2KDZA

Structure of the r2r3 dna binding domain of myb1 protein from protozoan parasite trichomonas vaginalis in complex with mre-1/mre-2r dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
107
structure length
107
Chain Sequence
KVKFTEEEDLKLQQLVMRYGAKDWIRISQLMITRNPRQCRERWNNYINPALRTDPWSPEEDMLLDQKYAEYGPKWNKISKFLKNRSDNNIRNRWMMIARHRAKHQKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structural analysis of DNA recognition by a novel Myb1 DNA-binding domain in the protozoan parasite Trichomonas vaginalis.
pubmed doi rcsb
source organism Trichomonas vaginalis
molecule tags Transcription/dna
molecule keywords MYB24
total genus 29
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13921 Myb_DNA-bind_6 Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2kdzA01
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2kdzA02
4B4CA 2JA6J 4DYCA 1U8BA 4CYCA 4MFDA 2VKEA 3HBLA 2JA7J 2R5ZB 4W97A 5FLVA 2COBA 2X48A 2DMUA 1O4XA 5J1RA 1B8IA 3GTQJ 2KT0A 5EZHA 1WH5A 3O8HA 1SFOJ 2XGEA 2P81A 2E1OA 4UUSA 1U9NA 5F08A 2DA3A 1VFCA 4AC0A 4IHVA 2LVSA 2CU7A 2TCTA 3K7AJ 2YU9J 1ETKA 3RZOJ 4JP0A 2EQRA 2R5YA 1RR7A 1X58A 3BG5A 4D5CA 2FQ4A 2XPWA 3BT9A 5GP9A 3K2AA 3TP3A 5F0HA 4IHXA 3JRFA 4A3EJ 3C2BA 2CQQA 1LE8A 3I4MJ 1UHSA 1NTCA 1FTZA 2VI6A 2HI3A 3MVPA 3JREA 1SANA 3S1QJ 5BNGA 5FKMA 3G1LA 2NVYJ 3RQIA 4MLOA 2TRTA 4EEFG 1FJLA 5EYRA 1LFBA 5IP9J 1JJ8C 4D7MA 4M3GA 1RESA 2EBIA 3LSGA 4A3CJ 2M8GX 3D1NI 4M3BA 3GTGJ 2DMTA 1ENHA 4A3LJ 4UUSB 3IH2A 2RAEA 2GBYA 1I6HJ 3FKIJ 2G0EA 1TWCJ 3O8GA 1JUMA 5IP7J 3TW6A 2W48A 4V2GA 1AHDP 2JK3A 1ZTRA 2CUEA 4FISA 5F0CA 4M3DA 4MO7A 4D5FA 2XB5A 2GLOA 4ABZA 5E3LA 3GBGA 3OSGA 4LOCA 1AU7A 2L7MP 3WHBA 5EG0B 1DU0A 4AUXA 3JR9A 3S16J 1JUSA 1H8AC 2M2EA 2LD5A 4A69C 1VI0A 2ZB9A 5GPCA 4M3EA 1MBHA 5IYDJ 1S7EA 1T33A 2LY9A 5F1JA 5IOZA 1TWHJ 4HNVA 5K7ZA 4DZPA 3BTCA 4JX5A 5EDNA 1HOMA 3PM1A 5FKOA 2MG4A 3LSJA 4QSHA 1U9OA 1IGNA 3TW7A 3ZQFA 1ITYA 2HXOA 2LK2A 2R93J 2HOSA 1IV6A 2IEKA 1HDDC 1ZGWA 5EG0A 2DA6A 1ETOA 2XPVA 1F43A 5IP6A 3F0CA 2XRLA 3GTKJ 1APLC 2HOAA 3W6VA 3HOXJ 2E2HJ 3HM5A 3HB9A 4V2FA 3CMYA 5EF6A 3SJMA 2H8RA 1TWFJ 1GV5A 3ZQCA 5K7FA 3HGYA 2WV1A 4BKXA 1R9TJ 2WAQN 5FKNA 3CCYA 1LE8B 2VUMJ 1ORKA 1RETA 1ETWA 1HDPA 2L0KA 4A3GJ 5F0FA 1ETYA 1VF9A 4QTRA 4X1EA 1MBEA 4C3HJ 4NDLA 2YUSA 4IEJA 1ETQA 1BW6A 4UUTA 1JT0A 1ZK8A 2DTZA 3NAUA 3PO3J 2ECBA 2HYJA 2MSYA 1B72A 4BXXJ 3HOZJ 1P7IA 4A3BJ 3LOCA 4BY1J 2OF7A 2VPRA 4Y7NJ 2EZIA 3G1MA 2NS7A 3FK7A 1OFCX 1WI3A 5FKKA 3OSFA 4DYQA 3DCFA 1D5YA 5C4JJ 1CQTA 2IBDA 2JWTA 4BY7J 2NVXJ 4C2MJ 1TWGJ 5IPAA 3IH4A 5DTDA 2XSDC 1WCMJ 2AO9A 3ZQGA 4J19A 3WHCA 4M3FA 2CQXA 3SFIA 1AKHB 1X2MA 3Q3SA 2NOGA 2HXIA 1B72B 2XGDA 2OPTA 2DMPA 5M5XJ 3BR6A 2HDDA 5F27A 4XK4A 3LNQA 3HEFA 2KDZA 3ZQHA 1HLVA 3QPLA 3ZQIA 1JJ6C 1A5JA 1JT6A 4QIWN 1Z77A 5J1UA 3JRBA 4M6VA 1MH4A 1W0UA 1K83J 4B3AA 3LSPA 2DMQA 3B6CA 2MW8A 3PO2J 2E2IJ 1MNMC 5C4XJ 5EGOB 3CQZJ 3Q0VA 1ZR4A 1JKQC 5FKLA 3VPRA 2O7OA 4I6ZA 4XRSA 1MBKA 1AKHA 4A3IJ 2M9HA 3GTOJ 1GV2A 4XIDA 2DA2A 2QF7A 2FX0A 4FE4A 1BW5A 2E19A 2WB1N 3TEDA 4B1RA 4A3FJ 1MSEC 1A6IA 4JX6A 5IOYA 1K61A 2JA8J 5FJ8J 4A3JJ 1GDTA 3S2DJ 3L1PA 2O9LA 2R7ZJ 4XRMA 2EZKA 5J3LA 3H0GJ 5M3MJ 2NVQJ 4X6AJ 3JRIA 3HOVJ 3HDDA 2DN0A 4MFEA 4IHWA 1OJLA 2I10A 2VKVA 1BL0A 3HOUJ 1BA5A 1HF0A 2Y9YA 1IC8A 3FK6A 1W0TA 2DA7A 1PUFB 4AYBN 2K9SA 2X9DA 1X2NA 4A3DJ 1P7JA 3LSRA 1NK3P 1EF4A 1B8IB 4D7NA 2QCOA 3BG9A 1BJZA 3JRAA 3FIWA 1ZQ3P 1XG1A 1MSFC 2FD5A 4L5EA 2Y0SN 1MH3A 1JKRC 3IV5A 1UG2A 3QPSA 4I76A 2L7ZA 5IYCJ 1POGA 1TWAJ 2YS9A 3A03A 2NVTJ 3HGGA 3HOYJ 3GTPJ 2R5YB 4W1UA 2EH3A 1H89C 1JTYA 3MN2A 1OCTC 3BTIA 1YRNA 2R0QC 3UKGA 2ID3A 5M5YJ 2LFBA 1WH7A 2XGCA 1F36A 3OIOA 1PUFA 2LP0A 4C3JJ 3JRDA 2HQ5A 2DA5A 2CUFA 2EZHA 3M4OJ 5K7HA 4C3IJ 3A02A 1G2HA 1IDYA 1FIAA 5C3EJ 1XC5A 3S14J 1JTXA 2ELKA 2JMWA 2R5ZA 5GPAA 4CYCB 2AHQA 1IG7A 4FE7A 1MBJA 2O8KA 3H3VK 3S17J 3S1NJ 2JN6A 4Y52J 2DMNA 4G12A 4XRSG 4BBSJ 1RPWA 2DA4A 2JJ7A 1JGGA 1YRNB 1I3QJ 3Q0WA 2E2JJ 4JYKA 3NARA 5JLWA 2DA1A 5M3FJ 2LTPA 1ETXA 3BQZA 1MBGA 2K9NA 4DYRA 5EGOA 1NK2P 2ME0A 4S0HB 1U78A 2FJ1A 2H1KA 2MGQA 2R92J 5DS9A 2D5VA 1JKPC 3S1MJ 2M0CA 4A3MJ 3S1RJ 2DJNA 3BTJA 3MKLA 1RKWA 3BR3A 3Q0UA 3OOUA 5E3OA 3JRHA 3ZOBA 3B6AA 3HKZN 1T56A 5FLMJ 1GT0C 2HOTA 4FTHA 1FIPA 1Z0XA 3CDLA 5HODA 1QVTA 1ETVA 2B63J 1WPKA 2M34A 2IAIA 2Y9ZA 4DZJA 3SDGA 1QRYA 2LR8A 5EZGA 1E3OC 5M5WJ 2Y2ZA 2GM4A 4BBRJ 5EEAA 1GUUA 1JUPA 1RKTA 2Y31A 5C44J 1OCPA 4DW6A 1MBFA 4RBOA 2ME6A 1QVUA 3JRCA 2N8GA 1QPIA 1Y1WJ 2L9RA 9ANTA 3QQAA 4A3KJ 1GVDA 2Y30A 1FEXA 1TC3C 1WGXA 1H88C 1JKOC 2ECCA 1UMQA 2L7FP 3GTMJ 1VNDA 3JRGA 3A01A 2LLKA 1IUFA 2LKXA 1ZR2A 5JLXA 2XPUA 4GFBA 2ID6A 2PMZN 3E7LA 5IYBJ 3HOWJ 3BR5A 1DU6A 1XS9A 3BG3A 3S15J 1ZKGA 1Q1VA 2CJJA 2CRGA 5E3MA 4FCYA 3TP0A 4XICA 3RZDJ 1IRZA 2JA5J 3ZQLA 3I4NJ 2K40A 3GTJJ 3BR0A 2EZLA 3BTLA 3S2HJ 5F04A 4IHYA 2X6OA 1I50J 1Y1VJ 1IJWC 3IH3A 4JX4A 2XB0X 3G1OA 1IDZA 4MIMA 3BR2A 4A93J 3BR1A 3A01B 1FTTA 3FISA 3RKQA 1LFUP 3GTLJ 3DEWA 2NS8A 2K9QA 3M3YJ 1HCRA 5J1YA 5E3NA 4RDUA 3BQYA
chains in the Genus database with same CATH superfamily
4B4CA 2JA6J 1Y0NA 4YIIA 3BCBA 3TOBA 3H5RA 1J5YA 1X4PA 3W2VA 2O03A 1MIJA 4II2A 1UFMA 4NBQA 5LD2C 1B8IA 4E7SA 2D1VA 1WH5A 3O8HA 3WTZA 1SFOJ 2CG4A 2P81A 3R61A 2E1OA 4UUSA 1U9NA 4U7DA 4AM3A 2DA3A 3BLYA 1J75A 2CS3A 4JQFA 4WXCA 3K7AJ 1P92A 4DIQA 1G59A 5CPRB 1ETKA 3BOQA 3LWFA 5CVIA 1EH8A 4JP0A 2EQRA 3MZ8A 2JUCA 3VSKA 5GAGJ 1RUNA 3T5XA 3BG5A 1W36D 3BT9A 4IKFA 3DKWA 3TP3A 1SMTA 2IGMA 1U5TB 4XMYA 3JRFA 1XMKA 1V5GA 3G2BA 4EJUA 3W6KB 2JZYA 3HPGA 4XSXF 1FZPB 2HI3A 3MVPA 3JREA 3PJRA 2I5UA 4R79A 5FKMA 3PNVA 2VOPA 2W24A 2VT2A 2H1LA 3DWLE 1MMNA 3GUDA 1UB9A 2TRTA 1WFXA 5B1AH 1VQMI 4GDFA 1W4MA 4D7MA 4M3GA 1RESA 2EBIA 1WJ5A 4M3BA 2DMTA 1BR4A 4A3LJ 4UUSB 2ELJA 2RAEA 2GBYA 4PK4A 5DM7F 1I6HJ 3O8GA 3BDDA 1JUMA 2DT5A 4G8XA 2W25A 3EUHC 3V7RA 3EETA 3MQ0A 3TW6A 2XAUA 1RI7A 3CCQI 1W7PD 2IGOA 1ZTRA 1BOBA 2CUEA 1D8JA 2P6SA 2Z9OA 1Z67A 4BEHA 2IA2A 4D5FA 4XLAA 3L2UA 2GLOA 1I3AA 1FPQA 2BXZA 4R1HA 4U7BA 2IS1A 2DOFA 1T0FA 3GBGA 3OSGA 4HQEA 4WK8F 4DBQA 3F8BA 2L7MP 2LH9A 3F9KA 5EG0B 3HSFA 1DU0A 1YYVA 3CD6I 1X3UA 1LJ9A 4HV6A 2R7QA 4IO9F 4PJMA 5D8KB 4PJNA 4PSXA 1SD6A 2FBKA 2L9NA 2ZJRF 2KMUA 1ZG5A 2NNYA 4YFXF 2ZXWH 2VJIA 4J01A 1WJCA 2EWNA 1X1BA 2W00A 2BY3A 3PM1A 4YG2F 2MG4A 3C18A 2CUZA 1WHUA 3ZQFA 2X6YA 2W57A 3PFYA 2KHMA 3GFJA 2VIXA 1IV6A 3LMMA 3QP6A 1ZGWA 1HDDC 3AG2H 1F43A 5IP6A 5ICFA 3VSLA 3GTKJ 1LEAA 4BQNA 2DYRH 2X6WA 1QGPA 2ZXHA 2F5DA 2PMHA 3K70C 3KIOA 4V2FA 1WI9A 5IY5H 5EF6A 2KZVA 3SJMA 1GV5A 2H8RA 3WGGA 3HGYA 4BKXA 1OYYA 3W2AA 4AYBA 2DQRA 2FBIA 2XHKA 1K79A 2VUMJ 2L0KA 1MKMA 3RDIA 3ZGKA 4YEJA 3SXYA 1NHAA 4HDUA 2YUSA 1UJ8A 3KEQA 1JHFA 3PIOF 4E7LA 2M7BA 3P7NA 1FYKA 4CH7A 3A1YA 5GADJ 1QU3A 3E3VA 2EV6A 2DW4A 2GZWA 3HOSA 1B72A 2MLKA 4BL0B 2P5LC 2OA4A 3HHHA 4BXXJ 2EILH 2B0LA 3I0TA 2WB1A 3DF8A 3IL2A 3EUHA 2NS7A 3W2WA 1DDNA 4BNCA 2ELHA 4IOAF 2DU9A 1WI3A 1SAXA 2IS6A 5FKKA 1E3PA 3MZHA 3DTKA 4DYQA 3OSFA 2R7OA 3DCFA 1WRJA 5C4JJ 4F92B 1CQTA 4OWRB 4RM3A 3BP8A 2QEXI 1XMAA 1MW7A 1TWGJ 2V9KA 4C2MJ 3IH4A 4BE2A 5DTDA 2XSDC 2K4JA 3CCJI 1QBJA 2IA0A 2K4BA 1ZN2A 1ZH5A 1FYLA 4EM2A 3BJOA 5TJJA 2ADUA 3ERMA 3OYAA 4O3MA 3RTRA 2DTRA 2HXIA 4UVCA 1YW7A 1PP8F 1FP1D 1TBXA 5CQGA 5F27A 3CJRB 3DKYA 5E20A 2CW7A 3HEFA 4XKVA 1YO5C 2A6TA 1JJ6C 1A5JA 1X1DA 4QIWN 4BHPA 5J1UA 3CC7I 1MH4A 3NEUA 3LQRA 1Y0UA 4B3AA 3D5SC 1YX5A 4ZTJA 3BZ6A 2MW8A 2XSJC 2VKHA 4CCLA 3RPQA 3Q0VA 4PUSA 3N05A 3ECOA 3FF5A 5HDGA 2FX0A 2K9MA 3WU1B 2WB1N 2XF7A 1TTYA 2UV1A 1T39A 3PSFA 4RB0A 4XM3A 5CQEA 1MMAA 2FF4A 4A3FJ 2ISZA 5AONA 3FZVA 4HX4A 1FMWA 3FXOA 5CVVA 1HW5A 5IOYA 2X6XA 3S2DJ 2O9LA 4I99C 1ZRFA 1TT0A 2STTA 2HZTA 4DJAA 2IS2A 1VQ7I 3EYIA 4KIGA 5GTIC 3QWLA 4BQQA 2CQNA 2BXYA 2NVQJ 3E5XA 4RGSA 3H3ZA 1Z7UA 3PQJA 3RIRA 2XC7A 4MFEA 1HBXG 4IHWA 3FM5A 5DEQA 2VKVA 2NNNA 3NWSA 3HOUJ 2BHYA 3G73A 4KMFA 2Y9YA 5F6FA 4ZZDA 4XLPF 1W0TA 1PUFB 4A5MA 1MZBA 1P7JA 2OV7A 4F3QA 3I56I 1BJZA 3V7CA 2VB6A 4L5EA 3FXUA 3IV5A 2VBWA 2R7VA 1HXDA 5JFRA 4Y17A 3GZNB 4I76A 3I64A 4LG0B 3QPTA 2OC6A 3HGGA 1XSVA 2Y48A 4ITVA 3F22A 1W36C 5L3BA 2EFOA 1OCTC 2KJBA 3F72A 3DBLB 1BIBA 2R0QC 2JQ7A 3EUKL 1RRJA 3LAPA 2ID3A 4RM2A 5M5YJ 4I02A 2BW3B 3GWZA 1KZHA 1X3ZB 2LREA 4IJAA 5LGUA 1DP7P 3Q9SA 1G3YA 3F3XA 4C3JJ 4A6EA 1O3QA 3HJEA 3SEZA 1MNEA 2L7KA 2DT6A 4G6QA 1OCOH 4Y15A 5CJ9A 1FIAA 5C3EJ 2DPDA 1RIOH 2QKMB 2PN6A 2ACJA 5HS7A 4F93B 5J6XA 4GRIA 3OYDA 1YJ9I 2KRFA 4CA0A 4IL6C 1EA3A 4AVZA 1RR8C 1D1CA 1QPMA 3S17J 4Y52J 2E36A 3E6BA 4G12A 4XRSG 4FT8A 1S6LA 2F5CA 4BBSJ 2XIGA 3H5AA 2QM3A 2DA4A 2JJ7A 1JGGA 5J8CA 2Z5UA 1BC8C 4PGHA 5DUIA 5JLWA 4P55A 2LTPA 2HU9A 3BC8A 3AG1H 2OAZA 4DYRA 2V9VA 2ME0A 3GFMA 2JA2A 3CCRI 3MFKA 3CF5F 4HSRA 2QYOA 4N4OB 2LY1A 3HSEA 2HPMA 3OIQA 3S1MJ 4OIPF 4A3MJ 3S1RJ 3E97A 1WVRA 2DJNA 3BTJA 4C2TA 4KN4X 2K86A 2L9SA 1ZARA 1HSJA 3JRHA 2Y0MA 4L0ZB 1T56A 2FEZA 3HXLA 1GT0C 4RAGA 2YX7A 1Z0XA 2D2WA 1XMXA 1WJFA 2OZ6A 3GF2A 5HLTA 1SC7A 2JVHA 2F2EA 1E3OC 3HRMA 3PQKA 3OYGA 2IRFG 3ULQB 1XCVA 2RNGA 2Y2ZA 3H9QA 5HS9A 4BBRJ 5EEAA 1QQIA 1RKTA 1VQ5I 3LSHA 2LKPA 1TNSA 2H94A 2MH9A 4FETA 4DW6A 2BYVE 2BVMA 3ZMVA 3SDBA 1Y1WJ 1STZA 4M73A 3HZJA 3P5JA 3TQNA 1WSUA 4KYWA 5AIQA 3FXKA 3FXMA 2O6GE 4CHUA 2KRCA 3ML6A 1IN7A 1JKOC 2BOLA 2MA3A 2O61A 2ECCA 1UMQA 1P2FA 4UY8I 4RAZA 3JRGA 1BOAA 1XSXA 2HKOA 3G3ZA 2ID6A 3K2ZA 1E2XA 2IXSA 5ILSA 5FLXK 3WG9A 1U3EM 3I59A 4B8XA 1KU7A 1DU6A 1XS9A 3BG3A 3S3OA 2CRGA 3TDZC 4G9YA 3E6CC 1UHWA 1XGMA 3CCUI 4HLYA 1WQ2A 3FDYA 4UUVA 1DGWY 4XICA 1ZLKA 4B43A 3GTJJ 2BY1A 1LDKB 5GAEJ 5BQTA 3BR0A 2EZLA 2JPBA 1WJAA 3S2HJ 3RPUD 2VQHA 2HVQA 1I50J 1K78A 2GXBA 2GXAA 3KETA 2Y69H 1DQUA 3MCZA 1QZZA 4ZYEA 1IDZA 1F5TA 4E70A 3CUQB 3HTSB 3FXQA 1BI2A 4IOCF 4EJTA 1FTTA 4WWCA 1LFUP 2HZDA 3KZIC 2EJRA 1J2XA 3DEWA 1N78A 3KZZA 2K9QA 2ZXJA 1HCRA 1PJRA 2DOEA 2V6EA 3EPZA 1VQ9I 2OTJI 3QYEA 3OIPA 1FMVA 1U8BA 4MFDA 4EGZA 3HBLA 2R5ZB 3FHNA 4W97A 4IZZA 2LC2A 2COBA 2FSWA 4KT5C 2DMUA 1OQYA 4GYGA 5J1RA 1XPXA 3N97A 1HSTA 3OR2C 2XGEA 1IRXA 5LGNA 1USTA 1UAAA 3HG9A 5F08A 4A0ZA 4IHVA 2W85A 1ZGAA 1ON2A 2CU7A 3KPHA 4NQWB 4WX9A 3CCEI 2MFZA 3VYUB 3RZOJ 3EDPA 2MBFA 2J5OA 4UV9A 1X58A 2XPWA 5K5OA 2L9VA 3K2AA 2HQNA 4U87A 1YIJI 4UVBA 2OD5A 1ZLJA 1JI8A 5ILUA 1IXCA 1MJBA 3WODF 1GLNA 4M9ZA 3IAM2 4ASNA 4G94A 1LEBA 1MDMB 2F5EA 1G3SA 2QVOA 3DEEA 1U0JA 5CKTA 3DU5A 1SANA 2K5CA 4NUBA 1XX5A 5FFXA 1GXPA 1Z21A 1LDJA 3ASNH 1R36A 4MLOA 3DXJF 4EEFG 5EYRA 1LFBA 4S04A 3BPXA 2XF6A 2Z16A 1PDNC 3DP7A 1MMDA 4XLEA 1ERDA 3MZYA 3D1NI 2LF7A 2P4WA 1S7OA 5D5WB 2WC2A 3I3LA 1P4XA 4G6TB 1SD7A 1TT5B 5J4YA 2PLYA 1VQOI 3VEPA 2G0EA 1TWCJ 2LSOA 4XNFA 5B66C 4RS8A 3CMAI 3AKZA 1HW1A 1AHDP 3WTWC 2CFXA 3OYLA 3GO5A 2FMLA 2LBFA 1TL8A 3FX3A 4BEHB 3CO7C 1XTAA 5ILVA 4L9TA 2E7XA 2CO5A 4MO7A 5GTHC 2XB5A 4BQAA 3J7AO 3GLLA 2L2OA 4Q48A 1F9NA 3PUBA 3SYTA 4LOCA 1AU7A 3WHBA 2ZSHB 4I09A 4IX7A 4LJZF 5DV5A 1K6YA 3S16J 3RI4A 3HHGA 1R22A 2V1UA 3EUAA 3AFHA 4HZFA 4M6XA 4EATA 1FP2A 5GAHJ 4M3EA 4HQMA 4BQOA 1MBHA 1FSEA 3IRRA 3K4KA 1XGSA 1S7EA 2LYCA 5AIPA 4BJ6C 1T33A 4ETSA 5IYDJ 5IOZA 1TWHJ 2ZSIB 1J59A 3U1DA 2WWYA 3BTCA 4ZZLA 1ODDA 2DI3A 3AG3H 2RV8A 1FOYA 2KDOA 5FKOA 2XVCA 2DYSH 3M1EA 4E7HA 3DU6A 2JVGA 1MMGA 2HXOA 4HSTA 2LK2A 4MQVA 3FXRA 1SVOA 2HOSA 2WY7Q 1ETOA 2HOEA 3H35A 3LQQA 2DAOA 2DDAA 2X1EA 1NG6A 1APLC 3W6VA 2HDWA 1D5VA 1PVEA 3HOXJ 3F21A 4PFPA 3HM5A 5FFZA 2KJCA 3VODA 3KEOA 3L2RA 3CMYA 1RC9A 1FBUA 5K7FA 3HUGB 1R9TJ 4NB5A 2KZGA 3LA7A 3OY9A 4UXNA 5E18F 1ORKA 4OOIA 3VB2A 1SFKA 1ETYA 1WWXA 2VT3A 3ZQ7A 4X1EA 2BY2A 5D6FA 4C3HJ 4NDLA 2VQCA 4IEJA 1O7FA 5LFAA 3B02A 3HPHA 3SQNA 3ZP5A 1ZRCA 2F6CA 1JT0A 2KIFA 1VQ4I 2MC3A 4CICA 4CXFA 4OIQF 4NC7A 4BJ5C 1P7IA 3LOCA 4RA2A 5J4VA 4BY1J 1TW2A 2R7XA 1YS7A 3DBHB 2VPRA 4Y7NJ 2CYYA 2P8TA 2H6CA 5HLHA 2A5WA 2F5FA 2OQGA 1T95A 2YPRA 2BY0A 5BS6A 1KYZA 3ISPA 4LG3A 5DM6F 3RJPA 2M4KA 1QNTA 4F7ZA 5J40A 2NXNB 2JWTA 1IRGA 2HYGD 4DBRA 4AIJA 2IT0A 5JVTA 2Q0OA 4KICA 1WZ2A 4J19A 5HVQC 1HKSA 1YJWI 2XAHA 2K02A 3NQOA 3SHFA 1AOYA 3Q3SA 2NOGA 1V5EA 3HSRA 2OPTA 2DMPA 5M5XJ 3M7GA 1VQKI 1HC8A 5IT9Z 2Z2SB 3LNQA 1DPUA 2KDZA 1KQ0A 2Q1ZB 4HEA2 3HYIA 3QPLA 1A04A 5LLQA 2D45A 1VZ0A 2V1NA 2VLAA 2VQLA 3G71I 2GXGA 1K83J 5BMZA 2IGKA 4IRHA 1QA6A 2DFHA 5C4XJ 2WY8Q 1EH7A 1ZR4A 1JKQC 4IRIA 5L3FA 2BBYA 2P5KA 1X1AA 2KKOA 1MBKA 1AKHA 5HLGA 2VXDA 3RSNA 2EFPA 1GV2A 4IRGA 4A3IJ 2EIJH 4XIDA 1EKEA 3GTOJ 3K1NA 1BW5A 3L2CA 5BPIA 2RN7A 2HVSA 1JXSA 3HIFA 2JT1A 4HNTA 2LDUA 1B59A 2FRHA 4A0YA 3DV8A 4IXAA 4B1RA 1MSEC 4CZZA 4QPOA 2VBZA 4XLNF 4ENJA 5BPDA 1A6IA 2F4OB 1S9HA 3ABUA 3CP8A 3COAC 2CV2A 5FJ8J 1GDTA 3BWGA 1XDUA 1Z3XA 2A6EF 2HS5A 4LITA 1IV8A 4PDKA 3H0GJ 1KGSA 1FWZA 5ICEA 2CUJA 2PMUA 2CQ7A 4TV7A 3HDDA 4MHGA 2DN0A 3UNGC 4PCQA 2L4MA 5A2QK 2E34A 1BA5A 1DUXC 3IUOA 4MTEA 1HF0A 3DBRB 1IC8A 3FK6A 1S29A 4AYBN 2UXXA 2R7UA 3DKXA 4XN0A 2QBYA 1J9IA 2VPLA 1B8IB 4D7NA 1ZQ3P 1XG1A 3OYMA 2FD5A 4EQQA 2ZMEC 3DTEA 2Y0SN 3R4KA 3H36A 3J80Z 1UG2A 3QPSA 3CCLI 3K4JA 1TWAJ 2YS9A 2NVTJ 2RREA 3CESA 5FRMA 2A3SA 4Q47A 3ERED 3HTUA 4W1UA 1Y8QB 2JRTA 1KU2A 2EH3A 1H89C 3MN2A 1ZREA 4P9UA 2KL4A 2XAGA 3U2RA 2CH0A 3UKGA 3J80K 4ANJA 4B09A 2QENA 2K9LA 2XGCA 1G3TA 3WTVC 3CTAA 2OBPA 2GOXB 2XKPA 3CJQB 2WA0A 1IW7F 4OINF 1MMSA 1TNTA 3IWZA 2J5PA 4HF0A 3P9CA 5K7HA 3OYCA 4Q5SF 2XDVA 1KQ9A 3S14J 5FO5A 3K4MA 1IZ1A 2OU2A 1I39A 2GWRA 4KN7X 4FE7A 2KQRA 1MBJA 4I0AA 3H3VK 5LBQA 1VQ8I 2O8XA 4G7ZF 3KP7A 2DQLA 5HDKA 4JYKA 4UV8A 3WTSC 2L02A 3VYRB 3ABTA 2PBIA 2DA1A 4NQWA 1ETXA 2WV0A 2CGPA 1YITI 3A4CA 4EJVA 4HF1A 4YFNF 5EGOA 1NK2P 4J00A 4OMZA 4S0HB 2FJ1A 2Y0SA 3DFGA 4S05A 1YJNI 1G4DA 1X1PA 2RDPA 3MD2A 5DS9A 1JKPC 4P96A 1UHMA 1R1VA 4M74A 4KIFA 1LQ1A 3K70D 4RGUA 1R23A 3H92A 2WAEA 3MKLA 3OS2A 3BY6A 1RKWA 2EIMH 5B5EC 2Z33A 6PAXA 3A2KA 3E6MA 3Q0UA 3OOUA 2LMDA 1VTNC 2EA4A 3H9GA 2HOTA 2M45A 4BE1A 5HODA 4F55A 1TP4A 3H0DA 2M34A 2IAIA 3GLXA 2Y9ZA 4DZJA 3SDGA 1QRYA 2LR8A 5EZGA 2K3FA 3ESWB 5M5WJ 3GEZA 2ZC2A 4IQ4A 3H1CA 4AD9A 5LHIA 3OYHA 2GM4A 2F4IA 4L0YB 4UHTA 2DJIA 3FM3A 1W5SA 2Y31A 3CCSI 3P9KA 3M8JA 1VQ6I 2DLLA 1W5TA 1QVUA 1O7LA 2B9SA 2MLGA 4U0WA 1FY7A 1QPIA 2COMA 5KAIC 2IGNA 3IP4B 2L9RA 2Y30A 3ELKA 4LK0F 4MTDA 3AL0B 1H88C 1H9GA 1MJAA 1FOWA 3GTMJ 4II3A 4HX8A 3LSKA 4RB3C 3WGIA 1ZELA 3A01A 2WADA 4GFBA 1LVKA 3MMYB 4B3XA 2PMZN 3DPLC 2CWEA 3E7LA 4M9SA 3HOWJ 1LB2A 3TO6A 2OZUA 2QKLB 2DFIA 4BS9A 3S15J 4G7OF 3K4BA 1Q1VA 1LFPA 1D0ZA 2RGVA 5HNHA 3TP0A 4WCGA 4D1QA 3RZDJ 2GOMA 4MEXF 1OR7C 1QHHD 2JA5J 4LGWA 2VKDA 1R58A 1A6QA 1WJBA 1TQPA 2NYXA 3CUOA 1J7KA 5LGTA 1Z1DA 2C6YA 3CDIA 5BOXA 1Y1VJ 4O6JA 4OU0A 4LFUA 2KPMA 4MIMA 3BR2A 5HLIA 4A93J 3V4GA 2HDCA 5L3DA 3BR1A 3JAMZ 3A01B 4IVNA 3FISA 1XN7A 1ZG3A 4N4NB 1U2WA 1R71A 2EB7A 3GTLJ 2QGUA 1KYWA 2L54A 2V4JC 3RYPA 3H9JA 4A12A 3OR1C 3M3YJ 5H20A 4LD5A 3IAS2 5J1YA 5E3NA 1R1UA 4DYCA 4CYCA 1Y56A 3JAMK 1IN6A 1BJAA 2HWVA 4P5OA 2JA7J 1X3WB 1XDSA 2VONA 5FLVA 5CVUA 4Y4RA 2X48A 1P4AA 5K1YA 3LFKA 1O4XA 1BR2A 3GTQJ 5EZHA 2IP2A 5KAFC 2KIUA 4YRVA 3RYRA 5ED4A 1VFCA 1TW3A 2M5WA 4B44A 4I2OA 1TZLA 2TCTA 2ZFWA 1ZRDA 2YU9J 1I6XA 5JI6A 1FX7A 3JSOA 2A61A 3WGHA 2R5YA 4XBFA 5E1WA 1ONVA 4D5CA 3JSPA 3GZ6A 2FQ4A 4HDVA 3CJTB 4IHXA 3QP5A 3B73A 1BI0A 4E7KA 4A3EJ 3C2BA 1G6NA 3MKYB 2CQQA 3I4MJ 1BI1A 2KIMA 3CC2I 1XGNA 4A6DA 3K4CA 1L3LA 1VQPI 3KFWX 4HX7A 1FTZA 1K7AA 4YELA 2MD0A 1YS6A 2VASA 2QBYB 5E1XA 4C2UA 5BNGA 1IUYA 4HV5A 3LA2A 5K5QA 1V3FA 3KP6A 1YTYA 2M87A 3WTUC 2Z99A 5IP9J 1OCZH 2JPCA 2XRNA 4A3CJ 2M8GX 2VC0A 3GTGJ 2OUMA 4BE0A 5FB2A 4GCVA 3SZTA 5FRNA 3ROUA 2M4GA 3C2GA 3IH2A 5KK1A 1JE8A 1OR7A 3KYLA 4DQ2A 1F4KA 4Z2YA 4XORA 2ZJQF 5IP7J 1UELB 4Y13A 3R0AA 1QO0D 1RNLA 4OAZA 2JK3A 2B7EA 1YI2I 2CFOA 4EM1A 2JTVA 2R4GA 3VYTB 5F0CA 1XCBA 3PFIA 4UB6C 4NNJA 4XLFA 4P9FA 2E71A 3I5UA 4C9YA 1OKRA 3I4PA 4MEYF 2P7CB 1IN8A 1P9QC 1YLFA 1B9NA 2M2EA 5LEKA 1M1EB 4A69C 2HNHA 1AWCA 1N77A 3Q9VA 1SFUA 3K0LA 5H2FC 3S2WA 1YW8A 4BH9A 1R5HA 2Z3YA 2H6BA 5E1ZB 4LB5A 4ZYHA 5K7ZA 5EDNA 4AIKA 3TL4X 1HOMA 1MGTA 2E5ZA 1D0YA 3NWTA 4FHTA 4ZDLA 3LSJA 1U9OA 4XOPA 2K7LA 5KCMA 1TQMA 1ITYA 5EEGA 3DPUA 4PFOA 4HAMA 3TKYA 2DBBA 5EJCA 4EV0A 1N25A 4XRFA 4EVIA 5D4SA 1J09A 3U9GA 1YOVB 2GIZA 2IEKA 5EG0A 2XPVA 5FROA 4E7ZA 2XRLA 3TO7A 4PJLA 5HDNA 3X2QH 3IHUA 2PJPA 2E2HJ 2O5RA 3HB9A 3FXLA 1SD5A 2D1HA 2WV1A 1AA7A 1I27A 2PFBA 2WAQN 3UR3C 3OWTA 3E1SA 4CDGA 2ESHA 1RETA 1ETWA 3L2QA 1YQAA 2VC1A 1HKQA 5F0FA 2UUZA 1F1ZA 1VF9A 5H6QA 3W6JB 3A0HC 3KP2A 5LEJA 4AVPA 4NC6A 2XAJA 1OMIA 2EA2A 3TBIA 4A2UA 3LSTA 4JK1X 3CMEI 4O5VA 2E1CA 1YIOA 2DTZA 3NAUA 3PO3J 2ECBA 2HYJA 2MSYA 3GYHX 1ON1A 4CSWA 1Z7LA 3PSIA 4CCNA 1BR1A 4XQFA 3HOZJ 4A3BJ 1HA8A 3BPVA 2OF7A 1YX3A 1R4MB 1LPQA 1LUJB 3LL7A 2V26A 1LKXA 1OFCX 2VL8A 1UZCA 4BYYA 4BDZA 3BG7A 4AWXB 1D1BA 1P6RA 2DDBA 1R5ID 4BY7J 2NVXJ 3U21A 5IPAA 2RKHA 1D1AA 1EH6A 2O3FA 2DK5A 4A0XA 3H3UA 3ZPLA 4GXOA 2FE3A 4M9XA 1WCMJ 2AO9A 2FQ3A 2EIKH 3BZCA 2I8DA 2CQXA 3SFIA 4BGDA 4EJWA 1X2MA 4WXDA 1BI3A 4PZJA 2PMZA 1B72B 2FMYA 1IF1A 2A05A 2QSHX 1XD7A 2DFEA 2F4MB 1T8IA 4PJ0C 4XK4A 3T8RA 2W84A 4KNYA 4D9JA 2LF8A 1HLVA 3GCMA 3I55I 1JT6A 1Z77A 4P1WA 3CZ6A 3M8EA 2PG4A 4M6VA 2KISA 4R8HA 3CLOA 3S93A 3GMEA 4ZYDA 5J8FA 1W0UA 2DMQA 1FNNA 2E2IJ 2BHZA 4L5JA 2ZNYA 1IN4A 4Y33A 2HYFA 5FKLA 3VPRA 4YFKF 4I6ZA 4XRSA 3QPHA 2M9HA 4XKBA 3WE3A 2E1NA 2YR2A 3SEQA 4FE4A 1KQ8A 4I98B 1A35A 4M71A 4ESJA 4CYDA 3TEDA 1Z6RA 1R4NB 3JCUC 5CVRA 4ESBA 2VE8A 5LHGA 2AXTC 4QWQA 3RPUA 3GFIA 4JOMA 2WAQA 3CO6C 1K61A 4ZH4F 4A3JJ 2JA8J 4RAYA 2VJ4A 2LKSA 3U1KA 3V42A 2R7ZJ 4XRMA 1Y6IA 2EZKA 4MGRA 4XLHA 2QUFA 5J3LA 3ZRGA 3ZMSA 2UZKA 2IA1A 1Z3YA 1L0OC 4EMSA 3JRIA 1D8KA 1IXSB 3OYIA 3HOVJ 3M8FA 1Y39A 3VWBA 1R00A 2BW3A 1OJLA 3RKWA 1KU9A 5TISC 1BL0A 2STWA 3J7ZI 2FNPA 2X0LA 2KFDA 4MNUA 1YFHA 1FLIA 2X9DA 4A3DJ 1USSA 2R7SA 1DGRM 3LSRA 3ZMTA 1NK3P 1YHQI 4XLCA 3C1DA 2QCOA 4ENKA 3BG9A 3QODA 1FT9A 2KIQA 3FIWA 3QYFA 1MSFC 3EQLF 2V1DA 2VE9A 1JKRC 4OMYA 3ABMH 4A5NA 2L7ZA 5K5RA 3OYBA 3A03A 5H6RA 4IHSA 1D3YA 1E0EA 3I59B 2R5YB 3DEUA 3ECHA 1YRNA 3HKZA 3QU6A 3K4LA 3M07A 2R7FA 3JTHA 3KZYA 4CCJA 2LFBA 1WH7A 2OJED 1LNWA 2H27A 2V79A 1LDDA 3C7JA 3OIOA 5D5XB 4BXFA 1PUFA 3ZXSA 2EV0A 3VOEA 2CW0F 2Q2EA 2LP0A 2DA5A 3F8FA 3RKYA 2CUFA 4LLGF 3KLNA 2PEXA 3M4OJ 4LIUA 3MKZA 1OCRH 4XOTA 4C3IJ 3A02A 1IDYA 4HW0A 4FX4A 2GAUA 2YSRA 3V7SA 4GGGA 2ELKA 2FNAA 2JMWA 5GPAA 4CYCB 2Y75A 3M1CA 3I54A 1ZGJA 3E5QA 3G4SI 2ZCWA 1R1TA 3QYBA 3OYNA 3PIPF 4ENMA 5HS8A 2O8KA 2DMNA 3I9V2 5KHDA 3DLLF 4XL9A 3BZKA 3DLAA 2F48A 2MYSA 4DNCA 1CGPA 1FC3A 1YRNB 4ON0A 4FASD 3Q0WA 4M72A 3CF2A 3QU3A 2BVLA 1DPRA 2QQBA 3S8PA 2PJRB 2M0MA 3BCAA 2ISYA 1GXQA 3OL4A 1Y8RB 2E7WA 4LLNA 1G8XA 2K9NA 4BU2A 4RGRA 1V5FA 1U78A 2XROA 4KA4A 3FMQA 2H1KA 2VBYA 2NRAC 2R92J 4F91B 4N9HA 4PGGA 3SZGA 3WG7H 1QZYA 1I1GA 1XSDA 3K6GA 4L18B 4BJTA 4ZJZA 1DP3A 4GO1A 2HKXA 2IJLA 4WXHA 1ZG1A 3HRUA 3WU2C 3HKZN 5FLMJ 3Q5FA 4GYIA 4FTHA 2FA5A 2E1MC 1PUEE 3CCMI 4HPQA 2V9PA 2B63J 3MKWB 1VQLI 4XN3A 3K10A 4LG0A 1MDMA 2H09A 2M8EA 3S3NA 2MD5A 3I58A 3M9AA 1O3TA 3ZN0A 1FOXA 3VDXA 2Z1DA 2FBHA 1JUPA 2BV6A 2FUG2 5C44J 4HYEA 2O0YA 4RBOA 2ME6A 1X1CA 4B48A 1B4AA 4HG2A 3JRCA 2N8GA 3JW4A 1EV7A 1S7AA 4IPAA 3T8TA 4A3KJ 2X51A 3D5LA 3AAFA 1FEXA 1WGXA 1K6OA 2BEOA 2L7FP 2LRDA 4RAFA 4AU7A 4RGXA 1OCCH 2LLKA 1IUFA 2LKXA 1SFEA 2KP6A 5JLXA 1W7PA 3QRFF 1ZR2A 3OYJA 1OISA 3A0BC 4FQGA 4RLQA 2JSPA 5IYBJ 2X1DA 1WJDA 3BR5A 2CV1A 3RQ4A 2NVUB 3T0YA 4EM0B 1ZKGA 5DCMA 2CJJA 2IPQX 1LVAA 1W5CC 4HBLA 5E3MA 3FHZA 3HUGA 2FOKA 4XKCA 1CF7A 2DO7A 4RMNA 1IRZA 5FGMA 3ZQLA 1I1SA 3HC7A 2R7WA 4OIRF 3WTTC 2K40A 3BTLA 5JHUA 3RKXA 4IHYA 4EGYA 5D6EA 3IH3A 2VJ5A 4LB6B 2XB0X 3G1OA 1FSHA 3ZR8X 3WTYC 1OYIA 4N9IA 4B47A 1SVLA 2P7VB 3RKQA 3OYKA 3F23A 3OS0A 1QZEA 1JHHA 3KP5A 5L3EA 3GW2A 3BQYA 3BJAA 1E3HA 2OQRA 4E7JA 4UVAA 2XKOA 2LG4A 2VKEA 3LSIA 1ZYRF 2G9WA 1H9TA 5D5VB 1ACIA 5FD6A 2NOJB 5EEHA 3GXOA 2OCEA 2KT0A 3BJ6A 3FWEA 2RQPA 2VXZA 1U5TC 1HQCA 1Z91A 4QPQA 1BBYA 4AC0A 1OPCA 2RNJA 2LVSA 4LIVA 1BM9A 2JSCA 1S72I 2HQRA 4KDPA 2ICWG 1T38A 1W1WE 5F64A 1RR7A 3KCCA 3K1MA 2PQ8A 4CCOA 5GP9A 5F0HA 4PJJA 5D8LB 4KFCA 1U8RA 4N0BA 1LE8A 4BAYA 1UHSA 1PYVA 2E60A 1NTCA 2QSGX 1UCRA 2ETHA 2VI6A 4CUGA 2H8WA 3S1QJ 2ZNZA 1OYWA 2GA2A 3G1LA 5E8IA 1KA8A 2NVYJ 3RQIA 1FJLA 1GHCA 2W1OA 4Y3OA 1JJ8C 2FU4A 1VQNI 2KLOA 2DOAA 1BIAA 3LSGA 1FBSA 3FMSA 4BDYA 4I01A 4H4KC 2ZJ2A 1ENHA 2IS4A 5DD8A 2AQEA 3FKIJ 5L3CA 2CV0A 1SD4A 2W48A 4V2GA 2CQKA 3L2WA 2EFNA 2EFQA 4FISA 5J47A 4H0EA 2R7DA 5JHFA 4M3DA 2L3DA 4ABZA 4XKWA 2M7AA 2HR3A 4HLXA 5E3LA 3TDUC 2YU3A 2DCEA 3V8LA 3QAHA 1R7JA 3FXJA 2P5VA 1O3RA 4AUXA 2HQAA 2CSOA 3JR9A 2DPUA 4RB2C 3KEYA 4L5IA 1JUSA 1H8AC 2ZO4A 4AIHA 2LD5A 1RUOA 1VI0A 2ZB9A 5E17F 3E6DA 5DDGA 5GPCA 2E35A 1T98A 1BN5A 1IRFA 3AG4H 2OTLI 4OAYA 2LY9A 5F1JA 4HNVA 4DZPA 2LY2A 3BG6A 4JX5A 4X0GA 3MEXA 4I0BA 1T0FC 5LHHA 5FLXZ 2Q2EB 4QSHA 1SMYF 4KMUX 2FXAA 4MQ9F 1IGNA 3TW7A 2MC4A 2IVMA 2CW8A 4BUPA 2EINH 2R93J 1EJ9A 2DXIA 2DA6A 3LA3A 1MJ9A 1V55H 3F0CA 3R0JA 2DFFA 3GX4X 3ZMDA 1YG2A 2HOAA 3KP3A 3R6SA 1A36A 3D0SA 3OV8A 3DQVC 1TWFJ 3ZQCA 2ZJPF 5JVGF 4D0PA 1ZAOA 2QLZA 2P6TA 5FKNA 3MWMA 3CCYA 2BZTA 1B6AA 3V8JA 1LE8B 5KNLA 2YX4A 1JGSA 1HDPA 2WBMA 4A3GJ 3V8KA 3LAJA 4CGZA 2QSFX 4QTRA 1U6GA 1MBEA 1J0RA 2R7RA 1KONA 1HW2A 4Z6YA 5L3GA 1ETQA 2EV5A 1BW6A 4UUTA 5DD4A 1ZK8A 5LRSA 3OL3A 2P0WA 3ZMZA 1BC7C 2JUGA 2LBFB 2RC4A 3FMRA 2EZIA 3G1MA 1K78B 4E4HA 3FK7A 2PX9A 3QOPA 3S32A 5TGTA 3N4MA 4G6DA 4L9NA 1B9MA 4KISA 2ZKZA 4G7HF 3SZPA 1D5YA 2V6CA 2IBDA 1TLHB 3FBNB 3TOAA 3GFLA 3PNTA 1K4SA 4OIOF 1QHGA 1Z9CA 3JTGA 1TQIA 3IC7A 2HPIA 3ZQGA 4KITB 1XB4A 1V4RA 2EK5A 4RB1A 2ZMEB 3WHCA 1N75A 4M3FA 4I7HA 3T1BA 1V54H 1AKHB 5KVRA 3K9TA 2EPFA 5JR3A 2XGDA 3WU0A 2TDXA 3L2VA 4UB8C 1IN5A 2WAFA 3J7AY 1T6SA 3BR6A 2HDDA 2MABA 3EYYA 3H5NA 4C30A 4BACA 4ENNA 3ABKH 2GIVA 3WTXC 3ZQHA 2M1BA 2M3AA 4LK1F 1KU3A 3ZQIA 2XAFA 3JRBA 4FX0A 3E5UA 5ICCA 3S3MA 2VODA 4RLFA 2WTEA 3IRQA 2A6HF 4BXUA 3CC4I 3LSPA 1IXRC 3L09A 2HTJA 4CO8A 3B6CA 4IQJA 3PO2J 4IHTA 4M6YA 3WE2A 3OS1A 1MNMC 3O6BB 5EGOB 3CQZJ 4U88A 3TO9A 2O7OA 3KP4A 2RVCA 1SFXA 2JRMA 4KJZA 1A31A 4DGWB 2RQQA 1G3WA 2DA2A 2QF7A 4JBAA 1RZ4A 2F5VA 2E19A 4BHCA 2W4SA 1P4WA 4L9VA 1S5LC 2HFHA 2V1XA 2W7NA 1T2KA 3LSMA 5F1RA 2QZ8A 3MAJA 3PL8A 3KLOA 4WF2A 4JX6A 1SVMA 3L7WA 2A5YB 3FKJA 3ASOH 3L1PA 4QLCU 4Q4ZF 5E79C 2EFWA 2VQGA 3RCOA 3W3CA 3CP2A 4KUMA 5HNFA 5M3MJ 2FOWA 2MH2A 3FBIB 4NHJA 1O57A 4X6AJ 2VN2A 4KIBA 4NC8A 3SFZA 2K27A 2HEOA 1FBQA 2I10A 5IT3A 3CJNA 1SEUA 4ZYAA 2DT7B 2DA7A 4HF2A 2K9SA 2K3PA 2XGXA 1X2NA 3CMMA 3OYEA 1EF4A 3NRVA 3I53A 1YW9A 3JRAA 4V19K 4CCKA 2XAQA 3DPTA 5DYMA 1R49A 4DOZA 1MH3A 3PNYA 1NH3A 2G7UA 3ZCOA 1CF7B 4KT6A 2LOOA 5IYCJ 1POGA 3F6VA 3E0JB 4ZYGA 3HRTA 4YIRX 3HOYJ 2VBXA 3GTPJ 1R5GA 1HKTA 3OYFA 3REOA 3F6OA 1JTYA 2XUBA 2CMPA 1K4TA 3BTIA 1WJEA 5DUKA 4ZDPA 2R3SA 3BROA 3CUQA 1XGOA 1IO2A 1F36A 2E1MB 5CLSA 3IKVA 3AL0C 3OOPA 3R60A 3CCVI 3QOEA 3DTIA 4ZDOA 2IW5A 3JRDA 2HQ5A 2EZHA 2XF5A 3ZN1A 5DCFA 1G2HA 1ZHFA 2PI0A 3KE2A 5B1BH 3F8NA 1XC5A 4L9JA 1JTXA 5ERIA 1IAWA 1B1BA 4BHBA 3G6EI 2ZBKA 4XONA 3TMOA 2R5ZA 4HNUA 2AHQA 1IG7A 2UXNA 3GVAA 1R6RA 3S1NJ 2JN6A 3K69A 4HA8A 3LFUA 1GVJA 1SAUA 1PP7U 1MD0A 1RPWA 4EJOA 5TRDA 1I3QJ 1MNDA 2E2JJ 1FOKA 2UWMA 3NARA 3O2PE 5M3FJ 4IF4A 2KRHA 2X1CA 3BQZA 2DK8A 1MBGA 5E8GA 4F52A 1D0XA 2V7FA 3ONQA 4AIDA 4ZTFA 2L01A 3HRSA 3J7YJ 1OLTA 4U0VA 2MGQA 2ZFUA 2D5VA 2XASA 2M0CA 1C0WA 2A07F 3ZMUA 1T08B 5IT9K 2X85A 3L9FA 4CZCA 5HOOA 3F8CA 2K85A 4E6KG 2VJJA 3BR3A 1S8NA 1UG0A 2BGCA 5FD5A 5E3OA 3ZOBA 3B6AA 2E5NA 2AQFA 3KX2A 3HOTA 3PUFA 5D4RA 4K2EA 1FIPA 4UNOA 3CDLA 2ESNA 4PSWA 1QVTA 1ETVA 2VOOA 1WPKA 2ZXIA 1YE9A 2NS0A 2QQAA 4U0YA 3C3WA 2G7HA 1Z6TA 5D5UB 4HRIA 2AS5F 3F8MA 3I71A 3OMYA 2M30A 3C2HA 2QQ9A 1GUUA 3IKTA 3VYSB 1OCPA 2OCCH 4LLLA 1MBFA 2X4HA 4YIFA 3K4NA 2HTSA 3K1PA 2PJRA 9ANTA 3O3KA 3QQAA 1GVDA 2HGCA 1TC3C 3VFZA 2R7TA 4CCMA 2BE5F 2AXLA 1VNDA 1H0MA 2A68F 3KYDB 2QA4I 2L4AA 1W7PB 1X4OA 1E17A 4HOBA 2XPUA 5LRRA 3HL2A 1Q1HA 3P9IA 2QQ8A 1I5ZA 2XV4S 1NG7A 1S3JA 1FYMA 4XR6A 5CVJA 2W82A 5DCMB 4ESFA 1WKMA 3CUQC 5ICGA 2NAZA 3CDHA 5A2QZ 3IWFA 4FCYA 1X19A 3CLQA 4LMYA 2QWWA 2LNBA 2DODA 5B3SH 3I4NJ 4XSZF 2HVRA 3J81K 5CYVA 5F04A 2X6OA 3L00A 3KYCB 3D5RC 1IJWC 3TGNA 4JX4A 3GZ5A 1Z05A 3ABLH 2A69F 4ZC3A 2Q8KA 3ZQQA 3J81Z 1ULYA 2GA1A 4E7IA 1REPC 2NS8A 2ZMEA 1O3SA 2L5QA 4RDUA 2GQQA 1U5TA
chains in the Genus database with same CATH topology
4B4CA 2JA6J 4DYCA 1U8BA 4CYCA 4MFDA 2VKEA 3HBLA 2JA7J 2R5ZB 4W97A 5FLVA 2COBA 2X48A 2DMUA 1O4XA 5J1RA 1B8IA 3GTQJ 2KT0A 5EZHA 1WH5A 3O8HA 1SFOJ 2XGEA 2P81A 2E1OA 4UUSA 1U9NA 5F08A 2DA3A 1VFCA 4AC0A 4IHVA 2LVSA 2CU7A 2TCTA 3K7AJ 2YU9J 1ETKA 3RZOJ 4JP0A 2EQRA 2R5YA 1RR7A 1X58A 3BG5A 4D5CA 2FQ4A 2XPWA 3BT9A 5GP9A 3K2AA 3TP3A 5F0HA 4IHXA 3JRFA 4A3EJ 3C2BA 2CQQA 1LE8A 3I4MJ 1UHSA 1NTCA 1FTZA 2VI6A 2HI3A 3MVPA 3JREA 1SANA 3S1QJ 5BNGA 5FKMA 3G1LA 2NVYJ 3RQIA 4MLOA 2TRTA 4EEFG 1FJLA 5EYRA 1LFBA 5IP9J 1JJ8C 4D7MA 4M3GA 1RESA 2EBIA 3LSGA 4A3CJ 2M8GX 3D1NI 4M3BA 3GTGJ 2DMTA 1ENHA 4A3LJ 4UUSB 3IH2A 2RAEA 2GBYA 1I6HJ 3FKIJ 2G0EA 1TWCJ 3O8GA 1JUMA 5IP7J 3TW6A 2W48A 4V2GA 1AHDP 2JK3A 1ZTRA 2CUEA 4FISA 5F0CA 4M3DA 4MO7A 4D5FA 2XB5A 2GLOA 4ABZA 5E3LA 3GBGA 3OSGA 4LOCA 1AU7A 2L7MP 3WHBA 5EG0B 1DU0A 4AUXA 3JR9A 3S16J 1JUSA 1H8AC 2M2EA 2LD5A 4A69C 1VI0A 2ZB9A 5GPCA 4M3EA 1MBHA 5IYDJ 1S7EA 1T33A 2LY9A 5F1JA 5IOZA 1TWHJ 4HNVA 5K7ZA 4DZPA 3BTCA 4JX5A 5EDNA 1HOMA 3PM1A 5FKOA 2MG4A 3LSJA 4QSHA 1U9OA 1IGNA 3TW7A 3ZQFA 1ITYA 2HXOA 2LK2A 2R93J 2HOSA 1IV6A 2IEKA 1HDDC 1ZGWA 5EG0A 2DA6A 1ETOA 2XPVA 1F43A 5IP6A 3F0CA 2XRLA 3GTKJ 1APLC 2HOAA 3W6VA 3HOXJ 2E2HJ 3HM5A 3HB9A 4V2FA 3CMYA 5EF6A 3SJMA 2H8RA 1TWFJ 1GV5A 3ZQCA 5K7FA 3HGYA 2WV1A 4BKXA 1R9TJ 2WAQN 5FKNA 3CCYA 1LE8B 2VUMJ 1ORKA 1RETA 1ETWA 1HDPA 2L0KA 4A3GJ 5F0FA 1ETYA 1VF9A 4QTRA 4X1EA 1MBEA 4C3HJ 4NDLA 2YUSA 4IEJA 1ETQA 1BW6A 4UUTA 1JT0A 1ZK8A 2DTZA 3NAUA 3PO3J 2ECBA 2HYJA 2MSYA 1B72A 4BXXJ 3HOZJ 1P7IA 4A3BJ 3LOCA 4BY1J 2OF7A 2VPRA 4Y7NJ 2EZIA 3G1MA 2NS7A 3FK7A 1OFCX 1WI3A 5FKKA 3OSFA 4DYQA 3DCFA 1D5YA 5C4JJ 1CQTA 2IBDA 2JWTA 4BY7J 2NVXJ 4C2MJ 1TWGJ 5IPAA 3IH4A 5DTDA 2XSDC 1WCMJ 2AO9A 3ZQGA 4J19A 3WHCA 4M3FA 2CQXA 3SFIA 1AKHB 1X2MA 3Q3SA 2NOGA 2HXIA 1B72B 2XGDA 2OPTA 2DMPA 5M5XJ 3BR6A 2HDDA 5F27A 4XK4A 3LNQA 3HEFA 2KDZA 3ZQHA 1HLVA 3QPLA 3ZQIA 1JJ6C 1A5JA 1JT6A 4QIWN 1Z77A 5J1UA 3JRBA 4M6VA 1MH4A 1W0UA 1K83J 4B3AA 3LSPA 2DMQA 3B6CA 2MW8A 3PO2J 2E2IJ 1MNMC 5C4XJ 5EGOB 3CQZJ 3Q0VA 1ZR4A 1JKQC 5FKLA 3VPRA 2O7OA 4I6ZA 4XRSA 1MBKA 1AKHA 4A3IJ 2M9HA 3GTOJ 1GV2A 4XIDA 2DA2A 2QF7A 2FX0A 4FE4A 1BW5A 2E19A 2WB1N 3TEDA 4B1RA 4A3FJ 1MSEC 1A6IA 4JX6A 5IOYA 1K61A 2JA8J 5FJ8J 4A3JJ 1GDTA 3S2DJ 3L1PA 2O9LA 2R7ZJ 4XRMA 2EZKA 5J3LA 3H0GJ 5M3MJ 2NVQJ 4X6AJ 3JRIA 3HOVJ 3HDDA 2DN0A 4MFEA 4IHWA 1OJLA 2I10A 2VKVA 1BL0A 3HOUJ 1BA5A 1HF0A 2Y9YA 1IC8A 3FK6A 1W0TA 2DA7A 1PUFB 4AYBN 2K9SA 2X9DA 1X2NA 4A3DJ 1P7JA 3LSRA 1NK3P 1EF4A 1B8IB 4D7NA 2QCOA 3BG9A 1BJZA 3JRAA 3FIWA 1ZQ3P 1XG1A 1MSFC 2FD5A 4L5EA 2Y0SN 1MH3A 1JKRC 3IV5A 1UG2A 3QPSA 4I76A 2L7ZA 5IYCJ 1POGA 1TWAJ 2YS9A 3A03A 2NVTJ 3HGGA 3HOYJ 3GTPJ 2R5YB 4W1UA 2EH3A 1H89C 1JTYA 3MN2A 1OCTC 3BTIA 1YRNA 2R0QC 3UKGA 2ID3A 5M5YJ 2LFBA 1WH7A 2XGCA 1F36A 3OIOA 1PUFA 2LP0A 4C3JJ 3JRDA 2HQ5A 2DA5A 2CUFA 2EZHA 3M4OJ 5K7HA 4C3IJ 3A02A 1G2HA 1IDYA 1FIAA 5C3EJ 1XC5A 3S14J 1JTXA 2ELKA 2JMWA 2R5ZA 5GPAA 4CYCB 2AHQA 1IG7A 4FE7A 1MBJA 2O8KA 3H3VK 3S17J 3S1NJ 2JN6A 4Y52J 2DMNA 4G12A 4XRSG 4BBSJ 1RPWA 2DA4A 2JJ7A 1JGGA 1YRNB 1I3QJ 3Q0WA 2E2JJ 4JYKA 3NARA 5JLWA 2DA1A 5M3FJ 2LTPA 1ETXA 3BQZA 1MBGA 2K9NA 4DYRA 5EGOA 1NK2P 2ME0A 4S0HB 1U78A 2FJ1A 2H1KA 2MGQA 2R92J 5DS9A 2D5VA 1JKPC 3S1MJ 2M0CA 4A3MJ 3S1RJ 2DJNA 3BTJA 3MKLA 1RKWA 3BR3A 3Q0UA 3OOUA 5E3OA 3JRHA 3ZOBA 3B6AA 3HKZN 1T56A 5FLMJ 1GT0C 2HOTA 4FTHA 1FIPA 1Z0XA 3CDLA 5HODA 1QVTA 1ETVA 2B63J 1WPKA 2M34A 2IAIA 2Y9ZA 4DZJA 3SDGA 1QRYA 2LR8A 5EZGA 1E3OC 5M5WJ 2Y2ZA 2GM4A 4BBRJ 5EEAA 1GUUA 1JUPA 1RKTA 2Y31A 5C44J 1OCPA 4DW6A 1MBFA 4RBOA 2ME6A 1QVUA 3JRCA 2N8GA 1QPIA 1Y1WJ 2L9RA 9ANTA 3QQAA 4A3KJ 1GVDA 2Y30A 1FEXA 1TC3C 1WGXA 1H88C 1JKOC 2ECCA 1UMQA 2L7FP 3GTMJ 1VNDA 3JRGA 3A01A 2LLKA 1IUFA 2LKXA 1ZR2A 5JLXA 2XPUA 4GFBA 2ID6A 2PMZN 3E7LA 5IYBJ 3HOWJ 3BR5A 1DU6A 1XS9A 3BG3A 3S15J 1ZKGA 1Q1VA 2CJJA 2CRGA 5E3MA 4FCYA 3TP0A 4XICA 3RZDJ 1IRZA 2JA5J 3ZQLA 3I4NJ 2K40A 3GTJJ 3BR0A 2EZLA 3BTLA 3S2HJ 5F04A 4IHYA 2X6OA 1I50J 1Y1VJ 1IJWC 3IH3A 4JX4A 2XB0X 3G1OA 1IDZA 4MIMA 3BR2A 4A93J 3BR1A 3A01B 1FTTA 3FISA 3RKQA 1LFUP 3GTLJ 3DEWA 2NS8A 2K9QA 3M3YJ 1HCRA 5J1YA 5E3NA 4RDUA 3BQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B4C A;  2JA6 J;  4DYC A;  1U8B A;  4CYC A;  4MFD A;  2VKE A;  3HBL A;  2JA7 J;  2R5Z B;  4W97 A;  5FLV A;  2COB A;  2X48 A;  2DMU A;  1O4X A;  5J1R A;  1B8I A;  3GTQ J;  2KT0 A;  5EZH A;  1WH5 A;  3O8H A;  1SFO J;  2XGE A;  2P81 A;  2E1O A;  4UUS A;  1U9N A;  5F08 A;  2DA3 A;  1VFC A;  4AC0 A;  4IHV A;  2LVS A;  2CU7 A;  2TCT A;  3K7A J;  2YU9 J;  1ETK A;  3RZO J;  4JP0 A;  2EQR A;  2R5Y A;  1RR7 A;  1X58 A;  3BG5 A;  4D5C A;  2FQ4 A;  2XPW A;  3BT9 A;  5GP9 A;  3K2A A;  3TP3 A;  5F0H A;  4IHX A;  3JRF A;  4A3E J;  3C2B A;  2CQQ A;  1LE8 A;  3I4M J;  1UHS A;  1NTC A;  1FTZ A;  2VI6 A;  2HI3 A;  3MVP A;  3JRE A;  1SAN A;  3S1Q J;  5BNG A;  5FKM A;  3G1L A;  2NVY J;  3RQI A;  4MLO A;  2TRT A;  4EEF G;  1FJL A;  5EYR A;  1LFB A;  5IP9 J;  1JJ8 C;  4D7M A;  4M3G A;  1RES A;  2EBI A;  3LSG A;  4A3C J;  2M8G X;  3D1N I;  4M3B A;  3GTG J;  2DMT A;  1ENH A;  4A3L J;  4UUS B;  3IH2 A;  2RAE A;  2GBY A;  1I6H J;  3FKI J;  2G0E A;  1TWC J;  3O8G A;  1JUM A;  5IP7 J;  3TW6 A;  2W48 A;  4V2G A;  1AHD P;  2JK3 A;  1ZTR A;  2CUE A;  4FIS A;  5F0C A;  4M3D A;  4MO7 A;  4D5F A;  2XB5 A;  2GLO A;  4ABZ A;  5E3L A;  3GBG A;  3OSG A;  4LOC A;  1AU7 A;  2L7M P;  3WHB A;  5EG0 B;  1DU0 A;  4AUX A;  3JR9 A;  3S16 J;  1JUS A;  1H8A C;  2M2E A;  2LD5 A;  4A69 C;  1VI0 A;  2ZB9 A;  5GPC A;  4M3E A;  1MBH A;  5IYD J;  1S7E A;  1T33 A;  2LY9 A;  5F1J A;  5IOZ A;  1TWH J;  4HNV A;  5K7Z A;  4DZP A;  3BTC A;  4JX5 A;  5EDN A;  1HOM A;  3PM1 A;  5FKO A;  2MG4 A;  3LSJ A;  4QSH A;  1U9O A;  1IGN A;  3TW7 A;  3ZQF A;  1ITY A;  2HXO A;  2LK2 A;  2R93 J;  2HOS A;  1IV6 A;  2IEK A;  1HDD C;  1ZGW A;  5EG0 A;  2DA6 A;  1ETO A;  2XPV A;  1F43 A;  5IP6 A;  3F0C A;  2XRL A;  3GTK J;  1APL C;  2HOA A;  3W6V A;  3HOX J;  2E2H J;  3HM5 A;  3HB9 A;  4V2F A;  3CMY A;  5EF6 A;  3SJM A;  2H8R A;  1TWF J;  1GV5 A;  3ZQC A;  5K7F A;  3HGY A;  2WV1 A;  4BKX A;  1R9T J;  2WAQ N;  5FKN A;  3CCY A;  1LE8 B;  2VUM J;  1ORK A;  1RET A;  1ETW A;  1HDP A;  2L0K A;  4A3G J;  5F0F A;  1ETY A;  1VF9 A;  4QTR A;  4X1E A;  1MBE A;  4C3H J;  4NDL A;  2YUS A;  4IEJ A;  1ETQ A;  1BW6 A;  4UUT A;  1JT0 A;  1ZK8 A;  2DTZ A;  3NAU A;  3PO3 J;  2ECB A;  2HYJ A;  2MSY A;  1B72 A;  4BXX J;  3HOZ J;  1P7I A;  4A3B J;  3LOC A;  4BY1 J;  2OF7 A;  2VPR A;  4Y7N J;  2EZI A;  3G1M A;  2NS7 A;  3FK7 A;  1OFC X;  1WI3 A;  5FKK A;  3OSF A;  4DYQ A;  3DCF A;  1D5Y A;  5C4J J;  1CQT A;  2IBD A;  2JWT A;  4BY7 J;  2NVX J;  4C2M J;  1TWG J;  5IPA A;  3IH4 A;  5DTD A;  2XSD C;  1WCM J;  2AO9 A;  3ZQG A;  4J19 A;  3WHC A;  4M3F A;  2CQX A;  3SFI A;  1AKH B;  1X2M A;  3Q3S A;  2NOG A;  2HXI A;  1B72 B;  2XGD A;  2OPT A;  2DMP A;  5M5X J;  3BR6 A;  2HDD A;  5F27 A;  4XK4 A;  3LNQ A;  3HEF A;  2KDZ A;  3ZQH A;  1HLV A;  3QPL A;  3ZQI A;  1JJ6 C;  1A5J A;  1JT6 A;  4QIW N;  1Z77 A;  5J1U A;  3JRB A;  4M6V A;  1MH4 A;  1W0U A;  1K83 J;  4B3A A;  3LSP A;  2DMQ A;  3B6C A;  2MW8 A;  3PO2 J;  2E2I J;  1MNM C;  5C4X J;  5EGO B;  3CQZ J;  3Q0V A;  1ZR4 A;  1JKQ C;  5FKL A;  3VPR A;  2O7O A;  4I6Z A;  4XRS A;  1MBK A;  1AKH A;  4A3I J;  2M9H A;  3GTO J;  1GV2 A;  4XID A;  2DA2 A;  2QF7 A;  2FX0 A;  4FE4 A;  1BW5 A;  2E19 A;  2WB1 N;  3TED A;  4B1R A;  4A3F J;  1MSE C;  1A6I A;  4JX6 A;  5IOY A;  1K61 A;  2JA8 J;  5FJ8 J;  4A3J J;  1GDT A;  3S2D J;  3L1P A;  2O9L A;  2R7Z J;  4XRM A;  2EZK A;  5J3L A;  3H0G J;  5M3M J;  2NVQ J;  4X6A J;  3JRI A;  3HOV J;  3HDD A;  2DN0 A;  4MFE A;  4IHW A;  1OJL A;  2I10 A;  2VKV A;  1BL0 A;  3HOU J;  1BA5 A;  1HF0 A;  2Y9Y A;  1IC8 A;  3FK6 A;  1W0T A;  2DA7 A;  1PUF B;  4AYB N;  2K9S A;  2X9D A;  1X2N A;  4A3D J;  1P7J A;  3LSR A;  1NK3 P;  1EF4 A;  1B8I B;  4D7N A;  2QCO A;  3BG9 A;  1BJZ A;  3JRA A;  3FIW A;  1ZQ3 P;  1XG1 A;  1MSF C;  2FD5 A;  4L5E A;  2Y0S N;  1MH3 A;  1JKR C;  3IV5 A;  1UG2 A;  3QPS A;  4I76 A;  2L7Z A;  5IYC J;  1POG A;  1TWA J;  2YS9 A;  3A03 A;  2NVT J;  3HGG A;  3HOY J;  3GTP J;  2R5Y B;  4W1U A;  2EH3 A;  1H89 C;  1JTY A;  3MN2 A;  1OCT C;  3BTI A;  1YRN A;  2R0Q C;  3UKG A;  2ID3 A;  5M5Y J;  2LFB A;  1WH7 A;  2XGC A;  1F36 A;  3OIO A;  1PUF A;  2LP0 A;  4C3J J;  3JRD A;  2HQ5 A;  2DA5 A;  2CUF A;  2EZH A;  3M4O J;  5K7H A;  4C3I J;  3A02 A;  1G2H A;  1IDY A;  1FIA A;  5C3E J;  1XC5 A;  3S14 J;  1JTX A;  2ELK A;  2JMW A;  2R5Z A;  5GPA A;  4CYC B;  2AHQ A;  1IG7 A;  4FE7 A;  1MBJ A;  2O8K A;  3H3V K;  3S17 J;  3S1N J;  2JN6 A;  4Y52 J;  2DMN A;  4G12 A;  4XRS G;  4BBS J;  1RPW A;  2DA4 A;  2JJ7 A;  1JGG A;  1YRN B;  1I3Q J;  3Q0W A;  2E2J J;  4JYK A;  3NAR A;  5JLW A;  2DA1 A;  5M3F J;  2LTP A;  1ETX A;  3BQZ A;  1MBG A;  2K9N A;  4DYR A;  5EGO A;  1NK2 P;  2ME0 A;  4S0H B;  1U78 A;  2FJ1 A;  2H1K A;  2MGQ A;  2R92 J;  5DS9 A;  2D5V A;  1JKP C;  3S1M J;  2M0C A;  4A3M J;  3S1R J;  2DJN A;  3BTJ A;  3MKL A;  1RKW A;  3BR3 A;  3Q0U A;  3OOU A;  5E3O A;  3JRH A;  3ZOB A;  3B6A A;  3HKZ N;  1T56 A;  5FLM J;  1GT0 C;  2HOT A;  4FTH A;  1FIP A;  1Z0X A;  3CDL A;  5HOD A;  1QVT A;  1ETV A;  2B63 J;  1WPK A;  2M34 A;  2IAI A;  2Y9Z A;  4DZJ A;  3SDG A;  1QRY A;  2LR8 A;  5EZG A;  1E3O C;  5M5W J;  2Y2Z A;  2GM4 A;  4BBR J;  5EEA A;  1GUU A;  1JUP A;  1RKT A;  2Y31 A;  5C44 J;  1OCP A;  4DW6 A;  1MBF A;  4RBO A;  2ME6 A;  1QVU A;  3JRC A;  2N8G A;  1QPI A;  1Y1W J;  2L9R A;  9ANT A;  3QQA A;  4A3K J;  1GVD A;  2Y30 A;  1FEX A;  1TC3 C;  1WGX A;  1H88 C;  1JKO C;  2ECC A;  1UMQ A;  2L7F P;  3GTM J;  1VND A;  3JRG A;  3A01 A;  2LLK A;  1IUF A;  2LKX A;  1ZR2 A;  5JLX A;  2XPU A;  4GFB A;  2ID6 A;  2PMZ N;  3E7L A;  5IYB J;  3HOW J;  3BR5 A;  1DU6 A;  1XS9 A;  3BG3 A;  3S15 J;  1ZKG A;  1Q1V A;  2CJJ A;  2CRG A;  5E3M A;  4FCY A;  3TP0 A;  4XIC A;  3RZD J;  1IRZ A;  2JA5 J;  3ZQL A;  3I4N J;  2K40 A;  3GTJ J;  3BR0 A;  2EZL A;  3BTL A;  3S2H J;  5F04 A;  4IHY A;  2X6O A;  1I50 J;  1Y1V J;  1IJW C;  3IH3 A;  4JX4 A;  2XB0 X;  3G1O A;  1IDZ A;  4MIM A;  3BR2 A;  4A93 J;  3BR1 A;  3A01 B;  1FTT A;  3FIS A;  3RKQ A;  1LFU P;  3GTL J;  3DEW A;  2NS8 A;  2K9Q A;  3M3Y J;  1HCR A;  5J1Y A;  5E3N A;  4RDU A;  3BQY A; 
#chains in the Genus database with same CATH topology
 4B4C A;  2JA6 J;  1Y0N A;  4YII A;  3BCB A;  3TOB A;  3H5R A;  1J5Y A;  1X4P A;  3W2V A;  2O03 A;  1MIJ A;  4II2 A;  1UFM A;  4NBQ A;  5LD2 C;  1B8I A;  4E7S A;  2D1V A;  1WH5 A;  3O8H A;  3WTZ A;  1SFO J;  2CG4 A;  2P81 A;  3R61 A;  2E1O A;  4UUS A;  1U9N A;  4U7D A;  4AM3 A;  2DA3 A;  3BLY A;  1J75 A;  2CS3 A;  4JQF A;  4WXC A;  3K7A J;  1P92 A;  4DIQ A;  1G59 A;  5CPR B;  1ETK A;  3BOQ A;  3LWF A;  5CVI A;  1EH8 A;  4JP0 A;  2EQR A;  3MZ8 A;  2JUC A;  3VSK A;  5GAG J;  1RUN A;  3T5X A;  3BG5 A;  1W36 D;  3BT9 A;  4IKF A;  3DKW A;  3TP3 A;  1SMT A;  2IGM A;  1U5T B;  4XMY A;  3JRF A;  1XMK A;  1V5G A;  3G2B A;  4EJU A;  3W6K B;  2JZY A;  3HPG A;  4XSX F;  1FZP B;  2HI3 A;  3MVP A;  3JRE A;  3PJR A;  2I5U A;  4R79 A;  5FKM A;  3PNV A;  2VOP A;  2W24 A;  2VT2 A;  2H1L A;  3DWL E;  1MMN A;  3GUD A;  1UB9 A;  2TRT A;  1WFX A;  5B1A H;  1VQM I;  4GDF A;  1W4M A;  4D7M A;  4M3G A;  1RES A;  2EBI A;  1WJ5 A;  4M3B A;  2DMT A;  1BR4 A;  4A3L J;  4UUS B;  2ELJ A;  2RAE A;  2GBY A;  4PK4 A;  5DM7 F;  1I6H J;  3O8G A;  3BDD A;  1JUM A;  2DT5 A;  4G8X A;  2W25 A;  3EUH C;  3V7R A;  3EET A;  3MQ0 A;  3TW6 A;  2XAU A;  1RI7 A;  3CCQ I;  1W7P D;  2IGO A;  1ZTR A;  1BOB A;  2CUE A;  1D8J A;  2P6S A;  2Z9O A;  1Z67 A;  4BEH A;  2IA2 A;  4D5F A;  4XLA A;  3L2U A;  2GLO A;  1I3A A;  1FPQ A;  2BXZ A;  4R1H A;  4U7B A;  2IS1 A;  2DOF A;  1T0F A;  3GBG A;  3OSG A;  4HQE A;  4WK8 F;  4DBQ A;  3F8B A;  2L7M P;  2LH9 A;  3F9K A;  5EG0 B;  3HSF A;  1DU0 A;  1YYV A;  3CD6 I;  1X3U A;  1LJ9 A;  4HV6 A;  2R7Q A;  4IO9 F;  4PJM A;  5D8K B;  4PJN A;  4PSX A;  1SD6 A;  2FBK A;  2L9N A;  2ZJR F;  2KMU A;  1ZG5 A;  2NNY A;  4YFX F;  2ZXW H;  2VJI A;  4J01 A;  1WJC A;  2EWN A;  1X1B A;  2W00 A;  2BY3 A;  3PM1 A;  4YG2 F;  2MG4 A;  3C18 A;  2CUZ A;  1WHU A;  3ZQF A;  2X6Y A;  2W57 A;  3PFY A;  2KHM A;  3GFJ A;  2VIX A;  1IV6 A;  3LMM A;  3QP6 A;  1ZGW A;  1HDD C;  3AG2 H;  1F43 A;  5IP6 A;  5ICF A;  3VSL A;  3GTK J;  1LEA A;  4BQN A;  2DYR H;  2X6W A;  1QGP A;  2ZXH A;  2F5D A;  2PMH A;  3K70 C;  3KIO A;  4V2F A;  1WI9 A;  5IY5 H;  5EF6 A;  2KZV A;  3SJM A;  1GV5 A;  2H8R A;  3WGG A;  3HGY A;  4BKX A;  1OYY A;  3W2A A;  4AYB A;  2DQR A;  2FBI A;  2XHK A;  1K79 A;  2VUM J;  2L0K A;  1MKM A;  3RDI A;  3ZGK A;  4YEJ A;  3SXY A;  1NHA A;  4HDU A;  2YUS A;  1UJ8 A;  3KEQ A;  1JHF A;  3PIO F;  4E7L A;  2M7B A;  3P7N A;  1FYK A;  4CH7 A;  3A1Y A;  5GAD J;  1QU3 A;  3E3V A;  2EV6 A;  2DW4 A;  2GZW A;  3HOS A;  1B72 A;  2MLK A;  4BL0 B;  2P5L C;  2OA4 A;  3HHH A;  4BXX J;  2EIL H;  2B0L A;  3I0T A;  2WB1 A;  3DF8 A;  3IL2 A;  3EUH A;  2NS7 A;  3W2W A;  1DDN A;  4BNC A;  2ELH A;  4IOA F;  2DU9 A;  1WI3 A;  1SAX A;  2IS6 A;  5FKK A;  1E3P A;  3MZH A;  3DTK A;  4DYQ A;  3OSF A;  2R7O A;  3DCF A;  1WRJ A;  5C4J J;  4F92 B;  1CQT A;  4OWR B;  4RM3 A;  3BP8 A;  2QEX I;  1XMA A;  1MW7 A;  1TWG J;  2V9K A;  4C2M J;  3IH4 A;  4BE2 A;  5DTD A;  2XSD C;  2K4J A;  3CCJ I;  1QBJ A;  2IA0 A;  2K4B A;  1ZN2 A;  1ZH5 A;  1FYL A;  4EM2 A;  3BJO A;  5TJJ A;  2ADU A;  3ERM A;  3OYA A;  4O3M A;  3RTR A;  2DTR A;  2HXI A;  4UVC A;  1YW7 A;  1PP8 F;  1FP1 D;  1TBX A;  5CQG A;  5F27 A;  3CJR B;  3DKY A;  5E20 A;  2CW7 A;  3HEF A;  4XKV A;  1YO5 C;  2A6T A;  1JJ6 C;  1A5J A;  1X1D A;  4QIW N;  4BHP A;  5J1U A;  3CC7 I;  1MH4 A;  3NEU A;  3LQR A;  1Y0U A;  4B3A A;  3D5S C;  1YX5 A;  4ZTJ A;  3BZ6 A;  2MW8 A;  2XSJ C;  2VKH A;  4CCL A;  3RPQ A;  3Q0V A;  4PUS A;  3N05 A;  3ECO A;  3FF5 A;  5HDG A;  2FX0 A;  2K9M A;  3WU1 B;  2WB1 N;  2XF7 A;  1TTY A;  2UV1 A;  1T39 A;  3PSF A;  4RB0 A;  4XM3 A;  5CQE A;  1MMA A;  2FF4 A;  4A3F J;  2ISZ A;  5AON A;  3FZV A;  4HX4 A;  1FMW A;  3FXO A;  5CVV A;  1HW5 A;  5IOY A;  2X6X A;  3S2D J;  2O9L A;  4I99 C;  1ZRF A;  1TT0 A;  2STT A;  2HZT A;  4DJA A;  2IS2 A;  1VQ7 I;  3EYI A;  4KIG A;  5GTI C;  3QWL A;  4BQQ A;  2CQN A;  2BXY A;  2NVQ J;  3E5X A;  4RGS A;  3H3Z A;  1Z7U A;  3PQJ A;  3RIR A;  2XC7 A;  4MFE A;  1HBX G;  4IHW A;  3FM5 A;  5DEQ A;  2VKV A;  2NNN A;  3NWS A;  3HOU J;  2BHY A;  3G73 A;  4KMF A;  2Y9Y A;  5F6F A;  4ZZD A;  4XLP F;  1W0T A;  1PUF B;  4A5M A;  1MZB A;  1P7J A;  2OV7 A;  4F3Q A;  3I56 I;  1BJZ A;  3V7C A;  2VB6 A;  4L5E A;  3FXU A;  3IV5 A;  2VBW A;  2R7V A;  1HXD A;  5JFR A;  4Y17 A;  3GZN B;  4I76 A;  3I64 A;  4LG0 B;  3QPT A;  2OC6 A;  3HGG A;  1XSV A;  2Y48 A;  4ITV A;  3F22 A;  1W36 C;  5L3B A;  2EFO A;  1OCT C;  2KJB A;  3F72 A;  3DBL B;  1BIB A;  2R0Q C;  2JQ7 A;  3EUK L;  1RRJ A;  3LAP A;  2ID3 A;  4RM2 A;  5M5Y J;  4I02 A;  2BW3 B;  3GWZ A;  1KZH A;  1X3Z B;  2LRE A;  4IJA A;  5LGU A;  1DP7 P;  3Q9S A;  1G3Y A;  3F3X A;  4C3J J;  4A6E A;  1O3Q A;  3HJE A;  3SEZ A;  1MNE A;  2L7K A;  2DT6 A;  4G6Q A;  1OCO H;  4Y15 A;  5CJ9 A;  1FIA A;  5C3E J;  2DPD A;  1RIO H;  2QKM B;  2PN6 A;  2ACJ A;  5HS7 A;  4F93 B;  5J6X A;  4GRI A;  3OYD A;  1YJ9 I;  2KRF A;  4CA0 A;  4IL6 C;  1EA3 A;  4AVZ A;  1RR8 C;  1D1C A;  1QPM A;  3S17 J;  4Y52 J;  2E36 A;  3E6B A;  4G12 A;  4XRS G;  4FT8 A;  1S6L A;  2F5C A;  4BBS J;  2XIG A;  3H5A A;  2QM3 A;  2DA4 A;  2JJ7 A;  1JGG A;  5J8C A;  2Z5U A;  1BC8 C;  4PGH A;  5DUI A;  5JLW A;  4P55 A;  2LTP A;  2HU9 A;  3BC8 A;  3AG1 H;  2OAZ A;  4DYR A;  2V9V A;  2ME0 A;  3GFM A;  2JA2 A;  3CCR I;  3MFK A;  3CF5 F;  4HSR A;  2QYO A;  4N4O B;  2LY1 A;  3HSE A;  2HPM A;  3OIQ A;  3S1M J;  4OIP F;  4A3M J;  3S1R J;  3E97 A;  1WVR A;  2DJN A;  3BTJ A;  4C2T A;  4KN4 X;  2K86 A;  2L9S A;  1ZAR A;  1HSJ A;  3JRH A;  2Y0M A;  4L0Z B;  1T56 A;  2FEZ A;  3HXL A;  1GT0 C;  4RAG A;  2YX7 A;  1Z0X A;  2D2W A;  1XMX A;  1WJF A;  2OZ6 A;  3GF2 A;  5HLT A;  1SC7 A;  2JVH A;  2F2E A;  1E3O C;  3HRM A;  3PQK A;  3OYG A;  2IRF G;  3ULQ B;  1XCV A;  2RNG A;  2Y2Z A;  3H9Q A;  5HS9 A;  4BBR J;  5EEA A;  1QQI A;  1RKT A;  1VQ5 I;  3LSH A;  2LKP A;  1TNS A;  2H94 A;  2MH9 A;  4FET A;  4DW6 A;  2BYV E;  2BVM A;  3ZMV A;  3SDB A;  1Y1W J;  1STZ A;  4M73 A;  3HZJ A;  3P5J A;  3TQN A;  1WSU A;  4KYW A;  5AIQ A;  3FXK A;  3FXM A;  2O6G E;  4CHU A;  2KRC A;  3ML6 A;  1IN7 A;  1JKO C;  2BOL A;  2MA3 A;  2O61 A;  2ECC A;  1UMQ A;  1P2F A;  4UY8 I;  4RAZ A;  3JRG A;  1BOA A;  1XSX A;  2HKO A;  3G3Z A;  2ID6 A;  3K2Z A;  1E2X A;  2IXS A;  5ILS A;  5FLX K;  3WG9 A;  1U3E M;  3I59 A;  4B8X A;  1KU7 A;  1DU6 A;  1XS9 A;  3BG3 A;  3S3O A;  2CRG A;  3TDZ C;  4G9Y A;  3E6C C;  1UHW A;  1XGM A;  3CCU I;  4HLY A;  1WQ2 A;  3FDY A;  4UUV A;  1DGW Y;  4XIC A;  1ZLK A;  4B43 A;  3GTJ J;  2BY1 A;  1LDK B;  5GAE J;  5BQT A;  3BR0 A;  2EZL A;  2JPB A;  1WJA A;  3S2H J;  3RPU D;  2VQH A;  2HVQ A;  1I50 J;  1K78 A;  2GXB A;  2GXA A;  3KET A;  2Y69 H;  1DQU A;  3MCZ A;  1QZZ A;  4ZYE A;  1IDZ A;  1F5T A;  4E70 A;  3CUQ B;  3HTS B;  3FXQ A;  1BI2 A;  4IOC F;  4EJT A;  1FTT A;  4WWC A;  1LFU P;  2HZD A;  3KZI C;  2EJR A;  1J2X A;  3DEW A;  1N78 A;  3KZZ A;  2K9Q A;  2ZXJ A;  1HCR A;  1PJR A;  2DOE A;  2V6E A;  3EPZ A;  1VQ9 I;  2OTJ I;  3QYE A;  3OIP A;  1FMV A;  1U8B A;  4MFD A;  4EGZ A;  3HBL A;  2R5Z B;  3FHN A;  4W97 A;  4IZZ A;  2LC2 A;  2COB A;  2FSW A;  4KT5 C;  2DMU A;  1OQY A;  4GYG A;  5J1R A;  1XPX A;  3N97 A;  1HST A;  3OR2 C;  2XGE A;  1IRX A;  5LGN A;  1UST A;  1UAA A;  3HG9 A;  5F08 A;  4A0Z A;  4IHV A;  2W85 A;  1ZGA A;  1ON2 A;  2CU7 A;  3KPH A;  4NQW B;  4WX9 A;  3CCE I;  2MFZ A;  3VYU B;  3RZO J;  3EDP A;  2MBF A;  2J5O A;  4UV9 A;  1X58 A;  2XPW A;  5K5O A;  2L9V A;  3K2A A;  2HQN A;  4U87 A;  1YIJ I;  4UVB A;  2OD5 A;  1ZLJ A;  1JI8 A;  5ILU A;  1IXC A;  1MJB A;  3WOD F;  1GLN A;  4M9Z A;  3IAM 2;  4ASN A;  4G94 A;  1LEB A;  1MDM B;  2F5E A;  1G3S A;  2QVO A;  3DEE A;  1U0J A;  5CKT A;  3DU5 A;  1SAN A;  2K5C A;  4NUB A;  1XX5 A;  5FFX A;  1GXP A;  1Z21 A;  1LDJ A;  3ASN H;  1R36 A;  4MLO A;  3DXJ F;  4EEF G;  5EYR A;  1LFB A;  4S04 A;  3BPX A;  2XF6 A;  2Z16 A;  1PDN C;  3DP7 A;  1MMD A;  4XLE A;  1ERD A;  3MZY A;  3D1N I;  2LF7 A;  2P4W A;  1S7O A;  5D5W B;  2WC2 A;  3I3L A;  1P4X A;  4G6T B;  1SD7 A;  1TT5 B;  5J4Y A;  2PLY A;  1VQO I;  3VEP A;  2G0E A;  1TWC J;  2LSO A;  4XNF A;  5B66 C;  4RS8 A;  3CMA I;  3AKZ A;  1HW1 A;  1AHD P;  3WTW C;  2CFX A;  3OYL A;  3GO5 A;  2FML A;  2LBF A;  1TL8 A;  3FX3 A;  4BEH B;  3CO7 C;  1XTA A;  5ILV A;  4L9T A;  2E7X A;  2CO5 A;  4MO7 A;  5GTH C;  2XB5 A;  4BQA A;  3J7A O;  3GLL A;  2L2O A;  4Q48 A;  1F9N A;  3PUB A;  3SYT A;  4LOC A;  1AU7 A;  3WHB A;  2ZSH B;  4I09 A;  4IX7 A;  4LJZ F;  5DV5 A;  1K6Y A;  3S16 J;  3RI4 A;  3HHG A;  1R22 A;  2V1U A;  3EUA A;  3AFH A;  4HZF A;  4M6X A;  4EAT A;  1FP2 A;  5GAH J;  4M3E A;  4HQM A;  4BQO A;  1MBH A;  1FSE A;  3IRR A;  3K4K A;  1XGS A;  1S7E A;  2LYC A;  5AIP A;  4BJ6 C;  1T33 A;  4ETS A;  5IYD J;  5IOZ A;  1TWH J;  2ZSI B;  1J59 A;  3U1D A;  2WWY A;  3BTC A;  4ZZL A;  1ODD A;  2DI3 A;  3AG3 H;  2RV8 A;  1FOY A;  2KDO A;  5FKO A;  2XVC A;  2DYS H;  3M1E A;  4E7H A;  3DU6 A;  2JVG A;  1MMG A;  2HXO A;  4HST A;  2LK2 A;  4MQV A;  3FXR A;  1SVO A;  2HOS A;  2WY7 Q;  1ETO A;  2HOE A;  3H35 A;  3LQQ A;  2DAO A;  2DDA A;  2X1E A;  1NG6 A;  1APL C;  3W6V A;  2HDW A;  1D5V A;  1PVE A;  3HOX J;  3F21 A;  4PFP A;  3HM5 A;  5FFZ A;  2KJC A;  3VOD A;  3KEO A;  3L2R A;  3CMY A;  1RC9 A;  1FBU A;  5K7F A;  3HUG B;  1R9T J;  4NB5 A;  2KZG A;  3LA7 A;  3OY9 A;  4UXN A;  5E18 F;  1ORK A;  4OOI A;  3VB2 A;  1SFK A;  1ETY A;  1WWX A;  2VT3 A;  3ZQ7 A;  4X1E A;  2BY2 A;  5D6F A;  4C3H J;  4NDL A;  2VQC A;  4IEJ A;  1O7F A;  5LFA A;  3B02 A;  3HPH A;  3SQN A;  3ZP5 A;  1ZRC A;  2F6C A;  1JT0 A;  2KIF A;  1VQ4 I;  2MC3 A;  4CIC A;  4CXF A;  4OIQ F;  4NC7 A;  4BJ5 C;  1P7I A;  3LOC A;  4RA2 A;  5J4V A;  4BY1 J;  1TW2 A;  2R7X A;  1YS7 A;  3DBH B;  2VPR A;  4Y7N J;  2CYY A;  2P8T A;  2H6C A;  5HLH A;  2A5W A;  2F5F A;  2OQG A;  1T95 A;  2YPR A;  2BY0 A;  5BS6 A;  1KYZ A;  3ISP A;  4LG3 A;  5DM6 F;  3RJP A;  2M4K A;  1QNT A;  4F7Z A;  5J40 A;  2NXN B;  2JWT A;  1IRG A;  2HYG D;  4DBR A;  4AIJ A;  2IT0 A;  5JVT A;  2Q0O A;  4KIC A;  1WZ2 A;  4J19 A;  5HVQ C;  1HKS A;  1YJW I;  2XAH A;  2K02 A;  3NQO A;  3SHF A;  1AOY A;  3Q3S A;  2NOG A;  1V5E A;  3HSR A;  2OPT A;  2DMP A;  5M5X J;  3M7G A;  1VQK I;  1HC8 A;  5IT9 Z;  2Z2S B;  3LNQ A;  1DPU A;  2KDZ A;  1KQ0 A;  2Q1Z B;  4HEA 2;  3HYI A;  3QPL A;  1A04 A;  5LLQ A;  2D45 A;  1VZ0 A;  2V1N A;  2VLA A;  2VQL A;  3G71 I;  2GXG A;  1K83 J;  5BMZ A;  2IGK A;  4IRH A;  1QA6 A;  2DFH A;  5C4X J;  2WY8 Q;  1EH7 A;  1ZR4 A;  1JKQ C;  4IRI A;  5L3F A;  2BBY A;  2P5K A;  1X1A A;  2KKO A;  1MBK A;  1AKH A;  5HLG A;  2VXD A;  3RSN A;  2EFP A;  1GV2 A;  4IRG A;  4A3I J;  2EIJ H;  4XID A;  1EKE A;  3GTO J;  3K1N A;  1BW5 A;  3L2C A;  5BPI A;  2RN7 A;  2HVS A;  1JXS A;  3HIF A;  2JT1 A;  4HNT A;  2LDU A;  1B59 A;  2FRH A;  4A0Y A;  3DV8 A;  4IXA A;  4B1R A;  1MSE C;  4CZZ A;  4QPO A;  2VBZ A;  4XLN F;  4ENJ A;  5BPD A;  1A6I A;  2F4O B;  1S9H A;  3ABU A;  3CP8 A;  3COA C;  2CV2 A;  5FJ8 J;  1GDT A;  3BWG A;  1XDU A;  1Z3X A;  2A6E F;  2HS5 A;  4LIT A;  1IV8 A;  4PDK A;  3H0G J;  1KGS A;  1FWZ A;  5ICE A;  2CUJ A;  2PMU A;  2CQ7 A;  4TV7 A;  3HDD A;  4MHG A;  2DN0 A;  3UNG C;  4PCQ A;  2L4M A;  5A2Q K;  2E34 A;  1BA5 A;  1DUX C;  3IUO A;  4MTE A;  1HF0 A;  3DBR B;  1IC8 A;  3FK6 A;  1S29 A;  4AYB N;  2UXX A;  2R7U A;  3DKX A;  4XN0 A;  2QBY A;  1J9I A;  2VPL A;  1B8I B;  4D7N A;  1ZQ3 P;  1XG1 A;  3OYM A;  2FD5 A;  4EQQ A;  2ZME C;  3DTE A;  2Y0S N;  3R4K A;  3H36 A;  3J80 Z;  1UG2 A;  3QPS A;  3CCL I;  3K4J A;  1TWA J;  2YS9 A;  2NVT J;  2RRE A;  3CES A;  5FRM A;  2A3S A;  4Q47 A;  3ERE D;  3HTU A;  4W1U A;  1Y8Q B;  2JRT A;  1KU2 A;  2EH3 A;  1H89 C;  3MN2 A;  1ZRE A;  4P9U A;  2KL4 A;  2XAG A;  3U2R A;  2CH0 A;  3UKG A;  3J80 K;  4ANJ A;  4B09 A;  2QEN A;  2K9L A;  2XGC A;  1G3T A;  3WTV C;  3CTA A;  2OBP A;  2GOX B;  2XKP A;  3CJQ B;  2WA0 A;  1IW7 F;  4OIN F;  1MMS A;  1TNT A;  3IWZ A;  2J5P A;  4HF0 A;  3P9C A;  5K7H A;  3OYC A;  4Q5S F;  2XDV A;  1KQ9 A;  3S14 J;  5FO5 A;  3K4M A;  1IZ1 A;  2OU2 A;  1I39 A;  2GWR A;  4KN7 X;  4FE7 A;  2KQR A;  1MBJ A;  4I0A A;  3H3V K;  5LBQ A;  1VQ8 I;  2O8X A;  4G7Z F;  3KP7 A;  2DQL A;  5HDK A;  4JYK A;  4UV8 A;  3WTS C;  2L02 A;  3VYR B;  3ABT A;  2PBI A;  2DA1 A;  4NQW A;  1ETX A;  2WV0 A;  2CGP A;  1YIT I;  3A4C A;  4EJV A;  4HF1 A;  4YFN F;  5EGO A;  1NK2 P;  4J00 A;  4OMZ A;  4S0H B;  2FJ1 A;  2Y0S A;  3DFG A;  4S05 A;  1YJN I;  1G4D A;  1X1P A;  2RDP A;  3MD2 A;  5DS9 A;  1JKP C;  4P96 A;  1UHM A;  1R1V A;  4M74 A;  4KIF A;  1LQ1 A;  3K70 D;  4RGU A;  1R23 A;  3H92 A;  2WAE A;  3MKL A;  3OS2 A;  3BY6 A;  1RKW A;  2EIM H;  5B5E C;  2Z33 A;  6PAX A;  3A2K A;  3E6M A;  3Q0U A;  3OOU A;  2LMD A;  1VTN C;  2EA4 A;  3H9G A;  2HOT A;  2M45 A;  4BE1 A;  5HOD A;  4F55 A;  1TP4 A;  3H0D A;  2M34 A;  2IAI A;  3GLX A;  2Y9Z A;  4DZJ A;  3SDG A;  1QRY A;  2LR8 A;  5EZG A;  2K3F A;  3ESW B;  5M5W J;  3GEZ A;  2ZC2 A;  4IQ4 A;  3H1C A;  4AD9 A;  5LHI A;  3OYH A;  2GM4 A;  2F4I A;  4L0Y B;  4UHT A;  2DJI A;  3FM3 A;  1W5S A;  2Y31 A;  3CCS I;  3P9K A;  3M8J A;  1VQ6 I;  2DLL A;  1W5T A;  1QVU A;  1O7L A;  2B9S A;  2MLG A;  4U0W A;  1FY7 A;  1QPI A;  2COM A;  5KAI C;  2IGN A;  3IP4 B;  2L9R A;  2Y30 A;  3ELK A;  4LK0 F;  4MTD A;  3AL0 B;  1H88 C;  1H9G A;  1MJA A;  1FOW A;  3GTM J;  4II3 A;  4HX8 A;  3LSK A;  4RB3 C;  3WGI A;  1ZEL A;  3A01 A;  2WAD A;  4GFB A;  1LVK A;  3MMY B;  4B3X A;  2PMZ N;  3DPL C;  2CWE A;  3E7L A;  4M9S A;  3HOW J;  1LB2 A;  3TO6 A;  2OZU A;  2QKL B;  2DFI A;  4BS9 A;  3S15 J;  4G7O F;  3K4B A;  1Q1V A;  1LFP A;  1D0Z A;  2RGV A;  5HNH A;  3TP0 A;  4WCG A;  4D1Q A;  3RZD J;  2GOM A;  4MEX F;  1OR7 C;  1QHH D;  2JA5 J;  4LGW A;  2VKD A;  1R58 A;  1A6Q A;  1WJB A;  1TQP A;  2NYX A;  3CUO A;  1J7K A;  5LGT A;  1Z1D A;  2C6Y A;  3CDI A;  5BOX A;  1Y1V J;  4O6J A;  4OU0 A;  4LFU A;  2KPM A;  4MIM A;  3BR2 A;  5HLI A;  4A93 J;  3V4G A;  2HDC A;  5L3D A;  3BR1 A;  3JAM Z;  3A01 B;  4IVN A;  3FIS A;  1XN7 A;  1ZG3 A;  4N4N B;  1U2W A;  1R71 A;  2EB7 A;  3GTL J;  2QGU A;  1KYW A;  2L54 A;  2V4J C;  3RYP A;  3H9J A;  4A12 A;  3OR1 C;  3M3Y J;  5H20 A;  4LD5 A;  3IAS 2;  5J1Y A;  5E3N A;  1R1U A;  4DYC A;  4CYC A;  1Y56 A;  3JAM K;  1IN6 A;  1BJA A;  2HWV A;  4P5O A;  2JA7 J;  1X3W B;  1XDS A;  2VON A;  5FLV A;  5CVU A;  4Y4R A;  2X48 A;  1P4A A;  5K1Y A;  3LFK A;  1O4X A;  1BR2 A;  3GTQ J;  5EZH A;  2IP2 A;  5KAF C;  2KIU A;  4YRV A;  3RYR A;  5ED4 A;  1VFC A;  1TW3 A;  2M5W A;  4B44 A;  4I2O A;  1TZL A;  2TCT A;  2ZFW A;  1ZRD A;  2YU9 J;  1I6X A;  5JI6 A;  1FX7 A;  3JSO A;  2A61 A;  3WGH A;  2R5Y A;  4XBF A;  5E1W A;  1ONV A;  4D5C A;  3JSP A;  3GZ6 A;  2FQ4 A;  4HDV A;  3CJT B;  4IHX A;  3QP5 A;  3B73 A;  1BI0 A;  4E7K A;  4A3E J;  3C2B A;  1G6N A;  3MKY B;  2CQQ A;  3I4M J;  1BI1 A;  2KIM A;  3CC2 I;  1XGN A;  4A6D A;  3K4C A;  1L3L A;  1VQP I;  3KFW X;  4HX7 A;  1FTZ A;  1K7A A;  4YEL A;  2MD0 A;  1YS6 A;  2VAS A;  2QBY B;  5E1X A;  4C2U A;  5BNG A;  1IUY A;  4HV5 A;  3LA2 A;  5K5Q A;  1V3F A;  3KP6 A;  1YTY A;  2M87 A;  3WTU C;  2Z99 A;  5IP9 J;  1OCZ H;  2JPC A;  2XRN A;  4A3C J;  2M8G X;  2VC0 A;  3GTG J;  2OUM A;  4BE0 A;  5FB2 A;  4GCV A;  3SZT A;  5FRN A;  3ROU A;  2M4G A;  3C2G A;  3IH2 A;  5KK1 A;  1JE8 A;  1OR7 A;  3KYL A;  4DQ2 A;  1F4K A;  4Z2Y A;  4XOR A;  2ZJQ F;  5IP7 J;  1UEL B;  4Y13 A;  3R0A A;  1QO0 D;  1RNL A;  4OAZ A;  2JK3 A;  2B7E A;  1YI2 I;  2CFO A;  4EM1 A;  2JTV A;  2R4G A;  3VYT B;  5F0C A;  1XCB A;  3PFI A;  4UB6 C;  4NNJ A;  4XLF A;  4P9F A;  2E71 A;  3I5U A;  4C9Y A;  1OKR A;  3I4P A;  4MEY F;  2P7C B;  1IN8 A;  1P9Q C;  1YLF A;  1B9N A;  2M2E A;  5LEK A;  1M1E B;  4A69 C;  2HNH A;  1AWC A;  1N77 A;  3Q9V A;  1SFU A;  3K0L A;  5H2F C;  3S2W A;  1YW8 A;  4BH9 A;  1R5H A;  2Z3Y A;  2H6B A;  5E1Z B;  4LB5 A;  4ZYH A;  5K7Z A;  5EDN A;  4AIK A;  3TL4 X;  1HOM A;  1MGT A;  2E5Z A;  1D0Y A;  3NWT A;  4FHT A;  4ZDL A;  3LSJ A;  1U9O A;  4XOP A;  2K7L A;  5KCM A;  1TQM A;  1ITY A;  5EEG A;  3DPU A;  4PFO A;  4HAM A;  3TKY A;  2DBB A;  5EJC A;  4EV0 A;  1N25 A;  4XRF A;  4EVI A;  5D4S A;  1J09 A;  3U9G A;  1YOV B;  2GIZ A;  2IEK A;  5EG0 A;  2XPV A;  5FRO A;  4E7Z A;  2XRL A;  3TO7 A;  4PJL A;  5HDN A;  3X2Q H;  3IHU A;  2PJP A;  2E2H J;  2O5R A;  3HB9 A;  3FXL A;  1SD5 A;  2D1H A;  2WV1 A;  1AA7 A;  1I27 A;  2PFB A;  2WAQ N;  3UR3 C;  3OWT A;  3E1S A;  4CDG A;  2ESH A;  1RET A;  1ETW A;  3L2Q A;  1YQA A;  2VC1 A;  1HKQ A;  5F0F A;  2UUZ A;  1F1Z A;  1VF9 A;  5H6Q A;  3W6J B;  3A0H C;  3KP2 A;  5LEJ A;  4AVP A;  4NC6 A;  2XAJ A;  1OMI A;  2EA2 A;  3TBI A;  4A2U A;  3LST A;  4JK1 X;  3CME I;  4O5V A;  2E1C A;  1YIO A;  2DTZ A;  3NAU A;  3PO3 J;  2ECB A;  2HYJ A;  2MSY A;  3GYH X;  1ON1 A;  4CSW A;  1Z7L A;  3PSI A;  4CCN A;  1BR1 A;  4XQF A;  3HOZ J;  4A3B J;  1HA8 A;  3BPV A;  2OF7 A;  1YX3 A;  1R4M B;  1LPQ A;  1LUJ B;  3LL7 A;  2V26 A;  1LKX A;  1OFC X;  2VL8 A;  1UZC A;  4BYY A;  4BDZ A;  3BG7 A;  4AWX B;  1D1B A;  1P6R A;  2DDB A;  1R5I D;  4BY7 J;  2NVX J;  3U21 A;  5IPA A;  2RKH A;  1D1A A;  1EH6 A;  2O3F A;  2DK5 A;  4A0X A;  3H3U A;  3ZPL A;  4GXO A;  2FE3 A;  4M9X A;  1WCM J;  2AO9 A;  2FQ3 A;  2EIK H;  3BZC A;  2I8D A;  2CQX A;  3SFI A;  4BGD A;  4EJW A;  1X2M A;  4WXD A;  1BI3 A;  4PZJ A;  2PMZ A;  1B72 B;  2FMY A;  1IF1 A;  2A05 A;  2QSH X;  1XD7 A;  2DFE A;  2F4M B;  1T8I A;  4PJ0 C;  4XK4 A;  3T8R A;  2W84 A;  4KNY A;  4D9J A;  2LF8 A;  1HLV A;  3GCM A;  3I55 I;  1JT6 A;  1Z77 A;  4P1W A;  3CZ6 A;  3M8E A;  2PG4 A;  4M6V A;  2KIS A;  4R8H A;  3CLO A;  3S93 A;  3GME A;  4ZYD A;  5J8F A;  1W0U A;  2DMQ A;  1FNN A;  2E2I J;  2BHZ A;  4L5J A;  2ZNY A;  1IN4 A;  4Y33 A;  2HYF A;  5FKL A;  3VPR A;  4YFK F;  4I6Z A;  4XRS A;  3QPH A;  2M9H A;  4XKB A;  3WE3 A;  2E1N A;  2YR2 A;  3SEQ A;  4FE4 A;  1KQ8 A;  4I98 B;  1A35 A;  4M71 A;  4ESJ A;  4CYD A;  3TED A;  1Z6R A;  1R4N B;  3JCU C;  5CVR A;  4ESB A;  2VE8 A;  5LHG A;  2AXT C;  4QWQ A;  3RPU A;  3GFI A;  4JOM A;  2WAQ A;  3CO6 C;  1K61 A;  4ZH4 F;  4A3J J;  2JA8 J;  4RAY A;  2VJ4 A;  2LKS A;  3U1K A;  3V42 A;  2R7Z J;  4XRM A;  1Y6I A;  2EZK A;  4MGR A;  4XLH A;  2QUF A;  5J3L A;  3ZRG A;  3ZMS A;  2UZK A;  2IA1 A;  1Z3Y A;  1L0O C;  4EMS A;  3JRI A;  1D8K A;  1IXS B;  3OYI A;  3HOV J;  3M8F A;  1Y39 A;  3VWB A;  1R00 A;  2BW3 A;  1OJL A;  3RKW A;  1KU9 A;  5TIS C;  1BL0 A;  2STW A;  3J7Z I;  2FNP A;  2X0L A;  2KFD A;  4MNU A;  1YFH A;  1FLI A;  2X9D A;  4A3D J;  1USS A;  2R7S A;  1DGR M;  3LSR A;  3ZMT A;  1NK3 P;  1YHQ I;  4XLC A;  3C1D A;  2QCO A;  4ENK A;  3BG9 A;  3QOD A;  1FT9 A;  2KIQ A;  3FIW A;  3QYF A;  1MSF C;  3EQL F;  2V1D A;  2VE9 A;  1JKR C;  4OMY A;  3ABM H;  4A5N A;  2L7Z A;  5K5R A;  3OYB A;  3A03 A;  5H6R A;  4IHS A;  1D3Y A;  1E0E A;  3I59 B;  2R5Y B;  3DEU A;  3ECH A;  1YRN A;  3HKZ A;  3QU6 A;  3K4L A;  3M07 A;  2R7F A;  3JTH A;  3KZY A;  4CCJ A;  2LFB A;  1WH7 A;  2OJE D;  1LNW A;  2H27 A;  2V79 A;  1LDD A;  3C7J A;  3OIO A;  5D5X B;  4BXF A;  1PUF A;  3ZXS A;  2EV0 A;  3VOE A;  2CW0 F;  2Q2E A;  2LP0 A;  2DA5 A;  3F8F A;  3RKY A;  2CUF A;  4LLG F;  3KLN A;  2PEX A;  3M4O J;  4LIU A;  3MKZ A;  1OCR H;  4XOT A;  4C3I J;  3A02 A;  1IDY A;  4HW0 A;  4FX4 A;  2GAU A;  2YSR A;  3V7S A;  4GGG A;  2ELK A;  2FNA A;  2JMW A;  5GPA A;  4CYC B;  2Y75 A;  3M1C A;  3I54 A;  1ZGJ A;  3E5Q A;  3G4S I;  2ZCW A;  1R1T A;  3QYB A;  3OYN A;  3PIP F;  4ENM A;  5HS8 A;  2O8K A;  2DMN A;  3I9V 2;  5KHD A;  3DLL F;  4XL9 A;  3BZK A;  3DLA A;  2F48 A;  2MYS A;  4DNC A;  1CGP A;  1FC3 A;  1YRN B;  4ON0 A;  4FAS D;  3Q0W A;  4M72 A;  3CF2 A;  3QU3 A;  2BVL A;  1DPR A;  2QQB A;  3S8P A;  2PJR B;  2M0M A;  3BCA A;  2ISY A;  1GXQ A;  3OL4 A;  1Y8R B;  2E7W A;  4LLN A;  1G8X A;  2K9N A;  4BU2 A;  4RGR A;  1V5F A;  1U78 A;  2XRO A;  4KA4 A;  3FMQ A;  2H1K A;  2VBY A;  2NRA C;  2R92 J;  4F91 B;  4N9H A;  4PGG A;  3SZG A;  3WG7 H;  1QZY A;  1I1G A;  1XSD A;  3K6G A;  4L18 B;  4BJT A;  4ZJZ A;  1DP3 A;  4GO1 A;  2HKX A;  2IJL A;  4WXH A;  1ZG1 A;  3HRU A;  3WU2 C;  3HKZ N;  5FLM J;  3Q5F A;  4GYI A;  4FTH A;  2FA5 A;  2E1M C;  1PUE E;  3CCM I;  4HPQ A;  2V9P A;  2B63 J;  3MKW B;  1VQL I;  4XN3 A;  3K10 A;  4LG0 A;  1MDM A;  2H09 A;  2M8E A;  3S3N A;  2MD5 A;  3I58 A;  3M9A A;  1O3T A;  3ZN0 A;  1FOX A;  3VDX A;  2Z1D A;  2FBH A;  1JUP A;  2BV6 A;  2FUG 2;  5C44 J;  4HYE A;  2O0Y A;  4RBO A;  2ME6 A;  1X1C A;  4B48 A;  1B4A A;  4HG2 A;  3JRC A;  2N8G A;  3JW4 A;  1EV7 A;  1S7A A;  4IPA A;  3T8T A;  4A3K J;  2X51 A;  3D5L A;  3AAF A;  1FEX A;  1WGX A;  1K6O A;  2BEO A;  2L7F P;  2LRD A;  4RAF A;  4AU7 A;  4RGX A;  1OCC H;  2LLK A;  1IUF A;  2LKX A;  1SFE A;  2KP6 A;  5JLX A;  1W7P A;  3QRF F;  1ZR2 A;  3OYJ A;  1OIS A;  3A0B C;  4FQG A;  4RLQ A;  2JSP A;  5IYB J;  2X1D A;  1WJD A;  3BR5 A;  2CV1 A;  3RQ4 A;  2NVU B;  3T0Y A;  4EM0 B;  1ZKG A;  5DCM A;  2CJJ A;  2IPQ X;  1LVA A;  1W5C C;  4HBL A;  5E3M A;  3FHZ A;  3HUG A;  2FOK A;  4XKC A;  1CF7 A;  2DO7 A;  4RMN A;  1IRZ A;  5FGM A;  3ZQL A;  1I1S A;  3HC7 A;  2R7W A;  4OIR F;  3WTT C;  2K40 A;  3BTL A;  5JHU A;  3RKX A;  4IHY A;  4EGY A;  5D6E A;  3IH3 A;  2VJ5 A;  4LB6 B;  2XB0 X;  3G1O A;  1FSH A;  3ZR8 X;  3WTY C;  1OYI A;  4N9I A;  4B47 A;  1SVL A;  2P7V B;  3RKQ A;  3OYK A;  3F23 A;  3OS0 A;  1QZE A;  1JHH A;  3KP5 A;  5L3E A;  3GW2 A;  3BQY A;  3BJA A;  1E3H A;  2OQR A;  4E7J A;  4UVA A;  2XKO A;  2LG4 A;  2VKE A;  3LSI A;  1ZYR F;  2G9W A;  1H9T A;  5D5V B;  1ACI A;  5FD6 A;  2NOJ B;  5EEH A;  3GXO A;  2OCE A;  2KT0 A;  3BJ6 A;  3FWE A;  2RQP A;  2VXZ A;  1U5T C;  1HQC A;  1Z91 A;  4QPQ A;  1BBY A;  4AC0 A;  1OPC A;  2RNJ A;  2LVS A;  4LIV A;  1BM9 A;  2JSC A;  1S72 I;  2HQR A;  4KDP A;  2ICW G;  1T38 A;  1W1W E;  5F64 A;  1RR7 A;  3KCC A;  3K1M A;  2PQ8 A;  4CCO A;  5GP9 A;  5F0H A;  4PJJ A;  5D8L B;  4KFC A;  1U8R A;  4N0B A;  1LE8 A;  4BAY A;  1UHS A;  1PYV A;  2E60 A;  1NTC A;  2QSG X;  1UCR A;  2ETH A;  2VI6 A;  4CUG A;  2H8W A;  3S1Q J;  2ZNZ A;  1OYW A;  2GA2 A;  3G1L A;  5E8I A;  1KA8 A;  2NVY J;  3RQI A;  1FJL A;  1GHC A;  2W1O A;  4Y3O A;  1JJ8 C;  2FU4 A;  1VQN I;  2KLO A;  2DOA A;  1BIA A;  3LSG A;  1FBS A;  3FMS A;  4BDY A;  4I01 A;  4H4K C;  2ZJ2 A;  1ENH A;  2IS4 A;  5DD8 A;  2AQE A;  3FKI J;  5L3C A;  2CV0 A;  1SD4 A;  2W48 A;  4V2G A;  2CQK A;  3L2W A;  2EFN A;  2EFQ A;  4FIS A;  5J47 A;  4H0E A;  2R7D A;  5JHF A;  4M3D A;  2L3D A;  4ABZ A;  4XKW A;  2M7A A;  2HR3 A;  4HLX A;  5E3L A;  3TDU C;  2YU3 A;  2DCE A;  3V8L A;  3QAH A;  1R7J A;  3FXJ A;  2P5V A;  1O3R A;  4AUX A;  2HQA A;  2CSO A;  3JR9 A;  2DPU A;  4RB2 C;  3KEY A;  4L5I A;  1JUS A;  1H8A C;  2ZO4 A;  4AIH A;  2LD5 A;  1RUO A;  1VI0 A;  2ZB9 A;  5E17 F;  3E6D A;  5DDG A;  5GPC A;  2E35 A;  1T98 A;  1BN5 A;  1IRF A;  3AG4 H;  2OTL I;  4OAY A;  2LY9 A;  5F1J A;  4HNV A;  4DZP A;  2LY2 A;  3BG6 A;  4JX5 A;  4X0G A;  3MEX A;  4I0B A;  1T0F C;  5LHH A;  5FLX Z;  2Q2E B;  4QSH A;  1SMY F;  4KMU X;  2FXA A;  4MQ9 F;  1IGN A;  3TW7 A;  2MC4 A;  2IVM A;  2CW8 A;  4BUP A;  2EIN H;  2R93 J;  1EJ9 A;  2DXI A;  2DA6 A;  3LA3 A;  1MJ9 A;  1V55 H;  3F0C A;  3R0J A;  2DFF A;  3GX4 X;  3ZMD A;  1YG2 A;  2HOA A;  3KP3 A;  3R6S A;  1A36 A;  3D0S A;  3OV8 A;  3DQV C;  1TWF J;  3ZQC A;  2ZJP F;  5JVG F;  4D0P A;  1ZAO A;  2QLZ A;  2P6T A;  5FKN A;  3MWM A;  3CCY A;  2BZT A;  1B6A A;  3V8J A;  1LE8 B;  5KNL A;  2YX4 A;  1JGS A;  1HDP A;  2WBM A;  4A3G J;  3V8K A;  3LAJ A;  4CGZ A;  2QSF X;  4QTR A;  1U6G A;  1MBE A;  1J0R A;  2R7R A;  1KON A;  1HW2 A;  4Z6Y A;  5L3G A;  1ETQ A;  2EV5 A;  1BW6 A;  4UUT A;  5DD4 A;  1ZK8 A;  5LRS A;  3OL3 A;  2P0W A;  3ZMZ A;  1BC7 C;  2JUG A;  2LBF B;  2RC4 A;  3FMR A;  2EZI A;  3G1M A;  1K78 B;  4E4H A;  3FK7 A;  2PX9 A;  3QOP A;  3S32 A;  5TGT A;  3N4M A;  4G6D A;  4L9N A;  1B9M A;  4KIS A;  2ZKZ A;  4G7H F;  3SZP A;  1D5Y A;  2V6C A;  2IBD A;  1TLH B;  3FBN B;  3TOA A;  3GFL A;  3PNT A;  1K4S A;  4OIO F;  1QHG A;  1Z9C A;  3JTG A;  1TQI A;  3IC7 A;  2HPI A;  3ZQG A;  4KIT B;  1XB4 A;  1V4R A;  2EK5 A;  4RB1 A;  2ZME B;  3WHC A;  1N75 A;  4M3F A;  4I7H A;  3T1B A;  1V54 H;  1AKH B;  5KVR A;  3K9T A;  2EPF A;  5JR3 A;  2XGD A;  3WU0 A;  2TDX A;  3L2V A;  4UB8 C;  1IN5 A;  2WAF A;  3J7A Y;  1T6S A;  3BR6 A;  2HDD A;  2MAB A;  3EYY A;  3H5N A;  4C30 A;  4BAC A;  4ENN A;  3ABK H;  2GIV A;  3WTX C;  3ZQH A;  2M1B A;  2M3A A;  4LK1 F;  1KU3 A;  3ZQI A;  2XAF A;  3JRB A;  4FX0 A;  3E5U A;  5ICC A;  3S3M A;  2VOD A;  4RLF A;  2WTE A;  3IRQ A;  2A6H F;  4BXU A;  3CC4 I;  3LSP A;  1IXR C;  3L09 A;  2HTJ A;  4CO8 A;  3B6C A;  4IQJ A;  3PO2 J;  4IHT A;  4M6Y A;  3WE2 A;  3OS1 A;  1MNM C;  3O6B B;  5EGO B;  3CQZ J;  4U88 A;  3TO9 A;  2O7O A;  3KP4 A;  2RVC A;  1SFX A;  2JRM A;  4KJZ A;  1A31 A;  4DGW B;  2RQQ A;  1G3W A;  2DA2 A;  2QF7 A;  4JBA A;  1RZ4 A;  2F5V A;  2E19 A;  4BHC A;  2W4S A;  1P4W A;  4L9V A;  1S5L C;  2HFH A;  2V1X A;  2W7N A;  1T2K A;  3LSM A;  5F1R A;  2QZ8 A;  3MAJ A;  3PL8 A;  3KLO A;  4WF2 A;  4JX6 A;  1SVM A;  3L7W A;  2A5Y B;  3FKJ A;  3ASO H;  3L1P A;  4QLC U;  4Q4Z F;  5E79 C;  2EFW A;  2VQG A;  3RCO A;  3W3C A;  3CP2 A;  4KUM A;  5HNF A;  5M3M J;  2FOW A;  2MH2 A;  3FBI B;  4NHJ A;  1O57 A;  4X6A J;  2VN2 A;  4KIB A;  4NC8 A;  3SFZ A;  2K27 A;  2HEO A;  1FBQ A;  2I10 A;  5IT3 A;  3CJN A;  1SEU A;  4ZYA A;  2DT7 B;  2DA7 A;  4HF2 A;  2K9S A;  2K3P A;  2XGX A;  1X2N A;  3CMM A;  3OYE A;  1EF4 A;  3NRV A;  3I53 A;  1YW9 A;  3JRA A;  4V19 K;  4CCK A;  2XAQ A;  3DPT A;  5DYM A;  1R49 A;  4DOZ A;  1MH3 A;  3PNY A;  1NH3 A;  2G7U A;  3ZCO A;  1CF7 B;  4KT6 A;  2LOO A;  5IYC J;  1POG A;  3F6V A;  3E0J B;  4ZYG A;  3HRT A;  4YIR X;  3HOY J;  2VBX A;  3GTP J;  1R5G A;  1HKT A;  3OYF A;  3REO A;  3F6O A;  1JTY A;  2XUB A;  2CMP A;  1K4T A;  3BTI A;  1WJE A;  5DUK A;  4ZDP A;  2R3S A;  3BRO A;  3CUQ A;  1XGO A;  1IO2 A;  1F36 A;  2E1M B;  5CLS A;  3IKV A;  3AL0 C;  3OOP A;  3R60 A;  3CCV I;  3QOE A;  3DTI A;  4ZDO A;  2IW5 A;  3JRD A;  2HQ5 A;  2EZH A;  2XF5 A;  3ZN1 A;  5DCF A;  1G2H A;  1ZHF A;  2PI0 A;  3KE2 A;  5B1B H;  3F8N A;  1XC5 A;  4L9J A;  1JTX A;  5ERI A;  1IAW A;  1B1B A;  4BHB A;  3G6E I;  2ZBK A;  4XON A;  3TMO A;  2R5Z A;  4HNU A;  2AHQ A;  1IG7 A;  2UXN A;  3GVA A;  1R6R A;  3S1N J;  2JN6 A;  3K69 A;  4HA8 A;  3LFU A;  1GVJ A;  1SAU A;  1PP7 U;  1MD0 A;  1RPW A;  4EJO A;  5TRD A;  1I3Q J;  1MND A;  2E2J J;  1FOK A;  2UWM A;  3NAR A;  3O2P E;  5M3F J;  4IF4 A;  2KRH A;  2X1C A;  3BQZ A;  2DK8 A;  1MBG A;  5E8G A;  4F52 A;  1D0X A;  2V7F A;  3ONQ A;  4AID A;  4ZTF A;  2L01 A;  3HRS A;  3J7Y J;  1OLT A;  4U0V A;  2MGQ A;  2ZFU A;  2D5V A;  2XAS A;  2M0C A;  1C0W A;  2A07 F;  3ZMU A;  1T08 B;  5IT9 K;  2X85 A;  3L9F A;  4CZC A;  5HOO A;  3F8C A;  2K85 A;  4E6K G;  2VJJ A;  3BR3 A;  1S8N A;  1UG0 A;  2BGC A;  5FD5 A;  5E3O A;  3ZOB A;  3B6A A;  2E5N A;  2AQF A;  3KX2 A;  3HOT A;  3PUF A;  5D4R A;  4K2E A;  1FIP A;  4UNO A;  3CDL A;  2ESN A;  4PSW A;  1QVT A;  1ETV A;  2VOO A;  1WPK A;  2ZXI A;  1YE9 A;  2NS0 A;  2QQA A;  4U0Y A;  3C3W A;  2G7H A;  1Z6T A;  5D5U B;  4HRI A;  2AS5 F;  3F8M A;  3I71 A;  3OMY A;  2M30 A;  3C2H A;  2QQ9 A;  1GUU A;  3IKT A;  3VYS B;  1OCP A;  2OCC H;  4LLL A;  1MBF A;  2X4H A;  4YIF A;  3K4N A;  2HTS A;  3K1P A;  2PJR A;  9ANT A;  3O3K A;  3QQA A;  1GVD A;  2HGC A;  1TC3 C;  3VFZ A;  2R7T A;  4CCM A;  2BE5 F;  2AXL A;  1VND A;  1H0M A;  2A68 F;  3KYD B;  2QA4 I;  2L4A A;  1W7P B;  1X4O A;  1E17 A;  4HOB A;  2XPU A;  5LRR A;  3HL2 A;  1Q1H A;  3P9I A;  2QQ8 A;  1I5Z A;  2XV4 S;  1NG7 A;  1S3J A;  1FYM A;  4XR6 A;  5CVJ A;  2W82 A;  5DCM B;  4ESF A;  1WKM A;  3CUQ C;  5ICG A;  2NAZ A;  3CDH A;  5A2Q Z;  3IWF A;  4FCY A;  1X19 A;  3CLQ A;  4LMY A;  2QWW A;  2LNB A;  2DOD A;  5B3S H;  3I4N J;  4XSZ F;  2HVR A;  3J81 K;  5CYV A;  5F04 A;  2X6O A;  3L00 A;  3KYC B;  3D5R C;  1IJW C;  3TGN A;  4JX4 A;  3GZ5 A;  1Z05 A;  3ABL H;  2A69 F;  4ZC3 A;  2Q8K A;  3ZQQ A;  3J81 Z;  1ULY A;  2GA1 A;  4E7I A;  1REP C;  2NS8 A;  2ZME A;  1O3S A;  2L5Q A;  4RDU A;  2GQQ A;  1U5T A; 
#chains in the Genus database with same CATH homology
 4B4C A;  2JA6 J;  4DYC A;  1U8B A;  4CYC A;  4MFD A;  2VKE A;  3HBL A;  2JA7 J;  2R5Z B;  4W97 A;  5FLV A;  2COB A;  2X48 A;  2DMU A;  1O4X A;  5J1R A;  1B8I A;  3GTQ J;  2KT0 A;  5EZH A;  1WH5 A;  3O8H A;  1SFO J;  2XGE A;  2P81 A;  2E1O A;  4UUS A;  1U9N A;  5F08 A;  2DA3 A;  1VFC A;  4AC0 A;  4IHV A;  2LVS A;  2CU7 A;  2TCT A;  3K7A J;  2YU9 J;  1ETK A;  3RZO J;  4JP0 A;  2EQR A;  2R5Y A;  1RR7 A;  1X58 A;  3BG5 A;  4D5C A;  2FQ4 A;  2XPW A;  3BT9 A;  5GP9 A;  3K2A A;  3TP3 A;  5F0H A;  4IHX A;  3JRF A;  4A3E J;  3C2B A;  2CQQ A;  1LE8 A;  3I4M J;  1UHS A;  1NTC A;  1FTZ A;  2VI6 A;  2HI3 A;  3MVP A;  3JRE A;  1SAN A;  3S1Q J;  5BNG A;  5FKM A;  3G1L A;  2NVY J;  3RQI A;  4MLO A;  2TRT A;  4EEF G;  1FJL A;  5EYR A;  1LFB A;  5IP9 J;  1JJ8 C;  4D7M A;  4M3G A;  1RES A;  2EBI A;  3LSG A;  4A3C J;  2M8G X;  3D1N I;  4M3B A;  3GTG J;  2DMT A;  1ENH A;  4A3L J;  4UUS B;  3IH2 A;  2RAE A;  2GBY A;  1I6H J;  3FKI J;  2G0E A;  1TWC J;  3O8G A;  1JUM A;  5IP7 J;  3TW6 A;  2W48 A;  4V2G A;  1AHD P;  2JK3 A;  1ZTR A;  2CUE A;  4FIS A;  5F0C A;  4M3D A;  4MO7 A;  4D5F A;  2XB5 A;  2GLO A;  4ABZ A;  5E3L A;  3GBG A;  3OSG A;  4LOC A;  1AU7 A;  2L7M P;  3WHB A;  5EG0 B;  1DU0 A;  4AUX A;  3JR9 A;  3S16 J;  1JUS A;  1H8A C;  2M2E A;  2LD5 A;  4A69 C;  1VI0 A;  2ZB9 A;  5GPC A;  4M3E A;  1MBH A;  5IYD J;  1S7E A;  1T33 A;  2LY9 A;  5F1J A;  5IOZ A;  1TWH J;  4HNV A;  5K7Z A;  4DZP A;  3BTC A;  4JX5 A;  5EDN A;  1HOM A;  3PM1 A;  5FKO A;  2MG4 A;  3LSJ A;  4QSH A;  1U9O A;  1IGN A;  3TW7 A;  3ZQF A;  1ITY A;  2HXO A;  2LK2 A;  2R93 J;  2HOS A;  1IV6 A;  2IEK A;  1HDD C;  1ZGW A;  5EG0 A;  2DA6 A;  1ETO A;  2XPV A;  1F43 A;  5IP6 A;  3F0C A;  2XRL A;  3GTK J;  1APL C;  2HOA A;  3W6V A;  3HOX J;  2E2H J;  3HM5 A;  3HB9 A;  4V2F A;  3CMY A;  5EF6 A;  3SJM A;  2H8R A;  1TWF J;  1GV5 A;  3ZQC A;  5K7F A;  3HGY A;  2WV1 A;  4BKX A;  1R9T J;  2WAQ N;  5FKN A;  3CCY A;  1LE8 B;  2VUM J;  1ORK A;  1RET A;  1ETW A;  1HDP A;  2L0K A;  4A3G J;  5F0F A;  1ETY A;  1VF9 A;  4QTR A;  4X1E A;  1MBE A;  4C3H J;  4NDL A;  2YUS A;  4IEJ A;  1ETQ A;  1BW6 A;  4UUT A;  1JT0 A;  1ZK8 A;  2DTZ A;  3NAU A;  3PO3 J;  2ECB A;  2HYJ A;  2MSY A;  1B72 A;  4BXX J;  3HOZ J;  1P7I A;  4A3B J;  3LOC A;  4BY1 J;  2OF7 A;  2VPR A;  4Y7N J;  2EZI A;  3G1M A;  2NS7 A;  3FK7 A;  1OFC X;  1WI3 A;  5FKK A;  3OSF A;  4DYQ A;  3DCF A;  1D5Y A;  5C4J J;  1CQT A;  2IBD A;  2JWT A;  4BY7 J;  2NVX J;  4C2M J;  1TWG J;  5IPA A;  3IH4 A;  5DTD A;  2XSD C;  1WCM J;  2AO9 A;  3ZQG A;  4J19 A;  3WHC A;  4M3F A;  2CQX A;  3SFI A;  1AKH B;  1X2M A;  3Q3S A;  2NOG A;  2HXI A;  1B72 B;  2XGD A;  2OPT A;  2DMP A;  5M5X J;  3BR6 A;  2HDD A;  5F27 A;  4XK4 A;  3LNQ A;  3HEF A;  2KDZ A;  3ZQH A;  1HLV A;  3QPL A;  3ZQI A;  1JJ6 C;  1A5J A;  1JT6 A;  4QIW N;  1Z77 A;  5J1U A;  3JRB A;  4M6V A;  1MH4 A;  1W0U A;  1K83 J;  4B3A A;  3LSP A;  2DMQ A;  3B6C A;  2MW8 A;  3PO2 J;  2E2I J;  1MNM C;  5C4X J;  5EGO B;  3CQZ J;  3Q0V A;  1ZR4 A;  1JKQ C;  5FKL A;  3VPR A;  2O7O A;  4I6Z A;  4XRS A;  1MBK A;  1AKH A;  4A3I J;  2M9H A;  3GTO J;  1GV2 A;  4XID A;  2DA2 A;  2QF7 A;  2FX0 A;  4FE4 A;  1BW5 A;  2E19 A;  2WB1 N;  3TED A;  4B1R A;  4A3F J;  1MSE C;  1A6I A;  4JX6 A;  5IOY A;  1K61 A;  2JA8 J;  5FJ8 J;  4A3J J;  1GDT A;  3S2D J;  3L1P A;  2O9L A;  2R7Z J;  4XRM A;  2EZK A;  5J3L A;  3H0G J;  5M3M J;  2NVQ J;  4X6A J;  3JRI A;  3HOV J;  3HDD A;  2DN0 A;  4MFE A;  4IHW A;  1OJL A;  2I10 A;  2VKV A;  1BL0 A;  3HOU J;  1BA5 A;  1HF0 A;  2Y9Y A;  1IC8 A;  3FK6 A;  1W0T A;  2DA7 A;  1PUF B;  4AYB N;  2K9S A;  2X9D A;  1X2N A;  4A3D J;  1P7J A;  3LSR A;  1NK3 P;  1EF4 A;  1B8I B;  4D7N A;  2QCO A;  3BG9 A;  1BJZ A;  3JRA A;  3FIW A;  1ZQ3 P;  1XG1 A;  1MSF C;  2FD5 A;  4L5E A;  2Y0S N;  1MH3 A;  1JKR C;  3IV5 A;  1UG2 A;  3QPS A;  4I76 A;  2L7Z A;  5IYC J;  1POG A;  1TWA J;  2YS9 A;  3A03 A;  2NVT J;  3HGG A;  3HOY J;  3GTP J;  2R5Y B;  4W1U A;  2EH3 A;  1H89 C;  1JTY A;  3MN2 A;  1OCT C;  3BTI A;  1YRN A;  2R0Q C;  3UKG A;  2ID3 A;  5M5Y J;  2LFB A;  1WH7 A;  2XGC A;  1F36 A;  3OIO A;  1PUF A;  2LP0 A;  4C3J J;  3JRD A;  2HQ5 A;  2DA5 A;  2CUF A;  2EZH A;  3M4O J;  5K7H A;  4C3I J;  3A02 A;  1G2H A;  1IDY A;  1FIA A;  5C3E J;  1XC5 A;  3S14 J;  1JTX A;  2ELK A;  2JMW A;  2R5Z A;  5GPA A;  4CYC B;  2AHQ A;  1IG7 A;  4FE7 A;  1MBJ A;  2O8K A;  3H3V K;  3S17 J;  3S1N J;  2JN6 A;  4Y52 J;  2DMN A;  4G12 A;  4XRS G;  4BBS J;  1RPW A;  2DA4 A;  2JJ7 A;  1JGG A;  1YRN B;  1I3Q J;  3Q0W A;  2E2J J;  4JYK A;  3NAR A;  5JLW A;  2DA1 A;  5M3F J;  2LTP A;  1ETX A;  3BQZ A;  1MBG A;  2K9N A;  4DYR A;  5EGO A;  1NK2 P;  2ME0 A;  4S0H B;  1U78 A;  2FJ1 A;  2H1K A;  2MGQ A;  2R92 J;  5DS9 A;  2D5V A;  1JKP C;  3S1M J;  2M0C A;  4A3M J;  3S1R J;  2DJN A;  3BTJ A;  3MKL A;  1RKW A;  3BR3 A;  3Q0U A;  3OOU A;  5E3O A;  3JRH A;  3ZOB A;  3B6A A;  3HKZ N;  1T56 A;  5FLM J;  1GT0 C;  2HOT A;  4FTH A;  1FIP A;  1Z0X A;  3CDL A;  5HOD A;  1QVT A;  1ETV A;  2B63 J;  1WPK A;  2M34 A;  2IAI A;  2Y9Z A;  4DZJ A;  3SDG A;  1QRY A;  2LR8 A;  5EZG A;  1E3O C;  5M5W J;  2Y2Z A;  2GM4 A;  4BBR J;  5EEA A;  1GUU A;  1JUP A;  1RKT A;  2Y31 A;  5C44 J;  1OCP A;  4DW6 A;  1MBF A;  4RBO A;  2ME6 A;  1QVU A;  3JRC A;  2N8G A;  1QPI A;  1Y1W J;  2L9R A;  9ANT A;  3QQA A;  4A3K J;  1GVD A;  2Y30 A;  1FEX A;  1TC3 C;  1WGX A;  1H88 C;  1JKO C;  2ECC A;  1UMQ A;  2L7F P;  3GTM J;  1VND A;  3JRG A;  3A01 A;  2LLK A;  1IUF A;  2LKX A;  1ZR2 A;  5JLX A;  2XPU A;  4GFB A;  2ID6 A;  2PMZ N;  3E7L A;  5IYB J;  3HOW J;  3BR5 A;  1DU6 A;  1XS9 A;  3BG3 A;  3S15 J;  1ZKG A;  1Q1V A;  2CJJ A;  2CRG A;  5E3M A;  4FCY A;  3TP0 A;  4XIC A;  3RZD J;  1IRZ A;  2JA5 J;  3ZQL A;  3I4N J;  2K40 A;  3GTJ J;  3BR0 A;  2EZL A;  3BTL A;  3S2H J;  5F04 A;  4IHY A;  2X6O A;  1I50 J;  1Y1V J;  1IJW C;  3IH3 A;  4JX4 A;  2XB0 X;  3G1O A;  1IDZ A;  4MIM A;  3BR2 A;  4A93 J;  3BR1 A;  3A01 B;  1FTT A;  3FIS A;  3RKQ A;  1LFU P;  3GTL J;  3DEW A;  2NS8 A;  2K9Q A;  3M3Y J;  1HCR A;  5J1Y A;  5E3N A;  4RDU A;  3BQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...