3H9JA

Crystal structure of e. coli mccb + ampcpp + semet mcca
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
348
structure length
339
Chain Sequence
MDYILGRYVKIARYGSGGLVGGGGKEQYVENLVLWENIIKTAYCFITPSSYTAALETANIPEKDFSNCFRFLKENFFIIPGEYNNSTENNRYSRNFLHYQSYGANPVLVQDKLKNAKVVILGCGGIGNHVSVILATSGIGEIILIDNDQIENTNLTRQVLFSEDDVGKNKTEVIKRELLKRNSEISVSEIALNINDYTDLHKVPEADIWVVSADHPFNLINWVNKYCVRANQPYINAGYVNDIAVFGPLYVPGKTGCYECQKKENIDHKIKLINSRFKPATFAPVNNVAAALCAADVIKFIGKYSEPLSLNKRIGIWSDEIKIHSQNMGRSPVCSVCGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccB protein
publication title How the MccB bacterial ancestor of ubiquitin E1 initiates biosynthesis of the microcin C7 antibiotic.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/antibiotic
total genus 107
structure length 339
sequence length 348
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1160 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3h9jA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3h9jA02
2JJYA 5IG2A 1B3RA 3EW7A 3MOIA 4NIMA 3LF1A 2YY7A 2Y1DA 3OA0A 3NX4A 1YDWA 1HF3A 1F12A 4LRSB 3EC7A 3DZFA 3C24A 4BOYA 4RZIA 2PLAA 1V8BA 3TZ6A 1A72A 3SJUA 4B4VA 3BIOA 4DQUA 1I2CA 4RPGA 5A3JA 4UUPA 4BB6A 4ZA2A 4XYLA 3AW9A 3CMMA 1ISMA 4NBTA 2VHWA 4E2WA 4BO3A 3DOOA 5H81A 3VDQA 5COAA 3HUDA 1P31A 5EINA 2NU7A 3C3XA 4WLOA 2ZTUA 1HLPA 5IZCA 5GY7A 4X54A 4II3A 5AXDA 5ICMA 2FRDA 2B0JA 4CM3A 4IQ0A 5IDQA 2Q50A 1PL7A 3AU9A 2FSVA 4OO3A 4XKJA 3ZI0A 4FD3A 3FWZA 4CR7A 4XB2A 2NQTA 3WR5A 3AM4A 2BELA 2QG4A 3ZV3A 4EJMA 1LDMA 2X5KO 4FQ8A 3WQRA 4FR5A 5JCJD 3DAPA 1WAMA 2DTDA 2NWQA 4FOSA 3LC2O 2NU6A 2NVUA 4YAEA 3VKUA 1M67A 1OC4A 1GL3A 3FTNA 1TLTA 1Y5MA 4BNZA 1B14A 5EJ2A 1CQJA 1T1SA 4NBRA 4WLVA 5IF3A 4A10A 1C0LA 5A5FA 3RD5A 4CV3A 1EBUA 1VC2A 1WDMA 3GF4A 3QP9A 1LRJA 1UXIA 4PVCA 1GUZA 3UH1A 2ILTA 1CIVA 2EJVA 4IJVA 3QQPA 4BNWA 5KCZA 2C07A 1GUFA 3OBBA 3OSUA 3CUKA 2RAFA 2OHXA 4CV0A 4R1SA 2BI7A 1UXHA 2G1UA 4BNKA 1Y8RB 1PZFA 5A02A 2HO5A 2NNLD 3E9QA 2ZYGA 3QVXA 3TZCA 3V2HA 1F14A 4O0LA 3D3EA 1BVRA 1RM0A 2HAEA 2P5UA 2O50A 4ZJUA 1FXSA 3WFIA 2JHGA 3KLMX 5TNXA 2NQ8A 5JXWA 1GADO 1NFRA 1PJ4A 3ZNOA 3D1LA 3PFFA 2X0IA 3NTQA 1U5CA 1IL0A 1QR6A 2O4UX 4G5HA 1O9BA 3KYDB 5JC1A 5JW6A 3RSHA 5B37A 4CR6A 4AJLA 3TRIA 3GN2A 4CLRA 3W4KA 2WYUA 2DC1A 1YXMA 2BF7A 1Q0LA 4HV4A 5GMOA 3S2GA 4M89A 3KO8A 4YVFA 5CFZA 3TL2A 4M55A 3PZRA 3JQ7A 3SLKA 2AHRA 3JQ8A 2GPTA 1N8KA 2NADA 3U0BA 3BTVA 2DUUA 2GN9A 2Y1CA 4KUGA 1T25A 3TZHA 5JS6A 4I1IA 4BNYA 4RZHA 5G4KB 3NEPX 4CM7A 4UVEA 1FDSA 4NHEA 4BV8A 1V3UA 3QE3A 1ZO8A 3QY9A 4ALKA 2GNAA 3AI2A 4BO5A 4R1NA 3ONEA 3WMXA 3LDHA 4JJGA 1AUPA 4MVJD 5JDIC 4R51A 4GKVA 2HQ1A 1KEWA 4DQXA 3O8QA 3W6ZA 2Q1TA 4AJPA 4CMEC 1T1RA 1VLLA 4J0FA 4AJIA 1U3VA 4CLDA 4C7JA 4JIGA 4CM9D 3OJFA 2EIHA 3BMQA 3JYLA 1WZIA 4LSMA 2X6TA 3HN7A 2F00A 1NAIA 2P5YA 2QX7A 2QHXA 3P2OA 1E7RA 5IN5A 3OP4A 1K0UA 4BMNA 1ZBQA 3FPLA 3D4PA 2NU8A 2XPCA 3WJ7A 3OETA 3U9LA 1H93A 2FWMX 4BO8A 4UVDA 1DPGA 1EVJA 2BGKA 3DEYX 1YS4A 3ONDA 2HMWA 4KQXA 4U5QA 2NTJA 1Y6JA 4DLAA 3PWSA 4L4SA 4D79A 1HEUA 3FN4A 1MXHA 3I83A 3PJEA 2VOJA 4XWYA 5DZSA 2BKAA 4YAKA 1NQTA 4YWJA 5BNIA 2OP1A 3Q1LA 3PJFA 4GLLA 1T4DA 3GK3A 1ID1A 4DL9A 1QG6A 3WQSB 1EFKA 4FFPA 4Y8VA 1U7TA 4Q3AA 3JQDA 1TT7A 2AMFA 1Y7TA 3K5PA 4FBGA 4LMRA 2YV2A 4ND5A 4CMEA 3DO5A 5GZ1A 1N2SA 8ADHA 3E9NA 1CJCA 4RPHA 1PJ3A 4TZKA 1XDWA 2I9PA 3DOJA 3UCEA 2AEFA 3KYCB 3S2FA 4ILKA 4BV9A 1PL8A 3GHHA 1MC4A 1R66A 4EBFA 1C0IA 3I5MA 3AJRA 3WGYA 2WD8A 4MINA 1PQWA 1Z7EA 4JXKA 3M2TA 1NASA 1J5PA 3Q11A 4LW8A 2WEKA 5EMHA 1U28A 3WYEA 4A73A 4R3WA 2HK7A 4IBOA 2UVDA 4GLOA 4D0SA 4YAGA 2GGSA 1B15A 1MLDA 3H6KA 3ITKA 1X7GA 4R41A 5DBIA 5KOIA 1DBVO 2QRKA 3UCFA 2O3JA 3WG9A 4DC0A 1H6BA 1JKFA 4HADA 1DIHA 1IHXA 5BSGA 1MV8A 3RFVA 3VC7A 1HT0A 3JQFC 2PD6A 5CDGA 5A4DA 2G76A 3EK2A 2PNFA 2OFPA 4PLCA 4WECA 3WWZA 6LDHA 4PFJA 1P77A 3HQ4O 3QWIA 4A2CA 1GTMA 3RUFA 1ENYA 4E0BA 1U3WA 5AQ1A 1G0NA 1K3TA 3KB6A 3ZWVA 3AUUA 4CL3A 4XQ9A 1A5ZA 1DIBA 4DLBA 4BO6A 2GO1A 5DBFA 3TOZA 4G81A 4GSKA 1JDJA 4RO0A 4PLWA 2HMVA 1EVIA 3HG7A 1IPFA 1EE2A 1ZZEA 2EJWA 4GKBA 1EUCA 3DMYA 1IULA 2DT5A 4AVYA 1C3VA 1GY8A 5C7IO 1V3TA 2G17A 4CMCA 4E5MA 3L6EA 4IIVA 3PLNA 2VTEA 3ICCA 2O3QA 1DFIA 4CLRB 1L1FA 1PJBA 2AQHA 3FNGA 3JQFA 3BMOB 2IYPA 5K0ZA 1E0DA 2HJRA 4RF3A 2V65A 3HE3A 3IP1A 4BQRA 1KEUA 3X2FA 3INGA 1NVMB 4OL9A 4N54A 2VHZA 3BMNA 3OF2A 3ITDA 3JQ7B 1ONNA 3FBGA 6ADHA 3JD3A 4J91A 4W7IA 1LDNA 1YE3A 3JQBA 4RV9A 3UKOA 4BS9A 4J90A 4TKLA 2BMAA 1YDEA 5JNLA 1YONA 3E6AA 4KMSA 4JN6B 4A26A 5IFLA 4WJZA 3IDSA 1ENZA 3GEGA 2BI8A 4XJTA 4EUFA 1T26A 1QYXA 3ULKA 3KOUA 1BDMA 3I9KA 4FDAA 4RDHA 4D42A 1XG5A 1YGYA 4IMRA 1BXGA 4RDIA 4AJ2A 1UZMA 1FF9A 5A04A 2VYVD 1FDTA 1XIVA 3NRCA 1SCUA 2OGUA 1NQ5A 4FFMA 2YHIB 4FIZA 3LK7A 2W4QA 4W4TA 5ENVA 3G3EA 1GZ3A 1U4SA 1NR7A 1ZKMA 3RU7A 3ETDA 1YQXA 1HDCA 3E1KA 2BD0A 3E82A 4B7CA 1Z73A 3FD8A 3VPSA 4W9NC 4IGEA 3IKVA 2PZMA 4L9RA 5I8WA 1Z6ZA 1I5RA 5JCXA 1DC3A 3INRA 2GASA 2HUNA 2HK9A 2TMDA 3RBVA 4YRDA 4CM1A 4R1TA 3DB2A 1IPEA 3S8MA 1VL8A 3K92A 4MP8A 4NBUA 1PJLA 1T2FA 1ARZA 5F1KA 4YRAA 4UEKA 2GN6A 4N7RA 4YJFB 3EY4A 3DMTC 2J5QA 4IPTA 4M1QA 4N5NA 4ND4A 3JYNA 4CM8A 4ZGWA 4EZBA 3Q2IA 4W82A 4C4OA 1DXYA 1I3NA 4XGKA 4U7WA 4YTEA 1O89A 3M1LA 3R0IA 1G0OA 2O3RA 2PGJA 2DBZA 3C85A 1RPNA 4JX8A 4GI2A 3M6IA 1AXEA 1V9LA 2BH9A 1LLUA 4PG4A 1DIAA 3GC6A 4S3MA 4XD2A 2DQ4A 4TROA 5DP1A 3K31A 5FI3A 3VDRA 4E13A 4W9NA 3ZU5A 4CODB 2NVWA 4RF4A 1T4BA 1HYEA 2J3JA 1H9BA 1SOVA 5L53A 1BSVA 2CMDA 3PEFA 5TJHA 4DPLA 4CMGA 4JK3A 4H16A 1J49A 4AJKA 3TZQA 4QEDA 1ZXBA 4ONEA 1HSOA 1X0XA 4PG7A 3ZWMA 3ZHBA 3GDFA 4OKNA 3DMTA 5K6AC 1HDRA 2GF2A 4FJ2A 1TT5B 2PY6A 4FPXA 3PJDA 3FBTA 1ZMOA 3BMCB 3VTZA 2P9GA 3CKYA 4Z0TA 1GZ4A 1SC6A 3QWAA 4XX0A 3UXYA 1NHGA 4CUZA 1I10A 4EJ0A 3PFWO 5G0SA 2W8ZA 2HMSA 4WLNA 1C1DA 3VKVA 1T2CA 1DRUA 1YO6A 1F06A 1SAYA 2ZCUA 4B3HA 4N5MA 3SBOA 4A27A 4NK5A 3UGKA 2H1SA 3DBLA 4HFJA 2QIOA 2X58A 2YV3A 3VPXA 1U4OA 4ALIA 1VL0A 3Q9NA 2VYNA 1PJCA 1YKFA 2P91A 3ASVA 1NVGA 1LBEA 1PU2A 5U9CA 3ZHYA 3FPCA 4J2HA 3ROPA 3S2EA 4AICA 5JYDA 2C20A 2LDXA 1E3EA 4NFSA 5K6AA 1ULSA 1B8VA 1YL5A 4XDZA 3OJ0A 2FMUA 2ZB4A 3MJVA 1WVGA 3DZIA 1GEEA 3NDJA 3JQGA 4J4TA 1HDZA 4CM6A 5JO9A 3ST7A 4D3DA 5HS4A 1PX0A 3EZYA 1KEVA 4HNHA 3WGGA 4CLXA 4JQCA 1SB9A 4NK4A 1GAEO 4BGEA 1KIFA 4YA6A 1GYQA 2I76A 1LDGA 2J6IA 1U8XX 4TMFA 4WCFC 3GT0A 1I2ZA 5CEJA 3ANMA 1PGOA 1BXGB 3PP8A 1NFQA 2EP7A 5TC4A 2GN8A 1NQOA 2FOIA 4HWKA 4OJNA 4DREA 3FR7A 4MO2A 3OQ1A 4IS2A 4EUHA 3JD4A 4IQGA 1OI7A 2CVOA 2PKRA 3CSDA 2B36A 5FWNA 4DIBA 3PHJA 1U8FO 3AUAA 5JPIA 2RBEA 4UEJA 1H2BA 4LCJA 3E9MA 1Q0QA 1E3WA 2DFVA 2FSSA 4P22A 2JFGA 4GX5A 5JYEA 1XR3A 5DULA 4GGOA 1KVTA 1GYRA 1OBFO 2V6BA 5ER9A 2HK8A 1H6CA 4J7UA 5B12A 3TF5A 1UDBA 2EW8A 5EQFA 1D7OA 4HBGA 4IINA 1DSSG 1I33A 1IZ0A 5JAIA 3T4EA 5THKA 2B35A 4LSWA 1J6UA 5BSFA 1SB8A 3JD1A 5COQA 3JQ6A 3D5TA 3Q6IA 4CLOB 4Y67A 2WE7A 2ZQZA 4RF2A 4L73A 1V0JA 1CYDA 4WCFA 5L3ZA 4AJ4A 1WLYA 3MJ4A 4FSHA 3WTBA 1W8DA 3EUWA 3LLVA 1U3UA 4FFNA 3OH8A 5DOVA 3WGHA 1A9YA 1E3LA 3O26A 5DCUA 4ZU3A 4XIYA 4WLFA 4BL5A 4CPDA 3SJ7A 1PR9A 2DAPA 3WWYA 4XDYA 4HKTA 4CMIA 3WNQA 3VPHA 1VSVA 4PZEA 3N74A 2Z1NA 3OQBA 3ORFA 3NUGA 1HRDA 1JU9A 3RBXA 1QLHA 2RH8A 4M54A 2X22A 5GZ6A 1X14A 1LLDA 4NBWA 3WDSA 4E3ZA 1GYPA 3F1LA 4KTVE 4CQMD 3GZNA 1Q7GA 2DKNA 3QHAA 1IE3A 3G49A 2BLLA 1LLCA 5I9NA 3ZHZA 2VRBA 4CV2A 4ID9A 1DC6A 1UDAA 3GY0A 1YBMA 1VKOA 4FC7A 4BNJA 4ZN6A 2I99A 1YH3A 2Q45A 1PJ2A 4O5OA 4GH5A 1QSGA 5T64A 3ZCXA 3S1LA 1A4UA 3A9WA 4R54A 3WNVA 3AM5A 4IDAA 3WX0A 2X9VA 2VN8A 4S1VA 5TJ9A 3PJGA 2JAHA 3KUXA 1PJTA 3RUDA 4BO7A 5BNFA 4PG8A 2Q1SA 3OA2A 4D43A 1ZSNA 2AW5A 3OIFA 3KETA 3IL2A 1C1DB 3KSDO 3X2EA 3ONFA 3ZZNA 5JE8A 1B26A 1HE5A 4DWVA 3WGOA 3WS7A 3CZMA 1FDWA 3L9XA 1AHIA 4R3NA 4QX6A 2GZ2A 4Z6KA 4KDFA 5EN4A 4KZPA 5JAQA 3ZWPA 5IZCC 3F6YA 4QO8A 4WGGA 2D5AA 5CEEA 5I8ZA 2CUKA 2G0TA 2VRCA 5AYVA 3PYLA 4IQ8A 1AHHA 1NVTA 1EK5A 1EEHA 1MC5A 1VJ0A 4MKZA 1T2DA 3WTCA 2NUAA 4DIFA 1T24A 3JQGB 4D0RA 3I3OA 1GQQA 3GA0A 2EGGA 1GV1A 1Z7BA 2Y0DA 4E32A 4N18A 4TZTA 1TVEA 3UOGA 4ZQBA 5THQA 2PZKA 4GVLA 2H6EA 3LF2A 4JBIA 4J3FA 5CAEA 2XOXA 1IYZA 4URFA 3A06A 1ZW1A 4XQGA 4HX5A 3ZU4A 3NKLA 2O7SA 3H9EO 1H0KA 1R12A 2W2KA 4OXYA 3WGQA 2I67A 1DJNA 3QWBA 5CDYA 5EQDA 3MJSA 1KS9A 2C82A 4NG5A 5U1PA 3QLJA 1JKJA 1S7CA 2BFMA 4BNLA 4CM5A 3OEWA 1A7AA 3U4CA 1GQYA 3UVEA 5ER6A 1M66A 3CMCO 3I4CA 1XEAA 3HNPA 4J1TA 5TS3A 1LDBA 4NR0A 2DPGA 4WOKA 2IZ0A 5CDUA 8LDHA 2EKQA 1R4NA 4F45A 2VUTA 4E31A 3EDMA 4BNTA 1TEHA 1VL6A 4ZQEA 4PRKA 2WM3A 1XYGA 1VJTA 4JJIA 2V6MA 1BW9A 4Z0HO 1GPDG 1E6UA 4N5LA 4NPCA 3M1AA 4TRJA 4G2NA 5K9ZA 3GFBA 2AE2A 5KTKA 3KSZO 1LDYA 3D4NA 4E30A 4NH4A 5FEUA 1GUYA 4ZQGA 3TWOA 4ZRNA 4ALMA 1QMGA 1O5IA 1LJ8A 4YB8A 3PGXA 3DHNA 3GRKA 1UAGA 1YBVA 2AQ8A 3EHEA 5A9RA 1HYGA 4XQEA 3HFGA 1R15A 3K73O 1YB4A 3Q2KA 3HDJA 1QLJA 1NPTO 2PGDA 3TQHA 1EUDA 1GD1O 2D8AA 2HCTA 5A9TA 3DXFA 4QO7A 2JAPA 2GRAA 2NV6A 1ADGA 4D7AA 5KWEA 4XJSA 3AY6A 4YAJA 1CQIA 3I9NA 1MXFA 1W4ZA 1I36A 1PIWA 2VHYA 1WP4A 2QQ5A 4J9UE 1O0SA 1ADFA 2WSBA 2ZJ0A 3KVOA 4YT8A 2GR9A 1EFLA 2YDYA 3L9WA 3PQEA 3U4HA 4RQTA 2TMGA 3V2GA 1AE1A 2QW8A 3PVZA 2Z95A 4OQZA 4BNXA 3GGGA 2BHLA 3LZ6A 3ZU2A 4IDBA 4YT2A 5T6BA 1K6IA 4IJKA 3GGOA 1E3IA 3B6ZA 3GMSA 2O2SA 4OYRA 1NP3A 5A05A 3WSVA 2QRLA 4DC1A 2Q4EA 3RCBA 1NQAO 3DQPA 1LC3A 2CDBA 1PWXA 1PZHA 1Z74A 4IDCA 2VWQA 3KXDA 2B83A 4JGBA 2X9NA 2WD7B 2P4HX 5EIOA 1NR1A 1IB6A 1EK6A 5BNTA 3E5MA 3AM3A 2EW2A 3CH6A 1J0XO 4NDNE 1DJQA 1PEDA 4J9VA 4RVFA 3TZKA 1ZCJA 1NPYA 3GEDA 2WTBA 5ES3A 1IHYA 3BTSA 3N7UA 2BFOA 1Y1PA 4BB5A 1K6XA 3WBFA 4E5NA 4J1SA 3ROQA 3T4XA 5G0VA 2FR8A 4QSMA 4YJHB 1DRVA 1VSUA 2JL1A 2A9FA 2JD2A 3LT4A 5B4UA 4J4BA 9LDTA 3FNFA 4IMPA 2YW9A 5DDIP 1D4FA 3TPCA 4KTTE 3W4IA 2OZPA 2O2YA 4QFDA 3IAHA 3E48A 4UVIA 2OP0A 3KV3O 3KEQA 3VZPA 4OH1A 4FGWA 3C7DB 4DBZA 4K26A 3IS3A 4KP7A 1P74A 1YQGA 3MTGA 1E7SA 2OBNA 3DZHA 1I24A 5B1YA 3PIDA 1Y9EA 3JYPA 5HWSA 1JWBB 1XA0A 1YL7A 3ADOA 5LCXA 3RU9A 2W2KB 3H5RA 3HB4X 1TA4A 3JCZA 4J1QA 3B70A 3F9IA 1I8TA 4E2ZA 4WCDA 3FR8A 3STHA 3VHRA 1VPDA 4ALJA 3WQQA 3EVTA 3GPIA 3I9OA 4RGBA 2CZCA 2CDCA 3RIHA 3U5TA 5I9MA 1DOHA 1P33A 4NJOA 5H83A 1MFPA 2EWMA 3JQEA 1DB3A 1LI4A 2C59A 3SX2A 3D3WA 4LISA 4MIOA 2Q2QA 3ROMA 3AWDA 3JQ9A 4J49A 2DVMA 1SMKA 3DZBA 4J43A 3D5QA 4I5DA 1CDOA 4CLHA 1P3DA 3DDNA 3GDOA 3PI7A 2YQ5A 4LN1A 3GMDA 1R6DA 3D7LA 3GNSA 3GDGA 5T67A 4FS3A 3RC7A 3RC2A 3ZV6A 4JP3A 2DM6A 2XXBA 5DT9A 4Z3DA 4AJNA 5KIAA 3DWFA 4NU5A 4R9RA 2NVUB 3H9QA 1HTBA 5AXCA 2EP5A 3P19A 1EVYA 1P1KA 4FW8A 4RPLA 1Z75A 2JCXA 1CEQA 1ONOA 1ZMTA 3BTOA 2AEMA 4L74A 4HFMA 4I8XA 1E1LA 5BR7A 3FCOA 2WYWA 4CV1A 2OUIA 2GUGA 3ON5A 2XXJA 3NJ4A 3I9JA 3HSKA 2D4AA 4GPD1 2B4TO 2GLXA 4HFNA 5L9AA 5F5NA 5L40A 2DTEA 3DC2A 4H3VA 3JQBC 4DMMA 5A06A 3K8ZA 4ESOA 2RHCA 3WYBA 5LDHA 3IC5A 3VOSA 3WGTA 3ZWOA 1NAHA 3ROKA 1E1KA 3VPGA 4JBGA 4W99A 3MEQA 2PD4A 3COSA 1M75A 3CIFA 3C1TA 4J16A 4MVJE 3H9JA 4PLVA 2G5CA 3VPFA 4F46A 5TLSA 4A03A 1RYDA 2OORA 1C0PA 1LNQA 4RPJA 4QUKA 5EL0A 1T2EA 3JYOA 4BGIA 4IJWA 4LGVA 4W7HA 1I0ZA 2VQ3A 1MB4A 4AG3A 5ICSA 2HLPA 4OSPA 3LQFA 3FF4A 1DLIA 2D0IA 4ZQFA 1PJSA 2FZEA 4UUNA 3L77A 3C7AA 3OEYA 3GFGA 1WWKA 2VNSA 1WNTA 2Y1OA 3JQ8B 4CQLA 1PWZA 3GVCA 4P4GA 4B8ZA 5DCWA 4EDFA 5JMPA 3RAJA 1ISGA 1DO8A 2JCVA 1GU7A 1XQ1A 1BXZA 1MFZA 2H63A 3OIDA 4OXKA 4E6PA 4EJ6A 1Q7CA 2PKQO 5IXYA 1NNUA 4WASA 1LSJA 4BNVA 1BXKA 1H5QA 1YJQA 2Q49A 2W98A 3I9LA 4A5OA 5EESA 2VWGA 5B4VA 4M86A 4M87A 5JDCA 4CMBA 1LDEA 3O8QB 1ZIDA 3O03A 1NWCA 4BNMA 2I65A 4F6CA 4GMFA 4CMAA 4WK6A 1B3BA 3UFXA 4B4WA 1X0VA 3ZN2A 4QFCA 3BMQB 4BNIA 4RVDA 1BTOA 1CETA 3L0DA 3NDRA 4PCVA 4PLPA 4DRYA 3VAZA 2PZJA 3KM0A 2Q99A 2FHSA 3G0OA 2Q2WA 1F0YA 5AVOA 1D3AA 1N5DA 4HNGA 1I01A 1YL6A 1LXCA 1OAAA 1N7HA 1BHSA 3MWEB 4FFRA 4KUHA 4BO1A 3DTTA 1ZEJA 4FN4A 2W2LA 2FN7A 2E48A 4IY1A 1X7HA 3Q0EA 3P2YA 5CP8A 4MOWA 4NBVA 4PLYA 4YJDA 5L4LA 4Y6PA 1PQPA 3MJTA 2O3TA 3H2SA 1Y5RA 2VHVA 1VM6A 3W6UA 5KJEA 2AXQA 4CUKA 4UAGA 2B5WA 1GR0A 5A9SA 3WMWA 1L7EA 3D3WB 3TNLA 3ZWYA 3ANNA 3JQAA 1V35A 1A9ZA 2CF5A 4XGIA 3H5AA 1YJ8A 1ZJZA 4WNIA 3I52A 3C7CB 5IZ4A 3NYWA 1RM5A 1X15A 3NDIA 3NGXA 1Z82A 2ZB3A 3GNQA 5L51A 4NMHA 2J5KA 3NV9A 1UJMA 2VT2A 2NACA 5JBIA 2O23A 2NTVA 1GZ6A 3RC9A 3SC4A 3VVCA 2OBYA 4LRTB 2C5EA 4L76A 2DTXA 2AQKA 4MKRA 3K2BA 2E37A 3QV1A 4R4JA 4WUVA 3UCXA 5L7WA 3EVNA 4YCAA 1LUAA 1UH5A 3GAFA 3O4RA 5KJ6A 3B1FA 2V7PA 1EUZA 4UUMA 3SXPA 5IJZA 3U4IA 4Z9FA 4GVXA 5TX7A 3BTUA 3NTRA 3GH3A 4F6LA 1K2WA 2P68A 4DUPA 1P0FA 1HKUA 3MTJA 1P1HA 1M2WA 1H2HA 3KTDA 4PZDA 2P9EA 5F1OA 3U49A 1MP0A 2C7VA 4IXWA 3ZWWA 3GRPA 1JAYA 1BVUA 5H82A 3CTMA 5TSDA 3INTA 1B8UA 1ZH8A 5DOZA 2EERA 4EYEA 1GCOA 1HWYA 2UV8A 1JVBA 1C1XA 1QV6A 2A92A 3MWDB 4NJMA 4Q3NA 4O59O 4AJHA 3PIIA 1LEHA 2I6TA 5ILGA 3IKTA 4PG5A 2CDAA 3C1AA 4YXFA 1ZFNA 1D8AA 1E7MA 4NFHA 2O48X 1DFGA 4B79A 3R6DA 3D0OA 1GEGA 2OO5A 3S55A 2JKVA 4OIMA 1YOVA 3EMKA 3D64A 3U62A 1FJHA 1C0KA 3RKRA 4IIUA 4M8SA 1D1TA 3PHLA 3TDKA 4PG6A 3QJ5A 4DGSA 1QKIA 4GWKA 4CL8A 1XHLA 3T7EA 1HDOA 4GBJA 3VH2A 3MCVA 1HDYA 2ZATA 4BKPA 1QORA 2P4QA 2BFPA 5DF1A 1UXKA 4QT0A 2PTGA 3CEAA 2ZK7A 4ZICA 3KRTA 5JCJA 5C7LO 3RUEA 1N9GA 3BMNB 2Q4BA 4L8VA 5JY1A 2J5RA 1BGVA 5TIIA 5KJ1A 1H6DA 3HHPA 2EKPA 2IE0A 4P4NA 4XYBA 4XB1A 3WB9A 3H9UA 1EQUA 5TF4A 1UP7A 1YWGO 4I9HA 4PLFA 1HXHA 3DAGA 1SO8A 3ZWBA 1WPQA 3RJ5A 4QXMA 5KJFA 1QXSA 3MJCA 3IMFA 5TGDA 4DBVO 1B0AA 1Q2XA 5MDHA 5G0TA 1XSEA 4R5HA 4R69A 1PJQA 2BGLA 2I3GA 4WLEA 4BO9A 2AEJA 3TFOA 1G6KA 2ZCVA 1UXGA 2PH5A 3ZNNA 2ZJ1A 3GLQA 2BRUA 2VCYA 3DBHA 4U6QA 1DIRA 1XELA 1UZNA 4E5YA 1PS8A 1YVEI 3I6QA 3TSCA 2GZ3A 1AGNA 2P9CA 1R0KA 4UVHA 4K6FA 1UZLA 1XCBA 2PH3A 3GEMA 1LSSA 3L4BC 4QECA 2J3IA 2B4QA 3F5SA 1XLTA 1FK8A 2VZ0A 2WE8A 3GOHA 4K28A 3DHYA 3KEOA 4U8GA 2GCGA 1DDOA 3WOHA 2HSDA 5ENDA 1I2BA 1VI2A 4YPOA 2JD0A 2CSUA 3K96A 5FI5A 1U2GA 4OAQA 4DPKA 2QZZA 4D46A 3ZWNA 2Y05A 4ND2A 3OECA 1XQ6A 4R01A 1O95A 4Q3DA 3L6DA 2X4GA 3IJPA 4L4XA 3PK0A 1PGPA 1PGQA 3JQAB 2D59A 5EPOA 1VRWA 4AJOA 2NLOA 2YJZA 4GWGA 4CM8B 1CF2O 3FSRA 2FP4A 4IJUA 3GVPA 4H15A 3WGIA 1OZAA 4AL4A 2HU2A 3PGJA 1Q7BA 4UVGA 5TRTA 2VTDA 4L75A 2UUPA 4Q39A 2B69A 4PLTA 2X1HA 4I5GA 3LC1O 2O3SA 1HZZA 4K1LA 2IXBA 4RLHA 2IRWA 5L7YA 5ITVA 4JROA 3DZKA 3L4BA 3IP3A 1A7KA 3GGPA 3NJ8A 1IZ9A 4D45A 4MVJA 1Q0HA 5KVCA 4TRMA 1SEPA 4A7PA 2VOEA 3V1YA 1EQ2A 5COBA 2W90A 5KVQA 4CM9A 4R5MA 5KVVA 3QVOA 4EGFA 1X7DA 4M49A 3M2PA 5U4QA 4WOJA 1BDBA 5CDSA 2Y68A 3S2IA 2HJSA 1DIGA 2NU9A 3QWFA 5KNLA 4R68A 3UUWA 1CERA 2D5CA 3DOCA 1NTOA 4IZIA 4XEHA 9LDBA 4E4YA 2AA3A 4Q3EA 1WW8A 4PVDA 2RH4A 4IUYA 1DRWA 3B1JA 5JAMA 4BKQA 1YBAA 4YR9A 1KERA 4ALNA 2E6UX 1YOVB 4WEQA 4I08A 4TSKA 1KC1A 4I9UA 4UUOA 3OFSA 4NI5A 1W6UA 4R16A 1FDVA 2BGMA 4L4RA 1JA9A 3U3XA 1GFSA 5CHEA 3QA9A 1LRKA 5IN4A 3DBLB 2EXXA 1BG6A 2DBQA 4Y9DA 3KSUA 3IOYA 3W8DA 2ZYAA 4ZD6A 1HETA 2AQIA 2PA3A 1PZEA 3ENKA 4BGUA 1BWSA 1W73A 2XAAA 3ZNQA 4NNJA 3RFTA 1R16A 3EZLA 4MVJG 4E5PA 1I30A 1XWFA 1A4IA 4XZ3A 2D2IA 2V6FA 2IDZA 4K6CA 1P45A 4ZQHA 4XYGA 1I32A 4WNCA 2ZKLA 2DPHA 3I23A 1WZEA 4BHTA 4LVUA 5G4KA 1GPJA 4YQZA 3VTFA 1K89A 1YQDA 2UDPA 2I3AA 1AN9A 2R6JA 4IDEA 2VWHA 4B3JA 1Z45A 2Y1FA 2POQX 1RWBA 5JO0A 2OOSA 4GX0A 2Y99A 3PTZA 2FR0A 3GN1A 3OQ6A 4D3FA 1P1FA 1S6YA 3ETGA 4EEZA 1R0SA 2WMDA 2GSDA 4JNKA 3RASA 3DBHB 1UAYA 1SBYA 1ZK2A 4KDEA 4CJXA 2JFFA 1RM4A 1NX6A 2V6GA 2X0RA 3DFUA 4MVJI 5BSEA 3PHIA 1E3WB 3LSYA 4OOEA 3ABIA 4XRRA 4Z9XA 1R4MA 2I66A 2ZQYA 1KETA 4ITUA 1XGKA 4DYVA 2CVZA 1SEVA 3WYCA 1KVSA 1OMOA 3K9QO 3A4VA 1B7GO 1ORRA 2X9GA 3ZH2A 1O8CA 3C1OA 4AJEA 3V8BA 4QTZA 1L7DA 4Q3CA 3GUCA 1UDCA 4EI2A 2C2XA 3BZUA 1B8PA 4TWRA 3V1TC 1V6AA 3RUIA 4WCFB 1O6ZA 3LVFO 4RLSA 3WFJA 4BNGA 3OJEA 4U6SA 4Y98A 4NFYA 2DUWA 2VYND 4Y6RA 4FOOA 2RCYA 1QYVA 4DMLA 2C54A 4GQAA 1E7YA 4YDRA 5DNAA 3HDQA 4CMIB 3KYCA 1FDUA 1XKQA 4CMJA 2B4RO 1MGOA 4INAA 1F8GA 5A5EA 4B8WA 1R37A 2NM0A 2NVBA 4DYDA 2Y93A 2P2SA 1U7HA 3GNTA 4FGSA 1EE9A 3W1VA 3GZNB 3I4FA 2HMUA 2QRJA 1PZGA 4RL6A 3BXXA 1KY5A 3BA1A 2CVQA 2VYVA 4XRGA 1ZK1A 1NXQA 2C7GA 2F1KA 3PWZA 4P38A 2E49A 1B16A 1H6AA 3BHIA 3MJEA 2XF8A 4BMSA 4YACA 1E6EA 3BAZA 4HUJA 5KJCA 2UUOA 3AU8A 4PGFA 1D1SA 1X1EA 4FFOA 3FRJA 3R3JA 4DXHA 3WBBA 3TJRA 1M76A 4XA8A 1IY8A 2X8LA 2VUUA 4XYEA 3I6IA 3LT0A 2EEZA 3Q9UA 1ENOA 2YUTA 1R0LA 2DBVO 3ZNPA 1HSZA 3F3SA 4CMKA 4RVGA 3JD2A 5JY6A 3GZ4A 4CMHA 1KVRA 2IZZA 3HDHA 2BFAA 1NM5A 5I7VA 2FY8A 1F8FA 4D3SA 4BO0A 3H8VA 5JAZA 1DAPA 4MP3A 3H4VA 3DZJA 2VT3A 3ZDFA 4IDDA 3RI3A 4YRBA 2X7HA 4IXTA 3HFSA 3E8XA 3WXBA 1NWHA 4OSOA 4Z3KA 5F3RA 3D4OA 3AY7A 3UHAA 3BMOA 3RWBA 4WLUA 4BKOA 5IXSA 4OQYA 4P4LA 3NGLA 4PZCA 3RUCA 4DTIA 3JQ9C 4OMUA 3CINA 2C0CA 1M6HA 3NAQA 5C5IA 4O63O 1MG5A 1LTHR 5AXAA 4TVOA 2QYSA 4W6ZA 3RUHA 5HRUA 3PQDA 1O94A 4GX2A 2VNAA 1H9AA 4G65A 1P1JA 5JC8A 1HLDA 4YJGA 1P1RA 4CM4A 5I9LA 5KKCA 3RUAA 2O7QA 4C7KA 2C2YA 3DAFA 3LT1A 2PV7A 3WLFA 3AFNA 3AOEC 3ZV5A 5T57A 1ISFA 1HDXA 1QYWA 4DQVA 1PQUA 2IXAA 2X5JO 3JSAA 3G1TA 1OC2A 3RFXA 1CRWG 2UAGA 4ALLA 2JD1A 1ULUA 2J3KA 2PZLA 2Q46A 2YHIA 3Q3CA 1CWUA 4YT4A 3L07A 4YQYA 1P1IA 4J7XA 3SVTA 2GD1O 3AI1A 1JLLA 3DL2A 2SCUA 3E03A 1DEHA 3K2EA 4TRNA 2JHFA 3IJRA 4ROSA 1OOEA 3ZWCA 4Z0PA 4EITA 3V2UA 1R4MB 1KY4A 4RCVA 2FPGA 1LSUA 5AXBA 2UYYA 4GX1A 3DR3A 1R4NB 4RQUA 3R3SA 1HZJA 1H94A 4I5EA 5HBRA 3PPIA 4DA9A 3HJAA 2D3TA 3H7AA 1E77A 1Q1NA 1BW9B 1MUUA 2PFGA 3AOEA 2A4KA 3PRJA 5ILOA 3DBRA 1JW9B 1JVSA 2CF6A 2WYVA 1JQBA 3GAZA 3IUSA 3O9ZA 4YJFA 3WJAA 3GR6A 5FFFA 5JDIA 4IDFA 3NT2A 2Q3EA 3KBOA 3GHYA 4PLGA 2PGLA 2Q1UA 4OXNA 1EMDA 5I7EA 3EYWA 4MDHA 2PR2A 2EKLA 2HRZA 3HADA 5FF9A 2EV9A 4WEOA 4E2XA 2VRCD 4LK3A 5G4LA 1GQ2A 4BUCA 5FYDA 2IODA 4DLLA 3ZV4A 4BVAA 1SOWA 2Q1WA 3JD0A 1WXDA 2IZ1A 2X86A 3UF0A 3P5SA 3DFZA 3F47A 5CPBA 2ZB8A 4KOAA 1ADCA 3EGOA 4EEXA 2WWRA 4YT5A 3A14A 3H9GA 3JTMA 1U2DA 1HDGO 1HE3A 3CPSA 3PHHA 1SNYA 4I5FA 4NU6A 3SC6A 4F3YA 1GCUA 1K6JA 1OFGA 3QW2A 3V1UA 3QSGA 5JMWA 1AXGA 1Y8QA 2PWZA 1WMBA 3B1KA 2Z5LA 4E2YA 4YAIA 5JDCC 1ZNQO 7ADHA 3O38A 4BNNA 1U1IA 5CDTA 2O3UA 3G17A 3QVTA 2NTNA 3KZVA 3PYMA 1TT5A 1X13A 3G1UA 3UN1A 3BMCA 1PS0A 1KOLA 2FZWA 4CLEA 2DBRA 2OL4A 3B20A 4XGNA 3QVWA 1NBOA 3OHSX 4LVCA 1N92A 1UP6A 1VE9A 4BO4A 3IIEA 4FCCA 1P9LA 3F5QA 3I1JA 4OHUA 3HB5X 3ZWXA 2FPPA 3JYQA 2A35A 3RQSA 1HE4A 1U5AA 5HS6A 4BNHA 3UICA 3WGZA 2DFDA 3C8MA 1T2AA 3CXRA 4P8RA 3E5RA 1ADBA 2QZ9A 3ZW8A 4D41A 3FNHA 2Q2VA 5G0UA 5CPFA 1RJWA 1HYHA 1LQTA 1I3LA 4ND3A 4E5KA 4OKIA 3BHJA 1E7WA 1N1EA 5CG2A 4J0EA 3SEFA 3ETEA 3L6OO 4IZHA 5EERA 1PGNA 3H5NA 3P7MA 2B37A 2RHRA 1JTVA 3ASUA 3CE6A 3F4BA 3TFQA 4B4OA 2RIRA 1UXJA 3CZRA 4AFNA 1GV0A 4CQMA 3QIVA 4JBHA 4YJGB 3RJ9A 4CM4B 1DFHA 2ZIZA 2EF1A 4DPMA 4J1NA 3V5NA 3IUPA 4PLHA 1E3JA 3R1IA 3UAGA 4HP8A 4FC6A 4B3IA 3ZWAA 3AK4A 3OJOA 5L4SA 1KVQA 1E1MA 4MPDA 4XR4A 4LCEA 2PK3A 5TT1A 3VH1A 5DN9A 4JCOA 5F5LA 3OJLA 1E92A 1VKNA 2IYOA 1DC5A 3DHEA 4BO2A 4FB5A 1LA2A 1QYCA 1YB1A 3JQCA 4XIJA 4U0KA 2CNBA 3F4LA 3PZBA 4AJJA 2FPIA 3DTYA 1SZJG 5JFOA 4FJ1A 5A1TA 3BYZA 4KUEA 1ZXLA 5TT0A 3OICA 5L45A 4I9NA 4B4UA 3ZHXA 1N7GA 4R1UA 2GDZA 4BGVA 2VZ8A 1JWAB 3HWRA 1NHWA 3FWNA 4BNFA 4O6VA 4J6FA 1M6WA 2EHDA 1I3KA 2GYYA 5IDXA 5KVSA 5C7OO 4MVJH 3GQVA 2EG9A 4Z9YA 5G0WA 1XU9A 4NQZA 3GVXA 4XYMA 4U0JA 1GDHA 1IUKA 4CLOA 3H3JA 1NFFA 1HL3A 2FR1A 3DBRB 4MVJF 5DBGA 4BIIA 5HM8A 3VZQA 4EW6A 2Y0EA 2J8ZA 3AUTA 5J23A 3QVSA 3SLGA 1X1TA 5I7FA 2YV1A 5DP2A 4MJLA 1N1GA 2CD9A 4HFRA 4UEOA 2VZ9A 3VH3A 3AUSA 5C37A 2X23A 2C5AA 4BNUA 3HZZA 1ENPA 3DONA 1C14A 4K9DA 5BQFA 4DVJA 2IEBA 2Y1GA 4BMVA 2Y0CA 3ZGYA 3DBVO 3MOGA 4RORA 4IS3A 1LRLA 1LQUA 3A1NA 3BHMA 4L0QA 3KYBA 4KQWA 1BRMA 1ISJA 2YZ7A 3VZRA 2I5PO 4KWIA 4KWHA 3AFMA 2DLDA 2CY0A 2GZ1A 1JAXA 1ISIA 2X0NA 3WLEA 4E21A 3GVHA 1PR3A 2VWPA 3FTPA 3PXXA 4E12A 2C29D 1XU7A 3HDYA 4JLWA 3ZU3A 2DU8A 4IDGA 1Y8QB 1TI7A 3WSWA 1KC3A 3FNEA 2AE1A 2R2GA 3FI9A 4AJ1A 4YYZA 1E5QA 3TN7A 2Y1EA 3PDJA 2QYTA 3RC1A 4TRRA 2E4AA 1W0CA 2YHUA 1LX6A 4R9SA 4TVBA 4XQCA 2OXIA 5HA5A 4MVJM 4MIYA 3WIDA 4RVUA 5JSFA 3VVBA 4MVJP 1EDOA 1ZK3A 1ZUD1 3T7CA 2X0JA 2ZYDA 3EAGA 3QRWA 1DAOA 3ADPA 5DCYA 2G82A 2HDHA 2LDBA 5JLAA 1BMDA 4H7PA 5KKAA 1U3TA 4D44A 1DHRA 2CFCA 4CQLB 1MX3A 1QP8A 1ZEMA 5C3MA 5F1PA 2VHXA 2PKQP 5L7TA 1RKXA 4BQPA 4O1MA 1U9JA 1QV7A 3G79A 1DLJA 3HN2A 3OM9A 3F46A 4MP6A 3GG9A 3PWKA 3W8FA 1JN0A 2Y67A 1RYEA 3JV7A 1ISHA 3N58A 4EUEA 1P44A 2JFHA 1EZ4A 3W8EA 1KYQA 2Y66A 4XCVA 4MKXA 3K6JA 3GVIA 3RBZA 4OM8A 3U4DA 1EDZA 2YFQA 2PD3A 1FMCA 4CQMB 2ET6A 1Y9AA 3F1KA 5ITWA 1LLQA 3ICPA 3L4SO 4GGPA 5LDGA 1I3MA 4YEDA 1EVZA 3VZSA 1ZK4A 5L4NA 4E33A 5HTOA 2IEDA 2YDXA 3ANLA 1KBZA 3PDUA 3RKUA 1UUFA 1PGJA 3NT5A 4PN3A 5L95A 5BT9A 2HRBA 1EBFA 4ZRMA 3W4JA 1WMAA 2EGHA 4ND1A 4IM7A 1E1NA 1VJ1A 2X5OA 1Y81A 1V3VA 3AI3A 3KLPX 3PYXA 4HXYA 4GSLA 5A9SB 2JCYA 4CUJA 4B7XA 1B2LA 4WKGA 2YYYA 2ZB7A 1LC0A 2YFHA 4Q9NA 1IOLA 1UR5A 5AOVA 4DIOA 1PSDA 4FFLA 5BSHA 3DZGA 1QYDA 4YBZA 5IAAA 4RPKA 5A3VA 4JP2A 1HE2A 1NPDA 3GG2A 1PL6A 1LU9A 4TKMA 3H65A 4OGWA 4RVHA 1MA0A 3OIGA 2A94A 5TQVA 1YB5A 1ZVMA 2E82A 5T8KC 4MIEA 4Q3BA 2R00C 1F17A 4JJFA 5B4TA 3AY3A 1KEPA 4FJ0A 3AOGA 1K5HA 4LMPA 5ADHA 4OOFA 4GL4A 3I9MA 4QQRA 2VUSA 1E5LA 1DC4A 2B5VA 4A0SA 5CG1A 3NT4A 1SPXA 3H3FA 1ZSVA 4PRLA 1MG0A 3IQDB 3LC7O 3RROA 2HMTA 4NZ9A 3TOXA 3UW3A 1DHTA 2GERA 3E18A 3QWHA 2OMEA 4B7UA 4BKRA 2H5LA 4Y6SA 3H2ZA 4WE3A 5I7SA 4RVSA 1Y8RA 1C1XB 4NJMB 4IGFA 2ZTMA 1WDLA 1RM3A 2HKIA 1PS9A 5G2OA 5A03A 5LC1A 4UREA 2D1YA 3KHUA 3U09A 1ONPA 5F21A 3LU1A 4GAEA 4HY3A 2AG8A 3GUYA 5T8KA 1WDKA 2AG5A 3LT2A 2R00A 1A71A 7MDHA 4RF5A 2W2LD 4II2A 3NTOA 1QRRA 3MZ0A 5IDYA 3ENNA 4ZVVA 4RJTA 3KYDA 3LYLA 3PQFA 2WJPA 3FHLA 3RVDA 1G1AA 1P0CA 1ML3A 2ZTLA 1E7QA 1E3SA 1YRLA 5CEFA 4PLZA 2Z1MA 3JQAD 4WPGA 3PHGA 3VH4A 3WICA 4J2OA 1TB4A 1UP4A 1A27A 1N9GB 2WD7A 2J3HA 1PTJA 3WIEA 1KVUA 5T5QA 3OMLA 2YQ4A 2ZTVA 4ZHSA 2WDZA 2NSDA 1ZSYA 1ZJYA 1J4AA 4J7CA 4PIVA 3TL3A 1ZK0A 1E6WA 3LLSA 2GN4A 1TXGA 3A28A 4GMGA 4CR8A 2O4CA 5MGBA 5GZ3A 4UULA 4TQGA 1LSOA 5IDWA 1NYTA 2H9IA 3GPDG 3PLRA 3ZW9A 4BKUA 1JKIA 4J4HA 4YJHA 3K30A 4XR9A
chains in the Genus database with same CATH superfamily
4CUGA 2L2OA 1Z34A 1E0KA 3DZFA 3C24A 2SECE 5K8IA 3Q0VA 1JDTA 3IPCA 4QPQA 2GPWA 1MIHA 4EVQA 5D3MB 3U31A 4BWVA 2NU7A 3T5GA 3P4UA 2ZTUA 2R7LA 4POAA 1GLNA 2EP8A 4IQ0A 2FSVA 3JY6A 2H7YA 2FP4B 1XQ9A 3JWHA 5EE5B 4B3TB 3WR5A 2DHCA 3Q40A 4FQ8A 1D6JA 3RANA 1T8WA 5HKKA 2PJDA 5A5FA 1L7QA 3ECSA 4B6EA 4U7DA 2M30A 4IJVA 3KT0A 2WA1A 1FWZA 1ZVJA 1MBFA 1M54A 4IIFA 1D2GA 2QRZA 3E9QA 1VRCA 2JIZD 2H9AA 3RVRA 4O0LA 2IYEA 2CL7X 1YJXA 2ZUCA 2H1VA 1C7IA 1ZGBA 4N0PA 4MUKA 2CHQA 4H60A 4OH7A 3VR4H 3WFIA 4ESBA 1LD3A 1WUIS 3KJQA 1PHRA 1U5CA 1O9BA 2FSGA 4QUGA 3K1NA 1Y5NA 4RY9A 2WYUA 2I8CA 2XMBA 1FFEA 4HV4A 5CVTA 4M89A 3LNQA 3F5DA 3N1UA 1LK5A 3DLTA 4IIDA 2GZDA 3VU1A 1N2GA 2GNAA 3WWEA 3ONEA 1P4WA 3K1AB 3GA5A 3L8FA 4A5SA 2VK8A 4F1WA 2PN6A 1KEWA 4NCBA 4OINF 3KZZA 3VTAA 2IEIA 2EIHA 3BMQA 4RGUA 2X6TA 2YZMA 1G20A 3VR0A 1UBEA 3LCUA 1KAMA 5KYWB 4BHBA 3D4PA 1DPGA 3H2IA 4HL6A 4I99A 4EHIA 5BNIA 3PJFA 2Z09A 4EJUA 1L7XA 3CO6C 4A6DA 3MYRA 3ZTWA 5HPYB 2QPTA 4X60A 3DR5A 4UC0A 4WK0B 2GHIA 2WD8A 3WGYA 2X19A 1BKDR 3WYEA 4AROA 3K9LA 1T8YA 4IOCF 4FZRA 3ZUPA 2GVDC 2ZRJA 3FTCA 4V0SA 3F96A 3M1IA 1P77A 4KI0A 2OBBA 4ZDLA 4OHBA 4E0BA 4GC5A 2YWRA 4A0HA 1G0NA 1A5ZA 2D2FA 4CWAA 3TOZA 4GFBA 4GSKA 2BGJA 3VMFA 1WKBA 3HG7A 4R40A 3KP3A 1C5KA 1E1CB 1J9IA 2BMDA 2JLCA 2XV1A 2QGUA 4H7IA 1IAQA 2B9VA 5G1OA 3B7WA 4D02A 3TX2A 4NTZA 4UNSA 2M2IA 3QBDA 3ITNA 6ADHA 1VDZA 1W4BA 3G0IA 2XNSA 3AERB 4UKDA 4KO4S 1VE3A 2VEOA 3O8LA 1VIYA 3AVTA 3I0ZA 1XMQB 5TRDA 4AUEA 2R7RA 1RE0A 3QX9A 2J33A 4W5QA 1SCUA 2XUIA 1X38A 2REBA 4B5LA 1U4SA 3PQ6A 2SCUB 2FH5B 4GI3A 4OUDB 3FCUB 1Z73A 2EZUA 3TIVA 3BIFA 1T9BA 2ZAMA 5CH3A 2F48A 2J5PA 1IPEA 2IV3A 3NHPA 5LRRA 1T2FA 5F1KA 4C88A 2G4CA 2J5QA 4GYWA 2I80A 1R2QA 4EZBA 3Q2IA 2C4VA 3WKAA 1O89A 1GHCA 3ECHA 2WHRA 3DFMA 1PNQA 1O94D 3ZU5A 4CODB 4RF4A 1HNXB 4MK4A 2QYHA 1PRYA 1KDRA 1YW8A 2KIFA 4PFQA 2VK4A 2HQSA 1WCIB 4PG7A 4EKGA 3JZFA 5CRIA 3PFGA 2CVFA 1OXMA 1BCRB 3FBTA 4MAMA 3WZ2A 2DPXA 5L3EA 1IUYA 4X63A 4XFDA 3ONQA 1GKIA 5C4GB 3ZS9A 1Z15A 5DKFA 5EKXA 3MMNA 4F2HA 4ALIA 1VL0A 3ZIUA 3GO5A 1GPNA 4XLTA 2DR2A 3ZHYA 1YVDA 4ZALA 1E3EA 1T3HA 3K0FB 3W6JB 1IN4A 2O0YA 5C53B 3G1WA 3QVVA 1SBQA 4GM0A 1QX3A 1KARA 2EF0A 4HWKA 1G3UA 5GGYA 3Q4GA 4Q5SF 4LXXA 4RWZA 1U8FO 3AQIA 2AHQA 1ZM9A 2E21A 4GGOA 1NJ1A 5BOVA 3RHTA 3T5BA 3X1KA 2VJCA 1L4FA 5JAIA 3FPFA 1OD6A 4MYUA 4F4JA 4ZEXA 2UV1A 1NI4A 3MIIA 2JGLA 2PH7A 4LNAA 3MJ4A 3VR4D 3IV9A 1G17A 1T9HA 2PG4A 3L79A 3NWJA 5GAGJ 3IQZA 1U0GA 1QLHA 3RSCA 1GJRA 4NBWA 3A2KA 2M45A 2QTVB 2K40A 4Y0NA 5C1IA 2YV4A 3IHTA 2GCEA 3DKXA 3BE8A 1NE2A 2XUFA 4E70A 1S2NA 2X9VA 3PQKA 5TJ9A 2JLXA 3WHCA 3SY8A 2BGTA 4MYSA 5H8WA 3KSDO 3MWYW 4P54A 1ORVA 5JE8A 4L5CA 3CZMA 5C35A 3VYTB 2MYUA 2EATA 1JQDA 5IT5A 3AR5A 2CUKA 2GF0A 1SHTX 1F6DA 5DBHX 4CEHA 4MKZA 1R5JA 5JNSA 4JQFA 1TQMA 5THQA 4Y0VA 2QLMA 1F2UB 3IE1A 3HPHA 1E1RA 3WAJA 4URFA 3A06A 3ZU4A 3U4QB 1JXSA 5CDYA 2CXHA 1MT0A 1JKJA 6NULA 1M66A 2EGUA 1KEZA 3DOUA 3OJWA 3BCSA 2Q41A 3CYFA 1G5RA 1A9PA 2QN3A 3AVUA 2AG6A 1Z0DA 3F49S 1E9SA 4TV8A 4QWWA 3GQBA 2W8BB 3DDCA 1LDYA 1IBSA 4OKSA 2AOVA 3DHNA 1VQOI 2ELJA 2I5UA 1P72A 3OPNA 2ZJ5A 1QVVA 2X8JB 3WKDA 1FQKA 4LKRA 1ZNZA 4OQFA 3OUTA 1J8DA 1QO7A 3I9NA 2VTBB 1DV1A 1ZGHA 2ZI4A 3BQNB 3GRAA 4C6TB 1EFLA 2TMGA 1JHXA 4IX7A 2F8MA 2JFZA 2Q3MA 1XZGA 5EJCA 3GGOA 2O2SA 4HXGA 6PFKA 4NCAA 4X62B 3SGLA 3KCCA 2VWQA 4CNQA 3VB2A 2WD7B 5CLJA 2DT7B 1RKBA 2JJ7A 2D1TA 4LXUA 1I3CA 3G6EI 2EV6A 4KO3S 3COVA 5ES3A 4QNMA 4J1SA 3AI7A 2FR8A 2C9BA 2O8FB 3ZBUA 3W4IA 4HNAA 3MB5A 1RRJA 2NVOA 1YQGA 4MWCA 2QTMA 3B48A 2I2AA 3G2MA 3PIDA 3E4CA 2WY8Q 1XA0A 4WN9A 3S17J 1TA4A 3NBFA 1Z38A 4RTLA 1NVDA 1MAVA 4M46A 1T1GA 3BGOS 4QXOA 4QQFA 1OCCH 5I9MA 3LGSA 1DOHA 5HG0A 4KXLA 1DB3A 4RVCA 1K4TA 2F17A 1BNCA 5F73A 5FKNA 3HUGA 4GR9A 1EVLA 1GG2A 3GDGA 5IJ0B 2KMLA 4YUWA 4HEHA 5BMVA 4G4GA 1EWKA 3UWOA 1W85B 1H69A 2GHQA 3BTOA 3BSSA 2XNKA 1BA5A 4RMNA 4BYGA 3FM3A 1QZUA 2PYIA 3OM1A 3F6EX 4CV1A 3FZYA 5F5NA 5F1YA 4OI2A 4F4IA 3OTWA 4CDGA 4JEUA 4YLYA 5ADWA 1CG6A 2XT9A 4MQLA 4FBLA 3I59B 1W52X 1NT2A 3CIFA 4MVJE 3CCLI 4M21A 4F55A 1OQYA 4DFDA 4A03A 4OIRF 3ZQ4A 1B8IB 3W2WA 1KU6A 4IJWA 1K92A 4DLYA 5D5XB 4EQ6A 3OEYA 1P2VA 2C9OA 4C9BA 4P1ZA 1LSJA 3I34X 3BGDA 2EV5A 5KYXB 1HDPA 2DECA 3O03A 5ARBA 4FKMA 4CMAA 2REQA 4PCVA 4LS3A 4D57A 5TQ2B 2HU7A 5HXAA 1N4AA 1ETQA 3FHJA 1E3MA 1N5DA 1QCDA 4KYVA 1V1RB 1W75A 2V5VA 3R9XB 1ZEJA 4Q48A 1CXZA 4PLYA 4YJDA 2GM4A 1YTYA 4M53A 1G8YA 5E1BA 1J75A 4UAGA 4I4TA 4PFOA 3FHTA 2XV4S 1WPGA 2OCEA 3C7CB 3ED1A 3FHCB 4UMEA 3ABQB 3Q2OA 2XVCA 3HPGA 4LRTB 3TZLA 4D6YA 1PWEA 3TBFA 3BXPA 1A98A 3H92A 1M1XB 2YBDA 3KKPA 3BZCA 3AVPA 2IUFA 3O5AA 3TKLA 5H82A 1BOFA 4DMHA 3CTMA 4I3GA 3E0XA 1ETYA 5D00A 2G67A 3ZOBA 2ONKA 3HRKA 3H0DA 1C1XA 4KYWA 3PIIA 4MQ6A 2CDAA 1ZAOA 5FV4A 4B17A 3BP8A 3CDHA 1FRFS 2A0UA 3E3VA 2QJTA 4MUHA 1HFWA 1C0KA 4IIUA 1W88B 3NDBB 3BRCA 4Q3LA 2JW5A 3FH0A 1AA6A 4UB8C 3U1KA 4RE6A 1TZKA 2ZBGA 1OLUB 4G9GA 3VKFA 2RGNC 3D6JA 1PVVA 1VMKA 4QPJC 4TTAA 2A6EF 4PCLA 2PTGA 2NN3C 1FRNA 4FXOA 4CT5A 1BGVA 4JJ7A 5TIIA 5KJ1A 2RI1A 3DAGA 4PNPA 2XIJA 3ZTTA 4NOKA 3K0EA 5AHKA 4R5HA 4CN8A 1LVAA 5KWJA 3N2KB 4GMHA 1UZCA 4ER7A 2QN7A 2ZRDA 4HX9A 4K6FA 1U5BA 2PH3A 3GEMA 3R7SA 3L4BC 3W3AH 4UHCA 3TRHA 4QIWN 3GOHA 4K28A 3KPYA 2J3EA 5J59A 4R0NA 1K63A 3MHPA 5FI5A 2VDWB 3GJSA 3KX2A 4HT3B 2Q7XA 4Q18A 1FPMA 1FNCA 3JQAB 2M6RA 5DUIA 4IJUA 2JVIA 1Z6TA 3UFBA 4HX2A 3BXFA 5JCZA 1VYTA 1DVRA 2IRWA 5L7YA 4JROA 4DDTA 2C77A 2YVQA 3G2QA 4UHTA 4HZGA 2XUZA 3OCZA 2IF2A 1AKHA 4FKZA 3RS4A 2QTNA 3ABLH 3DE1X 1X92A 3E9EA 1X3SA 2JJ2A 2Y0PA 2PUTA 3IKLA 3D7SA 1YCFA 4R68A 2VQLA 5CLGA 1SOAA 3AF5A 3KELA 5IC5A 4I9UA 3NNNA 3R09A 3EFOA 1VQPI 4TSFA 1T3LA 3MQ0A 4E08A 5KPJA 2O6LA 4LHVA 2C8VA 5ILQA 2XAAA 2QAGB 4B8XA 3ERMA 1GU1A 2ZFWA 1TLLA 2ZKLA 3ZHQA 5AJYA 1BXRB 4X1OA 3N6VA 3ORYA 3UT5A 1YZKA 2R6JA 5LUAA 3HJGA 1FFSA 1R9JA 3CC4I 3U7RA 5EC8A 5JPCA 3EIXA 3Q3JB 2XCTB 1V6CA 3H3UA 3DD1A 4KFCA 3PHIA 4C5AA 3TW4A 4UNIA 2WAEA 2TCTA 3WYCA 4DG9A 1BDIA 5F2KA 3TL4X 2ZSAA 3OFND 5BMVF 2EFQA 2P5TB 3SJMA 4OBBA 4EI2A 1I0LA 2X2PA 3DB1A 4LHEA 3H2KA 2HZDA 4NFYA 3SWWA 1GTVA 4Y6RA 1F2VA 1QYVA 4DMLA 4RJJA 3CC7I 3PU6A 3Q7RA 3REQB 2Z4RA 1NURA 5IT9Z 3ELUA 4INAA 2X0LA 4B8WA 3E23A 4JZKA 1EI9A 2P6SA 2W2XA 3S0JA 4RNCA 1F1JA 3DQZA 1U94A 5J6XA 1BI3A 1B16A 4YACA 4YI3A 1Y1RA 3OOYA 1ZESA 4MA4A 1O94C 2FX2A 4N0DA 1Z2EA 2MINB 2DBVO 1HEIA 4CMKA 3VOTA 5M5YJ 1KVRA 1NM5A 4KZKA 3E84A 1VCHA 2H11A 3H8VA 5FAXA 4DEVA 4IDDA 3KT8A 4Z2AA 4KMOA 1JEYB 3PC7A 2I2FA 1JG1A 1PFVA 4NNOA 3FI0A 4NBQA 5ECYA 2FG5A 3W5SA 2NUAB 5JC8A 3G9QA 4C30A 1Q44A 3TJZA 1GVJA 3W7VA 4E7IA 1QYWA 1PQUA 5L3RA 3NO4A 1ZRMA 1ONBA 3KUKA 3K94A 2Q46A 1YVPA 2DQLA 3T6KA 4GMKA 5DYYA 3N2IA 3LW8A 2CW0F 4ROSA 2VPYA 1YZUA 1IBMB 4G0YA 4TT3A 1T33A 3OL4A 4A0RA 4DLVA 1U2DC 3MWFA 1H94A 5DI3A 2VXBA 2ZC2A 1RBQA 3VGPA 1WU7A 2NTYC 3SX0A 3QW4B 3VR2A 1UJ2A 2NZJA 1RZUA 1TUBA 4ESFA 3PEUA 5HOOA 2C4UA 4DLLA 1WB5A 3RT9A 3WLJA 5FGMA 1N2CB 2WWRA 3KAJA 1CY1A 1CQIB 1GSIA 3UA3A 2IC5A 4HN4B 4DA6A 3B1KA 5JDCC 3VZCA 1ZNQO 1U1IA 2QVYX 4AT1A 2O3UA 3G17A 1MJAA 5FLKA 3RRMA 5E17F 2EQRA 1I6XA 5E4YA 3BSFA 5E3IA 1VE9A 2FZ4A 3SNHA 3Q8LA 1W9HA 5JUWA 1B00A 3HC7A 3TQOA 4PIMA 3W3AD 1IEXA 3RQSA 3CZ5A 2DFDA 3IJEB 4GCVA 3KVYA 1CRLA 4JT8A 1E1QA 1HORA 4J0EA 1IC8A 4UFPA 5EERA 1GNLA 5EMJA 2B37A 4TTRA 1JTVA 3OX2A 4AZVA 3HOWJ 3LDGA 4KJZA 2SNIE 5DK6A 4BMDA 1DFHA 2EF1A 4J1NA 1YZHA 2D8MA 3KP4A 3GRFA 5L4SA 3PNMA 5AVXA 3EVDA 3WU1B 3MTQA 1LPAB 5JFOA 4TS1A 3OZAA 5I01A 1ORHA 4EFNA 4KUEA 5FNVF 2E1PA 5H4GA 1JWAB 1IATA 2EHDA 4WERA 2OO5C 3SBEA 3NEJA 4HMQA 2NMVA 4RK4A 1KI9A 1NFFA 1HL3A 1L5KA 2Y0EA 1RI5A 4AP9A 1G19A 4MTLA 3FDJA 5BSTA 5LQKA 4UEOA 1GPH1 3UATA 1FYKA 4FYMA 1ENPA 3D5LA 3DT9A 4ME6A 2GLUA 1GT91 2N75A 1GL7A 1QH0A 3EPJA 2VQGA 1XKXA 4KQWA 1N6OA 1U81A 4KWIA 4KWHA 2MD5A 3F8SA 4YY3B 1GQFA 4G07A 3UA4A 4DW6A 3GVHA 4R79A 5K5QA 3GJYA 2DU8A 2CHEA 5JT1A 2V96A 4KX5A 5JAUA 2HTFA 4GXNA 4JT9A 2G72A 4XQCA 2YYAA 1U2QA 4MVJP 2IQIA 4DDVA 4B3XA 4BKXA 1KH1A 1N2ZA 2HXYA 2H48A 4H7PA 4HDNB 2CFCA 1SIUA 2PS9A 2PS1A 4JP1A 2C9ZA 4DCSA 2OWDA 3SZRA 3N2YA 1JUSA 3F46A 1ZD8A 3BT9A 4OREX 1RYEA 2HT6A 2EX4A 5BVHB 1C30B 4PZUA 3VJLA 5L3VA 3RBZA 3JU3A 3D9QX 4QYIB 2YFQA 2XKOA 4Y4RA 1T56A 4RL4A 5ALTA 1QOZA 1PZXA 2M34A 4ZRMA 2EGHA 1G3QA 3F7NA 5A9SB 4GSLA 1JHUA 5FROA 2ZZKA 1BHJA 1IOLA 2Z3WA 4R83A 1W0JA 4X1IB 4LUCA 3ELDA 3F8WA 1PL6A 2UZKA 3L18A 3OZRA 2HVQA 4DAEA 3AOGA 1X2MA 1EF4A 4GL4A 3DLBA 1X6VA 4AIDA 5JZVA 4M36A 3LOCA 1KYYA 4KK3A 3H2ZA 1RWWA 1ITYA 4OXIA 1W1WA 3K1MA 3H36A 1FS6A 2VQCA 3AH8A 3T7AA 5LC1A 4UREA 3U09A 5CDFE 3RJZA 4QAQA 3ZQIA 2A6PA 3ENNA 1N25A 1MGPA 2WJPA 2QVZX 4UBMA 4U5XA 5GV7A 1BW6A 5FLVA 5CFNA 3VH4A 3WICA 2OYSA 1YCGA 2R7NA 2NSDA 5D6NA 4XL9A 1CYEA 2IYUA 4RGVA 4ESVA 3ZHCA 2RGGA 2H51A 2OGTA 4W5HA 4MPJA 4FB4A 1PL0A 3RYTC 3PLRA 1C0EA 3UB3A 1K75A 2DKFA 2IIVA 2FU4A 3ZJUA 5ELMA 1B3RA 3M6FA 3HXMA 1YVUA 2D5BA 1OJLA 3QLTA 1YZGA 2JUCA 1NBHA 3NOVA 2C5BA 3GOQA 2A1TS 5LXTA 4FQ7A 4KVZA 5COAA 1Z21A 3C3XA 2HPVA 1HLPA 4M6VA 2OV8A 3UNGC 5ICMA 2M9MA 3W2IA 4CZCA 4XKJA 2X85A 5LD2B 4WFKA 1XD8A 2BC9A 2JVKA 3ZV3A 4FR5A 2ISSD 1AU7A 3A2NA 2NVUA 3PE3A 5DW3A 1TLTA 2FCAA 1FXUA 4PPFA 4LJYA 1KQ3A 2AYZA 1D6MA 4RLQA 3WBJA 4C3IJ 1YW9A 4TWIA 2XCRB 1QFXA 3STYA 1GGEA 4R7TA 4R1SA 2V79A 1ZQ3P 4BNKA 4RIFA 1VCMA 3TZCA 1I5EA 4FEGA 3D3EA 5HDGA 3LKDA 2AHOA 2L4AA 1T2UA 3ZNOA 2ZJOA 3OHMA 5KX5A 1QR6A 2GA8A 1VNDA 4KVAA 4LSZA 2E1OA 4KLAA 1ZR4A 2F9FA 1O95D 1I1GA 1XJQA 5HQ3A 1JFLA 4AN4A 1RHQA 4BBZA 5BOSA 5IF9A 2FRHA 2GPTA 1EVEA 4MDFA 4TWJA 4NCXA 3NIGB 4NHEA 2NYAA 2WAFA 3H3VK 1CS4C 4R1NA 1Q0RA 5EZGA 2IDJA 2HS5A 2XKJE 1RZ3A 3EVCA 4MMYB 3AHCA 2BUAA 2AJLI 1GSOA 2F00A 2YJTD 2QX7A 2ZRMA 2J3MA 2QSFX 1N6RA 1QZTA 2V1UA 4KH0A 3MSCA 4UVDA 3ZY4A 5CT8A 4NOMA 4IJAA 1HW5A 1WP9A 3FN4A 4RE5A 3PJEA 5DZSA 4QTTB 4YV1A 3NV7A 4AY3A 3S2ZA 1XJ5A 3H4MA 4QTRA 4PZAA 4O4IB 3KOWA 3LHFA 2H0QA 4HMOA 3ZXSA 4N3NA 5CFOA 2NO7A 3OE7A 4D0SA 2FA9A 4EJWA 1X7GA 1DBVO 5T4EA 5EHGA 1H6BA 2W70A 3SQDA 1Z5GA 4H17A 4YI5A 3VC7A 1WU8A 3K09C 5GIPE 4TWAA 4WECA 3MUNA 3WWZA 4A2CA 2A3RA 4ON9A 2COUA 4X7MA 5FJIA 1MNDA 3GCWA 3AX6A 2NO0A 2GK6A 1OHHD 1JDJA 1M33A 3I45A 2KWIA 5EYPA 1IULA 1GY8A 2VATA 1JSCA 2ZJAA 4DLWA 5EIAA 3BMOB 3Q7PA 2QN8A 3PNLA 2XRLA 3R0VA 3FBGA 4BS9A 2MLGA 1K7FB 4KMSA 3HV2A 5CXUA 2GQ0A 3R6TA 2AUNA 2PRYA 4MB0A 3QK7A 2JGDB 2Q5JA 5DTEA 5ABPA 1BXGA 1WVIA 2WP8J 5AESA 3S3NA 4BVFA 4D9CA 1C9JA 2HU9A 5ITZB 2PIDA 4BP8A 2UUZA 3E1KA 5EJAA 2QRQA 4CIBA 4O8ZA 2FPGB 2HHAA 3R7FA 2HK9A 1CULC 4EQQA 2I2XB 4UPEA 1D9ZA 1PV2A 3AILA 3D1JA 3DMTC 1WI3A 4M1QA 5JANA 1NNLA 4U7WA 3M1LA 2DU9A 5DNEA 1MC1A 1WB4A 3Q7QA 2BY0A 4AS3A 1ZS9A 2R7XA 2J08A 4C9YA 4RAQA 5HVQC 1RI2A 3VNQA 5I48A 2SBTA 3FYTA 1PJRA 2R5YA 1Y0NA 4G8DA 4ZCQA 3N7TA 4YO8A 3DE4X 4D9MA 2VCHA 1B6RA 3TSWA 1G66A 2O19A 3WODF 3C48A 2J9RA 4OU4A 4PAOA 2Q9CA 5F4ZA 5H59A 2VLAA 2IKSA 3DEWA 4R71A 1H3EA 4YJ3A 4FJ2A 1TT5B 4K40A 1IEWA 3ZQ7A 5J5VA 1J0DA 2R6GA 3ME5A 3DG9A 4QDKA 4ZCSA 2W5UA 2C4WA 1DI0A 3UGKA 5IANA 4HF2A 3A9CA 4RV4A 1RYBA 1YKSA 1UJNA 4L51A 1FFAA 4BQQA 3ASVA 5IMBA 4H59A 1V1MB 3QELA 3ROPA 2KRFA 5JYDA 2A67A 3BG5A 1L7BA 5AW1A 2ES4A 3MJVA 5D6FA 5EKUA 5IW8A 4D3DA 2VLIA 1PX0A 2OKCA 3B8HA 4YA6A 4EW3A 4U2CA 1B59A 1HC8A 4DCNA 3A05A 2QP3A 4FHDA 1SUSA 1XP8A 1RXYA 2GFHA 3AIMA 3ZDRA 3ETLA 4RPIA 4EMUA 2HRRA 3FTFA 1UBUS 4UEJA 2WZDA 2CC2A 3A9RA 1XG1A 1Z4PX 5DULA 2HK8A 3EQLF 4MNTA 3QPVA 3W9UA 2P69A 3VC1A 4C0LA 3H18A 4BASA 4H0FA 5KNCA 4P53A 1IUPA 1A9YA 4PQRA 2VJOA 5DCUA 4CPDA 1QDEA 4BGDA 2Q5HA 3DEKA 1QRDA 3QP5A 5LQDA 1WJCA 2RGYA 4YRNA 1Q7GA 2HJVA 4HDAA 4CV2A 3QP6A 4L95C 3B73A 4C05A 3GY0A 4BNJA 1QF7A 3GT7A 4PTZA 1ZVQA 2FDRA 2OTCA 3CUEF 2GCPA 3DGFC 3VOAA 4W6QA 4GH5A 1SUBA 1I5ZA 2WG2A 5EWJB 4BO7A 1TWHJ 1JI0A 3ND5A 5C5DA 1D6NA 3AHEA 3CD6I 2SHKA 3WS7A 1YDMA 2YYZA 3L9XA 4EG0A 4HWTA 5HFNA 2HEGA 4PYRA 4MS1A 1Q6YA 1V5WA 4B0OA 3DDWA 1CQWA 2ERYA 4IDPA 2G0TA 3H6GA 5ESRA 3COJA 2JI7A 3QF7A 3JQGB 3CCFA 1CP3A 2RQPA 2H6EA 4JBIA 4JHLA 2C04A 1H0KA 2GEVA 3FSGD 3IIIA 4DLXA 5LQJA 1KU3A 2QLJA 5SYNA 4ARSA 3FNIA 2X1LA 4BZWA 1OZ0A 2IZ0A 8LDHA 1ABFA 1XI2A 1H2ZA 5HF9A 2W58A 3ZPLA 2XGJA 3E9YA 1DKNA 3K0BA 4M3FA 1JSLA 2V6MA 2FGKA 5K9ZA 3K2ZA 2ID8A 2KDOA 1Q0UA 2ZVJA 4NV1A 2CW7A 3HUFA 4ALMA 3QX3A 2IPXA 2QKMB 4EF6A 1AQ6A 3EPLA 2CG4A 1ATZA 3K72B 3AJAA 5FB2A 3NHZA 1K61A 3DXFA 4E4RA 2IVZA 2WAXA 4D7AA 3ZGOA 2ZE7A 3UV6A 5FD6A 4I19A 3LZCA 3TTUA 2BSAA 4ZU1X 4OQLA 4BNXA 1KOJA 3ZU2A 4AD8A 1NP3A 2E1MC 3RCBA 2YFYA 3KPUA 1PVEA 3PUBA 3QPDA 4WFQA 1VBFA 2X9NA 4K2AA 5BNTA 1EK6A 2EKDA 3AM3A 4DQLA 2QUJA 1W47A 1FYMA 1M2OB 2GPJA 4ZP1A 1VBMA 3R7WB 3Q85A 3Q88A 1DCTA 1NVVR 3O8BA 1JIVA 2Z6UA 1F4LA 2R5FA 1IRGA 5B1BH 5A6VA 4C4TA 3K6SB 1OXKB 4A5MA 1U31A 1Q1BA 4A2PA 5LCXA 4XN3A 2IEZA 3FR8A 3HKBB 1E1YA 3GPIA 3I9OA 1L7PA 4G26A 4RY8A 3W5AA 2PGAA 1ODLA 2X1MA 3PSAA 3D5QA 3K10A 3PDIA 3NVMB 3C0KA 4I1YA 3CVVA 4ZZDA 1BU8A 4EW1A 4IJMA 3RAPR 2XTAA 3WJ1A 4HFMA 4B75A 5EJ6A 1VJRA 2PMBA 3HTSB 1OT5A 3ON5A 1MJ5A 1WJBA 3BLYA 3QJGA 4XW2A 4YJ3F 3HJFA 2ZE8A 3VOSA 4HDSB 2O06A 1AMOA 2HN9A 4V02A 2X14A 1E20A 2IV2X 1YS2X 3OZFA 2W7TA 1Z39A 3TOSA 3T5MA 4F46A 3RS8A 3FWHA 3OCYA 2A9QA 1KK3A 4HX4A 4B6OA 5ICSA 5K7ZA 3B8EA 1DLIA 3DWGA 1ZKGA 3TM5A 2VL8A 4WINA 3CLTD 2I87A 1H2RS 3NM4A 1JHAA 4E4HA 4OXKA 3V97A 4WASA 3O95A 2GEBA 3BTCA 2OYRA 1ZIDA 4C7VA 3E5QA 2R9VA 5CA1F 1V47A 3GFVA 4O3MA 3Q6NA 1IOWA 3G0OA 3QUTA 3GXOA 2RNJA 3FXUA 3KCQA 4US1R 3TM4A 4UQLA 2W2LA 3FROA 2ZXIA 1DBIA 1Q74A 1HKTA 3RRZA 1AT1A 1G5PA 1E8DA 1QHHD 3H8JA 1OLSA 2PYDA 2VBWA 4YH1A 4W1SA 3UUFA 1DCKA 3C1DA 1WXGA 1ZNXA 3NV9A 4LDQA 1ZQ1A 4BE2A 3GZ6A 2GJ8A 4V3CA 4CZ2A 1JHYA 1WX1A 3UK6A 3EMVA 3EVNA 3ZE6A 1LUAA 4OP1A 3UJNA 3UPUA 4CIVA 2V7PA 3ROTA 1XMPA 4HTAA 5C31A 1PNOA 1I1SA 4F6LA 3ND8A 1AGXA 2CBZA 3V4LA 1TGVA 5J1YA 3KLOA 5LYJB 1N32B 4MUNA 4BRUA 4TKVA 1VYUA 2YUIA 2XHEA 2XGDA 1DFGA 2V54A 3B60A 3S55A 1WKCA 3OQIA 5FR1A 2V5AA 4J0CA 5AONA 1UMCA 2WJIA 1Z26A 2V9CA 5IOZA 2QX8A 3RVKA 3ZJYA 2X76A 1K83J 2B2XA 4B35A 3IURA 3CEAA 5JY1A 2J5RA 2PQ6A 4UHHA 3T3GA 2EKPA 2M5WA 2MWMA 3PGVA 4PTLA 3NHMA 1O95C 1XCLA 1Z8DA 2IT1A 4HS4A 1X3ZB 4MCJA 3CR8A 3BF7A 3UJ6A 3UFXB 2D0DA 2JIZA 4E14A 4LI3X 1P92A 4L85A 2M9HA 1PS8A 1YVEI 1T95A 1I5OA 2Z99A 2CL0X 3P9SA 3GW8A 1O96A 4FSDA 1POWA 4D46A 2X4GA 3IJPA 4C3UA 1MJ9A 2YJZA 1ERDA 3FSRA 1GNTA 3WE7A 1CR1A 2JS7A 1Q14A 3JRHA 4AO7A 4OQQA 5A0TA 2PUAA 3L4BA 2CNOA 2EZKA 1KJ9A 5MFZA 4R5MA 3GFIA 1X7DA 3JRNA 3VPAA 2E2WA 4BWFB 4JU9A 2NU9A 1ZLYA 3UJ3X 5E8GA 1TNDA 2XPVA 2NUTB 1SCAA 1US8A 3ZQQA 3BG9A 1XXHE 5JS7A 1WJDA 2CLOB 4IRXA 4RKFA 3H11A 1LRKA 1M8JA 5HKAA 3DBLB 4LXHA 2WVJA 5JQWA 1YV9A 1ZI6A 2CYCA 1VGRA 1T9ZA 5IM4F 4CCJA 5AFSA 3V46A 1WZEA 3VPCA 4JB2A 3WLPA 3KOZA 3I55I 2UDPA 3O82A 4INPA 4FTWA 2MSDB 4CIAA 5H9VA 2BY3A 5IX8A 4TMYA 3VEPA 3DBHB 4H6WA 3DBIA 3YASA 4CJXA 2X0RA 3W2GA 1WMEA 5K0TA 5GJVC 4BX9A 3JALA 4XASA 4XRRA 5L3CA 1PSZA 4AYTA 1RZRD 3B12A 5F77A 2R7UA 1CZLA 5FUMA 3WLOA 1O6ZA 3JAWB 2UXBB 1AKRA 5JJCA 2CVHA 4B31A 1MAAA 1AIPA 4RZ3A 4C21A 4HNRA 3GGSA 2NM0A 2P2SA 3GNTA 3W1VA 1ZVKA 1ZICA 5D3ZA 2CVQA 2FNPA 2QGFA 1A9XB 2E49A 3EOBI 1HF0A 2KQRA 1Z6XA 1PNRA 4P82A 2WTMA 3AU8A 4B3SB 1K7CA 1X1EA 4WV3A 2BGRA 2LE0A 4EYKA 4XTRA 2NYVA 2EEZA 4NC6A 1P0QA 3TRJA 1VLHA 1EJBA 5FPHA 4H4KC 3H4VA 2B1QA 3VR3D 4YRBA 2M1BA 1P7YA 3DFFA 2CJPA 4P4LA 2WWVD 4KFTA 3CINA 1QG2A 2Q7OE 2PSHA 3UYKA 1O94A 3VJKA 3GYGA 4PZZA 3CNLA 4JQZA 3LSMA 2WZCA 2VXOA 3ZV5A 3IQIX 1TAQA 2XWSA 3N97A 5EHXA 2JD1A 4UHKA 2J3KA 5DWQA 4REQB 4RELA 1RPWA 1UEIA 2GD1O 3AI1A 3K2EA 3L1KA 3W8RA 1RAIA 5HZMA 2J7KA 4H1WA 1WD5A 1BKYA 1HZJA 5B7QA 2ZYVX 3TK1A 4YJFA 2X8WA 4NHJA 1TAGA 2H2GA 4MDYA 3K35A 1GQ2A 5JATA 2XODA 1KIAA 1EPUA 1E96A 2AN5A 2PRSA 2DA1A 5IJWA 4TMKA 1U2DA 1P1CA 3V1UA 2HDNB 2PWZA 1GVDA 4BNNA 1NI5A 3KZVA 1XAHA 4ZDJA 4BYMA 3BMCA 1WRJA 3E7WA 1KOLA 2J32A 2JF0A 4YRMA 3OWHA 1NBOA 2X5NA 5FHRA 5LU8A 4FLMA 5AW3A 3I1JA 3IO3A 3VR4A 1A2OA 3UXMA 4GE3A 3TKYA 4ETNA 3RTGA 2O54A 3WLNA 1CUYA 5AW4A 3L6OO 2V6EA 2FLVA 1CTQA 2H54A 3DV0B 4CM4B 1NBMD 1Z08A 3T7TA 3MRTA 1KVQA 3WGVA 1FFYA 3TBIA 3OAAD 1GG9A 1SZJG 3LK6A 4YUXA 3LPDA 3BORA 3C5CA 1OMIA 5DRYA 2I1WA 2EG9A 2OCXA 4IOMA 3P9NA 3G4SI 4G5OA 1GDHA 2MFZA 3TLKA 5DBGA 1BR4A 4DV4B 1EM8A 3DM9B 4QRDA 3CJQA 3WNDA 1W59A 2PANA 2FSIA 3DFKA 5JXJA 1BN5A 3AUSA 2C5AA 4CKXA 3HZZA 2AN4A 3FSEA 1OX5A 3GGJA 4O2LA 4RORA 4Q1BA 3L82B 3KYBA 2HF8A 2G1AA 3ZXXA 1NW3A 5BSKA 2DLDA 1VOTA 1Z5VA 1DUSA 3FTPA 1TVMA 3QYPA 1IBRA 3EGEA 1NXTA 4IDGA 3N05A 3BD9A 1GOTA 3AEQB 3GFJA 1EP2B 3I6YA 4RB3C 4XB6B 2ZPUA 4MIYA 4BXUA 1EDOA 1A76A 4ENTA 5FB3A 1QP8A 1SK9A 3BC1A 1RKXA 4BQPA 1UK6A 3SF8B 4U7JA 5JADA 2Y4OA 4RKEA 2JZCA 3QEBZ 4F9GA 4WNAA 4A0QA 5K2OA 4OI4A 3HTUA 4IO9F 4XBFA 2Y66A 2IPMA 2BVMA 2JFWA 3HHEA 1JYEA 3I2IA 4C4RA 3F6BX 3L4SO 2VC0A 4B0PA 1SHZA 2FJUA 3U13A 4WFIA 1SGWA 3PDUA 2ZS7A 1TC1A 5KI6A 1QJCA 2HRBA 2ZCWA 4XWAA 4XIFA 2C84A 1YZTA 3AI3A 1AKNA 5H2FC 3VXKA 2Q1XA 4DGWB 3LLMA 1I27A 4I9FA 5BSHA 4ENWA 3IFSA 4XWTA 4OGWA 4A8TA 3IBYA 1N36B 1KEPA 3WK9A 2VK2A 1XNQB 4NCIA 4C03A 4UPDA 5A7HA 5CG1A 1Y80A 3AFGA 3I62A 3B82A 2I2DA 3HCRA 1SQFA 1Y3BE 1FFXB 4RQAA 3BKXA 3HNRA 1KL7A 3Q0TA 4QUJA 3TBKA 4GAEA 5H6RA 1USWA 3TTSA 2G6TA 1JUDA 2C58A 4JLMA 4M2LA 3FHLA 3ODGA 2C5FA 4QPCA 2ZTLA 3MCZA 3UIEA 1RS0A 4WOCA 2FFJA 4MW2A 2Y2VA 3R5KA 3W9BA 4LDPA 1IDZA 3VDMA 1KU9A 1NJ5A 4KHZA 5GZ3A 1OWLA 5JS8A 5D5HA 3GPBA 3GPDG 3FXMA 4FU0A 2YY7A 3CLTC 1N7JA 2AI3A 3NHJA 2EZ4A 2FJ0A 2E6KA 3TQNA 1OQAA 4LX0A 3FKSD 3GCDA 3AW9A 3FXQA 4NABA 1YCDA 2OCAA 3HUDA 1E0EA 3LQKA 2OFOA 3GJ0A 1LBIA 3K4HA 3MGCA 4O2BB 2C4KA 3M9AA 4CR7A 4ROTA 3EPPA 4OIFA 2L9RA 3LC2O 4X8OA 1OV6A 3Q8WA 3WHPA 1C7FA 3HWSA 3ETNA 2MT9A 4WLVA 4AZ3A 2K9MA 6ABPA 4OAYA 4DR3B 4UHBA 1PR6A 3OWOA 4BAZA 4HPWA 1HNWB 5IARA 3IR5A 5EMMA 1JHHA 2HFHA 2RBKA 3KXKA 2WG0A 5A02A 4RB0A 2N1BA 4LX8A 3QVXA 4JLBA 3PL5A 4HLCA 4G1VA 2WIKA 4X64B 2H5IA 4DQ2A 1U11A 1EWVA 3IMKA 3TLGA 4MUAA 5HE9A 4QLAA 1AU9A 5JC1A 5JW6A 5M3MJ 4CLRA 1P75A 3R23A 1VYVA 3RHFA 2XKBA 4NATA 4L0CA 1L6IA 3D4LA 3TL2A 1X8JA 5JNVA 3WO1A 1QQIA 4DYHA 3A01A 1YDGA 1OXXK 2P2CA 2HIAA 3EXEB 1T9GS 3H5TA 1FDSA 3BGVA 4BV8A 2Q2OA 2CQNA 4LLNA 1SVSA 3BREA 1U2WA 3TTTA 4XFKA 2ZKZA 1SHKA 1T1RA 1QQ6A 4BMOB 4C7JA 3OJFA 2OV3A 2ZBRA 4MR8B 3HN7A 3RRJA 2OGSA 3QBJA 4EPVA 4EG4A 1UC9A 4CYCB 1SULA 3FPLA 5CCEA 5A2QA 2XPCA 4R8SA 1H93A 3EG9A 3Q3HA 4DV0B 4QTYA 2K9NA 3R0AA 4Q82A 1OR8A 1D2CA 3AZOA 4YAKA 4WW0A 1SVWA 3EZNA 3PENA 2YV2A 1VZ2A 2Z2XA 3DO5A 5GZ1A 1CJCA 4JQOA 3EQZA 1AN0A 2AGVA 3PG5A 5IKEA 1C0IA 3JTEA 5IJ9B 1TO2E 3CQZJ 4ICIA 5EMHA 4L8GA 4R3WA 3H75A 4P3YA 4I14A 4OA8A 2Y3IA 4BY1J 3A6LA 4QYWA 1HT0A 1ICIA 4E7SA 1ZCBA 3W3CA 2OFPA 2ZSJA 3TVYA 3CPJB 4U2DA 1P9WA 5IJXA 3W9YA 2CJXA 2QTBA 4IVNA 3G23A 1EVIA 3TUJC 1DPFA 3EUHA 4IIVA 2VTEA 5BYJA 3BQMB 5EUMA 2FW0A 2ZSIA 1G8KA 2GCNA 4PGAA 2IYPA 3K09A 3VUFA 2DQKA 2QNIA 2GTHA 3JD3A 4J91A 4OAZA 1MH9A 1QU2A 3BJAA 3GLXA 5IFLA 3AKZA 3ULKA 4D42A 3Q5FA 2A0YA 2FN9A 2DPDA 2E5NA 2IOQA 4L18B 2BGIA 4KE9A 3RFCA 1A8UA 1VZ3A 3PX2A 4G0ZA 3ZGNA 3PNSA 3NATA 3ETDA 4BNDB 2UZ1B 2DFIA 4DF3A 4EW2A 3T0FA 2ENUA 4CG2A 5JCXA 2ZQ5A 2GASA 4P2BA 3FVQA 2PXXA 1YR8A 3K92A 4MP8A 1BI1A 2EX0A 3FM9A 4PV7A 3D2LA 1L3LA 1F4VA 2AFRA 3JYNA 3DKIA 4W82A 3F6OA 4JYCA 5IWAB 1RPNA 4O3FA 4K46A 2GJ4A 4FYYA 2P0YA 2DQ4A 2XUOA 4C4PA 1DEKA 1AWCA 1HYEA 2I8AA 4ZJZA 2VTKA 1YG2A 1VE1A 3W3ZB 1YIAA 3GDFA 3DMTA 3RRXA 4KN4X 5CFMA