4A3CJ

Rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4a3cJ00
1X58A 2JN6A 3E7LA 4UUTA 1ZQ3P 3UKGA 1OFCX 1MBHA 3SJMA 1JKPC 5FKOA 1VI0A 3HOWJ 4B1RA 4A3GJ 3HBLA 2DA1A 3BR3A 1JJ8C 1Z0XA 2W48A 2LK2A 1LE8B 1JJ6C 4A3CJ 3FK7A 9ANTA 4MIMA 4X1EA 5JLXA 4FCYA 3PO3J 3BT9A 2COBA 3OIOA 2K9QA 1MBKA 5EG0A 5M3FJ 3JRGA 2CJJA 5GPCA 1RKTA 3BTCA 3IH3A 1I3QJ 1B72B 2QCOA 2LP0A 2NVYJ 3Q0UA 1CQTA 4S0HB 2GBYA 2Y31A 1U9NA 1EF4A 4A93J 2DMUA 3LSPA 5FLMJ 3Q0VA 3JRIA 1IRZA 1AHDP 3PM1A 3M4OJ 1XC5A 4M3EA 5IYBJ 1HOMA 1TWFJ 1FIPA 3BG5A 3M3YJ 1JUPA 3S17J 1QVTA 3GTQJ 3S2DJ 4MFEA 3K2AA 5EGOB 2R5YB 5J1RA 1IJWC 1BJZA 3BG9A 1TWCJ 1MBFA 1JTYA 4DW6A 5HODA 2E1OA 3H3VK 4A69C 1PUFA 2HOSA 4W97A 2O9LA 3I4NJ 4AYBN 2LD5A 1DU6A 2M8GX 1H89C 1GT0C 1P7IA 1GV2A 2JA7J 1ETKA 1TWHJ 4B3AA 3IH4A 2CQXA 3BG3A 4V2FA 5DS9A 3JREA 2E2HJ 5K7ZA 1Q1VA 1RPWA 2NS8A 4A3LJ 2XB0X 4A3MJ 2HOAA 3BR6A 3QPSA 1K61A 3GTJJ 1H8AC 2LKXA 5FKLA 1MH4A 5F0FA 2M9HA 4DZJA 5EG0B 4A3FJ 3IV5A 2O8KA 4JX4A 5F0CA 5GP9A 2CRGA 3S14J 1I6HJ 3LOCA 3BTLA 2IBDA 4QSHA 4BY7J 1MNMC 1QPIA 1RESA 3TW7A 3L1PA 1U9OA 4JP0A 3HGGA 3G1LA 3FK6A 1ITYA 2LY9A 3TEDA 2LVSA 4A3EJ 1WCMJ 3C2BA 2MG4A 1JT6A 3G1OA 1O4XA 1B72A 4DYQA 2H8RA 1NK3P 3WHBA 1F43A 3HGYA 1FEXA 4DZPA 3B6AA 5EDNA 2DA6A 4FISA 1OCTC 4A3JJ 1Y1WJ 1FIAA 2IAIA 2OF7A 4CYCB 3HOXJ 2WAQN 5IYDJ 4V2GA 2DJNA 2M2EA 1RKWA 1R9TJ 1MBGA 1ENHA 4C2MJ 2ME0A 4M6VA 3S1RJ 3B6CA 2L7ZA 3I4MJ 2Y9ZA 1UHSA 3HOYJ 2EZIA 2ELKA 1PUFB 4JYKA 5FKNA 2R5YA 4FTHA 2NVXJ 3S16J 1GUUA 1WGXA 2DA4A 2L9RA 3ZQHA 1GDTA 4UUSA 2G0EA 4B4CA 1WPKA 2XSDC 3JRFA 3HEFA 1H88C 5EYRA 1XS9A 1IGNA 2P81A 2DMTA 2AO9A 1XG1A 2L7FP 3HDDA 1WI3A 3A02A 5BNGA 4C3JJ 1E3OC 3GBGA 2EBIA 1BW6A 2MGQA 3JRBA 5IPAA 1FTZA 1SANA 2GM4A 4M3GA 2FQ4A 4I6ZA 3SFIA 5IP6A 1ETVA 5IP9J 2VKVA 3HOUJ 2ECCA 1T33A 3Q3SA 4HNVA 3BQZA 1FTTA 5C4XJ 2N8GA 1IDZA 5IOYA 2R7ZJ 2R5ZA 4C3IJ 1LFBA 1JKQC 2XPWA 2Y9YA 5FKMA 3QPLA 5E3LA 1OCPA 4BBSJ 3ZQIA 5C4JJ 3IH2A 1ZR2A 3S1QJ 4JX6A 5F04A 2XPUA 1HLVA 2ME6A 4JX5A 1VF9A 1W0UA 1SFOJ 5IYCJ 1S7EA 4A3KJ 2D5VA 4CYCA 3CQZJ 1T56A 2DA7A 2HXIA 5K7FA 2TCTA 3RZOJ 1K83J 4BXXJ 4UUSB 1JT0A 4DYRA 1ETXA 4C3HJ 2HXOA 4M3DA 3MKLA 4L5EA 3PO2J 1VNDA 2Y30A 1U8BA 3OSFA 2JA8J 5FKKA 3BR1A 2ECBA 1ZGWA 3JRHA 3BTIA 1UG2A 2EZLA 2KT0A 1ZTRA 3GTMJ 2E19A 1MSFC 1A5JA 3TP0A 1FJLA 3OSGA 1RETA 5J1YA 1A6IA 1IV6A 1WH7A 2DMNA 4MLOA 3TP3A 2NVTJ 4X6AJ 4IHWA 1HCRA 3G1MA 1AU7A 1APLC 5EF6A 2FX0A 4QTRA 1BL0A 2R5ZB 2RAEA 3MN2A 1QRYA 4J19A 2JJ7A 2K40A 1DU0A 4EEFG 2ID3A 2GLOA 4XIDA 5K7HA 4D7MA 2LFBA 4FE7A 1VFCA 2PMZN 1NK2P 4DYCA 3JRAA 1JKRC 3HOVJ 2M0CA 3O8HA 1JGGA 1F36A 3CDLA 1TWAJ 3LSRA 2QF7A 2X6OA 3LSGA 3MVPA 2HYJA 5J3LA 1ORKA 2DA3A 2TRTA 5EZHA 2VI6A 3S1NJ 2VKEA 3NAUA 3Q0WA 2B63J 3LNQA 3ZQCA 3DEWA 4XK4A 1X2NA 4GFBA 2R0QC 3CCYA 5F1JA 1JUSA 3QQAA 4BY1J 1P7JA 3A01B 3O8GA 5J1UA 5F27A 4XRMA 1ETWA 4AUXA 3HOZJ 5F0HA 2JMWA 1GVDA 1ZR4A 4M3BA 1IG7A 4Y52J 3GTKJ 1ZK8A 2EQRA 1NTCA 2NVQJ 2NS7A 2X9DA 1D5YA 3WHCA 2IEKA 2I10A 3GTLJ 5M3MJ 3FKIJ 3GTGJ 1U78A 2ZB9A 1B8IA 4W1UA 2VUMJ 2XGCA 4IEJA 4MO7A 4IHXA 5FJ8J 2Y2ZA 2L0KA 2DN0A 2MSYA 2HI3A 1ETQA 2XGDA 3LSJA 3JRDA 2EZHA 1AKHA 1I50J 1JTXA 5GPAA 3S1MJ 2MW8A 5E3NA 2M34A 2ID6A 3HM5A 1MBEA 1YRNA 3BQYA 2JWTA 3RZDJ 4D5CA 2HDDA 4Y7NJ 3GTPJ 4A3DJ 2XGEA 3HB9A 1WH5A 3BR2A 5E3OA 3ZQLA 2WB1N 2NOGA 3F0CA 4IHYA 2CU7A 3RKQA 2DA2A 5DTDA 2KDZA 4D7NA 5C44J 4FE4A 2K9SA 1IC8A 2FD5A 3K7AJ 4AC0A 1X2MA 2R92J 4D5FA 2XRLA 2VPRA 2LTPA 3A03A 1JUMA 3A01A 2XB5A 2YU9J 1QVUA 1BW5A 5EEAA 3H0GJ 4XICA 3NARA 4RDUA 4QIWN 1IDYA 1MSEC 4LOCA 2R93J 2Y0SN 3D1NI 4MFDA 1IUFA 3S15J 1B8IB 5E3MA 2LLKA 2O7OA 1UMQA 4XRSG 3JR9A 3VPRA 1G2HA 1AKHB 4RBOA 1ZKGA 5IOZA 5IP7J 4A3BJ 1ETOA 3HKZN 1TWGJ 2LR8A 2YUSA 2X48A 2WV1A 1ETYA 4I76A 1BA5A 1YRNB 1HDPA 3FIWA 3FISA 3ZQGA 1LFUP 2JA5J 1LE8A 1Y1VJ 4BBRJ 2K9NA 2HOTA 2AHQA 1OJLA 3BTJA 3RQIA 2XPVA 2JA6J 5EZGA 1TC3C 1W0TA 3ZOBA 1POGA 2E2IJ 4XRSA 5M5YJ 2DTZA 2EH3A 2CUEA 2YS9A 2CUFA 3S2HJ 5C3EJ 3CMYA 3GTOJ 3BR0A 1Z77A 4M3FA 3W6VA 2DMQA 5JLWA 4A3IJ 5F08A 3JRCA 3TW6A 1MBJA 4BKXA 2OPTA 1HDDC 1HF0A 4IHVA 5M5WJ 2E2JJ 1MH3A 2H1KA 5FLVA 4ABZA 2EZKA 2JK3A 2HQ5A 1JKOC 3DCFA 2DMPA 2DA5A 2L7MP 3BR5A 2CQQA 2FJ1A 4G12A 5EGOA 4NDLA 3SDGA 5M5XJ 3OOUA 3ZQFA 1GV5A 1RR7A
chains in the Genus database with same CATH superfamily
3ZQ7A 3OIPA 4XOTA 3E7LA 1RRJA 1W7PD 1OFCX 4AU7A 4A0YA 2PMHA 3PUFA 3WU2C 1K78B 2MD5A 1PUEE 3WE3A 4B1RA 3J80Z 3HBLA 4S04A 1TP4A 2IP2A 1IO2A 1D0XA 1Z0XA 3ONQA 1WJCA 2W48A 4UVCA 4A3CJ 1EJ9A 2W25A 4UB8C 3T8RA 1J75A 3PO3J 4AM3A 3F6OA 4WF2A 2DO7A 5M3FJ 4CCKA 1WJFA 1YS7A 2VKHA 1V3FA 2UZKA 3V7CA 1R36A 2VJ4A 2I8DA 2NVYJ 2PX9A 2WTEA 2Z99A 3BROA 3W6JB 4ESBA 2HDCA 5ICGA 1U9NA 1QBJA 1Y8QB 5FB2A 4F7ZA 2FUG2 3LSPA 3DV8A 3PIPF 2UV1A 1KQ0A 4P96A 2ISZA 3JRIA 2W84A 1UELB 4N4OB 3M4OJ 2FOWA 3I0TA 2XASA 2OZ6A 1LPQA 3LWFA 3TO6A 1QHHD 1JUPA 2XSJC 3IC7A 4DGWB 3GTQJ 1EV7A 3PNYA 4F3QA 2QBYA 2PQ8A 1FOYA 4I01A 4IJAA 5DCMB 1TWCJ 5HNFA 1IN6A 1XDSA 3K6GA 1HKQA 1KQ9A 3HHHA 3X2QH 3CLQA 2E1OA 4IL6C 2VE9A 2O9LA 3S3OA 3HXLA 3OYGA 1DU6A 2M8GX 1YJWI 3GMEA 3CC7I 4OINF 3HSFA 3BY6A 2XAFA 2VN2A 3BG3A 3MWMA 1Z6RA 1Q1VA 3BOQA 3KETA 1T39A 1RR8C 1QZZA 2QQ9A 2XB0X 3J81K 5LHIA 4NB5A 1MH4A 3DTIA 4EJUA 1UJ8A 5AONA 3P5JA 1ON2A 2M9HA 4PJJA 5DM7F 4AD9A 1KYZA 3CJRB 1M1EB 3G6EI 1R58A 3K4MA 3R0JA 3PFIA 2EFOA 4JX4A 4E7IA 1Z7LA 1YS6A 3S14J 1D3YA 2BW3A 3LOCA 3BTLA 3DEUA 5LFAA 2IBDA 2A6TA 1MNMC 2PMZA 1FYMA 2O03A 3L1PA 1X3WB 2DK8A 2XROA 1U9OA 4JP0A 1MJBA 1RNLA 3JCUC 5CJ9A 3G1LA 3DEEA 3ABTA 4ZZLA 3I59B 4BAYA 4L9NA 1LKXA 1JT6A 3JTHA 2R7FA 2HQNA 1V5FA 2DT7B 1NK3P 2A05A 1FEXA 2HOEA 4DZPA 1I1GA 1ZH5A 3B6AA 4FISA 4G6DA 2HVRA 1MNEA 1FIAA 2IAIA 2LMDA 2OF7A 4HX7A 4CYCB 5IYDJ 4V2GA 4M71A 3S93A 4AIKA 3BG6A 2D45A 1MBGA 1R9TJ 5DD4A 2VXZA 4C2MJ 3HG9A 2F5DA 1FSEA 2ADUA 3I4MJ 4CZZA 3OYEA 1D0ZA 4IRHA 3VYTB 3RYRA 3WODF 3HOYJ 5B1AH 1XD7A 4YIIA 4EM0B 1STZA 4FTHA 2D2WA 2NVXJ 1N75A 4BQOA 1YI2I 2UUZA 5EEGA 1A6QA 3JRFA 3HEFA 1S29A 5EYRA 1XS9A 4HQMA 1KGSA 1XN7A 5LD2C 2DMTA 2MA3A 1K4SA 4FX4A 2VQGA 1WI3A 4C3JJ 1IN7A 3SEQA 1WZ2A 1R49A 4B3XA 4HNTA 5D5VB 1BW6A 2MGQA 1FTZA 2BW3B 1R5ID 3J7YJ 4ESFA 3BDDA 4I6ZA 1ETVA 2VKVA 2IXSA 3HOUJ 2ECCA 3RPUD 1T33A 3Q3SA 5ICFA 1LQ1A 1T95A 1CF7B 4BHBA 5IOYA 2CSOA 2FSWA 1HXDA 2PI0A 5CVVA 1YFHA 1J9IA 2RNGA 3ABMH 3HHGA 3J7AY 1L0OC 1XMAA 1LDJA 3OYDA 5E3LA 1Z7UA 1SAXA 2Z2SB 3FDYA 2IS1A 4C30A 4KMFA 3PSIA 1XPXA 2WV0A 1ZR2A 1TTYA 1HLVA 3OYKA 2BBYA 2FBHA 1VF9A 1ZARA 2LOOA 2XHKA 3FXMA 1W0UA 1SFOJ 2OQGA 4G7OF 2CQKA 4M9ZA 4N9HA 2DOFA 3NWSA 2Q2EA 2XDVA 1ZG5A 1Y39A 3RZOJ 4BXXJ 2DT5A 2OV7A 5HLHA 3DTEA 3F3XA 2DW4A 4PGHA 1JT0A 3BPVA 1DDNA 3MAJA 5K1YA 1UAAA 2JSCA 3KZZA 3LSMA 4KMUX 4E7HA 3RJPA 1SFUA 5FKKA 3BR1A 1O57A 2ECBA 1ZGWA 1XX5A 3K10A 3LA7A 1K6YA 4CSWA 4BQQA 1U5TC 4RAZA 1XTAA 3WGGA 2HTJA 2DYRH 2FNPA 3HKZA 1RETA 2R7DA 2M0MA 2STWA 1E0EA 3TP3A 2OUMA 1CGPA 4IHWA 3KP2A 2LKSA 5KK1A 5EF6A 1WKMA 3J81Z 3E5XA 1R4MB 3KP3A 1LJ9A 2Y75A 3K4KA 3T5XA 3MN2A 3DBLB 4WX9A 5J40A 3MQ0A 4G94A 3FKJA 1DU0A 3H9JA 2JUCA 3CF2A 4XIDA 1FYLA 1VQ9I 4KFCA 1T08B 1FMVA 3JRAA 2QA4I 4F52A 1T6SA 3OOPA 3HTSB 4E7LA 2DPUA 1QO0D 4MEXF 3R0AA 2B7EA 2WAEA 2CV1A 3O8HA 4LGWA 2Q2EB 4HDUA 1JGSA 1ORKA 1MMSA 3T1BA 3F8CA 4AWXB 4IZZA 2ZMEC 2F5EA 2ZC2A 4Y33A 3LNQA 3C1DA 3K70D 2AXLA 3ZR8X 4GFBA 1GVJA 2R7WA 5F1JA 1G3WA 1UG0A 1MNDA 2OAZA 2IRFG 1R1TA 1FY7A 4XKCA 1ETWA 2E7XA 2IGOA 1VQNI 3HOZJ 5H6RA 3WG7H 2GWRA 2VQCA 2JVHA 1ZN2A 3GZ6A 1BI1A 2VBXA 3KX2A 4EJVA 2E34A 4NC8A 2Q8KA 2M30A 3DBHB 4ZH4F 1F5TA 1ZREA 2I10A 4YIFA 4HQEA 3FKIJ 1U78A 2XGCA 3L9FA 5FJ8J 4XRFA 4MTDA 2L0KA 2XF5A 3F8NA 3JRDA 1AKHA 1I50J 5HS9A 1JTXA 2LREA 3QRFF 3S1MJ 1DP3A 4M9SA 4HYEA 2VJJA 3FX3A 2X1CA 5DCFA 2E7WA 1MBEA 3J7AO 5DCMA 3RZDJ 2QZ8A 2HDWA 4YEJA 1F1ZA 4Y7NJ 4XBFA 4XN3A 5LHHA 1A31A 2LC2A 4HF2A 1WH5A 2NXNB 3BR2A 5AIQA 4L9VA 2WB1N 2NOGA 1R5HA 3EYYA 1YE9A 1OYIA 5D8LB 1J7KA 4HA8A 3M07A 3CZ6A 3SDBA 3M1EA 5DTDA 1D8KA 4KICA 1P92A 5L3CA 5HLIA 4XR6A 2A6HF 3ASOH 4AC0A 3D5RC 3F8BA 2R92J 1W5SA 4P55A 2VPRA 4DQ2A 2DK5A 1PYVA 4YFKF 3CMMA 2CQNA 2A07F 2IJLA 3CC4I 1JUMA 3VODA 3AL0B 3KLNA 2BY3A 1YW7A 3S8PA 1S7OA 4E7SA 4RB2C 3WTUC 1USTA 2CFXA 4BS9A 3H0GJ 4XICA 4RDUA 1X3ZB 3F22A 4LOCA 2E71A 2P5KA 3D1NI 3AG3H 3HRSA 2UXNA 3S15J 1RUNA 3I5UA 1RUOA 2LLKA 1UMQA 1BI0A 4XRSG 3JR9A 1AKHB 1G3YA 3BZ6A 2OCEA 5DEQA 5IP7J 1ETOA 2HVSA 2LR8A 2V6CA 3P9CA 1DGWY 1ETYA 2WV1A 1YW8A 1SD4A 4IRIA 2WY8Q 1MJAA 4I0AA 1FLIA 2H1LA 2O5RA 2EFNA 2FE3A 2LNBA 5CPRB 1LE8A 2JA5J 1Y1VJ 4XORA 2M3AA 4GXOA 4IX7A 2K9NA 2NYXA 1YHQI 3N05A 4BNCA 5IT9K 5E18F 1J2XA 3FXJA 4A6DA 1W0TA 3CP2A 2R4GA 3L00A 2H27A 1PDNC 5ILUA 3E6DA 1TQPA 3TQNA 1O3RA 2LSOA 4XOPA 2CUEA 1UHMA 4ZYEA 5FRNA 3SFZA 5EJCA 4RAYA 3FXRA 2M4GA 3CMYA 2KZVA 2V1NA 3DU5A 5FD6A 3BR0A 1J5YA 1Z77A 3W6VA 1MMDA 4A3IJ 4BKXA 1V55H 2DT6A 2EIJH 1LNWA 2KFDA 5M5WJ 2E2JJ 3QP6A 4XLCA 2O0YA 3OYBA 3FBNB 1KQ8A 1OYWA 3CUQC 2EA2A 2DA5A 2K85A 1I3AA 3VWBA 1TT0A 5EGOA 2OTLI 3WU1B 2CQ7A 3PFYA 4HX4A 3ISPA 1Z91A 1GV5A 1N78A 4YELA 1DUXC 4EGZA 3OYLA 3D0SA 2JN6A 4O3MA 4UUTA 5F6FA 4GCVA 4BU2A 2OCCH 3IKVA 3ABLH 1MBHA 3SJMA 1R00A 1JKPC 1VI0A 2JSPA 3F8FA 3HOWJ 3I55I 2LH9A 1VQMI 4ZDOA 4KUMA 1ON1A 3I64A 4CZCA 1LE8B 2I5UA 5CVJA 2MLKA 3GWZA 4BHPA 3D5LA 2A69F 3KYLA 4ZTFA 2XRNA 3OIOA 2M4KA 4XSZF 3KYCB 3HYIA 3CMAI 1UFMA 3HPHA 4IHSA 5DDGA 2CYYA 3HIFA 1U8RA 3IH3A 4BE1A 1I3QJ 1B72B 2K3FA 2KISA 2EFWA 4HAMA 2KIQA 1WHUA 3JSPA 3U1DA 2LY1A 2PEXA 2CH0A 3PSFA 3J7ZI 5LLQA 3JAMK 1R1UA 2GBYA 2CMPA 4OU0A 5JFRA 1EF4A 2VL8A 4A93J 3M7GA 4EM2A 2DMUA 1O3QA 1XSVA 3KEYA 4B47A 3Q0VA 1KZHA 1IRZA 2BE5F 3NEUA 3PM1A 4R8HA 1D1AA 3S3MA 1HOMA 1YQAA 3TO9A 1FIPA 3U1KA 3L09A 3BG5A 3S17J 2Z1DA 3DP7A 1QVTA 5EGOB 2R5YB 2CV2A 2XF7A 2WC2A 2DDBA 5TGTA 2VT3A 4BJ5C 2HWVA 2IVMA 3H3VK 4A69C 2HOSA 1MIJA 2QKMB 4W97A 2YR2A 2LD5A 1T2KA 1BM9A 2BHZA 4A2UA 1GV2A 2MC4A 1JXSA 5A2QK 4B3AA 5LHGA 2CQXA 5DS9A 3WTXC 2DYSH 5K7ZA 3BWGA 2NS8A 3WGIA 2DTRA 1FOXA 4I98B 2HOAA 3BR6A 3QPSA 4U7DA 1VQ8I 2CGPA 1T98A 3GTJJ 5K5RA 2LKXA 5F0FA 3CCSI 3FXKA 4HLXA 2LKPA 1KYWA 1YG2A 2PJRB 2W7NA 3IV5A 3BG7A 2A68F 3PL8A 3LFKA 4CYDA 2QUFA 2ELHA 5GP9A 2CRGA 3PNTA 3NRVA 3OYCA 3ZMVA 4BY7J 3TW7A 5DM6F 4PJMA 4Y13A 2PJPA 4BJTA 3HGGA 2KRCA 2LY9A 4YRVA 1ULYA 4A3EJ 3C2BA 5J8CA 2CUZA 1REPC 4CDGA 2H8RA 4HDVA 2QGUA 3K70C 2G7UA 4Q48A 3O6BB 3HGYA 5IT9Z 1G8XA 2EIMH 5HOOA 2VB6A 2MFZA 5CVIA 3IRRA 4M73A 1OCTC 4EJWA 1BR1A 1Y1WJ 4HSRA 2JPBA 5HS8A 2WAQN 3I71A 3OR1C 2DJNA 4R79A 1ZGAA 2ME0A 5HDKA 3WTVC 2GA1A 3HC7A 4CXFA 2ELKA 3BCAA 1SMTA 5FKNA 1FT9A 4JK1X 2F5FA 3S16J 1GUUA 1WGXA 3ZQHA 4UV8A 5BPIA 2G0EA 3CCJI 2J5OA 1TW3A 3SXYA 1WPKA 2OQRA 4EQQA 4S05A 1OCRH 2BXZA 2XSDC 4FQGA 1IGNA 4RGXA 1V4RA 3HZJA 2QLZA 2P5LC 2P81A 1W5CC 2FF4A 3K4LA 2ETHA 3HDDA 3AG4H 5BNGA 3L2UA 1E3OC 4PGGA 3A4CA 4ZTJA 3WGHA 2UWMA 3GBGA 4QLCU 1IV8A 3MZYA 4RB1A 3JRBA 1G4DA 4M3GA 3UR3C 3SFIA 4NC7A 3TO7A 1HW5A 3FMQA 1G6NA 2V4JC 5FRMA 4HNVA 1PJRA 1FTTA 2GZWA 2CUJA 4KIFA 4N9IA 3CO6C 1IDZA 3DKWA 5DUKA 2VQLA 1MDMA 2L3DA 2R5ZA 4M72A 1JKQC 2FA5A 2BGCA 2R7RA 2XPWA 3V8JA 2Y9YA 1P6RA 5FKMA 3I59A 5JHFA 1T38A 1BOBA 3QYFA 2HPMA 5ERIA 2XAGA 3ZQIA 4H0EA 2ZJQF 1Z3XA 2XUBA 5F04A 2MH9A 1LFPA 2MD0A 5IY5H 4JX5A 2EV0A 5IYCJ 1S7EA 4A3KJ 1TNTA 4CYCA 3CQZJ 1T56A 3H5NA 1TBXA 3G71I 3JAMZ 2OD5A 1K83J 1IRFA 1LDDA 4Y15A 2BXYA 1I6XA 3GFMA 1USSA 1ETXA 4C3HJ 1HW1A 4CICA 1IZ1A 4M3DA 4CCMA 4XLPF 2KRHA 2Y30A 4C2UA 2JA8J 3L2WA 4XQFA 1FX7A 4WXCA 2VKDA 4I2OA 2AQEA 5FD5A 4PJNA 1UG2A 4OWRB 5BS6A 1PP7U 4OOIA 2ZKZA 4Z6YA 3GTMJ 1MSFC 1U2WA 2AS5F 1FJLA 3CCVI 3W2VA 3L2QA 4AVPA 1IV6A 2IA0A 1E2XA 2MLGA 3ELKA 3REOA 5A2QZ 4X6AJ 1T0FA 2ZJRF 2LY2A 1NG6A 1FNNA 4U87A 2J5PA 3HRUA 3ERMA 5JVGF 1MDMB 2R5ZB 5K5OA 3N4MA 2RAEA 1CF7A 4CO8A 4J19A 2DOEA 1A36A 3FZVA 2GLOA 1VFCA 2PMZN 5D6EA 1IF1A 2DDAA 1UHWA 4AVZA 5E8IA 4PSWA 3DU6A 2XIGA 5LEJA 2QYOA 4BH9A 2M0CA 1FPQA 4CCLA 1JGGA 4FT8A 2PMUA 1TWAJ 4BDYA 1HA8A 2QF7A 2X6OA 1FSHA 3MVPA 4CCNA 5J3LA 4P9UA 2DA3A 3DF8A 1XGNA 3E0JB 1OCZH 4ZZDA 5EZHA 2HYGD 4C9YA 1HSTA 1NG7A 1QZYA 4B44A 5D5UB 4BDZA 3Q0WA 3ZP5A 1TQIA 4ENJA 6PAXA 3MD2A 3H0DA 1SD7A 1S8NA 1X2NA 1H9GA 3ECOA 4Q4ZF 1P7JA 4KIBA 2QQBA 3E6MA 1TT5B 2P5VA 2DQRA 3GZ5A 4R1HA 2M8EA 4D1QA 5KAIC 1Y56A 1Z67A 3RKWA 5DYMA 5F0HA 2WADA 1R71A 4E6KG 2L9SA 4LD5A 4HSTA 3SZPA 2EQRA 3CF5F 2NS7A 3QPTA 2LF8A 2E60A 1D5YA 2KRFA 4BUPA 3WTZA 2CW7A 3GTLJ 2FRHA 1D1BA 3KZYA 4OAZA 3GTGJ 4WK8F 1B8IA 3TBIA 2VUMJ 3K9TA 2VBZA 2KIUA 1IW7F 2DN0A 2FQ3A 3GLXA 2F5CA 2HI3A 1ETQA 3BLYA 2O3FA 4HW0A 1DQUA 5GPAA 1XGOA 2ZNZA 5KAFC 2M34A 2ID6A 3V7RA 3QODA 5E1ZB 5H20A 1YRNA 3BQYA 2JWTA 4LMYA 4UXNA 4D5CA 3U2RA 2G9WA 2VLAA 3SYTA 4I02A 3LAPA 3AG1H 4A3DJ 3IWFA 1IXRC 4UVBA 2VASA 3F9KA 3HB9A 2HZTA 3BJAA 3VOEA 3ZQLA 3H9QA 3VSLA 3F0CA 3R60A 1IUYA 3RYPA 3T0YA 1IN5A 1JHHA 3FM5A 4O5VA 1H0MA 3ZRGA 3TMOA 3QU3A 2HYFA 3KIOA 1ODDA 3CESA 2GQQA 2K9SA 2DPDA 2EIKH 2ZFWA 1V54H 3E3VA 3FBIB 2RNJA 2K9LA 4MEYF 2XRLA 2QEXI 3KE2A 3ZMUA 2V6EA 4L0ZB 3FXQA 5D6FA 2V1DA 2YU9J 1AOYA 4X0GA 1BW5A 1KU9A 3CUOA 2M7BA 1MSEC 5LGNA 1OR7A 1P4XA 1ZRFA 5ILVA 3E5UA 2K7LA 2O8XA 2VC0A 1V5EA 1BR2A 3EPZA 2F4MB 3ZMZA 1B8IB 4RB3C 2X6YA 3RKYA 1X1BA 3VSKA 3VYRB 4HNUA 1VQ6I 3OS1A 5IOZA 2BOLA 1L3LA 2M5WA 1YW9A 3HKZN 2Y69H 2X1DA 2YUSA 4II2A 4XLHA 2DJIA 4KYWA 4I76A 1BA5A 1YRNB 5J47A 5CLSA 4LG3A 4IHTA 4RA2A 2F4OB 3GLLA 4H4KC 1FYKA 3FISA 1XCVA 2IA1A 3ZQGA 5LGUA 5GADJ 3HOSA 4WXHA 5LGTA 3CMEI 1P2FA 2OZUA 5ICEA 2HOTA 1S7AA 2AHQA 3RQIA 3S2WA 2GOMA 4LK0F 1PP8F 3FMSA 2JA6J 2WA0A 1IXSB 4XL9A 2WBMA 5EZGA 2YSRA 1TC3C 1SFEA 1POGA 3AG2H 3ZOBA 4JOMA 2FMLA 3M9AA 4XRSA 2E2IJ 5M5YJ 3E97A 1GXPA 2YS9A 5LEKA 3C3WA 3L2CA 2ICWG 5C3EJ 3H36A 3MKZA 3GTOJ 3R4KA 4M3FA 4NC6A 1OISA 5F08A 2ELJA 2BEOA 1R4NB 2EV6A 2A6EF 4C2TA 2KZGA 4Y3OA 2DFFA 1HDDC 3K4JA 5F1RA 1WJBA 1YJNI 2BZTA 4ABZA 1EH6A 3DTKA 3KCCA 3DCFA 1LEAA 2IPQX 2COMA 3G73A 2CQQA 1GHCA 2OTJI 3WG9A 3SDGA 5M5XJ 3ZQQA 4Z2YA 4LK1F 3EUHA 3OOUA 4Q47A 2FMYA 4HEA2 1B59A 1X58A 1ZQ3P 3B02A 3BCBA 4HZFA 2LRDA 1U5TB 1XCBA 4L9TA 3RTRA 3TOBA 3IL2A 1SD5A 2JT1A 2MH2A 5FROA 5GTIC 1J0RA 3HSEA 1TL8A 3OYNA 3CCQI 3ZN1A 3BR3A 3EETA 3LSHA 2LK2A 2NOJB 1R23A 2KJCA 3F72A 4J01A 4MIMA 4X1EA 3ZXSA 3HL2A 3RDIA 2ACJA 4FCYA 4JBAA 2BYVE 1RI7A 4O6JA 3BT9A 1HSJA 5EG0A 3FXLA 4ETSA 3JRGA 2QSHX 1DPRA 2V1XA 4HOBA 4XLAA 5E20A 3LSTA 3BTCA 3AAFA 3L2RA 5LRSA 2Q0OA 3LAJA 1PVEA 1OMIA 2KQRA 2QCOA 2X1EA 3I4PA 2E36A 4EATA 1EA3A 3GFJA 2QM3A 4S0HB 3OWTA 2Y31A 1X1DA 3QP5A 5L3GA 2HNHA 3AKZA 2RKHA 2X6WA 1KU3A 4M3EA 5IYBJ 4DIQA 2E1MB 3OS0A 1ZHFA 2HQRA 5HNHA 3IUOA 1HW2A 2D1HA 3M3YJ 2NVUB 4V19K 3K2AA 3B73A 5J1RA 1IJWC 2FBIA 2UXXA 1ZRDA 2HR3A 1WI9A 5JHUA 3W3CA 1PUFA 3HSRA 3EUKL 3M8JA 5CKTA 1X4PA 4HRIA 2GOXB 4FHTA 2ZJPF 2GIVA 1P7IA 2ZXWH 1ETKA 3K1PA 1LVAA 3IH4A 4V2FA 3EYIA 4G9YA 3IRQA 2CW0F 1RPWA 4A3LJ 3Q9SA 3CDHA 1K61A 3C2GA 4QPOA 2VODA 2FEZA 4D0PA 5EG0B 3GFIA 4A3FJ 5DUIA 3IP4B 3ML6A 5F0CA 1I6HJ 1BIBA 4RM2A 3ULQB 1QU3A 2BHYA 2RV8A 2EINH 4EVIA 3WE2A 3FK6A 1D5VA 2XAHA 2QENA 1BI3A 3G1OA 1O4XA 1B72A 4DYQA 5DD8A 4KISA 1ACIA 1F43A 2YPRA 1VQKI 4UHTA 2L9VA 4YIRX 2CV0A 1SAUA 2F6CA 1MMNA 1R22A 3IAM2 5AIPA 3HOXJ 1YTYA 1RZ4A 2M2EA 3QYBA 1RKWA 3LSIA 3CO7C 2H6CA 2L9NA 1ENHA 2ZJ2A 2BVLA 4RAFA 4BXFA 4EM1A 3S1RJ 2NS0A 4GGGA 1UHSA 3W2AA 4OMYA 2EFPA 3MEXA 4ENKA 1PUFB 4JYKA 1KONA 2R5YA 1B1BA 5CVUA 1LB2A 3DKXA 2YU3A 3KFWX 2L9RA 4PFOA 1GDTA 2JTVA 2L5QA 4UUSA 3BZKA 3G3ZA 4EJTA 5BQTA 4HPQA 2BY1A 1MJ9A 3CTAA 3O2PE 4XKVA 1H88C 3OR2C 3RKXA 2YX4A 3E6CC 4UY8I 2AO9A 1XG1A 3KPHA 1SMYF 2ZSHB 4PFPA 4BACA 5E1WA 4HV6A 1OQYA 2NNYA 3BP8A 2EBIA 2XV4S 2B0LA 4ZYGA 2GM4A 3ZCOA 2FQ4A 2GXGA 4B48A 1BJAA 5IP9J 2PJRA 1O3TA 5D4SA 4UV9A 2E5ZA 4UNOA 4XMYA 2WWYA 4LB6B 2E1CA 5C4XJ 3A1YA 1E3HA 3DQVC 5KHDA 3OMYA 1VZ0A 1SVLA 4ZYAA 4HBLA 3S32A 2R7ZJ 4C3IJ 2PBIA 1LFBA 3P9IA 2V9KA 5L3DA 1FZPB 3ERED 3D5SC 3OYJA 3LSKA 3EDPA 4A0XA 5HLTA 1RIOH 3F6VA 1EH8A 4G6QA 4BBSJ 3GW2A 2R7OA 1X3UA 3S1QJ 1ZG3A 4RM3A 4BHCA 1XMXA 4DOZA 1Z6TA 1QQIA 3BPXA 2DA7A 1B9NA 5CVRA 3RSNA 5K7FA 3DPLC 5ED4A 2D1VA 4UUSB 3H3UA 2JQ7A 1W5TA 1OCOH 3NQOA 2HXOA 4IXAA 1IRXA 1MGTA 4L5EA 1VQ5I 2CO5A 4ASNA 3PO2J 3KP4A 3WTWC 3OSFA 2IA2A 3PNVA 2IS6A 2L4AA 2FNAA 2EZLA 3K4BA 4XSXF 2KT0A 1SVMA 3GFLA 4DNCA 2DFHA 4U7BA 1JI8A 1FMWA 4ANJA 1A5JA 3QYEA 3TP0A 4B43A 1K7AA 5L3EA 1VTNC 1G59A 3VB2A 1A6IA 3CLOA 2QQ8A 2VBYA 2DMNA 1HC8A 4MLOA 5K5QA 2NVTJ 1YITI 1WQ2A 4KIGA 1A35A 4CHUA 3G1MA 4DBQA 4E7JA 4LIUA 1APLC 1BC7C 2XAJA 4QTRA 1F9NA 1NH3A 4E4HA 3GEZA 4F55A 1MMGA 3FXOA 1Z21A 4RMNA 5GAGJ 5FLXK 2ZXHA 3KEOA 5K7HA 3OYFA 2LFBA 4YG2F 3JTGA 1JKRC 2PN6A 2W57A 2QSFX 3HOVJ 1Y0UA 4ZYHA 3I53A 1F36A 3CDLA 2ESHA 4TV7A 4OIRF 5LRRA 5H6QA 3S3NA 2HYJA 4KA4A 2CFOA 4L5JA 4BJ6C 2TRTA 2A61A 3K1NA 5HDGA 4OAYA 1OYYA 3NWTA 3V4GA 4E7KA 3NAUA 3ZMSA 1Z1DA 3FWEA 2B63J 1IXCA 4PJLA 2K5CA 2NAZA 2ZBKA 3ZQCA 3DEWA 2A5WA 3WTSC 1SC7A 3CCUI 2R0QC 2B9SA 3W6KB 3CCYA 3SZGA 1JUSA 3QQAA 2EB7A 2XVCA 3A01B 3O8GA 5J1UA 4PK4A 5FO5A 4XRMA 4EJOA 5HDNA 4NHJA 2G7HA 1ZR4A 4KT5C 4M3BA 5IT3A 4MTEA 1IG7A 4UB6C 2NVQJ 1LVKA 4P5OA 5GTHC 1FP1D 1ZELA 2OC6A 2DXIA 4BQAA 2IEKA 1VQOI 1ZGJA 3M1CA 3TL4X 4II3A 4L0YB 2H94A 1Z9CA 2AQFA 4W1UA 2L2OA 2R7VA 4WXDA 4IQJA 4Y4RA 2HS5A 2MSYA 2XGDA 2W85A 4OIOF 2EZHA 4ZDPA 1IN8A 1EH7A 3DFGA 4J00A 2PLYA 5E17F 2MW8A 1ZYRF 1YLFA 3HM5A 1TZLA 3T8TA 3CCMI 2XAUA 1YOVB 1BN5A 4GDFA 2V1UA 4E7ZA 4BE2A 2XGEA 2ZFUA 2HFHA 3FF5A 4PZJA 2VBWA 4RGRA 3CC2I 2R3SA 1OCCH 2W00A 1BBYA 4IF4A 1X1AA 5CQGA 2M7AA 3RKQA 2DA2A 3FHNA 2KDZA 3RQ4A 5C44J 1UCRA 2K4BA 3M8EA 1YX3A 4RLFA 1SFKA 2FD5A 2RVCA 3K7AJ 2GXBA 2ZCWA 3LQQA 4HV5A 4XKWA 2Y0SA 3V42A 4IOCF 2V9VA 3WTYC 1U3EM 2LTPA 1R6RA 3O3KA 2F4IA 3LA3A 3UNGC 2XB5A 1ZLKA 1QVUA 1UB9A 5JR3A 5L3FA 1D1CA 4QIWN 4LITA 1I39A 1TLHB 5E8GA 3L2VA 2Y0SN 1R7JA 1YYVA 2P8TA 5B3SH 2GXAA 4LFUA 2Y48A 4Y17A 2MYSA 2CG4A 1F4KA 4CUGA 3GYHX 2ZNYA 2O7OA 3PQJA 3WU0A 2QWWA 3CCLI 4BE0A 2NNNA 3OY9A 4NQWA 3GZNB 3VPRA 2FOKA 3FHZA 2KDOA 5BMZA 1T0FC 2W82A 1XSDA 3GX4X 2RREA 3BC8A 1A04A 1HKTA 3A2KA 4OIPF 3HTUA 4PUSA 3FIWA 2P7VB 4MHGA 2DOAA 1LFUP 2VJIA 5B5EC 1Y8RB 2STTA 3PQKA 3U21A 2ZO4A 1NHAA 3MZ8A 3GVAA 3H5RA 2MABA 2EWNA 2XPVA 2BY0A 2K3PA 1O7LA 2H09A 4BYYA 1FWZA 4QPQA 5FLXZ 2O61A 3K0LA 2DTZA 1OPCA 2EJRA 1VQ7I 4OIQF 2H6BA 3QOPA 3KP5A 2GAUA 2HGCA 3EQLF 3QU6A 2LDUA 5JLWA 2L4MA 4KNYA 1WJDA 4I99C 1WWXA 2R7SA 3TW6A 2E35A 2JA2A 2XKPA 3ASNH 2IS2A 2QQAA 1HF0A 4IHVA 4ZYDA 3DWLE 5EEHA 2VONA 5FLVA 5LBQA 4IOAF 2V7FA 1WFXA 2QBYB 2L01A 4EGYA 4RLQA 1JKOC 3MKYB 3RCOA 2QKLB 4ENNA 2L7MP 2R7QA 1Y0NA 2FJ1A 4G12A 2PFBA 5FFZA 4NDLA 4G7HF 5TRDA 1U6GA 2ZXIA 3ZQFA 1RR7A 4NQWB 1D0YA 1P9QC 5GAHJ 4BEHA 3BZCA 3UKGA 2FXAA 4ITVA 4JQFA 2H8WA 4HF1A 2KIMA 1TW2A 3LA2A 5FKOA 3FMRA 2V79A 2DODA 2ISYA 2HKXA 3LFUA 1MD0A 4A3GJ 3ZPLA 2DA1A 4MQ9F 1JJ8C 1KU2A 3FXUA 2KPMA 2P4WA 3FK7A 1JJ6C 4IVNA 2ESNA 1IRGA 9ANTA 1AA7A 1MMAA 2OU2A 3GO5A 3OYMA 5TISC 5JLXA 2DFIA 4D9JA 1DGRM 2COBA 3PUBA 4HX8A 4F93B 1DPUA 4RAGA 2K9QA 1MBKA 3G4SI 2O6GE 2CJJA 5GPCA 4UUVA 1RKTA 2IGNA 4A6EA 4ON0A 4P1WA 2K02A 5J6XA 1W4MA 2LP0A 3Q0UA 1CQTA 3ABKH 5GAEJ 4M74A 4IKFA 2VJ5A 2R7UA 3H3ZA 2LBFA 1V5GA 5FLMJ 2XF6A 2Z16A 1UZCA 1AHDP 1XC5A 5BOXA 1O7FA 1TWFJ 4BQNA 2JRMA 4E70A 2HVQA 1J09A 3I58A 3S2DJ 4AYBA 4MFEA 2BV6A 4IQ4A 4QWQA 3ECHA 3DPUA 1BJZA 3BG9A 5DV5A 1MBFA 4GRIA 1QHGA 4ZJZA 1JTYA 2KJBA 1OR7C 4DW6A 5HODA 1WSUA 3PIOF 3H92A 4BEHB 2LF7A 5HS7A 1QGPA 1JHFA 3JW4A 3I4NJ 1X19A 3ABUA 5L3BA 1G3SA 4AYBN 3V8KA 3K4CA 1H89C 3HJEA 1GT0C 1AWCA 5H2FC 2VOOA 2HEOA 3U9GA 1U5TA 4BGDA 2JA7J 1TWHJ 1T8IA 2IGKA 3JREA 3HRTA 4I09A 2E2HJ 3R61A 2F2EA 4A3MJ 2M87A 1SEUA 2VE8A 2P6SA 2X85A 1H8AC 1X4OA 5FKLA 3OYAA 4F92B 2VT2A 3K69A 4AIHA 3IAS2 1FOWA 4DZJA 1B6AA 3L7WA 1FBUA 2O8KA 4NUBA 5HVQC 1I1SA 3KP6A 1FBSA 4PJ0C 1MKMA 1QZEA 1B4AA 4QSHA 3E6BA 4CA0A 1QPIA 3GCMA 1RESA 5B66C 1XMKA 2EILH 4L5IA 2TDXA 2Z5UA 1N77A 1ITYA 3TEDA 1Y6IA 2LVSA 1BOAA 1WCMJ 4YFNF 2MG4A 2C6YA 3WHBA 2XKOA 2LBFB 3Q9VA 4XNFA 3VYSB 1W36D 1KA8A 1X1CA 3KZIC 2BVMA 1GXQA 4IRGA 2DA6A 5EDNA 4ESJA 4L9JA 1VQ4I 4KT6A 4A3JJ 2W4SA 2VPLA 4A0ZA 3C7JA 3C2HA 2DLLA 1K79A 2LG4A 1LEBA 1QPMA 1HBXG 2ZMEA 4M6VA 4ZDLA 4DBRA 3B6CA 4CCJA 2L7ZA 3K4NA 3OYHA 2HKOA 1VQPI 2Y9ZA 1DP7P 2EPFA 2EZIA 3AL0C 2E1MC 1BR4A 2GIZA 2X4HA 3SZTA 2Z3YA 3ESWB 4AIDA 1W7PA 4CH7A 3OYIA 2DA4A 4WCGA 2QSGX 5TJJA 1BIAA 1LDKB 4B4CA 4FX0A 2OA4A 3EUHC 1ZRCA 1MZBA 2P7CB 2DQLA 2K27A 5B1BH 2P6TA 4N0BA 3QOEA 1BC8C 4M9XA 4A5NA 2L7FP 3OL3A 5ICCA 2F48A 1OKRA 3A02A 1Z3YA 3TKYA 3RIRA 1HQCA 1XDUA 1P4AA 2KMUA 5D8KB 2E1NA 1FBQA 4PDKA 5F64A 5IPAA 1SANA 2DBBA 4MGRA 5IP6A 2XGXA 2L54A 3BQZA 2M1BA 2DU9A 5E79C 5CQEA 2W24A 1I5ZA 2N8GA 2JUGA 4XLEA 4FASD 3G2BA 3H5AA 2CS3A 3CCEI 1SFXA 2KKOA 1S5LC 2W1OA 2WB1A 1S72I 1XSXA 4ENMA 1B9MA 2ZSIB 1N25A 2DAOA 3QPLA 4HF0A 1OCPA 3P9KA 5C4JJ 3IH2A 3RPQA 1G3TA 2EV5A 4JX6A 1VQLI 2XPUA 4HLYA 2ZMEB 2ME6A 2D5VA 2RQPA 1XB4A 2EK5A 2DFEA 1YO5C 2HXIA 2XC7A 4G8XA 4GYIA 3GXOA 3LQRA 4XN0A 2TCTA 3A0BC 4EMSA 3DXJF 3CJTB 1W7PB 3BJ6A 3MZHA 2HPIA 4DYRA 5J4VA 3AFHA 3M8FA 3PJRA 4MNUA 3FM3A 3MKLA 1VNDA 3CJQB 1QA6A 2Y0MA 1U8BA 2DI3A 2MC3A 5E1XA 2HQAA 2VIXA 4UVAA 4U0WA 3IWZA 1YX5A 2EA4A 3JRHA 1S6LA 4I0BA 3BTIA 3CDIA 4U0VA 1ERDA 1ZTRA 3QAHA 3TGNA 2FU4A 2LYCA 2E19A 2PG4A 3LMMA 3KEQA 3OIQA 3OSGA 4RS8A 1YJ9I 1XGSA 2FBKA 5J1YA 1GLNA 1FOKA 1WH7A 2X51A 1Z05A 3C18A 1TQMA 3V8LA 1HCRA 4BL0B 1AU7A 3MCZA 1WJ5A 1HKSA 2FX0A 5J4YA 1BL0A 4P9FA 4B09A 2EFQA 2Z9OA 3QPHA 3V7SA 4PCQA 1P4WA 1KU7A 4LIVA 1QRYA 2CW8A 1YIJI 2JJ7A 4LB5A 2K40A 4EEFG 2ID3A 3KYDB 4D7MA 4LLLA 4FE7A 1NK2P 4DYCA 3CCRI 4N4NB 1ONVA 4F91B 1K4TA 3DBRB 3EUAA 2AXTC 1LUJB 1K6OA 3ROUA 4XLNF 4Q5SF 4YFXF 3LSRA 3LSGA 3MFKA 1X1PA 2CWEA 2KL4A 1SVOA 2MBFA 4DJAA 3KLOA 2JRTA 4AIJA 2VI6A 3S1NJ 3VDXA 3K1MA 4M6XA 1WRJA 2VKEA 4B8XA 4IO9F 3A0HC 2QVOA 4PSXA 4XK4A 4RGUA 4LG0A 1RC9A 1FP2A 1W1WE 3I54A 3OS2A 1R1VA 4BY1J 4LLGF 3SEZA 5F27A 4IPAA 4RGSA 2F5VA 3CUQA 3HUGA 1E17A 4CGZA 2P0WA 4AUXA 3F8MA 2KLOA 2JMWA 1GVDA 4FETA 2XAQA 2RGVA 3COAC 4Y52J 3H9GA 3GTKJ 1ZK8A 1QNTA 1NTCA 3J80K 2E5NA 2X9DA 3VYUB 2RDPA 3WHCA 4U0YA 3K2ZA 3RPUA 2VC1A 3DLAA 3VEPA 5M3MJ 4WWCA 3E1SA 3LL7A 2ZB9A 2K86A 5KNLA 4IEJA 2HTSA 4MO7A 3VFZA 4IHXA 1C0WA 2Y2ZA 2L02A 2A5YB 3LSJA 4XLFA 3TDUC 1ZLJA 3ZMTA 2DCEA 3SHFA 3H35A 5E3NA 2X6XA 4HG2A 2Z33A 1J59A 3DPTA 1D8JA 2JVGA 3MKWB 2NRAC 5BPDA 1IN4A 2K4JA 5KCMA 2R7XA 2HDDA 1ZAOA 5JI6A 3GTPJ 4LLNA 5E3OA 2VQHA 1SD6A 2JPCA 3W2WA 1U0JA 4IHYA 2CU7A 4EV0A 5D4RA 1FC3A 3DKYA 4D7NA 4CCOA 4LG0B 4K2EA 2WY7Q 4FE4A 1IC8A 1X2MA 1JE8A 2YX7A 4D5FA 3CUQB 3HUGB 4L18B 3HOTA 4BXUA 3MMYB 2OBPA 2IGMA 2RQQA 3I9V2 3A03A 5FFXA 1R5GA 3A01A 1H9TA 1TNSA 2Q1ZB 1YIOA 5EEAA 1Q1HA 3DLLF 4NNJA 3NARA 1IDYA 3CD6I 4U88A 2V26A 3QWLA 2R93J 3IKTA 3H1CA 4MFDA 1IUFA 4MQVA 5E3MA 3ZN0A 3I56I 2VXDA 2RN7A 3F23A 1OLTA 4RBOA 1G2HA 3OL4A 1ZKGA 2IW5A 3WTTC 4OMZA 4A3BJ 4KITB 3CJNA 3TOAA 1TWGJ 2KIFA 3ZGKA 2X48A 2WAFA 3P7NA 5KVRA 4G7ZF 1K78A 4XONA 5J8FA 3CP8A 1HDPA 1BI2A 2L7KA 4G6TB 4XM3A 3KP7A 1W36C 2KHMA 2R7TA 4BBRJ 4NBQA 5CYVA 2X0LA 3BTJA 1OJLA 2BY2A 2KP6A 3BJOA 2GA2A 4GO1A 2JZYA 4A5MA 2VOPA 1S3JA 2RC4A 3OV8A 3TDZC 4KDPA 2ZXJA 1O3SA 3RI4A 1IAWA 1S9HA 4KJZA 1WJEA 1XGMA 2EH3A 1MW7A 2CUFA 5ILSA 3S2HJ 3IHUA 3F21A 2WAQA 2V9PA 4I7HA 2DMQA 3GUDA 2IS4A 4KN4X 5D5XB 1I27A 1ZG1A 3JRCA 1MBJA 1WJAA 2HU9A 2OPTA 2HZDA 3N97A 5JVTA 1E3PA 4RB0A 4GYGA 3E5QA 1MH3A 2K9MA 2H1KA 4LJZF 4ZC3A 4A12A 1EKEA 1WVRA 2EZKA 3GF2A 2M45A 5HLGA 3Q5FA 2JK3A 3ZMDA 2HQ5A 3HRMA 5FGMA 2DMPA 2OJED 4KN7X 3SQNA 3BR5A 3R6SA 5D5WB 4M6YA 3I3LA 3HPGA 2IT0A 4XKBA 2A3SA 3JSOA
chains in the Genus database with same CATH topology
1X58A 2JN6A 3E7LA 4UUTA 1ZQ3P 3UKGA 1OFCX 1MBHA 3SJMA 1JKPC 5FKOA 1VI0A 3HOWJ 4B1RA 4A3GJ 3HBLA 2DA1A 3BR3A 1JJ8C 1Z0XA 2W48A 2LK2A 1LE8B 1JJ6C 4A3CJ 3FK7A 9ANTA 4MIMA 4X1EA 5JLXA 4FCYA 3PO3J 3BT9A 2COBA 3OIOA 2K9QA 1MBKA 5EG0A 5M3FJ 3JRGA 2CJJA 5GPCA 1RKTA 3BTCA 3IH3A 1I3QJ 1B72B 2QCOA 2LP0A 2NVYJ 3Q0UA 1CQTA 4S0HB 2GBYA 2Y31A 1U9NA 1EF4A 4A93J 2DMUA 3LSPA 5FLMJ 3Q0VA 3JRIA 1IRZA 1AHDP 3PM1A 3M4OJ 1XC5A 4M3EA 5IYBJ 1HOMA 1TWFJ 1FIPA 3BG5A 3M3YJ 1JUPA 3S17J 1QVTA 3GTQJ 3S2DJ 4MFEA 3K2AA 5EGOB 2R5YB 5J1RA 1IJWC 1BJZA 3BG9A 1TWCJ 1MBFA 1JTYA 4DW6A 5HODA 2E1OA 3H3VK 4A69C 1PUFA 2HOSA 4W97A 2O9LA 3I4NJ 4AYBN 2LD5A 1DU6A 2M8GX 1H89C 1GT0C 1P7IA 1GV2A 2JA7J 1ETKA 1TWHJ 4B3AA 3IH4A 2CQXA 3BG3A 4V2FA 5DS9A 3JREA 2E2HJ 5K7ZA 1Q1VA 1RPWA 2NS8A 4A3LJ 2XB0X 4A3MJ 2HOAA 3BR6A 3QPSA 1K61A 3GTJJ 1H8AC 2LKXA 5FKLA 1MH4A 5F0FA 2M9HA 4DZJA 5EG0B 4A3FJ 3IV5A 2O8KA 4JX4A 5F0CA 5GP9A 2CRGA 3S14J 1I6HJ 3LOCA 3BTLA 2IBDA 4QSHA 4BY7J 1MNMC 1QPIA 1RESA 3TW7A 3L1PA 1U9OA 4JP0A 3HGGA 3G1LA 3FK6A 1ITYA 2LY9A 3TEDA 2LVSA 4A3EJ 1WCMJ 3C2BA 2MG4A 1JT6A 3G1OA 1O4XA 1B72A 4DYQA 2H8RA 1NK3P 3WHBA 1F43A 3HGYA 1FEXA 4DZPA 3B6AA 5EDNA 2DA6A 4FISA 1OCTC 4A3JJ 1Y1WJ 1FIAA 2IAIA 2OF7A 4CYCB 3HOXJ 2WAQN 5IYDJ 4V2GA 2DJNA 2M2EA 1RKWA 1R9TJ 1MBGA 1ENHA 4C2MJ 2ME0A 4M6VA 3S1RJ 3B6CA 2L7ZA 3I4MJ 2Y9ZA 1UHSA 3HOYJ 2EZIA 2ELKA 1PUFB 4JYKA 5FKNA 2R5YA 4FTHA 2NVXJ 3S16J 1GUUA 1WGXA 2DA4A 2L9RA 3ZQHA 1GDTA 4UUSA 2G0EA 4B4CA 1WPKA 2XSDC 3JRFA 3HEFA 1H88C 5EYRA 1XS9A 1IGNA 2P81A 2DMTA 2AO9A 1XG1A 2L7FP 3HDDA 1WI3A 3A02A 5BNGA 4C3JJ 1E3OC 3GBGA 2EBIA 1BW6A 2MGQA 3JRBA 5IPAA 1FTZA 1SANA 2GM4A 4M3GA 2FQ4A 4I6ZA 3SFIA 5IP6A 1ETVA 5IP9J 2VKVA 3HOUJ 2ECCA 1T33A 3Q3SA 4HNVA 3BQZA 1FTTA 5C4XJ 2N8GA 1IDZA 5IOYA 2R7ZJ 2R5ZA 4C3IJ 1LFBA 1JKQC 2XPWA 2Y9YA 5FKMA 3QPLA 5E3LA 1OCPA 4BBSJ 3ZQIA 5C4JJ 3IH2A 1ZR2A 3S1QJ 4JX6A 5F04A 2XPUA 1HLVA 2ME6A 4JX5A 1VF9A 1W0UA 1SFOJ 5IYCJ 1S7EA 4A3KJ 2D5VA 4CYCA 3CQZJ 1T56A 2DA7A 2HXIA 5K7FA 2TCTA 3RZOJ 1K83J 4BXXJ 4UUSB 1JT0A 4DYRA 1ETXA 4C3HJ 2HXOA 4M3DA 3MKLA 4L5EA 3PO2J 1VNDA 2Y30A 1U8BA 3OSFA 2JA8J 5FKKA 3BR1A 2ECBA 1ZGWA 3JRHA 3BTIA 1UG2A 2EZLA 2KT0A 1ZTRA 3GTMJ 2E19A 1MSFC 1A5JA 3TP0A 1FJLA 3OSGA 1RETA 5J1YA 1A6IA 1IV6A 1WH7A 2DMNA 4MLOA 3TP3A 2NVTJ 4X6AJ 4IHWA 1HCRA 3G1MA 1AU7A 1APLC 5EF6A 2FX0A 4QTRA 1BL0A 2R5ZB 2RAEA 3MN2A 1QRYA 4J19A 2JJ7A 2K40A 1DU0A 4EEFG 2ID3A 2GLOA 4XIDA 5K7HA 4D7MA 2LFBA 4FE7A 1VFCA 2PMZN 1NK2P 4DYCA 3JRAA 1JKRC 3HOVJ 2M0CA 3O8HA 1JGGA 1F36A 3CDLA 1TWAJ 3LSRA 2QF7A 2X6OA 3LSGA 3MVPA 2HYJA 5J3LA 1ORKA 2DA3A 2TRTA 5EZHA 2VI6A 3S1NJ 2VKEA 3NAUA 3Q0WA 2B63J 3LNQA 3ZQCA 3DEWA 4XK4A 1X2NA 4GFBA 2R0QC 3CCYA 5F1JA 1JUSA 3QQAA 4BY1J 1P7JA 3A01B 3O8GA 5J1UA 5F27A 4XRMA 1ETWA 4AUXA 3HOZJ 5F0HA 2JMWA 1GVDA 1ZR4A 4M3BA 1IG7A 4Y52J 3GTKJ 1ZK8A 2EQRA 1NTCA 2NVQJ 2NS7A 2X9DA 1D5YA 3WHCA 2IEKA 2I10A 3GTLJ 5M3MJ 3FKIJ 3GTGJ 1U78A 2ZB9A 1B8IA 4W1UA 2VUMJ 2XGCA 4IEJA 4MO7A 4IHXA 5FJ8J 2Y2ZA 2L0KA 2DN0A 2MSYA 2HI3A 1ETQA 2XGDA 3LSJA 3JRDA 2EZHA 1AKHA 1I50J 1JTXA 5GPAA 3S1MJ 2MW8A 5E3NA 2M34A 2ID6A 3HM5A 1MBEA 1YRNA 3BQYA 2JWTA 3RZDJ 4D5CA 2HDDA 4Y7NJ 3GTPJ 4A3DJ 2XGEA 3HB9A 1WH5A 3BR2A 5E3OA 3ZQLA 2WB1N 2NOGA 3F0CA 4IHYA 2CU7A 3RKQA 2DA2A 5DTDA 2KDZA 4D7NA 5C44J 4FE4A 2K9SA 1IC8A 2FD5A 3K7AJ 4AC0A 1X2MA 2R92J 4D5FA 2XRLA 2VPRA 2LTPA 3A03A 1JUMA 3A01A 2XB5A 2YU9J 1QVUA 1BW5A 5EEAA 3H0GJ 4XICA 3NARA 4RDUA 4QIWN 1IDYA 1MSEC 4LOCA 2R93J 2Y0SN 3D1NI 4MFDA 1IUFA 3S15J 1B8IB 5E3MA 2LLKA 2O7OA 1UMQA 4XRSG 3JR9A 3VPRA 1G2HA 1AKHB 4RBOA 1ZKGA 5IOZA 5IP7J 4A3BJ 1ETOA 3HKZN 1TWGJ 2LR8A 2YUSA 2X48A 2WV1A 1ETYA 4I76A 1BA5A 1YRNB 1HDPA 3FIWA 3FISA 3ZQGA 1LFUP 2JA5J 1LE8A 1Y1VJ 4BBRJ 2K9NA 2HOTA 2AHQA 1OJLA 3BTJA 3RQIA 2XPVA 2JA6J 5EZGA 1TC3C 1W0TA 3ZOBA 1POGA 2E2IJ 4XRSA 5M5YJ 2DTZA 2EH3A 2CUEA 2YS9A 2CUFA 3S2HJ 5C3EJ 3CMYA 3GTOJ 3BR0A 1Z77A 4M3FA 3W6VA 2DMQA 5JLWA 4A3IJ 5F08A 3JRCA 3TW6A 1MBJA 4BKXA 2OPTA 1HDDC 1HF0A 4IHVA 5M5WJ 2E2JJ 1MH3A 2H1KA 5FLVA 4ABZA 2EZKA 2JK3A 2HQ5A 1JKOC 3DCFA 2DMPA 2DA5A 2L7MP 3BR5A 2CQQA 2FJ1A 4G12A 5EGOA 4NDLA 3SDGA 5M5XJ 3OOUA 3ZQFA 1GV5A 1RR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X58 A;  2JN6 A;  3E7L A;  4UUT A;  1ZQ3 P;  3UKG A;  1OFC X;  1MBH A;  3SJM A;  1JKP C;  5FKO A;  1VI0 A;  3HOW J;  4B1R A;  4A3G J;  3HBL A;  2DA1 A;  3BR3 A;  1JJ8 C;  1Z0X A;  2W48 A;  2LK2 A;  1LE8 B;  1JJ6 C;  4A3C J;  3FK7 A;  9ANT A;  4MIM A;  4X1E A;  5JLX A;  4FCY A;  3PO3 J;  3BT9 A;  2COB A;  3OIO A;  2K9Q A;  1MBK A;  5EG0 A;  5M3F J;  3JRG A;  2CJJ A;  5GPC A;  1RKT A;  3BTC A;  3IH3 A;  1I3Q J;  1B72 B;  2QCO A;  2LP0 A;  2NVY J;  3Q0U A;  1CQT A;  4S0H B;  2GBY A;  2Y31 A;  1U9N A;  1EF4 A;  4A93 J;  2DMU A;  3LSP A;  5FLM J;  3Q0V A;  3JRI A;  1IRZ A;  1AHD P;  3PM1 A;  3M4O J;  1XC5 A;  4M3E A;  5IYB J;  1HOM A;  1TWF J;  1FIP A;  3BG5 A;  3M3Y J;  1JUP A;  3S17 J;  1QVT A;  3GTQ J;  3S2D J;  4MFE A;  3K2A A;  5EGO B;  2R5Y B;  5J1R A;  1IJW C;  1BJZ A;  3BG9 A;  1TWC J;  1MBF A;  1JTY A;  4DW6 A;  5HOD A;  2E1O A;  3H3V K;  4A69 C;  1PUF A;  2HOS A;  4W97 A;  2O9L A;  3I4N J;  4AYB N;  2LD5 A;  1DU6 A;  2M8G X;  1H89 C;  1GT0 C;  1P7I A;  1GV2 A;  2JA7 J;  1ETK A;  1TWH J;  4B3A A;  3IH4 A;  2CQX A;  3BG3 A;  4V2F A;  5DS9 A;  3JRE A;  2E2H J;  5K7Z A;  1Q1V A;  1RPW A;  2NS8 A;  4A3L J;  2XB0 X;  4A3M J;  2HOA A;  3BR6 A;  3QPS A;  1K61 A;  3GTJ J;  1H8A C;  2LKX A;  5FKL A;  1MH4 A;  5F0F A;  2M9H A;  4DZJ A;  5EG0 B;  4A3F J;  3IV5 A;  2O8K A;  4JX4 A;  5F0C A;  5GP9 A;  2CRG A;  3S14 J;  1I6H J;  3LOC A;  3BTL A;  2IBD A;  4QSH A;  4BY7 J;  1MNM C;  1QPI A;  1RES A;  3TW7 A;  3L1P A;  1U9O A;  4JP0 A;  3HGG A;  3G1L A;  3FK6 A;  1ITY A;  2LY9 A;  3TED A;  2LVS A;  4A3E J;  1WCM J;  3C2B A;  2MG4 A;  1JT6 A;  3G1O A;  1O4X A;  1B72 A;  4DYQ A;  2H8R A;  1NK3 P;  3WHB A;  1F43 A;  3HGY A;  1FEX A;  4DZP A;  3B6A A;  5EDN A;  2DA6 A;  4FIS A;  1OCT C;  4A3J J;  1Y1W J;  1FIA A;  2IAI A;  2OF7 A;  4CYC B;  3HOX J;  2WAQ N;  5IYD J;  4V2G A;  2DJN A;  2M2E A;  1RKW A;  1R9T J;  1MBG A;  1ENH A;  4C2M J;  2ME0 A;  4M6V A;  3S1R J;  3B6C A;  2L7Z A;  3I4M J;  2Y9Z A;  1UHS A;  3HOY J;  2EZI A;  2ELK A;  1PUF B;  4JYK A;  5FKN A;  2R5Y A;  4FTH A;  2NVX J;  3S16 J;  1GUU A;  1WGX A;  2DA4 A;  2L9R A;  3ZQH A;  1GDT A;  4UUS A;  2G0E A;  4B4C A;  1WPK A;  2XSD C;  3JRF A;  3HEF A;  1H88 C;  5EYR A;  1XS9 A;  1IGN A;  2P81 A;  2DMT A;  2AO9 A;  1XG1 A;  2L7F P;  3HDD A;  1WI3 A;  3A02 A;  5BNG A;  4C3J J;  1E3O C;  3GBG A;  2EBI A;  1BW6 A;  2MGQ A;  3JRB A;  5IPA A;  1FTZ A;  1SAN A;  2GM4 A;  4M3G A;  2FQ4 A;  4I6Z A;  3SFI A;  5IP6 A;  1ETV A;  5IP9 J;  2VKV A;  3HOU J;  2ECC A;  1T33 A;  3Q3S A;  4HNV A;  3BQZ A;  1FTT A;  5C4X J;  2N8G A;  1IDZ A;  5IOY A;  2R7Z J;  2R5Z A;  4C3I J;  1LFB A;  1JKQ C;  2XPW A;  2Y9Y A;  5FKM A;  3QPL A;  5E3L A;  1OCP A;  4BBS J;  3ZQI A;  5C4J J;  3IH2 A;  1ZR2 A;  3S1Q J;  4JX6 A;  5F04 A;  2XPU A;  1HLV A;  2ME6 A;  4JX5 A;  1VF9 A;  1W0U A;  1SFO J;  5IYC J;  1S7E A;  4A3K J;  2D5V A;  4CYC A;  3CQZ J;  1T56 A;  2DA7 A;  2HXI A;  5K7F A;  2TCT A;  3RZO J;  1K83 J;  4BXX J;  4UUS B;  1JT0 A;  4DYR A;  1ETX A;  4C3H J;  2HXO A;  4M3D A;  3MKL A;  4L5E A;  3PO2 J;  1VND A;  2Y30 A;  1U8B A;  3OSF A;  2JA8 J;  5FKK A;  3BR1 A;  2ECB A;  1ZGW A;  3JRH A;  3BTI A;  1UG2 A;  2EZL A;  2KT0 A;  1ZTR A;  3GTM J;  2E19 A;  1MSF C;  1A5J A;  3TP0 A;  1FJL A;  3OSG A;  1RET A;  5J1Y A;  1A6I A;  1IV6 A;  1WH7 A;  2DMN A;  4MLO A;  3TP3 A;  2NVT J;  4X6A J;  4IHW A;  1HCR A;  3G1M A;  1AU7 A;  1APL C;  5EF6 A;  2FX0 A;  4QTR A;  1BL0 A;  2R5Z B;  2RAE A;  3MN2 A;  1QRY A;  4J19 A;  2JJ7 A;  2K40 A;  1DU0 A;  4EEF G;  2ID3 A;  2GLO A;  4XID A;  5K7H A;  4D7M A;  2LFB A;  4FE7 A;  1VFC A;  2PMZ N;  1NK2 P;  4DYC A;  3JRA A;  1JKR C;  3HOV J;  2M0C A;  3O8H A;  1JGG A;  1F36 A;  3CDL A;  1TWA J;  3LSR A;  2QF7 A;  2X6O A;  3LSG A;  3MVP A;  2HYJ A;  5J3L A;  1ORK A;  2DA3 A;  2TRT A;  5EZH A;  2VI6 A;  3S1N J;  2VKE A;  3NAU A;  3Q0W A;  2B63 J;  3LNQ A;  3ZQC A;  3DEW A;  4XK4 A;  1X2N A;  4GFB A;  2R0Q C;  3CCY A;  5F1J A;  1JUS A;  3QQA A;  4BY1 J;  1P7J A;  3A01 B;  3O8G A;  5J1U A;  5F27 A;  4XRM A;  1ETW A;  4AUX A;  3HOZ J;  5F0H A;  2JMW A;  1GVD A;  1ZR4 A;  4M3B A;  1IG7 A;  4Y52 J;  3GTK J;  1ZK8 A;  2EQR A;  1NTC A;  2NVQ J;  2NS7 A;  2X9D A;  1D5Y A;  3WHC A;  2IEK A;  2I10 A;  3GTL J;  5M3M J;  3FKI J;  3GTG J;  1U78 A;  2ZB9 A;  1B8I A;  4W1U A;  2VUM J;  2XGC A;  4IEJ A;  4MO7 A;  4IHX A;  5FJ8 J;  2Y2Z A;  2L0K A;  2DN0 A;  2MSY A;  2HI3 A;  1ETQ A;  2XGD A;  3LSJ A;  3JRD A;  2EZH A;  1AKH A;  1I50 J;  1JTX A;  5GPA A;  3S1M J;  2MW8 A;  5E3N A;  2M34 A;  2ID6 A;  3HM5 A;  1MBE A;  1YRN A;  3BQY A;  2JWT A;  3RZD J;  4D5C A;  2HDD A;  4Y7N J;  3GTP J;  4A3D J;  2XGE A;  3HB9 A;  1WH5 A;  3BR2 A;  5E3O A;  3ZQL A;  2WB1 N;  2NOG A;  3F0C A;  4IHY A;  2CU7 A;  3RKQ A;  2DA2 A;  5DTD A;  2KDZ A;  4D7N A;  5C44 J;  4FE4 A;  2K9S A;  1IC8 A;  2FD5 A;  3K7A J;  4AC0 A;  1X2M A;  2R92 J;  4D5F A;  2XRL A;  2VPR A;  2LTP A;  3A03 A;  1JUM A;  3A01 A;  2XB5 A;  2YU9 J;  1QVU A;  1BW5 A;  5EEA A;  3H0G J;  4XIC A;  3NAR A;  4RDU A;  4QIW N;  1IDY A;  1MSE C;  4LOC A;  2R93 J;  2Y0S N;  3D1N I;  4MFD A;  1IUF A;  3S15 J;  1B8I B;  5E3M A;  2LLK A;  2O7O A;  1UMQ A;  4XRS G;  3JR9 A;  3VPR A;  1G2H A;  1AKH B;  4RBO A;  1ZKG A;  5IOZ A;  5IP7 J;  4A3B J;  1ETO A;  3HKZ N;  1TWG J;  2LR8 A;  2YUS A;  2X48 A;  2WV1 A;  1ETY A;  4I76 A;  1BA5 A;  1YRN B;  1HDP A;  3FIW A;  3FIS A;  3ZQG A;  1LFU P;  2JA5 J;  1LE8 A;  1Y1V J;  4BBR J;  2K9N A;  2HOT A;  2AHQ A;  1OJL A;  3BTJ A;  3RQI A;  2XPV A;  2JA6 J;  5EZG A;  1TC3 C;  1W0T A;  3ZOB A;  1POG A;  2E2I J;  4XRS A;  5M5Y J;  2DTZ A;  2EH3 A;  2CUE A;  2YS9 A;  2CUF A;  3S2H J;  5C3E J;  3CMY A;  3GTO J;  3BR0 A;  1Z77 A;  4M3F A;  3W6V A;  2DMQ A;  5JLW A;  4A3I J;  5F08 A;  3JRC A;  3TW6 A;  1MBJ A;  4BKX A;  2OPT A;  1HDD C;  1HF0 A;  4IHV A;  5M5W J;  2E2J J;  1MH3 A;  2H1K A;  5FLV A;  4ABZ A;  2EZK A;  2JK3 A;  2HQ5 A;  1JKO C;  3DCF A;  2DMP A;  2DA5 A;  2L7M P;  3BR5 A;  2CQQ A;  2FJ1 A;  4G12 A;  5EGO A;  4NDL A;  3SDG A;  5M5X J;  3OOU A;  3ZQF A;  1GV5 A;  1RR7 A; 
#chains in the Genus database with same CATH topology
 3ZQ7 A;  3OIP A;  4XOT A;  3E7L A;  1RRJ A;  1W7P D;  1OFC X;  4AU7 A;  4A0Y A;  2PMH A;  3PUF A;  3WU2 C;  1K78 B;  2MD5 A;  1PUE E;  3WE3 A;  4B1R A;  3J80 Z;  3HBL A;  4S04 A;  1TP4 A;  2IP2 A;  1IO2 A;  1D0X A;  1Z0X A;  3ONQ A;  1WJC A;  2W48 A;  4UVC A;  4A3C J;  1EJ9 A;  2W25 A;  4UB8 C;  3T8R A;  1J75 A;  3PO3 J;  4AM3 A;  3F6O A;  4WF2 A;  2DO7 A;  5M3F J;  4CCK A;  1WJF A;  1YS7 A;  2VKH A;  1V3F A;  2UZK A;  3V7C A;  1R36 A;  2VJ4 A;  2I8D A;  2NVY J;  2PX9 A;  2WTE A;  2Z99 A;  3BRO A;  3W6J B;  4ESB A;  2HDC A;  5ICG A;  1U9N A;  1QBJ A;  1Y8Q B;  5FB2 A;  4F7Z A;  2FUG 2;  3LSP A;  3DV8 A;  3PIP F;  2UV1 A;  1KQ0 A;  4P96 A;  2ISZ A;  3JRI A;  2W84 A;  1UEL B;  4N4O B;  3M4O J;  2FOW A;  3I0T A;  2XAS A;  2OZ6 A;  1LPQ A;  3LWF A;  3TO6 A;  1QHH D;  1JUP A;  2XSJ C;  3IC7 A;  4DGW B;  3GTQ J;  1EV7 A;  3PNY A;  4F3Q A;  2QBY A;  2PQ8 A;  1FOY A;  4I01 A;  4IJA A;  5DCM B;  1TWC J;  5HNF A;  1IN6 A;  1XDS A;  3K6G A;  1HKQ A;  1KQ9 A;  3HHH A;  3X2Q H;  3CLQ A;  2E1O A;  4IL6 C;  2VE9 A;  2O9L A;  3S3O A;  3HXL A;  3OYG A;  1DU6 A;  2M8G X;  1YJW I;  3GME A;  3CC7 I;  4OIN F;  3HSF A;  3BY6 A;  2XAF A;  2VN2 A;  3BG3 A;  3MWM A;  1Z6R A;  1Q1V A;  3BOQ A;  3KET A;  1T39 A;  1RR8 C;  1QZZ A;  2QQ9 A;  2XB0 X;  3J81 K;  5LHI A;  4NB5 A;  1MH4 A;  3DTI A;  4EJU A;  1UJ8 A;  5AON A;  3P5J A;  1ON2 A;  2M9H A;  4PJJ A;  5DM7 F;  4AD9 A;  1KYZ A;  3CJR B;  1M1E B;  3G6E I;  1R58 A;  3K4M A;  3R0J A;  3PFI A;  2EFO A;  4JX4 A;  4E7I A;  1Z7L A;  1YS6 A;  3S14 J;  1D3Y A;  2BW3 A;  3LOC A;  3BTL A;  3DEU A;  5LFA A;  2IBD A;  2A6T A;  1MNM C;  2PMZ A;  1FYM A;  2O03 A;  3L1P A;  1X3W B;  2DK8 A;  2XRO A;  1U9O A;  4JP0 A;  1MJB A;  1RNL A;  3JCU C;  5CJ9 A;  3G1L A;  3DEE A;  3ABT A;  4ZZL A;  3I59 B;  4BAY A;  4L9N A;  1LKX A;  1JT6 A;  3JTH A;  2R7F A;  2HQN A;  1V5F A;  2DT7 B;  1NK3 P;  2A05 A;  1FEX A;  2HOE A;  4DZP A;  1I1G A;  1ZH5 A;  3B6A A;  4FIS A;  4G6D A;  2HVR A;  1MNE A;  1FIA A;  2IAI A;  2LMD A;  2OF7 A;  4HX7 A;  4CYC B;  5IYD J;  4V2G A;  4M71 A;  3S93 A;  4AIK A;  3BG6 A;  2D45 A;  1MBG A;  1R9T J;  5DD4 A;  2VXZ A;  4C2M J;  3HG9 A;  2F5D A;  1FSE A;  2ADU A;  3I4M J;  4CZZ A;  3OYE A;  1D0Z A;  4IRH A;  3VYT B;  3RYR A;  3WOD F;  3HOY J;  5B1A H;  1XD7 A;  4YII A;  4EM0 B;  1STZ A;  4FTH A;  2D2W A;  2NVX J;  1N75 A;  4BQO A;  1YI2 I;  2UUZ A;  5EEG A;  1A6Q A;  3JRF A;  3HEF A;  1S29 A;  5EYR A;  1XS9 A;  4HQM A;  1KGS A;  1XN7 A;  5LD2 C;  2DMT A;  2MA3 A;  1K4S A;  4FX4 A;  2VQG A;  1WI3 A;  4C3J J;  1IN7 A;  3SEQ A;  1WZ2 A;  1R49 A;  4B3X A;  4HNT A;  5D5V B;  1BW6 A;  2MGQ A;  1FTZ A;  2BW3 B;  1R5I D;  3J7Y J;  4ESF A;  3BDD A;  4I6Z A;  1ETV A;  2VKV A;  2IXS A;  3HOU J;  2ECC A;  3RPU D;  1T33 A;  3Q3S A;  5ICF A;  1LQ1 A;  1T95 A;  1CF7 B;  4BHB A;  5IOY A;  2CSO A;  2FSW A;  1HXD A;  2PI0 A;  5CVV A;  1YFH A;  1J9I A;  2RNG A;  3ABM H;  3HHG A;  3J7A Y;  1L0O C;  1XMA A;  1LDJ A;  3OYD A;  5E3L A;  1Z7U A;  1SAX A;  2Z2S B;  3FDY A;  2IS1 A;  4C30 A;  4KMF A;  3PSI A;  1XPX A;  2WV0 A;  1ZR2 A;  1TTY A;  1HLV A;  3OYK A;  2BBY A;  2FBH A;  1VF9 A;  1ZAR A;  2LOO A;  2XHK A;  3FXM A;  1W0U A;  1SFO J;  2OQG A;  4G7O F;  2CQK A;  4M9Z A;  4N9H A;  2DOF A;  3NWS A;  2Q2E A;  2XDV A;  1ZG5 A;  1Y39 A;  3RZO J;  4BXX J;  2DT5 A;  2OV7 A;  5HLH A;  3DTE A;  3F3X A;  2DW4 A;  4PGH A;  1JT0 A;  3BPV A;  1DDN A;  3MAJ A;  5K1Y A;  1UAA A;  2JSC A;  3KZZ A;  3LSM A;  4KMU X;  4E7H A;  3RJP A;  1SFU A;  5FKK A;  3BR1 A;  1O57 A;  2ECB A;  1ZGW A;  1XX5 A;  3K10 A;  3LA7 A;  1K6Y A;  4CSW A;  4BQQ A;  1U5T C;  4RAZ A;  1XTA A;  3WGG A;  2HTJ A;  2DYR H;  2FNP A;  3HKZ A;  1RET A;  2R7D A;  2M0M A;  2STW A;  1E0E A;  3TP3 A;  2OUM A;  1CGP A;  4IHW A;  3KP2 A;  2LKS A;  5KK1 A;  5EF6 A;  1WKM A;  3J81 Z;  3E5X A;  1R4M B;  3KP3 A;  1LJ9 A;  2Y75 A;  3K4K A;  3T5X A;  3MN2 A;  3DBL B;  4WX9 A;  5J40 A;  3MQ0 A;  4G94 A;  3FKJ A;  1DU0 A;  3H9J A;  2JUC A;  3CF2 A;  4XID A;  1FYL A;  1VQ9 I;  4KFC A;  1T08 B;  1FMV A;  3JRA A;  2QA4 I;  4F52 A;  1T6S A;  3OOP A;  3HTS B;  4E7L A;  2DPU A;  1QO0 D;  4MEX F;  3R0A A;  2B7E A;  2WAE A;  2CV1 A;  3O8H A;  4LGW A;  2Q2E B;  4HDU A;  1JGS A;  1ORK A;  1MMS A;  3T1B A;  3F8C A;  4AWX B;  4IZZ A;  2ZME C;  2F5E A;  2ZC2 A;  4Y33 A;  3LNQ A;  3C1D A;  3K70 D;  2AXL A;  3ZR8 X;  4GFB A;  1GVJ A;  2R7W A;  5F1J A;  1G3W A;  1UG0 A;  1MND A;  2OAZ A;  2IRF G;  1R1T A;  1FY7 A;  4XKC A;  1ETW A;  2E7X A;  2IGO A;  1VQN I;  3HOZ J;  5H6R A;  3WG7 H;  2GWR A;  2VQC A;  2JVH A;  1ZN2 A;  3GZ6 A;  1BI1 A;  2VBX A;  3KX2 A;  4EJV A;  2E34 A;  4NC8 A;  2Q8K A;  2M30 A;  3DBH B;  4ZH4 F;  1F5T A;  1ZRE A;  2I10 A;  4YIF A;  4HQE A;  3FKI J;  1U78 A;  2XGC A;  3L9F A;  5FJ8 J;  4XRF A;  4MTD A;  2L0K A;  2XF5 A;  3F8N A;  3JRD A;  1AKH A;  1I50 J;  5HS9 A;  1JTX A;  2LRE A;  3QRF F;  3S1M J;  1DP3 A;  4M9S A;  4HYE A;  2VJJ A;  3FX3 A;  2X1C A;  5DCF A;  2E7W A;  1MBE A;  3J7A O;  5DCM A;  3RZD J;  2QZ8 A;  2HDW A;  4YEJ A;  1F1Z A;  4Y7N J;  4XBF A;  4XN3 A;  5LHH A;  1A31 A;  2LC2 A;  4HF2 A;  1WH5 A;  2NXN B;  3BR2 A;  5AIQ A;  4L9V A;  2WB1 N;  2NOG A;  1R5H A;  3EYY A;  1YE9 A;  1OYI A;  5D8L B;  1J7K A;  4HA8 A;  3M07 A;  3CZ6 A;  3SDB A;  3M1E A;  5DTD A;  1D8K A;  4KIC A;  1P92 A;  5L3C A;  5HLI A;  4XR6 A;  2A6H F;  3ASO H;  4AC0 A;  3D5R C;  3F8B A;  2R92 J;  1W5S A;  4P55 A;  2VPR A;  4DQ2 A;  2DK5 A;  1PYV A;  4YFK F;  3CMM A;  2CQN A;  2A07 F;  2IJL A;  3CC4 I;  1JUM A;  3VOD A;  3AL0 B;  3KLN A;  2BY3 A;  1YW7 A;  3S8P A;  1S7O A;  4E7S A;  4RB2 C;  3WTU C;  1UST A;  2CFX A;  4BS9 A;  3H0G J;  4XIC A;  4RDU A;  1X3Z B;  3F22 A;  4LOC A;  2E71 A;  2P5K A;  3D1N I;  3AG3 H;  3HRS A;  2UXN A;  3S15 J;  1RUN A;  3I5U A;  1RUO A;  2LLK A;  1UMQ A;  1BI0 A;  4XRS G;  3JR9 A;  1AKH B;  1G3Y A;  3BZ6 A;  2OCE A;  5DEQ A;  5IP7 J;  1ETO A;  2HVS A;  2LR8 A;  2V6C A;  3P9C A;  1DGW Y;  1ETY A;  2WV1 A;  1YW8 A;  1SD4 A;  4IRI A;  2WY8 Q;  1MJA A;  4I0A A;  1FLI A;  2H1L A;  2O5R A;  2EFN A;  2FE3 A;  2LNB A;  5CPR B;  1LE8 A;  2JA5 J;  1Y1V J;  4XOR A;  2M3A A;  4GXO A;  4IX7 A;  2K9N A;  2NYX A;  1YHQ I;  3N05 A;  4BNC A;  5IT9 K;  5E18 F;  1J2X A;  3FXJ A;  4A6D A;  1W0T A;  3CP2 A;  2R4G A;  3L00 A;  2H27 A;  1PDN C;  5ILU A;  3E6D A;  1TQP A;  3TQN A;  1O3R A;  2LSO A;  4XOP A;  2CUE A;  1UHM A;  4ZYE A;  5FRN A;  3SFZ A;  5EJC A;  4RAY A;  3FXR A;  2M4G A;  3CMY A;  2KZV A;  2V1N A;  3DU5 A;  5FD6 A;  3BR0 A;  1J5Y A;  1Z77 A;  3W6V A;  1MMD A;  4A3I J;  4BKX A;  1V55 H;  2DT6 A;  2EIJ H;  1LNW A;  2KFD A;  5M5W J;  2E2J J;  3QP6 A;  4XLC A;  2O0Y A;  3OYB A;  3FBN B;  1KQ8 A;  1OYW A;  3CUQ C;  2EA2 A;  2DA5 A;  2K85 A;  1I3A A;  3VWB A;  1TT0 A;  5EGO A;  2OTL I;  3WU1 B;  2CQ7 A;  3PFY A;  4HX4 A;  3ISP A;  1Z91 A;  1GV5 A;  1N78 A;  4YEL A;  1DUX C;  4EGZ A;  3OYL A;  3D0S A;  2JN6 A;  4O3M A;  4UUT A;  5F6F A;  4GCV A;  4BU2 A;  2OCC H;  3IKV A;  3ABL H;  1MBH A;  3SJM A;  1R00 A;  1JKP C;  1VI0 A;  2JSP A;  3F8F A;  3HOW J;  3I55 I;  2LH9 A;  1VQM I;  4ZDO A;  4KUM A;  1ON1 A;  3I64 A;  4CZC A;  1LE8 B;  2I5U A;  5CVJ A;  2MLK A;  3GWZ A;  4BHP A;  3D5L A;  2A69 F;  3KYL A;  4ZTF A;  2XRN A;  3OIO A;  2M4K A;  4XSZ F;  3KYC B;  3HYI A;  3CMA I;  1UFM A;  3HPH A;  4IHS A;  5DDG A;  2CYY A;  3HIF A;  1U8R A;  3IH3 A;  4BE1 A;  1I3Q J;  1B72 B;  2K3F A;  2KIS A;  2EFW A;  4HAM A;  2KIQ A;  1WHU A;  3JSP A;  3U1D A;  2LY1 A;  2PEX A;  2CH0 A;  3PSF A;  3J7Z I;  5LLQ A;  3JAM K;  1R1U A;  2GBY A;  2CMP A;  4OU0 A;  5JFR A;  1EF4 A;  2VL8 A;  4A93 J;  3M7G A;  4EM2 A;  2DMU A;  1O3Q A;  1XSV A;  3KEY A;  4B47 A;  3Q0V A;  1KZH A;  1IRZ A;  2BE5 F;  3NEU A;  3PM1 A;  4R8H A;  1D1A A;  3S3M A;  1HOM A;  1YQA A;  3TO9 A;  1FIP A;  3U1K A;  3L09 A;  3BG5 A;  3S17 J;  2Z1D A;  3DP7 A;  1QVT A;  5EGO B;  2R5Y B;  2CV2 A;  2XF7 A;  2WC2 A;  2DDB A;  5TGT A;  2VT3 A;  4BJ5 C;  2HWV A;  2IVM A;  3H3V K;  4A69 C;  2HOS A;  1MIJ A;  2QKM B;  4W97 A;  2YR2 A;  2LD5 A;  1T2K A;  1BM9 A;  2BHZ A;  4A2U A;  1GV2 A;  2MC4 A;  1JXS A;  5A2Q K;  4B3A A;  5LHG A;  2CQX A;  5DS9 A;  3WTX C;  2DYS H;  5K7Z A;  3BWG A;  2NS8 A;  3WGI A;  2DTR A;  1FOX A;  4I98 B;  2HOA A;  3BR6 A;  3QPS A;  4U7D A;  1VQ8 I;  2CGP A;  1T98 A;  3GTJ J;  5K5R A;  2LKX A;  5F0F A;  3CCS I;  3FXK A;  4HLX A;  2LKP A;  1KYW A;  1YG2 A;  2PJR B;  2W7N A;  3IV5 A;  3BG7 A;  2A68 F;  3PL8 A;  3LFK A;  4CYD A;  2QUF A;  2ELH A;  5GP9 A;  2CRG A;  3PNT A;  3NRV A;  3OYC A;  3ZMV A;  4BY7 J;  3TW7 A;  5DM6 F;  4PJM A;  4Y13 A;  2PJP A;  4BJT A;  3HGG A;  2KRC A;  2LY9 A;  4YRV A;  1ULY A;  4A3E J;  3C2B A;  5J8C A;  2CUZ A;  1REP C;  4CDG A;  2H8R A;  4HDV A;  2QGU A;  3K70 C;  2G7U A;  4Q48 A;  3O6B B;  3HGY A;  5IT9 Z;  1G8X A;  2EIM H;  5HOO A;  2VB6 A;  2MFZ A;  5CVI A;  3IRR A;  4M73 A;  1OCT C;  4EJW A;  1BR1 A;  1Y1W J;  4HSR A;  2JPB A;  5HS8 A;  2WAQ N;  3I71 A;  3OR1 C;  2DJN A;  4R79 A;  1ZGA A;  2ME0 A;  5HDK A;  3WTV C;  2GA1 A;  3HC7 A;  4CXF A;  2ELK A;  3BCA A;  1SMT A;  5FKN A;  1FT9 A;  4JK1 X;  2F5F A;  3S16 J;  1GUU A;  1WGX A;  3ZQH A;  4UV8 A;  5BPI A;  2G0E A;  3CCJ I;  2J5O A;  1TW3 A;  3SXY A;  1WPK A;  2OQR A;  4EQQ A;  4S05 A;  1OCR H;  2BXZ A;  2XSD C;  4FQG A;  1IGN A;  4RGX A;  1V4R A;  3HZJ A;  2QLZ A;  2P5L C;  2P81 A;  1W5C C;  2FF4 A;  3K4L A;  2ETH A;  3HDD A;  3AG4 H;  5BNG A;  3L2U A;  1E3O C;  4PGG A;  3A4C A;  4ZTJ A;  3WGH A;  2UWM A;  3GBG A;  4QLC U;  1IV8 A;  3MZY A;  4RB1 A;  3JRB A;  1G4D A;  4M3G A;  3UR3 C;  3SFI A;  4NC7 A;  3TO7 A;  1HW5 A;  3FMQ A;  1G6N A;  2V4J C;  5FRM A;  4HNV A;  1PJR A;  1FTT A;  2GZW A;  2CUJ A;  4KIF A;  4N9I A;  3CO6 C;  1IDZ A;  3DKW A;  5DUK A;  2VQL A;  1MDM A;  2L3D A;  2R5Z A;  4M72 A;  1JKQ C;  2FA5 A;  2BGC A;  2R7R A;  2XPW A;  3V8J A;  2Y9Y A;  1P6R A;  5FKM A;  3I59 A;  5JHF A;  1T38 A;  1BOB A;  3QYF A;  2HPM A;  5ERI A;  2XAG A;  3ZQI A;  4H0E A;  2ZJQ F;  1Z3X A;  2XUB A;  5F04 A;  2MH9 A;  1LFP A;  2MD0 A;  5IY5 H;  4JX5 A;  2EV0 A;  5IYC J;  1S7E A;  4A3K J;  1TNT A;  4CYC A;  3CQZ J;  1T56 A;  3H5N A;  1TBX A;  3G71 I;  3JAM Z;  2OD5 A;  1K83 J;  1IRF A;  1LDD A;  4Y15 A;  2BXY A;  1I6X A;  3GFM A;  1USS A;  1ETX A;  4C3H J;  1HW1 A;  4CIC A;  1IZ1 A;  4M3D A;  4CCM A;  4XLP F;  2KRH A;  2Y30 A;  4C2U A;  2JA8 J;  3L2W A;  4XQF A;  1FX7 A;  4WXC A;  2VKD A;  4I2O A;  2AQE A;  5FD5 A;  4PJN A;  1UG2 A;  4OWR B;  5BS6 A;  1PP7 U;  4OOI A;  2ZKZ A;  4Z6Y A;  3GTM J;  1MSF C;  1U2W A;  2AS5 F;  1FJL A;  3CCV I;  3W2V A;  3L2Q A;  4AVP A;  1IV6 A;  2IA0 A;  1E2X A;  2MLG A;  3ELK A;  3REO A;  5A2Q Z;  4X6A J;  1T0F A;  2ZJR F;  2LY2 A;  1NG6 A;  1FNN A;  4U87 A;  2J5P A;  3HRU A;  3ERM A;  5JVG F;  1MDM B;  2R5Z B;  5K5O A;  3N4M A;  2RAE A;  1CF7 A;  4CO8 A;  4J19 A;  2DOE A;  1A36 A;  3FZV A;  2GLO A;  1VFC A;  2PMZ N;  5D6E A;  1IF1 A;  2DDA A;  1UHW A;  4AVZ A;  5E8I A;  4PSW A;  3DU6 A;  2XIG A;  5LEJ A;  2QYO A;  4BH9 A;  2M0C A;  1FPQ A;  4CCL A;  1JGG A;  4FT8 A;  2PMU A;  1TWA J;  4BDY A;  1HA8 A;  2QF7 A;  2X6O A;  1FSH A;  3MVP A;  4CCN A;  5J3L A;  4P9U A;  2DA3 A;  3DF8 A;  1XGN A;  3E0J B;  1OCZ H;  4ZZD A;  5EZH A;  2HYG D;  4C9Y A;  1HST A;  1NG7 A;  1QZY A;  4B44 A;  5D5U B;  4BDZ A;  3Q0W A;  3ZP5 A;  1TQI A;  4ENJ A;  6PAX A;  3MD2 A;  3H0D A;  1SD7 A;  1S8N A;  1X2N A;  1H9G A;  3ECO A;  4Q4Z F;  1P7J A;  4KIB A;  2QQB A;  3E6M A;  1TT5 B;  2P5V A;  2DQR A;  3GZ5 A;  4R1H A;  2M8E A;  4D1Q A;  5KAI C;  1Y56 A;  1Z67 A;  3RKW A;  5DYM A;  5F0H A;  2WAD A;  1R71 A;  4E6K G;  2L9S A;  4LD5 A;  4HST A;  3SZP A;  2EQR A;  3CF5 F;  2NS7 A;  3QPT A;  2LF8 A;  2E60 A;  1D5Y A;  2KRF A;  4BUP A;  3WTZ A;  2CW7 A;  3GTL J;  2FRH A;  1D1B A;  3KZY A;  4OAZ A;  3GTG J;  4WK8 F;  1B8I A;  3TBI A;  2VUM J;  3K9T A;  2VBZ A;  2KIU A;  1IW7 F;  2DN0 A;  2FQ3 A;  3GLX A;  2F5C A;  2HI3 A;  1ETQ A;  3BLY A;  2O3F A;  4HW0 A;  1DQU A;  5GPA A;  1XGO A;  2ZNZ A;  5KAF C;  2M34 A;  2ID6 A;  3V7R A;  3QOD A;  5E1Z B;  5H20 A;  1YRN A;  3BQY A;  2JWT A;  4LMY A;  4UXN A;  4D5C A;  3U2R A;  2G9W A;  2VLA A;  3SYT A;  4I02 A;  3LAP A;  3AG1 H;  4A3D J;  3IWF A;  1IXR C;  4UVB A;  2VAS A;  3F9K A;  3HB9 A;  2HZT A;  3BJA A;  3VOE A;  3ZQL A;  3H9Q A;  3VSL A;  3F0C A;  3R60 A;  1IUY A;  3RYP A;  3T0Y A;  1IN5 A;  1JHH A;  3FM5 A;  4O5V A;  1H0M A;  3ZRG A;  3TMO A;  3QU3 A;  2HYF A;  3KIO A;  1ODD A;  3CES A;  2GQQ A;  2K9S A;  2DPD A;  2EIK H;  2ZFW A;  1V54 H;  3E3V A;  3FBI B;  2RNJ A;  2K9L A;  4MEY F;  2XRL A;  2QEX I;  3KE2 A;  3ZMU A;  2V6E A;  4L0Z B;  3FXQ A;  5D6F A;  2V1D A;  2YU9 J;  1AOY A;  4X0G A;  1BW5 A;  1KU9 A;  3CUO A;  2M7B A;  1MSE C;  5LGN A;  1OR7 A;  1P4X A;  1ZRF A;  5ILV A;  3E5U A;  2K7L A;  2O8X A;  2VC0 A;  1V5E A;  1BR2 A;  3EPZ A;  2F4M B;  3ZMZ A;  1B8I B;  4RB3 C;  2X6Y A;  3RKY A;  1X1B A;  3VSK A;  3VYR B;  4HNU A;  1VQ6 I;  3OS1 A;  5IOZ A;  2BOL A;  1L3L A;  2M5W A;  1YW9 A;  3HKZ N;  2Y69 H;  2X1D A;  2YUS A;  4II2 A;  4XLH A;  2DJI A;  4KYW A;  4I76 A;  1BA5 A;  1YRN B;  5J47 A;  5CLS A;  4LG3 A;  4IHT A;  4RA2 A;  2F4O B;  3GLL A;  4H4K C;  1FYK A;  3FIS A;  1XCV A;  2IA1 A;  3ZQG A;  5LGU A;  5GAD J;  3HOS A;  4WXH A;  5LGT A;  3CME I;  1P2F A;  2OZU A;  5ICE A;  2HOT A;  1S7A A;  2AHQ A;  3RQI A;  3S2W A;  2GOM A;  4LK0 F;  1PP8 F;  3FMS A;  2JA6 J;  2WA0 A;  1IXS B;  4XL9 A;  2WBM A;  5EZG A;  2YSR A;  1TC3 C;  1SFE A;  1POG A;  3AG2 H;  3ZOB A;  4JOM A;  2FML A;  3M9A A;  4XRS A;  2E2I J;  5M5Y J;  3E97 A;  1GXP A;  2YS9 A;  5LEK A;  3C3W A;  3L2C A;  2ICW G;  5C3E J;  3H36 A;  3MKZ A;  3GTO J;  3R4K A;  4M3F A;  4NC6 A;  1OIS A;  5F08 A;  2ELJ A;  2BEO A;  1R4N B;  2EV6 A;  2A6E F;  4C2T A;  2KZG A;  4Y3O A;  2DFF A;  1HDD C;  3K4J A;  5F1R A;  1WJB A;  1YJN I;  2BZT A;  4ABZ A;  1EH6 A;  3DTK A;  3KCC A;  3DCF A;  1LEA A;  2IPQ X;  2COM A;  3G73 A;  2CQQ A;  1GHC A;  2OTJ I;  3WG9 A;  3SDG A;  5M5X J;  3ZQQ A;  4Z2Y A;  4LK1 F;  3EUH A;  3OOU A;  4Q47 A;  2FMY A;  4HEA 2;  1B59 A;  1X58 A;  1ZQ3 P;  3B02 A;  3BCB A;  4HZF A;  2LRD A;  1U5T B;  1XCB A;  4L9T A;  3RTR A;  3TOB A;  3IL2 A;  1SD5 A;  2JT1 A;  2MH2 A;  5FRO A;  5GTI C;  1J0R A;  3HSE A;  1TL8 A;  3OYN A;  3CCQ I;  3ZN1 A;  3BR3 A;  3EET A;  3LSH A;  2LK2 A;  2NOJ B;  1R23 A;  2KJC A;  3F72 A;  4J01 A;  4MIM A;  4X1E A;  3ZXS A;  3HL2 A;  3RDI A;  2ACJ A;  4FCY A;  4JBA A;  2BYV E;  1RI7 A;  4O6J A;  3BT9 A;  1HSJ A;  5EG0 A;  3FXL A;  4ETS A;  3JRG A;  2QSH X;  1DPR A;  2V1X A;  4HOB A;  4XLA A;  5E20 A;  3LST A;  3BTC A;  3AAF A;  3L2R A;  5LRS A;  2Q0O A;  3LAJ A;  1PVE A;  1OMI A;  2KQR A;  2QCO A;  2X1E A;  3I4P A;  2E36 A;  4EAT A;  1EA3 A;  3GFJ A;  2QM3 A;  4S0H B;  3OWT A;  2Y31 A;  1X1D A;  3QP5 A;  5L3G A;  2HNH A;  3AKZ A;  2RKH A;  2X6W A;  1KU3 A;  4M3E A;  5IYB J;  4DIQ A;  2E1M B;  3OS0 A;  1ZHF A;  2HQR A;  5HNH A;  3IUO A;  1HW2 A;  2D1H A;  3M3Y J;  2NVU B;  4V19 K;  3K2A A;  3B73 A;  5J1R A;  1IJW C;  2FBI A;  2UXX A;  1ZRD A;  2HR3 A;  1WI9 A;  5JHU A;  3W3C A;  1PUF A;  3HSR A;  3EUK L;  3M8J A;  5CKT A;  1X4P A;  4HRI A;  2GOX B;  4FHT A;  2ZJP F;  2GIV A;  1P7I A;  2ZXW H;  1ETK A;  3K1P A;  1LVA A;  3IH4 A;  4V2F A;  3EYI A;  4G9Y A;  3IRQ A;  2CW0 F;  1RPW A;  4A3L J;  3Q9S A;  3CDH A;  1K61 A;  3C2G A;  4QPO A;  2VOD A;  2FEZ A;  4D0P A;  5EG0 B;  3GFI A;  4A3F J;  5DUI A;  3IP4 B;  3ML6 A;  5F0C A;  1I6H J;  1BIB A;  4RM2 A;  3ULQ B;  1QU3 A;  2BHY A;  2RV8 A;  2EIN H;  4EVI A;  3WE2 A;  3FK6 A;  1D5V A;  2XAH A;  2QEN A;  1BI3 A;  3G1O A;  1O4X A;  1B72 A;  4DYQ A;  5DD8 A;  4KIS A;  1ACI A;  1F43 A;  2YPR A;  1VQK I;  4UHT A;  2L9V A;  4YIR X;  2CV0 A;  1SAU A;  2F6C A;  1MMN A;  1R22 A;  3IAM 2;  5AIP A;  3HOX J;  1YTY A;  1RZ4 A;  2M2E A;  3QYB A;  1RKW A;  3LSI A;  3CO7 C;  2H6C A;  2L9N A;  1ENH A;  2ZJ2 A;  2BVL A;  4RAF A;  4BXF A;  4EM1 A;  3S1R J;  2NS0 A;  4GGG A;  1UHS A;  3W2A A;  4OMY A;  2EFP A;  3MEX A;  4ENK A;  1PUF B;  4JYK A;  1KON A;  2R5Y A;  1B1B A;  5CVU A;  1LB2 A;  3DKX A;  2YU3 A;  3KFW X;  2L9R A;  4PFO A;  1GDT A;  2JTV A;  2L5Q A;  4UUS A;  3BZK A;  3G3Z A;  4EJT A;  5BQT A;  4HPQ A;  2BY1 A;  1MJ9 A;  3CTA A;  3O2P E;  4XKV A;  1H88 C;  3OR2 C;  3RKX A;  2YX4 A;  3E6C C;  4UY8 I;  2AO9 A;  1XG1 A;  3KPH A;  1SMY F;  2ZSH B;  4PFP A;  4BAC A;  5E1W A;  4HV6 A;  1OQY A;  2NNY A;  3BP8 A;  2EBI A;  2XV4 S;  2B0L A;  4ZYG A;  2GM4 A;  3ZCO A;  2FQ4 A;  2GXG A;  4B48 A;  1BJA A;  5IP9 J;  2PJR A;  1O3T A;  5D4S A;  4UV9 A;  2E5Z A;  4UNO A;  4XMY A;  2WWY A;  4LB6 B;  2E1C A;  5C4X J;  3A1Y A;  1E3H A;  3DQV C;  5KHD A;  3OMY A;  1VZ0 A;  1SVL A;  4ZYA A;  4HBL A;  3S32 A;  2R7Z J;  4C3I J;  2PBI A;  1LFB A;  3P9I A;  2V9K A;  5L3D A;  1FZP B;  3ERE D;  3D5S C;  3OYJ A;  3LSK A;  3EDP A;  4A0X A;  5HLT A;  1RIO H;  3F6V A;  1EH8 A;  4G6Q A;  4BBS J;  3GW2 A;  2R7O A;  1X3U A;  3S1Q J;  1ZG3 A;  4RM3 A;  4BHC A;  1XMX A;  4DOZ A;  1Z6T A;  1QQI A;  3BPX A;  2DA7 A;  1B9N A;  5CVR A;  3RSN A;  5K7F A;  3DPL C;  5ED4 A;  2D1V A;  4UUS B;  3H3U A;  2JQ7 A;  1W5T A;  1OCO H;  3NQO A;  2HXO A;  4IXA A;  1IRX A;  1MGT A;  4L5E A;  1VQ5 I;  2CO5 A;  4ASN A;  3PO2 J;  3KP4 A;  3WTW C;  3OSF A;  2IA2 A;  3PNV A;  2IS6 A;  2L4A A;  2FNA A;  2EZL A;  3K4B A;  4XSX F;  2KT0 A;  1SVM A;  3GFL A;  4DNC A;  2DFH A;  4U7B A;  1JI8 A;  1FMW A;  4ANJ A;  1A5J A;  3QYE A;  3TP0 A;  4B43 A;  1K7A A;  5L3E A;  1VTN C;  1G59 A;  3VB2 A;  1A6I A;  3CLO A;  2QQ8 A;  2VBY A;  2DMN A;  1HC8 A;  4MLO A;  5K5Q A;  2NVT J;  1YIT I;  1WQ2 A;  4KIG A;  1A35 A;  4CHU A;  3G1M A;  4DBQ A;  4E7J A;  4LIU A;  1APL C;  1BC7 C;  2XAJ A;  4QTR A;  1F9N A;  1NH3 A;  4E4H A;  3GEZ A;  4F55 A;  1MMG A;  3FXO A;  1Z21 A;  4RMN A;  5GAG J;  5FLX K;  2ZXH A;  3KEO A;  5K7H A;  3OYF A;  2LFB A;  4YG2 F;  3JTG A;  1JKR C;  2PN6 A;  2W57 A;  2QSF X;  3HOV J;  1Y0U A;  4ZYH A;  3I53 A;  1F36 A;  3CDL A;  2ESH A;  4TV7 A;  4OIR F;  5LRR A;  5H6Q A;  3S3N A;  2HYJ A;  4KA4 A;  2CFO A;  4L5J A;  4BJ6 C;  2TRT A;  2A61 A;  3K1N A;  5HDG A;  4OAY A;  1OYY A;  3NWT A;  3V4G A;  4E7K A;  3NAU A;  3ZMS A;  1Z1D A;  3FWE A;  2B63 J;  1IXC A;  4PJL A;  2K5C A;  2NAZ A;  2ZBK A;  3ZQC A;  3DEW A;  2A5W A;  3WTS C;  1SC7 A;  3CCU I;  2R0Q C;  2B9S A;  3W6K B;  3CCY A;  3SZG A;  1JUS A;  3QQA A;  2EB7 A;  2XVC A;  3A01 B;  3O8G A;  5J1U A;  4PK4 A;  5FO5 A;  4XRM A;  4EJO A;  5HDN A;  4NHJ A;  2G7H A;  1ZR4 A;  4KT5 C;  4M3B A;  5IT3 A;  4MTE A;  1IG7 A;  4UB6 C;  2NVQ J;  1LVK A;  4P5O A;  5GTH C;  1FP1 D;  1ZEL A;  2OC6 A;  2DXI A;  4BQA A;  2IEK A;  1VQO I;  1ZGJ A;  3M1C A;  3TL4 X;  4II3 A;  4L0Y B;  2H94 A;  1Z9C A;  2AQF A;  4W1U A;  2L2O A;  2R7V A;  4WXD A;  4IQJ A;  4Y4R A;  2HS5 A;  2MSY A;  2XGD A;  2W85 A;  4OIO F;  2EZH A;  4ZDP A;  1IN8 A;  1EH7 A;  3DFG A;  4J00 A;  2PLY A;  5E17 F;  2MW8 A;  1ZYR F;  1YLF A;  3HM5 A;  1TZL A;  3T8T A;  3CCM I;  2XAU A;  1YOV B;  1BN5 A;  4GDF A;  2V1U A;  4E7Z A;  4BE2 A;  2XGE A;  2ZFU A;  2HFH A;  3FF5 A;  4PZJ A;  2VBW A;  4RGR A;  3CC2 I;  2R3S A;  1OCC H;  2W00 A;  1BBY A;  4IF4 A;  1X1A A;  5CQG A;  2M7A A;  3RKQ A;  2DA2 A;  3FHN A;  2KDZ A;  3RQ4 A;  5C44 J;  1UCR A;  2K4B A;  3M8E A;  1YX3 A;  4RLF A;  1SFK A;  2FD5 A;  2RVC A;  3K7A J;  2GXB A;  2ZCW A;  3LQQ A;  4HV5 A;  4XKW A;  2Y0S A;  3V42 A;  4IOC F;  2V9V A;  3WTY C;  1U3E M;  2LTP A;  1R6R A;  3O3K A;  2F4I A;  3LA3 A;  3UNG C;  2XB5 A;  1ZLK A;  1QVU A;  1UB9 A;  5JR3 A;  5L3F A;  1D1C A;  4QIW N;  4LIT A;  1I39 A;  1TLH B;  5E8G A;  3L2V A;  2Y0S N;  1R7J A;  1YYV A;  2P8T A;  5B3S H;  2GXA A;  4LFU A;  2Y48 A;  4Y17 A;  2MYS A;  2CG4 A;  1F4K A;  4CUG A;  3GYH X;  2ZNY A;  2O7O A;  3PQJ A;  3WU0 A;  2QWW A;  3CCL I;  4BE0 A;  2NNN A;  3OY9 A;  4NQW A;  3GZN B;  3VPR A;  2FOK A;  3FHZ A;  2KDO A;  5BMZ A;  1T0F C;  2W82 A;  1XSD A;  3GX4 X;  2RRE A;  3BC8 A;  1A04 A;  1HKT A;  3A2K A;  4OIP F;  3HTU A;  4PUS A;  3FIW A;  2P7V B;  4MHG A;  2DOA A;  1LFU P;  2VJI A;  5B5E C;  1Y8R B;  2STT A;  3PQK A;  3U21 A;  2ZO4 A;  1NHA A;  3MZ8 A;  3GVA A;  3H5R A;  2MAB A;  2EWN A;  2XPV A;  2BY0 A;  2K3P A;  1O7L A;  2H09 A;  4BYY A;  1FWZ A;  4QPQ A;  5FLX Z;  2O61 A;  3K0L A;  2DTZ A;  1OPC A;  2EJR A;  1VQ7 I;  4OIQ F;  2H6B A;  3QOP A;  3KP5 A;  2GAU A;  2HGC A;  3EQL F;  3QU6 A;  2LDU A;  5JLW A;  2L4M A;  4KNY A;  1WJD A;  4I99 C;  1WWX A;  2R7S A;  3TW6 A;  2E35 A;  2JA2 A;  2XKP A;  3ASN H;  2IS2 A;  2QQA A;  1HF0 A;  4IHV A;  4ZYD A;  3DWL E;  5EEH A;  2VON A;  5FLV A;  5LBQ A;  4IOA F;  2V7F A;  1WFX A;  2QBY B;  2L01 A;  4EGY A;  4RLQ A;  1JKO C;  3MKY B;  3RCO A;  2QKL B;  4ENN A;  2L7M P;  2R7Q A;  1Y0N A;  2FJ1 A;  4G12 A;  2PFB A;  5FFZ A;  4NDL A;  4G7H F;  5TRD A;  1U6G A;  2ZXI A;  3ZQF A;  1RR7 A;  4NQW B;  1D0Y A;  1P9Q C;  5GAH J;  4BEH A;  3BZC A;  3UKG A;  2FXA A;  4ITV A;  4JQF A;  2H8W A;  4HF1 A;  2KIM A;  1TW2 A;  3LA2 A;  5FKO A;  3FMR A;  2V79 A;  2DOD A;  2ISY A;  2HKX A;  3LFU A;  1MD0 A;  4A3G J;  3ZPL A;  2DA1 A;  4MQ9 F;  1JJ8 C;  1KU2 A;  3FXU A;  2KPM A;  2P4W A;  3FK7 A;  1JJ6 C;  4IVN A;  2ESN A;  1IRG A;  9ANT A;  1AA7 A;  1MMA A;  2OU2 A;  3GO5 A;  3OYM A;  5TIS C;  5JLX A;  2DFI A;  4D9J A;  1DGR M;  2COB A;  3PUB A;  4HX8 A;  4F93 B;  1DPU A;  4RAG A;  2K9Q A;  1MBK A;  3G4S I;  2O6G E;  2CJJ A;  5GPC A;  4UUV A;  1RKT A;  2IGN A;  4A6E A;  4ON0 A;  4P1W A;  2K02 A;  5J6X A;  1W4M A;  2LP0 A;  3Q0U A;  1CQT A;  3ABK H;  5GAE J;  4M74 A;  4IKF A;  2VJ5 A;  2R7U A;  3H3Z A;  2LBF A;  1V5G A;  5FLM J;  2XF6 A;  2Z16 A;  1UZC A;  1AHD P;  1XC5 A;  5BOX A;  1O7F A;  1TWF J;  4BQN A;  2JRM A;  4E70 A;  2HVQ A;  1J09 A;  3I58 A;  3S2D J;  4AYB A;  4MFE A;  2BV6 A;  4IQ4 A;  4QWQ A;  3ECH A;  3DPU A;  1BJZ A;  3BG9 A;  5DV5 A;  1MBF A;  4GRI A;  1QHG A;  4ZJZ A;  1JTY A;  2KJB A;  1OR7 C;  4DW6 A;  5HOD A;  1WSU A;  3PIO F;  3H92 A;  4BEH B;  2LF7 A;  5HS7 A;  1QGP A;  1JHF A;  3JW4 A;  3I4N J;  1X19 A;  3ABU A;  5L3B A;  1G3S A;  4AYB N;  3V8K A;  3K4C A;  1H89 C;  3HJE A;  1GT0 C;  1AWC A;  5H2F C;  2VOO A;  2HEO A;  3U9G A;  1U5T A;  4BGD A;  2JA7 J;  1TWH J;  1T8I A;  2IGK A;  3JRE A;  3HRT A;  4I09 A;  2E2H J;  3R61 A;  2F2E A;  4A3M J;  2M87 A;  1SEU A;  2VE8 A;  2P6S A;  2X85 A;  1H8A C;  1X4O A;  5FKL A;  3OYA A;  4F92 B;  2VT2 A;  3K69 A;  4AIH A;  3IAS 2;  1FOW A;  4DZJ A;  1B6A A;  3L7W A;  1FBU A;  2O8K A;  4NUB A;  5HVQ C;  1I1S A;  3KP6 A;  1FBS A;  4PJ0 C;  1MKM A;  1QZE A;  1B4A A;  4QSH A;  3E6B A;  4CA0 A;  1QPI A;  3GCM A;  1RES A;  5B66 C;  1XMK A;  2EIL H;  4L5I A;  2TDX A;  2Z5U A;  1N77 A;  1ITY A;  3TED A;  1Y6I A;  2LVS A;  1BOA A;  1WCM J;  4YFN F;  2MG4 A;  2C6Y A;  3WHB A;  2XKO A;  2LBF B;  3Q9V A;  4XNF A;  3VYS B;  1W36 D;  1KA8 A;  1X1C A;  3KZI C;  2BVM A;  1GXQ A;  4IRG A;  2DA6 A;  5EDN A;  4ESJ A;  4L9J A;  1VQ4 I;  4KT6 A;  4A3J J;  2W4S A;  2VPL A;  4A0Z A;  3C7J A;  3C2H A;  2DLL A;  1K79 A;  2LG4 A;  1LEB A;  1QPM A;  1HBX G;  2ZME A;  4M6V A;  4ZDL A;  4DBR A;  3B6C A;  4CCJ A;  2L7Z A;  3K4N A;  3OYH A;  2HKO A;  1VQP I;  2Y9Z A;  1DP7 P;  2EPF A;  2EZI A;  3AL0 C;  2E1M C;  1BR4 A;  2GIZ A;  2X4H A;  3SZT A;  2Z3Y A;  3ESW B;  4AID A;  1W7P A;  4CH7 A;  3OYI A;  2DA4 A;  4WCG A;  2QSG X;  5TJJ A;  1BIA A;  1LDK B;  4B4C A;  4FX0 A;  2OA4 A;  3EUH C;  1ZRC A;  1MZB A;  2P7C B;  2DQL A;  2K27 A;  5B1B H;  2P6T A;  4N0B A;  3QOE A;  1BC8 C;  4M9X A;  4A5N A;  2L7F P;  3OL3 A;  5ICC A;  2F48 A;  1OKR A;  3A02 A;  1Z3Y A;  3TKY A;  3RIR A;  1HQC A;  1XDU A;  1P4A A;  2KMU A;  5D8K B;  2E1N A;  1FBQ A;  4PDK A;  5F64 A;  5IPA A;  1SAN A;  2DBB A;  4MGR A;  5IP6 A;  2XGX A;  2L54 A;  3BQZ A;  2M1B A;  2DU9 A;  5E79 C;  5CQE A;  2W24 A;  1I5Z A;  2N8G A;  2JUG A;  4XLE A;  4FAS D;  3G2B A;  3H5A A;  2CS3 A;  3CCE I;  1SFX A;  2KKO A;  1S5L C;  2W1O A;  2WB1 A;  1S72 I;  1XSX A;  4ENM A;  1B9M A;  2ZSI B;  1N25 A;  2DAO A;  3QPL A;  4HF0 A;  1OCP A;  3P9K A;  5C4J J;  3IH2 A;  3RPQ A;  1G3T A;  2EV5 A;  4JX6 A;  1VQL I;  2XPU A;  4HLY A;  2ZME B;  2ME6 A;  2D5V A;  2RQP A;  1XB4 A;  2EK5 A;  2DFE A;  1YO5 C;  2HXI A;  2XC7 A;  4G8X A;  4GYI A;  3GXO A;  3LQR A;  4XN0 A;  2TCT A;  3A0B C;  4EMS A;  3DXJ F;  3CJT B;  1W7P B;  3BJ6 A;  3MZH A;  2HPI A;  4DYR A;  5J4V A;  3AFH A;  3M8F A;  3PJR A;  4MNU A;  3FM3 A;  3MKL A;  1VND A;  3CJQ B;  1QA6 A;  2Y0M A;  1U8B A;  2DI3 A;  2MC3 A;  5E1X A;  2HQA A;  2VIX A;  4UVA A;  4U0W A;  3IWZ A;  1YX5 A;  2EA4 A;  3JRH A;  1S6L A;  4I0B A;  3BTI A;  3CDI A;  4U0V A;  1ERD A;  1ZTR A;  3QAH A;  3TGN A;  2FU4 A;  2LYC A;  2E19 A;  2PG4 A;  3LMM A;  3KEQ A;  3OIQ A;  3OSG A;  4RS8 A;  1YJ9 I;  1XGS A;  2FBK A;  5J1Y A;  1GLN A;  1FOK A;  1WH7 A;  2X51 A;  1Z05 A;  3C18 A;  1TQM A;  3V8L A;  1HCR A;  4BL0 B;  1AU7 A;  3MCZ A;  1WJ5 A;  1HKS A;  2FX0 A;  5J4Y A;  1BL0 A;  4P9F A;  4B09 A;  2EFQ A;  2Z9O A;  3QPH A;  3V7S A;  4PCQ A;  1P4W A;  1KU7 A;  4LIV A;  1QRY A;  2CW8 A;  1YIJ I;  2JJ7 A;  4LB5 A;  2K40 A;  4EEF G;  2ID3 A;  3KYD B;  4D7M A;  4LLL A;  4FE7 A;  1NK2 P;  4DYC A;  3CCR I;  4N4N B;  1ONV A;  4F91 B;  1K4T A;  3DBR B;  3EUA A;  2AXT C;  1LUJ B;  1K6O A;  3ROU A;  4XLN F;  4Q5S F;  4YFX F;  3LSR A;  3LSG A;  3MFK A;  1X1P A;  2CWE A;  2KL4 A;  1SVO A;  2MBF A;  4DJA A;  3KLO A;  2JRT A;  4AIJ A;  2VI6 A;  3S1N J;  3VDX A;  3K1M A;  4M6X A;  1WRJ A;  2VKE A;  4B8X A;  4IO9 F;  3A0H C;  2QVO A;  4PSX A;  4XK4 A;  4RGU A;  4LG0 A;  1RC9 A;  1FP2 A;  1W1W E;  3I54 A;  3OS2 A;  1R1V A;  4BY1 J;  4LLG F;  3SEZ A;  5F27 A;  4IPA A;  4RGS A;  2F5V A;  3CUQ A;  3HUG A;  1E17 A;  4CGZ A;  2P0W A;  4AUX A;  3F8M A;  2KLO A;  2JMW A;  1GVD A;  4FET A;  2XAQ A;  2RGV A;  3COA C;  4Y52 J;  3H9G A;  3GTK J;  1ZK8 A;  1QNT A;  1NTC A;  3J80 K;  2E5N A;  2X9D A;  3VYU B;  2RDP A;  3WHC A;  4U0Y A;  3K2Z A;  3RPU A;  2VC1 A;  3DLA A;  3VEP A;  5M3M J;  4WWC A;  3E1S A;  3LL7 A;  2ZB9 A;  2K86 A;  5KNL A;  4IEJ A;  2HTS A;  4MO7 A;  3VFZ A;  4IHX A;  1C0W A;  2Y2Z A;  2L02 A;  2A5Y B;  3LSJ A;  4XLF A;  3TDU C;  1ZLJ A;  3ZMT A;  2DCE A;  3SHF A;  3H35 A;  5E3N A;  2X6X A;  4HG2 A;  2Z33 A;  1J59 A;  3DPT A;  1D8J A;  2JVG A;  3MKW B;  2NRA C;  5BPD A;  1IN4 A;  2K4J A;  5KCM A;  2R7X A;  2HDD A;  1ZAO A;  5JI6 A;  3GTP J;  4LLN A;  5E3O A;  2VQH A;  1SD6 A;  2JPC A;  3W2W A;  1U0J A;  4IHY A;  2CU7 A;  4EV0 A;  5D4R A;  1FC3 A;  3DKY A;  4D7N A;  4CCO A;  4LG0 B;  4K2E A;  2WY7 Q;  4FE4 A;  1IC8 A;  1X2M A;  1JE8 A;  2YX7 A;  4D5F A;  3CUQ B;  3HUG B;  4L18 B;  3HOT A;  4BXU A;  3MMY B;  2OBP A;  2IGM A;  2RQQ A;  3I9V 2;  3A03 A;  5FFX A;  1R5G A;  3A01 A;  1H9T A;  1TNS A;  2Q1Z B;  1YIO A;  5EEA A;  1Q1H A;  3DLL F;  4NNJ A;  3NAR A;  1IDY A;  3CD6 I;  4U88 A;  2V26 A;  3QWL A;  2R93 J;  3IKT A;  3H1C A;  4MFD A;  1IUF A;  4MQV A;  5E3M A;  3ZN0 A;  3I56 I;  2VXD A;  2RN7 A;  3F23 A;  1OLT A;  4RBO A;  1G2H A;  3OL4 A;  1ZKG A;  2IW5 A;  3WTT C;  4OMZ A;  4A3B J;  4KIT B;  3CJN A;  3TOA A;  1TWG J;  2KIF A;  3ZGK A;  2X48 A;  2WAF A;  3P7N A;  5KVR A;  4G7Z F;  1K78 A;  4XON A;  5J8F A;  3CP8 A;  1HDP A;  1BI2 A;  2L7K A;  4G6T B;  4XM3 A;  3KP7 A;  1W36 C;  2KHM A;  2R7T A;  4BBR J;  4NBQ A;  5CYV A;  2X0L A;  3BTJ A;  1OJL A;  2BY2 A;  2KP6 A;  3BJO A;  2GA2 A;  4GO1 A;  2JZY A;  4A5M A;  2VOP A;  1S3J A;  2RC4 A;  3OV8 A;  3TDZ C;  4KDP A;  2ZXJ A;  1O3S A;  3RI4 A;  1IAW A;  1S9H A;  4KJZ A;  1WJE A;  1XGM A;  2EH3 A;  1MW7 A;  2CUF A;  5ILS A;  3S2H J;  3IHU A;  3F21 A;  2WAQ A;  2V9P A;  4I7H A;  2DMQ A;  3GUD A;  2IS4 A;  4KN4 X;  5D5X B;  1I27 A;  1ZG1 A;  3JRC A;  1MBJ A;  1WJA A;  2HU9 A;  2OPT A;  2HZD A;  3N97 A;  5JVT A;  1E3P A;  4RB0 A;  4GYG A;  3E5Q A;  1MH3 A;  2K9M A;  2H1K A;  4LJZ F;  4ZC3 A;  4A12 A;  1EKE A;  1WVR A;  2EZK A;  3GF2 A;  2M45 A;  5HLG A;  3Q5F A;  2JK3 A;  3ZMD A;  2HQ5 A;  3HRM A;  5FGM A;  2DMP A;  2OJE D;  4KN7 X;  3SQN A;  3BR5 A;  3R6S A;  5D5W B;  4M6Y A;  3I3L A;  3HPG A;  2IT0 A;  4XKB A;  2A3S A;  3JSO A; 
#chains in the Genus database with same CATH homology
 1X58 A;  2JN6 A;  3E7L A;  4UUT A;  1ZQ3 P;  3UKG A;  1OFC X;  1MBH A;  3SJM A;  1JKP C;  5FKO A;  1VI0 A;  3HOW J;  4B1R A;  4A3G J;  3HBL A;  2DA1 A;  3BR3 A;  1JJ8 C;  1Z0X A;  2W48 A;  2LK2 A;  1LE8 B;  1JJ6 C;  4A3C J;  3FK7 A;  9ANT A;  4MIM A;  4X1E A;  5JLX A;  4FCY A;  3PO3 J;  3BT9 A;  2COB A;  3OIO A;  2K9Q A;  1MBK A;  5EG0 A;  5M3F J;  3JRG A;  2CJJ A;  5GPC A;  1RKT A;  3BTC A;  3IH3 A;  1I3Q J;  1B72 B;  2QCO A;  2LP0 A;  2NVY J;  3Q0U A;  1CQT A;  4S0H B;  2GBY A;  2Y31 A;  1U9N A;  1EF4 A;  4A93 J;  2DMU A;  3LSP A;  5FLM J;  3Q0V A;  3JRI A;  1IRZ A;  1AHD P;  3PM1 A;  3M4O J;  1XC5 A;  4M3E A;  5IYB J;  1HOM A;  1TWF J;  1FIP A;  3BG5 A;  3M3Y J;  1JUP A;  3S17 J;  1QVT A;  3GTQ J;  3S2D J;  4MFE A;  3K2A A;  5EGO B;  2R5Y B;  5J1R A;  1IJW C;  1BJZ A;  3BG9 A;  1TWC J;  1MBF A;  1JTY A;  4DW6 A;  5HOD A;  2E1O A;  3H3V K;  4A69 C;  1PUF A;  2HOS A;  4W97 A;  2O9L A;  3I4N J;  4AYB N;  2LD5 A;  1DU6 A;  2M8G X;  1H89 C;  1GT0 C;  1P7I A;  1GV2 A;  2JA7 J;  1ETK A;  1TWH J;  4B3A A;  3IH4 A;  2CQX A;  3BG3 A;  4V2F A;  5DS9 A;  3JRE A;  2E2H J;  5K7Z A;  1Q1V A;  1RPW A;  2NS8 A;  4A3L J;  2XB0 X;  4A3M J;  2HOA A;  3BR6 A;  3QPS A;  1K61 A;  3GTJ J;  1H8A C;  2LKX A;  5FKL A;  1MH4 A;  5F0F A;  2M9H A;  4DZJ A;  5EG0 B;  4A3F J;  3IV5 A;  2O8K A;  4JX4 A;  5F0C A;  5GP9 A;  2CRG A;  3S14 J;  1I6H J;  3LOC A;  3BTL A;  2IBD A;  4QSH A;  4BY7 J;  1MNM C;  1QPI A;  1RES A;  3TW7 A;  3L1P A;  1U9O A;  4JP0 A;  3HGG A;  3G1L A;  3FK6 A;  1ITY A;  2LY9 A;  3TED A;  2LVS A;  4A3E J;  1WCM J;  3C2B A;  2MG4 A;  1JT6 A;  3G1O A;  1O4X A;  1B72 A;  4DYQ A;  2H8R A;  1NK3 P;  3WHB A;  1F43 A;  3HGY A;  1FEX A;  4DZP A;  3B6A A;  5EDN A;  2DA6 A;  4FIS A;  1OCT C;  4A3J J;  1Y1W J;  1FIA A;  2IAI A;  2OF7 A;  4CYC B;  3HOX J;  2WAQ N;  5IYD J;  4V2G A;  2DJN A;  2M2E A;  1RKW A;  1R9T J;  1MBG A;  1ENH A;  4C2M J;  2ME0 A;  4M6V A;  3S1R J;  3B6C A;  2L7Z A;  3I4M J;  2Y9Z A;  1UHS A;  3HOY J;  2EZI A;  2ELK A;  1PUF B;  4JYK A;  5FKN A;  2R5Y A;  4FTH A;  2NVX J;  3S16 J;  1GUU A;  1WGX A;  2DA4 A;  2L9R A;  3ZQH A;  1GDT A;  4UUS A;  2G0E A;  4B4C A;  1WPK A;  2XSD C;  3JRF A;  3HEF A;  1H88 C;  5EYR A;  1XS9 A;  1IGN A;  2P81 A;  2DMT A;  2AO9 A;  1XG1 A;  2L7F P;  3HDD A;  1WI3 A;  3A02 A;  5BNG A;  4C3J J;  1E3O C;  3GBG A;  2EBI A;  1BW6 A;  2MGQ A;  3JRB A;  5IPA A;  1FTZ A;  1SAN A;  2GM4 A;  4M3G A;  2FQ4 A;  4I6Z A;  3SFI A;  5IP6 A;  1ETV A;  5IP9 J;  2VKV A;  3HOU J;  2ECC A;  1T33 A;  3Q3S A;  4HNV A;  3BQZ A;  1FTT A;  5C4X J;  2N8G A;  1IDZ A;  5IOY A;  2R7Z J;  2R5Z A;  4C3I J;  1LFB A;  1JKQ C;  2XPW A;  2Y9Y A;  5FKM A;  3QPL A;  5E3L A;  1OCP A;  4BBS J;  3ZQI A;  5C4J J;  3IH2 A;  1ZR2 A;  3S1Q J;  4JX6 A;  5F04 A;  2XPU A;  1HLV A;  2ME6 A;  4JX5 A;  1VF9 A;  1W0U A;  1SFO J;  5IYC J;  1S7E A;  4A3K J;  2D5V A;  4CYC A;  3CQZ J;  1T56 A;  2DA7 A;  2HXI A;  5K7F A;  2TCT A;  3RZO J;  1K83 J;  4BXX J;  4UUS B;  1JT0 A;  4DYR A;  1ETX A;  4C3H J;  2HXO A;  4M3D A;  3MKL A;  4L5E A;  3PO2 J;  1VND A;  2Y30 A;  1U8B A;  3OSF A;  2JA8 J;  5FKK A;  3BR1 A;  2ECB A;  1ZGW A;  3JRH A;  3BTI A;  1UG2 A;  2EZL A;  2KT0 A;  1ZTR A;  3GTM J;  2E19 A;  1MSF C;  1A5J A;  3TP0 A;  1FJL A;  3OSG A;  1RET A;  5J1Y A;  1A6I A;  1IV6 A;  1WH7 A;  2DMN A;  4MLO A;  3TP3 A;  2NVT J;  4X6A J;  4IHW A;  1HCR A;  3G1M A;  1AU7 A;  1APL C;  5EF6 A;  2FX0 A;  4QTR A;  1BL0 A;  2R5Z B;  2RAE A;  3MN2 A;  1QRY A;  4J19 A;  2JJ7 A;  2K40 A;  1DU0 A;  4EEF G;  2ID3 A;  2GLO A;  4XID A;  5K7H A;  4D7M A;  2LFB A;  4FE7 A;  1VFC A;  2PMZ N;  1NK2 P;  4DYC A;  3JRA A;  1JKR C;  3HOV J;  2M0C A;  3O8H A;  1JGG A;  1F36 A;  3CDL A;  1TWA J;  3LSR A;  2QF7 A;  2X6O A;  3LSG A;  3MVP A;  2HYJ A;  5J3L A;  1ORK A;  2DA3 A;  2TRT A;  5EZH A;  2VI6 A;  3S1N J;  2VKE A;  3NAU A;  3Q0W A;  2B63 J;  3LNQ A;  3ZQC A;  3DEW A;  4XK4 A;  1X2N A;  4GFB A;  2R0Q C;  3CCY A;  5F1J A;  1JUS A;  3QQA A;  4BY1 J;  1P7J A;  3A01 B;  3O8G A;  5J1U A;  5F27 A;  4XRM A;  1ETW A;  4AUX A;  3HOZ J;  5F0H A;  2JMW A;  1GVD A;  1ZR4 A;  4M3B A;  1IG7 A;  4Y52 J;  3GTK J;  1ZK8 A;  2EQR A;  1NTC A;  2NVQ J;  2NS7 A;  2X9D A;  1D5Y A;  3WHC A;  2IEK A;  2I10 A;  3GTL J;  5M3M J;  3FKI J;  3GTG J;  1U78 A;  2ZB9 A;  1B8I A;  4W1U A;  2VUM J;  2XGC A;  4IEJ A;  4MO7 A;  4IHX A;  5FJ8 J;  2Y2Z A;  2L0K A;  2DN0 A;  2MSY A;  2HI3 A;  1ETQ A;  2XGD A;  3LSJ A;  3JRD A;  2EZH A;  1AKH A;  1I50 J;  1JTX A;  5GPA A;  3S1M J;  2MW8 A;  5E3N A;  2M34 A;  2ID6 A;  3HM5 A;  1MBE A;  1YRN A;  3BQY A;  2JWT A;  3RZD J;  4D5C A;  2HDD A;  4Y7N J;  3GTP J;  4A3D J;  2XGE A;  3HB9 A;  1WH5 A;  3BR2 A;  5E3O A;  3ZQL A;  2WB1 N;  2NOG A;  3F0C A;  4IHY A;  2CU7 A;  3RKQ A;  2DA2 A;  5DTD A;  2KDZ A;  4D7N A;  5C44 J;  4FE4 A;  2K9S A;  1IC8 A;  2FD5 A;  3K7A J;  4AC0 A;  1X2M A;  2R92 J;  4D5F A;  2XRL A;  2VPR A;  2LTP A;  3A03 A;  1JUM A;  3A01 A;  2XB5 A;  2YU9 J;  1QVU A;  1BW5 A;  5EEA A;  3H0G J;  4XIC A;  3NAR A;  4RDU A;  4QIW N;  1IDY A;  1MSE C;  4LOC A;  2R93 J;  2Y0S N;  3D1N I;  4MFD A;  1IUF A;  3S15 J;  1B8I B;  5E3M A;  2LLK A;  2O7O A;  1UMQ A;  4XRS G;  3JR9 A;  3VPR A;  1G2H A;  1AKH B;  4RBO A;  1ZKG A;  5IOZ A;  5IP7 J;  4A3B J;  1ETO A;  3HKZ N;  1TWG J;  2LR8 A;  2YUS A;  2X48 A;  2WV1 A;  1ETY A;  4I76 A;  1BA5 A;  1YRN B;  1HDP A;  3FIW A;  3FIS A;  3ZQG A;  1LFU P;  2JA5 J;  1LE8 A;  1Y1V J;  4BBR J;  2K9N A;  2HOT A;  2AHQ A;  1OJL A;  3BTJ A;  3RQI A;  2XPV A;  2JA6 J;  5EZG A;  1TC3 C;  1W0T A;  3ZOB A;  1POG A;  2E2I J;  4XRS A;  5M5Y J;  2DTZ A;  2EH3 A;  2CUE A;  2YS9 A;  2CUF A;  3S2H J;  5C3E J;  3CMY A;  3GTO J;  3BR0 A;  1Z77 A;  4M3F A;  3W6V A;  2DMQ A;  5JLW A;  4A3I J;  5F08 A;  3JRC A;  3TW6 A;  1MBJ A;  4BKX A;  2OPT A;  1HDD C;  1HF0 A;  4IHV A;  5M5W J;  2E2J J;  1MH3 A;  2H1K A;  5FLV A;  4ABZ A;  2EZK A;  2JK3 A;  2HQ5 A;  1JKO C;  3DCF A;  2DMP A;  2DA5 A;  2L7M P;  3BR5 A;  2CQQ A;  2FJ1 A;  4G12 A;  5EGO A;  4NDL A;  3SDG A;  5M5X J;  3OOU A;  3ZQF A;  1GV5 A;  1RR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...