3H9JA

Crystal structure of e. coli mccb + ampcpp + semet mcca
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
348
structure length
339
Chain Sequence
MDYILGRYVKIARYGSGGLVGGGGKEQYVENLVLWENIIKTAYCFITPSSYTAALETANIPEKDFSNCFRFLKENFFIIPGEYNNSTENNRYSRNFLHYQSYGANPVLVQDKLKNAKVVILGCGGIGNHVSVILATSGIGEIILIDNDQIENTNLTRQVLFSEDDVGKNKTEVIKRELLKRNSEISVSEIALNINDYTDLHKVPEADIWVVSADHPFNLINWVNKYCVRANQPYINAGYVNDIAVFGPLYVPGKTGCYECQKKENIDHKIKLINSRFKPATFAPVNNVAAALCAADVIKFIGKYSEPLSLNKRIGIWSDEIKIHSQNMGRSPVCSVCGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How the MccB bacterial ancestor of ubiquitin E1 initiates biosynthesis of the microcin C7 antibiotic.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/antibiotic
molecule keywords MccB protein
total genus 107
structure length 339
sequence length 348
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1160 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3h9jA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3h9jA02
4Q3DA 1DDOA 1PGNA 2Z1NA 4UVHA 4ZD6A 2JCVA 3FWZA 3O26A 5F5NA 3VZPA 2QYSA 4E2WA 4BS9A 3B20A 4XJTA 3ZU5A 3BYZA 2X7HA 3RUFA 1EVZA 1XDWA 2DT5A 1YS4A 4YT5A 4Q3AA 5A06A 3NT5A 5C7IO 2OMEA 4YYZA 4NU6A 4W7HA 3S2EA 1R4MA 3HB4X 3L07A 2O3JA 4MINA 5G0TA 2OO5A 1ENYA 2FHSA 5DBIA 5A3JA 1DIGA 1OMOA 2VT3A 1SAYA 4PLHA 1KBZA 4GX2A 2IZZA 4OL9A 3ZW8A 3D64A 1SO8A 4CLHA 2VYVD 4RVUA 1T2FA 3GGPA 3GA0A 3LT2A 1ZEMA 3MJEA 4UREA 4IGEA 4Z9XA 3ZV6A 4B7XA 4EDFA 3G0OA 3G1UA 3EDMA 2ZCVA 1EVJA 1NFRA 5A03A 4BGUA 1AXEA 3KEOA 1A9ZA 3OQBA 2I76A 4KQXA 1UXKA 1LLUA 3WB9A 2VQ3A 1Q7BA 2DFDA 2W98A 1TB4A 3DQPA 4PLVA 3KLPX 5I7SA 4PLCA 1E7YA 2EW8A 2VHYA 3AM5A 2RCYA 1FF9A 2JD2A 4XWYA 1LSSA 2J5KA 2DAPA 3NYWA 3JQFC 3EK2A 3LC7O 5DDIP 4A27A 1KY5A 4IDEA 3ZN2A 4GH5A 2E48A 1WZEA 1ONNA 5EQFA 1LSOA 4AJLA 4AJ4A 1IPEA 3ZNPA 4UUNA 2J3JA 3PWKA 4KUEA 2I66A 1ZNQO 3DZKA 4RPHA 4CQMA 1B8VA 1GD1O 3S8MA 2PV7A 2FPPA 4E6PA 3IUSA 3JYQA 3HN7A 1CIVA 1EFLA 1X7HA 4LMRA 2Y1DA 1X7GA 1ZJZA 3KSDO 4YAEA 3RC7A 2WWRA 2VNAA 5B1YA 4L73A 3DO5A 1VSVA 1RM5A 2GN9A 1IUKA 3JQGB 1TEHA 1JVBA 5L45A 3HNPA 5KIAA 5KKCA 4I08A 3TZKA 3DZFA 2DBZA 2AXQA 4FPXA 4YJGB 4I9UA 2WD8A 1VM6A 1QYCA 3ZWWA 3WGHA 4HNGA 5I7VA 3SX2A 1FDUA 4I5FA 1H9AA 3WGIA 3ITDA 4WOJA 2ZJ1A 3W4KA 4W6ZA 4E32A 5JCJA 1NHGA 2E6UX 3JYLA 1Z74A 5H83A 1M2WA 1LI4A 4EJ0A 1V3TA 4DVJA 3EGOA 4Y6RA 2JFHA 3HN2A 3ZGYA 2A92A 1I2BA 4XDZA 2P68A 5AOVA 4EEXA 4BV9A 3KXDA 4Q3EA 4QT0A 5T8KA 4EUFA 1ADCA 1XQ6A 3KV3O 4CLEA 2GPTA 5FI5A 4UUPA 5C37A 5TJ9A 5U4QA 4C7KA 1OI7A 3AI2A 2C59A 3UCEA 3VVCA 3SEFA 1NR1A 3DTTA 5THKA 3IKVA 2B83A 3DL2A 4IQ8A 7ADHA 1EVYA 3ENKA 3X2FA 2AQHA 4W4TA 3ROQA 5CEJA 4F3YA 1NM5A 3E48A 3ICCA 4J49A 3VH2A 1PIWA 3TF5A 5B4UA 3L77A 2HMVA 2P9CA 3E1KA 3E8XA 3UGKA 1WDLA 3JTMA 2J8ZA 1L7EA 4Q9NA 1WMAA 2DUWA 1UXHA 3KVOA 4XR9A 3GEGA 4GWKA 1PQPA 1Y8RB 2GLXA 4IJUA 2CF5A 2OL4A 3CIFA 3VTZA 1LDEA 4U6SA 1GYPA 4NFYA 1N1GA 3KTDA 5KJ1A 3R0IA 3BXXA 1GUZA 1VLLA 4YT4A 4JCOA 1RJWA 1PGPA 4PLPA 3ZU2A 2H6EA 3JQAA 1DOHA 4BHTA 4XQCA 1EZ4A 2DTDA 4A03A 4ALJA 2VYVA 2XOXA 3WXBA 4PZDA 2Y93A 1DJNA 1T1RA 4R9SA 1UH5A 1QMGA 4KTTE 4ZQHA 1ADFA 2XPCA 3KYCB 5CFZA 1RM4A 3PHHA 4BNMA 3AK4A 3DOOA 2NTVA 1I24A 3I1JA 4Z3DA 1DIAA 1PX0A 3JYPA 4ZRMA 5C7LO 4BO3A 4D0SA 3UVEA 1ZZEA 5DNAA 2O4UX 1YDWA 3WLFA 5EL0A 3Q2IA 1D4FA 3DAGA 4WLFA 1O95A 3JD4A 4IINA 4BB6A 1VKOA 4CM8A 2PZJA 4EBFA 2O23A 2GR9A 3E6AA 3KYDA 4OAQA 4Q39A 4YEDA 4HY3A 2P4QA 3CPSA 3FNHA 4IZIA 4CUKA 1Z75A 5JNLA 2EP7A 2Q1TA 1HLDA 2F1KA 1U1IA 5COQA 4FSHA 2VTEA 2WTBA 4TQGA 3HDHA 3VPSA 3WGOA 4U7WA 1HDYA 5GY7A 5JS6A 3DBLA 1V3UA 2HU2A 1SZJG 1U7TA 3UOGA 3FNFA 3NTRA 5DP2A 3QIVA 4YRBA 1EUZA 4E2ZA 1AE1A 4RPLA 1QP8A 3ZNNA 4QO7A 3E03A 3V5NA 3MZ0A 3V1YA 1PJ2A 1IB6A 2NU9A 2XF8A 5DN9A 4NDNE 3LZ6A 1DFIA 3DMTC 4MVJM 2QZ9A 2ILTA 3A14A 3Q11A 3F47A 3ZDFA 3GF4A 4GBJA 1Y81A 1X1TA 4ALKA 2QRJA 4MVJH 1N9GA 2G0TA 3O38A 5KKAA 1N1EA 3GHYA 3M2TA 3GEMA 3GN2A 2X86A 4J9UE 1PR3A 3WS7A 2YV3A 2HJRA 1WAMA 3ENNA 3PHJA 1K3TA 1D7OA 4FC6A 4J0FA 5I7FA 1O9BA 4O1MA 3LF2A 1PL6A 5JC8A 5JCXA 5BNTA 1QRRA 1LSUA 1S6YA 4KMSA 1VL8A 2Q2QA 5ES3A 3RUAA 4L4SA 2RH8A 2AQKA 1ENOA 4XZ3A 3QWFA 1DHTA 3WLEA 4DYDA 5KJFA 2AE2A 1T24A 2OBYA 1ZH8A 1ZXLA 4URFA 1TT5B 1FMCA 2ZK7A 3FBTA 3L6OO 3WGQA 3GC6A 2C7GA 1SMKA 5C3MA 4O0LA 1M6WA 2CFCA 3PJFA 3WQQA 1DBVO 1JWBB 4RPGA 4J16A 4LSWA 5FYDA 3QV1A 4YJDA 1JKIA 1WPQA 5A3VA 1PGJA 1QSGA 4WK6A 1GV0A 5JDCA 1AXGA 2AEFA 4FIZA 1H6AA 1DEHA 2OGUA 3OECA 4WECA 5DF1A 2HK8A 5TNXA 4ZQBA 3RUCA 4AJEA 4DTIA 1O94A 1ISJA 2YV1A 4KDEA 5FF9A 5ER6A 4NBUA 1PU2A 1EDOA 2BFAA 3NT2A 4N7RA 5HA5A 5IZ4A 3MCVA 4Y8VA 4XDYA 2OBNA 1NYTA 2WSBA 1PJLA 3EYWA 3DB2A 3WNVA 4R5MA 3VPXA 3PYLA 3ASVA 3TNLA 3W8DA 1QORA 3F9IA 1MXHA 3H65A 2AQIA 4UUOA 1T2EA 1PJCA 4ND1A 3BA1A 2YFQA 3PEFA 4ND2A 3TZCA 2AEJA 1ZSNA 2B4QA 4FW8A 1E7WA 3JQ7A 4UVIA 1E5LA 4GVXA 1XSEA 4BO9A 5L53A 2JFFA 4JGBA 5HWSA 1MP0A 1TVEA 1I36A 4BB5A 1UAGA 2A94A 2B37A 1LLQA 4NFSA 4DPMA 1UP7A 1W4ZA 4LISA 3WMWA 2CZCA 5GMOA 3FBGA 5B4VA 1HF3A 3E5RA 3BHIA 1H94A 1B14A 1XG5A 3KO8A 1Q0LA 5U1PA 3O03A 1O5IA 4XKJA 5CPBA 5EQDA 1UP4A 2YQ5A 4IXWA 4M49A 5KVSA 1DFHA 2J6IA 2B5VA 1QG6A 3FPLA 1GEEA 1VE9A 5EJ2A 2BRUA 3I23A 2QQ5A 4BNKA 3NT4A 4NIMA 3WJAA 3I9OA 4PLFA 1YB4A 3LDHA 2HLPA 1N7HA 3DZGA 3ICPA 3L9WA 1ISGA 3QVOA 1YQXA 5KVVA 2Z95A 3L6EA 1E92A 3AUSA 8LDHA 4R51A 3ADOA 2GCGA 4DRYA 4M89A 4WLNA 2NVBA 2WE7A 2GUGA 3TZHA 3AFMA 4DC0A 1WWKA 3BMCA 3LC1O 1MV8A 1R4MB 3TZQA 3LK7A 2B0JA 2PGJA 1HDZA 1TI7A 4CM3A 1HYHA 4ZRNA 5KOIA 2H5LA 2WM3A 4J7CA 4XYGA 1W0CA 4D79A 3S2GA 2J3IA 2X23A 2GRAA 4C4OA 1JLLA 2F00A 3WFIA 3K92A 2BD0A 3ETEA 1DXYA 3Q1LA 4A0SA 1PZHA 3O8QA 3GDGA 3I9LA 1GPJA 1HZZA 3JQFA 3Q2KA 4IJKA 4UVEA 5TF4A 4E33A 4N54A 1ENZA 5DZSA 2IODA 3VAZA 1R12A 4J1QA 4MJLA 4LN1A 4PLTA 5JXWA 1PJ4A 5TRTA 2YFHA 2ZYAA 1NASA 5C7OO 3ZWBA 1U28A 3JD0A 2J3KA 2X0NA 2Y0EA 3FF4A 4II3A 3WGTA 3WIDA 3GMSA 1HE2A 3Q3CA 1NX6A 3FHLA 1L7DA 1RPNA 4P22A 2FR8A 1F0YA 2VCYA 2FPGA 1K2WA 1EBUA 2NM0A 2PGDA 3E9NA 5K0ZA 2Q2VA 3OQ6A 2Z1MA 3P5SA 1E1MA 1P77A 1U3UA 2Y1GA 3H3FA 3ETDA 1P1JA 2FSVA 2GNAA 3BTOA 4TKLA 3IMFA 1UDAA 4GPD1 4MP8A 3VZSA 3DBRB 4J6FA 4LRTB 1YVEI 3F6YA 4PFJA 4JJIA 4BUCA 5KWEA 3GQVA 5IDQA 2Q1SA 4MVJF 1GUFA 1YDEA 2Y0DA 3WYCA 5AQ1A 1KEUA 2CD9A 4QFDA 4D3FA 5ICSA 1A4IA 3GK3A 1I0ZA 3CH6A 1R16A 2EERA 2IE0A 2D0IA 1U2DA 4CMCA 1YB5A 1NPDA 4HFNA 5IZCC 2ZTMA 4YR9A 4IIVA 4YBZA 4E12A 1T2CA 4CM5A 3ON5A 3QP9A 4GVLA 5MGBA 4W9NC 4UVGA 5HBRA 3OJ0A 1S7CA 4IQ0A 4WLEA 4GI2A 4H15A 5JAMA 3ZHZA 1BXKA 3W8EA 4B3HA 3EC7A 3UFXA 2HQ1A 2C20A 5DT9A 3ZWXA 3T4EA 2EF1A 3OP4A 3VDQA 2VHZA 3C8MA 3CMMA 1IOLA 1ENPA 4DQVA 1XU9A 3RBZA 1AHIA 1DFGA 5TIIA 4NNJA 4JROA 3O8QB 2EWMA 1A9YA 2VHWA 5TLSA 4RVSA 4WUVA 3RU9A 3PJDA 3K96A 1BDBA 4Y6SA 3EUWA 1PJ3A 4FB5A 2Q45A 4YRDA 4YTEA 4CM1A 4DMLA 1X13A 3G79A 3JQ9A 1I30A 1YJ8A 4JBHA 3DOCA 3FN4A 3KHUA 3ZV3A 3RROA 3D7LA 2IEDA 3SJ7A 4XRGA 4UEKA 1CWUA 1YBAA 1U4SA 4FJ0A 4J43A 4DLBA 3IKTA 3PTZA 4BGEA 1YGYA 2P91A 1H0KA 1X0XA 3WGYA 1N7GA 5JC1A 3ANMA 4I5GA 1X15A 4KQWA 3WNQA 4MVJP 5EERA 2NVUB 4CPDA 3WIEA 4XB1A 4L8VA 1JVSA 4DGSA 1DC3A 5IFLA 3KUXA 1E3WA 4AJPA 3OIGA 3RUIA 4D44A 1Y8QB 3RBXA 3I4FA 4M8SA 4G81A 4YT8A 4AJJA 3PZRA 2W2LA 2IDZA 2FR0A 1OC4A 1LUAA 1FDSA 1U5CA 2E49A 3R3JA 2VWPA 3INGA 1AN9A 5G0WA 2DBVO 1K6XA 1PL8A 1YBMA 4QECA 4KUGA 2V6GA 2VUSA 4B8ZA 3PJGA 2X5JO 4KP7A 1Y5MA 1ARZA 3QVTA 2QRLA 3WGZA 2Q2WA 3D4OA 4GMGA 4MVJG 1A71A 1C0PA 1B2LA 1SCUA 5AXCA 2HAEA 4BGIA 4PZEA 1ULSA 1GFSA 3GLQA 2X9VA 3COSA 4TZTA 4YJGA 3RSHA 2AA3A 2FY8A 3ONEA 1N2SA 3LU1A 4UULA 1G1AA 4AJ2A 1UZMA 2TMDA 4KWIA 3IL2A 2O3UA 1A4UA 3HB5X 3WBFA 4PN3A 2UUPA 1W6UA 5COAA 1X1EA 4NBRA 3OA2A 4JXKA 3GZNA 3ZWPA 1JTVA 1BDMA 2BI8A 3ZHXA 4HNHA 1GCOA 5BSGA 5JAIA 1MG0A 3I6QA 1LX6A 4R68A 4RF2A 1LA2A 3GDOA 4NG5A 1YE3A 3NAQA 3C1TA 1X7DA 1U8XX 2Z5LA 1F17A 1KYQA 3K30A 1FXSA 1QLJA 4K28A 1YBVA 4EW6A 3D3EA 4J2OA 2HUNA 3TFOA 4WASA 4PRLA 4HBGA 3BMOA 1GCUA 4GKBA 4B8WA 4DIFA 1LDNA 9LDTA 3KETA 2B35A 2O48X 3FPCA 4NPCA 1T4DA 3CSDA 3GVIA 4DQXA 2POQX 5F1KA 3RC1A 3BHMA 3UKOA 4ND3A 3RAJA 2GN4A 4CMIA 3NDIA 3Q9UA 1LNQA 2GZ3A 4IXTA 3GAZA 4BNFA 3R1IA 1IY8A 3KZVA 5HM8A 1K6JA 3DHYA 1KVUA 4GKVA 4OQYA 2OXIA 1BTOA 3ROPA 2FP4A 3N58A 1W73A 2EXXA 2ZJ0A 4CMGA 1Y8QA 3IAHA 3WTCA 2CDCA 4DPKA 4MOWA 4O63O 2W4QA 3Q0EA 4E5KA 4TZKA 1C3VA 2W2KA 1I3LA 1VC2A 1J5PA 5HS6A 2NU6A 3BMNB 4LSMA 2OZPA 4JIGA 5T67A 4W9NA 5DCYA 4BGVA 2G5CA 4TVBA 2UUOA 2GYYA 4IDCA 2CF6A 1D1TA 4XJSA 5G2OA 5JAQA 3GVXA 2WYUA 4O59O 1HE4A 4RORA 1V3VA 5G4KA 1OAAA 4IMPA 4I9HA 1IZ0A 4B79A 1HSZA 1EFKA 1VPDA 4GX1A 3OF2A 1NBOA 3PQEA 1B3BA 3CINA 3INTA 4PLWA 3VVBA 4TSKA 1UR5A 5H82A 4B3JA 4J91A 5JYDA 3JD3A 1KVRA 2QW8A 4BO5A 3H5AA 4RQTA 4A2CA 3A1NA 3DMYA 2W8ZA 4NJOA 1PWZA 2FN7A 1E77A 2P9GA 4H16A 2E37A 4BMVA 1R0SA 4AL4A 3H3JA 3PPIA 3BMOB 5TT0A 4NBWA 5T57A 4KUHA 3G17A 3F46A 4PRKA 4BO7A 3RFXA 3SJUA 1T1SA 3DMTA 3UXYA 4E5YA 5CDUA 2X0RA 1LRKA 4CL3A 4IGFA 3D4NA 3ZW9A 4WEQA 3ONDA 4R4JA 2JAPA 2VYND 4JN6B 5A9RA 5EINA 1IL0A 4TKMA 4P4LA 2D3TA 1Z7EA 5F3RA 5ER9A 3EVNA 1XEAA 3HDJA 4EJ6A 5JMWA 4GWGA 4IDAA 3IS3A 2EKQA 2RHRA 4A26A 4BO8A 3K73O 5MDHA 3C7CB 2I3GA 2Q1WA 1E0DA 5KCZA 5A04A 4K6CA 2BGMA 2VT2A 1EK5A 1NFFA 1B3RA 1ADGA 1E7SA 2Q99A 4XRRA 4MDHA 3I4CA 1E7QA 4AJHA 2JJYA 1KVTA 3LYLA 1E7RA 4NR0A 4IDBA 2WDZA 4L4XA 5AYVA 3U4CA 4OKNA 4IDDA 1YH3A 4YJFB 5T6BA 4R16A 3L4BC 4D0RA 4BO0A 3SBOA 1E3LA 5DBFA 4GGPA 1B16A 2PZMA 5CEFA 3TQHA 1NQAO 3IUPA 1LC3A 2CMDA 4I5DA 4MKXA 4NU5A 1M6HA 1PZEA 1MXFA 5JDCC 3E9MA 3CUKA 3NRCA 1ONOA 4PG7A 1MC4A 4MP6A 4ALMA 2QIOA 4MIYA 1WP4A 1HXHA 4CLXA 4NQZA 1QV6A 2P4HX 4IUYA 2JL1A 3H4VA 3IP1A 2PZLA 4RDHA 5TS3A 3H7AA 2JKVA 3F1KA 4Y6PA 2HMUA 2YYYA 4FC7A 1BW9A 1HDXA 2VRBA 4XEHA 4OOEA 5DCWA 4NK5A 1SNYA 1VJ1A 2Q4EA 3V8BA 2X22A 4HXYA 4C7JA 1QYVA 4CR7A 6ADHA 1P31A 1PSDA 4BO4A 3PDJA 2EKLA 4YVFA 3V2UA 2EG9A 4RDIA 4A5OA 2VN8A 4Y67A 2O7SA 4O6VA 4AJNA 4M55A 5L7WA 4KDFA 1SOWA 3PGJA 4ZVVA 3PYMA 4MP3A 3OIDA 4R3WA 3N7UA 4WLUA 2XXBA 1BMDA 1KC1A 3WR5A 3ZH2A 3ZWCA 1A5ZA 1M67A 3DBVO 9LDBA 4BKUA 1KVQA 3JCZA 2O7QA 4K9DA 1YQDA 3L4SO 3JQBC 4RQUA 2FZEA 1K0UA 5BT9A 4KWHA 1EQUA 4LVUA 4BKQA 1E6UA 2BF7A 3K31A 4J9VA 1UXJA 1Y1PA 5BSFA 4OIMA 4BMNA 2EGGA 1MB4A 1V6AA 2DPHA 1ISHA 1K6IA 5HS4A 3GVHA 4RGBA 4XQEA 1ZK1A 5JFOA 1E1LA 2XAAA 4FGWA 2Y0CA 3E82A 3W6UA 1LXCA 3QE3A 2GZ2A 2GF2A 3LLVA 4CLOA 1Y8RA 1WXDA 3KYCA 1M75A 4EEZA 3V1UA 1OFGA 3GGGA 3PDUA 2GO1A 4DIOA 3OA0A 3UF0A 4RV9A 4PG4A 4TRNA 4CMEA 4E21A 5EESA 4WCFC 3ZV5A 4BNUA 1PJTA 1ZFNA 1NPYA 3EZLA 3JQAB 4XYLA 1BXGA 2JAHA 2X5KO 5A9SA 4CR8A 1GL3A 5DOZA 3WJ7A 4IPTA 4PG5A 4WKGA 3D4PA 3L4BA 2C5EA 4S1VA 3DBHA 4OKIA 4ZQFA 4F6LA 5CDYA 4PVDA 5GZ1A 4LGVA 2EKPA 3MJSA 4ID9A 1LLDA 1G0NA 2PH3A 5AXDA 3FTNA 2GERA 4ESOA 1KOLA 1QV7A 3ZU4A 4M54A 5ICMA 4CR6A 2HSDA 3QQPA 3AM3A 2D8AA 1TLTA 1GDHA 2GDZA 2ZKLA 2BELA 3AFNA 3IIEA 4CMBA 3OM9A 3G1TA 1B15A 5CDSA 1F8GA 4R5HA 1MFPA 2ZTLA 1J6UA 3A4VA 4BQPA 2EV9A 4WCFB 1BVUA 2D4AA 2EJVA 2FSSA 2PKQP 2PNFA 4CM4B 1U2GA 2YUTA 3NJ4A 1H6BA 3DFZA 4TRJA 5TQVA 2DLDA 1VI2A 3DFUA 3NKLA 4R1SA 3UH1A 2V7PA 1DLIA 2OHXA 3L9XA 4E5MA 4EYEA 3K2BA 4RF5A 4AJOA 4XQGA 3CE6A 1H2HA 3SVTA 4FN4A 3TJRA 1P1HA 3GVPA 3LT1A 3Q9NA 2WD7A 5A5FA 4LMPA 4E5PA 4UVDA 2RBEA 3UHAA 3C85A 1PZGA 4E2XA 1U7HA 1P33A 2YW9A 1B0AA 2W90A 2BI7A 2H9IA 1ONPA 3EVTA 4GSLA 3RD5A 1VL0A 4PVCA 4UEOA 1Y5RA 1KIFA 3GFBA 5HTOA 1UXIA 3E5MA 4II2A 2X4GA 3NGLA 2PH5A 2CUKA 3WFJA 5JO0A 2QRKA 1FJHA 3RJ5A 1PWXA 2I9PA 3JQ9C 3MWDB 2B69A 1H6DA 3H8VA 1CJCA 1HSOA 1P3DA 1E1KA 3CMCO 5FI3A 5JO9A 2JCXA 2VRCD 4E30A 1KEVA 3QWAA 3GUYA 2GGSA 2VZ8A 2X8LA 1A27A 3GOHA 3LT4A 4YA6A 5A02A 4BNHA 1NAHA 4NJMA 5B4TA 3HHPA 3DBHB 1I32A 1NHWA 2AG8A 2DUUA 4YACA 1GZ3A 5C5IA 3P7MA 4L0QA 3WWZA 2FOIA 1CQJA 3PJEA 4OO3A 5L7TA 3DBRA 2Y1OA 1AGNA 1EEHA 4RPJA 1ZW1A 2JFGA 3AUUA 2CVOA 4MVJE 4M87A 2FZWA 3RI3A 3UW3A 1E5QA 1JKFA 3HFSA 1LDBA 1GQQA 3AUTA 4RPKA 2NTJA 4TRMA 2GZ1A 2G82A 1F8FA 2A35A 4H3VA 3RCBA 1HDRA 3I5MA 2VHXA 2YV2A 4QEDA 1U5AA 2I5PO 2DVMA 4X54A 3I83A 4D46A 1K5HA 2DBQA 1GU7A 3QRWA 3HDQA 1YB1A 1CERA 2ZIZA 1DSSG 2UV8A 2NADA 3TSCA 4ALNA 1EUCA 4CLRA 1P1KA 4WOKA 2ZQYA 3ZWAA 4FOOA 1XCBA 3GUCA 4FR5A 2OFPA 4D3SA 3CEAA 2BKAA 5TGDA 1OBFO 2C2XA 1Y9EA 3EZYA 4RF3A 1UDBA 3ZWOA 4NI5A 5EIOA 4AICA 1U3WA 1A7AA 3QVSA 3VZQA 1NFQA 3P19A 1C1DA 1TA4A 3C1AA 1O89A 3OEYA 2O3SA 2C7VA 5JE8A 1ZSYA 2PA3A 5JMPA 3H6KA 1GADO 4TWRA 1N8KA 2D5AA 2PKQO 1I3MA 3X2EA 1VJTA 1Z7BA 2ZB4A 3PYXA 3AOEC 1HKUA 3F3SA 3JQ8B 4BNZA 3NTOA 2C0CA 1TT7A 5JYEA 2Y66A 3GVCA 2PK3A 2NQ8A 5IDXA 3OH8A 5L40A 2Y68A 3PWSA 4BQRA 2O3QA 3KLMX 4DBVO 1YWGO 1ISFA 4HKTA 4U0KA 3UCFA 2C2YA 3TFQA 3CZMA 4J90A 1Q0HA 4GMFA 2VWHA 1C1XB 2P2SA 4HADA 1WDMA 3GFGA 3RUHA 3WYEA 1PJBA 3HJAA 3MTGA 3U09A 4PZCA 3C1OA 4XGIA 3BMCB 2ZATA 4IDFA 3VH4A 5K9ZA 2FPIA 1YL7A 2IXAA 4DLLA 1PJSA 1GZ4A 4R1TA 5CP8A 4CLOB 1LDYA 4W7IA 1ZSVA 2WEKA 5B37A 4CV3A 3H9JA 4LCEA 3UUWA 4YXFA 4BNYA 2J5RA 2XXJA 5FFFA 5CEEA 3I3OA 3VZRA 3D1LA 3LF1A 1DC4A 3LT0A 2C54A 4I5EA 4OXNA 1P74A 5KTKA 4CLRB 4J7XA 1CETA 4JQCA 1WZIA 2EEZA 4DYVA 1EDZA 1SBYA 3JV7A 3IC5A 3VH1A 3AOGA 4WPGA 1R6DA 2PGLA 3VC7A 1D1SA 4I1IA 1LSJA 2PD6A 5CHEA 4MIOA 3H9GA 3PHIA 4L75A 4Z0PA 3S1LA 5FEUA 1HL3A 1ZK4A 3PZBA 2YDXA 4J1NA 4J4HA 3K5PA 3IQDB 4MIEA 5JDIA 1Z6ZA 5DCUA 1I10A 3QJ5A 2OP0A 4E4YA 1Y7TA 4UUMA 5CDTA 1Q0QA 3DDNA 1IPFA 2I3AA 2JHGA 3A9WA 3RIHA 4WNIA 4J3FA 1SEVA 4U8GA 2PZKA 1JAYA 3OBBA 1LU9A 4N5LA 3IDSA 5COBA 5L7YA 4JP2A 1EBFA 1KS9A 1E3IA 1ORRA 4ZGWA 1IULA 4CMAA 3I9KA 3FD8A 4FDAA 3QSGA 3FR7A 5IG2A 1U9JA 2E4AA 5IJZA 3ZWNA 5ITVA 2ZYGA 2IRWA 4ALIA 4D7AA 3PWZA 4RF4A 2NSDA 1P0FA 4IBOA 3RJ9A 5L4SA 2D2IA 1DO8A 2Q46A 4W82A 3U4HA 4LVCA 1E3SA 5JY6A 4I8XA 3DONA 4HWKA 2YZ7A 2PD3A 3C7AA 1RM3A 1NNUA 2OOSA 3H2SA 5TC4A 1PS9A 3L0DA 1ISMA 1N92A 2VWQA 3S55A 3UAGA 4J1SA 3D0OA 2O2SA 4RO0A 2X58A 2J3HA 4YJHB 1SPXA 2EGHA 5JSFA 2P9EA 1IZ9A 2WYVA 3DZHA 1MA0A 3KSZO 5THQA 3I52A 4DXHA 5JCJD 1P45A 3RQSA 3K2EA 2BFOA 2NNLD 2ZTUA 4G5HA 5TSDA 2EJWA 1J49A 3INRA 1HWYA 2C82A 4CM6A 5IXSA 3MJVA 3PP8A 1Q7GA 1GV1A 4E31A 1P1FA 1DAPA 1F14A 1Q7CA 2QYTA 3JSAA 1P1RA 1P9LA 3JQEA 4P4NA 3B1KA 3NJ8A 1I3NA 4LRSB 4CMHA 3WX0A 4CM9A 5BNIA 4ROSA 1NQTA 1QXSA 2GSDA 2ZYDA 5L3ZA 1YOVB 4DQUA 4HUJA 3MTJA 5I8ZA 2W2LD 1YONA 1BG6A 1E3WB 1R4NB 1JKJA 2B36A 1BWSA 5K6AA 1R15A 5F1PA 3NX4A 4ND4A 4QXMA 1ZJYA 5IF3A 4A7PA 1ZO8A 3I9NA 1FDWA 3ANNA 3GH3A 3GHHA 4FCCA 4FFMA 2NU8A 4K26A 3PIIA 2OORA 1ZKMA 2WMDA 5I9MA 4DIBA 8ADHA 4YRAA 3SXPA 1C1DB 2QZZA 4U5QA 5ENVA 3PHLA 4OXYA 5LDGA 1HZJA 3OSUA 1Y9AA 2VNSA 4GGOA 2Q49A 4MVJA 1RYEA 5ILGA 2V6BA 4D42A 1IHYA 4Z9YA 3E9QA 1E1NA 1ZMOA 3JQDA 1AUPA 1LRJA 3OMLA 3DHNA 5KJEA 1LDGA 1R0LA 2VHVA 3DC2A 1SB8A 3GPIA 2A4KA 1NAIA 1P44A 2RH4A 3AM4A 3F5SA 1E3JA 1BXGB 3OJEA 2HDHA 4ITUA 1K89A 5BR7A 3PLNA 3CKYA 4BO1A 1E6EA 1HDCA 2WE8A 3F1LA 4CQLA 2BFPA 4L9RA 3WMXA 4BKPA 3FSRA 4RZHA 2O4CA 5JLAA 1ZCJA 3RC2A 3IOYA 4YQYA 3ITKA 1JA9A 1XA0A 3R3SA 3KEQA 3U9LA 1HEUA 4WCFA 1LQTA 2RHCA 5LDHA 4HFJA 4PLZA 2I99A 3F4BA 3AWDA 2BHLA 3WBBA 3UN1A 4XGNA 1HLPA 1T2AA 3RKUA 3RC9A 1ISIA 3BMQA 1ZXBA 3HUDA 1J4AA 4G65A 3JQBA 3OHSX 3HWRA 4DL9A 4N5NA 3OJFA 3SC6A 3M1LA 2AG5A 2HCTA 2YHUA 4XYBA 3JQCA 1HDGO 4FFPA 1OC2A 4YAKA 4FFOA 2AE1A 3V2HA 1CEQA 1V35A 4JLWA 3GG9A 3W8FA 4B4UA 3QLJA 2BMAA 1FDVA 2DQ4A 3DTYA 4WLVA 3PVZA 3WQSB 2O3TA 3QWIA 1NPTO 2AHRA 1ZUD1 2GASA 4E3ZA 3P2OA 1U3TA 1KETA 2NQTA 3DXFA 4BNWA 4IS3A 4XIJA 3NEPX 3V1TC 2V6FA 4XB2A 5I9NA 3LLSA 1Z73A 2PFGA 3GEDA 4F6CA 1V8BA 1A72A 1BVRA 1PGOA 4LW8A 3ADPA 1E7MA 3U3XA 4M1QA 5L4NA 4OMUA 5L9AA 4YAJA 3M1AA 2HMSA 3ORFA 4J2HA 3SLGA 4DA9A 1T4BA 4CMKA 1LC0A 1GUYA 3AW9A 4E5NA 3CXRA 4BKRA 2UYYA 4FQ8A 2Q4BA 1R0KA 4Z0TA 5IN4A 4NH4A 3STHA 5U9CA 4GAEA 3FR8A 4BO6A 2BFMA 2H63A 1QYWA 2YQ4A 1GR0A 1EQ2A 4E2YA 1NVMB 1UJMA 2TMGA 2Y1EA 2DU8A 2AQ8A 4LK3A 3C3XA 1QKIA 2DC1A 4XR4A 5AVOA 1W8DA 4EI2A 3RWBA 1C0IA 2VUUA 5T5QA 1T2DA 4NBVA 1DIBA 2HK7A 2Y1CA 4R69A 1CQIA 2FWMX 1PL7A 2YJZA 2CDAA 3ZI0A 3K6JA 3TN7A 3DEYX 5A05A 3WYBA 2VZ0A 2PLAA 1XR3A 4JBIA 3MEQA 5A9SB 5A1TA 1GY8A 4WEOA 3DZIA 2ZTVA 4H7PA 1DC5A 1UZNA 1CDOA 3AUAA 5ITWA 3H9UA 2PWZA 1O6ZA 3GGOA 4GLOA 2C29D 1TXGA 2ZB7A 3MOGA 2NVUA 3BAZA 4R54A 4QO8A 1JN0A 3I9JA 3KB6A 2ZB8A 1R37A 1WLYA 1JWAB 3FNEA 4IZHA 4JJGA 2I65A 4CM4A 3WSWA 3AY7A 3ZWYA 1XU7A 1U3VA 3AY3A 3BIOA 4L74A 4P8RA 4WLOA 3ST7A 3ZCXA 1L1FA 3T7EA 2JHFA 3GDFA 1JDJA 5F1OA 4YWJA 4PLYA 4JP3A 3MJTA 3Q6IA 3GNSA 2VWGA 3PI7A 3QVWA 4FGSA 4CJXA 1LEHA 2VRCA 4BIIA 3EW7A 3TL2A 3PRJA 4ND5A 1O8CA 4MVJD 3RFTA 3W4JA 4GLLA 3PFWO 1C0KA 1P0CA 3GPDG 3U0BA 2DPGA 1I3KA 2PTGA 4HFRA 5KVQA 3GR6A 4IDGA 4WE3A 1UUFA 3CZRA 4RVHA 2HMTA 2IZ1A 3ZNOA 4D43A 1YJQA 2NWQA 5AXAA 1PTJA 3LC2O 1EVIA 4BL5A 1C14A 1YL6A 4J1TA 4WCDA 3FCOA 1DB3A 4ALLA 2R00A 4S3MA 1ZVMA 4I9NA 3DAPA 2Y1FA 2QG4A 3WTBA 4CV2A 3H2ZA 3OETA 2GD1O 1B8UA 4EZBA 3RUEA 4YJFA 2CVQA 2HRBA 2VYNA 1M66A 3QY9A 1IE3A 4OOFA 3T4XA 4BNLA 2RAFA 4CM9D 3DZJA 2X5OA 4YB8A 1NQOA 2PY6A 4XCVA 1NVTA 4DREA 2G1UA 1H2BA 3PHGA 5JPIA 1SEPA 3GNTA 4AJIA 3BTSA 2EW2A 1H5QA 3DBLB 5BQFA 5CG1A 3D5TA 1GEGA 2ZCUA 3GY0A 4JNKA 4XIYA 5EPOA 4F45A 2HMWA 4ZN6A 4DC1A 2Y99A 4BKOA 4EJMA 3C24A 2UDPA 3MOIA 4XYMA 3I9MA 2ZQZA 4ZQEA 4ZQGA 1IHXA 3WG9A 3BHJA 3F5QA 5TT1A 3UICA 4G2NA 1WMBA 4D45A 3KBOA 4MVJI 1ZEJA 3GAFA 4XD2A 3LQFA 4B7UA 5A5EA 1RM0A 1UZLA 1DPGA 2VOEA 3K9QO 1E3EA 4AJ1A 1XHLA 4D3DA 1XQ1A 3JQ7B 3TOXA 2DM6A 3ZU3A 1QLHA 4HP8A 3OQ1A 2O50A 2HO5A 3PXXA 3IP3A 5KNLA 2HK9A 3QWHA 4WJZA 4MPDA 1DC6A 1LJ8A 4BNGA 3PLRA 1RYDA 4FOSA 1HYEA 5JY1A 1XLTA 2PR2A 1BRMA 3U4DA 3WDSA 1XKQA 4R9RA 3U4IA 4FJ2A 1QYXA 3VPHA 1EE2A 5I8WA 1R66A 4ILKA 1F12A 4CUZA 4EGFA 3ETGA 1LRLA 4OGWA 1EK6A 2BGLA 2NACA 4XA8A 4JK3A 3UCXA 1Q1NA 3ASUA 3QW2A 4Z9FA 3HQ4O 6LDHA 1AHHA 2O3RA 4QFCA 2JCYA 2CSUA 2WYWA 1I2CA 3QHAA 3ULKA 1GQYA 5IAAA 3JYNA 2YHIB 4CV0A 4NFHA 3VPFA 1Y6JA 1MLDA 5TJHA 2B4RO 4YJHA 5BSEA 3QVXA 2O2YA 3VKUA 3RVDA 3B6ZA 3VHRA 2P5YA 4QX6A 4ZHSA 5B12A 2ET6A 4QQRA 4R1UA 4DUPA 4YAIA 4RLSA 5J23A 1IYZA 2UVDA 4OYRA 4BNXA 1JW9B 1B26A 1HYGA 4BNVA 5F5LA 3M2PA 3QWBA 1RWBA 4B3IA 5CDGA 3AY6A 4WGGA 3VKVA 3ZHBA 2E82A 4HX5A 3KYBA 4MKZA 2X6TA 4ONEA 1DJQA 1H6CA 4JJFA 5G0SA 4OHUA 1Z82A 4FS3A 2QX7A 2C07A 4IY1A 3AU8A 1P1IA 2VUTA 3ZWVA 3H5NA 2FRDA 1NWHA 1VJ0A 5L4LA 3ZHYA 3F4LA 1C0LA 1BXZA 3RFVA 5L51A 1D8AA 4FFNA 2Q1UA 3WSVA 1KEWA 4BVAA 1D3AA 1VSUA 2G17A 4TMFA 4AJKA 5IDYA 4K6FA 4OSOA 4IJWA 1I33A 3ONFA 1EUDA 1DAOA 2NLOA 5DP1A 3SLKA 4BMSA 1ZK2A 3A06A 1XIVA 2Y05A 4MKRA 4CM8B 1KEPA 4PG6A 1DIHA 1MX3A 2BH9A 4AFNA 4RJTA 3IJRA 2D1YA 4Q3CA 3VH3A 1JAXA 3T7CA 1GYRA 1YOVA 4FFLA 1VKNA 3VDRA 4YAGA 4F46A 1B7GO 2C5AA 2CVZA 5ENDA 3TPCA 1NTOA 2YY7A 1OZAA 1X0VA 4GX0A 3GNQA 1WDKA 2HJSA 1R4NA 1EE9A 1SB9A 1XYGA 4Y98A 3TZ6A 3KSUA 1QR6A 3VTFA 1VL6A 4PLGA 4XQ9A 1LLCA 1NXQA 1YKFA 2W2KB 3S2IA 1CYDA 5CPFA 4J0EA 3W6ZA 2PD4A 3H9QA 4PIVA 3RUDA 1I5RA 3HZZA 1RKXA 5ADHA 5JAZA 1UXGA 3VOSA 4JBGA 2P5UA 3JD2A 3NDJA 1HE3A 4A10A 4TVOA 1ULUA 4CQLB 3FTPA 1PS8A 1N9GB 4GQAA 5IN5A 2IZ0A 1YO6A 4NBTA 2VTDA 1M76A 3WWYA 4EUEA 1H93A 4RVDA 1HT0A 3BTUA 1HRDA 4D41A 2AMFA 5G0VA 3D5QA 2X0IA 3GMDA 2J5QA 2IEBA 4NK4A 4CODB 4Z3KA 3AI1A 3LSYA 3PIDA 3DZBA 2Q50A 5EN4A 1MGOA 4IMRA 2DBRA 3JQGA 3OIFA 5CG2A 4W99A 2NV6A 4RVFA 1PJQA 4KOAA 3MJCA 2OP1A 1F06A 5BNFA 3PQDA 4E0BA 1FDTA 3O4RA 3EY4A 3EAGA 4CLDA 1OOEA 3RASA 1XELA 4IJVA 3ROMA 2X0JA 3JQAD 2LDBA 1GPDG 4OSPA 1GTMA 4OQZA 3KOUA 4FJ1A 4CUJA 3FNGA 1UAYA 1TT5A 1WNTA 3GZ4A 1PEDA 4RL6A 1DRVA 3DWFA 2NUAA 3HADA 3KM0A 4KZPA 3RKRA 1YXMA 2I6TA 3A28A 4HV4A 3BMQB 5EMHA 1I8TA 3HDYA 1I01A 3PGXA 2LDXA 2QHXA 4ZJUA 4Z6KA 1DHRA 2GN6A 5K6AC 2OUIA 4M86A 3SC4A 3PK0A 3KRTA 3B1FA 3JQ8A 2HKIA 4JX8A 1ZBQA 4L4RA 3TL3A 4YPOA 4AG3A 3OEWA 3OJOA 3V2GA 1U8FO 4ZU3A 4R41A 5IZCA 1Q2XA 5T64A 5I7EA 1KERA 1PQWA 4PCVA 2DKNA 3D3WA 2ZB3A 3JYOA 3ROKA 3S2FA 3B70A 3NDRA 2EHDA 1PS0A 3IJPA 2PKRA 3ANLA 2IXBA 3OICA 4RVGA 1XWFA 1C1XA 2YHIA 1E6WA 3AOEA 5IDWA 2AW5A 1G0OA 3K8ZA 2B4TO 4N5MA 4Q3NA 4BNNA 3LVFO 2I67A 4FD3A 1U4OA 4UEJA 4CMEC 3B1JA 1ID1A 1KY4A 4GL4A 3FI9A 4NZ9A 1XGKA 1BW9B 2JD0A 1GQ2A 1DRWA 2JD1A 2R2GA 4RLHA 5A9TA 3KYDB 4J4BA 3GN1A 4RCVA 1MUUA 2BGKA 1SC6A 2H1SA 3CTMA 3G3EA 4KTVE 5H81A 4EITA 3GRKA 4L76A 1MG5A 4P4GA 2CY0A 2DTXA 3TRIA 4K1LA 4B7CA 1CRWG 1DIRA 7MDHA 2WD7B 3R6DA 3M6IA 4B4OA 4PG8A 2DFVA 1O0SA 4CMJA 4IM7A 3GRPA 4BNIA 2EIHA 1YQGA 5A4DA 1VRWA 4IQGA 1G6KA 1MC5A 4UAGA 4BNJA 5DULA 1GZ6A 1FK8A 3U49A 4CMIB 3DR3A 3PQFA 3WOHA 1NVGA 1UP6A 4R3NA 4J7UA 1ADBA 2HRZA 4PGFA 1JU9A 3P2YA 1EMDA 3WICA 3RBVA 2AEMA 4CM7A 4GSKA 4CQMB 4RZIA 1KC3A 1H9BA 3ABIA 1PQUA 3QA9A 1GAEO 2B5WA 5KVCA 1LQUA 1PR9A 4XGKA 5GZ6A 2A9FA 3G49A 4OH1A 5I9LA 5JW6A 1YRLA 3FWNA 3PFFA 4FBGA 2UAGA 4BV8A 3MJ4A 4YQZA 3HSKA 3NUGA 5JDIC 4ZICA 4GX5A 4CV1A 3C7DB 3WGGA 5LC1A 4CQMD 1LBEA 1HDOA 5FWNA 2IYPA 5ILOA 4BOYA 4DBZA 4N18A 3NGXA 1KVSA 3D3WB 4YDRA 5G4LA 3W4IA 2X1HA 3FRJA 4Q3BA 5G4KB 3GT0A 4EUHA 2SCUA 4FFRA 5LCXA 1HTBA 2D5CA 2NVWA 2Y67A 2DTEA 4TROA 3E18A 1NP3A 5T8KC 1I2ZA 3U62A 3JD1A 2GN8A 5AXBA 4ZA2A 3OJLA 1PGQA 1DRUA 5CAEA 4XYEA 2BLLA 4BO2A 3WQRA 4E13A 3AJRA 4R01A 4AVYA 3HG7A 1QYDA 5TX7A 1J0XO 1GYQA 3GZNB 3DAFA 4IIUA 5DOVA 3VPGA 1ZK0A 1LTHR 4MO2A 1HE5A 5BSHA 3ZNQA 1ZMTA 1MFZA 3RU7A 3JQ6A 1Z45A 1LDMA 2X9NA 1NWCA 3L6DA 4LCJA 3BTVA 2V6MA 1V9LA 3MWEB 5JBIA 4DPLA 1ML3A 3BZUA 1NQ5A 1HETA 5DBGA 2WJPA 2D59A 4U6QA 1ZIDA 1PZFA 2V65A 1BSVA 3EMKA 3HFGA 4NHEA 1ZK3A 3AU9A 4CL8A 1A7KA 3NTQA 3H9EO 4QUKA 2VOJA 1WW8A 2X9GA 3DOJA 4IS2A 2Q3EA 3TDKA 4Y9DA 2IYOA 1WVGA 3I6IA 4YCAA 3EHEA 4XX0A 5KJCA 3O9ZA 1NR7A 3OFSA 2VZ9A 3TOZA 1N5DA 4R1NA 4Z0HO 5IXYA 5L95A 2NTNA 3AI3A 2NU7A 4YT2A 1X14A 3GG2A 3H5RA 2RIRA 4A73A 5G0UA 4U0JA 4DLAA 3TWOA 1V0JA 2CDBA 1T26A 4TRRA 3BMNA 5GZ3A 5F21A 3ZWMA 1BGVA 1SOVA 4O5OA 2R00C 3HE3A 3NV9A 4OJNA 2R6JA 4BNTA 1JQBA 4HFMA 4J4TA 3N74A 4P38A 4QSMA 5KJ6A 1DLJA 4B4VA 2FMUA 4DWVA 4OM8A 2CNBA 4WNCA 1CF2O 4B4WA 1UDCA 4NJMB 4INAA 3ZZNA 4DMMA 4OXKA 1T25A 2YDYA 1YL5A 4NMHA 3ZV4A 3U5TA 1B8PA 1BHSA 2EP5A 3DHEA 4QTZA 3W1VA 5HRUA 2G76A 2FR1A
chains in the Genus database with same CATH superfamily
2UUAB 1NULA 1W93A 2WAFA 2B94A 2HDOA 4ZD6A 1J5EB 4AWAA 4LJ5A 3VZPA 4M1ZA 4JP8A 4TYQA 1RR7A 3GYGA 1R1DA 1ZOIA 1QBGA 3DAYA 3F67A 3IIMA 2R87A 1LW6E 2OC4A 2X7HA 3CLRC 4K6OA 2Q6TA 1XDWA 3OPXA 4RSHA 3TAHA 3UW1A 5BR4A 1Z37A 5AOAA 4BMPB 4Q1EA 1V7QA 4J8PA 3UJ9A 2XUZA 2SKDA 3TX6A 3S1NJ 4NHOA 1Y89A 4NU6A 2WA0A 4YYZA 1SD5A 5C44J 1M2VB 1DBPA 3GUVA 2CWEA 3KE9A 1XCJA 4Q4AB 1Y82A 4JJEA 5DBIA 4EY6A 1DIGA 2FPMA 4W1QA 3AR4A 3NHZA 2VT3A 5AKZA 1Z91A 1JTEA 3C3KA 4HAIA 2XIQA 4PLHA 3WIOA 4OL9A 2FH5B 2IZZA 2B4YA 3KJFA 4GX2A 2XGXA 1TQDA 5IYZF 1K5PA 1V3QE 2AJ8A 3GTMJ 5TS2A 1WKCA 4ZI7A 5ESXA 5LQNA 3K4JA 2IHYA 4AN1A 2ZJAA 6Q21A 4HQNA 2GARA 4EDFA 1H8HA 4IFIA 4IGEA 2WWVD 5LOVA 3P1JA 4MR7A 1J1ZA 3QGMA 2QAJA 1R00A 4Q4JA 1GL7A 3WKCA 1L5WA 2IPNA 4RHUA 3VR1A 1T43A 3CF5F 5E4FA 1AXEA 5LR6A 1A9ZA 2UYQA 3LE8A 2ZBPA 2OQ2A 1MENA 2B34A 1GZDA 2RDPA 1TJNA 2UZ0A 2YRFA 4FSXA 2OHJA 2DFDA 4MO9A 1H88C 1TB4A 5GJVC 3IAXA 2GAOA 4HQRA 4S2EA 4G4SP 1XAGA 5ALEA 2IHBA 1R8JA 2F3UA 5DLPA 1QQ7A 4FKMA 4M71A 5IAGA 2C84A 4ENWA 3ZGVA 2XAGA 1YKGA 2DCEA 1RBMA 3DKPA 1LQ2A 4DCGA 8MHTA 3WU2C 3ZCUA 4EG7A 2R7OA 1NBMD 3JQFC 3EK2A 5ICGA 2XCQA 3EEBA 3I39X 4IHYA 1NXWA 2V96A 5HCIA 3BWCA 2VSYA 3AVYA 3IMGA 2Y76A 4JYMA 1TQHA 3A0BC 3SDGA 4U00A 4PZZA 3GLTA 3ZE1B 4EA7A 2WSSD 4NDZA 5JPCA 1J8YF 1P0QA 4Q16A 4U2BA 4QT4A 6NULA 1FP4A 2I66A 5E1WA 1ZNQO 2ECPA 4RPHA 5GTDA 2HDNB 1Q84A 4MKFA 2KLHA 1P8JA 1KZ7B 1RC1A 3O4VA 1XTQA 4D96A 2EFGA 3C6KA 4UOZA 4JI1B 2A9RA 5B57C 1U5TA 3H3VK 1OFUA 1MHPA 2Y1DA 1ZJZA 2B8WA 3IA2A 4YAEA 2WWRA 2J85A 2DK5A 4IVQA 3I55I 3ZE9A 3A70A 2I8DA 3RG8A 1NSTA 3DD5A 1RM5A 3V48A 1ZK8A 3B6MA 4LK0F 1K78A 4GEKA 1U3EM 3RNLA 3IVMA 3THWB 3HKZN 3ZDXB 2DBZA 4I9UA 4AZ0B 5AUPB 3AJEA 3OQIB 5LP6B 1VM6A 4MHTA 3HU2A 4MZDA 3EEIA 4NV0A 5HMLA 5K3CA 1L5GB 4CXMA 1Q57A 5A4JA 5I7VA 2SCUB 3E7DA 3SR4A 3SX2A 1FDUA 2A6HF 1KJ8A 2ZXUA 1ITYA 5IK2D 4TS3A 5TPZD 4TKVA 1ST3A 1HFWA 4C0LA 2P6PA 4WGFA 4J76A 2IY8A 3DHVA 4E32A 1HW1A 1T8SA 4JVLA 4RDXA 1DPFA 4HTAA 1TQ6A 2X2OA 1P1BA 1ZQ1A 2AFVA 2QTGA 2DOAA 3O83A 4HD8A 4D6YA 4C0AC 5H83A 2B9SA 4BBZA 2VJ4A 1M2WA 1U2RA 3HCBA 3RVOA 5ALFA 2JQ7A 3CF2A 5FT9A 4G89A 5UKDA 4Y6RA 4B84A 4JI8B 5GAGJ 2GCEA 2H7XA 3M5DA 4WFQA 5DYIA 3HUEA 1I2BA 4XDZA 1IG3A 1E17A 1UBFA 4G6TB 1HBXG 1Z5WA 1U8TA 2C4KA 2VF8A 1E9FA 4D81A 2F4OB 4M3NA 2X4LA 2JIMA 2VPWA 4ZCQA 5JRJA 3U6KA 2OG1A 4ESBA 3KPHA 1ECGA 1RC0A 1ADCA 1XQ6A 1Z88A 5FROA 2XD9A 4Q3EA 4TT3D 5CQGA 5LP6C 3TKAA 3UJ3X 1ATIA 1VP3A 5DIFA 1UG2A 2NXNA 1IVNA 3H75A 1BR1A 1XZNA 2SECE 3ANYB 1REQA 2ZUDA 4QOHA 4Q9HA 1ZRFA 2A3NA 3M8EA 4TS1A 2YWHA 5HS8A 5LGNA 2RHHA 3KD2A 2C59A 2QR3A 4QZVA 3VVCA 3TNDA 2A61A 2CXQA 1AZLA 5THKA 2B83A 1CW2B 7ADHA 3F90A 2HHJA 1S8NA 2GZSA 3X2FA 4HAWA 3ROQA 2FK8A 1A96A 1Z5NA 2QUIA 5A0FA 3I9FA 2YJ4A 2ZAOA 3NXKA 3STYA 5BUQA 1PIWA 1D6SA 1K7SN 2W0MA 5B4UA 5KINB 1PFUA 2HMVA 4NONA 5DISB 2OD9A 3BTJA 3E8XA 3IVGA 3FNBA 4K9OA 1OPCA 5JG7A 3TNFA 4L2IA 1JNYA 3JTMA 3KQPA 3E0QA 4V19K 2NS8A 4MARA 3BPVA 1LTQA 1RE1A 1WMAA 2QGZA 3KVOA 2WRZA 3U61B 5EJ8A 5DCFA 3HB9A 4JB2A 1GDTA 2GLXA 4U88A 3ABUA 2BAGA 2Q27A 3K0FA 2CF5A 4R2JA 4GL2A 1PJZA 2OL4A 2VDWB 3QOEA 3CIFA 1I7QB 1LS1A 1LDEA 3PEVA 3A25A 4PZ9A 1N1GA 1XTZA 3KTDA 3GUUA 3R0IA 5KOJB 1USKA 1PFVA 4KNYA 1C0EA 1VLLA 2HWKA 3LAJA 4JCOA 5KAPA 1IN1A 3WLAA 3WLPA 1KY3A 4GC5A 1WBJB 4HGRA 4A6XA 3SQWA 3QPLA 3ZLBA 4TZ6A 2HEGA 3H6GA 1BYUA 1U9CA 3CZ9A 4DIKA 4PWZA 2VONA 4REMA 3A3PA 2XRZA 4R9SA 4RSMA 1UH5A 3SLRA 3VYUB 2R7SA 1LI7A 3HV0A 3T5BA 1ZC3A 1IAQA 3WB1A 4ZQHA 3DWIA 3ZMSA 1BHO1 2C97A 2XPCA 5CFZA 1TJ5A 1N5RA 1NQXA 1RM4A 2P7VB 1OBCA 4U7BA 3PHHA 5IVHA 2F6CA 2WAEA 1I24A 3OTQA 1E69A 1JPJA 2AO9A 4MAFA 2B9VA 4WESB 1WUJS 2F1RA 1QZUA 3JYPA 3RS3A 4XSHA 3TRJA 4ETMA 4D0SA 3VYTB 2E1MC 2WPDD 1R2QA 4BAUA 3Q2IA 1D4FA 2ISQA 3GW8A 3DJYA 1U2GC 2KJBA 3DEAA 3JD4A 1FOYA 1IRFA 1P9NA 1ZU5A 1R71A 1CVIA 3C5WP 4B8XA 1T2NA 2BEUA 2BF4A 2PZJA 2O23A 5ALUA 1CP3A 1WKBA 2JDID 3KAKA 1N75A 1WW2A 1YB7A 3SK0A 4YEDA 1MIHA 4JC8A 4HY3A 4PXSA 5B3KA 4WJLA 5KDOA 4MIKA 1KOGA 2Q0QA 2G9RA 4CZ2A 3I1FA 2GEKA 4HR7A 2Q1TA 4E7HA 2ZVPX 4I9GA 1X1SA 3QBTA 3MQ0A 4XVQA 1U1IA 5EXTA 2VTEA 4OQNA 4AY2A 4MS3A 4D9JA 1IDYA 1RLJA 4RAZA 3TEJA 5C5CA 5JS6A 4H4CA 1BWRA 4HEA1 1U7TA 1FIUA 5KQPA 3UOGA 3NTRA 4JODA 3DTVB 5CX1A 5G40A 3T0IA 3IC7A 1E5DA 3QIVA 5KDDA 1BN7A 1EUZA 3IBFA 2E1MB 3W2VA 3ZDAA 3L8ZA 2FUNB 1QHYA 1XKXA 2Z5GA 3C48A 3E03A 3MZ0A 4QO7A 3VYVA 1X8XA 2XF8A 3DAOA 8ATCA 4NDNE 2H4JA 1DFIA 3LY9A 3D8RA 3DMTC 1QM5A 3M6VA 4WW0A 5FJJA 5JS2A 3QPWA 3URMA 1GZHB 1P5HA 1AKQA 2O1EA 5A5VA 1ESMA 2P30A 2OGZA 1N3LA 5T3YA 2W1OA 4IHXA 3WK4A 3U3RA 4U3JB 1USVA 3B02A 3SOPA 3C7TA 5CU7A 1L5ZA 1Y81A 3HFRA 4JEMA 1MJBA 3O38A 3QOPA 3DMRA 5I7HA 5F1RA 1KPHA 1N1EA 2G1KA 4LYAA 4F2WA 5ABPA 4KDPA 1XF1A 3GEMA 1C7IA 2X86A 4LWZA 2HJRA 5LBTA 3ENNA 3FPJA 1NZJA 4CKCA 3IDFA 3QUAA 2QTAA 3NANA 2NZVG 3EQ8A 4MLCA 1USSA 3MKZA 3OCCA 4O1MA 4CEIA 2QDXA 1K2VN 4R8KA 3VI3B 3W5CA 3TW7A 2WG1A 4C78A 2QUFA 4OMYA 1EXWA 3EASA 4KMSA 1VL8A 2RKOA 3LUKA 4BH9A 4BFWA 1R64A 2RH8A 1Y7HA 2AQKA 5KNCA 5LM3A 3IODA 1Q15A 2OTJI 4DYDA 4L4YA 2LXNA 5IM5A 3MCWA 4L0DA 2OBYA 1W30A 3LOPA 1T5LA 1FPMA 1XEWX 2ZIVB 3VBEA 4BN0A 3TK1A 4RKQA 4G0NA 2ZK7A 3L6OO 2RV8A 3HOYJ 1W29A 3GC6A 2ZYRA 1KDZA 2C7GA 4F86A 3JAWB 3NHKA 5I9SA 3R5FA 2VYFA 2CFCA 2VXCA 3CO5A 1BDJA 3FVWA 1KAGA 5EUQB 5H59A 3BQ9A 4YJDA 1NYLA 1N6OA 1DU4A 1E5VA 2DHEA 1Z28A 3V8QA 2Z98A 3B1VA 3TW4A 5IN4A 1QSGA 2WWFA 1F48A 2NVXJ 3K6KA 4WK6A 2AEFA 4LZNA 4ZDJA 5L4NA 1BW6A 3AV3A 2YCBA 1JTYA 2IT0A 1EUCB 2HTFA 2WWWA 3KTAA 2HK8A 5DF1A 1FSSA 4LYYA 2VJDA 4MPRA 4ZQBA 4BVEA 3KV1A 4K86A 4URZR 3NDBB 2E34A 4GS5A 1THZA 3WYNA 1Z16A 3S32A 2HRQA 2C98A 2WNIA 1JLLB 2W93A 5BURA 2NO5A 1T36B 2Z2YA 2Z3WA 1KJQA 3A2KA 3FHTA 2ECQA 3NT2A 1JQJC 2ACEA 4WDRA 3BB4A 1SCNE 2I10A 3ULQB 5ITSA 3E5UA 3G2OA 5LXTB 1ZA1A 2H1OA 1Z7GA 2WSBA 1IQRA 1FTGA 1XEWY 3Q88A 2WTNA 4TTJA 3DF7A 2YVKA 3DB2A 4Z8XA 2OHFA 2OG2A 1M7GA 3QEJA 2P5LC 4HATA 1IH8A 5CURA 1JJBA 2I6XA 4YUYA 1W7AA 3ASVA 4KFTA 1M74A 1MXHA 3H18A 3H65A 4U7PB 5P8WA 5EG0A 1ZLKA 3R1IA 5LGUA 3FKSA 3PEFA 1HT2E 2G67A 3TZCA 4GPTA 4D3XA 1G4UR 3RSOA 3RRXA 4HAVA 3K5HA 5IJXA 6GPBA 3HM2A 2VTBA 2BGJA 3QLEA 4QPQA 3D31A 1BJTA 3K1YA 4I9FA 5KMGB 2JFFA 5HWSA 1MP0A 1SBNE 1I36A 3C2QA 2D54A 4G0VA 2D7DA 1Q7RA 3WBKA 2EZKA 1KWKA 4DPMA 3LBYA 1DBWA 4Q47A 1HA3A 2C3PA 2KKOA 2WC1A 3QENA 4HB3A 3OEHD 4J3NA 3WMWA 1UPFA 2ELKA 1HF3A 3RHTA 3E5RA 5BMZA 1Z6TA 3I4PA 1B14A 1P5FA 1XG5A 2G9VA 9ANTA 2HR3A 1XUOA 2CNOA 1WV1A 2Q6LA 2BHRA 3KO8A 3O03A 1W9MA 5U1PA 4EYQA 3DLPX 4W5RA 4TS4A 2M1BA 1VA4A 2VSNA 4G41A 5KVSA 4UY8I 1DFHA 3FPLA 2GPJA 4HDSA 4DTIA 1N2CE 3KL4A 1CTQA 2CYBA 1A0OA 2P9FA 3QX7A 3WJAA 4E2XA 1UANA 4KOEC 2DFTA 2AUMA 2I4RA 3N2YA 3CCVI 4OBEA 1OHHA 1YLFA 2HLPA 3LDHA 1GWNA 3RPEA 3WI7A 5FO5A 1K0FA 2J3LA 3L9WA 3OAAD 3OO1A 3QVOA 5E6RB 3ZBQA 7REQB 1Y3DE 2HPAA 1ZAYA 4MO7A 3C8DA 2IELA 3HJBA 3C8UA 3L6EA 3AIMA 4R31A 5BT8A 8LDHA 2RN7A 2H6BA 3F78A 1E3PA 1XLVA 4Q05A 4D82A 4N0BA 1CUZA 2IBMA 1Z8DA 4HNAB 3TZHA 4CIWA 4GNRA 4CL2A 6CHYA 1MV8A 2IPXA 1EVLA 4HH3C 5CFPA 5JSQA 2WM9B 2P78A 1KHHA 2ZS9A 4ZT5A 1AQLA 3S1AB 3CESA 2PGJA 1RCTE 2QWXA 5GOTA 3L8GA 3BWXA 2H5LA 2WM3A 4D79A 4LV5B 5KOIA 1AHPA 4FONA 4NL4H 1P9QC 1Z1DA 1EFVB 2JGDB 2X23A 3OZFA 4FOLA 4JGIA 3S2GA 4C4OA 4HAZA 4MUJA 2GB4A 2O0LA 3CTPA 4JLVA 4QXQA 3UA3A 3IIIA 2BD0A 4OEHA 2DH6A 1JT9A 1S2IA 2NP7A 2QV7A 3U9GA 3K71B 4P31A 3DWGA 2G04A 1DT5A 2KQUA 5ECGC 3F6EX 5HFNA 2MCFA 3RT7A 3TQNA 1GPJA 1NBME 2FRVA 3H5TA 3H4TA 2P0AA 3KZCA 5LZ5A 5E95A 4BEJA 3G0DA 4L4UA 3CPJB 1PDNC 4UBNA 1ENZA 3G6EI 5DZSA 2EWNA 1DTEA 2IODA 3VAZA 2MSEB 3GF2A 2OYSA 4A0ZA 1QQTA 4PC2A 3ZVKA 1UPAA 3QNUA 1H0RA 4LN1A 1RRMA 3C2GA 3OPYA 5HS7A 4PPGA 4PLTA 3ZHVA 5JXWA 5ILSA 2KIQA 2FAXA 2QD3A 4HF0A 1A8QA 1PFQA 5CJ2A 3ZWBA 5HODA 1A69A 1QIIA 3NHYA 1I39A 1E20A 2QVZX 3SDSA 4AG5A 1C9DB 2CQXA 2GA2A 2PMZN 3WGTA 3WIDA 4JP0A 3LQ2A 3Q3CA 3K1MA 1NX6A 3ABRB 3VU3A 3LW8A 1L7DA 2GFIA 3UT5A 1R1VA 4P22A 4ZEXA 2ZRFA 1GT91 2ZZNA 2VCYA 2NM0A 1JGSA 3HUFA 3V7FA 4F0JA 2Q2VA 5DNCA 4HX7A 4L9VA 2O52A 2Z1MA 3FXAA 3P5SA 4JJ8A 4EB0A 5JWHA 3PPWA 4QVIA 2C3OA 3DM9B 5KTOA 4RA6B 2KYRA 2L0KA 3BIFA 1IWBB 4HLNA 4LY6A 3T54A 4XUGB 2NZJA 2F6RA 2P3LA 5TQVA 1W49A 5J4LA 2GNAA 3BTOA 1TGVA 3L92A 3LDUA 4EGQA 5KEIA 1SRQA 2O2GA 4D5GA 1LBTA 3FNRA 1KK2A 1QCZA 5BYJA 3K72B 3H3ZA 1WXXA 2PJZA 4P7GA 4BUCA 4K03A 3GQVA 4EUFA 5I48A 4XB6B 2D7CA 3K0HA 4XKJA 2O2ZA 2Y0DA 2ZIFA 4KXYA 1XMSA 3FM9A 3IAFA 3REQB 3LSGA 1BS9A 1KEUA 2VAMA 2Z8XA 4AWXA 4DIDA 3ZXSA 3HM5A 1Q1ZA 1RLMA 2CD9A 1QE5A 3MQFA 1RRFA 3H11A 2VP4A 4I6EA 5BO5A 5FBKA 3U1BA 3FOZA 3U48A 1C41A 2PU5A 1R16A 3HUUA 3G8CA 4QYSA 4ZVLA 2YRXA 4ZVRA 2NO1A 1BS2A 1Z21A 5E9JA 1MD0A 4D74A 1I1NA 2H1FA 2ZTMA 1XZDA 2F9LA 1SQSA 4YBZA 4YR9A 4E12A 3HO1A 3D7MA 1QFSA 3OYIA 1J21A 1PK7A 4N3GA 3NGMA 3TRKA 5I7UA 3AG4H 4G0YA 4O2RA 3IH4A 4GVLA 4KR3A 2HI3A 2HXYA 3T7IA 1J2UA 4IQ0A 3H2YA 4DILA 3LA3A 3OI7A 1P7WA 1TUIA 4MEJA 3TLAA 2EIJH 4WLEA 4WZZA 4HH1A 4GI2A 1MW8X 3R9WA 1WRJA 1URPA 3P26A 1Y98A 4LMYA 2B63J 3SBXA 5BPDA 2XDVA 2GPSA 1Q22A 2NXEA 3AINA 3EC7A 4V0SA 2HQ1A 2XMSA 3ORRA 3Q7SA 4GF5A 4XM0A 5DT9A 4BYYA 2HH9A 5C4IA 1YMQA 2JFWA 1U2EA 1XU9A 1XCOA 3EPJA 4NMWA 5D5QA 4NQWB 4F91B 3RBZA 3AIIA 5FLYA 5TIIA 3PD0A 4ARCA 2R7MA 4RD6A 5DK6A 5BN1A 3WL3A 1WNFA 3Q1KA 5E6UB 5EJAA 2VHWA 3IP6A 5AVSA 5FOQA 5F08A 1SUWA 4LLLA 5LRSA 4R9NA 5TLSA 4KR7A 4HX8A 5CLQA 4KN8A 1JI8A 4Y6SA 3EUWA 2JJMA 1Y1VJ 1V4VA 3K32A 3N8NA 5F9FA 4DWJA 1IBLB 2XROA 1O6BA 2XUIA 2X3UA 3E70C 1UKYA 4YTEA 1AKVA 1KJYA 3NP7A 1X13A 1XX6A 2BDUA 4HL6A 1CRPA 1DUIA 4UAVA 1LPPA 3KFLA 1YJ8A 5HW0A 1H85A 1NOIA 1QOQB 4PYQA 1ZGHA 3DVRX 3RROA 4F3QA 4FCYA 3IPYA 3WE7A 5LQSA 2H2WA 1CR0A 1I1HA 2HSJA 4QBFA 3SJ7A 5TV2A 3SYRA 2VHEA 1CWUA 3GRCA 4FJ0A 4HGPA 4DLBA 4EX6A 2NUPB 5JNVA 1Q0PA 4BGEA 4EF4A 2C9DA 3AUKA 3EFEA 1H0KA 2PNJA 4A2PA 3PJRA 3OWHA 3W78A 2R7XA 3ANMA 4F55A 1R23A 3E58A 3WNQA 2I03A 3NM4A 4CPDA 1KMHA 4DHWA 3F6CA 3VR5D 3E3NA 1J2YA 5CD1A 3IEPA 3KUXA 1E3WA 1JDBC 1ZJJA 2IEGA 3NV7A 4AJPA 5B58C 3ZOZA 4CZCA 1IK4A 3O2QB 4CIXA 1WU7A 2YXLA 3I4FA 1IV6A 1L4HA 2BHZA 1E0SA 1TNTA 1YZHA 2ZAGA 1A31A 1YV9A 2VLBA 3NOVA 3P9PA 4G5GA 4JEUA 4LWOA 5BSUA 3FH0A 1L4GA 3BG6A 1BMFA 1F3OA 1U5CA 1USIA 2GTPA 2GVDC 2X9QA 1FP4B 3FI0A 4Z4HA 3ZD6A 3R3JA 1T3ZA 4LXGA 4AZVA 2VWPA 5J3JA 1YULA 1AQUA 3S81A 3R3UA 2O5EA 3OY7A 3N0RA 1CUEA 1E2EA 3OYHA 1UJ5A 3ZKWA 2V6GA 1JB9A 2I2AA 2VUSA 1Q1GA 1WUIS 2X5JO 1L5SA 4KP7A 4DWWA 1NDQA 4YLYA 4YMLA 4CEJB 4ND7A 4DCMA 4A3EJ 4QTXA 4QM7A 3N4MA 1GPKA 5LYJA 4MVJG 3UK2A 3QFSA 1L1EA 2XPVA 1B2LA 2H0RA 3I45A 4YPVA 1T2KA 4A15A 5IT5A 1N5IA 3MMNA 1QC5B 2VNKA 2WIFA 3LO8A 1NJ8A 1VECA 1JVNA 3RSHA 1M1XB 1TM1E 2FY8A 2DB3A 4HX4A 3HHHA 1VPLA 2P41A 3BZBA 3DPLC 5IPAA 2FSFA 3ANTA 4MNTA 3I2JA 4B83A 4PZ0A 3CC4I 3TEFA 1QK4A 3KOWA 3KSAC 2ST1A 1A4UA 2NSLA 3WBFA 1DUVG 3GH1A 3SQNA 1YA4A 1WS6A 4HPQA 3NHAA 1SXJA 1U3GA 3OF5A 2H65A 3QPCA 4LJAA 4C1NA 2RI6A 1GVNB 1SOMA 3CC2I 1Z9CA 1WULS 1XI2A 4ZDPA 2D7JA 1JTVA 3OUZA 3ZHXA 1G60A 3OUUA 4C9YA 5FWYB 4AMUA 4D0LB 5FO1A 5BSGA 5JAIA 4DV4B 1PV4A 5INTA 1MG0A 3I6QA 2G08A 1OF1A 3I37X 4FEGA 2A1TR 3BS4A 1AZTA 2HZTA 1LX6A 1LA2A 4NG5A 1N36B 3USCS 2IBSA 2EQ5A 4UXJA 2DFKB 5DTRA 1F17A 1KYQA 2CJPA 2Q8NA 3A6JA 4BZPA 4REQB 1RWMA 1EZ1A 2YYZA 1QFJA 1X9HA 5DRTA 4LZZA 4Y2TA 4B3MB 2BEKA 2WW8A 3TFOA 4HBGA 3BMOA 4KZKA 4TLMB 7GPBA 3BD8A 4GKBA 1U8YA 5AI0A 5M04A 4MULA 5H8WA 3QF4A 2IU4A 1E32A 3K9BA 3GVIA 2PG3A 4E5DA 2Q5EA 2WAOA 2POQX 1C3OA 4DV0B 2XMPA 1GTRA 2GBCA 4DIQA 4DGWB 5HIAA 3CUQC 4INOA 5GONA 4BAYA 4PK4A 1BMQA 1Z38A 1VQ9I 2F17A 2RGGA 3WNBA 3THWA 1L7AA 4OY3A 4EMSA 1ODKA 2GZ3A 2PT9A 4GMXA 1U6KA 2XVAA 1YGPA 3D4IA 5DD8A 1XB2A 1Z35A 2XIGA 2P9YA 3R0JA 3GJQA 1KMIY 2LCIA 3DHYA 3ETLA 1COZA 2AYZA 4M3DA 1KVUA 4GKVA 3WGLA 1G3MA 1MC8A 2OZKA 5HEKA 1OLTA 5K8TA 5C51B 1FRQA 2ZRLA 4DIEA 1KEEB 2Z16A 1XE3A 2L19A 4UB8C 1RDFA 2ZRAA 1U9NA 3FRIA 5BV2P 3IAHA 3F8WA 3A4CA 1OIWA 2XW6A 4WXDA 2IGOA 3G73A 1IXZA 3A3KA 4HPWA 3U31A 2TRSB 4Z7OB 3FISA 3EF0A 3AL3A 1LVKA 4JX6A 3HJFA 1C3VA 1H3NA 2PJRA 4Q4HA 1VC2A 3PI6A 4WHMA 5EJ7A 5TVKA 2D4HA 3VU0A 2K4JA 3EZFA 3QUTA 4RIFA 2OWDA 2QGNA 5BP7A 1FYFA 5CRIA 5DCYA 5GV7A 5JALA 3SX0A 2GAUA 2GYYA 3PD7A 2ZGVA 4JLPA 2FSIA 3WQBA 1JEAA 1GRRA 3GVXA 1V5GA 3UATA 1E3TA 1FU8A 4O59O 3VOAA 5L3SB 1UMCB 1ZGZA 2HZ7A 3HXQA 3DVAA 5G4KA 1G6NA 1E9VA 4MQ9F 3QOXA 4OFXA 5KCMA 3S0JA 1YJAA 4IMPA 4K9RA 4G5YA 4F4FA 4JT8A 3IUQA 2JGMA 3BWBA 2RHDA 1UMQA 3KR0A 4NYIQ 2BZGA 5IBCA 3OLCX 1VE5A 4Z9BA 3JWHA 2ORWA 3E7LA 1OX5A 2GA1A 1ZRSA 3OF2A 2A6TA 3OZAA 1DJLA 3PQEA 4PC1A 2PT5A 4PLWA 4PSUA 1DTWB 3ZD9A 5FR2A 4CKWB 2NYRA 1CQIB 1H1LA 4EKYA 2VF4X 5CXQA 5JYDA 3ZQKA 4ASUD 1KVRA 4BO5A 1QF9A 3NHSA 4Q00A 4QYIB 1KEZA 3A1NA 3EZGA 2W8ZA 4A2CA 5CCBA 2HR1A 1VG9B 4NJOA 3HP4A 2WI8A 1HW5A 3ZQIA 2FN7A 3DT9A 4JOBA 3IRRA 1R4ZA 1RAAA 1KFJB 2B3TA 1JFFB 4N7MA 4Y6QA 1R0SA 3KAJA 3QKSB 4BX9A 5IHXA 1F9AA 3NBAA 4BNDB 3KEGA 3PPIA 2YNMC 4ZI3A 2GD2A 3DLIA 5FLXZ 3AHDA 3O3NB 1NLZA 2PKYX 4KQJA 1BX0A 3F46A 3DKKA 3H9CA 1PZMA 3QLUC 2PJPA 4KPGA 3CVXA 5CLSA 3HRTA 4NLLA 4WNAA 3F5FA 4UDOA 3QYPA 3EFOB 4CFSA 3UXYA 3QPUA 5D5WB 1BIFA 1BN6A 4DM7A 1T6ZA 3CX6A 4JUIA 4D9KA 1LRKA 3GCZA 2C57A 4CL3A 2LKSA 2P67A 3HR7A 1UWCA 1MOZA 4HG2A 1BEUB 3Q0VA 2V3WA 4LY9A 2JAPA 3N2IA 3GAAA 1CUWA 4P4LA 1C7QA 4CA0A 1Z7EA 2ZRBA 2CMPA 5F3RA 3X1DA 2FWAA 3ZEIA 2VQEB 1U5TC 1KU9A 3EVNA 3BGSA 3HDJA 3IDOA 5JMWA 2V1NA 2EJTA 1WSWA 2EKQA 3UG6A 2RHRA 1RUNA 2QAGC 1WH7A 3RAGA 4HV6A 1S6LA 1X7XA 4RCYA 3GLIB 3R61A 4HA8A 4XRMA 4DCNA 4G4IA 2Y2ZA 1EK5A 3M7GA 1ADGA 2M2EA 1E7SA 3BG9A 2Q99A 4WCVA 3NWTA 1DU6A 3LDGA 2PX5A 3EEYA 1M2GA 4RIGA 2JJYA 3LYLA 3M6AA 3L41A 2O8XA 5GGXA 4CT0A 4YV0A 3GP3A 3R4VA 1KEKA 2F4VB 1JIVA 1XSVA 3S1RJ 1T2UA 4X64B 2MYTA 4YUAA 3SYTA 1RKBA 4OKNA 5FPYA 1XTRA 5T6BA 4Q1CA 1ZUIA 1C4XA 3L4BC 1KMQA 3OR1C 2W2QA 5AVXA 1O03A 2BM0A 2OCLA 2DK8A 3EPRA 3HOUJ 5DSZA 3OJCA 1ODIA 3L0YA 4KGXA 4I5DA 4NU5A 2ONZA 5KUTA 2RD2A 5K0TA 1U5TB 2DODA 2M0CA 1N5OX 1PW7A 1XROA 2VPIA 4HNQA 4HPXB 3TB6A 5EHXA 1AX9A 2ZVJA 3TTYA 4RTKA 1TK9A 4MRSA 3P7NA 1MC4A 4ALMA 4MIYA 4KQ6A 3Q0IA 4QGSA 4CH7A 3AH8A 2W2PA 4IQFA 2EBFX 1MNDA 4PBSA 4CLXA 4NCIA 2CHUA 2JL1A 3Q3VA 1SAUA 3H4VA 1XJWA 1Y4AE 2LRHA 4R8LA 1H5UA 4AZ0A 5LP6A 4QYWA 3RYRA 4GPAA 4W5WA 1I2AA 2R0QC 2BR5A 2EFWA 3BSSA 2XJ4A 4MB2A 1PDWA 3TBKA 5K7SA 2FMIA 4AM3A 2XF7A 4MHOA 4PW0A 5FR1A 4CU5A 4OB6A 2DECA 3WU1B 5E8GA 4XEHA 5GGYA 5TARA 3S40A 5AW7A 5I6DA 4QASA 1G55A 1A6QA 1IEWA 1SNYA 1DZ3A 1XTUA 4QDTA 4XW2A 1LFUP 1CZOA 1NMXA 1P7ZA 2CNWA 1KMCA 2X22A 1LNZA 4HXYA 5ESWA 3S29A 1JEOA 1V25A 3PKJA 5LWHA 3H2HA 3LUDA 4AUNA 4I0AA 4Y67A 1XXHE 3EARA 3ECCA 3CZ4A 4EJUA 5EJIA 1M2KA 1X38A 4A8JA 4JYZA 4MI1A 3AC0A 2BW3B 1XQWA 3SJZA 1PT9A 1IZ7A 3VR2D 1TD1A 1N9ZA 1SOWA 4UU0A 1KJJA 1SMTA 2NTYC 3CR8A 4NAHA 1YSCA 4PJMA 1RQPA 3NNSA 4IYJA 4WXHA 5IKMA 2G4CA 2XDQB 4L8FA 3UXEA 3WR5A 4ZDWA 3ZH2A 1GVJA 1FX0A 3J81K 3ZWCA 1A5ZA 4LV6A 5IP7J 3DBVO 1ZGJA 3L6BA 1YFHA 3QIAA 3TMKA 1KVQA 3IERA 3JCZA 4IWYA 4L8LA 4OOIA 4A0XA 1EM8B 4I55F 3ZIAA 4RQUA 2FZEA 1D6NA 1C9NA 1JH8A 4O4IA 3C97A 1BH2A 3Q3EA 4KWHA 1EQUA 3F6VA 4NV3A 2CWDA 4B3XA 4J9VA 1L4EA 3NWBA 3GVAA 1UXJA 3O1LA 4NATA 5DHTA 4R2XA 2JFPA 1KP2A 3V7RA 4KLAA 4PGAA 3HPRA 2ERXA 4WXPA 3T12A 4MAMA 4G4GA 3SKXA 1ISHA 1K6IA 5AIAA 4XQEA 2OZ6A 2R5WA 1GVHA 1DKMA 4P9UA 2IUYA 5JFOA 1E1LA 4RVNA 5LMUB 1MVOA 2BFCA 1XMXA 4NHJA 3J7AY 4GP7A 4UD6A 2V1UA 4MI6A 3X1MA 4D56A 4EB6A 4RBOA 4B2IA 1X4OA 1GO2A 3IBGA 1CP2A 1ZX1A 3QE3A 5DYTA 4DMUB 5ALMA 1TIPA 4JUDX 4IJAA 5A2QA 1Z83A 3I04M 4OQFA 1ZPDA 2QW1A 4AYBN 2LKPA 4EEZA 3EXAA 1OX4B 2JH9A 3A6EA 2J6BA 3IOMA 3W05A 5LBUA 2WFLB 3CZ5A 2IPOA 2JFBA 5HGJA 2P62A 4N3AA 4P33A 5KHDA 4QQNA 1WL8A 2EZHA 3JRBA 4Q6BA 2QEQA 1CUJA 1W0UA 1QAMA 3HJGA 4LYFA 1VG8A 4CQNA 2HLDA 4JXXA 2LVSA 4FU0A 1NBWB 2X5KO 3M3DA 4BQOA 4M1WA 4KE8A 4PXYA 4CKBB 1T1JA 5CA1F 4LF5B 5C81A 2WHEA 3E7PA 1GFIA 3AHGA 3QVMA 3H0KA 3ZE7A 1YX3A 4D4LA 3P27A 3T52A 2UYCA 1C9JA 1S5PA 1CE8B 4C22A 5G41A 1Y8AA 1Y8CA 2O5VA 2ONCA 13PKA 1LLDA 2PH3A 3IAUA 2BBYA 5AXDA 2GERA 1DEOA 3CEHA 1LVUA 2R6DA 1JSLA 3ZU4A 3RADC 3OEEA 2HU5A 3O90A 2GDZA 3S8YA 1AHDP 2BELA 2ZKLA 4I8DA 3C3EA 4MUKA 3UB4A 4CMBA 3CRRA 4D5CA 4C20A 1F8GA 5TQJA 1MFPA 1OR8A 2OJED 2ZTLA 3IQWA 2XQIA 3A4VA 3R3VA 4HLUA 1JHVA 4KBGA 3JZDA 1XC5A 5TMEA 1OLUB 4HBLA 1EUQA 3PUHA 2XCOA 3L7JA 3E7WA 1RQXA 5LPNA 4W1SA 2PMHA 3DFZA 4PJJA 3OAAA 4TRJA 4B1RA 2XHEA 1UJNA 2I6UA 4ZDLA 4ZRDA 4JIMA 4L08A 4MUMA 4BRWA 4I4TB 1NXOA 1OYVA 1D2MA 1C3LA 4YG2F 2OHXA 3QU9A 2DKFA 4QUHA 1DP4A 4FCWA 4E5MA 4EYEA 2EDAA 3C4JA 4RF5A 4MS3B 4QLCU 4XQGA 5ERYA 2ZBFA 1KH1A 2HXIA 4LZPA 4PYOA 4RH1A 3SVTA 4FN4A 3BG5A 4A92A 1B0UA 2BKLA 3CT4A 3HRSA 4KT5C 1WUYA 2HJVA 4PCAA 3TJRA 2C4WA 2OFOA 4HF1A 1WCIB 4PHCA 4RHEA 2BM1A 4KPUB 5EE0A 5FWDA 3C85A 2EDCA 1PZGA 2X13A 3D59A 3TE6A 1IHDA 1P33A 2EP8A 2YW9A 1QGDA 2EFCB 2J7PA 1Z8HA 2VC2B 2QRQA 3K6GA 3EVTA 3B73A 3MGGA 4KRYA 4M7PA 2K7ZA 1Y5RA 5IMBA 3RYTC 2FSHA 3GFBA 4BJHB 2BGCA 1QZXA 1VFPA 3E5MA 1XNRB 4MRAA 5K3FA 1WZCA 1T5DX 1T8WA 1R6TA 1ZD8A 5HQ3B 4TUYB 1C3EA 4HNAA 1N77A 2QRKA 4I4TF 1RBZA 4XLEA 1P92A 1PWXA 2I9PA 3DL7A 3JQ9C 3I58A 3MWDB 3VDNB 4DLUA 1RQRA 3F8SA 3SFIA 2YINC 2WD9A 3Q9LA 5CYPA 1FS4A 3ZWKA 1P3DA 4HQ0A 3KJGA 4MR9B 3DEFA 5FI3A 5LA6B 3PQJA 2JCXA 4Z4FA 2X3YA 3ZEAA 4E30A 3GUYA 4RGSA 2WU8A 4QYXA 2JLWA 1X7XB 5C4XJ 2QUHA 2VZ8A 1REPC 3VSCA 3PLAE 2H29A 3DVSX 5B36A 4C0XA 4HVCA 4LBVA 4OU4A 4A23A 3BE5A 4JY7A 3WGVA 5A02A 1IC8A 4TMVA 1W36B 2LKXA 2O6LA 3FYUB 1G9SA 1Y1TA 4OWRB 3V8RA 4MGZR 4BQSA 3REQA 3NTVA 3G59A 4YACA 3LFKA 3VO1A 2XNKA 3EGDB 4LPSA 4X8OA 2D62A 2NXJA 3HKDA 3PJEA 2R1TB 4DAOA 3DBRA 1WCYA 4ZT4A 4FZ3A 2NNYA 1EEHA 1FNDA 2FJ1A 4MVJE 3CLSD 1D2CA 1Y5NA 4FGLA 4NK5A 3SF8A 1TYAE 1Z3YA 4EW2A 1SIUA 5HM6A 5BW6B 3W06A 3BXFA 4UNOA 3DG9A 3H86A 2QMOA 4HYEA 3W6KB 1SVSA 2R4TA 1TZJA 4KIBA 2VRWA 1N2XA 2VPRA 2XOKD 1BOOA 2Q2EA 3N28A 2QMZA 1D9ZA 1NVBA 2A35A 2DUNA 2YHSA 1RSZA 1UBGA 4Q0MA 3RCBA 1XX5A 2VHXA 3DAHA 4KGDA 3HTSB 5DX1A 3BL6A 2DVMA 4X54A 3Q9SA 2ZIWB 3I83A 4CF3A 3F8FA 2ZIEA 4RMNA 1W36C 3T41A 5JAOA 2CXTA 1XHFA 3HDQA 5C5DA 4KFCA 4EHNA 2QXTA 2NO9A 5BXQC 3LL4A 4CLRA 4ALNA 1EUCA 2ZUTA 4QG7A 1L3LA 1GKLA 1UMBB 4Q3OA 3KKZA 3S4YA 4KMMA 5FFZA 3WO1A 4A3MJ 1W36D 2I1LA 2MSLA 2DAOA 2GN2A 5LN1A 3FZNA 3HGQA 1BU5A 2IKQA 3EF1A 1UHWA 3CEAA 2BKAA 3F6PA 5TGDA 4CTKA 3HSYA 3SQLA 5KYNA 1CVLA 1NYRA 1UK6A 4LJRA 3EVZA 1UDBA 3ZWOA 1ZJ4A 1U3WA 1A7AA 3FDJA 2VDQB 4I99A 2DPDA 1S8FA 1UWLA 3ABOB 3P19A 2DKOA 2GOXB 4N47A 1TA4A 4YYEA 4M9RA 1N3YA 5JE8A 2I6FA 2OZUA 1E4OA 3W2HA 4YXWA 1ZSYA 2F5VA 1QQAA 1MRZA 3D6AA 3TLBA 2BFBA 3CFYA 1E1CB 1NQUA 4FLEA 1N8KA 4DQKA 4ENSA 3TLZA 2PKQO 2I9KA 1N5JA 3RZDJ 1WB6A 1DAHA 3AERA 2ZB4A 1JHZA 4IO1A 1EP9A 3AZPA 4Q9IA 2HYGD 3AKEA 5K0SA 1S7AA 1OKKD 5JYEA 3VDXA 4P32A 2ZWVA 5E7IA 2MINB 2PK3A 3RSNA 1KI3A 2HZDA 2OTLI 1NRWA 3F3KA 5TPWA 4XAQA 4BQRA 2BMVA 2O3QA 5BVGB 4DBVO 3CRVA 4MI3A 2E1RA 2AXPA 1PR6A 3LDAA 4B76A 1Q0HA 3QKTA 3QUCA 4CW7A 2XDYA 2JCBA 2YVUA 1AS3A 1RP7A 2CLOB 5LMZA 3RUHA 1AB5A 1UKEA 3HJAA 3R7DA 4AIHA 2BE5F 1PWHA 3KKEA 3RS5A 3CEPB 2XGMA 1SG6A 1XZAA 1SXJC 2FF5A 2OBPA 1YL7A 2PZEA 1MNMC 4DLLA 1PJSA 1GZ4A 2EK5A 2ZWPA 1MTOA 4R1TA 1M83A 2Z57A 3SMQA 1N6NA 4W8GA 1W44A 4GZ3A 3J80Z 3N0TA 1KBOA 1K86A 3A1CA 1WPKA 4R7ZA 3E22A 3ZH9B 4EY5A 3PT5A 1EWVA 3OWXA 3CH4B 5ALDA 4ZODA 5BRNA 1CJMA 4I4LA 3UUWA 1H0HA 1S3IA 2JGEA 3FCCA 4NBNA 4MSUA 2COEA 4ON9A