1FYKA

Serendipitous crystal structure containing the heat shock transcription factor's dna binding domain and cognate dna that is translationally disordered
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
92
structure length
88
Chain Sequence
ARPAFVNKLWSMVNDKSNEKFIHWSTSGESIVVPNRERFVQEVLPKYFKHSNFASFVRQLNMYGWHKVQDVKSGNNDSRWEFENERHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal packing interaction that blocks crystallization of a site-specific DNA binding protein-DNA complex.
pubmed doi rcsb
source organism Kluyveromyces lactis
molecule tags Transcription/dna
molecule keywords HSE DNA-PHOSPHATE BACKBONE
total genus 21
structure length 88
sequence length 92
ec nomenclature
pdb deposition date 2000-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fykA00
3FF5A 4Q5SF 3J81K 4UHTA 1S8NA 2CSOA 4FT8A 1JGSA 1P6RA 1KQ9A 4NQWA 3D0SA 1QZZA 3ZQ7A 4A0XA 1U5TA 4HF1A 3V8JA 3EUHA 1ZG1A 4KDPA 4M73A 4IXAA 3SZPA 1G3WA 1HW2A 2VC1A 1ZREA 1U8RA 2A6HF 5L3FA 1UCRA 5TRDA 2W84A 3L00A 2NNNA 1XMKA 4HLXA 3DKWA 4P9FA 3RKXA 2FOKA 4RB0A 3PFIA 4KICA 5LHHA 3V7CA 4L5IA 1ZAOA 3ZMVA 1D8JA 1YYVA 4IRHA 2V1UA 3ZMTA 5ILSA 1R23A 4XLPF 1TNSA 3N4MA 2XAFA 5D5WB 1TW2A 2FMLA 4ZH4F 3TOAA 1F9NA 2F5FA 2FBIA 3HTSB 4I0BA 2JT1A 4MEXF 2FU4A 2O03A 4A0ZA 4RGRA 4KIGA 1LEAA 3EQLF 4KN7X 5LBQA 3I64A 2NS0A 1AOYA 3ECOA 4MQ9F 4KN4X 1DP7P 2HQRA 1ON2A 4XSXF 2A07F 5D6EA 3ERED 2QQ9A 3IRRA 2O61A 3ZMDA 4LMYA 4MQVA 2KKOA 3CUQC 3MCZA 4WXCA 4AD9A 3DF8A 4G6DA 3M1EA 5J8CA 5L3GA 1W4MA 2F5CA 4HDVA 1XGSA 4ESJA 4M6XA 2OBPA 1J9IA 3LAPA 3CLOA 2CQKA 3P7NA 1O3RA 1FBUA 1BBYA 2IW5A 3SHFA 5IT9Z 2K02A 3IKVA 3T8TA 3Q9SA 1TBXA 1FLIA 1GXPA 1K78A 5DCFA 4HBLA 4I0AA 4H0EA 5AIQA 4G7HF 2VOPA 2XAJA 1T39A 1CGPA 4HQMA 4RAYA 3G3ZA 3Q9VA 1HW1A 1MD0A 3U1DA 4AIJA 4CYDA 3CUOA 3L7WA 2MLGA 5L3CA 2V9VA 3GO5A 1DUXC 3BJOA 3HRMA 5ICCA 3BOQA 2E7XA 3HSEA 1W5SA 3WTWC 1SFEA 1XDSA 1KA8A 1YG2A 1O3SA 3W6JB 1TNTA 3BROA 1FC3A 5FLXZ 1QPMA 4IRIA 2OQGA 1RIOH 1R36A 2RC4A 4BAYA 1SMYF 5K5QA 1UFMA 2MLKA 3MEXA 1F5TA 3K1MA 4ZYDA 2Z33A 1SD6A 1U5TC 1FX7A 1FY7A 1IF1A 2YSRA 2RNJA 4M71A 2STTA 4RAZA 3M8FA 4N0BA 4TV7A 4YIIA 1ZLKA 3QU6A 4KUMA 2ISYA 3GFMA 3IL2A 4L9NA 5LGTA 2XRNA 3GX4X 1X3UA 4G9YA 1P4WA 1ZYRF 1WKMA 3GLXA 2GXGA 2K4BA 1HW5A 3GW2A 3HIFA 4GO1A 5LEJA 5HDKA 2F2EA 1JXSA 4HOBA 1WRJA 2JZYA 5K5RA 1FYLA 4HX4A 1I1GA 2STWA 4P5OA 1FYKA 3E6CC 2MC3A 2DO7A 3IKTA 1Z1DA 2GZWA 2DU9A 1T0FA 2ZNYA 2EFWA 1LEBA 3PQJA 1K6OA 1SD5A 2XGXA 3OV8A 3DP7A 2RQPA 3E6BA 2MD5A 1BIAA 1T6SA 2DTRA 1IAWA 2Q2EA 1U6GA 2FEZA 2ZCWA 3H92A 2IA0A 3QP6A 4OINF 1MJ9A 3J80Z 2ADUA 1RNLA 3TDZC 2O0YA 4L5JA 5LGNA 2ZMEB 1H9GA 4U0WA 1D8KA 1J59A 2JTVA 2HFHA 1OMIA 4ZYEA 1WI9A 2DW4A 5ICGA 1HKQA 2IP2A 5ILUA 5FFZA 3J7AO 2XHKA 2PQ8A 3GWZA 5E8GA 1KQ0A 1B59A 3CTAA 3MFKA 5FO5A 3M8EA 2QYOA 1HSJA 4MTEA 1BN5A 2VBWA 3KZYA 4R79A 4NB5A 4ZYHA 3KP4A 1ZARA 2FF4A 3W6KB 4JQFA 2QBYA 1SFXA 1EH8A 2FBKA 1I1SA 2K86A 2Z99A 3E6MA 3QPTA 1DPUA 1XGOA 4D0PA 4HZFA 4MHGA 5BMZA 1G4DA 2M87A 1ZG3A 1LDKB 1BI1A 5EEGA 3I0TA 5E1WA 4UUVA 1BC8C 2Z9OA 3HSFA 2LSOA 3FWEA 4A0YA 2M8EA 4EMSA 4AIKA 1KYWA 3BZ6A 4KFCA 3ZN1A 1OPCA 5AIPA 3ZPLA 3HSRA 2EK5A 3SQNA 2VBZA 5HDGA 5CVVA 4A5NA 2HTJA 3MQ0A 3ROUA 3RTRA 1O7LA 4I2OA 2JPBA 2ZMEA 3BP8A 2ETHA 3VFZA 5HVQC 4OIRF 2FNPA 1K78B 1LVAA 3LQQA 1RUNA 3RPUA 4KA4A 5FD6A 2KIUA 1S6LA 5FFXA 2FXAA 3TDUC 3CUQB 4QLCU 3QU3A 2P4WA 3KETA 3S2WA 1BOAA 2M1BA 4EVIA 1XSXA 1DDNA 1NHAA 3E6DA 3K69A 2BGCA 3VODA 2IPQX 1TLHB 2FBHA 3TOBA 1R1UA 1KGSA 3KEOA 4U0VA 2W85A 1R5HA 5F1RA 2HEOA 1QNTA 3K9TA 1Z7UA 2QBYB 2Y48A 4EJOA 3ABUA 4LFUA 5ED4A 1WQ2A 1W7PA 2LKPA 1HQCA 1WSUA 4YFKF 4I7HA 4EQQA 2VT2A 1YW8A 1L3LA 5FLXK 1LDJA 4EV0A 4WX9A 4G7ZF 1LJ9A 4E70A 1ZRDA 1DPRA 5BPIA 2L54A 3WE2A 1IN5A 3RPQA 3F8CA 4EM2A 4HAMA 4ENMA 2R7DA 4XLNF 3LAJA 2RDPA 2P5KA 3BPXA 3KZZA 1IZ1A 1MGTA 4JBAA 3IWZA 4CGZA 4RGXA 4IHTA 3NRVA 5DCMB 4EJUA 1QZYA 2QM3A 3F6OA 2V6CA 4LG0B 4KIFA 4WXDA 2GWRA 1KU2A 3NEUA 4M9SA 4HDUA 4G7OF 1HSTA 4S04A 3E3VA 3DXJF 1J7KA 2FA5A 1J2XA 2CYYA 2XAGA 1Q1HA 3RI4A 3V7SA 4YFNF 2HGCA 2P7VB 4U7DA 3V8LA 1ZGAA 4U88A 4HYEA 2VBYA 1R7JA 3R0AA 4GYGA 4ETSA 4YG2F 5D5VB 1KU9A 1Z9CA 1LDDA 2Z5UA 1USSA 2AXLA 2VBXA 1E2XA 2LF7A 5J8FA 3WG9A 5H6QA 3HRTA 2VN2A 4WK8F 2GXBA 2XKPA 1R22A 2MH9A 3PQKA 2EWNA 1YS7A 4PCQA 1MJBA 4FX0A 1W5TA 2W57A 5E18F 1YLFA 3GZ5A 4MEYF 2J5PA 3RDIA 1IXCA 3ISPA 4RB1A 3MZHA 3OOPA 1U78A 2J5OA 2X4HA 2Y0MA 2B0LA 3KP7A 2C6YA 3F8FA 5EEHA 1SD7A 3FX3A 1XCVA 3I59A 3WODF 1C0WA 1XMAA 2FNAA 2DFIA 2HOEA 2R7FA 1V4RA 4A6DA 1E17A 1KYZA 3R6SA 2R3SA 3TQNA 3DEUA 5LRRA 1Y0UA 2LF8A 4ENKA 4BHPA 4CO8A 1A04A 3SXYA 4IF4A 1YTYA 1G6NA 2DT5A 3R4KA 5F64A 2KJBA 3KCCA 2O8XA 4HA8A 2PBIA 4G94A 1ZRCA 5BOXA 3F6VA 5DV5A 5FGMA 2ZBKA 2YX4A 2FSWA 2KIFA 1J75A 4I98B 5A2QZ 2M45A 2VE9A 3ML6A 3WTTC 3DPLC 2HKXA 1REPC 3C3WA 5FB2A 4BH9A 3WGGA 1I5ZA 3LA2A 3LA3A 3FM5A 3JTGA 4IPAA 4RB2C 3REOA 3BWGA 5A2QK 5DUIA 1U2WA 5E1XA 4M6YA 5JFRA 1JHFA 3GF2A 3ULQB 4LK1F 2ZNZA 3I59B 4LLGF 2UXXA 1XSDA 4ASNA 3P9CA 5J6XA 3I4PA 2E1NA 3NQOA 3V4GA 5H20A 3DQVC 3F23A 4A6EA 4QWQA 5HLHA 1FP1D 2VOOA 2D1VA 1T2KA 1EH7A 1RI7A 2OZ6A 4L0ZB 2PN6A 2VXZA 1B1BA 5DD4A 2D1HA 3G73A 2G9WA 4M74A 2EV5A 4Q4ZF 3FZVA 4RS8A 4EM0B 4LB5A 3MWMA 5CVIA 4WF2A 4HX8A 4ESFA 2DPUA 4IHSA 2QENA 2IT0A 5CLSA 2EA2A 5L3DA 4RGSA 2VT3A 2D2WA 2MBFA 5E17F 3FMSA 1P92A 2F5DA 4I02A 5K1YA 1MZBA 1R00A 2V1XA 3GFLA 2V79A 2GQQA 1F1ZA 3CUQA 1YIOA 1R1TA 4XBFA 1SMTA 2OZUA 1R1VA 4BNCA 2CGPA 1TW3A 3BJ6A 1HKTA 1ONVA 5HDNA 1FSHA 3HHHA 3GFIA 2XASA 5JI6A 4ZZDA 2HS5A 3HRSA 4KT5C 3J81Z 1O7FA 1H0MA 5KK1A 2QZ8A 3KLOA 5D4SA 4GYIA 3HOTA 4OMYA 3BPVA 1IRGA 5E8IA 2HDCA 3JAMZ 5D5XB 3O2PE 2XAQA 4L9TA 1T98A 2M5WA 2FQ3A 2P8TA 5IT9K 5DD8A 2E1CA 4YIFA 1V3FA 3FXUA 4CXFA 1MDMA 1GHCA 3ZN0A 3CJNA 4A5MA 4U7BA 3JSPA 1SAXA 5ICEA 4LB6B 3WGIA 2CFXA 3E97A 4ZYGA 1OYYA 1HBXG 1GXQA 1ON1A 4I09A 5LHGA 2EA4A 2O3FA 3WGHA 2Y75A 3I58A 4WCGA 3RIRA 3H3ZA 3EYYA 4R8HA 3ZMZA 5D8LB 1HKSA 1MKMA 2L01A 1O3QA 4HQEA 2EFOA 3N97A 3F21A 2AS5F 4NHJA 3O3KA 5HOOA 2DK8A 2VE8A 5JVTA 2P5LC 4N9IA 1ZHFA 1BI2A 4Y15A 2FE3A 3C1DA 3MZYA 3QOPA 3JSOA 2ZXJA 4OU0A 4MTDA 2W25A 3RJPA 2OQRA 1FPQA 3P9IA 3K2ZA 2XV4S 5ICFA 3KP6A 3TKYA 5TJJA 2UWMA 1K7AA 3HHGA 3JAMK 4GGGA 3HTUA 3ECHA 3BJAA 2IJLA 1FSEA 3QP5A 3WTZA 3WTUC 2YR2A 2P6SA 3COAC 1FZPB 2K27A 2L3DA 5DEQA 4L9JA 2XROA 4AWXB 1Z6RA 1B9NA 3CDHA 1EH6A 2DAOA 3WU1B 5CJ9A 4CHUA 3QPHA 4Q48A 2H94A 3B73A 4GXOA 1FP2A 3ZMUA 5BPDA 3B02A 5F6FA 1IN6A 4HV6A 5KVRA 2K4JA 4AIHA 3I71A 1RZ4A 4P55A 2QLZA 1LB2A 3F8NA 2CW0F 1YS6A 5BS6A 2GA1A 1P2FA 4HF2A 1OR7A 3LFKA 4P9UA 4HV5A 1R58A 4M72A 2RN7A 2NYXA 4N9HA 4I01A 4EGYA 4UV8A 2DI3A 3TO7A 1ULYA 3LWFA 1KU7A 4MNUA 5D5UB 3EDPA 2XVCA 1H9TA 1FWZA 3F8BA 2O6GE 2PMHA 2MA3A 1HXDA 4KNYA 1XGMA 3DV8A 3WTSC 4IRGA 3T0YA 2ZKZA 3K1NA 3KP5A 4L18B 1WWXA 3V7RA 4IVNA 4DNCA 1IUYA 1P4XA 1U3EM 1XN7A 1VTNC 3L9FA 5DCMA 4YFXF 3TGNA 3QRFF 1IN4A 3DPTA 2HR3A 2PMUA 1MJAA 3F22A 2JPCA 1FOKA 1MDMB 2ZJ2A 2A69F 2IVMA 2K7LA 4HLYA 3L09A 4GCVA 3GUDA 4UVCA 4OIQF 2PEXA 4ESBA 2EFQA 4A12A 3SZTA 3VB2A 1P4AA 1J0RA 3F8MA 4PGGA 2HTSA 3ABTA 2ZO4A 2HYFA 2YPRA 1XD7A 1LQ1A 4LK0F 2QVOA 2QWWA 3P9KA 1YO5C 2JRTA 5E20A 4M9ZA 5D4RA 1IRFA 1BI0A 4G8XA 1I6XA 2E7WA 2VODA 5D8KB 2RKHA 4BHCA 1ZH5A 2G7HA 1XDUA 2MH2A 2XIGA 2GAUA 3R60A 1BIBA 2QQAA 5HS9A 3WTYC 2BV6A 2XUBA 4MGRA 1G3TA 2ZFWA 3U9GA 1STZA 3HUGA 1QQIA 1ZG5A 3F72A 1UHWA 1B9MA 1L0OC 1EV7A 2Q0OA 3GEZA 4BQAA 1S29A 5ILVA 5L3EA 4LLNA 4L9VA 4FHTA 1UB9A 2FRHA 4LGWA 2ACJA 2HWVA 2HZTA 1ZGJA 4HF0A 3E5XA 1QGPA 3BY6A 3HYIA 2Q8KA 2IRFG 3HOSA 3K1PA 1UHMA 3WU0A 5AONA 5CVJA 2RGVA 3LQRA 2D45A 1YW7A 1PUEE 3AAFA 2BBYA 3DFGA 3FHZA 2P6TA 1Z91A 4ZZLA 2HYGD 4S05A 1XCBA 3EYIA 3GZ6A 1J5YA 2DLLA 2L4AA 5ERIA 4WXHA 1Z6TA 3IC7A 2NRAC 3GYHX 1IXSB 3E5QA 3KE2A 1BJAA 2DBBA 4Q47A 4R1HA 2CO5A 4EJVA 1S3JA 2XKOA 3BDDA 4G6QA 1GVJA 3KFWX 2WTEA 1Z05A 1QBJA 1XSVA 3C7JA 4EJWA 4Z2YA 3JTHA 4EJTA 1KU3A 1XB4A 4UVBA 5K5OA 1F4KA 2PLYA 4FX4A 4Y13A 2OA4A 1PP8F 2DK5A 2A5YB 2LDUA 2EJRA 4K2EA 1AWCA 1YFHA 4O5VA 3C18A 3RKYA 5HS7A 3LSTA 4ON0A 3KEQA 2P5VA 4BYYA 3ZMSA 3SFZA 3F3XA 2WWYA 2XAHA 1JHHA 4WWCA 1YQAA 5LLQA 2F5EA 3RYPA 1W7PB 5FD5A 1B4AA 1ZLJA 5DDGA 2H09A 5E1ZB 6PAXA 3QAHA 2P7CB 1CF7B 2RVCA 4UVAA 2DQLA 2PG4A 2EV0A 1OYWA 1ZN2A 3FM3A 4BHBA 1FNNA 3KP2A 1BC7C 3M9AA 2CG4A 4CDGA 4KIBA 3VEPA 2NNYA 1S7OA 2IA1A 1XGNA 3WTXC 3RKWA 2H6BA 4F7ZA 3L2CA 2HKOA 4A2UA 2A6EF 1USTA 3ZP5A 5LEKA 3WTVC 3T8RA 1OYIA 5CYVA 1U5TB 3GXOA 3EETA 2QUFA 4LLLA 2OAZA 4BXUA 4P96A 3U2RA 4O6JA 3ELKA 2VONA 2WV0A 5H6RA 4M9XA 4O3MA 3H3UA 2Z3YA 3O6BB 2ESHA 2JSCA 3FXQA 4LG0A 5IT3A 4U0YA 2L4MA 2BYVE 3FMQA 4HX7A 4CZZA 5JR3A 3J80K 3Q5FA 2M30A 1D5VA 1JE8A 2KRFA 1KQ8A 1IN8A 2DQRA 3WE3A 1OKRA 5DYMA 4ENNA 4OOIA 2KJCA 1G3SA 3IWFA 2ISZA 1YW9A 2DPDA 3I53A 1K79A 2EFNA 2PJPA 2WC2A 1R5GA 5LHIA 3CO7C 1IN7A 4LJZF 1G3YA 1SFUA 1O57A 3T1BA 2A3SA 1TQPA 2TDXA 4HW0A 3KLNA 1IW7F 3I54A 2YU3A 3R0JA 3K0LA 3E5UA 5DUKA 3M7GA 2QQBA 5L3BA 1O3TA 1ODDA 3IRQA 3V8KA 2A61A 2COMA 4PGHA 2RV8A 2G7UA 4XRFA 1FT9A 4XSZF 2EV6A 1BM9A 3TO6A 2A68F 3GVAA 4UV9A 3JW4A 4Y17A 1FBSA 2UZKA 1B6AA 2BEOA 2OD5A 3T5XA 5HLGA 2X0LA 5LGUA 2V1DA 2FMYA 2IA2A 5HLIA 1FBQA 2EB7A 1FYMA 2GIVA 5CVUA 4IJAA 4OIOF 4EGZA 1TTYA 4B8XA 3RYRA 2BE5F 1PDNC 2CWEA 1T38A 1S7AA 3FMRA 1QO0D 2NAZA 2OU2A 4EM1A 3D5LA 4RB3C 4CICA 2GA2A 1W7PD 2PFBA 5HS8A 3KP3A 3CO6C 4UXNA 4KYWA 2ESNA 3GFJA 1TQMA 4JK1X 4ENJA 3FXRA 5JHUA 1CF7A 3R61A 1IXRC 4UNOA 4AVPA 2YX7A 2PI0A 4L0YB 3IHUA 4LD5A 3TO9A 1PP7U 1SD4A 4OIPF 1LNWA 3HRUA 4PZJA 2W24A 3VOEA 1BI3A 2KIMA 2H6CA 4RGUA 2EFPA 1D3YA 5LRSA 1ZRFA 2L02A 5D6FA 1RUOA 4OMZA 4KMFA 5CVRA 2UXNA 4PDKA 5BQTA 4DQ2A 2HQNA 3I5UA 3LA7A 3MAJA 4B09A 1I27A 2H27A 2VC0A 2LNBA 1TQIA 4KMUX 2ELHA
chains in the Genus database with same CATH superfamily
2WV1A 3HOXJ 2BXZA 4F52A 3FF5A 2KRCA 2TCTA 2L7KA 3MKLA 4F91B 4Q5SF 3J81K 4UHTA 1S8NA 1TT5B 2CSOA 4FT8A 1JGSA 1D1AA 1P6RA 1KQ9A 1BR1A 1FOYA 5GTHC 4NQWA 3D0SA 1QZZA 3ESWB 1JUMA 2E5ZA 3ZQ7A 5C44J 4A0XA 4LIUA 4C9YA 1U5TA 1W36D 3HKZN 4HF1A 3V8JA 3EUHA 1ZG1A 3GTKJ 4KDPA 5J4VA 4M73A 3J7AY 4IXAA 3JRIA 5J1YA 3SZPA 1G3WA 5FJ8J 1HW2A 3ZCOA 2R93J 2VC1A 1ZREA 1U8RA 2A6HF 3KYLA 4YRVA 5L3FA 1UCRA 5TRDA 2VKDA 2W84A 3L00A 2DN0A 2NNNA 2OTLI 1GT0C 1XMKA 4HLXA 3DKWA 4P9FA 3RKXA 3CF5F 3TMOA 1WJEA 3ZQCA 3LFUA 2FOKA 1JUSA 4RB0A 3PFIA 4KICA 5LHHA 3V7CA 3DTKA 4L5IA 1ERDA 4L5EA 1E3PA 1ZAOA 3ZMVA 1D8JA 1YYVA 4IRHA 2HU9A 4MO7A 2V1UA 4QSHA 2MYSA 1OCTC 3ZMTA 1VQKI 3MMYB 5KHDA 5ILSA 3LSGA 2DFFA 2CJJA 2CW7A 1R23A 4Y52J 3OR1C 3ZQQA 4XLPF 1TNSA 3VYTB 3N4MA 3I9V2 1Z67A 2XAFA 4BEHB 1TW2A 2FMLA 5D5WB 2D5VA 4ZH4F 2V9PA 3TOAA 3ASNH 3AFHA 5EG0A 2YU9J 3BCAA 2DFEA 2OUMA 2QCOA 4CSWA 1F9NA 1B8IA 2F5FA 2FBIA 5DM6F 3C2BA 3HTSB 4I0BA 1N25A 4D7NA 1Y8RB 2JT1A 4X6AJ 2LR8A 3FXJA 4MEXF 2JN6A 2FU4A 2O03A 2KFDA 3ABLH 2DMTA 2VI6A 2B9SA 3HOVJ 1X19A 4A0ZA 4RGRA 5J4YA 4KIGA 5K7ZA 4AM3A 4PJJA 2R7XA 1LEAA 2I5UA 3EQLF 1SFKA 4KN7X 5LBQA 1J09A 3I64A 2NS0A 1AOYA 3ECOA 1VZ0A 2R7SA 2EIKH 4MQ9F 2CUEA 4KN4X 1DP7P 2HQRA 1ON2A 4XSXF 2A07F 2Y30A 5D6EA 3ERED 2RAEA 2QQ9A 3W2AA 4KT6A 3IRRA 2O61A 1M1EB 1SEUA 5JVGF 3LSJA 3ZMDA 4LMYA 3VPRA 4MQVA 3CCUI 3ERMA 2KKOA 2R5ZA 2LK2A 1OR7C 1X3ZB 3CUQC 3MCZA 3TW7A 1YITI 4ABZA 4WXCA 3L1PA 4AD9A 3DF8A 1Y0NA 4G6DA 2COBA 3M1EA 5DS9A 5J8CA 5L3GA 1W4MA 4PSXA 1QU3A 2F5CA 4HDVA 4CCMA 1S7EA 1WHUA 1YJWI 1MW7A 4A3EJ 1XGSA 4ESJA 4M6XA 2OBPA 3VYRB 5B1BH 3EUAA 3H9GA 3TW6A 1J9IA 3LAPA 2JMWA 2EIMH 3CLOA 2OC6A 1WZ2A 2CQKA 4XRMA 3P7NA 1O3RA 2W7NA 2E36A 1S9HA 1FTTA 1FBUA 2R5YA 3LSPA 2NVUB 1BBYA 1RKTA 4JYKA 2IW5A 2IXSA 3M4OJ 3SHFA 5IT9Z 1DQUA 2K02A 5GPCA 3IKVA 1TZLA 3G1LA 3PM1A 3T8TA 3TP0A 1HLVA 3Q9SA 3A1YA 3M8JA 3CCEI 1TBXA 1FLIA 4CCJA 2E2IJ 1GXPA 4UB8C 1K78A 5DCFA 3HB9A 4HBLA 4I0AA 2VQGA 4H0EA 5AIQA 4G7HF 1YX3A 3JCUC 2WAQA 2VOPA 2XAJA 5J3LA 1T39A 1CGPA 4I6ZA 4HQMA 5F08A 3HEFA 3CC4I 4RAYA 3NAUA 3G3ZA 2Y0SA 3Q9VA 1HW1A 5HNFA 1X1AA 1MD0A 2ZSIB 3U1DA 2W82A 4AIJA 1WVRA 4CYDA 3CUOA 4UB6C 3L7WA 3LSHA 2KZGA 3G2BA 4AIDA 3S8PA 2MLGA 5L3CA 2V9VA 3GO5A 1PVEA 1DUXC 3BJOA 3JR9A 3HRMA 1X1CA 1LVKA 5ICCA 3BOQA 2E7XA 3JRFA 2L7FP 3HSEA 4F55A 1W5SA 3WTWC 1SFEA 1XDSA 5FKNA 1KA8A 1YG2A 4DW6A 1CQTA 3BR0A 3FXKA 1O3SA 1MMDA 3HZJA 3W6JB 1R6RA 1TNTA 1YJ9I 3BROA 1FC3A 3KZIC 5FLXZ 2HPMA 1QPMA 4IRIA 2K9NA 2OQGA 1RIOH 1R36A 2RC4A 4BAYA 5EF6A 1AU7A 1LFUP 3CF2A 1RC9A 1SMYF 3WHBA 5IP7J 1R71A 5K5QA 1UFMA 2MLKA 3MEXA 5F0HA 1F5TA 3K1MA 4ZYDA 2LRDA 2VL8A 2Z33A 4A3DJ 1SD6A 1U5TC 1FX7A 1FY7A 3SDBA 1IF1A 1GDTA 2HVRA 2YSRA 2RNJA 4M71A 3GTMJ 2H8WA 3OL4A 2STTA 1Z7LA 2BHYA 3M8FA 4RAZA 1JJ8C 2UV1A 3ASOH 4N0BA 4DYRA 2LKXA 4NBQA 4TV7A 4YIIA 1JJ6C 1ZLKA 5F0FA 1T33A 3QU6A 4KUMA 2JVHA 2ISYA 3GFMA 2W00A 3IL2A 2F5VA 4D5FA 3K70D 1VQ7I 4L9NA 3LSKA 2O5RA 5LGTA 2XRNA 3GX4X 2Z1DA 2IEKA 1P9QC 1WPKA 1X3UA 4G9YA 4PK4A 1P4WA 1ZYRF 5FRMA 3GLXA 1WKMA 2WBMA 2GXGA 2K4BA 1HW5A 3GW2A 2N8GA 3HIFA 4GO1A 5LEJA 5HDKA 2F2EA 1JXSA 4HOBA 1NTCA 1WRJA 2JZYA 4XM3A 5K5RA 4HX4A 1FYLA 1MBFA 1I1GA 2STWA 3BCBA 1N77A 2X6YA 2DA1A 4P5OA 1FYKA 3O8GA 3H35A 3E6CC 2MC3A 2DO7A 2KIQA 4XL9A 3IKTA 5J40A 3Q0WA 1Z1DA 3S3OA 3I55I 5FKOA 3FBNB 2GZWA 3CCQI 2DU9A 2M9HA 3ZQFA 1T0FA 2ZNYA 1AA7A 2EFWA 2ELJA 1LEBA 3PQJA 4BDZA 1K6OA 1SD5A 2XGXA 2M4GA 3OV8A 2EQRA 4FTHA 3DP7A 2RQPA 4JOMA 2NVTJ 1VQ9I 1RETA 3E6BA 2A6TA 2LREA 1I50J 2MD5A 2VKVA 1H89C 1BIAA 3OYHA 1T6SA 1PUFB 2DTRA 1ACIA 2YUSA 1MBKA 1IAWA 1Q1VA 2Q2EA 1U6GA 2DA2A 2FEZA 2ZCWA 1T95A 3H92A 2DMNA 2ME6A 3OSFA 3HDDA 2IA0A 1DP3A 3I56I 3JREA 2I10A 4QPQA 3HKZA 3QP6A 4I99C 1MJ9A 4OINF 3J80Z 2ADUA 1RNLA 2ZJQF 3TDZC 4XK4A 2O0YA 4L5JA 5LGNA 2ZMEB 1H9GA 4U0WA 1D8KA 1J59A 2JTVA 2HFHA 3KYDB 1OMIA 4ZYEA 5HNHA 1WI9A 1QVTA 2DW4A 1OCOH 5ICGA 4PFPA 1RR8C 2WA0A 1HKQA 2DA6A 2F6CA 1FJLA 4BE1A 2IP2A 5FFZA 5ILUA 2ZJPF 1NK3P 3J7AO 2XHKA 3GWZA 2PQ8A 4DZJA 5E8GA 1KONA 1KQ0A 5HODA 3S15J 1F43A 1B59A 3RPUD 3CTAA 4G6TB 5FO5A 3MFKA 3K4NA 4GFBA 3M8EA 2L7ZA 4NC7A 5E3MA 3TL4X 2QYOA 1UMQA 1HSJA 4MTEA 1W0TA 1BN5A 2CFOA 1VQOI 4UY8I 2VBWA 3KZYA 4R79A 3D5RC 4BY7J 3OR2C 4NB5A 4ZYHA 1B72B 3KP4A 1ZARA 2FF4A 3W6KB 3JRBA 4JQFA 2JJ7A 2QBYA 1SFXA 1EH8A 2FBKA 1Z21A 3FKJA 4XLCA 3RKQA 1I1SA 1OQYA 2K86A 2Z99A 2LBFB 2CMPA 1Z0XA 3UR3C 2LMDA 3E6MA 3QPTA 3OS0A 1DPUA 1XGOA 4D0PA 4HZFA 3CJTB 4MHGA 4BXXJ 5BMZA 1G4DA 4J00A 3GBGA 4C3JJ 2M87A 3VWBA 3BR5A 2E1MC 1ZG3A 1Y1VJ 2EPFA 1LDKB 1BI1A 4I76A 1HA8A 2DJNA 1JTYA 4AYBA 1EF4A 1T08B 2L9RA 3CCRI 5EEGA 3I0TA 5E1WA 4N4OB 4UUVA 4D9JA 1BC8C 1D0XA 3OIQA 2Z9OA 1UJ8A 3HSFA 2LSOA 1SVOA 4V2FA 2JA5J 3GTGJ 5CKTA 2ZSHB 3FWEA 2MD0A 4A0YA 3LSRA 3I3LA 2M8EA 4EMSA 1A6QA 4AIKA 1KYWA 3BZ6A 4KFCA 1SVLA 3ZN1A 1OPCA 3QYFA 1MH4A 5AIPA 3ZPLA 3HSRA 2EK5A 3SQNA 4F92B 2NOGA 2VBZA 3HJEA 5CVVA 3QYEA 5HDGA 2Y2ZA 4A5NA 2HTJA 3HXLA 3MQ0A 3ROUA 3RTRA 1O7LA 4I2OA 2JPBA 4Y4RA 5CQGA 1SC7A 2ZMEA 3BP8A 2ETHA 3VFZA 5HVQC 2B7EA 4OIRF 2FNPA 4KJZA 4E4HA 3H5NA 1X4PA 4X1EA 1K78B 1LVAA 3CDIA 3LQQA 2FX0A 1RUNA 3RPUA 4KA4A 5FD6A 2KIUA 1S6LA 5FFXA 4G12A 2FXAA 2BW3B 3TDUC 4CZCA 3CCSI 4IOCF 3CUQB 4QLCU 2CRGA 3QU3A 2P4WA 3BR1A 3KETA 2ME0A 3HM5A 5KAIC 1U9OA 3DLAA 1D5YA 3S2WA 2NOJB 4YIRX 5LFAA 1BOAA 3CMAI 2M1BA 4EVIA 1XSXA 1DDNA 2XSJC 1NHAA 3E6DA 3K69A 2BGCA 1Y1WJ 1JKPC 1QHHD 3VODA 1NH3A 2IPQX 1TLHB 2H8RA 2FBHA 4NUBA 3TOBA 4HNUA 1R1UA 1KGSA 3KEOA 4JX5A 2M34A 4U0VA 1A35A 2W85A 1R5HA 5F1RA 4B3XA 1QNTA 4B3AA 2HEOA 3W2VA 3K9TA 2K3FA 3NWTA 1Z7UA 3SYTA 2AXTC 2QBYB 1OCPA 2Y48A 1HDPA 4EJOA 3ABUA 2NVYJ 4LFUA 5ED4A 1WQ2A 1K6YA 2DFHA 1W7PA 2K85A 2LKPA 1HQCA 3IV5A 4XKWA 5IPAA 3HPGA 2M7BA 3M1CA 1WSUA 1S5LC 1MMSA 4B43A 4YFKF 1DGRM 2VLAA 4I7HA 1RR7A 4EQQA 3S1MJ 2VT2A 1YW8A 1L3LA 2M0CA 1UELB 5FLXK 1LDJA 4EV0A 3PSIA 4WX9A 4G7ZF 3K4LA 4A69C 1LJ9A 3CMYA 4E70A 3KEYA 4FE4A 1DPRA 1G59A 1ZRDA 5BPIA 2L54A 3WE2A 1IN5A 3LSMA 3RPQA 2X1EA 5GTIC 3S14J 3F8CA 4II3A 5KCMA 4EM2A 1A5JA 4HAMA 4ENMA 5B5EC 3PO3J 3HOUJ 2R7DA 4E7SA 1R5ID 2QKMB 4XLNF 3LAJA 2RDPA 4PFOA 2HI3A 4A3FJ 3AL0B 2P5KA 2XPVA 3JRDA 3BPXA 3KZZA 5EG0B 3LNQA 1UG2A 1IZ1A 1MGTA 4JBAA 2L2OA 2H1LA 3IWZA 4PSWA 3H5AA 4CGZA 4RGXA 4IHTA 3NRVA 3A03A 5DCMB 4DGWB 4EJUA 1QZYA 2QM3A 3F6OA 2V6CA 4LG0B 4KIFA 2GIZA 4WXDA 3LMMA 4A3MJ 2HVSA 4ZDPA 4XRSG 2GWRA 5FKLA 1GUUA 1KU2A 4XN3A 3WHCA 3NEUA 4M9SA 3IH4A 2CS3A 4HDUA 4IHWA 3TEDA 3BQZA 4G7OF 3OS2A 3J7YJ 1OISA 1WJBA 1HSTA 4S04A 2HDWA 3E3VA 3DXJF 1Z3YA 1J7KA 2M8GX 2FA5A 1J2XA 4PJNA 2GLOA 3JRCA 2CYYA 2XAGA 3IAS2 1Q1HA 3ZQIA 4DYCA 1LE8B 2BY3A 2LLKA 2DT7B 3SEQA 3RI4A 1MSFC 3V7SA 1VQ8I 4BL0B 4YFNF 4BQNA 2X85A 1SAUA 2HGCA 5FRNA 2P7VB 4U7DA 3V8LA 1ZGAA 2CQ7A 2DMQA 4U88A 4B4CA 4HYEA 4BGDA 2VBYA 1V5EA 3BG5A 1R7JA 2GM4A 1MH3A 3R0AA 4GYGA 4ETSA 4YG2F 5D5VB 1KU9A 4BKXA 1Z9CA 1LDDA 3K4MA 2Z5UA 3QQAA 1USSA 2ZFUA 1OJLA 2X1CA 2CUZA 2DA4A 2R7ZJ 2AXLA 2VBXA 2X6WA 3K6GA 1E2XA 4HNTA 2LF7A 4CUGA 5J8FA 1TC3C 3WG9A 5H6QA 1ITYA 3HRTA 2VN2A 4WK8F 2GXBA 3BG6A 4QIWN 2XKPA 1R22A 2MH9A 3PQKA 2EWNA 4IQJA 1YS7A 3OYNA 5J1RA 4PCQA 1MJBA 4FX0A 2MFZA 1W5TA 2F48A 2W57A 5E18F 3P5JA 4MIMA 4CH7A 1YLFA 3GZ5A 4MEYF 2J5PA 3RDIA 1IXCA 1GV2A 4AU7A 3B6AA 3ISPA 4RB1A 2HQ5A 3CDLA 3OOPA 4E7IA 4A3KJ 3MZHA 1U78A 2J5OA 2X4HA 2Y0MA 2B0LA 3KP7A 3BG9A 5IOYA 2XC7A 2C6YA 4GDFA 3F8FA 5EEHA 1SD7A 3FX3A 1XCVA 3I59A 3WODF 3PIOF 1XMAA 4X0GA 1C0WA 2FNAA 1ZR2A 2DFIA 2X1DA 5FROA 2HOEA 2R7FA 1V4RA 5M3FJ 2L9SA 5B3SH 4LG3A 3FXMA 1IC8A 2DMPA 3PO2J 1Y39A 2FJ1A 4A6DA 3LL7A 2V7FA 2LD5A 1E17A 1MBEA 2NS7A 4XLHA 1KYZA 3R6SA 3DBHB 1JT0A 2R3SA 3AG1H 4M6VA 3I4NJ 3OYCA 3TQNA 5IP6A 3DEUA 5LRRA 1Y0UA 3GTQJ 2LF8A 4ENKA 1GVDA 3H36A 1YX5A 4BHPA 3PNYA 4CO8A 3C2GA 1ETQA 4FE7A 1A04A 3BT9A 3SXYA 4XQFA 3HUGB 4IF4A 1YTYA 2QKLB 1G6NA 3PIPF 4RBOA 2DT5A 3R4KA 5F64A 4OWRB 2KJBA 4FCYA 3KCCA 4MLOA 2O8XA 4HA8A 2PBIA 3OYAA 4G94A 1ZRCA 2MABA 5BOXA 3F6VA 5TISC 2DA5A 5DV5A 4IOAF 5FGMA 2ICWG 2ZBKA 2YX4A 2JRMA 5F1JA 2FSWA 2KIFA 3CJRB 1LKXA 1ZTRA 2XAUA 3OSGA 4M3FA 3OYJA 3GTJJ 1KZHA 2R92J 5E3OA 1J75A 3DKXA 4I98B 5A2QZ 4C3HJ 2M45A 2VE9A 1BR4A 3ML6A 3HOYJ 4FQGA 2DA7A 3DPLC 3WTTC 2P81A 3G71I 3AG2H 4AYBN 2HKXA 1REPC 3C3WA 2V26A 1R4NB 4QPOA 3BG7A 5FB2A 2XB0X 1I5ZA 3LA2A 3WGGA 2BOLA 3LA3A 3FM5A 4BH9A 1GLNA 4IPAA 4RB2C 3JTGA 4IHVA 3REOA 2DTZA 3BWGA 3S1NJ 5A2QK 5DUIA 1R4MB 1U2WA 5E1XA 3K4BA 4M6YA 3S16J 5JFRA 3H9JA 3RZDJ 2M0MA 1X1PA 1JHFA 3GF2A 3EUKL 2ZXWH 3ULQB 4P1WA 1ETWA 4LK1F 3GTOJ 2ZNZA 4E6KG 3I59B 2K9SA 2LKSA 2BHZA 4LLGF 2LP0A 2M4KA 2UXXA 3EUHC 1XSDA 4ASNA 3P9CA 3IH2A 5J6XA 1RKWA 2NVXJ 2VIXA 3I4PA 5JLWA 5M5WJ 3PUBA 3CJQB 3SJMA 2O7OA 3FK7A 2E1NA 4S0HB 2R0QC 1Y56A 3NQOA 3TP3A 1PUFA 3V4GA 5H20A 3DQVC 4BXFA 3F23A 4A6EA 3N05A 4FETA 4QWQA 2Y9ZA 5HLHA 1FP1D 1WGXA 2VOOA 3C2HA 2D1VA 1T2KA 1EH7A 2VQLA 2HOAA 1RI7A 2OZ6A 4ZTFA 3PUFA 4L0ZB 2PN6A 2L7MP 4HSTA 2VXZA 3AG4H 1B1BA 4DYQA 3OYFA 2FOWA 5DD4A 2D1HA 1OLTA 3G73A 2G9WA 4M74A 2EV5A 4Q4ZF 4D5CA 3FZVA 3DTEA 4RS8A 4EM0B 1VQ6I 4CCLA 2Q2EB 2JSPA 4LB5A 1B72A 3MWMA 5CVIA 2WAQN 1JKOC 1YE9A 4WF2A 1VQ5I 4C30A 4HX8A 2XGCA 4ESFA 2XB5A 2DPUA 1U8BA 4IHSA 3K4KA 2QENA 2IT0A 2YS9A 5CLSA 2EA2A 4D7MA 5L3DA 4RGSA 9ANTA 2VT3A 2D2WA 1BR2A 4JX6A 2MBFA 5E17F 3FMSA 1YHQI 1NK2P 1VQ4I 2G0EA 2KDOA 1P92A 2F5DA 4I02A 3WU2C 4DIQA 4KISA 1PJRA 5K1YA 1MZBA 1R49A 1R00A 2V1XA 2JA7J 3GFLA 2GBYA 2V79A 2GQQA 1LE8A 1F1ZA 2ZJRF 3CUQA 2JUCA 5F27A 1YIOA 1TT0A 1R1TA 4XBFA 2RNGA 3A01A 1SMTA 3BR3A 1O4XA 2OZUA 3H3VK 1VQNI 1R1VA 1X2MA 4BNCA 2CGPA 1BW6A 1A6IA 4NDLA 5M5XJ 1TW3A 4ZYAA 1D0ZA 4CCNA 3BJ6A 5GAHJ 1HKTA 1ONVA 5HDNA 1JKRC 1FSHA 3HHHA 3GFIA 2E60A 2XASA 5JI6A 2HOSA 4ZZDA 2HS5A 3QOEA 5IYCJ 3HRSA 4KT5C 3J81Z 3JRHA 1O7FA 1H0MA 5KK1A 4M3DA 3PL8A 2QZ8A 3KLOA 5D4SA 5EEAA 2CQQA 4GYIA 2VJJA 1IDYA 3HOTA 4IL6C 4BDYA 3BPVA 4OMYA 1IRGA 3OYKA 5E3LA 5E8IA 2HDCA 1W0UA 1D1CA 3JAMZ 3H5RA 5D5XB 3O2PE 1SVMA 2XF7A 3MKYB 2XAQA 1V55H 2KHMA 1QA6A 5F0CA 1T8IA 3MZ8A 3FIWA 4XLAA 3QWLA 1X1DA 4L9TA 3G1OA 2DODA 1T56A 4IHYA 1T98A 2WAEA 1HC8A 2M5WA 4A3GJ 2FQ3A 3A02A 1MIJA 3UNGC 2ELKA 4A3LJ 2P8TA 2IGOA 3BLYA 3FDYA 4HEA2 3CCVI 5DD8A 5IT9K 3DBRB 1A36A 2E1CA 4YIFA 1V3FA 5IY5H 3FXUA 2CU7A 4CXFA 1MDMA 1GHCA 3ZN0A 3M3YJ 1TP4A 2CV1A 3CJNA 4DOZA 2X9DA 1DGWY 4A5MA 4U7BA 3JSPA 1SAXA 2VKHA 5ICEA 3SDGA 5J47A 1WJ5A 4BE2A 1ZR4A 4LIVA 4LB6B 3CMMA 2IS1A 2L9VA 3WGIA 2CFXA 3E97A 2LYCA 3V42A 1BW5A 4MFDA 1FTZA 4ZYGA 1WJAA 1IRZA 2ZXHA 1OYYA 1HBXG 1GXQA 1ON1A 4I09A 3CD6I 1X4OA 5LHGA 2EA4A 3HC7A 1BL0A 2O3FA 2R5YB 4OAYA 3WGHA 2Y75A 3I58A 2ID6A 4WCGA 3RIRA 3H3ZA 3EYYA 2P0WA 4R8HA 3ZMZA 5D8LB 1HKSA 3QPSA 2K40A 2K9LA 4RAFA 4LOCA 2O9LA 1MKMA 4RLFA 3BR2A 3K10A 1G2HA 2LOOA 2L01A 2VB6A 1O3QA 4HQEA 3L2QA 3OY9A 2EFOA 3N97A 3F21A 2AS5F 2XDVA 3E0JB 4NHJA 3O3KA 1EKEA 2IGMA 2IS2A 5HOOA 2DK8A 2VE8A 1X3WB 2X6OA 3S3MA 1W36C 1ETOA 2BY1A 5JVTA 2XRLA 2K9MA 2KZVA 2P5LC 4N9IA 5B66C 1ZHFA 4AUXA 1BI2A 4Y15A 1D1BA 2FE3A 2E2JJ 2W1OA 3WG7H 1XS9A 2XF5A 3C1DA 1IJWC 3MZYA 2NVQJ 3QOPA 3JSOA 2ZXJA 1UG0A 3BG3A 1IDZA 4OU0A 4MTDA 2W25A 3RJPA 2OQRA 1QHGA 1FPQA 3DU6A 3S1QJ 2DOFA 5K7HA 3P9IA 4M3GA 3BTCA 3K2ZA 4ITVA 3CCMI 1MNEA 3CZ6A 2XV4S 2ID3A 1T0FC 1VQLI 1OCCH 2WY8Q 5ICFA 3H0GJ 3KP6A 3TKYA 2LC2A 5TJJA 5JLXA 2UWMA 1K7AA 4C2TA 3HHGA 2V9KA 3F0CA 1B8IB 4B48A 3JAMK 1X2NA 1MSEC 4GGGA 4CA0A 3HTUA 4N4NB 2R7WA 1ORKA 1H8AC 3ZQHA 2MW8A 1I3QJ 3H1CA 4LITA 1MNDA 5M3MJ 3ECHA 2HQAA 2CV0A 2EZIA 2EZHA 3BJAA 2QEXI 2IJLA 3HOWJ 1FSEA 3QP5A 1IO2A 3WTZA 3NARA 3HOZJ 4RDUA 3IUOA 3U21A 3WTUC 2QF7A 2YR2A 3A0BC 2P6SA 4AVZA 2DOEA 3COAC 1FZPB 2K27A 1TWAJ 4F93B 2L3DA 2EIJH 4W1UA 5DEQA 2JUGA 3BTLA 3LOCA 2QSFX 5GPAA 4L9JA 2XROA 4AWXB 1UHSA 1Z6RA 1B9NA 3CDHA 1ETXA 1EH6A 2IGNA 2VXDA 4IHXA 2DOAA 4IQ4A 3MKZA 2DAOA 3WU1B 5CJ9A 3D1NI 4CHUA 3QPHA 1V54H 2K5CA 4Q48A 2H94A 3B73A 4GXOA 1FP2A 3ZMUA 1ZQ3P 3AKZA 5BPDA 2W48A 3B02A 4XN0A 4BQOA 2UUZA 5F6FA 1IN6A 4EATA 2VJ4A 4HV6A 5KVRA 2K4JA 4AIHA 2HPIA 1UAAA 2ZMEC 3K4CA 4QTRA 3I71A 1RZ4A 3H0DA 4P55A 4A3IJ 4BBSJ 1TL8A 5E79C 3L2RA 2QLZA 3ZXSA 2EH3A 3HPHA 4IO9F 1LB2A 5EJCA 2KISA 3OYDA 3F8NA 2F4IA 2CW0F 1YS6A 3W2WA 4BJ6C 1BJZA 5BS6A 5CPRB 3ZQGA 2GA1A 1P2FA 4HF2A 3KX2A 2VJ5A 4DBRA 1OR7A 2E19A 3LFKA 2E1OA 4P9UA 4HV5A 1R58A 1WI3A 4M72A 2QQ8A 2RN7A 2NYXA 2ZB9A 4N9HA 5GP9A 4I01A 3GTPJ 4EGYA 4UUSB 4XOTA 4UV8A 2DI3A 3DU5A 2XSDC 5F04A 3TO7A 2AQFA 1ULYA 3LWFA 1KU7A 4MNUA 5D5UB 2R7OA 3EDPA 5LD2C 1BOBA 2XVCA 3F9KA 1H9TA 3CP2A 2KL4A 3GCMA 3F8BA 1FWZA 2KT0A 2XPUA 4BJ5C 2DDAA 4HNVA 1FOXA 2O6GE 5EGOB 2LBFA 2DYSH 2GOMA 1S72I 2PMHA 3CCYA 3FHNA 1HXDA 2MA3A 2NXNB 1XGMA 2V1NA 3L2VA 4KNYA 3DV8A 3H9QA 2HXOA 5CQEA 3WTSC 4IRGA 2HVQA 3T0YA 2ZKZA 1Y8QB 2E2HJ 5B1AH 4ZJZA 3K1NA 1K4TA 1U0JA 2DDBA 3KP5A 3KYCB 3K2AA 1E3HA 4XORA 4RLQA 1FIAA 1XG1A 4XR6A 2VUMJ 2PMZA 1K61A 1RRJA 2AHQA 4L18B 2BXYA 4JX4A 2B63J 1WWXA 3V7RA 1LUJB 2DMUA 3X2QH 4IVNA 1V5GA 4HRIA 4DNCA 2LG4A 3NWSA 1IUYA 1P4XA 2R7VA 1HDDC 1U3EM 1XN7A 1VTNC 4XRSA 4HPQA 3L9FA 5DCMA 1QPIA 3S32A 1ENHA 2R7TA 2VASA 1X58A 3RQ4A 1TWGJ 1LFBA 3DWLE 4YFXF 4BU2A 3TGNA 3QRFF 1R9TJ 1IN4A 2E5NA 3DPTA 2HR3A 1WJFA 3GZNB 3ABMH 3JRAA 4CCKA 2PMUA 1MJAA 2JVGA 4PUSA 3F22A 1IG7A 2JPCA 1FOKA 1MDMB 2ZJ2A 2BZTA 2A69F 2IVMA 2K7LA 4HLYA 4U87A 1IV8A 1W5CC 3L09A 4GCVA 3GUDA 4UVCA 4OIQF 2PEXA 4ESBA 1DU6A 3L2UA 2EFQA 2JA2A 4A12A 3QYBA 3SZTA 5M5YJ 3VB2A 2HYJA 1P4AA 1J0RA 3F8MA 1BA5A 4PGGA 2HTSA 4IKFA 3ABTA 2ZO4A 2HYFA 4AC0A 2MGQA 5GAGJ 2YPRA 1XD7A 2X6XA 4UUSA 1LQ1A 4LK0F 2QVOA 2QWWA 3P9KA 1YO5C 4J01A 1VQMI 2JRTA 4NC8A 1K4SA 5E20A 4XKCA 1OFCX 4M9ZA 4BACA 5D4RA 1IRFA 1I3AA 2CW8A 1BI0A 4G8XA 4E7KA 2QSGX 1I6XA 2BVLA 4YEJA 2E7WA 2AO9A 3DTIA 2VODA 5D8KB 3HL2A 3OS1A 2RKHA 2JWTA 4BHCA 3RCOA 1WJDA 3QPLA 2X48A 3HGGA 1ZH5A 2G7HA 4DJAA 5C3EJ 1XDUA 3FKIJ 2MH2A 2DT6A 2Y9YA 4W97A 4BEHA 2XIGA 1E3OC 1SFOJ 2GAUA 3R60A 1BIBA 2QQAA 3U1KA 5HS9A 2RQQA 1Y6IA 3IAM2 2HDDA 2FD5A 3S2HJ 3WTYC 4PJLA 2HNHA 2BV6A 2IS6A 2EINH 2XUBA 3PJRA 4MGRA 1G3TA 1MNMC 2ZFWA 2OCCH 3U9GA 1STZA 3HUGA 1QQIA 4Y33A 1ZG5A 3AL0C 3F72A 5JHFA 1UHWA 1LPQA 1B9MA 2KMUA 2W4SA 3CCJI 2K3PA 1L0OC 3DLLF 1EV7A 2Q0OA 2RREA 3GEZA 3ZR8X 3JRGA 4BQAA 1S29A 5ILVA 5L3EA 2JQ7A 4LLNA 4L9VA 3W6VA 3PSFA 1XMXA 4FHTA 1UB9A 2FRHA 1HCRA 3PFYA 4LGWA 2ACJA 2HWVA 2HZTA 3BC8A 1ZGJA 3CCLI 1LFPA 4HF0A 2IS4A 3E5XA 1QGPA 3IP4B 3BY6A 3HYIA 1N78A 1GV5A 3HBLA 2Q8KA 2IRFG 3RSNA 3HOSA 4IX7A 3K1PA 1UHMA 5AONA 3WU0A 5EDNA 5CVJA 2X51A 4ZTJA 2RGVA 2A05A 3LQRA 3ABKH 2D45A 1YW7A 1PUEE 2DXIA 3AG3H 3AAFA 2M3AA 2BBYA 2H1KA 3O8HA 3A2KA 3DFGA 3FHZA 3M07A 2XF6A 2P6TA 1Z91A 3PNVA 3S17J 4Z6YA 3FBIB 2PJRB 3CC2I 3BR6A 1XTAA 4ZZLA 2HYGD 4S05A 1XCBA 4A93J 3EYIA 1NG7A 3GZ6A 3BQYA 1J5YA 2DLLA 2LTPA 3GMEA 2L4AA 5ERIA 4WXHA 1F36A 3RQIA 1Z6TA 1X1BA 3IC7A 2NRAC 3GYHX 1IXSB 3E5QA 3KE2A 2JK3A 2EZLA 1BJAA 3OYBA 2DBBA 1K83J 2E35A 3CESA 4Q47A 3BTIA 1N75A 1HF0A 4R1HA 3MKWB 1P7IA 4RA2A 3SEZA 3CMEI 2CQNA 4B47A 5DTDA 1VF9A 2CO5A 1Z3XA 4EJVA 1S3JA 2XKOA 3BDDA 4G6QA 5C4XJ 2JA8J 1GVJA 3KFWX 2WTEA 1Z05A 1I39A 3L2WA 2A5WA 1XX5A 2Y31A 1QBJA 4UUTA 2QSHX 1XSVA 3VYUB 3C7JA 4XNFA 3DEWA 4Z2YA 4EJWA 4BS9A 2XGDA 3JTHA 1AKHA 1TWHJ 4EJTA 1WH5A 1KU3A 1XB4A 1VI0A 5IOZA 4UVBA 4M3BA 3BZKA 5K5OA 3J7ZI 1RPWA 5IYBJ 3S1RJ 3OYMA 1F4KA 2PLYA 4FX4A 3PNTA 4Y7NJ 4E7ZA 4E7LA 2LY9A 2CV2A 1ETVA 3MD2A 4Y13A 2I8DA 2OA4A 1PP8F 2O8KA 2DK5A 2KPMA 2A5YB 2LDUA 2L9NA 2EJRA 3FXOA 4K2EA 1AWCA 4A3JJ 1YFHA 4O5VA 3C18A 3RKYA 5HS7A 3VSLA 3DEEA 3LSTA 3K70C 4MFEA 1VNDA 2L0KA 4ON0A 3KPHA 3KEQA 3A01B 2P5VA 4BYYA 5C4JJ 3E1SA 3Q0VA 3ZMSA 5EGOA 1H88C 3G1MA 3SFZA 3F3XA 2WWYA 1WFXA 2XAHA 2M7AA 1JHHA 4WWCA 1ZELA 3OOUA 1JTXA 1YQAA 5LLQA 4J19A 2MC4A 2FQ4A 4II2A 5DM7F 2F5EA 3RYPA 2V4JC 2LH9A 1ETYA 2FUG2 1W7PB 3DBLB 5FD5A 2XPWA 3E7LA 3K7AJ 1B4AA 2ECCA 1ZLJA 4FASD 1IGNA 2R5ZB 2MSYA 2KRHA 5DDGA 3SFIA 2H09A 3ZGKA 5E1ZB 4FISA 6PAXA 3QAHA 2P7CB 3BZCA 3FXLA 2NS8A 1CF7B 1U9NA 2RVCA 3FISA 4UVAA 3CLQA 4XKBA 2Q1ZB 2DQLA 2PG4A 2IAIA 2EV0A 3CQZJ 3VYSB 1OYWA 2WB1N 2OF7A 1ZN2A 3FM3A 2CQXA 2DA3A 2L5QA 4XLEA 4PJMA 4BHBA 1FNNA 1WCMJ 4IEJA 3KP2A 2JA6J 1BC7C 3M9AA 2CG4A 4CDGA 4KIBA 2DJIA 3VEPA 2NNYA 2PMZN 2E34A 4BUPA 1S7OA 1DU0A 2IA1A 2IGKA 2KDZA 1XGNA 3WTXC 1WJCA 3RKWA 2H6BA 3ZRGA 3CP8A 4F7ZA 3L2CA 2HKOA 4A2UA 2KP6A 2XGEA 2A6EF 3MVPA 4ZC3A 1USTA 2KQRA 2ECBA 1ZGWA 2OCEA 3ZP5A 4ANJA 5LEKA 3WTVC 1JI8A 3S3NA 3S93A 3T8RA 1YOVB 5GAEJ 3Q0UA 1OYIA 1TWCJ 5CYVA 2WB1A 4CCOA 1E0EA 1U5TB 5IYDJ 5IP9J 3G6EI 1IV6A 3GXOA 3DPUA 1JT6A 1VQPI 2R7UA 4NQWB 3EETA 2QUFA 4LLLA 2VPLA 3A4CA 3ZOBA 4Y3OA 5J1UA 1OCRH 2OAZA 2BY0A 4H4KC 2Z2SB 4DBQA 4V19K 4BXUA 4P96A 1QRYA 3U2RA 4O6JA 4BJTA 2OPTA 3ELKA 2VONA 2EZKA 2WV0A 3LSIA 3SZGA 5H6RA 5EYRA 2EILH 3Q3SA 4M9XA 4E7JA 4O3MA 3H3UA 2Z3YA 4M3EA 4XIDA 1POGA 1ETKA 2BVMA 3O6BB 2ESHA 2JSCA 2F4OB 2VPRA 1MMAA 2CUFA 3FXQA 4LG0A 5IT3A 4U0YA 2L4MA 2BYVE 3FMQA 4HX7A 5EZHA 1XC5A 4CZZA 2VQHA 5JR3A 3J80K 2M30A 4RM3A 3Q5FA 1YI2I 1D5VA 4BY1J 1JE8A 2KRFA 4YELA 5GADJ 1KQ8A 1IN8A 4ZDOA 2DQRA 4HG2A 3WE3A 2LY2A 1OKRA 1JUPA 5DYMA 4ENNA 1JGGA 4OOIA 4XLFA 2KJCA 1G3SA 2MG4A 3B6CA 3IWFA 2ISZA 1XPXA 1YW9A 1FMVA 3OIOA 5BNGA 2V6EA 3D5SC 2DPDA 3I53A 2WAFA 1K79A 2EFNA 2PJPA 3TBIA 2WC2A 4B44A 1FMWA 1R5GA 5LHIA 4A3CJ 1QZEA 1I6HJ 3CO7C 2M2EA 3OYEA 1IN7A 4LJZF 1G3YA 4EEFG 4D1QA 1FIPA 1O57A 1SFUA 3T1BA 4A3BJ 2A3SA 1TQPA 2TDXA 4NNJA 3A0HC 2LVSA 2BW3A 2DCEA 4HW0A 3KLNA 1IW7F 3I54A 2VQCA 1A31A 2YU3A 3R0JA 3K0LA 3E5UA 5FLMJ 1MMNA 5DUKA 4XONA 2GXAA 3M7GA 2QQBA 2PJRA 5L3BA 1O3TA 2LY1A 1YRNA 3VSKA 4BBRJ 2E71A 1ODDA 3IRQA 3UKGA 3FK6A 1MBJA 3V8KA 2A61A 2COMA 4PGHA 2R7RA 2RV8A 2G7UA 4XRFA 1FT9A 5TGTA 4XSZF 2EV6A 4CYCB 1BM9A 3TO6A 4C3IJ 2A68F 3GVAA 3IH3A 1EJ9A 4UV9A 3JW4A 4Y17A 2OJED 1VFCA 1FBSA 2UZKA 2AQEA 1FOWA 3HG9A 1SANA 3KIOA 2VKEA 4F3QA 1AKHB 1B6AA 2GOXB 2BEOA 1ZK8A 5K7FA 1MMGA 2Y0SN 1QVUA 3RZOJ 2OD5A 3I4MJ 4BQQA 3T5XA 2LFBA 5HLGA 2X0LA 5LGUA 2R4GA 5FKKA 2V1DA 2FMYA 2DYRH 5KNLA 2IA2A 3MN2A 5HLIA 1FBQA 4C2MJ 1MBGA 3OL3A 2EB7A 1YJNI 1FYMA 1HOMA 2GIVA 5CVUA 4IZZA 4IJAA 4OIOF 3DKYA 3W3CA 1IUFA 1NG6A 2OV7A 4EGZA 2QGUA 5KAFC 1TTYA 4B8XA 3RYRA 2BE5F 2CWEA 3QODA 4XICA 1PDNC 3OYIA 1T38A 3VDXA 4E7HA 1S7AA 2ZC2A 2VJIA 3FMRA 3OYGA 1TWFJ 3EPZA 1QO0D 3S2DJ 2NAZA 2OU2A 1PYVA 1MBHA 2IBDA 4NC6A 4EM1A 2E1MB 2HOTA 1APLC 2WY7Q 3D5LA 4BE0A 5EZGA 4RB3C 3ONQA 4CICA 2GA2A 1W7PD 2PFBA 5HS8A 3DCFA 2HZDA 2F4MB 3CC7I 1YRNB 3KP3A 3CO6C 4UXNA 4KYWA 2ESNA 3GFJA 2CUJA 4RMNA 3K4JA 1D0YA 5H2FC 1TQMA 4JK1X 1P7JA 2HXIA 2K9QA 4ENJA 3FXRA 5JHUA 1CF7A 1W1WE 3R61A 1IXRC 1G8XA 3HGYA 2CH0A 4GRIA 4UNOA 1JKQC 1OCZH 2OTJI 3G4SI 5E3NA 5HLTA 1IRXA 4AVPA 2YX7A 2PI0A 4L0YB 3IHUA 4LD5A 2KLOA 3TO9A 4OAZA 2TRTA 1YIJI 1PP7U 4RM2A 1SD4A 4OIPF 1LNWA 3HRUA 4PZJA 3OWTA 1V5FA 4V2GA 4B1RA 3ZQLA 3OIPA 2W24A 4HSRA 1ZKGA 3VOEA 1BI3A 4KITB 1FEXA 1RESA 4RAGA 2KIMA 2H6CA 2Z16A 4DZPA 4RGUA 4CYCA 2EFPA 1D3YA 3OYLA 2EBIA 2PX9A 1EA3A 5LRSA 1ZRFA 2L02A 1UZCA 5D6FA 2WADA 4PJ0C 1RUOA 4XMYA 4XOPA 1Z77A 4OMZA 2BY2A 4KMFA 5CVRA 2UXNA 4PDKA 4JP0A 3GLLA 5BQTA 2R7QA 5FLVA 3GTLJ 3OMYA 4DQ2A 2HQNA 4XKVA 3I5UA 3LA7A 3MAJA 4B09A 1I27A 2H27A 2VC0A 2LNBA 1TQIA 3BTJA 5FKMA 2Y69H 1AHDP 1WH7A 4KMUX 2ZXIA 2ELHA 2QA4I 4C2UA 4ZDLA
chains in the Genus database with same CATH topology
3FF5A 4Q5SF 3J81K 4UHTA 1S8NA 2CSOA 4FT8A 1JGSA 1P6RA 1KQ9A 4NQWA 3D0SA 1QZZA 3ZQ7A 4A0XA 1U5TA 4HF1A 3V8JA 3EUHA 1ZG1A 4KDPA 4M73A 4IXAA 3SZPA 1G3WA 1HW2A 2VC1A 1ZREA 1U8RA 2A6HF 5L3FA 1UCRA 5TRDA 2W84A 3L00A 2NNNA 1XMKA 4HLXA 3DKWA 4P9FA 3RKXA 2FOKA 4RB0A 3PFIA 4KICA 5LHHA 3V7CA 4L5IA 1ZAOA 3ZMVA 1D8JA 1YYVA 4IRHA 2V1UA 3ZMTA 5ILSA 1R23A 4XLPF 1TNSA 3N4MA 2XAFA 5D5WB 1TW2A 2FMLA 4ZH4F 3TOAA 1F9NA 2F5FA 2FBIA 3HTSB 4I0BA 2JT1A 4MEXF 2FU4A 2O03A 4A0ZA 4RGRA 4KIGA 1LEAA 3EQLF 4KN7X 5LBQA 3I64A 2NS0A 1AOYA 3ECOA 4MQ9F 4KN4X 1DP7P 2HQRA 1ON2A 4XSXF 2A07F 5D6EA 3ERED 2QQ9A 3IRRA 2O61A 3ZMDA 4LMYA 4MQVA 2KKOA 3CUQC 3MCZA 4WXCA 4AD9A 3DF8A 4G6DA 3M1EA 5J8CA 5L3GA 1W4MA 2F5CA 4HDVA 1XGSA 4ESJA 4M6XA 2OBPA 1J9IA 3LAPA 3CLOA 2CQKA 3P7NA 1O3RA 1FBUA 1BBYA 2IW5A 3SHFA 5IT9Z 2K02A 3IKVA 3T8TA 3Q9SA 1TBXA 1FLIA 1GXPA 1K78A 5DCFA 4HBLA 4I0AA 4H0EA 5AIQA 4G7HF 2VOPA 2XAJA 1T39A 1CGPA 4HQMA 4RAYA 3G3ZA 3Q9VA 1HW1A 1MD0A 3U1DA 4AIJA 4CYDA 3CUOA 3L7WA 2MLGA 5L3CA 2V9VA 3GO5A 1DUXC 3BJOA 3HRMA 5ICCA 3BOQA 2E7XA 3HSEA 1W5SA 3WTWC 1SFEA 1XDSA 1KA8A 1YG2A 1O3SA 3W6JB 1TNTA 3BROA 1FC3A 5FLXZ 1QPMA 4IRIA 2OQGA 1RIOH 1R36A 2RC4A 4BAYA 1SMYF 5K5QA 1UFMA 2MLKA 3MEXA 1F5TA 3K1MA 4ZYDA 2Z33A 1SD6A 1U5TC 1FX7A 1FY7A 1IF1A 2YSRA 2RNJA 4M71A 2STTA 4RAZA 3M8FA 4N0BA 4TV7A 4YIIA 1ZLKA 3QU6A 4KUMA 2ISYA 3GFMA 3IL2A 4L9NA 5LGTA 2XRNA 3GX4X 1X3UA 4G9YA 1P4WA 1ZYRF 1WKMA 3GLXA 2GXGA 2K4BA 1HW5A 3GW2A 3HIFA 4GO1A 5LEJA 5HDKA 2F2EA 1JXSA 4HOBA 1WRJA 2JZYA 5K5RA 1FYLA 4HX4A 1I1GA 2STWA 4P5OA 1FYKA 3E6CC 2MC3A 2DO7A 3IKTA 1Z1DA 2GZWA 2DU9A 1T0FA 2ZNYA 2EFWA 1LEBA 3PQJA 1K6OA 1SD5A 2XGXA 3OV8A 3DP7A 2RQPA 3E6BA 2MD5A 1BIAA 1T6SA 2DTRA 1IAWA 2Q2EA 1U6GA 2FEZA 2ZCWA 3H92A 2IA0A 3QP6A 4OINF 1MJ9A 3J80Z 2ADUA 1RNLA 3TDZC 2O0YA 4L5JA 5LGNA 2ZMEB 1H9GA 4U0WA 1D8KA 1J59A 2JTVA 2HFHA 1OMIA 4ZYEA 1WI9A 2DW4A 5ICGA 1HKQA 2IP2A 5ILUA 5FFZA 3J7AO 2XHKA 2PQ8A 3GWZA 5E8GA 1KQ0A 1B59A 3CTAA 3MFKA 5FO5A 3M8EA 2QYOA 1HSJA 4MTEA 1BN5A 2VBWA 3KZYA 4R79A 4NB5A 4ZYHA 3KP4A 1ZARA 2FF4A 3W6KB 4JQFA 2QBYA 1SFXA 1EH8A 2FBKA 1I1SA 2K86A 2Z99A 3E6MA 3QPTA 1DPUA 1XGOA 4D0PA 4HZFA 4MHGA 5BMZA 1G4DA 2M87A 1ZG3A 1LDKB 1BI1A 5EEGA 3I0TA 5E1WA 4UUVA 1BC8C 2Z9OA 3HSFA 2LSOA 3FWEA 4A0YA 2M8EA 4EMSA 4AIKA 1KYWA 3BZ6A 4KFCA 3ZN1A 1OPCA 5AIPA 3ZPLA 3HSRA 2EK5A 3SQNA 2VBZA 5HDGA 5CVVA 4A5NA 2HTJA 3MQ0A 3ROUA 3RTRA 1O7LA 4I2OA 2JPBA 2ZMEA 3BP8A 2ETHA 3VFZA 5HVQC 4OIRF 2FNPA 1K78B 1LVAA 3LQQA 1RUNA 3RPUA 4KA4A 5FD6A 2KIUA 1S6LA 5FFXA 2FXAA 3TDUC 3CUQB 4QLCU 3QU3A 2P4WA 3KETA 3S2WA 1BOAA 2M1BA 4EVIA 1XSXA 1DDNA 1NHAA 3E6DA 3K69A 2BGCA 3VODA 2IPQX 1TLHB 2FBHA 3TOBA 1R1UA 1KGSA 3KEOA 4U0VA 2W85A 1R5HA 5F1RA 2HEOA 1QNTA 3K9TA 1Z7UA 2QBYB 2Y48A 4EJOA 3ABUA 4LFUA 5ED4A 1WQ2A 1W7PA 2LKPA 1HQCA 1WSUA 4YFKF 4I7HA 4EQQA 2VT2A 1YW8A 1L3LA 5FLXK 1LDJA 4EV0A 4WX9A 4G7ZF 1LJ9A 4E70A 1ZRDA 1DPRA 5BPIA 2L54A 3WE2A 1IN5A 3RPQA 3F8CA 4EM2A 4HAMA 4ENMA 2R7DA 4XLNF 3LAJA 2RDPA 2P5KA 3BPXA 3KZZA 1IZ1A 1MGTA 4JBAA 3IWZA 4CGZA 4RGXA 4IHTA 3NRVA 5DCMB 4EJUA 1QZYA 2QM3A 3F6OA 2V6CA 4LG0B 4KIFA 4WXDA 2GWRA 1KU2A 3NEUA 4M9SA 4HDUA 4G7OF 1HSTA 4S04A 3E3VA 3DXJF 1J7KA 2FA5A 1J2XA 2CYYA 2XAGA 1Q1HA 3RI4A 3V7SA 4YFNF 2HGCA 2P7VB 4U7DA 3V8LA 1ZGAA 4U88A 4HYEA 2VBYA 1R7JA 3R0AA 4GYGA 4ETSA 4YG2F 5D5VB 1KU9A 1Z9CA 1LDDA 2Z5UA 1USSA 2AXLA 2VBXA 1E2XA 2LF7A 5J8FA 3WG9A 5H6QA 3HRTA 2VN2A 4WK8F 2GXBA 2XKPA 1R22A 2MH9A 3PQKA 2EWNA 1YS7A 4PCQA 1MJBA 4FX0A 1W5TA 2W57A 5E18F 1YLFA 3GZ5A 4MEYF 2J5PA 3RDIA 1IXCA 3ISPA 4RB1A 3MZHA 3OOPA 1U78A 2J5OA 2X4HA 2Y0MA 2B0LA 3KP7A 2C6YA 3F8FA 5EEHA 1SD7A 3FX3A 1XCVA 3I59A 3WODF 1C0WA 1XMAA 2FNAA 2DFIA 2HOEA 2R7FA 1V4RA 4A6DA 1E17A 1KYZA 3R6SA 2R3SA 3TQNA 3DEUA 5LRRA 1Y0UA 2LF8A 4ENKA 4BHPA 4CO8A 1A04A 3SXYA 4IF4A 1YTYA 1G6NA 2DT5A 3R4KA 5F64A 2KJBA 3KCCA 2O8XA 4HA8A 2PBIA 4G94A 1ZRCA 5BOXA 3F6VA 5DV5A 5FGMA 2ZBKA 2YX4A 2FSWA 2KIFA 1J75A 4I98B 5A2QZ 2M45A 2VE9A 3ML6A 3WTTC 3DPLC 2HKXA 1REPC 3C3WA 5FB2A 4BH9A 3WGGA 1I5ZA 3LA2A 3LA3A 3FM5A 3JTGA 4IPAA 4RB2C 3REOA 3BWGA 5A2QK 5DUIA 1U2WA 5E1XA 4M6YA 5JFRA 1JHFA 3GF2A 3ULQB 4LK1F 2ZNZA 3I59B 4LLGF 2UXXA 1XSDA 4ASNA 3P9CA 5J6XA 3I4PA 2E1NA 3NQOA 3V4GA 5H20A 3DQVC 3F23A 4A6EA 4QWQA 5HLHA 1FP1D 2VOOA 2D1VA 1T2KA 1EH7A 1RI7A 2OZ6A 4L0ZB 2PN6A 2VXZA 1B1BA 5DD4A 2D1HA 3G73A 2G9WA 4M74A 2EV5A 4Q4ZF 3FZVA 4RS8A 4EM0B 4LB5A 3MWMA 5CVIA 4WF2A 4HX8A 4ESFA 2DPUA 4IHSA 2QENA 2IT0A 5CLSA 2EA2A 5L3DA 4RGSA 2VT3A 2D2WA 2MBFA 5E17F 3FMSA 1P92A 2F5DA 4I02A 5K1YA 1MZBA 1R00A 2V1XA 3GFLA 2V79A 2GQQA 1F1ZA 3CUQA 1YIOA 1R1TA 4XBFA 1SMTA 2OZUA 1R1VA 4BNCA 2CGPA 1TW3A 3BJ6A 1HKTA 1ONVA 5HDNA 1FSHA 3HHHA 3GFIA 2XASA 5JI6A 4ZZDA 2HS5A 3HRSA 4KT5C 3J81Z 1O7FA 1H0MA 5KK1A 2QZ8A 3KLOA 5D4SA 4GYIA 3HOTA 4OMYA 3BPVA 1IRGA 5E8IA 2HDCA 3JAMZ 5D5XB 3O2PE 2XAQA 4L9TA 1T98A 2M5WA 2FQ3A 2P8TA 5IT9K 5DD8A 2E1CA 4YIFA 1V3FA 3FXUA 4CXFA 1MDMA 1GHCA 3ZN0A 3CJNA 4A5MA 4U7BA 3JSPA 1SAXA 5ICEA 4LB6B 3WGIA 2CFXA 3E97A 4ZYGA 1OYYA 1HBXG 1GXQA 1ON1A 4I09A 5LHGA 2EA4A 2O3FA 3WGHA 2Y75A 3I58A 4WCGA 3RIRA 3H3ZA 3EYYA 4R8HA 3ZMZA 5D8LB 1HKSA 1MKMA 2L01A 1O3QA 4HQEA 2EFOA 3N97A 3F21A 2AS5F 4NHJA 3O3KA 5HOOA 2DK8A 2VE8A 5JVTA 2P5LC 4N9IA 1ZHFA 1BI2A 4Y15A 2FE3A 3C1DA 3MZYA 3QOPA 3JSOA 2ZXJA 4OU0A 4MTDA 2W25A 3RJPA 2OQRA 1FPQA 3P9IA 3K2ZA 2XV4S 5ICFA 3KP6A 3TKYA 5TJJA 2UWMA 1K7AA 3HHGA 3JAMK 4GGGA 3HTUA 3ECHA 3BJAA 2IJLA 1FSEA 3QP5A 3WTZA 3WTUC 2YR2A 2P6SA 3COAC 1FZPB 2K27A 2L3DA 5DEQA 4L9JA 2XROA 4AWXB 1Z6RA 1B9NA 3CDHA 1EH6A 2DAOA 3WU1B 5CJ9A 4CHUA 3QPHA 4Q48A 2H94A 3B73A 4GXOA 1FP2A 3ZMUA 5BPDA 3B02A 5F6FA 1IN6A 4HV6A 5KVRA 2K4JA 4AIHA 3I71A 1RZ4A 4P55A 2QLZA 1LB2A 3F8NA 2CW0F 1YS6A 5BS6A 2GA1A 1P2FA 4HF2A 1OR7A 3LFKA 4P9UA 4HV5A 1R58A 4M72A 2RN7A 2NYXA 4N9HA 4I01A 4EGYA 4UV8A 2DI3A 3TO7A 1ULYA 3LWFA 1KU7A 4MNUA 5D5UB 3EDPA 2XVCA 1H9TA 1FWZA 3F8BA 2O6GE 2PMHA 2MA3A 1HXDA 4KNYA 1XGMA 3DV8A 3WTSC 4IRGA 3T0YA 2ZKZA 3K1NA 3KP5A 4L18B 1WWXA 3V7RA 4IVNA 4DNCA 1IUYA 1P4XA 1U3EM 1XN7A 1VTNC 3L9FA 5DCMA 4YFXF 3TGNA 3QRFF 1IN4A 3DPTA 2HR3A 2PMUA 1MJAA 3F22A 2JPCA 1FOKA 1MDMB 2ZJ2A 2A69F 2IVMA 2K7LA 4HLYA 3L09A 4GCVA 3GUDA 4UVCA 4OIQF 2PEXA 4ESBA 2EFQA 4A12A 3SZTA 3VB2A 1P4AA 1J0RA 3F8MA 4PGGA 2HTSA 3ABTA 2ZO4A 2HYFA 2YPRA 1XD7A 1LQ1A 4LK0F 2QVOA 2QWWA 3P9KA 1YO5C 2JRTA 5E20A 4M9ZA 5D4RA 1IRFA 1BI0A 4G8XA 1I6XA 2E7WA 2VODA 5D8KB 2RKHA 4BHCA 1ZH5A 2G7HA 1XDUA 2MH2A 2XIGA 2GAUA 3R60A 1BIBA 2QQAA 5HS9A 3WTYC 2BV6A 2XUBA 4MGRA 1G3TA 2ZFWA 3U9GA 1STZA 3HUGA 1QQIA 1ZG5A 3F72A 1UHWA 1B9MA 1L0OC 1EV7A 2Q0OA 3GEZA 4BQAA 1S29A 5ILVA 5L3EA 4LLNA 4L9VA 4FHTA 1UB9A 2FRHA 4LGWA 2ACJA 2HWVA 2HZTA 1ZGJA 4HF0A 3E5XA 1QGPA 3BY6A 3HYIA 2Q8KA 2IRFG 3HOSA 3K1PA 1UHMA 3WU0A 5AONA 5CVJA 2RGVA 3LQRA 2D45A 1YW7A 1PUEE 3AAFA 2BBYA 3DFGA 3FHZA 2P6TA 1Z91A 4ZZLA 2HYGD 4S05A 1XCBA 3EYIA 3GZ6A 1J5YA 2DLLA 2L4AA 5ERIA 4WXHA 1Z6TA 3IC7A 2NRAC 3GYHX 1IXSB 3E5QA 3KE2A 1BJAA 2DBBA 4Q47A 4R1HA 2CO5A 4EJVA 1S3JA 2XKOA 3BDDA 4G6QA 1GVJA 3KFWX 2WTEA 1Z05A 1QBJA 1XSVA 3C7JA 4EJWA 4Z2YA 3JTHA 4EJTA 1KU3A 1XB4A 4UVBA 5K5OA 1F4KA 2PLYA 4FX4A 4Y13A 2OA4A 1PP8F 2DK5A 2A5YB 2LDUA 2EJRA 4K2EA 1AWCA 1YFHA 4O5VA 3C18A 3RKYA 5HS7A 3LSTA 4ON0A 3KEQA 2P5VA 4BYYA 3ZMSA 3SFZA 3F3XA 2WWYA 2XAHA 1JHHA 4WWCA 1YQAA 5LLQA 2F5EA 3RYPA 1W7PB 5FD5A 1B4AA 1ZLJA 5DDGA 2H09A 5E1ZB 6PAXA 3QAHA 2P7CB 1CF7B 2RVCA 4UVAA 2DQLA 2PG4A 2EV0A 1OYWA 1ZN2A 3FM3A 4BHBA 1FNNA 3KP2A 1BC7C 3M9AA 2CG4A 4CDGA 4KIBA 3VEPA 2NNYA 1S7OA 2IA1A 1XGNA 3WTXC 3RKWA 2H6BA 4F7ZA 3L2CA 2HKOA 4A2UA 2A6EF 1USTA 3ZP5A 5LEKA 3WTVC 3T8RA 1OYIA 5CYVA 1U5TB 3GXOA 3EETA 2QUFA 4LLLA 2OAZA 4BXUA 4P96A 3U2RA 4O6JA 3ELKA 2VONA 2WV0A 5H6RA 4M9XA 4O3MA 3H3UA 2Z3YA 3O6BB 2ESHA 2JSCA 3FXQA 4LG0A 5IT3A 4U0YA 2L4MA 2BYVE 3FMQA 4HX7A 4CZZA 5JR3A 3J80K 3Q5FA 2M30A 1D5VA 1JE8A 2KRFA 1KQ8A 1IN8A 2DQRA 3WE3A 1OKRA 5DYMA 4ENNA 4OOIA 2KJCA 1G3SA 3IWFA 2ISZA 1YW9A 2DPDA 3I53A 1K79A 2EFNA 2PJPA 2WC2A 1R5GA 5LHIA 3CO7C 1IN7A 4LJZF 1G3YA 1SFUA 1O57A 3T1BA 2A3SA 1TQPA 2TDXA 4HW0A 3KLNA 1IW7F 3I54A 2YU3A 3R0JA 3K0LA 3E5UA 5DUKA 3M7GA 2QQBA 5L3BA 1O3TA 1ODDA 3IRQA 3V8KA 2A61A 2COMA 4PGHA 2RV8A 2G7UA 4XRFA 1FT9A 4XSZF 2EV6A 1BM9A 3TO6A 2A68F 3GVAA 4UV9A 3JW4A 4Y17A 1FBSA 2UZKA 1B6AA 2BEOA 2OD5A 3T5XA 5HLGA 2X0LA 5LGUA 2V1DA 2FMYA 2IA2A 5HLIA 1FBQA 2EB7A 1FYMA 2GIVA 5CVUA 4IJAA 4OIOF 4EGZA 1TTYA 4B8XA 3RYRA 2BE5F 1PDNC 2CWEA 1T38A 1S7AA 3FMRA 1QO0D 2NAZA 2OU2A 4EM1A 3D5LA 4RB3C 4CICA 2GA2A 1W7PD 2PFBA 5HS8A 3KP3A 3CO6C 4UXNA 4KYWA 2ESNA 3GFJA 1TQMA 4JK1X 4ENJA 3FXRA 5JHUA 1CF7A 3R61A 1IXRC 4UNOA 4AVPA 2YX7A 2PI0A 4L0YB 3IHUA 4LD5A 3TO9A 1PP7U 1SD4A 4OIPF 1LNWA 3HRUA 4PZJA 2W24A 3VOEA 1BI3A 2KIMA 2H6CA 4RGUA 2EFPA 1D3YA 5LRSA 1ZRFA 2L02A 5D6FA 1RUOA 4OMZA 4KMFA 5CVRA 2UXNA 4PDKA 5BQTA 4DQ2A 2HQNA 3I5UA 3LA7A 3MAJA 4B09A 1I27A 2H27A 2VC0A 2LNBA 1TQIA 4KMUX 2ELHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FF5 A;  4Q5S F;  3J81 K;  4UHT A;  1S8N A;  2CSO A;  4FT8 A;  1JGS A;  1P6R A;  1KQ9 A;  4NQW A;  3D0S A;  1QZZ A;  3ZQ7 A;  4A0X A;  1U5T A;  4HF1 A;  3V8J A;  3EUH A;  1ZG1 A;  4KDP A;  4M73 A;  4IXA A;  3SZP A;  1G3W A;  1HW2 A;  2VC1 A;  1ZRE A;  1U8R A;  2A6H F;  5L3F A;  1UCR A;  5TRD A;  2W84 A;  3L00 A;  2NNN A;  1XMK A;  4HLX A;  3DKW A;  4P9F A;  3RKX A;  2FOK A;  4RB0 A;  3PFI A;  4KIC A;  5LHH A;  3V7C A;  4L5I A;  1ZAO A;  3ZMV A;  1D8J A;  1YYV A;  4IRH A;  2V1U A;  3ZMT A;  5ILS A;  1R23 A;  4XLP F;  1TNS A;  3N4M A;  2XAF A;  5D5W B;  1TW2 A;  2FML A;  4ZH4 F;  3TOA A;  1F9N A;  2F5F A;  2FBI A;  3HTS B;  4I0B A;  2JT1 A;  4MEX F;  2FU4 A;  2O03 A;  4A0Z A;  4RGR A;  4KIG A;  1LEA A;  3EQL F;  4KN7 X;  5LBQ A;  3I64 A;  2NS0 A;  1AOY A;  3ECO A;  4MQ9 F;  4KN4 X;  1DP7 P;  2HQR A;  1ON2 A;  4XSX F;  2A07 F;  5D6E A;  3ERE D;  2QQ9 A;  3IRR A;  2O61 A;  3ZMD A;  4LMY A;  4MQV A;  2KKO A;  3CUQ C;  3MCZ A;  4WXC A;  4AD9 A;  3DF8 A;  4G6D A;  3M1E A;  5J8C A;  5L3G A;  1W4M A;  2F5C A;  4HDV A;  1XGS A;  4ESJ A;  4M6X A;  2OBP A;  1J9I A;  3LAP A;  3CLO A;  2CQK A;  3P7N A;  1O3R A;  1FBU A;  1BBY A;  2IW5 A;  3SHF A;  5IT9 Z;  2K02 A;  3IKV A;  3T8T A;  3Q9S A;  1TBX A;  1FLI A;  1GXP A;  1K78 A;  5DCF A;  4HBL A;  4I0A A;  4H0E A;  5AIQ A;  4G7H F;  2VOP A;  2XAJ A;  1T39 A;  1CGP A;  4HQM A;  4RAY A;  3G3Z A;  3Q9V A;  1HW1 A;  1MD0 A;  3U1D A;  4AIJ A;  4CYD A;  3CUO A;  3L7W A;  2MLG A;  5L3C A;  2V9V A;  3GO5 A;  1DUX C;  3BJO A;  3HRM A;  5ICC A;  3BOQ A;  2E7X A;  3HSE A;  1W5S A;  3WTW C;  1SFE A;  1XDS A;  1KA8 A;  1YG2 A;  1O3S A;  3W6J B;  1TNT A;  3BRO A;  1FC3 A;  5FLX Z;  1QPM A;  4IRI A;  2OQG A;  1RIO H;  1R36 A;  2RC4 A;  4BAY A;  1SMY F;  5K5Q A;  1UFM A;  2MLK A;  3MEX A;  1F5T A;  3K1M A;  4ZYD A;  2Z33 A;  1SD6 A;  1U5T C;  1FX7 A;  1FY7 A;  1IF1 A;  2YSR A;  2RNJ A;  4M71 A;  2STT A;  4RAZ A;  3M8F A;  4N0B A;  4TV7 A;  4YII A;  1ZLK A;  3QU6 A;  4KUM A;  2ISY A;  3GFM A;  3IL2 A;  4L9N A;  5LGT A;  2XRN A;  3GX4 X;  1X3U A;  4G9Y A;  1P4W A;  1ZYR F;  1WKM A;  3GLX A;  2GXG A;  2K4B A;  1HW5 A;  3GW2 A;  3HIF A;  4GO1 A;  5LEJ A;  5HDK A;  2F2E A;  1JXS A;  4HOB A;  1WRJ A;  2JZY A;  5K5R A;  1FYL A;  4HX4 A;  1I1G A;  2STW A;  4P5O A;  1FYK A;  3E6C C;  2MC3 A;  2DO7 A;  3IKT A;  1Z1D A;  2GZW A;  2DU9 A;  1T0F A;  2ZNY A;  2EFW A;  1LEB A;  3PQJ A;  1K6O A;  1SD5 A;  2XGX A;  3OV8 A;  3DP7 A;  2RQP A;  3E6B A;  2MD5 A;  1BIA A;  1T6S A;  2DTR A;  1IAW A;  2Q2E A;  1U6G A;  2FEZ A;  2ZCW A;  3H92 A;  2IA0 A;  3QP6 A;  4OIN F;  1MJ9 A;  3J80 Z;  2ADU A;  1RNL A;  3TDZ C;  2O0Y A;  4L5J A;  5LGN A;  2ZME B;  1H9G A;  4U0W A;  1D8K A;  1J59 A;  2JTV A;  2HFH A;  1OMI A;  4ZYE A;  1WI9 A;  2DW4 A;  5ICG A;  1HKQ A;  2IP2 A;  5ILU A;  5FFZ A;  3J7A O;  2XHK A;  2PQ8 A;  3GWZ A;  5E8G A;  1KQ0 A;  1B59 A;  3CTA A;  3MFK A;  5FO5 A;  3M8E A;  2QYO A;  1HSJ A;  4MTE A;  1BN5 A;  2VBW A;  3KZY A;  4R79 A;  4NB5 A;  4ZYH A;  3KP4 A;  1ZAR A;  2FF4 A;  3W6K B;  4JQF A;  2QBY A;  1SFX A;  1EH8 A;  2FBK A;  1I1S A;  2K86 A;  2Z99 A;  3E6M A;  3QPT A;  1DPU A;  1XGO A;  4D0P A;  4HZF A;  4MHG A;  5BMZ A;  1G4D A;  2M87 A;  1ZG3 A;  1LDK B;  1BI1 A;  5EEG A;  3I0T A;  5E1W A;  4UUV A;  1BC8 C;  2Z9O A;  3HSF A;  2LSO A;  3FWE A;  4A0Y A;  2M8E A;  4EMS A;  4AIK A;  1KYW A;  3BZ6 A;  4KFC A;  3ZN1 A;  1OPC A;  5AIP A;  3ZPL A;  3HSR A;  2EK5 A;  3SQN A;  2VBZ A;  5HDG A;  5CVV A;  4A5N A;  2HTJ A;  3MQ0 A;  3ROU A;  3RTR A;  1O7L A;  4I2O A;  2JPB A;  2ZME A;  3BP8 A;  2ETH A;  3VFZ A;  5HVQ C;  4OIR F;  2FNP A;  1K78 B;  1LVA A;  3LQQ A;  1RUN A;  3RPU A;  4KA4 A;  5FD6 A;  2KIU A;  1S6L A;  5FFX A;  2FXA A;  3TDU C;  3CUQ B;  4QLC U;  3QU3 A;  2P4W A;  3KET A;  3S2W A;  1BOA A;  2M1B A;  4EVI A;  1XSX A;  1DDN A;  1NHA A;  3E6D A;  3K69 A;  2BGC A;  3VOD A;  2IPQ X;  1TLH B;  2FBH A;  3TOB A;  1R1U A;  1KGS A;  3KEO A;  4U0V A;  2W85 A;  1R5H A;  5F1R A;  2HEO A;  1QNT A;  3K9T A;  1Z7U A;  2QBY B;  2Y48 A;  4EJO A;  3ABU A;  4LFU A;  5ED4 A;  1WQ2 A;  1W7P A;  2LKP A;  1HQC A;  1WSU A;  4YFK F;  4I7H A;  4EQQ A;  2VT2 A;  1YW8 A;  1L3L A;  5FLX K;  1LDJ A;  4EV0 A;  4WX9 A;  4G7Z F;  1LJ9 A;  4E70 A;  1ZRD A;  1DPR A;  5BPI A;  2L54 A;  3WE2 A;  1IN5 A;  3RPQ A;  3F8C A;  4EM2 A;  4HAM A;  4ENM A;  2R7D A;  4XLN F;  3LAJ A;  2RDP A;  2P5K A;  3BPX A;  3KZZ A;  1IZ1 A;  1MGT A;  4JBA A;  3IWZ A;  4CGZ A;  4RGX A;  4IHT A;  3NRV A;  5DCM B;  4EJU A;  1QZY A;  2QM3 A;  3F6O A;  2V6C A;  4LG0 B;  4KIF A;  4WXD A;  2GWR A;  1KU2 A;  3NEU A;  4M9S A;  4HDU A;  4G7O F;  1HST A;  4S04 A;  3E3V A;  3DXJ F;  1J7K A;  2FA5 A;  1J2X A;  2CYY A;  2XAG A;  1Q1H A;  3RI4 A;  3V7S A;  4YFN F;  2HGC A;  2P7V B;  4U7D A;  3V8L A;  1ZGA A;  4U88 A;  4HYE A;  2VBY A;  1R7J A;  3R0A A;  4GYG A;  4ETS A;  4YG2 F;  5D5V B;  1KU9 A;  1Z9C A;  1LDD A;  2Z5U A;  1USS A;  2AXL A;  2VBX A;  1E2X A;  2LF7 A;  5J8F A;  3WG9 A;  5H6Q A;  3HRT A;  2VN2 A;  4WK8 F;  2GXB A;  2XKP A;  1R22 A;  2MH9 A;  3PQK A;  2EWN A;  1YS7 A;  4PCQ A;  1MJB A;  4FX0 A;  1W5T A;  2W57 A;  5E18 F;  1YLF A;  3GZ5 A;  4MEY F;  2J5P A;  3RDI A;  1IXC A;  3ISP A;  4RB1 A;  3MZH A;  3OOP A;  1U78 A;  2J5O A;  2X4H A;  2Y0M A;  2B0L A;  3KP7 A;  2C6Y A;  3F8F A;  5EEH A;  1SD7 A;  3FX3 A;  1XCV A;  3I59 A;  3WOD F;  1C0W A;  1XMA A;  2FNA A;  2DFI A;  2HOE A;  2R7F A;  1V4R A;  4A6D A;  1E17 A;  1KYZ A;  3R6S A;  2R3S A;  3TQN A;  3DEU A;  5LRR A;  1Y0U A;  2LF8 A;  4ENK A;  4BHP A;  4CO8 A;  1A04 A;  3SXY A;  4IF4 A;  1YTY A;  1G6N A;  2DT5 A;  3R4K A;  5F64 A;  2KJB A;  3KCC A;  2O8X A;  4HA8 A;  2PBI A;  4G94 A;  1ZRC A;  5BOX A;  3F6V A;  5DV5 A;  5FGM A;  2ZBK A;  2YX4 A;  2FSW A;  2KIF A;  1J75 A;  4I98 B;  5A2Q Z;  2M45 A;  2VE9 A;  3ML6 A;  3WTT C;  3DPL C;  2HKX A;  1REP C;  3C3W A;  5FB2 A;  4BH9 A;  3WGG A;  1I5Z A;  3LA2 A;  3LA3 A;  3FM5 A;  3JTG A;  4IPA A;  4RB2 C;  3REO A;  3BWG A;  5A2Q K;  5DUI A;  1U2W A;  5E1X A;  4M6Y A;  5JFR A;  1JHF A;  3GF2 A;  3ULQ B;  4LK1 F;  2ZNZ A;  3I59 B;  4LLG F;  2UXX A;  1XSD A;  4ASN A;  3P9C A;  5J6X A;  3I4P A;  2E1N A;  3NQO A;  3V4G A;  5H20 A;  3DQV C;  3F23 A;  4A6E A;  4QWQ A;  5HLH A;  1FP1 D;  2VOO A;  2D1V A;  1T2K A;  1EH7 A;  1RI7 A;  2OZ6 A;  4L0Z B;  2PN6 A;  2VXZ A;  1B1B A;  5DD4 A;  2D1H A;  3G73 A;  2G9W A;  4M74 A;  2EV5 A;  4Q4Z F;  3FZV A;  4RS8 A;  4EM0 B;  4LB5 A;  3MWM A;  5CVI A;  4WF2 A;  4HX8 A;  4ESF A;  2DPU A;  4IHS A;  2QEN A;  2IT0 A;  5CLS A;  2EA2 A;  5L3D A;  4RGS A;  2VT3 A;  2D2W A;  2MBF A;  5E17 F;  3FMS A;  1P92 A;  2F5D A;  4I02 A;  5K1Y A;  1MZB A;  1R00 A;  2V1X A;  3GFL A;  2V79 A;  2GQQ A;  1F1Z A;  3CUQ A;  1YIO A;  1R1T A;  4XBF A;  1SMT A;  2OZU A;  1R1V A;  4BNC A;  2CGP A;  1TW3 A;  3BJ6 A;  1HKT A;  1ONV A;  5HDN A;  1FSH A;  3HHH A;  3GFI A;  2XAS A;  5JI6 A;  4ZZD A;  2HS5 A;  3HRS A;  4KT5 C;  3J81 Z;  1O7F A;  1H0M A;  5KK1 A;  2QZ8 A;  3KLO A;  5D4S A;  4GYI A;  3HOT A;  4OMY A;  3BPV A;  1IRG A;  5E8I A;  2HDC A;  3JAM Z;  5D5X B;  3O2P E;  2XAQ A;  4L9T A;  1T98 A;  2M5W A;  2FQ3 A;  2P8T A;  5IT9 K;  5DD8 A;  2E1C A;  4YIF A;  1V3F A;  3FXU A;  4CXF A;  1MDM A;  1GHC A;  3ZN0 A;  3CJN A;  4A5M A;  4U7B A;  3JSP A;  1SAX A;  5ICE A;  4LB6 B;  3WGI A;  2CFX A;  3E97 A;  4ZYG A;  1OYY A;  1HBX G;  1GXQ A;  1ON1 A;  4I09 A;  5LHG A;  2EA4 A;  2O3F A;  3WGH A;  2Y75 A;  3I58 A;  4WCG A;  3RIR A;  3H3Z A;  3EYY A;  4R8H A;  3ZMZ A;  5D8L B;  1HKS A;  1MKM A;  2L01 A;  1O3Q A;  4HQE A;  2EFO A;  3N97 A;  3F21 A;  2AS5 F;  4NHJ A;  3O3K A;  5HOO A;  2DK8 A;  2VE8 A;  5JVT A;  2P5L C;  4N9I A;  1ZHF A;  1BI2 A;  4Y15 A;  2FE3 A;  3C1D A;  3MZY A;  3QOP A;  3JSO A;  2ZXJ A;  4OU0 A;  4MTD A;  2W25 A;  3RJP A;  2OQR A;  1FPQ A;  3P9I A;  3K2Z A;  2XV4 S;  5ICF A;  3KP6 A;  3TKY A;  5TJJ A;  2UWM A;  1K7A A;  3HHG A;  3JAM K;  4GGG A;  3HTU A;  3ECH A;  3BJA A;  2IJL A;  1FSE A;  3QP5 A;  3WTZ A;  3WTU C;  2YR2 A;  2P6S A;  3COA C;  1FZP B;  2K27 A;  2L3D A;  5DEQ A;  4L9J A;  2XRO A;  4AWX B;  1Z6R A;  1B9N A;  3CDH A;  1EH6 A;  2DAO A;  3WU1 B;  5CJ9 A;  4CHU A;  3QPH A;  4Q48 A;  2H94 A;  3B73 A;  4GXO A;  1FP2 A;  3ZMU A;  5BPD A;  3B02 A;  5F6F A;  1IN6 A;  4HV6 A;  5KVR A;  2K4J A;  4AIH A;  3I71 A;  1RZ4 A;  4P55 A;  2QLZ A;  1LB2 A;  3F8N A;  2CW0 F;  1YS6 A;  5BS6 A;  2GA1 A;  1P2F A;  4HF2 A;  1OR7 A;  3LFK A;  4P9U A;  4HV5 A;  1R58 A;  4M72 A;  2RN7 A;  2NYX A;  4N9H A;  4I01 A;  4EGY A;  4UV8 A;  2DI3 A;  3TO7 A;  1ULY A;  3LWF A;  1KU7 A;  4MNU A;  5D5U B;  3EDP A;  2XVC A;  1H9T A;  1FWZ A;  3F8B A;  2O6G E;  2PMH A;  2MA3 A;  1HXD A;  4KNY A;  1XGM A;  3DV8 A;  3WTS C;  4IRG A;  3T0Y A;  2ZKZ A;  3K1N A;  3KP5 A;  4L18 B;  1WWX A;  3V7R A;  4IVN A;  4DNC A;  1IUY A;  1P4X A;  1U3E M;  1XN7 A;  1VTN C;  3L9F A;  5DCM A;  4YFX F;  3TGN A;  3QRF F;  1IN4 A;  3DPT A;  2HR3 A;  2PMU A;  1MJA A;  3F22 A;  2JPC A;  1FOK A;  1MDM B;  2ZJ2 A;  2A69 F;  2IVM A;  2K7L A;  4HLY A;  3L09 A;  4GCV A;  3GUD A;  4UVC A;  4OIQ F;  2PEX A;  4ESB A;  2EFQ A;  4A12 A;  3SZT A;  3VB2 A;  1P4A A;  1J0R A;  3F8M A;  4PGG A;  2HTS A;  3ABT A;  2ZO4 A;  2HYF A;  2YPR A;  1XD7 A;  1LQ1 A;  4LK0 F;  2QVO A;  2QWW A;  3P9K A;  1YO5 C;  2JRT A;  5E20 A;  4M9Z A;  5D4R A;  1IRF A;  1BI0 A;  4G8X A;  1I6X A;  2E7W A;  2VOD A;  5D8K B;  2RKH A;  4BHC A;  1ZH5 A;  2G7H A;  1XDU A;  2MH2 A;  2XIG A;  2GAU A;  3R60 A;  1BIB A;  2QQA A;  5HS9 A;  3WTY C;  2BV6 A;  2XUB A;  4MGR A;  1G3T A;  2ZFW A;  3U9G A;  1STZ A;  3HUG A;  1QQI A;  1ZG5 A;  3F72 A;  1UHW A;  1B9M A;  1L0O C;  1EV7 A;  2Q0O A;  3GEZ A;  4BQA A;  1S29 A;  5ILV A;  5L3E A;  4LLN A;  4L9V A;  4FHT A;  1UB9 A;  2FRH A;  4LGW A;  2ACJ A;  2HWV A;  2HZT A;  1ZGJ A;  4HF0 A;  3E5X A;  1QGP A;  3BY6 A;  3HYI A;  2Q8K A;  2IRF G;  3HOS A;  3K1P A;  1UHM A;  3WU0 A;  5AON A;  5CVJ A;  2RGV A;  3LQR A;  2D45 A;  1YW7 A;  1PUE E;  3AAF A;  2BBY A;  3DFG A;  3FHZ A;  2P6T A;  1Z91 A;  4ZZL A;  2HYG D;  4S05 A;  1XCB A;  3EYI A;  3GZ6 A;  1J5Y A;  2DLL A;  2L4A A;  5ERI A;  4WXH A;  1Z6T A;  3IC7 A;  2NRA C;  3GYH X;  1IXS B;  3E5Q A;  3KE2 A;  1BJA A;  2DBB A;  4Q47 A;  4R1H A;  2CO5 A;  4EJV A;  1S3J A;  2XKO A;  3BDD A;  4G6Q A;  1GVJ A;  3KFW X;  2WTE A;  1Z05 A;  1QBJ A;  1XSV A;  3C7J A;  4EJW A;  4Z2Y A;  3JTH A;  4EJT A;  1KU3 A;  1XB4 A;  4UVB A;  5K5O A;  1F4K A;  2PLY A;  4FX4 A;  4Y13 A;  2OA4 A;  1PP8 F;  2DK5 A;  2A5Y B;  2LDU A;  2EJR A;  4K2E A;  1AWC A;  1YFH A;  4O5V A;  3C18 A;  3RKY A;  5HS7 A;  3LST A;  4ON0 A;  3KEQ A;  2P5V A;  4BYY A;  3ZMS A;  3SFZ A;  3F3X A;  2WWY A;  2XAH A;  1JHH A;  4WWC A;  1YQA A;  5LLQ A;  2F5E A;  3RYP A;  1W7P B;  5FD5 A;  1B4A A;  1ZLJ A;  5DDG A;  2H09 A;  5E1Z B;  6PAX A;  3QAH A;  2P7C B;  1CF7 B;  2RVC A;  4UVA A;  2DQL A;  2PG4 A;  2EV0 A;  1OYW A;  1ZN2 A;  3FM3 A;  4BHB A;  1FNN A;  3KP2 A;  1BC7 C;  3M9A A;  2CG4 A;  4CDG A;  4KIB A;  3VEP A;  2NNY A;  1S7O A;  2IA1 A;  1XGN A;  3WTX C;  3RKW A;  2H6B A;  4F7Z A;  3L2C A;  2HKO A;  4A2U A;  2A6E F;  1UST A;  3ZP5 A;  5LEK A;  3WTV C;  3T8R A;  1OYI A;  5CYV A;  1U5T B;  3GXO A;  3EET A;  2QUF A;  4LLL A;  2OAZ A;  4BXU A;  4P96 A;  3U2R A;  4O6J A;  3ELK A;  2VON A;  2WV0 A;  5H6R A;  4M9X A;  4O3M A;  3H3U A;  2Z3Y A;  3O6B B;  2ESH A;  2JSC A;  3FXQ A;  4LG0 A;  5IT3 A;  4U0Y A;  2L4M A;  2BYV E;  3FMQ A;  4HX7 A;  4CZZ A;  5JR3 A;  3J80 K;  3Q5F A;  2M30 A;  1D5V A;  1JE8 A;  2KRF A;  1KQ8 A;  1IN8 A;  2DQR A;  3WE3 A;  1OKR A;  5DYM A;  4ENN A;  4OOI A;  2KJC A;  1G3S A;  3IWF A;  2ISZ A;  1YW9 A;  2DPD A;  3I53 A;  1K79 A;  2EFN A;  2PJP A;  2WC2 A;  1R5G A;  5LHI A;  3CO7 C;  1IN7 A;  4LJZ F;  1G3Y A;  1SFU A;  1O57 A;  3T1B A;  2A3S A;  1TQP A;  2TDX A;  4HW0 A;  3KLN A;  1IW7 F;  3I54 A;  2YU3 A;  3R0J A;  3K0L A;  3E5U A;  5DUK A;  3M7G A;  2QQB A;  5L3B A;  1O3T A;  1ODD A;  3IRQ A;  3V8K A;  2A61 A;  2COM A;  4PGH A;  2RV8 A;  2G7U A;  4XRF A;  1FT9 A;  4XSZ F;  2EV6 A;  1BM9 A;  3TO6 A;  2A68 F;  3GVA A;  4UV9 A;  3JW4 A;  4Y17 A;  1FBS A;  2UZK A;  1B6A A;  2BEO A;  2OD5 A;  3T5X A;  5HLG A;  2X0L A;  5LGU A;  2V1D A;  2FMY A;  2IA2 A;  5HLI A;  1FBQ A;  2EB7 A;  1FYM A;  2GIV A;  5CVU A;  4IJA A;  4OIO F;  4EGZ A;  1TTY A;  4B8X A;  3RYR A;  2BE5 F;  1PDN C;  2CWE A;  1T38 A;  1S7A A;  3FMR A;  1QO0 D;  2NAZ A;  2OU2 A;  4EM1 A;  3D5L A;  4RB3 C;  4CIC A;  2GA2 A;  1W7P D;  2PFB A;  5HS8 A;  3KP3 A;  3CO6 C;  4UXN A;  4KYW A;  2ESN A;  3GFJ A;  1TQM A;  4JK1 X;  4ENJ A;  3FXR A;  5JHU A;  1CF7 A;  3R61 A;  1IXR C;  4UNO A;  4AVP A;  2YX7 A;  2PI0 A;  4L0Y B;  3IHU A;  4LD5 A;  3TO9 A;  1PP7 U;  1SD4 A;  4OIP F;  1LNW A;  3HRU A;  4PZJ A;  2W24 A;  3VOE A;  1BI3 A;  2KIM A;  2H6C A;  4RGU A;  2EFP A;  1D3Y A;  5LRS A;  1ZRF A;  2L02 A;  5D6F A;  1RUO A;  4OMZ A;  4KMF A;  5CVR A;  2UXN A;  4PDK A;  5BQT A;  4DQ2 A;  2HQN A;  3I5U A;  3LA7 A;  3MAJ A;  4B09 A;  1I27 A;  2H27 A;  2VC0 A;  2LNB A;  1TQI A;  4KMU X;  2ELH A; 
#chains in the Genus database with same CATH topology
 2WV1 A;  3HOX J;  2BXZ A;  4F52 A;  3FF5 A;  2KRC A;  2TCT A;  2L7K A;  3MKL A;  4F91 B;  4Q5S F;  3J81 K;  4UHT A;  1S8N A;  1TT5 B;  2CSO A;  4FT8 A;  1JGS A;  1D1A A;  1P6R A;  1KQ9 A;  1BR1 A;  1FOY A;  5GTH C;  4NQW A;  3D0S A;  1QZZ A;  3ESW B;  1JUM A;  2E5Z A;  3ZQ7 A;  5C44 J;  4A0X A;  4LIU A;  4C9Y A;  1U5T A;  1W36 D;  3HKZ N;  4HF1 A;  3V8J A;  3EUH A;  1ZG1 A;  3GTK J;  4KDP A;  5J4V A;  4M73 A;  3J7A Y;  4IXA A;  3JRI A;  5J1Y A;  3SZP A;  1G3W A;  5FJ8 J;  1HW2 A;  3ZCO A;  2R93 J;  2VC1 A;  1ZRE A;  1U8R A;  2A6H F;  3KYL A;  4YRV A;  5L3F A;  1UCR A;  5TRD A;  2VKD A;  2W84 A;  3L00 A;  2DN0 A;  2NNN A;  2OTL I;  1GT0 C;  1XMK A;  4HLX A;  3DKW A;  4P9F A;  3RKX A;  3CF5 F;  3TMO A;  1WJE A;  3ZQC A;  3LFU A;  2FOK A;  1JUS A;  4RB0 A;  3PFI A;  4KIC A;  5LHH A;  3V7C A;  3DTK A;  4L5I A;  1ERD A;  4L5E A;  1E3P A;  1ZAO A;  3ZMV A;  1D8J A;  1YYV A;  4IRH A;  2HU9 A;  4MO7 A;  2V1U A;  4QSH A;  2MYS A;  1OCT C;  3ZMT A;  1VQK I;  3MMY B;  5KHD A;  5ILS A;  3LSG A;  2DFF A;  2CJJ A;  2CW7 A;  1R23 A;  4Y52 J;  3OR1 C;  3ZQQ A;  4XLP F;  1TNS A;  3VYT B;  3N4M A;  3I9V 2;  1Z67 A;  2XAF A;  4BEH B;  1TW2 A;  2FML A;  5D5W B;  2D5V A;  4ZH4 F;  2V9P A;  3TOA A;  3ASN H;  3AFH A;  5EG0 A;  2YU9 J;  3BCA A;  2DFE A;  2OUM A;  2QCO A;  4CSW A;  1F9N A;  1B8I A;  2F5F A;  2FBI A;  5DM6 F;  3C2B A;  3HTS B;  4I0B A;  1N25 A;  4D7N A;  1Y8R B;  2JT1 A;  4X6A J;  2LR8 A;  3FXJ A;  4MEX F;  2JN6 A;  2FU4 A;  2O03 A;  2KFD A;  3ABL H;  2DMT A;  2VI6 A;  2B9S A;  3HOV J;  1X19 A;  4A0Z A;  4RGR A;  5J4Y A;  4KIG A;  5K7Z A;  4AM3 A;  4PJJ A;  2R7X A;  1LEA A;  2I5U A;  3EQL F;  1SFK A;  4KN7 X;  5LBQ A;  1J09 A;  3I64 A;  2NS0 A;  1AOY A;  3ECO A;  1VZ0 A;  2R7S A;  2EIK H;  4MQ9 F;  2CUE A;  4KN4 X;  1DP7 P;  2HQR A;  1ON2 A;  4XSX F;  2A07 F;  2Y30 A;  5D6E A;  3ERE D;  2RAE A;  2QQ9 A;  3W2A A;  4KT6 A;  3IRR A;  2O61 A;  1M1E B;  1SEU A;  5JVG F;  3LSJ A;  3ZMD A;  4LMY A;  3VPR A;  4MQV A;  3CCU I;  3ERM A;  2KKO A;  2R5Z A;  2LK2 A;  1OR7 C;  1X3Z B;  3CUQ C;  3MCZ A;  3TW7 A;  1YIT I;  4ABZ A;  4WXC A;  3L1P A;  4AD9 A;  3DF8 A;  1Y0N A;  4G6D A;  2COB A;  3M1E A;  5DS9 A;  5J8C A;  5L3G A;  1W4M A;  4PSX A;  1QU3 A;  2F5C A;  4HDV A;  4CCM A;  1S7E A;  1WHU A;  1YJW I;  1MW7 A;  4A3E J;  1XGS A;  4ESJ A;  4M6X A;  2OBP A;  3VYR B;  5B1B H;  3EUA A;  3H9G A;  3TW6 A;  1J9I A;  3LAP A;  2JMW A;  2EIM H;  3CLO A;  2OC6 A;  1WZ2 A;  2CQK A;  4XRM A;  3P7N A;  1O3R A;  2W7N A;  2E36 A;  1S9H A;  1FTT A;  1FBU A;  2R5Y A;  3LSP A;  2NVU B;  1BBY A;  1RKT A;  4JYK A;  2IW5 A;  2IXS A;  3M4O J;  3SHF A;  5IT9 Z;  1DQU A;  2K02 A;  5GPC A;  3IKV A;  1TZL A;  3G1L A;  3PM1 A;  3T8T A;  3TP0 A;  1HLV A;  3Q9S A;  3A1Y A;  3M8J A;  3CCE I;  1TBX A;  1FLI A;  4CCJ A;  2E2I J;  1GXP A;  4UB8 C;  1K78 A;  5DCF A;  3HB9 A;  4HBL A;  4I0A A;  2VQG A;  4H0E A;  5AIQ A;  4G7H F;  1YX3 A;  3JCU C;  2WAQ A;  2VOP A;  2XAJ A;  5J3L A;  1T39 A;  1CGP A;  4I6Z A;  4HQM A;  5F08 A;  3HEF A;  3CC4 I;  4RAY A;  3NAU A;  3G3Z A;  2Y0S A;  3Q9V A;  1HW1 A;  5HNF A;  1X1A A;  1MD0 A;  2ZSI B;  3U1D A;  2W82 A;  4AIJ A;  1WVR A;  4CYD A;  3CUO A;  4UB6 C;  3L7W A;  3LSH A;  2KZG A;  3G2B A;  4AID A;  3S8P A;  2MLG A;  5L3C A;  2V9V A;  3GO5 A;  1PVE A;  1DUX C;  3BJO A;  3JR9 A;  3HRM A;  1X1C A;  1LVK A;  5ICC A;  3BOQ A;  2E7X A;  3JRF A;  2L7F P;  3HSE A;  4F55 A;  1W5S A;  3WTW C;  1SFE A;  1XDS A;  5FKN A;  1KA8 A;  1YG2 A;  4DW6 A;  1CQT A;  3BR0 A;  3FXK A;  1O3S A;  1MMD A;  3HZJ A;  3W6J B;  1R6R A;  1TNT A;  1YJ9 I;  3BRO A;  1FC3 A;  3KZI C;  5FLX Z;  2HPM A;  1QPM A;  4IRI A;  2K9N A;  2OQG A;  1RIO H;  1R36 A;  2RC4 A;  4BAY A;  5EF6 A;  1AU7 A;  1LFU P;  3CF2 A;  1RC9 A;  1SMY F;  3WHB A;  5IP7 J;  1R71 A;  5K5Q A;  1UFM A;  2MLK A;  3MEX A;  5F0H A;  1F5T A;  3K1M A;  4ZYD A;  2LRD A;  2VL8 A;  2Z33 A;  4A3D J;  1SD6 A;  1U5T C;  1FX7 A;  1FY7 A;  3SDB A;  1IF1 A;  1GDT A;  2HVR A;  2YSR A;  2RNJ A;  4M71 A;  3GTM J;  2H8W A;  3OL4 A;  2STT A;  1Z7L A;  2BHY A;  3M8F A;  4RAZ A;  1JJ8 C;  2UV1 A;  3ASO H;  4N0B A;  4DYR A;  2LKX A;  4NBQ A;  4TV7 A;  4YII A;  1JJ6 C;  1ZLK A;  5F0F A;  1T33 A;  3QU6 A;  4KUM A;  2JVH A;  2ISY A;  3GFM A;  2W00 A;  3IL2 A;  2F5V A;  4D5F A;  3K70 D;  1VQ7 I;  4L9N A;  3LSK A;  2O5R A;  5LGT A;  2XRN A;  3GX4 X;  2Z1D A;  2IEK A;  1P9Q C;  1WPK A;  1X3U A;  4G9Y A;  4PK4 A;  1P4W A;  1ZYR F;  5FRM A;  3GLX A;  1WKM A;  2WBM A;  2GXG A;  2K4B A;  1HW5 A;  3GW2 A;  2N8G A;  3HIF A;  4GO1 A;  5LEJ A;  5HDK A;  2F2E A;  1JXS A;  4HOB A;  1NTC A;  1WRJ A;  2JZY A;  4XM3 A;  5K5R A;  4HX4 A;  1FYL A;  1MBF A;  1I1G A;  2STW A;  3BCB A;  1N77 A;  2X6Y A;  2DA1 A;  4P5O A;  1FYK A;  3O8G A;  3H35 A;  3E6C C;  2MC3 A;  2DO7 A;  2KIQ A;  4XL9 A;  3IKT A;  5J40 A;  3Q0W A;  1Z1D A;  3S3O A;  3I55 I;  5FKO A;  3FBN B;  2GZW A;  3CCQ I;  2DU9 A;  2M9H A;  3ZQF A;  1T0F A;  2ZNY A;  1AA7 A;  2EFW A;  2ELJ A;  1LEB A;  3PQJ A;  4BDZ A;  1K6O A;  1SD5 A;  2XGX A;  2M4G A;  3OV8 A;  2EQR A;  4FTH A;  3DP7 A;  2RQP A;  4JOM A;  2NVT J;  1VQ9 I;  1RET A;  3E6B A;  2A6T A;  2LRE A;  1I50 J;  2MD5 A;  2VKV A;  1H89 C;  1BIA A;  3OYH A;  1T6S A;  1PUF B;  2DTR A;  1ACI A;  2YUS A;  1MBK A;  1IAW A;  1Q1V A;  2Q2E A;  1U6G A;  2DA2 A;  2FEZ A;  2ZCW A;  1T95 A;  3H92 A;  2DMN A;  2ME6 A;  3OSF A;  3HDD A;  2IA0 A;  1DP3 A;  3I56 I;  3JRE A;  2I10 A;  4QPQ A;  3HKZ A;  3QP6 A;  4I99 C;  1MJ9 A;  4OIN F;  3J80 Z;  2ADU A;  1RNL A;  2ZJQ F;  3TDZ C;  4XK4 A;  2O0Y A;  4L5J A;  5LGN A;  2ZME B;  1H9G A;  4U0W A;  1D8K A;  1J59 A;  2JTV A;  2HFH A;  3KYD B;  1OMI A;  4ZYE A;  5HNH A;  1WI9 A;  1QVT A;  2DW4 A;  1OCO H;  5ICG A;  4PFP A;  1RR8 C;  2WA0 A;  1HKQ A;  2DA6 A;  2F6C A;  1FJL A;  4BE1 A;  2IP2 A;  5FFZ A;  5ILU A;  2ZJP F;  1NK3 P;  3J7A O;  2XHK A;  3GWZ A;  2PQ8 A;  4DZJ A;  5E8G A;  1KON A;  1KQ0 A;  5HOD A;  3S15 J;  1F43 A;  1B59 A;  3RPU D;  3CTA A;  4G6T B;  5FO5 A;  3MFK A;  3K4N A;  4GFB A;  3M8E A;  2L7Z A;  4NC7 A;  5E3M A;  3TL4 X;  2QYO A;  1UMQ A;  1HSJ A;  4MTE A;  1W0T A;  1BN5 A;  2CFO A;  1VQO I;  4UY8 I;  2VBW A;  3KZY A;  4R79 A;  3D5R C;  4BY7 J;  3OR2 C;  4NB5 A;  4ZYH A;  1B72 B;  3KP4 A;  1ZAR A;  2FF4 A;  3W6K B;  3JRB A;  4JQF A;  2JJ7 A;  2QBY A;  1SFX A;  1EH8 A;  2FBK A;  1Z21 A;  3FKJ A;  4XLC A;  3RKQ A;  1I1S A;  1OQY A;  2K86 A;  2Z99 A;  2LBF B;  2CMP A;  1Z0X A;  3UR3 C;  2LMD A;  3E6M A;  3QPT A;  3OS0 A;  1DPU A;  1XGO A;  4D0P A;  4HZF A;  3CJT B;  4MHG A;  4BXX J;  5BMZ A;  1G4D A;  4J00 A;  3GBG A;  4C3J J;  2M87 A;  3VWB A;  3BR5 A;  2E1M C;  1ZG3 A;  1Y1V J;  2EPF A;  1LDK B;  1BI1 A;  4I76 A;  1HA8 A;  2DJN A;  1JTY A;  4AYB A;  1EF4 A;  1T08 B;  2L9R A;  3CCR I;  5EEG A;  3I0T A;  5E1W A;  4N4O B;  4UUV A;  4D9J A;  1BC8 C;  1D0X A;  3OIQ A;  2Z9O A;  1UJ8 A;  3HSF A;  2LSO A;  1SVO A;  4V2F A;  2JA5 J;  3GTG J;  5CKT A;  2ZSH B;  3FWE A;  2MD0 A;  4A0Y A;  3LSR A;  3I3L A;  2M8E A;  4EMS A;  1A6Q A;  4AIK A;  1KYW A;  3BZ6 A;  4KFC A;  1SVL A;  3ZN1 A;  1OPC A;  3QYF A;  1MH4 A;  5AIP A;  3ZPL A;  3HSR A;  2EK5 A;  3SQN A;  4F92 B;  2NOG A;  2VBZ A;  3HJE A;  5CVV A;  3QYE A;  5HDG A;  2Y2Z A;  4A5N A;  2HTJ A;  3HXL A;  3MQ0 A;  3ROU A;  3RTR A;  1O7L A;  4I2O A;  2JPB A;  4Y4R A;  5CQG A;  1SC7 A;  2ZME A;  3BP8 A;  2ETH A;  3VFZ A;  5HVQ C;  2B7E A;  4OIR F;  2FNP A;  4KJZ A;  4E4H A;  3H5N A;  1X4P A;  4X1E A;  1K78 B;  1LVA A;  3CDI A;  3LQQ A;  2FX0 A;  1RUN A;  3RPU A;  4KA4 A;  5FD6 A;  2KIU A;  1S6L A;  5FFX A;  4G12 A;  2FXA A;  2BW3 B;  3TDU C;  4CZC A;  3CCS I;  4IOC F;  3CUQ B;  4QLC U;  2CRG A;  3QU3 A;  2P4W A;  3BR1 A;  3KET A;  2ME0 A;  3HM5 A;  5KAI C;  1U9O A;  3DLA A;  1D5Y A;  3S2W A;  2NOJ B;  4YIR X;  5LFA A;  1BOA A;  3CMA I;  2M1B A;  4EVI A;  1XSX A;  1DDN A;  2XSJ C;  1NHA A;  3E6D A;  3K69 A;  2BGC A;  1Y1W J;  1JKP C;  1QHH D;  3VOD A;  1NH3 A;  2IPQ X;  1TLH B;  2H8R A;  2FBH A;  4NUB A;  3TOB A;  4HNU A;  1R1U A;  1KGS A;  3KEO A;  4JX5 A;  2M34 A;  4U0V A;  1A35 A;  2W85 A;  1R5H A;  5F1R A;  4B3X A;  1QNT A;  4B3A A;  2HEO A;  3W2V A;  3K9T A;  2K3F A;  3NWT A;  1Z7U A;  3SYT A;  2AXT C;  2QBY B;  1OCP A;  2Y48 A;  1HDP A;  4EJO A;  3ABU A;  2NVY J;  4LFU A;  5ED4 A;  1WQ2 A;  1K6Y A;  2DFH A;  1W7P A;  2K85 A;  2LKP A;  1HQC A;  3IV5 A;  4XKW A;  5IPA A;  3HPG A;  2M7B A;  3M1C A;  1WSU A;  1S5L C;  1MMS A;  4B43 A;  4YFK F;  1DGR M;  2VLA A;  4I7H A;  1RR7 A;  4EQQ A;  3S1M J;  2VT2 A;  1YW8 A;  1L3L A;  2M0C A;  1UEL B;  5FLX K;  1LDJ A;  4EV0 A;  3PSI A;  4WX9 A;  4G7Z F;  3K4L A;  4A69 C;  1LJ9 A;  3CMY A;  4E70 A;  3KEY A;  4FE4 A;  1DPR A;  1G59 A;  1ZRD A;  5BPI A;  2L54 A;  3WE2 A;  1IN5 A;  3LSM A;  3RPQ A;  2X1E A;  5GTI C;  3S14 J;  3F8C A;  4II3 A;  5KCM A;  4EM2 A;  1A5J A;  4HAM A;  4ENM A;  5B5E C;  3PO3 J;  3HOU J;  2R7D A;  4E7S A;  1R5I D;  2QKM B;  4XLN F;  3LAJ A;  2RDP A;  4PFO A;  2HI3 A;  4A3F J;  3AL0 B;  2P5K A;  2XPV A;  3JRD A;  3BPX A;  3KZZ A;  5EG0 B;  3LNQ A;  1UG2 A;  1IZ1 A;  1MGT A;  4JBA A;  2L2O A;  2H1L A;  3IWZ A;  4PSW A;  3H5A A;  4CGZ A;  4RGX A;  4IHT A;  3NRV A;  3A03 A;  5DCM B;  4DGW B;  4EJU A;  1QZY A;  2QM3 A;  3F6O A;  2V6C A;  4LG0 B;  4KIF A;  2GIZ A;  4WXD A;  3LMM A;  4A3M J;  2HVS A;  4ZDP A;  4XRS G;  2GWR A;  5FKL A;  1GUU A;  1KU2 A;  4XN3 A;  3WHC A;  3NEU A;  4M9S A;  3IH4 A;  2CS3 A;  4HDU A;  4IHW A;  3TED A;  3BQZ A;  4G7O F;  3OS2 A;  3J7Y J;  1OIS A;  1WJB A;  1HST A;  4S04 A;  2HDW A;  3E3V A;  3DXJ F;  1Z3Y A;  1J7K A;  2M8G X;  2FA5 A;  1J2X A;  4PJN A;  2GLO A;  3JRC A;  2CYY A;  2XAG A;  3IAS 2;  1Q1H A;  3ZQI A;  4DYC A;  1LE8 B;  2BY3 A;  2LLK A;  2DT7 B;  3SEQ A;  3RI4 A;  1MSF C;  3V7S A;  1VQ8 I;  4BL0 B;  4YFN F;  4BQN A;  2X85 A;  1SAU A;  2HGC A;  5FRN A;  2P7V B;  4U7D A;  3V8L A;  1ZGA A;  2CQ7 A;  2DMQ A;  4U88 A;  4B4C A;  4HYE A;  4BGD A;  2VBY A;  1V5E A;  3BG5 A;  1R7J A;  2GM4 A;  1MH3 A;  3R0A A;  4GYG A;  4ETS A;  4YG2 F;  5D5V B;  1KU9 A;  4BKX A;  1Z9C A;  1LDD A;  3K4M A;  2Z5U A;  3QQA A;  1USS A;  2ZFU A;  1OJL A;  2X1C A;  2CUZ A;  2DA4 A;  2R7Z J;  2AXL A;  2VBX A;  2X6W A;  3K6G A;  1E2X A;  4HNT A;  2LF7 A;  4CUG A;  5J8F A;  1TC3 C;  3WG9 A;  5H6Q A;  1ITY A;  3HRT A;  2VN2 A;  4WK8 F;  2GXB A;  3BG6 A;  4QIW N;  2XKP A;  1R22 A;  2MH9 A;  3PQK A;  2EWN A;  4IQJ A;  1YS7 A;  3OYN A;  5J1R A;  4PCQ A;  1MJB A;  4FX0 A;  2MFZ A;  1W5T A;  2F48 A;  2W57 A;  5E18 F;  3P5J A;  4MIM A;  4CH7 A;  1YLF A;  3GZ5 A;  4MEY F;  2J5P A;  3RDI A;  1IXC A;  1GV2 A;  4AU7 A;  3B6A A;  3ISP A;  4RB1 A;  2HQ5 A;  3CDL A;  3OOP A;  4E7I A;  4A3K J;  3MZH A;  1U78 A;  2J5O A;  2X4H A;  2Y0M A;  2B0L A;  3KP7 A;  3BG9 A;  5IOY A;  2XC7 A;  2C6Y A;  4GDF A;  3F8F A;  5EEH A;  1SD7 A;  3FX3 A;  1XCV A;  3I59 A;  3WOD F;  3PIO F;  1XMA A;  4X0G A;  1C0W A;  2FNA A;  1ZR2 A;  2DFI A;  2X1D A;  5FRO A;  2HOE A;  2R7F A;  1V4R A;  5M3F J;  2L9S A;  5B3S H;  4LG3 A;  3FXM A;  1IC8 A;  2DMP A;  3PO2 J;  1Y39 A;  2FJ1 A;  4A6D A;  3LL7 A;  2V7F A;  2LD5 A;  1E17 A;  1MBE A;  2NS7 A;  4XLH A;  1KYZ A;  3R6S A;  3DBH B;  1JT0 A;  2R3S A;  3AG1 H;  4M6V A;  3I4N J;  3OYC A;  3TQN A;  5IP6 A;  3DEU A;  5LRR A;  1Y0U A;  3GTQ J;  2LF8 A;  4ENK A;  1GVD A;  3H36 A;  1YX5 A;  4BHP A;  3PNY A;  4CO8 A;  3C2G A;  1ETQ A;  4FE7 A;  1A04 A;  3BT9 A;  3SXY A;  4XQF A;  3HUG B;  4IF4 A;  1YTY A;  2QKL B;  1G6N A;  3PIP F;  4RBO A;  2DT5 A;  3R4K A;  5F64 A;  4OWR B;  2KJB A;  4FCY A;  3KCC A;  4MLO A;  2O8X A;  4HA8 A;  2PBI A;  3OYA A;  4G94 A;  1ZRC A;  2MAB A;  5BOX A;  3F6V A;  5TIS C;  2DA5 A;  5DV5 A;  4IOA F;  5FGM A;  2ICW G;  2ZBK A;  2YX4 A;  2JRM A;  5F1J A;  2FSW A;  2KIF A;  3CJR B;  1LKX A;  1ZTR A;  2XAU A;  3OSG A;  4M3F A;  3OYJ A;  3GTJ J;  1KZH A;  2R92 J;  5E3O A;  1J75 A;  3DKX A;  4I98 B;  5A2Q Z;  4C3H J;  2M45 A;  2VE9 A;  1BR4 A;  3ML6 A;  3HOY J;  4FQG A;  2DA7 A;  3DPL C;  3WTT C;  2P81 A;  3G71 I;  3AG2 H;  4AYB N;  2HKX A;  1REP C;  3C3W A;  2V26 A;  1R4N B;  4QPO A;  3BG7 A;  5FB2 A;  2XB0 X;  1I5Z A;  3LA2 A;  3WGG A;  2BOL A;  3LA3 A;  3FM5 A;  4BH9 A;  1GLN A;  4IPA A;  4RB2 C;  3JTG A;  4IHV A;  3REO A;  2DTZ A;  3BWG A;  3S1N J;  5A2Q K;  5DUI A;  1R4M B;  1U2W A;  5E1X A;  3K4B A;  4M6Y A;  3S16 J;  5JFR A;  3H9J A;  3RZD J;  2M0M A;  1X1P A;  1JHF A;  3GF2 A;  3EUK L;  2ZXW H;  3ULQ B;  4P1W A;  1ETW A;  4LK1 F;  3GTO J;  2ZNZ A;  4E6K G;  3I59 B;  2K9S A;  2LKS A;  2BHZ A;  4LLG F;  2LP0 A;  2M4K A;  2UXX A;  3EUH C;  1XSD A;  4ASN A;  3P9C A;  3IH2 A;  5J6X A;  1RKW A;  2NVX J;  2VIX A;  3I4P A;  5JLW A;  5M5W J;  3PUB A;  3CJQ B;  3SJM A;  2O7O A;  3FK7 A;  2E1N A;  4S0H B;  2R0Q C;  1Y56 A;  3NQO A;  3TP3 A;  1PUF A;  3V4G A;  5H20 A;  3DQV C;  4BXF A;  3F23 A;  4A6E A;  3N05 A;  4FET A;  4QWQ A;  2Y9Z A;  5HLH A;  1FP1 D;  1WGX A;  2VOO A;  3C2H A;  2D1V A;  1T2K A;  1EH7 A;  2VQL A;  2HOA A;  1RI7 A;  2OZ6 A;  4ZTF A;  3PUF A;  4L0Z B;  2PN6 A;  2L7M P;  4HST A;  2VXZ A;  3AG4 H;  1B1B A;  4DYQ A;  3OYF A;  2FOW A;  5DD4 A;  2D1H A;  1OLT A;  3G73 A;  2G9W A;  4M74 A;  2EV5 A;  4Q4Z F;  4D5C A;  3FZV A;  3DTE A;  4RS8 A;  4EM0 B;  1VQ6 I;  4CCL A;  2Q2E B;  2JSP A;  4LB5 A;  1B72 A;  3MWM A;  5CVI A;  2WAQ N;  1JKO C;  1YE9 A;  4WF2 A;  1VQ5 I;  4C30 A;  4HX8 A;  2XGC A;  4ESF A;  2XB5 A;  2DPU A;  1U8B A;  4IHS A;  3K4K A;  2QEN A;  2IT0 A;  2YS9 A;  5CLS A;  2EA2 A;  4D7M A;  5L3D A;  4RGS A;  9ANT A;  2VT3 A;  2D2W A;  1BR2 A;  4JX6 A;  2MBF A;  5E17 F;  3FMS A;  1YHQ I;  1NK2 P;  1VQ4 I;  2G0E A;  2KDO A;  1P92 A;  2F5D A;  4I02 A;  3WU2 C;  4DIQ A;  4KIS A;  1PJR A;  5K1Y A;  1MZB A;  1R49 A;  1R00 A;  2V1X A;  2JA7 J;  3GFL A;  2GBY A;  2V79 A;  2GQQ A;  1LE8 A;  1F1Z A;  2ZJR F;  3CUQ A;  2JUC A;  5F27 A;  1YIO A;  1TT0 A;  1R1T A;  4XBF A;  2RNG A;  3A01 A;  1SMT A;  3BR3 A;  1O4X A;  2OZU A;  3H3V K;  1VQN I;  1R1V A;  1X2M A;  4BNC A;  2CGP A;  1BW6 A;  1A6I A;  4NDL A;  5M5X J;  1TW3 A;  4ZYA A;  1D0Z A;  4CCN A;  3BJ6 A;  5GAH J;  1HKT A;  1ONV A;  5HDN A;  1JKR C;  1FSH A;  3HHH A;  3GFI A;  2E60 A;  2XAS A;  5JI6 A;  2HOS A;  4ZZD A;  2HS5 A;  3QOE A;  5IYC J;  3HRS A;  4KT5 C;  3J81 Z;  3JRH A;  1O7F A;  1H0M A;  5KK1 A;  4M3D A;  3PL8 A;  2QZ8 A;  3KLO A;  5D4S A;  5EEA A;  2CQQ A;  4GYI A;  2VJJ A;  1IDY A;  3HOT A;  4IL6 C;  4BDY A;  3BPV A;  4OMY A;  1IRG A;  3OYK A;  5E3L A;  5E8I A;  2HDC A;  1W0U A;  1D1C A;  3JAM Z;  3H5R A;  5D5X B;  3O2P E;  1SVM A;  2XF7 A;  3MKY B;  2XAQ A;  1V55 H;  2KHM A;  1QA6 A;  5F0C A;  1T8I A;  3MZ8 A;  3FIW A;  4XLA A;  3QWL A;  1X1D A;  4L9T A;  3G1O A;  2DOD A;  1T56 A;  4IHY A;  1T98 A;  2WAE A;  1HC8 A;  2M5W A;  4A3G J;  2FQ3 A;  3A02 A;  1MIJ A;  3UNG C;  2ELK A;  4A3L J;  2P8T A;  2IGO A;  3BLY A;  3FDY A;  4HEA 2;  3CCV I;  5DD8 A;  5IT9 K;  3DBR B;  1A36 A;  2E1C A;  4YIF A;  1V3F A;  5IY5 H;  3FXU A;  2CU7 A;  4CXF A;  1MDM A;  1GHC A;  3ZN0 A;  3M3Y J;  1TP4 A;  2CV1 A;  3CJN A;  4DOZ A;  2X9D A;  1DGW Y;  4A5M A;  4U7B A;  3JSP A;  1SAX A;  2VKH A;  5ICE A;  3SDG A;  5J47 A;  1WJ5 A;  4BE2 A;  1ZR4 A;  4LIV A;  4LB6 B;  3CMM A;  2IS1 A;  2L9V A;  3WGI A;  2CFX A;  3E97 A;  2LYC A;  3V42 A;  1BW5 A;  4MFD A;  1FTZ A;  4ZYG A;  1WJA A;  1IRZ A;  2ZXH A;  1OYY A;  1HBX G;  1GXQ A;  1ON1 A;  4I09 A;  3CD6 I;  1X4O A;  5LHG A;  2EA4 A;  3HC7 A;  1BL0 A;  2O3F A;  2R5Y B;  4OAY A;  3WGH A;  2Y75 A;  3I58 A;  2ID6 A;  4WCG A;  3RIR A;  3H3Z A;  3EYY A;  2P0W A;  4R8H A;  3ZMZ A;  5D8L B;  1HKS A;  3QPS A;  2K40 A;  2K9L A;  4RAF A;  4LOC A;  2O9L A;  1MKM A;  4RLF A;  3BR2 A;  3K10 A;  1G2H A;  2LOO A;  2L01 A;  2VB6 A;  1O3Q A;  4HQE A;  3L2Q A;  3OY9 A;  2EFO A;  3N97 A;  3F21 A;  2AS5 F;  2XDV A;  3E0J B;  4NHJ A;  3O3K A;  1EKE A;  2IGM A;  2IS2 A;  5HOO A;  2DK8 A;  2VE8 A;  1X3W B;  2X6O A;  3S3M A;  1W36 C;  1ETO A;  2BY1 A;  5JVT A;  2XRL A;  2K9M A;  2KZV A;  2P5L C;  4N9I A;  5B66 C;  1ZHF A;  4AUX A;  1BI2 A;  4Y15 A;  1D1B A;  2FE3 A;  2E2J J;  2W1O A;  3WG7 H;  1XS9 A;  2XF5 A;  3C1D A;  1IJW C;  3MZY A;  2NVQ J;  3QOP A;  3JSO A;  2ZXJ A;  1UG0 A;  3BG3 A;  1IDZ A;  4OU0 A;  4MTD A;  2W25 A;  3RJP A;  2OQR A;  1QHG A;  1FPQ A;  3DU6 A;  3S1Q J;  2DOF A;  5K7H A;  3P9I A;  4M3G A;  3BTC A;  3K2Z A;  4ITV A;  3CCM I;  1MNE A;  3CZ6 A;  2XV4 S;  2ID3 A;  1T0F C;  1VQL I;  1OCC H;  2WY8 Q;  5ICF A;  3H0G J;  3KP6 A;  3TKY A;  2LC2 A;  5TJJ A;  5JLX A;  2UWM A;  1K7A A;  4C2T A;  3HHG A;  2V9K A;  3F0C A;  1B8I B;  4B48 A;  3JAM K;  1X2N A;  1MSE C;  4GGG A;  4CA0 A;  3HTU A;  4N4N B;  2R7W A;  1ORK A;  1H8A C;  3ZQH A;  2MW8 A;  1I3Q J;  3H1C A;  4LIT A;  1MND A;  5M3M J;  3ECH A;  2HQA A;  2CV0 A;  2EZI A;  2EZH A;  3BJA A;  2QEX I;  2IJL A;  3HOW J;  1FSE A;  3QP5 A;  1IO2 A;  3WTZ A;  3NAR A;  3HOZ J;  4RDU A;  3IUO A;  3U21 A;  3WTU C;  2QF7 A;  2YR2 A;  3A0B C;  2P6S A;  4AVZ A;  2DOE A;  3COA C;  1FZP B;  2K27 A;  1TWA J;  4F93 B;  2L3D A;  2EIJ H;  4W1U A;  5DEQ A;  2JUG A;  3BTL A;  3LOC A;  2QSF X;  5GPA A;  4L9J A;  2XRO A;  4AWX B;  1UHS A;  1Z6R A;  1B9N A;  3CDH A;  1ETX A;  1EH6 A;  2IGN A;  2VXD A;  4IHX A;  2DOA A;  4IQ4 A;  3MKZ A;  2DAO A;  3WU1 B;  5CJ9 A;  3D1N I;  4CHU A;  3QPH A;  1V54 H;  2K5C A;  4Q48 A;  2H94 A;  3B73 A;  4GXO A;  1FP2 A;  3ZMU A;  1ZQ3 P;  3AKZ A;  5BPD A;  2W48 A;  3B02 A;  4XN0 A;  4BQO A;  2UUZ A;  5F6F A;  1IN6 A;  4EAT A;  2VJ4 A;  4HV6 A;  5KVR A;  2K4J A;  4AIH A;  2HPI A;  1UAA A;  2ZME C;  3K4C A;  4QTR A;  3I71 A;  1RZ4 A;  3H0D A;  4P55 A;  4A3I J;  4BBS J;  1TL8 A;  5E79 C;  3L2R A;  2QLZ A;  3ZXS A;  2EH3 A;  3HPH A;  4IO9 F;  1LB2 A;  5EJC A;  2KIS A;  3OYD A;  3F8N A;  2F4I A;  2CW0 F;  1YS6 A;  3W2W A;  4BJ6 C;  1BJZ A;  5BS6 A;  5CPR B;  3ZQG A;  2GA1 A;  1P2F A;  4HF2 A;  3KX2 A;  2VJ5 A;  4DBR A;  1OR7 A;  2E19 A;  3LFK A;  2E1O A;  4P9U A;  4HV5 A;  1R58 A;  1WI3 A;  4M72 A;  2QQ8 A;  2RN7 A;  2NYX A;  2ZB9 A;  4N9H A;  5GP9 A;  4I01 A;  3GTP J;  4EGY A;  4UUS B;  4XOT A;  4UV8 A;  2DI3 A;  3DU5 A;  2XSD C;  5F04 A;  3TO7 A;  2AQF A;  1ULY A;  3LWF A;  1KU7 A;  4MNU A;  5D5U B;  2R7O A;  3EDP A;  5LD2 C;  1BOB A;  2XVC A;  3F9K A;  1H9T A;  3CP2 A;  2KL4 A;  3GCM A;  3F8B A;  1FWZ A;  2KT0 A;  2XPU A;  4BJ5 C;  2DDA A;  4HNV A;  1FOX A;  2O6G E;  5EGO B;  2LBF A;  2DYS H;  2GOM A;  1S72 I;  2PMH A;  3CCY A;  3FHN A;  1HXD A;  2MA3 A;  2NXN B;  1XGM A;  2V1N A;  3L2V A;  4KNY A;  3DV8 A;  3H9Q A;  2HXO A;  5CQE A;  3WTS C;  4IRG A;  2HVQ A;  3T0Y A;  2ZKZ A;  1Y8Q B;  2E2H J;  5B1A H;  4ZJZ A;  3K1N A;  1K4T A;  1U0J A;  2DDB A;  3KP5 A;  3KYC B;  3K2A A;  1E3H A;  4XOR A;  4RLQ A;  1FIA A;  1XG1 A;  4XR6 A;  2VUM J;  2PMZ A;  1K61 A;  1RRJ A;  2AHQ A;  4L18 B;  2BXY A;  4JX4 A;  2B63 J;  1WWX A;  3V7R A;  1LUJ B;  2DMU A;  3X2Q H;  4IVN A;  1V5G A;  4HRI A;  4DNC A;  2LG4 A;  3NWS A;  1IUY A;  1P4X A;  2R7V A;  1HDD C;  1U3E M;  1XN7 A;  1VTN C;  4XRS A;  4HPQ A;  3L9F A;  5DCM A;  1QPI A;  3S32 A;  1ENH A;  2R7T A;  2VAS A;  1X58 A;  3RQ4 A;  1TWG J;  1LFB A;  3DWL E;  4YFX F;  4BU2 A;  3TGN A;  3QRF F;  1R9T J;  1IN4 A;  2E5N A;  3DPT A;  2HR3 A;  1WJF A;  3GZN B;  3ABM H;  3JRA A;  4CCK A;  2PMU A;  1MJA A;  2JVG A;  4PUS A;  3F22 A;  1IG7 A;  2JPC A;  1FOK A;  1MDM B;  2ZJ2 A;  2BZT A;  2A69 F;  2IVM A;  2K7L A;  4HLY A;  4U87 A;  1IV8 A;  1W5C C;  3L09 A;  4GCV A;  3GUD A;  4UVC A;  4OIQ F;  2PEX A;  4ESB A;  1DU6 A;  3L2U A;  2EFQ A;  2JA2 A;  4A12 A;  3QYB A;  3SZT A;  5M5Y J;  3VB2 A;  2HYJ A;  1P4A A;  1J0R A;  3F8M A;  1BA5 A;  4PGG A;  2HTS A;  4IKF A;  3ABT A;  2ZO4 A;  2HYF A;  4AC0 A;  2MGQ A;  5GAG J;  2YPR A;  1XD7 A;  2X6X A;  4UUS A;  1LQ1 A;  4LK0 F;  2QVO A;  2QWW A;  3P9K A;  1YO5 C;  4J01 A;  1VQM I;  2JRT A;  4NC8 A;  1K4S A;  5E20 A;  4XKC A;  1OFC X;  4M9Z A;  4BAC A;  5D4R A;  1IRF A;  1I3A A;  2CW8 A;  1BI0 A;  4G8X A;  4E7K A;  2QSG X;  1I6X A;  2BVL A;  4YEJ A;  2E7W A;  2AO9 A;  3DTI A;  2VOD A;  5D8K B;  3HL2 A;  3OS1 A;  2RKH A;  2JWT A;  4BHC A;  3RCO A;  1WJD A;  3QPL A;  2X48 A;  3HGG A;  1ZH5 A;  2G7H A;  4DJA A;  5C3E J;  1XDU A;  3FKI J;  2MH2 A;  2DT6 A;  2Y9Y A;  4W97 A;  4BEH A;  2XIG A;  1E3O C;  1SFO J;  2GAU A;  3R60 A;  1BIB A;  2QQA A;  3U1K A;  5HS9 A;  2RQQ A;  1Y6I A;  3IAM 2;  2HDD A;  2FD5 A;  3S2H J;  3WTY C;  4PJL A;  2HNH A;  2BV6 A;  2IS6 A;  2EIN H;  2XUB A;  3PJR A;  4MGR A;  1G3T A;  1MNM C;  2ZFW A;  2OCC H;  3U9G A;  1STZ A;  3HUG A;  1QQI A;  4Y33 A;  1ZG5 A;  3AL0 C;  3F72 A;  5JHF A;  1UHW A;  1LPQ A;  1B9M A;  2KMU A;  2W4S A;  3CCJ I;  2K3P A;  1L0O C;  3DLL F;  1EV7 A;  2Q0O A;  2RRE A;  3GEZ A;  3ZR8 X;  3JRG A;  4BQA A;  1S29 A;  5ILV A;  5L3E A;  2JQ7 A;  4LLN A;  4L9V A;  3W6V A;  3PSF A;  1XMX A;  4FHT A;  1UB9 A;  2FRH A;  1HCR A;  3PFY A;  4LGW A;  2ACJ A;  2HWV A;  2HZT A;  3BC8 A;  1ZGJ A;  3CCL I;  1LFP A;  4HF0 A;  2IS4 A;  3E5X A;  1QGP A;  3IP4 B;  3BY6 A;  3HYI A;  1N78 A;  1GV5 A;  3HBL A;  2Q8K A;  2IRF G;  3RSN A;  3HOS A;  4IX7 A;  3K1P A;  1UHM A;  5AON A;  3WU0 A;  5EDN A;  5CVJ A;  2X51 A;  4ZTJ A;  2RGV A;  2A05 A;  3LQR A;  3ABK H;  2D45 A;  1YW7 A;  1PUE E;  2DXI A;  3AG3 H;  3AAF A;  2M3A A;  2BBY A;  2H1K A;  3O8H A;  3A2K A;  3DFG A;  3FHZ A;  3M07 A;  2XF6 A;  2P6T A;  1Z91 A;  3PNV A;  3S17 J;  4Z6Y A;  3FBI B;  2PJR B;  3CC2 I;  3BR6 A;  1XTA A;  4ZZL A;  2HYG D;  4S05 A;  1XCB A;  4A93 J;  3EYI A;  1NG7 A;  3GZ6 A;  3BQY A;  1J5Y A;  2DLL A;  2LTP A;  3GME A;  2L4A A;  5ERI A;  4WXH A;  1F36 A;  3RQI A;  1Z6T A;  1X1B A;  3IC7 A;  2NRA C;  3GYH X;  1IXS B;  3E5Q A;  3KE2 A;  2JK3 A;  2EZL A;  1BJA A;  3OYB A;  2DBB A;  1K83 J;  2E35 A;  3CES A;  4Q47 A;  3BTI A;  1N75 A;  1HF0 A;  4R1H A;  3MKW B;  1P7I A;  4RA2 A;  3SEZ A;  3CME I;  2CQN A;  4B47 A;  5DTD A;  1VF9 A;  2CO5 A;  1Z3X A;  4EJV A;  1S3J A;  2XKO A;  3BDD A;  4G6Q A;  5C4X J;  2JA8 J;  1GVJ A;  3KFW X;  2WTE A;  1Z05 A;  1I39 A;  3L2W A;  2A5W A;  1XX5 A;  2Y31 A;  1QBJ A;  4UUT A;  2QSH X;  1XSV A;  3VYU B;  3C7J A;  4XNF A;  3DEW A;  4Z2Y A;  4EJW A;  4BS9 A;  2XGD A;  3JTH A;  1AKH A;  1TWH J;  4EJT A;  1WH5 A;  1KU3 A;  1XB4 A;  1VI0 A;  5IOZ A;  4UVB A;  4M3B A;  3BZK A;  5K5O A;  3J7Z I;  1RPW A;  5IYB J;  3S1R J;  3OYM A;  1F4K A;  2PLY A;  4FX4 A;  3PNT A;  4Y7N J;  4E7Z A;  4E7L A;  2LY9 A;  2CV2 A;  1ETV A;  3MD2 A;  4Y13 A;  2I8D A;  2OA4 A;  1PP8 F;  2O8K A;  2DK5 A;  2KPM A;  2A5Y B;  2LDU A;  2L9N A;  2EJR A;  3FXO A;  4K2E A;  1AWC A;  4A3J J;  1YFH A;  4O5V A;  3C18 A;  3RKY A;  5HS7 A;  3VSL A;  3DEE A;  3LST A;  3K70 C;  4MFE A;  1VND A;  2L0K A;  4ON0 A;  3KPH A;  3KEQ A;  3A01 B;  2P5V A;  4BYY A;  5C4J J;  3E1S A;  3Q0V A;  3ZMS A;  5EGO A;  1H88 C;  3G1M A;  3SFZ A;  3F3X A;  2WWY A;  1WFX A;  2XAH A;  2M7A A;  1JHH A;  4WWC A;  1ZEL A;  3OOU A;  1JTX A;  1YQA A;  5LLQ A;  4J19 A;  2MC4 A;  2FQ4 A;  4II2 A;  5DM7 F;  2F5E A;  3RYP A;  2V4J C;  2LH9 A;  1ETY A;  2FUG 2;  1W7P B;  3DBL B;  5FD5 A;  2XPW A;  3E7L A;  3K7A J;  1B4A A;  2ECC A;  1ZLJ A;  4FAS D;  1IGN A;  2R5Z B;  2MSY A;  2KRH A;  5DDG A;  3SFI A;  2H09 A;  3ZGK A;  5E1Z B;  4FIS A;  6PAX A;  3QAH A;  2P7C B;  3BZC A;  3FXL A;  2NS8 A;  1CF7 B;  1U9N A;  2RVC A;  3FIS A;  4UVA A;  3CLQ A;  4XKB A;  2Q1Z B;  2DQL A;  2PG4 A;  2IAI A;  2EV0 A;  3CQZ J;  3VYS B;  1OYW A;  2WB1 N;  2OF7 A;  1ZN2 A;  3FM3 A;  2CQX A;  2DA3 A;  2L5Q A;  4XLE A;  4PJM A;  4BHB A;  1FNN A;  1WCM J;  4IEJ A;  3KP2 A;  2JA6 J;  1BC7 C;  3M9A A;  2CG4 A;  4CDG A;  4KIB A;  2DJI A;  3VEP A;  2NNY A;  2PMZ N;  2E34 A;  4BUP A;  1S7O A;  1DU0 A;  2IA1 A;  2IGK A;  2KDZ A;  1XGN A;  3WTX C;  1WJC A;  3RKW A;  2H6B A;  3ZRG A;  3CP8 A;  4F7Z A;  3L2C A;  2HKO A;  4A2U A;  2KP6 A;  2XGE A;  2A6E F;  3MVP A;  4ZC3 A;  1UST A;  2KQR A;  2ECB A;  1ZGW A;  2OCE A;  3ZP5 A;  4ANJ A;  5LEK A;  3WTV C;  1JI8 A;  3S3N A;  3S93 A;  3T8R A;  1YOV B;  5GAE J;  3Q0U A;  1OYI A;  1TWC J;  5CYV A;  2WB1 A;  4CCO A;  1E0E A;  1U5T B;  5IYD J;  5IP9 J;  3G6E I;  1IV6 A;  3GXO A;  3DPU A;  1JT6 A;  1VQP I;  2R7U A;  4NQW B;  3EET A;  2QUF A;  4LLL A;  2VPL A;  3A4C A;  3ZOB A;  4Y3O A;  5J1U A;  1OCR H;  2OAZ A;  2BY0 A;  4H4K C;  2Z2S B;  4DBQ A;  4V19 K;  4BXU A;  4P96 A;  1QRY A;  3U2R A;  4O6J A;  4BJT A;  2OPT A;  3ELK A;  2VON A;  2EZK A;  2WV0 A;  3LSI A;  3SZG A;  5H6R A;  5EYR A;  2EIL H;  3Q3S A;  4M9X A;  4E7J A;  4O3M A;  3H3U A;  2Z3Y A;  4M3E A;  4XID A;  1POG A;  1ETK A;  2BVM A;  3O6B B;  2ESH A;  2JSC A;  2F4O B;  2VPR A;  1MMA A;  2CUF A;  3FXQ A;  4LG0 A;  5IT3 A;  4U0Y A;  2L4M A;  2BYV E;  3FMQ A;  4HX7 A;  5EZH A;  1XC5 A;  4CZZ A;  2VQH A;  5JR3 A;  3J80 K;  2M30 A;  4RM3 A;  3Q5F A;  1YI2 I;  1D5V A;  4BY1 J;  1JE8 A;  2KRF A;  4YEL A;  5GAD J;  1KQ8 A;  1IN8 A;  4ZDO A;  2DQR A;  4HG2 A;  3WE3 A;  2LY2 A;  1OKR A;  1JUP A;  5DYM A;  4ENN A;  1JGG A;  4OOI A;  4XLF A;  2KJC A;  1G3S A;  2MG4 A;  3B6C A;  3IWF A;  2ISZ A;  1XPX A;  1YW9 A;  1FMV A;  3OIO A;  5BNG A;  2V6E A;  3D5S C;  2DPD A;  3I53 A;  2WAF A;  1K79 A;  2EFN A;  2PJP A;  3TBI A;  2WC2 A;  4B44 A;  1FMW A;  1R5G A;  5LHI A;  4A3C J;  1QZE A;  1I6H J;  3CO7 C;  2M2E A;  3OYE A;  1IN7 A;  4LJZ F;  1G3Y A;  4EEF G;  4D1Q A;  1FIP A;  1O57 A;  1SFU A;  3T1B A;  4A3B J;  2A3S A;  1TQP A;  2TDX A;  4NNJ A;  3A0H C;  2LVS A;  2BW3 A;  2DCE A;  4HW0 A;  3KLN A;  1IW7 F;  3I54 A;  2VQC A;  1A31 A;  2YU3 A;  3R0J A;  3K0L A;  3E5U A;  5FLM J;  1MMN A;  5DUK A;  4XON A;  2GXA A;  3M7G A;  2QQB A;  2PJR A;  5L3B A;  1O3T A;  2LY1 A;  1YRN A;  3VSK A;  4BBR J;  2E71 A;  1ODD A;  3IRQ A;  3UKG A;  3FK6 A;  1MBJ A;  3V8K A;  2A61 A;  2COM A;  4PGH A;  2R7R A;  2RV8 A;  2G7U A;  4XRF A;  1FT9 A;  5TGT A;  4XSZ F;  2EV6 A;  4CYC B;  1BM9 A;  3TO6 A;  4C3I J;  2A68 F;  3GVA A;  3IH3 A;  1EJ9 A;  4UV9 A;  3JW4 A;  4Y17 A;  2OJE D;  1VFC A;  1FBS A;  2UZK A;  2AQE A;  1FOW A;  3HG9 A;  1SAN A;  3KIO A;  2VKE A;  4F3Q A;  1AKH B;  1B6A A;  2GOX B;  2BEO A;  1ZK8 A;  5K7F A;  1MMG A;  2Y0S N;  1QVU A;  3RZO J;  2OD5 A;  3I4M J;  4BQQ A;  3T5X A;  2LFB A;  5HLG A;  2X0L A;  5LGU A;  2R4G A;  5FKK A;  2V1D A;  2FMY A;  2DYR H;  5KNL A;  2IA2 A;  3MN2 A;  5HLI A;  1FBQ A;  4C2M J;  1MBG A;  3OL3 A;  2EB7 A;  1YJN I;  1FYM A;  1HOM A;  2GIV A;  5CVU A;  4IZZ A;  4IJA A;  4OIO F;  3DKY A;  3W3C A;  1IUF A;  1NG6 A;  2OV7 A;  4EGZ A;  2QGU A;  5KAF C;  1TTY A;  4B8X A;  3RYR A;  2BE5 F;  2CWE A;  3QOD A;  4XIC A;  1PDN C;  3OYI A;  1T38 A;  3VDX A;  4E7H A;  1S7A A;  2ZC2 A;  2VJI A;  3FMR A;  3OYG A;  1TWF J;  3EPZ A;  1QO0 D;  3S2D J;  2NAZ A;  2OU2 A;  1PYV A;  1MBH A;  2IBD A;  4NC6 A;  4EM1 A;  2E1M B;  2HOT A;  1APL C;  2WY7 Q;  3D5L A;  4BE0 A;  5EZG A;  4RB3 C;  3ONQ A;  4CIC A;  2GA2 A;  1W7P D;  2PFB A;  5HS8 A;  3DCF A;  2HZD A;  2F4M B;  3CC7 I;  1YRN B;  3KP3 A;  3CO6 C;  4UXN A;  4KYW A;  2ESN A;  3GFJ A;  2CUJ A;  4RMN A;  3K4J A;  1D0Y A;  5H2F C;  1TQM A;  4JK1 X;  1P7J A;  2HXI A;  2K9Q A;  4ENJ A;  3FXR A;  5JHU A;  1CF7 A;  1W1W E;  3R61 A;  1IXR C;  1G8X A;  3HGY A;  2CH0 A;  4GRI A;  4UNO A;  1JKQ C;  1OCZ H;  2OTJ I;  3G4S I;  5E3N A;  5HLT A;  1IRX A;  4AVP A;  2YX7 A;  2PI0 A;  4L0Y B;  3IHU A;  4LD5 A;  2KLO A;  3TO9 A;  4OAZ A;  2TRT A;  1YIJ I;  1PP7 U;  4RM2 A;  1SD4 A;  4OIP F;  1LNW A;  3HRU A;  4PZJ A;  3OWT A;  1V5F A;  4V2G A;  4B1R A;  3ZQL A;  3OIP A;  2W24 A;  4HSR A;  1ZKG A;  3VOE A;  1BI3 A;  4KIT B;  1FEX A;  1RES A;  4RAG A;  2KIM A;  2H6C A;  2Z16 A;  4DZP A;  4RGU A;  4CYC A;  2EFP A;  1D3Y A;  3OYL A;  2EBI A;  2PX9 A;  1EA3 A;  5LRS A;  1ZRF A;  2L02 A;  1UZC A;  5D6F A;  2WAD A;  4PJ0 C;  1RUO A;  4XMY A;  4XOP A;  1Z77 A;  4OMZ A;  2BY2 A;  4KMF A;  5CVR A;  2UXN A;  4PDK A;  4JP0 A;  3GLL A;  5BQT A;  2R7Q A;  5FLV A;  3GTL J;  3OMY A;  4DQ2 A;  2HQN A;  4XKV A;  3I5U A;  3LA7 A;  3MAJ A;  4B09 A;  1I27 A;  2H27 A;  2VC0 A;  2LNB A;  1TQI A;  3BTJ A;  5FKM A;  2Y69 H;  1AHD P;  1WH7 A;  4KMU X;  2ZXI A;  2ELH A;  2QA4 I;  4C2U A;  4ZDL A; 
#chains in the Genus database with same CATH homology
 3FF5 A;  4Q5S F;  3J81 K;  4UHT A;  1S8N A;  2CSO A;  4FT8 A;  1JGS A;  1P6R A;  1KQ9 A;  4NQW A;  3D0S A;  1QZZ A;  3ZQ7 A;  4A0X A;  1U5T A;  4HF1 A;  3V8J A;  3EUH A;  1ZG1 A;  4KDP A;  4M73 A;  4IXA A;  3SZP A;  1G3W A;  1HW2 A;  2VC1 A;  1ZRE A;  1U8R A;  2A6H F;  5L3F A;  1UCR A;  5TRD A;  2W84 A;  3L00 A;  2NNN A;  1XMK A;  4HLX A;  3DKW A;  4P9F A;  3RKX A;  2FOK A;  4RB0 A;  3PFI A;  4KIC A;  5LHH A;  3V7C A;  4L5I A;  1ZAO A;  3ZMV A;  1D8J A;  1YYV A;  4IRH A;  2V1U A;  3ZMT A;  5ILS A;  1R23 A;  4XLP F;  1TNS A;  3N4M A;  2XAF A;  5D5W B;  1TW2 A;  2FML A;  4ZH4 F;  3TOA A;  1F9N A;  2F5F A;  2FBI A;  3HTS B;  4I0B A;  2JT1 A;  4MEX F;  2FU4 A;  2O03 A;  4A0Z A;  4RGR A;  4KIG A;  1LEA A;  3EQL F;  4KN7 X;  5LBQ A;  3I64 A;  2NS0 A;  1AOY A;  3ECO A;  4MQ9 F;  4KN4 X;  1DP7 P;  2HQR A;  1ON2 A;  4XSX F;  2A07 F;  5D6E A;  3ERE D;  2QQ9 A;  3IRR A;  2O61 A;  3ZMD A;  4LMY A;  4MQV A;  2KKO A;  3CUQ C;  3MCZ A;  4WXC A;  4AD9 A;  3DF8 A;  4G6D A;  3M1E A;  5J8C A;  5L3G A;  1W4M A;  2F5C A;  4HDV A;  1XGS A;  4ESJ A;  4M6X A;  2OBP A;  1J9I A;  3LAP A;  3CLO A;  2CQK A;  3P7N A;  1O3R A;  1FBU A;  1BBY A;  2IW5 A;  3SHF A;  5IT9 Z;  2K02 A;  3IKV A;  3T8T A;  3Q9S A;  1TBX A;  1FLI A;  1GXP A;  1K78 A;  5DCF A;  4HBL A;  4I0A A;  4H0E A;  5AIQ A;  4G7H F;  2VOP A;  2XAJ A;  1T39 A;  1CGP A;  4HQM A;  4RAY A;  3G3Z A;  3Q9V A;  1HW1 A;  1MD0 A;  3U1D A;  4AIJ A;  4CYD A;  3CUO A;  3L7W A;  2MLG A;  5L3C A;  2V9V A;  3GO5 A;  1DUX C;  3BJO A;  3HRM A;  5ICC A;  3BOQ A;  2E7X A;  3HSE A;  1W5S A;  3WTW C;  1SFE A;  1XDS A;  1KA8 A;  1YG2 A;  1O3S A;  3W6J B;  1TNT A;  3BRO A;  1FC3 A;  5FLX Z;  1QPM A;  4IRI A;  2OQG A;  1RIO H;  1R36 A;  2RC4 A;  4BAY A;  1SMY F;  5K5Q A;  1UFM A;  2MLK A;  3MEX A;  1F5T A;  3K1M A;  4ZYD A;  2Z33 A;  1SD6 A;  1U5T C;  1FX7 A;  1FY7 A;  1IF1 A;  2YSR A;  2RNJ A;  4M71 A;  2STT A;  4RAZ A;  3M8F A;  4N0B A;  4TV7 A;  4YII A;  1ZLK A;  3QU6 A;  4KUM A;  2ISY A;  3GFM A;  3IL2 A;  4L9N A;  5LGT A;  2XRN A;  3GX4 X;  1X3U A;  4G9Y A;  1P4W A;  1ZYR F;  1WKM A;  3GLX A;  2GXG A;  2K4B A;  1HW5 A;  3GW2 A;  3HIF A;  4GO1 A;  5LEJ A;  5HDK A;  2F2E A;  1JXS A;  4HOB A;  1WRJ A;  2JZY A;  5K5R A;  1FYL A;  4HX4 A;  1I1G A;  2STW A;  4P5O A;  1FYK A;  3E6C C;  2MC3 A;  2DO7 A;  3IKT A;  1Z1D A;  2GZW A;  2DU9 A;  1T0F A;  2ZNY A;  2EFW A;  1LEB A;  3PQJ A;  1K6O A;  1SD5 A;  2XGX A;  3OV8 A;  3DP7 A;  2RQP A;  3E6B A;  2MD5 A;  1BIA A;  1T6S A;  2DTR A;  1IAW A;  2Q2E A;  1U6G A;  2FEZ A;  2ZCW A;  3H92 A;  2IA0 A;  3QP6 A;  4OIN F;  1MJ9 A;  3J80 Z;  2ADU A;  1RNL A;  3TDZ C;  2O0Y A;  4L5J A;  5LGN A;  2ZME B;  1H9G A;  4U0W A;  1D8K A;  1J59 A;  2JTV A;  2HFH A;  1OMI A;  4ZYE A;  1WI9 A;  2DW4 A;  5ICG A;  1HKQ A;  2IP2 A;  5ILU A;  5FFZ A;  3J7A O;  2XHK A;  2PQ8 A;  3GWZ A;  5E8G A;  1KQ0 A;  1B59 A;  3CTA A;  3MFK A;  5FO5 A;  3M8E A;  2QYO A;  1HSJ A;  4MTE A;  1BN5 A;  2VBW A;  3KZY A;  4R79 A;  4NB5 A;  4ZYH A;  3KP4 A;  1ZAR A;  2FF4 A;  3W6K B;  4JQF A;  2QBY A;  1SFX A;  1EH8 A;  2FBK A;  1I1S A;  2K86 A;  2Z99 A;  3E6M A;  3QPT A;  1DPU A;  1XGO A;  4D0P A;  4HZF A;  4MHG A;  5BMZ A;  1G4D A;  2M87 A;  1ZG3 A;  1LDK B;  1BI1 A;  5EEG A;  3I0T A;  5E1W A;  4UUV A;  1BC8 C;  2Z9O A;  3HSF A;  2LSO A;  3FWE A;  4A0Y A;  2M8E A;  4EMS A;  4AIK A;  1KYW A;  3BZ6 A;  4KFC A;  3ZN1 A;  1OPC A;  5AIP A;  3ZPL A;  3HSR A;  2EK5 A;  3SQN A;  2VBZ A;  5HDG A;  5CVV A;  4A5N A;  2HTJ A;  3MQ0 A;  3ROU A;  3RTR A;  1O7L A;  4I2O A;  2JPB A;  2ZME A;  3BP8 A;  2ETH A;  3VFZ A;  5HVQ C;  4OIR F;  2FNP A;  1K78 B;  1LVA A;  3LQQ A;  1RUN A;  3RPU A;  4KA4 A;  5FD6 A;  2KIU A;  1S6L A;  5FFX A;  2FXA A;  3TDU C;  3CUQ B;  4QLC U;  3QU3 A;  2P4W A;  3KET A;  3S2W A;  1BOA A;  2M1B A;  4EVI A;  1XSX A;  1DDN A;  1NHA A;  3E6D A;  3K69 A;  2BGC A;  3VOD A;  2IPQ X;  1TLH B;  2FBH A;  3TOB A;  1R1U A;  1KGS A;  3KEO A;  4U0V A;  2W85 A;  1R5H A;  5F1R A;  2HEO A;  1QNT A;  3K9T A;  1Z7U A;  2QBY B;  2Y48 A;  4EJO A;  3ABU A;  4LFU A;  5ED4 A;  1WQ2 A;  1W7P A;  2LKP A;  1HQC A;  1WSU A;  4YFK F;  4I7H A;  4EQQ A;  2VT2 A;  1YW8 A;  1L3L A;  5FLX K;  1LDJ A;  4EV0 A;  4WX9 A;  4G7Z F;  1LJ9 A;  4E70 A;  1ZRD A;  1DPR A;  5BPI A;  2L54 A;  3WE2 A;  1IN5 A;  3RPQ A;  3F8C A;  4EM2 A;  4HAM A;  4ENM A;  2R7D A;  4XLN F;  3LAJ A;  2RDP A;  2P5K A;  3BPX A;  3KZZ A;  1IZ1 A;  1MGT A;  4JBA A;  3IWZ A;  4CGZ A;  4RGX A;  4IHT A;  3NRV A;  5DCM B;  4EJU A;  1QZY A;  2QM3 A;  3F6O A;  2V6C A;  4LG0 B;  4KIF A;  4WXD A;  2GWR A;  1KU2 A;  3NEU A;  4M9S A;  4HDU A;  4G7O F;  1HST A;  4S04 A;  3E3V A;  3DXJ F;  1J7K A;  2FA5 A;  1J2X A;  2CYY A;  2XAG A;  1Q1H A;  3RI4 A;  3V7S A;  4YFN F;  2HGC A;  2P7V B;  4U7D A;  3V8L A;  1ZGA A;  4U88 A;  4HYE A;  2VBY A;  1R7J A;  3R0A A;  4GYG A;  4ETS A;  4YG2 F;  5D5V B;  1KU9 A;  1Z9C A;  1LDD A;  2Z5U A;  1USS A;  2AXL A;  2VBX A;  1E2X A;  2LF7 A;  5J8F A;  3WG9 A;  5H6Q A;  3HRT A;  2VN2 A;  4WK8 F;  2GXB A;  2XKP A;  1R22 A;  2MH9 A;  3PQK A;  2EWN A;  1YS7 A;  4PCQ A;  1MJB A;  4FX0 A;  1W5T A;  2W57 A;  5E18 F;  1YLF A;  3GZ5 A;  4MEY F;  2J5P A;  3RDI A;  1IXC A;  3ISP A;  4RB1 A;  3MZH A;  3OOP A;  1U78 A;  2J5O A;  2X4H A;  2Y0M A;  2B0L A;  3KP7 A;  2C6Y A;  3F8F A;  5EEH A;  1SD7 A;  3FX3 A;  1XCV A;  3I59 A;  3WOD F;  1C0W A;  1XMA A;  2FNA A;  2DFI A;  2HOE A;  2R7F A;  1V4R A;  4A6D A;  1E17 A;  1KYZ A;  3R6S A;  2R3S A;  3TQN A;  3DEU A;  5LRR A;  1Y0U A;  2LF8 A;  4ENK A;  4BHP A;  4CO8 A;  1A04 A;  3SXY A;  4IF4 A;  1YTY A;  1G6N A;  2DT5 A;  3R4K A;  5F64 A;  2KJB A;  3KCC A;  2O8X A;  4HA8 A;  2PBI A;  4G94 A;  1ZRC A;  5BOX A;  3F6V A;  5DV5 A;  5FGM A;  2ZBK A;  2YX4 A;  2FSW A;  2KIF A;  1J75 A;  4I98 B;  5A2Q Z;  2M45 A;  2VE9 A;  3ML6 A;  3WTT C;  3DPL C;  2HKX A;  1REP C;  3C3W A;  5FB2 A;  4BH9 A;  3WGG A;  1I5Z A;  3LA2 A;  3LA3 A;  3FM5 A;  3JTG A;  4IPA A;  4RB2 C;  3REO A;  3BWG A;  5A2Q K;  5DUI A;  1U2W A;  5E1X A;  4M6Y A;  5JFR A;  1JHF A;  3GF2 A;  3ULQ B;  4LK1 F;  2ZNZ A;  3I59 B;  4LLG F;  2UXX A;  1XSD A;  4ASN A;  3P9C A;  5J6X A;  3I4P A;  2E1N A;  3NQO A;  3V4G A;  5H20 A;  3DQV C;  3F23 A;  4A6E A;  4QWQ A;  5HLH A;  1FP1 D;  2VOO A;  2D1V A;  1T2K A;  1EH7 A;  1RI7 A;  2OZ6 A;  4L0Z B;  2PN6 A;  2VXZ A;  1B1B A;  5DD4 A;  2D1H A;  3G73 A;  2G9W A;  4M74 A;  2EV5 A;  4Q4Z F;  3FZV A;  4RS8 A;  4EM0 B;  4LB5 A;  3MWM A;  5CVI A;  4WF2 A;  4HX8 A;  4ESF A;  2DPU A;  4IHS A;  2QEN A;  2IT0 A;  5CLS A;  2EA2 A;  5L3D A;  4RGS A;  2VT3 A;  2D2W A;  2MBF A;  5E17 F;  3FMS A;  1P92 A;  2F5D A;  4I02 A;  5K1Y A;  1MZB A;  1R00 A;  2V1X A;  3GFL A;  2V79 A;  2GQQ A;  1F1Z A;  3CUQ A;  1YIO A;  1R1T A;  4XBF A;  1SMT A;  2OZU A;  1R1V A;  4BNC A;  2CGP A;  1TW3 A;  3BJ6 A;  1HKT A;  1ONV A;  5HDN A;  1FSH A;  3HHH A;  3GFI A;  2XAS A;  5JI6 A;  4ZZD A;  2HS5 A;  3HRS A;  4KT5 C;  3J81 Z;  1O7F A;  1H0M A;  5KK1 A;  2QZ8 A;  3KLO A;  5D4S A;  4GYI A;  3HOT A;  4OMY A;  3BPV A;  1IRG A;  5E8I A;  2HDC A;  3JAM Z;  5D5X B;  3O2P E;  2XAQ A;  4L9T A;  1T98 A;  2M5W A;  2FQ3 A;  2P8T A;  5IT9 K;  5DD8 A;  2E1C A;  4YIF A;  1V3F A;  3FXU A;  4CXF A;  1MDM A;  1GHC A;  3ZN0 A;  3CJN A;  4A5M A;  4U7B A;  3JSP A;  1SAX A;  5ICE A;  4LB6 B;  3WGI A;  2CFX A;  3E97 A;  4ZYG A;  1OYY A;  1HBX G;  1GXQ A;  1ON1 A;  4I09 A;  5LHG A;  2EA4 A;  2O3F A;  3WGH A;  2Y75 A;  3I58 A;  4WCG A;  3RIR A;  3H3Z A;  3EYY A;  4R8H A;  3ZMZ A;  5D8L B;  1HKS A;  1MKM A;  2L01 A;  1O3Q A;  4HQE A;  2EFO A;  3N97 A;  3F21 A;  2AS5 F;  4NHJ A;  3O3K A;  5HOO A;  2DK8 A;  2VE8 A;  5JVT A;  2P5L C;  4N9I A;  1ZHF A;  1BI2 A;  4Y15 A;  2FE3 A;  3C1D A;  3MZY A;  3QOP A;  3JSO A;  2ZXJ A;  4OU0 A;  4MTD A;  2W25 A;  3RJP A;  2OQR A;  1FPQ A;  3P9I A;  3K2Z A;  2XV4 S;  5ICF A;  3KP6 A;  3TKY A;  5TJJ A;  2UWM A;  1K7A A;  3HHG A;  3JAM K;  4GGG A;  3HTU A;  3ECH A;  3BJA A;  2IJL A;  1FSE A;  3QP5 A;  3WTZ A;  3WTU C;  2YR2 A;  2P6S A;  3COA C;  1FZP B;  2K27 A;  2L3D A;  5DEQ A;  4L9J A;  2XRO A;  4AWX B;  1Z6R A;  1B9N A;  3CDH A;  1EH6 A;  2DAO A;  3WU1 B;  5CJ9 A;  4CHU A;  3QPH A;  4Q48 A;  2H94 A;  3B73 A;  4GXO A;  1FP2 A;  3ZMU A;  5BPD A;  3B02 A;  5F6F A;  1IN6 A;  4HV6 A;  5KVR A;  2K4J A;  4AIH A;  3I71 A;  1RZ4 A;  4P55 A;  2QLZ A;  1LB2 A;  3F8N A;  2CW0 F;  1YS6 A;  5BS6 A;  2GA1 A;  1P2F A;  4HF2 A;  1OR7 A;  3LFK A;  4P9U A;  4HV5 A;  1R58 A;  4M72 A;  2RN7 A;  2NYX A;  4N9H A;  4I01 A;  4EGY A;  4UV8 A;  2DI3 A;  3TO7 A;  1ULY A;  3LWF A;  1KU7 A;  4MNU A;  5D5U B;  3EDP A;  2XVC A;  1H9T A;  1FWZ A;  3F8B A;  2O6G E;  2PMH A;  2MA3 A;  1HXD A;  4KNY A;  1XGM A;  3DV8 A;  3WTS C;  4IRG A;  3T0Y A;  2ZKZ A;  3K1N A;  3KP5 A;  4L18 B;  1WWX A;  3V7R A;  4IVN A;  4DNC A;  1IUY A;  1P4X A;  1U3E M;  1XN7 A;  1VTN C;  3L9F A;  5DCM A;  4YFX F;  3TGN A;  3QRF F;  1IN4 A;  3DPT A;  2HR3 A;  2PMU A;  1MJA A;  3F22 A;  2JPC A;  1FOK A;  1MDM B;  2ZJ2 A;  2A69 F;  2IVM A;  2K7L A;  4HLY A;  3L09 A;  4GCV A;  3GUD A;  4UVC A;  4OIQ F;  2PEX A;  4ESB A;  2EFQ A;  4A12 A;  3SZT A;  3VB2 A;  1P4A A;  1J0R A;  3F8M A;  4PGG A;  2HTS A;  3ABT A;  2ZO4 A;  2HYF A;  2YPR A;  1XD7 A;  1LQ1 A;  4LK0 F;  2QVO A;  2QWW A;  3P9K A;  1YO5 C;  2JRT A;  5E20 A;  4M9Z A;  5D4R A;  1IRF A;  1BI0 A;  4G8X A;  1I6X A;  2E7W A;  2VOD A;  5D8K B;  2RKH A;  4BHC A;  1ZH5 A;  2G7H A;  1XDU A;  2MH2 A;  2XIG A;  2GAU A;  3R60 A;  1BIB A;  2QQA A;  5HS9 A;  3WTY C;  2BV6 A;  2XUB A;  4MGR A;  1G3T A;  2ZFW A;  3U9G A;  1STZ A;  3HUG A;  1QQI A;  1ZG5 A;  3F72 A;  1UHW A;  1B9M A;  1L0O C;  1EV7 A;  2Q0O A;  3GEZ A;  4BQA A;  1S29 A;  5ILV A;  5L3E A;  4LLN A;  4L9V A;  4FHT A;  1UB9 A;  2FRH A;  4LGW A;  2ACJ A;  2HWV A;  2HZT A;  1ZGJ A;  4HF0 A;  3E5X A;  1QGP A;  3BY6 A;  3HYI A;  2Q8K A;  2IRF G;  3HOS A;  3K1P A;  1UHM A;  3WU0 A;  5AON A;  5CVJ A;  2RGV A;  3LQR A;  2D45 A;  1YW7 A;  1PUE E;  3AAF A;  2BBY A;  3DFG A;  3FHZ A;  2P6T A;  1Z91 A;  4ZZL A;  2HYG D;  4S05 A;  1XCB A;  3EYI A;  3GZ6 A;  1J5Y A;  2DLL A;  2L4A A;  5ERI A;  4WXH A;  1Z6T A;  3IC7 A;  2NRA C;  3GYH X;  1IXS B;  3E5Q A;  3KE2 A;  1BJA A;  2DBB A;  4Q47 A;  4R1H A;  2CO5 A;  4EJV A;  1S3J A;  2XKO A;  3BDD A;  4G6Q A;  1GVJ A;  3KFW X;  2WTE A;  1Z05 A;  1QBJ A;  1XSV A;  3C7J A;  4EJW A;  4Z2Y A;  3JTH A;  4EJT A;  1KU3 A;  1XB4 A;  4UVB A;  5K5O A;  1F4K A;  2PLY A;  4FX4 A;  4Y13 A;  2OA4 A;  1PP8 F;  2DK5 A;  2A5Y B;  2LDU A;  2EJR A;  4K2E A;  1AWC A;  1YFH A;  4O5V A;  3C18 A;  3RKY A;  5HS7 A;  3LST A;  4ON0 A;  3KEQ A;  2P5V A;  4BYY A;  3ZMS A;  3SFZ A;  3F3X A;  2WWY A;  2XAH A;  1JHH A;  4WWC A;  1YQA A;  5LLQ A;  2F5E A;  3RYP A;  1W7P B;  5FD5 A;  1B4A A;  1ZLJ A;  5DDG A;  2H09 A;  5E1Z B;  6PAX A;  3QAH A;  2P7C B;  1CF7 B;  2RVC A;  4UVA A;  2DQL A;  2PG4 A;  2EV0 A;  1OYW A;  1ZN2 A;  3FM3 A;  4BHB A;  1FNN A;  3KP2 A;  1BC7 C;  3M9A A;  2CG4 A;  4CDG A;  4KIB A;  3VEP A;  2NNY A;  1S7O A;  2IA1 A;  1XGN A;  3WTX C;  3RKW A;  2H6B A;  4F7Z A;  3L2C A;  2HKO A;  4A2U A;  2A6E F;  1UST A;  3ZP5 A;  5LEK A;  3WTV C;  3T8R A;  1OYI A;  5CYV A;  1U5T B;  3GXO A;  3EET A;  2QUF A;  4LLL A;  2OAZ A;  4BXU A;  4P96 A;  3U2R A;  4O6J A;  3ELK A;  2VON A;  2WV0 A;  5H6R A;  4M9X A;  4O3M A;  3H3U A;  2Z3Y A;  3O6B B;  2ESH A;  2JSC A;  3FXQ A;  4LG0 A;  5IT3 A;  4U0Y A;  2L4M A;  2BYV E;  3FMQ A;  4HX7 A;  4CZZ A;  5JR3 A;  3J80 K;  3Q5F A;  2M30 A;  1D5V A;  1JE8 A;  2KRF A;  1KQ8 A;  1IN8 A;  2DQR A;  3WE3 A;  1OKR A;  5DYM A;  4ENN A;  4OOI A;  2KJC A;  1G3S A;  3IWF A;  2ISZ A;  1YW9 A;  2DPD A;  3I53 A;  1K79 A;  2EFN A;  2PJP A;  2WC2 A;  1R5G A;  5LHI A;  3CO7 C;  1IN7 A;  4LJZ F;  1G3Y A;  1SFU A;  1O57 A;  3T1B A;  2A3S A;  1TQP A;  2TDX A;  4HW0 A;  3KLN A;  1IW7 F;  3I54 A;  2YU3 A;  3R0J A;  3K0L A;  3E5U A;  5DUK A;  3M7G A;  2QQB A;  5L3B A;  1O3T A;  1ODD A;  3IRQ A;  3V8K A;  2A61 A;  2COM A;  4PGH A;  2RV8 A;  2G7U A;  4XRF A;  1FT9 A;  4XSZ F;  2EV6 A;  1BM9 A;  3TO6 A;  2A68 F;  3GVA A;  4UV9 A;  3JW4 A;  4Y17 A;  1FBS A;  2UZK A;  1B6A A;  2BEO A;  2OD5 A;  3T5X A;  5HLG A;  2X0L A;  5LGU A;  2V1D A;  2FMY A;  2IA2 A;  5HLI A;  1FBQ A;  2EB7 A;  1FYM A;  2GIV A;  5CVU A;  4IJA A;  4OIO F;  4EGZ A;  1TTY A;  4B8X A;  3RYR A;  2BE5 F;  1PDN C;  2CWE A;  1T38 A;  1S7A A;  3FMR A;  1QO0 D;  2NAZ A;  2OU2 A;  4EM1 A;  3D5L A;  4RB3 C;  4CIC A;  2GA2 A;  1W7P D;  2PFB A;  5HS8 A;  3KP3 A;  3CO6 C;  4UXN A;  4KYW A;  2ESN A;  3GFJ A;  1TQM A;  4JK1 X;  4ENJ A;  3FXR A;  5JHU A;  1CF7 A;  3R61 A;  1IXR C;  4UNO A;  4AVP A;  2YX7 A;  2PI0 A;  4L0Y B;  3IHU A;  4LD5 A;  3TO9 A;  1PP7 U;  1SD4 A;  4OIP F;  1LNW A;  3HRU A;  4PZJ A;  2W24 A;  3VOE A;  1BI3 A;  2KIM A;  2H6C A;  4RGU A;  2EFP A;  1D3Y A;  5LRS A;  1ZRF A;  2L02 A;  5D6F A;  1RUO A;  4OMZ A;  4KMF A;  5CVR A;  2UXN A;  4PDK A;  5BQT A;  4DQ2 A;  2HQN A;  3I5U A;  3LA7 A;  3MAJ A;  4B09 A;  1I27 A;  2H27 A;  2VC0 A;  2LNB A;  1TQI A;  4KMU X;  2ELH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...