4A3CJ

Rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4a3cJ00
1MH3A 1JJ6C 4RDUA 1Y1VJ 4X6AJ 3H3VK 3MKLA 4Y7NJ 4M3DA 3O8HA 4V2FA 5EGOB 4FTHA 2ECBA 2NVTJ 2IEKA 3L1PA 5GP9A 2DMTA 5C4XJ 1GUUA 4D5CA 5M5XJ 1AKHA 5C44J 1H8AC 3CMYA 5K7ZA 5EG0A 2YUSA 3A01B 1MBJA 1APLC 1ZK8A 4RBOA 2R93J 1GDTA 3FISA 3TP0A 2TRTA 3GTJJ 3DEWA 3G1OA 1W0UA 2R5YB 1QVUA 4FISA 4AC0A 3S16J 3TW6A 4QIWN 1IGNA 4Y52J 2L0KA 1MNMC 5F08A 4XIDA 3HOUJ 1NTCA 4A3FJ 1ZQ3P 2IAIA 1I6HJ 1PUFB 2R0QC 2NVYJ 2PMZN 2DA7A 1BW5A 1POGA 1U9NA 2VI6A 1QRYA 2HOSA 2DA5A 2XGCA 2DA1A 1HOMA 5FJ8J 4XRSG 2B63J 2Y9ZA 2W48A 3Q0VA 1HCRA 4MLOA 2LFBA 4A3GJ 3FK6A 2DA2A 1FTZA 4JP0A 5FKMA 4A3IJ 1JUSA 3A02A 4BBSJ 2X9DA 2CU7A 4BBRJ 1ZR4A 2H8RA 1HLVA 3IH3A 1TC3C 2E1OA 5EG0B 4W97A 2NOGA 1I50J 3UKGA 1ZTRA 1BL0A 2XRLA 3S2DJ 2WAQN 2IBDA 4JX5A 2KT0A 2O9LA 5IPAA 1ZGWA 5IP7J 3JRAA 3CDLA 5E3LA 1ITYA 2QF7A 2MG4A 2AO9A 1K61A 1O4XA 3FIWA 3BT9A 4JYKA 1TWAJ 4D5FA 2YS9A 2JJ7A 1IDYA 1OJLA 1IRZA 1TWCJ 3PO2J 4XICA 4JX6A 2OF7A 1ETXA 1ORKA 2E19A 1RPWA 1A5JA 2DA6A 2ME0A 3OSGA 1AKHB 4LOCA 2K40A 1H89C 2CUFA 2WB1N 2VUMJ 2GLOA 2XPWA 3Q3SA 1IJWC 3I4NJ 1VNDA 4FE7A 3D1NI 1JKQC 2R5YA 2LTPA 4FCYA 2G0EA 1FTTA 1U9OA 3TW7A 2FD5A 3SDGA 5IYDJ 2LD5A 4C3IJ 5F27A 3JRDA 9ANTA 4QSHA 1VF9A 1CQTA 1D5YA 3S1MJ 3BTJA 3WHCA 3JREA 5M3MJ 1QPIA 1MBFA 1RKTA 1ZKGA 1WCMJ 1IC8A 1E3OC 5EF6A 2EZLA 5FKOA 1BW6A 3HKZN 4XRSA 3S1NJ 3RQIA 4IEJA 4GFBA 2Y9YA 2M2EA 1JKRC 3GTGJ 1B8IA 1ENHA 5M5WJ 4DW6A 5J1UA 3BTIA 4MFEA 2NVQJ 3M4OJ 4IHXA 1F43A 1Z77A 5F0HA 4CYCA 1HDDC 1NK3P 3TEDA 2AHQA 2EZKA 1B72A 2DTZA 3LNQA 1QVTA 3BR3A 1XC5A 2JK3A 2M8GX 3E7LA 1G2HA 1YRNA 2ID6A 5JLXA 2ZB9A 1DU6A 4C3HJ 2EZHA 4S0HB 5F0FA 5EDNA 2MSYA 4A3DJ 2E2HJ 3TP3A 2MW8A 3S1RJ 5IOZA 2TCTA 5EYRA 1GV5A 2ID3A 3H0GJ 4ABZA 5M3FJ 2JA7J 1IDZA 1T56A 2XSDC 2FQ4A 4B4CA 5IYCJ 2R92J 3FK7A 1ETKA 1X58A 1IV6A 4QTRA 4BY1J 3RZDJ 2M9HA 5F04A 4BKXA 1OFCX 1FJLA 3HBLA 4L5EA 1GT0C 3GTLJ 1UG2A 3OIOA 4A3KJ 4HNVA 1MBEA 2DMQA 2JA6J 2HXOA 1FIAA 3JRIA 4AUXA 1OCTC 2NS7A 3JRCA 3ZQLA 1AU7A 2VKVA 5EZHA 1B8IB 4FE4A 3A03A 1JKPC 2DA3A 2DMPA 2M0CA 2CRGA 2DMUA 3WHBA 5FKLA 2DN0A 5FKNA 4CYCB 2XPVA 5E3NA 1B72B 4C3JJ 3QPSA 3JRBA 5C3EJ 1W0TA 5FLMJ 3MN2A 5GPCA 1RESA 3RKQA 3LSGA 3MVPA 3BQYA 1YRNB 1TWHJ 3Q0UA 4DYQA 5J1YA 4IHYA 2LP0A 4MO7A 2K9NA 4DZPA 1WH5A 1MBGA 4EEFG 1UHSA 2ME6A 2L7ZA 4J19A 2FJ1A 2EQRA 2CJJA 3LOCA 4DYRA 2HI3A 5F1JA 3CCYA 3HGGA 2KDZA 2E2JJ 3BR6A 2X48A 2D5VA 1ETQA 3B6AA 3BTCA 1P7IA 3GTKJ 5FLVA 1ZR2A 1JUPA 3BR1A 4M3EA 5GPAA 3JRFA 4M3GA 2K9QA 5E3MA 4IHVA 3ZQIA 1ETOA 3IH4A 5DTDA 4BXXJ 1UMQA 3S14J 2ECCA 5K7FA 3I4MJ 2FX0A 2XB0X 1WH7A 5EZGA 1ETYA 2HOAA 1X2MA 2M34A 3SFIA 1F36A 3HOWJ 2CUEA 3HEFA 4UUSA 4NDLA 1JKOC 2HDDA 4A93J 5F0CA 1U8BA 4G12A 1VI0A 2LK2A 1OCPA 2WV1A 2DA4A 1GVDA 1Y1WJ 3OOUA 4X1EA 2XPUA 2LY9A 1JGGA 1TWGJ 3JR9A 3SJMA 1MBKA 4A3CJ 4M3FA 4M6VA 3LSRA 3PM1A 1FEXA 2VKEA 3GTOJ 2L7FP 4A3LJ 4B1RA 4XRMA 2DJNA 2JMWA 3HB9A 4W1UA 3HGYA 1SFOJ 3F0CA 3IH2A 1A6IA 2LR8A 4C2MJ 3Q0WA 1RKWA 3ZOBA 2R5ZA 2LKXA 2HOTA 2R7ZJ 2I10A 2VPRA 4I76A 3HM5A 2Y30A 2P81A 4B3AA 5IYBJ 1P7JA 4DZJA 3DCFA 3QQAA 1S7EA 5K7HA 4A3JJ 5FKKA 2HYJA 3C2BA 3GTQJ 1U78A 3BG5A 3S1QJ 3BQZA 2LVSA 2K9SA 3VPRA 4MIMA 1EF4A 4UUSB 2N8GA 1K83J 3BR5A 4UUTA 4A3EJ 3RZOJ 1LFUP 2LLKA 1IUFA 2Y2ZA 1RETA 2L7MP 3B6CA 5C4JJ 3FKIJ 3HDDA 5HODA 2XB5A 1JTYA 2HQ5A 3ZQFA 1LE8B 1H88C 2EH3A 2CQQA 5JLWA 3G1MA 4A3BJ 4MFDA 1HDPA 2JWTA 2E2IJ 1XG1A 3NARA 2JA5J 3NAUA 3HOYJ 3CQZJ 1HF0A 1JT0A 1LFBA 2ELKA 5DS9A 3BG9A 1JJ8C 1RR7A 4D7MA 5IOYA 1VFCA 5E3OA 1NK2P 3PO3J 2O8KA 2R5ZB 4IHWA 3HOVJ 1TWFJ 4JX4A 4I6ZA 1WI3A 2HXIA 2RAEA 1FIPA 2DMNA 3JRGA 2EZIA 3BR2A 1BJZA 3GBGA 1MBHA 4V2GA 2Y0SN 1ETVA 2QCOA 4D7NA 5J1RA 1Z0XA 3BG3A 2JN6A 1MSFC 2Y31A 1SANA 4XK4A 3M3YJ 2CQXA 3O8GA 5IP9J 1I3QJ 4DYCA 1XS9A 3ZQHA 1DU0A 3K7AJ 1BA5A 5IP6A 2GM4A 1MH4A 3K2AA 5EGOA 3GTMJ 3JRHA 3OSFA 2GBYA 3BR0A 5M5YJ 1R9TJ 1ETWA 5EEAA 1JTXA 3QPLA 2X6OA 2XGEA 3IV5A 2JA8J 3A01A 1JUMA 1X2NA 3S15J 3G1LA 2NVXJ 5BNGA 3ZQGA 4A3MJ 1GV2A 2OPTA 2COBA 4BY7J 3W6VA 1Q1VA 3ZQCA 3GTPJ 1WPKA 3BTLA 3S17J 1AHDP 3S2HJ 3HOZJ 1WGXA 1MSEC 3LSPA 3LSJA 2XGDA 2YU9J 2O7OA 1JT6A 4M3BA 2H1KA 4AYBN 4A69C 2MGQA 1LE8A 3HOXJ 2L9RA 1PUFA 1IG7A 2EBIA 1T33A 2NS8A 5J3LA
chains in the Genus database with same CATH superfamily
1MH3A 5HS7A 4X6AJ 3GMEA 4I0AA 2NOJB 3H3VK 1H0MA 3MKLA 3WODF 3O8HA 2DK5A 2GA1A 5J47A 2KRHA 2Z2SB 1ZH5A 1IN5A 1YE9A 4ESFA 3KP6A 2NVTJ 3L2QA 1G3YA 1YIOA 2L2OA 4AM3A 5DD8A 1ZHFA 1I3AA 4YEJA 5C44J 3FHNA 1H8AC 3MCZA 2HFHA 4BE2A 2YUSA 3A01B 1PDNC 1MBJA 1T38A 4AIDA 4RAGA 1J5YA 3GYHX 3KIOA 3H0DA 1RR8C 3DWLE 1ZK8A 1APLC 1A31A 3DEWA 5FD5A 2OA4A 4P96A 3LSMA 3MD2A 1CF7A 4KT6A 2CW7A 1QVUA 1Z7LA 4PUSA 4FISA 3A2KA 2OTJI 2E60A 2FSWA 3D5SC 3RJPA 4PSXA 3GFIA 2VODA 2NNYA 1LB2A 3F8BA 3V7RA 3V7CA 3RTRA 3ZGKA 2RNJA 3DLAA 1WFXA 2OTLI 1I6HJ 1PUFB 3HG9A 2HS5A 5FROA 5E18F 4YRVA 1NH3A 1JXSA 1U9NA 1SFUA 3ULQB 1KGSA 1DPUA 1VZ0A 1ZN2A 2F2EA 2DA1A 1SD7A 1Z1DA 2P4WA 1DDNA 3CCUI 2R7QA 1VQPI 4MLOA 2QLZA 5DUKA 1T8IA 2MD5A 1SMTA 2RNGA 3JAMK 2VQCA 4BBSJ 2HR3A 4BBRJ 5FRNA 1F9NA 3BZCA 2XROA 3LA3A 2XC7A 3BY6A 1ZTRA 1BL0A 2WAQN 3R61A 2IBDA 4JX5A 1UHWA 3QWLA 4PCQA 4ZYGA 5LGTA 1Q1HA 2ZC2A 1ZGWA 2JPCA 4D1QA 2WWYA 3JRAA 1ITYA 1R4MB 1IN7A 2QVOA 3ELKA 1VTNC 2MG4A 1HW2A 2OQGA 4CICA 5EEGA 5D5XB 2YS9A 5D5VB 2JJ7A 3ECHA 1OJLA 1IRZA 4RM3A 4ZYDA 3JCUC 5JHFA 4XICA 5BPIA 2LNBA 3EQLF 3E6BA 1XGOA 1ETXA 2E19A 1QHGA 3C18A 4RAYA 4Q5SF 1WZ2A 3I55I 5GAGJ 3OSGA 2ME0A 3ABUA 2LY2A 1IO2A 3ZN0A 1FBQA 4FE7A 1WQ2A 4XOPA 2R5YA 2LTPA 4FCYA 1PP8F 2BY1A 2G0EA 2IJLA 4XKVA 3LFKA 4BNCA 1R5ID 1G59A 1IV8A 2KHMA 2QQ8A 5ED4A 2RKHA 4L0ZB 3ML6A 2LD5A 2VQLA 2DJIA 2EILH 4BDYA 5BPDA 2IA1A 2D1VA 3OIQA 4KN7X 2ISZA 3WTXC 3CDIA 3OYEA 1BR2A 4G7ZF 4QSHA 3RCOA 1VF9A 4LG0A 4DNCA 1B6AA 3OYAA 1F5TA 1TQMA 2E1MB 3H36A 4G8XA 5L3BA 1K78A 3BTJA 2C6YA 3WHCA 3I5UA 2PI0A 3GUDA 1P4AA 5HDKA 3OYKA 1MBFA 1ZKGA 1QPIA 5L3DA 4BJ5C 1WCMJ 1UELB 2KQRA 5BS6A 5FO5A 2EZLA 4BJ6C 4AIKA 1A36A 2WAFA 2Y48A 1W7PA 3H92A 2Y75A 5F6FA 3S1NJ 2ZXHA 3RQIA 3MMYB 5AIQA 1FX7A 3TKYA 3J80K 4F52A 4MTDA 1EKEA 2V1NA 4DW6A 1KQ8A 5J1UA 4MFEA 4N4OB 3T8RA 3JSPA 1OQYA 5LGNA 4IHXA 2GQQA 1F43A 3DEEA 5F0HA 2COMA 3W6KB 1HW1A 3OS0A 4Y3OA 2AHQA 5LBQA 3TEDA 3ERMA 1UFMA 4LLGF 2B9SA 2JK3A 1X1DA 1G2HA 1YS7A 3O3KA 3K4NA 1DU6A 3CC4I 1KA8A 4S0HB 4A5NA 1U5TA 2W00A 3WTYC 2VC0A 2TCTA 5EYRA 1GV5A 3K4MA 3OYJA 2V9KA 4U88A 2F5FA 3LMMA 4RAZA 3RPUD 2VE9A 3MFKA 3IHUA 5GADJ 1MMAA 5HNFA 1K4TA 2F4OB 4N0BA 2FQ4A 2KP6A 3K4LA 2CV0A 3FK7A 3UNGC 4QTRA 1VQ7I 3RZDJ 3V8LA 5F04A 3CESA 2QQ9A 4ZYHA 5HS9A 1YI2I 1FJLA 3MEXA 1BI2A 1D3YA 2H1LA 5CQEA 3PUBA 2R7TA 2JA6J 4KIGA 1XD7A 1MIJA 1LDJA 2RDPA 3TO7A 5FB2A 4OMZA 5LGUA 3JRCA 3ZQLA 1OCTC 2IS6A 1YQAA 3OYGA 5EZHA 3IKVA 1MNEA 1R23A 2DA3A 2DMPA 2M0CA 2CRGA 1KONA 2DMUA 4IHSA 3S93A 3C2HA 3I59B 2FEZA 2DK8A 1T95A 1YOVB 5ICEA 2XPVA 1DP7P 2DI3A 2WTEA 2OCCH 3WTZA 4P5OA 2FBHA 4KA4A 1Z21A 3F23A 1I6XA 1MKMA 3LSGA 2VONA 2EA4A 2PBIA 3BQYA 2DODA 3V7SA 5GTIC 1TWHJ 4XLHA 5J1YA 4IHYA 1B9NA 2LBFB 2K9NA 1YJWI 5D6FA 2HQRA 1MBGA 3FZVA 5L3GA 3GX4X 4G7HF 2F5EA 3H1CA 2UV1A 3LOCA 3CCYA 4HDVA 4HEA2 3FF5A 3BR6A 2X48A 1V5EA 2D5VA 4BXFA 2O0YA 3X2QH 2DDBA 1O3QA 3V8KA 3B6AA 2VBXA 2DFFA 3DBRB 3GTKJ 2LY1A 5FLVA 2HVRA 2XAUA 5GPAA 2EFQA 4XMYA 4M3GA 5E3MA 2BOLA 4G6TB 5DTDA 3ZMTA 3C7JA 2CFOA 2ECCA 2XVCA 3OYMA 3P9IA 5K7FA 2FX0A 1AWCA 3I4MJ 5EZGA 1ETYA 1I39A 2HOAA 1X2MA 4J00A 3CCQI 4BXUA 4M72A 3HOWJ 3DTKA 2L9SA 1U8RA 2FUG2 3J7AO 4A93J 1A35A 5F0CA 1O3TA 4HLXA 1EJ9A 1IN6A 1IRXA 1OCPA 3SZPA 3GZ5A 2BV6A 4B3XA 3PNTA 1Y8QB 1F1ZA 3F8NA 1Y1WJ 3OOUA 3RSNA 4X1EA 5LHHA 4IHTA 1KU2A 4NQWB 3K4CA 4ZDLA 2L7KA 5ILVA 3SJMA 1YO5C 2BVLA 2VJ5A 4A6DA 3PM1A 1YX3A 5CVRA 3IP4B 2ZMEA 1J7KA 2MC3A 2W25A 2L01A 4MGRA 2DJNA 3FKJA 2JMWA 3HB9A 5D5UB 1SFOJ 4YFXF 1RNLA 2E1NA 1RKWA 3QYEA 3ZOBA 2OV7A 5ILUA 1Z3YA 4PJNA 4GRIA 3HM5A 1W5CC 3NQOA 3OS2A 1VQOI 5DM7F 4B3AA 5CVJA 2ZFUA 4K2EA 3QQAA 1ZYRF 1E2XA 5FKKA 1V5GA 2BW3B 1RRJA 3QU6A 2FNAA 4CCKA 2DOFA 4OAYA 3DEUA 3CP2A 1D0ZA 5FD6A 4LJZF 2VPLA 3CZ6A 1EF4A 2N8GA 1LVAA 4UUTA 2DLLA 2LLKA 2WADA 3B6CA 3I9V2 2MLGA 3HZJA 1UZCA 2BY3A 2R7OA 4EGZA 4E7LA 2OCEA 2M30A 4XNFA 2PEXA 3VDXA 2LC2A 2XB5A 1HXDA 2A5YB 3ZQFA 4PK4A 4FX0A 3KEYA 4E7SA 1LE8B 2BY0A 3Q5FA 4CCLA 5FLXZ 2EH3A 3G1MA 1MJAA 1LUJB 1DGWY 3AAFA 2GXGA 2JA2A 4YIIA 2E2IJ 2VJJA 4MTEA 3JTHA 2PJPA 2L3DA 4CUGA 2JA5J 3HOYJ 1JT0A 6PAXA 1FOKA 1QQIA 5D8KB 1R71A 5DS9A 1RR7A 4AWXB 1KU7A 2K3PA 5E1ZB 3K70C 5IOYA 1VFCA 5E3OA 1T98A 3PO3J 2EFNA 2GXAA 1BI3A 3GFJA 1TTYA 3ROUA 2W1OA 3HRSA 4I6ZA 3JRGA 1QPMA 1BJZA 4XLPF 2M45A 3GBGA 1RC9A 4V2GA 2M5WA 4XLNF 1JHHA 2QCOA 5H6QA 3VWBA 3R0AA 4RB1A 2FMYA 1I1SA 2WB1A 1MSFC 2Y31A 5CVIA 2ZBKA 2LKSA 1S7AA 2J5OA 1BOAA 4M9XA 2MLKA 3O8GA 2OD5A 4QPOA 5IP9J 1I3QJ 1G3WA 2BY2A 3E5UA 3K7AJ 1LJ9A 2DCEA 3HUGB 4BHPA 4FQGA 4BDZA 2GM4A 4V19K 1P4WA 4KIFA 2GIVA 5JR3A 2CS3A 1VQNI 1S8NA 3OSFA 2GBYA 3BR0A 4PZJA 3ZMDA 3HOSA 4CCNA 2XKOA 4A0ZA 3S3MA 4ENJA 3BG7A 3BLYA 2VJIA 4EJVA 4IKFA 1X1AA 4M9ZA 3E1SA 3A01A 5J6XA 3S15J 1U6GA 3G1LA 1TQPA 2QENA 3ZQGA 3RKXA 4LD5A 2XIGA 1G6NA 1Q1VA 3PL8A 1QZEA 1WPKA 4CO8A 1AHDP 3CDHA 3H3ZA 3S2HJ 3HOZJ 1WGXA 3LSPA 3LSJA 2NNNA 1YJ9I 2XRNA 5HLTA 3WG7H 1FYMA 3V42A 2H1KA 4HX8A 2DBBA 3TO6A 3HOXJ 1F4KA 2L9RA 1PUFA 3JAMZ 2UXXA 1WJFA 2X4HA 2JPBA 3KP5A 3CCJI 1JJ6C 2VT2A 1Y1VJ 1UB9A 5E8GA 5DDGA 3ABMH 3PIOF 4XONA 3QRFF 2XASA 3RQ4A 4FASD 1X3ZB 1S9HA 4WXDA 4OOIA 2KDOA 3SFZA 3L1PA 1I1GA 5GP9A 2RQPA 1GUUA 2CSOA 4D5CA 3RPQA 4BUPA 3ZCOA 1HKTA 1R36A 2DYRH 3CMYA 3FMRA 4Q48A 5EJCA 5K7ZA 2V26A 3E6CC 3ZPLA 3MZYA 5DCFA 1ZAOA 1IXCA 2R93J 4RM2A 1GDTA 3GTJJ 2TRTA 3WE2A 1MDMA 3J7AY 3IUOA 1OYYA 4AC0A 4PDKA 5DD4A 1IGNA 2ISYA 2ZXWH 3EUHA 1MNMC 3G2BA 3HRMA 1FYLA 3CMAI 4EM1A 4KFCA 3KFWX 5IT9K 1FMWA 3BCBA 3F8CA 1BIAA 5LRSA 2D1HA 1YG2A 3K69A 2HNHA 2F4MB 4ON0A 5F1RA 2OQRA 2HKXA 1FSHA 1QRYA 2H6BA 3FXKA 3HC7A 4KN4X 1YYVA 2XGCA 1HOMA 4Z2YA 4XRSG 2XAQA 4ESBA 2ELJA 2XKPA 1D1BA 1G3SA 4EGYA 1HCRA 3G71I 2DPDA 5K5QA 4RMNA 1IF1A 2V1DA 3HTSB 1OISA 2EINH 3HXLA 5AONA 5FKMA 1JUSA 2NS0A 2HPMA 2X9DA 2CU7A 4PSWA 4DQ2A 2VQHA 3CMMA 4ENNA 2PJRB 4W97A 3UKGA 2FRHA 5K5RA 3DPUA 4MQ9F 3J80Z 1RZ4A 4N4NB 3KZYA 4UV8A 1K7AA 3BOQA 5IPAA 5IP7J 1BR4A 3RPUA 1N25A 3CDLA 1E3PA 3NWSA 2JRMA 2CW0F 3K9TA 3S3NA 2AO9A 2KIMA 3JW4A 4BQNA 3BT9A 4DIQA 2BE5F 2CQKA 3WG9A 4TV7A 1RI7A 3FX3A 2F5CA 1QGPA 1TWCJ 3PO2J 1VQ4I 2O61A 3H3UA 4BJTA 3J81K 2KRFA 1RPWA 2GOXB 1A5JA 4IVNA 1WVRA 3VYUB 4KYWA 1HBXG 3KLOA 2WB1N 1IRFA 1P2FA 2VQGA 3FXMA 4U87A 1FY7A 1W1WE 2KL4A 2GLOA 4C9YA 2IGNA 3Q3SA 1RUNA 1SVLA 3I4NJ 3H5AA 1JKQC 2BVMA 5ICFA 5BQTA 2DQRA 4BHCA 4HX4A 1ON2A 3QAHA 1FTTA 3R6SA 1ZRCA 4AVPA 1OYIA 2HTSA 1U9OA 1S5LC 5KK1A 1V55H 3SDGA 1OCZH 2BHZA 3L09A 1X1CA 5GAEJ 5KHDA 3F21A 2QKMB 4BQOA 5E1XA 1BOBA 2DDAA 3JRDA 3WTVC 1HC8A 1T08B 4RA2A 1Y8RB 3AG4H 2CYYA 3OV8A 2OZ6A 3LAPA 1K6OA 1V4RA 3HIFA 2ZXJA 3P5JA 5CKTA 2P6SA 5AIPA 2IGMA 1V3FA 3OL4A 3CCEI 1BW6A 3H5NA 3EYYA 2W57A 2H6CA 3L00A 4D9JA 4IEJA 3FHZA 3KYDB 2M2EA 3AG1H 5DM6F 4MQVA 3GTGJ 1TQIA 5M5WJ 2CV2A 1PYVA 4XBFA 4AVZA 3SYTA 3M4OJ 3I59A 1REPC 1Z6TA 3UR3C 4E7HA 1O3SA 2EZKA 2DTZA 1ZRDA 3VSKA 1XC5A 1R6RA 1ZLJA 3G3ZA 1X4PA 4I0BA 4LIUA 2M8GX 2PLYA 2R7UA 2CQNA 2W82A 2ID6A 3DPLC 5JFRA 3WU1B 4C3HJ 2I5UA 5F0FA 5E17F 2E2HJ 1XGMA 2L4MA 1Z6RA 1E17A 2ZJQF 1UHMA 2ID3A 3H0GJ 4ABZA 1SC7A 1IDZA 2MFZA 4F92B 1T56A 2D2WA 4BL0B 2F5DA 1H9TA 3SDBA 1SFXA 4CCOA 4JOMA 1Y56A 1B9MA 1IV6A 2YX4A 4BY1J 2LG4A 2M9HA 4IF4A 4BKXA 1OFCX 2M7BA 4L5EA 1ZRFA 4HQEA 3NRVA 4CCJA 3GTLJ 1HA8A 1UG2A 2D45A 3OIOA 4A3KJ 4HNVA 2ESNA 2VKHA 1MBEA 2DMQA 2EB7A 2EFWA 3L2UA 1FIAA 3JRIA 3C1DA 2ZXIA 2OZUA 1BIBA 4O3MA 5LEJA 2I8DA 2IGOA 3IAS2 3H35A 1JKPC 1KQ9A 4P9FA 1R00A 1XB4A 3W2WA 3WHBA 2DN0A 5FKNA 4CYCB 3OYBA 2E36A 2RN7A 1QBJA 4LG3A 1B72B 4C3JJ 3COAC 4GO1A 3GEZA 1GXPA 2FOWA 1W0TA 3N4MA 4HG2A 4YELA 1RESA 4KIBA 3RKQA 1R5GA 3MVPA 3D5LA 1YRNB 3Q0UA 4NHJA 1TL8A 4C2TA 4UB8C 4MO7A 1XN7A 3ASOH 4NQWA 1WH5A 4L9NA 3V8JA 3DV8A 1LNWA 4EEFG 1UHSA 2ME6A 3WTSC 2ZJPF 2RC4A 1EA3A 1XDSA 2CJJA 2CO5A 4BS9A 1KQ0A 5FRMA 5LEKA 4HBLA 4BEHA 1QO0D 2Z16A 1WJCA 1FP1D 2MH2A 4LK0F 3GFMA 1J9IA 1BR1A 2Q2EB 4PJLA 3EETA 1P7IA 3CUQC 3CMEI 1WJ5A 2ACJA 4M3EA 4CYDA 2ZKZA 4ZYEA 3A0BC 2DU9A 1OR7A 2K9QA 3PNYA 3OIPA 2QGUA 4IXAA 1VQ9I 5B1AH 1UMQA 3LWFA 4IRGA 5D8LB 2QSFX 3DQVC 1WH7A 2BW3A 5K5OA 3CC7I 2M34A 2XAFA 3SFIA 1F36A 3WE3A 3MKZA 3OS1A 3DBHB 1JKOC 3RKWA 2EFOA 4XSZF 1C0WA 3E5XA 1I5ZA 1U8BA 4L5JA 1VI0A 2LK2A 4HV5A 2WV1A 3I56I 1ERDA 4ZDPA 2O6GE 2CQ7A 3BP8A 5HDGA 3F3XA 4XLEA 2LY9A 5LHGA 3LAJA 2HYGD 1MBKA 3LSIA 1R5HA 5HLIA 3GLXA 2Y0MA 3GTOJ 3T5XA 2L7FP 1S29A 3PUFA 3VFZA 4XRMA 1MZBA 1XMAA 2JQ7A 3BPVA 2V9PA 2W7NA 2FMLA 2L5QA 3HGYA 4XN3A 3F0CA 3IH2A 5E1WA 1OMIA 3S2WA 2M7AA 1FWZA 3Q0WA 4C2MJ 4UVBA 2HOTA 2R7XA 4LIVA 2JUCA 2M8EA 2JUGA 2VPRA 4RLFA 4I76A 1LQ1A 2PMZA 1P7JA 2VXZA 3M07A 1TT5B 3F6VA 4Q4ZF 1S7EA 4YG2F 2RVCA 2HYJA 2Z1DA 3BQZA 4ZC3A 3DKYA 4XR6A 1IW7F 4E7IA 3VPRA 4QPQA 3C2GA 2K3FA 4UUSB 4CDGA 2V1UA 5E79C 1K83J 4A3EJ 2EIKH 1MJ9A 1LFUP 5HOOA 1W36D 1DQUA 4BU2A 1RETA 2ADUA 4RB3C 4CGZA 5LFAA 4LLLA 3VYTB 3HDDA 3QPTA 3W6JB 4A6EA 5HODA 4EJTA 2YU3A 4GDFA 1KYWA 1RIOH 3CCRI 3RI4A 5JLWA 2HQNA 2VOPA 2OJED 4MEYF 3GW2A 1WWXA 1XG1A 3KZIC 2MA3A 2PFBA 2QKLB 1LFBA 2ELKA 1O3RA 1JJ8C 5HDNA 3WTWC 2CG4A 3VEPA 3VSLA 1WJDA 2VOOA 3DBLB 2STWA 2AXLA 4IHWA 1WJAA 1WKMA 1Y6IA 3L2RA 2P7VB 3P7NA 2DMNA 1GHCA 2EZIA 2ZCWA 4I2OA 1MBHA 2UZKA 3RDIA 4E7JA 3KEQA 3U1KA 1P6RA 2QUFA 4PJ0C 1S7OA 4M6YA 2UUZA 4F7ZA 2R7FA 1SANA 2L9NA 1OLTA 1ZGJA 5HLHA 2B0LA 1BA5A 3EPZA 2L02A 2Q1ZB 4GGGA 1MH4A 2W85A 1X3UA 5J8FA 3GTMJ 4QLCU 2LF7A 5M5YJ 1T2KA 3MQ0A 4KMUX 2GA2A 1R9TJ 3Q9SA 5ICGA 3L2WA 5DCMA 1FOWA 1YW7A 3EUKL 2XGEA 3KPHA 3IV5A 3CJTB 2JA8J 5IY5H 1JUMA 4P1WA 3IKTA 4H4KC 4L9JA 2AQEA 3QYBA 1TBXA 4ZYAA 4A3MJ 2K86A 3OR1C 2COBA 4LFUA 2DXIA 5IT9Z 2A3SA 3U1DA 3DU5A 3D0SA 3CCMI 3K1PA 3HKZA 1EV7A 1MSEC 2X1DA 4ASNA 2XGDA 2Y69H 3HPGA 2LH9A 2IS4A 1XSDA 3DKXA 1PVEA 2EK5A 2OBPA 3H9QA 4WCGA 2MGQA 1YHQI 4G7OF 2XDVA 1X1BA 1JGSA 2ZJ2A 1K79A 1IG7A 1TNTA 4AD9A 2K4BA 5H2FC 2M1BA 1T33A 3CTAA 2VB6A 4B43A 1QHHD 3FBNB 2M4GA 4M73A 2F5VA 1AOYA 3RKYA 1Z67A 2MD0A 5D6EA 1LKXA 1N75A 1MW7A 3OYDA 4Y4RA 2PG4A 2XAHA 3W2AA 4FTHA 3REOA 2E71A 1SFEA 2IXSA 3RYRA 4PGHA 4ZTJA 2DT7B 4RGUA 4RB2C 2DMTA 5C4XJ 5M5XJ 1AKHA 1FLIA 1BC8C 1R1TA 2QM3A 2PJRA 4II2A 5GAHJ 1ZG1A 1NG6A 3J81Z 4RBOA 3FISA 3TP0A 2P5VA 3HSRA 2XF6A 5B66C 3G1OA 2RV8A 4R79A 4UY8I 2CGPA 3PSIA 2E7XA 1SAUA 3OYNA 3GF2A 3Q9VA 4AIJA 1X4OA 2R5YB 3S16J 2X6XA 3TW6A 2J5PA 2ETHA 2K4JA 2QWWA 2Z33A 4Y52J 3A4CA 4F3QA 2L4AA 5F08A 1W5SA 1NTCA 1A6QA 3VB2A 2CWEA 3OYCA 4DBRA 4E4HA 2NVYJ 2MABA 2DTRA 2PMZN 5JHUA 1MMDA 2DA7A 1SVOA 1POGA 2X1EA 1ZARA 2VI6A 1IZ1A 1K78B 2KZGA 2DA5A 4RB0A 1R4NB 5H20A 2BEOA 5FJ8J 3IWZA 3TGNA 2EPFA 2B63J 2W48A 4GXOA 4CZCA 3Q0VA 1ZGAA 2LFBA 2DAOA 2FQ3A 3MKYB 1ZG5A 3FK6A 1W7PB 2DA2A 4JP0A 2DPUA 4A3IJ 5CYVA 2IA2A 2HVSA 4IRIA 2HTJA 2K7LA 2ZNZA 3IH3A 4CCMA 2E1OA 5EG0B 2M0MA 1SAXA 1I50J 2LREA 2XRLA 3GXOA 3S2DJ 1T0FC 4PJJA 5J4YA 4ENKA 4HLYA 2LOOA 3NEUA 2DO7A 1OYWA 3BJ6A 1YITI 1Y39A 1ZELA 1K61A 2K9LA 1O4XA 3M8EA 1ZLKA 1USTA 2HKOA 4LGWA 1P92A 2IW5A 2M87A 4G9YA 2LDUA 3LQRA 3ZP5A 4KDPA 3ISPA 1OCCH 5D4SA 1ORKA 2PN6A 3IRRA 2FE3A 3V4GA 5TGTA 2K40A 3AKZA 3I71A 1J59A 3TDUC 3CJQB 2LMDA 1J09A 1D8KA 4XRFA 1XCBA 2V1XA 1JI8A 3C3WA 2JZYA 2R4GA 4UB6C 2JVHA 1D1CA 1W4MA 4HOBA 4II3A 2HWVA 1IJWC 4MHGA 1VNDA 2XF5A 3D1NI 4N9HA 2JVGA 1FZPB 4CZZA 1S6LA 5E8IA 4OIPF 4J01A 3LSKA 2VXDA 1XMXA 3PFIA 3FDYA 1OCOH 2FD5A 2X1CA 1Y0UA 5IYDJ 2EV6A 2E7WA 1QNTA 3GO5A 4C3IJ 4KT5C 5HVQC 5F27A 3ZMVA 4HSRA 1YIJI 4OU0A 2KJBA 2V79A 4QWQA 1CQTA 4NUBA 1D5YA 3S1MJ 3QODA 3JREA 1B4AA 5M3MJ 2E1CA 1RKTA 1WJEA 3OOPA 1HQCA 4HQMA 3E97A 5EF6A 2IP2A 3DU6A 3HKZN 4XRSA 2HEOA 4L0YB 2CH0A 1AA7A 4GFBA 3PJRA 1OCRH 4GCVA 2QSHX 4NC8A 1JKRC 1ENHA 1E3HA 4S05A 3BTIA 1FT9A 1FBUA 2HQAA 3WGIA 1YTYA 4NC6A 5CPRB 4CYCA 1HDDC 1NK3P 3BG6A 3FXUA 2HPIA 1B72A 3LNQA 1QU3A 3BR3A 4U0VA 4UHTA 1UAAA 3VOEA 3E7LA 3QP6A 1VQ5I 1YRNA 2VN2A 4IZZA 5JLXA 2ZB9A 5EDNA 2EWNA 2MSYA 3F72A 4A5MA 3SZGA 4OAZA 3HSFA 3TP3A 3S1RJ 5IOZA 3J7ZI 2EA2A 2BXYA 1IXSB 3JTGA 2YSRA 5L3CA 1B59A 5ILSA 3DF8A 4IOCF 2IS1A 1R1UA 2XSDC 2DYSH 3BWGA 4B4CA 3WGGA 5IYCJ 3P9KA 3FXLA 4IX7A 4IL6C 1Z7UA 3M1EA 1UJ8A 1ZREA 2Q2EA 2GIZA 3D5RC 3HBLA 4EM2A 2DFHA 1GT0C 3K1MA 3RYPA 4EJWA 4L9TA 3KYCB 1FMVA 3AL0C 3G73A 2HXOA 1Y0NA 3LL7A 4AUXA 3HRTA 5J8CA 5LLQA 5LHIA 4EATA 2VKVA 1B8IB 4EJUA 4FE4A 3ZMZA 3A03A 3P9CA 4N9IA 2V6EA 3U9GA 5FKLA 4YIFA 4AIHA 4HA8A 2H8WA 2HVQA 5GTHC 4WX9A 3BDDA 2RGVA 1R22A 3QPSA 3CUQB 2XV4S 2NYXA 4O6JA 2P0WA 3SQNA 2CV1A 3WTTC 3HHGA 1U2WA 4XORA 1G3TA 1N78A 3E5QA 4M74A 4B8XA 3R60A 4A12A 4DYQA 2IPQX 3CF5F 4M71A 2L7ZA 2R7DA 3O6BB 4IQ4A 4J19A 2UWMA 1BI1A 4B47A 4DYRA 4UV9A 2E2JJ 1MD0A 3LA2A 3OMYA 3JSOA 2KLOA 4HX7A 2PX9A 2KZVA 4LK1F 4EM0B 2EV5A 3BTCA 2XHKA 4XSXF 4IRHA 3L2CA 1ZR2A 3GCMA 1YW9A 2LRDA 4RS8A 3BR1A 4FT8A 1DGRM 4KITB 3WTUC 1P4XA 1TW2A 2K02A 1ETOA 3IH4A 3M7GA 4CHUA 4BXXJ 3HRUA 2V9VA 3AG3H 3S14J 1U5TC 4G6QA 2F48A 4UVAA 3DP7A 3KP3A 4M9SA 1D8JA 4Q47A 2VLAA 4PFPA 3I0TA 5FGMA 1KU3A 1G8XA 1ONVA 4UUSA 3ZXSA 1SEUA 2WBMA 4NDLA 5JVGF 2HDDA 4HSTA 1O57A 4GYGA 1ODDA 1XGSA 2RQQA 1TZLA 2DA4A 1GVDA 3I4PA 2VL8A 3F6OA 2B7EA 2NVUB 3EDPA 4IOAF 2A05A 3JR9A 4A3CJ 4M3FA 4M6VA 1SMYF 3K2ZA 1FEXA 4B44A 4A3LJ 1WRJA 2KIUA 4B1RA 1QZZA 2Z99A 4W1UA 4ZDOA 2EJRA 3CP8A 2FBIA 4Y13A 3BZKA 2OC6A 1LEAA 3L2VA 1Z9CA 4Y15A 3QYFA 2DOAA 4KJZA 2LF8A 2I10A 4HNUA 2Y30A 2LBFA 2P81A 5ERIA 3GVAA 4G94A 5A2QK 3F22A 3DTIA 5K7HA 1Z3XA 3QPHA 3C2BA 1DUXC 1U78A 3BG5A 2LVSA 4XLFA 2K9SA 3QP5A 3OL3A 1YX5A 3K10A 4MIMA 2IVMA 1K6YA 4JK1X 1Z91A 4A0YA 2ZFWA 3U21A 4BYYA 1IUFA 4JQFA 4U7BA 4BH9A 4XQFA 1FSEA 3FKIJ 4XN0A 2QBYB 4XLCA 2GXBA 3KLNA 1JTYA 2HQ5A 2FNPA 5IT3A 2A68F 2CQQA 3WGHA 4MFDA 2JWTA 4M6XA 3ERED 3S8PA 3NWTA 3ECOA 2M4KA 2QYOA 1UCRA 3CQZJ 3TBIA 3M8FA 2FU4A 3BCAA 3OWTA 4B09A 3BG9A 5CLSA 3R0JA 3EUAA 4HF1A 3CJNA 4BAYA 4AU7A 1NK2P 1X1PA 1PP7U 4HF2A 1USSA 1S3JA 2R5ZB 3MZ8A 1WHUA 3SEQA 1B1BA 1FIPA 4BGDA 1NHAA 3BR2A 1ON1A 2QQAA 5DV5A 1YFHA 2Y0SN 3BC8A 4D7NA 2XAGA 1Z0XA 3OYIA 2G7UA 1MJBA 3FXOA 2CQXA 3M3YJ 2NAZA 3OY9A 2ZMEC 1MDMB 2KFDA 1FC3A 4DYCA 1XS9A 3PFYA 3ZQHA 1DU0A 5IP6A 3DXJF 2JSPA 2IRFG 4EMSA 2BHYA 1OPCA 4C30A 1XGNA 3FM3A 2O8XA 2DOEA 4UXNA 3B73A 4BQAA 2GOMA 2X6WA 1X2NA 2NRAC 4OMYA 2KIFA 1GV2A 2OPTA 4CH7A 4X0GA 1LVKA 3R4KA 2BBYA 4DBQA 2IA0A 3LSHA 4RLQA 3BTLA 4XLAA 4CA0A 1BM9A 3I58A 1G4DA 4OIRF 3LFUA 1JT6A 4AYBN 4A69C 4BHBA 4S04A 1LE8A 3CUOA 2A6TA 1XTAA 4I99C 5HLGA 2EBIA 4L5IA 3U2RA 4WXCA 5J3LA 1WI9A 1A04A 4KICA 4RDUA 4XOTA 1D5VA 4E6KG 1YJNI 1LDDA 3MAJA 1OKRA 2VT3A 4Y7NJ 2F6CA 2R3SA 1BI0A 4M3DA 5L3EA 4G6DA 3GLLA 3K6GA 3OYLA 4KUMA 4V2FA 2QQBA 5EGOB 2QZ8A 3EYIA 2DFIA 4EQQA 2ECBA 1HSTA 4UNOA 2BXZA 2IEKA 3L9FA 2P8TA 3B02A 3IRQA 4NB5A 3S3OA 1U0JA 1W5TA 1IN4A 1HKQA 2MH9A 5KNLA 2LKPA 3ZN1A 5EG0A 1MMSA 2EIJH 2X51A 4HZFA 5J40A 1STZA 3S32A 5BMZA 2A69F 2IGKA 2ZJRF 4UUVA 4F55A 3TQNA 2Q0OA 1HKSA 2PQ8A 1X3WB 5KAIC 4XKWA 1R7JA 5CQGA 5L3FA 3HUGA 1W0UA 3MKWB 4B48A 3FMSA 1SD6A 2XGXA 4RGRA 4QIWN 5K1YA 3F9KA 2HGCA 4RAFA 2L0KA 3BPXA 4LB6B 1GXQA 1NG7A 4XIDA 3HOUJ 4PFOA 2UXNA 4A3FJ 1ZQ3P 1BC7C 4KNYA 5CJ9A 2IAIA 2AQFA 3M1CA 3FXRA 2R0QC 1GLNA 4D0PA 3PQJA 1BW5A 4RGXA 2HZDA 2FA5A 3CD6I 2DT6A 5TISC 4PJMA 2HOSA 3CO6C 2WC2A 4A2UA 4CXFA 1ACIA 4E70A 1SVMA 2Y9ZA 2STTA 4DJAA 3MZHA 2KIQA 3KX2A 4A3GJ 1FTZA 3FXJA 2E35A 3A02A 1QZYA 2A07F 2H8RA 1ZR4A 2WA0A 1HLVA 1TNSA 1LEBA 1TC3C 4P9UA 2NOGA 3FBIB 1XMKA 3ABKH 3A0HC 3W3CA 2KJCA 2H27A 3K70D 2YX7A 2KT0A 3WU0A 2KISA 2O9LA 3MWMA 5E3LA 1O7FA 2QF7A 1R1VA 1CF7B 3FIWA 4P55A 3GWZA 1XX5A 4O5VA 3VYSB 4JYKA 1TWAJ 4D5FA 2H09A 4BQQA 4WF2A 5B5EC 1IDYA 2VASA 2K27A 2HU9A 2DT5A 2ZSHB 4JX6A 2QSGX 3A1YA 1T39A 2OF7A 3KP7A 3G6EI 1XCVA 4ZZLA 2P5LC 3ESWB 2DA6A 3H9GA 2PMUA 4L18B 1J0RA 4LOCA 1H89C 1WSUA 2CUFA 2MYSA 1QA6A 1YW8A 2VUMJ 2E5ZA 1EH6A 3CLQA 3PIPF 2XPWA 3TMOA 3E6MA 3T0YA 4F91B 1BN5A 2V7FA 3KYLA 2KRCA 2RREA 3HOTA 2CMPA 3TW7A 3EUHC 4U7DA 1U3EM 1TLHB 4LMYA 1J2XA 1N77A 2BYVE 3CLOA 3F8MA 3K1NA 1D0YA 1JE8A 3ZRGA 3J7YJ 5B1BH 4Y17A 2O03A 9ANTA 1HSJA 2R7SA 1IN8A 5D5WB 1BJAA 1WJBA 1FYKA 2K9MA 4JBAA 5JVTA 2ZNYA 3FM5A 4I7HA 2W84A 5KVRA 2VBZA 1IC8A 1E3OC 4HV6A 3N05A 5FKOA 1E0EA 3DLLF 5HS8A 4OIQF 3I54A 3KETA 2Y9YA 2W24A 3TL4X 1MMNA 2WAEA 2P6TA 1FP2A 1B8IA 1D1AA 2VJ4A 3KEOA 2YPRA 4YFNF 2QEXI 2NVQJ 4BEHB 1Z77A 2F4IA 3HL2A 2VE8A 1XDUA 4ENMA 3CUQA 2E1MC 2YR2A 3TO9A 1QVTA 1EH7A 5FFZA 1TT0A 3K4KA 5H6RA 1VQ8I 3N97A 1FBSA 3DKWA 3AL0B 2EZHA 5HNHA 2NXNB 4A3DJ 4E7KA 2JSCA 1W36C 2MW8A 3QOPA 3QOEA 1XSVA 2EIMH 4NBQA 4UVCA 5M3FJ 2JA7J 2CUZA 3F8FA 4WWCA 4BACA 3FXQA 4I02A 1DPRA 2X85A 4LG0B 2R92J 1ETKA 1CGPA 3HYIA 1X58A 3IC7A 3CCSI 1MMGA 4NNJA 1YS6A 3CO7C 3GZNB 2V4JC 5BOXA 2OAZA 3W2VA 4I09A 4OIOF 4FHTA 1EH8A 2O3FA 3KP4A 2EV0A 2HZTA 3E0JB 3I3LA 4RGSA 2NS7A 4L9VA 3G4SI 3HJEA 1AU7A 1TP4A 1KU9A 3VYRB 3H5RA 1O7LA 2Z3YA 2VC1A 1VQKI 2KMUA 5E3NA 4ETSA 2LYCA 4LLNA 2M3AA 1VQMI 4ZZDA 2CW8A 3JRBA 5C3EJ 5FLMJ 3MN2A 5GPCA 2FBKA 4U0WA 4ESJA 2LP0A 3HSEA 4DZPA 1U5TB 2LSOA 3PSFA 4C2UA 2X6YA 3WU2C 2FJ1A 2EQRA 2DFEA 4BE0A 2L9VA 3BZ6A 3KCCA 1TW3A 2HI3A 5F1JA 3HGGA 2KDZA 1R58A 5A2QZ 3AFHA 5CVVA 1UG0A 3H9JA 3KP2A 1I27A 3LQQA 2WY7Q 5ICCA 1V54H 1ETQA 3IWFA 2XF7A 1W7PD 2JRTA 3HPHA 4XKCA 4FETA 4KMFA 1JUPA 3JRFA 4ZTFA 2A6HF 5CVUA 5JI6A 1S72I 4IHVA 3ZQIA 1LFPA 2DQLA 5LD2C 1ULYA 2MBFA 3K0LA 4AYBA 2PMHA 2XB0X 5DUIA 2HYFA 1PJRA 2XUBA 3DFGA 3OR2C 2OUMA 2R7VA 2X0LA 2O5RA 1LPQA 2CUEA 3HEFA 5TJJA 2FOKA 2JT1A 2W4SA 3PQKA 2HDWA 2BZTA 4XM3A 5LRRA 1SD5A 5F64A 4Y33A 4U0YA 4EV0A 4G12A 1BBYA 3PNVA 2HOEA 3LA7A 3ZMUA 4HAMA 1P9QC 2QBYA 1IRGA 2K85A 2XPUA 2P5KA 1MGTA 4F93B 1TWGJ 4HNTA 1JGGA 2QA4I 2Z5UA 1KYZA 1VQ6I 3SHFA 4OWRB 3LSRA 3CF2A 1SD4A 2VKEA 2FXAA 1LDKB 3M8JA 2AS5F 1IUYA 3CCLI 2G9WA 4ANJA 2ELHA 2G7HA 2E5NA 3ZMSA 1PUEE 2CUJA 4IJAA 3SXYA 3FMQA 4IQJA 2GAUA 1A6IA 2LR8A 2LKXA 2R7ZJ 3K4JA 2R5ZA 2VKDA 2MC4A 5FFXA 3HHHA 5D4RA 2L54A 5DCMB 2VIXA 1RUOA 5IYBJ 3ZQQA 4DZJA 4ZH4F 3DCFA 4YIRX 4A3JJ 3TOAA 3GTQJ 3SZTA 3S1QJ 3SEZA 2WV0A 4DOZA 1VQLI 4E7ZA 1M1EB 3BJAA 3ASNH 4CSWA 3BR5A 3RZOJ 1MNDA 4WXHA 2Y2ZA 2L7MP 5DEQA 4EJOA 4HW0A 5C4JJ 4HDUA 2JTVA 1J75A 3T1BA 3I64A 2ESHA 4XL9A 1OR7C 2Y0SA 2R7WA 2ZO4A 1H88C 2WAQA 4OINF 4R8HA 4A3BJ 3TOBA 1HDPA 2ICWG 3CCVI 2TDXA 2ZMEB 3BJOA 3NARA 4H0EA 3TDZC 3NAUA 4GYIA 1IAWA 1HF0A 3LSTA 1JHFA 3QU3A 1ZG3A 3OYHA 4D7MA 1L0OC 1V5FA 2FF4A 3CC2I 2E34A 1FOYA 2VBWA 3DPTA 4HYEA 3ZR8X 2GWRA 4YFKF 4WK8F 2O8KA 1X19A 4KISA 1DP3A 4IPAA 3HOVJ 1TWFJ 3RIRA 2A61A 2XSJC 4JX4A 3FWEA 2BGCA 1AKHB 2RAEA 1SFKA 1WI3A 2HXIA 4FX4A 3GZ6A 1FPQA 3T8TA 1YLFA 4HPQA 2H94A 1ETVA 3ZQ7A 2K5CA 3CJRB 5J1RA 4EVIA 3VODA 4ZJZA 1H9GA 5EEHA 3BG3A 3L7WA 2GZWA 3ABTA 2JN6A 4NC7A 2IS2A 4XK4A 5J4VA 2ZSIB 1FNNA 2A5WA 5TRDA 3HTUA 4PGGA 5B3SH 2HDCA 4MNUA 1Z05A 3GFLA 3K2AA 1T6SA 5EGOA 1HW5A 2Z9OA 3JRHA 2EFPA 5DYMA 3O2PE 3DTEA 3E3VA 4ITVA 1GVJA 4HF0A 2P7CB 1ETWA 2A6EF 5EEAA 1JTXA 4XKBA 4MEXF 3QPLA 3IL2A 1XSXA 4LB5A 2X6OA 2OU2A 2R7RA 3OYFA 4A0XA 1IXRC 2NVXJ 2AXTC 2KKOA 1KZHA 3KZZA 5BNGA 4Z6YA 2V6CA 3M9AA 3E6DA 4IO9F 3KE2A 4DGWB 4BY7J 3W6VA 1D0XA 3BROA 2DW4A 3ZQCA 3GTPJ 3ABLH 5KAFC 3S17J 4HRIA 1K4SA 2VBYA 1FOXA 5KCMA 1R49A 5FLXK 2YU9J 2O7OA 3ONQA 1XPXA 2KPMA 1L3LA 3I53A 4I98B 4M3BA 2Q8KA 2XAJA 2IT0A 3K4BA 1T0FA 4BE1A 3AG2H 2WY8Q 5E20A 2CFXA 2NS8A 4LITA 4I01A 4R1HA 3IAM2
chains in the Genus database with same CATH topology
1MH3A 1JJ6C 4RDUA 1Y1VJ 4X6AJ 3H3VK 3MKLA 4Y7NJ 4M3DA 3O8HA 4V2FA 5EGOB 4FTHA 2ECBA 2NVTJ 2IEKA 3L1PA 5GP9A 2DMTA 5C4XJ 1GUUA 4D5CA 5M5XJ 1AKHA 5C44J 1H8AC 3CMYA 5K7ZA 5EG0A 2YUSA 3A01B 1MBJA 1APLC 1ZK8A 4RBOA 2R93J 1GDTA 3FISA 3TP0A 2TRTA 3GTJJ 3DEWA 3G1OA 1W0UA 2R5YB 1QVUA 4FISA 4AC0A 3S16J 3TW6A 4QIWN 1IGNA 4Y52J 2L0KA 1MNMC 5F08A 4XIDA 3HOUJ 1NTCA 4A3FJ 1ZQ3P 2IAIA 1I6HJ 1PUFB 2R0QC 2NVYJ 2PMZN 2DA7A 1BW5A 1POGA 1U9NA 2VI6A 1QRYA 2HOSA 2DA5A 2XGCA 2DA1A 1HOMA 5FJ8J 4XRSG 2B63J 2Y9ZA 2W48A 3Q0VA 1HCRA 4MLOA 2LFBA 4A3GJ 3FK6A 2DA2A 1FTZA 4JP0A 5FKMA 4A3IJ 1JUSA 3A02A 4BBSJ 2X9DA 2CU7A 4BBRJ 1ZR4A 2H8RA 1HLVA 3IH3A 1TC3C 2E1OA 5EG0B 4W97A 2NOGA 1I50J 3UKGA 1ZTRA 1BL0A 2XRLA 3S2DJ 2WAQN 2IBDA 4JX5A 2KT0A 2O9LA 5IPAA 1ZGWA 5IP7J 3JRAA 3CDLA 5E3LA 1ITYA 2QF7A 2MG4A 2AO9A 1K61A 1O4XA 3FIWA 3BT9A 4JYKA 1TWAJ 4D5FA 2YS9A 2JJ7A 1IDYA 1OJLA 1IRZA 1TWCJ 3PO2J 4XICA 4JX6A 2OF7A 1ETXA 1ORKA 2E19A 1RPWA 1A5JA 2DA6A 2ME0A 3OSGA 1AKHB 4LOCA 2K40A 1H89C 2CUFA 2WB1N 2VUMJ 2GLOA 2XPWA 3Q3SA 1IJWC 3I4NJ 1VNDA 4FE7A 3D1NI 1JKQC 2R5YA 2LTPA 4FCYA 2G0EA 1FTTA 1U9OA 3TW7A 2FD5A 3SDGA 5IYDJ 2LD5A 4C3IJ 5F27A 3JRDA 9ANTA 4QSHA 1VF9A 1CQTA 1D5YA 3S1MJ 3BTJA 3WHCA 3JREA 5M3MJ 1QPIA 1MBFA 1RKTA 1ZKGA 1WCMJ 1IC8A 1E3OC 5EF6A 2EZLA 5FKOA 1BW6A 3HKZN 4XRSA 3S1NJ 3RQIA 4IEJA 4GFBA 2Y9YA 2M2EA 1JKRC 3GTGJ 1B8IA 1ENHA 5M5WJ 4DW6A 5J1UA 3BTIA 4MFEA 2NVQJ 3M4OJ 4IHXA 1F43A 1Z77A 5F0HA 4CYCA 1HDDC 1NK3P 3TEDA 2AHQA 2EZKA 1B72A 2DTZA 3LNQA 1QVTA 3BR3A 1XC5A 2JK3A 2M8GX 3E7LA 1G2HA 1YRNA 2ID6A 5JLXA 2ZB9A 1DU6A 4C3HJ 2EZHA 4S0HB 5F0FA 5EDNA 2MSYA 4A3DJ 2E2HJ 3TP3A 2MW8A 3S1RJ 5IOZA 2TCTA 5EYRA 1GV5A 2ID3A 3H0GJ 4ABZA 5M3FJ 2JA7J 1IDZA 1T56A 2XSDC 2FQ4A 4B4CA 5IYCJ 2R92J 3FK7A 1ETKA 1X58A 1IV6A 4QTRA 4BY1J 3RZDJ 2M9HA 5F04A 4BKXA 1OFCX 1FJLA 3HBLA 4L5EA 1GT0C 3GTLJ 1UG2A 3OIOA 4A3KJ 4HNVA 1MBEA 2DMQA 2JA6J 2HXOA 1FIAA 3JRIA 4AUXA 1OCTC 2NS7A 3JRCA 3ZQLA 1AU7A 2VKVA 5EZHA 1B8IB 4FE4A 3A03A 1JKPC 2DA3A 2DMPA 2M0CA 2CRGA 2DMUA 3WHBA 5FKLA 2DN0A 5FKNA 4CYCB 2XPVA 5E3NA 1B72B 4C3JJ 3QPSA 3JRBA 5C3EJ 1W0TA 5FLMJ 3MN2A 5GPCA 1RESA 3RKQA 3LSGA 3MVPA 3BQYA 1YRNB 1TWHJ 3Q0UA 4DYQA 5J1YA 4IHYA 2LP0A 4MO7A 2K9NA 4DZPA 1WH5A 1MBGA 4EEFG 1UHSA 2ME6A 2L7ZA 4J19A 2FJ1A 2EQRA 2CJJA 3LOCA 4DYRA 2HI3A 5F1JA 3CCYA 3HGGA 2KDZA 2E2JJ 3BR6A 2X48A 2D5VA 1ETQA 3B6AA 3BTCA 1P7IA 3GTKJ 5FLVA 1ZR2A 1JUPA 3BR1A 4M3EA 5GPAA 3JRFA 4M3GA 2K9QA 5E3MA 4IHVA 3ZQIA 1ETOA 3IH4A 5DTDA 4BXXJ 1UMQA 3S14J 2ECCA 5K7FA 3I4MJ 2FX0A 2XB0X 1WH7A 5EZGA 1ETYA 2HOAA 1X2MA 2M34A 3SFIA 1F36A 3HOWJ 2CUEA 3HEFA 4UUSA 4NDLA 1JKOC 2HDDA 4A93J 5F0CA 1U8BA 4G12A 1VI0A 2LK2A 1OCPA 2WV1A 2DA4A 1GVDA 1Y1WJ 3OOUA 4X1EA 2XPUA 2LY9A 1JGGA 1TWGJ 3JR9A 3SJMA 1MBKA 4A3CJ 4M3FA 4M6VA 3LSRA 3PM1A 1FEXA 2VKEA 3GTOJ 2L7FP 4A3LJ 4B1RA 4XRMA 2DJNA 2JMWA 3HB9A 4W1UA 3HGYA 1SFOJ 3F0CA 3IH2A 1A6IA 2LR8A 4C2MJ 3Q0WA 1RKWA 3ZOBA 2R5ZA 2LKXA 2HOTA 2R7ZJ 2I10A 2VPRA 4I76A 3HM5A 2Y30A 2P81A 4B3AA 5IYBJ 1P7JA 4DZJA 3DCFA 3QQAA 1S7EA 5K7HA 4A3JJ 5FKKA 2HYJA 3C2BA 3GTQJ 1U78A 3BG5A 3S1QJ 3BQZA 2LVSA 2K9SA 3VPRA 4MIMA 1EF4A 4UUSB 2N8GA 1K83J 3BR5A 4UUTA 4A3EJ 3RZOJ 1LFUP 2LLKA 1IUFA 2Y2ZA 1RETA 2L7MP 3B6CA 5C4JJ 3FKIJ 3HDDA 5HODA 2XB5A 1JTYA 2HQ5A 3ZQFA 1LE8B 1H88C 2EH3A 2CQQA 5JLWA 3G1MA 4A3BJ 4MFDA 1HDPA 2JWTA 2E2IJ 1XG1A 3NARA 2JA5J 3NAUA 3HOYJ 3CQZJ 1HF0A 1JT0A 1LFBA 2ELKA 5DS9A 3BG9A 1JJ8C 1RR7A 4D7MA 5IOYA 1VFCA 5E3OA 1NK2P 3PO3J 2O8KA 2R5ZB 4IHWA 3HOVJ 1TWFJ 4JX4A 4I6ZA 1WI3A 2HXIA 2RAEA 1FIPA 2DMNA 3JRGA 2EZIA 3BR2A 1BJZA 3GBGA 1MBHA 4V2GA 2Y0SN 1ETVA 2QCOA 4D7NA 5J1RA 1Z0XA 3BG3A 2JN6A 1MSFC 2Y31A 1SANA 4XK4A 3M3YJ 2CQXA 3O8GA 5IP9J 1I3QJ 4DYCA 1XS9A 3ZQHA 1DU0A 3K7AJ 1BA5A 5IP6A 2GM4A 1MH4A 3K2AA 5EGOA 3GTMJ 3JRHA 3OSFA 2GBYA 3BR0A 5M5YJ 1R9TJ 1ETWA 5EEAA 1JTXA 3QPLA 2X6OA 2XGEA 3IV5A 2JA8J 3A01A 1JUMA 1X2NA 3S15J 3G1LA 2NVXJ 5BNGA 3ZQGA 4A3MJ 1GV2A 2OPTA 2COBA 4BY7J 3W6VA 1Q1VA 3ZQCA 3GTPJ 1WPKA 3BTLA 3S17J 1AHDP 3S2HJ 3HOZJ 1WGXA 1MSEC 3LSPA 3LSJA 2XGDA 2YU9J 2O7OA 1JT6A 4M3BA 2H1KA 4AYBN 4A69C 2MGQA 1LE8A 3HOXJ 2L9RA 1PUFA 1IG7A 2EBIA 1T33A 2NS8A 5J3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MH3 A;  1JJ6 C;  4RDU A;  1Y1V J;  4X6A J;  3H3V K;  3MKL A;  4Y7N J;  4M3D A;  3O8H A;  4V2F A;  5EGO B;  4FTH A;  2ECB A;  2NVT J;  2IEK A;  3L1P A;  5GP9 A;  2DMT A;  5C4X J;  1GUU A;  4D5C A;  5M5X J;  1AKH A;  5C44 J;  1H8A C;  3CMY A;  5K7Z A;  5EG0 A;  2YUS A;  3A01 B;  1MBJ A;  1APL C;  1ZK8 A;  4RBO A;  2R93 J;  1GDT A;  3FIS A;  3TP0 A;  2TRT A;  3GTJ J;  3DEW A;  3G1O A;  1W0U A;  2R5Y B;  1QVU A;  4FIS A;  4AC0 A;  3S16 J;  3TW6 A;  4QIW N;  1IGN A;  4Y52 J;  2L0K A;  1MNM C;  5F08 A;  4XID A;  3HOU J;  1NTC A;  4A3F J;  1ZQ3 P;  2IAI A;  1I6H J;  1PUF B;  2R0Q C;  2NVY J;  2PMZ N;  2DA7 A;  1BW5 A;  1POG A;  1U9N A;  2VI6 A;  1QRY A;  2HOS A;  2DA5 A;  2XGC A;  2DA1 A;  1HOM A;  5FJ8 J;  4XRS G;  2B63 J;  2Y9Z A;  2W48 A;  3Q0V A;  1HCR A;  4MLO A;  2LFB A;  4A3G J;  3FK6 A;  2DA2 A;  1FTZ A;  4JP0 A;  5FKM A;  4A3I J;  1JUS A;  3A02 A;  4BBS J;  2X9D A;  2CU7 A;  4BBR J;  1ZR4 A;  2H8R A;  1HLV A;  3IH3 A;  1TC3 C;  2E1O A;  5EG0 B;  4W97 A;  2NOG A;  1I50 J;  3UKG A;  1ZTR A;  1BL0 A;  2XRL A;  3S2D J;  2WAQ N;  2IBD A;  4JX5 A;  2KT0 A;  2O9L A;  5IPA A;  1ZGW A;  5IP7 J;  3JRA A;  3CDL A;  5E3L A;  1ITY A;  2QF7 A;  2MG4 A;  2AO9 A;  1K61 A;  1O4X A;  3FIW A;  3BT9 A;  4JYK A;  1TWA J;  4D5F A;  2YS9 A;  2JJ7 A;  1IDY A;  1OJL A;  1IRZ A;  1TWC J;  3PO2 J;  4XIC A;  4JX6 A;  2OF7 A;  1ETX A;  1ORK A;  2E19 A;  1RPW A;  1A5J A;  2DA6 A;  2ME0 A;  3OSG A;  1AKH B;  4LOC A;  2K40 A;  1H89 C;  2CUF A;  2WB1 N;  2VUM J;  2GLO A;  2XPW A;  3Q3S A;  1IJW C;  3I4N J;  1VND A;  4FE7 A;  3D1N I;  1JKQ C;  2R5Y A;  2LTP A;  4FCY A;  2G0E A;  1FTT A;  1U9O A;  3TW7 A;  2FD5 A;  3SDG A;  5IYD J;  2LD5 A;  4C3I J;  5F27 A;  3JRD A;  9ANT A;  4QSH A;  1VF9 A;  1CQT A;  1D5Y A;  3S1M J;  3BTJ A;  3WHC A;  3JRE A;  5M3M J;  1QPI A;  1MBF A;  1RKT A;  1ZKG A;  1WCM J;  1IC8 A;  1E3O C;  5EF6 A;  2EZL A;  5FKO A;  1BW6 A;  3HKZ N;  4XRS A;  3S1N J;  3RQI A;  4IEJ A;  4GFB A;  2Y9Y A;  2M2E A;  1JKR C;  3GTG J;  1B8I A;  1ENH A;  5M5W J;  4DW6 A;  5J1U A;  3BTI A;  4MFE A;  2NVQ J;  3M4O J;  4IHX A;  1F43 A;  1Z77 A;  5F0H A;  4CYC A;  1HDD C;  1NK3 P;  3TED A;  2AHQ A;  2EZK A;  1B72 A;  2DTZ A;  3LNQ A;  1QVT A;  3BR3 A;  1XC5 A;  2JK3 A;  2M8G X;  3E7L A;  1G2H A;  1YRN A;  2ID6 A;  5JLX A;  2ZB9 A;  1DU6 A;  4C3H J;  2EZH A;  4S0H B;  5F0F A;  5EDN A;  2MSY A;  4A3D J;  2E2H J;  3TP3 A;  2MW8 A;  3S1R J;  5IOZ A;  2TCT A;  5EYR A;  1GV5 A;  2ID3 A;  3H0G J;  4ABZ A;  5M3F J;  2JA7 J;  1IDZ A;  1T56 A;  2XSD C;  2FQ4 A;  4B4C A;  5IYC J;  2R92 J;  3FK7 A;  1ETK A;  1X58 A;  1IV6 A;  4QTR A;  4BY1 J;  3RZD J;  2M9H A;  5F04 A;  4BKX A;  1OFC X;  1FJL A;  3HBL A;  4L5E A;  1GT0 C;  3GTL J;  1UG2 A;  3OIO A;  4A3K J;  4HNV A;  1MBE A;  2DMQ A;  2JA6 J;  2HXO A;  1FIA A;  3JRI A;  4AUX A;  1OCT C;  2NS7 A;  3JRC A;  3ZQL A;  1AU7 A;  2VKV A;  5EZH A;  1B8I B;  4FE4 A;  3A03 A;  1JKP C;  2DA3 A;  2DMP A;  2M0C A;  2CRG A;  2DMU A;  3WHB A;  5FKL A;  2DN0 A;  5FKN A;  4CYC B;  2XPV A;  5E3N A;  1B72 B;  4C3J J;  3QPS A;  3JRB A;  5C3E J;  1W0T A;  5FLM J;  3MN2 A;  5GPC A;  1RES A;  3RKQ A;  3LSG A;  3MVP A;  3BQY A;  1YRN B;  1TWH J;  3Q0U A;  4DYQ A;  5J1Y A;  4IHY A;  2LP0 A;  4MO7 A;  2K9N A;  4DZP A;  1WH5 A;  1MBG A;  4EEF G;  1UHS A;  2ME6 A;  2L7Z A;  4J19 A;  2FJ1 A;  2EQR A;  2CJJ A;  3LOC A;  4DYR A;  2HI3 A;  5F1J A;  3CCY A;  3HGG A;  2KDZ A;  2E2J J;  3BR6 A;  2X48 A;  2D5V A;  1ETQ A;  3B6A A;  3BTC A;  1P7I A;  3GTK J;  5FLV A;  1ZR2 A;  1JUP A;  3BR1 A;  4M3E A;  5GPA A;  3JRF A;  4M3G A;  2K9Q A;  5E3M A;  4IHV A;  3ZQI A;  1ETO A;  3IH4 A;  5DTD A;  4BXX J;  1UMQ A;  3S14 J;  2ECC A;  5K7F A;  3I4M J;  2FX0 A;  2XB0 X;  1WH7 A;  5EZG A;  1ETY A;  2HOA A;  1X2M A;  2M34 A;  3SFI A;  1F36 A;  3HOW J;  2CUE A;  3HEF A;  4UUS A;  4NDL A;  1JKO C;  2HDD A;  4A93 J;  5F0C A;  1U8B A;  4G12 A;  1VI0 A;  2LK2 A;  1OCP A;  2WV1 A;  2DA4 A;  1GVD A;  1Y1W J;  3OOU A;  4X1E A;  2XPU A;  2LY9 A;  1JGG A;  1TWG J;  3JR9 A;  3SJM A;  1MBK A;  4A3C J;  4M3F A;  4M6V A;  3LSR A;  3PM1 A;  1FEX A;  2VKE A;  3GTO J;  2L7F P;  4A3L J;  4B1R A;  4XRM A;  2DJN A;  2JMW A;  3HB9 A;  4W1U A;  3HGY A;  1SFO J;  3F0C A;  3IH2 A;  1A6I A;  2LR8 A;  4C2M J;  3Q0W A;  1RKW A;  3ZOB A;  2R5Z A;  2LKX A;  2HOT A;  2R7Z J;  2I10 A;  2VPR A;  4I76 A;  3HM5 A;  2Y30 A;  2P81 A;  4B3A A;  5IYB J;  1P7J A;  4DZJ A;  3DCF A;  3QQA A;  1S7E A;  5K7H A;  4A3J J;  5FKK A;  2HYJ A;  3C2B A;  3GTQ J;  1U78 A;  3BG5 A;  3S1Q J;  3BQZ A;  2LVS A;  2K9S A;  3VPR A;  4MIM A;  1EF4 A;  4UUS B;  2N8G A;  1K83 J;  3BR5 A;  4UUT A;  4A3E J;  3RZO J;  1LFU P;  2LLK A;  1IUF A;  2Y2Z A;  1RET A;  2L7M P;  3B6C A;  5C4J J;  3FKI J;  3HDD A;  5HOD A;  2XB5 A;  1JTY A;  2HQ5 A;  3ZQF A;  1LE8 B;  1H88 C;  2EH3 A;  2CQQ A;  5JLW A;  3G1M A;  4A3B J;  4MFD A;  1HDP A;  2JWT A;  2E2I J;  1XG1 A;  3NAR A;  2JA5 J;  3NAU A;  3HOY J;  3CQZ J;  1HF0 A;  1JT0 A;  1LFB A;  2ELK A;  5DS9 A;  3BG9 A;  1JJ8 C;  1RR7 A;  4D7M A;  5IOY A;  1VFC A;  5E3O A;  1NK2 P;  3PO3 J;  2O8K A;  2R5Z B;  4IHW A;  3HOV J;  1TWF J;  4JX4 A;  4I6Z A;  1WI3 A;  2HXI A;  2RAE A;  1FIP A;  2DMN A;  3JRG A;  2EZI A;  3BR2 A;  1BJZ A;  3GBG A;  1MBH A;  4V2G A;  2Y0S N;  1ETV A;  2QCO A;  4D7N A;  5J1R A;  1Z0X A;  3BG3 A;  2JN6 A;  1MSF C;  2Y31 A;  1SAN A;  4XK4 A;  3M3Y J;  2CQX A;  3O8G A;  5IP9 J;  1I3Q J;  4DYC A;  1XS9 A;  3ZQH A;  1DU0 A;  3K7A J;  1BA5 A;  5IP6 A;  2GM4 A;  1MH4 A;  3K2A A;  5EGO A;  3GTM J;  3JRH A;  3OSF A;  2GBY A;  3BR0 A;  5M5Y J;  1R9T J;  1ETW A;  5EEA A;  1JTX A;  3QPL A;  2X6O A;  2XGE A;  3IV5 A;  2JA8 J;  3A01 A;  1JUM A;  1X2N A;  3S15 J;  3G1L A;  2NVX J;  5BNG A;  3ZQG A;  4A3M J;  1GV2 A;  2OPT A;  2COB A;  4BY7 J;  3W6V A;  1Q1V A;  3ZQC A;  3GTP J;  1WPK A;  3BTL A;  3S17 J;  1AHD P;  3S2H J;  3HOZ J;  1WGX A;  1MSE C;  3LSP A;  3LSJ A;  2XGD A;  2YU9 J;  2O7O A;  1JT6 A;  4M3B A;  2H1K A;  4AYB N;  4A69 C;  2MGQ A;  1LE8 A;  3HOX J;  2L9R A;  1PUF A;  1IG7 A;  2EBI A;  1T33 A;  2NS8 A;  5J3L A; 
#chains in the Genus database with same CATH topology
 1MH3 A;  5HS7 A;  4X6A J;  3GME A;  4I0A A;  2NOJ B;  3H3V K;  1H0M A;  3MKL A;  3WOD F;  3O8H A;  2DK5 A;  2GA1 A;  5J47 A;  2KRH A;  2Z2S B;  1ZH5 A;  1IN5 A;  1YE9 A;  4ESF A;  3KP6 A;  2NVT J;  3L2Q A;  1G3Y A;  1YIO A;  2L2O A;  4AM3 A;  5DD8 A;  1ZHF A;  1I3A A;  4YEJ A;  5C44 J;  3FHN A;  1H8A C;  3MCZ A;  2HFH A;  4BE2 A;  2YUS A;  3A01 B;  1PDN C;  1MBJ A;  1T38 A;  4AID A;  4RAG A;  1J5Y A;  3GYH X;  3KIO A;  3H0D A;  1RR8 C;  3DWL E;  1ZK8 A;  1APL C;  1A31 A;  3DEW A;  5FD5 A;  2OA4 A;  4P96 A;  3LSM A;  3MD2 A;  1CF7 A;  4KT6 A;  2CW7 A;  1QVU A;  1Z7L A;  4PUS A;  4FIS A;  3A2K A;  2OTJ I;  2E60 A;  2FSW A;  3D5S C;  3RJP A;  4PSX A;  3GFI A;  2VOD A;  2NNY A;  1LB2 A;  3F8B A;  3V7R A;  3V7C A;  3RTR A;  3ZGK A;  2RNJ A;  3DLA A;  1WFX A;  2OTL I;  1I6H J;  1PUF B;  3HG9 A;  2HS5 A;  5FRO A;  5E18 F;  4YRV A;  1NH3 A;  1JXS A;  1U9N A;  1SFU A;  3ULQ B;  1KGS A;  1DPU A;  1VZ0 A;  1ZN2 A;  2F2E A;  2DA1 A;  1SD7 A;  1Z1D A;  2P4W A;  1DDN A;  3CCU I;  2R7Q A;  1VQP I;  4MLO A;  2QLZ A;  5DUK A;  1T8I A;  2MD5 A;  1SMT A;  2RNG A;  3JAM K;  2VQC A;  4BBS J;  2HR3 A;  4BBR J;  5FRN A;  1F9N A;  3BZC A;  2XRO A;  3LA3 A;  2XC7 A;  3BY6 A;  1ZTR A;  1BL0 A;  2WAQ N;  3R61 A;  2IBD A;  4JX5 A;  1UHW A;  3QWL A;  4PCQ A;  4ZYG A;  5LGT A;  1Q1H A;  2ZC2 A;  1ZGW A;  2JPC A;  4D1Q A;  2WWY A;  3JRA A;  1ITY A;  1R4M B;  1IN7 A;  2QVO A;  3ELK A;  1VTN C;  2MG4 A;  1HW2 A;  2OQG A;  4CIC A;  5EEG A;  5D5X B;  2YS9 A;  5D5V B;  2JJ7 A;  3ECH A;  1OJL A;  1IRZ A;  4RM3 A;  4ZYD A;  3JCU C;  5JHF A;  4XIC A;  5BPI A;  2LNB A;  3EQL F;  3E6B A;  1XGO A;  1ETX A;  2E19 A;  1QHG A;  3C18 A;  4RAY A;  4Q5S F;  1WZ2 A;  3I55 I;  5GAG J;  3OSG A;  2ME0 A;  3ABU A;  2LY2 A;  1IO2 A;  3ZN0 A;  1FBQ A;  4FE7 A;  1WQ2 A;  4XOP A;  2R5Y A;  2LTP A;  4FCY A;  1PP8 F;  2BY1 A;  2G0E A;  2IJL A;  4XKV A;  3LFK A;  4BNC A;  1R5I D;  1G59 A;  1IV8 A;  2KHM A;  2QQ8 A;  5ED4 A;  2RKH A;  4L0Z B;  3ML6 A;  2LD5 A;  2VQL A;  2DJI A;  2EIL H;  4BDY A;  5BPD A;  2IA1 A;  2D1V A;  3OIQ A;  4KN7 X;  2ISZ A;  3WTX C;  3CDI A;  3OYE A;  1BR2 A;  4G7Z F;  4QSH A;  3RCO A;  1VF9 A;  4LG0 A;  4DNC A;  1B6A A;  3OYA A;  1F5T A;  1TQM A;  2E1M B;  3H36 A;  4G8X A;  5L3B A;  1K78 A;  3BTJ A;  2C6Y A;  3WHC A;  3I5U A;  2PI0 A;  3GUD A;  1P4A A;  5HDK A;  3OYK A;  1MBF A;  1ZKG A;  1QPI A;  5L3D A;  4BJ5 C;  1WCM J;  1UEL B;  2KQR A;  5BS6 A;  5FO5 A;  2EZL A;  4BJ6 C;  4AIK A;  1A36 A;  2WAF A;  2Y48 A;  1W7P A;  3H92 A;  2Y75 A;  5F6F A;  3S1N J;  2ZXH A;  3RQI A;  3MMY B;  5AIQ A;  1FX7 A;  3TKY A;  3J80 K;  4F52 A;  4MTD A;  1EKE A;  2V1N A;  4DW6 A;  1KQ8 A;  5J1U A;  4MFE A;  4N4O B;  3T8R A;  3JSP A;  1OQY A;  5LGN A;  4IHX A;  2GQQ A;  1F43 A;  3DEE A;  5F0H A;  2COM A;  3W6K B;  1HW1 A;  3OS0 A;  4Y3O A;  2AHQ A;  5LBQ A;  3TED A;  3ERM A;  1UFM A;  4LLG F;  2B9S A;  2JK3 A;  1X1D A;  1G2H A;  1YS7 A;  3O3K A;  3K4N A;  1DU6 A;  3CC4 I;  1KA8 A;  4S0H B;  4A5N A;  1U5T A;  2W00 A;  3WTY C;  2VC0 A;  2TCT A;  5EYR A;  1GV5 A;  3K4M A;  3OYJ A;  2V9K A;  4U88 A;  2F5F A;  3LMM A;  4RAZ A;  3RPU D;  2VE9 A;  3MFK A;  3IHU A;  5GAD J;  1MMA A;  5HNF A;  1K4T A;  2F4O B;  4N0B A;  2FQ4 A;  2KP6 A;  3K4L A;  2CV0 A;  3FK7 A;  3UNG C;  4QTR A;  1VQ7 I;  3RZD J;  3V8L A;  5F04 A;  3CES A;  2QQ9 A;  4ZYH A;  5HS9 A;  1YI2 I;  1FJL A;  3MEX A;  1BI2 A;  1D3Y A;  2H1L A;  5CQE A;  3PUB A;  2R7T A;  2JA6 J;  4KIG A;  1XD7 A;  1MIJ A;  1LDJ A;  2RDP A;  3TO7 A;  5FB2 A;  4OMZ A;  5LGU A;  3JRC A;  3ZQL A;  1OCT C;  2IS6 A;  1YQA A;  3OYG A;  5EZH A;  3IKV A;  1MNE A;  1R23 A;  2DA3 A;  2DMP A;  2M0C A;  2CRG A;  1KON A;  2DMU A;  4IHS A;  3S93 A;  3C2H A;  3I59 B;  2FEZ A;  2DK8 A;  1T95 A;  1YOV B;  5ICE A;  2XPV A;  1DP7 P;  2DI3 A;  2WTE A;  2OCC H;  3WTZ A;  4P5O A;  2FBH A;  4KA4 A;  1Z21 A;  3F23 A;  1I6X A;  1MKM A;  3LSG A;  2VON A;  2EA4 A;  2PBI A;  3BQY A;  2DOD A;  3V7S A;  5GTI C;  1TWH J;  4XLH A;  5J1Y A;  4IHY A;  1B9N A;  2LBF B;  2K9N A;  1YJW I;  5D6F A;  2HQR A;  1MBG A;  3FZV A;  5L3G A;  3GX4 X;  4G7H F;  2F5E A;  3H1C A;  2UV1 A;  3LOC A;  3CCY A;  4HDV A;  4HEA 2;  3FF5 A;  3BR6 A;  2X48 A;  1V5E A;  2D5V A;  4BXF A;  2O0Y A;  3X2Q H;  2DDB A;  1O3Q A;  3V8K A;  3B6A A;  2VBX A;  2DFF A;  3DBR B;  3GTK J;  2LY1 A;  5FLV A;  2HVR A;  2XAU A;  5GPA A;  2EFQ A;  4XMY A;  4M3G A;  5E3M A;  2BOL A;  4G6T B;  5DTD A;  3ZMT A;  3C7J A;  2CFO A;  2ECC A;  2XVC A;  3OYM A;  3P9I A;  5K7F A;  2FX0 A;  1AWC A;  3I4M J;  5EZG A;  1ETY A;  1I39 A;  2HOA A;  1X2M A;  4J00 A;  3CCQ I;  4BXU A;  4M72 A;  3HOW J;  3DTK A;  2L9S A;  1U8R A;  2FUG 2;  3J7A O;  4A93 J;  1A35 A;  5F0C A;  1O3T A;  4HLX A;  1EJ9 A;  1IN6 A;  1IRX A;  1OCP A;  3SZP A;  3GZ5 A;  2BV6 A;  4B3X A;  3PNT A;  1Y8Q B;  1F1Z A;  3F8N A;  1Y1W J;  3OOU A;  3RSN A;  4X1E A;  5LHH A;  4IHT A;  1KU2 A;  4NQW B;  3K4C A;  4ZDL A;  2L7K A;  5ILV A;  3SJM A;  1YO5 C;  2BVL A;  2VJ5 A;  4A6D A;  3PM1 A;  1YX3 A;  5CVR A;  3IP4 B;  2ZME A;  1J7K A;  2MC3 A;  2W25 A;  2L01 A;  4MGR A;  2DJN A;  3FKJ A;  2JMW A;  3HB9 A;  5D5U B;  1SFO J;  4YFX F;  1RNL A;  2E1N A;  1RKW A;  3QYE A;  3ZOB A;  2OV7 A;  5ILU A;  1Z3Y A;  4PJN A;  4GRI A;  3HM5 A;  1W5C C;  3NQO A;  3OS2 A;  1VQO I;  5DM7 F;  4B3A A;  5CVJ A;  2ZFU A;  4K2E A;  3QQA A;  1ZYR F;  1E2X A;  5FKK A;  1V5G A;  2BW3 B;  1RRJ A;  3QU6 A;  2FNA A;  4CCK A;  2DOF A;  4OAY A;  3DEU A;  3CP2 A;  1D0Z A;  5FD6 A;  4LJZ F;  2VPL A;  3CZ6 A;  1EF4 A;  2N8G A;  1LVA A;  4UUT A;  2DLL A;  2LLK A;  2WAD A;  3B6C A;  3I9V 2;  2MLG A;  3HZJ A;  1UZC A;  2BY3 A;  2R7O A;  4EGZ A;  4E7L A;  2OCE A;  2M30 A;  4XNF A;  2PEX A;  3VDX A;  2LC2 A;  2XB5 A;  1HXD A;  2A5Y B;  3ZQF A;  4PK4 A;  4FX0 A;  3KEY A;  4E7S A;  1LE8 B;  2BY0 A;  3Q5F A;  4CCL A;  5FLX Z;  2EH3 A;  3G1M A;  1MJA A;  1LUJ B;  1DGW Y;  3AAF A;  2GXG A;  2JA2 A;  4YII A;  2E2I J;  2VJJ A;  4MTE A;  3JTH A;  2PJP A;  2L3D A;  4CUG A;  2JA5 J;  3HOY J;  1JT0 A;  6PAX A;  1FOK A;  1QQI A;  5D8K B;  1R71 A;  5DS9 A;  1RR7 A;  4AWX B;  1KU7 A;  2K3P A;  5E1Z B;  3K70 C;  5IOY A;  1VFC A;  5E3O A;  1T98 A;  3PO3 J;  2EFN A;  2GXA A;  1BI3 A;  3GFJ A;  1TTY A;  3ROU A;  2W1O A;  3HRS A;  4I6Z A;  3JRG A;  1QPM A;  1BJZ A;  4XLP F;  2M45 A;  3GBG A;  1RC9 A;  4V2G A;  2M5W A;  4XLN F;  1JHH A;  2QCO A;  5H6Q A;  3VWB A;  3R0A A;  4RB1 A;  2FMY A;  1I1S A;  2WB1 A;  1MSF C;  2Y31 A;  5CVI A;  2ZBK A;  2LKS A;  1S7A A;  2J5O A;  1BOA A;  4M9X A;  2MLK A;  3O8G A;  2OD5 A;  4QPO A;  5IP9 J;  1I3Q J;  1G3W A;  2BY2 A;  3E5U A;  3K7A J;  1LJ9 A;  2DCE A;  3HUG B;  4BHP A;  4FQG A;  4BDZ A;  2GM4 A;  4V19 K;  1P4W A;  4KIF A;  2GIV A;  5JR3 A;  2CS3 A;  1VQN I;  1S8N A;  3OSF A;  2GBY A;  3BR0 A;  4PZJ A;  3ZMD A;  3HOS A;  4CCN A;  2XKO A;  4A0Z A;  3S3M A;  4ENJ A;  3BG7 A;  3BLY A;  2VJI A;  4EJV A;  4IKF A;  1X1A A;  4M9Z A;  3E1S A;  3A01 A;  5J6X A;  3S15 J;  1U6G A;  3G1L A;  1TQP A;  2QEN A;  3ZQG A;  3RKX A;  4LD5 A;  2XIG A;  1G6N A;  1Q1V A;  3PL8 A;  1QZE A;  1WPK A;  4CO8 A;  1AHD P;  3CDH A;  3H3Z A;  3S2H J;  3HOZ J;  1WGX A;  3LSP A;  3LSJ A;  2NNN A;  1YJ9 I;  2XRN A;  5HLT A;  3WG7 H;  1FYM A;  3V42 A;  2H1K A;  4HX8 A;  2DBB A;  3TO6 A;  3HOX J;  1F4K A;  2L9R A;  1PUF A;  3JAM Z;  2UXX A;  1WJF A;  2X4H A;  2JPB A;  3KP5 A;  3CCJ I;  1JJ6 C;  2VT2 A;  1Y1V J;  1UB9 A;  5E8G A;  5DDG A;  3ABM H;  3PIO F;  4XON A;  3QRF F;  2XAS A;  3RQ4 A;  4FAS D;  1X3Z B;  1S9H A;  4WXD A;  4OOI A;  2KDO A;  3SFZ A;  3L1P A;  1I1G A;  5GP9 A;  2RQP A;  1GUU A;  2CSO A;  4D5C A;  3RPQ A;  4BUP A;  3ZCO A;  1HKT A;  1R36 A;  2DYR H;  3CMY A;  3FMR A;  4Q48 A;  5EJC A;  5K7Z A;  2V26 A;  3E6C C;  3ZPL A;  3MZY A;  5DCF A;  1ZAO A;  1IXC A;  2R93 J;  4RM2 A;  1GDT A;  3GTJ J;  2TRT A;  3WE2 A;  1MDM A;  3J7A Y;  3IUO A;  1OYY A;  4AC0 A;  4PDK A;  5DD4 A;  1IGN A;  2ISY A;  2ZXW H;  3EUH A;  1MNM C;  3G2B A;  3HRM A;  1FYL A;  3CMA I;  4EM1 A;  4KFC A;  3KFW X;  5IT9 K;  1FMW A;  3BCB A;  3F8C A;  1BIA A;  5LRS A;  2D1H A;  1YG2 A;  3K69 A;  2HNH A;  2F4M B;  4ON0 A;  5F1R A;  2OQR A;  2HKX A;  1FSH A;  1QRY A;  2H6B A;  3FXK A;  3HC7 A;  4KN4 X;  1YYV A;  2XGC A;  1HOM A;  4Z2Y A;  4XRS G;  2XAQ A;  4ESB A;  2ELJ A;  2XKP A;  1D1B A;  1G3S A;  4EGY A;  1HCR A;  3G71 I;  2DPD A;  5K5Q A;  4RMN A;  1IF1 A;  2V1D A;  3HTS B;  1OIS A;  2EIN H;  3HXL A;  5AON A;  5FKM A;  1JUS A;  2NS0 A;  2HPM A;  2X9D A;  2CU7 A;  4PSW A;  4DQ2 A;  2VQH A;  3CMM A;  4ENN A;  2PJR B;  4W97 A;  3UKG A;  2FRH A;  5K5R A;  3DPU A;  4MQ9 F;  3J80 Z;  1RZ4 A;  4N4N B;  3KZY A;  4UV8 A;  1K7A A;  3BOQ A;  5IPA A;  5IP7 J;  1BR4 A;  3RPU A;  1N25 A;  3CDL A;  1E3P A;  3NWS A;  2JRM A;  2CW0 F;  3K9T A;  3S3N A;  2AO9 A;  2KIM A;  3JW4 A;  4BQN A;  3BT9 A;  4DIQ A;  2BE5 F;  2CQK A;  3WG9 A;  4TV7 A;  1RI7 A;  3FX3 A;  2F5C A;  1QGP A;  1TWC J;  3PO2 J;  1VQ4 I;  2O61 A;  3H3U A;  4BJT A;  3J81 K;  2KRF A;  1RPW A;  2GOX B;  1A5J A;  4IVN A;  1WVR A;  3VYU B;  4KYW A;  1HBX G;  3KLO A;  2WB1 N;  1IRF A;  1P2F A;  2VQG A;  3FXM A;  4U87 A;  1FY7 A;  1W1W E;  2KL4 A;  2GLO A;  4C9Y A;  2IGN A;  3Q3S A;  1RUN A;  1SVL A;  3I4N J;  3H5A A;  1JKQ C;  2BVM A;  5ICF A;  5BQT A;  2DQR A;  4BHC A;  4HX4 A;  1ON2 A;  3QAH A;  1FTT A;  3R6S A;  1ZRC A;  4AVP A;  1OYI A;  2HTS A;  1U9O A;  1S5L C;  5KK1 A;  1V55 H;  3SDG A;  1OCZ H;  2BHZ A;  3L09 A;  1X1C A;  5GAE J;  5KHD A;  3F21 A;  2QKM B;  4BQO A;  5E1X A;  1BOB A;  2DDA A;  3JRD A;  3WTV C;  1HC8 A;  1T08 B;  4RA2 A;  1Y8R B;  3AG4 H;  2CYY A;  3OV8 A;  2OZ6 A;  3LAP A;  1K6O A;  1V4R A;  3HIF A;  2ZXJ A;  3P5J A;  5CKT A;  2P6S A;  5AIP A;  2IGM A;  1V3F A;  3OL4 A;  3CCE I;  1BW6 A;  3H5N A;  3EYY A;  2W57 A;  2H6C A;  3L00 A;  4D9J A;  4IEJ A;  3FHZ A;  3KYD B;  2M2E A;  3AG1 H;  5DM6 F;  4MQV A;  3GTG J;  1TQI A;  5M5W J;  2CV2 A;  1PYV A;  4XBF A;  4AVZ A;  3SYT A;  3M4O J;  3I59 A;  1REP C;  1Z6T A;  3UR3 C;  4E7H A;  1O3S A;  2EZK A;  2DTZ A;  1ZRD A;  3VSK A;  1XC5 A;  1R6R A;  1ZLJ A;  3G3Z A;  1X4P A;  4I0B A;  4LIU A;  2M8G X;  2PLY A;  2R7U A;  2CQN A;  2W82 A;  2ID6 A;  3DPL C;  5JFR A;  3WU1 B;  4C3H J;  2I5U A;  5F0F A;  5E17 F;  2E2H J;  1XGM A;  2L4M A;  1Z6R A;  1E17 A;  2ZJQ F;  1UHM A;  2ID3 A;  3H0G J;  4ABZ A;  1SC7 A;  1IDZ A;  2MFZ A;  4F92 B;  1T56 A;  2D2W A;  4BL0 B;  2F5D A;  1H9T A;  3SDB A;  1SFX A;  4CCO A;  4JOM A;  1Y56 A;  1B9M A;  1IV6 A;  2YX4 A;  4BY1 J;  2LG4 A;  2M9H A;  4IF4 A;  4BKX A;  1OFC X;  2M7B A;  4L5E A;  1ZRF A;  4HQE A;  3NRV A;  4CCJ A;  3GTL J;  1HA8 A;  1UG2 A;  2D45 A;  3OIO A;  4A3K J;  4HNV A;  2ESN A;  2VKH A;  1MBE A;  2DMQ A;  2EB7 A;  2EFW A;  3L2U A;  1FIA A;  3JRI A;  3C1D A;  2ZXI A;  2OZU A;  1BIB A;  4O3M A;  5LEJ A;  2I8D A;  2IGO A;  3IAS 2;  3H35 A;  1JKP C;  1KQ9 A;  4P9F A;  1R00 A;  1XB4 A;  3W2W A;  3WHB A;  2DN0 A;  5FKN A;  4CYC B;  3OYB A;  2E36 A;  2RN7 A;  1QBJ A;  4LG3 A;  1B72 B;  4C3J J;  3COA C;  4GO1 A;  3GEZ A;  1GXP A;  2FOW A;  1W0T A;  3N4M A;  4HG2 A;  4YEL A;  1RES A;  4KIB A;  3RKQ A;  1R5G A;  3MVP A;  3D5L A;  1YRN B;  3Q0U A;  4NHJ A;  1TL8 A;  4C2T A;  4UB8 C;  4MO7 A;  1XN7 A;  3ASO H;  4NQW A;  1WH5 A;  4L9N A;  3V8J A;  3DV8 A;  1LNW A;  4EEF G;  1UHS A;  2ME6 A;  3WTS C;  2ZJP F;  2RC4 A;  1EA3 A;  1XDS A;  2CJJ A;  2CO5 A;  4BS9 A;  1KQ0 A;  5FRM A;  5LEK A;  4HBL A;  4BEH A;  1QO0 D;  2Z16 A;  1WJC A;  1FP1 D;  2MH2 A;  4LK0 F;  3GFM A;  1J9I A;  1BR1 A;  2Q2E B;  4PJL A;  3EET A;  1P7I A;  3CUQ C;  3CME I;  1WJ5 A;  2ACJ A;  4M3E A;  4CYD A;  2ZKZ A;  4ZYE A;  3A0B C;  2DU9 A;  1OR7 A;  2K9Q A;  3PNY A;  3OIP A;  2QGU A;  4IXA A;  1VQ9 I;  5B1A H;  1UMQ A;  3LWF A;  4IRG A;  5D8L B;  2QSF X;  3DQV C;  1WH7 A;  2BW3 A;  5K5O A;  3CC7 I;  2M34 A;  2XAF A;  3SFI A;  1F36 A;  3WE3 A;  3MKZ A;  3OS1 A;  3DBH B;  1JKO C;  3RKW A;  2EFO A;  4XSZ F;  1C0W A;  3E5X A;  1I5Z A;  1U8B A;  4L5J A;  1VI0 A;  2LK2 A;  4HV5 A;  2WV1 A;  3I56 I;  1ERD A;  4ZDP A;  2O6G E;  2CQ7 A;  3BP8 A;  5HDG A;  3F3X A;  4XLE A;  2LY9 A;  5LHG A;  3LAJ A;  2HYG D;  1MBK A;  3LSI A;  1R5H A;  5HLI A;  3GLX A;  2Y0M A;  3GTO J;  3T5X A;  2L7F P;  1S29 A;  3PUF A;  3VFZ A;  4XRM A;  1MZB A;  1XMA A;  2JQ7 A;  3BPV A;  2V9P A;  2W7N A;  2FML A;  2L5Q A;  3HGY A;  4XN3 A;  3F0C A;  3IH2 A;  5E1W A;  1OMI A;  3S2W A;  2M7A A;  1FWZ A;  3Q0W A;  4C2M J;  4UVB A;  2HOT A;  2R7X A;  4LIV A;  2JUC A;  2M8E A;  2JUG A;  2VPR A;  4RLF A;  4I76 A;  1LQ1 A;  2PMZ A;  1P7J A;  2VXZ A;  3M07 A;  1TT5 B;  3F6V A;  4Q4Z F;  1S7E A;  4YG2 F;  2RVC A;  2HYJ A;  2Z1D A;  3BQZ A;  4ZC3 A;  3DKY A;  4XR6 A;  1IW7 F;  4E7I A;  3VPR A;  4QPQ A;  3C2G A;  2K3F A;  4UUS B;  4CDG A;  2V1U A;  5E79 C;  1K83 J;  4A3E J;  2EIK H;  1MJ9 A;  1LFU P;  5HOO A;  1W36 D;  1DQU A;  4BU2 A;  1RET A;  2ADU A;  4RB3 C;  4CGZ A;  5LFA A;  4LLL A;  3VYT B;  3HDD A;  3QPT A;  3W6J B;  4A6E A;  5HOD A;  4EJT A;  2YU3 A;  4GDF A;  1KYW A;  1RIO H;  3CCR I;  3RI4 A;  5JLW A;  2HQN A;  2VOP A;  2OJE D;  4MEY F;  3GW2 A;  1WWX A;  1XG1 A;  3KZI C;  2MA3 A;  2PFB A;  2QKL B;  1LFB A;  2ELK A;  1O3R A;  1JJ8 C;  5HDN A;  3WTW C;  2CG4 A;  3VEP A;  3VSL A;  1WJD A;  2VOO A;  3DBL B;  2STW A;  2AXL A;  4IHW A;  1WJA A;  1WKM A;  1Y6I A;  3L2R A;  2P7V B;  3P7N A;  2DMN A;  1GHC A;  2EZI A;  2ZCW A;  4I2O A;  1MBH A;  2UZK A;  3RDI A;  4E7J A;  3KEQ A;  3U1K A;  1P6R A;  2QUF A;  4PJ0 C;  1S7O A;  4M6Y A;  2UUZ A;  4F7Z A;  2R7F A;  1SAN A;  2L9N A;  1OLT A;  1ZGJ A;  5HLH A;  2B0L A;  1BA5 A;  3EPZ A;  2L02 A;  2Q1Z B;  4GGG A;  1MH4 A;  2W85 A;  1X3U A;  5J8F A;  3GTM J;  4QLC U;  2LF7 A;  5M5Y J;  1T2K A;  3MQ0 A;  4KMU X;  2GA2 A;  1R9T J;  3Q9S A;  5ICG A;  3L2W A;  5DCM A;  1FOW A;  1YW7 A;  3EUK L;  2XGE A;  3KPH A;  3IV5 A;  3CJT B;  2JA8 J;  5IY5 H;  1JUM A;  4P1W A;  3IKT A;  4H4K C;  4L9J A;  2AQE A;  3QYB A;  1TBX A;  4ZYA A;  4A3M J;  2K86 A;  3OR1 C;  2COB A;  4LFU A;  2DXI A;  5IT9 Z;  2A3S A;  3U1D A;  3DU5 A;  3D0S A;  3CCM I;  3K1P A;  3HKZ A;  1EV7 A;  1MSE C;  2X1D A;  4ASN A;  2XGD A;  2Y69 H;  3HPG A;  2LH9 A;  2IS4 A;  1XSD A;  3DKX A;  1PVE A;  2EK5 A;  2OBP A;  3H9Q A;  4WCG A;  2MGQ A;  1YHQ I;  4G7O F;  2XDV A;  1X1B A;  1JGS A;  2ZJ2 A;  1K79 A;  1IG7 A;  1TNT A;  4AD9 A;  2K4B A;  5H2F C;  2M1B A;  1T33 A;  3CTA A;  2VB6 A;  4B43 A;  1QHH D;  3FBN B;  2M4G A;  4M73 A;  2F5V A;  1AOY A;  3RKY A;  1Z67 A;  2MD0 A;  5D6E A;  1LKX A;  1N75 A;  1MW7 A;  3OYD A;  4Y4R A;  2PG4 A;  2XAH A;  3W2A A;  4FTH A;  3REO A;  2E71 A;  1SFE A;  2IXS A;  3RYR A;  4PGH A;  4ZTJ A;  2DT7 B;  4RGU A;  4RB2 C;  2DMT A;  5C4X J;  5M5X J;  1AKH A;  1FLI A;  1BC8 C;  1R1T A;  2QM3 A;  2PJR A;  4II2 A;  5GAH J;  1ZG1 A;  1NG6 A;  3J81 Z;  4RBO A;  3FIS A;  3TP0 A;  2P5V A;  3HSR A;  2XF6 A;  5B66 C;  3G1O A;  2RV8 A;  4R79 A;  4UY8 I;  2CGP A;  3PSI A;  2E7X A;  1SAU A;  3OYN A;  3GF2 A;  3Q9V A;  4AIJ A;  1X4O A;  2R5Y B;  3S16 J;  2X6X A;  3TW6 A;  2J5P A;  2ETH A;  2K4J A;  2QWW A;  2Z33 A;  4Y52 J;  3A4C A;  4F3Q A;  2L4A A;  5F08 A;  1W5S A;  1NTC A;  1A6Q A;  3VB2 A;  2CWE A;  3OYC A;  4DBR A;  4E4H A;  2NVY J;  2MAB A;  2DTR A;  2PMZ N;  5JHU A;  1MMD A;  2DA7 A;  1SVO A;  1POG A;  2X1E A;  1ZAR A;  2VI6 A;  1IZ1 A;  1K78 B;  2KZG A;  2DA5 A;  4RB0 A;  1R4N B;  5H20 A;  2BEO A;  5FJ8 J;  3IWZ A;  3TGN A;  2EPF A;  2B63 J;  2W48 A;  4GXO A;  4CZC A;  3Q0V A;  1ZGA A;  2LFB A;  2DAO A;  2FQ3 A;  3MKY B;  1ZG5 A;  3FK6 A;  1W7P B;  2DA2 A;  4JP0 A;  2DPU A;  4A3I J;  5CYV A;  2IA2 A;  2HVS A;  4IRI A;  2HTJ A;  2K7L A;  2ZNZ A;  3IH3 A;  4CCM A;  2E1O A;  5EG0 B;  2M0M A;  1SAX A;  1I50 J;  2LRE A;  2XRL A;  3GXO A;  3S2D J;  1T0F C;  4PJJ A;  5J4Y A;  4ENK A;  4HLY A;  2LOO A;  3NEU A;  2DO7 A;  1OYW A;  3BJ6 A;  1YIT I;  1Y39 A;  1ZEL A;  1K61 A;  2K9L A;  1O4X A;  3M8E A;  1ZLK A;  1UST A;  2HKO A;  4LGW A;  1P92 A;  2IW5 A;  2M87 A;  4G9Y A;  2LDU A;  3LQR A;  3ZP5 A;  4KDP A;  3ISP A;  1OCC H;  5D4S A;  1ORK A;  2PN6 A;  3IRR A;  2FE3 A;  3V4G A;  5TGT A;  2K40 A;  3AKZ A;  3I71 A;  1J59 A;  3TDU C;  3CJQ B;  2LMD A;  1J09 A;  1D8K A;  4XRF A;  1XCB A;  2V1X A;  1JI8 A;  3C3W A;  2JZY A;  2R4G A;  4UB6 C;  2JVH A;  1D1C A;  1W4M A;  4HOB A;  4II3 A;  2HWV A;  1IJW C;  4MHG A;  1VND A;  2XF5 A;  3D1N I;  4N9H A;  2JVG A;  1FZP B;  4CZZ A;  1S6L A;  5E8I A;  4OIP F;  4J01 A;  3LSK A;  2VXD A;  1XMX A;  3PFI A;  3FDY A;  1OCO H;  2FD5 A;  2X1C A;  1Y0U A;  5IYD J;  2EV6 A;  2E7W A;  1QNT A;  3GO5 A;  4C3I J;  4KT5 C;  5HVQ C;  5F27 A;  3ZMV A;  4HSR A;  1YIJ I;  4OU0 A;  2KJB A;  2V79 A;  4QWQ A;  1CQT A;  4NUB A;  1D5Y A;  3S1M J;  3QOD A;  3JRE A;  1B4A A;  5M3M J;  2E1C A;  1RKT A;  1WJE A;  3OOP A;  1HQC A;  4HQM A;  3E97 A;  5EF6 A;  2IP2 A;  3DU6 A;  3HKZ N;  4XRS A;  2HEO A;  4L0Y B;  2CH0 A;  1AA7 A;  4GFB A;  3PJR A;  1OCR H;  4GCV A;  2QSH X;  4NC8 A;  1JKR C;  1ENH A;  1E3H A;  4S05 A;  3BTI A;  1FT9 A;  1FBU A;  2HQA A;  3WGI A;  1YTY A;  4NC6 A;  5CPR B;  4CYC A;  1HDD C;  1NK3 P;  3BG6 A;  3FXU A;  2HPI A;  1B72 A;  3LNQ A;  1QU3 A;  3BR3 A;  4U0V A;  4UHT A;  1UAA A;  3VOE A;  3E7L A;  3QP6 A;  1VQ5 I;  1YRN A;  2VN2 A;  4IZZ A;  5JLX A;  2ZB9 A;  5EDN A;  2EWN A;  2MSY A;  3F72 A;  4A5M A;  3SZG A;  4OAZ A;  3HSF A;  3TP3 A;  3S1R J;  5IOZ A;  3J7Z I;  2EA2 A;  2BXY A;  1IXS B;  3JTG A;  2YSR A;  5L3C A;  1B59 A;  5ILS A;  3DF8 A;  4IOC F;  2IS1 A;  1R1U A;  2XSD C;  2DYS H;  3BWG A;  4B4C A;  3WGG A;  5IYC J;  3P9K A;  3FXL A;  4IX7 A;  4IL6 C;  1Z7U A;  3M1E A;  1UJ8 A;  1ZRE A;  2Q2E A;  2GIZ A;  3D5R C;  3HBL A;  4EM2 A;  2DFH A;  1GT0 C;  3K1M A;  3RYP A;  4EJW A;  4L9T A;  3KYC B;  1FMV A;  3AL0 C;  3G73 A;  2HXO A;  1Y0N A;  3LL7 A;  4AUX A;  3HRT A;  5J8C A;  5LLQ A;  5LHI A;  4EAT A;  2VKV A;  1B8I B;  4EJU A;  4FE4 A;  3ZMZ A;  3A03 A;  3P9C A;  4N9I A;  2V6E A;  3U9G A;  5FKL A;  4YIF A;  4AIH A;  4HA8 A;  2H8W A;  2HVQ A;  5GTH C;  4WX9 A;  3BDD A;  2RGV A;  1R22 A;  3QPS A;  3CUQ B;  2XV4 S;  2NYX A;  4O6J A;  2P0W A;  3SQN A;  2CV1 A;  3WTT C;  3HHG A;  1U2W A;  4XOR A;  1G3T A;  1N78 A;  3E5Q A;  4M74 A;  4B8X A;  3R60 A;  4A12 A;  4DYQ A;  2IPQ X;  3CF5 F;  4M71 A;  2L7Z A;  2R7D A;  3O6B B;  4IQ4 A;  4J19 A;  2UWM A;  1BI1 A;  4B47 A;  4DYR A;  4UV9 A;  2E2J J;  1MD0 A;  3LA2 A;  3OMY A;  3JSO A;  2KLO A;  4HX7 A;  2PX9 A;  2KZV A;  4LK1 F;  4EM0 B;  2EV5 A;  3BTC A;  2XHK A;  4XSX F;  4IRH A;  3L2C A;  1ZR2 A;  3GCM A;  1YW9 A;  2LRD A;  4RS8 A;  3BR1 A;  4FT8 A;  1DGR M;  4KIT B;  3WTU C;  1P4X A;  1TW2 A;  2K02 A;  1ETO A;  3IH4 A;  3M7G A;  4CHU A;  4BXX J;  3HRU A;  2V9V A;  3AG3 H;  3S14 J;  1U5T C;  4G6Q A;  2F48 A;  4UVA A;  3DP7 A;  3KP3 A;  4M9S A;  1D8J A;  4Q47 A;  2VLA A;  4PFP A;  3I0T A;  5FGM A;  1KU3 A;  1G8X A;  1ONV A;  4UUS A;  3ZXS A;  1SEU A;  2WBM A;  4NDL A;  5JVG F;  2HDD A;  4HST A;  1O57 A;  4GYG A;  1ODD A;  1XGS A;  2RQQ A;  1TZL A;  2DA4 A;  1GVD A;  3I4P A;  2VL8 A;  3F6O A;  2B7E A;  2NVU B;  3EDP A;  4IOA F;  2A05 A;  3JR9 A;  4A3C J;  4M3F A;  4M6V A;  1SMY F;  3K2Z A;  1FEX A;  4B44 A;  4A3L J;  1WRJ A;  2KIU A;  4B1R A;  1QZZ A;  2Z99 A;  4W1U A;  4ZDO A;  2EJR A;  3CP8 A;  2FBI A;  4Y13 A;  3BZK A;  2OC6 A;  1LEA A;  3L2V A;  1Z9C A;  4Y15 A;  3QYF A;  2DOA A;  4KJZ A;  2LF8 A;  2I10 A;  4HNU A;  2Y30 A;  2LBF A;  2P81 A;  5ERI A;  3GVA A;  4G94 A;  5A2Q K;  3F22 A;  3DTI A;  5K7H A;  1Z3X A;  3QPH A;  3C2B A;  1DUX C;  1U78 A;  3BG5 A;  2LVS A;  4XLF A;  2K9S A;  3QP5 A;  3OL3 A;  1YX5 A;  3K10 A;  4MIM A;  2IVM A;  1K6Y A;  4JK1 X;  1Z91 A;  4A0Y A;  2ZFW A;  3U21 A;  4BYY A;  1IUF A;  4JQF A;  4U7B A;  4BH9 A;  4XQF A;  1FSE A;  3FKI J;  4XN0 A;  2QBY B;  4XLC A;  2GXB A;  3KLN A;  1JTY A;  2HQ5 A;  2FNP A;  5IT3 A;  2A68 F;  2CQQ A;  3WGH A;  4MFD A;  2JWT A;  4M6X A;  3ERE D;  3S8P A;  3NWT A;  3ECO A;  2M4K A;  2QYO A;  1UCR A;  3CQZ J;  3TBI A;  3M8F A;  2FU4 A;  3BCA A;  3OWT A;  4B09 A;  3BG9 A;  5CLS A;  3R0J A;  3EUA A;  4HF1 A;  3CJN A;  4BAY A;  4AU7 A;  1NK2 P;  1X1P A;  1PP7 U;  4HF2 A;  1USS A;  1S3J A;  2R5Z B;  3MZ8 A;  1WHU A;  3SEQ A;  1B1B A;  1FIP A;  4BGD A;  1NHA A;  3BR2 A;  1ON1 A;  2QQA A;  5DV5 A;  1YFH A;  2Y0S N;  3BC8 A;  4D7N A;  2XAG A;  1Z0X A;  3OYI A;  2G7U A;  1MJB A;  3FXO A;  2CQX A;  3M3Y J;  2NAZ A;  3OY9 A;  2ZME C;  1MDM B;  2KFD A;  1FC3 A;  4DYC A;  1XS9 A;  3PFY A;  3ZQH A;  1DU0 A;  5IP6 A;  3DXJ F;  2JSP A;  2IRF G;  4EMS A;  2BHY A;  1OPC A;  4C30 A;  1XGN A;  3FM3 A;  2O8X A;  2DOE A;  4UXN A;  3B73 A;  4BQA A;  2GOM A;  2X6W A;  1X2N A;  2NRA C;  4OMY A;  2KIF A;  1GV2 A;  2OPT A;  4CH7 A;  4X0G A;  1LVK A;  3R4K A;  2BBY A;  4DBQ A;  2IA0 A;  3LSH A;  4RLQ A;  3BTL A;  4XLA A;  4CA0 A;  1BM9 A;  3I58 A;  1G4D A;  4OIR F;  3LFU A;  1JT6 A;  4AYB N;  4A69 C;  4BHB A;  4S04 A;  1LE8 A;  3CUO A;  2A6T A;  1XTA A;  4I99 C;  5HLG A;  2EBI A;  4L5I A;  3U2R A;  4WXC A;  5J3L A;  1WI9 A;  1A04 A;  4KIC A;  4RDU A;  4XOT A;  1D5V A;  4E6K G;  1YJN I;  1LDD A;  3MAJ A;  1OKR A;  2VT3 A;  4Y7N J;  2F6C A;  2R3S A;  1BI0 A;  4M3D A;  5L3E A;  4G6D A;  3GLL A;  3K6G A;  3OYL A;  4KUM A;  4V2F A;  2QQB A;  5EGO B;  2QZ8 A;  3EYI A;  2DFI A;  4EQQ A;  2ECB A;  1HST A;  4UNO A;  2BXZ A;  2IEK A;  3L9F A;  2P8T A;  3B02 A;  3IRQ A;  4NB5 A;  3S3O A;  1U0J A;  1W5T A;  1IN4 A;  1HKQ A;  2MH9 A;  5KNL A;  2LKP A;  3ZN1 A;  5EG0 A;  1MMS A;  2EIJ H;  2X51 A;  4HZF A;  5J40 A;  1STZ A;  3S32 A;  5BMZ A;  2A69 F;  2IGK A;  2ZJR F;  4UUV A;  4F55 A;  3TQN A;  2Q0O A;  1HKS A;  2PQ8 A;  1X3W B;  5KAI C;  4XKW A;  1R7J A;  5CQG A;  5L3F A;  3HUG A;  1W0U A;  3MKW B;  4B48 A;  3FMS A;  1SD6 A;  2XGX A;  4RGR A;  4QIW N;  5K1Y A;  3F9K A;  2HGC A;  4RAF A;  2L0K A;  3BPX A;  4LB6 B;  1GXQ A;  1NG7 A;  4XID A;  3HOU J;  4PFO A;  2UXN A;  4A3F J;  1ZQ3 P;  1BC7 C;  4KNY A;  5CJ9 A;  2IAI A;  2AQF A;  3M1C A;  3FXR A;  2R0Q C;  1GLN A;  4D0P A;  3PQJ A;  1BW5 A;  4RGX A;  2HZD A;  2FA5 A;  3CD6 I;  2DT6 A;  5TIS C;  4PJM A;  2HOS A;  3CO6 C;  2WC2 A;  4A2U A;  4CXF A;  1ACI A;  4E70 A;  1SVM A;  2Y9Z A;  2STT A;  4DJA A;  3MZH A;  2KIQ A;  3KX2 A;  4A3G J;  1FTZ A;  3FXJ A;  2E35 A;  3A02 A;  1QZY A;  2A07 F;  2H8R A;  1ZR4 A;  2WA0 A;  1HLV A;  1TNS A;  1LEB A;  1TC3 C;  4P9U A;  2NOG A;  3FBI B;  1XMK A;  3ABK H;  3A0H C;  3W3C A;  2KJC A;  2H27 A;  3K70 D;  2YX7 A;  2KT0 A;  3WU0 A;  2KIS A;  2O9L A;  3MWM A;  5E3L A;  1O7F A;  2QF7 A;  1R1V A;  1CF7 B;  3FIW A;  4P55 A;  3GWZ A;  1XX5 A;  4O5V A;  3VYS B;  4JYK A;  1TWA J;  4D5F A;  2H09 A;  4BQQ A;  4WF2 A;  5B5E C;  1IDY A;  2VAS A;  2K27 A;  2HU9 A;  2DT5 A;  2ZSH B;  4JX6 A;  2QSG X;  3A1Y A;  1T39 A;  2OF7 A;  3KP7 A;  3G6E I;  1XCV A;  4ZZL A;  2P5L C;  3ESW B;  2DA6 A;  3H9G A;  2PMU A;  4L18 B;  1J0R A;  4LOC A;  1H89 C;  1WSU A;  2CUF A;  2MYS A;  1QA6 A;  1YW8 A;  2VUM J;  2E5Z A;  1EH6 A;  3CLQ A;  3PIP F;  2XPW A;  3TMO A;  3E6M A;  3T0Y A;  4F91 B;  1BN5 A;  2V7F A;  3KYL A;  2KRC A;  2RRE A;  3HOT A;  2CMP A;  3TW7 A;  3EUH C;  4U7D A;  1U3E M;  1TLH B;  4LMY A;  1J2X A;  1N77 A;  2BYV E;  3CLO A;  3F8M A;  3K1N A;  1D0Y A;  1JE8 A;  3ZRG A;  3J7Y J;  5B1B H;  4Y17 A;  2O03 A;  9ANT A;  1HSJ A;  2R7S A;  1IN8 A;  5D5W B;  1BJA A;  1WJB A;  1FYK A;  2K9M A;  4JBA A;  5JVT A;  2ZNY A;  3FM5 A;  4I7H A;  2W84 A;  5KVR A;  2VBZ A;  1IC8 A;  1E3O C;  4HV6 A;  3N05 A;  5FKO A;  1E0E A;  3DLL F;  5HS8 A;  4OIQ F;  3I54 A;  3KET A;  2Y9Y A;  2W24 A;  3TL4 X;  1MMN A;  2WAE A;  2P6T A;  1FP2 A;  1B8I A;  1D1A A;  2VJ4 A;  3KEO A;  2YPR A;  4YFN F;  2QEX I;  2NVQ J;  4BEH B;  1Z77 A;  2F4I A;  3HL2 A;  2VE8 A;  1XDU A;  4ENM A;  3CUQ A;  2E1M C;  2YR2 A;  3TO9 A;  1QVT A;  1EH7 A;  5FFZ A;  1TT0 A;  3K4K A;  5H6R A;  1VQ8 I;  3N97 A;  1FBS A;  3DKW A;  3AL0 B;  2EZH A;  5HNH A;  2NXN B;  4A3D J;  4E7K A;  2JSC A;  1W36 C;  2MW8 A;  3QOP A;  3QOE A;  1XSV A;  2EIM H;  4NBQ A;  4UVC A;  5M3F J;  2JA7 J;  2CUZ A;  3F8F A;  4WWC A;  4BAC A;  3FXQ A;  4I02 A;  1DPR A;  2X85 A;  4LG0 B;  2R92 J;  1ETK A;  1CGP A;  3HYI A;  1X58 A;  3IC7 A;  3CCS I;  1MMG A;  4NNJ A;  1YS6 A;  3CO7 C;  3GZN B;  2V4J C;  5BOX A;  2OAZ A;  3W2V A;  4I09 A;  4OIO F;  4FHT A;  1EH8 A;  2O3F A;  3KP4 A;  2EV0 A;  2HZT A;  3E0J B;  3I3L A;  4RGS A;  2NS7 A;  4L9V A;  3G4S I;  3HJE A;  1AU7 A;  1TP4 A;  1KU9 A;  3VYR B;  3H5R A;  1O7L A;  2Z3Y A;  2VC1 A;  1VQK I;  2KMU A;  5E3N A;  4ETS A;  2LYC A;  4LLN A;  2M3A A;  1VQM I;  4ZZD A;  2CW8 A;  3JRB A;  5C3E J;  5FLM J;  3MN2 A;  5GPC A;  2FBK A;  4U0W A;  4ESJ A;  2LP0 A;  3HSE A;  4DZP A;  1U5T B;  2LSO A;  3PSF A;  4C2U A;  2X6Y A;  3WU2 C;  2FJ1 A;  2EQR A;  2DFE A;  4BE0 A;  2L9V A;  3BZ6 A;  3KCC A;  1TW3 A;  2HI3 A;  5F1J A;  3HGG A;  2KDZ A;  1R58 A;  5A2Q Z;  3AFH A;  5CVV A;  1UG0 A;  3H9J A;  3KP2 A;  1I27 A;  3LQQ A;  2WY7 Q;  5ICC A;  1V54 H;  1ETQ A;  3IWF A;  2XF7 A;  1W7P D;  2JRT A;  3HPH A;  4XKC A;  4FET A;  4KMF A;  1JUP A;  3JRF A;  4ZTF A;  2A6H F;  5CVU A;  5JI6 A;  1S72 I;  4IHV A;  3ZQI A;  1LFP A;  2DQL A;  5LD2 C;  1ULY A;  2MBF A;  3K0L A;  4AYB A;  2PMH A;  2XB0 X;  5DUI A;  2HYF A;  1PJR A;  2XUB A;  3DFG A;  3OR2 C;  2OUM A;  2R7V A;  2X0L A;  2O5R A;  1LPQ A;  2CUE A;  3HEF A;  5TJJ A;  2FOK A;  2JT1 A;  2W4S A;  3PQK A;  2HDW A;  2BZT A;  4XM3 A;  5LRR A;  1SD5 A;  5F64 A;  4Y33 A;  4U0Y A;  4EV0 A;  4G12 A;  1BBY A;  3PNV A;  2HOE A;  3LA7 A;  3ZMU A;  4HAM A;  1P9Q C;  2QBY A;  1IRG A;  2K85 A;  2XPU A;  2P5K A;  1MGT A;  4F93 B;  1TWG J;  4HNT A;  1JGG A;  2QA4 I;  2Z5U A;  1KYZ A;  1VQ6 I;  3SHF A;  4OWR B;  3LSR A;  3CF2 A;  1SD4 A;  2VKE A;  2FXA A;  1LDK B;  3M8J A;  2AS5 F;  1IUY A;  3CCL I;  2G9W A;  4ANJ A;  2ELH A;  2G7H A;  2E5N A;  3ZMS A;  1PUE E;  2CUJ A;  4IJA A;  3SXY A;  3FMQ A;  4IQJ A;  2GAU A;  1A6I A;  2LR8 A;  2LKX A;  2R7Z J;  3K4J A;  2R5Z A;  2VKD A;  2MC4 A;  5FFX A;  3HHH A;  5D4R A;  2L54 A;  5DCM B;  2VIX A;  1RUO A;  5IYB J;  3ZQQ A;  4DZJ A;  4ZH4 F;  3DCF A;  4YIR X;  4A3J J;  3TOA A;  3GTQ J;  3SZT A;  3S1Q J;  3SEZ A;  2WV0 A;  4DOZ A;  1VQL I;  4E7Z A;  1M1E B;  3BJA A;  3ASN H;  4CSW A;  3BR5 A;  3RZO J;  1MND A;  4WXH A;  2Y2Z A;  2L7M P;  5DEQ A;  4EJO A;  4HW0 A;  5C4J J;  4HDU A;  2JTV A;  1J75 A;  3T1B A;  3I64 A;  2ESH A;  4XL9 A;  1OR7 C;  2Y0S A;  2R7W A;  2ZO4 A;  1H88 C;  2WAQ A;  4OIN F;  4R8H A;  4A3B J;  3TOB A;  1HDP A;  2ICW G;  3CCV I;  2TDX A;  2ZME B;  3BJO A;  3NAR A;  4H0E A;  3TDZ C;  3NAU A;  4GYI A;  1IAW A;  1HF0 A;  3LST A;  1JHF A;  3QU3 A;  1ZG3 A;  3OYH A;  4D7M A;  1L0O C;  1V5F A;  2FF4 A;  3CC2 I;  2E34 A;  1FOY A;  2VBW A;  3DPT A;  4HYE A;  3ZR8 X;  2GWR A;  4YFK F;  4WK8 F;  2O8K A;  1X19 A;  4KIS A;  1DP3 A;  4IPA A;  3HOV J;  1TWF J;  3RIR A;  2A61 A;  2XSJ C;  4JX4 A;  3FWE A;  2BGC A;  1AKH B;  2RAE A;  1SFK A;  1WI3 A;  2HXI A;  4FX4 A;  3GZ6 A;  1FPQ A;  3T8T A;  1YLF A;  4HPQ A;  2H94 A;  1ETV A;  3ZQ7 A;  2K5C A;  3CJR B;  5J1R A;  4EVI A;  3VOD A;  4ZJZ A;  1H9G A;  5EEH A;  3BG3 A;  3L7W A;  2GZW A;  3ABT A;  2JN6 A;  4NC7 A;  2IS2 A;  4XK4 A;  5J4V A;  2ZSI B;  1FNN A;  2A5W A;  5TRD A;  3HTU A;  4PGG A;  5B3S H;  2HDC A;  4MNU A;  1Z05 A;  3GFL A;  3K2A A;  1T6S A;  5EGO A;  1HW5 A;  2Z9O A;  3JRH A;  2EFP A;  5DYM A;  3O2P E;  3DTE A;  3E3V A;  4ITV A;  1GVJ A;  4HF0 A;  2P7C B;  1ETW A;  2A6E F;  5EEA A;  1JTX A;  4XKB A;  4MEX F;  3QPL A;  3IL2 A;  1XSX A;  4LB5 A;  2X6O A;  2OU2 A;  2R7R A;  3OYF A;  4A0X A;  1IXR C;  2NVX J;  2AXT C;  2KKO A;  1KZH A;  3KZZ A;  5BNG A;  4Z6Y A;  2V6C A;  3M9A A;  3E6D A;  4IO9 F;  3KE2 A;  4DGW B;  4BY7 J;  3W6V A;  1D0X A;  3BRO A;  2DW4 A;  3ZQC A;  3GTP J;  3ABL H;  5KAF C;  3S17 J;  4HRI A;  1K4S A;  2VBY A;  1FOX A;  5KCM A;  1R49 A;  5FLX K;  2YU9 J;  2O7O A;  3ONQ A;  1XPX A;  2KPM A;  1L3L A;  3I53 A;  4I98 B;  4M3B A;  2Q8K A;  2XAJ A;  2IT0 A;  3K4B A;  1T0F A;  4BE1 A;  3AG2 H;  2WY8 Q;  5E20 A;  2CFX A;  2NS8 A;  4LIT A;  4I01 A;  4R1H A;  3IAM 2; 
#chains in the Genus database with same CATH homology
 1MH3 A;  1JJ6 C;  4RDU A;  1Y1V J;  4X6A J;  3H3V K;  3MKL A;  4Y7N J;  4M3D A;  3O8H A;  4V2F A;  5EGO B;  4FTH A;  2ECB A;  2NVT J;  2IEK A;  3L1P A;  5GP9 A;  2DMT A;  5C4X J;  1GUU A;  4D5C A;  5M5X J;  1AKH A;  5C44 J;  1H8A C;  3CMY A;  5K7Z A;  5EG0 A;  2YUS A;  3A01 B;  1MBJ A;  1APL C;  1ZK8 A;  4RBO A;  2R93 J;  1GDT A;  3FIS A;  3TP0 A;  2TRT A;  3GTJ J;  3DEW A;  3G1O A;  1W0U A;  2R5Y B;  1QVU A;  4FIS A;  4AC0 A;  3S16 J;  3TW6 A;  4QIW N;  1IGN A;  4Y52 J;  2L0K A;  1MNM C;  5F08 A;  4XID A;  3HOU J;  1NTC A;  4A3F J;  1ZQ3 P;  2IAI A;  1I6H J;  1PUF B;  2R0Q C;  2NVY J;  2PMZ N;  2DA7 A;  1BW5 A;  1POG A;  1U9N A;  2VI6 A;  1QRY A;  2HOS A;  2DA5 A;  2XGC A;  2DA1 A;  1HOM A;  5FJ8 J;  4XRS G;  2B63 J;  2Y9Z A;  2W48 A;  3Q0V A;  1HCR A;  4MLO A;  2LFB A;  4A3G J;  3FK6 A;  2DA2 A;  1FTZ A;  4JP0 A;  5FKM A;  4A3I J;  1JUS A;  3A02 A;  4BBS J;  2X9D A;  2CU7 A;  4BBR J;  1ZR4 A;  2H8R A;  1HLV A;  3IH3 A;  1TC3 C;  2E1O A;  5EG0 B;  4W97 A;  2NOG A;  1I50 J;  3UKG A;  1ZTR A;  1BL0 A;  2XRL A;  3S2D J;  2WAQ N;  2IBD A;  4JX5 A;  2KT0 A;  2O9L A;  5IPA A;  1ZGW A;  5IP7 J;  3JRA A;  3CDL A;  5E3L A;  1ITY A;  2QF7 A;  2MG4 A;  2AO9 A;  1K61 A;  1O4X A;  3FIW A;  3BT9 A;  4JYK A;  1TWA J;  4D5F A;  2YS9 A;  2JJ7 A;  1IDY A;  1OJL A;  1IRZ A;  1TWC J;  3PO2 J;  4XIC A;  4JX6 A;  2OF7 A;  1ETX A;  1ORK A;  2E19 A;  1RPW A;  1A5J A;  2DA6 A;  2ME0 A;  3OSG A;  1AKH B;  4LOC A;  2K40 A;  1H89 C;  2CUF A;  2WB1 N;  2VUM J;  2GLO A;  2XPW A;  3Q3S A;  1IJW C;  3I4N J;  1VND A;  4FE7 A;  3D1N I;  1JKQ C;  2R5Y A;  2LTP A;  4FCY A;  2G0E A;  1FTT A;  1U9O A;  3TW7 A;  2FD5 A;  3SDG A;  5IYD J;  2LD5 A;  4C3I J;  5F27 A;  3JRD A;  9ANT A;  4QSH A;  1VF9 A;  1CQT A;  1D5Y A;  3S1M J;  3BTJ A;  3WHC A;  3JRE A;  5M3M J;  1QPI A;  1MBF A;  1RKT A;  1ZKG A;  1WCM J;  1IC8 A;  1E3O C;  5EF6 A;  2EZL A;  5FKO A;  1BW6 A;  3HKZ N;  4XRS A;  3S1N J;  3RQI A;  4IEJ A;  4GFB A;  2Y9Y A;  2M2E A;  1JKR C;  3GTG J;  1B8I A;  1ENH A;  5M5W J;  4DW6 A;  5J1U A;  3BTI A;  4MFE A;  2NVQ J;  3M4O J;  4IHX A;  1F43 A;  1Z77 A;  5F0H A;  4CYC A;  1HDD C;  1NK3 P;  3TED A;  2AHQ A;  2EZK A;  1B72 A;  2DTZ A;  3LNQ A;  1QVT A;  3BR3 A;  1XC5 A;  2JK3 A;  2M8G X;  3E7L A;  1G2H A;  1YRN A;  2ID6 A;  5JLX A;  2ZB9 A;  1DU6 A;  4C3H J;  2EZH A;  4S0H B;  5F0F A;  5EDN A;  2MSY A;  4A3D J;  2E2H J;  3TP3 A;  2MW8 A;  3S1R J;  5IOZ A;  2TCT A;  5EYR A;  1GV5 A;  2ID3 A;  3H0G J;  4ABZ A;  5M3F J;  2JA7 J;  1IDZ A;  1T56 A;  2XSD C;  2FQ4 A;  4B4C A;  5IYC J;  2R92 J;  3FK7 A;  1ETK A;  1X58 A;  1IV6 A;  4QTR A;  4BY1 J;  3RZD J;  2M9H A;  5F04 A;  4BKX A;  1OFC X;  1FJL A;  3HBL A;  4L5E A;  1GT0 C;  3GTL J;  1UG2 A;  3OIO A;  4A3K J;  4HNV A;  1MBE A;  2DMQ A;  2JA6 J;  2HXO A;  1FIA A;  3JRI A;  4AUX A;  1OCT C;  2NS7 A;  3JRC A;  3ZQL A;  1AU7 A;  2VKV A;  5EZH A;  1B8I B;  4FE4 A;  3A03 A;  1JKP C;  2DA3 A;  2DMP A;  2M0C A;  2CRG A;  2DMU A;  3WHB A;  5FKL A;  2DN0 A;  5FKN A;  4CYC B;  2XPV A;  5E3N A;  1B72 B;  4C3J J;  3QPS A;  3JRB A;  5C3E J;  1W0T A;  5FLM J;  3MN2 A;  5GPC A;  1RES A;  3RKQ A;  3LSG A;  3MVP A;  3BQY A;  1YRN B;  1TWH J;  3Q0U A;  4DYQ A;  5J1Y A;  4IHY A;  2LP0 A;  4MO7 A;  2K9N A;  4DZP A;  1WH5 A;  1MBG A;  4EEF G;  1UHS A;  2ME6 A;  2L7Z A;  4J19 A;  2FJ1 A;  2EQR A;  2CJJ A;  3LOC A;  4DYR A;  2HI3 A;  5F1J A;  3CCY A;  3HGG A;  2KDZ A;  2E2J J;  3BR6 A;  2X48 A;  2D5V A;  1ETQ A;  3B6A A;  3BTC A;  1P7I A;  3GTK J;  5FLV A;  1ZR2 A;  1JUP A;  3BR1 A;  4M3E A;  5GPA A;  3JRF A;  4M3G A;  2K9Q A;  5E3M A;  4IHV A;  3ZQI A;  1ETO A;  3IH4 A;  5DTD A;  4BXX J;  1UMQ A;  3S14 J;  2ECC A;  5K7F A;  3I4M J;  2FX0 A;  2XB0 X;  1WH7 A;  5EZG A;  1ETY A;  2HOA A;  1X2M A;  2M34 A;  3SFI A;  1F36 A;  3HOW J;  2CUE A;  3HEF A;  4UUS A;  4NDL A;  1JKO C;  2HDD A;  4A93 J;  5F0C A;  1U8B A;  4G12 A;  1VI0 A;  2LK2 A;  1OCP A;  2WV1 A;  2DA4 A;  1GVD A;  1Y1W J;  3OOU A;  4X1E A;  2XPU A;  2LY9 A;  1JGG A;  1TWG J;  3JR9 A;  3SJM A;  1MBK A;  4A3C J;  4M3F A;  4M6V A;  3LSR A;  3PM1 A;  1FEX A;  2VKE A;  3GTO J;  2L7F P;  4A3L J;  4B1R A;  4XRM A;  2DJN A;  2JMW A;  3HB9 A;  4W1U A;  3HGY A;  1SFO J;  3F0C A;  3IH2 A;  1A6I A;  2LR8 A;  4C2M J;  3Q0W A;  1RKW A;  3ZOB A;  2R5Z A;  2LKX A;  2HOT A;  2R7Z J;  2I10 A;  2VPR A;  4I76 A;  3HM5 A;  2Y30 A;  2P81 A;  4B3A A;  5IYB J;  1P7J A;  4DZJ A;  3DCF A;  3QQA A;  1S7E A;  5K7H A;  4A3J J;  5FKK A;  2HYJ A;  3C2B A;  3GTQ J;  1U78 A;  3BG5 A;  3S1Q J;  3BQZ A;  2LVS A;  2K9S A;  3VPR A;  4MIM A;  1EF4 A;  4UUS B;  2N8G A;  1K83 J;  3BR5 A;  4UUT A;  4A3E J;  3RZO J;  1LFU P;  2LLK A;  1IUF A;  2Y2Z A;  1RET A;  2L7M P;  3B6C A;  5C4J J;  3FKI J;  3HDD A;  5HOD A;  2XB5 A;  1JTY A;  2HQ5 A;  3ZQF A;  1LE8 B;  1H88 C;  2EH3 A;  2CQQ A;  5JLW A;  3G1M A;  4A3B J;  4MFD A;  1HDP A;  2JWT A;  2E2I J;  1XG1 A;  3NAR A;  2JA5 J;  3NAU A;  3HOY J;  3CQZ J;  1HF0 A;  1JT0 A;  1LFB A;  2ELK A;  5DS9 A;  3BG9 A;  1JJ8 C;  1RR7 A;  4D7M A;  5IOY A;  1VFC A;  5E3O A;  1NK2 P;  3PO3 J;  2O8K A;  2R5Z B;  4IHW A;  3HOV J;  1TWF J;  4JX4 A;  4I6Z A;  1WI3 A;  2HXI A;  2RAE A;  1FIP A;  2DMN A;  3JRG A;  2EZI A;  3BR2 A;  1BJZ A;  3GBG A;  1MBH A;  4V2G A;  2Y0S N;  1ETV A;  2QCO A;  4D7N A;  5J1R A;  1Z0X A;  3BG3 A;  2JN6 A;  1MSF C;  2Y31 A;  1SAN A;  4XK4 A;  3M3Y J;  2CQX A;  3O8G A;  5IP9 J;  1I3Q J;  4DYC A;  1XS9 A;  3ZQH A;  1DU0 A;  3K7A J;  1BA5 A;  5IP6 A;  2GM4 A;  1MH4 A;  3K2A A;  5EGO A;  3GTM J;  3JRH A;  3OSF A;  2GBY A;  3BR0 A;  5M5Y J;  1R9T J;  1ETW A;  5EEA A;  1JTX A;  3QPL A;  2X6O A;  2XGE A;  3IV5 A;  2JA8 J;  3A01 A;  1JUM A;  1X2N A;  3S15 J;  3G1L A;  2NVX J;  5BNG A;  3ZQG A;  4A3M J;  1GV2 A;  2OPT A;  2COB A;  4BY7 J;  3W6V A;  1Q1V A;  3ZQC A;  3GTP J;  1WPK A;  3BTL A;  3S17 J;  1AHD P;  3S2H J;  3HOZ J;  1WGX A;  1MSE C;  3LSP A;  3LSJ A;  2XGD A;  2YU9 J;  2O7O A;  1JT6 A;  4M3B A;  2H1K A;  4AYB N;  4A69 C;  2MGQ A;  1LE8 A;  3HOX J;  2L9R A;  1PUF A;  1IG7 A;  2EBI A;  1T33 A;  2NS8 A;  5J3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...