3H9JA

Crystal structure of e. coli mccb + ampcpp + semet mcca
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
348
structure length
339
Chain Sequence
MDYILGRYVKIARYGSGGLVGGGGKEQYVENLVLWENIIKTAYCFITPSSYTAALETANIPEKDFSNCFRFLKENFFIIPGEYNNSTENNRYSRNFLHYQSYGANPVLVQDKLKNAKVVILGCGGIGNHVSVILATSGIGEIILIDNDQIENTNLTRQVLFSEDDVGKNKTEVIKRELLKRNSEISVSEIALNINDYTDLHKVPEADIWVVSADHPFNLINWVNKYCVRANQPYINAGYVNDIAVFGPLYVPGKTGCYECQKKENIDHKIKLINSRFKPATFAPVNNVAAALCAADVIKFIGKYSEPLSLNKRIGIWSDEIKIHSQNMGRSPVCSVCGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/antibiotic
molecule keywords MccB protein
publication title How the MccB bacterial ancestor of ubiquitin E1 initiates biosynthesis of the microcin C7 antibiotic.
pubmed doi rcsb
source organism Escherichia coli
total genus 107
structure length 339
sequence length 348
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1160 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3h9jA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3h9jA02
3DZKA 2VUTA 2VHZA 3DFUA 4ALJA 1HDCA 1GADO 1Q1NA 2O50A 2YQ5A 2NVUB 1HRDA 1LC3A 2H5LA 1C1XB 4N7RA 5G0VA 3ZWOA 4YQYA 1U7TA 1PWZA 3HDJA 2DQ4A 1JN0A 1Z74A 3WGGA 1ZK4A 3PHLA 3HN2A 3I9KA 3RBXA 4BOYA 4DC0A 5ES3A 5I9MA 1ARZA 1XQ6A 3LVFO 1K2WA 2IXAA 2Q1WA 1XR3A 2Q46A 4E5MA 3GVIA 4MO2A 4CM5A 3LT4A 9LDTA 4Z0HO 3IUPA 3I4FA 3IMFA 1HDGO 2E82A 1FDWA 3Q2IA 5KVCA 5KJ1A 4MVJP 1MFZA 2O3QA 3KSDO 4N5MA 4E6PA 1ADCA 4AICA 4J1SA 6LDHA 1ISGA 3CINA 3KRTA 4BO6A 4F3YA 4YT5A 3SJUA 3PHJA 3TDKA 1NAHA 3E5MA 4MP8A 3EUWA 1BG6A 3K8ZA 3JQ9A 5TGDA 3GPIA 3WNVA 4RGBA 3ZWMA 1NM5A 3IDSA 5DBFA 2JFGA 1H6BA 3W4JA 1MC5A 4RLHA 1O89A 3ICPA 1MP0A 3Q9NA 1T4BA 2CD9A 2VRCA 1WVGA 2ZCUA 2H63A 3GOHA 3ZWPA 4JJFA 4I5EA 5JAMA 1H2HA 1Y8QA 3WIEA 3ZHBA 4J7XA 4I9NA 2Y0DA 3PWZA 2Q45A 4ID9A 5BNTA 3ADOA 1D3AA 2V6FA 2IEDA 5TQVA 4UEOA 2EV9A 3BMOB 1W73A 4RL6A 4U5QA 2WJPA 3SBOA 4Y6RA 4E2ZA 5EL0A 4LN1A 4CLOB 1NNUA 2EXXA 4BKUA 1W8DA 2J3IA 2JD0A 5JC1A 3KB6A 1XGKA 1R0LA 1IUKA 1MA0A 3KXDA 3PPIA 1HE2A 4GBJA 2IRWA 3Q11A 3NKLA 4NJOA 1EUZA 2IDZA 2B5WA 4WGGA 3U4CA 1HYGA 4NDNE 1Y5MA 3DEYX 4J0EA 4ND4A 1GZ4A 3WSWA 1IE3A 1UP6A 1P44A 3FWZA 4PZEA 1E0DA 1XYGA 2V6MA 3DHYA 3QVOA 5A9SB 1IZ9A 2FY8A 3MWDB 4HP8A 4NHEA 3H9JA 5HS6A 4RDIA 3WG9A 3WX0A 3LZ6A 3BTSA 1Q2XA 2CSUA 2W2LA 4CUJA 4BO5A 3BHMA 4RPKA 3KYCB 3D4PA 3E6AA 2FOIA 3RUFA 1T2CA 2WDZA 2GERA 4U6SA 1X14A 4B3IA 3GGOA 1BRMA 4O63O 4YJHA 3QW2A 2WE7A 3AI3A 1VI2A 5IAAA 3OJOA 3GDFA 1ZO8A 3WWYA 5JYDA 3UUWA 2GZ3A 3RU9A 1M66A 3EW7A 1DEHA 1F14A 1R15A 4BNFA 3RJ5A 3QWAA 4CMHA 4QSMA 5G2OA 1P1FA 4J1TA 3TOXA 3HWRA 3JQ7A 1E5QA 4NMHA 1E7WA 4ALMA 4ZQFA 4E30A 5L3ZA 2J3KA 3VDQA 3PQEA 2BGLA 5TSDA 1G1AA 3ADPA 5KCZA 1NBOA 1VJTA 4JJGA 4NK4A 1Y5RA 1R4MB 3COSA 4AJHA 1HZZA 1BSVA 1PTJA 2X9GA 1LU9A 1U7HA 4KQWA 2GASA 4CR6A 2ILTA 1UH5A 2VZ0A 2ZB3A 5IG2A 4QO7A 3FNEA 4L73A 4C4OA 1DO8A 1UXJA 2C7VA 3LDHA 2BI8A 2WTBA 3RUIA 3WTCA 5HS4A 2A35A 2UVDA 1SEVA 1FK8A 4KZPA 4CV3A 1DHTA 3H3JA 4IZIA 1GAEO 4OH1A 4BGUA 4IXWA 2XPCA 5L95A 2X23A 1VKNA 4U8GA 2VHWA 3K5PA 5JAZA 2EW8A 4W9NA 1KC3A 4WUVA 4GL4A 3EC7A 4Q3DA 1ZW1A 2J5KA 4A0SA 5U4QA 1EE9A 1ADGA 2BFPA 2V6GA 3WJAA 4AJ4A 4X54A 3H9GA 3UXYA 4XYGA 3RKRA 3FRJA 4B4OA 2D0IA 3E8XA 1ADFA 4PLYA 1LSJA 1KOLA 2O3RA 3L9XA 4NBVA 4D42A 2IZ1A 1I01A 1GQQA 4DLLA 2EIHA 3JQBC 3K31A 3K96A 1O94A 3NTOA 4ZQEA 1Z75A 2QX7A 4R54A 5CG1A 4MKZA 1PSDA 3ZNNA 2YDYA 3C1AA 4HNGA 1DXYA 2R6JA 3R3JA 3GGGA 4IY1A 5JYEA 1NHGA 4HFRA 3JQFA 2EGGA 5H83A 4Q3AA 3LSYA 1OC2A 5I9LA 3RD5A 3W6ZA 1A27A 4BNNA 2ZTLA 3QIVA 5F3RA 3CXRA 2ZYDA 1S7CA 2GGSA 3GK3A 2P5UA 4MPDA 1J0XO 1D8AA 1DRUA 1K0UA 4JP2A 4ONEA 3ZV6A 1FDTA 4H7PA 3RUAA 1VC2A 3GPDG 4FD3A 2O2SA 1NASA 4CL3A 4CM4A 5JXWA 2RH4A 2G76A 1SOVA 4BQRA 5DZSA 1U8FO 4F6LA 5IZCC 3FBGA 3VPHA 4IM7A 3FR7A 3MOGA 1P77A 5FF9A 4GWGA 5AVOA 3UVEA 1Q0LA 3ZCXA 1O5IA 3JD1A 1B8UA 2WEKA 1IPEA 2EKPA 2G5CA 1HDZA 4XD2A 2OORA 4A26A 4DTIA 2X5KO 4AJPA 1CEQA 1NTOA 3BZUA 2AW5A 3EZYA 3D3WA 3U3XA 5ILGA 1SEPA 3OJLA 3GGPA 3I6IA 3PQFA 5GZ3A 1R4NA 4BKQA 1QKIA 1NX6A 3L6EA 2Z95A 2HMWA 4HY3A 2FSVA 1ISHA 2X0RA 2NLOA 4OYRA 2PFGA 3KLMX 4TSKA 3KO8A 3ITDA 4R1UA 3CMMA 5BQFA 4XR4A 3VTFA 3BHJA 1DIAA 1T25A 1PGJA 2O48X 4KUGA 2EP5A 2PH3A 3WLEA 3E9QA 5JDCC 4AJ1A 3WXBA 3GQVA 4QUKA 3PLNA 5BSFA 2PD3A 1PQWA 4Z9YA 2RHCA 3QWHA 3TPCA 2YV1A 5COBA 3DL2A 1M75A 1RM5A 4XA8A 5K0ZA 4FN4A 4CLRA 1IHXA 2Y1FA 2YY7A 2PGJA 3DBLB 4LISA 1XA0A 1ENOA 3DR3A 1YWGO 1UZLA 4GX2A 4FQ8A 3UFXA 3PI7A 3OBBA 1X1TA 3DOOA 3DDNA 3OQBA 3JYNA 3E18A 2WD8A 5JMWA 3LF1A 4MVJG 1SB8A 2Y1CA 2PH5A 4UUPA 2EKQA 1Z7EA 3ZU5A 1PL8A 3DOCA 2NVUA 5T64A 3GNSA 1BHSA 1HSZA 1ONPA 3DZFA 5EN4A 3GA0A 2HU2A 1NWHA 4B4UA 1ZXLA 4J4TA 4QXMA 1YL5A 3JQAA 4G2NA 1I3LA 1E7MA 4FC6A 5MDHA 1T2DA 2C29D 2A92A 3W1VA 2IXBA 3VH2A 3DC2A 2GR9A 1GCUA 3MCVA 5B4TA 1YBVA 4D7AA 4YCAA 4D3DA 3LC2O 3RIHA 3KYDA 4YTEA 4AL4A 1DDOA 1QXSA 3U62A 2OFPA 2AE2A 2UV8A 5G0TA 4YACA 1GUZA 1E1LA 4GVXA 1PJQA 4AFNA 3GEDA 5JY6A 1GTMA 2Y67A 2X8LA 4BO1A 3ZN2A 5JNLA 2OHXA 4OMUA 4HBGA 3AI1A 3AU8A 4DYDA 1B8VA 4B4WA 1EK5A 2VNAA 2QQ5A 1C0KA 1CQIA 2PGLA 4NU6A 1LLCA 5EQFA 3C7AA 4E21A 2O3SA 3AUSA 3PFWO 4CMGA 3C85A 4U7WA 2BGMA 1GPDG 3FF4A 4FDAA 4NH4A 1YONA 2ZJ0A 3OFSA 3OIDA 4INAA 4YBZA 4CM3A 3ZNPA 2FMUA 3JD2A 3KUXA 4Y9DA 1LLUA 3U4IA 5B4VA 3JQDA 3WGQA 4NQZA 1U9JA 4C7JA 2NTJA 1X0VA 1N7HA 3VDRA 2QRLA 3TQHA 1P9LA 1LI4A 2DKNA 3PIDA 3DBRA 1GR0A 2GDZA 4J7CA 3OQ6A 3I6QA 4R01A 5KOIA 2I76A 1VRWA 1ZVMA 3HFGA 1R37A 1V6AA 4XYMA 5T6BA 5A9SA 3IKVA 1E3LA 1E5LA 3AFMA 2FPGA 1M2WA 4PG5A 3F4LA 4RDHA 1D4FA 1HLPA 1H5QA 4BNIA 3SEFA 3QE3A 2GZ2A 4YJHB 2DPHA 3I9JA 2YDXA 2PD6A 3KYCA 5KVVA 3RUCA 4CMCA 1YQGA 7ADHA 2HCTA 3AM3A 4BMSA 2X0JA 4CLDA 3ZWNA 4NBUA 4ALIA 4W9NC 2X0IA 3IUSA 1PQPA 2I6TA 3JQ7B 3LT1A 1W0CA 2P4QA 1SNYA 3EY4A 3K2BA 2DBQA 4HFNA 1DAOA 2CDBA 3NT5A 2O7SA 4IGFA 5JO9A 1N2SA 1Z82A 4EI2A 4FB5A 2XF8A 1XU7A 1N8KA 2W90A 4YDRA 2JCYA 1VKOA 3EZLA 4JLWA 3RWBA 4IDGA 4CLHA 2JHGA 3F9IA 5H81A 1I30A 3MJSA 3ROPA 4RZIA 1ZEMA 1RPNA 3VVBA 1H93A 4U6QA 3ZU4A 2Q50A 1R4MA 2GCGA 2Q99A 1EVZA 2X5JO 3HSKA 4BNVA 1UAYA 3OEWA 4OL9A 1PJ2A 4MIOA 1DC6A 4ALKA 1VL0A 1LQTA 4J0FA 1NPTO 4XR9A 4IS2A 2FWMX 2ZB7A 4LSMA 4ZN6A 2I3GA 3GDOA 2GRAA 3PZRA 3W8EA 3FI9A 1UDAA 4E0BA 5EIOA 3WR5A 3PJEA 4XDYA 4YT2A 1R16A 2OGUA 5BSHA 3ZNQA 2JCXA 1NPDA 2HJSA 1F06A 1G0OA 1YQDA 4PGFA 4WK6A 4J2HA 3RROA 2V65A 4H15A 3QHAA 4XYEA 1ZNQO 4TKMA 1HETA 4E2WA 5HTOA 1TEHA 1ULUA 2GN4A 2I66A 2ZKLA 3KZVA 3OECA 4CM8A 2O3TA 2WYVA 4WNIA 2D2IA 5A9RA 1IL0A 4GX1A 1I24A 3GMSA 3O26A 1PU2A 2GNAA 3AUTA 2XXJA 3VC7A 4BMVA 3WIDA 4YQZA 1A9ZA 1Y1PA 1B14A 2GSDA 2NVWA 2OBNA 4TRJA 1HTBA 4MIEA 3WSVA 1UUFA 1GL3A 5TIIA 1F8GA 2HKIA 1ADBA 3AU9A 3E5RA 2POQX 1U3WA 5TT0A 3ZWCA 1H2BA 3PVZA 2VRCD 4PG6A 4DIBA 2GUGA 3ZV5A 4GLOA 1ZIDA 3FPLA 2CUKA 1NPYA 1SCUA 2GO1A 4F45A 2YYYA 1HDOA 4G81A 1IULA 4ND5A 2C0CA 3ZU2A 1DLIA 2JAHA 4BKPA 4TZKA 2D8AA 2I5PO 4Y98A 4EEXA 2PNFA 2TMGA 3TZHA 1YGYA 2X5OA 5DCUA 4B3JA 2R00A 2PKQO 5I7VA 3KETA 3HADA 3LC7O 3VZQA 2G17A 4BNJA 1SPXA 4UUOA 3W8FA 1WW8A 4WCFB 4DPLA 4YRAA 3P5SA 4EUHA 2UUOA 3O8QA 1BW9B 1LNQA 2NQTA 3IJRA 4CV0A 2ET6A 4PRLA 4J1NA 5I7SA 4BNGA 3M2TA 5A4DA 1P74A 3GFGA 1X13A 3I1JA 4MJLA 1DHRA 1ENYA 3PHHA 3ABIA 4GKVA 3DAFA 1R4NB 2W2LD 4CLOA 4DLAA 4DBVO 4I9UA 3RKUA 4CQMA 4E33A 3OIFA 4L0QA 4BNTA 3GRKA 3O03A 1HE4A 2ZB4A 4IDAA 2C07A 2FN7A 3S1LA 4QTZA 4NK5A 2GLXA 2PD4A 5IFLA 4IIUA 5I8ZA 3PHGA 4BHTA 3B70A 4EYEA 4MINA 3EVTA 4XQ9A 3LF2A 5ENDA 5K6AA 4NBTA 1RKXA 3RAJA 4KDEA 1U3TA 3GUCA 1R12A 3ZWBA 2SCUA 1TLTA 2B69A 3HQ4O 2PK3A 4Z6KA 5CDYA 1XIVA 4JNKA 3OF2A 4BKRA 3F1LA 4HWKA 3UCXA 4YRBA 1EK6A 1BDBA 3F47A 1PS0A 3T4XA 2NADA 3PYLA 4AVYA 3RUHA 2ZYAA 4CLRB 4GGOA 4NG5A 4AJLA 2IEBA 1DIHA 1DIGA 3R1IA 4IDBA 2ZYGA 3KTDA 1WDLA 1PJCA 3M6IA 1D1TA 3H9UA 5GMOA 1LTHR 2GF2A 3A4VA 1UP7A 2P2SA 4FPXA 1IY8A 1LXCA 5IXSA 1QLHA 1EFKA 3VTZA 2D3TA 3AY3A 3BTUA 3JD3A 3V1TC 1I8TA 5F21A 3PIIA 1XELA 2DM6A 1O8CA 1ORRA 3TZQA 3H5AA 1DSSG 4J3FA 4XJTA 5T67A 3ZWAA 1UXGA 5L4NA 4Y8VA 1I3NA 1YOVA 1PGOA 2OOSA 2NWQA 3H5RA 4Y67A 1P3DA 1W4ZA 4KP7A 3GNTA 2QG4A 3F3SA 2Q1UA 2GN9A 3JQAB 1LDNA 1CJCA 3PHIA 2AEMA 2UYYA 3GZ4A 1JKFA 1MB4A 3GEMA 3SX2A 4I5GA 4DQVA 1TT5A 1Z45A 3PLRA 4LMPA 4BNKA 4IJVA 2OXIA 4ESOA 5C7OO 3KYDB 1RYDA 2HUNA 4A73A 3JV7A 4BNLA 5C5IA 4PIVA 4ZQHA 4IQGA 1GYPA 4NI5A 4J6FA 1ZZEA 4HKTA 4CM1A 3E1KA 3PFFA 4UVEA 1IYZA 1P1RA 5IDYA 8LDHA 2DTEA 1D7OA 3FNFA 3JQ8A 2QYSA 2JAPA 3ZWXA 3BTVA 3L4BA 3STHA 3LU1A 4KOAA 3KYBA 1ZK0A 2D5CA 3QVXA 5C7IO 1C0PA 1PWXA 2QRJA 3WFJA 5A04A 3AOEC 5J23A 2WE8A 3HNPA 4XKJA 3GF4A 4E2XA 3C3XA 5L45A 1OZAA 2YFQA 4ZICA 2HDHA 4EZBA 4RPLA 3OEYA 4J43A 1PJ3A 3FBTA 4LCEA 4M87A 1BDMA 2C2XA 4PLFA 5TC4A 1XWFA 3D7LA 3DBRB 2JHFA 4OKNA 1E92A 4QQRA 4DWVA 1VJ1A 4LCJA 1KEPA 3B6ZA 4CMBA 5K9ZA 4YEDA 2YUTA 4JK3A 5TJHA 3C24A 1ZH8A 1OI7A 4GLLA 2B35A 1CRWG 3TJRA 2Y05A 1XQ1A 3PGXA 1WP4A 1Y81A 3DZBA 1AHHA 3GZNA 1SO8A 1E1KA 1DPGA 3TOZA 3GDGA 2EP7A 3GHHA 2E4AA 4NZ9A 4XDZA 2ZJ1A 3QVWA 3UCFA 3GEGA 4TROA 4I5DA 5DF1A 1WDKA 2HK7A 3DMTC 3GVPA 3FHLA 4XQGA 4JIGA 1DAPA 1NVGA 3M1AA 4IMPA 5TJ9A 4EJ6A 5GZ1A 5ICSA 1LRJA 4IDEA 4D3SA 3QA9A 1T1RA 1DFIA 3OMLA 4OOFA 4WNCA 5TNXA 4Y6SA 3RI3A 4E4YA 1O0SA 3I3OA 4TMFA 3IQDB 2Y1OA 2E48A 3JQCA 1QR6A 3FNHA 4FCCA 1UZMA 3H3FA 4RV9A 5COQA 4OXYA 1ZJYA 1I33A 3ETGA 3FTNA 4QEDA 4WE3A 2H6EA 3VKVA 2RH8A 5COAA 3GHYA 3DFZA 2NM0A 2ZK7A 1E7RA 2NUAA 4EW6A 4CMIA 4B8ZA 1PX0A 2FR0A 4K6FA 4M49A 4JBGA 4PZCA 3ZHZA 2AQKA 1K3TA 2VYND 2O2YA 1VL8A 5L7WA 2Q4EA 1YB5A 3S2IA 1FXSA 1SBYA 4M89A 4BO4A 3PEFA 2B83A 5TS3A 4GH5A 2QW8A 3WNQA 2X58A 2Q4BA 1LRKA 3HB4X 2R00C 4D44A 3AUUA 4GVLA 3JQAD 1YBAA 4UULA 1A72A 2W2KA 4NFSA 4ROSA 3PK0A 1MUUA 4CM8B 4FFOA 3CPSA 5LC1A 4UUMA 3SLKA 4EUEA 4BNWA 3PRJA 3RCBA 3W8DA 3KVOA 4TVBA 2QIOA 3VH3A 2VZ8A 3PTZA 4GQAA 2NU9A 4E3ZA 1U5AA 1N1GA 1I2BA 4BO3A 1AXGA 4ZQGA 2JD2A 1L1FA 1KVRA 3GVHA 3GT0A 2XOXA 3PDJA 2G1UA 3ZGYA 4II2A 1B15A 2AQIA 4LSWA 4N54A 2HMUA 5TT1A 1JLLA 2NU6A 2HK8A 3ZH2A 1CETA 3TZKA 4RVUA 4CODB 3WGZA 1DRVA 1A7AA 1YJQA 4TKLA 4K6CA 5IF3A 1LSUA 3WBFA 5JDIC 3IJPA 4XYBA 5THQA 4TZTA 4RVGA 1V0JA 2FZWA 4EITA 4GPD1 4XZ3A 4EJ0A 3FN4A 3G1TA 3QQPA 2CF5A 3AOGA 3LLVA 1EVJA 4IBOA 1LEHA 2VWGA 4OJNA 5DCYA 3X2FA 1U2GA 1N1EA 2HK9A 3V2GA 2PZJA 1A4IA 1U3VA 3ZW8A 1VSUA 3O8QB 4W4TA 3NDJA 3P7MA 3P2YA 5GY7A 1E7SA 3QWIA 4WCFA 1JKIA 3G49A 2DBRA 2Q2QA 5EMHA 1BW9A 5HA5A 4D0RA 2ZB8A 2VNSA 3AJRA 1NQAO 1Y9AA 3OETA 1F17A 3E82A 3H8VA 1M67A 2QYTA 1PGPA 2J8ZA 3WFIA 2O4CA 1H6AA 4PZDA 5DNAA 1P1IA 2BLLA 4CQMB 2BKAA 1NR7A 1QRRA 2VTEA 2YHUA 4KMSA 4M54A 5THKA 1M6HA 1P31A 3LQFA 4R9SA 5ADHA 2VYVD 3B1FA 4DLBA 3IS3A 4YJGB 2OO5A 4FFMA 3UGKA 2J3HA 4MKRA 1NP3A 3U5TA 1QYXA 2VN8A 3BHIA 3WLFA 2EHDA 3H65A 3JD0A 1WWKA 1AE1A 3AM4A 4CMEA 6ADHA 2FPIA 1GQYA 4W7HA 4MVJM 3H5NA 1HE3A 4IJWA 8ADHA 1HDXA 4AJKA 3U49A 4BNZA 1E3EA 4CLEA 4KTVE 1PJ4A 1HEUA 4OKIA 3ZZNA 3PJGA 1QMGA 2VWQA 3IC5A 1YJ8A 2CF6A 4YR9A 4YAJA 4YA6A 5BT9A 4BO9A 5JY1A 1CQJA 2DFDA 4J4BA 3WWZA 4JBIA 4WOKA 5JPIA 1PR9A 2O3JA 3HDHA 3UICA 4WLEA 2FPPA 2DBVO 3QVTA 3KOUA 2PZLA 3JQ9C 2F1KA 2DAPA 2VT2A 4K26A 4UUNA 3DO5A 3CTMA 3AFNA 1D1SA 3U4HA 4LVCA 5JMPA 1UZNA 1P1JA 5KKAA 1F8FA 3UF0A 4MVJI 4MDHA 3VOSA 2DLDA 1A71A 5JC8A 3NV9A 2VYNA 1KVSA 1YOVB 5G0SA 1HDYA 3HDQA 2JFFA 4WECA 3FWNA 4MVJE 5JO0A 1OFGA 4XRRA 3P2OA 1G6KA 2FSSA 4BMNA 4FJ2A 1ZSVA 3I52A 3OA2A 4A5OA 2Y0CA 3H7AA 3MWEB 2YW9A 3H4VA 3M1LA 4OHUA 4YJDA 4JJIA 1TT5B 3OIGA 1T2FA 4PLZA 3DQPA 1DIBA 1O6ZA 3G17A 3U0BA 1TA4A 4DPMA 1LSOA 4DL9A 1V3UA 3G0OA 5DCWA 3BMQA 3RFTA 1JWAB 4EEZA 1KVQA 4EDFA 1V35A 5FI3A 3E48A 3NGXA 3GVCA 1GQ2A 3UHAA 3EDMA 4TWRA 3ZHXA 3R6DA 4L76A 1PR3A 3CEAA 2QRKA 3ANMA 1WAMA 3UW3A 4YAGA 1EDZA 1TVEA 4YWJA 3RUDA 1KVUA 3JQ8B 4TRNA 1GYRA 2NNLD 1GZ3A 1U3UA 3L07A 4P22A 1E6WA 3GG9A 1ZFNA 5T57A 4BKOA 1ZSYA 1HXHA 3DOJA 4G5HA 4JN6B 2AQ8A 4RPJA 1LDMA 2PGDA 2Y66A 4NU5A 5CP8A 5DP1A 3X2EA 3WMWA 4D45A 3GRPA 3K30A 1T26A 1LDBA 1RM3A 2VOEA 3GN1A 4DVJA 1Y9EA 4JROA 3PGJA 5KNLA 2OMEA 1GPJA 4P38A 4ZA2A 4YXFA 4HXYA 4ND1A 3H9QA 4PVDA 1A5ZA 4JP3A 1HYHA 2IYOA 1C3VA 1PEDA 4DA9A 2GZ1A 2J5QA 3S8MA 4J9UE 1BXKA 1QP8A 4MP3A 4KWHA 4IZHA 1CIVA 3TF5A 1NVTA 1ENPA 1MG5A 3DONA 3PWSA 3VPGA 2EF1A 4LGVA 4DIFA 3KV3O 3I23A 5L9AA 3WQQA 1E7QA 5B37A 4UREA 2Q2VA 1J5PA 3I4CA 1GZ6A 4IGEA 2ZCVA 4FS3A 3PQDA 5BSEA 1QG6A 1T2EA 4ZVVA 1DRWA 5ICMA 3GZNB 4NPCA 4UEJA 2HMSA 1PIWA 4CQMD 1I36A 3QP9A 5EQDA 3QJ5A 2PR2A 2VYVA 1DOHA 1JW9B 1MGOA 1ZMTA 2VCYA 4ZU3A 3JYPA 4ILKA 3DWFA 1R0KA 1E1MA 3GH3A 4FBGA 5KWEA 1K89A 1X1EA 4FOOA 4CQLA 1KIFA 2VHYA 4AJ2A 1HZJA 1FMCA 4PLGA 1JVBA 3I83A 1SAYA 1W6UA 3MEQA 3U9LA 4FIZA 4DQUA 4FFLA 2GN6A 2BFMA 4EJMA 1CYDA 2PY6A 3F46A 3IKTA 1EDOA 3LT2A 1LBEA 1NFRA 1GFSA 3OP4A 1WMAA 2EJVA 3AWDA 1T2AA 3MZ0A 3TL2A 3IL2A 3BTOA 4WEOA 4NR0A 1GUFA 1MV8A 2RHRA 2VZ9A 5JAIA 2IODA 2UDPA 4ZJUA 2EEZA 2CFCA 2X7HA 1B7GO 4BV8A 1NFQA 4WEQA 1XCBA 3L9WA 1KVTA 3E9NA 1QYVA 3G79A 3DZIA 1ISJA 2AEJA 3JTMA 4FSHA 4D79A 4CMIB 4IINA 4NBRA 4RZHA 1EVYA 3WQRA 2PKQP 2YV3A 1PL7A 1H6CA 4J1QA 5CDSA 5I8WA 1BVRA 3JQFC 3DZJA 4P8RA 3SC6A 3VAZA 2X0NA 5CHEA 4D0SA 3CZMA 3C1TA 4N18A 1K6JA 3QV1A 2P68A 2EJWA 3CUKA 1E3SA 2WM3A 4R16A 4L9RA 1H0KA 1BWSA 5IN4A 5MGBA 2BFAA 1YO6A 4CL8A 4DXHA 1X15A 2W2KB 3QSGA 1U28A 4XJSA 4YRDA 5DN9A 2F00A 2FRDA 3D1LA 2BMAA 2DTDA 3C7DB 4QFDA 4DC1A 2RIRA 2AE1A 5KJEA 3C8MA 3ST7A 1HKUA 1P1KA 4WCFC 4M8SA 1J4AA 4IMRA 5I9NA 2FHSA 2J3JA 3RQSA 4B7XA 2VWHA 4UVDA 1JAYA 2AEFA 4FFRA 5G0UA 3ZU3A 4EBFA 3JQEA 3DXFA 3HJAA 2HO5A 4GI2A 2VWPA 1U8XX 1HF3A 2D59A 1ENZA 1HYEA 1JU9A 2DPGA 1KERA 3AY6A 3CIFA 3MOIA 4Y6PA 1OBFO 4FGSA 1PZGA 2RCYA 4R1TA 5A05A 1LC0A 1NQTA 5ER6A 3K2EA 4BO7A 2Z1NA 4AJOA 1ZEJA 1PS8A 2VTDA 4LMRA 1ML3A 1DC4A 3BXXA 3MJEA 4IDCA 1XG5A 3WJ7A 5KVQA 1H9BA 7MDHA 2CVZA 4H3VA 1S6YA 1U2DA 3GNQA 4E5PA 3RFVA 2OBYA 3D0OA 4ALNA 4XGNA 3G1UA 1ONNA 2CVQA 2DTXA 2OP0A 3EGOA 1NVMB 4IDFA 5L7YA 2W8ZA 4NFHA 5CPFA 1DFGA 2GPTA 1RM0A 3OSUA 3UN1A 2LDXA 4Q3EA 2YHIA 3BMNA 1B0AA 4MKXA 1PJBA 1ZK2A 2PLAA 5B4UA 1I5RA 4M1QA 4HFMA 3VKUA 5AXAA 5CEFA 4I5FA 5C7LO 5L4LA 4OM8A 2I3AA 4IQ0A 2A9FA 4CM6A 1HLDA 1IZ0A 4J4HA 1C1DA 1QV7A 2BFOA 4O1MA 3VH1A 3I9OA 5CDTA 1AN9A 3TSCA 3FTPA 4HADA 4PVCA 1L7DA 4JX8A 5FYDA 3WGIA 3AY7A 3JQGA 4RJTA 3GAZA 2A4KA 1XLTA 2P4HX 1MFPA 3WGTA 1DBVO 4E32A 4YAIA 3V1YA 4NNJA 5LDHA 3WDSA 4YJGA 3B1JA 3WTBA 3TN7A 2YQ4A 2I67A 5HRUA 4PLTA 3DAGA 4PLVA 4LRSB 4YJFA 1VM6A 2HSDA 4MVJH 2H9IA 4OQZA 1EUCA 4XIYA 4R9RA 2OZPA 3JQBA 1K5HA 2O23A 3OJEA 3E9MA 2C7GA 5A1TA 2HRBA 3NJ4A 5L53A 2YJZA 5ENVA 1EZ4A 1I32A 3QWBA 1E3IA 4WLFA 2CDCA 1QYCA 4FC7A 4JQCA 3ZI0A 2BI7A 5B1YA 3HB5X 1UXKA 3NDIA 3RASA 4A7PA 1KETA 2RBEA 4CM9D 5FI5A 4PG4A 1V3VA 4XQCA 5ITVA 4N5LA 3NGLA 5IZCA 4S3MA 4BGIA 4AG3A 4PLCA 1A4UA 4L75A 4MOWA 1FDVA 5FFFA 5H82A 1BGVA 3GUYA 3JCZA 3ZV3A 3UCEA 5JS6A 3HG7A 3WB9A 3TWOA 1JWBB 3NT4A 3NX4A 1DC3A 4K1LA 2VT3A 4P4LA 3N74A 5IZ4A 2NV6A 1LRLA 2WD7A 4RLSA 4XEHA 1UR5A 2WYWA 4N5NA 3BMQB 4UAGA 3LYLA 1UDBA 4NJMA 1CF2O 4I8XA 2ZIZA 4O5OA 1LUAA 3WMXA 1E6UA 3ZDFA 5G4LA 5A3VA 1ZMOA 3N7UA 1X0XA 2PZMA 3A06A 2NACA 3ON5A 3RBVA 1V3TA 4BNXA 4DBZA 5IDWA 4L4XA 1LDYA 1OMOA 3ROKA 2Y68A 4E31A 4O6VA 4BGVA 1O95A 2FR8A 5LDGA 2D1YA 1SOWA 5CEJA 2X6TA 3AM5A 4FFPA 4DMMA 3OH8A 3H2SA 4OO3A 4J90A 5JDCA 1FJHA 3OA0A 3VHRA 3HN7A 4O59O 4PLWA 5A9TA 1EFLA 3NAQA 3W4IA 3TFQA 2NU7A 1Y8RA 4RVSA 3JQ6A 1E77A 4ND2A 4LK3A 3VPXA 2QHXA 1Q0QA 1WNTA 2IYPA 1QV6A 4B7CA 1K6XA 3BAZA 2E6UX 2HAEA 2GYYA 3ONFA 4CMJA 1I2CA 5JAQA 4OXKA 1YL7A 4UVHA 3VVCA 1LJ8A 2CY0A 2A94A 5JSFA 3VH4A 2OUIA 5A3JA 3D5TA 4M86A 4E12A 4E5KA 1ULSA 4RQUA 2VHXA 5DDIP 2V6BA 2Y1EA 2ZQYA 1ISFA 3K73O 5AXDA 3LLSA 4MP6A 4Q3CA 3ZWYA 2P9GA 1UDCA 3DBHA 3U09A 5CDUA 3ZHYA 3ETDA 3QLJA 2BELA 4OAQA 4TQGA 4QX6A 1MXFA 4FFNA 2Q2WA 2CZCA 2P9EA 1IB6A 4LW8A 3GG2A 2P5YA 4XB1A 3V2UA 1SB9A 4CQLB 1ZCJA 2HQ1A 4FJ0A 1KY4A 5CAEA 2B36A 2J5RA 1NR1A 3O9ZA 2JJYA 5L7TA 4J7UA 2H1SA 2ZATA 4QECA 3MTJA 3IIEA 1KS9A 4GGPA 4W99A 2Y1GA 3O38A 1I10A 1R6DA 5BNFA 2EWMA 3H6KA 1YB1A 3VZSA 4AJIA 4CR8A 1X7DA 3G3EA 3NTQA 4PRKA 3W4KA 3V5NA 2VHVA 2GD1O 4MVJD 4KQXA 1YRLA 3EAGA 4FJ1A 1UJMA 2BRUA 3SXPA 1RYEA 1OOEA 4XGKA 2O4UX 1VPDA 1HWYA 3ROQA 3PDUA 3PZBA 1XEAA 3PJFA 1EUDA 1VL6A 1PZEA 4QO8A 2B5VA 1M6WA 1JTVA 4UEKA 2JL1A 1JDJA 2ZQZA 3FD8A 3GY0A 3C1OA 2VUSA 4GAEA 2IZ0A 1B8PA 4AJEA 3ENNA 4CM9A 1U5CA 4R3NA 3BA1A 3Q9UA 2C2YA 5DOVA 3RBZA 4ITUA 1DFHA 1HT0A 2RAFA 1KY5A 1GUYA 2CDAA 1I2ZA 1GYQA 3TZCA 3A1NA 3PYMA 4C7KA 4UVGA 1EVIA 2JCVA 1EQUA 3W6UA 1A9YA 1P45A 3DBVO 3HDYA 3L77A 3LT0A 5F1PA 4PN3A 4CPDA 3FPCA 4OSPA 2IE0A 5IJZA 2W98A 1GEEA 3ETEA 3JYQA 3DHNA 4IQ8A 1ZSNA 4U0JA 1PGQA 4IJUA 3ROMA 1LQUA 4BB5A 2NSDA 1U4SA 4FW8A 5AXBA 1U1IA 4II3A 2G82A 3GC6A 3FR8A 3B1KA 1E3JA 4OIMA 4R51A 5G4KA 5JW6A 1KC1A 2DBZA 2O7QA 1YL6A 2VRBA 1SC6A 4O0LA 1YVEI 1ZBQA 2OL4A 1XHLA 2UAGA 4UVIA 1WDMA 3IP1A 4YT8A 4B8WA 3L6OO 2P9CA 1RM4A 3I9NA 4RPGA 1ZUD1 3CE6A 4B4VA 4Z9XA 2C54A 5F1OA 5TX7A 1DB3A 1BXGA 2BF7A 4XCVA 2DC1A 5BR7A 5IDXA 5IDQA 1PS9A 3NTRA 4R1SA 4YYZA 1ZJZA 1B3BA 1N9GB 1PQUA 2HRZA 5K6AC 5C3MA 3ENKA 5KKCA 4XYLA 4BVAA 3TFOA 3A14A 4ALLA 1E6EA 5A03A 3QVSA 5HBRA 4PLPA 2YHIB 3MJ4A 3BMNB 4L8VA 2PZKA 1MG0A 4WOJA 4BL5A 4K9DA 3RSHA 5JCJD 5EJ2A 1UXIA 1NWCA 3OM9A 4IJKA 5AQ1A 3T4EA 1NXQA 3WGYA 3R3SA 4Z3KA 4CJXA 4DGSA 2B0JA 1B2LA 2C20A 4Z3DA 1E7YA 3KSUA 1C1DB 1HL3A 1PZHA 4Q3BA 4CLXA 3C7CB 1E3WA 3F5SA 5KIAA 3JQGB 5TLSA 1H94A 3EYWA 2XAAA 2PWZA 5T5QA 1MC4A 1XU9A 3D4NA 1YDWA 2I99A 3E03A 3PJDA 1RWBA 2UUPA 3MJTA 4BQPA 2Q3EA 1I0ZA 1ZXBA 4RQTA 4W7IA 3RUEA 4BNUA 4A27A 1X7GA 1WLYA 5DULA 3RFXA 3ULKA 5F1KA 4B3HA 3O4RA 3MJCA 4YJFB 3KM0A 3PP8A 2PV7A 1R0SA 4DQXA 1U4OA 5CPBA 1YQXA 4P4NA 4A03A 1LSSA 3HZZA 5CFZA 5F5LA 1DLJA 1KBZA 2D4AA 3I9MA 4CMKA 4EGFA 1GCOA 4F6CA 1NQ5A 4RF4A 2Y0EA 5CDGA 4ZRMA 4E2YA 4XX0A 4MVJA 1IHYA 2AA3A 5LCXA 3VPSA 2DVMA 3MTGA 1PJTA 1ZKMA 4OOEA 5F5NA 3BMCA 3GN2A 5ILOA 3WGOA 4FR5A 1P0FA 1KEWA 3V1UA 3KLPX 3BIOA 4KDFA 3SVTA 1ISMA 4JXKA 3T7EA 1M76A 2PKRA 2B37A 1GV0A 1NYTA 3ITKA 3D5QA 3D64A 4D41A 2YV2A 1FF9A 2E49A 3L4BC 3EMKA 3WYCA 1JQBA 1JVSA 2DUWA 4R68A 4ZQBA 4IIVA 4E13A 1EE2A 2Z5LA 2DT5A 5T8KA 3UOGA 4BB6A 4TRRA 4GMGA 3T7CA 1QSGA 3S2FA 1LX6A 2Y99A 1JAXA 3WQSB 4LRTB 3INGA 1UAGA 2DFVA 1YB4A 3PXXA 2WD7B 1B26A 4MIYA 2CNBA 4OQYA 5EERA 3DZGA 4NJMB 5B12A 4GWKA 2ZTMA 3F6YA 2VQ3A 4GSLA 3S55A 1YH3A 4WKGA 2TMDA 4W82A 5JBIA 4KTTE 2D5AA 4J91A 4RVHA 4XGIA 4AJNA 3LC1O 4LVUA 1C1XA 1ONOA 5KVSA 1B3RA 3ICCA 3SJ7A 3DHEA 3V2HA 4CR7A 1BTOA 2NTVA 4GMFA 4YT4A 2BH9A 4CUKA 4GX5A 2EERA 4IPTA 4BO0A 2NVBA 3A28A 3JD4A 3KBOA 4WLOA 2E37A 3AI2A 4KWIA 1DIRA 5DBGA 1HSOA 4IDDA 3EVNA 4TVOA 4K28A 3GVXA 5DOZA 4BNMA 1Q7CA 1Q7BA 3DB2A 4XQEA 3ORFA 1XDWA 1Y8RB 1H6DA 1EQ2A 3KEOA 5G0WA 4IUYA 2NU8A 2R2GA 3GAFA 3S2GA 2NQ8A 2HLPA 4Q3NA 1WZEA 1MXHA 2X4GA 1V8BA 4J16A 5KJCA 3OJFA 2EGHA 4KUEA 4ZHSA 4M55A 5JFOA 3HHPA 5JCXA 1P1HA 4IXTA 3WICA 1VSVA 3SC4A 1LDEA 3WBBA 1XKQA 2VUUA 4JCOA 4WASA 3H9EO 3D3EA 3ONDA 2X9NA 1PZFA 3UKOA 1Y7TA 2LDBA 3EK2A 1Y8QB 5JCJA 4BV9A 1NAIA 4YPOA 4PLHA 2GN8A 1BMDA 2C82A 1Q7GA 3DBHB 1YE3A 5I7EA 4A2CA 4QFCA 5TF4A 5A02A 3CH6A 1P0CA 4YVFA 5A06A 4R41A 2G0TA 2QZZA 1R66A 4D46A 3Q3CA 3OICA 3BMOA 3L6DA 3VPFA 4YAKA 2Y93A 2O3UA 3MJVA 4RPHA 1AUPA 1GU7A 1O9BA 4RVDA 4URFA 1RJWA 3VZRA 5L4SA 1I3MA 4P4GA 5L51A 3ASUA 4BUCA 2FP4A 1VLLA 3GMDA 1B16A 1YXMA 3RVDA 4XIJA 1N5DA 3AUAA 4XWYA 2WWRA 3L0DA 3F5QA 3WS7A 5BNIA 3ZV4A 1I3KA 1PJSA 2XXBA 3DZHA 1F12A 4Z9FA 1WZIA 4HV4A 1E1NA 1KEVA 4DIOA 2C59A 1TI7A 4Q39A 4E5YA 2WYUA 4MVJF 3ZWWA 3CSDA 4CM7A 3JYLA 1J6UA 2X22A 3RJ9A 1F0YA 1T4DA 4H16A 4I9HA 2DU8A 5KTKA 5FWNA 5EINA 3ZW9A 3ZWVA 4A10A 2WSBA 3FSRA 2X1HA 3CMCO 5IN5A 5L40A 1JKJA 2YFHA 3D4OA 4BGEA 1K6IA 1Y6JA 1KEUA 5U9CA 3AOEA 4JBHA 2J6IA 4GX0A 2I9PA 2ZTVA 4DYVA 1EEHA 1Z73A 1ZK3A 1P33A 1GEGA 5IXYA 3Q1LA 5CG2A 1AGNA 4RF5A 2HJRA 4OSOA 1YKFA 5A5EA 2B4TO 4WLUA 3OHSX 9LDBA 4OXNA 1YDEA 3UH1A 4IS3A 3Q0EA 4J9VA 5AXCA 3NUGA 4L74A 1NHWA 4NBWA 4YAEA 3ZNOA 4L4RA 1WPQA 4OGWA 3RU7A 4PCVA 3RC2A 2P91A 2CVOA 2C5AA 3IP3A 4FOSA 1EBUA 1X7HA 2HMTA 3I9LA 4R5HA 4ZD6A 1MX3A 1UXHA 2Q1SA 2NTNA 1GDHA 1CWUA 4JGBA 3HUDA 5EPOA 1EBFA 1BVUA 1QLJA 3DTYA 4U0KA 4WJZA 2V7PA 4Z0PA 5ITWA 4R5MA 5JLAA 3ANLA 3INTA 4WCDA 2ZTUA 1YBMA 1N7GA 3M2PA 4WLNA 3CZRA 3BYZA 3NEPX 4B7UA 5AOVA 2BGKA 1DJNA 4BO2A 1ID1A 1ISIA 3NRCA 3GFBA 2X86A 3N58A 5G4KB 3FCOA 5GZ6A 2JFHA 3IOYA 3RC7A 1LLQA 3DMYA 3EHEA 4RCVA 4CV1A 1VE9A 3DMTA 2EG9A 4R4JA 4Z0TA 3S2EA 2YZ7A 1ZK1A 4I1IA 3RC9A 5HWSA 4RO0A 2X9VA 4FGWA 2AQHA 3AK4A 3F4BA 2B4RO 3I5MA 3OJ0A 4HFJA 4PFJA 4R1NA 1T24A 1BXGB 3ANNA 1OAAA 3LK7A 1GY8A 1GD1O 2Q1TA 5FEUA 2B4QA 2VOJA 3QY9A 1VJ0A 3FNGA 3AW9A 4DUPA 1C0IA 3HE3A 1IOLA 1WMBA 4PG7A 1Z7BA 4L4SA 5A5FA 4CMEC 4DRYA 1J49A 1QYDA 1NFFA 3B20A 3NJ8A 3TRIA 2PA3A 1N9GA 3NDRA 4ND3A 1TT7A 4KUHA 5HM8A 1FDSA 1V9LA 4QT0A 4NIMA 1CDOA 1DC5A 5KJFA 4YB8A 2FZEA 3VZPA 4CMAA 3PYXA 5EESA 2JD1A 5DT9A 2OP1A 4HNHA 1SMKA 3QWFA 3P19A 4HX5A 5CEEA 4G65A 3RC1A 3IAHA 1EMDA 1T1SA 3SLGA 3K9QO 4Q9NA 3KHUA 2I65A 3UAGA 1Q0HA 1TXGA 2AG8A 1E3WB 1YS4A 4DREA 4ZRNA 3TNLA 1H9AA 4CM4B 2HMVA 3L4SO 1LLDA 1SZJG 1UP4A 5JE8A 2W4QA 2WMDA 4GKBA 4NFYA 2PTGA 3U4DA 1PJLA 5T8KC 3TZ6A 5KJ6A 1DJQA 4DMLA 2QZ9A 2AXQA 4E5NA 1BXZA 2C5EA 4R69A 3Q2KA 3NT2A 5DBIA 1L7EA 5TRTA 1AHIA 2AG5A 3D3WB 3Q6IA 2BD0A 4I08A 4CUZA 4RF2A 3DAPA 5I7FA 3GR6A 5BSGA 5C37A 2JKVA 3GLQA 3H2ZA 3NYWA 2EW2A 3WGHA 4DPKA 4D3FA 3ASVA 1CERA 1QORA 1HDRA 4BS9A 3JSAA 2FR1A 4RORA 1TB4A 3WYEA 4J2OA 4BO8A 3KEQA 2DUUA 4TRMA 1G0NA 3BMCB 3INRA 3QRWA 3ONEA 1C0LA 4XB2A 4EUFA 1PL6A 3KSZO 4CV2A 1XSEA 4BNYA 5JDIA 3F1KA 4BNHA 1PGNA 2Q49A 2IZZA 1KYQA 1HE5A 1Z6ZA 1IPFA 1C14A 5DP2A 2AMFA 2EKLA 4ZGWA 1JA9A 4J49A 4WLVA 4WPGA 3A9WA 4PG8A 1LA2A 3V8BA 1FDUA 1A7KA 1MLDA 1AXEA 1OC4A 3K92A 4S1VA 5AYVA 4RVFA 1WXDA 3CKYA 3K6JA 3WYBA 2Y1DA 4GSKA 4F46A 4XRGA 3TL3A 3HFSA 4AJJA 3JYOA 1LDGA 3DTTA 4HUJA 3OQ1A 3WOHA 1GV1A 1NQOA 5ER9A 4BIIA 4D43A 4R3WA 1QYWA 4W6ZA 2CMDA 5U1PA 2Z1MA 3DBLA 1N92A 2AHRA 3R0IA 4B79A 4RF3A 3PWKA 2BHLA
chains in the Genus database with same CATH superfamily
5JR3A 2VUTA 2PH7A 4GPEA 3SX0A 1J22A 3OO1A 3C8DA 1L2TA 2IHKA 3DKKA 1AUQA 3FGNA 3RBXA 4N82A 2DCEA 1ARZA 2WB2A 4QPNA 3BT7A 5KTTA 2AFHB 2PJUA 1LPNA 1KZGB 2Y77A 1P3JA 4AICA 1GUBA 1R50A 2RHMA 4EHBA 3PNOA 3ZJTA 2AW3A 3EUKL 2WPNA 3O4HA 3DMNA 3ANSA 4IFBA 3CRNA 4URXR 3HUFA 3AKEA 3FM9A 3W4JA 1ZLXA 3A7DA 3LQ1A 1XD8A 4JJFA 5JAMA 1Y8QA 4QDKA 1IN7A 4QU8A 3AB3A 3CF0A 1QS0B 5BNFA 4YCNA 1IUKA 3WODF 3DOHA 4J0EA 1GZ4A 2PT9A 3KUKA 3MWDB 2P2ZA 2FRDC 1JB9A 4UOQA 2W2LA 4TLCA 1CR2A 1F2UA 2FOIA 5FNVA 2QE6A 4ND6A 4WN9B 3FB4A 3TX2A 4LY3A 3HB1A 1I1OA 3PXAA 2CXHA 1VQ5I 1VI2A 1VQ6I 1NXSA 5DX8A 3WRXC 2ZIAA 1QC5A 5D3KA 1DQZA 3EFOA 4QLAA 4BNFA 4IKOA 1IUOA 4B32A 5HIJA 1U3CA 4HH1A 3O0DA 1WRJA 1H0HA 1TAGA 5DXAA 1HH4A 3IVCA 4J75A 5KCZA 1E9BA 5K3SA 3K94A 3NTLA 4DLKA 4G67A 3HS3A 2QZ8A 3TNYA 1XTRA 3EVDA 2RHJA 6REQB 1I1GA 4O4HF 3TNDA 3QEMB 4OHBA 1FYVA 2JTVA 2OV4A 2XQJA 2RHGB 3AGQA 2OV1A 3D8NA 1NBMA 2RNGA 3KR2A 1YJBA 3WL5A 3EVZA 1I3QJ 5C5DA 4W1RA 1AS2A 4LV8B 4XYGA 3RKRA 3CF4G 3FRJA 4CG3A 2BGWA 2DFFA 2IE8A 4C88A 1D2NA 4G0QA 4P2BA 2P7HA 3WU1B 4PJJA 4HAZA 1Z75A 4DLVA 3GGGA 4ETSA 3UM9A 3FVTA 1LUJB 3QIVA 3K09A 2LH9A 1HQYE 4E7KA 3K9HA 1ODDA 4HMQA 4CL3A 2VSQA 5JXWA 4F6LA 1BS9A 4D8VA 5FF9A 4JUIA 1O5IA 1B8UA 1ZNZA 2EKPA 3R76A 3E9YA 4MNTA 1XDZA 3EMBA 3BZUA 3ZCVA 3UXEA 3PUWA 3PFIA 4GOMD 4QBFA 4AYTA 2YYSA 3V4RA 3V3KA 4OIQF 3ZX5A 1OX5A 4WOCA 1CT9A 1DMSA 3ZE0B 1E20A 4ZOBA 4H4CA 2QMHA 2HL6A 4Q9HA 3I4PA 5HCUA 3BCUA 5K8JB 2PH3A 5HIMA 1DJPA 2JNWA 1QBJA 3H0DA 3OR1C 1WY7A 1G6Q1 1IIRA 2EKQA 3LXUX 2NVUA 4GGGA 3A3NA 2W2QA 1HSZA 3A9SA 4R40A 3VU9A 3ZY2A 4B71A 2CYBA 3K1AA 4QXMA 3KCQA 4ARAA 1E7MA 2CLHB 3Q8KA 4FSXA 4H3HB 3G9QA 4PS0A 2Y9YA 2HOTA 1QXSA 2EX1A 5FRNA 3ZHRA 3N2KA 4C3ZA 2VLAA 5D8LB 1A5JA 5SZKB 4KBYA 1NATA 3IOMA 3G7UA 3C7AA 3HRMA 2LZ0A 1AX9A 2QPOA 3L7LA 1J5EB 2NG1A 1X3SA 3K71B 2PBIA 3TEMA 1JHOA 3L1JA 3T3MB 3PFGA 1R88A 1JXOA 3L0YA 5FUMA 4A0GA 1EAMA 2GDZA 4EDHA 1I4EB 1ZITA 2P79A 1M2WA 2AWNA 3WYDA 2HJ9A 1V39A 1WHUA 3DKVA 4F3QA 2YDXA 3PL5A 4DANA 2ZBVA 1IZYA 2IF0A 1UFRA 3LT1A 1PVDA 1SNYA 2O7SA 1TTPB 4FB5A 3ZQFA 1SUDA 3O1JC 1N8KA 2VN2A 2C00A 1X74A 4WNAA 1T9ZA 3KQVA 3L5OA 2PI0A 1UAYA 3QI7A 4OL9A 3MRXA 1WJDA 1PJ2A 2EAUA 1FYLA 3OAAD 4L72A 3DU5A 4IS2A 5TVGA 1FL9A 1UAAA 1T2NA 3OM1A 1Q15A 1UDAA 2BDTA 3VM6A 2A68F 5J2TA 1H05A 5DYWA 3ABMH 2JCXA 2IWRA 2E55A 1XWWA 4C7OA 2AI1A 3W77A 2RHWA 1AQNA 3AG6A 1VI0A 1N7IA 4X3CA 3E9EA 3KJIA 1Q7RA 2HYDA 4WNIA 5EJ5A 4GX1A 3DB1A 4MEYF 4FR2A 3HV0A 5F4BA 1QUEA 9ATCA 1XPUA 4KH0A 3ROUA 1GV2A 3AU9A 4NCNA 4UUBA 4AZSA 3UWPA 1JEYB 1E2IA 1X1QA 2D8AA 2I5PO 3PNTA 2X5OA 1W7AA 3T1YB 2RC4A 5FCDA 3GRYA 1XMOB 2YMPA 1BW9B 4C05A 2ET6A 3AVOA 1MBHA 1DHRA 5A6SB 5FHRA 4ERNA 2A9RA 3U37A 4CLOA 2HSGA 3DYBA 7REQB 4YMVA 3BGWA 1Z7GA 2GHRA 1MD9A 1OIWA 1M54A 1QPBA 3A1FA 2O8EB 2ZB4A 1BR1A 1S7OA 3E1SA 2WM9B 3RHZA 5FROA 3S1LA 3CSSA 1DJOA 3M5WA 1Z4NA 3EVTA 2D06A 4KDEA 1U8RA 5TB5A 4HLNA 4AECA 4L5JA 1FLDA 2GXBA 5IYBJ 2BFFA 1N9ZA 5MN5A 2RONA 5JS8A 1D1TA 2XWBF 2XPWA 5TS2A 1UP7A 3CX7A 3QPTA 2TMYA 2LNDA 3AY3A 3L7DA 3W6VA 3SBEA 2FDXA 3HKDA 4PBSA 1J2XA 4Q5SF 5E9QA 4MW4A 1R1TA 3E3LA 3LPMA 2Y4OA 2IYRA 1JKFA 4MULA 2PANA 1FBQA 2ZJZA 4K6MA 1UZCA 1U0NA 3GTQJ 3MCWA 2DTEA 3JQ8A 4KR3A 1LPAB 1GDTA 1OCZH 2D5CA 3RARA 2QRJA 3CEJA 2H5IA 4IRUB 1LBQA 3GF4A 2LR8A 3LAWA 1G41A 3CZPA 2V6JA 4RH3A 4F4JA 3DBRB 1VJGA 3SP1A 2P67A 5BNGA 1U65A 2FPLA 1HE8B 5K9ZA 2Y1WA 4YRVA 3HFRA 1S3IA 4B1FA 3SZTA 4YIIA 3TJRA 3GJ5A 1PVVA 1AHHA 1SO8A 2PZBA 3IQEA 3GJYA 4XDZA 4A8JB 1P7CA 2YTZA 1LRJA 5I5GA 1G59A 4D3SA 5F64A 1SXQA 1J0EA 1FQOA 1RUOA 2X2OA 3GMTA 4MROA 2DMRA 3GJ8A 1ZH0A 3RSGA 2STWA 1DBSA 1BKSB 3ZD7A 4TLAA 1JTXA 1II8B 3DFZA 4OEHA 3QKWA 2OR3A 4Q6BA 4G5XA 4G9YA 1E0AA 5FJ8J 3WP0A 3TNJA 5H1YA 4WX9A 1MO4A 2VAXA 2ZUTA 3DBIA 1YBAA 1J8QA 3OCZA 2L2OA 4MW1A 4AZTA 3EAFA 3EPPA 3SX4A 3ODPA 4FINA 2GRJA 3PTZA 4RFSB 4DQ2A 5FHQA 3BKXA 2NU6A 1TJNA 1TX4B 4N76A 5AW8A 5TMEA 4K46A 3COPA 4EITA 4NEHB 3K5HA 5BNZA 3L43A 4CFZA 4W4TA 4MUXA 1W4CA 4NLLA 1PHRA 4H18A 4ZOLA 3T12A 3GUUA 2VNSA 1PNVA 1C7EA 5HXAA 4AD8A 4M54A 1R0XA 2Q0OA 8GPBA 1XKXA 4WZBA 1QYXA 1XZGA 1YE5A 3IIIA 2CDNA 3VPDA 4EYSA 1NI3A 1XC5A 3PFNA 1Z47A 4WW0A 5JWHA 1PJ4A 3ACCA 2EQRA 5ENZA 3ZZNA 1OISA 3RVBA 4OXQA 1CQJA 4J4BA 3UICA 2X1MA 4IJAA 4EW3A 4IVNA 1MW7A 3EEOA 5AKZA 3FUVA 1X19A 2NIPA 4G3XA 2PMZN 1I4DD 3HCOA 4MVJI 2VYNA 3R8XA 1W2GA 3VO2A 2ABWA 1NN1A 5DSTA 2CV0A 4CU2A 5REQA 4TUYB 1EIZA 1R3DA 2PJPA 2G4VA 1H3NA 3L6CA 1EVQA 2BFWA 4DSOA 6PFKA 1RQ7A 3SJCA 4DMRA 1C30A 3ESWB 2AVNA 4MRAA 5J1SB 4OA5A 4MUGA 2JJ1D 2HOAA 3GFJA 5IJ0A 3Q8LA 2H17A 4B2PA 1CULC 4IZHA 1TJYA 2J9FA 1J00A 2M6KA 2D1RA 4S12A 4N6GA 3KJZA 4C7XA 5HCIA 5EUQB 4XCXA 4RHFA 2QMEA 3P0EA 2VDMB 3PO3J 1SUWA 1FY2A 4HMPA 2VHYA 4KSYA 1ZYRF 5JVTA 1FMCA 4KK4A 3RDIA 1GUUA 2D1VA 2BLNA 3ZK8A 4RKRA 1KNXA 3O6BB 3ZZTA 5JTUA 2EJVA 3AWDA 2D2WA 3IUJA 4IJ6A 2SNIE 2VZ9A 2E6KA 3KXLA 2JZOA 1I3OA 2NUAB 4CMIB 4JB0A 5F7JA 3KFXA 4DBLC 2QUHA 1Q2UA 5P21A 5KC9A 4MR9A 3SS8A 1YFJA 3LHSA 2YRWA 3HUGB 1E3SA 3I2YX 4PIPA 4IV0A 3L09A 2XMQA 1S9HA 2OCLA 3L3BA 4DC1A 4QFDA 3JRGA 3CW8X 1HC8A 3QUSA 5AVYA 1QHXA 3RQSA 5ALYA 3CN7A 3KLBA 4OUDA 5CLFA 1VMAA 3TIFA 3LPLA 4JFRA 3UIEA 3KSMA 4P0TA 4F3YA 2D59A 2Y1XA 4QWMA 3FOZA 4I36A 1KERA 2ZVJA 3ANXA 1VE5A 3S0JA 2Z1NA 1IZ8A 2X9QA 2XIJA 2RAPA 4U7PB 4JB2A 1DC4A 3VKWA 3AT1A 1SCJA 2V7TA 2OBYA 4XGNA 3HI4A 1EG7A 2W8ZA 3LUFA 4I50F 1ZK2A 3VR4H 1NOKA 8AT1A 5DK4A 2ZI7A 2W4MA 2Z9CA 2CK3A 3RZOJ 4ESHA 1SIOA 1K92A 1KJQA 3TLZA 2BFOA 4A6DA 1XSDA 2ORYA 2IXEA 2IOFA 2A4KA 1MFPA 4GD3Q 4J0HA 2IYXA 2M4GA 1M2VA 2EWNA 1EK2A 3LZDA 3DAGA 5KC8A 4QHTA 5KAIC 1LZLA 4XPIB 2H9IA 1G9XA 3JQBA 2FMKA 2JBWA 2ZJPF 4CKWB 4DSNA 2C7GA 1E79A 1Z2CA 3MRSA 3RT1A 4DLSA 3C5CA 3GMEA 1A9TA 3PG5A 3QF4B 3MRTA 3R3WA 3S70A 1N78A 1IVNA 2YHSA 4M88A 1EP3B 3S5UA 2G25A 4NABA 2FQQA 3SJMA 1FDVA 1XP8A 4K05A 2GYWA 1XDUA 1GPH1 2EFEB 2EL7A 1NXOA 4S1TA 1QDUA 1Z17A 1QFYA 3U7QA 5CNJA 5KU7A 2WYWA 2ZS9A 4NJMA 3HA5A 1JHPA 3A05A 3WGJA 3RVJA 3QHPA 1Y7IA 3FJOA 1M5RA 3ZDFA 2Y69H 2PUAA 2MINB 4WOPA 5BN4B 3AFIA 4DY6A 3ON5A 3X3HA 4E31A 4IKPA 1RMTA 3KS9A 3OLYA 3DKWA 5E1ZB 4EKIA 3VHRA 1P2BA 2GCEA 3R61A 4QOHA 4ND2A 3EVGA 3BAZA 3QAHA 4JK1X 1QPIA 1UWVA 5JAQA 5DXFA 3PM1A 1PUJA 4NG4A 2XMBA 2I6FA 3HB7A 1JZSA 2V6BA 2Y1EA 4Q3CA 5EJ8A 4OP3A 3JALB 1QRSA 3ETDA 1O96B 3DCYA 5AJTA 2QZSA 4IGIA 3WGKA 2P5YA 2HEIA 4FJ0A 4RHYA 5D5UB 4J7UA 4QECA 3CEMA 5TGZA 4O8ZA 3K10A 4XSGA 1EEXB 4OY3A 1VCMA 1Z9BA 1GNSA 1Z6PA 1A36A 1NVVR 2JW5A 2VDWB 1FZPB 2V26A 2YXNA 4XGKA 3S14J 1HWYA 4ZDKA 1R1UA 4QPQA 1J0CA 5CA1A 1FUYB 1NXVA 3K4QA 1BC8C 2EVWX 4N03A 2ZQZA 1NBAA 2Z4RA 4AJEA 1DV2A 4B31A 3ZEAA 4NUBA 3DLCA 4JEUA 4RA9B 1XTSA 1XGMA 1P45A 4D81A 1C29B 3BJ6A 1RXEA 1Y8CA 5K1ZA 4KT6A 2IE0A 5IJZA 3QP6A 4FIDA 1H9GA 1BU8A 1KQOA 3BTCA 1SHLA 3MKYB 2WV0A 4BJ5A 3UFBA 3ZJYA 4Q12A 4RD3A 4YUYA 5LD2B 3TLCA 5F1OA 3S44A 4XCVA 1JFVA 1Q21A 1KFEB 1PS9A 3TUIC 2MR5A 3WMEA 2W6JD 1AGPA 4DLZA 4KOEC 1T0FC 4FQGA 3MJ4A 4P31A 1MG0A 4WOJA 1ERDA 2RG1A 4BL5A 5JCJD 4LDRA 1A9PA 3R3SA 3W5BA 1E7YA 4JJ4A 3ISVA 3MT7A 3EYWA 1GKIA 1VMIA 1YDWA 3NYRA 5CR9A 4U88A 2JPCA 1SUFA 2DFPA 5AW5A 5D7NA 4UBOA 3MJCA 4DSZA 4IRGA 3RAGA 2OBLA 3CJRA 1T6XA 4E7PA 2R7VA 4KYWA 3I9MA 4EGFA 1ZGHA 1NNLA 2WAQN 4RZSA 5ILOA 5TR9A 2JT1A 1OWMA 2CJWB 5KS2A 3LGAA 2O8FB 4LIVA 3WHIA 2E71A 3GBSA 4D9NA 4OF4A 1I3AA 3GLHA 3SZGA 1P4AA 1M7HA 4MS4B 3RLIA 3TTWA 3T7CA 3T3NA 4IOLA 1N2BA 1ZR4A 1N2HA 2O0KA 5EERA 3DZGA 4GWKA 5A4AA 1MRNA 4W82A 3DV8A 4RVHA 3HWSA 3CUWA 4Q3KA 1BTOA 1II9A 3M4NA 4MO7A 4QDZA 5DOZA 8MHTA 2OUKA 1IG0A 2D5BA 4QUDA 2ICAA 1Y8RB 1G7CA 4LDQA 5K8UA 3M7IA 3B3QA 3G73A 4PQYA 3FMFA 2DA6A 1JJ8C 4WXCA 1FNMA 3WICA 3S8PA 1VSVA 3F7MA 1KAHA 3WWPA 1FBUA 2ID7A 1NJFA 4MJXA 2FWJA 2BEUA 1VQ9I 3DBHB 1M0WA 4G6TB 1HOMA 4R41A 2Y93A 3WRYA 4RPHA 4I0AA 5FOXA 4HYEA 1OKKD 4DR2B 1VL2A 2XAGA 4C9BA 1HR0B 1AGRA 1RTTA 5CT8A 3M34A 4AIDA 2X22A 3SIPA 1F0YA 3JQRA 2Z2XA 4N7MA 3MKLA 4ER3A 3QU4A 3OM8A 4PFOA 3DPUA 1XTQA 4CHGA 4ESVA 5K3FB 2ZPAA 1QG0A 3WE7A 2B4TO 4ZYDA 1A31A 9LDBA 1RRFA 2QK4A 1KWGA 2QVLA 1URPA 3E2IA 3IT1A 3EXHC 4FLFA 2V7PA 3V8LA 2ZTUA 4J0QA 3NRCA 4QPCA 2R60A 4B4KA 3EIUA 4C29A 1NSYA 3VNBA 5DI3A 1CZLA 2Q2EA 1P9QC 4KREA 2E7ZA 4HAWA 4KJXA 3LSIA 2B4RO 1OAAA 3HYIA 4JJ6A 3RYIB 3AW9A 3HE3A 1WMBA 4OHPA 4LSZA 4BFLA 1B76A 2VPWA 1QYDA 2GBCA 4I4TF 4F3NA 2EA2A 4IRMA 3Q8MA 4HDSB 3HKEB 3KQKA 3IAHA 2HZBA 4Q9NA 2OJED 3LP8A 2HMVA 4FHCA 2IDKA 3H35A 5L3SA 3TCKA 5HX7A 3J7AY 1MDMB 4CL0A 3C5WP 4P9UA 1IG7A 5ALGA 1UM9B 1HRKA 4X97A 1XRMA 5M29A 4BNHA 4NZMA 5LIPA 1W0KA 4N40A 4M7RA 4P93A 4OAOA 3L7JA 5IT9Z 3LV8A 4XWAA 5B1IA 4D4MA 2J7PD 4S1VA 2BBOA 2ZJAA 1WXDA 3WWDA 3ABLH 1R1DA 2DPDA 4BIIA 2P2CA 4R3WA 5K5EA 3CNOA 4DMUB 5ALRA 4L7VA 3S4YA 3AEUB 2O6LA 2VDKB 3M5PA 3HY3A 4YJ2A 3LT4A 4Z0HO 5HZGA 4G1BA 3VXKA 2JJ2A 1ADCA 1SPBS 2I29A 1O7JA 4KYUA 4XLEA 3ZIUA 4BE9A 1EE1A 2K7FA 3E5MA 1N8NA 3N0WA 1UBCA 2JGIA 2P8TA 2BFCA 4TN1A 2C31A 2ZRPA 4NOMA 1JXSA 5K0LA 4JENA 4XSHA 5D6OA 5ERGB 4INPA 2CD9A 2VRCA 2BKEA 1XAGA 3ZWPA 2WYIA 3W5SA 2DI3A 1JSRA 3QXJA 2ZBGA 2BYVE 3RKXA 1MH4A 1YX5A 1NIJA 5GTIC 4TQUS 3KB6A 4JVNA 4GBJA 1ZOSA 3Q11A 3I1IA 5CM9C 3U4MA 5H59A 3QVOA 1ZD3A 3AQ4A 3SD7A 5EC8A 1K4MA 2VEDA 1T2CA 4EPWA 4CZ2A 2GERA 4F12A 3BF8A 5DYGA 3SQLA 3HN6A 1SXIA 2C2ZA 5JYDA 1CU1A 3EW7A 3KZIC 1DADA 1UOQA 1X9HA 4H08A 1Z6QA 2Z8YM 4YONB 2FZ5A 4LEIA 3J7ZI 5E6RB 2WIDA 1T98A 3S1SA 2ST1A 4NYMQ 4Y6QA 1A1SA 2CXQA 2VJMA 1JDVA 1DO8A 3WTCA 1IB0A 3EOZA 1JMVA 2MYSA 4O1IA 2XB0X 2PMZA 4GI7A 5IW8A 3FVRA 2HCFA 3ZVMA 2CL5A 4LG1A 1WXFA 2GCOB 4RS4A 3H99A 2GPSA 4X54A 4ZDWA 4BN4A 4Q4DA 1NJ5A 5CJ9A 1V16B 2D0IA 1PJAA 4O3MA 1ADFA 1JQLB 3ZDDA 4TSFA 2XNKA 5C31A 1U0SY 1HF0A 1PX2A 2EATA 4CKEB 4PINA 2QX7A 5CG1A 1CKEA 3C1AA 3VSKA 3SJBA 2BTQB 3OL3A 3O73A 1S7CA 5A3QA 2JIPA 1WU8A 4KPUA 1SOVA 1AHPA 3K1JA 2HO4A 3SCZA 2D0DA 2PZEA 4QTYA 4A2QA 1RZRA 2A9JA 3NWBA 1CEQA 2H4ZA 2IT0A 1WVIA 4YUXA 5KTSA 4LRQA 3EPZA 3O9VA 5FULA 3BTJA 2PGXA 3ITDA 5CX1A 4EENA 1JR2A 1XSVA 3B38A 3IODA 4YP5A 3OEED 3BHJA 2NZ2A 3BCBA 2O48X 4KUGA 2ZIWB 4EO9A 3II6X 2PD3A 3Q0IA 4Y52J 1ENOA 3K9NA 2OBFA 4XWGA 4ZV7A 3FXAA 4ECEA 5JALA 1SB8A 4ML3A 4FTHA 2EFDB 1UBOS 3IE2A 3GJXC 4PZ9A 2B99A 2XWQA 3OPNA 4J4TA 3QVJA 5ELXA 1G66A 1BAPA 1YVRA 4FQ5A 3DC2A 3G8YA 5B4TA 1FSSA 4OQXA 4AL4A 5ARCA 4Z7NB 4A12A 2A5LA 2C9BA 5G0TA 2NXNB 1ODIA 3AU8A 3CT6A 1L4LA 3C85A 1C3EA 1H2AS 3S7ZA 3OIDA 3EWSA 2QD3A 5EGSA 1ZAKA 2D1FA 2QM8A 1N7HA 2QRLA 3GCDA 1E6LA 5CVUA 2PDAA 5K51A 1O03A 4J7CA 3W2WA 2VJ5A 3CR7A 3HFGA 1E3LA 1N3YA 2OKCA 5K0JA 1W1WA 5HNFA 2BMDA 1KO4A 4WFJA 2FMXA 3FMVA 3P27A 4CF5A 2YXDA 3ZWNA 5HKBA 3OT1B 4D9HA 4PNPA 4J0JA 4B45A 1RHQA 2GPWA 2KQUA 2NQ2C 3OY9A 4BE2A 3NW9A 3I42A 5H80A 1BS1A 3HHHA 3S16J 3KOYA 2P9TA 3W5UA 2CDBA 3NT5A 1KO7A 1GPWB 1S3FA 2W90A 4RWZA 3W5DA 1D9ZA 1IV6A 2X0FA 3GZTB 3ROPA 4RKFA 2X5JO 2WUDA 4ALKA 2RMKA 2JBAA 2F1JA 3H0CA 2DMNA 5LU9A 1FDOA 1QGZA 3VISA 2F3SA 1AHDP 4D80A 4FNGA 4M0CA 4OV6B 1RRPA 1L7QA 2PGIA 5CNKA 3RM3A 2BUAA 3V1NA 3KZVA 3BR1A 1YFZA 3SM3A 1PU2A 2PL1A 5TRDA 2R7OA 1ADBA 4M1ZA 3QPVA 4JLPA 4PG6A 3E6DA 3SIWA 5JEEA 2K02A 4B3AA 1TTTA 2O20A 4ND5A 1ITYA 1CJVC 4D0NA 3ZXUB 4AYXA 1YQEA 1JQDA 3MQ0A 1CZKA 1MVNA 5C81A 1Y1LA 3VC2A 2JPBA 2Z04A 1ORDA 4DPLA 1MOQA 4YCCA 2OG2A 1P74A 5JOQA 3SHWA 5IYZF 3NOVA 4KQEA 5FKLA 5F77A 1A9OA 2FXIA 3JWJA 1U2TA 2FP3A 3LQYA 3UKDA 3CW2A 3HA2A 3MJDA 3RS5A 2JSPA 2MLGA 1FRFS 3WGMA 2XMGA 2IYSA 4NS1A 3TM5A 5JPCA 1DBWA 4C5BA 2H27A 1R12A 4JNKA 4KR9A 3K1PA 2V59A 1E1YA 5FX2A 3C7JA 1ECBA 2HXSA 4HGQA 1Z26A 2VDQB 3F8MA 2KYRA 4KISA 3H9UA 3MUOA 1DAEA 1EAYA 3GDHA 4ZZ0A 3ZWAA 4BVLA 3G13A 4NYMR 2DETA 3JQAB 5DT2A 3QNUA 3FZGA 3KX2A 5KYYA 3D4IA 3IWFA 2E1RA 1SXGA 1OXUA 3F5FA 1ZZEA 4HN4B 2OT3B 3O3CA 3REOA 4TV9F 1MQ9A 5J2UB 3KPYA 3PKIA 1GG2A 3TEDA 2G7HA 4BRUA 4MYDA 5E7IA 1FFSA 2G67A 1PYGA 3ROFA 2GA2A 5KKNB 4C1NA 3D59A 4HMOA 4EZBA 1YCHA 2BFBB 3FBTA 3B6JA 3CBQA 2JHFA 3KZXA 1M7BA 3EDOA 4YASA 2X6YA 1NVAA 2ZNZA 5GP1A 1QBGA 1Y5LA 4ANFA 2X8BA 4I5DA 3GVPA 2MH2A 2NZ8A 4XQGA 3PEYA 2ODAA 3EPRA 3QA9A 4R83A 2YUIA 3ZCQA 2JLZA 3S93A 4WNCA 3R7BA 3FXLA 4QYMA 3JARA 4EX6A 4LKRA 4OXYA 4IEEA 5LA6F 2AV6A 2WAQA 3BCRA 4I02A 2QZJA 1W0JA 3I5AA 1YQUA 1TO6A 1GVHA 3ZCUA 4J2TA 1MO5A 3DZ8A 1YIDA 2P4UA 3A3PA 4R8MA 3GCGA 1TMGE 2X58A 2AZXA 2JA5J 3DXJF 3B2EA 4HPXB 1AURA 4ROSA 3D81A 3E5HA 3HPRA 3GFFA 3SYNA 1JV2B 2NZJA 2VZ8A 3SWWA 2OCCH 3AHGA 4ZQGA 3DEJA 2YCLA 3QBEA 2XOXA 2DPYA 3I2IA 2GEFA 4RTOA 4GPBA 5CDFE 2H9YA 1A7AA 3IJPA 4DT1B 4D98A 2QNIA 3QQPA 1OLSB 4OJNA 4LHXA 4DM4A 5HZHA 1IJBA 5HUJA 1D0SA 2QN3A 2K4JA 4IIGA 4WCFA 2P0YA 3WP1B 1RXUA 3IAS1 4EZIA 4XORA 3FM3A 2EBWA 5CYGA 1M67A 1PGPA 1W1UA 5HILA 4D6PA 4BFSA 4E46A 4CQMB 2A0UA 1NR7A 1E4EB 4R9SA 5DHTA 4YP9A 3PHBE 3JXEA 3AG1H 4A3IJ 3U3MA 1KQ0A 1TZMA 3RC3A 3BWBA 2CF6A 4YAJA 4MRMB 1LV8A 2GNOA 2DBVO 5C8YA 4ZCRA 5JD4A 2HDDA 2CXSA 3DWEX 1AD2A 2DLDA 3NV9A 2APJA 3WK6A 2H59A 1N1DA 2V7VA 1RE1A 1RQLA 4MYUA 2GIVA 5ICGA 1TA4A 721PA 2K4BA 3QTLA 5FPQA 1OCCH 3ZRGA 3E81A 5JVDF 2RGGA 1CUAA 2XJ4A 1JDBC 5JSKA 1KDZA 1KVUA 3ASYA 3AL0B 2QQGA 3DOJA 4RPJA 1Z0JA 3GLVA 1IN1A 1ZI9A 2PUVA 4YRIA 4DVJA 1E3MA 4RK7A 5KNLA 2LUOA 4X92A 4JP3A 1X1SA 1L4GA 4OYHA 3BJZA 4ACAA 4I9GA 3ANYB 3IPYA 3VPGA 1Z67A 3WQQA 3PPWA 1SVOA 1KDTA 2IHYA 3VKGA 3PDIB 3VGJA 2VCYA 4F91B 1BQ3A 1D5CA 1E1MA 4MFDA 3OG9A 1HZJA 3HVJA 1RP7A 4ED9A 3HPHA 1H8EA 4QGHA 1MIOA 1SC9A 1LBEA 1ZGJA 1E9RA 2CS3A 2RHRA 4QRDA 2EEZA 2IX9A 5KTRA 1DU4A 2QF7A 4IJ5A 1JYSA 2XD9A 1T1EA 5TQJA 2G9VA 4EB6A 2XRLA 2P4WA 1GR1A 4JBYA 4C2AA 5ECGC 2QW1A 3PXEA 2AK2A 4KMMA 1DGWY 4PHFA 3ZTYA 4LE1A 1MOZA 4I8DA 4R16A 5LGTA 5C1PA 1IVYA 5MGBA 4A3JJ 2X9LA 4MVYA 3P2JA 2CQKA 5K7ZA 3CCFA 3RUPA 1MB0A 3ST7A 3GEIA 5JARA 2YVKA 4HN2A 1P4GA 3A6LA 1SJ9A 1G8JA 2VWPA 2JGDA 4FBGA 3TW0A 1LKXA 3KAPA 1PZGA 4LZLA 3LDAA 3GTOJ 3H4IA 3Q1KA 2GT1A 1NSFA 3U81A 3WJ7A 4WXPA 3COJA 4BMXA 3S1NJ 4QFBA 2AG1A 3VMFA 1Q1EA 4MLDA 3OSUA 1KEZA 1RM0A 4Q3EA 1YA8A 5B4UA 4ND7A 3ESDA 1B23P 1OB2A 1Z8FA 3A01B 1HE1C 4OQFA 3VR3A 3DEIA 3G2NA 1LPQA 3DU6A 5E3HA 4PVCA 1BM9A 1TQ8A 4PSUA 2Q9AA 4TMTA 2Y2VA 3QKSB 4YJGA 1UBTS 1OPCA 3MMXA 4DLNA 2YQ4A 4YMWA 3L1VA 1P0QA 3SY8A 1DL5A 1DQYA 2HSDA 2P5KA 1Z7UA 2JIOA 4CEIA 1ETKA 2HRBA 1WA5A 4JASB 1SANA 4EM1A 3UMBA 2P75A 1MRSA 2BI7A 3HB5X 2B61A 5LL6P 4YUVA 3VUEA 1ZQ3P 2YU3A 4PAWA 4I1PA 3CO0S 2ADMA 2M3AA 4MOWA 3WB9A 3EFBA 5FB2A 2YN2A 1DQPA 5JRDS 1WEKA 3J81k 4RAFA 1PQ4A 1ND6A 1U2SA 3N7UA 4OGLA 1XYYA 5ILVA 1JVNA 5HS7A 1IY0A 3QPSA 1OIXA 3NHPA 4XIIA 1P17A 2I4OA 3RVKA 5ALIA 2AZDA 5IANA 3PE6A 1UEIA 4DTCA 1LCIA 5TPWA 3F3YA 2IYNA 4BQAA 1AQ6A 4LF5B 2JAUA 2Y48A 2MOKA 1QRAA 4UVHA 1USTA 4CIAA 4KIWA 1PUIA 3OPXA 2VHXA 3V46A 4TYWA 1UADA 3ZQIA 1ISFA 3K73O 3ECSA 2ZSHA 4TQGA 1QFJA 3FXRA 5GVSA 5TQ2B 5EXTA 3F96A 1DX4A 2CW7A 3GLXA 4DIDA 2A88A 2PT6A 3IGFA 3CGGA 3LX5A 4G0ZA 3E5QA 2QVGA 3SKXA 2Y1GA 4ZVPA 5EIEA 2WHEA 4Q82A 4PR0A 4HQMA 1Q84A 2JK1A 5F52A 4YRSA 1XL1A 2VASA 1SXJA 3ZKAA 4KR7A 4XN3A 2L19A 4LX0A 4QQ8A 2ZBKA 3PT5A 4RIGA 1FP6A 4TLEA 4CM9A 2F8SA 2ZKIA 1UPCA 4IG4A 4G25A 3GO5A 2JI4A 3U3OA 3A31A 2B8EA 2W98A 2JLWA 1CS4C 5C8DA 4D1YA 1U1IA 3FR8A 3B1KA 1YL6A 3PL1A 1N6NA 2J4CA 5KOJA 4Y2JA 2QAGA 2JEYA 1XHLA 1KQ9A 1I39A 4UVIA 2E7WA 1ZRHA 4YT8A 3CT4A 2ZM6B 5F51A 4N12A 1REQB 2A7XA 2V97A 1Q7EA 2A4MA 3WWEA 3NTRA 3D3JA 3HP4A 2HWVA 4XGQA 4MKGA 2Z2JA 3F6CA 3OY7A 3FDYA 5EJ2A 3U3RA 3WGYA 2OFWA 1MSFC 2B0JA 2BY0A 3DQQA 2GB4A 1IRZA 2FG5A 2Z99A 2F2EA 3HWWA 3FKIJ 2PX4A 1AA7A 1AKYA 4PYIA 1NN3A 4LX8A 3RUEA 3AUJB 2XUBA 1ZISA 2OCKA 2GM4A 4A03A 3J81K 1GKYA 5CDGA 4PTZA 4XX0A 2DVMA 4ZI5A 4G6ZA 2KP6A 2X48A 2D62A 4JXKA 1SQ6A 3UAOA 1W4BA 1L0OC 4ZI7A 3AR4A 3WYCA 3NWJA 1AF7A 4TRRA 4CDNA 3QH4A 3BDIA 3CJQA 5C1BA 1R6UA 4J91A 4LVUA 1GRRA 5AVJA 4YT4A 4TL9A 2GEKA 1T5SA 2ORED 4P34A 3E0QA 1WXIA 4MKHA 1GTZA 4RGXA 3EVBA 3KB2A 3I12A 1U8AA 2XIGA 4IUYA 1XLUA 2XB5A 2JI6A 2PSEA 3WKBA 4EKYA 3OJFA 2NPFA 1TFUA 4NULA 1BCRB 2IPMA 2GJKA 2O2ZA 4HAYA 2CLMB 2D2VA 3TR5A 3H2KA 3OOJA 1DPFA 1R5GA 2AFHE 2AUNA 4X41A 2QXUA 2R5YA 4MTDA 2KIUA 3T5GA 2WM8A 3KVVA 4R2XA 2NYVA 5LP6C 2DDBA 2JH3A 2RJOA 1VCHA 3LAPA 1ZICA 4LY9A 3QX3A 5CAEB 3VDNB 4CNBA 4MUMA 2C7RA 3AF2A 1I3KA 4MW6A 3EMVA 1BMTA 1F7UA 3EXEA 3RJ9A 3LDUA 2G83A 2WSSA 1BCSA 3I9V1 1L5GB 5LU8A 4JOMA 4MV1A 1C3LA 1WKVA 2ZTVA 1KAEA 1V54H 1WCYA 3IH5A 5LP1A 4MQ5A 4YGXB 4AG6A 3VNRA 2A78A 2FOXA 3IRQA 1C7ZA 1Z8HA 2KI5A 2Q1SA 3TZBA 1CWUA 4QC2A 1XZPA 2WHPA 3MD0A 1XDBA 4Z0PA 4TYNA 1GXSA 3HGGA 3INTA 3NHRA 2M87A 2QNRA 5ALQA 5EJAA 2AXEA 1JR6A 1HBJA 5LQMA 3PR1A 4M0KA 2PTHA 2X9VA 4FGWA 4QHSA 3F4BA 2OQ2A 4DYRA 2B2CA 3T1HB 1GD1O 1MSEC 5KYTA 2XOKD 1XEFA 3TO6A 4HNAA 4MA4A 2PQ2A 5CFRA 1WSDA 5A5FA 4JT9A 3Q3EA 1NFFA 3OYFA 4HX9A 1T8RA 3AFGA 3V9AA 3EETA 1NMEA 4HB3A 4D96A 1BEZA 1SAXA 5E6UA 5GAEJ 3WLRA 1QO0D 2FLVA 4HNHA 1OVGA 3KHUA 3UAGA 2FLKA 2AG8A 1CQZA 1T9GR 5LQRA 4GKBA 2GHIA 2AKEA 2NZUG 1ABEA 2ZWMA 5LQNA 3I6YA 3Q2KA 4H59A 2I34A 4EY5A 1L7EA 2FEAA 1UJBA 3GEPA 4I08A 2GXQA 1VHWA 2JGNA 5FOVA 1K1EA 2J0VA 3D5RC 1JG4A 1EDBA 1QORA 1PDWA 2PUCA 3X1WA 2WKWA 2E3JA 2GZAA 1Y1VJ 1UOOA 4R05A 1UJCA 1FFDA 5LQCA 3FXMA 2E60A 4Y6OA 3IQIX 2N75A 3Q9SA 2R7XA 3V00A 2AOUA 5GQSA 4KK3A 4ZGWA 1RI4A 4F8EA 1SHTX 2GHTA 1FDUA 1N2JA 5CLSA 1QVAA 1OC4A 5FADA 1HA8A 4DYCA 3LCCA 5LXTA 1Q20A 1VJRA 3OQNA 4GZMA 2C6YA 2BHLA 3OOEA 2F5CA 1WXWA 5E3JA 1Q0RA 1Y1RA 4YHBA 1Q14A 2PVSA 2OCIA 5D3MB 2DQ4A 2VJBA 1WETA 1U2EA 3MJHA 1QH9A 3KHTA 4BHCA 4OHKA 2FFAA 1P9NA 3ZIAA 5ALTA 1YA4A 4NESA 4MO2A 3UMGA 4ARSA 5K2OA 1J8FA 1SY7A 5KVCA 1MFZA 3KSDO 1A8UA 4J1SA 2XF6A 4D5FA 1EWTA 3TDKA 4M1OA 1TRHA 2R96A 2FZLA 2FWBA 3C3KA 3T0FA 2COMA 1H0RA 1GOTA 2E1OA 3N59A 1KE2A 1MAHA 4ENMA 4LXUA 2Y6UA 5TQVA 2MR6A 2XVCA 4L6IA 4DZZA 1H3EA 1Y5MA 3UV3A 5CB0A 5E18F 1YTYA 4BZZA 3TIIA 3H9JA 2XH8A 3WX0A 3JRHA 2X85A 1Q2XA 4JX9A 3OIOA 1AJEA 4RPKA 1CUYA 3HJTA 4MQ6A 3PKJA 3F22A 4CZZA 1X14A 4GSYA 1LBTA 2K9QA 3GDFA 4ENRA 2VQLA 1G6HA 3OZXA 4PO1A 3HXTA 3NEAA 4QSMA 5G2OA 3S8EA 1E7WA 2VBXA 5PNTA 2VXZA 2Q3MA 3VDQA 3ADPA 2ES4A 1UINA 1W4AA 1KDPA 4B87A 2ONYA 2FEXA 3F8FA 2E21A 3LUJA 4ZQIA 1SM4A 2GAAA 2W2NA 2IXTA 1PAUA 1DPUA 3HOZJ 1CJMA 1SCBA 1E17A 1R23A 5M5WJ 2GEVA 5CA0F 3WA6A 3T15A 2JDID 3K1TA 3C41J 3BZCA 2IA1A 3G2MA 3JAMZ 3E8XA 4PPFA 1I7SB 2AMJA 3EDYA 4DCMA 2EIHA 3GCWA 3VZBA 4NENB 3JASB 5LEKA 3AKYA 4J29A 4BNNA 1Q19A 2V7WA 4XRSG 1NRWA 3OTOB 4G8XA 4GKKB 3U16A 2O2SA 1PV1A 3I72A 3U44A 4HZIA 4A26A 1BWPA 5CLQA 1TCBA 1L7OA 4HGYA 5ICFA 3K9WA 4KNVA 3LL4A 4CWAA 2QIPA 3IAM1 1J97A 2X0RA 3UT6A 3HKBB 3KO8A 2Q9BA 4NFLA 1GTRA 2IZ5A 1NU8A 5LZ9A 5A2GA 1WWXA 2OTCA 1BR4A 2Z43A 1FVFA 2NO0A 1PGJA 3IUYA 3HEBA 1OA1A 4AUKA 3CRZA 1GZ7A 1SZDA 1CS0A 2R25B 3I6MA 3IURA 2LP0A 1OXBB 4CLRA 1M1UA 1IHXA 4OK3A 1RHMA 1YWGO 4X7RA 3SMVA 2VPIA 3OO0A 2FPKA 3K8QA 5C35A 5DLDA 2WBLC 2AUMA 4UTOA 1OBHA 4JITA 1XZMA 2F4MB 1KGDA 3TVDA 1JMKC 5AMXA 1FY7A 2J9GA 1KK1A 3AL2A 1E1LA 5AJXA 2WNHA 4BO1A 3ZN2A 2VHQA 5EFOA 1VKHA 3HG9A 2BN4A 4RDCA 3FF4A 1KOFA 1YONA 4CM3A 2BR4A 4ZYVA 4BFTA 3KJGA 3KUXA 1JFSA 1X7WB 2D5LA 1G21A 4ABTA 3K5WA 3GUZA 1HZZC 4QXOA 1Y4AE 1E4YA 1TZBA 4RAZA 3PSHA 1ZG1A 4AS2A 2VQCA 3MMSA 2W8BA 1QHNA 1ZXXA 3F4LA 4NBKA 4BNIA 4N9HA 1ZDMA 3E9ZA 5TGTA 1LK0A 4K9PA 1TL8A 4ZEWA 1IQUA 3Q88A 3ZPXA 2XWSA 3UB3A 3JQ7B 2BR5A 3N3BC 4IGFA 4GR9A 4R2JA 4EJWA 1VKOA 2AIRA 1N2CA 4IFIA 4KO1S 5ALDA 1YTUA 2I2XB 4BNVA 3OEWA 5ALPA 2BBYA 1LQTA 3BICA 2JWTA 3WL7A 2FWMX 4BFYA 2C4UA 2I3GA 4BATA