2KDZA

Structure of the r2r3 dna binding domain of myb1 protein from protozoan parasite trichomonas vaginalis in complex with mre-1/mre-2r dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
107
structure length
107
Chain Sequence
b'KVKFTEEEDLKLQQLVMRYGAKDWIRISQLMITRNPRQCRERWNNYINPALRTDPWSPEEDMLLDQKYAEYGPKWNKISKFLKNRSDNNIRNRWMMIARHRAKHQKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYB24
publication title NMR structural analysis of DNA recognition by a novel Myb1 DNA-binding domain in the protozoan parasite Trichomonas vaginalis.
pubmed doi rcsb
source organism Trichomonas vaginalis
molecule tags Transcription/dna
total genus 29
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13921 Myb_DNA-bind_6 Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2kdzA01
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2kdzA02
1R9TJ 2DA4A 1K61A 3FK7A 4UUSA 2EBIA 3G1OA 2HI3A 1ORKA 4MIMA 2GBYA 3PM1A 2G0EA 5EEAA 2WV1A 2VUMJ 3S1RJ 1JUSA 1TWAJ 4BY7J 5FKOA 5C4JJ 1DU0A 2EH3A 1ETQA 1PUFA 2L7ZA 3GTJJ 1IG7A 2CU7A 4D5CA 1BW6A 1AKHB 4FE4A 5DS9A 1TWCJ 3CCYA 3LOCA 3QQAA 4MO7A 3BR5A 1ETVA 2JA6J 1YRNA 2XGDA 4M3GA 1ZGWA 4MLOA 3BR3A 3GBGA 4M3EA 2VI6A 4G12A 1FTZA 1WH7A 5GPCA 3A01A 2R93J 2VKVA 3TP3A 4DZJA 3JRIA 1B8IB 5GP9A 2TRTA 1HCRA 1MSEC 4A3BJ 1WH5A 3IV5A 3ZQCA 1JJ8C 4IEJA 3DCFA 1LFBA 4M3DA 1FJLA 3BG9A 4X6AJ 2XPWA 3BR1A 4FCYA 4A3IJ 1GUUA 5FKNA 5F0FA 4XRSG 3VPRA 3CQZJ 3GTKJ 3G1LA 2M34A 2JWTA 3BR0A 2L7MP 2I10A 2M9HA 3C2BA 4JX5A 4ABZA 4IHVA 2K9QA 1X2NA 5FKKA 2E19A 2MSYA 2NS8A 1TWHJ 5IP6A 1RETA 2LR8A 2YUSA 3BR6A 2YU9J 5BNGA 2LLKA 1MBEA 2CRGA 4M6VA 4CYCB 3JR9A 1UMQA 5M5XJ 3SJMA 3TEDA 3BTIA 1UG2A 4V2GA 3JRHA 4B3AA 2RAEA 3FKIJ 3I4NJ 5K7HA 3CMYA 2HDDA 2CQXA 1Y1WJ 2O8KA 3GTLJ 5EZGA 3F0CA 1H89C 1EF4A 2DN0A 2ELKA 3FIWA 1ZKGA 5FLVA 4A3EJ 2ME0A 3K2AA 1K83J 2DMQA 1QVUA 2Y9YA 2NVTJ 3E7LA 4M3FA 2Y31A 3NARA 4QSHA 2OPTA 3M3YJ 3BTCA 3HB9A 4AYBN 3OSGA 4J19A 3S16J 1RKWA 1RR7A 4A3DJ 2LVSA 3SDGA 2NVXJ 2EZIA 2QCOA 2DA7A 5JLWA 2KT0A 1XG1A 3HEFA 4IHWA 4IHYA 2R5ZA 2DMUA 5EG0B 4D7NA 2NVYJ 1O4XA 3FISA 3ZQFA 2NVQJ 3Q0UA 3O8HA 1B72A 4A3GJ 3SFIA 1ITYA 2LP0A 4QTRA 4I6ZA 1I3QJ 3S15J 2Y9ZA 2MG4A 1MBGA 1ETYA 4A3MJ 1IJWC 3LSPA 4D5FA 3S17J 1U9NA 4XRSA 4Y52J 1GVDA 2ID3A 5EGOB 2NS7A 2FJ1A 1MSFC 1HF0A 3CDLA 3D1NI 1FEXA 3BR2A 2YS9A 2JMWA 4L5EA 2XSDC 2R5YA 2X6OA 3I4MJ 2DMTA 3OOUA 1FIAA 1H8AC 1FIPA 2Y30A 4DW6A 2WAQN 3TW7A 5M3MJ 1W0UA 1LE8B 2HYJA 1IUFA 2K40A 2ID6A 2EZKA 2W48A 2R92J 1AHDP 4HNVA 2CUEA 2COBA 5FLMJ 1MNMC 2DMNA 1ETOA 1OJLA 2JN6A 1Z77A 3ZQHA 3OSFA 1NK2P 1ZQ3P 2L7FP 3B6AA 1G2HA 2EZHA 2KDZA 1WCMJ 5IP9J 1AKHA 4B4CA 4BY1J 3BG5A 3HGGA 2MW8A 1JJ6C 1BW5A 3BTLA 2DA2A 5FKMA 1ZR4A 3HOWJ 1WGXA 1JT6A 3GTPJ 4I76A 4NDLA 3L1PA 3BQYA 1Q1VA 1T33A 1ZR2A 1APLC 2LY9A 3LSRA 1QRYA 3HOXJ 2LFBA 4FE7A 3HOYJ 2XPUA 5K7FA 4FISA 5K7ZA 4RBOA 1B8IA 3BG3A 2DTZA 5FKLA 2K9SA 3BTJA 5F27A 5EDNA 2O7OA 1AU7A 1SANA 2M2EA 3GTMJ 2K9NA 5F0HA 3W6VA 3S2HJ 2XPVA 2DJNA 4IHXA 2LKXA 5E3NA 2N8GA 5JLXA 4A3LJ 4MFEA 2O9LA 3HOUJ 2M0CA 1W0TA 2LD5A 3GTQJ 1DU6A 2H8RA 1GDTA 3UKGA 3ZOBA 4C2MJ 3QPLA 2IEKA 2ZB9A 3LNQA 1JKOC 3S1MJ 4A69C 1WI3A 1D5YA 1X58A 1CQTA 3RZOJ 1F36A 1GV5A 3FK6A 1GT0C 3HM5A 4CYCA 1FTTA 2X9DA 4W97A 1JTYA 1S7EA 5IP7J 3Q0WA 2DMPA 2IAIA 5FJ8J 2XGEA 3S1NJ 3BT9A 5E3MA 3LSJA 5F08A 3WHBA 4GFBA 3IH2A 3HOZJ 1A6IA 2E2JJ 2VKEA 1JKRC 2L0KA 4A3FJ 2H1KA 1SFOJ 5IOZA 1ZK8A 2P81A 4JX6A 4XRMA 1OCPA 4MFDA 2LK2A 5F0CA 4BBRJ 1HOMA 1JT0A 4UUSB 1E3OC 2E2IJ 2PMZN 4B1RA 1IV6A 2JA8J 2IBDA 3DEWA 1P7IA 2AO9A 1OCTC 1ENHA 2EQRA 1Y1VJ 1ETKA 2HXIA 2NOGA 1PUFB 1HDDC 2JA7J 4LOCA 5EG0A 5E3LA 3A02A 2Y0SN 1VNDA 4FTHA 5C44J 4QIWN 1MBJA 4AC0A 1GV2A 1YRNB 4DYQA 2CQQA 3PO2J 3JRBA 3MKLA 4XK4A 3M4OJ 4Y7NJ 1TC3C 3IH3A 4D7MA 1VF9A 4XICA 2JK3A 3A01B 5E3OA 1LFUP 9ANTA 4UUTA 1TWFJ 2DA5A 4A3KJ 1H88C 5EGOA 1BA5A 2DA3A 1JKQC 3MN2A 1Z0XA 4DYCA 3JRFA 3JRCA 1IGNA 5HODA 4V2FA 1T56A 1A5JA 4EEFG 3JRGA 3A03A 1NTCA 2DA1A 1UHSA 4A3JJ 3B6CA 1VI0A 2JJ7A 1IDZA 2XB5A 1OFCX 2R7ZJ 2ECCA 1IRZA 1X2MA 4JP0A 1U8BA 2FX0A 3LSGA 5EYRA 2FQ4A 1LE8A 1NK3P 2XB0X 3JRDA 2QF7A 4S0HB 5IOYA 2LTPA 1HDPA 5J1UA 2M8GX 2VPRA 3IH4A 3OIOA 5C4XJ 5IYCJ 1U78A 3S2DJ 2GM4A 1RKTA 1TWGJ 1XC5A 2L9RA 2HOAA 3S14J 4JX4A 2MGQA 1ZTRA 2X48A 3RKQA 4X1EA 5IYBJ 1IDYA 2DA6A 2Y2ZA 3G1MA 5M5YJ 1HLVA 2E2HJ 1MBFA 5EZHA 3HKZN 1POGA 4A93J 3RQIA 3GTGJ 2B63J 5EF6A 3ZQIA 3TP0A 1MBHA 4A3CJ 3GTOJ 4BXXJ 5F04A 3PO3J 2D5VA 5M3FJ 3S1QJ 3JREA 3WHCA 1RPWA 2WB1N 2R0QC 1ETWA 5DTDA 1JKPC 4RDUA 3Q3SA 1WPKA 2FD5A 2JA5J 4M3BA 1IC8A 2HOSA 5J1RA 1ETXA 2R5ZB 3K7AJ 1MBKA 5J3LA 3MVPA 3NAUA 4JYKA 4AUXA 4C3JJ 1RESA 1B72B 1JTXA 3H0GJ 3HBLA 3JRAA 1QVTA 5IPAA 1I6HJ 4C3HJ 1P7JA 2XGCA 3BQZA 1JGGA 5F1JA 1MH3A 3ZQGA 4C3IJ 3ZQLA 3O8GA 1BJZA 1JUPA 2AHQA 2ECBA 1JUMA 2TCTA 2E1OA 4BBSJ 1F43A 2CUFA 5IYDJ 1MH4A 1QPIA 3H3VK 3HOVJ 2HXOA 4XIDA 4BKXA 2HOTA 2EZLA 2GLOA 2XRLA 5J1YA 3Q0VA 1U9OA 2R5YB 3QPSA 1BL0A 4DYRA 2ME6A 3HGYA 2CJJA 3HDDA 1I50J 1VFCA 3RZDJ 5M5WJ 4DZPA 3TW6A 4W1UA 5C3EJ 1XS9A 5GPAA 2HQ5A 2OF7A
chains in the Genus database with same CATH superfamily
3BPVA 4RLQA 1K61A 2HVQA 2JTVA 1IUYA 3I55I 2O61A 2HI3A 3PM1A 5EEAA 3RDIA 1IW7F 3S93A 2GIZA 2G9WA 3ML6A 2VL8A 5F1RA 1ZAOA 3MZHA 2A61A 1SVLA 1V5EA 2DYRH 3M8EA 4LIVA 5E18F 4PCQA 2RN7A 3ZRGA 1XSDA 5FLXK 2PG4A 2DPDA 1T98A 2J5PA 2ELHA 1ZELA 3VEPA 3SFZA 1FMVA 4S04A 4E7JA 3AAFA 3KP3A 1YW8A 1QNTA 2EK5A 4MLOA 1R00A 1SC7A 3BR3A 4ZZLA 5LRRA 2IGOA 4KIGA 4D0PA 2MD0A 3HIFA 4HAMA 2RNGA 3KYCB 2ICWG 4ZDLA 4A5NA 3IHUA 3PSFA 4KITB 2X1CA 4BQQA 2RGVA 1YW7A 3TP3A 5LEKA 4DZJA 1MSEC 3ZQCA 3GYHX 1J5YA 1YS6A 2YX4A 4M74A 1G3TA 3K0LA 1R1UA 2F5FA 1XDUA 4M3DA 1FJLA 2BY0A 1BI3A 1UELB 3U1DA 3F8FA 5HDKA 3PIOF 4X6AJ 4KN7X 5DV5A 2VJ5A 1NHAA 2CFOA 4XRSG 2IS6A 2EIMH 3CQZJ 3GTKJ 1R22A 1Z05A 3P9KA 1P6RA 4BL0B 1LJ9A 5GAEJ 2G7HA 1K79A 2HVRA 3ZMVA 4JX5A 4ABZA 4IHVA 4BQOA 4BEHB 1X2NA 5FKKA 1TWHJ 1MDMA 2W82A 1JGSA 2LR8A 2YUSA 4M73A 5GADJ 1V5FA 1LDDA 4JQFA 1D3YA 2DT6A 4M6VA 4PSWA 4WXDA 3JR9A 2EPFA 4ZH4F 3KP7A 5DYMA 2OBPA 4XLPF 3PIPF 4PJNA 1QU3A 2FQ3A 2RAEA 3FKIJ 4HRIA 3KIOA 3I4NJ 5K7HA 3GFJA 3I9V2 2O8KA 4Y15A 4EV0A 2ELKA 2RREA 2HS5A 3MAJA 1QVUA 3A4CA 3E7LA 3HYIA 1KGSA 2Y31A 2DK5A 4CZZA 1MKMA 4O5VA 4MNUA 1Z67A 3MKYB 2KIQA 2PEXA 3S8PA 3G3ZA 1RR7A 3SQNA 1QHGA 1ZGAA 2KJCA 1W7PD 2QQ9A 2EZIA 4NNJA 2QCOA 2DA7A 2CW7A 3TOAA 2KT0A 3HEFA 4IHWA 3RI4A 4GYIA 2NVYJ 2ZC2A 2DT5A 1A31A 2KISA 1WFXA 4IPAA 3UNGC 2HZTA 2HGCA 3GFMA 4LG0A 1B72A 2MYSA 2M45A 1D1CA 4QTRA 1ONVA 2HQAA 4II2A 2V6EA 1JHFA 2O5RA 2ETHA 2LOOA 2F4OB 1LVAA 2V79A 4YFNF 5LHIA 4HDVA 3S17J 4OINF 4XRSA 3WGIA 2XAJA 1I3AA 2W7NA 2CV2A 1V4RA 3FXUA 5GTIC 1GVDA 5EGOB 2NS7A 4OU0A 2FJ1A 1Z3XA 2D45A 1ODDA 2BOLA 1G3WA 1LEAA 4NQWA 4L5EA 3G6EI 1WJ5A 3IWZA 1KYZA 3TO7A 3CMMA 3I4MJ 3C18A 4ZYEA 1FOWA 3RPUD 2DMTA 5H6QA 5CKTA 2W85A 2DW4A 4RGXA 2IA1A 2LH9A 3ASNH 4DW6A 1H0MA 1G6NA 2X1DA 4LFUA 2KIFA 2OU2A 3CJTB 2ID6A 2EZKA 3U21A 3C2GA 4NUBA 1EJ9A 1ZRCA 1SAXA 3W2AA 2R92J 1AHDP 1Z7UA 1J7KA 4EM2A 2CUEA 1IRFA 2UUZA 1BC7C 1MNMC 2DMNA 3HRSA 3BROA 2V4JC 1TZLA 5HS8A 1FYMA 1TP4A 3RQ4A 3L2QA 2CQNA 3CO7C 3ZPLA 3FXOA 3AG3H 5ED4A 3KZYA 2KDZA 2NXNB 1KQ0A 4G6DA 1GXPA 2CMPA 1WKMA 5ICEA 5IP9J 2XC7A 2HR3A 3HHHA 4B4CA 4F91B 2BVLA 3OIPA 1MGTA 3PFIA 2Z99A 3T0YA 1O3RA 4HX4A 1ZR4A 3HOWJ 1ZN2A 2F4IA 3DQVC 5H6RA 4XBFA 2BE5F 4UHTA 3CDHA 1PUEE 1S72I 3X2QH 3BQYA 3I58A 4OIQF 1SAUA 1MNDA 4H0EA 3A0HC 3ZXSA 4FQGA 2R7VA 2DPUA 3QRFF 3D5SC 2E7XA 5DCFA 4RBOA 5EDNA 2F48A 5F27A 2O7OA 3AFHA 3V7CA 3GW2A 4WWCA 1PDNC 1SANA 4G6TB 1QGPA 1ULYA 2JVGA 2K9NA 1QBJA 1V3FA 2A05A 3S2HJ 2XPVA 1UCRA 3P7NA 3TO6A 5TGTA 4CH7A 2N8GA 5DD8A 4MFEA 2L01A 1U6GA 1W0TA 2HWVA 1GDTA 2H27A 2W57A 3ZOBA 3QPLA 3GCMA 5HVQC 1VQMI 1ON1A 4BEHA 3I3LA 3LNQA 1JKOC 1E3PA 1KU2A 2ELJA 3RZOJ 2BY1A 1MW7A 3FK6A 2KPMA 2KIUA 2R7UA 1FTTA 3HSEA 4NC7A 2X9DA 2V26A 2R7QA 2R7TA 5FGMA 3FZVA 1W5CC 3QPHA 1S7EA 5IP7J 1Y0NA 3FBNB 3LSJA 3BG6A 4OWRB 5GAGJ 3CUQC 2BXZA 2J5OA 3IH2A 4GFBA 2A69F 3M1EA 1KQ8A 2Y69H 4QPQA 3NWTA 3ESWB 2L0KA 2LKSA 4JK1X 2R7OA 4KT6A 1GVJA 3VSLA 2BBYA 4OOIA 1KU7A 4HBLA 1X4PA 1ZK8A 4O3MA 4JX6A 1MMAA 3CUQB 3VYTB 4MFDA 2E60A 2M0MA 4HX8A 4RLFA 1IN5A 4UUSB 1WHUA 3GF2A 3CC2I 2PMZN 1XCVA 4KJZA 1TL8A 3EUHC 2ZCWA 3K4BA 4UB8C 3HOTA 1P7IA 3H36A 4XRFA 1HBXG 1WVRA 3IAS2 4LOCA 3WG9A 3PQJA 2HKOA 3FF5A 3A0BC 2WAFA 4UV8A 3OYJA 1FP2A 1IN7A 2DDAA 3E6MA 2K85A 4AC0A 4AM3A 3FXKA 1OR7C 3K9TA 1FOYA 1W36D 3JRBA 1OCOH 4ZYHA 3LSKA 3CCEI 1TC3C 2EV6A 3E0JB 3CLOA 4RMNA 4XICA 2JK3A 2HYFA 5AIPA 3BPXA 5E3OA 2MC4A 1J75A 1YX5A 3DTEA 2FA5A 2OQRA 1YOVB 1Y39A 3GZ6A 5EGOA 1WJCA 4PJ0C 2E36A 1IGNA 1Z0XA 4DYCA 3JRFA 3JRCA 2ZSIB 4L5IA 2QLZA 4V2FA 5HODA 5D4RA 1TW3A 2JQ7A 3VODA 1DDNA 3DBRB 4XSZF 3WE3A 4A3JJ 3WTSC 1IDZA 4IL6C 1JHHA 3S3OA 1BR1A 2ECCA 1K4SA 2A6TA 1X19A 3IP4B 2X6YA 3D5RC 4BQNA 2QF7A 5BOXA 2PJRB 5D5WB 4S0HB 2M8GX 3I0TA 4B3XA 3OIOA 1T39A 1FSEA 2GWRA 5CVIA 3HG9A 3V8JA 5GTHC 2OAZA 4LG3A 2ZFUA 1XB4A 4AIKA 2Z2SB 1UJ8A 1VZ0A 2MGQA 2X48A 1N78A 2Y2ZA 4PZJA 2V1NA 4HNTA 1HLVA 2E2HJ 1MBFA 4KN4X 5IT3A 3QU3A 1CF7B 4A93J 3NEUA 2EFWA 4E7KA 4ETSA 1U5TB 1F1ZA 3KE2A 3ABKH 3DEEA 3ZQIA 3DU5A 3TP0A 4UVCA 4RAGA 2CH0A 4EATA 1RI7A 5AONA 3JCUC 2M5WA 1BR4A 1T8IA 4EM1A 2VONA 1G59A 2EV0A 5B1BH 2R0QC 1DP7P 4IRIA 3Q3SA 1PP8F 2QYOA 2GXAA 4OIPF 2ISZA 1KYWA 1IXCA 3K7AJ 2L54A 4B09A 4JYKA 4AUXA 2D2WA 2M1BA 1RESA 1Y56A 5J6XA 5HNHA 4WF2A 5HDGA 1X1DA 2XHKA 2K4BA 2M7AA 4IXAA 1QPMA 2W1OA 5A2QK 2XF7A 1I6HJ 1STZA 1MH3A 2H8WA 2IW5A 2QWWA 2ZNYA 5F64A 3E6BA 1BJZA 1WZ2A 2QQBA 3CCUI 2TCTA 2E1OA 4BXUA 1M1EB 3GO5A 4U88A 5LLQA 4Y17A 5IYDJ 1MH4A 1QPIA 1IO2A 3D0SA 4BGDA 2ZXHA 4JOMA 2QSHX 2BXYA 4CA0A 2QQAA 1SVOA 3ONQA 3BDDA 3CZ6A 2O8XA 4BKXA 1TLHB 2EFPA 1LKXA 2ZJ2A 4MHGA 1U9OA 2PI0A 4E7HA 2ME6A 2CS3A 1YFHA 4E6KG 3HHGA 2DYSH 2V6CA 4DZPA 3QP5A 1YX3A 4HSTA 4P9FA 3HRMA 2HQ5A 4AIDA 1R9TJ 3CUQA 2A5WA 3DWLE 3WG7H 1Z6TA 4UUSA 3FXMA 2XROA 1ERDA 1YIOA 2EBIA 3G1OA 4ITVA 1ORKA 1Y6IA 2KZVA 2NS0A 4MIMA 3OYBA 2CSOA 2WV1A 1DGWY 1K6YA 3K1MA 1YG2A 5LHHA 2ZMEC 1A6QA 2O6GE 4U0YA 3IRQA 1I6XA 1FZPB 1QZYA 2E34A 4BY7J 3R6SA 5FKOA 1DU0A 2EH3A 5D5UB 1XGOA 1W5SA 4HF2A 3MKZA 3EQLF 4LLNA 3EUHA 2ZMEB 3FHNA 1TWCJ 5DS9A 3CCYA 3QQAA 1WJAA 3GX4X 1ETVA 4C30A 3CMAI 2Q2EB 5DM6F 2KDOA 2LRDA 1R58A 2XGDA 5KK1A 2ZJQF 1FYKA 2XRNA 1Z6RA 3L00A 4LLGF 3GBGA 5ERIA 4M3EA 4M72A 4G12A 1FTZA 4AVPA 1OR7A 3LAJA 1HC8A 2D1HA 1FMWA 1IN8A 1SMYF 3J80K 4J01A 4Q47A 2CFXA 2TRTA 1HCRA 3IV5A 5E1ZB 3OV8A 3OOPA 4RB0A 1LFBA 4UUVA 2MBFA 2L4AA 1RR8C 3ECHA 3BR1A 1WJEA 3I54A 2FMLA 2IRFG 1P92A 1FX7A 1GUUA 3ZQQA 5F0FA 1D0YA 4MEYF 3EYYA 3SZTA 4EJTA 3G1LA 2Q8KA 3T8TA 5K5RA 3BR0A 4XORA 2R7RA 3FKJA 4IZZA 2M9HA 3C2BA 3CJRB 2PJRA 1IF1A 1R7JA 2K9QA 3H1CA 3JAMK 1XSXA 2XAFA 3BCAA 1U0JA 4AVZA 4FASD 2XAQA 3J81Z 3OYAA 1PVEA 2VC1A 3BR6A 5BNGA 2LLKA 4C9YA 4CYCB 3I56I 4I99C 1Z7LA 2A68F 5CVUA 1UMQA 2K3FA 5M5XJ 3AKZA 3TEDA 1XGNA 3BTIA 3JRHA 2QKMB 4U7BA 5J40A 2F2EA 4II3A 1EH8A 3H5AA 1CF7A 3ZR8X 3VB2A 3CMYA 3H9QA 1VQ7I 1TQPA 1U5TA 1UG0A 2DN0A 4BS9A 3FIWA 1ZKGA 4F3QA 1H89C 2A6EF 5BMZA 1VQOI 1K83J 1SD5A 1N25A 2OV7A 2XV4S 4GGGA 4QSHA 1P4AA 1XTAA 3M3YJ 2DOFA 4AYBN 2DJIA 3OSGA 4U0VA 4I2OA 4PSXA 3I64A 3OYIA 3V42A 3OYHA 2LYCA 3PL8A 3SDGA 1JI8A 1MMGA 3Q9VA 4I09A 4G7OF 2EILH 1MZBA 1I5ZA 2YR2A 2LG4A 2QQ8A 4D7NA 2KIMA 1O4XA 2ZO4A 1WRJA 3FISA 5JHUA 3OWTA 4RM3A 1BN5A 4A6DA 2LDUA 3BJOA 4Q5SF 2NOJB 1SFUA 3O6BB 3SDBA 1VQ9I 2GOXB 2VLAA 4HLYA 3QOEA 1D0ZA 4M6YA 2XUBA 4IHTA 3HOSA 3LSPA 1XX5A 2WV0A 2WAQA 2E35A 1E2XA 3LSMA 1OMIA 3RSNA 3DKWA 3RKWA 1O3TA 1XD7A 2L9VA 4F55A 1BI0A 4EJOA 3CDLA 3F6OA 3D1NI 2Z9OA 3BR2A 2JMWA 1NG7A 2KRCA 4IF4A 3OYNA 1T08B 3CCQI 4HF1A 2XSDC 4OIRF 2JRMA 2X6OA 3PNYA 3T1BA 2QEXI 4L18B 1H8AC 2WC2A 3ZMTA 4FETA 1W0UA 4ASNA 5BPDA 2FBHA 2HYJA 1MMDA 1Z91A 2M7BA 2K40A 5FO5A 1G3SA 1QO0D 4CCLA 4HNVA 2JPCA 4GO1A 2ACJA 4B47A 1Z77A 2F5VA 3VWBA 1P2FA 4L9JA 1OLTA 2P5KA 2GA2A 4P5OA 3OYFA 3WGHA 2L7FP 1ZQ3P 3AG1H 3GUDA 3BJAA 2VBZA 1MNEA 3CP8A 1JXSA 3ZMZA 1B1BA 2BZTA 4IQ4A 2M3AA 1KA8A 2ZMEA 4BDYA 2V9VA 4L9VA 2LF7A 2VQHA 2QZ8A 3BTLA 3LSIA 2DA2A 5FKMA 4R79A 2Q2EA 1N75A 1HSTA 1WGXA 1JT6A 3GTPJ 2COMA 4NHJA 4G8XA 3QYBA 4I76A 3L1PA 1IXSB 4LD5A 3N4MA 1HKQA 2K3PA 1Z21A 2CW8A 1RUOA 3FXJA 2DAOA 2FXAA 3LSRA 1HKTA 1E3HA 4PJJA 3W6KB 4M6XA 3HOYJ 1VTNC 2XPUA 4FISA 2XASA 3B73A 3PQKA 5JR3A 1SD6A 3K4KA 1AU7A 3FHZA 2IGMA 2EV5A 4WXCA 2M4GA 3GTMJ 2PFBA 4QLCU 1FBQA 3COAC 4AYBA 2Y0MA 2FU4A 3H5RA 3V4GA 3W6JB 3S3MA 3U9GA 4A12A 5TRDA 3GZNB 3GLLA 4XKWA 3QYEA 5JLXA 3U1KA 2CWEA 3U2RA 1HW2A 3HOUJ 2H1LA 3DXJF 3ABLH 1DU6A 1ZARA 5FFZA 4HPQA 3FMRA 5KHDA 2K86A 5CJ9A 5E8IA 4IX7A 1HQCA 2JZYA 1FC3A 2IEKA 4RB1A 1HW5A 4AU7A 2Y75A 4A69C 1XMAA 1F36A 2F5CA 2GZWA 4CYCA 1LQ1A 1BIBA 1F9NA 2OQGA 4P55A 1JTYA 4N9IA 3Q0WA 3HRTA 2IAIA 3L2UA 3BT9A 2OTLI 3FWEA 1T6SA 3M7GA 5KAIC 5H2FC 4FX0A 1VQ8I 2P8TA 4F7ZA 1DQUA 2IXSA 2GOMA 1B9MA 3KCCA 3KX2A 4E4HA 3PUFA 1R6RA 4M9XA 4QWQA 4HLXA 2VJJA 1O57A 1H9GA 2DCEA 2Y0SA 2DU9A 5CVRA 4IO9F 2LK2A 5HLTA 3QWLA 2R7WA 3F6VA 1NG6A 2DBBA 2G7UA 2VQCA 2FNAA 2V7FA 4B1RA 3KEOA 2AQEA 2JA8J 3K1PA 2EIJH 4EVIA 2L9NA 1YO5C 2VQLA 5FRMA 4IOAF 3DEWA 3CP2A 2DODA 2EQRA 4J00A 1Y1VJ 1ETKA 1W7PB 1FOKA 2R7XA 1I27A 3GFLA 1YJ9I 2IP2A 1QA6A 4RB2C 3LQRA 3OL4A 1ZYRF 4AD9A 2MLGA 3B02A 5C44J 2BW3B 2M30A 3IAM2 3K6GA 5FROA 1YRNB 2CQQA 2FF4A 1DPRA 1OYWA 3ISPA 3KLNA 2XKPA 5L3DA 3V7SA 3I59B 3A01B 2RDPA 2QSFX 1LFUP 4PGHA 4CUGA 4UUTA 1VQ6I 1BOAA 2DA5A 5LGNA 1H88C 1XMXA 2DA3A 2JT1A 3VOEA 3WTYC 4N4NB 1A5JA 4EEFG 3JRGA 3A03A 1NTCA 3OMYA 4XKVA 4HX7A 3MWMA 3B6CA 2PQ8A 2JJ7A 2R7ZJ 5E17F 1IRZA 2VOOA 5E8GA 2CUZA 3K1NA 1U8BA 3LSGA 3VYSB 1R23A 4PJMA 1BBYA 2EJRA 3CMEI 3ZQ7A 4OMYA 2NYXA 4YEJA 3JRDA 5FD6A 2PN6A 1MJAA 2HZDA 2QKLB 1O3SA 1OCCH 2V1XA 3TDZC 4MTDA 4ANJA 3K4LA 4OMZA 1S9HA 2LREA 5IYCJ 5C4XJ 1R5HA 3JW4A 1TWGJ 1FBUA 2L9RA 3A1YA 4ENNA 1P9QC 1MMNA 5M5YJ 1IDYA 1MJ9A 3FX3A 3G1MA 3F8CA 3FXRA 2VN2A 1HW1A 5EZHA 3TO9A 4YIFA 4IRGA 3H0DA 4XLEA 1K7AA 3MKWB 3CDIA 5J4VA 4FX4A 3GTGJ 3LFUA 3RYPA 2BVMA 3TBIA 2DQLA 1LB2A 2K4JA 3BG7A 2OZUA 3GTOJ 4C2UA 4ZDPA 4K2EA 2HDCA 1I39A 4DBQA 4AWXB 3PO3J 3R61A 3FBIB 5M3FJ 3LWFA 3S1QJ 2LC2A 2X4HA 3WHCA 3FM3A 4ZTFA 4XOPA 1RPWA 4HOBA 2VBXA 5DTDA 1WPKA 3M9AA 2JSPA 1SFEA 3IKVA 3OYDA 1IC8A 5D4SA 3BC8A 2DOEA 4UVAA 5J1RA 5LD2C 2ZNZA 5DCMB 3IC7A 1EA3A 1ETXA 1GHCA 1PYVA 3QYFA 2YPRA 3OR1C 1L3LA 1Z9CA 3MVPA 3H0GJ 3JRAA 1VQLI 5IPAA 2FBIA 4GCVA 3KP5A 4BXFA 3KP4A 2IS1A 3JSPA 5E79C 3BQZA 2XGCA 3ZQLA 1BIAA 4V19K 3O8GA 1VQNI 5E1XA 2HPIA 4UNOA 5CPRB 2V9PA 2A3SA 3G71I 4BBSJ 3HPHA 1F43A 2CUFA 3LSTA 4HSRA 5D6FA 4GYGA 1YJNI 4EJWA 3J7YJ 1TQMA 2HXOA 1TTYA 2MFZA 3CTAA 5B1AH 5HNFA 3F22A 4HNUA 5DM7F 2GLOA 4HZFA 3TQNA 3Q0VA 4BU2A 3FMQA 4C2TA 3C7JA 5D6EA 4RAYA 1G3YA 1MMSA 5CYVA 3FDYA 5HS9A 3SEZA 3HDDA 1S6LA 2EB7A 3PSIA 5B66C 3DPUA 3RZDJ 4W1UA 4CXFA 1XS9A 3LA3A 5GPAA 3CD6I 4Y4RA 3WU0A 2KLOA 2CG4A 5L3GA 5FLXZ 3AG4H 3EUKL 4F92B 3BWGA 1YI2I 2GBYA 2CQ7A 3REOA 2OUMA 4ZDOA 4CCNA 1JUSA 1C0WA 2CV0A 2Z5UA 2ZKZA 1W7PA 4N0BA 4RGUA 4LB6B 2VT3A 3CCVI 1IG7A 1BW6A 4FE4A 3DBHB 1W36C 2P5LC 4BQAA 3PNTA 2WY7Q 3OYKA 3BOQA 2BW3A 2JA6J 3M8JA 2EA2A 1YRNA 4F93B 4M3GA 1ZGWA 4WK8F 5L3CA 1USTA 2F4MB 1WH7A 5GPCA 3I59A 3A01A 2R93J 2DQRA 4NC8A 2FOKA 2AXTC 1TNTA 2W00A 3P9CA 2DLLA 3F72A 4A3BJ 2AXLA 1JJ8C 4IEJA 4I0BA 1U5TC 2OA4A 4NBQA 1LNWA 2WTEA 4BUPA 3MD2A 3ZMUA 3TKYA 3UR3C 2IS2A 2XPWA 1R36A 2RKHA 4OIOF 2VXDA 5TJJA 4YELA 5FKNA 1SD4A 2TDXA 3RPUA 3VPRA 4Y33A 4MQVA 2W4SA 4KIBA 1EH7A 4NB5A 2PBIA 4XQFA 4BYYA 4PGGA 2L7MP 2I10A 1T2KA 1LPQA 2HDWA 2H6CA 1R1VA 2E19A 2MSYA 2NS8A 2DT7B 2P6TA 2KZGA 1R5ID 4A0ZA 5IP6A 1LUJB 2YU9J 1Q1HA 3M07A 2CQKA 1ZG3A 5K5OA 1R4MB 4IHSA 4Z2YA 1L0OC 4DNCA 5J4YA 1J59A 3SJMA 1YW9A 3ROUA 4CCJA 2VC0A 1MD0A 2HDDA 1Y1WJ 1T95A 4LK1F 2JUCA 1F5TA 2FEZA 5FLVA 1EF4A 2QA4I 2ME0A 3K4JA 1R4NB 2DMQA 2Y9YA 2NVTJ 1IV8A 3BJ6A 1XMKA 4XN0A 3QP6A 1H9TA 2BHZA 3WTTC 3S16J 4E7IA 1RKWA 1XSVA 1Y0UA 2CYYA 2O0YA 2JSCA 3K69A 1S5LC 1ZG1A 4EM0B 2LVSA 5H20A 2JA2A 4XR6A 4HA8A 2L5QA 3GZ5A 3I71A 1R71A 1FPQA 3C2HA 1R49A 1AOYA 1XG1A 2O3FA 4IHYA 1UFMA 2DMUA 5EG0B 2HKXA 1TQIA 2ZFWA 1V5GA 3OS2A 2O03A 3HL2A 3O8HA 2WWYA 1E17A 3SFIA 2VE9A 1ITYA 2VOPA 1I3QJ 3GVAA 2Y9ZA 2MG4A 2X6WA 4D1QA 1MBGA 1ETYA 4A3MJ 1QZZA 1IJWC 3ERMA 1TT0A 4D5FA 4Y52J 1RRJA 1DPUA 4MTEA 2ID3A 4LITA 2VB6A 2X1EA 4BE0A 2STTA 3DBLB 2PLYA 2QSGX 1DGRM 2HTJA 3GMEA 1YTYA 3K70D 5J8CA 3C3WA 5LHGA 2XAGA 1EH6A 1FIPA 1X1BA 1U8RA 4XMYA 2Y30A 2L2OA 2WAQN 3Q5FA 2CUJA 3CUOA 3E5QA 4DIQA 4S05A 2WADA 4KFCA 3L2RA 1BI2A 2H6BA 3MCZA 4O6JA 1D1BA 4N9HA 1QHHD 1Y8QB 3F21A 1ETOA 2R4GA 1OJLA 3L2CA 1IXRC 3EYIA 2PMHA 4HYEA 1GLNA 5CLSA 3ZQHA 5LGUA 1NK2P 1FP1D 3ZN0A 3OY9A 3CCJI 3B6AA 4XONA 2RQPA 2QGUA 3CJNA 2MH2A 2FOWA 3VYRB 2KQRA 3H3ZA 2EFOA 1CGPA 4BY1J 3BG5A 4OAYA 2H94A 3O3KA 3QPTA 2MW8A 1JJ6C 2DOAA 2AS5F 3E97A 1W4MA 4EGZA 4UV9A 3CESA 2MH9A 1SD7A 2RNJA 3VSKA 1LVKA 3CCLI 4NDLA 1OCZH 1R5GA 4IQJA 3OYMA 3CLQA 2Y48A 3Q9SA 1N77A 4ENKA 4A0XA 2DTRA 5HS7A 3R4KA 3DPTA 3TDUC 2R7FA 2OTJI 1KONA 2BY3A 2HU9A 3HOXJ 3SZGA 2LFBA 4FE7A 3N05A 4Q48A 5K7FA 4IKFA 3KETA 2B9SA 2DTZA 5FKLA 4M71A 4E70A 2M2EA 3KEYA 3BCBA 4BE1A 5F0HA 1T38A 5AIQA 3OYEA 3ABTA 5E20A 1BI1A 1WJDA 3HTSB 2M8EA 5E3NA 2V9KA 1D0XA 4A3LJ 1UAAA 2LKPA 2O9LA 5IT9Z 5K5QA 2XAUA 1W5TA 2LD5A 4ENJA 3S3NA 5CVVA 3UKGA 4DQ2A 2OJED 2LY1A 1XN7A 4C2MJ 4N4OB 5KVRA 2P6SA 2HOEA 4A0YA 3HSFA 5D5XB 6PAXA 1Z3YA 2PX9A 3TOBA 4XLNF 1WI3A 1D5YA 1KQ9A 1AA7A 4IOCF 3HM5A 4ON0A 2WBMA 3IL2A 4W97A 4G94A 3K10A 1XDSA 2AQFA 4YFXF 3LFKA 4EGYA 2VKDA 2Z16A 3HRUA 4LG0B 2VQGA 5FJ8J 2XGEA 3S1NJ 3LA7A 1A04A 3WHBA 5JI6A 3D5LA 2DFEA 1A6IA 2KHMA 2KRHA 2Q0OA 4BH9A 1JKRC 2H1KA 3ZP5A 1VQKI 1SFOJ 2DFHA 4F52A 2ZSHB 4P96A 2HPMA 4CHUA 4D9JA 1XGMA 1OCPA 2Q1ZB 5F0CA 2ESHA 4BBRJ 3KZIC 1HOMA 3KZZA 1JT0A 2WY8Q 2X85A 3KP2A 3CF2A 2UWMA 2E2IJ 2IA0A 3GWZA 4XLHA 3BZCA 1ZGJA 4PK4A 2IA2A 3K2ZA 2ZXWH 2YX7A 2AO9A 4I02A 5CVJA 1OCTC 2LF8A 2HEOA 2NOGA 3QAHA 3QOPA 4IRHA 4XLAA 1PUFB 1Z1DA 3H5NA 3KEQA 5EG0A 5E3LA 3A02A 1UHWA 5BQTA 2HTSA 3CC7I 2Y0SN 1VNDA 1TBXA 1HA8A 1MBJA 3DKYA 1RZ4A 4ZJZA 2ZXJA 1HKSA 1S29A 5ICCA 3RPQA 2I5UA 4B8XA 5BS6A 3F23A 3MQ0A 1X3UA 4WXHA 4HG2A 3IH3A 2RQQA 1HXDA 4D7MA 3WTWC 4DOZA 3BZKA 3H92A 1TT5B 5L3BA 1TWFJ 2LMDA 4HDUA 4KYWA 4A3KJ 4B48A 1V54H 1G4DA 1BJAA 1T0FC 1O3QA 3MN2A 3PUBA 4GDFA 1YITI 2ISYA 1J9IA 1IAWA 1UHSA 3OYCA 2F5EA 3P5JA 1OFCX 3RKXA 1TW2A 2PJPA 3O2PE 3AG2H 1B6AA 2FMYA 2OD5A 1ZLKA 5L3FA 3WE2A 3HKZA 4CCOA 1EKEA 2XB0X 5LRSA 2STWA 4Y3OA 3MZ8A 1HDPA 1VQ5I 1FY7A 4CCMA 3ULQB 2FSWA 3IH4A 2WA0A 1U78A 2GM4A 3V8LA 4M9SA 3KP6A 3H9GA 3WTVC 3KLOA 4JX4A 1ZTRA 4X1EA 3E1SA 5IYBJ 2DA6A 2GXGA 2EFQA 1IZ1A 3P9IA 1I1SA 5EEHA 1O7FA 4LK0F 2VBWA 3H9JA 3I4PA 2B63J 2VJIA 3HUGB 4U0WA 2IT0A 1WJBA 2P5VA 3BLYA 5D8LB 2VODA 5LEJA 2IVMA 1FYLA 4BXXJ 5F04A 1DUXC 4LIUA 4UXNA 1D8KA 3DP7A 2EA4A 2WB1N 1ETWA 4L5JA 5A2QZ 5BPIA 1S7OA 1JKPC 5ILSA 2FD5A 2KP6A 4BAYA 2Z33A 4M3BA 4RS8A 2XKOA 3GXOA 2XIGA 2EWNA 5HOOA 4BJ5C 1K78B 2R5ZB 3L7WA 3W2VA 1J0RA 3NAUA 3ZGKA 4C3JJ 1IN4A 2UV1A 3HBLA 4KDPA 2M87A 3RKYA 4C3HJ 1P7JA 2XF5A 2XGXA 1BR2A 4RGSA 2DDBA 1AWCA 1JUPA 2ECBA 4ZTJA 3ZMSA 2P7CB 3HSRA 2D1VA 4KT5C 3LAPA 5D5VB 1PP7U 4RA2A 3ZMDA 3H3VK 3HOVJ 2ZJPF 4XLCA 2IJLA 1U3EM 4HW0A 3PFYA 4EJUA 1RIOH 4P1WA 2HOTA 3RCOA 4GRIA 4PUSA 4CDGA 2XRLA 5J1YA 4M9ZA 2R5YB 2QM3A 5ILVA 2IGKA 3E5XA 2KRFA 3S32A 2HYGD 3HGYA 1I1GA 2OZ6A 4Q4ZF 1I50J 1K6OA 3EUAA 5M5WJ 5B3SH 2NVUB 4U87A 2KKOA 5C3EJ 2LSOA 4FHTA 2PMUA 2OF7A 2DA4A 2I8DA 3FK7A 5E1WA 5FB2A 4QPOA 1W1WE 3DEUA 4DGWB 2LBFB 1FSHA 2G0EA 3F8NA 3ELKA 1OKRA 3DTIA 3G2BA 2VUMJ 3S1RJ 3N97A 1TWAJ 4G9YA 3NQOA 5C4JJ 2LNBA 3FXQA 2F6CA 1ETQA 1PUFA 2GQQA 2L7ZA 4LMYA 5J8FA 4KA4A 1OQYA 4XM3A 4ZYGA 3GTJJ 1D8JA 3HC7A 2CU7A 4D5CA 3CC4I 4RAZA 1AKHB 4EJVA 3LOCA 3J80Z 4MO7A 2UXNA 3BR5A 4DBRA 3R60A 4XL9A 3BZ6A 1WI9A 1LEBA 3TMOA 3SYTA 3MFKA 2ADUA 3TGNA 4G7ZF 1WJFA 3SXYA 2HFHA 2GIVA 2JUGA 3K4MA 1B4AA 3DPLC 4G6QA 2VI6A 5D8KB 4HEA2 2OC6A 2FE3A 4BJTA 5EJCA 3V7RA 2VKVA 1RNLA 2K9LA 3JRIA 4E7LA 1B8IB 1F4KA 1D1AA 5GP9A 3JSOA 1LDKB 1WH5A 1S8NA 3JAMZ 4BNCA 4EMSA 3ERED 1USSA 3DCFA 2L02A 2Z3YA 4CO8A 3BG9A 5JHFA 4FCYA 4I01A 1T0FA 2WB1A 4MGRA 4A3IJ 3GLXA 3LQQA 1ON2A 3EDPA 4KIFA 2VASA 4L0ZB 2M34A 2JWTA 3NWSA 2BV6A 5JVTA 1X1CA 2KMUA 4IVNA 2JRTA 4BACA 3BP8A 4I0AA 4CICA 3VFZA 4TV7A 2VIXA 1SMTA 1S7AA 2A5YB 1K4TA 1RETA 1ZRDA 1X1AA 4KMFA 1MBEA 2CRGA 3ECOA 1FBSA 2EINH 1X3ZB 1YQAA 5TISC 3F9KA 2MC3A 4FT8A 1ZLJA 1UG2A 4V2GA 3F8BA 2GA1A 4B3AA 4CSWA 2UZKA 5ICGA 4UB6C 2QUFA 5HLIA 2HNHA 3GTLJ 2CQXA 2E7WA 3M1CA 4BDZA 5EZGA 3F0CA 3J81K 4A3EJ 3HUGA 3K2AA 1YE9A 1KZHA 1RUNA 4M3FA 1VQPI 3NARA 5HLHA 2OPTA 3BTCA 3HB9A 2FBKA 4J19A 2V1DA 2FUG2 1ZRFA 4A3DJ 4G7HF 2R7SA 2X51A 2V1UA 3WU1B 5IT9K 4NC6A 1FWZA 2NVXJ 3PJRA 1LDJA 4HF0A 5JLWA 3CCRI 3DKXA 4RB3C 1WQ2A 4B44A 1K78A 2R5ZA 3HPGA 4YIIA 4A2UA 2P7VB 3SZPA 2XAHA 3ZQFA 3HZJA 1BM9A 5KNLA 3Q0UA 2NVQJ 4A3GJ 1X1PA 3IUOA 2LP0A 1UHMA 4I6ZA 4ZZDA 5K1YA 3S15J 1PJRA 1OYIA 1O7LA 3OYLA 5FD5A 3M8FA 5ILUA 4KMUX 4YIRX 2KL4A 4U7DA 1U9NA 2QBYB 1XPXA 4H4KC 3DFGA 4BHCA 2CO5A 3BY6A 1FT9A 4E7SA 1MSFC 1HF0A 3LA2A 1FEXA 1OYYA 2E5NA 3F8MA 3FM5A 2YS9A 3AL0C 5DUKA 1R1TA 2XF6A 5DDGA 2R5YA 4JBAA 3OOUA 1FIAA 5L3EA 1SVMA 2IPQX 3AL0B 4A6EA 4GXOA 3TW7A 5M3MJ 4I98B 1FOXA 1LE8B 1IUFA 3QODA 3HTUA 4RGRA 2W48A 4Z6YA 2DO7A 4A5MA 2NNNA 2VJ4A 2COBA 5FLMJ 2LBFA 2JN6A 3WODF 2EIKH 3G73A 3OSFA 1E0EA 4BHPA 1A35A 1REPC 3ABUA 4DJAA 1BOBA 3HXLA 1WWXA 2P0WA 1KU3A 3L2VA 3NRVA 2EZHA 1G2HA 3WU2C 4R8HA 3RYRA 1WCMJ 1KU9A 2L7KA 4KICA 1AKHA 3HGGA 5LFAA 3CO6C 2YU3A 1BW5A 2KJBA 2H09A 3J7ZI 1OISA 1V55H 3KFWX 2RC4A 2CW0F 3OR2C 3V8KA 2IS4A 1TNSA 2XSJC 5CQGA 1ZG5A 3L2WA 2UXXA 1Q1VA 1T33A 1ZR2A 4I7HA 1SEUA 2LY2A 1APLC 2RV8A 2LY9A 5KAFC 1QRYA 3KPHA 4L0YB 2GXBA 5K7ZA 1IRGA 1B8IA 2E1MC 3BG3A 2K9SA 3BTJA 1OCRH 4HQEA 4KISA 1FLIA 3DU6A 3RJPA 1YS7A 1YLFA 3W6VA 1J09A 2DJNA 5JVGF 2A6HF 2E1MB 2R3SA 3OIQA 3IRRA 2LKXA 4IHXA 4XKCA 3TL4X 3VDXA 2M0CA 3CCSI 3ZN1A 2VKHA 3GTQJ 2H8RA 2EFNA 4CYDA 3G4SI 4AIJA 3DLLF 4R1HA 2E5ZA 3FXLA 3WGGA 4EQQA 4UVBA 2E71A 2ZB9A 2IGNA 2E1NA 1GXQA 3S1MJ 5HLGA 1LFPA 1X58A 2DI3A 1CQTA 1GV5A 1ZREA 3J7AO 1GT0C 4X0GA 2K7LA 2ESNA 5DUIA 2MD5A 3HJEA 3R0JA 3DF8A 2M4KA 4RM2A 2PMZA 5DCMA 2DMPA 2HQNA 4PFPA 5E3MA 5F08A 3DLAA 1RC9A 3KYDB 3HOZJ 2E2JJ 2DFIA 2VKEA 3ZCOA 4WX9A 4A3FJ 4XKBA 3LMMA 4MQ9F 5IOZA 2P81A 2WAEA 4XRMA 1JE8A 1OPCA 2W24A 2B7EA 1YYVA 3W2WA 2KFDA 2NRAC 1E3OC 1IV6A 1ACIA 2FNPA 1DP3A 3WTUC 2IBDA 1ENHA 1ZHFA 2HXIA 3VYUB 2JA7J 1HDDC 2L9SA 1YIJI 3IKTA 1HSJA 1UZCA 2QENA 1U2WA 3L09A 2X6XA 4FTHA 3CF5F 4QIWN 1Y8RB 3JTHA 1GV2A 4HV5A 4XLFA 1D5VA 3RTRA 4KUMA 2ZBKA 4DYQA 3CCMI 4B43A 3PO2J 1SFXA 4BE2A 1MIJA 3MKLA 2BGCA 4XN3A 4CCKA 4XK4A 2CGPA 3M4OJ 2VXZA 2MLKA 2DFFA 4Y7NJ 1VQ4I 1VF9A 2VE8A 2HQRA 2FRHA 4HQMA 2BY2A 4L9TA 3RIRA 9ANTA 3GEZA 1YHQI 2QBYA 5DEQA 4ESJA 2A07F 3DV8A 3H3UA 4ENMA 1BA5A 3QU6A 1JKQC 3C1DA 1XGSA 3K70C 1T56A 3OYGA 5B5EC 1ZH5A 2L3DA 1UB9A 2K27A 2DA1A 3OS1A 2MA3A 3E3VA 1VI0A 1NH3A 3EETA 2XB5A 4YFKF 3JTGA 3IWFA 2QVOA 3E5UA 4PDKA 1X2MA 2XVCA 4JP0A 2FX0A 3OL3A 1QZEA 2BHYA 1IN6A 5EYRA 2VT2A 2FQ4A 1LE8A 1NK3P 2OCEA 1B9NA 1MJBA 2BEOA 5HDNA 5IOYA 1X4OA 2LTPA 1P4XA 4ZC3A 2K5CA 5J1UA 5KCMA 4BJ6C 4KNYA 2VPRA 4CZCA 1MDMB 3ASOH 3EPZA 2ZXIA 3K4NA 3S2DJ 3E6CC 1RKTA 2C6YA 1XC5A 3SHFA 1QQIA 1SFKA 2XDVA 2P4WA 2HOAA 4YG2F 3S14J 3WTXC 1XCBA 3RKQA 1FNNA 2CV1A 4WCGA 4ZYAA 3GFIA 1S3JA 2OCCH 2YSRA 3HKZN 1POGA 4XSXF 2VPLA 3DTKA 3LL7A 3I5UA 3RQIA 2DK8A 3OS0A 2BYVE 4OAZA 4UY8I 1EV7A 5EF6A 1MBHA 3F3XA 4A3CJ 3K4CA 4HV6A 4ESBA 5J47A 5LGTA 2X0LA 4PFOA 3J7AY 3S2WA 2D5VA 3JREA 2F5DA 1X3WB 4L9NA 5FRNA 1G8XA 3PNVA 3A2KA 4RDUA 4IJAA 4AIHA 2ZJRF 2JA5J 3MEXA 4LGWA 3H35A 2HOSA 4XOTA 4LLLA 1MBKA 1WSUA 5J3LA 4MEXF 4LB5A 3I53A 1B59A 5JFRA 2NAZA 2L4MA 1JTXA 3L9FA 1B72B 1QVTA 5F6FA 2W25A 1BC8C 4ZYDA 2B0LA 4XNFA 4PJLA 5FFXA 3WTZA 3E6DA 2DXIA 1J2XA 3T5XA 4Y13A 1JGGA 2K02A 5F1JA 3ZQGA 4P9UA 4C3IJ 3CJQB 3LSHA 3T8RA 2AHQA 3ABMH 1JUMA 2VBYA 5DD4A 2Z1DA 4BHBA 3KYLA 2JPBA 4XIDA 4RAFA 2MABA 2GAUA 4YRVA 1YJWI 2HVSA 5LBQA 2EZLA 1IRXA 4NQWB 3SEQA 3QPSA 1BL0A 2W84A 5ICFA 4ESFA 4DYRA 2K9MA 3FMSA 1A36A 3R0AA 1P4WA 4LJZF 2CJJA 3W3CA 2RVCA 5CQEA 4CGZA 5GAHJ 1VFCA 2NNYA 5IY5H 3TW6A 4E7ZA 5EEGA 2E1CA 3MZYA 2R7DA 3MMYB 2JVHA
chains in the Genus database with same CATH topology
1R9TJ 2DA4A 1K61A 3FK7A 4UUSA 2EBIA 3G1OA 2HI3A 1ORKA 4MIMA 2GBYA 3PM1A 2G0EA 5EEAA 2WV1A 2VUMJ 3S1RJ 1JUSA 1TWAJ 4BY7J 5FKOA 5C4JJ 1DU0A 2EH3A 1ETQA 1PUFA 2L7ZA 3GTJJ 1IG7A 2CU7A 4D5CA 1BW6A 1AKHB 4FE4A 5DS9A 1TWCJ 3CCYA 3LOCA 3QQAA 4MO7A 3BR5A 1ETVA 2JA6J 1YRNA 2XGDA 4M3GA 1ZGWA 4MLOA 3BR3A 3GBGA 4M3EA 2VI6A 4G12A 1FTZA 1WH7A 5GPCA 3A01A 2R93J 2VKVA 3TP3A 4DZJA 3JRIA 1B8IB 5GP9A 2TRTA 1HCRA 1MSEC 4A3BJ 1WH5A 3IV5A 3ZQCA 1JJ8C 4IEJA 3DCFA 1LFBA 4M3DA 1FJLA 3BG9A 4X6AJ 2XPWA 3BR1A 4FCYA 4A3IJ 1GUUA 5FKNA 5F0FA 4XRSG 3VPRA 3CQZJ 3GTKJ 3G1LA 2M34A 2JWTA 3BR0A 2L7MP 2I10A 2M9HA 3C2BA 4JX5A 4ABZA 4IHVA 2K9QA 1X2NA 5FKKA 2E19A 2MSYA 2NS8A 1TWHJ 5IP6A 1RETA 2LR8A 2YUSA 3BR6A 2YU9J 5BNGA 2LLKA 1MBEA 2CRGA 4M6VA 4CYCB 3JR9A 1UMQA 5M5XJ 3SJMA 3TEDA 3BTIA 1UG2A 4V2GA 3JRHA 4B3AA 2RAEA 3FKIJ 3I4NJ 5K7HA 3CMYA 2HDDA 2CQXA 1Y1WJ 2O8KA 3GTLJ 5EZGA 3F0CA 1H89C 1EF4A 2DN0A 2ELKA 3FIWA 1ZKGA 5FLVA 4A3EJ 2ME0A 3K2AA 1K83J 2DMQA 1QVUA 2Y9YA 2NVTJ 3E7LA 4M3FA 2Y31A 3NARA 4QSHA 2OPTA 3M3YJ 3BTCA 3HB9A 4AYBN 3OSGA 4J19A 3S16J 1RKWA 1RR7A 4A3DJ 2LVSA 3SDGA 2NVXJ 2EZIA 2QCOA 2DA7A 5JLWA 2KT0A 1XG1A 3HEFA 4IHWA 4IHYA 2R5ZA 2DMUA 5EG0B 4D7NA 2NVYJ 1O4XA 3FISA 3ZQFA 2NVQJ 3Q0UA 3O8HA 1B72A 4A3GJ 3SFIA 1ITYA 2LP0A 4QTRA 4I6ZA 1I3QJ 3S15J 2Y9ZA 2MG4A 1MBGA 1ETYA 4A3MJ 1IJWC 3LSPA 4D5FA 3S17J 1U9NA 4XRSA 4Y52J 1GVDA 2ID3A 5EGOB 2NS7A 2FJ1A 1MSFC 1HF0A 3CDLA 3D1NI 1FEXA 3BR2A 2YS9A 2JMWA 4L5EA 2XSDC 2R5YA 2X6OA 3I4MJ 2DMTA 3OOUA 1FIAA 1H8AC 1FIPA 2Y30A 4DW6A 2WAQN 3TW7A 5M3MJ 1W0UA 1LE8B 2HYJA 1IUFA 2K40A 2ID6A 2EZKA 2W48A 2R92J 1AHDP 4HNVA 2CUEA 2COBA 5FLMJ 1MNMC 2DMNA 1ETOA 1OJLA 2JN6A 1Z77A 3ZQHA 3OSFA 1NK2P 1ZQ3P 2L7FP 3B6AA 1G2HA 2EZHA 2KDZA 1WCMJ 5IP9J 1AKHA 4B4CA 4BY1J 3BG5A 3HGGA 2MW8A 1JJ6C 1BW5A 3BTLA 2DA2A 5FKMA 1ZR4A 3HOWJ 1WGXA 1JT6A 3GTPJ 4I76A 4NDLA 3L1PA 3BQYA 1Q1VA 1T33A 1ZR2A 1APLC 2LY9A 3LSRA 1QRYA 3HOXJ 2LFBA 4FE7A 3HOYJ 2XPUA 5K7FA 4FISA 5K7ZA 4RBOA 1B8IA 3BG3A 2DTZA 5FKLA 2K9SA 3BTJA 5F27A 5EDNA 2O7OA 1AU7A 1SANA 2M2EA 3GTMJ 2K9NA 5F0HA 3W6VA 3S2HJ 2XPVA 2DJNA 4IHXA 2LKXA 5E3NA 2N8GA 5JLXA 4A3LJ 4MFEA 2O9LA 3HOUJ 2M0CA 1W0TA 2LD5A 3GTQJ 1DU6A 2H8RA 1GDTA 3UKGA 3ZOBA 4C2MJ 3QPLA 2IEKA 2ZB9A 3LNQA 1JKOC 3S1MJ 4A69C 1WI3A 1D5YA 1X58A 1CQTA 3RZOJ 1F36A 1GV5A 3FK6A 1GT0C 3HM5A 4CYCA 1FTTA 2X9DA 4W97A 1JTYA 1S7EA 5IP7J 3Q0WA 2DMPA 2IAIA 5FJ8J 2XGEA 3S1NJ 3BT9A 5E3MA 3LSJA 5F08A 3WHBA 4GFBA 3IH2A 3HOZJ 1A6IA 2E2JJ 2VKEA 1JKRC 2L0KA 4A3FJ 2H1KA 1SFOJ 5IOZA 1ZK8A 2P81A 4JX6A 4XRMA 1OCPA 4MFDA 2LK2A 5F0CA 4BBRJ 1HOMA 1JT0A 4UUSB 1E3OC 2E2IJ 2PMZN 4B1RA 1IV6A 2JA8J 2IBDA 3DEWA 1P7IA 2AO9A 1OCTC 1ENHA 2EQRA 1Y1VJ 1ETKA 2HXIA 2NOGA 1PUFB 1HDDC 2JA7J 4LOCA 5EG0A 5E3LA 3A02A 2Y0SN 1VNDA 4FTHA 5C44J 4QIWN 1MBJA 4AC0A 1GV2A 1YRNB 4DYQA 2CQQA 3PO2J 3JRBA 3MKLA 4XK4A 3M4OJ 4Y7NJ 1TC3C 3IH3A 4D7MA 1VF9A 4XICA 2JK3A 3A01B 5E3OA 1LFUP 9ANTA 4UUTA 1TWFJ 2DA5A 4A3KJ 1H88C 5EGOA 1BA5A 2DA3A 1JKQC 3MN2A 1Z0XA 4DYCA 3JRFA 3JRCA 1IGNA 5HODA 4V2FA 1T56A 1A5JA 4EEFG 3JRGA 3A03A 1NTCA 2DA1A 1UHSA 4A3JJ 3B6CA 1VI0A 2JJ7A 1IDZA 2XB5A 1OFCX 2R7ZJ 2ECCA 1IRZA 1X2MA 4JP0A 1U8BA 2FX0A 3LSGA 5EYRA 2FQ4A 1LE8A 1NK3P 2XB0X 3JRDA 2QF7A 4S0HB 5IOYA 2LTPA 1HDPA 5J1UA 2M8GX 2VPRA 3IH4A 3OIOA 5C4XJ 5IYCJ 1U78A 3S2DJ 2GM4A 1RKTA 1TWGJ 1XC5A 2L9RA 2HOAA 3S14J 4JX4A 2MGQA 1ZTRA 2X48A 3RKQA 4X1EA 5IYBJ 1IDYA 2DA6A 2Y2ZA 3G1MA 5M5YJ 1HLVA 2E2HJ 1MBFA 5EZHA 3HKZN 1POGA 4A93J 3RQIA 3GTGJ 2B63J 5EF6A 3ZQIA 3TP0A 1MBHA 4A3CJ 3GTOJ 4BXXJ 5F04A 3PO3J 2D5VA 5M3FJ 3S1QJ 3JREA 3WHCA 1RPWA 2WB1N 2R0QC 1ETWA 5DTDA 1JKPC 4RDUA 3Q3SA 1WPKA 2FD5A 2JA5J 4M3BA 1IC8A 2HOSA 5J1RA 1ETXA 2R5ZB 3K7AJ 1MBKA 5J3LA 3MVPA 3NAUA 4JYKA 4AUXA 4C3JJ 1RESA 1B72B 1JTXA 3H0GJ 3HBLA 3JRAA 1QVTA 5IPAA 1I6HJ 4C3HJ 1P7JA 2XGCA 3BQZA 1JGGA 5F1JA 1MH3A 3ZQGA 4C3IJ 3ZQLA 3O8GA 1BJZA 1JUPA 2AHQA 2ECBA 1JUMA 2TCTA 2E1OA 4BBSJ 1F43A 2CUFA 5IYDJ 1MH4A 1QPIA 3H3VK 3HOVJ 2HXOA 4XIDA 4BKXA 2HOTA 2EZLA 2GLOA 2XRLA 5J1YA 3Q0VA 1U9OA 2R5YB 3QPSA 1BL0A 4DYRA 2ME6A 3HGYA 2CJJA 3HDDA 1I50J 1VFCA 3RZDJ 5M5WJ 4DZPA 3TW6A 4W1UA 5C3EJ 1XS9A 5GPAA 2HQ5A 2OF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R9T J;  2DA4 A;  1K61 A;  3FK7 A;  4UUS A;  2EBI A;  3G1O A;  2HI3 A;  1ORK A;  4MIM A;  2GBY A;  3PM1 A;  2G0E A;  5EEA A;  2WV1 A;  2VUM J;  3S1R J;  1JUS A;  1TWA J;  4BY7 J;  5FKO A;  5C4J J;  1DU0 A;  2EH3 A;  1ETQ A;  1PUF A;  2L7Z A;  3GTJ J;  1IG7 A;  2CU7 A;  4D5C A;  1BW6 A;  1AKH B;  4FE4 A;  5DS9 A;  1TWC J;  3CCY A;  3LOC A;  3QQA A;  4MO7 A;  3BR5 A;  1ETV A;  2JA6 J;  1YRN A;  2XGD A;  4M3G A;  1ZGW A;  4MLO A;  3BR3 A;  3GBG A;  4M3E A;  2VI6 A;  4G12 A;  1FTZ A;  1WH7 A;  5GPC A;  3A01 A;  2R93 J;  2VKV A;  3TP3 A;  4DZJ A;  3JRI A;  1B8I B;  5GP9 A;  2TRT A;  1HCR A;  1MSE C;  4A3B J;  1WH5 A;  3IV5 A;  3ZQC A;  1JJ8 C;  4IEJ A;  3DCF A;  1LFB A;  4M3D A;  1FJL A;  3BG9 A;  4X6A J;  2XPW A;  3BR1 A;  4FCY A;  4A3I J;  1GUU A;  5FKN A;  5F0F A;  4XRS G;  3VPR A;  3CQZ J;  3GTK J;  3G1L A;  2M34 A;  2JWT A;  3BR0 A;  2L7M P;  2I10 A;  2M9H A;  3C2B A;  4JX5 A;  4ABZ A;  4IHV A;  2K9Q A;  1X2N A;  5FKK A;  2E19 A;  2MSY A;  2NS8 A;  1TWH J;  5IP6 A;  1RET A;  2LR8 A;  2YUS A;  3BR6 A;  2YU9 J;  5BNG A;  2LLK A;  1MBE A;  2CRG A;  4M6V A;  4CYC B;  3JR9 A;  1UMQ A;  5M5X J;  3SJM A;  3TED A;  3BTI A;  1UG2 A;  4V2G A;  3JRH A;  4B3A A;  2RAE A;  3FKI J;  3I4N J;  5K7H A;  3CMY A;  2HDD A;  2CQX A;  1Y1W J;  2O8K A;  3GTL J;  5EZG A;  3F0C A;  1H89 C;  1EF4 A;  2DN0 A;  2ELK A;  3FIW A;  1ZKG A;  5FLV A;  4A3E J;  2ME0 A;  3K2A A;  1K83 J;  2DMQ A;  1QVU A;  2Y9Y A;  2NVT J;  3E7L A;  4M3F A;  2Y31 A;  3NAR A;  4QSH A;  2OPT A;  3M3Y J;  3BTC A;  3HB9 A;  4AYB N;  3OSG A;  4J19 A;  3S16 J;  1RKW A;  1RR7 A;  4A3D J;  2LVS A;  3SDG A;  2NVX J;  2EZI A;  2QCO A;  2DA7 A;  5JLW A;  2KT0 A;  1XG1 A;  3HEF A;  4IHW A;  4IHY A;  2R5Z A;  2DMU A;  5EG0 B;  4D7N A;  2NVY J;  1O4X A;  3FIS A;  3ZQF A;  2NVQ J;  3Q0U A;  3O8H A;  1B72 A;  4A3G J;  3SFI A;  1ITY A;  2LP0 A;  4QTR A;  4I6Z A;  1I3Q J;  3S15 J;  2Y9Z A;  2MG4 A;  1MBG A;  1ETY A;  4A3M J;  1IJW C;  3LSP A;  4D5F A;  3S17 J;  1U9N A;  4XRS A;  4Y52 J;  1GVD A;  2ID3 A;  5EGO B;  2NS7 A;  2FJ1 A;  1MSF C;  1HF0 A;  3CDL A;  3D1N I;  1FEX A;  3BR2 A;  2YS9 A;  2JMW A;  4L5E A;  2XSD C;  2R5Y A;  2X6O A;  3I4M J;  2DMT A;  3OOU A;  1FIA A;  1H8A C;  1FIP A;  2Y30 A;  4DW6 A;  2WAQ N;  3TW7 A;  5M3M J;  1W0U A;  1LE8 B;  2HYJ A;  1IUF A;  2K40 A;  2ID6 A;  2EZK A;  2W48 A;  2R92 J;  1AHD P;  4HNV A;  2CUE A;  2COB A;  5FLM J;  1MNM C;  2DMN A;  1ETO A;  1OJL A;  2JN6 A;  1Z77 A;  3ZQH A;  3OSF A;  1NK2 P;  1ZQ3 P;  2L7F P;  3B6A A;  1G2H A;  2EZH A;  2KDZ A;  1WCM J;  5IP9 J;  1AKH A;  4B4C A;  4BY1 J;  3BG5 A;  3HGG A;  2MW8 A;  1JJ6 C;  1BW5 A;  3BTL A;  2DA2 A;  5FKM A;  1ZR4 A;  3HOW J;  1WGX A;  1JT6 A;  3GTP J;  4I76 A;  4NDL A;  3L1P A;  3BQY A;  1Q1V A;  1T33 A;  1ZR2 A;  1APL C;  2LY9 A;  3LSR A;  1QRY A;  3HOX J;  2LFB A;  4FE7 A;  3HOY J;  2XPU A;  5K7F A;  4FIS A;  5K7Z A;  4RBO A;  1B8I A;  3BG3 A;  2DTZ A;  5FKL A;  2K9S A;  3BTJ A;  5F27 A;  5EDN A;  2O7O A;  1AU7 A;  1SAN A;  2M2E A;  3GTM J;  2K9N A;  5F0H A;  3W6V A;  3S2H J;  2XPV A;  2DJN A;  4IHX A;  2LKX A;  5E3N A;  2N8G A;  5JLX A;  4A3L J;  4MFE A;  2O9L A;  3HOU J;  2M0C A;  1W0T A;  2LD5 A;  3GTQ J;  1DU6 A;  2H8R A;  1GDT A;  3UKG A;  3ZOB A;  4C2M J;  3QPL A;  2IEK A;  2ZB9 A;  3LNQ A;  1JKO C;  3S1M J;  4A69 C;  1WI3 A;  1D5Y A;  1X58 A;  1CQT A;  3RZO J;  1F36 A;  1GV5 A;  3FK6 A;  1GT0 C;  3HM5 A;  4CYC A;  1FTT A;  2X9D A;  4W97 A;  1JTY A;  1S7E A;  5IP7 J;  3Q0W A;  2DMP A;  2IAI A;  5FJ8 J;  2XGE A;  3S1N J;  3BT9 A;  5E3M A;  3LSJ A;  5F08 A;  3WHB A;  4GFB A;  3IH2 A;  3HOZ J;  1A6I A;  2E2J J;  2VKE A;  1JKR C;  2L0K A;  4A3F J;  2H1K A;  1SFO J;  5IOZ A;  1ZK8 A;  2P81 A;  4JX6 A;  4XRM A;  1OCP A;  4MFD A;  2LK2 A;  5F0C A;  4BBR J;  1HOM A;  1JT0 A;  4UUS B;  1E3O C;  2E2I J;  2PMZ N;  4B1R A;  1IV6 A;  2JA8 J;  2IBD A;  3DEW A;  1P7I A;  2AO9 A;  1OCT C;  1ENH A;  2EQR A;  1Y1V J;  1ETK A;  2HXI A;  2NOG A;  1PUF B;  1HDD C;  2JA7 J;  4LOC A;  5EG0 A;  5E3L A;  3A02 A;  2Y0S N;  1VND A;  4FTH A;  5C44 J;  4QIW N;  1MBJ A;  4AC0 A;  1GV2 A;  1YRN B;  4DYQ A;  2CQQ A;  3PO2 J;  3JRB A;  3MKL A;  4XK4 A;  3M4O J;  4Y7N J;  1TC3 C;  3IH3 A;  4D7M A;  1VF9 A;  4XIC A;  2JK3 A;  3A01 B;  5E3O A;  1LFU P;  9ANT A;  4UUT A;  1TWF J;  2DA5 A;  4A3K J;  1H88 C;  5EGO A;  1BA5 A;  2DA3 A;  1JKQ C;  3MN2 A;  1Z0X A;  4DYC A;  3JRF A;  3JRC A;  1IGN A;  5HOD A;  4V2F A;  1T56 A;  1A5J A;  4EEF G;  3JRG A;  3A03 A;  1NTC A;  2DA1 A;  1UHS A;  4A3J J;  3B6C A;  1VI0 A;  2JJ7 A;  1IDZ A;  2XB5 A;  1OFC X;  2R7Z J;  2ECC A;  1IRZ A;  1X2M A;  4JP0 A;  1U8B A;  2FX0 A;  3LSG A;  5EYR A;  2FQ4 A;  1LE8 A;  1NK3 P;  2XB0 X;  3JRD A;  2QF7 A;  4S0H B;  5IOY A;  2LTP A;  1HDP A;  5J1U A;  2M8G X;  2VPR A;  3IH4 A;  3OIO A;  5C4X J;  5IYC J;  1U78 A;  3S2D J;  2GM4 A;  1RKT A;  1TWG J;  1XC5 A;  2L9R A;  2HOA A;  3S14 J;  4JX4 A;  2MGQ A;  1ZTR A;  2X48 A;  3RKQ A;  4X1E A;  5IYB J;  1IDY A;  2DA6 A;  2Y2Z A;  3G1M A;  5M5Y J;  1HLV A;  2E2H J;  1MBF A;  5EZH A;  3HKZ N;  1POG A;  4A93 J;  3RQI A;  3GTG J;  2B63 J;  5EF6 A;  3ZQI A;  3TP0 A;  1MBH A;  4A3C J;  3GTO J;  4BXX J;  5F04 A;  3PO3 J;  2D5V A;  5M3F J;  3S1Q J;  3JRE A;  3WHC A;  1RPW A;  2WB1 N;  2R0Q C;  1ETW A;  5DTD A;  1JKP C;  4RDU A;  3Q3S A;  1WPK A;  2FD5 A;  2JA5 J;  4M3B A;  1IC8 A;  2HOS A;  5J1R A;  1ETX A;  2R5Z B;  3K7A J;  1MBK A;  5J3L A;  3MVP A;  3NAU A;  4JYK A;  4AUX A;  4C3J J;  1RES A;  1B72 B;  1JTX A;  3H0G J;  3HBL A;  3JRA A;  1QVT A;  5IPA A;  1I6H J;  4C3H J;  1P7J A;  2XGC A;  3BQZ A;  1JGG A;  5F1J A;  1MH3 A;  3ZQG A;  4C3I J;  3ZQL A;  3O8G A;  1BJZ A;  1JUP A;  2AHQ A;  2ECB A;  1JUM A;  2TCT A;  2E1O A;  4BBS J;  1F43 A;  2CUF A;  5IYD J;  1MH4 A;  1QPI A;  3H3V K;  3HOV J;  2HXO A;  4XID A;  4BKX A;  2HOT A;  2EZL A;  2GLO A;  2XRL A;  5J1Y A;  3Q0V A;  1U9O A;  2R5Y B;  3QPS A;  1BL0 A;  4DYR A;  2ME6 A;  3HGY A;  2CJJ A;  3HDD A;  1I50 J;  1VFC A;  3RZD J;  5M5W J;  4DZP A;  3TW6 A;  4W1U A;  5C3E J;  1XS9 A;  5GPA A;  2HQ5 A;  2OF7 A; 
#chains in the Genus database with same CATH topology
 3BPV A;  4RLQ A;  1K61 A;  2HVQ A;  2JTV A;  1IUY A;  3I55 I;  2O61 A;  2HI3 A;  3PM1 A;  5EEA A;  3RDI A;  1IW7 F;  3S93 A;  2GIZ A;  2G9W A;  3ML6 A;  2VL8 A;  5F1R A;  1ZAO A;  3MZH A;  2A61 A;  1SVL A;  1V5E A;  2DYR H;  3M8E A;  4LIV A;  5E18 F;  4PCQ A;  2RN7 A;  3ZRG A;  1XSD A;  5FLX K;  2PG4 A;  2DPD A;  1T98 A;  2J5P A;  2ELH A;  1ZEL A;  3VEP A;  3SFZ A;  1FMV A;  4S04 A;  4E7J A;  3AAF A;  3KP3 A;  1YW8 A;  1QNT A;  2EK5 A;  4MLO A;  1R00 A;  1SC7 A;  3BR3 A;  4ZZL A;  5LRR A;  2IGO A;  4KIG A;  4D0P A;  2MD0 A;  3HIF A;  4HAM A;  2RNG A;  3KYC B;  2ICW G;  4ZDL A;  4A5N A;  3IHU A;  3PSF A;  4KIT B;  2X1C A;  4BQQ A;  2RGV A;  1YW7 A;  3TP3 A;  5LEK A;  4DZJ A;  1MSE C;  3ZQC A;  3GYH X;  1J5Y A;  1YS6 A;  2YX4 A;  4M74 A;  1G3T A;  3K0L A;  1R1U A;  2F5F A;  1XDU A;  4M3D A;  1FJL A;  2BY0 A;  1BI3 A;  1UEL B;  3U1D A;  3F8F A;  5HDK A;  3PIO F;  4X6A J;  4KN7 X;  5DV5 A;  2VJ5 A;  1NHA A;  2CFO A;  4XRS G;  2IS6 A;  2EIM H;  3CQZ J;  3GTK J;  1R22 A;  1Z05 A;  3P9K A;  1P6R A;  4BL0 B;  1LJ9 A;  5GAE J;  2G7H A;  1K79 A;  2HVR A;  3ZMV A;  4JX5 A;  4ABZ A;  4IHV A;  4BQO A;  4BEH B;  1X2N A;  5FKK A;  1TWH J;  1MDM A;  2W82 A;  1JGS A;  2LR8 A;  2YUS A;  4M73 A;  5GAD J;  1V5F A;  1LDD A;  4JQF A;  1D3Y A;  2DT6 A;  4M6V A;  4PSW A;  4WXD A;  3JR9 A;  2EPF A;  4ZH4 F;  3KP7 A;  5DYM A;  2OBP A;  4XLP F;  3PIP F;  4PJN A;  1QU3 A;  2FQ3 A;  2RAE A;  3FKI J;  4HRI A;  3KIO A;  3I4N J;  5K7H A;  3GFJ A;  3I9V 2;  2O8K A;  4Y15 A;  4EV0 A;  2ELK A;  2RRE A;  2HS5 A;  3MAJ A;  1QVU A;  3A4C A;  3E7L A;  3HYI A;  1KGS A;  2Y31 A;  2DK5 A;  4CZZ A;  1MKM A;  4O5V A;  4MNU A;  1Z67 A;  3MKY B;  2KIQ A;  2PEX A;  3S8P A;  3G3Z A;  1RR7 A;  3SQN A;  1QHG A;  1ZGA A;  2KJC A;  1W7P D;  2QQ9 A;  2EZI A;  4NNJ A;  2QCO A;  2DA7 A;  2CW7 A;  3TOA A;  2KT0 A;  3HEF A;  4IHW A;  3RI4 A;  4GYI A;  2NVY J;  2ZC2 A;  2DT5 A;  1A31 A;  2KIS A;  1WFX A;  4IPA A;  3UNG C;  2HZT A;  2HGC A;  3GFM A;  4LG0 A;  1B72 A;  2MYS A;  2M45 A;  1D1C A;  4QTR A;  1ONV A;  2HQA A;  4II2 A;  2V6E A;  1JHF A;  2O5R A;  2ETH A;  2LOO A;  2F4O B;  1LVA A;  2V79 A;  4YFN F;  5LHI A;  4HDV A;  3S17 J;  4OIN F;  4XRS A;  3WGI A;  2XAJ A;  1I3A A;  2W7N A;  2CV2 A;  1V4R A;  3FXU A;  5GTI C;  1GVD A;  5EGO B;  2NS7 A;  4OU0 A;  2FJ1 A;  1Z3X A;  2D45 A;  1ODD A;  2BOL A;  1G3W A;  1LEA A;  4NQW A;  4L5E A;  3G6E I;  1WJ5 A;  3IWZ A;  1KYZ A;  3TO7 A;  3CMM A;  3I4M J;  3C18 A;  4ZYE A;  1FOW A;  3RPU D;  2DMT A;  5H6Q A;  5CKT A;  2W85 A;  2DW4 A;  4RGX A;  2IA1 A;  2LH9 A;  3ASN H;  4DW6 A;  1H0M A;  1G6N A;  2X1D A;  4LFU A;  2KIF A;  2OU2 A;  3CJT B;  2ID6 A;  2EZK A;  3U21 A;  3C2G A;  4NUB A;  1EJ9 A;  1ZRC A;  1SAX A;  3W2A A;  2R92 J;  1AHD P;  1Z7U A;  1J7K A;  4EM2 A;  2CUE A;  1IRF A;  2UUZ A;  1BC7 C;  1MNM C;  2DMN A;  3HRS A;  3BRO A;  2V4J C;  1TZL A;  5HS8 A;  1FYM A;  1TP4 A;  3RQ4 A;  3L2Q A;  2CQN A;  3CO7 C;  3ZPL A;  3FXO A;  3AG3 H;  5ED4 A;  3KZY A;  2KDZ A;  2NXN B;  1KQ0 A;  4G6D A;  1GXP A;  2CMP A;  1WKM A;  5ICE A;  5IP9 J;  2XC7 A;  2HR3 A;  3HHH A;  4B4C A;  4F91 B;  2BVL A;  3OIP A;  1MGT A;  3PFI A;  2Z99 A;  3T0Y A;  1O3R A;  4HX4 A;  1ZR4 A;  3HOW J;  1ZN2 A;  2F4I A;  3DQV C;  5H6R A;  4XBF A;  2BE5 F;  4UHT A;  3CDH A;  1PUE E;  1S72 I;  3X2Q H;  3BQY A;  3I58 A;  4OIQ F;  1SAU A;  1MND A;  4H0E A;  3A0H C;  3ZXS A;  4FQG A;  2R7V A;  2DPU A;  3QRF F;  3D5S C;  2E7X A;  5DCF A;  4RBO A;  5EDN A;  2F48 A;  5F27 A;  2O7O A;  3AFH A;  3V7C A;  3GW2 A;  4WWC A;  1PDN C;  1SAN A;  4G6T B;  1QGP A;  1ULY A;  2JVG A;  2K9N A;  1QBJ A;  1V3F A;  2A05 A;  3S2H J;  2XPV A;  1UCR A;  3P7N A;  3TO6 A;  5TGT A;  4CH7 A;  2N8G A;  5DD8 A;  4MFE A;  2L01 A;  1U6G A;  1W0T A;  2HWV A;  1GDT A;  2H27 A;  2W57 A;  3ZOB A;  3QPL A;  3GCM A;  5HVQ C;  1VQM I;  1ON1 A;  4BEH A;  3I3L A;  3LNQ A;  1JKO C;  1E3P A;  1KU2 A;  2ELJ A;  3RZO J;  2BY1 A;  1MW7 A;  3FK6 A;  2KPM A;  2KIU A;  2R7U A;  1FTT A;  3HSE A;  4NC7 A;  2X9D A;  2V26 A;  2R7Q A;  2R7T A;  5FGM A;  3FZV A;  1W5C C;  3QPH A;  1S7E A;  5IP7 J;  1Y0N A;  3FBN B;  3LSJ A;  3BG6 A;  4OWR B;  5GAG J;  3CUQ C;  2BXZ A;  2J5O A;  3IH2 A;  4GFB A;  2A69 F;  3M1E A;  1KQ8 A;  2Y69 H;  4QPQ A;  3NWT A;  3ESW B;  2L0K A;  2LKS A;  4JK1 X;  2R7O A;  4KT6 A;  1GVJ A;  3VSL A;  2BBY A;  4OOI A;  1KU7 A;  4HBL A;  1X4P A;  1ZK8 A;  4O3M A;  4JX6 A;  1MMA A;  3CUQ B;  3VYT B;  4MFD A;  2E60 A;  2M0M A;  4HX8 A;  4RLF A;  1IN5 A;  4UUS B;  1WHU A;  3GF2 A;  3CC2 I;  2PMZ N;  1XCV A;  4KJZ A;  1TL8 A;  3EUH C;  2ZCW A;  3K4B A;  4UB8 C;  3HOT A;  1P7I A;  3H36 A;  4XRF A;  1HBX G;  1WVR A;  3IAS 2;  4LOC A;  3WG9 A;  3PQJ A;  2HKO A;  3FF5 A;  3A0B C;  2WAF A;  4UV8 A;  3OYJ A;  1FP2 A;  1IN7 A;  2DDA A;  3E6M A;  2K85 A;  4AC0 A;  4AM3 A;  3FXK A;  1OR7 C;  3K9T A;  1FOY A;  1W36 D;  3JRB A;  1OCO H;  4ZYH A;  3LSK A;  3CCE I;  1TC3 C;  2EV6 A;  3E0J B;  3CLO A;  4RMN A;  4XIC A;  2JK3 A;  2HYF A;  5AIP A;  3BPX A;  5E3O A;  2MC4 A;  1J75 A;  1YX5 A;  3DTE A;  2FA5 A;  2OQR A;  1YOV B;  1Y39 A;  3GZ6 A;  5EGO A;  1WJC A;  4PJ0 C;  2E36 A;  1IGN A;  1Z0X A;  4DYC A;  3JRF A;  3JRC A;  2ZSI B;  4L5I A;  2QLZ A;  4V2F A;  5HOD A;  5D4R A;  1TW3 A;  2JQ7 A;  3VOD A;  1DDN A;  3DBR B;  4XSZ F;  3WE3 A;  4A3J J;  3WTS C;  1IDZ A;  4IL6 C;  1JHH A;  3S3O A;  1BR1 A;  2ECC A;  1K4S A;  2A6T A;  1X19 A;  3IP4 B;  2X6Y A;  3D5R C;  4BQN A;  2QF7 A;  5BOX A;  2PJR B;  5D5W B;  4S0H B;  2M8G X;  3I0T A;  4B3X A;  3OIO A;  1T39 A;  1FSE A;  2GWR A;  5CVI A;  3HG9 A;  3V8J A;  5GTH C;  2OAZ A;  4LG3 A;  2ZFU A;  1XB4 A;  4AIK A;  2Z2S B;  1UJ8 A;  1VZ0 A;  2MGQ A;  2X48 A;  1N78 A;  2Y2Z A;  4PZJ A;  2V1N A;  4HNT A;  1HLV A;  2E2H J;  1MBF A;  4KN4 X;  5IT3 A;  3QU3 A;  1CF7 B;  4A93 J;  3NEU A;  2EFW A;  4E7K A;  4ETS A;  1U5T B;  1F1Z A;  3KE2 A;  3ABK H;  3DEE A;  3ZQI A;  3DU5 A;  3TP0 A;  4UVC A;  4RAG A;  2CH0 A;  4EAT A;  1RI7 A;  5AON A;  3JCU C;  2M5W A;  1BR4 A;  1T8I A;  4EM1 A;  2VON A;  1G59 A;  2EV0 A;  5B1B H;  2R0Q C;  1DP7 P;  4IRI A;  3Q3S A;  1PP8 F;  2QYO A;  2GXA A;  4OIP F;  2ISZ A;  1KYW A;  1IXC A;  3K7A J;  2L54 A;  4B09 A;  4JYK A;  4AUX A;  2D2W A;  2M1B A;  1RES A;  1Y56 A;  5J6X A;  5HNH A;  4WF2 A;  5HDG A;  1X1D A;  2XHK A;  2K4B A;  2M7A A;  4IXA A;  1QPM A;  2W1O A;  5A2Q K;  2XF7 A;  1I6H J;  1STZ A;  1MH3 A;  2H8W A;  2IW5 A;  2QWW A;  2ZNY A;  5F64 A;  3E6B A;  1BJZ A;  1WZ2 A;  2QQB A;  3CCU I;  2TCT A;  2E1O A;  4BXU A;  1M1E B;  3GO5 A;  4U88 A;  5LLQ A;  4Y17 A;  5IYD J;  1MH4 A;  1QPI A;  1IO2 A;  3D0S A;  4BGD A;  2ZXH A;  4JOM A;  2QSH X;  2BXY A;  4CA0 A;  2QQA A;  1SVO A;  3ONQ A;  3BDD A;  3CZ6 A;  2O8X A;  4BKX A;  1TLH B;  2EFP A;  1LKX A;  2ZJ2 A;  4MHG A;  1U9O A;  2PI0 A;  4E7H A;  2ME6 A;  2CS3 A;  1YFH A;  4E6K G;  3HHG A;  2DYS H;  2V6C A;  4DZP A;  3QP5 A;  1YX3 A;  4HST A;  4P9F A;  3HRM A;  2HQ5 A;  4AID A;  1R9T J;  3CUQ A;  2A5W A;  3DWL E;  3WG7 H;  1Z6T A;  4UUS A;  3FXM A;  2XRO A;  1ERD A;  1YIO A;  2EBI A;  3G1O A;  4ITV A;  1ORK A;  1Y6I A;  2KZV A;  2NS0 A;  4MIM A;  3OYB A;  2CSO A;  2WV1 A;  1DGW Y;  1K6Y A;  3K1M A;  1YG2 A;  5LHH A;  2ZME C;  1A6Q A;  2O6G E;  4U0Y A;  3IRQ A;  1I6X A;  1FZP B;  1QZY A;  2E34 A;  4BY7 J;  3R6S A;  5FKO A;  1DU0 A;  2EH3 A;  5D5U B;  1XGO A;  1W5S A;  4HF2 A;  3MKZ A;  3EQL F;  4LLN A;  3EUH A;  2ZME B;  3FHN A;  1TWC J;  5DS9 A;  3CCY A;  3QQA A;  1WJA A;  3GX4 X;  1ETV A;  4C30 A;  3CMA I;  2Q2E B;  5DM6 F;  2KDO A;  2LRD A;  1R58 A;  2XGD A;  5KK1 A;  2ZJQ F;  1FYK A;  2XRN A;  1Z6R A;  3L00 A;  4LLG F;  3GBG A;  5ERI A;  4M3E A;  4M72 A;  4G12 A;  1FTZ A;  4AVP A;  1OR7 A;  3LAJ A;  1HC8 A;  2D1H A;  1FMW A;  1IN8 A;  1SMY F;  3J80 K;  4J01 A;  4Q47 A;  2CFX A;  2TRT A;  1HCR A;  3IV5 A;  5E1Z B;  3OV8 A;  3OOP A;  4RB0 A;  1LFB A;  4UUV A;  2MBF A;  2L4A A;  1RR8 C;  3ECH A;  3BR1 A;  1WJE A;  3I54 A;  2FML A;  2IRF G;  1P92 A;  1FX7 A;  1GUU A;  3ZQQ A;  5F0F A;  1D0Y A;  4MEY F;  3EYY A;  3SZT A;  4EJT A;  3G1L A;  2Q8K A;  3T8T A;  5K5R A;  3BR0 A;  4XOR A;  2R7R A;  3FKJ A;  4IZZ A;  2M9H A;  3C2B A;  3CJR B;  2PJR A;  1IF1 A;  1R7J A;  2K9Q A;  3H1C A;  3JAM K;  1XSX A;  2XAF A;  3BCA A;  1U0J A;  4AVZ A;  4FAS D;  2XAQ A;  3J81 Z;  3OYA A;  1PVE A;  2VC1 A;  3BR6 A;  5BNG A;  2LLK A;  4C9Y A;  4CYC B;  3I56 I;  4I99 C;  1Z7L A;  2A68 F;  5CVU A;  1UMQ A;  2K3F A;  5M5X J;  3AKZ A;  3TED A;  1XGN A;  3BTI A;  3JRH A;  2QKM B;  4U7B A;  5J40 A;  2F2E A;  4II3 A;  1EH8 A;  3H5A A;  1CF7 A;  3ZR8 X;  3VB2 A;  3CMY A;  3H9Q A;  1VQ7 I;  1TQP A;  1U5T A;  1UG0 A;  2DN0 A;  4BS9 A;  3FIW A;  1ZKG A;  4F3Q A;  1H89 C;  2A6E F;  5BMZ A;  1VQO I;  1K83 J;  1SD5 A;  1N25 A;  2OV7 A;  2XV4 S;  4GGG A;  4QSH A;  1P4A A;  1XTA A;  3M3Y J;  2DOF A;  4AYB N;  2DJI A;  3OSG A;  4U0V A;  4I2O A;  4PSX A;  3I64 A;  3OYI A;  3V42 A;  3OYH A;  2LYC A;  3PL8 A;  3SDG A;  1JI8 A;  1MMG A;  3Q9V A;  4I09 A;  4G7O F;  2EIL H;  1MZB A;  1I5Z A;  2YR2 A;  2LG4 A;  2QQ8 A;  4D7N A;  2KIM A;  1O4X A;  2ZO4 A;  1WRJ A;  3FIS A;  5JHU A;  3OWT A;  4RM3 A;  1BN5 A;  4A6D A;  2LDU A;  3BJO A;  4Q5S F;  2NOJ B;  1SFU A;  3O6B B;  3SDB A;  1VQ9 I;  2GOX B;  2VLA A;  4HLY A;  3QOE A;  1D0Z A;  4M6Y A;  2XUB A;  4IHT A;  3HOS A;  3LSP A;  1XX5 A;  2WV0 A;  2WAQ A;  2E35 A;  1E2X A;  3LSM A;  1OMI A;  3RSN A;  3DKW A;  3RKW A;  1O3T A;  1XD7 A;  2L9V A;  4F55 A;  1BI0 A;  4EJO A;  3CDL A;  3F6O A;  3D1N I;  2Z9O A;  3BR2 A;  2JMW A;  1NG7 A;  2KRC A;  4IF4 A;  3OYN A;  1T08 B;  3CCQ I;  4HF1 A;  2XSD C;  4OIR F;  2JRM A;  2X6O A;  3PNY A;  3T1B A;  2QEX I;  4L18 B;  1H8A C;  2WC2 A;  3ZMT A;  4FET A;  1W0U A;  4ASN A;  5BPD A;  2FBH A;  2HYJ A;  1MMD A;  1Z91 A;  2M7B A;  2K40 A;  5FO5 A;  1G3S A;  1QO0 D;  4CCL A;  4HNV A;  2JPC A;  4GO1 A;  2ACJ A;  4B47 A;  1Z77 A;  2F5V A;  3VWB A;  1P2F A;  4L9J A;  1OLT A;  2P5K A;  2GA2 A;  4P5O A;  3OYF A;  3WGH A;  2L7F P;  1ZQ3 P;  3AG1 H;  3GUD A;  3BJA A;  2VBZ A;  1MNE A;  3CP8 A;  1JXS A;  3ZMZ A;  1B1B A;  2BZT A;  4IQ4 A;  2M3A A;  1KA8 A;  2ZME A;  4BDY A;  2V9V A;  4L9V A;  2LF7 A;  2VQH A;  2QZ8 A;  3BTL A;  3LSI A;  2DA2 A;  5FKM A;  4R79 A;  2Q2E A;  1N75 A;  1HST A;  1WGX A;  1JT6 A;  3GTP J;  2COM A;  4NHJ A;  4G8X A;  3QYB A;  4I76 A;  3L1P A;  1IXS B;  4LD5 A;  3N4M A;  1HKQ A;  2K3P A;  1Z21 A;  2CW8 A;  1RUO A;  3FXJ A;  2DAO A;  2FXA A;  3LSR A;  1HKT A;  1E3H A;  4PJJ A;  3W6K B;  4M6X A;  3HOY J;  1VTN C;  2XPU A;  4FIS A;  2XAS A;  3B73 A;  3PQK A;  5JR3 A;  1SD6 A;  3K4K A;  1AU7 A;  3FHZ A;  2IGM A;  2EV5 A;  4WXC A;  2M4G A;  3GTM J;  2PFB A;  4QLC U;  1FBQ A;  3COA C;  4AYB A;  2Y0M A;  2FU4 A;  3H5R A;  3V4G A;  3W6J B;  3S3M A;  3U9G A;  4A12 A;  5TRD A;  3GZN B;  3GLL A;  4XKW A;  3QYE A;  5JLX A;  3U1K A;  2CWE A;  3U2R A;  1HW2 A;  3HOU J;  2H1L A;  3DXJ F;  3ABL H;  1DU6 A;  1ZAR A;  5FFZ A;  4HPQ A;  3FMR A;  5KHD A;  2K86 A;  5CJ9 A;  5E8I A;  4IX7 A;  1HQC A;  2JZY A;  1FC3 A;  2IEK A;  4RB1 A;  1HW5 A;  4AU7 A;  2Y75 A;  4A69 C;  1XMA A;  1F36 A;  2F5C A;  2GZW A;  4CYC A;  1LQ1 A;  1BIB A;  1F9N A;  2OQG A;  4P55 A;  1JTY A;  4N9I A;  3Q0W A;  3HRT A;  2IAI A;  3L2U A;  3BT9 A;  2OTL I;  3FWE A;  1T6S A;  3M7G A;  5KAI C;  5H2F C;  4FX0 A;  1VQ8 I;  2P8T A;  4F7Z A;  1DQU A;  2IXS A;  2GOM A;  1B9M A;  3KCC A;  3KX2 A;  4E4H A;  3PUF A;  1R6R A;  4M9X A;  4QWQ A;  4HLX A;  2VJJ A;  1O57 A;  1H9G A;  2DCE A;  2Y0S A;  2DU9 A;  5CVR A;  4IO9 F;  2LK2 A;  5HLT A;  3QWL A;  2R7W A;  3F6V A;  1NG6 A;  2DBB A;  2G7U A;  2VQC A;  2FNA A;  2V7F A;  4B1R A;  3KEO A;  2AQE A;  2JA8 J;  3K1P A;  2EIJ H;  4EVI A;  2L9N A;  1YO5 C;  2VQL A;  5FRM A;  4IOA F;  3DEW A;  3CP2 A;  2DOD A;  2EQR A;  4J00 A;  1Y1V J;  1ETK A;  1W7P B;  1FOK A;  2R7X A;  1I27 A;  3GFL A;  1YJ9 I;  2IP2 A;  1QA6 A;  4RB2 C;  3LQR A;  3OL4 A;  1ZYR F;  4AD9 A;  2MLG A;  3B02 A;  5C44 J;  2BW3 B;  2M30 A;  3IAM 2;  3K6G A;  5FRO A;  1YRN B;  2CQQ A;  2FF4 A;  1DPR A;  1OYW A;  3ISP A;  3KLN A;  2XKP A;  5L3D A;  3V7S A;  3I59 B;  3A01 B;  2RDP A;  2QSF X;  1LFU P;  4PGH A;  4CUG A;  4UUT A;  1VQ6 I;  1BOA A;  2DA5 A;  5LGN A;  1H88 C;  1XMX A;  2DA3 A;  2JT1 A;  3VOE A;  3WTY C;  4N4N B;  1A5J A;  4EEF G;  3JRG A;  3A03 A;  1NTC A;  3OMY A;  4XKV A;  4HX7 A;  3MWM A;  3B6C A;  2PQ8 A;  2JJ7 A;  2R7Z J;  5E17 F;  1IRZ A;  2VOO A;  5E8G A;  2CUZ A;  3K1N A;  1U8B A;  3LSG A;  3VYS B;  1R23 A;  4PJM A;  1BBY A;  2EJR A;  3CME I;  3ZQ7 A;  4OMY A;  2NYX A;  4YEJ A;  3JRD A;  5FD6 A;  2PN6 A;  1MJA A;  2HZD A;  2QKL B;  1O3S A;  1OCC H;  2V1X A;  3TDZ C;  4MTD A;  4ANJ A;  3K4L A;  4OMZ A;  1S9H A;  2LRE A;  5IYC J;  5C4X J;  1R5H A;  3JW4 A;  1TWG J;  1FBU A;  2L9R A;  3A1Y A;  4ENN A;  1P9Q C;  1MMN A;  5M5Y J;  1IDY A;  1MJ9 A;  3FX3 A;  3G1M A;  3F8C A;  3FXR A;  2VN2 A;  1HW1 A;  5EZH A;  3TO9 A;  4YIF A;  4IRG A;  3H0D A;  4XLE A;  1K7A A;  3MKW B;  3CDI A;  5J4V A;  4FX4 A;  3GTG J;  3LFU A;  3RYP A;  2BVM A;  3TBI A;  2DQL A;  1LB2 A;  2K4J A;  3BG7 A;  2OZU A;  3GTO J;  4C2U A;  4ZDP A;  4K2E A;  2HDC A;  1I39 A;  4DBQ A;  4AWX B;  3PO3 J;  3R61 A;  3FBI B;  5M3F J;  3LWF A;  3S1Q J;  2LC2 A;  2X4H A;  3WHC A;  3FM3 A;  4ZTF A;  4XOP A;  1RPW A;  4HOB A;  2VBX A;  5DTD A;  1WPK A;  3M9A A;  2JSP A;  1SFE A;  3IKV A;  3OYD A;  1IC8 A;  5D4S A;  3BC8 A;  2DOE A;  4UVA A;  5J1R A;  5LD2 C;  2ZNZ A;  5DCM B;  3IC7 A;  1EA3 A;  1ETX A;  1GHC A;  1PYV A;  3QYF A;  2YPR A;  3OR1 C;  1L3L A;  1Z9C A;  3MVP A;  3H0G J;  3JRA A;  1VQL I;  5IPA A;  2FBI A;  4GCV A;  3KP5 A;  4BXF A;  3KP4 A;  2IS1 A;  3JSP A;  5E79 C;  3BQZ A;  2XGC A;  3ZQL A;  1BIA A;  4V19 K;  3O8G A;  1VQN I;  5E1X A;  2HPI A;  4UNO A;  5CPR B;  2V9P A;  2A3S A;  3G71 I;  4BBS J;  3HPH A;  1F43 A;  2CUF A;  3LST A;  4HSR A;  5D6F A;  4GYG A;  1YJN I;  4EJW A;  3J7Y J;  1TQM A;  2HXO A;  1TTY A;  2MFZ A;  3CTA A;  5B1A H;  5HNF A;  3F22 A;  4HNU A;  5DM7 F;  2GLO A;  4HZF A;  3TQN A;  3Q0V A;  4BU2 A;  3FMQ A;  4C2T A;  3C7J A;  5D6E A;  4RAY A;  1G3Y A;  1MMS A;  5CYV A;  3FDY A;  5HS9 A;  3SEZ A;  3HDD A;  1S6L A;  2EB7 A;  3PSI A;  5B66 C;  3DPU A;  3RZD J;  4W1U A;  4CXF A;  1XS9 A;  3LA3 A;  5GPA A;  3CD6 I;  4Y4R A;  3WU0 A;  2KLO A;  2CG4 A;  5L3G A;  5FLX Z;  3AG4 H;  3EUK L;  4F92 B;  3BWG A;  1YI2 I;  2GBY A;  2CQ7 A;  3REO A;  2OUM A;  4ZDO A;  4CCN A;  1JUS A;  1C0W A;  2CV0 A;  2Z5U A;  2ZKZ A;  1W7P A;  4N0B A;  4RGU A;  4LB6 B;  2VT3 A;  3CCV I;  1IG7 A;  1BW6 A;  4FE4 A;  3DBH B;  1W36 C;  2P5L C;  4BQA A;  3PNT A;  2WY7 Q;  3OYK A;  3BOQ A;  2BW3 A;  2JA6 J;  3M8J A;  2EA2 A;  1YRN A;  4F93 B;  4M3G A;  1ZGW A;  4WK8 F;  5L3C A;  1UST A;  2F4M B;  1WH7 A;  5GPC A;  3I59 A;  3A01 A;  2R93 J;  2DQR A;  4NC8 A;  2FOK A;  2AXT C;  1TNT A;  2W00 A;  3P9C A;  2DLL A;  3F72 A;  4A3B J;  2AXL A;  1JJ8 C;  4IEJ A;  4I0B A;  1U5T C;  2OA4 A;  4NBQ A;  1LNW A;  2WTE A;  4BUP A;  3MD2 A;  3ZMU A;  3TKY A;  3UR3 C;  2IS2 A;  2XPW A;  1R36 A;  2RKH A;  4OIO F;  2VXD A;  5TJJ A;  4YEL A;  5FKN A;  1SD4 A;  2TDX A;  3RPU A;  3VPR A;  4Y33 A;  4MQV A;  2W4S A;  4KIB A;  1EH7 A;  4NB5 A;  2PBI A;  4XQF A;  4BYY A;  4PGG A;  2L7M P;  2I10 A;  1T2K A;  1LPQ A;  2HDW A;  2H6C A;  1R1V A;  2E19 A;  2MSY A;  2NS8 A;  2DT7 B;  2P6T A;  2KZG A;  1R5I D;  4A0Z A;  5IP6 A;  1LUJ B;  2YU9 J;  1Q1H A;  3M07 A;  2CQK A;  1ZG3 A;  5K5O A;  1R4M B;  4IHS A;  4Z2Y A;  1L0O C;  4DNC A;  5J4Y A;  1J59 A;  3SJM A;  1YW9 A;  3ROU A;  4CCJ A;  2VC0 A;  1MD0 A;  2HDD A;  1Y1W J;  1T95 A;  4LK1 F;  2JUC A;  1F5T A;  2FEZ A;  5FLV A;  1EF4 A;  2QA4 I;  2ME0 A;  3K4J A;  1R4N B;  2DMQ A;  2Y9Y A;  2NVT J;  1IV8 A;  3BJ6 A;  1XMK A;  4XN0 A;  3QP6 A;  1H9T A;  2BHZ A;  3WTT C;  3S16 J;  4E7I A;  1RKW A;  1XSV A;  1Y0U A;  2CYY A;  2O0Y A;  2JSC A;  3K69 A;  1S5L C;  1ZG1 A;  4EM0 B;  2LVS A;  5H20 A;  2JA2 A;  4XR6 A;  4HA8 A;  2L5Q A;  3GZ5 A;  3I71 A;  1R71 A;  1FPQ A;  3C2H A;  1R49 A;  1AOY A;  1XG1 A;  2O3F A;  4IHY A;  1UFM A;  2DMU A;  5EG0 B;  2HKX A;  1TQI A;  2ZFW A;  1V5G A;  3OS2 A;  2O03 A;  3HL2 A;  3O8H A;  2WWY A;  1E17 A;  3SFI A;  2VE9 A;  1ITY A;  2VOP A;  1I3Q J;  3GVA A;  2Y9Z A;  2MG4 A;  2X6W A;  4D1Q A;  1MBG A;  1ETY A;  4A3M J;  1QZZ A;  1IJW C;  3ERM A;  1TT0 A;  4D5F A;  4Y52 J;  1RRJ A;  1DPU A;  4MTE A;  2ID3 A;  4LIT A;  2VB6 A;  2X1E A;  4BE0 A;  2STT A;  3DBL B;  2PLY A;  2QSG X;  1DGR M;  2HTJ A;  3GME A;  1YTY A;  3K70 D;  5J8C A;  3C3W A;  5LHG A;  2XAG A;  1EH6 A;  1FIP A;  1X1B A;  1U8R A;  4XMY A;  2Y30 A;  2L2O A;  2WAQ N;  3Q5F A;  2CUJ A;  3CUO A;  3E5Q A;  4DIQ A;  4S05 A;  2WAD A;  4KFC A;  3L2R A;  1BI2 A;  2H6B A;  3MCZ A;  4O6J A;  1D1B A;  4N9H A;  1QHH D;  1Y8Q B;  3F21 A;  1ETO A;  2R4G A;  1OJL A;  3L2C A;  1IXR C;  3EYI A;  2PMH A;  4HYE A;  1GLN A;  5CLS A;  3ZQH A;  5LGU A;  1NK2 P;  1FP1 D;  3ZN0 A;  3OY9 A;  3CCJ I;  3B6A A;  4XON A;  2RQP A;  2QGU A;  3CJN A;  2MH2 A;  2FOW A;  3VYR B;  2KQR A;  3H3Z A;  2EFO A;  1CGP A;  4BY1 J;  3BG5 A;  4OAY A;  2H94 A;  3O3K A;  3QPT A;  2MW8 A;  1JJ6 C;  2DOA A;  2AS5 F;  3E97 A;  1W4M A;  4EGZ A;  4UV9 A;  3CES A;  2MH9 A;  1SD7 A;  2RNJ A;  3VSK A;  1LVK A;  3CCL I;  4NDL A;  1OCZ H;  1R5G A;  4IQJ A;  3OYM A;  3CLQ A;  2Y48 A;  3Q9S A;  1N77 A;  4ENK A;  4A0X A;  2DTR A;  5HS7 A;  3R4K A;  3DPT A;  3TDU C;  2R7F A;  2OTJ I;  1KON A;  2BY3 A;  2HU9 A;  3HOX J;  3SZG A;  2LFB A;  4FE7 A;  3N05 A;  4Q48 A;  5K7F A;  4IKF A;  3KET A;  2B9S A;  2DTZ A;  5FKL A;  4M71 A;  4E70 A;  2M2E A;  3KEY A;  3BCB A;  4BE1 A;  5F0H A;  1T38 A;  5AIQ A;  3OYE A;  3ABT A;  5E20 A;  1BI1 A;  1WJD A;  3HTS B;  2M8E A;  5E3N A;  2V9K A;  1D0X A;  4A3L J;  1UAA A;  2LKP A;  2O9L A;  5IT9 Z;  5K5Q A;  2XAU A;  1W5T A;  2LD5 A;  4ENJ A;  3S3N A;  5CVV A;  3UKG A;  4DQ2 A;  2OJE D;  2LY1 A;  1XN7 A;  4C2M J;  4N4O B;  5KVR A;  2P6S A;  2HOE A;  4A0Y A;  3HSF A;  5D5X B;  6PAX A;  1Z3Y A;  2PX9 A;  3TOB A;  4XLN F;  1WI3 A;  1D5Y A;  1KQ9 A;  1AA7 A;  4IOC F;  3HM5 A;  4ON0 A;  2WBM A;  3IL2 A;  4W97 A;  4G94 A;  3K10 A;  1XDS A;  2AQF A;  4YFX F;  3LFK A;  4EGY A;  2VKD A;  2Z16 A;  3HRU A;  4LG0 B;  2VQG A;  5FJ8 J;  2XGE A;  3S1N J;  3LA7 A;  1A04 A;  3WHB A;  5JI6 A;  3D5L A;  2DFE A;  1A6I A;  2KHM A;  2KRH A;  2Q0O A;  4BH9 A;  1JKR C;  2H1K A;  3ZP5 A;  1VQK I;  1SFO J;  2DFH A;  4F52 A;  2ZSH B;  4P96 A;  2HPM A;  4CHU A;  4D9J A;  1XGM A;  1OCP A;  2Q1Z B;  5F0C A;  2ESH A;  4BBR J;  3KZI C;  1HOM A;  3KZZ A;  1JT0 A;  2WY8 Q;  2X85 A;  3KP2 A;  3CF2 A;  2UWM A;  2E2I J;  2IA0 A;  3GWZ A;  4XLH A;  3BZC A;  1ZGJ A;  4PK4 A;  2IA2 A;  3K2Z A;  2ZXW H;  2YX7 A;  2AO9 A;  4I02 A;  5CVJ A;  1OCT C;  2LF8 A;  2HEO A;  2NOG A;  3QAH A;  3QOP A;  4IRH A;  4XLA A;  1PUF B;  1Z1D A;  3H5N A;  3KEQ A;  5EG0 A;  5E3L A;  3A02 A;  1UHW A;  5BQT A;  2HTS A;  3CC7 I;  2Y0S N;  1VND A;  1TBX A;  1HA8 A;  1MBJ A;  3DKY A;  1RZ4 A;  4ZJZ A;  2ZXJ A;  1HKS A;  1S29 A;  5ICC A;  3RPQ A;  2I5U A;  4B8X A;  5BS6 A;  3F23 A;  3MQ0 A;  1X3U A;  4WXH A;  4HG2 A;  3IH3 A;  2RQQ A;  1HXD A;  4D7M A;  3WTW C;  4DOZ A;  3BZK A;  3H92 A;  1TT5 B;  5L3B A;  1TWF J;  2LMD A;  4HDU A;  4KYW A;  4A3K J;  4B48 A;  1V54 H;  1G4D A;  1BJA A;  1T0F C;  1O3Q A;  3MN2 A;  3PUB A;  4GDF A;  1YIT I;  2ISY A;  1J9I A;  1IAW A;  1UHS A;  3OYC A;  2F5E A;  3P5J A;  1OFC X;  3RKX A;  1TW2 A;  2PJP A;  3O2P E;  3AG2 H;  1B6A A;  2FMY A;  2OD5 A;  1ZLK A;  5L3F A;  3WE2 A;  3HKZ A;  4CCO A;  1EKE A;  2XB0 X;  5LRS A;  2STW A;  4Y3O A;  3MZ8 A;  1HDP A;  1VQ5 I;  1FY7 A;  4CCM A;  3ULQ B;  2FSW A;  3IH4 A;  2WA0 A;  1U78 A;  2GM4 A;  3V8L A;  4M9S A;  3KP6 A;  3H9G A;  3WTV C;  3KLO A;  4JX4 A;  1ZTR A;  4X1E A;  3E1S A;  5IYB J;  2DA6 A;  2GXG A;  2EFQ A;  1IZ1 A;  3P9I A;  1I1S A;  5EEH A;  1O7F A;  4LK0 F;  2VBW A;  3H9J A;  3I4P A;  2B63 J;  2VJI A;  3HUG B;  4U0W A;  2IT0 A;  1WJB A;  2P5V A;  3BLY A;  5D8L B;  2VOD A;  5LEJ A;  2IVM A;  1FYL A;  4BXX J;  5F04 A;  1DUX C;  4LIU A;  4UXN A;  1D8K A;  3DP7 A;  2EA4 A;  2WB1 N;  1ETW A;  4L5J A;  5A2Q Z;  5BPI A;  1S7O A;  1JKP C;  5ILS A;  2FD5 A;  2KP6 A;  4BAY A;  2Z33 A;  4M3B A;  4RS8 A;  2XKO A;  3GXO A;  2XIG A;  2EWN A;  5HOO A;  4BJ5 C;  1K78 B;  2R5Z B;  3L7W A;  3W2V A;  1J0R A;  3NAU A;  3ZGK A;  4C3J J;  1IN4 A;  2UV1 A;  3HBL A;  4KDP A;  2M87 A;  3RKY A;  4C3H J;  1P7J A;  2XF5 A;  2XGX A;  1BR2 A;  4RGS A;  2DDB A;  1AWC A;  1JUP A;  2ECB A;  4ZTJ A;  3ZMS A;  2P7C B;  3HSR A;  2D1V A;  4KT5 C;  3LAP A;  5D5V B;  1PP7 U;  4RA2 A;  3ZMD A;  3H3V K;  3HOV J;  2ZJP F;  4XLC A;  2IJL A;  1U3E M;  4HW0 A;  3PFY A;  4EJU A;  1RIO H;  4P1W A;  2HOT A;  3RCO A;  4GRI A;  4PUS A;  4CDG A;  2XRL A;  5J1Y A;  4M9Z A;  2R5Y B;  2QM3 A;  5ILV A;  2IGK A;  3E5X A;  2KRF A;  3S32 A;  2HYG D;  3HGY A;  1I1G A;  2OZ6 A;  4Q4Z F;  1I50 J;  1K6O A;  3EUA A;  5M5W J;  5B3S H;  2NVU B;  4U87 A;  2KKO A;  5C3E J;  2LSO A;  4FHT A;  2PMU A;  2OF7 A;  2DA4 A;  2I8D A;  3FK7 A;  5E1W A;  5FB2 A;  4QPO A;  1W1W E;  3DEU A;  4DGW B;  2LBF B;  1FSH A;  2G0E A;  3F8N A;  3ELK A;  1OKR A;  3DTI A;  3G2B A;  2VUM J;  3S1R J;  3N97 A;  1TWA J;  4G9Y A;  3NQO A;  5C4J J;  2LNB A;  3FXQ A;  2F6C A;  1ETQ A;  1PUF A;  2GQQ A;  2L7Z A;  4LMY A;  5J8F A;  4KA4 A;  1OQY A;  4XM3 A;  4ZYG A;  3GTJ J;  1D8J A;  3HC7 A;  2CU7 A;  4D5C A;  3CC4 I;  4RAZ A;  1AKH B;  4EJV A;  3LOC A;  3J80 Z;  4MO7 A;  2UXN A;  3BR5 A;  4DBR A;  3R60 A;  4XL9 A;  3BZ6 A;  1WI9 A;  1LEB A;  3TMO A;  3SYT A;  3MFK A;  2ADU A;  3TGN A;  4G7Z F;  1WJF A;  3SXY A;  2HFH A;  2GIV A;  2JUG A;  3K4M A;  1B4A A;  3DPL C;  4G6Q A;  2VI6 A;  5D8K B;  4HEA 2;  2OC6 A;  2FE3 A;  4BJT A;  5EJC A;  3V7R A;  2VKV A;  1RNL A;  2K9L A;  3JRI A;  4E7L A;  1B8I B;  1F4K A;  1D1A A;  5GP9 A;  3JSO A;  1LDK B;  1WH5 A;  1S8N A;  3JAM Z;  4BNC A;  4EMS A;  3ERE D;  1USS A;  3DCF A;  2L02 A;  2Z3Y A;  4CO8 A;  3BG9 A;  5JHF A;  4FCY A;  4I01 A;  1T0F A;  2WB1 A;  4MGR A;  4A3I J;  3GLX A;  3LQQ A;  1ON2 A;  3EDP A;  4KIF A;  2VAS A;  4L0Z B;  2M34 A;  2JWT A;  3NWS A;  2BV6 A;  5JVT A;  1X1C A;  2KMU A;  4IVN A;  2JRT A;  4BAC A;  3BP8 A;  4I0A A;  4CIC A;  3VFZ A;  4TV7 A;  2VIX A;  1SMT A;  1S7A A;  2A5Y B;  1K4T A;  1RET A;  1ZRD A;  1X1A A;  4KMF A;  1MBE A;  2CRG A;  3ECO A;  1FBS A;  2EIN H;  1X3Z B;  1YQA A;  5TIS C;  3F9K A;  2MC3 A;  4FT8 A;  1ZLJ A;  1UG2 A;  4V2G A;  3F8B A;  2GA1 A;  4B3A A;  4CSW A;  2UZK A;  5ICG A;  4UB6 C;  2QUF A;  5HLI A;  2HNH A;  3GTL J;  2CQX A;  2E7W A;  3M1C A;  4BDZ A;  5EZG A;  3F0C A;  3J81 K;  4A3E J;  3HUG A;  3K2A A;  1YE9 A;  1KZH A;  1RUN A;  4M3F A;  1VQP I;  3NAR A;  5HLH A;  2OPT A;  3BTC A;  3HB9 A;  2FBK A;  4J19 A;  2V1D A;  2FUG 2;  1ZRF A;  4A3D J;  4G7H F;  2R7S A;  2X51 A;  2V1U A;  3WU1 B;  5IT9 K;  4NC6 A;  1FWZ A;  2NVX J;  3PJR A;  1LDJ A;  4HF0 A;  5JLW A;  3CCR I;  3DKX A;  4RB3 C;  1WQ2 A;  4B44 A;  1K78 A;  2R5Z A;  3HPG A;  4YII A;  4A2U A;  2P7V B;  3SZP A;  2XAH A;  3ZQF A;  3HZJ A;  1BM9 A;  5KNL A;  3Q0U A;  2NVQ J;  4A3G J;  1X1P A;  3IUO A;  2LP0 A;  1UHM A;  4I6Z A;  4ZZD A;  5K1Y A;  3S15 J;  1PJR A;  1OYI A;  1O7L A;  3OYL A;  5FD5 A;  3M8F A;  5ILU A;  4KMU X;  4YIR X;  2KL4 A;  4U7D A;  1U9N A;  2QBY B;  1XPX A;  4H4K C;  3DFG A;  4BHC A;  2CO5 A;  3BY6 A;  1FT9 A;  4E7S A;  1MSF C;  1HF0 A;  3LA2 A;  1FEX A;  1OYY A;  2E5N A;  3F8M A;  3FM5 A;  2YS9 A;  3AL0 C;  5DUK A;  1R1T A;  2XF6 A;  5DDG A;  2R5Y A;  4JBA A;  3OOU A;  1FIA A;  5L3E A;  1SVM A;  2IPQ X;  3AL0 B;  4A6E A;  4GXO A;  3TW7 A;  5M3M J;  4I98 B;  1FOX A;  1LE8 B;  1IUF A;  3QOD A;  3HTU A;  4RGR A;  2W48 A;  4Z6Y A;  2DO7 A;  4A5M A;  2NNN A;  2VJ4 A;  2COB A;  5FLM J;  2LBF A;  2JN6 A;  3WOD F;  2EIK H;  3G73 A;  3OSF A;  1E0E A;  4BHP A;  1A35 A;  1REP C;  3ABU A;  4DJA A;  1BOB A;  3HXL A;  1WWX A;  2P0W A;  1KU3 A;  3L2V A;  3NRV A;  2EZH A;  1G2H A;  3WU2 C;  4R8H A;  3RYR A;  1WCM J;  1KU9 A;  2L7K A;  4KIC A;  1AKH A;  3HGG A;  5LFA A;  3CO6 C;  2YU3 A;  1BW5 A;  2KJB A;  2H09 A;  3J7Z I;  1OIS A;  1V55 H;  3KFW X;  2RC4 A;  2CW0 F;  3OR2 C;  3V8K A;  2IS4 A;  1TNS A;  2XSJ C;  5CQG A;  1ZG5 A;  3L2W A;  2UXX A;  1Q1V A;  1T33 A;  1ZR2 A;  4I7H A;  1SEU A;  2LY2 A;  1APL C;  2RV8 A;  2LY9 A;  5KAF C;  1QRY A;  3KPH A;  4L0Y B;  2GXB A;  5K7Z A;  1IRG A;  1B8I A;  2E1M C;  3BG3 A;  2K9S A;  3BTJ A;  1OCR H;  4HQE A;  4KIS A;  1FLI A;  3DU6 A;  3RJP A;  1YS7 A;  1YLF A;  3W6V A;  1J09 A;  2DJN A;  5JVG F;  2A6H F;  2E1M B;  2R3S A;  3OIQ A;  3IRR A;  2LKX A;  4IHX A;  4XKC A;  3TL4 X;  3VDX A;  2M0C A;  3CCS I;  3ZN1 A;  2VKH A;  3GTQ J;  2H8R A;  2EFN A;  4CYD A;  3G4S I;  4AIJ A;  3DLL F;  4R1H A;  2E5Z A;  3FXL A;  3WGG A;  4EQQ A;  4UVB A;  2E71 A;  2ZB9 A;  2IGN A;  2E1N A;  1GXQ A;  3S1M J;  5HLG A;  1LFP A;  1X58 A;  2DI3 A;  1CQT A;  1GV5 A;  1ZRE A;  3J7A O;  1GT0 C;  4X0G A;  2K7L A;  2ESN A;  5DUI A;  2MD5 A;  3HJE A;  3R0J A;  3DF8 A;  2M4K A;  4RM2 A;  2PMZ A;  5DCM A;  2DMP A;  2HQN A;  4PFP A;  5E3M A;  5F08 A;  3DLA A;  1RC9 A;  3KYD B;  3HOZ J;  2E2J J;  2DFI A;  2VKE A;  3ZCO A;  4WX9 A;  4A3F J;  4XKB A;  3LMM A;  4MQ9 F;  5IOZ A;  2P81 A;  2WAE A;  4XRM A;  1JE8 A;  1OPC A;  2W24 A;  2B7E A;  1YYV A;  3W2W A;  2KFD A;  2NRA C;  1E3O C;  1IV6 A;  1ACI A;  2FNP A;  1DP3 A;  3WTU C;  2IBD A;  1ENH A;  1ZHF A;  2HXI A;  3VYU B;  2JA7 J;  1HDD C;  2L9S A;  1YIJ I;  3IKT A;  1HSJ A;  1UZC A;  2QEN A;  1U2W A;  3L09 A;  2X6X A;  4FTH A;  3CF5 F;  4QIW N;  1Y8R B;  3JTH A;  1GV2 A;  4HV5 A;  4XLF A;  1D5V A;  3RTR A;  4KUM A;  2ZBK A;  4DYQ A;  3CCM I;  4B43 A;  3PO2 J;  1SFX A;  4BE2 A;  1MIJ A;  3MKL A;  2BGC A;  4XN3 A;  4CCK A;  4XK4 A;  2CGP A;  3M4O J;  2VXZ A;  2MLK A;  2DFF A;  4Y7N J;  1VQ4 I;  1VF9 A;  2VE8 A;  2HQR A;  2FRH A;  4HQM A;  2BY2 A;  4L9T A;  3RIR A;  9ANT A;  3GEZ A;  1YHQ I;  2QBY A;  5DEQ A;  4ESJ A;  2A07 F;  3DV8 A;  3H3U A;  4ENM A;  1BA5 A;  3QU6 A;  1JKQ C;  3C1D A;  1XGS A;  3K70 C;  1T56 A;  3OYG A;  5B5E C;  1ZH5 A;  2L3D A;  1UB9 A;  2K27 A;  2DA1 A;  3OS1 A;  2MA3 A;  3E3V A;  1VI0 A;  1NH3 A;  3EET A;  2XB5 A;  4YFK F;  3JTG A;  3IWF A;  2QVO A;  3E5U A;  4PDK A;  1X2M A;  2XVC A;  4JP0 A;  2FX0 A;  3OL3 A;  1QZE A;  2BHY A;  1IN6 A;  5EYR A;  2VT2 A;  2FQ4 A;  1LE8 A;  1NK3 P;  2OCE A;  1B9N A;  1MJB A;  2BEO A;  5HDN A;  5IOY A;  1X4O A;  2LTP A;  1P4X A;  4ZC3 A;  2K5C A;  5J1U A;  5KCM A;  4BJ6 C;  4KNY A;  2VPR A;  4CZC A;  1MDM B;  3ASO H;  3EPZ A;  2ZXI A;  3K4N A;  3S2D J;  3E6C C;  1RKT A;  2C6Y A;  1XC5 A;  3SHF A;  1QQI A;  1SFK A;  2XDV A;  2P4W A;  2HOA A;  4YG2 F;  3S14 J;  3WTX C;  1XCB A;  3RKQ A;  1FNN A;  2CV1 A;  4WCG A;  4ZYA A;  3GFI A;  1S3J A;  2OCC H;  2YSR A;  3HKZ N;  1POG A;  4XSX F;  2VPL A;  3DTK A;  3LL7 A;  3I5U A;  3RQI A;  2DK8 A;  3OS0 A;  2BYV E;  4OAZ A;  4UY8 I;  1EV7 A;  5EF6 A;  1MBH A;  3F3X A;  4A3C J;  3K4C A;  4HV6 A;  4ESB A;  5J47 A;  5LGT A;  2X0L A;  4PFO A;  3J7A Y;  3S2W A;  2D5V A;  3JRE A;  2F5D A;  1X3W B;  4L9N A;  5FRN A;  1G8X A;  3PNV A;  3A2K A;  4RDU A;  4IJA A;  4AIH A;  2ZJR F;  2JA5 J;  3MEX A;  4LGW A;  3H35 A;  2HOS A;  4XOT A;  4LLL A;  1MBK A;  1WSU A;  5J3L A;  4MEX F;  4LB5 A;  3I53 A;  1B59 A;  5JFR A;  2NAZ A;  2L4M A;  1JTX A;  3L9F A;  1B72 B;  1QVT A;  5F6F A;  2W25 A;  1BC8 C;  4ZYD A;  2B0L A;  4XNF A;  4PJL A;  5FFX A;  3WTZ A;  3E6D A;  2DXI A;  1J2X A;  3T5X A;  4Y13 A;  1JGG A;  2K02 A;  5F1J A;  3ZQG A;  4P9U A;  4C3I J;  3CJQ B;  3LSH A;  3T8R A;  2AHQ A;  3ABM H;  1JUM A;  2VBY A;  5DD4 A;  2Z1D A;  4BHB A;  3KYL A;  2JPB A;  4XID A;  4RAF A;  2MAB A;  2GAU A;  4YRV A;  1YJW I;  2HVS A;  5LBQ A;  2EZL A;  1IRX A;  4NQW B;  3SEQ A;  3QPS A;  1BL0 A;  2W84 A;  5ICF A;  4ESF A;  4DYR A;  2K9M A;  3FMS A;  1A36 A;  3R0A A;  1P4W A;  4LJZ F;  2CJJ A;  3W3C A;  2RVC A;  5CQE A;  4CGZ A;  5GAH J;  1VFC A;  2NNY A;  5IY5 H;  3TW6 A;  4E7Z A;  5EEG A;  2E1C A;  3MZY A;  2R7D A;  3MMY B;  2JVH A; 
#chains in the Genus database with same CATH homology
 1R9T J;  2DA4 A;  1K61 A;  3FK7 A;  4UUS A;  2EBI A;  3G1O A;  2HI3 A;  1ORK A;  4MIM A;  2GBY A;  3PM1 A;  2G0E A;  5EEA A;  2WV1 A;  2VUM J;  3S1R J;  1JUS A;  1TWA J;  4BY7 J;  5FKO A;  5C4J J;  1DU0 A;  2EH3 A;  1ETQ A;  1PUF A;  2L7Z A;  3GTJ J;  1IG7 A;  2CU7 A;  4D5C A;  1BW6 A;  1AKH B;  4FE4 A;  5DS9 A;  1TWC J;  3CCY A;  3LOC A;  3QQA A;  4MO7 A;  3BR5 A;  1ETV A;  2JA6 J;  1YRN A;  2XGD A;  4M3G A;  1ZGW A;  4MLO A;  3BR3 A;  3GBG A;  4M3E A;  2VI6 A;  4G12 A;  1FTZ A;  1WH7 A;  5GPC A;  3A01 A;  2R93 J;  2VKV A;  3TP3 A;  4DZJ A;  3JRI A;  1B8I B;  5GP9 A;  2TRT A;  1HCR A;  1MSE C;  4A3B J;  1WH5 A;  3IV5 A;  3ZQC A;  1JJ8 C;  4IEJ A;  3DCF A;  1LFB A;  4M3D A;  1FJL A;  3BG9 A;  4X6A J;  2XPW A;  3BR1 A;  4FCY A;  4A3I J;  1GUU A;  5FKN A;  5F0F A;  4XRS G;  3VPR A;  3CQZ J;  3GTK J;  3G1L A;  2M34 A;  2JWT A;  3BR0 A;  2L7M P;  2I10 A;  2M9H A;  3C2B A;  4JX5 A;  4ABZ A;  4IHV A;  2K9Q A;  1X2N A;  5FKK A;  2E19 A;  2MSY A;  2NS8 A;  1TWH J;  5IP6 A;  1RET A;  2LR8 A;  2YUS A;  3BR6 A;  2YU9 J;  5BNG A;  2LLK A;  1MBE A;  2CRG A;  4M6V A;  4CYC B;  3JR9 A;  1UMQ A;  5M5X J;  3SJM A;  3TED A;  3BTI A;  1UG2 A;  4V2G A;  3JRH A;  4B3A A;  2RAE A;  3FKI J;  3I4N J;  5K7H A;  3CMY A;  2HDD A;  2CQX A;  1Y1W J;  2O8K A;  3GTL J;  5EZG A;  3F0C A;  1H89 C;  1EF4 A;  2DN0 A;  2ELK A;  3FIW A;  1ZKG A;  5FLV A;  4A3E J;  2ME0 A;  3K2A A;  1K83 J;  2DMQ A;  1QVU A;  2Y9Y A;  2NVT J;  3E7L A;  4M3F A;  2Y31 A;  3NAR A;  4QSH A;  2OPT A;  3M3Y J;  3BTC A;  3HB9 A;  4AYB N;  3OSG A;  4J19 A;  3S16 J;  1RKW A;  1RR7 A;  4A3D J;  2LVS A;  3SDG A;  2NVX J;  2EZI A;  2QCO A;  2DA7 A;  5JLW A;  2KT0 A;  1XG1 A;  3HEF A;  4IHW A;  4IHY A;  2R5Z A;  2DMU A;  5EG0 B;  4D7N A;  2NVY J;  1O4X A;  3FIS A;  3ZQF A;  2NVQ J;  3Q0U A;  3O8H A;  1B72 A;  4A3G J;  3SFI A;  1ITY A;  2LP0 A;  4QTR A;  4I6Z A;  1I3Q J;  3S15 J;  2Y9Z A;  2MG4 A;  1MBG A;  1ETY A;  4A3M J;  1IJW C;  3LSP A;  4D5F A;  3S17 J;  1U9N A;  4XRS A;  4Y52 J;  1GVD A;  2ID3 A;  5EGO B;  2NS7 A;  2FJ1 A;  1MSF C;  1HF0 A;  3CDL A;  3D1N I;  1FEX A;  3BR2 A;  2YS9 A;  2JMW A;  4L5E A;  2XSD C;  2R5Y A;  2X6O A;  3I4M J;  2DMT A;  3OOU A;  1FIA A;  1H8A C;  1FIP A;  2Y30 A;  4DW6 A;  2WAQ N;  3TW7 A;  5M3M J;  1W0U A;  1LE8 B;  2HYJ A;  1IUF A;  2K40 A;  2ID6 A;  2EZK A;  2W48 A;  2R92 J;  1AHD P;  4HNV A;  2CUE A;  2COB A;  5FLM J;  1MNM C;  2DMN A;  1ETO A;  1OJL A;  2JN6 A;  1Z77 A;  3ZQH A;  3OSF A;  1NK2 P;  1ZQ3 P;  2L7F P;  3B6A A;  1G2H A;  2EZH A;  2KDZ A;  1WCM J;  5IP9 J;  1AKH A;  4B4C A;  4BY1 J;  3BG5 A;  3HGG A;  2MW8 A;  1JJ6 C;  1BW5 A;  3BTL A;  2DA2 A;  5FKM A;  1ZR4 A;  3HOW J;  1WGX A;  1JT6 A;  3GTP J;  4I76 A;  4NDL A;  3L1P A;  3BQY A;  1Q1V A;  1T33 A;  1ZR2 A;  1APL C;  2LY9 A;  3LSR A;  1QRY A;  3HOX J;  2LFB A;  4FE7 A;  3HOY J;  2XPU A;  5K7F A;  4FIS A;  5K7Z A;  4RBO A;  1B8I A;  3BG3 A;  2DTZ A;  5FKL A;  2K9S A;  3BTJ A;  5F27 A;  5EDN A;  2O7O A;  1AU7 A;  1SAN A;  2M2E A;  3GTM J;  2K9N A;  5F0H A;  3W6V A;  3S2H J;  2XPV A;  2DJN A;  4IHX A;  2LKX A;  5E3N A;  2N8G A;  5JLX A;  4A3L J;  4MFE A;  2O9L A;  3HOU J;  2M0C A;  1W0T A;  2LD5 A;  3GTQ J;  1DU6 A;  2H8R A;  1GDT A;  3UKG A;  3ZOB A;  4C2M J;  3QPL A;  2IEK A;  2ZB9 A;  3LNQ A;  1JKO C;  3S1M J;  4A69 C;  1WI3 A;  1D5Y A;  1X58 A;  1CQT A;  3RZO J;  1F36 A;  1GV5 A;  3FK6 A;  1GT0 C;  3HM5 A;  4CYC A;  1FTT A;  2X9D A;  4W97 A;  1JTY A;  1S7E A;  5IP7 J;  3Q0W A;  2DMP A;  2IAI A;  5FJ8 J;  2XGE A;  3S1N J;  3BT9 A;  5E3M A;  3LSJ A;  5F08 A;  3WHB A;  4GFB A;  3IH2 A;  3HOZ J;  1A6I A;  2E2J J;  2VKE A;  1JKR C;  2L0K A;  4A3F J;  2H1K A;  1SFO J;  5IOZ A;  1ZK8 A;  2P81 A;  4JX6 A;  4XRM A;  1OCP A;  4MFD A;  2LK2 A;  5F0C A;  4BBR J;  1HOM A;  1JT0 A;  4UUS B;  1E3O C;  2E2I J;  2PMZ N;  4B1R A;  1IV6 A;  2JA8 J;  2IBD A;  3DEW A;  1P7I A;  2AO9 A;  1OCT C;  1ENH A;  2EQR A;  1Y1V J;  1ETK A;  2HXI A;  2NOG A;  1PUF B;  1HDD C;  2JA7 J;  4LOC A;  5EG0 A;  5E3L A;  3A02 A;  2Y0S N;  1VND A;  4FTH A;  5C44 J;  4QIW N;  1MBJ A;  4AC0 A;  1GV2 A;  1YRN B;  4DYQ A;  2CQQ A;  3PO2 J;  3JRB A;  3MKL A;  4XK4 A;  3M4O J;  4Y7N J;  1TC3 C;  3IH3 A;  4D7M A;  1VF9 A;  4XIC A;  2JK3 A;  3A01 B;  5E3O A;  1LFU P;  9ANT A;  4UUT A;  1TWF J;  2DA5 A;  4A3K J;  1H88 C;  5EGO A;  1BA5 A;  2DA3 A;  1JKQ C;  3MN2 A;  1Z0X A;  4DYC A;  3JRF A;  3JRC A;  1IGN A;  5HOD A;  4V2F A;  1T56 A;  1A5J A;  4EEF G;  3JRG A;  3A03 A;  1NTC A;  2DA1 A;  1UHS A;  4A3J J;  3B6C A;  1VI0 A;  2JJ7 A;  1IDZ A;  2XB5 A;  1OFC X;  2R7Z J;  2ECC A;  1IRZ A;  1X2M A;  4JP0 A;  1U8B A;  2FX0 A;  3LSG A;  5EYR A;  2FQ4 A;  1LE8 A;  1NK3 P;  2XB0 X;  3JRD A;  2QF7 A;  4S0H B;  5IOY A;  2LTP A;  1HDP A;  5J1U A;  2M8G X;  2VPR A;  3IH4 A;  3OIO A;  5C4X J;  5IYC J;  1U78 A;  3S2D J;  2GM4 A;  1RKT A;  1TWG J;  1XC5 A;  2L9R A;  2HOA A;  3S14 J;  4JX4 A;  2MGQ A;  1ZTR A;  2X48 A;  3RKQ A;  4X1E A;  5IYB J;  1IDY A;  2DA6 A;  2Y2Z A;  3G1M A;  5M5Y J;  1HLV A;  2E2H J;  1MBF A;  5EZH A;  3HKZ N;  1POG A;  4A93 J;  3RQI A;  3GTG J;  2B63 J;  5EF6 A;  3ZQI A;  3TP0 A;  1MBH A;  4A3C J;  3GTO J;  4BXX J;  5F04 A;  3PO3 J;  2D5V A;  5M3F J;  3S1Q J;  3JRE A;  3WHC A;  1RPW A;  2WB1 N;  2R0Q C;  1ETW A;  5DTD A;  1JKP C;  4RDU A;  3Q3S A;  1WPK A;  2FD5 A;  2JA5 J;  4M3B A;  1IC8 A;  2HOS A;  5J1R A;  1ETX A;  2R5Z B;  3K7A J;  1MBK A;  5J3L A;  3MVP A;  3NAU A;  4JYK A;  4AUX A;  4C3J J;  1RES A;  1B72 B;  1JTX A;  3H0G J;  3HBL A;  3JRA A;  1QVT A;  5IPA A;  1I6H J;  4C3H J;  1P7J A;  2XGC A;  3BQZ A;  1JGG A;  5F1J A;  1MH3 A;  3ZQG A;  4C3I J;  3ZQL A;  3O8G A;  1BJZ A;  1JUP A;  2AHQ A;  2ECB A;  1JUM A;  2TCT A;  2E1O A;  4BBS J;  1F43 A;  2CUF A;  5IYD J;  1MH4 A;  1QPI A;  3H3V K;  3HOV J;  2HXO A;  4XID A;  4BKX A;  2HOT A;  2EZL A;  2GLO A;  2XRL A;  5J1Y A;  3Q0V A;  1U9O A;  2R5Y B;  3QPS A;  1BL0 A;  4DYR A;  2ME6 A;  3HGY A;  2CJJ A;  3HDD A;  1I50 J;  1VFC A;  3RZD J;  5M5W J;  4DZP A;  3TW6 A;  4W1U A;  5C3E J;  1XS9 A;  5GPA A;  2HQ5 A;  2OF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...