1FYKA

Serendipitous crystal structure containing the heat shock transcription factor's dna binding domain and cognate dna that is translationally disordered
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
92
structure length
88
Chain Sequence
ARPAFVNKLWSMVNDKSNEKFIHWSTSGESIVVPNRERFVQEVLPKYFKHSNFASFVRQLNMYGWHKVQDVKSGNNDSRWEFENERHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords HSE DNA-PHOSPHATE BACKBONE
publication title Crystal packing interaction that blocks crystallization of a site-specific DNA binding protein-DNA complex.
pubmed doi rcsb
source organism Kluyveromyces lactis
total genus 21
structure length 88
sequence length 92
ec nomenclature
pdb deposition date 2000-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fykA00
5E20A 2LKPA 3I4PA 1ZAOA 3HSRA 4M6YA 2DPUA 5DCFA 2YX7A 4MGRA 4DQ2A 4PDKA 2IRFG 3K9TA 2G7UA 2ZXJA 2XUBA 2YU3A 3E5QA 4LB6B 3QP5A 1REPC 3DEUA 3TDZC 1OPCA 1QGPA 1IW7F 3V7RA 1ZARA 3MAJA 5DCMA 1H9TA 5K5QA 3N97A 5E1WA 1ON2A 2XAGA 1U8RA 2NYXA 3C3WA 4IVNA 2PMHA 5F6FA 1OR7A 4UUVA 3L00A 1HW1A 3GZ5A 4ZZDA 2EFQA 3K69A 3F8FA 4MEXF 4BNCA 1RNLA 2QVOA 5AONA 5L3DA 1QPMA 2KJBA 1DP7P 1G4DA 4P96A 2OD5A 1Z05A 3JTGA 2H6BA 4EM1A 4ZYHA 3ZN0A 1FSEA 3M1EA 5E1ZB 4HLYA 3WU0A 2DPDA 1U2WA 4EJOA 3M9AA 1KQ9A 4HX4A 1X3UA 1Z6RA 4KN4X 2STWA 1UFMA 2BBYA 2OZUA 2VXZA 2EA4A 3ZN1A 2XGXA 3ZMUA 2PMUA 2IJLA 1D8KA 3RJPA 2QQBA 1GXPA 3ROUA 3LAPA 4GYIA 2Z99A 3I71A 1B6AA 1IRGA 3P9CA 2BV6A 4LLGF 5AIPA 2EFPA 3HOSA 1P2FA 4LK0F 2MD5A 2KIFA 1SD7A 3LAJA 5DUKA 3QU6A 2E1NA 2EFWA 3FWEA 1FBQA 3IRQA 5BOXA 2IT0A 4Q4ZF 1XMAA 2E7XA 2IW5A 4KIFA 3H92A 2EV6A 4G94A 5LHGA 3FXUA 3QOPA 1U5TC 1JGSA 3EYIA 4G9YA 1IN8A 3DFGA 1P4AA 4UVBA 3ULQB 3KEOA 3SHFA 3MFKA 2EFOA 3SZPA 4KICA 1XGOA 2EJRA 5HS9A 3ELKA 1YLFA 2FBHA 4Q48A 5JVTA 1PDNC 2EWNA 3U2RA 3C1DA 3WGHA 3CO6C 3MWMA 1SMYF 2PFBA 2EK5A 1YW8A 2V1UA 2DAOA 4I2OA 1B9MA 2VODA 5FO5A 2V1DA 5F1RA 1W7PB 2P7VB 1ON1A 3VB2A 3BOQA 5CVJA 2ADUA 3WTZA 5LGUA 4L5IA 4UNOA 2WV0A 2ZMEA 1G3SA 1R23A 1DPUA 3IKTA 3LQQA 4RAYA 1HW5A 2IA2A 5BPDA 5A2QZ 5AIQA 1W5SA 4GXOA 4U7DA 1PUEE 4KMFA 3HYIA 4UVCA 3HRMA 2P6SA 3ECHA 2PLYA 3FXRA 4HBLA 4M71A 1OYWA 2RN7A 2DK5A 4WXDA 1LDKB 4WWCA 2PI0A 3R61A 2TDXA 1RI7A 2M8EA 1ZGJA 2OQGA 3E6DA 2XKOA 5CVRA 4IRIA 1KYZA 1IN5A 1JE8A 1KU2A 2W84A 4Z2YA 5IT3A 3WGIA 2QZ8A 1O7FA 1I6XA 3D0SA 3I58A 3FM3A 2L3DA 4AIJA 1GHCA 1XSXA 2XIGA 1WI9A 2RDPA 2HFHA 4GO1A 3QU3A 5K1YA 1BI2A 5IT9Z 1QQIA 2L02A 3IL2A 5L3CA 1ZREA 3K0LA 6PAXA 3HTSB 2O03A 2G9WA 3QP6A 4R79A 1P6RA 2HS5A 3EETA 1BBYA 1HBXG 2DQRA 1FLIA 2M45A 4CICA 4IJAA 1EH7A 4D0PA 5FD6A 5LBQA 3F21A 5DCMB 2O6GE 4XRFA 2WC2A 3H3ZA 1QZYA 2VBZA 4OIRF 1ZG1A 4KUMA 2J5PA 3COAC 1Y0UA 2KIUA 5HLHA 4S05A 1USSA 1KYWA 2FSWA 1MZBA 3R0AA 1OYIA 3HTUA 4I0BA 3SQNA 2VT3A 3JW4A 4YIIA 4CGZA 4EJTA 3JSPA 1IRFA 1O3RA 5LGNA 2GAUA 1UHMA 1H0MA 4EVIA 2A07F 3H3UA 2GXBA 4A6EA 3K2ZA 2P6TA 1HW2A 3SFZA 5J6XA 2VBWA 1YS6A 3O2PE 1MDMA 3V8LA 1MJAA 1I27A 4MEYF 2J5OA 3D5LA 4L18B 4M72A 1S3JA 3T1BA 4B09A 3HUGA 4BH9A 1ZLKA 3ZPLA 3J81Z 4EGZA 2QWWA 4HAMA 3WTWC 4EJVA 2DQLA 2EV0A 2XAHA 2H09A 1T0FA 1HQCA 4JK1X 1E2XA 5H6QA 3VEPA 3QPTA 3RI4A 2BEOA 4HQEA 2OU2A 1D3YA 1YW9A 4JQFA 4IRGA 2B0LA 2DFIA 4ZZLA 3ZQ7A 1IZ1A 3KLOA 4PGGA 1O3QA 4RGSA 3PQJA 5K5RA 5DEQA 1V4RA 2RV8A 3FX3A 3JAMK 4OIQF 2HDCA 3E3VA 4OOIA 4OINF 1HKQA 2HZTA 1WSUA 1XDUA 3J7AO 2KIMA 2JZYA 3R4KA 4XLNF 3L2CA 4EGYA 3F8CA 4GYGA 1O3TA 2FU4A 2XAFA 4HV6A 1UB9A 3TOBA 2P4WA 3B73A 3VFZA 2ISZA 4OIOF 1XGNA 2Z9OA 2DW4A 2HWVA 3B02A 3ERED 2MH9A 1P4XA 2ESHA 3HIFA 5D8KB 1Z9CA 2ZMEB 3QAHA 1PP7U 2O0YA 1U5TA 3C18A 1ZGAA 1EV7A 2NS0A 1BIBA 4M6XA 4CXFA 5HS7A 2QENA 4G6QA 3F23A 1UCRA 4UV8A 4CZZA 4L9VA 2HQRA 5LGTA 2D1VA 4TV7A 1D5VA 1P4WA 3MQ0A 1XSVA 4EJUA 3F72A 2RVCA 3KEQA 3V7CA 5JHUA 4RAZA 3RYRA 4HF2A 3FZVA 2WWYA 1FP2A 4U0YA 2L54A 1RIOH 1E17A 1HKSA 2ZNYA 3M8EA 3N4MA 2YR2A 2EFNA 3L9FA 3CUQC 3ML6A 4KA4A 5FD5A 1J0RA 4WXCA 2V9VA 2VONA 4UV9A 4EM2A 2M5WA 3W6KB 1FOKA 4BHPA 3ZMZA 1FYLA 3T5XA 2RQPA 1Z1DA 3GZ6A 3RIRA 2W57A 3OV8A 3DKWA 2D1HA 4A5MA 3U9GA 1QO0D 3WGGA 4M9SA 3V4GA 2FRHA 4ESFA 4K2EA 4WXHA 2A69F 2ZBKA 3NQOA 3GW2A 5FFXA 1QBJA 3NEUA 4GCVA 1XN7A 1YIOA 4FHTA 2MLKA 3ABTA 2ACJA 5L3FA 1XCVA 2V1XA 2O8XA 3F6OA 3BDDA 2KJCA 1S8NA 2GWRA 4O3MA 5HDKA 3IC7A 4YIFA 5FLXZ 1J75A 5E17F 2PG4A 3EDPA 3R0JA 5J8CA 4HDVA 1K7AA 4CDGA 1BJAA 3LSTA 3J81K 4R8HA 3W6JB 4KIGA 2V79A 2HKOA 2QLZA 4B8XA 1J5YA 1LNWA 4QLCU 3TO7A 1MDMB 4ZYEA 5LEKA 1YQAA 5D4SA 4N9HA 2FNAA 2X0LA 3I53A 3DF8A 4RGRA 4M9XA 4ETSA 3REOA 1W4MA 1L0OC 3K1NA 2DBBA 5BMZA 1T2KA 4WF2A 2OAZA 1DDNA 2OA4A 4RB2C 5HLGA 1HSTA 5D5VB 2HYFA 3FHZA 4I98B 4KNYA 3ZMDA 1PP8F 2CG4A 1T98A 3J80Z 3RKYA 2QYOA 3O3KA 1XDSA 5TJJA 3TGNA 1VTNC 4FX4A 1R58A 1T38A 3GXOA 5CVUA 4OMZA 4IHTA 2P5LC 3FXQA 2PJPA 5FGMA 1FBUA 5E18F 2AS5F 4Y13A 3CUOA 1WRJA 3S2WA 5HLIA 1LDJA 2FMYA 3V8JA 4A0ZA 3KP6A 4EJWA 5DYMA 4RB0A 1IAWA 5EEGA 1DPRA 3QPHA 3RTRA 3ISPA 2KKOA 1KQ0A 1V3FA 3HRTA 2G7HA 2HR3A 4O6JA 4YG2F 1MD0A 2JT1A 1Z7UA 1ZG3A 4EMSA 1U5TB 3KP7A 4ENKA 2GA2A 4H0EA 3BY6A 4BYYA 1UHWA 1FYKA 3HSEA 1RUNA 1XD7A 4L9NA 4XSZF 3LA2A 4RGXA 3WTXC 2FQ3A 4WCGA 2E7WA 5ICGA 2XRNA 1SAXA 3RPUA 2Q2EA 1IN7A 3DV8A 3DP7A 2XROA 4F7ZA 2L4AA 3CTAA 1B4AA 2HGCA 2P5VA 3GFJA 4MNUA 4UHTA 1LEAA 2QQAA 1S29A 2CGPA 1BC8C 1GVJA 2DT5A 3RPQA 2A3SA 2XAQA 3KZYA 1R1VA 1K78A 1O57A 1J59A 3HSFA 2ELHA 4G8XA 3TO9A 4ENNA 3GUDA 4Q47A 5LRRA 1SD6A 2K4JA 3WTUC 2K7LA 3AAFA 5HDNA 3HOTA 3T8TA 4ESJA 1AWCA 1YFHA 2VC0A 3EQLF 5H20A 3BPVA 2CSOA 2OQRA 3RYPA 3EUHA 1ZRCA 1LEBA 3CUQA 2VE8A 3GFLA 2JTVA 2EA2A 1K6OA 2GXGA 2FOKA 4P5OA 1FSHA 3MZYA 1DUXC 1FZPB 1F1ZA 5D6EA 4ESBA 2VE9A 1J7KA 2QM3A 5HDGA 1Z91A 1Z6TA 1F5TA 1IXCA 3M7GA 2MBFA 2FF4A 2MLGA 2F2EA 1S6LA 3O6BB 2ZCWA 3KETA 5F64A 1MGTA 2ZFWA 3BWGA 1EH6A 5HOOA 2CWEA 2ESNA 4HYEA 4Q5SF 2DU9A 4A2UA 4AVPA 5LEJA 1CF7A 1C0WA 4U88A 4FT8A 4AIHA 3K1MA 3L7WA 4U0WA 2DO7A 2Q8KA 1FY7A 2LF8A 1K79A 2K4BA 3WTTC 4CO8A 2NNYA 3L09A 4HX8A 4G7HF 1G6NA 3J80K 1STZA 2VC1A 4GGGA 3LQRA 4LFUA 4PGHA 3VODA 1L3LA 5D5WB 3M8FA 1OKRA 1LJ9A 3WTSC 1ONVA 2VBYA 1FBSA 3KZZA 5E8IA 5CLSA 2IA1A 2CQKA 3MZHA 2LNBA 5ILUA 2EV5A 4MQ9F 2FXAA 4G7OF 3FM5A 3LA3A 5CVIA 4L0ZB 3T0YA 4AIKA 5L3BA 5A2QK 4LG0A 3T8RA 2HTSA 4P9UA 3KFWX 4Y15A 3IWFA 2XAJA 1KU7A 1U78A 1G3TA 2BGCA 4KMUX 2XKPA 2CFXA 3I54A 2EB7A 2BYVE 3IHUA 3V8KA 3F8MA 4P9FA 4EV0A 4L9TA 1R22A 2ZKZA 1J2XA 1YYVA 1KGSA 1BC7C 2YPRA 4KYWA 1SFUA 1TLHB 3V7SA 3G3ZA 1I1GA 3K1PA 5BQTA 5JI6A 1EH8A 4NB5A 4IXAA 2A5YB 3GX4X 4BHBA 5E8GA 3BJAA 3P7NA 3OOPA 1BOAA 3NRVA 2P7CB 2YSRA 2HYGD 2VN2A 5IT9K 1FPQA 1TQIA 1HXDA 3HRSA 1B59A 5D6FA 4L5JA 2H94A 3WU1B 1F9NA 3R6SA 3Q5FA 3WE2A 4MTDA 4RS8A 2F5DA 4S04A 2AXLA 4QWQA 3BJ6A 4L9JA 2FBIA 2A68F 4YFXF 1TNSA 1SFXA 4M74A 4O5VA 1YS7A 5DUIA 3FMRA 2LF7A 3I59A 4HW0A 3CDHA 2K02A 4UXNA 1G3WA 4AD9A 1YO5C 3GWZA 1U3EM 2ZJ2A 3GYHX 2O3FA 4A6DA 2CYYA 1K78B 4AWXB 5ICCA 3F6VA 2A6HF 4N9IA 2QQ9A 2ZO4A 4BQAA 2IP2A 1USTA 4A5NA 2DK8A 1XMKA 2L4MA 2V6CA 2JPBA 4OU0A 2UXNA 4DNCA 2PQ8A 2Z5UA 3HRUA 1IN6A 3DQVC 4XBFA 2X4HA 1SD4A 2RKHA 3FMSA 1D8JA 1FWZA 2WTEA 1HSJA 4PCQA 4LK1F 4L0YB 2RC4A 2QUFA 2A61A 3CUQB 3ZP5A 1SFEA 4ZH4F 2K86A 1B9NA 5DV5A 3TOAA 4LB5A 3MCZA 2LDUA 1ODDA 2R7DA 2KRFA 4KFCA 4LLLA 4HQMA 4IHSA 1ZN2A 2H6CA 3BZ6A 1TNTA 1FT9A 2Z3YA 2MH2A 3KCCA 5E1XA 2P5KA 1IF1A 2GIVA 3E6CC 2XASA 2Y0MA 2VOOA 4A0YA 4IPAA 4U0VA 1ULYA 1LDDA 1BI0A 2HQNA 2L01A 4CYDA 1ZH5A 3TQNA 4IF4A 4KIBA 1XSDA 1CF7B 3GFMA 1P92A 1SD5A 5KK1A 5K5OA 3JSOA 4G6DA 3F8BA 5HS8A 2E1CA 1WKMA 2VBXA 1FNNA 5L3EA 5JFRA 1KA8A 1SMTA 2GZWA 2M1BA 2PEXA 3KP3A 5D5UB 2R3SA 2O61A 2FMLA 3KP5A 2CW0F 1T6SA 2ISYA 5ERIA 4RB3C 3GF2A 4XSXF 1TQMA 2P8TA 1W5TA 3RDIA 4M9ZA 4LD5A 3WTVC 3HHHA 4ENJA 3JAMZ 2CO5A 2VT2A 3DXJF 3GVAA 1TW3A 1YG2A 2QBYA 5ICEA 1GXQA 2NRAC 1OMIA 2MA3A 3LWFA 4HLXA 1MJBA 3FF5A 4LG0B 4HA8A 1JHFA 1FYMA 3I64A 3R60A 2HEOA 3ZMSA 3IWZA 2IA0A 1H9GA 2PBIA 3KP4A 2VOPA 4ENMA 2W85A 1ZRDA 3GEZA 2UWMA 4ON0A 3ZMVA 2JRTA 3VOEA 3RKWA 2W25A 5CJ9A 1KU9A 2HTJA 3P9KA 2JSCA 4HX7A 3KLNA 4PZJA 1JHHA 3Q9VA 3SZTA 2UXXA 1BI3A 2R7FA 4EM0B 3PQKA 2FEZA 2XVCA 1TTYA 3P9IA 4HV5A 2PN6A 4YFKF 2Q0OA 5J8FA 1G3YA 4MQVA 4IRHA 1J9IA 2F5EA 1AOYA 3BPXA 2DLLA 5CYVA 3E97A 2M30A 3CLOA 5BS6A 1I5ZA 2BE5F 4NHJA 3BP8A 3E5XA 1XGSA 4HZFA 4RGUA 4JBAA 5ICFA 1KU3A 4RB1A 1NHAA 2GQQA 1BI1A 3U1DA 3ABUA 4MHGA 3SXYA 4EQQA 2YX4A 4A12A 1MJ9A 1R7JA 4OIPF 1YTYA 1WQ2A 3E6MA 3I59B 2UZKA 1R36A 4HF1A 1YW7A 2DI3A 3DPTA 2FNPA 2NAZA 3KE2A 4ZYGA 2OBPA 2ZNZA 3BROA 2JPCA 1IN4A 1LB2A 4I09A 1JXSA 2HKXA 1ZYRF 4LMYA 4XLPF 4HOBA 3ZMTA 5DD4A 4E70A 2NNNA 5LRSA 5FLXK 1HKTA 2F5FA 4U7BA 1XGMA 4R1HA 3F8NA 4NQWA 1MKMA 1FX7A 5EEHA 2FA5A 3WE3A 4BHCA 1CGPA 3BJOA 2XHKA 1OYYA 3HHGA 1O3SA 3I5UA 2Z33A 2COMA 4LJZF 4A0XA 4HF0A 1R5HA 1WWXA 4I02A 3TO6A 1R1TA 2K27A 4OMYA 4I0AA 3ECOA 1Q1HA 2IVMA 1IUYA 3PFIA 4BXUA 3WODF 3CJNA 3E6BA 3F3XA 2HOEA 1XB4A 3WG9A 1W7PD 3GO5A 4M73A 2F5CA 3I0TA 5D8LB 1T39A 2D45A 3WTYC 3QRFF 1ZRFA 2IPQX 2RGVA 4ASNA 3GLXA 4KT5C 1B1BA 4WK8F 1U6GA 5CVVA 4YFNF 5H6RA 1ZLJA 2RNJA 1BIAA 4N0BA 1W7PA 4WX9A 4LGWA 3GFIA 1XCBA 5KVRA 3IKVA 5D4RA 3E5UA 2W24A 3C7JA 1R5GA 5DDGA 4LLNA 2FBKA 5D5XB 3CO7C 1KQ8A 1QZZA 2ETHA 3RKXA 4Y17A 5BPIA 1S7AA 1RUOA 1IXSB 2XV4S 1RZ4A 4I7HA 3DPLC 5ILSA 5LHHA 4MTEA 3LFKA 1FC3A 2GA1A 3MEXA 4KDPA 1F4KA 4UVAA 5LLQA 2MC3A 3KP2A 2M87A 5JR3A 2QBYB 4G7ZF 3TKYA 5HVQC 1QNTA 4BAYA 1O7LA 1R00A 5L3GA 5ILVA 4KN7X 4CHUA 1R1UA 2STTA 1BM9A 2C6YA 2FE3A 5TRDA 3JTHA 1TW2A 3G73A 1ZG5A 3LA7A 4HDUA 1TQPA 1IXRC 2LSOA 1BN5A 2A6EF 1LVAA 3Q9SA 2DTRA 4ZYDA 3IRRA 1LQ1A 5ED4A 4P55A 2Y48A 3EYYA 3TDUC 2H27A 1S7OA 2D2WA 4FX0A 1FP1D 3FMQA 3F22A 5LHIA 4I01A 1TBXA 1ZHFA 2Y75A 5FFZA 1A04A 2OZ6A 1I1SA 5DD8A 5FB2A
chains in the Genus database with same CATH superfamily
2LLKA 5E20A 1JJ6C 4B43A 1VQLI 4V2GA 2LKPA 3I4PA 1ZAOA 3HSRA 3RZDJ 1JI8A 3MVPA 3K4JA 4M6YA 2DPUA 3M07A 5DCFA 1DU6A 2HYJA 2VKVA 3SEQA 3X2QH 2K9NA 2YX7A 4MGRA 4DQ2A 4PDKA 2IRFG 2M34A 4ABZA 3M3YJ 3K9TA 2G7UA 2ZXJA 2VPRA 2XUBA 2WBMA 2YU3A 3E5QA 3HGGA 4LB6B 3QP5A 3CQZJ 1REPC 4XN0A 5KNLA 2QKMB 3DEUA 3F0CA 3TDZC 1OPCA 4BACA 5GTHC 1QGPA 3PFYA 4Z6YA 2AXTC 1IW7F 3V7RA 4A3DJ 1ZARA 1ETVA 2LC2A 3MAJA 4RMNA 5DCMA 1H9TA 5K5QA 2XC7A 4B44A 3N97A 2KMUA 2R5ZB 5E1WA 1ON2A 2FD5A 1WFXA 3HOWJ 3K4BA 2XAGA 1U8RA 2DFHA 5FKKA 5FKLA 2NYXA 3C3WA 4IVNA 2VJ4A 2L7KA 3KYLA 2PMHA 5F6FA 1XPXA 1OR7A 3GLLA 1Y1VJ 4UUVA 2HZDA 3L00A 2ZXHA 1HW1A 3GZ5A 3B6AA 4ZZDA 2EFQA 3QYFA 3BG9A 3I9V2 3P5JA 3K69A 3F8FA 2A05A 2NS7A 1XS9A 2HVSA 3S93A 2DA1A 4MEXF 5KHDA 4BNCA 1Y8QB 1X19A 3IAM2 1RNLA 3ABKH 3RQIA 2QVOA 1UG0A 3LSHA 3OIPA 5AONA 5L3DA 1QPMA 2KJBA 1DP7P 1U8BA 1T0FC 1B72B 1G4DA 4P96A 4F93B 2O7OA 2OD5A 1Z05A 2BY1A 3JTGA 4IHXA 4BGDA 2H6BA 4EM1A 1TWCJ 2MSYA 3A0BC 3PO2J 2E1MC 3CMYA 4ZYHA 3ZN0A 1DGWY 1FSEA 3M1EA 5E1ZB 4BDZA 4HLYA 1KONA 1IG7A 2OTJI 1PYVA 1YI2I 3BR2A 4BJ6C 3WU0A 2DPDA 1U2WA 3W2VA 4EJOA 5J4YA 4GRIA 2BXZA 4E7KA 3M9AA 4BQQA 1KQ9A 5J1YA 4HX4A 1X3UA 1Z6RA 4KN4X 2STWA 1UFMA 2BBYA 2OZUA 1OCTC 1QU3A 2VXZA 1DGRM 2EA4A 4NQWB 3OS0A 3CCUI 2JA6J 3OYEA 3ZN1A 2XGXA 3ZMUA 4YIRX 2PMUA 2IJLA 3CCEI 1D8KA 1J09A 2HXIA 2KL4A 1X2MA 3BR1A 3RJPA 1VQMI 2QQBA 1GXPA 1MMSA 3KZIC 3QPSA 3ROUA 3LAPA 4GYIA 2LY2A 2Z99A 3I71A 1B6AA 3S1MJ 1IRGA 3S2HJ 3JR9A 3P9CA 1OCPA 3IAS2 2MGQA 3N05A 4NC7A 4V2FA 2BV6A 4LLGF 5AIPA 2EFPA 3HOSA 1P2FA 4LK0F 2MD5A 2KIFA 1SD7A 3LAJA 3CC2I 5DUKA 3QU6A 2E1NA 2EFWA 3PNVA 5DM6F 4Y3OA 3FWEA 1FBQA 3IRQA 3MKLA 3GTOJ 3CMAI 5BOXA 2IT0A 4Q4ZF 4JYKA 1XMAA 2E7XA 5FRMA 2IW5A 2W00A 2A5WA 4KIFA 4E6KG 1TC3C 3H92A 2EV6A 4G94A 5LHGA 3FXUA 2GM4A 1BR2A 4NUBA 3QOPA 1U5TC 2QF7A 2PJRA 1AA7A 1JGSA 3CCVI 5IOYA 2VUMJ 3CJQB 3EYIA 4G9YA 4HRIA 1IN8A 3DFGA 1P4AA 2E5NA 4UVBA 3ULQB 1Z21A 3L2UA 3KEOA 3BTJA 3SHFA 3BG7A 3MFKA 2EFOA 3SZPA 4KICA 3RQ4A 1XGOA 2EJRA 5CQGA 5HS9A 3ELKA 1YLFA 5BNGA 2FBHA 2E1MB 2FQ4A 2MYSA 1JUSA 4Q48A 5JVTA 2CW8A 1PDNC 2EWNA 1FTZA 3U2RA 2X48A 3C1DA 3WGHA 3CO6C 3PUBA 3MWMA 1FIAA 1SMYF 2F4MB 2WAQA 3PSIA 2PFBA 2EK5A 1YW8A 2V1UA 3MMYB 2DAOA 3S3NA 4I2OA 1B9MA 2VODA 3L2WA 2HI3A 5FO5A 4IHVA 2V1DA 5F1RA 1W7PB 3A0HC 2P7VB 1LFPA 1ON1A 3VB2A 2FOWA 3BOQA 4QPOA 4PJLA 5CVJA 2ADUA 3OYFA 1AHDP 4EEFG 2R7UA 3WTZA 4LIVA 5LGUA 4L5IA 3PSFA 4UNOA 2WV0A 2ZMEA 1G3SA 2DN0A 1R23A 1DPUA 2LTPA 4CZCA 2AQEA 2DDAA 3LQQA 3IKTA 1RPWA 4RAYA 2Y69H 1HW5A 2IA2A 5BPDA 5A2QZ 4B48A 4BEHB 1P9QC 3HZJA 3K4NA 1UAAA 5AIQA 1W5SA 4GXOA 4U7DA 3CCYA 3ERMA 1ZQ3P 1PUEE 1WZ2A 2V7FA 4KMFA 3HYIA 4UVCA 3HRMA 2P6SA 5GADJ 1S72I 3ECHA 2PLYA 3FXRA 1SFKA 4HBLA 4M71A 1OYWA 2RN7A 2DODA 2DK5A 1WJDA 4WXDA 2Z2SB 1LDKB 2NVYJ 5JLXA 4WWCA 1VQOI 2PI0A 2QA4I 4F92B 1EJ9A 1A6IA 3R61A 2TDXA 1RI7A 2M8EA 4XOTA 4DOZA 1ZGJA 3PL8A 4CCLA 5IP7J 2OQGA 1MMNA 2VLAA 1VF9A 3E6DA 2XKOA 3VSKA 1JJ8C 5CVRA 4XK4A 4IRIA 1KYZA 1IN5A 1JE8A 4DZPA 3A1YA 3DKYA 1KU2A 2HNHA 2W84A 4Z2YA 2LBFB 3DEEA 5IT3A 1TT5B 3NARA 3WGIA 4HNUA 2QZ8A 1O7FA 1I6XA 1LKXA 3D0SA 4FQGA 3I58A 3B6CA 3FM3A 1WGXA 2L3DA 4AIJA 1GHCA 3G1MA 5LD2C 1LUJB 2PMZA 1XSXA 2XIGA 4NDLA 4YELA 1WI9A 5M3FJ 2RDPA 1XG1A 2HFHA 2X85A 3M8JA 4GO1A 3H0DA 1JKQC 3HM5A 3HOZJ 3QU3A 5K1YA 3W2AA 1SFOJ 2MG4A 1BI2A 5IT9Z 1QQIA 2L02A 3IL2A 5L3CA 3BLYA 1ZREA 3K0LA 6PAXA 3HTSB 4PK4A 3OWTA 3WHCA 2O03A 2G9WA 3G4SI 5F0CA 3QP6A 4R79A 2ME0A 1P6RA 1WJCA 3OYMA 3FDYA 3CLQA 4G12A 2HS5A 3EETA 4BS9A 1RRJA 1P7IA 1BBYA 3CMEI 1HBXG 1A6QA 2DQRA 1FLIA 2M45A 3TL4X 5HODA 2M9HA 2Z16A 4CICA 1BA5A 4IJAA 1EH7A 4D0PA 2LK2A 5FD6A 2JWTA 5LBQA 1U9OA 3KIOA 3GTJJ 1SC7A 1LFBA 1R6RA 5IYBJ 3S14J 1D0XA 1X4PA 2L9SA 3F21A 2WAEA 5DCMB 2O6GE 3JCUC 4E7JA 4XRFA 3KEYA 4ZTJA 2WC2A 3H3ZA 1QZYA 1NG6A 4BU2A 5EDNA 1TL8A 1AU7A 2VJJA 2O5RA 2VBZA 1T08B 4OIRF 1U0JA 2VQLA 3OYIA 1ZG1A 4KUMA 2J5PA 3COAC 1B8IA 1TWFJ 1EKEA 4ZDOA 1Y0UA 5IYCJ 3TW6A 1HF0A 2KIUA 5HLHA 3GTPJ 4S05A 2R0QC 1USSA 1KYWA 3CCSI 2FSWA 3AG2H 4DJAA 2V6EA 1QHHD 1E0EA 5CPRB 1MZBA 2DDBA 1WHUA 5FROA 3R0AA 1OYIA 2W82A 2EIKH 2X6YA 3IUOA 1K4TA 1MH4A 3HTUA 4I0BA 4AIDA 3SQNA 3C2GA 2VT3A 3JW4A 4YIIA 5EF6A 4CGZA 4LIUA 3DBLB 2M4KA 4EJTA 2DYRH 2VASA 3JSPA 1IRFA 1O3RA 5LGNA 2IGNA 2GAUA 1UHMA 1H0MA 1G8XA 4EVIA 2A07F 3H3UA 1JGGA 2GXBA 1Z67A 1YIJI 4A3CJ 4A6EA 3J7AY 3K2ZA 2UUZA 1QHGA 1PUFA 2P6TA 2QKLB 2IGKA 1HW2A 2WB1N 3H36A 3SFZA 4RAGA 2OJED 1X4OA 5KAIC 5J6XA 4E7HA 3HGYA 5M5WJ 2VBWA 4LG3A 1YS6A 2JN6A 3AL0C 2I5UA 3O2PE 2Y9YA 1MDMA 3V8LA 4M3GA 1MJAA 2H8WA 1I27A 2HDWA 4JX6A 4MEYF 3KYCB 1OJLA 2DFFA 2J5OA 2EILH 1WH7A 3D5LA 4L18B 4M72A 1S3JA 2DT7B 3T1BA 4PUSA 4B09A 3HUGA 5IP6A 4BH9A 1ZLKA 3ZPLA 3PIOF 3J81Z 1K6YA 4EGZA 2QWWA 2K3FA 4HAMA 3WTWC 4EJVA 3OYKA 3HXLA 3DPUA 2DQLA 5K7HA 1WJBA 2EV0A 2XAHA 2H09A 3JRDA 4C3IJ 4PJNA 1YJ9I 1T0FA 1OCCH 3VDXA 1HQCA 4JK1X 2QCOA 1E2XA 5H6QA 3W3CA 3QPTA 4IEJA 4LITA 3VEPA 2R7OA 2E19A 4W1UA 3OYHA 2NOJB 4E7SA 3RI4A 2BEOA 4HSTA 2AQFA 4HQEA 3CCJI 2W1OA 3Q3SA 2OU2A 1D3YA 1YW9A 4JQFA 4IHYA 4IRGA 4XLHA 2KZVA 2B0LA 1YX5A 3K6GA 3OIQA 2DFIA 2BZTA 2P81A 4ZZLA 3ZQ7A 2WAQN 1IZ1A 1UHSA 3EUAA 1W36C 1Z7LA 4RLQA 3KLOA 4PGGA 1O3QA 4RGSA 3D5SC 2E2HJ 3PQJA 2MD0A 1JT6A 1SANA 5K5RA 5DEQA 1V4RA 2RV8A 1VZ0A 3FX3A 3JAMK 4BE1A 2HDCA 4OIQF 3E3VA 1OCRH 2L0KA 5F08A 4OOIA 4OINF 3HJEA 4QPQA 5H2FC 2IGMA 4B4CA 1HKQA 4PJMA 1RKWA 2HZTA 1WSUA 2WV1A 1XDUA 4OAZA 3J7AO 1WI3A 2KIMA 3WG7H 2JZYA 3R4KA 4XLNF 3L2CA 4EGYA 3F8CA 4PJJA 4GYGA 1O3TA 2FU4A 2XAFA 4DGWB 3BC8A 2IS6A 3LL7A 1BW6A 2B9SA 2M2EA 5LFAA 1VQ5I 4HV6A 1UB9A 3TOBA 2P4WA 1Y0NA 1GVDA 3B73A 2Y2ZA 3K4LA 3VFZA 3I56I 2ISZA 4OIOF 5C4XJ 1ZGWA 1XGNA 2Z9OA 4Y33A 3NWTA 1NK3P 2DW4A 2HWVA 3B02A 3GZNB 4XORA 2MH9A 2R7RA 3ERED 1XMXA 3LSMA 1P4XA 2ESHA 2JJ7A 3FK7A 3CDLA 3HIFA 2WADA 2ZJQF 5D8KB 3OYDA 2E2IJ 2X6OA 2ZMEB 1Z9CA 3QAHA 1PP7U 1Z3XA 2O0YA 2L9VA 1U5TA 1OCZH 3LOCA 3C18A 3DU6A 2HPMA 3ABMH 1ZGAA 1EV7A 2NS0A 4XICA 2Y30A 1BIBA 4M6XA 4D9JA 4CXFA 1BL0A 5HS7A 2QENA 1YX3A 3KYDB 2QSGX 4IKFA 4G6QA 3F23A 1UCRA 4UV8A 4CZZA 4L9VA 5DM7F 2HQRA 5LGTA 2D1VA 4TV7A 1D5VA 1F43A 2M0CA 4A3JJ 1P4WA 3H0GJ 3HC7A 1WJEA 3OYAA 1A36A 3IP4B 4JP0A 3MQ0A 1XSVA 2ZJRF 4EJUA 3F72A 2RVCA 4N4NB 3KEQA 1ORKA 2H1KA 3DWLE 1WJ5A 3V7CA 4H4KC 3LSJA 3QODA 4M6VA 5JHUA 3S3MA 4RAZA 3RYRA 2HOAA 2LRDA 1OLTA 4HF2A 1IO2A 3FZVA 3LSKA 2WWYA 4ZTFA 3HPGA 1FP2A 4U0YA 3ZQFA 2L54A 1RIOH 4XONA 1G59A 1E17A 1HKSA 2ZNYA 3EUHC 3M8EA 5B1AH 3N4MA 2XPVA 2YR2A 2EFNA 3L9FA 3CUQC 1NK2P 3ML6A 2EBIA 4XR6A 4KA4A 2KDZA 3TMOA 3LFUA 3BR5A 2CQ7A 2L5QA 5FD5A 1J0RA 4BE2A 4WXCA 2V9VA 3G2BA 3HOYJ 3VPRA 1BJZA 3WHBA 2VONA 4UV9A 3I55I 3TW7A 4EM2A 2M5WA 3W6KB 2VPLA 2XPUA 3CJRB 1FOKA 4BHPA 3PO3J 3BZCA 3ZMZA 3ASOH 5M5YJ 1FYLA 4JX5A 2YU9J 4XLAA 1DU0A 1VQ9I 2EQRA 1I39A 3T5XA 2RQPA 1Z1DA 3K70D 3RIRA 3GZ6A 2W57A 3DLLF 3FXOA 3OV8A 3DKWA 2D1HA 1OCOH 2JSPA 4A5MA 2ZC2A 4AYBA 3U9GA 4MO7A 1QO0D 3JRGA 2VKHA 2BVMA 1K4SA 3WGGA 4M9SA 3CF5F 1ZR4A 4DIQA 3V4GA 2FRHA 1RESA 3HG9A 4ESFA 2MABA 3A03A 4K2EA 3OYJA 4WXHA 4ITVA 2KDOA 2A69F 4X1EA 4A69C 2V4JC 2ZBKA 3NQOA 3GW2A 5FFXA 5HNHA 4KISA 2F6CA 3CF2A 1QBJA 2CU7A 5FJ8J 3NEUA 4GCVA 1XN7A 2IEKA 3OR2C 1QZEA 3VYTB 3GTQJ 4XLFA 2DA7A 2V26A 2CUZA 3J7ZI 1YIOA 4FHTA 2MLKA 4QTRA 1YJWI 3ABTA 2VL8A 4YEJA 1VQ6I 2ACJA 5DTDA 1S7EA 4G6TB 2HVQA 5L3FA 1WJAA 2R5YA 1XCVA 4BDYA 2V1XA 2O8XA 3F6OA 2DA6A 3BDDA 2KJCA 3OL3A 3OYGA 3F9KA 1S8NA 2GWRA 4O3MA 5HDKA 3IC7A 4YIFA 1BR1A 4FASD 5FLXZ 1J75A 4BUPA 5M3MJ 5E17F 4ZC3A 3OYNA 5E3NA 2PG4A 3EDPA 3R0JA 3OYBA 5J8CA 4HDVA 1K7AA 2LKSA 4CCNA 4CDGA 2OC6A 1U9NA 1BJAA 3LSTA 4ZJZA 1QRYA 5B66C 3J81K 4R8HA 3W6JB 2KLOA 3K4KA 4J19A 1PUFB 4KIGA 2V79A 2HKOA 2MFZA 2QLZA 3LSIA 1TWAJ 3NAUA 2CQXA 2K85A 4B8XA 1V55H 1J5YA 1LNWA 3I4NJ 1A31A 3UKGA 5EYRA 4QLCU 3QYBA 3TO7A 5FLVA 1MDMB 4BJTA 4ZYEA 1V5FA 4HSRA 4QIWN 2JA7J 5LEKA 4ZDPA 1YQAA 5D4SA 4N9HA 5GP9A 2XDVA 2CUFA 1LPQA 2FNAA 2X0LA 3I53A 3H9QA 3HUGB 1VQPI 3FK6A 3DF8A 4RGRA 4M9XA 2XGEA 4ETSA 3REOA 4XLEA 2H8RA 1W4MA 1L0OC 3K1NA 1D0ZA 2DBBA 5BMZA 1T2KA 4WF2A 2E60A 2OAZA 1DDNA 1MBFA 4GDFA 2OA4A 3S16J 2OV7A 2HQ5A 4RB2C 5HLGA 5GAEJ 1HSTA 5D5VB 1BR4A 1IJWC 2HYFA 1TP4A 3FHZA 4I98B 1YHQI 3U21A 3ZQHA 5FLMJ 3W6VA 4KNYA 3ZMDA 1IRZA 2DYSH 1PP8F 3MKWB 2CG4A 1T98A 3J80Z 1MBGA 3RKYA 1RKTA 2LG4A 2QYOA 1FJLA 4C2MJ 3O3KA 1XDSA 3FXMA 5TJJA 3TGNA 3CZ6A 1VTNC 4FX4A 1R58A 1T38A 3GXOA 3LSGA 1E3HA 3IH4A 1G2HA 1F36A 3ZQIA 5CVUA 4A3EJ 4OMZA 4CCOA 4IHTA 2P5LC 3ZXSA 3FXQA 2PJPA 2BY0A 5FGMA 3OSGA 1FBUA 3HOUJ 3S1QJ 5E18F 2AS5F 1W36D 4Y13A 4NNJA 1Y1WJ 3S2DJ 4S0HB 3CUOA 1WRJA 4RA2A 3S2WA 3K10A 1KZHA 2R7VA 5HLIA 3H9JA 1LDJA 2W48A 1MW7A 2FMYA 3V8JA 3BTIA 3KP6A 4A0ZA 4EJWA 3CCRI 1OQYA 5DYMA 1QVTA 4PFPA 4RB0A 3SEZA 3MKZA 2X6WA 2FX0A 4MFEA 2DA3A 4FE7A 5J47A 3BCAA 1IAWA 1MMGA 5EEGA 1DPRA 4UUSB 1JKRC 1UG2A 3QPHA 4BBRJ 3TP3A 1MBJA 5DS9A 3RTRA 1Y39A 3GTKJ 3S32A 1Z0XA 2R7WA 2HU9A 4XRSA 4I76A 3ISPA 2KKOA 3CP2A 2XSJC 1KQ0A 1P7JA 2CRGA 3ZCOA 1X58A 3LMMA 1V3FA 3HRTA 1VQ7I 2G7HA 1W5CC 3RPUD 5FKNA 2HR3A 3FKIJ 1ITYA 1MMDA 4O6JA 2ZFUA 4YG2F 3GTMJ 2KRCA 2VQCA 2IS4A 4ANJA 1MD0A 2JT1A 1Z7UA 1ZG3A 2DOEA 4EMSA 1U5TB 3KP7A 4B3XA 4I6ZA 4ENKA 2GA2A 4H0EA 3BY6A 5J4VA 2ELKA 3BT9A 1W0UA 4BYYA 1UHWA 2CUEA 2IXSA 4XKCA 1DQUA 4E7ZA 1FYKA 2QSHX 3MD2A 3HSEA 1RUNA 1XD7A 4L9NA 5KCMA 3E1SA 4XSZF 3FXKA 1EA3A 3LA2A 4RGXA 2K3PA 3WTXC 3OS1A 2E2JJ 2EPFA 4B47A 2FQ3A 2HPIA 3PNYA 2E7WA 4WCGA 2OCEA 1YJNI 3K4MA 5ICGA 2EIJH 2R4GA 4C9YA 2XRNA 1SAXA 3GTLJ 3K7AJ 2AHQA 2EZHA 3RPUA 2Q2EA 1UMQA 1IN7A 3DV8A 2L7MP 3DP7A 5J1RA 3JREA 2DOFA 2X1EA 2VKEA 3KX2A 4XMYA 2XROA 2XSDC 4F7ZA 3QWLA 2L4AA 2M7BA 3AKZA 4J00A 3CTAA 2WY8Q 1B4AA 2CMPA 2NOGA 3G1OA 1QA6A 3BR0A 2HGCA 2P5VA 2LH9A 3GFJA 4MNUA 4UHTA 1LEAA 2OPTA 2QQAA 1JKOC 1S29A 2LVSA 2BVLA 2CGPA 1BC8C 1GVJA 1WPKA 2ID3A 2DT5A 3FIWA 3FKJA 3HPHA 3RPQA 2A3SA 2XAQA 2KZGA 3KZYA 1R1VA 1K78A 1O57A 1J59A 3HSFA 2CFOA 2ELHA 4G8XA 3J7YJ 3TO9A 4ENNA 2COBA 1OISA 2M4GA 3GUDA 4Q47A 5LRRA 1GV5A 1SD6A 2K4JA 3DTIA 3WTUC 3L2RA 2K7LA 2WAFA 3D5RC 3U1KA 3AAFA 2CV0A 2R7TA 2LR8A 5HDNA 4A3GJ 4LOCA 2DMPA 2VXDA 3QPLA 5K7ZA 4D5FA 3HOTA 3T8TA 4C3JJ 4ESJA 1AWCA 2Y0SA 1IDZA 2KP6A 1YFHA 5B3SH 2VC0A 5GPAA 2XF7A 3DU5A 4YRVA 4OAYA 1CQTA 1YOVB 2K5CA 1FOXA 3EQLF 3E7LA 3BPVA 5H20A 1T56A 2CSOA 1RR7A 3A02A 4MFDA 3QOEA 2OQRA 2LYCA 3CMMA 5JVGF 4B3AA 3RYPA 3EPZA 2YUSA 1D0YA 3EUHA 1ZRCA 3ZRGA 1LEBA 4X6AJ 4IHWA 2W4SA 2K9LA 3CUQA 1R4NB 2EZIA 2VE8A 4XQFA 3OOUA 3GFLA 2JTVA 3H5NA 1VQNI 2EA2A 1FOYA 1K6OA 2GXGA 2FOKA 1H89C 4DYQA 4P5OA 1FSHA 1A35A 3MZYA 1DUXC 2IAIA 1FZPB 2GLOA 2RAEA 1F1ZA 5D6EA 4ESBA 2VE9A 1J7KA 2QM3A 5HDGA 2NS8A 2CJJA 2MC4A 2DJIA 5EGOA 1ZR2A 3JRIA 2R93J 3O8GA 1HA8A 4F3QA 1Z91A 1Z6TA 1F5TA 2R5YB 1IXCA 3M7GA 3PIPF 2MBFA 4NC6A 2FF4A 1FEXA 2MLGA 2F2EA 1S6LA 3O6BB 1SVOA 2ZCWA 3KETA 1NH3A 2P0WA 5F64A 1MGTA 2ZFWA 3BWGA 1EH6A 2GBYA 5C4JJ 4CYCA 1MSEC 2BXYA 2RREA 4FCYA 4E7IA 2ID6A 4II2A 2XPWA 4E4HA 1QVUA 4XKVA 3VSLA 2RNGA 4F52A 5HOOA 3S8PA 3RSNA 2E5ZA 4B1RA 2CWEA 2ESNA 4HYEA 4NC8A 5EZHA 4Q5SF 2DU9A 4A2UA 4AVPA 5LEJA 1CF7A 3Q0WA 2QQ8A 1C0WA 2V9PA 2XF6A 4U88A 4RLFA 4FT8A 4AIHA 2L2OA 3FHNA 3K1MA 3L7WA 4U0WA 2DO7A 4ZDLA 2Q8KA 4IQ4A 5F0FA 1FY7A 2LF8A 5CKTA 4XRSG 1NG7A 1K79A 5EJCA 3A4CA 2F48A 3DLAA 2K4BA 1UJ8A 5J1UA 3Q0UA 4BY7J 3WTTC 3H1CA 4Y4RA 4CO8A 2ECCA 4J01A 2NNYA 2CV2A 3AFHA 3L09A 3LNQA 4HX8A 4G7HF 3D1NI 1G6NA 2K9MA 3AG3H 3J80K 1STZA 3W2WA 2VC1A 1X3ZB 2VI6A 2Y31A 3LQRA 4GGGA 4LFUA 4PGHA 3VODA 3S1RJ 1L3LA 5D5WB 4KT6A 2PJRB 3M8FA 1OKRA 2L9NA 1LJ9A 3WTSC 1SEUA 1HLVA 1ONVA 2VBYA 1FBSA 3KZZA 5E8IA 5CLSA 2IA1A 1GLNA 2CQKA 3MZHA 2HDDA 2LNBA 5ILUA 2EV5A 2QSFX 4MQ9F 2FXAA 4G7OF 1R4MB 3FM5A 3LA3A 5CVIA 4CCKA 5F04A 4A3FJ 4L0ZB 3T0YA 4AIKA 1Y8RB 3BQZA 1Q1VA 3UR3C 3HL2A 4XNFA 1VNDA 4IQJA 2PX9A 1PVEA 5L3BA 4M3FA 4CCJA 2I8DA 5A2QK 4A3BJ 4LG0A 3T8RA 2HTSA 4P9UA 3SJMA 2RQQA 3KFWX 2M0MA 4RDUA 4Y15A 5EG0A 1SVLA 3IWFA 3AL0B 1ZKGA 1IUFA 4PJ0C 2CW7A 2H1LA 3PNTA 2XAJA 5B5EC 1KU7A 3ZQCA 1U78A 1G3TA 2BGCA 4KMUX 3FBNB 2XKPA 2HVRA 1JUPA 2CUJA 2CFXA 3I54A 2KIQA 1S9HA 2BYVE 2EB7A 2F4OB 3IHUA 3V8KA 2CQNA 3F8MA 4P9FA 4EV0A 4L9TA 2Z1DA 2HQAA 2ZKZA 1R22A 2LY9A 5TISC 1J2XA 1YYVA 1KGSA 1BC7C 3KPHA 5J3LA 2YPRA 2BW3A 4AVZA 1ACIA 5E3LA 4KYWA 3L2VA 1SFUA 1TLHB 3V7SA 3S1NJ 2TCTA 5FKMA 3G3ZA 3G1LA 1I1GA 1APLC 3K1PA 5BQTA 1R49A 5JI6A 1EH8A 2NVUB 2PMZN 4NB5A 4IXAA 2A5YB 4HEA2 3GX4X 2EINH 4P1WA 5E8GA 4BHBA 2HOSA 3BJAA 3P7NA 4UY8I 2F4IA 4IOCF 3OOPA 2K9QA 1BOAA 3NRVA 1LE8A 4PSXA 2LFBA 1K61A 2P7CB 2YSRA 2HYGD 2VN2A 9ANTA 1MNEA 4HG2A 5IT9K 1FPQA 1LVKA 5J40A 1TQIA 3ESWB 2DMNA 1Y6IA 2XB0X 1O4XA 3E0JB 1HXDA 3HRSA 2DA2A 1B59A 2X1DA 3ZQQA 5D6FA 4L5JA 3A2KA 3VYRB 2H94A 3WU1B 1F9NA 2OF7A 3R6SA 3GTGJ 2JMWA 3Q5FA 3WE2A 2WA0A 3OY9A 1AKHA 2IGOA 4RS8A 4MTDA 3CP8A 2F5DA 4S04A 2GIZA 2AXLA 1MMAA 4QWQA 5K7FA 1XTAA 1NTCA 3BJ6A 4BQNA 5C44J 3HKZA 2Q2EB 4RM2A 4L9JA 2FBIA 2A68F 4YFXF 1TNSA 2GOMA 1SFXA 3BR6A 1SAUA 4M74A 4O5VA 3DTKA 3HEFA 3AG1H 3OR1C 1YS7A 5DUIA 3FMRA 2LF7A 3I59A 2JA8J 4HW0A 2A6TA 2Y0SN 3CDHA 3OS2A 2K02A 3G71I 4UXNA 2CH0A 2V9KA 1G3WA 4AD9A 1YO5C 3LSPA 3GWZA 1MBKA 1U3EM 2ZJ2A 3GYHX 1HCRA 2DXIA 2O3FA 3CCQI 4A6DA 2X1CA 1ETQA 2CYYA 1K78B 1E3PA 1OFCX 1RC9A 4AWXB 5ICCA 1YITI 4XM3A 1ETXA 3F6VA 2A6HF 4N9IA 1IGNA 4DBRA 1V5EA 2KT0A 2QQ9A 4Y7NJ 2ZO4A 1IV6A 2BOLA 2VJIA 4BQAA 2IP2A 1USTA 4A5NA 2DK8A 1XMKA 1HC8A 3RCOA 3IH2A 2L4MA 2V6CA 2X6XA 3CC4I 2JPBA 3HB9A 1IDYA 3HDDA 1HDDC 4OU0A 2UXNA 4DNCA 1QPIA 1FOWA 5IP9J 2JVGA 1X1PA 2PQ8A 4XLCA 2Z5UA 3HRUA 3S15J 1B8IB 2N8GA 1IN6A 1TWGJ 1VI0A 3JRHA 3DQVC 4XBFA 1ETKA 2X4HA 2R7XA 2LMDA 3IV5A 1ETWA 1DP3A 5E3OA 1SD4A 2RKHA 3FMSA 3A01A 1D8JA 1X2NA 1FWZA 2VKDA 4X0GA 1T95A 2WTEA 1HSJA 4PCQA 4C3HJ 2DMUA 2BHZA 4LK1F 2R7ZJ 4L0YB 2RC4A 1X1CA 2ZXIA 2QUFA 2A61A 3CUQB 4EATA 4PFOA 3HBLA 1SFEA 3ZP5A 2VJ5A 4ZH4F 1JTYA 2K86A 2NVQJ 1B9NA 2IS1A 5DV5A 2GXAA 3TOAA 5JHFA 4LB5A 2ELJA 4D5CA 1VQKI 3VYSB 3MCZA 3CESA 2LDUA 1ODDA 2R7DA 2KRFA 4KFCA 4LLLA 4HQMA 4IHSA 3OYLA 3K4CA 2XRLA 3OYCA 2X51A 5EGOB 1ZN2A 2H6CA 2Q1ZB 3BZ6A 1TNTA 3ZOBA 2LD5A 1T8IA 2V1NA 3BR3A 2ZXWH 1FT9A 1TWHJ 2MH2A 2Z3YA 3KCCA 3PUFA 5E1XA 5TGTA 2P5KA 3EUKL 3SDBA 4XKWA 1IF1A 1ETYA 2GIVA 2K9SA 3TBIA 3E6CC 2XASA 1ZELA 2LOOA 2Y0MA 2WB1A 4U87A 2VOOA 2CS3A 2EZKA 3BTCA 4A0YA 4IPAA 3DBHB 4CYCB 5GAGJ 4U0VA 1ULYA 4BJ5C 1LDDA 1BI0A 4RBOA 2HQNA 4CUGA 1W1WE 1Z77A 4RAFA 4KITB 2L01A 4CYDA 1ZH5A 1K83J 3BG3A 2ECBA 3TQNA 4IF4A 4KIBA 1XSDA 1CF7B 2G0EA 1ZK8A 3GFMA 1R71A 1P92A 1SD5A 2KISA 5KK1A 5K5OA 3JSOA 1GV2A 4G6DA 3F8BA 4XRMA 5HS8A 2YS9A 1WKMA 4DYCA 2E1CA 2LP0A 2VQGA 1ERDA 4C2TA 1VFCA 3G6EI 2VBXA 4F91B 1FNNA 5L3EA 5JFRA 1KA8A 2Y9ZA 1SMTA 2GZWA 2M1BA 2PEXA 3KP3A 5D5UB 2IS2A 2IBDA 2R3SA 4QSHA 2FMLA 2O61A 3KP5A 1JUMA 4IOAF 1TT0A 2EIMH 2CW0F 3CDIA 1FMVA 1T6SA 2VQHA 1I3AA 2ISYA 5ERIA 4RB3C 3GF2A 4XSXF 1TQMA 3BTLA 2ME6A 1IC8A 1I50J 2ICWG 2P8TA 4FE4A 1JTXA 1Z3YA 1W5TA 3RDIA 4Y52J 5KAFC 4M9ZA 4DZJA 4IO9F 2HOTA 4LD5A 3WTVC 3HHHA 4D1QA 4ENJA 3JAMZ 2CO5A 4OWRB 5E3MA 2VT2A 3DXJF 3GVAA 1TW3A 1YG2A 1H8AC 2QBYA 2DA5A 5ICEA 2DT6A 2NXNB 3DBRB 1GXQA 2B7EA 2NRAC 2M3AA 4BXXJ 1OMIA 3DKXA 1BW5A 2MA3A 4AUXA 3LWFA 1X3WB 3VYUB 4HLXA 1WH5A 3DCFA 1MJBA 4MLOA 2KFDA 3JRFA 4A93J 3FF5A 4LG0B 4HA8A 3S3OA 2CQQA 1JHFA 3NWSA 4BE0A 1FYMA 4V19K 2F5VA 5EG0B 2JA2A 2KQRA 3I64A 3R60A 2HEOA 3ZMSA 3IWZA 2IA0A 3MZ8A 1H9GA 1D1AA 2PBIA 3KP4A 4M3DA 2XB5A 2VOPA 3OIOA 2X9DA 4RM3A 4UUTA 1MSFC 2FUG2 5IYDJ 4ENMA 2KHMA 2XGDA 2W85A 1XC5A 2B63J 4MIMA 4A3IJ 1GT0C 4BXFA 1ZRDA 3GEZA 2QGUA 3ZR8X 2UWMA 4ON0A 2OCCH 2R92J 3BG5A 2BW3B 3ZMVA 3OSFA 2JRTA 1OR7C 3VOEA 3H3VK 1WVRA 2KPMA 3OMYA 3H35A 3RKWA 2W25A 5CJ9A 5GTIC 3JRCA 1KU9A 3SZGA 2HTJA 5IY5H 3P9KA 1YRNA 1FIPA 2JSCA 4HX7A 3RKQA 3HOXJ 2DMQA 3QYEA 1D1CA 3KLNA 4PZJA 4A3LJ 2JUCA 1JHHA 3Q9VA 1V54H 3SZTA 5EZGA 2UXXA 3BQYA 1BI3A 3HKZN 2R7FA 1HDPA 2LREA 5F27A 1LE8B 4EM0B 2JA5J 3PQKA 2GOXB 2DCEA 2FEZA 2XVCA 1TTYA 4XL9A 5GAHJ 3P9IA 4HV5A 1BOBA 2XAUA 2BHYA 4XOPA 2PN6A 4YFKF 1POGA 3L1PA 2Q0OA 5J8FA 1G3YA 4MQVA 1H88C 2L7ZA 4A3MJ 4IRHA 4DYRA 1VQ4I 1J9IA 2F5EA 1AOYA 3BPXA 5EEAA 2DLLA 3MKYB 4AC0A 5CYVA 2WY7Q 4AYBN 3K70C 3E97A 2M30A 3CLOA 2R5ZA 3RZOJ 4CCMA 5BS6A 1A5JA 1I5ZA 4C30A 2BE5F 4NHJA 4I99C 1AKHB 3BP8A 3ZQLA 3E5XA 4HPQA 1MBEA 3I3LA 1HOMA 2LY1A 2M7AA 4W97A 1XGSA 4HNVA 1T33A 2CV1A 1MNMC 2E34A 4HZFA 3M1CA 4BKXA 3TP0A 4D7NA 4RGUA 3CJTB 4XN3A 4JBAA 1R9TJ 1FMWA 1KU3A 5ICFA 2R7QA 3ASNH 4RB1A 1NHAA 2GQQA 2E1OA 1BI1A 4II3A 3U1DA 3MN2A 3ABUA 4MHGA 3SXYA 4EQQA 2L7FP 3GMEA 2YX4A 4A12A 1JT0A 1MJ9A 4GFBA 1R7JA 4OIPF 1YTYA 1WQ2A 4KJZA 3CCLI 3E6MA 3I59B 3O8HA 2UZKA 3V42A 1R36A 4HF1A 3M4OJ 1YW7A 2DI3A 2W7NA 1B72A 5HNFA 3DPTA 2FNPA 2NAZA 2ZSIB 3KE2A 4ZYGA 3IH3A 2OBPA 4PSWA 1N25A 4C2UA 2ZNZA 4XKBA 2EH3A 2DOAA 3BROA 2JPCA 3JRBA 1MBHA 3FXJA 1IN4A 3H5RA 3DTEA 2VB6A 2ZB9A 2TRTA 1LB2A 4I09A 1JXSA 2HKXA 1ETOA 4BL0B 1ZYRF 4LMYA 4XLPF 4HOBA 3ZMTA 5DD4A 3SFIA 4E70A 1N75A 4D7MA 2DMTA 2NNNA 5GPCA 5LRSA 1JKPC 5FLXK 1HKTA 2O9LA 2F5FA 3Q0VA 4U7BA 1XGMA 4R1HA 3OL4A 4FISA 3F8NA 3GBGA 4NQWA 1MKMA 3CCMI 3BZKA 3GCMA 4CA0A 1FX7A 5EEHA 2FA5A 3WE3A 4BHCA 3A01B 1CGPA 3BCBA 1D5YA 3BJOA 2XHKA 1OYYA 3HHGA 2HXOA 1O3SA 2VIXA 3I5UA 2Z33A 2COMA 1MNDA 1UELB 3PM1A 4LJZF 5FRNA 3AG4H 4A0XA 1EF4A 2BY3A 3ABLH 4UB6C 4HF0A 1D1BA 1R5HA 1N77A 1WWXA 4I02A 3TO6A 1R1TA 1I6HJ 2E71A 2K27A 2OUMA 4I0AA 5IOZA 5C3EJ 4OMYA 3ECOA 3CD6I 1Q1HA 5HLTA 4L5EA 2IVMA 1YE9A 1I3QJ 1IUYA 3VWBA 4DW6A 3PFIA 3QQAA 4BXUA 3WODF 3CJNA 3E6BA 3F3XA 2HOEA 2JK3A 1PJRA 1RR8C 3PJRA 1XB4A 3WG9A 2R7SA 4AM3A 2OTLI 2ZMEC 2JVHA 4XIDA 1VQ8I 2NVXJ 1E3OC 1W7PD 5E79C 5IPAA 2L9RA 5F1JA 3GO5A 3BG6A 4M73A 1ENHA 1V5GA 2F5CA 2LKXA 2KRHA 3I0TA 3UNGC 5D8LB 1T39A 2D45A 3WTYC 2NVTJ 3QRFF 1ZRFA 2IPQX 4ZYAA 4FTHA 2RGVA 3ONQA 2DJNA 4ASNA 3TEDA 1FTTA 3GLXA 4KT5C 1B1BA 2BY2A 1IV8A 2DFEA 4WK8F 1U6GA 5CVVA 3H9GA 2JRMA 1WCMJ 4YFNF 5B1BH 5H6RA 1S5LC 1ZLJA 1RETA 2RNJA 1BIAA 4N0BA 3FBIB 1W7PA 4WX9A 4LGWA 3GFIA 2XF5A 1XCBA 1LFUP 1WJFA 2I10A 4N4OB 5KVRA 3IKVA 5D4RA 3E5UA 2W24A 3LSRA 3C7JA 1R5GA 5DDGA 4LLNA 2FBKA 5D5XB 3C2HA 3CO7C 3I4MJ 1KQ8A 1QZZA 2ETHA 3RKXA 4BY1J 3ZGKA 1ZTRA 1W0TA 4BBSJ 5M5XJ 2M8GX 5FKOA 1SVMA 4Y17A 4BEHA 5BPIA 4E7LA 1X1DA 3C2BA 3DEWA 2AO9A 1S7AA 1RUOA 4IZZA 1IXSB 2XV4S 1RZ4A 4I7HA 5CQEA 4CH7A 1IRXA 2O8KA 3CC7I 3DPLC 5ILSA 5JLWA 5LHHA 4MTEA 4IX7A 3LFKA 1GDTA 4FETA 1UZCA 1X1BA 4DBQA 2FJ1A 1FC3A 1GUUA 2DA4A 2GA1A 1XX5A 3MEXA 4UUSA 4KDPA 1F4KA 1N78A 4JX4A 4UVAA 5LLQA 2D5VA 2MC3A 2EZLA 3KP2A 2M87A 5JR3A 2QBYB 2E35A 4G7ZF 3TKYA 1MIJA 2ZSHB 4JOMA 1QNTA 3SDGA 5HVQC 4BAYA 3K2AA 4BQOA 1O7LA 1R00A 3JRAA 1Y56A 2MW8A 5L3GA 4KN7X 2K40A 5ILVA 4CHUA 1R1UA 4M3BA 2QEXI 3HOVJ 3H5AA 2STTA 1BM9A 2C6YA 2FE3A 4HNTA 5TRDA 2LBFA 2UV1A 2XGCA 4CSWA 3FXLA 2JQ7A 2DTZA 3JTHA 1TW2A 3G73A 1ZG5A 1M1EB 3LA7A 4M3EA 4F55A 4HDUA 1TQPA 1IXRC 2LSOA 3ZQGA 2ZJPF 1BN5A 1R5ID 2A6EF 3S17J 1LVAA 1TZLA 3L2QA 3Q9SA 2DTRA 5F0HA 4IL6C 4ZYDA 3IRRA 1LQ1A 5ED4A 3SYTA 3WU2C 4AU7A 1MH3A 4P55A 2Y48A 3EYYA 3TDUC 2H27A 1S7OA 2D2WA 3FISA 4FX0A 1FP1D 3FMQA 3F22A 5LHIA 4I01A 1TBXA 1ZHFA 1X1AA 2Y75A 5FFZA 2JUGA 1A04A 4A3KJ 1YRNB 2OZ6A 4UB8C 4NBQA 1I1SA 5DD8A 5FB2A 2E36A
chains in the Genus database with same CATH topology
5E20A 2LKPA 3I4PA 1ZAOA 3HSRA 4M6YA 2DPUA 5DCFA 2YX7A 4MGRA 4DQ2A 4PDKA 2IRFG 3K9TA 2G7UA 2ZXJA 2XUBA 2YU3A 3E5QA 4LB6B 3QP5A 1REPC 3DEUA 3TDZC 1OPCA 1QGPA 1IW7F 3V7RA 1ZARA 3MAJA 5DCMA 1H9TA 5K5QA 3N97A 5E1WA 1ON2A 2XAGA 1U8RA 2NYXA 3C3WA 4IVNA 2PMHA 5F6FA 1OR7A 4UUVA 3L00A 1HW1A 3GZ5A 4ZZDA 2EFQA 3K69A 3F8FA 4MEXF 4BNCA 1RNLA 2QVOA 5AONA 5L3DA 1QPMA 2KJBA 1DP7P 1G4DA 4P96A 2OD5A 1Z05A 3JTGA 2H6BA 4EM1A 4ZYHA 3ZN0A 1FSEA 3M1EA 5E1ZB 4HLYA 3WU0A 2DPDA 1U2WA 4EJOA 3M9AA 1KQ9A 4HX4A 1X3UA 1Z6RA 4KN4X 2STWA 1UFMA 2BBYA 2OZUA 2VXZA 2EA4A 3ZN1A 2XGXA 3ZMUA 2PMUA 2IJLA 1D8KA 3RJPA 2QQBA 1GXPA 3ROUA 3LAPA 4GYIA 2Z99A 3I71A 1B6AA 1IRGA 3P9CA 2BV6A 4LLGF 5AIPA 2EFPA 3HOSA 1P2FA 4LK0F 2MD5A 2KIFA 1SD7A 3LAJA 5DUKA 3QU6A 2E1NA 2EFWA 3FWEA 1FBQA 3IRQA 5BOXA 2IT0A 4Q4ZF 1XMAA 2E7XA 2IW5A 4KIFA 3H92A 2EV6A 4G94A 5LHGA 3FXUA 3QOPA 1U5TC 1JGSA 3EYIA 4G9YA 1IN8A 3DFGA 1P4AA 4UVBA 3ULQB 3KEOA 3SHFA 3MFKA 2EFOA 3SZPA 4KICA 1XGOA 2EJRA 5HS9A 3ELKA 1YLFA 2FBHA 4Q48A 5JVTA 1PDNC 2EWNA 3U2RA 3C1DA 3WGHA 3CO6C 3MWMA 1SMYF 2PFBA 2EK5A 1YW8A 2V1UA 2DAOA 4I2OA 1B9MA 2VODA 5FO5A 2V1DA 5F1RA 1W7PB 2P7VB 1ON1A 3VB2A 3BOQA 5CVJA 2ADUA 3WTZA 5LGUA 4L5IA 4UNOA 2WV0A 2ZMEA 1G3SA 1R23A 1DPUA 3IKTA 3LQQA 4RAYA 1HW5A 2IA2A 5BPDA 5A2QZ 5AIQA 1W5SA 4GXOA 4U7DA 1PUEE 4KMFA 3HYIA 4UVCA 3HRMA 2P6SA 3ECHA 2PLYA 3FXRA 4HBLA 4M71A 1OYWA 2RN7A 2DK5A 4WXDA 1LDKB 4WWCA 2PI0A 3R61A 2TDXA 1RI7A 2M8EA 1ZGJA 2OQGA 3E6DA 2XKOA 5CVRA 4IRIA 1KYZA 1IN5A 1JE8A 1KU2A 2W84A 4Z2YA 5IT3A 3WGIA 2QZ8A 1O7FA 1I6XA 3D0SA 3I58A 3FM3A 2L3DA 4AIJA 1GHCA 1XSXA 2XIGA 1WI9A 2RDPA 2HFHA 4GO1A 3QU3A 5K1YA 1BI2A 5IT9Z 1QQIA 2L02A 3IL2A 5L3CA 1ZREA 3K0LA 6PAXA 3HTSB 2O03A 2G9WA 3QP6A 4R79A 1P6RA 2HS5A 3EETA 1BBYA 1HBXG 2DQRA 1FLIA 2M45A 4CICA 4IJAA 1EH7A 4D0PA 5FD6A 5LBQA 3F21A 5DCMB 2O6GE 4XRFA 2WC2A 3H3ZA 1QZYA 2VBZA 4OIRF 1ZG1A 4KUMA 2J5PA 3COAC 1Y0UA 2KIUA 5HLHA 4S05A 1USSA 1KYWA 2FSWA 1MZBA 3R0AA 1OYIA 3HTUA 4I0BA 3SQNA 2VT3A 3JW4A 4YIIA 4CGZA 4EJTA 3JSPA 1IRFA 1O3RA 5LGNA 2GAUA 1UHMA 1H0MA 4EVIA 2A07F 3H3UA 2GXBA 4A6EA 3K2ZA 2P6TA 1HW2A 3SFZA 5J6XA 2VBWA 1YS6A 3O2PE 1MDMA 3V8LA 1MJAA 1I27A 4MEYF 2J5OA 3D5LA 4L18B 4M72A 1S3JA 3T1BA 4B09A 3HUGA 4BH9A 1ZLKA 3ZPLA 3J81Z 4EGZA 2QWWA 4HAMA 3WTWC 4EJVA 2DQLA 2EV0A 2XAHA 2H09A 1T0FA 1HQCA 4JK1X 1E2XA 5H6QA 3VEPA 3QPTA 3RI4A 2BEOA 4HQEA 2OU2A 1D3YA 1YW9A 4JQFA 4IRGA 2B0LA 2DFIA 4ZZLA 3ZQ7A 1IZ1A 3KLOA 4PGGA 1O3QA 4RGSA 3PQJA 5K5RA 5DEQA 1V4RA 2RV8A 3FX3A 3JAMK 4OIQF 2HDCA 3E3VA 4OOIA 4OINF 1HKQA 2HZTA 1WSUA 1XDUA 3J7AO 2KIMA 2JZYA 3R4KA 4XLNF 3L2CA 4EGYA 3F8CA 4GYGA 1O3TA 2FU4A 2XAFA 4HV6A 1UB9A 3TOBA 2P4WA 3B73A 3VFZA 2ISZA 4OIOF 1XGNA 2Z9OA 2DW4A 2HWVA 3B02A 3ERED 2MH9A 1P4XA 2ESHA 3HIFA 5D8KB 1Z9CA 2ZMEB 3QAHA 1PP7U 2O0YA 1U5TA 3C18A 1ZGAA 1EV7A 2NS0A 1BIBA 4M6XA 4CXFA 5HS7A 2QENA 4G6QA 3F23A 1UCRA 4UV8A 4CZZA 4L9VA 2HQRA 5LGTA 2D1VA 4TV7A 1D5VA 1P4WA 3MQ0A 1XSVA 4EJUA 3F72A 2RVCA 3KEQA 3V7CA 5JHUA 4RAZA 3RYRA 4HF2A 3FZVA 2WWYA 1FP2A 4U0YA 2L54A 1RIOH 1E17A 1HKSA 2ZNYA 3M8EA 3N4MA 2YR2A 2EFNA 3L9FA 3CUQC 3ML6A 4KA4A 5FD5A 1J0RA 4WXCA 2V9VA 2VONA 4UV9A 4EM2A 2M5WA 3W6KB 1FOKA 4BHPA 3ZMZA 1FYLA 3T5XA 2RQPA 1Z1DA 3GZ6A 3RIRA 2W57A 3OV8A 3DKWA 2D1HA 4A5MA 3U9GA 1QO0D 3WGGA 4M9SA 3V4GA 2FRHA 4ESFA 4K2EA 4WXHA 2A69F 2ZBKA 3NQOA 3GW2A 5FFXA 1QBJA 3NEUA 4GCVA 1XN7A 1YIOA 4FHTA 2MLKA 3ABTA 2ACJA 5L3FA 1XCVA 2V1XA 2O8XA 3F6OA 3BDDA 2KJCA 1S8NA 2GWRA 4O3MA 5HDKA 3IC7A 4YIFA 5FLXZ 1J75A 5E17F 2PG4A 3EDPA 3R0JA 5J8CA 4HDVA 1K7AA 4CDGA 1BJAA 3LSTA 3J81K 4R8HA 3W6JB 4KIGA 2V79A 2HKOA 2QLZA 4B8XA 1J5YA 1LNWA 4QLCU 3TO7A 1MDMB 4ZYEA 5LEKA 1YQAA 5D4SA 4N9HA 2FNAA 2X0LA 3I53A 3DF8A 4RGRA 4M9XA 4ETSA 3REOA 1W4MA 1L0OC 3K1NA 2DBBA 5BMZA 1T2KA 4WF2A 2OAZA 1DDNA 2OA4A 4RB2C 5HLGA 1HSTA 5D5VB 2HYFA 3FHZA 4I98B 4KNYA 3ZMDA 1PP8F 2CG4A 1T98A 3J80Z 3RKYA 2QYOA 3O3KA 1XDSA 5TJJA 3TGNA 1VTNC 4FX4A 1R58A 1T38A 3GXOA 5CVUA 4OMZA 4IHTA 2P5LC 3FXQA 2PJPA 5FGMA 1FBUA 5E18F 2AS5F 4Y13A 3CUOA 1WRJA 3S2WA 5HLIA 1LDJA 2FMYA 3V8JA 4A0ZA 3KP6A 4EJWA 5DYMA 4RB0A 1IAWA 5EEGA 1DPRA 3QPHA 3RTRA 3ISPA 2KKOA 1KQ0A 1V3FA 3HRTA 2G7HA 2HR3A 4O6JA 4YG2F 1MD0A 2JT1A 1Z7UA 1ZG3A 4EMSA 1U5TB 3KP7A 4ENKA 2GA2A 4H0EA 3BY6A 4BYYA 1UHWA 1FYKA 3HSEA 1RUNA 1XD7A 4L9NA 4XSZF 3LA2A 4RGXA 3WTXC 2FQ3A 4WCGA 2E7WA 5ICGA 2XRNA 1SAXA 3RPUA 2Q2EA 1IN7A 3DV8A 3DP7A 2XROA 4F7ZA 2L4AA 3CTAA 1B4AA 2HGCA 2P5VA 3GFJA 4MNUA 4UHTA 1LEAA 2QQAA 1S29A 2CGPA 1BC8C 1GVJA 2DT5A 3RPQA 2A3SA 2XAQA 3KZYA 1R1VA 1K78A 1O57A 1J59A 3HSFA 2ELHA 4G8XA 3TO9A 4ENNA 3GUDA 4Q47A 5LRRA 1SD6A 2K4JA 3WTUC 2K7LA 3AAFA 5HDNA 3HOTA 3T8TA 4ESJA 1AWCA 1YFHA 2VC0A 3EQLF 5H20A 3BPVA 2CSOA 2OQRA 3RYPA 3EUHA 1ZRCA 1LEBA 3CUQA 2VE8A 3GFLA 2JTVA 2EA2A 1K6OA 2GXGA 2FOKA 4P5OA 1FSHA 3MZYA 1DUXC 1FZPB 1F1ZA 5D6EA 4ESBA 2VE9A 1J7KA 2QM3A 5HDGA 1Z91A 1Z6TA 1F5TA 1IXCA 3M7GA 2MBFA 2FF4A 2MLGA 2F2EA 1S6LA 3O6BB 2ZCWA 3KETA 5F64A 1MGTA 2ZFWA 3BWGA 1EH6A 5HOOA 2CWEA 2ESNA 4HYEA 4Q5SF 2DU9A 4A2UA 4AVPA 5LEJA 1CF7A 1C0WA 4U88A 4FT8A 4AIHA 3K1MA 3L7WA 4U0WA 2DO7A 2Q8KA 1FY7A 2LF8A 1K79A 2K4BA 3WTTC 4CO8A 2NNYA 3L09A 4HX8A 4G7HF 1G6NA 3J80K 1STZA 2VC1A 4GGGA 3LQRA 4LFUA 4PGHA 3VODA 1L3LA 5D5WB 3M8FA 1OKRA 1LJ9A 3WTSC 1ONVA 2VBYA 1FBSA 3KZZA 5E8IA 5CLSA 2IA1A 2CQKA 3MZHA 2LNBA 5ILUA 2EV5A 4MQ9F 2FXAA 4G7OF 3FM5A 3LA3A 5CVIA 4L0ZB 3T0YA 4AIKA 5L3BA 5A2QK 4LG0A 3T8RA 2HTSA 4P9UA 3KFWX 4Y15A 3IWFA 2XAJA 1KU7A 1U78A 1G3TA 2BGCA 4KMUX 2XKPA 2CFXA 3I54A 2EB7A 2BYVE 3IHUA 3V8KA 3F8MA 4P9FA 4EV0A 4L9TA 1R22A 2ZKZA 1J2XA 1YYVA 1KGSA 1BC7C 2YPRA 4KYWA 1SFUA 1TLHB 3V7SA 3G3ZA 1I1GA 3K1PA 5BQTA 5JI6A 1EH8A 4NB5A 4IXAA 2A5YB 3GX4X 4BHBA 5E8GA 3BJAA 3P7NA 3OOPA 1BOAA 3NRVA 2P7CB 2YSRA 2HYGD 2VN2A 5IT9K 1FPQA 1TQIA 1HXDA 3HRSA 1B59A 5D6FA 4L5JA 2H94A 3WU1B 1F9NA 3R6SA 3Q5FA 3WE2A 4MTDA 4RS8A 2F5DA 4S04A 2AXLA 4QWQA 3BJ6A 4L9JA 2FBIA 2A68F 4YFXF 1TNSA 1SFXA 4M74A 4O5VA 1YS7A 5DUIA 3FMRA 2LF7A 3I59A 4HW0A 3CDHA 2K02A 4UXNA 1G3WA 4AD9A 1YO5C 3GWZA 1U3EM 2ZJ2A 3GYHX 2O3FA 4A6DA 2CYYA 1K78B 4AWXB 5ICCA 3F6VA 2A6HF 4N9IA 2QQ9A 2ZO4A 4BQAA 2IP2A 1USTA 4A5NA 2DK8A 1XMKA 2L4MA 2V6CA 2JPBA 4OU0A 2UXNA 4DNCA 2PQ8A 2Z5UA 3HRUA 1IN6A 3DQVC 4XBFA 2X4HA 1SD4A 2RKHA 3FMSA 1D8JA 1FWZA 2WTEA 1HSJA 4PCQA 4LK1F 4L0YB 2RC4A 2QUFA 2A61A 3CUQB 3ZP5A 1SFEA 4ZH4F 2K86A 1B9NA 5DV5A 3TOAA 4LB5A 3MCZA 2LDUA 1ODDA 2R7DA 2KRFA 4KFCA 4LLLA 4HQMA 4IHSA 1ZN2A 2H6CA 3BZ6A 1TNTA 1FT9A 2Z3YA 2MH2A 3KCCA 5E1XA 2P5KA 1IF1A 2GIVA 3E6CC 2XASA 2Y0MA 2VOOA 4A0YA 4IPAA 4U0VA 1ULYA 1LDDA 1BI0A 2HQNA 2L01A 4CYDA 1ZH5A 3TQNA 4IF4A 4KIBA 1XSDA 1CF7B 3GFMA 1P92A 1SD5A 5KK1A 5K5OA 3JSOA 4G6DA 3F8BA 5HS8A 2E1CA 1WKMA 2VBXA 1FNNA 5L3EA 5JFRA 1KA8A 1SMTA 2GZWA 2M1BA 2PEXA 3KP3A 5D5UB 2R3SA 2O61A 2FMLA 3KP5A 2CW0F 1T6SA 2ISYA 5ERIA 4RB3C 3GF2A 4XSXF 1TQMA 2P8TA 1W5TA 3RDIA 4M9ZA 4LD5A 3WTVC 3HHHA 4ENJA 3JAMZ 2CO5A 2VT2A 3DXJF 3GVAA 1TW3A 1YG2A 2QBYA 5ICEA 1GXQA 2NRAC 1OMIA 2MA3A 3LWFA 4HLXA 1MJBA 3FF5A 4LG0B 4HA8A 1JHFA 1FYMA 3I64A 3R60A 2HEOA 3ZMSA 3IWZA 2IA0A 1H9GA 2PBIA 3KP4A 2VOPA 4ENMA 2W85A 1ZRDA 3GEZA 2UWMA 4ON0A 3ZMVA 2JRTA 3VOEA 3RKWA 2W25A 5CJ9A 1KU9A 2HTJA 3P9KA 2JSCA 4HX7A 3KLNA 4PZJA 1JHHA 3Q9VA 3SZTA 2UXXA 1BI3A 2R7FA 4EM0B 3PQKA 2FEZA 2XVCA 1TTYA 3P9IA 4HV5A 2PN6A 4YFKF 2Q0OA 5J8FA 1G3YA 4MQVA 4IRHA 1J9IA 2F5EA 1AOYA 3BPXA 2DLLA 5CYVA 3E97A 2M30A 3CLOA 5BS6A 1I5ZA 2BE5F 4NHJA 3BP8A 3E5XA 1XGSA 4HZFA 4RGUA 4JBAA 5ICFA 1KU3A 4RB1A 1NHAA 2GQQA 1BI1A 3U1DA 3ABUA 4MHGA 3SXYA 4EQQA 2YX4A 4A12A 1MJ9A 1R7JA 4OIPF 1YTYA 1WQ2A 3E6MA 3I59B 2UZKA 1R36A 4HF1A 1YW7A 2DI3A 3DPTA 2FNPA 2NAZA 3KE2A 4ZYGA 2OBPA 2ZNZA 3BROA 2JPCA 1IN4A 1LB2A 4I09A 1JXSA 2HKXA 1ZYRF 4LMYA 4XLPF 4HOBA 3ZMTA 5DD4A 4E70A 2NNNA 5LRSA 5FLXK 1HKTA 2F5FA 4U7BA 1XGMA 4R1HA 3F8NA 4NQWA 1MKMA 1FX7A 5EEHA 2FA5A 3WE3A 4BHCA 1CGPA 3BJOA 2XHKA 1OYYA 3HHGA 1O3SA 3I5UA 2Z33A 2COMA 4LJZF 4A0XA 4HF0A 1R5HA 1WWXA 4I02A 3TO6A 1R1TA 2K27A 4OMYA 4I0AA 3ECOA 1Q1HA 2IVMA 1IUYA 3PFIA 4BXUA 3WODF 3CJNA 3E6BA 3F3XA 2HOEA 1XB4A 3WG9A 1W7PD 3GO5A 4M73A 2F5CA 3I0TA 5D8LB 1T39A 2D45A 3WTYC 3QRFF 1ZRFA 2IPQX 2RGVA 4ASNA 3GLXA 4KT5C 1B1BA 4WK8F 1U6GA 5CVVA 4YFNF 5H6RA 1ZLJA 2RNJA 1BIAA 4N0BA 1W7PA 4WX9A 4LGWA 3GFIA 1XCBA 5KVRA 3IKVA 5D4RA 3E5UA 2W24A 3C7JA 1R5GA 5DDGA 4LLNA 2FBKA 5D5XB 3CO7C 1KQ8A 1QZZA 2ETHA 3RKXA 4Y17A 5BPIA 1S7AA 1RUOA 1IXSB 2XV4S 1RZ4A 4I7HA 3DPLC 5ILSA 5LHHA 4MTEA 3LFKA 1FC3A 2GA1A 3MEXA 4KDPA 1F4KA 4UVAA 5LLQA 2MC3A 3KP2A 2M87A 5JR3A 2QBYB 4G7ZF 3TKYA 5HVQC 1QNTA 4BAYA 1O7LA 1R00A 5L3GA 5ILVA 4KN7X 4CHUA 1R1UA 2STTA 1BM9A 2C6YA 2FE3A 5TRDA 3JTHA 1TW2A 3G73A 1ZG5A 3LA7A 4HDUA 1TQPA 1IXRC 2LSOA 1BN5A 2A6EF 1LVAA 3Q9SA 2DTRA 4ZYDA 3IRRA 1LQ1A 5ED4A 4P55A 2Y48A 3EYYA 3TDUC 2H27A 1S7OA 2D2WA 4FX0A 1FP1D 3FMQA 3F22A 5LHIA 4I01A 1TBXA 1ZHFA 2Y75A 5FFZA 1A04A 2OZ6A 1I1SA 5DD8A 5FB2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E20 A;  2LKP A;  3I4P A;  1ZAO A;  3HSR A;  4M6Y A;  2DPU A;  5DCF A;  2YX7 A;  4MGR A;  4DQ2 A;  4PDK A;  2IRF G;  3K9T A;  2G7U A;  2ZXJ A;  2XUB A;  2YU3 A;  3E5Q A;  4LB6 B;  3QP5 A;  1REP C;  3DEU A;  3TDZ C;  1OPC A;  1QGP A;  1IW7 F;  3V7R A;  1ZAR A;  3MAJ A;  5DCM A;  1H9T A;  5K5Q A;  3N97 A;  5E1W A;  1ON2 A;  2XAG A;  1U8R A;  2NYX A;  3C3W A;  4IVN A;  2PMH A;  5F6F A;  1OR7 A;  4UUV A;  3L00 A;  1HW1 A;  3GZ5 A;  4ZZD A;  2EFQ A;  3K69 A;  3F8F A;  4MEX F;  4BNC A;  1RNL A;  2QVO A;  5AON A;  5L3D A;  1QPM A;  2KJB A;  1DP7 P;  1G4D A;  4P96 A;  2OD5 A;  1Z05 A;  3JTG A;  2H6B A;  4EM1 A;  4ZYH A;  3ZN0 A;  1FSE A;  3M1E A;  5E1Z B;  4HLY A;  3WU0 A;  2DPD A;  1U2W A;  4EJO A;  3M9A A;  1KQ9 A;  4HX4 A;  1X3U A;  1Z6R A;  4KN4 X;  2STW A;  1UFM A;  2BBY A;  2OZU A;  2VXZ A;  2EA4 A;  3ZN1 A;  2XGX A;  3ZMU A;  2PMU A;  2IJL A;  1D8K A;  3RJP A;  2QQB A;  1GXP A;  3ROU A;  3LAP A;  4GYI A;  2Z99 A;  3I71 A;  1B6A A;  1IRG A;  3P9C A;  2BV6 A;  4LLG F;  5AIP A;  2EFP A;  3HOS A;  1P2F A;  4LK0 F;  2MD5 A;  2KIF A;  1SD7 A;  3LAJ A;  5DUK A;  3QU6 A;  2E1N A;  2EFW A;  3FWE A;  1FBQ A;  3IRQ A;  5BOX A;  2IT0 A;  4Q4Z F;  1XMA A;  2E7X A;  2IW5 A;  4KIF A;  3H92 A;  2EV6 A;  4G94 A;  5LHG A;  3FXU A;  3QOP A;  1U5T C;  1JGS A;  3EYI A;  4G9Y A;  1IN8 A;  3DFG A;  1P4A A;  4UVB A;  3ULQ B;  3KEO A;  3SHF A;  3MFK A;  2EFO A;  3SZP A;  4KIC A;  1XGO A;  2EJR A;  5HS9 A;  3ELK A;  1YLF A;  2FBH A;  4Q48 A;  5JVT A;  1PDN C;  2EWN A;  3U2R A;  3C1D A;  3WGH A;  3CO6 C;  3MWM A;  1SMY F;  2PFB A;  2EK5 A;  1YW8 A;  2V1U A;  2DAO A;  4I2O A;  1B9M A;  2VOD A;  5FO5 A;  2V1D A;  5F1R A;  1W7P B;  2P7V B;  1ON1 A;  3VB2 A;  3BOQ A;  5CVJ A;  2ADU A;  3WTZ A;  5LGU A;  4L5I A;  4UNO A;  2WV0 A;  2ZME A;  1G3S A;  1R23 A;  1DPU A;  3IKT A;  3LQQ A;  4RAY A;  1HW5 A;  2IA2 A;  5BPD A;  5A2Q Z;  5AIQ A;  1W5S A;  4GXO A;  4U7D A;  1PUE E;  4KMF A;  3HYI A;  4UVC A;  3HRM A;  2P6S A;  3ECH A;  2PLY A;  3FXR A;  4HBL A;  4M71 A;  1OYW A;  2RN7 A;  2DK5 A;  4WXD A;  1LDK B;  4WWC A;  2PI0 A;  3R61 A;  2TDX A;  1RI7 A;  2M8E A;  1ZGJ A;  2OQG A;  3E6D A;  2XKO A;  5CVR A;  4IRI A;  1KYZ A;  1IN5 A;  1JE8 A;  1KU2 A;  2W84 A;  4Z2Y A;  5IT3 A;  3WGI A;  2QZ8 A;  1O7F A;  1I6X A;  3D0S A;  3I58 A;  3FM3 A;  2L3D A;  4AIJ A;  1GHC A;  1XSX A;  2XIG A;  1WI9 A;  2RDP A;  2HFH A;  4GO1 A;  3QU3 A;  5K1Y A;  1BI2 A;  5IT9 Z;  1QQI A;  2L02 A;  3IL2 A;  5L3C A;  1ZRE A;  3K0L A;  6PAX A;  3HTS B;  2O03 A;  2G9W A;  3QP6 A;  4R79 A;  1P6R A;  2HS5 A;  3EET A;  1BBY A;  1HBX G;  2DQR A;  1FLI A;  2M45 A;  4CIC A;  4IJA A;  1EH7 A;  4D0P A;  5FD6 A;  5LBQ A;  3F21 A;  5DCM B;  2O6G E;  4XRF A;  2WC2 A;  3H3Z A;  1QZY A;  2VBZ A;  4OIR F;  1ZG1 A;  4KUM A;  2J5P A;  3COA C;  1Y0U A;  2KIU A;  5HLH A;  4S05 A;  1USS A;  1KYW A;  2FSW A;  1MZB A;  3R0A A;  1OYI A;  3HTU A;  4I0B A;  3SQN A;  2VT3 A;  3JW4 A;  4YII A;  4CGZ A;  4EJT A;  3JSP A;  1IRF A;  1O3R A;  5LGN A;  2GAU A;  1UHM A;  1H0M A;  4EVI A;  2A07 F;  3H3U A;  2GXB A;  4A6E A;  3K2Z A;  2P6T A;  1HW2 A;  3SFZ A;  5J6X A;  2VBW A;  1YS6 A;  3O2P E;  1MDM A;  3V8L A;  1MJA A;  1I27 A;  4MEY F;  2J5O A;  3D5L A;  4L18 B;  4M72 A;  1S3J A;  3T1B A;  4B09 A;  3HUG A;  4BH9 A;  1ZLK A;  3ZPL A;  3J81 Z;  4EGZ A;  2QWW A;  4HAM A;  3WTW C;  4EJV A;  2DQL A;  2EV0 A;  2XAH A;  2H09 A;  1T0F A;  1HQC A;  4JK1 X;  1E2X A;  5H6Q A;  3VEP A;  3QPT A;  3RI4 A;  2BEO A;  4HQE A;  2OU2 A;  1D3Y A;  1YW9 A;  4JQF A;  4IRG A;  2B0L A;  2DFI A;  4ZZL A;  3ZQ7 A;  1IZ1 A;  3KLO A;  4PGG A;  1O3Q A;  4RGS A;  3PQJ A;  5K5R A;  5DEQ A;  1V4R A;  2RV8 A;  3FX3 A;  3JAM K;  4OIQ F;  2HDC A;  3E3V A;  4OOI A;  4OIN F;  1HKQ A;  2HZT A;  1WSU A;  1XDU A;  3J7A O;  2KIM A;  2JZY A;  3R4K A;  4XLN F;  3L2C A;  4EGY A;  3F8C A;  4GYG A;  1O3T A;  2FU4 A;  2XAF A;  4HV6 A;  1UB9 A;  3TOB A;  2P4W A;  3B73 A;  3VFZ A;  2ISZ A;  4OIO F;  1XGN A;  2Z9O A;  2DW4 A;  2HWV A;  3B02 A;  3ERE D;  2MH9 A;  1P4X A;  2ESH A;  3HIF A;  5D8K B;  1Z9C A;  2ZME B;  3QAH A;  1PP7 U;  2O0Y A;  1U5T A;  3C18 A;  1ZGA A;  1EV7 A;  2NS0 A;  1BIB A;  4M6X A;  4CXF A;  5HS7 A;  2QEN A;  4G6Q A;  3F23 A;  1UCR A;  4UV8 A;  4CZZ A;  4L9V A;  2HQR A;  5LGT A;  2D1V A;  4TV7 A;  1D5V A;  1P4W A;  3MQ0 A;  1XSV A;  4EJU A;  3F72 A;  2RVC A;  3KEQ A;  3V7C A;  5JHU A;  4RAZ A;  3RYR A;  4HF2 A;  3FZV A;  2WWY A;  1FP2 A;  4U0Y A;  2L54 A;  1RIO H;  1E17 A;  1HKS A;  2ZNY A;  3M8E A;  3N4M A;  2YR2 A;  2EFN A;  3L9F A;  3CUQ C;  3ML6 A;  4KA4 A;  5FD5 A;  1J0R A;  4WXC A;  2V9V A;  2VON A;  4UV9 A;  4EM2 A;  2M5W A;  3W6K B;  1FOK A;  4BHP A;  3ZMZ A;  1FYL A;  3T5X A;  2RQP A;  1Z1D A;  3GZ6 A;  3RIR A;  2W57 A;  3OV8 A;  3DKW A;  2D1H A;  4A5M A;  3U9G A;  1QO0 D;  3WGG A;  4M9S A;  3V4G A;  2FRH A;  4ESF A;  4K2E A;  4WXH A;  2A69 F;  2ZBK A;  3NQO A;  3GW2 A;  5FFX A;  1QBJ A;  3NEU A;  4GCV A;  1XN7 A;  1YIO A;  4FHT A;  2MLK A;  3ABT A;  2ACJ A;  5L3F A;  1XCV A;  2V1X A;  2O8X A;  3F6O A;  3BDD A;  2KJC A;  1S8N A;  2GWR A;  4O3M A;  5HDK A;  3IC7 A;  4YIF A;  5FLX Z;  1J75 A;  5E17 F;  2PG4 A;  3EDP A;  3R0J A;  5J8C A;  4HDV A;  1K7A A;  4CDG A;  1BJA A;  3LST A;  3J81 K;  4R8H A;  3W6J B;  4KIG A;  2V79 A;  2HKO A;  2QLZ A;  4B8X A;  1J5Y A;  1LNW A;  4QLC U;  3TO7 A;  1MDM B;  4ZYE A;  5LEK A;  1YQA A;  5D4S A;  4N9H A;  2FNA A;  2X0L A;  3I53 A;  3DF8 A;  4RGR A;  4M9X A;  4ETS A;  3REO A;  1W4M A;  1L0O C;  3K1N A;  2DBB A;  5BMZ A;  1T2K A;  4WF2 A;  2OAZ A;  1DDN A;  2OA4 A;  4RB2 C;  5HLG A;  1HST A;  5D5V B;  2HYF A;  3FHZ A;  4I98 B;  4KNY A;  3ZMD A;  1PP8 F;  2CG4 A;  1T98 A;  3J80 Z;  3RKY A;  2QYO A;  3O3K A;  1XDS A;  5TJJ A;  3TGN A;  1VTN C;  4FX4 A;  1R58 A;  1T38 A;  3GXO A;  5CVU A;  4OMZ A;  4IHT A;  2P5L C;  3FXQ A;  2PJP A;  5FGM A;  1FBU A;  5E18 F;  2AS5 F;  4Y13 A;  3CUO A;  1WRJ A;  3S2W A;  5HLI A;  1LDJ A;  2FMY A;  3V8J A;  4A0Z A;  3KP6 A;  4EJW A;  5DYM A;  4RB0 A;  1IAW A;  5EEG A;  1DPR A;  3QPH A;  3RTR A;  3ISP A;  2KKO A;  1KQ0 A;  1V3F A;  3HRT A;  2G7H A;  2HR3 A;  4O6J A;  4YG2 F;  1MD0 A;  2JT1 A;  1Z7U A;  1ZG3 A;  4EMS A;  1U5T B;  3KP7 A;  4ENK A;  2GA2 A;  4H0E A;  3BY6 A;  4BYY A;  1UHW A;  1FYK A;  3HSE A;  1RUN A;  1XD7 A;  4L9N A;  4XSZ F;  3LA2 A;  4RGX A;  3WTX C;  2FQ3 A;  4WCG A;  2E7W A;  5ICG A;  2XRN A;  1SAX A;  3RPU A;  2Q2E A;  1IN7 A;  3DV8 A;  3DP7 A;  2XRO A;  4F7Z A;  2L4A A;  3CTA A;  1B4A A;  2HGC A;  2P5V A;  3GFJ A;  4MNU A;  4UHT A;  1LEA A;  2QQA A;  1S29 A;  2CGP A;  1BC8 C;  1GVJ A;  2DT5 A;  3RPQ A;  2A3S A;  2XAQ A;  3KZY A;  1R1V A;  1K78 A;  1O57 A;  1J59 A;  3HSF A;  2ELH A;  4G8X A;  3TO9 A;  4ENN A;  3GUD A;  4Q47 A;  5LRR A;  1SD6 A;  2K4J A;  3WTU C;  2K7L A;  3AAF A;  5HDN A;  3HOT A;  3T8T A;  4ESJ A;  1AWC A;  1YFH A;  2VC0 A;  3EQL F;  5H20 A;  3BPV A;  2CSO A;  2OQR A;  3RYP A;  3EUH A;  1ZRC A;  1LEB A;  3CUQ A;  2VE8 A;  3GFL A;  2JTV A;  2EA2 A;  1K6O A;  2GXG A;  2FOK A;  4P5O A;  1FSH A;  3MZY A;  1DUX C;  1FZP B;  1F1Z A;  5D6E A;  4ESB A;  2VE9 A;  1J7K A;  2QM3 A;  5HDG A;  1Z91 A;  1Z6T A;  1F5T A;  1IXC A;  3M7G A;  2MBF A;  2FF4 A;  2MLG A;  2F2E A;  1S6L A;  3O6B B;  2ZCW A;  3KET A;  5F64 A;  1MGT A;  2ZFW A;  3BWG A;  1EH6 A;  5HOO A;  2CWE A;  2ESN A;  4HYE A;  4Q5S F;  2DU9 A;  4A2U A;  4AVP A;  5LEJ A;  1CF7 A;  1C0W A;  4U88 A;  4FT8 A;  4AIH A;  3K1M A;  3L7W A;  4U0W A;  2DO7 A;  2Q8K A;  1FY7 A;  2LF8 A;  1K79 A;  2K4B A;  3WTT C;  4CO8 A;  2NNY A;  3L09 A;  4HX8 A;  4G7H F;  1G6N A;  3J80 K;  1STZ A;  2VC1 A;  4GGG A;  3LQR A;  4LFU A;  4PGH A;  3VOD A;  1L3L A;  5D5W B;  3M8F A;  1OKR A;  1LJ9 A;  3WTS C;  1ONV A;  2VBY A;  1FBS A;  3KZZ A;  5E8I A;  5CLS A;  2IA1 A;  2CQK A;  3MZH A;  2LNB A;  5ILU A;  2EV5 A;  4MQ9 F;  2FXA A;  4G7O F;  3FM5 A;  3LA3 A;  5CVI A;  4L0Z B;  3T0Y A;  4AIK A;  5L3B A;  5A2Q K;  4LG0 A;  3T8R A;  2HTS A;  4P9U A;  3KFW X;  4Y15 A;  3IWF A;  2XAJ A;  1KU7 A;  1U78 A;  1G3T A;  2BGC A;  4KMU X;  2XKP A;  2CFX A;  3I54 A;  2EB7 A;  2BYV E;  3IHU A;  3V8K A;  3F8M A;  4P9F A;  4EV0 A;  4L9T A;  1R22 A;  2ZKZ A;  1J2X A;  1YYV A;  1KGS A;  1BC7 C;  2YPR A;  4KYW A;  1SFU A;  1TLH B;  3V7S A;  3G3Z A;  1I1G A;  3K1P A;  5BQT A;  5JI6 A;  1EH8 A;  4NB5 A;  4IXA A;  2A5Y B;  3GX4 X;  4BHB A;  5E8G A;  3BJA A;  3P7N A;  3OOP A;  1BOA A;  3NRV A;  2P7C B;  2YSR A;  2HYG D;  2VN2 A;  5IT9 K;  1FPQ A;  1TQI A;  1HXD A;  3HRS A;  1B59 A;  5D6F A;  4L5J A;  2H94 A;  3WU1 B;  1F9N A;  3R6S A;  3Q5F A;  3WE2 A;  4MTD A;  4RS8 A;  2F5D A;  4S04 A;  2AXL A;  4QWQ A;  3BJ6 A;  4L9J A;  2FBI A;  2A68 F;  4YFX F;  1TNS A;  1SFX A;  4M74 A;  4O5V A;  1YS7 A;  5DUI A;  3FMR A;  2LF7 A;  3I59 A;  4HW0 A;  3CDH A;  2K02 A;  4UXN A;  1G3W A;  4AD9 A;  1YO5 C;  3GWZ A;  1U3E M;  2ZJ2 A;  3GYH X;  2O3F A;  4A6D A;  2CYY A;  1K78 B;  4AWX B;  5ICC A;  3F6V A;  2A6H F;  4N9I A;  2QQ9 A;  2ZO4 A;  4BQA A;  2IP2 A;  1UST A;  4A5N A;  2DK8 A;  1XMK A;  2L4M A;  2V6C A;  2JPB A;  4OU0 A;  2UXN A;  4DNC A;  2PQ8 A;  2Z5U A;  3HRU A;  1IN6 A;  3DQV C;  4XBF A;  2X4H A;  1SD4 A;  2RKH A;  3FMS A;  1D8J A;  1FWZ A;  2WTE A;  1HSJ A;  4PCQ A;  4LK1 F;  4L0Y B;  2RC4 A;  2QUF A;  2A61 A;  3CUQ B;  3ZP5 A;  1SFE A;  4ZH4 F;  2K86 A;  1B9N A;  5DV5 A;  3TOA A;  4LB5 A;  3MCZ A;  2LDU A;  1ODD A;  2R7D A;  2KRF A;  4KFC A;  4LLL A;  4HQM A;  4IHS A;  1ZN2 A;  2H6C A;  3BZ6 A;  1TNT A;  1FT9 A;  2Z3Y A;  2MH2 A;  3KCC A;  5E1X A;  2P5K A;  1IF1 A;  2GIV A;  3E6C C;  2XAS A;  2Y0M A;  2VOO A;  4A0Y A;  4IPA A;  4U0V A;  1ULY A;  1LDD A;  1BI0 A;  2HQN A;  2L01 A;  4CYD A;  1ZH5 A;  3TQN A;  4IF4 A;  4KIB A;  1XSD A;  1CF7 B;  3GFM A;  1P92 A;  1SD5 A;  5KK1 A;  5K5O A;  3JSO A;  4G6D A;  3F8B A;  5HS8 A;  2E1C A;  1WKM A;  2VBX A;  1FNN A;  5L3E A;  5JFR A;  1KA8 A;  1SMT A;  2GZW A;  2M1B A;  2PEX A;  3KP3 A;  5D5U B;  2R3S A;  2O61 A;  2FML A;  3KP5 A;  2CW0 F;  1T6S A;  2ISY A;  5ERI A;  4RB3 C;  3GF2 A;  4XSX F;  1TQM A;  2P8T A;  1W5T A;  3RDI A;  4M9Z A;  4LD5 A;  3WTV C;  3HHH A;  4ENJ A;  3JAM Z;  2CO5 A;  2VT2 A;  3DXJ F;  3GVA A;  1TW3 A;  1YG2 A;  2QBY A;  5ICE A;  1GXQ A;  2NRA C;  1OMI A;  2MA3 A;  3LWF A;  4HLX A;  1MJB A;  3FF5 A;  4LG0 B;  4HA8 A;  1JHF A;  1FYM A;  3I64 A;  3R60 A;  2HEO A;  3ZMS A;  3IWZ A;  2IA0 A;  1H9G A;  2PBI A;  3KP4 A;  2VOP A;  4ENM A;  2W85 A;  1ZRD A;  3GEZ A;  2UWM A;  4ON0 A;  3ZMV A;  2JRT A;  3VOE A;  3RKW A;  2W25 A;  5CJ9 A;  1KU9 A;  2HTJ A;  3P9K A;  2JSC A;  4HX7 A;  3KLN A;  4PZJ A;  1JHH A;  3Q9V A;  3SZT A;  2UXX A;  1BI3 A;  2R7F A;  4EM0 B;  3PQK A;  2FEZ A;  2XVC A;  1TTY A;  3P9I A;  4HV5 A;  2PN6 A;  4YFK F;  2Q0O A;  5J8F A;  1G3Y A;  4MQV A;  4IRH A;  1J9I A;  2F5E A;  1AOY A;  3BPX A;  2DLL A;  5CYV A;  3E97 A;  2M30 A;  3CLO A;  5BS6 A;  1I5Z A;  2BE5 F;  4NHJ A;  3BP8 A;  3E5X A;  1XGS A;  4HZF A;  4RGU A;  4JBA A;  5ICF A;  1KU3 A;  4RB1 A;  1NHA A;  2GQQ A;  1BI1 A;  3U1D A;  3ABU A;  4MHG A;  3SXY A;  4EQQ A;  2YX4 A;  4A12 A;  1MJ9 A;  1R7J A;  4OIP F;  1YTY A;  1WQ2 A;  3E6M A;  3I59 B;  2UZK A;  1R36 A;  4HF1 A;  1YW7 A;  2DI3 A;  3DPT A;  2FNP A;  2NAZ A;  3KE2 A;  4ZYG A;  2OBP A;  2ZNZ A;  3BRO A;  2JPC A;  1IN4 A;  1LB2 A;  4I09 A;  1JXS A;  2HKX A;  1ZYR F;  4LMY A;  4XLP F;  4HOB A;  3ZMT A;  5DD4 A;  4E70 A;  2NNN A;  5LRS A;  5FLX K;  1HKT A;  2F5F A;  4U7B A;  1XGM A;  4R1H A;  3F8N A;  4NQW A;  1MKM A;  1FX7 A;  5EEH A;  2FA5 A;  3WE3 A;  4BHC A;  1CGP A;  3BJO A;  2XHK A;  1OYY A;  3HHG A;  1O3S A;  3I5U A;  2Z33 A;  2COM A;  4LJZ F;  4A0X A;  4HF0 A;  1R5H A;  1WWX A;  4I02 A;  3TO6 A;  1R1T A;  2K27 A;  4OMY A;  4I0A A;  3ECO A;  1Q1H A;  2IVM A;  1IUY A;  3PFI A;  4BXU A;  3WOD F;  3CJN A;  3E6B A;  3F3X A;  2HOE A;  1XB4 A;  3WG9 A;  1W7P D;  3GO5 A;  4M73 A;  2F5C A;  3I0T A;  5D8L B;  1T39 A;  2D45 A;  3WTY C;  3QRF F;  1ZRF A;  2IPQ X;  2RGV A;  4ASN A;  3GLX A;  4KT5 C;  1B1B A;  4WK8 F;  1U6G A;  5CVV A;  4YFN F;  5H6R A;  1ZLJ A;  2RNJ A;  1BIA A;  4N0B A;  1W7P A;  4WX9 A;  4LGW A;  3GFI A;  1XCB A;  5KVR A;  3IKV A;  5D4R A;  3E5U A;  2W24 A;  3C7J A;  1R5G A;  5DDG A;  4LLN A;  2FBK A;  5D5X B;  3CO7 C;  1KQ8 A;  1QZZ A;  2ETH A;  3RKX A;  4Y17 A;  5BPI A;  1S7A A;  1RUO A;  1IXS B;  2XV4 S;  1RZ4 A;  4I7H A;  3DPL C;  5ILS A;  5LHH A;  4MTE A;  3LFK A;  1FC3 A;  2GA1 A;  3MEX A;  4KDP A;  1F4K A;  4UVA A;  5LLQ A;  2MC3 A;  3KP2 A;  2M87 A;  5JR3 A;  2QBY B;  4G7Z F;  3TKY A;  5HVQ C;  1QNT A;  4BAY A;  1O7L A;  1R00 A;  5L3G A;  5ILV A;  4KN7 X;  4CHU A;  1R1U A;  2STT A;  1BM9 A;  2C6Y A;  2FE3 A;  5TRD A;  3JTH A;  1TW2 A;  3G73 A;  1ZG5 A;  3LA7 A;  4HDU A;  1TQP A;  1IXR C;  2LSO A;  1BN5 A;  2A6E F;  1LVA A;  3Q9S A;  2DTR A;  4ZYD A;  3IRR A;  1LQ1 A;  5ED4 A;  4P55 A;  2Y48 A;  3EYY A;  3TDU C;  2H27 A;  1S7O A;  2D2W A;  4FX0 A;  1FP1 D;  3FMQ A;  3F22 A;  5LHI A;  4I01 A;  1TBX A;  1ZHF A;  2Y75 A;  5FFZ A;  1A04 A;  2OZ6 A;  1I1S A;  5DD8 A;  5FB2 A; 
#chains in the Genus database with same CATH topology
 2LLK A;  5E20 A;  1JJ6 C;  4B43 A;  1VQL I;  4V2G A;  2LKP A;  3I4P A;  1ZAO A;  3HSR A;  3RZD J;  1JI8 A;  3MVP A;  3K4J A;  4M6Y A;  2DPU A;  3M07 A;  5DCF A;  1DU6 A;  2HYJ A;  2VKV A;  3SEQ A;  3X2Q H;  2K9N A;  2YX7 A;  4MGR A;  4DQ2 A;  4PDK A;  2IRF G;  2M34 A;  4ABZ A;  3M3Y J;  3K9T A;  2G7U A;  2ZXJ A;  2VPR A;  2XUB A;  2WBM A;  2YU3 A;  3E5Q A;  3HGG A;  4LB6 B;  3QP5 A;  3CQZ J;  1REP C;  4XN0 A;  5KNL A;  2QKM B;  3DEU A;  3F0C A;  3TDZ C;  1OPC A;  4BAC A;  5GTH C;  1QGP A;  3PFY A;  4Z6Y A;  2AXT C;  1IW7 F;  3V7R A;  4A3D J;  1ZAR A;  1ETV A;  2LC2 A;  3MAJ A;  4RMN A;  5DCM A;  1H9T A;  5K5Q A;  2XC7 A;  4B44 A;  3N97 A;  2KMU A;  2R5Z B;  5E1W A;  1ON2 A;  2FD5 A;  1WFX A;  3HOW J;  3K4B A;  2XAG A;  1U8R A;  2DFH A;  5FKK A;  5FKL A;  2NYX A;  3C3W A;  4IVN A;  2VJ4 A;  2L7K A;  3KYL A;  2PMH A;  5F6F A;  1XPX A;  1OR7 A;  3GLL A;  1Y1V J;  4UUV A;  2HZD A;  3L00 A;  2ZXH A;  1HW1 A;  3GZ5 A;  3B6A A;  4ZZD A;  2EFQ A;  3QYF A;  3BG9 A;  3I9V 2;  3P5J A;  3K69 A;  3F8F A;  2A05 A;  2NS7 A;  1XS9 A;  2HVS A;  3S93 A;  2DA1 A;  4MEX F;  5KHD A;  4BNC A;  1Y8Q B;  1X19 A;  3IAM 2;  1RNL A;  3ABK H;  3RQI A;  2QVO A;  1UG0 A;  3LSH A;  3OIP A;  5AON A;  5L3D A;  1QPM A;  2KJB A;  1DP7 P;  1U8B A;  1T0F C;  1B72 B;  1G4D A;  4P96 A;  4F93 B;  2O7O A;  2OD5 A;  1Z05 A;  2BY1 A;  3JTG A;  4IHX A;  4BGD A;  2H6B A;  4EM1 A;  1TWC J;  2MSY A;  3A0B C;  3PO2 J;  2E1M C;  3CMY A;  4ZYH A;  3ZN0 A;  1DGW Y;  1FSE A;  3M1E A;  5E1Z B;  4BDZ A;  4HLY A;  1KON A;  1IG7 A;  2OTJ I;  1PYV A;  1YI2 I;  3BR2 A;  4BJ6 C;  3WU0 A;  2DPD A;  1U2W A;  3W2V A;  4EJO A;  5J4Y A;  4GRI A;  2BXZ A;  4E7K A;  3M9A A;  4BQQ A;  1KQ9 A;  5J1Y A;  4HX4 A;  1X3U A;  1Z6R A;  4KN4 X;  2STW A;  1UFM A;  2BBY A;  2OZU A;  1OCT C;  1QU3 A;  2VXZ A;  1DGR M;  2EA4 A;  4NQW B;  3OS0 A;  3CCU I;  2JA6 J;  3OYE A;  3ZN1 A;  2XGX A;  3ZMU A;  4YIR X;  2PMU A;  2IJL A;  3CCE I;  1D8K A;  1J09 A;  2HXI A;  2KL4 A;  1X2M A;  3BR1 A;  3RJP A;  1VQM I;  2QQB A;  1GXP A;  1MMS A;  3KZI C;  3QPS A;  3ROU A;  3LAP A;  4GYI A;  2LY2 A;  2Z99 A;  3I71 A;  1B6A A;  3S1M J;  1IRG A;  3S2H J;  3JR9 A;  3P9C A;  1OCP A;  3IAS 2;  2MGQ A;  3N05 A;  4NC7 A;  4V2F A;  2BV6 A;  4LLG F;  5AIP A;  2EFP A;  3HOS A;  1P2F A;  4LK0 F;  2MD5 A;  2KIF A;  1SD7 A;  3LAJ A;  3CC2 I;  5DUK A;  3QU6 A;  2E1N A;  2EFW A;  3PNV A;  5DM6 F;  4Y3O A;  3FWE A;  1FBQ A;  3IRQ A;  3MKL A;  3GTO J;  3CMA I;  5BOX A;  2IT0 A;  4Q4Z F;  4JYK A;  1XMA A;  2E7X A;  5FRM A;  2IW5 A;  2W00 A;  2A5W A;  4KIF A;  4E6K G;  1TC3 C;  3H92 A;  2EV6 A;  4G94 A;  5LHG A;  3FXU A;  2GM4 A;  1BR2 A;  4NUB A;  3QOP A;  1U5T C;  2QF7 A;  2PJR A;  1AA7 A;  1JGS A;  3CCV I;  5IOY A;  2VUM J;  3CJQ B;  3EYI A;  4G9Y A;  4HRI A;  1IN8 A;  3DFG A;  1P4A A;  2E5N A;  4UVB A;  3ULQ B;  1Z21 A;  3L2U A;  3KEO A;  3BTJ A;  3SHF A;  3BG7 A;  3MFK A;  2EFO A;  3SZP A;  4KIC A;  3RQ4 A;  1XGO A;  2EJR A;  5CQG A;  5HS9 A;  3ELK A;  1YLF A;  5BNG A;  2FBH A;  2E1M B;  2FQ4 A;  2MYS A;  1JUS A;  4Q48 A;  5JVT A;  2CW8 A;  1PDN C;  2EWN A;  1FTZ A;  3U2R A;  2X48 A;  3C1D A;  3WGH A;  3CO6 C;  3PUB A;  3MWM A;  1FIA A;  1SMY F;  2F4M B;  2WAQ A;  3PSI A;  2PFB A;  2EK5 A;  1YW8 A;  2V1U A;  3MMY B;  2DAO A;  3S3N A;  4I2O A;  1B9M A;  2VOD A;  3L2W A;  2HI3 A;  5FO5 A;  4IHV A;  2V1D A;  5F1R A;  1W7P B;  3A0H C;  2P7V B;  1LFP A;  1ON1 A;  3VB2 A;  2FOW A;  3BOQ A;  4QPO A;  4PJL A;  5CVJ A;  2ADU A;  3OYF A;  1AHD P;  4EEF G;  2R7U A;  3WTZ A;  4LIV A;  5LGU A;  4L5I A;  3PSF A;  4UNO A;  2WV0 A;  2ZME A;  1G3S A;  2DN0 A;  1R23 A;  1DPU A;  2LTP A;  4CZC A;  2AQE A;  2DDA A;  3LQQ A;  3IKT A;  1RPW A;  4RAY A;  2Y69 H;  1HW5 A;  2IA2 A;  5BPD A;  5A2Q Z;  4B48 A;  4BEH B;  1P9Q C;  3HZJ A;  3K4N A;  1UAA A;  5AIQ A;  1W5S A;  4GXO A;  4U7D A;  3CCY A;  3ERM A;  1ZQ3 P;  1PUE E;  1WZ2 A;  2V7F A;  4KMF A;  3HYI A;  4UVC A;  3HRM A;  2P6S A;  5GAD J;  1S72 I;  3ECH A;  2PLY A;  3FXR A;  1SFK A;  4HBL A;  4M71 A;  1OYW A;  2RN7 A;  2DOD A;  2DK5 A;  1WJD A;  4WXD A;  2Z2S B;  1LDK B;  2NVY J;  5JLX A;  4WWC A;  1VQO I;  2PI0 A;  2QA4 I;  4F92 B;  1EJ9 A;  1A6I A;  3R61 A;  2TDX A;  1RI7 A;  2M8E A;  4XOT A;  4DOZ A;  1ZGJ A;  3PL8 A;  4CCL A;  5IP7 J;  2OQG A;  1MMN A;  2VLA A;  1VF9 A;  3E6D A;  2XKO A;  3VSK A;  1JJ8 C;  5CVR A;  4XK4 A;  4IRI A;  1KYZ A;  1IN5 A;  1JE8 A;  4DZP A;  3A1Y A;  3DKY A;  1KU2 A;  2HNH A;  2W84 A;  4Z2Y A;  2LBF B;  3DEE A;  5IT3 A;  1TT5 B;  3NAR A;  3WGI A;  4HNU A;  2QZ8 A;  1O7F A;  1I6X A;  1LKX A;  3D0S A;  4FQG A;  3I58 A;  3B6C A;  3FM3 A;  1WGX A;  2L3D A;  4AIJ A;  1GHC A;  3G1M A;  5LD2 C;  1LUJ B;  2PMZ A;  1XSX A;  2XIG A;  4NDL A;  4YEL A;  1WI9 A;  5M3F J;  2RDP A;  1XG1 A;  2HFH A;  2X85 A;  3M8J A;  4GO1 A;  3H0D A;  1JKQ C;  3HM5 A;  3HOZ J;  3QU3 A;  5K1Y A;  3W2A A;  1SFO J;  2MG4 A;  1BI2 A;  5IT9 Z;  1QQI A;  2L02 A;  3IL2 A;  5L3C A;  3BLY A;  1ZRE A;  3K0L A;  6PAX A;  3HTS B;  4PK4 A;  3OWT A;  3WHC A;  2O03 A;  2G9W A;  3G4S I;  5F0C A;  3QP6 A;  4R79 A;  2ME0 A;  1P6R A;  1WJC A;  3OYM A;  3FDY A;  3CLQ A;  4G12 A;  2HS5 A;  3EET A;  4BS9 A;  1RRJ A;  1P7I A;  1BBY A;  3CME I;  1HBX G;  1A6Q A;  2DQR A;  1FLI A;  2M45 A;  3TL4 X;  5HOD A;  2M9H A;  2Z16 A;  4CIC A;  1BA5 A;  4IJA A;  1EH7 A;  4D0P A;  2LK2 A;  5FD6 A;  2JWT A;  5LBQ A;  1U9O A;  3KIO A;  3GTJ J;  1SC7 A;  1LFB A;  1R6R A;  5IYB J;  3S14 J;  1D0X A;  1X4P A;  2L9S A;  3F21 A;  2WAE A;  5DCM B;  2O6G E;  3JCU C;  4E7J A;  4XRF A;  3KEY A;  4ZTJ A;  2WC2 A;  3H3Z A;  1QZY A;  1NG6 A;  4BU2 A;  5EDN A;  1TL8 A;  1AU7 A;  2VJJ A;  2O5R A;  2VBZ A;  1T08 B;  4OIR F;  1U0J A;  2VQL A;  3OYI A;  1ZG1 A;  4KUM A;  2J5P A;  3COA C;  1B8I A;  1TWF J;  1EKE A;  4ZDO A;  1Y0U A;  5IYC J;  3TW6 A;  1HF0 A;  2KIU A;  5HLH A;  3GTP J;  4S05 A;  2R0Q C;  1USS A;  1KYW A;  3CCS I;  2FSW A;  3AG2 H;  4DJA A;  2V6E A;  1QHH D;  1E0E A;  5CPR B;  1MZB A;  2DDB A;  1WHU A;  5FRO A;  3R0A A;  1OYI A;  2W82 A;  2EIK H;  2X6Y A;  3IUO A;  1K4T A;  1MH4 A;  3HTU A;  4I0B A;  4AID A;  3SQN A;  3C2G A;  2VT3 A;  3JW4 A;  4YII A;  5EF6 A;  4CGZ A;  4LIU A;  3DBL B;  2M4K A;  4EJT A;  2DYR H;  2VAS A;  3JSP A;  1IRF A;  1O3R A;  5LGN A;  2IGN A;  2GAU A;  1UHM A;  1H0M A;  1G8X A;  4EVI A;  2A07 F;  3H3U A;  1JGG A;  2GXB A;  1Z67 A;  1YIJ I;  4A3C J;  4A6E A;  3J7A Y;  3K2Z A;  2UUZ A;  1QHG A;  1PUF A;  2P6T A;  2QKL B;  2IGK A;  1HW2 A;  2WB1 N;  3H36 A;  3SFZ A;  4RAG A;  2OJE D;  1X4O A;  5KAI C;  5J6X A;  4E7H A;  3HGY A;  5M5W J;  2VBW A;  4LG3 A;  1YS6 A;  2JN6 A;  3AL0 C;  2I5U A;  3O2P E;  2Y9Y A;  1MDM A;  3V8L A;  4M3G A;  1MJA A;  2H8W A;  1I27 A;  2HDW A;  4JX6 A;  4MEY F;  3KYC B;  1OJL A;  2DFF A;  2J5O A;  2EIL H;  1WH7 A;  3D5L A;  4L18 B;  4M72 A;  1S3J A;  2DT7 B;  3T1B A;  4PUS A;  4B09 A;  3HUG A;  5IP6 A;  4BH9 A;  1ZLK A;  3ZPL A;  3PIO F;  3J81 Z;  1K6Y A;  4EGZ A;  2QWW A;  2K3F A;  4HAM A;  3WTW C;  4EJV A;  3OYK A;  3HXL A;  3DPU A;  2DQL A;  5K7H A;  1WJB A;  2EV0 A;  2XAH A;  2H09 A;  3JRD A;  4C3I J;  4PJN A;  1YJ9 I;  1T0F A;  1OCC H;  3VDX A;  1HQC A;  4JK1 X;  2QCO A;  1E2X A;  5H6Q A;  3W3C A;  3QPT A;  4IEJ A;  4LIT A;  3VEP A;  2R7O A;  2E19 A;  4W1U A;  3OYH A;  2NOJ B;  4E7S A;  3RI4 A;  2BEO A;  4HST A;  2AQF A;  4HQE A;  3CCJ I;  2W1O A;  3Q3S A;  2OU2 A;  1D3Y A;  1YW9 A;  4JQF A;  4IHY A;  4IRG A;  4XLH A;  2KZV A;  2B0L A;  1YX5 A;  3K6G A;  3OIQ A;  2DFI A;  2BZT A;  2P81 A;  4ZZL A;  3ZQ7 A;  2WAQ N;  1IZ1 A;  1UHS A;  3EUA A;  1W36 C;  1Z7L A;  4RLQ A;  3KLO A;  4PGG A;  1O3Q A;  4RGS A;  3D5S C;  2E2H J;  3PQJ A;  2MD0 A;  1JT6 A;  1SAN A;  5K5R A;  5DEQ A;  1V4R A;  2RV8 A;  1VZ0 A;  3FX3 A;  3JAM K;  4BE1 A;  2HDC A;  4OIQ F;  3E3V A;  1OCR H;  2L0K A;  5F08 A;  4OOI A;  4OIN F;  3HJE A;  4QPQ A;  5H2F C;  2IGM A;  4B4C A;  1HKQ A;  4PJM A;  1RKW A;  2HZT A;  1WSU A;  2WV1 A;  1XDU A;  4OAZ A;  3J7A O;  1WI3 A;  2KIM A;  3WG7 H;  2JZY A;  3R4K A;  4XLN F;  3L2C A;  4EGY A;  3F8C A;  4PJJ A;  4GYG A;  1O3T A;  2FU4 A;  2XAF A;  4DGW B;  3BC8 A;  2IS6 A;  3LL7 A;  1BW6 A;  2B9S A;  2M2E A;  5LFA A;  1VQ5 I;  4HV6 A;  1UB9 A;  3TOB A;  2P4W A;  1Y0N A;  1GVD A;  3B73 A;  2Y2Z A;  3K4L A;  3VFZ A;  3I56 I;  2ISZ A;  4OIO F;  5C4X J;  1ZGW A;  1XGN A;  2Z9O A;  4Y33 A;  3NWT A;  1NK3 P;  2DW4 A;  2HWV A;  3B02 A;  3GZN B;  4XOR A;  2MH9 A;  2R7R A;  3ERE D;  1XMX A;  3LSM A;  1P4X A;  2ESH A;  2JJ7 A;  3FK7 A;  3CDL A;  3HIF A;  2WAD A;  2ZJQ F;  5D8K B;  3OYD A;  2E2I J;  2X6O A;  2ZME B;  1Z9C A;  3QAH A;  1PP7 U;  1Z3X A;  2O0Y A;  2L9V A;  1U5T A;  1OCZ H;  3LOC A;  3C18 A;  3DU6 A;  2HPM A;  3ABM H;  1ZGA A;  1EV7 A;  2NS0 A;  4XIC A;  2Y30 A;  1BIB A;  4M6X A;  4D9J A;  4CXF A;  1BL0 A;  5HS7 A;  2QEN A;  1YX3 A;  3KYD B;  2QSG X;  4IKF A;  4G6Q A;  3F23 A;  1UCR A;  4UV8 A;  4CZZ A;  4L9V A;  5DM7 F;  2HQR A;  5LGT A;  2D1V A;  4TV7 A;  1D5V A;  1F43 A;  2M0C A;  4A3J J;  1P4W A;  3H0G J;  3HC7 A;  1WJE A;  3OYA A;  1A36 A;  3IP4 B;  4JP0 A;  3MQ0 A;  1XSV A;  2ZJR F;  4EJU A;  3F72 A;  2RVC A;  4N4N B;  3KEQ A;  1ORK A;  2H1K A;  3DWL E;  1WJ5 A;  3V7C A;  4H4K C;  3LSJ A;  3QOD A;  4M6V A;  5JHU A;  3S3M A;  4RAZ A;  3RYR A;  2HOA A;  2LRD A;  1OLT A;  4HF2 A;  1IO2 A;  3FZV A;  3LSK A;  2WWY A;  4ZTF A;  3HPG A;  1FP2 A;  4U0Y A;  3ZQF A;  2L54 A;  1RIO H;  4XON A;  1G59 A;  1E17 A;  1HKS A;  2ZNY A;  3EUH C;  3M8E A;  5B1A H;  3N4M A;  2XPV A;  2YR2 A;  2EFN A;  3L9F A;  3CUQ C;  1NK2 P;  3ML6 A;  2EBI A;  4XR6 A;  4KA4 A;  2KDZ A;  3TMO A;  3LFU A;  3BR5 A;  2CQ7 A;  2L5Q A;  5FD5 A;  1J0R A;  4BE2 A;  4WXC A;  2V9V A;  3G2B A;  3HOY J;  3VPR A;  1BJZ A;  3WHB A;  2VON A;  4UV9 A;  3I55 I;  3TW7 A;  4EM2 A;  2M5W A;  3W6K B;  2VPL A;  2XPU A;  3CJR B;  1FOK A;  4BHP A;  3PO3 J;  3BZC A;  3ZMZ A;  3ASO H;  5M5Y J;  1FYL A;  4JX5 A;  2YU9 J;  4XLA A;  1DU0 A;  1VQ9 I;  2EQR A;  1I39 A;  3T5X A;  2RQP A;  1Z1D A;  3K70 D;  3RIR A;  3GZ6 A;  2W57 A;  3DLL F;  3FXO A;  3OV8 A;  3DKW A;  2D1H A;  1OCO H;  2JSP A;  4A5M A;  2ZC2 A;  4AYB A;  3U9G A;  4MO7 A;  1QO0 D;  3JRG A;  2VKH A;  2BVM A;  1K4S A;  3WGG A;  4M9S A;  3CF5 F;  1ZR4 A;  4DIQ A;  3V4G A;  2FRH A;  1RES A;  3HG9 A;  4ESF A;  2MAB A;  3A03 A;  4K2E A;  3OYJ A;  4WXH A;  4ITV A;  2KDO A;  2A69 F;  4X1E A;  4A69 C;  2V4J C;  2ZBK A;  3NQO A;  3GW2 A;  5FFX A;  5HNH A;  4KIS A;  2F6C A;  3CF2 A;  1QBJ A;  2CU7 A;  5FJ8 J;  3NEU A;  4GCV A;  1XN7 A;  2IEK A;  3OR2 C;  1QZE A;  3VYT B;  3GTQ J;  4XLF A;  2DA7 A;  2V26 A;  2CUZ A;  3J7Z I;  1YIO A;  4FHT A;  2MLK A;  4QTR A;  1YJW I;  3ABT A;  2VL8 A;  4YEJ A;  1VQ6 I;  2ACJ A;  5DTD A;  1S7E A;  4G6T B;  2HVQ A;  5L3F A;  1WJA A;  2R5Y A;  1XCV A;  4BDY A;  2V1X A;  2O8X A;  3F6O A;  2DA6 A;  3BDD A;  2KJC A;  3OL3 A;  3OYG A;  3F9K A;  1S8N A;  2GWR A;  4O3M A;  5HDK A;  3IC7 A;  4YIF A;  1BR1 A;  4FAS D;  5FLX Z;  1J75 A;  4BUP A;  5M3M J;  5E17 F;  4ZC3 A;  3OYN A;  5E3N A;  2PG4 A;  3EDP A;  3R0J A;  3OYB A;  5J8C A;  4HDV A;  1K7A A;  2LKS A;  4CCN A;  4CDG A;  2OC6 A;  1U9N A;  1BJA A;  3LST A;  4ZJZ A;  1QRY A;  5B66 C;  3J81 K;  4R8H A;  3W6J B;  2KLO A;  3K4K A;  4J19 A;  1PUF B;  4KIG A;  2V79 A;  2HKO A;  2MFZ A;  2QLZ A;  3LSI A;  1TWA J;  3NAU A;  2CQX A;  2K85 A;  4B8X A;  1V55 H;  1J5Y A;  1LNW A;  3I4N J;  1A31 A;  3UKG A;  5EYR A;  4QLC U;  3QYB A;  3TO7 A;  5FLV A;  1MDM B;  4BJT A;  4ZYE A;  1V5F A;  4HSR A;  4QIW N;  2JA7 J;  5LEK A;  4ZDP A;  1YQA A;  5D4S A;  4N9H A;  5GP9 A;  2XDV A;  2CUF A;  1LPQ A;  2FNA A;  2X0L A;  3I53 A;  3H9Q A;  3HUG B;  1VQP I;  3FK6 A;  3DF8 A;  4RGR A;  4M9X A;  2XGE A;  4ETS A;  3REO A;  4XLE A;  2H8R A;  1W4M A;  1L0O C;  3K1N A;  1D0Z A;  2DBB A;  5BMZ A;  1T2K A;  4WF2 A;  2E60 A;  2OAZ A;  1DDN A;  1MBF A;  4GDF A;  2OA4 A;  3S16 J;  2OV7 A;  2HQ5 A;  4RB2 C;  5HLG A;  5GAE J;  1HST A;  5D5V B;  1BR4 A;  1IJW C;  2HYF A;  1TP4 A;  3FHZ A;  4I98 B;  1YHQ I;  3U21 A;  3ZQH A;  5FLM J;  3W6V A;  4KNY A;  3ZMD A;  1IRZ A;  2DYS H;  1PP8 F;  3MKW B;  2CG4 A;  1T98 A;  3J80 Z;  1MBG A;  3RKY A;  1RKT A;  2LG4 A;  2QYO A;  1FJL A;  4C2M J;  3O3K A;  1XDS A;  3FXM A;  5TJJ A;  3TGN A;  3CZ6 A;  1VTN C;  4FX4 A;  1R58 A;  1T38 A;  3GXO A;  3LSG A;  1E3H A;  3IH4 A;  1G2H A;  1F36 A;  3ZQI A;  5CVU A;  4A3E J;  4OMZ A;  4CCO A;  4IHT A;  2P5L C;  3ZXS A;  3FXQ A;  2PJP A;  2BY0 A;  5FGM A;  3OSG A;  1FBU A;  3HOU J;  3S1Q J;  5E18 F;  2AS5 F;  1W36 D;  4Y13 A;  4NNJ A;  1Y1W J;  3S2D J;  4S0H B;  3CUO A;  1WRJ A;  4RA2 A;  3S2W A;  3K10 A;  1KZH A;  2R7V A;  5HLI A;  3H9J A;  1LDJ A;  2W48 A;  1MW7 A;  2FMY A;  3V8J A;  3BTI A;  3KP6 A;  4A0Z A;  4EJW A;  3CCR I;  1OQY A;  5DYM A;  1QVT A;  4PFP A;  4RB0 A;  3SEZ A;  3MKZ A;  2X6W A;  2FX0 A;  4MFE A;  2DA3 A;  4FE7 A;  5J47 A;  3BCA A;  1IAW A;  1MMG A;  5EEG A;  1DPR A;  4UUS B;  1JKR C;  1UG2 A;  3QPH A;  4BBR J;  3TP3 A;  1MBJ A;  5DS9 A;  3RTR A;  1Y39 A;  3GTK J;  3S32 A;  1Z0X A;  2R7W A;  2HU9 A;  4XRS A;  4I76 A;  3ISP A;  2KKO A;  3CP2 A;  2XSJ C;  1KQ0 A;  1P7J A;  2CRG A;  3ZCO A;  1X58 A;  3LMM A;  1V3F A;  3HRT A;  1VQ7 I;  2G7H A;  1W5C C;  3RPU D;  5FKN A;  2HR3 A;  3FKI J;  1ITY A;  1MMD A;  4O6J A;  2ZFU A;  4YG2 F;  3GTM J;  2KRC A;  2VQC A;  2IS4 A;  4ANJ A;  1MD0 A;  2JT1 A;  1Z7U A;  1ZG3 A;  2DOE A;  4EMS A;  1U5T B;  3KP7 A;  4B3X A;  4I6Z A;  4ENK A;  2GA2 A;  4H0E A;  3BY6 A;  5J4V A;  2ELK A;  3BT9 A;  1W0U A;  4BYY A;  1UHW A;  2CUE A;  2IXS A;  4XKC A;  1DQU A;  4E7Z A;  1FYK A;  2QSH X;  3MD2 A;  3HSE A;  1RUN A;  1XD7 A;  4L9N A;  5KCM A;  3E1S A;  4XSZ F;  3FXK A;  1EA3 A;  3LA2 A;  4RGX A;  2K3P A;  3WTX C;  3OS1 A;  2E2J J;  2EPF A;  4B47 A;  2FQ3 A;  2HPI A;  3PNY A;  2E7W A;  4WCG A;  2OCE A;  1YJN I;  3K4M A;  5ICG A;  2EIJ H;  2R4G A;  4C9Y A;  2XRN A;  1SAX A;  3GTL J;  3K7A J;  2AHQ A;  2EZH A;  3RPU A;  2Q2E A;  1UMQ A;  1IN7 A;  3DV8 A;  2L7M P;  3DP7 A;  5J1R A;  3JRE A;  2DOF A;  2X1E A;  2VKE A;  3KX2 A;  4XMY A;  2XRO A;  2XSD C;  4F7Z A;  3QWL A;  2L4A A;  2M7B A;  3AKZ A;  4J00 A;  3CTA A;  2WY8 Q;  1B4A A;  2CMP A;  2NOG A;  3G1O A;  1QA6 A;  3BR0 A;  2HGC A;  2P5V A;  2LH9 A;  3GFJ A;  4MNU A;  4UHT A;  1LEA A;  2OPT A;  2QQA A;  1JKO C;  1S29 A;  2LVS A;  2BVL A;  2CGP A;  1BC8 C;  1GVJ A;  1WPK A;  2ID3 A;  2DT5 A;  3FIW A;  3FKJ A;  3HPH A;  3RPQ A;  2A3S A;  2XAQ A;  2KZG A;  3KZY A;  1R1V A;  1K78 A;  1O57 A;  1J59 A;  3HSF A;  2CFO A;  2ELH A;  4G8X A;  3J7Y J;  3TO9 A;  4ENN A;  2COB A;  1OIS A;  2M4G A;  3GUD A;  4Q47 A;  5LRR A;  1GV5 A;  1SD6 A;  2K4J A;  3DTI A;  3WTU C;  3L2R A;  2K7L A;  2WAF A;  3D5R C;  3U1K A;  3AAF A;  2CV0 A;  2R7T A;  2LR8 A;  5HDN A;  4A3G J;  4LOC A;  2DMP A;  2VXD A;  3QPL A;  5K7Z A;  4D5F A;  3HOT A;  3T8T A;  4C3J J;  4ESJ A;  1AWC A;  2Y0S A;  1IDZ A;  2KP6 A;  1YFH A;  5B3S H;  2VC0 A;  5GPA A;  2XF7 A;  3DU5 A;  4YRV A;  4OAY A;  1CQT A;  1YOV B;  2K5C A;  1FOX A;  3EQL F;  3E7L A;  3BPV A;  5H20 A;  1T56 A;  2CSO A;  1RR7 A;  3A02 A;  4MFD A;  3QOE A;  2OQR A;  2LYC A;  3CMM A;  5JVG F;  4B3A A;  3RYP A;  3EPZ A;  2YUS A;  1D0Y A;  3EUH A;  1ZRC A;  3ZRG A;  1LEB A;  4X6A J;  4IHW A;  2W4S A;  2K9L A;  3CUQ A;  1R4N B;  2EZI A;  2VE8 A;  4XQF A;  3OOU A;  3GFL A;  2JTV A;  3H5N A;  1VQN I;  2EA2 A;  1FOY A;  1K6O A;  2GXG A;  2FOK A;  1H89 C;  4DYQ A;  4P5O A;  1FSH A;  1A35 A;  3MZY A;  1DUX C;  2IAI A;  1FZP B;  2GLO A;  2RAE A;  1F1Z A;  5D6E A;  4ESB A;  2VE9 A;  1J7K A;  2QM3 A;  5HDG A;  2NS8 A;  2CJJ A;  2MC4 A;  2DJI A;  5EGO A;  1ZR2 A;  3JRI A;  2R93 J;  3O8G A;  1HA8 A;  4F3Q A;  1Z91 A;  1Z6T A;  1F5T A;  2R5Y B;  1IXC A;  3M7G A;  3PIP F;  2MBF A;  4NC6 A;  2FF4 A;  1FEX A;  2MLG A;  2F2E A;  1S6L A;  3O6B B;  1SVO A;  2ZCW A;  3KET A;  1NH3 A;  2P0W A;  5F64 A;  1MGT A;  2ZFW A;  3BWG A;  1EH6 A;  2GBY A;  5C4J J;  4CYC A;  1MSE C;  2BXY A;  2RRE A;  4FCY A;  4E7I A;  2ID6 A;  4II2 A;  2XPW A;  4E4H A;  1QVU A;  4XKV A;  3VSL A;  2RNG A;  4F52 A;  5HOO A;  3S8P A;  3RSN A;  2E5Z A;  4B1R A;  2CWE A;  2ESN A;  4HYE A;  4NC8 A;  5EZH A;  4Q5S F;  2DU9 A;  4A2U A;  4AVP A;  5LEJ A;  1CF7 A;  3Q0W A;  2QQ8 A;  1C0W A;  2V9P A;  2XF6 A;  4U88 A;  4RLF A;  4FT8 A;  4AIH A;  2L2O A;  3FHN A;  3K1M A;  3L7W A;  4U0W A;  2DO7 A;  4ZDL A;  2Q8K A;  4IQ4 A;  5F0F A;  1FY7 A;  2LF8 A;  5CKT A;  4XRS G;  1NG7 A;  1K79 A;  5EJC A;  3A4C A;  2F48 A;  3DLA A;  2K4B A;  1UJ8 A;  5J1U A;  3Q0U A;  4BY7 J;  3WTT C;  3H1C A;  4Y4R A;  4CO8 A;  2ECC A;  4J01 A;  2NNY A;  2CV2 A;  3AFH A;  3L09 A;  3LNQ A;  4HX8 A;  4G7H F;  3D1N I;  1G6N A;  2K9M A;  3AG3 H;  3J80 K;  1STZ A;  3W2W A;  2VC1 A;  1X3Z B;  2VI6 A;  2Y31 A;  3LQR A;  4GGG A;  4LFU A;  4PGH A;  3VOD A;  3S1R J;  1L3L A;  5D5W B;  4KT6 A;  2PJR B;  3M8F A;  1OKR A;  2L9N A;  1LJ9 A;  3WTS C;  1SEU A;  1HLV A;  1ONV A;  2VBY A;  1FBS A;  3KZZ A;  5E8I A;  5CLS A;  2IA1 A;  1GLN A;  2CQK A;  3MZH A;  2HDD A;  2LNB A;  5ILU A;  2EV5 A;  2QSF X;  4MQ9 F;  2FXA A;  4G7O F;  1R4M B;  3FM5 A;  3LA3 A;  5CVI A;  4CCK A;  5F04 A;  4A3F J;  4L0Z B;  3T0Y A;  4AIK A;  1Y8R B;  3BQZ A;  1Q1V A;  3UR3 C;  3HL2 A;  4XNF A;  1VND A;  4IQJ A;  2PX9 A;  1PVE A;  5L3B A;  4M3F A;  4CCJ A;  2I8D A;  5A2Q K;  4A3B J;  4LG0 A;  3T8R A;  2HTS A;  4P9U A;  3SJM A;  2RQQ A;  3KFW X;  2M0M A;  4RDU A;  4Y15 A;  5EG0 A;  1SVL A;  3IWF A;  3AL0 B;  1ZKG A;  1IUF A;  4PJ0 C;  2CW7 A;  2H1L A;  3PNT A;  2XAJ A;  5B5E C;  1KU7 A;  3ZQC A;  1U78 A;  1G3T A;  2BGC A;  4KMU X;  3FBN B;  2XKP A;  2HVR A;  1JUP A;  2CUJ A;  2CFX A;  3I54 A;  2KIQ A;  1S9H A;  2BYV E;  2EB7 A;  2F4O B;  3IHU A;  3V8K A;  2CQN A;  3F8M A;  4P9F A;  4EV0 A;  4L9T A;  2Z1D A;  2HQA A;  2ZKZ A;  1R22 A;  2LY9 A;  5TIS C;  1J2X A;  1YYV A;  1KGS A;  1BC7 C;  3KPH A;  5J3L A;  2YPR A;  2BW3 A;  4AVZ A;  1ACI A;  5E3L A;  4KYW A;  3L2V A;  1SFU A;  1TLH B;  3V7S A;  3S1N J;  2TCT A;  5FKM A;  3G3Z A;  3G1L A;  1I1G A;  1APL C;  3K1P A;  5BQT A;  1R49 A;  5JI6 A;  1EH8 A;  2NVU B;  2PMZ N;  4NB5 A;  4IXA A;  2A5Y B;  4HEA 2;  3GX4 X;  2EIN H;  4P1W A;  5E8G A;  4BHB A;  2HOS A;  3BJA A;  3P7N A;  4UY8 I;  2F4I A;  4IOC F;  3OOP A;  2K9Q A;  1BOA A;  3NRV A;  1LE8 A;  4PSX A;  2LFB A;  1K61 A;  2P7C B;  2YSR A;  2HYG D;  2VN2 A;  9ANT A;  1MNE A;  4HG2 A;  5IT9 K;  1FPQ A;  1LVK A;  5J40 A;  1TQI A;  3ESW B;  2DMN A;  1Y6I A;  2XB0 X;  1O4X A;  3E0J B;  1HXD A;  3HRS A;  2DA2 A;  1B59 A;  2X1D A;  3ZQQ A;  5D6F A;  4L5J A;  3A2K A;  3VYR B;  2H94 A;  3WU1 B;  1F9N A;  2OF7 A;  3R6S A;  3GTG J;  2JMW A;  3Q5F A;  3WE2 A;  2WA0 A;  3OY9 A;  1AKH A;  2IGO A;  4RS8 A;  4MTD A;  3CP8 A;  2F5D A;  4S04 A;  2GIZ A;  2AXL A;  1MMA A;  4QWQ A;  5K7F A;  1XTA A;  1NTC A;  3BJ6 A;  4BQN A;  5C44 J;  3HKZ A;  2Q2E B;  4RM2 A;  4L9J A;  2FBI A;  2A68 F;  4YFX F;  1TNS A;  2GOM A;  1SFX A;  3BR6 A;  1SAU A;  4M74 A;  4O5V A;  3DTK A;  3HEF A;  3AG1 H;  3OR1 C;  1YS7 A;  5DUI A;  3FMR A;  2LF7 A;  3I59 A;  2JA8 J;  4HW0 A;  2A6T A;  2Y0S N;  3CDH A;  3OS2 A;  2K02 A;  3G71 I;  4UXN A;  2CH0 A;  2V9K A;  1G3W A;  4AD9 A;  1YO5 C;  3LSP A;  3GWZ A;  1MBK A;  1U3E M;  2ZJ2 A;  3GYH X;  1HCR A;  2DXI A;  2O3F A;  3CCQ I;  4A6D A;  2X1C A;  1ETQ A;  2CYY A;  1K78 B;  1E3P A;  1OFC X;  1RC9 A;  4AWX B;  5ICC A;  1YIT I;  4XM3 A;  1ETX A;  3F6V A;  2A6H F;  4N9I A;  1IGN A;  4DBR A;  1V5E A;  2KT0 A;  2QQ9 A;  4Y7N J;  2ZO4 A;  1IV6 A;  2BOL A;  2VJI A;  4BQA A;  2IP2 A;  1UST A;  4A5N A;  2DK8 A;  1XMK A;  1HC8 A;  3RCO A;  3IH2 A;  2L4M A;  2V6C A;  2X6X A;  3CC4 I;  2JPB A;  3HB9 A;  1IDY A;  3HDD A;  1HDD C;  4OU0 A;  2UXN A;  4DNC A;  1QPI A;  1FOW A;  5IP9 J;  2JVG A;  1X1P A;  2PQ8 A;  4XLC A;  2Z5U A;  3HRU A;  3S15 J;  1B8I B;  2N8G A;  1IN6 A;  1TWG J;  1VI0 A;  3JRH A;  3DQV C;  4XBF A;  1ETK A;  2X4H A;  2R7X A;  2LMD A;  3IV5 A;  1ETW A;  1DP3 A;  5E3O A;  1SD4 A;  2RKH A;  3FMS A;  3A01 A;  1D8J A;  1X2N A;  1FWZ A;  2VKD A;  4X0G A;  1T95 A;  2WTE A;  1HSJ A;  4PCQ A;  4C3H J;  2DMU A;  2BHZ A;  4LK1 F;  2R7Z J;  4L0Y B;  2RC4 A;  1X1C A;  2ZXI A;  2QUF A;  2A61 A;  3CUQ B;  4EAT A;  4PFO A;  3HBL A;  1SFE A;  3ZP5 A;  2VJ5 A;  4ZH4 F;  1JTY A;  2K86 A;  2NVQ J;  1B9N A;  2IS1 A;  5DV5 A;  2GXA A;  3TOA A;  5JHF A;  4LB5 A;  2ELJ A;  4D5C A;  1VQK I;  3VYS B;  3MCZ A;  3CES A;  2LDU A;  1ODD A;  2R7D A;  2KRF A;  4KFC A;  4LLL A;  4HQM A;  4IHS A;  3OYL A;  3K4C A;  2XRL A;  3OYC A;  2X51 A;  5EGO B;  1ZN2 A;  2H6C A;  2Q1Z B;  3BZ6 A;  1TNT A;  3ZOB A;  2LD5 A;  1T8I A;  2V1N A;  3BR3 A;  2ZXW H;  1FT9 A;  1TWH J;  2MH2 A;  2Z3Y A;  3KCC A;  3PUF A;  5E1X A;  5TGT A;  2P5K A;  3EUK L;  3SDB A;  4XKW A;  1IF1 A;  1ETY A;  2GIV A;  2K9S A;  3TBI A;  3E6C C;  2XAS A;  1ZEL A;  2LOO A;  2Y0M A;  2WB1 A;  4U87 A;  2VOO A;  2CS3 A;  2EZK A;  3BTC A;  4A0Y A;  4IPA A;  3DBH B;  4CYC B;  5GAG J;  4U0V A;  1ULY A;  4BJ5 C;  1LDD A;  1BI0 A;  4RBO A;  2HQN A;  4CUG A;  1W1W E;  1Z77 A;  4RAF A;  4KIT B;  2L01 A;  4CYD A;  1ZH5 A;  1K83 J;  3BG3 A;  2ECB A;  3TQN A;  4IF4 A;  4KIB A;  1XSD A;  1CF7 B;  2G0E A;  1ZK8 A;  3GFM A;  1R71 A;  1P92 A;  1SD5 A;  2KIS A;  5KK1 A;  5K5O A;  3JSO A;  1GV2 A;  4G6D A;  3F8B A;  4XRM A;  5HS8 A;  2YS9 A;  1WKM A;  4DYC A;  2E1C A;  2LP0 A;  2VQG A;  1ERD A;  4C2T A;  1VFC A;  3G6E I;  2VBX A;  4F91 B;  1FNN A;  5L3E A;  5JFR A;  1KA8 A;  2Y9Z A;  1SMT A;  2GZW A;  2M1B A;  2PEX A;  3KP3 A;  5D5U B;  2IS2 A;  2IBD A;  2R3S A;  4QSH A;  2FML A;  2O61 A;  3KP5 A;  1JUM A;  4IOA F;  1TT0 A;  2EIM H;  2CW0 F;  3CDI A;  1FMV A;  1T6S A;  2VQH A;  1I3A A;  2ISY A;  5ERI A;  4RB3 C;  3GF2 A;  4XSX F;  1TQM A;  3BTL A;  2ME6 A;  1IC8 A;  1I50 J;  2ICW G;  2P8T A;  4FE4 A;  1JTX A;  1Z3Y A;  1W5T A;  3RDI A;  4Y52 J;  5KAF C;  4M9Z A;  4DZJ A;  4IO9 F;  2HOT A;  4LD5 A;  3WTV C;  3HHH A;  4D1Q A;  4ENJ A;  3JAM Z;  2CO5 A;  4OWR B;  5E3M A;  2VT2 A;  3DXJ F;  3GVA A;  1TW3 A;  1YG2 A;  1H8A C;  2QBY A;  2DA5 A;  5ICE A;  2DT6 A;  2NXN B;  3DBR B;  1GXQ A;  2B7E A;  2NRA C;  2M3A A;  4BXX J;  1OMI A;  3DKX A;  1BW5 A;  2MA3 A;  4AUX A;  3LWF A;  1X3W B;  3VYU B;  4HLX A;  1WH5 A;  3DCF A;  1MJB A;  4MLO A;  2KFD A;  3JRF A;  4A93 J;  3FF5 A;  4LG0 B;  4HA8 A;  3S3O A;  2CQQ A;  1JHF A;  3NWS A;  4BE0 A;  1FYM A;  4V19 K;  2F5V A;  5EG0 B;  2JA2 A;  2KQR A;  3I64 A;  3R60 A;  2HEO A;  3ZMS A;  3IWZ A;  2IA0 A;  3MZ8 A;  1H9G A;  1D1A A;  2PBI A;  3KP4 A;  4M3D A;  2XB5 A;  2VOP A;  3OIO A;  2X9D A;  4RM3 A;  4UUT A;  1MSF C;  2FUG 2;  5IYD J;  4ENM A;  2KHM A;  2XGD A;  2W85 A;  1XC5 A;  2B63 J;  4MIM A;  4A3I J;  1GT0 C;  4BXF A;  1ZRD A;  3GEZ A;  2QGU A;  3ZR8 X;  2UWM A;  4ON0 A;  2OCC H;  2R92 J;  3BG5 A;  2BW3 B;  3ZMV A;  3OSF A;  2JRT A;  1OR7 C;  3VOE A;  3H3V K;  1WVR A;  2KPM A;  3OMY A;  3H35 A;  3RKW A;  2W25 A;  5CJ9 A;  5GTI C;  3JRC A;  1KU9 A;  3SZG A;  2HTJ A;  5IY5 H;  3P9K A;  1YRN A;  1FIP A;  2JSC A;  4HX7 A;  3RKQ A;  3HOX J;  2DMQ A;  3QYE A;  1D1C A;  3KLN A;  4PZJ A;  4A3L J;  2JUC A;  1JHH A;  3Q9V A;  1V54 H;  3SZT A;  5EZG A;  2UXX A;  3BQY A;  1BI3 A;  3HKZ N;  2R7F A;  1HDP A;  2LRE A;  5F27 A;  1LE8 B;  4EM0 B;  2JA5 J;  3PQK A;  2GOX B;  2DCE A;  2FEZ A;  2XVC A;  1TTY A;  4XL9 A;  5GAH J;  3P9I A;  4HV5 A;  1BOB A;  2XAU A;  2BHY A;  4XOP A;  2PN6 A;  4YFK F;  1POG A;  3L1P A;  2Q0O A;  5J8F A;  1G3Y A;  4MQV A;  1H88 C;  2L7Z A;  4A3M J;  4IRH A;  4DYR A;  1VQ4 I;  1J9I A;  2F5E A;  1AOY A;  3BPX A;  5EEA A;  2DLL A;  3MKY B;  4AC0 A;  5CYV A;  2WY7 Q;  4AYB N;  3K70 C;  3E97 A;  2M30 A;  3CLO A;  2R5Z A;  3RZO J;  4CCM A;  5BS6 A;  1A5J A;  1I5Z A;  4C30 A;  2BE5 F;  4NHJ A;  4I99 C;  1AKH B;  3BP8 A;  3ZQL A;  3E5X A;  4HPQ A;  1MBE A;  3I3L A;  1HOM A;  2LY1 A;  2M7A A;  4W97 A;  1XGS A;  4HNV A;  1T33 A;  2CV1 A;  1MNM C;  2E34 A;  4HZF A;  3M1C A;  4BKX A;  3TP0 A;  4D7N A;  4RGU A;  3CJT B;  4XN3 A;  4JBA A;  1R9T J;  1FMW A;  1KU3 A;  5ICF A;  2R7Q A;  3ASN H;  4RB1 A;  1NHA A;  2GQQ A;  2E1O A;  1BI1 A;  4II3 A;  3U1D A;  3MN2 A;  3ABU A;  4MHG A;  3SXY A;  4EQQ A;  2L7F P;  3GME A;  2YX4 A;  4A12 A;  1JT0 A;  1MJ9 A;  4GFB A;  1R7J A;  4OIP F;  1YTY A;  1WQ2 A;  4KJZ A;  3CCL I;  3E6M A;  3I59 B;  3O8H A;  2UZK A;  3V42 A;  1R36 A;  4HF1 A;  3M4O J;  1YW7 A;  2DI3 A;  2W7N A;  1B72 A;  5HNF A;  3DPT A;  2FNP A;  2NAZ A;  2ZSI B;  3KE2 A;  4ZYG A;  3IH3 A;  2OBP A;  4PSW A;  1N25 A;  4C2U A;  2ZNZ A;  4XKB A;  2EH3 A;  2DOA A;  3BRO A;  2JPC A;  3JRB A;  1MBH A;  3FXJ A;  1IN4 A;  3H5R A;  3DTE A;  2VB6 A;  2ZB9 A;  2TRT A;  1LB2 A;  4I09 A;  1JXS A;  2HKX A;  1ETO A;  4BL0 B;  1ZYR F;  4LMY A;  4XLP F;  4HOB A;  3ZMT A;  5DD4 A;  3SFI A;  4E70 A;  1N75 A;  4D7M A;  2DMT A;  2NNN A;  5GPC A;  5LRS A;  1JKP C;  5FLX K;  1HKT A;  2O9L A;  2F5F A;  3Q0V A;  4U7B A;  1XGM A;  4R1H A;  3OL4 A;  4FIS A;  3F8N A;  3GBG A;  4NQW A;  1MKM A;  3CCM I;  3BZK A;  3GCM A;  4CA0 A;  1FX7 A;  5EEH A;  2FA5 A;  3WE3 A;  4BHC A;  3A01 B;  1CGP A;  3BCB A;  1D5Y A;  3BJO A;  2XHK A;  1OYY A;  3HHG A;  2HXO A;  1O3S A;  2VIX A;  3I5U A;  2Z33 A;  2COM A;  1MND A;  1UEL B;  3PM1 A;  4LJZ F;  5FRN A;  3AG4 H;  4A0X A;  1EF4 A;  2BY3 A;  3ABL H;  4UB6 C;  4HF0 A;  1D1B A;  1R5H A;  1N77 A;  1WWX A;  4I02 A;  3TO6 A;  1R1T A;  1I6H J;  2E71 A;  2K27 A;  2OUM A;  4I0A A;  5IOZ A;  5C3E J;  4OMY A;  3ECO A;  3CD6 I;  1Q1H A;  5HLT A;  4L5E A;  2IVM A;  1YE9 A;  1I3Q J;  1IUY A;  3VWB A;  4DW6 A;  3PFI A;  3QQA A;  4BXU A;  3WOD F;  3CJN A;  3E6B A;  3F3X A;  2HOE A;  2JK3 A;  1PJR A;  1RR8 C;  3PJR A;  1XB4 A;  3WG9 A;  2R7S A;  4AM3 A;  2OTL I;  2ZME C;  2JVH A;  4XID A;  1VQ8 I;  2NVX J;  1E3O C;  1W7P D;  5E79 C;  5IPA A;  2L9R A;  5F1J A;  3GO5 A;  3BG6 A;  4M73 A;  1ENH A;  1V5G A;  2F5C A;  2LKX A;  2KRH A;  3I0T A;  3UNG C;  5D8L B;  1T39 A;  2D45 A;  3WTY C;  2NVT J;  3QRF F;  1ZRF A;  2IPQ X;  4ZYA A;  4FTH A;  2RGV A;  3ONQ A;  2DJN A;  4ASN A;  3TED A;  1FTT A;  3GLX A;  4KT5 C;  1B1B A;  2BY2 A;  1IV8 A;  2DFE A;  4WK8 F;  1U6G A;  5CVV A;  3H9G A;  2JRM A;  1WCM J;  4YFN F;  5B1B H;  5H6R A;  1S5L C;  1ZLJ A;  1RET A;  2RNJ A;  1BIA A;  4N0B A;  3FBI B;  1W7P A;  4WX9 A;  4LGW A;  3GFI A;  2XF5 A;  1XCB A;  1LFU P;  1WJF A;  2I10 A;  4N4O B;  5KVR A;  3IKV A;  5D4R A;  3E5U A;  2W24 A;  3LSR A;  3C7J A;  1R5G A;  5DDG A;  4LLN A;  2FBK A;  5D5X B;  3C2H A;  3CO7 C;  3I4M J;  1KQ8 A;  1QZZ A;  2ETH A;  3RKX A;  4BY1 J;  3ZGK A;  1ZTR A;  1W0T A;  4BBS J;  5M5X J;  2M8G X;  5FKO A;  1SVM A;  4Y17 A;  4BEH A;  5BPI A;  4E7L A;  1X1D A;  3C2B A;  3DEW A;  2AO9 A;  1S7A A;  1RUO A;  4IZZ A;  1IXS B;  2XV4 S;  1RZ4 A;  4I7H A;  5CQE A;  4CH7 A;  1IRX A;  2O8K A;  3CC7 I;  3DPL C;  5ILS A;  5JLW A;  5LHH A;  4MTE A;  4IX7 A;  3LFK A;  1GDT A;  4FET A;  1UZC A;  1X1B A;  4DBQ A;  2FJ1 A;  1FC3 A;  1GUU A;  2DA4 A;  2GA1 A;  1XX5 A;  3MEX A;  4UUS A;  4KDP A;  1F4K A;  1N78 A;  4JX4 A;  4UVA A;  5LLQ A;  2D5V A;  2MC3 A;  2EZL A;  3KP2 A;  2M87 A;  5JR3 A;  2QBY B;  2E35 A;  4G7Z F;  3TKY A;  1MIJ A;  2ZSH B;  4JOM A;  1QNT A;  3SDG A;  5HVQ C;  4BAY A;  3K2A A;  4BQO A;  1O7L A;  1R00 A;  3JRA A;  1Y56 A;  2MW8 A;  5L3G A;  4KN7 X;  2K40 A;  5ILV A;  4CHU A;  1R1U A;  4M3B A;  2QEX I;  3HOV J;  3H5A A;  2STT A;  1BM9 A;  2C6Y A;  2FE3 A;  4HNT A;  5TRD A;  2LBF A;  2UV1 A;  2XGC A;  4CSW A;  3FXL A;  2JQ7 A;  2DTZ A;  3JTH A;  1TW2 A;  3G73 A;  1ZG5 A;  1M1E B;  3LA7 A;  4M3E A;  4F55 A;  4HDU A;  1TQP A;  1IXR C;  2LSO A;  3ZQG A;  2ZJP F;  1BN5 A;  1R5I D;  2A6E F;  3S17 J;  1LVA A;  1TZL A;  3L2Q A;  3Q9S A;  2DTR A;  5F0H A;  4IL6 C;  4ZYD A;  3IRR A;  1LQ1 A;  5ED4 A;  3SYT A;  3WU2 C;  4AU7 A;  1MH3 A;  4P55 A;  2Y48 A;  3EYY A;  3TDU C;  2H27 A;  1S7O A;  2D2W A;  3FIS A;  4FX0 A;  1FP1 D;  3FMQ A;  3F22 A;  5LHI A;  4I01 A;  1TBX A;  1ZHF A;  1X1A A;  2Y75 A;  5FFZ A;  2JUG A;  1A04 A;  4A3K J;  1YRN B;  2OZ6 A;  4UB8 C;  4NBQ A;  1I1S A;  5DD8 A;  5FB2 A;  2E36 A; 
#chains in the Genus database with same CATH homology
 5E20 A;  2LKP A;  3I4P A;  1ZAO A;  3HSR A;  4M6Y A;  2DPU A;  5DCF A;  2YX7 A;  4MGR A;  4DQ2 A;  4PDK A;  2IRF G;  3K9T A;  2G7U A;  2ZXJ A;  2XUB A;  2YU3 A;  3E5Q A;  4LB6 B;  3QP5 A;  1REP C;  3DEU A;  3TDZ C;  1OPC A;  1QGP A;  1IW7 F;  3V7R A;  1ZAR A;  3MAJ A;  5DCM A;  1H9T A;  5K5Q A;  3N97 A;  5E1W A;  1ON2 A;  2XAG A;  1U8R A;  2NYX A;  3C3W A;  4IVN A;  2PMH A;  5F6F A;  1OR7 A;  4UUV A;  3L00 A;  1HW1 A;  3GZ5 A;  4ZZD A;  2EFQ A;  3K69 A;  3F8F A;  4MEX F;  4BNC A;  1RNL A;  2QVO A;  5AON A;  5L3D A;  1QPM A;  2KJB A;  1DP7 P;  1G4D A;  4P96 A;  2OD5 A;  1Z05 A;  3JTG A;  2H6B A;  4EM1 A;  4ZYH A;  3ZN0 A;  1FSE A;  3M1E A;  5E1Z B;  4HLY A;  3WU0 A;  2DPD A;  1U2W A;  4EJO A;  3M9A A;  1KQ9 A;  4HX4 A;  1X3U A;  1Z6R A;  4KN4 X;  2STW A;  1UFM A;  2BBY A;  2OZU A;  2VXZ A;  2EA4 A;  3ZN1 A;  2XGX A;  3ZMU A;  2PMU A;  2IJL A;  1D8K A;  3RJP A;  2QQB A;  1GXP A;  3ROU A;  3LAP A;  4GYI A;  2Z99 A;  3I71 A;  1B6A A;  1IRG A;  3P9C A;  2BV6 A;  4LLG F;  5AIP A;  2EFP A;  3HOS A;  1P2F A;  4LK0 F;  2MD5 A;  2KIF A;  1SD7 A;  3LAJ A;  5DUK A;  3QU6 A;  2E1N A;  2EFW A;  3FWE A;  1FBQ A;  3IRQ A;  5BOX A;  2IT0 A;  4Q4Z F;  1XMA A;  2E7X A;  2IW5 A;  4KIF A;  3H92 A;  2EV6 A;  4G94 A;  5LHG A;  3FXU A;  3QOP A;  1U5T C;  1JGS A;  3EYI A;  4G9Y A;  1IN8 A;  3DFG A;  1P4A A;  4UVB A;  3ULQ B;  3KEO A;  3SHF A;  3MFK A;  2EFO A;  3SZP A;  4KIC A;  1XGO A;  2EJR A;  5HS9 A;  3ELK A;  1YLF A;  2FBH A;  4Q48 A;  5JVT A;  1PDN C;  2EWN A;  3U2R A;  3C1D A;  3WGH A;  3CO6 C;  3MWM A;  1SMY F;  2PFB A;  2EK5 A;  1YW8 A;  2V1U A;  2DAO A;  4I2O A;  1B9M A;  2VOD A;  5FO5 A;  2V1D A;  5F1R A;  1W7P B;  2P7V B;  1ON1 A;  3VB2 A;  3BOQ A;  5CVJ A;  2ADU A;  3WTZ A;  5LGU A;  4L5I A;  4UNO A;  2WV0 A;  2ZME A;  1G3S A;  1R23 A;  1DPU A;  3IKT A;  3LQQ A;  4RAY A;  1HW5 A;  2IA2 A;  5BPD A;  5A2Q Z;  5AIQ A;  1W5S A;  4GXO A;  4U7D A;  1PUE E;  4KMF A;  3HYI A;  4UVC A;  3HRM A;  2P6S A;  3ECH A;  2PLY A;  3FXR A;  4HBL A;  4M71 A;  1OYW A;  2RN7 A;  2DK5 A;  4WXD A;  1LDK B;  4WWC A;  2PI0 A;  3R61 A;  2TDX A;  1RI7 A;  2M8E A;  1ZGJ A;  2OQG A;  3E6D A;  2XKO A;  5CVR A;  4IRI A;  1KYZ A;  1IN5 A;  1JE8 A;  1KU2 A;  2W84 A;  4Z2Y A;  5IT3 A;  3WGI A;  2QZ8 A;  1O7F A;  1I6X A;  3D0S A;  3I58 A;  3FM3 A;  2L3D A;  4AIJ A;  1GHC A;  1XSX A;  2XIG A;  1WI9 A;  2RDP A;  2HFH A;  4GO1 A;  3QU3 A;  5K1Y A;  1BI2 A;  5IT9 Z;  1QQI A;  2L02 A;  3IL2 A;  5L3C A;  1ZRE A;  3K0L A;  6PAX A;  3HTS B;  2O03 A;  2G9W A;  3QP6 A;  4R79 A;  1P6R A;  2HS5 A;  3EET A;  1BBY A;  1HBX G;  2DQR A;  1FLI A;  2M45 A;  4CIC A;  4IJA A;  1EH7 A;  4D0P A;  5FD6 A;  5LBQ A;  3F21 A;  5DCM B;  2O6G E;  4XRF A;  2WC2 A;  3H3Z A;  1QZY A;  2VBZ A;  4OIR F;  1ZG1 A;  4KUM A;  2J5P A;  3COA C;  1Y0U A;  2KIU A;  5HLH A;  4S05 A;  1USS A;  1KYW A;  2FSW A;  1MZB A;  3R0A A;  1OYI A;  3HTU A;  4I0B A;  3SQN A;  2VT3 A;  3JW4 A;  4YII A;  4CGZ A;  4EJT A;  3JSP A;  1IRF A;  1O3R A;  5LGN A;  2GAU A;  1UHM A;  1H0M A;  4EVI A;  2A07 F;  3H3U A;  2GXB A;  4A6E A;  3K2Z A;  2P6T A;  1HW2 A;  3SFZ A;  5J6X A;  2VBW A;  1YS6 A;  3O2P E;  1MDM A;  3V8L A;  1MJA A;  1I27 A;  4MEY F;  2J5O A;  3D5L A;  4L18 B;  4M72 A;  1S3J A;  3T1B A;  4B09 A;  3HUG A;  4BH9 A;  1ZLK A;  3ZPL A;  3J81 Z;  4EGZ A;  2QWW A;  4HAM A;  3WTW C;  4EJV A;  2DQL A;  2EV0 A;  2XAH A;  2H09 A;  1T0F A;  1HQC A;  4JK1 X;  1E2X A;  5H6Q A;  3VEP A;  3QPT A;  3RI4 A;  2BEO A;  4HQE A;  2OU2 A;  1D3Y A;  1YW9 A;  4JQF A;  4IRG A;  2B0L A;  2DFI A;  4ZZL A;  3ZQ7 A;  1IZ1 A;  3KLO A;  4PGG A;  1O3Q A;  4RGS A;  3PQJ A;  5K5R A;  5DEQ A;  1V4R A;  2RV8 A;  3FX3 A;  3JAM K;  4OIQ F;  2HDC A;  3E3V A;  4OOI A;  4OIN F;  1HKQ A;  2HZT A;  1WSU A;  1XDU A;  3J7A O;  2KIM A;  2JZY A;  3R4K A;  4XLN F;  3L2C A;  4EGY A;  3F8C A;  4GYG A;  1O3T A;  2FU4 A;  2XAF A;  4HV6 A;  1UB9 A;  3TOB A;  2P4W A;  3B73 A;  3VFZ A;  2ISZ A;  4OIO F;  1XGN A;  2Z9O A;  2DW4 A;  2HWV A;  3B02 A;  3ERE D;  2MH9 A;  1P4X A;  2ESH A;  3HIF A;  5D8K B;  1Z9C A;  2ZME B;  3QAH A;  1PP7 U;  2O0Y A;  1U5T A;  3C18 A;  1ZGA A;  1EV7 A;  2NS0 A;  1BIB A;  4M6X A;  4CXF A;  5HS7 A;  2QEN A;  4G6Q A;  3F23 A;  1UCR A;  4UV8 A;  4CZZ A;  4L9V A;  2HQR A;  5LGT A;  2D1V A;  4TV7 A;  1D5V A;  1P4W A;  3MQ0 A;  1XSV A;  4EJU A;  3F72 A;  2RVC A;  3KEQ A;  3V7C A;  5JHU A;  4RAZ A;  3RYR A;  4HF2 A;  3FZV A;  2WWY A;  1FP2 A;  4U0Y A;  2L54 A;  1RIO H;  1E17 A;  1HKS A;  2ZNY A;  3M8E A;  3N4M A;  2YR2 A;  2EFN A;  3L9F A;  3CUQ C;  3ML6 A;  4KA4 A;  5FD5 A;  1J0R A;  4WXC A;  2V9V A;  2VON A;  4UV9 A;  4EM2 A;  2M5W A;  3W6K B;  1FOK A;  4BHP A;  3ZMZ A;  1FYL A;  3T5X A;  2RQP A;  1Z1D A;  3GZ6 A;  3RIR A;  2W57 A;  3OV8 A;  3DKW A;  2D1H A;  4A5M A;  3U9G A;  1QO0 D;  3WGG A;  4M9S A;  3V4G A;  2FRH A;  4ESF A;  4K2E A;  4WXH A;  2A69 F;  2ZBK A;  3NQO A;  3GW2 A;  5FFX A;  1QBJ A;  3NEU A;  4GCV A;  1XN7 A;  1YIO A;  4FHT A;  2MLK A;  3ABT A;  2ACJ A;  5L3F A;  1XCV A;  2V1X A;  2O8X A;  3F6O A;  3BDD A;  2KJC A;  1S8N A;  2GWR A;  4O3M A;  5HDK A;  3IC7 A;  4YIF A;  5FLX Z;  1J75 A;  5E17 F;  2PG4 A;  3EDP A;  3R0J A;  5J8C A;  4HDV A;  1K7A A;  4CDG A;  1BJA A;  3LST A;  3J81 K;  4R8H A;  3W6J B;  4KIG A;  2V79 A;  2HKO A;  2QLZ A;  4B8X A;  1J5Y A;  1LNW A;  4QLC U;  3TO7 A;  1MDM B;  4ZYE A;  5LEK A;  1YQA A;  5D4S A;  4N9H A;  2FNA A;  2X0L A;  3I53 A;  3DF8 A;  4RGR A;  4M9X A;  4ETS A;  3REO A;  1W4M A;  1L0O C;  3K1N A;  2DBB A;  5BMZ A;  1T2K A;  4WF2 A;  2OAZ A;  1DDN A;  2OA4 A;  4RB2 C;  5HLG A;  1HST A;  5D5V B;  2HYF A;  3FHZ A;  4I98 B;  4KNY A;  3ZMD A;  1PP8 F;  2CG4 A;  1T98 A;  3J80 Z;  3RKY A;  2QYO A;  3O3K A;  1XDS A;  5TJJ A;  3TGN A;  1VTN C;  4FX4 A;  1R58 A;  1T38 A;  3GXO A;  5CVU A;  4OMZ A;  4IHT A;  2P5L C;  3FXQ A;  2PJP A;  5FGM A;  1FBU A;  5E18 F;  2AS5 F;  4Y13 A;  3CUO A;  1WRJ A;  3S2W A;  5HLI A;  1LDJ A;  2FMY A;  3V8J A;  4A0Z A;  3KP6 A;  4EJW A;  5DYM A;  4RB0 A;  1IAW A;  5EEG A;  1DPR A;  3QPH A;  3RTR A;  3ISP A;  2KKO A;  1KQ0 A;  1V3F A;  3HRT A;  2G7H A;  2HR3 A;  4O6J A;  4YG2 F;  1MD0 A;  2JT1 A;  1Z7U A;  1ZG3 A;  4EMS A;  1U5T B;  3KP7 A;  4ENK A;  2GA2 A;  4H0E A;  3BY6 A;  4BYY A;  1UHW A;  1FYK A;  3HSE A;  1RUN A;  1XD7 A;  4L9N A;  4XSZ F;  3LA2 A;  4RGX A;  3WTX C;  2FQ3 A;  4WCG A;  2E7W A;  5ICG A;  2XRN A;  1SAX A;  3RPU A;  2Q2E A;  1IN7 A;  3DV8 A;  3DP7 A;  2XRO A;  4F7Z A;  2L4A A;  3CTA A;  1B4A A;  2HGC A;  2P5V A;  3GFJ A;  4MNU A;  4UHT A;  1LEA A;  2QQA A;  1S29 A;  2CGP A;  1BC8 C;  1GVJ A;  2DT5 A;  3RPQ A;  2A3S A;  2XAQ A;  3KZY A;  1R1V A;  1K78 A;  1O57 A;  1J59 A;  3HSF A;  2ELH A;  4G8X A;  3TO9 A;  4ENN A;  3GUD A;  4Q47 A;  5LRR A;  1SD6 A;  2K4J A;  3WTU C;  2K7L A;  3AAF A;  5HDN A;  3HOT A;  3T8T A;  4ESJ A;  1AWC A;  1YFH A;  2VC0 A;  3EQL F;  5H20 A;  3BPV A;  2CSO A;  2OQR A;  3RYP A;  3EUH A;  1ZRC A;  1LEB A;  3CUQ A;  2VE8 A;  3GFL A;  2JTV A;  2EA2 A;  1K6O A;  2GXG A;  2FOK A;  4P5O A;  1FSH A;  3MZY A;  1DUX C;  1FZP B;  1F1Z A;  5D6E A;  4ESB A;  2VE9 A;  1J7K A;  2QM3 A;  5HDG A;  1Z91 A;  1Z6T A;  1F5T A;  1IXC A;  3M7G A;  2MBF A;  2FF4 A;  2MLG A;  2F2E A;  1S6L A;  3O6B B;  2ZCW A;  3KET A;  5F64 A;  1MGT A;  2ZFW A;  3BWG A;  1EH6 A;  5HOO A;  2CWE A;  2ESN A;  4HYE A;  4Q5S F;  2DU9 A;  4A2U A;  4AVP A;  5LEJ A;  1CF7 A;  1C0W A;  4U88 A;  4FT8 A;  4AIH A;  3K1M A;  3L7W A;  4U0W A;  2DO7 A;  2Q8K A;  1FY7 A;  2LF8 A;  1K79 A;  2K4B A;  3WTT C;  4CO8 A;  2NNY A;  3L09 A;  4HX8 A;  4G7H F;  1G6N A;  3J80 K;  1STZ A;  2VC1 A;  4GGG A;  3LQR A;  4LFU A;  4PGH A;  3VOD A;  1L3L A;  5D5W B;  3M8F A;  1OKR A;  1LJ9 A;  3WTS C;  1ONV A;  2VBY A;  1FBS A;  3KZZ A;  5E8I A;  5CLS A;  2IA1 A;  2CQK A;  3MZH A;  2LNB A;  5ILU A;  2EV5 A;  4MQ9 F;  2FXA A;  4G7O F;  3FM5 A;  3LA3 A;  5CVI A;  4L0Z B;  3T0Y A;  4AIK A;  5L3B A;  5A2Q K;  4LG0 A;  3T8R A;  2HTS A;  4P9U A;  3KFW X;  4Y15 A;  3IWF A;  2XAJ A;  1KU7 A;  1U78 A;  1G3T A;  2BGC A;  4KMU X;  2XKP A;  2CFX A;  3I54 A;  2EB7 A;  2BYV E;  3IHU A;  3V8K A;  3F8M A;  4P9F A;  4EV0 A;  4L9T A;  1R22 A;  2ZKZ A;  1J2X A;  1YYV A;  1KGS A;  1BC7 C;  2YPR A;  4KYW A;  1SFU A;  1TLH B;  3V7S A;  3G3Z A;  1I1G A;  3K1P A;  5BQT A;  5JI6 A;  1EH8 A;  4NB5 A;  4IXA A;  2A5Y B;  3GX4 X;  4BHB A;  5E8G A;  3BJA A;  3P7N A;  3OOP A;  1BOA A;  3NRV A;  2P7C B;  2YSR A;  2HYG D;  2VN2 A;  5IT9 K;  1FPQ A;  1TQI A;  1HXD A;  3HRS A;  1B59 A;  5D6F A;  4L5J A;  2H94 A;  3WU1 B;  1F9N A;  3R6S A;  3Q5F A;  3WE2 A;  4MTD A;  4RS8 A;  2F5D A;  4S04 A;  2AXL A;  4QWQ A;  3BJ6 A;  4L9J A;  2FBI A;  2A68 F;  4YFX F;  1TNS A;  1SFX A;  4M74 A;  4O5V A;  1YS7 A;  5DUI A;  3FMR A;  2LF7 A;  3I59 A;  4HW0 A;  3CDH A;  2K02 A;  4UXN A;  1G3W A;  4AD9 A;  1YO5 C;  3GWZ A;  1U3E M;  2ZJ2 A;  3GYH X;  2O3F A;  4A6D A;  2CYY A;  1K78 B;  4AWX B;  5ICC A;  3F6V A;  2A6H F;  4N9I A;  2QQ9 A;  2ZO4 A;  4BQA A;  2IP2 A;  1UST A;  4A5N A;  2DK8 A;  1XMK A;  2L4M A;  2V6C A;  2JPB A;  4OU0 A;  2UXN A;  4DNC A;  2PQ8 A;  2Z5U A;  3HRU A;  1IN6 A;  3DQV C;  4XBF A;  2X4H A;  1SD4 A;  2RKH A;  3FMS A;  1D8J A;  1FWZ A;  2WTE A;  1HSJ A;  4PCQ A;  4LK1 F;  4L0Y B;  2RC4 A;  2QUF A;  2A61 A;  3CUQ B;  3ZP5 A;  1SFE A;  4ZH4 F;  2K86 A;  1B9N A;  5DV5 A;  3TOA A;  4LB5 A;  3MCZ A;  2LDU A;  1ODD A;  2R7D A;  2KRF A;  4KFC A;  4LLL A;  4HQM A;  4IHS A;  1ZN2 A;  2H6C A;  3BZ6 A;  1TNT A;  1FT9 A;  2Z3Y A;  2MH2 A;  3KCC A;  5E1X A;  2P5K A;  1IF1 A;  2GIV A;  3E6C C;  2XAS A;  2Y0M A;  2VOO A;  4A0Y A;  4IPA A;  4U0V A;  1ULY A;  1LDD A;  1BI0 A;  2HQN A;  2L01 A;  4CYD A;  1ZH5 A;  3TQN A;  4IF4 A;  4KIB A;  1XSD A;  1CF7 B;  3GFM A;  1P92 A;  1SD5 A;  5KK1 A;  5K5O A;  3JSO A;  4G6D A;  3F8B A;  5HS8 A;  2E1C A;  1WKM A;  2VBX A;  1FNN A;  5L3E A;  5JFR A;  1KA8 A;  1SMT A;  2GZW A;  2M1B A;  2PEX A;  3KP3 A;  5D5U B;  2R3S A;  2O61 A;  2FML A;  3KP5 A;  2CW0 F;  1T6S A;  2ISY A;  5ERI A;  4RB3 C;  3GF2 A;  4XSX F;  1TQM A;  2P8T A;  1W5T A;  3RDI A;  4M9Z A;  4LD5 A;  3WTV C;  3HHH A;  4ENJ A;  3JAM Z;  2CO5 A;  2VT2 A;  3DXJ F;  3GVA A;  1TW3 A;  1YG2 A;  2QBY A;  5ICE A;  1GXQ A;  2NRA C;  1OMI A;  2MA3 A;  3LWF A;  4HLX A;  1MJB A;  3FF5 A;  4LG0 B;  4HA8 A;  1JHF A;  1FYM A;  3I64 A;  3R60 A;  2HEO A;  3ZMS A;  3IWZ A;  2IA0 A;  1H9G A;  2PBI A;  3KP4 A;  2VOP A;  4ENM A;  2W85 A;  1ZRD A;  3GEZ A;  2UWM A;  4ON0 A;  3ZMV A;  2JRT A;  3VOE A;  3RKW A;  2W25 A;  5CJ9 A;  1KU9 A;  2HTJ A;  3P9K A;  2JSC A;  4HX7 A;  3KLN A;  4PZJ A;  1JHH A;  3Q9V A;  3SZT A;  2UXX A;  1BI3 A;  2R7F A;  4EM0 B;  3PQK A;  2FEZ A;  2XVC A;  1TTY A;  3P9I A;  4HV5 A;  2PN6 A;  4YFK F;  2Q0O A;  5J8F A;  1G3Y A;  4MQV A;  4IRH A;  1J9I A;  2F5E A;  1AOY A;  3BPX A;  2DLL A;  5CYV A;  3E97 A;  2M30 A;  3CLO A;  5BS6 A;  1I5Z A;  2BE5 F;  4NHJ A;  3BP8 A;  3E5X A;  1XGS A;  4HZF A;  4RGU A;  4JBA A;  5ICF A;  1KU3 A;  4RB1 A;  1NHA A;  2GQQ A;  1BI1 A;  3U1D A;  3ABU A;  4MHG A;  3SXY A;  4EQQ A;  2YX4 A;  4A12 A;  1MJ9 A;  1R7J A;  4OIP F;  1YTY A;  1WQ2 A;  3E6M A;  3I59 B;  2UZK A;  1R36 A;  4HF1 A;  1YW7 A;  2DI3 A;  3DPT A;  2FNP A;  2NAZ A;  3KE2 A;  4ZYG A;  2OBP A;  2ZNZ A;  3BRO A;  2JPC A;  1IN4 A;  1LB2 A;  4I09 A;  1JXS A;  2HKX A;  1ZYR F;  4LMY A;  4XLP F;  4HOB A;  3ZMT A;  5DD4 A;  4E70 A;  2NNN A;  5LRS A;  5FLX K;  1HKT A;  2F5F A;  4U7B A;  1XGM A;  4R1H A;  3F8N A;  4NQW A;  1MKM A;  1FX7 A;  5EEH A;  2FA5 A;  3WE3 A;  4BHC A;  1CGP A;  3BJO A;  2XHK A;  1OYY A;  3HHG A;  1O3S A;  3I5U A;  2Z33 A;  2COM A;  4LJZ F;  4A0X A;  4HF0 A;  1R5H A;  1WWX A;  4I02 A;  3TO6 A;  1R1T A;  2K27 A;  4OMY A;  4I0A A;  3ECO A;  1Q1H A;  2IVM A;  1IUY A;  3PFI A;  4BXU A;  3WOD F;  3CJN A;  3E6B A;  3F3X A;  2HOE A;  1XB4 A;  3WG9 A;  1W7P D;  3GO5 A;  4M73 A;  2F5C A;  3I0T A;  5D8L B;  1T39 A;  2D45 A;  3WTY C;  3QRF F;  1ZRF A;  2IPQ X;  2RGV A;  4ASN A;  3GLX A;  4KT5 C;  1B1B A;  4WK8 F;  1U6G A;  5CVV A;  4YFN F;  5H6R A;  1ZLJ A;  2RNJ A;  1BIA A;  4N0B A;  1W7P A;  4WX9 A;  4LGW A;  3GFI A;  1XCB A;  5KVR A;  3IKV A;  5D4R A;  3E5U A;  2W24 A;  3C7J A;  1R5G A;  5DDG A;  4LLN A;  2FBK A;  5D5X B;  3CO7 C;  1KQ8 A;  1QZZ A;  2ETH A;  3RKX A;  4Y17 A;  5BPI A;  1S7A A;  1RUO A;  1IXS B;  2XV4 S;  1RZ4 A;  4I7H A;  3DPL C;  5ILS A;  5LHH A;  4MTE A;  3LFK A;  1FC3 A;  2GA1 A;  3MEX A;  4KDP A;  1F4K A;  4UVA A;  5LLQ A;  2MC3 A;  3KP2 A;  2M87 A;  5JR3 A;  2QBY B;  4G7Z F;  3TKY A;  5HVQ C;  1QNT A;  4BAY A;  1O7L A;  1R00 A;  5L3G A;  5ILV A;  4KN7 X;  4CHU A;  1R1U A;  2STT A;  1BM9 A;  2C6Y A;  2FE3 A;  5TRD A;  3JTH A;  1TW2 A;  3G73 A;  1ZG5 A;  3LA7 A;  4HDU A;  1TQP A;  1IXR C;  2LSO A;  1BN5 A;  2A6E F;  1LVA A;  3Q9S A;  2DTR A;  4ZYD A;  3IRR A;  1LQ1 A;  5ED4 A;  4P55 A;  2Y48 A;  3EYY A;  3TDU C;  2H27 A;  1S7O A;  2D2W A;  4FX0 A;  1FP1 D;  3FMQ A;  3F22 A;  5LHI A;  4I01 A;  1TBX A;  1ZHF A;  2Y75 A;  5FFZ A;  1A04 A;  2OZ6 A;  1I1S A;  5DD8 A;  5FB2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...