2KDZA

Structure of the r2r3 dna binding domain of myb1 protein from protozoan parasite trichomonas vaginalis in complex with mre-1/mre-2r dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
107
structure length
107
Chain Sequence
KVKFTEEEDLKLQQLVMRYGAKDWIRISQLMITRNPRQCRERWNNYINPALRTDPWSPEEDMLLDQKYAEYGPKWNKISKFLKNRSDNNIRNRWMMIARHRAKHQKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords MYB24
publication title NMR structural analysis of DNA recognition by a novel Myb1 DNA-binding domain in the protozoan parasite Trichomonas vaginalis.
pubmed doi rcsb
source organism Trichomonas vaginalis
total genus 29
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13921 Myb_DNA-bind_6 Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2kdzA01
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2kdzA02
5K7ZA 3RZDJ 5E3NA 1BW6A 3RZOJ 2FJ1A 4IHWA 1JKPC 1GVDA 4IEJA 1LE8B 2TRTA 2XGEA 5F04A 5GPCA 4A3EJ 3BQYA 2MGQA 3BR0A 1U78A 3VPRA 4M3DA 1ZR2A 3FIWA 2NVYJ 3HOXJ 1ITYA 1DU0A 2KDZA 2HOTA 4C3JJ 3TW7A 4DZJA 1NK3P 1FIAA 4BY1J 5DS9A 2DA4A 1XG1A 1LE8A 1FEXA 3A01B 2LD5A 2VKVA 5K7FA 1OJLA 1IC8A 1MSFC 3GTLJ 3GBGA 1ETVA 4UUTA 1JJ8C 1ZKGA 4MIMA 2DMNA 3M3YJ 1HOMA 2EZHA 2I10A 1GV5A 4D5FA 4L5EA 2DMPA 4D7MA 5F27A 2WAQN 3A01A 3S16J 4BBSJ 4M3BA 5GPAA 2DA2A 4BBRJ 4FE4A 3QQAA 3C2BA 2ME6A 1D5YA 2ID6A 2HI3A 1U8BA 4XRMA 1ORKA 1RPWA 3BR5A 3G1LA 5F0HA 3S14J 4A3KJ 3BQZA 3RQIA 3HOYJ 2AHQA 2LK2A 4JX4A 4LOCA 5DTDA 5M3MJ 3O8GA 2DMQA 4S0HB 5C4XJ 1IJWC 2VKEA 2Y9YA 4X6AJ 4A3CJ 1MBJA 3SDGA 4BXXJ 1UHSA 4M6VA 1MSEC 1SFOJ 3BTJA 3ZQLA 2MG4A 2M9HA 2K9NA 2MSYA 3PO2J 4AC0A 3K7AJ 2M8GX 2O9LA 4IHVA 3IH2A 2L7ZA 2H8RA 3WHBA 1WPKA 2COBA 5IOZA 1I3QJ 3ZQFA 3LOCA 4B1RA 5E3LA 1MH4A 3TP3A 2CQQA 2WB1N 1RETA 2E19A 2X9DA 1HLVA 2QF7A 3MKLA 1OFCX 2PMZN 3BTIA 4CYCB 2VPRA 2DMTA 1IV6A 1JKQC 3K2AA 3QPLA 1UMQA 2XPVA 1WH5A 1GUUA 2NVQJ 4G12A 1JTYA 2YUSA 2EZKA 1PUFB 4AYBN 4DW6A 3D1NI 5FLMJ 5M5YJ 3TEDA 2ELKA 3BG3A 4W97A 4CYCA 1ETKA 1ETOA 2FQ4A 3CMYA 1WCMJ 3JRIA 1OCTC 1JKOC 1ZTRA 3HOWJ 5EZGA 3S1NJ 1JUMA 1WH7A 2XSDC 3LSRA 2QCOA 4A3IJ 2X6OA 3S2HJ 4DYQA 4V2GA 1VNDA 1VI0A 2W48A 4JP0A 4A3JJ 2M0CA 3BG5A 1GV2A 1FIPA 3HDDA 2Y9ZA 2K9QA 2L9RA 4QSHA 1W0TA 3Q0VA 2LY9A 3ZQCA 5IYBJ 3ZQHA 3FK6A 3W6VA 1MNMC 2Y2ZA 1H8AC 3GTQJ 3DCFA 2ECCA 1WI3A 3SJMA 1LFBA 1IG7A 4V2FA 5FKMA 5EZHA 4Y7NJ 2AO9A 1YRNB 3L1PA 3JRDA 1RESA 5IP7J 1TWCJ 1ETXA 5J3LA 4FISA 4NDLA 4XIDA 1ZK8A 2DA3A 2XGCA 5F08A 3A03A 4FCYA 1YRNA 2CJJA 3HM5A 1B72B 1RR7A 4XICA 1B8IB 1T56A 2NS8A 3B6CA 1HDPA 5J1UA 1F36A 2DTZA 1AU7A 3BTLA 1HCRA 5C3EJ 1K83J 1JT0A 2ID3A 2LKXA 2RAEA 4BKXA 2NVXJ 2JMWA 2XB5A 4QTRA 1TWAJ 2LLKA 1VF9A 2EZIA 4EEFG 3HBLA 1X2NA 3DEWA 2WV1A 1B72A 1B8IA 3LSJA 3ZOBA 3HB9A 2IBDA 4Y52J 4QIWN 3E7LA 2VUMJ 5HODA 2JWTA 1A6IA 5EDNA 1QRYA 1FTTA 3NARA 1S7EA 4B4CA 2L7MP 2DA6A 2R7ZJ 1ETYA 5F0CA 1WGXA 1Z77A 2YS9A 2FX0A 4C3HJ 4X1EA 5M5WJ 5F1JA 2XRLA 1LFUP 1Z0XA 1ENHA 1NK2P 1R9TJ 2JA5J 3RKQA 4MLOA 3FK7A 3ZQGA 4XRSA 4M3GA 2O7OA 2H1KA 1JKRC 2E2HJ 1XS9A 3HOUJ 5EG0A 2GM4A 2NVTJ 1VFCA 4J19A 3S1RJ 1ETQA 3S1QJ 1P7IA 2JJ7A 4ABZA 3BR6A 2CUEA 2R5ZB 2YU9J 4GFBA 3GTPJ 2JK3A 5EF6A 1AKHB 3LNQA 5E3MA 1F43A 3CCYA 1ZGWA 3TP0A 3A02A 5M5XJ 5FKLA 4IHYA 2R5YB 4RDUA 4M3FA 1U9NA 1K61A 1MH3A 4AUXA 2DJNA 1P7JA 3PM1A 4D7NA 3LSPA 1NTCA 2R5ZA 3OIOA 2K40A 3JRCA 4I6ZA 3HGYA 4A3GJ 3GTJJ 3UKGA 1AKHA 2G0EA 1IDYA 2LFBA 3FKIJ 1A5JA 1W0UA 2HOAA 4MFEA 2E2IJ 1RKWA 3B6AA 5FKNA 2R5YA 5M3FJ 5IOYA 5FJ8J 5FLVA 1BL0A 4UUSB 5IP6A 2B63J 2JA6J 1ETWA 1QPIA 1JJ6C 1MBFA 2DA5A 1Y1VJ 3SFIA 1ZQ3P 1TWHJ 4FTHA 3CDLA 5FKKA 2DMUA 2R93J 4UUSA 1T33A 2EQRA 2Y30A 1RKTA 5JLWA 2JA7J 1BJZA 1IDZA 5F0FA 1JGGA 2LR8A 5EYRA 5J1YA 4A69C 3BTCA 1I6HJ 2LTPA 3BR2A 4A3BJ 3WHCA 2K9SA 2Y0SN 3JR9A 1GT0C 4W1UA 4DZPA 3S15J 3BT9A 1FJLA 4XRSG 3MVPA 2HXOA 3CQZJ 1JUSA 3OSGA 2XGDA 2JA8J 3I4MJ 2TCTA 4DYRA 1OCPA 5IPAA 1HDDC 1MBHA 2EBIA 1JUPA 3HOVJ 2EH3A 5BNGA 5E3OA 1TWGJ 1SANA 1JT6A 3S2DJ 3MN2A 3H3VK 3GTOJ 2XPUA 1DU6A 3Q3SA 2D5VA 2Y31A 3O8HA 4XK4A 4DYCA 5JLXA 5EEAA 4RBOA 3PO3J 2R0QC 1IRZA 2HXIA 5C4JJ 2CU7A 2E1OA 3IH3A 1GDTA 3JRGA 4C2MJ 2XB0X 5EG0B 1POGA 2ECBA 2E2JJ 1ZR4A 2IEKA 2MW8A 2XPWA 4B3AA 2KT0A 3BG9A 2CUFA 4A93J 1HF0A 2IAIA 3IH4A 2NOGA 3Q0UA 2EZLA 2HOSA 2JN6A 1X58A 2HDDA 2NS7A 2N8GA 2HQ5A 1EF4A 1QVTA 1H88C 5EGOB 4A3LJ 4MO7A 1BW5A 2ME0A 2CQXA 3OOUA 3JRBA 2M34A 1QVUA 3GTKJ 1G2HA 3H0GJ 3FISA 1MBEA 5GP9A 3BR3A 1JTXA 3G1OA 2L0KA 2M2EA 4HNVA 3S17J 5J1RA 5EGOA 3ZQIA 5C44J 1AHDP 3GTGJ 2VI6A 1CQTA 3JRAA 3IV5A 3OSFA 2LP0A 3TW6A 3LSGA 1MBKA 1X2MA 4A3MJ 4A3FJ 3Q0WA 2ZB9A 5IYDJ 2DA1A 2DN0A 1Q1VA 2GBYA 1APLC 3F0CA 1O4XA 2DA7A 3JRFA 2GLOA 2FD5A 1MBGA 4BY7J 4C3IJ 4D5CA 5FKOA 3HOZJ 1FTZA 3HEFA 3GTMJ 1BA5A 1U9OA 4JYKA 3HKZN 1IGNA 3BR1A 3I4NJ 1E3OC 4FE7A 4A3DJ 4JX6A 3HGGA 1XC5A 5K7HA 9ANTA 2P81A 2HYJA 1Y1WJ 1UG2A 2O8KA 2LVSA 1IUFA 4M3EA 3NAUA 3JREA 3QPSA 2R92J 1I50J 5IYCJ 5IP9J 3S1MJ 2OPTA 1PUFA 3JRHA 2OF7A 3M4OJ 1H89C 4MFDA 2L7FP 2CRGA 1TC3C 4I76A 4IHXA 4JX5A 3G1MA 2X48A 1TWFJ
chains in the Genus database with same CATH superfamily
2Z5UA 1X4OA 3L2CA 1VQ8I 4AYBA 4ZDLA 2VONA 4XLNF 5E3NA 2FJ1A 4M71A 4IHWA 1GVDA 4IEJA 2PN6A 3SYTA 3U21A 3CZ6A 2KKOA 3F8NA 1T0FC 2VIXA 5F04A 3BDDA 2NS0A 4PJJA 3CDIA 3CJTB 2MGQA 1NG7A 3FXKA 4ZDPA 1U78A 4M3DA 2F5VA 3FIWA 3HOXJ 2DXIA 3O3KA 2JUCA 2K86A 3HOTA 2NNNA 1IRXA 4ON0A 1X1DA 1L0OC 2DQLA 4HNTA 4F92B 3CLOA 3GO5A 1DQUA 4U7BA 2OBPA 4BY1J 5ICGA 3H5NA 2DA4A 3B02A 3K6GA 1IN4A 3A01B 1RRJA 5K7FA 2M30A 1SD6A 6PAXA 3GLLA 3K4MA 1IN5A 5AIQA 5CQEA 3GTLJ 3QPHA 4LFUA 4HX4A 1JJ8C 2VB6A 3H35A 1UHWA 3HPGA 1ZKGA 4LK0F 4PK4A 2DMNA 1LPQA 1S9HA 3W3CA 2EZHA 3ZGKA 2F6CA 1T2KA 4XN0A 1OYIA 2DMPA 4EGZA 4QWQA 4LMYA 5F27A 2E34A 2WAQN 2ISYA 3KEQA 4EQQA 4XSZF 5LHIA 1YYVA 1O57A 4M3BA 4CA0A 2P7VB 1E3HA 2QSFX 3LA3A 5JFRA 4FE4A 2RDPA 2RV8A 3S3NA 4IXAA 2A6TA 3E6MA 3TO9A 1D5YA 4KNYA 3E5QA 5D8LB 4HSTA 4KIGA 4KMUX 2Y75A 2P7CB 2F5FA 3K9TA 5DDGA 3ZMTA 3QOPA 1USSA 5HS8A 1RIOH 2CG4A 3R4KA 4L9VA 3BQZA 5GTIC 3HOYJ 2AHQA 1U6GA 1X1CA 2LK2A 3HUGA 2KJBA 2WAQA 2P4WA 3J80Z 1ZARA 4NQWB 2LRDA 1MW7A 3DEEA 5CKTA 3WGIA 4ZC3A 1IJWC 2KMUA 1XTAA 2K3FA 2GAUA 2QBYA 1EJ9A 5K5QA 3TGNA 2HZTA 1YFHA 1Y6IA 2L4MA 2UZKA 1J9IA 5FLXZ 2XV4S 2M1BA 4AC0A 3K7AJ 3V8LA 4BJTA 2O9LA 4IHSA 2ZJRF 2H8RA 3WE2A 3LOCA 3DXJF 2M4KA 5E79C 5E3LA 4A6DA 1RNLA 4CDGA 3TP3A 2CQQA 4BJ6C 5D8KB 2CV2A 5L3EA 4L5IA 5BOXA 4HLYA 3BTIA 1F9NA 1VQ6I 4CYCB 5E8IA 2OCCH 1VQNI 2ZBKA 1JKQC 2LF7A 1UMQA 2EA4A 5GTHC 1GUUA 2NVQJ 3EETA 4EV0A 4E7IA 1WZ2A 2KIMA 2DK5A 2AS5F 1IN6A 2EK5A 1JHHA 4IVNA 2ELKA 2ZMEB 3TEDA 1ETKA 3IP4B 1S7AA 1ETOA 4S05A 1WCMJ 2Z1DA 3ZN0A 1XSDA 3H9GA 3JRIA 2LKSA 3KYDB 3PUBA 1MMSA 1P6RA 1G3YA 1CF7B 3BLYA 5EZGA 1JUMA 2K9LA 4KIFA 3WG9A 3CUOA 1USTA 4RAFA 2XSDC 4PFPA 2GXBA 3LSRA 3PNYA 2QCOA 5LEKA 4A3IJ 1N77A 1XCVA 4FQGA 4V2GA 1T6SA 3F72A 4JP0A 4A3JJ 2M0CA 1ZG3A 1OKRA 2I5UA 2V7FA 3HDDA 3W6KB 5KAFC 4OOIA 1Y0UA 4BHCA 1W0TA 1PP7U 5FRNA 1V4RA 5DCFA 2E60A 2HGCA 3CTAA 1MNMC 3P9CA 4PCQA 1G59A 1LFBA 1IG7A 3G2BA 1ZAOA 1D5VA 3WODF 1VQ7I 1DPRA 3GYHX 4XORA 1WKMA 3CJQB 3L1PA 1RESA 4L18B 3H3UA 2CUJA 2JSPA 4FISA 4PUSA 1ZK8A 1VZ0A 4FX0A 2DA3A 2EFWA 4K2EA 5E18F 2IW5A 2ZSHB 3S93A 3A03A 2L01A 2X1DA 2G7HA 4FCYA 1BR2A 2RKHA 1P9QC 4WF2A 4E6KG 1T56A 1Y56A 1N75A 1HCRA 3BTLA 5C3EJ 2VC0A 3KEOA 2W1OA 3GF2A 2ID3A 4XLPF 3HUGB 3BWGA 4EMSA 1VQMI 1A6QA 1E17A 5DCMB 3BP8A 1TWAJ 2LYCA 1OLTA 3HBLA 1WI9A 4OIQF 2PQ8A 3VWBA 1IN8A 2IBDA 4E7JA 2EILH 4QIWN 2VUMJ 1O7FA 2JWTA 2WAEA 4XONA 2EJRA 1QRYA 4GO1A 4XOPA 1BN5A 5JR3A 2EB7A 2L7MP 3R0AA 5HOOA 2RQQA 1QZZA 3I4PA 1YS7A 4IZZA 4X1EA 3R6SA 1U5TA 2QKLB 1ENHA 2DT6A 2A5WA 4HV6A 2XIGA 4YRVA 3EDPA 3FK7A 3DWLE 3QP6A 1Z9CA 2RQPA 2E2HJ 1XS9A 2DQRA 1S72I 2HPMA 2KZGA 3S3OA 5JHUA 2F5CA 5HNFA 2JJ7A 1IXSB 3BR6A 3PNTA 4GFBA 2QYOA 4E7LA 1AKHB 5K1YA 1GXPA 4XRFA 2NNYA 1ZGWA 2BOLA 1ODDA 3LWFA 1FC3A 1SMYF 4RDUA 3ZMVA 2DOEA 1K61A 3OS2A 4NHJA 1BR4A 3PM1A 5FD5A 1R58A 2JTVA 2R5ZA 5CVIA 2A6HF 2MA3A 3F6OA 1XX5A 4HYEA 4D9JA 3OYNA 4IOCF 5L3DA 2LFBA 1IDYA 3FKIJ 3IC7A 4KICA 2O61A 2HOAA 3BPXA 3AG1H 1Z91A 4LLGF 3T0YA 3WE3A 1RKWA 2ICWG 4RB0A 5FKNA 1KQ9A 4AVPA 4BQQA 2O03A 5IOYA 3N4MA 2WWYA 2VXDA 2Z3YA 3VOEA 4B43A 3J80K 3PQKA 3C2HA 3HC7A 3R0JA 2L9SA 3ZMUA 4Q4ZF 1ZQ3P 1S29A 2A05A 2CO5A 3CO6C 1Z21A 3CC7I 2DMUA 4DIQA 4EJWA 4RGUA 1T33A 2DBBA 3ML6A 3FHZA 1LNWA 2ZFUA 4Z2YA 1RKTA 2FOKA 5LHHA 3GZ5A 1MDMB 3JSPA 2JA7J 1RUNA 3J81K 2IS6A 2FMLA 3HHGA 4PJMA 3BZ6A 2VXZA 4ENNA 2X4HA 3MKZA 2DODA 2VC1A 2ZC2A 3S3MA 4A5NA 3BTCA 2P6SA 1I6HJ 2LC2A 2DT5A 2ADUA 3P5JA 3BR2A 3JR9A 1HA8A 3BT9A 2H6CA 3G4SI 2XF5A 5DV5A 1YOVB 2DAOA 2V26A 5B1AH 1MNEA 3PFYA 3I0TA 1HW5A 3NWSA 2KLOA 1FY7A 1OCPA 1YW9A 1MBHA 2PEXA 2X51A 3HOVJ 2AQEA 1X1PA 3HIFA 5E3OA 2JT1A 1TWGJ 4O3MA 3MN2A 4G6DA 4IPAA 2HKOA 2Y31A 1YJWI 4AIHA 5JLXA 3SQNA 3CMEI 1DUXC 5D5UB 1TQMA 4MGRA 1IRZA 5ILVA 4KIBA 3LSKA 2VLAA 1F5TA 2L7KA 1PUEE 2CGPA 2CYYA 4Y4RA 2NVUB 2X1CA 4BHBA 1GDTA 2PG4A 1YHQI 3N97A 1PP8F 2FEZA 2XB0X 4CCOA 4NB5A 3D5LA 1SEUA 3FXMA 1FBSA 2BW3B 2ECBA 2E2JJ 2IEKA 1MGTA 3ERMA 3BG9A 1BI0A 2FBKA 3ZP5A 2V9KA 2GXGA 3Q0UA 1NH3A 2HDDA 2PLYA 2N8GA 2HU9A 3K4LA 2KIFA 3TQNA 4BAYA 4H0EA 4A3LJ 1LDDA 2W82A 4KN4X 1BW5A 1HKQA 2DCEA 5CVVA 4Z6YA 3GTKJ 1MJBA 1W1WE 3FISA 2GXAA 2M4GA 2ISZA 3I58A 4IKFA 2YSRA 1LDJA 4RGRA 2KFDA 5GP9A 2R7RA 3BR3A 1JTXA 4KT6A 5J1RA 2CWEA 1YS6A 2FE3A 5FD6A 3NEUA 3DLLF 1CQTA 2D1VA 2EFQA 4LJZF 4IQ4A 2RNGA 1Y8RB 2XROA 5HLGA 3RI4A 1ZGAA 4U0YA 1WSUA 1YQAA 1X1BA 3BG6A 2Q0OA 1YW8A 5E1ZB 2DN0A 1XN7A 1X3ZB 2EA2A 2DA7A 1O4XA 2R7WA 2JPCA 2JVHA 1MBGA 4BE1A 3CJRB 3AL0B 2VE9A 4HQMA 3GTMJ 2MYSA 2AXTC 1CGPA 2JRTA 3DU6A 4JYKA 3HKZN 5LRRA 3BR1A 2DFFA 2KRHA 3E6DA 3V42A 4XKWA 3HGGA 1XC5A 5K7HA 2DPDA 2XAUA 3OR1C 3K4JA 1Y1WJ 1UG2A 3J7ZI 3NAUA 1TQPA 1I50J 2IP2A 2Z2SB 2KHMA 2QQBA 2XAHA 3L09A 1PUFA 3JRHA 2STWA 1F4KA 1H0MA 1LVAA 2OF7A 3M4OJ 1H89C 1U2WA 1FP1D 3K70C 1TC3C 4JX5A 3HKZA 2EV0A 5K7ZA 4RS8A 2O3FA 3AAFA 1BW6A 3RZOJ 1JKPC 1K79A 1LE8B 3V8KA 1U8RA 2M7AA 4IRGA 2TRTA 5CVUA 3C3WA 3TL4X 4OINF 1ZRCA 1O3QA 2QSHX 3M8FA 1QNTA 2IJLA 4FASD 1FWZA 1G4DA 4WXCA 4A12A 3IAM2 4P9FA 4DZJA 1OISA 4KUMA 3TO6A 5DS9A 1U5TC 1Z1DA 4B48A 2VKVA 2LD5A 1IV8A 2WAFA 3GBGA 4YFNF 4UUTA 3TKYA 5ERIA 3GFLA 4HPQA 4D5FA 1XD7A 2MABA 2BBYA 1Z05A 4M9XA 4HG2A 4RAZA 1J59A 3A01A 3S16J 4BBSJ 1XPXA 1QHHD 5GPAA 2WA0A 2Z99A 1ZG5A 3L2VA 2DI3A 4UHTA 3VEPA 2LMDA 2IS1A 1TBXA 2ME6A 1SC7A 1W5TA 1Z67A 1U8BA 3I9V2 3G1LA 1RPWA 4HX8A 2VKDA 4BXFA 2IGKA 4D0PA 5K5RA 1FYMA 2JSCA 5A2QZ 4A3KJ 2ESNA 3SXYA 1TNSA 1REPC 2VBWA 3PQJA 4GGGA 3TOAA 2R7TA 5DTDA 3PNVA 1MKMA 4EJOA 4XOTA 2EV5A 3OYDA 2LSOA 2E1CA 1QQIA 2K4BA 2DMQA 3K1MA 1MZBA 4DBRA 3W2VA 4G7ZF 4RLFA 3J7AY 1LVKA 4A3CJ 3SDGA 1UHSA 3QYBA 3FHNA 1MSEC 1KGSA 4HW0A 2MG4A 2B0LA 5FB2A 2M9HA 1BI3A 2K9NA 2K5CA 4NQWA 2MSYA 1QPMA 1XMKA 2M8GX 4IHVA 2ZJPF 2L7ZA 4IO9F 2COBA 3LSMA 4B1RA 1Y8QB 3I5UA 1YTYA 1KU3A 3KP6A 3KE2A 2X9DA 3HHHA 2K7LA 2QF7A 3M7GA 2X6YA 1U3EM 5DM7F 4XBFA 1OFCX 3BZCA 4NC8A 1MNDA 1A04A 2VPRA 3OV8A 1IV6A 4AM3A 4LB5A 1T39A 4PSWA 3K0LA 2MLGA 3K2AA 3GLXA 3QPLA 1C0WA 4ASNA 3MWMA 4X0GA 3L00A 4G12A 2M3AA 1ZYRF 1JTYA 5F6FA 2EZKA 1R4MB 1PUFB 4UNOA 4AYBN 2E5NA 2BVLA 3D1NI 1BBYA 4ZYEA 1G3SA 4RB2C 4W97A 4CYCA 3JW4A 1XGSA 4MTDA 4HZFA 4BUPA 4HX7A 2HTJA 4PGGA 2DPUA 2VQHA 1TT0A 2E1MC 1R71A 1YLFA 1VQLI 1GHCA 2ETHA 2E7WA 2OCEA 1ZGJA 3H5AA 3CCUI 2ZMEA 2R7UA 1R49A 1WQ2A 2HKXA 1YIOA 1VI0A 3FX3A 1WJAA 4UXNA 3ZMSA 1FIPA 4M72A 2M87A 3E6CC 2VOPA 4ZDOA 1MMAA 2L9RA 1CF7A 2WY7Q 3VYTB 3BJOA 4Y3OA 2XAJA 5ICCA 3KLNA 2LY9A 1R5ID 3EQLF 2A3SA 3W6VA 2GOXB 3M1CA 3GTQJ 1WI3A 3RPUA 2L3DA 4E7SA 4HNUA 3F8BA 2LG4A 5EZHA 4Y7NJ 1IF1A 1GVJA 2XKPA 4Q47A 2L02A 3ECHA 3I71A 4C2UA 4I09A 5J3LA 1SFKA 2I8DA 3OYGA 4I0BA 3QRFF 2F4OB 1IXCA 3QYFA 1EA3A 5KVRA 2W7NA 1SFXA 5LD2C 2LOOA 3FF5A 3KX2A 4EATA 3C7JA 2QQ8A 3MZ8A 1WHUA 2P5KA 3HM5A 1D1AA 1B72B 5HLIA 3VODA 2HYFA 1QZEA 2EV6A 1LUJB 1D0ZA 5J1UA 4CUGA 3DTEA 4I01A 2CQKA 3G6EI 2NVXJ 4L9TA 3KP5A 2L54A 5K5OA 1VF9A 2Y0SA 2NAZA 3I53A 3DEWA 1BIBA 3LSJA 1QU3A 2EIJH 4H4KC 5DD8A 1BC8C 3E7LA 5E1WA 2LBFB 3GFIA 2BGCA 4OWRB 2BY0A 1J09A 3NARA 1D1CA 1W5SA 5DCMA 4CZZA 2JA2A 4B4CA 2DA6A 5TRDA 1PYVA 2YS9A 4NNJA 2AXLA 1IUYA 5M5WJ 4HF2A 5F1JA 1Z0XA 2V1XA 1SD7A 3NRVA 4C2TA 3OL4A 3CF5F 5LHGA 4RB1A 3ZQGA 2EWNA 4XRSA 2HVRA 4HDVA 2PX9A 3MEXA 5EG0A 2GM4A 3H3ZA 1MJAA 3J81Z 2NVTJ 4RAGA 1VFCA 1IZ1A 4J19A 3EUHA 1M1EB 1V3FA 1UJ8A 5TJJA 4WX9A 1AWCA 2CUEA 2NRAC 2YU9J 3GTPJ 4BQAA 2JK3A 2OJED 1K4SA 4E7KA 1T8IA 1F43A 1Z6RA 2ZJ2A 3CCYA 3OWTA 2FBHA 3V7RA 5FO5A 3TP0A 5FKLA 1S3JA 4IHYA 4OAYA 3WTSC 2BVMA 2V4JC 1D0XA 1P7JA 1S8NA 1WJDA 5KK1A 2VL8A 2RC4A 2K40A 3JRCA 1HXDA 3ELKA 1K78A 1AKHA 1P4WA 1RZ4A 3W2WA 5DM6F 1SVLA 2O6GE 3FZVA 4MEYF 5A2QK 1FOXA 1TQIA 3MMYB 3WG7H 2DDAA 1OCZH 2Q1ZB 2XAGA 4BEHB 4RMNA 4F52A 4D1QA 3HTSB 4B3XA 1UELB 2BXYA 4UUSB 4GDFA 3TBIA 1ETWA 2VJ5A 4RLQA 3CLQA 2VKHA 4LG0B 1MBFA 4XLFA 1ULYA 4P9UA 4B8XA 5FFXA 5GADJ 2OC6A 1OCCH 1TWHJ 3IUOA 3M8EA 2ZXIA 5FKKA 1LB2A 2HZDA 1G6NA 2VBXA 3PIPF 2R7XA 1S6LA 2CFXA 3CCMI 5CVRA 2HEOA 3OL3A 3K4NA 1BJZA 2DO7A 5EJCA 1IDZA 5F0FA 2A07F 4DBQA 1JGGA 2LR8A 4OAZA 2XUBA 3EUAA 4IRHA 2CMPA 4ENJA 2MC4A 5J1YA 4WK8F 5B3SH 4WWCA 4A69C 4YIFA 3CCRI 4G8XA 3WHCA 1EV7A 1MDMA 4QPQA 5BMZA 2GA1A 4PZJA 3MVPA 4F3QA 2XASA 3L9FA 4B47A 1JUSA 3OSGA 3I4MJ 4CCKA 3GX4X 4G6TB 4DYRA 5FRMA 1WRJA 1R00A 2OUMA 1E2XA 2ZNYA 2EBIA 4A2UA 1JUPA 1VTNC 3SDBA 2GA2A 4F93B 3MKYB 1YO5C 2UUZA 1OPCA 4F55A 2EH3A 2W24A 3U1KA 3S2DJ 3H3VK 2DT7B 1DU6A 2MH2A 1R1UA 4YFKF 4XK4A 1BIAA 1J75A 3KP3A 1V5EA 2E36A 3MKWB 2R0QC 4ZTFA 5CVJA 2GIVA 4GYIA 3RPQA 1QZYA 5C4JJ 4LIVA 1NG6A 3OYKA 2OTJI 2E1OA 2HS5A 3H92A 3ISPA 4PSXA 1U0JA 4BL0B 4ESFA 5BQTA 3WU1B 2ESHA 3MCZA 3FBIB 4C2MJ 3LAJA 5EG0B 1LKXA 4L9JA 3GMEA 4UVCA 3PL8A 2P6TA 5TISC 3CCEI 1ZR4A 1R5HA 2MW8A 2BY3A 1J2XA 2GIZA 4I99C 2MD0A 3OYMA 2EZLA 2JN6A 4EM2A 1X58A 3K4KA 2NS7A 3KYLA 4XNFA 3GZ6A 5EGOB 4KFCA 2BW3A 3DFGA 3DQVC 3DBRB 4AIDA 3F8FA 2CQXA 1O3RA 4HEA2 2IS4A 3KCCA 2VBZA 3OOUA 3JRBA 5ILSA 1K78B 2VOOA 3H0GJ 1YITI 1XDSA 2H09A 2DK8A 2L0KA 3ZQIA 1AHDP 2FNAA 2VI6A 2W57A 2M7BA 4XLEA 1MMNA 3I55I 2XDVA 2R7FA 2F4MB 2ACJA 1MD0A 1QHGA 3TW6A 1MBKA 1X2MA 3AG4H 4LLLA 4YIRX 4A3FJ 3J7YJ 3MZYA 2HYGD 3HSEA 3MQ0A 3VFZA 5IYDJ 2DDBA 2FF4A 2IXSA 2GBYA 3F0CA 2P5LC 3WU0A 4AU7A 4R79A 2GLOA 1YG2A 3SEZA 1TP4A 2ELHA 3OS1A 3L2WA 2ZSIB 4C3IJ 4D5CA 5LRSA 4UV9A 2KIQA 1TL8A 1V5GA 3BJ6A 1FSEA 3HEFA 3H5RA 5DUKA 1LEBA 5JVGF 1IGNA 2ZNZA 3LQQA 5CJ9A 1E3OC 4HA8A 4FE7A 1TZLA 3HRSA 9ANTA 5HLTA 1I1GA 1ZRDA 2DLLA 4KITB 4ENMA 5H20A 2EFOA 3JREA 2PMZA 3QPSA 2R92J 2KIUA 3BC8A 5IYCJ 1PVEA 3HG9A 4M73A 2VJIA 4FETA 3AG3H 5HDGA 1BI1A 2HQNA 2UXNA 5J6XA 3D5SC 2Q2EB 4Y17A 2L7FP 2CRGA 3BPVA 2R7SA 2R3SA 3E0JB 3GXOA 5CYVA 3V7CA 1U9NA 4KN7X 1FLIA 2ZO4A 5AIPA 1D3YA 1WJ5A 3RZDJ 2BYVE 2KL4A 3SZGA 1ZLJA 1AOYA 2A6EF 4KA4A 4N4NB 5L3BA 3CCLI 1WVRA 5GPCA 5EEGA 3BQYA 2F48A 3BR0A 4XLAA 5KHDA 3VPRA 1XGNA 3F8MA 3RCOA 3LA2A 2NVYJ 3BZKA 3H9JA 1KA8A 1SVMA 2O0YA 4C3JJ 3TW7A 1NK3P 2IA2A 5DEQA 1FBQA 1LE8A 1KQ8A 1A35A 2KDOA 1D8KA 2NOJB 3CDHA 1OJLA 2VJJA 1MSFC 3S8PA 3EYYA 4CCMA 1JGSA 2O5RA 1B6AA 2RGVA 1ZHFA 3GZNB 1O3TA 4MIMA 1RR8C 4II2A 1W36D 1HOMA 2I10A 5CQGA 2PI0A 1GV5A 3EUHC 3WTTC 4D7MA 4II3A 1X3WB 3CC4I 3WTZA 2G7UA 1WJCA 3A2KA 4A0XA 3QODA 4PJ0C 3M9AA 4CSWA 2IT0A 4BBRJ 1PDNC 5H6QA 4J00A 2VASA 5J4YA 4IX7A 1YX5A 3C2BA 3LL7A 5FGMA 4XKBA 2LY1A 5HS7A 4XRMA 1ORKA 2ZXHA 3BR5A 2PJRB 5J8FA 3V8JA 3E97A 3ZR8X 5F0HA 3S14J 2EFPA 3LFKA 4KJZA 5EEHA 4ESBA 1T0FA 2P0WA 3AFHA 5JHFA 4P96A 2QEXI 4CCJA 4FHTA 2ZXWH 3O8GA 3GFJA 2VQGA 2V6EA 5E17F 3C1DA 4JQFA 5C4XJ 2YU3A 2QGUA 2VKEA 2Y9YA 2MFZA 1MBJA 4BXXJ 4M6VA 3LAPA 3FXJA 1L3LA 1UG0A 1SFEA 2GQQA 1A31A 3E6BA 4M74A 2H8WA 2OZUA 1SFOJ 4IJAA 1IO2A 1DGWY 5B1BH 2FBIA 3CCJI 2QQAA 3DEUA 2UWMA 3CESA 3PO2J 4OIPF 3OYFA 3CC2I 1UFMA 1WPKA 5D5VB 1B9NA 2BHYA 2L4AA 3DKYA 2KZVA 4XQFA 1SFUA 1MH4A 2XF6A 1D8JA 1MMDA 4U7DA 1XGOA 2FXAA 2H27A 3E5UA 1HLVA 3MKLA 3WGGA 1W7PD 3REOA 4XL9A 4LGWA 4XMYA 3J7AO 2KJCA 5E8GA 4PFOA 5TGTA 1VQ5I 2XPVA 4PJLA 1O3SA 1WH5A 2WV0A 2Z33A 4AWXB 3L2UA 4IOAF 2YUSA 3OMYA 3WTXC 1WJEA 4JK1X 3P9KA 3E1SA 2GWRA 5FLMJ 4E7ZA 5M5YJ 2HDCA 3BG3A 1R4NB 4HF0A 2DW4A 1FP2A 2GZWA 2FQ4A 5D6EA 1VQPI 3Q5FA 1XSXA 2RNJA 3K4CA 3FMSA 1OCTC 1ZN2A 1BM9A 1LDKB 1BR1A 1JI8A 4UB8C 1HW1A 4UUVA 5D5WB 3L2RA 2J5PA 2Y48A 4I02A 1X4PA 3RIRA 2JVGA 2XKOA 2X6OA 4RM2A 4DYQA 1UZCA 2CS3A 3BG7A 3LSHA 4XN3A 1LEAA 1EH8A 2W48A 4HBLA 4M9ZA 5LFAA 3BG5A 3E5XA 2FSWA 1XMAA 3CUQB 4N9HA 3VDXA 2Y9ZA 3LMMA 2ZXJA 3P9IA 2RN7A 2R7QA 1SAUA 3FK6A 3SHFA 3ZQHA 2Y2ZA 1H8AC 2ECCA 3SJMA 3O6BB 3ZPLA 4AIJA 4Q5SF 1OR7A 3LFUA 1FOWA 1B1BA 2AO9A 4WXDA 1YRNB 3JRDA 4DQ2A 3V7SA 3GEZA 1ZELA 1DPUA 3DTKA 4JOMA 3U9GA 3B73A 4NDLA 2CW0F 1HBXG 2CQNA 2XGCA 5FFZA 2IA0A 1KU7A 5F08A 1DGRM 2E1NA 4L0ZB 1QO0D 4OIOF 2FNPA 3A0HC 2CJJA 1B8IB 2NS8A 3KP2A 4IQJA 1MMGA 5J8CA 1F36A 2Z16A 4J01A 3VYUB 1K83J 1OCOH 2PJPA 4LD5A 4O5VA 5GAGJ 4BKXA 2MD5A 3GCMA 3I59B 2JMWA 2XB5A 3TMOA 4NBQA 5B66C 2EZIA 3ABMH 2CW7A 2BXZA 4EEFG 1X2NA 1WFXA 4OU0A 2WV1A 1B72A 3ZOBA 2YPRA 3HL2A 3F23A 5AONA 3ABUA 3RYPA 4AIKA 4Y52J 3ERED 3RTRA 3GVAA 1FOYA 4BE0A 1G3WA 4CGZA 2DOFA 1IXRC 2H1LA 2F5DA 5EDNA 1FTTA 2DU9A 2PMUA 5J4VA 3DBHB 4QLCU 2L5QA 1FZPB 1R36A 3CJNA 2R7ZJ 1ETYA 4A6EA 2W25A 3MAJA 2X0LA 3RJPA 1WGXA 1Z77A 5HS9A 2FX0A 1FOKA 3QPTA 4C3HJ 1SMTA 2XRLA 3DKXA 4LITA 1NK2P 2LBFA 3S2WA 4M6XA 2JA5J 1W5CC 2YR2A 4IRIA 3TOBA 2QLZA 4MLOA 4M3GA 2O7OA 3OYIA 5J40A 1VQOI 4BQNA 2DYSH 1QBJA 3G71I 3HOUJ 5L3GA 4RA2A 5DD4A 3DKWA 2R7OA 4IHTA 3S1RJ 1ETQA 3AL0C 2K27A 4B09A 4I98B 1JXSA 3S1QJ 4EJTA 1IRGA 3NWTA 1P7IA 4BU2A 1MJ9A 4ZYHA 3RYRA 2V1NA 5LLQA 4I2OA 1Q1HA 3LNQA 5E3MA 2X6WA 1R23A 3CP8A 3A02A 5M5XJ 2HWVA 2R5YB 2LKPA 3G3ZA 3M8JA 2HR3A 3QU6A 2DJNA 4XKVA 4D7NA 2KISA 4NUBA 4UY8I 1NTCA 3BCAA 3OIOA 5CPRB 2XRNA 3HGYA 4A3GJ 3GFMA 4EVIA 1LFPA 3FKJA 1W0UA 1KZHA 2WC2A 2F2EA 1BI2A 4N0BA 2E2IJ 3B6AA 2HOEA 4EM1A 2UXXA 1R6RA 3IWZA 5M3FJ 1KONA 3JCUC 1OYWA 4HQEA 2HPIA 4MEXF 2JA6J 1QPIA 2W84A 3KFWX 1JJ6C 2KP6A 2RVCA 1OMIA 1HKTA 2D1HA 3SFIA 2YX7A 1XDUA 3GWZA 4CICA 4Y13A 3ZMZA 5KAIC 4EJUA 3CDLA 3GW2A 4AD9A 4BEHA 2LNBA 1KYWA 2YX4A 4GCVA 3TO7A 4DJAA 1QA6A 4UUSA 1XCBA 2AQFA 4O6JA 2LDUA 3K4BA 3L7WA 3A0BC 1I1SA 2Y30A 4LG0A 3S32A 3VYRB 5JLWA 4ENKA 2K02A 3JTGA 4OMZA 4IF4A 1J7KA 3FM5A 5EYRA 2XAFA 4MQVA 3D5RC 3QAHA 4L0YB 4HRIA 2R7VA 3IWFA 3NQOA 2V1UA 2LTPA 4YIIA 3CMAI 1GT0C 2Y0SN 4W1UA 1W7PB 4DZPA 1H9GA 3S15J 1GLNA 3ECOA 3IL2A 2BE5F 5JVTA 4XM3A 2HFHA 4YEJA 1Z7UA 4XKCA 2EINH 5IPAA 3BOQA 1BJAA 4S04A 1ZH5A 3OY9A 1K6YA 5BNGA 3ZRGA 5FROA 1SANA 3FBNB 3IHUA 1JT6A 2CQ7A 3QOEA 3K2ZA 5D4SA 4LK1F 2XPUA 2D5VA 4Y15A 3I56I 1HQCA 4RBOA 4CCNA 4CZCA 1N78A 1LJ9A 4U87A 2L2OA 2C6YA 2E5ZA 5ICEA 4KISA 2M0MA 5KNLA 1YIJI 2E71A 3K1NA 3JRGA 1JHFA 3DP7A 2FU4A 2K9MA 1HW2A 1WJFA 5H6RA 3Q9SA 1POGA 2DYRH 3HYIA 5F1RA 4ZJZA 3FM3A 2IVMA 2XPWA 1RUOA 4MHGA 2A69F 5DUIA 3BCBA 2CUFA 2MLKA 2V9PA 3DV8A 2XF7A 3CO7C 1HF0A 4A93J 4BQOA 3PUFA 1W36C 4ZZLA 2JUGA 1QVTA 3T8TA 3HTUA 1P4AA 3L2QA 3F3XA 2EPFA 2BZTA 2ME0A 3VSLA 1ZREA 3OOPA 3PFIA 2O8XA 1KYZA 5LGNA 2M34A 4ZH4F 1H9TA 3VYSB 1G2HA 1MBEA 2VODA 2V79A 2V9VA 3G1OA 1YE9A 2M2EA 4LB6B 5EGOA 1DDNA 5C44J 2QUFA 4PDKA 3GTGJ 4B44A 2OA4A 1RI7A 5D4RA 3IV5A 4BACA 3K1PA 3V4GA 2QVOA 2V6CA 3Q0WA 4CH7A 3MD2A 2VT2A 3JAMK 1LQ1A 1APLC 2K3PA 1XSVA 3ABKH 2A68F 2J5OA 3A1YA 1OR7C 1DP7P 2K4JA 2FD5A 2WADA 4F7ZA 3QWLA 5BS6A 3K70D 2IA1A 5FKOA 4XR6A 1U9OA 3LA7A 1VQKI 3N05A 1X1AA 2OU2A 3ZMDA 4A3DJ 1R5GA 3OYAA 1FMWA 3UNGC 1TNTA 2OV7A 3KIOA 1FMVA 4P55A 2P5VA 4M3EA 4YELA 1OQYA 2HQAA 2ZKZA 5IP9J 4I0AA 4P1WA 4YG2F 1E0EA 2QA4I 4MFDA 2VN2A 1G8XA 1X3UA 4I76A 3ULQB 3K69A 2LY2A 4G7OF 4ZZDA 3T8RA 2IGNA 3KP4A 4Q48A 4WXHA 3T1BA 2XGEA 2B7EA 5GAEJ 3CCQI 4A3EJ 2Q2EA 2D2WA 3WTVC 3PIOF 1ZR2A 1ITYA 3DTIA 3T5XA 1DU0A 2KDZA 2D45A 3IKTA 1I5ZA 1EH7A 2FMYA 4XLHA 1FIAA 3OYJA 3PJRA 2CFOA 2F5EA 3CF2A 1XB4A 1XG1A 1FEXA 4PGHA 1Y39A 4E7HA 3PSIA 1IC8A 2Q8KA 1ETVA 3ONQA 3ZQQA 3IRRA 3FXQA 4PJNA 4BS9A 2RREA 1TTYA 3AKZA 3M3YJ 5HVQC 3ZN1A 2HOTA 3OIQA 1FYKA 2L9VA 4L5EA 2BEOA 4R8HA 3ZCOA 2CW8A 1FSHA 2DA2A 3ASNH 3IKVA 3QQAA 4BDZA 1YX3A 4M9SA 1VQ4I 1XGMA 3OIPA 2JRMA 2ID6A 2MH9A 2HI3A 3DPUA 1UAAA 3FXUA 3HJEA 3SFZA 2E7XA 2QBYB 4KMFA 3RQIA 4G9YA 2DFEA 4JX4A 4LOCA 4RM3A 2VQLA 3GUDA 3FWEA 5H2FC 3FDYA 3I54A 5M3MJ 3F22A 3HXLA 4C9YA 2IPQX 2PJRA 4S0HB 1AA7A 4HF1A 4HV5A 2DFIA 3X2QH 4X6AJ 1P4XA 2ZMEC 3F6VA 3C18A 4EGYA 1QGPA 3BTJA 3HZJA 3ZQLA 4ZTJA 3MFKA 3RSNA 2F4IA 1Z3XA 3O2PE 4ZYGA 4DGWB 3IH2A 4V19K 1KU9A 3WHBA 5IOZA 4QPOA 5BPDA 1I3QJ 3ZQFA 1D0YA 5HDNA 2GOMA 2M45A 5IT3A 4BDYA 2WB1N 1RETA 2E19A 4CCLA 4U88A 1FT9A 2CH0A 3ZXSA 2PMZN 4MQ9F 4DNCA 1FBUA 1JE8A 4MNUA 2DMTA 1ERDA 1B59A 3ZQ7A 3KYCB 3R61A 3LQRA 3LSTA 2V1DA 2WTEA 2HNHA 3W2AA 4DW6A 3Q9VA 3DPTA 4CXFA 2XAQA 3HRTA 4JBAA 2WB1A 4BXUA 3CMYA 2JQ7A 2Y69H 1JKOC 1E3PA 1J0RA 1ZTRA 3WGHA 5L3FA 3HOWJ 4E70A 3S1NJ 2CV0A 1WH7A 1B9MA 2BHZA 2H6BA 2DJIA 1T08B 4G7HF 2OTLI 1IN7A 3FXLA 2VPLA 3F8CA 3S2HJ 3IAS2 1I6XA 4L5JA 1N25A 2BY2A 4NC6A 4CO8A 1VNDA 4BH9A 3DF8A 1V5FA 1GV2A 1RC9A 2K9QA 3OYEA 4QSHA 1HSJA 2G9WA 4OMYA 3DBLB 3Q0VA 3JSOA 4AVZA 2TDXA 5IT9Z 2OQGA 3ZQCA 5IYBJ 5FLXK 4ETSA 4KDPA 3DCFA 3EUKL 2HTSA 2OD5A 3R60A 1K7AA 1ZG1A 3EYIA 1ZRFA 1P92A 3RQ4A 4V2FA 2K85A 5FKMA 1HSTA 4BHPA 3M1EA 3CUQA 5DYMA 5IY5H 1P2FA 3KEYA 1T95A 4OIRF 4ZYDA 5IP7J 1Z3YA 2LREA 1TWCJ 3LSIA 1ETXA 2FUG2 3CMMA 4ZYAA 4UV8A 4XIDA 4BYYA 1K4TA 3ESWB 2W00A 4YFXF 1X19A 1UHMA 3CD6I 2COMA 1ON1A 5GAHJ 1YRNA 1Z6TA 4DOZA 1RR7A 4XICA 3B6CA 1SVOA 1HDPA 1UB9A 2QM3A 2DTZA 1AU7A 2STTA 4KYWA 3OR2C 2BV6A 2KQRA 3KZIC 4HLXA 3JTHA 4R1HA 1JT0A 3SZPA 1ACIA 2LKXA 2RAEA 1R7JA 4A5MA 3WTYC 1FX7A 4QTRA 2LLKA 5E1XA 2X85A 1B8IA 3OYCA 2X1EA 2XSJC 3BY6A 3VSKA 1TW2A 3HB9A 3ABLH 5CLSA 1U5TB 2ELJA 5D5XB 3WTWC 4BE2A 4EJVA 4XSXF 4A0YA 5HODA 1BC7C 4G6QA 4P5OA 1DP3A 3RKXA 4F91B 2M8EA 1A6IA 3I59A 1XMXA 4BJ5C 3H1CA 2NYXA 3W6JB 4WCGA 2IS2A 1S7EA 5HLHA 2XHKA 5F0CA 4FX4A 5L3CA 3KP7A 1LFUP 4HDUA 1EH6A 5HNHA 3CCSI 1R9TJ 1R22A 2BY1A 2L9NA 4HSRA 3RKQA 1IW7F 1B4AA 2PMHA 2H1KA 2HQRA 3DPLC 5HDKA 1JKRC 4N9IA 1UCRA 2MC3A 1R1TA 2EIMH 5F64A 5E20A 3BJAA 2DFHA 4NC7A 1I3AA 4ABZA 3QYEA 2LF8A 3KZZA 3I3LA 2R5ZB 5JI6A 2PFBA 2QENA 5EF6A 5KCMA 4I7HA 1ON2A 2QWWA 3KZYA 4M3FA 1TT5B 1MH3A 2FOWA 4AUXA 4HAMA 5BPIA 1KQ0A 2R7DA 5LGUA 3LSPA 1I39A 4I6ZA 3QU3A 3GTJJ 3UKGA 3RKWA 2G0EA 4L9NA 5ED4A 3MZHA 1A5JA 2B9SA 3IRQA 4MFEA 3FMRA 2X6XA 3DLAA 2R5YA 1IRFA 3U1DA 3KETA 3SEQA 2IGMA 5FJ8J 3OYHA 5FLVA 1TW3A 1BL0A 1W4MA 5IP6A 2B63J 4ESJA 4GXOA 4LLNA 4UB6C 2HVQA 2DA5A 1Y1VJ 2IGOA 2XGXA 2OQRA 2VJ4A 2W85A 4RB3C 1A36A 3HOSA 4FTHA 2FRHA 2R93J 1Z7LA 2KRCA 3FMQA 1HC8A 3FXRA 3UR3C 2EQRA 3K10A 2OZ6A 2WY8Q 3H36A 4ITVA 3HPHA 5LGTA 2P8TA 1R1VA 5J47A 3PSFA 1VQ9I 2FQ3A 1WWXA 1FYLA 4M6YA 3OYBA 2EIKH 2ZFWA 1SD5A 1IAWA 4A3BJ 1BOBA 1SD4A 2K9SA 2KRFA 3U2RA 1J5YA 2E1MB 2VBYA 1FJLA 4XRSG 3HSRA 3H9QA 2DTRA 2M5WA 2HXOA 1YI2I 3CQZJ 2XGDA 1GXQA 4UVAA 4CHUA 2JA8J 3H0DA 1I27A 4A0ZA 1STZA 2TCTA 2NXNB 3RDIA 1HDDC 4LG3A 1W7PA 4HOBA 1FPQA 2JZYA 2HVSA 1G3TA 1NHAA 3FXOA 3SZTA 4EM0B 2W4SA 3GTOJ 4C30A 2KPMA 3A4CA 3Q3SA 1KU2A 3O8HA 3ABTA 4DYCA 2R4GA 3DU5A 4U0VA 5EEAA 3PO3J 2ZJQF 1S5LC 3JAMZ 1TLHB 2A5YB 2WBMA 2E35A 4LIUA 1EKEA 2H94A 5B5EC 2HXIA 2LH9A 2CU7A 3IH3A 3HRMA 1BOAA 1OCRH 3WTUC 1O7LA 2VE8A 1YW7A 5IT9K 4GRIA 1T38A 1V54H 4BNCA 3TDUC 4G94A 2QSGX 4RAYA 1D1BA 3HRUA 4B3AA 2KT0A 1SAXA 2IAIA 3IH4A 3QP5A 4KT5C 2NOGA 5LBQA 2HOSA 2FA5A 1OYYA 1S7OA 1YJ9I 3P7NA 2HQ5A 1EF4A 4N4OB 1H88C 1K6OA 1WJBA 2A61A 2UV1A 1ONVA 4GYGA 2DOAA 1PJRA 3RPUD 3OYLA 3OS0A 1HKSA 4MO7A 2MBFA 3KLOA 1QVUA 2VT3A 4BGDA 2IRFG 3ROUA 2XVCA 1V55H 4HNVA 3C2GA 3S17J 2QZ8A 3F21A 3M07A 2VQCA 2EFNA 4U0WA 3KPHA 3JRAA 2CV1A 3OSFA 3AG2H 2LP0A 1FNNA 4RGSA 3VB2A 3G73A 3LSGA 4A3MJ 5ICFA 3RKYA 2ZB9A 2ZCWA 2DA1A 2Z9OA 4Y33A 1Q1VA 3D0SA 3F9KA 5D6FA 3JRFA 3CUQC 3COAC 1F1ZA 2XC7A 4RGXA 4BY7J 5LEJA 3BROA 3HOZJ 1FTZA 5ILUA 2QQ9A 3E3VA 2OAZA 1BA5A 4XLCA 3I64A 2CSOA 3I4NJ 3ASOH 2HDWA 4IL6C 2JPBA 1ZLKA 1Y0NA 3EPZA 4JX6A 4UVBA 1T98A 3CP2A 2P81A 2HYJA 1YJNI 2PBIA 2O8KA 2LVSA 1IUFA 3HSFA 4ANJA 4TV7A 2CUZA 3CCVI 3S1MJ 2OPTA 3WU2C 4CYDA 3TDZC 4MTEA 4IHXA 1MIJA 4E4HA 4FT8A 2QKMB 3G1MA 2Y0MA 2X48A 1TWFJ
chains in the Genus database with same CATH topology
5K7ZA 3RZDJ 5E3NA 1BW6A 3RZOJ 2FJ1A 4IHWA 1JKPC 1GVDA 4IEJA 1LE8B 2TRTA 2XGEA 5F04A 5GPCA 4A3EJ 3BQYA 2MGQA 3BR0A 1U78A 3VPRA 4M3DA 1ZR2A 3FIWA 2NVYJ 3HOXJ 1ITYA 1DU0A 2KDZA 2HOTA 4C3JJ 3TW7A 4DZJA 1NK3P 1FIAA 4BY1J 5DS9A 2DA4A 1XG1A 1LE8A 1FEXA 3A01B 2LD5A 2VKVA 5K7FA 1OJLA 1IC8A 1MSFC 3GTLJ 3GBGA 1ETVA 4UUTA 1JJ8C 1ZKGA 4MIMA 2DMNA 3M3YJ 1HOMA 2EZHA 2I10A 1GV5A 4D5FA 4L5EA 2DMPA 4D7MA 5F27A 2WAQN 3A01A 3S16J 4BBSJ 4M3BA 5GPAA 2DA2A 4BBRJ 4FE4A 3QQAA 3C2BA 2ME6A 1D5YA 2ID6A 2HI3A 1U8BA 4XRMA 1ORKA 1RPWA 3BR5A 3G1LA 5F0HA 3S14J 4A3KJ 3BQZA 3RQIA 3HOYJ 2AHQA 2LK2A 4JX4A 4LOCA 5DTDA 5M3MJ 3O8GA 2DMQA 4S0HB 5C4XJ 1IJWC 2VKEA 2Y9YA 4X6AJ 4A3CJ 1MBJA 3SDGA 4BXXJ 1UHSA 4M6VA 1MSEC 1SFOJ 3BTJA 3ZQLA 2MG4A 2M9HA 2K9NA 2MSYA 3PO2J 4AC0A 3K7AJ 2M8GX 2O9LA 4IHVA 3IH2A 2L7ZA 2H8RA 3WHBA 1WPKA 2COBA 5IOZA 1I3QJ 3ZQFA 3LOCA 4B1RA 5E3LA 1MH4A 3TP3A 2CQQA 2WB1N 1RETA 2E19A 2X9DA 1HLVA 2QF7A 3MKLA 1OFCX 2PMZN 3BTIA 4CYCB 2VPRA 2DMTA 1IV6A 1JKQC 3K2AA 3QPLA 1UMQA 2XPVA 1WH5A 1GUUA 2NVQJ 4G12A 1JTYA 2YUSA 2EZKA 1PUFB 4AYBN 4DW6A 3D1NI 5FLMJ 5M5YJ 3TEDA 2ELKA 3BG3A 4W97A 4CYCA 1ETKA 1ETOA 2FQ4A 3CMYA 1WCMJ 3JRIA 1OCTC 1JKOC 1ZTRA 3HOWJ 5EZGA 3S1NJ 1JUMA 1WH7A 2XSDC 3LSRA 2QCOA 4A3IJ 2X6OA 3S2HJ 4DYQA 4V2GA 1VNDA 1VI0A 2W48A 4JP0A 4A3JJ 2M0CA 3BG5A 1GV2A 1FIPA 3HDDA 2Y9ZA 2K9QA 2L9RA 4QSHA 1W0TA 3Q0VA 2LY9A 3ZQCA 5IYBJ 3ZQHA 3FK6A 3W6VA 1MNMC 2Y2ZA 1H8AC 3GTQJ 3DCFA 2ECCA 1WI3A 3SJMA 1LFBA 1IG7A 4V2FA 5FKMA 5EZHA 4Y7NJ 2AO9A 1YRNB 3L1PA 3JRDA 1RESA 5IP7J 1TWCJ 1ETXA 5J3LA 4FISA 4NDLA 4XIDA 1ZK8A 2DA3A 2XGCA 5F08A 3A03A 4FCYA 1YRNA 2CJJA 3HM5A 1B72B 1RR7A 4XICA 1B8IB 1T56A 2NS8A 3B6CA 1HDPA 5J1UA 1F36A 2DTZA 1AU7A 3BTLA 1HCRA 5C3EJ 1K83J 1JT0A 2ID3A 2LKXA 2RAEA 4BKXA 2NVXJ 2JMWA 2XB5A 4QTRA 1TWAJ 2LLKA 1VF9A 2EZIA 4EEFG 3HBLA 1X2NA 3DEWA 2WV1A 1B72A 1B8IA 3LSJA 3ZOBA 3HB9A 2IBDA 4Y52J 4QIWN 3E7LA 2VUMJ 5HODA 2JWTA 1A6IA 5EDNA 1QRYA 1FTTA 3NARA 1S7EA 4B4CA 2L7MP 2DA6A 2R7ZJ 1ETYA 5F0CA 1WGXA 1Z77A 2YS9A 2FX0A 4C3HJ 4X1EA 5M5WJ 5F1JA 2XRLA 1LFUP 1Z0XA 1ENHA 1NK2P 1R9TJ 2JA5J 3RKQA 4MLOA 3FK7A 3ZQGA 4XRSA 4M3GA 2O7OA 2H1KA 1JKRC 2E2HJ 1XS9A 3HOUJ 5EG0A 2GM4A 2NVTJ 1VFCA 4J19A 3S1RJ 1ETQA 3S1QJ 1P7IA 2JJ7A 4ABZA 3BR6A 2CUEA 2R5ZB 2YU9J 4GFBA 3GTPJ 2JK3A 5EF6A 1AKHB 3LNQA 5E3MA 1F43A 3CCYA 1ZGWA 3TP0A 3A02A 5M5XJ 5FKLA 4IHYA 2R5YB 4RDUA 4M3FA 1U9NA 1K61A 1MH3A 4AUXA 2DJNA 1P7JA 3PM1A 4D7NA 3LSPA 1NTCA 2R5ZA 3OIOA 2K40A 3JRCA 4I6ZA 3HGYA 4A3GJ 3GTJJ 3UKGA 1AKHA 2G0EA 1IDYA 2LFBA 3FKIJ 1A5JA 1W0UA 2HOAA 4MFEA 2E2IJ 1RKWA 3B6AA 5FKNA 2R5YA 5M3FJ 5IOYA 5FJ8J 5FLVA 1BL0A 4UUSB 5IP6A 2B63J 2JA6J 1ETWA 1QPIA 1JJ6C 1MBFA 2DA5A 1Y1VJ 3SFIA 1ZQ3P 1TWHJ 4FTHA 3CDLA 5FKKA 2DMUA 2R93J 4UUSA 1T33A 2EQRA 2Y30A 1RKTA 5JLWA 2JA7J 1BJZA 1IDZA 5F0FA 1JGGA 2LR8A 5EYRA 5J1YA 4A69C 3BTCA 1I6HJ 2LTPA 3BR2A 4A3BJ 3WHCA 2K9SA 2Y0SN 3JR9A 1GT0C 4W1UA 4DZPA 3S15J 3BT9A 1FJLA 4XRSG 3MVPA 2HXOA 3CQZJ 1JUSA 3OSGA 2XGDA 2JA8J 3I4MJ 2TCTA 4DYRA 1OCPA 5IPAA 1HDDC 1MBHA 2EBIA 1JUPA 3HOVJ 2EH3A 5BNGA 5E3OA 1TWGJ 1SANA 1JT6A 3S2DJ 3MN2A 3H3VK 3GTOJ 2XPUA 1DU6A 3Q3SA 2D5VA 2Y31A 3O8HA 4XK4A 4DYCA 5JLXA 5EEAA 4RBOA 3PO3J 2R0QC 1IRZA 2HXIA 5C4JJ 2CU7A 2E1OA 3IH3A 1GDTA 3JRGA 4C2MJ 2XB0X 5EG0B 1POGA 2ECBA 2E2JJ 1ZR4A 2IEKA 2MW8A 2XPWA 4B3AA 2KT0A 3BG9A 2CUFA 4A93J 1HF0A 2IAIA 3IH4A 2NOGA 3Q0UA 2EZLA 2HOSA 2JN6A 1X58A 2HDDA 2NS7A 2N8GA 2HQ5A 1EF4A 1QVTA 1H88C 5EGOB 4A3LJ 4MO7A 1BW5A 2ME0A 2CQXA 3OOUA 3JRBA 2M34A 1QVUA 3GTKJ 1G2HA 3H0GJ 3FISA 1MBEA 5GP9A 3BR3A 1JTXA 3G1OA 2L0KA 2M2EA 4HNVA 3S17J 5J1RA 5EGOA 3ZQIA 5C44J 1AHDP 3GTGJ 2VI6A 1CQTA 3JRAA 3IV5A 3OSFA 2LP0A 3TW6A 3LSGA 1MBKA 1X2MA 4A3MJ 4A3FJ 3Q0WA 2ZB9A 5IYDJ 2DA1A 2DN0A 1Q1VA 2GBYA 1APLC 3F0CA 1O4XA 2DA7A 3JRFA 2GLOA 2FD5A 1MBGA 4BY7J 4C3IJ 4D5CA 5FKOA 3HOZJ 1FTZA 3HEFA 3GTMJ 1BA5A 1U9OA 4JYKA 3HKZN 1IGNA 3BR1A 3I4NJ 1E3OC 4FE7A 4A3DJ 4JX6A 3HGGA 1XC5A 5K7HA 9ANTA 2P81A 2HYJA 1Y1WJ 1UG2A 2O8KA 2LVSA 1IUFA 4M3EA 3NAUA 3JREA 3QPSA 2R92J 1I50J 5IYCJ 5IP9J 3S1MJ 2OPTA 1PUFA 3JRHA 2OF7A 3M4OJ 1H89C 4MFDA 2L7FP 2CRGA 1TC3C 4I76A 4IHXA 4JX5A 3G1MA 2X48A 1TWFJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K7Z A;  3RZD J;  5E3N A;  1BW6 A;  3RZO J;  2FJ1 A;  4IHW A;  1JKP C;  1GVD A;  4IEJ A;  1LE8 B;  2TRT A;  2XGE A;  5F04 A;  5GPC A;  4A3E J;  3BQY A;  2MGQ A;  3BR0 A;  1U78 A;  3VPR A;  4M3D A;  1ZR2 A;  3FIW A;  2NVY J;  3HOX J;  1ITY A;  1DU0 A;  2KDZ A;  2HOT A;  4C3J J;  3TW7 A;  4DZJ A;  1NK3 P;  1FIA A;  4BY1 J;  5DS9 A;  2DA4 A;  1XG1 A;  1LE8 A;  1FEX A;  3A01 B;  2LD5 A;  2VKV A;  5K7F A;  1OJL A;  1IC8 A;  1MSF C;  3GTL J;  3GBG A;  1ETV A;  4UUT A;  1JJ8 C;  1ZKG A;  4MIM A;  2DMN A;  3M3Y J;  1HOM A;  2EZH A;  2I10 A;  1GV5 A;  4D5F A;  4L5E A;  2DMP A;  4D7M A;  5F27 A;  2WAQ N;  3A01 A;  3S16 J;  4BBS J;  4M3B A;  5GPA A;  2DA2 A;  4BBR J;  4FE4 A;  3QQA A;  3C2B A;  2ME6 A;  1D5Y A;  2ID6 A;  2HI3 A;  1U8B A;  4XRM A;  1ORK A;  1RPW A;  3BR5 A;  3G1L A;  5F0H A;  3S14 J;  4A3K J;  3BQZ A;  3RQI A;  3HOY J;  2AHQ A;  2LK2 A;  4JX4 A;  4LOC A;  5DTD A;  5M3M J;  3O8G A;  2DMQ A;  4S0H B;  5C4X J;  1IJW C;  2VKE A;  2Y9Y A;  4X6A J;  4A3C J;  1MBJ A;  3SDG A;  4BXX J;  1UHS A;  4M6V A;  1MSE C;  1SFO J;  3BTJ A;  3ZQL A;  2MG4 A;  2M9H A;  2K9N A;  2MSY A;  3PO2 J;  4AC0 A;  3K7A J;  2M8G X;  2O9L A;  4IHV A;  3IH2 A;  2L7Z A;  2H8R A;  3WHB A;  1WPK A;  2COB A;  5IOZ A;  1I3Q J;  3ZQF A;  3LOC A;  4B1R A;  5E3L A;  1MH4 A;  3TP3 A;  2CQQ A;  2WB1 N;  1RET A;  2E19 A;  2X9D A;  1HLV A;  2QF7 A;  3MKL A;  1OFC X;  2PMZ N;  3BTI A;  4CYC B;  2VPR A;  2DMT A;  1IV6 A;  1JKQ C;  3K2A A;  3QPL A;  1UMQ A;  2XPV A;  1WH5 A;  1GUU A;  2NVQ J;  4G12 A;  1JTY A;  2YUS A;  2EZK A;  1PUF B;  4AYB N;  4DW6 A;  3D1N I;  5FLM J;  5M5Y J;  3TED A;  2ELK A;  3BG3 A;  4W97 A;  4CYC A;  1ETK A;  1ETO A;  2FQ4 A;  3CMY A;  1WCM J;  3JRI A;  1OCT C;  1JKO C;  1ZTR A;  3HOW J;  5EZG A;  3S1N J;  1JUM A;  1WH7 A;  2XSD C;  3LSR A;  2QCO A;  4A3I J;  2X6O A;  3S2H J;  4DYQ A;  4V2G A;  1VND A;  1VI0 A;  2W48 A;  4JP0 A;  4A3J J;  2M0C A;  3BG5 A;  1GV2 A;  1FIP A;  3HDD A;  2Y9Z A;  2K9Q A;  2L9R A;  4QSH A;  1W0T A;  3Q0V A;  2LY9 A;  3ZQC A;  5IYB J;  3ZQH A;  3FK6 A;  3W6V A;  1MNM C;  2Y2Z A;  1H8A C;  3GTQ J;  3DCF A;  2ECC A;  1WI3 A;  3SJM A;  1LFB A;  1IG7 A;  4V2F A;  5FKM A;  5EZH A;  4Y7N J;  2AO9 A;  1YRN B;  3L1P A;  3JRD A;  1RES A;  5IP7 J;  1TWC J;  1ETX A;  5J3L A;  4FIS A;  4NDL A;  4XID A;  1ZK8 A;  2DA3 A;  2XGC A;  5F08 A;  3A03 A;  4FCY A;  1YRN A;  2CJJ A;  3HM5 A;  1B72 B;  1RR7 A;  4XIC A;  1B8I B;  1T56 A;  2NS8 A;  3B6C A;  1HDP A;  5J1U A;  1F36 A;  2DTZ A;  1AU7 A;  3BTL A;  1HCR A;  5C3E J;  1K83 J;  1JT0 A;  2ID3 A;  2LKX A;  2RAE A;  4BKX A;  2NVX J;  2JMW A;  2XB5 A;  4QTR A;  1TWA J;  2LLK A;  1VF9 A;  2EZI A;  4EEF G;  3HBL A;  1X2N A;  3DEW A;  2WV1 A;  1B72 A;  1B8I A;  3LSJ A;  3ZOB A;  3HB9 A;  2IBD A;  4Y52 J;  4QIW N;  3E7L A;  2VUM J;  5HOD A;  2JWT A;  1A6I A;  5EDN A;  1QRY A;  1FTT A;  3NAR A;  1S7E A;  4B4C A;  2L7M P;  2DA6 A;  2R7Z J;  1ETY A;  5F0C A;  1WGX A;  1Z77 A;  2YS9 A;  2FX0 A;  4C3H J;  4X1E A;  5M5W J;  5F1J A;  2XRL A;  1LFU P;  1Z0X A;  1ENH A;  1NK2 P;  1R9T J;  2JA5 J;  3RKQ A;  4MLO A;  3FK7 A;  3ZQG A;  4XRS A;  4M3G A;  2O7O A;  2H1K A;  1JKR C;  2E2H J;  1XS9 A;  3HOU J;  5EG0 A;  2GM4 A;  2NVT J;  1VFC A;  4J19 A;  3S1R J;  1ETQ A;  3S1Q J;  1P7I A;  2JJ7 A;  4ABZ A;  3BR6 A;  2CUE A;  2R5Z B;  2YU9 J;  4GFB A;  3GTP J;  2JK3 A;  5EF6 A;  1AKH B;  3LNQ A;  5E3M A;  1F43 A;  3CCY A;  1ZGW A;  3TP0 A;  3A02 A;  5M5X J;  5FKL A;  4IHY A;  2R5Y B;  4RDU A;  4M3F A;  1U9N A;  1K61 A;  1MH3 A;  4AUX A;  2DJN A;  1P7J A;  3PM1 A;  4D7N A;  3LSP A;  1NTC A;  2R5Z A;  3OIO A;  2K40 A;  3JRC A;  4I6Z A;  3HGY A;  4A3G J;  3GTJ J;  3UKG A;  1AKH A;  2G0E A;  1IDY A;  2LFB A;  3FKI J;  1A5J A;  1W0U A;  2HOA A;  4MFE A;  2E2I J;  1RKW A;  3B6A A;  5FKN A;  2R5Y A;  5M3F J;  5IOY A;  5FJ8 J;  5FLV A;  1BL0 A;  4UUS B;  5IP6 A;  2B63 J;  2JA6 J;  1ETW A;  1QPI A;  1JJ6 C;  1MBF A;  2DA5 A;  1Y1V J;  3SFI A;  1ZQ3 P;  1TWH J;  4FTH A;  3CDL A;  5FKK A;  2DMU A;  2R93 J;  4UUS A;  1T33 A;  2EQR A;  2Y30 A;  1RKT A;  5JLW A;  2JA7 J;  1BJZ A;  1IDZ A;  5F0F A;  1JGG A;  2LR8 A;  5EYR A;  5J1Y A;  4A69 C;  3BTC A;  1I6H J;  2LTP A;  3BR2 A;  4A3B J;  3WHC A;  2K9S A;  2Y0S N;  3JR9 A;  1GT0 C;  4W1U A;  4DZP A;  3S15 J;  3BT9 A;  1FJL A;  4XRS G;  3MVP A;  2HXO A;  3CQZ J;  1JUS A;  3OSG A;  2XGD A;  2JA8 J;  3I4M J;  2TCT A;  4DYR A;  1OCP A;  5IPA A;  1HDD C;  1MBH A;  2EBI A;  1JUP A;  3HOV J;  2EH3 A;  5BNG A;  5E3O A;  1TWG J;  1SAN A;  1JT6 A;  3S2D J;  3MN2 A;  3H3V K;  3GTO J;  2XPU A;  1DU6 A;  3Q3S A;  2D5V A;  2Y31 A;  3O8H A;  4XK4 A;  4DYC A;  5JLX A;  5EEA A;  4RBO A;  3PO3 J;  2R0Q C;  1IRZ A;  2HXI A;  5C4J J;  2CU7 A;  2E1O A;  3IH3 A;  1GDT A;  3JRG A;  4C2M J;  2XB0 X;  5EG0 B;  1POG A;  2ECB A;  2E2J J;  1ZR4 A;  2IEK A;  2MW8 A;  2XPW A;  4B3A A;  2KT0 A;  3BG9 A;  2CUF A;  4A93 J;  1HF0 A;  2IAI A;  3IH4 A;  2NOG A;  3Q0U A;  2EZL A;  2HOS A;  2JN6 A;  1X58 A;  2HDD A;  2NS7 A;  2N8G A;  2HQ5 A;  1EF4 A;  1QVT A;  1H88 C;  5EGO B;  4A3L J;  4MO7 A;  1BW5 A;  2ME0 A;  2CQX A;  3OOU A;  3JRB A;  2M34 A;  1QVU A;  3GTK J;  1G2H A;  3H0G J;  3FIS A;  1MBE A;  5GP9 A;  3BR3 A;  1JTX A;  3G1O A;  2L0K A;  2M2E A;  4HNV A;  3S17 J;  5J1R A;  5EGO A;  3ZQI A;  5C44 J;  1AHD P;  3GTG J;  2VI6 A;  1CQT A;  3JRA A;  3IV5 A;  3OSF A;  2LP0 A;  3TW6 A;  3LSG A;  1MBK A;  1X2M A;  4A3M J;  4A3F J;  3Q0W A;  2ZB9 A;  5IYD J;  2DA1 A;  2DN0 A;  1Q1V A;  2GBY A;  1APL C;  3F0C A;  1O4X A;  2DA7 A;  3JRF A;  2GLO A;  2FD5 A;  1MBG A;  4BY7 J;  4C3I J;  4D5C A;  5FKO A;  3HOZ J;  1FTZ A;  3HEF A;  3GTM J;  1BA5 A;  1U9O A;  4JYK A;  3HKZ N;  1IGN A;  3BR1 A;  3I4N J;  1E3O C;  4FE7 A;  4A3D J;  4JX6 A;  3HGG A;  1XC5 A;  5K7H A;  9ANT A;  2P81 A;  2HYJ A;  1Y1W J;  1UG2 A;  2O8K A;  2LVS A;  1IUF A;  4M3E A;  3NAU A;  3JRE A;  3QPS A;  2R92 J;  1I50 J;  5IYC J;  5IP9 J;  3S1M J;  2OPT A;  1PUF A;  3JRH A;  2OF7 A;  3M4O J;  1H89 C;  4MFD A;  2L7F P;  2CRG A;  1TC3 C;  4I76 A;  4IHX A;  4JX5 A;  3G1M A;  2X48 A;  1TWF J; 
#chains in the Genus database with same CATH topology
 2Z5U A;  1X4O A;  3L2C A;  1VQ8 I;  4AYB A;  4ZDL A;  2VON A;  4XLN F;  5E3N A;  2FJ1 A;  4M71 A;  4IHW A;  1GVD A;  4IEJ A;  2PN6 A;  3SYT A;  3U21 A;  3CZ6 A;  2KKO A;  3F8N A;  1T0F C;  2VIX A;  5F04 A;  3BDD A;  2NS0 A;  4PJJ A;  3CDI A;  3CJT B;  2MGQ A;  1NG7 A;  3FXK A;  4ZDP A;  1U78 A;  4M3D A;  2F5V A;  3FIW A;  3HOX J;  2DXI A;  3O3K A;  2JUC A;  2K86 A;  3HOT A;  2NNN A;  1IRX A;  4ON0 A;  1X1D A;  1L0O C;  2DQL A;  4HNT A;  4F92 B;  3CLO A;  3GO5 A;  1DQU A;  4U7B A;  2OBP A;  4BY1 J;  5ICG A;  3H5N A;  2DA4 A;  3B02 A;  3K6G A;  1IN4 A;  3A01 B;  1RRJ A;  5K7F A;  2M30 A;  1SD6 A;  6PAX A;  3GLL A;  3K4M A;  1IN5 A;  5AIQ A;  5CQE A;  3GTL J;  3QPH A;  4LFU A;  4HX4 A;  1JJ8 C;  2VB6 A;  3H35 A;  1UHW A;  3HPG A;  1ZKG A;  4LK0 F;  4PK4 A;  2DMN A;  1LPQ A;  1S9H A;  3W3C A;  2EZH A;  3ZGK A;  2F6C A;  1T2K A;  4XN0 A;  1OYI A;  2DMP A;  4EGZ A;  4QWQ A;  4LMY A;  5F27 A;  2E34 A;  2WAQ N;  2ISY A;  3KEQ A;  4EQQ A;  4XSZ F;  5LHI A;  1YYV A;  1O57 A;  4M3B A;  4CA0 A;  2P7V B;  1E3H A;  2QSF X;  3LA3 A;  5JFR A;  4FE4 A;  2RDP A;  2RV8 A;  3S3N A;  4IXA A;  2A6T A;  3E6M A;  3TO9 A;  1D5Y A;  4KNY A;  3E5Q A;  5D8L B;  4HST A;  4KIG A;  4KMU X;  2Y75 A;  2P7C B;  2F5F A;  3K9T A;  5DDG A;  3ZMT A;  3QOP A;  1USS A;  5HS8 A;  1RIO H;  2CG4 A;  3R4K A;  4L9V A;  3BQZ A;  5GTI C;  3HOY J;  2AHQ A;  1U6G A;  1X1C A;  2LK2 A;  3HUG A;  2KJB A;  2WAQ A;  2P4W A;  3J80 Z;  1ZAR A;  4NQW B;  2LRD A;  1MW7 A;  3DEE A;  5CKT A;  3WGI A;  4ZC3 A;  1IJW C;  2KMU A;  1XTA A;  2K3F A;  2GAU A;  2QBY A;  1EJ9 A;  5K5Q A;  3TGN A;  2HZT A;  1YFH A;  1Y6I A;  2L4M A;  2UZK A;  1J9I A;  5FLX Z;  2XV4 S;  2M1B A;  4AC0 A;  3K7A J;  3V8L A;  4BJT A;  2O9L A;  4IHS A;  2ZJR F;  2H8R A;  3WE2 A;  3LOC A;  3DXJ F;  2M4K A;  5E79 C;  5E3L A;  4A6D A;  1RNL A;  4CDG A;  3TP3 A;  2CQQ A;  4BJ6 C;  5D8K B;  2CV2 A;  5L3E A;  4L5I A;  5BOX A;  4HLY A;  3BTI A;  1F9N A;  1VQ6 I;  4CYC B;  5E8I A;  2OCC H;  1VQN I;  2ZBK A;  1JKQ C;  2LF7 A;  1UMQ A;  2EA4 A;  5GTH C;  1GUU A;  2NVQ J;  3EET A;  4EV0 A;  4E7I A;  1WZ2 A;  2KIM A;  2DK5 A;  2AS5 F;  1IN6 A;  2EK5 A;  1JHH A;  4IVN A;  2ELK A;  2ZME B;  3TED A;  1ETK A;  3IP4 B;  1S7A A;  1ETO A;  4S05 A;  1WCM J;  2Z1D A;  3ZN0 A;  1XSD A;  3H9G A;  3JRI A;  2LKS A;  3KYD B;  3PUB A;  1MMS A;  1P6R A;  1G3Y A;  1CF7 B;  3BLY A;  5EZG A;  1JUM A;  2K9L A;  4KIF A;  3WG9 A;  3CUO A;  1UST A;  4RAF A;  2XSD C;  4PFP A;  2GXB A;  3LSR A;  3PNY A;  2QCO A;  5LEK A;  4A3I J;  1N77 A;  1XCV A;  4FQG A;  4V2G A;  1T6S A;  3F72 A;  4JP0 A;  4A3J J;  2M0C A;  1ZG3 A;  1OKR A;  2I5U A;  2V7F A;  3HDD A;  3W6K B;  5KAF C;  4OOI A;  1Y0U A;  4BHC A;  1W0T A;  1PP7 U;  5FRN A;  1V4R A;  5DCF A;  2E60 A;  2HGC A;  3CTA A;  1MNM C;  3P9C A;  4PCQ A;  1G59 A;  1LFB A;  1IG7 A;  3G2B A;  1ZAO A;  1D5V A;  3WOD F;  1VQ7 I;  1DPR A;  3GYH X;  4XOR A;  1WKM A;  3CJQ B;  3L1P A;  1RES A;  4L18 B;  3H3U A;  2CUJ A;  2JSP A;  4FIS A;  4PUS A;  1ZK8 A;  1VZ0 A;  4FX0 A;  2DA3 A;  2EFW A;  4K2E A;  5E18 F;  2IW5 A;  2ZSH B;  3S93 A;  3A03 A;  2L01 A;  2X1D A;  2G7H A;  4FCY A;  1BR2 A;  2RKH A;  1P9Q C;  4WF2 A;  4E6K G;  1T56 A;  1Y56 A;  1N75 A;  1HCR A;  3BTL A;  5C3E J;  2VC0 A;  3KEO A;  2W1O A;  3GF2 A;  2ID3 A;  4XLP F;  3HUG B;  3BWG A;  4EMS A;  1VQM I;  1A6Q A;  1E17 A;  5DCM B;  3BP8 A;  1TWA J;  2LYC A;  1OLT A;  3HBL A;  1WI9 A;  4OIQ F;  2PQ8 A;  3VWB A;  1IN8 A;  2IBD A;  4E7J A;  2EIL H;  4QIW N;  2VUM J;  1O7F A;  2JWT A;  2WAE A;  4XON A;  2EJR A;  1QRY A;  4GO1 A;  4XOP A;  1BN5 A;  5JR3 A;  2EB7 A;  2L7M P;  3R0A A;  5HOO A;  2RQQ A;  1QZZ A;  3I4P A;  1YS7 A;  4IZZ A;  4X1E A;  3R6S A;  1U5T A;  2QKL B;  1ENH A;  2DT6 A;  2A5W A;  4HV6 A;  2XIG A;  4YRV A;  3EDP A;  3FK7 A;  3DWL E;  3QP6 A;  1Z9C A;  2RQP A;  2E2H J;  1XS9 A;  2DQR A;  1S72 I;  2HPM A;  2KZG A;  3S3O A;  5JHU A;  2F5C A;  5HNF A;  2JJ7 A;  1IXS B;  3BR6 A;  3PNT A;  4GFB A;  2QYO A;  4E7L A;  1AKH B;  5K1Y A;  1GXP A;  4XRF A;  2NNY A;  1ZGW A;  2BOL A;  1ODD A;  3LWF A;  1FC3 A;  1SMY F;  4RDU A;  3ZMV A;  2DOE A;  1K61 A;  3OS2 A;  4NHJ A;  1BR4 A;  3PM1 A;  5FD5 A;  1R58 A;  2JTV A;  2R5Z A;  5CVI A;  2A6H F;  2MA3 A;  3F6O A;  1XX5 A;  4HYE A;  4D9J A;  3OYN A;  4IOC F;  5L3D A;  2LFB A;  1IDY A;  3FKI J;  3IC7 A;  4KIC A;  2O61 A;  2HOA A;  3BPX A;  3AG1 H;  1Z91 A;  4LLG F;  3T0Y A;  3WE3 A;  1RKW A;  2ICW G;  4RB0 A;  5FKN A;  1KQ9 A;  4AVP A;  4BQQ A;  2O03 A;  5IOY A;  3N4M A;  2WWY A;  2VXD A;  2Z3Y A;  3VOE A;  4B43 A;  3J80 K;  3PQK A;  3C2H A;  3HC7 A;  3R0J A;  2L9S A;  3ZMU A;  4Q4Z F;  1ZQ3 P;  1S29 A;  2A05 A;  2CO5 A;  3CO6 C;  1Z21 A;  3CC7 I;  2DMU A;  4DIQ A;  4EJW A;  4RGU A;  1T33 A;  2DBB A;  3ML6 A;  3FHZ A;  1LNW A;  2ZFU A;  4Z2Y A;  1RKT A;  2FOK A;  5LHH A;  3GZ5 A;  1MDM B;  3JSP A;  2JA7 J;  1RUN A;  3J81 K;  2IS6 A;  2FML A;  3HHG A;  4PJM A;  3BZ6 A;  2VXZ A;  4ENN A;  2X4H A;  3MKZ A;  2DOD A;  2VC1 A;  2ZC2 A;  3S3M A;  4A5N A;  3BTC A;  2P6S A;  1I6H J;  2LC2 A;  2DT5 A;  2ADU A;  3P5J A;  3BR2 A;  3JR9 A;  1HA8 A;  3BT9 A;  2H6C A;  3G4S I;  2XF5 A;  5DV5 A;  1YOV B;  2DAO A;  2V26 A;  5B1A H;  1MNE A;  3PFY A;  3I0T A;  1HW5 A;  3NWS A;  2KLO A;  1FY7 A;  1OCP A;  1YW9 A;  1MBH A;  2PEX A;  2X51 A;  3HOV J;  2AQE A;  1X1P A;  3HIF A;  5E3O A;  2JT1 A;  1TWG J;  4O3M A;  3MN2 A;  4G6D A;  4IPA A;  2HKO A;  2Y31 A;  1YJW I;  4AIH A;  5JLX A;  3SQN A;  3CME I;  1DUX C;  5D5U B;  1TQM A;  4MGR A;  1IRZ A;  5ILV A;  4KIB A;  3LSK A;  2VLA A;  1F5T A;  2L7K A;  1PUE E;  2CGP A;  2CYY A;  4Y4R A;  2NVU B;  2X1C A;  4BHB A;  1GDT A;  2PG4 A;  1YHQ I;  3N97 A;  1PP8 F;  2FEZ A;  2XB0 X;  4CCO A;  4NB5 A;  3D5L A;  1SEU A;  3FXM A;  1FBS A;  2BW3 B;  2ECB A;  2E2J J;  2IEK A;  1MGT A;  3ERM A;  3BG9 A;  1BI0 A;  2FBK A;  3ZP5 A;  2V9K A;  2GXG A;  3Q0U A;  1NH3 A;  2HDD A;  2PLY A;  2N8G A;  2HU9 A;  3K4L A;  2KIF A;  3TQN A;  4BAY A;  4H0E A;  4A3L J;  1LDD A;  2W82 A;  4KN4 X;  1BW5 A;  1HKQ A;  2DCE A;  5CVV A;  4Z6Y A;  3GTK J;  1MJB A;  1W1W E;  3FIS A;  2GXA A;  2M4G A;  2ISZ A;  3I58 A;  4IKF A;  2YSR A;  1LDJ A;  4RGR A;  2KFD A;  5GP9 A;  2R7R A;  3BR3 A;  1JTX A;  4KT6 A;  5J1R A;  2CWE A;  1YS6 A;  2FE3 A;  5FD6 A;  3NEU A;  3DLL F;  1CQT A;  2D1V A;  2EFQ A;  4LJZ F;  4IQ4 A;  2RNG A;  1Y8R B;  2XRO A;  5HLG A;  3RI4 A;  1ZGA A;  4U0Y A;  1WSU A;  1YQA A;  1X1B A;  3BG6 A;  2Q0O A;  1YW8 A;  5E1Z B;  2DN0 A;  1XN7 A;  1X3Z B;  2EA2 A;  2DA7 A;  1O4X A;  2R7W A;  2JPC A;  2JVH A;  1MBG A;  4BE1 A;  3CJR B;  3AL0 B;  2VE9 A;  4HQM A;  3GTM J;  2MYS A;  2AXT C;  1CGP A;  2JRT A;  3DU6 A;  4JYK A;  3HKZ N;  5LRR A;  3BR1 A;  2DFF A;  2KRH A;  3E6D A;  3V42 A;  4XKW A;  3HGG A;  1XC5 A;  5K7H A;  2DPD A;  2XAU A;  3OR1 C;  3K4J A;  1Y1W J;  1UG2 A;  3J7Z I;  3NAU A;  1TQP A;  1I50 J;  2IP2 A;  2Z2S B;  2KHM A;  2QQB A;  2XAH A;  3L09 A;  1PUF A;  3JRH A;  2STW A;  1F4K A;  1H0M A;  1LVA A;  2OF7 A;  3M4O J;  1H89 C;  1U2W A;  1FP1 D;  3K70 C;  1TC3 C;  4JX5 A;  3HKZ A;  2EV0 A;  5K7Z A;  4RS8 A;  2O3F A;  3AAF A;  1BW6 A;  3RZO J;  1JKP C;  1K79 A;  1LE8 B;  3V8K A;  1U8R A;  2M7A A;  4IRG A;  2TRT A;  5CVU A;  3C3W A;  3TL4 X;  4OIN F;  1ZRC A;  1O3Q A;  2QSH X;  3M8F A;  1QNT A;  2IJL A;  4FAS D;  1FWZ A;  1G4D A;  4WXC A;  4A12 A;  3IAM 2;  4P9F A;  4DZJ A;  1OIS A;  4KUM A;  3TO6 A;  5DS9 A;  1U5T C;  1Z1D A;  4B48 A;  2VKV A;  2LD5 A;  1IV8 A;  2WAF A;  3GBG A;  4YFN F;  4UUT A;  3TKY A;  5ERI A;  3GFL A;  4HPQ A;  4D5F A;  1XD7 A;  2MAB A;  2BBY A;  1Z05 A;  4M9X A;  4HG2 A;  4RAZ A;  1J59 A;  3A01 A;  3S16 J;  4BBS J;  1XPX A;  1QHH D;  5GPA A;  2WA0 A;  2Z99 A;  1ZG5 A;  3L2V A;  2DI3 A;  4UHT A;  3VEP A;  2LMD A;  2IS1 A;  1TBX A;  2ME6 A;  1SC7 A;  1W5T A;  1Z67 A;  1U8B A;  3I9V 2;  3G1L A;  1RPW A;  4HX8 A;  2VKD A;  4BXF A;  2IGK A;  4D0P A;  5K5R A;  1FYM A;  2JSC A;  5A2Q Z;  4A3K J;  2ESN A;  3SXY A;  1TNS A;  1REP C;  2VBW A;  3PQJ A;  4GGG A;  3TOA A;  2R7T A;  5DTD A;  3PNV A;  1MKM A;  4EJO A;  4XOT A;  2EV5 A;  3OYD A;  2LSO A;  2E1C A;  1QQI A;  2K4B A;  2DMQ A;  3K1M A;  1MZB A;  4DBR A;  3W2V A;  4G7Z F;  4RLF A;  3J7A Y;  1LVK A;  4A3C J;  3SDG A;  1UHS A;  3QYB A;  3FHN A;  1MSE C;  1KGS A;  4HW0 A;  2MG4 A;  2B0L A;  5FB2 A;  2M9H A;  1BI3 A;  2K9N A;  2K5C A;  4NQW A;  2MSY A;  1QPM A;  1XMK A;  2M8G X;  4IHV A;  2ZJP F;  2L7Z A;  4IO9 F;  2COB A;  3LSM A;  4B1R A;  1Y8Q B;  3I5U A;  1YTY A;  1KU3 A;  3KP6 A;  3KE2 A;  2X9D A;  3HHH A;  2K7L A;  2QF7 A;  3M7G A;  2X6Y A;  1U3E M;  5DM7 F;  4XBF A;  1OFC X;  3BZC A;  4NC8 A;  1MND A;  1A04 A;  2VPR A;  3OV8 A;  1IV6 A;  4AM3 A;  4LB5 A;  1T39 A;  4PSW A;  3K0L A;  2MLG A;  3K2A A;  3GLX A;  3QPL A;  1C0W A;  4ASN A;  3MWM A;  4X0G A;  3L00 A;  4G12 A;  2M3A A;  1ZYR F;  1JTY A;  5F6F A;  2EZK A;  1R4M B;  1PUF B;  4UNO A;  4AYB N;  2E5N A;  2BVL A;  3D1N I;  1BBY A;  4ZYE A;  1G3S A;  4RB2 C;  4W97 A;  4CYC A;  3JW4 A;  1XGS A;  4MTD A;  4HZF A;  4BUP A;  4HX7 A;  2HTJ A;  4PGG A;  2DPU A;  2VQH A;  1TT0 A;  2E1M C;  1R71 A;  1YLF A;  1VQL I;  1GHC A;  2ETH A;  2E7W A;  2OCE A;  1ZGJ A;  3H5A A;  3CCU I;  2ZME A;  2R7U A;  1R49 A;  1WQ2 A;  2HKX A;  1YIO A;  1VI0 A;  3FX3 A;  1WJA A;  4UXN A;  3ZMS A;  1FIP A;  4M72 A;  2M87 A;  3E6C C;  2VOP A;  4ZDO A;  1MMA A;  2L9R A;  1CF7 A;  2WY7 Q;  3VYT B;  3BJO A;  4Y3O A;  2XAJ A;  5ICC A;  3KLN A;  2LY9 A;  1R5I D;  3EQL F;  2A3S A;  3W6V A;  2GOX B;  3M1C A;  3GTQ J;  1WI3 A;  3RPU A;  2L3D A;  4E7S A;  4HNU A;  3F8B A;  2LG4 A;  5EZH A;  4Y7N J;  1IF1 A;  1GVJ A;  2XKP A;  4Q47 A;  2L02 A;  3ECH A;  3I71 A;  4C2U A;  4I09 A;  5J3L A;  1SFK A;  2I8D A;  3OYG A;  4I0B A;  3QRF F;  2F4O B;  1IXC A;  3QYF A;  1EA3 A;  5KVR A;  2W7N A;  1SFX A;  5LD2 C;  2LOO A;  3FF5 A;  3KX2 A;  4EAT A;  3C7J A;  2QQ8 A;  3MZ8 A;  1WHU A;  2P5K A;  3HM5 A;  1D1A A;  1B72 B;  5HLI A;  3VOD A;  2HYF A;  1QZE A;  2EV6 A;  1LUJ B;  1D0Z A;  5J1U A;  4CUG A;  3DTE A;  4I01 A;  2CQK A;  3G6E I;  2NVX J;  4L9T A;  3KP5 A;  2L54 A;  5K5O A;  1VF9 A;  2Y0S A;  2NAZ A;  3I53 A;  3DEW A;  1BIB A;  3LSJ A;  1QU3 A;  2EIJ H;  4H4K C;  5DD8 A;  1BC8 C;  3E7L A;  5E1W A;  2LBF B;  3GFI A;  2BGC A;  4OWR B;  2BY0 A;  1J09 A;  3NAR A;  1D1C A;  1W5S A;  5DCM A;  4CZZ A;  2JA2 A;  4B4C A;  2DA6 A;  5TRD A;  1PYV A;  2YS9 A;  4NNJ A;  2AXL A;  1IUY A;  5M5W J;  4HF2 A;  5F1J A;  1Z0X A;  2V1X A;  1SD7 A;  3NRV A;  4C2T A;  3OL4 A;  3CF5 F;  5LHG A;  4RB1 A;  3ZQG A;  2EWN A;  4XRS A;  2HVR A;  4HDV A;  2PX9 A;  3MEX A;  5EG0 A;  2GM4 A;  3H3Z A;  1MJA A;  3J81 Z;  2NVT J;  4RAG A;  1VFC A;  1IZ1 A;  4J19 A;  3EUH A;  1M1E B;  1V3F A;  1UJ8 A;  5TJJ A;  4WX9 A;  1AWC A;  2CUE A;  2NRA C;  2YU9 J;  3GTP J;  4BQA A;  2JK3 A;  2OJE D;  1K4S A;  4E7K A;  1T8I A;  1F43 A;  1Z6R A;  2ZJ2 A;  3CCY A;  3OWT A;  2FBH A;  3V7R A;  5FO5 A;  3TP0 A;  5FKL A;  1S3J A;  4IHY A;  4OAY A;  3WTS C;  2BVM A;  2V4J C;  1D0X A;  1P7J A;  1S8N A;  1WJD A;  5KK1 A;  2VL8 A;  2RC4 A;  2K40 A;  3JRC A;  1HXD A;  3ELK A;  1K78 A;  1AKH A;  1P4W A;  1RZ4 A;  3W2W A;  5DM6 F;  1SVL A;  2O6G E;  3FZV A;  4MEY F;  5A2Q K;  1FOX A;  1TQI A;  3MMY B;  3WG7 H;  2DDA A;  1OCZ H;  2Q1Z B;  2XAG A;  4BEH B;  4RMN A;  4F52 A;  4D1Q A;  3HTS B;  4B3X A;  1UEL B;  2BXY A;  4UUS B;  4GDF A;  3TBI A;  1ETW A;  2VJ5 A;  4RLQ A;  3CLQ A;  2VKH A;  4LG0 B;  1MBF A;  4XLF A;  1ULY A;  4P9U A;  4B8X A;  5FFX A;  5GAD J;  2OC6 A;  1OCC H;  1TWH J;  3IUO A;  3M8E A;  2ZXI A;  5FKK A;  1LB2 A;  2HZD A;  1G6N A;  2VBX A;  3PIP F;  2R7X A;  1S6L A;  2CFX A;  3CCM I;  5CVR A;  2HEO A;  3OL3 A;  3K4N A;  1BJZ A;  2DO7 A;  5EJC A;  1IDZ A;  5F0F A;  2A07 F;  4DBQ A;  1JGG A;  2LR8 A;  4OAZ A;  2XUB A;  3EUA A;  4IRH A;  2CMP A;  4ENJ A;  2MC4 A;  5J1Y A;  4WK8 F;  5B3S H;  4WWC A;  4A69 C;  4YIF A;  3CCR I;  4G8X A;  3WHC A;  1EV7 A;  1MDM A;  4QPQ A;  5BMZ A;  2GA1 A;  4PZJ A;  3MVP A;  4F3Q A;  2XAS A;  3L9F A;  4B47 A;  1JUS A;  3OSG A;  3I4M J;  4CCK A;  3GX4 X;  4G6T B;  4DYR A;  5FRM A;  1WRJ A;  1R00 A;  2OUM A;  1E2X A;  2ZNY A;  2EBI A;  4A2U A;  1JUP A;  1VTN C;  3SDB A;  2GA2 A;  4F93 B;  3MKY B;  1YO5 C;  2UUZ A;  1OPC A;  4F55 A;  2EH3 A;  2W24 A;  3U1K A;  3S2D J;  3H3V K;  2DT7 B;  1DU6 A;  2MH2 A;  1R1U A;  4YFK F;  4XK4 A;  1BIA A;  1J75 A;  3KP3 A;  1V5E A;  2E36 A;  3MKW B;  2R0Q C;  4ZTF A;  5CVJ A;  2GIV A;  4GYI A;  3RPQ A;  1QZY A;  5C4J J;  4LIV A;  1NG6 A;  3OYK A;  2OTJ I;  2E1O A;  2HS5 A;  3H92 A;  3ISP A;  4PSX A;  1U0J A;  4BL0 B;  4ESF A;  5BQT A;  3WU1 B;  2ESH A;  3MCZ A;  3FBI B;  4C2M J;  3LAJ A;  5EG0 B;  1LKX A;  4L9J A;  3GME A;  4UVC A;  3PL8 A;  2P6T A;  5TIS C;  3CCE I;  1ZR4 A;  1R5H A;  2MW8 A;  2BY3 A;  1J2X A;  2GIZ A;  4I99 C;  2MD0 A;  3OYM A;  2EZL A;  2JN6 A;  4EM2 A;  1X58 A;  3K4K A;  2NS7 A;  3KYL A;  4XNF A;  3GZ6 A;  5EGO B;  4KFC A;  2BW3 A;  3DFG A;  3DQV C;  3DBR B;  4AID A;  3F8F A;  2CQX A;  1O3R A;  4HEA 2;  2IS4 A;  3KCC A;  2VBZ A;  3OOU A;  3JRB A;  5ILS A;  1K78 B;  2VOO A;  3H0G J;  1YIT I;  1XDS A;  2H09 A;  2DK8 A;  2L0K A;  3ZQI A;  1AHD P;  2FNA A;  2VI6 A;  2W57 A;  2M7B A;  4XLE A;  1MMN A;  3I55 I;  2XDV A;  2R7F A;  2F4M B;  2ACJ A;  1MD0 A;  1QHG A;  3TW6 A;  1MBK A;  1X2M A;  3AG4 H;  4LLL A;  4YIR X;  4A3F J;  3J7Y J;  3MZY A;  2HYG D;  3HSE A;  3MQ0 A;  3VFZ A;  5IYD J;  2DDB A;  2FF4 A;  2IXS A;  2GBY A;  3F0C A;  2P5L C;  3WU0 A;  4AU7 A;  4R79 A;  2GLO A;  1YG2 A;  3SEZ A;  1TP4 A;  2ELH A;  3OS1 A;  3L2W A;  2ZSI B;  4C3I J;  4D5C A;  5LRS A;  4UV9 A;  2KIQ A;  1TL8 A;  1V5G A;  3BJ6 A;  1FSE A;  3HEF A;  3H5R A;  5DUK A;  1LEB A;  5JVG F;  1IGN A;  2ZNZ A;  3LQQ A;  5CJ9 A;  1E3O C;  4HA8 A;  4FE7 A;  1TZL A;  3HRS A;  9ANT A;  5HLT A;  1I1G A;  1ZRD A;  2DLL A;  4KIT B;  4ENM A;  5H20 A;  2EFO A;  3JRE A;  2PMZ A;  3QPS A;  2R92 J;  2KIU A;  3BC8 A;  5IYC J;  1PVE A;  3HG9 A;  4M73 A;  2VJI A;  4FET A;  3AG3 H;  5HDG A;  1BI1 A;  2HQN A;  2UXN A;  5J6X A;  3D5S C;  2Q2E B;  4Y17 A;  2L7F P;  2CRG A;  3BPV A;  2R7S A;  2R3S A;  3E0J B;  3GXO A;  5CYV A;  3V7C A;  1U9N A;  4KN7 X;  1FLI A;  2ZO4 A;  5AIP A;  1D3Y A;  1WJ5 A;  3RZD J;  2BYV E;  2KL4 A;  3SZG A;  1ZLJ A;  1AOY A;  2A6E F;  4KA4 A;  4N4N B;  5L3B A;  3CCL I;  1WVR A;  5GPC A;  5EEG A;  3BQY A;  2F48 A;  3BR0 A;  4XLA A;  5KHD A;  3VPR A;  1XGN A;  3F8M A;  3RCO A;  3LA2 A;  2NVY J;  3BZK A;  3H9J A;  1KA8 A;  1SVM A;  2O0Y A;  4C3J J;  3TW7 A;  1NK3 P;  2IA2 A;  5DEQ A;  1FBQ A;  1LE8 A;  1KQ8 A;  1A35 A;  2KDO A;  1D8K A;  2NOJ B;  3CDH A;  1OJL A;  2VJJ A;  1MSF C;  3S8P A;  3EYY A;  4CCM A;  1JGS A;  2O5R A;  1B6A A;  2RGV A;  1ZHF A;  3GZN B;  1O3T A;  4MIM A;  1RR8 C;  4II2 A;  1W36 D;  1HOM A;  2I10 A;  5CQG A;  2PI0 A;  1GV5 A;  3EUH C;  3WTT C;  4D7M A;  4II3 A;  1X3W B;  3CC4 I;  3WTZ A;  2G7U A;  1WJC A;  3A2K A;  4A0X A;  3QOD A;  4PJ0 C;  3M9A A;  4CSW A;  2IT0 A;  4BBR J;  1PDN C;  5H6Q A;  4J00 A;  2VAS A;  5J4Y A;  4IX7 A;  1YX5 A;  3C2B A;  3LL7 A;  5FGM A;  4XKB A;  2LY1 A;  5HS7 A;  4XRM A;  1ORK A;  2ZXH A;  3BR5 A;  2PJR B;  5J8F A;  3V8J A;  3E97 A;  3ZR8 X;  5F0H A;  3S14 J;  2EFP A;  3LFK A;  4KJZ A;  5EEH A;  4ESB A;  1T0F A;  2P0W A;  3AFH A;  5JHF A;  4P96 A;  2QEX I;  4CCJ A;  4FHT A;  2ZXW H;  3O8G A;  3GFJ A;  2VQG A;  2V6E A;  5E17 F;  3C1D A;  4JQF A;  5C4X J;  2YU3 A;  2QGU A;  2VKE A;  2Y9Y A;  2MFZ A;  1MBJ A;  4BXX J;  4M6V A;  3LAP A;  3FXJ A;  1L3L A;  1UG0 A;  1SFE A;  2GQQ A;  1A31 A;  3E6B A;  4M74 A;  2H8W A;  2OZU A;  1SFO J;  4IJA A;  1IO2 A;  1DGW Y;  5B1B H;  2FBI A;  3CCJ I;  2QQA A;  3DEU A;  2UWM A;  3CES A;  3PO2 J;  4OIP F;  3OYF A;  3CC2 I;  1UFM A;  1WPK A;  5D5V B;  1B9N A;  2BHY A;  2L4A A;  3DKY A;  2KZV A;  4XQF A;  1SFU A;  1MH4 A;  2XF6 A;  1D8J A;  1MMD A;  4U7D A;  1XGO A;  2FXA A;  2H27 A;  3E5U A;  1HLV A;  3MKL A;  3WGG A;  1W7P D;  3REO A;  4XL9 A;  4LGW A;  4XMY A;  3J7A O;  2KJC A;  5E8G A;  4PFO A;  5TGT A;  1VQ5 I;  2XPV A;  4PJL A;  1O3S A;  1WH5 A;  2WV0 A;  2Z33 A;  4AWX B;  3L2U A;  4IOA F;  2YUS A;  3OMY A;  3WTX C;  1WJE A;  4JK1 X;  3P9K A;  3E1S A;  2GWR A;  5FLM J;  4E7Z A;  5M5Y J;  2HDC A;  3BG3 A;  1R4N B;  4HF0 A;  2DW4 A;  1FP2 A;  2GZW A;  2FQ4 A;  5D6E A;  1VQP I;  3Q5F A;  1XSX A;  2RNJ A;  3K4C A;  3FMS A;  1OCT C;  1ZN2 A;  1BM9 A;  1LDK B;  1BR1 A;  1JI8 A;  4UB8 C;  1HW1 A;  4UUV A;  5D5W B;  3L2R A;  2J5P A;  2Y48 A;  4I02 A;  1X4P A;  3RIR A;  2JVG A;  2XKO A;  2X6O A;  4RM2 A;  4DYQ A;  1UZC A;  2CS3 A;  3BG7 A;  3LSH A;  4XN3 A;  1LEA A;  1EH8 A;  2W48 A;  4HBL A;  4M9Z A;  5LFA A;  3BG5 A;  3E5X A;  2FSW A;  1XMA A;  3CUQ B;  4N9H A;  3VDX A;  2Y9Z A;  3LMM A;  2ZXJ A;  3P9I A;  2RN7 A;  2R7Q A;  1SAU A;  3FK6 A;  3SHF A;  3ZQH A;  2Y2Z A;  1H8A C;  2ECC A;  3SJM A;  3O6B B;  3ZPL A;  4AIJ A;  4Q5S F;  1OR7 A;  3LFU A;  1FOW A;  1B1B A;  2AO9 A;  4WXD A;  1YRN B;  3JRD A;  4DQ2 A;  3V7S A;  3GEZ A;  1ZEL A;  1DPU A;  3DTK A;  4JOM A;  3U9G A;  3B73 A;  4NDL A;  2CW0 F;  1HBX G;  2CQN A;  2XGC A;  5FFZ A;  2IA0 A;  1KU7 A;  5F08 A;  1DGR M;  2E1N A;  4L0Z B;  1QO0 D;  4OIO F;  2FNP A;  3A0H C;  2CJJ A;  1B8I B;  2NS8 A;  3KP2 A;  4IQJ A;  1MMG A;  5J8C A;  1F36 A;  2Z16 A;  4J01 A;  3VYU B;  1K83 J;  1OCO H;  2PJP A;  4LD5 A;  4O5V A;  5GAG J;  4BKX A;  2MD5 A;  3GCM A;  3I59 B;  2JMW A;  2XB5 A;  3TMO A;  4NBQ A;  5B66 C;  2EZI A;  3ABM H;  2CW7 A;  2BXZ A;  4EEF G;  1X2N A;  1WFX A;  4OU0 A;  2WV1 A;  1B72 A;  3ZOB A;  2YPR A;  3HL2 A;  3F23 A;  5AON A;  3ABU A;  3RYP A;  4AIK A;  4Y52 J;  3ERE D;  3RTR A;  3GVA A;  1FOY A;  4BE0 A;  1G3W A;  4CGZ A;  2DOF A;  1IXR C;  2H1L A;  2F5D A;  5EDN A;  1FTT A;  2DU9 A;  2PMU A;  5J4V A;  3DBH B;  4QLC U;  2L5Q A;  1FZP B;  1R36 A;  3CJN A;  2R7Z J;  1ETY A;  4A6E A;  2W25 A;  3MAJ A;  2X0L A;  3RJP A;  1WGX A;  1Z77 A;  5HS9 A;  2FX0 A;  1FOK A;  3QPT A;  4C3H J;  1SMT A;  2XRL A;  3DKX A;  4LIT A;  1NK2 P;  2LBF A;  3S2W A;  4M6X A;  2JA5 J;  1W5C C;  2YR2 A;  4IRI A;  3TOB A;  2QLZ A;  4MLO A;  4M3G A;  2O7O A;  3OYI A;  5J40 A;  1VQO I;  4BQN A;  2DYS H;  1QBJ A;  3G71 I;  3HOU J;  5L3G A;  4RA2 A;  5DD4 A;  3DKW A;  2R7O A;  4IHT A;  3S1R J;  1ETQ A;  3AL0 C;  2K27 A;  4B09 A;  4I98 B;  1JXS A;  3S1Q J;  4EJT A;  1IRG A;  3NWT A;  1P7I A;  4BU2 A;  1MJ9 A;  4ZYH A;  3RYR A;  2V1N A;  5LLQ A;  4I2O A;  1Q1H A;  3LNQ A;  5E3M A;  2X6W A;  1R23 A;  3CP8 A;  3A02 A;  5M5X J;  2HWV A;  2R5Y B;  2LKP A;  3G3Z A;  3M8J A;  2HR3 A;  3QU6 A;  2DJN A;  4XKV A;  4D7N A;  2KIS A;  4NUB A;  4UY8 I;  1NTC A;  3BCA A;  3OIO A;  5CPR B;  2XRN A;  3HGY A;  4A3G J;  3GFM A;  4EVI A;  1LFP A;  3FKJ A;  1W0U A;  1KZH A;  2WC2 A;  2F2E A;  1BI2 A;  4N0B A;  2E2I J;  3B6A A;  2HOE A;  4EM1 A;  2UXX A;  1R6R A;  3IWZ A;  5M3F J;  1KON A;  3JCU C;  1OYW A;  4HQE A;  2HPI A;  4MEX F;  2JA6 J;  1QPI A;  2W84 A;  3KFW X;  1JJ6 C;  2KP6 A;  2RVC A;  1OMI A;  1HKT A;  2D1H A;  3SFI A;  2YX7 A;  1XDU A;  3GWZ A;  4CIC A;  4Y13 A;  3ZMZ A;  5KAI C;  4EJU A;  3CDL A;  3GW2 A;  4AD9 A;  4BEH A;  2LNB A;  1KYW A;  2YX4 A;  4GCV A;  3TO7 A;  4DJA A;  1QA6 A;  4UUS A;  1XCB A;  2AQF A;  4O6J A;  2LDU A;  3K4B A;  3L7W A;  3A0B C;  1I1S A;  2Y30 A;  4LG0 A;  3S32 A;  3VYR B;  5JLW A;  4ENK A;  2K02 A;  3JTG A;  4OMZ A;  4IF4 A;  1J7K A;  3FM5 A;  5EYR A;  2XAF A;  4MQV A;  3D5R C;  3QAH A;  4L0Y B;  4HRI A;  2R7V A;  3IWF A;  3NQO A;  2V1U A;  2LTP A;  4YII A;  3CMA I;  1GT0 C;  2Y0S N;  4W1U A;  1W7P B;  4DZP A;  1H9G A;  3S15 J;  1GLN A;  3ECO A;  3IL2 A;  2BE5 F;  5JVT A;  4XM3 A;  2HFH A;  4YEJ A;  1Z7U A;  4XKC A;  2EIN H;  5IPA A;  3BOQ A;  1BJA A;  4S04 A;  1ZH5 A;  3OY9 A;  1K6Y A;  5BNG A;  3ZRG A;  5FRO A;  1SAN A;  3FBN B;  3IHU A;  1JT6 A;  2CQ7 A;  3QOE A;  3K2Z A;  5D4S A;  4LK1 F;  2XPU A;  2D5V A;  4Y15 A;  3I56 I;  1HQC A;  4RBO A;  4CCN A;  4CZC A;  1N78 A;  1LJ9 A;  4U87 A;  2L2O A;  2C6Y A;  2E5Z A;  5ICE A;  4KIS A;  2M0M A;  5KNL A;  1YIJ I;  2E71 A;  3K1N A;  3JRG A;  1JHF A;  3DP7 A;  2FU4 A;  2K9M A;  1HW2 A;  1WJF A;  5H6R A;  3Q9S A;  1POG A;  2DYR H;  3HYI A;  5F1R A;  4ZJZ A;  3FM3 A;  2IVM A;  2XPW A;  1RUO A;  4MHG A;  2A69 F;  5DUI A;  3BCB A;  2CUF A;  2MLK A;  2V9P A;  3DV8 A;  2XF7 A;  3CO7 C;  1HF0 A;  4A93 J;  4BQO A;  3PUF A;  1W36 C;  4ZZL A;  2JUG A;  1QVT A;  3T8T A;  3HTU A;  1P4A A;  3L2Q A;  3F3X A;  2EPF A;  2BZT A;  2ME0 A;  3VSL A;  1ZRE A;  3OOP A;  3PFI A;  2O8X A;  1KYZ A;  5LGN A;  2M34 A;  4ZH4 F;  1H9T A;  3VYS B;  1G2H A;  1MBE A;  2VOD A;  2V79 A;  2V9V A;  3G1O A;  1YE9 A;  2M2E A;  4LB6 B;  5EGO A;  1DDN A;  5C44 J;  2QUF A;  4PDK A;  3GTG J;  4B44 A;  2OA4 A;  1RI7 A;  5D4R A;  3IV5 A;  4BAC A;  3K1P A;  3V4G A;  2QVO A;  2V6C A;  3Q0W A;  4CH7 A;  3MD2 A;  2VT2 A;  3JAM K;  1LQ1 A;  1APL C;  2K3P A;  1XSV A;  3ABK H;  2A68 F;  2J5O A;  3A1Y A;  1OR7 C;  1DP7 P;  2K4J A;  2FD5 A;  2WAD A;  4F7Z A;  3QWL A;  5BS6 A;  3K70 D;  2IA1 A;  5FKO A;  4XR6 A;  1U9O A;  3LA7 A;  1VQK I;  3N05 A;  1X1A A;  2OU2 A;  3ZMD A;  4A3D J;  1R5G A;  3OYA A;  1FMW A;  3UNG C;  1TNT A;  2OV7 A;  3KIO A;  1FMV A;  4P55 A;  2P5V A;  4M3E A;  4YEL A;  1OQY A;  2HQA A;  2ZKZ A;  5IP9 J;  4I0A A;  4P1W A;  4YG2 F;  1E0E A;  2QA4 I;  4MFD A;  2VN2 A;  1G8X A;  1X3U A;  4I76 A;  3ULQ B;  3K69 A;  2LY2 A;  4G7O F;  4ZZD A;  3T8R A;  2IGN A;  3KP4 A;  4Q48 A;  4WXH A;  3T1B A;  2XGE A;  2B7E A;  5GAE J;  3CCQ I;  4A3E J;  2Q2E A;  2D2W A;  3WTV C;  3PIO F;  1ZR2 A;  1ITY A;  3DTI A;  3T5X A;  1DU0 A;  2KDZ A;  2D45 A;  3IKT A;  1I5Z A;  1EH7 A;  2FMY A;  4XLH A;  1FIA A;  3OYJ A;  3PJR A;  2CFO A;  2F5E A;  3CF2 A;  1XB4 A;  1XG1 A;  1FEX A;  4PGH A;  1Y39 A;  4E7H A;  3PSI A;  1IC8 A;  2Q8K A;  1ETV A;  3ONQ A;  3ZQQ A;  3IRR A;  3FXQ A;  4PJN A;  4BS9 A;  2RRE A;  1TTY A;  3AKZ A;  3M3Y J;  5HVQ C;  3ZN1 A;  2HOT A;  3OIQ A;  1FYK A;  2L9V A;  4L5E A;  2BEO A;  4R8H A;  3ZCO A;  2CW8 A;  1FSH A;  2DA2 A;  3ASN H;  3IKV A;  3QQA A;  4BDZ A;  1YX3 A;  4M9S A;  1VQ4 I;  1XGM A;  3OIP A;  2JRM A;  2ID6 A;  2MH9 A;  2HI3 A;  3DPU A;  1UAA A;  3FXU A;  3HJE A;  3SFZ A;  2E7X A;  2QBY B;  4KMF A;  3RQI A;  4G9Y A;  2DFE A;  4JX4 A;  4LOC A;  4RM3 A;  2VQL A;  3GUD A;  3FWE A;  5H2F C;  3FDY A;  3I54 A;  5M3M J;  3F22 A;  3HXL A;  4C9Y A;  2IPQ X;  2PJR A;  4S0H B;  1AA7 A;  4HF1 A;  4HV5 A;  2DFI A;  3X2Q H;  4X6A J;  1P4X A;  2ZME C;  3F6V A;  3C18 A;  4EGY A;  1QGP A;  3BTJ A;  3HZJ A;  3ZQL A;  4ZTJ A;  3MFK A;  3RSN A;  2F4I A;  1Z3X A;  3O2P E;  4ZYG A;  4DGW B;  3IH2 A;  4V19 K;  1KU9 A;  3WHB A;  5IOZ A;  4QPO A;  5BPD A;  1I3Q J;  3ZQF A;  1D0Y A;  5HDN A;  2GOM A;  2M45 A;  5IT3 A;  4BDY A;  2WB1 N;  1RET A;  2E19 A;  4CCL A;  4U88 A;  1FT9 A;  2CH0 A;  3ZXS A;  2PMZ N;  4MQ9 F;  4DNC A;  1FBU A;  1JE8 A;  4MNU A;  2DMT A;  1ERD A;  1B59 A;  3ZQ7 A;  3KYC B;  3R61 A;  3LQR A;  3LST A;  2V1D A;  2WTE A;  2HNH A;  3W2A A;  4DW6 A;  3Q9V A;  3DPT A;  4CXF A;  2XAQ A;  3HRT A;  4JBA A;  2WB1 A;  4BXU A;  3CMY A;  2JQ7 A;  2Y69 H;  1JKO C;  1E3P A;  1J0R A;  1ZTR A;  3WGH A;  5L3F A;  3HOW J;  4E70 A;  3S1N J;  2CV0 A;  1WH7 A;  1B9M A;  2BHZ A;  2H6B A;  2DJI A;  1T08 B;  4G7H F;  2OTL I;  1IN7 A;  3FXL A;  2VPL A;  3F8C A;  3S2H J;  3IAS 2;  1I6X A;  4L5J A;  1N25 A;  2BY2 A;  4NC6 A;  4CO8 A;  1VND A;  4BH9 A;  3DF8 A;  1V5F A;  1GV2 A;  1RC9 A;  2K9Q A;  3OYE A;  4QSH A;  1HSJ A;  2G9W A;  4OMY A;  3DBL B;  3Q0V A;  3JSO A;  4AVZ A;  2TDX A;  5IT9 Z;  2OQG A;  3ZQC A;  5IYB J;  5FLX K;  4ETS A;  4KDP A;  3DCF A;  3EUK L;  2HTS A;  2OD5 A;  3R60 A;  1K7A A;  1ZG1 A;  3EYI A;  1ZRF A;  1P92 A;  3RQ4 A;  4V2F A;  2K85 A;  5FKM A;  1HST A;  4BHP A;  3M1E A;  3CUQ A;  5DYM A;  5IY5 H;  1P2F A;  3KEY A;  1T95 A;  4OIR F;  4ZYD A;  5IP7 J;  1Z3Y A;  2LRE A;  1TWC J;  3LSI A;  1ETX A;  2FUG 2;  3CMM A;  4ZYA A;  4UV8 A;  4XID A;  4BYY A;  1K4T A;  3ESW B;  2W00 A;  4YFX F;  1X19 A;  1UHM A;  3CD6 I;  2COM A;  1ON1 A;  5GAH J;  1YRN A;  1Z6T A;  4DOZ A;  1RR7 A;  4XIC A;  3B6C A;  1SVO A;  1HDP A;  1UB9 A;  2QM3 A;  2DTZ A;  1AU7 A;  2STT A;  4KYW A;  3OR2 C;  2BV6 A;  2KQR A;  3KZI C;  4HLX A;  3JTH A;  4R1H A;  1JT0 A;  3SZP A;  1ACI A;  2LKX A;  2RAE A;  1R7J A;  4A5M A;  3WTY C;  1FX7 A;  4QTR A;  2LLK A;  5E1X A;  2X85 A;  1B8I A;  3OYC A;  2X1E A;  2XSJ C;  3BY6 A;  3VSK A;  1TW2 A;  3HB9 A;  3ABL H;  5CLS A;  1U5T B;  2ELJ A;  5D5X B;  3WTW C;  4BE2 A;  4EJV A;  4XSX F;  4A0Y A;  5HOD A;  1BC7 C;  4G6Q A;  4P5O A;  1DP3 A;  3RKX A;  4F91 B;  2M8E A;  1A6I A;  3I59 A;  1XMX A;  4BJ5 C;  3H1C A;  2NYX A;  3W6J B;  4WCG A;  2IS2 A;  1S7E A;  5HLH A;  2XHK A;  5F0C A;  4FX4 A;  5L3C A;  3KP7 A;  1LFU P;  4HDU A;  1EH6 A;  5HNH A;  3CCS I;  1R9T J;  1R22 A;  2BY1 A;  2L9N A;  4HSR A;  3RKQ A;  1IW7 F;  1B4A A;  2PMH A;  2H1K A;  2HQR A;  3DPL C;  5HDK A;  1JKR C;  4N9I A;  1UCR A;  2MC3 A;  1R1T A;  2EIM H;  5F64 A;  5E20 A;  3BJA A;  2DFH A;  4NC7 A;  1I3A A;  4ABZ A;  3QYE A;  2LF8 A;  3KZZ A;  3I3L A;  2R5Z B;  5JI6 A;  2PFB A;  2QEN A;  5EF6 A;  5KCM A;  4I7H A;  1ON2 A;  2QWW A;  3KZY A;  4M3F A;  1TT5 B;  1MH3 A;  2FOW A;  4AUX A;  4HAM A;  5BPI A;  1KQ0 A;  2R7D A;  5LGU A;  3LSP A;  1I39 A;  4I6Z A;  3QU3 A;  3GTJ J;  3UKG A;  3RKW A;  2G0E A;  4L9N A;  5ED4 A;  3MZH A;  1A5J A;  2B9S A;  3IRQ A;  4MFE A;  3FMR A;  2X6X A;  3DLA A;  2R5Y A;  1IRF A;  3U1D A;  3KET A;  3SEQ A;  2IGM A;  5FJ8 J;  3OYH A;  5FLV A;  1TW3 A;  1BL0 A;  1W4M A;  5IP6 A;  2B63 J;  4ESJ A;  4GXO A;  4LLN A;  4UB6 C;  2HVQ A;  2DA5 A;  1Y1V J;  2IGO A;  2XGX A;  2OQR A;  2VJ4 A;  2W85 A;  4RB3 C;  1A36 A;  3HOS A;  4FTH A;  2FRH A;  2R93 J;  1Z7L A;  2KRC A;  3FMQ A;  1HC8 A;  3FXR A;  3UR3 C;  2EQR A;  3K10 A;  2OZ6 A;  2WY8 Q;  3H36 A;  4ITV A;  3HPH A;  5LGT A;  2P8T A;  1R1V A;  5J47 A;  3PSF A;  1VQ9 I;  2FQ3 A;  1WWX A;  1FYL A;  4M6Y A;  3OYB A;  2EIK H;  2ZFW A;  1SD5 A;  1IAW A;  4A3B J;  1BOB A;  1SD4 A;  2K9S A;  2KRF A;  3U2R A;  1J5Y A;  2E1M B;  2VBY A;  1FJL A;  4XRS G;  3HSR A;  3H9Q A;  2DTR A;  2M5W A;  2HXO A;  1YI2 I;  3CQZ J;  2XGD A;  1GXQ A;  4UVA A;  4CHU A;  2JA8 J;  3H0D A;  1I27 A;  4A0Z A;  1STZ A;  2TCT A;  2NXN B;  3RDI A;  1HDD C;  4LG3 A;  1W7P A;  4HOB A;  1FPQ A;  2JZY A;  2HVS A;  1G3T A;  1NHA A;  3FXO A;  3SZT A;  4EM0 B;  2W4S A;  3GTO J;  4C30 A;  2KPM A;  3A4C A;  3Q3S A;  1KU2 A;  3O8H A;  3ABT A;  4DYC A;  2R4G A;  3DU5 A;  4U0V A;  5EEA A;  3PO3 J;  2ZJQ F;  1S5L C;  3JAM Z;  1TLH B;  2A5Y B;  2WBM A;  2E35 A;  4LIU A;  1EKE A;  2H94 A;  5B5E C;  2HXI A;  2LH9 A;  2CU7 A;  3IH3 A;  3HRM A;  1BOA A;  1OCR H;  3WTU C;  1O7L A;  2VE8 A;  1YW7 A;  5IT9 K;  4GRI A;  1T38 A;  1V54 H;  4BNC A;  3TDU C;  4G94 A;  2QSG X;  4RAY A;  1D1B A;  3HRU A;  4B3A A;  2KT0 A;  1SAX A;  2IAI A;  3IH4 A;  3QP5 A;  4KT5 C;  2NOG A;  5LBQ A;  2HOS A;  2FA5 A;  1OYY A;  1S7O A;  1YJ9 I;  3P7N A;  2HQ5 A;  1EF4 A;  4N4O B;  1H88 C;  1K6O A;  1WJB A;  2A61 A;  2UV1 A;  1ONV A;  4GYG A;  2DOA A;  1PJR A;  3RPU D;  3OYL A;  3OS0 A;  1HKS A;  4MO7 A;  2MBF A;  3KLO A;  1QVU A;  2VT3 A;  4BGD A;  2IRF G;  3ROU A;  2XVC A;  1V55 H;  4HNV A;  3C2G A;  3S17 J;  2QZ8 A;  3F21 A;  3M07 A;  2VQC A;  2EFN A;  4U0W A;  3KPH A;  3JRA A;  2CV1 A;  3OSF A;  3AG2 H;  2LP0 A;  1FNN A;  4RGS A;  3VB2 A;  3G73 A;  3LSG A;  4A3M J;  5ICF A;  3RKY A;  2ZB9 A;  2ZCW A;  2DA1 A;  2Z9O A;  4Y33 A;  1Q1V A;  3D0S A;  3F9K A;  5D6F A;  3JRF A;  3CUQ C;  3COA C;  1F1Z A;  2XC7 A;  4RGX A;  4BY7 J;  5LEJ A;  3BRO A;  3HOZ J;  1FTZ A;  5ILU A;  2QQ9 A;  3E3V A;  2OAZ A;  1BA5 A;  4XLC A;  3I64 A;  2CSO A;  3I4N J;  3ASO H;  2HDW A;  4IL6 C;  2JPB A;  1ZLK A;  1Y0N A;  3EPZ A;  4JX6 A;  4UVB A;  1T98 A;  3CP2 A;  2P81 A;  2HYJ A;  1YJN I;  2PBI A;  2O8K A;  2LVS A;  1IUF A;  3HSF A;  4ANJ A;  4TV7 A;  2CUZ A;  3CCV I;  3S1M J;  2OPT A;  3WU2 C;  4CYD A;  3TDZ C;  4MTE A;  4IHX A;  1MIJ A;  4E4H A;  4FT8 A;  2QKM B;  3G1M A;  2Y0M A;  2X48 A;  1TWF J; 
#chains in the Genus database with same CATH homology
 5K7Z A;  3RZD J;  5E3N A;  1BW6 A;  3RZO J;  2FJ1 A;  4IHW A;  1JKP C;  1GVD A;  4IEJ A;  1LE8 B;  2TRT A;  2XGE A;  5F04 A;  5GPC A;  4A3E J;  3BQY A;  2MGQ A;  3BR0 A;  1U78 A;  3VPR A;  4M3D A;  1ZR2 A;  3FIW A;  2NVY J;  3HOX J;  1ITY A;  1DU0 A;  2KDZ A;  2HOT A;  4C3J J;  3TW7 A;  4DZJ A;  1NK3 P;  1FIA A;  4BY1 J;  5DS9 A;  2DA4 A;  1XG1 A;  1LE8 A;  1FEX A;  3A01 B;  2LD5 A;  2VKV A;  5K7F A;  1OJL A;  1IC8 A;  1MSF C;  3GTL J;  3GBG A;  1ETV A;  4UUT A;  1JJ8 C;  1ZKG A;  4MIM A;  2DMN A;  3M3Y J;  1HOM A;  2EZH A;  2I10 A;  1GV5 A;  4D5F A;  4L5E A;  2DMP A;  4D7M A;  5F27 A;  2WAQ N;  3A01 A;  3S16 J;  4BBS J;  4M3B A;  5GPA A;  2DA2 A;  4BBR J;  4FE4 A;  3QQA A;  3C2B A;  2ME6 A;  1D5Y A;  2ID6 A;  2HI3 A;  1U8B A;  4XRM A;  1ORK A;  1RPW A;  3BR5 A;  3G1L A;  5F0H A;  3S14 J;  4A3K J;  3BQZ A;  3RQI A;  3HOY J;  2AHQ A;  2LK2 A;  4JX4 A;  4LOC A;  5DTD A;  5M3M J;  3O8G A;  2DMQ A;  4S0H B;  5C4X J;  1IJW C;  2VKE A;  2Y9Y A;  4X6A J;  4A3C J;  1MBJ A;  3SDG A;  4BXX J;  1UHS A;  4M6V A;  1MSE C;  1SFO J;  3BTJ A;  3ZQL A;  2MG4 A;  2M9H A;  2K9N A;  2MSY A;  3PO2 J;  4AC0 A;  3K7A J;  2M8G X;  2O9L A;  4IHV A;  3IH2 A;  2L7Z A;  2H8R A;  3WHB A;  1WPK A;  2COB A;  5IOZ A;  1I3Q J;  3ZQF A;  3LOC A;  4B1R A;  5E3L A;  1MH4 A;  3TP3 A;  2CQQ A;  2WB1 N;  1RET A;  2E19 A;  2X9D A;  1HLV A;  2QF7 A;  3MKL A;  1OFC X;  2PMZ N;  3BTI A;  4CYC B;  2VPR A;  2DMT A;  1IV6 A;  1JKQ C;  3K2A A;  3QPL A;  1UMQ A;  2XPV A;  1WH5 A;  1GUU A;  2NVQ J;  4G12 A;  1JTY A;  2YUS A;  2EZK A;  1PUF B;  4AYB N;  4DW6 A;  3D1N I;  5FLM J;  5M5Y J;  3TED A;  2ELK A;  3BG3 A;  4W97 A;  4CYC A;  1ETK A;  1ETO A;  2FQ4 A;  3CMY A;  1WCM J;  3JRI A;  1OCT C;  1JKO C;  1ZTR A;  3HOW J;  5EZG A;  3S1N J;  1JUM A;  1WH7 A;  2XSD C;  3LSR A;  2QCO A;  4A3I J;  2X6O A;  3S2H J;  4DYQ A;  4V2G A;  1VND A;  1VI0 A;  2W48 A;  4JP0 A;  4A3J J;  2M0C A;  3BG5 A;  1GV2 A;  1FIP A;  3HDD A;  2Y9Z A;  2K9Q A;  2L9R A;  4QSH A;  1W0T A;  3Q0V A;  2LY9 A;  3ZQC A;  5IYB J;  3ZQH A;  3FK6 A;  3W6V A;  1MNM C;  2Y2Z A;  1H8A C;  3GTQ J;  3DCF A;  2ECC A;  1WI3 A;  3SJM A;  1LFB A;  1IG7 A;  4V2F A;  5FKM A;  5EZH A;  4Y7N J;  2AO9 A;  1YRN B;  3L1P A;  3JRD A;  1RES A;  5IP7 J;  1TWC J;  1ETX A;  5J3L A;  4FIS A;  4NDL A;  4XID A;  1ZK8 A;  2DA3 A;  2XGC A;  5F08 A;  3A03 A;  4FCY A;  1YRN A;  2CJJ A;  3HM5 A;  1B72 B;  1RR7 A;  4XIC A;  1B8I B;  1T56 A;  2NS8 A;  3B6C A;  1HDP A;  5J1U A;  1F36 A;  2DTZ A;  1AU7 A;  3BTL A;  1HCR A;  5C3E J;  1K83 J;  1JT0 A;  2ID3 A;  2LKX A;  2RAE A;  4BKX A;  2NVX J;  2JMW A;  2XB5 A;  4QTR A;  1TWA J;  2LLK A;  1VF9 A;  2EZI A;  4EEF G;  3HBL A;  1X2N A;  3DEW A;  2WV1 A;  1B72 A;  1B8I A;  3LSJ A;  3ZOB A;  3HB9 A;  2IBD A;  4Y52 J;  4QIW N;  3E7L A;  2VUM J;  5HOD A;  2JWT A;  1A6I A;  5EDN A;  1QRY A;  1FTT A;  3NAR A;  1S7E A;  4B4C A;  2L7M P;  2DA6 A;  2R7Z J;  1ETY A;  5F0C A;  1WGX A;  1Z77 A;  2YS9 A;  2FX0 A;  4C3H J;  4X1E A;  5M5W J;  5F1J A;  2XRL A;  1LFU P;  1Z0X A;  1ENH A;  1NK2 P;  1R9T J;  2JA5 J;  3RKQ A;  4MLO A;  3FK7 A;  3ZQG A;  4XRS A;  4M3G A;  2O7O A;  2H1K A;  1JKR C;  2E2H J;  1XS9 A;  3HOU J;  5EG0 A;  2GM4 A;  2NVT J;  1VFC A;  4J19 A;  3S1R J;  1ETQ A;  3S1Q J;  1P7I A;  2JJ7 A;  4ABZ A;  3BR6 A;  2CUE A;  2R5Z B;  2YU9 J;  4GFB A;  3GTP J;  2JK3 A;  5EF6 A;  1AKH B;  3LNQ A;  5E3M A;  1F43 A;  3CCY A;  1ZGW A;  3TP0 A;  3A02 A;  5M5X J;  5FKL A;  4IHY A;  2R5Y B;  4RDU A;  4M3F A;  1U9N A;  1K61 A;  1MH3 A;  4AUX A;  2DJN A;  1P7J A;  3PM1 A;  4D7N A;  3LSP A;  1NTC A;  2R5Z A;  3OIO A;  2K40 A;  3JRC A;  4I6Z A;  3HGY A;  4A3G J;  3GTJ J;  3UKG A;  1AKH A;  2G0E A;  1IDY A;  2LFB A;  3FKI J;  1A5J A;  1W0U A;  2HOA A;  4MFE A;  2E2I J;  1RKW A;  3B6A A;  5FKN A;  2R5Y A;  5M3F J;  5IOY A;  5FJ8 J;  5FLV A;  1BL0 A;  4UUS B;  5IP6 A;  2B63 J;  2JA6 J;  1ETW A;  1QPI A;  1JJ6 C;  1MBF A;  2DA5 A;  1Y1V J;  3SFI A;  1ZQ3 P;  1TWH J;  4FTH A;  3CDL A;  5FKK A;  2DMU A;  2R93 J;  4UUS A;  1T33 A;  2EQR A;  2Y30 A;  1RKT A;  5JLW A;  2JA7 J;  1BJZ A;  1IDZ A;  5F0F A;  1JGG A;  2LR8 A;  5EYR A;  5J1Y A;  4A69 C;  3BTC A;  1I6H J;  2LTP A;  3BR2 A;  4A3B J;  3WHC A;  2K9S A;  2Y0S N;  3JR9 A;  1GT0 C;  4W1U A;  4DZP A;  3S15 J;  3BT9 A;  1FJL A;  4XRS G;  3MVP A;  2HXO A;  3CQZ J;  1JUS A;  3OSG A;  2XGD A;  2JA8 J;  3I4M J;  2TCT A;  4DYR A;  1OCP A;  5IPA A;  1HDD C;  1MBH A;  2EBI A;  1JUP A;  3HOV J;  2EH3 A;  5BNG A;  5E3O A;  1TWG J;  1SAN A;  1JT6 A;  3S2D J;  3MN2 A;  3H3V K;  3GTO J;  2XPU A;  1DU6 A;  3Q3S A;  2D5V A;  2Y31 A;  3O8H A;  4XK4 A;  4DYC A;  5JLX A;  5EEA A;  4RBO A;  3PO3 J;  2R0Q C;  1IRZ A;  2HXI A;  5C4J J;  2CU7 A;  2E1O A;  3IH3 A;  1GDT A;  3JRG A;  4C2M J;  2XB0 X;  5EG0 B;  1POG A;  2ECB A;  2E2J J;  1ZR4 A;  2IEK A;  2MW8 A;  2XPW A;  4B3A A;  2KT0 A;  3BG9 A;  2CUF A;  4A93 J;  1HF0 A;  2IAI A;  3IH4 A;  2NOG A;  3Q0U A;  2EZL A;  2HOS A;  2JN6 A;  1X58 A;  2HDD A;  2NS7 A;  2N8G A;  2HQ5 A;  1EF4 A;  1QVT A;  1H88 C;  5EGO B;  4A3L J;  4MO7 A;  1BW5 A;  2ME0 A;  2CQX A;  3OOU A;  3JRB A;  2M34 A;  1QVU A;  3GTK J;  1G2H A;  3H0G J;  3FIS A;  1MBE A;  5GP9 A;  3BR3 A;  1JTX A;  3G1O A;  2L0K A;  2M2E A;  4HNV A;  3S17 J;  5J1R A;  5EGO A;  3ZQI A;  5C44 J;  1AHD P;  3GTG J;  2VI6 A;  1CQT A;  3JRA A;  3IV5 A;  3OSF A;  2LP0 A;  3TW6 A;  3LSG A;  1MBK A;  1X2M A;  4A3M J;  4A3F J;  3Q0W A;  2ZB9 A;  5IYD J;  2DA1 A;  2DN0 A;  1Q1V A;  2GBY A;  1APL C;  3F0C A;  1O4X A;  2DA7 A;  3JRF A;  2GLO A;  2FD5 A;  1MBG A;  4BY7 J;  4C3I J;  4D5C A;  5FKO A;  3HOZ J;  1FTZ A;  3HEF A;  3GTM J;  1BA5 A;  1U9O A;  4JYK A;  3HKZ N;  1IGN A;  3BR1 A;  3I4N J;  1E3O C;  4FE7 A;  4A3D J;  4JX6 A;  3HGG A;  1XC5 A;  5K7H A;  9ANT A;  2P81 A;  2HYJ A;  1Y1W J;  1UG2 A;  2O8K A;  2LVS A;  1IUF A;  4M3E A;  3NAU A;  3JRE A;  3QPS A;  2R92 J;  1I50 J;  5IYC J;  5IP9 J;  3S1M J;  2OPT A;  1PUF A;  3JRH A;  2OF7 A;  3M4O J;  1H89 C;  4MFD A;  2L7F P;  2CRG A;  1TC3 C;  4I76 A;  4IHX A;  4JX5 A;  3G1M A;  2X48 A;  1TWF J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...