1FYKA

Serendipitous crystal structure containing the heat shock transcription factor's dna binding domain and cognate dna that is translationally disordered
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
92
structure length
88
Chain Sequence
ARPAFVNKLWSMVNDKSNEKFIHWSTSGESIVVPNRERFVQEVLPKYFKHSNFASFVRQLNMYGWHKVQDVKSGNNDSRWEFENERHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HSE DNA-PHOSPHATE BACKBONE
publication title Crystal packing interaction that blocks crystallization of a site-specific DNA binding protein-DNA complex.
pubmed doi rcsb
source organism Kluyveromyces lactis
molecule tags Transcription/dna
total genus 21
structure length 88
sequence length 92
ec nomenclature
pdb deposition date 2000-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fykA00
4IRGA 3ZPLA 3GF2A 2EV6A 1IN7A 1DPUA 3WU0A 1ZGAA 1ZN2A 2G7UA 5ICCA 1QBJA 2E7XA 3CUOA 3L7WA 1QZZA 2P6TA 1R7JA 1U5TA 4G7OF 2M5WA 2HYGD 4UV9A 4U0YA 2OZ6A 5H20A 3ECHA 5LEJA 1SFEA 1SMTA 2BV6A 2LSOA 3WTSC 5CVUA 3F3XA 3WTXC 1TW3A 3E5UA 4UVCA 5AONA 3IWZA 2BEOA 2V1XA 4UVAA 4EVIA 2QQAA 1O3SA 1U78A 3GVAA 5EEHA 2QBYB 2FQ3A 3RYPA 2O8XA 2XIGA 4N0BA 2CSOA 1FP1D 1IXRC 5D8LB 3DKWA 1IXSB 1JXSA 5E18F 4LG0B 4I02A 4Q4ZF 3IC7A 4BYYA 2K86A 4YIFA 2UXXA 1WKMA 5FGMA 3TO6A 4GXOA 1FP2A 4ZYGA 1ZG1A 1USTA 4HBLA 3PFIA 4KMFA 2XVCA 2YX7A 3G3ZA 2MLKA 3GFMA 3EETA 3SHFA 3V7CA 1O7FA 2ISZA 3WTVC 4Q47A 2WTEA 2Z5UA 3K1NA 4A0ZA 4EMSA 3BROA 1G3YA 1HSJA 5ERIA 5LRRA 1I27A 5IT9K 1MZBA 1A04A 3BJAA 4LFUA 3E3VA 1FZPB 5CYVA 5AIQA 2V79A 2HDCA 4PGGA 3ABTA 4KN7X 4ENJA 1W5TA 3GWZA 1I1GA 2RQPA 3KLNA 1ULYA 4I01A 2GXBA 5FD6A 5E1WA 3SXYA 1USSA 3BP8A 3GEZA 2M30A 4ASNA 1KA8A 2W57A 2DK8A 4A5MA 2CGPA 2QM3A 4ENMA 3ELKA 2L4MA 2IRFG 3HOSA 2JT1A 1MGTA 3ZMSA 3FMRA 1UFMA 2D1VA 1S7AA 2F2EA 2O3FA 4ON0A 2W25A 2X4HA 2HTSA 3REOA 3KP7A 5DD4A 5ILVA 1FOKA 3RYRA 3E5XA 3HTSB 3HUGA 3NQOA 4Z2YA 3HOTA 3V7RA 5K5QA 2P5KA 1IRGA 5J8FA 3CLOA 2YSRA 4RGXA 5FFXA 3I54A 5CVIA 3RKWA 3KLOA 3Q5FA 4PZJA 4RAYA 4G8XA 2P7VB 3FX3A 4TV7A 1G3WA 4ESBA 5JR3A 1OMIA 3IKVA 2M1BA 5E17F 1S8NA 2Q2EA 1SAXA 4HX7A 2VOPA 5FO5A 2NNYA 3WTUC 3LAPA 2LF8A 3K1MA 2V6CA 2VT3A 4WCGA 1HBXG 2XROA 3FXQA 2VT2A 3G73A 1LNWA 4KMUX 3T1BA 3LWFA 1SD5A 1ZYRF 2A07F 4KNYA 4HLXA 4AIJA 2P6SA 4BHCA 1W5SA 4KFCA 1IZ1A 4P5OA 3H3UA 2W24A 5LGTA 5TRDA 1U2WA 1OKRA 3KEQA 5CLSA 5LLQA 1PP7U 4CXFA 1J75A 2ETHA 1HKQA 2VN2A 4P55A 5D8KB 3GFJA 4HOBA 2Q8KA 2Q0OA 1S29A 3RKXA 1ZARA 4M72A 2RVCA 3ML6A 1HW1A 3H3ZA 3GZ5A 1R00A 2HGCA 5LRSA 5ICGA 3DV8A 4U0VA 4HW0A 4QLCU 4G7ZF 3KP6A 3JSOA 1J7KA 4GO1A 4EM2A 4FT8A 1MKMA 3TKYA 1BM9A 4OIPF 1QPMA 1XB4A 2QQ9A 4LK1F 3D0SA 4HV5A 1F4KA 3ZMZA 2HKXA 3J80K 4JBAA 2F5FA 3QRFF 4L9NA 4AD9A 2WV0A 4M6XA 2L02A 1S7OA 1G4DA 3T8RA 4CZZA 2PI0A 3O3KA 2BYVE 4Y13A 2EFNA 4G6DA 1XGNA 4LK0F 3QPTA 4ENKA 2LNBA 2F5CA 3QP6A 3TO7A 2IA2A 4XLNF 1B9MA 1VTNC 4O6JA 2CW0F 2GA2A 3M1EA 4XRFA 5K5OA 3MCZA 3FMSA 2ELHA 2Z99A 2Z3YA 4NB5A 1BOAA 1O3TA 4RB1A 5D5VB 1B9NA 3KP2A 1PP8F 5IT3A 3R4KA 1O57A 4YFKF 2A6EF 4K2EA 4MTDA 1LVAA 4L9TA 4A0YA 5J6XA 5CJ9A 2L3DA 5DCMA 3GFIA 3KEOA 4Y15A 3I71A 4ZYEA 2JRTA 2XUBA 5LGUA 1MD0A 1YQAA 2M8EA 1LEBA 1FLIA 4LB6B 1R1UA 2L54A 1ZGJA 3L09A 5HVQC 1IAWA 4M9SA 3BY6A 5HDNA 1MJBA 2GZWA 3HRMA 1Y0UA 5AIPA 3GFLA 2W85A 1QNTA 2YPRA 1JGSA 1FNNA 1EH7A 2HFHA 1GXQA 3H92A 4I09A 1LEAA 1LDKB 2E7WA 1R58A 1XSXA 1U6GA 1HSTA 3J7AO 5HS7A 2H6CA 4B09A 3IRRA 2FXAA 3IRQA 2E1CA 2OQRA 4HF1A 3M8EA 3QAHA 3WG9A 2PQ8A 4GCVA 3U9GA 2IPQX 5J8CA 5TJJA 3ABUA 3RJPA 3CTAA 2LF7A 4HF0A 1QO0D 2IJLA 3DEUA 4RS8A 5BS6A 3F21A 2XAGA 4M9ZA 5BMZA 5FLXK 1YTYA 2KJBA 4KN4X 3GX4X 3HRUA 1HKTA 1IXCA 2FNAA 1Z6RA 2XAFA 5HLIA 2JPCA 3RTRA 5LHGA 1U8RA 3QP5A 4FHTA 4U0WA 1SFXA 4ETSA 2G7HA 3B73A 2DQLA 1LB2A 2V9VA 2R3SA 3LSTA 1K7AA 3EUHA 3F72A 4CDGA 4WXDA 3BJOA 4DQ2A 3I0TA 3W6JB 4DNCA 3FXUA 1KU7A 3F8MA 3LA2A 2A61A 3Q9SA 3CDHA 2XRNA 1ZG3A 2GWRA 4OINF 2MLGA 1S3JA 5ICFA 2CG4A 1Z7UA 3S2WA 3K0LA 4YFXF 3RKYA 4M6YA 2HZTA 1K6OA 3ZMTA 3M8FA 2PEXA 3I59B 3EYIA 5E1XA 4MGRA 3KZZA 3GLXA 2DBBA 3HSFA 4G9YA 2RN7A 2EFWA 4S04A 4L9JA 4ZYDA 3HHGA 1TW2A 2M45A 2OZUA 2DPUA 1YLFA 4EGYA 5ICEA 2GAUA 2KIFA 1B6AA 2FNPA 3WU1B 2HQNA 3E6DA 5D4SA 3F6OA 2DTRA 5HS8A 3RDIA 1V3FA 1E17A 4LMYA 1DUXC 5FFZA 3JAMZ 1B59A 1SD6A 1WQ2A 3LAJA 2ADUA 5CVJA 1B4AA 4A6DA 3TDZC 3VFZA 1LQ1A 3GUDA 1C0WA 5A2QZ 3T5XA 3MZYA 4IF4A 4HV6A 3SQNA 3KZYA 2EFPA 1BI1A 2L4AA 3KP3A 2EA4A 4MQVA 1HXDA 2O6GE 1IUYA 1IRFA 4G6QA 2J5PA 4OIOF 1FYKA 3WE2A 1KU2A 2YU3A 2F5EA 1SFUA 2GXGA 1YG2A 4NQWA 4A2UA 4ENNA 3KETA 1FBSA 4MHGA 5LBQA 2EK5A 2BE5F 5E1ZB 2M87A 3ZP5A 2FMLA 3L9FA 2IT0A 2DAOA 2FBKA 5D5UB 3R0AA 1TNTA 4KUMA 3N97A 5LGNA 5FD5A 3M7GA 1BBYA 3B02A 2CWEA 2QWWA 4KYWA 3BJ6A 1D3YA 2KIMA 3MZHA 3T0YA 1EV7A 3TO9A 3VODA 3VOEA 5F64A 1XD7A 4QWQA 4HQEA 1W7PB 1KYWA 4RB2C 1O3QA 2OQGA 4U7DA 2FMYA 4HYEA 4B8XA 1KGSA 4KDPA 3V4GA 3F6VA 3P9CA 2V1DA 4D0PA 2IA0A 4WWCA 3I5UA 2HYFA 2EA2A 1YYVA 4S05A 4UUVA 5F1RA 2MD5A 2QBYA 3KFWX 4M74A 2ZBKA 2K4BA 5JI6A 2FU4A 4EQQA 3FXRA 5D6FA 1KQ0A 2FBHA 1ZH5A 3IL2A 2STTA 5BPIA 2H27A 4LG0A 1NHAA 1FPQA 3NEUA 4AWXB 5HLHA 2IVMA 1RIOH 2QENA 2O61A 4ESJA 1CF7B 4CYDA 2ZO4A 1ZLJA 5JFRA 4ZH4F 3J81K 1OYYA 4ESFA 5HDKA 2D1HA 1HKSA 4RGRA 4Q48A 4Y17A 1DDNA 4L9VA 1TLHB 4O3MA 2K4JA 1R1VA 3HIFA 4L18B 2NAZA 1KQ8A 3BPVA 2PN6A 2A3SA 3O2PE 1ZRFA 2PBIA 2VONA 1P4AA 4OIQF 1QZYA 3K9TA 2QUFA 1YS7A 4IVNA 5IT9Z 1IN4A 3IWFA 4RB0A 4MEYF 3F8NA 1WWXA 1P92A 4CO8A 3ULQB 1O3RA 2DU9A 1IN6A 3HSRA 2CYYA 1E2XA 3TQNA 2XAHA 2RC4A 1UHWA 1FT9A 1T0FA 2WWYA 2HOEA 2Z9OA 2JPBA 1TQPA 2H94A 1YFHA 1RUOA 3MQ0A 5EEGA 2LDUA 4A12A 3LFKA 3E6CC 4EJOA 3GZ6A 1TTYA 1XMKA 3M9AA 2ESNA 2OAZA 2VC0A 2DI3A 1IF1A 1J5YA 2ZKZA 4A0XA 1K78B 3R6SA 5D5WB 4M9XA 5JHUA 1HW5A 2WC2A 1B1BA 1ZG5A 1FC3A 2CQKA 2A69F 1LJ9A 4EJTA 3C7JA 2NYXA 3GYHX 1L0OC 2J5OA 2ZFWA 2Y48A 2K7LA 2F5DA 1X3UA 1PUEE 2H6BA 2OA4A 1H9GA 2NNNA 4UVBA 1U5TB 3I4PA 3AAFA 2QQBA 1G3SA 2VC1A 4L0YB 3F22A 4GGGA 4HZFA 3EYYA 4WX9A 3WE3A 2HKOA 2OU2A 1F5TA 5L3EA 1FBQA 1OR7A 4HDVA 3FF5A 3CUQB 4G7HF 3HTUA 3JSPA 3V8LA 4LLNA 1FYMA 1Z6TA 2CO5A 1F9NA 3K69A 1YW8A 1CF7A 3BPXA 1BC7C 4R8HA 1S6LA 4G94A 1BI2A 4UV8A 3FM5A 3BDDA 3W6KB 1XMAA 3FZVA 2XV4S 2STWA 4KICA 5LEKA 2EJRA 1FY7A 4HF2A 2GIVA 3FHZA 1YO5C 2G9WA 5HOOA 1R1TA 3VEPA 2FBIA 3E6BA 4UXNA 4I0BA 3WODF 1SD4A 2EV5A 3PQJA 5ILSA 3T8TA 1K79A 1XGMA 1RZ4A 2E1NA 3R0JA 1FWZA 6PAXA 3DP7A 2OBPA 4IPAA 3QPHA 1R23A 3IKTA 3CO7C 3WGHA 1HQCA 2ZNZA 4E70A 1KU3A 1R22A 1FBUA 2QLZA 1SMYF 1AOYA 2MA3A 2P8TA 3E6MA 3IHUA 3RI4A 1ONVA 1G3TA 1CGPA 4AIHA 1XCVA 1Z9CA 1R5HA 4KIFA 1YW7A 4LLLA 2COMA 1JHHA 2RDPA 3J80Z 1KQ9A 4R79A 1Z91A 3C18A 2X0LA 5DV5A 3QU6A 2LKPA 4L5JA 3SZPA 2FE3A 2H09A 3JTGA 1GHCA 2HQRA 3BWGA 4WXCA 4KIGA 4I7HA 3GO5A 2PLYA 2EFOA 2AXLA 1ZREA 3L2CA 2FRHA 4EM1A 1REPC 4P9FA 4WXHA 2GQQA 2VXZA 3CJNA 5K1YA 5FB2A 1MJ9A 1ON2A 5LHIA 2DK5A 1GVJA 2VODA 5KVRA 5DEQA 1ZAOA 3WTWC 3L00A 2EFQA 2ACJA 3HRTA 1SD7A 3WTYC 2FA5A 3JTHA 4BNCA 3FMQA 1J0RA 2A5YB 1AWCA 2O0YA 4LLGF 3CUQA 4BHPA 1UHMA 2JZYA 5HLGA 2ESHA 2KRFA 3K1PA 5L3CA 2PG4A 3LQRA 2EV0A 4XLPF 4WF2A 3ROUA 3EDPA 2V1UA 4AVPA 3JW4A 3OV8A 2MH2A 2R7FA 4OMYA 2BBYA 1F1ZA 3C3WA 1FX7A 3TDUC 2HWVA 1H9TA 4EGZA 1TQMA 4N9IA 3I58A 4RB3C 4H0EA 3Q9VA 5DYMA 4FX4A 3DPLC 3MWMA 2XKOA 1U3EM 3VB2A 1DPRA 2O03A 3COAC 2P5LC 2PMHA 5HS9A 4I0AA 3WTZA 4YIIA 4L0ZB 4HA8A 5ILUA 5KK1A 5D4RA 3KP5A 1OPCA 4U7BA 3CO6C 1D8KA 2FEZA 1DP7P 4ZZDA 2XASA 5FLXZ 3TOAA 2HR3A 5H6QA 4ZYHA 1BC8C 4R1HA 4KA4A 4F7ZA 2K27A 3F8BA 4OIRF 1FSEA 2VE9A 4Q5SF 1TBXA 2OD5A 4WK8F 5BPDA 4O5VA 1XCBA 1W4MA 3P7NA 4A6EA 3QU3A 1BI3A 2FSWA 2KIUA 4AIKA 4PGHA 2ZMEB 1BI0A 1RI7A 2ISYA 2D45A 2DO7A 3U1DA 2A6HF 2AS5F 2HEOA 2NS0A 3DFGA 2K02A 2DW4A 2VBWA 1Z05A 1D8JA 4YG2F 1OYWA 1EH6A 3I59A 4JQFA 2PMUA 3MAJA 3SZTA 1UB9A 1FYLA 3C1DA 3WGIA 4HQMA 1MDMB 1BIBA 2RKHA 2XAQA 2EB7A 2ZJ2A 3I53A 1WSUA 4PCQA 5D6EA 2C6YA 4UNOA 3ERED 1R36A 4CGZA 4LD5A 5L3FA 4P96A 4GYGA 1R5GA 1LDJA 1OYIA 2YR2A 1YS6A 2HS5A 2TDXA 3ZQ7A 2IA1A 5DCMB 3HRSA 1KU9A 3DF8A 1RNLA 2XHKA 3MEXA 1EH8A 3RIRA 2P5VA 4HAMA 3KP4A 2VBZA 1ZRCA 4HX8A 1BIAA 1D5VA 3ZN1A 3BOQA 2YX4A 3LQQA 3RPUA 2QYOA 4MQ9F 3HSEA 3ZN0A 4OOIA 3R61A 2ZXJA 2QZ8A 3ZMVA 2JSCA 2XKPA 3LA3A 3D5LA 1TQIA 2DT5A 1P2FA 1YW9A 1JHFA 3WTTC 5JVTA 1W7PD 2A68F 2P4WA 1I6XA 2KKOA 4BHBA 1O7LA 2DFIA 1T6SA 5CVRA 3ZMDA 4XSXF 4BH9A 3OOPA 4XSZF 2VOOA 2KJCA 1T2KA 2ZNYA 1HW2A 1P6RA 5E8GA 1BN5A 2MC3A 4MEXF 5ED4A 4BAYA 4JK1X 1J9IA 1IW7F 2UZKA 4EJVA 2DLLA 4MNUA 3DQVC 3I64A 1TNSA 2PJPA 5DDGA 2ZMEA 1STZA 2CFXA 3P9KA 2VE8A 1XSDA 1KYZA 1J59A 1J2XA 4IRHA 4HX4A 5DCFA 4EJUA 3F8FA 5K5RA 5L3BA 1XGOA 4I98B 3RPQA 4IXAA 1IN8A 1G6NA 1T38A 1RUNA 1WI9A 3ISPA 2GA1A 3GW2A 4LGWA 1QQIA 1WRJA 2BGCA 2EWNA 3V7SA 4IRIA 2VBXA 3PQKA 1W7PA 2MH9A 3NRVA 5E20A 4RAZA 1JE8A 1IN5A 1Q1HA 1P4XA 2DPDA 1V4RA 1H0MA 1MDMA 2L01A 5E8IA 3E5QA 4PDKA 1XDUA 2B0LA 4KIBA 2XAJA 3F8CA 5H6RA 4NHJA 3R60A 2FOKA 1ODDA 1XN7A 2IP2A 1PDNC 3GXOA 3P9IA 1UCRA 2ZCWA 1FSHA 1T39A 2UXNA 4EJWA 2FF4A 2RV8A 4M73A 4IHTA 4P9UA 2RNJA 3E97A 4M71A 2VBYA 4I2OA 5L3GA 3HHHA 3EQLF 5HDGA 2R7DA 3O6BB 1XGSA 4FX0A 4BQAA 4CHUA 2Z33A 1QGPA 2DQRA 1U5TC 2JTVA 3QOPA 2Y75A 3J81Z 3JAMK 3V8JA 4GYIA 4ZZLA 4IJAA 1BJAA 1LDDA 1L3LA 3V8KA 3ECOA 1ON1A 5BOXA 1ZLKA 4CICA 4OMZA 5DUKA 5BQTA 2QVOA 3CUQC 1Z1DA 1XDSA 1YIOA 4A5NA 2NRAC 4RGSA 4MTEA 4YFNF 4KT5C 5A2QK 1I5ZA 5DUIA 4LJZF 3KE2A 3FWEA 3LA7A 3DPTA 4N9HA 2Y0MA 4EV0A 1GXPA 5L3DA 4L5IA 5LHHA 3TOBA 2RGVA 3ZMUA 3U2RA 1P4WA 4IHSA 3SFZA 5CVVA 4LB5A 4EM0B 4RGUA 4UHTA 1I1SA 2W84A 4OU0A 4HLYA 3K2ZA 3KCCA 2XGXA 3BZ6A 3DXJF 1ZHFA 2P7CB 1T98A 4U88A 2HTJA 4XBFA 3TGNA 5F6FA 3FM3A 3N4MA 2D2WA 3HYIA 5DD8A 2UWMA 1ZRDA 1MJAA 4HDUA 3WGGA 1XSVA 2MBFA 1K78A 3F23A 5D5XB 4BXUA 2IW5A 2PFBA 3MFKA
chains in the Genus database with same CATH superfamily
4IRGA 3ZPLA 1EA3A 3GF2A 3S93A 2EV6A 1IN7A 1DPUA 3WU0A 1B8IB 4HEA2 1ZGAA 1ZN2A 4RAFA 2VJJA 1D5YA 2G7UA 5ICCA 3GMEA 1QBJA 5F0CA 5C4JJ 1YIJI 2E7XA 2O5RA 3CUOA 2E1MC 3L7WA 2L5QA 3ZR8X 1YJNI 1QZZA 1XTAA 2P6TA 1R7JA 4Y33A 2OTLI 1U5TA 2E2IJ 3KPHA 4G7OF 4CCMA 2BY1A 2M9HA 3CP2A 2M5WA 4BDZA 2HYGD 4UV9A 4U0YA 3JRDA 1TWHJ 2DA6A 2OZ6A 5H20A 3ECHA 5LEJA 1SFEA 1SMTA 2BV6A 3OS2A 2JA5J 2LSOA 3WTSC 4ZYAA 3S3NA 2DMTA 4NUBA 5CVUA 4D9JA 2M3AA 3F3XA 3WTXC 1TW3A 3OL4A 3E5UA 4UVCA 5AONA 2TCTA 3IWZA 2BEOA 2V1XA 2L9SA 4UVAA 4EVIA 2QQAA 2LREA 1O3SA 1U78A 2K9MA 3GVAA 2NOGA 3GTMJ 2XC7A 5EEHA 2QBYB 2FQ3A 3V42A 2CRGA 2L7ZA 3RYPA 3HB9A 3HBLA 2DTZA 1VQPI 2O8XA 2JA7J 4B3XA 2XIGA 4N0BA 2CSOA 2Z1DA 1FP1D 1WJCA 4FETA 5JHFA 4IQJA 4DGWB 1IXRC 5D8LB 2IS6A 3DKWA 1IXSB 1JXSA 2F4MB 5E18F 4LG0B 2I10A 4I02A 3TEDA 4Q4ZF 2DFEA 3IC7A 3IP4B 4BYYA 2AQEA 2K86A 4YIFA 2R5YB 4XONA 2L2OA 2UXXA 1WKMA 3FKIJ 4A3DJ 1PUFA 2KDOA 5FGMA 3TO6A 4GXOA 3H9QA 1FP2A 3DPUA 4ZYGA 1ZG1A 3Q3SA 1USTA 2EH3A 4HBLA 4PSWA 1BA5A 3PFIA 5EG0B 2E2HJ 2M34A 4KMFA 2XVCA 2YX7A 3G3ZA 2MLKA 4XLFA 3GFMA 1MBGA 3C2HA 3EETA 3SHFA 3V7CA 2EBIA 1O7FA 2W82A 4AUXA 2ISZA 4I6ZA 3PJRA 3WTVC 4Q47A 2WTEA 2Z5UA 3DLLF 2HVRA 3K1NA 5EZGA 4A0ZA 2CS3A 4JX6A 4EMSA 2DXIA 1YJWI 3BROA 2CV0A 1G3YA 3PSFA 1Z67A 1HSJA 2LFBA 5ERIA 3GCMA 3ZQIA 5LRRA 3S3OA 1I27A 5IT9K 1MZBA 1A04A 1GT0C 4DIQA 3BJAA 4A3LJ 4LFUA 4XR6A 2BW3A 3DLAA 1BJZA 3CMEI 3E3VA 2OUMA 1FZPB 5CYVA 5AIQA 3KYDB 2V79A 4RLQA 2HDCA 2LY2A 4PGGA 1JI8A 2E71A 3ABTA 4KN7X 4ENJA 5EZHA 1W5TA 3BG3A 3GWZA 1I1GA 1NG6A 2RQPA 4XLHA 5HODA 4HG2A 1MMGA 3KLNA 1ULYA 2XGDA 3G2BA 2R5ZB 4I01A 3FXJA 1FEXA 4QIWN 2GXBA 1MBJA 1QVUA 5FD6A 3BR6A 5E1WA 3SXYA 1FOYA 1USSA 3OY9A 3BP8A 2NS8A 2QSHX 3BZKA 3GEZA 2KMUA 2VIXA 2M30A 3PL8A 4ASNA 3CJQB 1KA8A 2W57A 1N25A 2DK8A 1WPKA 3PM1A 5KHDA 4QPQA 1MSEC 2HVQA 3G1MA 4A5MA 2CGPA 3HOZJ 2QM3A 2Z2SB 3VYRB 4ENMA 3TL4X 2GXAA 3ELKA 1FJLA 1V5FA 1X2NA 2L4MA 2IRFG 1BR1A 3HOSA 4E7SA 2WB1A 2JT1A 1LE8A 1MGTA 4HNTA 2DA4A 1MW7A 2K3FA 3Q0VA 3ZMSA 3FMRA 1UFMA 2D1VA 1WJDA 1FIPA 4IHWA 1VF9A 1S7AA 2F2EA 2O3FA 2ZJQF 3J7AY 4ON0A 2W25A 2E2JJ 2X4HA 4EEFG 2HTSA 4MIMA 4BE0A 1ZTRA 3RPUD 2IS4A 4II2A 3REOA 4PSXA 3UR3C 4XKCA 3KP7A 4I99C 2MC4A 5DD4A 5ILVA 4X1EA 1FOKA 3RYRA 3KX2A 3E5XA 3HTSB 3HUGA 3NQOA 4BS9A 3OS1A 3L2RA 2ZMEC 2WY7Q 4Z2YA 3H9JA 2K9QA 4NDLA 4XORA 5M5XJ 1JTYA 3HOTA 3V7RA 5K5QA 1R9TJ 3H35A 1FOWA 2P5KA 1IRGA 1R4MB 5J8FA 3CLOA 2YSRA 4XICA 5DS9A 4G6TB 2WADA 4HSRA 1MH3A 1PJRA 3BR0A 4RGXA 5FFXA 4ZC3A 3I54A 3H0DA 5CVIA 3RKWA 3KLOA 1V55H 3JRFA 3Q5FA 1WHUA 4Y52J 4PZJA 1TWCJ 4RAYA 4G8XA 1W0TA 2P7VB 3FX3A 5J4VA 2KFDA 9ANTA 4TV7A 3TBIA 4ZDPA 3LOCA 3GTPJ 2E5NA 1MBHA 1WJ5A 4KJZA 3ASNH 1G3WA 4ESBA 2CW8A 3BCAA 5JR3A 5LFAA 2DA3A 2I8DA 1OMIA 3IKVA 4BY1J 2M1BA 3GLLA 5E17F 2ID3A 2X6WA 2JJ7A 2E60A 1S8NA 2Q2EA 4FE7A 5FKNA 1SAXA 3MN2A 4HX7A 3RQ4A 4LIUA 2VOPA 5FO5A 3J7YJ 2NNYA 3EUAA 3VPRA 1X2MA 2KHMA 3WTUC 3LAPA 2LF8A 3K1MA 1U8BA 2V6CA 3SZGA 1TT5B 1UELB 2VT3A 4WCGA 1HBXG 2XROA 2XGEA 4NC7A 3FXQA 1PVEA 1I3QJ 2VT2A 3G73A 3KIOA 1JT0A 1LNWA 4KMUX 3E7LA 5FJ8J 2F5VA 3T1BA 3BCBA 3LWFA 1SD5A 1ZYRF 2A07F 4KNYA 4HLXA 3D1NI 4AIJA 2V7FA 2P6SA 4ZTJA 4BHCA 1W5SA 2ZJPF 4KFCA 1IZ1A 4A3CJ 4P5OA 2EQRA 3H3UA 4DYQA 2W24A 2HOTA 5LGTA 3SDGA 5TRDA 1U2WA 1OKRA 3KEQA 5CLSA 5LLQA 1PP7U 4CXFA 1J75A 2ETHA 2X85A 1HKQA 3W2VA 2VN2A 4P55A 2DDAA 5D8KB 3GFJA 2ZSIB 1X4PA 1B72A 4IHVA 4HOBA 5EGOB 3JRHA 2Q8KA 2Q0OA 1S29A 3RKXA 1ZARA 4M72A 2RVCA 3CCEI 1RPWA 3QPSA 3ML6A 1HW1A 1GV2A 3BTIA 3H3ZA 4RM2A 1Q1VA 3GZ5A 4A3JJ 1R00A 2HGCA 3CCLI 5LRSA 5ICGA 3DV8A 4U0VA 3IUOA 4AVZA 1S9HA 4HW0A 2R5ZA 4QLCU 3OS0A 4NNJA 3S1RJ 2LK2A 1ZK8A 3GTJJ 4G7ZF 4A3IJ 3KP6A 5EDNA 3JSOA 1J7KA 4GO1A 4EM2A 2Y31A 1NTCA 2ELJA 2JN6A 4FT8A 1MKMA 3TKYA 1BM9A 3FBIB 2LYCA 4BJ5C 2DOAA 1D0ZA 4OIPF 1LFBA 1Z21A 1QPMA 1XB4A 2EINH 2QQ9A 4LK1F 3D0SA 4HV5A 2DMUA 1F4KA 1VQ5I 5FRMA 3ZMZA 2HKXA 1WJBA 3J80K 4N4NB 4JBAA 4CA0A 5J40A 2F5FA 2HI3A 2GLOA 4YIRX 3QRFF 1SVMA 2HQAA 3P5JA 4L9NA 3ZQHA 4AD9A 4B4CA 3B6AA 2WV0A 4M6XA 2L02A 1S7OA 3HM5A 1G4DA 2LKSA 1TT0A 3T8RA 4CZZA 2PI0A 3O3KA 2BYVE 2XPUA 4Y13A 2EFNA 4G6DA 4JP0A 1XGNA 4A3FJ 1YHQI 4LK0F 3HOXJ 3UKGA 1YI2I 3QPTA 5F0HA 4ENKA 2ZXHA 2LNBA 2F5CA 2Z16A 2EZHA 2WBMA 3QP6A 1OFCX 3AG3H 2FX0A 3TO7A 4HRIA 3S2HJ 4QPOA 2IA2A 4XLNF 3M4OJ 1B9MA 1VTNC 1E0EA 2KRHA 2PJRB 4O6JA 5KAFC 2CW0F 2GA2A 2ECBA 5CQEA 3M1EA 4XRFA 3IAS2 5K5OA 2HXOA 2X1EA 3MCZA 3PUBA 3FMSA 4RAGA 2ELHA 4LOCA 3OWTA 2Z99A 2Z3YA 4NB5A 1BOAA 1O3TA 2HVSA 4RB1A 5D5VB 1B9NA 3KP2A 1PP8F 5IT3A 3ASOH 4I76A 5EEAA 3ABLH 3D5SC 1SFKA 3O8GA 3R4KA 1O57A 2ECCA 4YFKF 2A6EF 4K2EA 4MTDA 1R4NB 3H36A 3K4BA 5HNFA 3Q0UA 4J00A 2JQ7A 3BT9A 1LVAA 4L9TA 4A0YA 5J6XA 2R92J 5CJ9A 2L3DA 5DCMA 3WHCA 3GFIA 3KEOA 3KYLA 4Y15A 5GAEJ 3I71A 4ZYEA 2JUGA 4BEHB 3GTQJ 2JRTA 2XUBA 3MVPA 5LGUA 5M5WJ 1MD0A 1YQAA 2DOFA 2M8EA 2QGUA 4XNFA 3DTKA 5HNHA 1LEBA 1FLIA 4E7LA 1Y1WJ 4LB6B 4M3DA 2CUEA 3GTLJ 1R1UA 2L54A 1ZGJA 2O9LA 2LH9A 3L09A 4JX4A 5HVQC 1IAWA 4M9SA 3BY6A 5HDNA 1MJBA 2GZWA 2MD0A 2XAUA 3HRMA 4IKFA 1X1PA 1Y0UA 2JA6J 1LFPA 2K85A 5AIPA 3GFLA 2W85A 1QNTA 4BY7J 2YPRA 1N75A 1JGSA 1FNNA 1EH7A 2HFHA 2MSYA 1LFUP 1GXQA 3H92A 4I09A 3H5RA 1LEAA 1LDKB 2E7WA 2K9SA 1R58A 1XSXA 2A05A 1U6GA 1HA8A 1HSTA 3J7AO 5HS7A 2JK3A 3IV5A 4AU7A 2H6CA 4YEJA 1U0JA 4B09A 3A01A 4CCJA 1QU3A 2ZXIA 3IRRA 2FXAA 3IRQA 2KL4A 2E1CA 2OQRA 4HF1A 3M8EA 4IZZA 3QAHA 2BHYA 2EILH 3SFIA 3WG9A 2CQ7A 2PQ8A 4C3JJ 4GCVA 3U9GA 1AKHA 2IPQX 5J8CA 5TJJA 3ABUA 2VQLA 2I5UA 3RJPA 5EGOA 3K4NA 2OCEA 3OIPA 1NH3A 3GTOJ 3CTAA 2LF7A 4HF0A 1QO0D 3SYTA 2IJLA 3DEUA 4RS8A 2NVTJ 3LFUA 5BS6A 3F21A 2XAGA 5K7ZA 4M9ZA 5BMZA 3BG6A 4BQOA 2XF5A 1HF0A 5FLXK 4M6VA 1YTYA 3AL0C 3CJTB 2LG4A 3S14J 1X19A 1R71A 2KJBA 1BW5A 4KN4X 3GX4X 3HRUA 3L1PA 1HKTA 3ABMH 1IXCA 1WJEA 4BQQA 4PJLA 3N05A 1MMAA 2FNAA 4D7NA 1Z6RA 2XAFA 1POGA 2A5WA 5HLIA 2JPCA 2LLKA 2EIMH 3RTRA 5LHGA 5K7FA 1U8RA 3QP5A 1JGGA 4E7ZA 4FHTA 4U0WA 1SFXA 2M4GA 4ETSA 2G7HA 1XMXA 2DQLA 2HNHA 3B73A 2RNGA 1LB2A 2CJJA 4B1RA 1CQTA 2V9VA 4A3GJ 2R3SA 3LSTA 1K7AA 3EUHA 3F72A 2NOJB 2XF6A 5FKLA 4A93J 4CDGA 4WXDA 5IP6A 3BJOA 4DQ2A 3I0TA 3W6JB 4DNCA 2CMPA 4XK4A 3FXUA 1KU7A 1OLTA 3F8MA 3LA2A 2A61A 2E1MB 3Q9SA 3CDHA 1Y0NA 2XRNA 3G71I 1ZG3A 2GWRA 4OINF 4BKXA 1YRNA 1VQNI 2EZKA 2L9NA 3G1OA 2MLGA 3K4CA 1DGRM 1S3JA 2IEKA 2VQGA 1HCRA 3LSPA 2Y9YA 1GVDA 5ICFA 2CG4A 2R4GA 1Z7UA 2AO9A 3SJMA 3S2WA 4DZJA 1OCZH 2E1OA 3K0LA 4YFXF 3CF2A 1S7EA 4PJ0C 4BUPA 5JVGF 3RKYA 1TWGJ 4M6YA 2HZTA 3TW6A 1K6OA 3ZMTA 2PJRA 5J1UA 3M8FA 3RZOJ 4DZPA 3A4CA 2PEXA 2VXDA 2IXSA 2ZB9A 3I59B 3LNQA 5E1XA 3EYIA 4A3MJ 2PX9A 2DFFA 2EPFA 2Y69H 4MGRA 2WAQA 3KZZA 4UUTA 3GLXA 1IDYA 3JRBA 1LKXA 1IC8A 4PUSA 2DBBA 3HSFA 4G9YA 2RN7A 1IUFA 2EFWA 3S15J 4S04A 4JYKA 4UB6C 3ZOBA 4NBQA 4L9JA 4ZYDA 3HHGA 5IOYA 1TW2A 2M45A 2OZUA 2QSGX 2DPUA 1HOMA 1YLFA 5HLTA 1QVTA 4BEHA 3OYLA 4EGYA 1W0UA 3K7AJ 4CCOA 4F52A 1WCMJ 4IX7A 2OJED 5ICEA 2KLOA 3BLYA 3S32A 3J7ZI 5F0FA 2DJIA 2GAUA 5IY5H 2KIFA 1B6AA 2FNPA 4BJ6C 3WU1B 2MYSA 2HQNA 2X48A 4C2TA 1ORKA 1IO2A 3E6DA 5KCMA 4C9YA 1MNEA 5D4SA 3LSMA 3F6OA 1JJ6C 2DTRA 5HS8A 4ZDLA 3RDIA 1V3FA 1E17A 4FE4A 2ZXWH 2KDZA 2VASA 1VQ7I 2BZTA 3FDYA 4LMYA 5FFZA 2GBYA 3JAMZ 1DUXC 1B59A 3OYEA 1SD6A 2LOOA 1WQ2A 3LAJA 4B3AA 3CCMI 2ADUA 2H1KA 2DA2A 5CVJA 2VPRA 3CJRB 1B4AA 4A6DA 3TDZC 3ZQFA 1FMVA 3VFZA 5JLXA 3KZIC 2LBFA 1LQ1A 4BDYA 4H4KC 3GUDA 1TWAJ 3RCOA 1C0WA 5EJCA 5A2QZ 2XGCA 3T5XA 2P81A 3MZYA 2BY2A 1T33A 2XSJC 4IF4A 4HV6A 3SQNA 3KZYA 1ZR2A 1A35A 2EFPA 4MO7A 1BI1A 4II3A 3DU6A 1I39A 2L4AA 4PK4A 4CH7A 4E7IA 2ZC2A 2XB0X 3KP3A 3M8JA 4C30A 2F4OB 2EA4A 1X1DA 4MQVA 1HXDA 2O6GE 1IUYA 1IRFA 2H1LA 4G6QA 2J5PA 1NK2P 4BU2A 4OIOF 1P9QC 1FYKA 3WE2A 3FIWA 3OYDA 4IQ4A 4E7HA 1KU2A 2FQ4A 2YU3A 3LSRA 2F5EA 1SFUA 4BBSJ 2GXGA 3AG2H 1X3WB 1YG2A 4NQWA 2QF7A 1TP4A 3FK7A 4A2UA 3CP8A 5C3EJ 2LVSA 1DQUA 4ENNA 3KETA 1FBSA 4MHGA 3A02A 3IH3A 3HKZA 2PMZA 5IOZA 5LBQA 2EK5A 2BE5F 1A36A 2DDBA 2IAIA 2MFZA 5E1ZB 2M87A 2M2EA 2VJ4A 3L2WA 2BY3A 3ZP5A 5BNGA 5FKOA 5M3MJ 2FMLA 3L9FA 4AYBA 5DTDA 2IT0A 2DAOA 2FBKA 5D5UB 3R0AA 1TNTA 4KUMA 2GM4A 3N97A 2VJ5A 5LGNA 3S1QJ 1ERDA 5FD5A 3M7GA 4PJNA 5DM7F 1NG7A 1IRXA 1BBYA 3B02A 2CWEA 1ZGWA 2QWWA 4KYWA 3BJ6A 1B8IA 3TMOA 2JRMA 1D3YA 2NVQJ 2IBDA 3BR2A 1FOXA 4S0HB 1WJAA 2KIMA 4Z6YA 3MZHA 1BL0A 3T0YA 1TC3C 1EV7A 1VQ9I 3DEWA 1FTTA 3BG5A 3TO9A 4UUSB 2AQFA 4YRVA 3VODA 3VOEA 3D5RC 5F64A 3BTCA 2VJIA 1V5GA 2JWTA 1XD7A 3CZ6A 2P0WA 4QWQA 4HQEA 3WU2C 1W7PB 1KYWA 4RB2C 1O3QA 2OQGA 1R49A 4U7DA 2FMYA 3EPZA 4HYEA 4B8XA 1KGSA 2VLAA 4KDPA 3PUFA 3V4GA 3F6VA 2R7SA 1U9OA 3S1NJ 3EUKL 1U9NA 4ANJA 2JVGA 3P9CA 1KZHA 1ACIA 2V1DA 1IDZA 2Y2ZA 4D0PA 3E0JB 2IA0A 3RQIA 4WWCA 3I5UA 2HYFA 2EA2A 3LSHA 1SVOA 2Y9ZA 1YYVA 4S05A 4UUVA 5F1RA 1VZ0A 3FXMA 2MD5A 1YX5A 2QBYA 3KFWX 1QPIA 1FIAA 4M74A 1Z0XA 2ZBKA 2K4BA 5JI6A 2FU4A 3FHNA 4AM3A 4EQQA 1D1CA 3FXRA 2L9VA 1KQ0A 5D6FA 2FBHA 2OCCH 3JCUC 1ZH5A 3OL3A 1P7IA 4XOPA 4KISA 2UV1A 3OYMA 2D5VA 3IL2A 2STTA 3L2QA 3ZRGA 3G4SI 5BPIA 2H27A 3VWBA 4LG0A 1NHAA 1FPQA 3NEUA 4RA2A 2ID6A 2BVMA 2R5YA 2K40A 3KEYA 4AWXB 3AG4H 5HLHA 4A3KJ 2IVMA 1RIOH 2A6TA 2QENA 2VQCA 2DT7B 3JRIA 2O61A 4ESJA 1CF7B 2XRLA 4CYDA 2ZO4A 4GRIA 2VPLA 5EG0A 1ZLJA 5JFRA 4ZH4F 2XPVA 3HOUJ 4D5FA 3J81K 1OYYA 1T56A 4ESFA 5HDKA 2D1HA 3VYUB 4HNUA 1HKSA 4RGRA 4Q48A 4EATA 4E7KA 4Y17A 1VQOI 1DDNA 4LITA 4L9VA 2R93J 1TLHB 4O3MA 2O8KA 4GDFA 2K4JA 1R1VA 3H5AA 3HIFA 2NAZA 3GZNB 1RR8C 4L18B 1S72I 2F48A 4BXFA 1KQ8A 1EKEA 3HOVJ 3BPVA 4PJMA 2PN6A 3CCVI 2FUG2 2A3SA 3O2PE 1SEUA 3QYBA 1ZRFA 1LPQA 3I4MJ 1V54H 2PBIA 2VONA 4XOTA 4XLEA 1P4AA 4OIQF 1QZYA 2VUMJ 3F0CA 3K9TA 2QUFA 5GP9A 4XRMA 3ABKH 3SDBA 4F93B 1YS7A 2R7OA 4IVNA 4XL9A 5IT9Z 1IN4A 2CW7A 3DKXA 2R7TA 3IWFA 4Y4RA 1HDDC 4RB0A 2WA0A 1ETVA 4MEYF 3F8NA 2R7UA 4U87A 3K4LA 3X2QH 3CCSI 3PNYA 1GDTA 1Z3YA 1WWXA 4V2GA 1P92A 4CO8A 3ULQB 1O3RA 2DU9A 4NC6A 1IN6A 1SFOJ 3HSRA 3CCYA 1H89C 2CYYA 1OCCH 3OYKA 1UAAA 1E2XA 3TQNA 2XAHA 2RC4A 3DCFA 2B7EA 1UHWA 5FLMJ 5M5YJ 1FT9A 1T0FA 5B3SH 2WWYA 4ABZA 3TW7A 4G12A 3PO2J 2HOEA 2Z9OA 1IG7A 2CV2A 2LRDA 2JPBA 1TQPA 3OIOA 3OR1C 3CQZJ 2H94A 4M3FA 1SANA 1YFHA 1RUOA 3MQ0A 5IYBJ 5EEGA 2LDUA 1FMWA 4E7JA 1VQLI 4DBRA 2W7NA 4A12A 1RR7A 1JKRC 3H3VK 3LFKA 5DM6F 1IRZA 3E6CC 3U21A 4A3BJ 2VKHA 2V6EA 1Z7LA 4EJOA 4UY8I 4J01A 1N78A 4DYRA 2UUZA 3GZ6A 1TTYA 1XMKA 1UZCA 3M9AA 4MFEA 3S8PA 2ESNA 2OAZA 1MBEA 2QKMB 2VC0A 4BE2A 3OYGA 2DI3A 3K10A 1IF1A 4FQGA 1J5YA 1YOVB 2ME0A 2ZKZA 4PFOA 4BJTA 4FASD 4UUSA 4B43A 3OYFA 3LMMA 4A0XA 1K78B 3FXOA 1A5JA 3R6SA 5D5WB 1OCPA 2HZDA 4CZCA 5GTIC 4M9XA 4XMYA 5JHUA 4DBQA 1UHSA 1HW5A 3AG1H 2WC2A 3GBGA 1B1BA 3RKQA 4IL6C 3S17J 1ZG5A 1FC3A 2ME6A 3OYCA 2CQKA 2A69F 2O7OA 1LJ9A 4EJTA 3EUHC 3C7JA 2NYXA 3GYHX 1L0OC 3BG7A 4RM3A 2J5OA 2ZFWA 1ETWA 3LSKA 2Y48A 5FRNA 1AA7A 4V2FA 2K7LA 3PIPF 1X1BA 5EF6A 2F5DA 2NVUB 2W4SA 1X3UA 2EIKH 3A0HC 1D1BA 1PUEE 4GFBA 2H6BA 2Y0SN 2MG4A 2OA4A 1H9GA 2YU9J 2NNNA 2FD5A 3CMMA 4UVBA 1U5TB 3I4PA 3AAFA 1VQ8I 2QQBA 3DEEA 1G3SA 2VC1A 1WZ2A 3HEFA 4DJAA 4L0YB 2VKVA 3F22A 5E3NA 4OAZA 2DMNA 4GGGA 4F55A 5IP9J 4HZFA 3HGGA 3EYYA 4X6AJ 4WX9A 3WE3A 2HKOA 3C2GA 2OU2A 1F5TA 5CKTA 5L3EA 4BXXJ 4JX5A 3HGYA 1RKWA 5GAGJ 1FBQA 1OR7A 1RC9A 2CUJA 4HDVA 3FF5A 5EYRA 3CUQB 4G7HF 3HTUA 5FKMA 3JSPA 3V8LA 4LLNA 1SVLA 1FYMA 2CV1A 1Z6TA 4OAYA 2CO5A 1F9NA 4M3GA 3OYJA 3K69A 2DA5A 1YW8A 1CF7A 3BPXA 1BC7C 4R8HA 1UJ8A 2VKDA 1S6LA 4G94A 1BI2A 2MABA 4UV8A 5J1RA 2RAEA 4ZJZA 4RBOA 1R5ID 3FM5A 3BDDA 1MNMC 4RLFA 3BR5A 3W6KB 4CCNA 1XMAA 1SAUA 4MFDA 3FZVA 2LD5A 2XV4S 2STWA 4KICA 5LEKA 2KPMA 4MLOA 2EJRA 4C2UA 1BOBA 2HOAA 1FY7A 4HF2A 2GIVA 3FHZA 1PUFB 2HDDA 1YO5C 2G9WA 3OSFA 5HOOA 1R1TA 3CMAI 2CQQA 3VEPA 3MKWB 2FBIA 3E6BA 4UXNA 4I0BA 2X6YA 3WODF 1SD4A 2EV5A 2M7BA 4V19K 3PQJA 5ILSA 3T8TA 1K79A 3MKYB 1Z77A 1XGMA 1RZ4A 2E1NA 3R0JA 3ZQLA 1FWZA 6PAXA 2IGOA 4D1QA 1DU0A 2TRTA 3DP7A 2OBPA 4IPAA 3S1MJ 3QPHA 1J09A 1R23A 3DTEA 2ZJRF 4N4OB 3IKTA 4AIDA 3CO7C 1X1AA 3WGHA 1HQCA 2ZNZA 4E70A 2QSFX 1KU3A 1R22A 1FBUA 1OJLA 5TGTA 2QLZA 1VFCA 1SMYF 1MH4A 1AOYA 2MA3A 4AC0A 2P8TA 3E6MA 3IHUA 1RESA 3RI4A 1ONVA 1G3TA 1CGPA 4AIHA 3CCJI 3PIOF 2AXTC 1DP3A 3H5NA 2E34A 1XCVA 3K6GA 4C3HJ 4LG3A 2HPMA 1Z9CA 1R5HA 2L7FP 2KIQA 3AFHA 1ENHA 2HXIA 4M3BA 2M0CA 3IH4A 4KIFA 1YW7A 3ONQA 2COMA 3HPGA 4LLLA 3IAM2 3O8HA 1JHHA 2WB1N 2RDPA 3J80Z 3OMYA 1RETA 2EIJH 1KQ9A 3FISA 1Z91A 3MZ8A 4R79A 3C18A 1GUUA 2JA2A 2JVHA 4FISA 2X0LA 5DV5A 2DOEA 3QU6A 2LKPA 4BL0B 4L5JA 3OYAA 1GLNA 2EZLA 3Q0WA 2HPIA 1ETQA 3SZPA 3S3MA 4KT6A 2FE3A 4PJJA 1WH5A 2H09A 3JTGA 3DTIA 2HQRA 5KAIC 1GHCA 3BWGA 2IS2A 4WXCA 5F27A 2R0QC 3SEQA 4KIGA 4E4HA 4DW6A 2VL8A 1W1WE 4I7HA 2QCOA 2NS7A 3GO5A 3LSIA 2DCEA 5GTHC 1LE8B 2PLYA 2EFOA 4L5EA 2AXLA 4J19A 2DMPA 3L2CA 1ZREA 2FRHA 3VDXA 4EM1A 1D0XA 1REPC 3OYIA 1X3ZB 1W5CC 2RREA 3OYNA 4P9FA 4WXHA 2GQQA 4BGDA 3H9GA 2VXZA 2X51A 3B6CA 2DYSH 3CJNA 1YE9A 3OYHA 5K1YA 3VSKA 2E35A 1WVRA 5FB2A 1MJ9A 1ON2A 1JKPC 5LHIA 3L2UA 1UG2A 2IGKA 2DK5A 2V1NA 1GVJA 3HUGB 2VODA 5KVRA 5DEQA 2BXZA 1XX5A 1ZAOA 2DN0A 3WTWC 3JRAA 1SC7A 4BBRJ 2CUFA 3L00A 3VYTB 2EFQA 2ACJA 3GTGJ 3HRTA 2OPTA 2V26A 1SD7A 3WTYC 2FJ1A 1N77A 1HDPA 2FA5A 4X0GA 2R7WA 3JTHA 4BNCA 2VB6A 3FMQA 3QYEA 3PNVA 1W36C 1J0RA 2VQHA 2ICWG 2EZIA 2A5YB 1WI3A 1AWCA 3E1SA 2DFHA 4IHXA 2O0YA 3VSLA 1QRYA 4LLGF 3JRGA 3CUQA 2KT0A 3W6VA 1H88C 4BHPA 2Y0SA 3FXKA 1UHMA 1MSFC 2JZYA 1D0YA 5HLGA 2B9SA 1LVKA 2ESHA 1APLC 5GPAA 2KRFA 3K1PA 5KNLA 1T8IA 3QQAA 5L3CA 2PG4A 3BR1A 3LQRA 2EV0A 1Y1VJ 1Z3XA 2QEXI 4XLPF 3CC4I 4WF2A 3ROUA 3EDPA 3CD6I 2V1UA 4AVPA 3JW4A 3OV8A 2GIZA 2NXNB 5J4YA 4ZDOA 2LY1A 2MH2A 2R7FA 2WAEA 2XPWA 3K4KA 3PFYA 4QSHA 2BBYA 4OMYA 3HZJA 2Q2EB 1F1ZA 3C3WA 1FX7A 4IOAF 3TDUC 2HWVA 1H9TA 4EGZA 1TQMA 4N9IA 3I58A 5LD2C 4RB3C 4H0EA 3RZDJ 3S16J 2HQ5A 1QHGA 3Q9VA 1AHDP 3ZQCA 2CUZA 3BZCA 3ZQQA 5DYMA 4FX4A 3DPLC 2DYRH 3MWMA 2XKOA 2HDWA 1U3EM 2KQRA 2OF7A 4FTHA 3BG9A 3VB2A 1DPRA 1ZELA 2JSPA 2O03A 4XLAA 3DBLB 1W36D 3COAC 2P5LC 1OCOH 3QYFA 2PMHA 3JR9A 2L7MP 5HS9A 2R7VA 4I0AA 3WTZA 1ZQ3P 1M1EB 4YIIA 1V5EA 3HOYJ 4L0ZB 1DGWY 4HA8A 1R6RA 4W1UA 5ILUA 2JMWA 4DOZA 5KK1A 4YELA 2X6OA 3PO3J 5D4RA 3M3YJ 3KP5A 1OPCA 1IGNA 4U7BA 3CO6C 1D8KA 4QTRA 2L0KA 4NC8A 1JUMA 2FEZA 3F9KA 1DP7P 4ZZDA 2XASA 5FLXZ 4IOCF 3TOAA 2HR3A 1MIJA 5H6QA 4ZYHA 1BC8C 5C4XJ 4R1HA 3K70C 4KA4A 1B72B 4F7ZA 1BW6A 2IGMA 2K27A 2WY8Q 3F8BA 3MD2A 4XQFA 4OIRF 1FSEA 1JUPA 2VE9A 1F43A 4Q5SF 4XN0A 1TBXA 2GOXB 2V9KA 3KYCB 2OD5A 1MMDA 1VI0A 2DA1A 2E5ZA 3CCQI 4WK8F 3A0BC 5BPDA 3CC2I 4O5VA 2JUCA 2LP0A 1XCBA 1W4MA 3P7NA 3OOUA 2H8WA 3I3LA 3U1KA 3QU3A 4A6EA 2BVLA 3W3CA 3A03A 2B63J 1BI3A 3VYSB 2FSWA 3JREA 1Y8RB 2KIUA 4AIKA 1RKTA 2X6XA 5F08A 4PGHA 1QZEA 2ZMEB 1OCTC 1BI0A 2KP6A 5E3MA 1G2HA 5M3FJ 1RI7A 2K5CA 4C2MJ 2ZFUA 1ETKA 2DT6A 1TWFJ 2ISYA 2D45A 3A2KA 2DO7A 1G59A 3U1DA 2A6HF 2AS5F 3WHBA 2HEOA 2NS0A 3FKJA 3WG7H 3DFGA 2K02A 2DW4A 2VBWA 2OC6A 2DODA 2W1OA 3TP0A 1Z05A 1D8JA 1MBKA 3K70D 4YG2F 3LSJA 2ZSHB 4ITVA 2R7ZJ 1OYWA 5J47A 2QA4I 3ZCOA 1E3OC 2OTJI 1EH6A 2W00A 3I59A 1DU6A 3QOEA 1Y56A 2CU7A 4JQFA 1T0FC 2PMUA 3MAJA 4HSTA 3H0GJ 3FXLA 1MMNA 3CF5F 2F6CA 3SZTA 1UB9A 1FYLA 4F92B 3C1DA 1WFXA 3WGIA 5FLVA 2XB5A 2H8RA 3CMYA 5B1AH 3HL2A 2LKXA 4HQMA 1MDMB 1BIBA 2OV7A 1G8XA 1X58A 5K7HA 3HXLA 1I6HJ 2K9LA 4RDUA 2RKHA 2XAQA 5TISC 2EB7A 3HG9A 4JOMA 1E3HA 2ZJ2A 3I53A 1WSUA 1HC8A 4PCQA 5D6EA 2C6YA 4UNOA 3ERED 1R36A 2HU9A 2R7QA 1JJ8C 4CGZA 2Y30A 4LD5A 3BQYA 1OCRH 2R7RA 5L3FA 2LC2A 3HPHA 5FROA 4P96A 1GV5A 1IV6A 4GYGA 1R5GA 1LDJA 1OYIA 4CUGA 4F91B 2YR2A 2LY9A 2Q1ZB 1YS6A 2E36A 2HS5A 2TDXA 3ZQ7A 2IA1A 5DCMB 3HRSA 3SEZA 2XDVA 3LSGA 1KU9A 2IGNA 3DF8A 2KISA 3HC7A 1RNLA 2XHKA 3DU5A 1OQYA 5IP7J 3MEXA 3AKZA 1EH8A 5FKKA 2P5VA 3RIRA 4HAMA 3CDIA 3KP4A 2VBZA 1ZRCA 1XS9A 4IO9F 4HX8A 4HPQA 1BIAA 2V9PA 1D5VA 5IPAA 1A31A 3ZN1A 3BOQA 3CLQA 2YX4A 3LQQA 3RPUA 2QYOA 4BACA 4MQ9F 3HSEA 3ZN0A 1XC5A 1K83J 4OOIA 3CDLA 3RSNA 3R61A 1BR4A 2AHQA 2ZXJA 4A3EJ 1UMQA 2QZ8A 3ZMVA 2LTPA 2JSCA 2XKPA 3LA3A 1EF4A 3BTJA 1TQIA 3D5LA 3NARA 3M1CA 5IYCJ 2DT5A 1OR7C 1WH7A 1Y8QB 1P2FA 3S2DJ 1YW9A 1VNDA 2CH0A 2XF7A 1JHFA 3WTTC 5JVTA 3G1LA 3A01B 1P7JA 1ZKGA 1W7PD 2A68F 2P4WA 4ZTFA 5E3LA 1I6XA 4PFPA 4CCLA 3TP3A 2KKOA 4BHBA 2M0MA 1O7LA 2DFIA 1T6SA 5CVRA 3ZMDA 1BR2A 4XSXF 1AKHB 1JTXA 2K9NA 4BH9A 4B48A 3OOPA 4XSZF 4XRSA 2VOOA 2KJCA 1T2KA 3DBHB 1VQ4I 5E3OA 2ZNYA 1HW2A 1P6RA 4XM3A 5E8GA 1KONA 1BN5A 2MC3A 4MEXF 5ED4A 4LIVA 4BAYA 4A69C 1AU7A 4JK1X 1J9IA 4XKBA 1IW7F 2UZKA 4EJVA 2DLLA 1JKOC 2BY0A 4MNUA 1ITYA 3DQVC 3I64A 5GPCA 1TNSA 2V4JC 4XN3A 1K6YA 2PJPA 1LUJB 3NAUA 3BC8A 5DDGA 2ZMEA 1STZA 2CFXA 2XSDC 2KZGA 1O4XA 4XRSG 3P9KA 2VE8A 1IV8A 4XLCA 1WGXA 3BR3A 4C3IJ 5B66C 1XSDA 3W2AA 1KYZA 3I4NJ 1J59A 1J2XA 4IRHA 2R7XA 1RRJA 1I50J 2CQXA 4HX4A 5DCFA 4EJUA 1MNDA 3F8FA 2BXYA 5K5RA 5L3BA 1XGOA 4I98B 3RPQA 1HLVA 4IHYA 4IXAA 1IN8A 1G6NA 1T38A 1RUNA 1WI9A 3ISPA 2GA1A 1QA6A 3GW2A 1ETOA 4LGWA 5IYDJ 1QQIA 3C2BA 1WRJA 5F1JA 4CYCB 2BGCA 3ZQGA 2YS9A 2EWNA 3V7SA 3DWLE 1UG0A 4IRIA 3BQZA 2VBXA 2L7KA 3K2AA 3PQKA 1Y39A 1W7PA 4BQNA 1YRNB 2WAQN 2MH9A 2QQ8A 3NRVA 5E20A 4RAZA 2N8GA 5C44J 1IN5A 1JE8A 1Q1HA 1YJ9I 1P4XA 2DPDA 5B5EC 1V4RA 3OIQA 3LL7A 1H0MA 1IJWC 4W97A 1MDMA 2DMQA 1TZLA 5J3LA 1MBFA 2L01A 3G6EI 5E79C 3W2WA 3FBNB 5E8IA 4OWRB 2L9RA 1VQKI 4XKWA 3E5QA 4PDKA 1XDUA 2B0LA 2VKEA 2LR8A 4M3EA 1JKQC 2G0EA 4KIBA 2XAJA 3NWTA 3CC7I 3F8CA 3MMYB 3DKYA 5H6RA 4CCKA 4NHJA 3R60A 2FOKA 1NK3P 1ODDA 1XN7A 1K4SA 2DA7A 2IP2A 1PDNC 2COBA 1MMSA 3GXOA 3P9IA 2M7AA 3HDDA 2X1DA 1UCRA 2ZCWA 2BHZA 1PYVA 4E6KG 1FSHA 1T39A 2UXNA 4RMNA 4EJWA 1FTZA 2FF4A 2RV8A 1T08B 2NVYJ 3M07A 4Y7NJ 4CSWA 1X4OA 2KZVA 2NVXJ 4M73A 4IHTA 4P9UA 2RNJA 3GTKJ 3E97A 1ETYA 4M71A 3ZXSA 3ERMA 2VBYA 4I2OA 5L3GA 2CFOA 3HHHA 3OYBA 3FK6A 1YX3A 3EQLF 3OSGA 5HDGA 2R7DA 1T95A 1I3AA 3O6BB 1XGSA 2DJNA 2YUSA 2VI6A 3H1CA 4FX0A 1XPXA 4BQAA 5GADJ 4CHUA 3DBRB 3OR2C 2Z33A 3MKZA 1QGPA 2DQRA 1A6QA 4Y3OA 1U5TC 2JTVA 3QOPA 3AL0B 2X9DA 2Y75A 5CQGA 3J81Z 3JAMK 4P1WA 3V8JA 3NWSA 4GYIA 4ZZLA 4IEJA 4IJAA 1BJAA 2KRCA 1LDDA 3K4JA 1VQMI 1L3LA 2CQNA 2RQQA 3V8KA 3ECOA 1ON1A 1ZR4A 1EJ9A 5B1BH 5BOXA 1ZLKA 4XIDA 3CCUI 4CICA 4OMZA 1F36A 5DUKA 1H8AC 1OISA 5BQTA 2QVOA 3CUQC 1Z1DA 1XDSA 4B47A 1YIOA 3JRCA 2GOMA 2BOLA 3I9V2 4A5NA 2NRAC 4RGSA 4MTEA 4YFNF 4KT5C 3IH2A 1X1CA 5A2QK 4D5CA 1I5ZA 5DUIA 4LJZF 1K4TA 5J1YA 4UB8C 3KE2A 3FWEA 5F04A 4D7MA 3LA7A 3DPTA 2LBFB 2FOWA 4N9HA 2Y0MA 3A1YA 4EV0A 1A6IA 1GXPA 3QWLA 5L3DA 4L5IA 4HNVA 1TL8A 5LHHA 1E3PA 2E19A 4KITB 3TOBA 2RGVA 3ZMUA 3U2RA 1P4WA 1WJFA 4IHSA 3SFZA 5CVVA 2BW3B 3CCRI 4LB5A 1QHHD 3HKZN 3QODA 4EM0B 4RGUA 2PMZN 4UHTA 4FCYA 1I1SA 3PSIA 2MW8A 2W84A 4OU0A 5GAHJ 4HLYA 2F4IA 2WAFA 2LMDA 3K2ZA 3KCCA 2XGXA 3ESWB 3BZ6A 5JLWA 3HJEA 3MKLA 3DXJF 1ZHFA 1XG1A 2QKLB 2P7CB 1T98A 4U88A 1Y6IA 2X1CA 3ZGKA 4AYBN 1YITI 2WV1A 1JUSA 2M8GX 2HTJA 1D1AA 4BE1A 4XBFA 3HOWJ 3TGNA 5F6FA 4NQWB 3FM3A 2IS1A 3N4MA 1JT6A 2D2WA 1K61A 3HYIA 1ETXA 2HYJA 3BTLA 4DYCA 2K3PA 5DD8A 3K4MA 2UWMA 2MGQA 3I56I 1VQ6I 5CPRB 3I55I 3UNGC 2JA8J 3PNTA 1ZRDA 4F3QA 3L2VA 1MJAA 4HDUA 3WGGA 4XKVA 1XSVA 2MBFA 4B44A 1K78A 2W48A 4CYCA 2M4KA 5H2FC 3F23A 1S5LC 5D5XB 4BXUA 2IW5A 2PFBA 3CESA 3QPLA 2ELKA 2HOSA 3MFKA
chains in the Genus database with same CATH topology
4IRGA 3ZPLA 3GF2A 2EV6A 1IN7A 1DPUA 3WU0A 1ZGAA 1ZN2A 2G7UA 5ICCA 1QBJA 2E7XA 3CUOA 3L7WA 1QZZA 2P6TA 1R7JA 1U5TA 4G7OF 2M5WA 2HYGD 4UV9A 4U0YA 2OZ6A 5H20A 3ECHA 5LEJA 1SFEA 1SMTA 2BV6A 2LSOA 3WTSC 5CVUA 3F3XA 3WTXC 1TW3A 3E5UA 4UVCA 5AONA 3IWZA 2BEOA 2V1XA 4UVAA 4EVIA 2QQAA 1O3SA 1U78A 3GVAA 5EEHA 2QBYB 2FQ3A 3RYPA 2O8XA 2XIGA 4N0BA 2CSOA 1FP1D 1IXRC 5D8LB 3DKWA 1IXSB 1JXSA 5E18F 4LG0B 4I02A 4Q4ZF 3IC7A 4BYYA 2K86A 4YIFA 2UXXA 1WKMA 5FGMA 3TO6A 4GXOA 1FP2A 4ZYGA 1ZG1A 1USTA 4HBLA 3PFIA 4KMFA 2XVCA 2YX7A 3G3ZA 2MLKA 3GFMA 3EETA 3SHFA 3V7CA 1O7FA 2ISZA 3WTVC 4Q47A 2WTEA 2Z5UA 3K1NA 4A0ZA 4EMSA 3BROA 1G3YA 1HSJA 5ERIA 5LRRA 1I27A 5IT9K 1MZBA 1A04A 3BJAA 4LFUA 3E3VA 1FZPB 5CYVA 5AIQA 2V79A 2HDCA 4PGGA 3ABTA 4KN7X 4ENJA 1W5TA 3GWZA 1I1GA 2RQPA 3KLNA 1ULYA 4I01A 2GXBA 5FD6A 5E1WA 3SXYA 1USSA 3BP8A 3GEZA 2M30A 4ASNA 1KA8A 2W57A 2DK8A 4A5MA 2CGPA 2QM3A 4ENMA 3ELKA 2L4MA 2IRFG 3HOSA 2JT1A 1MGTA 3ZMSA 3FMRA 1UFMA 2D1VA 1S7AA 2F2EA 2O3FA 4ON0A 2W25A 2X4HA 2HTSA 3REOA 3KP7A 5DD4A 5ILVA 1FOKA 3RYRA 3E5XA 3HTSB 3HUGA 3NQOA 4Z2YA 3HOTA 3V7RA 5K5QA 2P5KA 1IRGA 5J8FA 3CLOA 2YSRA 4RGXA 5FFXA 3I54A 5CVIA 3RKWA 3KLOA 3Q5FA 4PZJA 4RAYA 4G8XA 2P7VB 3FX3A 4TV7A 1G3WA 4ESBA 5JR3A 1OMIA 3IKVA 2M1BA 5E17F 1S8NA 2Q2EA 1SAXA 4HX7A 2VOPA 5FO5A 2NNYA 3WTUC 3LAPA 2LF8A 3K1MA 2V6CA 2VT3A 4WCGA 1HBXG 2XROA 3FXQA 2VT2A 3G73A 1LNWA 4KMUX 3T1BA 3LWFA 1SD5A 1ZYRF 2A07F 4KNYA 4HLXA 4AIJA 2P6SA 4BHCA 1W5SA 4KFCA 1IZ1A 4P5OA 3H3UA 2W24A 5LGTA 5TRDA 1U2WA 1OKRA 3KEQA 5CLSA 5LLQA 1PP7U 4CXFA 1J75A 2ETHA 1HKQA 2VN2A 4P55A 5D8KB 3GFJA 4HOBA 2Q8KA 2Q0OA 1S29A 3RKXA 1ZARA 4M72A 2RVCA 3ML6A 1HW1A 3H3ZA 3GZ5A 1R00A 2HGCA 5LRSA 5ICGA 3DV8A 4U0VA 4HW0A 4QLCU 4G7ZF 3KP6A 3JSOA 1J7KA 4GO1A 4EM2A 4FT8A 1MKMA 3TKYA 1BM9A 4OIPF 1QPMA 1XB4A 2QQ9A 4LK1F 3D0SA 4HV5A 1F4KA 3ZMZA 2HKXA 3J80K 4JBAA 2F5FA 3QRFF 4L9NA 4AD9A 2WV0A 4M6XA 2L02A 1S7OA 1G4DA 3T8RA 4CZZA 2PI0A 3O3KA 2BYVE 4Y13A 2EFNA 4G6DA 1XGNA 4LK0F 3QPTA 4ENKA 2LNBA 2F5CA 3QP6A 3TO7A 2IA2A 4XLNF 1B9MA 1VTNC 4O6JA 2CW0F 2GA2A 3M1EA 4XRFA 5K5OA 3MCZA 3FMSA 2ELHA 2Z99A 2Z3YA 4NB5A 1BOAA 1O3TA 4RB1A 5D5VB 1B9NA 3KP2A 1PP8F 5IT3A 3R4KA 1O57A 4YFKF 2A6EF 4K2EA 4MTDA 1LVAA 4L9TA 4A0YA 5J6XA 5CJ9A 2L3DA 5DCMA 3GFIA 3KEOA 4Y15A 3I71A 4ZYEA 2JRTA 2XUBA 5LGUA 1MD0A 1YQAA 2M8EA 1LEBA 1FLIA 4LB6B 1R1UA 2L54A 1ZGJA 3L09A 5HVQC 1IAWA 4M9SA 3BY6A 5HDNA 1MJBA 2GZWA 3HRMA 1Y0UA 5AIPA 3GFLA 2W85A 1QNTA 2YPRA 1JGSA 1FNNA 1EH7A 2HFHA 1GXQA 3H92A 4I09A 1LEAA 1LDKB 2E7WA 1R58A 1XSXA 1U6GA 1HSTA 3J7AO 5HS7A 2H6CA 4B09A 3IRRA 2FXAA 3IRQA 2E1CA 2OQRA 4HF1A 3M8EA 3QAHA 3WG9A 2PQ8A 4GCVA 3U9GA 2IPQX 5J8CA 5TJJA 3ABUA 3RJPA 3CTAA 2LF7A 4HF0A 1QO0D 2IJLA 3DEUA 4RS8A 5BS6A 3F21A 2XAGA 4M9ZA 5BMZA 5FLXK 1YTYA 2KJBA 4KN4X 3GX4X 3HRUA 1HKTA 1IXCA 2FNAA 1Z6RA 2XAFA 5HLIA 2JPCA 3RTRA 5LHGA 1U8RA 3QP5A 4FHTA 4U0WA 1SFXA 4ETSA 2G7HA 3B73A 2DQLA 1LB2A 2V9VA 2R3SA 3LSTA 1K7AA 3EUHA 3F72A 4CDGA 4WXDA 3BJOA 4DQ2A 3I0TA 3W6JB 4DNCA 3FXUA 1KU7A 3F8MA 3LA2A 2A61A 3Q9SA 3CDHA 2XRNA 1ZG3A 2GWRA 4OINF 2MLGA 1S3JA 5ICFA 2CG4A 1Z7UA 3S2WA 3K0LA 4YFXF 3RKYA 4M6YA 2HZTA 1K6OA 3ZMTA 3M8FA 2PEXA 3I59B 3EYIA 5E1XA 4MGRA 3KZZA 3GLXA 2DBBA 3HSFA 4G9YA 2RN7A 2EFWA 4S04A 4L9JA 4ZYDA 3HHGA 1TW2A 2M45A 2OZUA 2DPUA 1YLFA 4EGYA 5ICEA 2GAUA 2KIFA 1B6AA 2FNPA 3WU1B 2HQNA 3E6DA 5D4SA 3F6OA 2DTRA 5HS8A 3RDIA 1V3FA 1E17A 4LMYA 1DUXC 5FFZA 3JAMZ 1B59A 1SD6A 1WQ2A 3LAJA 2ADUA 5CVJA 1B4AA 4A6DA 3TDZC 3VFZA 1LQ1A 3GUDA 1C0WA 5A2QZ 3T5XA 3MZYA 4IF4A 4HV6A 3SQNA 3KZYA 2EFPA 1BI1A 2L4AA 3KP3A 2EA4A 4MQVA 1HXDA 2O6GE 1IUYA 1IRFA 4G6QA 2J5PA 4OIOF 1FYKA 3WE2A 1KU2A 2YU3A 2F5EA 1SFUA 2GXGA 1YG2A 4NQWA 4A2UA 4ENNA 3KETA 1FBSA 4MHGA 5LBQA 2EK5A 2BE5F 5E1ZB 2M87A 3ZP5A 2FMLA 3L9FA 2IT0A 2DAOA 2FBKA 5D5UB 3R0AA 1TNTA 4KUMA 3N97A 5LGNA 5FD5A 3M7GA 1BBYA 3B02A 2CWEA 2QWWA 4KYWA 3BJ6A 1D3YA 2KIMA 3MZHA 3T0YA 1EV7A 3TO9A 3VODA 3VOEA 5F64A 1XD7A 4QWQA 4HQEA 1W7PB 1KYWA 4RB2C 1O3QA 2OQGA 4U7DA 2FMYA 4HYEA 4B8XA 1KGSA 4KDPA 3V4GA 3F6VA 3P9CA 2V1DA 4D0PA 2IA0A 4WWCA 3I5UA 2HYFA 2EA2A 1YYVA 4S05A 4UUVA 5F1RA 2MD5A 2QBYA 3KFWX 4M74A 2ZBKA 2K4BA 5JI6A 2FU4A 4EQQA 3FXRA 5D6FA 1KQ0A 2FBHA 1ZH5A 3IL2A 2STTA 5BPIA 2H27A 4LG0A 1NHAA 1FPQA 3NEUA 4AWXB 5HLHA 2IVMA 1RIOH 2QENA 2O61A 4ESJA 1CF7B 4CYDA 2ZO4A 1ZLJA 5JFRA 4ZH4F 3J81K 1OYYA 4ESFA 5HDKA 2D1HA 1HKSA 4RGRA 4Q48A 4Y17A 1DDNA 4L9VA 1TLHB 4O3MA 2K4JA 1R1VA 3HIFA 4L18B 2NAZA 1KQ8A 3BPVA 2PN6A 2A3SA 3O2PE 1ZRFA 2PBIA 2VONA 1P4AA 4OIQF 1QZYA 3K9TA 2QUFA 1YS7A 4IVNA 5IT9Z 1IN4A 3IWFA 4RB0A 4MEYF 3F8NA 1WWXA 1P92A 4CO8A 3ULQB 1O3RA 2DU9A 1IN6A 3HSRA 2CYYA 1E2XA 3TQNA 2XAHA 2RC4A 1UHWA 1FT9A 1T0FA 2WWYA 2HOEA 2Z9OA 2JPBA 1TQPA 2H94A 1YFHA 1RUOA 3MQ0A 5EEGA 2LDUA 4A12A 3LFKA 3E6CC 4EJOA 3GZ6A 1TTYA 1XMKA 3M9AA 2ESNA 2OAZA 2VC0A 2DI3A 1IF1A 1J5YA 2ZKZA 4A0XA 1K78B 3R6SA 5D5WB 4M9XA 5JHUA 1HW5A 2WC2A 1B1BA 1ZG5A 1FC3A 2CQKA 2A69F 1LJ9A 4EJTA 3C7JA 2NYXA 3GYHX 1L0OC 2J5OA 2ZFWA 2Y48A 2K7LA 2F5DA 1X3UA 1PUEE 2H6BA 2OA4A 1H9GA 2NNNA 4UVBA 1U5TB 3I4PA 3AAFA 2QQBA 1G3SA 2VC1A 4L0YB 3F22A 4GGGA 4HZFA 3EYYA 4WX9A 3WE3A 2HKOA 2OU2A 1F5TA 5L3EA 1FBQA 1OR7A 4HDVA 3FF5A 3CUQB 4G7HF 3HTUA 3JSPA 3V8LA 4LLNA 1FYMA 1Z6TA 2CO5A 1F9NA 3K69A 1YW8A 1CF7A 3BPXA 1BC7C 4R8HA 1S6LA 4G94A 1BI2A 4UV8A 3FM5A 3BDDA 3W6KB 1XMAA 3FZVA 2XV4S 2STWA 4KICA 5LEKA 2EJRA 1FY7A 4HF2A 2GIVA 3FHZA 1YO5C 2G9WA 5HOOA 1R1TA 3VEPA 2FBIA 3E6BA 4UXNA 4I0BA 3WODF 1SD4A 2EV5A 3PQJA 5ILSA 3T8TA 1K79A 1XGMA 1RZ4A 2E1NA 3R0JA 1FWZA 6PAXA 3DP7A 2OBPA 4IPAA 3QPHA 1R23A 3IKTA 3CO7C 3WGHA 1HQCA 2ZNZA 4E70A 1KU3A 1R22A 1FBUA 2QLZA 1SMYF 1AOYA 2MA3A 2P8TA 3E6MA 3IHUA 3RI4A 1ONVA 1G3TA 1CGPA 4AIHA 1XCVA 1Z9CA 1R5HA 4KIFA 1YW7A 4LLLA 2COMA 1JHHA 2RDPA 3J80Z 1KQ9A 4R79A 1Z91A 3C18A 2X0LA 5DV5A 3QU6A 2LKPA 4L5JA 3SZPA 2FE3A 2H09A 3JTGA 1GHCA 2HQRA 3BWGA 4WXCA 4KIGA 4I7HA 3GO5A 2PLYA 2EFOA 2AXLA 1ZREA 3L2CA 2FRHA 4EM1A 1REPC 4P9FA 4WXHA 2GQQA 2VXZA 3CJNA 5K1YA 5FB2A 1MJ9A 1ON2A 5LHIA 2DK5A 1GVJA 2VODA 5KVRA 5DEQA 1ZAOA 3WTWC 3L00A 2EFQA 2ACJA 3HRTA 1SD7A 3WTYC 2FA5A 3JTHA 4BNCA 3FMQA 1J0RA 2A5YB 1AWCA 2O0YA 4LLGF 3CUQA 4BHPA 1UHMA 2JZYA 5HLGA 2ESHA 2KRFA 3K1PA 5L3CA 2PG4A 3LQRA 2EV0A 4XLPF 4WF2A 3ROUA 3EDPA 2V1UA 4AVPA 3JW4A 3OV8A 2MH2A 2R7FA 4OMYA 2BBYA 1F1ZA 3C3WA 1FX7A 3TDUC 2HWVA 1H9TA 4EGZA 1TQMA 4N9IA 3I58A 4RB3C 4H0EA 3Q9VA 5DYMA 4FX4A 3DPLC 3MWMA 2XKOA 1U3EM 3VB2A 1DPRA 2O03A 3COAC 2P5LC 2PMHA 5HS9A 4I0AA 3WTZA 4YIIA 4L0ZB 4HA8A 5ILUA 5KK1A 5D4RA 3KP5A 1OPCA 4U7BA 3CO6C 1D8KA 2FEZA 1DP7P 4ZZDA 2XASA 5FLXZ 3TOAA 2HR3A 5H6QA 4ZYHA 1BC8C 4R1HA 4KA4A 4F7ZA 2K27A 3F8BA 4OIRF 1FSEA 2VE9A 4Q5SF 1TBXA 2OD5A 4WK8F 5BPDA 4O5VA 1XCBA 1W4MA 3P7NA 4A6EA 3QU3A 1BI3A 2FSWA 2KIUA 4AIKA 4PGHA 2ZMEB 1BI0A 1RI7A 2ISYA 2D45A 2DO7A 3U1DA 2A6HF 2AS5F 2HEOA 2NS0A 3DFGA 2K02A 2DW4A 2VBWA 1Z05A 1D8JA 4YG2F 1OYWA 1EH6A 3I59A 4JQFA 2PMUA 3MAJA 3SZTA 1UB9A 1FYLA 3C1DA 3WGIA 4HQMA 1MDMB 1BIBA 2RKHA 2XAQA 2EB7A 2ZJ2A 3I53A 1WSUA 4PCQA 5D6EA 2C6YA 4UNOA 3ERED 1R36A 4CGZA 4LD5A 5L3FA 4P96A 4GYGA 1R5GA 1LDJA 1OYIA 2YR2A 1YS6A 2HS5A 2TDXA 3ZQ7A 2IA1A 5DCMB 3HRSA 1KU9A 3DF8A 1RNLA 2XHKA 3MEXA 1EH8A 3RIRA 2P5VA 4HAMA 3KP4A 2VBZA 1ZRCA 4HX8A 1BIAA 1D5VA 3ZN1A 3BOQA 2YX4A 3LQQA 3RPUA 2QYOA 4MQ9F 3HSEA 3ZN0A 4OOIA 3R61A 2ZXJA 2QZ8A 3ZMVA 2JSCA 2XKPA 3LA3A 3D5LA 1TQIA 2DT5A 1P2FA 1YW9A 1JHFA 3WTTC 5JVTA 1W7PD 2A68F 2P4WA 1I6XA 2KKOA 4BHBA 1O7LA 2DFIA 1T6SA 5CVRA 3ZMDA 4XSXF 4BH9A 3OOPA 4XSZF 2VOOA 2KJCA 1T2KA 2ZNYA 1HW2A 1P6RA 5E8GA 1BN5A 2MC3A 4MEXF 5ED4A 4BAYA 4JK1X 1J9IA 1IW7F 2UZKA 4EJVA 2DLLA 4MNUA 3DQVC 3I64A 1TNSA 2PJPA 5DDGA 2ZMEA 1STZA 2CFXA 3P9KA 2VE8A 1XSDA 1KYZA 1J59A 1J2XA 4IRHA 4HX4A 5DCFA 4EJUA 3F8FA 5K5RA 5L3BA 1XGOA 4I98B 3RPQA 4IXAA 1IN8A 1G6NA 1T38A 1RUNA 1WI9A 3ISPA 2GA1A 3GW2A 4LGWA 1QQIA 1WRJA 2BGCA 2EWNA 3V7SA 4IRIA 2VBXA 3PQKA 1W7PA 2MH9A 3NRVA 5E20A 4RAZA 1JE8A 1IN5A 1Q1HA 1P4XA 2DPDA 1V4RA 1H0MA 1MDMA 2L01A 5E8IA 3E5QA 4PDKA 1XDUA 2B0LA 4KIBA 2XAJA 3F8CA 5H6RA 4NHJA 3R60A 2FOKA 1ODDA 1XN7A 2IP2A 1PDNC 3GXOA 3P9IA 1UCRA 2ZCWA 1FSHA 1T39A 2UXNA 4EJWA 2FF4A 2RV8A 4M73A 4IHTA 4P9UA 2RNJA 3E97A 4M71A 2VBYA 4I2OA 5L3GA 3HHHA 3EQLF 5HDGA 2R7DA 3O6BB 1XGSA 4FX0A 4BQAA 4CHUA 2Z33A 1QGPA 2DQRA 1U5TC 2JTVA 3QOPA 2Y75A 3J81Z 3JAMK 3V8JA 4GYIA 4ZZLA 4IJAA 1BJAA 1LDDA 1L3LA 3V8KA 3ECOA 1ON1A 5BOXA 1ZLKA 4CICA 4OMZA 5DUKA 5BQTA 2QVOA 3CUQC 1Z1DA 1XDSA 1YIOA 4A5NA 2NRAC 4RGSA 4MTEA 4YFNF 4KT5C 5A2QK 1I5ZA 5DUIA 4LJZF 3KE2A 3FWEA 3LA7A 3DPTA 4N9HA 2Y0MA 4EV0A 1GXPA 5L3DA 4L5IA 5LHHA 3TOBA 2RGVA 3ZMUA 3U2RA 1P4WA 4IHSA 3SFZA 5CVVA 4LB5A 4EM0B 4RGUA 4UHTA 1I1SA 2W84A 4OU0A 4HLYA 3K2ZA 3KCCA 2XGXA 3BZ6A 3DXJF 1ZHFA 2P7CB 1T98A 4U88A 2HTJA 4XBFA 3TGNA 5F6FA 3FM3A 3N4MA 2D2WA 3HYIA 5DD8A 2UWMA 1ZRDA 1MJAA 4HDUA 3WGGA 1XSVA 2MBFA 1K78A 3F23A 5D5XB 4BXUA 2IW5A 2PFBA 3MFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IRG A;  3ZPL A;  3GF2 A;  2EV6 A;  1IN7 A;  1DPU A;  3WU0 A;  1ZGA A;  1ZN2 A;  2G7U A;  5ICC A;  1QBJ A;  2E7X A;  3CUO A;  3L7W A;  1QZZ A;  2P6T A;  1R7J A;  1U5T A;  4G7O F;  2M5W A;  2HYG D;  4UV9 A;  4U0Y A;  2OZ6 A;  5H20 A;  3ECH A;  5LEJ A;  1SFE A;  1SMT A;  2BV6 A;  2LSO A;  3WTS C;  5CVU A;  3F3X A;  3WTX C;  1TW3 A;  3E5U A;  4UVC A;  5AON A;  3IWZ A;  2BEO A;  2V1X A;  4UVA A;  4EVI A;  2QQA A;  1O3S A;  1U78 A;  3GVA A;  5EEH A;  2QBY B;  2FQ3 A;  3RYP A;  2O8X A;  2XIG A;  4N0B A;  2CSO A;  1FP1 D;  1IXR C;  5D8L B;  3DKW A;  1IXS B;  1JXS A;  5E18 F;  4LG0 B;  4I02 A;  4Q4Z F;  3IC7 A;  4BYY A;  2K86 A;  4YIF A;  2UXX A;  1WKM A;  5FGM A;  3TO6 A;  4GXO A;  1FP2 A;  4ZYG A;  1ZG1 A;  1UST A;  4HBL A;  3PFI A;  4KMF A;  2XVC A;  2YX7 A;  3G3Z A;  2MLK A;  3GFM A;  3EET A;  3SHF A;  3V7C A;  1O7F A;  2ISZ A;  3WTV C;  4Q47 A;  2WTE A;  2Z5U A;  3K1N A;  4A0Z A;  4EMS A;  3BRO A;  1G3Y A;  1HSJ A;  5ERI A;  5LRR A;  1I27 A;  5IT9 K;  1MZB A;  1A04 A;  3BJA A;  4LFU A;  3E3V A;  1FZP B;  5CYV A;  5AIQ A;  2V79 A;  2HDC A;  4PGG A;  3ABT A;  4KN7 X;  4ENJ A;  1W5T A;  3GWZ A;  1I1G A;  2RQP A;  3KLN A;  1ULY A;  4I01 A;  2GXB A;  5FD6 A;  5E1W A;  3SXY A;  1USS A;  3BP8 A;  3GEZ A;  2M30 A;  4ASN A;  1KA8 A;  2W57 A;  2DK8 A;  4A5M A;  2CGP A;  2QM3 A;  4ENM A;  3ELK A;  2L4M A;  2IRF G;  3HOS A;  2JT1 A;  1MGT A;  3ZMS A;  3FMR A;  1UFM A;  2D1V A;  1S7A A;  2F2E A;  2O3F A;  4ON0 A;  2W25 A;  2X4H A;  2HTS A;  3REO A;  3KP7 A;  5DD4 A;  5ILV A;  1FOK A;  3RYR A;  3E5X A;  3HTS B;  3HUG A;  3NQO A;  4Z2Y A;  3HOT A;  3V7R A;  5K5Q A;  2P5K A;  1IRG A;  5J8F A;  3CLO A;  2YSR A;  4RGX A;  5FFX A;  3I54 A;  5CVI A;  3RKW A;  3KLO A;  3Q5F A;  4PZJ A;  4RAY A;  4G8X A;  2P7V B;  3FX3 A;  4TV7 A;  1G3W A;  4ESB A;  5JR3 A;  1OMI A;  3IKV A;  2M1B A;  5E17 F;  1S8N A;  2Q2E A;  1SAX A;  4HX7 A;  2VOP A;  5FO5 A;  2NNY A;  3WTU C;  3LAP A;  2LF8 A;  3K1M A;  2V6C A;  2VT3 A;  4WCG A;  1HBX G;  2XRO A;  3FXQ A;  2VT2 A;  3G73 A;  1LNW A;  4KMU X;  3T1B A;  3LWF A;  1SD5 A;  1ZYR F;  2A07 F;  4KNY A;  4HLX A;  4AIJ A;  2P6S A;  4BHC A;  1W5S A;  4KFC A;  1IZ1 A;  4P5O A;  3H3U A;  2W24 A;  5LGT A;  5TRD A;  1U2W A;  1OKR A;  3KEQ A;  5CLS A;  5LLQ A;  1PP7 U;  4CXF A;  1J75 A;  2ETH A;  1HKQ A;  2VN2 A;  4P55 A;  5D8K B;  3GFJ A;  4HOB A;  2Q8K A;  2Q0O A;  1S29 A;  3RKX A;  1ZAR A;  4M72 A;  2RVC A;  3ML6 A;  1HW1 A;  3H3Z A;  3GZ5 A;  1R00 A;  2HGC A;  5LRS A;  5ICG A;  3DV8 A;  4U0V A;  4HW0 A;  4QLC U;  4G7Z F;  3KP6 A;  3JSO A;  1J7K A;  4GO1 A;  4EM2 A;  4FT8 A;  1MKM A;  3TKY A;  1BM9 A;  4OIP F;  1QPM A;  1XB4 A;  2QQ9 A;  4LK1 F;  3D0S A;  4HV5 A;  1F4K A;  3ZMZ A;  2HKX A;  3J80 K;  4JBA A;  2F5F A;  3QRF F;  4L9N A;  4AD9 A;  2WV0 A;  4M6X A;  2L02 A;  1S7O A;  1G4D A;  3T8R A;  4CZZ A;  2PI0 A;  3O3K A;  2BYV E;  4Y13 A;  2EFN A;  4G6D A;  1XGN A;  4LK0 F;  3QPT A;  4ENK A;  2LNB A;  2F5C A;  3QP6 A;  3TO7 A;  2IA2 A;  4XLN F;  1B9M A;  1VTN C;  4O6J A;  2CW0 F;  2GA2 A;  3M1E A;  4XRF A;  5K5O A;  3MCZ A;  3FMS A;  2ELH A;  2Z99 A;  2Z3Y A;  4NB5 A;  1BOA A;  1O3T A;  4RB1 A;  5D5V B;  1B9N A;  3KP2 A;  1PP8 F;  5IT3 A;  3R4K A;  1O57 A;  4YFK F;  2A6E F;  4K2E A;  4MTD A;  1LVA A;  4L9T A;  4A0Y A;  5J6X A;  5CJ9 A;  2L3D A;  5DCM A;  3GFI A;  3KEO A;  4Y15 A;  3I71 A;  4ZYE A;  2JRT A;  2XUB A;  5LGU A;  1MD0 A;  1YQA A;  2M8E A;  1LEB A;  1FLI A;  4LB6 B;  1R1U A;  2L54 A;  1ZGJ A;  3L09 A;  5HVQ C;  1IAW A;  4M9S A;  3BY6 A;  5HDN A;  1MJB A;  2GZW A;  3HRM A;  1Y0U A;  5AIP A;  3GFL A;  2W85 A;  1QNT A;  2YPR A;  1JGS A;  1FNN A;  1EH7 A;  2HFH A;  1GXQ A;  3H92 A;  4I09 A;  1LEA A;  1LDK B;  2E7W A;  1R58 A;  1XSX A;  1U6G A;  1HST A;  3J7A O;  5HS7 A;  2H6C A;  4B09 A;  3IRR A;  2FXA A;  3IRQ A;  2E1C A;  2OQR A;  4HF1 A;  3M8E A;  3QAH A;  3WG9 A;  2PQ8 A;  4GCV A;  3U9G A;  2IPQ X;  5J8C A;  5TJJ A;  3ABU A;  3RJP A;  3CTA A;  2LF7 A;  4HF0 A;  1QO0 D;  2IJL A;  3DEU A;  4RS8 A;  5BS6 A;  3F21 A;  2XAG A;  4M9Z A;  5BMZ A;  5FLX K;  1YTY A;  2KJB A;  4KN4 X;  3GX4 X;  3HRU A;  1HKT A;  1IXC A;  2FNA A;  1Z6R A;  2XAF A;  5HLI A;  2JPC A;  3RTR A;  5LHG A;  1U8R A;  3QP5 A;  4FHT A;  4U0W A;  1SFX A;  4ETS A;  2G7H A;  3B73 A;  2DQL A;  1LB2 A;  2V9V A;  2R3S A;  3LST A;  1K7A A;  3EUH A;  3F72 A;  4CDG A;  4WXD A;  3BJO A;  4DQ2 A;  3I0T A;  3W6J B;  4DNC A;  3FXU A;  1KU7 A;  3F8M A;  3LA2 A;  2A61 A;  3Q9S A;  3CDH A;  2XRN A;  1ZG3 A;  2GWR A;  4OIN F;  2MLG A;  1S3J A;  5ICF A;  2CG4 A;  1Z7U A;  3S2W A;  3K0L A;  4YFX F;  3RKY A;  4M6Y A;  2HZT A;  1K6O A;  3ZMT A;  3M8F A;  2PEX A;  3I59 B;  3EYI A;  5E1X A;  4MGR A;  3KZZ A;  3GLX A;  2DBB A;  3HSF A;  4G9Y A;  2RN7 A;  2EFW A;  4S04 A;  4L9J A;  4ZYD A;  3HHG A;  1TW2 A;  2M45 A;  2OZU A;  2DPU A;  1YLF A;  4EGY A;  5ICE A;  2GAU A;  2KIF A;  1B6A A;  2FNP A;  3WU1 B;  2HQN A;  3E6D A;  5D4S A;  3F6O A;  2DTR A;  5HS8 A;  3RDI A;  1V3F A;  1E17 A;  4LMY A;  1DUX C;  5FFZ A;  3JAM Z;  1B59 A;  1SD6 A;  1WQ2 A;  3LAJ A;  2ADU A;  5CVJ A;  1B4A A;  4A6D A;  3TDZ C;  3VFZ A;  1LQ1 A;  3GUD A;  1C0W A;  5A2Q Z;  3T5X A;  3MZY A;  4IF4 A;  4HV6 A;  3SQN A;  3KZY A;  2EFP A;  1BI1 A;  2L4A A;  3KP3 A;  2EA4 A;  4MQV A;  1HXD A;  2O6G E;  1IUY A;  1IRF A;  4G6Q A;  2J5P A;  4OIO F;  1FYK A;  3WE2 A;  1KU2 A;  2YU3 A;  2F5E A;  1SFU A;  2GXG A;  1YG2 A;  4NQW A;  4A2U A;  4ENN A;  3KET A;  1FBS A;  4MHG A;  5LBQ A;  2EK5 A;  2BE5 F;  5E1Z B;  2M87 A;  3ZP5 A;  2FML A;  3L9F A;  2IT0 A;  2DAO A;  2FBK A;  5D5U B;  3R0A A;  1TNT A;  4KUM A;  3N97 A;  5LGN A;  5FD5 A;  3M7G A;  1BBY A;  3B02 A;  2CWE A;  2QWW A;  4KYW A;  3BJ6 A;  1D3Y A;  2KIM A;  3MZH A;  3T0Y A;  1EV7 A;  3TO9 A;  3VOD A;  3VOE A;  5F64 A;  1XD7 A;  4QWQ A;  4HQE A;  1W7P B;  1KYW A;  4RB2 C;  1O3Q A;  2OQG A;  4U7D A;  2FMY A;  4HYE A;  4B8X A;  1KGS A;  4KDP A;  3V4G A;  3F6V A;  3P9C A;  2V1D A;  4D0P A;  2IA0 A;  4WWC A;  3I5U A;  2HYF A;  2EA2 A;  1YYV A;  4S05 A;  4UUV A;  5F1R A;  2MD5 A;  2QBY A;  3KFW X;  4M74 A;  2ZBK A;  2K4B A;  5JI6 A;  2FU4 A;  4EQQ A;  3FXR A;  5D6F A;  1KQ0 A;  2FBH A;  1ZH5 A;  3IL2 A;  2STT A;  5BPI A;  2H27 A;  4LG0 A;  1NHA A;  1FPQ A;  3NEU A;  4AWX B;  5HLH A;  2IVM A;  1RIO H;  2QEN A;  2O61 A;  4ESJ A;  1CF7 B;  4CYD A;  2ZO4 A;  1ZLJ A;  5JFR A;  4ZH4 F;  3J81 K;  1OYY A;  4ESF A;  5HDK A;  2D1H A;  1HKS A;  4RGR A;  4Q48 A;  4Y17 A;  1DDN A;  4L9V A;  1TLH B;  4O3M A;  2K4J A;  1R1V A;  3HIF A;  4L18 B;  2NAZ A;  1KQ8 A;  3BPV A;  2PN6 A;  2A3S A;  3O2P E;  1ZRF A;  2PBI A;  2VON A;  1P4A A;  4OIQ F;  1QZY A;  3K9T A;  2QUF A;  1YS7 A;  4IVN A;  5IT9 Z;  1IN4 A;  3IWF A;  4RB0 A;  4MEY F;  3F8N A;  1WWX A;  1P92 A;  4CO8 A;  3ULQ B;  1O3R A;  2DU9 A;  1IN6 A;  3HSR A;  2CYY A;  1E2X A;  3TQN A;  2XAH A;  2RC4 A;  1UHW A;  1FT9 A;  1T0F A;  2WWY A;  2HOE A;  2Z9O A;  2JPB A;  1TQP A;  2H94 A;  1YFH A;  1RUO A;  3MQ0 A;  5EEG A;  2LDU A;  4A12 A;  3LFK A;  3E6C C;  4EJO A;  3GZ6 A;  1TTY A;  1XMK A;  3M9A A;  2ESN A;  2OAZ A;  2VC0 A;  2DI3 A;  1IF1 A;  1J5Y A;  2ZKZ A;  4A0X A;  1K78 B;  3R6S A;  5D5W B;  4M9X A;  5JHU A;  1HW5 A;  2WC2 A;  1B1B A;  1ZG5 A;  1FC3 A;  2CQK A;  2A69 F;  1LJ9 A;  4EJT A;  3C7J A;  2NYX A;  3GYH X;  1L0O C;  2J5O A;  2ZFW A;  2Y48 A;  2K7L A;  2F5D A;  1X3U A;  1PUE E;  2H6B A;  2OA4 A;  1H9G A;  2NNN A;  4UVB A;  1U5T B;  3I4P A;  3AAF A;  2QQB A;  1G3S A;  2VC1 A;  4L0Y B;  3F22 A;  4GGG A;  4HZF A;  3EYY A;  4WX9 A;  3WE3 A;  2HKO A;  2OU2 A;  1F5T A;  5L3E A;  1FBQ A;  1OR7 A;  4HDV A;  3FF5 A;  3CUQ B;  4G7H F;  3HTU A;  3JSP A;  3V8L A;  4LLN A;  1FYM A;  1Z6T A;  2CO5 A;  1F9N A;  3K69 A;  1YW8 A;  1CF7 A;  3BPX A;  1BC7 C;  4R8H A;  1S6L A;  4G94 A;  1BI2 A;  4UV8 A;  3FM5 A;  3BDD A;  3W6K B;  1XMA A;  3FZV A;  2XV4 S;  2STW A;  4KIC A;  5LEK A;  2EJR A;  1FY7 A;  4HF2 A;  2GIV A;  3FHZ A;  1YO5 C;  2G9W A;  5HOO A;  1R1T A;  3VEP A;  2FBI A;  3E6B A;  4UXN A;  4I0B A;  3WOD F;  1SD4 A;  2EV5 A;  3PQJ A;  5ILS A;  3T8T A;  1K79 A;  1XGM A;  1RZ4 A;  2E1N A;  3R0J A;  1FWZ A;  6PAX A;  3DP7 A;  2OBP A;  4IPA A;  3QPH A;  1R23 A;  3IKT A;  3CO7 C;  3WGH A;  1HQC A;  2ZNZ A;  4E70 A;  1KU3 A;  1R22 A;  1FBU A;  2QLZ A;  1SMY F;  1AOY A;  2MA3 A;  2P8T A;  3E6M A;  3IHU A;  3RI4 A;  1ONV A;  1G3T A;  1CGP A;  4AIH A;  1XCV A;  1Z9C A;  1R5H A;  4KIF A;  1YW7 A;  4LLL A;  2COM A;  1JHH A;  2RDP A;  3J80 Z;  1KQ9 A;  4R79 A;  1Z91 A;  3C18 A;  2X0L A;  5DV5 A;  3QU6 A;  2LKP A;  4L5J A;  3SZP A;  2FE3 A;  2H09 A;  3JTG A;  1GHC A;  2HQR A;  3BWG A;  4WXC A;  4KIG A;  4I7H A;  3GO5 A;  2PLY A;  2EFO A;  2AXL A;  1ZRE A;  3L2C A;  2FRH A;  4EM1 A;  1REP C;  4P9F A;  4WXH A;  2GQQ A;  2VXZ A;  3CJN A;  5K1Y A;  5FB2 A;  1MJ9 A;  1ON2 A;  5LHI A;  2DK5 A;  1GVJ A;  2VOD A;  5KVR A;  5DEQ A;  1ZAO A;  3WTW C;  3L00 A;  2EFQ A;  2ACJ A;  3HRT A;  1SD7 A;  3WTY C;  2FA5 A;  3JTH A;  4BNC A;  3FMQ A;  1J0R A;  2A5Y B;  1AWC A;  2O0Y A;  4LLG F;  3CUQ A;  4BHP A;  1UHM A;  2JZY A;  5HLG A;  2ESH A;  2KRF A;  3K1P A;  5L3C A;  2PG4 A;  3LQR A;  2EV0 A;  4XLP F;  4WF2 A;  3ROU A;  3EDP A;  2V1U A;  4AVP A;  3JW4 A;  3OV8 A;  2MH2 A;  2R7F A;  4OMY A;  2BBY A;  1F1Z A;  3C3W A;  1FX7 A;  3TDU C;  2HWV A;  1H9T A;  4EGZ A;  1TQM A;  4N9I A;  3I58 A;  4RB3 C;  4H0E A;  3Q9V A;  5DYM A;  4FX4 A;  3DPL C;  3MWM A;  2XKO A;  1U3E M;  3VB2 A;  1DPR A;  2O03 A;  3COA C;  2P5L C;  2PMH A;  5HS9 A;  4I0A A;  3WTZ A;  4YII A;  4L0Z B;  4HA8 A;  5ILU A;  5KK1 A;  5D4R A;  3KP5 A;  1OPC A;  4U7B A;  3CO6 C;  1D8K A;  2FEZ A;  1DP7 P;  4ZZD A;  2XAS A;  5FLX Z;  3TOA A;  2HR3 A;  5H6Q A;  4ZYH A;  1BC8 C;  4R1H A;  4KA4 A;  4F7Z A;  2K27 A;  3F8B A;  4OIR F;  1FSE A;  2VE9 A;  4Q5S F;  1TBX A;  2OD5 A;  4WK8 F;  5BPD A;  4O5V A;  1XCB A;  1W4M A;  3P7N A;  4A6E A;  3QU3 A;  1BI3 A;  2FSW A;  2KIU A;  4AIK A;  4PGH A;  2ZME B;  1BI0 A;  1RI7 A;  2ISY A;  2D45 A;  2DO7 A;  3U1D A;  2A6H F;  2AS5 F;  2HEO A;  2NS0 A;  3DFG A;  2K02 A;  2DW4 A;  2VBW A;  1Z05 A;  1D8J A;  4YG2 F;  1OYW A;  1EH6 A;  3I59 A;  4JQF A;  2PMU A;  3MAJ A;  3SZT A;  1UB9 A;  1FYL A;  3C1D A;  3WGI A;  4HQM A;  1MDM B;  1BIB A;  2RKH A;  2XAQ A;  2EB7 A;  2ZJ2 A;  3I53 A;  1WSU A;  4PCQ A;  5D6E A;  2C6Y A;  4UNO A;  3ERE D;  1R36 A;  4CGZ A;  4LD5 A;  5L3F A;  4P96 A;  4GYG A;  1R5G A;  1LDJ A;  1OYI A;  2YR2 A;  1YS6 A;  2HS5 A;  2TDX A;  3ZQ7 A;  2IA1 A;  5DCM B;  3HRS A;  1KU9 A;  3DF8 A;  1RNL A;  2XHK A;  3MEX A;  1EH8 A;  3RIR A;  2P5V A;  4HAM A;  3KP4 A;  2VBZ A;  1ZRC A;  4HX8 A;  1BIA A;  1D5V A;  3ZN1 A;  3BOQ A;  2YX4 A;  3LQQ A;  3RPU A;  2QYO A;  4MQ9 F;  3HSE A;  3ZN0 A;  4OOI A;  3R61 A;  2ZXJ A;  2QZ8 A;  3ZMV A;  2JSC A;  2XKP A;  3LA3 A;  3D5L A;  1TQI A;  2DT5 A;  1P2F A;  1YW9 A;  1JHF A;  3WTT C;  5JVT A;  1W7P D;  2A68 F;  2P4W A;  1I6X A;  2KKO A;  4BHB A;  1O7L A;  2DFI A;  1T6S A;  5CVR A;  3ZMD A;  4XSX F;  4BH9 A;  3OOP A;  4XSZ F;  2VOO A;  2KJC A;  1T2K A;  2ZNY A;  1HW2 A;  1P6R A;  5E8G A;  1BN5 A;  2MC3 A;  4MEX F;  5ED4 A;  4BAY A;  4JK1 X;  1J9I A;  1IW7 F;  2UZK A;  4EJV A;  2DLL A;  4MNU A;  3DQV C;  3I64 A;  1TNS A;  2PJP A;  5DDG A;  2ZME A;  1STZ A;  2CFX A;  3P9K A;  2VE8 A;  1XSD A;  1KYZ A;  1J59 A;  1J2X A;  4IRH A;  4HX4 A;  5DCF A;  4EJU A;  3F8F A;  5K5R A;  5L3B A;  1XGO A;  4I98 B;  3RPQ A;  4IXA A;  1IN8 A;  1G6N A;  1T38 A;  1RUN A;  1WI9 A;  3ISP A;  2GA1 A;  3GW2 A;  4LGW A;  1QQI A;  1WRJ A;  2BGC A;  2EWN A;  3V7S A;  4IRI A;  2VBX A;  3PQK A;  1W7P A;  2MH9 A;  3NRV A;  5E20 A;  4RAZ A;  1JE8 A;  1IN5 A;  1Q1H A;  1P4X A;  2DPD A;  1V4R A;  1H0M A;  1MDM A;  2L01 A;  5E8I A;  3E5Q A;  4PDK A;  1XDU A;  2B0L A;  4KIB A;  2XAJ A;  3F8C A;  5H6R A;  4NHJ A;  3R60 A;  2FOK A;  1ODD A;  1XN7 A;  2IP2 A;  1PDN C;  3GXO A;  3P9I A;  1UCR A;  2ZCW A;  1FSH A;  1T39 A;  2UXN A;  4EJW A;  2FF4 A;  2RV8 A;  4M73 A;  4IHT A;  4P9U A;  2RNJ A;  3E97 A;  4M71 A;  2VBY A;  4I2O A;  5L3G A;  3HHH A;  3EQL F;  5HDG A;  2R7D A;  3O6B B;  1XGS A;  4FX0 A;  4BQA A;  4CHU A;  2Z33 A;  1QGP A;  2DQR A;  1U5T C;  2JTV A;  3QOP A;  2Y75 A;  3J81 Z;  3JAM K;  3V8J A;  4GYI A;  4ZZL A;  4IJA A;  1BJA A;  1LDD A;  1L3L A;  3V8K A;  3ECO A;  1ON1 A;  5BOX A;  1ZLK A;  4CIC A;  4OMZ A;  5DUK A;  5BQT A;  2QVO A;  3CUQ C;  1Z1D A;  1XDS A;  1YIO A;  4A5N A;  2NRA C;  4RGS A;  4MTE A;  4YFN F;  4KT5 C;  5A2Q K;  1I5Z A;  5DUI A;  4LJZ F;  3KE2 A;  3FWE A;  3LA7 A;  3DPT A;  4N9H A;  2Y0M A;  4EV0 A;  1GXP A;  5L3D A;  4L5I A;  5LHH A;  3TOB A;  2RGV A;  3ZMU A;  3U2R A;  1P4W A;  4IHS A;  3SFZ A;  5CVV A;  4LB5 A;  4EM0 B;  4RGU A;  4UHT A;  1I1S A;  2W84 A;  4OU0 A;  4HLY A;  3K2Z A;  3KCC A;  2XGX A;  3BZ6 A;  3DXJ F;  1ZHF A;  2P7C B;  1T98 A;  4U88 A;  2HTJ A;  4XBF A;  3TGN A;  5F6F A;  3FM3 A;  3N4M A;  2D2W A;  3HYI A;  5DD8 A;  2UWM A;  1ZRD A;  1MJA A;  4HDU A;  3WGG A;  1XSV A;  2MBF A;  1K78 A;  3F23 A;  5D5X B;  4BXU A;  2IW5 A;  2PFB A;  3MFK A; 
#chains in the Genus database with same CATH topology
 4IRG A;  3ZPL A;  1EA3 A;  3GF2 A;  3S93 A;  2EV6 A;  1IN7 A;  1DPU A;  3WU0 A;  1B8I B;  4HEA 2;  1ZGA A;  1ZN2 A;  4RAF A;  2VJJ A;  1D5Y A;  2G7U A;  5ICC A;  3GME A;  1QBJ A;  5F0C A;  5C4J J;  1YIJ I;  2E7X A;  2O5R A;  3CUO A;  2E1M C;  3L7W A;  2L5Q A;  3ZR8 X;  1YJN I;  1QZZ A;  1XTA A;  2P6T A;  1R7J A;  4Y33 A;  2OTL I;  1U5T A;  2E2I J;  3KPH A;  4G7O F;  4CCM A;  2BY1 A;  2M9H A;  3CP2 A;  2M5W A;  4BDZ A;  2HYG D;  4UV9 A;  4U0Y A;  3JRD A;  1TWH J;  2DA6 A;  2OZ6 A;  5H20 A;  3ECH A;  5LEJ A;  1SFE A;  1SMT A;  2BV6 A;  3OS2 A;  2JA5 J;  2LSO A;  3WTS C;  4ZYA A;  3S3N A;  2DMT A;  4NUB A;  5CVU A;  4D9J A;  2M3A A;  3F3X A;  3WTX C;  1TW3 A;  3OL4 A;  3E5U A;  4UVC A;  5AON A;  2TCT A;  3IWZ A;  2BEO A;  2V1X A;  2L9S A;  4UVA A;  4EVI A;  2QQA A;  2LRE A;  1O3S A;  1U78 A;  2K9M A;  3GVA A;  2NOG A;  3GTM J;  2XC7 A;  5EEH A;  2QBY B;  2FQ3 A;  3V42 A;  2CRG A;  2L7Z A;  3RYP A;  3HB9 A;  3HBL A;  2DTZ A;  1VQP I;  2O8X A;  2JA7 J;  4B3X A;  2XIG A;  4N0B A;  2CSO A;  2Z1D A;  1FP1 D;  1WJC A;  4FET A;  5JHF A;  4IQJ A;  4DGW B;  1IXR C;  5D8L B;  2IS6 A;  3DKW A;  1IXS B;  1JXS A;  2F4M B;  5E18 F;  4LG0 B;  2I10 A;  4I02 A;  3TED A;  4Q4Z F;  2DFE A;  3IC7 A;  3IP4 B;  4BYY A;  2AQE A;  2K86 A;  4YIF A;  2R5Y B;  4XON A;  2L2O A;  2UXX A;  1WKM A;  3FKI J;  4A3D J;  1PUF A;  2KDO A;  5FGM A;  3TO6 A;  4GXO A;  3H9Q A;  1FP2 A;  3DPU A;  4ZYG A;  1ZG1 A;  3Q3S A;  1UST A;  2EH3 A;  4HBL A;  4PSW A;  1BA5 A;  3PFI A;  5EG0 B;  2E2H J;  2M34 A;  4KMF A;  2XVC A;  2YX7 A;  3G3Z A;  2MLK A;  4XLF A;  3GFM A;  1MBG A;  3C2H A;  3EET A;  3SHF A;  3V7C A;  2EBI A;  1O7F A;  2W82 A;  4AUX A;  2ISZ A;  4I6Z A;  3PJR A;  3WTV C;  4Q47 A;  2WTE A;  2Z5U A;  3DLL F;  2HVR A;  3K1N A;  5EZG A;  4A0Z A;  2CS3 A;  4JX6 A;  4EMS A;  2DXI A;  1YJW I;  3BRO A;  2CV0 A;  1G3Y A;  3PSF A;  1Z67 A;  1HSJ A;  2LFB A;  5ERI A;  3GCM A;  3ZQI A;  5LRR A;  3S3O A;  1I27 A;  5IT9 K;  1MZB A;  1A04 A;  1GT0 C;  4DIQ A;  3BJA A;  4A3L J;  4LFU A;  4XR6 A;  2BW3 A;  3DLA A;  1BJZ A;  3CME I;  3E3V A;  2OUM A;  1FZP B;  5CYV A;  5AIQ A;  3KYD B;  2V79 A;  4RLQ A;  2HDC A;  2LY2 A;  4PGG A;  1JI8 A;  2E71 A;  3ABT A;  4KN7 X;  4ENJ A;  5EZH A;  1W5T A;  3BG3 A;  3GWZ A;  1I1G A;  1NG6 A;  2RQP A;  4XLH A;  5HOD A;  4HG2 A;  1MMG A;  3KLN A;  1ULY A;  2XGD A;  3G2B A;  2R5Z B;  4I01 A;  3FXJ A;  1FEX A;  4QIW N;  2GXB A;  1MBJ A;  1QVU A;  5FD6 A;  3BR6 A;  5E1W A;  3SXY A;  1FOY A;  1USS A;  3OY9 A;  3BP8 A;  2NS8 A;  2QSH X;  3BZK A;  3GEZ A;  2KMU A;  2VIX A;  2M30 A;  3PL8 A;  4ASN A;  3CJQ B;  1KA8 A;  2W57 A;  1N25 A;  2DK8 A;  1WPK A;  3PM1 A;  5KHD A;  4QPQ A;  1MSE C;  2HVQ A;  3G1M A;  4A5M A;  2CGP A;  3HOZ J;  2QM3 A;  2Z2S B;  3VYR B;  4ENM A;  3TL4 X;  2GXA A;  3ELK A;  1FJL A;  1V5F A;  1X2N A;  2L4M A;  2IRF G;  1BR1 A;  3HOS A;  4E7S A;  2WB1 A;  2JT1 A;  1LE8 A;  1MGT A;  4HNT A;  2DA4 A;  1MW7 A;  2K3F A;  3Q0V A;  3ZMS A;  3FMR A;  1UFM A;  2D1V A;  1WJD A;  1FIP A;  4IHW A;  1VF9 A;  1S7A A;  2F2E A;  2O3F A;  2ZJQ F;  3J7A Y;  4ON0 A;  2W25 A;  2E2J J;  2X4H A;  4EEF G;  2HTS A;  4MIM A;  4BE0 A;  1ZTR A;  3RPU D;  2IS4 A;  4II2 A;  3REO A;  4PSX A;  3UR3 C;  4XKC A;  3KP7 A;  4I99 C;  2MC4 A;  5DD4 A;  5ILV A;  4X1E A;  1FOK A;  3RYR A;  3KX2 A;  3E5X A;  3HTS B;  3HUG A;  3NQO A;  4BS9 A;  3OS1 A;  3L2R A;  2ZME C;  2WY7 Q;  4Z2Y A;  3H9J A;  2K9Q A;  4NDL A;  4XOR A;  5M5X J;  1JTY A;  3HOT A;  3V7R A;  5K5Q A;  1R9T J;  3H35 A;  1FOW A;  2P5K A;  1IRG A;  1R4M B;  5J8F A;  3CLO A;  2YSR A;  4XIC A;  5DS9 A;  4G6T B;  2WAD A;  4HSR A;  1MH3 A;  1PJR A;  3BR0 A;  4RGX A;  5FFX A;  4ZC3 A;  3I54 A;  3H0D A;  5CVI A;  3RKW A;  3KLO A;  1V55 H;  3JRF A;  3Q5F A;  1WHU A;  4Y52 J;  4PZJ A;  1TWC J;  4RAY A;  4G8X A;  1W0T A;  2P7V B;  3FX3 A;  5J4V A;  2KFD A;  9ANT A;  4TV7 A;  3TBI A;  4ZDP A;  3LOC A;  3GTP J;  2E5N A;  1MBH A;  1WJ5 A;  4KJZ A;  3ASN H;  1G3W A;  4ESB A;  2CW8 A;  3BCA A;  5JR3 A;  5LFA A;  2DA3 A;  2I8D A;  1OMI A;  3IKV A;  4BY1 J;  2M1B A;  3GLL A;  5E17 F;  2ID3 A;  2X6W A;  2JJ7 A;  2E60 A;  1S8N A;  2Q2E A;  4FE7 A;  5FKN A;  1SAX A;  3MN2 A;  4HX7 A;  3RQ4 A;  4LIU A;  2VOP A;  5FO5 A;  3J7Y J;  2NNY A;  3EUA A;  3VPR A;  1X2M A;  2KHM A;  3WTU C;  3LAP A;  2LF8 A;  3K1M A;  1U8B A;  2V6C A;  3SZG A;  1TT5 B;  1UEL B;  2VT3 A;  4WCG A;  1HBX G;  2XRO A;  2XGE A;  4NC7 A;  3FXQ A;  1PVE A;  1I3Q J;  2VT2 A;  3G73 A;  3KIO A;  1JT0 A;  1LNW A;  4KMU X;  3E7L A;  5FJ8 J;  2F5V A;  3T1B A;  3BCB A;  3LWF A;  1SD5 A;  1ZYR F;  2A07 F;  4KNY A;  4HLX A;  3D1N I;  4AIJ A;  2V7F A;  2P6S A;  4ZTJ A;  4BHC A;  1W5S A;  2ZJP F;  4KFC A;  1IZ1 A;  4A3C J;  4P5O A;  2EQR A;  3H3U A;  4DYQ A;  2W24 A;  2HOT A;  5LGT A;  3SDG A;  5TRD A;  1U2W A;  1OKR A;  3KEQ A;  5CLS A;  5LLQ A;  1PP7 U;  4CXF A;  1J75 A;  2ETH A;  2X85 A;  1HKQ A;  3W2V A;  2VN2 A;  4P55 A;  2DDA A;  5D8K B;  3GFJ A;  2ZSI B;  1X4P A;  1B72 A;  4IHV A;  4HOB A;  5EGO B;  3JRH A;  2Q8K A;  2Q0O A;  1S29 A;  3RKX A;  1ZAR A;  4M72 A;  2RVC A;  3CCE I;  1RPW A;  3QPS A;  3ML6 A;  1HW1 A;  1GV2 A;  3BTI A;  3H3Z A;  4RM2 A;  1Q1V A;  3GZ5 A;  4A3J J;  1R00 A;  2HGC A;  3CCL I;  5LRS A;  5ICG A;  3DV8 A;  4U0V A;  3IUO A;  4AVZ A;  1S9H A;  4HW0 A;  2R5Z A;  4QLC U;  3OS0 A;  4NNJ A;  3S1R J;  2LK2 A;  1ZK8 A;  3GTJ J;  4G7Z F;  4A3I J;  3KP6 A;  5EDN A;  3JSO A;  1J7K A;  4GO1 A;  4EM2 A;  2Y31 A;  1NTC A;  2ELJ A;  2JN6 A;  4FT8 A;  1MKM A;  3TKY A;  1BM9 A;  3FBI B;  2LYC A;  4BJ5 C;  2DOA A;  1D0Z A;  4OIP F;  1LFB A;  1Z21 A;  1QPM A;  1XB4 A;  2EIN H;  2QQ9 A;  4LK1 F;  3D0S A;  4HV5 A;  2DMU A;  1F4K A;  1VQ5 I;  5FRM A;  3ZMZ A;  2HKX A;  1WJB A;  3J80 K;  4N4N B;  4JBA A;  4CA0 A;  5J40 A;  2F5F A;  2HI3 A;  2GLO A;  4YIR X;  3QRF F;  1SVM A;  2HQA A;  3P5J A;  4L9N A;  3ZQH A;  4AD9 A;  4B4C A;  3B6A A;  2WV0 A;  4M6X A;  2L02 A;  1S7O A;  3HM5 A;  1G4D A;  2LKS A;  1TT0 A;  3T8R A;  4CZZ A;  2PI0 A;  3O3K A;  2BYV E;  2XPU A;  4Y13 A;  2EFN A;  4G6D A;  4JP0 A;  1XGN A;  4A3F J;  1YHQ I;  4LK0 F;  3HOX J;  3UKG A;  1YI2 I;  3QPT A;  5F0H A;  4ENK A;  2ZXH A;  2LNB A;  2F5C A;  2Z16 A;  2EZH A;  2WBM A;  3QP6 A;  1OFC X;  3AG3 H;  2FX0 A;  3TO7 A;  4HRI A;  3S2H J;  4QPO A;  2IA2 A;  4XLN F;  3M4O J;  1B9M A;  1VTN C;  1E0E A;  2KRH A;  2PJR B;  4O6J A;  5KAF C;  2CW0 F;  2GA2 A;  2ECB A;  5CQE A;  3M1E A;  4XRF A;  3IAS 2;  5K5O A;  2HXO A;  2X1E A;  3MCZ A;  3PUB A;  3FMS A;  4RAG A;  2ELH A;  4LOC A;  3OWT A;  2Z99 A;  2Z3Y A;  4NB5 A;  1BOA A;  1O3T A;  2HVS A;  4RB1 A;  5D5V B;  1B9N A;  3KP2 A;  1PP8 F;  5IT3 A;  3ASO H;  4I76 A;  5EEA A;  3ABL H;  3D5S C;  1SFK A;  3O8G A;  3R4K A;  1O57 A;  2ECC A;  4YFK F;  2A6E F;  4K2E A;  4MTD A;  1R4N B;  3H36 A;  3K4B A;  5HNF A;  3Q0U A;  4J00 A;  2JQ7 A;  3BT9 A;  1LVA A;  4L9T A;  4A0Y A;  5J6X A;  2R92 J;  5CJ9 A;  2L3D A;  5DCM A;  3WHC A;  3GFI A;  3KEO A;  3KYL A;  4Y15 A;  5GAE J;  3I71 A;  4ZYE A;  2JUG A;  4BEH B;  3GTQ J;  2JRT A;  2XUB A;  3MVP A;  5LGU A;  5M5W J;  1MD0 A;  1YQA A;  2DOF A;  2M8E A;  2QGU A;  4XNF A;  3DTK A;  5HNH A;  1LEB A;  1FLI A;  4E7L A;  1Y1W J;  4LB6 B;  4M3D A;  2CUE A;  3GTL J;  1R1U A;  2L54 A;  1ZGJ A;  2O9L A;  2LH9 A;  3L09 A;  4JX4 A;  5HVQ C;  1IAW A;  4M9S A;  3BY6 A;  5HDN A;  1MJB A;  2GZW A;  2MD0 A;  2XAU A;  3HRM A;  4IKF A;  1X1P A;  1Y0U A;  2JA6 J;  1LFP A;  2K85 A;  5AIP A;  3GFL A;  2W85 A;  1QNT A;  4BY7 J;  2YPR A;  1N75 A;  1JGS A;  1FNN A;  1EH7 A;  2HFH A;  2MSY A;  1LFU P;  1GXQ A;  3H92 A;  4I09 A;  3H5R A;  1LEA A;  1LDK B;  2E7W A;  2K9S A;  1R58 A;  1XSX A;  2A05 A;  1U6G A;  1HA8 A;  1HST A;  3J7A O;  5HS7 A;  2JK3 A;  3IV5 A;  4AU7 A;  2H6C A;  4YEJ A;  1U0J A;  4B09 A;  3A01 A;  4CCJ A;  1QU3 A;  2ZXI A;  3IRR A;  2FXA A;  3IRQ A;  2KL4 A;  2E1C A;  2OQR A;  4HF1 A;  3M8E A;  4IZZ A;  3QAH A;  2BHY A;  2EIL H;  3SFI A;  3WG9 A;  2CQ7 A;  2PQ8 A;  4C3J J;  4GCV A;  3U9G A;  1AKH A;  2IPQ X;  5J8C A;  5TJJ A;  3ABU A;  2VQL A;  2I5U A;  3RJP A;  5EGO A;  3K4N A;  2OCE A;  3OIP A;  1NH3 A;  3GTO J;  3CTA A;  2LF7 A;  4HF0 A;  1QO0 D;  3SYT A;  2IJL A;  3DEU A;  4RS8 A;  2NVT J;  3LFU A;  5BS6 A;  3F21 A;  2XAG A;  5K7Z A;  4M9Z A;  5BMZ A;  3BG6 A;  4BQO A;  2XF5 A;  1HF0 A;  5FLX K;  4M6V A;  1YTY A;  3AL0 C;  3CJT B;  2LG4 A;  3S14 J;  1X19 A;  1R71 A;  2KJB A;  1BW5 A;  4KN4 X;  3GX4 X;  3HRU A;  3L1P A;  1HKT A;  3ABM H;  1IXC A;  1WJE A;  4BQQ A;  4PJL A;  3N05 A;  1MMA A;  2FNA A;  4D7N A;  1Z6R A;  2XAF A;  1POG A;  2A5W A;  5HLI A;  2JPC A;  2LLK A;  2EIM H;  3RTR A;  5LHG A;  5K7F A;  1U8R A;  3QP5 A;  1JGG A;  4E7Z A;  4FHT A;  4U0W A;  1SFX A;  2M4G A;  4ETS A;  2G7H A;  1XMX A;  2DQL A;  2HNH A;  3B73 A;  2RNG A;  1LB2 A;  2CJJ A;  4B1R A;  1CQT A;  2V9V A;  4A3G J;  2R3S A;  3LST A;  1K7A A;  3EUH A;  3F72 A;  2NOJ B;  2XF6 A;  5FKL A;  4A93 J;  4CDG A;  4WXD A;  5IP6 A;  3BJO A;  4DQ2 A;  3I0T A;  3W6J B;  4DNC A;  2CMP A;  4XK4 A;  3FXU A;  1KU7 A;  1OLT A;  3F8M A;  3LA2 A;  2A61 A;  2E1M B;  3Q9S A;  3CDH A;  1Y0N A;  2XRN A;  3G71 I;  1ZG3 A;  2GWR A;  4OIN F;  4BKX A;  1YRN A;  1VQN I;  2EZK A;  2L9N A;  3G1O A;  2MLG A;  3K4C A;  1DGR M;  1S3J A;  2IEK A;  2VQG A;  1HCR A;  3LSP A;  2Y9Y A;  1GVD A;  5ICF A;  2CG4 A;  2R4G A;  1Z7U A;  2AO9 A;  3SJM A;  3S2W A;  4DZJ A;  1OCZ H;  2E1O A;  3K0L A;  4YFX F;  3CF2 A;  1S7E A;  4PJ0 C;  4BUP A;  5JVG F;  3RKY A;  1TWG J;  4M6Y A;  2HZT A;  3TW6 A;  1K6O A;  3ZMT A;  2PJR A;  5J1U A;  3M8F A;  3RZO J;  4DZP A;  3A4C A;  2PEX A;  2VXD A;  2IXS A;  2ZB9 A;  3I59 B;  3LNQ A;  5E1X A;  3EYI A;  4A3M J;  2PX9 A;  2DFF A;  2EPF A;  2Y69 H;  4MGR A;  2WAQ A;  3KZZ A;  4UUT A;  3GLX A;  1IDY A;  3JRB A;  1LKX A;  1IC8 A;  4PUS A;  2DBB A;  3HSF A;  4G9Y A;  2RN7 A;  1IUF A;  2EFW A;  3S15 J;  4S04 A;  4JYK A;  4UB6 C;  3ZOB A;  4NBQ A;  4L9J A;  4ZYD A;  3HHG A;  5IOY A;  1TW2 A;  2M45 A;  2OZU A;  2QSG X;  2DPU A;  1HOM A;  1YLF A;  5HLT A;  1QVT A;  4BEH A;  3OYL A;  4EGY A;  1W0U A;  3K7A J;  4CCO A;  4F52 A;  1WCM J;  4IX7 A;  2OJE D;  5ICE A;  2KLO A;  3BLY A;  3S32 A;  3J7Z I;  5F0F A;  2DJI A;  2GAU A;  5IY5 H;  2KIF A;  1B6A A;  2FNP A;  4BJ6 C;  3WU1 B;  2MYS A;  2HQN A;  2X48 A;  4C2T A;  1ORK A;  1IO2 A;  3E6D A;  5KCM A;  4C9Y A;  1MNE A;  5D4S A;  3LSM A;  3F6O A;  1JJ6 C;  2DTR A;  5HS8 A;  4ZDL A;  3RDI A;  1V3F A;  1E17 A;  4FE4 A;  2ZXW H;  2KDZ A;  2VAS A;  1VQ7 I;  2BZT A;  3FDY A;  4LMY A;  5FFZ A;  2GBY A;  3JAM Z;  1DUX C;  1B59 A;  3OYE A;  1SD6 A;  2LOO A;  1WQ2 A;  3LAJ A;  4B3A A;  3CCM I;  2ADU A;  2H1K A;  2DA2 A;  5CVJ A;  2VPR A;  3CJR B;  1B4A A;  4A6D A;  3TDZ C;  3ZQF A;  1FMV A;  3VFZ A;  5JLX A;  3KZI C;  2LBF A;  1LQ1 A;  4BDY A;  4H4K C;  3GUD A;  1TWA J;  3RCO A;  1C0W A;  5EJC A;  5A2Q Z;  2XGC A;  3T5X A;  2P81 A;  3MZY A;  2BY2 A;  1T33 A;  2XSJ C;  4IF4 A;  4HV6 A;  3SQN A;  3KZY A;  1ZR2 A;  1A35 A;  2EFP A;  4MO7 A;  1BI1 A;  4II3 A;  3DU6 A;  1I39 A;  2L4A A;  4PK4 A;  4CH7 A;  4E7I A;  2ZC2 A;  2XB0 X;  3KP3 A;  3M8J A;  4C30 A;  2F4O B;  2EA4 A;  1X1D A;  4MQV A;  1HXD A;  2O6G E;  1IUY A;  1IRF A;  2H1L A;  4G6Q A;  2J5P A;  1NK2 P;  4BU2 A;  4OIO F;  1P9Q C;  1FYK A;  3WE2 A;  3FIW A;  3OYD A;  4IQ4 A;  4E7H A;  1KU2 A;  2FQ4 A;  2YU3 A;  3LSR A;  2F5E A;  1SFU A;  4BBS J;  2GXG A;  3AG2 H;  1X3W B;  1YG2 A;  4NQW A;  2QF7 A;  1TP4 A;  3FK7 A;  4A2U A;  3CP8 A;  5C3E J;  2LVS A;  1DQU A;  4ENN A;  3KET A;  1FBS A;  4MHG A;  3A02 A;  3IH3 A;  3HKZ A;  2PMZ A;  5IOZ A;  5LBQ A;  2EK5 A;  2BE5 F;  1A36 A;  2DDB A;  2IAI A;  2MFZ A;  5E1Z B;  2M87 A;  2M2E A;  2VJ4 A;  3L2W A;  2BY3 A;  3ZP5 A;  5BNG A;  5FKO A;  5M3M J;  2FML A;  3L9F A;  4AYB A;  5DTD A;  2IT0 A;  2DAO A;  2FBK A;  5D5U B;  3R0A A;  1TNT A;  4KUM A;  2GM4 A;  3N97 A;  2VJ5 A;  5LGN A;  3S1Q J;  1ERD A;  5FD5 A;  3M7G A;  4PJN A;  5DM7 F;  1NG7 A;  1IRX A;  1BBY A;  3B02 A;  2CWE A;  1ZGW A;  2QWW A;  4KYW A;  3BJ6 A;  1B8I A;  3TMO A;  2JRM A;  1D3Y A;  2NVQ J;  2IBD A;  3BR2 A;  1FOX A;  4S0H B;  1WJA A;  2KIM A;  4Z6Y A;  3MZH A;  1BL0 A;  3T0Y A;  1TC3 C;  1EV7 A;  1VQ9 I;  3DEW A;  1FTT A;  3BG5 A;  3TO9 A;  4UUS B;  2AQF A;  4YRV A;  3VOD A;  3VOE A;  3D5R C;  5F64 A;  3BTC A;  2VJI A;  1V5G A;  2JWT A;  1XD7 A;  3CZ6 A;  2P0W A;  4QWQ A;  4HQE A;  3WU2 C;  1W7P B;  1KYW A;  4RB2 C;  1O3Q A;  2OQG A;  1R49 A;  4U7D A;  2FMY A;  3EPZ A;  4HYE A;  4B8X A;  1KGS A;  2VLA A;  4KDP A;  3PUF A;  3V4G A;  3F6V A;  2R7S A;  1U9O A;  3S1N J;  3EUK L;  1U9N A;  4ANJ A;  2JVG A;  3P9C A;  1KZH A;  1ACI A;  2V1D A;  1IDZ A;  2Y2Z A;  4D0P A;  3E0J B;  2IA0 A;  3RQI A;  4WWC A;  3I5U A;  2HYF A;  2EA2 A;  3LSH A;  1SVO A;  2Y9Z A;  1YYV A;  4S05 A;  4UUV A;  5F1R A;  1VZ0 A;  3FXM A;  2MD5 A;  1YX5 A;  2QBY A;  3KFW X;  1QPI A;  1FIA A;  4M74 A;  1Z0X A;  2ZBK A;  2K4B A;  5JI6 A;  2FU4 A;  3FHN A;  4AM3 A;  4EQQ A;  1D1C A;  3FXR A;  2L9V A;  1KQ0 A;  5D6F A;  2FBH A;  2OCC H;  3JCU C;  1ZH5 A;  3OL3 A;  1P7I A;  4XOP A;  4KIS A;  2UV1 A;  3OYM A;  2D5V A;  3IL2 A;  2STT A;  3L2Q A;  3ZRG A;  3G4S I;  5BPI A;  2H27 A;  3VWB A;  4LG0 A;  1NHA A;  1FPQ A;  3NEU A;  4RA2 A;  2ID6 A;  2BVM A;  2R5Y A;  2K40 A;  3KEY A;  4AWX B;  3AG4 H;  5HLH A;  4A3K J;  2IVM A;  1RIO H;  2A6T A;  2QEN A;  2VQC A;  2DT7 B;  3JRI A;  2O61 A;  4ESJ A;  1CF7 B;  2XRL A;  4CYD A;  2ZO4 A;  4GRI A;  2VPL A;  5EG0 A;  1ZLJ A;  5JFR A;  4ZH4 F;  2XPV A;  3HOU J;  4D5F A;  3J81 K;  1OYY A;  1T56 A;  4ESF A;  5HDK A;  2D1H A;  3VYU B;  4HNU A;  1HKS A;  4RGR A;  4Q48 A;  4EAT A;  4E7K A;  4Y17 A;  1VQO I;  1DDN A;  4LIT A;  4L9V A;  2R93 J;  1TLH B;  4O3M A;  2O8K A;  4GDF A;  2K4J A;  1R1V A;  3H5A A;  3HIF A;  2NAZ A;  3GZN B;  1RR8 C;  4L18 B;  1S72 I;  2F48 A;  4BXF A;  1KQ8 A;  1EKE A;  3HOV J;  3BPV A;  4PJM A;  2PN6 A;  3CCV I;  2FUG 2;  2A3S A;  3O2P E;  1SEU A;  3QYB A;  1ZRF A;  1LPQ A;  3I4M J;  1V54 H;  2PBI A;  2VON A;  4XOT A;  4XLE A;  1P4A A;  4OIQ F;  1QZY A;  2VUM J;  3F0C A;  3K9T A;  2QUF A;  5GP9 A;  4XRM A;  3ABK H;  3SDB A;  4F93 B;  1YS7 A;  2R7O A;  4IVN A;  4XL9 A;  5IT9 Z;  1IN4 A;  2CW7 A;  3DKX A;  2R7T A;  3IWF A;  4Y4R A;  1HDD C;  4RB0 A;  2WA0 A;  1ETV A;  4MEY F;  3F8N A;  2R7U A;  4U87 A;  3K4L A;  3X2Q H;  3CCS I;  3PNY A;  1GDT A;  1Z3Y A;  1WWX A;  4V2G A;  1P92 A;  4CO8 A;  3ULQ B;  1O3R A;  2DU9 A;  4NC6 A;  1IN6 A;  1SFO J;  3HSR A;  3CCY A;  1H89 C;  2CYY A;  1OCC H;  3OYK A;  1UAA A;  1E2X A;  3TQN A;  2XAH A;  2RC4 A;  3DCF A;  2B7E A;  1UHW A;  5FLM J;  5M5Y J;  1FT9 A;  1T0F A;  5B3S H;  2WWY A;  4ABZ A;  3TW7 A;  4G12 A;  3PO2 J;  2HOE A;  2Z9O A;  1IG7 A;  2CV2 A;  2LRD A;  2JPB A;  1TQP A;  3OIO A;  3OR1 C;  3CQZ J;  2H94 A;  4M3F A;  1SAN A;  1YFH A;  1RUO A;  3MQ0 A;  5IYB J;  5EEG A;  2LDU A;  1FMW A;  4E7J A;  1VQL I;  4DBR A;  2W7N A;  4A12 A;  1RR7 A;  1JKR C;  3H3V K;  3LFK A;  5DM6 F;  1IRZ A;  3E6C C;  3U21 A;  4A3B J;  2VKH A;  2V6E A;  1Z7L A;  4EJO A;  4UY8 I;  4J01 A;  1N78 A;  4DYR A;  2UUZ A;  3GZ6 A;  1TTY A;  1XMK A;  1UZC A;  3M9A A;  4MFE A;  3S8P A;  2ESN A;  2OAZ A;  1MBE A;  2QKM B;  2VC0 A;  4BE2 A;  3OYG A;  2DI3 A;  3K10 A;  1IF1 A;  4FQG A;  1J5Y A;  1YOV B;  2ME0 A;  2ZKZ A;  4PFO A;  4BJT A;  4FAS D;  4UUS A;  4B43 A;  3OYF A;  3LMM A;  4A0X A;  1K78 B;  3FXO A;  1A5J A;  3R6S A;  5D5W B;  1OCP A;  2HZD A;  4CZC A;  5GTI C;  4M9X A;  4XMY A;  5JHU A;  4DBQ A;  1UHS A;  1HW5 A;  3AG1 H;  2WC2 A;  3GBG A;  1B1B A;  3RKQ A;  4IL6 C;  3S17 J;  1ZG5 A;  1FC3 A;  2ME6 A;  3OYC A;  2CQK A;  2A69 F;  2O7O A;  1LJ9 A;  4EJT A;  3EUH C;  3C7J A;  2NYX A;  3GYH X;  1L0O C;  3BG7 A;  4RM3 A;  2J5O A;  2ZFW A;  1ETW A;  3LSK A;  2Y48 A;  5FRN A;  1AA7 A;  4V2F A;  2K7L A;  3PIP F;  1X1B A;  5EF6 A;  2F5D A;  2NVU B;  2W4S A;  1X3U A;  2EIK H;  3A0H C;  1D1B A;  1PUE E;  4GFB A;  2H6B A;  2Y0S N;  2MG4 A;  2OA4 A;  1H9G A;  2YU9 J;  2NNN A;  2FD5 A;  3CMM A;  4UVB A;  1U5T B;  3I4P A;  3AAF A;  1VQ8 I;  2QQB A;  3DEE A;  1G3S A;  2VC1 A;  1WZ2 A;  3HEF A;  4DJA A;  4L0Y B;  2VKV A;  3F22 A;  5E3N A;  4OAZ A;  2DMN A;  4GGG A;  4F55 A;  5IP9 J;  4HZF A;  3HGG A;  3EYY A;  4X6A J;  4WX9 A;  3WE3 A;  2HKO A;  3C2G A;  2OU2 A;  1F5T A;  5CKT A;  5L3E A;  4BXX J;  4JX5 A;  3HGY A;  1RKW A;  5GAG J;  1FBQ A;  1OR7 A;  1RC9 A;  2CUJ A;  4HDV A;  3FF5 A;  5EYR A;  3CUQ B;  4G7H F;  3HTU A;  5FKM A;  3JSP A;  3V8L A;  4LLN A;  1SVL A;  1FYM A;  2CV1 A;  1Z6T A;  4OAY A;  2CO5 A;  1F9N A;  4M3G A;  3OYJ A;  3K69 A;  2DA5 A;  1YW8 A;  1CF7 A;  3BPX A;  1BC7 C;  4R8H A;  1UJ8 A;  2VKD A;  1S6L A;  4G94 A;  1BI2 A;  2MAB A;  4UV8 A;  5J1R A;  2RAE A;  4ZJZ A;  4RBO A;  1R5I D;  3FM5 A;  3BDD A;  1MNM C;  4RLF A;  3BR5 A;  3W6K B;  4CCN A;  1XMA A;  1SAU A;  4MFD A;  3FZV A;  2LD5 A;  2XV4 S;  2STW A;  4KIC A;  5LEK A;  2KPM A;  4MLO A;  2EJR A;  4C2U A;  1BOB A;  2HOA A;  1FY7 A;  4HF2 A;  2GIV A;  3FHZ A;  1PUF B;  2HDD A;  1YO5 C;  2G9W A;  3OSF A;  5HOO A;  1R1T A;  3CMA I;  2CQQ A;  3VEP A;  3MKW B;  2FBI A;  3E6B A;  4UXN A;  4I0B A;  2X6Y A;  3WOD F;  1SD4 A;  2EV5 A;  2M7B A;  4V19 K;  3PQJ A;  5ILS A;  3T8T A;  1K79 A;  3MKY B;  1Z77 A;  1XGM A;  1RZ4 A;  2E1N A;  3R0J A;  3ZQL A;  1FWZ A;  6PAX A;  2IGO A;  4D1Q A;  1DU0 A;  2TRT A;  3DP7 A;  2OBP A;  4IPA A;  3S1M J;  3QPH A;  1J09 A;  1R23 A;  3DTE A;  2ZJR F;  4N4O B;  3IKT A;  4AID A;  3CO7 C;  1X1A A;  3WGH A;  1HQC A;  2ZNZ A;  4E70 A;  2QSF X;  1KU3 A;  1R22 A;  1FBU A;  1OJL A;  5TGT A;  2QLZ A;  1VFC A;  1SMY F;  1MH4 A;  1AOY A;  2MA3 A;  4AC0 A;  2P8T A;  3E6M A;  3IHU A;  1RES A;  3RI4 A;  1ONV A;  1G3T A;  1CGP A;  4AIH A;  3CCJ I;  3PIO F;  2AXT C;  1DP3 A;  3H5N A;  2E34 A;  1XCV A;  3K6G A;  4C3H J;  4LG3 A;  2HPM A;  1Z9C A;  1R5H A;  2L7F P;  2KIQ A;  3AFH A;  1ENH A;  2HXI A;  4M3B A;  2M0C A;  3IH4 A;  4KIF A;  1YW7 A;  3ONQ A;  2COM A;  3HPG A;  4LLL A;  3IAM 2;  3O8H A;  1JHH A;  2WB1 N;  2RDP A;  3J80 Z;  3OMY A;  1RET A;  2EIJ H;  1KQ9 A;  3FIS A;  1Z91 A;  3MZ8 A;  4R79 A;  3C18 A;  1GUU A;  2JA2 A;  2JVH A;  4FIS A;  2X0L A;  5DV5 A;  2DOE A;  3QU6 A;  2LKP A;  4BL0 B;  4L5J A;  3OYA A;  1GLN A;  2EZL A;  3Q0W A;  2HPI A;  1ETQ A;  3SZP A;  3S3M A;  4KT6 A;  2FE3 A;  4PJJ A;  1WH5 A;  2H09 A;  3JTG A;  3DTI A;  2HQR A;  5KAI C;  1GHC A;  3BWG A;  2IS2 A;  4WXC A;  5F27 A;  2R0Q C;  3SEQ A;  4KIG A;  4E4H A;  4DW6 A;  2VL8 A;  1W1W E;  4I7H A;  2QCO A;  2NS7 A;  3GO5 A;  3LSI A;  2DCE A;  5GTH C;  1LE8 B;  2PLY A;  2EFO A;  4L5E A;  2AXL A;  4J19 A;  2DMP A;  3L2C A;  1ZRE A;  2FRH A;  3VDX A;  4EM1 A;  1D0X A;  1REP C;  3OYI A;  1X3Z B;  1W5C C;  2RRE A;  3OYN A;  4P9F A;  4WXH A;  2GQQ A;  4BGD A;  3H9G A;  2VXZ A;  2X51 A;  3B6C A;  2DYS H;  3CJN A;  1YE9 A;  3OYH A;  5K1Y A;  3VSK A;  2E35 A;  1WVR A;  5FB2 A;  1MJ9 A;  1ON2 A;  1JKP C;  5LHI A;  3L2U A;  1UG2 A;  2IGK A;  2DK5 A;  2V1N A;  1GVJ A;  3HUG B;  2VOD A;  5KVR A;  5DEQ A;  2BXZ A;  1XX5 A;  1ZAO A;  2DN0 A;  3WTW C;  3JRA A;  1SC7 A;  4BBR J;  2CUF A;  3L00 A;  3VYT B;  2EFQ A;  2ACJ A;  3GTG J;  3HRT A;  2OPT A;  2V26 A;  1SD7 A;  3WTY C;  2FJ1 A;  1N77 A;  1HDP A;  2FA5 A;  4X0G A;  2R7W A;  3JTH A;  4BNC A;  2VB6 A;  3FMQ A;  3QYE A;  3PNV A;  1W36 C;  1J0R A;  2VQH A;  2ICW G;  2EZI A;  2A5Y B;  1WI3 A;  1AWC A;  3E1S A;  2DFH A;  4IHX A;  2O0Y A;  3VSL A;  1QRY A;  4LLG F;  3JRG A;  3CUQ A;  2KT0 A;  3W6V A;  1H88 C;  4BHP A;  2Y0S A;  3FXK A;  1UHM A;  1MSF C;  2JZY A;  1D0Y A;  5HLG A;  2B9S A;  1LVK A;  2ESH A;  1APL C;  5GPA A;  2KRF A;  3K1P A;  5KNL A;  1T8I A;  3QQA A;  5L3C A;  2PG4 A;  3BR1 A;  3LQR A;  2EV0 A;  1Y1V J;  1Z3X A;  2QEX I;  4XLP F;  3CC4 I;  4WF2 A;  3ROU A;  3EDP A;  3CD6 I;  2V1U A;  4AVP A;  3JW4 A;  3OV8 A;  2GIZ A;  2NXN B;  5J4Y A;  4ZDO A;  2LY1 A;  2MH2 A;  2R7F A;  2WAE A;  2XPW A;  3K4K A;  3PFY A;  4QSH A;  2BBY A;  4OMY A;  3HZJ A;  2Q2E B;  1F1Z A;  3C3W A;  1FX7 A;  4IOA F;  3TDU C;  2HWV A;  1H9T A;  4EGZ A;  1TQM A;  4N9I A;  3I58 A;  5LD2 C;  4RB3 C;  4H0E A;  3RZD J;  3S16 J;  2HQ5 A;  1QHG A;  3Q9V A;  1AHD P;  3ZQC A;  2CUZ A;  3BZC A;  3ZQQ A;  5DYM A;  4FX4 A;  3DPL C;  2DYR H;  3MWM A;  2XKO A;  2HDW A;  1U3E M;  2KQR A;  2OF7 A;  4FTH A;  3BG9 A;  3VB2 A;  1DPR A;  1ZEL A;  2JSP A;  2O03 A;  4XLA A;  3DBL B;  1W36 D;  3COA C;  2P5L C;  1OCO H;  3QYF A;  2PMH A;  3JR9 A;  2L7M P;  5HS9 A;  2R7V A;  4I0A A;  3WTZ A;  1ZQ3 P;  1M1E B;  4YII A;  1V5E A;  3HOY J;  4L0Z B;  1DGW Y;  4HA8 A;  1R6R A;  4W1U A;  5ILU A;  2JMW A;  4DOZ A;  5KK1 A;  4YEL A;  2X6O A;  3PO3 J;  5D4R A;  3M3Y J;  3KP5 A;  1OPC A;  1IGN A;  4U7B A;  3CO6 C;  1D8K A;  4QTR A;  2L0K A;  4NC8 A;  1JUM A;  2FEZ A;  3F9K A;  1DP7 P;  4ZZD A;  2XAS A;  5FLX Z;  4IOC F;  3TOA A;  2HR3 A;  1MIJ A;  5H6Q A;  4ZYH A;  1BC8 C;  5C4X J;  4R1H A;  3K70 C;  4KA4 A;  1B72 B;  4F7Z A;  1BW6 A;  2IGM A;  2K27 A;  2WY8 Q;  3F8B A;  3MD2 A;  4XQF A;  4OIR F;  1FSE A;  1JUP A;  2VE9 A;  1F43 A;  4Q5S F;  4XN0 A;  1TBX A;  2GOX B;  2V9K A;  3KYC B;  2OD5 A;  1MMD A;  1VI0 A;  2DA1 A;  2E5Z A;  3CCQ I;  4WK8 F;  3A0B C;  5BPD A;  3CC2 I;  4O5V A;  2JUC A;  2LP0 A;  1XCB A;  1W4M A;  3P7N A;  3OOU A;  2H8W A;  3I3L A;  3U1K A;  3QU3 A;  4A6E A;  2BVL A;  3W3C A;  3A03 A;  2B63 J;  1BI3 A;  3VYS B;  2FSW A;  3JRE A;  1Y8R B;  2KIU A;  4AIK A;  1RKT A;  2X6X A;  5F08 A;  4PGH A;  1QZE A;  2ZME B;  1OCT C;  1BI0 A;  2KP6 A;  5E3M A;  1G2H A;  5M3F J;  1RI7 A;  2K5C A;  4C2M J;  2ZFU A;  1ETK A;  2DT6 A;  1TWF J;  2ISY A;  2D45 A;  3A2K A;  2DO7 A;  1G59 A;  3U1D A;  2A6H F;  2AS5 F;  3WHB A;  2HEO A;  2NS0 A;  3FKJ A;  3WG7 H;  3DFG A;  2K02 A;  2DW4 A;  2VBW A;  2OC6 A;  2DOD A;  2W1O A;  3TP0 A;  1Z05 A;  1D8J A;  1MBK A;  3K70 D;  4YG2 F;  3LSJ A;  2ZSH B;  4ITV A;  2R7Z J;  1OYW A;  5J47 A;  2QA4 I;  3ZCO A;  1E3O C;  2OTJ I;  1EH6 A;  2W00 A;  3I59 A;  1DU6 A;  3QOE A;  1Y56 A;  2CU7 A;  4JQF A;  1T0F C;  2PMU A;  3MAJ A;  4HST A;  3H0G J;  3FXL A;  1MMN A;  3CF5 F;  2F6C A;  3SZT A;  1UB9 A;  1FYL A;  4F92 B;  3C1D A;  1WFX A;  3WGI A;  5FLV A;  2XB5 A;  2H8R A;  3CMY A;  5B1A H;  3HL2 A;  2LKX A;  4HQM A;  1MDM B;  1BIB A;  2OV7 A;  1G8X A;  1X58 A;  5K7H A;  3HXL A;  1I6H J;  2K9L A;  4RDU A;  2RKH A;  2XAQ A;  5TIS C;  2EB7 A;  3HG9 A;  4JOM A;  1E3H A;  2ZJ2 A;  3I53 A;  1WSU A;  1HC8 A;  4PCQ A;  5D6E A;  2C6Y A;  4UNO A;  3ERE D;  1R36 A;  2HU9 A;  2R7Q A;  1JJ8 C;  4CGZ A;  2Y30 A;  4LD5 A;  3BQY A;  1OCR H;  2R7R A;  5L3F A;  2LC2 A;  3HPH A;  5FRO A;  4P96 A;  1GV5 A;  1IV6 A;  4GYG A;  1R5G A;  1LDJ A;  1OYI A;  4CUG A;  4F91 B;  2YR2 A;  2LY9 A;  2Q1Z B;  1YS6 A;  2E36 A;  2HS5 A;  2TDX A;  3ZQ7 A;  2IA1 A;  5DCM B;  3HRS A;  3SEZ A;  2XDV A;  3LSG A;  1KU9 A;  2IGN A;  3DF8 A;  2KIS A;  3HC7 A;  1RNL A;  2XHK A;  3DU5 A;  1OQY A;  5IP7 J;  3MEX A;  3AKZ A;  1EH8 A;  5FKK A;  2P5V A;  3RIR A;  4HAM A;  3CDI A;  3KP4 A;  2VBZ A;  1ZRC A;  1XS9 A;  4IO9 F;  4HX8 A;  4HPQ A;  1BIA A;  2V9P A;  1D5V A;  5IPA A;  1A31 A;  3ZN1 A;  3BOQ A;  3CLQ A;  2YX4 A;  3LQQ A;  3RPU A;  2QYO A;  4BAC A;  4MQ9 F;  3HSE A;  3ZN0 A;  1XC5 A;  1K83 J;  4OOI A;  3CDL A;  3RSN A;  3R61 A;  1BR4 A;  2AHQ A;  2ZXJ A;  4A3E J;  1UMQ A;  2QZ8 A;  3ZMV A;  2LTP A;  2JSC A;  2XKP A;  3LA3 A;  1EF4 A;  3BTJ A;  1TQI A;  3D5L A;  3NAR A;  3M1C A;  5IYC J;  2DT5 A;  1OR7 C;  1WH7 A;  1Y8Q B;  1P2F A;  3S2D J;  1YW9 A;  1VND A;  2CH0 A;  2XF7 A;  1JHF A;  3WTT C;  5JVT A;  3G1L A;  3A01 B;  1P7J A;  1ZKG A;  1W7P D;  2A68 F;  2P4W A;  4ZTF A;  5E3L A;  1I6X A;  4PFP A;  4CCL A;  3TP3 A;  2KKO A;  4BHB A;  2M0M A;  1O7L A;  2DFI A;  1T6S A;  5CVR A;  3ZMD A;  1BR2 A;  4XSX F;  1AKH B;  1JTX A;  2K9N A;  4BH9 A;  4B48 A;  3OOP A;  4XSZ F;  4XRS A;  2VOO A;  2KJC A;  1T2K A;  3DBH B;  1VQ4 I;  5E3O A;  2ZNY A;  1HW2 A;  1P6R A;  4XM3 A;  5E8G A;  1KON A;  1BN5 A;  2MC3 A;  4MEX F;  5ED4 A;  4LIV A;  4BAY A;  4A69 C;  1AU7 A;  4JK1 X;  1J9I A;  4XKB A;  1IW7 F;  2UZK A;  4EJV A;  2DLL A;  1JKO C;  2BY0 A;  4MNU A;  1ITY A;  3DQV C;  3I64 A;  5GPC A;  1TNS A;  2V4J C;  4XN3 A;  1K6Y A;  2PJP A;  1LUJ B;  3NAU A;  3BC8 A;  5DDG A;  2ZME A;  1STZ A;  2CFX A;  2XSD C;  2KZG A;  1O4X A;  4XRS G;  3P9K A;  2VE8 A;  1IV8 A;  4XLC A;  1WGX A;  3BR3 A;  4C3I J;  5B66 C;  1XSD A;  3W2A A;  1KYZ A;  3I4N J;  1J59 A;  1J2X A;  4IRH A;  2R7X A;  1RRJ A;  1I50 J;  2CQX A;  4HX4 A;  5DCF A;  4EJU A;  1MND A;  3F8F A;  2BXY A;  5K5R A;  5L3B A;  1XGO A;  4I98 B;  3RPQ A;  1HLV A;  4IHY A;  4IXA A;  1IN8 A;  1G6N A;  1T38 A;  1RUN A;  1WI9 A;  3ISP A;  2GA1 A;  1QA6 A;  3GW2 A;  1ETO A;  4LGW A;  5IYD J;  1QQI A;  3C2B A;  1WRJ A;  5F1J A;  4CYC B;  2BGC A;  3ZQG A;  2YS9 A;  2EWN A;  3V7S A;  3DWL E;  1UG0 A;  4IRI A;  3BQZ A;  2VBX A;  2L7K A;  3K2A A;  3PQK A;  1Y39 A;  1W7P A;  4BQN A;  1YRN B;  2WAQ N;  2MH9 A;  2QQ8 A;  3NRV A;  5E20 A;  4RAZ A;  2N8G A;  5C44 J;  1IN5 A;  1JE8 A;  1Q1H A;  1YJ9 I;  1P4X A;  2DPD A;  5B5E C;  1V4R A;  3OIQ A;  3LL7 A;  1H0M A;  1IJW C;  4W97 A;  1MDM A;  2DMQ A;  1TZL A;  5J3L A;  1MBF A;  2L01 A;  3G6E I;  5E79 C;  3W2W A;  3FBN B;  5E8I A;  4OWR B;  2L9R A;  1VQK I;  4XKW A;  3E5Q A;  4PDK A;  1XDU A;  2B0L A;  2VKE A;  2LR8 A;  4M3E A;  1JKQ C;  2G0E A;  4KIB A;  2XAJ A;  3NWT A;  3CC7 I;  3F8C A;  3MMY B;  3DKY A;  5H6R A;  4CCK A;  4NHJ A;  3R60 A;  2FOK A;  1NK3 P;  1ODD A;  1XN7 A;  1K4S A;  2DA7 A;  2IP2 A;  1PDN C;  2COB A;  1MMS A;  3GXO A;  3P9I A;  2M7A A;  3HDD A;  2X1D A;  1UCR A;  2ZCW A;  2BHZ A;  1PYV A;  4E6K G;  1FSH A;  1T39 A;  2UXN A;  4RMN A;  4EJW A;  1FTZ A;  2FF4 A;  2RV8 A;  1T08 B;  2NVY J;  3M07 A;  4Y7N J;  4CSW A;  1X4O A;  2KZV A;  2NVX J;  4M73 A;  4IHT A;  4P9U A;  2RNJ A;  3GTK J;  3E97 A;  1ETY A;  4M71 A;  3ZXS A;  3ERM A;  2VBY A;  4I2O A;  5L3G A;  2CFO A;  3HHH A;  3OYB A;  3FK6 A;  1YX3 A;  3EQL F;  3OSG A;  5HDG A;  2R7D A;  1T95 A;  1I3A A;  3O6B B;  1XGS A;  2DJN A;  2YUS A;  2VI6 A;  3H1C A;  4FX0 A;  1XPX A;  4BQA A;  5GAD J;  4CHU A;  3DBR B;  3OR2 C;  2Z33 A;  3MKZ A;  1QGP A;  2DQR A;  1A6Q A;  4Y3O A;  1U5T C;  2JTV A;  3QOP A;  3AL0 B;  2X9D A;  2Y75 A;  5CQG A;  3J81 Z;  3JAM K;  4P1W A;  3V8J A;  3NWS A;  4GYI A;  4ZZL A;  4IEJ A;  4IJA A;  1BJA A;  2KRC A;  1LDD A;  3K4J A;  1VQM I;  1L3L A;  2CQN A;  2RQQ A;  3V8K A;  3ECO A;  1ON1 A;  1ZR4 A;  1EJ9 A;  5B1B H;  5BOX A;  1ZLK A;  4XID A;  3CCU I;  4CIC A;  4OMZ A;  1F36 A;  5DUK A;  1H8A C;  1OIS A;  5BQT A;  2QVO A;  3CUQ C;  1Z1D A;  1XDS A;  4B47 A;  1YIO A;  3JRC A;  2GOM A;  2BOL A;  3I9V 2;  4A5N A;  2NRA C;  4RGS A;  4MTE A;  4YFN F;  4KT5 C;  3IH2 A;  1X1C A;  5A2Q K;  4D5C A;  1I5Z A;  5DUI A;  4LJZ F;  1K4T A;  5J1Y A;  4UB8 C;  3KE2 A;  3FWE A;  5F04 A;  4D7M A;  3LA7 A;  3DPT A;  2LBF B;  2FOW A;  4N9H A;  2Y0M A;  3A1Y A;  4EV0 A;  1A6I A;  1GXP A;  3QWL A;  5L3D A;  4L5I A;  4HNV A;  1TL8 A;  5LHH A;  1E3P A;  2E19 A;  4KIT B;  3TOB A;  2RGV A;  3ZMU A;  3U2R A;  1P4W A;  1WJF A;  4IHS A;  3SFZ A;  5CVV A;  2BW3 B;  3CCR I;  4LB5 A;  1QHH D;  3HKZ N;  3QOD A;  4EM0 B;  4RGU A;  2PMZ N;  4UHT A;  4FCY A;  1I1S A;  3PSI A;  2MW8 A;  2W84 A;  4OU0 A;  5GAH J;  4HLY A;  2F4I A;  2WAF A;  2LMD A;  3K2Z A;  3KCC A;  2XGX A;  3ESW B;  3BZ6 A;  5JLW A;  3HJE A;  3MKL A;  3DXJ F;  1ZHF A;  1XG1 A;  2QKL B;  2P7C B;  1T98 A;  4U88 A;  1Y6I A;  2X1C A;  3ZGK A;  4AYB N;  1YIT I;  2WV1 A;  1JUS A;  2M8G X;  2HTJ A;  1D1A A;  4BE1 A;  4XBF A;  3HOW J;  3TGN A;  5F6F A;  4NQW B;  3FM3 A;  2IS1 A;  3N4M A;  1JT6 A;  2D2W A;  1K61 A;  3HYI A;  1ETX A;  2HYJ A;  3BTL A;  4DYC A;  2K3P A;  5DD8 A;  3K4M A;  2UWM A;  2MGQ A;  3I56 I;  1VQ6 I;  5CPR B;  3I55 I;  3UNG C;  2JA8 J;  3PNT A;  1ZRD A;  4F3Q A;  3L2V A;  1MJA A;  4HDU A;  3WGG A;  4XKV A;  1XSV A;  2MBF A;  4B44 A;  1K78 A;  2W48 A;  4CYC A;  2M4K A;  5H2F C;  3F23 A;  1S5L C;  5D5X B;  4BXU A;  2IW5 A;  2PFB A;  3CES A;  3QPL A;  2ELK A;  2HOS A;  3MFK A; 
#chains in the Genus database with same CATH homology
 4IRG A;  3ZPL A;  3GF2 A;  2EV6 A;  1IN7 A;  1DPU A;  3WU0 A;  1ZGA A;  1ZN2 A;  2G7U A;  5ICC A;  1QBJ A;  2E7X A;  3CUO A;  3L7W A;  1QZZ A;  2P6T A;  1R7J A;  1U5T A;  4G7O F;  2M5W A;  2HYG D;  4UV9 A;  4U0Y A;  2OZ6 A;  5H20 A;  3ECH A;  5LEJ A;  1SFE A;  1SMT A;  2BV6 A;  2LSO A;  3WTS C;  5CVU A;  3F3X A;  3WTX C;  1TW3 A;  3E5U A;  4UVC A;  5AON A;  3IWZ A;  2BEO A;  2V1X A;  4UVA A;  4EVI A;  2QQA A;  1O3S A;  1U78 A;  3GVA A;  5EEH A;  2QBY B;  2FQ3 A;  3RYP A;  2O8X A;  2XIG A;  4N0B A;  2CSO A;  1FP1 D;  1IXR C;  5D8L B;  3DKW A;  1IXS B;  1JXS A;  5E18 F;  4LG0 B;  4I02 A;  4Q4Z F;  3IC7 A;  4BYY A;  2K86 A;  4YIF A;  2UXX A;  1WKM A;  5FGM A;  3TO6 A;  4GXO A;  1FP2 A;  4ZYG A;  1ZG1 A;  1UST A;  4HBL A;  3PFI A;  4KMF A;  2XVC A;  2YX7 A;  3G3Z A;  2MLK A;  3GFM A;  3EET A;  3SHF A;  3V7C A;  1O7F A;  2ISZ A;  3WTV C;  4Q47 A;  2WTE A;  2Z5U A;  3K1N A;  4A0Z A;  4EMS A;  3BRO A;  1G3Y A;  1HSJ A;  5ERI A;  5LRR A;  1I27 A;  5IT9 K;  1MZB A;  1A04 A;  3BJA A;  4LFU A;  3E3V A;  1FZP B;  5CYV A;  5AIQ A;  2V79 A;  2HDC A;  4PGG A;  3ABT A;  4KN7 X;  4ENJ A;  1W5T A;  3GWZ A;  1I1G A;  2RQP A;  3KLN A;  1ULY A;  4I01 A;  2GXB A;  5FD6 A;  5E1W A;  3SXY A;  1USS A;  3BP8 A;  3GEZ A;  2M30 A;  4ASN A;  1KA8 A;  2W57 A;  2DK8 A;  4A5M A;  2CGP A;  2QM3 A;  4ENM A;  3ELK A;  2L4M A;  2IRF G;  3HOS A;  2JT1 A;  1MGT A;  3ZMS A;  3FMR A;  1UFM A;  2D1V A;  1S7A A;  2F2E A;  2O3F A;  4ON0 A;  2W25 A;  2X4H A;  2HTS A;  3REO A;  3KP7 A;  5DD4 A;  5ILV A;  1FOK A;  3RYR A;  3E5X A;  3HTS B;  3HUG A;  3NQO A;  4Z2Y A;  3HOT A;  3V7R A;  5K5Q A;  2P5K A;  1IRG A;  5J8F A;  3CLO A;  2YSR A;  4RGX A;  5FFX A;  3I54 A;  5CVI A;  3RKW A;  3KLO A;  3Q5F A;  4PZJ A;  4RAY A;  4G8X A;  2P7V B;  3FX3 A;  4TV7 A;  1G3W A;  4ESB A;  5JR3 A;  1OMI A;  3IKV A;  2M1B A;  5E17 F;  1S8N A;  2Q2E A;  1SAX A;  4HX7 A;  2VOP A;  5FO5 A;  2NNY A;  3WTU C;  3LAP A;  2LF8 A;  3K1M A;  2V6C A;  2VT3 A;  4WCG A;  1HBX G;  2XRO A;  3FXQ A;  2VT2 A;  3G73 A;  1LNW A;  4KMU X;  3T1B A;  3LWF A;  1SD5 A;  1ZYR F;  2A07 F;  4KNY A;  4HLX A;  4AIJ A;  2P6S A;  4BHC A;  1W5S A;  4KFC A;  1IZ1 A;  4P5O A;  3H3U A;  2W24 A;  5LGT A;  5TRD A;  1U2W A;  1OKR A;  3KEQ A;  5CLS A;  5LLQ A;  1PP7 U;  4CXF A;  1J75 A;  2ETH A;  1HKQ A;  2VN2 A;  4P55 A;  5D8K B;  3GFJ A;  4HOB A;  2Q8K A;  2Q0O A;  1S29 A;  3RKX A;  1ZAR A;  4M72 A;  2RVC A;  3ML6 A;  1HW1 A;  3H3Z A;  3GZ5 A;  1R00 A;  2HGC A;  5LRS A;  5ICG A;  3DV8 A;  4U0V A;  4HW0 A;  4QLC U;  4G7Z F;  3KP6 A;  3JSO A;  1J7K A;  4GO1 A;  4EM2 A;  4FT8 A;  1MKM A;  3TKY A;  1BM9 A;  4OIP F;  1QPM A;  1XB4 A;  2QQ9 A;  4LK1 F;  3D0S A;  4HV5 A;  1F4K A;  3ZMZ A;  2HKX A;  3J80 K;  4JBA A;  2F5F A;  3QRF F;  4L9N A;  4AD9 A;  2WV0 A;  4M6X A;  2L02 A;  1S7O A;  1G4D A;  3T8R A;  4CZZ A;  2PI0 A;  3O3K A;  2BYV E;  4Y13 A;  2EFN A;  4G6D A;  1XGN A;  4LK0 F;  3QPT A;  4ENK A;  2LNB A;  2F5C A;  3QP6 A;  3TO7 A;  2IA2 A;  4XLN F;  1B9M A;  1VTN C;  4O6J A;  2CW0 F;  2GA2 A;  3M1E A;  4XRF A;  5K5O A;  3MCZ A;  3FMS A;  2ELH A;  2Z99 A;  2Z3Y A;  4NB5 A;  1BOA A;  1O3T A;  4RB1 A;  5D5V B;  1B9N A;  3KP2 A;  1PP8 F;  5IT3 A;  3R4K A;  1O57 A;  4YFK F;  2A6E F;  4K2E A;  4MTD A;  1LVA A;  4L9T A;  4A0Y A;  5J6X A;  5CJ9 A;  2L3D A;  5DCM A;  3GFI A;  3KEO A;  4Y15 A;  3I71 A;  4ZYE A;  2JRT A;  2XUB A;  5LGU A;  1MD0 A;  1YQA A;  2M8E A;  1LEB A;  1FLI A;  4LB6 B;  1R1U A;  2L54 A;  1ZGJ A;  3L09 A;  5HVQ C;  1IAW A;  4M9S A;  3BY6 A;  5HDN A;  1MJB A;  2GZW A;  3HRM A;  1Y0U A;  5AIP A;  3GFL A;  2W85 A;  1QNT A;  2YPR A;  1JGS A;  1FNN A;  1EH7 A;  2HFH A;  1GXQ A;  3H92 A;  4I09 A;  1LEA A;  1LDK B;  2E7W A;  1R58 A;  1XSX A;  1U6G A;  1HST A;  3J7A O;  5HS7 A;  2H6C A;  4B09 A;  3IRR A;  2FXA A;  3IRQ A;  2E1C A;  2OQR A;  4HF1 A;  3M8E A;  3QAH A;  3WG9 A;  2PQ8 A;  4GCV A;  3U9G A;  2IPQ X;  5J8C A;  5TJJ A;  3ABU A;  3RJP A;  3CTA A;  2LF7 A;  4HF0 A;  1QO0 D;  2IJL A;  3DEU A;  4RS8 A;  5BS6 A;  3F21 A;  2XAG A;  4M9Z A;  5BMZ A;  5FLX K;  1YTY A;  2KJB A;  4KN4 X;  3GX4 X;  3HRU A;  1HKT A;  1IXC A;  2FNA A;  1Z6R A;  2XAF A;  5HLI A;  2JPC A;  3RTR A;  5LHG A;  1U8R A;  3QP5 A;  4FHT A;  4U0W A;  1SFX A;  4ETS A;  2G7H A;  3B73 A;  2DQL A;  1LB2 A;  2V9V A;  2R3S A;  3LST A;  1K7A A;  3EUH A;  3F72 A;  4CDG A;  4WXD A;  3BJO A;  4DQ2 A;  3I0T A;  3W6J B;  4DNC A;  3FXU A;  1KU7 A;  3F8M A;  3LA2 A;  2A61 A;  3Q9S A;  3CDH A;  2XRN A;  1ZG3 A;  2GWR A;  4OIN F;  2MLG A;  1S3J A;  5ICF A;  2CG4 A;  1Z7U A;  3S2W A;  3K0L A;  4YFX F;  3RKY A;  4M6Y A;  2HZT A;  1K6O A;  3ZMT A;  3M8F A;  2PEX A;  3I59 B;  3EYI A;  5E1X A;  4MGR A;  3KZZ A;  3GLX A;  2DBB A;  3HSF A;  4G9Y A;  2RN7 A;  2EFW A;  4S04 A;  4L9J A;  4ZYD A;  3HHG A;  1TW2 A;  2M45 A;  2OZU A;  2DPU A;  1YLF A;  4EGY A;  5ICE A;  2GAU A;  2KIF A;  1B6A A;  2FNP A;  3WU1 B;  2HQN A;  3E6D A;  5D4S A;  3F6O A;  2DTR A;  5HS8 A;  3RDI A;  1V3F A;  1E17 A;  4LMY A;  1DUX C;  5FFZ A;  3JAM Z;  1B59 A;  1SD6 A;  1WQ2 A;  3LAJ A;  2ADU A;  5CVJ A;  1B4A A;  4A6D A;  3TDZ C;  3VFZ A;  1LQ1 A;  3GUD A;  1C0W A;  5A2Q Z;  3T5X A;  3MZY A;  4IF4 A;  4HV6 A;  3SQN A;  3KZY A;  2EFP A;  1BI1 A;  2L4A A;  3KP3 A;  2EA4 A;  4MQV A;  1HXD A;  2O6G E;  1IUY A;  1IRF A;  4G6Q A;  2J5P A;  4OIO F;  1FYK A;  3WE2 A;  1KU2 A;  2YU3 A;  2F5E A;  1SFU A;  2GXG A;  1YG2 A;  4NQW A;  4A2U A;  4ENN A;  3KET A;  1FBS A;  4MHG A;  5LBQ A;  2EK5 A;  2BE5 F;  5E1Z B;  2M87 A;  3ZP5 A;  2FML A;  3L9F A;  2IT0 A;  2DAO A;  2FBK A;  5D5U B;  3R0A A;  1TNT A;  4KUM A;  3N97 A;  5LGN A;  5FD5 A;  3M7G A;  1BBY A;  3B02 A;  2CWE A;  2QWW A;  4KYW A;  3BJ6 A;  1D3Y A;  2KIM A;  3MZH A;  3T0Y A;  1EV7 A;  3TO9 A;  3VOD A;  3VOE A;  5F64 A;  1XD7 A;  4QWQ A;  4HQE A;  1W7P B;  1KYW A;  4RB2 C;  1O3Q A;  2OQG A;  4U7D A;  2FMY A;  4HYE A;  4B8X A;  1KGS A;  4KDP A;  3V4G A;  3F6V A;  3P9C A;  2V1D A;  4D0P A;  2IA0 A;  4WWC A;  3I5U A;  2HYF A;  2EA2 A;  1YYV A;  4S05 A;  4UUV A;  5F1R A;  2MD5 A;  2QBY A;  3KFW X;  4M74 A;  2ZBK A;  2K4B A;  5JI6 A;  2FU4 A;  4EQQ A;  3FXR A;  5D6F A;  1KQ0 A;  2FBH A;  1ZH5 A;  3IL2 A;  2STT A;  5BPI A;  2H27 A;  4LG0 A;  1NHA A;  1FPQ A;  3NEU A;  4AWX B;  5HLH A;  2IVM A;  1RIO H;  2QEN A;  2O61 A;  4ESJ A;  1CF7 B;  4CYD A;  2ZO4 A;  1ZLJ A;  5JFR A;  4ZH4 F;  3J81 K;  1OYY A;  4ESF A;  5HDK A;  2D1H A;  1HKS A;  4RGR A;  4Q48 A;  4Y17 A;  1DDN A;  4L9V A;  1TLH B;  4O3M A;  2K4J A;  1R1V A;  3HIF A;  4L18 B;  2NAZ A;  1KQ8 A;  3BPV A;  2PN6 A;  2A3S A;  3O2P E;  1ZRF A;  2PBI A;  2VON A;  1P4A A;  4OIQ F;  1QZY A;  3K9T A;  2QUF A;  1YS7 A;  4IVN A;  5IT9 Z;  1IN4 A;  3IWF A;  4RB0 A;  4MEY F;  3F8N A;  1WWX A;  1P92 A;  4CO8 A;  3ULQ B;  1O3R A;  2DU9 A;  1IN6 A;  3HSR A;  2CYY A;  1E2X A;  3TQN A;  2XAH A;  2RC4 A;  1UHW A;  1FT9 A;  1T0F A;  2WWY A;  2HOE A;  2Z9O A;  2JPB A;  1TQP A;  2H94 A;  1YFH A;  1RUO A;  3MQ0 A;  5EEG A;  2LDU A;  4A12 A;  3LFK A;  3E6C C;  4EJO A;  3GZ6 A;  1TTY A;  1XMK A;  3M9A A;  2ESN A;  2OAZ A;  2VC0 A;  2DI3 A;  1IF1 A;  1J5Y A;  2ZKZ A;  4A0X A;  1K78 B;  3R6S A;  5D5W B;  4M9X A;  5JHU A;  1HW5 A;  2WC2 A;  1B1B A;  1ZG5 A;  1FC3 A;  2CQK A;  2A69 F;  1LJ9 A;  4EJT A;  3C7J A;  2NYX A;  3GYH X;  1L0O C;  2J5O A;  2ZFW A;  2Y48 A;  2K7L A;  2F5D A;  1X3U A;  1PUE E;  2H6B A;  2OA4 A;  1H9G A;  2NNN A;  4UVB A;  1U5T B;  3I4P A;  3AAF A;  2QQB A;  1G3S A;  2VC1 A;  4L0Y B;  3F22 A;  4GGG A;  4HZF A;  3EYY A;  4WX9 A;  3WE3 A;  2HKO A;  2OU2 A;  1F5T A;  5L3E A;  1FBQ A;  1OR7 A;  4HDV A;  3FF5 A;  3CUQ B;  4G7H F;  3HTU A;  3JSP A;  3V8L A;  4LLN A;  1FYM A;  1Z6T A;  2CO5 A;  1F9N A;  3K69 A;  1YW8 A;  1CF7 A;  3BPX A;  1BC7 C;  4R8H A;  1S6L A;  4G94 A;  1BI2 A;  4UV8 A;  3FM5 A;  3BDD A;  3W6K B;  1XMA A;  3FZV A;  2XV4 S;  2STW A;  4KIC A;  5LEK A;  2EJR A;  1FY7 A;  4HF2 A;  2GIV A;  3FHZ A;  1YO5 C;  2G9W A;  5HOO A;  1R1T A;  3VEP A;  2FBI A;  3E6B A;  4UXN A;  4I0B A;  3WOD F;  1SD4 A;  2EV5 A;  3PQJ A;  5ILS A;  3T8T A;  1K79 A;  1XGM A;  1RZ4 A;  2E1N A;  3R0J A;  1FWZ A;  6PAX A;  3DP7 A;  2OBP A;  4IPA A;  3QPH A;  1R23 A;  3IKT A;  3CO7 C;  3WGH A;  1HQC A;  2ZNZ A;  4E70 A;  1KU3 A;  1R22 A;  1FBU A;  2QLZ A;  1SMY F;  1AOY A;  2MA3 A;  2P8T A;  3E6M A;  3IHU A;  3RI4 A;  1ONV A;  1G3T A;  1CGP A;  4AIH A;  1XCV A;  1Z9C A;  1R5H A;  4KIF A;  1YW7 A;  4LLL A;  2COM A;  1JHH A;  2RDP A;  3J80 Z;  1KQ9 A;  4R79 A;  1Z91 A;  3C18 A;  2X0L A;  5DV5 A;  3QU6 A;  2LKP A;  4L5J A;  3SZP A;  2FE3 A;  2H09 A;  3JTG A;  1GHC A;  2HQR A;  3BWG A;  4WXC A;  4KIG A;  4I7H A;  3GO5 A;  2PLY A;  2EFO A;  2AXL A;  1ZRE A;  3L2C A;  2FRH A;  4EM1 A;  1REP C;  4P9F A;  4WXH A;  2GQQ A;  2VXZ A;  3CJN A;  5K1Y A;  5FB2 A;  1MJ9 A;  1ON2 A;  5LHI A;  2DK5 A;  1GVJ A;  2VOD A;  5KVR A;  5DEQ A;  1ZAO A;  3WTW C;  3L00 A;  2EFQ A;  2ACJ A;  3HRT A;  1SD7 A;  3WTY C;  2FA5 A;  3JTH A;  4BNC A;  3FMQ A;  1J0R A;  2A5Y B;  1AWC A;  2O0Y A;  4LLG F;  3CUQ A;  4BHP A;  1UHM A;  2JZY A;  5HLG A;  2ESH A;  2KRF A;  3K1P A;  5L3C A;  2PG4 A;  3LQR A;  2EV0 A;  4XLP F;  4WF2 A;  3ROU A;  3EDP A;  2V1U A;  4AVP A;  3JW4 A;  3OV8 A;  2MH2 A;  2R7F A;  4OMY A;  2BBY A;  1F1Z A;  3C3W A;  1FX7 A;  3TDU C;  2HWV A;  1H9T A;  4EGZ A;  1TQM A;  4N9I A;  3I58 A;  4RB3 C;  4H0E A;  3Q9V A;  5DYM A;  4FX4 A;  3DPL C;  3MWM A;  2XKO A;  1U3E M;  3VB2 A;  1DPR A;  2O03 A;  3COA C;  2P5L C;  2PMH A;  5HS9 A;  4I0A A;  3WTZ A;  4YII A;  4L0Z B;  4HA8 A;  5ILU A;  5KK1 A;  5D4R A;  3KP5 A;  1OPC A;  4U7B A;  3CO6 C;  1D8K A;  2FEZ A;  1DP7 P;  4ZZD A;  2XAS A;  5FLX Z;  3TOA A;  2HR3 A;  5H6Q A;  4ZYH A;  1BC8 C;  4R1H A;  4KA4 A;  4F7Z A;  2K27 A;  3F8B A;  4OIR F;  1FSE A;  2VE9 A;  4Q5S F;  1TBX A;  2OD5 A;  4WK8 F;  5BPD A;  4O5V A;  1XCB A;  1W4M A;  3P7N A;  4A6E A;  3QU3 A;  1BI3 A;  2FSW A;  2KIU A;  4AIK A;  4PGH A;  2ZME B;  1BI0 A;  1RI7 A;  2ISY A;  2D45 A;  2DO7 A;  3U1D A;  2A6H F;  2AS5 F;  2HEO A;  2NS0 A;  3DFG A;  2K02 A;  2DW4 A;  2VBW A;  1Z05 A;  1D8J A;  4YG2 F;  1OYW A;  1EH6 A;  3I59 A;  4JQF A;  2PMU A;  3MAJ A;  3SZT A;  1UB9 A;  1FYL A;  3C1D A;  3WGI A;  4HQM A;  1MDM B;  1BIB A;  2RKH A;  2XAQ A;  2EB7 A;  2ZJ2 A;  3I53 A;  1WSU A;  4PCQ A;  5D6E A;  2C6Y A;  4UNO A;  3ERE D;  1R36 A;  4CGZ A;  4LD5 A;  5L3F A;  4P96 A;  4GYG A;  1R5G A;  1LDJ A;  1OYI A;  2YR2 A;  1YS6 A;  2HS5 A;  2TDX A;  3ZQ7 A;  2IA1 A;  5DCM B;  3HRS A;  1KU9 A;  3DF8 A;  1RNL A;  2XHK A;  3MEX A;  1EH8 A;  3RIR A;  2P5V A;  4HAM A;  3KP4 A;  2VBZ A;  1ZRC A;  4HX8 A;  1BIA A;  1D5V A;  3ZN1 A;  3BOQ A;  2YX4 A;  3LQQ A;  3RPU A;  2QYO A;  4MQ9 F;  3HSE A;  3ZN0 A;  4OOI A;  3R61 A;  2ZXJ A;  2QZ8 A;  3ZMV A;  2JSC A;  2XKP A;  3LA3 A;  3D5L A;  1TQI A;  2DT5 A;  1P2F A;  1YW9 A;  1JHF A;  3WTT C;  5JVT A;  1W7P D;  2A68 F;  2P4W A;  1I6X A;  2KKO A;  4BHB A;  1O7L A;  2DFI A;  1T6S A;  5CVR A;  3ZMD A;  4XSX F;  4BH9 A;  3OOP A;  4XSZ F;  2VOO A;  2KJC A;  1T2K A;  2ZNY A;  1HW2 A;  1P6R A;  5E8G A;  1BN5 A;  2MC3 A;  4MEX F;  5ED4 A;  4BAY A;  4JK1 X;  1J9I A;  1IW7 F;  2UZK A;  4EJV A;  2DLL A;  4MNU A;  3DQV C;  3I64 A;  1TNS A;  2PJP A;  5DDG A;  2ZME A;  1STZ A;  2CFX A;  3P9K A;  2VE8 A;  1XSD A;  1KYZ A;  1J59 A;  1J2X A;  4IRH A;  4HX4 A;  5DCF A;  4EJU A;  3F8F A;  5K5R A;  5L3B A;  1XGO A;  4I98 B;  3RPQ A;  4IXA A;  1IN8 A;  1G6N A;  1T38 A;  1RUN A;  1WI9 A;  3ISP A;  2GA1 A;  3GW2 A;  4LGW A;  1QQI A;  1WRJ A;  2BGC A;  2EWN A;  3V7S A;  4IRI A;  2VBX A;  3PQK A;  1W7P A;  2MH9 A;  3NRV A;  5E20 A;  4RAZ A;  1JE8 A;  1IN5 A;  1Q1H A;  1P4X A;  2DPD A;  1V4R A;  1H0M A;  1MDM A;  2L01 A;  5E8I A;  3E5Q A;  4PDK A;  1XDU A;  2B0L A;  4KIB A;  2XAJ A;  3F8C A;  5H6R A;  4NHJ A;  3R60 A;  2FOK A;  1ODD A;  1XN7 A;  2IP2 A;  1PDN C;  3GXO A;  3P9I A;  1UCR A;  2ZCW A;  1FSH A;  1T39 A;  2UXN A;  4EJW A;  2FF4 A;  2RV8 A;  4M73 A;  4IHT A;  4P9U A;  2RNJ A;  3E97 A;  4M71 A;  2VBY A;  4I2O A;  5L3G A;  3HHH A;  3EQL F;  5HDG A;  2R7D A;  3O6B B;  1XGS A;  4FX0 A;  4BQA A;  4CHU A;  2Z33 A;  1QGP A;  2DQR A;  1U5T C;  2JTV A;  3QOP A;  2Y75 A;  3J81 Z;  3JAM K;  3V8J A;  4GYI A;  4ZZL A;  4IJA A;  1BJA A;  1LDD A;  1L3L A;  3V8K A;  3ECO A;  1ON1 A;  5BOX A;  1ZLK A;  4CIC A;  4OMZ A;  5DUK A;  5BQT A;  2QVO A;  3CUQ C;  1Z1D A;  1XDS A;  1YIO A;  4A5N A;  2NRA C;  4RGS A;  4MTE A;  4YFN F;  4KT5 C;  5A2Q K;  1I5Z A;  5DUI A;  4LJZ F;  3KE2 A;  3FWE A;  3LA7 A;  3DPT A;  4N9H A;  2Y0M A;  4EV0 A;  1GXP A;  5L3D A;  4L5I A;  5LHH A;  3TOB A;  2RGV A;  3ZMU A;  3U2R A;  1P4W A;  4IHS A;  3SFZ A;  5CVV A;  4LB5 A;  4EM0 B;  4RGU A;  4UHT A;  1I1S A;  2W84 A;  4OU0 A;  4HLY A;  3K2Z A;  3KCC A;  2XGX A;  3BZ6 A;  3DXJ F;  1ZHF A;  2P7C B;  1T98 A;  4U88 A;  2HTJ A;  4XBF A;  3TGN A;  5F6F A;  3FM3 A;  3N4M A;  2D2W A;  3HYI A;  5DD8 A;  2UWM A;  1ZRD A;  1MJA A;  4HDU A;  3WGG A;  1XSV A;  2MBF A;  1K78 A;  3F23 A;  5D5X B;  4BXU A;  2IW5 A;  2PFB A;  3MFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...