2J5PA

E. coli ftsk gamma domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
70
structure length
70
Chain Sequence
HGAEELDPLFDQAVQFVTEKRKASISGVQRQFRIGYNRAARIIEQMEAQGIVSEQGHNGNREVLAPPPFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Recombination
molecule keywords DNA TRANSLOCASE FTSK
publication title The Ftsk Gamma Domain Directs Oriented DNA Translocation by Interacting with Kops.
pubmed doi rcsb
source organism Escherichia coli
total genus 15
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2006-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09397 FtsK_gamma Ftsk gamma domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2j5pA01
2VE8A 3CTAA 3RIRA 3GUDA 3E6MA 1PUEE 3B73A 3GYHX 4RGSA 5E8IA 3BY6A 1FX7A 5HLHA 5LBQA 1Z05A 4UUVA 4LLLA 2KJBA 1O3QA 2HYGD 2LSOA 4AWXB 2EB7A 3CO6C 3F3XA 1Z6RA 4A12A 2XROA 3BJ6A 2DQLA 1T98A 2OBPA 1VTNC 1U2WA 2XV4S 3DFGA 1J59A 1JHHA 1DP7P 3T1BA 1BC7C 1YW7A 2ZO4A 4DQ2A 4ENNA 1YLFA 1KYZA 3OOPA 2MD5A 1S3JA 2YPRA 4P9FA 4R8HA 5JFRA 1TQIA 1HBXG 2BBYA 4HDUA 1T6SA 5E18F 2FEZA 5K5RA 2FNAA 1IN7A 5KVRA 3HUGA 2KIFA 5IT9Z 1A04A 5DYMA 3DPLC 4LG0B 5K1YA 3MZHA 4LK0F 2EV6A 1L3LA 1BI3A 3HRMA 1KU9A 3R61A 1U5TC 4OU0A 2VODA 2P7VB 3SHFA 3HSRA 3WTUC 3JTGA 3BJAA 4EJVA 2IRFG 2Z3YA 2Y0MA 2DAOA 4RGRA 2LDUA 4XSZF 3HHHA 5L3DA 2W84A 3WG9A 4BHPA 4UNOA 4G7HF 4A0ZA 2VBZA 2VXZA 1XMAA 1PDNC 1WRJA 4RB0A 4U0YA 2ISZA 2LF8A 1U5TB 4MTEA 5CLSA 4ZYHA 4ENMA 4AIJA 4HZFA 4UV9A 2DT5A 4UVCA 1I27A 1YW9A 1IN6A 5A2QZ 3WE2A 1V3FA 2XKOA 1HXDA 4ETSA 3BPXA 1E2XA 1UB9A 3ABTA 5FLXZ 3WE3A 1FBUA 3R0JA 3RYRA 3M1EA 3VFZA 1F4KA 2DO7A 3ZPLA 2X0LA 4LB6B 1UHWA 6PAXA 3DPTA 4HDVA 5L3CA 5H6RA 3AAFA 1MDMA 4YFKF 1QZZA 2OA4A 3T0YA 4R1HA 3WGGA 2FA5A 4A6EA 2PLYA 2IA0A 3ELKA 3E5UA 5LEJA 4QLCU 4L5JA 2Q0OA 4EJWA 3MWMA 1O7LA 4Q48A 5F6FA 4OOIA 3RKWA 1CF7A 2PEXA 3LFKA 3Q9VA 2M8EA 3KLOA 4EJTA 1ONVA 5HDNA 5E1ZB 2EFOA 2Y75A 1YYVA 1LEAA 1XSVA 3WTSC 2NS0A 1WI9A 5ICGA 1JHFA 1MKMA 1QZYA 1ZN2A 3DXJF 2EFPA 3MEXA 3BROA 2FF4A 2OD5A 4IJAA 4G6QA 4WXCA 4KNYA 2Z33A 2QBYB 3RYPA 1B59A 5D4RA 2IPQX 2PG4A 1SD5A 3ZN1A 1PP7U 2YR2A 4N9IA 1FBQA 3JAMK 3L00A 1HKQA 1Z7UA 3Q9SA 1XSDA 4KMFA 4PGHA 2EV0A 2V1UA 3V8LA 2V1XA 2AS5F 1OMIA 4HA8A 4FX0A 1U78A 4NQWA 3BJOA 3QU3A 1R36A 5CVIA 3GO5A 2RQPA 4G94A 4EGZA 5LGNA 2CYYA 4IPAA 1ZARA 4K2EA 1YS7A 1ZREA 2CSOA 1IUYA 1T2KA 4Y13A 1S7OA 1ZRCA 2GXGA 2QQBA 1KGSA 1H0MA 2VOOA 2W25A 2A6EF 3BOQA 2XVCA 2H6CA 2P6TA 1IN4A 3VB2A 4AIKA 1ZGJA 5ICEA 3RKXA 4HV5A 2MH2A 2P6SA 4OIOF 4CYDA 4G8XA 2QZ8A 1XCVA 1MD0A 2UXNA 2LNBA 1LDDA 4RGXA 3WTYC 2ZJ2A 1SD4A 2F5DA 4L9VA 3SZTA 2QYOA 3LA3A 2A5YB 2R3SA 2JPCA 2O03A 3WTXC 2Q8KA 2QENA 2HOEA 2H94A 4I2OA 1GHCA 2EJRA 5D5VB 3U2RA 5LEKA 3WTWC 1O57A 1HW2A 4FT8A 5J8CA 2Y48A 1U5TA 2E1CA 1BI0A 2FNPA 1FBSA 4OIRF 4MTDA 1H9TA 5LGUA 4LB5A 2VBXA 4BAYA 3FHZA 1QGPA 5CJ9A 2WC2A 2IA2A 4BNCA 3WGHA 3I54A 1LNWA 1R22A 2BYVE 2FQ3A 3WTVC 1IAWA 3S2WA 2RC4A 3CLOA 4HW0A 2CO5A 2M30A 3ZN0A 2QWWA 4CGZA 2O61A 4PDKA 3J80K 1ZLJA 2P7CB 1O7FA 3HHGA 3R4KA 3KZZA 3C18A 5FD6A 4CDGA 1SMTA 2KRFA 5AIPA 2FBIA 2HFHA 3C1DA 4WWCA 1HW5A 2KIUA 2A61A 4ZZLA 1NHAA 5E20A 5DD4A 1D5VA 3FMSA 2YSRA 3HOTA 1MDMB 2YX7A 3GW2A 2RV8A 5D8LB 3F21A 1O3SA 4I02A 2DW4A 1H9GA 3RI4A 1Z1DA 3O6BB 5H20A 2TDXA 2O0YA 3D0SA 4GYGA 4UVBA 2EFQA 3K9TA 3IL2A 2RNJA 1YFHA 2DK8A 4RAYA 3KP5A 4GGGA 3LA2A 4UVAA 3J81K 1O3TA 4BH9A 2QBYA 3ERED 3FMQA 1D8JA 4LGWA 2V1DA 3GWZA 2VE9A 3E97A 4KN4X 2MLGA 3E5XA 1KA8A 3E5QA 5DEQA 3FMRA 1QQIA 3E3VA 4ZYGA 3OV8A 4G6DA 2JZYA 1CGPA 3FWEA 1R5HA 1RUOA 2L3DA 2LF7A 4HAMA 4NHJA 4IRHA 2IP2A 2ACJA 1OPCA 4WCGA 5D6EA 4Q5SF 3IC7A 1J7KA 3LAJA 3IHUA 1BI1A 2DBBA 4BHBA 4O5VA 4LD5A 2D45A 2LKPA 4FHTA 5K5OA 2RDPA 3K69A 2EA2A 3T8RA 4L0ZB 2P5KA 4L9JA 3ZQ7A 3KFWX 4EGYA 1FP2A 3VOEA 4HX7A 1MJAA 1RZ4A 3GZ6A 5BOXA 2HEOA 1ON1A 2ISYA 1YTYA 3CJNA 1YW8A 2XRNA 4ASNA 2OZ6A 1HQCA 3BPVA 1HKTA 1T39A 5HLIA 2CG4A 2XGXA 4ZH4F 3WGIA 3L09A 4AIHA 1IXRC 4MGRA 1J2XA 1B9MA 2BEOA 3L2CA 4EM0B 2R7FA 2L54A 1E17A 2ETHA 2K4BA 2F2EA 2GWRA 1ZRDA 5D5UB 2ZKZA 4PZJA 2O3FA 1BBYA 5DV5A 4EMSA 5DUIA 2A68F 1YG2A 4EQQA 1BM9A 3LAPA 1R7JA 3I59A 2HKXA 1LQ1A 5DCFA 4OMZA 5E17F 1HSTA 4YG2F 3R6SA 1TNTA 4I0AA 1YQAA 3U9GA 5D8KB 1K7AA 2VN2A 3ZP5A 4IXAA 3JSPA 2NNYA 4LJZF 3IKVA 1FWZA 1Z91A 5K5QA 1K79A 1U6GA 4PCQA 1FT9A 3F22A 1IRGA 2D2WA 3TO6A 2ZCWA 5HDKA 2ZFWA 3MCZA 1U3EM 4M9XA 1ZAOA 3I58A 3F8FA 4CXFA 3P9CA 2C6YA 3T8TA 3M9AA 4RGUA 5JR3A 5E1XA 4L5IA 1GXQA 4D0PA 1EH6A 4KDPA 2XASA 4A5MA 2V79A 2STTA 1AOYA 3F6VA 1LDJA 1RUNA 3CUOA 5D5XB 4CO8A 3DQVC 2XAJA 3FX3A 3GFJA 1XGMA 3IWFA 1R1TA 2RVCA 2MBFA 1G3WA 2VBWA 2IVMA 4YIIA 2HGCA 4ESFA 3JAMZ 4ESJA 5LHHA 3P9KA 1FSEA 2MA3A 2EWNA 1X3UA 2FSWA 4BHCA 4ENKA 2JPBA 3KEOA 1J5YA 2BV6A 2L01A 1HW1A 5EEGA 3TO7A 2HR3A 4HYEA 5D6FA 5DDGA 3MFKA 4XBFA 1U8RA 1FSHA 2D1VA 3K1MA 2A69F 2CWEA 3K0LA 3E6CC 3I71A 3E6BA 1B9NA 1P92A 2GIVA 3N97A 3WTTC 4OIQF 5J8FA 4HQEA 4M74A 2JRTA 4MEXF 1QPMA 4O6JA 2OU2A 1XB4A 4M6YA 5CVVA 1XDUA 4U0VA 4MEYF 2Q2EA 3I4PA 3M8FA 3SFZA 5LLQA 2WWYA 3F72A 4QWQA 4JQFA 4NB5A 3V4GA 1UCRA 1V4RA 3V7RA 3FM3A 3EQLF 1DDNA 1TQPA 1W5TA 2HDCA 3CO7C 2F5EA 1BOAA 5HVQC 1USTA 1K78B 1RIOH 1TW2A 4GXOA 1XSXA 1EV7A 1YS6A 2RN7A 1F9NA 4P5OA 4GO1A 2PMUA 3F8MA 1SFXA 2K27A 2IT0A 3NEUA 3GXOA 1WKMA 2A6HF 4ON0A 2K7LA 5JHUA 1IN8A 1YO5C 2QLZA 5ICCA 1WQ2A 4MQVA 4L0YB 1XGNA 4S05A 3GFLA 2HTJA 3HTUA 1R1UA 3DEUA 3CDHA 2CQKA 2GA2A 4FX4A 2EV5A 2FMLA 4HQMA 1FZPB 4IRIA 2W57A 2M45A 4UV8A 4IF4A 4KIFA 1TBXA 5CVUA 3WTZA 4LLNA 2DPUA 4M9SA 4A2UA 5L3FA 4HF0A 4BQAA 1SD7A 1ULYA 3QAHA 1JXSA 3FZVA 2UWMA 3LQRA 3EDPA 5J6XA 1FY7A 1KQ8A 1W7PB 3GFIA 3O2PE 1ZYRF 1DUXC 2L4AA 1R00A 5F64A 2EA4A 1ON2A 5DUKA 3J80Z 4RAZA 2K86A 4AVPA 2IW5A 3WU0A 2Z9OA 1DPUA 5HOOA 5ICFA 5L3BA 4UXNA 2QM3A 2PFBA 4LMYA 1TW3A 1L0OC 3I59B 4N0BA 3V8KA 3C3WA 3N4MA 5BPIA 1OKRA 2GZWA 3REOA 1G4DA 2V9VA 4YFNF 3K1PA 2JTVA 3IKTA 4YFXF 3CUQC 2XAGA 2VT2A 4U88A 4EJOA 3ZMVA 4KN7X 1QBJA 1REPC 3HRSA 2FBKA 2DQRA 1RI7A 3RPUA 3KP6A 3WU1B 4F7ZA 4L18B 1HSJA 2STWA 3KEQA 1LVAA 1T38A 1J9IA 3J81Z 2FMYA 4KICA 4DNCA 4BXUA 1C0WA 3GX4X 5JI6A 2KKOA 4KT5C 4EM1A 5L3EA 1ZG3A 2Z5UA 4I7HA 3F8CA 2NYXA 3HTSB 3P9IA 2VT3A 2FBHA 2ZBKA 3QRFF 3K1NA 5HS7A 2FOKA 2GAUA 1TLHB 1IN5A 2EFWA 2PJPA 3VODA 5E8GA 1OYWA 3EETA 5ERIA 1G3TA 2M5WA 1SMYF 1W5SA 4HV6A 2P8TA 2KJCA 2J5OA 3MAJA 3KETA 1J0RA 4HF1A 4XLPF 2HTSA 3KP4A 4KFCA 4RB3C 3TQNA 5FB2A 1WSUA 3FXUA 4E70A 2ZNZA 2B0LA 5CVRA 2PBIA 2JT1A 4I09A 2MH9A 4I98B 2WV0A 4M73A 3KP7A 2O6GE 3DP7A 3W6JB 3F23A 1S7AA 5HS8A 4HX8A 1K78A 2P5VA 2ADUA 2PQ8A 2DK5A 4ZYDA 3JSOA 3P7NA 3IWZA 4XLNF 3TO9A 4A0XA 2HKOA 3GVAA 5LRRA 3H3ZA 2HZTA 3SXYA 3KLNA 4ENJA 2G9WA 1W7PD 2GA1A 1JGSA 3EUHA 3RDIA 1MJ9A 2X4HA 1G3SA 3BZ6A 1HKSA 2Z99A 3KP2A 3T5XA 3R60A 1IF1A 3MZYA 3ABUA 2NAZA 3W6KB 3GZ5A 1Z9CA 2DFIA 1IRFA 1FP1D 1S6LA 2EK5A 4IHTA 5D4SA 5EEHA 4CZZA 4JBAA 3HYIA 1I1SA 3I64A 2NNNA 1P2FA 2BGCA 4RB2C 3COAC 2HWVA 4Y15A 1JE8A 5HLGA 3ZMSA 2W24A 3BP8A 3LA7A 3ZMDA 1W7PA 4A5NA 2QVOA 2XAQA 3IRRA 1FOKA 3RJPA 2XKPA 2GXBA 2VOPA 3J7AO 5DCMB 1IZ1A 1OYYA 1I5ZA 2IJLA 2DI3A 4WX9A 2PI0A 3H3UA 3M8EA 1P4XA 1J75A 3DF8A 4U0WA 2HQRA 1B4AA 4HF2A 3TOAA 3FXRA 4YIFA 4R79A 3LWFA 3TKYA 2ZXJA 4L9NA 1XCBA 4A6DA 3F6OA 4OINF 3GLXA 5LHIA 4HOBA 1SFUA 3HSFA 2BE5F 1KU7A 1ZG1A 4P55A 4Q47A 3FXQA 3ECOA 3TOBA 1XGSA 1ZGAA 3C7JA 1LEBA 4PGGA 4IRGA 5FD5A 3QU6A 5L3GA 3V8JA 3ISPA 1TQMA 1I6XA 2VONA 5FFXA 2GQQA 4G7ZF 1GXPA 1XGOA 4RS8A 2G7UA 4L9TA 1R5GA 1S8NA 2K4JA 1MZBA 3HRTA 4KUMA 5LGTA 2YU3A 5IT9K 2ELHA 4I01A 3BDDA 4CICA 3CUQA 5JVTA 1R1VA 1BJAA 2F5FA 1SAXA 2K02A 3LSTA 1D3YA 2H09A 3NQOA 4KMUX 5CYVA 4HLYA 4GYIA 3GEZA 2PN6A 2NRAC 3KZYA 5HDGA 3H92A 4A0YA 1R58A 3EYYA 2DTRA 4H0EA 1PP8F 1D8KA 5F1RA 4MQ9F 1SFEA 2G7HA 2KIMA 4LFUA 5ILUA 4ESBA 3ZMZA 4Z2YA 2M87A 3KE2A 4AD9A 3FM5A 4UHTA 2L02A 4Q4ZF 3SZPA 4EM2A 5FFZA 5DD8A 2OQGA 1S29A 1MJBA 2IA1A 5A2QK 1XN7A 1K6OA 2ZMEB 2R7DA 1SD6A 1B1BA 1KYWA 4EV0A 3RPQA 2RGVA 1WWXA 3KCCA 3QPTA 3GFMA 5FLXK 3PQJA 3ZMUA 1Q1HA 3SQNA 4I0BA 1TNSA 3B02A 5H6QA 5HS9A 3IRQA 2CFXA 2HQNA 2P4WA 3U1DA 2VC1A 4U7BA 4Y17A 3RTRA 1FYKA 2FU4A 3E6DA 1UHMA 4ZYEA 4MHGA 4XSXF 2F5CA 1T0FA 4LK1F 2ESHA 1KQ0A 5CVJA 2QQAA 2FE3A 3R0AA 3F8BA 2O8XA 4GCVA 1ZRFA 3DKWA 1XD7A 3MQ0A 5FGMA 1AWCA 1LDKB 2W85A 3L9FA 2WTEA 2M1BA 3HIFA 4HLXA 4KYWA 5BS6A 2H6BA 1DPRA 2OZUA 2YX4A 3F8NA 3L7WA 1G6NA 4S04A 5KK1A 1Z6TA 4P96A 2PMHA 4M71A 4KIGA 3Q5FA 2E7XA 3I0TA 4BYYA 3BWGA 2A3SA 4ZZDA 2RKHA 2UZKA 4LLGF 3TDZC 1FYLA 3RKYA 1MGTA 5DCMA 3ZMTA 2VBYA 1R23A 2L4MA 1ZLKA 1BIAA 3KP3A 4G9YA 1QNTA 4LG0A 2VC0A 3V7CA 2ESNA 3HRUA 2XHKA 1YIOA 4EVIA 3I53A 4M9ZA 2XAFA 3ROUA 4WK8F 3K2ZA 1ZG5A 4B09A 1GVJA 1W4MA 1G3YA 5D5WB 1XDSA 4MNUA 2HYFA 1IXCA 5ILSA 2XAHA 1ODDA 4OMYA 1FLIA 4G7OF 4TV7A 1F5TA 2ZNYA 4M6XA 1KQ9A 1Y0UA 3EYIA 2MC3A 3LQQA 5ILVA 2UXXA 4WXDA 1QO0D 2CW0F 1BN5A 1RNLA 2MLKA 4N9HA 3PFIA 4IHSA 4XRFA 5E1WA 1ZH5A 1FPQA 1LJ9A 4KA4A 4HBLA 2CGPA 2COMA 1TTYA 5AIQA 3G73A 1F1ZA 1KU2A 5ED4A 2QQ9A 3ML6A 4KIBA 5AONA 2QUFA 3QP6A 5BPDA 1XMKA 2FXAA 1FC3A 2E7WA 3NRVA 5TJJA 1BIBA 3WODF 2DPDA 2XUBA 1ZHFA 1IW7F 2D1HA 1P6RA 3CUQB 2XIGA 3ECHA 2H27A 1O3RA 5LRSA 2V6CA 1KU3A 4RB1A 3O3KA 4JK1X 4P9UA 1OYIA 3HSEA 4IVNA 4EJUA 2JSCA 3VEPA 4WXHA 1IXSB 3QOPA 4CHUA 5IT3A 2ZMEA 5BQTA 1UFMA 1STZA 3JW4A 1P4AA 1OR7A 4OIPF 4M72A 1FNNA 3PQKA 3V7SA 4HX4A 2OAZA 4WF2A 5LHGA 1EH8A 2A07F 2DU9A 2P5LC 3JTHA 3TDUC 3D5LA 1P4WA 1LB2A 1CF7B 2EFNA 2FRHA 5FO5A 3GF2A 2AXLA 3DV8A 4U7DA 3ULQB 1I1GA 3G3ZA 3M7GA 3QP5A 1USSA 4O3MA 3I5UA 3HOSA 3FF5A 2DLLA 3TGNA 2J5PA 3QPHA 4B8XA 5BMZA 5TRDA 1B6AA 2HS5A 1BI2A 1EH7A 2OQRA 1FYMA 2E1NA 1BC8C
chains in the Genus database with same CATH superfamily
2VE8A 3KYDB 3CTAA 5E3OA 2KRCA 3RIRA 3S17J 1VQ7I 3GUDA 2DA1A 3E6MA 1PUEE 4IEJA 3B73A 3QPSA 2X1EA 1NK2P 3GYHX 4RGSA 1MH3A 4IO9F 2X6XA 5E8IA 3BY6A 3HOWJ 1FX7A 5HLHA 3PFYA 4RLFA 3ZR8X 4ZDOA 5LBQA 1Z05A 2BY3A 5FKMA 4UUVA 4LLLA 1MMDA 2KJBA 1PJRA 2CFOA 1O3QA 2DMUA 1T33A 1UELB 2HYGD 2LSOA 3AG3H 3PIOF 5FKLA 4AWXB 1G59A 2EB7A 3CO6C 5J40A 2VKEA 3F3XA 1Z6RA 2ZXIA 4A12A 1XG1A 1WI3A 2XROA 4BEHA 3BJ6A 2DQLA 2K9MA 2E2JJ 1T98A 2OBPA 2V9PA 3BQZA 2R7UA 1SVOA 1VTNC 1VI0A 1U2WA 1WPKA 2XV4S 5EGOB 1F43A 3ABMH 2VKDA 4D5FA 3DFGA 4NQWB 1IDYA 1J59A 1JHHA 1YX3A 1DP7P 2R5ZB 2VASA 3T1BA 1BC7C 1SVMA 1YW7A 4NUBA 2Q1ZB 2ZO4A 2AXTC 4DQ2A 3JRAA 3WG7H 4ENNA 1WGXA 1P7IA 4AUXA 1YLFA 1KYZA 3C2HA 1BOBA 3DBHB 3OOPA 3CDLA 2MD5A 2DT6A 1APLC 4RAGA 4B4CA 1S3JA 2YPRA 4P9FA 4R8HA 4XLHA 4PJNA 5JFRA 1TQIA 3OYFA 2NVXJ 2ZXWH 1HBXG 2BBYA 1CQTA 4HDUA 1T6SA 2JA6J 1I50J 1AA7A 2B7EA 5E18F 2FEZA 5FKNA 5B66C 5K5RA 2FNAA 1IN7A 5KVRA 2E71A 3HUGA 1LFUP 3CJRB 2K3PA 2KIFA 2X48A 4C2TA 4IKFA 3CMMA 1A04A 1XC5A 5IT9Z 5DYMA 2QF7A 3DPLC 2LRDA 4LG0B 2VUMJ 4JYKA 2JA2A 4XKCA 3GTJJ 4BBRJ 1OCCH 3BTIA 3S8PA 3CESA 5K1YA 2L7KA 3MZHA 2ZB9A 2CV1A 4LK0F 5FLVA 2K9SA 2EV6A 2R92J 1L3LA 1BI3A 3HRMA 4BBSJ 4J19A 1KU9A 3R61A 1U5TC 4OU0A 2VODA 2P7VB 3SHFA 3HSRA 5F1JA 3WTUC 1MNDA 3CJQB 3JTGA 4BE0A 1MBEA 5M5XJ 1AHDP 3BJAA 3I9V2 4PJJA 4EJVA 2IRFG 2Z3YA 2Y0MA 1X3ZB 2DAOA 4RGRA 1OFCX 4I6ZA 2LDUA 4XSZF 5IYDJ 4BJTA 5KNLA 1VQ9I 1X1PA 3HHHA 1N77A 1YX5A 2XPVA 1K4SA 5L3DA 1EA3A 2IGMA 1WJAA 2W84A 1BJZA 3WG9A 4BHPA 4UNOA 1IDZA 2DA6A 1YRNB 5FROA 4MIMA 4G7HF 2CUFA 4A0ZA 5CQEA 2VBZA 1OLTA 1WCMJ 2VXZA 1XMAA 4ZJZA 1MW7A 5GPCA 1PDNC 1WRJA 3I3LA 4RB0A 4U0YA 2F4IA 2ISZA 2LF8A 1U5TB 4MTEA 5CLSA 4ZYHA 4J00A 4ENMA 4AIJA 4HZFA 4UV9A 1LFBA 2DT5A 1YOVB 4UVCA 1I27A 4UY8I 4BDYA 1K4TA 1YW9A 1IN6A 5A2QZ 1ACIA 3D5SC 2MYSA 3WE2A 1V3FA 3OYBA 4CH7A 2BW3A 1HXDA 2XKOA 4ETSA 2TCTA 3BPXA 1FTTA 3SFIA 1E2XA 2H1KA 1UB9A 4E7HA 1R4MB 3ABTA 3PUFA 2M8GX 5FLXZ 2CUEA 3WE3A 2DMQA 2L9RA 1FBUA 3R0JA 2KIQA 3RYRA 2ECBA 3M1EA 2R7ZJ 3VFZA 1F4KA 2DO7A 3VDXA 3ZPLA 3FK6A 2Z16A 3C2GA 2X0LA 1S5LC 4DZJA 2R7SA 4LB6B 1UHWA 6PAXA 1A5JA 3DPTA 3ZQLA 3HGYA 4HDVA 5L3CA 5H6RA 3OYMA 3AAFA 2CUJA 1MDMA 5IOZA 4YFKF 1Y8QB 1H89C 1X4PA 1QZZA 2NXNB 1B8IB 2HQAA 4DIQA 2OA4A 3OYDA 3T0YA 2TRTA 4R1HA 3WGGA 3L2QA 2FA5A 3HJEA 1YITI 4A6EA 2PLYA 1LKXA 1W36D 2IA0A 3ELKA 2X51A 2PMZN 3E5UA 5LEJA 4QLCU 1E3HA 3S1RJ 4L5JA 4W97A 3HOVJ 2Q0OA 2OUMA 1WH5A 4EJWA 4RA2A 2GIZA 1MSEC 3MWMA 1O7LA 4Q48A 5F6FA 4OOIA 4XR6A 1VQ5I 3RKWA 1CF7A 2PEXA 3LFKA 3G1OA 2O9LA 3Q9VA 3ZXSA 2M8EA 3BTJA 3KLOA 4EJTA 4JX4A 1ONVA 2IS1A 3J7AY 5HDNA 4AVZA 2DFHA 5E1ZB 1A31A 3AL0B 3CC7I 1JKQC 3MKZA 2PJRB 2EFOA 2Y75A 1YYVA 1LEAA 3BR6A 3CDIA 1FOXA 3LSRA 3HZJA 1XSVA 2DA7A 4XN0A 5IP6A 3I4MJ 3WTSC 2NS0A 1WI9A 3BR1A 5ICGA 3CC2I 1LE8A 3H9JA 1JHFA 1WJEA 2X1DA 1VQPI 5KAFC 3V42A 1MKMA 1QZYA 1ZN2A 3DXJF 1GV2A 2EFPA 3MEXA 2G0EA 5J4YA 3BROA 4IHWA 2FF4A 2OD5A 4IJAA 2VXDA 2ICWG 5IYCJ 3A0BC 3DPUA 3OYKA 1MH4A 4G6QA 2DA2A 4WXCA 3S1MJ 2NOJB 4XIDA 3QWLA 4KNYA 1NTCA 1SVLA 2Z33A 2IGKA 2QBYB 3RYPA 1B59A 5D4RA 2IPQX 2PG4A 1SD5A 2ZFUA 3ZN1A 1PP7U 2JVHA 1VFCA 2YR2A 4N9IA 2HOTA 1FBQA 2I5UA 3VPRA 3JAMK 1YJWI 4BE1A 3L00A 1HKQA 1Z7UA 3Q9SA 1XSDA 2IS6A 2QKLB 4XLAA 1QA6A 3ASNH 3IAM2 3EUHC 4M3FA 4KMFA 4PGHA 2EV0A 5EG0B 3SDGA 2V1UA 2M4GA 3V8LA 2V1XA 2AS5F 1OMIA 3OS1A 4HA8A 4FX0A 2LVSA 5IP9J 1U78A 4NQWA 3C2BA 3BJOA 2R5ZA 1SFOJ 3QU3A 1R36A 5CVIA 3GO5A 5GAHJ 4IHYA 2RQPA 4G94A 5J1UA 4EGZA 3K70C 1X19A 5LGNA 2CYYA 4IPAA 2LR8A 2E1MC 2XDVA 1ZARA 4K2EA 1D5YA 1YS7A 1ZREA 1BR1A 3ZQGA 2Y9YA 3MVPA 4B3AA 2CSOA 2AO9A 1IUYA 1T2KA 5DS9A 4Y13A 3JR9A 1FTZA 1S7OA 1ZRCA 2GXGA 2QQBA 1KGSA 3UKGA 5F08A 1H0MA 2VOOA 2W25A 3PJRA 2HYJA 4HNUA 2A6EF 2DJNA 3BOQA 3QQAA 4BEHB 2XVCA 3GBGA 2H6CA 2P6TA 4HNTA 1IG7A 1IN4A 1W1WE 2AQEA 3BCAA 3KYLA 3VB2A 2V26A 4AIKA 2B63J 4KT6A 1ZGJA 5ICEA 3RKXA 4HV5A 1WZ2A 1U9OA 2VPRA 2MH2A 3PIPF 4IOCF 2DA5A 2P6SA 3G2BA 4OIOF 3TP3A 4CYDA 4G8XA 4BDZA 1ERDA 4ZDLA 3M8JA 2QZ8A 1XCVA 1YJ9I 4PJ0C 4V2FA 2K9NA 1NK3P 1MD0A 2HU9A 3N05A 1Y0NA 1JKPC 2F4MB 2HZDA 2JN6A 1AU7A 2UXNA 4C2MJ 2LNBA 4XONA 1LDDA 4RGXA 2OV7A 3WTYC 1JT0A 4PJLA 1Y56A 2OTLI 1I3AA 2ZJ2A 1SD4A 3CZ6A 2F5DA 4L9VA 3SZTA 3G4SI 2QYOA 1MBGA 2W00A 3E1SA 3LA3A 5IYBJ 4DBRA 2A5YB 2R3SA 2KRHA 1R6RA 2JPCA 2O03A 1JGGA 4NC6A 2ID6A 2YS9A 4ABZA 3LSIA 3WTXC 2Q8KA 2QENA 4IOAF 4PK4A 2HOEA 2H94A 2JUCA 4I2OA 1GHCA 2EJRA 3QYBA 3B6CA 5D5VB 4M6VA 5F27A 3U2RA 5LEKA 4D9JA 2VIXA 3WTWC 1TWFJ 3JREA 4A3KJ 1O57A 3ZQFA 4D7NA 1HW2A 4CCJA 4Y52J 4FT8A 5J8CA 2CQXA 2Y48A 3L1PA 1ZGWA 1G2HA 1U5TA 2E1CA 1BI0A 2Z1DA 2X85A 2IGNA 3S1NJ 3DEWA 1Y6IA 2FNPA 1FBSA 2Y69H 5J1RA 2NOGA 2BHZA 4C3JJ 4OIRF 3OYIA 4Y33A 4MTDA 4BQNA 1H9TA 4HRIA 4E6KG 2EZIA 5LGUA 2VBXA 4LB5A 4BAYA 3L2RA 3FHZA 2XSJC 5J4VA 5J47A 1QGPA 5CJ9A 3F9KA 5GPAA 4NNJA 2WC2A 1ZK8A 2E5ZA 2XF7A 2R5YA 2IA2A 3G6EI 5HNHA 4XM3A 5J3LA 3DLLF 3CCMI 4BNCA 3WGHA 2CRGA 3I54A 1LNWA 3KPHA 1R22A 2BYVE 1WVRA 2R7TA 2FQ3A 2KDZA 3IP4B 2HXOA 3X2QH 1ZR2A 1A35A 5GP9A 2VJIA 4G12A 1ZTRA 3WTVC 1IAWA 3S2WA 1AKHA 2RC4A 3CLOA 4HW0A 2DTZA 2R4GA 5GAGJ 1N25A 1K83J 2CO5A 1MMGA 1POGA 2M30A 2NVQJ 3ZN0A 2QWWA 4CGZA 2O61A 4PDKA 5E3NA 3J80K 3ZCOA 1ZLJA 3PUBA 2P7CB 1O7FA 2IBDA 3S16J 5M5YJ 2BW3B 3TW6A 3HHGA 1Z77A 3R4KA 3KZZA 1D0YA 1TC3C 3C18A 5FD6A 3QYFA 4CDGA 4XLCA 1SMTA 2KRFA 2K85A 1WJDA 3ZQIA 2E19A 5AIPA 4YELA 2FBIA 1MBKA 2HFHA 5F0HA 4AYBA 3C1DA 4WWCA 1HW5A 2KIUA 3PM1A 1EJ9A 5HODA 2A61A 4ZZLA 1NHAA 1DGRM 5DD4A 5E20A 5GAEJ 1D5VA 3FMSA 2KHMA 2YSRA 4H4KC 3HOTA 1MDMB 2YX7A 3GW2A 3LSKA 1XX5A 1PVEA 3A2KA 2RV8A 2L9VA 2MC4A 5D8LB 2PJRA 2ZJPF 2R93J 3F21A 1O3SA 2VQLA 1LUJB 2DW4A 4I02A 2IS4A 1TWGJ 2KL4A 3CP2A 5BNGA 3BCBA 1H9GA 1NG7A 3K10A 3RI4A 2KFDA 1Z1DA 4LITA 3O6BB 1M1EB 5H20A 2BY2A 2TDXA 2O0YA 3D0SA 4HPQA 4GYGA 4UVBA 3K4KA 2EFQA 2LBFA 2WY8Q 3K9TA 3IL2A 3H35A 2RNJA 1YFHA 2DK8A 1UZCA 4RAYA 2O8KA 5HLTA 3KP5A 2X6WA 4GGGA 3JRFA 2L7ZA 3CD6I 3LA2A 1DU0A 3FK7A 4UVAA 1OCTC 2LLKA 3J81K 1SEUA 1XMXA 2VQCA 1O3TA 2E5NA 4BH9A 2QBYA 3ERED 3FMQA 2L7FP 1D8JA 4LGWA 1MMNA 2ECCA 4A3JJ 3W2VA 2V1DA 3GWZA 3K70D 2VE9A 2KP6A 3S2HJ 3E97A 3LSPA 4UB8C 2JUGA 1LPQA 4KN4X 2MLGA 2XGCA 3E5XA 1KA8A 3E5QA 5DEQA 5EG0A 2HOSA 2M0CA 3FMRA 3K4JA 2WBMA 1QQIA 3HB9A 4BGDA 4BQQA 2XB5A 3E3VA 3J7ZI 2L0KA 2QGUA 3VYSB 4ZYGA 3JRIA 1FMVA 3OV8A 3CCYA 1MNMC 4G6DA 2JZYA 1CGPA 3FWEA 1R5HA 1RUOA 2L9NA 2L3DA 2LF7A 4HAMA 4NHJA 3HEFA 3QYEA 3HPHA 4UUSB 1R49A 1QVTA 4IRHA 2IP2A 3FHNA 2ACJA 3TW7A 3CCRI 1OPCA 2BVLA 2Q2EB 5GTIC 3OS2A 3S32A 3W2AA 2H8RA 4WCGA 2K9QA 3UR3C 5HNFA 5D6EA 3PO2J 4Q5SF 2ZJQF 4NDLA 3EPZA 3IC7A 4QPOA 1J7KA 9ANTA 4XL9A 3HOZJ 3LAJA 2UV1A 4DW6A 2DCEA 3IHUA 1R71A 3MKLA 4NC7A 3VSLA 1BI1A 2DBBA 2W1OA 3ONQA 3Q3SA 3P5JA 4O5VA 2E1OA 4BHBA 2OPTA 4LD5A 1V55H 1SANA 2D45A 2XF5A 4CYCA 2LKPA 4FHTA 5K5OA 2RDPA 2HPMA 3K69A 2EA2A 3T8RA 4L0ZB 4XK4A 2P5KA 4L9JA 2DFFA 4BY7J 4CCMA 5C3EJ 1VQ6I 1MNEA 3ZQ7A 4AC0A 3KFWX 2JSPA 4OAZA 3VYTB 4EGYA 1FP2A 3VOEA 4HX7A 3BG6A 1UG0A 1MJAA 1RZ4A 1VQ4I 1JKRC 1VQKI 3GZ6A 1FEXA 2ELKA 5BOXA 2HEOA 1ON1A 1TZLA 1UAAA 2CUZA 5H2FC 4IZZA 2ISYA 2F6CA 1YTYA 3CJNA 1TWAJ 1YW8A 2XRNA 4ASNA 2OZ6A 1HQCA 3CP8A 2ZC2A 3BPVA 1HKTA 1P7JA 1T39A 2W82A 5HLIA 2CG4A 2XGXA 4ZH4F 3WGIA 1FMWA 3LSJA 2DOEA 3VYUB 3L09A 4AIHA 1X2MA 2JVGA 1IXRC 3PL8A 1X3WB 4MGRA 3ZQCA 1J2XA 1B9MA 2ZXHA 2BEOA 4MFEA 3L2CA 4EM0B 2JA8J 2R7FA 2FX0A 2L54A 1BR4A 1DU6A 1E17A 2ETHA 2K4BA 2F2EA 2UUZA 2GWRA 1ZRDA 1WFXA 5D5UB 2ZKZA 4BJ6C 4PZJA 2O3FA 3M1CA 2ZJRF 1DP3A 2NS8A 3MN2A 1BBYA 3OR2C 2QSHX 5DV5A 4EMSA 2WA0A 5DUIA 1OQYA 2A68F 1IC8A 1YG2A 4EQQA 1BM9A 1Q1VA 1D1CA 3LAPA 1IRXA 4IL6C 2R7VA 1R7JA 3ZGKA 3I59A 2LD5A 5LD2C 2HKXA 4B3XA 1LQ1A 5DCFA 3E0JB 4OMZA 2DOAA 4A3BJ 5E17F 4M3EA 1HSTA 4C3HJ 4YG2F 3R6SA 2XB0X 1ETQA 2A6TA 4HSRA 3JRBA 2ZSHB 1TNTA 3A4CA 4I0AA 1YQAA 2X6YA 3U9GA 5D8KB 1K7AA 2VN2A 3NARA 5B5EC 5E3MA 4IXAA 3ZP5A 1TP4A 3JSPA 2NNYA 4LJZF 1E0EA 3IKVA 1FWZA 3IV5A 1Z91A 5K5QA 1H8AC 1S72I 3BR5A 1K79A 1U6GA 3GLLA 3OR1C 1UMQA 3QPLA 4PCQA 1FT9A 1SC7A 3MKWB 3CCLI 3F22A 1IRGA 2D2WA 3GTQJ 2XPWA 3TO6A 1U0JA 4HG2A 3RKQA 5IOYA 3OYAA 1JTYA 2ZCWA 1W0TA 1SAUA 4M3GA 5HDKA 2ZFWA 3S93A 3OYNA 1ITYA 4D7MA 2LH9A 3BTCA 2R5YB 3DWLE 5F04A 1N75A 4DGWB 3MCZA 3G1MA 1U3EM 2KPMA 1HLVA 4M9XA 1ZAOA 2EZLA 4IQJA 3HPGA 3GMEA 3I58A 2VJ4A 3F8FA 5K7FA 4CXFA 3P9CA 1F36A 1AKHB 1BW6A 2C6YA 3T8TA 3M9AA 4RGUA 5JR3A 5E1XA 1JTXA 3DBLB 4L5IA 4KISA 4FCYA 1GXQA 4BKXA 4JX5A 3BR2A 4D0PA 1EH6A 4KDPA 3L2UA 1JT6A 2XASA 4A5MA 3BZKA 2V79A 2STTA 4PFPA 3CCJI 1AOYA 3F6VA 4ZDPA 1LDJA 4Y7NJ 2ZMEC 2DMTA 3CUOA 5D5XB 1RUNA 5GADJ 3RZOJ 2V9KA 1MIJA 4CO8A 3DQVC 2XAJA 2LY1A 3FX3A 3GFJA 1S7EA 1XGMA 3IWFA 1R1TA 2RVCA 2MBFA 4FTHA 2O5RA 2MD0A 1OR7C 1G3WA 2LK2A 2VBWA 2IVMA 4A69C 2XSDC 3DTEA 4YIIA 2HGCA 1N78A 4ESFA 3BZCA 2GOXB 3JAMZ 4ESJA 2E60A 1QU3A 5LHHA 2V7FA 3DKYA 1FSEA 3NAUA 3P9KA 2MA3A 2EWNA 1X3UA 4X6AJ 2FSWA 4BHCA 3BR3A 4OWRB 4ENKA 2JPBA 3KEOA 1J5YA 3RSNA 1EF4A 2BV6A 4E4HA 4S0HB 2L01A 1HW1A 2M3AA 1JUSA 5EEGA 2L7MP 4AIDA 3OYJA 3TO7A 4E7SA 1VQNI 3D1NI 2HR3A 2BXZA 4HYEA 5D6FA 2EPFA 5DDGA 3MFKA 4FQGA 3LSGA 4F55A 1FIAA 4XBFA 3GTOJ 2MW8A 3PSIA 4II2A 3SZGA 1U8RA 1FSHA 2D1VA 2Y2ZA 2LREA 2LBFB 3FISA 3K1MA 2A69F 2CWEA 3K0LA 3E6CC 3I71A 3E6BA 1RC9A 2XAUA 1B9NA 1P92A 2GIVA 1OJLA 3N97A 1G8XA 3WTTC 1FOYA 4OIQF 5J8FA 3K7AJ 4M74A 2R0QC 4HQEA 3RCOA 1VNDA 2JRTA 1EKEA 2E34A 4BUPA 3HKZA 2LP0A 1TT0A 3VSKA 1OCZH 4MEXF 1QPMA 4O6JA 2MSYA 4G6TB 4UUSA 2OU2A 1XB4A 3BLYA 4M6YA 5CVVA 2DFEA 1XDUA 4U0VA 4MEYF 5B3SH 1R4NB 5TGTA 2Q2EA 3I4PA 2JA5J 5EF6A 3M8FA 3SFZA 3AG1H 4UB6C 5LLQA 2WWYA 2IXSA 3F72A 4QWQA 3JRHA 3H5NA 4JQFA 4NB5A 3V4GA 4A3GJ 3K4NA 1UCRA 2VB6A 1V4RA 3V7RA 3FM3A 3EQLF 1DDNA 1TQPA 1W5TA 2HDCA 3CO7C 1TWCJ 1GV5A 2F5EA 1BOAA 5KCMA 2OJED 5HVQC 2XGEA 1E3PA 1USTA 2WB1A 1K78B 4BXFA 1RIOH 1S9HA 1TW2A 3CF2A 1JKOC 3OMYA 3S3MA 1BW5A 4GXOA 2A05A 1XSXA 1EV7A 1TT5B 1YS6A 1MBJA 2RN7A 1F9NA 1Z21A 4P5OA 2FQ4A 4GO1A 1QPIA 1R5ID 2PMUA 2R7WA 4F92B 3F8MA 1SFXA 2K27A 2MFZA 3BG7A 2IT0A 3NEUA 3GXOA 3OIQA 1WKMA 3Q0UA 4MO7A 1V5GA 3CCVI 4JOMA 4DJAA 2E35A 1ZKGA 2A6HF 4ON0A 4HSTA 2K7LA 1U9NA 5JHUA 1IN8A 1YO5C 2QLZA 5ICCA 1WQ2A 2CQNA 4MQVA 4L0YB 1XGNA 4S05A 2M7BA 1TWHJ 3GFLA 3ABKH 3NWSA 4CYCB 3KEYA 3CLQA 3MMYB 3UNGC 2E1MB 4BACA 2DOFA 2JRMA 2HTJA 3H1CA 3HTUA 1R1UA 3U1KA 3DEUA 3CDHA 2CQKA 3FDYA 2GA2A 5J1YA 4FE7A 3A01B 4FX4A 4F52A 2EV5A 2FMLA 4HQMA 1FZPB 4IRIA 2W57A 4AM3A 2M45A 3KZIC 3PSFA 4UV8A 4BQOA 4IF4A 4KIFA 1TBXA 1ETVA 1X1CA 5CVUA 5KAIC 3WTZA 4LLNA 2DPUA 4M9SA 1LVKA 3L2VA 4W1UA 4A2UA 1A36A 5L3FA 4HF0A 4BQAA 1SD7A 1ULYA 2CV2A 2CH0A 1OCRH 3QAHA 3KYCB 1JXSA 3FZVA 2UWMA 2ID3A 3LQRA 3EDPA 3OWTA 5J6XA 2R7RA 3WHCA 5FLMJ 5K7ZA 2VL8A 3FBNB 3E7LA 3QODA 1FY7A 1KQ8A 1W7PB 3GFIA 2BOLA 3O2PE 3QOEA 1ZYRF 4YIRX 1DUXC 3CCQI 4BL0B 2L4AA 1R00A 2R7OA 5F64A 2EA4A 1ON2A 2Y31A 3FXMA 5DUKA 3RPUD 2VJ5A 3J80Z 3OIOA 3ZQHA 4RAZA 2K86A 2EH3A 4EEFG 4AVPA 2IW5A 4ZYAA 3CF5F 3WU0A 4XORA 4RAFA 2EIJH 2Y0SA 2Z9OA 1DPUA 5HOOA 4YRVA 3TBIA 5ICFA 4F93B 5L3BA 4UXNA 3W3CA 4N4NB 2DYSH 2QM3A 1VZ0A 2PFBA 3BG3A 3H36A 4LMYA 5DTDA 1JI8A 4RM3A 1TW3A 2EILH 3GZNB 1E3OC 1L0OC 2M4KA 3I59B 4C9YA 3AG4H 4N0BA 3V8KA 3C3WA 3N4MA 5BPIA 1OKRA 2GZWA 5M3FJ 3REOA 1G4DA 2V9VA 4YFNF 3K1PA 1WHUA 2JTVA 1GVDA 3IKTA 1RKTA 4YFXF 3CUQC 3DCFA 3MD2A 2XAGA 2VT2A 4U88A 3A03A 3K2AA 4EJOA 2M7AA 3A02A 3ZMVA 4XLFA 4KN7X 4BJ5C 4A3EJ 1QBJA 5C4JJ 2WAQA 3HRSA 1REPC 1YE9A 4B43A 1B72B 2FBKA 2DQRA 4BU2A 1QZEA 1RI7A 1XTAA 1Y8RB 4PUSA 2DXIA 3DTKA 3RPUA 1FIPA 3KP6A 3WU1B 4F7ZA 3ZQQA 4L18B 3MZ8A 1HSJA 1X1AA 5FRNA 5EZHA 2STWA 3KEQA 1LVAA 3K4CA 1T38A 3ZRGA 1J9IA 5CQGA 3J81Z 3CCUI 2FMYA 4CUGA 4B47A 4KICA 4DNCA 3S1QJ 3H0DA 1Z0XA 2HPIA 4BXUA 4LIVA 1C0WA 3GX4X 1OCPA 5JI6A 4C3IJ 3CCSI 4E7ZA 4DYRA 3F0CA 2RREA 1Z67A 2KKOA 3H5RA 4KT5C 4EM1A 1IV6A 4ZTFA 2XPUA 5L3EA 1ZG3A 3M4OJ 1UJ8A 2Z5UA 3LOCA 4I7HA 1QHHD 2K3FA 1YIJI 3F8CA 2M9HA 2NYXA 3HTSB 1RKWA 1WJCA 3P9IA 2VT3A 2FBHA 2ZBKA 1VQ8I 2CW7A 3QRFF 4FE4A 2KZVA 3K1NA 2PMZA 5HS7A 1T08B 2DDBA 3OL4A 2FOKA 4ANJA 2GAUA 1TLHB 1IN5A 2OCEA 2EFWA 1X2NA 5IPAA 2PJPA 1I39A 4IX7A 3VODA 2ZSIB 5E8GA 5K7HA 2XGDA 1OYWA 3EETA 5ERIA 3K4LA 1G3TA 4D1QA 2M5WA 1SMYF 1W5SA 4HV6A 2VLAA 2DMNA 3GCMA 2V1NA 5FKOA 3OYLA 2P8TA 5JHFA 2KJCA 2J5OA 3MAJA 3KETA 1J0RA 4HF1A 4XLPF 3K6GA 2HTSA 3G71I 3KP4A 2WAEA 4KFCA 3JCUC 4RB3C 3TQNA 5FB2A 2FUG2 2AQFA 5TISC 3S2DJ 1WSUA 3FXUA 4E70A 3OYHA 2ZNZA 3ZOBA 2ME6A 2B0LA 5CVRA 2PBIA 4IQ4A 2JT1A 4I09A 2FD5A 2MH9A 4I98B 1HA8A 2NVYJ 3FBIB 5JLWA 2BZTA 2N8GA 2WV0A 2HXIA 2BY0A 4M73A 4X0GA 3LSHA 1YJNI 3BR0A 3KP7A 1W36C 3DP7A 2O6GE 1T95A 4A3DJ 1T0FC 2X6OA 3W6JB 3F23A 1S7AA 3B6AA 5HS8A 4HX8A 3HOYJ 2JJ7A 3I56I 1K78A 2P5VA 2DT7B 2ADUA 4LIUA 3KX2A 4A3CJ 2H1LA 2PQ8A 2XRLA 1JUPA 2DK5A 4XLEA 4DYQA 4ZYDA 4PSXA 3DBRB 3P7NA 3JSOA 3IWZA 4ZTJA 1R9TJ 4XLNF 3TO9A 4A0XA 1D1AA 1I3QJ 2DODA 2HKOA 1IO2A 3GVAA 4NC8A 5LRRA 3H3ZA 5EDNA 4GDFA 1ETKA 2HZTA 3PO3J 3SXYA 1WJBA 3KLNA 4ENJA 4V19K 1RETA 2G9WA 3OSFA 1W7PD 2GA1A 2KZGA 2DN0A 2BY1A 3OS0A 1IV8A 4QIWN 3M3YJ 1JGSA 3EUHA 3RDIA 2CS3A 3EUAA 1MJ9A 2WB1N 2X4HA 1G3SA 5CKTA 3BZ6A 1HKSA 2Z99A 1VF9A 3KP2A 3T5XA 3R60A 5EEAA 2EZHA 1VQMI 1IF1A 4E7KA 3MZYA 3ABUA 2NAZA 3W6KB 1ZQ3P 4XNFA 3GZ5A 2CJJA 1Z9CA 2DFIA 2KDOA 4E7JA 3ERMA 1ETYA 2FJ1A 4JX6A 4XRMA 1QRYA 4XMYA 1IRFA 1FP1D 1S6LA 2EK5A 3DTIA 4EATA 3A01A 1D1BA 3G1LA 4IHTA 5D4SA 3ASOH 3CCEI 4A3LJ 5EEHA 4CZZA 4MFDA 3BG9A 2NS7A 5GTHC 4JBAA 3HYIA 4DOZA 1QHGA 4LG3A 1I1SA 3I64A 3GTMJ 2NNNA 1P2FA 2BGCA 3TMOA 4RB2C 3PNYA 3COAC 2I10A 2HWVA 4Y15A 1JE8A 4II3A 3S15J 5HLGA 3SDBA 4CZCA 3ZMSA 2W24A 4I99C 4E7LA 3BP8A 3BC8A 2M0MA 2VJJA 4E7IA 3TEDA 3DU6A 3LA7A 3ZMDA 4XRSA 2IGOA 4RM2A 3MKYB 1FOWA 1W7PA 4A5NA 2QVOA 3AFHA 2XAQA 5C4XJ 3IRRA 1BA5A 1FOKA 3RJPA 4XOPA 2XKPA 2RAEA 1V5EA 2GXBA 2QCOA 2VOPA 4XQFA 1UHSA 3J7AO 5DCMB 1IZ1A 1OYYA 1I5ZA 2IJLA 2V4JC 2DI3A 2WAFA 2AHQA 4XKBA 4WX9A 2QEXI 2PI0A 2EQRA 3H3UA 3M8EA 1P4XA 1J75A 1A6IA 3DF8A 3Q0VA 4U0WA 2EIKH 2HQRA 1B4AA 4HF2A 3TOAA 2CV0A 2L2OA 3FXRA 4QPQA 2L5QA 5FRMA 4YIFA 4R79A 5F0CA 3LWFA 4CCKA 2Y9ZA 3TKYA 2ZXJA 4L9NA 2V6EA 1PUFA 2EIMH 1XCBA 4A6DA 2HI3A 3F6OA 2CU7A 4OINF 4DYCA 3GLXA 5LHIA 4HOBA 1SFUA 3HSFA 5EJCA 2EBIA 3OY9A 2BE5F 3O8HA 1KU7A 4M3BA 4OAYA 5JLXA 1ZG1A 1P9QC 2NVTJ 3LL7A 4P55A 4Q47A 3FXQA 2LKSA 3ECOA 3TOBA 2Y0SN 3H3VK 1XGSA 3A1YA 1ZGAA 3C7JA 2NVUB 2DA3A 2VKVA 1LEBA 4PGGA 4IRGA 5FD5A 3QU6A 5L3GA 1Y39A 3V8JA 1B72A 1IUFA 2LMDA 3ISPA 1TQMA 1I6XA 2VONA 2WADA 5FFXA 4A3FJ 3K4MA 2GQQA 4G7ZF 1GXPA 1XGOA 2K9LA 4RS8A 4Y3OA 2LYCA 2A5WA 2G7UA 4L9TA 4RMNA 4C30A 1R5GA 2MG4A 1XS9A 2EZKA 2OTJI 2M2EA 3AG2H 4I76A 3HC7A 2DJIA 1S8NA 2K4JA 1MZBA 3HRTA 3PNTA 4KUMA 2YU3A 5LGTA 5IT9K 2ELHA 2WV1A 4I01A 2IEKA 1X4OA 5DM6F 3BDDA 4CICA 2XF6A 3H9GA 3CUQA 2E2IJ 5JVTA 2WAQN 4V2GA 1R1VA 2OC6A 1BJAA 2F5FA 1SAXA 2K02A 3LSTA 3AKZA 1D3YA 2H09A 3NQOA 4KMUX 5CYVA 4HLYA 3SJMA 4RLQA 4GYIA 3GEZA 1D0XA 2PN6A 2NRAC 3KZYA 3HOXJ 4C2UA 5HDGA 5FKKA 3IH2A 3H92A 4P1WA 4A0YA 1HF0A 3OOUA 1R58A 2QSGX 3EYYA 1X58A 1HDPA 2DTRA 4BY1J 3S3NA 4XKVA 4H0EA 3JRGA 1D8KA 5F1RA 1PP8F 4MQ9F 4DZPA 4LOCA 1SFEA 4CCNA 4AYBN 2OF7A 3OL3A 5B1AH 2G7HA 2KIMA 4BE2A 2ME0A 3BTLA 4LFUA 1RESA 5ILUA 4ESBA 1BL0A 3ZMZA 1DGWY 2MABA 4Z2YA 2M87A 3KE2A 3AL0C 3WU2C 4AD9A 4XICA 3FM5A 2GLOA 4FETA 4CCOA 4UHTA 3LNQA 2W48A 5LFAA 2CQQA 2L02A 4Q4ZF 3SZPA 4EM2A 3CQZJ 4KITB 2W4SA 5FFZA 4XKWA 5DD8A 2OQGA 4GRIA 1S29A 1MJBA 1JJ6C 2HOAA 3OSGA 3SEQA 1H88C 2IA1A 2DDAA 1DQUA 5A2QK 4GFBA 1U8BA 1XN7A 3HXLA 1K6OA 2ZMEB 2R7DA 1SD6A 1B1BA 1KYWA 3FXKA 4EV0A 3CC4I 3RPQA 2LY9A 2RGVA 4L5EA 3FKJA 5FJ8J 1W0UA 1W5CC 1WWXA 3KCCA 3QPTA 5EZGA 2GM4A 4IHXA 3GFMA 5FLXK 2BHYA 3PQJA 3ZMUA 2MGQA 1Q1HA 1UG2A 3SQNA 2RNGA 2GXAA 2LC2A 1MSFC 4ZC3A 4I0BA 2WY7Q 3GTLJ 1TNSA 2DYRH 3B02A 5H6QA 2JMWA 5HS9A 3IRQA 2CFXA 4A3MJ 3HBLA 2HQNA 2P4WA 3U1DA 1NH3A 4PJMA 1FJLA 2VC1A 2VQHA 4U7BA 4Y17A 3RTRA 1FYKA 2FU4A 2B9SA 2DA4A 3E6DA 5EYRA 1UHMA 4ZYEA 2KMUA 5M5WJ 3TL4X 3BT9A 4XRSG 3CMYA 3S14J 4MHGA 3OYGA 5B1BH 4XSXF 2IAIA 1ETXA 2F5CA 3WHBA 2GOMA 4IHVA 2JWTA 1WJ5A 2FOWA 2HVQA 1T0FA 4LK1F 2VQGA 2ESHA 1KQ0A 5CVJA 3VWBA 2QQAA 1Z3YA 3DKXA 2FE3A 3R0AA 1ORKA 3F8BA 2O8XA 1D0ZA 1RR8C 4QSHA 4GCVA 3S3OA 2QSFX 1ZRFA 3KIOA 2LY2A 3DKWA 1GUUA 1XD7A 3MQ0A 5FGMA 3I4NJ 1AWCA 2E2HJ 1LDKB 2W85A 3L9FA 2WTEA 2M1BA 2YUSA 3HIFA 4HLXA 4KYWA 4A93J 5BS6A 2H6BA 2ELJA 5EGOA 1DPRA 2OZUA 2D5VA 2YX4A 3F8NA 3L7WA 1G6NA 4XOTA 3IH3A 4PSWA 2I8DA 4S04A 5KK1A 1VQLI 1Z6TA 4P96A 2PMHA 4M71A 1V54H 1X1DA 3FXJA 2Z2SB 4KIGA 4B44A 1RR7A 3EUKL 3ABLH 3Q5FA 2E7XA 5C44J 3I0TA 5E79C 2VPLA 2P0WA 4BYYA 2X9DA 5E3LA 3BWGA 2YU9J 2KT0A 2JK3A 3HOUJ 1Z7LA 2A3SA 4ZZDA 3IH4A 1O4XA 1JJ8C 4U87A 2RKHA 4NBQA 2UZKA 4LLGF 4CSWA 3TDZC 1Y1VJ 1FYLA 4M3DA 3SYTA 3RKYA 1MMAA 1MGTA 5M3MJ 2R7XA 3DEEA 5DCMA 2EINH 3ZMTA 4B48A 3LMMA 2VBYA 2L9SA 3TP0A 1R23A 2L4MA 1ZLKA 3OIPA 1BIAA 3KP3A 4G9YA 1QNTA 2JQ7A 4Z6YA 3OYCA 3BQYA 4LG0A 3HL2A 2COBA 2VC0A 3V7CA 3FXOA 2ESNA 2JA7J 3HRUA 4JP0A 2XHKA 3PNVA 3RQ4A 1YIOA 4EVIA 2QKMB 4HNVA 2H8WA 5IY5H 3I53A 4M9ZA 2XAFA 3ROUA 1Z3XA 3GTPJ 3CMAI 3H0GJ 4FISA 4WK8F 3K2ZA 1ETOA 1ZG5A 2VI6A 4B09A 1GVJA 1LFPA 1OCOH 1W4MA 3GTKJ 3W2WA 1G3YA 4XN3A 5D5WB 1XDSA 4MNUA 2HYFA 1IXCA 3FXLA 2LG4A 3HUGB 1TL8A 2QA4I 2QQ8A 5ILSA 2XAHA 4Y4RA 1IRZA 1YRNA 3U21A 2CW8A 3GTGJ 1ODDA 1ZR4A 2HVRA 4OMYA 1GT0C 3D5RC 1RPWA 1PUFB 1FLIA 4G7OF 4TV7A 1F5TA 3DLAA 1K6YA 3FKIJ 4J01A 2ZNYA 1BR2A 5KHDA 4M6XA 1KQ9A 4B1RA 1Y0UA 3EYIA 2HVSA 2CMPA 2MC3A 3LQQA 5ILVA 2UXXA 4WXDA 1QO0D 2E36A 1J09A 2CW0F 2Y30A 1BN5A 4QTRA 4CA0A 1RNLA 2K5CA 2MLKA 4A3IJ 2X1CA 2R7QA 4N9HA 3LFUA 4BXXJ 5CPRB 3PFIA 4IHSA 4XRFA 4RDUA 2IS2A 5E1WA 4F3QA 1ZH5A 3HM5A 1ENHA 1FPQA 1LJ9A 4KA4A 4HBLA 2CGPA 2F48A 3W6VA 2BXYA 3VYRB 3A0HC 2COMA 1GDTA 1TTYA 5AIQA 3G73A 1F1ZA 1RRJA 1KU2A 5ED4A 1IGNA 2LFBA 2QQ9A 3ML6A 3H9QA 4KIBA 1MMSA 5AONA 1HC8A 2P81A 5DM7F 1OISA 1YHQI 2HQ5A 2QUFA 3QP6A 5BPDA 4MLOA 1XMKA 2FXAA 1FC3A 2VKHA 1ZELA 1WJFA 1T56A 2E7WA 4DBQA 2K40A 4F91B 3NRVA 5TJJA 2RQQA 3M07A 4YEJA 1HDDC 1BIBA 3WODF 2DPDA 2W7NA 2XUBA 1ZHFA 1IW7F 2D1HA 1P6RA 1X1BA 3CUQB 2XIGA 3ECHA 1B8IA 2H27A 2HDDA 1O3RA 3HDDA 1ETWA 5LRSA 5IP7J 2V6CA 3BG5A 1KU3A 4RB1A 3O3KA 4JK1X 3OYEA 3O8GA 2BVMA 4X1EA 2XC7A 3CMEI 1VQOI 4ITVA 1JUMA 4P9UA 2LTPA 3SEZA 3RZDJ 1OYIA 1Y1WJ 3HSEA 4D5CA 4IVNA 4EJUA 2JSCA 4AU7A 3VEPA 4WXHA 3ESWB 1SFKA 1IXSB 3QOPA 4CHUA 2KISA 5IT3A 2ZMEA 2M34A 5BQTA 3DU5A 1UFMA 2O7OA 1XPXA 1STZA 3JW4A 1P4AA 1V5FA 3NWTA 4HEA2 3RQIA 2GBYA 1OR7A 3JRCA 4PFOA 3H5AA 1A6QA 4OIPF 1IJWC 4M72A 5JVGF 1FNNA 3PQKA 3V7SA 3Q0WA 2OAZA 4HX4A 1NG6A 4N4OB 4WF2A 5LHGA 3JRDA 2DMPA 2LOOA 2KLOA 1EH8A 1MBHA 3L2WA 2A07F 2DU9A 1KONA 2P5LC 1MBFA 1T8IA 1WH7A 3JTHA 3TDUC 1HOMA 3D5LA 1YI2I 1GLNA 1P4WA 1LB2A 4KJZA 1CF7B 2EFNA 3HGGA 2FRHA 4CCLA 5F0FA 5FO5A 4BS9A 2LKXA 1K61A 3CJTB 1QVUA 2AXLA 3FIWA 3GF2A 4FASD 3DV8A 1PYVA 4U7DA 3ULQB 1I1GA 3G3ZA 3M7GA 4RBOA 2PX9A 2OCCH 3QP5A 1USSA 3HKZN 2F4OB 3IAS2 4O3MA 3I5UA 3HOSA 3FF5A 2DLLA 3HG9A 2F5VA 3I55I 3J7YJ 3TGNA 2J5PA 3QPHA 4B8XA 5BMZA 5TRDA 2CQ7A 1B6AA 2HS5A 1HCRA 3K4BA 1BI2A 1EH7A 3LSMA 4UUTA 2OQRA 3IUOA 1FYMA 2E1NA 1LE8B 1BC8C 2HNHA 1I6HJ 1KZHA 2HDWA 2KQRA
chains in the Genus database with same CATH topology
2VE8A 3CTAA 3RIRA 3GUDA 3E6MA 1PUEE 3B73A 3GYHX 4RGSA 5E8IA 3BY6A 1FX7A 5HLHA 5LBQA 1Z05A 4UUVA 4LLLA 2KJBA 1O3QA 2HYGD 2LSOA 4AWXB 2EB7A 3CO6C 3F3XA 1Z6RA 4A12A 2XROA 3BJ6A 2DQLA 1T98A 2OBPA 1VTNC 1U2WA 2XV4S 3DFGA 1J59A 1JHHA 1DP7P 3T1BA 1BC7C 1YW7A 2ZO4A 4DQ2A 4ENNA 1YLFA 1KYZA 3OOPA 2MD5A 1S3JA 2YPRA 4P9FA 4R8HA 5JFRA 1TQIA 1HBXG 2BBYA 4HDUA 1T6SA 5E18F 2FEZA 5K5RA 2FNAA 1IN7A 5KVRA 3HUGA 2KIFA 5IT9Z 1A04A 5DYMA 3DPLC 4LG0B 5K1YA 3MZHA 4LK0F 2EV6A 1L3LA 1BI3A 3HRMA 1KU9A 3R61A 1U5TC 4OU0A 2VODA 2P7VB 3SHFA 3HSRA 3WTUC 3JTGA 3BJAA 4EJVA 2IRFG 2Z3YA 2Y0MA 2DAOA 4RGRA 2LDUA 4XSZF 3HHHA 5L3DA 2W84A 3WG9A 4BHPA 4UNOA 4G7HF 4A0ZA 2VBZA 2VXZA 1XMAA 1PDNC 1WRJA 4RB0A 4U0YA 2ISZA 2LF8A 1U5TB 4MTEA 5CLSA 4ZYHA 4ENMA 4AIJA 4HZFA 4UV9A 2DT5A 4UVCA 1I27A 1YW9A 1IN6A 5A2QZ 3WE2A 1V3FA 2XKOA 1HXDA 4ETSA 3BPXA 1E2XA 1UB9A 3ABTA 5FLXZ 3WE3A 1FBUA 3R0JA 3RYRA 3M1EA 3VFZA 1F4KA 2DO7A 3ZPLA 2X0LA 4LB6B 1UHWA 6PAXA 3DPTA 4HDVA 5L3CA 5H6RA 3AAFA 1MDMA 4YFKF 1QZZA 2OA4A 3T0YA 4R1HA 3WGGA 2FA5A 4A6EA 2PLYA 2IA0A 3ELKA 3E5UA 5LEJA 4QLCU 4L5JA 2Q0OA 4EJWA 3MWMA 1O7LA 4Q48A 5F6FA 4OOIA 3RKWA 1CF7A 2PEXA 3LFKA 3Q9VA 2M8EA 3KLOA 4EJTA 1ONVA 5HDNA 5E1ZB 2EFOA 2Y75A 1YYVA 1LEAA 1XSVA 3WTSC 2NS0A 1WI9A 5ICGA 1JHFA 1MKMA 1QZYA 1ZN2A 3DXJF 2EFPA 3MEXA 3BROA 2FF4A 2OD5A 4IJAA 4G6QA 4WXCA 4KNYA 2Z33A 2QBYB 3RYPA 1B59A 5D4RA 2IPQX 2PG4A 1SD5A 3ZN1A 1PP7U 2YR2A 4N9IA 1FBQA 3JAMK 3L00A 1HKQA 1Z7UA 3Q9SA 1XSDA 4KMFA 4PGHA 2EV0A 2V1UA 3V8LA 2V1XA 2AS5F 1OMIA 4HA8A 4FX0A 1U78A 4NQWA 3BJOA 3QU3A 1R36A 5CVIA 3GO5A 2RQPA 4G94A 4EGZA 5LGNA 2CYYA 4IPAA 1ZARA 4K2EA 1YS7A 1ZREA 2CSOA 1IUYA 1T2KA 4Y13A 1S7OA 1ZRCA 2GXGA 2QQBA 1KGSA 1H0MA 2VOOA 2W25A 2A6EF 3BOQA 2XVCA 2H6CA 2P6TA 1IN4A 3VB2A 4AIKA 1ZGJA 5ICEA 3RKXA 4HV5A 2MH2A 2P6SA 4OIOF 4CYDA 4G8XA 2QZ8A 1XCVA 1MD0A 2UXNA 2LNBA 1LDDA 4RGXA 3WTYC 2ZJ2A 1SD4A 2F5DA 4L9VA 3SZTA 2QYOA 3LA3A 2A5YB 2R3SA 2JPCA 2O03A 3WTXC 2Q8KA 2QENA 2HOEA 2H94A 4I2OA 1GHCA 2EJRA 5D5VB 3U2RA 5LEKA 3WTWC 1O57A 1HW2A 4FT8A 5J8CA 2Y48A 1U5TA 2E1CA 1BI0A 2FNPA 1FBSA 4OIRF 4MTDA 1H9TA 5LGUA 4LB5A 2VBXA 4BAYA 3FHZA 1QGPA 5CJ9A 2WC2A 2IA2A 4BNCA 3WGHA 3I54A 1LNWA 1R22A 2BYVE 2FQ3A 3WTVC 1IAWA 3S2WA 2RC4A 3CLOA 4HW0A 2CO5A 2M30A 3ZN0A 2QWWA 4CGZA 2O61A 4PDKA 3J80K 1ZLJA 2P7CB 1O7FA 3HHGA 3R4KA 3KZZA 3C18A 5FD6A 4CDGA 1SMTA 2KRFA 5AIPA 2FBIA 2HFHA 3C1DA 4WWCA 1HW5A 2KIUA 2A61A 4ZZLA 1NHAA 5E20A 5DD4A 1D5VA 3FMSA 2YSRA 3HOTA 1MDMB 2YX7A 3GW2A 2RV8A 5D8LB 3F21A 1O3SA 4I02A 2DW4A 1H9GA 3RI4A 1Z1DA 3O6BB 5H20A 2TDXA 2O0YA 3D0SA 4GYGA 4UVBA 2EFQA 3K9TA 3IL2A 2RNJA 1YFHA 2DK8A 4RAYA 3KP5A 4GGGA 3LA2A 4UVAA 3J81K 1O3TA 4BH9A 2QBYA 3ERED 3FMQA 1D8JA 4LGWA 2V1DA 3GWZA 2VE9A 3E97A 4KN4X 2MLGA 3E5XA 1KA8A 3E5QA 5DEQA 3FMRA 1QQIA 3E3VA 4ZYGA 3OV8A 4G6DA 2JZYA 1CGPA 3FWEA 1R5HA 1RUOA 2L3DA 2LF7A 4HAMA 4NHJA 4IRHA 2IP2A 2ACJA 1OPCA 4WCGA 5D6EA 4Q5SF 3IC7A 1J7KA 3LAJA 3IHUA 1BI1A 2DBBA 4BHBA 4O5VA 4LD5A 2D45A 2LKPA 4FHTA 5K5OA 2RDPA 3K69A 2EA2A 3T8RA 4L0ZB 2P5KA 4L9JA 3ZQ7A 3KFWX 4EGYA 1FP2A 3VOEA 4HX7A 1MJAA 1RZ4A 3GZ6A 5BOXA 2HEOA 1ON1A 2ISYA 1YTYA 3CJNA 1YW8A 2XRNA 4ASNA 2OZ6A 1HQCA 3BPVA 1HKTA 1T39A 5HLIA 2CG4A 2XGXA 4ZH4F 3WGIA 3L09A 4AIHA 1IXRC 4MGRA 1J2XA 1B9MA 2BEOA 3L2CA 4EM0B 2R7FA 2L54A 1E17A 2ETHA 2K4BA 2F2EA 2GWRA 1ZRDA 5D5UB 2ZKZA 4PZJA 2O3FA 1BBYA 5DV5A 4EMSA 5DUIA 2A68F 1YG2A 4EQQA 1BM9A 3LAPA 1R7JA 3I59A 2HKXA 1LQ1A 5DCFA 4OMZA 5E17F 1HSTA 4YG2F 3R6SA 1TNTA 4I0AA 1YQAA 3U9GA 5D8KB 1K7AA 2VN2A 3ZP5A 4IXAA 3JSPA 2NNYA 4LJZF 3IKVA 1FWZA 1Z91A 5K5QA 1K79A 1U6GA 4PCQA 1FT9A 3F22A 1IRGA 2D2WA 3TO6A 2ZCWA 5HDKA 2ZFWA 3MCZA 1U3EM 4M9XA 1ZAOA 3I58A 3F8FA 4CXFA 3P9CA 2C6YA 3T8TA 3M9AA 4RGUA 5JR3A 5E1XA 4L5IA 1GXQA 4D0PA 1EH6A 4KDPA 2XASA 4A5MA 2V79A 2STTA 1AOYA 3F6VA 1LDJA 1RUNA 3CUOA 5D5XB 4CO8A 3DQVC 2XAJA 3FX3A 3GFJA 1XGMA 3IWFA 1R1TA 2RVCA 2MBFA 1G3WA 2VBWA 2IVMA 4YIIA 2HGCA 4ESFA 3JAMZ 4ESJA 5LHHA 3P9KA 1FSEA 2MA3A 2EWNA 1X3UA 2FSWA 4BHCA 4ENKA 2JPBA 3KEOA 1J5YA 2BV6A 2L01A 1HW1A 5EEGA 3TO7A 2HR3A 4HYEA 5D6FA 5DDGA 3MFKA 4XBFA 1U8RA 1FSHA 2D1VA 3K1MA 2A69F 2CWEA 3K0LA 3E6CC 3I71A 3E6BA 1B9NA 1P92A 2GIVA 3N97A 3WTTC 4OIQF 5J8FA 4HQEA 4M74A 2JRTA 4MEXF 1QPMA 4O6JA 2OU2A 1XB4A 4M6YA 5CVVA 1XDUA 4U0VA 4MEYF 2Q2EA 3I4PA 3M8FA 3SFZA 5LLQA 2WWYA 3F72A 4QWQA 4JQFA 4NB5A 3V4GA 1UCRA 1V4RA 3V7RA 3FM3A 3EQLF 1DDNA 1TQPA 1W5TA 2HDCA 3CO7C 2F5EA 1BOAA 5HVQC 1USTA 1K78B 1RIOH 1TW2A 4GXOA 1XSXA 1EV7A 1YS6A 2RN7A 1F9NA 4P5OA 4GO1A 2PMUA 3F8MA 1SFXA 2K27A 2IT0A 3NEUA 3GXOA 1WKMA 2A6HF 4ON0A 2K7LA 5JHUA 1IN8A 1YO5C 2QLZA 5ICCA 1WQ2A 4MQVA 4L0YB 1XGNA 4S05A 3GFLA 2HTJA 3HTUA 1R1UA 3DEUA 3CDHA 2CQKA 2GA2A 4FX4A 2EV5A 2FMLA 4HQMA 1FZPB 4IRIA 2W57A 2M45A 4UV8A 4IF4A 4KIFA 1TBXA 5CVUA 3WTZA 4LLNA 2DPUA 4M9SA 4A2UA 5L3FA 4HF0A 4BQAA 1SD7A 1ULYA 3QAHA 1JXSA 3FZVA 2UWMA 3LQRA 3EDPA 5J6XA 1FY7A 1KQ8A 1W7PB 3GFIA 3O2PE 1ZYRF 1DUXC 2L4AA 1R00A 5F64A 2EA4A 1ON2A 5DUKA 3J80Z 4RAZA 2K86A 4AVPA 2IW5A 3WU0A 2Z9OA 1DPUA 5HOOA 5ICFA 5L3BA 4UXNA 2QM3A 2PFBA 4LMYA 1TW3A 1L0OC 3I59B 4N0BA 3V8KA 3C3WA 3N4MA 5BPIA 1OKRA 2GZWA 3REOA 1G4DA 2V9VA 4YFNF 3K1PA 2JTVA 3IKTA 4YFXF 3CUQC 2XAGA 2VT2A 4U88A 4EJOA 3ZMVA 4KN7X 1QBJA 1REPC 3HRSA 2FBKA 2DQRA 1RI7A 3RPUA 3KP6A 3WU1B 4F7ZA 4L18B 1HSJA 2STWA 3KEQA 1LVAA 1T38A 1J9IA 3J81Z 2FMYA 4KICA 4DNCA 4BXUA 1C0WA 3GX4X 5JI6A 2KKOA 4KT5C 4EM1A 5L3EA 1ZG3A 2Z5UA 4I7HA 3F8CA 2NYXA 3HTSB 3P9IA 2VT3A 2FBHA 2ZBKA 3QRFF 3K1NA 5HS7A 2FOKA 2GAUA 1TLHB 1IN5A 2EFWA 2PJPA 3VODA 5E8GA 1OYWA 3EETA 5ERIA 1G3TA 2M5WA 1SMYF 1W5SA 4HV6A 2P8TA 2KJCA 2J5OA 3MAJA 3KETA 1J0RA 4HF1A 4XLPF 2HTSA 3KP4A 4KFCA 4RB3C 3TQNA 5FB2A 1WSUA 3FXUA 4E70A 2ZNZA 2B0LA 5CVRA 2PBIA 2JT1A 4I09A 2MH9A 4I98B 2WV0A 4M73A 3KP7A 2O6GE 3DP7A 3W6JB 3F23A 1S7AA 5HS8A 4HX8A 1K78A 2P5VA 2ADUA 2PQ8A 2DK5A 4ZYDA 3JSOA 3P7NA 3IWZA 4XLNF 3TO9A 4A0XA 2HKOA 3GVAA 5LRRA 3H3ZA 2HZTA 3SXYA 3KLNA 4ENJA 2G9WA 1W7PD 2GA1A 1JGSA 3EUHA 3RDIA 1MJ9A 2X4HA 1G3SA 3BZ6A 1HKSA 2Z99A 3KP2A 3T5XA 3R60A 1IF1A 3MZYA 3ABUA 2NAZA 3W6KB 3GZ5A 1Z9CA 2DFIA 1IRFA 1FP1D 1S6LA 2EK5A 4IHTA 5D4SA 5EEHA 4CZZA 4JBAA 3HYIA 1I1SA 3I64A 2NNNA 1P2FA 2BGCA 4RB2C 3COAC 2HWVA 4Y15A 1JE8A 5HLGA 3ZMSA 2W24A 3BP8A 3LA7A 3ZMDA 1W7PA 4A5NA 2QVOA 2XAQA 3IRRA 1FOKA 3RJPA 2XKPA 2GXBA 2VOPA 3J7AO 5DCMB 1IZ1A 1OYYA 1I5ZA 2IJLA 2DI3A 4WX9A 2PI0A 3H3UA 3M8EA 1P4XA 1J75A 3DF8A 4U0WA 2HQRA 1B4AA 4HF2A 3TOAA 3FXRA 4YIFA 4R79A 3LWFA 3TKYA 2ZXJA 4L9NA 1XCBA 4A6DA 3F6OA 4OINF 3GLXA 5LHIA 4HOBA 1SFUA 3HSFA 2BE5F 1KU7A 1ZG1A 4P55A 4Q47A 3FXQA 3ECOA 3TOBA 1XGSA 1ZGAA 3C7JA 1LEBA 4PGGA 4IRGA 5FD5A 3QU6A 5L3GA 3V8JA 3ISPA 1TQMA 1I6XA 2VONA 5FFXA 2GQQA 4G7ZF 1GXPA 1XGOA 4RS8A 2G7UA 4L9TA 1R5GA 1S8NA 2K4JA 1MZBA 3HRTA 4KUMA 5LGTA 2YU3A 5IT9K 2ELHA 4I01A 3BDDA 4CICA 3CUQA 5JVTA 1R1VA 1BJAA 2F5FA 1SAXA 2K02A 3LSTA 1D3YA 2H09A 3NQOA 4KMUX 5CYVA 4HLYA 4GYIA 3GEZA 2PN6A 2NRAC 3KZYA 5HDGA 3H92A 4A0YA 1R58A 3EYYA 2DTRA 4H0EA 1PP8F 1D8KA 5F1RA 4MQ9F 1SFEA 2G7HA 2KIMA 4LFUA 5ILUA 4ESBA 3ZMZA 4Z2YA 2M87A 3KE2A 4AD9A 3FM5A 4UHTA 2L02A 4Q4ZF 3SZPA 4EM2A 5FFZA 5DD8A 2OQGA 1S29A 1MJBA 2IA1A 5A2QK 1XN7A 1K6OA 2ZMEB 2R7DA 1SD6A 1B1BA 1KYWA 4EV0A 3RPQA 2RGVA 1WWXA 3KCCA 3QPTA 3GFMA 5FLXK 3PQJA 3ZMUA 1Q1HA 3SQNA 4I0BA 1TNSA 3B02A 5H6QA 5HS9A 3IRQA 2CFXA 2HQNA 2P4WA 3U1DA 2VC1A 4U7BA 4Y17A 3RTRA 1FYKA 2FU4A 3E6DA 1UHMA 4ZYEA 4MHGA 4XSXF 2F5CA 1T0FA 4LK1F 2ESHA 1KQ0A 5CVJA 2QQAA 2FE3A 3R0AA 3F8BA 2O8XA 4GCVA 1ZRFA 3DKWA 1XD7A 3MQ0A 5FGMA 1AWCA 1LDKB 2W85A 3L9FA 2WTEA 2M1BA 3HIFA 4HLXA 4KYWA 5BS6A 2H6BA 1DPRA 2OZUA 2YX4A 3F8NA 3L7WA 1G6NA 4S04A 5KK1A 1Z6TA 4P96A 2PMHA 4M71A 4KIGA 3Q5FA 2E7XA 3I0TA 4BYYA 3BWGA 2A3SA 4ZZDA 2RKHA 2UZKA 4LLGF 3TDZC 1FYLA 3RKYA 1MGTA 5DCMA 3ZMTA 2VBYA 1R23A 2L4MA 1ZLKA 1BIAA 3KP3A 4G9YA 1QNTA 4LG0A 2VC0A 3V7CA 2ESNA 3HRUA 2XHKA 1YIOA 4EVIA 3I53A 4M9ZA 2XAFA 3ROUA 4WK8F 3K2ZA 1ZG5A 4B09A 1GVJA 1W4MA 1G3YA 5D5WB 1XDSA 4MNUA 2HYFA 1IXCA 5ILSA 2XAHA 1ODDA 4OMYA 1FLIA 4G7OF 4TV7A 1F5TA 2ZNYA 4M6XA 1KQ9A 1Y0UA 3EYIA 2MC3A 3LQQA 5ILVA 2UXXA 4WXDA 1QO0D 2CW0F 1BN5A 1RNLA 2MLKA 4N9HA 3PFIA 4IHSA 4XRFA 5E1WA 1ZH5A 1FPQA 1LJ9A 4KA4A 4HBLA 2CGPA 2COMA 1TTYA 5AIQA 3G73A 1F1ZA 1KU2A 5ED4A 2QQ9A 3ML6A 4KIBA 5AONA 2QUFA 3QP6A 5BPDA 1XMKA 2FXAA 1FC3A 2E7WA 3NRVA 5TJJA 1BIBA 3WODF 2DPDA 2XUBA 1ZHFA 1IW7F 2D1HA 1P6RA 3CUQB 2XIGA 3ECHA 2H27A 1O3RA 5LRSA 2V6CA 1KU3A 4RB1A 3O3KA 4JK1X 4P9UA 1OYIA 3HSEA 4IVNA 4EJUA 2JSCA 3VEPA 4WXHA 1IXSB 3QOPA 4CHUA 5IT3A 2ZMEA 5BQTA 1UFMA 1STZA 3JW4A 1P4AA 1OR7A 4OIPF 4M72A 1FNNA 3PQKA 3V7SA 4HX4A 2OAZA 4WF2A 5LHGA 1EH8A 2A07F 2DU9A 2P5LC 3JTHA 3TDUC 3D5LA 1P4WA 1LB2A 1CF7B 2EFNA 2FRHA 5FO5A 3GF2A 2AXLA 3DV8A 4U7DA 3ULQB 1I1GA 3G3ZA 3M7GA 3QP5A 1USSA 4O3MA 3I5UA 3HOSA 3FF5A 2DLLA 3TGNA 2J5PA 3QPHA 4B8XA 5BMZA 5TRDA 1B6AA 2HS5A 1BI2A 1EH7A 2OQRA 1FYMA 2E1NA 1BC8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VE8 A;  3CTA A;  3RIR A;  3GUD A;  3E6M A;  1PUE E;  3B73 A;  3GYH X;  4RGS A;  5E8I A;  3BY6 A;  1FX7 A;  5HLH A;  5LBQ A;  1Z05 A;  4UUV A;  4LLL A;  2KJB A;  1O3Q A;  2HYG D;  2LSO A;  4AWX B;  2EB7 A;  3CO6 C;  3F3X A;  1Z6R A;  4A12 A;  2XRO A;  3BJ6 A;  2DQL A;  1T98 A;  2OBP A;  1VTN C;  1U2W A;  2XV4 S;  3DFG A;  1J59 A;  1JHH A;  1DP7 P;  3T1B A;  1BC7 C;  1YW7 A;  2ZO4 A;  4DQ2 A;  4ENN A;  1YLF A;  1KYZ A;  3OOP A;  2MD5 A;  1S3J A;  2YPR A;  4P9F A;  4R8H A;  5JFR A;  1TQI A;  1HBX G;  2BBY A;  4HDU A;  1T6S A;  5E18 F;  2FEZ A;  5K5R A;  2FNA A;  1IN7 A;  5KVR A;  3HUG A;  2KIF A;  5IT9 Z;  1A04 A;  5DYM A;  3DPL C;  4LG0 B;  5K1Y A;  3MZH A;  4LK0 F;  2EV6 A;  1L3L A;  1BI3 A;  3HRM A;  1KU9 A;  3R61 A;  1U5T C;  4OU0 A;  2VOD A;  2P7V B;  3SHF A;  3HSR A;  3WTU C;  3JTG A;  3BJA A;  4EJV A;  2IRF G;  2Z3Y A;  2Y0M A;  2DAO A;  4RGR A;  2LDU A;  4XSZ F;  3HHH A;  5L3D A;  2W84 A;  3WG9 A;  4BHP A;  4UNO A;  4G7H F;  4A0Z A;  2VBZ A;  2VXZ A;  1XMA A;  1PDN C;  1WRJ A;  4RB0 A;  4U0Y A;  2ISZ A;  2LF8 A;  1U5T B;  4MTE A;  5CLS A;  4ZYH A;  4ENM A;  4AIJ A;  4HZF A;  4UV9 A;  2DT5 A;  4UVC A;  1I27 A;  1YW9 A;  1IN6 A;  5A2Q Z;  3WE2 A;  1V3F A;  2XKO A;  1HXD A;  4ETS A;  3BPX A;  1E2X A;  1UB9 A;  3ABT A;  5FLX Z;  3WE3 A;  1FBU A;  3R0J A;  3RYR A;  3M1E A;  3VFZ A;  1F4K A;  2DO7 A;  3ZPL A;  2X0L A;  4LB6 B;  1UHW A;  6PAX A;  3DPT A;  4HDV A;  5L3C A;  5H6R A;  3AAF A;  1MDM A;  4YFK F;  1QZZ A;  2OA4 A;  3T0Y A;  4R1H A;  3WGG A;  2FA5 A;  4A6E A;  2PLY A;  2IA0 A;  3ELK A;  3E5U A;  5LEJ A;  4QLC U;  4L5J A;  2Q0O A;  4EJW A;  3MWM A;  1O7L A;  4Q48 A;  5F6F A;  4OOI A;  3RKW A;  1CF7 A;  2PEX A;  3LFK A;  3Q9V A;  2M8E A;  3KLO A;  4EJT A;  1ONV A;  5HDN A;  5E1Z B;  2EFO A;  2Y75 A;  1YYV A;  1LEA A;  1XSV A;  3WTS C;  2NS0 A;  1WI9 A;  5ICG A;  1JHF A;  1MKM A;  1QZY A;  1ZN2 A;  3DXJ F;  2EFP A;  3MEX A;  3BRO A;  2FF4 A;  2OD5 A;  4IJA A;  4G6Q A;  4WXC A;  4KNY A;  2Z33 A;  2QBY B;  3RYP A;  1B59 A;  5D4R A;  2IPQ X;  2PG4 A;  1SD5 A;  3ZN1 A;  1PP7 U;  2YR2 A;  4N9I A;  1FBQ A;  3JAM K;  3L00 A;  1HKQ A;  1Z7U A;  3Q9S A;  1XSD A;  4KMF A;  4PGH A;  2EV0 A;  2V1U A;  3V8L A;  2V1X A;  2AS5 F;  1OMI A;  4HA8 A;  4FX0 A;  1U78 A;  4NQW A;  3BJO A;  3QU3 A;  1R36 A;  5CVI A;  3GO5 A;  2RQP A;  4G94 A;  4EGZ A;  5LGN A;  2CYY A;  4IPA A;  1ZAR A;  4K2E A;  1YS7 A;  1ZRE A;  2CSO A;  1IUY A;  1T2K A;  4Y13 A;  1S7O A;  1ZRC A;  2GXG A;  2QQB A;  1KGS A;  1H0M A;  2VOO A;  2W25 A;  2A6E F;  3BOQ A;  2XVC A;  2H6C A;  2P6T A;  1IN4 A;  3VB2 A;  4AIK A;  1ZGJ A;  5ICE A;  3RKX A;  4HV5 A;  2MH2 A;  2P6S A;  4OIO F;  4CYD A;  4G8X A;  2QZ8 A;  1XCV A;  1MD0 A;  2UXN A;  2LNB A;  1LDD A;  4RGX A;  3WTY C;  2ZJ2 A;  1SD4 A;  2F5D A;  4L9V A;  3SZT A;  2QYO A;  3LA3 A;  2A5Y B;  2R3S A;  2JPC A;  2O03 A;  3WTX C;  2Q8K A;  2QEN A;  2HOE A;  2H94 A;  4I2O A;  1GHC A;  2EJR A;  5D5V B;  3U2R A;  5LEK A;  3WTW C;  1O57 A;  1HW2 A;  4FT8 A;  5J8C A;  2Y48 A;  1U5T A;  2E1C A;  1BI0 A;  2FNP A;  1FBS A;  4OIR F;  4MTD A;  1H9T A;  5LGU A;  4LB5 A;  2VBX A;  4BAY A;  3FHZ A;  1QGP A;  5CJ9 A;  2WC2 A;  2IA2 A;  4BNC A;  3WGH A;  3I54 A;  1LNW A;  1R22 A;  2BYV E;  2FQ3 A;  3WTV C;  1IAW A;  3S2W A;  2RC4 A;  3CLO A;  4HW0 A;  2CO5 A;  2M30 A;  3ZN0 A;  2QWW A;  4CGZ A;  2O61 A;  4PDK A;  3J80 K;  1ZLJ A;  2P7C B;  1O7F A;  3HHG A;  3R4K A;  3KZZ A;  3C18 A;  5FD6 A;  4CDG A;  1SMT A;  2KRF A;  5AIP A;  2FBI A;  2HFH A;  3C1D A;  4WWC A;  1HW5 A;  2KIU A;  2A61 A;  4ZZL A;  1NHA A;  5E20 A;  5DD4 A;  1D5V A;  3FMS A;  2YSR A;  3HOT A;  1MDM B;  2YX7 A;  3GW2 A;  2RV8 A;  5D8L B;  3F21 A;  1O3S A;  4I02 A;  2DW4 A;  1H9G A;  3RI4 A;  1Z1D A;  3O6B B;  5H20 A;  2TDX A;  2O0Y A;  3D0S A;  4GYG A;  4UVB A;  2EFQ A;  3K9T A;  3IL2 A;  2RNJ A;  1YFH A;  2DK8 A;  4RAY A;  3KP5 A;  4GGG A;  3LA2 A;  4UVA A;  3J81 K;  1O3T A;  4BH9 A;  2QBY A;  3ERE D;  3FMQ A;  1D8J A;  4LGW A;  2V1D A;  3GWZ A;  2VE9 A;  3E97 A;  4KN4 X;  2MLG A;  3E5X A;  1KA8 A;  3E5Q A;  5DEQ A;  3FMR A;  1QQI A;  3E3V A;  4ZYG A;  3OV8 A;  4G6D A;  2JZY A;  1CGP A;  3FWE A;  1R5H A;  1RUO A;  2L3D A;  2LF7 A;  4HAM A;  4NHJ A;  4IRH A;  2IP2 A;  2ACJ A;  1OPC A;  4WCG A;  5D6E A;  4Q5S F;  3IC7 A;  1J7K A;  3LAJ A;  3IHU A;  1BI1 A;  2DBB A;  4BHB A;  4O5V A;  4LD5 A;  2D45 A;  2LKP A;  4FHT A;  5K5O A;  2RDP A;  3K69 A;  2EA2 A;  3T8R A;  4L0Z B;  2P5K A;  4L9J A;  3ZQ7 A;  3KFW X;  4EGY A;  1FP2 A;  3VOE A;  4HX7 A;  1MJA A;  1RZ4 A;  3GZ6 A;  5BOX A;  2HEO A;  1ON1 A;  2ISY A;  1YTY A;  3CJN A;  1YW8 A;  2XRN A;  4ASN A;  2OZ6 A;  1HQC A;  3BPV A;  1HKT A;  1T39 A;  5HLI A;  2CG4 A;  2XGX A;  4ZH4 F;  3WGI A;  3L09 A;  4AIH A;  1IXR C;  4MGR A;  1J2X A;  1B9M A;  2BEO A;  3L2C A;  4EM0 B;  2R7F A;  2L54 A;  1E17 A;  2ETH A;  2K4B A;  2F2E A;  2GWR A;  1ZRD A;  5D5U B;  2ZKZ A;  4PZJ A;  2O3F A;  1BBY A;  5DV5 A;  4EMS A;  5DUI A;  2A68 F;  1YG2 A;  4EQQ A;  1BM9 A;  3LAP A;  1R7J A;  3I59 A;  2HKX A;  1LQ1 A;  5DCF A;  4OMZ A;  5E17 F;  1HST A;  4YG2 F;  3R6S A;  1TNT A;  4I0A A;  1YQA A;  3U9G A;  5D8K B;  1K7A A;  2VN2 A;  3ZP5 A;  4IXA A;  3JSP A;  2NNY A;  4LJZ F;  3IKV A;  1FWZ A;  1Z91 A;  5K5Q A;  1K79 A;  1U6G A;  4PCQ A;  1FT9 A;  3F22 A;  1IRG A;  2D2W A;  3TO6 A;  2ZCW A;  5HDK A;  2ZFW A;  3MCZ A;  1U3E M;  4M9X A;  1ZAO A;  3I58 A;  3F8F A;  4CXF A;  3P9C A;  2C6Y A;  3T8T A;  3M9A A;  4RGU A;  5JR3 A;  5E1X A;  4L5I A;  1GXQ A;  4D0P A;  1EH6 A;  4KDP A;  2XAS A;  4A5M A;  2V79 A;  2STT A;  1AOY A;  3F6V A;  1LDJ A;  1RUN A;  3CUO A;  5D5X B;  4CO8 A;  3DQV C;  2XAJ A;  3FX3 A;  3GFJ A;  1XGM A;  3IWF A;  1R1T A;  2RVC A;  2MBF A;  1G3W A;  2VBW A;  2IVM A;  4YII A;  2HGC A;  4ESF A;  3JAM Z;  4ESJ A;  5LHH A;  3P9K A;  1FSE A;  2MA3 A;  2EWN A;  1X3U A;  2FSW A;  4BHC A;  4ENK A;  2JPB A;  3KEO A;  1J5Y A;  2BV6 A;  2L01 A;  1HW1 A;  5EEG A;  3TO7 A;  2HR3 A;  4HYE A;  5D6F A;  5DDG A;  3MFK A;  4XBF A;  1U8R A;  1FSH A;  2D1V A;  3K1M A;  2A69 F;  2CWE A;  3K0L A;  3E6C C;  3I71 A;  3E6B A;  1B9N A;  1P92 A;  2GIV A;  3N97 A;  3WTT C;  4OIQ F;  5J8F A;  4HQE A;  4M74 A;  2JRT A;  4MEX F;  1QPM A;  4O6J A;  2OU2 A;  1XB4 A;  4M6Y A;  5CVV A;  1XDU A;  4U0V A;  4MEY F;  2Q2E A;  3I4P A;  3M8F A;  3SFZ A;  5LLQ A;  2WWY A;  3F72 A;  4QWQ A;  4JQF A;  4NB5 A;  3V4G A;  1UCR A;  1V4R A;  3V7R A;  3FM3 A;  3EQL F;  1DDN A;  1TQP A;  1W5T A;  2HDC A;  3CO7 C;  2F5E A;  1BOA A;  5HVQ C;  1UST A;  1K78 B;  1RIO H;  1TW2 A;  4GXO A;  1XSX A;  1EV7 A;  1YS6 A;  2RN7 A;  1F9N A;  4P5O A;  4GO1 A;  2PMU A;  3F8M A;  1SFX A;  2K27 A;  2IT0 A;  3NEU A;  3GXO A;  1WKM A;  2A6H F;  4ON0 A;  2K7L A;  5JHU A;  1IN8 A;  1YO5 C;  2QLZ A;  5ICC A;  1WQ2 A;  4MQV A;  4L0Y B;  1XGN A;  4S05 A;  3GFL A;  2HTJ A;  3HTU A;  1R1U A;  3DEU A;  3CDH A;  2CQK A;  2GA2 A;  4FX4 A;  2EV5 A;  2FML A;  4HQM A;  1FZP B;  4IRI A;  2W57 A;  2M45 A;  4UV8 A;  4IF4 A;  4KIF A;  1TBX A;  5CVU A;  3WTZ A;  4LLN A;  2DPU A;  4M9S A;  4A2U A;  5L3F A;  4HF0 A;  4BQA A;  1SD7 A;  1ULY A;  3QAH A;  1JXS A;  3FZV A;  2UWM A;  3LQR A;  3EDP A;  5J6X A;  1FY7 A;  1KQ8 A;  1W7P B;  3GFI A;  3O2P E;  1ZYR F;  1DUX C;  2L4A A;  1R00 A;  5F64 A;  2EA4 A;  1ON2 A;  5DUK A;  3J80 Z;  4RAZ A;  2K86 A;  4AVP A;  2IW5 A;  3WU0 A;  2Z9O A;  1DPU A;  5HOO A;  5ICF A;  5L3B A;  4UXN A;  2QM3 A;  2PFB A;  4LMY A;  1TW3 A;  1L0O C;  3I59 B;  4N0B A;  3V8K A;  3C3W A;  3N4M A;  5BPI A;  1OKR A;  2GZW A;  3REO A;  1G4D A;  2V9V A;  4YFN F;  3K1P A;  2JTV A;  3IKT A;  4YFX F;  3CUQ C;  2XAG A;  2VT2 A;  4U88 A;  4EJO A;  3ZMV A;  4KN7 X;  1QBJ A;  1REP C;  3HRS A;  2FBK A;  2DQR A;  1RI7 A;  3RPU A;  3KP6 A;  3WU1 B;  4F7Z A;  4L18 B;  1HSJ A;  2STW A;  3KEQ A;  1LVA A;  1T38 A;  1J9I A;  3J81 Z;  2FMY A;  4KIC A;  4DNC A;  4BXU A;  1C0W A;  3GX4 X;  5JI6 A;  2KKO A;  4KT5 C;  4EM1 A;  5L3E A;  1ZG3 A;  2Z5U A;  4I7H A;  3F8C A;  2NYX A;  3HTS B;  3P9I A;  2VT3 A;  2FBH A;  2ZBK A;  3QRF F;  3K1N A;  5HS7 A;  2FOK A;  2GAU A;  1TLH B;  1IN5 A;  2EFW A;  2PJP A;  3VOD A;  5E8G A;  1OYW A;  3EET A;  5ERI A;  1G3T A;  2M5W A;  1SMY F;  1W5S A;  4HV6 A;  2P8T A;  2KJC A;  2J5O A;  3MAJ A;  3KET A;  1J0R A;  4HF1 A;  4XLP F;  2HTS A;  3KP4 A;  4KFC A;  4RB3 C;  3TQN A;  5FB2 A;  1WSU A;  3FXU A;  4E70 A;  2ZNZ A;  2B0L A;  5CVR A;  2PBI A;  2JT1 A;  4I09 A;  2MH9 A;  4I98 B;  2WV0 A;  4M73 A;  3KP7 A;  2O6G E;  3DP7 A;  3W6J B;  3F23 A;  1S7A A;  5HS8 A;  4HX8 A;  1K78 A;  2P5V A;  2ADU A;  2PQ8 A;  2DK5 A;  4ZYD A;  3JSO A;  3P7N A;  3IWZ A;  4XLN F;  3TO9 A;  4A0X A;  2HKO A;  3GVA A;  5LRR A;  3H3Z A;  2HZT A;  3SXY A;  3KLN A;  4ENJ A;  2G9W A;  1W7P D;  2GA1 A;  1JGS A;  3EUH A;  3RDI A;  1MJ9 A;  2X4H A;  1G3S A;  3BZ6 A;  1HKS A;  2Z99 A;  3KP2 A;  3T5X A;  3R60 A;  1IF1 A;  3MZY A;  3ABU A;  2NAZ A;  3W6K B;  3GZ5 A;  1Z9C A;  2DFI A;  1IRF A;  1FP1 D;  1S6L A;  2EK5 A;  4IHT A;  5D4S A;  5EEH A;  4CZZ A;  4JBA A;  3HYI A;  1I1S A;  3I64 A;  2NNN A;  1P2F A;  2BGC A;  4RB2 C;  3COA C;  2HWV A;  4Y15 A;  1JE8 A;  5HLG A;  3ZMS A;  2W24 A;  3BP8 A;  3LA7 A;  3ZMD A;  1W7P A;  4A5N A;  2QVO A;  2XAQ A;  3IRR A;  1FOK A;  3RJP A;  2XKP A;  2GXB A;  2VOP A;  3J7A O;  5DCM B;  1IZ1 A;  1OYY A;  1I5Z A;  2IJL A;  2DI3 A;  4WX9 A;  2PI0 A;  3H3U A;  3M8E A;  1P4X A;  1J75 A;  3DF8 A;  4U0W A;  2HQR A;  1B4A A;  4HF2 A;  3TOA A;  3FXR A;  4YIF A;  4R79 A;  3LWF A;  3TKY A;  2ZXJ A;  4L9N A;  1XCB A;  4A6D A;  3F6O A;  4OIN F;  3GLX A;  5LHI A;  4HOB A;  1SFU A;  3HSF A;  2BE5 F;  1KU7 A;  1ZG1 A;  4P55 A;  4Q47 A;  3FXQ A;  3ECO A;  3TOB A;  1XGS A;  1ZGA A;  3C7J A;  1LEB A;  4PGG A;  4IRG A;  5FD5 A;  3QU6 A;  5L3G A;  3V8J A;  3ISP A;  1TQM A;  1I6X A;  2VON A;  5FFX A;  2GQQ A;  4G7Z F;  1GXP A;  1XGO A;  4RS8 A;  2G7U A;  4L9T A;  1R5G A;  1S8N A;  2K4J A;  1MZB A;  3HRT A;  4KUM A;  5LGT A;  2YU3 A;  5IT9 K;  2ELH A;  4I01 A;  3BDD A;  4CIC A;  3CUQ A;  5JVT A;  1R1V A;  1BJA A;  2F5F A;  1SAX A;  2K02 A;  3LST A;  1D3Y A;  2H09 A;  3NQO A;  4KMU X;  5CYV A;  4HLY A;  4GYI A;  3GEZ A;  2PN6 A;  2NRA C;  3KZY A;  5HDG A;  3H92 A;  4A0Y A;  1R58 A;  3EYY A;  2DTR A;  4H0E A;  1PP8 F;  1D8K A;  5F1R A;  4MQ9 F;  1SFE A;  2G7H A;  2KIM A;  4LFU A;  5ILU A;  4ESB A;  3ZMZ A;  4Z2Y A;  2M87 A;  3KE2 A;  4AD9 A;  3FM5 A;  4UHT A;  2L02 A;  4Q4Z F;  3SZP A;  4EM2 A;  5FFZ A;  5DD8 A;  2OQG A;  1S29 A;  1MJB A;  2IA1 A;  5A2Q K;  1XN7 A;  1K6O A;  2ZME B;  2R7D A;  1SD6 A;  1B1B A;  1KYW A;  4EV0 A;  3RPQ A;  2RGV A;  1WWX A;  3KCC A;  3QPT A;  3GFM A;  5FLX K;  3PQJ A;  3ZMU A;  1Q1H A;  3SQN A;  4I0B A;  1TNS A;  3B02 A;  5H6Q A;  5HS9 A;  3IRQ A;  2CFX A;  2HQN A;  2P4W A;  3U1D A;  2VC1 A;  4U7B A;  4Y17 A;  3RTR A;  1FYK A;  2FU4 A;  3E6D A;  1UHM A;  4ZYE A;  4MHG A;  4XSX F;  2F5C A;  1T0F A;  4LK1 F;  2ESH A;  1KQ0 A;  5CVJ A;  2QQA A;  2FE3 A;  3R0A A;  3F8B A;  2O8X A;  4GCV A;  1ZRF A;  3DKW A;  1XD7 A;  3MQ0 A;  5FGM A;  1AWC A;  1LDK B;  2W85 A;  3L9F A;  2WTE A;  2M1B A;  3HIF A;  4HLX A;  4KYW A;  5BS6 A;  2H6B A;  1DPR A;  2OZU A;  2YX4 A;  3F8N A;  3L7W A;  1G6N A;  4S04 A;  5KK1 A;  1Z6T A;  4P96 A;  2PMH A;  4M71 A;  4KIG A;  3Q5F A;  2E7X A;  3I0T A;  4BYY A;  3BWG A;  2A3S A;  4ZZD A;  2RKH A;  2UZK A;  4LLG F;  3TDZ C;  1FYL A;  3RKY A;  1MGT A;  5DCM A;  3ZMT A;  2VBY A;  1R23 A;  2L4M A;  1ZLK A;  1BIA A;  3KP3 A;  4G9Y A;  1QNT A;  4LG0 A;  2VC0 A;  3V7C A;  2ESN A;  3HRU A;  2XHK A;  1YIO A;  4EVI A;  3I53 A;  4M9Z A;  2XAF A;  3ROU A;  4WK8 F;  3K2Z A;  1ZG5 A;  4B09 A;  1GVJ A;  1W4M A;  1G3Y A;  5D5W B;  1XDS A;  4MNU A;  2HYF A;  1IXC A;  5ILS A;  2XAH A;  1ODD A;  4OMY A;  1FLI A;  4G7O F;  4TV7 A;  1F5T A;  2ZNY A;  4M6X A;  1KQ9 A;  1Y0U A;  3EYI A;  2MC3 A;  3LQQ A;  5ILV A;  2UXX A;  4WXD A;  1QO0 D;  2CW0 F;  1BN5 A;  1RNL A;  2MLK A;  4N9H A;  3PFI A;  4IHS A;  4XRF A;  5E1W A;  1ZH5 A;  1FPQ A;  1LJ9 A;  4KA4 A;  4HBL A;  2CGP A;  2COM A;  1TTY A;  5AIQ A;  3G73 A;  1F1Z A;  1KU2 A;  5ED4 A;  2QQ9 A;  3ML6 A;  4KIB A;  5AON A;  2QUF A;  3QP6 A;  5BPD A;  1XMK A;  2FXA A;  1FC3 A;  2E7W A;  3NRV A;  5TJJ A;  1BIB A;  3WOD F;  2DPD A;  2XUB A;  1ZHF A;  1IW7 F;  2D1H A;  1P6R A;  3CUQ B;  2XIG A;  3ECH A;  2H27 A;  1O3R A;  5LRS A;  2V6C A;  1KU3 A;  4RB1 A;  3O3K A;  4JK1 X;  4P9U A;  1OYI A;  3HSE A;  4IVN A;  4EJU A;  2JSC A;  3VEP A;  4WXH A;  1IXS B;  3QOP A;  4CHU A;  5IT3 A;  2ZME A;  5BQT A;  1UFM A;  1STZ A;  3JW4 A;  1P4A A;  1OR7 A;  4OIP F;  4M72 A;  1FNN A;  3PQK A;  3V7S A;  4HX4 A;  2OAZ A;  4WF2 A;  5LHG A;  1EH8 A;  2A07 F;  2DU9 A;  2P5L C;  3JTH A;  3TDU C;  3D5L A;  1P4W A;  1LB2 A;  1CF7 B;  2EFN A;  2FRH A;  5FO5 A;  3GF2 A;  2AXL A;  3DV8 A;  4U7D A;  3ULQ B;  1I1G A;  3G3Z A;  3M7G A;  3QP5 A;  1USS A;  4O3M A;  3I5U A;  3HOS A;  3FF5 A;  2DLL A;  3TGN A;  2J5P A;  3QPH A;  4B8X A;  5BMZ A;  5TRD A;  1B6A A;  2HS5 A;  1BI2 A;  1EH7 A;  2OQR A;  1FYM A;  2E1N A;  1BC8 C; 
#chains in the Genus database with same CATH topology
 2VE8 A;  3KYD B;  3CTA A;  5E3O A;  2KRC A;  3RIR A;  3S17 J;  1VQ7 I;  3GUD A;  2DA1 A;  3E6M A;  1PUE E;  4IEJ A;  3B73 A;  3QPS A;  2X1E A;  1NK2 P;  3GYH X;  4RGS A;  1MH3 A;  4IO9 F;  2X6X A;  5E8I A;  3BY6 A;  3HOW J;  1FX7 A;  5HLH A;  3PFY A;  4RLF A;  3ZR8 X;  4ZDO A;  5LBQ A;  1Z05 A;  2BY3 A;  5FKM A;  4UUV A;  4LLL A;  1MMD A;  2KJB A;  1PJR A;  2CFO A;  1O3Q A;  2DMU A;  1T33 A;  1UEL B;  2HYG D;  2LSO A;  3AG3 H;  3PIO F;  5FKL A;  4AWX B;  1G59 A;  2EB7 A;  3CO6 C;  5J40 A;  2VKE A;  3F3X A;  1Z6R A;  2ZXI A;  4A12 A;  1XG1 A;  1WI3 A;  2XRO A;  4BEH A;  3BJ6 A;  2DQL A;  2K9M A;  2E2J J;  1T98 A;  2OBP A;  2V9P A;  3BQZ A;  2R7U A;  1SVO A;  1VTN C;  1VI0 A;  1U2W A;  1WPK A;  2XV4 S;  5EGO B;  1F43 A;  3ABM H;  2VKD A;  4D5F A;  3DFG A;  4NQW B;  1IDY A;  1J59 A;  1JHH A;  1YX3 A;  1DP7 P;  2R5Z B;  2VAS A;  3T1B A;  1BC7 C;  1SVM A;  1YW7 A;  4NUB A;  2Q1Z B;  2ZO4 A;  2AXT C;  4DQ2 A;  3JRA A;  3WG7 H;  4ENN A;  1WGX A;  1P7I A;  4AUX A;  1YLF A;  1KYZ A;  3C2H A;  1BOB A;  3DBH B;  3OOP A;  3CDL A;  2MD5 A;  2DT6 A;  1APL C;  4RAG A;  4B4C A;  1S3J A;  2YPR A;  4P9F A;  4R8H A;  4XLH A;  4PJN A;  5JFR A;  1TQI A;  3OYF A;  2NVX J;  2ZXW H;  1HBX G;  2BBY A;  1CQT A;  4HDU A;  1T6S A;  2JA6 J;  1I50 J;  1AA7 A;  2B7E A;  5E18 F;  2FEZ A;  5FKN A;  5B66 C;  5K5R A;  2FNA A;  1IN7 A;  5KVR A;  2E71 A;  3HUG A;  1LFU P;  3CJR B;  2K3P A;  2KIF A;  2X48 A;  4C2T A;  4IKF A;  3CMM A;  1A04 A;  1XC5 A;  5IT9 Z;  5DYM A;  2QF7 A;  3DPL C;  2LRD A;  4LG0 B;  2VUM J;  4JYK A;  2JA2 A;  4XKC A;  3GTJ J;  4BBR J;  1OCC H;  3BTI A;  3S8P A;  3CES A;  5K1Y A;  2L7K A;  3MZH A;  2ZB9 A;  2CV1 A;  4LK0 F;  5FLV A;  2K9S A;  2EV6 A;  2R92 J;  1L3L A;  1BI3 A;  3HRM A;  4BBS J;  4J19 A;  1KU9 A;  3R61 A;  1U5T C;  4OU0 A;  2VOD A;  2P7V B;  3SHF A;  3HSR A;  5F1J A;  3WTU C;  1MND A;  3CJQ B;  3JTG A;  4BE0 A;  1MBE A;  5M5X J;  1AHD P;  3BJA A;  3I9V 2;  4PJJ A;  4EJV A;  2IRF G;  2Z3Y A;  2Y0M A;  1X3Z B;  2DAO A;  4RGR A;  1OFC X;  4I6Z A;  2LDU A;  4XSZ F;  5IYD J;  4BJT A;  5KNL A;  1VQ9 I;  1X1P A;  3HHH A;  1N77 A;  1YX5 A;  2XPV A;  1K4S A;  5L3D A;  1EA3 A;  2IGM A;  1WJA A;  2W84 A;  1BJZ A;  3WG9 A;  4BHP A;  4UNO A;  1IDZ A;  2DA6 A;  1YRN B;  5FRO A;  4MIM A;  4G7H F;  2CUF A;  4A0Z A;  5CQE A;  2VBZ A;  1OLT A;  1WCM J;  2VXZ A;  1XMA A;  4ZJZ A;  1MW7 A;  5GPC A;  1PDN C;  1WRJ A;  3I3L A;  4RB0 A;  4U0Y A;  2F4I A;  2ISZ A;  2LF8 A;  1U5T B;  4MTE A;  5CLS A;  4ZYH A;  4J00 A;  4ENM A;  4AIJ A;  4HZF A;  4UV9 A;  1LFB A;  2DT5 A;  1YOV B;  4UVC A;  1I27 A;  4UY8 I;  4BDY A;  1K4T A;  1YW9 A;  1IN6 A;  5A2Q Z;  1ACI A;  3D5S C;  2MYS A;  3WE2 A;  1V3F A;  3OYB A;  4CH7 A;  2BW3 A;  1HXD A;  2XKO A;  4ETS A;  2TCT A;  3BPX A;  1FTT A;  3SFI A;  1E2X A;  2H1K A;  1UB9 A;  4E7H A;  1R4M B;  3ABT A;  3PUF A;  2M8G X;  5FLX Z;  2CUE A;  3WE3 A;  2DMQ A;  2L9R A;  1FBU A;  3R0J A;  2KIQ A;  3RYR A;  2ECB A;  3M1E A;  2R7Z J;  3VFZ A;  1F4K A;  2DO7 A;  3VDX A;  3ZPL A;  3FK6 A;  2Z16 A;  3C2G A;  2X0L A;  1S5L C;  4DZJ A;  2R7S A;  4LB6 B;  1UHW A;  6PAX A;  1A5J A;  3DPT A;  3ZQL A;  3HGY A;  4HDV A;  5L3C A;  5H6R A;  3OYM A;  3AAF A;  2CUJ A;  1MDM A;  5IOZ A;  4YFK F;  1Y8Q B;  1H89 C;  1X4P A;  1QZZ A;  2NXN B;  1B8I B;  2HQA A;  4DIQ A;  2OA4 A;  3OYD A;  3T0Y A;  2TRT A;  4R1H A;  3WGG A;  3L2Q A;  2FA5 A;  3HJE A;  1YIT I;  4A6E A;  2PLY A;  1LKX A;  1W36 D;  2IA0 A;  3ELK A;  2X51 A;  2PMZ N;  3E5U A;  5LEJ A;  4QLC U;  1E3H A;  3S1R J;  4L5J A;  4W97 A;  3HOV J;  2Q0O A;  2OUM A;  1WH5 A;  4EJW A;  4RA2 A;  2GIZ A;  1MSE C;  3MWM A;  1O7L A;  4Q48 A;  5F6F A;  4OOI A;  4XR6 A;  1VQ5 I;  3RKW A;  1CF7 A;  2PEX A;  3LFK A;  3G1O A;  2O9L A;  3Q9V A;  3ZXS A;  2M8E A;  3BTJ A;  3KLO A;  4EJT A;  4JX4 A;  1ONV A;  2IS1 A;  3J7A Y;  5HDN A;  4AVZ A;  2DFH A;  5E1Z B;  1A31 A;  3AL0 B;  3CC7 I;  1JKQ C;  3MKZ A;  2PJR B;  2EFO A;  2Y75 A;  1YYV A;  1LEA A;  3BR6 A;  3CDI A;  1FOX A;  3LSR A;  3HZJ A;  1XSV A;  2DA7 A;  4XN0 A;  5IP6 A;  3I4M J;  3WTS C;  2NS0 A;  1WI9 A;  3BR1 A;  5ICG A;  3CC2 I;  1LE8 A;  3H9J A;  1JHF A;  1WJE A;  2X1D A;  1VQP I;  5KAF C;  3V42 A;  1MKM A;  1QZY A;  1ZN2 A;  3DXJ F;  1GV2 A;  2EFP A;  3MEX A;  2G0E A;  5J4Y A;  3BRO A;  4IHW A;  2FF4 A;  2OD5 A;  4IJA A;  2VXD A;  2ICW G;  5IYC J;  3A0B C;  3DPU A;  3OYK A;  1MH4 A;  4G6Q A;  2DA2 A;  4WXC A;  3S1M J;  2NOJ B;  4XID A;  3QWL A;  4KNY A;  1NTC A;  1SVL A;  2Z33 A;  2IGK A;  2QBY B;  3RYP A;  1B59 A;  5D4R A;  2IPQ X;  2PG4 A;  1SD5 A;  2ZFU A;  3ZN1 A;  1PP7 U;  2JVH A;  1VFC A;  2YR2 A;  4N9I A;  2HOT A;  1FBQ A;  2I5U A;  3VPR A;  3JAM K;  1YJW I;  4BE1 A;  3L00 A;  1HKQ A;  1Z7U A;  3Q9S A;  1XSD A;  2IS6 A;  2QKL B;  4XLA A;  1QA6 A;  3ASN H;  3IAM 2;  3EUH C;  4M3F A;  4KMF A;  4PGH A;  2EV0 A;  5EG0 B;  3SDG A;  2V1U A;  2M4G A;  3V8L A;  2V1X A;  2AS5 F;  1OMI A;  3OS1 A;  4HA8 A;  4FX0 A;  2LVS A;  5IP9 J;  1U78 A;  4NQW A;  3C2B A;  3BJO A;  2R5Z A;  1SFO J;  3QU3 A;  1R36 A;  5CVI A;  3GO5 A;  5GAH J;  4IHY A;  2RQP A;  4G94 A;  5J1U A;  4EGZ A;  3K70 C;  1X19 A;  5LGN A;  2CYY A;  4IPA A;  2LR8 A;  2E1M C;  2XDV A;  1ZAR A;  4K2E A;  1D5Y A;  1YS7 A;  1ZRE A;  1BR1 A;  3ZQG A;  2Y9Y A;  3MVP A;  4B3A A;  2CSO A;  2AO9 A;  1IUY A;  1T2K A;  5DS9 A;  4Y13 A;  3JR9 A;  1FTZ A;  1S7O A;  1ZRC A;  2GXG A;  2QQB A;  1KGS A;  3UKG A;  5F08 A;  1H0M A;  2VOO A;  2W25 A;  3PJR A;  2HYJ A;  4HNU A;  2A6E F;  2DJN A;  3BOQ A;  3QQA A;  4BEH B;  2XVC A;  3GBG A;  2H6C A;  2P6T A;  4HNT A;  1IG7 A;  1IN4 A;  1W1W E;  2AQE A;  3BCA A;  3KYL A;  3VB2 A;  2V26 A;  4AIK A;  2B63 J;  4KT6 A;  1ZGJ A;  5ICE A;  3RKX A;  4HV5 A;  1WZ2 A;  1U9O A;  2VPR A;  2MH2 A;  3PIP F;  4IOC F;  2DA5 A;  2P6S A;  3G2B A;  4OIO F;  3TP3 A;  4CYD A;  4G8X A;  4BDZ A;  1ERD A;  4ZDL A;  3M8J A;  2QZ8 A;  1XCV A;  1YJ9 I;  4PJ0 C;  4V2F A;  2K9N A;  1NK3 P;  1MD0 A;  2HU9 A;  3N05 A;  1Y0N A;  1JKP C;  2F4M B;  2HZD A;  2JN6 A;  1AU7 A;  2UXN A;  4C2M J;  2LNB A;  4XON A;  1LDD A;  4RGX A;  2OV7 A;  3WTY C;  1JT0 A;  4PJL A;  1Y56 A;  2OTL I;  1I3A A;  2ZJ2 A;  1SD4 A;  3CZ6 A;  2F5D A;  4L9V A;  3SZT A;  3G4S I;  2QYO A;  1MBG A;  2W00 A;  3E1S A;  3LA3 A;  5IYB J;  4DBR A;  2A5Y B;  2R3S A;  2KRH A;  1R6R A;  2JPC A;  2O03 A;  1JGG A;  4NC6 A;  2ID6 A;  2YS9 A;  4ABZ A;  3LSI A;  3WTX C;  2Q8K A;  2QEN A;  4IOA F;  4PK4 A;  2HOE A;  2H94 A;  2JUC A;  4I2O A;  1GHC A;  2EJR A;  3QYB A;  3B6C A;  5D5V B;  4M6V A;  5F27 A;  3U2R A;  5LEK A;  4D9J A;  2VIX A;  3WTW C;  1TWF J;  3JRE A;  4A3K J;  1O57 A;  3ZQF A;  4D7N A;  1HW2 A;  4CCJ A;  4Y52 J;  4FT8 A;  5J8C A;  2CQX A;  2Y48 A;  3L1P A;  1ZGW A;  1G2H A;  1U5T A;  2E1C A;  1BI0 A;  2Z1D A;  2X85 A;  2IGN A;  3S1N J;  3DEW A;  1Y6I A;  2FNP A;  1FBS A;  2Y69 H;  5J1R A;  2NOG A;  2BHZ A;  4C3J J;  4OIR F;  3OYI A;  4Y33 A;  4MTD A;  4BQN A;  1H9T A;  4HRI A;  4E6K G;  2EZI A;  5LGU A;  2VBX A;  4LB5 A;  4BAY A;  3L2R A;  3FHZ A;  2XSJ C;  5J4V A;  5J47 A;  1QGP A;  5CJ9 A;  3F9K A;  5GPA A;  4NNJ A;  2WC2 A;  1ZK8 A;  2E5Z A;  2XF7 A;  2R5Y A;  2IA2 A;  3G6E I;  5HNH A;  4XM3 A;  5J3L A;  3DLL F;  3CCM I;  4BNC A;  3WGH A;  2CRG A;  3I54 A;  1LNW A;  3KPH A;  1R22 A;  2BYV E;  1WVR A;  2R7T A;  2FQ3 A;  2KDZ A;  3IP4 B;  2HXO A;  3X2Q H;  1ZR2 A;  1A35 A;  5GP9 A;  2VJI A;  4G12 A;  1ZTR A;  3WTV C;  1IAW A;  3S2W A;  1AKH A;  2RC4 A;  3CLO A;  4HW0 A;  2DTZ A;  2R4G A;  5GAG J;  1N25 A;  1K83 J;  2CO5 A;  1MMG A;  1POG A;  2M30 A;  2NVQ J;  3ZN0 A;  2QWW A;  4CGZ A;  2O61 A;  4PDK A;  5E3N A;  3J80 K;  3ZCO A;  1ZLJ A;  3PUB A;  2P7C B;  1O7F A;  2IBD A;  3S16 J;  5M5Y J;  2BW3 B;  3TW6 A;  3HHG A;  1Z77 A;  3R4K A;  3KZZ A;  1D0Y A;  1TC3 C;  3C18 A;  5FD6 A;  3QYF A;  4CDG A;  4XLC A;  1SMT A;  2KRF A;  2K85 A;  1WJD A;  3ZQI A;  2E19 A;  5AIP A;  4YEL A;  2FBI A;  1MBK A;  2HFH A;  5F0H A;  4AYB A;  3C1D A;  4WWC A;  1HW5 A;  2KIU A;  3PM1 A;  1EJ9 A;  5HOD A;  2A61 A;  4ZZL A;  1NHA A;  1DGR M;  5DD4 A;  5E20 A;  5GAE J;  1D5V A;  3FMS A;  2KHM A;  2YSR A;  4H4K C;  3HOT A;  1MDM B;  2YX7 A;  3GW2 A;  3LSK A;  1XX5 A;  1PVE A;  3A2K A;  2RV8 A;  2L9V A;  2MC4 A;  5D8L B;  2PJR A;  2ZJP F;  2R93 J;  3F21 A;  1O3S A;  2VQL A;  1LUJ B;  2DW4 A;  4I02 A;  2IS4 A;  1TWG J;  2KL4 A;  3CP2 A;  5BNG A;  3BCB A;  1H9G A;  1NG7 A;  3K10 A;  3RI4 A;  2KFD A;  1Z1D A;  4LIT A;  3O6B B;  1M1E B;  5H20 A;  2BY2 A;  2TDX A;  2O0Y A;  3D0S A;  4HPQ A;  4GYG A;  4UVB A;  3K4K A;  2EFQ A;  2LBF A;  2WY8 Q;  3K9T A;  3IL2 A;  3H35 A;  2RNJ A;  1YFH A;  2DK8 A;  1UZC A;  4RAY A;  2O8K A;  5HLT A;  3KP5 A;  2X6W A;  4GGG A;  3JRF A;  2L7Z A;  3CD6 I;  3LA2 A;  1DU0 A;  3FK7 A;  4UVA A;  1OCT C;  2LLK A;  3J81 K;  1SEU A;  1XMX A;  2VQC A;  1O3T A;  2E5N A;  4BH9 A;  2QBY A;  3ERE D;  3FMQ A;  2L7F P;  1D8J A;  4LGW A;  1MMN A;  2ECC A;  4A3J J;  3W2V A;  2V1D A;  3GWZ A;  3K70 D;  2VE9 A;  2KP6 A;  3S2H J;  3E97 A;  3LSP A;  4UB8 C;  2JUG A;  1LPQ A;  4KN4 X;  2MLG A;  2XGC A;  3E5X A;  1KA8 A;  3E5Q A;  5DEQ A;  5EG0 A;  2HOS A;  2M0C A;  3FMR A;  3K4J A;  2WBM A;  1QQI A;  3HB9 A;  4BGD A;  4BQQ A;  2XB5 A;  3E3V A;  3J7Z I;  2L0K A;  2QGU A;  3VYS B;  4ZYG A;  3JRI A;  1FMV A;  3OV8 A;  3CCY A;  1MNM C;  4G6D A;  2JZY A;  1CGP A;  3FWE A;  1R5H A;  1RUO A;  2L9N A;  2L3D A;  2LF7 A;  4HAM A;  4NHJ A;  3HEF A;  3QYE A;  3HPH A;  4UUS B;  1R49 A;  1QVT A;  4IRH A;  2IP2 A;  3FHN A;  2ACJ A;  3TW7 A;  3CCR I;  1OPC A;  2BVL A;  2Q2E B;  5GTI C;  3OS2 A;  3S32 A;  3W2A A;  2H8R A;  4WCG A;  2K9Q A;  3UR3 C;  5HNF A;  5D6E A;  3PO2 J;  4Q5S F;  2ZJQ F;  4NDL A;  3EPZ A;  3IC7 A;  4QPO A;  1J7K A;  9ANT A;  4XL9 A;  3HOZ J;  3LAJ A;  2UV1 A;  4DW6 A;  2DCE A;  3IHU A;  1R71 A;  3MKL A;  4NC7 A;  3VSL A;  1BI1 A;  2DBB A;  2W1O A;  3ONQ A;  3Q3S A;  3P5J A;  4O5V A;  2E1O A;  4BHB A;  2OPT A;  4LD5 A;  1V55 H;  1SAN A;  2D45 A;  2XF5 A;  4CYC A;  2LKP A;  4FHT A;  5K5O A;  2RDP A;  2HPM A;  3K69 A;  2EA2 A;  3T8R A;  4L0Z B;  4XK4 A;  2P5K A;  4L9J A;  2DFF A;  4BY7 J;  4CCM A;  5C3E J;  1VQ6 I;  1MNE A;  3ZQ7 A;  4AC0 A;  3KFW X;  2JSP A;  4OAZ A;  3VYT B;  4EGY A;  1FP2 A;  3VOE A;  4HX7 A;  3BG6 A;  1UG0 A;  1MJA A;  1RZ4 A;  1VQ4 I;  1JKR C;  1VQK I;  3GZ6 A;  1FEX A;  2ELK A;  5BOX A;  2HEO A;  1ON1 A;  1TZL A;  1UAA A;  2CUZ A;  5H2F C;  4IZZ A;  2ISY A;  2F6C A;  1YTY A;  3CJN A;  1TWA J;  1YW8 A;  2XRN A;  4ASN A;  2OZ6 A;  1HQC A;  3CP8 A;  2ZC2 A;  3BPV A;  1HKT A;  1P7J A;  1T39 A;  2W82 A;  5HLI A;  2CG4 A;  2XGX A;  4ZH4 F;  3WGI A;  1FMW A;  3LSJ A;  2DOE A;  3VYU B;  3L09 A;  4AIH A;  1X2M A;  2JVG A;  1IXR C;  3PL8 A;  1X3W B;  4MGR A;  3ZQC A;  1J2X A;  1B9M A;  2ZXH A;  2BEO A;  4MFE A;  3L2C A;  4EM0 B;  2JA8 J;  2R7F A;  2FX0 A;  2L54 A;  1BR4 A;  1DU6 A;  1E17 A;  2ETH A;  2K4B A;  2F2E A;  2UUZ A;  2GWR A;  1ZRD A;  1WFX A;  5D5U B;  2ZKZ A;  4BJ6 C;  4PZJ A;  2O3F A;  3M1C A;  2ZJR F;  1DP3 A;  2NS8 A;  3MN2 A;  1BBY A;  3OR2 C;  2QSH X;  5DV5 A;  4EMS A;  2WA0 A;  5DUI A;  1OQY A;  2A68 F;  1IC8 A;  1YG2 A;  4EQQ A;  1BM9 A;  1Q1V A;  1D1C A;  3LAP A;  1IRX A;  4IL6 C;  2R7V A;  1R7J A;  3ZGK A;  3I59 A;  2LD5 A;  5LD2 C;  2HKX A;  4B3X A;  1LQ1 A;  5DCF A;  3E0J B;  4OMZ A;  2DOA A;  4A3B J;  5E17 F;  4M3E A;  1HST A;  4C3H J;  4YG2 F;  3R6S A;  2XB0 X;  1ETQ A;  2A6T A;  4HSR A;  3JRB A;  2ZSH B;  1TNT A;  3A4C A;  4I0A A;  1YQA A;  2X6Y A;  3U9G A;  5D8K B;  1K7A A;  2VN2 A;  3NAR A;  5B5E C;  5E3M A;  4IXA A;  3ZP5 A;  1TP4 A;  3JSP A;  2NNY A;  4LJZ F;  1E0E A;  3IKV A;  1FWZ A;  3IV5 A;  1Z91 A;  5K5Q A;  1H8A C;  1S72 I;  3BR5 A;  1K79 A;  1U6G A;  3GLL A;  3OR1 C;  1UMQ A;  3QPL A;  4PCQ A;  1FT9 A;  1SC7 A;  3MKW B;  3CCL I;  3F22 A;  1IRG A;  2D2W A;  3GTQ J;  2XPW A;  3TO6 A;  1U0J A;  4HG2 A;  3RKQ A;  5IOY A;  3OYA A;  1JTY A;  2ZCW A;  1W0T A;  1SAU A;  4M3G A;  5HDK A;  2ZFW A;  3S93 A;  3OYN A;  1ITY A;  4D7M A;  2LH9 A;  3BTC A;  2R5Y B;  3DWL E;  5F04 A;  1N75 A;  4DGW B;  3MCZ A;  3G1M A;  1U3E M;  2KPM A;  1HLV A;  4M9X A;  1ZAO A;  2EZL A;  4IQJ A;  3HPG A;  3GME A;  3I58 A;  2VJ4 A;  3F8F A;  5K7F A;  4CXF A;  3P9C A;  1F36 A;  1AKH B;  1BW6 A;  2C6Y A;  3T8T A;  3M9A A;  4RGU A;  5JR3 A;  5E1X A;  1JTX A;  3DBL B;  4L5I A;  4KIS A;  4FCY A;  1GXQ A;  4BKX A;  4JX5 A;  3BR2 A;  4D0P A;  1EH6 A;  4KDP A;  3L2U A;  1JT6 A;  2XAS A;  4A5M A;  3BZK A;  2V79 A;  2STT A;  4PFP A;  3CCJ I;  1AOY A;  3F6V A;  4ZDP A;  1LDJ A;  4Y7N J;  2ZME C;  2DMT A;  3CUO A;  5D5X B;  1RUN A;  5GAD J;  3RZO J;  2V9K A;  1MIJ A;  4CO8 A;  3DQV C;  2XAJ A;  2LY1 A;  3FX3 A;  3GFJ A;  1S7E A;  1XGM A;  3IWF A;  1R1T A;  2RVC A;  2MBF A;  4FTH A;  2O5R A;  2MD0 A;  1OR7 C;  1G3W A;  2LK2 A;  2VBW A;  2IVM A;  4A69 C;  2XSD C;  3DTE A;  4YII A;  2HGC A;  1N78 A;  4ESF A;  3BZC A;  2GOX B;  3JAM Z;  4ESJ A;  2E60 A;  1QU3 A;  5LHH A;  2V7F A;  3DKY A;  1FSE A;  3NAU A;  3P9K A;  2MA3 A;  2EWN A;  1X3U A;  4X6A J;  2FSW A;  4BHC A;  3BR3 A;  4OWR B;  4ENK A;  2JPB A;  3KEO A;  1J5Y A;  3RSN A;  1EF4 A;  2BV6 A;  4E4H A;  4S0H B;  2L01 A;  1HW1 A;  2M3A A;  1JUS A;  5EEG A;  2L7M P;  4AID A;  3OYJ A;  3TO7 A;  4E7S A;  1VQN I;  3D1N I;  2HR3 A;  2BXZ A;  4HYE A;  5D6F A;  2EPF A;  5DDG A;  3MFK A;  4FQG A;  3LSG A;  4F55 A;  1FIA A;  4XBF A;  3GTO J;  2MW8 A;  3PSI A;  4II2 A;  3SZG A;  1U8R A;  1FSH A;  2D1V A;  2Y2Z A;  2LRE A;  2LBF B;  3FIS A;  3K1M A;  2A69 F;  2CWE A;  3K0L A;  3E6C C;  3I71 A;  3E6B A;  1RC9 A;  2XAU A;  1B9N A;  1P92 A;  2GIV A;  1OJL A;  3N97 A;  1G8X A;  3WTT C;  1FOY A;  4OIQ F;  5J8F A;  3K7A J;  4M74 A;  2R0Q C;  4HQE A;  3RCO A;  1VND A;  2JRT A;  1EKE A;  2E34 A;  4BUP A;  3HKZ A;  2LP0 A;  1TT0 A;  3VSK A;  1OCZ H;  4MEX F;  1QPM A;  4O6J A;  2MSY A;  4G6T B;  4UUS A;  2OU2 A;  1XB4 A;  3BLY A;  4M6Y A;  5CVV A;  2DFE A;  1XDU A;  4U0V A;  4MEY F;  5B3S H;  1R4N B;  5TGT A;  2Q2E A;  3I4P A;  2JA5 J;  5EF6 A;  3M8F A;  3SFZ A;  3AG1 H;  4UB6 C;  5LLQ A;  2WWY A;  2IXS A;  3F72 A;  4QWQ A;  3JRH A;  3H5N A;  4JQF A;  4NB5 A;  3V4G A;  4A3G J;  3K4N A;  1UCR A;  2VB6 A;  1V4R A;  3V7R A;  3FM3 A;  3EQL F;  1DDN A;  1TQP A;  1W5T A;  2HDC A;  3CO7 C;  1TWC J;  1GV5 A;  2F5E A;  1BOA A;  5KCM A;  2OJE D;  5HVQ C;  2XGE A;  1E3P A;  1UST A;  2WB1 A;  1K78 B;  4BXF A;  1RIO H;  1S9H A;  1TW2 A;  3CF2 A;  1JKO C;  3OMY A;  3S3M A;  1BW5 A;  4GXO A;  2A05 A;  1XSX A;  1EV7 A;  1TT5 B;  1YS6 A;  1MBJ A;  2RN7 A;  1F9N A;  1Z21 A;  4P5O A;  2FQ4 A;  4GO1 A;  1QPI A;  1R5I D;  2PMU A;  2R7W A;  4F92 B;  3F8M A;  1SFX A;  2K27 A;  2MFZ A;  3BG7 A;  2IT0 A;  3NEU A;  3GXO A;  3OIQ A;  1WKM A;  3Q0U A;  4MO7 A;  1V5G A;  3CCV I;  4JOM A;  4DJA A;  2E35 A;  1ZKG A;  2A6H F;  4ON0 A;  4HST A;  2K7L A;  1U9N A;  5JHU A;  1IN8 A;  1YO5 C;  2QLZ A;  5ICC A;  1WQ2 A;  2CQN A;  4MQV A;  4L0Y B;  1XGN A;  4S05 A;  2M7B A;  1TWH J;  3GFL A;  3ABK H;  3NWS A;  4CYC B;  3KEY A;  3CLQ A;  3MMY B;  3UNG C;  2E1M B;  4BAC A;  2DOF A;  2JRM A;  2HTJ A;  3H1C A;  3HTU A;  1R1U A;  3U1K A;  3DEU A;  3CDH A;  2CQK A;  3FDY A;  2GA2 A;  5J1Y A;  4FE7 A;  3A01 B;  4FX4 A;  4F52 A;  2EV5 A;  2FML A;  4HQM A;  1FZP B;  4IRI A;  2W57 A;  4AM3 A;  2M45 A;  3KZI C;  3PSF A;  4UV8 A;  4BQO A;  4IF4 A;  4KIF A;  1TBX A;  1ETV A;  1X1C A;  5CVU A;  5KAI C;  3WTZ A;  4LLN A;  2DPU A;  4M9S A;  1LVK A;  3L2V A;  4W1U A;  4A2U A;  1A36 A;  5L3F A;  4HF0 A;  4BQA A;  1SD7 A;  1ULY A;  2CV2 A;  2CH0 A;  1OCR H;  3QAH A;  3KYC B;  1JXS A;  3FZV A;  2UWM A;  2ID3 A;  3LQR A;  3EDP A;  3OWT A;  5J6X A;  2R7R A;  3WHC A;  5FLM J;  5K7Z A;  2VL8 A;  3FBN B;  3E7L A;  3QOD A;  1FY7 A;  1KQ8 A;  1W7P B;  3GFI A;  2BOL A;  3O2P E;  3QOE A;  1ZYR F;  4YIR X;  1DUX C;  3CCQ I;  4BL0 B;  2L4A A;  1R00 A;  2R7O A;  5F64 A;  2EA4 A;  1ON2 A;  2Y31 A;  3FXM A;  5DUK A;  3RPU D;  2VJ5 A;  3J80 Z;  3OIO A;  3ZQH A;  4RAZ A;  2K86 A;  2EH3 A;  4EEF G;  4AVP A;  2IW5 A;  4ZYA A;  3CF5 F;  3WU0 A;  4XOR A;  4RAF A;  2EIJ H;  2Y0S A;  2Z9O A;  1DPU A;  5HOO A;  4YRV A;  3TBI A;  5ICF A;  4F93 B;  5L3B A;  4UXN A;  3W3C A;  4N4N B;  2DYS H;  2QM3 A;  1VZ0 A;  2PFB A;  3BG3 A;  3H36 A;  4LMY A;  5DTD A;  1JI8 A;  4RM3 A;  1TW3 A;  2EIL H;  3GZN B;  1E3O C;  1L0O C;  2M4K A;  3I59 B;  4C9Y A;  3AG4 H;  4N0B A;  3V8K A;  3C3W A;  3N4M A;  5BPI A;  1OKR A;  2GZW A;  5M3F J;  3REO A;  1G4D A;  2V9V A;  4YFN F;  3K1P A;  1WHU A;  2JTV A;  1GVD A;  3IKT A;  1RKT A;  4YFX F;  3CUQ C;  3DCF A;  3MD2 A;  2XAG A;  2VT2 A;  4U88 A;  3A03 A;  3K2A A;  4EJO A;  2M7A A;  3A02 A;  3ZMV A;  4XLF A;  4KN7 X;  4BJ5 C;  4A3E J;  1QBJ A;  5C4J J;  2WAQ A;  3HRS A;  1REP C;  1YE9 A;  4B43 A;  1B72 B;  2FBK A;  2DQR A;  4BU2 A;  1QZE A;  1RI7 A;  1XTA A;  1Y8R B;  4PUS A;  2DXI A;  3DTK A;  3RPU A;  1FIP A;  3KP6 A;  3WU1 B;  4F7Z A;  3ZQQ A;  4L18 B;  3MZ8 A;  1HSJ A;  1X1A A;  5FRN A;  5EZH A;  2STW A;  3KEQ A;  1LVA A;  3K4C A;  1T38 A;  3ZRG A;  1J9I A;  5CQG A;  3J81 Z;  3CCU I;  2FMY A;  4CUG A;  4B47 A;  4KIC A;  4DNC A;  3S1Q J;  3H0D A;  1Z0X A;  2HPI A;  4BXU A;  4LIV A;  1C0W A;  3GX4 X;  1OCP A;  5JI6 A;  4C3I J;  3CCS I;  4E7Z A;  4DYR A;  3F0C A;  2RRE A;  1Z67 A;  2KKO A;  3H5R A;  4KT5 C;  4EM1 A;  1IV6 A;  4ZTF A;  2XPU A;  5L3E A;  1ZG3 A;  3M4O J;  1UJ8 A;  2Z5U A;  3LOC A;  4I7H A;  1QHH D;  2K3F A;  1YIJ I;  3F8C A;  2M9H A;  2NYX A;  3HTS B;  1RKW A;  1WJC A;  3P9I A;  2VT3 A;  2FBH A;  2ZBK A;  1VQ8 I;  2CW7 A;  3QRF F;  4FE4 A;  2KZV A;  3K1N A;  2PMZ A;  5HS7 A;  1T08 B;  2DDB A;  3OL4 A;  2FOK A;  4ANJ A;  2GAU A;  1TLH B;  1IN5 A;  2OCE A;  2EFW A;  1X2N A;  5IPA A;  2PJP A;  1I39 A;  4IX7 A;  3VOD A;  2ZSI B;  5E8G A;  5K7H A;  2XGD A;  1OYW A;  3EET A;  5ERI A;  3K4L A;  1G3T A;  4D1Q A;  2M5W A;  1SMY F;  1W5S A;  4HV6 A;  2VLA A;  2DMN A;  3GCM A;  2V1N A;  5FKO A;  3OYL A;  2P8T A;  5JHF A;  2KJC A;  2J5O A;  3MAJ A;  3KET A;  1J0R A;  4HF1 A;  4XLP F;  3K6G A;  2HTS A;  3G71 I;  3KP4 A;  2WAE A;  4KFC A;  3JCU C;  4RB3 C;  3TQN A;  5FB2 A;  2FUG 2;  2AQF A;  5TIS C;  3S2D J;  1WSU A;  3FXU A;  4E70 A;  3OYH A;  2ZNZ A;  3ZOB A;  2ME6 A;  2B0L A;  5CVR A;  2PBI A;  4IQ4 A;  2JT1 A;  4I09 A;  2FD5 A;  2MH9 A;  4I98 B;  1HA8 A;  2NVY J;  3FBI B;  5JLW A;  2BZT A;  2N8G A;  2WV0 A;  2HXI A;  2BY0 A;  4M73 A;  4X0G A;  3LSH A;  1YJN I;  3BR0 A;  3KP7 A;  1W36 C;  3DP7 A;  2O6G E;  1T95 A;  4A3D J;  1T0F C;  2X6O A;  3W6J B;  3F23 A;  1S7A A;  3B6A A;  5HS8 A;  4HX8 A;  3HOY J;  2JJ7 A;  3I56 I;  1K78 A;  2P5V A;  2DT7 B;  2ADU A;  4LIU A;  3KX2 A;  4A3C J;  2H1L A;  2PQ8 A;  2XRL A;  1JUP A;  2DK5 A;  4XLE A;  4DYQ A;  4ZYD A;  4PSX A;  3DBR B;  3P7N A;  3JSO A;  3IWZ A;  4ZTJ A;  1R9T J;  4XLN F;  3TO9 A;  4A0X A;  1D1A A;  1I3Q J;  2DOD A;  2HKO A;  1IO2 A;  3GVA A;  4NC8 A;  5LRR A;  3H3Z A;  5EDN A;  4GDF A;  1ETK A;  2HZT A;  3PO3 J;  3SXY A;  1WJB A;  3KLN A;  4ENJ A;  4V19 K;  1RET A;  2G9W A;  3OSF A;  1W7P D;  2GA1 A;  2KZG A;  2DN0 A;  2BY1 A;  3OS0 A;  1IV8 A;  4QIW N;  3M3Y J;  1JGS A;  3EUH A;  3RDI A;  2CS3 A;  3EUA A;  1MJ9 A;  2WB1 N;  2X4H A;  1G3S A;  5CKT A;  3BZ6 A;  1HKS A;  2Z99 A;  1VF9 A;  3KP2 A;  3T5X A;  3R60 A;  5EEA A;  2EZH A;  1VQM I;  1IF1 A;  4E7K A;  3MZY A;  3ABU A;  2NAZ A;  3W6K B;  1ZQ3 P;  4XNF A;  3GZ5 A;  2CJJ A;  1Z9C A;  2DFI A;  2KDO A;  4E7J A;  3ERM A;  1ETY A;  2FJ1 A;  4JX6 A;  4XRM A;  1QRY A;  4XMY A;  1IRF A;  1FP1 D;  1S6L A;  2EK5 A;  3DTI A;  4EAT A;  3A01 A;  1D1B A;  3G1L A;  4IHT A;  5D4S A;  3ASO H;  3CCE I;  4A3L J;  5EEH A;  4CZZ A;  4MFD A;  3BG9 A;  2NS7 A;  5GTH C;  4JBA A;  3HYI A;  4DOZ A;  1QHG A;  4LG3 A;  1I1S A;  3I64 A;  3GTM J;  2NNN A;  1P2F A;  2BGC A;  3TMO A;  4RB2 C;  3PNY A;  3COA C;  2I10 A;  2HWV A;  4Y15 A;  1JE8 A;  4II3 A;  3S15 J;  5HLG A;  3SDB A;  4CZC A;  3ZMS A;  2W24 A;  4I99 C;  4E7L A;  3BP8 A;  3BC8 A;  2M0M A;  2VJJ A;  4E7I A;  3TED A;  3DU6 A;  3LA7 A;  3ZMD A;  4XRS A;  2IGO A;  4RM2 A;  3MKY B;  1FOW A;  1W7P A;  4A5N A;  2QVO A;  3AFH A;  2XAQ A;  5C4X J;  3IRR A;  1BA5 A;  1FOK A;  3RJP A;  4XOP A;  2XKP A;  2RAE A;  1V5E A;  2GXB A;  2QCO A;  2VOP A;  4XQF A;  1UHS A;  3J7A O;  5DCM B;  1IZ1 A;  1OYY A;  1I5Z A;  2IJL A;  2V4J C;  2DI3 A;  2WAF A;  2AHQ A;  4XKB A;  4WX9 A;  2QEX I;  2PI0 A;  2EQR A;  3H3U A;  3M8E A;  1P4X A;  1J75 A;  1A6I A;  3DF8 A;  3Q0V A;  4U0W A;  2EIK H;  2HQR A;  1B4A A;  4HF2 A;  3TOA A;  2CV0 A;  2L2O A;  3FXR A;  4QPQ A;  2L5Q A;  5FRM A;  4YIF A;  4R79 A;  5F0C A;  3LWF A;  4CCK A;  2Y9Z A;  3TKY A;  2ZXJ A;  4L9N A;  2V6E A;  1PUF A;  2EIM H;  1XCB A;  4A6D A;  2HI3 A;  3F6O A;  2CU7 A;  4OIN F;  4DYC A;  3GLX A;  5LHI A;  4HOB A;  1SFU A;  3HSF A;  5EJC A;  2EBI A;  3OY9 A;  2BE5 F;  3O8H A;  1KU7 A;  4M3B A;  4OAY A;  5JLX A;  1ZG1 A;  1P9Q C;  2NVT J;  3LL7 A;  4P55 A;  4Q47 A;  3FXQ A;  2LKS A;  3ECO A;  3TOB A;  2Y0S N;  3H3V K;  1XGS A;  3A1Y A;  1ZGA A;  3C7J A;  2NVU B;  2DA3 A;  2VKV A;  1LEB A;  4PGG A;  4IRG A;  5FD5 A;  3QU6 A;  5L3G A;  1Y39 A;  3V8J A;  1B72 A;  1IUF A;  2LMD A;  3ISP A;  1TQM A;  1I6X A;  2VON A;  2WAD A;  5FFX A;  4A3F J;  3K4M A;  2GQQ A;  4G7Z F;  1GXP A;  1XGO A;  2K9L A;  4RS8 A;  4Y3O A;  2LYC A;  2A5W A;  2G7U A;  4L9T A;  4RMN A;  4C30 A;  1R5G A;  2MG4 A;  1XS9 A;  2EZK A;  2OTJ I;  2M2E A;  3AG2 H;  4I76 A;  3HC7 A;  2DJI A;  1S8N A;  2K4J A;  1MZB A;  3HRT A;  3PNT A;  4KUM A;  2YU3 A;  5LGT A;  5IT9 K;  2ELH A;  2WV1 A;  4I01 A;  2IEK A;  1X4O A;  5DM6 F;  3BDD A;  4CIC A;  2XF6 A;  3H9G A;  3CUQ A;  2E2I J;  5JVT A;  2WAQ N;  4V2G A;  1R1V A;  2OC6 A;  1BJA A;  2F5F A;  1SAX A;  2K02 A;  3LST A;  3AKZ A;  1D3Y A;  2H09 A;  3NQO A;  4KMU X;  5CYV A;  4HLY A;  3SJM A;  4RLQ A;  4GYI A;  3GEZ A;  1D0X A;  2PN6 A;  2NRA C;  3KZY A;  3HOX J;  4C2U A;  5HDG A;  5FKK A;  3IH2 A;  3H92 A;  4P1W A;  4A0Y A;  1HF0 A;  3OOU A;  1R58 A;  2QSG X;  3EYY A;  1X58 A;  1HDP A;  2DTR A;  4BY1 J;  3S3N A;  4XKV A;  4H0E A;  3JRG A;  1D8K A;  5F1R A;  1PP8 F;  4MQ9 F;  4DZP A;  4LOC A;  1SFE A;  4CCN A;  4AYB N;  2OF7 A;  3OL3 A;  5B1A H;  2G7H A;  2KIM A;  4BE2 A;  2ME0 A;  3BTL A;  4LFU A;  1RES A;  5ILU A;  4ESB A;  1BL0 A;  3ZMZ A;  1DGW Y;  2MAB A;  4Z2Y A;  2M87 A;  3KE2 A;  3AL0 C;  3WU2 C;  4AD9 A;  4XIC A;  3FM5 A;  2GLO A;  4FET A;  4CCO A;  4UHT A;  3LNQ A;  2W48 A;  5LFA A;  2CQQ A;  2L02 A;  4Q4Z F;  3SZP A;  4EM2 A;  3CQZ J;  4KIT B;  2W4S A;  5FFZ A;  4XKW A;  5DD8 A;  2OQG A;  4GRI A;  1S29 A;  1MJB A;  1JJ6 C;  2HOA A;  3OSG A;  3SEQ A;  1H88 C;  2IA1 A;  2DDA A;  1DQU A;  5A2Q K;  4GFB A;  1U8B A;  1XN7 A;  3HXL A;  1K6O A;  2ZME B;  2R7D A;  1SD6 A;  1B1B A;  1KYW A;  3FXK A;  4EV0 A;  3CC4 I;  3RPQ A;  2LY9 A;  2RGV A;  4L5E A;  3FKJ A;  5FJ8 J;  1W0U A;  1W5C C;  1WWX A;  3KCC A;  3QPT A;  5EZG A;  2GM4 A;  4IHX A;  3GFM A;  5FLX K;  2BHY A;  3PQJ A;  3ZMU A;  2MGQ A;  1Q1H A;  1UG2 A;  3SQN A;  2RNG A;  2GXA A;  2LC2 A;  1MSF C;  4ZC3 A;  4I0B A;  2WY7 Q;  3GTL J;  1TNS A;  2DYR H;  3B02 A;  5H6Q A;  2JMW A;  5HS9 A;  3IRQ A;  2CFX A;  4A3M J;  3HBL A;  2HQN A;  2P4W A;  3U1D A;  1NH3 A;  4PJM A;  1FJL A;  2VC1 A;  2VQH A;  4U7B A;  4Y17 A;  3RTR A;  1FYK A;  2FU4 A;  2B9S A;  2DA4 A;  3E6D A;  5EYR A;  1UHM A;  4ZYE A;  2KMU A;  5M5W J;  3TL4 X;  3BT9 A;  4XRS G;  3CMY A;  3S14 J;  4MHG A;  3OYG A;  5B1B H;  4XSX F;  2IAI A;  1ETX A;  2F5C A;  3WHB A;  2GOM A;  4IHV A;  2JWT A;  1WJ5 A;  2FOW A;  2HVQ A;  1T0F A;  4LK1 F;  2VQG A;  2ESH A;  1KQ0 A;  5CVJ A;  3VWB A;  2QQA A;  1Z3Y A;  3DKX A;  2FE3 A;  3R0A A;  1ORK A;  3F8B A;  2O8X A;  1D0Z A;  1RR8 C;  4QSH A;  4GCV A;  3S3O A;  2QSF X;  1ZRF A;  3KIO A;  2LY2 A;  3DKW A;  1GUU A;  1XD7 A;  3MQ0 A;  5FGM A;  3I4N J;  1AWC A;  2E2H J;  1LDK B;  2W85 A;  3L9F A;  2WTE A;  2M1B A;  2YUS A;  3HIF A;  4HLX A;  4KYW A;  4A93 J;  5BS6 A;  2H6B A;  2ELJ A;  5EGO A;  1DPR A;  2OZU A;  2D5V A;  2YX4 A;  3F8N A;  3L7W A;  1G6N A;  4XOT A;  3IH3 A;  4PSW A;  2I8D A;  4S04 A;  5KK1 A;  1VQL I;  1Z6T A;  4P96 A;  2PMH A;  4M71 A;  1V54 H;  1X1D A;  3FXJ A;  2Z2S B;  4KIG A;  4B44 A;  1RR7 A;  3EUK L;  3ABL H;  3Q5F A;  2E7X A;  5C44 J;  3I0T A;  5E79 C;  2VPL A;  2P0W A;  4BYY A;  2X9D A;  5E3L A;  3BWG A;  2YU9 J;  2KT0 A;  2JK3 A;  3HOU J;  1Z7L A;  2A3S A;  4ZZD A;  3IH4 A;  1O4X A;  1JJ8 C;  4U87 A;  2RKH A;  4NBQ A;  2UZK A;  4LLG F;  4CSW A;  3TDZ C;  1Y1V J;  1FYL A;  4M3D A;  3SYT A;  3RKY A;  1MMA A;  1MGT A;  5M3M J;  2R7X A;  3DEE A;  5DCM A;  2EIN H;  3ZMT A;  4B48 A;  3LMM A;  2VBY A;  2L9S A;  3TP0 A;  1R23 A;  2L4M A;  1ZLK A;  3OIP A;  1BIA A;  3KP3 A;  4G9Y A;  1QNT A;  2JQ7 A;  4Z6Y A;  3OYC A;  3BQY A;  4LG0 A;  3HL2 A;  2COB A;  2VC0 A;  3V7C A;  3FXO A;  2ESN A;  2JA7 J;  3HRU A;  4JP0 A;  2XHK A;  3PNV A;  3RQ4 A;  1YIO A;  4EVI A;  2QKM B;  4HNV A;  2H8W A;  5IY5 H;  3I53 A;  4M9Z A;  2XAF A;  3ROU A;  1Z3X A;  3GTP J;  3CMA I;  3H0G J;  4FIS A;  4WK8 F;  3K2Z A;  1ETO A;  1ZG5 A;  2VI6 A;  4B09 A;  1GVJ A;  1LFP A;  1OCO H;  1W4M A;  3GTK J;  3W2W A;  1G3Y A;  4XN3 A;  5D5W B;  1XDS A;  4MNU A;  2HYF A;  1IXC A;  3FXL A;  2LG4 A;  3HUG B;  1TL8 A;  2QA4 I;  2QQ8 A;  5ILS A;  2XAH A;  4Y4R A;  1IRZ A;  1YRN A;  3U21 A;  2CW8 A;  3GTG J;  1ODD A;  1ZR4 A;  2HVR A;  4OMY A;  1GT0 C;  3D5R C;  1RPW A;  1PUF B;  1FLI A;  4G7O F;  4TV7 A;  1F5T A;  3DLA A;  1K6Y A;  3FKI J;  4J01 A;  2ZNY A;  1BR2 A;  5KHD A;  4M6X A;  1KQ9 A;  4B1R A;  1Y0U A;  3EYI A;  2HVS A;  2CMP A;  2MC3 A;  3LQQ A;  5ILV A;  2UXX A;  4WXD A;  1QO0 D;  2E36 A;  1J09 A;  2CW0 F;  2Y30 A;  1BN5 A;  4QTR A;  4CA0 A;  1RNL A;  2K5C A;  2MLK A;  4A3I J;  2X1C A;  2R7Q A;  4N9H A;  3LFU A;  4BXX J;  5CPR B;  3PFI A;  4IHS A;  4XRF A;  4RDU A;  2IS2 A;  5E1W A;  4F3Q A;  1ZH5 A;  3HM5 A;  1ENH A;  1FPQ A;  1LJ9 A;  4KA4 A;  4HBL A;  2CGP A;  2F48 A;  3W6V A;  2BXY A;  3VYR B;  3A0H C;  2COM A;  1GDT A;  1TTY A;  5AIQ A;  3G73 A;  1F1Z A;  1RRJ A;  1KU2 A;  5ED4 A;  1IGN A;  2LFB A;  2QQ9 A;  3ML6 A;  3H9Q A;  4KIB A;  1MMS A;  5AON A;  1HC8 A;  2P81 A;  5DM7 F;  1OIS A;  1YHQ I;  2HQ5 A;  2QUF A;  3QP6 A;  5BPD A;  4MLO A;  1XMK A;  2FXA A;  1FC3 A;  2VKH A;  1ZEL A;  1WJF A;  1T56 A;  2E7W A;  4DBQ A;  2K40 A;  4F91 B;  3NRV A;  5TJJ A;  2RQQ A;  3M07 A;  4YEJ A;  1HDD C;  1BIB A;  3WOD F;  2DPD A;  2W7N A;  2XUB A;  1ZHF A;  1IW7 F;  2D1H A;  1P6R A;  1X1B A;  3CUQ B;  2XIG A;  3ECH A;  1B8I A;  2H27 A;  2HDD A;  1O3R A;  3HDD A;  1ETW A;  5LRS A;  5IP7 J;  2V6C A;  3BG5 A;  1KU3 A;  4RB1 A;  3O3K A;  4JK1 X;  3OYE A;  3O8G A;  2BVM A;  4X1E A;  2XC7 A;  3CME I;  1VQO I;  4ITV A;  1JUM A;  4P9U A;  2LTP A;  3SEZ A;  3RZD J;  1OYI A;  1Y1W J;  3HSE A;  4D5C A;  4IVN A;  4EJU A;  2JSC A;  4AU7 A;  3VEP A;  4WXH A;  3ESW B;  1SFK A;  1IXS B;  3QOP A;  4CHU A;  2KIS A;  5IT3 A;  2ZME A;  2M34 A;  5BQT A;  3DU5 A;  1UFM A;  2O7O A;  1XPX A;  1STZ A;  3JW4 A;  1P4A A;  1V5F A;  3NWT A;  4HEA 2;  3RQI A;  2GBY A;  1OR7 A;  3JRC A;  4PFO A;  3H5A A;  1A6Q A;  4OIP F;  1IJW C;  4M72 A;  5JVG F;  1FNN A;  3PQK A;  3V7S A;  3Q0W A;  2OAZ A;  4HX4 A;  1NG6 A;  4N4O B;  4WF2 A;  5LHG A;  3JRD A;  2DMP A;  2LOO A;  2KLO A;  1EH8 A;  1MBH A;  3L2W A;  2A07 F;  2DU9 A;  1KON A;  2P5L C;  1MBF A;  1T8I A;  1WH7 A;  3JTH A;  3TDU C;  1HOM A;  3D5L A;  1YI2 I;  1GLN A;  1P4W A;  1LB2 A;  4KJZ A;  1CF7 B;  2EFN A;  3HGG A;  2FRH A;  4CCL A;  5F0F A;  5FO5 A;  4BS9 A;  2LKX A;  1K61 A;  3CJT B;  1QVU A;  2AXL A;  3FIW A;  3GF2 A;  4FAS D;  3DV8 A;  1PYV A;  4U7D A;  3ULQ B;  1I1G A;  3G3Z A;  3M7G A;  4RBO A;  2PX9 A;  2OCC H;  3QP5 A;  1USS A;  3HKZ N;  2F4O B;  3IAS 2;  4O3M A;  3I5U A;  3HOS A;  3FF5 A;  2DLL A;  3HG9 A;  2F5V A;  3I55 I;  3J7Y J;  3TGN A;  2J5P A;  3QPH A;  4B8X A;  5BMZ A;  5TRD A;  2CQ7 A;  1B6A A;  2HS5 A;  1HCR A;  3K4B A;  1BI2 A;  1EH7 A;  3LSM A;  4UUT A;  2OQR A;  3IUO A;  1FYM A;  2E1N A;  1LE8 B;  1BC8 C;  2HNH A;  1I6H J;  1KZH A;  2HDW A;  2KQR A; 
#chains in the Genus database with same CATH homology
 2VE8 A;  3CTA A;  3RIR A;  3GUD A;  3E6M A;  1PUE E;  3B73 A;  3GYH X;  4RGS A;  5E8I A;  3BY6 A;  1FX7 A;  5HLH A;  5LBQ A;  1Z05 A;  4UUV A;  4LLL A;  2KJB A;  1O3Q A;  2HYG D;  2LSO A;  4AWX B;  2EB7 A;  3CO6 C;  3F3X A;  1Z6R A;  4A12 A;  2XRO A;  3BJ6 A;  2DQL A;  1T98 A;  2OBP A;  1VTN C;  1U2W A;  2XV4 S;  3DFG A;  1J59 A;  1JHH A;  1DP7 P;  3T1B A;  1BC7 C;  1YW7 A;  2ZO4 A;  4DQ2 A;  4ENN A;  1YLF A;  1KYZ A;  3OOP A;  2MD5 A;  1S3J A;  2YPR A;  4P9F A;  4R8H A;  5JFR A;  1TQI A;  1HBX G;  2BBY A;  4HDU A;  1T6S A;  5E18 F;  2FEZ A;  5K5R A;  2FNA A;  1IN7 A;  5KVR A;  3HUG A;  2KIF A;  5IT9 Z;  1A04 A;  5DYM A;  3DPL C;  4LG0 B;  5K1Y A;  3MZH A;  4LK0 F;  2EV6 A;  1L3L A;  1BI3 A;  3HRM A;  1KU9 A;  3R61 A;  1U5T C;  4OU0 A;  2VOD A;  2P7V B;  3SHF A;  3HSR A;  3WTU C;  3JTG A;  3BJA A;  4EJV A;  2IRF G;  2Z3Y A;  2Y0M A;  2DAO A;  4RGR A;  2LDU A;  4XSZ F;  3HHH A;  5L3D A;  2W84 A;  3WG9 A;  4BHP A;  4UNO A;  4G7H F;  4A0Z A;  2VBZ A;  2VXZ A;  1XMA A;  1PDN C;  1WRJ A;  4RB0 A;  4U0Y A;  2ISZ A;  2LF8 A;  1U5T B;  4MTE A;  5CLS A;  4ZYH A;  4ENM A;  4AIJ A;  4HZF A;  4UV9 A;  2DT5 A;  4UVC A;  1I27 A;  1YW9 A;  1IN6 A;  5A2Q Z;  3WE2 A;  1V3F A;  2XKO A;  1HXD A;  4ETS A;  3BPX A;  1E2X A;  1UB9 A;  3ABT A;  5FLX Z;  3WE3 A;  1FBU A;  3R0J A;  3RYR A;  3M1E A;  3VFZ A;  1F4K A;  2DO7 A;  3ZPL A;  2X0L A;  4LB6 B;  1UHW A;  6PAX A;  3DPT A;  4HDV A;  5L3C A;  5H6R A;  3AAF A;  1MDM A;  4YFK F;  1QZZ A;  2OA4 A;  3T0Y A;  4R1H A;  3WGG A;  2FA5 A;  4A6E A;  2PLY A;  2IA0 A;  3ELK A;  3E5U A;  5LEJ A;  4QLC U;  4L5J A;  2Q0O A;  4EJW A;  3MWM A;  1O7L A;  4Q48 A;  5F6F A;  4OOI A;  3RKW A;  1CF7 A;  2PEX A;  3LFK A;  3Q9V A;  2M8E A;  3KLO A;  4EJT A;  1ONV A;  5HDN A;  5E1Z B;  2EFO A;  2Y75 A;  1YYV A;  1LEA A;  1XSV A;  3WTS C;  2NS0 A;  1WI9 A;  5ICG A;  1JHF A;  1MKM A;  1QZY A;  1ZN2 A;  3DXJ F;  2EFP A;  3MEX A;  3BRO A;  2FF4 A;  2OD5 A;  4IJA A;  4G6Q A;  4WXC A;  4KNY A;  2Z33 A;  2QBY B;  3RYP A;  1B59 A;  5D4R A;  2IPQ X;  2PG4 A;  1SD5 A;  3ZN1 A;  1PP7 U;  2YR2 A;  4N9I A;  1FBQ A;  3JAM K;  3L00 A;  1HKQ A;  1Z7U A;  3Q9S A;  1XSD A;  4KMF A;  4PGH A;  2EV0 A;  2V1U A;  3V8L A;  2V1X A;  2AS5 F;  1OMI A;  4HA8 A;  4FX0 A;  1U78 A;  4NQW A;  3BJO A;  3QU3 A;  1R36 A;  5CVI A;  3GO5 A;  2RQP A;  4G94 A;  4EGZ A;  5LGN A;  2CYY A;  4IPA A;  1ZAR A;  4K2E A;  1YS7 A;  1ZRE A;  2CSO A;  1IUY A;  1T2K A;  4Y13 A;  1S7O A;  1ZRC A;  2GXG A;  2QQB A;  1KGS A;  1H0M A;  2VOO A;  2W25 A;  2A6E F;  3BOQ A;  2XVC A;  2H6C A;  2P6T A;  1IN4 A;  3VB2 A;  4AIK A;  1ZGJ A;  5ICE A;  3RKX A;  4HV5 A;  2MH2 A;  2P6S A;  4OIO F;  4CYD A;  4G8X A;  2QZ8 A;  1XCV A;  1MD0 A;  2UXN A;  2LNB A;  1LDD A;  4RGX A;  3WTY C;  2ZJ2 A;  1SD4 A;  2F5D A;  4L9V A;  3SZT A;  2QYO A;  3LA3 A;  2A5Y B;  2R3S A;  2JPC A;  2O03 A;  3WTX C;  2Q8K A;  2QEN A;  2HOE A;  2H94 A;  4I2O A;  1GHC A;  2EJR A;  5D5V B;  3U2R A;  5LEK A;  3WTW C;  1O57 A;  1HW2 A;  4FT8 A;  5J8C A;  2Y48 A;  1U5T A;  2E1C A;  1BI0 A;  2FNP A;  1FBS A;  4OIR F;  4MTD A;  1H9T A;  5LGU A;  4LB5 A;  2VBX A;  4BAY A;  3FHZ A;  1QGP A;  5CJ9 A;  2WC2 A;  2IA2 A;  4BNC A;  3WGH A;  3I54 A;  1LNW A;  1R22 A;  2BYV E;  2FQ3 A;  3WTV C;  1IAW A;  3S2W A;  2RC4 A;  3CLO A;  4HW0 A;  2CO5 A;  2M30 A;  3ZN0 A;  2QWW A;  4CGZ A;  2O61 A;  4PDK A;  3J80 K;  1ZLJ A;  2P7C B;  1O7F A;  3HHG A;  3R4K A;  3KZZ A;  3C18 A;  5FD6 A;  4CDG A;  1SMT A;  2KRF A;  5AIP A;  2FBI A;  2HFH A;  3C1D A;  4WWC A;  1HW5 A;  2KIU A;  2A61 A;  4ZZL A;  1NHA A;  5E20 A;  5DD4 A;  1D5V A;  3FMS A;  2YSR A;  3HOT A;  1MDM B;  2YX7 A;  3GW2 A;  2RV8 A;  5D8L B;  3F21 A;  1O3S A;  4I02 A;  2DW4 A;  1H9G A;  3RI4 A;  1Z1D A;  3O6B B;  5H20 A;  2TDX A;  2O0Y A;  3D0S A;  4GYG A;  4UVB A;  2EFQ A;  3K9T A;  3IL2 A;  2RNJ A;  1YFH A;  2DK8 A;  4RAY A;  3KP5 A;  4GGG A;  3LA2 A;  4UVA A;  3J81 K;  1O3T A;  4BH9 A;  2QBY A;  3ERE D;  3FMQ A;  1D8J A;  4LGW A;  2V1D A;  3GWZ A;  2VE9 A;  3E97 A;  4KN4 X;  2MLG A;  3E5X A;  1KA8 A;  3E5Q A;  5DEQ A;  3FMR A;  1QQI A;  3E3V A;  4ZYG A;  3OV8 A;  4G6D A;  2JZY A;  1CGP A;  3FWE A;  1R5H A;  1RUO A;  2L3D A;  2LF7 A;  4HAM A;  4NHJ A;  4IRH A;  2IP2 A;  2ACJ A;  1OPC A;  4WCG A;  5D6E A;  4Q5S F;  3IC7 A;  1J7K A;  3LAJ A;  3IHU A;  1BI1 A;  2DBB A;  4BHB A;  4O5V A;  4LD5 A;  2D45 A;  2LKP A;  4FHT A;  5K5O A;  2RDP A;  3K69 A;  2EA2 A;  3T8R A;  4L0Z B;  2P5K A;  4L9J A;  3ZQ7 A;  3KFW X;  4EGY A;  1FP2 A;  3VOE A;  4HX7 A;  1MJA A;  1RZ4 A;  3GZ6 A;  5BOX A;  2HEO A;  1ON1 A;  2ISY A;  1YTY A;  3CJN A;  1YW8 A;  2XRN A;  4ASN A;  2OZ6 A;  1HQC A;  3BPV A;  1HKT A;  1T39 A;  5HLI A;  2CG4 A;  2XGX A;  4ZH4 F;  3WGI A;  3L09 A;  4AIH A;  1IXR C;  4MGR A;  1J2X A;  1B9M A;  2BEO A;  3L2C A;  4EM0 B;  2R7F A;  2L54 A;  1E17 A;  2ETH A;  2K4B A;  2F2E A;  2GWR A;  1ZRD A;  5D5U B;  2ZKZ A;  4PZJ A;  2O3F A;  1BBY A;  5DV5 A;  4EMS A;  5DUI A;  2A68 F;  1YG2 A;  4EQQ A;  1BM9 A;  3LAP A;  1R7J A;  3I59 A;  2HKX A;  1LQ1 A;  5DCF A;  4OMZ A;  5E17 F;  1HST A;  4YG2 F;  3R6S A;  1TNT A;  4I0A A;  1YQA A;  3U9G A;  5D8K B;  1K7A A;  2VN2 A;  3ZP5 A;  4IXA A;  3JSP A;  2NNY A;  4LJZ F;  3IKV A;  1FWZ A;  1Z91 A;  5K5Q A;  1K79 A;  1U6G A;  4PCQ A;  1FT9 A;  3F22 A;  1IRG A;  2D2W A;  3TO6 A;  2ZCW A;  5HDK A;  2ZFW A;  3MCZ A;  1U3E M;  4M9X A;  1ZAO A;  3I58 A;  3F8F A;  4CXF A;  3P9C A;  2C6Y A;  3T8T A;  3M9A A;  4RGU A;  5JR3 A;  5E1X A;  4L5I A;  1GXQ A;  4D0P A;  1EH6 A;  4KDP A;  2XAS A;  4A5M A;  2V79 A;  2STT A;  1AOY A;  3F6V A;  1LDJ A;  1RUN A;  3CUO A;  5D5X B;  4CO8 A;  3DQV C;  2XAJ A;  3FX3 A;  3GFJ A;  1XGM A;  3IWF A;  1R1T A;  2RVC A;  2MBF A;  1G3W A;  2VBW A;  2IVM A;  4YII A;  2HGC A;  4ESF A;  3JAM Z;  4ESJ A;  5LHH A;  3P9K A;  1FSE A;  2MA3 A;  2EWN A;  1X3U A;  2FSW A;  4BHC A;  4ENK A;  2JPB A;  3KEO A;  1J5Y A;  2BV6 A;  2L01 A;  1HW1 A;  5EEG A;  3TO7 A;  2HR3 A;  4HYE A;  5D6F A;  5DDG A;  3MFK A;  4XBF A;  1U8R A;  1FSH A;  2D1V A;  3K1M A;  2A69 F;  2CWE A;  3K0L A;  3E6C C;  3I71 A;  3E6B A;  1B9N A;  1P92 A;  2GIV A;  3N97 A;  3WTT C;  4OIQ F;  5J8F A;  4HQE A;  4M74 A;  2JRT A;  4MEX F;  1QPM A;  4O6J A;  2OU2 A;  1XB4 A;  4M6Y A;  5CVV A;  1XDU A;  4U0V A;  4MEY F;  2Q2E A;  3I4P A;  3M8F A;  3SFZ A;  5LLQ A;  2WWY A;  3F72 A;  4QWQ A;  4JQF A;  4NB5 A;  3V4G A;  1UCR A;  1V4R A;  3V7R A;  3FM3 A;  3EQL F;  1DDN A;  1TQP A;  1W5T A;  2HDC A;  3CO7 C;  2F5E A;  1BOA A;  5HVQ C;  1UST A;  1K78 B;  1RIO H;  1TW2 A;  4GXO A;  1XSX A;  1EV7 A;  1YS6 A;  2RN7 A;  1F9N A;  4P5O A;  4GO1 A;  2PMU A;  3F8M A;  1SFX A;  2K27 A;  2IT0 A;  3NEU A;  3GXO A;  1WKM A;  2A6H F;  4ON0 A;  2K7L A;  5JHU A;  1IN8 A;  1YO5 C;  2QLZ A;  5ICC A;  1WQ2 A;  4MQV A;  4L0Y B;  1XGN A;  4S05 A;  3GFL A;  2HTJ A;  3HTU A;  1R1U A;  3DEU A;  3CDH A;  2CQK A;  2GA2 A;  4FX4 A;  2EV5 A;  2FML A;  4HQM A;  1FZP B;  4IRI A;  2W57 A;  2M45 A;  4UV8 A;  4IF4 A;  4KIF A;  1TBX A;  5CVU A;  3WTZ A;  4LLN A;  2DPU A;  4M9S A;  4A2U A;  5L3F A;  4HF0 A;  4BQA A;  1SD7 A;  1ULY A;  3QAH A;  1JXS A;  3FZV A;  2UWM A;  3LQR A;  3EDP A;  5J6X A;  1FY7 A;  1KQ8 A;  1W7P B;  3GFI A;  3O2P E;  1ZYR F;  1DUX C;  2L4A A;  1R00 A;  5F64 A;  2EA4 A;  1ON2 A;  5DUK A;  3J80 Z;  4RAZ A;  2K86 A;  4AVP A;  2IW5 A;  3WU0 A;  2Z9O A;  1DPU A;  5HOO A;  5ICF A;  5L3B A;  4UXN A;  2QM3 A;  2PFB A;  4LMY A;  1TW3 A;  1L0O C;  3I59 B;  4N0B A;  3V8K A;  3C3W A;  3N4M A;  5BPI A;  1OKR A;  2GZW A;  3REO A;  1G4D A;  2V9V A;  4YFN F;  3K1P A;  2JTV A;  3IKT A;  4YFX F;  3CUQ C;  2XAG A;  2VT2 A;  4U88 A;  4EJO A;  3ZMV A;  4KN7 X;  1QBJ A;  1REP C;  3HRS A;  2FBK A;  2DQR A;  1RI7 A;  3RPU A;  3KP6 A;  3WU1 B;  4F7Z A;  4L18 B;  1HSJ A;  2STW A;  3KEQ A;  1LVA A;  1T38 A;  1J9I A;  3J81 Z;  2FMY A;  4KIC A;  4DNC A;  4BXU A;  1C0W A;  3GX4 X;  5JI6 A;  2KKO A;  4KT5 C;  4EM1 A;  5L3E A;  1ZG3 A;  2Z5U A;  4I7H A;  3F8C A;  2NYX A;  3HTS B;  3P9I A;  2VT3 A;  2FBH A;  2ZBK A;  3QRF F;  3K1N A;  5HS7 A;  2FOK A;  2GAU A;  1TLH B;  1IN5 A;  2EFW A;  2PJP A;  3VOD A;  5E8G A;  1OYW A;  3EET A;  5ERI A;  1G3T A;  2M5W A;  1SMY F;  1W5S A;  4HV6 A;  2P8T A;  2KJC A;  2J5O A;  3MAJ A;  3KET A;  1J0R A;  4HF1 A;  4XLP F;  2HTS A;  3KP4 A;  4KFC A;  4RB3 C;  3TQN A;  5FB2 A;  1WSU A;  3FXU A;  4E70 A;  2ZNZ A;  2B0L A;  5CVR A;  2PBI A;  2JT1 A;  4I09 A;  2MH9 A;  4I98 B;  2WV0 A;  4M73 A;  3KP7 A;  2O6G E;  3DP7 A;  3W6J B;  3F23 A;  1S7A A;  5HS8 A;  4HX8 A;  1K78 A;  2P5V A;  2ADU A;  2PQ8 A;  2DK5 A;  4ZYD A;  3JSO A;  3P7N A;  3IWZ A;  4XLN F;  3TO9 A;  4A0X A;  2HKO A;  3GVA A;  5LRR A;  3H3Z A;  2HZT A;  3SXY A;  3KLN A;  4ENJ A;  2G9W A;  1W7P D;  2GA1 A;  1JGS A;  3EUH A;  3RDI A;  1MJ9 A;  2X4H A;  1G3S A;  3BZ6 A;  1HKS A;  2Z99 A;  3KP2 A;  3T5X A;  3R60 A;  1IF1 A;  3MZY A;  3ABU A;  2NAZ A;  3W6K B;  3GZ5 A;  1Z9C A;  2DFI A;  1IRF A;  1FP1 D;  1S6L A;  2EK5 A;  4IHT A;  5D4S A;  5EEH A;  4CZZ A;  4JBA A;  3HYI A;  1I1S A;  3I64 A;  2NNN A;  1P2F A;  2BGC A;  4RB2 C;  3COA C;  2HWV A;  4Y15 A;  1JE8 A;  5HLG A;  3ZMS A;  2W24 A;  3BP8 A;  3LA7 A;  3ZMD A;  1W7P A;  4A5N A;  2QVO A;  2XAQ A;  3IRR A;  1FOK A;  3RJP A;  2XKP A;  2GXB A;  2VOP A;  3J7A O;  5DCM B;  1IZ1 A;  1OYY A;  1I5Z A;  2IJL A;  2DI3 A;  4WX9 A;  2PI0 A;  3H3U A;  3M8E A;  1P4X A;  1J75 A;  3DF8 A;  4U0W A;  2HQR A;  1B4A A;  4HF2 A;  3TOA A;  3FXR A;  4YIF A;  4R79 A;  3LWF A;  3TKY A;  2ZXJ A;  4L9N A;  1XCB A;  4A6D A;  3F6O A;  4OIN F;  3GLX A;  5LHI A;  4HOB A;  1SFU A;  3HSF A;  2BE5 F;  1KU7 A;  1ZG1 A;  4P55 A;  4Q47 A;  3FXQ A;  3ECO A;  3TOB A;  1XGS A;  1ZGA A;  3C7J A;  1LEB A;  4PGG A;  4IRG A;  5FD5 A;  3QU6 A;  5L3G A;  3V8J A;  3ISP A;  1TQM A;  1I6X A;  2VON A;  5FFX A;  2GQQ A;  4G7Z F;  1GXP A;  1XGO A;  4RS8 A;  2G7U A;  4L9T A;  1R5G A;  1S8N A;  2K4J A;  1MZB A;  3HRT A;  4KUM A;  5LGT A;  2YU3 A;  5IT9 K;  2ELH A;  4I01 A;  3BDD A;  4CIC A;  3CUQ A;  5JVT A;  1R1V A;  1BJA A;  2F5F A;  1SAX A;  2K02 A;  3LST A;  1D3Y A;  2H09 A;  3NQO A;  4KMU X;  5CYV A;  4HLY A;  4GYI A;  3GEZ A;  2PN6 A;  2NRA C;  3KZY A;  5HDG A;  3H92 A;  4A0Y A;  1R58 A;  3EYY A;  2DTR A;  4H0E A;  1PP8 F;  1D8K A;  5F1R A;  4MQ9 F;  1SFE A;  2G7H A;  2KIM A;  4LFU A;  5ILU A;  4ESB A;  3ZMZ A;  4Z2Y A;  2M87 A;  3KE2 A;  4AD9 A;  3FM5 A;  4UHT A;  2L02 A;  4Q4Z F;  3SZP A;  4EM2 A;  5FFZ A;  5DD8 A;  2OQG A;  1S29 A;  1MJB A;  2IA1 A;  5A2Q K;  1XN7 A;  1K6O A;  2ZME B;  2R7D A;  1SD6 A;  1B1B A;  1KYW A;  4EV0 A;  3RPQ A;  2RGV A;  1WWX A;  3KCC A;  3QPT A;  3GFM A;  5FLX K;  3PQJ A;  3ZMU A;  1Q1H A;  3SQN A;  4I0B A;  1TNS A;  3B02 A;  5H6Q A;  5HS9 A;  3IRQ A;  2CFX A;  2HQN A;  2P4W A;  3U1D A;  2VC1 A;  4U7B A;  4Y17 A;  3RTR A;  1FYK A;  2FU4 A;  3E6D A;  1UHM A;  4ZYE A;  4MHG A;  4XSX F;  2F5C A;  1T0F A;  4LK1 F;  2ESH A;  1KQ0 A;  5CVJ A;  2QQA A;  2FE3 A;  3R0A A;  3F8B A;  2O8X A;  4GCV A;  1ZRF A;  3DKW A;  1XD7 A;  3MQ0 A;  5FGM A;  1AWC A;  1LDK B;  2W85 A;  3L9F A;  2WTE A;  2M1B A;  3HIF A;  4HLX A;  4KYW A;  5BS6 A;  2H6B A;  1DPR A;  2OZU A;  2YX4 A;  3F8N A;  3L7W A;  1G6N A;  4S04 A;  5KK1 A;  1Z6T A;  4P96 A;  2PMH A;  4M71 A;  4KIG A;  3Q5F A;  2E7X A;  3I0T A;  4BYY A;  3BWG A;  2A3S A;  4ZZD A;  2RKH A;  2UZK A;  4LLG F;  3TDZ C;  1FYL A;  3RKY A;  1MGT A;  5DCM A;  3ZMT A;  2VBY A;  1R23 A;  2L4M A;  1ZLK A;  1BIA A;  3KP3 A;  4G9Y A;  1QNT A;  4LG0 A;  2VC0 A;  3V7C A;  2ESN A;  3HRU A;  2XHK A;  1YIO A;  4EVI A;  3I53 A;  4M9Z A;  2XAF A;  3ROU A;  4WK8 F;  3K2Z A;  1ZG5 A;  4B09 A;  1GVJ A;  1W4M A;  1G3Y A;  5D5W B;  1XDS A;  4MNU A;  2HYF A;  1IXC A;  5ILS A;  2XAH A;  1ODD A;  4OMY A;  1FLI A;  4G7O F;  4TV7 A;  1F5T A;  2ZNY A;  4M6X A;  1KQ9 A;  1Y0U A;  3EYI A;  2MC3 A;  3LQQ A;  5ILV A;  2UXX A;  4WXD A;  1QO0 D;  2CW0 F;  1BN5 A;  1RNL A;  2MLK A;  4N9H A;  3PFI A;  4IHS A;  4XRF A;  5E1W A;  1ZH5 A;  1FPQ A;  1LJ9 A;  4KA4 A;  4HBL A;  2CGP A;  2COM A;  1TTY A;  5AIQ A;  3G73 A;  1F1Z A;  1KU2 A;  5ED4 A;  2QQ9 A;  3ML6 A;  4KIB A;  5AON A;  2QUF A;  3QP6 A;  5BPD A;  1XMK A;  2FXA A;  1FC3 A;  2E7W A;  3NRV A;  5TJJ A;  1BIB A;  3WOD F;  2DPD A;  2XUB A;  1ZHF A;  1IW7 F;  2D1H A;  1P6R A;  3CUQ B;  2XIG A;  3ECH A;  2H27 A;  1O3R A;  5LRS A;  2V6C A;  1KU3 A;  4RB1 A;  3O3K A;  4JK1 X;  4P9U A;  1OYI A;  3HSE A;  4IVN A;  4EJU A;  2JSC A;  3VEP A;  4WXH A;  1IXS B;  3QOP A;  4CHU A;  5IT3 A;  2ZME A;  5BQT A;  1UFM A;  1STZ A;  3JW4 A;  1P4A A;  1OR7 A;  4OIP F;  4M72 A;  1FNN A;  3PQK A;  3V7S A;  4HX4 A;  2OAZ A;  4WF2 A;  5LHG A;  1EH8 A;  2A07 F;  2DU9 A;  2P5L C;  3JTH A;  3TDU C;  3D5L A;  1P4W A;  1LB2 A;  1CF7 B;  2EFN A;  2FRH A;  5FO5 A;  3GF2 A;  2AXL A;  3DV8 A;  4U7D A;  3ULQ B;  1I1G A;  3G3Z A;  3M7G A;  3QP5 A;  1USS A;  4O3M A;  3I5U A;  3HOS A;  3FF5 A;  2DLL A;  3TGN A;  2J5P A;  3QPH A;  4B8X A;  5BMZ A;  5TRD A;  1B6A A;  2HS5 A;  1BI2 A;  1EH7 A;  2OQR A;  1FYM A;  2E1N A;  1BC8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...