4A3CJ

Rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
b'MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4a3cJ00
2Y9YA 4A3DJ 1P7JA 1FTTA 2X9DA 3L1PA 4M3FA 2O9LA 1JUSA 3D1NI 4AYBN 2WV1A 2WAQN 1JKRC 2IBDA 2W48A 1WCMJ 1ITYA 3PM1A 2NVQJ 1RKTA 2JWTA 4MFDA 4HNVA 1E3OC 2NVTJ 2R92J 2K9SA 3GTMJ 1U78A 2N8GA 3JRBA 3JRAA 4D7NA 2HOTA 2HOAA 1GUUA 3WHBA 3LSPA 1FEXA 1NK3P 2L9RA 4ABZA 3HB9A 4A69C 2OF7A 2NOGA 1I3QJ 1R9TJ 2JA7J 3BR5A 1F43A 5GPCA 3HGYA 3BR2A 1TC3C 1QVTA 3QPLA 3CDLA 3O8GA 2XB5A 1IGNA 3PO2J 3A02A 3A03A 1OFCX 1UHSA 2XB0X 1H89C 2MW8A 5GPAA 1ZGWA 1ZR4A 5GP9A 4A3BJ 1GT0C 3HOWJ 1XC5A 1ETKA 4BKXA 5DS9A 2M34A 3GBGA 2EZKA 2P81A 5J1YA 1B72A 4FE4A 2E1OA 2VPRA 3FKIJ 3HKZN 4C3HJ 1HF0A 3FISA 2FX0A 2Y2ZA 1F36A 3HOZJ 1LFBA 1IDZA 2M2EA 2CQQA 4XRMA 3I4NJ 1T56A 5M5WJ 2JA6J 2DA3A 2L7FP 1LFUP 3HOYJ 1W0TA 1JKQC 2PMZN 4L5EA 3GTPJ 1PUFA 3BR0A 3S16J 2G0EA 3MN2A 1XG1A 5F04A 5IOZA 5EYRA 5K7HA 3LNQA 3Q0WA 1ZQ3P 5K7ZA 4JX5A 2KDZA 1FJLA 4V2GA 1HDPA 2HQ5A 2DMQA 2YUSA 4DZPA 2XSDC 3HOXJ 3S17J 1JTXA 3S2DJ 1W0UA 3UKGA 1JGGA 1AU7A 3E7LA 2MGQA 1DU6A 1UG2A 4IEJA 4XRSA 1RPWA 5FLVA 3GTKJ 2FJ1A 2L0KA 1YRNA 1ZKGA 1FIPA 4M3DA 2DTZA 1JUPA 2O7OA 4M3BA 2E19A 2R0QC 3DEWA 3S2HJ 2NVXJ 5FKKA 3W6VA 5E3MA 2I10A 1YRNB 2HDDA 3K2AA 1U8BA 3SDGA 1G2HA 3BQZA 3JREA 4FTHA 1Q1VA 3TEDA 4DW6A 1VI0A 2R5YA 3BG9A 3S15J 2DN0A 4D5CA 2LR8A 5EDNA 2XGDA 5F0FA 2XGCA 4IHXA 1SFOJ 1HCRA 5EG0A 4M3EA 3JRFA 9ANTA 3LOCA 5C3EJ 5M5XJ 3IH3A 1GV2A 5M3MJ 3Q0VA 3F0CA 3GTOJ 2Y31A 4C3IJ 1ZK8A 1AHDP 4X1EA 3BR6A 1EF4A 4A3CJ 5EG0B 2EBIA 5DTDA 5F0CA 3GTGJ 5JLWA 1T33A 2ME0A 2CRGA 3RKQA 1O4XA 3FK7A 4A3GJ 1P7IA 1IRZA 4A3JJ 2R7ZJ 3I4MJ 3CQZJ 5K7FA 2H8RA 2LLKA 1TWAJ 1I6HJ 2XGEA 4UUSA 2VKVA 2DMPA 1BW6A 1IJWC 2Y30A 4QTRA 5C4JJ 3HBLA 2IEKA 3WHCA 2Y0SN 2EQRA 5M3FJ 2DA4A 2VI6A 2E2HJ 3JRIA 1S7EA 1QRYA 2DA2A 4AUXA 1WH5A 5IP6A 1Y1VJ 1OJLA 1ORKA 5E3NA 4RDUA 2ME6A 3NAUA 3FK6A 2GM4A 3HOUJ 3CMYA 2NS7A 4EEFG 1MBJA 1WH7A 4D7MA 1TWGJ 1TWFJ 3BG5A 4A93J 2K9NA 3SFIA 1SANA 2MSYA 4V2FA 2CJJA 1VNDA 5IYCJ 5IOYA 3QPSA 1DU0A 5IP7J 1B72B 4C2MJ 1MSFC 1RR7A 1ETXA 2XPWA 3B6AA 4AC0A 2JA8J 4DZJA 5IP9J 5J1UA 5EGOA 3G1LA 2YS9A 2M8GX 3ZQLA 4IHVA 1MNMC 3ZQIA 2E2IJ 2JJ7A 3BR1A 4RBOA 1JJ8C 1CQTA 1ETQA 4MIMA 5HODA 2OPTA 4DYRA 3C2BA 3JRHA 4A3EJ 3LSGA 2IAIA 2RAEA 4B1RA 1PUFB 1POGA 1Y1WJ 1GVDA 3OSFA 1H8AC 1VF9A 4IHWA 4A3IJ 2ECCA 1JKOC 1APLC 2X48A 3MKLA 5FLMJ 2WB1N 1HOMA 3ZQHA 4BXXJ 1X2MA 1D5YA 2LTPA 4Y52J 4JX4A 1XS9A 1RKWA 3GTJJ 1FIAA 2HOSA 4QIWN 2JA5J 4CYCA 2CQXA 2R5ZA 1ETOA 4A3FJ 2JMWA 4A3LJ 1TWCJ 5FKMA 1IUFA 2EZHA 1AKHA 4BY1J 2GBYA 4QSHA 1FTZA 3S1NJ 2H1KA 1MBGA 4M3GA 2R5ZB 1ETYA 4X6AJ 2LY9A 5F0HA 2O8KA 3DCFA 3O8HA 2FQ4A 1MBFA 4XIDA 3Q3SA 1JT6A 3S14J 5FJ8J 2E2JJ 2TCTA 5IYBJ 3A01A 4NDLA 4LOCA 4JYKA 3JRCA 5BNGA 3LSJA 2R5YB 4G12A 2COBA 1K83J 2MG4A 3TW6A 1IDYA 2L7ZA 3TP3A 3TW7A 1BW5A 2DJNA 2JK3A 3BTLA 1VFCA 5EZHA 3JRGA 4UUTA 3BTCA 1ZR2A 2CUEA 3G1OA 2DMUA 3GTQJ 1IG7A 1U9NA 2ECBA 1IV6A 5C4XJ 2DA5A 2KT0A 2DA1A 4S0HB 2AO9A 2VKEA 1GV5A 4MFEA 4FCYA 1JTYA 2L7MP 3ZOBA 2DA6A 3ZQFA 1JKPC 4XRSG 3S1QJ 2LFBA 3GTLJ 5FKOA 5F1JA 2B63J 2QF7A 4DYCA 5C44J 3VPRA 1U9OA 3BR3A 3SJMA 1ENHA 5EF6A 4UUSB 3IH2A 2VUMJ 1RETA 3PO3J 2XRLA 5J3LA 4XICA 3HDDA 2R93J 2FD5A 5IYDJ 3ZQGA 1MH3A 1HDDC 2D5VA 2EZLA 4BBRJ 2LKXA 1HLVA 2ID3A 3M4OJ 5F08A 1JT0A 3OSGA 2XPVA 4FE7A 5J1RA 1JJ6C 2X6OA 3RZDJ 2TRTA 2DMNA 3JR9A 1K61A 3RZOJ 5FKLA 1WGXA 1JUMA 2NS8A 2GLOA 3HEFA 3G1MA 1B8IA 2JN6A 5M5YJ 2Y9ZA 3CCYA 2XPUA 4MLOA 1RESA 1X58A 4MO7A 3LSRA 4JP0A 4I6ZA 3HOVJ 3BT9A 2ZB9A 3ZQCA 5IPAA 1B8IB 2EH3A 5EGOB 5E3OA 3S1MJ 1MBHA 3IV5A 1MBEA 1BL0A 1UMQA 4GFBA 4FISA 2QCOA 2HXIA 1IC8A 1TWHJ 5JLXA 4XK4A 3TP0A 2ID6A 2CU7A 3QQAA 4IHYA 1MSEC 4BY7J 2DA7A 3RQIA 2HYJA 3HGGA 4Y7NJ 3IH4A 3FIWA 1OCTC 1WI3A 1GDTA 2YU9J 4C3JJ 1QPIA 1LE8A 3OOUA 1BA5A 4JX6A 2CUFA 1NTCA 4DYQA 1QVUA 1ETWA 4D5FA 1MBKA 3BG3A 4CYCB 3S1RJ 1OCPA 2K40A 4A3MJ 2LP0A 3HM5A 1A6IA 3B6CA 2M9HA 1I50J 1LE8B 2HXOA 4B4CA 1WPKA 2HI3A 3H0GJ 4M6VA 3H3VK 1H88C 2LVSA 3BTIA 1AKHB 5EZGA 5FKNA 2K9QA 4W1UA 1Z0XA 2NVYJ 3BQYA 3OIOA 4A3KJ 2DMTA 5F27A 1BJZA 4B3AA 2M0CA 5E3LA 3BTJA 4I76A 1NK2P 1X2NA 3K7AJ 1Z77A 2EZIA 4W97A 5EEAA 4J19A 1MH4A 4BBSJ 3Q0UA 1A5JA 3A01B 3M3YJ 2AHQA 2LD5A 2ELKA 1ETVA 2LK2A 3MVPA 3NARA 3JRDA 1ZTRA
chains in the Genus database with same CATH superfamily
4Q4ZF 1J75A 2Y9YA 4CCNA 1OMIA 1P7JA 1X3UA 4LK1F 5ILUA 2WAFA 1XMAA 2IBDA 4IXAA 1PJRA 1XGMA 1L0OC 2NVQJ 4MFDA 5LFAA 5HLTA 3CESA 5E1XA 4C2TA 1B4AA 4QWQA 4ESJA 2QEXI 4QLCU 3SXYA 1K4SA 3JRAA 4LLLA 3DF8A 2O0YA 2HOTA 2DFFA 2W84A 1RR8C 1DGRM 1FOWA 3WGHA 3WHBA 3LSPA 2JRMA 2L9RA 4KICA 1MMNA 3HB9A 3PIOF 3GFJA 4AVPA 4C9YA 1VQOI 3S32A 1FBQA 2OF7A 4F3QA 4MQ9F 3JSOA 2NOGA 1I3QJ 1OR7C 1R9TJ 1F43A 3GCMA 3HGYA 1TC3C 3U21A 3OYKA 2J5PA 4I0BA 2XB5A 2HZDA 2G7HA 3PO2J 3A02A 4NUBA 3DTKA 1FT9A 4E6KG 3BOQA 3E6DA 4E7HA 1ZR4A 1U3EM 2NVUB 4XORA 4EVIA 3RIRA 4A3BJ 3AG4H 5J40A 3W2WA 1D0YA 1XC5A 2L01A 3ZPLA 2WWYA 5EEGA 3GVAA 2Y0SA 3LWFA 2ZMEC 4EJUA 2BY0A 5DS9A 3LSIA 2QLZA 4E70A 4UY8I 3OYDA 2FOKA 2QZ8A 1BI3A 2LKSA 2P81A 3V42A 1NHAA 3MZYA 5DV5A 4NQWB 2AXLA 2Z3YA 2VPRA 4RMNA 1USTA 2FX0A 1F36A 2GXGA 3O3KA 2A6TA 3G71I 3BCAA 4ON0A 1OYYA 3BJAA 3PIPF 5M5WJ 1MD0A 3EQLF 1LFUP 3CCEI 3M1CA 3HKZA 3V7CA 4L9VA 1WJDA 2XAJA 4BE2A 1FYKA 3HSEA 3F22A 4L5EA 1PUFA 4XMYA 2OTJI 1XMXA 3VODA 2VQCA 1HXDA 5HNFA 3B02A 2MBFA 3QYEA 2EFPA 5IOZA 1BR1A 5EYRA 2DLLA 2K4BA 3LNQA 2A5YB 5K7ZA 4JX5A 4LK0F 2KDZA 2YUSA 3WG7H 2XSDC 3S17J 2GQQA 3MKYB 3BDDA 1JTXA 3S2DJ 5CPRB 4RGXA 4M9ZA 1JGGA 3M8EA 4A0XA 4XKWA 4F7ZA 2XAGA 3BC8A 2Q8KA 3K6GA 2PFBA 1RPWA 1X1AA 4R79A 2OD5A 4F93B 2VQHA 3CCMI 1QPMA 2L0KA 1KYWA 2DBBA 1XGOA 4HX4A 4RM2A 3V8KA 3PQKA 2VJJA 2P5VA 4II3A 1YO5C 1JUPA 4M3BA 2CQ7A 1IN5A 4KT6A 4F91B 1HQCA 2NVXJ 5FKKA 2IA2A 2JVGA 5K5QA 4EJVA 2HDDA 2XAUA 3GW2A 1BI1A 3CLQA 2DT6A 1G2HA 4OIQF 2VBYA 4KUMA 2GA1A 1I1GA 5GTHC 1GXQA 3I56I 4YELA 2FF4A 2LR8A 1FC3A 3TO9A 5IT3A 2QENA 5F0FA 4IOAF 3T0YA 1ZRDA 3ZQ7A 2K3FA 3HTUA 3WU2C 5DM7F 1FYMA 3OS2A 4CCKA 5A2QZ 3M8JA 2LH9A 3QU3A 1LUJB 3KEYA 4BXFA 1Y8RB 3IHUA 2LY2A 4C3IJ 1ZK8A 2CUJA 2R7FA 4AU7A 1YTYA 1RNLA 3O2PE 5DTDA 1V3FA 5F0CA 5FD6A 5EG0B 2QSGX 1REPC 2V6CA 2ME0A 1EH7A 3RKQA 1LPQA 1LVKA 2CW0F 4EQQA 2R7ZJ 3I4MJ 2Z5UA 5LEJA 3GFMA 2H8RA 3LA7A 2LLKA 2DO7A 2XGEA 1MIJA 2Y30A 4DIQA 1PDNC 5FRMA 5C4JJ 1SFKA 2Y0SN 3KLOA 5LRSA 1LNWA 3I4PA 2EQRA 2JQ7A 2H27A 1H9GA 3OL4A 1HSTA 5IP6A 1OJLA 3FBIB 2R7SA 1GHCA 1YHQI 1P92A 2JVHA 3NAUA 2G9WA 2HU9A 3BLYA 5ICEA 2V1DA 1MBJA 1MJAA 1IN4A 1D8KA 2OCEA 2PJRA 3BG5A 4RB0A 2QWWA 2EFNA 1SANA 2MSYA 1A04A 2CJJA 1VNDA 4KT5C 3GUDA 3T8RA 1A6QA 2BY2A 4KITB 2J5OA 5BMZA 3C7JA 2W85A 1B72B 1ZH5A 2GOMA 4J00A 1IXCA 4C2MJ 1RR7A 1ETXA 1XDSA 4R1HA 3CJNA 2XRNA 4PDKA 1J7KA 3BCBA 5EGOA 2M8GX 1XB4A 4IHVA 2EFQA 3QOPA 4BHCA 2M4KA 3NWTA 3TKYA 4RB3C 4DYRA 4BNCA 3WTUC 2FQ3A 2LBFB 1H8AC 1UB9A 1LE8A 1VF9A 3QP5A 3OWTA 1JKOC 4F52A 3ZN0A 2D2WA 4BDZA 1SD4A 2K27A 3DTIA 2KHMA 3LQRA 3ESWB 2QBYA 1X2MA 5CQEA 2VC1A 4LFUA 1J59A 4BHBA 1SC7A 2BY1A 2RN7A 4JX4A 1RKWA 3HSRA 1FIAA 3FM5A 2DOAA 3WGIA 2MH9A 2KRFA 4A3FJ 4A3LJ 2ELJA 2BXZA 4IOCF 4BACA 1AKHA 3REOA 4BY1J 5LHGA 1MMSA 4CCLA 3S1NJ 2Z1DA 2H1KA 1J09A 2LG4A 4X6AJ 2LY9A 4BDYA 4LGWA 1AA7A 1VQPI 2RNJA 4UXNA 1SD7A 3H5NA 4IJAA 5FGMA 1I1SA 4YIFA 4XLPF 2GIVA 1V4RA 2W1OA 1QHHD 3EYYA 3ZCOA 4IKFA 4NDLA 4JYKA 3ISPA 1K78A 3JRCA 1U5TB 2COBA 2R7TA 2K9MA 1IDYA 1P4XA 1G3YA 2VASA 3WTZA 1G6NA 5D4RA 3PNVA 3L00A 3BTLA 2VIXA 1ODDA 1SFXA 2L9NA 3PSFA 4ENNA 2F2EA 3HPHA 4U87A 4HX8A 1SFEA 4CUGA 3ELKA 1U5TC 2DFEA 3ZQQA 3ZP5A 3P7NA 3J7AO 2PI0A 1N75A 2DA5A 1OR7A 5GAHJ 2ZXJA 3KLNA 3E6CC 2CSOA 3GF2A 4OOIA 2VKEA 4ITVA 3M9AA 5DUKA 1JKPC 4L5IA 3GTLJ 4AYBA 2WAQA 4FX0A 1WZ2A 2RGVA 4RGRA 1YX3A 3U1KA 5CJ9A 2IS6A 3HRMA 1YIOA 3LA3A 2A68F 2PQ8A 2C6YA 3PO3J 4AIJA 3IWZA 2HZTA 2BW3B 3JAMK 1MMGA 5IYDJ 3TDZC 2EZLA 4BBRJ 1O3TA 2F5FA 2BGCA 3M4OJ 3LA2A 5BPDA 2DT7B 4A6EA 3J80K 1FWZA 3OSGA 2M30A 1MGTA 5E1WA 1RI7A 3E97A 4P96A 1N78A 3GX4X 3HXLA 3OOPA 2ACJA 1T38A 4NQWA 3IP4B 4ZJZA 3RYRA 4EM2A 2Y0MA 4BUPA 2EIMH 2ZNYA 1WGXA 2GLOA 2R7WA 3W2VA 1ULYA 3A1YA 4PZJA 5TISC 2Y9ZA 4DOZA 3ZMSA 1SVOA 3MMYB 3TOAA 2WA0A 3DLAA 4II2A 3LSRA 3EUHC 4WX9A 3HOVJ 3BPVA 1N77A 2BHYA 3SZTA 5HDNA 3ZQCA 4U7BA 1F4KA 1B8IB 2EH3A 3KX2A 1W7PA 3S1MJ 2JTVA 1UG0A 2MH2A 1LFPA 4G7OF 6PAXA 4WXHA 1IN6A 2EIJH 4RGUA 1UMQA 3HRUA 2L9VA 4GFBA 1R5ID 4F92B 3G6EI 2CGPA 4GYGA 1BM9A 1DGWY 2FMYA 3G2BA 2X6YA 3W6JB 2GOXB 4G9YA 5D6FA 5FROA 2FSWA 1JGSA 4UVBA 2E7WA 5J4YA 5JFRA 1E17A 2LKPA 2CYYA 3HRTA 1OCTC 3R60A 4C3JJ 3OYHA 1MJBA 1KU7A 4EGYA 2OBPA 3OOUA 1QGPA 2E5ZA 2ICWG 2V26A 4JX6A 4XSXF 2CUFA 2EK5A 4I99C 5AIQA 3C18A 3TGNA 2ADUA 4DQ2A 4CYCB 3S1RJ 4MQVA 2K40A 4K2EA 5DUIA 1A6IA 2F4MB 2M9HA 3OIQA 2DFIA 2VC0A 2P5KA 3RKWA 1D1AA 4D9JA 1Z3XA 1R4MB 3H0GJ 1IXRC 3KE2A 4A0YA 1Y56A 2OQGA 5EZGA 2ZXWH 2O3FA 2WY8Q 2EA4A 2CS3A 1R5GA 1FY7A 3BQYA 3OIOA 1O3SA 2QM3A 4KYWA 5HOOA 1WKMA 3M1EA 3ZMVA 5DDGA 2ZFWA 2M0CA 5E3LA 4B3AA 2VOOA 2GWRA 4A12A 3BJ6A 1XDUA 1OYIA 2O03A 2O8XA 4CICA 3CO6C 1Z6TA 1NK2P 1QA6A 3K7AJ 2EZIA 3DFGA 3QOEA 2FXAA 4DNCA 2DXIA 4BL0B 4YRVA 4BE0A 4XLCA 2LDUA 3L09A 1KZHA 4GGGA 2LK2A 2V7FA 3MVPA 4IQJA 3JRDA 3FXQA 4JK1X 1WFXA 4A3DJ 1FTTA 3L1PA 4GYIA 2O9LA 2M45A 2VE8A 4AYBN 2WAQN 3HRSA 3ZRGA 4BAYA 1R71A 3CCRI 2W48A 4P9UA 1ITYA 3PM1A 4ZZLA 1VTNC 4HNVA 4XSZF 5LGNA 4I09A 4Y17A 1TNSA 4IF4A 2R92J 4OWRB 2XAFA 2Z2SB 3JRBA 3FX3A 4M72A 2F5VA 2L2OA 4D7NA 1FMVA 1BC8C 2FRHA 5ILVA 2V9KA 4ENKA 4I02A 4ZYHA 5IT9Z 1FEXA 4FT8A 4ABZA 4B43A 1E0EA 1OLTA 3WE3A 3F72A 5B66C 4BQQA 3C3WA 3L2UA 1T0FA 5GPCA 3BR2A 1QVTA 2JSCA 3CDLA 2KZGA 3LQQA 1FYLA 1FP2A 2E1MC 4XKCA 1UHSA 3GWZA 1H89C 2WADA 3EYIA 2MW8A 5GPAA 2CG4A 5GP9A 4I2OA 4DJAA 3HOWJ 3W2AA 1ETKA 2HYGD 3QP6A 1PVEA 4A2UA 4LLNA 1A31A 1WRJA 3WTYC 4HBLA 4U0WA 1O3RA 3GBGA 3VDXA 4I01A 1CF7A 1B72A 1V5EA 3DBLB 1ZG5A 1WHUA 2E1OA 4TV7A 4C3HJ 2Y2ZA 4IHTA 1IDZA 1LFBA 3G73A 3IRQA 1T56A 2DCEA 2FEZA 4HF0A 3ASNH 2V1XA 1BA5A 2DA3A 2KJCA 3CP8A 3CUQB 5E20A 2MYSA 4NC8A 1T98A 1UELB 5L3GA 2OA4A 4Q5SF 1FNNA 2L7KA 3J7ZI 3GTPJ 4ENMA 1MNEA 3OYIA 2GA2A 3MN2A 3H3UA 1SVMA 3CC2I 1IUYA 2HKOA 3HUGB 4Z6YA 1QQIA 2QGUA 1ZQ3P 4AIDA 4XQFA 1YIJI 2XHKA 3PNTA 4WXDA 3CCUI 1FJLA 2HQ5A 3DP7A 2DMQA 2A61A 2HGCA 2Q1ZB 4L9NA 3ECHA 1W0UA 3UKGA 2OV7A 3FXMA 2VE9A 5E8GA 3R6SA 1HKQA 1LJ9A 2MGQA 2JRTA 1DPRA 1ZYRF 4Q47A 4H4KC 1R22A 2LNBA 3J81Z 2M1BA 1G3SA 3E5XA 1UHMA 4XLAA 1KONA 2FJ1A 2H09A 1BI0A 4IQ4A 2O5RA 4UUVA 2EIKH 1D3YA 5DCMB 2PJPA 5FD5A 5D8LB 4M3DA 2DTZA 2QSHX 2O7OA 4YEJA 3ABLH 1Z7LA 3S2HJ 4RB1A 1O7LA 4AIKA 4AD9A 3F8BA 2I10A 2VXZA 2LREA 3MFKA 1YRNB 3K2AA 2JUGA 3KIOA 3F6VA 3BQZA 3HC7A 2CV2A 3FDYA 1Q1VA 3K9TA 2HDWA 1ZG1A 4FX4A 1F1ZA 1V5FA 4L5JA 1U5TA 3S15J 2HEOA 1KU9A 5CQGA 4XBFA 3NRVA 1Z7UA 2P0WA 1E2XA 2XGCA 3H0DA 4IHXA 4BQOA 1HCRA 2VL8A 4CH7A 1J2XA 4LMYA 2ESNA 4M3EA 9ANTA 3LOCA 5C3EJ 3R4KA 3VYSB 2D1HA 4HX7A 3F0CA 2XC7A 1TNTA 2Y31A 1YS6A 4GRIA 5E79C 2EFOA 5E17F 3BR6A 4XOTA 1S72I 4NB5A 4U0VA 2DTRA 4N9HA 2CRGA 3GYHX 4KIGA 2JSPA 1IRZA 4A3JJ 5D6EA 2IVMA 3OYNA 2CUZA 5K7FA 1WVRA 3I71A 1HKTA 3ABKH 1LQ1A 2FBIA 4RLFA 2DMPA 1IJWC 5L3FA 4L0ZB 2BW3A 5H20A 3WHCA 2KIUA 1ZELA 2KRHA 2M8EA 2DA4A 4BQNA 2VI6A 2Z16A 1S7EA 4AUXA 1WH5A 5GADJ 2HQNA 4D1QA 5J6XA 4XLNF 2ZKZA 4RS8A 4IRIA 3FK6A 2GM4A 1P6RA 3EUHA 3KP2A 2DFHA 1P9QC 1KU2A 1P4WA 4V2FA 3QPSA 3M8FA 2KKOA 2KMUA 2EB7A 4A6DA 2DAOA 2X51A 1X4OA 4E7LA 1SVLA 5IP9J 3ZQLA 2IXSA 3P9CA 1MNMC 2HTJA 3BR1A 2FUG2 1CQTA 1ETQA 4MIMA 2OPTA 2KFDA 3G4SI 1ZAOA 4A3EJ 3DWLE 2RAEA 3PQJA 4B1RA 4IX7A 2HS5A 1FP1D 5ICCA 2DW4A 1S5LC 1DUXC 2PEXA 2L3DA 4Q48A 2X48A 2ZNZA 4AVZA 2XF5A 5FLMJ 2OJED 4QPOA 2CFOA 3T1BA 2NOJB 2RREA 5J47A 1MNDA 2DQLA 3R0JA 1S3JA 2V9VA 4N4OB 1X3ZB 4J01A 4CYCA 2CQXA 2BV6A 1R5HA 1ETOA 1XN7A 4XNFA 2BEOA 3WTSC 4ZTFA 2JMWA 4QPQA 2NXNB 5FKMA 2W4SA 2HR3A 1TZLA 1FTZA 3AAFA 2R5ZB 3WTWC 1G4DA 1UCRA 1FLIA 3OY9A 2FOWA 1W36D 3O8HA 1XSDA 2FQ4A 3K4NA 3I9V2 3A0BC 3HHHA 3OYCA 5FJ8J 4Y4RA 3V4GA 3MEXA 2TCTA 1IRXA 3K4CA 1YOVB 5IYBJ 4IRGA 1YQAA 1YX5A 2R5YB 3LSJA 5B1BH 1B9MA 4PCQA 5BOXA 4EATA 3TW6A 1YJ9I 2L7ZA 3CLOA 3KZIC 2JK3A 4EGZA 5KVRA 3JRGA 2A05A 1TT5B 4G8XA 2CUEA 1YE9A 2Z9OA 5FB2A 1FX7A 1RUNA 3FMRA 4EMSA 3CJRB 4PJJA 2QQ9A 3NEUA 1IG7A 1U9NA 2ECBA 2JPCA 2GIZA 4HNUA 3KYLA 5C4XJ 4HZFA 1JXSA 2VLAA 1HC8A 2NS0A 2KT0A 4PFPA 3RJPA 4S0HB 3QPTA 4GCVA 2AO9A 4UVAA 1K7AA 2XF6A 3PFIA 1GV5A 2M87A 1JTYA 3FHNA 3ZOBA 2DA6A 3ZQFA 2ZJQF 4Y15A 2X6WA 5FKOA 4KISA 5F1JA 4B47A 4MHGA 2RDPA 2B63J 2EWNA 3RPQA 1BC7C 4BJTA 4Y3OA 3ZMZA 5C44J 2P6SA 1IXSB 4XN0A 3LAPA 3LAJA 1U9OA 2OC6A 1ENHA 5EF6A 4YFNF 3CC7I 4I7HA 2KIMA 1Q1HA 3SEZA 2VBZA 2P7VB 5J3LA 2M5WA 5L3BA 5B1AH 2D5VA 2LKXA 3HOTA 3PUFA 3ABTA 1T0FC 2WY7Q 3CZ6A 2XPVA 1S8NA 3S8PA 3RI4A 4FE7A 4HG2A 3T5XA 2V9PA 1TQIA 2YX4A 3OR1C 5K1YA 2E5NA 2MC4A 1ZGJA 2Z99A 4ESBA 2ZCWA 5GAGJ 4P1WA 4EJOA 1K61A 4NC7A 3RCOA 2KISA 3G1MA 5M5YJ 4PJ0C 4B09A 2XPUA 4MLOA 1RESA 2ZXHA 3M7GA 3U2RA 2ZSHB 2MD0A 3GZ5A 3VOEA 3BT9A 5J4VA 2ZJRF 5BS6A 3WGGA 1BIBA 1ONVA 5IPAA 5ED4A 3G3ZA 1FZPB 5E3OA 3IV5A 1Y0NA 4U0YA 2JT1A 3HUGA 5ILSA 3FMQA 1BL0A 3DV8A 4YFXF 1S6LA 2W00A 3IAS2 1LDJA 5D5WB 3OYMA 2IGMA 4RAZA 1XD7A 2HXIA 3SFZA 4AM3A 2PBIA 3TP0A 4M6XA 4IHYA 2FMLA 1YYVA 3QRFF 2W25A 3RQIA 3KZYA 4IHSA 4L0YB 5BPIA 3HG9A 3MQ0A 2AS5F 1IW7F 3EDPA 5DD8A 3KEOA 3AL0B 1T39A 3GZ6A 2ZJPF 3DEEA 3CCSI 1TTYA 1NTCA 1TT0A 4UVCA 1ETWA 2EPFA 2V4JC 2VJ4A 2XDVA 1R23A 1OQYA 3BG3A 5DCMA 2LF8A 2PMUA 3R0AA 2GXBA 3B6CA 2BVLA 2HXOA 3KYCB 2HI3A 4WK8F 4G7ZF 3AL0C 4DBQA 4M6VA 3QYBA 4CA0A 2K9QA 4W1UA 2F48A 4A3KJ 2DMTA 4E7SA 3H92A 2A07F 3Q9VA 3CJTB 5LHHA 2JPBA 3HHGA 3BTJA 4PFOA 3KPHA 4I76A 3KP7A 5KCMA 2BY3A 1X2NA 2RV8A 2HOEA 4RAYA 1X4PA 4W97A 5LBQA 1XSVA 4GXOA 1Z05A 3Q0UA 3B73A 4OINF 2UXNA 1FSEA 3M3YJ 2ELKA 5E18F 1EA3A 4U88A 4PK4A 3DKYA 2F4OB 3U9GA 3GFLA 1HA8A 4KDPA 1JUSA 3D1NI 1VQKI 1JKRC 2VKHA 3SHFA 1WCMJ 2CH0A 3EUKL 2H94A 1OPCA 2AXTC 2XF7A 1RUOA 2FBHA 1E3OC 1BBYA 2K9SA 3N05A 5K5OA 3GTMJ 2N8GA 4ETSA 1SAXA 1J9IA 1U6GA 1U2WA 2R4GA 2ETHA 3FXUA 2I5UA 1W36C 2F5EA 4RM3A 5DM6F 2YPRA 4YIRX 2CFXA 3K69A 3N97A 2UWMA 1EH8A 3BR5A 4AWXB 3QYFA 3J7AY 3QPLA 1V55H 5E1ZB 2HKXA 2BVMA 3FXJA 3L9FA 3A03A 1OFCX 2KRCA 4RLQA 2L4MA 2M3AA 2MA3A 2JUCA 3AG3H 3L2QA 1Z9CA 1VQ8I 2K4JA 4BKXA 3HTSB 2M34A 3V8JA 3L2CA 1EV7A 3BZCA 3CMAI 4MTDA 3HJEA 5FRNA 2EZKA 4GO1A 1FPQA 5J1YA 1MMDA 4FE4A 4WWCA 1QU3A 2MD5A 2F6CA 3FKIJ 2E1NA 3HOZJ 3FISA 1B6AA 1MJ9A 1WI9A 2X1DA 2M2EA 4DGWB 2CQQA 4XRMA 3P5JA 4OU0A 3OMYA 4ZYDA 2L7FP 2JZYA 2V6EA 2WAEA 2L54A 3VB2A 1JKQC 5KNLA 4OMYA 3MZ8A 3DPTA 3E6MA 2HVSA 1TW2A 2AQFA 2P5LC 2B0LA 3O6BB 4CHUA 1YW7A 4IVNA 1CGPA 4WXCA 2G0EA 3S16J 4L18B 1D0ZA 5F04A 2F4IA 5K7HA 4HF2A 3S3MA 4LG0B 5J8FA 3H36A 3VSKA 4V2GA 2KQRA 1HDPA 4DZPA 1T8IA 2X1CA 2LYCA 4P9FA 3CCJI 2EFWA 3E7LA 3OYAA 2IT0A 2NYXA 1BR4A 3FZVA 3FXRA 3UNGC 1UG2A 5DYMA 1R4NB 1VQ7I 1XGNA 5FLVA 1BI2A 2IS1A 3LSKA 1ZRCA 3TO6A 3GTKJ 2YR2A 1EH6A 2KIQA 1Y6IA 4EM1A 2NRAC 3DQVC 2OQRA 3Q9SA 3SZGA 4ZDPA 1R6RA 3N4MA 4IRHA 1ZKGA 1FIPA 4FQGA 3KYDB 2R0QC 4S04A 3LSMA 3V7SA 1TBXA 2RC4A 4XRFA 1KU3A 2H8WA 3TMOA 3LSTA 3JREA 2EV6A 4ZYAA 5HS8A 2ZC2A 4FTHA 3MCZA 5TJJA 2IRFG 2R5YA 3PJRA 3HZJA 1V5GA 3K70D 3CO7C 4D5CA 2UXXA 1QNTA 5F64A 1QO0D 2P8TA 2DOFA 3OYBA 5L3CA 1YFHA 1SFOJ 5EG0A 4LLGF 4N9IA 3PUBA 5M5XJ 3IH3A 2VBWA 1GV2A 2KIFA 3D0SA 5M3MJ 3K4MA 3MZHA 1HW1A 2VODA 3QPHA 1AHDP 1D5VA 3BP8A 2HQRA 4X1EA 3AFHA 3E3VA 1HSJA 3QU6A 4N0BA 3WTVC 4G6QA 2KL4A 5JLWA 1T33A 3E5UA 1O4XA 5D5VB 1QZYA 3K1MA 4A3GJ 1QBJA 2LMDA 2QKLB 2X6XA 2P4WA 3GLLA 4ESFA 4OMZA 3RPUD 2PG4A 3OYLA 1Y8QB 3FXKA 1I6HJ 1XCBA 5CVRA 2K85A 1E3HA 4QTRA 2Y69H 4U7DA 2IEKA 2DJIA 1R36A 2DK8A 5M3FJ 2XUBA 3JRIA 1BN5A 1FOXA 3F8MA 2DA2A 3OV8A 4EV0A 3BZ6A 1X1PA 3JAMZ 1Y1VJ 5HVQC 1P2FA 2CO5A 2R7RA 3SQNA 4ZZDA 3HOUJ 5FLXZ 3CD6I 3CMYA 5LGTA 2NS7A 3J80Z 4EEFG 2HPIA 2YX7A 4XL9A 5FO5A 3DEUA 1WH7A 2VJIA 1HW5A 2E71A 1TWFJ 5H6RA 2K9NA 4KIBA 5IYCJ 2COMA 1D1BA 1ZARA 3ZR8X 1OKRA 1EKEA 5IP7J 3RQ4A 5JI6A 3CC4I 4CZZA 2BXYA 3FBNB 3CDIA 4AC0A 3JTGA 4XKVA 4BJ5C 2LBFA 2ZFUA 4XLFA 4L9TA 4P5OA 2HTSA 2YS9A 1W5SA 2FBKA 2CV1A 5JVTA 2JJ7A 2X0LA 3CUQC 1IRGA 4HEA2 4UB8C 1WQ2A 2V1UA 3C2BA 3JRHA 2M7BA 3RKYA 3BZKA 2IAIA 1O57A 1POGA 1Y1WJ 3OSFA 4IHWA 2DQRA 1HW2A 4A3IJ 1X1DA 3GZNB 1WJAA 3KP4A 4G6TB 3MKLA 5F1RA 1HOMA 1SFUA 1Z3YA 3IC7A 3ZQHA 1A36A 4BXXJ 1WWXA 1I27A 5HS9A 5D5XB 3CF5F 2LSOA 3CCQI 3GXOA 5KHDA 2EV0A 1P4AA 1XS9A 2JA5J 4QIWN 5K5RA 3AKZA 4C2UA 1YW8A 3K1NA 4UHTA 1G3WA 3MKZA 4JBAA 3LL7A 3WG9A 4UV8A 5CVJA 1IUFA 2GBYA 4QSHA 3TBIA 2DODA 1MBGA 4XN3A 5LLQA 3DPUA 2DOEA 2UUZA 4LB6B 1ZREA 3MKWB 5GAEJ 5LRRA 4E7ZA 2LF7A 5HDGA 3ONQA 4HLYA 3VEPA 3FM3A 2LC2A 5ERIA 1O7FA 3TOBA 3Q3SA 4X0GA 2EA2A 5D5UB 1JT6A 3OS1A 3S14J 3CTAA 4CYDA 2EINH 2CWEA 2IGNA 4M71A 4L9JA 4LOCA 1R1TA 1TLHB 1OYWA 4HV5A 1K83J 3NQOA 2MG4A 5A2QK 3TW7A 3TP3A 4B48A 2PLYA 1BW5A 2GZWA 2RQPA 1BR2A 4R8HA 4RGSA 1VFCA 4UUTA 4UB6C 3BTCA 1FBUA 4Z2YA 3ROUA 4CDGA 1ON1A 5GTIC 4LJZF 1ZR2A 1ZLJA 1TL8A 3P9IA 1UJ8A 2BHZA 4HOBA 2DMUA 4G7HF 3ABUA 3I53A 2V1NA 5KAIC 4HW0A 2NNYA 2DA1A 2QKMB 4DBRA 3PFYA 3LMMA 3S93A 3ZXSA 1X1BA 3CCLI 3L7WA 4MFEA 4FCYA 1MKMA 1UZCA 4XRSG 3CMEI 3K4LA 5DCFA 1K4TA 2X1EA 5B3SH 3NWSA 4DYCA 3VPRA 1YS7A 1KGSA 2L02A 3BR3A 3SJMA 4B3XA 1RRJA 4UUSB 2VUMJ 4BGDA 3K70C 2XRLA 2QA4I 1YLFA 3HDDA 1G8XA 3ZQGA 1MH3A 1RIOH 1L3LA 1HDDC 4M74A 3S3NA 1IV8A 4CCMA 5HLGA 2VB6A 1C0WA 2ZMEB 2VKDA 2ISYA 2YU3A 1ZRFA 5HLHA 1H9TA 4WCGA 2X6OA 3RZDJ 3GFIA 2Y48A 1JUMA 2NS8A 4LIUA 3CMMA 3HEFA 2XV4S 1B8IA 1R00A 1K79A 2JN6A 1PUEE 2Q0OA 3CCYA 1WJEA 3GMEA 3KFWX 4KN7X 2ISZA 5CVVA 4MO7A 1XTAA 4M73A 4JP0A 4A0ZA 2ZB9A 3DLLF 4D0PA 1GXPA 4YFKF 1MBEA 4BEHB 4LG0A 4FISA 2L4AA 2ZJ2A 1M1EB 1V54H 4HRIA 2QCOA 3GLXA 2ZXIA 4XONA 1VQNI 1W7PB 1NG6A 1IC8A 3AG1H 2PMZA 4JOMA 3RKXA 1X19A 2A6EF 2ID6A 2CU7A 3PL8A 4E7KA 4XKBA 1MSEC 4BY7J 2MLGA 4YG2F 1UHWA 3KEQA 3HGGA 3IH4A 1IRFA 3FIWA 4B8XA 1GDTA 2YU9J 5HDKA 2W57A 2CQNA 5H6QA 4I98B 4ASNA 1AOYA 3VWBA 4I0AA 1D1CA 1QVUA 3VSLA 5LEKA 2VPLA 1LDDA 4PGGA 1MBKA 2OCCH 1B1BA 2LP0A 2P6TA 2OTLI 4MEYF 3SYTA 1I50J 2L5QA 1LE8B 4B4CA 1WPKA 5FFXA 3A4CA 2LVSA 3BTIA 2KJBA 2JA2A 2W24A 3DKXA 4O6JA 4RAGA 2HYFA 3LFUA 2BYVE 3OYFA 4MGRA 2CW7A 5F27A 3KCCA 3F6OA 1W5TA 3LFKA 3KZZA 4KJZA 2DT5A 5AONA 4LD5A 3HPGA 2BE5F 1IN8A 1S7OA 1IF1A 4BHPA 4CCJA 2IGOA 4HYEA 4EJWA 4BBSJ 4KNYA 2OUMA 4FETA 4PJNA 2CW8A 5D8KB 2AHQA 4CZCA 3A01B 1FOYA 4HF1A 1ETVA 2WV0A 1JHFA 4H0EA 1QHGA 2DYRH 2ZBKA 4MTEA 1ZTRA 2UZKA 2O61A 2X9DA 3ZMDA 3A0HC 4BJ6C 4M3FA 4IZZA 3BROA 3FMSA 3CUOA 2WV1A 2DYSH 2E34A 2XGXA 3BWGA 3SDBA 3I59B 3K2ZA 2WTEA 3F8CA 5JHUA 1RKTA 4CCOA 1OCRH 5CKTA 2JWTA 4BS9A 2NVTJ 1U78A 1WJFA 2XVCA 5HNHA 1SD6A 1WJ5A 2HOAA 5E8IA 2DK5A 2L9SA 1GUUA 1BIAA 3HIFA 2LY1A 2NNNA 1NK3P 3H5AA 1LEBA 3D5SC 4BYYA 3OS0A 4A69C 1YJNI 2JA7J 5JR3A 3O8GA 3MD2A 4HQMA 3BY6A 2MFZA 3OIPA 2RQQA 3WU1B 2X85A 2XASA 1IGNA 2IS4A 1K6YA 1H0MA 2XB0X 3P9KA 5F6FA 3E6BA 1ZGWA 4BU2A 5D4SA 1I5ZA 3DTEA 1GT0C 1JI8A 2OU2A 3OYGA 3EPZA 1E3PA 2Y75A 4A5NA 3ERMA 3CUQA 2E36A 4ANJA 3F9KA 1KQ0A 1ZHFA 1Y0UA 3HKZN 1HF0A 1IAWA 3BPXA 3CF2A 4OIOF 3I4NJ 1MDMB 2JA6J 1LB2A 3DXJF 3WTXC 1CF7B 3HOYJ 1W0TA 3IKTA 4G94A 4HSTA 4RB2C 2PMZN 1ON2A 2KP6A 4PJLA 1WJCA 2DPDA 2WBMA 1KYZA 2V79A 3I0TA 2DPUA 3BR0A 1SAUA 2F5DA 3FXLA 1XG1A 3JTHA 2VXDA 4ZDLA 2IP2A 3Q0WA 3ERED 5JVGF 1AWCA 4BH9A 4ZDOA 1DPUA 3H3ZA 2BOLA 3HOXJ 2OZ6A 3VYUB 4OAZA 5EJCA 1TW3A 2ELHA 1AU7A 1QZZA 4KMFA 3K10A 4FHTA 4HQEA 3C1DA 4A5MA 3IRRA 1MW7A 1KA8A 1YW9A 1DU6A 4IEJA 4XRSA 1SEUA 2QUFA 4NNJA 1GVJA 1Z91A 1BJAA 2D1VA 3H9GA 4NC6A 2PN6A 2WB1A 4E4HA 1JE8A 1OCOH 2EILH 3X2QH 3C2HA 1YRNA 2O6GE 3ZN1A 1VQMI 4ZC3A 5LD2C 3BG6A 5IY5H 1R58A 2VT3A 1T6SA 2I8DA 4HAMA 2E19A 3EETA 3F3XA 2Q2EB 3DEWA 4KN4X 4LIVA 3PSIA 3W6VA 2KDOA 5E3MA 1FSHA 3L2VA 1D0XA 1U8BA 3SDGA 2K7LA 3ECOA 3TEDA 4DW6A 1VI0A 3ML6A 2PMHA 3BG9A 1EJ9A 3DBRB 2DN0A 4MNUA 2H1LA 1RC9A 4XOPA 1Z6RA 5EDNA 4OIPF 2XGDA 2QQAA 4E7IA 3ABMH 3FF5A 3L2RA 3DU6A 3FHZA 3E1SA 2HVRA 2K5CA 2BZTA 2XKOA 4HPQA 1X3WB 1S29A 3JRFA 1XGSA 5FFZA 3R61A 3Q0VA 1IN7A 2M4GA 1XMKA 3GTOJ 2QVOA 4PUSA 1YI2I 2FA5A 3HL2A 1BOBA 4RA2A 1EF4A 4A3CJ 1MZBA 4KFCA 1YITI 1TP4A 2XKPA 4NHJA 4P55A 2EBIA 3GTGJ 1G59A 3RTRA 4LB5A 2MABA 4OAYA 3FK7A 5LGUA 4E7JA 1P7IA 2DU9A 2IA0A 3OR2C 5IT9K 2MC3A 1DP3A 2K02A 3CQZJ 1PP7U 4AIHA 1FMWA 1TWAJ 1SD5A 2DDAA 2XROA 4UUSA 2VKVA 4CGZA 1BW6A 3HBLA 3MAJA 1KQ8A 1LEAA 1WSUA 3ZMTA 4Y13A 1F5TA 5CVIA 2E2HJ 1QRYA 4ZYEA 2ZMEA 1WJBA 3E0JB 2OAZA 5DEQA 1DQUA 2GAUA 1ORKA 5E3NA 4RDUA 2ME6A 2ZSIB 4PJMA 4HDUA 4PSWA 2RKHA 2KPMA 1G3TA 3RPUA 3E5QA 5FLXK 4D7MA 3D5RC 1TWGJ 3U1DA 4Y33A 4G6DA 4A93J 3SFIA 2VBXA 5IOYA 2ZO4A 3L2WA 1DP7P 2DI3A 3WTTC 4JQFA 4YIIA 1DU0A 2FU4A 4M9XA 1ACIA 1I6XA 2W7NA 2Z33A 1J5YA 1MSFC 2XPWA 1IO2A 2STWA 3K4KA 4RAFA 1TQMA 3B6AA 2JA8J 5H2FC 1VQ5I 2E1CA 4DZJA 2K3PA 3TL4X 5J1UA 2QSFX 2R7XA 3S1QJ 1N25A 3G1LA 1R1UA 1NG7A 3ZQIA 5KAFC 4RBOA 1JJ8C 2E2IJ 4BEHA 5HODA 3I3LA 1I39A 1T2KA 1USSA 1VQLI 3LSGA 4KMUX 1PUFB 2E7XA 4WF2A 2D45A 1GVDA 2P7CB 4BXUA 1R1VA 1STZA 4F55A 1XSXA 5CYVA 2ECCA 2CMPA 1APLC 4HA8A 3LSHA 2H6CA 4PGHA 1QZEA 2QQ8A 2CQKA 2VT2A 2VONA 2WB1N 1F9NA 1Z1DA 5LHIA 4XR6A 1RZ4A 1XCVA 5TGTA 5L3DA 2M7AA 2K86A 1D5YA 4N4NB 2K9LA 3FWEA 1YJWI 1VQ4I 2LTPA 4Y52J 1LKXA 2R7DA 3J81K 3GTJJ 3JCUC 2HOSA 3VYRB 2EJRA 2R5ZA 3UR3C 3IAM2 2E35A 2A5WA 3ASOH 3I54A 1B59A 3DPLC 2AQEA 2TDXA 1OCZH 1T95A 1TWCJ 2EZHA 1SMYF 4ZTJA 2HFHA 2R7VA 4M3GA 4HDVA 1PYVA 2UV1A 1ETYA 4IL6C 4LITA 2O8KA 5F0HA 3K4BA 1TQPA 3DCFA 2GXAA 2RNGA 4HNTA 1ZLKA 1MBFA 3KETA 2X4HA 3EUAA 2ESHA 4XIDA 2M0MA 2PX9A 3BG7A 1I3AA 3DKWA 1DDNA 1S9HA 2HQAA 2E2JJ 2NAZA 3H35A 3I64A 3A01A 4ENJA 3IL2A 5BNGA 4OIRF 2RVCA 4G12A 3SEQA 3TO7A 1D8JA 2IW5A 2R7QA 3I55I 3Q5FA 3F8NA 2DJNA 3H5RA 3FKJA 5EZHA 2XIGA 4MEXF 2IA1A 3C2GA 3G1OA 2A6HF 3K1PA 4XLHA 2R3SA 1NH3A 3I59A 3K0LA 4XM3A 1Z67A 4EM0B 1ERDA 3GTQJ 3TQNA 3MWMA 5ICGA 1IV6A 4IPAA 1K6OA 3S2WA 3T8TA 2VQLA 3IKVA 3AG2H 1ZN2A 1VZ0A 2HNHA 3I58A 2HPMA 4C30A 5DD4A 3S3OA 2L7MP 1ZGAA 2LFBA 5BQTA 3OL3A 2R7UA 1Y39A 2QF7A 3F21A 2HVQA 4BQAA 1UFMA 1VQ6I 1BOAA 1KQ9A 1U0JA 5CVUA 4ZYGA 2E1MB 4ZH4F 2QQBA 3IH2A 1RETA 1JHHA 2XAHA 4UV9A 2STTA 2DDBA 4S05A 3BJOA 1Z21A 2OZUA 4XICA 3CP2A 2R93J 4KIFA 2FD5A 1MMAA 1R7JA 2LOOA 3V7RA 3RYPA 2B9SA 3CJQB 2FNAA 1PP8F 1HLVA 1YG2A 3COAC 2ID3A 4CXFA 5F08A 1JT0A 3JW4A 1HBXG 1FBSA 3RDIA 3RSNA 1W7PD 5J1RA 4O3MA 3D5LA 1JJ6C 1ZG3A 2A3SA 4V19K 3KP6A 5AIPA 3IWFA 5CLSA 2TRTA 1J0RA 4HLXA 2DMNA 3JR9A 2PJRB 4HV6A 3RZOJ 5FKLA 1MDMA 2B7EA 3QAHA 3DU5A 1X58A 2EV5A 4I6ZA 1XPXA 4LG3A 1OCCH 4XLEA 3K4JA 1LDKB 5KK1A 5ICFA 4CO8A 3QWLA 5B5EC 5EGOB 2LRDA 1MBHA 3PNYA 3ULQB 4BE1A 4UNOA 4IO9F 3CCVI 4HSRA 2FE3A 3J7YJ 1A35A 3SZPA 3HOSA 2E60A 1T08B 3F23A 2HDCA 2WC2A 3H9JA 2IPQX 1TWHJ 1W4MA 4XK4A 5JLXA 3OYJA 3QQAA 5L3EA 2DA7A 2VQGA 3CDHA 1S7AA 3I5UA 4FASD 2CV0A 1LVAA 2HYJA 4O5VA 4Y7NJ 4M6YA 4CSWA 3HSFA 1WI3A 2QBYB 1QPIA 2YSRA 1FOKA 2IS2A 1IZ1A 2BBYA 3W6KB 2F5CA 4M9SA 1X1CA 1OISA 4DYQA 3W3CA 3GEZA 2IJLA 4D5FA 4KA4A 2VOPA 5JHFA 1GLNA 1OCPA 4A3MJ 1B9NA 5J8CA 3HM5A 2MLKA 3WE2A 1U8RA 3GO5A 3H1CA 3QODA 4EJTA 2R7OA 3IUOA 2Q2EA 2KLOA 2W82A 1H88C 3H3VK 1AKHB 3VFZA 3HYIA 2A69F 3DBHB 5FKNA 3H9QA 4GDFA 5TRDA 3A2KA 1Z0XA 2NVYJ 4B44A 1SMTA 3WODF 3WU0A 4PSXA 3V8LA 1W1WE 2FNPA 1BJZA 3KP3A 3TDUC 3VYTB 5HS7A 1R49A 1UAAA 2H6BA 1W5CC 1VQ9I 5HLIA 3F8FA 1O3QA 3ZMUA 3M07A 2XSJC 2VN2A 3FXOA 1XX5A 1Z77A 2VJ5A 3JSPA 2KZVA 5EEAA 5EEHA 1MH4A 3KP5A 3ZGKA 4J19A 3OYEA 1A5JA 2LD5A 2G7UA 1HKSA 4NBQA 1K78B 2IGKA 3NARA 2HWVA 2QYOA 2XAQA
chains in the Genus database with same CATH topology
2Y9YA 4A3DJ 1P7JA 1FTTA 2X9DA 3L1PA 4M3FA 2O9LA 1JUSA 3D1NI 4AYBN 2WV1A 2WAQN 1JKRC 2IBDA 2W48A 1WCMJ 1ITYA 3PM1A 2NVQJ 1RKTA 2JWTA 4MFDA 4HNVA 1E3OC 2NVTJ 2R92J 2K9SA 3GTMJ 1U78A 2N8GA 3JRBA 3JRAA 4D7NA 2HOTA 2HOAA 1GUUA 3WHBA 3LSPA 1FEXA 1NK3P 2L9RA 4ABZA 3HB9A 4A69C 2OF7A 2NOGA 1I3QJ 1R9TJ 2JA7J 3BR5A 1F43A 5GPCA 3HGYA 3BR2A 1TC3C 1QVTA 3QPLA 3CDLA 3O8GA 2XB5A 1IGNA 3PO2J 3A02A 3A03A 1OFCX 1UHSA 2XB0X 1H89C 2MW8A 5GPAA 1ZGWA 1ZR4A 5GP9A 4A3BJ 1GT0C 3HOWJ 1XC5A 1ETKA 4BKXA 5DS9A 2M34A 3GBGA 2EZKA 2P81A 5J1YA 1B72A 4FE4A 2E1OA 2VPRA 3FKIJ 3HKZN 4C3HJ 1HF0A 3FISA 2FX0A 2Y2ZA 1F36A 3HOZJ 1LFBA 1IDZA 2M2EA 2CQQA 4XRMA 3I4NJ 1T56A 5M5WJ 2JA6J 2DA3A 2L7FP 1LFUP 3HOYJ 1W0TA 1JKQC 2PMZN 4L5EA 3GTPJ 1PUFA 3BR0A 3S16J 2G0EA 3MN2A 1XG1A 5F04A 5IOZA 5EYRA 5K7HA 3LNQA 3Q0WA 1ZQ3P 5K7ZA 4JX5A 2KDZA 1FJLA 4V2GA 1HDPA 2HQ5A 2DMQA 2YUSA 4DZPA 2XSDC 3HOXJ 3S17J 1JTXA 3S2DJ 1W0UA 3UKGA 1JGGA 1AU7A 3E7LA 2MGQA 1DU6A 1UG2A 4IEJA 4XRSA 1RPWA 5FLVA 3GTKJ 2FJ1A 2L0KA 1YRNA 1ZKGA 1FIPA 4M3DA 2DTZA 1JUPA 2O7OA 4M3BA 2E19A 2R0QC 3DEWA 3S2HJ 2NVXJ 5FKKA 3W6VA 5E3MA 2I10A 1YRNB 2HDDA 3K2AA 1U8BA 3SDGA 1G2HA 3BQZA 3JREA 4FTHA 1Q1VA 3TEDA 4DW6A 1VI0A 2R5YA 3BG9A 3S15J 2DN0A 4D5CA 2LR8A 5EDNA 2XGDA 5F0FA 2XGCA 4IHXA 1SFOJ 1HCRA 5EG0A 4M3EA 3JRFA 9ANTA 3LOCA 5C3EJ 5M5XJ 3IH3A 1GV2A 5M3MJ 3Q0VA 3F0CA 3GTOJ 2Y31A 4C3IJ 1ZK8A 1AHDP 4X1EA 3BR6A 1EF4A 4A3CJ 5EG0B 2EBIA 5DTDA 5F0CA 3GTGJ 5JLWA 1T33A 2ME0A 2CRGA 3RKQA 1O4XA 3FK7A 4A3GJ 1P7IA 1IRZA 4A3JJ 2R7ZJ 3I4MJ 3CQZJ 5K7FA 2H8RA 2LLKA 1TWAJ 1I6HJ 2XGEA 4UUSA 2VKVA 2DMPA 1BW6A 1IJWC 2Y30A 4QTRA 5C4JJ 3HBLA 2IEKA 3WHCA 2Y0SN 2EQRA 5M3FJ 2DA4A 2VI6A 2E2HJ 3JRIA 1S7EA 1QRYA 2DA2A 4AUXA 1WH5A 5IP6A 1Y1VJ 1OJLA 1ORKA 5E3NA 4RDUA 2ME6A 3NAUA 3FK6A 2GM4A 3HOUJ 3CMYA 2NS7A 4EEFG 1MBJA 1WH7A 4D7MA 1TWGJ 1TWFJ 3BG5A 4A93J 2K9NA 3SFIA 1SANA 2MSYA 4V2FA 2CJJA 1VNDA 5IYCJ 5IOYA 3QPSA 1DU0A 5IP7J 1B72B 4C2MJ 1MSFC 1RR7A 1ETXA 2XPWA 3B6AA 4AC0A 2JA8J 4DZJA 5IP9J 5J1UA 5EGOA 3G1LA 2YS9A 2M8GX 3ZQLA 4IHVA 1MNMC 3ZQIA 2E2IJ 2JJ7A 3BR1A 4RBOA 1JJ8C 1CQTA 1ETQA 4MIMA 5HODA 2OPTA 4DYRA 3C2BA 3JRHA 4A3EJ 3LSGA 2IAIA 2RAEA 4B1RA 1PUFB 1POGA 1Y1WJ 1GVDA 3OSFA 1H8AC 1VF9A 4IHWA 4A3IJ 2ECCA 1JKOC 1APLC 2X48A 3MKLA 5FLMJ 2WB1N 1HOMA 3ZQHA 4BXXJ 1X2MA 1D5YA 2LTPA 4Y52J 4JX4A 1XS9A 1RKWA 3GTJJ 1FIAA 2HOSA 4QIWN 2JA5J 4CYCA 2CQXA 2R5ZA 1ETOA 4A3FJ 2JMWA 4A3LJ 1TWCJ 5FKMA 1IUFA 2EZHA 1AKHA 4BY1J 2GBYA 4QSHA 1FTZA 3S1NJ 2H1KA 1MBGA 4M3GA 2R5ZB 1ETYA 4X6AJ 2LY9A 5F0HA 2O8KA 3DCFA 3O8HA 2FQ4A 1MBFA 4XIDA 3Q3SA 1JT6A 3S14J 5FJ8J 2E2JJ 2TCTA 5IYBJ 3A01A 4NDLA 4LOCA 4JYKA 3JRCA 5BNGA 3LSJA 2R5YB 4G12A 2COBA 1K83J 2MG4A 3TW6A 1IDYA 2L7ZA 3TP3A 3TW7A 1BW5A 2DJNA 2JK3A 3BTLA 1VFCA 5EZHA 3JRGA 4UUTA 3BTCA 1ZR2A 2CUEA 3G1OA 2DMUA 3GTQJ 1IG7A 1U9NA 2ECBA 1IV6A 5C4XJ 2DA5A 2KT0A 2DA1A 4S0HB 2AO9A 2VKEA 1GV5A 4MFEA 4FCYA 1JTYA 2L7MP 3ZOBA 2DA6A 3ZQFA 1JKPC 4XRSG 3S1QJ 2LFBA 3GTLJ 5FKOA 5F1JA 2B63J 2QF7A 4DYCA 5C44J 3VPRA 1U9OA 3BR3A 3SJMA 1ENHA 5EF6A 4UUSB 3IH2A 2VUMJ 1RETA 3PO3J 2XRLA 5J3LA 4XICA 3HDDA 2R93J 2FD5A 5IYDJ 3ZQGA 1MH3A 1HDDC 2D5VA 2EZLA 4BBRJ 2LKXA 1HLVA 2ID3A 3M4OJ 5F08A 1JT0A 3OSGA 2XPVA 4FE7A 5J1RA 1JJ6C 2X6OA 3RZDJ 2TRTA 2DMNA 3JR9A 1K61A 3RZOJ 5FKLA 1WGXA 1JUMA 2NS8A 2GLOA 3HEFA 3G1MA 1B8IA 2JN6A 5M5YJ 2Y9ZA 3CCYA 2XPUA 4MLOA 1RESA 1X58A 4MO7A 3LSRA 4JP0A 4I6ZA 3HOVJ 3BT9A 2ZB9A 3ZQCA 5IPAA 1B8IB 2EH3A 5EGOB 5E3OA 3S1MJ 1MBHA 3IV5A 1MBEA 1BL0A 1UMQA 4GFBA 4FISA 2QCOA 2HXIA 1IC8A 1TWHJ 5JLXA 4XK4A 3TP0A 2ID6A 2CU7A 3QQAA 4IHYA 1MSEC 4BY7J 2DA7A 3RQIA 2HYJA 3HGGA 4Y7NJ 3IH4A 3FIWA 1OCTC 1WI3A 1GDTA 2YU9J 4C3JJ 1QPIA 1LE8A 3OOUA 1BA5A 4JX6A 2CUFA 1NTCA 4DYQA 1QVUA 1ETWA 4D5FA 1MBKA 3BG3A 4CYCB 3S1RJ 1OCPA 2K40A 4A3MJ 2LP0A 3HM5A 1A6IA 3B6CA 2M9HA 1I50J 1LE8B 2HXOA 4B4CA 1WPKA 2HI3A 3H0GJ 4M6VA 3H3VK 1H88C 2LVSA 3BTIA 1AKHB 5EZGA 5FKNA 2K9QA 4W1UA 1Z0XA 2NVYJ 3BQYA 3OIOA 4A3KJ 2DMTA 5F27A 1BJZA 4B3AA 2M0CA 5E3LA 3BTJA 4I76A 1NK2P 1X2NA 3K7AJ 1Z77A 2EZIA 4W97A 5EEAA 4J19A 1MH4A 4BBSJ 3Q0UA 1A5JA 3A01B 3M3YJ 2AHQA 2LD5A 2ELKA 1ETVA 2LK2A 3MVPA 3NARA 3JRDA 1ZTRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y9Y A;  4A3D J;  1P7J A;  1FTT A;  2X9D A;  3L1P A;  4M3F A;  2O9L A;  1JUS A;  3D1N I;  4AYB N;  2WV1 A;  2WAQ N;  1JKR C;  2IBD A;  2W48 A;  1WCM J;  1ITY A;  3PM1 A;  2NVQ J;  1RKT A;  2JWT A;  4MFD A;  4HNV A;  1E3O C;  2NVT J;  2R92 J;  2K9S A;  3GTM J;  1U78 A;  2N8G A;  3JRB A;  3JRA A;  4D7N A;  2HOT A;  2HOA A;  1GUU A;  3WHB A;  3LSP A;  1FEX A;  1NK3 P;  2L9R A;  4ABZ A;  3HB9 A;  4A69 C;  2OF7 A;  2NOG A;  1I3Q J;  1R9T J;  2JA7 J;  3BR5 A;  1F43 A;  5GPC A;  3HGY A;  3BR2 A;  1TC3 C;  1QVT A;  3QPL A;  3CDL A;  3O8G A;  2XB5 A;  1IGN A;  3PO2 J;  3A02 A;  3A03 A;  1OFC X;  1UHS A;  2XB0 X;  1H89 C;  2MW8 A;  5GPA A;  1ZGW A;  1ZR4 A;  5GP9 A;  4A3B J;  1GT0 C;  3HOW J;  1XC5 A;  1ETK A;  4BKX A;  5DS9 A;  2M34 A;  3GBG A;  2EZK A;  2P81 A;  5J1Y A;  1B72 A;  4FE4 A;  2E1O A;  2VPR A;  3FKI J;  3HKZ N;  4C3H J;  1HF0 A;  3FIS A;  2FX0 A;  2Y2Z A;  1F36 A;  3HOZ J;  1LFB A;  1IDZ A;  2M2E A;  2CQQ A;  4XRM A;  3I4N J;  1T56 A;  5M5W J;  2JA6 J;  2DA3 A;  2L7F P;  1LFU P;  3HOY J;  1W0T A;  1JKQ C;  2PMZ N;  4L5E A;  3GTP J;  1PUF A;  3BR0 A;  3S16 J;  2G0E A;  3MN2 A;  1XG1 A;  5F04 A;  5IOZ A;  5EYR A;  5K7H A;  3LNQ A;  3Q0W A;  1ZQ3 P;  5K7Z A;  4JX5 A;  2KDZ A;  1FJL A;  4V2G A;  1HDP A;  2HQ5 A;  2DMQ A;  2YUS A;  4DZP A;  2XSD C;  3HOX J;  3S17 J;  1JTX A;  3S2D J;  1W0U A;  3UKG A;  1JGG A;  1AU7 A;  3E7L A;  2MGQ A;  1DU6 A;  1UG2 A;  4IEJ A;  4XRS A;  1RPW A;  5FLV A;  3GTK J;  2FJ1 A;  2L0K A;  1YRN A;  1ZKG A;  1FIP A;  4M3D A;  2DTZ A;  1JUP A;  2O7O A;  4M3B A;  2E19 A;  2R0Q C;  3DEW A;  3S2H J;  2NVX J;  5FKK A;  3W6V A;  5E3M A;  2I10 A;  1YRN B;  2HDD A;  3K2A A;  1U8B A;  3SDG A;  1G2H A;  3BQZ A;  3JRE A;  4FTH A;  1Q1V A;  3TED A;  4DW6 A;  1VI0 A;  2R5Y A;  3BG9 A;  3S15 J;  2DN0 A;  4D5C A;  2LR8 A;  5EDN A;  2XGD A;  5F0F A;  2XGC A;  4IHX A;  1SFO J;  1HCR A;  5EG0 A;  4M3E A;  3JRF A;  9ANT A;  3LOC A;  5C3E J;  5M5X J;  3IH3 A;  1GV2 A;  5M3M J;  3Q0V A;  3F0C A;  3GTO J;  2Y31 A;  4C3I J;  1ZK8 A;  1AHD P;  4X1E A;  3BR6 A;  1EF4 A;  4A3C J;  5EG0 B;  2EBI A;  5DTD A;  5F0C A;  3GTG J;  5JLW A;  1T33 A;  2ME0 A;  2CRG A;  3RKQ A;  1O4X A;  3FK7 A;  4A3G J;  1P7I A;  1IRZ A;  4A3J J;  2R7Z J;  3I4M J;  3CQZ J;  5K7F A;  2H8R A;  2LLK A;  1TWA J;  1I6H J;  2XGE A;  4UUS A;  2VKV A;  2DMP A;  1BW6 A;  1IJW C;  2Y30 A;  4QTR A;  5C4J J;  3HBL A;  2IEK A;  3WHC A;  2Y0S N;  2EQR A;  5M3F J;  2DA4 A;  2VI6 A;  2E2H J;  3JRI A;  1S7E A;  1QRY A;  2DA2 A;  4AUX A;  1WH5 A;  5IP6 A;  1Y1V J;  1OJL A;  1ORK A;  5E3N A;  4RDU A;  2ME6 A;  3NAU A;  3FK6 A;  2GM4 A;  3HOU J;  3CMY A;  2NS7 A;  4EEF G;  1MBJ A;  1WH7 A;  4D7M A;  1TWG J;  1TWF J;  3BG5 A;  4A93 J;  2K9N A;  3SFI A;  1SAN A;  2MSY A;  4V2F A;  2CJJ A;  1VND A;  5IYC J;  5IOY A;  3QPS A;  1DU0 A;  5IP7 J;  1B72 B;  4C2M J;  1MSF C;  1RR7 A;  1ETX A;  2XPW A;  3B6A A;  4AC0 A;  2JA8 J;  4DZJ A;  5IP9 J;  5J1U A;  5EGO A;  3G1L A;  2YS9 A;  2M8G X;  3ZQL A;  4IHV A;  1MNM C;  3ZQI A;  2E2I J;  2JJ7 A;  3BR1 A;  4RBO A;  1JJ8 C;  1CQT A;  1ETQ A;  4MIM A;  5HOD A;  2OPT A;  4DYR A;  3C2B A;  3JRH A;  4A3E J;  3LSG A;  2IAI A;  2RAE A;  4B1R A;  1PUF B;  1POG A;  1Y1W J;  1GVD A;  3OSF A;  1H8A C;  1VF9 A;  4IHW A;  4A3I J;  2ECC A;  1JKO C;  1APL C;  2X48 A;  3MKL A;  5FLM J;  2WB1 N;  1HOM A;  3ZQH A;  4BXX J;  1X2M A;  1D5Y A;  2LTP A;  4Y52 J;  4JX4 A;  1XS9 A;  1RKW A;  3GTJ J;  1FIA A;  2HOS A;  4QIW N;  2JA5 J;  4CYC A;  2CQX A;  2R5Z A;  1ETO A;  4A3F J;  2JMW A;  4A3L J;  1TWC J;  5FKM A;  1IUF A;  2EZH A;  1AKH A;  4BY1 J;  2GBY A;  4QSH A;  1FTZ A;  3S1N J;  2H1K A;  1MBG A;  4M3G A;  2R5Z B;  1ETY A;  4X6A J;  2LY9 A;  5F0H A;  2O8K A;  3DCF A;  3O8H A;  2FQ4 A;  1MBF A;  4XID A;  3Q3S A;  1JT6 A;  3S14 J;  5FJ8 J;  2E2J J;  2TCT A;  5IYB J;  3A01 A;  4NDL A;  4LOC A;  4JYK A;  3JRC A;  5BNG A;  3LSJ A;  2R5Y B;  4G12 A;  2COB A;  1K83 J;  2MG4 A;  3TW6 A;  1IDY A;  2L7Z A;  3TP3 A;  3TW7 A;  1BW5 A;  2DJN A;  2JK3 A;  3BTL A;  1VFC A;  5EZH A;  3JRG A;  4UUT A;  3BTC A;  1ZR2 A;  2CUE A;  3G1O A;  2DMU A;  3GTQ J;  1IG7 A;  1U9N A;  2ECB A;  1IV6 A;  5C4X J;  2DA5 A;  2KT0 A;  2DA1 A;  4S0H B;  2AO9 A;  2VKE A;  1GV5 A;  4MFE A;  4FCY A;  1JTY A;  2L7M P;  3ZOB A;  2DA6 A;  3ZQF A;  1JKP C;  4XRS G;  3S1Q J;  2LFB A;  3GTL J;  5FKO A;  5F1J A;  2B63 J;  2QF7 A;  4DYC A;  5C44 J;  3VPR A;  1U9O A;  3BR3 A;  3SJM A;  1ENH A;  5EF6 A;  4UUS B;  3IH2 A;  2VUM J;  1RET A;  3PO3 J;  2XRL A;  5J3L A;  4XIC A;  3HDD A;  2R93 J;  2FD5 A;  5IYD J;  3ZQG A;  1MH3 A;  1HDD C;  2D5V A;  2EZL A;  4BBR J;  2LKX A;  1HLV A;  2ID3 A;  3M4O J;  5F08 A;  1JT0 A;  3OSG A;  2XPV A;  4FE7 A;  5J1R A;  1JJ6 C;  2X6O A;  3RZD J;  2TRT A;  2DMN A;  3JR9 A;  1K61 A;  3RZO J;  5FKL A;  1WGX A;  1JUM A;  2NS8 A;  2GLO A;  3HEF A;  3G1M A;  1B8I A;  2JN6 A;  5M5Y J;  2Y9Z A;  3CCY A;  2XPU A;  4MLO A;  1RES A;  1X58 A;  4MO7 A;  3LSR A;  4JP0 A;  4I6Z A;  3HOV J;  3BT9 A;  2ZB9 A;  3ZQC A;  5IPA A;  1B8I B;  2EH3 A;  5EGO B;  5E3O A;  3S1M J;  1MBH A;  3IV5 A;  1MBE A;  1BL0 A;  1UMQ A;  4GFB A;  4FIS A;  2QCO A;  2HXI A;  1IC8 A;  1TWH J;  5JLX A;  4XK4 A;  3TP0 A;  2ID6 A;  2CU7 A;  3QQA A;  4IHY A;  1MSE C;  4BY7 J;  2DA7 A;  3RQI A;  2HYJ A;  3HGG A;  4Y7N J;  3IH4 A;  3FIW A;  1OCT C;  1WI3 A;  1GDT A;  2YU9 J;  4C3J J;  1QPI A;  1LE8 A;  3OOU A;  1BA5 A;  4JX6 A;  2CUF A;  1NTC A;  4DYQ A;  1QVU A;  1ETW A;  4D5F A;  1MBK A;  3BG3 A;  4CYC B;  3S1R J;  1OCP A;  2K40 A;  4A3M J;  2LP0 A;  3HM5 A;  1A6I A;  3B6C A;  2M9H A;  1I50 J;  1LE8 B;  2HXO A;  4B4C A;  1WPK A;  2HI3 A;  3H0G J;  4M6V A;  3H3V K;  1H88 C;  2LVS A;  3BTI A;  1AKH B;  5EZG A;  5FKN A;  2K9Q A;  4W1U A;  1Z0X A;  2NVY J;  3BQY A;  3OIO A;  4A3K J;  2DMT A;  5F27 A;  1BJZ A;  4B3A A;  2M0C A;  5E3L A;  3BTJ A;  4I76 A;  1NK2 P;  1X2N A;  3K7A J;  1Z77 A;  2EZI A;  4W97 A;  5EEA A;  4J19 A;  1MH4 A;  4BBS J;  3Q0U A;  1A5J A;  3A01 B;  3M3Y J;  2AHQ A;  2LD5 A;  2ELK A;  1ETV A;  2LK2 A;  3MVP A;  3NAR A;  3JRD A;  1ZTR A; 
#chains in the Genus database with same CATH topology
 4Q4Z F;  1J75 A;  2Y9Y A;  4CCN A;  1OMI A;  1P7J A;  1X3U A;  4LK1 F;  5ILU A;  2WAF A;  1XMA A;  2IBD A;  4IXA A;  1PJR A;  1XGM A;  1L0O C;  2NVQ J;  4MFD A;  5LFA A;  5HLT A;  3CES A;  5E1X A;  4C2T A;  1B4A A;  4QWQ A;  4ESJ A;  2QEX I;  4QLC U;  3SXY A;  1K4S A;  3JRA A;  4LLL A;  3DF8 A;  2O0Y A;  2HOT A;  2DFF A;  2W84 A;  1RR8 C;  1DGR M;  1FOW A;  3WGH A;  3WHB A;  3LSP A;  2JRM A;  2L9R A;  4KIC A;  1MMN A;  3HB9 A;  3PIO F;  3GFJ A;  4AVP A;  4C9Y A;  1VQO I;  3S32 A;  1FBQ A;  2OF7 A;  4F3Q A;  4MQ9 F;  3JSO A;  2NOG A;  1I3Q J;  1OR7 C;  1R9T J;  1F43 A;  3GCM A;  3HGY A;  1TC3 C;  3U21 A;  3OYK A;  2J5P A;  4I0B A;  2XB5 A;  2HZD A;  2G7H A;  3PO2 J;  3A02 A;  4NUB A;  3DTK A;  1FT9 A;  4E6K G;  3BOQ A;  3E6D A;  4E7H A;  1ZR4 A;  1U3E M;  2NVU B;  4XOR A;  4EVI A;  3RIR A;  4A3B J;  3AG4 H;  5J40 A;  3W2W A;  1D0Y A;  1XC5 A;  2L01 A;  3ZPL A;  2WWY A;  5EEG A;  3GVA A;  2Y0S A;  3LWF A;  2ZME C;  4EJU A;  2BY0 A;  5DS9 A;  3LSI A;  2QLZ A;  4E70 A;  4UY8 I;  3OYD A;  2FOK A;  2QZ8 A;  1BI3 A;  2LKS A;  2P81 A;  3V42 A;  1NHA A;  3MZY A;  5DV5 A;  4NQW B;  2AXL A;  2Z3Y A;  2VPR A;  4RMN A;  1UST A;  2FX0 A;  1F36 A;  2GXG A;  3O3K A;  2A6T A;  3G71 I;  3BCA A;  4ON0 A;  1OYY A;  3BJA A;  3PIP F;  5M5W J;  1MD0 A;  3EQL F;  1LFU P;  3CCE I;  3M1C A;  3HKZ A;  3V7C A;  4L9V A;  1WJD A;  2XAJ A;  4BE2 A;  1FYK A;  3HSE A;  3F22 A;  4L5E A;  1PUF A;  4XMY A;  2OTJ I;  1XMX A;  3VOD A;  2VQC A;  1HXD A;  5HNF A;  3B02 A;  2MBF A;  3QYE A;  2EFP A;  5IOZ A;  1BR1 A;  5EYR A;  2DLL A;  2K4B A;  3LNQ A;  2A5Y B;  5K7Z A;  4JX5 A;  4LK0 F;  2KDZ A;  2YUS A;  3WG7 H;  2XSD C;  3S17 J;  2GQQ A;  3MKY B;  3BDD A;  1JTX A;  3S2D J;  5CPR B;  4RGX A;  4M9Z A;  1JGG A;  3M8E A;  4A0X A;  4XKW A;  4F7Z A;  2XAG A;  3BC8 A;  2Q8K A;  3K6G A;  2PFB A;  1RPW A;  1X1A A;  4R79 A;  2OD5 A;  4F93 B;  2VQH A;  3CCM I;  1QPM A;  2L0K A;  1KYW A;  2DBB A;  1XGO A;  4HX4 A;  4RM2 A;  3V8K A;  3PQK A;  2VJJ A;  2P5V A;  4II3 A;  1YO5 C;  1JUP A;  4M3B A;  2CQ7 A;  1IN5 A;  4KT6 A;  4F91 B;  1HQC A;  2NVX J;  5FKK A;  2IA2 A;  2JVG A;  5K5Q A;  4EJV A;  2HDD A;  2XAU A;  3GW2 A;  1BI1 A;  3CLQ A;  2DT6 A;  1G2H A;  4OIQ F;  2VBY A;  4KUM A;  2GA1 A;  1I1G A;  5GTH C;  1GXQ A;  3I56 I;  4YEL A;  2FF4 A;  2LR8 A;  1FC3 A;  3TO9 A;  5IT3 A;  2QEN A;  5F0F A;  4IOA F;  3T0Y A;  1ZRD A;  3ZQ7 A;  2K3F A;  3HTU A;  3WU2 C;  5DM7 F;  1FYM A;  3OS2 A;  4CCK A;  5A2Q Z;  3M8J A;  2LH9 A;  3QU3 A;  1LUJ B;  3KEY A;  4BXF A;  1Y8R B;  3IHU A;  2LY2 A;  4C3I J;  1ZK8 A;  2CUJ A;  2R7F A;  4AU7 A;  1YTY A;  1RNL A;  3O2P E;  5DTD A;  1V3F A;  5F0C A;  5FD6 A;  5EG0 B;  2QSG X;  1REP C;  2V6C A;  2ME0 A;  1EH7 A;  3RKQ A;  1LPQ A;  1LVK A;  2CW0 F;  4EQQ A;  2R7Z J;  3I4M J;  2Z5U A;  5LEJ A;  3GFM A;  2H8R A;  3LA7 A;  2LLK A;  2DO7 A;  2XGE A;  1MIJ A;  2Y30 A;  4DIQ A;  1PDN C;  5FRM A;  5C4J J;  1SFK A;  2Y0S N;  3KLO A;  5LRS A;  1LNW A;  3I4P A;  2EQR A;  2JQ7 A;  2H27 A;  1H9G A;  3OL4 A;  1HST A;  5IP6 A;  1OJL A;  3FBI B;  2R7S A;  1GHC A;  1YHQ I;  1P92 A;  2JVH A;  3NAU A;  2G9W A;  2HU9 A;  3BLY A;  5ICE A;  2V1D A;  1MBJ A;  1MJA A;  1IN4 A;  1D8K A;  2OCE A;  2PJR A;  3BG5 A;  4RB0 A;  2QWW A;  2EFN A;  1SAN A;  2MSY A;  1A04 A;  2CJJ A;  1VND A;  4KT5 C;  3GUD A;  3T8R A;  1A6Q A;  2BY2 A;  4KIT B;  2J5O A;  5BMZ A;  3C7J A;  2W85 A;  1B72 B;  1ZH5 A;  2GOM A;  4J00 A;  1IXC A;  4C2M J;  1RR7 A;  1ETX A;  1XDS A;  4R1H A;  3CJN A;  2XRN A;  4PDK A;  1J7K A;  3BCB A;  5EGO A;  2M8G X;  1XB4 A;  4IHV A;  2EFQ A;  3QOP A;  4BHC A;  2M4K A;  3NWT A;  3TKY A;  4RB3 C;  4DYR A;  4BNC A;  3WTU C;  2FQ3 A;  2LBF B;  1H8A C;  1UB9 A;  1LE8 A;  1VF9 A;  3QP5 A;  3OWT A;  1JKO C;  4F52 A;  3ZN0 A;  2D2W A;  4BDZ A;  1SD4 A;  2K27 A;  3DTI A;  2KHM A;  3LQR A;  3ESW B;  2QBY A;  1X2M A;  5CQE A;  2VC1 A;  4LFU A;  1J59 A;  4BHB A;  1SC7 A;  2BY1 A;  2RN7 A;  4JX4 A;  1RKW A;  3HSR A;  1FIA A;  3FM5 A;  2DOA A;  3WGI A;  2MH9 A;  2KRF A;  4A3F J;  4A3L J;  2ELJ A;  2BXZ A;  4IOC F;  4BAC A;  1AKH A;  3REO A;  4BY1 J;  5LHG A;  1MMS A;  4CCL A;  3S1N J;  2Z1D A;  2H1K A;  1J09 A;  2LG4 A;  4X6A J;  2LY9 A;  4BDY A;  4LGW A;  1AA7 A;  1VQP I;  2RNJ A;  4UXN A;  1SD7 A;  3H5N A;  4IJA A;  5FGM A;  1I1S A;  4YIF A;  4XLP F;  2GIV A;  1V4R A;  2W1O A;  1QHH D;  3EYY A;  3ZCO A;  4IKF A;  4NDL A;  4JYK A;  3ISP A;  1K78 A;  3JRC A;  1U5T B;  2COB A;  2R7T A;  2K9M A;  1IDY A;  1P4X A;  1G3Y A;  2VAS A;  3WTZ A;  1G6N A;  5D4R A;  3PNV A;  3L00 A;  3BTL A;  2VIX A;  1ODD A;  1SFX A;  2L9N A;  3PSF A;  4ENN A;  2F2E A;  3HPH A;  4U87 A;  4HX8 A;  1SFE A;  4CUG A;  3ELK A;  1U5T C;  2DFE A;  3ZQQ A;  3ZP5 A;  3P7N A;  3J7A O;  2PI0 A;  1N75 A;  2DA5 A;  1OR7 A;  5GAH J;  2ZXJ A;  3KLN A;  3E6C C;  2CSO A;  3GF2 A;  4OOI A;  2VKE A;  4ITV A;  3M9A A;  5DUK A;  1JKP C;  4L5I A;  3GTL J;  4AYB A;  2WAQ A;  4FX0 A;  1WZ2 A;  2RGV A;  4RGR A;  1YX3 A;  3U1K A;  5CJ9 A;  2IS6 A;  3HRM A;  1YIO A;  3LA3 A;  2A68 F;  2PQ8 A;  2C6Y A;  3PO3 J;  4AIJ A;  3IWZ A;  2HZT A;  2BW3 B;  3JAM K;  1MMG A;  5IYD J;  3TDZ C;  2EZL A;  4BBR J;  1O3T A;  2F5F A;  2BGC A;  3M4O J;  3LA2 A;  5BPD A;  2DT7 B;  4A6E A;  3J80 K;  1FWZ A;  3OSG A;  2M30 A;  1MGT A;  5E1W A;  1RI7 A;  3E97 A;  4P96 A;  1N78 A;  3GX4 X;  3HXL A;  3OOP A;  2ACJ A;  1T38 A;  4NQW A;  3IP4 B;  4ZJZ A;  3RYR A;  4EM2 A;  2Y0M A;  4BUP A;  2EIM H;  2ZNY A;  1WGX A;  2GLO A;  2R7W A;  3W2V A;  1ULY A;  3A1Y A;  4PZJ A;  5TIS C;  2Y9Z A;  4DOZ A;  3ZMS A;  1SVO A;  3MMY B;  3TOA A;  2WA0 A;  3DLA A;  4II2 A;  3LSR A;  3EUH C;  4WX9 A;  3HOV J;  3BPV A;  1N77 A;  2BHY A;  3SZT A;  5HDN A;  3ZQC A;  4U7B A;  1F4K A;  1B8I B;  2EH3 A;  3KX2 A;  1W7P A;  3S1M J;  2JTV A;  1UG0 A;  2MH2 A;  1LFP A;  4G7O F;  6PAX A;  4WXH A;  1IN6 A;  2EIJ H;  4RGU A;  1UMQ A;  3HRU A;  2L9V A;  4GFB A;  1R5I D;  4F92 B;  3G6E I;  2CGP A;  4GYG A;  1BM9 A;  1DGW Y;  2FMY A;  3G2B A;  2X6Y A;  3W6J B;  2GOX B;  4G9Y A;  5D6F A;  5FRO A;  2FSW A;  1JGS A;  4UVB A;  2E7W A;  5J4Y A;  5JFR A;  1E17 A;  2LKP A;  2CYY A;  3HRT A;  1OCT C;  3R60 A;  4C3J J;  3OYH A;  1MJB A;  1KU7 A;  4EGY A;  2OBP A;  3OOU A;  1QGP A;  2E5Z A;  2ICW G;  2V26 A;  4JX6 A;  4XSX F;  2CUF A;  2EK5 A;  4I99 C;  5AIQ A;  3C18 A;  3TGN A;  2ADU A;  4DQ2 A;  4CYC B;  3S1R J;  4MQV A;  2K40 A;  4K2E A;  5DUI A;  1A6I A;  2F4M B;  2M9H A;  3OIQ A;  2DFI A;  2VC0 A;  2P5K A;  3RKW A;  1D1A A;  4D9J A;  1Z3X A;  1R4M B;  3H0G J;  1IXR C;  3KE2 A;  4A0Y A;  1Y56 A;  2OQG A;  5EZG A;  2ZXW H;  2O3F A;  2WY8 Q;  2EA4 A;  2CS3 A;  1R5G A;  1FY7 A;  3BQY A;  3OIO A;  1O3S A;  2QM3 A;  4KYW A;  5HOO A;  1WKM A;  3M1E A;  3ZMV A;  5DDG A;  2ZFW A;  2M0C A;  5E3L A;  4B3A A;  2VOO A;  2GWR A;  4A12 A;  3BJ6 A;  1XDU A;  1OYI A;  2O03 A;  2O8X A;  4CIC A;  3CO6 C;  1Z6T A;  1NK2 P;  1QA6 A;  3K7A J;  2EZI A;  3DFG A;  3QOE A;  2FXA A;  4DNC A;  2DXI A;  4BL0 B;  4YRV A;  4BE0 A;  4XLC A;  2LDU A;  3L09 A;  1KZH A;  4GGG A;  2LK2 A;  2V7F A;  3MVP A;  4IQJ A;  3JRD A;  3FXQ A;  4JK1 X;  1WFX A;  4A3D J;  1FTT A;  3L1P A;  4GYI A;  2O9L A;  2M45 A;  2VE8 A;  4AYB N;  2WAQ N;  3HRS A;  3ZRG A;  4BAY A;  1R71 A;  3CCR I;  2W48 A;  4P9U A;  1ITY A;  3PM1 A;  4ZZL A;  1VTN C;  4HNV A;  4XSZ F;  5LGN A;  4I09 A;  4Y17 A;  1TNS A;  4IF4 A;  2R92 J;  4OWR B;  2XAF A;  2Z2S B;  3JRB A;  3FX3 A;  4M72 A;  2F5V A;  2L2O A;  4D7N A;  1FMV A;  1BC8 C;  2FRH A;  5ILV A;  2V9K A;  4ENK A;  4I02 A;  4ZYH A;  5IT9 Z;  1FEX A;  4FT8 A;  4ABZ A;  4B43 A;  1E0E A;  1OLT A;  3WE3 A;  3F72 A;  5B66 C;  4BQQ A;  3C3W A;  3L2U A;  1T0F A;  5GPC A;  3BR2 A;  1QVT A;  2JSC A;  3CDL A;  2KZG A;  3LQQ A;  1FYL A;  1FP2 A;  2E1M C;  4XKC A;  1UHS A;  3GWZ A;  1H89 C;  2WAD A;  3EYI A;  2MW8 A;  5GPA A;  2CG4 A;  5GP9 A;  4I2O A;  4DJA A;  3HOW J;  3W2A A;  1ETK A;  2HYG D;  3QP6 A;  1PVE A;  4A2U A;  4LLN A;  1A31 A;  1WRJ A;  3WTY C;  4HBL A;  4U0W A;  1O3R A;  3GBG A;  3VDX A;  4I01 A;  1CF7 A;  1B72 A;  1V5E A;  3DBL B;  1ZG5 A;  1WHU A;  2E1O A;  4TV7 A;  4C3H J;  2Y2Z A;  4IHT A;  1IDZ A;  1LFB A;  3G73 A;  3IRQ A;  1T56 A;  2DCE A;  2FEZ A;  4HF0 A;  3ASN H;  2V1X A;  1BA5 A;  2DA3 A;  2KJC A;  3CP8 A;  3CUQ B;  5E20 A;  2MYS A;  4NC8 A;  1T98 A;  1UEL B;  5L3G A;  2OA4 A;  4Q5S F;  1FNN A;  2L7K A;  3J7Z I;  3GTP J;  4ENM A;  1MNE A;  3OYI A;  2GA2 A;  3MN2 A;  3H3U A;  1SVM A;  3CC2 I;  1IUY A;  2HKO A;  3HUG B;  4Z6Y A;  1QQI A;  2QGU A;  1ZQ3 P;  4AID A;  4XQF A;  1YIJ I;  2XHK A;  3PNT A;  4WXD A;  3CCU I;  1FJL A;  2HQ5 A;  3DP7 A;  2DMQ A;  2A61 A;  2HGC A;  2Q1Z B;  4L9N A;  3ECH A;  1W0U A;  3UKG A;  2OV7 A;  3FXM A;  2VE9 A;  5E8G A;  3R6S A;  1HKQ A;  1LJ9 A;  2MGQ A;  2JRT A;  1DPR A;  1ZYR F;  4Q47 A;  4H4K C;  1R22 A;  2LNB A;  3J81 Z;  2M1B A;  1G3S A;  3E5X A;  1UHM A;  4XLA A;  1KON A;  2FJ1 A;  2H09 A;  1BI0 A;  4IQ4 A;  2O5R A;  4UUV A;  2EIK H;  1D3Y A;  5DCM B;  2PJP A;  5FD5 A;  5D8L B;  4M3D A;  2DTZ A;  2QSH X;  2O7O A;  4YEJ A;  3ABL H;  1Z7L A;  3S2H J;  4RB1 A;  1O7L A;  4AIK A;  4AD9 A;  3F8B A;  2I10 A;  2VXZ A;  2LRE A;  3MFK A;  1YRN B;  3K2A A;  2JUG A;  3KIO A;  3F6V A;  3BQZ A;  3HC7 A;  2CV2 A;  3FDY A;  1Q1V A;  3K9T A;  2HDW A;  1ZG1 A;  4FX4 A;  1F1Z A;  1V5F A;  4L5J A;  1U5T A;  3S15 J;  2HEO A;  1KU9 A;  5CQG A;  4XBF A;  3NRV A;  1Z7U A;  2P0W A;  1E2X A;  2XGC A;  3H0D A;  4IHX A;  4BQO A;  1HCR A;  2VL8 A;  4CH7 A;  1J2X A;  4LMY A;  2ESN A;  4M3E A;  9ANT A;  3LOC A;  5C3E J;  3R4K A;  3VYS B;  2D1H A;  4HX7 A;  3F0C A;  2XC7 A;  1TNT A;  2Y31 A;  1YS6 A;  4GRI A;  5E79 C;  2EFO A;  5E17 F;  3BR6 A;  4XOT A;  1S72 I;  4NB5 A;  4U0V A;  2DTR A;  4N9H A;  2CRG A;  3GYH X;  4KIG A;  2JSP A;  1IRZ A;  4A3J J;  5D6E A;  2IVM A;  3OYN A;  2CUZ A;  5K7F A;  1WVR A;  3I71 A;  1HKT A;  3ABK H;  1LQ1 A;  2FBI A;  4RLF A;  2DMP A;  1IJW C;  5L3F A;  4L0Z B;  2BW3 A;  5H20 A;  3WHC A;  2KIU A;  1ZEL A;  2KRH A;  2M8E A;  2DA4 A;  4BQN A;  2VI6 A;  2Z16 A;  1S7E A;  4AUX A;  1WH5 A;  5GAD J;  2HQN A;  4D1Q A;  5J6X A;  4XLN F;  2ZKZ A;  4RS8 A;  4IRI A;  3FK6 A;  2GM4 A;  1P6R A;  3EUH A;  3KP2 A;  2DFH A;  1P9Q C;  1KU2 A;  1P4W A;  4V2F A;  3QPS A;  3M8F A;  2KKO A;  2KMU A;  2EB7 A;  4A6D A;  2DAO A;  2X51 A;  1X4O A;  4E7L A;  1SVL A;  5IP9 J;  3ZQL A;  2IXS A;  3P9C A;  1MNM C;  2HTJ A;  3BR1 A;  2FUG 2;  1CQT A;  1ETQ A;  4MIM A;  2OPT A;  2KFD A;  3G4S I;  1ZAO A;  4A3E J;  3DWL E;  2RAE A;  3PQJ A;  4B1R A;  4IX7 A;  2HS5 A;  1FP1 D;  5ICC A;  2DW4 A;  1S5L C;  1DUX C;  2PEX A;  2L3D A;  4Q48 A;  2X48 A;  2ZNZ A;  4AVZ A;  2XF5 A;  5FLM J;  2OJE D;  4QPO A;  2CFO A;  3T1B A;  2NOJ B;  2RRE A;  5J47 A;  1MND A;  2DQL A;  3R0J A;  1S3J A;  2V9V A;  4N4O B;  1X3Z B;  4J01 A;  4CYC A;  2CQX A;  2BV6 A;  1R5H A;  1ETO A;  1XN7 A;  4XNF A;  2BEO A;  3WTS C;  4ZTF A;  2JMW A;  4QPQ A;  2NXN B;  5FKM A;  2W4S A;  2HR3 A;  1TZL A;  1FTZ A;  3AAF A;  2R5Z B;  3WTW C;  1G4D A;  1UCR A;  1FLI A;  3OY9 A;  2FOW A;  1W36 D;  3O8H A;  1XSD A;  2FQ4 A;  3K4N A;  3I9V 2;  3A0B C;  3HHH A;  3OYC A;  5FJ8 J;  4Y4R A;  3V4G A;  3MEX A;  2TCT A;  1IRX A;  3K4C A;  1YOV B;  5IYB J;  4IRG A;  1YQA A;  1YX5 A;  2R5Y B;  3LSJ A;  5B1B H;  1B9M A;  4PCQ A;  5BOX A;  4EAT A;  3TW6 A;  1YJ9 I;  2L7Z A;  3CLO A;  3KZI C;  2JK3 A;  4EGZ A;  5KVR A;  3JRG A;  2A05 A;  1TT5 B;  4G8X A;  2CUE A;  1YE9 A;  2Z9O A;  5FB2 A;  1FX7 A;  1RUN A;  3FMR A;  4EMS A;  3CJR B;  4PJJ A;  2QQ9 A;  3NEU A;  1IG7 A;  1U9N A;  2ECB A;  2JPC A;  2GIZ A;  4HNU A;  3KYL A;  5C4X J;  4HZF A;  1JXS A;  2VLA A;  1HC8 A;  2NS0 A;  2KT0 A;  4PFP A;  3RJP A;  4S0H B;  3QPT A;  4GCV A;  2AO9 A;  4UVA A;  1K7A A;  2XF6 A;  3PFI A;  1GV5 A;  2M87 A;  1JTY A;  3FHN A;  3ZOB A;  2DA6 A;  3ZQF A;  2ZJQ F;  4Y15 A;  2X6W A;  5FKO A;  4KIS A;  5F1J A;  4B47 A;  4MHG A;  2RDP A;  2B63 J;  2EWN A;  3RPQ A;  1BC7 C;  4BJT A;  4Y3O A;  3ZMZ A;  5C44 J;  2P6S A;  1IXS B;  4XN0 A;  3LAP A;  3LAJ A;  1U9O A;  2OC6 A;  1ENH A;  5EF6 A;  4YFN F;  3CC7 I;  4I7H A;  2KIM A;  1Q1H A;  3SEZ A;  2VBZ A;  2P7V B;  5J3L A;  2M5W A;  5L3B A;  5B1A H;  2D5V A;  2LKX A;  3HOT A;  3PUF A;  3ABT A;  1T0F C;  2WY7 Q;  3CZ6 A;  2XPV A;  1S8N A;  3S8P A;  3RI4 A;  4FE7 A;  4HG2 A;  3T5X A;  2V9P A;  1TQI A;  2YX4 A;  3OR1 C;  5K1Y A;  2E5N A;  2MC4 A;  1ZGJ A;  2Z99 A;  4ESB A;  2ZCW A;  5GAG J;  4P1W A;  4EJO A;  1K61 A;  4NC7 A;  3RCO A;  2KIS A;  3G1M A;  5M5Y J;  4PJ0 C;  4B09 A;  2XPU A;  4MLO A;  1RES A;  2ZXH A;  3M7G A;  3U2R A;  2ZSH B;  2MD0 A;  3GZ5 A;  3VOE A;  3BT9 A;  5J4V A;  2ZJR F;  5BS6 A;  3WGG A;  1BIB A;  1ONV A;  5IPA A;  5ED4 A;  3G3Z A;  1FZP B;  5E3O A;  3IV5 A;  1Y0N A;  4U0Y A;  2JT1 A;  3HUG A;  5ILS A;  3FMQ A;  1BL0 A;  3DV8 A;  4YFX F;  1S6L A;  2W00 A;  3IAS 2;  1LDJ A;  5D5W B;  3OYM A;  2IGM A;  4RAZ A;  1XD7 A;  2HXI A;  3SFZ A;  4AM3 A;  2PBI A;  3TP0 A;  4M6X A;  4IHY A;  2FML A;  1YYV A;  3QRF F;  2W25 A;  3RQI A;  3KZY A;  4IHS A;  4L0Y B;  5BPI A;  3HG9 A;  3MQ0 A;  2AS5 F;  1IW7 F;  3EDP A;  5DD8 A;  3KEO A;  3AL0 B;  1T39 A;  3GZ6 A;  2ZJP F;  3DEE A;  3CCS I;  1TTY A;  1NTC A;  1TT0 A;  4UVC A;  1ETW A;  2EPF A;  2V4J C;  2VJ4 A;  2XDV A;  1R23 A;  1OQY A;  3BG3 A;  5DCM A;  2LF8 A;  2PMU A;  3R0A A;  2GXB A;  3B6C A;  2BVL A;  2HXO A;  3KYC B;  2HI3 A;  4WK8 F;  4G7Z F;  3AL0 C;  4DBQ A;  4M6V A;  3QYB A;  4CA0 A;  2K9Q A;  4W1U A;  2F48 A;  4A3K J;  2DMT A;  4E7S A;  3H92 A;  2A07 F;  3Q9V A;  3CJT B;  5LHH A;  2JPB A;  3HHG A;  3BTJ A;  4PFO A;  3KPH A;  4I76 A;  3KP7 A;  5KCM A;  2BY3 A;  1X2N A;  2RV8 A;  2HOE A;  4RAY A;  1X4P A;  4W97 A;  5LBQ A;  1XSV A;  4GXO A;  1Z05 A;  3Q0U A;  3B73 A;  4OIN F;  2UXN A;  1FSE A;  3M3Y J;  2ELK A;  5E18 F;  1EA3 A;  4U88 A;  4PK4 A;  3DKY A;  2F4O B;  3U9G A;  3GFL A;  1HA8 A;  4KDP A;  1JUS A;  3D1N I;  1VQK I;  1JKR C;  2VKH A;  3SHF A;  1WCM J;  2CH0 A;  3EUK L;  2H94 A;  1OPC A;  2AXT C;  2XF7 A;  1RUO A;  2FBH A;  1E3O C;  1BBY A;  2K9S A;  3N05 A;  5K5O A;  3GTM J;  2N8G A;  4ETS A;  1SAX A;  1J9I A;  1U6G A;  1U2W A;  2R4G A;  2ETH A;  3FXU A;  2I5U A;  1W36 C;  2F5E A;  4RM3 A;  5DM6 F;  2YPR A;  4YIR X;  2CFX A;  3K69 A;  3N97 A;  2UWM A;  1EH8 A;  3BR5 A;  4AWX B;  3QYF A;  3J7A Y;  3QPL A;  1V55 H;  5E1Z B;  2HKX A;  2BVM A;  3FXJ A;  3L9F A;  3A03 A;  1OFC X;  2KRC A;  4RLQ A;  2L4M A;  2M3A A;  2MA3 A;  2JUC A;  3AG3 H;  3L2Q A;  1Z9C A;  1VQ8 I;  2K4J A;  4BKX A;  3HTS B;  2M34 A;  3V8J A;  3L2C A;  1EV7 A;  3BZC A;  3CMA I;  4MTD A;  3HJE A;  5FRN A;  2EZK A;  4GO1 A;  1FPQ A;  5J1Y A;  1MMD A;  4FE4 A;  4WWC A;  1QU3 A;  2MD5 A;  2F6C A;  3FKI J;  2E1N A;  3HOZ J;  3FIS A;  1B6A A;  1MJ9 A;  1WI9 A;  2X1D A;  2M2E A;  4DGW B;  2CQQ A;  4XRM A;  3P5J A;  4OU0 A;  3OMY A;  4ZYD A;  2L7F P;  2JZY A;  2V6E A;  2WAE A;  2L54 A;  3VB2 A;  1JKQ C;  5KNL A;  4OMY A;  3MZ8 A;  3DPT A;  3E6M A;  2HVS A;  1TW2 A;  2AQF A;  2P5L C;  2B0L A;  3O6B B;  4CHU A;  1YW7 A;  4IVN A;  1CGP A;  4WXC A;  2G0E A;  3S16 J;  4L18 B;  1D0Z A;  5F04 A;  2F4I A;  5K7H A;  4HF2 A;  3S3M A;  4LG0 B;  5J8F A;  3H36 A;  3VSK A;  4V2G A;  2KQR A;  1HDP A;  4DZP A;  1T8I A;  2X1C A;  2LYC A;  4P9F A;  3CCJ I;  2EFW A;  3E7L A;  3OYA A;  2IT0 A;  2NYX A;  1BR4 A;  3FZV A;  3FXR A;  3UNG C;  1UG2 A;  5DYM A;  1R4N B;  1VQ7 I;  1XGN A;  5FLV A;  1BI2 A;  2IS1 A;  3LSK A;  1ZRC A;  3TO6 A;  3GTK J;  2YR2 A;  1EH6 A;  2KIQ A;  1Y6I A;  4EM1 A;  2NRA C;  3DQV C;  2OQR A;  3Q9S A;  3SZG A;  4ZDP A;  1R6R A;  3N4M A;  4IRH A;  1ZKG A;  1FIP A;  4FQG A;  3KYD B;  2R0Q C;  4S04 A;  3LSM A;  3V7S A;  1TBX A;  2RC4 A;  4XRF A;  1KU3 A;  2H8W A;  3TMO A;  3LST A;  3JRE A;  2EV6 A;  4ZYA A;  5HS8 A;  2ZC2 A;  4FTH A;  3MCZ A;  5TJJ A;  2IRF G;  2R5Y A;  3PJR A;  3HZJ A;  1V5G A;  3K70 D;  3CO7 C;  4D5C A;  2UXX A;  1QNT A;  5F64 A;  1QO0 D;  2P8T A;  2DOF A;  3OYB A;  5L3C A;  1YFH A;  1SFO J;  5EG0 A;  4LLG F;  4N9I A;  3PUB A;  5M5X J;  3IH3 A;  2VBW A;  1GV2 A;  2KIF A;  3D0S A;  5M3M J;  3K4M A;  3MZH A;  1HW1 A;  2VOD A;  3QPH A;  1AHD P;  1D5V A;  3BP8 A;  2HQR A;  4X1E A;  3AFH A;  3E3V A;  1HSJ A;  3QU6 A;  4N0B A;  3WTV C;  4G6Q A;  2KL4 A;  5JLW A;  1T33 A;  3E5U A;  1O4X A;  5D5V B;  1QZY A;  3K1M A;  4A3G J;  1QBJ A;  2LMD A;  2QKL B;  2X6X A;  2P4W A;  3GLL A;  4ESF A;  4OMZ A;  3RPU D;  2PG4 A;  3OYL A;  1Y8Q B;  3FXK A;  1I6H J;  1XCB A;  5CVR A;  2K85 A;  1E3H A;  4QTR A;  2Y69 H;  4U7D A;  2IEK A;  2DJI A;  1R36 A;  2DK8 A;  5M3F J;  2XUB A;  3JRI A;  1BN5 A;  1FOX A;  3F8M A;  2DA2 A;  3OV8 A;  4EV0 A;  3BZ6 A;  1X1P A;  3JAM Z;  1Y1V J;  5HVQ C;  1P2F A;  2CO5 A;  2R7R A;  3SQN A;  4ZZD A;  3HOU J;  5FLX Z;  3CD6 I;  3CMY A;  5LGT A;  2NS7 A;  3J80 Z;  4EEF G;  2HPI A;  2YX7 A;  4XL9 A;  5FO5 A;  3DEU A;  1WH7 A;  2VJI A;  1HW5 A;  2E71 A;  1TWF J;  5H6R A;  2K9N A;  4KIB A;  5IYC J;  2COM A;  1D1B A;  1ZAR A;  3ZR8 X;  1OKR A;  1EKE A;  5IP7 J;  3RQ4 A;  5JI6 A;  3CC4 I;  4CZZ A;  2BXY A;  3FBN B;  3CDI A;  4AC0 A;  3JTG A;  4XKV A;  4BJ5 C;  2LBF A;  2ZFU A;  4XLF A;  4L9T A;  4P5O A;  2HTS A;  2YS9 A;  1W5S A;  2FBK A;  2CV1 A;  5JVT A;  2JJ7 A;  2X0L A;  3CUQ C;  1IRG A;  4HEA 2;  4UB8 C;  1WQ2 A;  2V1U A;  3C2B A;  3JRH A;  2M7B A;  3RKY A;  3BZK A;  2IAI A;  1O57 A;  1POG A;  1Y1W J;  3OSF A;  4IHW A;  2DQR A;  1HW2 A;  4A3I J;  1X1D A;  3GZN B;  1WJA A;  3KP4 A;  4G6T B;  3MKL A;  5F1R A;  1HOM A;  1SFU A;  1Z3Y A;  3IC7 A;  3ZQH A;  1A36 A;  4BXX J;  1WWX A;  1I27 A;  5HS9 A;  5D5X B;  3CF5 F;  2LSO A;  3CCQ I;  3GXO A;  5KHD A;  2EV0 A;  1P4A A;  1XS9 A;  2JA5 J;  4QIW N;  5K5R A;  3AKZ A;  4C2U A;  1YW8 A;  3K1N A;  4UHT A;  1G3W A;  3MKZ A;  4JBA A;  3LL7 A;  3WG9 A;  4UV8 A;  5CVJ A;  1IUF A;  2GBY A;  4QSH A;  3TBI A;  2DOD A;  1MBG A;  4XN3 A;  5LLQ A;  3DPU A;  2DOE A;  2UUZ A;  4LB6 B;  1ZRE A;  3MKW B;  5GAE J;  5LRR A;  4E7Z A;  2LF7 A;  5HDG A;  3ONQ A;  4HLY A;  3VEP A;  3FM3 A;  2LC2 A;  5ERI A;  1O7F A;  3TOB A;  3Q3S A;  4X0G A;  2EA2 A;  5D5U B;  1JT6 A;  3OS1 A;  3S14 J;  3CTA A;  4CYD A;  2EIN H;  2CWE A;  2IGN A;  4M71 A;  4L9J A;  4LOC A;  1R1T A;  1TLH B;  1OYW A;  4HV5 A;  1K83 J;  3NQO A;  2MG4 A;  5A2Q K;  3TW7 A;  3TP3 A;  4B48 A;  2PLY A;  1BW5 A;  2GZW A;  2RQP A;  1BR2 A;  4R8H A;  4RGS A;  1VFC A;  4UUT A;  4UB6 C;  3BTC A;  1FBU A;  4Z2Y A;  3ROU A;  4CDG A;  1ON1 A;  5GTI C;  4LJZ F;  1ZR2 A;  1ZLJ A;  1TL8 A;  3P9I A;  1UJ8 A;  2BHZ A;  4HOB A;  2DMU A;  4G7H F;  3ABU A;  3I53 A;  2V1N A;  5KAI C;  4HW0 A;  2NNY A;  2DA1 A;  2QKM B;  4DBR A;  3PFY A;  3LMM A;  3S93 A;  3ZXS A;  1X1B A;  3CCL I;  3L7W A;  4MFE A;  4FCY A;  1MKM A;  1UZC A;  4XRS G;  3CME I;  3K4L A;  5DCF A;  1K4T A;  2X1E A;  5B3S H;  3NWS A;  4DYC A;  3VPR A;  1YS7 A;  1KGS A;  2L02 A;  3BR3 A;  3SJM A;  4B3X A;  1RRJ A;  4UUS B;  2VUM J;  4BGD A;  3K70 C;  2XRL A;  2QA4 I;  1YLF A;  3HDD A;  1G8X A;  3ZQG A;  1MH3 A;  1RIO H;  1L3L A;  1HDD C;  4M74 A;  3S3N A;  1IV8 A;  4CCM A;  5HLG A;  2VB6 A;  1C0W A;  2ZME B;  2VKD A;  2ISY A;  2YU3 A;  1ZRF A;  5HLH A;  1H9T A;  4WCG A;  2X6O A;  3RZD J;  3GFI A;  2Y48 A;  1JUM A;  2NS8 A;  4LIU A;  3CMM A;  3HEF A;  2XV4 S;  1B8I A;  1R00 A;  1K79 A;  2JN6 A;  1PUE E;  2Q0O A;  3CCY A;  1WJE A;  3GME A;  3KFW X;  4KN7 X;  2ISZ A;  5CVV A;  4MO7 A;  1XTA A;  4M73 A;  4JP0 A;  4A0Z A;  2ZB9 A;  3DLL F;  4D0P A;  1GXP A;  4YFK F;  1MBE A;  4BEH B;  4LG0 A;  4FIS A;  2L4A A;  2ZJ2 A;  1M1E B;  1V54 H;  4HRI A;  2QCO A;  3GLX A;  2ZXI A;  4XON A;  1VQN I;  1W7P B;  1NG6 A;  1IC8 A;  3AG1 H;  2PMZ A;  4JOM A;  3RKX A;  1X19 A;  2A6E F;  2ID6 A;  2CU7 A;  3PL8 A;  4E7K A;  4XKB A;  1MSE C;  4BY7 J;  2MLG A;  4YG2 F;  1UHW A;  3KEQ A;  3HGG A;  3IH4 A;  1IRF A;  3FIW A;  4B8X A;  1GDT A;  2YU9 J;  5HDK A;  2W57 A;  2CQN A;  5H6Q A;  4I98 B;  4ASN A;  1AOY A;  3VWB A;  4I0A A;  1D1C A;  1QVU A;  3VSL A;  5LEK A;  2VPL A;  1LDD A;  4PGG A;  1MBK A;  2OCC H;  1B1B A;  2LP0 A;  2P6T A;  2OTL I;  4MEY F;  3SYT A;  1I50 J;  2L5Q A;  1LE8 B;  4B4C A;  1WPK A;  5FFX A;  3A4C A;  2LVS A;  3BTI A;  2KJB A;  2JA2 A;  2W24 A;  3DKX A;  4O6J A;  4RAG A;  2HYF A;  3LFU A;  2BYV E;  3OYF A;  4MGR A;  2CW7 A;  5F27 A;  3KCC A;  3F6O A;  1W5T A;  3LFK A;  3KZZ A;  4KJZ A;  2DT5 A;  5AON A;  4LD5 A;  3HPG A;  2BE5 F;  1IN8 A;  1S7O A;  1IF1 A;  4BHP A;  4CCJ A;  2IGO A;  4HYE A;  4EJW A;  4BBS J;  4KNY A;  2OUM A;  4FET A;  4PJN A;  2CW8 A;  5D8K B;  2AHQ A;  4CZC A;  3A01 B;  1FOY A;  4HF1 A;  1ETV A;  2WV0 A;  1JHF A;  4H0E A;  1QHG A;  2DYR H;  2ZBK A;  4MTE A;  1ZTR A;  2UZK A;  2O61 A;  2X9D A;  3ZMD A;  3A0H C;  4BJ6 C;  4M3F A;  4IZZ A;  3BRO A;  3FMS A;  3CUO A;  2WV1 A;  2DYS H;  2E34 A;  2XGX A;  3BWG A;  3SDB A;  3I59 B;  3K2Z A;  2WTE A;  3F8C A;  5JHU A;  1RKT A;  4CCO A;  1OCR H;  5CKT A;  2JWT A;  4BS9 A;  2NVT J;  1U78 A;  1WJF A;  2XVC A;  5HNH A;  1SD6 A;  1WJ5 A;  2HOA A;  5E8I A;  2DK5 A;  2L9S A;  1GUU A;  1BIA A;  3HIF A;  2LY1 A;  2NNN A;  1NK3 P;  3H5A A;  1LEB A;  3D5S C;  4BYY A;  3OS0 A;  4A69 C;  1YJN I;  2JA7 J;  5JR3 A;  3O8G A;  3MD2 A;  4HQM A;  3BY6 A;  2MFZ A;  3OIP A;  2RQQ A;  3WU1 B;  2X85 A;  2XAS A;  1IGN A;  2IS4 A;  1K6Y A;  1H0M A;  2XB0 X;  3P9K A;  5F6F A;  3E6B A;  1ZGW A;  4BU2 A;  5D4S A;  1I5Z A;  3DTE A;  1GT0 C;  1JI8 A;  2OU2 A;  3OYG A;  3EPZ A;  1E3P A;  2Y75 A;  4A5N A;  3ERM A;  3CUQ A;  2E36 A;  4ANJ A;  3F9K A;  1KQ0 A;  1ZHF A;  1Y0U A;  3HKZ N;  1HF0 A;  1IAW A;  3BPX A;  3CF2 A;  4OIO F;  3I4N J;  1MDM B;  2JA6 J;  1LB2 A;  3DXJ F;  3WTX C;  1CF7 B;  3HOY J;  1W0T A;  3IKT A;  4G94 A;  4HST A;  4RB2 C;  2PMZ N;  1ON2 A;  2KP6 A;  4PJL A;  1WJC A;  2DPD A;  2WBM A;  1KYZ A;  2V79 A;  3I0T A;  2DPU A;  3BR0 A;  1SAU A;  2F5D A;  3FXL A;  1XG1 A;  3JTH A;  2VXD A;  4ZDL A;  2IP2 A;  3Q0W A;  3ERE D;  5JVG F;  1AWC A;  4BH9 A;  4ZDO A;  1DPU A;  3H3Z A;  2BOL A;  3HOX J;  2OZ6 A;  3VYU B;  4OAZ A;  5EJC A;  1TW3 A;  2ELH A;  1AU7 A;  1QZZ A;  4KMF A;  3K10 A;  4FHT A;  4HQE A;  3C1D A;  4A5M A;  3IRR A;  1MW7 A;  1KA8 A;  1YW9 A;  1DU6 A;  4IEJ A;  4XRS A;  1SEU A;  2QUF A;  4NNJ A;  1GVJ A;  1Z91 A;  1BJA A;  2D1V A;  3H9G A;  4NC6 A;  2PN6 A;  2WB1 A;  4E4H A;  1JE8 A;  1OCO H;  2EIL H;  3X2Q H;  3C2H A;  1YRN A;  2O6G E;  3ZN1 A;  1VQM I;  4ZC3 A;  5LD2 C;  3BG6 A;  5IY5 H;  1R58 A;  2VT3 A;  1T6S A;  2I8D A;  4HAM A;  2E19 A;  3EET A;  3F3X A;  2Q2E B;  3DEW A;  4KN4 X;  4LIV A;  3PSI A;  3W6V A;  2KDO A;  5E3M A;  1FSH A;  3L2V A;  1D0X A;  1U8B A;  3SDG A;  2K7L A;  3ECO A;  3TED A;  4DW6 A;  1VI0 A;  3ML6 A;  2PMH A;  3BG9 A;  1EJ9 A;  3DBR B;  2DN0 A;  4MNU A;  2H1L A;  1RC9 A;  4XOP A;  1Z6R A;  5EDN A;  4OIP F;  2XGD A;  2QQA A;  4E7I A;  3ABM H;  3FF5 A;  3L2R A;  3DU6 A;  3FHZ A;  3E1S A;  2HVR A;  2K5C A;  2BZT A;  2XKO A;  4HPQ A;  1X3W B;  1S29 A;  3JRF A;  1XGS A;  5FFZ A;  3R61 A;  3Q0V A;  1IN7 A;  2M4G A;  1XMK A;  3GTO J;  2QVO A;  4PUS A;  1YI2 I;  2FA5 A;  3HL2 A;  1BOB A;  4RA2 A;  1EF4 A;  4A3C J;  1MZB A;  4KFC A;  1YIT I;  1TP4 A;  2XKP A;  4NHJ A;  4P55 A;  2EBI A;  3GTG J;  1G59 A;  3RTR A;  4LB5 A;  2MAB A;  4OAY A;  3FK7 A;  5LGU A;  4E7J A;  1P7I A;  2DU9 A;  2IA0 A;  3OR2 C;  5IT9 K;  2MC3 A;  1DP3 A;  2K02 A;  3CQZ J;  1PP7 U;  4AIH A;  1FMW A;  1TWA J;  1SD5 A;  2DDA A;  2XRO A;  4UUS A;  2VKV A;  4CGZ A;  1BW6 A;  3HBL A;  3MAJ A;  1KQ8 A;  1LEA A;  1WSU A;  3ZMT A;  4Y13 A;  1F5T A;  5CVI A;  2E2H J;  1QRY A;  4ZYE A;  2ZME A;  1WJB A;  3E0J B;  2OAZ A;  5DEQ A;  1DQU A;  2GAU A;  1ORK A;  5E3N A;  4RDU A;  2ME6 A;  2ZSI B;  4PJM A;  4HDU A;  4PSW A;  2RKH A;  2KPM A;  1G3T A;  3RPU A;  3E5Q A;  5FLX K;  4D7M A;  3D5R C;  1TWG J;  3U1D A;  4Y33 A;  4G6D A;  4A93 J;  3SFI A;  2VBX A;  5IOY A;  2ZO4 A;  3L2W A;  1DP7 P;  2DI3 A;  3WTT C;  4JQF A;  4YII A;  1DU0 A;  2FU4 A;  4M9X A;  1ACI A;  1I6X A;  2W7N A;  2Z33 A;  1J5Y A;  1MSF C;  2XPW A;  1IO2 A;  2STW A;  3K4K A;  4RAF A;  1TQM A;  3B6A A;  2JA8 J;  5H2F C;  1VQ5 I;  2E1C A;  4DZJ A;  2K3P A;  3TL4 X;  5J1U A;  2QSF X;  2R7X A;  3S1Q J;  1N25 A;  3G1L A;  1R1U A;  1NG7 A;  3ZQI A;  5KAF C;  4RBO A;  1JJ8 C;  2E2I J;  4BEH A;  5HOD A;  3I3L A;  1I39 A;  1T2K A;  1USS A;  1VQL I;  3LSG A;  4KMU X;  1PUF B;  2E7X A;  4WF2 A;  2D45 A;  1GVD A;  2P7C B;  4BXU A;  1R1V A;  1STZ A;  4F55 A;  1XSX A;  5CYV A;  2ECC A;  2CMP A;  1APL C;  4HA8 A;  3LSH A;  2H6C A;  4PGH A;  1QZE A;  2QQ8 A;  2CQK A;  2VT2 A;  2VON A;  2WB1 N;  1F9N A;  1Z1D A;  5LHI A;  4XR6 A;  1RZ4 A;  1XCV A;  5TGT A;  5L3D A;  2M7A A;  2K86 A;  1D5Y A;  4N4N B;  2K9L A;  3FWE A;  1YJW I;  1VQ4 I;  2LTP A;  4Y52 J;  1LKX A;  2R7D A;  3J81 K;  3GTJ J;  3JCU C;  2HOS A;  3VYR B;  2EJR A;  2R5Z A;  3UR3 C;  3IAM 2;  2E35 A;  2A5W A;  3ASO H;  3I54 A;  1B59 A;  3DPL C;  2AQE A;  2TDX A;  1OCZ H;  1T95 A;  1TWC J;  2EZH A;  1SMY F;  4ZTJ A;  2HFH A;  2R7V A;  4M3G A;  4HDV A;  1PYV A;  2UV1 A;  1ETY A;  4IL6 C;  4LIT A;  2O8K A;  5F0H A;  3K4B A;  1TQP A;  3DCF A;  2GXA A;  2RNG A;  4HNT A;  1ZLK A;  1MBF A;  3KET A;  2X4H A;  3EUA A;  2ESH A;  4XID A;  2M0M A;  2PX9 A;  3BG7 A;  1I3A A;  3DKW A;  1DDN A;  1S9H A;  2HQA A;  2E2J J;  2NAZ A;  3H35 A;  3I64 A;  3A01 A;  4ENJ A;  3IL2 A;  5BNG A;  4OIR F;  2RVC A;  4G12 A;  3SEQ A;  3TO7 A;  1D8J A;  2IW5 A;  2R7Q A;  3I55 I;  3Q5F A;  3F8N A;  2DJN A;  3H5R A;  3FKJ A;  5EZH A;  2XIG A;  4MEX F;  2IA1 A;  3C2G A;  3G1O A;  2A6H F;  3K1P A;  4XLH A;  2R3S A;  1NH3 A;  3I59 A;  3K0L A;  4XM3 A;  1Z67 A;  4EM0 B;  1ERD A;  3GTQ J;  3TQN A;  3MWM A;  5ICG A;  1IV6 A;  4IPA A;  1K6O A;  3S2W A;  3T8T A;  2VQL A;  3IKV A;  3AG2 H;  1ZN2 A;  1VZ0 A;  2HNH A;  3I58 A;  2HPM A;  4C30 A;  5DD4 A;  3S3O A;  2L7M P;  1ZGA A;  2LFB A;  5BQT A;  3OL3 A;  2R7U A;  1Y39 A;  2QF7 A;  3F21 A;  2HVQ A;  4BQA A;  1UFM A;  1VQ6 I;  1BOA A;  1KQ9 A;  1U0J A;  5CVU A;  4ZYG A;  2E1M B;  4ZH4 F;  2QQB A;  3IH2 A;  1RET A;  1JHH A;  2XAH A;  4UV9 A;  2STT A;  2DDB A;  4S05 A;  3BJO A;  1Z21 A;  2OZU A;  4XIC A;  3CP2 A;  2R93 J;  4KIF A;  2FD5 A;  1MMA A;  1R7J A;  2LOO A;  3V7R A;  3RYP A;  2B9S A;  3CJQ B;  2FNA A;  1PP8 F;  1HLV A;  1YG2 A;  3COA C;  2ID3 A;  4CXF A;  5F08 A;  1JT0 A;  3JW4 A;  1HBX G;  1FBS A;  3RDI A;  3RSN A;  1W7P D;  5J1R A;  4O3M A;  3D5L A;  1JJ6 C;  1ZG3 A;  2A3S A;  4V19 K;  3KP6 A;  5AIP A;  3IWF A;  5CLS A;  2TRT A;  1J0R A;  4HLX A;  2DMN A;  3JR9 A;  2PJR B;  4HV6 A;  3RZO J;  5FKL A;  1MDM A;  2B7E A;  3QAH A;  3DU5 A;  1X58 A;  2EV5 A;  4I6Z A;  1XPX A;  4LG3 A;  1OCC H;  4XLE A;  3K4J A;  1LDK B;  5KK1 A;  5ICF A;  4CO8 A;  3QWL A;  5B5E C;  5EGO B;  2LRD A;  1MBH A;  3PNY A;  3ULQ B;  4BE1 A;  4UNO A;  4IO9 F;  3CCV I;  4HSR A;  2FE3 A;  3J7Y J;  1A35 A;  3SZP A;  3HOS A;  2E60 A;  1T08 B;  3F23 A;  2HDC A;  2WC2 A;  3H9J A;  2IPQ X;  1TWH J;  1W4M A;  4XK4 A;  5JLX A;  3OYJ A;  3QQA A;  5L3E A;  2DA7 A;  2VQG A;  3CDH A;  1S7A A;  3I5U A;  4FAS D;  2CV0 A;  1LVA A;  2HYJ A;  4O5V A;  4Y7N J;  4M6Y A;  4CSW A;  3HSF A;  1WI3 A;  2QBY B;  1QPI A;  2YSR A;  1FOK A;  2IS2 A;  1IZ1 A;  2BBY A;  3W6K B;  2F5C A;  4M9S A;  1X1C A;  1OIS A;  4DYQ A;  3W3C A;  3GEZ A;  2IJL A;  4D5F A;  4KA4 A;  2VOP A;  5JHF A;  1GLN A;  1OCP A;  4A3M J;  1B9N A;  5J8C A;  3HM5 A;  2MLK A;  3WE2 A;  1U8R A;  3GO5 A;  3H1C A;  3QOD A;  4EJT A;  2R7O A;  3IUO A;  2Q2E A;  2KLO A;  2W82 A;  1H88 C;  3H3V K;  1AKH B;  3VFZ A;  3HYI A;  2A69 F;  3DBH B;  5FKN A;  3H9Q A;  4GDF A;  5TRD A;  3A2K A;  1Z0X A;  2NVY J;  4B44 A;  1SMT A;  3WOD F;  3WU0 A;  4PSX A;  3V8L A;  1W1W E;  2FNP A;  1BJZ A;  3KP3 A;  3TDU C;  3VYT B;  5HS7 A;  1R49 A;  1UAA A;  2H6B A;  1W5C C;  1VQ9 I;  5HLI A;  3F8F A;  1O3Q A;  3ZMU A;  3M07 A;  2XSJ C;  2VN2 A;  3FXO A;  1XX5 A;  1Z77 A;  2VJ5 A;  3JSP A;  2KZV A;  5EEA A;  5EEH A;  1MH4 A;  3KP5 A;  3ZGK A;  4J19 A;  3OYE A;  1A5J A;  2LD5 A;  2G7U A;  1HKS A;  4NBQ A;  1K78 B;  2IGK A;  3NAR A;  2HWV A;  2QYO A;  2XAQ A; 
#chains in the Genus database with same CATH homology
 2Y9Y A;  4A3D J;  1P7J A;  1FTT A;  2X9D A;  3L1P A;  4M3F A;  2O9L A;  1JUS A;  3D1N I;  4AYB N;  2WV1 A;  2WAQ N;  1JKR C;  2IBD A;  2W48 A;  1WCM J;  1ITY A;  3PM1 A;  2NVQ J;  1RKT A;  2JWT A;  4MFD A;  4HNV A;  1E3O C;  2NVT J;  2R92 J;  2K9S A;  3GTM J;  1U78 A;  2N8G A;  3JRB A;  3JRA A;  4D7N A;  2HOT A;  2HOA A;  1GUU A;  3WHB A;  3LSP A;  1FEX A;  1NK3 P;  2L9R A;  4ABZ A;  3HB9 A;  4A69 C;  2OF7 A;  2NOG A;  1I3Q J;  1R9T J;  2JA7 J;  3BR5 A;  1F43 A;  5GPC A;  3HGY A;  3BR2 A;  1TC3 C;  1QVT A;  3QPL A;  3CDL A;  3O8G A;  2XB5 A;  1IGN A;  3PO2 J;  3A02 A;  3A03 A;  1OFC X;  1UHS A;  2XB0 X;  1H89 C;  2MW8 A;  5GPA A;  1ZGW A;  1ZR4 A;  5GP9 A;  4A3B J;  1GT0 C;  3HOW J;  1XC5 A;  1ETK A;  4BKX A;  5DS9 A;  2M34 A;  3GBG A;  2EZK A;  2P81 A;  5J1Y A;  1B72 A;  4FE4 A;  2E1O A;  2VPR A;  3FKI J;  3HKZ N;  4C3H J;  1HF0 A;  3FIS A;  2FX0 A;  2Y2Z A;  1F36 A;  3HOZ J;  1LFB A;  1IDZ A;  2M2E A;  2CQQ A;  4XRM A;  3I4N J;  1T56 A;  5M5W J;  2JA6 J;  2DA3 A;  2L7F P;  1LFU P;  3HOY J;  1W0T A;  1JKQ C;  2PMZ N;  4L5E A;  3GTP J;  1PUF A;  3BR0 A;  3S16 J;  2G0E A;  3MN2 A;  1XG1 A;  5F04 A;  5IOZ A;  5EYR A;  5K7H A;  3LNQ A;  3Q0W A;  1ZQ3 P;  5K7Z A;  4JX5 A;  2KDZ A;  1FJL A;  4V2G A;  1HDP A;  2HQ5 A;  2DMQ A;  2YUS A;  4DZP A;  2XSD C;  3HOX J;  3S17 J;  1JTX A;  3S2D J;  1W0U A;  3UKG A;  1JGG A;  1AU7 A;  3E7L A;  2MGQ A;  1DU6 A;  1UG2 A;  4IEJ A;  4XRS A;  1RPW A;  5FLV A;  3GTK J;  2FJ1 A;  2L0K A;  1YRN A;  1ZKG A;  1FIP A;  4M3D A;  2DTZ A;  1JUP A;  2O7O A;  4M3B A;  2E19 A;  2R0Q C;  3DEW A;  3S2H J;  2NVX J;  5FKK A;  3W6V A;  5E3M A;  2I10 A;  1YRN B;  2HDD A;  3K2A A;  1U8B A;  3SDG A;  1G2H A;  3BQZ A;  3JRE A;  4FTH A;  1Q1V A;  3TED A;  4DW6 A;  1VI0 A;  2R5Y A;  3BG9 A;  3S15 J;  2DN0 A;  4D5C A;  2LR8 A;  5EDN A;  2XGD A;  5F0F A;  2XGC A;  4IHX A;  1SFO J;  1HCR A;  5EG0 A;  4M3E A;  3JRF A;  9ANT A;  3LOC A;  5C3E J;  5M5X J;  3IH3 A;  1GV2 A;  5M3M J;  3Q0V A;  3F0C A;  3GTO J;  2Y31 A;  4C3I J;  1ZK8 A;  1AHD P;  4X1E A;  3BR6 A;  1EF4 A;  4A3C J;  5EG0 B;  2EBI A;  5DTD A;  5F0C A;  3GTG J;  5JLW A;  1T33 A;  2ME0 A;  2CRG A;  3RKQ A;  1O4X A;  3FK7 A;  4A3G J;  1P7I A;  1IRZ A;  4A3J J;  2R7Z J;  3I4M J;  3CQZ J;  5K7F A;  2H8R A;  2LLK A;  1TWA J;  1I6H J;  2XGE A;  4UUS A;  2VKV A;  2DMP A;  1BW6 A;  1IJW C;  2Y30 A;  4QTR A;  5C4J J;  3HBL A;  2IEK A;  3WHC A;  2Y0S N;  2EQR A;  5M3F J;  2DA4 A;  2VI6 A;  2E2H J;  3JRI A;  1S7E A;  1QRY A;  2DA2 A;  4AUX A;  1WH5 A;  5IP6 A;  1Y1V J;  1OJL A;  1ORK A;  5E3N A;  4RDU A;  2ME6 A;  3NAU A;  3FK6 A;  2GM4 A;  3HOU J;  3CMY A;  2NS7 A;  4EEF G;  1MBJ A;  1WH7 A;  4D7M A;  1TWG J;  1TWF J;  3BG5 A;  4A93 J;  2K9N A;  3SFI A;  1SAN A;  2MSY A;  4V2F A;  2CJJ A;  1VND A;  5IYC J;  5IOY A;  3QPS A;  1DU0 A;  5IP7 J;  1B72 B;  4C2M J;  1MSF C;  1RR7 A;  1ETX A;  2XPW A;  3B6A A;  4AC0 A;  2JA8 J;  4DZJ A;  5IP9 J;  5J1U A;  5EGO A;  3G1L A;  2YS9 A;  2M8G X;  3ZQL A;  4IHV A;  1MNM C;  3ZQI A;  2E2I J;  2JJ7 A;  3BR1 A;  4RBO A;  1JJ8 C;  1CQT A;  1ETQ A;  4MIM A;  5HOD A;  2OPT A;  4DYR A;  3C2B A;  3JRH A;  4A3E J;  3LSG A;  2IAI A;  2RAE A;  4B1R A;  1PUF B;  1POG A;  1Y1W J;  1GVD A;  3OSF A;  1H8A C;  1VF9 A;  4IHW A;  4A3I J;  2ECC A;  1JKO C;  1APL C;  2X48 A;  3MKL A;  5FLM J;  2WB1 N;  1HOM A;  3ZQH A;  4BXX J;  1X2M A;  1D5Y A;  2LTP A;  4Y52 J;  4JX4 A;  1XS9 A;  1RKW A;  3GTJ J;  1FIA A;  2HOS A;  4QIW N;  2JA5 J;  4CYC A;  2CQX A;  2R5Z A;  1ETO A;  4A3F J;  2JMW A;  4A3L J;  1TWC J;  5FKM A;  1IUF A;  2EZH A;  1AKH A;  4BY1 J;  2GBY A;  4QSH A;  1FTZ A;  3S1N J;  2H1K A;  1MBG A;  4M3G A;  2R5Z B;  1ETY A;  4X6A J;  2LY9 A;  5F0H A;  2O8K A;  3DCF A;  3O8H A;  2FQ4 A;  1MBF A;  4XID A;  3Q3S A;  1JT6 A;  3S14 J;  5FJ8 J;  2E2J J;  2TCT A;  5IYB J;  3A01 A;  4NDL A;  4LOC A;  4JYK A;  3JRC A;  5BNG A;  3LSJ A;  2R5Y B;  4G12 A;  2COB A;  1K83 J;  2MG4 A;  3TW6 A;  1IDY A;  2L7Z A;  3TP3 A;  3TW7 A;  1BW5 A;  2DJN A;  2JK3 A;  3BTL A;  1VFC A;  5EZH A;  3JRG A;  4UUT A;  3BTC A;  1ZR2 A;  2CUE A;  3G1O A;  2DMU A;  3GTQ J;  1IG7 A;  1U9N A;  2ECB A;  1IV6 A;  5C4X J;  2DA5 A;  2KT0 A;  2DA1 A;  4S0H B;  2AO9 A;  2VKE A;  1GV5 A;  4MFE A;  4FCY A;  1JTY A;  2L7M P;  3ZOB A;  2DA6 A;  3ZQF A;  1JKP C;  4XRS G;  3S1Q J;  2LFB A;  3GTL J;  5FKO A;  5F1J A;  2B63 J;  2QF7 A;  4DYC A;  5C44 J;  3VPR A;  1U9O A;  3BR3 A;  3SJM A;  1ENH A;  5EF6 A;  4UUS B;  3IH2 A;  2VUM J;  1RET A;  3PO3 J;  2XRL A;  5J3L A;  4XIC A;  3HDD A;  2R93 J;  2FD5 A;  5IYD J;  3ZQG A;  1MH3 A;  1HDD C;  2D5V A;  2EZL A;  4BBR J;  2LKX A;  1HLV A;  2ID3 A;  3M4O J;  5F08 A;  1JT0 A;  3OSG A;  2XPV A;  4FE7 A;  5J1R A;  1JJ6 C;  2X6O A;  3RZD J;  2TRT A;  2DMN A;  3JR9 A;  1K61 A;  3RZO J;  5FKL A;  1WGX A;  1JUM A;  2NS8 A;  2GLO A;  3HEF A;  3G1M A;  1B8I A;  2JN6 A;  5M5Y J;  2Y9Z A;  3CCY A;  2XPU A;  4MLO A;  1RES A;  1X58 A;  4MO7 A;  3LSR A;  4JP0 A;  4I6Z A;  3HOV J;  3BT9 A;  2ZB9 A;  3ZQC A;  5IPA A;  1B8I B;  2EH3 A;  5EGO B;  5E3O A;  3S1M J;  1MBH A;  3IV5 A;  1MBE A;  1BL0 A;  1UMQ A;  4GFB A;  4FIS A;  2QCO A;  2HXI A;  1IC8 A;  1TWH J;  5JLX A;  4XK4 A;  3TP0 A;  2ID6 A;  2CU7 A;  3QQA A;  4IHY A;  1MSE C;  4BY7 J;  2DA7 A;  3RQI A;  2HYJ A;  3HGG A;  4Y7N J;  3IH4 A;  3FIW A;  1OCT C;  1WI3 A;  1GDT A;  2YU9 J;  4C3J J;  1QPI A;  1LE8 A;  3OOU A;  1BA5 A;  4JX6 A;  2CUF A;  1NTC A;  4DYQ A;  1QVU A;  1ETW A;  4D5F A;  1MBK A;  3BG3 A;  4CYC B;  3S1R J;  1OCP A;  2K40 A;  4A3M J;  2LP0 A;  3HM5 A;  1A6I A;  3B6C A;  2M9H A;  1I50 J;  1LE8 B;  2HXO A;  4B4C A;  1WPK A;  2HI3 A;  3H0G J;  4M6V A;  3H3V K;  1H88 C;  2LVS A;  3BTI A;  1AKH B;  5EZG A;  5FKN A;  2K9Q A;  4W1U A;  1Z0X A;  2NVY J;  3BQY A;  3OIO A;  4A3K J;  2DMT A;  5F27 A;  1BJZ A;  4B3A A;  2M0C A;  5E3L A;  3BTJ A;  4I76 A;  1NK2 P;  1X2N A;  3K7A J;  1Z77 A;  2EZI A;  4W97 A;  5EEA A;  4J19 A;  1MH4 A;  4BBS J;  3Q0U A;  1A5J A;  3A01 B;  3M3Y J;  2AHQ A;  2LD5 A;  2ELK A;  1ETV A;  2LK2 A;  3MVP A;  3NAR A;  3JRD A;  1ZTR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...