1FYKA

Serendipitous crystal structure containing the heat shock transcription factor's dna binding domain and cognate dna that is translationally disordered
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
92
structure length
88
Chain Sequence
ARPAFVNKLWSMVNDKSNEKFIHWSTSGESIVVPNRERFVQEVLPKYFKHSNFASFVRQLNMYGWHKVQDVKSGNNDSRWEFENERHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HSE DNA-PHOSPHATE BACKBONE
publication title Crystal packing interaction that blocks crystallization of a site-specific DNA binding protein-DNA complex.
pubmed doi rcsb
source organism Kluyveromyces lactis
molecule tags Transcription/dna
total genus 21
structure length 88
sequence length 92
ec nomenclature
pdb deposition date 2000-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fykA00
4HDVA 2GQQA 3SQNA 2IRFG 3F3XA 3AAFA 4G8XA 4R1HA 4ZYDA 4KN4X 1I5ZA 3T1BA 3VFZA 2OD5A 1LNWA 2JTVA 4YFNF 3KZYA 4UXNA 1K79A 2XKPA 2ISYA 3C18A 2HTSA 4EV0A 2JSCA 4RGUA 1R5HA 4MQVA 2HTJA 3JSPA 1Q1HA 4R8HA 1KQ9A 5E8GA 4HV5A 4KYWA 4M9XA 3QP5A 3TDUC 4O5VA 5EEHA 2DQLA 2F5FA 3CUQB 5DCMB 1XB4A 1FOKA 4RB2C 1SFEA 2DK8A 4YFXF 2R3SA 2Y0MA 1LDKB 2OA4A 1GXPA 2QQ9A 3MZHA 1NHAA 4HF1A 2HYFA 4L0YB 3HTSB 3B02A 3KLOA 5ILVA 2RQPA 3BOQA 1OKRA 3I0TA 4HF2A 1EH6A 2BV6A 4MEYF 3QRFF 3WGHA 2XKOA 5CVVA 3EQLF 1F5TA 1BOAA 1ZRCA 4M73A 1IRFA 2VT2A 3LFKA 3TO6A 1R1UA 3KP3A 1BC7C 5FGMA 1HW2A 3N4MA 3TOBA 4U0VA 1QQIA 3D0SA 5DD4A 2Q0OA 2CWEA 2VXZA 5HDGA 3R60A 3O2PE 5CVIA 1HSJA 1J7KA 4A2UA 2M30A 5BMZA 2DO7A 3QP6A 4XBFA 4AD9A 2CFXA 3SFZA 3I64A 2HEOA 1YW8A 5DD8A 2V79A 2XAGA 4Z2YA 2IA0A 3SXYA 4JQFA 4P9UA 2NNNA 4IRGA 2H09A 2K27A 3ZMDA 5D8LB 4WXHA 1FLIA 4RB1A 5LHIA 2RVCA 2RGVA 1MZBA 2JPCA 4PGGA 1JHFA 3TDZC 1YW9A 3DKWA 1BI3A 3NEUA 2F5CA 3E3VA 1XCBA 4G7OF 1ODDA 4EM0B 3H3ZA 1F9NA 4L9NA 4UVCA 5F6FA 2HQNA 3RPQA 4KNYA 2O61A 3T5XA 5J8CA 4UUVA 5FLXK 4YIFA 1SD4A 2KIFA 4HDUA 3ZN1A 4RGSA 1FX7A 2Y48A 3MEXA 2E1CA 5HDNA 2AS5F 2Q8KA 1XDSA 2XAJA 4MNUA 1Z7UA 5F1RA 4L18B 4P96A 1MDMB 3R61A 2GXGA 2EA4A 4Q48A 4ENJA 4DQ2A 2D2WA 2XUBA 2CW0F 2WC2A 2HKOA 2VC1A 2LKPA 1LVAA 2CYYA 4A0YA 4A12A 3CUQA 5ED4A 4I09A 2WWYA 1T0FA 4MHGA 4CO8A 3V7RA 3LAPA 2MBFA 5FLXZ 5JHUA 3SZTA 2QUFA 5AIQA 3DV8A 5HLIA 2F2EA 1G3TA 2G7HA 2FA5A 3PQJA 2AXLA 4ZH4F 1IXSB 3GX4X 1SFUA 2HR3A 2A07F 5HLHA 1L3LA 1FC3A 4M6XA 2VODA 2EB7A 4L9JA 1KU3A 3BPVA 5E17F 5ILUA 3HUGA 4A5MA 3EDPA 3TKYA 2DLLA 2OZ6A 4BYYA 2RDPA 2A61A 4YFKF 4I02A 1UHWA 2FNAA 1FSHA 4PZJA 4LGWA 1FYMA 1GHCA 6PAXA 2P6SA 2X0LA 2XGXA 4UV9A 1BIAA 3L7WA 4UVBA 3KP7A 3GYHX 2O8XA 2PFBA 5L3DA 2DFIA 4B09A 1UCRA 1O3SA 1B59A 4OIOF 3E6DA 2XASA 4IRHA 1BI2A 3GUDA 2ZCWA 3OOPA 1B9MA 2P8TA 4ENMA 2XRNA 2Z33A 1K78B 2H6BA 4AWXB 1FZPB 2ZFWA 2WTEA 2MA3A 1ZLKA 4MEXF 1QBJA 2QBYB 3DP7A 2NYXA 4WXCA 3ERED 1TQPA 3LWFA 3ZMVA 3Q5FA 4RAYA 5CVJA 4EVIA 4RB0A 3LSTA 3FM3A 3IL2A 3WU1B 3IWZA 3ABUA 2EA2A 1PDNC 2KIMA 1U5TA 3VB2A 3M8EA 4ESBA 5LGTA 4UVAA 3GZ5A 1QPMA 2P5LC 1ZG3A 3BJ6A 4HLYA 1P92A 2VE8A 2R7FA 2FQ3A 1R58A 2W84A 1P6RA 4G7ZF 5TRDA 1MDMA 2QQAA 4OINF 1R22A 3FXUA 4HZFA 4M9ZA 1T39A 4DNCA 1L0OC 1IN7A 1XGOA 1T6SA 2P4WA 4WWCA 5H6QA 4ZYEA 3WTVC 3KP6A 2ISZA 3BJAA 4M72A 5LLQA 3BZ6A 3ROUA 4EMSA 3L09A 1DP7P 2Z99A 3HRSA 4HV6A 5K5OA 2H27A 2FE3A 2QENA 1QZYA 2R7DA 1SD7A 4CHUA 5D5WB 1W7PA 3WODF 2A69F 2YPRA 5HOOA 2K7LA 2EV6A 2FOKA 1YW7A 3M7GA 1ZH5A 2ZMEB 1Z9CA 2GZWA 4ZZLA 1SFXA 3RDIA 2EFQA 4MQ9F 1SD6A 4G9YA 4A6EA 3FX3A 4H0EA 3E5UA 1KA8A 1G3WA 5D5XB 5JFRA 1PP7U 3WTXC 2D45A 4EJOA 2DQRA 4HAMA 4Q47A 2FSWA 5HLGA 1TQMA 2L3DA 1DPUA 1IN4A 1LDJA 3MCZA 4OMYA 1XCVA 1K7AA 3ZQ7A 3HTUA 2UXXA 3M9AA 4KICA 2YU3A 1RIOH 5L3BA 1V4RA 1IF1A 1S6LA 3MWMA 2RC4A 3HSEA 3T8RA 2IP2A 2XROA 1IUYA 4WX9A 5DUIA 1ZG5A 2EWNA 2UZKA 2ZNYA 3F8BA 1BJAA 2ACJA 5LHHA 4I2OA 5FD5A 2DPUA 1R00A 4XSZF 4GCVA 2TDXA 4LLLA 4L9VA 4A6DA 5LRRA 1U3EM 4L0ZB 1AWCA 3CTAA 4WXDA 1DUXC 3DF8A 1R23A 2STWA 4B8XA 2P7VB 4P9FA 3CUOA 5KK1A 4EQQA 4HX8A 3M1EA 4LLGF 3I59A 1I27A 4Y13A 3GVAA 1Z6RA 4U88A 1SMYF 1R7JA 3BJOA 3IWFA 2ESHA 5BPIA 5LGNA 4BAYA 1USSA 5H20A 4E70A 4KIBA 3W6KB 1D8KA 3P9IA 5TJJA 1YS7A 1XN7A 3WU0A 1BC8C 1IXRC 2DAOA 4ENKA 1IAWA 4K2EA 1IN8A 2W25A 5DCFA 2F5EA 3IKVA 1S7OA 4RB3C 2JRTA 5LGUA 1ONVA 1EV7A 3F6VA 3FF5A 4L5IA 4YG2F 4AVPA 1KYZA 2EV5A 4IHSA 1USTA 4LG0A 2JPBA 1KU2A 2M8EA 1WWXA 3GFMA 3FMQA 4CZZA 3ZMUA 3P7NA 1TLHB 3VODA 1T2KA 3QAHA 4F7ZA 4UNOA 4PCQA 2YR2A 4QWQA 3VOEA 2DI3A 1KGSA 1HKTA 1FBQA 1RUNA 3CO7C 4KFCA 4M9SA 5CYVA 2VT3A 4KDPA 1XSVA 3K2ZA 2OQGA 4U0WA 2VOPA 5CVRA 4EM1A 3RI4A 4ASNA 4CDGA 3TO9A 2YX7A 3CLOA 5D8KB 3HOSA 3E6MA 2J5OA 4GYGA 1GVJA 5HS8A 2XAHA 4PDKA 1V3FA 2IW5A 2PMUA 3J81K 1B9NA 4BHCA 4HA8A 1U5TC 1Z05A 3R0AA 1MJ9A 1G6NA 3JAMK 3HRTA 3V7CA 3WG9A 1FYLA 3E6CC 4I0BA 3JSOA 5BS6A 5F64A 3QPHA 3GFLA 3HHGA 2DTRA 4RAZA 2V6CA 2Z5UA 1A04A 4CXFA 1CGPA 2KIUA 3COAC 2EV0A 1FSEA 2EFPA 1IN6A 1BBYA 4R79A 2V9VA 2NRAC 3WE3A 3HYIA 2W57A 3J81Z 5HVQC 2GWRA 5E1ZB 1ON2A 1X3UA 3M8FA 3JAMZ 1QGPA 2MC3A 4HLXA 1FWZA 5DCMA 5KVRA 2D1VA 5HDKA 4A5NA 3WGIA 1R1TA 4KIGA 2K4BA 4FX4A 4U7BA 1YS6A 1XD7A 2G7UA 3FMRA 3CO6C 3MZYA 3EUHA 2Z3YA 1JXSA 2VOOA 3V8LA 2PJPA 3H92A 1ZRDA 4IXAA 1ZG1A 2DU9A 2B0LA 1BN5A 1ZHFA 4N9IA 4FHTA 1FP1D 5LEKA 2Q2EA 3GFIA 1XGNA 3B73A 2L02A 4NB5A 2OU2A 4IHTA 5JI6A 3I4PA 3R4KA 4TV7A 3GXOA 4XLPF 2PBIA 1ZYRF 2Z9OA 4HQEA 5D4RA 2EFWA 4PGHA 1FP2A 2JZYA 3OV8A 1CF7B 3K1MA 4Y17A 2DW4A 1B1BA 1QO0D 2X4HA 3K9TA 2ETHA 3RKWA 1DDNA 2A6EF 2L01A 1TNTA 4CYDA 4BH9A 3PFIA 3TOAA 3JW4A 5D5VB 2QLZA 4IJAA 3J7AO 5DDGA 3K69A 1HKQA 3K1PA 1J9IA 3ZN0A 4ZYGA 4LB6B 3RYRA 3H3UA 2BBYA 3FMSA 2D1HA 5J8FA 2GA1A 3GEZA 3T0YA 3V4GA 1BIBA 1YG2A 4LMYA 5BPDA 5L3FA 1TNSA 4G6DA 2GXBA 3J80K 2M1BA 5E18F 2KRFA 3KEQA 1FYKA 2H6CA 3ZPLA 3TQNA 4KIFA 3BPXA 4P5OA 2MD5A 1J59A 4CGZA 1YFHA 4M6YA 3T8TA 4G7HF 1HKSA 5E1XA 5ICFA 4HW0A 2PMHA 3K0LA 2RNJA 2W24A 3ABTA 3QPTA 3C7JA 4EJTA 2LDUA 2HOEA 1GXQA 5ERIA 4OOIA 1B6AA 1T38A 1HSTA 3I58A 2O0YA 4UV8A 1I6XA 5K5QA 3O6BB 2OBPA 2A3SA 1STZA 2NAZA 5DYMA 3ULQB 1LJ9A 1FY7A 3RKXA 2LF7A 2ESNA 2CO5A 4AIJA 3RPUA 2DK5A 3TO7A 5FD6A 4LB5A 4ESJA 1TQIA 3KZZA 2CGPA 3RJPA 3HRUA 1RZ4A 2MLGA 4Q4ZF 2V1UA 3I71A 1U8RA 1ZREA 4G6QA 2ADUA 1D5VA 5DV5A 1JGSA 1ZAOA 2OAZA 1YYVA 1HQCA 2PG4A 3E5QA 3WTSC 1AOYA 3ECOA 3IRQA 1KQ8A 1FPQA 3LA7A 2VC0A 4YIIA 2CQKA 2WV0A 4L9TA 1MJAA 4AIKA 3BP8A 3FWEA 2IA2A 4I01A 5ICEA 3KP2A 1BM9A 2JT1A 4UHTA 3IKTA 1FBSA 4I98B 3JTHA 3ZMSA 1P4AA 3LAJA 3GZ6A 1R5GA 5DEQA 3ECHA 1H9GA 2A5YB 1O3QA 1U2WA 3WTWC 5CJ9A 3EYIA 5D6EA 1ZLJA 1YO5C 1K78A 2UWMA 3LA3A 4U0YA 4IF4A 1J2XA 2HGCA 3WTUC 3P9CA 1G4DA 2QBYA 5E1WA 5IT9K 2PEXA 2GAUA 4RGXA 3NRVA 2ZKZA 2MH9A 2XIGA 3I54A 4EGZA 4HBLA 3PQKA 3R0JA 3I53A 2NNYA 1W5TA 1WI9A 3LQQA 5D6FA 3HSFA 4I7HA 3VEPA 4A0ZA 3FXRA 3ISPA 3CUQC 4JK1X 3V8JA 2FBKA 2LNBA 4IVNA 2QZ8A 2LSOA 3RKYA 2A68F 5IT3A 5J6XA 1LDDA 5IT9Z 1LEAA 1W7PD 2KJBA 3KP4A 4O3MA 2RKHA 2HS5A 1O3RA 2DT5A 3GF2A 1PUEE 3RIRA 2L4AA 1XGSA 5A2QK 2F5DA 2XV4S 4RS8A 1H9TA 4IRIA 4EJWA 4Q5SF 3U2RA 3HIFA 3QU3A 4CICA 4HX4A 2FMLA 1DPRA 1Z91A 3C1DA 3WE2A 1TTYA 3HOTA 4OIRF 4BNCA 3FZVA 1O7FA 2FEZA 2STTA 4Y15A 3KE2A 1Z6TA 3F8CA 3CJNA 4WF2A 1ZGJA 1LQ1A 2CSOA 1IZ1A 3KP5A 3F8FA 1P2FA 2J5PA 3MFKA 2VBXA 1YTYA 5D5UB 1KYWA 3GFJA 4N0BA 5FB2A 5A2QZ 2PI0A 5LEJA 3ML6A 2RN7A 1HBXG 1TBXA 3K1NA 4O6JA 2BGCA 3RTRA 3CDHA 3C3WA 1EH8A 4N9HA 3WGGA 1G3YA 3ZMZA 2QQBA 4BHBA 3EYYA 2CG4A 3NQOA 2O6GE 3DQVC 4HQMA 2COMA 2FBIA 3KFWX 4EGYA 1XSDA 1U6GA 2XAFA 2ZMEA 2VE9A 2ZJ2A 3REOA 2XAQA 1RUOA 3WTYC 2HFHA 3F6OA 5K5RA 2HKXA 3KCCA 5ICGA 4HYEA 1BI0A 4ENNA 1WKMA 1U78A 1SD5A 4LK0F 1J75A 3HSRA 3IRRA 4M71A 4P55A 4NHJA 3RYPA 4LJZF 1ON1A 1IN5A 2RV8A 4ESFA 4WK8F 2ZO4A 2DPDA 5LBQA 3F8NA 2K4JA 1OR7A 1KU9A 3E6BA 1P4WA 3DXJF 4GO1A 2P6TA 3MAJA 3QU6A 1U5TB 4BXUA 1SMTA 4JBAA 3U1DA 2ELHA 4LK1F 2IT0A 5H6RA 3P9KA 3FM5A 1FT9A 2E7WA 1MD0A 2L4MA 2FMYA 2K86A 2PLYA 1XGMA 2GA2A 1O3TA 1ZGAA 4HX7A 4OIQF 3GLXA 4WCGA 4OU0A 1IW7F 2E1NA 1HW5A 4S05A 1QZZA 1E2XA 2LF8A 4AIHA 3E5XA 1IXCA 5L3CA 5BQTA 1TW2A 5CLSA 3E97A 3F21A 1D8JA 2QVOA 1I1SA 1OYWA 2V1DA 1ZRFA 4LD5A 5AONA 3DFGA 5K1YA 2FBHA 3BY6A 1HW1A 3HRMA 2P7CB 1O57A 2XVCA 1WQ2A 2HDCA 3ELKA 2L54A 1BI1A 2VBZA 5LRSA 5DUKA 1C0WA 4MTDA 4KN7X 2M5WA 1G3SA 2VBYA 2KKOA 3HHHA 2QM3A 3F22A 4NQWA 1S7AA 1XMAA 2IA1A 1OPCA 1MJBA 1B4AA 1W7PB 2XHKA 4IPAA 1K6OA 4BQAA 2FU4A 2O03A 1P4XA 2W85A 2H94A 1XSXA 1R1VA 1SAXA 4LFUA 1OYYA 4A0XA 3F8MA 4XSXF 2Y75A 4MGRA 2MLKA 3QOPA 3I5UA 4OIPF 1J0RA 3W6JB 4G94A 2K02A 2FXAA 2DBBA 3G3ZA 4KUMA 4GYIA 5BOXA 4ON0A 3LQRA 1OMIA 1W4MA 2E7XA 4BHPA 1XMKA 2IJLA 3WTTC 1LEBA 1IRGA 2P5VA 2KJCA 2C6YA 1S29A 3TGNA 4EJUA 5FFXA 3LA2A 3Q9VA 4ETSA 3FXQA 3KETA 4ZYHA 1F4KA 3L9FA 1EH7A 5FO5A 5AIPA 3S2WA 2P5KA 5EEGA 3V7SA 2EFOA 2YX4A 5ILSA 2ZBKA 4QLCU 2OQRA 5JR3A 4KMFA 3DPTA 3WTZA 4S04A 3D5LA 4FT8A 3DPLC 3F23A 1YIOA 5ICCA 2HYGD 3IC7A 3JTGA 2OZUA 2A6HF 2IPQX 2VN2A 5FFZA 3GW2A 3G73A 3BROA 1JHHA 3KEOA 1YLFA 4XLNF 1TW3A 1Y0UA 3J80Z 1VTNC 3L00A 4FX0A 1T98A 4RGRA 4KMUX 1UFMA 2QWWA 5JVTA 4MTEA 4U7DA 1REPC 5D4SA 1JE8A 4GGGA 4KT5C 3L2CA 4LLNA 4EM2A 1W5SA 2EFNA 4I0AA 3I59B 1R36A 1RI7A 2PN6A 3U9GA 2HWVA 3N97A 1RNLA 2HZTA 5E8IA 2MH2A 1S8NA 1Z1DA 5HS9A 4XRFA 2BYVE 3KLNA 5L3GA 1ZARA 1H0MA 2M45A 3SHFA 1S3JA 1QNTA 1O7LA 2V1XA 3F72A 1UB9A 2QYOA 3EETA 4GXOA 1WSUA 4HOBA 1OYIA 4M74A 1I1GA 3BWGA 5E20A 4KA4A 2ZXJA 3BDDA 1KQ0A 3FHZA 2GIVA 2VONA 2UXNA 4EJVA 1YQAA 3ZP5A 2EJRA 1PP8F 4LG0B 2ZNZA 2O3FA 4L5JA 2YSRA 1XDUA 4HF0A 1E17A 3ZMTA 3SZPA 1CF7A 1F1ZA 3GWZA 3R6SA 3V8KA 2IVMA 1MKMA 1UHMA 5CVUA 2FRHA 5LHGA 2BEOA 2EK5A 1KU7A 4ZZDA 1ZN2A 2PQ8A 2VBWA 3MQ0A 2NS0A 1D3YA 3IHUA 2G9WA 3O3KA 5L3EA 1MGTA 1HXDA 2HQRA 1LB2A 1FBUA 2BE5F 1ULYA 1J5YA 1WRJA 1FNNA 5HS7A 2FNPA 3DEUA 3GO5A 2FF4A 3Q9SA 4OMZA 4D0PA 2M87A
chains in the Genus database with same CATH superfamily
4HDVA 2GQQA 3SQNA 5C4XJ 2IRFG 3F3XA 1XTAA 3AAFA 4G8XA 1G59A 3A1YA 4R1HA 4ZYDA 4KN4X 2V1NA 1I5ZA 1FMVA 1H8AC 2HDDA 5FKKA 3T1BA 4FE7A 3NAUA 3FKIJ 3VFZA 2OD5A 1LNWA 1J09A 2JTVA 2RAEA 4YFNF 1T33A 3C2HA 4X6AJ 3KZYA 4UXNA 1K79A 3CC4I 2XKPA 1I50J 3K4CA 2R7VA 4C3HJ 2WADA 2ISYA 3C18A 2HTSA 4EV0A 3MKLA 2DT6A 2JSCA 2L7FP 1W0UA 3DKXA 4RGUA 5GADJ 1R5HA 4BJ5C 4MQVA 4ANJA 1GV5A 4BGDA 3OYKA 2HTJA 4N4OB 1GVDA 3JSPA 2EZHA 2XGDA 1Q1HA 4R8HA 2JJ7A 5J40A 5B66C 3K4MA 2KHMA 1V5FA 4AC0A 1KQ9A 1X2NA 2ZJQF 2LY9A 5E8GA 1DU0A 4HV5A 4KYWA 5F08A 4M9XA 3I55I 3QP5A 3TDUC 4O5VA 4BACA 5EEHA 3OIPA 4BY7J 2DQLA 2F5FA 3CUQB 4BQQA 3O8HA 5DCMB 1MH4A 1XB4A 1FOKA 3G1LA 4CH7A 4FETA 4CUGA 2UUZA 4RB2C 3EUHC 1SFEA 3CCVI 3W2VA 2VIXA 2WB1A 2CUFA 1JKOC 4F52A 2DK8A 3VWBA 4YFXF 2R3SA 1LFPA 2Y0MA 1JTYA 1XG1A 3AL0C 1LDKB 2BXYA 2OA4A 1GXPA 2QQ9A 3MZHA 1NHAA 1SFOJ 3UKGA 4HF1A 3LSGA 2HYFA 2M7AA 2LP0A 4L0YB 3HTSB 3B02A 1TWAJ 3KLOA 2JSPA 5ILVA 2RQPA 3BOQA 2W00A 4LIVA 2UV1A 1OKRA 2A5WA 5M5XJ 1FTZA 3I0TA 2NVQJ 4HF2A 2CQNA 1EH6A 2BV6A 4MEYF 3QRFF 2MC4A 3WGHA 2XKOA 5CVVA 3AKZA 3EQLF 1OLTA 2FJ1A 1F5TA 1D0XA 1BOAA 2LMDA 1ZRCA 2Q2EB 4M73A 1IRFA 3ZCOA 2VT2A 3CESA 1YX3A 1ZKGA 2WA0A 4XLCA 3LFKA 3TO6A 2QEXI 4B44A 1R1UA 3KP3A 5EF6A 1SFKA 1BC7C 5FGMA 4AU7A 3KYCB 1HW2A 1MMAA 4XMYA 4UB6C 4DGWB 3N4MA 2ZXWH 3TOBA 4U0VA 2R7QA 1W36D 1QQIA 3OR1C 3D0SA 5DD4A 2Q0OA 1WJ5A 1TWHJ 3BTCA 2CWEA 1M1EB 2MD0A 2VXZA 1YJ9I 1PUFB 5HDGA 1JT6A 3O2PE 3R60A 4BDZA 5CVIA 2EH3A 1HSJA 3DBHB 4CCMA 1J7KA 4A2UA 4NBQA 2M30A 3TMOA 5EGOA 1A31A 3TW6A 1WCMJ 3JRAA 5BMZA 2JUCA 3HOYJ 2OJED 2VJ4A 3I9V2 1S9HA 2DO7A 2X6XA 3QP6A 4XBFA 4AD9A 4BE2A 2CFXA 3SFZA 3I64A 1HCRA 2HEOA 1YW8A 2VJIA 5C44J 1ITYA 2ELKA 5DD8A 2V79A 3K4BA 2XAGA 1I39A 4X1EA 4Z2YA 3ZR8X 2IA0A 1X58A 3SXYA 4A3FJ 3ZRGA 4JQFA 5JLXA 4BE1A 1VF9A 2BY3A 1BA5A 4P9UA 4B3XA 3FXMA 2NNNA 4IRGA 4IZZA 5FRMA 2JA5J 2E1MB 2H8RA 3W2AA 2R7ZJ 2H09A 4XK4A 3X2QH 2K27A 3ZMDA 3CCJI 4HPQA 5D8LB 3W3CA 2NVYJ 1MMGA 4WXHA 5IYDJ 1U9OA 1FLIA 4RB1A 3BTLA 5LHIA 4ZC3A 3V42A 2V6EA 2RVCA 1HDDC 2RGVA 1MZBA 2JPCA 3ASOH 3BR6A 1N77A 4PGGA 2TCTA 2OTLI 1JHFA 4PJLA 4B1RA 3FHNA 4E7KA 3TDZC 2WB1N 4XN3A 4RLQA 1YW9A 3JRIA 3DKWA 3S15J 1BI3A 3NEUA 5FKNA 5FLVA 2F5CA 3E3VA 3C2BA 1XCBA 4G7OF 4OAZA 4BS9A 1ODDA 4EM0B 1UZCA 2ID6A 3H3ZA 3ESWB 3LSMA 1F9NA 3M4OJ 4L9NA 4UVCA 5F6FA 3C2GA 2HQNA 4C30A 2R7SA 3RPQA 4KNYA 2O61A 4F91B 5CQEA 2G0EA 3SEQA 3T5XA 2E36A 5J8CA 4UUVA 2JA2A 1WJCA 5FLXK 4YIFA 1SD4A 2KIFA 2ZXHA 4HDUA 2KRCA 3ZN1A 1UMQA 4RGSA 1FX7A 1Y6IA 2Y48A 1MSEC 3MEXA 2E1CA 5HDNA 3S3NA 2AS5F 2Q8KA 4D7NA 1XDSA 5FKOA 3O8GA 4JP0A 2XAJA 4MNUA 2NS8A 5IY5H 4LITA 1Z7UA 5F1RA 4L18B 4P96A 3EUAA 1MDMB 3S2DJ 2LD5A 1W0TA 3S14J 3R61A 1OCTC 2GXGA 2EA4A 4Q48A 4MFDA 4E7JA 1FEXA 4ENJA 2WBMA 4DQ2A 2GM4A 2D2WA 2XUBA 3K4NA 2CW0F 2WC2A 3JRGA 1YOVB 2HKOA 2VC1A 2LKPA 1BW6A 1LVAA 2CYYA 3G71I 4A0YA 2EZIA 4A12A 3CUQA 3GTMJ 4QIWN 5ED4A 4I09A 1UELB 2WWYA 1T0FA 4MHGA 1IUFA 4Y4RA 4CO8A 4IX7A 2XDVA 4IL6C 3V7RA 3LAPA 2AHQA 3DTKA 4XOTA 2MBFA 5FLXZ 5JHUA 1BR1A 1MBJA 3SZTA 2QUFA 2DJNA 3ZQQA 1DU6A 5AIQA 4XONA 3DV8A 3OYNA 5HLIA 2KMUA 2F2EA 2NVUB 1G3TA 2G7HA 4BXFA 2FA5A 4HNVA 3PQJA 2M4GA 3OS1A 1Z3XA 2AXLA 5EZHA 4ZH4F 1IXSB 3GX4X 1SFUA 1JKRC 5F0CA 2HR3A 4JX4A 1EJ9A 2A07F 5HLHA 4P1WA 2X6YA 1VQKI 3OYAA 1L3LA 1FC3A 4D1QA 4M6XA 2VQHA 4DOZA 3F9KA 2VODA 2ICWG 2EB7A 2BXZA 4L9JA 1KU3A 3BPVA 5E17F 3PUBA 5ILUA 3HUGA 2M4KA 3BG5A 1DGRM 4A5MA 1OFCX 3DEEA 3EDPA 3TKYA 5E3MA 2DLLA 2K9NA 3BG6A 1JTXA 2OZ6A 4BYYA 3QPSA 2RDPA 2BW3B 2HNHA 3HEFA 3M07A 2A61A 2DN0A 1T95A 4CSWA 4X0GA 3MN2A 4YFKF 4I02A 3HDDA 1UHWA 2FNAA 3CC7I 2KP6A 1FSHA 1X2MA 4PZJA 4LGWA 3OYIA 1FYMA 1GHCA 6PAXA 2X0LA 2P6SA 4XLEA 2XGXA 2IGNA 4UV9A 2LREA 1BIAA 3JCUC 3L7WA 4UVBA 3KP7A 3GYHX 2O8XA 2PFBA 5L3DA 2DFIA 1U9NA 4B09A 1UCRA 1O3SA 1B59A 4OIOF 1VQMI 3VSKA 3E6DA 4BKXA 2XASA 2VPLA 4IRHA 4UY8I 1BI2A 3GUDA 2ZCWA 3OOPA 3BLYA 1B9MA 2P8TA 4A3LJ 4A93J 4ENMA 3ONQA 2XRNA 3OYGA 2Z33A 5FKMA 1HDPA 1K78B 2DTZA 2ELJA 2ME0A 2GBYA 2EIKH 5BNGA 2HQAA 1VQOI 4KISA 2E5NA 3CCSI 3FXLA 2H6BA 4W1UA 4AWXB 1FZPB 1LPQA 1TP4A 2ZFWA 3HL2A 2WTEA 2MA3A 4E4HA 1ZLKA 2KQRA 1IDZA 3FK6A 4II2A 1K61A 4MEXF 1HF0A 1QBJA 2QBYB 3DP7A 3S1NJ 3ABMH 3CP8A 4B43A 4CYCA 2NYXA 4WXCA 2MYSA 1Y39A 1TT5B 3ERED 4HNUA 2V7FA 1DGWY 1JJ8C 1TQPA 2CMPA 3LWFA 1K6YA 3ZMVA 5EG0A 2B7EA 3Q5FA 2ECCA 4RAYA 1I3AA 5J1UA 1TT0A 3K6GA 5CVJA 2D5VA 2VKHA 5F1JA 4EVIA 1ETWA 2EQRA 4RB0A 3LSTA 4BQNA 3FM3A 3DCFA 3IL2A 3WU1B 3IWZA 3OR2C 3ABUA 3ABKH 2EA2A 1LUJB 1PDNC 2EZLA 2KIMA 1U5TA 4XORA 4KITB 4N4NB 3U21A 2QKLB 4ZTJA 1X3ZB 2M2EA 1WPKA 3TEDA 1D1CA 2JVGA 3VB2A 4Y7NJ 3M8EA 2COBA 3TW7A 1E0EA 2FUG2 2L7KA 4BUPA 4ESBA 5TISC 2LC2A 4DZJA 1XC5A 5LGTA 5EDNA 4UVAA 4XKWA 1X1PA 1VZ0A 3KYDB 4RLFA 1X19A 3L2WA 1QHGA 2Y0SA 3GZ5A 1QPMA 1LVKA 2P5LC 1ZG3A 5HLTA 3BJ6A 4HLYA 1NK2P 1P92A 1NTCA 2EILH 2VE8A 4PSXA 3WU2C 1OISA 2R7FA 3HOVJ 5GPCA 2FQ3A 4XRSA 4XRMA 1R58A 2W84A 1P6RA 4G7ZF 5TRDA 1MDMA 2QQAA 2DFHA 4OINF 1R22A 2O9LA 1YHQI 3FXUA 4C3JJ 1VQ8I 3CLQA 4HZFA 1WHUA 4M9ZA 3BCBA 4OWRB 3VDXA 1CQTA 3S3OA 1Y8RB 1T39A 4DNCA 1OCPA 1L0OC 1XPXA 1IN7A 1XGOA 1T6SA 4MO7A 3WG7H 3L2UA 2WY8Q 4A3DJ 3S1MJ 3A4CA 5TGTA 1ZK8A 2P4WA 4WWCA 5H6QA 4ZYEA 1MBHA 5F0HA 3WTVC 4NDLA 5FRNA 3KP6A 1GV2A 2XRLA 1WJEA 3VYUB 2Y2ZA 2ISZA 3MKWB 3BJAA 2XB0X 1RKTA 5GAHJ 4M72A 5LLQA 1RR8C 4KT6A 3BZ6A 2LRDA 3ROUA 1LKXA 4EMSA 3L09A 3HOXJ 1DP7P 2Z99A 3HRSA 4HV6A 5K5OA 3QODA 3TP3A 2H27A 3S17J 3RCOA 1KONA 4FCYA 2FE3A 4UUSB 1B72B 3DTEA 4RA2A 3DPUA 1JJ6C 3PO3J 1JGGA 2QENA 3S32A 1QZYA 2R7DA 1SD7A 3OL3A 4CHUA 3I3LA 5D5WB 2K9LA 1W7PA 2ZFUA 2FD5A 3WODF 4AUXA 2A69F 3BCAA 2YPRA 5HOOA 2K7LA 1BL0A 3JRHA 4BQOA 2M8GX 1SVMA 2EV6A 2FOKA 4HRIA 4GRIA 1YW7A 1UHSA 3M7GA 1ZH5A 5F04A 2JA8J 2ZMEB 4E7LA 4IQ4A 2DA5A 2GZWA 4M6VA 4ZZLA 1Z9CA 1SFXA 3FXKA 3RDIA 5K7FA 2EFQA 5FKLA 3OY9A 1VQ7I 1TWFJ 2X1CA 4MQ9F 1YRNB 1SD6A 3WHCA 1UJ8A 2GIZA 4G9YA 4A6EA 3HOZJ 3FX3A 4LG3A 4H0EA 1SVLA 3E5UA 1KA8A 2M3AA 1VQPI 1G3WA 2OCCH 5GP9A 5D5XB 5JFRA 1PP7U 2V26A 2Z2SB 3E1SA 2E1OA 3WTXC 2AQEA 3ZQIA 2D45A 1A35A 1OCCH 2OC6A 4EJOA 1NK3P 2DQRA 3PL8A 1LE8B 4HAMA 4Q47A 2FSWA 5HLGA 1TQMA 2L3DA 1DPUA 2BY0A 2QSFX 3H0DA 4I99C 1IN4A 1LDJA 2X51A 3MCZA 3QYEA 1XCVA 3RZDJ 4OMYA 3BTJA 1K7AA 3SYTA 3DTIA 4W97A 3B6AA 3ZQ7A 3LSJA 4BEHA 3HTUA 2Y0SN 1TC3C 2UXXA 3S8PA 4A3JJ 2DT7B 3M9AA 1MIJA 4KICA 2YU3A 1RIOH 5L3BA 3H0GJ 1V4RA 1IF1A 1S6LA 1GDTA 3MWMA 3Q3SA 2RC4A 5DM7F 3HSEA 2XPUA 3T8RA 2XAUA 4B4CA 5JVGF 2MG4A 2IP2A 2V4JC 2R5YA 1V5EA 5GAEJ 2XROA 2HOTA 2KT0A 1IUYA 4WX9A 5DUIA 3CJTB 3GCMA 4BDYA 1ZG5A 2EWNA 2UZKA 2ZNYA 3F8BA 1BJAA 1A5JA 4CCJA 1Z7LA 1VQ9I 2ACJA 1Q1VA 5LHHA 3VYTB 4I2OA 1AU7A 2R93J 5FD5A 4LOCA 2DPUA 1R00A 4XSZF 4GCVA 4XOPA 2TDXA 5F27A 1X4PA 4LLLA 4L9VA 2IGKA 3DKYA 2KLOA 4A6DA 5LRRA 1U3EM 5CPRB 4HSRA 3GMEA 4Y52J 1OCOH 4C3IJ 3HXLA 4L0ZB 2FX0A 1AWCA 3CTAA 2LBFB 2JWTA 4WXDA 1X1BA 1YX5A 4PSWA 1DUXC 3Q0VA 2XPVA 4XM3A 2QKMB 4JX6A 2ZXIA 1F36A 2GOMA 2DA1A 3H36A 4ZDPA 2I5UA 3DF8A 1R23A 4XL9A 1T0FC 2STWA 4B8XA 2P7VB 4P9FA 3ZQLA 3CUOA 5KK1A 4EQQA 2IS4A 4HX8A 3M1EA 4LLGF 2TRTA 4DZPA 2JRMA 3I59A 3NWSA 3IV5A 2BVMA 1I27A 4DYCA 4OAYA 4Y13A 3GVAA 3CJQB 1Z6RA 4L5EA 2VI6A 4CCLA 1GT0C 4U88A 1SMYF 4EEFG 2V9PA 1R7JA 1JUSA 2KISA 2IEKA 3BJOA 3IWFA 2ESHA 3D1NI 3CCYA 5BPIA 5LGNA 4BAYA 1USSA 5H20A 4E70A 4KIBA 3W6KB 4C9YA 1D8KA 3DU5A 3P9IA 5TJJA 3OSFA 3AL0B 1YS7A 2ZSIB 1XN7A 4YELA 5M3FJ 2A05A 3WU0A 1BC8C 2JMWA 1FJLA 4I6ZA 1IDYA 1IXRC 2DAOA 1ETQA 4ENKA 1IAWA 4K2EA 1IN8A 2W25A 5DCFA 2F5EA 3HB9A 1TZLA 3ASNH 2HOAA 2L2OA 3IKVA 1S7OA 3QWLA 4RB3C 2PI0A 1UG2A 3W6VA 4NQWB 2JRTA 1QPIA 5LGUA 2W1OA 1ONVA 1EV7A 2CH0A 3BZCA 3F6VA 5IP7J 3FF5A 1WH5A 5H2FC 2VLAA 4L5IA 4FTHA 3H3VK 4YG2F 4AVPA 3K70D 1KYZA 3PIOF 4E7ZA 2EV5A 1QVTA 4IHSA 1USTA 1QZEA 1YJNI 2E60A 3ZQGA 4LG0A 2JPBA 1MNEA 1P9QC 1KU2A 2M8EA 3HJEA 1WWXA 3GFMA 5E3OA 2H1KA 3FMQA 5E3LA 4CZZA 3CDLA 3ZMUA 2W7NA 3P7NA 1TLHB 3VODA 4PFOA 3QAHA 1T2KA 3A0HC 4F7ZA 4UNOA 4PCQA 3LSHA 4QSHA 2YR2A 2YS9A 4FE4A 1T56A 2JVHA 4QWQA 4DYQA 3VOEA 2DI3A 1KGSA 1HKTA 1FBQA 1FIAA 3GTPJ 2VXDA 3HBLA 1RC9A 4RAGA 3MKZA 1RUNA 2MFZA 2XC7A 3CO7C 4KFCA 4M9SA 5CYVA 2VT3A 4KDPA 1XSVA 3FK7A 2BY1A 1PVEA 4ITVA 1KZHA 3OYEA 3K2ZA 2OQGA 3OYMA 4AYBA 4XICA 4U0WA 2VOPA 3BZKA 5CVRA 4EM1A 3RI4A 1EF4A 4ASNA 5FLMJ 4CDGA 3TO9A 2E19A 1NH3A 2YX7A 1MNDA 3CLOA 3UR3C 1D1AA 5D8KB 3ZQCA 3HOSA 4IOAF 3E6MA 2J5OA 4GYGA 9ANTA 1ZELA 1GVJA 2Y30A 5HS8A 4IHYA 2L0KA 2XAHA 1B8IB 2R7OA 1V3FA 4PDKA 2CW8A 2IW5A 2CU7A 3OMYA 2PMUA 3J81K 2K40A 4J01A 1B9NA 2OCEA 3K4LA 4E7SA 4BHCA 4HA8A 5JHFA 1O4XA 1U5TC 3BR5A 1Z05A 3R0AA 1MJ9A 4PJNA 1G6NA 3JAMK 3HRTA 3V7CA 3BC8A 2L9NA 5J1RA 3RKQA 3WG9A 4MIMA 1FYLA 2W82A 3E6CC 4I0BA 4BE0A 4NUBA 5BS6A 5F64A 3JSOA 1MMNA 3QPHA 2VQGA 1W5CC 3GFLA 1IV8A 4V2GA 3HHGA 1AA7A 2DTRA 4GDFA 4RAZA 2V6CA 2Z5UA 3CMEI 4PUSA 1A04A 1JKPC 2NOGA 4IKFA 4CXFA 1IV6A 1WFXA 5DTDA 1CGPA 2KIUA 1X1DA 3LMMA 3COAC 2EV0A 2XSDC 1ERDA 3L2QA 1FSEA 3BR2A 2P81A 1F43A 2EFPA 2KRHA 3M3YJ 5E3NA 2KIQA 1IN6A 1BBYA 4R79A 2V9VA 2NRAC 3WE3A 4CZCA 3HYIA 2IS1A 2W57A 5IP9J 3J81Z 2O7OA 3PFYA 3OYCA 5HVQC 2GWRA 5E1ZB 3A0BC 2M7BA 1ON2A 1ETKA 1X3UA 3M8FA 3JAMZ 3OYBA 3CCLI 4ZDLA 1SVOA 1K83J 1QGPA 2DMNA 2MC3A 2LBFA 4HLXA 1FWZA 5DCMA 5KVRA 2D1VA 3OSGA 2EINH 3VYRB 3CZ6A 5HDKA 2CUZA 4A5NA 3CMMA 4M3BA 3WGIA 4F55A 2X1DA 1X4OA 1R1TA 4KIGA 1RRJA 1WGXA 1T8IA 2AQFA 2LVSA 2VKVA 4RMNA 2BHZA 2K4BA 4FX4A 4U7BA 3K4KA 1YS6A 1GLNA 2R92J 1XD7A 1N75A 1ZQ3P 5JLWA 1WJAA 2G7UA 3FMRA 3VPRA 3CO6C 3MZYA 2R0QC 5M5WJ 1VQ5I 3EUHA 4IHWA 1IRXA 1EKEA 5FROA 2Z3YA 2HVSA 1JXSA 2VOOA 3V8LA 2VJJA 2PJPA 5GTIC 2VQLA 3H92A 1ZRDA 1Y8QB 4IXAA 1ZG1A 2DU9A 2B0LA 1BN5A 1ZHFA 4N9IA 1FOXA 4FHTA 1NG7A 2NOJB 1FP1D 5LEKA 2Q2EA 5E79C 2BVLA 4BXXJ 3IP4B 2QF7A 3GFIA 1XGNA 3B73A 4AYBN 2L02A 4NB5A 5IPAA 2OU2A 1APLC 4IHTA 1IC8A 5JI6A 3I4PA 3R4KA 4TV7A 3SDGA 1X1CA 3LNQA 3GXOA 4XLPF 3HOWJ 2PBIA 1ZYRF 4QTRA 4A69C 4HQEA 2I10A 3KEYA 2Z9OA 5D4RA 2EFWA 2VB6A 4PGHA 3MD2A 1FP2A 2JZYA 3OYHA 3OV8A 1CF7B 3K1MA 4Y17A 2DW4A 1B1BA 1BR4A 1QO0D 2X4HA 1BW5A 3K9TA 5IOZA 2ETHA 3RKWA 1PUFA 1FTTA 2EBIA 1WVRA 1XS9A 1DDNA 2A6EF 2L01A 1TNTA 4CYDA 3M8JA 4BH9A 3PFIA 3TOAA 1POGA 5K7ZA 3JW4A 5B1BH 5D5VB 2B9SA 2QLZA 4IJAA 3J7AO 5DDGA 2JQ7A 2ME6A 3K69A 1HKQA 3IH2A 5LD2C 3K1PA 2CV2A 1J9IA 3ZN0A 4PJ0C 4ZYGA 4DBRA 5KHDA 4LB6B 4I76A 2E5ZA 3RYRA 3H3UA 2E71A 2BBYA 1XMXA 4XN0A 4C2MJ 3KIOA 1K4SA 3FMSA 2D1HA 5J8FA 2GA1A 3GEZA 3T0YA 3V4GA 1BIBA 1YG2A 3QYFA 2CUEA 2MABA 3JR9A 3OWTA 4LMYA 4RBOA 3H9JA 2HI3A 3PM1A 4M3FA 5BPDA 1MBKA 3L2RA 5L3FA 4H4KC 1JT0A 1TNSA 4G6DA 1W36C 1G2HA 2GXBA 2PMZA 3J80K 3I4NJ 2GOXB 2M1BA 5E18F 2KRFA 3KEQA 1FYKA 3FXOA 1ZR2A 4C2UA 1B8IA 2H6CA 3GBGA 3RQIA 3TQNA 3ZPLA 3HOUJ 3Q0UA 4KIFA 3BPXA 5GTHC 5M3MJ 4P5OA 2R7XA 2O5RA 3OYFA 2NXNB 2DMTA 2MD5A 2K3FA 2Q1ZB 1ZR4A 1J59A 1OCRH 3F0CA 4CGZA 1X1AA 1YFHA 1ETOA 2VKDA 5GPAA 1YE9A 2WAQA 4RM2A 4M6YA 3T8TA 4G7HF 1HKSA 4F3QA 5E1XA 1VQ6I 5ICFA 4HW0A 2PMHA 3H5RA 3K0LA 4FQGA 3OS0A 2RNJA 2W24A 3ABTA 3MMYB 4M3EA 3G1MA 1XX5A 3QPTA 3C7JA 4EJTA 2LDUA 2HOEA 3BQZA 2PX9A 3CP2A 2KZGA 1GXQA 1I3QJ 2LYCA 5ERIA 4OOIA 1B6AA 2H1LA 4NC8A 4PFPA 2QA4I 1T38A 1HSTA 2HU9A 3OL4A 4JYKA 3I58A 3H5NA 3ZOBA 2LLKA 2O0YA 4UV8A 1I6XA 3KZIC 5K5QA 3O6BB 2N8GA 2OBPA 2QSGX 2W48A 3RPUD 3G2BA 2CW7A 2A3SA 1STZA 2NAZA 5DYMA 3ULQB 1LJ9A 2IAIA 2I8DA 1FY7A 3RKXA 2LF7A 2ESNA 2CO5A 2OPTA 4AIJA 3SFIA 3RPUA 2DK5A 4D5FA 2VKEA 3LL7A 1V5GA 3TO7A 5FD6A 2CUJA 2LY2A 5C3EJ 4NC6A 4LB5A 4DJAA 1Z3YA 3BG3A 2L7MP 4ESJA 1TQIA 4A3IJ 3KX2A 4E7IA 3KZZA 4DYRA 3LSPA 2WY7Q 3CCQI 2CGPA 3ABLH 4XR6A 3RJPA 2DA4A 3HRUA 1RR7A 1RZ4A 1ETYA 2MLGA 4Q4ZF 2JUGA 2V1UA 2QGUA 2X9DA 2XGEA 3I71A 2F5VA 1U8RA 1ZREA 4ABZA 2X48A 4G6QA 3PUFA 2ADUA 3CCMI 3GTGJ 1D5VA 5DV5A 4S0HB 1JGSA 1JKQC 1VI0A 2W4SA 1ZAOA 2GXAA 1MBGA 1WJFA 3ZQHA 2BY2A 2OAZA 1YYVA 1HQCA 2PG4A 3E5QA 3WTSC 1AOYA 4A3GJ 1S72I 2M0CA 1OJLA 3BQYA 4BBSJ 3ECOA 5M5YJ 3IRQA 1TL8A 1KQ8A 1FPQA 3LA7A 2VC0A 4XQFA 4YIIA 2CQKA 2WV0A 3QPLA 4L9TA 1MJAA 4AIKA 4IHXA 3A2KA 3BP8A 4HSTA 2DMUA 2WV1A 2DJIA 3FWEA 2IA2A 4I01A 5ICEA 4MLOA 2A6TA 4BL0B 3GZNB 3KP2A 1BM9A 2JT1A 4UHTA 2HOSA 1QHHD 3PO2J 1LFUP 2CS3A 3DLLF 2MGQA 3J7ZI 2PMZN 2DDAA 2BW3A 2RQQA 5IYBJ 4ZJZA 4RDUA 3IKTA 3IAM2 5IOYA 4A3CJ 1FBSA 1YI2I 4AM3A 3HZJA 3JTHA 4I98B 3HGYA 2KDOA 1HA8A 3ZMSA 1P4AA 3LAJA 3GZ6A 3DU6A 1MH3A 2M9HA 3HM5A 3I4MJ 1R5GA 5DEQA 3ECHA 1H9GA 2BOLA 2LKSA 1WJBA 2A5YB 1O3QA 2H8WA 3SZGA 1U2WA 5DM6F 3WTWC 1ETXA 1TWGJ 4Y33A 4B47A 2WAQN 4XKCA 1S5LC 1ZTRA 2DODA 5CJ9A 3EYIA 3GTQJ 5D6EA 1R5ID 4DBQA 3JRDA 1ZLJA 5B3SH 3CMYA 3OIOA 4CCNA 1Z0XA 1FOWA 1YO5C 4XNFA 5B5EC 1U8BA 1K78A 2UWMA 3ERMA 3LA3A 2XF6A 4U0YA 1S7EA 4IF4A 1J2XA 2HVQA 2HGCA 3LFUA 3H5AA 2Y9YA 3W2WA 1W1WE 2VJ5A 4BJTA 3P9CA 3WTUC 1G4DA 1A36A 2R7RA 2GLOA 3LSKA 1WZ2A 4BU2A 2QBYA 2KL4A 2M0MA 5E1WA 5IT9K 5C4JJ 2PEXA 2GAUA 3BG7A 3S2HJ 1R4NB 1HLVA 2Z16A 4RGXA 1FMWA 2YU9J 3NRVA 2ZKZA 1K4TA 2MH9A 1IRZA 2XGCA 4MFEA 4BBRJ 2XIGA 5J1YA 2IXSA 3I54A 1ZGWA 4II3A 3PJRA 3CD6I 2MW8A 4B48A 4EGZA 3HG9A 5HNFA 3UNGC 2X85A 4HBLA 3PQKA 3R0JA 1E3OC 3I53A 2HPIA 3OYLA 2NNYA 1W5TA 1WI9A 3LQQA 5D6FA 4C2TA 3HSFA 4EATA 2NVTJ 4G6TB 4I7HA 3VEPA 1U0JA 4A0ZA 1MMSA 3Q0WA 3FXRA 2Y69H 3ISPA 3CUQC 4JK1X 2F4IA 3JRCA 2DA6A 1OQYA 3V8JA 2FBKA 2LNBA 4IVNA 4DIQA 2QZ8A 2LSOA 3RKYA 2A68F 5IT3A 5J6XA 1LDDA 5IT9Z 1LEAA 2CJJA 2DYSH 1W7PD 3S3MA 2HQ5A 2KJBA 3KP4A 2K5CA 2CV0A 1LFBA 2RKHA 4O3MA 2HS5A 1O3RA 1RPWA 2DT5A 2R7TA 3GF2A 1PUEE 3K2AA 3RIRA 4ZYAA 2EIJH 2L4AA 1XGSA 1VNDA 2DCEA 5A2QK 2E2IJ 2F5DA 2F4OB 2IBDA 2XV4S 4RS8A 1R6RA 1H9TA 2DDBA 2KFDA 5HNHA 4IRIA 4EJWA 1HOMA 4Q5SF 3U2RA 3HIFA 3H35A 2LK2A 4U87A 3GTOJ 3QU3A 4CICA 4HX4A 2DOEA 2FMLA 1DPRA 1Z91A 3C1DA 2XSJC 3WE2A 5EEAA 2R7UA 1OCZH 1N78A 1TTYA 2Y31A 4OIRF 3HOTA 4BNCA 3FZVA 3HKZA 4IO9F 1PJRA 2HXOA 1WH7A 5K7HA 1O7FA 3QQAA 2FEZA 3AG3H 2STTA 4Y15A 3KE2A 1Z6TA 3F8CA 3CJNA 4WF2A 1ZGJA 3KPHA 2CSOA 1LQ1A 2R5ZB 1IZ1A 3KP5A 3F8FA 2L7ZA 3DLAA 3J7AY 1D5YA 1P2FA 1UAAA 3PNTA 4A3BJ 2J5PA 3MFKA 2HPMA 4J19A 2LR8A 3JREA 2VBXA 2ZSHB 1YTYA 4DW6A 1KYWA 3GFJA 4N0BA 5FB2A 5KAIC 4XLAA 1BJZA 1Z67A 3HUGB 5D5UB 5A2QZ 1R9TJ 5LEJA 3ML6A 2JA7J 2DFEA 4UUSA 2RN7A 1B72A 1HBXG 1E3PA 1TBXA 3K1NA 4O6JA 2BGCA 3RTRA 3CDHA 3C3WA 1R71A 3EPZA 3CJRB 1EH8A 2JK3A 3FBIB 4N9HA 3WGGA 1G3YA 3ZMZA 2QQBA 3EYYA 4BHBA 2CG4A 3NQOA 2O6GE 2BZTA 3DQVC 4HQMA 2COMA 2FBIA 2B63J 3DBRB 3KFWX 4RAFA 4FASD 5B1AH 4EGYA 2DXIA 4BJ6C 3N05A 2F4MB 1XSDA 3VSLA 1U6GA 2ZB9A 2XAFA 2ZMEA 2VE9A 2ZJ2A 3L2VA 2AO9A 3REOA 1HC8A 3FDYA 2EZKA 2KPMA 2LFBA 2XAQA 1RUOA 3WTYC 1YRNA 2HFHA 3G6EI 3F6OA 1VFCA 5K5RA 2HKXA 3KCCA 5ICGA 2ZJRF 2JA6J 3CMAI 2E1MC 4HYEA 1BI0A 4ENNA 1WKMA 2KZVA 1U78A 4XIDA 1UG0A 1SD5A 4LK0F 1J75A 3HSRA 3IRRA 2HZDA 3QYBA 4M71A 4P55A 4NHJA 3RYPA 4LJZF 2K9MA 1LE8A 1ON1A 2AXTC 5HODA 1IN5A 5LFAA 4CYCB 3P5JA 2RV8A 1MBEA 4RM3A 2JN6A 4ESFA 2ZO4A 4WK8F 2DPDA 3OIQA 1NG6A 3HC7A 5LBQA 4YEJA 5EG0B 1D1BA 3F8NA 3CC2I 2K4JA 1OR7A 1TWCJ 4PJMA 3JRFA 1KU9A 4D7MA 3TL4X 3E6BA 3GTKJ 1P4WA 3DXJF 4IOCF 3ZXSA 1A6IA 2BHYA 3I56I 3PSIA 1IGNA 1RKWA 4GO1A 2P6TA 3MAJA 3A01B 3QU6A 3WHBA 4XKVA 1U5TB 3JRBA 3CDIA 4BXUA 1SMTA 4JBAA 2IS6A 1BR2A 2OV7A 3IH3A 3U1DA 3S1RJ 2ELHA 4LK1F 2IT0A 5H6RA 5KAFC 3P9KA 3K10A 1RESA 2XPWA 3FM5A 1FT9A 2E7WA 2QSHX 1MD0A 2L4MA 2FMYA 1H89C 2K86A 2PLYA 1XGMA 2GA2A 1O3TA 3HKZN 1ZGAA 4HX7A 4JX5A 3A02A 4OIQF 2ZJPF 2ECBA 3GLXA 4WCGA 4LIUA 4JOMA 4OU0A 1IW7F 3OOUA 2E1NA 3MKYB 1HW5A 1MW7A 2MSYA 4AIDA 4S05A 2X1EA 1QZZA 1VQLI 5F0FA 1E2XA 2LF8A 4AIHA 2M34A 3E5XA 2CQ7A 1P7IA 1IXCA 5L3CA 4FISA 2NS7A 3NWTA 2DYRH 3ZQFA 2R4GA 5BQTA 1ACIA 4AVZA 1ORKA 2XF7A 1SC7A 1A6QA 1GUUA 1TW2A 3AG1H 5CLSA 3AFHA 3E97A 4NC7A 3F21A 2HDWA 1D8JA 2DA2A 2QVOA 1YITI 1I1SA 4CA0A 1IG7A 1OYWA 2V1DA 4KJZA 3EUKL 3MVPA 1AKHB 2DMQA 1ZRFA 4LD5A 5AONA 3DFGA 5K1YA 2FBHA 5EYRA 3BTIA 3BY6A 1HW1A 3VYSB 4CCKA 1MSFC 3HRMA 2P7CB 3A03A 1O57A 3B6CA 1EA3A 2XVCA 1WQ2A 2HDCA 3ELKA 2L54A 4PJJA 1BI1A 1PYVA 2VBZA 5LRSA 2K9QA 2CV1A 2Z1DA 5DUKA 1C0WA 2FOWA 5J4VA 2K85A 5KCMA 4MTDA 4KN7X 2LY1A 2M5WA 1G3SA 2VBYA 2KKOA 4A3MJ 2P0WA 3HHHA 2CQQA 2QM3A 2WAEA 1JI8A 3F22A 1I6HJ 4NQWA 1S7AA 3MZ8A 3SJMA 2R7WA 1QU3A 1ETVA 3DBLB 3DWLE 1XMAA 2HYJA 2ID3A 2FQ4A 2IA1A 2R5ZA 1OPCA 5CKTA 2DMPA 1MJBA 3RQ4A 1B4AA 1W7PB 1BOBA 2XHKA 4IPAA 3OYJA 1K6OA 3GTLJ 1RETA 2LTPA 4BQAA 3CF5F 2FU4A 2O03A 1P4XA 3CF2A 2W85A 1YIJI 3HGGA 4GFBA 5J4YA 2H94A 1XSXA 4HNTA 1R1VA 1SAXA 4LFUA 1OYYA 4XLFA 4A0XA 3F8MA 2L9VA 4XSXF 2PJRB 4A3EJ 1V55H 2Y75A 4MGRA 2MLKA 3QOPA 3OS2A 3I5UA 4OIPF 1J0RA 2E2HJ 4XLHA 3D5RC 3W6JB 4G94A 1QRYA 1MNMC 2K02A 3CCEI 2FXAA 2EPFA 3U1KA 2DBBA 3G3ZA 4XRSG 4KUMA 4GYIA 5J3LA 5FJ8J 5BOXA 1WI3A 4ON0A 4Z6YA 3LQRA 1OMIA 2V9KA 1W4MA 3KYLA 2E7XA 1DP3A 4BHPA 2X6OA 1XMKA 4V2FA 2DA3A 2IJLA 3OYDA 3S1QJ 3WTTC 2L9RA 2NVXJ 1LEBA 1JUMA 3G1OA 2QQ8A 1AHDP 1IRGA 2P5VA 2IGOA 2KJCA 4UB8C 2CRGA 2C6YA 1S29A 3S93A 3TGNA 4EJUA 5FFXA 3LA2A 4QPOA 3PNVA 5KNLA 3K70C 3HPGA 3Q9VA 4BEHB 4ETSA 2L5QA 3SEZA 3FXQA 3KETA 2RREA 1SAUA 4QPQA 4ZYHA 1F4KA 3LSIA 1VQNI 3M1CA 3IH4A 3L9FA 1EH7A 5FO5A 5AIPA 2OUMA 3S2WA 1R4MB 1WJDA 2P5KA 2LKXA 1N25A 3BG9A 5EEGA 3V7SA 2EFOA 2YX4A 2VL8A 1VQ4I 5ILSA 4E6KG 1MMDA 4E7HA 2DFFA 4Y3OA 4B3AA 2ZBKA 2R5YB 2VASA 3E7LA 3AG4H 4QLCU 5J47A 2OQRA 5JR3A 5CQGA 3S16J 4KMFA 2F48A 2HXIA 3DPTA 3WTZA 4S04A 4F93B 3D5LA 4FT8A 5GAGJ 1IJWC 3DPLC 3F23A 1YIOA 5ICCA 2HYGD 3IC7A 1SANA 3TP0A 3ZGKA 3JTGA 2LG4A 2OZUA 4UUTA 2A6HF 2IPQX 2VN2A 5FFZA 3GW2A 3RZOJ 3A01A 3G73A 2OTJI 3BR0A 3BROA 1YJWI 1JHHA 3KEOA 1YLFA 2QCOA 3BR3A 4XLNF 1TW3A 1Y0UA 3J80Z 3G4SI 1VTNC 3L00A 4FX0A 3GTJJ 1T98A 3CQZJ 4RGRA 3RSNA 4KMUX 3AG2H 3CCRI 4BY1J 4D9JA 1UFMA 2E35A 2VUMJ 2QWWA 2CQXA 5JVTA 1Z21A 1R49A 4MTEA 4U7DA 1REPC 5D4SA 1JE8A 4GGGA 4KT5C 2CFOA 2ZC2A 3LOCA 3L2CA 4LLNA 4EM2A 4F92B 1W5SA 2EFNA 4I0AA 3I59B 4XKBA 3D5SC 1R36A 1RI7A 3J7YJ 2PN6A 1DQUA 4IEJA 3U9GA 2HWVA 3N97A 1RNLA 2HZTA 5E8IA 3DEWA 4M3DA 2MH2A 2O8KA 1D0YA 1S8NA 1Z1DA 5EZGA 5HS9A 3FBNB 2BYVE 4XRFA 4V19K 4IQJA 3PNYA 3KLNA 2Y9ZA 1D0ZA 1V54H 2XB5A 2XF5A 3PIPF 5L3GA 3H1CA 1X3WB 1JUPA 2EIMH 1ZARA 1T08B 1H0MA 2E2JJ 2M45A 1Y1WJ 3FKJA 3TBIA 3SHFA 3PSFA 4G12A 1S3JA 2LOOA 2DA7A 3H9QA 1QNTA 2LH9A 4ZTFA 1O7LA 2V1XA 2WAFA 3F72A 1FIPA 1UB9A 1AKHA 1P7JA 2QYOA 3HPHA 3EETA 3L1PA 2IGMA 4GXOA 1WSUA 3BR1A 4HOBA 1OYIA 4D5CA 4M74A 1I1GA 3H9GA 4NNJA 3BWGA 5E20A 4KA4A 2ZXJA 3IUOA 3BDDA 1KQ0A 3FHZA 2GIVA 2OF7A 5IYCJ 2VONA 2UXNA 1MBFA 1YQAA 4EJVA 4YRVA 5DS9A 3ZP5A 2EJRA 1PP8F 4LG0B 2ZNZA 4ZDOA 2O3FA 1Y1VJ 4L5JA 2IS2A 2YSRA 1XDUA 4HF0A 1QVUA 1H88C 2RNGA 1E17A 2F6CA 3ZMTA 3SZPA 4PK4A 2VPRA 2ZMEC 5EJCA 5EGOB 1CF7A 1F1ZA 2YUSA 4M3GA 3GWZA 3R6SA 3V8KA 4HG2A 3FISA 2IVMA 3NARA 4YIRX 4HEA2 1MKMA 2E34A 1Y56A 5IP6A 1G8XA 1UHMA 5CVUA 2FRHA 5LHGA 1SEUA 2BEOA 2EK5A 1Y0NA 3K4JA 4A3KJ 1KU7A 2X6WA 1IO2A 4ZZDA 1Z77A 1ZN2A 2KDZA 2PQ8A 2PJRA 2VBWA 1FOYA 4IHVA 1E3HA 1ENHA 2VQCA 2K3PA 3MQ0A 3FIWA 1QA6A 2NS0A 1D3YA 3IHUA 2G9WA 3O3KA 3K7AJ 5L3EA 1MGTA 1HXDA 2HQRA 3FXJA 1LB2A 1FBUA 2BE5F 4CCOA 3SDBA 2K9SA 1ULYA 1J5YA 2DOAA 3IAS2 1WRJA 2DOFA 2HVRA 1OR7C 3E0JB 3LSRA 1FNNA 5HS7A 3GLLA 3CCUI 2FNPA 3DEUA 3GO5A 2FF4A 3Q9SA 4OMZA 3QOEA 4D0PA 3BT9A 4J00A 2L9SA 2M87A
chains in the Genus database with same CATH topology
4HDVA 2GQQA 3SQNA 2IRFG 3F3XA 3AAFA 4G8XA 4R1HA 4ZYDA 4KN4X 1I5ZA 3T1BA 3VFZA 2OD5A 1LNWA 2JTVA 4YFNF 3KZYA 4UXNA 1K79A 2XKPA 2ISYA 3C18A 2HTSA 4EV0A 2JSCA 4RGUA 1R5HA 4MQVA 2HTJA 3JSPA 1Q1HA 4R8HA 1KQ9A 5E8GA 4HV5A 4KYWA 4M9XA 3QP5A 3TDUC 4O5VA 5EEHA 2DQLA 2F5FA 3CUQB 5DCMB 1XB4A 1FOKA 4RB2C 1SFEA 2DK8A 4YFXF 2R3SA 2Y0MA 1LDKB 2OA4A 1GXPA 2QQ9A 3MZHA 1NHAA 4HF1A 2HYFA 4L0YB 3HTSB 3B02A 3KLOA 5ILVA 2RQPA 3BOQA 1OKRA 3I0TA 4HF2A 1EH6A 2BV6A 4MEYF 3QRFF 3WGHA 2XKOA 5CVVA 3EQLF 1F5TA 1BOAA 1ZRCA 4M73A 1IRFA 2VT2A 3LFKA 3TO6A 1R1UA 3KP3A 1BC7C 5FGMA 1HW2A 3N4MA 3TOBA 4U0VA 1QQIA 3D0SA 5DD4A 2Q0OA 2CWEA 2VXZA 5HDGA 3R60A 3O2PE 5CVIA 1HSJA 1J7KA 4A2UA 2M30A 5BMZA 2DO7A 3QP6A 4XBFA 4AD9A 2CFXA 3SFZA 3I64A 2HEOA 1YW8A 5DD8A 2V79A 2XAGA 4Z2YA 2IA0A 3SXYA 4JQFA 4P9UA 2NNNA 4IRGA 2H09A 2K27A 3ZMDA 5D8LB 4WXHA 1FLIA 4RB1A 5LHIA 2RVCA 2RGVA 1MZBA 2JPCA 4PGGA 1JHFA 3TDZC 1YW9A 3DKWA 1BI3A 3NEUA 2F5CA 3E3VA 1XCBA 4G7OF 1ODDA 4EM0B 3H3ZA 1F9NA 4L9NA 4UVCA 5F6FA 2HQNA 3RPQA 4KNYA 2O61A 3T5XA 5J8CA 4UUVA 5FLXK 4YIFA 1SD4A 2KIFA 4HDUA 3ZN1A 4RGSA 1FX7A 2Y48A 3MEXA 2E1CA 5HDNA 2AS5F 2Q8KA 1XDSA 2XAJA 4MNUA 1Z7UA 5F1RA 4L18B 4P96A 1MDMB 3R61A 2GXGA 2EA4A 4Q48A 4ENJA 4DQ2A 2D2WA 2XUBA 2CW0F 2WC2A 2HKOA 2VC1A 2LKPA 1LVAA 2CYYA 4A0YA 4A12A 3CUQA 5ED4A 4I09A 2WWYA 1T0FA 4MHGA 4CO8A 3V7RA 3LAPA 2MBFA 5FLXZ 5JHUA 3SZTA 2QUFA 5AIQA 3DV8A 5HLIA 2F2EA 1G3TA 2G7HA 2FA5A 3PQJA 2AXLA 4ZH4F 1IXSB 3GX4X 1SFUA 2HR3A 2A07F 5HLHA 1L3LA 1FC3A 4M6XA 2VODA 2EB7A 4L9JA 1KU3A 3BPVA 5E17F 5ILUA 3HUGA 4A5MA 3EDPA 3TKYA 2DLLA 2OZ6A 4BYYA 2RDPA 2A61A 4YFKF 4I02A 1UHWA 2FNAA 1FSHA 4PZJA 4LGWA 1FYMA 1GHCA 6PAXA 2P6SA 2X0LA 2XGXA 4UV9A 1BIAA 3L7WA 4UVBA 3KP7A 3GYHX 2O8XA 2PFBA 5L3DA 2DFIA 4B09A 1UCRA 1O3SA 1B59A 4OIOF 3E6DA 2XASA 4IRHA 1BI2A 3GUDA 2ZCWA 3OOPA 1B9MA 2P8TA 4ENMA 2XRNA 2Z33A 1K78B 2H6BA 4AWXB 1FZPB 2ZFWA 2WTEA 2MA3A 1ZLKA 4MEXF 1QBJA 2QBYB 3DP7A 2NYXA 4WXCA 3ERED 1TQPA 3LWFA 3ZMVA 3Q5FA 4RAYA 5CVJA 4EVIA 4RB0A 3LSTA 3FM3A 3IL2A 3WU1B 3IWZA 3ABUA 2EA2A 1PDNC 2KIMA 1U5TA 3VB2A 3M8EA 4ESBA 5LGTA 4UVAA 3GZ5A 1QPMA 2P5LC 1ZG3A 3BJ6A 4HLYA 1P92A 2VE8A 2R7FA 2FQ3A 1R58A 2W84A 1P6RA 4G7ZF 5TRDA 1MDMA 2QQAA 4OINF 1R22A 3FXUA 4HZFA 4M9ZA 1T39A 4DNCA 1L0OC 1IN7A 1XGOA 1T6SA 2P4WA 4WWCA 5H6QA 4ZYEA 3WTVC 3KP6A 2ISZA 3BJAA 4M72A 5LLQA 3BZ6A 3ROUA 4EMSA 3L09A 1DP7P 2Z99A 3HRSA 4HV6A 5K5OA 2H27A 2FE3A 2QENA 1QZYA 2R7DA 1SD7A 4CHUA 5D5WB 1W7PA 3WODF 2A69F 2YPRA 5HOOA 2K7LA 2EV6A 2FOKA 1YW7A 3M7GA 1ZH5A 2ZMEB 1Z9CA 2GZWA 4ZZLA 1SFXA 3RDIA 2EFQA 4MQ9F 1SD6A 4G9YA 4A6EA 3FX3A 4H0EA 3E5UA 1KA8A 1G3WA 5D5XB 5JFRA 1PP7U 3WTXC 2D45A 4EJOA 2DQRA 4HAMA 4Q47A 2FSWA 5HLGA 1TQMA 2L3DA 1DPUA 1IN4A 1LDJA 3MCZA 4OMYA 1XCVA 1K7AA 3ZQ7A 3HTUA 2UXXA 3M9AA 4KICA 2YU3A 1RIOH 5L3BA 1V4RA 1IF1A 1S6LA 3MWMA 2RC4A 3HSEA 3T8RA 2IP2A 2XROA 1IUYA 4WX9A 5DUIA 1ZG5A 2EWNA 2UZKA 2ZNYA 3F8BA 1BJAA 2ACJA 5LHHA 4I2OA 5FD5A 2DPUA 1R00A 4XSZF 4GCVA 2TDXA 4LLLA 4L9VA 4A6DA 5LRRA 1U3EM 4L0ZB 1AWCA 3CTAA 4WXDA 1DUXC 3DF8A 1R23A 2STWA 4B8XA 2P7VB 4P9FA 3CUOA 5KK1A 4EQQA 4HX8A 3M1EA 4LLGF 3I59A 1I27A 4Y13A 3GVAA 1Z6RA 4U88A 1SMYF 1R7JA 3BJOA 3IWFA 2ESHA 5BPIA 5LGNA 4BAYA 1USSA 5H20A 4E70A 4KIBA 3W6KB 1D8KA 3P9IA 5TJJA 1YS7A 1XN7A 3WU0A 1BC8C 1IXRC 2DAOA 4ENKA 1IAWA 4K2EA 1IN8A 2W25A 5DCFA 2F5EA 3IKVA 1S7OA 4RB3C 2JRTA 5LGUA 1ONVA 1EV7A 3F6VA 3FF5A 4L5IA 4YG2F 4AVPA 1KYZA 2EV5A 4IHSA 1USTA 4LG0A 2JPBA 1KU2A 2M8EA 1WWXA 3GFMA 3FMQA 4CZZA 3ZMUA 3P7NA 1TLHB 3VODA 1T2KA 3QAHA 4F7ZA 4UNOA 4PCQA 2YR2A 4QWQA 3VOEA 2DI3A 1KGSA 1HKTA 1FBQA 1RUNA 3CO7C 4KFCA 4M9SA 5CYVA 2VT3A 4KDPA 1XSVA 3K2ZA 2OQGA 4U0WA 2VOPA 5CVRA 4EM1A 3RI4A 4ASNA 4CDGA 3TO9A 2YX7A 3CLOA 5D8KB 3HOSA 3E6MA 2J5OA 4GYGA 1GVJA 5HS8A 2XAHA 4PDKA 1V3FA 2IW5A 2PMUA 3J81K 1B9NA 4BHCA 4HA8A 1U5TC 1Z05A 3R0AA 1MJ9A 1G6NA 3JAMK 3HRTA 3V7CA 3WG9A 1FYLA 3E6CC 4I0BA 3JSOA 5BS6A 5F64A 3QPHA 3GFLA 3HHGA 2DTRA 4RAZA 2V6CA 2Z5UA 1A04A 4CXFA 1CGPA 2KIUA 3COAC 2EV0A 1FSEA 2EFPA 1IN6A 1BBYA 4R79A 2V9VA 2NRAC 3WE3A 3HYIA 2W57A 3J81Z 5HVQC 2GWRA 5E1ZB 1ON2A 1X3UA 3M8FA 3JAMZ 1QGPA 2MC3A 4HLXA 1FWZA 5DCMA 5KVRA 2D1VA 5HDKA 4A5NA 3WGIA 1R1TA 4KIGA 2K4BA 4FX4A 4U7BA 1YS6A 1XD7A 2G7UA 3FMRA 3CO6C 3MZYA 3EUHA 2Z3YA 1JXSA 2VOOA 3V8LA 2PJPA 3H92A 1ZRDA 4IXAA 1ZG1A 2DU9A 2B0LA 1BN5A 1ZHFA 4N9IA 4FHTA 1FP1D 5LEKA 2Q2EA 3GFIA 1XGNA 3B73A 2L02A 4NB5A 2OU2A 4IHTA 5JI6A 3I4PA 3R4KA 4TV7A 3GXOA 4XLPF 2PBIA 1ZYRF 2Z9OA 4HQEA 5D4RA 2EFWA 4PGHA 1FP2A 2JZYA 3OV8A 1CF7B 3K1MA 4Y17A 2DW4A 1B1BA 1QO0D 2X4HA 3K9TA 2ETHA 3RKWA 1DDNA 2A6EF 2L01A 1TNTA 4CYDA 4BH9A 3PFIA 3TOAA 3JW4A 5D5VB 2QLZA 4IJAA 3J7AO 5DDGA 3K69A 1HKQA 3K1PA 1J9IA 3ZN0A 4ZYGA 4LB6B 3RYRA 3H3UA 2BBYA 3FMSA 2D1HA 5J8FA 2GA1A 3GEZA 3T0YA 3V4GA 1BIBA 1YG2A 4LMYA 5BPDA 5L3FA 1TNSA 4G6DA 2GXBA 3J80K 2M1BA 5E18F 2KRFA 3KEQA 1FYKA 2H6CA 3ZPLA 3TQNA 4KIFA 3BPXA 4P5OA 2MD5A 1J59A 4CGZA 1YFHA 4M6YA 3T8TA 4G7HF 1HKSA 5E1XA 5ICFA 4HW0A 2PMHA 3K0LA 2RNJA 2W24A 3ABTA 3QPTA 3C7JA 4EJTA 2LDUA 2HOEA 1GXQA 5ERIA 4OOIA 1B6AA 1T38A 1HSTA 3I58A 2O0YA 4UV8A 1I6XA 5K5QA 3O6BB 2OBPA 2A3SA 1STZA 2NAZA 5DYMA 3ULQB 1LJ9A 1FY7A 3RKXA 2LF7A 2ESNA 2CO5A 4AIJA 3RPUA 2DK5A 3TO7A 5FD6A 4LB5A 4ESJA 1TQIA 3KZZA 2CGPA 3RJPA 3HRUA 1RZ4A 2MLGA 4Q4ZF 2V1UA 3I71A 1U8RA 1ZREA 4G6QA 2ADUA 1D5VA 5DV5A 1JGSA 1ZAOA 2OAZA 1YYVA 1HQCA 2PG4A 3E5QA 3WTSC 1AOYA 3ECOA 3IRQA 1KQ8A 1FPQA 3LA7A 2VC0A 4YIIA 2CQKA 2WV0A 4L9TA 1MJAA 4AIKA 3BP8A 3FWEA 2IA2A 4I01A 5ICEA 3KP2A 1BM9A 2JT1A 4UHTA 3IKTA 1FBSA 4I98B 3JTHA 3ZMSA 1P4AA 3LAJA 3GZ6A 1R5GA 5DEQA 3ECHA 1H9GA 2A5YB 1O3QA 1U2WA 3WTWC 5CJ9A 3EYIA 5D6EA 1ZLJA 1YO5C 1K78A 2UWMA 3LA3A 4U0YA 4IF4A 1J2XA 2HGCA 3WTUC 3P9CA 1G4DA 2QBYA 5E1WA 5IT9K 2PEXA 2GAUA 4RGXA 3NRVA 2ZKZA 2MH9A 2XIGA 3I54A 4EGZA 4HBLA 3PQKA 3R0JA 3I53A 2NNYA 1W5TA 1WI9A 3LQQA 5D6FA 3HSFA 4I7HA 3VEPA 4A0ZA 3FXRA 3ISPA 3CUQC 4JK1X 3V8JA 2FBKA 2LNBA 4IVNA 2QZ8A 2LSOA 3RKYA 2A68F 5IT3A 5J6XA 1LDDA 5IT9Z 1LEAA 1W7PD 2KJBA 3KP4A 4O3MA 2RKHA 2HS5A 1O3RA 2DT5A 3GF2A 1PUEE 3RIRA 2L4AA 1XGSA 5A2QK 2F5DA 2XV4S 4RS8A 1H9TA 4IRIA 4EJWA 4Q5SF 3U2RA 3HIFA 3QU3A 4CICA 4HX4A 2FMLA 1DPRA 1Z91A 3C1DA 3WE2A 1TTYA 3HOTA 4OIRF 4BNCA 3FZVA 1O7FA 2FEZA 2STTA 4Y15A 3KE2A 1Z6TA 3F8CA 3CJNA 4WF2A 1ZGJA 1LQ1A 2CSOA 1IZ1A 3KP5A 3F8FA 1P2FA 2J5PA 3MFKA 2VBXA 1YTYA 5D5UB 1KYWA 3GFJA 4N0BA 5FB2A 5A2QZ 2PI0A 5LEJA 3ML6A 2RN7A 1HBXG 1TBXA 3K1NA 4O6JA 2BGCA 3RTRA 3CDHA 3C3WA 1EH8A 4N9HA 3WGGA 1G3YA 3ZMZA 2QQBA 4BHBA 3EYYA 2CG4A 3NQOA 2O6GE 3DQVC 4HQMA 2COMA 2FBIA 3KFWX 4EGYA 1XSDA 1U6GA 2XAFA 2ZMEA 2VE9A 2ZJ2A 3REOA 2XAQA 1RUOA 3WTYC 2HFHA 3F6OA 5K5RA 2HKXA 3KCCA 5ICGA 4HYEA 1BI0A 4ENNA 1WKMA 1U78A 1SD5A 4LK0F 1J75A 3HSRA 3IRRA 4M71A 4P55A 4NHJA 3RYPA 4LJZF 1ON1A 1IN5A 2RV8A 4ESFA 4WK8F 2ZO4A 2DPDA 5LBQA 3F8NA 2K4JA 1OR7A 1KU9A 3E6BA 1P4WA 3DXJF 4GO1A 2P6TA 3MAJA 3QU6A 1U5TB 4BXUA 1SMTA 4JBAA 3U1DA 2ELHA 4LK1F 2IT0A 5H6RA 3P9KA 3FM5A 1FT9A 2E7WA 1MD0A 2L4MA 2FMYA 2K86A 2PLYA 1XGMA 2GA2A 1O3TA 1ZGAA 4HX7A 4OIQF 3GLXA 4WCGA 4OU0A 1IW7F 2E1NA 1HW5A 4S05A 1QZZA 1E2XA 2LF8A 4AIHA 3E5XA 1IXCA 5L3CA 5BQTA 1TW2A 5CLSA 3E97A 3F21A 1D8JA 2QVOA 1I1SA 1OYWA 2V1DA 1ZRFA 4LD5A 5AONA 3DFGA 5K1YA 2FBHA 3BY6A 1HW1A 3HRMA 2P7CB 1O57A 2XVCA 1WQ2A 2HDCA 3ELKA 2L54A 1BI1A 2VBZA 5LRSA 5DUKA 1C0WA 4MTDA 4KN7X 2M5WA 1G3SA 2VBYA 2KKOA 3HHHA 2QM3A 3F22A 4NQWA 1S7AA 1XMAA 2IA1A 1OPCA 1MJBA 1B4AA 1W7PB 2XHKA 4IPAA 1K6OA 4BQAA 2FU4A 2O03A 1P4XA 2W85A 2H94A 1XSXA 1R1VA 1SAXA 4LFUA 1OYYA 4A0XA 3F8MA 4XSXF 2Y75A 4MGRA 2MLKA 3QOPA 3I5UA 4OIPF 1J0RA 3W6JB 4G94A 2K02A 2FXAA 2DBBA 3G3ZA 4KUMA 4GYIA 5BOXA 4ON0A 3LQRA 1OMIA 1W4MA 2E7XA 4BHPA 1XMKA 2IJLA 3WTTC 1LEBA 1IRGA 2P5VA 2KJCA 2C6YA 1S29A 3TGNA 4EJUA 5FFXA 3LA2A 3Q9VA 4ETSA 3FXQA 3KETA 4ZYHA 1F4KA 3L9FA 1EH7A 5FO5A 5AIPA 3S2WA 2P5KA 5EEGA 3V7SA 2EFOA 2YX4A 5ILSA 2ZBKA 4QLCU 2OQRA 5JR3A 4KMFA 3DPTA 3WTZA 4S04A 3D5LA 4FT8A 3DPLC 3F23A 1YIOA 5ICCA 2HYGD 3IC7A 3JTGA 2OZUA 2A6HF 2IPQX 2VN2A 5FFZA 3GW2A 3G73A 3BROA 1JHHA 3KEOA 1YLFA 4XLNF 1TW3A 1Y0UA 3J80Z 1VTNC 3L00A 4FX0A 1T98A 4RGRA 4KMUX 1UFMA 2QWWA 5JVTA 4MTEA 4U7DA 1REPC 5D4SA 1JE8A 4GGGA 4KT5C 3L2CA 4LLNA 4EM2A 1W5SA 2EFNA 4I0AA 3I59B 1R36A 1RI7A 2PN6A 3U9GA 2HWVA 3N97A 1RNLA 2HZTA 5E8IA 2MH2A 1S8NA 1Z1DA 5HS9A 4XRFA 2BYVE 3KLNA 5L3GA 1ZARA 1H0MA 2M45A 3SHFA 1S3JA 1QNTA 1O7LA 2V1XA 3F72A 1UB9A 2QYOA 3EETA 4GXOA 1WSUA 4HOBA 1OYIA 4M74A 1I1GA 3BWGA 5E20A 4KA4A 2ZXJA 3BDDA 1KQ0A 3FHZA 2GIVA 2VONA 2UXNA 4EJVA 1YQAA 3ZP5A 2EJRA 1PP8F 4LG0B 2ZNZA 2O3FA 4L5JA 2YSRA 1XDUA 4HF0A 1E17A 3ZMTA 3SZPA 1CF7A 1F1ZA 3GWZA 3R6SA 3V8KA 2IVMA 1MKMA 1UHMA 5CVUA 2FRHA 5LHGA 2BEOA 2EK5A 1KU7A 4ZZDA 1ZN2A 2PQ8A 2VBWA 3MQ0A 2NS0A 1D3YA 3IHUA 2G9WA 3O3KA 5L3EA 1MGTA 1HXDA 2HQRA 1LB2A 1FBUA 2BE5F 1ULYA 1J5YA 1WRJA 1FNNA 5HS7A 2FNPA 3DEUA 3GO5A 2FF4A 3Q9SA 4OMZA 4D0PA 2M87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HDV A;  2GQQ A;  3SQN A;  2IRF G;  3F3X A;  3AAF A;  4G8X A;  4R1H A;  4ZYD A;  4KN4 X;  1I5Z A;  3T1B A;  3VFZ A;  2OD5 A;  1LNW A;  2JTV A;  4YFN F;  3KZY A;  4UXN A;  1K79 A;  2XKP A;  2ISY A;  3C18 A;  2HTS A;  4EV0 A;  2JSC A;  4RGU A;  1R5H A;  4MQV A;  2HTJ A;  3JSP A;  1Q1H A;  4R8H A;  1KQ9 A;  5E8G A;  4HV5 A;  4KYW A;  4M9X A;  3QP5 A;  3TDU C;  4O5V A;  5EEH A;  2DQL A;  2F5F A;  3CUQ B;  5DCM B;  1XB4 A;  1FOK A;  4RB2 C;  1SFE A;  2DK8 A;  4YFX F;  2R3S A;  2Y0M A;  1LDK B;  2OA4 A;  1GXP A;  2QQ9 A;  3MZH A;  1NHA A;  4HF1 A;  2HYF A;  4L0Y B;  3HTS B;  3B02 A;  3KLO A;  5ILV A;  2RQP A;  3BOQ A;  1OKR A;  3I0T A;  4HF2 A;  1EH6 A;  2BV6 A;  4MEY F;  3QRF F;  3WGH A;  2XKO A;  5CVV A;  3EQL F;  1F5T A;  1BOA A;  1ZRC A;  4M73 A;  1IRF A;  2VT2 A;  3LFK A;  3TO6 A;  1R1U A;  3KP3 A;  1BC7 C;  5FGM A;  1HW2 A;  3N4M A;  3TOB A;  4U0V A;  1QQI A;  3D0S A;  5DD4 A;  2Q0O A;  2CWE A;  2VXZ A;  5HDG A;  3R60 A;  3O2P E;  5CVI A;  1HSJ A;  1J7K A;  4A2U A;  2M30 A;  5BMZ A;  2DO7 A;  3QP6 A;  4XBF A;  4AD9 A;  2CFX A;  3SFZ A;  3I64 A;  2HEO A;  1YW8 A;  5DD8 A;  2V79 A;  2XAG A;  4Z2Y A;  2IA0 A;  3SXY A;  4JQF A;  4P9U A;  2NNN A;  4IRG A;  2H09 A;  2K27 A;  3ZMD A;  5D8L B;  4WXH A;  1FLI A;  4RB1 A;  5LHI A;  2RVC A;  2RGV A;  1MZB A;  2JPC A;  4PGG A;  1JHF A;  3TDZ C;  1YW9 A;  3DKW A;  1BI3 A;  3NEU A;  2F5C A;  3E3V A;  1XCB A;  4G7O F;  1ODD A;  4EM0 B;  3H3Z A;  1F9N A;  4L9N A;  4UVC A;  5F6F A;  2HQN A;  3RPQ A;  4KNY A;  2O61 A;  3T5X A;  5J8C A;  4UUV A;  5FLX K;  4YIF A;  1SD4 A;  2KIF A;  4HDU A;  3ZN1 A;  4RGS A;  1FX7 A;  2Y48 A;  3MEX A;  2E1C A;  5HDN A;  2AS5 F;  2Q8K A;  1XDS A;  2XAJ A;  4MNU A;  1Z7U A;  5F1R A;  4L18 B;  4P96 A;  1MDM B;  3R61 A;  2GXG A;  2EA4 A;  4Q48 A;  4ENJ A;  4DQ2 A;  2D2W A;  2XUB A;  2CW0 F;  2WC2 A;  2HKO A;  2VC1 A;  2LKP A;  1LVA A;  2CYY A;  4A0Y A;  4A12 A;  3CUQ A;  5ED4 A;  4I09 A;  2WWY A;  1T0F A;  4MHG A;  4CO8 A;  3V7R A;  3LAP A;  2MBF A;  5FLX Z;  5JHU A;  3SZT A;  2QUF A;  5AIQ A;  3DV8 A;  5HLI A;  2F2E A;  1G3T A;  2G7H A;  2FA5 A;  3PQJ A;  2AXL A;  4ZH4 F;  1IXS B;  3GX4 X;  1SFU A;  2HR3 A;  2A07 F;  5HLH A;  1L3L A;  1FC3 A;  4M6X A;  2VOD A;  2EB7 A;  4L9J A;  1KU3 A;  3BPV A;  5E17 F;  5ILU A;  3HUG A;  4A5M A;  3EDP A;  3TKY A;  2DLL A;  2OZ6 A;  4BYY A;  2RDP A;  2A61 A;  4YFK F;  4I02 A;  1UHW A;  2FNA A;  1FSH A;  4PZJ A;  4LGW A;  1FYM A;  1GHC A;  6PAX A;  2P6S A;  2X0L A;  2XGX A;  4UV9 A;  1BIA A;  3L7W A;  4UVB A;  3KP7 A;  3GYH X;  2O8X A;  2PFB A;  5L3D A;  2DFI A;  4B09 A;  1UCR A;  1O3S A;  1B59 A;  4OIO F;  3E6D A;  2XAS A;  4IRH A;  1BI2 A;  3GUD A;  2ZCW A;  3OOP A;  1B9M A;  2P8T A;  4ENM A;  2XRN A;  2Z33 A;  1K78 B;  2H6B A;  4AWX B;  1FZP B;  2ZFW A;  2WTE A;  2MA3 A;  1ZLK A;  4MEX F;  1QBJ A;  2QBY B;  3DP7 A;  2NYX A;  4WXC A;  3ERE D;  1TQP A;  3LWF A;  3ZMV A;  3Q5F A;  4RAY A;  5CVJ A;  4EVI A;  4RB0 A;  3LST A;  3FM3 A;  3IL2 A;  3WU1 B;  3IWZ A;  3ABU A;  2EA2 A;  1PDN C;  2KIM A;  1U5T A;  3VB2 A;  3M8E A;  4ESB A;  5LGT A;  4UVA A;  3GZ5 A;  1QPM A;  2P5L C;  1ZG3 A;  3BJ6 A;  4HLY A;  1P92 A;  2VE8 A;  2R7F A;  2FQ3 A;  1R58 A;  2W84 A;  1P6R A;  4G7Z F;  5TRD A;  1MDM A;  2QQA A;  4OIN F;  1R22 A;  3FXU A;  4HZF A;  4M9Z A;  1T39 A;  4DNC A;  1L0O C;  1IN7 A;  1XGO A;  1T6S A;  2P4W A;  4WWC A;  5H6Q A;  4ZYE A;  3WTV C;  3KP6 A;  2ISZ A;  3BJA A;  4M72 A;  5LLQ A;  3BZ6 A;  3ROU A;  4EMS A;  3L09 A;  1DP7 P;  2Z99 A;  3HRS A;  4HV6 A;  5K5O A;  2H27 A;  2FE3 A;  2QEN A;  1QZY A;  2R7D A;  1SD7 A;  4CHU A;  5D5W B;  1W7P A;  3WOD F;  2A69 F;  2YPR A;  5HOO A;  2K7L A;  2EV6 A;  2FOK A;  1YW7 A;  3M7G A;  1ZH5 A;  2ZME B;  1Z9C A;  2GZW A;  4ZZL A;  1SFX A;  3RDI A;  2EFQ A;  4MQ9 F;  1SD6 A;  4G9Y A;  4A6E A;  3FX3 A;  4H0E A;  3E5U A;  1KA8 A;  1G3W A;  5D5X B;  5JFR A;  1PP7 U;  3WTX C;  2D45 A;  4EJO A;  2DQR A;  4HAM A;  4Q47 A;  2FSW A;  5HLG A;  1TQM A;  2L3D A;  1DPU A;  1IN4 A;  1LDJ A;  3MCZ A;  4OMY A;  1XCV A;  1K7A A;  3ZQ7 A;  3HTU A;  2UXX A;  3M9A A;  4KIC A;  2YU3 A;  1RIO H;  5L3B A;  1V4R A;  1IF1 A;  1S6L A;  3MWM A;  2RC4 A;  3HSE A;  3T8R A;  2IP2 A;  2XRO A;  1IUY A;  4WX9 A;  5DUI A;  1ZG5 A;  2EWN A;  2UZK A;  2ZNY A;  3F8B A;  1BJA A;  2ACJ A;  5LHH A;  4I2O A;  5FD5 A;  2DPU A;  1R00 A;  4XSZ F;  4GCV A;  2TDX A;  4LLL A;  4L9V A;  4A6D A;  5LRR A;  1U3E M;  4L0Z B;  1AWC A;  3CTA A;  4WXD A;  1DUX C;  3DF8 A;  1R23 A;  2STW A;  4B8X A;  2P7V B;  4P9F A;  3CUO A;  5KK1 A;  4EQQ A;  4HX8 A;  3M1E A;  4LLG F;  3I59 A;  1I27 A;  4Y13 A;  3GVA A;  1Z6R A;  4U88 A;  1SMY F;  1R7J A;  3BJO A;  3IWF A;  2ESH A;  5BPI A;  5LGN A;  4BAY A;  1USS A;  5H20 A;  4E70 A;  4KIB A;  3W6K B;  1D8K A;  3P9I A;  5TJJ A;  1YS7 A;  1XN7 A;  3WU0 A;  1BC8 C;  1IXR C;  2DAO A;  4ENK A;  1IAW A;  4K2E A;  1IN8 A;  2W25 A;  5DCF A;  2F5E A;  3IKV A;  1S7O A;  4RB3 C;  2JRT A;  5LGU A;  1ONV A;  1EV7 A;  3F6V A;  3FF5 A;  4L5I A;  4YG2 F;  4AVP A;  1KYZ A;  2EV5 A;  4IHS A;  1UST A;  4LG0 A;  2JPB A;  1KU2 A;  2M8E A;  1WWX A;  3GFM A;  3FMQ A;  4CZZ A;  3ZMU A;  3P7N A;  1TLH B;  3VOD A;  1T2K A;  3QAH A;  4F7Z A;  4UNO A;  4PCQ A;  2YR2 A;  4QWQ A;  3VOE A;  2DI3 A;  1KGS A;  1HKT A;  1FBQ A;  1RUN A;  3CO7 C;  4KFC A;  4M9S A;  5CYV A;  2VT3 A;  4KDP A;  1XSV A;  3K2Z A;  2OQG A;  4U0W A;  2VOP A;  5CVR A;  4EM1 A;  3RI4 A;  4ASN A;  4CDG A;  3TO9 A;  2YX7 A;  3CLO A;  5D8K B;  3HOS A;  3E6M A;  2J5O A;  4GYG A;  1GVJ A;  5HS8 A;  2XAH A;  4PDK A;  1V3F A;  2IW5 A;  2PMU A;  3J81 K;  1B9N A;  4BHC A;  4HA8 A;  1U5T C;  1Z05 A;  3R0A A;  1MJ9 A;  1G6N A;  3JAM K;  3HRT A;  3V7C A;  3WG9 A;  1FYL A;  3E6C C;  4I0B A;  3JSO A;  5BS6 A;  5F64 A;  3QPH A;  3GFL A;  3HHG A;  2DTR A;  4RAZ A;  2V6C A;  2Z5U A;  1A04 A;  4CXF A;  1CGP A;  2KIU A;  3COA C;  2EV0 A;  1FSE A;  2EFP A;  1IN6 A;  1BBY A;  4R79 A;  2V9V A;  2NRA C;  3WE3 A;  3HYI A;  2W57 A;  3J81 Z;  5HVQ C;  2GWR A;  5E1Z B;  1ON2 A;  1X3U A;  3M8F A;  3JAM Z;  1QGP A;  2MC3 A;  4HLX A;  1FWZ A;  5DCM A;  5KVR A;  2D1V A;  5HDK A;  4A5N A;  3WGI A;  1R1T A;  4KIG A;  2K4B A;  4FX4 A;  4U7B A;  1YS6 A;  1XD7 A;  2G7U A;  3FMR A;  3CO6 C;  3MZY A;  3EUH A;  2Z3Y A;  1JXS A;  2VOO A;  3V8L A;  2PJP A;  3H92 A;  1ZRD A;  4IXA A;  1ZG1 A;  2DU9 A;  2B0L A;  1BN5 A;  1ZHF A;  4N9I A;  4FHT A;  1FP1 D;  5LEK A;  2Q2E A;  3GFI A;  1XGN A;  3B73 A;  2L02 A;  4NB5 A;  2OU2 A;  4IHT A;  5JI6 A;  3I4P A;  3R4K A;  4TV7 A;  3GXO A;  4XLP F;  2PBI A;  1ZYR F;  2Z9O A;  4HQE A;  5D4R A;  2EFW A;  4PGH A;  1FP2 A;  2JZY A;  3OV8 A;  1CF7 B;  3K1M A;  4Y17 A;  2DW4 A;  1B1B A;  1QO0 D;  2X4H A;  3K9T A;  2ETH A;  3RKW A;  1DDN A;  2A6E F;  2L01 A;  1TNT A;  4CYD A;  4BH9 A;  3PFI A;  3TOA A;  3JW4 A;  5D5V B;  2QLZ A;  4IJA A;  3J7A O;  5DDG A;  3K69 A;  1HKQ A;  3K1P A;  1J9I A;  3ZN0 A;  4ZYG A;  4LB6 B;  3RYR A;  3H3U A;  2BBY A;  3FMS A;  2D1H A;  5J8F A;  2GA1 A;  3GEZ A;  3T0Y A;  3V4G A;  1BIB A;  1YG2 A;  4LMY A;  5BPD A;  5L3F A;  1TNS A;  4G6D A;  2GXB A;  3J80 K;  2M1B A;  5E18 F;  2KRF A;  3KEQ A;  1FYK A;  2H6C A;  3ZPL A;  3TQN A;  4KIF A;  3BPX A;  4P5O A;  2MD5 A;  1J59 A;  4CGZ A;  1YFH A;  4M6Y A;  3T8T A;  4G7H F;  1HKS A;  5E1X A;  5ICF A;  4HW0 A;  2PMH A;  3K0L A;  2RNJ A;  2W24 A;  3ABT A;  3QPT A;  3C7J A;  4EJT A;  2LDU A;  2HOE A;  1GXQ A;  5ERI A;  4OOI A;  1B6A A;  1T38 A;  1HST A;  3I58 A;  2O0Y A;  4UV8 A;  1I6X A;  5K5Q A;  3O6B B;  2OBP A;  2A3S A;  1STZ A;  2NAZ A;  5DYM A;  3ULQ B;  1LJ9 A;  1FY7 A;  3RKX A;  2LF7 A;  2ESN A;  2CO5 A;  4AIJ A;  3RPU A;  2DK5 A;  3TO7 A;  5FD6 A;  4LB5 A;  4ESJ A;  1TQI A;  3KZZ A;  2CGP A;  3RJP A;  3HRU A;  1RZ4 A;  2MLG A;  4Q4Z F;  2V1U A;  3I71 A;  1U8R A;  1ZRE A;  4G6Q A;  2ADU A;  1D5V A;  5DV5 A;  1JGS A;  1ZAO A;  2OAZ A;  1YYV A;  1HQC A;  2PG4 A;  3E5Q A;  3WTS C;  1AOY A;  3ECO A;  3IRQ A;  1KQ8 A;  1FPQ A;  3LA7 A;  2VC0 A;  4YII A;  2CQK A;  2WV0 A;  4L9T A;  1MJA A;  4AIK A;  3BP8 A;  3FWE A;  2IA2 A;  4I01 A;  5ICE A;  3KP2 A;  1BM9 A;  2JT1 A;  4UHT A;  3IKT A;  1FBS A;  4I98 B;  3JTH A;  3ZMS A;  1P4A A;  3LAJ A;  3GZ6 A;  1R5G A;  5DEQ A;  3ECH A;  1H9G A;  2A5Y B;  1O3Q A;  1U2W A;  3WTW C;  5CJ9 A;  3EYI A;  5D6E A;  1ZLJ A;  1YO5 C;  1K78 A;  2UWM A;  3LA3 A;  4U0Y A;  4IF4 A;  1J2X A;  2HGC A;  3WTU C;  3P9C A;  1G4D A;  2QBY A;  5E1W A;  5IT9 K;  2PEX A;  2GAU A;  4RGX A;  3NRV A;  2ZKZ A;  2MH9 A;  2XIG A;  3I54 A;  4EGZ A;  4HBL A;  3PQK A;  3R0J A;  3I53 A;  2NNY A;  1W5T A;  1WI9 A;  3LQQ A;  5D6F A;  3HSF A;  4I7H A;  3VEP A;  4A0Z A;  3FXR A;  3ISP A;  3CUQ C;  4JK1 X;  3V8J A;  2FBK A;  2LNB A;  4IVN A;  2QZ8 A;  2LSO A;  3RKY A;  2A68 F;  5IT3 A;  5J6X A;  1LDD A;  5IT9 Z;  1LEA A;  1W7P D;  2KJB A;  3KP4 A;  4O3M A;  2RKH A;  2HS5 A;  1O3R A;  2DT5 A;  3GF2 A;  1PUE E;  3RIR A;  2L4A A;  1XGS A;  5A2Q K;  2F5D A;  2XV4 S;  4RS8 A;  1H9T A;  4IRI A;  4EJW A;  4Q5S F;  3U2R A;  3HIF A;  3QU3 A;  4CIC A;  4HX4 A;  2FML A;  1DPR A;  1Z91 A;  3C1D A;  3WE2 A;  1TTY A;  3HOT A;  4OIR F;  4BNC A;  3FZV A;  1O7F A;  2FEZ A;  2STT A;  4Y15 A;  3KE2 A;  1Z6T A;  3F8C A;  3CJN A;  4WF2 A;  1ZGJ A;  1LQ1 A;  2CSO A;  1IZ1 A;  3KP5 A;  3F8F A;  1P2F A;  2J5P A;  3MFK A;  2VBX A;  1YTY A;  5D5U B;  1KYW A;  3GFJ A;  4N0B A;  5FB2 A;  5A2Q Z;  2PI0 A;  5LEJ A;  3ML6 A;  2RN7 A;  1HBX G;  1TBX A;  3K1N A;  4O6J A;  2BGC A;  3RTR A;  3CDH A;  3C3W A;  1EH8 A;  4N9H A;  3WGG A;  1G3Y A;  3ZMZ A;  2QQB A;  4BHB A;  3EYY A;  2CG4 A;  3NQO A;  2O6G E;  3DQV C;  4HQM A;  2COM A;  2FBI A;  3KFW X;  4EGY A;  1XSD A;  1U6G A;  2XAF A;  2ZME A;  2VE9 A;  2ZJ2 A;  3REO A;  2XAQ A;  1RUO A;  3WTY C;  2HFH A;  3F6O A;  5K5R A;  2HKX A;  3KCC A;  5ICG A;  4HYE A;  1BI0 A;  4ENN A;  1WKM A;  1U78 A;  1SD5 A;  4LK0 F;  1J75 A;  3HSR A;  3IRR A;  4M71 A;  4P55 A;  4NHJ A;  3RYP A;  4LJZ F;  1ON1 A;  1IN5 A;  2RV8 A;  4ESF A;  4WK8 F;  2ZO4 A;  2DPD A;  5LBQ A;  3F8N A;  2K4J A;  1OR7 A;  1KU9 A;  3E6B A;  1P4W A;  3DXJ F;  4GO1 A;  2P6T A;  3MAJ A;  3QU6 A;  1U5T B;  4BXU A;  1SMT A;  4JBA A;  3U1D A;  2ELH A;  4LK1 F;  2IT0 A;  5H6R A;  3P9K A;  3FM5 A;  1FT9 A;  2E7W A;  1MD0 A;  2L4M A;  2FMY A;  2K86 A;  2PLY A;  1XGM A;  2GA2 A;  1O3T A;  1ZGA A;  4HX7 A;  4OIQ F;  3GLX A;  4WCG A;  4OU0 A;  1IW7 F;  2E1N A;  1HW5 A;  4S05 A;  1QZZ A;  1E2X A;  2LF8 A;  4AIH A;  3E5X A;  1IXC A;  5L3C A;  5BQT A;  1TW2 A;  5CLS A;  3E97 A;  3F21 A;  1D8J A;  2QVO A;  1I1S A;  1OYW A;  2V1D A;  1ZRF A;  4LD5 A;  5AON A;  3DFG A;  5K1Y A;  2FBH A;  3BY6 A;  1HW1 A;  3HRM A;  2P7C B;  1O57 A;  2XVC A;  1WQ2 A;  2HDC A;  3ELK A;  2L54 A;  1BI1 A;  2VBZ A;  5LRS A;  5DUK A;  1C0W A;  4MTD A;  4KN7 X;  2M5W A;  1G3S A;  2VBY A;  2KKO A;  3HHH A;  2QM3 A;  3F22 A;  4NQW A;  1S7A A;  1XMA A;  2IA1 A;  1OPC A;  1MJB A;  1B4A A;  1W7P B;  2XHK A;  4IPA A;  1K6O A;  4BQA A;  2FU4 A;  2O03 A;  1P4X A;  2W85 A;  2H94 A;  1XSX A;  1R1V A;  1SAX A;  4LFU A;  1OYY A;  4A0X A;  3F8M A;  4XSX F;  2Y75 A;  4MGR A;  2MLK A;  3QOP A;  3I5U A;  4OIP F;  1J0R A;  3W6J B;  4G94 A;  2K02 A;  2FXA A;  2DBB A;  3G3Z A;  4KUM A;  4GYI A;  5BOX A;  4ON0 A;  3LQR A;  1OMI A;  1W4M A;  2E7X A;  4BHP A;  1XMK A;  2IJL A;  3WTT C;  1LEB A;  1IRG A;  2P5V A;  2KJC A;  2C6Y A;  1S29 A;  3TGN A;  4EJU A;  5FFX A;  3LA2 A;  3Q9V A;  4ETS A;  3FXQ A;  3KET A;  4ZYH A;  1F4K A;  3L9F A;  1EH7 A;  5FO5 A;  5AIP A;  3S2W A;  2P5K A;  5EEG A;  3V7S A;  2EFO A;  2YX4 A;  5ILS A;  2ZBK A;  4QLC U;  2OQR A;  5JR3 A;  4KMF A;  3DPT A;  3WTZ A;  4S04 A;  3D5L A;  4FT8 A;  3DPL C;  3F23 A;  1YIO A;  5ICC A;  2HYG D;  3IC7 A;  3JTG A;  2OZU A;  2A6H F;  2IPQ X;  2VN2 A;  5FFZ A;  3GW2 A;  3G73 A;  3BRO A;  1JHH A;  3KEO A;  1YLF A;  4XLN F;  1TW3 A;  1Y0U A;  3J80 Z;  1VTN C;  3L00 A;  4FX0 A;  1T98 A;  4RGR A;  4KMU X;  1UFM A;  2QWW A;  5JVT A;  4MTE A;  4U7D A;  1REP C;  5D4S A;  1JE8 A;  4GGG A;  4KT5 C;  3L2C A;  4LLN A;  4EM2 A;  1W5S A;  2EFN A;  4I0A A;  3I59 B;  1R36 A;  1RI7 A;  2PN6 A;  3U9G A;  2HWV A;  3N97 A;  1RNL A;  2HZT A;  5E8I A;  2MH2 A;  1S8N A;  1Z1D A;  5HS9 A;  4XRF A;  2BYV E;  3KLN A;  5L3G A;  1ZAR A;  1H0M A;  2M45 A;  3SHF A;  1S3J A;  1QNT A;  1O7L A;  2V1X A;  3F72 A;  1UB9 A;  2QYO A;  3EET A;  4GXO A;  1WSU A;  4HOB A;  1OYI A;  4M74 A;  1I1G A;  3BWG A;  5E20 A;  4KA4 A;  2ZXJ A;  3BDD A;  1KQ0 A;  3FHZ A;  2GIV A;  2VON A;  2UXN A;  4EJV A;  1YQA A;  3ZP5 A;  2EJR A;  1PP8 F;  4LG0 B;  2ZNZ A;  2O3F A;  4L5J A;  2YSR A;  1XDU A;  4HF0 A;  1E17 A;  3ZMT A;  3SZP A;  1CF7 A;  1F1Z A;  3GWZ A;  3R6S A;  3V8K A;  2IVM A;  1MKM A;  1UHM A;  5CVU A;  2FRH A;  5LHG A;  2BEO A;  2EK5 A;  1KU7 A;  4ZZD A;  1ZN2 A;  2PQ8 A;  2VBW A;  3MQ0 A;  2NS0 A;  1D3Y A;  3IHU A;  2G9W A;  3O3K A;  5L3E A;  1MGT A;  1HXD A;  2HQR A;  1LB2 A;  1FBU A;  2BE5 F;  1ULY A;  1J5Y A;  1WRJ A;  1FNN A;  5HS7 A;  2FNP A;  3DEU A;  3GO5 A;  2FF4 A;  3Q9S A;  4OMZ A;  4D0P A;  2M87 A; 
#chains in the Genus database with same CATH topology
 4HDV A;  2GQQ A;  3SQN A;  5C4X J;  2IRF G;  3F3X A;  1XTA A;  3AAF A;  4G8X A;  1G59 A;  3A1Y A;  4R1H A;  4ZYD A;  4KN4 X;  2V1N A;  1I5Z A;  1FMV A;  1H8A C;  2HDD A;  5FKK A;  3T1B A;  4FE7 A;  3NAU A;  3FKI J;  3VFZ A;  2OD5 A;  1LNW A;  1J09 A;  2JTV A;  2RAE A;  4YFN F;  1T33 A;  3C2H A;  4X6A J;  3KZY A;  4UXN A;  1K79 A;  3CC4 I;  2XKP A;  1I50 J;  3K4C A;  2R7V A;  4C3H J;  2WAD A;  2ISY A;  3C18 A;  2HTS A;  4EV0 A;  3MKL A;  2DT6 A;  2JSC A;  2L7F P;  1W0U A;  3DKX A;  4RGU A;  5GAD J;  1R5H A;  4BJ5 C;  4MQV A;  4ANJ A;  1GV5 A;  4BGD A;  3OYK A;  2HTJ A;  4N4O B;  1GVD A;  3JSP A;  2EZH A;  2XGD A;  1Q1H A;  4R8H A;  2JJ7 A;  5J40 A;  5B66 C;  3K4M A;  2KHM A;  1V5F A;  4AC0 A;  1KQ9 A;  1X2N A;  2ZJQ F;  2LY9 A;  5E8G A;  1DU0 A;  4HV5 A;  4KYW A;  5F08 A;  4M9X A;  3I55 I;  3QP5 A;  3TDU C;  4O5V A;  4BAC A;  5EEH A;  3OIP A;  4BY7 J;  2DQL A;  2F5F A;  3CUQ B;  4BQQ A;  3O8H A;  5DCM B;  1MH4 A;  1XB4 A;  1FOK A;  3G1L A;  4CH7 A;  4FET A;  4CUG A;  2UUZ A;  4RB2 C;  3EUH C;  1SFE A;  3CCV I;  3W2V A;  2VIX A;  2WB1 A;  2CUF A;  1JKO C;  4F52 A;  2DK8 A;  3VWB A;  4YFX F;  2R3S A;  1LFP A;  2Y0M A;  1JTY A;  1XG1 A;  3AL0 C;  1LDK B;  2BXY A;  2OA4 A;  1GXP A;  2QQ9 A;  3MZH A;  1NHA A;  1SFO J;  3UKG A;  4HF1 A;  3LSG A;  2HYF A;  2M7A A;  2LP0 A;  4L0Y B;  3HTS B;  3B02 A;  1TWA J;  3KLO A;  2JSP A;  5ILV A;  2RQP A;  3BOQ A;  2W00 A;  4LIV A;  2UV1 A;  1OKR A;  2A5W A;  5M5X J;  1FTZ A;  3I0T A;  2NVQ J;  4HF2 A;  2CQN A;  1EH6 A;  2BV6 A;  4MEY F;  3QRF F;  2MC4 A;  3WGH A;  2XKO A;  5CVV A;  3AKZ A;  3EQL F;  1OLT A;  2FJ1 A;  1F5T A;  1D0X A;  1BOA A;  2LMD A;  1ZRC A;  2Q2E B;  4M73 A;  1IRF A;  3ZCO A;  2VT2 A;  3CES A;  1YX3 A;  1ZKG A;  2WA0 A;  4XLC A;  3LFK A;  3TO6 A;  2QEX I;  4B44 A;  1R1U A;  3KP3 A;  5EF6 A;  1SFK A;  1BC7 C;  5FGM A;  4AU7 A;  3KYC B;  1HW2 A;  1MMA A;  4XMY A;  4UB6 C;  4DGW B;  3N4M A;  2ZXW H;  3TOB A;  4U0V A;  2R7Q A;  1W36 D;  1QQI A;  3OR1 C;  3D0S A;  5DD4 A;  2Q0O A;  1WJ5 A;  1TWH J;  3BTC A;  2CWE A;  1M1E B;  2MD0 A;  2VXZ A;  1YJ9 I;  1PUF B;  5HDG A;  1JT6 A;  3O2P E;  3R60 A;  4BDZ A;  5CVI A;  2EH3 A;  1HSJ A;  3DBH B;  4CCM A;  1J7K A;  4A2U A;  4NBQ A;  2M30 A;  3TMO A;  5EGO A;  1A31 A;  3TW6 A;  1WCM J;  3JRA A;  5BMZ A;  2JUC A;  3HOY J;  2OJE D;  2VJ4 A;  3I9V 2;  1S9H A;  2DO7 A;  2X6X A;  3QP6 A;  4XBF A;  4AD9 A;  4BE2 A;  2CFX A;  3SFZ A;  3I64 A;  1HCR A;  2HEO A;  1YW8 A;  2VJI A;  5C44 J;  1ITY A;  2ELK A;  5DD8 A;  2V79 A;  3K4B A;  2XAG A;  1I39 A;  4X1E A;  4Z2Y A;  3ZR8 X;  2IA0 A;  1X58 A;  3SXY A;  4A3F J;  3ZRG A;  4JQF A;  5JLX A;  4BE1 A;  1VF9 A;  2BY3 A;  1BA5 A;  4P9U A;  4B3X A;  3FXM A;  2NNN A;  4IRG A;  4IZZ A;  5FRM A;  2JA5 J;  2E1M B;  2H8R A;  3W2A A;  2R7Z J;  2H09 A;  4XK4 A;  3X2Q H;  2K27 A;  3ZMD A;  3CCJ I;  4HPQ A;  5D8L B;  3W3C A;  2NVY J;  1MMG A;  4WXH A;  5IYD J;  1U9O A;  1FLI A;  4RB1 A;  3BTL A;  5LHI A;  4ZC3 A;  3V42 A;  2V6E A;  2RVC A;  1HDD C;  2RGV A;  1MZB A;  2JPC A;  3ASO H;  3BR6 A;  1N77 A;  4PGG A;  2TCT A;  2OTL I;  1JHF A;  4PJL A;  4B1R A;  3FHN A;  4E7K A;  3TDZ C;  2WB1 N;  4XN3 A;  4RLQ A;  1YW9 A;  3JRI A;  3DKW A;  3S15 J;  1BI3 A;  3NEU A;  5FKN A;  5FLV A;  2F5C A;  3E3V A;  3C2B A;  1XCB A;  4G7O F;  4OAZ A;  4BS9 A;  1ODD A;  4EM0 B;  1UZC A;  2ID6 A;  3H3Z A;  3ESW B;  3LSM A;  1F9N A;  3M4O J;  4L9N A;  4UVC A;  5F6F A;  3C2G A;  2HQN A;  4C30 A;  2R7S A;  3RPQ A;  4KNY A;  2O61 A;  4F91 B;  5CQE A;  2G0E A;  3SEQ A;  3T5X A;  2E36 A;  5J8C A;  4UUV A;  2JA2 A;  1WJC A;  5FLX K;  4YIF A;  1SD4 A;  2KIF A;  2ZXH A;  4HDU A;  2KRC A;  3ZN1 A;  1UMQ A;  4RGS A;  1FX7 A;  1Y6I A;  2Y48 A;  1MSE C;  3MEX A;  2E1C A;  5HDN A;  3S3N A;  2AS5 F;  2Q8K A;  4D7N A;  1XDS A;  5FKO A;  3O8G A;  4JP0 A;  2XAJ A;  4MNU A;  2NS8 A;  5IY5 H;  4LIT A;  1Z7U A;  5F1R A;  4L18 B;  4P96 A;  3EUA A;  1MDM B;  3S2D J;  2LD5 A;  1W0T A;  3S14 J;  3R61 A;  1OCT C;  2GXG A;  2EA4 A;  4Q48 A;  4MFD A;  4E7J A;  1FEX A;  4ENJ A;  2WBM A;  4DQ2 A;  2GM4 A;  2D2W A;  2XUB A;  3K4N A;  2CW0 F;  2WC2 A;  3JRG A;  1YOV B;  2HKO A;  2VC1 A;  2LKP A;  1BW6 A;  1LVA A;  2CYY A;  3G71 I;  4A0Y A;  2EZI A;  4A12 A;  3CUQ A;  3GTM J;  4QIW N;  5ED4 A;  4I09 A;  1UEL B;  2WWY A;  1T0F A;  4MHG A;  1IUF A;  4Y4R A;  4CO8 A;  4IX7 A;  2XDV A;  4IL6 C;  3V7R A;  3LAP A;  2AHQ A;  3DTK A;  4XOT A;  2MBF A;  5FLX Z;  5JHU A;  1BR1 A;  1MBJ A;  3SZT A;  2QUF A;  2DJN A;  3ZQQ A;  1DU6 A;  5AIQ A;  4XON A;  3DV8 A;  3OYN A;  5HLI A;  2KMU A;  2F2E A;  2NVU B;  1G3T A;  2G7H A;  4BXF A;  2FA5 A;  4HNV A;  3PQJ A;  2M4G A;  3OS1 A;  1Z3X A;  2AXL A;  5EZH A;  4ZH4 F;  1IXS B;  3GX4 X;  1SFU A;  1JKR C;  5F0C A;  2HR3 A;  4JX4 A;  1EJ9 A;  2A07 F;  5HLH A;  4P1W A;  2X6Y A;  1VQK I;  3OYA A;  1L3L A;  1FC3 A;  4D1Q A;  4M6X A;  2VQH A;  4DOZ A;  3F9K A;  2VOD A;  2ICW G;  2EB7 A;  2BXZ A;  4L9J A;  1KU3 A;  3BPV A;  5E17 F;  3PUB A;  5ILU A;  3HUG A;  2M4K A;  3BG5 A;  1DGR M;  4A5M A;  1OFC X;  3DEE A;  3EDP A;  3TKY A;  5E3M A;  2DLL A;  2K9N A;  3BG6 A;  1JTX A;  2OZ6 A;  4BYY A;  3QPS A;  2RDP A;  2BW3 B;  2HNH A;  3HEF A;  3M07 A;  2A61 A;  2DN0 A;  1T95 A;  4CSW A;  4X0G A;  3MN2 A;  4YFK F;  4I02 A;  3HDD A;  1UHW A;  2FNA A;  3CC7 I;  2KP6 A;  1FSH A;  1X2M A;  4PZJ A;  4LGW A;  3OYI A;  1FYM A;  1GHC A;  6PAX A;  2X0L A;  2P6S A;  4XLE A;  2XGX A;  2IGN A;  4UV9 A;  2LRE A;  1BIA A;  3JCU C;  3L7W A;  4UVB A;  3KP7 A;  3GYH X;  2O8X A;  2PFB A;  5L3D A;  2DFI A;  1U9N A;  4B09 A;  1UCR A;  1O3S A;  1B59 A;  4OIO F;  1VQM I;  3VSK A;  3E6D A;  4BKX A;  2XAS A;  2VPL A;  4IRH A;  4UY8 I;  1BI2 A;  3GUD A;  2ZCW A;  3OOP A;  3BLY A;  1B9M A;  2P8T A;  4A3L J;  4A93 J;  4ENM A;  3ONQ A;  2XRN A;  3OYG A;  2Z33 A;  5FKM A;  1HDP A;  1K78 B;  2DTZ A;  2ELJ A;  2ME0 A;  2GBY A;  2EIK H;  5BNG A;  2HQA A;  1VQO I;  4KIS A;  2E5N A;  3CCS I;  3FXL A;  2H6B A;  4W1U A;  4AWX B;  1FZP B;  1LPQ A;  1TP4 A;  2ZFW A;  3HL2 A;  2WTE A;  2MA3 A;  4E4H A;  1ZLK A;  2KQR A;  1IDZ A;  3FK6 A;  4II2 A;  1K61 A;  4MEX F;  1HF0 A;  1QBJ A;  2QBY B;  3DP7 A;  3S1N J;  3ABM H;  3CP8 A;  4B43 A;  4CYC A;  2NYX A;  4WXC A;  2MYS A;  1Y39 A;  1TT5 B;  3ERE D;  4HNU A;  2V7F A;  1DGW Y;  1JJ8 C;  1TQP A;  2CMP A;  3LWF A;  1K6Y A;  3ZMV A;  5EG0 A;  2B7E A;  3Q5F A;  2ECC A;  4RAY A;  1I3A A;  5J1U A;  1TT0 A;  3K6G A;  5CVJ A;  2D5V A;  2VKH A;  5F1J A;  4EVI A;  1ETW A;  2EQR A;  4RB0 A;  3LST A;  4BQN A;  3FM3 A;  3DCF A;  3IL2 A;  3WU1 B;  3IWZ A;  3OR2 C;  3ABU A;  3ABK H;  2EA2 A;  1LUJ B;  1PDN C;  2EZL A;  2KIM A;  1U5T A;  4XOR A;  4KIT B;  4N4N B;  3U21 A;  2QKL B;  4ZTJ A;  1X3Z B;  2M2E A;  1WPK A;  3TED A;  1D1C A;  2JVG A;  3VB2 A;  4Y7N J;  3M8E A;  2COB A;  3TW7 A;  1E0E A;  2FUG 2;  2L7K A;  4BUP A;  4ESB A;  5TIS C;  2LC2 A;  4DZJ A;  1XC5 A;  5LGT A;  5EDN A;  4UVA A;  4XKW A;  1X1P A;  1VZ0 A;  3KYD B;  4RLF A;  1X19 A;  3L2W A;  1QHG A;  2Y0S A;  3GZ5 A;  1QPM A;  1LVK A;  2P5L C;  1ZG3 A;  5HLT A;  3BJ6 A;  4HLY A;  1NK2 P;  1P92 A;  1NTC A;  2EIL H;  2VE8 A;  4PSX A;  3WU2 C;  1OIS A;  2R7F A;  3HOV J;  5GPC A;  2FQ3 A;  4XRS A;  4XRM A;  1R58 A;  2W84 A;  1P6R A;  4G7Z F;  5TRD A;  1MDM A;  2QQA A;  2DFH A;  4OIN F;  1R22 A;  2O9L A;  1YHQ I;  3FXU A;  4C3J J;  1VQ8 I;  3CLQ A;  4HZF A;  1WHU A;  4M9Z A;  3BCB A;  4OWR B;  3VDX A;  1CQT A;  3S3O A;  1Y8R B;  1T39 A;  4DNC A;  1OCP A;  1L0O C;  1XPX A;  1IN7 A;  1XGO A;  1T6S A;  4MO7 A;  3WG7 H;  3L2U A;  2WY8 Q;  4A3D J;  3S1M J;  3A4C A;  5TGT A;  1ZK8 A;  2P4W A;  4WWC A;  5H6Q A;  4ZYE A;  1MBH A;  5F0H A;  3WTV C;  4NDL A;  5FRN A;  3KP6 A;  1GV2 A;  2XRL A;  1WJE A;  3VYU B;  2Y2Z A;  2ISZ A;  3MKW B;  3BJA A;  2XB0 X;  1RKT A;  5GAH J;  4M72 A;  5LLQ A;  1RR8 C;  4KT6 A;  3BZ6 A;  2LRD A;  3ROU A;  1LKX A;  4EMS A;  3L09 A;  3HOX J;  1DP7 P;  2Z99 A;  3HRS A;  4HV6 A;  5K5O A;  3QOD A;  3TP3 A;  2H27 A;  3S17 J;  3RCO A;  1KON A;  4FCY A;  2FE3 A;  4UUS B;  1B72 B;  3DTE A;  4RA2 A;  3DPU A;  1JJ6 C;  3PO3 J;  1JGG A;  2QEN A;  3S32 A;  1QZY A;  2R7D A;  1SD7 A;  3OL3 A;  4CHU A;  3I3L A;  5D5W B;  2K9L A;  1W7P A;  2ZFU A;  2FD5 A;  3WOD F;  4AUX A;  2A69 F;  3BCA A;  2YPR A;  5HOO A;  2K7L A;  1BL0 A;  3JRH A;  4BQO A;  2M8G X;  1SVM A;  2EV6 A;  2FOK A;  4HRI A;  4GRI A;  1YW7 A;  1UHS A;  3M7G A;  1ZH5 A;  5F04 A;  2JA8 J;  2ZME B;  4E7L A;  4IQ4 A;  2DA5 A;  2GZW A;  4M6V A;  4ZZL A;  1Z9C A;  1SFX A;  3FXK A;  3RDI A;  5K7F A;  2EFQ A;  5FKL A;  3OY9 A;  1VQ7 I;  1TWF J;  2X1C A;  4MQ9 F;  1YRN B;  1SD6 A;  3WHC A;  1UJ8 A;  2GIZ A;  4G9Y A;  4A6E A;  3HOZ J;  3FX3 A;  4LG3 A;  4H0E A;  1SVL A;  3E5U A;  1KA8 A;  2M3A A;  1VQP I;  1G3W A;  2OCC H;  5GP9 A;  5D5X B;  5JFR A;  1PP7 U;  2V26 A;  2Z2S B;  3E1S A;  2E1O A;  3WTX C;  2AQE A;  3ZQI A;  2D45 A;  1A35 A;  1OCC H;  2OC6 A;  4EJO A;  1NK3 P;  2DQR A;  3PL8 A;  1LE8 B;  4HAM A;  4Q47 A;  2FSW A;  5HLG A;  1TQM A;  2L3D A;  1DPU A;  2BY0 A;  2QSF X;  3H0D A;  4I99 C;  1IN4 A;  1LDJ A;  2X51 A;  3MCZ A;  3QYE A;  1XCV A;  3RZD J;  4OMY A;  3BTJ A;  1K7A A;  3SYT A;  3DTI A;  4W97 A;  3B6A A;  3ZQ7 A;  3LSJ A;  4BEH A;  3HTU A;  2Y0S N;  1TC3 C;  2UXX A;  3S8P A;  4A3J J;  2DT7 B;  3M9A A;  1MIJ A;  4KIC A;  2YU3 A;  1RIO H;  5L3B A;  3H0G J;  1V4R A;  1IF1 A;  1S6L A;  1GDT A;  3MWM A;  3Q3S A;  2RC4 A;  5DM7 F;  3HSE A;  2XPU A;  3T8R A;  2XAU A;  4B4C A;  5JVG F;  2MG4 A;  2IP2 A;  2V4J C;  2R5Y A;  1V5E A;  5GAE J;  2XRO A;  2HOT A;  2KT0 A;  1IUY A;  4WX9 A;  5DUI A;  3CJT B;  3GCM A;  4BDY A;  1ZG5 A;  2EWN A;  2UZK A;  2ZNY A;  3F8B A;  1BJA A;  1A5J A;  4CCJ A;  1Z7L A;  1VQ9 I;  2ACJ A;  1Q1V A;  5LHH A;  3VYT B;  4I2O A;  1AU7 A;  2R93 J;  5FD5 A;  4LOC A;  2DPU A;  1R00 A;  4XSZ F;  4GCV A;  4XOP A;  2TDX A;  5F27 A;  1X4P A;  4LLL A;  4L9V A;  2IGK A;  3DKY A;  2KLO A;  4A6D A;  5LRR A;  1U3E M;  5CPR B;  4HSR A;  3GME A;  4Y52 J;  1OCO H;  4C3I J;  3HXL A;  4L0Z B;  2FX0 A;  1AWC A;  3CTA A;  2LBF B;  2JWT A;  4WXD A;  1X1B A;  1YX5 A;  4PSW A;  1DUX C;  3Q0V A;  2XPV A;  4XM3 A;  2QKM B;  4JX6 A;  2ZXI A;  1F36 A;  2GOM A;  2DA1 A;  3H36 A;  4ZDP A;  2I5U A;  3DF8 A;  1R23 A;  4XL9 A;  1T0F C;  2STW A;  4B8X A;  2P7V B;  4P9F A;  3ZQL A;  3CUO A;  5KK1 A;  4EQQ A;  2IS4 A;  4HX8 A;  3M1E A;  4LLG F;  2TRT A;  4DZP A;  2JRM A;  3I59 A;  3NWS A;  3IV5 A;  2BVM A;  1I27 A;  4DYC A;  4OAY A;  4Y13 A;  3GVA A;  3CJQ B;  1Z6R A;  4L5E A;  2VI6 A;  4CCL A;  1GT0 C;  4U88 A;  1SMY F;  4EEF G;  2V9P A;  1R7J A;  1JUS A;  2KIS A;  2IEK A;  3BJO A;  3IWF A;  2ESH A;  3D1N I;  3CCY A;  5BPI A;  5LGN A;  4BAY A;  1USS A;  5H20 A;  4E70 A;  4KIB A;  3W6K B;  4C9Y A;  1D8K A;  3DU5 A;  3P9I A;  5TJJ A;  3OSF A;  3AL0 B;  1YS7 A;  2ZSI B;  1XN7 A;  4YEL A;  5M3F J;  2A05 A;  3WU0 A;  1BC8 C;  2JMW A;  1FJL A;  4I6Z A;  1IDY A;  1IXR C;  2DAO A;  1ETQ A;  4ENK A;  1IAW A;  4K2E A;  1IN8 A;  2W25 A;  5DCF A;  2F5E A;  3HB9 A;  1TZL A;  3ASN H;  2HOA A;  2L2O A;  3IKV A;  1S7O A;  3QWL A;  4RB3 C;  2PI0 A;  1UG2 A;  3W6V A;  4NQW B;  2JRT A;  1QPI A;  5LGU A;  2W1O A;  1ONV A;  1EV7 A;  2CH0 A;  3BZC A;  3F6V A;  5IP7 J;  3FF5 A;  1WH5 A;  5H2F C;  2VLA A;  4L5I A;  4FTH A;  3H3V K;  4YG2 F;  4AVP A;  3K70 D;  1KYZ A;  3PIO F;  4E7Z A;  2EV5 A;  1QVT A;  4IHS A;  1UST A;  1QZE A;  1YJN I;  2E60 A;  3ZQG A;  4LG0 A;  2JPB A;  1MNE A;  1P9Q C;  1KU2 A;  2M8E A;  3HJE A;  1WWX A;  3GFM A;  5E3O A;  2H1K A;  3FMQ A;  5E3L A;  4CZZ A;  3CDL A;  3ZMU A;  2W7N A;  3P7N A;  1TLH B;  3VOD A;  4PFO A;  3QAH A;  1T2K A;  3A0H C;  4F7Z A;  4UNO A;  4PCQ A;  3LSH A;  4QSH A;  2YR2 A;  2YS9 A;  4FE4 A;  1T56 A;  2JVH A;  4QWQ A;  4DYQ A;  3VOE A;  2DI3 A;  1KGS A;  1HKT A;  1FBQ A;  1FIA A;  3GTP J;  2VXD A;  3HBL A;  1RC9 A;  4RAG A;  3MKZ A;  1RUN A;  2MFZ A;  2XC7 A;  3CO7 C;  4KFC A;  4M9S A;  5CYV A;  2VT3 A;  4KDP A;  1XSV A;  3FK7 A;  2BY1 A;  1PVE A;  4ITV A;  1KZH A;  3OYE A;  3K2Z A;  2OQG A;  3OYM A;  4AYB A;  4XIC A;  4U0W A;  2VOP A;  3BZK A;  5CVR A;  4EM1 A;  3RI4 A;  1EF4 A;  4ASN A;  5FLM J;  4CDG A;  3TO9 A;  2E19 A;  1NH3 A;  2YX7 A;  1MND A;  3CLO A;  3UR3 C;  1D1A A;  5D8K B;  3ZQC A;  3HOS A;  4IOA F;  3E6M A;  2J5O A;  4GYG A;  9ANT A;  1ZEL A;  1GVJ A;  2Y30 A;  5HS8 A;  4IHY A;  2L0K A;  2XAH A;  1B8I B;  2R7O A;  1V3F A;  4PDK A;  2CW8 A;  2IW5 A;  2CU7 A;  3OMY A;  2PMU A;  3J81 K;  2K40 A;  4J01 A;  1B9N A;  2OCE A;  3K4L A;  4E7S A;  4BHC A;  4HA8 A;  5JHF A;  1O4X A;  1U5T C;  3BR5 A;  1Z05 A;  3R0A A;  1MJ9 A;  4PJN A;  1G6N A;  3JAM K;  3HRT A;  3V7C A;  3BC8 A;  2L9N A;  5J1R A;  3RKQ A;  3WG9 A;  4MIM A;  1FYL A;  2W82 A;  3E6C C;  4I0B A;  4BE0 A;  4NUB A;  5BS6 A;  5F64 A;  3JSO A;  1MMN A;  3QPH A;  2VQG A;  1W5C C;  3GFL A;  1IV8 A;  4V2G A;  3HHG A;  1AA7 A;  2DTR A;  4GDF A;  4RAZ A;  2V6C A;  2Z5U A;  3CME I;  4PUS A;  1A04 A;  1JKP C;  2NOG A;  4IKF A;  4CXF A;  1IV6 A;  1WFX A;  5DTD A;  1CGP A;  2KIU A;  1X1D A;  3LMM A;  3COA C;  2EV0 A;  2XSD C;  1ERD A;  3L2Q A;  1FSE A;  3BR2 A;  2P81 A;  1F43 A;  2EFP A;  2KRH A;  3M3Y J;  5E3N A;  2KIQ A;  1IN6 A;  1BBY A;  4R79 A;  2V9V A;  2NRA C;  3WE3 A;  4CZC A;  3HYI A;  2IS1 A;  2W57 A;  5IP9 J;  3J81 Z;  2O7O A;  3PFY A;  3OYC A;  5HVQ C;  2GWR A;  5E1Z B;  3A0B C;  2M7B A;  1ON2 A;  1ETK A;  1X3U A;  3M8F A;  3JAM Z;  3OYB A;  3CCL I;  4ZDL A;  1SVO A;  1K83 J;  1QGP A;  2DMN A;  2MC3 A;  2LBF A;  4HLX A;  1FWZ A;  5DCM A;  5KVR A;  2D1V A;  3OSG A;  2EIN H;  3VYR B;  3CZ6 A;  5HDK A;  2CUZ A;  4A5N A;  3CMM A;  4M3B A;  3WGI A;  4F55 A;  2X1D A;  1X4O A;  1R1T A;  4KIG A;  1RRJ A;  1WGX A;  1T8I A;  2AQF A;  2LVS A;  2VKV A;  4RMN A;  2BHZ A;  2K4B A;  4FX4 A;  4U7B A;  3K4K A;  1YS6 A;  1GLN A;  2R92 J;  1XD7 A;  1N75 A;  1ZQ3 P;  5JLW A;  1WJA A;  2G7U A;  3FMR A;  3VPR A;  3CO6 C;  3MZY A;  2R0Q C;  5M5W J;  1VQ5 I;  3EUH A;  4IHW A;  1IRX A;  1EKE A;  5FRO A;  2Z3Y A;  2HVS A;  1JXS A;  2VOO A;  3V8L A;  2VJJ A;  2PJP A;  5GTI C;  2VQL A;  3H92 A;  1ZRD A;  1Y8Q B;  4IXA A;  1ZG1 A;  2DU9 A;  2B0L A;  1BN5 A;  1ZHF A;  4N9I A;  1FOX A;  4FHT A;  1NG7 A;  2NOJ B;  1FP1 D;  5LEK A;  2Q2E A;  5E79 C;  2BVL A;  4BXX J;  3IP4 B;  2QF7 A;  3GFI A;  1XGN A;  3B73 A;  4AYB N;  2L02 A;  4NB5 A;  5IPA A;  2OU2 A;  1APL C;  4IHT A;  1IC8 A;  5JI6 A;  3I4P A;  3R4K A;  4TV7 A;  3SDG A;  1X1C A;  3LNQ A;  3GXO A;  4XLP F;  3HOW J;  2PBI A;  1ZYR F;  4QTR A;  4A69 C;  4HQE A;  2I10 A;  3KEY A;  2Z9O A;  5D4R A;  2EFW A;  2VB6 A;  4PGH A;  3MD2 A;  1FP2 A;  2JZY A;  3OYH A;  3OV8 A;  1CF7 B;  3K1M A;  4Y17 A;  2DW4 A;  1B1B A;  1BR4 A;  1QO0 D;  2X4H A;  1BW5 A;  3K9T A;  5IOZ A;  2ETH A;  3RKW A;  1PUF A;  1FTT A;  2EBI A;  1WVR A;  1XS9 A;  1DDN A;  2A6E F;  2L01 A;  1TNT A;  4CYD A;  3M8J A;  4BH9 A;  3PFI A;  3TOA A;  1POG A;  5K7Z A;  3JW4 A;  5B1B H;  5D5V B;  2B9S A;  2QLZ A;  4IJA A;  3J7A O;  5DDG A;  2JQ7 A;  2ME6 A;  3K69 A;  1HKQ A;  3IH2 A;  5LD2 C;  3K1P A;  2CV2 A;  1J9I A;  3ZN0 A;  4PJ0 C;  4ZYG A;  4DBR A;  5KHD A;  4LB6 B;  4I76 A;  2E5Z A;  3RYR A;  3H3U A;  2E71 A;  2BBY A;  1XMX A;  4XN0 A;  4C2M J;  3KIO A;  1K4S A;  3FMS A;  2D1H A;  5J8F A;  2GA1 A;  3GEZ A;  3T0Y A;  3V4G A;  1BIB A;  1YG2 A;  3QYF A;  2CUE A;  2MAB A;  3JR9 A;  3OWT A;  4LMY A;  4RBO A;  3H9J A;  2HI3 A;  3PM1 A;  4M3F A;  5BPD A;  1MBK A;  3L2R A;  5L3F A;  4H4K C;  1JT0 A;  1TNS A;  4G6D A;  1W36 C;  1G2H A;  2GXB A;  2PMZ A;  3J80 K;  3I4N J;  2GOX B;  2M1B A;  5E18 F;  2KRF A;  3KEQ A;  1FYK A;  3FXO A;  1ZR2 A;  4C2U A;  1B8I A;  2H6C A;  3GBG A;  3RQI A;  3TQN A;  3ZPL A;  3HOU J;  3Q0U A;  4KIF A;  3BPX A;  5GTH C;  5M3M J;  4P5O A;  2R7X A;  2O5R A;  3OYF A;  2NXN B;  2DMT A;  2MD5 A;  2K3F A;  2Q1Z B;  1ZR4 A;  1J59 A;  1OCR H;  3F0C A;  4CGZ A;  1X1A A;  1YFH A;  1ETO A;  2VKD A;  5GPA A;  1YE9 A;  2WAQ A;  4RM2 A;  4M6Y A;  3T8T A;  4G7H F;  1HKS A;  4F3Q A;  5E1X A;  1VQ6 I;  5ICF A;  4HW0 A;  2PMH A;  3H5R A;  3K0L A;  4FQG A;  3OS0 A;  2RNJ A;  2W24 A;  3ABT A;  3MMY B;  4M3E A;  3G1M A;  1XX5 A;  3QPT A;  3C7J A;  4EJT A;  2LDU A;  2HOE A;  3BQZ A;  2PX9 A;  3CP2 A;  2KZG A;  1GXQ A;  1I3Q J;  2LYC A;  5ERI A;  4OOI A;  1B6A A;  2H1L A;  4NC8 A;  4PFP A;  2QA4 I;  1T38 A;  1HST A;  2HU9 A;  3OL4 A;  4JYK A;  3I58 A;  3H5N A;  3ZOB A;  2LLK A;  2O0Y A;  4UV8 A;  1I6X A;  3KZI C;  5K5Q A;  3O6B B;  2N8G A;  2OBP A;  2QSG X;  2W48 A;  3RPU D;  3G2B A;  2CW7 A;  2A3S A;  1STZ A;  2NAZ A;  5DYM A;  3ULQ B;  1LJ9 A;  2IAI A;  2I8D A;  1FY7 A;  3RKX A;  2LF7 A;  2ESN A;  2CO5 A;  2OPT A;  4AIJ A;  3SFI A;  3RPU A;  2DK5 A;  4D5F A;  2VKE A;  3LL7 A;  1V5G A;  3TO7 A;  5FD6 A;  2CUJ A;  2LY2 A;  5C3E J;  4NC6 A;  4LB5 A;  4DJA A;  1Z3Y A;  3BG3 A;  2L7M P;  4ESJ A;  1TQI A;  4A3I J;  3KX2 A;  4E7I A;  3KZZ A;  4DYR A;  3LSP A;  2WY7 Q;  3CCQ I;  2CGP A;  3ABL H;  4XR6 A;  3RJP A;  2DA4 A;  3HRU A;  1RR7 A;  1RZ4 A;  1ETY A;  2MLG A;  4Q4Z F;  2JUG A;  2V1U A;  2QGU A;  2X9D A;  2XGE A;  3I71 A;  2F5V A;  1U8R A;  1ZRE A;  4ABZ A;  2X48 A;  4G6Q A;  3PUF A;  2ADU A;  3CCM I;  3GTG J;  1D5V A;  5DV5 A;  4S0H B;  1JGS A;  1JKQ C;  1VI0 A;  2W4S A;  1ZAO A;  2GXA A;  1MBG A;  1WJF A;  3ZQH A;  2BY2 A;  2OAZ A;  1YYV A;  1HQC A;  2PG4 A;  3E5Q A;  3WTS C;  1AOY A;  4A3G J;  1S72 I;  2M0C A;  1OJL A;  3BQY A;  4BBS J;  3ECO A;  5M5Y J;  3IRQ A;  1TL8 A;  1KQ8 A;  1FPQ A;  3LA7 A;  2VC0 A;  4XQF A;  4YII A;  2CQK A;  2WV0 A;  3QPL A;  4L9T A;  1MJA A;  4AIK A;  4IHX A;  3A2K A;  3BP8 A;  4HST A;  2DMU A;  2WV1 A;  2DJI A;  3FWE A;  2IA2 A;  4I01 A;  5ICE A;  4MLO A;  2A6T A;  4BL0 B;  3GZN B;  3KP2 A;  1BM9 A;  2JT1 A;  4UHT A;  2HOS A;  1QHH D;  3PO2 J;  1LFU P;  2CS3 A;  3DLL F;  2MGQ A;  3J7Z I;  2PMZ N;  2DDA A;  2BW3 A;  2RQQ A;  5IYB J;  4ZJZ A;  4RDU A;  3IKT A;  3IAM 2;  5IOY A;  4A3C J;  1FBS A;  1YI2 I;  4AM3 A;  3HZJ A;  3JTH A;  4I98 B;  3HGY A;  2KDO A;  1HA8 A;  3ZMS A;  1P4A A;  3LAJ A;  3GZ6 A;  3DU6 A;  1MH3 A;  2M9H A;  3HM5 A;  3I4M J;  1R5G A;  5DEQ A;  3ECH A;  1H9G A;  2BOL A;  2LKS A;  1WJB A;  2A5Y B;  1O3Q A;  2H8W A;  3SZG A;  1U2W A;  5DM6 F;  3WTW C;  1ETX A;  1TWG J;  4Y33 A;  4B47 A;  2WAQ N;  4XKC A;  1S5L C;  1ZTR A;  2DOD A;  5CJ9 A;  3EYI A;  3GTQ J;  5D6E A;  1R5I D;  4DBQ A;  3JRD A;  1ZLJ A;  5B3S H;  3CMY A;  3OIO A;  4CCN A;  1Z0X A;  1FOW A;  1YO5 C;  4XNF A;  5B5E C;  1U8B A;  1K78 A;  2UWM A;  3ERM A;  3LA3 A;  2XF6 A;  4U0Y A;  1S7E A;  4IF4 A;  1J2X A;  2HVQ A;  2HGC A;  3LFU A;  3H5A A;  2Y9Y A;  3W2W A;  1W1W E;  2VJ5 A;  4BJT A;  3P9C A;  3WTU C;  1G4D A;  1A36 A;  2R7R A;  2GLO A;  3LSK A;  1WZ2 A;  4BU2 A;  2QBY A;  2KL4 A;  2M0M A;  5E1W A;  5IT9 K;  5C4J J;  2PEX A;  2GAU A;  3BG7 A;  3S2H J;  1R4N B;  1HLV A;  2Z16 A;  4RGX A;  1FMW A;  2YU9 J;  3NRV A;  2ZKZ A;  1K4T A;  2MH9 A;  1IRZ A;  2XGC A;  4MFE A;  4BBR J;  2XIG A;  5J1Y A;  2IXS A;  3I54 A;  1ZGW A;  4II3 A;  3PJR A;  3CD6 I;  2MW8 A;  4B48 A;  4EGZ A;  3HG9 A;  5HNF A;  3UNG C;  2X85 A;  4HBL A;  3PQK A;  3R0J A;  1E3O C;  3I53 A;  2HPI A;  3OYL A;  2NNY A;  1W5T A;  1WI9 A;  3LQQ A;  5D6F A;  4C2T A;  3HSF A;  4EAT A;  2NVT J;  4G6T B;  4I7H A;  3VEP A;  1U0J A;  4A0Z A;  1MMS A;  3Q0W A;  3FXR A;  2Y69 H;  3ISP A;  3CUQ C;  4JK1 X;  2F4I A;  3JRC A;  2DA6 A;  1OQY A;  3V8J A;  2FBK A;  2LNB A;  4IVN A;  4DIQ A;  2QZ8 A;  2LSO A;  3RKY A;  2A68 F;  5IT3 A;  5J6X A;  1LDD A;  5IT9 Z;  1LEA A;  2CJJ A;  2DYS H;  1W7P D;  3S3M A;  2HQ5 A;  2KJB A;  3KP4 A;  2K5C A;  2CV0 A;  1LFB A;  2RKH A;  4O3M A;  2HS5 A;  1O3R A;  1RPW A;  2DT5 A;  2R7T A;  3GF2 A;  1PUE E;  3K2A A;  3RIR A;  4ZYA A;  2EIJ H;  2L4A A;  1XGS A;  1VND A;  2DCE A;  5A2Q K;  2E2I J;  2F5D A;  2F4O B;  2IBD A;  2XV4 S;  4RS8 A;  1R6R A;  1H9T A;  2DDB A;  2KFD A;  5HNH A;  4IRI A;  4EJW A;  1HOM A;  4Q5S F;  3U2R A;  3HIF A;  3H35 A;  2LK2 A;  4U87 A;  3GTO J;  3QU3 A;  4CIC A;  4HX4 A;  2DOE A;  2FML A;  1DPR A;  1Z91 A;  3C1D A;  2XSJ C;  3WE2 A;  5EEA A;  2R7U A;  1OCZ H;  1N78 A;  1TTY A;  2Y31 A;  4OIR F;  3HOT A;  4BNC A;  3FZV A;  3HKZ A;  4IO9 F;  1PJR A;  2HXO A;  1WH7 A;  5K7H A;  1O7F A;  3QQA A;  2FEZ A;  3AG3 H;  2STT A;  4Y15 A;  3KE2 A;  1Z6T A;  3F8C A;  3CJN A;  4WF2 A;  1ZGJ A;  3KPH A;  2CSO A;  1LQ1 A;  2R5Z B;  1IZ1 A;  3KP5 A;  3F8F A;  2L7Z A;  3DLA A;  3J7A Y;  1D5Y A;  1P2F A;  1UAA A;  3PNT A;  4A3B J;  2J5P A;  3MFK A;  2HPM A;  4J19 A;  2LR8 A;  3JRE A;  2VBX A;  2ZSH B;  1YTY A;  4DW6 A;  1KYW A;  3GFJ A;  4N0B A;  5FB2 A;  5KAI C;  4XLA A;  1BJZ A;  1Z67 A;  3HUG B;  5D5U B;  5A2Q Z;  1R9T J;  5LEJ A;  3ML6 A;  2JA7 J;  2DFE A;  4UUS A;  2RN7 A;  1B72 A;  1HBX G;  1E3P A;  1TBX A;  3K1N A;  4O6J A;  2BGC A;  3RTR A;  3CDH A;  3C3W A;  1R71 A;  3EPZ A;  3CJR B;  1EH8 A;  2JK3 A;  3FBI B;  4N9H A;  3WGG A;  1G3Y A;  3ZMZ A;  2QQB A;  3EYY A;  4BHB A;  2CG4 A;  3NQO A;  2O6G E;  2BZT A;  3DQV C;  4HQM A;  2COM A;  2FBI A;  2B63 J;  3DBR B;  3KFW X;  4RAF A;  4FAS D;  5B1A H;  4EGY A;  2DXI A;  4BJ6 C;  3N05 A;  2F4M B;  1XSD A;  3VSL A;  1U6G A;  2ZB9 A;  2XAF A;  2ZME A;  2VE9 A;  2ZJ2 A;  3L2V A;  2AO9 A;  3REO A;  1HC8 A;  3FDY A;  2EZK A;  2KPM A;  2LFB A;  2XAQ A;  1RUO A;  3WTY C;  1YRN A;  2HFH A;  3G6E I;  3F6O A;  1VFC A;  5K5R A;  2HKX A;  3KCC A;  5ICG A;  2ZJR F;  2JA6 J;  3CMA I;  2E1M C;  4HYE A;  1BI0 A;  4ENN A;  1WKM A;  2KZV A;  1U78 A;  4XID A;  1UG0 A;  1SD5 A;  4LK0 F;  1J75 A;  3HSR A;  3IRR A;  2HZD A;  3QYB A;  4M71 A;  4P55 A;  4NHJ A;  3RYP A;  4LJZ F;  2K9M A;  1LE8 A;  1ON1 A;  2AXT C;  5HOD A;  1IN5 A;  5LFA A;  4CYC B;  3P5J A;  2RV8 A;  1MBE A;  4RM3 A;  2JN6 A;  4ESF A;  2ZO4 A;  4WK8 F;  2DPD A;  3OIQ A;  1NG6 A;  3HC7 A;  5LBQ A;  4YEJ A;  5EG0 B;  1D1B A;  3F8N A;  3CC2 I;  2K4J A;  1OR7 A;  1TWC J;  4PJM A;  3JRF A;  1KU9 A;  4D7M A;  3TL4 X;  3E6B A;  3GTK J;  1P4W A;  3DXJ F;  4IOC F;  3ZXS A;  1A6I A;  2BHY A;  3I56 I;  3PSI A;  1IGN A;  1RKW A;  4GO1 A;  2P6T A;  3MAJ A;  3A01 B;  3QU6 A;  3WHB A;  4XKV A;  1U5T B;  3JRB A;  3CDI A;  4BXU A;  1SMT A;  4JBA A;  2IS6 A;  1BR2 A;  2OV7 A;  3IH3 A;  3U1D A;  3S1R J;  2ELH A;  4LK1 F;  2IT0 A;  5H6R A;  5KAF C;  3P9K A;  3K10 A;  1RES A;  2XPW A;  3FM5 A;  1FT9 A;  2E7W A;  2QSH X;  1MD0 A;  2L4M A;  2FMY A;  1H89 C;  2K86 A;  2PLY A;  1XGM A;  2GA2 A;  1O3T A;  3HKZ N;  1ZGA A;  4HX7 A;  4JX5 A;  3A02 A;  4OIQ F;  2ZJP F;  2ECB A;  3GLX A;  4WCG A;  4LIU A;  4JOM A;  4OU0 A;  1IW7 F;  3OOU A;  2E1N A;  3MKY B;  1HW5 A;  1MW7 A;  2MSY A;  4AID A;  4S05 A;  2X1E A;  1QZZ A;  1VQL I;  5F0F A;  1E2X A;  2LF8 A;  4AIH A;  2M34 A;  3E5X A;  2CQ7 A;  1P7I A;  1IXC A;  5L3C A;  4FIS A;  2NS7 A;  3NWT A;  2DYR H;  3ZQF A;  2R4G A;  5BQT A;  1ACI A;  4AVZ A;  1ORK A;  2XF7 A;  1SC7 A;  1A6Q A;  1GUU A;  1TW2 A;  3AG1 H;  5CLS A;  3AFH A;  3E97 A;  4NC7 A;  3F21 A;  2HDW A;  1D8J A;  2DA2 A;  2QVO A;  1YIT I;  1I1S A;  4CA0 A;  1IG7 A;  1OYW A;  2V1D A;  4KJZ A;  3EUK L;  3MVP A;  1AKH B;  2DMQ A;  1ZRF A;  4LD5 A;  5AON A;  3DFG A;  5K1Y A;  2FBH A;  5EYR A;  3BTI A;  3BY6 A;  1HW1 A;  3VYS B;  4CCK A;  1MSF C;  3HRM A;  2P7C B;  3A03 A;  1O57 A;  3B6C A;  1EA3 A;  2XVC A;  1WQ2 A;  2HDC A;  3ELK A;  2L54 A;  4PJJ A;  1BI1 A;  1PYV A;  2VBZ A;  5LRS A;  2K9Q A;  2CV1 A;  2Z1D A;  5DUK A;  1C0W A;  2FOW A;  5J4V A;  2K85 A;  5KCM A;  4MTD A;  4KN7 X;  2LY1 A;  2M5W A;  1G3S A;  2VBY A;  2KKO A;  4A3M J;  2P0W A;  3HHH A;  2CQQ A;  2QM3 A;  2WAE A;  1JI8 A;  3F22 A;  1I6H J;  4NQW A;  1S7A A;  3MZ8 A;  3SJM A;  2R7W A;  1QU3 A;  1ETV A;  3DBL B;  3DWL E;  1XMA A;  2HYJ A;  2ID3 A;  2FQ4 A;  2IA1 A;  2R5Z A;  1OPC A;  5CKT A;  2DMP A;  1MJB A;  3RQ4 A;  1B4A A;  1W7P B;  1BOB A;  2XHK A;  4IPA A;  3OYJ A;  1K6O A;  3GTL J;  1RET A;  2LTP A;  4BQA A;  3CF5 F;  2FU4 A;  2O03 A;  1P4X A;  3CF2 A;  2W85 A;  1YIJ I;  3HGG A;  4GFB A;  5J4Y A;  2H94 A;  1XSX A;  4HNT A;  1R1V A;  1SAX A;  4LFU A;  1OYY A;  4XLF A;  4A0X A;  3F8M A;  2L9V A;  4XSX F;  2PJR B;  4A3E J;  1V55 H;  2Y75 A;  4MGR A;  2MLK A;  3QOP A;  3OS2 A;  3I5U A;  4OIP F;  1J0R A;  2E2H J;  4XLH A;  3D5R C;  3W6J B;  4G94 A;  1QRY A;  1MNM C;  2K02 A;  3CCE I;  2FXA A;  2EPF A;  3U1K A;  2DBB A;  3G3Z A;  4XRS G;  4KUM A;  4GYI A;  5J3L A;  5FJ8 J;  5BOX A;  1WI3 A;  4ON0 A;  4Z6Y A;  3LQR A;  1OMI A;  2V9K A;  1W4M A;  3KYL A;  2E7X A;  1DP3 A;  4BHP A;  2X6O A;  1XMK A;  4V2F A;  2DA3 A;  2IJL A;  3OYD A;  3S1Q J;  3WTT C;  2L9R A;  2NVX J;  1LEB A;  1JUM A;  3G1O A;  2QQ8 A;  1AHD P;  1IRG A;  2P5V A;  2IGO A;  2KJC A;  4UB8 C;  2CRG A;  2C6Y A;  1S29 A;  3S93 A;  3TGN A;  4EJU A;  5FFX A;  3LA2 A;  4QPO A;  3PNV A;  5KNL A;  3K70 C;  3HPG A;  3Q9V A;  4BEH B;  4ETS A;  2L5Q A;  3SEZ A;  3FXQ A;  3KET A;  2RRE A;  1SAU A;  4QPQ A;  4ZYH A;  1F4K A;  3LSI A;  1VQN I;  3M1C A;  3IH4 A;  3L9F A;  1EH7 A;  5FO5 A;  5AIP A;  2OUM A;  3S2W A;  1R4M B;  1WJD A;  2P5K A;  2LKX A;  1N25 A;  3BG9 A;  5EEG A;  3V7S A;  2EFO A;  2YX4 A;  2VL8 A;  1VQ4 I;  5ILS A;  4E6K G;  1MMD A;  4E7H A;  2DFF A;  4Y3O A;  4B3A A;  2ZBK A;  2R5Y B;  2VAS A;  3E7L A;  3AG4 H;  4QLC U;  5J47 A;  2OQR A;  5JR3 A;  5CQG A;  3S16 J;  4KMF A;  2F48 A;  2HXI A;  3DPT A;  3WTZ A;  4S04 A;  4F93 B;  3D5L A;  4FT8 A;  5GAG J;  1IJW C;  3DPL C;  3F23 A;  1YIO A;  5ICC A;  2HYG D;  3IC7 A;  1SAN A;  3TP0 A;  3ZGK A;  3JTG A;  2LG4 A;  2OZU A;  4UUT A;  2A6H F;  2IPQ X;  2VN2 A;  5FFZ A;  3GW2 A;  3RZO J;  3A01 A;  3G73 A;  2OTJ I;  3BR0 A;  3BRO A;  1YJW I;  1JHH A;  3KEO A;  1YLF A;  2QCO A;  3BR3 A;  4XLN F;  1TW3 A;  1Y0U A;  3J80 Z;  3G4S I;  1VTN C;  3L00 A;  4FX0 A;  3GTJ J;  1T98 A;  3CQZ J;  4RGR A;  3RSN A;  4KMU X;  3AG2 H;  3CCR I;  4BY1 J;  4D9J A;  1UFM A;  2E35 A;  2VUM J;  2QWW A;  2CQX A;  5JVT A;  1Z21 A;  1R49 A;  4MTE A;  4U7D A;  1REP C;  5D4S A;  1JE8 A;  4GGG A;  4KT5 C;  2CFO A;  2ZC2 A;  3LOC A;  3L2C A;  4LLN A;  4EM2 A;  4F92 B;  1W5S A;  2EFN A;  4I0A A;  3I59 B;  4XKB A;  3D5S C;  1R36 A;  1RI7 A;  3J7Y J;  2PN6 A;  1DQU A;  4IEJ A;  3U9G A;  2HWV A;  3N97 A;  1RNL A;  2HZT A;  5E8I A;  3DEW A;  4M3D A;  2MH2 A;  2O8K A;  1D0Y A;  1S8N A;  1Z1D A;  5EZG A;  5HS9 A;  3FBN B;  2BYV E;  4XRF A;  4V19 K;  4IQJ A;  3PNY A;  3KLN A;  2Y9Z A;  1D0Z A;  1V54 H;  2XB5 A;  2XF5 A;  3PIP F;  5L3G A;  3H1C A;  1X3W B;  1JUP A;  2EIM H;  1ZAR A;  1T08 B;  1H0M A;  2E2J J;  2M45 A;  1Y1W J;  3FKJ A;  3TBI A;  3SHF A;  3PSF A;  4G12 A;  1S3J A;  2LOO A;  2DA7 A;  3H9Q A;  1QNT A;  2LH9 A;  4ZTF A;  1O7L A;  2V1X A;  2WAF A;  3F72 A;  1FIP A;  1UB9 A;  1AKH A;  1P7J A;  2QYO A;  3HPH A;  3EET A;  3L1P A;  2IGM A;  4GXO A;  1WSU A;  3BR1 A;  4HOB A;  1OYI A;  4D5C A;  4M74 A;  1I1G A;  3H9G A;  4NNJ A;  3BWG A;  5E20 A;  4KA4 A;  2ZXJ A;  3IUO A;  3BDD A;  1KQ0 A;  3FHZ A;  2GIV A;  2OF7 A;  5IYC J;  2VON A;  2UXN A;  1MBF A;  1YQA A;  4EJV A;  4YRV A;  5DS9 A;  3ZP5 A;  2EJR A;  1PP8 F;  4LG0 B;  2ZNZ A;  4ZDO A;  2O3F A;  1Y1V J;  4L5J A;  2IS2 A;  2YSR A;  1XDU A;  4HF0 A;  1QVU A;  1H88 C;  2RNG A;  1E17 A;  2F6C A;  3ZMT A;  3SZP A;  4PK4 A;  2VPR A;  2ZME C;  5EJC A;  5EGO B;  1CF7 A;  1F1Z A;  2YUS A;  4M3G A;  3GWZ A;  3R6S A;  3V8K A;  4HG2 A;  3FIS A;  2IVM A;  3NAR A;  4YIR X;  4HEA 2;  1MKM A;  2E34 A;  1Y56 A;  5IP6 A;  1G8X A;  1UHM A;  5CVU A;  2FRH A;  5LHG A;  1SEU A;  2BEO A;  2EK5 A;  1Y0N A;  3K4J A;  4A3K J;  1KU7 A;  2X6W A;  1IO2 A;  4ZZD A;  1Z77 A;  1ZN2 A;  2KDZ A;  2PQ8 A;  2PJR A;  2VBW A;  1FOY A;  4IHV A;  1E3H A;  1ENH A;  2VQC A;  2K3P A;  3MQ0 A;  3FIW A;  1QA6 A;  2NS0 A;  1D3Y A;  3IHU A;  2G9W A;  3O3K A;  3K7A J;  5L3E A;  1MGT A;  1HXD A;  2HQR A;  3FXJ A;  1LB2 A;  1FBU A;  2BE5 F;  4CCO A;  3SDB A;  2K9S A;  1ULY A;  1J5Y A;  2DOA A;  3IAS 2;  1WRJ A;  2DOF A;  2HVR A;  1OR7 C;  3E0J B;  3LSR A;  1FNN A;  5HS7 A;  3GLL A;  3CCU I;  2FNP A;  3DEU A;  3GO5 A;  2FF4 A;  3Q9S A;  4OMZ A;  3QOE A;  4D0P A;  3BT9 A;  4J00 A;  2L9S A;  2M87 A; 
#chains in the Genus database with same CATH homology
 4HDV A;  2GQQ A;  3SQN A;  2IRF G;  3F3X A;  3AAF A;  4G8X A;  4R1H A;  4ZYD A;  4KN4 X;  1I5Z A;  3T1B A;  3VFZ A;  2OD5 A;  1LNW A;  2JTV A;  4YFN F;  3KZY A;  4UXN A;  1K79 A;  2XKP A;  2ISY A;  3C18 A;  2HTS A;  4EV0 A;  2JSC A;  4RGU A;  1R5H A;  4MQV A;  2HTJ A;  3JSP A;  1Q1H A;  4R8H A;  1KQ9 A;  5E8G A;  4HV5 A;  4KYW A;  4M9X A;  3QP5 A;  3TDU C;  4O5V A;  5EEH A;  2DQL A;  2F5F A;  3CUQ B;  5DCM B;  1XB4 A;  1FOK A;  4RB2 C;  1SFE A;  2DK8 A;  4YFX F;  2R3S A;  2Y0M A;  1LDK B;  2OA4 A;  1GXP A;  2QQ9 A;  3MZH A;  1NHA A;  4HF1 A;  2HYF A;  4L0Y B;  3HTS B;  3B02 A;  3KLO A;  5ILV A;  2RQP A;  3BOQ A;  1OKR A;  3I0T A;  4HF2 A;  1EH6 A;  2BV6 A;  4MEY F;  3QRF F;  3WGH A;  2XKO A;  5CVV A;  3EQL F;  1F5T A;  1BOA A;  1ZRC A;  4M73 A;  1IRF A;  2VT2 A;  3LFK A;  3TO6 A;  1R1U A;  3KP3 A;  1BC7 C;  5FGM A;  1HW2 A;  3N4M A;  3TOB A;  4U0V A;  1QQI A;  3D0S A;  5DD4 A;  2Q0O A;  2CWE A;  2VXZ A;  5HDG A;  3R60 A;  3O2P E;  5CVI A;  1HSJ A;  1J7K A;  4A2U A;  2M30 A;  5BMZ A;  2DO7 A;  3QP6 A;  4XBF A;  4AD9 A;  2CFX A;  3SFZ A;  3I64 A;  2HEO A;  1YW8 A;  5DD8 A;  2V79 A;  2XAG A;  4Z2Y A;  2IA0 A;  3SXY A;  4JQF A;  4P9U A;  2NNN A;  4IRG A;  2H09 A;  2K27 A;  3ZMD A;  5D8L B;  4WXH A;  1FLI A;  4RB1 A;  5LHI A;  2RVC A;  2RGV A;  1MZB A;  2JPC A;  4PGG A;  1JHF A;  3TDZ C;  1YW9 A;  3DKW A;  1BI3 A;  3NEU A;  2F5C A;  3E3V A;  1XCB A;  4G7O F;  1ODD A;  4EM0 B;  3H3Z A;  1F9N A;  4L9N A;  4UVC A;  5F6F A;  2HQN A;  3RPQ A;  4KNY A;  2O61 A;  3T5X A;  5J8C A;  4UUV A;  5FLX K;  4YIF A;  1SD4 A;  2KIF A;  4HDU A;  3ZN1 A;  4RGS A;  1FX7 A;  2Y48 A;  3MEX A;  2E1C A;  5HDN A;  2AS5 F;  2Q8K A;  1XDS A;  2XAJ A;  4MNU A;  1Z7U A;  5F1R A;  4L18 B;  4P96 A;  1MDM B;  3R61 A;  2GXG A;  2EA4 A;  4Q48 A;  4ENJ A;  4DQ2 A;  2D2W A;  2XUB A;  2CW0 F;  2WC2 A;  2HKO A;  2VC1 A;  2LKP A;  1LVA A;  2CYY A;  4A0Y A;  4A12 A;  3CUQ A;  5ED4 A;  4I09 A;  2WWY A;  1T0F A;  4MHG A;  4CO8 A;  3V7R A;  3LAP A;  2MBF A;  5FLX Z;  5JHU A;  3SZT A;  2QUF A;  5AIQ A;  3DV8 A;  5HLI A;  2F2E A;  1G3T A;  2G7H A;  2FA5 A;  3PQJ A;  2AXL A;  4ZH4 F;  1IXS B;  3GX4 X;  1SFU A;  2HR3 A;  2A07 F;  5HLH A;  1L3L A;  1FC3 A;  4M6X A;  2VOD A;  2EB7 A;  4L9J A;  1KU3 A;  3BPV A;  5E17 F;  5ILU A;  3HUG A;  4A5M A;  3EDP A;  3TKY A;  2DLL A;  2OZ6 A;  4BYY A;  2RDP A;  2A61 A;  4YFK F;  4I02 A;  1UHW A;  2FNA A;  1FSH A;  4PZJ A;  4LGW A;  1FYM A;  1GHC A;  6PAX A;  2P6S A;  2X0L A;  2XGX A;  4UV9 A;  1BIA A;  3L7W A;  4UVB A;  3KP7 A;  3GYH X;  2O8X A;  2PFB A;  5L3D A;  2DFI A;  4B09 A;  1UCR A;  1O3S A;  1B59 A;  4OIO F;  3E6D A;  2XAS A;  4IRH A;  1BI2 A;  3GUD A;  2ZCW A;  3OOP A;  1B9M A;  2P8T A;  4ENM A;  2XRN A;  2Z33 A;  1K78 B;  2H6B A;  4AWX B;  1FZP B;  2ZFW A;  2WTE A;  2MA3 A;  1ZLK A;  4MEX F;  1QBJ A;  2QBY B;  3DP7 A;  2NYX A;  4WXC A;  3ERE D;  1TQP A;  3LWF A;  3ZMV A;  3Q5F A;  4RAY A;  5CVJ A;  4EVI A;  4RB0 A;  3LST A;  3FM3 A;  3IL2 A;  3WU1 B;  3IWZ A;  3ABU A;  2EA2 A;  1PDN C;  2KIM A;  1U5T A;  3VB2 A;  3M8E A;  4ESB A;  5LGT A;  4UVA A;  3GZ5 A;  1QPM A;  2P5L C;  1ZG3 A;  3BJ6 A;  4HLY A;  1P92 A;  2VE8 A;  2R7F A;  2FQ3 A;  1R58 A;  2W84 A;  1P6R A;  4G7Z F;  5TRD A;  1MDM A;  2QQA A;  4OIN F;  1R22 A;  3FXU A;  4HZF A;  4M9Z A;  1T39 A;  4DNC A;  1L0O C;  1IN7 A;  1XGO A;  1T6S A;  2P4W A;  4WWC A;  5H6Q A;  4ZYE A;  3WTV C;  3KP6 A;  2ISZ A;  3BJA A;  4M72 A;  5LLQ A;  3BZ6 A;  3ROU A;  4EMS A;  3L09 A;  1DP7 P;  2Z99 A;  3HRS A;  4HV6 A;  5K5O A;  2H27 A;  2FE3 A;  2QEN A;  1QZY A;  2R7D A;  1SD7 A;  4CHU A;  5D5W B;  1W7P A;  3WOD F;  2A69 F;  2YPR A;  5HOO A;  2K7L A;  2EV6 A;  2FOK A;  1YW7 A;  3M7G A;  1ZH5 A;  2ZME B;  1Z9C A;  2GZW A;  4ZZL A;  1SFX A;  3RDI A;  2EFQ A;  4MQ9 F;  1SD6 A;  4G9Y A;  4A6E A;  3FX3 A;  4H0E A;  3E5U A;  1KA8 A;  1G3W A;  5D5X B;  5JFR A;  1PP7 U;  3WTX C;  2D45 A;  4EJO A;  2DQR A;  4HAM A;  4Q47 A;  2FSW A;  5HLG A;  1TQM A;  2L3D A;  1DPU A;  1IN4 A;  1LDJ A;  3MCZ A;  4OMY A;  1XCV A;  1K7A A;  3ZQ7 A;  3HTU A;  2UXX A;  3M9A A;  4KIC A;  2YU3 A;  1RIO H;  5L3B A;  1V4R A;  1IF1 A;  1S6L A;  3MWM A;  2RC4 A;  3HSE A;  3T8R A;  2IP2 A;  2XRO A;  1IUY A;  4WX9 A;  5DUI A;  1ZG5 A;  2EWN A;  2UZK A;  2ZNY A;  3F8B A;  1BJA A;  2ACJ A;  5LHH A;  4I2O A;  5FD5 A;  2DPU A;  1R00 A;  4XSZ F;  4GCV A;  2TDX A;  4LLL A;  4L9V A;  4A6D A;  5LRR A;  1U3E M;  4L0Z B;  1AWC A;  3CTA A;  4WXD A;  1DUX C;  3DF8 A;  1R23 A;  2STW A;  4B8X A;  2P7V B;  4P9F A;  3CUO A;  5KK1 A;  4EQQ A;  4HX8 A;  3M1E A;  4LLG F;  3I59 A;  1I27 A;  4Y13 A;  3GVA A;  1Z6R A;  4U88 A;  1SMY F;  1R7J A;  3BJO A;  3IWF A;  2ESH A;  5BPI A;  5LGN A;  4BAY A;  1USS A;  5H20 A;  4E70 A;  4KIB A;  3W6K B;  1D8K A;  3P9I A;  5TJJ A;  1YS7 A;  1XN7 A;  3WU0 A;  1BC8 C;  1IXR C;  2DAO A;  4ENK A;  1IAW A;  4K2E A;  1IN8 A;  2W25 A;  5DCF A;  2F5E A;  3IKV A;  1S7O A;  4RB3 C;  2JRT A;  5LGU A;  1ONV A;  1EV7 A;  3F6V A;  3FF5 A;  4L5I A;  4YG2 F;  4AVP A;  1KYZ A;  2EV5 A;  4IHS A;  1UST A;  4LG0 A;  2JPB A;  1KU2 A;  2M8E A;  1WWX A;  3GFM A;  3FMQ A;  4CZZ A;  3ZMU A;  3P7N A;  1TLH B;  3VOD A;  1T2K A;  3QAH A;  4F7Z A;  4UNO A;  4PCQ A;  2YR2 A;  4QWQ A;  3VOE A;  2DI3 A;  1KGS A;  1HKT A;  1FBQ A;  1RUN A;  3CO7 C;  4KFC A;  4M9S A;  5CYV A;  2VT3 A;  4KDP A;  1XSV A;  3K2Z A;  2OQG A;  4U0W A;  2VOP A;  5CVR A;  4EM1 A;  3RI4 A;  4ASN A;  4CDG A;  3TO9 A;  2YX7 A;  3CLO A;  5D8K B;  3HOS A;  3E6M A;  2J5O A;  4GYG A;  1GVJ A;  5HS8 A;  2XAH A;  4PDK A;  1V3F A;  2IW5 A;  2PMU A;  3J81 K;  1B9N A;  4BHC A;  4HA8 A;  1U5T C;  1Z05 A;  3R0A A;  1MJ9 A;  1G6N A;  3JAM K;  3HRT A;  3V7C A;  3WG9 A;  1FYL A;  3E6C C;  4I0B A;  3JSO A;  5BS6 A;  5F64 A;  3QPH A;  3GFL A;  3HHG A;  2DTR A;  4RAZ A;  2V6C A;  2Z5U A;  1A04 A;  4CXF A;  1CGP A;  2KIU A;  3COA C;  2EV0 A;  1FSE A;  2EFP A;  1IN6 A;  1BBY A;  4R79 A;  2V9V A;  2NRA C;  3WE3 A;  3HYI A;  2W57 A;  3J81 Z;  5HVQ C;  2GWR A;  5E1Z B;  1ON2 A;  1X3U A;  3M8F A;  3JAM Z;  1QGP A;  2MC3 A;  4HLX A;  1FWZ A;  5DCM A;  5KVR A;  2D1V A;  5HDK A;  4A5N A;  3WGI A;  1R1T A;  4KIG A;  2K4B A;  4FX4 A;  4U7B A;  1YS6 A;  1XD7 A;  2G7U A;  3FMR A;  3CO6 C;  3MZY A;  3EUH A;  2Z3Y A;  1JXS A;  2VOO A;  3V8L A;  2PJP A;  3H92 A;  1ZRD A;  4IXA A;  1ZG1 A;  2DU9 A;  2B0L A;  1BN5 A;  1ZHF A;  4N9I A;  4FHT A;  1FP1 D;  5LEK A;  2Q2E A;  3GFI A;  1XGN A;  3B73 A;  2L02 A;  4NB5 A;  2OU2 A;  4IHT A;  5JI6 A;  3I4P A;  3R4K A;  4TV7 A;  3GXO A;  4XLP F;  2PBI A;  1ZYR F;  2Z9O A;  4HQE A;  5D4R A;  2EFW A;  4PGH A;  1FP2 A;  2JZY A;  3OV8 A;  1CF7 B;  3K1M A;  4Y17 A;  2DW4 A;  1B1B A;  1QO0 D;  2X4H A;  3K9T A;  2ETH A;  3RKW A;  1DDN A;  2A6E F;  2L01 A;  1TNT A;  4CYD A;  4BH9 A;  3PFI A;  3TOA A;  3JW4 A;  5D5V B;  2QLZ A;  4IJA A;  3J7A O;  5DDG A;  3K69 A;  1HKQ A;  3K1P A;  1J9I A;  3ZN0 A;  4ZYG A;  4LB6 B;  3RYR A;  3H3U A;  2BBY A;  3FMS A;  2D1H A;  5J8F A;  2GA1 A;  3GEZ A;  3T0Y A;  3V4G A;  1BIB A;  1YG2 A;  4LMY A;  5BPD A;  5L3F A;  1TNS A;  4G6D A;  2GXB A;  3J80 K;  2M1B A;  5E18 F;  2KRF A;  3KEQ A;  1FYK A;  2H6C A;  3ZPL A;  3TQN A;  4KIF A;  3BPX A;  4P5O A;  2MD5 A;  1J59 A;  4CGZ A;  1YFH A;  4M6Y A;  3T8T A;  4G7H F;  1HKS A;  5E1X A;  5ICF A;  4HW0 A;  2PMH A;  3K0L A;  2RNJ A;  2W24 A;  3ABT A;  3QPT A;  3C7J A;  4EJT A;  2LDU A;  2HOE A;  1GXQ A;  5ERI A;  4OOI A;  1B6A A;  1T38 A;  1HST A;  3I58 A;  2O0Y A;  4UV8 A;  1I6X A;  5K5Q A;  3O6B B;  2OBP A;  2A3S A;  1STZ A;  2NAZ A;  5DYM A;  3ULQ B;  1LJ9 A;  1FY7 A;  3RKX A;  2LF7 A;  2ESN A;  2CO5 A;  4AIJ A;  3RPU A;  2DK5 A;  3TO7 A;  5FD6 A;  4LB5 A;  4ESJ A;  1TQI A;  3KZZ A;  2CGP A;  3RJP A;  3HRU A;  1RZ4 A;  2MLG A;  4Q4Z F;  2V1U A;  3I71 A;  1U8R A;  1ZRE A;  4G6Q A;  2ADU A;  1D5V A;  5DV5 A;  1JGS A;  1ZAO A;  2OAZ A;  1YYV A;  1HQC A;  2PG4 A;  3E5Q A;  3WTS C;  1AOY A;  3ECO A;  3IRQ A;  1KQ8 A;  1FPQ A;  3LA7 A;  2VC0 A;  4YII A;  2CQK A;  2WV0 A;  4L9T A;  1MJA A;  4AIK A;  3BP8 A;  3FWE A;  2IA2 A;  4I01 A;  5ICE A;  3KP2 A;  1BM9 A;  2JT1 A;  4UHT A;  3IKT A;  1FBS A;  4I98 B;  3JTH A;  3ZMS A;  1P4A A;  3LAJ A;  3GZ6 A;  1R5G A;  5DEQ A;  3ECH A;  1H9G A;  2A5Y B;  1O3Q A;  1U2W A;  3WTW C;  5CJ9 A;  3EYI A;  5D6E A;  1ZLJ A;  1YO5 C;  1K78 A;  2UWM A;  3LA3 A;  4U0Y A;  4IF4 A;  1J2X A;  2HGC A;  3WTU C;  3P9C A;  1G4D A;  2QBY A;  5E1W A;  5IT9 K;  2PEX A;  2GAU A;  4RGX A;  3NRV A;  2ZKZ A;  2MH9 A;  2XIG A;  3I54 A;  4EGZ A;  4HBL A;  3PQK A;  3R0J A;  3I53 A;  2NNY A;  1W5T A;  1WI9 A;  3LQQ A;  5D6F A;  3HSF A;  4I7H A;  3VEP A;  4A0Z A;  3FXR A;  3ISP A;  3CUQ C;  4JK1 X;  3V8J A;  2FBK A;  2LNB A;  4IVN A;  2QZ8 A;  2LSO A;  3RKY A;  2A68 F;  5IT3 A;  5J6X A;  1LDD A;  5IT9 Z;  1LEA A;  1W7P D;  2KJB A;  3KP4 A;  4O3M A;  2RKH A;  2HS5 A;  1O3R A;  2DT5 A;  3GF2 A;  1PUE E;  3RIR A;  2L4A A;  1XGS A;  5A2Q K;  2F5D A;  2XV4 S;  4RS8 A;  1H9T A;  4IRI A;  4EJW A;  4Q5S F;  3U2R A;  3HIF A;  3QU3 A;  4CIC A;  4HX4 A;  2FML A;  1DPR A;  1Z91 A;  3C1D A;  3WE2 A;  1TTY A;  3HOT A;  4OIR F;  4BNC A;  3FZV A;  1O7F A;  2FEZ A;  2STT A;  4Y15 A;  3KE2 A;  1Z6T A;  3F8C A;  3CJN A;  4WF2 A;  1ZGJ A;  1LQ1 A;  2CSO A;  1IZ1 A;  3KP5 A;  3F8F A;  1P2F A;  2J5P A;  3MFK A;  2VBX A;  1YTY A;  5D5U B;  1KYW A;  3GFJ A;  4N0B A;  5FB2 A;  5A2Q Z;  2PI0 A;  5LEJ A;  3ML6 A;  2RN7 A;  1HBX G;  1TBX A;  3K1N A;  4O6J A;  2BGC A;  3RTR A;  3CDH A;  3C3W A;  1EH8 A;  4N9H A;  3WGG A;  1G3Y A;  3ZMZ A;  2QQB A;  4BHB A;  3EYY A;  2CG4 A;  3NQO A;  2O6G E;  3DQV C;  4HQM A;  2COM A;  2FBI A;  3KFW X;  4EGY A;  1XSD A;  1U6G A;  2XAF A;  2ZME A;  2VE9 A;  2ZJ2 A;  3REO A;  2XAQ A;  1RUO A;  3WTY C;  2HFH A;  3F6O A;  5K5R A;  2HKX A;  3KCC A;  5ICG A;  4HYE A;  1BI0 A;  4ENN A;  1WKM A;  1U78 A;  1SD5 A;  4LK0 F;  1J75 A;  3HSR A;  3IRR A;  4M71 A;  4P55 A;  4NHJ A;  3RYP A;  4LJZ F;  1ON1 A;  1IN5 A;  2RV8 A;  4ESF A;  4WK8 F;  2ZO4 A;  2DPD A;  5LBQ A;  3F8N A;  2K4J A;  1OR7 A;  1KU9 A;  3E6B A;  1P4W A;  3DXJ F;  4GO1 A;  2P6T A;  3MAJ A;  3QU6 A;  1U5T B;  4BXU A;  1SMT A;  4JBA A;  3U1D A;  2ELH A;  4LK1 F;  2IT0 A;  5H6R A;  3P9K A;  3FM5 A;  1FT9 A;  2E7W A;  1MD0 A;  2L4M A;  2FMY A;  2K86 A;  2PLY A;  1XGM A;  2GA2 A;  1O3T A;  1ZGA A;  4HX7 A;  4OIQ F;  3GLX A;  4WCG A;  4OU0 A;  1IW7 F;  2E1N A;  1HW5 A;  4S05 A;  1QZZ A;  1E2X A;  2LF8 A;  4AIH A;  3E5X A;  1IXC A;  5L3C A;  5BQT A;  1TW2 A;  5CLS A;  3E97 A;  3F21 A;  1D8J A;  2QVO A;  1I1S A;  1OYW A;  2V1D A;  1ZRF A;  4LD5 A;  5AON A;  3DFG A;  5K1Y A;  2FBH A;  3BY6 A;  1HW1 A;  3HRM A;  2P7C B;  1O57 A;  2XVC A;  1WQ2 A;  2HDC A;  3ELK A;  2L54 A;  1BI1 A;  2VBZ A;  5LRS A;  5DUK A;  1C0W A;  4MTD A;  4KN7 X;  2M5W A;  1G3S A;  2VBY A;  2KKO A;  3HHH A;  2QM3 A;  3F22 A;  4NQW A;  1S7A A;  1XMA A;  2IA1 A;  1OPC A;  1MJB A;  1B4A A;  1W7P B;  2XHK A;  4IPA A;  1K6O A;  4BQA A;  2FU4 A;  2O03 A;  1P4X A;  2W85 A;  2H94 A;  1XSX A;  1R1V A;  1SAX A;  4LFU A;  1OYY A;  4A0X A;  3F8M A;  4XSX F;  2Y75 A;  4MGR A;  2MLK A;  3QOP A;  3I5U A;  4OIP F;  1J0R A;  3W6J B;  4G94 A;  2K02 A;  2FXA A;  2DBB A;  3G3Z A;  4KUM A;  4GYI A;  5BOX A;  4ON0 A;  3LQR A;  1OMI A;  1W4M A;  2E7X A;  4BHP A;  1XMK A;  2IJL A;  3WTT C;  1LEB A;  1IRG A;  2P5V A;  2KJC A;  2C6Y A;  1S29 A;  3TGN A;  4EJU A;  5FFX A;  3LA2 A;  3Q9V A;  4ETS A;  3FXQ A;  3KET A;  4ZYH A;  1F4K A;  3L9F A;  1EH7 A;  5FO5 A;  5AIP A;  3S2W A;  2P5K A;  5EEG A;  3V7S A;  2EFO A;  2YX4 A;  5ILS A;  2ZBK A;  4QLC U;  2OQR A;  5JR3 A;  4KMF A;  3DPT A;  3WTZ A;  4S04 A;  3D5L A;  4FT8 A;  3DPL C;  3F23 A;  1YIO A;  5ICC A;  2HYG D;  3IC7 A;  3JTG A;  2OZU A;  2A6H F;  2IPQ X;  2VN2 A;  5FFZ A;  3GW2 A;  3G73 A;  3BRO A;  1JHH A;  3KEO A;  1YLF A;  4XLN F;  1TW3 A;  1Y0U A;  3J80 Z;  1VTN C;  3L00 A;  4FX0 A;  1T98 A;  4RGR A;  4KMU X;  1UFM A;  2QWW A;  5JVT A;  4MTE A;  4U7D A;  1REP C;  5D4S A;  1JE8 A;  4GGG A;  4KT5 C;  3L2C A;  4LLN A;  4EM2 A;  1W5S A;  2EFN A;  4I0A A;  3I59 B;  1R36 A;  1RI7 A;  2PN6 A;  3U9G A;  2HWV A;  3N97 A;  1RNL A;  2HZT A;  5E8I A;  2MH2 A;  1S8N A;  1Z1D A;  5HS9 A;  4XRF A;  2BYV E;  3KLN A;  5L3G A;  1ZAR A;  1H0M A;  2M45 A;  3SHF A;  1S3J A;  1QNT A;  1O7L A;  2V1X A;  3F72 A;  1UB9 A;  2QYO A;  3EET A;  4GXO A;  1WSU A;  4HOB A;  1OYI A;  4M74 A;  1I1G A;  3BWG A;  5E20 A;  4KA4 A;  2ZXJ A;  3BDD A;  1KQ0 A;  3FHZ A;  2GIV A;  2VON A;  2UXN A;  4EJV A;  1YQA A;  3ZP5 A;  2EJR A;  1PP8 F;  4LG0 B;  2ZNZ A;  2O3F A;  4L5J A;  2YSR A;  1XDU A;  4HF0 A;  1E17 A;  3ZMT A;  3SZP A;  1CF7 A;  1F1Z A;  3GWZ A;  3R6S A;  3V8K A;  2IVM A;  1MKM A;  1UHM A;  5CVU A;  2FRH A;  5LHG A;  2BEO A;  2EK5 A;  1KU7 A;  4ZZD A;  1ZN2 A;  2PQ8 A;  2VBW A;  3MQ0 A;  2NS0 A;  1D3Y A;  3IHU A;  2G9W A;  3O3K A;  5L3E A;  1MGT A;  1HXD A;  2HQR A;  1LB2 A;  1FBU A;  2BE5 F;  1ULY A;  1J5Y A;  1WRJ A;  1FNN A;  5HS7 A;  2FNP A;  3DEU A;  3GO5 A;  2FF4 A;  3Q9S A;  4OMZ A;  4D0P A;  2M87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...