  1V5G A;  1PYV A;  4EGZ A;  3B02 A;  2XAF A;  1RR8 C;  2GIV A;  4BHC A;  5K5Q A;  1V5E A;  2IGN A;  4R1H A;  2R0Q C;  3MZY A;  3E6B A;  2K02 A;  4HOB A;  4M71 A;  4CZZ A;  5DD8 A;  5K1Y A;  3PFI A;  4DGW B;  4FX0 A;  1TLH B;  4ZC3 A;  4BAC A;  3QYE A;  3IAS 2;  5E8I A;  5J1U A;  1UFM A;  5EG0 A;  3K2A A;  2K40 A;  3IH2 A;  1XDU A;  2IA1 A;  1IRG A;  1MBF A;  1HCR A;  2VL8 A;  2R5Y A;  4G12 A;  1X3W B;  3ZQL A;  2P4W A;  3FBN B;  1NG7 A;  2W84 A;  2WY8 Q;  3HHG A;  1X3U A;  3FDY A;  3ABK H;  4HV6 A;  1XMA A;  4KA4 A;  1UAA A;  4YG2 F;  3JR9 A;  3CES A;  5IYB J;  1TBX A;  1SFK A;  5C44 J;  4CCN A;  1NHA A;  3NWT A;  2VT3 A;  5LLQ A;  4UNO A;  4CA0 A;  5D6E A;  3HKZ A;  4IJA A;  1R23 A;  5E18 F;  3WGH A;  1FP2 A;  1Q1H A;  3A01 A;  1VFC A;  3FKJ A;  3F3X A;  3PFY A;  2ECC A;  1YLF A;  3SDG A;  5ICE A;  1FOX A;  4XLH A;  4Q48 A;  3ZMZ A;  5IYD J;  1FOK A;  3T8T A;  2XDV A;  3HGY A;  3PIO F;  5E3M A;  2QVO A;  4I98 B;  3BRO A;  4XIC A;  1VQM I;  1E3O C;  4Y13 A;  3ABM H;  3M9A A;  2Z5U A;  3ZQI A;  3OYE A;  4X0G A;  3B73 A;  2JPC A;  2WAD A;  2LDU A;  2M4G A;  1Y8R B;  2CW0 F;  2WB1 A;  5CVU A;  4ENJ A;  2DA4 A;  4ZH4 F;  1OFC X;  2RGV A;  3IP4 B;  4NDL A;  4BBR J;  1J59 A;  4I99 C;  4G6T B;  5CVR A;  4XBF A;  2HXO A;  3HB9 A;  2YSR A;  2X1C A;  1YJ9 I;  2BE5 F;  2DK5 A;  3LSJ A;  2VI6 A;  1K7A A;  5C4J J;  1FOW A;  3FF5 A;  5H6Q A;  3CC4 I;  3ELK A;  1A6Q A;  5C3E J;  4DJA A;  4EQQ A;  1L0O C;  4IVN A;  3RPU A;  5E3L A;  2XAJ A;  4IOC F;  4IF4 A;  2XF5 A;  3HJE A;  4ZZL A;  4ZYD A;  3HOZ J;  3TP3 A;  3S14 J;  3OL3 A;  2KJB A;  1FLI A;  1DU6 A;  3H5R A;  2BXY A;  1A31 A;  2NXN B;  1N78 A;  2D1H A;  2QF7 A;  3HRS A;  4UB6 C;  2VB6 A;  3M8E A;  5ILS A;  3EYY A;  4IKF A;  1ZYR F;  2K9N A;  3NAR A;  2DMU A;  1F43 A;  3PO3 J;  2OCC H;  2DMT A;  1K4T A;  1K61 A;  5DS9 A;  1Z6R A;  4IRI A;  1JKO C;  1R5I D;  2WAF A;  4A3L J;  3DBL B;  1JHH A;  5HS7 A;  3HL2 A;  2CQN A;  2O0Y A;  5FKN A;  4Z2Y A;  2H27 A;  1QZY A;  3PQK A;  3W3C A;  1IXC A;  4B4C A;  3WU1 B;  2FOW A;  2JPB A;  5CPR B;  1AU7 A;  4P5O A;  2GXA A;  1U8R A;  2ELJ A;  3KZI C;  3DBR B;  3QU3 A;  4KIG A;  4LIU A;  4BHB A;  3ABL H;  2P7C B;  2DTZ A;  1AWC A;  1EH7 A;  2VKE A;  3OOU A;  4CCK A;  2L4M A;  5LGU A;  1MMD A;  2Z33 A;  4A12 A;  3DF8 A;  2GOX B;  2Y0S N;  1AKH A;  3QYF A;  4V19 K;  1R22 A;  1WH7 A;  3I9V 2;  4ENK A;  4FQG A;  1KQ9 A;  1TQI A;  1UHM A;  4A3G J;  4DZP A;  3MMY B;  1JHF A;  3C2H A;  2J5O A;  2L9V A;  1YQA A;  1SAX A;  2O8K A;  3WE3 A;  3OYN A;  2EIM H;  4KIF A;  4HLX A;  5IP6 A;  5JLX A;  3RDI A;  4RGS A;  2LOO A;  1PJR A;  2F6C A;  5EZG A;  4BEH A;  3CMM A;  2QGU A;  1MNM C;  2G9W A;  3E1S A;  5TJJ A;  1K78 B;  3S15 J;  5DCM A;  2LR8 A;  4XLF A;  4GRI A;  4HZF A;  5AIQ A;  2W24 A;  5IOZ A;  2PJP A;  2BGC A;  2OTJ I;  2A6E F;  3Q0U A;  3CUQ B;  4MFD A;  1R1V A;  3BC8 A;  4M72 A;  1KZH A;  4L9N A;  4XKW A;  1MH4 A;  5HDN A;  1FMV A;  3A03 A;  4QWQ A;  2IS6 A;  4RB2 C;  4AIJ A;  2BY3 A;  1T6S A;  1FMW A;  1V4R A;  1BC8 C;  5BPI A;  2CH0 A;  1YE9 A;  1MGT A;  4EM2 A;  3W2A A;  2BOL A;  2L9N A;  2A68 F;  3BPV A;  5TGT A;  5TRD A;  3BCA A;  3JRG A;  3CCS I; 
#chains in the Genus database with same CATH homology
 4H0E A;  3WGI A;  1U6G A;  2IP2 A;  1VTN C;  2K27 A;  1HW5 A;  3RI4 A;  3RIR A;  5HOO A;  1B9M A;  4CYD A;  2G7U A;  4Q5S F;  1IF1 A;  5KVR A;  4WK8 F;  4KUM A;  1IN6 A;  3S2W A;  2RDP A;  2VC1 A;  3GZ5 A;  5HDG A;  2GWR A;  2FE3 A;  1ZGJ A;  4LJZ F;  4U7B A;  3V8L A;  1IRF A;  4EJW A;  1FX7 A;  5E1X A;  3ZQ7 A;  1ZG1 A;  4K2E A;  5D5U B;  4I09 A;  2XAH A;  3ISP A;  4CIC A;  1BOA A;  5D8L B;  2CG4 A;  3E6C C;  1TNS A;  4U7D A;  3QP5 A;  2CYY A;  5JVT A;  1OYW A;  2W25 A;  3I4P A;  3FXR A;  3T5X A;  3FXQ A;  3N4M A;  2QQ9 A;  4WCG A;  5J8C A;  1KU9 A;  2DW4 A;  3P9I A;  4HQM A;  3F21 A;  3EUH A;  1QGP A;  2PG4 A;  3TO9 A;  4WXH A;  5FD5 A;  1FY7 A;  3GF2 A;  4I02 A;  5JFR A;  2K4B A;  1HSJ A;  3CDH A;  3M7G A;  5HVQ C;  4N9H A;  4HAM A;  5ERI A;  2P5V A;  3K1P A;  5L3D A;  1FZP B;  4KIB A;  1SD4 A;  3DPT A;  3R6S A;  4ESJ A;  1J9I A;  3F8F A;  1K78 A;  3O3K A;  1FYK A;  3IKT A;  4FT8 A;  4S04 A;  2CSO A;  3CUQ A;  5K5O A;  2DQL A;  2ISZ A;  3T8R A;  4Q47 A;  3I0T A;  2XAS A;  4KNY A;  3F8C A;  4IXA A;  3RKX A;  1S29 A;  1ULY A;  1BM9 A;  4LD5 A;  4EM0 B;  1J5Y A;  2GXB A;  4G8X A;  1B59 A;  1GHC A;  3O6B B;  4UXN A;  3VOD A;  3ZMV A;  1MD0 A;  3I54 A;  5LRS A;  2O03 A;  2VBZ A;  2Y75 A;  4OU0 A;  4UHT A;  3CO6 C;  1BI2 A;  1G6N A;  2JZY A;  1MJA A;  2VE8 A;  2IRF G;  5ICC A;  3V8K A;  4EM1 A;  2M8E A;  5E1W A;  1KYW A;  4LLN A;  2E7X A;  4MHG A;  4YIF A;  2GQQ A;  3KE2 A;  5HLI A;  3BZ6 A;  2R7D A;  2YX4 A;  4PZJ A;  1XGS A;  1ON1 A;  1F1Z A;  2WV0 A;  1HW2 A;  3LA2 A;  1KU7 A;  1FPQ A;  1W4M A;  1I5Z A;  3RYR A;  1Z9C A;  3W6J B;  4HYE A;  4EV0 A;  4Y15 A;  3SZT A;  1TQM A;  4LGW A;  2A61 A;  4GCV A;  2Y48 A;  1O7L A;  1ZHF A;  1FWZ A;  2HTS A;  3V7S A;  1KU3 A;  1EH6 A;  4HDV A;  2VOP A;  2K7L A;  1G3S A;  1O57 A;  3IKV A;  1TNT A;  3TO7 A;  3GUD A;  3ERE D;  4ZYE A;  4MTE A;  4A6D A;  3CUQ C;  4G7Z F;  1OYI A;  4PGG A;  3WTT C;  1BBY A;  1ZGA A;  4ENN A;  2MLK A;  2ZJ2 A;  5H6R A;  3GWZ A;  4OIP F;  2M1B A;  2IA0 A;  4UV8 A;  1H0M A;  2UXX A;  3V7C A;  1V3F A;  2BEO A;  1H9G A;  5KK1 A;  1XSV A;  1KYZ A;  2EA2 A;  2ADU A;  1TW2 A;  3QPH A;  4EVI A;  3WGG A;  1FT9 A;  4E70 A;  3D5L A;  1FBQ A;  3VB2 A;  3LQQ A;  1R1U A;  4EJU A;  4Q4Z F;  1UST A;  1D8K A;  1SFX A;  3GXO A;  4U0Y A;  4MEX F;  4KMF A;  2EV5 A;  2RC4 A;  1O3T A;  3M8F A;  1GXP A;  2ZNY A;  3DQV C;  2CWE A;  2ACJ A;  1EH8 A;  4LK1 F;  3U2R A;  2M30 A;  2HKO A;  1IN7 A;  2PFB A;  1PP8 F;  4HDU A;  4ENM A;  4EGY A;  4JBA A;  5JI6 A;  2LSO A;  4MNU A;  3J7A O;  5CYV A;  1QQI A;  4ASN A;  1DDN A;  1KQ8 A;  3QP6 A;  1P4X A;  3GLX A;  2HR3 A;  3WTU C;  3JSO A;  5HS8 A;  2VC0 A;  2F5E A;  4KMU X;  3E97 A;  2L3D A;  2VOO A;  4G94 A;  3FM3 A;  1FYM A;  2ZME B;  1XGM A;  5BOX A;  2QLZ A;  1RZ4 A;  2K4J A;  2P7V B;  3BJ6 A;  4GYG A;  5DUK A;  2HDC A;  3GYH X;  4M6Y A;  3HTS B;  4OIO F;  1SFU A;  4BHP A;  5FGM A;  3ECO A;  1WQ2 A;  4XSX F;  2PMU A;  2ZKZ A;  2EFW A;  2E1C A;  3P9C A;  1XCV A;  2NS0 A;  1ZRE A;  1SD7 A;  4A5M A;  3P7N A;  2DT5 A;  3ZMT A;  1XMK A;  4OIQ F;  2ZBK A;  4CDG A;  1WWX A;  5LHI A;  2UWM A;  1LDJ A;  2XVC A;  3SHF A;  4IRG A;  4TV7 A;  2CFX A;  1Z05 A;  3V4G A;  4EJO A;  4MQV A;  2OAZ A;  2F5D A;  5D5W B;  1ODD A;  5J6X A;  4WXC A;  1KGS A;  3JSP A;  2VOD A;  2Q8K A;  3TOA A;  1R00 A;  4ZYH A;  4RB3 C;  1DPR A;  4DQ2 A;  3CUO A;  1XGN A;  1BI3 A;  1BIB A;  4UUV A;  3P9K A;  4XRF A;  2EWN A;  4EMS A;  1HBX G;  3I59 B;  3G3Z A;  1S8N A;  1E2X A;  5F1R A;  1XD7 A;  2WTE A;  3T0Y A;  4LK0 F;  3HRM A;  4XLN F;  3EET A;  4MEY F;  4FX4 A;  2Z3Y A;  1I6X A;  2HKX A;  4YFX F;  1SFE A;  1XSD A;  3H3U A;  1J0R A;  1J7K A;  3KP5 A;  1CGP A;  1F4K A;  1E17 A;  2Z99 A;  2HQN A;  4OIR F;  2W85 A;  3K69 A;  1O7F A;  5BQT A;  1J75 A;  3IRQ A;  3F22 A;  1XN7 A;  4RGX A;  2O6G E;  2JT1 A;  2Q2E A;  2P5K A;  1R1T A;  2OQR A;  1BI0 A;  3H92 A;  5DDG A;  2ZME A;  3BWG A;  2AS5 F;  4R79 A;  3FMR A;  3WE2 A;  2ZCW A;  5ILV A;  2ETH A;  2QYO A;  2COM A;  5JHU A;  4KN4 X;  4HX7 A;  2QBY B;  2L4A A;  3I58 A;  3K1M A;  2ESH A;  4G9Y A;  3AAF A;  1LEB A;  2OZ6 A;  3HIF A;  4YFK F;  4RS8 A;  2P5L C;  5FB2 A;  4IHS A;  1FSE A;  2YR2 A;  5D4R A;  1JXS A;  3KLN A;  4QLC U;  1OKR A;  2M45 A;  5D5V B;  3HHH A;  4CHU A;  1T39 A;  1S7O A;  2UZK A;  1U2W A;  3T1B A;  1FC3 A;  4RAZ A;  1W5T A;  5LEK A;  3DXJ F;  4RB1 A;  2FBK A;  5LBQ A;  4HF2 A;  3KP6 A;  1T0F A;  1O3S A;  1Z1D A;  3FWE A;  1BC7 C;  2IPQ X;  3HUG A;  1W5S A;  2QQA A;  1FP1 D;  2EV6 A;  5ED4 A;  4I0A A;  2V6C A;  3HTU A;  1H9T A;  1OYY A;  4JQF A;  5HDK A;  3TQN A;  1ZG5 A;  5FFX A;  1P92 A;  4U0W A;  1B9N A;  3ZMS A;  3I59 A;  2QEN A;  3NEU A;  2JTV A;  3FM5 A;  4JK1 X;  3V7R A;  1T2K A;  2DO7 A;  4GYI A;  4MTD A;  1SD5 A;  3VFZ A;  1DP7 P;  2EK5 A;  3HSE A;  2O3F A;  2VBX A;  3ZMD A;  4WX9 A;  3CLO A;  1ZAO A;  4G6Q A;  4HW0 A;  5L3E A;  1FYL A;  2M87 A;  3C1D A;  3D0S A;  1LNW A;  5CVJ A;  2KIF A;  1XCB A;  1IN8 A;  5LEJ A;  1B4A A;  5FFZ A;  3L09 A;  2YX7 A;  1YS7 A;  2QM3 A;  2WC2 A;  4O5V A;  2MA3 A;  2NNN A;  4L5I A;  4U88 A;  2RKH A;  4LB5 A;  3BY6 A;  1Z6T A;  3F6V A;  5FO5 A;  2XAQ A;  1ZAR A;  2QBY A;  4AVP A;  1XDS A;  2HS5 A;  3LFK A;  2Y0M A;  2E1N A;  2EB7 A;  4FHT A;  2OQG A;  1P2F A;  2V79 A;  4CO8 A;  3DFG A;  3IC7 A;  2HWV A;  3ZN1 A;  1XB4 A;  2ELH A;  3KEO A;  2FU4 A;  1ZLJ A;  5D5X B;  2A6H F;  4I7H A;  1KA8 A;  4UVB A;  2V1X A;  2PN6 A;  4LB6 B;  5DUI A;  5CVV A;  3GO5 A;  5CLS A;  2XHK A;  4BYY A;  3MQ0 A;  1YYV A;  3QRF F;  3H3Z A;  1USS A;  2XGX A;  3LAP A;  2O8X A;  2FBI A;  3LA7 A;  2CO5 A;  3ABU A;  5ICF A;  3J80 K;  4OMZ A;  1Z7U A;  1LJ9 A;  1MJ9 A;  2UXN A;  3I71 A;  5ICG A;  2HYG D;  3R0J A;  2PMH A;  1Y0U A;  4KYW A;  3U9G A;  2GAU A;  2DQR A;  2FNP A;  4BH9 A;  3Q9V A;  2GXG A;  4M9X A;  2EFN A;  2H09 A;  2RVC A;  3WOD F;  2V1U A;  3JTH A;  1WRJ A;  2FQ3 A;  3E6D A;  3K1N A;  3IWF A;  3L9F A;  2LF8 A;  4UVC A;  4N0B A;  2B0L A;  3BP8 A;  2PI0 A;  2L54 A;  1MDM B;  1Z91 A;  3HRT A;  3WTX C;  4B09 A;  1G3T A;  4ON0 A;  5A2Q K;  2A07 F;  2R7F A;  4RGR A;  4WF2 A;  4M74 A;  3WTY C;  3LAJ A;  2KRF A;  2A5Y B;  5H20 A;  3EDP A;  2IJL A;  3CO7 C;  2BBY A;  2FXA A;  1HKQ A;  5L3G A;  3ZMU A;  4MGR A;  4AIK A;  4KT5 C;  2XAG A;  2KJC A;  1UCR A;  2HOE A;  2EFO A;  1T98 A;  3K0L A;  2GZW A;  2XKP A;  5DCF A;  4OIN F;  1LVA A;  5FLX K;  2GA1 A;  1LQ1 A;  4WWC A;  4HX8 A;  5E17 F;  2JSC A;  4A0Z A;  2X0L A;  3V8J A;  5FLX Z;  4U0V A;  1UB9 A;  4ZZD A;  3FHZ A;  3F23 A;  2DK8 A;  2MH9 A;  2L01 A;  2BYV E;  2J5P A;  2PEX A;  2O61 A;  3QPT A;  3F72 A;  5IT9 K;  2RN7 A;  1C0W A;  3CJN A;  2RQP A;  3I53 A;  5E8G A;  1R5H A;  4BXU A;  5F64 A;  2CGP A;  2EJR A;  3KFW X;  1S7A A;  1FBU A;  3I64 A;  1W7P B;  3N97 A;  1QBJ A;  1WKM A;  4I0B A;  2NNY A;  2IW5 A;  1YFH A;  1WSU A;  4ZYG A;  4BAY A;  4M9S A;  3ABT A;  2FML A;  2EA4 A;  4UVA A;  3FMQ A;  5JR3 A;  2EFQ A;  4AD9 A;  2A69 F;  1FBS A;  1BIA A;  3K9T A;  2PQ8 A;  2QZ8 A;  3E5U A;  2CQK A;  3BPX A;  2IA2 A;  1ZLK A;  4G7H F;  3F6O A;  3ECH A;  1UHW A;  1W7P D;  2FEZ A;  3KLO A;  3LWF A;  2H6B A;  1BI1 A;  5IT3 A;  3HRU A;  5E20 A;  2V9V A;  3KP2 A;  4YII A;  1OMI A;  4B8X A;  1S6L A;  2DTR A;  3RJP A;  1JE8 A;  2ZXJ A;  2OBP A;  4HA8 A;  3KZY A;  1XSX A;  2DBB A;  1GVJ A;  5LHG A;  1D5V A;  3BOQ A;  1O3R A;  4O3M A;  2FBH A;  2HEO A;  2KKO A;  5EEG A;  1ZN2 A;  1MDM A;  4LLL A;  1ZRD A;  5HLG A;  1CF7 B;  3IWZ A;  3DV8 A;  3HSF A;  2LNB A;  4LG0 B;  1IUY A;  2R3S A;  2KIM A;  3E5X A;  3ML6 A;  4PGH A;  4A2U A;  1R36 A;  3RTR A;  4L9T A;  3HOS A;  2FNA A;  1P6R A;  1YS6 A;  4G7O F;  3L00 A;  4HV5 A;  4P96 A;  4I2O A;  3GZ6 A;  2XIG A;  3GVA A;  1YO5 C;  3L2C A;  2RNJ A;  1K79 A;  4ETS A;  1R5G A;  2VXZ A;  4A0X A;  3QAH A;  2HQR A;  2ISY A;  4OOI A;  5LHH A;  1R7J A;  2FOK A;  2D45 A;  3EYI A;  4HF0 A;  2XRO A;  4R8H A;  3Q9S A;  3NQO A;  3J81 K;  1ZRF A;  2JRT A;  3ZPL A;  3J81 Z;  3JAM K;  1B6A A;  3ZN0 A;  1YTY A;  4AWX B;  3TDU C;  3COA C;  3JAM Z;  3SQN A;  2PLY A;  2W57 A;  4PCQ A;  1PDN C;  1G3W A;  3C18 A;  1U78 A;  2DU9 A;  1W7P A;  2Q0O A;  2H6C A;  4N9I A;  3HOT A;  5AON A;  1QPM A;  2ZO4 A;  4RB0 A;  2A3S A;  2DAO A;  3IRR A;  3HYI A;  1QNT A;  3O2P E;  4HBL A;  3W6K B;  1ZH5 A;  3MAJ A;  2VON A;  3ZP5 A;  4KFC A;  2HGC A;  1F5T A;  3LQR A;  1YW9 A;  3MFK A;  5BS6 A;  2D1V A;  2XV4 S;  3F8N A;  1ONV A;  2IVM A;  3GX4 X;  4L9J A;  2YU3 A;  4YFN F;  1O3Q A;  3E5Q A;  2AXL A;  2FSW A;  2H94 A;  1WI9 A;  4I01 A;  3PQJ A;  2OA4 A;  1B1B A;  3RKY A;  2MH2 A;  4GGG A;  2DPD A;  5ILU A;  3TKY A;  5HLH A;  4OMY A;  3JW4 A;  4L9V A;  3I5U A;  3GW2 A;  1G3Y A;  4HF1 A;  2DI3 A;  3F8B A;  2MBF A;  3KEQ A;  3R4K A;  3Q5F A;  1REP C;  4XLP F;  5BPD A;  1CF7 A;  4RGU A;  6PAX A;  4M73 A;  4LG0 A;  1QZZ A;  2D2W A;  1J2X A;  1IN5 A;  1IW7 F;  5E1Z B;  3KP7 A;  1IXR C;  3RYP A;  1OR7 A;  3E3V A;  1F9N A;  1PUE E;  1HKS A;  2K86 A;  2MD5 A;  5J8F A;  3TGN A;  4L0Z B;  1IXS B;  4RAY A;  4P9F A;  3IL2 A;  3FXU A;  3F8M A;  1I1G A;  1D3Y A;  3TDZ C;  2DPU A;  1RNL A;  2KIU A;  2VBW A;  4A0Y A;  1SD6 A;  3FMS A;  1SMY F;  1U3E M;  3WTZ A;  5K5R A;  3RKW A;  1I27 A;  1U5T B;  1STZ A;  5L3B A;  5D6F A;  4L18 B;  4L0Y B;  3WTV C;  3TOB A;  3FX3 A;  2OU2 A;  3SZP A;  3RPQ A;  2EV0 A;  1D8J A;  4LLG F;  4D0P A;  3ULQ B;  5F6F A;  2M5W A;  2HZT A;  2Z9O A;  1MJB A;  3WTS C;  2FRH A;  1SMT A;  5BMZ A;  2STW A;  2G7H A;  2GA2 A;  3SFZ A;  2BV6 A;  1YG2 A;  2DLL A;  3C7J A;  2HFH A;  4WXD A;  2LKP A;  5DD4 A;  1G4D A;  4DNC A;  5HS9 A;  4NQW A;  5EEH A;  3HSR A;  3C3W A;  1A04 A;  1TTY A;  1L3L A;  5AIP A;  3FZV A;  3VOE A;  4HQE A;  4LFU A;  4M9Z A;  1P4W A;  3CTA A;  1IAW A;  2LF7 A;  2RV8 A;  1RUO A;  2ESN A;  1IZ1 A;  1GXQ A;  3KET A;  2NRA C;  4O6J A;  3DP7 A;  2F2E A;  3GFL A;  4A5N A;  3MZH A;  3KP3 A;  1KU2 A;  3GEZ A;  2VBY A;  5DV5 A;  1TW3 A;  2VT2 A;  2FF4 A;  5DEQ A;  2FMY A;  4ESF A;  1DUX C;  1KQ0 A;  5DYM A;  3GFI A;  3MWM A;  3JTG A;  1ZG3 A;  2ZFW A;  1DPU A;  2QWW A;  2VN2 A;  4P55 A;  1YW8 A;  1EV7 A;  2EFP A;  3WU0 A;  2ZNZ A;  4GO1 A;  1HW1 A;  1FNN A;  3J80 Z;  3OOP A;  1MKM A;  3U1D A;  4CXF A;  3IHU A;  2F5F A;  2VE9 A;  1LDK B;  1YW7 A;  1ON2 A;  3DKW A;  4Y17 A;  4KN7 X;  4GXO A;  4MQ9 F;  4KIC A;  4F7Z A;  3QU6 A;  2STT A;  4XSZ F;  1OPC A;  2QUF A;  4EJT A;  2P8T A;  3GFM A;  2PBI A;  3G73 A;  2QQB A;  4BNC A;  3WTW C;  2FA5 A;  4L5J A;  4PDK A;  3REO A;  1PP7 U;  3ROU A;  2XUB A;  4HX4 A;  3BDD A;  1LDD A;  3TO6 A;  2OZU A;  1IN4 A;  3E6M A;  5A2Q Z;  1U5T A;  1LB2 A;  4ESB A;  2NYX A;  3LA3 A;  1I1S A;  2HTJ A;  2DFI A;  2P6T A;  1T38 A;  4S05 A;  2XRN A;  2L02 A;  3QOP A;  2NAZ A;  1JGS A;  3NRV A;  4NB5 A;  1QO0 D;  4P9U A;  3OV8 A;  3L7W A;  4BQA A;  4IHT A;  3KCC A;  3KP4 A;  4IPA A;  3MEX A;  3DEU A;  1AOY A;  2IT0 A;  1RIO H;  2C6Y A;  2E7W A;  1MZB A;  4M6X A;  3K2Z A;  2MC3 A;  1HST A;  5D8K B;  1LEA A;  1HXD A;  2XKO A;  4LMY A;  3SXY A;  5IT9 Z;  1ZRC A;  1BJA A;  3BJA A;  1HKT A;  1R58 A;  1RI7 A;  5LGT A;  4CGZ A;  1HQC A;  4A6E A;  1TQP A;  2MLG A;  5CVI A;  5D4S A;  4HLY A;  4NHJ A;  1YIO A;  1FSH A;  2OD5 A;  5L3F A;  3KZZ A;  3R61 A;  3EQL F;  2TDX A;  1BN5 A;  2WWY A;  3WG9 A;  1K6O A;  4G6D A;  4UV9 A;  3DPL C;  2YPR A;  3R0A A;  3M1E A;  3LST A;  1XGO A;  3VEP A;  3R60 A;  4AIH A;  2X4H A;  3GFJ A;  5FD6 A;  2HYF A;  1P4A A;  5DCM B;  2V1D A;  4KDP A;  4EJV A;  1S3J A;  5LRR A;  3BJO A;  1U5T C;  5L3C A;  1RUN A;  3MCZ A;  5CJ9 A;  5LGN A;  2P6S A;  4IRH A;  2F5C A;  4EGZ A;  3B02 A;  2XAF A;  2GIV A;  4BHC A;  5K5Q A;  4R1H A;  3MZY A;  3E6B A;  2K02 A;  4HOB A;  4M71 A;  4CZZ A;  5DD8 A;  5K1Y A;  3PFI A;  4FX0 A;  1TLH B;  5E8I A;  1UFM A;  1XDU A;  2IA1 A;  1IRG A;  2P4W A;  2W84 A;  3HHG A;  1X3U A;  4HV6 A;  4KA4 A;  1XMA A;  4YG2 F;  1TBX A;  1NHA A;  2VT3 A;  5LLQ A;  4UNO A;  5D6E A;  4IJA A;  1R23 A;  5E18 F;  3WGH A;  1FP2 A;  1Q1H A;  3F3X A;  1YLF A;  5ICE A;  4Q48 A;  3ZMZ A;  1FOK A;  3T8T A;  2QVO A;  4I98 B;  3BRO A;  4Y13 A;  3M9A A;  2Z5U A;  3B73 A;  2JPC A;  2LDU A;  2CW0 F;  5CVU A;  4ENJ A;  4ZH4 F;  2RGV A;  1J59 A;  5CVR A;  4XBF A;  2YSR A;  2BE5 F;  2DK5 A;  1K7A A;  3FF5 A;  5H6Q A;  3ELK A;  4EQQ A;  1L0O C;  4IVN A;  3RPU A;  2XAJ A;  4IF4 A;  4ZYD A;  4ZZL A;  2KJB A;  1FLI A;  2D1H A;  3HRS A;  3M8E A;  5ILS A;  3EYY A;  1ZYR F;  1Z6R A;  4IRI A;  5HS7 A;  1JHH A;  2O0Y A;  4Z2Y A;  2H27 A;  1QZY A;  3PQK A;  1IXC A;  3WU1 B;  2JPB A;  4P5O A;  1U8R A;  4KIG A;  3QU3 A;  4BHB A;  2P7C B;  1AWC A;  1EH7 A;  2L4M A;  5LGU A;  2Z33 A;  4A12 A;  3DF8 A;  1R22 A;  4ENK A;  1KQ9 A;  1TQI A;  1UHM A;  1JHF A;  2J5O A;  1YQA A;  1SAX A;  3WE3 A;  4KIF A;  4HLX A;  3RDI A;  4RGS A;  2G9W A;  5TJJ A;  1K78 B;  5DCM A;  5AIQ A;  4HZF A;  2W24 A;  2PJP A;  2BGC A;  2A6E F;  3CUQ B;  1R1V A;  4M72 A;  4L9N A;  5HDN A;  4QWQ A;  4AIJ A;  4RB2 C;  1T6S A;  1V4R A;  1BC8 C;  5BPI A;  1MGT A;  4EM2 A;  2A68 F;  3BPV A;  5TRD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...