2KDZA

Structure of the r2r3 dna binding domain of myb1 protein from protozoan parasite trichomonas vaginalis in complex with mre-1/mre-2r dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
107
structure length
107
Chain Sequence
KVKFTEEEDLKLQQLVMRYGAKDWIRISQLMITRNPRQCRERWNNYINPALRTDPWSPEEDMLLDQKYAEYGPKWNKISKFLKNRSDNNIRNRWMMIARHRAKHQKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYB24
publication title NMR structural analysis of DNA recognition by a novel Myb1 DNA-binding domain in the protozoan parasite Trichomonas vaginalis.
pubmed doi rcsb
source organism Trichomonas vaginalis
molecule tags Transcription/dna
total genus 29
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13921 Myb_DNA-bind_6 Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2kdzA01
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2kdzA02
3NAUA 4IHVA 1H8AC 2DA4A 3BTIA 4RDUA 1HOMA 4JYKA 1BW6A 1RPWA 2DA2A 4A3KJ 3LSGA 1K83J 1BL0A 3MKLA 2HOTA 2JA6J 2DMPA 1ITYA 1X2NA 1TC3C 1ETYA 4AYBN 1RKTA 2DA6A 2HOAA 2LKXA 5GPAA 4GFBA 1F43A 1A5JA 4A3MJ 1U9NA 3G1OA 4JP0A 2KT0A 3SJMA 5EGOB 2DA3A 2MG4A 5BNGA 4B1RA 1WH7A 2X48A 1WI3A 2XSDC 3M4OJ 2EQRA 3JRBA 3OSGA 1ZTRA 5FKNA 4A93J 2LK2A 3JRFA 1X58A 5IOZA 3QPLA 1TWHJ 2HXIA 1WGXA 3BT9A 2M0CA 1W0TA 5GPCA 3CCYA 1O4XA 4DYQA 2N8GA 2LVSA 1WPKA 1JUPA 1ZKGA 4BY7J 2K9SA 1X2MA 1U8BA 1IGNA 4LOCA 3HOUJ 5IYCJ 2K9QA 5IYDJ 1ZK8A 4D7MA 5JLXA 2ID6A 4JX4A 3S16J 1IC8A 2LP0A 4HNVA 3H3VK 3IV5A 2O9LA 2LLKA 4RBOA 1S7EA 3G1MA 1MSEC 2FQ4A 5IPAA 1ZR2A 2NVXJ 1T56A 1FIPA 1JKOC 1LE8A 2O7OA 3BG9A 2NVYJ 4W1UA 1IV6A 2TRTA 4AUXA 3BG5A 1UG2A 1RESA 4M3GA 3VPRA 1BJZA 2ZB9A 2EZKA 5FJ8J 4M3BA 4CYCB 3MN2A 1FIAA 4XRSG 4IHXA 2IBDA 1HLVA 3CDLA 3ZQCA 1MBEA 1Z0XA 1BW5A 3JRAA 2WAQN 1FTZA 3A01B 2XRLA 4A3CJ 1JUMA 1ZGWA 3ZQIA 1AHDP 2RAEA 3Q0WA 3RQIA 1OCTC 2HDDA 5EEAA 1JT0A 3Q0VA 1IUFA 2CUEA 5IOYA 1WH5A 3BR0A 1RKWA 1VNDA 2LR8A 4X1EA 4Y52J 4M3FA 5F0HA 3ZOBA 2IAIA 2JA8J 2JJ7A 2MW8A 2LFBA 2R0QC 1NK2P 2GLOA 2AO9A 2CRGA 1CQTA 1FTTA 4XRMA 2M9HA 3GTJJ 2VKEA 2JK3A 2FJ1A 2B63J 2CJJA 2DMTA 4A3IJ 1BA5A 2NOGA 1H88C 2HXOA 2E2JJ 4A3GJ 2R5YB 5M3MJ 1POGA 2R5ZB 1GV2A 1FJLA 1P7IA 5IP7J 2R7ZJ 2EH3A 3PO2J 1HDPA 1MBFA 1OCPA 2DA5A 3L1PA 3PO3J 1FEXA 4ABZA 1U9OA 1UHSA 5F08A 2R92J 3FISA 3GTQJ 2ME0A 3B6CA 2H8RA 1MBKA 2L7FP 5JLWA 1SANA 3F0CA 4C3JJ 3W6VA 4J19A 1AKHB 5M5YJ 5M3FJ 1EF4A 2HYJA 3MVPA 1ZR4A 1B8IB 2O8KA 5EZGA 3BTCA 4JX6A 4I76A 3O8GA 9ANTA 2MSYA 3OIOA 2Y31A 2HOSA 2NVTJ 2M8GX 2HQ5A 4FE4A 5J1UA 2LTPA 1E3OC 5EGOA 1ETQA 3HOVJ 4A3LJ 1OJLA 1PUFB 2DN0A 5E3OA 3RKQA 1JJ6C 2DMNA 1GDTA 1ETWA 1IJWC 1JUSA 5E3MA 3HOXJ 2X6OA 3JREA 4JX5A 4V2FA 2X9DA 3TW7A 2KDZA 3HOZJ 1MSFC 1B72B 2NVQJ 2XB0X 2EZIA 4XIDA 2DJNA 1MH3A 2W48A 1QVUA 2K40A 5EF6A 3BQYA 1VF9A 2PMZN 5E3LA 2XB5A 4A69C 3SFIA 4UUSB 2AHQA 4BKXA 2DTZA 1JTYA 1Q1VA 3JRHA 1TWFJ 1MH4A 3NARA 2XGEA 5K7FA 5EG0A 1ENHA 4UUTA 1YRNA 1MNMC 3IH3A 5FLVA 4DW6A 4AC0A 2CQXA 4D5CA 4DZJA 5FKKA 3LNQA 3BTJA 2R93J 1JJ8C 3HEFA 4QTRA 1I50J 3JRDA 3RZDJ 3HM5A 4XICA 2XPVA 3BR3A 4C3IJ 1DU0A 3A01A 2M34A 1MBGA 1OFCX 4IEJA 5C4JJ 3TEDA 2DMQA 2L0KA 3DEWA 3SDGA 4QIWN 4NDLA 2Y2ZA 2MGQA 5J1YA 1TWCJ 5FKMA 3JRGA 5F27A 3TW6A 3GTPJ 3BG3A 5C44J 2CU7A 2NS7A 1JKQC 3S14J 1F36A 4B4CA 2L7MP 5IP9J 4BY1J 3S2HJ 3BTLA 1HCRA 4D5FA 5J3LA 3D1NI 1SFOJ 1MBHA 5K7ZA 5GP9A 3K7AJ 2JWTA 1DU6A 4M3DA 2E19A 2TCTA 2YS9A 3HGGA 2LY9A 1UMQA 2COBA 3ZQLA 1HF0A 1K61A 3LSJA 2H1KA 3GTGJ 4X6AJ 3BQZA 2Y30A 5F1JA 2R5YA 3S2DJ 2NS8A 2OPTA 4M3EA 4MFDA 3S15J 2JA7J 3QPSA 2M2EA 5DTDA 1ETKA 4W97A 2DA7A 3Q3SA 1TWAJ 4MIMA 1LFBA 1RETA 4B3AA 5M5XJ 1ORKA 1ETOA 3LSPA 1XC5A 2WV1A 3M3YJ 5F0CA 1JTXA 2CUFA 1JT6A 3C2BA 3OSFA 2E2IJ 3I4NJ 2L7ZA 5C4XJ 1I3QJ 1B8IA 2GBYA 3CMYA 5EZHA 3WHCA 2P81A 5IYBJ 4QSHA 2ECBA 2QF7A 3FKIJ 3BR6A 5FLMJ 4C2MJ 1NTCA 3S1MJ 1XS9A 2D5VA 5F0FA 2YUSA 1WCMJ 4S0HB 4DYRA 1PUFA 2EZHA 3HGYA 2OF7A 3S1QJ 3Q0UA 1IDYA 2VUMJ 1A6IA 1U78A 2E2HJ 1GV5A 4A3BJ 4DYCA 2Y0SN 3LOCA 2XPUA 4I6ZA 1B72A 2DMUA 2I10A 3UKGA 2FD5A 1JKPC 2XPWA 4DZPA 2E1OA 3H0GJ 3LSRA 1IRZA 3HKZN 3ZQGA 3RZOJ 1P7JA 2EBIA 3TP0A 2ME6A 1AU7A 2G0EA 2FX0A 2JN6A 5EDNA 2HI3A 5K7HA 4UUSA 4BBSJ 3FIWA 4FE7A 3HOYJ 3PM1A 3HOWJ 2Y9YA 3JRIA 3QQAA 1GT0C 4XK4A 4A3JJ 1ETVA 3I4MJ 1XG1A 1JGGA 1APLC 3BR5A 3S1RJ 3ZQFA 1Y1VJ 3BR2A 1JKRC 1VI0A 3GTOJ 1LFUP 2ECCA 1NK3P 3A02A 4CYCA 2VI6A 4BBRJ 5IP6A 1G2HA 1IG7A 3IH4A 5M5WJ 1LE8B 2YU9J 3HDDA 1Y1WJ 2Y9ZA 2JMWA 1IDZA 1H89C 5EG0B 4C3HJ 1YRNB 4FTHA 1GVDA 4FISA 1T33A 2EZLA 1VFCA 1TWGJ 3A03A 2JA5J 5EYRA 3OOUA 5FKLA 3S17J 3K2AA 4A3FJ 4V2GA 5E3NA 2ID3A 1GUUA 1RR7A 1QRYA 2K9NA 3JR9A 4G12A 4MO7A 2GM4A 5HODA 2L9RA 4L5EA 5C3EJ 1QPIA 1MBJA 4XRSA 3E7LA 3S1NJ 5FKOA 2VPRA 3G1LA 3O8HA 1I6HJ 2DA1A 1ETXA 3BR1A 3GBGA 3ZQHA 4D7NA 1Z77A 5J1RA 2R5ZA 3GTKJ 4IHWA 3GTMJ 3TP3A 4FCYA 4MLOA 2ELKA 1QVTA 2VKVA 4BXXJ 3HB9A 4Y7NJ 3WHBA 4EEFG 3JRCA 2LD5A 1W0UA 2XGDA 1HDDC 1R9TJ 2WB1N 4A3EJ 3FK7A 3B6AA 3DCFA 1AKHA 2IEKA 3HBLA 4IHYA 3CQZJ 2XGCA 5F04A 3FK6A 4M6VA 5DS9A 3GTLJ 3IH2A 2CQQA 1D5YA 4A3DJ 4MFEA 1ZQ3P 2QCOA
chains in the Genus database with same CATH superfamily
2E1NA 3NAUA 2ESNA 2LF7A 1SFEA 2L54A 3BG7A 3CP2A 4NBQA 2ISYA 4JYKA 3Q9VA 3EUKL 4GO1A 4L9JA 4EV0A 4C2UA 4B44A 5TISC 4F55A 3HUGA 1RRJA 1T2KA 1K83J 3NRVA 1V5GA 3MZYA 3WTSC 1QHHD 2P6SA 5B1BH 1VQ8I 2RN7A 1MJ9A 3JAMZ 4P96A 3CC2I 1ITYA 3M8FA 1Z67A 2A61A 4AYBN 4GFBA 1R58A 1FBUA 3H36A 1RC9A 5E79C 3T0YA 3VEPA 3G1OA 3HSRA 4UVBA 2VC0A 2CQ7A 5FROA 2STWA 4A0YA 2OC6A 4CSWA 4G7HF 2EQRA 1DDNA 1J2XA 1J75A 3M8JA 1WZ2A 4A93J 4Q4ZF 4KDPA 2DPUA 2LMDA 2OZ6A 1J59A 1FX7A 3V7RA 2VBWA 3F21A 4PJLA 3HXLA 2HXIA 5E18F 4P9UA 1WGXA 3BT9A 2FOKA 4UHTA 1B59A 2EIJH 2YSRA 4DYQA 2N8GA 4A6EA 5IT9Z 3FM3A 3CCUI 1XGSA 3S3OA 1FPQA 4XMYA 1U5TC 1IGNA 3K70D 2K9QA 1G3WA 3GFMA 1BC7C 1P4AA 2BY1A 1S5LC 4KN7X 4BQOA 3CCMI 2W82A 4Y17A 1P9QC 2O8XA 3IV5A 3ABMH 4UY8I 1AOYA 2BOLA 3AG1H 3C2HA 1S7EA 4UVCA 2OD5A 3DPTA 4RGRA 1YW7A 2NVXJ 1FIPA 2DFHA 3OYDA 2QSHX 1Y6IA 4W1UA 2HQNA 3KYLA 3BG5A 1UG2A 2CW8A 4M3GA 4XN3A 4HLYA 4LG0B 5FLXK 3I56I 4L9NA 2EZKA 3ERED 1B6AA 2WTEA 3HRUA 3ZN1A 3GZ5A 3HPHA 4RAYA 3E97A 2LY2A 1HLVA 2HOEA 3L9FA 4GRIA 2PLYA 2LF8A 3CDLA 2F5DA 3OWTA 4HF0A 1MBEA 1Z0XA 2R7DA 1MMDA 2K27A 4LK0F 3J7ZI 1FTZA 3A01B 2XRLA 4Y13A 1AWCA 4GXOA 2KIFA 2JRMA 1OCTC 4YEJA 5DDGA 1JT0A 3PUBA 4PJJA 3U1KA 4F91B 4HAMA 3P7NA 3VOEA 2CUEA 5IOYA 2CW7A 2DFIA 2V1UA 2K86A 3H5AA 1VNDA 1LFPA 2CSOA 2J5OA 3GWZA 4X1EA 4M3FA 3PSFA 3ZOBA 5F0HA 2JJ7A 2HQRA 3R0JA 1R1UA 2KIMA 5K5OA 1NK2P 2GLOA 5IY5H 1XTAA 4I02A 2CRGA 1CQTA 2CV0A 2CUJA 3QODA 2IW5A 5JVGF 2P5LC 1OYIA 2M9HA 5BPIA 2GA1A 2VKEA 2FJ1A 2CJJA 5LLQA 5LGNA 4A3IJ 2KKOA 2JA2A 1H88C 4MNUA 2E5ZA 4A3GJ 1X19A 1POGA 1FJLA 1J9IA 1PVEA 2H94A 1MDMA 2HR3A 2EH3A 3LFUA 3G3ZA 1MKMA 3L1PA 1XCBA 2Z2SB 4IHSA 1FMWA 4G6DA 3GFIA 1TTYA 1IN8A 1IXRC 2LC2A 4NUBA 1SD4A 2CGPA 3CJQB 2Y75A 4CZZA 3HRMA 4F93B 3AL0B 3FKJA 1K4TA 1AKHB 2A3SA 2MC4A 2VJ5A 5CVVA 3DXJF 2PJRA 5AONA 3K2ZA 4O5VA 1B8IB 3CF5F 2O8KA 2DTRA 3ZP5A 4JX6A 3CC7I 5CVRA 2XGXA 4ZYEA 2MSYA 4UXNA 3OIOA 2HOSA 3SEQA 2HQ5A 6PAXA 2IXSA 4HX8A 1TBXA 2LTPA 5E17F 4N9IA 4CO8A 3KP2A 1ETQA 4I0BA 4CA0A 4QLCU 5H6RA 3I0TA 5EGOA 1WI9A 1BIBA 1JJ6C 1KA8A 3HUGB 1GDTA 4XLNF 1JUSA 1Y8QB 2ESHA 2DOEA 1KQ0A 3F8BA 3H9QA 1T0FA 2X9DA 3J7AO 1SD5A 2KDZA 1ZH5A 2QKMB 2F4IA 2R7FA 2DO7A 2NVQJ 3LSMA 3VB2A 1G6NA 2DPDA 2WBMA 3TO9A 4NQWA 1SFKA 1GLNA 1MH3A 2OTJI 1QVUA 2V1DA 3BG6A 2K40A 3WG7H 2L9VA 1ODDA 1SMYF 3BQYA 3PIPF 2KP6A 3W2AA 2W25A 1DPUA 1IRGA 2LRDA 2M3AA 1U3EM 3QPHA 3HHHA 3EPZA 3AL0C 2JQ7A 5ERIA 1H0MA 2L3DA 3OL4A 4YIIA 1F1ZA 3NARA 1WKMA 2Z5UA 2YPRA 3TO7A 5HVQC 5K7FA 5F6FA 2JVHA 4IJAA 5EG0A 3J80K 1RZ4A 2ZSIB 4M6YA 2X85A 3IH3A 3IKVA 4AC0A 4XR6A 5GADJ 4D5CA 2QQAA 3T1BA 2R7WA 4YFXF 3VFZA 2DYSH 4DZJA 5KAFC 3I59B 5FKKA 1WJDA 2BBYA 2F5CA 2LG4A 3MD2A 2R93J 3VWBA 3QRFF 4G8XA 2FMYA 3FXMA 3BCAA 3HEFA 5JHUA 1I50J 3RZDJ 3HM5A 4XICA 2STTA 1P4XA 2FMLA 3L7WA 4PFPA 3TDZC 4C3IJ 4GYIA 4RAZA 4ZJZA 2VKDA 3TEDA 2VONA 1FMVA 2DMQA 4KISA 3DEWA 5J1YA 2VE9A 2IT0A 3ABUA 3SDBA 3LSHA 2VJIA 4LJZF 3QOEA 3G6EI 1KU7A 5KCMA 2GA2A 3U2RA 5C44J 4CGZA 2GXGA 1XPXA 2WADA 5IP9J 3S2HJ 2ZJPF 1HCRA 1SFOJ 4XKBA 3LSKA 1ZG3A 3PNTA 1V54H 4KMUX 4XNFA 4NHJA 1I1GA 2QZ8A 2LY9A 1UMQA 1XMKA 2HVQA 3LWFA 4IL6C 4JQFA 3M9AA 4AIHA 3Q5FA 1HF0A 2AQEA 4RGXA 1YG2A 2E5NA 2VODA 1HA8A 1O7LA 5CVUA 3S2DJ 1UJ8A 1Y0UA 4HBLA 1USSA 2OPTA 1B9MA 3F22A 1BJAA 4M3EA 3K4BA 1YX3A 2CH0A 1NHAA 1FLIA 1TWAJ 2JSCA 4MIMA 1LFBA 2GAUA 5M5XJ 5J4VA 3EYIA 1KGSA 4ZTJA 2XF5A 1J7KA 2VQHA 2WV1A 3H3ZA 5F0CA 1NG6A 1K6YA 2DLLA 2HTSA 5IT3A 5FD5A 3C2BA 4HZFA 5CPRB 2L7ZA 4FX0A 4PSXA 1LVKA 1S8NA 4Y3OA 5EZHA 5IYBJ 2P81A 5H6QA 2XASA 1K78A 2QF7A 3BR6A 2V9PA 4C2MJ 1Q1HA 1NTCA 2ZFWA 2FBIA 5A2QZ 4XSZF 2EA2A 3PFIA 3DU6A 2CFOA 4DYRA 1PUFA 4WXCA 5ICCA 3Q0UA 3KETA 3OYBA 3H92A 4JK1X 1GV5A 4DYCA 3DKXA 2CQNA 4PJNA 2QSFX 2G9WA 2HPIA 1IN7A 3UKGA 2FD5A 3UR3C 2FOWA 5E1ZB 3N97A 2E1OA 5KNLA 3E6DA 1YS7A 4BJ6C 3HKZN 4EM2A 3RZOJ 1P7JA 4RA2A 3SZPA 3PQKA 4PUSA 2IS6A 2G0EA 3KP4A 2XAFA 5CYVA 2FX0A 2VT3A 3E1SA 5F1RA 1D1AA 2ZBKA 2GIVA 1BI0A 1A35A 1S6LA 4BHCA 1FOYA 4FE7A 3V7SA 3FBIB 1J0RA 1X4PA 4N9HA 4C30A 3HZJA 1JGGA 3CF2A 4AVPA 1Y1VJ 4CCMA 3HSFA 3RPUA 2XSJC 4GDFA 4DGWB 4KT6A 2HU9A 1FT9A 3PL8A 5E20A 4BBRJ 5LRRA 5ICGA 3KZZA 1EH8A 4ASNA 3FM5A 3TKYA 3CMEI 4RAFA 2MBFA 1G2HA 1D1BA 3IH4A 5M5WJ 4OMZA 4B43A 2P5KA 2JMWA 3V8KA 1IDZA 1LDDA 2R7TA 2HTJA 5L3GA 5EG0B 4C3HJ 4A12A 1H89C 4FTHA 5L3DA 3BPXA 3ZQQA 1NH3A 4LLLA 1VFCA 4NC6A 2Q8KA 1YLFA 4WX9A 3HOTA 1R5GA 5EYRA 5FKLA 2X6YA 3S17J 1IN6A 2XVCA 3E3VA 3K2AA 3R60A 4YELA 5DCMB 1T0FC 3GCMA 3BZKA 2LKPA 2CV1A 2L9RA 4L5EA 4KT5C 2JVGA 2W24A 4XRSA 2ZKZA 4M72A 3OYMA 2VPRA 3I71A 4EJTA 2XKPA 3O8HA 3S93A 4U0YA 3JW4A 3C18A 2M7BA 4AIJA 1BOAA 3WODF 3K4MA 4B47A 1VQLI 3W6JB 5ILVA 3C1DA 2ZXWH 3ZQHA 4EGZA 1Z77A 5J1RA 4Y4RA 1MJAA 1MNDA 4P5OA 4EM1A 4FCYA 1Z7UA 3LSTA 2CWEA 5JFRA 2VKVA 3QYFA 2R7SA 3GO5A 3TL4X 4N4OB 2KIQA 3WHBA 3JRCA 3CESA 3QAHA 3ZN0A 4ETSA 4AIKA 3KIOA 1DGRM 2R7OA 2UUZA 3FK7A 1JGSA 2H1LA 4XOPA 4E4HA 4PGHA 3PIOF 5FRNA 1IRFA 4IVNA 1R7JA 2CQKA 4IHYA 1A04A 2WY7Q 4IOAF 2XGCA 3E6BA 1BR1A 2VT2A 1BI3A 4CCKA 3RDIA 2GIZA 2Q2EB 3N05A 4MFEA 1QZYA 4ESBA 1OR7A 2QCOA 1G3SA 1Z05A 4ESFA 3A2KA 4N4NB 5H2FC 4IHVA 2FRHA 3DLAA 1H8AC 4RB2C 2IPQX 3H35A 2DA4A 3OYGA 4I01A 1HOMA 5HLGA 3IUOA 1BW6A 2XDVA 3V42A 2DA2A 4R79A 3M1CA 2Z1DA 4S04A 4CDGA 3LSGA 2DW4A 2DQLA 1BL0A 2HOTA 3DV8A 3RTRA 2NRAC 3K4CA 1K78B 1ETYA 1T08B 1I27A 2LKXA 3K0LA 2L01A 1F43A 5GPAA 2W00A 2OQGA 2IVMA 4RB1A 2KT0A 2KFDA 2HS5A 3SJMA 1LQ1A 1USTA 2DA3A 5LGTA 3WU1B 2X48A 3WTXC 2XSDC 2DQRA 1MMSA 2A05A 3FXUA 2RVCA 5HDGA 5IOZA 4MHGA 1TWHJ 1W5TA 1WJCA 2HFHA 3K6GA 3DTIA 2M0CA 4PJMA 3CCYA 1O4XA 1MMAA 3LMMA 5FLXZ 3OYLA 1WPKA 1ZKGA 3SYTA 3O6BB 3HOUJ 4U7BA 4D7MA 5JLXA 2L9NA 2ID6A 1X4OA 4HPQA 1IC8A 2DFFA 4II3A 4HNVA 4BQAA 1DGWY 2AXTC 4OAYA 3KZYA 2LLKA 5CVIA 5LGUA 3FXOA 4F7ZA 4J01A 1MSEC 1WJ5A 1FP1D 3IWZA 2ETHA 3ZQ7A 1YW8A 4IRIA 1JKOC 5E1XA 3KPHA 1TW2A 1TP4A 2ZMEA 1T38A 1W7PA 2CMPA 1LDKB 1ZREA 2X1EA 4KFCA 1E17A 1RESA 1S9HA 4XORA 5FJ8J 4M6XA 2EFNA 3MN2A 5D5UB 3RKYA 2TDXA 2XV4S 1BW5A 1I1SA 2DK5A 5B66C 3JRAA 2F5EA 1MNEA 5D8LB 3KYCB 1AHDP 4M71A 3Q0WA 1IN5A 5B5EC 1V5FA 1S72I 3RQIA 4WCGA 5EEAA 4E70A 3Q0VA 3PFYA 4AWXB 4I0AA 1IUFA 3IRRA 2ZXJA 2X4HA 4ZYGA 1RKWA 2XROA 4O6JA 3LQQA 2WA0A 4U88A 5L3EA 1V5EA 2LFBA 1IAWA 5KVRA 2EK5A 2VB6A 2FUG2 1QU3A 2MC3A 1G8XA 2JK3A 3QU6A 4P1WA 3OMYA 4EGYA 1WHUA 4Z2YA 1XSDA 3WGGA 2NOGA 1QZEA 2EA4A 4XLPF 3OS2A 3CO6C 2IGMA 1XX5A 3F6VA 2H27A 2UXXA 5IP7J 3ZRGA 5GAEJ 1VQOI 4ZC3A 3WG9A 3PO3J 4IO9F 4EM0B 3CCJI 1U9OA 5F08A 4YRVA 2R92J 2V9KA 2MFZA 5L3BA 3GTQJ 1WQ2A 2B0LA 3M07A 1SANA 3F0CA 3RYRA 3VSLA 4AIDA 3W6VA 3K4JA 1XCVA 3WGIA 5M3FJ 2BE5F 3MVPA 3TO6A 1FP2A 4IPAA 3D5SC 5BOXA 2Y69H 2X0LA 1LEAA 5HNHA 4HA8A 4QWQA 3CCLI 5FD6A 2RREA 1XSXA 3BTCA 4I76A 3FZVA 5D5XB 2LKSA 3O8GA 9ANTA 4L5JA 3U21A 2UV1A 1IO2A 3I5UA 2Y31A 3DFGA 3TOBA 2NNYA 2NVTJ 3GW2A 4U7DA 1KU3A 1E3OC 4A3LJ 3PUFA 1BI2A 5E3OA 2DODA 2EFPA 4H4KC 2QUFA 2XUBA 1FYLA 3FHZA 1N25A 2DOFA 2X6OA 4JX5A 3JREA 3H9JA 2K9MA 2DYRH 2L7KA 2E7XA 3BJ6A 3TW7A 2GXBA 2E1CA 2WV0A 3L2RA 2VOOA 4XIDA 1YOVB 1PYVA 2EJRA 2OU2A 4LK1F 2W48A 3DQVC 1JHHA 3KE2A 3J81K 2HZDA 2QEXI 4KIBA 2XB5A 3LA2A 4XONA 4UUSB 3JTGA 3ELKA 2VASA 4CXFA 3ROUA 2L2OA 1TWFJ 1V3FA 2G7HA 4LFUA 3ULQB 5ICEA 5HOOA 3OY9A 2XGEA 1ZELA 1OR7C 1ENHA 3CZ6A 1ZYRF 1MNMC 5FLVA 4C9YA 2Z99A 3EUAA 3HRTA 1ULYA 5FGMA 2XAGA 1ZGAA 5TJJA 2CQXA 4NC8A 2P0WA 1I5ZA 1TNTA 1OKRA 2BW3B 2P5VA 3BTJA 3H5RA 4DNCA 3AAFA 4F92B 1JJ8C 1ONVA 4F3QA 4BGDA 5FO5A 4XLAA 2H09A 4BQQA 2HPMA 2IRFG 2RC4A 4RB3C 1EV7A 1MBGA 1OFCX 4KICA 4IEJA 5TGTA 2L4MA 2PMZA 3RQ4A 1O3QA 4AM3A 3MKZA 2L0KA 2DT6A 2EV5A 1X1DA 3SXYA 1B4AA 3BCBA 3OIPA 2KL4A 1TLHB 2ADUA 1V4RA 2V1NA 2P6TA 3BG3A 5LBQA 2A6TA 2XRNA 4ON0A 1YE9A 2NS7A 1JKQC 2OCEA 3FDYA 1KYZA 3D1NI 1BOBA 1MJBA 1SVOA 3OYFA 1WJAA 1DU6A 2E19A 2YS9A 5HDNA 1Z7LA 2H8WA 3QP5A 4OIOF 1ZGJA 1UB9A 2V79A 1IUYA 2H1KA 1OYWA 3CC4I 1QNTA 1UHMA 2Y30A 3E6CC 5F1JA 2R5YA 4BACA 4LIUA 1VTNC 4UUVA 1VQ6I 3KP7A 1X1AA 1HW1A 2L5QA 2F5VA 2YR2A 4XL9A 3FBNB 4MFDA 1TL8A 3QPSA 2W57A 1PP8F 3MEXA 2IS4A 2QBYB 2FE3A 4B3AA 4CUGA 5HNFA 2WC2A 1KQ8A 4D0PA 2W4SA 3LSPA 5LHGA 2P4WA 2ZMEC 4UNOA 5J8FA 3A0HC 5F64A 3WTVC 1PJRA 3M3YJ 3K1NA 5JVTA 4P55A 3OSFA 2KLOA 4LD5A 3WTYC 1EH7A 1KONA 2GBYA 3L2CA 2RNJA 2K3FA 3WHCA 1FYKA 2HYFA 5KAIC 2PN6A 3FKIJ 4U87A 3ZMTA 5FLMJ 1NG7A 2BGCA 4CCOA 3KFWX 3MCZA 4V19K 1G4DA 2LBFA 3OR2C 1VQ7I 1TQMA 3S3MA 2D5VA 2YUSA 1WCMJ 2LREA 4S0HB 3SHFA 2XIGA 2XAUA 3DEEA 3MQ0A 4IRHA 1A6IA 2E36A 4E7IA 1MMNA 3W6KB 2B7EA 2XPUA 3CCEI 4I6ZA 1QGPA 1B72A 2DMUA 5D6EA 2P7CB 3OYJA 3BC8A 1BIAA 2DK8A 3RYPA 3VDXA 4BDYA 1D0ZA 1HKTA 2GXAA 3K9TA 4XLHA 1RUNA 3ONQA 3DPLC 2HDWA 3NWTA 2EIMH 5E1WA 1YJWI 2HI3A 3JTHA 4XKVA 2ZCWA 3GEZA 4BJ5C 4J00A 1ZRDA 2CYYA 4KN4X 2ZXHA 2Y9YA 1UFMA 3JCUC 2VBZA 5L3CA 3RPQA 4A3JJ 2IGKA 2PMUA 3BR5A 1FSHA 1W4MA 4EJVA 4ZYHA 1FZPB 3BR2A 2E60A 2X6WA 1JKRC 1LFUP 1EKEA 2ECCA 5DM7F 5E8GA 1NK3P 2A6EF 2VI6A 3CJRB 1PP7U 2C6YA 2MD0A 1X1PA 4OIPF 1XN7A 2X6XA 1X3UA 3WGHA 4BE0A 3HDDA 3M7GA 2Y9ZA 3C2GA 2W84A 3CUQA 4E6KG 2Z16A 5GTHC 5IT9K 4BHPA 3OV8A 1TWGJ 2XAQA 3A03A 3CLOA 4II2A 3BJAA 3QYBA 3SZTA 3OOUA 2WWYA 3B73A 4BL0B 1F5TA 4V2GA 2ID3A 1GUUA 1QRYA 4WF2A 2Q0OA 2ZC2A 4G12A 4MO7A 4DIQA 5HODA 4WK8F 5C3EJ 2AQFA 1QPIA 2DU9A 2E1MC 1W36D 3LFKA 2UWMA 1P2FA 2DDBA 3FX3A 4D7NA 3IRQA 3K70C 1R49A 5B3SH 2IP2A 4QPOA 3OYKA 1HC8A 1P6RA 1YIOA 3K69A 3P5JA 2YX4A 4HDVA 3ZMDA 2D1VA 2ELKA 4BXXJ 4K2EA 1R1VA 5E8IA 1O57A 2R7VA 4EEFG 1HDDC 1ZG5A 4Y33A 3FXJA 1OLTA 1R9TJ 1R00A 5ED4A 5J47A 3B6AA 2KRCA 2CG4A 2HYGD 4KMFA 1MDMB 1FBQA 4Q48A 3WTTC 5F04A 3TBIA 2I5UA 3FK6A 5DS9A 2DBBA 1A36A 5H20A 3DLLF 2KJCA 4IXAA 3EUHA 5KK1A 4B3XA 3BROA 1MW7A 1WI3A 2PFBA 3VODA 4A5MA 4I99C 3PJRA 1BC8C 1SFXA 4MQVA 4AVZA 4KIFA 4RDUA 4HDUA 2WY8Q 2PJRB 4FASD 5HS7A 4FX4A 1LB2A 4A3KJ 1FNNA 5D4RA 3KCCA 3MKLA 3QU3A 2DMPA 4BYYA 1X2NA 3D0SA 2HNHA 1W5CC 2DA6A 4A3MJ 1U9NA 3IP4B 2VXDA 4JP0A 4HX4A 2LBFB 5EGOB 3HL2A 2E71A 5BNGA 4B1RA 5CQGA 1WH7A 2FSWA 2M8EA 4LIVA 5HLHA 4I2OA 2ZSHB 3IAS2 3JRBA 4B8XA 2EWNA 3CJNA 4BXFA 3NQOA 1ZTRA 1U0JA 4MEXF 5FKNA 3OYHA 3EQLF 1Z9CA 1B9NA 1X58A 5LHIA 3QPLA 2QGUA 1R22A 3AKZA 2CW0F 3AG2H 1ZLKA 4NQWB 1W0TA 5GPCA 2VJ4A 1XDSA 3OR1C 2LSOA 1O3SA 2LVSA 1JUPA 4BY7J 2RKHA 2K9SA 5FRMA 1U8BA 4LOCA 2KRHA 5IYCJ 5IYDJ 4XOTA 1ZK8A 1VQ9I 4PGGA 3T8TA 1K7AA 3S16J 1T39A 5KHDA 3H3VK 4PK4A 3BOQA 4HF2A 2JT1A 3OYAA 2O9LA 2BY2A 3I55I 2BV6A 4IRGA 4RBOA 2MA3A 3I53A 5D8KB 3G4SI 1YI2I 2FQ4A 1YJ9I 2W85A 4ANJA 1T56A 2R7RA 1LE8A 3JSPA 2O7OA 3BG9A 2NVYJ 1IV6A 1XDUA 1KYWA 2TRTA 3OS1A 3LA3A 4AUXA 2NAZA 3VPRA 1BJZA 2ZB9A 2VQCA 4IHXA 2PMHA 5LHHA 3J7YJ 4ZTFA 1E3PA 2EINH 4L9VA 1H9GA 4B48A 4KUMA 1G3YA 3EDPA 1GXQA 2PG4A 4NB5A 5L3FA 3OYIA 4A3CJ 1JUMA 1Y0NA 2IA0A 1ON1A 2M87A 3H1CA 1X3ZB 2HDDA 3DBRB 1R36A 2P7VB 1PDNC 2A5WA 2Y48A 2FNAA 4L18B 3BR0A 4ZYAA 2M7AA 4CCJA 2O03A 1HKQA 2G7UA 2LR8A 3RSNA 5K5QA 3A0BC 1YYVA 2IAIA 2R0QC 3I4PA 1T6SA 2VOPA 1H9TA 1ZRFA 4UB6C 1FTTA 5BPDA 2B63J 2DMTA 1R23A 4IQ4A 1X1BA 3KLOA 2FA5A 2QM3A 1KZHA 1XSVA 2HXOA 2RQPA 2E2JJ 2PJPA 1GHCA 1K6OA 1P7IA 2LOOA 2WAQA 3BZ6A 4HOBA 4TV7A 3VYSB 2R7ZJ 2K7LA 1YO5C 1MBFA 1OCPA 2DA5A 2DI3A 2OJED 4BE1A 4U0WA 4ABZA 1FOXA 2ZFUA 4BXUA 1HW5A 2D45A 3CUQC 2ME0A 4LG3A 2H8RA 4ZDPA 1F9NA 2QQ8A 3KP6A 3I58A 1I6XA 1U2WA 3U9GA 4C3JJ 5M5YJ 2I8DA 4XLEA 1Z3XA 2L9SA 3RKWA 4XLFA 3N4MA 1EH6A 5J8CA 2EFWA 4OOIA 2KZVA 2EV0A 5HS8A 4AU7A 3IHUA 3K4NA 5BMZA 3VYUB 1V55H 1WWXA 2M8GX 1XGNA 2COMA 5J1UA 1VQMI 1HKSA 3HOVJ 1R71A 5GAGJ 2LDUA 1OJLA 1BN5A 1BR4A 3O3KA 1PUFB 4LMYA 2LNBA 2DMNA 2VBYA 1ETWA 3W2WA 1E2XA 5E3MA 3HOXJ 2F4MB 1S3JA 3CDIA 1YW9A 2RV8A 4V2FA 2QYOA 1M1EB 2YX7A 1X1CA 2KQRA 3CCVI 1MSFC 3HOZJ 2VJJA 3ECHA 1QA6A 2DJNA 2HVRA 5FFZA 2R7UA 1Z3YA 3B02A 2VLAA 2E7WA 1LPQA 2PI0A 5EF6A 1BM9A 1VF9A 3A1YA 4JBAA 2PMZN 5E3LA 1SD7A 4CHUA 3HTUA 5AIPA 4G7OF 2MH2A 4ENMA 5HS9A 5B1AH 3QPTA 4RMNA 3ABLH 3SFIA 4BKXA 4NC7A 2OBPA 4RGUA 1JTYA 1TW3A 1Q1VA 3MAJA 1MH4A 1OPCA 4H0EA 3GZ6A 1L3LA 4A6DA 4M74A 3KLNA 3CD6I 3EUHC 4P9FA 1ZLJA 4UVAA 4UUTA 1A6QA 3KZIC 4U0VA 4E7ZA 2Z9OA 1HQCA 1O7FA 4LG0A 3CMAI 2K9LA 5DD4A 1E0EA 4A2UA 4ZZLA 4IKFA 2OUMA 3FMQA 3FXLA 5CQEA 4QTRA 3JRDA 3CP8A 3H0DA 3BR3A 2K85A 3A01A 5LEKA 2M34A 1LVAA 2R4GA 5C4JJ 3K10A 4E7KA 4CCLA 2Y2ZA 2MGQA 3ZCOA 4C2TA 5F27A 3GTPJ 4D1QA 3L09A 5ILUA 2UXNA 5HLIA 1OMIA 2EFQA 3HG9A 3S14J 1F36A 4ENNA 2FU4A 2L7MP 4BY1J 2DJIA 3H3UA 2B9SA 3ZMSA 4D5FA 1KU2A 1BBYA 2O61A 2DXIA 3OL3A 1YQAA 4G6TB 2GOXB 2JWTA 4LLNA 5DV5A 2KRFA 3HGGA 2COBA 2LYCA 2NNNA 3NWSA 4IF4A 3TMOA 1K61A 1XGMA 1OCOH 3CCSI 2M5WA 3RI4A 1Y39A 3K4KA 1SD6A 4EMSA 3S15J 2EFOA 4PSWA 2M2EA 5DTDA 2E35A 4KIGA 1ERDA 5DM6F 3PSIA 3HRSA 3GMEA 3SEZA 2IGOA 4GCVA 4S05A 3IAM2 1ORKA 4OAZA 1D0XA 3BY6A 2FBKA 1XC5A 4EQQA 5FB2A 3ASNH 3HOSA 2V4JC 2IA2A 3HIFA 1JTXA 1JT6A 3BPVA 2IA1A 4I98B 3HSEA 4X0GA 1O3TA 2E2IJ 2BYVE 2V9VA 5C4XJ 1I3QJ 1B8IA 3NEUA 1VQ4I 2F2EA 3IKTA 2ECBA 2GOMA 3K1PA 3WTWC 4FETA 4ZYDA 4IHTA 5D6FA 2XF7A 3I9V2 3P9CA 1KU9A 3ML6A 4E7HA 4YFNF 1JHFA 3FHNA 5GAHJ 5DUIA 2H6BA 3LSIA 5F0FA 1SVLA 2KPMA 3JSOA 4MTDA 2EZHA 3HGYA 3RCOA 2OF7A 4DOZA 3S1QJ 1IDYA 1Z1DA 2NXNB 1U78A 2XKOA 1DUXC 3LOCA 5LD2C 1SAXA 3KEYA 3MMYB 2I10A 2ACJA 3GUDA 3J80Z 1JKPC 4RGSA 2VE8A 4PDKA 1RI7A 2XPWA 4MTEA 3RJPA 4CCNA 2CO5A 2JRTA 4FHTA 3GLXA 1IRZA 2MD5A 3L2QA 2EBIA 2ME6A 1DPRA 4IQJA 4Q47A 5EDNA 3ZPLA 2QQBA 2VKHA 4HQEA 3E0JB 3FIWA 2Q1ZB 2W1OA 2OQRA 3CLQA 2VQGA 1E3HA 4WXDA 2VL8A 3JRIA 3QQAA 3V7CA 4ZH4F 2AS5F 4L9TA 3K4LA 5JI6A 4ENJA 4R1HA 2BVMA 1ZN2A 3I4MJ 1XG1A 2PBIA 1REPC 3ZQFA 1VI0A 4PFOA 3GTOJ 2F6CA 4HEA2 3L2VA 3A02A 2DAOA 4CYCA 1T8IA 2Y0SA 3G2BA 5FFXA 3HPGA 4M9XA 4I7HA 1YX5A 3I59A 2QENA 2K02A 5HDKA 4E7SA 1AA7A 4LITA 2YU9J 3J7AY 3TOAA 4DJAA 2ZMEB 1W7PB 1ZAOA 1FBSA 1T33A 2K3PA 5EEHA 1HSTA 4ENKA 2XAJA 1TNSA 3D5RC 2PX9A 3K1MA 1IW7F 3ABKH 3ZR8X 4A3FJ 5E3NA 1UG0A 1RR7A 2A6HF 4BDZA 4HQMA 1MBJA 1WJEA 3BLYA 3S1NJ 4GGGA 5FKOA 3G1LA 4BH9A 1G3TA 4E7LA 2IS2A 3KP3A 4UV9A 2ZJRF 2V6CA 4ITVA 3R4KA 3BR1A 3H9GA 3WE3A 2R5ZA 4KA4A 3GTKJ 1W5SA 1T95A 1KQ9A 4WXHA 3DWLE 3Q9SA 3GTMJ 4MEYF 1RIOH 3F8NA 3ECOA 3QOPA 3T8RA 2QQ9A 4BU2A 2A69F 2LD5A 1W0UA 1T98A 4IZZA 2KDOA 2VPLA 4HF1A 3FWEA 3FMRA 3GLLA 2IJLA 5JHFA 2DT5A 2JPBA 3CCQI 3HBLA 1FC3A 1FWZA 1DQUA 3E6MA 4O3MA 5DEQA 4M6VA 3F8MA 1LNWA 3HHGA 1ZRCA 3SZGA 2XAHA 2JUGA 3IH2A 1U8RA 4HNTA 2M45A 4A3DJ 1STZA 2WAFA 1SVMA 1ZQ3P 1Y8RB 2E34A 5D4SA 3F72A 2A68F 1YTYA 1YITI 3ERMA 2O6GE 2BY0A 1W1WE 3ISPA 1X3WB 3BTIA 2ELJA 1UELB 5DD8A 1BR2A 2KZGA 4AD9A 1RPWA 3V4GA 1G59A 3F23A 4RM2A 3F8FA 2X1CA 3G73A 1Z6RA 2JA6J 3OYNA 4M9SA 3HC7A 2KJBA 1P92A 1TC3C 1RKTA 2HOAA 1A5JA 2OA4A 1XMAA 2D1HA 2MG4A 1VQKI 2WB1A 2D2WA 1FY7A 3H5NA 2O0YA 3M4OJ 2NOJB 3S2WA 3OSGA 1R5HA 1LJ9A 1QQIA 4F52A 4HNUA 3ZMUA 2Y0MA 5K5RA 2LK2A 4CICA 1ON2A 4RAGA 2GWRA 3JRFA 1VQPI 2JTVA 4HV6A 2E1MB 2HVSA 2OCCH 1QPMA 4HV5A 4DBQA 3JAMK 3SFZA 2BXYA 3COAC 2K4JA 1HBXG 2FBHA 4XSXF 2MLGA 3E5UA 4EJWA 3CUOA 2Z3YA 1X2MA 4JX4A 1R4MB 3DTKA 3P9KA 1LEBA 3SQNA 1WJFA 2LP0A 3BZCA 2M4GA 1D8KA 4AYBA 1SC7A 3G1MA 3U1DA 2CS3A 2DFEA 4CYDA 1R4NB 5IPAA 1ZR2A 3V8JA 1PUEE 3ESWB 3R6SA 2LH9A 3OYEA 2JPCA 2MH9A 3TDUC 3F3XA 2RQQA 2HQAA 3ZMVA 1LKXA 4M3BA 3R0AA 4CYCB 5TRDA 1FIAA 3FMSA 4XRSG 4BEHA 2M4KA 2IBDA 1QZZA 3BWGA 3IC7A 3L00A 3LAJA 3DBHB 3ZQCA 1IXCA 5DCMA 4XRFA 5CKTA 2WAQN 3G71I 2MYSA 3X2QH 1ZGWA 3FXRA 3ZQIA 1O3RA 5AIQA 2RAEA 3ZGKA 1OCZH 1VZ0A 3F9KA 3DBLB 1S29A 4E7JA 2HKXA 1WH5A 4UB8C 3CO7C 3RKXA 3QYEA 2R7QA 2BHYA 1OYYA 2DDAA 4Y52J 2GQQA 2JA8J 2MW8A 1RR8C 2AO9A 3WTUC 3TQNA 4YG2F 4BAYA 4BUPA 4ZDLA 4EJUA 5HLTA 3VSKA 2KISA 1LUJB 4XRMA 1IF1A 3GTJJ 3V8LA 2QVOA 2AXLA 2Z33A 3KX2A 3RIRA 1D0YA 5EEGA 4XBFA 2FEZA 2OV7A 1BA5A 4Z6YA 2R5YB 2BXZA 5M3MJ 2HDCA 2R5ZB 1GV2A 5DYMA 2NYXA 1IXSB 4MGRA 4QPQA 2VC1A 2R7XA 1MD0A 5J6XA 3AFHA 5CLSA 3PO2J 1HDPA 3FXQA 2V1XA 1FEXA 1J09A 4MQ9F 4R8HA 4L0YB 4OMYA 5BQTA 1Z91A 1WVRA 3LQRA 1UHSA 2M0MA 3FISA 2Q2EA 3B6CA 3F6OA 1MBKA 4YFKF 2L7FP 2W7NA 1XGOA 5JLWA 2NS0A 4J19A 4LB6B 3L2UA 1HSJA 2L02A 1EF4A 2KIUA 1Z21A 2HYJA 3I3LA 4HSTA 3E5QA 5LEJA 3CCRI 1ZR4A 1R5ID 3D5LA 2KMUA 1XD7A 3FXKA 5EZGA 4CZCA 2V7FA 1BI1A 3MFKA 3TGNA 1ACIA 2R3SA 2VXZA 1R1TA 1WJBA 4FE4A 3T5XA 2MABA 2XF6A 3QWLA 4OINF 4XKWA 1TQIA 4XLCA 2CV2A 3PQJA 2DN0A 3QP6A 4B09A 1IZ1A 3PNYA 3RKQA 1IJWC 1RNLA 4HYEA 4BS9A 4L0ZB 3W3CA 2YU3A 3I54A 3DP7A 1RUOA 1B72B 1JI8A 2XB0X 2EZIA 1CF7A 2VIXA 3WU0A 4LGWA 2HZTA 3DPUA 3CMMA 3MKWB 2EPFA 3F8CA 1EJ9A 2IS1A 4DQ2A 2XC7A 2IGNA 3EYYA 3GXOA 4EJOA 2EIKH 2GZWA 1UHWA 4A69C 3LA7A 4YIRX 2AHQA 2DTZA 2VN2A 1ZHFA 2K5CA 3JRHA 4IX7A 2P8TA 4A0XA 4OIQF 3CJTB 2RGVA 3RPUD 2MLKA 1YRNA 4EVIA 5K1YA 2DCEA 4DW6A 3REOA 4CH7A 1FOKA 1D5VA 2QLZA 2ISZA 4OIRF 1WFXA 1WSUA 2F48A 4JOMA 3GFLA 3LNQA 3DU5A 3ABTA 2QA4I 4GYGA 4EATA 1YJNI 4BNCA 3GFJA 2EV6A 3OIQA 2XPVA 3CUQB 2CUZA 3BJOA 2A07F 1DU0A 1OCRH 2PEXA 3S8PA 1VQ5I 4ZDOA 2HEOA 2QKLB 1K79A 4NNJA 1IN4A 2DOAA 3SDGA 4QIWN 3DTEA 2V6EA 4NDLA 4I09A 1TWCJ 1SMTA 4RLQA 1WRJA 5FKMA 4BEHB 3JRGA 2QSGX 1MIJA 3EETA 3TW6A 3GZNB 2CU7A 1OQYA 4B4CA 4D9JA 5BS6A 3BTLA 2ICWG 5J3LA 2OTLI 1MBHA 5K7ZA 1YIJI 3DKWA 5GP9A 3K7AJ 4M3DA 2TCTA 4OU0A 3ZQLA 1MGTA 1MZBA 3I64A 2EB7A 2F5FA 1D8JA 4RLFA 3O2PE 3LSJA 3BP8A 3GTGJ 4RB0A 2BZTA 1FOWA 3IWFA 3VYRB 4X6AJ 3BQZA 4HSRA 4WWCA 1Y56A 2DT7B 1DP3A 3E5XA 1SEUA 2NS8A 5D5VB 1HXDA 1C0WA 2JA7J 1ETKA 2JZYA 2DA7A 4W97A 5EJCA 3Q3SA 1TQPA 3DEUA 3LL7A 1L0OC 4IOCF 5LRSA 1RETA 1N78A 1U5TA 4XKCA 2ZJQF 1ETOA 4KYWA 4BQNA 2A5YB 2X51A 2HKOA 1TT0A 2RNGA 1CGPA 1QO0D 2CUFA 3KEQA 4LB5A 3IL2A 1P4WA 2UZKA 1Z6TA 3VYTB 3PNVA 3I4NJ 3S32A 1I3AA 2BVLA 2V26A 4PZJA 3CMYA 5ICFA 4QSHA 1J5YA 4BJTA 4KITB 3OS0A 3S1MJ 1XS9A 3J81Z 3UNGC 3LAPA 1R6RA 2BHZA 1D1CA 1TZLA 1W36C 3DKYA 5DUKA 1I39A 2BY3A 2VUMJ 3AG4H 4XM3A 1F4KA 2CFXA 3L2WA 3GX4X 2E2HJ 3MZHA 4A3BJ 3C7JA 2Y0SN 4FQGA 1D3YA 2J5PA 3M8EA 3BDDA 4HX7A 4ZZDA 3HJEA 3WE2A 2ELHA 2FXAA 4OWRB 4DZPA 3H0GJ 3WTZA 3LSRA 4G6QA 3MKYB 3ZQGA 2JUCA 4Y15A 1YS6A 5A2QK 3TP0A 1XMXA 2EILH 2FNPA 5D5WB 1AU7A 2M30A 2JSPA 2JN6A 5DCFA 4BE2A 1IRXA 3M1EA 3HTSB 1TT5B 2FF4A 3C3WA 5K7HA 4UUSA 4BBSJ 1S7AA 4XN0A 3OYCA 1CF7B 2BEOA 3AG3H 1A31A 3HOYJ 1UCRA 3PM1A 5J40A 3HOWJ 4HG2A 2LY1A 4PCQA 1GT0C 3ZXSA 4DBRA 4XK4A 2QWWA 4KJZA 2OAZA 1ETVA 1APLC 1ZARA 3S1RJ 1OISA 2ZO4A 1HW2A 1S7OA 3P9IA 2NVUB 4BHBA 3S3NA 3CTAA 5LFAA 5J4YA 2PQ8A 1QBJA 4M73A 4G7ZF 5IP6A 4G9YA 2BW3A 2ZNZA 2L4AA 1XB4A 1EA3A 2ZNYA 1IG7A 1LE8B 1YHQI 3KYDB 1Y1WJ 4YIFA 1K4SA 1W7PD 4HLXA 1JXSA 1SAUA 2ZXIA 3HKZA 1YRNB 1GVDA 4FISA 3GYHX 2EZLA 1N77A 4LLGF 2JA5J 3R61A 2X1DA 4ESJA 3MWMA 1N75A 1SFUA 1LDJA 2O5RA 4KNYA 4HW0A 2H6CA 2K9NA 2XHKA 4RM3A 3JR9A 2GM4A 3KP5A 1GXPA 5GTIC 2WAEA 4Q5SF 3E7LA 2K4BA 2F4OB 3KEOA 1I6HJ 2DA1A 3HYIA 1ETXA 3WU2C 1OCCH 3ZMZA 1FYMA 3CDHA 4FT8A 2KHMA 3ASOH 4PJ0C 1GVJA 1U6GA 1IV8A 3GBGA 1YFHA 3DF8A 5JR3A 1DP7P 4A5NA 1FSEA 2ZJ2A 2VBXA 1JE8A 4IHWA 4HRIA 1ZG1A 3TP3A 2OZUA 3OOPA 4M9ZA 4MLOA 4A0ZA 1QVTA 2RDPA 3MZ8A 2QBYA 2HGCA 2VQLA 3HB9A 4G94A 5CJ9A 4UV8A 4Y7NJ 1B1BA 2XGDA 2HWVA 3GVAA 2WB1N 4A3EJ 2FQ3A 3DCFA 1AKHA 2O3FA 1UZCA 2IEKA 1UAAA 3A4CA 4XQFA 1VQNI 5ILSA 3CQZJ 4N0BA 4RS8A 5CVJA 3FF5A 2M1BA 3GTLJ 3GF2A 1QHGA 2CQQA 1D5YA 4L5IA 1MMGA 3W2VA 1U5TB
chains in the Genus database with same CATH topology
3NAUA 4IHVA 1H8AC 2DA4A 3BTIA 4RDUA 1HOMA 4JYKA 1BW6A 1RPWA 2DA2A 4A3KJ 3LSGA 1K83J 1BL0A 3MKLA 2HOTA 2JA6J 2DMPA 1ITYA 1X2NA 1TC3C 1ETYA 4AYBN 1RKTA 2DA6A 2HOAA 2LKXA 5GPAA 4GFBA 1F43A 1A5JA 4A3MJ 1U9NA 3G1OA 4JP0A 2KT0A 3SJMA 5EGOB 2DA3A 2MG4A 5BNGA 4B1RA 1WH7A 2X48A 1WI3A 2XSDC 3M4OJ 2EQRA 3JRBA 3OSGA 1ZTRA 5FKNA 4A93J 2LK2A 3JRFA 1X58A 5IOZA 3QPLA 1TWHJ 2HXIA 1WGXA 3BT9A 2M0CA 1W0TA 5GPCA 3CCYA 1O4XA 4DYQA 2N8GA 2LVSA 1WPKA 1JUPA 1ZKGA 4BY7J 2K9SA 1X2MA 1U8BA 1IGNA 4LOCA 3HOUJ 5IYCJ 2K9QA 5IYDJ 1ZK8A 4D7MA 5JLXA 2ID6A 4JX4A 3S16J 1IC8A 2LP0A 4HNVA 3H3VK 3IV5A 2O9LA 2LLKA 4RBOA 1S7EA 3G1MA 1MSEC 2FQ4A 5IPAA 1ZR2A 2NVXJ 1T56A 1FIPA 1JKOC 1LE8A 2O7OA 3BG9A 2NVYJ 4W1UA 1IV6A 2TRTA 4AUXA 3BG5A 1UG2A 1RESA 4M3GA 3VPRA 1BJZA 2ZB9A 2EZKA 5FJ8J 4M3BA 4CYCB 3MN2A 1FIAA 4XRSG 4IHXA 2IBDA 1HLVA 3CDLA 3ZQCA 1MBEA 1Z0XA 1BW5A 3JRAA 2WAQN 1FTZA 3A01B 2XRLA 4A3CJ 1JUMA 1ZGWA 3ZQIA 1AHDP 2RAEA 3Q0WA 3RQIA 1OCTC 2HDDA 5EEAA 1JT0A 3Q0VA 1IUFA 2CUEA 5IOYA 1WH5A 3BR0A 1RKWA 1VNDA 2LR8A 4X1EA 4Y52J 4M3FA 5F0HA 3ZOBA 2IAIA 2JA8J 2JJ7A 2MW8A 2LFBA 2R0QC 1NK2P 2GLOA 2AO9A 2CRGA 1CQTA 1FTTA 4XRMA 2M9HA 3GTJJ 2VKEA 2JK3A 2FJ1A 2B63J 2CJJA 2DMTA 4A3IJ 1BA5A 2NOGA 1H88C 2HXOA 2E2JJ 4A3GJ 2R5YB 5M3MJ 1POGA 2R5ZB 1GV2A 1FJLA 1P7IA 5IP7J 2R7ZJ 2EH3A 3PO2J 1HDPA 1MBFA 1OCPA 2DA5A 3L1PA 3PO3J 1FEXA 4ABZA 1U9OA 1UHSA 5F08A 2R92J 3FISA 3GTQJ 2ME0A 3B6CA 2H8RA 1MBKA 2L7FP 5JLWA 1SANA 3F0CA 4C3JJ 3W6VA 4J19A 1AKHB 5M5YJ 5M3FJ 1EF4A 2HYJA 3MVPA 1ZR4A 1B8IB 2O8KA 5EZGA 3BTCA 4JX6A 4I76A 3O8GA 9ANTA 2MSYA 3OIOA 2Y31A 2HOSA 2NVTJ 2M8GX 2HQ5A 4FE4A 5J1UA 2LTPA 1E3OC 5EGOA 1ETQA 3HOVJ 4A3LJ 1OJLA 1PUFB 2DN0A 5E3OA 3RKQA 1JJ6C 2DMNA 1GDTA 1ETWA 1IJWC 1JUSA 5E3MA 3HOXJ 2X6OA 3JREA 4JX5A 4V2FA 2X9DA 3TW7A 2KDZA 3HOZJ 1MSFC 1B72B 2NVQJ 2XB0X 2EZIA 4XIDA 2DJNA 1MH3A 2W48A 1QVUA 2K40A 5EF6A 3BQYA 1VF9A 2PMZN 5E3LA 2XB5A 4A69C 3SFIA 4UUSB 2AHQA 4BKXA 2DTZA 1JTYA 1Q1VA 3JRHA 1TWFJ 1MH4A 3NARA 2XGEA 5K7FA 5EG0A 1ENHA 4UUTA 1YRNA 1MNMC 3IH3A 5FLVA 4DW6A 4AC0A 2CQXA 4D5CA 4DZJA 5FKKA 3LNQA 3BTJA 2R93J 1JJ8C 3HEFA 4QTRA 1I50J 3JRDA 3RZDJ 3HM5A 4XICA 2XPVA 3BR3A 4C3IJ 1DU0A 3A01A 2M34A 1MBGA 1OFCX 4IEJA 5C4JJ 3TEDA 2DMQA 2L0KA 3DEWA 3SDGA 4QIWN 4NDLA 2Y2ZA 2MGQA 5J1YA 1TWCJ 5FKMA 3JRGA 5F27A 3TW6A 3GTPJ 3BG3A 5C44J 2CU7A 2NS7A 1JKQC 3S14J 1F36A 4B4CA 2L7MP 5IP9J 4BY1J 3S2HJ 3BTLA 1HCRA 4D5FA 5J3LA 3D1NI 1SFOJ 1MBHA 5K7ZA 5GP9A 3K7AJ 2JWTA 1DU6A 4M3DA 2E19A 2TCTA 2YS9A 3HGGA 2LY9A 1UMQA 2COBA 3ZQLA 1HF0A 1K61A 3LSJA 2H1KA 3GTGJ 4X6AJ 3BQZA 2Y30A 5F1JA 2R5YA 3S2DJ 2NS8A 2OPTA 4M3EA 4MFDA 3S15J 2JA7J 3QPSA 2M2EA 5DTDA 1ETKA 4W97A 2DA7A 3Q3SA 1TWAJ 4MIMA 1LFBA 1RETA 4B3AA 5M5XJ 1ORKA 1ETOA 3LSPA 1XC5A 2WV1A 3M3YJ 5F0CA 1JTXA 2CUFA 1JT6A 3C2BA 3OSFA 2E2IJ 3I4NJ 2L7ZA 5C4XJ 1I3QJ 1B8IA 2GBYA 3CMYA 5EZHA 3WHCA 2P81A 5IYBJ 4QSHA 2ECBA 2QF7A 3FKIJ 3BR6A 5FLMJ 4C2MJ 1NTCA 3S1MJ 1XS9A 2D5VA 5F0FA 2YUSA 1WCMJ 4S0HB 4DYRA 1PUFA 2EZHA 3HGYA 2OF7A 3S1QJ 3Q0UA 1IDYA 2VUMJ 1A6IA 1U78A 2E2HJ 1GV5A 4A3BJ 4DYCA 2Y0SN 3LOCA 2XPUA 4I6ZA 1B72A 2DMUA 2I10A 3UKGA 2FD5A 1JKPC 2XPWA 4DZPA 2E1OA 3H0GJ 3LSRA 1IRZA 3HKZN 3ZQGA 3RZOJ 1P7JA 2EBIA 3TP0A 2ME6A 1AU7A 2G0EA 2FX0A 2JN6A 5EDNA 2HI3A 5K7HA 4UUSA 4BBSJ 3FIWA 4FE7A 3HOYJ 3PM1A 3HOWJ 2Y9YA 3JRIA 3QQAA 1GT0C 4XK4A 4A3JJ 1ETVA 3I4MJ 1XG1A 1JGGA 1APLC 3BR5A 3S1RJ 3ZQFA 1Y1VJ 3BR2A 1JKRC 1VI0A 3GTOJ 1LFUP 2ECCA 1NK3P 3A02A 4CYCA 2VI6A 4BBRJ 5IP6A 1G2HA 1IG7A 3IH4A 5M5WJ 1LE8B 2YU9J 3HDDA 1Y1WJ 2Y9ZA 2JMWA 1IDZA 1H89C 5EG0B 4C3HJ 1YRNB 4FTHA 1GVDA 4FISA 1T33A 2EZLA 1VFCA 1TWGJ 3A03A 2JA5J 5EYRA 3OOUA 5FKLA 3S17J 3K2AA 4A3FJ 4V2GA 5E3NA 2ID3A 1GUUA 1RR7A 1QRYA 2K9NA 3JR9A 4G12A 4MO7A 2GM4A 5HODA 2L9RA 4L5EA 5C3EJ 1QPIA 1MBJA 4XRSA 3E7LA 3S1NJ 5FKOA 2VPRA 3G1LA 3O8HA 1I6HJ 2DA1A 1ETXA 3BR1A 3GBGA 3ZQHA 4D7NA 1Z77A 5J1RA 2R5ZA 3GTKJ 4IHWA 3GTMJ 3TP3A 4FCYA 4MLOA 2ELKA 1QVTA 2VKVA 4BXXJ 3HB9A 4Y7NJ 3WHBA 4EEFG 3JRCA 2LD5A 1W0UA 2XGDA 1HDDC 1R9TJ 2WB1N 4A3EJ 3FK7A 3B6AA 3DCFA 1AKHA 2IEKA 3HBLA 4IHYA 3CQZJ 2XGCA 5F04A 3FK6A 4M6VA 5DS9A 3GTLJ 3IH2A 2CQQA 1D5YA 4A3DJ 4MFEA 1ZQ3P 2QCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NAU A;  4IHV A;  1H8A C;  2DA4 A;  3BTI A;  4RDU A;  1HOM A;  4JYK A;  1BW6 A;  1RPW A;  2DA2 A;  4A3K J;  3LSG A;  1K83 J;  1BL0 A;  3MKL A;  2HOT A;  2JA6 J;  2DMP A;  1ITY A;  1X2N A;  1TC3 C;  1ETY A;  4AYB N;  1RKT A;  2DA6 A;  2HOA A;  2LKX A;  5GPA A;  4GFB A;  1F43 A;  1A5J A;  4A3M J;  1U9N A;  3G1O A;  4JP0 A;  2KT0 A;  3SJM A;  5EGO B;  2DA3 A;  2MG4 A;  5BNG A;  4B1R A;  1WH7 A;  2X48 A;  1WI3 A;  2XSD C;  3M4O J;  2EQR A;  3JRB A;  3OSG A;  1ZTR A;  5FKN A;  4A93 J;  2LK2 A;  3JRF A;  1X58 A;  5IOZ A;  3QPL A;  1TWH J;  2HXI A;  1WGX A;  3BT9 A;  2M0C A;  1W0T A;  5GPC A;  3CCY A;  1O4X A;  4DYQ A;  2N8G A;  2LVS A;  1WPK A;  1JUP A;  1ZKG A;  4BY7 J;  2K9S A;  1X2M A;  1U8B A;  1IGN A;  4LOC A;  3HOU J;  5IYC J;  2K9Q A;  5IYD J;  1ZK8 A;  4D7M A;  5JLX A;  2ID6 A;  4JX4 A;  3S16 J;  1IC8 A;  2LP0 A;  4HNV A;  3H3V K;  3IV5 A;  2O9L A;  2LLK A;  4RBO A;  1S7E A;  3G1M A;  1MSE C;  2FQ4 A;  5IPA A;  1ZR2 A;  2NVX J;  1T56 A;  1FIP A;  1JKO C;  1LE8 A;  2O7O A;  3BG9 A;  2NVY J;  4W1U A;  1IV6 A;  2TRT A;  4AUX A;  3BG5 A;  1UG2 A;  1RES A;  4M3G A;  3VPR A;  1BJZ A;  2ZB9 A;  2EZK A;  5FJ8 J;  4M3B A;  4CYC B;  3MN2 A;  1FIA A;  4XRS G;  4IHX A;  2IBD A;  1HLV A;  3CDL A;  3ZQC A;  1MBE A;  1Z0X A;  1BW5 A;  3JRA A;  2WAQ N;  1FTZ A;  3A01 B;  2XRL A;  4A3C J;  1JUM A;  1ZGW A;  3ZQI A;  1AHD P;  2RAE A;  3Q0W A;  3RQI A;  1OCT C;  2HDD A;  5EEA A;  1JT0 A;  3Q0V A;  1IUF A;  2CUE A;  5IOY A;  1WH5 A;  3BR0 A;  1RKW A;  1VND A;  2LR8 A;  4X1E A;  4Y52 J;  4M3F A;  5F0H A;  3ZOB A;  2IAI A;  2JA8 J;  2JJ7 A;  2MW8 A;  2LFB A;  2R0Q C;  1NK2 P;  2GLO A;  2AO9 A;  2CRG A;  1CQT A;  1FTT A;  4XRM A;  2M9H A;  3GTJ J;  2VKE A;  2JK3 A;  2FJ1 A;  2B63 J;  2CJJ A;  2DMT A;  4A3I J;  1BA5 A;  2NOG A;  1H88 C;  2HXO A;  2E2J J;  4A3G J;  2R5Y B;  5M3M J;  1POG A;  2R5Z B;  1GV2 A;  1FJL A;  1P7I A;  5IP7 J;  2R7Z J;  2EH3 A;  3PO2 J;  1HDP A;  1MBF A;  1OCP A;  2DA5 A;  3L1P A;  3PO3 J;  1FEX A;  4ABZ A;  1U9O A;  1UHS A;  5F08 A;  2R92 J;  3FIS A;  3GTQ J;  2ME0 A;  3B6C A;  2H8R A;  1MBK A;  2L7F P;  5JLW A;  1SAN A;  3F0C A;  4C3J J;  3W6V A;  4J19 A;  1AKH B;  5M5Y J;  5M3F J;  1EF4 A;  2HYJ A;  3MVP A;  1ZR4 A;  1B8I B;  2O8K A;  5EZG A;  3BTC A;  4JX6 A;  4I76 A;  3O8G A;  9ANT A;  2MSY A;  3OIO A;  2Y31 A;  2HOS A;  2NVT J;  2M8G X;  2HQ5 A;  4FE4 A;  5J1U A;  2LTP A;  1E3O C;  5EGO A;  1ETQ A;  3HOV J;  4A3L J;  1OJL A;  1PUF B;  2DN0 A;  5E3O A;  3RKQ A;  1JJ6 C;  2DMN A;  1GDT A;  1ETW A;  1IJW C;  1JUS A;  5E3M A;  3HOX J;  2X6O A;  3JRE A;  4JX5 A;  4V2F A;  2X9D A;  3TW7 A;  2KDZ A;  3HOZ J;  1MSF C;  1B72 B;  2NVQ J;  2XB0 X;  2EZI A;  4XID A;  2DJN A;  1MH3 A;  2W48 A;  1QVU A;  2K40 A;  5EF6 A;  3BQY A;  1VF9 A;  2PMZ N;  5E3L A;  2XB5 A;  4A69 C;  3SFI A;  4UUS B;  2AHQ A;  4BKX A;  2DTZ A;  1JTY A;  1Q1V A;  3JRH A;  1TWF J;  1MH4 A;  3NAR A;  2XGE A;  5K7F A;  5EG0 A;  1ENH A;  4UUT A;  1YRN A;  1MNM C;  3IH3 A;  5FLV A;  4DW6 A;  4AC0 A;  2CQX A;  4D5C A;  4DZJ A;  5FKK A;  3LNQ A;  3BTJ A;  2R93 J;  1JJ8 C;  3HEF A;  4QTR A;  1I50 J;  3JRD A;  3RZD J;  3HM5 A;  4XIC A;  2XPV A;  3BR3 A;  4C3I J;  1DU0 A;  3A01 A;  2M34 A;  1MBG A;  1OFC X;  4IEJ A;  5C4J J;  3TED A;  2DMQ A;  2L0K A;  3DEW A;  3SDG A;  4QIW N;  4NDL A;  2Y2Z A;  2MGQ A;  5J1Y A;  1TWC J;  5FKM A;  3JRG A;  5F27 A;  3TW6 A;  3GTP J;  3BG3 A;  5C44 J;  2CU7 A;  2NS7 A;  1JKQ C;  3S14 J;  1F36 A;  4B4C A;  2L7M P;  5IP9 J;  4BY1 J;  3S2H J;  3BTL A;  1HCR A;  4D5F A;  5J3L A;  3D1N I;  1SFO J;  1MBH A;  5K7Z A;  5GP9 A;  3K7A J;  2JWT A;  1DU6 A;  4M3D A;  2E19 A;  2TCT A;  2YS9 A;  3HGG A;  2LY9 A;  1UMQ A;  2COB A;  3ZQL A;  1HF0 A;  1K61 A;  3LSJ A;  2H1K A;  3GTG J;  4X6A J;  3BQZ A;  2Y30 A;  5F1J A;  2R5Y A;  3S2D J;  2NS8 A;  2OPT A;  4M3E A;  4MFD A;  3S15 J;  2JA7 J;  3QPS A;  2M2E A;  5DTD A;  1ETK A;  4W97 A;  2DA7 A;  3Q3S A;  1TWA J;  4MIM A;  1LFB A;  1RET A;  4B3A A;  5M5X J;  1ORK A;  1ETO A;  3LSP A;  1XC5 A;  2WV1 A;  3M3Y J;  5F0C A;  1JTX A;  2CUF A;  1JT6 A;  3C2B A;  3OSF A;  2E2I J;  3I4N J;  2L7Z A;  5C4X J;  1I3Q J;  1B8I A;  2GBY A;  3CMY A;  5EZH A;  3WHC A;  2P81 A;  5IYB J;  4QSH A;  2ECB A;  2QF7 A;  3FKI J;  3BR6 A;  5FLM J;  4C2M J;  1NTC A;  3S1M J;  1XS9 A;  2D5V A;  5F0F A;  2YUS A;  1WCM J;  4S0H B;  4DYR A;  1PUF A;  2EZH A;  3HGY A;  2OF7 A;  3S1Q J;  3Q0U A;  1IDY A;  2VUM J;  1A6I A;  1U78 A;  2E2H J;  1GV5 A;  4A3B J;  4DYC A;  2Y0S N;  3LOC A;  2XPU A;  4I6Z A;  1B72 A;  2DMU A;  2I10 A;  3UKG A;  2FD5 A;  1JKP C;  2XPW A;  4DZP A;  2E1O A;  3H0G J;  3LSR A;  1IRZ A;  3HKZ N;  3ZQG A;  3RZO J;  1P7J A;  2EBI A;  3TP0 A;  2ME6 A;  1AU7 A;  2G0E A;  2FX0 A;  2JN6 A;  5EDN A;  2HI3 A;  5K7H A;  4UUS A;  4BBS J;  3FIW A;  4FE7 A;  3HOY J;  3PM1 A;  3HOW J;  2Y9Y A;  3JRI A;  3QQA A;  1GT0 C;  4XK4 A;  4A3J J;  1ETV A;  3I4M J;  1XG1 A;  1JGG A;  1APL C;  3BR5 A;  3S1R J;  3ZQF A;  1Y1V J;  3BR2 A;  1JKR C;  1VI0 A;  3GTO J;  1LFU P;  2ECC A;  1NK3 P;  3A02 A;  4CYC A;  2VI6 A;  4BBR J;  5IP6 A;  1G2H A;  1IG7 A;  3IH4 A;  5M5W J;  1LE8 B;  2YU9 J;  3HDD A;  1Y1W J;  2Y9Z A;  2JMW A;  1IDZ A;  1H89 C;  5EG0 B;  4C3H J;  1YRN B;  4FTH A;  1GVD A;  4FIS A;  1T33 A;  2EZL A;  1VFC A;  1TWG J;  3A03 A;  2JA5 J;  5EYR A;  3OOU A;  5FKL A;  3S17 J;  3K2A A;  4A3F J;  4V2G A;  5E3N A;  2ID3 A;  1GUU A;  1RR7 A;  1QRY A;  2K9N A;  3JR9 A;  4G12 A;  4MO7 A;  2GM4 A;  5HOD A;  2L9R A;  4L5E A;  5C3E J;  1QPI A;  1MBJ A;  4XRS A;  3E7L A;  3S1N J;  5FKO A;  2VPR A;  3G1L A;  3O8H A;  1I6H J;  2DA1 A;  1ETX A;  3BR1 A;  3GBG A;  3ZQH A;  4D7N A;  1Z77 A;  5J1R A;  2R5Z A;  3GTK J;  4IHW A;  3GTM J;  3TP3 A;  4FCY A;  4MLO A;  2ELK A;  1QVT A;  2VKV A;  4BXX J;  3HB9 A;  4Y7N J;  3WHB A;  4EEF G;  3JRC A;  2LD5 A;  1W0U A;  2XGD A;  1HDD C;  1R9T J;  2WB1 N;  4A3E J;  3FK7 A;  3B6A A;  3DCF A;  1AKH A;  2IEK A;  3HBL A;  4IHY A;  3CQZ J;  2XGC A;  5F04 A;  3FK6 A;  4M6V A;  5DS9 A;  3GTL J;  3IH2 A;  2CQQ A;  1D5Y A;  4A3D J;  4MFE A;  1ZQ3 P;  2QCO A; 
#chains in the Genus database with same CATH topology
 2E1N A;  3NAU A;  2ESN A;  2LF7 A;  1SFE A;  2L54 A;  3BG7 A;  3CP2 A;  4NBQ A;  2ISY A;  4JYK A;  3Q9V A;  3EUK L;  4GO1 A;  4L9J A;  4EV0 A;  4C2U A;  4B44 A;  5TIS C;  4F55 A;  3HUG A;  1RRJ A;  1T2K A;  1K83 J;  3NRV A;  1V5G A;  3MZY A;  3WTS C;  1QHH D;  2P6S A;  5B1B H;  1VQ8 I;  2RN7 A;  1MJ9 A;  3JAM Z;  4P96 A;  3CC2 I;  1ITY A;  3M8F A;  1Z67 A;  2A61 A;  4AYB N;  4GFB A;  1R58 A;  1FBU A;  3H36 A;  1RC9 A;  5E79 C;  3T0Y A;  3VEP A;  3G1O A;  3HSR A;  4UVB A;  2VC0 A;  2CQ7 A;  5FRO A;  2STW A;  4A0Y A;  2OC6 A;  4CSW A;  4G7H F;  2EQR A;  1DDN A;  1J2X A;  1J75 A;  3M8J A;  1WZ2 A;  4A93 J;  4Q4Z F;  4KDP A;  2DPU A;  2LMD A;  2OZ6 A;  1J59 A;  1FX7 A;  3V7R A;  2VBW A;  3F21 A;  4PJL A;  3HXL A;  2HXI A;  5E18 F;  4P9U A;  1WGX A;  3BT9 A;  2FOK A;  4UHT A;  1B59 A;  2EIJ H;  2YSR A;  4DYQ A;  2N8G A;  4A6E A;  5IT9 Z;  3FM3 A;  3CCU I;  1XGS A;  3S3O A;  1FPQ A;  4XMY A;  1U5T C;  1IGN A;  3K70 D;  2K9Q A;  1G3W A;  3GFM A;  1BC7 C;  1P4A A;  2BY1 A;  1S5L C;  4KN7 X;  4BQO A;  3CCM I;  2W82 A;  4Y17 A;  1P9Q C;  2O8X A;  3IV5 A;  3ABM H;  4UY8 I;  1AOY A;  2BOL A;  3AG1 H;  3C2H A;  1S7E A;  4UVC A;  2OD5 A;  3DPT A;  4RGR A;  1YW7 A;  2NVX J;  1FIP A;  2DFH A;  3OYD A;  2QSH X;  1Y6I A;  4W1U A;  2HQN A;  3KYL A;  3BG5 A;  1UG2 A;  2CW8 A;  4M3G A;  4XN3 A;  4HLY A;  4LG0 B;  5FLX K;  3I56 I;  4L9N A;  2EZK A;  3ERE D;  1B6A A;  2WTE A;  3HRU A;  3ZN1 A;  3GZ5 A;  3HPH A;  4RAY A;  3E97 A;  2LY2 A;  1HLV A;  2HOE A;  3L9F A;  4GRI A;  2PLY A;  2LF8 A;  3CDL A;  2F5D A;  3OWT A;  4HF0 A;  1MBE A;  1Z0X A;  2R7D A;  1MMD A;  2K27 A;  4LK0 F;  3J7Z I;  1FTZ A;  3A01 B;  2XRL A;  4Y13 A;  1AWC A;  4GXO A;  2KIF A;  2JRM A;  1OCT C;  4YEJ A;  5DDG A;  1JT0 A;  3PUB A;  4PJJ A;  3U1K A;  4F91 B;  4HAM A;  3P7N A;  3VOE A;  2CUE A;  5IOY A;  2CW7 A;  2DFI A;  2V1U A;  2K86 A;  3H5A A;  1VND A;  1LFP A;  2CSO A;  2J5O A;  3GWZ A;  4X1E A;  4M3F A;  3PSF A;  3ZOB A;  5F0H A;  2JJ7 A;  2HQR A;  3R0J A;  1R1U A;  2KIM A;  5K5O A;  1NK2 P;  2GLO A;  5IY5 H;  1XTA A;  4I02 A;  2CRG A;  1CQT A;  2CV0 A;  2CUJ A;  3QOD A;  2IW5 A;  5JVG F;  2P5L C;  1OYI A;  2M9H A;  5BPI A;  2GA1 A;  2VKE A;  2FJ1 A;  2CJJ A;  5LLQ A;  5LGN A;  4A3I J;  2KKO A;  2JA2 A;  1H88 C;  4MNU A;  2E5Z A;  4A3G J;  1X19 A;  1POG A;  1FJL A;  1J9I A;  1PVE A;  2H94 A;  1MDM A;  2HR3 A;  2EH3 A;  3LFU A;  3G3Z A;  1MKM A;  3L1P A;  1XCB A;  2Z2S B;  4IHS A;  1FMW A;  4G6D A;  3GFI A;  1TTY A;  1IN8 A;  1IXR C;  2LC2 A;  4NUB A;  1SD4 A;  2CGP A;  3CJQ B;  2Y75 A;  4CZZ A;  3HRM A;  4F93 B;  3AL0 B;  3FKJ A;  1K4T A;  1AKH B;  2A3S A;  2MC4 A;  2VJ5 A;  5CVV A;  3DXJ F;  2PJR A;  5AON A;  3K2Z A;  4O5V A;  1B8I B;  3CF5 F;  2O8K A;  2DTR A;  3ZP5 A;  4JX6 A;  3CC7 I;  5CVR A;  2XGX A;  4ZYE A;  2MSY A;  4UXN A;  3OIO A;  2HOS A;  3SEQ A;  2HQ5 A;  6PAX A;  2IXS A;  4HX8 A;  1TBX A;  2LTP A;  5E17 F;  4N9I A;  4CO8 A;  3KP2 A;  1ETQ A;  4I0B A;  4CA0 A;  4QLC U;  5H6R A;  3I0T A;  5EGO A;  1WI9 A;  1BIB A;  1JJ6 C;  1KA8 A;  3HUG B;  1GDT A;  4XLN F;  1JUS A;  1Y8Q B;  2ESH A;  2DOE A;  1KQ0 A;  3F8B A;  3H9Q A;  1T0F A;  2X9D A;  3J7A O;  1SD5 A;  2KDZ A;  1ZH5 A;  2QKM B;  2F4I A;  2R7F A;  2DO7 A;  2NVQ J;  3LSM A;  3VB2 A;  1G6N A;  2DPD A;  2WBM A;  3TO9 A;  4NQW A;  1SFK A;  1GLN A;  1MH3 A;  2OTJ I;  1QVU A;  2V1D A;  3BG6 A;  2K40 A;  3WG7 H;  2L9V A;  1ODD A;  1SMY F;  3BQY A;  3PIP F;  2KP6 A;  3W2A A;  2W25 A;  1DPU A;  1IRG A;  2LRD A;  2M3A A;  1U3E M;  3QPH A;  3HHH A;  3EPZ A;  3AL0 C;  2JQ7 A;  5ERI A;  1H0M A;  2L3D A;  3OL4 A;  4YII A;  1F1Z A;  3NAR A;  1WKM A;  2Z5U A;  2YPR A;  3TO7 A;  5HVQ C;  5K7F A;  5F6F A;  2JVH A;  4IJA A;  5EG0 A;  3J80 K;  1RZ4 A;  2ZSI B;  4M6Y A;  2X85 A;  3IH3 A;  3IKV A;  4AC0 A;  4XR6 A;  5GAD J;  4D5C A;  2QQA A;  3T1B A;  2R7W A;  4YFX F;  3VFZ A;  2DYS H;  4DZJ A;  5KAF C;  3I59 B;  5FKK A;  1WJD A;  2BBY A;  2F5C A;  2LG4 A;  3MD2 A;  2R93 J;  3VWB A;  3QRF F;  4G8X A;  2FMY A;  3FXM A;  3BCA A;  3HEF A;  5JHU A;  1I50 J;  3RZD J;  3HM5 A;  4XIC A;  2STT A;  1P4X A;  2FML A;  3L7W A;  4PFP A;  3TDZ C;  4C3I J;  4GYI A;  4RAZ A;  4ZJZ A;  2VKD A;  3TED A;  2VON A;  1FMV A;  2DMQ A;  4KIS A;  3DEW A;  5J1Y A;  2VE9 A;  2IT0 A;  3ABU A;  3SDB A;  3LSH A;  2VJI A;  4LJZ F;  3QOE A;  3G6E I;  1KU7 A;  5KCM A;  2GA2 A;  3U2R A;  5C44 J;  4CGZ A;  2GXG A;  1XPX A;  2WAD A;  5IP9 J;  3S2H J;  2ZJP F;  1HCR A;  1SFO J;  4XKB A;  3LSK A;  1ZG3 A;  3PNT A;  1V54 H;  4KMU X;  4XNF A;  4NHJ A;  1I1G A;  2QZ8 A;  2LY9 A;  1UMQ A;  1XMK A;  2HVQ A;  3LWF A;  4IL6 C;  4JQF A;  3M9A A;  4AIH A;  3Q5F A;  1HF0 A;  2AQE A;  4RGX A;  1YG2 A;  2E5N A;  2VOD A;  1HA8 A;  1O7L A;  5CVU A;  3S2D J;  1UJ8 A;  1Y0U A;  4HBL A;  1USS A;  2OPT A;  1B9M A;  3F22 A;  1BJA A;  4M3E A;  3K4B A;  1YX3 A;  2CH0 A;  1NHA A;  1FLI A;  1TWA J;  2JSC A;  4MIM A;  1LFB A;  2GAU A;  5M5X J;  5J4V A;  3EYI A;  1KGS A;  4ZTJ A;  2XF5 A;  1J7K A;  2VQH A;  2WV1 A;  3H3Z A;  5F0C A;  1NG6 A;  1K6Y A;  2DLL A;  2HTS A;  5IT3 A;  5FD5 A;  3C2B A;  4HZF A;  5CPR B;  2L7Z A;  4FX0 A;  4PSX A;  1LVK A;  1S8N A;  4Y3O A;  5EZH A;  5IYB J;  2P81 A;  5H6Q A;  2XAS A;  1K78 A;  2QF7 A;  3BR6 A;  2V9P A;  4C2M J;  1Q1H A;  1NTC A;  2ZFW A;  2FBI A;  5A2Q Z;  4XSZ F;  2EA2 A;  3PFI A;  3DU6 A;  2CFO A;  4DYR A;  1PUF A;  4WXC A;  5ICC A;  3Q0U A;  3KET A;  3OYB A;  3H92 A;  4JK1 X;  1GV5 A;  4DYC A;  3DKX A;  2CQN A;  4PJN A;  2QSF X;  2G9W A;  2HPI A;  1IN7 A;  3UKG A;  2FD5 A;  3UR3 C;  2FOW A;  5E1Z B;  3N97 A;  2E1O A;  5KNL A;  3E6D A;  1YS7 A;  4BJ6 C;  3HKZ N;  4EM2 A;  3RZO J;  1P7J A;  4RA2 A;  3SZP A;  3PQK A;  4PUS A;  2IS6 A;  2G0E A;  3KP4 A;  2XAF A;  5CYV A;  2FX0 A;  2VT3 A;  3E1S A;  5F1R A;  1D1A A;  2ZBK A;  2GIV A;  1BI0 A;  1A35 A;  1S6L A;  4BHC A;  1FOY A;  4FE7 A;  3V7S A;  3FBI B;  1J0R A;  1X4P A;  4N9H A;  4C30 A;  3HZJ A;  1JGG A;  3CF2 A;  4AVP A;  1Y1V J;  4CCM A;  3HSF A;  3RPU A;  2XSJ C;  4GDF A;  4DGW B;  4KT6 A;  2HU9 A;  1FT9 A;  3PL8 A;  5E20 A;  4BBR J;  5LRR A;  5ICG A;  3KZZ A;  1EH8 A;  4ASN A;  3FM5 A;  3TKY A;  3CME I;  4RAF A;  2MBF A;  1G2H A;  1D1B A;  3IH4 A;  5M5W J;  4OMZ A;  4B43 A;  2P5K A;  2JMW A;  3V8K A;  1IDZ A;  1LDD A;  2R7T A;  2HTJ A;  5L3G A;  5EG0 B;  4C3H J;  4A12 A;  1H89 C;  4FTH A;  5L3D A;  3BPX A;  3ZQQ A;  1NH3 A;  4LLL A;  1VFC A;  4NC6 A;  2Q8K A;  1YLF A;  4WX9 A;  3HOT A;  1R5G A;  5EYR A;  5FKL A;  2X6Y A;  3S17 J;  1IN6 A;  2XVC A;  3E3V A;  3K2A A;  3R60 A;  4YEL A;  5DCM B;  1T0F C;  3GCM A;  3BZK A;  2LKP A;  2CV1 A;  2L9R A;  4L5E A;  4KT5 C;  2JVG A;  2W24 A;  4XRS A;  2ZKZ A;  4M72 A;  3OYM A;  2VPR A;  3I71 A;  4EJT A;  2XKP A;  3O8H A;  3S93 A;  4U0Y A;  3JW4 A;  3C18 A;  2M7B A;  4AIJ A;  1BOA A;  3WOD F;  3K4M A;  4B47 A;  1VQL I;  3W6J B;  5ILV A;  3C1D A;  2ZXW H;  3ZQH A;  4EGZ A;  1Z77 A;  5J1R A;  4Y4R A;  1MJA A;  1MND A;  4P5O A;  4EM1 A;  4FCY A;  1Z7U A;  3LST A;  2CWE A;  5JFR A;  2VKV A;  3QYF A;  2R7S A;  3GO5 A;  3TL4 X;  4N4O B;  2KIQ A;  3WHB A;  3JRC A;  3CES A;  3QAH A;  3ZN0 A;  4ETS A;  4AIK A;  3KIO A;  1DGR M;  2R7O A;  2UUZ A;  3FK7 A;  1JGS A;  2H1L A;  4XOP A;  4E4H A;  4PGH A;  3PIO F;  5FRN A;  1IRF A;  4IVN A;  1R7J A;  2CQK A;  4IHY A;  1A04 A;  2WY7 Q;  4IOA F;  2XGC A;  3E6B A;  1BR1 A;  2VT2 A;  1BI3 A;  4CCK A;  3RDI A;  2GIZ A;  2Q2E B;  3N05 A;  4MFE A;  1QZY A;  4ESB A;  1OR7 A;  2QCO A;  1G3S A;  1Z05 A;  4ESF A;  3A2K A;  4N4N B;  5H2F C;  4IHV A;  2FRH A;  3DLA A;  1H8A C;  4RB2 C;  2IPQ X;  3H35 A;  2DA4 A;  3OYG A;  4I01 A;  1HOM A;  5HLG A;  3IUO A;  1BW6 A;  2XDV A;  3V42 A;  2DA2 A;  4R79 A;  3M1C A;  2Z1D A;  4S04 A;  4CDG A;  3LSG A;  2DW4 A;  2DQL A;  1BL0 A;  2HOT A;  3DV8 A;  3RTR A;  2NRA C;  3K4C A;  1K78 B;  1ETY A;  1T08 B;  1I27 A;  2LKX A;  3K0L A;  2L01 A;  1F43 A;  5GPA A;  2W00 A;  2OQG A;  2IVM A;  4RB1 A;  2KT0 A;  2KFD A;  2HS5 A;  3SJM A;  1LQ1 A;  1UST A;  2DA3 A;  5LGT A;  3WU1 B;  2X48 A;  3WTX C;  2XSD C;  2DQR A;  1MMS A;  2A05 A;  3FXU A;  2RVC A;  5HDG A;  5IOZ A;  4MHG A;  1TWH J;  1W5T A;  1WJC A;  2HFH A;  3K6G A;  3DTI A;  2M0C A;  4PJM A;  3CCY A;  1O4X A;  1MMA A;  3LMM A;  5FLX Z;  3OYL A;  1WPK A;  1ZKG A;  3SYT A;  3O6B B;  3HOU J;  4U7B A;  4D7M A;  5JLX A;  2L9N A;  2ID6 A;  1X4O A;  4HPQ A;  1IC8 A;  2DFF A;  4II3 A;  4HNV A;  4BQA A;  1DGW Y;  2AXT C;  4OAY A;  3KZY A;  2LLK A;  5CVI A;  5LGU A;  3FXO A;  4F7Z A;  4J01 A;  1MSE C;  1WJ5 A;  1FP1 D;  3IWZ A;  2ETH A;  3ZQ7 A;  1YW8 A;  4IRI A;  1JKO C;  5E1X A;  3KPH A;  1TW2 A;  1TP4 A;  2ZME A;  1T38 A;  1W7P A;  2CMP A;  1LDK B;  1ZRE A;  2X1E A;  4KFC A;  1E17 A;  1RES A;  1S9H A;  4XOR A;  5FJ8 J;  4M6X A;  2EFN A;  3MN2 A;  5D5U B;  3RKY A;  2TDX A;  2XV4 S;  1BW5 A;  1I1S A;  2DK5 A;  5B66 C;  3JRA A;  2F5E A;  1MNE A;  5D8L B;  3KYC B;  1AHD P;  4M71 A;  3Q0W A;  1IN5 A;  5B5E C;  1V5F A;  1S72 I;  3RQI A;  4WCG A;  5EEA A;  4E70 A;  3Q0V A;  3PFY A;  4AWX B;  4I0A A;  1IUF A;  3IRR A;  2ZXJ A;  2X4H A;  4ZYG A;  1RKW A;  2XRO A;  4O6J A;  3LQQ A;  2WA0 A;  4U88 A;  5L3E A;  1V5E A;  2LFB A;  1IAW A;  5KVR A;  2EK5 A;  2VB6 A;  2FUG 2;  1QU3 A;  2MC3 A;  1G8X A;  2JK3 A;  3QU6 A;  4P1W A;  3OMY A;  4EGY A;  1WHU A;  4Z2Y A;  1XSD A;  3WGG A;  2NOG A;  1QZE A;  2EA4 A;  4XLP F;  3OS2 A;  3CO6 C;  2IGM A;  1XX5 A;  3F6V A;  2H27 A;  2UXX A;  5IP7 J;  3ZRG A;  5GAE J;  1VQO I;  4ZC3 A;  3WG9 A;  3PO3 J;  4IO9 F;  4EM0 B;  3CCJ I;  1U9O A;  5F08 A;  4YRV A;  2R92 J;  2V9K A;  2MFZ A;  5L3B A;  3GTQ J;  1WQ2 A;  2B0L A;  3M07 A;  1SAN A;  3F0C A;  3RYR A;  3VSL A;  4AID A;  3W6V A;  3K4J A;  1XCV A;  3WGI A;  5M3F J;  2BE5 F;  3MVP A;  3TO6 A;  1FP2 A;  4IPA A;  3D5S C;  5BOX A;  2Y69 H;  2X0L A;  1LEA A;  5HNH A;  4HA8 A;  4QWQ A;  3CCL I;  5FD6 A;  2RRE A;  1XSX A;  3BTC A;  4I76 A;  3FZV A;  5D5X B;  2LKS A;  3O8G A;  9ANT A;  4L5J A;  3U21 A;  2UV1 A;  1IO2 A;  3I5U A;  2Y31 A;  3DFG A;  3TOB A;  2NNY A;  2NVT J;  3GW2 A;  4U7D A;  1KU3 A;  1E3O C;  4A3L J;  3PUF A;  1BI2 A;  5E3O A;  2DOD A;  2EFP A;  4H4K C;  2QUF A;  2XUB A;  1FYL A;  3FHZ A;  1N25 A;  2DOF A;  2X6O A;  4JX5 A;  3JRE A;  3H9J A;  2K9M A;  2DYR H;  2L7K A;  2E7X A;  3BJ6 A;  3TW7 A;  2GXB A;  2E1C A;  2WV0 A;  3L2R A;  2VOO A;  4XID A;  1YOV B;  1PYV A;  2EJR A;  2OU2 A;  4LK1 F;  2W48 A;  3DQV C;  1JHH A;  3KE2 A;  3J81 K;  2HZD A;  2QEX I;  4KIB A;  2XB5 A;  3LA2 A;  4XON A;  4UUS B;  3JTG A;  3ELK A;  2VAS A;  4CXF A;  3ROU A;  2L2O A;  1TWF J;  1V3F A;  2G7H A;  4LFU A;  3ULQ B;  5ICE A;  5HOO A;  3OY9 A;  2XGE A;  1ZEL A;  1OR7 C;  1ENH A;  3CZ6 A;  1ZYR F;  1MNM C;  5FLV A;  4C9Y A;  2Z99 A;  3EUA A;  3HRT A;  1ULY A;  5FGM A;  2XAG A;  1ZGA A;  5TJJ A;  2CQX A;  4NC8 A;  2P0W A;  1I5Z A;  1TNT A;  1OKR A;  2BW3 B;  2P5V A;  3BTJ A;  3H5R A;  4DNC A;  3AAF A;  4F92 B;  1JJ8 C;  1ONV A;  4F3Q A;  4BGD A;  5FO5 A;  4XLA A;  2H09 A;  4BQQ A;  2HPM A;  2IRF G;  2RC4 A;  4RB3 C;  1EV7 A;  1MBG A;  1OFC X;  4KIC A;  4IEJ A;  5TGT A;  2L4M A;  2PMZ A;  3RQ4 A;  1O3Q A;  4AM3 A;  3MKZ A;  2L0K A;  2DT6 A;  2EV5 A;  1X1D A;  3SXY A;  1B4A A;  3BCB A;  3OIP A;  2KL4 A;  1TLH B;  2ADU A;  1V4R A;  2V1N A;  2P6T A;  3BG3 A;  5LBQ A;  2A6T A;  2XRN A;  4ON0 A;  1YE9 A;  2NS7 A;  1JKQ C;  2OCE A;  3FDY A;  1KYZ A;  3D1N I;  1BOB A;  1MJB A;  1SVO A;  3OYF A;  1WJA A;  1DU6 A;  2E19 A;  2YS9 A;  5HDN A;  1Z7L A;  2H8W A;  3QP5 A;  4OIO F;  1ZGJ A;  1UB9 A;  2V79 A;  1IUY A;  2H1K A;  1OYW A;  3CC4 I;  1QNT A;  1UHM A;  2Y30 A;  3E6C C;  5F1J A;  2R5Y A;  4BAC A;  4LIU A;  1VTN C;  4UUV A;  1VQ6 I;  3KP7 A;  1X1A A;  1HW1 A;  2L5Q A;  2F5V A;  2YR2 A;  4XL9 A;  3FBN B;  4MFD A;  1TL8 A;  3QPS A;  2W57 A;  1PP8 F;  3MEX A;  2IS4 A;  2QBY B;  2FE3 A;  4B3A A;  4CUG A;  5HNF A;  2WC2 A;  1KQ8 A;  4D0P A;  2W4S A;  3LSP A;  5LHG A;  2P4W A;  2ZME C;  4UNO A;  5J8F A;  3A0H C;  5F64 A;  3WTV C;  1PJR A;  3M3Y J;  3K1N A;  5JVT A;  4P55 A;  3OSF A;  2KLO A;  4LD5 A;  3WTY C;  1EH7 A;  1KON A;  2GBY A;  3L2C A;  2RNJ A;  2K3F A;  3WHC A;  1FYK A;  2HYF A;  5KAI C;  2PN6 A;  3FKI J;  4U87 A;  3ZMT A;  5FLM J;  1NG7 A;  2BGC A;  4CCO A;  3KFW X;  3MCZ A;  4V19 K;  1G4D A;  2LBF A;  3OR2 C;  1VQ7 I;  1TQM A;  3S3M A;  2D5V A;  2YUS A;  1WCM J;  2LRE A;  4S0H B;  3SHF A;  2XIG A;  2XAU A;  3DEE A;  3MQ0 A;  4IRH A;  1A6I A;  2E36 A;  4E7I A;  1MMN A;  3W6K B;  2B7E A;  2XPU A;  3CCE I;  4I6Z A;  1QGP A;  1B72 A;  2DMU A;  5D6E A;  2P7C B;  3OYJ A;  3BC8 A;  1BIA A;  2DK8 A;  3RYP A;  3VDX A;  4BDY A;  1D0Z A;  1HKT A;  2GXA A;  3K9T A;  4XLH A;  1RUN A;  3ONQ A;  3DPL C;  2HDW A;  3NWT A;  2EIM H;  5E1W A;  1YJW I;  2HI3 A;  3JTH A;  4XKV A;  2ZCW A;  3GEZ A;  4BJ5 C;  4J00 A;  1ZRD A;  2CYY A;  4KN4 X;  2ZXH A;  2Y9Y A;  1UFM A;  3JCU C;  2VBZ A;  5L3C A;  3RPQ A;  4A3J J;  2IGK A;  2PMU A;  3BR5 A;  1FSH A;  1W4M A;  4EJV A;  4ZYH A;  1FZP B;  3BR2 A;  2E60 A;  2X6W A;  1JKR C;  1LFU P;  1EKE A;  2ECC A;  5DM7 F;  5E8G A;  1NK3 P;  2A6E F;  2VI6 A;  3CJR B;  1PP7 U;  2C6Y A;  2MD0 A;  1X1P A;  4OIP F;  1XN7 A;  2X6X A;  1X3U A;  3WGH A;  4BE0 A;  3HDD A;  3M7G A;  2Y9Z A;  3C2G A;  2W84 A;  3CUQ A;  4E6K G;  2Z16 A;  5GTH C;  5IT9 K;  4BHP A;  3OV8 A;  1TWG J;  2XAQ A;  3A03 A;  3CLO A;  4II2 A;  3BJA A;  3QYB A;  3SZT A;  3OOU A;  2WWY A;  3B73 A;  4BL0 B;  1F5T A;  4V2G A;  2ID3 A;  1GUU A;  1QRY A;  4WF2 A;  2Q0O A;  2ZC2 A;  4G12 A;  4MO7 A;  4DIQ A;  5HOD A;  4WK8 F;  5C3E J;  2AQF A;  1QPI A;  2DU9 A;  2E1M C;  1W36 D;  3LFK A;  2UWM A;  1P2F A;  2DDB A;  3FX3 A;  4D7N A;  3IRQ A;  3K70 C;  1R49 A;  5B3S H;  2IP2 A;  4QPO A;  3OYK A;  1HC8 A;  1P6R A;  1YIO A;  3K69 A;  3P5J A;  2YX4 A;  4HDV A;  3ZMD A;  2D1V A;  2ELK A;  4BXX J;  4K2E A;  1R1V A;  5E8I A;  1O57 A;  2R7V A;  4EEF G;  1HDD C;  1ZG5 A;  4Y33 A;  3FXJ A;  1OLT A;  1R9T J;  1R00 A;  5ED4 A;  5J47 A;  3B6A A;  2KRC A;  2CG4 A;  2HYG D;  4KMF A;  1MDM B;  1FBQ A;  4Q48 A;  3WTT C;  5F04 A;  3TBI A;  2I5U A;  3FK6 A;  5DS9 A;  2DBB A;  1A36 A;  5H20 A;  3DLL F;  2KJC A;  4IXA A;  3EUH A;  5KK1 A;  4B3X A;  3BRO A;  1MW7 A;  1WI3 A;  2PFB A;  3VOD A;  4A5M A;  4I99 C;  3PJR A;  1BC8 C;  1SFX A;  4MQV A;  4AVZ A;  4KIF A;  4RDU A;  4HDU A;  2WY8 Q;  2PJR B;  4FAS D;  5HS7 A;  4FX4 A;  1LB2 A;  4A3K J;  1FNN A;  5D4R A;  3KCC A;  3MKL A;  3QU3 A;  2DMP A;  4BYY A;  1X2N A;  3D0S A;  2HNH A;  1W5C C;  2DA6 A;  4A3M J;  1U9N A;  3IP4 B;  2VXD A;  4JP0 A;  4HX4 A;  2LBF B;  5EGO B;  3HL2 A;  2E71 A;  5BNG A;  4B1R A;  5CQG A;  1WH7 A;  2FSW A;  2M8E A;  4LIV A;  5HLH A;  4I2O A;  2ZSH B;  3IAS 2;  3JRB A;  4B8X A;  2EWN A;  3CJN A;  4BXF A;  3NQO A;  1ZTR A;  1U0J A;  4MEX F;  5FKN A;  3OYH A;  3EQL F;  1Z9C A;  1B9N A;  1X58 A;  5LHI A;  3QPL A;  2QGU A;  1R22 A;  3AKZ A;  2CW0 F;  3AG2 H;  1ZLK A;  4NQW B;  1W0T A;  5GPC A;  2VJ4 A;  1XDS A;  3OR1 C;  2LSO A;  1O3S A;  2LVS A;  1JUP A;  4BY7 J;  2RKH A;  2K9S A;  5FRM A;  1U8B A;  4LOC A;  2KRH A;  5IYC J;  5IYD J;  4XOT A;  1ZK8 A;  1VQ9 I;  4PGG A;  3T8T A;  1K7A A;  3S16 J;  1T39 A;  5KHD A;  3H3V K;  4PK4 A;  3BOQ A;  4HF2 A;  2JT1 A;  3OYA A;  2O9L A;  2BY2 A;  3I55 I;  2BV6 A;  4IRG A;  4RBO A;  2MA3 A;  3I53 A;  5D8K B;  3G4S I;  1YI2 I;  2FQ4 A;  1YJ9 I;  2W85 A;  4ANJ A;  1T56 A;  2R7R A;  1LE8 A;  3JSP A;  2O7O A;  3BG9 A;  2NVY J;  1IV6 A;  1XDU A;  1KYW A;  2TRT A;  3OS1 A;  3LA3 A;  4AUX A;  2NAZ A;  3VPR A;  1BJZ A;  2ZB9 A;  2VQC A;  4IHX A;  2PMH A;  5LHH A;  3J7Y J;  4ZTF A;  1E3P A;  2EIN H;  4L9V A;  1H9G A;  4B48 A;  4KUM A;  1G3Y A;  3EDP A;  1GXQ A;  2PG4 A;  4NB5 A;  5L3F A;  3OYI A;  4A3C J;  1JUM A;  1Y0N A;  2IA0 A;  1ON1 A;  2M87 A;  3H1C A;  1X3Z B;  2HDD A;  3DBR B;  1R36 A;  2P7V B;  1PDN C;  2A5W A;  2Y48 A;  2FNA A;  4L18 B;  3BR0 A;  4ZYA A;  2M7A A;  4CCJ A;  2O03 A;  1HKQ A;  2G7U A;  2LR8 A;  3RSN A;  5K5Q A;  3A0B C;  1YYV A;  2IAI A;  2R0Q C;  3I4P A;  1T6S A;  2VOP A;  1H9T A;  1ZRF A;  4UB6 C;  1FTT A;  5BPD A;  2B63 J;  2DMT A;  1R23 A;  4IQ4 A;  1X1B A;  3KLO A;  2FA5 A;  2QM3 A;  1KZH A;  1XSV A;  2HXO A;  2RQP A;  2E2J J;  2PJP A;  1GHC A;  1K6O A;  1P7I A;  2LOO A;  2WAQ A;  3BZ6 A;  4HOB A;  4TV7 A;  3VYS B;  2R7Z J;  2K7L A;  1YO5 C;  1MBF A;  1OCP A;  2DA5 A;  2DI3 A;  2OJE D;  4BE1 A;  4U0W A;  4ABZ A;  1FOX A;  2ZFU A;  4BXU A;  1HW5 A;  2D45 A;  3CUQ C;  2ME0 A;  4LG3 A;  2H8R A;  4ZDP A;  1F9N A;  2QQ8 A;  3KP6 A;  3I58 A;  1I6X A;  1U2W A;  3U9G A;  4C3J J;  5M5Y J;  2I8D A;  4XLE A;  1Z3X A;  2L9S A;  3RKW A;  4XLF A;  3N4M A;  1EH6 A;  5J8C A;  2EFW A;  4OOI A;  2KZV A;  2EV0 A;  5HS8 A;  4AU7 A;  3IHU A;  3K4N A;  5BMZ A;  3VYU B;  1V55 H;  1WWX A;  2M8G X;  1XGN A;  2COM A;  5J1U A;  1VQM I;  1HKS A;  3HOV J;  1R71 A;  5GAG J;  2LDU A;  1OJL A;  1BN5 A;  1BR4 A;  3O3K A;  1PUF B;  4LMY A;  2LNB A;  2DMN A;  2VBY A;  1ETW A;  3W2W A;  1E2X A;  5E3M A;  3HOX J;  2F4M B;  1S3J A;  3CDI A;  1YW9 A;  2RV8 A;  4V2F A;  2QYO A;  1M1E B;  2YX7 A;  1X1C A;  2KQR A;  3CCV I;  1MSF C;  3HOZ J;  2VJJ A;  3ECH A;  1QA6 A;  2DJN A;  2HVR A;  5FFZ A;  2R7U A;  1Z3Y A;  3B02 A;  2VLA A;  2E7W A;  1LPQ A;  2PI0 A;  5EF6 A;  1BM9 A;  1VF9 A;  3A1Y A;  4JBA A;  2PMZ N;  5E3L A;  1SD7 A;  4CHU A;  3HTU A;  5AIP A;  4G7O F;  2MH2 A;  4ENM A;  5HS9 A;  5B1A H;  3QPT A;  4RMN A;  3ABL H;  3SFI A;  4BKX A;  4NC7 A;  2OBP A;  4RGU A;  1JTY A;  1TW3 A;  1Q1V A;  3MAJ A;  1MH4 A;  1OPC A;  4H0E A;  3GZ6 A;  1L3L A;  4A6D A;  4M74 A;  3KLN A;  3CD6 I;  3EUH C;  4P9F A;  1ZLJ A;  4UVA A;  4UUT A;  1A6Q A;  3KZI C;  4U0V A;  4E7Z A;  2Z9O A;  1HQC A;  1O7F A;  4LG0 A;  3CMA I;  2K9L A;  5DD4 A;  1E0E A;  4A2U A;  4ZZL A;  4IKF A;  2OUM A;  3FMQ A;  3FXL A;  5CQE A;  4QTR A;  3JRD A;  3CP8 A;  3H0D A;  3BR3 A;  2K85 A;  3A01 A;  5LEK A;  2M34 A;  1LVA A;  2R4G A;  5C4J J;  3K10 A;  4E7K A;  4CCL A;  2Y2Z A;  2MGQ A;  3ZCO A;  4C2T A;  5F27 A;  3GTP J;  4D1Q A;  3L09 A;  5ILU A;  2UXN A;  5HLI A;  1OMI A;  2EFQ A;  3HG9 A;  3S14 J;  1F36 A;  4ENN A;  2FU4 A;  2L7M P;  4BY1 J;  2DJI A;  3H3U A;  2B9S A;  3ZMS A;  4D5F A;  1KU2 A;  1BBY A;  2O61 A;  2DXI A;  3OL3 A;  1YQA A;  4G6T B;  2GOX B;  2JWT A;  4LLN A;  5DV5 A;  2KRF A;  3HGG A;  2COB A;  2LYC A;  2NNN A;  3NWS A;  4IF4 A;  3TMO A;  1K61 A;  1XGM A;  1OCO H;  3CCS I;  2M5W A;  3RI4 A;  1Y39 A;  3K4K A;  1SD6 A;  4EMS A;  3S15 J;  2EFO A;  4PSW A;  2M2E A;  5DTD A;  2E35 A;  4KIG A;  1ERD A;  5DM6 F;  3PSI A;  3HRS A;  3GME A;  3SEZ A;  2IGO A;  4GCV A;  4S05 A;  3IAM 2;  1ORK A;  4OAZ A;  1D0X A;  3BY6 A;  2FBK A;  1XC5 A;  4EQQ A;  5FB2 A;  3ASN H;  3HOS A;  2V4J C;  2IA2 A;  3HIF A;  1JTX A;  1JT6 A;  3BPV A;  2IA1 A;  4I98 B;  3HSE A;  4X0G A;  1O3T A;  2E2I J;  2BYV E;  2V9V A;  5C4X J;  1I3Q J;  1B8I A;  3NEU A;  1VQ4 I;  2F2E A;  3IKT A;  2ECB A;  2GOM A;  3K1P A;  3WTW C;  4FET A;  4ZYD A;  4IHT A;  5D6F A;  2XF7 A;  3I9V 2;  3P9C A;  1KU9 A;  3ML6 A;  4E7H A;  4YFN F;  1JHF A;  3FHN A;  5GAH J;  5DUI A;  2H6B A;  3LSI A;  5F0F A;  1SVL A;  2KPM A;  3JSO A;  4MTD A;  2EZH A;  3HGY A;  3RCO A;  2OF7 A;  4DOZ A;  3S1Q J;  1IDY A;  1Z1D A;  2NXN B;  1U78 A;  2XKO A;  1DUX C;  3LOC A;  5LD2 C;  1SAX A;  3KEY A;  3MMY B;  2I10 A;  2ACJ A;  3GUD A;  3J80 Z;  1JKP C;  4RGS A;  2VE8 A;  4PDK A;  1RI7 A;  2XPW A;  4MTE A;  3RJP A;  4CCN A;  2CO5 A;  2JRT A;  4FHT A;  3GLX A;  1IRZ A;  2MD5 A;  3L2Q A;  2EBI A;  2ME6 A;  1DPR A;  4IQJ A;  4Q47 A;  5EDN A;  3ZPL A;  2QQB A;  2VKH A;  4HQE A;  3E0J B;  3FIW A;  2Q1Z B;  2W1O A;  2OQR A;  3CLQ A;  2VQG A;  1E3H A;  4WXD A;  2VL8 A;  3JRI A;  3QQA A;  3V7C A;  4ZH4 F;  2AS5 F;  4L9T A;  3K4L A;  5JI6 A;  4ENJ A;  4R1H A;  2BVM A;  1ZN2 A;  3I4M J;  1XG1 A;  2PBI A;  1REP C;  3ZQF A;  1VI0 A;  4PFO A;  3GTO J;  2F6C A;  4HEA 2;  3L2V A;  3A02 A;  2DAO A;  4CYC A;  1T8I A;  2Y0S A;  3G2B A;  5FFX A;  3HPG A;  4M9X A;  4I7H A;  1YX5 A;  3I59 A;  2QEN A;  2K02 A;  5HDK A;  4E7S A;  1AA7 A;  4LIT A;  2YU9 J;  3J7A Y;  3TOA A;  4DJA A;  2ZME B;  1W7P B;  1ZAO A;  1FBS A;  1T33 A;  2K3P A;  5EEH A;  1HST A;  4ENK A;  2XAJ A;  1TNS A;  3D5R C;  2PX9 A;  3K1M A;  1IW7 F;  3ABK H;  3ZR8 X;  4A3F J;  5E3N A;  1UG0 A;  1RR7 A;  2A6H F;  4BDZ A;  4HQM A;  1MBJ A;  1WJE A;  3BLY A;  3S1N J;  4GGG A;  5FKO A;  3G1L A;  4BH9 A;  1G3T A;  4E7L A;  2IS2 A;  3KP3 A;  4UV9 A;  2ZJR F;  2V6C A;  4ITV A;  3R4K A;  3BR1 A;  3H9G A;  3WE3 A;  2R5Z A;  4KA4 A;  3GTK J;  1W5S A;  1T95 A;  1KQ9 A;  4WXH A;  3DWL E;  3Q9S A;  3GTM J;  4MEY F;  1RIO H;  3F8N A;  3ECO A;  3QOP A;  3T8R A;  2QQ9 A;  4BU2 A;  2A69 F;  2LD5 A;  1W0U A;  1T98 A;  4IZZ A;  2KDO A;  2VPL A;  4HF1 A;  3FWE A;  3FMR A;  3GLL A;  2IJL A;  5JHF A;  2DT5 A;  2JPB A;  3CCQ I;  3HBL A;  1FC3 A;  1FWZ A;  1DQU A;  3E6M A;  4O3M A;  5DEQ A;  4M6V A;  3F8M A;  1LNW A;  3HHG A;  1ZRC A;  3SZG A;  2XAH A;  2JUG A;  3IH2 A;  1U8R A;  4HNT A;  2M45 A;  4A3D J;  1STZ A;  2WAF A;  1SVM A;  1ZQ3 P;  1Y8R B;  2E34 A;  5D4S A;  3F72 A;  2A68 F;  1YTY A;  1YIT I;  3ERM A;  2O6G E;  2BY0 A;  1W1W E;  3ISP A;  1X3W B;  3BTI A;  2ELJ A;  1UEL B;  5DD8 A;  1BR2 A;  2KZG A;  4AD9 A;  1RPW A;  3V4G A;  1G59 A;  3F23 A;  4RM2 A;  3F8F A;  2X1C A;  3G73 A;  1Z6R A;  2JA6 J;  3OYN A;  4M9S A;  3HC7 A;  2KJB A;  1P92 A;  1TC3 C;  1RKT A;  2HOA A;  1A5J A;  2OA4 A;  1XMA A;  2D1H A;  2MG4 A;  1VQK I;  2WB1 A;  2D2W A;  1FY7 A;  3H5N A;  2O0Y A;  3M4O J;  2NOJ B;  3S2W A;  3OSG A;  1R5H A;  1LJ9 A;  1QQI A;  4F52 A;  4HNU A;  3ZMU A;  2Y0M A;  5K5R A;  2LK2 A;  4CIC A;  1ON2 A;  4RAG A;  2GWR A;  3JRF A;  1VQP I;  2JTV A;  4HV6 A;  2E1M B;  2HVS A;  2OCC H;  1QPM A;  4HV5 A;  4DBQ A;  3JAM K;  3SFZ A;  2BXY A;  3COA C;  2K4J A;  1HBX G;  2FBH A;  4XSX F;  2MLG A;  3E5U A;  4EJW A;  3CUO A;  2Z3Y A;  1X2M A;  4JX4 A;  1R4M B;  3DTK A;  3P9K A;  1LEB A;  3SQN A;  1WJF A;  2LP0 A;  3BZC A;  2M4G A;  1D8K A;  4AYB A;  1SC7 A;  3G1M A;  3U1D A;  2CS3 A;  2DFE A;  4CYD A;  1R4N B;  5IPA A;  1ZR2 A;  3V8J A;  1PUE E;  3ESW B;  3R6S A;  2LH9 A;  3OYE A;  2JPC A;  2MH9 A;  3TDU C;  3F3X A;  2RQQ A;  2HQA A;  3ZMV A;  1LKX A;  4M3B A;  3R0A A;  4CYC B;  5TRD A;  1FIA A;  3FMS A;  4XRS G;  4BEH A;  2M4K A;  2IBD A;  1QZZ A;  3BWG A;  3IC7 A;  3L00 A;  3LAJ A;  3DBH B;  3ZQC A;  1IXC A;  5DCM A;  4XRF A;  5CKT A;  2WAQ N;  3G71 I;  2MYS A;  3X2Q H;  1ZGW A;  3FXR A;  3ZQI A;  1O3R A;  5AIQ A;  2RAE A;  3ZGK A;  1OCZ H;  1VZ0 A;  3F9K A;  3DBL B;  1S29 A;  4E7J A;  2HKX A;  1WH5 A;  4UB8 C;  3CO7 C;  3RKX A;  3QYE A;  2R7Q A;  2BHY A;  1OYY A;  2DDA A;  4Y52 J;  2GQQ A;  2JA8 J;  2MW8 A;  1RR8 C;  2AO9 A;  3WTU C;  3TQN A;  4YG2 F;  4BAY A;  4BUP A;  4ZDL A;  4EJU A;  5HLT A;  3VSK A;  2KIS A;  1LUJ B;  4XRM A;  1IF1 A;  3GTJ J;  3V8L A;  2QVO A;  2AXL A;  2Z33 A;  3KX2 A;  3RIR A;  1D0Y A;  5EEG A;  4XBF A;  2FEZ A;  2OV7 A;  1BA5 A;  4Z6Y A;  2R5Y B;  2BXZ A;  5M3M J;  2HDC A;  2R5Z B;  1GV2 A;  5DYM A;  2NYX A;  1IXS B;  4MGR A;  4QPQ A;  2VC1 A;  2R7X A;  1MD0 A;  5J6X A;  3AFH A;  5CLS A;  3PO2 J;  1HDP A;  3FXQ A;  2V1X A;  1FEX A;  1J09 A;  4MQ9 F;  4R8H A;  4L0Y B;  4OMY A;  5BQT A;  1Z91 A;  1WVR A;  3LQR A;  1UHS A;  2M0M A;  3FIS A;  2Q2E A;  3B6C A;  3F6O A;  1MBK A;  4YFK F;  2L7F P;  2W7N A;  1XGO A;  5JLW A;  2NS0 A;  4J19 A;  4LB6 B;  3L2U A;  1HSJ A;  2L02 A;  1EF4 A;  2KIU A;  1Z21 A;  2HYJ A;  3I3L A;  4HST A;  3E5Q A;  5LEJ A;  3CCR I;  1ZR4 A;  1R5I D;  3D5L A;  2KMU A;  1XD7 A;  3FXK A;  5EZG A;  4CZC A;  2V7F A;  1BI1 A;  3MFK A;  3TGN A;  1ACI A;  2R3S A;  2VXZ A;  1R1T A;  1WJB A;  4FE4 A;  3T5X A;  2MAB A;  2XF6 A;  3QWL A;  4OIN F;  4XKW A;  1TQI A;  4XLC A;  2CV2 A;  3PQJ A;  2DN0 A;  3QP6 A;  4B09 A;  1IZ1 A;  3PNY A;  3RKQ A;  1IJW C;  1RNL A;  4HYE A;  4BS9 A;  4L0Z B;  3W3C A;  2YU3 A;  3I54 A;  3DP7 A;  1RUO A;  1B72 B;  1JI8 A;  2XB0 X;  2EZI A;  1CF7 A;  2VIX A;  3WU0 A;  4LGW A;  2HZT A;  3DPU A;  3CMM A;  3MKW B;  2EPF A;  3F8C A;  1EJ9 A;  2IS1 A;  4DQ2 A;  2XC7 A;  2IGN A;  3EYY A;  3GXO A;  4EJO A;  2EIK H;  2GZW A;  1UHW A;  4A69 C;  3LA7 A;  4YIR X;  2AHQ A;  2DTZ A;  2VN2 A;  1ZHF A;  2K5C A;  3JRH A;  4IX7 A;  2P8T A;  4A0X A;  4OIQ F;  3CJT B;  2RGV A;  3RPU D;  2MLK A;  1YRN A;  4EVI A;  5K1Y A;  2DCE A;  4DW6 A;  3REO A;  4CH7 A;  1FOK A;  1D5V A;  2QLZ A;  2ISZ A;  4OIR F;  1WFX A;  1WSU A;  2F48 A;  4JOM A;  3GFL A;  3LNQ A;  3DU5 A;  3ABT A;  2QA4 I;  4GYG A;  4EAT A;  1YJN I;  4BNC A;  3GFJ A;  2EV6 A;  3OIQ A;  2XPV A;  3CUQ B;  2CUZ A;  3BJO A;  2A07 F;  1DU0 A;  1OCR H;  2PEX A;  3S8P A;  1VQ5 I;  4ZDO A;  2HEO A;  2QKL B;  1K79 A;  4NNJ A;  1IN4 A;  2DOA A;  3SDG A;  4QIW N;  3DTE A;  2V6E A;  4NDL A;  4I09 A;  1TWC J;  1SMT A;  4RLQ A;  1WRJ A;  5FKM A;  4BEH B;  3JRG A;  2QSG X;  1MIJ A;  3EET A;  3TW6 A;  3GZN B;  2CU7 A;  1OQY A;  4B4C A;  4D9J A;  5BS6 A;  3BTL A;  2ICW G;  5J3L A;  2OTL I;  1MBH A;  5K7Z A;  1YIJ I;  3DKW A;  5GP9 A;  3K7A J;  4M3D A;  2TCT A;  4OU0 A;  3ZQL A;  1MGT A;  1MZB A;  3I64 A;  2EB7 A;  2F5F A;  1D8J A;  4RLF A;  3O2P E;  3LSJ A;  3BP8 A;  3GTG J;  4RB0 A;  2BZT A;  1FOW A;  3IWF A;  3VYR B;  4X6A J;  3BQZ A;  4HSR A;  4WWC A;  1Y56 A;  2DT7 B;  1DP3 A;  3E5X A;  1SEU A;  2NS8 A;  5D5V B;  1HXD A;  1C0W A;  2JA7 J;  1ETK A;  2JZY A;  2DA7 A;  4W97 A;  5EJC A;  3Q3S A;  1TQP A;  3DEU A;  3LL7 A;  1L0O C;  4IOC F;  5LRS A;  1RET A;  1N78 A;  1U5T A;  4XKC A;  2ZJQ F;  1ETO A;  4KYW A;  4BQN A;  2A5Y B;  2X51 A;  2HKO A;  1TT0 A;  2RNG A;  1CGP A;  1QO0 D;  2CUF A;  3KEQ A;  4LB5 A;  3IL2 A;  1P4W A;  2UZK A;  1Z6T A;  3VYT B;  3PNV A;  3I4N J;  3S32 A;  1I3A A;  2BVL A;  2V26 A;  4PZJ A;  3CMY A;  5ICF A;  4QSH A;  1J5Y A;  4BJT A;  4KIT B;  3OS0 A;  3S1M J;  1XS9 A;  3J81 Z;  3UNG C;  3LAP A;  1R6R A;  2BHZ A;  1D1C A;  1TZL A;  1W36 C;  3DKY A;  5DUK A;  1I39 A;  2BY3 A;  2VUM J;  3AG4 H;  4XM3 A;  1F4K A;  2CFX A;  3L2W A;  3GX4 X;  2E2H J;  3MZH A;  4A3B J;  3C7J A;  2Y0S N;  4FQG A;  1D3Y A;  2J5P A;  3M8E A;  3BDD A;  4HX7 A;  4ZZD A;  3HJE A;  3WE2 A;  2ELH A;  2FXA A;  4OWR B;  4DZP A;  3H0G J;  3WTZ A;  3LSR A;  4G6Q A;  3MKY B;  3ZQG A;  2JUC A;  4Y15 A;  1YS6 A;  5A2Q K;  3TP0 A;  1XMX A;  2EIL H;  2FNP A;  5D5W B;  1AU7 A;  2M30 A;  2JSP A;  2JN6 A;  5DCF A;  4BE2 A;  1IRX A;  3M1E A;  3HTS B;  1TT5 B;  2FF4 A;  3C3W A;  5K7H A;  4UUS A;  4BBS J;  1S7A A;  4XN0 A;  3OYC A;  1CF7 B;  2BEO A;  3AG3 H;  1A31 A;  3HOY J;  1UCR A;  3PM1 A;  5J40 A;  3HOW J;  4HG2 A;  2LY1 A;  4PCQ A;  1GT0 C;  3ZXS A;  4DBR A;  4XK4 A;  2QWW A;  4KJZ A;  2OAZ A;  1ETV A;  1APL C;  1ZAR A;  3S1R J;  1OIS A;  2ZO4 A;  1HW2 A;  1S7O A;  3P9I A;  2NVU B;  4BHB A;  3S3N A;  3CTA A;  5LFA A;  5J4Y A;  2PQ8 A;  1QBJ A;  4M73 A;  4G7Z F;  5IP6 A;  4G9Y A;  2BW3 A;  2ZNZ A;  2L4A A;  1XB4 A;  1EA3 A;  2ZNY A;  1IG7 A;  1LE8 B;  1YHQ I;  3KYD B;  1Y1W J;  4YIF A;  1K4S A;  1W7P D;  4HLX A;  1JXS A;  1SAU A;  2ZXI A;  3HKZ A;  1YRN B;  1GVD A;  4FIS A;  3GYH X;  2EZL A;  1N77 A;  4LLG F;  2JA5 J;  3R61 A;  2X1D A;  4ESJ A;  3MWM A;  1N75 A;  1SFU A;  1LDJ A;  2O5R A;  4KNY A;  4HW0 A;  2H6C A;  2K9N A;  2XHK A;  4RM3 A;  3JR9 A;  2GM4 A;  3KP5 A;  1GXP A;  5GTI C;  2WAE A;  4Q5S F;  3E7L A;  2K4B A;  2F4O B;  3KEO A;  1I6H J;  2DA1 A;  3HYI A;  1ETX A;  3WU2 C;  1OCC H;  3ZMZ A;  1FYM A;  3CDH A;  4FT8 A;  2KHM A;  3ASO H;  4PJ0 C;  1GVJ A;  1U6G A;  1IV8 A;  3GBG A;  1YFH A;  3DF8 A;  5JR3 A;  1DP7 P;  4A5N A;  1FSE A;  2ZJ2 A;  2VBX A;  1JE8 A;  4IHW A;  4HRI A;  1ZG1 A;  3TP3 A;  2OZU A;  3OOP A;  4M9Z A;  4MLO A;  4A0Z A;  1QVT A;  2RDP A;  3MZ8 A;  2QBY A;  2HGC A;  2VQL A;  3HB9 A;  4G94 A;  5CJ9 A;  4UV8 A;  4Y7N J;  1B1B A;  2XGD A;  2HWV A;  3GVA A;  2WB1 N;  4A3E J;  2FQ3 A;  3DCF A;  1AKH A;  2O3F A;  1UZC A;  2IEK A;  1UAA A;  3A4C A;  4XQF A;  1VQN I;  5ILS A;  3CQZ J;  4N0B A;  4RS8 A;  5CVJ A;  3FF5 A;  2M1B A;  3GTL J;  3GF2 A;  1QHG A;  2CQQ A;  1D5Y A;  4L5I A;  1MMG A;  3W2V A;  1U5T B; 
#chains in the Genus database with same CATH homology
 3NAU A;  4IHV A;  1H8A C;  2DA4 A;  3BTI A;  4RDU A;  1HOM A;  4JYK A;  1BW6 A;  1RPW A;  2DA2 A;  4A3K J;  3LSG A;  1K83 J;  1BL0 A;  3MKL A;  2HOT A;  2JA6 J;  2DMP A;  1ITY A;  1X2N A;  1TC3 C;  1ETY A;  4AYB N;  1RKT A;  2DA6 A;  2HOA A;  2LKX A;  5GPA A;  4GFB A;  1F43 A;  1A5J A;  4A3M J;  1U9N A;  3G1O A;  4JP0 A;  2KT0 A;  3SJM A;  5EGO B;  2DA3 A;  2MG4 A;  5BNG A;  4B1R A;  1WH7 A;  2X48 A;  1WI3 A;  2XSD C;  3M4O J;  2EQR A;  3JRB A;  3OSG A;  1ZTR A;  5FKN A;  4A93 J;  2LK2 A;  3JRF A;  1X58 A;  5IOZ A;  3QPL A;  1TWH J;  2HXI A;  1WGX A;  3BT9 A;  2M0C A;  1W0T A;  5GPC A;  3CCY A;  1O4X A;  4DYQ A;  2N8G A;  2LVS A;  1WPK A;  1JUP A;  1ZKG A;  4BY7 J;  2K9S A;  1X2M A;  1U8B A;  1IGN A;  4LOC A;  3HOU J;  5IYC J;  2K9Q A;  5IYD J;  1ZK8 A;  4D7M A;  5JLX A;  2ID6 A;  4JX4 A;  3S16 J;  1IC8 A;  2LP0 A;  4HNV A;  3H3V K;  3IV5 A;  2O9L A;  2LLK A;  4RBO A;  1S7E A;  3G1M A;  1MSE C;  2FQ4 A;  5IPA A;  1ZR2 A;  2NVX J;  1T56 A;  1FIP A;  1JKO C;  1LE8 A;  2O7O A;  3BG9 A;  2NVY J;  4W1U A;  1IV6 A;  2TRT A;  4AUX A;  3BG5 A;  1UG2 A;  1RES A;  4M3G A;  3VPR A;  1BJZ A;  2ZB9 A;  2EZK A;  5FJ8 J;  4M3B A;  4CYC B;  3MN2 A;  1FIA A;  4XRS G;  4IHX A;  2IBD A;  1HLV A;  3CDL A;  3ZQC A;  1MBE A;  1Z0X A;  1BW5 A;  3JRA A;  2WAQ N;  1FTZ A;  3A01 B;  2XRL A;  4A3C J;  1JUM A;  1ZGW A;  3ZQI A;  1AHD P;  2RAE A;  3Q0W A;  3RQI A;  1OCT C;  2HDD A;  5EEA A;  1JT0 A;  3Q0V A;  1IUF A;  2CUE A;  5IOY A;  1WH5 A;  3BR0 A;  1RKW A;  1VND A;  2LR8 A;  4X1E A;  4Y52 J;  4M3F A;  5F0H A;  3ZOB A;  2IAI A;  2JA8 J;  2JJ7 A;  2MW8 A;  2LFB A;  2R0Q C;  1NK2 P;  2GLO A;  2AO9 A;  2CRG A;  1CQT A;  1FTT A;  4XRM A;  2M9H A;  3GTJ J;  2VKE A;  2JK3 A;  2FJ1 A;  2B63 J;  2CJJ A;  2DMT A;  4A3I J;  1BA5 A;  2NOG A;  1H88 C;  2HXO A;  2E2J J;  4A3G J;  2R5Y B;  5M3M J;  1POG A;  2R5Z B;  1GV2 A;  1FJL A;  1P7I A;  5IP7 J;  2R7Z J;  2EH3 A;  3PO2 J;  1HDP A;  1MBF A;  1OCP A;  2DA5 A;  3L1P A;  3PO3 J;  1FEX A;  4ABZ A;  1U9O A;  1UHS A;  5F08 A;  2R92 J;  3FIS A;  3GTQ J;  2ME0 A;  3B6C A;  2H8R A;  1MBK A;  2L7F P;  5JLW A;  1SAN A;  3F0C A;  4C3J J;  3W6V A;  4J19 A;  1AKH B;  5M5Y J;  5M3F J;  1EF4 A;  2HYJ A;  3MVP A;  1ZR4 A;  1B8I B;  2O8K A;  5EZG A;  3BTC A;  4JX6 A;  4I76 A;  3O8G A;  9ANT A;  2MSY A;  3OIO A;  2Y31 A;  2HOS A;  2NVT J;  2M8G X;  2HQ5 A;  4FE4 A;  5J1U A;  2LTP A;  1E3O C;  5EGO A;  1ETQ A;  3HOV J;  4A3L J;  1OJL A;  1PUF B;  2DN0 A;  5E3O A;  3RKQ A;  1JJ6 C;  2DMN A;  1GDT A;  1ETW A;  1IJW C;  1JUS A;  5E3M A;  3HOX J;  2X6O A;  3JRE A;  4JX5 A;  4V2F A;  2X9D A;  3TW7 A;  2KDZ A;  3HOZ J;  1MSF C;  1B72 B;  2NVQ J;  2XB0 X;  2EZI A;  4XID A;  2DJN A;  1MH3 A;  2W48 A;  1QVU A;  2K40 A;  5EF6 A;  3BQY A;  1VF9 A;  2PMZ N;  5E3L A;  2XB5 A;  4A69 C;  3SFI A;  4UUS B;  2AHQ A;  4BKX A;  2DTZ A;  1JTY A;  1Q1V A;  3JRH A;  1TWF J;  1MH4 A;  3NAR A;  2XGE A;  5K7F A;  5EG0 A;  1ENH A;  4UUT A;  1YRN A;  1MNM C;  3IH3 A;  5FLV A;  4DW6 A;  4AC0 A;  2CQX A;  4D5C A;  4DZJ A;  5FKK A;  3LNQ A;  3BTJ A;  2R93 J;  1JJ8 C;  3HEF A;  4QTR A;  1I50 J;  3JRD A;  3RZD J;  3HM5 A;  4XIC A;  2XPV A;  3BR3 A;  4C3I J;  1DU0 A;  3A01 A;  2M34 A;  1MBG A;  1OFC X;  4IEJ A;  5C4J J;  3TED A;  2DMQ A;  2L0K A;  3DEW A;  3SDG A;  4QIW N;  4NDL A;  2Y2Z A;  2MGQ A;  5J1Y A;  1TWC J;  5FKM A;  3JRG A;  5F27 A;  3TW6 A;  3GTP J;  3BG3 A;  5C44 J;  2CU7 A;  2NS7 A;  1JKQ C;  3S14 J;  1F36 A;  4B4C A;  2L7M P;  5IP9 J;  4BY1 J;  3S2H J;  3BTL A;  1HCR A;  4D5F A;  5J3L A;  3D1N I;  1SFO J;  1MBH A;  5K7Z A;  5GP9 A;  3K7A J;  2JWT A;  1DU6 A;  4M3D A;  2E19 A;  2TCT A;  2YS9 A;  3HGG A;  2LY9 A;  1UMQ A;  2COB A;  3ZQL A;  1HF0 A;  1K61 A;  3LSJ A;  2H1K A;  3GTG J;  4X6A J;  3BQZ A;  2Y30 A;  5F1J A;  2R5Y A;  3S2D J;  2NS8 A;  2OPT A;  4M3E A;  4MFD A;  3S15 J;  2JA7 J;  3QPS A;  2M2E A;  5DTD A;  1ETK A;  4W97 A;  2DA7 A;  3Q3S A;  1TWA J;  4MIM A;  1LFB A;  1RET A;  4B3A A;  5M5X J;  1ORK A;  1ETO A;  3LSP A;  1XC5 A;  2WV1 A;  3M3Y J;  5F0C A;  1JTX A;  2CUF A;  1JT6 A;  3C2B A;  3OSF A;  2E2I J;  3I4N J;  2L7Z A;  5C4X J;  1I3Q J;  1B8I A;  2GBY A;  3CMY A;  5EZH A;  3WHC A;  2P81 A;  5IYB J;  4QSH A;  2ECB A;  2QF7 A;  3FKI J;  3BR6 A;  5FLM J;  4C2M J;  1NTC A;  3S1M J;  1XS9 A;  2D5V A;  5F0F A;  2YUS A;  1WCM J;  4S0H B;  4DYR A;  1PUF A;  2EZH A;  3HGY A;  2OF7 A;  3S1Q J;  3Q0U A;  1IDY A;  2VUM J;  1A6I A;  1U78 A;  2E2H J;  1GV5 A;  4A3B J;  4DYC A;  2Y0S N;  3LOC A;  2XPU A;  4I6Z A;  1B72 A;  2DMU A;  2I10 A;  3UKG A;  2FD5 A;  1JKP C;  2XPW A;  4DZP A;  2E1O A;  3H0G J;  3LSR A;  1IRZ A;  3HKZ N;  3ZQG A;  3RZO J;  1P7J A;  2EBI A;  3TP0 A;  2ME6 A;  1AU7 A;  2G0E A;  2FX0 A;  2JN6 A;  5EDN A;  2HI3 A;  5K7H A;  4UUS A;  4BBS J;  3FIW A;  4FE7 A;  3HOY J;  3PM1 A;  3HOW J;  2Y9Y A;  3JRI A;  3QQA A;  1GT0 C;  4XK4 A;  4A3J J;  1ETV A;  3I4M J;  1XG1 A;  1JGG A;  1APL C;  3BR5 A;  3S1R J;  3ZQF A;  1Y1V J;  3BR2 A;  1JKR C;  1VI0 A;  3GTO J;  1LFU P;  2ECC A;  1NK3 P;  3A02 A;  4CYC A;  2VI6 A;  4BBR J;  5IP6 A;  1G2H A;  1IG7 A;  3IH4 A;  5M5W J;  1LE8 B;  2YU9 J;  3HDD A;  1Y1W J;  2Y9Z A;  2JMW A;  1IDZ A;  1H89 C;  5EG0 B;  4C3H J;  1YRN B;  4FTH A;  1GVD A;  4FIS A;  1T33 A;  2EZL A;  1VFC A;  1TWG J;  3A03 A;  2JA5 J;  5EYR A;  3OOU A;  5FKL A;  3S17 J;  3K2A A;  4A3F J;  4V2G A;  5E3N A;  2ID3 A;  1GUU A;  1RR7 A;  1QRY A;  2K9N A;  3JR9 A;  4G12 A;  4MO7 A;  2GM4 A;  5HOD A;  2L9R A;  4L5E A;  5C3E J;  1QPI A;  1MBJ A;  4XRS A;  3E7L A;  3S1N J;  5FKO A;  2VPR A;  3G1L A;  3O8H A;  1I6H J;  2DA1 A;  1ETX A;  3BR1 A;  3GBG A;  3ZQH A;  4D7N A;  1Z77 A;  5J1R A;  2R5Z A;  3GTK J;  4IHW A;  3GTM J;  3TP3 A;  4FCY A;  4MLO A;  2ELK A;  1QVT A;  2VKV A;  4BXX J;  3HB9 A;  4Y7N J;  3WHB A;  4EEF G;  3JRC A;  2LD5 A;  1W0U A;  2XGD A;  1HDD C;  1R9T J;  2WB1 N;  4A3E J;  3FK7 A;  3B6A A;  3DCF A;  1AKH A;  2IEK A;  3HBL A;  4IHY A;  3CQZ J;  2XGC A;  5F04 A;  3FK6 A;  4M6V A;  5DS9 A;  3GTL J;  3IH2 A;  2CQQ A;  1D5Y A;  4A3D J;  4MFE A;  1ZQ3 P;  2QCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...