3RI4A

Ets1 cooperative binding to widely separated sites on promoter dna
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
136
structure length
136
Chain Sequence
b'GTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein C-ets-1
publication title Structural basis of ets1 cooperative binding to widely separated sites on promoter DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 46
structure length 136
sequence length 136
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ri4A00
3E6MA 1STZA 1EH8A 2EV0A 4L5JA 4HLXA 2W24A 1IXSB 2YSRA 1J7KA 2RKHA 1BC8C 1XDUA 1P4XA 1XN7A 4UVCA 3I53A 3GFMA 1FX7A 2ZJ2A 3H3ZA 3H92A 4EJWA 1W5TA 4AVPA 5TJJA 4I01A 4RB1A 3GW2A 4UV8A 3VOEA 1IN8A 2W85A 4N0BA 2UZKA 1S6LA 4HF1A 1J59A 2R3SA 2VN2A 3U2RA 5JFRA 5ILSA 3VFZA 1ZG5A 2W84A 4EJTA 1K6OA 3DEUA 4OU0A 3V8KA 1DP7P 1OYYA 3I54A 2A69F 5ICEA 4ZH4F 2P6TA 2P5LC 1MDMB 3LQQA 1Z7UA 1JGSA 4YIFA 3ZQ7A 1HW1A 4M74A 2VC0A 3RKXA 2VXZA 2CO5A 4G7ZF 3PQJA 3EYIA 2H94A 4A5MA 1ON1A 4DQ2A 3P9CA 4LB6B 3N4MA 1UHMA 1LVAA 3VEPA 2ESNA 5FFZA 4BQAA 3J81Z 2QZ8A 1FY7A 3FM5A 3GEZA 5D8KB 1F4KA 2EFWA 3K1PA 5DUIA 1U2WA 4MQVA 1J9IA 2WTEA 1CGPA 4Q47A 3QU3A 2JZYA 3NRVA 2O3FA 2QQ9A 4CXFA 1LEBA 4BH9A 2MLGA 2XKOA 1DPUA 1BJAA 5ERIA 2P5KA 3SZPA 4GYIA 4U0YA 3JTHA 2R7FA 3ZN1A 4Q4ZF 3V7RA 4HQMA 2L54A 3GVAA 3KZYA 4OIOF 3BJ6A 1Z6RA 2FXAA 3DF8A 4YFKF 1OPCA 2H6CA 2VBZA 2F5FA 5L3DA 3WTXC 3IWFA 1U6GA 5K5QA 2OQGA 4KN4X 3QP6A 5D5VB 4ON0A 3ZMDA 4ZYGA 4R79A 1ZRFA 1PP8F 4IHSA 2BV6A 3JSPA 5LEJA 1LQ1A 4AIHA 4Q5SF 5HLIA 4WK8F 2HWVA 1UFMA 5LLQA 2UWMA 4HQEA 3OOPA 4GXOA 1FT9A 4RGUA 3K1NA 2VONA 4N9IA 3VB2A 1G3YA 5HLGA 2O61A 1BBYA 3HSEA 5HDKA 2IT0A 1R36A 3F8MA 2BYVE 5CVIA 2V1UA 3O3KA 1SFUA 2MLKA 2OAZA 2VBWA 4EMSA 2A6HF 2EB7A 4FX0A 1REPC 5CJ9A 5AIPA 3TDUC 4FT8A 3BPXA 3GF2A 3DFGA 3BY6A 1MJAA 1Z91A 1IN6A 2FMLA 2NS0A 1YIOA 4HBLA 1YW9A 3O2PE 2CFXA 5EEHA 3I58A 4HLYA 2KIMA 1ZGJA 3GFLA 3L09A 1TW3A 2MD5A 1NHAA 3JTGA 4NHJA 2IRFG 2F2EA 4MTDA 3TKYA 2QBYB 3IRQA 4ZYHA 2BEOA 1FP1D 3Q9VA 4CZZA 1XMAA 2HFHA 1H9GA 2VE8A 4WXCA 2IPQX 4MQ9F 2DAOA 2EFNA 4CGZA 2KKOA 4LLGF 2PEXA 5D6FA 2QBYA 2IP2A 3CJNA 1V4RA 5H6QA 1DUXC 2DPDA 5HDGA 2CWEA 2M45A 3I0TA 1KU3A 4MEYF 5E20A 1EV7A 1S7AA 5KK1A 3F22A 2DPUA 3R4KA 1BI3A 2GA1A 4JK1X 3U9GA 2JT1A 4IRGA 4XRFA 2VBXA 4OIPF 4I7HA 2IA2A 4GYGA 3N97A 4LB5A 2QVOA 3IKVA 5AIQA 1AOYA 3G73A 3E6CC 5DCMA 2GWRA 1FOKA 2A61A 1O3SA 1T0FA 2GZWA 2DQLA 3W6JB 4ZZDA 4BYYA 4KFCA 2XAFA 2ISYA 2IA0A 2RVCA 2EV6A 2HQRA 1KQ9A 4XSZF 3SQNA 4EM0B 4WX9A 2A07F 1R00A 5HOOA 2ELHA 3E5QA 1TQMA 1QBJA 5E8GA 1ZN2A 3KFWX 5D4SA 3BOQA 2ZFWA 3R61A 4O3MA 4UV9A 4RS8A 1IXCA 4IPAA 4D0PA 1H0MA 2GQQA 3Q9SA 2IJLA 3I4PA 5ICCA 5D5UB 2MBFA 3LSTA 3ZN0A 4XSXF 2OU2A 1RI7A 3SFZA 1HQCA 4YG2F 1YLFA 3E97A 1R1VA 1ZLJA 2J5PA 2XVCA 3M8FA 1BC7C 3VODA 1OKRA 2LF7A 3WGHA 1FYLA 3F6OA 1YG2A 4CHUA 2OQRA 2MA3A 1MGTA 2HS5A 1U3EM 3FXRA 2FRHA 1IUYA 1O7LA 1LEAA 2VT2A 1TQIA 3LAPA 3QAHA 1IF1A 3WGGA 3WTWC 1TBXA 4L5IA 2WV0A 1YS6A 1QNTA 3IL2A 2C6YA 2K27A 4ESJA 4MGRA 4KIBA 2G7UA 5CYVA 5EEGA 1L3LA 5HLHA 3IC7A 5KVRA 1CF7B 4KUMA 1R23A 3F6VA 3CUQC 1T2KA 1FSHA 2Y75A 4P96A 2Q8KA 3E6DA 2FE3A 1IRFA 1P4WA 3ZMSA 1S3JA 5DD8A 1IRGA 2EFQA 4L9NA 5DDGA 2P6SA 3K1MA 1U5TA 2HOEA 3ERED 3L9FA 5IT9Z 1OR7A 4LG0B 1CF7A 3MZYA 1FP2A 1Z9CA 2L01A 2IW5A 4EGYA 3T5XA 5A2QZ 4WXHA 5DEQA 2V79A 4OOIA 3T8RA 2K7LA 3F3XA 1S7OA 3G3ZA 2PQ8A 1IAWA 3RTRA 5JVTA 4LGWA 3BJOA 3E6BA 2PN6A 4LG0A 1KU2A 2DFIA 2GIVA 4HF2A 2XASA 4UUVA 4ZYEA 2G9WA 1RZ4A 4U7DA 1LJ9A 4MHGA 4HDVA 1I5ZA 4ENKA 1I1SA 3GLXA 4HA8A 3C18A 1IXRC 1I27A 1FWZA 4ESFA 4RAYA 2FEZA 1HKQA 1YS7A 3L7WA 2BE5F 4LD5A 2A6EF 4IJAA 1HSJA 2GAUA 4LK1F 3FZVA 1J2XA 2LSOA 2ZXJA 4EVIA 2HQNA 5BOXA 4WCGA 2D1HA 2JPCA 3WE3A 4YFNF 3RKYA 1Z6TA 4O6JA 4AWXB 3BDDA 5DCFA 1GXPA 1B9NA 4LLLA 1E17A 4BHPA 2DTRA 3PQKA 3T0YA 3FWEA 1B4AA 2EK5A 4DNCA 2V1XA 1MD0A 3WU1B 4NB5A 5L3EA 3U1DA 3JAMZ 3M8EA 4KDPA 5LRSA 1HW5A 4I2OA 3J81K 4ZYDA 4E70A 3QPHA 1G3TA 5E1ZB 5FLXZ 5E1XA 1UHWA 4JQFA 2RGVA 1SMYF 1VTNC 4KMFA 3TDZC 2EWNA 3CTAA 2L02A 1R7JA 3OV8A 1MDMA 3MEXA 5K5RA 3P7NA 2ZO4A 3KLNA 2PG4A 2F5EA 1BI1A 4OMZA 2O8XA 3FF5A 1FYKA 2JTVA 2Z33A 2YX4A 3TO6A 3K69A 1QGPA 3WE2A 3HRSA 2YX7A 4ENMA 1YO5C 4UXNA 3ABUA 1A04A 2R7DA 2M87A 4HX7A 1OYWA 2M8EA 5DYMA 4IHTA 2NYXA 3ECHA 2CSOA 2K4BA 5DD4A 3R0AA 3Q5FA 5LHIA 1K7AA 2VOOA 2XHKA 3ZMTA 2CQKA 3MCZA 2PBIA 5L3BA 5ICFA 2QWWA 3V7CA 4MEXF 5L3FA 2KIFA 3GFJA 2FBHA 4IXAA 4HV6A 2HYGD 2HYFA 3ECOA 4HOBA 3F23A 2E7WA 3RPQA 2VE9A 3ML6A 3C3WA 1W7PD 3I59B 2L3DA 3I5UA 4LLNA 1E2XA 3WG9A 4L9JA 1G6NA 2LKPA 1GXQA 3L2CA 2A68F 4KIGA 4U0WA 2ADUA 2HEOA 2VOPA 5LRRA 3FMQA 2LF8A 2F5CA 4XBFA 2UXNA 3TGNA 4I02A 2XAJA 3I59A 5E8IA 4N9HA 4XLPF 4XLNF 3RYPA 2AXLA 3MAJA 5D8LB 3FX3A 1XDSA 3HSFA 3J80Z 4PGHA 1HW2A 2P7VB 4GCVA 4RB3C 4OIRF 4RB2C 4FX4A 2A3SA 4HAMA 5TRDA 1LB2A 3KP7A 2ETHA 4OINF 4AD9A 2EFOA 1WQ2A 2DLLA 2XAGA 2GXBA 2L4AA 4G6QA 5JHUA 4PZJA 1ZRCA 5FGMA 3T8TA 1IZ1A 1FBSA 2KJBA 4R8HA 5LGNA 1SD6A 1PP7U 4JBAA 3TOAA 4M6YA 5HVQC 1L0OC 5BMZA 1O57A 3WU0A 4AIJA 3EYYA 4U88A 3HRMA 1AWCA 3ZMUA 4AIKA 1I1GA 3D0SA 4A12A 1TTYA 1MJBA 2MC3A 4I09A 3BROA 5DV5A 3CDHA 3WTTC 1MZBA 5D5WB 1XD7A 2O03A 4Z2YA 3KE2A 2BGCA 3ABTA 2L4MA 3QRFF 2RN7A 1B1BA 3FM3A 4RAZA 3JW4A 3CO7C 1XMKA 4L18B 1RUOA 5L3GA 1D8JA 2RNJA 1R1TA 2PI0A 1KQ0A 4RB0A 2RC4A 1YQAA 5CVJA 3DKWA 2FBIA 3E5XA 4P9UA 5H20A 3SXYA 1O3TA 2DT5A 5K1YA 2Z9OA 4BNCA 1JHHA 3I71A 1O3RA 3ZPLA 4WF2A 2DBBA 1T98A 5F1RA 2D1VA 2QQAA 3PFIA 4HX4A 4IRHA 3CUOA 5CLSA 5HDNA 3MQ0A 3SHFA 2O0YA 1HBXG 3KP6A 5J8FA 1XCVA 4PDKA 2JSCA 4I0BA 1TLHB 1U8RA 3WTSC 3LAJA 1R5HA 2XROA 1TNTA 2ZNZA 1D8KA 4KA4A 3GYHX 4MNUA 3J7AO 2LNBA 2P7CB 2FSWA 5K5OA 1O3QA 1G4DA 3HUGA 2D2WA 4S05A 4A6DA 2NNYA 2FQ3A 2YU3A 2DI3A 1Z1DA 3RYRA 2E1NA 1GVJA 1TW2A 4ESBA 1FPQA 4TV7A 2QUFA 1KA8A 3GZ6A 2QENA 1IN7A 2B0LA 3KP2A 1ULYA 1BIBA 2CYYA 1FZPB 1S29A 2BBYA 5J8CA 2EV5A 2M30A 3V7SA 1ONVA 4H0EA 4EM2A 1BN5A 1U78A 2H09A 2HTJA 4LK0F 2Q0OA 2Y48A 3FXQA 1D3YA 3DPTA 1R1UA 2EFPA 2X4HA 4RGSA 1D5VA 4U0VA 5AONA 5HS8A 2PJPA 3REOA 1FNNA 3R0JA 1U5TC 3GWZA 1P92A 4KIFA 3BWGA 3T1BA 4K2EA 3GX4X 5FD5A 2FU4A 4A2UA 5IT9K 1F9NA 3QU6A 2AS5F 1P6RA 3K9TA 1QQIA 3DPLC 2KRFA 4KICA 4ENNA 3O6BB 2DU9A 4BHCA 2CGPA 5ED4A 2RDPA 1SMTA 2ZNYA 3LQRA 4CDGA 5A2QK 3DQVC 3LA2A 3ROUA 3HOSA 1QZYA 4HZFA 1UB9A 2GXGA 3FXUA 1B9MA 1JE8A 4G6DA 3P9IA 1HSTA 4Y17A 4QWQA 1FC3A 1OYIA 1X3UA 5LGTA 2YPRA 1B59A 2NAZA 4A0YA 3F8FA 2QM3A 2D45A 4IRIA 3F8BA 2PLYA 2IA1A 4OMYA 3B02A 5F64A 1PDNC 1XGOA 2PMHA 2O6GE 1USTA 1XSDA 2W57A 3BP8A 1W5SA 4UVBA 1JXSA 4HX8A 5FB2A 4HDUA 5CVVA 2FNPA 1BI2A 1FBQA 4UVAA 2VC1A 2FMYA 4CICA 4EGZA 2ZBKA 3KETA 2EJRA 2HZTA 4RGRA 3QPTA 5F6FA 2EA2A 3JAMK 2K02A 2DQRA 2RV8A 3F8CA 4A0XA 2UXXA 5LEKA 2DK8A 1KU9A 1S8NA 2QYOA 5BS6A 3E5UA 2OD5A 1IN4A 2ESHA 1LDJA 5FLXK 1BM9A 1ZARA 2A5YB 2GA2A 3B73A 1P4AA 1YW8A 2FA5A 1ZYRF 2Q2EA 2OZ6A 3MFKA 4M71A 4BAYA 1J0RA 3NQOA 2FOKA 3LA7A 3P9KA 3GZ5A 5FFXA 3WTZA 5HS9A 2IVMA 1HXDA 3FMSA 5CVUA 4U7BA 3WTVC 2E1CA 1USSA 2M5WA 1J75A 4P5OA 2STWA 1F1ZA 1XSXA 3WTYC 1EH7A 3ZMZA 1KGSA 2HR3A 2XV4S 4S04A 5FO5A 1ON2A 4A0ZA 4LMYA 2Z3YA 2HKOA 2V9VA 3RJPA 1WRJA 4O5VA 1TNSA 1W4MA 1DDNA 1G3WA 1ZGAA 4RGXA 4L0YB 2XUBA 1IN5A 1BI0A 4EJVA 4I98B 1B6AA 3BJAA 3IWZA 5LHGA 3S2WA 3HYIA 3MWMA 5LHHA 2FF4A 2HKXA 3FHZA 3GUDA 3LFKA 4UNOA 2OA4A 2HTSA 1K79A 2YR2A 2H27A 2G7HA 4EM1A 1YW7A 3EDPA 3H3UA 1SFXA 1KYWA 3EQLF 4KYWA 2ISZA 3KP4A 3K0LA 4KN7X 3DP7A 4G7HF 4M72A 1SAXA 6PAXA 3M9AA 5IT3A 3IRRA 4M9SA 4BXUA 3K2ZA 4Q48A 2PMUA 3WTUC 3HHGA 3CLOA 2QQBA 3KEQA 1G3SA 3MZHA 3AAFA 3TQNA 4UHTA 3IHUA 3J80K 3TO9A 3BZ6A 1WKMA 3LWFA 1DPRA 1K78B 4IVNA 4WWCA 4GO1A 2XAQA 3KLOA 1ZG3A 5JR3A 4PGGA 2J5OA 1TQPA 4L9VA 4YIIA 3HHHA 5HS7A 1Y0UA 1V3FA 2VBYA 1ZH5A 1FSEA 1K78A 2CG4A 1SD5A 1ODDA 1SD7A 4CYDA 3W6KB 1T6SA 1QPMA 2M1BA 1XGSA 1RUNA 3E3VA 1RIOH 5ILVA 3RDIA 3HRUA 1HKTA 5J6XA 3D5LA 4P9FA 3M1EA 3HTUA 4F7ZA 2XKPA 3CO6C 5LBQA 1JHFA 3ISPA 3KZZA 3R6SA 4A5NA 3HRTA 5BPIA 4ETSA 1FYMA 4HV5A 5D6EA 4EQQA 5E18F 1R22A 3GFIA 2KIUA 4B8XA 2HDCA 2FNAA 1ZG1A 3IKTA 2K86A 1J5YA 4G94A 1WI9A 2Z99A 3I64A 3RI4A 2Z5UA 4KMUX 1MKMA 2QLZA 1LDDA 1ZHFA 1BOAA 5D5XB 1ZLKA 4BHBA 5DUKA 1XB4A 4HYEA 3DV8A 2ZKZA 4M73A 3ELKA 1F5TA 1PUEE 3C1DA 2XIGA 2MH2A 1T38A 4G8XA 3DXJF 3F8NA 4L9TA 3WODF 3ULQB 5DCMB 1GHCA 2CW0F 3QOPA 4I0AA 1YTYA 2NRAC 5ILUA 1FBUA 4WXDA 2XGXA 1LNWA 2VT3A 3C7JA 4L0ZB 2LDUA 2MH9A 2WC2A 2KJCA 1OMIA 1BIAA 1LDKB 1YFHA 2ACJA 2TDXA 4HW0A 5FD6A 4MTEA 3EETA 3ZMVA 5LGUA 2OZUA 2PFBA 2F5DA 4PCQA 4P55A 3KP5A 3BPVA 4Y15A 5H6RA 1KYZA 3HTSB 1YYVA 4FHTA 3V4GA 2DO7A 3JSOA 1SFEA 5E17F 2ZCWA 4G7OF 1KQ8A 4IF4A 4GGGA 4CO8A 3KP3A 3QP5A 4EJUA 1XGMA 1W7PB 2P4WA 1H9TA 2DK5A 4KT5C 2DW4A 2NNNA 5D4RA 1QZZA 1RNLA 4EV0A 4M9XA 2JRTA 1IW7F 3HOTA 2HGCA 4LJZF 1XSVA 3RIRA 1MJ9A 3ZP5A 4EJOA 1W7PA 1O7FA 2COMA 3RKWA 2Y0MA 3SZTA 2WWYA 3TO7A 1EH6A 1C0WA 3KCCA 2JPBA 2X0LA 4M6XA 4ENJA 1Q1HA 2XAHA 3WGIA 3COAC 1KU7A 4G9YA 3GO5A 1T39A 2H6BA 3F21A 1UCRA 4A6EA 1SD4A 5CVRA 1QO0D 4NQWA 2P5VA 1I6XA 2V1DA 2STTA 2FBKA 2K4JA 3GXOA 5BPDA 5L3CA 1U5TB 4OIQF 4Y13A 4YFXF 2VODA 4HF0A 2OBPA 3TOBA 3KEOA 2P8TA 4ASNA 1XCBA 4B09A 3CUQB 2RQPA 3L00A 3M7GA 3RPUA 2W25A 2ZMEB 5E1WA 3R60A 3HIFA 3LA3A 2E7XA 1FLIA 3F72A 1ZAOA 3V8LA 1WSUA 2XRNA 3FMRA 1XGNA 4M9ZA 3CUQA 4KNYA 4QLCU 5JI6A 3V8JA 2EA4A 2ZMEA 5BQTA 1WWXA 1Z05A 4ZZLA 4LFUA 4R1HA 1R5GA 1ZRDA 3HSRA 1HKSA 1P2FA 3EUHA 1R58A 3NEUA 5ICGA 2V6CA 1ZREA
chains in the Genus database with same CATH superfamily
3E6MA 1STZA 1EH8A 2EV0A 4L5JA 4IKFA 4HLXA 2W24A 1IXSB 2YSRA 1J7KA 2RKHA 5IYBJ 3GTJJ 1BC8C 1XDUA 2ZJQF 4RLQA 3FISA 2HYJA 3UNGC 1P4XA 1XN7A 3LSJA 1GLNA 1H8AC 3BC8A 3JRIA 3GTPJ 4UVCA 3I53A 3GFMA 1FX7A 3W6VA 2ZJ2A 3G1LA 2QA4I 3H3ZA 3MMYB 1K61A 3H92A 4EJWA 1W5TA 3G1MA 4AVPA 5TJJA 2WB1N 4I01A 5DS9A 2VQCA 3S16J 4RB1A 3GW2A 4UV8A 3VOEA 2K85A 3OYEA 1IN8A 4B43A 2W85A 1FMVA 4N0BA 2UZKA 1S6LA 4HF1A 1J59A 5GADJ 2R3SA 2VN2A 1ETKA 3U2RA 4YRVA 2HU9A 5JFRA 1IDZA 5ILSA 3VFZA 1ZG5A 2W84A 3FXKA 2XSJC 4EJTA 2E34A 1Y39A 1K6OA 3HOYJ 1V54H 3DEUA 4OU0A 3AG2H 3V8KA 1DP7P 1OYYA 3I54A 3OYBA 1IUFA 2A69F 5ICEA 2HVRA 4ZH4F 2P6TA 1XMXA 3LSPA 1WGXA 2P5LC 1MDMB 3LQQA 1Z7UA 4E6KG 2VKHA 1JGSA 4YIFA 2EZHA 1OISA 1HW1A 3ZQ7A 2VXDA 4M74A 2HVQA 2L7KA 2VC0A 3BTLA 3RKXA 3PFYA 2KHMA 4A69C 2EINH 2VXZA 3BZCA 2CO5A 1X1AA 2DT6A 4A3CJ 1D1CA 4G7ZF 3PQJA 3EYIA 5B5EC 1SVLA 2H94A 1MNEA 1ON1A 4A5MA 4DQ2A 2IGKA 3P9CA 4LB6B 4BU2A 3N4MA 1UHMA 1LVAA 3VEPA 3DCFA 3A0HC 3M1CA 2ESNA 5FFZA 3CD6I 4BQAA 2WADA 3J81Z 2QZ8A 3I4NJ 2R7WA 1FY7A 3FM5A 5GAHJ 3WHCA 3HOWJ 3KYCB 1JUSA 3GEZA 3DEEA 5D8KB 1A36A 1F4KA 2EFWA 2XPWA 3K1PA 1QVTA 3QPSA 2F4OB 3S8PA 4X6AJ 3QODA 4BXFA 5DUIA 1EJ9A 1U2WA 3QYFA 4MQVA 1J9IA 3H0GJ 2JK3A 2DT7B 2WTEA 1CGPA 3H5RA 4Q47A 3QU3A 2JZYA 3LSMA 2CUEA 2DMTA 1E3OC 1LFPA 3NRVA 2O3FA 2QQ9A 3JR9A 4CXFA 1W1WE 1LEBA 4EEFG 4CH7A 4BE1A 4BH9A 4F55A 2MLGA 2XKOA 1DPUA 1BJAA 4ZYAA 2CQQA 5FRMA 5ERIA 2F4IA 1X1CA 2CFOA 2P5KA 5FLVA 3SZPA 4GYIA 4U0YA 3JTHA 2R7FA 3ZN1A 2DA3A 4Q4ZF 3HL2A 3CCEI 4XNFA 4F93B 5F0HA 2K9LA 3V7RA 3PNVA 5EZHA 4HQMA 2L54A 3GVAA 3KZYA 1VQPI 4OIOF 2VPLA 3BJ6A 1Z6RA 1WH7A 2FXAA 3DF8A 1D1AA 4YFKF 1UG2A 1OPCA 2H6CA 2QGUA 2Z16A 3WHBA 1LE8B 4C2UA 2VBZA 3MZ8A 2F5FA 5L3DA 3VDXA 3WTXC 3IWFA 3A01B 1WVRA 4C3HJ 2VASA 1U6GA 3DU6A 5K5QA 2OQGA 4ZTJA 4KN4X 3QP6A 5D5VB 4ON0A 3ZMDA 5C4XJ 4PSXA 4ZYGA 4R79A 1ZRFA 1PP8F 1I3QJ 3CDIA 4IHSA 2BV6A 3JSPA 5LEJA 2X6XA 1LQ1A 3W2WA 4AIHA 4NC8A 4Q5SF 5HLIA 4WK8F 1Y56A 3SEQA 3TBIA 2HWVA 5GP9A 1UFMA 5LLQA 2UWMA 2LLKA 2E60A 4HQEA 2CUZA 2M0CA 3OOPA 1LE8A 3D1NI 3A01A 4GXOA 1FT9A 2VKVA 4RGUA 3SDGA 3K1NA 5F1JA 2VONA 2HXOA 4N9IA 3VB2A 1G3YA 3ZCOA 4FETA 5M3MJ 5HLGA 2O61A 4HNUA 1EKEA 2X48A 1KONA 4BKXA 1BBYA 4OAYA 3H5AA 3E7LA 2QEXI 2JRMA 3HSEA 5HDKA 2IT0A 1LKXA 1R36A 3F8MA 2BYVE 5CVIA 2V1UA 1R5ID 2LY2A 3O3KA 3KPHA 1SFUA 2KP6A 1X3WB 2M0MA 1DU0A 2MLKA 1IJWC 2OAZA 2VBWA 3CCVI 5J3LA 4EMSA 2A6HF 2EB7A 2L9SA 1JJ6C 2Z2SB 4FX0A 1AU7A 1REPC 5CJ9A 5AIPA 4RDUA 1PVEA 3HG9A 2R7XA 3OY9A 1MMGA 3DTIA 2WY8Q 3TDUC 4FT8A 2NOJB 3BPXA 1TZLA 3GF2A 3DFGA 2IGMA 3BY6A 1MJAA 1Z91A 4IQJA 1IN6A 2R92J 2FMLA 2NS0A 5FKOA 1YIOA 4HBLA 1YW9A 3O2PE 1HDDC 2CFXA 5EEHA 1YIJI 1YRNB 3I58A 4HLYA 1WJFA 4BY1J 2KIMA 1ZGJA 3GFLA 3L09A 1TW3A 2MD5A 1ITYA 1NHAA 4H4KC 3JTGA 4NHJA 2IRFG 3SEZA 2F2EA 3CF5F 2PX9A 2W1OA 4MTDA 5GPCA 2X1EA 3S93A 3CF2A 5M3FJ 3TKYA 2QBYB 3VYUB 3IRQA 2XGCA 4ZYHA 3JREA 4XOTA 1OJLA 2BEOA 1FP1D 3Q9VA 4CZZA 1XMAA 2HFHA 2K3FA 3DU5A 3BR2A 1H9GA 1A6QA 2BY2A 2VE8A 4WXCA 3G71I 2IPQX 2G0EA 4MQ9F 3BCBA 1WH5A 3WU2C 2DAOA 2EFNA 4C9YA 4XOPA 2VLAA 1YX5A 3SJMA 4IZZA 4CGZA 5F0FA 1POGA 5F27A 2KKOA 3CJQB 3LSGA 4LLGF 3VSLA 3IH3A 1OLTA 2PEXA 2KIQA 5D6FA 3FHNA 1QHHD 4BJTA 2QBYA 2IP2A 2DYRH 1WJDA 2VKEA 1X1PA 3CJNA 1X4OA 1V4RA 4Y3OA 4LOCA 1VF9A 5H6QA 1DUXC 3DPUA 2DPDA 5KAIC 1QU3A 5HDGA 2CWEA 2M45A 3I0TA 1WHUA 3OS0A 1KU3A 4MEYF 5E20A 1HOMA 3OS1A 1EV7A 1S7AA 1BW6A 5KK1A 4AUXA 5EEAA 3F22A 4E7SA 3OL3A 2DPUA 4B44A 2ID3A 1E3HA 3FKJA 3R4KA 3U1KA 4KJZA 1BI3A 2GA1A 4JK1X 3U9GA 2JT1A 4QTRA 3ZQCA 2Y9ZA 3FK6A 4XK4A 4IRGA 4XRFA 2DXIA 2VBXA 4OIPF 1MBKA 3U21A 5KCMA 1FIAA 3LMMA 2VUMJ 4IOAF 2EIMH 4I7HA 2IA2A 4GYGA 3N97A 2LR8A 2QVOA 3K6GA 4LB5A 1W36D 4Y52J 3IKVA 5AIQA 1SVOA 1AOYA 2XB5A 3G73A 2EIKH 1S5LC 3E6CC 5DCMA 2GWRA 1FOKA 2A61A 1IGNA 1O3SA 1T0FA 4Z6YA 2GZWA 3OYKA 2DQLA 3W6JB 3CMYA 1YJ9I 5EJCA 3M3YJ 4ZZDA 4BYYA 1UHSA 4KFCA 2XAFA 2ISYA 4C2MJ 2IA0A 1V5EA 2D5VA 2RVCA 2EV6A 4LIUA 2HQRA 1KQ9A 2L7FP 5E3MA 3BR5A 4XSZF 2LC2A 3SQNA 2OF7A 4EM0B 1BR2A 4E7LA 4WX9A 2CQNA 2A07F 1QZEA 1R00A 1ZK8A 2LOOA 3HUGB 4XRSA 5HOOA 2ELHA 3E5QA 3DKXA 1TQMA 3HC7A 3BCAA 5LD2C 1VQOI 2IS2A 3S1NJ 5M5YJ 2LD5A 1AKHA 1QBJA 5E8GA 2HVSA 1FTTA 2FD5A 1MBGA 1ZN2A 3KFWX 4L5EA 5D4SA 2OCCH 3BOQA 3K4LA 3AFHA 1MMSA 4BBRJ 2R4GA 2X6WA 4A3LJ 2ZFWA 3R61A 4O3MA 4UV9A 4F3QA 3OOUA 3HEFA 4RS8A 1IXCA 2M7AA 3H9QA 4IPAA 4D0PA 3IAS2 1TWHJ 1H0MA 3OR2C 2GQQA 3DLAA 3OSGA 3Q9SA 1KZHA 1JUPA 1LFBA 2IJLA 3I4PA 3OL4A 5ICCA 5D5UB 1ZR2A 2MBFA 2JA8J 5FKNA 2K3PA 2NVQJ 3LSTA 3ZN0A 4XSXF 3ZOBA 3BG3A 1JTXA 1RI7A 2OU2A 2ZFUA 1AA7A 3SFZA 1HQCA 4YG2F 3O8GA 1YLFA 3E97A 1D0ZA 5K7HA 4JOMA 1Y1WJ 1R1VA 1ZLJA 2J5PA 1T56A 2XVCA 4QPOA 3M8FA 3ZGKA 1BC7C 3VODA 2WAQA 1OKRA 5DM7F 2LF7A 2GM4A 4XN3A 3WGHA 4FE4A 1FYLA 4F91B 2R5YB 4AYBA 2RNGA 2I10A 1BR4A 3F6OA 1YG2A 4CHUA 3ZQGA 2OQRA 3FIWA 5IP6A 2MA3A 4CCKA 1MGTA 2HS5A 1U3EM 3FXRA 3MVPA 4I6ZA 2FRHA 3S32A 3HKZA 5IY5H 3OR1C 1IUYA 1O7LA 1X3ZB 1EF4A 1LEAA 2VT2A 1TQIA 3W3CA 4RBOA 3OYCA 2ID6A 3LAPA 3QAHA 1IF1A 3WGGA 3WTWC 1G8XA 1VQLI 1UAAA 1TBXA 4L5IA 1HF0A 2TRTA 2WV0A 1YS6A 1QNTA 3IL2A 2C6YA 2K27A 4ESJA 2BY0A 4MGRA 3BG7A 4PUSA 4AU7A 1FOXA 1QRYA 1P7JA 4XR6A 4KIBA 1G59A 2G7UA 5CYVA 2Y30A 4PJ0C 5EEGA 1L3LA 1TT0A 4BEHB 1I39A 5HLHA 2L9NA 2VJIA 1ZGWA 1VQ4I 3IC7A 5KVRA 3FDYA 4KUMA 1R23A 1CF7B 2DMUA 3F6VA 3CUQC 1T2KA 1FSHA 2LBFA 2Y75A 4P96A 4N4OB 3V42A 3ASOH 1MMDA 2Q8KA 2ZMEC 3E6DA 2FE3A 1IRFA 1BR1A 1P4WA 1S3JA 5DD8A 3ZMSA 1MW7A 1IRGA 2VI6A 3CP8A 2EFQA 2WA0A 2E35A 4L9NA 5DDGA 2R7SA 3TMOA 2P6SA 3RZDJ 2HNHA 3K1MA 4J19A 1U5TA 2HOEA 1LPQA 4BEHA 3ERED 1ETYA 3S1RJ 3L9FA 5IT9Z 1OR7A 4LG0B 1CF7A 3OYIA 3MZYA 4OWRB 1FP2A 1RRJA 1Z9CA 2KZGA 2XPUA 2L01A 2IW5A 2VL8A 4EGYA 1W0TA 3T5XA 3CJRB 5A2QZ 4A3IJ 1R6RA 1MSEC 5J4YA 1ORKA 4WXHA 5DEQA 2V79A 1WJ5A 4OOIA 3T8RA 2K7LA 3F3XA 1S7OA 3G3ZA 1P9QC 2PQ8A 1IAWA 1U9OA 2CQ7A 3RTRA 5JVTA 1N77A 2XPVA 4EATA 4LGWA 3BJOA 4M3DA 5F04A 1PUFB 3MD2A 3E6BA 3G6EI 2R7TA 3FK7A 2PN6A 4LG0A 2XF5A 1KU2A 2DFIA 3ABKH 2GIVA 4CZCA 4HF2A 2XASA 4UUVA 1VQ9I 4ZYEA 2G9WA 4JX4A 1RZ4A 4PJNA 4U7DA 1LJ9A 4MHGA 4HDVA 4IO9F 1I5ZA 2L9VA 4ENKA 3GLXA 1I1SA 3ZXSA 4HA8A 3C18A 5FJ8J 1IXRC 1I27A 2E2IJ 3LSRA 2PMZA 1TWAJ 1WJAA 1FWZA 4ESFA 2ZXHA 3M4OJ 2VKDA 4RAYA 4FTHA 2FEZA 3H9JA 1PUFA 1JT0A 2H1KA 1HKQA 2CV2A 3IUOA 1Z0XA 1UJ8A 1YS7A 2B9SA 4DBRA 3L7WA 2BE5F 3SDBA 1YHQI 1ERDA 5EYRA 5GAGJ 4BE2A 4LD5A 2A6EF 4IJAA 2DOFA 4A3EJ 1HSJA 3AG4H 5HNHA 2GAUA 5J1YA 2DJNA 4LK1F 4XN0A 3FZVA 1J2XA 2CS3A 2LSOA 2ZXJA 4EVIA 2HQNA 5BOXA 4WCGA 2D1HA 3EUAA 4UUTA 2RAEA 2JPCA 3CZ6A 2MYSA 3WE3A 4PJMA 4YFNF 3RKYA 1Z6TA 2TCTA 4O6JA 4AWXB 3BDDA 4DZPA 1MIJA 5DCFA 1GXPA 2EPFA 2Q2EB 3SZGA 1B9NA 4LLLA 1E17A 5M5WJ 3JRGA 1X19A 2DTRA 3PQKA 4BHPA 5IYCJ 3T0YA 3FWEA 4XLAA 4NC6A 1B4AA 1CQTA 3K4KA 1ETWA 2EK5A 4DNCA 2V1XA 1MD0A 4Y4RA 3WU1B 4NB5A 1JKOC 5L3EA 3U1DA 3JAMZ 1YX3A 3M8EA 3TEDA 4KDPA 2P0WA 4AM3A 2IEKA 2W82A 5LRSA 1HW5A 3RKQA 1MMNA 2CV1A 4I2OA 3S1MJ 3J81K 4ZYDA 4E70A 3EUKL 3IP4B 3QPHA 2FX0A 4XMYA 2O7OA 1G3TA 5E1ZB 5FLXZ 1Y6IA 1MBFA 5DM6F 5E1XA 1UHWA 3CCRI 3ESWB 1VNDA 2EIJH 2L9RA 4JQFA 2RGVA 3K10A 1SMYF 2ZSIB 3OYGA 1VTNC 4KMFA 3TDZC 2EWNA 3CTAA 1NH3A 2L02A 1R7JA 2LMDA 3OV8A 1UG0A 1V5FA 1MDMA 1U8BA 1ETXA 3MEXA 5K5RA 2K5CA 3P7NA 2ZO4A 3KLNA 2PG4A 2F5EA 4BY7J 2NVXJ 2H1LA 1BI1A 4D1QA 4OMZA 2O8XA 3FF5A 1FYKA 1OQYA 2JTVA 2Z33A 2YX4A 3GTKJ 3TO6A 3W2AA 2E1MB 1YJNI 3K69A 1QGPA 3WE2A 4HEA2 2K9SA 4ANJA 2X1DA 3HRSA 3LSHA 2YX7A 1FOWA 4ENMA 1YO5C 2DA7A 3B6AA 4UXNA 3ABUA 4W1UA 1A04A 4I99C 2FUG2 2R7DA 2M87A 4HX7A 1BOBA 1OYWA 4CSWA 2M8EA 2JUCA 3S2DJ 5DYMA 4IHTA 1I6HJ 4RAFA 2NYXA 3ECHA 2CSOA 3X2QH 2K4BA 1ETOA 5DD4A 3R0AA 3Q5FA 2I5UA 2F5VA 1T95A 5LHIA 2ZJRF 1K7AA 2VOOA 3GLLA 5LFAA 2XHKA 3OYDA 2F48A 3ZMTA 2CQKA 3JCUC 3MCZA 5CPRB 2PBIA 5L3BA 4XKBA 4CUGA 2XRLA 2QKMB 3CCMI 2XAUA 3HPGA 2KISA 3HOUJ 2L7MP 4ZJZA 2QCOA 1DGRM 1D0XA 5ICFA 3S2HJ 2QWWA 3V7CA 4MEXF 2Y69H 1SVMA 2KIFA 5L3FA 2ZXWH 1XX5A 3GFJA 4XONA 1MBEA 3HM5A 2FBHA 4D9JA 4V19K 3I9V2 4IXAA 3MKLA 4JYKA 4HV6A 2HYGD 5GPAA 2QSHX 2HYFA 4PJLA 3ECOA 1VQ5I 3H35A 4HOBA 3F23A 3D5SC 2E7WA 2LKSA 3FBNB 5CQGA 4KISA 5IOZA 4XLCA 1ENHA 3RPQA 2VE9A 1R4MB 3ML6A 3C3WA 1RR8C 1W7PD 4Y33A 3PNYA 3I59B 4UUSB 5IOYA 4XLFA 2L3DA 3I5UA 3OYHA 4LLNA 1E2XA 2B7EA 3WG9A 2OPTA 4L9JA 3S17J 2L7ZA 1G6NA 2CW7A 2LKPA 1GXQA 2M9HA 2GOXB 3L2CA 2A68F 3Q0VA 4KIGA 2QSFX 4ZC3A 3IAM2 4BQQA 2Q1ZB 4U0WA 4XKVA 2R93J 2ADUA 2HEOA 2VOPA 5LRRA 3FMQA 2LF8A 3E0JB 2F5CA 1T08B 4XBFA 2UXNA 2BVLA 5TISC 3BTJA 2VQHA 3TP3A 3TGNA 4DZJA 5EZGA 4I02A 2XAJA 3I59A 4UUSA 3O8HA 5E8IA 4N9HA 4XLPF 2EZKA 4XLNF 3RYPA 2AXLA 3MAJA 5D8LB 2FQ4A 2CJJA 3FX3A 1V5GA 1XDSA 2Z1DA 3HSFA 1VQMI 3J80Z 4PGHA 2BHYA 1HW2A 2P7VB 2O8KA 3OMYA 4GCVA 3H5NA 4RB3C 4FASD 4OIRF 4RB2C 1VQ7I 4FX4A 4BDZA 2A3SA 4HAMA 5TRDA 1LB2A 1TC3C 2R7VA 2JJ7A 1NG7A 2UUZA 4BQOA 3KP7A 2QQ8A 2ETHA 1MNDA 2E5NA 2GIZA 2X1CA 4OINF 4AD9A 1YI2I 4QSHA 4DYRA 3IH2A 2HQAA 4G6TB 2EFOA 1HA8A 1WQ2A 2DLLA 2XAGA 4CCMA 1MMAA 2GXBA 1WI3A 2L4AA 2KL4A 1HC8A 1BJZA 4G6QA 5JHUA 4PZJA 3SFIA 1ZRCA 5FGMA 4UB6C 3BLYA 3T8TA 1IZ1A 3TW6A 1FBSA 2NS8A 2KJBA 3ASNH 4R8HA 5FROA 5LGNA 1SD6A 1PP7U 4JBAA 3TOAA 4M6YA 4XORA 5HVQC 2W00A 1L0OC 2DMQA 3K70C 5BMZA 2XB0X 4D7MA 1O57A 5GTHC 1QPIA 3WU0A 4AIJA 1ETVA 3EYYA 4U88A 3CP2A 2OTLI 3HRMA 3K4MA 3AL0C 1AWCA 3ZMUA 1YRNA 4D5FA 4DOZA 4AIKA 1I1GA 3D0SA 3B6CA 2K9NA 4A12A 4CCLA 5IPAA 1TTYA 1MJBA 4BXXJ 2MC3A 4I09A 3BROA 5DV5A 3CDHA 3WTTC 1MZBA 3PO3J 3H36A 4B1RA 5D5WB 1W0UA 1XD7A 2BY1A 3I56I 3NWSA 4M3FA 1JKRC 2O03A 4LG3A 4FE7A 4NBQA 4CCOA 4Z2YA 4M6VA 3KE2A 2BGCA 2EH3A 2L4MA 3ABTA 5FKMA 1MBHA 2GOMA 3QRFF 2RN7A 3CCJI 1SFOJ 1X2MA 4BJ6C 3WG7H 1B1BA 2QSGX 1T0FC 2JA2A 3FM3A 2W4SA 1SANA 4RAZA 2R7ZJ 3CESA 3JW4A 3CO7C 1XMKA 4L18B 2V9KA 1RUOA 1T8IA 2DCEA 2JA6J 5L3GA 1D8JA 2RNJA 1A6IA 3ZQLA 4A3DJ 1R1TA 2FOWA 2PI0A 1KQ0A 4RB0A 2RC4A 2Y0SA 1YQAA 1YJWI 2VJ5A 3FXMA 5CVJA 3W2VA 1I50J 3NARA 3DKWA 2FBIA 3E5XA 1JKPC 2I8DA 4P9UA 5IYDJ 5H20A 3CCSI 3ABLH 1R49A 3SXYA 1O3TA 2NXNB 2DT5A 5K1YA 3HGGA 2Z9OA 2X6YA 2MABA 4BNCA 1JHHA 2V26A 5FRNA 4IOCF 1FOYA 4NUBA 3I71A 1O3RA 3ZPLA 3F9KA 4WF2A 5HNFA 2DBBA 1XPXA 1T98A 5F1RA 3C2GA 1UZCA 2D1VA 3P5JA 2QQAA 3PFIA 4BL0B 4HX4A 4IRHA 3CUOA 5CLSA 2JWTA 1MNMC 2WV1A 4S0HB 5HDNA 3DBLB 4B4CA 1VQ8I 3MQ0A 2ZC2A 3SHFA 4E4HA 2K40A 2O0YA 2QKLB 1HBXG 3KP6A 5J8FA 1A35A 3BG9A 4MFEA 1U9NA 1XCVA 3LFUA 1APLC 4PDKA 2JSCA 4I0BA 1TLHB 1U8RA 2ZJPF 1OCTC 3CC4I 3WTSC 5B1BH 3LAJA 4MIMA 1R5HA 2XROA 1TNTA 1DQUA 4XICA 2ZNZA 1D8KA 2FJ1A 5J1RA 1OCZH 4KA4A 5BNGA 4MNUA 3GYHX 2LNBA 3FXOA 1B72B 3J7AO 2P7CB 2BXYA 3A03A 3OS2A 2FSWA 4IL6C 5K5OA 1O3QA 3HUGA 2D2WA 2P81A 3FKIJ 5JLXA 4S05A 4A6DA 2NNYA 1LFUP 2FQ3A 2HXIA 3ZQQA 2YU3A 2DI3A 1Z1DA 2EZIA 4PK4A 2E1NA 3RYRA 4D5CA 1GVJA 1TW2A 2DDAA 2HPIA 2JQ7A 4PFPA 4ESBA 1OCPA 1FPQA 3DTKA 4RM3A 4TV7A 2OV7A 2QUFA 1KA8A 3Q3SA 1XC5A 3GZ6A 1OFCX 3CC2I 3A2KA 3DBHB 1B72A 3TL4X 2LFBA 2QENA 1IN7A 1DGWY 4YIRX 2B0LA 3FXLA 3KP2A 4CCNA 1MBJA 2R7OA 1ULYA 5FLMJ 1BIBA 1AHDP 2CYYA 1OCCH 1FZPB 1HLVA 1S29A 2BBYA 5J8CA 1FIPA 3BT9A 2EV5A 3CMEI 2M30A 2BW3B 3ZR8X 2DA5A 3V7SA 1ONVA 2XF7A 4H0EA 2KRCA 4EM2A 1BN5A 2M7BA 2IS6A 3VYTB 1U78A 2H09A 2V9PA 3CQZJ 3VWBA 2HTJA 2X51A 1A31A 4LK0F 1WFXA 2MC4A 2Q0OA 1D5YA 1IRXA 4XIDA 2M3AA 2Y48A 2HDDA 1FMWA 3OWTA 3GTLJ 2VB6A 3FXQA 1YITI 2DFEA 1D3YA 2BZTA 4JX5A 4BS9A 3DPTA 2YU9J 1R1UA 2EFPA 2DMNA 2X4HA 4RGSA 1D5VA 4JX6A 2X9DA 4U0VA 5CKTA 4X1EA 5AONA 5HS8A 2PJPA 3REOA 3LL7A 1FNNA 2YS9A 3KYLA 3R0JA 4B3XA 2BW3A 1U5TC 2KPMA 2R5YA 3VYRB 3GWZA 4KITB 1P92A 3H3VK 1V55H 2VJ4A 2VPRA 4FISA 3M07A 4KIFA 2JVHA 2V1NA 1GT0C 3BWGA 2NOGA 4MFDA 3T1BA 3LSIA 1Y0NA 4K2EA 2R7UA 3GX4X 3A02A 5FD5A 2FU4A 1JI8A 3C2BA 3J7AY 4A2UA 4FCYA 5IT9K 1F9NA 3QWLA 3QU6A 3LSKA 4RLFA 3CJTB 2AS5F 1P6RA 2DA4A 1QQIA 3K9TA 4UY8I 3MKZA 3DPLC 2KRFA 1J09A 2DA6A 4KICA 4ENNA 3O6BB 2DU9A 4BHCA 2CGPA 2DOAA 2NS7A 2CW8A 5ED4A 4B48A 3PJRA 3BZKA 2ZNYA 1SMTA 2NVYJ 2RDPA 2WAQN 3LQRA 4CDGA 5A2QK 1K6YA 3JRAA 1WCMJ 4BJ5C 3S3NA 3DQVC 2CRGA 2JVGA 3EUHC 3LA2A 1FEXA 2E1OA 1SAUA 1XTAA 3ROUA 1QZYA 4HZFA 3HOSA 3K2AA 1UB9A 5B3SH 2HZDA 2GXGA 3K4BA 3D5RC 3FXUA 1B9MA 3HKZN 1JE8A 3CCYA 3DKYA 4G6DA 5CQEA 4C3JJ 3P9IA 1IO2A 2Y9YA 4XLHA 1HSTA 3ZQIA 4Y17A 4QWQA 1FC3A 1OYIA 5JHFA 1X3UA 2WB1A 5LGTA 2YPRA 1B59A 4E7KA 2NAZA 4A0YA 3F8FA 3KZIC 2QM3A 3DLLF 1E0EA 2D45A 4IRIA 2VIXA 5GTIC 3F8BA 3L2WA 2PLYA 4C30A 1VQNI 2RREA 1Z7LA 2IA1A 4DGWB 3S14J 2K9QA 3PL8A 2PJRB 4OMYA 3B02A 2A6TA 5F64A 3OYNA 4DYQA 1PDNC 1XGOA 3S3OA 1FJLA 2PMHA 2O6GE 1USTA 4IEJA 1XSDA 2W57A 3BP8A 1W5SA 4UVBA 1JXSA 1N25A 1LUJB 2LY9A 4HX8A 5FB2A 4HDUA 5CVVA 2FNPA 1BI2A 4HRIA 1FBQA 4ZTFA 1W36C 3J7YJ 1DP3A 3CMMA 3IV5A 4UVAA 2VC1A 1JTYA 3OSFA 2DYSH 4V2GA 4E7IA 2MG4A 1G2HA 2FMYA 4E7ZA 2PJRA 1NK2P 4CICA 2R0QC 4EGZA 2ZBKA 3KETA 2EJRA 2HZTA 4RGRA 2Y31A 3QPTA 3LOCA 3ZQHA 5F6FA 2WAFA 2EA2A 3JAMK 2K02A 5EG0B 2DQRA 2HDWA 2RV8A 2LP0A 3F8CA 4A0XA 2UXXA 5LEKA 2DK8A 1KU9A 1MSFC 1WPKA 1S8NA 2ME6A 3CCUI 2AQEA 1X1BA 2QYOA 3BG5A 5BS6A 3E5UA 2OD5A 1IN4A 2ESHA 3RQIA 1LDJA 2LY1A 5FLXK 4RAGA 5K7FA 1BM9A 1ZARA 1PJRA 3RSNA 4XLEA 2A5YB 2GA2A 4RA2A 2JA7J 1P7IA 4DIQA 3ABMH 4X0GA 3PIPF 3ZQFA 3DEWA 1BA5A 3B73A 1P4AA 3QYBA 1YW8A 2AO9A 2FA5A 3RCOA 5EG0A 3K70D 2ECCA 2R7RA 3FXJA 1NTCA 3KYDB 1ZYRF 3CC7I 2PMZN 2Q2EA 4P1WA 1PYVA 3BR6A 2VJJA 2OZ6A 3OYFA 3MFKA 2DODA 4KT6A 4PFOA 4M71A 4BAYA 3OYMA 1U0JA 4XKCA 1J0RA 3NQOA 1XG1A 4M3EA 2FOKA 3BTIA 3LA7A 3S15J 3P9KA 5JVGF 3GZ5A 5FFXA 2MSYA 3MKYB 1B8IB 1F36A 4IHVA 3DWLE 3WTZA 5HS9A 2IVMA 1HXDA 2DA1A 3FMSA 5CVUA 4U7BA 3WTVC 5F0CA 2E1CA 2M5WA 1USSA 1GV5A 1SFKA 4P5OA 3L2UA 1J75A 2E1MC 2STWA 1F1ZA 4V2FA 3HDDA 1TT5B 5J40A 1XSXA 3E1SA 3BR0A 3WTYC 4LIVA 1BW5A 2V7FA 3SYTA 3H9GA 1EH7A 3ZMZA 1KGSA 2HR3A 4OAZA 4RMNA 2XV4S 4HSTA 4F52A 4S04A 5FO5A 3ERMA 4IHXA 1ON2A 4A0ZA 1ETQA 4ABZA 2VQLA 4LMYA 2Z3YA 4XKWA 1K83J 2HKOA 1B8IA 1X4PA 1D1BA 2V9VA 5IP9J 3RJPA 1WRJA 4O5VA 1TNSA 3GZNB 1W4MA 4BDYA 1DDNA 5E3LA 5GAEJ 3DBRB 2H8RA 1G3WA 1JJ8C 1ZGAA 2ME0A 1YE9A 4RGXA 3BG6A 4L0YB 2XUBA 1IN5A 2GXAA 2A5WA 3N05A 1BI0A 4EJVA 1VI0A 2JN6A 4I98B 2IAIA 1B6AA 2RQQA 4J00A 2XC7A 3BJAA 1OCRH 3Q0WA 3IWZA 4I76A 5LHGA 2EBIA 2OUMA 5TGTA 2L5QA 3K7AJ 3S2WA 3HYIA 2H8WA 2FF4A 2HKXA 3MWMA 5LHHA 3H0DA 2IXSA 2KFDA 3FHZA 3GUDA 5J4VA 5EDNA 2BY3A 2OJED 2B63J 3LFKA 2OC6A 4A3GJ 2AXTC 4UNOA 3HZJA 2OA4A 2HTSA 1E3PA 1K79A 2YR2A 2H27A 2G7HA 4EM1A 1YW7A 3EDPA 2M2EA 1F43A 5F08A 2JSPA 3ZRGA 3H3UA 5KAFC 3KIOA 1SFXA 1JKQC 1KYWA 3EQLF 4HPQA 4U87A 4KYWA 1UELB 2DMPA 1ZQ3P 3S3MA 2ISZA 3KP4A 1JUMA 3K0LA 4KN7X 3OIOA 3DP7A 2IS1A 1N78A 3UR3C 3KEYA 2R5ZB 4G7HF 4M72A 1Z3YA 3GTQJ 1SAXA 6PAXA 4XRSG 3M9AA 5IT3A 4HNTA 2DFHA 3OYAA 2AHQA 3IRRA 4M9SA 3QYEA 2CV0A 4BXUA 4IHYA 1XS9A 2VQGA 3K2ZA 2WBMA 4HG2A 4Q48A 2IBDA 2CMPA 2PMUA 3WTUC 3HHGA 3CLOA 2O9LA 2QQBA 2CQXA 3KEQA 3L2VA 1X2NA 1G3SA 3MZHA 3HBLA 1T33A 1Q1VA 4PJJA 4YEJA 1Z3XA 2KDZA 3AAFA 3BR3A 3TQNA 4UHTA 3IHUA 3OYJA 3QOEA 3J80K 2R5ZA 5EGOB 4GDFA 3TO9A 3BZ6A 4UB8C 1WKMA 3I55I 3FBIB 3I3LA 3M8JA 3LWFA 2BHZA 3G1OA 1DPRA 1Z67A 5B1AH 4NNJA 3NAUA 1ZTRA 3GTMJ 1K78B 4IVNA 1I3AA 1LVKA 1GDTA 3JRHA 3MN2A 5C44J 4WWCA 2HOAA 4GO1A 3DTEA 2XAQA 3KLOA 2LKXA 2HOSA 4A3JJ 1GVDA 1ZG3A 2BOLA 5JR3A 4PGGA 1Z77A 2LVSA 5C4JJ 1H88C 2J5OA 2HI3A 3BQZA 2DN0A 4II3A 1TQPA 4L9VA 5FKKA 4YIIA 3PSIA 3HHHA 5HS7A 5EGOA 4RM2A 1TWCJ 1Y0UA 2ZXIA 2IGNA 1V3FA 2VBYA 1ZH5A 1RESA 2KRHA 3Q0UA 1G4DA 1VZ0A 2ECBA 2ELJA 1FSEA 2M4KA 1K78A 1FTZA 2CG4A 4A3KJ 1SD5A 1ODDA 1SD7A 2CU7A 3F0CA 4CYDA 3W6KB 2Y2ZA 2A05A 2GBYA 3EPZA 1T6SA 2OCEA 1QPMA 2M1BA 2F6CA 3RPUD 2CUFA 4B3AA 1XGSA 1WJEA 1RUNA 4YELA 5C3EJ 3E3VA 1RIOH 2DDBA 5ILVA 1K4SA 3RDIA 1SC7A 2MD0A 3HRUA 5J6XA 3LNQA 1HKTA 3D5LA 4P9FA 5HODA 3I4MJ 1O4XA 3M1EA 3HTUA 4F7ZA 4E7HA 2XKPA 4DYCA 3CO6C 2CUJA 2IS4A 5LBQA 4LITA 1JHFA 2LYCA 3ISPA 3KZZA 3R6SA 4A5NA 5HLTA 3HRTA 5BPIA 4ETSA 1FYMA 3PUFA 2R7QA 2M4GA 4HV5A 2N8GA 5D6EA 1NG6A 2JA5J 4D7NA 2KQRA 4ZDPA 3K4CA 4EQQA 4G12A 1BL0A 5E18F 2WAEA 3PUBA 1R22A 3G4SI 3GFIA 1WJBA 2DTZA 2KIUA 4B8XA 2HDCA 2FNAA 4C2TA 1ZG1A 5KHDA 3IKTA 2KMUA 2XF6A 2K86A 4XRMA 1J5YA 4G94A 1WI9A 2Z99A 3L2QA 3I64A 1QA6A 1TWFJ 2V4JC 2E2JJ 2MFZA 3RI4A 3CDLA 3RZOJ 2Z5UA 4KMUX 3AL0B 1RPWA 1MKMA 3L2RA 2QLZA 1LDDA 1ZHFA 1BOAA 1K4TA 4QIWN 4BUPA 5D5XB 1ZLKA 2EZLA 1D0YA 4BHBA 1X58A 5DUKA 1XB4A 4HYEA 3PIOF 2W48A 3DV8A 1HCRA 2ELKA 2MGQA 1DU6A 2ZKZA 4M73A 3ELKA 1F5TA 1PUEE 2IGOA 2XIGA 3C1DA 2MH2A 2COBA 4ITVA 2KLOA 1T38A 3A1YA 4G8XA 2WY7Q 5J1UA 2BVMA 3DXJF 3F8NA 4L9TA 4NC7A 4GRIA 3JRDA 2E2HJ 3WODF 3PO2J 4HSRA 3KX2A 5J47A 3ULQB 1VQKI 2L0KA 1IV6A 5DCMB 4BQNA 1GHCA 4XM3A 1H89C 2L2OA 5K7ZA 3QQAA 1NK3P 2CW0F 3QOPA 4I0AA 1YTYA 2NRAC 3NWTA 1R71A 5ILUA 3K4JA 4BBSJ 1FBUA 2DOEA 2YUSA 3HJEA 4WXDA 2EQRA 2XGXA 3C2HA 2CH0A 1LNWA 2VT3A 3C7JA 4L0ZB 2LDUA 2LTPA 2MH9A 2WC2A 5E79C 3AG1H 1JT6A 2KJCA 5KNLA 1OCOH 2DA2A 2QF7A 1OMIA 1W5CC 1BIAA 4F92B 2XDVA 9ANTA 1LDKB 1YFHA 2ACJA 3A4CA 1S7EA 5JLWA 2TDXA 3GCMA 1TP4A 2KZVA 4HW0A 5FD6A 2LH9A 1AKHB 2K9MA 4C3IJ 4MTEA 4NDLA 4AIDA 3AKZA 3EETA 3ZMVA 1JGGA 5IP7J 5LGUA 3S1QJ 2OZUA 2PFBA 3HPHA 3HXLA 5FKLA 2F5DA 1EA3A 4PCQA 2LG4A 4P55A 3KP5A 4II2A 4HNVA 3BPVA 4Y15A 5H6RA 2X6OA 1KYZA 3JRCA 3HTSB 1YYVA 2X85A 1YOVB 3AG3H 4FHTA 3V4GA 2DO7A 3PM1A 3JSOA 5M5XJ 1SFEA 5E17F 2ZCWA 1Z21A 2XSDC 4G7OF 1KQ8A 4IF4A 4GGGA 2Y0SN 4CO8A 3KP3A 1IC8A 3QP5A 1RKWA 4EJUA 1XGMA 3CCLI 4AVZA 1W7PB 2P4WA 1H9TA 2DK5A 4KT5C 2EILH 1GUUA 2DW4A 1N75A 2NNNA 5D4RA 2ICWG 2HOTA 1QZZA 3BQYA 4QPQA 1RNLA 4EV0A 4M9XA 1RETA 4A3FJ 2JRTA 1IW7F 1M1EB 3RQ4A 1Y8RB 3HOZJ 2HQ5A 3HOTA 3CCQI 4M3BA 2HGCA 4LJZF 1XSVA 3RIRA 3VSKA 5E3NA 1MJ9A 3ONQA 3ZP5A 3UKGA 2KT0A 4EJOA 4CCJA 1W7PA 1O7FA 1RC9A 2COMA 2UV1A 4AC0A 3J7ZI 2W7NA 3RKWA 2DFFA 2Y0MA 3SZTA 4BE0A 4NQWB 4XL9A 1UMQA 2E36A 2M8GX 1MH4A 2WWYA 2M34A 3OIPA 3TO7A 1EH6A 1C0WA 4ZDLA 1IV8A 1TWGJ 3KCCA 2JPBA 1QVUA 1ZKGA 2X0LA 3BR1A 4M6XA 1IDYA 2LK2A 2XGDA 4JP0A 4ENJA 4DW6A 4GFBA 1WJCA 1Q1HA 2XAHA 4W97A 1IRZA 5EF6A 3WGIA 3COAC 1KU7A 4G9YA 1HDPA 2NVUB 3GO5A 1T39A 2H6BA 4DBQA 2AQFA 2NVTJ 5B66C 1MH3A 4PSWA 2XGEA 1UCRA 3F21A 4A6EA 1SD4A 5CVRA 1QO0D 4NQWA 2MW8A 5H2FC 3VPRA 2P5VA 4A93J 1OR7C 2E5ZA 3CMAI 1I6XA 2V1DA 2STTA 2FBKA 3K4NA 2LBFB 3VYSB 2K4JA 2E71A 3GXOA 5BPDA 3HGYA 4M3GA 1RKTA 4IX7A 2ZB9A 3PSFA 5E3OA 4A3MJ 4A3BJ 5L3CA 3HOVJ 4ZDOA 2DJIA 1TL8A 1U5TB 3A0BC 4OIQF 4Y13A 2F4MB 4MO7A 1IG7A 4YFXF 2VODA 3H1CA 2ZSHB 2OBPA 4HF0A 3JRBA 5DTDA 3TOBA 3KEOA 4BGDA 2P8TA 4ASNA 1Y1VJ 1WZ2A 1A5JA 1XCBA 3HB9A 3TW7A 1VQ6I 4B09A 4AYBN 3CUQB 3IH4A 4N4NB 4DJAA 2RQPA 3L00A 1VFCA 1R9TJ 3M7GA 3RPUA 2E19A 2W25A 2ZMEB 1ZR4A 5E1WA 2OTJI 3R60A 2LRDA 3HIFA 1ACIA 3BTCA 2KDOA 1R4NB 3OIQA 3LA3A 2E7XA 2GLOA 1FLIA 3GTGJ 3F72A 3OYLA 1ZAOA 3L1PA 3V8LA 3CLQA 2V6EA 1WSUA 2XRNA 3TP0A 2HPMA 3FMRA 3GTOJ 1XGNA 4M9ZA 1S9HA 4E7JA 2JMWA 3CUQA 4KNYA 4QLCU 4CYCB 5JI6A 4J01A 1ZELA 3V8JA 4B47A 1X1DA 2EA4A 1S72I 2ZMEA 3MKWB 3PNTA 5BQTA 3HOXJ 1QHGA 3GMEA 1WWXA 1Z05A 4IHWA 4ZZLA 4LFUA 4R1HA 4XQFA 1R5GA 3QPLA 4FQGA 4MLOA 3JRFA 3G2BA 1Y8QB 1RR7A 2BXZA 2LREA 1ZRDA 3HSRA 1HKSA 1P2FA 3EUHA 1R58A 3NEUA 2JUGA 4Y7NJ 2V6CA 5ICGA 4IQ4A 4BACA 3GBGA 1ZREA 2O5RA 1SEUA 4CA0A 4CYCA 1GV2A
chains in the Genus database with same CATH topology
3E6MA 1STZA 1EH8A 2EV0A 4L5JA 4HLXA 2W24A 1IXSB 2YSRA 1J7KA 2RKHA 1BC8C 1XDUA 1P4XA 1XN7A 4UVCA 3I53A 3GFMA 1FX7A 2ZJ2A 3H3ZA 3H92A 4EJWA 1W5TA 4AVPA 5TJJA 4I01A 4RB1A 3GW2A 4UV8A 3VOEA 1IN8A 2W85A 4N0BA 2UZKA 1S6LA 4HF1A 1J59A 2R3SA 2VN2A 3U2RA 5JFRA 5ILSA 3VFZA 1ZG5A 2W84A 4EJTA 1K6OA 3DEUA 4OU0A 3V8KA 1DP7P 1OYYA 3I54A 2A69F 5ICEA 4ZH4F 2P6TA 2P5LC 1MDMB 3LQQA 1Z7UA 1JGSA 4YIFA 3ZQ7A 1HW1A 4M74A 2VC0A 3RKXA 2VXZA 2CO5A 4G7ZF 3PQJA 3EYIA 2H94A 4A5MA 1ON1A 4DQ2A 3P9CA 4LB6B 3N4MA 1UHMA 1LVAA 3VEPA 2ESNA 5FFZA 4BQAA 3J81Z 2QZ8A 1FY7A 3FM5A 3GEZA 5D8KB 1F4KA 2EFWA 3K1PA 5DUIA 1U2WA 4MQVA 1J9IA 2WTEA 1CGPA 4Q47A 3QU3A 2JZYA 3NRVA 2O3FA 2QQ9A 4CXFA 1LEBA 4BH9A 2MLGA 2XKOA 1DPUA 1BJAA 5ERIA 2P5KA 3SZPA 4GYIA 4U0YA 3JTHA 2R7FA 3ZN1A 4Q4ZF 3V7RA 4HQMA 2L54A 3GVAA 3KZYA 4OIOF 3BJ6A 1Z6RA 2FXAA 3DF8A 4YFKF 1OPCA 2H6CA 2VBZA 2F5FA 5L3DA 3WTXC 3IWFA 1U6GA 5K5QA 2OQGA 4KN4X 3QP6A 5D5VB 4ON0A 3ZMDA 4ZYGA 4R79A 1ZRFA 1PP8F 4IHSA 2BV6A 3JSPA 5LEJA 1LQ1A 4AIHA 4Q5SF 5HLIA 4WK8F 2HWVA 1UFMA 5LLQA 2UWMA 4HQEA 3OOPA 4GXOA 1FT9A 4RGUA 3K1NA 2VONA 4N9IA 3VB2A 1G3YA 5HLGA 2O61A 1BBYA 3HSEA 5HDKA 2IT0A 1R36A 3F8MA 2BYVE 5CVIA 2V1UA 3O3KA 1SFUA 2MLKA 2OAZA 2VBWA 4EMSA 2A6HF 2EB7A 4FX0A 1REPC 5CJ9A 5AIPA 3TDUC 4FT8A 3BPXA 3GF2A 3DFGA 3BY6A 1MJAA 1Z91A 1IN6A 2FMLA 2NS0A 1YIOA 4HBLA 1YW9A 3O2PE 2CFXA 5EEHA 3I58A 4HLYA 2KIMA 1ZGJA 3GFLA 3L09A 1TW3A 2MD5A 1NHAA 3JTGA 4NHJA 2IRFG 2F2EA 4MTDA 3TKYA 2QBYB 3IRQA 4ZYHA 2BEOA 1FP1D 3Q9VA 4CZZA 1XMAA 2HFHA 1H9GA 2VE8A 4WXCA 2IPQX 4MQ9F 2DAOA 2EFNA 4CGZA 2KKOA 4LLGF 2PEXA 5D6FA 2QBYA 2IP2A 3CJNA 1V4RA 5H6QA 1DUXC 2DPDA 5HDGA 2CWEA 2M45A 3I0TA 1KU3A 4MEYF 5E20A 1EV7A 1S7AA 5KK1A 3F22A 2DPUA 3R4KA 1BI3A 2GA1A 4JK1X 3U9GA 2JT1A 4IRGA 4XRFA 2VBXA 4OIPF 4I7HA 2IA2A 4GYGA 3N97A 4LB5A 2QVOA 3IKVA 5AIQA 1AOYA 3G73A 3E6CC 5DCMA 2GWRA 1FOKA 2A61A 1O3SA 1T0FA 2GZWA 2DQLA 3W6JB 4ZZDA 4BYYA 4KFCA 2XAFA 2ISYA 2IA0A 2RVCA 2EV6A 2HQRA 1KQ9A 4XSZF 3SQNA 4EM0B 4WX9A 2A07F 1R00A 5HOOA 2ELHA 3E5QA 1TQMA 1QBJA 5E8GA 1ZN2A 3KFWX 5D4SA 3BOQA 2ZFWA 3R61A 4O3MA 4UV9A 4RS8A 1IXCA 4IPAA 4D0PA 1H0MA 2GQQA 3Q9SA 2IJLA 3I4PA 5ICCA 5D5UB 2MBFA 3LSTA 3ZN0A 4XSXF 2OU2A 1RI7A 3SFZA 1HQCA 4YG2F 1YLFA 3E97A 1R1VA 1ZLJA 2J5PA 2XVCA 3M8FA 1BC7C 3VODA 1OKRA 2LF7A 3WGHA 1FYLA 3F6OA 1YG2A 4CHUA 2OQRA 2MA3A 1MGTA 2HS5A 1U3EM 3FXRA 2FRHA 1IUYA 1O7LA 1LEAA 2VT2A 1TQIA 3LAPA 3QAHA 1IF1A 3WGGA 3WTWC 1TBXA 4L5IA 2WV0A 1YS6A 1QNTA 3IL2A 2C6YA 2K27A 4ESJA 4MGRA 4KIBA 2G7UA 5CYVA 5EEGA 1L3LA 5HLHA 3IC7A 5KVRA 1CF7B 4KUMA 1R23A 3F6VA 3CUQC 1T2KA 1FSHA 2Y75A 4P96A 2Q8KA 3E6DA 2FE3A 1IRFA 1P4WA 3ZMSA 1S3JA 5DD8A 1IRGA 2EFQA 4L9NA 5DDGA 2P6SA 3K1MA 1U5TA 2HOEA 3ERED 3L9FA 5IT9Z 1OR7A 4LG0B 1CF7A 3MZYA 1FP2A 1Z9CA 2L01A 2IW5A 4EGYA 3T5XA 5A2QZ 4WXHA 5DEQA 2V79A 4OOIA 3T8RA 2K7LA 3F3XA 1S7OA 3G3ZA 2PQ8A 1IAWA 3RTRA 5JVTA 4LGWA 3BJOA 3E6BA 2PN6A 4LG0A 1KU2A 2DFIA 2GIVA 4HF2A 2XASA 4UUVA 4ZYEA 2G9WA 1RZ4A 4U7DA 1LJ9A 4MHGA 4HDVA 1I5ZA 4ENKA 1I1SA 3GLXA 4HA8A 3C18A 1IXRC 1I27A 1FWZA 4ESFA 4RAYA 2FEZA 1HKQA 1YS7A 3L7WA 2BE5F 4LD5A 2A6EF 4IJAA 1HSJA 2GAUA 4LK1F 3FZVA 1J2XA 2LSOA 2ZXJA 4EVIA 2HQNA 5BOXA 4WCGA 2D1HA 2JPCA 3WE3A 4YFNF 3RKYA 1Z6TA 4O6JA 4AWXB 3BDDA 5DCFA 1GXPA 1B9NA 4LLLA 1E17A 4BHPA 2DTRA 3PQKA 3T0YA 3FWEA 1B4AA 2EK5A 4DNCA 2V1XA 1MD0A 3WU1B 4NB5A 5L3EA 3U1DA 3JAMZ 3M8EA 4KDPA 5LRSA 1HW5A 4I2OA 3J81K 4ZYDA 4E70A 3QPHA 1G3TA 5E1ZB 5FLXZ 5E1XA 1UHWA 4JQFA 2RGVA 1SMYF 1VTNC 4KMFA 3TDZC 2EWNA 3CTAA 2L02A 1R7JA 3OV8A 1MDMA 3MEXA 5K5RA 3P7NA 2ZO4A 3KLNA 2PG4A 2F5EA 1BI1A 4OMZA 2O8XA 3FF5A 1FYKA 2JTVA 2Z33A 2YX4A 3TO6A 3K69A 1QGPA 3WE2A 3HRSA 2YX7A 4ENMA 1YO5C 4UXNA 3ABUA 1A04A 2R7DA 2M87A 4HX7A 1OYWA 2M8EA 5DYMA 4IHTA 2NYXA 3ECHA 2CSOA 2K4BA 5DD4A 3R0AA 3Q5FA 5LHIA 1K7AA 2VOOA 2XHKA 3ZMTA 2CQKA 3MCZA 2PBIA 5L3BA 5ICFA 2QWWA 3V7CA 4MEXF 5L3FA 2KIFA 3GFJA 2FBHA 4IXAA 4HV6A 2HYGD 2HYFA 3ECOA 4HOBA 3F23A 2E7WA 3RPQA 2VE9A 3ML6A 3C3WA 1W7PD 3I59B 2L3DA 3I5UA 4LLNA 1E2XA 3WG9A 4L9JA 1G6NA 2LKPA 1GXQA 3L2CA 2A68F 4KIGA 4U0WA 2ADUA 2HEOA 2VOPA 5LRRA 3FMQA 2LF8A 2F5CA 4XBFA 2UXNA 3TGNA 4I02A 2XAJA 3I59A 5E8IA 4N9HA 4XLPF 4XLNF 3RYPA 2AXLA 3MAJA 5D8LB 3FX3A 1XDSA 3HSFA 3J80Z 4PGHA 1HW2A 2P7VB 4GCVA 4RB3C 4OIRF 4RB2C 4FX4A 2A3SA 4HAMA 5TRDA 1LB2A 3KP7A 2ETHA 4OINF 4AD9A 2EFOA 1WQ2A 2DLLA 2XAGA 2GXBA 2L4AA 4G6QA 5JHUA 4PZJA 1ZRCA 5FGMA 3T8TA 1IZ1A 1FBSA 2KJBA 4R8HA 5LGNA 1SD6A 1PP7U 4JBAA 3TOAA 4M6YA 5HVQC 1L0OC 5BMZA 1O57A 3WU0A 4AIJA 3EYYA 4U88A 3HRMA 1AWCA 3ZMUA 4AIKA 1I1GA 3D0SA 4A12A 1TTYA 1MJBA 2MC3A 4I09A 3BROA 5DV5A 3CDHA 3WTTC 1MZBA 5D5WB 1XD7A 2O03A 4Z2YA 3KE2A 2BGCA 3ABTA 2L4MA 3QRFF 2RN7A 1B1BA 3FM3A 4RAZA 3JW4A 3CO7C 1XMKA 4L18B 1RUOA 5L3GA 1D8JA 2RNJA 1R1TA 2PI0A 1KQ0A 4RB0A 2RC4A 1YQAA 5CVJA 3DKWA 2FBIA 3E5XA 4P9UA 5H20A 3SXYA 1O3TA 2DT5A 5K1YA 2Z9OA 4BNCA 1JHHA 3I71A 1O3RA 3ZPLA 4WF2A 2DBBA 1T98A 5F1RA 2D1VA 2QQAA 3PFIA 4HX4A 4IRHA 3CUOA 5CLSA 5HDNA 3MQ0A 3SHFA 2O0YA 1HBXG 3KP6A 5J8FA 1XCVA 4PDKA 2JSCA 4I0BA 1TLHB 1U8RA 3WTSC 3LAJA 1R5HA 2XROA 1TNTA 2ZNZA 1D8KA 4KA4A 3GYHX 4MNUA 3J7AO 2LNBA 2P7CB 2FSWA 5K5OA 1O3QA 1G4DA 3HUGA 2D2WA 4S05A 4A6DA 2NNYA 2FQ3A 2YU3A 2DI3A 1Z1DA 3RYRA 2E1NA 1GVJA 1TW2A 4ESBA 1FPQA 4TV7A 2QUFA 1KA8A 3GZ6A 2QENA 1IN7A 2B0LA 3KP2A 1ULYA 1BIBA 2CYYA 1FZPB 1S29A 2BBYA 5J8CA 2EV5A 2M30A 3V7SA 1ONVA 4H0EA 4EM2A 1BN5A 1U78A 2H09A 2HTJA 4LK0F 2Q0OA 2Y48A 3FXQA 1D3YA 3DPTA 1R1UA 2EFPA 2X4HA 4RGSA 1D5VA 4U0VA 5AONA 5HS8A 2PJPA 3REOA 1FNNA 3R0JA 1U5TC 3GWZA 1P92A 4KIFA 3BWGA 3T1BA 4K2EA 3GX4X 5FD5A 2FU4A 4A2UA 5IT9K 1F9NA 3QU6A 2AS5F 1P6RA 3K9TA 1QQIA 3DPLC 2KRFA 4KICA 4ENNA 3O6BB 2DU9A 4BHCA 2CGPA 5ED4A 2RDPA 1SMTA 2ZNYA 3LQRA 4CDGA 5A2QK 3DQVC 3LA2A 3ROUA 3HOSA 1QZYA 4HZFA 1UB9A 2GXGA 3FXUA 1B9MA 1JE8A 4G6DA 3P9IA 1HSTA 4Y17A 4QWQA 1FC3A 1OYIA 1X3UA 5LGTA 2YPRA 1B59A 2NAZA 4A0YA 3F8FA 2QM3A 2D45A 4IRIA 3F8BA 2PLYA 2IA1A 4OMYA 3B02A 5F64A 1PDNC 1XGOA 2PMHA 2O6GE 1USTA 1XSDA 2W57A 3BP8A 1W5SA 4UVBA 1JXSA 4HX8A 5FB2A 4HDUA 5CVVA 2FNPA 1BI2A 1FBQA 4UVAA 2VC1A 2FMYA 4CICA 4EGZA 2ZBKA 3KETA 2EJRA 2HZTA 4RGRA 3QPTA 5F6FA 2EA2A 3JAMK 2K02A 2DQRA 2RV8A 3F8CA 4A0XA 2UXXA 5LEKA 2DK8A 1KU9A 1S8NA 2QYOA 5BS6A 3E5UA 2OD5A 1IN4A 2ESHA 1LDJA 5FLXK 1BM9A 1ZARA 2A5YB 2GA2A 3B73A 1P4AA 1YW8A 2FA5A 1ZYRF 2Q2EA 2OZ6A 3MFKA 4M71A 4BAYA 1J0RA 3NQOA 2FOKA 3LA7A 3P9KA 3GZ5A 5FFXA 3WTZA 5HS9A 2IVMA 1HXDA 3FMSA 5CVUA 4U7BA 3WTVC 2E1CA 1USSA 2M5WA 1J75A 4P5OA 2STWA 1F1ZA 1XSXA 3WTYC 1EH7A 3ZMZA 1KGSA 2HR3A 2XV4S 4S04A 5FO5A 1ON2A 4A0ZA 4LMYA 2Z3YA 2HKOA 2V9VA 3RJPA 1WRJA 4O5VA 1TNSA 1W4MA 1DDNA 1G3WA 1ZGAA 4RGXA 4L0YB 2XUBA 1IN5A 1BI0A 4EJVA 4I98B 1B6AA 3BJAA 3IWZA 5LHGA 3S2WA 3HYIA 3MWMA 5LHHA 2FF4A 2HKXA 3FHZA 3GUDA 3LFKA 4UNOA 2OA4A 2HTSA 1K79A 2YR2A 2H27A 2G7HA 4EM1A 1YW7A 3EDPA 3H3UA 1SFXA 1KYWA 3EQLF 4KYWA 2ISZA 3KP4A 3K0LA 4KN7X 3DP7A 4G7HF 4M72A 1SAXA 6PAXA 3M9AA 5IT3A 3IRRA 4M9SA 4BXUA 3K2ZA 4Q48A 2PMUA 3WTUC 3HHGA 3CLOA 2QQBA 3KEQA 1G3SA 3MZHA 3AAFA 3TQNA 4UHTA 3IHUA 3J80K 3TO9A 3BZ6A 1WKMA 3LWFA 1DPRA 1K78B 4IVNA 4WWCA 4GO1A 2XAQA 3KLOA 1ZG3A 5JR3A 4PGGA 2J5OA 1TQPA 4L9VA 4YIIA 3HHHA 5HS7A 1Y0UA 1V3FA 2VBYA 1ZH5A 1FSEA 1K78A 2CG4A 1SD5A 1ODDA 1SD7A 4CYDA 3W6KB 1T6SA 1QPMA 2M1BA 1XGSA 1RUNA 3E3VA 1RIOH 5ILVA 3RDIA 3HRUA 1HKTA 5J6XA 3D5LA 4P9FA 3M1EA 3HTUA 4F7ZA 2XKPA 3CO6C 5LBQA 1JHFA 3ISPA 3KZZA 3R6SA 4A5NA 3HRTA 5BPIA 4ETSA 1FYMA 4HV5A 5D6EA 4EQQA 5E18F 1R22A 3GFIA 2KIUA 4B8XA 2HDCA 2FNAA 1ZG1A 3IKTA 2K86A 1J5YA 4G94A 1WI9A 2Z99A 3I64A 3RI4A 2Z5UA 4KMUX 1MKMA 2QLZA 1LDDA 1ZHFA 1BOAA 5D5XB 1ZLKA 4BHBA 5DUKA 1XB4A 4HYEA 3DV8A 2ZKZA 4M73A 3ELKA 1F5TA 1PUEE 3C1DA 2XIGA 2MH2A 1T38A 4G8XA 3DXJF 3F8NA 4L9TA 3WODF 3ULQB 5DCMB 1GHCA 2CW0F 3QOPA 4I0AA 1YTYA 2NRAC 5ILUA 1FBUA 4WXDA 2XGXA 1LNWA 2VT3A 3C7JA 4L0ZB 2LDUA 2MH9A 2WC2A 2KJCA 1OMIA 1BIAA 1LDKB 1YFHA 2ACJA 2TDXA 4HW0A 5FD6A 4MTEA 3EETA 3ZMVA 5LGUA 2OZUA 2PFBA 2F5DA 4PCQA 4P55A 3KP5A 3BPVA 4Y15A 5H6RA 1KYZA 3HTSB 1YYVA 4FHTA 3V4GA 2DO7A 3JSOA 1SFEA 5E17F 2ZCWA 4G7OF 1KQ8A 4IF4A 4GGGA 4CO8A 3KP3A 3QP5A 4EJUA 1XGMA 1W7PB 2P4WA 1H9TA 2DK5A 4KT5C 2DW4A 2NNNA 5D4RA 1QZZA 1RNLA 4EV0A 4M9XA 2JRTA 1IW7F 3HOTA 2HGCA 4LJZF 1XSVA 3RIRA 1MJ9A 3ZP5A 4EJOA 1W7PA 1O7FA 2COMA 3RKWA 2Y0MA 3SZTA 2WWYA 3TO7A 1EH6A 1C0WA 3KCCA 2JPBA 2X0LA 4M6XA 4ENJA 1Q1HA 2XAHA 3WGIA 3COAC 1KU7A 4G9YA 3GO5A 1T39A 2H6BA 3F21A 1UCRA 4A6EA 1SD4A 5CVRA 1QO0D 4NQWA 2P5VA 1I6XA 2V1DA 2STTA 2FBKA 2K4JA 3GXOA 5BPDA 5L3CA 1U5TB 4OIQF 4Y13A 4YFXF 2VODA 4HF0A 2OBPA 3TOBA 3KEOA 2P8TA 4ASNA 1XCBA 4B09A 3CUQB 2RQPA 3L00A 3M7GA 3RPUA 2W25A 2ZMEB 5E1WA 3R60A 3HIFA 3LA3A 2E7XA 1FLIA 3F72A 1ZAOA 3V8LA 1WSUA 2XRNA 3FMRA 1XGNA 4M9ZA 3CUQA 4KNYA 4QLCU 5JI6A 3V8JA 2EA4A 2ZMEA 5BQTA 1WWXA 1Z05A 4ZZLA 4LFUA 4R1HA 1R5GA 1ZRDA 3HSRA 1HKSA 1P2FA 3EUHA 1R58A 3NEUA 5ICGA 2V6CA 1ZREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E6M A;  1STZ A;  1EH8 A;  2EV0 A;  4L5J A;  4HLX A;  2W24 A;  1IXS B;  2YSR A;  1J7K A;  2RKH A;  1BC8 C;  1XDU A;  1P4X A;  1XN7 A;  4UVC A;  3I53 A;  3GFM A;  1FX7 A;  2ZJ2 A;  3H3Z A;  3H92 A;  4EJW A;  1W5T A;  4AVP A;  5TJJ A;  4I01 A;  4RB1 A;  3GW2 A;  4UV8 A;  3VOE A;  1IN8 A;  2W85 A;  4N0B A;  2UZK A;  1S6L A;  4HF1 A;  1J59 A;  2R3S A;  2VN2 A;  3U2R A;  5JFR A;  5ILS A;  3VFZ A;  1ZG5 A;  2W84 A;  4EJT A;  1K6O A;  3DEU A;  4OU0 A;  3V8K A;  1DP7 P;  1OYY A;  3I54 A;  2A69 F;  5ICE A;  4ZH4 F;  2P6T A;  2P5L C;  1MDM B;  3LQQ A;  1Z7U A;  1JGS A;  4YIF A;  3ZQ7 A;  1HW1 A;  4M74 A;  2VC0 A;  3RKX A;  2VXZ A;  2CO5 A;  4G7Z F;  3PQJ A;  3EYI A;  2H94 A;  4A5M A;  1ON1 A;  4DQ2 A;  3P9C A;  4LB6 B;  3N4M A;  1UHM A;  1LVA A;  3VEP A;  2ESN A;  5FFZ A;  4BQA A;  3J81 Z;  2QZ8 A;  1FY7 A;  3FM5 A;  3GEZ A;  5D8K B;  1F4K A;  2EFW A;  3K1P A;  5DUI A;  1U2W A;  4MQV A;  1J9I A;  2WTE A;  1CGP A;  4Q47 A;  3QU3 A;  2JZY A;  3NRV A;  2O3F A;  2QQ9 A;  4CXF A;  1LEB A;  4BH9 A;  2MLG A;  2XKO A;  1DPU A;  1BJA A;  5ERI A;  2P5K A;  3SZP A;  4GYI A;  4U0Y A;  3JTH A;  2R7F A;  3ZN1 A;  4Q4Z F;  3V7R A;  4HQM A;  2L54 A;  3GVA A;  3KZY A;  4OIO F;  3BJ6 A;  1Z6R A;  2FXA A;  3DF8 A;  4YFK F;  1OPC A;  2H6C A;  2VBZ A;  2F5F A;  5L3D A;  3WTX C;  3IWF A;  1U6G A;  5K5Q A;  2OQG A;  4KN4 X;  3QP6 A;  5D5V B;  4ON0 A;  3ZMD A;  4ZYG A;  4R79 A;  1ZRF A;  1PP8 F;  4IHS A;  2BV6 A;  3JSP A;  5LEJ A;  1LQ1 A;  4AIH A;  4Q5S F;  5HLI A;  4WK8 F;  2HWV A;  1UFM A;  5LLQ A;  2UWM A;  4HQE A;  3OOP A;  4GXO A;  1FT9 A;  4RGU A;  3K1N A;  2VON A;  4N9I A;  3VB2 A;  1G3Y A;  5HLG A;  2O61 A;  1BBY A;  3HSE A;  5HDK A;  2IT0 A;  1R36 A;  3F8M A;  2BYV E;  5CVI A;  2V1U A;  3O3K A;  1SFU A;  2MLK A;  2OAZ A;  2VBW A;  4EMS A;  2A6H F;  2EB7 A;  4FX0 A;  1REP C;  5CJ9 A;  5AIP A;  3TDU C;  4FT8 A;  3BPX A;  3GF2 A;  3DFG A;  3BY6 A;  1MJA A;  1Z91 A;  1IN6 A;  2FML A;  2NS0 A;  1YIO A;  4HBL A;  1YW9 A;  3O2P E;  2CFX A;  5EEH A;  3I58 A;  4HLY A;  2KIM A;  1ZGJ A;  3GFL A;  3L09 A;  1TW3 A;  2MD5 A;  1NHA A;  3JTG A;  4NHJ A;  2IRF G;  2F2E A;  4MTD A;  3TKY A;  2QBY B;  3IRQ A;  4ZYH A;  2BEO A;  1FP1 D;  3Q9V A;  4CZZ A;  1XMA A;  2HFH A;  1H9G A;  2VE8 A;  4WXC A;  2IPQ X;  4MQ9 F;  2DAO A;  2EFN A;  4CGZ A;  2KKO A;  4LLG F;  2PEX A;  5D6F A;  2QBY A;  2IP2 A;  3CJN A;  1V4R A;  5H6Q A;  1DUX C;  2DPD A;  5HDG A;  2CWE A;  2M45 A;  3I0T A;  1KU3 A;  4MEY F;  5E20 A;  1EV7 A;  1S7A A;  5KK1 A;  3F22 A;  2DPU A;  3R4K A;  1BI3 A;  2GA1 A;  4JK1 X;  3U9G A;  2JT1 A;  4IRG A;  4XRF A;  2VBX A;  4OIP F;  4I7H A;  2IA2 A;  4GYG A;  3N97 A;  4LB5 A;  2QVO A;  3IKV A;  5AIQ A;  1AOY A;  3G73 A;  3E6C C;  5DCM A;  2GWR A;  1FOK A;  2A61 A;  1O3S A;  1T0F A;  2GZW A;  2DQL A;  3W6J B;  4ZZD A;  4BYY A;  4KFC A;  2XAF A;  2ISY A;  2IA0 A;  2RVC A;  2EV6 A;  2HQR A;  1KQ9 A;  4XSZ F;  3SQN A;  4EM0 B;  4WX9 A;  2A07 F;  1R00 A;  5HOO A;  2ELH A;  3E5Q A;  1TQM A;  1QBJ A;  5E8G A;  1ZN2 A;  3KFW X;  5D4S A;  3BOQ A;  2ZFW A;  3R61 A;  4O3M A;  4UV9 A;  4RS8 A;  1IXC A;  4IPA A;  4D0P A;  1H0M A;  2GQQ A;  3Q9S A;  2IJL A;  3I4P A;  5ICC A;  5D5U B;  2MBF A;  3LST A;  3ZN0 A;  4XSX F;  2OU2 A;  1RI7 A;  3SFZ A;  1HQC A;  4YG2 F;  1YLF A;  3E97 A;  1R1V A;  1ZLJ A;  2J5P A;  2XVC A;  3M8F A;  1BC7 C;  3VOD A;  1OKR A;  2LF7 A;  3WGH A;  1FYL A;  3F6O A;  1YG2 A;  4CHU A;  2OQR A;  2MA3 A;  1MGT A;  2HS5 A;  1U3E M;  3FXR A;  2FRH A;  1IUY A;  1O7L A;  1LEA A;  2VT2 A;  1TQI A;  3LAP A;  3QAH A;  1IF1 A;  3WGG A;  3WTW C;  1TBX A;  4L5I A;  2WV0 A;  1YS6 A;  1QNT A;  3IL2 A;  2C6Y A;  2K27 A;  4ESJ A;  4MGR A;  4KIB A;  2G7U A;  5CYV A;  5EEG A;  1L3L A;  5HLH A;  3IC7 A;  5KVR A;  1CF7 B;  4KUM A;  1R23 A;  3F6V A;  3CUQ C;  1T2K A;  1FSH A;  2Y75 A;  4P96 A;  2Q8K A;  3E6D A;  2FE3 A;  1IRF A;  1P4W A;  3ZMS A;  1S3J A;  5DD8 A;  1IRG A;  2EFQ A;  4L9N A;  5DDG A;  2P6S A;  3K1M A;  1U5T A;  2HOE A;  3ERE D;  3L9F A;  5IT9 Z;  1OR7 A;  4LG0 B;  1CF7 A;  3MZY A;  1FP2 A;  1Z9C A;  2L01 A;  2IW5 A;  4EGY A;  3T5X A;  5A2Q Z;  4WXH A;  5DEQ A;  2V79 A;  4OOI A;  3T8R A;  2K7L A;  3F3X A;  1S7O A;  3G3Z A;  2PQ8 A;  1IAW A;  3RTR A;  5JVT A;  4LGW A;  3BJO A;  3E6B A;  2PN6 A;  4LG0 A;  1KU2 A;  2DFI A;  2GIV A;  4HF2 A;  2XAS A;  4UUV A;  4ZYE A;  2G9W A;  1RZ4 A;  4U7D A;  1LJ9 A;  4MHG A;  4HDV A;  1I5Z A;  4ENK A;  1I1S A;  3GLX A;  4HA8 A;  3C18 A;  1IXR C;  1I27 A;  1FWZ A;  4ESF A;  4RAY A;  2FEZ A;  1HKQ A;  1YS7 A;  3L7W A;  2BE5 F;  4LD5 A;  2A6E F;  4IJA A;  1HSJ A;  2GAU A;  4LK1 F;  3FZV A;  1J2X A;  2LSO A;  2ZXJ A;  4EVI A;  2HQN A;  5BOX A;  4WCG A;  2D1H A;  2JPC A;  3WE3 A;  4YFN F;  3RKY A;  1Z6T A;  4O6J A;  4AWX B;  3BDD A;  5DCF A;  1GXP A;  1B9N A;  4LLL A;  1E17 A;  4BHP A;  2DTR A;  3PQK A;  3T0Y A;  3FWE A;  1B4A A;  2EK5 A;  4DNC A;  2V1X A;  1MD0 A;  3WU1 B;  4NB5 A;  5L3E A;  3U1D A;  3JAM Z;  3M8E A;  4KDP A;  5LRS A;  1HW5 A;  4I2O A;  3J81 K;  4ZYD A;  4E70 A;  3QPH A;  1G3T A;  5E1Z B;  5FLX Z;  5E1X A;  1UHW A;  4JQF A;  2RGV A;  1SMY F;  1VTN C;  4KMF A;  3TDZ C;  2EWN A;  3CTA A;  2L02 A;  1R7J A;  3OV8 A;  1MDM A;  3MEX A;  5K5R A;  3P7N A;  2ZO4 A;  3KLN A;  2PG4 A;  2F5E A;  1BI1 A;  4OMZ A;  2O8X A;  3FF5 A;  1FYK A;  2JTV A;  2Z33 A;  2YX4 A;  3TO6 A;  3K69 A;  1QGP A;  3WE2 A;  3HRS A;  2YX7 A;  4ENM A;  1YO5 C;  4UXN A;  3ABU A;  1A04 A;  2R7D A;  2M87 A;  4HX7 A;  1OYW A;  2M8E A;  5DYM A;  4IHT A;  2NYX A;  3ECH A;  2CSO A;  2K4B A;  5DD4 A;  3R0A A;  3Q5F A;  5LHI A;  1K7A A;  2VOO A;  2XHK A;  3ZMT A;  2CQK A;  3MCZ A;  2PBI A;  5L3B A;  5ICF A;  2QWW A;  3V7C A;  4MEX F;  5L3F A;  2KIF A;  3GFJ A;  2FBH A;  4IXA A;  4HV6 A;  2HYG D;  2HYF A;  3ECO A;  4HOB A;  3F23 A;  2E7W A;  3RPQ A;  2VE9 A;  3ML6 A;  3C3W A;  1W7P D;  3I59 B;  2L3D A;  3I5U A;  4LLN A;  1E2X A;  3WG9 A;  4L9J A;  1G6N A;  2LKP A;  1GXQ A;  3L2C A;  2A68 F;  4KIG A;  4U0W A;  2ADU A;  2HEO A;  2VOP A;  5LRR A;  3FMQ A;  2LF8 A;  2F5C A;  4XBF A;  2UXN A;  3TGN A;  4I02 A;  2XAJ A;  3I59 A;  5E8I A;  4N9H A;  4XLP F;  4XLN F;  3RYP A;  2AXL A;  3MAJ A;  5D8L B;  3FX3 A;  1XDS A;  3HSF A;  3J80 Z;  4PGH A;  1HW2 A;  2P7V B;  4GCV A;  4RB3 C;  4OIR F;  4RB2 C;  4FX4 A;  2A3S A;  4HAM A;  5TRD A;  1LB2 A;  3KP7 A;  2ETH A;  4OIN F;  4AD9 A;  2EFO A;  1WQ2 A;  2DLL A;  2XAG A;  2GXB A;  2L4A A;  4G6Q A;  5JHU A;  4PZJ A;  1ZRC A;  5FGM A;  3T8T A;  1IZ1 A;  1FBS A;  2KJB A;  4R8H A;  5LGN A;  1SD6 A;  1PP7 U;  4JBA A;  3TOA A;  4M6Y A;  5HVQ C;  1L0O C;  5BMZ A;  1O57 A;  3WU0 A;  4AIJ A;  3EYY A;  4U88 A;  3HRM A;  1AWC A;  3ZMU A;  4AIK A;  1I1G A;  3D0S A;  4A12 A;  1TTY A;  1MJB A;  2MC3 A;  4I09 A;  3BRO A;  5DV5 A;  3CDH A;  3WTT C;  1MZB A;  5D5W B;  1XD7 A;  2O03 A;  4Z2Y A;  3KE2 A;  2BGC A;  3ABT A;  2L4M A;  3QRF F;  2RN7 A;  1B1B A;  3FM3 A;  4RAZ A;  3JW4 A;  3CO7 C;  1XMK A;  4L18 B;  1RUO A;  5L3G A;  1D8J A;  2RNJ A;  1R1T A;  2PI0 A;  1KQ0 A;  4RB0 A;  2RC4 A;  1YQA A;  5CVJ A;  3DKW A;  2FBI A;  3E5X A;  4P9U A;  5H20 A;  3SXY A;  1O3T A;  2DT5 A;  5K1Y A;  2Z9O A;  4BNC A;  1JHH A;  3I71 A;  1O3R A;  3ZPL A;  4WF2 A;  2DBB A;  1T98 A;  5F1R A;  2D1V A;  2QQA A;  3PFI A;  4HX4 A;  4IRH A;  3CUO A;  5CLS A;  5HDN A;  3MQ0 A;  3SHF A;  2O0Y A;  1HBX G;  3KP6 A;  5J8F A;  1XCV A;  4PDK A;  2JSC A;  4I0B A;  1TLH B;  1U8R A;  3WTS C;  3LAJ A;  1R5H A;  2XRO A;  1TNT A;  2ZNZ A;  1D8K A;  4KA4 A;  3GYH X;  4MNU A;  3J7A O;  2LNB A;  2P7C B;  2FSW A;  5K5O A;  1O3Q A;  1G4D A;  3HUG A;  2D2W A;  4S05 A;  4A6D A;  2NNY A;  2FQ3 A;  2YU3 A;  2DI3 A;  1Z1D A;  3RYR A;  2E1N A;  1GVJ A;  1TW2 A;  4ESB A;  1FPQ A;  4TV7 A;  2QUF A;  1KA8 A;  3GZ6 A;  2QEN A;  1IN7 A;  2B0L A;  3KP2 A;  1ULY A;  1BIB A;  2CYY A;  1FZP B;  1S29 A;  2BBY A;  5J8C A;  2EV5 A;  2M30 A;  3V7S A;  1ONV A;  4H0E A;  4EM2 A;  1BN5 A;  1U78 A;  2H09 A;  2HTJ A;  4LK0 F;  2Q0O A;  2Y48 A;  3FXQ A;  1D3Y A;  3DPT A;  1R1U A;  2EFP A;  2X4H A;  4RGS A;  1D5V A;  4U0V A;  5AON A;  5HS8 A;  2PJP A;  3REO A;  1FNN A;  3R0J A;  1U5T C;  3GWZ A;  1P92 A;  4KIF A;  3BWG A;  3T1B A;  4K2E A;  3GX4 X;  5FD5 A;  2FU4 A;  4A2U A;  5IT9 K;  1F9N A;  3QU6 A;  2AS5 F;  1P6R A;  3K9T A;  1QQI A;  3DPL C;  2KRF A;  4KIC A;  4ENN A;  3O6B B;  2DU9 A;  4BHC A;  2CGP A;  5ED4 A;  2RDP A;  1SMT A;  2ZNY A;  3LQR A;  4CDG A;  5A2Q K;  3DQV C;  3LA2 A;  3ROU A;  3HOS A;  1QZY A;  4HZF A;  1UB9 A;  2GXG A;  3FXU A;  1B9M A;  1JE8 A;  4G6D A;  3P9I A;  1HST A;  4Y17 A;  4QWQ A;  1FC3 A;  1OYI A;  1X3U A;  5LGT A;  2YPR A;  1B59 A;  2NAZ A;  4A0Y A;  3F8F A;  2QM3 A;  2D45 A;  4IRI A;  3F8B A;  2PLY A;  2IA1 A;  4OMY A;  3B02 A;  5F64 A;  1PDN C;  1XGO A;  2PMH A;  2O6G E;  1UST A;  1XSD A;  2W57 A;  3BP8 A;  1W5S A;  4UVB A;  1JXS A;  4HX8 A;  5FB2 A;  4HDU A;  5CVV A;  2FNP A;  1BI2 A;  1FBQ A;  4UVA A;  2VC1 A;  2FMY A;  4CIC A;  4EGZ A;  2ZBK A;  3KET A;  2EJR A;  2HZT A;  4RGR A;  3QPT A;  5F6F A;  2EA2 A;  3JAM K;  2K02 A;  2DQR A;  2RV8 A;  3F8C A;  4A0X A;  2UXX A;  5LEK A;  2DK8 A;  1KU9 A;  1S8N A;  2QYO A;  5BS6 A;  3E5U A;  2OD5 A;  1IN4 A;  2ESH A;  1LDJ A;  5FLX K;  1BM9 A;  1ZAR A;  2A5Y B;  2GA2 A;  3B73 A;  1P4A A;  1YW8 A;  2FA5 A;  1ZYR F;  2Q2E A;  2OZ6 A;  3MFK A;  4M71 A;  4BAY A;  1J0R A;  3NQO A;  2FOK A;  3LA7 A;  3P9K A;  3GZ5 A;  5FFX A;  3WTZ A;  5HS9 A;  2IVM A;  1HXD A;  3FMS A;  5CVU A;  4U7B A;  3WTV C;  2E1C A;  1USS A;  2M5W A;  1J75 A;  4P5O A;  2STW A;  1F1Z A;  1XSX A;  3WTY C;  1EH7 A;  3ZMZ A;  1KGS A;  2HR3 A;  2XV4 S;  4S04 A;  5FO5 A;  1ON2 A;  4A0Z A;  4LMY A;  2Z3Y A;  2HKO A;  2V9V A;  3RJP A;  1WRJ A;  4O5V A;  1TNS A;  1W4M A;  1DDN A;  1G3W A;  1ZGA A;  4RGX A;  4L0Y B;  2XUB A;  1IN5 A;  1BI0 A;  4EJV A;  4I98 B;  1B6A A;  3BJA A;  3IWZ A;  5LHG A;  3S2W A;  3HYI A;  3MWM A;  5LHH A;  2FF4 A;  2HKX A;  3FHZ A;  3GUD A;  3LFK A;  4UNO A;  2OA4 A;  2HTS A;  1K79 A;  2YR2 A;  2H27 A;  2G7H A;  4EM1 A;  1YW7 A;  3EDP A;  3H3U A;  1SFX A;  1KYW A;  3EQL F;  4KYW A;  2ISZ A;  3KP4 A;  3K0L A;  4KN7 X;  3DP7 A;  4G7H F;  4M72 A;  1SAX A;  6PAX A;  3M9A A;  5IT3 A;  3IRR A;  4M9S A;  4BXU A;  3K2Z A;  4Q48 A;  2PMU A;  3WTU C;  3HHG A;  3CLO A;  2QQB A;  3KEQ A;  1G3S A;  3MZH A;  3AAF A;  3TQN A;  4UHT A;  3IHU A;  3J80 K;  3TO9 A;  3BZ6 A;  1WKM A;  3LWF A;  1DPR A;  1K78 B;  4IVN A;  4WWC A;  4GO1 A;  2XAQ A;  3KLO A;  1ZG3 A;  5JR3 A;  4PGG A;  2J5O A;  1TQP A;  4L9V A;  4YII A;  3HHH A;  5HS7 A;  1Y0U A;  1V3F A;  2VBY A;  1ZH5 A;  1FSE A;  1K78 A;  2CG4 A;  1SD5 A;  1ODD A;  1SD7 A;  4CYD A;  3W6K B;  1T6S A;  1QPM A;  2M1B A;  1XGS A;  1RUN A;  3E3V A;  1RIO H;  5ILV A;  3RDI A;  3HRU A;  1HKT A;  5J6X A;  3D5L A;  4P9F A;  3M1E A;  3HTU A;  4F7Z A;  2XKP A;  3CO6 C;  5LBQ A;  1JHF A;  3ISP A;  3KZZ A;  3R6S A;  4A5N A;  3HRT A;  5BPI A;  4ETS A;  1FYM A;  4HV5 A;  5D6E A;  4EQQ A;  5E18 F;  1R22 A;  3GFI A;  2KIU A;  4B8X A;  2HDC A;  2FNA A;  1ZG1 A;  3IKT A;  2K86 A;  1J5Y A;  4G94 A;  1WI9 A;  2Z99 A;  3I64 A;  3RI4 A;  2Z5U A;  4KMU X;  1MKM A;  2QLZ A;  1LDD A;  1ZHF A;  1BOA A;  5D5X B;  1ZLK A;  4BHB A;  5DUK A;  1XB4 A;  4HYE A;  3DV8 A;  2ZKZ A;  4M73 A;  3ELK A;  1F5T A;  1PUE E;  3C1D A;  2XIG A;  2MH2 A;  1T38 A;  4G8X A;  3DXJ F;  3F8N A;  4L9T A;  3WOD F;  3ULQ B;  5DCM B;  1GHC A;  2CW0 F;  3QOP A;  4I0A A;  1YTY A;  2NRA C;  5ILU A;  1FBU A;  4WXD A;  2XGX A;  1LNW A;  2VT3 A;  3C7J A;  4L0Z B;  2LDU A;  2MH9 A;  2WC2 A;  2KJC A;  1OMI A;  1BIA A;  1LDK B;  1YFH A;  2ACJ A;  2TDX A;  4HW0 A;  5FD6 A;  4MTE A;  3EET A;  3ZMV A;  5LGU A;  2OZU A;  2PFB A;  2F5D A;  4PCQ A;  4P55 A;  3KP5 A;  3BPV A;  4Y15 A;  5H6R A;  1KYZ A;  3HTS B;  1YYV A;  4FHT A;  3V4G A;  2DO7 A;  3JSO A;  1SFE A;  5E17 F;  2ZCW A;  4G7O F;  1KQ8 A;  4IF4 A;  4GGG A;  4CO8 A;  3KP3 A;  3QP5 A;  4EJU A;  1XGM A;  1W7P B;  2P4W A;  1H9T A;  2DK5 A;  4KT5 C;  2DW4 A;  2NNN A;  5D4R A;  1QZZ A;  1RNL A;  4EV0 A;  4M9X A;  2JRT A;  1IW7 F;  3HOT A;  2HGC A;  4LJZ F;  1XSV A;  3RIR A;  1MJ9 A;  3ZP5 A;  4EJO A;  1W7P A;  1O7F A;  2COM A;  3RKW A;  2Y0M A;  3SZT A;  2WWY A;  3TO7 A;  1EH6 A;  1C0W A;  3KCC A;  2JPB A;  2X0L A;  4M6X A;  4ENJ A;  1Q1H A;  2XAH A;  3WGI A;  3COA C;  1KU7 A;  4G9Y A;  3GO5 A;  1T39 A;  2H6B A;  3F21 A;  1UCR A;  4A6E A;  1SD4 A;  5CVR A;  1QO0 D;  4NQW A;  2P5V A;  1I6X A;  2V1D A;  2STT A;  2FBK A;  2K4J A;  3GXO A;  5BPD A;  5L3C A;  1U5T B;  4OIQ F;  4Y13 A;  4YFX F;  2VOD A;  4HF0 A;  2OBP A;  3TOB A;  3KEO A;  2P8T A;  4ASN A;  1XCB A;  4B09 A;  3CUQ B;  2RQP A;  3L00 A;  3M7G A;  3RPU A;  2W25 A;  2ZME B;  5E1W A;  3R60 A;  3HIF A;  3LA3 A;  2E7X A;  1FLI A;  3F72 A;  1ZAO A;  3V8L A;  1WSU A;  2XRN A;  3FMR A;  1XGN A;  4M9Z A;  3CUQ A;  4KNY A;  4QLC U;  5JI6 A;  3V8J A;  2EA4 A;  2ZME A;  5BQT A;  1WWX A;  1Z05 A;  4ZZL A;  4LFU A;  4R1H A;  1R5G A;  1ZRD A;  3HSR A;  1HKS A;  1P2F A;  3EUH A;  1R58 A;  3NEU A;  5ICG A;  2V6C A;  1ZRE A; 
#chains in the Genus database with same CATH topology
 3E6M A;  1STZ A;  1EH8 A;  2EV0 A;  4L5J A;  4IKF A;  4HLX A;  2W24 A;  1IXS B;  2YSR A;  1J7K A;  2RKH A;  5IYB J;  3GTJ J;  1BC8 C;  1XDU A;  2ZJQ F;  4RLQ A;  3FIS A;  2HYJ A;  3UNG C;  1P4X A;  1XN7 A;  3LSJ A;  1GLN A;  1H8A C;  3BC8 A;  3JRI A;  3GTP J;  4UVC A;  3I53 A;  3GFM A;  1FX7 A;  3W6V A;  2ZJ2 A;  3G1L A;  2QA4 I;  3H3Z A;  3MMY B;  1K61 A;  3H92 A;  4EJW A;  1W5T A;  3G1M A;  4AVP A;  5TJJ A;  2WB1 N;  4I01 A;  5DS9 A;  2VQC A;  3S16 J;  4RB1 A;  3GW2 A;  4UV8 A;  3VOE A;  2K85 A;  3OYE A;  1IN8 A;  4B43 A;  2W85 A;  1FMV A;  4N0B A;  2UZK A;  1S6L A;  4HF1 A;  1J59 A;  5GAD J;  2R3S A;  2VN2 A;  1ETK A;  3U2R A;  4YRV A;  2HU9 A;  5JFR A;  1IDZ A;  5ILS A;  3VFZ A;  1ZG5 A;  2W84 A;  3FXK A;  2XSJ C;  4EJT A;  2E34 A;  1Y39 A;  1K6O A;  3HOY J;  1V54 H;  3DEU A;  4OU0 A;  3AG2 H;  3V8K A;  1DP7 P;  1OYY A;  3I54 A;  3OYB A;  1IUF A;  2A69 F;  5ICE A;  2HVR A;  4ZH4 F;  2P6T A;  1XMX A;  3LSP A;  1WGX A;  2P5L C;  1MDM B;  3LQQ A;  1Z7U A;  4E6K G;  2VKH A;  1JGS A;  4YIF A;  2EZH A;  1OIS A;  1HW1 A;  3ZQ7 A;  2VXD A;  4M74 A;  2HVQ A;  2L7K A;  2VC0 A;  3BTL A;  3RKX A;  3PFY A;  2KHM A;  4A69 C;  2EIN H;  2VXZ A;  3BZC A;  2CO5 A;  1X1A A;  2DT6 A;  4A3C J;  1D1C A;  4G7Z F;  3PQJ A;  3EYI A;  5B5E C;  1SVL A;  2H94 A;  1MNE A;  1ON1 A;  4A5M A;  4DQ2 A;  2IGK A;  3P9C A;  4LB6 B;  4BU2 A;  3N4M A;  1UHM A;  1LVA A;  3VEP A;  3DCF A;  3A0H C;  3M1C A;  2ESN A;  5FFZ A;  3CD6 I;  4BQA A;  2WAD A;  3J81 Z;  2QZ8 A;  3I4N J;  2R7W A;  1FY7 A;  3FM5 A;  5GAH J;  3WHC A;  3HOW J;  3KYC B;  1JUS A;  3GEZ A;  3DEE A;  5D8K B;  1A36 A;  1F4K A;  2EFW A;  2XPW A;  3K1P A;  1QVT A;  3QPS A;  2F4O B;  3S8P A;  4X6A J;  3QOD A;  4BXF A;  5DUI A;  1EJ9 A;  1U2W A;  3QYF A;  4MQV A;  1J9I A;  3H0G J;  2JK3 A;  2DT7 B;  2WTE A;  1CGP A;  3H5R A;  4Q47 A;  3QU3 A;  2JZY A;  3LSM A;  2CUE A;  2DMT A;  1E3O C;  1LFP A;  3NRV A;  2O3F A;  2QQ9 A;  3JR9 A;  4CXF A;  1W1W E;  1LEB A;  4EEF G;  4CH7 A;  4BE1 A;  4BH9 A;  4F55 A;  2MLG A;  2XKO A;  1DPU A;  1BJA A;  4ZYA A;  2CQQ A;  5FRM A;  5ERI A;  2F4I A;  1X1C A;  2CFO A;  2P5K A;  5FLV A;  3SZP A;  4GYI A;  4U0Y A;  3JTH A;  2R7F A;  3ZN1 A;  2DA3 A;  4Q4Z F;  3HL2 A;  3CCE I;  4XNF A;  4F93 B;  5F0H A;  2K9L A;  3V7R A;  3PNV A;  5EZH A;  4HQM A;  2L54 A;  3GVA A;  3KZY A;  1VQP I;  4OIO F;  2VPL A;  3BJ6 A;  1Z6R A;  1WH7 A;  2FXA A;  3DF8 A;  1D1A A;  4YFK F;  1UG2 A;  1OPC A;  2H6C A;  2QGU A;  2Z16 A;  3WHB A;  1LE8 B;  4C2U A;  2VBZ A;  3MZ8 A;  2F5F A;  5L3D A;  3VDX A;  3WTX C;  3IWF A;  3A01 B;  1WVR A;  4C3H J;  2VAS A;  1U6G A;  3DU6 A;  5K5Q A;  2OQG A;  4ZTJ A;  4KN4 X;  3QP6 A;  5D5V B;  4ON0 A;  3ZMD A;  5C4X J;  4PSX A;  4ZYG A;  4R79 A;  1ZRF A;  1PP8 F;  1I3Q J;  3CDI A;  4IHS A;  2BV6 A;  3JSP A;  5LEJ A;  2X6X A;  1LQ1 A;  3W2W A;  4AIH A;  4NC8 A;  4Q5S F;  5HLI A;  4WK8 F;  1Y56 A;  3SEQ A;  3TBI A;  2HWV A;  5GP9 A;  1UFM A;  5LLQ A;  2UWM A;  2LLK A;  2E60 A;  4HQE A;  2CUZ A;  2M0C A;  3OOP A;  1LE8 A;  3D1N I;  3A01 A;  4GXO A;  1FT9 A;  2VKV A;  4RGU A;  3SDG A;  3K1N A;  5F1J A;  2VON A;  2HXO A;  4N9I A;  3VB2 A;  1G3Y A;  3ZCO A;  4FET A;  5M3M J;  5HLG A;  2O61 A;  4HNU A;  1EKE A;  2X48 A;  1KON A;  4BKX A;  1BBY A;  4OAY A;  3H5A A;  3E7L A;  2QEX I;  2JRM A;  3HSE A;  5HDK A;  2IT0 A;  1LKX A;  1R36 A;  3F8M A;  2BYV E;  5CVI A;  2V1U A;  1R5I D;  2LY2 A;  3O3K A;  3KPH A;  1SFU A;  2KP6 A;  1X3W B;  2M0M A;  1DU0 A;  2MLK A;  1IJW C;  2OAZ A;  2VBW A;  3CCV I;  5J3L A;  4EMS A;  2A6H F;  2EB7 A;  2L9S A;  1JJ6 C;  2Z2S B;  4FX0 A;  1AU7 A;  1REP C;  5CJ9 A;  5AIP A;  4RDU A;  1PVE A;  3HG9 A;  2R7X A;  3OY9 A;  1MMG A;  3DTI A;  2WY8 Q;  3TDU C;  4FT8 A;  2NOJ B;  3BPX A;  1TZL A;  3GF2 A;  3DFG A;  2IGM A;  3BY6 A;  1MJA A;  1Z91 A;  4IQJ A;  1IN6 A;  2R92 J;  2FML A;  2NS0 A;  5FKO A;  1YIO A;  4HBL A;  1YW9 A;  3O2P E;  1HDD C;  2CFX A;  5EEH A;  1YIJ I;  1YRN B;  3I58 A;  4HLY A;  1WJF A;  4BY1 J;  2KIM A;  1ZGJ A;  3GFL A;  3L09 A;  1TW3 A;  2MD5 A;  1ITY A;  1NHA A;  4H4K C;  3JTG A;  4NHJ A;  2IRF G;  3SEZ A;  2F2E A;  3CF5 F;  2PX9 A;  2W1O A;  4MTD A;  5GPC A;  2X1E A;  3S93 A;  3CF2 A;  5M3F J;  3TKY A;  2QBY B;  3VYU B;  3IRQ A;  2XGC A;  4ZYH A;  3JRE A;  4XOT A;  1OJL A;  2BEO A;  1FP1 D;  3Q9V A;  4CZZ A;  1XMA A;  2HFH A;  2K3F A;  3DU5 A;  3BR2 A;  1H9G A;  1A6Q A;  2BY2 A;  2VE8 A;  4WXC A;  3G71 I;  2IPQ X;  2G0E A;  4MQ9 F;  3BCB A;  1WH5 A;  3WU2 C;  2DAO A;  2EFN A;  4C9Y A;  4XOP A;  2VLA A;  1YX5 A;  3SJM A;  4IZZ A;  4CGZ A;  5F0F A;  1POG A;  5F27 A;  2KKO A;  3CJQ B;  3LSG A;  4LLG F;  3VSL A;  3IH3 A;  1OLT A;  2PEX A;  2KIQ A;  5D6F A;  3FHN A;  1QHH D;  4BJT A;  2QBY A;  2IP2 A;  2DYR H;  1WJD A;  2VKE A;  1X1P A;  3CJN A;  1X4O A;  1V4R A;  4Y3O A;  4LOC A;  1VF9 A;  5H6Q A;  1DUX C;  3DPU A;  2DPD A;  5KAI C;  1QU3 A;  5HDG A;  2CWE A;  2M45 A;  3I0T A;  1WHU A;  3OS0 A;  1KU3 A;  4MEY F;  5E20 A;  1HOM A;  3OS1 A;  1EV7 A;  1S7A A;  1BW6 A;  5KK1 A;  4AUX A;  5EEA A;  3F22 A;  4E7S A;  3OL3 A;  2DPU A;  4B44 A;  2ID3 A;  1E3H A;  3FKJ A;  3R4K A;  3U1K A;  4KJZ A;  1BI3 A;  2GA1 A;  4JK1 X;  3U9G A;  2JT1 A;  4QTR A;  3ZQC A;  2Y9Z A;  3FK6 A;  4XK4 A;  4IRG A;  4XRF A;  2DXI A;  2VBX A;  4OIP F;  1MBK A;  3U21 A;  5KCM A;  1FIA A;  3LMM A;  2VUM J;  4IOA F;  2EIM H;  4I7H A;  2IA2 A;  4GYG A;  3N97 A;  2LR8 A;  2QVO A;  3K6G A;  4LB5 A;  1W36 D;  4Y52 J;  3IKV A;  5AIQ A;  1SVO A;  1AOY A;  2XB5 A;  3G73 A;  2EIK H;  1S5L C;  3E6C C;  5DCM A;  2GWR A;  1FOK A;  2A61 A;  1IGN A;  1O3S A;  1T0F A;  4Z6Y A;  2GZW A;  3OYK A;  2DQL A;  3W6J B;  3CMY A;  1YJ9 I;  5EJC A;  3M3Y J;  4ZZD A;  4BYY A;  1UHS A;  4KFC A;  2XAF A;  2ISY A;  4C2M J;  2IA0 A;  1V5E A;  2D5V A;  2RVC A;  2EV6 A;  4LIU A;  2HQR A;  1KQ9 A;  2L7F P;  5E3M A;  3BR5 A;  4XSZ F;  2LC2 A;  3SQN A;  2OF7 A;  4EM0 B;  1BR2 A;  4E7L A;  4WX9 A;  2CQN A;  2A07 F;  1QZE A;  1R00 A;  1ZK8 A;  2LOO A;  3HUG B;  4XRS A;  5HOO A;  2ELH A;  3E5Q A;  3DKX A;  1TQM A;  3HC7 A;  3BCA A;  5LD2 C;  1VQO I;  2IS2 A;  3S1N J;  5M5Y J;  2LD5 A;  1AKH A;  1QBJ A;  5E8G A;  2HVS A;  1FTT A;  2FD5 A;  1MBG A;  1ZN2 A;  3KFW X;  4L5E A;  5D4S A;  2OCC H;  3BOQ A;  3K4L A;  3AFH A;  1MMS A;  4BBR J;  2R4G A;  2X6W A;  4A3L J;  2ZFW A;  3R61 A;  4O3M A;  4UV9 A;  4F3Q A;  3OOU A;  3HEF A;  4RS8 A;  1IXC A;  2M7A A;  3H9Q A;  4IPA A;  4D0P A;  3IAS 2;  1TWH J;  1H0M A;  3OR2 C;  2GQQ A;  3DLA A;  3OSG A;  3Q9S A;  1KZH A;  1JUP A;  1LFB A;  2IJL A;  3I4P A;  3OL4 A;  5ICC A;  5D5U B;  1ZR2 A;  2MBF A;  2JA8 J;  5FKN A;  2K3P A;  2NVQ J;  3LST A;  3ZN0 A;  4XSX F;  3ZOB A;  3BG3 A;  1JTX A;  1RI7 A;  2OU2 A;  2ZFU A;  1AA7 A;  3SFZ A;  1HQC A;  4YG2 F;  3O8G A;  1YLF A;  3E97 A;  1D0Z A;  5K7H A;  4JOM A;  1Y1W J;  1R1V A;  1ZLJ A;  2J5P A;  1T56 A;  2XVC A;  4QPO A;  3M8F A;  3ZGK A;  1BC7 C;  3VOD A;  2WAQ A;  1OKR A;  5DM7 F;  2LF7 A;  2GM4 A;  4XN3 A;  3WGH A;  4FE4 A;  1FYL A;  4F91 B;  2R5Y B;  4AYB A;  2RNG A;  2I10 A;  1BR4 A;  3F6O A;  1YG2 A;  4CHU A;  3ZQG A;  2OQR A;  3FIW A;  5IP6 A;  2MA3 A;  4CCK A;  1MGT A;  2HS5 A;  1U3E M;  3FXR A;  3MVP A;  4I6Z A;  2FRH A;  3S32 A;  3HKZ A;  5IY5 H;  3OR1 C;  1IUY A;  1O7L A;  1X3Z B;  1EF4 A;  1LEA A;  2VT2 A;  1TQI A;  3W3C A;  4RBO A;  3OYC A;  2ID6 A;  3LAP A;  3QAH A;  1IF1 A;  3WGG A;  3WTW C;  1G8X A;  1VQL I;  1UAA A;  1TBX A;  4L5I A;  1HF0 A;  2TRT A;  2WV0 A;  1YS6 A;  1QNT A;  3IL2 A;  2C6Y A;  2K27 A;  4ESJ A;  2BY0 A;  4MGR A;  3BG7 A;  4PUS A;  4AU7 A;  1FOX A;  1QRY A;  1P7J A;  4XR6 A;  4KIB A;  1G59 A;  2G7U A;  5CYV A;  2Y30 A;  4PJ0 C;  5EEG A;  1L3L A;  1TT0 A;  4BEH B;  1I39 A;  5HLH A;  2L9N A;  2VJI A;  1ZGW A;  1VQ4 I;  3IC7 A;  5KVR A;  3FDY A;  4KUM A;  1R23 A;  1CF7 B;  2DMU A;  3F6V A;  3CUQ C;  1T2K A;  1FSH A;  2LBF A;  2Y75 A;  4P96 A;  4N4O B;  3V42 A;  3ASO H;  1MMD A;  2Q8K A;  2ZME C;  3E6D A;  2FE3 A;  1IRF A;  1BR1 A;  1P4W A;  1S3J A;  5DD8 A;  3ZMS A;  1MW7 A;  1IRG A;  2VI6 A;  3CP8 A;  2EFQ A;  2WA0 A;  2E35 A;  4L9N A;  5DDG A;  2R7S A;  3TMO A;  2P6S A;  3RZD J;  2HNH A;  3K1M A;  4J19 A;  1U5T A;  2HOE A;  1LPQ A;  4BEH A;  3ERE D;  1ETY A;  3S1R J;  3L9F A;  5IT9 Z;  1OR7 A;  4LG0 B;  1CF7 A;  3OYI A;  3MZY A;  4OWR B;  1FP2 A;  1RRJ A;  1Z9C A;  2KZG A;  2XPU A;  2L01 A;  2IW5 A;  2VL8 A;  4EGY A;  1W0T A;  3T5X A;  3CJR B;  5A2Q Z;  4A3I J;  1R6R A;  1MSE C;  5J4Y A;  1ORK A;  4WXH A;  5DEQ A;  2V79 A;  1WJ5 A;  4OOI A;  3T8R A;  2K7L A;  3F3X A;  1S7O A;  3G3Z A;  1P9Q C;  2PQ8 A;  1IAW A;  1U9O A;  2CQ7 A;  3RTR A;  5JVT A;  1N77 A;  2XPV A;  4EAT A;  4LGW A;  3BJO A;  4M3D A;  5F04 A;  1PUF B;  3MD2 A;  3E6B A;  3G6E I;  2R7T A;  3FK7 A;  2PN6 A;  4LG0 A;  2XF5 A;  1KU2 A;  2DFI A;  3ABK H;  2GIV A;  4CZC A;  4HF2 A;  2XAS A;  4UUV A;  1VQ9 I;  4ZYE A;  2G9W A;  4JX4 A;  1RZ4 A;  4PJN A;  4U7D A;  1LJ9 A;  4MHG A;  4HDV A;  4IO9 F;  1I5Z A;  2L9V A;  4ENK A;  3GLX A;  1I1S A;  3ZXS A;  4HA8 A;  3C18 A;  5FJ8 J;  1IXR C;  1I27 A;  2E2I J;  3LSR A;  2PMZ A;  1TWA J;  1WJA A;  1FWZ A;  4ESF A;  2ZXH A;  3M4O J;  2VKD A;  4RAY A;  4FTH A;  2FEZ A;  3H9J A;  1PUF A;  1JT0 A;  2H1K A;  1HKQ A;  2CV2 A;  3IUO A;  1Z0X A;  1UJ8 A;  1YS7 A;  2B9S A;  4DBR A;  3L7W A;  2BE5 F;  3SDB A;  1YHQ I;  1ERD A;  5EYR A;  5GAG J;  4BE2 A;  4LD5 A;  2A6E F;  4IJA A;  2DOF A;  4A3E J;  1HSJ A;  3AG4 H;  5HNH A;  2GAU A;  5J1Y A;  2DJN A;  4LK1 F;  4XN0 A;  3FZV A;  1J2X A;  2CS3 A;  2LSO A;  2ZXJ A;  4EVI A;  2HQN A;  5BOX A;  4WCG A;  2D1H A;  3EUA A;  4UUT A;  2RAE A;  2JPC A;  3CZ6 A;  2MYS A;  3WE3 A;  4PJM A;  4YFN F;  3RKY A;  1Z6T A;  2TCT A;  4O6J A;  4AWX B;  3BDD A;  4DZP A;  1MIJ A;  5DCF A;  1GXP A;  2EPF A;  2Q2E B;  3SZG A;  1B9N A;  4LLL A;  1E17 A;  5M5W J;  3JRG A;  1X19 A;  2DTR A;  3PQK A;  4BHP A;  5IYC J;  3T0Y A;  3FWE A;  4XLA A;  4NC6 A;  1B4A A;  1CQT A;  3K4K A;  1ETW A;  2EK5 A;  4DNC A;  2V1X A;  1MD0 A;  4Y4R A;  3WU1 B;  4NB5 A;  1JKO C;  5L3E A;  3U1D A;  3JAM Z;  1YX3 A;  3M8E A;  3TED A;  4KDP A;  2P0W A;  4AM3 A;  2IEK A;  2W82 A;  5LRS A;  1HW5 A;  3RKQ A;  1MMN A;  2CV1 A;  4I2O A;  3S1M J;  3J81 K;  4ZYD A;  4E70 A;  3EUK L;  3IP4 B;  3QPH A;  2FX0 A;  4XMY A;  2O7O A;  1G3T A;  5E1Z B;  5FLX Z;  1Y6I A;  1MBF A;  5DM6 F;  5E1X A;  1UHW A;  3CCR I;  3ESW B;  1VND A;  2EIJ H;  2L9R A;  4JQF A;  2RGV A;  3K10 A;  1SMY F;  2ZSI B;  3OYG A;  1VTN C;  4KMF A;  3TDZ C;  2EWN A;  3CTA A;  1NH3 A;  2L02 A;  1R7J A;  2LMD A;  3OV8 A;  1UG0 A;  1V5F A;  1MDM A;  1U8B A;  1ETX A;  3MEX A;  5K5R A;  2K5C A;  3P7N A;  2ZO4 A;  3KLN A;  2PG4 A;  2F5E A;  4BY7 J;  2NVX J;  2H1L A;  1BI1 A;  4D1Q A;  4OMZ A;  2O8X A;  3FF5 A;  1FYK A;  1OQY A;  2JTV A;  2Z33 A;  2YX4 A;  3GTK J;  3TO6 A;  3W2A A;  2E1M B;  1YJN I;  3K69 A;  1QGP A;  3WE2 A;  4HEA 2;  2K9S A;  4ANJ A;  2X1D A;  3HRS A;  3LSH A;  2YX7 A;  1FOW A;  4ENM A;  1YO5 C;  2DA7 A;  3B6A A;  4UXN A;  3ABU A;  4W1U A;  1A04 A;  4I99 C;  2FUG 2;  2R7D A;  2M87 A;  4HX7 A;  1BOB A;  1OYW A;  4CSW A;  2M8E A;  2JUC A;  3S2D J;  5DYM A;  4IHT A;  1I6H J;  4RAF A;  2NYX A;  3ECH A;  2CSO A;  3X2Q H;  2K4B A;  1ETO A;  5DD4 A;  3R0A A;  3Q5F A;  2I5U A;  2F5V A;  1T95 A;  5LHI A;  2ZJR F;  1K7A A;  2VOO A;  3GLL A;  5LFA A;  2XHK A;  3OYD A;  2F48 A;  3ZMT A;  2CQK A;  3JCU C;  3MCZ A;  5CPR B;  2PBI A;  5L3B A;  4XKB A;  4CUG A;  2XRL A;  2QKM B;  3CCM I;  2XAU A;  3HPG A;  2KIS A;  3HOU J;  2L7M P;  4ZJZ A;  2QCO A;  1DGR M;  1D0X A;  5ICF A;  3S2H J;  2QWW A;  3V7C A;  4MEX F;  2Y69 H;  1SVM A;  2KIF A;  5L3F A;  2ZXW H;  1XX5 A;  3GFJ A;  4XON A;  1MBE A;  3HM5 A;  2FBH A;  4D9J A;  4V19 K;  3I9V 2;  4IXA A;  3MKL A;  4JYK A;  4HV6 A;  2HYG D;  5GPA A;  2QSH X;  2HYF A;  4PJL A;  3ECO A;  1VQ5 I;  3H35 A;  4HOB A;  3F23 A;  3D5S C;  2E7W A;  2LKS A;  3FBN B;  5CQG A;  4KIS A;  5IOZ A;  4XLC A;  1ENH A;  3RPQ A;  2VE9 A;  1R4M B;  3ML6 A;  3C3W A;  1RR8 C;  1W7P D;  4Y33 A;  3PNY A;  3I59 B;  4UUS B;  5IOY A;  4XLF A;  2L3D A;  3I5U A;  3OYH A;  4LLN A;  1E2X A;  2B7E A;  3WG9 A;  2OPT A;  4L9J A;  3S17 J;  2L7Z A;  1G6N A;  2CW7 A;  2LKP A;  1GXQ A;  2M9H A;  2GOX B;  3L2C A;  2A68 F;  3Q0V A;  4KIG A;  2QSF X;  4ZC3 A;  3IAM 2;  4BQQ A;  2Q1Z B;  4U0W A;  4XKV A;  2R93 J;  2ADU A;  2HEO A;  2VOP A;  5LRR A;  3FMQ A;  2LF8 A;  3E0J B;  2F5C A;  1T08 B;  4XBF A;  2UXN A;  2BVL A;  5TIS C;  3BTJ A;  2VQH A;  3TP3 A;  3TGN A;  4DZJ A;  5EZG A;  4I02 A;  2XAJ A;  3I59 A;  4UUS A;  3O8H A;  5E8I A;  4N9H A;  4XLP F;  2EZK A;  4XLN F;  3RYP A;  2AXL A;  3MAJ A;  5D8L B;  2FQ4 A;  2CJJ A;  3FX3 A;  1V5G A;  1XDS A;  2Z1D A;  3HSF A;  1VQM I;  3J80 Z;  4PGH A;  2BHY A;  1HW2 A;  2P7V B;  2O8K A;  3OMY A;  4GCV A;  3H5N A;  4RB3 C;  4FAS D;  4OIR F;  4RB2 C;  1VQ7 I;  4FX4 A;  4BDZ A;  2A3S A;  4HAM A;  5TRD A;  1LB2 A;  1TC3 C;  2R7V A;  2JJ7 A;  1NG7 A;  2UUZ A;  4BQO A;  3KP7 A;  2QQ8 A;  2ETH A;  1MND A;  2E5N A;  2GIZ A;  2X1C A;  4OIN F;  4AD9 A;  1YI2 I;  4QSH A;  4DYR A;  3IH2 A;  2HQA A;  4G6T B;  2EFO A;  1HA8 A;  1WQ2 A;  2DLL A;  2XAG A;  4CCM A;  1MMA A;  2GXB A;  1WI3 A;  2L4A A;  2KL4 A;  1HC8 A;  1BJZ A;  4G6Q A;  5JHU A;  4PZJ A;  3SFI A;  1ZRC A;  5FGM A;  4UB6 C;  3BLY A;  3T8T A;  1IZ1 A;  3TW6 A;  1FBS A;  2NS8 A;  2KJB A;  3ASN H;  4R8H A;  5FRO A;  5LGN A;  1SD6 A;  1PP7 U;  4JBA A;  3TOA A;  4M6Y A;  4XOR A;  5HVQ C;  2W00 A;  1L0O C;  2DMQ A;  3K70 C;  5BMZ A;  2XB0 X;  4D7M A;  1O57 A;  5GTH C;  1QPI A;  3WU0 A;  4AIJ A;  1ETV A;  3EYY A;  4U88 A;  3CP2 A;  2OTL I;  3HRM A;  3K4M A;  3AL0 C;  1AWC A;  3ZMU A;  1YRN A;  4D5F A;  4DOZ A;  4AIK A;  1I1G A;  3D0S A;  3B6C A;  2K9N A;  4A12 A;  4CCL A;  5IPA A;  1TTY A;  1MJB A;  4BXX J;  2MC3 A;  4I09 A;  3BRO A;  5DV5 A;  3CDH A;  3WTT C;  1MZB A;  3PO3 J;  3H36 A;  4B1R A;  5D5W B;  1W0U A;  1XD7 A;  2BY1 A;  3I56 I;  3NWS A;  4M3F A;  1JKR C;  2O03 A;  4LG3 A;  4FE7 A;  4NBQ A;  4CCO A;  4Z2Y A;  4M6V A;  3KE2 A;  2BGC A;  2EH3 A;  2L4M A;  3ABT A;  5FKM A;  1MBH A;  2GOM A;  3QRF F;  2RN7 A;  3CCJ I;  1SFO J;  1X2M A;  4BJ6 C;  3WG7 H;  1B1B A;  2QSG X;  1T0F C;  2JA2 A;  3FM3 A;  2W4S A;  1SAN A;  4RAZ A;  2R7Z J;  3CES A;  3JW4 A;  3CO7 C;  1XMK A;  4L18 B;  2V9K A;  1RUO A;  1T8I A;  2DCE A;  2JA6 J;  5L3G A;  1D8J A;  2RNJ A;  1A6I A;  3ZQL A;  4A3D J;  1R1T A;  2FOW A;  2PI0 A;  1KQ0 A;  4RB0 A;  2RC4 A;  2Y0S A;  1YQA A;  1YJW I;  2VJ5 A;  3FXM A;  5CVJ A;  3W2V A;  1I50 J;  3NAR A;  3DKW A;  2FBI A;  3E5X A;  1JKP C;  2I8D A;  4P9U A;  5IYD J;  5H20 A;  3CCS I;  3ABL H;  1R49 A;  3SXY A;  1O3T A;  2NXN B;  2DT5 A;  5K1Y A;  3HGG A;  2Z9O A;  2X6Y A;  2MAB A;  4BNC A;  1JHH A;  2V26 A;  5FRN A;  4IOC F;  1FOY A;  4NUB A;  3I71 A;  1O3R A;  3ZPL A;  3F9K A;  4WF2 A;  5HNF A;  2DBB A;  1XPX A;  1T98 A;  5F1R A;  3C2G A;  1UZC A;  2D1V A;  3P5J A;  2QQA A;  3PFI A;  4BL0 B;  4HX4 A;  4IRH A;  3CUO A;  5CLS A;  2JWT A;  1MNM C;  2WV1 A;  4S0H B;  5HDN A;  3DBL B;  4B4C A;  1VQ8 I;  3MQ0 A;  2ZC2 A;  3SHF A;  4E4H A;  2K40 A;  2O0Y A;  2QKL B;  1HBX G;  3KP6 A;  5J8F A;  1A35 A;  3BG9 A;  4MFE A;  1U9N A;  1XCV A;  3LFU A;  1APL C;  4PDK A;  2JSC A;  4I0B A;  1TLH B;  1U8R A;  2ZJP F;  1OCT C;  3CC4 I;  3WTS C;  5B1B H;  3LAJ A;  4MIM A;  1R5H A;  2XRO A;  1TNT A;  1DQU A;  4XIC A;  2ZNZ A;  1D8K A;  2FJ1 A;  5J1R A;  1OCZ H;  4KA4 A;  5BNG A;  4MNU A;  3GYH X;  2LNB A;  3FXO A;  1B72 B;  3J7A O;  2P7C B;  2BXY A;  3A03 A;  3OS2 A;  2FSW A;  4IL6 C;  5K5O A;  1O3Q A;  3HUG A;  2D2W A;  2P81 A;  3FKI J;  5JLX A;  4S05 A;  4A6D A;  2NNY A;  1LFU P;  2FQ3 A;  2HXI A;  3ZQQ A;  2YU3 A;  2DI3 A;  1Z1D A;  2EZI A;  4PK4 A;  2E1N A;  3RYR A;  4D5C A;  1GVJ A;  1TW2 A;  2DDA A;  2HPI A;  2JQ7 A;  4PFP A;  4ESB A;  1OCP A;  1FPQ A;  3DTK A;  4RM3 A;  4TV7 A;  2OV7 A;  2QUF A;  1KA8 A;  3Q3S A;  1XC5 A;  3GZ6 A;  1OFC X;  3CC2 I;  3A2K A;  3DBH B;  1B72 A;  3TL4 X;  2LFB A;  2QEN A;  1IN7 A;  1DGW Y;  4YIR X;  2B0L A;  3FXL A;  3KP2 A;  4CCN A;  1MBJ A;  2R7O A;  1ULY A;  5FLM J;  1BIB A;  1AHD P;  2CYY A;  1OCC H;  1FZP B;  1HLV A;  1S29 A;  2BBY A;  5J8C A;  1FIP A;  3BT9 A;  2EV5 A;  3CME I;  2M30 A;  2BW3 B;  3ZR8 X;  2DA5 A;  3V7S A;  1ONV A;  2XF7 A;  4H0E A;  2KRC A;  4EM2 A;  1BN5 A;  2M7B A;  2IS6 A;  3VYT B;  1U78 A;  2H09 A;  2V9P A;  3CQZ J;  3VWB A;  2HTJ A;  2X51 A;  1A31 A;  4LK0 F;  1WFX A;  2MC4 A;  2Q0O A;  1D5Y A;  1IRX A;  4XID A;  2M3A A;  2Y48 A;  2HDD A;  1FMW A;  3OWT A;  3GTL J;  2VB6 A;  3FXQ A;  1YIT I;  2DFE A;  1D3Y A;  2BZT A;  4JX5 A;  4BS9 A;  3DPT A;  2YU9 J;  1R1U A;  2EFP A;  2DMN A;  2X4H A;  4RGS A;  1D5V A;  4JX6 A;  2X9D A;  4U0V A;  5CKT A;  4X1E A;  5AON A;  5HS8 A;  2PJP A;  3REO A;  3LL7 A;  1FNN A;  2YS9 A;  3KYL A;  3R0J A;  4B3X A;  2BW3 A;  1U5T C;  2KPM A;  2R5Y A;  3VYR B;  3GWZ A;  4KIT B;  1P92 A;  3H3V K;  1V55 H;  2VJ4 A;  2VPR A;  4FIS A;  3M07 A;  4KIF A;  2JVH A;  2V1N A;  1GT0 C;  3BWG A;  2NOG A;  4MFD A;  3T1B A;  3LSI A;  1Y0N A;  4K2E A;  2R7U A;  3GX4 X;  3A02 A;  5FD5 A;  2FU4 A;  1JI8 A;  3C2B A;  3J7A Y;  4A2U A;  4FCY A;  5IT9 K;  1F9N A;  3QWL A;  3QU6 A;  3LSK A;  4RLF A;  3CJT B;  2AS5 F;  1P6R A;  2DA4 A;  1QQI A;  3K9T A;  4UY8 I;  3MKZ A;  3DPL C;  2KRF A;  1J09 A;  2DA6 A;  4KIC A;  4ENN A;  3O6B B;  2DU9 A;  4BHC A;  2CGP A;  2DOA A;  2NS7 A;  2CW8 A;  5ED4 A;  4B48 A;  3PJR A;  3BZK A;  2ZNY A;  1SMT A;  2NVY J;  2RDP A;  2WAQ N;  3LQR A;  4CDG A;  5A2Q K;  1K6Y A;  3JRA A;  1WCM J;  4BJ5 C;  3S3N A;  3DQV C;  2CRG A;  2JVG A;  3EUH C;  3LA2 A;  1FEX A;  2E1O A;  1SAU A;  1XTA A;  3ROU A;  1QZY A;  4HZF A;  3HOS A;  3K2A A;  1UB9 A;  5B3S H;  2HZD A;  2GXG A;  3K4B A;  3D5R C;  3FXU A;  1B9M A;  3HKZ N;  1JE8 A;  3CCY A;  3DKY A;  4G6D A;  5CQE A;  4C3J J;  3P9I A;  1IO2 A;  2Y9Y A;  4XLH A;  1HST A;  3ZQI A;  4Y17 A;  4QWQ A;  1FC3 A;  1OYI A;  5JHF A;  1X3U A;  2WB1 A;  5LGT A;  2YPR A;  1B59 A;  4E7K A;  2NAZ A;  4A0Y A;  3F8F A;  3KZI C;  2QM3 A;  3DLL F;  1E0E A;  2D45 A;  4IRI A;  2VIX A;  5GTI C;  3F8B A;  3L2W A;  2PLY A;  4C30 A;  1VQN I;  2RRE A;  1Z7L A;  2IA1 A;  4DGW B;  3S14 J;  2K9Q A;  3PL8 A;  2PJR B;  4OMY A;  3B02 A;  2A6T A;  5F64 A;  3OYN A;  4DYQ A;  1PDN C;  1XGO A;  3S3O A;  1FJL A;  2PMH A;  2O6G E;  1UST A;  4IEJ A;  1XSD A;  2W57 A;  3BP8 A;  1W5S A;  4UVB A;  1JXS A;  1N25 A;  1LUJ B;  2LY9 A;  4HX8 A;  5FB2 A;  4HDU A;  5CVV A;  2FNP A;  1BI2 A;  4HRI A;  1FBQ A;  4ZTF A;  1W36 C;  3J7Y J;  1DP3 A;  3CMM A;  3IV5 A;  4UVA A;  2VC1 A;  1JTY A;  3OSF A;  2DYS H;  4V2G A;  4E7I A;  2MG4 A;  1G2H A;  2FMY A;  4E7Z A;  2PJR A;  1NK2 P;  4CIC A;  2R0Q C;  4EGZ A;  2ZBK A;  3KET A;  2EJR A;  2HZT A;  4RGR A;  2Y31 A;  3QPT A;  3LOC A;  3ZQH A;  5F6F A;  2WAF A;  2EA2 A;  3JAM K;  2K02 A;  5EG0 B;  2DQR A;  2HDW A;  2RV8 A;  2LP0 A;  3F8C A;  4A0X A;  2UXX A;  5LEK A;  2DK8 A;  1KU9 A;  1MSF C;  1WPK A;  1S8N A;  2ME6 A;  3CCU I;  2AQE A;  1X1B A;  2QYO A;  3BG5 A;  5BS6 A;  3E5U A;  2OD5 A;  1IN4 A;  2ESH A;  3RQI A;  1LDJ A;  2LY1 A;  5FLX K;  4RAG A;  5K7F A;  1BM9 A;  1ZAR A;  1PJR A;  3RSN A;  4XLE A;  2A5Y B;  2GA2 A;  4RA2 A;  2JA7 J;  1P7I A;  4DIQ A;  3ABM H;  4X0G A;  3PIP F;  3ZQF A;  3DEW A;  1BA5 A;  3B73 A;  1P4A A;  3QYB A;  1YW8 A;  2AO9 A;  2FA5 A;  3RCO A;  5EG0 A;  3K70 D;  2ECC A;  2R7R A;  3FXJ A;  1NTC A;  3KYD B;  1ZYR F;  3CC7 I;  2PMZ N;  2Q2E A;  4P1W A;  1PYV A;  3BR6 A;  2VJJ A;  2OZ6 A;  3OYF A;  3MFK A;  2DOD A;  4KT6 A;  4PFO A;  4M71 A;  4BAY A;  3OYM A;  1U0J A;  4XKC A;  1J0R A;  3NQO A;  1XG1 A;  4M3E A;  2FOK A;  3BTI A;  3LA7 A;  3S15 J;  3P9K A;  5JVG F;  3GZ5 A;  5FFX A;  2MSY A;  3MKY B;  1B8I B;  1F36 A;  4IHV A;  3DWL E;  3WTZ A;  5HS9 A;  2IVM A;  1HXD A;  2DA1 A;  3FMS A;  5CVU A;  4U7B A;  3WTV C;  5F0C A;  2E1C A;  2M5W A;  1USS A;  1GV5 A;  1SFK A;  4P5O A;  3L2U A;  1J75 A;  2E1M C;  2STW A;  1F1Z A;  4V2F A;  3HDD A;  1TT5 B;  5J40 A;  1XSX A;  3E1S A;  3BR0 A;  3WTY C;  4LIV A;  1BW5 A;  2V7F A;  3SYT A;  3H9G A;  1EH7 A;  3ZMZ A;  1KGS A;  2HR3 A;  4OAZ A;  4RMN A;  2XV4 S;  4HST A;  4F52 A;  4S04 A;  5FO5 A;  3ERM A;  4IHX A;  1ON2 A;  4A0Z A;  1ETQ A;  4ABZ A;  2VQL A;  4LMY A;  2Z3Y A;  4XKW A;  1K83 J;  2HKO A;  1B8I A;  1X4P A;  1D1B A;  2V9V A;  5IP9 J;  3RJP A;  1WRJ A;  4O5V A;  1TNS A;  3GZN B;  1W4M A;  4BDY A;  1DDN A;  5E3L A;  5GAE J;  3DBR B;  2H8R A;  1G3W A;  1JJ8 C;  1ZGA A;  2ME0 A;  1YE9 A;  4RGX A;  3BG6 A;  4L0Y B;  2XUB A;  1IN5 A;  2GXA A;  2A5W A;  3N05 A;  1BI0 A;  4EJV A;  1VI0 A;  2JN6 A;  4I98 B;  2IAI A;  1B6A A;  2RQQ A;  4J00 A;  2XC7 A;  3BJA A;  1OCR H;  3Q0W A;  3IWZ A;  4I76 A;  5LHG A;  2EBI A;  2OUM A;  5TGT A;  2L5Q A;  3K7A J;  3S2W A;  3HYI A;  2H8W A;  2FF4 A;  2HKX A;  3MWM A;  5LHH A;  3H0D A;  2IXS A;  2KFD A;  3FHZ A;  3GUD A;  5J4V A;  5EDN A;  2BY3 A;  2OJE D;  2B63 J;  3LFK A;  2OC6 A;  4A3G J;  2AXT C;  4UNO A;  3HZJ A;  2OA4 A;  2HTS A;  1E3P A;  1K79 A;  2YR2 A;  2H27 A;  2G7H A;  4EM1 A;  1YW7 A;  3EDP A;  2M2E A;  1F43 A;  5F08 A;  2JSP A;  3ZRG A;  3H3U A;  5KAF C;  3KIO A;  1SFX A;  1JKQ C;  1KYW A;  3EQL F;  4HPQ A;  4U87 A;  4KYW A;  1UEL B;  2DMP A;  1ZQ3 P;  3S3M A;  2ISZ A;  3KP4 A;  1JUM A;  3K0L A;  4KN7 X;  3OIO A;  3DP7 A;  2IS1 A;  1N78 A;  3UR3 C;  3KEY A;  2R5Z B;  4G7H F;  4M72 A;  1Z3Y A;  3GTQ J;  1SAX A;  6PAX A;  4XRS G;  3M9A A;  5IT3 A;  4HNT A;  2DFH A;  3OYA A;  2AHQ A;  3IRR A;  4M9S A;  3QYE A;  2CV0 A;  4BXU A;  4IHY A;  1XS9 A;  2VQG A;  3K2Z A;  2WBM A;  4HG2 A;  4Q48 A;  2IBD A;  2CMP A;  2PMU A;  3WTU C;  3HHG A;  3CLO A;  2O9L A;  2QQB A;  2CQX A;  3KEQ A;  3L2V A;  1X2N A;  1G3S A;  3MZH A;  3HBL A;  1T33 A;  1Q1V A;  4PJJ A;  4YEJ A;  1Z3X A;  2KDZ A;  3AAF A;  3BR3 A;  3TQN A;  4UHT A;  3IHU A;  3OYJ A;  3QOE A;  3J80 K;  2R5Z A;  5EGO B;  4GDF A;  3TO9 A;  3BZ6 A;  4UB8 C;  1WKM A;  3I55 I;  3FBI B;  3I3L A;  3M8J A;  3LWF A;  2BHZ A;  3G1O A;  1DPR A;  1Z67 A;  5B1A H;  4NNJ A;  3NAU A;  1ZTR A;  3GTM J;  1K78 B;  4IVN A;  1I3A A;  1LVK A;  1GDT A;  3JRH A;  3MN2 A;  5C44 J;  4WWC A;  2HOA A;  4GO1 A;  3DTE A;  2XAQ A;  3KLO A;  2LKX A;  2HOS A;  4A3J J;  1GVD A;  1ZG3 A;  2BOL A;  5JR3 A;  4PGG A;  1Z77 A;  2LVS A;  5C4J J;  1H88 C;  2J5O A;  2HI3 A;  3BQZ A;  2DN0 A;  4II3 A;  1TQP A;  4L9V A;  5FKK A;  4YII A;  3PSI A;  3HHH A;  5HS7 A;  5EGO A;  4RM2 A;  1TWC J;  1Y0U A;  2ZXI A;  2IGN A;  1V3F A;  2VBY A;  1ZH5 A;  1RES A;  2KRH A;  3Q0U A;  1G4D A;  1VZ0 A;  2ECB A;  2ELJ A;  1FSE A;  2M4K A;  1K78 A;  1FTZ A;  2CG4 A;  4A3K J;  1SD5 A;  1ODD A;  1SD7 A;  2CU7 A;  3F0C A;  4CYD A;  3W6K B;  2Y2Z A;  2A05 A;  2GBY A;  3EPZ A;  1T6S A;  2OCE A;  1QPM A;  2M1B A;  2F6C A;  3RPU D;  2CUF A;  4B3A A;  1XGS A;  1WJE A;  1RUN A;  4YEL A;  5C3E J;  3E3V A;  1RIO H;  2DDB A;  5ILV A;  1K4S A;  3RDI A;  1SC7 A;  2MD0 A;  3HRU A;  5J6X A;  3LNQ A;  1HKT A;  3D5L A;  4P9F A;  5HOD A;  3I4M J;  1O4X A;  3M1E A;  3HTU A;  4F7Z A;  4E7H A;  2XKP A;  4DYC A;  3CO6 C;  2CUJ A;  2IS4 A;  5LBQ A;  4LIT A;  1JHF A;  2LYC A;  3ISP A;  3KZZ A;  3R6S A;  4A5N A;  5HLT A;  3HRT A;  5BPI A;  4ETS A;  1FYM A;  3PUF A;  2R7Q A;  2M4G A;  4HV5 A;  2N8G A;  5D6E A;  1NG6 A;  2JA5 J;  4D7N A;  2KQR A;  4ZDP A;  3K4C A;  4EQQ A;  4G12 A;  1BL0 A;  5E18 F;  2WAE A;  3PUB A;  1R22 A;  3G4S I;  3GFI A;  1WJB A;  2DTZ A;  2KIU A;  4B8X A;  2HDC A;  2FNA A;  4C2T A;  1ZG1 A;  5KHD A;  3IKT A;  2KMU A;  2XF6 A;  2K86 A;  4XRM A;  1J5Y A;  4G94 A;  1WI9 A;  2Z99 A;  3L2Q A;  3I64 A;  1QA6 A;  1TWF J;  2V4J C;  2E2J J;  2MFZ A;  3RI4 A;  3CDL A;  3RZO J;  2Z5U A;  4KMU X;  3AL0 B;  1RPW A;  1MKM A;  3L2R A;  2QLZ A;  1LDD A;  1ZHF A;  1BOA A;  1K4T A;  4QIW N;  4BUP A;  5D5X B;  1ZLK A;  2EZL A;  1D0Y A;  4BHB A;  1X58 A;  5DUK A;  1XB4 A;  4HYE A;  3PIO F;  2W48 A;  3DV8 A;  1HCR A;  2ELK A;  2MGQ A;  1DU6 A;  2ZKZ A;  4M73 A;  3ELK A;  1F5T A;  1PUE E;  2IGO A;  2XIG A;  3C1D A;  2MH2 A;  2COB A;  4ITV A;  2KLO A;  1T38 A;  3A1Y A;  4G8X A;  2WY7 Q;  5J1U A;  2BVM A;  3DXJ F;  3F8N A;  4L9T A;  4NC7 A;  4GRI A;  3JRD A;  2E2H J;  3WOD F;  3PO2 J;  4HSR A;  3KX2 A;  5J47 A;  3ULQ B;  1VQK I;  2L0K A;  1IV6 A;  5DCM B;  4BQN A;  1GHC A;  4XM3 A;  1H89 C;  2L2O A;  5K7Z A;  3QQA A;  1NK3 P;  2CW0 F;  3QOP A;  4I0A A;  1YTY A;  2NRA C;  3NWT A;  1R71 A;  5ILU A;  3K4J A;  4BBS J;  1FBU A;  2DOE A;  2YUS A;  3HJE A;  4WXD A;  2EQR A;  2XGX A;  3C2H A;  2CH0 A;  1LNW A;  2VT3 A;  3C7J A;  4L0Z B;  2LDU A;  2LTP A;  2MH9 A;  2WC2 A;  5E79 C;  3AG1 H;  1JT6 A;  2KJC A;  5KNL A;  1OCO H;  2DA2 A;  2QF7 A;  1OMI A;  1W5C C;  1BIA A;  4F92 B;  2XDV A;  9ANT A;  1LDK B;  1YFH A;  2ACJ A;  3A4C A;  1S7E A;  5JLW A;  2TDX A;  3GCM A;  1TP4 A;  2KZV A;  4HW0 A;  5FD6 A;  2LH9 A;  1AKH B;  2K9M A;  4C3I J;  4MTE A;  4NDL A;  4AID A;  3AKZ A;  3EET A;  3ZMV A;  1JGG A;  5IP7 J;  5LGU A;  3S1Q J;  2OZU A;  2PFB A;  3HPH A;  3HXL A;  5FKL A;  2F5D A;  1EA3 A;  4PCQ A;  2LG4 A;  4P55 A;  3KP5 A;  4II2 A;  4HNV A;  3BPV A;  4Y15 A;  5H6R A;  2X6O A;  1KYZ A;  3JRC A;  3HTS B;  1YYV A;  2X85 A;  1YOV B;  3AG3 H;  4FHT A;  3V4G A;  2DO7 A;  3PM1 A;  3JSO A;  5M5X J;  1SFE A;  5E17 F;  2ZCW A;  1Z21 A;  2XSD C;  4G7O F;  1KQ8 A;  4IF4 A;  4GGG A;  2Y0S N;  4CO8 A;  3KP3 A;  1IC8 A;  3QP5 A;  1RKW A;  4EJU A;  1XGM A;  3CCL I;  4AVZ A;  1W7P B;  2P4W A;  1H9T A;  2DK5 A;  4KT5 C;  2EIL H;  1GUU A;  2DW4 A;  1N75 A;  2NNN A;  5D4R A;  2ICW G;  2HOT A;  1QZZ A;  3BQY A;  4QPQ A;  1RNL A;  4EV0 A;  4M9X A;  1RET A;  4A3F J;  2JRT A;  1IW7 F;  1M1E B;  3RQ4 A;  1Y8R B;  3HOZ J;  2HQ5 A;  3HOT A;  3CCQ I;  4M3B A;  2HGC A;  4LJZ F;  1XSV A;  3RIR A;  3VSK A;  5E3N A;  1MJ9 A;  3ONQ A;  3ZP5 A;  3UKG A;  2KT0 A;  4EJO A;  4CCJ A;  1W7P A;  1O7F A;  1RC9 A;  2COM A;  2UV1 A;  4AC0 A;  3J7Z I;  2W7N A;  3RKW A;  2DFF A;  2Y0M A;  3SZT A;  4BE0 A;  4NQW B;  4XL9 A;  1UMQ A;  2E36 A;  2M8G X;  1MH4 A;  2WWY A;  2M34 A;  3OIP A;  3TO7 A;  1EH6 A;  1C0W A;  4ZDL A;  1IV8 A;  1TWG J;  3KCC A;  2JPB A;  1QVU A;  1ZKG A;  2X0L A;  3BR1 A;  4M6X A;  1IDY A;  2LK2 A;  2XGD A;  4JP0 A;  4ENJ A;  4DW6 A;  4GFB A;  1WJC A;  1Q1H A;  2XAH A;  4W97 A;  1IRZ A;  5EF6 A;  3WGI A;  3COA C;  1KU7 A;  4G9Y A;  1HDP A;  2NVU B;  3GO5 A;  1T39 A;  2H6B A;  4DBQ A;  2AQF A;  2NVT J;  5B66 C;  1MH3 A;  4PSW A;  2XGE A;  1UCR A;  3F21 A;  4A6E A;  1SD4 A;  5CVR A;  1QO0 D;  4NQW A;  2MW8 A;  5H2F C;  3VPR A;  2P5V A;  4A93 J;  1OR7 C;  2E5Z A;  3CMA I;  1I6X A;  2V1D A;  2STT A;  2FBK A;  3K4N A;  2LBF B;  3VYS B;  2K4J A;  2E71 A;  3GXO A;  5BPD A;  3HGY A;  4M3G A;  1RKT A;  4IX7 A;  2ZB9 A;  3PSF A;  5E3O A;  4A3M J;  4A3B J;  5L3C A;  3HOV J;  4ZDO A;  2DJI A;  1TL8 A;  1U5T B;  3A0B C;  4OIQ F;  4Y13 A;  2F4M B;  4MO7 A;  1IG7 A;  4YFX F;  2VOD A;  3H1C A;  2ZSH B;  2OBP A;  4HF0 A;  3JRB A;  5DTD A;  3TOB A;  3KEO A;  4BGD A;  2P8T A;  4ASN A;  1Y1V J;  1WZ2 A;  1A5J A;  1XCB A;  3HB9 A;  3TW7 A;  1VQ6 I;  4B09 A;  4AYB N;  3CUQ B;  3IH4 A;  4N4N B;  4DJA A;  2RQP A;  3L00 A;  1VFC A;  1R9T J;  3M7G A;  3RPU A;  2E19 A;  2W25 A;  2ZME B;  1ZR4 A;  5E1W A;  2OTJ I;  3R60 A;  2LRD A;  3HIF A;  1ACI A;  3BTC A;  2KDO A;  1R4N B;  3OIQ A;  3LA3 A;  2E7X A;  2GLO A;  1FLI A;  3GTG J;  3F72 A;  3OYL A;  1ZAO A;  3L1P A;  3V8L A;  3CLQ A;  2V6E A;  1WSU A;  2XRN A;  3TP0 A;  2HPM A;  3FMR A;  3GTO J;  1XGN A;  4M9Z A;  1S9H A;  4E7J A;  2JMW A;  3CUQ A;  4KNY A;  4QLC U;  4CYC B;  5JI6 A;  4J01 A;  1ZEL A;  3V8J A;  4B47 A;  1X1D A;  2EA4 A;  1S72 I;  2ZME A;  3MKW B;  3PNT A;  5BQT A;  3HOX J;  1QHG A;  3GME A;  1WWX A;  1Z05 A;  4IHW A;  4ZZL A;  4LFU A;  4R1H A;  4XQF A;  1R5G A;  3QPL A;  4FQG A;  4MLO A;  3JRF A;  3G2B A;  1Y8Q B;  1RR7 A;  2BXZ A;  2LRE A;  1ZRD A;  3HSR A;  1HKS A;  1P2F A;  3EUH A;  1R58 A;  3NEU A;  2JUG A;  4Y7N J;  2V6C A;  5ICG A;  4IQ4 A;  4BAC A;  3GBG A;  1ZRE A;  2O5R A;  1SEU A;  4CA0 A;  4CYC A;  1GV2 A; 
#chains in the Genus database with same CATH homology
 3E6M A;  1STZ A;  1EH8 A;  2EV0 A;  4L5J A;  4HLX A;  2W24 A;  1IXS B;  2YSR A;  1J7K A;  2RKH A;  1BC8 C;  1XDU A;  1P4X A;  1XN7 A;  4UVC A;  3I53 A;  3GFM A;  1FX7 A;  2ZJ2 A;  3H3Z A;  3H92 A;  4EJW A;  1W5T A;  4AVP A;  5TJJ A;  4I01 A;  4RB1 A;  3GW2 A;  4UV8 A;  3VOE A;  1IN8 A;  2W85 A;  4N0B A;  2UZK A;  1S6L A;  4HF1 A;  1J59 A;  2R3S A;  2VN2 A;  3U2R A;  5JFR A;  5ILS A;  3VFZ A;  1ZG5 A;  2W84 A;  4EJT A;  1K6O A;  3DEU A;  4OU0 A;  3V8K A;  1DP7 P;  1OYY A;  3I54 A;  2A69 F;  5ICE A;  4ZH4 F;  2P6T A;  2P5L C;  1MDM B;  3LQQ A;  1Z7U A;  1JGS A;  4YIF A;  3ZQ7 A;  1HW1 A;  4M74 A;  2VC0 A;  3RKX A;  2VXZ A;  2CO5 A;  4G7Z F;  3PQJ A;  3EYI A;  2H94 A;  4A5M A;  1ON1 A;  4DQ2 A;  3P9C A;  4LB6 B;  3N4M A;  1UHM A;  1LVA A;  3VEP A;  2ESN A;  5FFZ A;  4BQA A;  3J81 Z;  2QZ8 A;  1FY7 A;  3FM5 A;  3GEZ A;  5D8K B;  1F4K A;  2EFW A;  3K1P A;  5DUI A;  1U2W A;  4MQV A;  1J9I A;  2WTE A;  1CGP A;  4Q47 A;  3QU3 A;  2JZY A;  3NRV A;  2O3F A;  2QQ9 A;  4CXF A;  1LEB A;  4BH9 A;  2MLG A;  2XKO A;  1DPU A;  1BJA A;  5ERI A;  2P5K A;  3SZP A;  4GYI A;  4U0Y A;  3JTH A;  2R7F A;  3ZN1 A;  4Q4Z F;  3V7R A;  4HQM A;  2L54 A;  3GVA A;  3KZY A;  4OIO F;  3BJ6 A;  1Z6R A;  2FXA A;  3DF8 A;  4YFK F;  1OPC A;  2H6C A;  2VBZ A;  2F5F A;  5L3D A;  3WTX C;  3IWF A;  1U6G A;  5K5Q A;  2OQG A;  4KN4 X;  3QP6 A;  5D5V B;  4ON0 A;  3ZMD A;  4ZYG A;  4R79 A;  1ZRF A;  1PP8 F;  4IHS A;  2BV6 A;  3JSP A;  5LEJ A;  1LQ1 A;  4AIH A;  4Q5S F;  5HLI A;  4WK8 F;  2HWV A;  1UFM A;  5LLQ A;  2UWM A;  4HQE A;  3OOP A;  4GXO A;  1FT9 A;  4RGU A;  3K1N A;  2VON A;  4N9I A;  3VB2 A;  1G3Y A;  5HLG A;  2O61 A;  1BBY A;  3HSE A;  5HDK A;  2IT0 A;  1R36 A;  3F8M A;  2BYV E;  5CVI A;  2V1U A;  3O3K A;  1SFU A;  2MLK A;  2OAZ A;  2VBW A;  4EMS A;  2A6H F;  2EB7 A;  4FX0 A;  1REP C;  5CJ9 A;  5AIP A;  3TDU C;  4FT8 A;  3BPX A;  3GF2 A;  3DFG A;  3BY6 A;  1MJA A;  1Z91 A;  1IN6 A;  2FML A;  2NS0 A;  1YIO A;  4HBL A;  1YW9 A;  3O2P E;  2CFX A;  5EEH A;  3I58 A;  4HLY A;  2KIM A;  1ZGJ A;  3GFL A;  3L09 A;  1TW3 A;  2MD5 A;  1NHA A;  3JTG A;  4NHJ A;  2IRF G;  2F2E A;  4MTD A;  3TKY A;  2QBY B;  3IRQ A;  4ZYH A;  2BEO A;  1FP1 D;  3Q9V A;  4CZZ A;  1XMA A;  2HFH A;  1H9G A;  2VE8 A;  4WXC A;  2IPQ X;  4MQ9 F;  2DAO A;  2EFN A;  4CGZ A;  2KKO A;  4LLG F;  2PEX A;  5D6F A;  2QBY A;  2IP2 A;  3CJN A;  1V4R A;  5H6Q A;  1DUX C;  2DPD A;  5HDG A;  2CWE A;  2M45 A;  3I0T A;  1KU3 A;  4MEY F;  5E20 A;  1EV7 A;  1S7A A;  5KK1 A;  3F22 A;  2DPU A;  3R4K A;  1BI3 A;  2GA1 A;  4JK1 X;  3U9G A;  2JT1 A;  4IRG A;  4XRF A;  2VBX A;  4OIP F;  4I7H A;  2IA2 A;  4GYG A;  3N97 A;  4LB5 A;  2QVO A;  3IKV A;  5AIQ A;  1AOY A;  3G73 A;  3E6C C;  5DCM A;  2GWR A;  1FOK A;  2A61 A;  1O3S A;  1T0F A;  2GZW A;  2DQL A;  3W6J B;  4ZZD A;  4BYY A;  4KFC A;  2XAF A;  2ISY A;  2IA0 A;  2RVC A;  2EV6 A;  2HQR A;  1KQ9 A;  4XSZ F;  3SQN A;  4EM0 B;  4WX9 A;  2A07 F;  1R00 A;  5HOO A;  2ELH A;  3E5Q A;  1TQM A;  1QBJ A;  5E8G A;  1ZN2 A;  3KFW X;  5D4S A;  3BOQ A;  2ZFW A;  3R61 A;  4O3M A;  4UV9 A;  4RS8 A;  1IXC A;  4IPA A;  4D0P A;  1H0M A;  2GQQ A;  3Q9S A;  2IJL A;  3I4P A;  5ICC A;  5D5U B;  2MBF A;  3LST A;  3ZN0 A;  4XSX F;  2OU2 A;  1RI7 A;  3SFZ A;  1HQC A;  4YG2 F;  1YLF A;  3E97 A;  1R1V A;  1ZLJ A;  2J5P A;  2XVC A;  3M8F A;  1BC7 C;  3VOD A;  1OKR A;  2LF7 A;  3WGH A;  1FYL A;  3F6O A;  1YG2 A;  4CHU A;  2OQR A;  2MA3 A;  1MGT A;  2HS5 A;  1U3E M;  3FXR A;  2FRH A;  1IUY A;  1O7L A;  1LEA A;  2VT2 A;  1TQI A;  3LAP A;  3QAH A;  1IF1 A;  3WGG A;  3WTW C;  1TBX A;  4L5I A;  2WV0 A;  1YS6 A;  1QNT A;  3IL2 A;  2C6Y A;  2K27 A;  4ESJ A;  4MGR A;  4KIB A;  2G7U A;  5CYV A;  5EEG A;  1L3L A;  5HLH A;  3IC7 A;  5KVR A;  1CF7 B;  4KUM A;  1R23 A;  3F6V A;  3CUQ C;  1T2K A;  1FSH A;  2Y75 A;  4P96 A;  2Q8K A;  3E6D A;  2FE3 A;  1IRF A;  1P4W A;  3ZMS A;  1S3J A;  5DD8 A;  1IRG A;  2EFQ A;  4L9N A;  5DDG A;  2P6S A;  3K1M A;  1U5T A;  2HOE A;  3ERE D;  3L9F A;  5IT9 Z;  1OR7 A;  4LG0 B;  1CF7 A;  3MZY A;  1FP2 A;  1Z9C A;  2L01 A;  2IW5 A;  4EGY A;  3T5X A;  5A2Q Z;  4WXH A;  5DEQ A;  2V79 A;  4OOI A;  3T8R A;  2K7L A;  3F3X A;  1S7O A;  3G3Z A;  2PQ8 A;  1IAW A;  3RTR A;  5JVT A;  4LGW A;  3BJO A;  3E6B A;  2PN6 A;  4LG0 A;  1KU2 A;  2DFI A;  2GIV A;  4HF2 A;  2XAS A;  4UUV A;  4ZYE A;  2G9W A;  1RZ4 A;  4U7D A;  1LJ9 A;  4MHG A;  4HDV A;  1I5Z A;  4ENK A;  1I1S A;  3GLX A;  4HA8 A;  3C18 A;  1IXR C;  1I27 A;  1FWZ A;  4ESF A;  4RAY A;  2FEZ A;  1HKQ A;  1YS7 A;  3L7W A;  2BE5 F;  4LD5 A;  2A6E F;  4IJA A;  1HSJ A;  2GAU A;  4LK1 F;  3FZV A;  1J2X A;  2LSO A;  2ZXJ A;  4EVI A;  2HQN A;  5BOX A;  4WCG A;  2D1H A;  2JPC A;  3WE3 A;  4YFN F;  3RKY A;  1Z6T A;  4O6J A;  4AWX B;  3BDD A;  5DCF A;  1GXP A;  1B9N A;  4LLL A;  1E17 A;  4BHP A;  2DTR A;  3PQK A;  3T0Y A;  3FWE A;  1B4A A;  2EK5 A;  4DNC A;  2V1X A;  1MD0 A;  3WU1 B;  4NB5 A;  5L3E A;  3U1D A;  3JAM Z;  3M8E A;  4KDP A;  5LRS A;  1HW5 A;  4I2O A;  3J81 K;  4ZYD A;  4E70 A;  3QPH A;  1G3T A;  5E1Z B;  5FLX Z;  5E1X A;  1UHW A;  4JQF A;  2RGV A;  1SMY F;  1VTN C;  4KMF A;  3TDZ C;  2EWN A;  3CTA A;  2L02 A;  1R7J A;  3OV8 A;  1MDM A;  3MEX A;  5K5R A;  3P7N A;  2ZO4 A;  3KLN A;  2PG4 A;  2F5E A;  1BI1 A;  4OMZ A;  2O8X A;  3FF5 A;  1FYK A;  2JTV A;  2Z33 A;  2YX4 A;  3TO6 A;  3K69 A;  1QGP A;  3WE2 A;  3HRS A;  2YX7 A;  4ENM A;  1YO5 C;  4UXN A;  3ABU A;  1A04 A;  2R7D A;  2M87 A;  4HX7 A;  1OYW A;  2M8E A;  5DYM A;  4IHT A;  2NYX A;  3ECH A;  2CSO A;  2K4B A;  5DD4 A;  3R0A A;  3Q5F A;  5LHI A;  1K7A A;  2VOO A;  2XHK A;  3ZMT A;  2CQK A;  3MCZ A;  2PBI A;  5L3B A;  5ICF A;  2QWW A;  3V7C A;  4MEX F;  5L3F A;  2KIF A;  3GFJ A;  2FBH A;  4IXA A;  4HV6 A;  2HYG D;  2HYF A;  3ECO A;  4HOB A;  3F23 A;  2E7W A;  3RPQ A;  2VE9 A;  3ML6 A;  3C3W A;  1W7P D;  3I59 B;  2L3D A;  3I5U A;  4LLN A;  1E2X A;  3WG9 A;  4L9J A;  1G6N A;  2LKP A;  1GXQ A;  3L2C A;  2A68 F;  4KIG A;  4U0W A;  2ADU A;  2HEO A;  2VOP A;  5LRR A;  3FMQ A;  2LF8 A;  2F5C A;  4XBF A;  2UXN A;  3TGN A;  4I02 A;  2XAJ A;  3I59 A;  5E8I A;  4N9H A;  4XLP F;  4XLN F;  3RYP A;  2AXL A;  3MAJ A;  5D8L B;  3FX3 A;  1XDS A;  3HSF A;  3J80 Z;  4PGH A;  1HW2 A;  2P7V B;  4GCV A;  4RB3 C;  4OIR F;  4RB2 C;  4FX4 A;  2A3S A;  4HAM A;  5TRD A;  1LB2 A;  3KP7 A;  2ETH A;  4OIN F;  4AD9 A;  2EFO A;  1WQ2 A;  2DLL A;  2XAG A;  2GXB A;  2L4A A;  4G6Q A;  5JHU A;  4PZJ A;  1ZRC A;  5FGM A;  3T8T A;  1IZ1 A;  1FBS A;  2KJB A;  4R8H A;  5LGN A;  1SD6 A;  1PP7 U;  4JBA A;  3TOA A;  4M6Y A;  5HVQ C;  1L0O C;  5BMZ A;  1O57 A;  3WU0 A;  4AIJ A;  3EYY A;  4U88 A;  3HRM A;  1AWC A;  3ZMU A;  4AIK A;  1I1G A;  3D0S A;  4A12 A;  1TTY A;  1MJB A;  2MC3 A;  4I09 A;  3BRO A;  5DV5 A;  3CDH A;  3WTT C;  1MZB A;  5D5W B;  1XD7 A;  2O03 A;  4Z2Y A;  3KE2 A;  2BGC A;  3ABT A;  2L4M A;  3QRF F;  2RN7 A;  1B1B A;  3FM3 A;  4RAZ A;  3JW4 A;  3CO7 C;  1XMK A;  4L18 B;  1RUO A;  5L3G A;  1D8J A;  2RNJ A;  1R1T A;  2PI0 A;  1KQ0 A;  4RB0 A;  2RC4 A;  1YQA A;  5CVJ A;  3DKW A;  2FBI A;  3E5X A;  4P9U A;  5H20 A;  3SXY A;  1O3T A;  2DT5 A;  5K1Y A;  2Z9O A;  4BNC A;  1JHH A;  3I71 A;  1O3R A;  3ZPL A;  4WF2 A;  2DBB A;  1T98 A;  5F1R A;  2D1V A;  2QQA A;  3PFI A;  4HX4 A;  4IRH A;  3CUO A;  5CLS A;  5HDN A;  3MQ0 A;  3SHF A;  2O0Y A;  1HBX G;  3KP6 A;  5J8F A;  1XCV A;  4PDK A;  2JSC A;  4I0B A;  1TLH B;  1U8R A;  3WTS C;  3LAJ A;  1R5H A;  2XRO A;  1TNT A;  2ZNZ A;  1D8K A;  4KA4 A;  3GYH X;  4MNU A;  3J7A O;  2LNB A;  2P7C B;  2FSW A;  5K5O A;  1O3Q A;  1G4D A;  3HUG A;  2D2W A;  4S05 A;  4A6D A;  2NNY A;  2FQ3 A;  2YU3 A;  2DI3 A;  1Z1D A;  3RYR A;  2E1N A;  1GVJ A;  1TW2 A;  4ESB A;  1FPQ A;  4TV7 A;  2QUF A;  1KA8 A;  3GZ6 A;  2QEN A;  1IN7 A;  2B0L A;  3KP2 A;  1ULY A;  1BIB A;  2CYY A;  1FZP B;  1S29 A;  2BBY A;  5J8C A;  2EV5 A;  2M30 A;  3V7S A;  1ONV A;  4H0E A;  4EM2 A;  1BN5 A;  1U78 A;  2H09 A;  2HTJ A;  4LK0 F;  2Q0O A;  2Y48 A;  3FXQ A;  1D3Y A;  3DPT A;  1R1U A;  2EFP A;  2X4H A;  4RGS A;  1D5V A;  4U0V A;  5AON A;  5HS8 A;  2PJP A;  3REO A;  1FNN A;  3R0J A;  1U5T C;  3GWZ A;  1P92 A;  4KIF A;  3BWG A;  3T1B A;  4K2E A;  3GX4 X;  5FD5 A;  2FU4 A;  4A2U A;  5IT9 K;  1F9N A;  3QU6 A;  2AS5 F;  1P6R A;  3K9T A;  1QQI A;  3DPL C;  2KRF A;  4KIC A;  4ENN A;  3O6B B;  2DU9 A;  4BHC A;  2CGP A;  5ED4 A;  2RDP A;  1SMT A;  2ZNY A;  3LQR A;  4CDG A;  5A2Q K;  3DQV C;  3LA2 A;  3ROU A;  3HOS A;  1QZY A;  4HZF A;  1UB9 A;  2GXG A;  3FXU A;  1B9M A;  1JE8 A;  4G6D A;  3P9I A;  1HST A;  4Y17 A;  4QWQ A;  1FC3 A;  1OYI A;  1X3U A;  5LGT A;  2YPR A;  1B59 A;  2NAZ A;  4A0Y A;  3F8F A;  2QM3 A;  2D45 A;  4IRI A;  3F8B A;  2PLY A;  2IA1 A;  4OMY A;  3B02 A;  5F64 A;  1PDN C;  1XGO A;  2PMH A;  2O6G E;  1UST A;  1XSD A;  2W57 A;  3BP8 A;  1W5S A;  4UVB A;  1JXS A;  4HX8 A;  5FB2 A;  4HDU A;  5CVV A;  2FNP A;  1BI2 A;  1FBQ A;  4UVA A;  2VC1 A;  2FMY A;  4CIC A;  4EGZ A;  2ZBK A;  3KET A;  2EJR A;  2HZT A;  4RGR A;  3QPT A;  5F6F A;  2EA2 A;  3JAM K;  2K02 A;  2DQR A;  2RV8 A;  3F8C A;  4A0X A;  2UXX A;  5LEK A;  2DK8 A;  1KU9 A;  1S8N A;  2QYO A;  5BS6 A;  3E5U A;  2OD5 A;  1IN4 A;  2ESH A;  1LDJ A;  5FLX K;  1BM9 A;  1ZAR A;  2A5Y B;  2GA2 A;  3B73 A;  1P4A A;  1YW8 A;  2FA5 A;  1ZYR F;  2Q2E A;  2OZ6 A;  3MFK A;  4M71 A;  4BAY A;  1J0R A;  3NQO A;  2FOK A;  3LA7 A;  3P9K A;  3GZ5 A;  5FFX A;  3WTZ A;  5HS9 A;  2IVM A;  1HXD A;  3FMS A;  5CVU A;  4U7B A;  3WTV C;  2E1C A;  1USS A;  2M5W A;  1J75 A;  4P5O A;  2STW A;  1F1Z A;  1XSX A;  3WTY C;  1EH7 A;  3ZMZ A;  1KGS A;  2HR3 A;  2XV4 S;  4S04 A;  5FO5 A;  1ON2 A;  4A0Z A;  4LMY A;  2Z3Y A;  2HKO A;  2V9V A;  3RJP A;  1WRJ A;  4O5V A;  1TNS A;  1W4M A;  1DDN A;  1G3W A;  1ZGA A;  4RGX A;  4L0Y B;  2XUB A;  1IN5 A;  1BI0 A;  4EJV A;  4I98 B;  1B6A A;  3BJA A;  3IWZ A;  5LHG A;  3S2W A;  3HYI A;  3MWM A;  5LHH A;  2FF4 A;  2HKX A;  3FHZ A;  3GUD A;  3LFK A;  4UNO A;  2OA4 A;  2HTS A;  1K79 A;  2YR2 A;  2H27 A;  2G7H A;  4EM1 A;  1YW7 A;  3EDP A;  3H3U A;  1SFX A;  1KYW A;  3EQL F;  4KYW A;  2ISZ A;  3KP4 A;  3K0L A;  4KN7 X;  3DP7 A;  4G7H F;  4M72 A;  1SAX A;  6PAX A;  3M9A A;  5IT3 A;  3IRR A;  4M9S A;  4BXU A;  3K2Z A;  4Q48 A;  2PMU A;  3WTU C;  3HHG A;  3CLO A;  2QQB A;  3KEQ A;  1G3S A;  3MZH A;  3AAF A;  3TQN A;  4UHT A;  3IHU A;  3J80 K;  3TO9 A;  3BZ6 A;  1WKM A;  3LWF A;  1DPR A;  1K78 B;  4IVN A;  4WWC A;  4GO1 A;  2XAQ A;  3KLO A;  1ZG3 A;  5JR3 A;  4PGG A;  2J5O A;  1TQP A;  4L9V A;  4YII A;  3HHH A;  5HS7 A;  1Y0U A;  1V3F A;  2VBY A;  1ZH5 A;  1FSE A;  1K78 A;  2CG4 A;  1SD5 A;  1ODD A;  1SD7 A;  4CYD A;  3W6K B;  1T6S A;  1QPM A;  2M1B A;  1XGS A;  1RUN A;  3E3V A;  1RIO H;  5ILV A;  3RDI A;  3HRU A;  1HKT A;  5J6X A;  3D5L A;  4P9F A;  3M1E A;  3HTU A;  4F7Z A;  2XKP A;  3CO6 C;  5LBQ A;  1JHF A;  3ISP A;  3KZZ A;  3R6S A;  4A5N A;  3HRT A;  5BPI A;  4ETS A;  1FYM A;  4HV5 A;  5D6E A;  4EQQ A;  5E18 F;  1R22 A;  3GFI A;  2KIU A;  4B8X A;  2HDC A;  2FNA A;  1ZG1 A;  3IKT A;  2K86 A;  1J5Y A;  4G94 A;  1WI9 A;  2Z99 A;  3I64 A;  3RI4 A;  2Z5U A;  4KMU X;  1MKM A;  2QLZ A;  1LDD A;  1ZHF A;  1BOA A;  5D5X B;  1ZLK A;  4BHB A;  5DUK A;  1XB4 A;  4HYE A;  3DV8 A;  2ZKZ A;  4M73 A;  3ELK A;  1F5T A;  1PUE E;  3C1D A;  2XIG A;  2MH2 A;  1T38 A;  4G8X A;  3DXJ F;  3F8N A;  4L9T A;  3WOD F;  3ULQ B;  5DCM B;  1GHC A;  2CW0 F;  3QOP A;  4I0A A;  1YTY A;  2NRA C;  5ILU A;  1FBU A;  4WXD A;  2XGX A;  1LNW A;  2VT3 A;  3C7J A;  4L0Z B;  2LDU A;  2MH9 A;  2WC2 A;  2KJC A;  1OMI A;  1BIA A;  1LDK B;  1YFH A;  2ACJ A;  2TDX A;  4HW0 A;  5FD6 A;  4MTE A;  3EET A;  3ZMV A;  5LGU A;  2OZU A;  2PFB A;  2F5D A;  4PCQ A;  4P55 A;  3KP5 A;  3BPV A;  4Y15 A;  5H6R A;  1KYZ A;  3HTS B;  1YYV A;  4FHT A;  3V4G A;  2DO7 A;  3JSO A;  1SFE A;  5E17 F;  2ZCW A;  4G7O F;  1KQ8 A;  4IF4 A;  4GGG A;  4CO8 A;  3KP3 A;  3QP5 A;  4EJU A;  1XGM A;  1W7P B;  2P4W A;  1H9T A;  2DK5 A;  4KT5 C;  2DW4 A;  2NNN A;  5D4R A;  1QZZ A;  1RNL A;  4EV0 A;  4M9X A;  2JRT A;  1IW7 F;  3HOT A;  2HGC A;  4LJZ F;  1XSV A;  3RIR A;  1MJ9 A;  3ZP5 A;  4EJO A;  1W7P A;  1O7F A;  2COM A;  3RKW A;  2Y0M A;  3SZT A;  2WWY A;  3TO7 A;  1EH6 A;  1C0W A;  3KCC A;  2JPB A;  2X0L A;  4M6X A;  4ENJ A;  1Q1H A;  2XAH A;  3WGI A;  3COA C;  1KU7 A;  4G9Y A;  3GO5 A;  1T39 A;  2H6B A;  3F21 A;  1UCR A;  4A6E A;  1SD4 A;  5CVR A;  1QO0 D;  4NQW A;  2P5V A;  1I6X A;  2V1D A;  2STT A;  2FBK A;  2K4J A;  3GXO A;  5BPD A;  5L3C A;  1U5T B;  4OIQ F;  4Y13 A;  4YFX F;  2VOD A;  4HF0 A;  2OBP A;  3TOB A;  3KEO A;  2P8T A;  4ASN A;  1XCB A;  4B09 A;  3CUQ B;  2RQP A;  3L00 A;  3M7G A;  3RPU A;  2W25 A;  2ZME B;  5E1W A;  3R60 A;  3HIF A;  3LA3 A;  2E7X A;  1FLI A;  3F72 A;  1ZAO A;  3V8L A;  1WSU A;  2XRN A;  3FMR A;  1XGN A;  4M9Z A;  3CUQ A;  4KNY A;  4QLC U;  5JI6 A;  3V8J A;  2EA4 A;  2ZME A;  5BQT A;  1WWX A;  1Z05 A;  4ZZL A;  4LFU A;  4R1H A;  1R5G A;  1ZRD A;  3HSR A;  1HKS A;  1P2F A;  3EUH A;  1R58 A;  3NEU A;  5ICG A;  2V6C A;  1ZRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...