4A3CJ

Rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4a3cJ00
1T33A 1ETWA 3M3YJ 3SFIA 2CQXA 3NAUA 3GTOJ 3JRCA 1PUFB 2R5ZB 3DEWA 2FX0A 5IPAA 2EQRA 4QTRA 3JRHA 2GLOA 2DA1A 2XRLA 3DCFA 3CMYA 3S1NJ 3HEFA 2FJ1A 1I50J 3BQYA 2O8KA 3BG5A 4X1EA 1MH3A 2DMTA 3BR0A 2JA6J 1GUUA 4DZJA 3FKIJ 1I6HJ 1WH7A 3Q0UA 4D5FA 3HOVJ 2DMNA 2O7OA 2L7FP 4A3BJ 3BT9A 5FKOA 1JGGA 4C2MJ 2H1KA 1RR7A 3BTLA 2M9HA 2DJNA 2Y9ZA 2HDDA 1W0TA 5F1JA 4JP0A 1VNDA 3H3VK 1ZKGA 4FE4A 5DS9A 5E3OA 2DA3A 4D7NA 3ZOBA 2YU9J 2R5ZA 1G2HA 3GTGJ 4B3AA 2COBA 1JT6A 4L5EA 3RZOJ 1WCMJ 1MH4A 1UMQA 1O4XA 1Z0XA 4AC0A 4W1UA 3G1LA 5EF6A 2L0KA 3RZDJ 3BR5A 3FIWA 1FJLA 5J1YA 1GV2A 1H8AC 1U8BA 2DA7A 4IHVA 1EF4A 4UUSB 1MBGA 3RQIA 2ID3A 1XG1A 3W6VA 4M6VA 5F0CA 5J3LA 5FLVA 3LSPA 2EBIA 1RESA 2GBYA 5IP6A 1JJ6C 2E2HJ 2DN0A 2CQQA 1HOMA 2VKVA 1A6IA 3BQZA 5GPAA 2QCOA 2CRGA 4UUSA 2E2JJ 2FD5A 4XRSA 1AKHA 2JA8J 5EG0B 4Y52J 3ZQLA 2DMQA 4JX4A 3WHCA 4EEFG 5IP7J 5JLWA 2B63J 1Z77A 2R92J 2CJJA 4V2FA 3CQZJ 3MKLA 2LK2A 5JLXA 1PUFA 1HDDC 2Y0SN 4FE7A 5F04A 4A3GJ 1A5JA 5IYBJ 2MG4A 4D7MA 3RKQA 1JJ8C 3IH3A 1B8IB 4A3EJ 1TWHJ 5GPCA 2R7ZJ 4B1RA 2LVSA 1NK2P 1ETQA 1ZTRA 3K7AJ 5EEAA 3TW7A 3JRDA 2X9DA 2MSYA 1K83J 2EZIA 2M0CA 1YRNA 5DTDA 5M5XJ 2XPVA 2D5VA 4A93J 4M3EA 1QVTA 2R5YA 1E3OC 2PMZN 1QRYA 3MN2A 2ZB9A 2KT0A 1AHDP 3FK7A 1IGNA 2VI6A 2XB5A 4DZPA 1HLVA 2O9LA 4XK4A 3K2AA 1DU0A 1LFUP 3HGYA 2CU7A 2HXIA 3NARA 2LTPA 3BG3A 3BTCA 2R5YB 2EZKA 1NK3P 3S14J 3HB9A 4A3JJ 4V2GA 5EZGA 2HOTA 3MVPA 3LSGA 5M5WJ 3CCYA 2NOGA 2LLKA 1D5YA 4A3LJ 3HM5A 3BTIA 3A03A 1MBEA 1ETOA 1XS9A 1P7JA 3TP0A 4BKXA 2KDZA 2LD5A 4IEJA 2N8GA 4RBOA 2JN6A 3JRFA 1Q1VA 3F0CA 3FISA 5F0FA 2DA5A 3OIOA 1APLC 3CDLA 3SDGA 2HQ5A 5FKMA 1XC5A 2R0QC 4AYBN 4HNVA 5K7HA 5FKLA 2NS7A 3TW6A 1BA5A 1JKRC 2HYJA 4JYKA 2MGQA 3O8GA 4MO7A 1GV5A 5C4JJ 2YS9A 1IDYA 5HODA 1RPWA 1OCTC 3LOCA 1F43A 3ZQIA 4QSHA 4I6ZA 3HKZN 5J1UA 3GTLJ 3JRBA 2DA2A 3HOZJ 3M4OJ 1JKQC 1RKWA 4A3FJ 2RAEA 3TEDA 2L9RA 2OPTA 2GM4A 2LY9A 2TCTA 4XIDA 3GTPJ 2M34A 5IYDJ 1F36A 3G1OA 1HF0A 2HOSA 2DTZA 3IV5A 4GFBA 1JTYA 1OFCX 2WB1N 2X48A 3HOUJ 2JK3A 3HOYJ 2E2IJ 1ENHA 5M3MJ 4A3KJ 1FTZA 1QVUA 3QQAA 1WGXA 1S7EA 1WH5A 3GBGA 3PO3J 2Y31A 2WAQN 2ECBA 3BTJA 2IAIA 2W48A 1TC3C 1POGA 2HXOA 5E3LA 3HDDA 2JWTA 2ELKA 2JMWA 2K40A 2XGEA 1IG7A 3SJMA 3LSRA 4JX5A 3O8HA 5K7FA 4XRMA 3I4NJ 4IHWA 2TRTA 5IYCJ 4A3CJ 4J19A 3HGGA 1GT0C 4BXXJ 5M5YJ 1TWAJ 1VFCA 1U9OA 3BR1A 2DMUA 1MNMC 3GTJJ 1IC8A 1YRNB 1GVDA 3C2BA 5C44J 2OF7A 2ME6A 2QF7A 1TWGJ 2K9NA 2P81A 2I10A 1IUFA 4Y7NJ 1JKOC 4MLOA 3S17J 2LFBA 2CUEA 1JTXA 3UKGA 3GTMJ 1MBHA 1ZK8A 5IP9J 2K9QA 4A3IJ 5FLMJ 1I3QJ 3JRAA 4X6AJ 4D5CA 3A01B 5FKKA 3BG9A 3BR6A 1BJZA 1UHSA 1RKTA 4FISA 1BW6A 3JR9A 2XB0X 2XGDA 3OSGA 3BR3A 4CYCB 5IOYA 1FIPA 3E7LA 3IH4A 3S2DJ 3S16J 5EG0A 2H8RA 2JA7J 1ETVA 4NDLA 3JRGA 1DU6A 2VPRA 4QIWN 3HBLA 1U9NA 1LE8A 2M8GX 2XPUA 3D1NI 4C3JJ 5BNGA 1Y1VJ 2MW8A 1W0UA 3LSJA 2NVQJ 1P7IA 1UG2A 4BY7J 1FEXA 5FKNA 1LE8B 3WHBA 3OOUA 4LOCA 1JUPA 5E3NA 2XSDC 2HOAA 4DYQA 4A3DJ 1ETYA 1ZR4A 2Y9YA 1X2NA 4IHYA 5F0HA 1B72A 2JA5J 2CUFA 1RETA 2AHQA 1OJLA 2XGCA 5EGOA 4XICA 3Q3SA 1SFOJ 3I4MJ 2XPWA 4G12A 5EZHA 1MBFA 3ZQFA 1H88C 1B72B 2NVXJ 4M3FA 4AUXA 2NS8A 3S1MJ 2DA6A 1H89C 3PO2J 3S1RJ 2VUMJ 2X6OA 3Q0VA 2M2EA 3S15J 5C4XJ 1IJWC 3B6AA 1ETKA 2LKXA 2E19A 1GDTA 3IH2A 1IRZA 1IV6A 5FJ8J 1MBKA 4ABZA 4IHXA 1FIAA 3QPSA 4DYRA 5J1RA 4BBSJ 2HI3A 4C3HJ 2ME0A 1ORKA 1JUSA 1NTCA 2AO9A 3FK6A 2IBDA 1Y1WJ 4XRSG 4UUTA 5M3FJ 2NVYJ 3QPLA 1X2MA 1FTTA 3OSFA 2Y2ZA 3HOWJ 1T56A 3H0GJ 3B6CA 5EGOB 4DW6A 4BY1J 2L7ZA 1HCRA 1K61A 5E3MA 5K7ZA 3JREA 4MFDA 1JUMA 3S2HJ 2G0EA 4RDUA 4C3IJ 1MSFC 1TWCJ 3LNQA 2FQ4A 4MIMA 9ANTA 1U78A 2VKEA 3Q0WA 4A69C 4M3GA 2JJ7A 5IOZA 1MBJA 4B4CA 5F27A 1JT0A 4M3DA 1JKPC 3A02A 1R9TJ 2LR8A 2DA4A 3BR2A 2EH3A 5GP9A 3HOXJ 3ZQCA 1OCPA 1VI0A 2IEKA 1IDZA 4W97A 2LP0A 1VF9A 1ZR2A 2EZHA 2WV1A 2K9SA 2ECCA 1ITYA 3ZQHA 3JRIA 2DMPA 1ZGWA 3GTKJ 4FCYA 2R93J 1WPKA 3VPRA 4BBRJ 4CYCA 3S1QJ 5C3EJ 1ZQ3P 4I76A 1TWFJ 4A3MJ 2Y30A 3A01A 1LFBA 3G1MA 3GTQJ 1BW5A 2YUSA 5EYRA 1WI3A 1CQTA 4JX6A 2NVTJ 1SANA 3TP3A 4DYCA 4M3BA 1QPIA 4S0HB 1ETXA 4MFEA 2L7MP 1HDPA 1MSEC 4FTHA 3ZQGA 5F08A 1AU7A 2E1OA 1AKHB 2EZLA 3PM1A 5EDNA 1B8IA 3L1PA 2ID6A 1BL0A 1X58A
chains in the Genus database with same CATH superfamily
4IL6C 3KE2A 2EV6A 3DEWA 5IPAA 4AM3A 5HLHA 4EV0A 3VOEA 3MFKA 3OYHA 3G3ZA 4PZJA 3C3WA 3E6CC 3D5SC 2O8KA 1MH3A 4RM3A 1JHHA 1YOVB 3U1KA 2ZSHB 3FKIJ 1LDDA 1TQIA 4RB1A 2F2EA 3TL4X 1WH7A 4L18B 2BYVE 5L3BA 1BR1A 4AIJA 2EA4A 2X6XA 2FNPA 2BVLA 3MCZA 3BDDA 1IRXA 2W57A 3T8TA 3IL2A 3BT9A 3CJQB 2OZUA 4C2MJ 5ILVA 4ENJA 3BC8A 2EIJH 2HDDA 2XRNA 4PGHA 2EB7A 3ZMDA 1ZKGA 4FX4A 3ZMVA 4ZDLA 3RPQA 4BHCA 5E3OA 5FRNA 2RDPA 2QSFX 4RGXA 5F6FA 1EH6A 2COMA 3EYYA 3E6DA 3H1CA 1S7AA 4EGYA 1G2HA 3K4MA 3K69A 2COBA 4PJMA 4RB3C 1JT6A 3RZOJ 1WCMJ 2R3SA 2K7LA 2XC7A 4JQFA 1O4XA 4UB8C 2V9KA 3L2RA 2OA4A 3G1LA 5D6EA 3A0HC 3BR5A 2BE5F 4OIQF 1GHCA 5J1YA 4B09A 2X6YA 3LSTA 3CP8A 1EF4A 2H1LA 2G7UA 1XSXA 4KDPA 4N9HA 1IXRC 3M8JA 1FSEA 5FFZA 1USTA 2ID3A 1XG1A 3RQIA 3LA7A 1BC7C 1VQMI 3CD6I 3GX4X 1YJ9I 2ZKZA 4D0PA 5IP6A 5A2QK 2OTLI 4NB5A 5GPAA 1HW2A 3I64A 3PNTA 1N78A 2ZFUA 2M0MA 3P9CA 2JA8J 5EG0B 1CF7B 4R1HA 5A2QZ 1BN5A 2DMQA 4XSZF 4EEFG 5IP7J 1O3QA 2G7HA 1Z77A 4BAYA 4FETA 3CQZJ 1WHUA 4FT8A 5JVGF 3AG2H 2V4JC 5F1RA 1S29A 1HDDC 1G6NA 1KU2A 2Y0SN 4RLFA 5F04A 1HSJA 2PI0A 1MNDA 4XKCA 4C30A 2CSOA 1ZRFA 3KEOA 4WF2A 3IH3A 3W6JB 3WTZA 2DTRA 1S6LA 1ON1A 3I4PA 3BJOA 1JE8A 2XF5A 1NK2P 3KYLA 2VQCA 2JZYA 2KRCA 1MKMA 4CCOA 1FSHA 3JRDA 2L02A 3BPVA 1OCCH 2MSYA 4ENMA 2EZIA 2M0CA 5DTDA 5M5XJ 3QYFA 2XPVA 2ISZA 1WJDA 4DOZA 2F4MB 3BZ6A 1QRYA 4E70A 3WU0A 4E4HA 2DXIA 2KT0A 3WTWC 1TP4A 2I8DA 5LEKA 1AHDP 4PSXA 4A2UA 1HLVA 2V7FA 1LFUP 3HGYA 4KIBA 2CU7A 3C2HA 3EETA 2IGMA 4BE0A 2HXIA 3BG3A 4RAGA 5K5RA 3S14J 2A69F 4L9NA 2OBPA 4ESBA 2IRFG 4V2GA 2HOTA 3GFLA 5M5WJ 3A0BC 2NRAC 5CVIA 2DK8A 2LLKA 3K70C 3HM5A 3ZQQA 4S05A 2QWWA 2STTA 2VLAA 4C2UA 2O5RA 2RQQA 2BHYA 5AIQA 4ESFA 2UWMA 1X1PA 3DU6A 2N8GA 1RZ4A 2JN6A 4IO9F 4IXAA 5LRSA 2I5UA 1DQUA 4L0YB 1HKTA 3QU3A 4G9YA 2UXXA 3FISA 4KUMA 3OIOA 4NC8A 1APLC 2F48A 2R0QC 1SFXA 4HNVA 4L5JA 2H6CA 5FKLA 3TW6A 3QWLA 1Z1DA 2MGQA 4OMZA 3I53A 5HODA 4KIFA 2HNHA 3LOCA 4Y3OA 3BZKA 4QSHA 2R7WA 2IA1A 2VBYA 4PJJA 2Y0MA 3FM5A 3PNVA 5HDKA 3JRBA 3SQNA 3FMRA 4YFKF 4GYIA 4PJNA 4IHTA 2KIFA 1XGMA 3CJNA 3K9TA 2HGCA 3L2VA 2MLKA 2LY1A 2RAEA 2DFHA 2ZMEA 3GTPJ 2M34A 1F36A 2FBKA 3W2WA 4BUPA 2ZXWH 2HOSA 1FY7A 1XDUA 2P8TA 3OR1C 3M1EA 3HOYJ 4Q47A 2A68F 1QHGA 1CGPA 4A3KJ 1QVUA 2VASA 1PP7U 1WGXA 1S7EA 2VBXA 1WJ5A 1WH5A 4XLEA 2MC3A 1YW8A 3F8MA 4NNJA 3CJRB 4UB6C 4NC7A 4EM0B 5DUIA 2BOLA 3PL8A 2WV0A 5FO5A 3BTJA 1R49A 3IUOA 3JAMZ 1U0JA 3EUHC 2JVHA 3WGGA 2JWTA 2K40A 2XGEA 2GXGA 4HLYA 2OQRA 4I7HA 4XORA 1KZHA 3RPUA 2W7NA 4UV9A 1JGSA 5LLQA 4WCGA 1TTYA 2ADUA 2JQ7A 5IYCJ 2DQRA 4A3CJ 4CXFA 1TWAJ 2QEXI 1VFCA 1HQCA 2ZJQF 1FC3A 1MNMC 1TT5B 1IC8A 1YRNB 1GVDA 4B48A 4BGDA 2OJED 1FNNA 4XOTA 1TWGJ 2KZVA 1P4WA 1L3LA 1IUFA 4Y7NJ 2JRTA 1JKOC 2DOFA 4IPAA 2DBBA 2YSRA 3CCQI 2L9NA 3CUQB 5HS8A 3KIOA 3D5RC 3DU5A 1QGPA 1YO5C 1IUYA 3GFMA 4X6AJ 3FM3A 1OLTA 3PFYA 4D9JA 1IN8A 3FXRA 2LF8A 3L00A 5DUKA 1VQ7I 2ZJPF 1BW6A 3VWBA 1BI0A 4IRIA 2BXYA 4HSTA 3SEQA 2XB0X 2CH0A 4IF4A 3V42A 5B1AH 3WGHA 3E7LA 5FD5A 3IH4A 3H9QA 1IW7F 4DIQA 2JA7J 2K27A 4GCVA 5BPDA 3M9AA 1LE8A 2ELHA 1W36C 3KP5A 4C3JJ 5LHGA 5KAFC 1YTYA 3B02A 1ZARA 4A12A 4I02A 4HV5A 4BY7J 4U0WA 4BU2A 5CYVA 1A36A 3FXQA 2HS5A 3L2UA 1U5TC 1BJAA 3T0YA 4M72A 4EMSA 5J8CA 4Y15A 2FF4A 3K4CA 1YJNI 1LVAA 1ETYA 3LA2A 3WU1B 5BMZA 1S72I 1W5SA 2OZ6A 3K4KA 2CUFA 2AHQA 4YRVA 2L3DA 3QYEA 3QP5A 4LG0B 3DXJF 2ISYA 3LSHA 4PFOA 3I4MJ 2XPWA 5FFXA 3IWZA 5ILSA 2FXAA 3LMMA 4ENKA 2NVXJ 1MGTA 1Z21A 1QNTA 1YX5A 2PX9A 2VXZA 2DA6A 4AUXA 3QRFF 1H89C 5DYMA 4C2TA 3PO2J 1D5VA 1Z9CA 2X6OA 3SZGA 3Q0VA 5KAIC 1NH3A 5C4XJ 5E18F 2FOKA 3OV8A 2YU3A 3B6AA 1ETKA 2LKXA 2E19A 1BM9A 3ELKA 1F4KA 2XGXA 1IV6A 1SD7A 1NG6A 3ONQA 4ABZA 2XIGA 1FIAA 4ZDPA 3CP2A 4BBSJ 3ML6A 2HKXA 1S5LC 1ORKA 3OWTA 5FROA 3SEZA 3PQJA 5JHFA 2LY2A 2CQKA 5HDGA 5HLGA 2O6GE 1KYWA 4II3A 4HOBA 1YQAA 5IY5H 5D5XB 5CQGA 4XRSG 1FYLA 4HDUA 3KYCB 2O0YA 2BBYA 2DT6A 1YIOA 1IZ1A 4M6YA 3UR3C 2KKOA 2DT5A 5EGOB 4BY1J 4IQJA 5E3MA 1FMVA 2L54A 2Q2EA 3SXYA 1R36A 2R7SA 2QSHX 3QPHA 1QBJA 1MSFC 2LG4A 3FXUA 4ZH4F 4BJ6C 1L0OC 2GA2A 1H9TA 1YLFA 4HA8A 5JR3A 3I3LA 1ZAOA 3VSLA 4A69C 4MGRA 4JBAA 3S3OA 3A02A 3OS2A 5JVTA 2K86A 2WAFA 1MMAA 5GP9A 4I09A 1Z67A 3DQVC 1TW2A 2K3PA 2L01A 5CLSA 2K4BA 1ZRCA 2FMYA 3REOA 3SZTA 2KISA 5FB2A 2WV1A 2MBFA 2PMHA 1M1EB 2E71A 2ECCA 2DMPA 4CSWA 4FCYA 2L9VA 3VPRA 2RKHA 3V8LA 2JSPA 1U5TB 1ZQ3P 4I76A 3A01A 1LFBA 1BW5A 2RC4A 4RAZA 3DTKA 3RQ4A 3PIPF 3TKYA 1SVOA 3ZGKA 2GA1A 1SANA 3TP3A 4DYCA 1X1AA 1IO2A 2X85A 4U0VA 2X1DA 2MD0A 3QPTA 1S9HA 4YIFA 4WK8F 3CF5F 3PM1A 1B8IA 3EDPA 1MMDA 1A31A 4Y4RA 1BL0A 2ZO4A 4Z2YA 2RVCA 1T33A 1ETWA 1R00A 3OIPA 4LLGF 5BS6A 3M3YJ 3NAUA 3HRSA 1KONA 2BY0A 1DDNA 3RJPA 3JRCA 1D0YA 2R5ZB 1PJRA 2YPRA 2FX0A 3SZPA 3JRHA 2H94A 4N9IA 5J47A 1SFKA 3CMYA 3S1NJ 3AL0C 1V5FA 1XDSA 3BQYA 4QWQA 4X1EA 3TGNA 2E1NA 1GUUA 2W24A 3FHZA 2FE3A 2HZDA 4DZJA 1I6HJ 2VONA 1OR7C 1WJBA 3K4JA 2ELJA 3BG6A 5LHHA 2O7OA 3HRTA 4A3BJ 5FKOA 1X1CA 4P9FA 4E7JA 1PYVA 2DJNA 3O6BB 3V7CA 1D8JA 4JP0A 5CKTA 1R58A 1VNDA 3H3VK 1J5YA 2OCCH 3I0TA 2GOMA 4G6TB 3H92A 1K78B 2VL8A 1I27A 1DGWY 2TDXA 5D5UB 1ERDA 3ZOBA 2YU9J 5JI6A 4M73A 2HPIA 4EJWA 4ZYEA 3VYTB 3WU2C 1KQ9A 3FX3A 3AKZA 3IWFA 1I1GA 1UMQA 5HVQC 1EH8A 1Z0XA 4XN3A 4LLLA 3ECOA 2L0KA 5J8FA 4AIDA 2EV5A 3OYMA 3RZDJ 1SD5A 2ZFWA 3HPGA 2ZC2A 1GV2A 1U8BA 2G9WA 1WJCA 5E20A 5TGTA 4M9SA 4UUSB 3FWEA 3K1MA 3M8FA 3W6VA 3NWSA 2KQRA 2LH9A 1OKRA 5F0CA 1LEBA 5J3LA 3FDYA 5FLVA 5TISC 2GBYA 1X4OA 5GTIC 2E2HJ 2WB1A 2KIQA 1BI3A 2IW5A 2ZXJA 2V6CA 4IOAF 5CQEA 3H3UA 4KYWA 5GADJ 1O7LA 2B63J 2R92J 2CJJA 4V2FA 1D8KA 3MKLA 5CVJA 4FE7A 4A3GJ 2M1BA 1G3YA 2MG4A 3ZQ7A 3U9GA 1YJWI 4OWRB 4D7MA 1Z6TA 1MMNA 3CMAI 1B8IB 2RREA 3LQRA 2XV4S 4XL9A 3CUQA 5GPCA 1W1WE 4B1RA 2LVSA 4UVBA 3J81K 2KRFA 2P5LC 2AQEA 2X9DA 1J09A 2V1XA 1XD7A 1MJ9A 3F3XA 4HPQA 2KL4A 2E60A 1YRNA 2HOEA 3CMMA 2D5VA 4BNCA 1FMWA 5K1YA 4FHTA 5HNFA 3HOSA 1Y0NA 2CYYA 3MN2A 4F91B 2LDUA 2ZB9A 4I98B 2BEOA 2Y75A 3Q9VA 2WA0A 1FP1D 5L3EA 4XK4A 2A6EF 1DP3A 1DU0A 1IRFA 2P6SA 3RDIA 5AONA 3F72A 3CCLI 3BTCA 2KRHA 2QQAA 2DU9A 2WY8Q 2JSCA 4A3JJ 3ROUA 2HWVA 5EZGA 3LSGA 2GIZA 5GAEJ 3U1DA 4A5NA 1XMAA 1GXQA 1D5YA 2AQFA 3BTIA 4GXOA 3A03A 2K3FA 2ICWG 3ISPA 2K85A 1ETOA 4LJZF 2IT0A 3AG1H 4M9XA 3HL2A 4BE2A 1P7JA 4BKXA 2LD5A 1LPQA 4EJOA 2CWEA 4N0BA 1DGRM 2CS3A 2P6TA 4IEJA 4OOIA 5KHDA 1K79A 3I71A 4IX7A 4CZCA 2P5KA 1Q1VA 3FF5A 3D5LA 2DA5A 2XAGA 3CDLA 3SDGA 2HQ5A 1EV7A 2XVCA 3C7JA 1MMSA 1T0FA 2NS7A 1TLHB 5ICCA 5ED4A 4N4OB 3J7YJ 2DOAA 2YS9A 2RNJA 1XX5A 2CQ7A 3Q9SA 2ESHA 4OINF 3S3MA 1N25A 1XB4A 2XKPA 3MQ0A 2KIUA 3GFJA 1F43A 1Z6RA 1YI2I 3DPLC 5J1UA 1T39A 4CHUA 2J5PA 4HNTA 2WWYA 3GTLJ 3E3VA 4QLCU 1ZG3A 1S8NA 3HOZJ 4IHSA 3M4OJ 3C1DA 1R5ID 4A3FJ 3TEDA 3L09A 2DFEA 2OPTA 2GM4A 2HDWA 4XIDA 3DPUA 5IYDJ 3HUGA 3OS0A 2QA4I 2DCEA 4BQQA 2F5FA 2DTZA 3IV5A 5BOXA 1OFCX 2WB1N 2F6CA 2M7AA 1RR8C 1BOAA 2X48A 1KYZA 3PQKA 4RB0A 1A6QA 2VQLA 3MZHA 1HA8A 4YFNF 5M3MJ 1FTZA 3QQAA 3JAMK 1UELB 2KFDA 1X3WB 2Y31A 3EUKL 3WE2A 1LB2A 4NBQA 4XNFA 3BLYA 1I1SA 4LG0A 2W48A 1POGA 5E3LA 3HDDA 1P92A 2X0LA 1SMYF 4M74A 2MC4A 3KZZA 1V4RA 4XRMA 2OCEA 3VYRB 2V26A 2W4SA 4XR6A 3K4NA 3Q5FA 3F6VA 4BE1A 3HGGA 5B1BH 4BXXJ 5M5YJ 3E5XA 1U9OA 2CW7A 2XKOA 1U6GA 1TBXA 3A4CA 1BIAA 2GOXB 1LDKB 3IRQA 2W00A 3C2BA 5C44J 1E2XA 2ME6A 5E17F 3OY9A 4PDKA 5GTHC 2DT7B 2DODA 2P5VA 1D3YA 3MMYB 3R60A 3I58A 1IV8A 4MLOA 1J59A 4ZYGA 2LFBA 1OCOH 3CESA 1TNTA 1G3SA 1GXPA 1K4TA 3HRUA 4A3IJ 1XSVA 2ETHA 1OYWA 4RGRA 4BXUA 4D5CA 3A01B 5FKKA 2VKDA 3VFZA 3E6MA 2VC1A 1OYIA 3BR6A 4JK1X 2ZXHA 1TW3A 3HRMA 2HEOA 1NHAA 4YELA 2FUG2 3K4BA 3OSGA 4UY8I 3S2DJ 1UHWA 3K6GA 5EG0A 1CF7A 3WODF 2C6YA 1I6XA 1ETVA 1DU6A 2F5EA 2NYXA 3BWGA 3JRGA 4BACA 3GFIA 2VPRA 5LGUA 3OYDA 2LKSA 4FX0A 5F64A 5BNGA 1YITI 2MW8A 4IZZA 1XCBA 1W0UA 4DGWB 4LG3A 1UG2A 3I59A 1FEXA 4RGUA 2DFFA 5FKNA 2ACJA 2STWA 4LOCA 1X3UA 2M87A 2MABA 3E1SA 3HUGB 5E3NA 3W2VA 5D4RA 3G4SI 1DUXC 3A2KA 5H6RA 5KK1A 3K1NA 3OYAA 3RIRA 2KP6A 4A3DJ 3LFKA 3GF2A 1ULYA 3GEZA 4LIUA 3K1PA 5B66C 3IAS2 1X2NA 3H5AA 2GIVA 2JA5J 3TBIA 1W5CC 2P0WA 3I5UA 5EGOA 3EUHA 3WTXC 4HEA2 1ZGAA 3BCBA 3Q3SA 1WKMA 4XQFA 1MDMB 2QBYA 1FLIA 2XDVA 2DK5A 2KMUA 3NEUA 4G12A 3HG9A 1YIJI 4LFUA 1H88C 1B72B 2L7KA 3V8JA 1B6AA 4YEJA 4M3FA 3J7AO 2EIMH 2NS8A 4LB6B 3S1MJ 2VBWA 2KLOA 4B47A 1WZ2A 4WXDA 3PFIA 4IVNA 1SFUA 3IHUA 3AG3H 3IH2A 3PIOF 4IHXA 3QPSA 1WFXA 3GO5A 5J40A 4KN7X 1WJEA 4XONA 1T98A 1IN6A 3WTYC 1NTCA 4HZFA 4EVIA 5IT3A 4MQVA 1XN7A 1FPQA 5D8KB 4IQ4A 4G7HF 2R7RA 1K6YA 5LGTA 2XSJC 2IBDA 1ODDA 1WRJA 3PNYA 1Y1WJ 2CUJA 2A3SA 2VT3A 5B3SH 5M3FJ 4E7SA 1ZG5A 1I5ZA 3NRVA 3QPLA 4XKBA 4OAZA 1X2MA 2VIXA 1R1VA 4O6JA 2KZGA 4B8XA 2Y2ZA 3WE3A 3H0GJ 3B6CA 5DD4A 3GZNB 5LBQA 1P6RA 1VQPI 1FZPB 1YS7A 3ZPLA 3HPHA 1K61A 4MQ9F 2FQ3A 3CUQC 1HKQA 1XGSA 2B0LA 4UV8A 1JUMA 3H9GA 1VQOI 1LJ9A 3KZIC 3KX2A 1E3PA 3E0JB 4C3IJ 4RDUA 1F5TA 1W5TA 1FYKA 1ZLKA 5DDGA 2UZKA 5GAHJ 3LNQA 2HYFA 2QQBA 4MIMA 3S32A 2D1HA 1U78A 1Y56A 2VKEA 4EJTA 3LQQA 5DD8A 4A5MA 4ASNA 3KP2A 3Q0WA 2W82A 4M3GA 3QOEA 1ZELA 4B4CA 1JT0A 1EKEA 2Z16A 3ESWB 2DA4A 5TJJA 3JSOA 2CMPA 3CJTB 2OQGA 5HOOA 3GUDA 1KU3A 5LGNA 2IEKA 2IS6A 2DOEA 3TO7A 5EJCA 1IDZA 5H6QA 3HJEA 1ZYRF 3WTSC 3LAPA 3HOTA 2K9SA 3DF8A 2QLZA 2IGKA 4LMYA 3ZQHA 1PUEE 3CC7I 3JRIA 2R7FA 3ULQB 3EPZA 4BBRJ 3B73A 3R61A 1OYYA 4A6DA 3N4MA 3NWTA 4N4NB 4A3MJ 3WGIA 2Y30A 4H4KC 1ZG1A 4CGZA 3N97A 3GTQJ 4PFPA 5EYRA 1Z05A 1WI3A 1W7PD 3PUFA 1CQTA 1F1ZA 3CCRI 3CF2A 5H2FC 4XN0A 2QZ8A 3KYDB 1ETXA 4MFEA 2L7MP 1MSEC 4FTHA 3DTEA 4QPOA 1R6RA 1AU7A 4Q4ZF 1R22A 2EZLA 2OAZA 3VYSB 2Q0OA 3OR2C 2ID6A 3V8KA 4V19K 1XSDA 4ITVA 1MIJA 3H35A 1I39A 2WBMA 2BY1A 1FOXA 3QP6A 3C2GA 1SMTA 4XRFA 4NC6A 5EEGA 2EQRA 3BJ6A 2K5CA 4QTRA 3RCOA 3MWMA 3KLNA 4HF0A 2FEZA 2XRLA 1BI1A 3CUOA 3HEFA 2FJ1A 3KFWX 1YS6A 4HX7A 3O2PE 4KFCA 3IKTA 1QZZA 3M1CA 4CCMA 2KJBA 2P7CB 3BR0A 5CVRA 3CDIA 5DV5A 2B7EA 1SC7A 1BBYA 1SVMA 4Y13A 1G3WA 2HQNA 4BDYA 1A35A 3E5UA 4K2EA 3Q0UA 3F8CA 1B9NA 2CGPA 4B43A 2VOOA 5EEHA 4D5FA 2H8WA 4BDZA 1WQ2A 1T8IA 1Q1HA 2L7FP 4F93B 1YFHA 2H1KA 2IGNA 1RR7A 2V1NA 2M9HA 2Y9ZA 5JHUA 1W0TA 2IA0A 1QZEA 4GGGA 1QO0D 1RNLA 3M07A 1UHMA 2BW3A 4FE4A 2DLLA 3DKYA 4E7IA 2R7OA 4TV7A 2AXTC 4ZYHA 1YX3A 2A5YB 2JUCA 2EILH 2R7VA 4YIRX 2R5ZA 2Z99A 2HZTA 4L0ZB 4RA2A 4L5EA 4PCQA 1Z3YA 3MAJA 3CLOA 2GXBA 1D1CA 1QZYA 3HSEA 4B3XA 4E7HA 3W6KB 4RAFA 5BQTA 1LQ1A 4W1UA 4CO8A 1TT0A 3FIWA 1LVKA 3DPTA 3LFUA 3LA3A 1H8AC 2F4IA 3RPUD 3F9KA 1HW5A 1TQPA 2QQ8A 2OV7A 4XLAA 2VQGA 2J5OA 4L9TA 1KQ0A 2OC6A 4F52A 3FXJA 4M6VA 4AIKA 1OQYA 2HFHA 2O3FA 3SYTA 1IF1A 1R1UA 4FQGA 1XGNA 5HLTA 5D5VB 4IOCF 3BPXA 4A6EA 2QQ9A 4UUSA 2CRGA 2E2JJ 2F4OB 2Z2SB 4I0BA 2ZBKA 3ZXSA 2FD5A 4XRSA 1AKHA 2HDCA 5KNLA 5D8LB 3ZQLA 5JLWA 2D45A 3AG4H 4RS8A 3WHCA 3S2WA 3MEXA 2D2WA 4MTDA 1SAUA 2A6TA 2PMUA 3S3NA 1AWCA 2K9LA 3F8BA 1G8XA 1X3ZB 2XAUA 3FXOA 3OYCA 1A5JA 2JA2A 4PJLA 4D1QA 2DO7A 4G6DA 5IYBJ 1T6SA 2BV6A 2K9MA 3OYNA 2NXNB 2F5VA 3RKQA 4OMYA 1HC8A 1D1AA 2VJIA 2MYSA 1BC8C 3DLLF 1TWHJ 2HU9A 2LRDA 3OS1A 1SEUA 2X4HA 3ASOH 2R7ZJ 4IRHA 4XLHA 2UV1A 1ZTRA 4EGZA 1WWXA 2R7XA 2HVSA 2BVMA 1K83J 2E1MC 1XTAA 2RQPA 4H0EA 4HBLA 2EWNA 2H6BA 5K5OA 3N05A 3V4GA 3LSKA 3KP6A 2HTJA 4LIVA 5CPRB 1V5GA 4B44A 3PSIA 3IAM2 3FK7A 1R71A 2VI6A 1IGNA 4DZPA 3FZVA 3FXMA 1Z3XA 4I01A 3RYRA 2LTPA 1IAWA 2LYCA 2R5YB 3E5QA 1PP8F 1P9QC 3HB9A 3U2RA 3CCJI 2ZNZA 2VE9A 2IPQX 2NOGA 1R5GA 2VQHA 4UUVA 4A3LJ 1V54H 1BI2A 1KU9A 3OYFA 2H27A 3RTRA 1FBSA 1XS9A 3TO9A 5DM7F 1WSUA 1LNWA 3TP0A 3TDUC 4C9YA 2KDZA 1UZCA 4AYBA 2LKPA 4G7ZF 4O3MA 2DDBA 1B59A 4MNUA 4RBOA 1HKSA 3JRFA 3BY6A 3HHGA 3F0CA 4BHPA 3J80Z 1K4SA 3L2WA 2M45A 5F0FA 3AFHA 2IXSA 2O61A 2FSWA 4PK4A 1XC5A 1REPC 1J2XA 4AYBN 2VJ4A 3GZ6A 5K7HA 1BA5A 2UXNA 4XBFA 4HQEA 1JKRC 2HYJA 3O8GA 4MO7A 1GV5A 1IDYA 2P4WA 3ZMZA 1ZGJA 1RPWA 2Z5UA 1RI7A 4DNCA 3GYHX 1IN5A 3TDZC 4HLXA 3HKZN 4XSXF 2IA2A 3HYIA 2NVUB 2KIMA 1HXDA 2DA2A 3KPHA 4PGGA 4AVPA 2DDAA 3COAC 2EFOA 3ABLH 1J9IA 1JKQC 3VSKA 4HSRA 2R7DA 1FOWA 3ZMUA 2LY9A 2VODA 5B5EC 3G1OA 2QENA 2E35A 3RKWA 1FOYA 4EATA 2HVQA 1JTYA 2XF7A 1R7JA 2DQLA 4PUSA 1ZRDA 2FA5A 3HOUJ 4AVZA 3OYGA 2JK3A 2WTEA 2E2IJ 1ENHA 3F21A 3HHHA 3HTSB 5E1XA 2EIKH 3R0JA 3WTTC 3GBGA 3PO3J 1RC9A 3LL7A 3GXOA 3HC7A 2WAQN 4CYDA 2ECBA 2M3AA 4KJZA 3TOAA 1KA8A 2XAHA 4CA0A 2XF6A 2IAIA 2XAFA 1TC3C 3M7GA 2ELKA 4M6XA 1IG7A 1W7PB 3SJMA 2DJIA 4BXFA 1XMKA 4U7BA 2WAQA 1BR4A 3O8HA 5K7FA 2W85A 1RUNA 3OYJA 4CH7A 2EK5A 3K10A 2Z3YA 2TRTA 3CO7C 1ZN2A 4J19A 4UNOA 1B4AA 2V79A 3FBIB 4GRIA 3D0SA 1MMGA 2NNNA 3BR1A 2Q1ZB 3GTJJ 2DPDA 1UJ8A 2ZCWA 4KMUX 1FYMA 3H36A 5DEQA 3VODA 2Z33A 4A0ZA 3CZ6A 2PJPA 2QF7A 4KN4X 2V9PA 1LFPA 2BXZA 3H5NA 1HBXG 4ANJA 1VQLI 2P81A 2I10A 3HSFA 3M8EA 4WX9A 2CFOA 2CUEA 2KPMA 4XM3A 3VDXA 2FMLA 4P5OA 2EFWA 3C18A 3GTMJ 2RV8A 2WC2A 2K9QA 5IP9J 4X0GA 4F3QA 5FLMJ 3JRAA 3L7WA 2HR3A 4Q5SF 4S04A 2L2OA 1SD4A 2E5NA 3U21A 1UHSA 5L3CA 1RKTA 4FISA 5H20A 3JR9A 1OCZH 1B1BA 2XGDA 2GXAA 4CYCB 3K4LA 5KCMA 5IOYA 4KISA 3QYBA 2OUMA 2V6EA 3QAHA 3ZMTA 2ZMEB 4KT6A 4RGSA 3TOBA 1O7FA 4OIOF 4QIWN 5ILUA 1SFEA 4G7OF 1U9NA 2JVGA 2A6HF 5D6FA 3ZN0A 5LHIA 3EYIA 4MEYF 2JUGA 5L3GA 1Y1VJ 1FOKA 3PSFA 1TNSA 2L5QA 1Z7UA 2DAOA 4CUGA 3WG7H 2LMDA 5HNHA 3ECHA 3KZYA 1LE8B 3OL3A 3WHBA 5TRDA 1IXCA 1JUPA 1VQ4I 2R7QA 2EFPA 3LSIA 2XSDC 2HOAA 4E6KG 4DYQA 2Y69H 1SVLA 3OL4A 3ABKH 4Q48A 2VB6A 3MKZA 2HKOA 1ZR4A 2GQQA 1C0WA 1B72A 4HDVA 2WAEA 4CZZA 4F7ZA 2FOWA 1MDMA 1AA7A 2VN2A 2UUZA 4QPQA 3ZR8X 2K4JA 1SFOJ 4CICA 5EZHA 1MBFA 2QKLB 3ZQFA 1TQMA 3VEPA 5BPIA 4P1WA 3ABTA 1DPUA 2HQRA 3GZ5A 4NUBA 3S1RJ 5E79C 4LB5A 3S15J 3VYUB 2L4MA 2CV1A 2NS0A 1B9MA 4CCJA 1GLNA 1GDTA 1IRZA 2ESNA 2DYRH 3I59B 5J6XA 1VQKI 1MBKA 5D4SA 2BZTA 2E7WA 4DYRA 2VT2A 2HI3A 1S3JA 4C3HJ 2ME0A 1ZREA 1VQNI 4ZDOA 1RUOA 1D1BA 1FBQA 1YYVA 3FK6A 3LSMA 1T2KA 1RRJA 1O3TA 2EINH 1G59A 4XKWA 4KNYA 2OTJI 4EM2A 2NVYJ 3F6OA 4E7ZA 1UAAA 1FTTA 1T56A 2GWRA 4KMFA 4ON0A 2L7ZA 1HCRA 1J75A 1A04A 2MH9A 4RLQA 3I54A 1R4MB 4MFDA 1YW9A 4E7LA 4HAMA 2E7XA 4JOMA 1WJFA 5FGMA 1W36D 1TWCJ 3CCSI 1IN4A 4PSWA 4U7DA 1Y8QB 3CCUI 2VOPA 2IVMA 2Q2EB 2JJ7A 5IOZA 3CC2I 4G6QA 2FRHA 2DYSH 1R9TJ 4LITA 2IS1A 4BS9A 5CJ9A 3KCCA 2HTSA 2Q8KA 1OPCA 2EH3A 4EJUA 3HOXJ 3ZQCA 5FLXZ 3I56I 1OCPA 1VI0A 5E8GA 3DKWA 4I2OA 1Y8RB 3FXLA 3OOPA 4W97A 4XKVA 4ETSA 1VF9A 2JRMA 1ZR2A 2YX7A 2M4KA 1ITYA 3F23A 3GTKJ 1QA6A 3JTHA 2JPCA 1WPKA 4Y33A 4CYCA 2LF7A 2IP2A 1TWFJ 1ZLJA 1D0ZA 4M71A 4NQWB 3G1MA 4O5VA 3OYIA 1V55H 2VBZA 2YUSA 3GVAA 2VPLA 3DP7A 4JX6A 2PN6A 4U0YA 4I0AA 4OU0A 3DBHB 1N75A 1KGSA 1K78A 5L3FA 1VQ5I 3MZYA 3ZQGA 4XMYA 4EM1A 3MKWB 3ZN1A 5DM6F 5EDNA 3E97A 1UCRA 4II2A 1U8RA 2NNYA 2K02A 1R1TA 3SFIA 2CQXA 3GTOJ 3T5XA 2XASA 1PUFB 1FBUA 3K2ZA 2CG4A 5FD6A 4F92B 3BOQA 2GLOA 2DA1A 3DCFA 1IXSB 1R5HA 4XLFA 1I50J 2FU4A 1KQ8A 3ABUA 3CCVI 1XCVA 4HYEA 4KA4A 3BG5A 3OYEA 2DMTA 3SDBA 1N77A 2JA6J 1MZBA 4ZC3A 4PJ0C 3FBNB 2PBIA 4BL0B 3JSPA 1H9GA 4BEHA 1ACIA 3F8FA 3HOVJ 3WG9A 2DMNA 3S93A 1JGGA 1ONVA 5AIPA 3BTLA 1NG7A 4BQAA 2QM3A 3R6SA 2PJRA 5F1JA 4OIRF 1P4AA 5DS9A 1S7OA 5E1ZB 1BOBA 2DA3A 4D7NA 1USSA 4L5IA 2GAUA 2VJ5A 2PJRB 4GO1A 2V1UA 3ZRGA 1R23A 3GTGJ 4B3AA 1RIOH 1ZH5A 2IJLA 4P55A 1MH4A 2HYGD 4WWCA 4BH9A 1J7KA 1WVRA 2RNGA 4AC0A 4LK1F 1H0MA 5EF6A 3FKJA 2FNAA 4BHBA 2LC2A 1FJLA 4UVCA 1VQ8I 4UXNA 4IHVA 2DA7A 2QYOA 1MBGA 2XHKA 1K6OA 3MZ8A 3ERED 1BIBA 4I99C 1U5TA 4DJAA 5D5WB 3J7AY 1XMXA 5DCMB 1HSTA 1T08B 3TMOA 3CTAA 2BHZA 3LSPA 4BEHB 2EBIA 1RESA 1JJ6C 2EV0A 1SD6A 5ICFA 2DN0A 3NQOA 2CQQA 1HOMA 2VKVA 1A6IA 3BQZA 4HF1A 2QCOA 4RAYA 3WTVC 1QPMA 2QVOA 5E8IA 3FMSA 4Y52J 1ON2A 2Y48A 1JI8A 4JX4A 3HZJA 5HS9A 2P7VB 3I9V2 2NOJB 2MFZA 4EQQA 2LK2A 5JLXA 4MTEA 3T1BA 1PUFA 3IRRA 1YG2A 2WADA 2RN7A 1MJBA 2QKMB 3EUAA 1JJ8C 2CQNA 4A3EJ 1VZ0A 2FBIA 4FASD 1EA3A 4CCLA 4XLNF 2VE8A 3DV8A 1ETQA 3EQLF 3IP4B 3K7AJ 4KIGA 5EEAA 3TW7A 4AD9A 3JTGA 4IKFA 2EPFA 4EJVA 3DKXA 4M9ZA 3RKXA 5ERIA 3ZCOA 4A93J 4M3EA 2A61A 2XAQA 1QVTA 1PVEA 2R5YA 3KETA 3H0DA 1E3OC 1O3RA 2DPUA 2PMZN 3FHNA 4XLCA 1X4PA 4E7KA 3IKVA 1EH7A 1X1DA 2PEXA 4YFXF 2XB5A 2O9LA 3K2AA 4A0YA 4LD5A 2OU2A 3BCAA 3NARA 3SHFA 2EZKA 3GW2A 1NK3P 5J4YA 5L3DA 4HRIA 1W4MA 3MVPA 1LKXA 2O03A 2CO5A 2KJCA 3H3ZA 3CCYA 2AS5F 1X1BA 3CLQA 3BP8A 1IRGA 2LNBA 3W3CA 1MBEA 4WXHA 3ZP5A 2EA2A 6PAXA 3O3KA 3J80K 5HLIA 1UFMA 3OYLA 2HQAA 3CO6C 4F55A 1YW7A 4R79A 3OIQA 1AOYA 5FKMA 1FP2A 4Z6YA 3KP7A 3FMQA 1JXSA 2M4GA 3L2QA 4JYKA 5C4JJ 4J00A 1MJAA 2JT1A 3H9JA 2W25A 2ZJ2A 4WXCA 2M5WA 1V3FA 2V9VA 4CCNA 1OCTC 2JPBA 3ZQIA 1SAXA 1W7PA 2QUFA 4I6ZA 4OAYA 1Y39A 3J81Z 4CCKA 2CW0F 2XROA 4ZTJA 3QU6A 1Y6IA 3J7ZI 5DCMA 4L9VA 4G8XA 1RKWA 2YR2A 4P9UA 3ERMA 2L9RA 1XGOA 2TCTA 1MNEA 4L9JA 3AAFA 2BGCA 1HF0A 3GWZA 4GFBA 5GAGJ 4MEXF 1TZLA 4U87A 2E1CA 2WY7Q 3P5JA 1U3EM 2ZNYA 2DFIA 2HPMA 2R7UA 4XOPA 4HF2A 2L9SA 1PDNC 3SFZA 2QBYB 1ZHFA 3L9FA 5JFRA 1K7AA 5IT9K 2HXOA 2JMWA 4MHGA 3KEQA 3LSRA 4JX5A 4DBRA 2ZJRF 4ZZLA 3I4NJ 3BJAA 4Y17A 3PJRA 4IHWA 3DEEA 3GCMA 5IT9Z 2E1MB 1MD0A 1GT0C 2L4AA 4ENNA 2YX4A 2M30A 2DMUA 1QHHD 2ZSIB 2M7BA 3RI4A 5HDNA 2LBFA 2LBFB 2DW4A 3JW4A 5CVUA 1WI9A 1P2FA 2OF7A 4LK0F 1R4NB 4GDFA 1FWZA 3LAJA 2IS2A 2K9NA 1OISA 2PLYA 1G4DA 4R8HA 3RYPA 3S17J 2HVRA 1JTXA 2BY3A 1XPXA 1YHQI 3UKGA 1OCRH 1MBHA 1ZK8A 2AXLA 4HQMA 3HSRA 1I3QJ 1MW7A 3P9KA 3G6EI 3G2BA 4NQWA 2A07F 3BG9A 2Y0SA 2EJRA 1BJZA 3QODA 4HNUA 2IS4A 2VJJA 2Z1DA 2RGVA 3CCEI 3BR3A 1FIPA 5J4VA 1QU3A 3HXLA 3S16J 4ZTFA 3DBLB 5LD2C 2H8RA 1VQ6I 1Y0UA 4NDLA 5ICEA 2X6WA 3HBLA 2VKHA 2V1DA 2M8GX 2XPUA 3BZCA 3D1NI 3G73A 1STZA 3DEUA 3IC7A 4OIPF 4J01A 1U2WA 2MD5A 3LSJA 3F8NA 2MLGA 2NVQJ 1P7IA 3E6BA 3DLAA 4KICA 3VB2A 2ZXIA 2X51A 4ZYDA 3OOUA 1DP7P 4BJ5C 3WTUC 4DQ2A 2GZWA 1I3AA 2M8EA 3JCUC 3TO6A 4CDGA 2CUZA 4DBQA 1O3SA 3P7NA 1VTNC 1TL8A 3AL0B 2E34A 1QQIA 4BYYA 1UB9A 3BG7A 1YE9A 4GYGA 3CCMI 2Y9YA 3T8RA 2QSGX 4IHYA 5F0HA 1FX7A 1RETA 2A5WA 1JHFA 2XGCA 1OJLA 3KEYA 1KU7A 1GVJA 4HV6A 4RMNA 4IJAA 4RM2A 4XICA 4XLPF 3RSNA 4ZJZA 3H5RA 3W2AA 4YIIA 2VC0A 1O57A 2BY2A 4RB2C 4NHJA 4IRGA 1FT9A 2LOOA 1HW1A 5LEJA 3LWFA 4ZYAA 1EJ9A 2VUMJ 2M2EA 4KITB 1IJWC 1P4XA 3R0AA 1T95A 2W84A 3K70D 5FJ8J 1E0EA 3GLLA 1BR2A 1E3HA 4BQNA 1G3TA 3HIFA 3CDHA 2MA3A 2ZMEC 5J1RA 2FBHA 1LDJA 2E5ZA 2OD5A 1JUSA 2JTVA 2R7TA 4P96A 3ASNH 3V7RA 2IGOA 5CVVA 2AO9A 2XUBA 5K5QA 3OYBA 4KT5C 4HW0A 2W1OA 3FXKA 3KP4A 4UUTA 3UNGC 4BQOA 1IN7A 5LRRA 5ICGA 2QGUA 2Z9OA 3OSFA 3HOWJ 1T0FC 5DCFA 1WJAA 2E36A 4HX8A 4DW6A 1Z7LA 4AU7A 2D1VA 3KLOA 5K7ZA 4LLNA 3TQNA 3JREA 2F5CA 3DTIA 5E1WA 3S2HJ 2LREA 2G0EA 1J0RA 2BW3B 4ZZDA 3L2CA 1V5EA 3OYKA 5FRMA 3QOPA 3G71I 2FQ4A 2MH2A 9ANTA 2X1EA 3DWLE 3S8PA 2XAJA 4YG2F 2CV2A 3CMEI 5FLXK 2EFNA 1MBJA 2X1CA 1F9NA 5F27A 4M3DA 1JKPC 2LR8A 2H09A 3I55I 3F22A 4ESJA 3BR2A 4A0XA 2F5DA 1X19A 2KDOA 2B9SA 2LSOA 3R4KA 1LUJB 4AWXB 2KHMA 2PMZA 1VQ9I 2LP0A 3A1YA 2O8XA 2EZHA 2NAZA 2EFQA 3ABMH 3X2QH 1D0XA 3ZMSA 1ZGWA 1OR7A 3BROA 3CC4I 2R93J 3S1QJ 3MKYB 3DFGA 2CFXA 3PUBA 5C3EJ 3HKZA 3KP3A 2R4GA 4UVAA 2CW8A 5KVRA 2PG4A 4HG2A 3MD2A 1Z91A 2VXDA 4UHTA 2NVTJ 2CV0A 4M3BA 1QPIA 4U88A 4S0HB 1UG0A 1DPRA 3DBRB 1HDPA 3OMYA 4LGWA 2PFBA 3RKYA 5HS7A 5F08A 2E1OA 2PQ8A 3GMEA 2A05A 3HTUA 3P9IA 3GLXA 3K0LA 4G94A 1T38A 1AKHB 3V7SA 5LFAA 3L1PA 1LEAA 4HX4A 1X58A 2DI3A 1E17A 4AIHA 1OMIA 4BJTA
chains in the Genus database with same CATH topology
1T33A 1ETWA 3M3YJ 3SFIA 2CQXA 3NAUA 3GTOJ 3JRCA 1PUFB 2R5ZB 3DEWA 2FX0A 5IPAA 2EQRA 4QTRA 3JRHA 2GLOA 2DA1A 2XRLA 3DCFA 3CMYA 3S1NJ 3HEFA 2FJ1A 1I50J 3BQYA 2O8KA 3BG5A 4X1EA 1MH3A 2DMTA 3BR0A 2JA6J 1GUUA 4DZJA 3FKIJ 1I6HJ 1WH7A 3Q0UA 4D5FA 3HOVJ 2DMNA 2O7OA 2L7FP 4A3BJ 3BT9A 5FKOA 1JGGA 4C2MJ 2H1KA 1RR7A 3BTLA 2M9HA 2DJNA 2Y9ZA 2HDDA 1W0TA 5F1JA 4JP0A 1VNDA 3H3VK 1ZKGA 4FE4A 5DS9A 5E3OA 2DA3A 4D7NA 3ZOBA 2YU9J 2R5ZA 1G2HA 3GTGJ 4B3AA 2COBA 1JT6A 4L5EA 3RZOJ 1WCMJ 1MH4A 1UMQA 1O4XA 1Z0XA 4AC0A 4W1UA 3G1LA 5EF6A 2L0KA 3RZDJ 3BR5A 3FIWA 1FJLA 5J1YA 1GV2A 1H8AC 1U8BA 2DA7A 4IHVA 1EF4A 4UUSB 1MBGA 3RQIA 2ID3A 1XG1A 3W6VA 4M6VA 5F0CA 5J3LA 5FLVA 3LSPA 2EBIA 1RESA 2GBYA 5IP6A 1JJ6C 2E2HJ 2DN0A 2CQQA 1HOMA 2VKVA 1A6IA 3BQZA 5GPAA 2QCOA 2CRGA 4UUSA 2E2JJ 2FD5A 4XRSA 1AKHA 2JA8J 5EG0B 4Y52J 3ZQLA 2DMQA 4JX4A 3WHCA 4EEFG 5IP7J 5JLWA 2B63J 1Z77A 2R92J 2CJJA 4V2FA 3CQZJ 3MKLA 2LK2A 5JLXA 1PUFA 1HDDC 2Y0SN 4FE7A 5F04A 4A3GJ 1A5JA 5IYBJ 2MG4A 4D7MA 3RKQA 1JJ8C 3IH3A 1B8IB 4A3EJ 1TWHJ 5GPCA 2R7ZJ 4B1RA 2LVSA 1NK2P 1ETQA 1ZTRA 3K7AJ 5EEAA 3TW7A 3JRDA 2X9DA 2MSYA 1K83J 2EZIA 2M0CA 1YRNA 5DTDA 5M5XJ 2XPVA 2D5VA 4A93J 4M3EA 1QVTA 2R5YA 1E3OC 2PMZN 1QRYA 3MN2A 2ZB9A 2KT0A 1AHDP 3FK7A 1IGNA 2VI6A 2XB5A 4DZPA 1HLVA 2O9LA 4XK4A 3K2AA 1DU0A 1LFUP 3HGYA 2CU7A 2HXIA 3NARA 2LTPA 3BG3A 3BTCA 2R5YB 2EZKA 1NK3P 3S14J 3HB9A 4A3JJ 4V2GA 5EZGA 2HOTA 3MVPA 3LSGA 5M5WJ 3CCYA 2NOGA 2LLKA 1D5YA 4A3LJ 3HM5A 3BTIA 3A03A 1MBEA 1ETOA 1XS9A 1P7JA 3TP0A 4BKXA 2KDZA 2LD5A 4IEJA 2N8GA 4RBOA 2JN6A 3JRFA 1Q1VA 3F0CA 3FISA 5F0FA 2DA5A 3OIOA 1APLC 3CDLA 3SDGA 2HQ5A 5FKMA 1XC5A 2R0QC 4AYBN 4HNVA 5K7HA 5FKLA 2NS7A 3TW6A 1BA5A 1JKRC 2HYJA 4JYKA 2MGQA 3O8GA 4MO7A 1GV5A 5C4JJ 2YS9A 1IDYA 5HODA 1RPWA 1OCTC 3LOCA 1F43A 3ZQIA 4QSHA 4I6ZA 3HKZN 5J1UA 3GTLJ 3JRBA 2DA2A 3HOZJ 3M4OJ 1JKQC 1RKWA 4A3FJ 2RAEA 3TEDA 2L9RA 2OPTA 2GM4A 2LY9A 2TCTA 4XIDA 3GTPJ 2M34A 5IYDJ 1F36A 3G1OA 1HF0A 2HOSA 2DTZA 3IV5A 4GFBA 1JTYA 1OFCX 2WB1N 2X48A 3HOUJ 2JK3A 3HOYJ 2E2IJ 1ENHA 5M3MJ 4A3KJ 1FTZA 1QVUA 3QQAA 1WGXA 1S7EA 1WH5A 3GBGA 3PO3J 2Y31A 2WAQN 2ECBA 3BTJA 2IAIA 2W48A 1TC3C 1POGA 2HXOA 5E3LA 3HDDA 2JWTA 2ELKA 2JMWA 2K40A 2XGEA 1IG7A 3SJMA 3LSRA 4JX5A 3O8HA 5K7FA 4XRMA 3I4NJ 4IHWA 2TRTA 5IYCJ 4A3CJ 4J19A 3HGGA 1GT0C 4BXXJ 5M5YJ 1TWAJ 1VFCA 1U9OA 3BR1A 2DMUA 1MNMC 3GTJJ 1IC8A 1YRNB 1GVDA 3C2BA 5C44J 2OF7A 2ME6A 2QF7A 1TWGJ 2K9NA 2P81A 2I10A 1IUFA 4Y7NJ 1JKOC 4MLOA 3S17J 2LFBA 2CUEA 1JTXA 3UKGA 3GTMJ 1MBHA 1ZK8A 5IP9J 2K9QA 4A3IJ 5FLMJ 1I3QJ 3JRAA 4X6AJ 4D5CA 3A01B 5FKKA 3BG9A 3BR6A 1BJZA 1UHSA 1RKTA 4FISA 1BW6A 3JR9A 2XB0X 2XGDA 3OSGA 3BR3A 4CYCB 5IOYA 1FIPA 3E7LA 3IH4A 3S2DJ 3S16J 5EG0A 2H8RA 2JA7J 1ETVA 4NDLA 3JRGA 1DU6A 2VPRA 4QIWN 3HBLA 1U9NA 1LE8A 2M8GX 2XPUA 3D1NI 4C3JJ 5BNGA 1Y1VJ 2MW8A 1W0UA 3LSJA 2NVQJ 1P7IA 1UG2A 4BY7J 1FEXA 5FKNA 1LE8B 3WHBA 3OOUA 4LOCA 1JUPA 5E3NA 2XSDC 2HOAA 4DYQA 4A3DJ 1ETYA 1ZR4A 2Y9YA 1X2NA 4IHYA 5F0HA 1B72A 2JA5J 2CUFA 1RETA 2AHQA 1OJLA 2XGCA 5EGOA 4XICA 3Q3SA 1SFOJ 3I4MJ 2XPWA 4G12A 5EZHA 1MBFA 3ZQFA 1H88C 1B72B 2NVXJ 4M3FA 4AUXA 2NS8A 3S1MJ 2DA6A 1H89C 3PO2J 3S1RJ 2VUMJ 2X6OA 3Q0VA 2M2EA 3S15J 5C4XJ 1IJWC 3B6AA 1ETKA 2LKXA 2E19A 1GDTA 3IH2A 1IRZA 1IV6A 5FJ8J 1MBKA 4ABZA 4IHXA 1FIAA 3QPSA 4DYRA 5J1RA 4BBSJ 2HI3A 4C3HJ 2ME0A 1ORKA 1JUSA 1NTCA 2AO9A 3FK6A 2IBDA 1Y1WJ 4XRSG 4UUTA 5M3FJ 2NVYJ 3QPLA 1X2MA 1FTTA 3OSFA 2Y2ZA 3HOWJ 1T56A 3H0GJ 3B6CA 5EGOB 4DW6A 4BY1J 2L7ZA 1HCRA 1K61A 5E3MA 5K7ZA 3JREA 4MFDA 1JUMA 3S2HJ 2G0EA 4RDUA 4C3IJ 1MSFC 1TWCJ 3LNQA 2FQ4A 4MIMA 9ANTA 1U78A 2VKEA 3Q0WA 4A69C 4M3GA 2JJ7A 5IOZA 1MBJA 4B4CA 5F27A 1JT0A 4M3DA 1JKPC 3A02A 1R9TJ 2LR8A 2DA4A 3BR2A 2EH3A 5GP9A 3HOXJ 3ZQCA 1OCPA 1VI0A 2IEKA 1IDZA 4W97A 2LP0A 1VF9A 1ZR2A 2EZHA 2WV1A 2K9SA 2ECCA 1ITYA 3ZQHA 3JRIA 2DMPA 1ZGWA 3GTKJ 4FCYA 2R93J 1WPKA 3VPRA 4BBRJ 4CYCA 3S1QJ 5C3EJ 1ZQ3P 4I76A 1TWFJ 4A3MJ 2Y30A 3A01A 1LFBA 3G1MA 3GTQJ 1BW5A 2YUSA 5EYRA 1WI3A 1CQTA 4JX6A 2NVTJ 1SANA 3TP3A 4DYCA 4M3BA 1QPIA 4S0HB 1ETXA 4MFEA 2L7MP 1HDPA 1MSEC 4FTHA 3ZQGA 5F08A 1AU7A 2E1OA 1AKHB 2EZLA 3PM1A 5EDNA 1B8IA 3L1PA 2ID6A 1BL0A 1X58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T33 A;  1ETW A;  3M3Y J;  3SFI A;  2CQX A;  3NAU A;  3GTO J;  3JRC A;  1PUF B;  2R5Z B;  3DEW A;  2FX0 A;  5IPA A;  2EQR A;  4QTR A;  3JRH A;  2GLO A;  2DA1 A;  2XRL A;  3DCF A;  3CMY A;  3S1N J;  3HEF A;  2FJ1 A;  1I50 J;  3BQY A;  2O8K A;  3BG5 A;  4X1E A;  1MH3 A;  2DMT A;  3BR0 A;  2JA6 J;  1GUU A;  4DZJ A;  3FKI J;  1I6H J;  1WH7 A;  3Q0U A;  4D5F A;  3HOV J;  2DMN A;  2O7O A;  2L7F P;  4A3B J;  3BT9 A;  5FKO A;  1JGG A;  4C2M J;  2H1K A;  1RR7 A;  3BTL A;  2M9H A;  2DJN A;  2Y9Z A;  2HDD A;  1W0T A;  5F1J A;  4JP0 A;  1VND A;  3H3V K;  1ZKG A;  4FE4 A;  5DS9 A;  5E3O A;  2DA3 A;  4D7N A;  3ZOB A;  2YU9 J;  2R5Z A;  1G2H A;  3GTG J;  4B3A A;  2COB A;  1JT6 A;  4L5E A;  3RZO J;  1WCM J;  1MH4 A;  1UMQ A;  1O4X A;  1Z0X A;  4AC0 A;  4W1U A;  3G1L A;  5EF6 A;  2L0K A;  3RZD J;  3BR5 A;  3FIW A;  1FJL A;  5J1Y A;  1GV2 A;  1H8A C;  1U8B A;  2DA7 A;  4IHV A;  1EF4 A;  4UUS B;  1MBG A;  3RQI A;  2ID3 A;  1XG1 A;  3W6V A;  4M6V A;  5F0C A;  5J3L A;  5FLV A;  3LSP A;  2EBI A;  1RES A;  2GBY A;  5IP6 A;  1JJ6 C;  2E2H J;  2DN0 A;  2CQQ A;  1HOM A;  2VKV A;  1A6I A;  3BQZ A;  5GPA A;  2QCO A;  2CRG A;  4UUS A;  2E2J J;  2FD5 A;  4XRS A;  1AKH A;  2JA8 J;  5EG0 B;  4Y52 J;  3ZQL A;  2DMQ A;  4JX4 A;  3WHC A;  4EEF G;  5IP7 J;  5JLW A;  2B63 J;  1Z77 A;  2R92 J;  2CJJ A;  4V2F A;  3CQZ J;  3MKL A;  2LK2 A;  5JLX A;  1PUF A;  1HDD C;  2Y0S N;  4FE7 A;  5F04 A;  4A3G J;  1A5J A;  5IYB J;  2MG4 A;  4D7M A;  3RKQ A;  1JJ8 C;  3IH3 A;  1B8I B;  4A3E J;  1TWH J;  5GPC A;  2R7Z J;  4B1R A;  2LVS A;  1NK2 P;  1ETQ A;  1ZTR A;  3K7A J;  5EEA A;  3TW7 A;  3JRD A;  2X9D A;  2MSY A;  1K83 J;  2EZI A;  2M0C A;  1YRN A;  5DTD A;  5M5X J;  2XPV A;  2D5V A;  4A93 J;  4M3E A;  1QVT A;  2R5Y A;  1E3O C;  2PMZ N;  1QRY A;  3MN2 A;  2ZB9 A;  2KT0 A;  1AHD P;  3FK7 A;  1IGN A;  2VI6 A;  2XB5 A;  4DZP A;  1HLV A;  2O9L A;  4XK4 A;  3K2A A;  1DU0 A;  1LFU P;  3HGY A;  2CU7 A;  2HXI A;  3NAR A;  2LTP A;  3BG3 A;  3BTC A;  2R5Y B;  2EZK A;  1NK3 P;  3S14 J;  3HB9 A;  4A3J J;  4V2G A;  5EZG A;  2HOT A;  3MVP A;  3LSG A;  5M5W J;  3CCY A;  2NOG A;  2LLK A;  1D5Y A;  4A3L J;  3HM5 A;  3BTI A;  3A03 A;  1MBE A;  1ETO A;  1XS9 A;  1P7J A;  3TP0 A;  4BKX A;  2KDZ A;  2LD5 A;  4IEJ A;  2N8G A;  4RBO A;  2JN6 A;  3JRF A;  1Q1V A;  3F0C A;  3FIS A;  5F0F A;  2DA5 A;  3OIO A;  1APL C;  3CDL A;  3SDG A;  2HQ5 A;  5FKM A;  1XC5 A;  2R0Q C;  4AYB N;  4HNV A;  5K7H A;  5FKL A;  2NS7 A;  3TW6 A;  1BA5 A;  1JKR C;  2HYJ A;  4JYK A;  2MGQ A;  3O8G A;  4MO7 A;  1GV5 A;  5C4J J;  2YS9 A;  1IDY A;  5HOD A;  1RPW A;  1OCT C;  3LOC A;  1F43 A;  3ZQI A;  4QSH A;  4I6Z A;  3HKZ N;  5J1U A;  3GTL J;  3JRB A;  2DA2 A;  3HOZ J;  3M4O J;  1JKQ C;  1RKW A;  4A3F J;  2RAE A;  3TED A;  2L9R A;  2OPT A;  2GM4 A;  2LY9 A;  2TCT A;  4XID A;  3GTP J;  2M34 A;  5IYD J;  1F36 A;  3G1O A;  1HF0 A;  2HOS A;  2DTZ A;  3IV5 A;  4GFB A;  1JTY A;  1OFC X;  2WB1 N;  2X48 A;  3HOU J;  2JK3 A;  3HOY J;  2E2I J;  1ENH A;  5M3M J;  4A3K J;  1FTZ A;  1QVU A;  3QQA A;  1WGX A;  1S7E A;  1WH5 A;  3GBG A;  3PO3 J;  2Y31 A;  2WAQ N;  2ECB A;  3BTJ A;  2IAI A;  2W48 A;  1TC3 C;  1POG A;  2HXO A;  5E3L A;  3HDD A;  2JWT A;  2ELK A;  2JMW A;  2K40 A;  2XGE A;  1IG7 A;  3SJM A;  3LSR A;  4JX5 A;  3O8H A;  5K7F A;  4XRM A;  3I4N J;  4IHW A;  2TRT A;  5IYC J;  4A3C J;  4J19 A;  3HGG A;  1GT0 C;  4BXX J;  5M5Y J;  1TWA J;  1VFC A;  1U9O A;  3BR1 A;  2DMU A;  1MNM C;  3GTJ J;  1IC8 A;  1YRN B;  1GVD A;  3C2B A;  5C44 J;  2OF7 A;  2ME6 A;  2QF7 A;  1TWG J;  2K9N A;  2P81 A;  2I10 A;  1IUF A;  4Y7N J;  1JKO C;  4MLO A;  3S17 J;  2LFB A;  2CUE A;  1JTX A;  3UKG A;  3GTM J;  1MBH A;  1ZK8 A;  5IP9 J;  2K9Q A;  4A3I J;  5FLM J;  1I3Q J;  3JRA A;  4X6A J;  4D5C A;  3A01 B;  5FKK A;  3BG9 A;  3BR6 A;  1BJZ A;  1UHS A;  1RKT A;  4FIS A;  1BW6 A;  3JR9 A;  2XB0 X;  2XGD A;  3OSG A;  3BR3 A;  4CYC B;  5IOY A;  1FIP A;  3E7L A;  3IH4 A;  3S2D J;  3S16 J;  5EG0 A;  2H8R A;  2JA7 J;  1ETV A;  4NDL A;  3JRG A;  1DU6 A;  2VPR A;  4QIW N;  3HBL A;  1U9N A;  1LE8 A;  2M8G X;  2XPU A;  3D1N I;  4C3J J;  5BNG A;  1Y1V J;  2MW8 A;  1W0U A;  3LSJ A;  2NVQ J;  1P7I A;  1UG2 A;  4BY7 J;  1FEX A;  5FKN A;  1LE8 B;  3WHB A;  3OOU A;  4LOC A;  1JUP A;  5E3N A;  2XSD C;  2HOA A;  4DYQ A;  4A3D J;  1ETY A;  1ZR4 A;  2Y9Y A;  1X2N A;  4IHY A;  5F0H A;  1B72 A;  2JA5 J;  2CUF A;  1RET A;  2AHQ A;  1OJL A;  2XGC A;  5EGO A;  4XIC A;  3Q3S A;  1SFO J;  3I4M J;  2XPW A;  4G12 A;  5EZH A;  1MBF A;  3ZQF A;  1H88 C;  1B72 B;  2NVX J;  4M3F A;  4AUX A;  2NS8 A;  3S1M J;  2DA6 A;  1H89 C;  3PO2 J;  3S1R J;  2VUM J;  2X6O A;  3Q0V A;  2M2E A;  3S15 J;  5C4X J;  1IJW C;  3B6A A;  1ETK A;  2LKX A;  2E19 A;  1GDT A;  3IH2 A;  1IRZ A;  1IV6 A;  5FJ8 J;  1MBK A;  4ABZ A;  4IHX A;  1FIA A;  3QPS A;  4DYR A;  5J1R A;  4BBS J;  2HI3 A;  4C3H J;  2ME0 A;  1ORK A;  1JUS A;  1NTC A;  2AO9 A;  3FK6 A;  2IBD A;  1Y1W J;  4XRS G;  4UUT A;  5M3F J;  2NVY J;  3QPL A;  1X2M A;  1FTT A;  3OSF A;  2Y2Z A;  3HOW J;  1T56 A;  3H0G J;  3B6C A;  5EGO B;  4DW6 A;  4BY1 J;  2L7Z A;  1HCR A;  1K61 A;  5E3M A;  5K7Z A;  3JRE A;  4MFD A;  1JUM A;  3S2H J;  2G0E A;  4RDU A;  4C3I J;  1MSF C;  1TWC J;  3LNQ A;  2FQ4 A;  4MIM A;  9ANT A;  1U78 A;  2VKE A;  3Q0W A;  4A69 C;  4M3G A;  2JJ7 A;  5IOZ A;  1MBJ A;  4B4C A;  5F27 A;  1JT0 A;  4M3D A;  1JKP C;  3A02 A;  1R9T J;  2LR8 A;  2DA4 A;  3BR2 A;  2EH3 A;  5GP9 A;  3HOX J;  3ZQC A;  1OCP A;  1VI0 A;  2IEK A;  1IDZ A;  4W97 A;  2LP0 A;  1VF9 A;  1ZR2 A;  2EZH A;  2WV1 A;  2K9S A;  2ECC A;  1ITY A;  3ZQH A;  3JRI A;  2DMP A;  1ZGW A;  3GTK J;  4FCY A;  2R93 J;  1WPK A;  3VPR A;  4BBR J;  4CYC A;  3S1Q J;  5C3E J;  1ZQ3 P;  4I76 A;  1TWF J;  4A3M J;  2Y30 A;  3A01 A;  1LFB A;  3G1M A;  3GTQ J;  1BW5 A;  2YUS A;  5EYR A;  1WI3 A;  1CQT A;  4JX6 A;  2NVT J;  1SAN A;  3TP3 A;  4DYC A;  4M3B A;  1QPI A;  4S0H B;  1ETX A;  4MFE A;  2L7M P;  1HDP A;  1MSE C;  4FTH A;  3ZQG A;  5F08 A;  1AU7 A;  2E1O A;  1AKH B;  2EZL A;  3PM1 A;  5EDN A;  1B8I A;  3L1P A;  2ID6 A;  1BL0 A;  1X58 A; 
#chains in the Genus database with same CATH topology
 4IL6 C;  3KE2 A;  2EV6 A;  3DEW A;  5IPA A;  4AM3 A;  5HLH A;  4EV0 A;  3VOE A;  3MFK A;  3OYH A;  3G3Z A;  4PZJ A;  3C3W A;  3E6C C;  3D5S C;  2O8K A;  1MH3 A;  4RM3 A;  1JHH A;  1YOV B;  3U1K A;  2ZSH B;  3FKI J;  1LDD A;  1TQI A;  4RB1 A;  2F2E A;  3TL4 X;  1WH7 A;  4L18 B;  2BYV E;  5L3B A;  1BR1 A;  4AIJ A;  2EA4 A;  2X6X A;  2FNP A;  2BVL A;  3MCZ A;  3BDD A;  1IRX A;  2W57 A;  3T8T A;  3IL2 A;  3BT9 A;  3CJQ B;  2OZU A;  4C2M J;  5ILV A;  4ENJ A;  3BC8 A;  2EIJ H;  2HDD A;  2XRN A;  4PGH A;  2EB7 A;  3ZMD A;  1ZKG A;  4FX4 A;  3ZMV A;  4ZDL A;  3RPQ A;  4BHC A;  5E3O A;  5FRN A;  2RDP A;  2QSF X;  4RGX A;  5F6F A;  1EH6 A;  2COM A;  3EYY A;  3E6D A;  3H1C A;  1S7A A;  4EGY A;  1G2H A;  3K4M A;  3K69 A;  2COB A;  4PJM A;  4RB3 C;  1JT6 A;  3RZO J;  1WCM J;  2R3S A;  2K7L A;  2XC7 A;  4JQF A;  1O4X A;  4UB8 C;  2V9K A;  3L2R A;  2OA4 A;  3G1L A;  5D6E A;  3A0H C;  3BR5 A;  2BE5 F;  4OIQ F;  1GHC A;  5J1Y A;  4B09 A;  2X6Y A;  3LST A;  3CP8 A;  1EF4 A;  2H1L A;  2G7U A;  1XSX A;  4KDP A;  4N9H A;  1IXR C;  3M8J A;  1FSE A;  5FFZ A;  1UST A;  2ID3 A;  1XG1 A;  3RQI A;  3LA7 A;  1BC7 C;  1VQM I;  3CD6 I;  3GX4 X;  1YJ9 I;  2ZKZ A;  4D0P A;  5IP6 A;  5A2Q K;  2OTL I;  4NB5 A;  5GPA A;  1HW2 A;  3I64 A;  3PNT A;  1N78 A;  2ZFU A;  2M0M A;  3P9C A;  2JA8 J;  5EG0 B;  1CF7 B;  4R1H A;  5A2Q Z;  1BN5 A;  2DMQ A;  4XSZ F;  4EEF G;  5IP7 J;  1O3Q A;  2G7H A;  1Z77 A;  4BAY A;  4FET A;  3CQZ J;  1WHU A;  4FT8 A;  5JVG F;  3AG2 H;  2V4J C;  5F1R A;  1S29 A;  1HDD C;  1G6N A;  1KU2 A;  2Y0S N;  4RLF A;  5F04 A;  1HSJ A;  2PI0 A;  1MND A;  4XKC A;  4C30 A;  2CSO A;  1ZRF A;  3KEO A;  4WF2 A;  3IH3 A;  3W6J B;  3WTZ A;  2DTR A;  1S6L A;  1ON1 A;  3I4P A;  3BJO A;  1JE8 A;  2XF5 A;  1NK2 P;  3KYL A;  2VQC A;  2JZY A;  2KRC A;  1MKM A;  4CCO A;  1FSH A;  3JRD A;  2L02 A;  3BPV A;  1OCC H;  2MSY A;  4ENM A;  2EZI A;  2M0C A;  5DTD A;  5M5X J;  3QYF A;  2XPV A;  2ISZ A;  1WJD A;  4DOZ A;  2F4M B;  3BZ6 A;  1QRY A;  4E70 A;  3WU0 A;  4E4H A;  2DXI A;  2KT0 A;  3WTW C;  1TP4 A;  2I8D A;  5LEK A;  1AHD P;  4PSX A;  4A2U A;  1HLV A;  2V7F A;  1LFU P;  3HGY A;  4KIB A;  2CU7 A;  3C2H A;  3EET A;  2IGM A;  4BE0 A;  2HXI A;  3BG3 A;  4RAG A;  5K5R A;  3S14 J;  2A69 F;  4L9N A;  2OBP A;  4ESB A;  2IRF G;  4V2G A;  2HOT A;  3GFL A;  5M5W J;  3A0B C;  2NRA C;  5CVI A;  2DK8 A;  2LLK A;  3K70 C;  3HM5 A;  3ZQQ A;  4S05 A;  2QWW A;  2STT A;  2VLA A;  4C2U A;  2O5R A;  2RQQ A;  2BHY A;  5AIQ A;  4ESF A;  2UWM A;  1X1P A;  3DU6 A;  2N8G A;  1RZ4 A;  2JN6 A;  4IO9 F;  4IXA A;  5LRS A;  2I5U A;  1DQU A;  4L0Y B;  1HKT A;  3QU3 A;  4G9Y A;  2UXX A;  3FIS A;  4KUM A;  3OIO A;  4NC8 A;  1APL C;  2F48 A;  2R0Q C;  1SFX A;  4HNV A;  4L5J A;  2H6C A;  5FKL A;  3TW6 A;  3QWL A;  1Z1D A;  2MGQ A;  4OMZ A;  3I53 A;  5HOD A;  4KIF A;  2HNH A;  3LOC A;  4Y3O A;  3BZK A;  4QSH A;  2R7W A;  2IA1 A;  2VBY A;  4PJJ A;  2Y0M A;  3FM5 A;  3PNV A;  5HDK A;  3JRB A;  3SQN A;  3FMR A;  4YFK F;  4GYI A;  4PJN A;  4IHT A;  2KIF A;  1XGM A;  3CJN A;  3K9T A;  2HGC A;  3L2V A;  2MLK A;  2LY1 A;  2RAE A;  2DFH A;  2ZME A;  3GTP J;  2M34 A;  1F36 A;  2FBK A;  3W2W A;  4BUP A;  2ZXW H;  2HOS A;  1FY7 A;  1XDU A;  2P8T A;  3OR1 C;  3M1E A;  3HOY J;  4Q47 A;  2A68 F;  1QHG A;  1CGP A;  4A3K J;  1QVU A;  2VAS A;  1PP7 U;  1WGX A;  1S7E A;  2VBX A;  1WJ5 A;  1WH5 A;  4XLE A;  2MC3 A;  1YW8 A;  3F8M A;  4NNJ A;  3CJR B;  4UB6 C;  4NC7 A;  4EM0 B;  5DUI A;  2BOL A;  3PL8 A;  2WV0 A;  5FO5 A;  3BTJ A;  1R49 A;  3IUO A;  3JAM Z;  1U0J A;  3EUH C;  2JVH A;  3WGG A;  2JWT A;  2K40 A;  2XGE A;  2GXG A;  4HLY A;  2OQR A;  4I7H A;  4XOR A;  1KZH A;  3RPU A;  2W7N A;  4UV9 A;  1JGS A;  5LLQ A;  4WCG A;  1TTY A;  2ADU A;  2JQ7 A;  5IYC J;  2DQR A;  4A3C J;  4CXF A;  1TWA J;  2QEX I;  1VFC A;  1HQC A;  2ZJQ F;  1FC3 A;  1MNM C;  1TT5 B;  1IC8 A;  1YRN B;  1GVD A;  4B48 A;  4BGD A;  2OJE D;  1FNN A;  4XOT A;  1TWG J;  2KZV A;  1P4W A;  1L3L A;  1IUF A;  4Y7N J;  2JRT A;  1JKO C;  2DOF A;  4IPA A;  2DBB A;  2YSR A;  3CCQ I;  2L9N A;  3CUQ B;  5HS8 A;  3KIO A;  3D5R C;  3DU5 A;  1QGP A;  1YO5 C;  1IUY A;  3GFM A;  4X6A J;  3FM3 A;  1OLT A;  3PFY A;  4D9J A;  1IN8 A;  3FXR A;  2LF8 A;  3L00 A;  5DUK A;  1VQ7 I;  2ZJP F;  1BW6 A;  3VWB A;  1BI0 A;  4IRI A;  2BXY A;  4HST A;  3SEQ A;  2XB0 X;  2CH0 A;  4IF4 A;  3V42 A;  5B1A H;  3WGH A;  3E7L A;  5FD5 A;  3IH4 A;  3H9Q A;  1IW7 F;  4DIQ A;  2JA7 J;  2K27 A;  4GCV A;  5BPD A;  3M9A A;  1LE8 A;  2ELH A;  1W36 C;  3KP5 A;  4C3J J;  5LHG A;  5KAF C;  1YTY A;  3B02 A;  1ZAR A;  4A12 A;  4I02 A;  4HV5 A;  4BY7 J;  4U0W A;  4BU2 A;  5CYV A;  1A36 A;  3FXQ A;  2HS5 A;  3L2U A;  1U5T C;  1BJA A;  3T0Y A;  4M72 A;  4EMS A;  5J8C A;  4Y15 A;  2FF4 A;  3K4C A;  1YJN I;  1LVA A;  1ETY A;  3LA2 A;  3WU1 B;  5BMZ A;  1S72 I;  1W5S A;  2OZ6 A;  3K4K A;  2CUF A;  2AHQ A;  4YRV A;  2L3D A;  3QYE A;  3QP5 A;  4LG0 B;  3DXJ F;  2ISY A;  3LSH A;  4PFO A;  3I4M J;  2XPW A;  5FFX A;  3IWZ A;  5ILS A;  2FXA A;  3LMM A;  4ENK A;  2NVX J;  1MGT A;  1Z21 A;  1QNT A;  1YX5 A;  2PX9 A;  2VXZ A;  2DA6 A;  4AUX A;  3QRF F;  1H89 C;  5DYM A;  4C2T A;  3PO2 J;  1D5V A;  1Z9C A;  2X6O A;  3SZG A;  3Q0V A;  5KAI C;  1NH3 A;  5C4X J;  5E18 F;  2FOK A;  3OV8 A;  2YU3 A;  3B6A A;  1ETK A;  2LKX A;  2E19 A;  1BM9 A;  3ELK A;  1F4K A;  2XGX A;  1IV6 A;  1SD7 A;  1NG6 A;  3ONQ A;  4ABZ A;  2XIG A;  1FIA A;  4ZDP A;  3CP2 A;  4BBS J;  3ML6 A;  2HKX A;  1S5L C;  1ORK A;  3OWT A;  5FRO A;  3SEZ A;  3PQJ A;  5JHF A;  2LY2 A;  2CQK A;  5HDG A;  5HLG A;  2O6G E;  1KYW A;  4II3 A;  4HOB A;  1YQA A;  5IY5 H;  5D5X B;  5CQG A;  4XRS G;  1FYL A;  4HDU A;  3KYC B;  2O0Y A;  2BBY A;  2DT6 A;  1YIO A;  1IZ1 A;  4M6Y A;  3UR3 C;  2KKO A;  2DT5 A;  5EGO B;  4BY1 J;  4IQJ A;  5E3M A;  1FMV A;  2L54 A;  2Q2E A;  3SXY A;  1R36 A;  2R7S A;  2QSH X;  3QPH A;  1QBJ A;  1MSF C;  2LG4 A;  3FXU A;  4ZH4 F;  4BJ6 C;  1L0O C;  2GA2 A;  1H9T A;  1YLF A;  4HA8 A;  5JR3 A;  3I3L A;  1ZAO A;  3VSL A;  4A69 C;  4MGR A;  4JBA A;  3S3O A;  3A02 A;  3OS2 A;  5JVT A;  2K86 A;  2WAF A;  1MMA A;  5GP9 A;  4I09 A;  1Z67 A;  3DQV C;  1TW2 A;  2K3P A;  2L01 A;  5CLS A;  2K4B A;  1ZRC A;  2FMY A;  3REO A;  3SZT A;  2KIS A;  5FB2 A;  2WV1 A;  2MBF A;  2PMH A;  1M1E B;  2E71 A;  2ECC A;  2DMP A;  4CSW A;  4FCY A;  2L9V A;  3VPR A;  2RKH A;  3V8L A;  2JSP A;  1U5T B;  1ZQ3 P;  4I76 A;  3A01 A;  1LFB A;  1BW5 A;  2RC4 A;  4RAZ A;  3DTK A;  3RQ4 A;  3PIP F;  3TKY A;  1SVO A;  3ZGK A;  2GA1 A;  1SAN A;  3TP3 A;  4DYC A;  1X1A A;  1IO2 A;  2X85 A;  4U0V A;  2X1D A;  2MD0 A;  3QPT A;  1S9H A;  4YIF A;  4WK8 F;  3CF5 F;  3PM1 A;  1B8I A;  3EDP A;  1MMD A;  1A31 A;  4Y4R A;  1BL0 A;  2ZO4 A;  4Z2Y A;  2RVC A;  1T33 A;  1ETW A;  1R00 A;  3OIP A;  4LLG F;  5BS6 A;  3M3Y J;  3NAU A;  3HRS A;  1KON A;  2BY0 A;  1DDN A;  3RJP A;  3JRC A;  1D0Y A;  2R5Z B;  1PJR A;  2YPR A;  2FX0 A;  3SZP A;  3JRH A;  2H94 A;  4N9I A;  5J47 A;  1SFK A;  3CMY A;  3S1N J;  3AL0 C;  1V5F A;  1XDS A;  3BQY A;  4QWQ A;  4X1E A;  3TGN A;  2E1N A;  1GUU A;  2W24 A;  3FHZ A;  2FE3 A;  2HZD A;  4DZJ A;  1I6H J;  2VON A;  1OR7 C;  1WJB A;  3K4J A;  2ELJ A;  3BG6 A;  5LHH A;  2O7O A;  3HRT A;  4A3B J;  5FKO A;  1X1C A;  4P9F A;  4E7J A;  1PYV A;  2DJN A;  3O6B B;  3V7C A;  1D8J A;  4JP0 A;  5CKT A;  1R58 A;  1VND A;  3H3V K;  1J5Y A;  2OCC H;  3I0T A;  2GOM A;  4G6T B;  3H92 A;  1K78 B;  2VL8 A;  1I27 A;  1DGW Y;  2TDX A;  5D5U B;  1ERD A;  3ZOB A;  2YU9 J;  5JI6 A;  4M73 A;  2HPI A;  4EJW A;  4ZYE A;  3VYT B;  3WU2 C;  1KQ9 A;  3FX3 A;  3AKZ A;  3IWF A;  1I1G A;  1UMQ A;  5HVQ C;  1EH8 A;  1Z0X A;  4XN3 A;  4LLL A;  3ECO A;  2L0K A;  5J8F A;  4AID A;  2EV5 A;  3OYM A;  3RZD J;  1SD5 A;  2ZFW A;  3HPG A;  2ZC2 A;  1GV2 A;  1U8B A;  2G9W A;  1WJC A;  5E20 A;  5TGT A;  4M9S A;  4UUS B;  3FWE A;  3K1M A;  3M8F A;  3W6V A;  3NWS A;  2KQR A;  2LH9 A;  1OKR A;  5F0C A;  1LEB A;  5J3L A;  3FDY A;  5FLV A;  5TIS C;  2GBY A;  1X4O A;  5GTI C;  2E2H J;  2WB1 A;  2KIQ A;  1BI3 A;  2IW5 A;  2ZXJ A;  2V6C A;  4IOA F;  5CQE A;  3H3U A;  4KYW A;  5GAD J;  1O7L A;  2B63 J;  2R92 J;  2CJJ A;  4V2F A;  1D8K A;  3MKL A;  5CVJ A;  4FE7 A;  4A3G J;  2M1B A;  1G3Y A;  2MG4 A;  3ZQ7 A;  3U9G A;  1YJW I;  4OWR B;  4D7M A;  1Z6T A;  1MMN A;  3CMA I;  1B8I B;  2RRE A;  3LQR A;  2XV4 S;  4XL9 A;  3CUQ A;  5GPC A;  1W1W E;  4B1R A;  2LVS A;  4UVB A;  3J81 K;  2KRF A;  2P5L C;  2AQE A;  2X9D A;  1J09 A;  2V1X A;  1XD7 A;  1MJ9 A;  3F3X A;  4HPQ A;  2KL4 A;  2E60 A;  1YRN A;  2HOE A;  3CMM A;  2D5V A;  4BNC A;  1FMW A;  5K1Y A;  4FHT A;  5HNF A;  3HOS A;  1Y0N A;  2CYY A;  3MN2 A;  4F91 B;  2LDU A;  2ZB9 A;  4I98 B;  2BEO A;  2Y75 A;  3Q9V A;  2WA0 A;  1FP1 D;  5L3E A;  4XK4 A;  2A6E F;  1DP3 A;  1DU0 A;  1IRF A;  2P6S A;  3RDI A;  5AON A;  3F72 A;  3CCL I;  3BTC A;  2KRH A;  2QQA A;  2DU9 A;  2WY8 Q;  2JSC A;  4A3J J;  3ROU A;  2HWV A;  5EZG A;  3LSG A;  2GIZ A;  5GAE J;  3U1D A;  4A5N A;  1XMA A;  1GXQ A;  1D5Y A;  2AQF A;  3BTI A;  4GXO A;  3A03 A;  2K3F A;  2ICW G;  3ISP A;  2K85 A;  1ETO A;  4LJZ F;  2IT0 A;  3AG1 H;  4M9X A;  3HL2 A;  4BE2 A;  1P7J A;  4BKX A;  2LD5 A;  1LPQ A;  4EJO A;  2CWE A;  4N0B A;  1DGR M;  2CS3 A;  2P6T A;  4IEJ A;  4OOI A;  5KHD A;  1K79 A;  3I71 A;  4IX7 A;  4CZC A;  2P5K A;  1Q1V A;  3FF5 A;  3D5L A;  2DA5 A;  2XAG A;  3CDL A;  3SDG A;  2HQ5 A;  1EV7 A;  2XVC A;  3C7J A;  1MMS A;  1T0F A;  2NS7 A;  1TLH B;  5ICC A;  5ED4 A;  4N4O B;  3J7Y J;  2DOA A;  2YS9 A;  2RNJ A;  1XX5 A;  2CQ7 A;  3Q9S A;  2ESH A;  4OIN F;  3S3M A;  1N25 A;  1XB4 A;  2XKP A;  3MQ0 A;  2KIU A;  3GFJ A;  1F43 A;  1Z6R A;  1YI2 I;  3DPL C;  5J1U A;  1T39 A;  4CHU A;  2J5P A;  4HNT A;  2WWY A;  3GTL J;  3E3V A;  4QLC U;  1ZG3 A;  1S8N A;  3HOZ J;  4IHS A;  3M4O J;  3C1D A;  1R5I D;  4A3F J;  3TED A;  3L09 A;  2DFE A;  2OPT A;  2GM4 A;  2HDW A;  4XID A;  3DPU A;  5IYD J;  3HUG A;  3OS0 A;  2QA4 I;  2DCE A;  4BQQ A;  2F5F A;  2DTZ A;  3IV5 A;  5BOX A;  1OFC X;  2WB1 N;  2F6C A;  2M7A A;  1RR8 C;  1BOA A;  2X48 A;  1KYZ A;  3PQK A;  4RB0 A;  1A6Q A;  2VQL A;  3MZH A;  1HA8 A;  4YFN F;  5M3M J;  1FTZ A;  3QQA A;  3JAM K;  1UEL B;  2KFD A;  1X3W B;  2Y31 A;  3EUK L;  3WE2 A;  1LB2 A;  4NBQ A;  4XNF A;  3BLY A;  1I1S A;  4LG0 A;  2W48 A;  1POG A;  5E3L A;  3HDD A;  1P92 A;  2X0L A;  1SMY F;  4M74 A;  2MC4 A;  3KZZ A;  1V4R A;  4XRM A;  2OCE A;  3VYR B;  2V26 A;  2W4S A;  4XR6 A;  3K4N A;  3Q5F A;  3F6V A;  4BE1 A;  3HGG A;  5B1B H;  4BXX J;  5M5Y J;  3E5X A;  1U9O A;  2CW7 A;  2XKO A;  1U6G A;  1TBX A;  3A4C A;  1BIA A;  2GOX B;  1LDK B;  3IRQ A;  2W00 A;  3C2B A;  5C44 J;  1E2X A;  2ME6 A;  5E17 F;  3OY9 A;  4PDK A;  5GTH C;  2DT7 B;  2DOD A;  2P5V A;  1D3Y A;  3MMY B;  3R60 A;  3I58 A;  1IV8 A;  4MLO A;  1J59 A;  4ZYG A;  2LFB A;  1OCO H;  3CES A;  1TNT A;  1G3S A;  1GXP A;  1K4T A;  3HRU A;  4A3I J;  1XSV A;  2ETH A;  1OYW A;  4RGR A;  4BXU A;  4D5C A;  3A01 B;  5FKK A;  2VKD A;  3VFZ A;  3E6M A;  2VC1 A;  1OYI A;  3BR6 A;  4JK1 X;  2ZXH A;  1TW3 A;  3HRM A;  2HEO A;  1NHA A;  4YEL A;  2FUG 2;  3K4B A;  3OSG A;  4UY8 I;  3S2D J;  1UHW A;  3K6G A;  5EG0 A;  1CF7 A;  3WOD F;  2C6Y A;  1I6X A;  1ETV A;  1DU6 A;  2F5E A;  2NYX A;  3BWG A;  3JRG A;  4BAC A;  3GFI A;  2VPR A;  5LGU A;  3OYD A;  2LKS A;  4FX0 A;  5F64 A;  5BNG A;  1YIT I;  2MW8 A;  4IZZ A;  1XCB A;  1W0U A;  4DGW B;  4LG3 A;  1UG2 A;  3I59 A;  1FEX A;  4RGU A;  2DFF A;  5FKN A;  2ACJ A;  2STW A;  4LOC A;  1X3U A;  2M87 A;  2MAB A;  3E1S A;  3HUG B;  5E3N A;  3W2V A;  5D4R A;  3G4S I;  1DUX C;  3A2K A;  5H6R A;  5KK1 A;  3K1N A;  3OYA A;  3RIR A;  2KP6 A;  4A3D J;  3LFK A;  3GF2 A;  1ULY A;  3GEZ A;  4LIU A;  3K1P A;  5B66 C;  3IAS 2;  1X2N A;  3H5A A;  2GIV A;  2JA5 J;  3TBI A;  1W5C C;  2P0W A;  3I5U A;  5EGO A;  3EUH A;  3WTX C;  4HEA 2;  1ZGA A;  3BCB A;  3Q3S A;  1WKM A;  4XQF A;  1MDM B;  2QBY A;  1FLI A;  2XDV A;  2DK5 A;  2KMU A;  3NEU A;  4G12 A;  3HG9 A;  1YIJ I;  4LFU A;  1H88 C;  1B72 B;  2L7K A;  3V8J A;  1B6A A;  4YEJ A;  4M3F A;  3J7A O;  2EIM H;  2NS8 A;  4LB6 B;  3S1M J;  2VBW A;  2KLO A;  4B47 A;  1WZ2 A;  4WXD A;  3PFI A;  4IVN A;  1SFU A;  3IHU A;  3AG3 H;  3IH2 A;  3PIO F;  4IHX A;  3QPS A;  1WFX A;  3GO5 A;  5J40 A;  4KN7 X;  1WJE A;  4XON A;  1T98 A;  1IN6 A;  3WTY C;  1NTC A;  4HZF A;  4EVI A;  5IT3 A;  4MQV A;  1XN7 A;  1FPQ A;  5D8K B;  4IQ4 A;  4G7H F;  2R7R A;  1K6Y A;  5LGT A;  2XSJ C;  2IBD A;  1ODD A;  1WRJ A;  3PNY A;  1Y1W J;  2CUJ A;  2A3S A;  2VT3 A;  5B3S H;  5M3F J;  4E7S A;  1ZG5 A;  1I5Z A;  3NRV A;  3QPL A;  4XKB A;  4OAZ A;  1X2M A;  2VIX A;  1R1V A;  4O6J A;  2KZG A;  4B8X A;  2Y2Z A;  3WE3 A;  3H0G J;  3B6C A;  5DD4 A;  3GZN B;  5LBQ A;  1P6R A;  1VQP I;  1FZP B;  1YS7 A;  3ZPL A;  3HPH A;  1K61 A;  4MQ9 F;  2FQ3 A;  3CUQ C;  1HKQ A;  1XGS A;  2B0L A;  4UV8 A;  1JUM A;  3H9G A;  1VQO I;  1LJ9 A;  3KZI C;  3KX2 A;  1E3P A;  3E0J B;  4C3I J;  4RDU A;  1F5T A;  1W5T A;  1FYK A;  1ZLK A;  5DDG A;  2UZK A;  5GAH J;  3LNQ A;  2HYF A;  2QQB A;  4MIM A;  3S32 A;  2D1H A;  1U78 A;  1Y56 A;  2VKE A;  4EJT A;  3LQQ A;  5DD8 A;  4A5M A;  4ASN A;  3KP2 A;  3Q0W A;  2W82 A;  4M3G A;  3QOE A;  1ZEL A;  4B4C A;  1JT0 A;  1EKE A;  2Z16 A;  3ESW B;  2DA4 A;  5TJJ A;  3JSO A;  2CMP A;  3CJT B;  2OQG A;  5HOO A;  3GUD A;  1KU3 A;  5LGN A;  2IEK A;  2IS6 A;  2DOE A;  3TO7 A;  5EJC A;  1IDZ A;  5H6Q A;  3HJE A;  1ZYR F;  3WTS C;  3LAP A;  3HOT A;  2K9S A;  3DF8 A;  2QLZ A;  2IGK A;  4LMY A;  3ZQH A;  1PUE E;  3CC7 I;  3JRI A;  2R7F A;  3ULQ B;  3EPZ A;  4BBR J;  3B73 A;  3R61 A;  1OYY A;  4A6D A;  3N4M A;  3NWT A;  4N4N B;  4A3M J;  3WGI A;  2Y30 A;  4H4K C;  1ZG1 A;  4CGZ A;  3N97 A;  3GTQ J;  4PFP A;  5EYR A;  1Z05 A;  1WI3 A;  1W7P D;  3PUF A;  1CQT A;  1F1Z A;  3CCR I;  3CF2 A;  5H2F C;  4XN0 A;  2QZ8 A;  3KYD B;  1ETX A;  4MFE A;  2L7M P;  1MSE C;  4FTH A;  3DTE A;  4QPO A;  1R6R A;  1AU7 A;  4Q4Z F;  1R22 A;  2EZL A;  2OAZ A;  3VYS B;  2Q0O A;  3OR2 C;  2ID6 A;  3V8K A;  4V19 K;  1XSD A;  4ITV A;  1MIJ A;  3H35 A;  1I39 A;  2WBM A;  2BY1 A;  1FOX A;  3QP6 A;  3C2G A;  1SMT A;  4XRF A;  4NC6 A;  5EEG A;  2EQR A;  3BJ6 A;  2K5C A;  4QTR A;  3RCO A;  3MWM A;  3KLN A;  4HF0 A;  2FEZ A;  2XRL A;  1BI1 A;  3CUO A;  3HEF A;  2FJ1 A;  3KFW X;  1YS6 A;  4HX7 A;  3O2P E;  4KFC A;  3IKT A;  1QZZ A;  3M1C A;  4CCM A;  2KJB A;  2P7C B;  3BR0 A;  5CVR A;  3CDI A;  5DV5 A;  2B7E A;  1SC7 A;  1BBY A;  1SVM A;  4Y13 A;  1G3W A;  2HQN A;  4BDY A;  1A35 A;  3E5U A;  4K2E A;  3Q0U A;  3F8C A;  1B9N A;  2CGP A;  4B43 A;  2VOO A;  5EEH A;  4D5F A;  2H8W A;  4BDZ A;  1WQ2 A;  1T8I A;  1Q1H A;  2L7F P;  4F93 B;  1YFH A;  2H1K A;  2IGN A;  1RR7 A;  2V1N A;  2M9H A;  2Y9Z A;  5JHU A;  1W0T A;  2IA0 A;  1QZE A;  4GGG A;  1QO0 D;  1RNL A;  3M07 A;  1UHM A;  2BW3 A;  4FE4 A;  2DLL A;  3DKY A;  4E7I A;  2R7O A;  4TV7 A;  2AXT C;  4ZYH A;  1YX3 A;  2A5Y B;  2JUC A;  2EIL H;  2R7V A;  4YIR X;  2R5Z A;  2Z99 A;  2HZT A;  4L0Z B;  4RA2 A;  4L5E A;  4PCQ A;  1Z3Y A;  3MAJ A;  3CLO A;  2GXB A;  1D1C A;  1QZY A;  3HSE A;  4B3X A;  4E7H A;  3W6K B;  4RAF A;  5BQT A;  1LQ1 A;  4W1U A;  4CO8 A;  1TT0 A;  3FIW A;  1LVK A;  3DPT A;  3LFU A;  3LA3 A;  1H8A C;  2F4I A;  3RPU D;  3F9K A;  1HW5 A;  1TQP A;  2QQ8 A;  2OV7 A;  4XLA A;  2VQG A;  2J5O A;  4L9T A;  1KQ0 A;  2OC6 A;  4F52 A;  3FXJ A;  4M6V A;  4AIK A;  1OQY A;  2HFH A;  2O3F A;  3SYT A;  1IF1 A;  1R1U A;  4FQG A;  1XGN A;  5HLT A;  5D5V B;  4IOC F;  3BPX A;  4A6E A;  2QQ9 A;  4UUS A;  2CRG A;  2E2J J;  2F4O B;  2Z2S B;  4I0B A;  2ZBK A;  3ZXS A;  2FD5 A;  4XRS A;  1AKH A;  2HDC A;  5KNL A;  5D8L B;  3ZQL A;  5JLW A;  2D45 A;  3AG4 H;  4RS8 A;  3WHC A;  3S2W A;  3MEX A;  2D2W A;  4MTD A;  1SAU A;  2A6T A;  2PMU A;  3S3N A;  1AWC A;  2K9L A;  3F8B A;  1G8X A;  1X3Z B;  2XAU A;  3FXO A;  3OYC A;  1A5J A;  2JA2 A;  4PJL A;  4D1Q A;  2DO7 A;  4G6D A;  5IYB J;  1T6S A;  2BV6 A;  2K9M A;  3OYN A;  2NXN B;  2F5V A;  3RKQ A;  4OMY A;  1HC8 A;  1D1A A;  2VJI A;  2MYS A;  1BC8 C;  3DLL F;  1TWH J;  2HU9 A;  2LRD A;  3OS1 A;  1SEU A;  2X4H A;  3ASO H;  2R7Z J;  4IRH A;  4XLH A;  2UV1 A;  1ZTR A;  4EGZ A;  1WWX A;  2R7X A;  2HVS A;  2BVM A;  1K83 J;  2E1M C;  1XTA A;  2RQP A;  4H0E A;  4HBL A;  2EWN A;  2H6B A;  5K5O A;  3N05 A;  3V4G A;  3LSK A;  3KP6 A;  2HTJ A;  4LIV A;  5CPR B;  1V5G A;  4B44 A;  3PSI A;  3IAM 2;  3FK7 A;  1R71 A;  2VI6 A;  1IGN A;  4DZP A;  3FZV A;  3FXM A;  1Z3X A;  4I01 A;  3RYR A;  2LTP A;  1IAW A;  2LYC A;  2R5Y B;  3E5Q A;  1PP8 F;  1P9Q C;  3HB9 A;  3U2R A;  3CCJ I;  2ZNZ A;  2VE9 A;  2IPQ X;  2NOG A;  1R5G A;  2VQH A;  4UUV A;  4A3L J;  1V54 H;  1BI2 A;  1KU9 A;  3OYF A;  2H27 A;  3RTR A;  1FBS A;  1XS9 A;  3TO9 A;  5DM7 F;  1WSU A;  1LNW A;  3TP0 A;  3TDU C;  4C9Y A;  2KDZ A;  1UZC A;  4AYB A;  2LKP A;  4G7Z F;  4O3M A;  2DDB A;  1B59 A;  4MNU A;  4RBO A;  1HKS A;  3JRF A;  3BY6 A;  3HHG A;  3F0C A;  4BHP A;  3J80 Z;  1K4S A;  3L2W A;  2M45 A;  5F0F A;  3AFH A;  2IXS A;  2O61 A;  2FSW A;  4PK4 A;  1XC5 A;  1REP C;  1J2X A;  4AYB N;  2VJ4 A;  3GZ6 A;  5K7H A;  1BA5 A;  2UXN A;  4XBF A;  4HQE A;  1JKR C;  2HYJ A;  3O8G A;  4MO7 A;  1GV5 A;  1IDY A;  2P4W A;  3ZMZ A;  1ZGJ A;  1RPW A;  2Z5U A;  1RI7 A;  4DNC A;  3GYH X;  1IN5 A;  3TDZ C;  4HLX A;  3HKZ N;  4XSX F;  2IA2 A;  3HYI A;  2NVU B;  2KIM A;  1HXD A;  2DA2 A;  3KPH A;  4PGG A;  4AVP A;  2DDA A;  3COA C;  2EFO A;  3ABL H;  1J9I A;  1JKQ C;  3VSK A;  4HSR A;  2R7D A;  1FOW A;  3ZMU A;  2LY9 A;  2VOD A;  5B5E C;  3G1O A;  2QEN A;  2E35 A;  3RKW A;  1FOY A;  4EAT A;  2HVQ A;  1JTY A;  2XF7 A;  1R7J A;  2DQL A;  4PUS A;  1ZRD A;  2FA5 A;  3HOU J;  4AVZ A;  3OYG A;  2JK3 A;  2WTE A;  2E2I J;  1ENH A;  3F21 A;  3HHH A;  3HTS B;  5E1X A;  2EIK H;  3R0J A;  3WTT C;  3GBG A;  3PO3 J;  1RC9 A;  3LL7 A;  3GXO A;  3HC7 A;  2WAQ N;  4CYD A;  2ECB A;  2M3A A;  4KJZ A;  3TOA A;  1KA8 A;  2XAH A;  4CA0 A;  2XF6 A;  2IAI A;  2XAF A;  1TC3 C;  3M7G A;  2ELK A;  4M6X A;  1IG7 A;  1W7P B;  3SJM A;  2DJI A;  4BXF A;  1XMK A;  4U7B A;  2WAQ A;  1BR4 A;  3O8H A;  5K7F A;  2W85 A;  1RUN A;  3OYJ A;  4CH7 A;  2EK5 A;  3K10 A;  2Z3Y A;  2TRT A;  3CO7 C;  1ZN2 A;  4J19 A;  4UNO A;  1B4A A;  2V79 A;  3FBI B;  4GRI A;  3D0S A;  1MMG A;  2NNN A;  3BR1 A;  2Q1Z B;  3GTJ J;  2DPD A;  1UJ8 A;  2ZCW A;  4KMU X;  1FYM A;  3H36 A;  5DEQ A;  3VOD A;  2Z33 A;  4A0Z A;  3CZ6 A;  2PJP A;  2QF7 A;  4KN4 X;  2V9P A;  1LFP A;  2BXZ A;  3H5N A;  1HBX G;  4ANJ A;  1VQL I;  2P81 A;  2I10 A;  3HSF A;  3M8E A;  4WX9 A;  2CFO A;  2CUE A;  2KPM A;  4XM3 A;  3VDX A;  2FML A;  4P5O A;  2EFW A;  3C18 A;  3GTM J;  2RV8 A;  2WC2 A;  2K9Q A;  5IP9 J;  4X0G A;  4F3Q A;  5FLM J;  3JRA A;  3L7W A;  2HR3 A;  4Q5S F;  4S04 A;  2L2O A;  1SD4 A;  2E5N A;  3U21 A;  1UHS A;  5L3C A;  1RKT A;  4FIS A;  5H20 A;  3JR9 A;  1OCZ H;  1B1B A;  2XGD A;  2GXA A;  4CYC B;  3K4L A;  5KCM A;  5IOY A;  4KIS A;  3QYB A;  2OUM A;  2V6E A;  3QAH A;  3ZMT A;  2ZME B;  4KT6 A;  4RGS A;  3TOB A;  1O7F A;  4OIO F;  4QIW N;  5ILU A;  1SFE A;  4G7O F;  1U9N A;  2JVG A;  2A6H F;  5D6F A;  3ZN0 A;  5LHI A;  3EYI A;  4MEY F;  2JUG A;  5L3G A;  1Y1V J;  1FOK A;  3PSF A;  1TNS A;  2L5Q A;  1Z7U A;  2DAO A;  4CUG A;  3WG7 H;  2LMD A;  5HNH A;  3ECH A;  3KZY A;  1LE8 B;  3OL3 A;  3WHB A;  5TRD A;  1IXC A;  1JUP A;  1VQ4 I;  2R7Q A;  2EFP A;  3LSI A;  2XSD C;  2HOA A;  4E6K G;  4DYQ A;  2Y69 H;  1SVL A;  3OL4 A;  3ABK H;  4Q48 A;  2VB6 A;  3MKZ A;  2HKO A;  1ZR4 A;  2GQQ A;  1C0W A;  1B72 A;  4HDV A;  2WAE A;  4CZZ A;  4F7Z A;  2FOW A;  1MDM A;  1AA7 A;  2VN2 A;  2UUZ A;  4QPQ A;  3ZR8 X;  2K4J A;  1SFO J;  4CIC A;  5EZH A;  1MBF A;  2QKL B;  3ZQF A;  1TQM A;  3VEP A;  5BPI A;  4P1W A;  3ABT A;  1DPU A;  2HQR A;  3GZ5 A;  4NUB A;  3S1R J;  5E79 C;  4LB5 A;  3S15 J;  3VYU B;  2L4M A;  2CV1 A;  2NS0 A;  1B9M A;  4CCJ A;  1GLN A;  1GDT A;  1IRZ A;  2ESN A;  2DYR H;  3I59 B;  5J6X A;  1VQK I;  1MBK A;  5D4S A;  2BZT A;  2E7W A;  4DYR A;  2VT2 A;  2HI3 A;  1S3J A;  4C3H J;  2ME0 A;  1ZRE A;  1VQN I;  4ZDO A;  1RUO A;  1D1B A;  1FBQ A;  1YYV A;  3FK6 A;  3LSM A;  1T2K A;  1RRJ A;  1O3T A;  2EIN H;  1G59 A;  4XKW A;  4KNY A;  2OTJ I;  4EM2 A;  2NVY J;  3F6O A;  4E7Z A;  1UAA A;  1FTT A;  1T56 A;  2GWR A;  4KMF A;  4ON0 A;  2L7Z A;  1HCR A;  1J75 A;  1A04 A;  2MH9 A;  4RLQ A;  3I54 A;  1R4M B;  4MFD A;  1YW9 A;  4E7L A;  4HAM A;  2E7X A;  4JOM A;  1WJF A;  5FGM A;  1W36 D;  1TWC J;  3CCS I;  1IN4 A;  4PSW A;  4U7D A;  1Y8Q B;  3CCU I;  2VOP A;  2IVM A;  2Q2E B;  2JJ7 A;  5IOZ A;  3CC2 I;  4G6Q A;  2FRH A;  2DYS H;  1R9T J;  4LIT A;  2IS1 A;  4BS9 A;  5CJ9 A;  3KCC A;  2HTS A;  2Q8K A;  1OPC A;  2EH3 A;  4EJU A;  3HOX J;  3ZQC A;  5FLX Z;  3I56 I;  1OCP A;  1VI0 A;  5E8G A;  3DKW A;  4I2O A;  1Y8R B;  3FXL A;  3OOP A;  4W97 A;  4XKV A;  4ETS A;  1VF9 A;  2JRM A;  1ZR2 A;  2YX7 A;  2M4K A;  1ITY A;  3F23 A;  3GTK J;  1QA6 A;  3JTH A;  2JPC A;  1WPK A;  4Y33 A;  4CYC A;  2LF7 A;  2IP2 A;  1TWF J;  1ZLJ A;  1D0Z A;  4M71 A;  4NQW B;  3G1M A;  4O5V A;  3OYI A;  1V55 H;  2VBZ A;  2YUS A;  3GVA A;  2VPL A;  3DP7 A;  4JX6 A;  2PN6 A;  4U0Y A;  4I0A A;  4OU0 A;  3DBH B;  1N75 A;  1KGS A;  1K78 A;  5L3F A;  1VQ5 I;  3MZY A;  3ZQG A;  4XMY A;  4EM1 A;  3MKW B;  3ZN1 A;  5DM6 F;  5EDN A;  3E97 A;  1UCR A;  4II2 A;  1U8R A;  2NNY A;  2K02 A;  1R1T A;  3SFI A;  2CQX A;  3GTO J;  3T5X A;  2XAS A;  1PUF B;  1FBU A;  3K2Z A;  2CG4 A;  5FD6 A;  4F92 B;  3BOQ A;  2GLO A;  2DA1 A;  3DCF A;  1IXS B;  1R5H A;  4XLF A;  1I50 J;  2FU4 A;  1KQ8 A;  3ABU A;  3CCV I;  1XCV A;  4HYE A;  4KA4 A;  3BG5 A;  3OYE A;  2DMT A;  3SDB A;  1N77 A;  2JA6 J;  1MZB A;  4ZC3 A;  4PJ0 C;  3FBN B;  2PBI A;  4BL0 B;  3JSP A;  1H9G A;  4BEH A;  1ACI A;  3F8F A;  3HOV J;  3WG9 A;  2DMN A;  3S93 A;  1JGG A;  1ONV A;  5AIP A;  3BTL A;  1NG7 A;  4BQA A;  2QM3 A;  3R6S A;  2PJR A;  5F1J A;  4OIR F;  1P4A A;  5DS9 A;  1S7O A;  5E1Z B;  1BOB A;  2DA3 A;  4D7N A;  1USS A;  4L5I A;  2GAU A;  2VJ5 A;  2PJR B;  4GO1 A;  2V1U A;  3ZRG A;  1R23 A;  3GTG J;  4B3A A;  1RIO H;  1ZH5 A;  2IJL A;  4P55 A;  1MH4 A;  2HYG D;  4WWC A;  4BH9 A;  1J7K A;  1WVR A;  2RNG A;  4AC0 A;  4LK1 F;  1H0M A;  5EF6 A;  3FKJ A;  2FNA A;  4BHB A;  2LC2 A;  1FJL A;  4UVC A;  1VQ8 I;  4UXN A;  4IHV A;  2DA7 A;  2QYO A;  1MBG A;  2XHK A;  1K6O A;  3MZ8 A;  3ERE D;  1BIB A;  4I99 C;  1U5T A;  4DJA A;  5D5W B;  3J7A Y;  1XMX A;  5DCM B;  1HST A;  1T08 B;  3TMO A;  3CTA A;  2BHZ A;  3LSP A;  4BEH B;  2EBI A;  1RES A;  1JJ6 C;  2EV0 A;  1SD6 A;  5ICF A;  2DN0 A;  3NQO A;  2CQQ A;  1HOM A;  2VKV A;  1A6I A;  3BQZ A;  4HF1 A;  2QCO A;  4RAY A;  3WTV C;  1QPM A;  2QVO A;  5E8I A;  3FMS A;  4Y52 J;  1ON2 A;  2Y48 A;  1JI8 A;  4JX4 A;  3HZJ A;  5HS9 A;  2P7V B;  3I9V 2;  2NOJ B;  2MFZ A;  4EQQ A;  2LK2 A;  5JLX A;  4MTE A;  3T1B A;  1PUF A;  3IRR A;  1YG2 A;  2WAD A;  2RN7 A;  1MJB A;  2QKM B;  3EUA A;  1JJ8 C;  2CQN A;  4A3E J;  1VZ0 A;  2FBI A;  4FAS D;  1EA3 A;  4CCL A;  4XLN F;  2VE8 A;  3DV8 A;  1ETQ A;  3EQL F;  3IP4 B;  3K7A J;  4KIG A;  5EEA A;  3TW7 A;  4AD9 A;  3JTG A;  4IKF A;  2EPF A;  4EJV A;  3DKX A;  4M9Z A;  3RKX A;  5ERI A;  3ZCO A;  4A93 J;  4M3E A;  2A61 A;  2XAQ A;  1QVT A;  1PVE A;  2R5Y A;  3KET A;  3H0D A;  1E3O C;  1O3R A;  2DPU A;  2PMZ N;  3FHN A;  4XLC A;  1X4P A;  4E7K A;  3IKV A;  1EH7 A;  1X1D A;  2PEX A;  4YFX F;  2XB5 A;  2O9L A;  3K2A A;  4A0Y A;  4LD5 A;  2OU2 A;  3BCA A;  3NAR A;  3SHF A;  2EZK A;  3GW2 A;  1NK3 P;  5J4Y A;  5L3D A;  4HRI A;  1W4M A;  3MVP A;  1LKX A;  2O03 A;  2CO5 A;  2KJC A;  3H3Z A;  3CCY A;  2AS5 F;  1X1B A;  3CLQ A;  3BP8 A;  1IRG A;  2LNB A;  3W3C A;  1MBE A;  4WXH A;  3ZP5 A;  2EA2 A;  6PAX A;  3O3K A;  3J80 K;  5HLI A;  1UFM A;  3OYL A;  2HQA A;  3CO6 C;  4F55 A;  1YW7 A;  4R79 A;  3OIQ A;  1AOY A;  5FKM A;  1FP2 A;  4Z6Y A;  3KP7 A;  3FMQ A;  1JXS A;  2M4G A;  3L2Q A;  4JYK A;  5C4J J;  4J00 A;  1MJA A;  2JT1 A;  3H9J A;  2W25 A;  2ZJ2 A;  4WXC A;  2M5W A;  1V3F A;  2V9V A;  4CCN A;  1OCT C;  2JPB A;  3ZQI A;  1SAX A;  1W7P A;  2QUF A;  4I6Z A;  4OAY A;  1Y39 A;  3J81 Z;  4CCK A;  2CW0 F;  2XRO A;  4ZTJ A;  3QU6 A;  1Y6I A;  3J7Z I;  5DCM A;  4L9V A;  4G8X A;  1RKW A;  2YR2 A;  4P9U A;  3ERM A;  2L9R A;  1XGO A;  2TCT A;  1MNE A;  4L9J A;  3AAF A;  2BGC A;  1HF0 A;  3GWZ A;  4GFB A;  5GAG J;  4MEX F;  1TZL A;  4U87 A;  2E1C A;  2WY7 Q;  3P5J A;  1U3E M;  2ZNY A;  2DFI A;  2HPM A;  2R7U A;  4XOP A;  4HF2 A;  2L9S A;  1PDN C;  3SFZ A;  2QBY B;  1ZHF A;  3L9F A;  5JFR A;  1K7A A;  5IT9 K;  2HXO A;  2JMW A;  4MHG A;  3KEQ A;  3LSR A;  4JX5 A;  4DBR A;  2ZJR F;  4ZZL A;  3I4N J;  3BJA A;  4Y17 A;  3PJR A;  4IHW A;  3DEE A;  3GCM A;  5IT9 Z;  2E1M B;  1MD0 A;  1GT0 C;  2L4A A;  4ENN A;  2YX4 A;  2M30 A;  2DMU A;  1QHH D;  2ZSI B;  2M7B A;  3RI4 A;  5HDN A;  2LBF A;  2LBF B;  2DW4 A;  3JW4 A;  5CVU A;  1WI9 A;  1P2F A;  2OF7 A;  4LK0 F;  1R4N B;  4GDF A;  1FWZ A;  3LAJ A;  2IS2 A;  2K9N A;  1OIS A;  2PLY A;  1G4D A;  4R8H A;  3RYP A;  3S17 J;  2HVR A;  1JTX A;  2BY3 A;  1XPX A;  1YHQ I;  3UKG A;  1OCR H;  1MBH A;  1ZK8 A;  2AXL A;  4HQM A;  3HSR A;  1I3Q J;  1MW7 A;  3P9K A;  3G6E I;  3G2B A;  4NQW A;  2A07 F;  3BG9 A;  2Y0S A;  2EJR A;  1BJZ A;  3QOD A;  4HNU A;  2IS4 A;  2VJJ A;  2Z1D A;  2RGV A;  3CCE I;  3BR3 A;  1FIP A;  5J4V A;  1QU3 A;  3HXL A;  3S16 J;  4ZTF A;  3DBL B;  5LD2 C;  2H8R A;  1VQ6 I;  1Y0U A;  4NDL A;  5ICE A;  2X6W A;  3HBL A;  2VKH A;  2V1D A;  2M8G X;  2XPU A;  3BZC A;  3D1N I;  3G73 A;  1STZ A;  3DEU A;  3IC7 A;  4OIP F;  4J01 A;  1U2W A;  2MD5 A;  3LSJ A;  3F8N A;  2MLG A;  2NVQ J;  1P7I A;  3E6B A;  3DLA A;  4KIC A;  3VB2 A;  2ZXI A;  2X51 A;  4ZYD A;  3OOU A;  1DP7 P;  4BJ5 C;  3WTU C;  4DQ2 A;  2GZW A;  1I3A A;  2M8E A;  3JCU C;  3TO6 A;  4CDG A;  2CUZ A;  4DBQ A;  1O3S A;  3P7N A;  1VTN C;  1TL8 A;  3AL0 B;  2E34 A;  1QQI A;  4BYY A;  1UB9 A;  3BG7 A;  1YE9 A;  4GYG A;  3CCM I;  2Y9Y A;  3T8R A;  2QSG X;  4IHY A;  5F0H A;  1FX7 A;  1RET A;  2A5W A;  1JHF A;  2XGC A;  1OJL A;  3KEY A;  1KU7 A;  1GVJ A;  4HV6 A;  4RMN A;  4IJA A;  4RM2 A;  4XIC A;  4XLP F;  3RSN A;  4ZJZ A;  3H5R A;  3W2A A;  4YII A;  2VC0 A;  1O57 A;  2BY2 A;  4RB2 C;  4NHJ A;  4IRG A;  1FT9 A;  2LOO A;  1HW1 A;  5LEJ A;  3LWF A;  4ZYA A;  1EJ9 A;  2VUM J;  2M2E A;  4KIT B;  1IJW C;  1P4X A;  3R0A A;  1T95 A;  2W84 A;  3K70 D;  5FJ8 J;  1E0E A;  3GLL A;  1BR2 A;  1E3H A;  4BQN A;  1G3T A;  3HIF A;  3CDH A;  2MA3 A;  2ZME C;  5J1R A;  2FBH A;  1LDJ A;  2E5Z A;  2OD5 A;  1JUS A;  2JTV A;  2R7T A;  4P96 A;  3ASN H;  3V7R A;  2IGO A;  5CVV A;  2AO9 A;  2XUB A;  5K5Q A;  3OYB A;  4KT5 C;  4HW0 A;  2W1O A;  3FXK A;  3KP4 A;  4UUT A;  3UNG C;  4BQO A;  1IN7 A;  5LRR A;  5ICG A;  2QGU A;  2Z9O A;  3OSF A;  3HOW J;  1T0F C;  5DCF A;  1WJA A;  2E36 A;  4HX8 A;  4DW6 A;  1Z7L A;  4AU7 A;  2D1V A;  3KLO A;  5K7Z A;  4LLN A;  3TQN A;  3JRE A;  2F5C A;  3DTI A;  5E1W A;  3S2H J;  2LRE A;  2G0E A;  1J0R A;  2BW3 B;  4ZZD A;  3L2C A;  1V5E A;  3OYK A;  5FRM A;  3QOP A;  3G71 I;  2FQ4 A;  2MH2 A;  9ANT A;  2X1E A;  3DWL E;  3S8P A;  2XAJ A;  4YG2 F;  2CV2 A;  3CME I;  5FLX K;  2EFN A;  1MBJ A;  2X1C A;  1F9N A;  5F27 A;  4M3D A;  1JKP C;  2LR8 A;  2H09 A;  3I55 I;  3F22 A;  4ESJ A;  3BR2 A;  4A0X A;  2F5D A;  1X19 A;  2KDO A;  2B9S A;  2LSO A;  3R4K A;  1LUJ B;  4AWX B;  2KHM A;  2PMZ A;  1VQ9 I;  2LP0 A;  3A1Y A;  2O8X A;  2EZH A;  2NAZ A;  2EFQ A;  3ABM H;  3X2Q H;  1D0X A;  3ZMS A;  1ZGW A;  1OR7 A;  3BRO A;  3CC4 I;  2R93 J;  3S1Q J;  3MKY B;  3DFG A;  2CFX A;  3PUB A;  5C3E J;  3HKZ A;  3KP3 A;  2R4G A;  4UVA A;  2CW8 A;  5KVR A;  2PG4 A;  4HG2 A;  3MD2 A;  1Z91 A;  2VXD A;  4UHT A;  2NVT J;  2CV0 A;  4M3B A;  1QPI A;  4U88 A;  4S0H B;  1UG0 A;  1DPR A;  3DBR B;  1HDP A;  3OMY A;  4LGW A;  2PFB A;  3RKY A;  5HS7 A;  5F08 A;  2E1O A;  2PQ8 A;  3GME A;  2A05 A;  3HTU A;  3P9I A;  3GLX A;  3K0L A;  4G94 A;  1T38 A;  1AKH B;  3V7S A;  5LFA A;  3L1P A;  1LEA A;  4HX4 A;  1X58 A;  2DI3 A;  1E17 A;  4AIH A;  1OMI A;  4BJT A; 
#chains in the Genus database with same CATH homology
 1T33 A;  1ETW A;  3M3Y J;  3SFI A;  2CQX A;  3NAU A;  3GTO J;  3JRC A;  1PUF B;  2R5Z B;  3DEW A;  2FX0 A;  5IPA A;  2EQR A;  4QTR A;  3JRH A;  2GLO A;  2DA1 A;  2XRL A;  3DCF A;  3CMY A;  3S1N J;  3HEF A;  2FJ1 A;  1I50 J;  3BQY A;  2O8K A;  3BG5 A;  4X1E A;  1MH3 A;  2DMT A;  3BR0 A;  2JA6 J;  1GUU A;  4DZJ A;  3FKI J;  1I6H J;  1WH7 A;  3Q0U A;  4D5F A;  3HOV J;  2DMN A;  2O7O A;  2L7F P;  4A3B J;  3BT9 A;  5FKO A;  1JGG A;  4C2M J;  2H1K A;  1RR7 A;  3BTL A;  2M9H A;  2DJN A;  2Y9Z A;  2HDD A;  1W0T A;  5F1J A;  4JP0 A;  1VND A;  3H3V K;  1ZKG A;  4FE4 A;  5DS9 A;  5E3O A;  2DA3 A;  4D7N A;  3ZOB A;  2YU9 J;  2R5Z A;  1G2H A;  3GTG J;  4B3A A;  2COB A;  1JT6 A;  4L5E A;  3RZO J;  1WCM J;  1MH4 A;  1UMQ A;  1O4X A;  1Z0X A;  4AC0 A;  4W1U A;  3G1L A;  5EF6 A;  2L0K A;  3RZD J;  3BR5 A;  3FIW A;  1FJL A;  5J1Y A;  1GV2 A;  1H8A C;  1U8B A;  2DA7 A;  4IHV A;  1EF4 A;  4UUS B;  1MBG A;  3RQI A;  2ID3 A;  1XG1 A;  3W6V A;  4M6V A;  5F0C A;  5J3L A;  5FLV A;  3LSP A;  2EBI A;  1RES A;  2GBY A;  5IP6 A;  1JJ6 C;  2E2H J;  2DN0 A;  2CQQ A;  1HOM A;  2VKV A;  1A6I A;  3BQZ A;  5GPA A;  2QCO A;  2CRG A;  4UUS A;  2E2J J;  2FD5 A;  4XRS A;  1AKH A;  2JA8 J;  5EG0 B;  4Y52 J;  3ZQL A;  2DMQ A;  4JX4 A;  3WHC A;  4EEF G;  5IP7 J;  5JLW A;  2B63 J;  1Z77 A;  2R92 J;  2CJJ A;  4V2F A;  3CQZ J;  3MKL A;  2LK2 A;  5JLX A;  1PUF A;  1HDD C;  2Y0S N;  4FE7 A;  5F04 A;  4A3G J;  1A5J A;  5IYB J;  2MG4 A;  4D7M A;  3RKQ A;  1JJ8 C;  3IH3 A;  1B8I B;  4A3E J;  1TWH J;  5GPC A;  2R7Z J;  4B1R A;  2LVS A;  1NK2 P;  1ETQ A;  1ZTR A;  3K7A J;  5EEA A;  3TW7 A;  3JRD A;  2X9D A;  2MSY A;  1K83 J;  2EZI A;  2M0C A;  1YRN A;  5DTD A;  5M5X J;  2XPV A;  2D5V A;  4A93 J;  4M3E A;  1QVT A;  2R5Y A;  1E3O C;  2PMZ N;  1QRY A;  3MN2 A;  2ZB9 A;  2KT0 A;  1AHD P;  3FK7 A;  1IGN A;  2VI6 A;  2XB5 A;  4DZP A;  1HLV A;  2O9L A;  4XK4 A;  3K2A A;  1DU0 A;  1LFU P;  3HGY A;  2CU7 A;  2HXI A;  3NAR A;  2LTP A;  3BG3 A;  3BTC A;  2R5Y B;  2EZK A;  1NK3 P;  3S14 J;  3HB9 A;  4A3J J;  4V2G A;  5EZG A;  2HOT A;  3MVP A;  3LSG A;  5M5W J;  3CCY A;  2NOG A;  2LLK A;  1D5Y A;  4A3L J;  3HM5 A;  3BTI A;  3A03 A;  1MBE A;  1ETO A;  1XS9 A;  1P7J A;  3TP0 A;  4BKX A;  2KDZ A;  2LD5 A;  4IEJ A;  2N8G A;  4RBO A;  2JN6 A;  3JRF A;  1Q1V A;  3F0C A;  3FIS A;  5F0F A;  2DA5 A;  3OIO A;  1APL C;  3CDL A;  3SDG A;  2HQ5 A;  5FKM A;  1XC5 A;  2R0Q C;  4AYB N;  4HNV A;  5K7H A;  5FKL A;  2NS7 A;  3TW6 A;  1BA5 A;  1JKR C;  2HYJ A;  4JYK A;  2MGQ A;  3O8G A;  4MO7 A;  1GV5 A;  5C4J J;  2YS9 A;  1IDY A;  5HOD A;  1RPW A;  1OCT C;  3LOC A;  1F43 A;  3ZQI A;  4QSH A;  4I6Z A;  3HKZ N;  5J1U A;  3GTL J;  3JRB A;  2DA2 A;  3HOZ J;  3M4O J;  1JKQ C;  1RKW A;  4A3F J;  2RAE A;  3TED A;  2L9R A;  2OPT A;  2GM4 A;  2LY9 A;  2TCT A;  4XID A;  3GTP J;  2M34 A;  5IYD J;  1F36 A;  3G1O A;  1HF0 A;  2HOS A;  2DTZ A;  3IV5 A;  4GFB A;  1JTY A;  1OFC X;  2WB1 N;  2X48 A;  3HOU J;  2JK3 A;  3HOY J;  2E2I J;  1ENH A;  5M3M J;  4A3K J;  1FTZ A;  1QVU A;  3QQA A;  1WGX A;  1S7E A;  1WH5 A;  3GBG A;  3PO3 J;  2Y31 A;  2WAQ N;  2ECB A;  3BTJ A;  2IAI A;  2W48 A;  1TC3 C;  1POG A;  2HXO A;  5E3L A;  3HDD A;  2JWT A;  2ELK A;  2JMW A;  2K40 A;  2XGE A;  1IG7 A;  3SJM A;  3LSR A;  4JX5 A;  3O8H A;  5K7F A;  4XRM A;  3I4N J;  4IHW A;  2TRT A;  5IYC J;  4A3C J;  4J19 A;  3HGG A;  1GT0 C;  4BXX J;  5M5Y J;  1TWA J;  1VFC A;  1U9O A;  3BR1 A;  2DMU A;  1MNM C;  3GTJ J;  1IC8 A;  1YRN B;  1GVD A;  3C2B A;  5C44 J;  2OF7 A;  2ME6 A;  2QF7 A;  1TWG J;  2K9N A;  2P81 A;  2I10 A;  1IUF A;  4Y7N J;  1JKO C;  4MLO A;  3S17 J;  2LFB A;  2CUE A;  1JTX A;  3UKG A;  3GTM J;  1MBH A;  1ZK8 A;  5IP9 J;  2K9Q A;  4A3I J;  5FLM J;  1I3Q J;  3JRA A;  4X6A J;  4D5C A;  3A01 B;  5FKK A;  3BG9 A;  3BR6 A;  1BJZ A;  1UHS A;  1RKT A;  4FIS A;  1BW6 A;  3JR9 A;  2XB0 X;  2XGD A;  3OSG A;  3BR3 A;  4CYC B;  5IOY A;  1FIP A;  3E7L A;  3IH4 A;  3S2D J;  3S16 J;  5EG0 A;  2H8R A;  2JA7 J;  1ETV A;  4NDL A;  3JRG A;  1DU6 A;  2VPR A;  4QIW N;  3HBL A;  1U9N A;  1LE8 A;  2M8G X;  2XPU A;  3D1N I;  4C3J J;  5BNG A;  1Y1V J;  2MW8 A;  1W0U A;  3LSJ A;  2NVQ J;  1P7I A;  1UG2 A;  4BY7 J;  1FEX A;  5FKN A;  1LE8 B;  3WHB A;  3OOU A;  4LOC A;  1JUP A;  5E3N A;  2XSD C;  2HOA A;  4DYQ A;  4A3D J;  1ETY A;  1ZR4 A;  2Y9Y A;  1X2N A;  4IHY A;  5F0H A;  1B72 A;  2JA5 J;  2CUF A;  1RET A;  2AHQ A;  1OJL A;  2XGC A;  5EGO A;  4XIC A;  3Q3S A;  1SFO J;  3I4M J;  2XPW A;  4G12 A;  5EZH A;  1MBF A;  3ZQF A;  1H88 C;  1B72 B;  2NVX J;  4M3F A;  4AUX A;  2NS8 A;  3S1M J;  2DA6 A;  1H89 C;  3PO2 J;  3S1R J;  2VUM J;  2X6O A;  3Q0V A;  2M2E A;  3S15 J;  5C4X J;  1IJW C;  3B6A A;  1ETK A;  2LKX A;  2E19 A;  1GDT A;  3IH2 A;  1IRZ A;  1IV6 A;  5FJ8 J;  1MBK A;  4ABZ A;  4IHX A;  1FIA A;  3QPS A;  4DYR A;  5J1R A;  4BBS J;  2HI3 A;  4C3H J;  2ME0 A;  1ORK A;  1JUS A;  1NTC A;  2AO9 A;  3FK6 A;  2IBD A;  1Y1W J;  4XRS G;  4UUT A;  5M3F J;  2NVY J;  3QPL A;  1X2M A;  1FTT A;  3OSF A;  2Y2Z A;  3HOW J;  1T56 A;  3H0G J;  3B6C A;  5EGO B;  4DW6 A;  4BY1 J;  2L7Z A;  1HCR A;  1K61 A;  5E3M A;  5K7Z A;  3JRE A;  4MFD A;  1JUM A;  3S2H J;  2G0E A;  4RDU A;  4C3I J;  1MSF C;  1TWC J;  3LNQ A;  2FQ4 A;  4MIM A;  9ANT A;  1U78 A;  2VKE A;  3Q0W A;  4A69 C;  4M3G A;  2JJ7 A;  5IOZ A;  1MBJ A;  4B4C A;  5F27 A;  1JT0 A;  4M3D A;  1JKP C;  3A02 A;  1R9T J;  2LR8 A;  2DA4 A;  3BR2 A;  2EH3 A;  5GP9 A;  3HOX J;  3ZQC A;  1OCP A;  1VI0 A;  2IEK A;  1IDZ A;  4W97 A;  2LP0 A;  1VF9 A;  1ZR2 A;  2EZH A;  2WV1 A;  2K9S A;  2ECC A;  1ITY A;  3ZQH A;  3JRI A;  2DMP A;  1ZGW A;  3GTK J;  4FCY A;  2R93 J;  1WPK A;  3VPR A;  4BBR J;  4CYC A;  3S1Q J;  5C3E J;  1ZQ3 P;  4I76 A;  1TWF J;  4A3M J;  2Y30 A;  3A01 A;  1LFB A;  3G1M A;  3GTQ J;  1BW5 A;  2YUS A;  5EYR A;  1WI3 A;  1CQT A;  4JX6 A;  2NVT J;  1SAN A;  3TP3 A;  4DYC A;  4M3B A;  1QPI A;  4S0H B;  1ETX A;  4MFE A;  2L7M P;  1HDP A;  1MSE C;  4FTH A;  3ZQG A;  5F08 A;  1AU7 A;  2E1O A;  1AKH B;  2EZL A;  3PM1 A;  5EDN A;  1B8I A;  3L1P A;  2ID6 A;  1BL0 A;  1X58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...