3H9JA

Crystal structure of e. coli mccb + ampcpp + semet mcca
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
348
structure length
339
Chain Sequence
b'MDYILGRYVKIARYGSGGLVGGGGKEQYVENLVLWENIIKTAYCFITPSSYTAALETANIPEKDFSNCFRFLKENFFIIPGEYNNSTENNRYSRNFLHYQSYGANPVLVQDKLKNAKVVILGCGGIGNHVSVILATSGIGEIILIDNDQIENTNLTRQVLFSEDDVGKNKTEVIKRELLKRNSEISVSEIALNINDYTDLHKVPEADIWVVSADHPFNLINWVNKYCVRANQPYINAGYVNDIAVFGPLYVPGKTGCYECQKKENIDHKIKLINSRFKPATFAPVNNVAAALCAADVIKFIGKYSEPLSLNKRIGIWSDEIKIHSQNMGRSPVCSVCGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccB protein
publication title How the MccB bacterial ancestor of ubiquitin E1 initiates biosynthesis of the microcin C7 antibiotic.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/antibiotic
total genus 107
structure length 339
sequence length 348
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1160 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3h9jA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3h9jA02
4NU6A 4E30A 2J3KA 1IUKA 1MC5A 2Q2VA 4B7UA 5KVVA 3WSWA 3VKVA 3ZU4A 1GFSA 2CVQA 3MJTA 5BNTA 4Z9FA 1YQXA 3GNQA 2OL4A 4GMFA 3UICA 1YS4A 5TC4A 1V35A 5EN4A 1V6AA 1Z6ZA 1Q1NA 1HYHA 1VKOA 1JA9A 1SEVA 5A05A 1KETA 1P0FA 1HE4A 5CDUA 1EVIA 4MVJM 2NVBA 1R4NB 2OGUA 4GGPA 4NDNE 2AG5A 2ZYGA 4FN4A 4D0SA 3RUCA 1NP3A 4XA8A 3DXFA 5DBGA 4BS9A 4E5NA 1GUZA 4NIMA 3ZNQA 2BFMA 1E3SA 3B1FA 2A92A 1BXKA 4CLHA 3H9GA 1CEQA 3MJEA 1ZW1A 2DTEA 3BHJA 4ZQEA 3RU7A 3ZGYA 4R51A 3ZI0A 2CZCA 3IP3A 3CKYA 1U7TA 4IQ0A 4RV9A 2H5LA 5G2OA 2OORA 4K28A 4JN6B 4I9NA 4HFMA 1H2BA 3JQBA 4O59O 4TZKA 1C0LA 1W6UA 3VPSA 3WJAA 2JFGA 4BGIA 2NTNA 4MKZA 4RORA 1CQIA 3K30A 5JY1A 3GRKA 2P68A 4Y67A 2NLOA 2HRZA 4JIGA 3GGOA 3K9QO 4QXMA 4JK3A 3KSUA 4II2A 3ZZNA 2Q4BA 3B70A 4CLDA 3GEGA 2X22A 4CUKA 1HDRA 2GZ3A 5B12A 1GZ3A 2FSSA 1PQWA 4J9VA 1ZNQO 4N5MA 3RUAA 1ADCA 2IRWA 4OKNA 1HZZA 3HNPA 1V3UA 2NTJA 1F14A 1GV1A 4G65A 2XXJA 4FFLA 1ONOA 4D0RA 1KERA 2C5EA 2ZYDA 4JP2A 4P38A 3ROMA 2G1UA 1H6BA 4J4BA 4B4UA 1PJTA 3KYDA 4XGKA 1DDOA 3WQSB 2V6MA 4KOAA 5ITVA 1X14A 3LF1A 3C85A 3ENKA 4J16A 3TOZA 2CD9A 4EUHA 1IY8A 3LVFO 2EV9A 3GVPA 3PYLA 5G4LA 4E3ZA 4QFDA 3ICCA 4FDAA 3OHSX 4LCJA 3HHPA 3PFFA 4C7KA 2R6JA 3ZHXA 3AY3A 1YL7A 1WNTA 4CV1A 3NDJA 1RKXA 5I8WA 1LA2A 1LLQA 3AK4A 4RVDA 3ETGA 3I83A 3VDQA 4J6FA 4PFJA 5A9TA 2J3HA 4BNGA 1LXCA 2G17A 1U8FO 4YEDA 4RVUA 4R01A 3ANLA 3L77A 4YYZA 3KXDA 4WLEA 5KJEA 1T4DA 4CM4B 5JCJD 4ALIA 1GDHA 3JQ9A 2O48X 3ZWOA 1W8DA 4BKRA 5AQ1A 5DP2A 4IIVA 4NBWA 4BNUA 4KMSA 4CM8B 3R3SA 1UJMA 3WMWA 3KBOA 2WE7A 4OQZA 2OXIA 2QZ9A 3JQFA 4A5OA 3E82A 4WCDA 3OH8A 3V2GA 5BSHA 4Q3AA 2X5KO 4Q3EA 1U4SA 4E13A 2YQ4A 4RPLA 4BB5A 2YHUA 3JQGB 1T2CA 4ZRNA 2NWQA 2OP0A 3M1AA 5H82A 1NQAO 4PLPA 3AM5A 2FY8A 3ZDFA 3QVSA 4HWKA 5L7YA 4AJKA 1ZBQA 5GY7A 1DJNA 4CMHA 1ISMA 3BXXA 3K73O 4U6SA 4U7WA 3NYWA 4LGVA 4Y6SA 2H63A 2R2GA 2VWGA 2JD2A 3LT0A 2DBVO 2OFPA 1V8BA 3PDUA 3HN7A 4HFJA 4PG8A 1V0JA 3AWDA 3EAGA 3H5RA 1V9LA 2QHXA 1BHSA 5L4SA 2J3JA 5TJHA 3S2FA 1I0ZA 1BVRA 4E5PA 4FJ2A 3WQRA 5AXDA 2HRBA 3RASA 5H81A 1EVYA 2DLDA 3E9QA 3LLVA 5ER9A 4XQCA 1PR9A 1E7YA 1HYEA 1L1FA 1CWUA 3MCVA 3TNLA 1O6ZA 4XDYA 3IAHA 2B0JA 4R9SA 4FGSA 5CHEA 2P4QA 3NTOA 3O03A 4ND4A 3DMTC 3CINA 2AE2A 1NVGA 3WGOA 3VPHA 1U8XX 2I3GA 1YBMA 1P74A 4IQGA 5TGDA 1B8UA 1DC6A 3DMTA 4PLZA 1ZIDA 4QSMA 2NNLD 4CUJA 2BH9A 2Y1DA 1Y9AA 3GFGA 4IY1A 3VC7A 4CM9D 3D5QA 3ST7A 4ROSA 1XGKA 3JQ8A 1JKJA 2P9EA 3DBRA 1XYGA 2C07A 4MINA 1HE3A 1JTVA 1SB8A 3G1TA 3MJCA 4WLFA 4NG5A 3S8MA 2QG4A 2YZ7A 4G5HA 1AE1A 5FEUA 4DA9A 3H5AA 3CUKA 2ZQYA 5HS6A 2BD0A 4P4GA 4CMCA 2Q2QA 4E21A 2X23A 2VHYA 3ONDA 2VOJA 5AYVA 2JHFA 4DLBA 3AI3A 4DYDA 4S3MA 4YT2A 3ZWWA 3RU9A 3BTVA 2X6TA 1D4FA 2B4TO 2QZZA 5CEFA 1GYRA 3WGGA 3KZVA 3PXXA 3E8XA 3CH6A 1ZJZA 3H9EO 5A02A 4DGSA 1U3VA 4CM6A 4LCEA 3QVXA 1Q7GA 3JD0A 3WLFA 2EWMA 4E2ZA 3GVIA 5IDWA 1ISGA 1LSUA 2PGDA 3HZZA 1V3VA 3WMXA 5B4TA 4YQZA 1I2BA 2Q1SA 4MIEA 2WDZA 1RYDA 3T7EA 2W2KB 4NU5A 4RCVA 5BR7A 2VUSA 2Q45A 4CM5A 1PX0A 2HKIA 3Q6IA 3ROQA 5MGBA 4PGFA 3ON5A 1C0IA 2BFPA 2UUPA 4QUKA 3JCZA 2Y05A 3F6YA 3FNHA 3UVEA 2PLAA 1RM3A 1DFHA 2FR8A 1N8KA 1E3EA 1N9GA 1TT5B 1U5CA 3DZGA 1NNUA 2YDYA 3PQDA 4EBFA 4TMFA 1SAYA 1ZVMA 1M76A 3DHYA 3KYCB 3QWIA 3WR5A 3RFXA 1O8CA 1VE9A 3LQFA 4BMNA 1Z73A 4RF5A 1NVMB 3IKTA 4OKIA 1F17A 4IS2A 1O9BA 2AQKA 3Q11A 4JBGA 3T7CA 4CMGA 1FDVA 2D4AA 2C7GA 3JQAD 1B15A 3AUTA 1ORRA 1SPXA 2I99A 2JCXA 2PD6A 5B4VA 1IPEA 5ITWA 5KVQA 3D3WA 4NZ9A 1KC1A 4E32A 1P33A 4WCFB 4TROA 5H83A 3VZQA 3FR8A 5G4KB 3ZW9A 5A4DA 1PJ3A 1AHIA 1ISFA 1I33A 2BI7A 4IPTA 1M66A 2WSBA 3NTQA 4N5LA 3QLJA 3HUDA 4GSKA 4JQCA 4CR8A 3M2TA 1T1SA 2G0TA 4ZJUA 5LC1A 1LI4A 4MKRA 2A9FA 3F1LA 3U4IA 3VTFA 3GHHA 4KUEA 2AEJA 4PZEA 1SOWA 2DBZA 4URFA 3H9QA 1J0XO 3FNEA 3IL2A 3NTRA 4FGWA 3EVNA 3OMLA 2NU8A 1IHYA 2G5CA 2X58A 3ROPA 1YO6A 1R4MB 1U2DA 1HSOA 2W2LD 1SO8A 1H6DA 1NQOA 3PGXA 2BRUA 1QXSA 1G0NA 3OEYA 3U4CA 2O3RA 2VYNA 3ASUA 4KWIA 3NJ8A 3IUPA 1MG5A 4FOSA 2YYYA 3ZV6A 3PFWO 3JD2A 3KHUA 1WZEA 2GUGA 1X0XA 3SEFA 8ADHA 1LQTA 3GZNA 5EERA 5IG2A 1B14A 2GSDA 2QW8A 4PG4A 4OAQA 3NAQA 4ZQGA 1A5ZA 3L07A 1XIVA 3FTPA 2C29D 3WICA 5L95A 2FPIA 3LF2A 4DC1A 3DB2A 5ICSA 1PGNA 4FW8A 4AJOA 4DREA 4A03A 2B83A 3EVTA 1DSSG 1ZFNA 5JMPA 2YW9A 3GRPA 4TRMA 3AOGA 1M6HA 2ZIZA 1ZZEA 4PRKA 4AJIA 4B4VA 2FR1A 3VH2A 3DL2A 5JDIC 1T25A 1Y8RB 2AXQA 1IL0A 5KCZA 5L53A 3UFXA 1ZK4A 4RZIA 4L76A 1HDZA 5AXAA 5T8KA 4W82A 3L0DA 4CQLB 1D1TA 3QRWA 3AJRA 1LC3A 1U3WA 3LT1A 5JDIA 1B8VA 4PLWA 3W8FA 4G2NA 4UAGA 3RC9A 2CY0A 3JQAB 1KEPA 2Q46A 2FN7A 4IXWA 2B37A 4NHEA 4BV9A 5A04A 2O7SA 4FBGA 2VHVA 1I8TA 2NUAA 4R69A 3PI7A 1YJQA 4J7UA 3VVCA 2XOXA 3ZNPA 4BNXA 5JYDA 3JQDA 1KIFA 4TWRA 3JYPA 4EEXA 1VPDA 3E6AA 4AJEA 4KDFA 3AI2A 3TSCA 5HA5A 3STHA 2EJVA 1ZXBA 3QWHA 1E7WA 1X7DA 2NACA 1NAHA 4A7PA 1A9YA 3OETA 1B0AA 2PNFA 3VH3A 3O8QA 2AQHA 4K26A 4QO8A 1S7CA 3GZ4A 1A7KA 3DBVO 3RFVA 3TZCA 1ISIA 3JQ7B 1SCUA 1MB4A 1VL0A 1UXGA 1HLDA 5FYDA 4GBJA 1GCUA 1Y8QA 1S6YA 3PIIA 4AVYA 5CDYA 1YONA 4N7RA 1UZMA 1I10A 1FDSA 4YRDA 3WFIA 5JBIA 1VSVA 3GY0A 1HDXA 4IJUA 4FSHA 1UP6A 5BNFA 4WASA 3TWOA 5HWSA 3DR3A 3KRTA 4I1IA 2WYUA 3R0IA 4OJNA 4XYGA 5G0UA 1YWGO 2HMTA 1HETA 4BNZA 5I7VA 4CLRA 1T1RA 2QQ5A 2VOEA 4GX0A 2O4UX 4NK4A 4XYEA 5COBA 2NU7A 5JDCC 2YHIB 4FQ8A 4KP7A 3FWZA 1TA4A 1YDEA 1XU9A 3GNSA 1HTBA 5IZ4A 3GAZA 2OHXA 1SC6A 1UP7A 4IDEA 4A27A 4YJFA 4XRGA 3GUYA 2Z1MA 2BFOA 3GGGA 4FFRA 1C1XB 2BI8A 2D8AA 1C1DB 1GUFA 1LRKA 2ZB8A 2FWMX 3ASVA 3W6UA 1G6KA 2ZCVA 2ZKLA 5K6AC 4HKTA 5EJ2A 2VWPA 3CXRA 1DXYA 1EBFA 4D41A 2GPTA 1A9ZA 4BO1A 4DIBA 1ML3A 4IM7A 4TKMA 4CJXA 4U5QA 5T67A 3SC6A 1ARZA 5IDYA 2D1YA 4RL6A 5JC1A 5BSGA 1IB6A 3DBLB 3HDHA 1FXSA 1N92A 1Q7BA 1W0CA 4MP6A 1KY5A 1I01A 2VT2A 4M55A 2G76A 3DBHA 1YKFA 3PP8A 4QQRA 1YOVB 4WKGA 4B7XA 1X15A 4I5GA 2P5YA 3KM0A 3QY9A 1EE2A 2DUUA 2VT3A 3A4VA 4AJNA 2H6EA 3RROA 4EDFA 5JNLA 1GD1O 2DBQA 1IOLA 3T4XA 4LRTB 4M86A 4ZA2A 2W2LA 3GH3A 2BF7A 2DBRA 4H3VA 2B5VA 4E12A 5DDIP 5TRTA 1ISHA 2XF8A 1DIGA 1PJCA 1XA0A 2X0IA 2WM3A 4BO0A 1UP4A 1X7GA 2E48A 1PL6A 2PY6A 4J0EA 2UV8A 4R1UA 2NVUA 1BW9B 1H6AA 1OI7A 3MTJA 3E03A 4MVJG 5TT0A 5DCWA 1CDOA 1F12A 4RPGA 3ZWAA 2XPCA 2R00C 1CF2O 2EW8A 4LISA 4YWJA 4NBRA 4AJLA 4RLSA 1KEUA 2C5AA 4B79A 2QRKA 4Z0PA 3L6EA 4HP8A 3RAJA 4KTVE 2V7PA 4D46A 3SJUA 3RKRA 4EI2A 2PV7A 4GAEA 3ZHBA 1JVSA 3GMSA 2ZTLA 3ONFA 2VUTA 3PHJA 1MX3A 1HDOA 1YE3A 2Z1NA 3RC7A 3PWKA 2GF2A 3QHAA 1AXGA 4CQMA 2GZ1A 3KOUA 2ZATA 3ITKA 5I7EA 3CE6A 3ENNA 4MVJD 4Q39A 3L6DA 1OBFO 5EL0A 3C1TA 5IZCC 2RIRA 1ZEMA 2VYVA 5CEEA 3PHGA 1E7MA 5EQFA 2JHGA 3SJ7A 3QW2A 4B3JA 4ZRMA 1EE9A 2TMDA 2EJWA 1W4ZA 4DIOA 3KB6A 5THQA 5CP8A 1PL8A 5KKCA 4HV4A 3OECA 4GLOA 3BMOB 1TT7A 1O0SA 1T2EA 3DEYX 4UUNA 1R16A 2IZZA 1PJ2A 4B7CA 3COSA 1WWKA 4CLXA 4WPGA 2Z5LA 4DC0A 4DL9A 4N18A 4AICA 1P3DA 2X4GA 4RQTA 2B69A 5TX7A 1BTOA 5IN4A 4FIZA 2C0CA 2NSDA 1KVRA 4MKXA 4IMRA 1TB4A 5G0WA 2UUOA 2VHWA 2X0NA 3K8ZA 5I7FA 4DBVO 1JDJA 1JKFA 4Z3KA 1HDYA 4OO3A 1BVUA 2YV3A 3IC5A 1NHWA 1ID1A 4XB1A 3ADOA 2VTDA 4YAGA 5A3VA 1QYXA 4RF2A 3LT2A 4FR5A 1PZHA 3MWEB 3JD1A 1LQUA 3SBOA 4D3FA 1BXGA 2J3IA 3O4RA 1U3UA 2VZ0A 4GMGA 4E33A 1NTOA 3HE3A 3ZN2A 1LX6A 1RM0A 4BO2A 3KYDB 4FC6A 4BVAA 3W4JA 4D45A 2PGJA 2FOIA 3Q1LA 1Y81A 4QO7A 4L4XA 1QKIA 3QV1A 4OHUA 1OC2A 1K6IA 5GMOA 1A4UA 1FK8A 3KLPX 4XYLA 3WFJA 4YR9A 4Z9YA 1W73A 3OJLA 1DIAA 1R0KA 1YL6A 4E0BA 4RJTA 4UVHA 3TL3A 1XKQA 2OOSA 3Q9UA 1HLPA 1HZJA 4XD2A 5CG1A 5TQVA 3K5PA 1BG6A 3KVOA 3OA2A 5JAQA 1DFGA 4IUYA 3JYLA 2PTGA 3E9MA 3QJ5A 4OSPA 3I4FA 2NADA 3NGXA 2B4RO 1JQBA 1SEPA 3UGKA 2O50A 2BLLA 1WLYA 1GR0A 4JNKA 1H9BA 1DB3A 4WOJA 3ONEA 1E3WA 2AE1A 2DM6A 4YRBA 2O3UA 2TMGA 4EUEA 3MEQA 1LC0A 3WGIA 1RPNA 3A9WA 1H93A 4HXYA 3BMNA 3K92A 5KJ1A 3JD4A 1TVEA 1GQYA 5CDSA 2WD8A 2ILTA 4FFMA 3FBTA 1MV8A 1UAGA 3I6IA 4KWHA 1SBYA 4W7HA 2D0IA 2ZB4A 3H65A 3I9OA 3AW9A 3WX0A 2GD1O 2B5WA 1IE3A 3F4BA 5DZSA 1O95A 1XU7A 3D1LA 3V2HA 9LDBA 4JROA 3ETEA 4EEZA 1VM6A 3ZWCA 1DAOA 1PGPA 1FDUA 4JX8A 2VHXA 2IXBA 3EDMA 4AJJA 3BTOA 1PWZA 4HNHA 3LC2O 1SMKA 5AXBA 4DYVA 3KETA 3WSVA 2NU9A 1MLDA 4K6FA 4JBHA 5L3ZA 4I8XA 3VKUA 1R4NA 6ADHA 4ALJA 4DMLA 3ZNOA 4IDAA 3UCXA 2YV2A 1BRMA 3DZBA 1LSOA 2D2IA 3O9ZA 4J1QA 2EKQA 2WD7B 4AJ4A 2IZ0A 1YB5A 1LTHR 5BQFA 3H9UA 4YJGB 1GPJA 5A9SB 2Y1OA 3AI1A 3Q3CA 3ANNA 5HRUA 3QWFA 1VJTA 3EZLA 2X8LA 1K3TA 5A5EA 1ADFA 1T2DA 5HM8A 4Z3DA 1MG0A 1MFPA 2V6GA 4NBUA 1I30A 4BNHA 2DFVA 4NBVA 4XR9A 2JJYA 4DXHA 2GNAA 2VZ9A 3BHIA 1QV7A 4R1NA 1MGOA 3PWSA 2AQ8A 2IEDA 4H7PA 1XCBA 4E5YA 4IDCA 3WIDA 1OZAA 4MVJA 4ZQBA 4I5FA 1IYZA 3CZMA 1XQ6A 2BGKA 2EGHA 1KVUA 1LDYA 2WYVA 2HMWA 3OJOA 1OAAA 3PHLA 3VPFA 3I6QA 1Q7CA 1PS9A 3IDSA 3V1YA 4R1SA 3GVXA 4MVJI 2O23A 2E37A 1P1HA 4TSKA 1PEDA 2Y1GA 1KY4A 3HFGA 3DZIA 1J5PA 3AUAA 5T57A 4TKLA 3RJ9A 3L9XA 5CDGA 1E5LA 3PLNA 4CUZA 4W4TA 4JLWA 3NUGA 3VH1A 3ZV5A 1VRWA 1MXFA 2X9GA 5TNXA 4J1NA 4PLTA 5B1YA 2PZMA 1GCOA 3DHNA 4FD3A 1U9JA 3PJEA 1HYGA 4ND2A 4YAIA 4L4SA 5GZ3A 1YBAA 1E3LA 2GERA 1WZIA 4OM8A 3GN1A 3NT4A 1ENYA 1P9LA 2GDZA 3MZ0A 3S2EA 5L40A 3HSKA 3L4BC 2DVMA 2J8ZA 4HNGA 4CV0A 1DEHA 3K96A 1Y7TA 2ZK7A 4YACA 1PZEA 2ZJ1A 4J3FA 4L4RA 1NPDA 3IP1A 1CRWG 4RO0A 3UKOA 4C7JA 3L4BA 3BYZA 4QFCA 3QA9A 2CVZA 3VH4A 2Y1EA 1B2LA 1UDBA 1NR7A 3V8BA 1M75A 2VTEA 3ADPA 3I3OA 4IGFA 4TRNA 1H2HA 2YFQA 3C1OA 3WYEA 3MJ4A 1I3MA 1QRRA 3RUHA 4YT4A 5I8ZA 4F45A 3PZRA 4TRRA 5F5NA 3KLMX 5COQA 5L51A 3ZWVA 3O26A 3PQEA 4CM4A 2DQ4A 3UHAA 2C2XA 1H5QA 1PJSA 1YQGA 3SC4A 1DAPA 4TQGA 2YUTA 4BIIA 1TEHA 4GX5A 4BL5A 1EUCA 3FF4A 3PDJA 3AFMA 4R3NA 1IHXA 2E4AA 4UUPA 4YJDA 3U9LA 3UOGA 3PYXA 4H15A 4XKJA 3PEFA 1A7AA 1EQUA 5HS4A 2JFFA 1WP4A 1YH3A 3JQGA 2AG8A 1E92A 4RF4A 1C14A 1B26A 3JQ6A 3WBFA 3G1UA 3OEWA 2B36A 3OIDA 1K6JA 3WBBA 2PH3A 4IDFA 2Q3EA 1ZMOA 3EHEA 1KVTA 1P31A 1HT0A 3E1KA 2OBNA 3H2ZA 3CZRA 5C7LO 3DZKA 2CMDA 4KUGA 1QYVA 2CDBA 1DHRA 2A35A 4NNJA 4UVEA 4B8ZA 1GADO 3LC7O 1UXHA 3AOEC 4BO8A 6LDHA 3ZWBA 1XR3A 5BT9A 5IDXA 4XX0A 5F5LA 2BELA 3RVDA 1H6CA 5GZ6A 3NX4A 1EZ4A 1AUPA 2Q99A 4ITUA 4LK3A 4F6LA 5JXWA 4RPHA 2DPGA 2W8ZA 2VRBA 3FSRA 4RF3A 5CFZA 2EF1A 1U1IA 2GN8A 4CLOB 1H9AA 4ND5A 3WNQA 1JAXA 1FDTA 3D7LA 4OYRA 3P2YA 4PG7A 1CERA 2PH5A 1TI7A 3GAFA 4J9UE 3SLKA 4YAEA 4L75A 7ADHA 1JVBA 3W8DA 1YB4A 4H16A 2X0JA 4W9NC 1GY8A 1NASA 4FFPA 4YJHB 5EPOA 5IFLA 3SXPA 2HAEA 4NFHA 3GGPA 4W99A 5EQDA 4P4LA 5CPBA 1R66A 3VTZA 5A3JA 1QLJA 4WLVA 1GEEA 1BGVA 4D43A 3B20A 4QEDA 3IJRA 3GDOA 1BDMA 1FDWA 3TL2A 3UH1A 2HK8A 3G0OA 3KV3O 4F3YA 4ALNA 3BZUA 5JCJA 3RSHA 2XAAA 3VZPA 1PR3A 4X54A 1LDBA 4RPKA 2WYWA 1Z7BA 2Y1FA 2RCYA 1X13A 4FJ1A 3V5NA 3GPDG 3F4LA 2BFAA 2OZPA 1D3AA 4PZCA 3TPCA 1HE2A 1PJBA 3NV9A 3HJAA 4M8SA 1PS0A 4YDRA 3GT0A 2J5QA 3WYCA 5JC8A 5FFFA 3V2UA 1DHTA 5U1PA 4A0SA 3KEOA 5CEJA 4GGOA 2PKQO 4J49A 3PJDA 4WE3A 1N7HA 4MVJP 4A2CA 3C8MA 4QECA 3AM4A 4BNFA 4HX5A 1HXHA 5FWNA 3ZWXA 1P1KA 1UAYA 1LNQA 2WTBA 4R5MA 2W2KA 1ZK2A 1DLIA 4BGEA 4XWYA 2O2YA 1DRWA 1LDGA 1P1RA 2ZJ0A 3PK0A 4PVDA 5F21A 3O8QB 2JCYA 2O4CA 1B16A 1Y5RA 3TQHA 1F0YA 2GZ2A 2VQ3A 3F1KA 3PJGA 4Y6RA 4BNJA 3ZH2A 2W4QA 1NHGA 1TT5A 2AEMA 2EIHA 3RBXA 3R3JA 4CL8A 2D5CA 2HJRA 5ES3A 1EFLA 3DOCA 3IJPA 1ZEJA 3PLRA 4W6ZA 5CDTA 2AA3A 5IXSA 3W6ZA 4D79A 4LVUA 3I9NA 1DFIA 1WMAA 2GO1A 1OC4A 1JN0A 1QG6A 3KTDA 1PJLA 4DLLA 4BO4A 5C37A 1ZSVA 3T4EA 3H3FA 3ZHZA 3GF4A 4QTZA 4WCFC 2WE8A 2IYOA 2FZWA 2Q1TA 4J91A 4RZHA 1I2ZA 4NI5A 3DFZA 1RWBA 4J0FA 4RVSA 4WLNA 3OSUA 3SLGA 3P5SA 4WCFA 1VL6A 3WWZA 4CM9A 3ZU3A 2FZEA 5JCXA 3OQ6A 4JXKA 4U6QA 2AMFA 3I1JA 5G4KA 3VHRA 5TLSA 4CR7A 4ZD6A 2NVWA 3SVTA 3Q2IA 4OMUA 4R1TA 5JAIA 1GAEO 5U4QA 4I08A 4CMIB 5KIAA 3UXYA 2GRAA 4TVBA 4PLGA 2I3AA 3VZSA 5JE8A 2Y1CA 3SX2A 2PK3A 5CAEA 4J2OA 3BIOA 3FCOA 3P19A 2RBEA 3ZWMA 3HDYA 4BOYA 3V1UA 1DC3A 1R4MA 4LSMA 2QRJA 4PLVA 2GASA 3ZWNA 3BMCB 1KEVA 1D8AA 4Z0HO 3H8VA 5EMHA 2V65A 1HDGO 1ENZA 4Z6KA 1MP0A 1E6WA 5AXCA 3OQBA 4HADA 3GK3A 4RQUA 2O7QA 4R9RA 4BUCA 3G79A 2QYSA 4W7IA 4XYBA 5C3MA 5B37A 3FD8A 1HE5A 2P9CA 3S55A 3TDKA 4R41A 4L8VA 5I9LA 1YXMA 1T2FA 1QYWA 1XEAA 3GQVA 4CMJA 5G0SA 4R5HA 4UULA 4UUMA 2Q4EA 2J6IA 5A03A 4GH5A 4BNMA 1XELA 3RFTA 1JWAB 1R12A 4ALMA 3HDJA 3LU1A 5JFOA 3GR6A 2PKQP 4CQLA 4Q3NA 2NVUB 2VHZA 3RJ5A 4P8RA 4RVFA 5JDCA 2GN6A 1YJ8A 4FFOA 2C82A 4EW6A 4JJFA 3F5QA 3JQAA 3N7UA 2CDAA 5TS3A 3UN1A 3QWBA 2POQX 4YB8A 5L7WA 4CMEC 5DN9A 4NJMB 1Y5MA 4NR0A 5C7OO 1RM4A 2O3TA 5DCYA 3MOGA 2HDHA 5K6AA 3BMQB 4E2XA 4CMEA 1Z7EA 2JAPA 1DRVA 1DC4A 4EITA 2I76A 3K2EA 4OXKA 4XIYA 4GKVA 4E31A 4KQWA 4I9UA 3BTSA 3ZU5A 4BKOA 4RDIA 5ADHA 2VCYA 3AUUA 1ULSA 5EIOA 4WLUA 3LSYA 2EERA 1EDZA 3S1LA 1SNYA 3JQ7A 7MDHA 2UVDA 4FFNA 4XIJA 1PGOA 1GYPA 3F46A 1XLTA 4PN3A 4CM1A 5EESA 4GLLA 3WTCA 1PWXA 1ZKMA 3UW3A 1B7GO 1LRJA 3I9JA 3H5NA 2Q49A 4II3A 3KYBA 4BMVA 1UUFA 1UH5A 4AJ2A 4IINA 1J4AA 4UEKA 3BTUA 3D0OA 3VDRA 4MIYA 4CQMB 2HMSA 2VRCD 1F8FA 3GEMA 1GYQA 3GPIA 1AGNA 4LSWA 4J4HA 4L9RA 4LMPA 4RDHA 3RBVA 4GX1A 4BNVA 4C4OA 2C54A 3FN4A 5KKAA 3OICA 5ILGA 1HWYA 3DHEA 3JYQA 1E6EA 3RIHA 2R00A 4WECA 3WGHA 3K6JA 1CJCA 4ND1A 3OJEA 3DTTA 1VL8A 1YL5A 4WLOA 4ESOA 2YHIA 1ISJA 3PVZA 2FSVA 3GN2A 3U4HA 3LT4A 1NBOA 1GU7A 3DMYA 2VNAA 3N58A 3IOYA 4NJOA 3LK7A 4IS3A 1GV0A 1F06A 2C2YA 3ZWYA 2P9GA 2BKAA 3HB5X 4BB6A 1ZK1A 1C1XA 2PD3A 3RBZA 4XYMA 3FNFA 3RC1A 1C1DA 1NPTO 2BGLA 5BNIA 3EGOA 5JO9A 2Y93A 1O94A 4BO6A 4PLYA 4M49A 3WGZA 1P1IA 3TFOA 4I5DA 3UCFA 1MFZA 5A06A 4RGBA 3HFSA 2F00A 3I9KA 3LZ6A 3ZU2A 3OM9A 4UUOA 3H7AA 4J7CA 4BNWA 3KEQA 1GEGA 4YXFA 2EEZA 4FCCA 4IQ8A 4JCOA 2F1KA 3DBLA 4OXNA 1WAMA 1E1MA 2A4KA 4L73A 4IDDA 4HFRA 1I3KA 2Q2WA 3U0BA 4MVJE 3UF0A 1YOVA 4MP8A 3KSDO 3QVTA 4GQAA 4CL3A 1SOVA 2VNSA 4RVGA 3H9JA 3OQ1A 4MDHA 2RHCA 4OXYA 1X7HA 4UREA 2CSUA 4RVHA 5KJFA 1Q0HA 1C3VA 3W1VA 4A26A 3TF5A 2EKPA 4CPDA 4BKUA 4AG3A 2HLPA 3M6IA 5I7SA 4FB5A 1BW9A 1EQ2A 5DNAA 1YVEI 3VOSA 2HCTA 4XQEA 1FMCA 2PFGA 3CTMA 3DAGA 5EINA 1CYDA 3WXBA 4WNCA 1LRLA 1RYEA 1XG5A 3QVWA 4CM3A 5IF3A 1V3TA 2J5RA 2WEKA 3PRJA 2X9NA 4NMHA 1YQDA 3QSGA 4ALKA 4PRLA 1DIHA 4UVDA 1U3TA 3C24A 3C7DB 1PGQA 2Y68A 4JP3A 5U9CA 1ZK0A 4BGVA 2E82A 1G0OA 2H9IA 1E7RA 2PZJA 2X86A 1H0KA 1KYQA 5KTKA 1R6DA 2Z95A 1NVTA 3RUDA 5JW6A 1EMDA 3ANMA 2ZCUA 4QX6A 1QORA 4R16A 1D7OA 5DT9A 3ZCXA 3JQBC 3GOHA 1WDKA 2GCGA 3M1LA 4M54A 3WOHA 1DRUA 2ZTVA 2EXXA 4O0LA 5T6BA 4GVLA 4DPKA 2H1SA 3E5RA 1QYDA 4PIVA 4BO9A 2FPGA 1MXHA 4EUFA 1R0SA 2IODA 3BMOA 4A10A 2QIOA 1ZK3A 3G17A 3G49A 4FS3A 1PJQA 1ENOA 5I9MA 1F8GA 1ZSNA 4Z0TA 1HSZA 2GYYA 2JD1A 4IJVA 5JO0A 4R68A 2Y0EA 1LJ8A 3RQSA 4IZHA 1XWFA 3RD5A 1GZ6A 3VPGA 4BNYA 2EP7A 5G0VA 4NK5A 2JKVA 5LCXA 2EKLA 4I9HA 2C20A 1GL3A 3FWNA 3DWFA 2PZKA 5DULA 1ONPA 2HK9A 4PG5A 4XGNA 3UCEA 1VLLA 2CDCA 4ZVVA 4B3IA 5FF9A 4GX2A 4DQXA 4D3DA 2I65A 1LLCA 1P77A 2UAGA 2IYPA 4S1VA 2NU6A 4ZU3A 3HG7A 4BMSA 2AQIA 5FI3A 3P2OA 3IS3A 1MA0A 4J7XA 4P22A 4XGIA 3ROKA 3A28A 3HDQA 4Z9XA 5BSFA 1XQ1A 2X9VA 2ZTUA 1FF9A 3DQPA 4K1LA 5DCUA 4BV8A 3WGYA 3EK2A 3ZV4A 3UAGA 3GFBA 4J4TA 2VRCA 1I5RA 3AU9A 4Y98A 4YBZA 4N5NA 4AFNA 1EEHA 4AJHA 3NDIA 3PIDA 3HN2A 1YB1A 4Y6PA 4YA6A 3Q9NA 3MJSA 4L0QA 3INTA 5L7TA 2P5UA 1A4IA 3DOOA 3ZHYA 2VN8A 1DIRA 2VUUA 3AY6A 3GVCA 1P44A 3KO8A 1N7GA 3DFUA 2O3JA 4IDBA 1NM5A 3N74A 3U5TA 2ZYAA 3WJ7A 2OBYA 1Z74A 1LBEA 4MOWA 1BWSA 4PLHA 5IJZA 3ITDA 1PTJA 2B4QA 3PJFA 4WNIA 4FC7A 3H4VA 2YY7A 1ZXLA 2ZQZA 3DAPA 3JQ9C 1Q2XA 3JQ8B 3NDRA 1WMBA 3DBRB 3IKVA 1I3NA 4XQ9A 5JAMA 4NPCA 1G1AA 1PSDA 2C59A 2X1HA 3AFNA 3JSAA 4JGBA 4E2WA 3AY7A 4MP3A 5JMWA 1DC5A 1MC4A 4JBIA 4M89A 3QQPA 4O1MA 2BHLA 3JQFC 4FPXA 5HBRA 4BNKA 2YDXA 3WYBA 4CODB 3CMCO 1N2SA 2V6FA 4CMAA 1ADGA 4WOKA 4AL4A 5J23A 2W98A 3L9WA 2OUIA 3H2SA 1PQUA 1GTMA 4R54A 1KC3A 3GLQA 1BDBA 1K5HA 4CR6A 4ZN6A 4BKPA 3BHMA 2VYND 2NV6A 3S2IA 4QT0A 3ETDA 2OMEA 1EVJA 4O6VA 4OSOA 4Q3DA 2BMAA 4GWGA 3A1NA 1K89A 1NQTA 4FJ0A 4KTTE 1Y6JA 3LYLA 3WQQA 1GQ2A 2YFHA 5DF1A 3KSZO 1OOEA 1YGYA 1LSJA 2WD7A 1E0DA 1LDEA 3C1AA 3NT5A 5F1KA 4IXTA 4HUJA 4CM7A 4YJGA 2HSDA 1QLHA 4CV2A 4A73A 4E5MA 2D59A 2P91A 4BNNA 5A9SA 4UEJA 3EMKA 5TSDA 3WDSA 2E6UX 2PD4A 3PHHA 3TJRA 2HUNA 3JYOA 1N9GB 1JAYA 5T5QA 3E9NA 3NGLA 4GWKA 2I66A 1M2WA 1UZLA 4ND3A 1P1FA 3EYWA 1LU9A 3CIFA 1VSUA 4DWVA 1D1SA 2FRDA 2JD0A 2VZ8A 2EGGA 3EW7A 4BO7A 4OIMA 5KVSA 2CFCA 4CM8A 3IUSA 1EK6A 1ADBA 4D42A 4BNIA 1OFGA 5DOVA 5IXYA 1RJWA 3VAZA 4XDZA 4WK6A 2BGMA 1TLTA 3D3WB 3W8EA 2B35A 1Z75A 3AM3A 1KVSA 4EJ6A 3TZQA 1JWBB 1GZ4A 3WIEA 3U09A 3P7MA 3IQDB 1IZ9A 3F9IA 2HMVA 3R6DA 3FTNA 2I6TA 5CG2A 3I5MA 4KZPA 1UXIA 2Q1WA 2FP4A 1EK5A 4R3WA 3C7AA 3RUFA 4WEQA 1ZSYA 4Q3CA 1FJHA 4ILKA 1IZ0A 2GR9A 2P4HX 2SCUA 1J6UA 1ZJYA 3GEDA 3PQFA 1KS9A 5AVOA 1E3IA 1YBVA 2D3TA 2FPPA 4CMBA 4MO2A 1JLLA 3V1TC 1R0LA 3FHLA 4DMMA 1VKNA 3WGQA 4PG6A 4DQUA 5ILOA 1CQJA 4BQPA 2WMDA 4GI2A 5LDGA 1NFRA 5L45A 1DJQA 3WS7A 5A5FA 3AOEA 1K6XA 3OA0A 3GC6A 2X5OA 4P4NA 4UVIA 3QP9A 3EY4A 1T26A 1GUYA 1EUDA 4OH1A 3RKUA 4DPLA 1VJ1A 2FMUA 2PGLA 3K2BA 3C7CB 3FR7A 3OFSA 4CV3A 1T24A 3B6ZA 2FHSA 2JL1A 2W90A 5ICMA 3GZNB 2EW2A 2PWZA 3K31A 3PHIA 4M1QA 4XCVA 1LSSA 4E4YA 1TXGA 2Q1UA 3FBGA 4EYEA 4ZICA 1UXJA 3NKLA 1U2GA 1PJ4A 1U4OA 4B4WA 1C0KA 4N54A 3D3EA 3E48A 5A1TA 3RWBA 4E5KA 2I9PA 3WG9A 5ENDA 4YT8A 1JKIA 3WLEA 4W9NA 3WWYA 5TJ9A 4M87A 3RC2A 1LDNA 5F1OA 1QMGA 1NWHA 1WXDA 4E6PA 5C7IO 3GDGA 5KVCA 3DZHA 3OJFA 1EFKA 3GUCA 3LLSA 1C0PA 3FPLA 3QE3A 3DAFA 4OOEA 5FI5A 1N1GA 5KWEA 3GNTA 3WB9A 5L4LA 3ZWPA 4GKBA 4HY3A 1VC2A 3EZYA 2HK7A 4DLAA 4WGGA 5IZCA 2DT5A 1HDCA 2X5JO 1K2WA 3JD3A 5ENVA 2E49A 4J2HA 4IMPA 4YRAA 2OP1A 5L4NA 4Y9DA 5A9RA 1PU2A 3NT2A 5DBFA 4EGFA 3TZHA 2A94A 2EG9A 1IULA 1ONNA 2X7HA 1BMDA 1ZH8A 4BNTA 2WWRA 3VVBA 4Q9NA 5GZ1A 1DPGA 3FNGA 5JPIA 4KDEA 3AUSA 4OGWA 3DOJA 2PKRA 2UYYA 5HTOA 1E5QA 4ALLA 4E2YA 2DU8A 5DBIA 1HRDA 1M67A 3I9MA 5C5IA 2GN9A 2Y99A 1CETA 4NFSA 2HQ1A 2AHRA 2AEFA 3PWZA 1X0VA 2I5PO 3G3EA 4INAA 3FRJA 2UDPA 4GPD1 3S2GA 2JCVA 3ZNNA 5K0ZA 1QYCA 4I5EA 1Q0LA 1CIVA 3D64A 1LUAA 1XSEA 3HWRA 4OOFA 4DIFA 1PZGA 4UEOA 3W4KA 1E77A 3Q2KA 1RM5A 3GA0A 3ICPA 2J5KA 4GL4A 2GN4A 2O2SA 1H94A 4G81A 2YJZA 1Y8QB 4CLOA 3KYCA 3BA1A 3OIGA 4OL9A 2Y0CA 2DC1A 1NAIA 1KOLA 1ENPA 4TRJA 3ZW8A 4NQZA 3I4CA 1P45A 4PZDA 1R15A 3Q0EA 4XEHA 1PIWA 4YJHA 1VJ0A 3PTZA 1KVQA 3H6KA 2JFHA 2CNBA 1WDMA 3GHYA 4YTEA 4TVOA 4YCAA 4F46A 3BAZA 5MDHA 5TIIA 2O3SA 4XQGA 5KJCA 1K0UA 1N5DA 3L6OO 3OJ0A 2DPHA 4J90A 5COAA 3U62A 3B1KA 4BO5A 1E7SA 1NXQA 4O63O 3QVOA 3R1IA 4IGEA 5T8KC 3CPSA 3GMDA 4CLRB 4AJ1A 5T64A 2CUKA 2HMUA 3RCBA 4DUPA 5B4UA 2RHRA 4OQYA 4K6CA 3RUIA 2VYVD 4BQRA 1I2CA 2O3QA 2Q50A 1B8PA 1VI2A 1E1LA 3OF2A 3TRIA 1LLUA 2NTVA 4YJFB 4MJLA 3TZKA 2LDXA 1DOHA 1SB9A 4NBTA 5I9NA 1A27A 1JW9B 1LLDA 1AXEA 1P1JA 2EP5A 1ZCJA 3WTBA 1ULUA 2CF6A 2WJPA 4NFYA 2RH4A 4J43A 4DVJA 4WUVA 1PGJA 3X2FA 1MUUA 4LMRA 4RPJA 3F5SA 4KUHA 4LW8A 2ZB7A 5TT1A 2XXBA 4GVXA 1E6UA 4IIUA 3IIEA 1NWCA 3MWDB 1DBVO 4CQMD 5JAZA 1WDLA 2ET6A 1AHHA 4Q3BA 1EVZA 4F6CA 1I32A 1UZNA 2NM0A 3EC7A 3IMFA 2CF5A 5THKA 5DP1A 3DBHB 2I67A 1L7EA 3A14A 5JSFA 1I24A 1T2AA 1OMOA 3I52A 4K9DA 2HO5A 1YDWA 1Q0QA 1E1KA 2QRLA 3U3XA 2HJSA 2ZTMA 1Y1PA 4BHTA 1E3JA 2EHDA 4MPDA 5F1PA 1NQ5A 5KJ6A 4PVCA 3INGA 1EBUA 1HF3A 1XHLA 3ABIA 1PQPA 4B3HA 1N1EA 2GLXA 2NQTA 1NPYA 1X1TA 4DTIA 1Y8RA 3QWAA 4CLEA 2IXAA 4DRYA 3M2PA 2DKNA 3JV7A 9LDTA 4HFNA 1DO8A 4PLCA 1J49A 1ZMTA 3HB4X 5K9ZA 4U0JA 5LDHA 1DIBA 4RLHA 1GQQA 4YAKA 3A06A 4FOOA 1L7DA 1P0CA 4PCVA 3JTMA 1UXKA 3GG2A 1NR1A 4U8GA 3JQEA 5CPFA 2RH8A 3B1JA 4PLFA 2X0RA 4CMIA 2QYTA 1HEUA 1WPQA 2ZB3A 1KBZA 3L4SO 4IJWA 4CMKA 3F3SA 3D5TA 4JJGA 2PA3A 3PZBA 2DTXA 2PZLA 4U0KA 1I3LA 3E5MA 8LDHA 1B3RA 1DLJA 4NH4A 1QP8A 3OP4A 2YQ5A 4GSLA 4ZQFA 3CMMA 3BMCA 2PR2A 4XJTA 3ZV3A 5AOVA 2IEBA 5IN5A 1A71A 3MOIA 5L9AA 4DPMA 3W4IA 3GVHA 4ZGWA 1U5AA 4D44A 5KNLA 3DC2A 4D7AA 1LDMA 2G82A 1Z82A 4BKQA 5G0TA 4BNLA 1X1EA 3AU8A 3MTGA 3OIFA 4YAJA 5JYEA 3NRCA 4IZIA 4UVGA 4O5OA 3E18A 4LRSB 1WVGA 3FI9A 4WJZA 3WNVA 4BO3A 1NFFA 2VWQA 4ID9A 4YPOA 4XJSA 3PYMA 2DUWA 4ONEA 1NFQA 4XB2A 4ZQHA 1NYTA 5ER6A 2V6BA 1SZJG 2D5AA 3LDHA 4DBZA 1BXZA 1O5IA 1PZFA 3U49A 1NX6A 1EDOA 3D4PA 2DAPA 2JAHA 2HU2A 1O89A 1PL7A 3DZJA 3U4DA 1B3BA 1IPFA 4EZBA 4KQXA 3ULKA 3VZRA 3RUEA 4D3SA 1HKUA 4YT5A 4AJPA 1XDWA 3OBBA 2IZ1A 1AN9A 3JQCA 1KEWA 4HBGA 4MVJF 4MVJH 4ZHSA 1BXGB 3DTYA 4IJKA 1R37A 2C7VA 2DFDA 2IDZA 4IBOA 1M6WA 4XR4A 4EJMA 3D4OA 1QR6A 4DQVA 3F47A 2GGSA 5F3RA 2RAFA 2NQ8A 4NJMA 1ZUD1 1YRLA 2Y0DA 3HADA 3O38A 5TF4A 2DTDA 5DOZA 3DZFA 4B8WA 2P2SA 1E7QA 3BMQA 3TN7A 3INRA 2YV1A 1BSVA 3NEPX 4L74A 3X2EA 2VWHA 4LN1A 3GG9A 3DONA 4IDGA 3H3JA 1JU9A 3DO5A 3I23A 4YQYA 2Y67A 3I9LA 3RI3A 1UDCA 2IE0A 2Y66A 4XZ3A 5JY6A 2QX7A 5IAAA 1QSGA 3FPCA 2AW5A 4Y8VA 5KOIA 3CEAA 3JYNA 1GPDG 3KUXA 3VPXA 3ORFA 5IDQA 1T4BA 3D4NA 3MJVA 4J1TA 1UDAA 3WGTA 3QIVA 4J1SA 3EUWA 3TZ6A 5JS6A 1UR5A 3UUWA 5JLAA 1U7HA 5BSEA 2FR0A 4WEOA 4B4OA 1PS8A 1E3WB 1E1NA 1I36A 4R4JA 4JJIA 1Y9EA 1U28A 3C3XA 3TOXA 3BMNB 1HL3A 1ZO8A 4MIOA 4TZTA 4BGUA 2OO5A 1EUZA 3NJ4A 3PGJA 4LVCA 2LDBA 4XRRA 4YVFA 4EJ0A 3PPIA 1A72A 1Z45A 1LEHA 3DDNA 3GDFA 3TFQA 3HQ4O 3CSDA 2CVOA 3LC1O 1WW8A 1QV6A
chains in the Genus database with same CATH superfamily
4MTDA 2OV8A 4LEIA 4HHEA 1VRCA 4E94A 1GFSA 4E5UA 4GMFA 1G8GA 1WOYA 1BMFD 2W82A 1DAFA 1ZN9A 5ALZA 3DYVA 4BJ6A 4GOJA 4PO1A 2IDMA 4X7BA 1FB5A 4QPOA 1OPRA 4ZQEA 1G5HA 4WF2A 4R05A 5BQ5A 5B5SA 1SURA 4I9NA 4Y0AA 2K87A 4MKZA 3K9QO 4OKSA 2DA7A 3ZZNA 2R5NA 4N48A 5AICA 2Q9UA 1NTCA 3Q10A 1GZ7A 2X22A 4G5OA 3DMHA 2KIUA 1Q1GA 2Q27A 4MWDA 4F3QA 2NTJA 2RIPA 1E4VA 3R6LA 4FFLA 2DR3A 3KYDA 2VYQA 1R5BA 5LYYA 1X92A 3ROEA 1GHTA 1H88C 4ARUA 4QYMA 5F64A 5HGJA 5SZIA 5HG0A 3NRBA 6PAXA 1N57A 1Z9BA 3VR4A 4PZZA 1MJFA 1RKXA 3CZQA 2ODEA 3TJZA 4KYWA 3OIPA 2JFXA 5C31A 3O0DA 5JCJD 1EZZA 4A8TA 3P26A 2ZE6A 2DHCA 4O5VA 2ZXHA 4IIVA 5LHIA 2FF4A 1LGYA 3OH8A 1BA5A 4KK4A 4DN6A 3LYHA 2R62A 1MRNA 5KHLB 1E64A 1T2CA 2O61A 3R76A 2DH6A 4N7JA 4PLPA 1SXJB 1N1MA 2MMGA 3CX4A 3D7KA 5JJLA 5EHIA 2G72A 3M6LA 2ZXUA 2R7AA 3NYWA 2HJGA 3VGJA 3DZ8A 2EWWA 5HDBB 1OIVA 1OYVA 3AR4A 1OXKB 1W44A 5TJHA 2ZKZA 5H81A 5K99A 1UJ4A 2I22A 4XQCA 2ZXEA 1U0GA 3ETNA 4MV8A 5EJGA 4ND4A 1FTQA 2GAUA 4I4LA 3VPHA 2I3GA 5HVNA 2ZRFA 3FOWA 4Y2XA 3IFSA 1I7NA 1DAEA 1V16A 4FMDB 3G2JA 4GOLD 4LIVA 5LB2A 1HUQA 3SBDA 1GNSA 4DJDC 1DJPA 3JQ8A 1XEWY 3D2BA 5AONA 3A9SA 4F12A 5LOVB 3MJCA 3LPMA 1D1QA 2YZ7A 5HKKD 4JLUA 4E21A 4NQWA 4IPAA 4R9UC 4RDUA 4KB5A 2WY8Q 5TF0A 4TZ6A 3KJFA 3LYUA 3GTOJ 2I8LA 3F78A 3ZTYA 2LSOA 5DHUA 3CR3C 1ISGA 3OX1A 1DZIA 3DHVA 3T7EA 2W6NA 5CXUA 5BR7A 1JI3A 3TFWA 4EKGA 4L8LA 4IIGA 2CK3A 5TDHA 1AY0A 3QSYA 3I12A 3MS2A 2JI7A 2WSSD 1NMZA 1PSWA 1C1YA 4ZGBA 4M0CA 1F17A 5BMVA 2JTVA 3JVDA 3LGXA 1YFHA 2CD7A 2QVBA 5B53A 2QQEA 4I6EA 3I39X 2APJA 1AHIA 2OY0A 4IPTA 4D0PA 3QLJA 5BRAA 1XZKA 1E1CA 2LY9A 2AEJA 3DDCA 1QLWA 4F84A 2NU8A 5B7GA 3BCAA 5AKIA 3ENQA 2CMKA 3WV5A 2E6KA 1YHZA 2AHOA 3PFKA 1Z3IX 2FFHA 3NBAA 1LI5A 3NJ8A 3PUBA 2JJQA 5IKEA 5CGZA 1LDDA 4EJSA 1A9RA 3L07A 3L5OA 4J0KA 5L95A 3KZZA 1E94E 3EUEA 4DREA 3FYUC 4WOBA 4DRXA 1ZFNA 3GRPA 2CYCA 4I2VA 4EF4A 2YS6A 2Q5JA 3HNRA 3ERMA 1AKEA 4HXFB 2FEXA 1SRRA 3ASYA 3OYIA 4RADA 5FO1A 1XZHA 4WBNA 3TO9A 2P30A 4QPNA 2VHVA 5A4FS 4UUBA 2BFCB 2Z9DA 3IEXA 5FUVA 4KDFA 1SUPA 5LEKA 4GYGA 2ID9A 3CLUD 3X1YA 1UJ2A 1FTYA 4ZI7B 1TJYA 3ITNA 2XYPA 4RETA 5E6RA 1RLUA 3MQ2A 1ISIA 2AZ4A 4KNWA 3MFKA 2NV0A 3U21A 2HO4A 2DEUA 4QGGA 4IFEA 3NKFA 4YCSA 4WASA 1FP4B 3KRTA 2WU4A 4XYGA 4IW3B 4BN5A 4ML3A 1ZRFA 1MTOA 4GX0A 5JDCC 5AVTA 1E9DA 1AKYA 4CGYA 1GKKA 4YJFA 1C1XB 4GPBA 4DZJA 2FWMX 1Z7UA 2JK1A 1ZGBA 2VWPA 4DDMA 1A9ZA 4DIBA 4H77A 2B4YA 2P3SA 2JPBA 3V4OA 1DEAA 1IB6A 3BIWA 1Q7BA 5KCMA 2JIZA 3KJNA 4M55A 1P9QC 4LZPA 2BGIA 1NKSA 1P6QA 4M7PA 1X15A 3KM0A 1XMIA 3A4VA 3J81A 5CK5A 4DC9A 1EUQA 4EB6B 1TQMA 4OFXA 3LDAA 4KV7A 1TLHB 3F6BX 2PY6A 2G4VA 2M6KA 3S1SA 3ZVKA 3QEJA 1YASA 2RKWA 4HN4B 5TT0A 5H3LA 1DDIA 4C0AC 1KEUA 2C5AA 4QEKA 2DTRA 3JRAA 2HEOA 2VNKA 4EI2A 5GGYA 4O2BA 2ZG6A 4YQFA 1JVSA 4JMPA 2ZOSA 2ZATA 1YB7A 3F49S 3EPLA 1T5IA 1XE3A 4XLCA 4K05A 1W4ZA 2QM7A 1T2EA 4YCLA 2CNDA 1PJ2A 5AOAA 2GAAA 2VP9A 2WTMA 3OD5A 1B8OA 5ILVA 2XRYA 3SM9A 3PX2A 3DXYA 5I7FA 2OZLA 3ZDQA 1GA1A 1KMHB 2GEDA 2Z3WA 1PZHA 3LX8A 4DLYA 3OE5A 4RBNA 4I4CA 4D4JA 2DPXA 1G6Q1 3AM1A 1NRWA 5ILQA 1NTOA 3SQNA 3AW8A 3RKQA 3TTUA 5LP6C 1Z2PX 4AO7A 5EQJB 2FDRA 3S1QJ 1QFXA 5HIMA 1IXZA 2KDOA 4RJTA 4DWWA 1U0HC 2P6NA 3LW7A 2JA5J 3TIVA 3ZQ7A 1M2HA 1A77A 3DC7A 4L51A 3NGXA 2B4RO 1U8ZA 4QFMA 1Z63A 2VFAA 4FE3A 3F6EX 2XY4A 1X8KA 4UM9B 5JQGB 5BV1A 4P5OA 4PXSA 2QVOA 2ZRIA 2HLHA 3U4GA 3N2EA 2X42A 3CQZJ 1IE3A 3ADCA 4JROA 4ZCPA 1N5LA 1FMTA 1SH7A 1WV1A 2ZJPF 4C0XA 5LLTA 4WXDA 2OJED 4XJVA 1YQ9A 4KLNA 2IUYA 1N9KA 1Z8DA 5FB2A 3F7TA 5A9SB 4ND8A 1VJTA 5BQOA 1Z3XA 3WY9A 3LGAA 3ECCA 3BEOA 3LRXA 2RGDA 4DXHA 3PRKE 1NJFA 4R1NA 5F12A 2PUVA 5HJEA 5JVTA 3L2QA 1NVXQ 2BGKA 3EEYA 2B1JA 4C0BA 5G3YA 2Y1LA 4PJ0C 3UA4A 4R1SA 2WYHA 2O23A 4TSKA 1YZLA 3UKGA 1SUEA 5CDGA 4ZXPA 3SNHA 2XB9A 3F8WA 4QJ3A 3VH1A 2KRHA 4U2BA 3V7WA 3GDWA 5KX5A 4DR1B 3FHTA 3QU7A 1ZX1A 1EXDA 1Y7TA 1TO1E 3C48A 4FZ5A 2KLBA 3WKCA 2RB5A 1ZH6A 3GLRA 4AJ9A 2E3JA 5I8ZA 2VCHA 2FFRA 2Z99A 4QRDA 1VPEA 3O8CA 2JVIA 3AFMA 2O6GE 2YVAA 2H54A 2XADA 2UVQA 1TRHA 3RVOA 1SXJC 4M53A 1YH3A 2AG8A 3REQA 3RSNA 4HD8A 2D74A 1BXRA 1WULS 3EHEA 3U7RA 3AEUA 3E1KA 1Y80A 3O7WA 4KUGA 2WUWE 4B8ZA 1DHRA 2OCBA 3HCNA 3ZWBA 1WLSA 4BWGA 3RVDA 2VLBA 2HRDA 2OZUA 4JJ4A 4S2EA 2EG5A 1N32B 2XV4S 2OA4A 5D6NA 2ODPA 1T3HA 3UC5A 1XPOA 1CERA 3A32A 3CX6A 1GTSA 3CJQA 4OQEA 4C1BA 1QZEA 4L95C 3SXPA 1BGWA 1JA0A 3II6X 4OLHA 1IZYA 1AK1A 5T3YA 4AY4A 2P9QA 2XAAA 2B6HA 1PR3A 4B3CA 1LDBA 4ZAVA 1MCZA 2D5IA 3VX3A 2OXRA 4S1TA 1FZTA 4BLWA 4KXQA 4DYRA 3HPHA 1U4NA 2QJOA 3RIRA 1Y37A 1FSEA 2PKQO 5LQRA 2GXBA 3ZS9A 3C8MA 4FQ5A 1K3UB 1AZTA 2UUBB 4OBXA 3T5CA 5C1PA 4DUGA 4TL7A 2F67A 3UKJA 2H4XA 3QG1A 2PVSA 2W4QA 4Z7OB 4LYYA 3HL0A 2VBFA 3MTBA 1O6BA 2NYVA 2A3NA 3L1JA 3KWFA 3F2IA 1AHNA 3AHGA 2L0XA 1JN0A 3V97A 3CEHA 4BO4A 4HDKB 2AFIA 5K8IA 2BBWA 2RI6A 2HA3A 4RZHA 4PZ0A 4V0MA 5SYNA 1OTXA 3W3ZB 4XWKA 4A0FA 2Y30A 3VHRA 3QVKA 3Q2IA 5BUZA 4A0ZA 3GT7A 2ZJ7A 4ZZ3A 5TS2A 3G9ZA 2G83A 3B1YA 5E79C 5FKOA 3ZX4A 3DTNA 1M3SA 4JR0A 2F43B 3LBAA 3E5XA 4ZZ0A 3PO3J 1JEQA 4MS1A 5EWLA 3BROA 3DTKA 2E5NA 3E0QA 5HCNA 3C3KA 4H1WA 3N2KA 1RWMA 2PGIA 5KQMA 2QRUA 4CQLA 4Q3NA 5DCFA 4FFOA 4EMBA 3JZMA 3COAC 1IWOA 4AMZA 4CMEC 3STYA 2GAFA 2OGWA 2XJ4A 5CR9A 2BW0A 2PZ8A 5LZ8A 2X8BA 4OJMX 3FDFA 3PCTA 4I9UA 4A3DJ 3ANSA 1L6IA 3ZU5A 1J97A 3EBOA 3ZYCA 3EX7C 4LOHA 3K72B 3X1ZA 4AI6A 3VC2A 1M2KA 1R1DA 4WIAA 3WQHA 5FUXA 3K5HA 4BMVA 5DN6A 4PSWA 2N1BA 3QBEA 3CGGA 2HHAA 3T95A 4BC0A 4MJXA 2ZI6A 2FSVC 4PICA 4HDSB 3WGHA 4ESOA 2KLHA 1BQEA 3HZRA 1BJKA 3ZLJA 3K4CA 2ZXIA 4NJOA 2XSDC 3TTTA 4MEBA 3FNFA 4PHGA 1TW2A 2KRFA 3NBQA 1Q0UA 2P1RA 4R1LA 1UBGA 2O0MA 5LA6B 2VBZA 4ER6A 2WWWA 4A3JJ 2X6YA 3QVTA 3A0BC 1NBAA 4HBLA 4IJAA 2M2IA 1H9TA 4GKJB 2GJSA 2QTVA 3OWXA 1C3VA 4N3GA 3VRHA 1R58A 2L4MA 3KOOA 3EISA 4M88A 4BBZA 5A2QK 1ZNZA 5EGOB 4HJRA 3BLYA 2CB9A 1AO3A 5JV5A 2EZ9A 3MKLA 1DIHA 3D6HA 1N0VC 1ORWA 2E82A 1QE5A 1KYQA 5KTKA 1WJ5A 1W6RA 3IAM6 3AH8A 4AG6A 3BZWA 2WJIA 1PD0A 1QOPB 2O07A 3HEBA 1D7OA 3WU1B 4E7PA 4RKFA 4EJFA 3V1LA 1T3SA 4URXR 3E5RA 5BWLA 3DMFA 1QYDA 2I2XB 4M3FA 1IN4A 5BV8A 4KLAA 4V1CI 2IWRA 4YALA 5HCIA 4BNYA 3DWFA 4CIDA 1JR3D 4KIUA 3H11B 1WJDA 2Z1DA 4C3ZA 1W47A 3FIUA 4F2HA 3RPEA 4MI1A 3AF1A 3W5VA 3MD9A 1WQ3A 3R9IA 2P2NA 2LLKA 2P2YA 4BV8A 5KYVA 2Z2JA 2EBUA 3X2QH 4DR2B 2EX0A 3DCNA 2FFQA 1WABA 4QODA 4D7MA 1E9EA 2ACVA 3IQXA 1JEYB 3LYAA 2PMFA 3TP0A 1RYHA 1KI3A 1YIDA 5J1UA 3DGEC 1OY1A 3FYCA 5TY0A 4EG3A 4WNIA 4HH0A 2AOVA 4HQEA 5GJBA 3AFNA 3AY7A 5IKOA 4ZVRA 2IZ6A 1SU7A 3VR6D 1C4XA 2JVKA 5T6MA 2FOXA 1LPSA 5C1BA 2FPUA 4K0RA 3GJ3A 2DT7B 1KZ7B 2OCLA 1E62A 2BGTA 3K1AB 4JJ6A 3VU1A 2HEGA 5FBKA 1JTEA 3OZGA 1LFDB 3D2AA 2VJMB 3B53X 2IOFA 1YVUA 4KR7A 1VSQA 4H0FA 3VAZA 4XDZA 2FU4A 1QH0A 3RV4A 5FBRB 1KP9A 1I6LA 2JI9A 1O97C 3X1DA 1SUSA 3P7MA 2HF8A 3MG9A 4BDYA 4YRNA 3ZHCA 4HN9A 2GPNA 2I6TA 1YFKA 3IJEB 3RM3A 2DOAA 3ZQ6A 5EHQA 4CMBA 4UTXA 3V1TC 1DC7A 3LIIA 4IRMA 3OFSA 2L2OA 4Y2RA 5CH3A 5ICMA 5K0GA 4M1QA 2F1OA 1UXJA 3BL8A 4B4WA 3GPLA 1WSBA 3RWBA 2GIZA 3LWZA 3KWMA 2X8AA 1U78A 1S8OA 5C7IO 3DAFA 1ACLA 1NW8A 1XJ5A 2RAUA 2WBLC 2FRHA 4RGXA 4N4AA 3DV9A 3G2NA 3PGMA 3WL7A 4NS1A 1UDRA 1P2GA 4G4IA 4DCCA 4YV7A 1IULA 1KYYA 3VVBA 4ZYAA 1DPGA 4YRLA 2CDNA 5BUSA 4A3EJ 4MHOA 4UM5A 4C0KA 1ZAKA 5JBNA 2JCVA 4ETMA 3OYJA 2I4OA 4DIFA 4XLNF 3GA0A 2NNWB 3FSGD 1P7WA 1Y8QB 4G1EB 4BQSA 4TRJA 3BDVA 3PXUA 4PU0A 2PA0A 5GPBA 3KTOA 3COPA 3FNBA 4Q66C 1ACJA 2BGNA 3OL3A 4U63A 2JBAA 2QRQA 2HU8A 4M74A 2ZQ5A 3R1IA 1ZJ6A 1D4AA 4ZYZA 1JIIA 5G1PA 1U9NA 2NUBA 4KIJA 2FFBA 5LQMA 4URZR 3O94A 1AURA 4LMRA 1KKLA 4NARA 4KUHA 2JUCA 4MRAA 4X7MA 1T4CA 2VOPA 4OFWA 4MKGA 3EC7A 4N4NB 13PKA 1I3QJ 1Y7PA 1N78A 2HJSA 2ZTMA 3JALA 4D9BA 2X0KA 3VX4A 4E1BA 5KJ6A 3INGA 1XHLA 1HF3A 3MMPA 1JGGA 2PT9A 2DECA 4IRIA 4AYXA 2X3FA 1NPYA 2F3SA 4JDPA 4LF4B 5F7XA 1J8MF 1J06A 4XICA 2IT1A 3JWIA 4AB1A 4PLFA 4NCJA 4Z8YA 1DU4A 3UK7A 3VR5A 2HJHA 4HYEA 4CKZA 1AMNA 2V45A 3MOIA 1NH3A 2IGNA 2XD9A 3TNJA 3D3JA 4PF1A 5F77A 3F6VA 4DV0B 1FQKA 5K3BA 4YAJA 3EJWA 4D9EA 4BMZA 1O4VA 3ESRA 4L5YA 4WGFA 2I6GA 3ZJVA 1TNDA 2AN1A 3SFVA 5D1HA 2FQ1A 1MV5A 3WZLA 1E4YA 2IY8A 1AN9A 2CUFA 3OIWA 4L3WA 3I2JA 2P6PA 3LQQA 2I1QA 4PAWA 5AVSA 2BR3A 2IHJA 2CSXA 2Q2EB 3ABQB 2GGSA 2RAFA 2NQ8A 4Z9BA 1E7QA 4Q1CA 2YV1A 2HHJA 3DO5A 3PNSA 2IUSA 1IRXA 1Q95A 5B3JA 3HSRA 4HV5A 1MB2A 2O54A 1ON2A 1IUPA 5IDQA 3IQHX 1W4AA 5JSQA 4Z4QA 2PO5A 3AV0B 4UBLA 1WTCA 3H2GA 5E6SA 2FPOA 1QNLA 2NPIA 4YVFA 1RQPA 3RTAA 1G20E 4GZ6A 1O4XA 4DQDA 2R97A 1W9HA 5FNVF 3MJTA 5BNTA 1GKUB 3ZOKA 4HMQA 2VPIA 2IPQX 2OC6A 3JARB 2NVBA 2OGUA 3RS8A 5JEDA 3BSWA 4FN4A 121PA 4PE5B 4LTMA 4OGLA 3JZIA 4R51A 4KPYA 1SBHA 1CR6A 3OYFA 1N5MA 4UHCA 1W0KD 1W6UA 3Q3JB 4F2DA 4BGIA 1K8YB 4AN4A 3BWVA 2PL3A 1VZ0A 1RQ2A 4RORA 4YQEA 2HJVA 4Y67A 521PA 4JIGA 2VAMA 1WJCA 3WLQA 2IGBA 2VS1A 1E1RD 1SKAA 1S9HA 5CLLA 1VCIA 1VRVA 3NETA 5B12A 1F2TB 1KO4A 2K3PA 4IIJF 3BR5A 1ADCA 5DPMA 4CRWB 4E5SA 2N75A 3WLKX 2Z5FA 1U8UA 1SOMA 2G1UA 1WPKA 3OEED 3WQSB 4QIWN 2LIVA 2A7XA 2D7DA 1XDUA 2IE8A 3O8OB 4NAVA 4GGGA 3P94A 4QJ4A 3VO2A 4RTSA 3DU6A 3I61A 1ECPA 1K97A 3MUEA 1SC7A 2JHPA 3OIVA 3P0RA 1IF1A 1I2MA 1T35A 2C4WA 3EXHB 3SEAA 3KSBC 5GADJ 3EF3A 4G1MB 3ZWOA 4XONA 5AQ1A 3FKQA 1C9DB 3PT5A 4O4IA 5IKMA 4WCDA 2MR6A 4MB2A 4LZZA 3KALA 2YQ4A 4RPLA 4PONA 5I4BA 4PCUA 2RSLA 4F56A 1Z5ZA 1DJNA 4HF2A 2JD2A 2DBVO 3LX6A 3HN7A 3RIGA 3AWDA 1O96A 1BHQ1 3LLVA 1XVUA 3QBTA 3CE9A 1PG5A 2FE4A 4U9UA 3SVLA 1XOIA 2VIXA 3NC0C 1XVTA 1DC6A 4M8KA 4Q5IA 1EA5A 2XF7A 1P60A 5DM1A 2J1LA 3TNDA 1YB2A 1HH4A 2LG4A 5D8KB 3BZCA 4MZXA 3DDHA 4M71A 4M0FA 3L1IA 1S6LA 4AP5A 4MA4A 4G5HA 3FJYA 3CUKA 2DR0A 1HKHA 1Y3CE 5CFQA 1GYRA 1R8QA 2Q41A 3NHSA 4KR9A 1XGMA 3O3OB 1LTKA 1LK5A 4HT3B 3SWWA 2ZMEC 2W2KB 4JZKA 1OLTA 2LCQA 1M0TA 2UUPA 3S2WA 3Q7PA 3K8QA 4LOCA 3L92A 4J3JA 4OHZA 3WJ1A 5JS1A 3PQ5A 2IUFA 1XCGB 1M2GA 2XVMA 1RSZA 3AB3A 1XZEA 3SGLA 5I3CA 2ICAA 1QK5A 5KVQA 4HGQA 1K86A 1FS6A 1J0AA 4GI5A 4GT1A 2PAAA 2PXCA 4Q7EA 4GSKA 4CR8A 1FC3A 3SFIA 3R5JA 4HF7A 1JZTA 5E4JA 2WT8A 2H2WA 1U2DA 2VVTA 1NQOA 4IGKA 1QUEA 1NW4A 2YV4A 4MKIA 1FPMA 2OCGA 8ADHA 3GZNA 3IR5A 4B83A 3CC4I 4ZEWA 3B3AA 3FTPA 3KE9A 2DWPA 4KU4A 2FPIA 1YZ3A 3TRJA 2B83A 1IXSB 4AF6A 1IN5A 4RTQA 3T8TA 4ZTUB 3RPUA 1GARA 1P8AA 1S2MA 3IQIX 5KWVA 1R5JA 2VXCA 1CUUA 2X4DA 4FU0A 4N6NA 1RRFA 2RI0A 3MLAA 2LV8A 2QRPA 2YYAA 4JYZA 5BR8B 2HU5A 2B99A 1TCAA 4ZAWA 1UMCA 5BPDA 1A9YA 3OETA 1B0AA 3VH3A 2QWWA 4EJWA 1X74A 1ZN8A 3TZCA 5M2QA 2VPQA 3RSFA 1JEAA 2G04A 3WE3A 4UBKA 4TMZA 1EX9A 1Z0ZA 1O5TA 4CCMA 3K0LA 3U40A 3ELBA 4YRDA 5FORA 1HDXA 1QGUB 1KU7A 2YNMC 3EH2A 1T8YA 2WI8A 2ZVDA 1HQCA 3RSZA 1JLHA 10MHA 4D4KA 3DMNA 2QQ5A 4U2FA 1FFDA 1YDEA 2H00A 4MR7B 4C0QC 3GUYA 2VKEA 5J2TA 2ONYA 5BUQA 1I5EA 1E2DA 3NJRA 2XT9A 1DBRA 4H2DA 1OYOA 2XB4A 1H0HA 3O3MB 1O95D 4PAGA 4X6AJ 4RTRA 1T1IA 5HS9A 3FTQA 3SZOA 5FKMA 5AVJA 2VT3A 5HX7A 1JZQA 5TRTA 3MGGA 1DIGA 1S7OA 4P93A 3NWSA 3GJ8A 2QORA 3I72A 5AM3A 1YA6A 2AMVA 3E03A 4MVJG 1F12A 1NXXA 3WC4A 3ZWAA 4HGOA 3CUEF 4B79A 2QRKA 3GLHA 5AKEA 3RAJA 3D8SA 4ZPXA 4PHHA 3C43A 3CWZA 1IN6A 1IPHA 5AI5A 4EKYA 3TR0A 3QW2A 5DLQC 1TMKA 2QN8A 1M54A 3FNQA 1XMKA 5A7FA 2XGCA 2YJTD 5E8JA 2EIXA 2Q8NA 4DAEA 5TX7A 1H8ED 3ICWA 4CG0A 3B3GA 1E3OC 3L7DA 4MPRA 3K8ZA 4DBVO 1HDYA 3N97A 5I7AA 3ADOA 2L7FP 4FR5A 4HZIA 2J3IA 4E33A 1DQZA 1SCIA 5IDVA 2XUZA 4RXTA 4PIMA 2YR2A 5K4HA 1A95A 2FSIA 3SZRA 1NR5A 2E36A 1VCOA 3QV1A 4GECA 4OHUA 4XGRA 3DP9A 2VDKB 3ZD9A 1A4UA 3SZPA 4DVGA 4Z4EA 4LA4A 2O59A 1XKQA 5REQA 4FDLA 4V0LA 1F2DA 5DGIA 3HK2A 1GVHA 4MEYF 3B9BA 2PTGA 3RK4A 4DT1B 2QUAA 1JTXA 2IDJA 2SECE 3EIWA 3MTEA 4YRBA 3OMYA 5C35A 1Z5VA 2LKPA 5JNRA 3MEXA 4LWZA 3ETJA 7GPBA 5HBGA 2V7QA 1G20B 2FSPA 1TVCA 2CQNA 1FRNA 1ZM7A 3L8ZA 3DS8A 3P0IA 2IXBA 1D0IA 1KRXA 2GEFA 1PWZA 2O03A 1PP4A 3WHPA 3QBJA 3IIJA 3X1XA 2LF7A 4MDYA 2DPYA 3HBJA 4TYNA 1MB0A 1IBLB 1KSFX 4L9TA 3HYRA 5EYRA 1EA7A 1FUIA 4KH1A 1TEZA 4R2WA 4YRSA 5JXHA 2CQXA 3JRHA 1C8LA 4MV6A 1OWPA 1IWPB 2O2JA 1LPMA 1KYTA 1AUVA 3CZMA 3L8MA 2WPDD 1U11A 2V1XA 4L5EA 2WYVA 1PJ8A 3VPFA 2HGZA 2V7WA 3LQ2A 2CG4A 5H4GA 1O7JA 1FTGA 1RC8A 2R7TA 4LZNA 2VPPA 3G2KA 4FVTA 4J1NA 5FLKA 2PZMA 1QE3A 4MVYA 3GJ6A 1WZIA 1QRTA 3CWQA 3WTZA 4RD1A 1X1QA 2PKWA 3L4BC 1HO3A 2C2MA 1L4YA 2WTEA 2CH0A 4ZDLA 2EPFA 4LDAA 4NEGA 3U2RA 4MUMA 3P9YA 1H2HA 3EXHC 1QS0B 3FWKA 1QRRA 4F45A 2C7PA 5F5NA 1QIDA 3KLMX 3QE0A 5L51A 4G25A 4HB2A 3EE6A 4EG4A 2ZM6B 3K1PA 2Q5OA 4BIIA 3WIOA 3C41J 4I81A 4Q4HB 3ZDRA 1XXHA 3T3DA 1JXAA 4ZOAA 2VK2A 4AURA 3BUSA 1OFTA 2QE6A 3WBBA 5KI6A 1Y0NA 2BZSA 3N2NA 4JL6A 3J81K 3A01B 2G9ZA 4LOAA 4DLZA 2O8NA 4LX0A 1E2KA 1HC8A 2ISSD 3ZMSA 1TJ4A 3F6PA 3PD0A 5BURA 2W8ZA 4MPTA 3R8CA 5CA0B 4ND5A 4RD3A 2HJ9A 1COWD 3DPIA 4PG7A 3BJAA 1M1YA 1KKUA 4IOLA 3HDVA 2IXTA 1QH1B 4FFPA 3HSYA 5EF6A 5CT9A 5A3JA 1BGVA 3PPVA 1TE2A 3WGJA 3R9XB 1FDWA 2X2EA 4AZWA 1OZHA 1CEXA 3FCUB 3CGWA 5LM3A 4X54A 1E66A 4CG1A 2WYWA 4FJ1A 1L5HB 2YKGA 2C3PA 1TQPA 4QBGB 4PZCA 1K7YA 1KSHA 1YR1A 1U98A 4RZSA 3Q1KA 4LYAA 3FK7A 3ZDZB 2C2OA 1ZK2A 4JB3A 1VE1A 3VR3D 1QIKA 1XCLA 2JCYA 1T0HB 2I6XA 1MW8X 1IZZA 1BWPA 4O4JF 2JI6A 3HBAA 1PJAA 4DDWA 2MSCB 4BXOA 1E9FA 2POCA 2BM9A 2W6ZA 4JGIA 3QELB 5DTJA 2BFDA 3TL4X 1AN0A 4TWBA 4RD2A 3ZS8A 2FZWA 4GWLA 5IYZF 2I10A 2OV3A 5ITZA 1I2ZA 1IXRC 3WWDA 4WLNA 5GM1A 3FCEA 1VL6A 4NESA 4UCQA 3VODA 2QKMB 2NVWA 5AVRA 5ENZA 4KYUA 5KIAA 2ZBKA 3QFTA 5D6FA 4R9NA 1QZ3A 3DEZA 2VAXA 3TE6A 1DC3A 3LUHA 4LXTA 2PVCA 1KEVA 1OLXA 2W2VA 4BU2A 2E4UA 3OC0A 4XK4A 1P18A 3EUAA 2QLMA 1ZKDA 3GK3A 5B66C 1Z6QA 4BLVA 5BOSA 3QUTA 4XYBA 3SF8B 4DMGA 4KIBA 3FD8A 3OYLA 3FYHA 4XWTA 1SCAA 3AGPA 5HMMA 3NB0A 1PV2A 5G0SA 3PNQA 1Y34E 3PTAA 1OLUA 2Q4EA 1R0CA 2EL7A 4BNMA 2JDIA 4ZDPA 3PIOF 3O5AA 1EWRA 4J0GA 3TLAA 1JEJA 1F9NA 3F5QA 2O8FA 2POQX 4QOFA 5KSZA 5DN9A 5IJ9B 1VA5A 1IBMB 1DBPA 2BMWA 5EZ6B 4D8TA 4GDMA 2Q28A 4E5VA 1T0PA 2OYSA 1Z4JA 2MSEB 3JQ7A 3ET5A 4E51A 1YHQI 4M6VA 4LG3A 5EESA 5ALVA 1AM4D 4HTAA 1GPAA 2I4TA 4E7IA 5LR6A 4TUYA 1OXSC 4YDSA 5C3EJ 1F8FA 1GYQA 1VQ5I 3WK5A 1BHO1 2L7KA 3DHEA 4DQ2A 2WQZA 1S3FA 1T39A 1CJCA 4BQFA 3PVZA 5KYYA 3N58A 4B3MB 2BZGA 3IOYA 2XWQA 2P9GA 1M7BA 1C1DA 3C2GA 3LSKA 3B6MA 1P1IA 4Y6QA 1IBKB 1XYYA 5E17F 4WZ6A 1YNOA 4JELA 3H7AA 4M7WA 3P0EA 3DBLA 5AVXA 4QNMA 2CFRA 1I3KA 2Q3FA 2MBFA 5EJCA 3KSDO 4UNNA 5B1SA 4ENRA 1OROA 4PN7A 4GQAA 4MDHA 3QBVA 3UJ3X 1UWLA 3D7SA 2GPJA 3ZTWA 4RA6B 3HBLA 1H2YA 5DO9A 2XVAA 3BKXA 2RG7A 2HCTA 4XQEA 3KB1A 3DAGA 2GA2A 4WNCA 4R40A 3WMEA 3T4UA 1KOFA 2IUUA 1GR1A 1XK7A 1FJ2A 4P1ZA 5AJZA 3RYTC 1ZOSA 3RTGA 3RUDA 1RT9A 2WUDA 1RVDA 4V1CA 3GOHA 3FHCB 2YSRA 4CUGA 1TK3A 1R0SA 2GYYA 2CLHB 1L7BA 2W7TA 1XDDA 3NHPA 3VMFA 1R6TA 3IPAA 5C4GB 4NE2A 3EQLF 2C20A 2TYSB 2F48A 2H4YA 3AEKB 5K0LA 1FQWA 3GAAA 4IIXA 5ALMA 4F2GA 4B3IA 3ES9A 5AKYA 3VYVA 4GX2A 2UAGA 2ZRHA 2IYPA 3U3RA 1EX1A 1COZA 2VA9A 4YJ2B 3RVPA 5K20A 2WA2A 5D3MA 1ZN7A 5BUCA 5LL6P 3FMSA 3UAGA 3GFBA 3IDZA 1QFJA 1EEHA 1Y3FE 4MYRA 4L0QA 3TSOA 1S0UA 4HNSA 5ERGB 4HAMA 2A58A 3AY6A 4PX3A 1MJHA 4G6ZA 2G3YA 1G38A 4UXIA 4QUBA 1BJZA 4ACAA 3T9FA 3IKVA 2BEWA 3D4LA 4NPCA 4UBMA 2V74B 4NAUA 2PGOA 2GN0A 2J9ZB 2A67A 2OCPA 4PCLA 2P5LC 3L9WA 1TC1A 1FOYA 1Y0BA 3C5WP 4JYMA 3UV6A 3B85A 4ZN6A 3RT1A 2JNWA 3BHMA 2VYND 3ETDA 3BCRA 3VZCA 4KAXA 2J67A 1QCZA 4IRUB 4RPIA 1JXMA 3GLIA 4LD5A 4Z4FA 4YBRA 1NBMA 3TQCA 5A3QA 2H7CA 4H0CA 3OZTA 5NLLA 4B5LA 4HB3A 2QN9A 4KAJA 3ENWA 3ER6A 2FHPA 4IIEA 1RAIA 4D8UA 3KT0A 2GBLA 3L6RA 4O4HB 2XF5A 2ZSEA 4LXHA 2VZ8A 2ERCA 2RGUA 2XCRB 3LUCA 2K85A 4J7AA 2AV6A 5AW2A 3L6BA 3TZQA 2KHZA 1EJ2A 2UZ1B 1WXQA 3TO7A 3KJZA 2PUTA 4NVRA 1QMPA 2FW6A 1ZJYA 1JLLA 4BB9A 1AKMA 3WGQA 3DLHA 2UVPB 4DR4B 2ZROA 5LHGA 1WDTA 4IWXA 2FMUA 4CV3A 2ZJAA 5JFRA 1U2GA 5F2OA 3D3EA 1I9CA 5CVVA 1OHHA 3W04A 2ES4A 4N9IA 1BJAA 1UJ5A 4EHFA 4DMCA 1IMOA 4YJKA 2IZ7A 4D97A 4QPQA 1WXDA 1QZXA 2EFNA 3QLUA 2EBIA 1VC2A 3FZEA 1EG7A 2VF8A 4J2HA 4KMRA 1OAOC 2IA2A 3TZHA 3RT7A 1UMKA 3BBLA 3NORA 4DSUA 1KMQA 3KPUA 3ZE6A 1QIMA 4Q4ZF 2I5PO 4GPD1 2DPLA 4HDMA 2H27A 2HXOA 1VIYA 1Q0LA 3HKBA 2H17A 1LUAA 1SKBA 1JE8A 1TK2A 1PFWA 1RM5A 3LBNA 3QMMA 4W6QA 3KYCA 1L1RA 4X6XA 2R6R1 4XEHA 2A78A 1U1GA 2NZYA 2L19A 3GHYA 4DARA 4ZVTA 4BX0A 3OAAA 2CHFA 5CRIA 1LUJB 3U5ZB 2WB2A 4N5HX 4ZQIA 3M7GA 2VYVD 3S70A 5BPHA 1APBA 5I9NA 1J21A 2EP5A 3DNFA 4HUQB 4I98B 4F4FA 2I3DA 1PGJA 1IBCA 1EJ9A 2ZT7A 3A7DA 4YRFA 4GC5A 5L3GA 4CQMD 2OV1A 2HQBA 3JTHA 5EZYA 2BY1A 3VKFA 3SJZA 1C9EA 5PNTA 1DEKA 2QMHA 3IO3A 1X8LA 1QR2A 3H04A 5B1DA 3A1VA 1XNGA 4M46A 4DMHA 1CRPA 1GPKA 2B1GA 4XLZA 4U0JA 3OLWA 3T7AA 1GQQA 4BECA 1UBJS 3VR2A 2IIBA 1OGYA 3MGKA 4EYOA 3IDOA 2EFWA 2I34A 2GUWA 2KJQA 2DTXA 4MUIA 1DX4A 1QVVA 5KOJB 3W1WA 3BMCA 4XJTA 5DI3B 5IN5A 3L8GA 1RJFA 4FNGA 3V8MA 1NG6A 3DOEA 2XF2A 3ZG6A 2CN1A 3THYA 2Z5GA 2WZQA 1NL3A 2P6OA 4X0EA 1KH1A 2HVRA 5JR3A 4WJZA 1NFFA 3H1EA 3PYMA 4XB2A 2VP3A 2WYOA 3THSA 2PGXA 4EZBA 3ULKA 4YY3B 4HBGA 1B4DA 2PGNA 3SBXA 3OTGA 4BY7J 3A4MA 4WA8A 5TMPA 4CI0B 1A8QA 2Y0DA 2Q6TA 1WSAA 2CNWA 3TGNA 1UMBA 3NEPX 5EXTA 4IDGA 2XUOA 3T3IA 3E9EA 4LE1A 1UDCA 2LXNA 4G8CA 3JRGA 1SIUA 3K35A 3HFRA 5I5GA 2RNJA 3HR4A 2VJPA 3W5SA 2ZKIA 4W7SA 1U28A 3BMXA 3GTJJ 3PPIA 3DDNA 4MUYA 4KXUA 4EHNA 5KVVA 2VP4A 1NIJA 3SU8A 4H4EA 2QL7A 4GYWA 2YWFA 4WKOA 1J0EA 1H89C 1K4MA 1HE4A 4YMWA 1GTG1 4NBSA 3BPSA 1LQ2A 2AG5A 2ZYGA 3RUCA 5KVAA 4XA8A 3LVRE 2DPMA 2WWXA 2H6CA 5JLWA 3MFQA 5DHTA 4CCYB 5FTWA 3KWLA 2O2XA 2NS8A 1KNXA 1U7TA 2HZDA 2OORA 1I94B 1LVKA 1EM8B 4DSOA 1P3JA 2A5LA 3PC7A 2NAFA 1QH8A 4QEZA 1TIBA 2AL7A 3W0LB 3PL8A 4CLDA 2VHEA 1PP8F 5JWRA 2YU9J 2BMFA 1IRZA 3HNPA 3IVMA 1AUOA 4EGSA 2ZYDA 1MJ5A 1XZJA 3ZCSA 2RHWA 4K3VA 5ETJA 1GLNA 2N46A 1X14A 2IA1A 1A7UA 2GDJA 1TWCJ 2QPLA 3TOZA 4H4DA 2QZ4A 5BNWA 3C8UA 2PIDA 1IEQA 1CJKC 5K09A 5F2KA 3Q7SA 2SHKA 4CNQA 5AR1A 5CPRB 4EGZA 4L85A 1J1UA 4TYYA 1I5ZA 4ER0A 1PUEE 4O2LA 4RMIA 4WDQA 5KOYA 1UC4B 1IFXA 1PG2A 3D7MA 4FTWA 1R23A 4A16A 4R3UC 1NW7A 3GLTA 3LOQA 4GKKB 3TIFA 4BMYA 5F3WB 3C97A 3M7IA 4OK5A 1RKWA 1WCMJ 1BD3A 3PVCA 3K73O 4U7WA 2OB1A 2CJWB 2EB7A 3TI7A 1M8JA 4PG8A 2R8EA 4JKYA 3HL4A 4LLGF 1BIFA 3O84A 4N7BA 1PT9A 2H1CA 3RTEA 4XIGS 2R5YB 2F2TA 2UZ0A 4RELA 2XCOA 3MCVA 1ZBDA 1DCTA 4R9SA 4JOSA 4YLGA 3KL4A 3MINA 3GMIA 3GCDA 1KQ8A 4ON0A 4QARA 3RSGA 3VC7A 4KXNA 5FL3A 2I0FA 1Q50A 5TMBA 3QRFF 2XECA 3KJQA 4H18A 1RBQA 4R83A 1H23A 4D9NA 3OOHA 1ZRHA 3H5AA 2QSZA 2JHFA 3EA0A 1GQRA 3K7AJ 4LCEA 1DELA 2EWMA 2DYKA 4RY0A 2VJ5A 1GNPA 3ABUA 3D5SC 4BFUA 4QDKA 1V11B 2XOKA 4M0UA 5FWXB 3DHYA 2JMWA 1MENA 1I5OA 2HPAA 2AX4A 2RVCA 5AW7A 1FDVA 4OI4A 4QOEA 3K0AA 1UL1X 4DIKA 3AUTA 1KIMA 1UANA 3EOAI 5B4VA 2ADUA 5KOHA 2IEYA 1WZNA 4TROA 5IYDJ 2QTHA 1ISFA 1J5YA 5ECGC 4WI1A 4UQOA 1Q0SA 3HUDA 1LI4A 2OD9A 2A9FA 4OH7A 3AT1A 1DQUA 4URFA 1J0XO 3OMLA 3TBKA 4V0KA 2Q8PA 3GH1A 2IP2A 3CJTB 3ROPA 5KTSA 3U4CA 1STZA 2PMDA 3L2VA 2AFVA 4QUGA 3F3XA 1MC8A 4M1OA 1FFGA 4PTYA 2EV6A 3RHSA 4FW8A 3PF8A 4MYHA 4OVKA 3AOGA 1M6HA 1CF7B 3HEAA 4XVCA 5JDIC 3SYKA 1YS9A 5JYBA 3W1EA 1HDZA 1D1TA 3AJRA 3V8JA 4EIWA 2X15A 3RC9A 5GJVC 3JRXA 5A04A 4ESEA 3AG4H 1JXSA 3VVCA 3TMKA 5JYDA 2C77A 3HFJA 3E6AA 4YN3A 4MV7A 3I1YA 2JAQA 1J70A 4ZTFA 3UPUA 2WVJA 2FG5A 3G4SI 1ZAOA 1XZLA 1A76A 2HTSA 4PQGA 2HTJA 1VSVA 3T5DA 1S2DA 3M49A 2XDQA 2R7XA 4BJ1A 1L4NA 1OWMA 4KMMA 4PAQA 4BNZA 2NT3A 4CLRA 2W58A 3KX2A 2G6BA 3HOWJ 3AF0A 5TV2A 3K0CC 1NV9A 1N33B 2FKNA 3F6CA 4UMVA 1XNQB 2C9YA 1GUFA 3BB4A 3QPVA 2BN4A 3QE9Y 2ACEA 5CXSA 3HXTA 5M04A