3H9JA

Crystal structure of e. coli mccb + ampcpp + semet mcca
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
348
structure length
339
Chain Sequence
MDYILGRYVKIARYGSGGLVGGGGKEQYVENLVLWENIIKTAYCFITPSSYTAALETANIPEKDFSNCFRFLKENFFIIPGEYNNSTENNRYSRNFLHYQSYGANPVLVQDKLKNAKVVILGCGGIGNHVSVILATSGIGEIILIDNDQIENTNLTRQVLFSEDDVGKNKTEVIKRELLKRNSEISVSEIALNINDYTDLHKVPEADIWVVSADHPFNLINWVNKYCVRANQPYINAGYVNDIAVFGPLYVPGKTGCYECQKKENIDHKIKLINSRFKPATFAPVNNVAAALCAADVIKFIGKYSEPLSLNKRIGIWSDEIKIHSQNMGRSPVCSVCGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccB protein
publication title How the MccB bacterial ancestor of ubiquitin E1 initiates biosynthesis of the microcin C7 antibiotic.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/antibiotic
total genus 107
structure length 339
sequence length 348
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1160 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3h9jA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3h9jA02
1ENPA 1VC2A 2PKQO 1ARZA 4MO2A 4NJMA 3INRA 5EERA 1MFPA 1E7WA 1P1IA 4FFPA 3TSCA 1WDMA 3ZWVA 5DCWA 3ZV4A 3FPCA 3W8FA 1KVTA 2ZQZA 3IP3A 2I3AA 3JD2A 4BO1A 4BO5A 1HDYA 2WYWA 3TF5A 2VRBA 4XDYA 3DL2A 2VTEA 4AJJA 3DHYA 4IXTA 4CM8B 1YBVA 4AJ2A 1JW9B 2DM6A 4CQLA 3C1TA 3IKVA 1LLQA 2G1UA 3WFJA 4BNHA 2WDZA 4Z9FA 3FI9A 3GN2A 3SJUA 5ER6A 3PP8A 4DPLA 4YB8A 5JAZA 4IZIA 3EK2A 4C7JA 3AWDA 1GEEA 3PYMA 3S55A 5JC1A 1WW8A 2YUTA 4AJPA 3ZV3A 2D5AA 2VQ3A 4YTEA 3WGOA 1H6CA 4P8RA 2QRLA 2X1HA 2NUAA 4YAIA 3OMLA 2NQTA 3RCBA 3VTFA 3BMQB 2JL1A 3ZI0A 4B8ZA 2I65A 3AY6A 4DBZA 2VN8A 4XGNA 4CMIB 3FBGA 4CLRB 5BSFA 3VH4A 3G3EA 2JD2A 3MOIA 4YAGA 1N1GA 5BSEA 3PZRA 2E48A 4WK6A 1JVBA 3OJEA 1KBZA 3HFGA 4CV3A 3RC2A 1J5PA 3BTUA 3INGA 1GQQA 3BMCB 1E77A 3AU8A 1RM4A 1IHYA 3GNSA 2IZZA 4ITUA 2J3JA 2VTDA 3ZGYA 4BNNA 4DTIA 3PIDA 1PL7A 4S3MA 3KUXA 5CDUA 2D1YA 3RFVA 4E0BA 5KWEA 2JD1A 1Q7BA 3H2ZA 1JWBB 3I3OA 4K9DA 1YQGA 3JSAA 4QO8A 1A27A 4BNYA 1VJ0A 3U62A 1E3WA 3F3SA 3GPIA 2FZEA 3U9LA 4OGWA 4JJGA 1P1FA 2VWHA 3DAFA 3DZKA 3ROPA 3V2UA 4B7XA 3RWBA 4G5HA 2W98A 3W1VA 3D1LA 4IQGA 2Y68A 2PTGA 3N7UA 1W4ZA 3B6ZA 1NTOA 1YJQA 1MFZA 2TMGA 4MKRA 4YACA 4UUMA 2RAFA 4BNKA 4FBGA 1P44A 1H94A 3QVWA 4IXWA 4UVGA 3QVOA 2Y0DA 4R69A 2A92A 4MDHA 1BXKA 4U7WA 5IDWA 4GAEA 3KYCA 4PG4A 4BGUA 4EYEA 4FIZA 1I0ZA 4J4HA 2AQHA 4XB2A 3FR7A 1PZEA 3EUWA 3PJEA 4BB5A 1B3RA 1LBEA 4RDHA 3ANLA 2JCYA 2BHLA 3GZNB 3RI3A 1ENOA 2TMDA 2NTNA 3AOEC 3VZRA 1Y9EA 2PZJA 5FYDA 2Q4BA 2QYTA 2VZ8A 5T64A 4CMAA 2GZ1A 4FOOA 1KVSA 1KEWA 2GUGA 2O3RA 1SOWA 1G0OA 2P5UA 3UCEA 1LEHA 4CODB 1Y9AA 4G81A 3RQSA 3NAQA 1LLCA 5AOVA 1U3WA 4PN3A 3DONA 3FNGA 4OAQA 5L95A 5KVVA 3VTZA 4RVDA 3PFFA 5A04A 3VH3A 4N5LA 4MP3A 4FFNA 1NFQA 2PR2A 1P31A 1QYCA 2C59A 3PI7A 4GLLA 3BHJA 1WAMA 2GO1A 1G0NA 1HKUA 1KEPA 2H6EA 3SJ7A 1ONNA 1IY8A 1DAOA 1TI7A 1LX6A 3RUEA 3ZW9A 2Q4EA 2JAPA 3QVXA 3E03A 1C0LA 2ZQYA 1ZXBA 2B4RO 1EVZA 1P9LA 3H5AA 1R0SA 5CPFA 1AXGA 1PJSA 1E0DA 3FNFA 3IQDB 1K6JA 4XKJA 1LU9A 3KSUA 4JNKA 3KSZO 1Z74A 3GEMA 3ZU3A 2EKPA 4R1TA 3EZYA 5DOZA 2J3IA 3WSVA 3DBLB 1ULUA 3AM4A 1E7SA 4P4LA 2HRBA 3D5QA 4DL9A 5A3VA 1E92A 3BXXA 5DNAA 3ONEA 4TRNA 2QG4A 1FDTA 3JYNA 2BLLA 1CETA 3CXRA 3GGOA 2X6TA 3QQPA 1UZNA 1N2SA 3KM0A 4MP8A 4CM1A 4IDDA 1HDXA 1R4MB 3ETDA 4JBGA 2RIRA 4J9VA 5T8KA 2JHFA 5JFOA 1PGPA 3PYXA 1Q0HA 3A9WA 5HWSA 4CMEC 3HZZA 5JDIC 4R16A 4A27A 3EGOA 3I83A 1XEAA 2GZ2A 1YL6A 4HFJA 3JQDA 3AUSA 2DC1A 4RO0A 2HU2A 2GN6A 3QWAA 4LSMA 1X0XA 3EC7A 2VRCD 4PZEA 4E5MA 4Q3AA 1ZEMA 3PVZA 4AJHA 1SAYA 3HQ4O 4E33A 4LK3A 3GY0A 3F4BA 2AEMA 4Z0PA 5JAMA 1GQ2A 2O23A 1TB4A 4FGWA 2JKVA 3QW2A 1MV8A 2JD0A 1UUFA 3VKVA 3OQ1A 5JXWA 1R12A 1P0CA 1UXKA 4AFNA 1BXGA 1WP4A 1EK5A 2NVUB 2DAPA 1ISJA 3GG2A 2GASA 1ML3A 5DCUA 3AK4A 4CMCA 4H15A 3ZWXA 2HMVA 4E13A 3DEYX 5COQA 2AG8A 1GCOA 4WLEA 5EINA 3RSHA 5JPIA 4BKUA 1XSEA 1NVMB 2HSDA 3RUIA 3OIFA 7MDHA 1PJ4A 2BGMA 1I24A 1YL5A 5JO9A 2AW5A 3CZMA 1ZW1A 2HKIA 1AE1A 2YY7A 1K5HA 2C0CA 2Y1FA 3ZHXA 5CDYA 2QIOA 4E2WA 5JAIA 1T2CA 2H1SA 2VHYA 5BT9A 1F14A 2AE1A 3GGPA 4XYBA 1VE9A 3R1IA 4IGEA 1CYDA 5CFZA 3KB6A 5IDQA 4PLVA 2PZLA 5AVOA 5J23A 3RVDA 3IDSA 4AJOA 1QYVA 2Z95A 3NEPX 4K6CA 2EXXA 3MWEB 1V3TA 4DQXA 2D5CA 4EGFA 1IB6A 4ZU3A 4Z3DA 5EQFA 4RPGA 4XYGA 2HLPA 4CUZA 2CSUA 4TRJA 3BMOA 1CERA 3DZHA 3AUAA 4IJWA 4CM4B 4O1MA 4K1LA 2V65A 1E6EA 5F1KA 3CINA 2FPGA 2HK7A 2I6TA 3LDHA 3GRKA 2PD4A 1T4DA 3PJDA 4LCJA 4OM8A 3RC1A 3SLGA 3IIEA 2OMEA 4YJGA 3V2HA 4NU6A 4KQXA 5EQDA 1H2BA 2GCGA 3OA0A 1PGNA 3HDJA 3JQAD 5LDHA 3HB5X 1T1SA 4OYRA 4MVJF 1A4UA 4A26A 3MJEA 2VHVA 3NDIA 4GVXA 4PFJA 4JROA 4MIEA 1E1LA 1HETA 2EJWA 3KYDB 4D43A 5I7SA 1H6AA 1C0PA 1WDLA 3F5QA 9LDBA 1B15A 5ENDA 3G0OA 4PLGA 4YAJA 1TEHA 3RAJA 3F47A 1LTHR 2HAEA 3WICA 2Y1CA 1D1SA 4D7AA 4CLXA 3H9GA 5KKCA 4B79A 1P1KA 1U3UA 2EGGA 1P3DA 3IAHA 3KHUA 1NP3A 4KTVE 3AI2A 3HE3A 3W4IA 1A71A 1PSDA 1NVGA 1O0SA 3WGTA 2X9VA 3B1KA 5EN4A 1L1FA 4EDFA 1T25A 4M86A 2IODA 3PEFA 1H0KA 4QECA 3VC7A 2DBQA 1BRMA 4D46A 2R00A 2I66A 1ZCJA 1FXSA 2GPTA 4MPDA 4XYMA 5TT0A 4RF3A 2WD7B 3GAFA 4PLTA 3AY7A 2Z1MA 1GV1A 3AOGA 4Z3KA 4Y98A 1NAIA 3EMKA 1ISIA 1PJBA 3C7AA 3K2BA 1JTVA 4GLOA 4RZHA 4XR9A 4EJ6A 3A4VA 4YQZA 1OAAA 2F1KA 3C3XA 2QZZA 1NPTO 4IQ0A 3ZN2A 1E6UA 4WKGA 3VH2A 3O9ZA 3FCOA 1E1NA 1V3VA 1Y8QB 1N1EA 4I5DA 4QSMA 3QWHA 4GQAA 1D7OA 2H5LA 3PHIA 2PNFA 2D2IA 1EDZA 1RM3A 2A9FA 3INTA 1ZK3A 3L4SO 3ZHBA 3I9JA 5C7OO 4PLFA 5DCYA 4D42A 3FF4A 3S2FA 3AOEA 3JQFA 5L3ZA 3JV7A 4C7KA 2CDBA 4E3ZA 5JCJD 1PS8A 5G0UA 1K2WA 2RHCA 3FN4A 5I7VA 1T2DA 1SNYA 4DIFA 4BKRA 1GZ4A 3BTVA 2DTDA 1VL8A 2Z1NA 3ETGA 3FPLA 3GVXA 4Z6KA 1PZFA 1GYRA 1ENYA 2HO5A 3GHYA 1UXGA 3DZBA 5LCXA 1WNTA 3C7DB 1V6AA 1VL0A 3K2EA 4YAKA 8LDHA 2W4QA 2PLAA 4RVHA 4DRYA 3TZ6A 2BI8A 5A5FA 1DSSG 2CVOA 3PWZA 4BNMA 4A03A 2CFCA 4KUEA 4IS2A 4PLYA 5DDIP 1PJQA 2Q1WA 3ASUA 5IG2A 1UZMA 3MOGA 3NTRA 1SCUA 4HNHA 4NIMA 1ZUD1 1TXGA 4MJLA 3LT0A 3WLEA 4DUPA 4NI5A 1HE2A 3DB2A 3E18A 3PDJA 4OJNA 4KTTE 1B3BA 4G2NA 4MVJH 2RH4A 2PGDA 4FCCA 2FR0A 1TT5A 2I9PA 4K28A 4WCFA 1J49A 3H3JA 4QO7A 2OBYA 2GERA 4X54A 1HDOA 2X0RA 3ADPA 4XJSA 5I9LA 4CV0A 4NDNE 4YWJA 4D0SA 3C7CB 1XHLA 3PJGA 4IPTA 2DLDA 1Q2XA 3O8QA 4E2XA 4I9NA 5DBGA 1GCUA 1HDGO 1K6IA 4PG7A 5F1PA 4J7XA 4OOEA 1ZVMA 3JD0A 1JDJA 5JDIA 4ILKA 1BHSA 3KTDA 3WSWA 2C2YA 4B3JA 2VZ0A 3U3XA 4BNVA 5TJ9A 3GGGA 2Y0EA 4WE3A 3MJSA 2BFOA 2IZ0A 1RM0A 2HUNA 3FRJA 3I1JA 2PZMA 1UH5A 3WDSA 1P1HA 4IJKA 1MP0A 1IPFA 1DLIA 4IINA 4XYEA 5JLAA 4Q3EA 1BDMA 1YGYA 5H82A 5CAEA 1Z73A 2PV7A 1HEUA 3DFZA 5IXSA 4TZTA 4J4TA 4LISA 5IAAA 4RF4A 4RLHA 3SC6A 1GR0A 4OSPA 5CHEA 1ZSNA 2Y1EA 4YVFA 1GYQA 2Q2VA 1LDYA 1QORA 3JYQA 3WOHA 1ZEJA 3OETA 1NHGA 3HN2A 4ZHSA 1BG6A 1A5ZA 5A9SB 5L9AA 1PZGA 5T57A 1VPDA 5G4KA 3DMTA 1UAYA 5B4TA 3JQBC 4ND1A 2BGLA 2FP4A 2NVBA 1BW9B 3HSKA 4OOFA 4K26A 2UDPA 3MCVA 1F12A 2DKNA 4W9NC 3E48A 3WG9A 1A9ZA 1LSUA 3QRWA 1J4AA 2EF1A 2P4QA 2DTXA 4PRLA 2PFGA 3K96A 3FR8A 5F3RA 3TFQA 5A06A 2OP0A 1T26A 4GWKA 5JO0A 5KCZA 4FB5A 1GTMA 1QYDA 1GU7A 3I9NA 2O2YA 2JCXA 5TX7A 3ZWBA 1C0IA 2PH5A 2D3TA 2RCYA 2Q2WA 5BNTA 5AXCA 1A4IA 3DAPA 3JQ8A 3LU1A 1JN0A 1CIVA 2WTBA 5KJCA 1YBMA 2X22A 3D5TA 3GG9A 3WGHA 4P4GA 1LRLA 4PCVA 4UVIA 3WJ7A 5CP8A 1Z7BA 4HADA 4J43A 4URFA 1N92A 4YT2A 1T1RA 3BMNB 3ZNNA 3GHHA 4QTZA 1WVGA 4J3FA 3NJ8A 5KOIA 5A9TA 3ONDA 2VUSA 4XQ9A 4H16A 4J1TA 4CR7A 4NBVA 2JCVA 2BFMA 2I3GA 4WEOA 3QVTA 3G79A 4FN4A 5GMOA 1CRWG 1ZK1A 3TZKA 2IDZA 1HLDA 4XDZA 5T8KC 4N18A 1HYGA 3P7MA 1VKNA 2YDXA 4YJHB 1NASA 4ZQFA 4DVJA 4B8WA 4CM8A 3GVCA 4CQMB 1I3LA 4DLAA 2YQ5A 2X0JA 3UCFA 3W8DA 1QV7A 3W4JA 3PLNA 2P2SA 4TROA 2BGKA 3D3WA 5T6BA 3L6OO 1XWFA 2FN7A 3GDFA 4PG6A 1GQYA 1XKQA 1GDHA 1TA4A 4XEHA 1B14A 2O4CA 3SC4A 3JCZA 4BS9A 2B0JA 5KTKA 1PWZA 5KIAA 3OA2A 1ZK0A 4IDFA 2O3SA 1BMDA 1K0UA 3C1OA 4R54A 2B5WA 2O2SA 4J91A 4N54A 1I2BA 4DGSA 1UDBA 1ZK4A 2P91A 3BMQA 4XQGA 4J16A 2GLXA 4OQZA 4U0JA 2Y67A 3JQGB 4CPDA 2C5EA 2NM0A 3WYEA 1U8FO 2JFHA 4CUKA 2AE2A 4O0LA 4NQZA 1LDMA 3PGXA 1R66A 1U28A 4WOJA 3E9MA 3QE3A 4KWHA 4N7RA 3ZV6A 4CM9A 5FFFA 3SX2A 1OC4A 3G17A 2HRZA 4CL3A 3RC7A 3DTYA 3WBBA 1J6UA 3K5PA 1DRUA 4NK4A 4E21A 4FJ2A 3H5NA 1BTOA 3I5MA 3JQEA 5IZ4A 2DT5A 1DXYA 2WYUA 3RU7A 4DIBA 1QLHA 1XA0A 2HK9A 2UAGA 3GR6A 3HWRA 1JA9A 4HY3A 3Q6IA 5FWNA 1HSOA 2XPCA 1DC4A 2ZIZA 1NFRA 4PLHA 2Y1GA 4JQCA 5BR7A 5KVSA 5DT9A 1H9BA 1DIBA 3NUGA 4L76A 5L45A 4DMMA 1S7CA 4R3WA 3RBXA 1LQUA 4DBVO 1U5AA 1Z7EA 1KOLA 3B1JA 3CMMA 2BF7A 3VPHA 2DVMA 2Q49A 1B2LA 4FQ8A 2B83A 3R0IA 2H63A 4KUHA 1IL0A 4RF2A 4CM9D 3DO5A 1LI4A 4QT0A 3G1TA 1HDRA 4ALJA 3U0BA 2EEZA 1X14A 4HV4A 3GH3A 2VOJA 5GZ1A 4GGOA 3MJCA 2GN9A 1O95A 1U9JA 4DA9A 3WTBA 4U0KA 3H2SA 1UXHA 2Q50A 4IIUA 1QP8A 4DPMA 1SEVA 3RUCA 1KY5A 3GFBA 3JQ7B 4DWVA 3Q0EA 4D79A 4XRGA 5C37A 4TVBA 3T4EA 4RCVA 3GZNA 3H9QA 1R4NB 2W90A 3H5RA 1I5RA 4UEJA 5F21A 3RUHA 4NBTA 4ZRMA 3VPSA 1CWUA 1Y6JA 1Y7TA 2B4QA 3QA9A 3RUFA 4H3VA 5DZSA 2HMTA 4RGBA 4Z0TA 2OZPA 1A9YA 4NFSA 3O38A 4PG8A 3FWZA 3IJRA 1N9GA 4JLWA 3MWDB 4M89A 4N5NA 1T2AA 3QY9A 1OOEA 3VVCA 2FSSA 3WS7A 3WGGA 1DPGA 5L4LA 2B5VA 3EDMA 3S1LA 3U09A 2BI7A 1UR5A 1V9LA 2EKQA 3B70A 1BVUA 1DC3A 1DRVA 3VZPA 4JJFA 2VNAA 3KRTA 3L9XA 3GDOA 2C29D 4TMFA 1JU9A 5I7FA 3BYZA 4MVJI 1ZXLA 5B37A 2R00C 3O4RA 5ICSA 4HP8A 5CDGA 1LSSA 3TPCA 4BGVA 4NJMB 5T67A 1ISFA 3ICCA 5KVQA 3ZWYA 3DZFA 3BTOA 3P5SA 3PHJA 1YKFA 1NFFA 4HBGA 4IJUA 2G0TA 3WWYA 1NYTA 4KZPA 4I9HA 2X9GA 4AL4A 1F0YA 2C5AA 1MXHA 2B4TO 4R51A 4YAEA 4PVCA 3V1UA 2YHUA 4C4OA 2P4HX 1PGQA 4GL4A 1B8VA 2POQX 3WWZA 1QR6A 3H8VA 3FTPA 4HKTA 3TFOA 3OQBA 4L4XA 2Z5LA 4IMPA 4CQLB 2IE0A 2EP7A 3JQFC 1Z6ZA 1WZEA 1ULSA 3F6YA 2O7SA 3PWKA 4XR4A 3JQBA 4I9UA 2FSVA 4PG5A 3WQSB 1ZFNA 4GWGA 5U1PA 4EUEA 1IHXA 3MJ4A 4OKIA 4OIMA 4W9NA 4EJMA 1O94A 2HJSA 3DHEA 3JYOA 4WGGA 4L0QA 5JYEA 3EYWA 1DIHA 4YJFA 1XDWA 3GVPA 3QWBA 1M75A 5EESA 3LC7O 4R1NA 2EHDA 2CD9A 5L4SA 3STHA 1Y5MA 3TL2A 4OSOA 3AFNA 3OJLA 1NQ5A 5IDYA 4ID9A 1YXMA 2J8ZA 2O4UX 3ZWAA 4OKNA 5FF9A 2NVWA 4FJ0A 5ES3A 4IIVA 4RZIA 3RU9A 4D0RA 4ONEA 1NQTA 3U49A 1JKJA 1C1XA 4CMHA 1LRKA 1PS9A 3AFMA 1GEGA 3AM5A 2V6MA 2IYPA 3IUPA 4Q3DA 2VRCA 4GKBA 1QSGA 3KXDA 1LDBA 3E8XA 3DXFA 3NTQA 4S1VA 1T24A 3QWIA 4WCFC 1MGOA 4ND2A 5TGDA 4R1SA 5GZ6A 1GADO 1LDEA 1I2CA 1P45A 5TS3A 3QHAA 2GDZA 3C8MA 5K0ZA 1SEPA 1E3WB 3Q3CA 2HMWA 3E9QA 4RDIA 3D4PA 2DUUA 2YZ7A 2QRKA 4Y6PA 1LRJA 4GSLA 3H3FA 2CDCA 2AG5A 4A73A 2XAAA 5MGBA 2C54A 3I9LA 1GPDG 2V6GA 4PLWA 3ULKA 1ZSVA 3VHRA 4ALIA 4FFRA 1BGVA 2ILTA 1UP7A 3K8ZA 1N7GA 2P9CA 4AJEA 4ESOA 4KUGA 4W4TA 5C7IO 3ZWWA 4B7UA 4O59O 6ADHA 4FSHA 1Y1PA 4XWYA 5DULA 3MTJA 5L7TA 4RPHA 4GVLA 3RKUA 4INAA 4RF5A 8ADHA 4K6FA 4WLFA 1ADFA 3W6UA 3KYCB 1QKIA 3L77A 5TT1A 4R3NA 4HXYA 2GNAA 4BIIA 1EUZA 3BTSA 3FNHA 4RVSA 1KYQA 1RYDA 2Q1UA 1B8PA 2AEFA 4NZ9A 3V1YA 1NPYA 1PIWA 1BDBA 2C07A 4BV8A 1HYEA 3UICA 3VOSA 1H6BA 3VDQA 1IUKA 1XU7A 3ZWNA 1PJLA 1HL3A 2XOXA 1RJWA 3NX4A 1W6UA 2PGJA 3ZH2A 4CM7A 2NWQA 5G0TA 1DRWA 4LRSB 3OM9A 4JJIA 3TWOA 3S8MA 2CVZA 4ALNA 1EUCA 4BHTA 1MUUA 1ZO8A 3DZIA 4CM6A 2HJRA 1WLYA 4NR0A 1YVEI 4LCEA 3C1AA 4OHUA 3DMTC 3ZW8A 4GMFA 1R16A 1LDNA 4MKZA 5HTOA 2C82A 5A9RA 1V0JA 4J1SA 3TRIA 1O9BA 2GF2A 1JKIA 2QHXA 3TZHA 1I3KA 4IDCA 2I76A 3ZWMA 2VWPA 4CL8A 3GA0A 1ORRA 2J6IA 4YDRA 3F9IA 4AJ1A 4BO8A 1AHIA 2FPIA 4UUNA 3CKYA 3BHMA 4YJDA 1QLJA 2UYYA 2X58A 2Y93A 1AHHA 1OC2A 3KZVA 4B7CA 1J0XO 3OBBA 5B12A 1X1EA 2O48X 3ZWPA 3DBRA 5G0WA 5G2OA 1KEVA 2UUOA 1YH3A 1DBVO 1U3TA 3JQAA 1V35A 1YJ8A 3X2EA 4ND5A 4CLOA 2BELA 1A72A 1ONPA 3NTOA 4EEXA 5JY1A 4XRRA 3F1LA 1JQBA 2C2XA 2CNBA 4BNUA 2OP1A 1XGKA 4KWIA 4IGFA 4Q3CA 1I8TA 4E6PA 4KP7A 1MG0A 2DFDA 2PH3A 1DFIA 1E7MA 4A5OA 2NU6A 2OFPA 3EW7A 4BNLA 1Y5RA 3EZLA 1ZMOA 4O5OA 3JD4A 3CEAA 4IZHA 3FD8A 4I5GA 1HSZA 5JYDA 3OQ6A 5DP2A 3LLSA 4WLVA 3JTMA 4QX6A 1IOLA 4LMRA 4DQUA 3LT2A 2J3HA 5CDSA 3WMWA 2ZTLA 1DFGA 3IOYA 4WUVA 1YOVA 1UAGA 2NADA 1UP4A 3WIEA 2J5QA 4F6CA 1A7AA 4BB6A 1IZ9A 2CMDA 2YHIA 3TOZA 2ZB7A 1TT7A 1YQXA 3BIOA 4FW8A 5IZCC 1KC3A 1TVEA 4DXHA 4ZJUA 2PKRA 5THKA 3I9KA 1DJNA 5JY6A 5CPBA 3U4HA 2EJVA 3WX0A 3ENNA 1XCBA 1RWBA 5A5EA 2DFVA 3ABIA 3OFSA 2D4AA 4I08A 3DBHA 1GUYA 1N8KA 3WB9A 1VL6A 3VAZA 2FY8A 3OSUA 4EI2A 3UAGA 5F5NA 1KVRA 4MIYA 1FDUA 3JD1A 1ENZA 2YDYA 4R41A 3DOJA 4DYVA 4A2CA 1BXGB 3IP1A 4PGFA 4Y6RA 3RBZA 3ZU4A 1X0VA 2EKLA 2CVQA 4CM5A 5H81A 1ID1A 5JCJA 4TKLA 1NR1A 4MVJG 4IDEA 4CLDA 5DN9A 3M1LA 1HWYA 2QRJA 4KQWA 2YYYA 1UJMA 1MC5A 3TQHA 3CH6A 5CEFA 4B4OA 5HA5A 3K9QO 4BO9A 3UFXA 4W7IA 4TKMA 1NX6A 2C7GA 4MIOA 1XU9A 3PGJA 2G17A 4FR5A 4IDGA 4IDAA 2P9EA 3LSYA 2CZCA 5KNLA 1UXJA 2W2LD 3GVHA 4ALLA 5KJ6A 1ZZEA 3OEYA 4LGVA 1AXEA 1T4BA 2Q45A 4JCOA 1C1DA 1QV6A 3FBTA 2PK3A 1OMOA 4MVJP 4WLOA 3OJFA 4OL9A 3ASVA 3BMOB 1CJCA 4M49A 3H65A 4XQCA 1FDWA 4FGSA 1GUFA 1JWAB 3A28A 2FOIA 4Y6SA 5THQA 3VPXA 1WDKA 5A3JA 3NT2A 1VI2A 2DBVO 1M6WA 2E4AA 4W82A 4BO7A 4HFRA 4I1IA 2NNLD 2YJZA 1W0CA 3DQPA 2WM3A 1PQPA 1I30A 1KC1A 4E2YA 4XIJA 4R5HA 4YJGB 3H9JA 5GY7A 3RIHA 3D0OA 4YT5A 1QMGA 2NTJA 5ILGA 3X2FA 1ZJZA 1LSOA 2DBRA 2V6BA 4ND4A 3T7EA 2IRWA 3WQQA 1IPEA 5I8ZA 2P5YA 4UVEA 1DLJA 1PGJA 1YONA 3SVTA 4M1QA 1U7HA 2D0IA 4XZ3A 3H4VA 4J90A 1Q0QA 2Q1SA 3WYCA 2O3JA 3Q2KA 3Q9UA 5B4UA 4ZGWA 3AM3A 2W2KB 2WYVA 2VZ9A 4U6QA 1E5QA 2PD6A 2XF8A 4BVAA 2IYOA 3LYLA 3OECA 3W8EA 1Y8RA 3BHIA 2NSDA 4ND3A 3EVNA 1R6DA 3OP4A 3DR3A 5G0VA 6LDHA 3RKRA 3WGZA 2EP5A 2VYVA 3CIFA 1YE3A 2OORA 1X15A 3DOCA 4R1UA 3DOOA 3E5MA 5AXDA 2DPHA 3PZBA 1QYXA 4I8XA 2X0NA 4ZA2A 2VNSA 4PLPA 2CF5A 3PJFA 4IJVA 1LC3A 4WEQA 3DFUA 3ON5A 5JDCA 4LW8A 4CR8A 3WGYA 1CEQA 3L6DA 3IKTA 5IFLA 2PD3A 3B20A 4NMHA 4HFMA 1WXDA 3WNVA 2AQ8A 4FC6A 4BMVA 2YFHA 1JVSA 3ICPA 4WNIA 5JSFA 1L7EA 4Z9XA 3A06A 3PPIA 4ZQEA 1GY8A 2Y05A 3ZWCA 4CM3A 2VYVD 3IMFA 5AXAA 5A03A 5BNIA 3W4KA 5DOVA 3LC2O 2WD8A 3VKUA 1U8XX 2BFAA 3KOUA 5B1YA 4YJHA 3RC9A 2NU7A 4UUPA 4J1NA 3ITKA 3LVFO 4LVUA 4RV9A 1FDVA 2E82A 2RH8A 4OO3A 2Y1DA 3QSGA 1CQIA 5KVCA 1XG5A 2AXQA 4DLBA 2X5JO 1O6ZA 4BNZA 1E7YA 2B69A 1UDAA 4OXNA 5TIIA 5T5QA 3EY4A 5F5LA 2ZB8A 1VSUA 4ROSA 4AJLA 2IEDA 2YFQA 3AUTA 4GX1A 1LSJA 1T2EA 4L73A 3WGQA 1EEHA 1K3TA 2Q1TA 3H9EO 1UP6A 4UREA 1DO8A 5ITWA 1MX3A 4A0SA 1HF3A 1LJ8A 4CQMD 1WMAA 4JK3A 4NHEA 3TZCA 1G6KA 1ZK2A 4PRKA 2P68A 1TT5B 1U7TA 4BNTA 2AEJA 5B4VA 4BGEA 1M67A 1B0AA 2NQ8A 4CR6A 1Z75A 2ZATA 3HDYA 1GZ3A 2R6JA 3RFXA 2QYSA 4YYZA 4XCVA 5C3MA 3GK3A 3DTTA 4BKOA 5C5IA 5IF3A 1E5LA 3A1NA 3VDRA 5BQFA 1VJ1A 1AGNA 2WE7A 3KLMX 5L40A 2EG9A 2FPPA 4RJTA 1HTBA 2X86A 3JQCA 2GR9A 5MDHA 4NU5A 2EWMA 3E6AA 5DP1A 3QP9A 5AYVA 2D59A 1K89A 4E12A 2AQKA 1PL6A 1YS4A 3KYBA 3HG7A 3PRJA 4YPOA 4BNIA 3ZNOA 4BO0A 5IZCA 5IN5A 4NH4A 2YV3A 3H7AA 3GLQA 2DU8A 3R3SA 4ZRNA 2EIHA 4DC0A 2O3TA 3ZNQA 1NNUA 5HRUA 4YCAA 1KETA 3PLRA 1DHRA 4U8GA 2ZCUA 1PQUA 4P38A 1KS9A 2D8AA 2Q3EA 3ANNA 4ZQHA 3UXYA 1OI7A 3WFIA 1H5QA 5KJEA 3JD3A 4XGIA 1DJQA 2NV6A 4P4NA 1E3EA 3U4DA 1KY4A 3LF2A 5G4KB 4CMIA 4CLRA 4MVJD 4NBRA 4UEOA 1NM5A 1MC4A 3BMCA 4NFYA 4DREA 3WBFA 4JN6B 3NRCA 1VSVA 3DAGA 2ZB4A 5TRTA 2VYND 1F06A 4IS3A 1NHWA 1RKXA 1P1JA 5KJFA 1PEDA 4RPLA 2CY0A 5TSDA 4DLLA 1SB9A 4YEDA 4MVJM 1JKFA 5G4LA 5K9ZA 5IDXA 3RFTA 1C14A 1H6DA 3D7LA 3PDUA 3PK0A 3FWNA 4TSKA 3TDKA 4GX0A 3JQ8B 3DMYA 1RYEA 4RVGA 2JFFA 3GF4A 3PXXA 5DF1A 4GH5A 1U5CA 1OBFO 4D3DA 3GMSA 3L9WA 3Q9NA 4D3FA 4NPCA 3C24A 1U3VA 4LRTB 4G65A 2BKAA 2UVDA 1P0FA 1I36A 1YB5A 4WJZA 3NKLA 1AUPA 3I4CA 3I9MA 4YBZA 4HUJA 4GGPA 3GRPA 4II2A 2FMUA 3AJRA 3D64A 3RBVA 1G1AA 3DDNA 1EQ2A 4JBIA 2LDXA 4J2OA 5HS6A 3K92A 5A05A 2VHWA 5FI3A 4BNWA 3R3JA 3RROA 1BXZA 3D3WB 1IULA 2G5CA 2QQ5A 1QYWA 1GV0A 1A7KA 3GEDA 3EHEA 3FTNA 4FS3A 4QFCA 4W6ZA 1H2HA 3JQ9C 2O3UA 1TLTA 2LDBA 5C7LO 4EBFA 3AI1A 3GN1A 4J2HA 4RLSA 3OICA 1ZBQA 1YRLA 1T2FA 4XA8A 4XQEA 3WLFA 1GD1O 4BV9A 1GL3A 3TOXA 4R5MA 2BH9A 1MXFA 1V8BA 3CZRA 4BO2A 1JAXA 3OH8A 4WPGA 4W99A 1NWHA 3NGLA 3K31A 4R01A 4YQYA 1HLPA 5EMHA 2I5PO 4KMSA 4J1QA 5L51A 1R0KA 3OIGA 5DBIA 5ENVA 2PZKA 4O63O 3LT4A 5A02A 4EEZA 1M76A 1U2GA 3C85A 5TNXA 1DAPA 5KKAA 1PTJA 1H93A 4YRDA 3ZNPA 4NJOA 2Y99A 1GZ6A 1KVQA 4MOWA 2C20A 5AQ1A 4LMPA 1SB8A 3OF2A 4L74A 1D1TA 4M87A 2YW9A 3DBLA 1B8UA 1EVIA 3HJAA 4NG5A 2C7VA 3QJ5A 4CJXA 1HE3A 2J3KA 3HDQA 3ANMA 3DHNA 2ZYDA 4TQGA 3MEQA 3OJOA 3GMDA 3PFWO 3HADA 3PHHA 4E5KA 3FNEA 2E37A 3KO8A 1R4MA 3KEOA 2YV2A 4TWRA 4QUKA 2A4KA 1BSVA 3IC5A 4E32A 5I8WA 3WJAA 1IYZA 3WXBA 4Q39A 5IXYA 3HUDA 4YT4A 4CMJA 3CPSA 2GD1O 4YXFA 1XQ1A 1VKOA 1PL8A 1R15A 1U2DA 2BFPA 1DC5A 2V7PA 4YRBA 3P2YA 5DBFA 1XQ6A 3ZV5A 4BNJA 1LLDA 4B3IA 4B4WA 1P33A 2AHRA 4HX5A 2VT3A 5LC1A 4UEKA 1UZLA 4AG3A 1XR3A 1I2ZA 5L4NA 1ISMA 3I23A 1HXHA 2VOEA 3NDJA 2UUPA 1B16A 2X8LA 4BO6A 4YT8A 2B37A 3PWSA 4BGIA 1EFKA 1HZZA 2OGUA 4JGBA 1H9AA 4PIVA 4N5MA 2DUWA 1LUAA 2NVUA 4L4RA 4FFLA 4UVDA 1M6HA 2AA3A 4NNJA 4M8SA 1E3LA 4L4SA 2NLOA 1SC6A 3TZQA 3LF1A 2DQ4A 1N9GB 1HE4A 3K6JA 4ZVVA 3KSDO 1GYPA 3D3EA 4IDBA 1E3SA 2ZCVA 1FMCA 1WPQA 4E5PA 2W8ZA 2HMSA 3QIVA 3F46A 2IXAA 2IXBA 4JBHA 3UCXA 3HN7A 3GEGA 3GT0A 3QLJA 2DBZA 3M1AA 2I67A 4B4UA 5JS6A 4E31A 3JQ6A 1K6XA 3SLKA 1QG6A 4R9SA 2ZYGA 3UKOA 4EJ0A 1FDSA 4J6FA 4BO3A 2F00A 1Z45A 3MJTA 1XELA 3FHLA 1D8AA 4E4YA 5CG1A 2VCYA 4BL5A 3EAGA 4IUYA 1HT0A 5ER9A 3TN7A 1WZIA 3ITDA 1HDCA 1YL7A 5JDCC 4RQUA 3RJ9A 4NBWA 4OXYA 4KOAA 4ZD6A 3M6IA 3MZ0A 2X4GA 2GYYA 3S2EA 5TLSA 1PJTA 4D41A 4MINA 4CM4A 1QRRA 1PU2A 2EW2A 3SXPA 5ICMA 1DEHA 4DPKA 5HM8A 4AJ4A 4QQRA 4E5YA 4LSWA 4GX5A 3BA1A 3WNQA 1YB1A 2EW8A 3L4BC 1I3MA 2AMFA 3ETEA 4IM7A 2X5KO 5IN4A 1PJCA 3D4OA 4EUFA 3G1UA 4DC1A 2HCTA 2HDHA 2QX7A 3RASA 1CDOA 3NYWA 4ALMA 4XX0A 2GZ3A 3IUSA 2Y66A 1R0LA 3KYDA 4BNXA 3LLVA 1HE5A 1SOVA 4I5FA 1RM5A 1EQUA 2A35A 1EE2A 1Q1NA 4RVFA 1Q7CA 4J9UE 1E7RA 3NJ4A 2EGHA 4H7PA 2GGSA 4YJFB 1FJHA 4F3YA 1ZSYA 3IS3A 1NWCA 1DFHA 2IEBA 3PQEA 3GVIA 3HDHA 1Q0LA 2B35A 2ZJ1A 1U1IA 2WSBA 4Q3NA 3Q1LA 3ZHZA 4CMGA 4YR9A 4PLCA 2YV1A 4XB1A 1LLUA 4GKVA 3DBVO 3UUWA 4ALKA 4CUJA 5K6AA 5EL0A 1I32A 4II3A 4E2ZA 4DQVA 4CV1A 4EW6A 1LA2A 4OQYA 2NU9A 1XIVA 4E5NA 2WD7A 3PYLA 1YO6A 1C1XB 2WJPA 3WIDA 2ZYAA 4KDEA 4WOKA 1ADCA 2ZKLA 4YA6A 2BRUA 2V6FA 3G49A 3WMXA 3AU9A 4OXKA 3F5SA 1DIRA 3I9OA 4JP2A 5JMWA 2FWMX 3V5NA 4QXMA 3F4LA 4RQTA 1Y8QA 4M54A 4R68A 1ZMTA 1ZKMA 1EFLA 3UOGA 4DYDA 1GFSA 1ADGA 2DPGA 1U4SA 2UV8A 2HMUA 3GPDG 5JE8A 3VH1A 3QV1A 1I01A 1QXSA 3NT4A 2OXIA 4R9RA 2HK8A 3MTGA 2GSDA 3GOHA 4AJIA 5I9MA 5JCXA 3GDGA 1R37A 1E6WA 2IZ1A 4Y8VA 3NV9A 1DC6A 1F8FA 5U9CA 5JBIA 4IMRA 5CG2A 1Y81A 3JQ9A 4NBUA 4J4BA 1EVYA 4EUHA 3RUDA 1W8DA 4J0EA 3ROMA 3KETA 4XGKA 1DIGA 1NVTA 1SO8A 3NDRA 2ET6A 2OL4A 2ZJ0A 3GFGA 3SBOA 1YWGO 4XIYA 5CDTA 1GAEO 2JFGA 1OFGA 2PWZA 1BVRA 5I7EA 2ZTVA 3N58A 5JNLA 1S6YA 4Q9NA 4QEDA 4TVOA 4XD2A 4ZQBA 2Y1OA 3VPFA 5JW6A 3U4IA 5IJZA 2W2LA 1BWSA 4WLNA 1DOHA 2W2KA 3RD5A 1SMKA 3ZU5A 1KERA 2E6UX 5EJ2A 2P9GA 4AJKA 1PR3A 2I99A 3PIIA 4WASA 3H6KA 1VLLA 1E1KA 2XXJA 1EVJA 3E82A 4GMGA 3ZZNA 5JC8A 3DC2A 1X7HA 1NR7A 3OIDA 4WECA 4UVHA 3LQFA 1YB4A 2O3QA 1EZ4A 5LDGA 3CSDA 3P2OA 1CQJA 5GZ3A 3DBRB 3JQAB 3PTZA 4CLOB 4D3SA 1PJ2A 4JIGA 4MP6A 2RHRA 1L7DA 3VZSA 3LC1O 3MJVA 1X7DA 2DTEA 4PZDA 2B36A 4AICA 2QZ9A 3LT1A 1IE3A 4JP3A 1YQDA 2FZWA 1E3JA 3KEQA 1YBAA 1HRDA 1D3AA 1PR9A 3ZU2A 1PX0A 1LDGA 3O26A 2VWQA 4QFDA 3I6QA 3TJRA 1E3IA 5JAQA 1FF9A 3D4NA 4OMUA 4FFMA 5I9NA 2PA3A 1LNQA 4D44A 4MKXA 3PQDA 3ZCXA 4J7CA 4CLEA 4FDAA 4Y9DA 1DHTA 3GQVA 1P77A 3Q2IA 3UH1A 5TF4A 1U4OA 5EPOA 3GUCA 4AVYA 3OJ0A 2PGLA 2OBNA 1O8CA 5F1OA 4BNGA 5FEUA 1YOVB 4L9RA 3E5RA 2HQ1A 3S2GA 1DB3A 3I52A 5A9SA 2VUTA 3M2PA 2WEKA 2YHIB 1ADBA 1Z82A 5L53A 2O7QA 3LZ6A 1IZ0A 3NT5A 3QWFA 2PKQP 1NQAO 2WE8A 3ENKA 3K30A 2ZTMA 1M2WA 4KDFA 3ONFA 4RPJA 3AW9A 4BMSA 4HFNA 2VT2A 1OZAA 3WR5A 1PJ3A 4FOSA 3E1KA 3U5TA 2OOSA 1JAYA 3DBHB 2OUIA 1BW9A 1HZJA 3H9UA 3PHLA 2VUUA 3JYPA 1EBFA 3GAZA 3AI3A 4LN1A 2Q99A 2PY6A 1EBUA 3GZ4A 4J7UA 5EIOA 2JAHA 3M2TA 4PLZA 4F6LA 5HS4A 3UF0A 4BOYA 3AUUA 4JX8A 1EE9A 4TZKA 4BQRA 4FD3A 4Z9YA 3V1TC 1I10A 3TNLA 1HDZA 3WTCA 1NXQA 5JMPA 1F17A 1N5DA 3AY3A 3ZDFA 2NACA 4P22A 1MG5A 3DWFA 3HHPA 5U4QA 5ITVA 4PZCA 2VWGA 2X5OA 5TC4A 3UHAA 3UW3A 1I33A 4BMNA 1GUZA 2EV9A 4Q3BA 3BMNA 5HBRA 1SPXA 3L4BA 1UXIA 2Y0CA 2ZK7A 4CMEA 1E7QA 3CUKA 2QW8A 4BKQA 1MA0A 1B26A 1KVUA 1SZJG 3UN1A 4U6SA 2O50A 1C1DB 4XJTA 1NQOA 3CMCO 2NTVA 2VHXA 4DIOA 1DIAA 4GBJA 2FRDA 4ZICA 3ROKA 4CQMA 4M55A 2ZB3A 3RUAA 2OHXA 3N74A 1P74A 3VPGA 4CLHA 1ONOA 4IQ8A 5TJHA 4ZN6A 3BZUA 5A4DA 1SBYA 3I4FA 4ZQGA 2EERA 1AN9A 5BNFA 3W6ZA 4OH1A 3ZWOA 3HB4X 3KV3O 3R6DA 3DZJA 3OEWA 1CF2O 4HNGA 3O03A 4AJNA 2OO5A 3BAZA 4RL6A 4FJ1A 3K73O 3KBOA 5COAA 5CEJA 3L6EA 3PQFA 1UDCA 2Q46A 2X7HA 4BKPA 3KVOA 5A1TA 2X23A 3DZGA 4A7PA 2E49A 3F1KA 1MLDA 4CMKA 3ROQA 5BSHA 3JQGA 4A10A 1F8GA 1YDEA 3JYLA 4GPD1 4NFHA 1FK8A 4CV2A 1NAHA 2X0IA 3HFSA 3ORFA 1EUDA 1X13A 1ZIDA 1EMDA 2CUKA 3PHGA 1ISGA 1W73A 3GNTA 1O89A 1D4FA 1Y8RB 1HYHA 1KIFA 1PS0A 2J5RA 5COBA 3ST7A 4D45A 4WCFB 2VHZA 4PVDA 4O6VA 9LDTA 4HWKA 3A14A 4XYLA 2JHGA 2WMDA 3T4XA 1PWXA 1GPJA 3HNPA 4WLUA 1X7GA 3ZHYA 3O8QB 4JXKA 3VZQA 4UULA 3VVBA 2H9IA 1PQWA 1VM6A 1O5IA 1X1TA 1LXCA 1XYGA 2FR1A 3WYBA 4GI2A 3SEFA 1ISHA 3CE6A 4GX2A 4EZBA 3IL2A 2GN8A 7ADHA 4FC7A 3U4CA 2Q2QA 2ZTUA 4L8VA 4TRMA 2CDAA 2NU8A 5KJ1A 4MVJA 4RVUA 2WWRA 3KLPX 4WNCA 1Q7GA 5L7WA 3T7CA 1WMBA 2CF6A 1B7GO 2GN4A 5L7YA 4J49A 4U5QA 4YRAA 3COSA 4RORA 3V2GA 2YQ4A 1C0KA 4UAGA 4Y67A 3TL3A 4BNFA 1NBOA 4CMBA 2VYNA 1M66A 4Z0HO 3WQRA 4BO4A 3WGIA 4UUOA 1VRWA 2AQIA 2J5KA 3GNQA 4MVJE 3JQ7A 4FPXA 1EDOA 1R4NA 1I3NA 1DDOA 2GRAA 4R4JA 4B4VA 1YDWA 2XXBA 4EITA 3QVSA 1ZNQO 5ADHA 3GC6A 4J0FA 2FR8A 4TRRA 1XLTA 3FSRA 1NPDA 1RPNA 1E1MA 5FI5A 1P1RA 3I6IA 1WWKA 3LK7A 3L07A 1LQTA 4BQPA 3S2IA 5G0SA 3UVEA 2G76A 4WCDA 1C3VA 4F46A 1V3UA 5TQVA 4F45A 1JLLA 1MB4A 5CEEA 4DMLA 2BD0A 3CTMA 4LVCA 2X9NA 2G82A 4W7HA 4IY1A 3GUYA 1VJTA 3E9NA 3IJPA 3UGKA 1LC0A 1N7HA 2A94A 3P19A 1KEUA 4B3HA 4GSKA 3B1FA 3EVTA 4IBOA 5AXBA 2SCUA 4L75A 2RBEA 3NGXA 1ZJYA 2BMAA 3L0DA 2FHSA 4FFOA 4I5EA 5BSGA 2R2GA 4RPKA 4BUCA 5H83A 5K6AC 3RJ5A 4NK5A 3OHSX 4E30A 1PGOA 3Q11A 1ZH8A 5ILOA 2JJYA 3ADOA 1EK6A 3V8BA 1PZHA
chains in the Genus database with same CATH superfamily
3H35A 4GCVA 3INRA 1N2CE 2STWA 4ZO4A 4O5AA 2FQYA 5FCDA 5F0HA 3PXBA 1N6LA 3R3HA 1X19A 3KELA 3L49A 2G9UA 4L4ZA 3SI7A 4BEJA 2PYIA 3KR2A 4X0GA 2JATA 4YB8A 3IEXA 3PYMA 1N6IA 3DO6A 1WW8A 1XX6A 2NV0A 2VQ3A 3I05A 3PPWA 3OU7A 4OYYA 2ATIA 2VF4X 2JL1A 4TKZA 4NPAA 3HTSB 5K4AA 4CV3A 3BTUA 2I0FA 5E1MA 3NALA 3ITNA 1SBIA 1RI3A 3M5CA 2WU4A 1UJ8A 4HXFB 5CDUA 3H2ZA 3LX4A 2OLEA 2V7EA 3Q7TA 4LJ8A 1XVIA 4O4JF 2V1XA 2VB6A 1OYWA 1G21B 1XL0A 2PXCA 3D1LA 4OMCA 3M3HA 1C1YA 2G63A 4MR7B 2VONA 4S0HB 2V97A 4IG4A 3B82A 4A0ZA 2F1JA 5FX2A 3SP1A 4U7WA 3NAZA 2YCBA 2J0UA 2UYQA 3S2YA 3D1VA 2J9RA 5I3ZA 5FOUA 2W6MA 3I73A 3RSZA 3EDPA 3RYPA 3GZNB 1E2NA 4G4SP 3U13A 2VZ8A 2LKPA 1F4PA 1WU8A 3ICEA 2MA3A 3HH8A 2IYYA 3OZWA 3K32A 2W25A 3RS3A 4G5YA 1A96A 1O6FA 2XHKA 3N4MA 4RIIA 2AI3A 3I04M 3O8RA 2VEDA 4NVRA 3L1PA 2JAPA 3L92A 2HMAA 1WCMJ 1RRKA 3GJSA 2WTAA 4AMVA 3MUEA 1LVHA 4M6XA 4LE1A 1GCGA 1QUEA 3QPVA 1SQGA 2BUCA 2ONZA 4DBLE 1RXWA 4CM1A 4CDGA 3OYJA 2C2BA 4CMEC 4P5OA 3CXUA 3PTAA 1N2XA 3CRW1 4OAPA 1J21A 3GD5A 2RAUA 3HA2A 3ISPA 5JD5A 3PVZA 4ZAGA 1QA6A 1LVGA 1TB4A 4RB2C 4M9SA 1XK6A 1E8NA 2QQEA 1U2ZA 3PUHA 1NI4A 1WP4A 1N5RA 4OYHA 3AK4A 3ZWXA 3KFLA 1AD2A 2IHVA 4F60A 4N39A 1KHTA 3HYNA 4K3UA 1V41E 1KFJB 1U5TB 1WJCA 1T8UA 3ZHXA 3GNLA 3JSXA 2Q6IA 1WD7A 1PKEA 4AIJA 3R1IA 1SUSA 4QHTA 1XXLA 2PZLA 3EUFA 3W5HA 3E81A 4ZYGA 4Z3DA 4RPGA 1G5TA 2V7QA 3SDZA 3E6MA 1VBFA 4LZLA 1VLJA 4EF6A 4QD3A 3VMFA 4BLOA 2QM0A 2C84A 4HEHA 1KO7A 3FAKA 3EEOA 3RC1A 3IIEA 4JYBA 2M6KA 2ZZKA 5DNDA 1SQ0A 4TSFD 5CJJA 3BWEA 4FN5A 5B7GA 4GOLD 5KNBD 1K2VN 4CCAA 1K79A 2UU9B 1ZICA 3KOMA 5EGSA 3BD8A 3LKVA 5EXTA 3F5QA 2IOFA 4AIRA 4MA5A 4XM3A 5BOVA 5JTUA 4ZI7F 3VC7A 4XYMA 1NVWQ 1ZCJA 3ANSA 5KX5A 2JK0A 4C3IJ 1YQEA 2ZR7A 3MUOA 2PMCA 1OAAA 3H13A 2M6LA 1QHNA 1D7OA 4QAJA 4KXQA 2E1PA 4DM7A 3E9YA 1D0SA 2DMPA 3BMXA 1YITI 3M4JA 3OLWA 4Z6KA 5GTIC 3EOZA 3UTDA 1TMOA 3TLCA 1VCNA 1WNTA 4XICA 4JU8A 1VL0A 1DXHA 3OPYB 4D9JA 1O95C 2ZJ2A 1K3UB 2PLAA 3OZFA 4FK8A 1U0TA 5IG2A 2XQFA 3I59B 1DQZA 1NXOA 4MJLA 1Q1VA 3N0TA 5K5OA 1EG2A 4KRFA 1NJGA 1VQ4I 3L8YA 2FETA 2ZUCA 1QZZA 1I80A 3IAS2 1XHLA 3S3NA 2DLDA 4HB2A 5I7UA 3KOYA 1HDGO 3WLJA 1FLIA 4F1JA 2KJQA 2WYHA 2QU7A 3WSWA 2GBFA 1J5YA 5TJ9A 3UBMA 3S1SA 3MD0A 4OK6A 1YRHA 4O25A 1PUXA 2PQ2A 3GYGA 2GQ0A 1CUEA 3WMEA 1LDYA 2OD5A 3WOHA 1Z91A 2FW1A 1OLOA 4I2VA 4IDNA 5B4TA 1EH8A 3A6GA 2BGLA 1ODTC 1HQDA 2OBBA 2GK3A 2EA2A 4IFIA 2BSXA 4OHKA 1IF1A 5BSMA 4FB5A 1QYDA 4G0OA 3AR6A 1C0IA 3HPGA 3UAVA 1TGVA 4IJAA 1FMLA 4JJAA 5E3OA 1WSWA 5AVQA 1BW5A 4RQBA 1UANA 1VHQA 4RL4A 1HEYA 4ZYHA 2CVHA 4YGXB 5L3CA 5KOIA 1AU7A 3R4CA 3B6CA 1OLXB 1CUUA 3TZKA 1YS7A 4XUEA 4XGQA 2YDXA 7REQA 2HMYB 3UCFA 3QE4A 1B9MA 3UJ8A 4LECA 5EEAA 4BEBA 1GQYA 5C0OE 3DT6A 1PFGA 2KPOA 4HB4A 3BE5A 2PMHA 3C1OA 4DNQA 4R54A 1M1UA 1UDBA 2K9LA 3OUTA 4BDSA 1WJAA 2F3PA 2HDCA 4TQAA 3FPSA 2XTNA 5DK6A 1XN1A 2G6TA 3RWOA 1BTOA 3S7ZA 4G1VA 1G5RA 3V8VA 1QLHA 1XA0A 3E9CA 1Y9ZA 1D0IA 2WHYA 1NDHA 3VEPA 1P92A 3PO3J 4N8SA 2VJMA 1DPFA 1KOLA 3HVHA 2OD2A 4MQ6A 3ME5A 2QN3A 4ALJA 4X6UA 2GYWA 4QFMA 4D57A 5AMXA 2EIMH 4DADA 3MJCA 1RWKA 4KGXA 1OXVA 2JRLA 2Q50A 4A93J 2QQFA 1VKJA 2VPPA 4MV9A 4DWVA 3T4EA 2JF0A 1OT5A 4NAHA 3FETA 4JHLA 2X13A 4GNRA 1Z5PA 1Z36A 4XWKA 4TMYA 4R9NA 3OCJA 3UWPA 4RGBA 2BR3A 1A9YA 4RK1A 3AI7A 4GKJB 4MKHA 3INNA 4QDKA 3TNDA 1KZ7B 1GZSA 4UARA 1XVTA 3O4RA 5HNKA 3V9AA 4FBLA 5GGYA 4PAGA 4MUFA 3LTEA 3ZGLA 2OTLI 1QE0A 2D2FA 4L50A 5M3BA 4F3RA 5JTTA 1NR5A 3KE2A 1YKFA 3EGVA 4I9HA 1Z6GA 4OBEA 1V26A 1QR6A 3A02A 1SBQA 3VKFA 3CUYA 2R7MA 4ZDJA 4YFVA 2FSVA 1WXQA 1OA0A 3MJ4A 2PEZA 2EFJA 3FVWA 5DWDA 4Q4CA 3KV1A 3H99A 4TUYA 4KBYA 1XDWA 4G5QA 1M75A 4MQFA 2LTPA 2HRDA 2OO3A 3TL2A 4L8LA 3RI4A 2ZSEA 3K9WA 1NI5A 3V80A 3ZWAA 4OKNA 3LX5A 4HWPA 1VGQA 3MTAA 1YDHA 3L84A 4BACA 4CMHA 3DXFA 9ABPA 4ND2A 3RQIA 3X43A 3FBNB 4YIKA 1E3WB 4V38A 4FI3F 1FSHA 3F8CA 3CN9A 2OORC 1G4UR 1RRGA 1WM1A 1AM4D 2R1TB 4XSHA 3EMBA 5B2ZA 4NB5A 4NEHB 1ZXXA 2CHUA 5J4KA 3RKUA 8ADHA 1PYVA 2KDZA 3V7NA 3U1TA 4L9TA 1VFCA 4CKBA 3MJHA 1Z21A 3H5LA 2KZVA 1TA9A 1IUKA 1W6UA 1YV9A 1EUCA 1STZA 1ESMA 5B3JA 2HF2A 1KAGA 1XKTA 3F8FA 1Y8CA 3AW8A 1O9BA 2ZXHA 2BE5F 4JI2B 5HFNA 5LA6A 1E89A 4MYHA 2JI4A 2C1ZA 3SWWA 2O48X 3STTA 5G0WA 4ZCMA 3K15A 4RDUA 2QTLA 3O8NA 4C9BA 3NOQA 3H5WA 5JY1A 4M0KA 2GJ4A 1XEWY 1RIIA 2B8WA 5AOBA 5JQGA 2VJNA 2Q21A 4E6PA 2X6RA 1PL0A 2NU6A 4BVHA 3EW7A 1VJRA 4LXUA 4BQSA 5A4JA 1CUCA 4O5OA 4H0EA 3VNRA 1U9CA 2ZJRF 1Z4MA 1SD2A 4X7BA 1E2XA 3Q7QA 3QNUA 5K3BA 4LMRA 3O1IC 5I51A 3EWSA 3NHAA 2E5FA 5BORA 2FPXA 1U0HC 3WIEA 2FLKA 2VE8A 1EFCA 5CH3A 3MTQA 4ARIA 1DJNA 1RWBA 5A5EA 2EX1A 4JOSA 3DBHA 2ZS8A 1N8KA 3VYWA 4Z7JA 5DGHA 4KXMA 1Z2NX 2YL2A 3LWDA 1IUFA 2YR2A 2VF5X 3JD1A 2KZGA 3WQBA 1ENZA 3U3RA 4EL0A 2VYFA 2YMMA 5FV7A 3TTUA 3LGAA 5KHOC 2J5OA 2IYVA 3PDCA 2A33A 4G84A 1BD3A 1D1PA 1KDTA 4WK2B 2WQ7A 3CW2A 2GOXB 1Q44A 3NH9A 3TE7A 4RTSA 2ELHA 4M0DA 2XMGA 4TS1A 4AUNA 3A11A 1C1DA 1OMOA 4MVJP 3CCEI 4WBSA 2IGTA 1HY3A 4NLLA 4FGSA 3CCSI 1VQPI 1NUUA 4MWGA 2O54A 1E2DA 3NT2A 2NNLD 3BUSA 4OFZA 1N2EA 5GY7A 4HX8A 4ND4A 2NYUA 4OHWA 4BN0A 4RSMA 4BFTA 2ZJ3A 2WWYA 3G2PA 2NUPB 5HNHA 3RC3A 3M89A 1E0JA 5D3KA 2FNPA 1RHKA 2OSVA 4E09A 2NAPA 1X15A 2LRDA 3E5MA 3I71A 4MWSA 5E4FA 1WETA 4PBSA 5JLWA 1ZGGA 2X41A 3SE7A 2YFHA 4UFNA 2GHQA 1PEKE 3CVVA 4FTWA 4I36A 2ODEA 3MINA 2WSMA 4J0IA 4LYYA 1JHDA 4IHSA 1YS6A 2HR3A 1Y98A 3SFTA 2AF3C 1MBGA 1JLRA 3EMVA 4OO3A 1ZVQA 1PG5A 2BFCB 2QVLA 3OOPA 3T5AA 3O2JA 1NG6A 2CJPA 3QX8A 4BVEA 1SULA 5DUKA 4NOKA 5YASA 2FN4A 4GVPA 4TLDA 1RZRA 5ED4A 1KEEB 3I0TA 1RR8C 4JI6B 3KSBC 4TV8A 4WI1A 4ZPXA 1G8YA 1UP6A 1E5XA 1DO8A 2O1SA 3DXZA 1EEXB 4OBXA 4CXFA 4DEXA 4JK3A 4NHEA 2Q5CA 2VDPB 5AKIA 1X39A 4IJMA 2AEJA 5B4VA 2VVTA 2EIKH 1D8TA 4XGRA 2R6JA 3ABTA 4K81B 3TQFA 4XCVA 5IPFA 2MT9A 5BQFA 3OYMA 4NU5A 3GRUA 1I5EA 3S1MJ 5FQNA 3GEIA 3Q3JB 1NUPA 3ZNOA 4BO0A 3IRUA 4TV7A 2QGNA 5IN5A 2HA4A 4G5GA 3KZMA 3LT5A 3DYVA 3JXEA 1USWA 4NULA 5LWHA 1XRMA 3WHPA 4PZLA 2EV5A 3N07A 3I37X 1J8QA 3IAM2 1UQUA 4TN5A 3TR0A 3QBEA 2GZSA 4F9EA 4EUSA 3H1TA 5FT9A 2X15A 1C14A 3D7LA 3OF3A 1HYBA 1MOSA 3X0DA 2R6FA 5I9TA 3S3TA 1U1GA 4BX3A 3RF6A 2XUAA 4D3DA 4TVKA 4X20A 4CZCA 1COWD 5FFZA 2GEKA 1HT2E 4Q6WA 4WJZA 2P78A 3HN6A 3I4CA 4NV0A 4WXCA 1AT1A 4DLXA 3DGEC 5F52A 5B3SH 1FFHA 3GX1A 3K92A 3RC8A 3JTEA 1RW4A 3GUHA 4KNVA 3UKGA 4X1KB 4RZXA 4EBFA 4MEAA 4MWTA 721PA 1CR2A 1V9CA 3B52X 1L8LA 1VKHA 3R2JA 3GIWA 4LDPA 4INZA 4IKEA 1ZINA 3N8DA 3M1YA 4AP6A 1J0AA 5F51A 4YV1A 4ZRDA 1RAFA 4EO9A 2IPLA 1DAPA 1Y4ZA 5B7QA 1GZ6A 2O14A 1O87A 1YHZA 4ODIA 1L4NA 3HJAA 4CJXA 1ZHFA 1ACIA 5AD1A 3IWFA 5E4JA 4WX9A 3BIXA 2H1IA 3CF2A 1CUHA 2CXXA 2Y9ZA 5JSQA 1BW6A 3PQ4A 1MF7A 4YRBA 4UAVA 1OCOH 2CNLA 5B6PA 2X7JA 2AHRA 3PS9A 4AG3A 3PUXA 4W5WA 5DHTA 3AIMA 5DD4A 2EKDA 2I62A 1UBMS 1ZRSA 2PZBA 4NHOA 4FLFA 1FSZA 2HXOA 2WYOA 1WPRA 2P0EA 3QIVA 3DH0A 3R5XA 4AIDA 1NRWA 1E60A 3E84A 4Z53A 2ZYGA 3B6IA 4LY9A 3EXIB 4Z7QB 4MUYA 5JECA 1WCWA 1DUXC 2VCYA 2E89A 1OBOA 3MWEA 1FPMA 1FC3A 3SX4A 3DTVA 4NBWA 2DP4E 3VDMA 2BW3A 1DIOB 4RHCA 4F85A 1Q11A 3HMKA 1PU2A 4BBSJ 3PSFA 4B35A 4A2UA 3A58B 5IN4A 4ICIA 3T06B 5C4IA 1S6LA 2KIUA 3A9RA 3D4LA 2DCUA 1R0LA 1HE5A 3MERA 1ZGAA 1Q7CA 2C7RA 2CRGA 2GGSA 1KZHA 2IZOA 3N0XA 1ZSYA 3HDHA 4GU5A 1F0KA 1U1IA 2WSBA 5EGNA 1MBZA 2WF6A 4ALKA 2AD1A 5EL0A 3T5BA 4LK1F 1EM8A 2NU9A 1RZUA 2WD7A 3MIIA 3MKYB 4EZEA 3RTRA 4XRMA 2X9LA 4OXKA 2WD9A 2WW8A 1QZTA 4R68A 2ONJA 1M8KA 3GF2A 2JGIA 3OPNA 3VH1A 2OXIA 2WFLB 1XSXA 3CCLI 4RKQA 5DYWA 1NNSA 2ZBDA 4IIJF 5CLQA 2GXAA 4GMXA 4BJ6A 1W8DA 1NVTA 1R0ZA 3HJCA 3CEJA 5CDTA 4XQFA 3TW8A 1Z6XA 5T4HA 4OJYA 3JR9A 5ESRA 3B1XA 1FUYB 2I8DA 2X6YA 3EH2A 1APBA 3DVSX 3OIDA 4TYMA 3IALA 2O3QA 4MRMB 4KT5C 4RESA 2L01A 3JQAB 1PJ2A 5J2TA 3U19A 5BMZA 3G0GA 2B36A 1EUYA 1E3JA 2PKYX 3AG6A 4Q82A 4RU1A 1MEJA 1P73A 2ZYIA 3RVPA 3ICOA 1M6NA 4GEKA 5TF4A 4LJZF 1A35A 1R1DA 2OBNA 4RGYA 3LAJA 1EGMB 2ODPA 1YOVB 4BZZA 3S2GA 1W85B 1VJDA 2PKQP 2AJ8A 3NQOA 1U6KA 5DX1A 1ZMBA 2OOSA 2OUIA 4MYDA 1HZJA 1Y1KE 1OI2A 2WINI 1NG9A 3RYFA 4J7UA 1HEIA 1ZD5A 1EFAA 2A3SA 3KQQA 5EWJA 2C57A 4LFBB 4DKXA 3ILSA 3WTCA 2XPUA 3DWFA 2P0YA 3WNCA 3AHDA 2DT7B 5IM5A 3MTDA 4U2FA 3I53A 1ZIXA 3FHJA 4I1SA 4I9FA 4BP8A 4ZICA 3N2GA 2JA2A 1ULYA 5A4DA 2Y76A 2A78A 4OSEA 3GLRA 3QXCA 4H7HA 5EHZA 2FCAA 4G4JA 2UYGA 2V9CA 3ORFA 3DDHA 4ZO6A 4CCYA 4DV2B 3MHPA 4JMLA 4B6JA 4HDKB 1URPA 5A3SA 3ZHYA 1I4LD 1AZWA 2LCIA 1PTKA 2N46A 2PKEA 9ATCA 1DINA 1ISHA 2W57A 3AEKA 3N59A 2QUFA 2CDAA 3ORHA 1F0PA 2XASA 3GCZA 4RVUA 2PJUA 3LSGA 3V2GA 2VTBB 4BWVA 4BO4A 4D4LA 2JWTA 2YZMA 2GA9A 4B3GA 3GLUA 5AI4A 4MVJE 3JQ7A 1NQVA 2OU2A 4MS3B 2Y6UA 4OX9B 3FXUA 3QYEA 3E58A 4I0BA 4EITA 5ADHA 2O7NA 3TCKA 4TRRA 3GROA 1XLTA 4AF6A 5IFKA 2NXNB 4BQPA 4YHBA 3L7DA 1YNOA 1FP1D 3RKYA 4Y9TA 4MHGA 1YW9A 1DTWA 3EZ9A 1K9VF 4EKYA 2C6YA 1N7HA 4YP0A 3OO1A 3AWIA 3CUOA 4M1ZA 3JY6A 3GEHA 5BMVF 3ZGKA 3Q11A 4MAFA 3G0CA 4ZEMA 1YRQA 4G1FA 2DUMA 4AZ3B 2I2AA 2I8AA 1JZSA 3PNQA 3TF5A 3T3PB 5KMGB 3VI3B 5LLDA 2NT4A 1M2JA 2CZGA 2CUEA 1DO2A 3SJUA 1E3DA 1MAUA 5LLTA 5JAZA 4C7JA 2PGAA 1GRCA 1MO3A 2QRLA 4RTNA 1TQDA 1I7NA 4B8ZA 2HXGA 4MVCA 1F2UA 1YBHA 3FMSA 2PEXA 2QLNA 2YVLA 1GQQA 3IE1A 2IY9A 1N0HA 3NWBA 4ER7A 1P2SA 3QMMA 1JWBB 4QO8A 1TJ5A 4DZJA 4J29A 1RR7A 1SCIA 4JKYA 5JSZA 4HPXB 3SM9A 3K9HA 1JYEA 1O4VA 1OWOA 4UUMA 3R9XA 4ZTZB 4RAQA 4D8UA 4C4YA 1YASA 3A3YA 4UUSA 4YLYA 3CJTB 1Z17A 3VR6D 2ZKZA 2I29A 1Z35A 3ZYCA 5JHUA 4QLBA 2REXB 4OP3A 4GOJA 3THYB 4DQKA 2UXDB 1W88B 2HBRA 2ZJZA 2P5UA 1TM2A 3NCTA 3O6VA 5A04A 4IIBA 3BWXA 3SZMA 1CXZA 1SK9A 2ZE5A 1CR6A 2PR2A 5HM6A 4JBYA 1U3GA 1CS4C 1JHHA 2Q4EA 5DTDA 5FJJA 3T3HA 3H5AA 5EY5B 1E0DA 2ZAGA 1S3IA 1YRAA 1KK3A 4TYYA 3L82B 5ELMA 3DV0B 5H8WA 4P4LA 3D5QA 1P0MA 2IU6A 3ONEA 3ZXXA 4MQVA 3DFMA 2JHFA 1PGPA 1Q0HA 5KHDA 4JWTA 3FIJA 2C95A 2WHEA 2QGUA 3OM8A 4I4LA 1XEAA 2N75A 4B6SA 2IYRA 5BYJA 5IS2A 3OWTA 4MDEA 3TLYA 2Q28A 3P27A 1QGDA 4EAQA 4B2IA 5JAMA 4NV1A 4Q4HB 4RK5A 1I7QB 3T7IA 5JMTA 2WLSA 1D2HA 5M5BA 5ARBA 4AFNA 4KH0A 1L5ZA 4KVGA 1L5HA 3RSHA 1PR0A 1MENA 2ISZA 1JKJB 3AYZB 2AW5A 2VJBA 2Y1FA 4YFXF 4BJHB 2NPFA 4XYBA 1YVRA 1VE9A 3T7JA 2KL4A 3EUEA 4QJBA 3MS7A 2PO7A 5JS1A 5K3OA 3DZHA 4G89A 2VHEA 5F1KA 4BB9A 2PD4A 2BR5A 3V2HA 5J1UA 4DWOA 2C4WA 3V4ZA 5T4EA 1T10A 2P8JA 1T29A 1E1LA 1ETKA 3LLUA 1BFDA 2C97A 4A8TA 4KR2A 5E38A 5DYYA 3WICA 4D7AA 4YAUA 4MR9A 1JJ6C 2HTJA 3FSEA 4HNAA 4N0DA 3Q3EA 3KHUA 4DA4A 3ZQFA 3W8NA 4EVIA 3O8OA 2OY0A 2XUHA 2BFBA 4DNFA 5BV0A 1BM9A 3QX3A 1NAIA 4BAUA 4LGWA 5ITZA 2D5IA 5CT5A 1E3OC 2VXZA 3REOA 4FFSA 1W1IA 1IRXA 1FBUA 2VP0A 1EDZA 1DS6A 5DCYA 1OE0A 1K2WA 1E1QD 3W06A 2MSYA 2GPWA 1K78B 4X1IA 2FFAA 1GYRA 2NSJA 4G6QA 3I1IA 1YCFA 6PAXA 3QTBA 8LDHA 5A5FA 1DSSG 5KPDA 3THOA 3C43A 2IP1A 3L1IA 4MW4A 4U9HS 3VSLA 3JZAA 2I4OA 3J80K 4GECA 4XOPA 4WCFA 3H3JA 2GERA 4XJSA 5EQJB 4Z4FA 3C7CB 3PJGA 4YJ2A 4TV9F 4B82A 3SHTA 3PXDA 3J7TA 3GJRA 1JFRA 4LXIA 4ILKA 5GAJA 2CCKA 4BNVA 3KUCA 1QRTA 2AR7A 2HUNA 1UH5A 3WDSA 5L3FA 3Q9VA 3EFHA 1U6JA 4RY2A 3MVPA 2CNDA 1WLSA 2BOVA 2PVPA 4J4TA 2FVXA 3OCZA 1KTIA 2WTEA 1ZGHA 5HODA 1TK3A 4FEYA 4U0VA 5CJ9A 2I4RA 3UMCA 1GZHB 1XQYA 4TYWA 5JJLA 1FZTA 4BCDA 1JSXA 4HLUA 5LQRA 3KDSE 3M4XA 2J3EA 3L46A 3WL8A 4BBRJ 3KAKA 3U48A 2JCXA 2Y4NA 3IH2A 3I0NA 5E3JA 2X22A 3VA7A 3HV0A 1JXOA 4UVIA 1BGXT 1IZZA 2Q4OA 1M5UA 4EHNA 5M5YJ 2VATA 3L8CA 4HPWA 5HUHA 4FN4A 2CMGA 2VAXA 5I4BA 1TLFA 2QQ8A 5JHGB 4JLOA 3K2QA 1VBKA 3S2DJ 1QPBA 4CYMA 4BMPB 3M3YJ 1CNEA 2V7GA 4XOIA 4YRMA 3D3WA 4XEHA 1THGA 2ZJ6A 3FK6A 3M81A 2B0JA 4MLOA 1JHPA 1H3NA 1E2IA 1ZK0A 4B31A 4MW2A 3REQB 4FLEA 4ZZIA 2ZW9A 5DS9A 4NQZA 5EVJA 1U28A 2PLWA 2YS6A 2FN3A 2QQBA 2DK8A 1T95A 1UMCB 5IASA 4RTPA 1DXYA 4DIBA 4XUDA 2IZ6A 2N1MA 3UPTA 1H0RA 5DT9A 4OHPA 1H23A 4DBVO 3B1JA 2Z2SB 5LRSA 5JWOA 4FQ8A 2XV1A 1IL0A 4WN9B 1Y4SA 1J2TA 3LWBA 2GN9A 3NG1A 4QG3A 1KWGA 3CCJI 4NYIR 2C4KA 5LYJA 1TJ4A 4MZDA 2F1HA 3RK1A 2LK2A 2PUEA 3ESBA 2PN6A 5F21A 1VE3A 3L41A 1T5OA 2B4QA 3R24A 4R2LA 3ZBPA 2HMTA 2A6TA 4KW7A 2YJ6A 4NFSA 3FCXA 3QY9A 3W5VA 2OCYC 2GZDA 3CF6R 3T9AA 2GBCA 3CLUD 1V9LA 3IUNA 2TECE 4GUDA 4AM3A 4RY9A 2X77A 1BMTA 3A1YA 1BXRA 5FV4A 4C3HJ 1T39A 3DVQX 4NDLA 4M8NE 1NG1A 4US1R 4XWGA 2YIDA 2E9SA 2PLRA 4FYXA 5ALRA 3AH8A 2X9GA 1DG1G 3P8ZA 1TZKA 4Q6BA 1AKQA 3EGDB 4IKOA 3OQBA 2Z5LA 1N36B 5B30A 1V8ZA 1YFKA 2C8VA 1T36A 1FQJA 2DU9A 1M2FA 5JXGA 3ACBA 4H1VA 3EYWA 1LFDB 2NW6A 3G02A 3EG5A 3LL7A 1GPBA 2VJPA 3QEBZ 4M74A 3PC7A 4OSOA 3DOEA 4QJ5A 3OJLA 4DM4A 1NQ5A 3AVQA 3KP6A 3A6FA 2YXDA 3SR4A 2OM2A 3WWCA 2Q3HA 2CJJA 4LI0A 2AR0A 3W5UA 4Q3DA 2VRCA 3B13B 3GFPA 3QWIA 1IY9A 2GDZA 3OCXA 2IIVA 3D4PA 2CXQA 1RQGA 5A2QK 1NN0A 1T3LA 3G8AA 3NW9A 1NBIA 2JGLA 4HDOB 3E9EA 4G8CA 6ADHA 2H59A 3MTJA 4RF5A 1DP4A 4KQJA 5TT1A 4OXQA 2J9FA 2GNAA 4BIIA 1OXMA 4RVSA 2CFSA 4NZ9A 4NZNA 2HHHB 4D74A 3A7EA 3K09C 3ZDBA 3S2WA 2CVZA 1D1QA 1A82A 1IAVA 3IEKA 1IQ0A 3C1AA 3EC1A 3ZW8A 3W1WA 2GLTA 2VWPA 4LY6A 1CE8B 1QLJA 2Q3CA 2X58A 1AHHA 3G1OA 3I56I 2FG6C 4B2YA 3I3LA 5AJVB 4RXUA 1WB6A 5CA0F 1ESNA 4IGFA 3FH0A 4S2UA 4IV5A 4YRQA 1Z18A 3A9SA 4S35A 2UXCB 1UK7A 3TUIC 1HSZA 3I2IA 2PUCA 4QX6A 4WXRA 4CEIB 3V00A 4B81A 4JAVC 2GEUA 4TMZA 4WUVA 3R23A 4A69C 3W9YA 1JBEA 5DM2A 2DG2A 1QE5A 4WWCA 1TT7A 3P9KA 3V8NA 2FQXA 2PCJA 4DXHA 2OOKA 3O21A 2EFHB 3PLAE 3GIDA 5JT1A 2K4JA 3LQRA 1Y0BA 2FZCA 2YJ3A 3CZ5A 4FYMA 3I6ZA 3AZOA 4DXAA 2RGGA 2EWNA 2EKLA 2IGNA 1PKXA 4ESJA 3SEZA 4CHTA 2HD4A 3DJFA 4C7XA 5B57C 1UT8A 4ZAVA 1EAYA 2ZSDA 1RXIA 4G4GA 1K8XB 1RWWA 1X2MA 4O4HA 5AW7A 3CF0A 5LKAA 3KE9A 1YK0A 4KKVA 1AY0A 4G5FA 3LP6A 1XQVA 2EG5A 1G8MA 4RXMA 3OEYA 1TF7A 3TG8A 1Y6RA 1V45E 4TLEA 3U9TA 5I7WA 5A71A 4Q7JB 2HA5A 5KOJB 1I30A 3D2AA 4EABA 4PX3A 4YJGB 3D0OA 4QTUB 2NTJA 1NOJA 3MQ4A 2Z9DA 4UVEA 3ENVA 1VZ3A 2WIJA 2D0IA 4U7FA 1ILWA 3WYCA 2MU1A 5TMPA 1DQPA 2IYOA 1GNLA 1N57A 3EVNA 3SJAA 4UBMA 1QQ7A 1SHTX 3MSCA 2QZ8A 3TXAA 3ZJTA 5H7XA 5AXDA 2DPHA 1SRRA 2FKAA 5CJ2A 4YP5A 4ENSA 2CW0F 3D6TB 1WUKS 1WXXA 4BRZA 5LQNA 1OREA 2D2EA 4BMVA 2Q5OA 2QEXI 5ALDA 3UT5B 3MXTA 3IT3A 4P3KA 4MVXA 3TKYA 3A06A 1T6SA 1DL5A 5AXAA 2UZ1A 3GRYA 4RABA 4YJHA 1V11A 1NF2A 1OCPA 1GARA 1SUIA 1VRCA 4H7IA 2Y1LA 4JX9A 4R31A 1A4RA 5T5QA 4YRGA 2WMOB 1YBFA 1K7AA 1RSZA 4DY4A 3TMYA 1ZM2A 4LHXA 4JD5A 3OTGA 1MX3A 1NN5A 1US8A 4HG2A 4CCKA 5E8GA 2P68A 3WY9A 4BTVA 2F8TA 3JALB 4MNTA 5LUAA 2C3UA 2AZ4A 4IEEA 5IF3A 4CEJB 1BQ4A 1VJ1A 3LW8A 4AT1A 1UMDB 2WM9B 1P5ZB 4V1CI 1IXCA 5LBQA 5A7HA 1NNLA 5TRDA 5JRDS 1VSBA 5DGIA 2PFSA 5HVQC 4BNIA 1OV6A 3OD5A 1R9NA 4NH4A 5EMNA 4HWSA 1EGVB 3RYCB 5DI3A 1LPBB 2C9MA 5LZ5A 1BOBA 2WTUA 4YMGA 4CEHB 4G01B 5EIEA 2XJ4A 4MVJD 2HYIC 4UEOA 5EMKA 3WBFA 1MVNA 1JPNA 4UTNA 3K2ZA 3JRFA 2YWHA 4MTLA 3IPYA 3M9XA 1Z8NA 1R4AA 1WXFA 5IYZF 3G85A 1JKFA 2GD2A 3TO7A 2NZ8A 3PK0A 1RYEA 1OT3A 4WZAA 3FVRA 4KFCA 1U5CA 1OBFO 2IYAA 5A4FS 1F5SA 2B2CA 2V0GA 4MQMA 2XBUA 3KZNA 1L4HA 3RSFA 3C5CA 1L7MA 2JI9A 3HA5A 1CZUA 1WG8A 4M1EA 3HCOA 3KDAA 5D00A 3MBOA 2GH1A 4UZEA 4M6WA 1UOOA 3WQHA 3OICA 1O3RA 2PFBA 4XQEA 3AR3A 1ST2A 1LB1B 3OH8A 1NWHA 3PQ2A 4R01A 2QZSA 3L04A 4FKZA 3ECCA 5TNXA 4FP9A 2Y99A 4M38A 2BI4A 2K7FA 4UU0A 5HGXA 3NC4A 2YW9A 4NG5A 2DQZA 2P3QA 2CLKB 3DHNA 1VCHA 4J0QA 5D8DA 3GMDA 2WJHA 1JJVA 3KEOA 4TWRA 4IW3B 4L6IA 3LUHA 4N4OB 3SJZA 4Q39A 4BMDA 2X42A 3NNNA 4RA6A 4BNJA 4E1BA 4HX5A 4WCVA 2QE6A 2D2XA 2HY7A 5ENZA 1P6XA 5AJYA 1OB5A 2QVGA 2OWDA 3BCUA 2XLBA 3OC0A 3VGJA 2VHUA 4PIVA 5CCDA 2EZ9A 4MGEA 4CIBA 2OCDA 3LF1A 1DKOA 2DQ4A 4GR9A 4AY2A 4EM2A 3WRVA 3HN7A 4DT1B 4I6JA 5J2UB 3TVDA 1GCAA 5FLMJ 3OFND 2V7VA 3UR3C 4N9WA 5KBYA 2OGZA 1XELA 4L0MA 2X19A 5DISB 2QL6A 3IH4A 1QHHB 1DCMA 2OA4A 3ITDA 4OU0A 5FLXA 4RQUA 1DCFA 3FG9A 4ZALA 5EHXA 2RHBA 3TNJA 1NU6A 3GLHA 3BD9A 4GX5A 2N3ZA 1UDRA 2HV8A 4EJVA 4IM7A 3D4OA 5IOYA 3GZ6A 4AMGA 3RASA 2QVCA 3IAUA 2GPYA 3VPBA 5JQWA 3P2EA 2O8NA 5L6LB 4YJFB 5CLJA 4NH0A 4FIDA 3IS3A 4U2BA 4YRFA 2CLCX 3T5TA 3WTVC 3IODA 4OQEA 3UUWA 4LDNA 2ZFWA 5JSHA 5IF9A 1D4ZA 3RJPA 3SIPA 3RVJA 1XGNA 1CNFA 4N5DA 3A4IA 3SJMA 2ZKLA 2BRUA 2V6FA 2JJQA 1AV6A 3GFJA 5BOSA 2FWMX 5DEOA 4KI0A 4N01A 2XA9A 4FBMA 1GHTA 3BSWA 1Z5VA 3GJ7A 4WA8A 3HO6A 4WD3A 1KJYA 4GP9A 5KNCA 1Y81A 4KYVA 5AK5A 2P3LA 3WJ2A 2GILA 2RGNA 2IXDA 4FW9A 3LW7A 3JARA 4GI5A 3TOCA 1Y7IA 3IB3A 5AI5A 2NO4A 1WBBA 4ZQBA 1PK8A 3BCRA 1VQ7I 1V6SA 3BJZA 3RD5A 1CS0B 5BYKA 2G25A 4AJKA 5CITA 2WU3A 3HDGA 1Z13A 2BN4A 3NEAA 1SD7A 1UJNA 3SAJA 4DYRA 5H4GA 2WV7A 3AJAA 5FKOA 3SF8A 4DWJA 1EZ4A 2DYKA 2VDMB 3DBRB 4CW7A 4CLOB 1FSGA 3AHHA 3K1NA 1TZMA 2WU1A 5HKKA 1LK5A 1ZAYA 2LDUA 1LDGA 2ZIWB 4OMUA 1N3YA 3PNYA 2F2EA 3FGPA 4Y6OA 3RGGA 4F2HA 3WTUC 1BJRE 4LHZA 1Q21A 1KQOA 5CVCA 1DKQA 1J25A 3LYHA 4KYTA 1Z82A 4EY3A 3LZ6A 5FWYA 1SOUA 3GRZA 2C04A 4RMGA 2XMRA 7YASA 2DR2A 4D8XA 5EKXA 5FA8A 1YVDA 3BFXA 3N2ZB 1WXHA 3EYYA 3LCRA 1EE9A 4BQRA 3DLAA 2EZKA 1I10A 1HDZA 1WDWB 3RRYA 2Q8NA 3EEIA 3ZLUA 4CG2A 4CZZA 4UXJA 4PZCA 2VWGA 5JNTA 3WHLA 3OBIA 4LMYA 3BMNA 3QMPA 3H2HA 3ZCSA 1B2RA 1ULHA 2LV8A 4RV4A 2VTVA 2IAIA 1DZ3A 3ZH9B 3QE9Y 1LPSA 2ZRFA 3IHWA 3FXMA 3EVDA 2VO1A 1P74A 3WB2A 2H1VA 1ZN8A 4JQOA 2PYDA 4HQLA 5AW8A 2ZRLA 3D7MA 1REQB 4R2WA 4MEJA 1TU0A 1ZM7A 3L6EA 2PE5A 4A7PA 4CMKA 1CBUA 1KL7A 1W0TA 1Z6YA 4I50A 4U7GA 3ZQ4A 4ANFA 3TBFA 2VQ6A 4UATA 2L42A 2CJXA 3HL4A 4O6VA 4PCLA 1VRVA 1WJFA 2JHGA 2BP7B 3IKLA 4QXPA 2PT6A 4AIKA 1A9OA 2K7ZA 5EIWA 4KQHA 7ADHA 2QSZA 1OMIA 2IV3A 1G20B 2PBLA 2DPDA 3KLPX 3B3FA 4RORA 1GDDA 2W1OA 1C0KA 3GQBB 4C6HA 1M66A 3DCNA 4N3NA 4FASD 2AQIA 4MPRA 2W43A 5FKNA 4UDNA 5F3DA 4I0AA 1F43A 1P2FA 2AMLA 2JRTA 3ZMVA 4O3FA 3QVSA 4KPUB 4TM8A 1NPDA 2VJYA 3ZQUA 1X8KA 1V16B 3LSHA 4QU9A 1YE8A 4F46A 1V8PA 3VZBA 2XNSA 3GTQJ 3BORA 2RJ3A 4Y2RA 4KMRA 2IH5A 2WFZA 2WIKA 4D4IA 2MH9A 4L75A 1ZJYA 3MTEA 3LRXA 3U1BA 2YHSA 4LEIA 1XTKA 4RQAA 4AWXB 3DFGA 3VU8A 1E7WA 4LOHA 1KVTA 2KYRA 1VYTA 1A04A 4AROA 2VTEA 2I3BA 4CM8B 4XB6B 2ZT6A 3MD9A 1MKMA 1UPCA 5BY2A 3EA0A 4A8JB 5M2QA 4BJ6C 4EFKA 2EIJH 2VBCA 1BHQ1 3H1BA 3RCBA 2OZLB 2HJ9A 1H3FA 2VN8A 4YJKA 5BSFA 4NE7A 1USIA 1ADYA 2CLLB 4IO0A 4DIUA 2WWVD 2RG7A 1RM4A 3OJWA 5E9WA 5JJBA 3ZGYA 2NS8A 1JTFA 1GPMA 3AG2H 2D1YA 4JNCA 1H69A 3AJDA 4D1YA 3QU5A 3UT0A 1YB6A 4ZKEA 1WHTB 1KDVA 4RH3A 3QUCA 3W1VA 3V55A 3GFFA 2VPIA 5DKFA 3I04A 3R9IA 2XH8A 1P44A 3RHZA 4R69A 1JR3E 3ZPXA 3ER8A 4YFKF 4QXQA 3FR7A 1PZEA 4RUKA 3ANLA 2FUEA 4BN5A 3OCVA 4FS8A 1R00A 2E36A 1GRQA 2H2IA 1ZBDA 2Q4BA 6REQB 3HKCB 1N6NA 3LXUX 3M1CA 1KMNA 4N1AA 1RYMA 1L5NA 1Y3BE 2PX6A 5LM3A 1PCXA 2K4BA 3L1JA 4BHPA 3M33A 1WAMA 3W5AA 2JGJA 5E7JA 4AKSA 4H1UA 1C0LA 1T9KA 3W2IA 3ZQJA 4C01A 1JH8A 3IQDB 1CP3A 1LU9A 1TAGA 1NKVA 2RAPA 3LY5A 5TARA 2FI1A 3WSVA 2OILA 2HWUA 3WO0A 4Q7MB 3TVTA 5CYVA 4Q7QA 4ZAZA 4IDDA 1CX9B 2FN9A 1O5OA 1QDEA 3RYHA 4BLSA 1E3PA 3QWAA 3EC7A 1OZGA 1ZI9A 4E33A 1FXWF 3H42B 4RHTA 4WKOA 3K9GA 1I7DA 2W2MA 2O23A 5I4KA 1AMUA 3VKHA 3OQ1A 3MWMA 3GG2A 1ML3A 3QOPA 1Y1QA 2X8JA 1RYHA 4IR7A 1B6AA 3EX7C 1Z05A 4F9FA 2AF4C 5CPRB 4MV8A 2K40A 1EU1A 2Q6OA 4WERA 3DCIA 3UIEA 4BN4A 5E8RA 1ZQ9A 1L3IA 3NMUF 1H42A 1KFCB 3LX8A 4Y0AA 4DQXA 2C4TA 1BAPA 2ZRIA 1JLSA 3OOUA 3LKDA 2CSUA 1ZARA 2RB5A 2RONA 4C7OB 2M32A 2LNDA 1LY1A 1TD1A 5CVIA 1JHQA 2F8MA 1B8NA 1FSSA 2F1OA 4A3DJ 3IUQA 4RA2A 2XC7A 1TJNA 1K5PA 2WP8J 3HSEA 5GOTA 4HWGA 2WAFA 4YAJA 2AK2A 3PUKA 1ZGZA 4QDJA 4YP9A 2E1RA 2ZUUA 1SC4A 4H9GA 4KX5A 1L1FA 4NYJQ 4O2AA 4ER6A 1E0AA 4HR7A 3IIIA 2WZDA 3H19A 3KEFA 1U8TA 3KB2A 2Z1MA 1MIJA 1ISIA 3K2BA 4RZHA 3CUQB 2C2GA 5CTAA 3GCGA 2O8CB 1DAGA 2BGIA 4RBNA