3RI4A

Ets1 cooperative binding to widely separated sites on promoter dna
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
136
structure length
136
Chain Sequence
GTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of ets1 cooperative binding to widely separated sites on promoter DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords Protein C-ets-1
total genus 46
structure length 136
sequence length 136
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ri4A00
1QQIA 3J81Z 3FXRA 2GIVA 3L2CA 1IN6A 2NAZA 4KA4A 3ABUA 3GLXA 1S29A 1FYMA 2MA3A 4A0XA 1Y0UA 2GZWA 1TQPA 2XGXA 1SAXA 3DFGA 3RYRA 4L9TA 2ACJA 2HS5A 1MJAA 4MEXF 1MZBA 4NHJA 5BMZA 5ICFA 5IT9K 3C3WA 5H6RA 1U6GA 5HOOA 4KNYA 3ZMTA 2A61A 4MQVA 2G7UA 1BJAA 3HTSB 5BPIA 2XASA 1LVAA 2M8EA 2C6YA 1TQMA 1IXSB 2QVOA 4R8HA 1R00A 2PG4A 4A0YA 4FT8A 4ESJA 5K5OA 5BQTA 1B9MA 4EVIA 2FSWA 1T39A 4Y17A 1U78A 2VONA 3K1NA 3P9CA 3EUHA 1HW5A 4EQQA 4BAYA 3NRVA 4BH9A 2STWA 5FLXK 2HTSA 2Z99A 4G7HF 2RN7A 3LFKA 1QZYA 2RDPA 2GA1A 3VB2A 2DO7A 2UXNA 1ZGAA 2RQPA 3BOQA 4L0YB 3ULQB 4IVNA 2L4AA 3K9TA 3EYIA 2QQAA 1ZRCA 3TO9A 3PFIA 2K86A 4UNOA 1WKMA 1P92A 3ECOA 1S7OA 4IF4A 1LEAA 2O3FA 4ON0A 3I58A 1XSDA 4RB2C 4GXOA 4P96A 2V6CA 1SMTA 2Q8KA 1TW2A 2D1VA 3V7SA 2QLZA 2EFNA 3JSPA 3TOBA 2P4WA 3ECHA 5DCMB 5LGTA 1BC8C 2HDCA 4UV9A 1ZLKA 5DYMA 2QQBA 1IN5A 4H0EA 2B0LA 2OA4A 3FM5A 1ZHFA 1J0RA 3SFZA 5D6EA 2DLLA 1YW7A 1B4AA 5EEGA 5L3FA 1RUOA 2QUFA 1BBYA 3BJOA 3IC7A 1H9TA 3I5UA 1IW7F 2NYXA 4OMYA 3F22A 5HS9A 5E18F 2MBFA 2WC2A 3SXYA 1HKSA 2ELHA 2KIMA 4LK0F 1BI1A 3R0JA 2VBWA 3U1DA 2JZYA 1OYIA 4U0VA 1J9IA 4EM1A 2STTA 1B59A 2Y48A 3F6VA 4O3MA 2YX4A 1JHFA 1FSHA 1OR7A 4EGYA 1OPCA 1D8KA 4DQ2A 2PBIA 5BPDA 2EFQA 3ZMVA 1J7KA 2QYOA 1I5ZA 2NRAC 3JSOA 2M1BA 2K7LA 5L3GA 3LA3A 1O3SA 1XGMA 4OIPF 3EYYA 1DPRA 1KYZA 1YIOA 2GA2A 3QP6A 1ZG1A 3V8KA 1PDNC 4U0WA 4A0ZA 5ED4A 2EFPA 2A5YB 2FMYA 3RTRA 3J81K 4M9SA 3TDUC 3J80K 3H92A 3KFWX 1EH7A 2Z3YA 2MH9A 3BWGA 3TQNA 3HSEA 2XAFA 1XD7A 2MLKA 3R61A 2JT1A 2FXAA 3KZYA 5DCFA 1ULYA 4GO1A 2A07F 2IJLA 2DI3A 1E2XA 3RKWA 4U7DA 3KZZA 3HRSA 1G6NA 4KYWA 3WTYC 1IXCA 3QU6A 2VODA 3F72A 3K1PA 1KU9A 3T0YA 5JR3A 1DDNA 4KMUX 1XSVA 2DW4A 2CSOA 1AWCA 3F8FA 4S04A 3K2ZA 4UXNA 3L00A 2OZUA 5LRSA 4CDGA 1FBSA 1I27A 4QWQA 2DBBA 5D5WB 2BEOA 5DD8A 2KRFA 5JFRA 2K4JA 3I59B 3WE3A 1YW9A 5CVRA 2E1CA 1OMIA 1SFXA 1YQAA 4HX7A 2O0YA 1RNLA 5BOXA 4G6DA 2LF8A 2RKHA 5LHHA 4KIBA 2CW0F 2CO5A 2XKOA 4HZFA 2X4HA 4BHCA 1W4MA 4L9VA 2IT0A 3WTVC 2ZNZA 2GXGA 1WWXA 3C18A 3QP5A 1SFEA 4JQFA 4UVAA 2QBYB 2DTRA 4O6JA 3TGNA 4HX4A 4Q48A 3T1BA 1F1ZA 3F6OA 3P9KA 3SHFA 4ENNA 3VOEA 1KU7A 3BY6A 2J5PA 4HQMA 4RB0A 5CVJA 4B8XA 3TO6A 3H3ZA 4M74A 4M6XA 1FWZA 1JHHA 4HAMA 3CJNA 3CDHA 1V4RA 2DQRA 3DEUA 1ZYRF 2CG4A 1O7FA 1J5YA 4ZH4F 4JBAA 2IPQX 3NQOA 1HQCA 2XHKA 4RB1A 2FNPA 2HR3A 4IRHA 1STZA 1MJ9A 4ZYEA 5D8KB 3B02A 4OIRF 2V79A 4A5MA 3F8BA 2W25A 1SMYF 3ABTA 3K0LA 2G7HA 4NB5A 1EH6A 3WU1B 4EMSA 3REOA 3TDZC 3GUDA 5D5VB 2KJCA 4KN7X 3BP8A 1HXDA 3GFIA 1REPC 1C0WA 2XUBA 3Q5FA 1YS7A 1O57A 2DFIA 2OAZA 2Q2EA 1G3YA 3ZMSA 2ISZA 1JXSA 4RB3C 2VC0A 1BM9A 3RKXA 1BIBA 1DP7P 3FMQA 2WV0A 3JAMZ 3ELKA 3I64A 1XDSA 4RGXA 4I0AA 3K1MA 3ZP5A 1YG2A 3QU3A 1OYYA 1HKQA 3ROUA 5DV5A 3BPVA 1O7LA 1GXPA 2OD5A 1TNTA 1XMAA 5ILVA 2F5DA 1QO0D 2RNJA 3HYIA 4FX0A 1K6OA 3DKWA 4IHSA 3LA7A 2MD5A 4Y13A 5HLHA 3V4GA 1U2WA 1EH8A 2JTVA 3ZN1A 4ENMA 1KQ0A 2RGVA 2O8XA 3T8RA 3IRRA 1PP8F 1ON1A 4PZJA 1H0MA 2V9VA 1QGPA 5ILUA 4HF2A 2A69F 4KIGA 1TTYA 2EJRA 3VFZA 2Z5UA 1Z91A 3ZN0A 1KQ9A 1MD0A 4MTDA 1RIOH 4WK8F 4MEYF 2R7FA 2PI0A 4NQWA 3G3ZA 4P5OA 2E7XA 4KMFA 4YG2F 1CGPA 3I53A 4LD5A 3GO5A 2L02A 3GFLA 4E70A 2EB7A 1O3QA 3RI4A 4HF1A 1W7PA 1FLIA 2E1NA 4L5IA 2OQGA 1KYWA 2ETHA 1E17A 1FP1D 3CLOA 2VT3A 1Z7UA 5F6FA 3MZHA 4AIHA 2PEXA 1KA8A 4RGUA 4AWXB 5K5QA 1TBXA 2A6EF 1K78B 5CVIA 1XCVA 1FX7A 1IRFA 3E3VA 1R1VA 3SZPA 1SFUA 3BROA 1IN7A 4B09A 2K4BA 3FXQA 1S6LA 1S8NA 4YFXF 3E5QA 3E6BA 5HS7A 4PDKA 5HDNA 2P6SA 4OIOF 4G7OF 5LLQA 3KP6A 3RDIA 2IA2A 4N9IA 4XRFA 2K27A 1RI7A 4WXHA 3BZ6A 4XBFA 4UV8A 5FLXZ 2M87A 2UXXA 2OBPA 4I2OA 3BJAA 3DP7A 4IXAA 4IRIA 2EWNA 3R0AA 5FFZA 2JRTA 3I59A 3GX4X 1ZREA 2R7DA 3OV8A 1Z6TA 1R36A 1ZH5A 1ZG3A 3HHGA 2ZMEB 2P7VB 2FBKA 2YX7A 2NNNA 4HF0A 5J8FA 2W84A 1O3RA 2HYGD 2Z33A 2MH2A 3WGGA 1HKTA 2D45A 1F5TA 3Q9VA 3M1EA 5L3BA 1U5TB 1Q1HA 2HFHA 2BBYA 4S05A 4Q4ZF 2CQKA 1LDDA 4M9XA 1ZN2A 2W57A 1S3JA 4F7ZA 2ZKZA 3NEUA 1H9GA 2MLGA 4JK1X 3HHHA 3WTUC 2UZKA 5DUIA 3GWZA 4LG0A 3WTSC 4A6EA 2CWEA 2WTEA 2BE5F 5L3EA 2V1DA 3N97A 4AIKA 3TKYA 2XKPA 1O3TA 1L3LA 5J6XA 4ZYHA 2IA1A 1BI3A 3L7WA 4FHTA 1LDJA 2HQNA 4CO8A 4AIJA 3KCCA 3O2PE 5D4SA 1I1SA 1BIAA 2ZJ2A 2XAQA 1UCRA 5FB2A 3DPTA 1FYLA 4ENJA 1ONVA 3V7CA 2PN6A 3LAPA 5JHUA 1SD5A 1BI2A 2JPBA 3TOAA 5IT3A 4KDPA 2H6CA 2O61A 2ADUA 4HBLA 2VN2A 1KU3A 1ZAOA 3G73A 2PFBA 2CYYA 4P9UA 3J7AO 2D1HA 1FNNA 1ZLJA 3GW2A 3FMRA 2ESHA 1W7PD 1KU2A 1Z05A 1T38A 3TO7A 5AIPA 1IXRC 6PAXA 1XDUA 4GYIA 4LB6B 4PGHA 2XIGA 2FU4A 1KQ8A 2LDUA 4YIFA 3WTWC 3V8LA 4HV6A 3FXUA 3MAJA 2YSRA 3AAFA 2J5OA 4LB5A 3J80Z 1Z9CA 4M72A 2D2WA 2F5FA 2GAUA 5FGMA 4MQ9F 3WU0A 4GGGA 4AD9A 3QAHA 4LLNA 5JI6A 5BS6A 1MJBA 1WQ2A 1HBXG 3E5XA 2QENA 2W85A 5H20A 3JTHA 3FHZA 2GWRA 5F64A 2DPDA 3S2WA 3R4KA 2RV8A 4RGSA 3ZMZA 1USTA 1QNTA 1U3EM 2EV6A 3BJ6A 2EA2A 3MQ0A 2AS5F 3K69A 4UVCA 2HZTA 3LQRA 1IF1A 4EGZA 5LEKA 3P9IA 5ICCA 3I71A 2H09A 1G3WA 4CGZA 5FFXA 2BYVE 1CF7A 2L01A 4Y15A 3DXJF 1G4DA 3GEZA 2VE9A 4CXFA 1LB2A 2V1UA 4HDVA 2EV0A 4P55A 1TNSA 4I09A 3I0TA 1IAWA 3JAMK 4BXUA 4L9JA 1P4WA 3RKYA 4BYYA 4A6DA 5JVTA 3WTTC 3T5XA 4GCVA 4EM0B 1TLHB 4KT5C 5ICGA 5IT9Z 4EJWA 4U88A 1L0OC 2ZXJA 3FX3A 3H3UA 2W24A 2HQRA 2IRFG 2HKXA 3C1DA 1HW2A 1TW3A 2KKOA 4G6QA 4KUMA 1MDMA 3RPQA 1EV7A 2O03A 1YFHA 2DK5A 1ZRFA 1B6AA 1QPMA 1ZG5A 1QZZA 2VBZA 4L0ZB 3MZYA 2IVMA 4CZZA 5TJJA 3WODF 3O6BB 3RJPA 2M5WA 5L3CA 1FBQA 2EK5A 5KK1A 1R5HA 4WX9A 1MGTA 3WGHA 3WGIA 4ZYDA 1FC3A 2HTJA 2VBXA 2A6HF 4YFNF 1R22A 3BPXA 1ZRDA 3C7JA 3OOPA 4M71A 4N9HA 4EJUA 1J59A 5DCMA 3LWFA 4EM2A 3HUGA 1XMKA 1USSA 4GYGA 1HW1A 3GFMA 1IN4A 2FOKA 5HLIA 4Q47A 3GVAA 2CFXA 1I6XA 3U9GA 4ZZDA 3KP3A 1Z6RA 4FX4A 4L18B 2HOEA 1D5VA 4A12A 2H6BA 4YFKF 3KP4A 3HSFA 5LHIA 2PQ8A 2COMA 5AIQA 2QBYA 3HOSA 3GFJA 4G8XA 1F9NA 4PGGA 4OOIA 2QWWA 2VOOA 4L9NA 5ILSA 2XROA 3L09A 4ESFA 4LMYA 2VC1A 5DUKA 2ZFWA 3IWZA 2X0LA 4ZYGA 4N0BA 3CUOA 1R58A 2DK8A 3ML6A 3CUQA 3DV8A 1UHMA 5F1RA 4RAZA 4ENKA 5CVUA 1BN5A 2P5KA 4WF2A 4EJTA 2DU9A 3RYPA 3I4PA 1GXQA 4HW0A 2HWVA 1LDKB 1YLFA 2L4MA 3KP7A 3QPTA 3U2RA 3IL2A 4WCGA 3KETA 4LLLA 1YW8A 3T8TA 4LG0B 1T98A 4MHGA 3VEPA 2UWMA 3WG9A 1IZ1A 1WI9A 1XSXA 5HS8A 3V7RA 3V8JA 1Z1DA 2L54A 2XAGA 3HRMA 2QM3A 1YYVA 2JPCA 2FBHA 3LSTA 2KIUA 3LA2A 1R1UA 4XLPF 1B1BA 2M30A 1IN8A 2OZ6A 2GXBA 4OIQF 2CGPA 2OU2A 4LK1F 1MKMA 4D0PA 3IWFA 1NHAA 1T0FA 3RIRA 1FYKA 4O5VA 5FD6A 1D8JA 2KIFA 4HX8A 1WSUA 5K5RA 1U8RA 3PQKA 3E6MA 2F5EA 2HEOA 2LNBA 3R60A 5E17F 5E1WA 1X3UA 5E8IA 2LKPA 4EJVA 4IRGA 3N4MA 4G9YA 1SD4A 2M45A 1LQ1A 2QQ9A 1J2XA 4M9ZA 2ESNA 5LGUA 3E6DA 1FZPB 2F5CA 2DAOA 4UHTA 2YPRA 3HSRA 1DPUA 2V1XA 5ERIA 3HIFA 3E97A 5D8LB 2RC4A 1UHWA 2FEZA 3E5UA 4KFCA 2XV4S 2VOPA 3F8MA 3MWMA 2H27A 5D5XB 2EFWA 3FMSA 1FPQA 2TDXA 3LQQA 2DPUA 4WXCA 2XVCA 4XLNF 1R5GA 2Y75A 3O3KA 2FRHA 2JSCA 2FNAA 3QPHA 3RPUA 3HOTA 4HQEA 3KLOA 4MGRA 4HA8A 3IHUA 3HTUA 4DNCA 4CHUA 5ICEA 2YR2A 1XB4A 3FM3A 2VXZA 2FBIA 1XGOA 5HVQC 3IRQA 3M8EA 4ETSA 4MTEA 3MCZA 3DF8A 2OQRA 1KGSA 5A2QZ 1G3TA 2P6TA 2QZ8A 1FP2A 5E8GA 3QRFF 1W5TA 4Q5SF 4ZZLA 3ZMDA 1T6SA 5TRDA 3KEOA 4AVPA 2ISYA 2KJBA 2P5LC 4BHPA 4A5NA 1XGNA 2HKOA 1BI0A 3ZQ7A 4L5JA 2FMLA 2A3SA 4IJAA 3P7NA 2Y0MA 3JTGA 2FA5A 5DDGA 1LNWA 4KIFA 4I98B 5AONA 2H94A 4I7HA 2P8TA 5KVRA 4UVBA 1P2FA 3CTAA 4HOBA 5HDGA 2EV5A 3W6JB 2RVCA 2FE3A 1ZGJA 5CYVA 1WRJA 3GYHX 4G7ZF 4HLXA 1TQIA 1FT9A 3Q9SA 5CLSA 1LJ9A 4RGRA 4R1HA 2R3SA 2XRNA 4OU0A 1SD7A 2HYFA 2F2EA 5K1YA 1V3FA 4ASNA 2ZNYA 1K78A 2IA0A 1GVJA 3EDPA 3FWEA 1K79A 3BDDA 5L3DA 5EEHA 1FY7A 1YTYA 5D5UB 4HDUA 1FOKA 2MC3A 3E6CC 5CVVA 2P5VA 3HRUA 2BV6A 5J8CA 3GZ5A 1W7PB 5HLGA 3M7GA 2VBYA 1D3YA 3MEXA 3W6KB 3F8CA 1AOYA 1HSTA 4HV5A 2WWYA 2FQ3A 2IP2A 4U7BA 2NS0A 2VE8A 1T2KA 4KICA 1ZARA 1UB9A 4CYDA 2L3DA 4R79A 3M8FA 1I1GA 4XSZF 1GHCA 1P4AA 5CJ9A 1SD6A 1FBUA 1F4KA 1G3SA 2NNYA 1DUXC 4WXDA 4OINF 2P7CB 1XCBA 4P9FA 3KP2A 4UUVA 5D4RA 1K7AA 3CO7C 1RUNA 5E20A 2ZO4A 3GF2A 3ERED 3LAJA 4RAYA 4IHTA 1ON2A 2FF4A 3F23A 3DQVC 2HGCA 4I01A 2IW5A 4CICA 1J75A 5DEQA 1B9NA 5LBQA 1JGSA 3WE2A 4M6YA 1U5TA 3GXOA 4HLYA 2E7WA 3MFKA 5LRRA 2K02A 3IKTA 3PQJA 3EQLF 1LEBA 1PP7U 1CF7B 3CUQC 3L9FA 1IRGA 5E1XA 5DD4A 2XAHA 1ODDA 1XN7A 4RS8A 2AXLA 1P4XA 1YO5C 1MDMB 2BGCA 4BNCA 5D6FA 2A68F 1A04A 4LLGF 5A2QK 3WTXC 4G94A 2O6GE 3CUQB 2PMHA 2LSOA 1PUEE 4K2EA 3ZMUA 2ZMEA 3WTZA 4PCQA 1HSJA 5LGNA 4BQAA 5LEJA 5HDKA 2XAJA 3R6SA 1R7JA 1YS6A 5FO5A 5H6QA 3F21A 4LJZF 4XSXF 4I0BA 2ZBKA 4U0YA 1R1TA 1OYWA 3F8NA 3KE2A 2PLYA 2PJPA 3D0SA 4LFUA 1IUYA 1P6RA 2GQQA 1OKRA 3D5LA 3EETA 4QLCU 3VODA 1BOAA 1BC7C 4I02A 2DQLA 1VTNC 1UFMA 4WWCA 2G9WA 5E1ZB 4TV7A 3ISPA 1S7AA 4EJOA 4Z2YA 1QBJA 3ZPLA 4IPAA 4LGWA 3HRTA 4ESBA 3FF5A 3SQNA 1U5TC 2YU3A 5LHGA 3CO6C 1FSEA 3M9AA 3QOPA 5FD5A 4A2UA 4EV0A 2VT2A 1JE8A 2LF7A 3GZ6A 2Z9OA 1W5SA 2Q0OA 1R23A 3KLNA 3I54A 4MNUA 1RZ4A 3B73A 2DT5A 4YIIA 3FZVA 4OMZA 4M73A 3KP5A 2PMUA 2EA4A 2ZCWA 2EFOA 3F3XA 3DPLC 1XGSA 3JW4A 3COAC 4HYEA 4KN4X 4BHBA 3KEQA 3SZTA 3IKVA
chains in the Genus database with same CATH superfamily
1QQIA 2B63J 3J81Z 3FXRA 1ORKA 4Y4RA 2GIVA 3L2CA 4B43A 1IN6A 2NAZA 4KA4A 2JUCA 3ABUA 3ZQHA 4DZPA 3GTPJ 3GLXA 1K4TA 1S29A 1QZEA 1FYMA 3FKIJ 2MA3A 3HOVJ 4A0XA 3ASOH 4E7JA 4AU7A 1Y0UA 2GZWA 2KMUA 1TQPA 3AG3H 2M7AA 3TMOA 3GZNB 3MVPA 1BW6A 2XGXA 1G2HA 1SAXA 3DFGA 3Q0UA 3S3OA 3RYRA 4DYRA 4QPQA 4L9TA 2V7FA 2Z2SB 2ACJA 4PSXA 2LMDA 3GCMA 2HS5A 3C2BA 1AA7A 1MJAA 3CMEI 4MEXF 1MZBA 4NHJA 5BMZA 5ICFA 4Z6YA 5IT9K 3C3WA 5H6RA 3DBRB 3C2GA 1ZR4A 4C3HJ 2NXNB 1U6GA 2R7QA 3CD6I 5HOOA 2IEKA 3ZMTA 1ETOA 1GT0C 4KNYA 2A61A 4MQVA 2HU9A 1YHQI 1T33A 4B3XA 2G7UA 1BJAA 3HTSB 4J19A 5BPIA 1VQNI 1QHHD 2XASA 1LVAA 5DS9A 2QSFX 2HVRA 2DODA 2VIXA 2M34A 2M8EA 4XM3A 4NBQA 5IP6A 2Z1DA 2C6YA 3S14J 1TQMA 1IXSB 2QVOA 2EIKH 4R8HA 3DKXA 1VQ7I 1R00A 2PG4A 4A0YA 4FT8A 4ESJA 4C3IJ 3CMYA 1PJRA 2X85A 5K5OA 3MKYB 5BQTA 1B9MA 2DCEA 4EVIA 4BQOA 2FSWA 1T39A 4Y17A 1LE8A 1U78A 4DOZA 2VONA 3K1NA 3P9CA 2JA7J 2CUEA 3EUHA 1HW5A 2BXZA 4BAYA 4EQQA 3DU6A 3NRVA 3DEWA 4BQNA 4BH9A 2KL4A 2STWA 5FLXK 1LFBA 1HF0A 1VQ6I 2HTSA 2Z99A 4JX6A 4G7HF 2RN7A 4F52A 1BR2A 3LFKA 4F92B 1V5GA 1QZYA 2RDPA 2GA1A 2E2IJ 3NWTA 2Y30A 2DO7A 3VB2A 1IRZA 2K3PA 2UXNA 1DQUA 1ZGAA 3VDXA 4BY7J 2RQPA 3BOQA 4E6KG 1ETQA 2ZFUA 4M3FA 5IP9J 4L0YB 3ULQB 4IVNA 2L4AA 3K9TA 1S7EA 2QQAA 2RAEA 1ZRCA 3EYIA 3K6GA 4A3KJ 1UG2A 1X2NA 3TO9A 3OR2C 1TWCJ 3PFIA 2K86A 1X1BA 3I3LA 4FASD 3L2RA 2JA5J 3EPZA 2QQ8A 3GLLA 4UNOA 3JRIA 1WKMA 3VYTB 1P92A 3H35A 4BJ6C 3ECOA 4BDZA 1FOYA 3PUFA 1ZGWA 3KEYA 1S7OA 1G59A 2L0KA 4IF4A 1LEAA 2O3FA 4ON0A 1S9HA 3I58A 3Q0VA 4D1QA 1VQOI 1ZQ3P 3S16J 1XSDA 4RB2C 4LITA 4GXOA 4P96A 3OIQA 2V6EA 4A3BJ 2V6CA 2BY3A 1SMTA 2Q8KA 1TW2A 2D1VA 2BW3A 3A01B 3V7SA 2M2EA 1HCRA 2QLZA 3J7YJ 2EFNA 3FKJA 3I4NJ 1V55H 2NS7A 3OOUA 1U9OA 4XICA 3JSPA 3TOBA 1Z77A 4KITB 2P4WA 5TISC 3ECHA 1AHDP 3S2HJ 5DCMB 5LGTA 3QWLA 1BC8C 2HDCA 3OWTA 1A35A 4UV9A 1ZLKA 1SVOA 5CQEA 5KAFC 2VL8A 1IDZA 3ABMH 5DYMA 2QQBA 1IN5A 1Y1VJ 4H0EA 1OCTC 2EPFA 5FLVA 2WAQA 3AG2H 3ABLH 2B0LA 2OA4A 2MW8A 3FM5A 3OYDA 3KPHA 1ZHFA 4JX5A 1SFOJ 4MO7A 2HVSA 1J0RA 2DT6A 3SFZA 3I56I 2OPTA 5D6EA 2DLLA 4BACA 1YW7A 3BG6A 2VKDA 4XLCA 1JJ8C 4UUSA 1VF9A 1B4AA 3BTLA 5EEGA 4FISA 3JRGA 5L3FA 2N8GA 1RUOA 2JUGA 2QUFA 3GTGJ 4IOAF 1X4OA 1BBYA 3BJOA 3IC7A 1H9TA 2MABA 3I5UA 1IW7F 1ZK8A 2NYXA 4OMYA 3F22A 2R7XA 5HS9A 5E18F 2MBFA 4N4NB 2QKLB 1R4NB 2WC2A 3CCMI 2QF7A 3SXYA 1HKSA 1YE9A 2ELHA 2KIMA 4LK0F 1BI1A 3R0JA 2VBWA 3U1DA 2JZYA 1OYIA 1FMVA 4U0VA 1J9IA 2E1OA 5KCMA 3G6EI 4EM1A 2STTA 1B59A 2FJ1A 2DMNA 3RCOA 2Y48A 3F6VA 3CCQI 4O3MA 2YX4A 5F0FA 1JHFA 1OJLA 1OR7A 4D5FA 5J1YA 1FSHA 4Y3OA 3S1NJ 3DEEA 2R7VA 4EGYA 1OPCA 1KZHA 4Y7NJ 1GV2A 1D8KA 2LOOA 1H88C 2Y9ZA 1IV6A 4DQ2A 2PBIA 5BPDA 1VQ4I 2DOEA 2EFQA 2HQAA 3LSIA 5F04A 3ZMVA 1J7KA 2ZSIB 2BOLA 2QYOA 1Z0XA 1I5ZA 2NRAC 3JSOA 3DKYA 4GRIA 3BCBA 2O7OA 2M1BA 2K7LA 1XX5A 5L3GA 2VUMJ 3LA3A 1O3SA 1XGMA 4OIPF 3EYYA 1DPRA 1KYZA 5F0CA 1MW7A 3FDYA 4M3EA 1DGWY 1YIOA 3CCUI 1U0JA 3L2WA 2GA2A 2M3AA 3QP6A 1ZG1A 3V8KA 5FRNA 3OIPA 1PDNC 4YELA 4U0WA 4A0ZA 5ED4A 2EFPA 2A5YB 1MBJA 2FMYA 3RTRA 3J81K 3U1KA 2KP6A 4M9SA 3TDUC 2L9VA 2DYRH 3J80K 2K5CA 3G71I 1QA6A 2EIMH 3H92A 1MIJA 3KFWX 1EH7A 2LR8A 4BBSJ 2Z3YA 2MH9A 2K9MA 2XRLA 3BWGA 3TQNA 3HSEA 1F36A 4PFPA 4DBRA 2XAFA 1MBKA 1XD7A 2MLKA 2COBA 3EUAA 3R61A 4X1EA 2JT1A 4XORA 1W5CC 2FXAA 3KZYA 5DCFA 1ULYA 4GO1A 1X1CA 2A07F 3ZR8X 1RPWA 2IJLA 4XLEA 3K70C 3FXLA 1E2XA 2DI3A 3RSNA 1E3PA 3B6AA 3RKWA 4U7DA 4P1WA 2X1EA 3KZZA 3DTIA 3HRSA 3QPSA 1G6NA 3BCAA 4KYWA 3A02A 2DA5A 1TWAJ 3WTYC 5F27A 1IXCA 3S1MJ 3QU6A 2A5WA 1AKHA 3M4OJ 2VODA 1OCPA 3F72A 4PUSA 3K1PA 2W82A 1KU9A 3T0YA 5JR3A 1DDNA 1IG7A 4KMUX 4A93J 1UG0A 1XSVA 2NOGA 2R4GA 2KISA 2DW4A 2CSOA 1AWCA 3CMAI 2YU9J 3F8FA 4S04A 3K2ZA 3OYKA 4UXNA 2CW8A 2F4OB 3L00A 2OZUA 1YRNA 5LRSA 4J00A 3TW7A 3F0CA 4CDGA 1FBSA 1I27A 4QWQA 3S1RJ 2DBBA 1D0ZA 5D5WB 2BEOA 5DD8A 2F48A 2KRFA 4RA2A 5JFRA 3OS2A 3E7LA 1Z3YA 2K4JA 3PO3J 1WGXA 2JVGA 3I59B 3WE3A 1MSEC 2VKVA 1YW9A 5CVRA 2E1CA 1OMIA 1SFXA 2B7EA 1GUUA 3FK6A 1YQAA 4HX7A 2LRDA 2O0YA 2DA3A 1RNLA 4XIDA 5F1JA 2M8GX 3DBHB 1MMDA 1X2MA 4ZTJA 2ZMEC 5BOXA 4G6DA 2LF8A 4NDLA 1WH7A 2RKHA 1W0TA 5LHHA 4KIBA 2CW0F 3ZXSA 2WB1A 2CO5A 4A69C 2XKOA 2JVHA 4HZFA 4IHXA 2X4HA 4BHCA 1W4MA 4L9VA 2IT0A 4BXFA 3WTVC 2ZNZA 1X58A 1LFUP 4AIDA 3M1CA 3ONQA 2GXGA 1WWXA 3C18A 1MMNA 2E5NA 3QP5A 1DU6A 3OYFA 3BG5A 4IQJA 2KFDA 1SFEA 1Z3XA 4JQFA 2OC6A 3AG4H 4UVAA 1W36D 5GP9A 3CC2I 2QBYB 2DTRA 2QCOA 2ZXIA 4O6JA 3MN2A 3B6CA 4W1UA 4FE4A 3TGNA 3VWBA 4HX4A 4Q48A 5BNGA 4A3LJ 3T1BA 2VASA 1F1ZA 3Q3SA 2DA2A 3AL0B 3F6OA 3P9KA 3SHFA 4ENNA 3VYUB 2UV1A 1JUMA 1N25A 3VOEA 1UHSA 2NS8A 3BY6A 2J5PA 4HEA2 1KU7A 4HQMA 4RB0A 1MBEA 5E3MA 5CVJA 4B8XA 2OTLI 2BW3B 2JA2A 2ZXHA 3TO6A 3KYLA 1OR7C 3H3ZA 4M74A 2CH0A 4M6XA 2D5VA 1FWZA 1JHHA 4HAMA 5M3MJ 3CJNA 4AYBN 2EQRA 3CDHA 3BZCA 1RKWA 5KHDA 3PFYA 1V4RA 2DQRA 2LVSA 3DEUA 1ZYRF 2CG4A 3RQIA 1O7FA 1J5YA 1OCRH 4JBAA 3G1OA 4ZH4F 2FUG2 2IPQX 2MD0A 3JRBA 1B8IA 3NQOA 4IO9F 3QQAA 1HQCA 3H36A 2XHKA 1OCZH 5B1AH 4RB1A 1BA5A 2FNPA 2HR3A 4IRHA 4B47A 2YS9A 1STZA 1MJ9A 3S93A 4ZYEA 5D8KB 3B02A 3HDDA 4OIRF 4E4HA 3A03A 3W2AA 2V79A 4A5MA 4NC6A 3F8BA 1MBHA 2W25A 2HPIA 4A3EJ 5H2FC 1SMYF 4BJ5C 3ABTA 2V26A 3K0LA 2G7HA 4DGWB 4NB5A 5GPCA 1ITYA 1EH6A 1TT5B 2FOWA 3H0DA 3ZQLA 1I39A 3WU1B 3CP8A 4EMSA 3REOA 2QGUA 3TDZC 4HSRA 3OYCA 3GUDA 5D5VB 2KJCA 4KN7X 4DIQA 2WADA 3BP8A 1HXDA 4NC8A 2LBFB 3SEZA 3GFIA 1IRXA 2DMQA 1REPC 1ETYA 3DCFA 3M3YJ 1C0WA 2O9LA 3BTCA 2XUBA 4CCNA 3Q5FA 1YS7A 1HDDC 1O57A 2R5YA 3GTOJ 4BE2A 2DFIA 2L9RA 2OAZA 2Q2EA 4MLOA 4XOPA 3CJQB 2R5ZB 5GAEJ 2CU7A 1G3YA 3ZMSA 1H89C 2LK2A 2ISZA 1JXSA 3HC7A 4RB3C 2VC0A 1BM9A 3CESA 3RQ4A 3TBIA 3RKXA 5FKMA 1NK3P 9ANTA 2A05A 1BIBA 1JKOC 1DP7P 3K4MA 1JGGA 3FMQA 2WV0A 3JAMZ 3ELKA 3I64A 1XDSA 3ESWB 4RGXA 3V42A 4AC0A 3IAS2 3UR3C 5EJCA 4I0AA 3H5AA 3K1MA 3HPGA 3ZP5A 1YG2A 3QU3A 3AG1H 1OYYA 1HKQA 3UNGC 3ROUA 1OFCX 5DV5A 3BPVA 1O7LA 3I4MJ 5B1BH 1GXPA 1FTZA 1RESA 2OD5A 1TNTA 1XMAA 5K7ZA 5ILVA 1JUPA 2F5DA 2NVXJ 1PUFB 1QO0D 2RNJA 2DDBA 2GIZA 3S15J 2RNGA 2EIJH 1P9QC 3HYIA 4FX0A 1K6OA 3DKWA 4IHSA 3IH2A 3GTJJ 3LA7A 2MD5A 5K7HA 4Y13A 1FTTA 5HLHA 3K4NA 2DDAA 3O8HA 5M5WJ 3V4GA 2MSYA 1U2WA 4DYQA 1EH8A 2JTVA 3ZN1A 2HXIA 4ENMA 1KQ0A 2RGVA 2O8XA 3T8RA 3OYGA 3IRRA 3JRDA 1PP8F 2E2HJ 1T95A 2VJ4A 2KDOA 4RAGA 3G2BA 2CV2A 1ON1A 3LSJA 4PZJA 1H8AC 1H0MA 2E71A 2V9VA 1QGPA 4QPOA 5ILUA 2HPMA 2FD5A 1SAUA 4F93B 1MH3A 4HF2A 1TWHJ 2A69F 5M5YJ 4LIVA 4KIGA 5GAHJ 2VKEA 3HEFA 1TTYA 1B72B 2EJRA 2E34A 3VFZA 2DOFA 3GBGA 5IYCJ 3LL7A 2Z5UA 1Z91A 3ZN0A 3IAM2 1KQ9A 2L5QA 1MD0A 4MTDA 2X6YA 1RIOH 1QVUA 4WK8F 4MEYF 3AFHA 2R7FA 5CPRB 2PI0A 2CUZA 4QIWN 5CKTA 4NQWA 4KJZA 4J01A 3G3ZA 4P5OA 2E7XA 1WJ5A 2LH9A 4KMFA 3TP0A 4YG2F 2DA1A 2QSHX 4II2A 3CDIA 2BXYA 3PIOF 1CGPA 3I53A 1D1AA 4LD5A 1JUSA 2OUMA 3GO5A 3CJTB 2L02A 3GFLA 3FBNB 4E70A 2EB7A 1O3QA 3RI4A 4HF1A 1W7PA 3H3VK 1FLIA 2E1NA 4JP0A 4N4OB 4L5IA 2OQGA 1KYWA 1V5EA 1Y6IA 2ETHA 2NVUB 5IOZA 1E17A 4UB8C 5J4VA 4BXXJ 1FP1D 3OS0A 2IS6A 2K9SA 3A0HC 2VT3A 1Z7UA 3CLOA 5F6FA 2KHMA 3MZHA 2HZDA 4AIHA 1DP3A 2PEXA 1KA8A 3OYIA 4RGUA 4C2MJ 5IYBJ 4AWXB 1GDTA 3U21A 5K5QA 1N77A 4F55A 3H9GA 2DA7A 1TBXA 2F5VA 3CZ6A 2A6EF 1K78B 5CVIA 1XCVA 1FX7A 1IRFA 4V2FA 1LUJB 2LY9A 3MZ8A 3E3VA 1R1VA 3H9JA 3SZPA 1SFUA 3K4JA 3BROA 3BR6A 1IN7A 1VQ9I 4B09A 3J7ZI 1EF4A 2K4BA 2Y0SN 3FXQA 3DLLF 1S6LA 1S8NA 4YFXF 3E5QA 3E6BA 3S3MA 3UKGA 5HS7A 5IOYA 2ECCA 3QYBA 4MFDA 4PDKA 5HDNA 2JN6A 2KQRA 2P6SA 2HOAA 4OIOF 4G7OF 5LLQA 2FQ4A 3KP6A 3RDIA 3SDBA 2IA2A 4N9IA 4XRFA 3FK7A 2K27A 5EF6A 4KT6A 5FKLA 1APLC 3PUBA 2ZC2A 1RI7A 2IGNA 4BL0B 5IYDJ 3DBLB 4WXHA 3BZ6A 3D5RC 3G1MA 4XBFA 4UV8A 5FLXZ 2M87A 2UXXA 2OBPA 1AKHB 3FXOA 1V54H 4I2OA 4CCKA 3BJAA 1WHUA 3KYDB 3OIOA 4HSTA 2HQ5A 1WJEA 2CUFA 3DP7A 4IXAA 4IRIA 2VXDA 2EWNA 3R0AA 5FFZA 2JRTA 3I59A 5C4JJ 3GX4X 1ZREA 4D7NA 4RMNA 2R7DA 3OV8A 3BTIA 2EH3A 1Z6TA 1R36A 4IX7A 1ZH5A 1ZG3A 3HHGA 1X19A 2X6OA 2HOTA 2ZMEB 4G6TB 3QYEA 2P7VB 2VPRA 5GADJ 4UUTA 1YI2I 2FBKA 2XGDA 2YX7A 2XB5A 2LY2A 2NNNA 4IL6C 4HF0A 1HDPA 5J8FA 1VI0A 2W84A 2M0CA 1W1WE 1O3RA 2HYGD 2AQEA 1TP4A 4E7ZA 2VQHA 2Z33A 1R49A 2MH2A 3WGGA 3VYSB 4C30A 3A1YA 1HKTA 1NG7A 2D45A 1PVEA 3CF2A 1F5TA 3Q9VA 2VQGA 3M1EA 5L3BA 1U5TB 3OYHA 1Q1HA 2HFHA 2BBYA 4S05A 4Q4ZF 2CQKA 1LDDA 1CQTA 4M9XA 4XKCA 1ZN2A 2Y2ZA 1HA8A 1VFCA 2W57A 2JQ7A 1S3JA 4RLQA 4F7ZA 3D5SC 2ZKZA 3RZDJ 1JKQC 3NEUA 1H9GA 2MLGA 4RDUA 1D1CA 4JK1X 5FKOA 4A3CJ 3ERMA 1MNEA 3HHHA 3WTUC 4ZTFA 2UZKA 1MMGA 3BR1A 1O4XA 3EUKL 5DUIA 4EEFG 3GWZA 4JX4A 1YITI 4LG0A 3WTSC 3H0GJ 4A6EA 4PSWA 4XQFA 2CWEA 2WTEA 3FBIB 2BE5F 5L3EA 2V1DA 1TWFJ 3N97A 3BQYA 4AIKA 3TKYA 2XKPA 4BBRJ 1YJWI 1O3TA 1TT0A 4EATA 1R9TJ 1L3LA 5J6XA 4H4KC 5JHFA 1ETWA 4ZYHA 2IA1A 3TP3A 2DA4A 1BI3A 1EKEA 3A2KA 3L7WA 4FHTA 3PO2J 1FMWA 1LDJA 2HQNA 4CO8A 2R5YB 4AIJA 3KCCA 2IBDA 4M3GA 3O2PE 4ZDOA 5D4SA 1I1SA 1BIAA 1RETA 1K83J 2ZJ2A 2XAQA 1UCRA 2LFBA 5FB2A 3J7AY 3IP4B 3DPTA 2R7UA 1FYLA 2CV0A 2E1MC 2XSJC 1R6RA 4ENJA 1ONVA 4C2UA 3V7CA 3W6VA 2PN6A 3LSHA 3LNQA 2K40A 2GOXB 4DYCA 3L1PA 3LAPA 4XRMA 5EDNA 5JHUA 1SD5A 2JA6J 1BI2A 4BEHA 1A5JA 1KONA 5J4YA 4BKXA 3GTKJ 1WJFA 1TZLA 2JPBA 2X1DA 3TOAA 4OWRB 4OAYA 2DFEA 1WPKA 4V19K 5IT3A 2F4MB 2E1MB 2ZJQF 4KDPA 2H6CA 4BUPA 2DMUA 4IHVA 2R93J 3HZJA 2G0EA 2ADUA 4HBLA 2O61A 2VN2A 2BVMA 1KU3A 1XS9A 1ZAOA 3G73A 2PFBA 2CYYA 4P9UA 1RRJA 2QEXI 1F43A 3J7AO 2Z16A 2D1HA 1R4MB 1FNNA 1ZLJA 3GW2A 4OAZA 3FMRA 2ESHA 2DFHA 1XC5A 1W7PD 5C44J 1KU2A 1Z05A 1T38A 3TO7A 5AIPA 1IXRC 6PAXA 1XDUA 4GYIA 2W7NA 3PNTA 4LB6B 3CJRB 4PGHA 1WJAA 3CP2A 1FEXA 2XIGA 5E79C 2FU4A 1KQ8A 1K4SA 2LDUA 2ECBA 4YIFA 3ZQQA 4CZCA 3WTWC 3V8LA 4FETA 3L2VA 3FXUA 4HV6A 3MAJA 1MBGA 2YSRA 3AAFA 4BQQA 4S0HB 2HXOA 2J5OA 2DXIA 4HG2A 4LB5A 3J80Z 1Z9CA 4ABZA 3CCVI 3SYTA 3G1LA 4M72A 4PK4A 2WY8Q 1XG1A 5KAIC 2D2WA 2F5FA 1IV8A 2ME0A 2GAUA 5FGMA 4MQ9F 3WU0A 4GGGA 4AD9A 1Z67A 2E2JJ 3QAHA 4LLNA 4CCMA 5JI6A 5BS6A 1MJBA 1WQ2A 5CQGA 1HBXG 3E5XA 3OL4A 4BGDA 2BY1A 2QENA 2W85A 2I8DA 1T8IA 5H20A 2X6WA 4NQWB 3JTHA 1D0YA 3FHZA 2GWRA 2K9LA 5EG0A 5F64A 1OISA 3S2WA 2DPDA 3R4KA 2RV8A 5F0HA 4RGSA 3ZMZA 1USTA 1QNTA 1U3EM 2EV6A 5E3OA 3BJ6A 4ANJA 2EA2A 3MQ0A 2AS5F 4HNUA 5C4XJ 2F6CA 1IO2A 2R7RA 4BU2A 3K69A 2OCEA 3HBLA 4UVCA 1YX3A 2HZTA 1R5ID 3LQRA 3BR2A 3CQZJ 3ZCOA 1IF1A 4I76A 4EGZA 5LEKA 2V1NA 1YOVB 1M1EB 1WFXA 2K85A 3H9QA 3P9IA 1T56A 3CCSI 5ICCA 1DGRM 1X3WB 3WG7H 5EEAA 2X6XA 4CCJA 1UAAA 3I71A 5J1UA 2H09A 1G3WA 4CGZA 2TCTA 5FFXA 3TL4X 2CQXA 1VQ5I 1ZKGA 2BYVE 1CF7A 2L01A 4Y15A 3DXJF 1BR4A 2KRCA 4U87A 1G4DA 1SVLA 3GEZA 2VE9A 1HLVA 4D5CA 4CXFA 1LB2A 2LKXA 2V1UA 4HDVA 2EV0A 3OYAA 4CYCB 4P55A 1TNSA 3KYCB 2KLOA 4I09A 3I0TA 3MKZA 2KDZA 1IAWA 2BY2A 3BQZA 3JAMK 4BXUA 3HGYA 4L9JA 1P4WA 1WCMJ 3RKYA 4BYYA 4A6DA 5JVTA 3WTTC 4XN3A 3T5XA 1WJBA 2GLOA 4GCVA 1Y1WJ 4EM0B 1TLHB 2IAIA 4KT5C 5B3SH 5HLTA 5ICGA 2QA4I 5IT9Z 4EJWA 4U88A 3CMMA 1L0OC 1QHGA 2CUJA 2JRMA 2JSPA 2ZXJA 2X1CA 1RKTA 2WBMA 3FX3A 4BE1A 3H1CA 4CSWA 3E1SA 3H3UA 2L7MP 1T0FC 2CQNA 4C9YA 3I55I 2M4GA 4PJNA 2W24A 2HQRA 2L2OA 1EJ9A 2IRFG 3OYMA 1ETKA 3G4SI 4XNFA 1WZ2A 2HKXA 1BR1A 3C1DA 5DTDA 1HW2A 5JVGF 4JYKA 1J09A 1TW3A 2XF5A 2KKOA 5EZGA 4XK4A 3HM5A 4G6QA 4KUMA 2R0QC 1MDMA 2DMPA 2L9SA 3RPQA 1EV7A 2O03A 2ME6A 3SEQA 1YFHA 2DK5A 4NUBA 3GTLJ 2XPUA 4E7LA 3JR9A 1ZRFA 1B6AA 2P0WA 2LC2A 1POGA 3PIPF 4A3GJ 1ACIA 1MNMC 2HI3A 2XGEA 1QPMA 1ZG5A 3OYEA 3PSFA 4CA0A 1QZZA 2VBZA 4L0ZB 2R5ZA 3MZYA 2IVMA 1GVDA 4CZZA 2Q2EB 1JTXA 5IP7J 5TJJA 4AVZA 4A3IJ 4IHWA 3WODF 3O6BB 3ZRGA 1QU3A 3RJPA 3IV5A 2M5WA 3E0JB 2CMPA 5FRMA 5L3CA 3RZOJ 1SFKA 3HUGB 1FBQA 3L2QA 2EK5A 2PJRA 3ZQIA 1VQMI 5KK1A 2PMZA 1R5HA 3FISA 4WX9A 3GTQJ 1MGTA 3WGHA 3WGIA 4ZYDA 1FC3A 2HTJA 2VBXA 5F08A 5TGTA 1SVMA 2A6HF 3ZQFA 4YFNF 4KISA 1R22A 1BW5A 2WB1N 4C2TA 2DFFA 3QYFA 5GPAA 3W3CA 3BPXA 1ZRDA 2ID3A 3C7JA 4G12A 3OSGA 5EG0B 3OOPA 3JRFA 2ZSHB 4M71A 3LSKA 3BT9A 4N9HA 2ZJRF 1IGNA 1W0UA 4EJUA 1J59A 5DCMA 1WVRA 1VQ8I 3K4LA 1UELB 2NVTJ 3LWFA 4EM2A 3BC8A 3HUGA 1XMKA 1USSA 4GYGA 1UJ8A 3GMEA 1HW1A 3GFMA 4PJLA 2ZXWH 1IN4A 2FOKA 5HLIA 4Q47A 3A01A 3GVAA 2CFXA 1I6XA 5IY5H 3U9GA 3ZGKA 4CUGA 3ASNH 1IJWC 3HPHA 4HRIA 4ZZDA 3KP3A 1Z6RA 2UUZA 5M5XJ 2NOJB 4FX4A 4L18B 2GXAA 2HOEA 2GM4A 1D5VA 4A12A 2ZB9A 2H6BA 2M4KA 4YFKF 3KIOA 3KP4A 5LFAA 2K3FA 5EGOA 3HSFA 3H5NA 5LHIA 2PQ8A 2COMA 2DTZA 5AIQA 2QBYA 3HOSA 1FOXA 3GFJA 3LSPA 3K2AA 2X9DA 1VQPI 4G8XA 4NC7A 1Y8QB 2EZLA 1A31A 2KZGA 2E60A 1F9NA 1FIPA 3W2WA 4PGGA 4OOIA 2QWWA 4PFOA 2MFZA 4L9NA 5ILSA 2VOOA 2XROA 4E7SA 1E3OC 3L09A 3FXKA 4ESFA 3K10A 4LMYA 1YJNI 2VC1A 1Z21A 5DUKA 4HPQA 3SZGA 2JA8J 2ZFWA 1S5LC 1I3QJ 3IWZA 4RBOA 1GV5A 1JI8A 2X0LA 5HODA 3QPLA 1HOMA 4ZYGA 4N0BA 3OYBA 2OV7A 2R7WA 3CUOA 2AO9A 1R58A 2DK8A 3ML6A 3K4BA 4ZYAA 5J47A 4A3JJ 1D0XA 3DPUA 3VYRB 1MH4A 3CUQA 2LREA 3DV8A 1UHMA 1Q1VA 2PJRB 3A0BC 5F1RA 1G8XA 4RAZA 4ENKA 1A6IA 2IGKA 5CVUA 1NK2P 3AL0C 1BN5A 2P5KA 4WF2A 4EJTA 2DU9A 3RYPA 3HG9A 3I4PA 4A3DJ 4CH7A 3AKZA 1GXQA 1JKRC 4HW0A 3OSFA 2HWVA 1A36A 1LDKB 1YLFA 2L4MA 3KP7A 2VLAA 2LLKA 3QPTA 3U2RA 3IL2A 4WCGA 3KETA 4LLLA 1YW8A 2LP0A 2E36A 5FLMJ 1RR7A 2PMZN 3T8TA 4LG0B 1T98A 4XRSA 4MHGA 3VEPA 3HXLA 4HNVA 2UWMA 3WG9A 1IZ1A 1WI9A 1XSXA 3HKZN 3V7RA 3V8JA 5HS8A 4ZJZA 1VZ0A 1MMAA 1Z1DA 2A6TA 2L54A 4ZC3A 2XAGA 3HRMA 3TEDA 2QM3A 2OJED 3JCUC 4GFBA 4RM2A 2LBFA 4IHYA 1YYVA 2JPCA 2FBHA 3LSTA 2KIUA 3LA2A 3HOZJ 1R1UA 4XLPF 1B1BA 2XB0X 2M30A 1IN8A 2OZ6A 4X0GA 2MYSA 5C3EJ 2GXBA 4OIQF 2CGPA 3O8GA 1LE8B 2OU2A 4LK1F 4PJ0C 1PUFA 2JMWA 3KZIC 3DWLE 5FROA 3EUHC 1MKMA 4D0PA 1Y56A 3IWFA 3WHCA 3S1QJ 2XSDC 1NHAA 1T0FA 3RIRA 5JLWA 1FYKA 1A6QA 4O5VA 5FD6A 4XONA 1D8JA 1SEUA 2KIFA 4HX8A 1MMSA 1WSUA 5K5RA 1U8RA 3LSRA 4FCYA 3PQKA 3QOEA 1ZR2A 1BJZA 1TL8A 2E19A 3E6MA 5EGOB 2F5EA 2HEOA 2LNBA 3R60A 5HNHA 1BOBA 5E17F 5E1WA 1Y8RB 3PNVA 3H5RA 1X3UA 2VQCA 5E8IA 2CS3A 2GOMA 2LKPA 3HJEA 4EJVA 4IRGA 4YRVA 1X1DA 3HOXJ 3N4MA 4G9YA 1SD4A 2M45A 3P5JA 1LQ1A 4GDFA 2X48A 2QQ9A 1J2XA 1D1BA 2M7BA 4ITVA 2ESNA 4M9ZA 3LSGA 2XPVA 1ERDA 5LGUA 3E6DA 1FZPB 2F5CA 4AM3A 5EZHA 4M3DA 2DAOA 4UHTA 2YPRA 2EZKA 4B48A 3HSRA 3JRHA 2V1XA 5ERIA 3HIFA 4YEJA 1DPUA 3HGGA 2Q1ZB 3E97A 5D8LB 4PJMA 2RC4A 1UHWA 2EBIA 2FEZA 3E5UA 4DW6A 2EZHA 1NH3A 4KFCA 2R7SA 2CFOA 2XV4S 4C3JJ 3Q0WA 3F8MA 2VOPA 1OCOH 3MWMA 2H27A 5D5XB 1E3HA 1I3AA 2CJJA 2HNHA 3FMSA 2EFWA 4UUSB 2E35A 1FPQA 3OS1A 2TDXA 3LQQA 3NARA 2DPUA 2BVLA 4WXCA 2XVCA 1NTCA 2W1OA 3IUOA 1R71A 4XLNF 1R5GA 2Y75A 3ABKH 3O3KA 3MKWB 2YUSA 2FRHA 2MC4A 4Y33A 4L5EA 4E7HA 3BG9A 2JSCA 3W2VA 2FNAA 3QPHA 3OYJA 2R92J 4QTRA 4FE7A 5DM6F 3K4KA 3HOUJ 3RPUA 4ZDPA 4E7IA 1LKXA 3MKLA 5B66C 2KT0A 3HOTA 4HQEA 5GTHC 3KLOA 4NNJA 4MGRA 2XF7A 1ETVA 1LVKA 4HA8A 3IHUA 2OCCH 1X3ZB 2X51A 3HTUA 1JKPC 4DNCA 4CHUA 1IDYA 3SFIA 5ICEA 2YR2A 1XB4A 4ZDLA 4MIMA 3CDLA 3S32A 4B4CA 2MG4A 2E5ZA 3FIWA 3FM3A 2VKHA 3FXJA 2VXZA 2FBIA 1XGOA 5HVQC 2B9SA 3OR1C 1U9NA 3IRQA 2PX9A 3JREA 2VI6A 3M8EA 4ETSA 4MTEA 1GLNA 4XN0A 3MCZA 5JLXA 3BZKA 3DF8A 3KX2A 2OQRA 2CQ7A 1KGSA 5A2QZ 1G3TA 2P6TA 2QZ8A 1FP2A 2VB6A 5E8GA 3PL8A 2LKSA 3QRFF 2IXSA 1W5TA 4Q5SF 3F9KA 4ZZLA 3LOCA 3ZMDA 4RM3A 1T6SA 1JTYA 5TRDA 3KEOA 3QODA 4AVPA 2WV1A 2DOAA 2ISYA 2KJBA 2P5LC 4DZJA 4BHPA 4A5NA 1XGNA 2HKOA 2EZIA 3JRCA 3HKZA 1BI0A 1S72I 3ZQ7A 2ZJPF 2ICWG 4L5JA 3BR3A 2FMLA 5M3FJ 4XLHA 2A3SA 4FTHA 4IJAA 1YRNB 3SJMA 3P7NA 2Y0MA 1VQLI 2XC7A 3JTGA 4X6AJ 2JK3A 1K61A 1TC3C 1FOWA 2FA5A 5DDGA 1LNWA 2CQQA 3K4CA 4JOMA 4KIFA 4I98B 5AONA 4B44A 4IOCF 2H94A 4B3AA 2CW7A 4I7HA 3BG3A 4RLFA 5FJ8J 1WJDA 1ZELA 3FHNA 3M8JA 2P8TA 2KPMA 5KVRA 4V2GA 4UVBA 1P2FA 1UZCA 1MSFC 4CCOA 3CTAA 4HOBA 5HDGA 1N75A 2Y0SA 2IS1A 1X1AA 2VJ5A 2EV5A 3CCRI 3W6JB 2RVCA 3S8PA 1PYVA 2FE3A 1ZGJA 5CYVA 1WRJA 4CCLA 2H8WA 5FKKA 3GYHX 5LD2C 1VQKI 4G7ZF 4F3QA 2H8RA 4II3A 4HLXA 1TQIA 1FT9A 4IKFA 1WI3A 3Q9SA 5CLSA 4W97A 1SC7A 1LJ9A 3LMMA 4RGRA 4R1HA 2R3SA 3BR5A 5FKNA 2WAFA 2L7KA 3CCYA 2XGCA 2XRNA 5B5EC 4OU0A 4IZZA 1SD7A 1OLTA 1YIJI 2K9NA 2HYFA 2F2EA 1IUFA 1Z7LA 2O8KA 5K1YA 3ZQCA 2Y69H 4AUXA 4I6ZA 1P7IA 3C2HA 1BL0A 1Y0NA 3HB9A 1V3FA 4ASNA 1OCCH 1ENHA 2DT7B 2ZNYA 1K78A 2IA0A 1GVJA 1QVTA 3FXMA 3EDPA 2BZTA 3FWEA 2TRTA 1SANA 1QRYA 2HOSA 3BTJA 4I99C 1K79A 3BDDA 5L3DA 3OYNA 5EEHA 1RR8C 1FY7A 3BLYA 1YTYA 4IEJA 3OL3A 3K70D 5D5UB 1Y39A 1AU7A 3ZOBA 4HDUA 1FOKA 5E3NA 2MC3A 3LFUA 5CVVA 3E6CC 4A3MJ 2P5VA 3HRUA 2JJ7A 2XDVA 1I6HJ 4IQ4A 4E7KA 2BV6A 2VJIA 5J8CA 4FQGA 2AQFA 3PJRA 3GZ5A 1W7PB 1UMQA 2HYJA 1X1PA 5HLGA 2HDWA 1RC9A 3M7GA 4A3FJ 3ZQGA 3A4CA 2VBYA 4BS9A 1D3YA 2QKMB 3MEXA 1MBFA 3W6KB 3F8CA 1AOYA 1HSTA 4HV5A 2DJIA 1K6YA 3OMYA 2WWYA 2HVQA 2FQ3A 2IP2A 2W4SA 4AYBA 4U7BA 3OYLA 2NS0A 2VE8A 1T2KA 4KICA 4XKWA 1ZARA 1UB9A 4CYDA 1D5YA 3MMYB 1WJCA 3L2UA 2L3DA 4R79A 1JJ6C 4MFEA 2Y9YA 1EA3A 4RAFA 3M8FA 1I1GA 2ELJA 4PJJA 2L7ZA 1XMXA 2DJNA 2JWTA 3GTMJ 4XSZF 3VSLA 5DM7F 1GHCA 1P4AA 4XL9A 5J40A 3SDGA 5CJ9A 1SD6A 1FBUA 1F4KA 1G3SA 2M9HA 3S2DJ 5HNFA 2NNYA 1DUXC 2R7ZJ 2DYSH 4XKBA 4WXDA 3RPUD 4XLAA 1WH5A 3BG7A 4OINF 1U8BA 3DU5A 4M3BA 2P7CB 1XCBA 3NAUA 4P9FA 3KP2A 2RQQA 2OF7A 4UUVA 4D7MA 5D4RA 2V9KA 3N05A 2KRHA 1K7AA 3CO7C 4XMYA 3HOYJ 2F4IA 2EILH 5KNLA 1RUNA 5E20A 2ZO4A 3GF2A 2BY0A 3ERED 1V5FA 2WA0A 3LAJA 4RAYA 5GAGJ 4UB6C 3RKQA 4IHTA 4BEHB 2EINH 3IH4A 1QPIA 3VSKA 1ON2A 2FF4A 3F23A 3DQVC 2HGCA 4I01A 2IW5A 5GTIC 4CICA 2K9QA 4D9JA 1FJLA 3CC7I 4Y52J 1J75A 2IGOA 2DA6A 2O5RA 5DEQA 1B72A 1B9NA 2LY1A 5LBQA 3VPRA 3CCEI 1JGSA 3S3NA 2LYCA 3WE2A 4M6YA 2AHQA 1U5TA 1ETXA 4BY1J 3GXOA 2XF6A 4HLYA 5K7FA 2E7WA 2CV1A 2I5UA 3MFKA 4UY8I 3PM1A 2IS2A 4B1RA 5LRRA 3TW6A 3HOWJ 2K02A 3S17J 3IKTA 5J3LA 3PQJA 2NVQJ 3EQLF 4LIUA 1LEBA 1PP7U 1CF7B 3CUQC 2ID6A 3L9FA 1IRGA 5E1XA 5DD4A 1N78A 2XAHA 1ODDA 1I50J 3CC4I 1XN7A 2XAUA 2AXLA 1P4XA 4RS8A 1YO5C 1MDMB 2BGCA 2VPLA 2LG4A 2H1LA 4BNCA 5D6FA 2VQLA 4HNTA 2A68F 2WAQN 1A04A 4LLGF 5A2QK 3BR0A 4G94A 3WTXC 2WY7Q 3CUQB 2O6GE 2PMHA 2VJJA 2LSOA 1FIAA 3MD2A 3DTEA 2W48A 2L9NA 1PUEE 4K2EA 1IC8A 3ZMUA 5E3LA 2ZMEA 2OTJI 3DTKA 4M6VA 4PCQA 1HSJA 3WTZA 5LGNA 3JRAA 4BQAA 2BHYA 5LEJA 1HC8A 5HDKA 2XAJA 2DN0A 1P7JA 4CYCA 3R6SA 3NWSA 1R7JA 2I10A 1YS6A 2M0MA 5FO5A 5H6QA 3F21A 2P81A 4LJZF 4F91B 2RREA 2AXTC 4XSXF 4I0BA 2ZBKA 1ZTRA 1XTAA 1R1TA 4XKVA 4U0YA 1OYWA 1T08B 3F8NA 3KE2A 1YX5A 1XPXA 2PLYA 2PJPA 1E0EA 1OQYA 3D0SA 4LFUA 3WU2C 1IUYA 1JT0A 2IGMA 1P6RA 2GQQA 5IPAA 1OKRA 3D5LA 3X2QH 3EETA 2KZVA 1B8IB 2QSGX 4QLCU 3VODA 2IS4A 3CF5F 1MNDA 4YIRX 1BOAA 2KIQA 2HDDA 1BC7C 4I02A 4XLFA 3DLAA 4XOTA 2XPWA 2V4JC 2DQLA 1VTNC 1UFMA 4WWCA 2G9WA 5E1ZB 4TV7A 3I9V2 2LTPA 3ISPA 1S7AA 3K7AJ 4Z2YA 4EJOA 1DU0A 1QBJA 3IH3A 2ELKA 3ZPLA 4IPAA 4LGWA 3HRTA 3CCJI 2FX0A 4ESBA 2V9PA 5J1RA 4BJTA 3FF5A 2R7OA 3SQNA 2LD5A 1U5TC 2W00A 2YU3A 3PNYA 5LHGA 3CO6C 2R7TA 1FSEA 2L7FP 4XRSG 3M9AA 4QSHA 4DJAA 2H1KA 4LOCA 3QOPA 3CCLI 5FD5A 4A2UA 4EV0A 2VT2A 3HL2A 1JE8A 2LF7A 3GZ6A 2Z9OA 3LSMA 1W5SA 2Q0OA 1R23A 4BE0A 4DBQA 3OY9A 3M07A 1LFPA 2DMTA 3PSIA 3KLNA 3D1NI 3I54A 3CLQA 2BHZA 5EYRA 4MNUA 1RZ4A 3B73A 2DT5A 4YIIA 3FZVA 1W36C 4BDYA 4OMZA 2WAEA 1YJ9I 2NVYJ 2CRGA 4M73A 1TWGJ 3KP5A 2MGQA 1VNDA 2PMUA 2GBYA 2EA4A 2ZCWA 4XR6A 2EFOA 3F3XA 1X4PA 3DPLC 2Y31A 3WHBA 4LG3A 1XGSA 1JT6A 3JW4A 3COAC 4HYEA 1LPQA 4KN4X 1NG6A 4BHBA 3KEQA 3SZTA 3IKVA
chains in the Genus database with same CATH topology
1QQIA 3J81Z 3FXRA 2GIVA 3L2CA 1IN6A 2NAZA 4KA4A 3ABUA 3GLXA 1S29A 1FYMA 2MA3A 4A0XA 1Y0UA 2GZWA 1TQPA 2XGXA 1SAXA 3DFGA 3RYRA 4L9TA 2ACJA 2HS5A 1MJAA 4MEXF 1MZBA 4NHJA 5BMZA 5ICFA 5IT9K 3C3WA 5H6RA 1U6GA 5HOOA 4KNYA 3ZMTA 2A61A 4MQVA 2G7UA 1BJAA 3HTSB 5BPIA 2XASA 1LVAA 2M8EA 2C6YA 1TQMA 1IXSB 2QVOA 4R8HA 1R00A 2PG4A 4A0YA 4FT8A 4ESJA 5K5OA 5BQTA 1B9MA 4EVIA 2FSWA 1T39A 4Y17A 1U78A 2VONA 3K1NA 3P9CA 3EUHA 1HW5A 4EQQA 4BAYA 3NRVA 4BH9A 2STWA 5FLXK 2HTSA 2Z99A 4G7HF 2RN7A 3LFKA 1QZYA 2RDPA 2GA1A 3VB2A 2DO7A 2UXNA 1ZGAA 2RQPA 3BOQA 4L0YB 3ULQB 4IVNA 2L4AA 3K9TA 3EYIA 2QQAA 1ZRCA 3TO9A 3PFIA 2K86A 4UNOA 1WKMA 1P92A 3ECOA 1S7OA 4IF4A 1LEAA 2O3FA 4ON0A 3I58A 1XSDA 4RB2C 4GXOA 4P96A 2V6CA 1SMTA 2Q8KA 1TW2A 2D1VA 3V7SA 2QLZA 2EFNA 3JSPA 3TOBA 2P4WA 3ECHA 5DCMB 5LGTA 1BC8C 2HDCA 4UV9A 1ZLKA 5DYMA 2QQBA 1IN5A 4H0EA 2B0LA 2OA4A 3FM5A 1ZHFA 1J0RA 3SFZA 5D6EA 2DLLA 1YW7A 1B4AA 5EEGA 5L3FA 1RUOA 2QUFA 1BBYA 3BJOA 3IC7A 1H9TA 3I5UA 1IW7F 2NYXA 4OMYA 3F22A 5HS9A 5E18F 2MBFA 2WC2A 3SXYA 1HKSA 2ELHA 2KIMA 4LK0F 1BI1A 3R0JA 2VBWA 3U1DA 2JZYA 1OYIA 4U0VA 1J9IA 4EM1A 2STTA 1B59A 2Y48A 3F6VA 4O3MA 2YX4A 1JHFA 1FSHA 1OR7A 4EGYA 1OPCA 1D8KA 4DQ2A 2PBIA 5BPDA 2EFQA 3ZMVA 1J7KA 2QYOA 1I5ZA 2NRAC 3JSOA 2M1BA 2K7LA 5L3GA 3LA3A 1O3SA 1XGMA 4OIPF 3EYYA 1DPRA 1KYZA 1YIOA 2GA2A 3QP6A 1ZG1A 3V8KA 1PDNC 4U0WA 4A0ZA 5ED4A 2EFPA 2A5YB 2FMYA 3RTRA 3J81K 4M9SA 3TDUC 3J80K 3H92A 3KFWX 1EH7A 2Z3YA 2MH9A 3BWGA 3TQNA 3HSEA 2XAFA 1XD7A 2MLKA 3R61A 2JT1A 2FXAA 3KZYA 5DCFA 1ULYA 4GO1A 2A07F 2IJLA 2DI3A 1E2XA 3RKWA 4U7DA 3KZZA 3HRSA 1G6NA 4KYWA 3WTYC 1IXCA 3QU6A 2VODA 3F72A 3K1PA 1KU9A 3T0YA 5JR3A 1DDNA 4KMUX 1XSVA 2DW4A 2CSOA 1AWCA 3F8FA 4S04A 3K2ZA 4UXNA 3L00A 2OZUA 5LRSA 4CDGA 1FBSA 1I27A 4QWQA 2DBBA 5D5WB 2BEOA 5DD8A 2KRFA 5JFRA 2K4JA 3I59B 3WE3A 1YW9A 5CVRA 2E1CA 1OMIA 1SFXA 1YQAA 4HX7A 2O0YA 1RNLA 5BOXA 4G6DA 2LF8A 2RKHA 5LHHA 4KIBA 2CW0F 2CO5A 2XKOA 4HZFA 2X4HA 4BHCA 1W4MA 4L9VA 2IT0A 3WTVC 2ZNZA 2GXGA 1WWXA 3C18A 3QP5A 1SFEA 4JQFA 4UVAA 2QBYB 2DTRA 4O6JA 3TGNA 4HX4A 4Q48A 3T1BA 1F1ZA 3F6OA 3P9KA 3SHFA 4ENNA 3VOEA 1KU7A 3BY6A 2J5PA 4HQMA 4RB0A 5CVJA 4B8XA 3TO6A 3H3ZA 4M74A 4M6XA 1FWZA 1JHHA 4HAMA 3CJNA 3CDHA 1V4RA 2DQRA 3DEUA 1ZYRF 2CG4A 1O7FA 1J5YA 4ZH4F 4JBAA 2IPQX 3NQOA 1HQCA 2XHKA 4RB1A 2FNPA 2HR3A 4IRHA 1STZA 1MJ9A 4ZYEA 5D8KB 3B02A 4OIRF 2V79A 4A5MA 3F8BA 2W25A 1SMYF 3ABTA 3K0LA 2G7HA 4NB5A 1EH6A 3WU1B 4EMSA 3REOA 3TDZC 3GUDA 5D5VB 2KJCA 4KN7X 3BP8A 1HXDA 3GFIA 1REPC 1C0WA 2XUBA 3Q5FA 1YS7A 1O57A 2DFIA 2OAZA 2Q2EA 1G3YA 3ZMSA 2ISZA 1JXSA 4RB3C 2VC0A 1BM9A 3RKXA 1BIBA 1DP7P 3FMQA 2WV0A 3JAMZ 3ELKA 3I64A 1XDSA 4RGXA 4I0AA 3K1MA 3ZP5A 1YG2A 3QU3A 1OYYA 1HKQA 3ROUA 5DV5A 3BPVA 1O7LA 1GXPA 2OD5A 1TNTA 1XMAA 5ILVA 2F5DA 1QO0D 2RNJA 3HYIA 4FX0A 1K6OA 3DKWA 4IHSA 3LA7A 2MD5A 4Y13A 5HLHA 3V4GA 1U2WA 1EH8A 2JTVA 3ZN1A 4ENMA 1KQ0A 2RGVA 2O8XA 3T8RA 3IRRA 1PP8F 1ON1A 4PZJA 1H0MA 2V9VA 1QGPA 5ILUA 4HF2A 2A69F 4KIGA 1TTYA 2EJRA 3VFZA 2Z5UA 1Z91A 3ZN0A 1KQ9A 1MD0A 4MTDA 1RIOH 4WK8F 4MEYF 2R7FA 2PI0A 4NQWA 3G3ZA 4P5OA 2E7XA 4KMFA 4YG2F 1CGPA 3I53A 4LD5A 3GO5A 2L02A 3GFLA 4E70A 2EB7A 1O3QA 3RI4A 4HF1A 1W7PA 1FLIA 2E1NA 4L5IA 2OQGA 1KYWA 2ETHA 1E17A 1FP1D 3CLOA 2VT3A 1Z7UA 5F6FA 3MZHA 4AIHA 2PEXA 1KA8A 4RGUA 4AWXB 5K5QA 1TBXA 2A6EF 1K78B 5CVIA 1XCVA 1FX7A 1IRFA 3E3VA 1R1VA 3SZPA 1SFUA 3BROA 1IN7A 4B09A 2K4BA 3FXQA 1S6LA 1S8NA 4YFXF 3E5QA 3E6BA 5HS7A 4PDKA 5HDNA 2P6SA 4OIOF 4G7OF 5LLQA 3KP6A 3RDIA 2IA2A 4N9IA 4XRFA 2K27A 1RI7A 4WXHA 3BZ6A 4XBFA 4UV8A 5FLXZ 2M87A 2UXXA 2OBPA 4I2OA 3BJAA 3DP7A 4IXAA 4IRIA 2EWNA 3R0AA 5FFZA 2JRTA 3I59A 3GX4X 1ZREA 2R7DA 3OV8A 1Z6TA 1R36A 1ZH5A 1ZG3A 3HHGA 2ZMEB 2P7VB 2FBKA 2YX7A 2NNNA 4HF0A 5J8FA 2W84A 1O3RA 2HYGD 2Z33A 2MH2A 3WGGA 1HKTA 2D45A 1F5TA 3Q9VA 3M1EA 5L3BA 1U5TB 1Q1HA 2HFHA 2BBYA 4S05A 4Q4ZF 2CQKA 1LDDA 4M9XA 1ZN2A 2W57A 1S3JA 4F7ZA 2ZKZA 3NEUA 1H9GA 2MLGA 4JK1X 3HHHA 3WTUC 2UZKA 5DUIA 3GWZA 4LG0A 3WTSC 4A6EA 2CWEA 2WTEA 2BE5F 5L3EA 2V1DA 3N97A 4AIKA 3TKYA 2XKPA 1O3TA 1L3LA 5J6XA 4ZYHA 2IA1A 1BI3A 3L7WA 4FHTA 1LDJA 2HQNA 4CO8A 4AIJA 3KCCA 3O2PE 5D4SA 1I1SA 1BIAA 2ZJ2A 2XAQA 1UCRA 5FB2A 3DPTA 1FYLA 4ENJA 1ONVA 3V7CA 2PN6A 3LAPA 5JHUA 1SD5A 1BI2A 2JPBA 3TOAA 5IT3A 4KDPA 2H6CA 2O61A 2ADUA 4HBLA 2VN2A 1KU3A 1ZAOA 3G73A 2PFBA 2CYYA 4P9UA 3J7AO 2D1HA 1FNNA 1ZLJA 3GW2A 3FMRA 2ESHA 1W7PD 1KU2A 1Z05A 1T38A 3TO7A 5AIPA 1IXRC 6PAXA 1XDUA 4GYIA 4LB6B 4PGHA 2XIGA 2FU4A 1KQ8A 2LDUA 4YIFA 3WTWC 3V8LA 4HV6A 3FXUA 3MAJA 2YSRA 3AAFA 2J5OA 4LB5A 3J80Z 1Z9CA 4M72A 2D2WA 2F5FA 2GAUA 5FGMA 4MQ9F 3WU0A 4GGGA 4AD9A 3QAHA 4LLNA 5JI6A 5BS6A 1MJBA 1WQ2A 1HBXG 3E5XA 2QENA 2W85A 5H20A 3JTHA 3FHZA 2GWRA 5F64A 2DPDA 3S2WA 3R4KA 2RV8A 4RGSA 3ZMZA 1USTA 1QNTA 1U3EM 2EV6A 3BJ6A 2EA2A 3MQ0A 2AS5F 3K69A 4UVCA 2HZTA 3LQRA 1IF1A 4EGZA 5LEKA 3P9IA 5ICCA 3I71A 2H09A 1G3WA 4CGZA 5FFXA 2BYVE 1CF7A 2L01A 4Y15A 3DXJF 1G4DA 3GEZA 2VE9A 4CXFA 1LB2A 2V1UA 4HDVA 2EV0A 4P55A 1TNSA 4I09A 3I0TA 1IAWA 3JAMK 4BXUA 4L9JA 1P4WA 3RKYA 4BYYA 4A6DA 5JVTA 3WTTC 3T5XA 4GCVA 4EM0B 1TLHB 4KT5C 5ICGA 5IT9Z 4EJWA 4U88A 1L0OC 2ZXJA 3FX3A 3H3UA 2W24A 2HQRA 2IRFG 2HKXA 3C1DA 1HW2A 1TW3A 2KKOA 4G6QA 4KUMA 1MDMA 3RPQA 1EV7A 2O03A 1YFHA 2DK5A 1ZRFA 1B6AA 1QPMA 1ZG5A 1QZZA 2VBZA 4L0ZB 3MZYA 2IVMA 4CZZA 5TJJA 3WODF 3O6BB 3RJPA 2M5WA 5L3CA 1FBQA 2EK5A 5KK1A 1R5HA 4WX9A 1MGTA 3WGHA 3WGIA 4ZYDA 1FC3A 2HTJA 2VBXA 2A6HF 4YFNF 1R22A 3BPXA 1ZRDA 3C7JA 3OOPA 4M71A 4N9HA 4EJUA 1J59A 5DCMA 3LWFA 4EM2A 3HUGA 1XMKA 1USSA 4GYGA 1HW1A 3GFMA 1IN4A 2FOKA 5HLIA 4Q47A 3GVAA 2CFXA 1I6XA 3U9GA 4ZZDA 3KP3A 1Z6RA 4FX4A 4L18B 2HOEA 1D5VA 4A12A 2H6BA 4YFKF 3KP4A 3HSFA 5LHIA 2PQ8A 2COMA 5AIQA 2QBYA 3HOSA 3GFJA 4G8XA 1F9NA 4PGGA 4OOIA 2QWWA 2VOOA 4L9NA 5ILSA 2XROA 3L09A 4ESFA 4LMYA 2VC1A 5DUKA 2ZFWA 3IWZA 2X0LA 4ZYGA 4N0BA 3CUOA 1R58A 2DK8A 3ML6A 3CUQA 3DV8A 1UHMA 5F1RA 4RAZA 4ENKA 5CVUA 1BN5A 2P5KA 4WF2A 4EJTA 2DU9A 3RYPA 3I4PA 1GXQA 4HW0A 2HWVA 1LDKB 1YLFA 2L4MA 3KP7A 3QPTA 3U2RA 3IL2A 4WCGA 3KETA 4LLLA 1YW8A 3T8TA 4LG0B 1T98A 4MHGA 3VEPA 2UWMA 3WG9A 1IZ1A 1WI9A 1XSXA 5HS8A 3V7RA 3V8JA 1Z1DA 2L54A 2XAGA 3HRMA 2QM3A 1YYVA 2JPCA 2FBHA 3LSTA 2KIUA 3LA2A 1R1UA 4XLPF 1B1BA 2M30A 1IN8A 2OZ6A 2GXBA 4OIQF 2CGPA 2OU2A 4LK1F 1MKMA 4D0PA 3IWFA 1NHAA 1T0FA 3RIRA 1FYKA 4O5VA 5FD6A 1D8JA 2KIFA 4HX8A 1WSUA 5K5RA 1U8RA 3PQKA 3E6MA 2F5EA 2HEOA 2LNBA 3R60A 5E17F 5E1WA 1X3UA 5E8IA 2LKPA 4EJVA 4IRGA 3N4MA 4G9YA 1SD4A 2M45A 1LQ1A 2QQ9A 1J2XA 4M9ZA 2ESNA 5LGUA 3E6DA 1FZPB 2F5CA 2DAOA 4UHTA 2YPRA 3HSRA 1DPUA 2V1XA 5ERIA 3HIFA 3E97A 5D8LB 2RC4A 1UHWA 2FEZA 3E5UA 4KFCA 2XV4S 2VOPA 3F8MA 3MWMA 2H27A 5D5XB 2EFWA 3FMSA 1FPQA 2TDXA 3LQQA 2DPUA 4WXCA 2XVCA 4XLNF 1R5GA 2Y75A 3O3KA 2FRHA 2JSCA 2FNAA 3QPHA 3RPUA 3HOTA 4HQEA 3KLOA 4MGRA 4HA8A 3IHUA 3HTUA 4DNCA 4CHUA 5ICEA 2YR2A 1XB4A 3FM3A 2VXZA 2FBIA 1XGOA 5HVQC 3IRQA 3M8EA 4ETSA 4MTEA 3MCZA 3DF8A 2OQRA 1KGSA 5A2QZ 1G3TA 2P6TA 2QZ8A 1FP2A 5E8GA 3QRFF 1W5TA 4Q5SF 4ZZLA 3ZMDA 1T6SA 5TRDA 3KEOA 4AVPA 2ISYA 2KJBA 2P5LC 4BHPA 4A5NA 1XGNA 2HKOA 1BI0A 3ZQ7A 4L5JA 2FMLA 2A3SA 4IJAA 3P7NA 2Y0MA 3JTGA 2FA5A 5DDGA 1LNWA 4KIFA 4I98B 5AONA 2H94A 4I7HA 2P8TA 5KVRA 4UVBA 1P2FA 3CTAA 4HOBA 5HDGA 2EV5A 3W6JB 2RVCA 2FE3A 1ZGJA 5CYVA 1WRJA 3GYHX 4G7ZF 4HLXA 1TQIA 1FT9A 3Q9SA 5CLSA 1LJ9A 4RGRA 4R1HA 2R3SA 2XRNA 4OU0A 1SD7A 2HYFA 2F2EA 5K1YA 1V3FA 4ASNA 2ZNYA 1K78A 2IA0A 1GVJA 3EDPA 3FWEA 1K79A 3BDDA 5L3DA 5EEHA 1FY7A 1YTYA 5D5UB 4HDUA 1FOKA 2MC3A 3E6CC 5CVVA 2P5VA 3HRUA 2BV6A 5J8CA 3GZ5A 1W7PB 5HLGA 3M7GA 2VBYA 1D3YA 3MEXA 3W6KB 3F8CA 1AOYA 1HSTA 4HV5A 2WWYA 2FQ3A 2IP2A 4U7BA 2NS0A 2VE8A 1T2KA 4KICA 1ZARA 1UB9A 4CYDA 2L3DA 4R79A 3M8FA 1I1GA 4XSZF 1GHCA 1P4AA 5CJ9A 1SD6A 1FBUA 1F4KA 1G3SA 2NNYA 1DUXC 4WXDA 4OINF 2P7CB 1XCBA 4P9FA 3KP2A 4UUVA 5D4RA 1K7AA 3CO7C 1RUNA 5E20A 2ZO4A 3GF2A 3ERED 3LAJA 4RAYA 4IHTA 1ON2A 2FF4A 3F23A 3DQVC 2HGCA 4I01A 2IW5A 4CICA 1J75A 5DEQA 1B9NA 5LBQA 1JGSA 3WE2A 4M6YA 1U5TA 3GXOA 4HLYA 2E7WA 3MFKA 5LRRA 2K02A 3IKTA 3PQJA 3EQLF 1LEBA 1PP7U 1CF7B 3CUQC 3L9FA 1IRGA 5E1XA 5DD4A 2XAHA 1ODDA 1XN7A 4RS8A 2AXLA 1P4XA 1YO5C 1MDMB 2BGCA 4BNCA 5D6FA 2A68F 1A04A 4LLGF 5A2QK 3WTXC 4G94A 2O6GE 3CUQB 2PMHA 2LSOA 1PUEE 4K2EA 3ZMUA 2ZMEA 3WTZA 4PCQA 1HSJA 5LGNA 4BQAA 5LEJA 5HDKA 2XAJA 3R6SA 1R7JA 1YS6A 5FO5A 5H6QA 3F21A 4LJZF 4XSXF 4I0BA 2ZBKA 4U0YA 1R1TA 1OYWA 3F8NA 3KE2A 2PLYA 2PJPA 3D0SA 4LFUA 1IUYA 1P6RA 2GQQA 1OKRA 3D5LA 3EETA 4QLCU 3VODA 1BOAA 1BC7C 4I02A 2DQLA 1VTNC 1UFMA 4WWCA 2G9WA 5E1ZB 4TV7A 3ISPA 1S7AA 4EJOA 4Z2YA 1QBJA 3ZPLA 4IPAA 4LGWA 3HRTA 4ESBA 3FF5A 3SQNA 1U5TC 2YU3A 5LHGA 3CO6C 1FSEA 3M9AA 3QOPA 5FD5A 4A2UA 4EV0A 2VT2A 1JE8A 2LF7A 3GZ6A 2Z9OA 1W5SA 2Q0OA 1R23A 3KLNA 3I54A 4MNUA 1RZ4A 3B73A 2DT5A 4YIIA 3FZVA 4OMZA 4M73A 3KP5A 2PMUA 2EA4A 2ZCWA 2EFOA 3F3XA 3DPLC 1XGSA 3JW4A 3COAC 4HYEA 4KN4X 4BHBA 3KEQA 3SZTA 3IKVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QQI A;  3J81 Z;  3FXR A;  2GIV A;  3L2C A;  1IN6 A;  2NAZ A;  4KA4 A;  3ABU A;  3GLX A;  1S29 A;  1FYM A;  2MA3 A;  4A0X A;  1Y0U A;  2GZW A;  1TQP A;  2XGX A;  1SAX A;  3DFG A;  3RYR A;  4L9T A;  2ACJ A;  2HS5 A;  1MJA A;  4MEX F;  1MZB A;  4NHJ A;  5BMZ A;  5ICF A;  5IT9 K;  3C3W A;  5H6R A;  1U6G A;  5HOO A;  4KNY A;  3ZMT A;  2A61 A;  4MQV A;  2G7U A;  1BJA A;  3HTS B;  5BPI A;  2XAS A;  1LVA A;  2M8E A;  2C6Y A;  1TQM A;  1IXS B;  2QVO A;  4R8H A;  1R00 A;  2PG4 A;  4A0Y A;  4FT8 A;  4ESJ A;  5K5O A;  5BQT A;  1B9M A;  4EVI A;  2FSW A;  1T39 A;  4Y17 A;  1U78 A;  2VON A;  3K1N A;  3P9C A;  3EUH A;  1HW5 A;  4EQQ A;  4BAY A;  3NRV A;  4BH9 A;  2STW A;  5FLX K;  2HTS A;  2Z99 A;  4G7H F;  2RN7 A;  3LFK A;  1QZY A;  2RDP A;  2GA1 A;  3VB2 A;  2DO7 A;  2UXN A;  1ZGA A;  2RQP A;  3BOQ A;  4L0Y B;  3ULQ B;  4IVN A;  2L4A A;  3K9T A;  3EYI A;  2QQA A;  1ZRC A;  3TO9 A;  3PFI A;  2K86 A;  4UNO A;  1WKM A;  1P92 A;  3ECO A;  1S7O A;  4IF4 A;  1LEA A;  2O3F A;  4ON0 A;  3I58 A;  1XSD A;  4RB2 C;  4GXO A;  4P96 A;  2V6C A;  1SMT A;  2Q8K A;  1TW2 A;  2D1V A;  3V7S A;  2QLZ A;  2EFN A;  3JSP A;  3TOB A;  2P4W A;  3ECH A;  5DCM B;  5LGT A;  1BC8 C;  2HDC A;  4UV9 A;  1ZLK A;  5DYM A;  2QQB A;  1IN5 A;  4H0E A;  2B0L A;  2OA4 A;  3FM5 A;  1ZHF A;  1J0R A;  3SFZ A;  5D6E A;  2DLL A;  1YW7 A;  1B4A A;  5EEG A;  5L3F A;  1RUO A;  2QUF A;  1BBY A;  3BJO A;  3IC7 A;  1H9T A;  3I5U A;  1IW7 F;  2NYX A;  4OMY A;  3F22 A;  5HS9 A;  5E18 F;  2MBF A;  2WC2 A;  3SXY A;  1HKS A;  2ELH A;  2KIM A;  4LK0 F;  1BI1 A;  3R0J A;  2VBW A;  3U1D A;  2JZY A;  1OYI A;  4U0V A;  1J9I A;  4EM1 A;  2STT A;  1B59 A;  2Y48 A;  3F6V A;  4O3M A;  2YX4 A;  1JHF A;  1FSH A;  1OR7 A;  4EGY A;  1OPC A;  1D8K A;  4DQ2 A;  2PBI A;  5BPD A;  2EFQ A;  3ZMV A;  1J7K A;  2QYO A;  1I5Z A;  2NRA C;  3JSO A;  2M1B A;  2K7L A;  5L3G A;  3LA3 A;  1O3S A;  1XGM A;  4OIP F;  3EYY A;  1DPR A;  1KYZ A;  1YIO A;  2GA2 A;  3QP6 A;  1ZG1 A;  3V8K A;  1PDN C;  4U0W A;  4A0Z A;  5ED4 A;  2EFP A;  2A5Y B;  2FMY A;  3RTR A;  3J81 K;  4M9S A;  3TDU C;  3J80 K;  3H92 A;  3KFW X;  1EH7 A;  2Z3Y A;  2MH9 A;  3BWG A;  3TQN A;  3HSE A;  2XAF A;  1XD7 A;  2MLK A;  3R61 A;  2JT1 A;  2FXA A;  3KZY A;  5DCF A;  1ULY A;  4GO1 A;  2A07 F;  2IJL A;  2DI3 A;  1E2X A;  3RKW A;  4U7D A;  3KZZ A;  3HRS A;  1G6N A;  4KYW A;  3WTY C;  1IXC A;  3QU6 A;  2VOD A;  3F72 A;  3K1P A;  1KU9 A;  3T0Y A;  5JR3 A;  1DDN A;  4KMU X;  1XSV A;  2DW4 A;  2CSO A;  1AWC A;  3F8F A;  4S04 A;  3K2Z A;  4UXN A;  3L00 A;  2OZU A;  5LRS A;  4CDG A;  1FBS A;  1I27 A;  4QWQ A;  2DBB A;  5D5W B;  2BEO A;  5DD8 A;  2KRF A;  5JFR A;  2K4J A;  3I59 B;  3WE3 A;  1YW9 A;  5CVR A;  2E1C A;  1OMI A;  1SFX A;  1YQA A;  4HX7 A;  2O0Y A;  1RNL A;  5BOX A;  4G6D A;  2LF8 A;  2RKH A;  5LHH A;  4KIB A;  2CW0 F;  2CO5 A;  2XKO A;  4HZF A;  2X4H A;  4BHC A;  1W4M A;  4L9V A;  2IT0 A;  3WTV C;  2ZNZ A;  2GXG A;  1WWX A;  3C18 A;  3QP5 A;  1SFE A;  4JQF A;  4UVA A;  2QBY B;  2DTR A;  4O6J A;  3TGN A;  4HX4 A;  4Q48 A;  3T1B A;  1F1Z A;  3F6O A;  3P9K A;  3SHF A;  4ENN A;  3VOE A;  1KU7 A;  3BY6 A;  2J5P A;  4HQM A;  4RB0 A;  5CVJ A;  4B8X A;  3TO6 A;  3H3Z A;  4M74 A;  4M6X A;  1FWZ A;  1JHH A;  4HAM A;  3CJN A;  3CDH A;  1V4R A;  2DQR A;  3DEU A;  1ZYR F;  2CG4 A;  1O7F A;  1J5Y A;  4ZH4 F;  4JBA A;  2IPQ X;  3NQO A;  1HQC A;  2XHK A;  4RB1 A;  2FNP A;  2HR3 A;  4IRH A;  1STZ A;  1MJ9 A;  4ZYE A;  5D8K B;  3B02 A;  4OIR F;  2V79 A;  4A5M A;  3F8B A;  2W25 A;  1SMY F;  3ABT A;  3K0L A;  2G7H A;  4NB5 A;  1EH6 A;  3WU1 B;  4EMS A;  3REO A;  3TDZ C;  3GUD A;  5D5V B;  2KJC A;  4KN7 X;  3BP8 A;  1HXD A;  3GFI A;  1REP C;  1C0W A;  2XUB A;  3Q5F A;  1YS7 A;  1O57 A;  2DFI A;  2OAZ A;  2Q2E A;  1G3Y A;  3ZMS A;  2ISZ A;  1JXS A;  4RB3 C;  2VC0 A;  1BM9 A;  3RKX A;  1BIB A;  1DP7 P;  3FMQ A;  2WV0 A;  3JAM Z;  3ELK A;  3I64 A;  1XDS A;  4RGX A;  4I0A A;  3K1M A;  3ZP5 A;  1YG2 A;  3QU3 A;  1OYY A;  1HKQ A;  3ROU A;  5DV5 A;  3BPV A;  1O7L A;  1GXP A;  2OD5 A;  1TNT A;  1XMA A;  5ILV A;  2F5D A;  1QO0 D;  2RNJ A;  3HYI A;  4FX0 A;  1K6O A;  3DKW A;  4IHS A;  3LA7 A;  2MD5 A;  4Y13 A;  5HLH A;  3V4G A;  1U2W A;  1EH8 A;  2JTV A;  3ZN1 A;  4ENM A;  1KQ0 A;  2RGV A;  2O8X A;  3T8R A;  3IRR A;  1PP8 F;  1ON1 A;  4PZJ A;  1H0M A;  2V9V A;  1QGP A;  5ILU A;  4HF2 A;  2A69 F;  4KIG A;  1TTY A;  2EJR A;  3VFZ A;  2Z5U A;  1Z91 A;  3ZN0 A;  1KQ9 A;  1MD0 A;  4MTD A;  1RIO H;  4WK8 F;  4MEY F;  2R7F A;  2PI0 A;  4NQW A;  3G3Z A;  4P5O A;  2E7X A;  4KMF A;  4YG2 F;  1CGP A;  3I53 A;  4LD5 A;  3GO5 A;  2L02 A;  3GFL A;  4E70 A;  2EB7 A;  1O3Q A;  3RI4 A;  4HF1 A;  1W7P A;  1FLI A;  2E1N A;  4L5I A;  2OQG A;  1KYW A;  2ETH A;  1E17 A;  1FP1 D;  3CLO A;  2VT3 A;  1Z7U A;  5F6F A;  3MZH A;  4AIH A;  2PEX A;  1KA8 A;  4RGU A;  4AWX B;  5K5Q A;  1TBX A;  2A6E F;  1K78 B;  5CVI A;  1XCV A;  1FX7 A;  1IRF A;  3E3V A;  1R1V A;  3SZP A;  1SFU A;  3BRO A;  1IN7 A;  4B09 A;  2K4B A;  3FXQ A;  1S6L A;  1S8N A;  4YFX F;  3E5Q A;  3E6B A;  5HS7 A;  4PDK A;  5HDN A;  2P6S A;  4OIO F;  4G7O F;  5LLQ A;  3KP6 A;  3RDI A;  2IA2 A;  4N9I A;  4XRF A;  2K27 A;  1RI7 A;  4WXH A;  3BZ6 A;  4XBF A;  4UV8 A;  5FLX Z;  2M87 A;  2UXX A;  2OBP A;  4I2O A;  3BJA A;  3DP7 A;  4IXA A;  4IRI A;  2EWN A;  3R0A A;  5FFZ A;  2JRT A;  3I59 A;  3GX4 X;  1ZRE A;  2R7D A;  3OV8 A;  1Z6T A;  1R36 A;  1ZH5 A;  1ZG3 A;  3HHG A;  2ZME B;  2P7V B;  2FBK A;  2YX7 A;  2NNN A;  4HF0 A;  5J8F A;  2W84 A;  1O3R A;  2HYG D;  2Z33 A;  2MH2 A;  3WGG A;  1HKT A;  2D45 A;  1F5T A;  3Q9V A;  3M1E A;  5L3B A;  1U5T B;  1Q1H A;  2HFH A;  2BBY A;  4S05 A;  4Q4Z F;  2CQK A;  1LDD A;  4M9X A;  1ZN2 A;  2W57 A;  1S3J A;  4F7Z A;  2ZKZ A;  3NEU A;  1H9G A;  2MLG A;  4JK1 X;  3HHH A;  3WTU C;  2UZK A;  5DUI A;  3GWZ A;  4LG0 A;  3WTS C;  4A6E A;  2CWE A;  2WTE A;  2BE5 F;  5L3E A;  2V1D A;  3N97 A;  4AIK A;  3TKY A;  2XKP A;  1O3T A;  1L3L A;  5J6X A;  4ZYH A;  2IA1 A;  1BI3 A;  3L7W A;  4FHT A;  1LDJ A;  2HQN A;  4CO8 A;  4AIJ A;  3KCC A;  3O2P E;  5D4S A;  1I1S A;  1BIA A;  2ZJ2 A;  2XAQ A;  1UCR A;  5FB2 A;  3DPT A;  1FYL A;  4ENJ A;  1ONV A;  3V7C A;  2PN6 A;  3LAP A;  5JHU A;  1SD5 A;  1BI2 A;  2JPB A;  3TOA A;  5IT3 A;  4KDP A;  2H6C A;  2O61 A;  2ADU A;  4HBL A;  2VN2 A;  1KU3 A;  1ZAO A;  3G73 A;  2PFB A;  2CYY A;  4P9U A;  3J7A O;  2D1H A;  1FNN A;  1ZLJ A;  3GW2 A;  3FMR A;  2ESH A;  1W7P D;  1KU2 A;  1Z05 A;  1T38 A;  3TO7 A;  5AIP A;  1IXR C;  6PAX A;  1XDU A;  4GYI A;  4LB6 B;  4PGH A;  2XIG A;  2FU4 A;  1KQ8 A;  2LDU A;  4YIF A;  3WTW C;  3V8L A;  4HV6 A;  3FXU A;  3MAJ A;  2YSR A;  3AAF A;  2J5O A;  4LB5 A;  3J80 Z;  1Z9C A;  4M72 A;  2D2W A;  2F5F A;  2GAU A;  5FGM A;  4MQ9 F;  3WU0 A;  4GGG A;  4AD9 A;  3QAH A;  4LLN A;  5JI6 A;  5BS6 A;  1MJB A;  1WQ2 A;  1HBX G;  3E5X A;  2QEN A;  2W85 A;  5H20 A;  3JTH A;  3FHZ A;  2GWR A;  5F64 A;  2DPD A;  3S2W A;  3R4K A;  2RV8 A;  4RGS A;  3ZMZ A;  1UST A;  1QNT A;  1U3E M;  2EV6 A;  3BJ6 A;  2EA2 A;  3MQ0 A;  2AS5 F;  3K69 A;  4UVC A;  2HZT A;  3LQR A;  1IF1 A;  4EGZ A;  5LEK A;  3P9I A;  5ICC A;  3I71 A;  2H09 A;  1G3W A;  4CGZ A;  5FFX A;  2BYV E;  1CF7 A;  2L01 A;  4Y15 A;  3DXJ F;  1G4D A;  3GEZ A;  2VE9 A;  4CXF A;  1LB2 A;  2V1U A;  4HDV A;  2EV0 A;  4P55 A;  1TNS A;  4I09 A;  3I0T A;  1IAW A;  3JAM K;  4BXU A;  4L9J A;  1P4W A;  3RKY A;  4BYY A;  4A6D A;  5JVT A;  3WTT C;  3T5X A;  4GCV A;  4EM0 B;  1TLH B;  4KT5 C;  5ICG A;  5IT9 Z;  4EJW A;  4U88 A;  1L0O C;  2ZXJ A;  3FX3 A;  3H3U A;  2W24 A;  2HQR A;  2IRF G;  2HKX A;  3C1D A;  1HW2 A;  1TW3 A;  2KKO A;  4G6Q A;  4KUM A;  1MDM A;  3RPQ A;  1EV7 A;  2O03 A;  1YFH A;  2DK5 A;  1ZRF A;  1B6A A;  1QPM A;  1ZG5 A;  1QZZ A;  2VBZ A;  4L0Z B;  3MZY A;  2IVM A;  4CZZ A;  5TJJ A;  3WOD F;  3O6B B;  3RJP A;  2M5W A;  5L3C A;  1FBQ A;  2EK5 A;  5KK1 A;  1R5H A;  4WX9 A;  1MGT A;  3WGH A;  3WGI A;  4ZYD A;  1FC3 A;  2HTJ A;  2VBX A;  2A6H F;  4YFN F;  1R22 A;  3BPX A;  1ZRD A;  3C7J A;  3OOP A;  4M71 A;  4N9H A;  4EJU A;  1J59 A;  5DCM A;  3LWF A;  4EM2 A;  3HUG A;  1XMK A;  1USS A;  4GYG A;  1HW1 A;  3GFM A;  1IN4 A;  2FOK A;  5HLI A;  4Q47 A;  3GVA A;  2CFX A;  1I6X A;  3U9G A;  4ZZD A;  3KP3 A;  1Z6R A;  4FX4 A;  4L18 B;  2HOE A;  1D5V A;  4A12 A;  2H6B A;  4YFK F;  3KP4 A;  3HSF A;  5LHI A;  2PQ8 A;  2COM A;  5AIQ A;  2QBY A;  3HOS A;  3GFJ A;  4G8X A;  1F9N A;  4PGG A;  4OOI A;  2QWW A;  2VOO A;  4L9N A;  5ILS A;  2XRO A;  3L09 A;  4ESF A;  4LMY A;  2VC1 A;  5DUK A;  2ZFW A;  3IWZ A;  2X0L A;  4ZYG A;  4N0B A;  3CUO A;  1R58 A;  2DK8 A;  3ML6 A;  3CUQ A;  3DV8 A;  1UHM A;  5F1R A;  4RAZ A;  4ENK A;  5CVU A;  1BN5 A;  2P5K A;  4WF2 A;  4EJT A;  2DU9 A;  3RYP A;  3I4P A;  1GXQ A;  4HW0 A;  2HWV A;  1LDK B;  1YLF A;  2L4M A;  3KP7 A;  3QPT A;  3U2R A;  3IL2 A;  4WCG A;  3KET A;  4LLL A;  1YW8 A;  3T8T A;  4LG0 B;  1T98 A;  4MHG A;  3VEP A;  2UWM A;  3WG9 A;  1IZ1 A;  1WI9 A;  1XSX A;  5HS8 A;  3V7R A;  3V8J A;  1Z1D A;  2L54 A;  2XAG A;  3HRM A;  2QM3 A;  1YYV A;  2JPC A;  2FBH A;  3LST A;  2KIU A;  3LA2 A;  1R1U A;  4XLP F;  1B1B A;  2M30 A;  1IN8 A;  2OZ6 A;  2GXB A;  4OIQ F;  2CGP A;  2OU2 A;  4LK1 F;  1MKM A;  4D0P A;  3IWF A;  1NHA A;  1T0F A;  3RIR A;  1FYK A;  4O5V A;  5FD6 A;  1D8J A;  2KIF A;  4HX8 A;  1WSU A;  5K5R A;  1U8R A;  3PQK A;  3E6M A;  2F5E A;  2HEO A;  2LNB A;  3R60 A;  5E17 F;  5E1W A;  1X3U A;  5E8I A;  2LKP A;  4EJV A;  4IRG A;  3N4M A;  4G9Y A;  1SD4 A;  2M45 A;  1LQ1 A;  2QQ9 A;  1J2X A;  4M9Z A;  2ESN A;  5LGU A;  3E6D A;  1FZP B;  2F5C A;  2DAO A;  4UHT A;  2YPR A;  3HSR A;  1DPU A;  2V1X A;  5ERI A;  3HIF A;  3E97 A;  5D8L B;  2RC4 A;  1UHW A;  2FEZ A;  3E5U A;  4KFC A;  2XV4 S;  2VOP A;  3F8M A;  3MWM A;  2H27 A;  5D5X B;  2EFW A;  3FMS A;  1FPQ A;  2TDX A;  3LQQ A;  2DPU A;  4WXC A;  2XVC A;  4XLN F;  1R5G A;  2Y75 A;  3O3K A;  2FRH A;  2JSC A;  2FNA A;  3QPH A;  3RPU A;  3HOT A;  4HQE A;  3KLO A;  4MGR A;  4HA8 A;  3IHU A;  3HTU A;  4DNC A;  4CHU A;  5ICE A;  2YR2 A;  1XB4 A;  3FM3 A;  2VXZ A;  2FBI A;  1XGO A;  5HVQ C;  3IRQ A;  3M8E A;  4ETS A;  4MTE A;  3MCZ A;  3DF8 A;  2OQR A;  1KGS A;  5A2Q Z;  1G3T A;  2P6T A;  2QZ8 A;  1FP2 A;  5E8G A;  3QRF F;  1W5T A;  4Q5S F;  4ZZL A;  3ZMD A;  1T6S A;  5TRD A;  3KEO A;  4AVP A;  2ISY A;  2KJB A;  2P5L C;  4BHP A;  4A5N A;  1XGN A;  2HKO A;  1BI0 A;  3ZQ7 A;  4L5J A;  2FML A;  2A3S A;  4IJA A;  3P7N A;  2Y0M A;  3JTG A;  2FA5 A;  5DDG A;  1LNW A;  4KIF A;  4I98 B;  5AON A;  2H94 A;  4I7H A;  2P8T A;  5KVR A;  4UVB A;  1P2F A;  3CTA A;  4HOB A;  5HDG A;  2EV5 A;  3W6J B;  2RVC A;  2FE3 A;  1ZGJ A;  5CYV A;  1WRJ A;  3GYH X;  4G7Z F;  4HLX A;  1TQI A;  1FT9 A;  3Q9S A;  5CLS A;  1LJ9 A;  4RGR A;  4R1H A;  2R3S A;  2XRN A;  4OU0 A;  1SD7 A;  2HYF A;  2F2E A;  5K1Y A;  1V3F A;  4ASN A;  2ZNY A;  1K78 A;  2IA0 A;  1GVJ A;  3EDP A;  3FWE A;  1K79 A;  3BDD A;  5L3D A;  5EEH A;  1FY7 A;  1YTY A;  5D5U B;  4HDU A;  1FOK A;  2MC3 A;  3E6C C;  5CVV A;  2P5V A;  3HRU A;  2BV6 A;  5J8C A;  3GZ5 A;  1W7P B;  5HLG A;  3M7G A;  2VBY A;  1D3Y A;  3MEX A;  3W6K B;  3F8C A;  1AOY A;  1HST A;  4HV5 A;  2WWY A;  2FQ3 A;  2IP2 A;  4U7B A;  2NS0 A;  2VE8 A;  1T2K A;  4KIC A;  1ZAR A;  1UB9 A;  4CYD A;  2L3D A;  4R79 A;  3M8F A;  1I1G A;  4XSZ F;  1GHC A;  1P4A A;  5CJ9 A;  1SD6 A;  1FBU A;  1F4K A;  1G3S A;  2NNY A;  1DUX C;  4WXD A;  4OIN F;  2P7C B;  1XCB A;  4P9F A;  3KP2 A;  4UUV A;  5D4R A;  1K7A A;  3CO7 C;  1RUN A;  5E20 A;  2ZO4 A;  3GF2 A;  3ERE D;  3LAJ A;  4RAY A;  4IHT A;  1ON2 A;  2FF4 A;  3F23 A;  3DQV C;  2HGC A;  4I01 A;  2IW5 A;  4CIC A;  1J75 A;  5DEQ A;  1B9N A;  5LBQ A;  1JGS A;  3WE2 A;  4M6Y A;  1U5T A;  3GXO A;  4HLY A;  2E7W A;  3MFK A;  5LRR A;  2K02 A;  3IKT A;  3PQJ A;  3EQL F;  1LEB A;  1PP7 U;  1CF7 B;  3CUQ C;  3L9F A;  1IRG A;  5E1X A;  5DD4 A;  2XAH A;  1ODD A;  1XN7 A;  4RS8 A;  2AXL A;  1P4X A;  1YO5 C;  1MDM B;  2BGC A;  4BNC A;  5D6F A;  2A68 F;  1A04 A;  4LLG F;  5A2Q K;  3WTX C;  4G94 A;  2O6G E;  3CUQ B;  2PMH A;  2LSO A;  1PUE E;  4K2E A;  3ZMU A;  2ZME A;  3WTZ A;  4PCQ A;  1HSJ A;  5LGN A;  4BQA A;  5LEJ A;  5HDK A;  2XAJ A;  3R6S A;  1R7J A;  1YS6 A;  5FO5 A;  5H6Q A;  3F21 A;  4LJZ F;  4XSX F;  4I0B A;  2ZBK A;  4U0Y A;  1R1T A;  1OYW A;  3F8N A;  3KE2 A;  2PLY A;  2PJP A;  3D0S A;  4LFU A;  1IUY A;  1P6R A;  2GQQ A;  1OKR A;  3D5L A;  3EET A;  4QLC U;  3VOD A;  1BOA A;  1BC7 C;  4I02 A;  2DQL A;  1VTN C;  1UFM A;  4WWC A;  2G9W A;  5E1Z B;  4TV7 A;  3ISP A;  1S7A A;  4EJO A;  4Z2Y A;  1QBJ A;  3ZPL A;  4IPA A;  4LGW A;  3HRT A;  4ESB A;  3FF5 A;  3SQN A;  1U5T C;  2YU3 A;  5LHG A;  3CO6 C;  1FSE A;  3M9A A;  3QOP A;  5FD5 A;  4A2U A;  4EV0 A;  2VT2 A;  1JE8 A;  2LF7 A;  3GZ6 A;  2Z9O A;  1W5S A;  2Q0O A;  1R23 A;  3KLN A;  3I54 A;  4MNU A;  1RZ4 A;  3B73 A;  2DT5 A;  4YII A;  3FZV A;  4OMZ A;  4M73 A;  3KP5 A;  2PMU A;  2EA4 A;  2ZCW A;  2EFO A;  3F3X A;  3DPL C;  1XGS A;  3JW4 A;  3COA C;  4HYE A;  4KN4 X;  4BHB A;  3KEQ A;  3SZT A;  3IKV A; 
#chains in the Genus database with same CATH topology
 1QQI A;  2B63 J;  3J81 Z;  3FXR A;  1ORK A;  4Y4R A;  2GIV A;  3L2C A;  4B43 A;  1IN6 A;  2NAZ A;  4KA4 A;  2JUC A;  3ABU A;  3ZQH A;  4DZP A;  3GTP J;  3GLX A;  1K4T A;  1S29 A;  1QZE A;  1FYM A;  3FKI J;  2MA3 A;  3HOV J;  4A0X A;  3ASO H;  4E7J A;  4AU7 A;  1Y0U A;  2GZW A;  2KMU A;  1TQP A;  3AG3 H;  2M7A A;  3TMO A;  3GZN B;  3MVP A;  1BW6 A;  2XGX A;  1G2H A;  1SAX A;  3DFG A;  3Q0U A;  3S3O A;  3RYR A;  4DYR A;  4QPQ A;  4L9T A;  2V7F A;  2Z2S B;  2ACJ A;  4PSX A;  2LMD A;  3GCM A;  2HS5 A;  3C2B A;  1AA7 A;  1MJA A;  3CME I;  4MEX F;  1MZB A;  4NHJ A;  5BMZ A;  5ICF A;  4Z6Y A;  5IT9 K;  3C3W A;  5H6R A;  3DBR B;  3C2G A;  1ZR4 A;  4C3H J;  2NXN B;  1U6G A;  2R7Q A;  3CD6 I;  5HOO A;  2IEK A;  3ZMT A;  1ETO A;  1GT0 C;  4KNY A;  2A61 A;  4MQV A;  2HU9 A;  1YHQ I;  1T33 A;  4B3X A;  2G7U A;  1BJA A;  3HTS B;  4J19 A;  5BPI A;  1VQN I;  1QHH D;  2XAS A;  1LVA A;  5DS9 A;  2QSF X;  2HVR A;  2DOD A;  2VIX A;  2M34 A;  2M8E A;  4XM3 A;  4NBQ A;  5IP6 A;  2Z1D A;  2C6Y A;  3S14 J;  1TQM A;  1IXS B;  2QVO A;  2EIK H;  4R8H A;  3DKX A;  1VQ7 I;  1R00 A;  2PG4 A;  4A0Y A;  4FT8 A;  4ESJ A;  4C3I J;  3CMY A;  1PJR A;  2X85 A;  5K5O A;  3MKY B;  5BQT A;  1B9M A;  2DCE A;  4EVI A;  4BQO A;  2FSW A;  1T39 A;  4Y17 A;  1LE8 A;  1U78 A;  4DOZ A;  2VON A;  3K1N A;  3P9C A;  2JA7 J;  2CUE A;  3EUH A;  1HW5 A;  2BXZ A;  4BAY A;  4EQQ A;  3DU6 A;  3NRV A;  3DEW A;  4BQN A;  4BH9 A;  2KL4 A;  2STW A;  5FLX K;  1LFB A;  1HF0 A;  1VQ6 I;  2HTS A;  2Z99 A;  4JX6 A;  4G7H F;  2RN7 A;  4F52 A;  1BR2 A;  3LFK A;  4F92 B;  1V5G A;  1QZY A;  2RDP A;  2GA1 A;  2E2I J;  3NWT A;  2Y30 A;  2DO7 A;  3VB2 A;  1IRZ A;  2K3P A;  2UXN A;  1DQU A;  1ZGA A;  3VDX A;  4BY7 J;  2RQP A;  3BOQ A;  4E6K G;  1ETQ A;  2ZFU A;  4M3F A;  5IP9 J;  4L0Y B;  3ULQ B;  4IVN A;  2L4A A;  3K9T A;  1S7E A;  2QQA A;  2RAE A;  1ZRC A;  3EYI A;  3K6G A;  4A3K J;  1UG2 A;  1X2N A;  3TO9 A;  3OR2 C;  1TWC J;  3PFI A;  2K86 A;  1X1B A;  3I3L A;  4FAS D;  3L2R A;  2JA5 J;  3EPZ A;  2QQ8 A;  3GLL A;  4UNO A;  3JRI A;  1WKM A;  3VYT B;  1P92 A;  3H35 A;  4BJ6 C;  3ECO A;  4BDZ A;  1FOY A;  3PUF A;  1ZGW A;  3KEY A;  1S7O A;  1G59 A;  2L0K A;  4IF4 A;  1LEA A;  2O3F A;  4ON0 A;  1S9H A;  3I58 A;  3Q0V A;  4D1Q A;  1VQO I;  1ZQ3 P;  3S16 J;  1XSD A;  4RB2 C;  4LIT A;  4GXO A;  4P96 A;  3OIQ A;  2V6E A;  4A3B J;  2V6C A;  2BY3 A;  1SMT A;  2Q8K A;  1TW2 A;  2D1V A;  2BW3 A;  3A01 B;  3V7S A;  2M2E A;  1HCR A;  2QLZ A;  3J7Y J;  2EFN A;  3FKJ A;  3I4N J;  1V55 H;  2NS7 A;  3OOU A;  1U9O A;  4XIC A;  3JSP A;  3TOB A;  1Z77 A;  4KIT B;  2P4W A;  5TIS C;  3ECH A;  1AHD P;  3S2H J;  5DCM B;  5LGT A;  3QWL A;  1BC8 C;  2HDC A;  3OWT A;  1A35 A;  4UV9 A;  1ZLK A;  1SVO A;  5CQE A;  5KAF C;  2VL8 A;  1IDZ A;  3ABM H;  5DYM A;  2QQB A;  1IN5 A;  1Y1V J;  4H0E A;  1OCT C;  2EPF A;  5FLV A;  2WAQ A;  3AG2 H;  3ABL H;  2B0L A;  2OA4 A;  2MW8 A;  3FM5 A;  3OYD A;  3KPH A;  1ZHF A;  4JX5 A;  1SFO J;  4MO7 A;  2HVS A;  1J0R A;  2DT6 A;  3SFZ A;  3I56 I;  2OPT A;  5D6E A;  2DLL A;  4BAC A;  1YW7 A;  3BG6 A;  2VKD A;  4XLC A;  1JJ8 C;  4UUS A;  1VF9 A;  1B4A A;  3BTL A;  5EEG A;  4FIS A;  3JRG A;  5L3F A;  2N8G A;  1RUO A;  2JUG A;  2QUF A;  3GTG J;  4IOA F;  1X4O A;  1BBY A;  3BJO A;  3IC7 A;  1H9T A;  2MAB A;  3I5U A;  1IW7 F;  1ZK8 A;  2NYX A;  4OMY A;  3F22 A;  2R7X A;  5HS9 A;  5E18 F;  2MBF A;  4N4N B;  2QKL B;  1R4N B;  2WC2 A;  3CCM I;  2QF7 A;  3SXY A;  1HKS A;  1YE9 A;  2ELH A;  2KIM A;  4LK0 F;  1BI1 A;  3R0J A;  2VBW A;  3U1D A;  2JZY A;  1OYI A;  1FMV A;  4U0V A;  1J9I A;  2E1O A;  5KCM A;  3G6E I;  4EM1 A;  2STT A;  1B59 A;  2FJ1 A;  2DMN A;  3RCO A;  2Y48 A;  3F6V A;  3CCQ I;  4O3M A;  2YX4 A;  5F0F A;  1JHF A;  1OJL A;  1OR7 A;  4D5F A;  5J1Y A;  1FSH A;  4Y3O A;  3S1N J;  3DEE A;  2R7V A;  4EGY A;  1OPC A;  1KZH A;  4Y7N J;  1GV2 A;  1D8K A;  2LOO A;  1H88 C;  2Y9Z A;  1IV6 A;  4DQ2 A;  2PBI A;  5BPD A;  1VQ4 I;  2DOE A;  2EFQ A;  2HQA A;  3LSI A;  5F04 A;  3ZMV A;  1J7K A;  2ZSI B;  2BOL A;  2QYO A;  1Z0X A;  1I5Z A;  2NRA C;  3JSO A;  3DKY A;  4GRI A;  3BCB A;  2O7O A;  2M1B A;  2K7L A;  1XX5 A;  5L3G A;  2VUM J;  3LA3 A;  1O3S A;  1XGM A;  4OIP F;  3EYY A;  1DPR A;  1KYZ A;  5F0C A;  1MW7 A;  3FDY A;  4M3E A;  1DGW Y;  1YIO A;  3CCU I;  1U0J A;  3L2W A;  2GA2 A;  2M3A A;  3QP6 A;  1ZG1 A;  3V8K A;  5FRN A;  3OIP A;  1PDN C;  4YEL A;  4U0W A;  4A0Z A;  5ED4 A;  2EFP A;  2A5Y B;  1MBJ A;  2FMY A;  3RTR A;  3J81 K;  3U1K A;  2KP6 A;  4M9S A;  3TDU C;  2L9V A;  2DYR H;  3J80 K;  2K5C A;  3G71 I;  1QA6 A;  2EIM H;  3H92 A;  1MIJ A;  3KFW X;  1EH7 A;  2LR8 A;  4BBS J;  2Z3Y A;  2MH9 A;  2K9M A;  2XRL A;  3BWG A;  3TQN A;  3HSE A;  1F36 A;  4PFP A;  4DBR A;  2XAF A;  1MBK A;  1XD7 A;  2MLK A;  2COB A;  3EUA A;  3R61 A;  4X1E A;  2JT1 A;  4XOR A;  1W5C C;  2FXA A;  3KZY A;  5DCF A;  1ULY A;  4GO1 A;  1X1C A;  2A07 F;  3ZR8 X;  1RPW A;  2IJL A;  4XLE A;  3K70 C;  3FXL A;  1E2X A;  2DI3 A;  3RSN A;  1E3P A;  3B6A A;  3RKW A;  4U7D A;  4P1W A;  2X1E A;  3KZZ A;  3DTI A;  3HRS A;  3QPS A;  1G6N A;  3BCA A;  4KYW A;  3A02 A;  2DA5 A;  1TWA J;  3WTY C;  5F27 A;  1IXC A;  3S1M J;  3QU6 A;  2A5W A;  1AKH A;  3M4O J;  2VOD A;  1OCP A;  3F72 A;  4PUS A;  3K1P A;  2W82 A;  1KU9 A;  3T0Y A;  5JR3 A;  1DDN A;  1IG7 A;  4KMU X;  4A93 J;  1UG0 A;  1XSV A;  2NOG A;  2R4G A;  2KIS A;  2DW4 A;  2CSO A;  1AWC A;  3CMA I;  2YU9 J;  3F8F A;  4S04 A;  3K2Z A;  3OYK A;  4UXN A;  2CW8 A;  2F4O B;  3L00 A;  2OZU A;  1YRN A;  5LRS A;  4J00 A;  3TW7 A;  3F0C A;  4CDG A;  1FBS A;  1I27 A;  4QWQ A;  3S1R J;  2DBB A;  1D0Z A;  5D5W B;  2BEO A;  5DD8 A;  2F48 A;  2KRF A;  4RA2 A;  5JFR A;  3OS2 A;  3E7L A;  1Z3Y A;  2K4J A;  3PO3 J;  1WGX A;  2JVG A;  3I59 B;  3WE3 A;  1MSE C;  2VKV A;  1YW9 A;  5CVR A;  2E1C A;  1OMI A;  1SFX A;  2B7E A;  1GUU A;  3FK6 A;  1YQA A;  4HX7 A;  2LRD A;  2O0Y A;  2DA3 A;  1RNL A;  4XID A;  5F1J A;  2M8G X;  3DBH B;  1MMD A;  1X2M A;  4ZTJ A;  2ZME C;  5BOX A;  4G6D A;  2LF8 A;  4NDL A;  1WH7 A;  2RKH A;  1W0T A;  5LHH A;  4KIB A;  2CW0 F;  3ZXS A;  2WB1 A;  2CO5 A;  4A69 C;  2XKO A;  2JVH A;  4HZF A;  4IHX A;  2X4H A;  4BHC A;  1W4M A;  4L9V A;  2IT0 A;  4BXF A;  3WTV C;  2ZNZ A;  1X58 A;  1LFU P;  4AID A;  3M1C A;  3ONQ A;  2GXG A;  1WWX A;  3C18 A;  1MMN A;  2E5N A;  3QP5 A;  1DU6 A;  3OYF A;  3BG5 A;  4IQJ A;  2KFD A;  1SFE A;  1Z3X A;  4JQF A;  2OC6 A;  3AG4 H;  4UVA A;  1W36 D;  5GP9 A;  3CC2 I;  2QBY B;  2DTR A;  2QCO A;  2ZXI A;  4O6J A;  3MN2 A;  3B6C A;  4W1U A;  4FE4 A;  3TGN A;  3VWB A;  4HX4 A;  4Q48 A;  5BNG A;  4A3L J;  3T1B A;  2VAS A;  1F1Z A;  3Q3S A;  2DA2 A;  3AL0 B;  3F6O A;  3P9K A;  3SHF A;  4ENN A;  3VYU B;  2UV1 A;  1JUM A;  1N25 A;  3VOE A;  1UHS A;  2NS8 A;  3BY6 A;  2J5P A;  4HEA 2;  1KU7 A;  4HQM A;  4RB0 A;  1MBE A;  5E3M A;  5CVJ A;  4B8X A;  2OTL I;  2BW3 B;  2JA2 A;  2ZXH A;  3TO6 A;  3KYL A;  1OR7 C;  3H3Z A;  4M74 A;  2CH0 A;  4M6X A;  2D5V A;  1FWZ A;  1JHH A;  4HAM A;  5M3M J;  3CJN A;  4AYB N;  2EQR A;  3CDH A;  3BZC A;  1RKW A;  5KHD A;  3PFY A;  1V4R A;  2DQR A;  2LVS A;  3DEU A;  1ZYR F;  2CG4 A;  3RQI A;  1O7F A;  1J5Y A;  1OCR H;  4JBA A;  3G1O A;  4ZH4 F;  2FUG 2;  2IPQ X;  2MD0 A;  3JRB A;  1B8I A;  3NQO A;  4IO9 F;  3QQA A;  1HQC A;  3H36 A;  2XHK A;  1OCZ H;  5B1A H;  4RB1 A;  1BA5 A;  2FNP A;  2HR3 A;  4IRH A;  4B47 A;  2YS9 A;  1STZ A;  1MJ9 A;  3S93 A;  4ZYE A;  5D8K B;  3B02 A;  3HDD A;  4OIR F;  4E4H A;  3A03 A;  3W2A A;  2V79 A;  4A5M A;  4NC6 A;  3F8B A;  1MBH A;  2W25 A;  2HPI A;  4A3E J;  5H2F C;  1SMY F;  4BJ5 C;  3ABT A;  2V26 A;  3K0L A;  2G7H A;  4DGW B;  4NB5 A;  5GPC A;  1ITY A;  1EH6 A;  1TT5 B;  2FOW A;  3H0D A;  3ZQL A;  1I39 A;  3WU1 B;  3CP8 A;  4EMS A;  3REO A;  2QGU A;  3TDZ C;  4HSR A;  3OYC A;  3GUD A;  5D5V B;  2KJC A;  4KN7 X;  4DIQ A;  2WAD A;  3BP8 A;  1HXD A;  4NC8 A;  2LBF B;  3SEZ A;  3GFI A;  1IRX A;  2DMQ A;  1REP C;  1ETY A;  3DCF A;  3M3Y J;  1C0W A;  2O9L A;  3BTC A;  2XUB A;  4CCN A;  3Q5F A;  1YS7 A;  1HDD C;  1O57 A;  2R5Y A;  3GTO J;  4BE2 A;  2DFI A;  2L9R A;  2OAZ A;  2Q2E A;  4MLO A;  4XOP A;  3CJQ B;  2R5Z B;  5GAE J;  2CU7 A;  1G3Y A;  3ZMS A;  1H89 C;  2LK2 A;  2ISZ A;  1JXS A;  3HC7 A;  4RB3 C;  2VC0 A;  1BM9 A;  3CES A;  3RQ4 A;  3TBI A;  3RKX A;  5FKM A;  1NK3 P;  9ANT A;  2A05 A;  1BIB A;  1JKO C;  1DP7 P;  3K4M A;  1JGG A;  3FMQ A;  2WV0 A;  3JAM Z;  3ELK A;  3I64 A;  1XDS A;  3ESW B;  4RGX A;  3V42 A;  4AC0 A;  3IAS 2;  3UR3 C;  5EJC A;  4I0A A;  3H5A A;  3K1M A;  3HPG A;  3ZP5 A;  1YG2 A;  3QU3 A;  3AG1 H;  1OYY A;  1HKQ A;  3UNG C;  3ROU A;  1OFC X;  5DV5 A;  3BPV A;  1O7L A;  3I4M J;  5B1B H;  1GXP A;  1FTZ A;  1RES A;  2OD5 A;  1TNT A;  1XMA A;  5K7Z A;  5ILV A;  1JUP A;  2F5D A;  2NVX J;  1PUF B;  1QO0 D;  2RNJ A;  2DDB A;  2GIZ A;  3S15 J;  2RNG A;  2EIJ H;  1P9Q C;  3HYI A;  4FX0 A;  1K6O A;  3DKW A;  4IHS A;  3IH2 A;  3GTJ J;  3LA7 A;  2MD5 A;  5K7H A;  4Y13 A;  1FTT A;  5HLH A;  3K4N A;  2DDA A;  3O8H A;  5M5W J;  3V4G A;  2MSY A;  1U2W A;  4DYQ A;  1EH8 A;  2JTV A;  3ZN1 A;  2HXI A;  4ENM A;  1KQ0 A;  2RGV A;  2O8X A;  3T8R A;  3OYG A;  3IRR A;  3JRD A;  1PP8 F;  2E2H J;  1T95 A;  2VJ4 A;  2KDO A;  4RAG A;  3G2B A;  2CV2 A;  1ON1 A;  3LSJ A;  4PZJ A;  1H8A C;  1H0M A;  2E71 A;  2V9V A;  1QGP A;  4QPO A;  5ILU A;  2HPM A;  2FD5 A;  1SAU A;  4F93 B;  1MH3 A;  4HF2 A;  1TWH J;  2A69 F;  5M5Y J;  4LIV A;  4KIG A;  5GAH J;  2VKE A;  3HEF A;  1TTY A;  1B72 B;  2EJR A;  2E34 A;  3VFZ A;  2DOF A;  3GBG A;  5IYC J;  3LL7 A;  2Z5U A;  1Z91 A;  3ZN0 A;  3IAM 2;  1KQ9 A;  2L5Q A;  1MD0 A;  4MTD A;  2X6Y A;  1RIO H;  1QVU A;  4WK8 F;  4MEY F;  3AFH A;  2R7F A;  5CPR B;  2PI0 A;  2CUZ A;  4QIW N;  5CKT A;  4NQW A;  4KJZ A;  4J01 A;  3G3Z A;  4P5O A;  2E7X A;  1WJ5 A;  2LH9 A;  4KMF A;  3TP0 A;  4YG2 F;  2DA1 A;  2QSH X;  4II2 A;  3CDI A;  2BXY A;  3PIO F;  1CGP A;  3I53 A;  1D1A A;  4LD5 A;  1JUS A;  2OUM A;  3GO5 A;  3CJT B;  2L02 A;  3GFL A;  3FBN B;  4E70 A;  2EB7 A;  1O3Q A;  3RI4 A;  4HF1 A;  1W7P A;  3H3V K;  1FLI A;  2E1N A;  4JP0 A;  4N4O B;  4L5I A;  2OQG A;  1KYW A;  1V5E A;  1Y6I A;  2ETH A;  2NVU B;  5IOZ A;  1E17 A;  4UB8 C;  5J4V A;  4BXX J;  1FP1 D;  3OS0 A;  2IS6 A;  2K9S A;  3A0H C;  2VT3 A;  1Z7U A;  3CLO A;  5F6F A;  2KHM A;  3MZH A;  2HZD A;  4AIH A;  1DP3 A;  2PEX A;  1KA8 A;  3OYI A;  4RGU A;  4C2M J;  5IYB J;  4AWX B;  1GDT A;  3U21 A;  5K5Q A;  1N77 A;  4F55 A;  3H9G A;  2DA7 A;  1TBX A;  2F5V A;  3CZ6 A;  2A6E F;  1K78 B;  5CVI A;  1XCV A;  1FX7 A;  1IRF A;  4V2F A;  1LUJ B;  2LY9 A;  3MZ8 A;  3E3V A;  1R1V A;  3H9J A;  3SZP A;  1SFU A;  3K4J A;  3BRO A;  3BR6 A;  1IN7 A;  1VQ9 I;  4B09 A;  3J7Z I;  1EF4 A;  2K4B A;  2Y0S N;  3FXQ A;  3DLL F;  1S6L A;  1S8N A;  4YFX F;  3E5Q A;  3E6B A;  3S3M A;  3UKG A;  5HS7 A;  5IOY A;  2ECC A;  3QYB A;  4MFD A;  4PDK A;  5HDN A;  2JN6 A;  2KQR A;  2P6S A;  2HOA A;  4OIO F;  4G7O F;  5LLQ A;  2FQ4 A;  3KP6 A;  3RDI A;  3SDB A;  2IA2 A;  4N9I A;  4XRF A;  3FK7 A;  2K27 A;  5EF6 A;  4KT6 A;  5FKL A;  1APL C;  3PUB A;  2ZC2 A;  1RI7 A;  2IGN A;  4BL0 B;  5IYD J;  3DBL B;  4WXH A;  3BZ6 A;  3D5R C;  3G1M A;  4XBF A;  4UV8 A;  5FLX Z;  2M87 A;  2UXX A;  2OBP A;  1AKH B;  3FXO A;  1V54 H;  4I2O A;  4CCK A;  3BJA A;  1WHU A;  3KYD B;  3OIO A;  4HST A;  2HQ5 A;  1WJE A;  2CUF A;  3DP7 A;  4IXA A;  4IRI A;  2VXD A;  2EWN A;  3R0A A;  5FFZ A;  2JRT A;  3I59 A;  5C4J J;  3GX4 X;  1ZRE A;  4D7N A;  4RMN A;  2R7D A;  3OV8 A;  3BTI A;  2EH3 A;  1Z6T A;  1R36 A;  4IX7 A;  1ZH5 A;  1ZG3 A;  3HHG A;  1X19 A;  2X6O A;  2HOT A;  2ZME B;  4G6T B;  3QYE A;  2P7V B;  2VPR A;  5GAD J;  4UUT A;  1YI2 I;  2FBK A;  2XGD A;  2YX7 A;  2XB5 A;  2LY2 A;  2NNN A;  4IL6 C;  4HF0 A;  1HDP A;  5J8F A;  1VI0 A;  2W84 A;  2M0C A;  1W1W E;  1O3R A;  2HYG D;  2AQE A;  1TP4 A;  4E7Z A;  2VQH A;  2Z33 A;  1R49 A;  2MH2 A;  3WGG A;  3VYS B;  4C30 A;  3A1Y A;  1HKT A;  1NG7 A;  2D45 A;  1PVE A;  3CF2 A;  1F5T A;  3Q9V A;  2VQG A;  3M1E A;  5L3B A;  1U5T B;  3OYH A;  1Q1H A;  2HFH A;  2BBY A;  4S05 A;  4Q4Z F;  2CQK A;  1LDD A;  1CQT A;  4M9X A;  4XKC A;  1ZN2 A;  2Y2Z A;  1HA8 A;  1VFC A;  2W57 A;  2JQ7 A;  1S3J A;  4RLQ A;  4F7Z A;  3D5S C;  2ZKZ A;  3RZD J;  1JKQ C;  3NEU A;  1H9G A;  2MLG A;  4RDU A;  1D1C A;  4JK1 X;  5FKO A;  4A3C J;  3ERM A;  1MNE A;  3HHH A;  3WTU C;  4ZTF A;  2UZK A;  1MMG A;  3BR1 A;  1O4X A;  3EUK L;  5DUI A;  4EEF G;  3GWZ A;  4JX4 A;  1YIT I;  4LG0 A;  3WTS C;  3H0G J;  4A6E A;  4PSW A;  4XQF A;  2CWE A;  2WTE A;  3FBI B;  2BE5 F;  5L3E A;  2V1D A;  1TWF J;  3N97 A;  3BQY A;  4AIK A;  3TKY A;  2XKP A;  4BBR J;  1YJW I;  1O3T A;  1TT0 A;  4EAT A;  1R9T J;  1L3L A;  5J6X A;  4H4K C;  5JHF A;  1ETW A;  4ZYH A;  2IA1 A;  3TP3 A;  2DA4 A;  1BI3 A;  1EKE A;  3A2K A;  3L7W A;  4FHT A;  3PO2 J;  1FMW A;  1LDJ A;  2HQN A;  4CO8 A;  2R5Y B;  4AIJ A;  3KCC A;  2IBD A;  4M3G A;  3O2P E;  4ZDO A;  5D4S A;  1I1S A;  1BIA A;  1RET A;  1K83 J;  2ZJ2 A;  2XAQ A;  1UCR A;  2LFB A;  5FB2 A;  3J7A Y;  3IP4 B;  3DPT A;  2R7U A;  1FYL A;  2CV0 A;  2E1M C;  2XSJ C;  1R6R A;  4ENJ A;  1ONV A;  4C2U A;  3V7C A;  3W6V A;  2PN6 A;  3LSH A;  3LNQ A;  2K40 A;  2GOX B;  4DYC A;  3L1P A;  3LAP A;  4XRM A;  5EDN A;  5JHU A;  1SD5 A;  2JA6 J;  1BI2 A;  4BEH A;  1A5J A;  1KON A;  5J4Y A;  4BKX A;  3GTK J;  1WJF A;  1TZL A;  2JPB A;  2X1D A;  3TOA A;  4OWR B;  4OAY A;  2DFE A;  1WPK A;  4V19 K;  5IT3 A;  2F4M B;  2E1M B;  2ZJQ F;  4KDP A;  2H6C A;  4BUP A;  2DMU A;  4IHV A;  2R93 J;  3HZJ A;  2G0E A;  2ADU A;  4HBL A;  2O61 A;  2VN2 A;  2BVM A;  1KU3 A;  1XS9 A;  1ZAO A;  3G73 A;  2PFB A;  2CYY A;  4P9U A;  1RRJ A;  2QEX I;  1F43 A;  3J7A O;  2Z16 A;  2D1H A;  1R4M B;  1FNN A;  1ZLJ A;  3GW2 A;  4OAZ A;  3FMR A;  2ESH A;  2DFH A;  1XC5 A;  1W7P D;  5C44 J;  1KU2 A;  1Z05 A;  1T38 A;  3TO7 A;  5AIP A;  1IXR C;  6PAX A;  1XDU A;  4GYI A;  2W7N A;  3PNT A;  4LB6 B;  3CJR B;  4PGH A;  1WJA A;  3CP2 A;  1FEX A;  2XIG A;  5E79 C;  2FU4 A;  1KQ8 A;  1K4S A;  2LDU A;  2ECB A;  4YIF A;  3ZQQ A;  4CZC A;  3WTW C;  3V8L A;  4FET A;  3L2V A;  3FXU A;  4HV6 A;  3MAJ A;  1MBG A;  2YSR A;  3AAF A;  4BQQ A;  4S0H B;  2HXO A;  2J5O A;  2DXI A;  4HG2 A;  4LB5 A;  3J80 Z;  1Z9C A;  4ABZ A;  3CCV I;  3SYT A;  3G1L A;  4M72 A;  4PK4 A;  2WY8 Q;  1XG1 A;  5KAI C;  2D2W A;  2F5F A;  1IV8 A;  2ME0 A;  2GAU A;  5FGM A;  4MQ9 F;  3WU0 A;  4GGG A;  4AD9 A;  1Z67 A;  2E2J J;  3QAH A;  4LLN A;  4CCM A;  5JI6 A;  5BS6 A;  1MJB A;  1WQ2 A;  5CQG A;  1HBX G;  3E5X A;  3OL4 A;  4BGD A;  2BY1 A;  2QEN A;  2W85 A;  2I8D A;  1T8I A;  5H20 A;  2X6W A;  4NQW B;  3JTH A;  1D0Y A;  3FHZ A;  2GWR A;  2K9L A;  5EG0 A;  5F64 A;  1OIS A;  3S2W A;  2DPD A;  3R4K A;  2RV8 A;  5F0H A;  4RGS A;  3ZMZ A;  1UST A;  1QNT A;  1U3E M;  2EV6 A;  5E3O A;  3BJ6 A;  4ANJ A;  2EA2 A;  3MQ0 A;  2AS5 F;  4HNU A;  5C4X J;  2F6C A;  1IO2 A;  2R7R A;  4BU2 A;  3K69 A;  2OCE A;  3HBL A;  4UVC A;  1YX3 A;  2HZT A;  1R5I D;  3LQR A;  3BR2 A;  3CQZ J;  3ZCO A;  1IF1 A;  4I76 A;  4EGZ A;  5LEK A;  2V1N A;  1YOV B;  1M1E B;  1WFX A;  2K85 A;  3H9Q A;  3P9I A;  1T56 A;  3CCS I;  5ICC A;  1DGR M;  1X3W B;  3WG7 H;  5EEA A;  2X6X A;  4CCJ A;  1UAA A;  3I71 A;  5J1U A;  2H09 A;  1G3W A;  4CGZ A;  2TCT A;  5FFX A;  3TL4 X;  2CQX A;  1VQ5 I;  1ZKG A;  2BYV E;  1CF7 A;  2L01 A;  4Y15 A;  3DXJ F;  1BR4 A;  2KRC A;  4U87 A;  1G4D A;  1SVL A;  3GEZ A;  2VE9 A;  1HLV A;  4D5C A;  4CXF A;  1LB2 A;  2LKX A;  2V1U A;  4HDV A;  2EV0 A;  3OYA A;  4CYC B;  4P55 A;  1TNS A;  3KYC B;  2KLO A;  4I09 A;  3I0T A;  3MKZ A;  2KDZ A;  1IAW A;  2BY2 A;  3BQZ A;  3JAM K;  4BXU A;  3HGY A;  4L9J A;  1P4W A;  1WCM J;  3RKY A;  4BYY A;  4A6D A;  5JVT A;  3WTT C;  4XN3 A;  3T5X A;  1WJB A;  2GLO A;  4GCV A;  1Y1W J;  4EM0 B;  1TLH B;  2IAI A;  4KT5 C;  5B3S H;  5HLT A;  5ICG A;  2QA4 I;  5IT9 Z;  4EJW A;  4U88 A;  3CMM A;  1L0O C;  1QHG A;  2CUJ A;  2JRM A;  2JSP A;  2ZXJ A;  2X1C A;  1RKT A;  2WBM A;  3FX3 A;  4BE1 A;  3H1C A;  4CSW A;  3E1S A;  3H3U A;  2L7M P;  1T0F C;  2CQN A;  4C9Y A;  3I55 I;  2M4G A;  4PJN A;  2W24 A;  2HQR A;  2L2O A;  1EJ9 A;  2IRF G;  3OYM A;  1ETK A;  3G4S I;  4XNF A;  1WZ2 A;  2HKX A;  1BR1 A;  3C1D A;  5DTD A;  1HW2 A;  5JVG F;  4JYK A;  1J09 A;  1TW3 A;  2XF5 A;  2KKO A;  5EZG A;  4XK4 A;  3HM5 A;  4G6Q A;  4KUM A;  2R0Q C;  1MDM A;  2DMP A;  2L9S A;  3RPQ A;  1EV7 A;  2O03 A;  2ME6 A;  3SEQ A;  1YFH A;  2DK5 A;  4NUB A;  3GTL J;  2XPU A;  4E7L A;  3JR9 A;  1ZRF A;  1B6A A;  2P0W A;  2LC2 A;  1POG A;  3PIP F;  4A3G J;  1ACI A;  1MNM C;  2HI3 A;  2XGE A;  1QPM A;  1ZG5 A;  3OYE A;  3PSF A;  4CA0 A;  1QZZ A;  2VBZ A;  4L0Z B;  2R5Z A;  3MZY A;  2IVM A;  1GVD A;  4CZZ A;  2Q2E B;  1JTX A;  5IP7 J;  5TJJ A;  4AVZ A;  4A3I J;  4IHW A;  3WOD F;  3O6B B;  3ZRG A;  1QU3 A;  3RJP A;  3IV5 A;  2M5W A;  3E0J B;  2CMP A;  5FRM A;  5L3C A;  3RZO J;  1SFK A;  3HUG B;  1FBQ A;  3L2Q A;  2EK5 A;  2PJR A;  3ZQI A;  1VQM I;  5KK1 A;  2PMZ A;  1R5H A;  3FIS A;  4WX9 A;  3GTQ J;  1MGT A;  3WGH A;  3WGI A;  4ZYD A;  1FC3 A;  2HTJ A;  2VBX A;  5F08 A;  5TGT A;  1SVM A;  2A6H F;  3ZQF A;  4YFN F;  4KIS A;  1R22 A;  1BW5 A;  2WB1 N;  4C2T A;  2DFF A;  3QYF A;  5GPA A;  3W3C A;  3BPX A;  1ZRD A;  2ID3 A;  3C7J A;  4G12 A;  3OSG A;  5EG0 B;  3OOP A;  3JRF A;  2ZSH B;  4M71 A;  3LSK A;  3BT9 A;  4N9H A;  2ZJR F;  1IGN A;  1W0U A;  4EJU A;  1J59 A;  5DCM A;  1WVR A;  1VQ8 I;  3K4L A;  1UEL B;  2NVT J;  3LWF A;  4EM2 A;  3BC8 A;  3HUG A;  1XMK A;  1USS A;  4GYG A;  1UJ8 A;  3GME A;  1HW1 A;  3GFM A;  4PJL A;  2ZXW H;  1IN4 A;  2FOK A;  5HLI A;  4Q47 A;  3A01 A;  3GVA A;  2CFX A;  1I6X A;  5IY5 H;  3U9G A;  3ZGK A;  4CUG A;  3ASN H;  1IJW C;  3HPH A;  4HRI A;  4ZZD A;  3KP3 A;  1Z6R A;  2UUZ A;  5M5X J;  2NOJ B;  4FX4 A;  4L18 B;  2GXA A;  2HOE A;  2GM4 A;  1D5V A;  4A12 A;  2ZB9 A;  2H6B A;  2M4K A;  4YFK F;  3KIO A;  3KP4 A;  5LFA A;  2K3F A;  5EGO A;  3HSF A;  3H5N A;  5LHI A;  2PQ8 A;  2COM A;  2DTZ A;  5AIQ A;  2QBY A;  3HOS A;  1FOX A;  3GFJ A;  3LSP A;  3K2A A;  2X9D A;  1VQP I;  4G8X A;  4NC7 A;  1Y8Q B;  2EZL A;  1A31 A;  2KZG A;  2E60 A;  1F9N A;  1FIP A;  3W2W A;  4PGG A;  4OOI A;  2QWW A;  4PFO A;  2MFZ A;  4L9N A;  5ILS A;  2VOO A;  2XRO A;  4E7S A;  1E3O C;  3L09 A;  3FXK A;  4ESF A;  3K10 A;  4LMY A;  1YJN I;  2VC1 A;  1Z21 A;  5DUK A;  4HPQ A;  3SZG A;  2JA8 J;  2ZFW A;  1S5L C;  1I3Q J;  3IWZ A;  4RBO A;  1GV5 A;  1JI8 A;  2X0L A;  5HOD A;  3QPL A;  1HOM A;  4ZYG A;  4N0B A;  3OYB A;  2OV7 A;  2R7W A;  3CUO A;  2AO9 A;  1R58 A;  2DK8 A;  3ML6 A;  3K4B A;  4ZYA A;  5J47 A;  4A3J J;  1D0X A;  3DPU A;  3VYR B;  1MH4 A;  3CUQ A;  2LRE A;  3DV8 A;  1UHM A;  1Q1V A;  2PJR B;  3A0B C;  5F1R A;  1G8X A;  4RAZ A;  4ENK A;  1A6I A;  2IGK A;  5CVU A;  1NK2 P;  3AL0 C;  1BN5 A;  2P5K A;  4WF2 A;  4EJT A;  2DU9 A;  3RYP A;  3HG9 A;  3I4P A;  4A3D J;  4CH7 A;  3AKZ A;  1GXQ A;  1JKR C;  4HW0 A;  3OSF A;  2HWV A;  1A36 A;  1LDK B;  1YLF A;  2L4M A;  3KP7 A;  2VLA A;  2LLK A;  3QPT A;  3U2R A;  3IL2 A;  4WCG A;  3KET A;  4LLL A;  1YW8 A;  2LP0 A;  2E36 A;  5FLM J;  1RR7 A;  2PMZ N;  3T8T A;  4LG0 B;  1T98 A;  4XRS A;  4MHG A;  3VEP A;  3HXL A;  4HNV A;  2UWM A;  3WG9 A;  1IZ1 A;  1WI9 A;  1XSX A;  3HKZ N;  3V7R A;  3V8J A;  5HS8 A;  4ZJZ A;  1VZ0 A;  1MMA A;  1Z1D A;  2A6T A;  2L54 A;  4ZC3 A;  2XAG A;  3HRM A;  3TED A;  2QM3 A;  2OJE D;  3JCU C;  4GFB A;  4RM2 A;  2LBF A;  4IHY A;  1YYV A;  2JPC A;  2FBH A;  3LST A;  2KIU A;  3LA2 A;  3HOZ J;  1R1U A;  4XLP F;  1B1B A;  2XB0 X;  2M30 A;  1IN8 A;  2OZ6 A;  4X0G A;  2MYS A;  5C3E J;  2GXB A;  4OIQ F;  2CGP A;  3O8G A;  1LE8 B;  2OU2 A;  4LK1 F;  4PJ0 C;  1PUF A;  2JMW A;  3KZI C;  3DWL E;  5FRO A;  3EUH C;  1MKM A;  4D0P A;  1Y56 A;  3IWF A;  3WHC A;  3S1Q J;  2XSD C;  1NHA A;  1T0F A;  3RIR A;  5JLW A;  1FYK A;  1A6Q A;  4O5V A;  5FD6 A;  4XON A;  1D8J A;  1SEU A;  2KIF A;  4HX8 A;  1MMS A;  1WSU A;  5K5R A;  1U8R A;  3LSR A;  4FCY A;  3PQK A;  3QOE A;  1ZR2 A;  1BJZ A;  1TL8 A;  2E19 A;  3E6M A;  5EGO B;  2F5E A;  2HEO A;  2LNB A;  3R60 A;  5HNH A;  1BOB A;  5E17 F;  5E1W A;  1Y8R B;  3PNV A;  3H5R A;  1X3U A;  2VQC A;  5E8I A;  2CS3 A;  2GOM A;  2LKP A;  3HJE A;  4EJV A;  4IRG A;  4YRV A;  1X1D A;  3HOX J;  3N4M A;  4G9Y A;  1SD4 A;  2M45 A;  3P5J A;  1LQ1 A;  4GDF A;  2X48 A;  2QQ9 A;  1J2X A;  1D1B A;  2M7B A;  4ITV A;  2ESN A;  4M9Z A;  3LSG A;  2XPV A;  1ERD A;  5LGU A;  3E6D A;  1FZP B;  2F5C A;  4AM3 A;  5EZH A;  4M3D A;  2DAO A;  4UHT A;  2YPR A;  2EZK A;  4B48 A;  3HSR A;  3JRH A;  2V1X A;  5ERI A;  3HIF A;  4YEJ A;  1DPU A;  3HGG A;  2Q1Z B;  3E97 A;  5D8L B;  4PJM A;  2RC4 A;  1UHW A;  2EBI A;  2FEZ A;  3E5U A;  4DW6 A;  2EZH A;  1NH3 A;  4KFC A;  2R7S A;  2CFO A;  2XV4 S;  4C3J J;  3Q0W A;  3F8M A;  2VOP A;  1OCO H;  3MWM A;  2H27 A;  5D5X B;  1E3H A;  1I3A A;  2CJJ A;  2HNH A;  3FMS A;  2EFW A;  4UUS B;  2E35 A;  1FPQ A;  3OS1 A;  2TDX A;  3LQQ A;  3NAR A;  2DPU A;  2BVL A;  4WXC A;  2XVC A;  1NTC A;  2W1O A;  3IUO A;  1R71 A;  4XLN F;  1R5G A;  2Y75 A;  3ABK H;  3O3K A;  3MKW B;  2YUS A;  2FRH A;  2MC4 A;  4Y33 A;  4L5E A;  4E7H A;  3BG9 A;  2JSC A;  3W2V A;  2FNA A;  3QPH A;  3OYJ A;  2R92 J;  4QTR A;  4FE7 A;  5DM6 F;  3K4K A;  3HOU J;  3RPU A;  4ZDP A;  4E7I A;  1LKX A;  3MKL A;  5B66 C;  2KT0 A;  3HOT A;  4HQE A;  5GTH C;  3KLO A;  4NNJ A;  4MGR A;  2XF7 A;  1ETV A;  1LVK A;  4HA8 A;  3IHU A;  2OCC H;  1X3Z B;  2X51 A;  3HTU A;  1JKP C;  4DNC A;  4CHU A;  1IDY A;  3SFI A;  5ICE A;  2YR2 A;  1XB4 A;  4ZDL A;  4MIM A;  3CDL A;  3S32 A;  4B4C A;  2MG4 A;  2E5Z A;  3FIW A;  3FM3 A;  2VKH A;  3FXJ A;  2VXZ A;  2FBI A;  1XGO A;  5HVQ C;  2B9S A;  3OR1 C;  1U9N A;  3IRQ A;  2PX9 A;  3JRE A;  2VI6 A;  3M8E A;  4ETS A;  4MTE A;  1GLN A;  4XN0 A;  3MCZ A;  5JLX A;  3BZK A;  3DF8 A;  3KX2 A;  2OQR A;  2CQ7 A;  1KGS A;  5A2Q Z;  1G3T A;  2P6T A;  2QZ8 A;  1FP2 A;  2VB6 A;  5E8G A;  3PL8 A;  2LKS A;  3QRF F;  2IXS A;  1W5T A;  4Q5S F;  3F9K A;  4ZZL A;  3LOC A;  3ZMD A;  4RM3 A;  1T6S A;  1JTY A;  5TRD A;  3KEO A;  3QOD A;  4AVP A;  2WV1 A;  2DOA A;  2ISY A;  2KJB A;  2P5L C;  4DZJ A;  4BHP A;  4A5N A;  1XGN A;  2HKO A;  2EZI A;  3JRC A;  3HKZ A;  1BI0 A;  1S72 I;  3ZQ7 A;  2ZJP F;  2ICW G;  4L5J A;  3BR3 A;  2FML A;  5M3F J;  4XLH A;  2A3S A;  4FTH A;  4IJA A;  1YRN B;  3SJM A;  3P7N A;  2Y0M A;  1VQL I;  2XC7 A;  3JTG A;  4X6A J;  2JK3 A;  1K61 A;  1TC3 C;  1FOW A;  2FA5 A;  5DDG A;  1LNW A;  2CQQ A;  3K4C A;  4JOM A;  4KIF A;  4I98 B;  5AON A;  4B44 A;  4IOC F;  2H94 A;  4B3A A;  2CW7 A;  4I7H A;  3BG3 A;  4RLF A;  5FJ8 J;  1WJD A;  1ZEL A;  3FHN A;  3M8J A;  2P8T A;  2KPM A;  5KVR A;  4V2G A;  4UVB A;  1P2F A;  1UZC A;  1MSF C;  4CCO A;  3CTA A;  4HOB A;  5HDG A;  1N75 A;  2Y0S A;  2IS1 A;  1X1A A;  2VJ5 A;  2EV5 A;  3CCR I;  3W6J B;  2RVC A;  3S8P A;  1PYV A;  2FE3 A;  1ZGJ A;  5CYV A;  1WRJ A;  4CCL A;  2H8W A;  5FKK A;  3GYH X;  5LD2 C;  1VQK I;  4G7Z F;  4F3Q A;  2H8R A;  4II3 A;  4HLX A;  1TQI A;  1FT9 A;  4IKF A;  1WI3 A;  3Q9S A;  5CLS A;  4W97 A;  1SC7 A;  1LJ9 A;  3LMM A;  4RGR A;  4R1H A;  2R3S A;  3BR5 A;  5FKN A;  2WAF A;  2L7K A;  3CCY A;  2XGC A;  2XRN A;  5B5E C;  4OU0 A;  4IZZ A;  1SD7 A;  1OLT A;  1YIJ I;  2K9N A;  2HYF A;  2F2E A;  1IUF A;  1Z7L A;  2O8K A;  5K1Y A;  3ZQC A;  2Y69 H;  4AUX A;  4I6Z A;  1P7I A;  3C2H A;  1BL0 A;  1Y0N A;  3HB9 A;  1V3F A;  4ASN A;  1OCC H;  1ENH A;  2DT7 B;  2ZNY A;  1K78 A;  2IA0 A;  1GVJ A;  1QVT A;  3FXM A;  3EDP A;  2BZT A;  3FWE A;  2TRT A;  1SAN A;  1QRY A;  2HOS A;  3BTJ A;  4I99 C;  1K79 A;  3BDD A;  5L3D A;  3OYN A;  5EEH A;  1RR8 C;  1FY7 A;  3BLY A;  1YTY A;  4IEJ A;  3OL3 A;  3K70 D;  5D5U B;  1Y39 A;  1AU7 A;  3ZOB A;  4HDU A;  1FOK A;  5E3N A;  2MC3 A;  3LFU A;  5CVV A;  3E6C C;  4A3M J;  2P5V A;  3HRU A;  2JJ7 A;  2XDV A;  1I6H J;  4IQ4 A;  4E7K A;  2BV6 A;  2VJI A;  5J8C A;  4FQG A;  2AQF A;  3PJR A;  3GZ5 A;  1W7P B;  1UMQ A;  2HYJ A;  1X1P A;  5HLG A;  2HDW A;  1RC9 A;  3M7G A;  4A3F J;  3ZQG A;  3A4C A;  2VBY A;  4BS9 A;  1D3Y A;  2QKM B;  3MEX A;  1MBF A;  3W6K B;  3F8C A;  1AOY A;  1HST A;  4HV5 A;  2DJI A;  1K6Y A;  3OMY A;  2WWY A;  2HVQ A;  2FQ3 A;  2IP2 A;  2W4S A;  4AYB A;  4U7B A;  3OYL A;  2NS0 A;  2VE8 A;  1T2K A;  4KIC A;  4XKW A;  1ZAR A;  1UB9 A;  4CYD A;  1D5Y A;  3MMY B;  1WJC A;  3L2U A;  2L3D A;  4R79 A;  1JJ6 C;  4MFE A;  2Y9Y A;  1EA3 A;  4RAF A;  3M8F A;  1I1G A;  2ELJ A;  4PJJ A;  2L7Z A;  1XMX A;  2DJN A;  2JWT A;  3GTM J;  4XSZ F;  3VSL A;  5DM7 F;  1GHC A;  1P4A A;  4XL9 A;  5J40 A;  3SDG A;  5CJ9 A;  1SD6 A;  1FBU A;  1F4K A;  1G3S A;  2M9H A;  3S2D J;  5HNF A;  2NNY A;  1DUX C;  2R7Z J;  2DYS H;  4XKB A;  4WXD A;  3RPU D;  4XLA A;  1WH5 A;  3BG7 A;  4OIN F;  1U8B A;  3DU5 A;  4M3B A;  2P7C B;  1XCB A;  3NAU A;  4P9F A;  3KP2 A;  2RQQ A;  2OF7 A;  4UUV A;  4D7M A;  5D4R A;  2V9K A;  3N05 A;  2KRH A;  1K7A A;  3CO7 C;  4XMY A;  3HOY J;  2F4I A;  2EIL H;  5KNL A;  1RUN A;  5E20 A;  2ZO4 A;  3GF2 A;  2BY0 A;  3ERE D;  1V5F A;  2WA0 A;  3LAJ A;  4RAY A;  5GAG J;  4UB6 C;  3RKQ A;  4IHT A;  4BEH B;  2EIN H;  3IH4 A;  1QPI A;  3VSK A;  1ON2 A;  2FF4 A;  3F23 A;  3DQV C;  2HGC A;  4I01 A;  2IW5 A;  5GTI C;  4CIC A;  2K9Q A;  4D9J A;  1FJL A;  3CC7 I;  4Y52 J;  1J75 A;  2IGO A;  2DA6 A;  2O5R A;  5DEQ A;  1B72 A;  1B9N A;  2LY1 A;  5LBQ A;  3VPR A;  3CCE I;  1JGS A;  3S3N A;  2LYC A;  3WE2 A;  4M6Y A;  2AHQ A;  1U5T A;  1ETX A;  4BY1 J;  3GXO A;  2XF6 A;  4HLY A;  5K7F A;  2E7W A;  2CV1 A;  2I5U A;  3MFK A;  4UY8 I;  3PM1 A;  2IS2 A;  4B1R A;  5LRR A;  3TW6 A;  3HOW J;  2K02 A;  3S17 J;  3IKT A;  5J3L A;  3PQJ A;  2NVQ J;  3EQL F;  4LIU A;  1LEB A;  1PP7 U;  1CF7 B;  3CUQ C;  2ID6 A;  3L9F A;  1IRG A;  5E1X A;  5DD4 A;  1N78 A;  2XAH A;  1ODD A;  1I50 J;  3CC4 I;  1XN7 A;  2XAU A;  2AXL A;  1P4X A;  4RS8 A;  1YO5 C;  1MDM B;  2BGC A;  2VPL A;  2LG4 A;  2H1L A;  4BNC A;  5D6F A;  2VQL A;  4HNT A;  2A68 F;  2WAQ N;  1A04 A;  4LLG F;  5A2Q K;  3BR0 A;  4G94 A;  3WTX C;  2WY7 Q;  3CUQ B;  2O6G E;  2PMH A;  2VJJ A;  2LSO A;  1FIA A;  3MD2 A;  3DTE A;  2W48 A;  2L9N A;  1PUE E;  4K2E A;  1IC8 A;  3ZMU A;  5E3L A;  2ZME A;  2OTJ I;  3DTK A;  4M6V A;  4PCQ A;  1HSJ A;  3WTZ A;  5LGN A;  3JRA A;  4BQA A;  2BHY A;  5LEJ A;  1HC8 A;  5HDK A;  2XAJ A;  2DN0 A;  1P7J A;  4CYC A;  3R6S A;  3NWS A;  1R7J A;  2I10 A;  1YS6 A;  2M0M A;  5FO5 A;  5H6Q A;  3F21 A;  2P81 A;  4LJZ F;  4F91 B;  2RRE A;  2AXT C;  4XSX F;  4I0B A;  2ZBK A;  1ZTR A;  1XTA A;  1R1T A;  4XKV A;  4U0Y A;  1OYW A;  1T08 B;  3F8N A;  3KE2 A;  1YX5 A;  1XPX A;  2PLY A;  2PJP A;  1E0E A;  1OQY A;  3D0S A;  4LFU A;  3WU2 C;  1IUY A;  1JT0 A;  2IGM A;  1P6R A;  2GQQ A;  5IPA A;  1OKR A;  3D5L A;  3X2Q H;  3EET A;  2KZV A;  1B8I B;  2QSG X;  4QLC U;  3VOD A;  2IS4 A;  3CF5 F;  1MND A;  4YIR X;  1BOA A;  2KIQ A;  2HDD A;  1BC7 C;  4I02 A;  4XLF A;  3DLA A;  4XOT A;  2XPW A;  2V4J C;  2DQL A;  1VTN C;  1UFM A;  4WWC A;  2G9W A;  5E1Z B;  4TV7 A;  3I9V 2;  2LTP A;  3ISP A;  1S7A A;  3K7A J;  4Z2Y A;  4EJO A;  1DU0 A;  1QBJ A;  3IH3 A;  2ELK A;  3ZPL A;  4IPA A;  4LGW A;  3HRT A;  3CCJ I;  2FX0 A;  4ESB A;  2V9P A;  5J1R A;  4BJT A;  3FF5 A;  2R7O A;  3SQN A;  2LD5 A;  1U5T C;  2W00 A;  2YU3 A;  3PNY A;  5LHG A;  3CO6 C;  2R7T A;  1FSE A;  2L7F P;  4XRS G;  3M9A A;  4QSH A;  4DJA A;  2H1K A;  4LOC A;  3QOP A;  3CCL I;  5FD5 A;  4A2U A;  4EV0 A;  2VT2 A;  3HL2 A;  1JE8 A;  2LF7 A;  3GZ6 A;  2Z9O A;  3LSM A;  1W5S A;  2Q0O A;  1R23 A;  4BE0 A;  4DBQ A;  3OY9 A;  3M07 A;  1LFP A;  2DMT A;  3PSI A;  3KLN A;  3D1N I;  3I54 A;  3CLQ A;  2BHZ A;  5EYR A;  4MNU A;  1RZ4 A;  3B73 A;  2DT5 A;  4YII A;  3FZV A;  1W36 C;  4BDY A;  4OMZ A;  2WAE A;  1YJ9 I;  2NVY J;  2CRG A;  4M73 A;  1TWG J;  3KP5 A;  2MGQ A;  1VND A;  2PMU A;  2GBY A;  2EA4 A;  2ZCW A;  4XR6 A;  2EFO A;  3F3X A;  1X4P A;  3DPL C;  2Y31 A;  3WHB A;  4LG3 A;  1XGS A;  1JT6 A;  3JW4 A;  3COA C;  4HYE A;  1LPQ A;  4KN4 X;  1NG6 A;  4BHB A;  3KEQ A;  3SZT A;  3IKV A; 
#chains in the Genus database with same CATH homology
 1QQI A;  3J81 Z;  3FXR A;  2GIV A;  3L2C A;  1IN6 A;  2NAZ A;  4KA4 A;  3ABU A;  3GLX A;  1S29 A;  1FYM A;  2MA3 A;  4A0X A;  1Y0U A;  2GZW A;  1TQP A;  2XGX A;  1SAX A;  3DFG A;  3RYR A;  4L9T A;  2ACJ A;  2HS5 A;  1MJA A;  4MEX F;  1MZB A;  4NHJ A;  5BMZ A;  5ICF A;  5IT9 K;  3C3W A;  5H6R A;  1U6G A;  5HOO A;  4KNY A;  3ZMT A;  2A61 A;  4MQV A;  2G7U A;  1BJA A;  3HTS B;  5BPI A;  2XAS A;  1LVA A;  2M8E A;  2C6Y A;  1TQM A;  1IXS B;  2QVO A;  4R8H A;  1R00 A;  2PG4 A;  4A0Y A;  4FT8 A;  4ESJ A;  5K5O A;  5BQT A;  1B9M A;  4EVI A;  2FSW A;  1T39 A;  4Y17 A;  1U78 A;  2VON A;  3K1N A;  3P9C A;  3EUH A;  1HW5 A;  4EQQ A;  4BAY A;  3NRV A;  4BH9 A;  2STW A;  5FLX K;  2HTS A;  2Z99 A;  4G7H F;  2RN7 A;  3LFK A;  1QZY A;  2RDP A;  2GA1 A;  3VB2 A;  2DO7 A;  2UXN A;  1ZGA A;  2RQP A;  3BOQ A;  4L0Y B;  3ULQ B;  4IVN A;  2L4A A;  3K9T A;  3EYI A;  2QQA A;  1ZRC A;  3TO9 A;  3PFI A;  2K86 A;  4UNO A;  1WKM A;  1P92 A;  3ECO A;  1S7O A;  4IF4 A;  1LEA A;  2O3F A;  4ON0 A;  3I58 A;  1XSD A;  4RB2 C;  4GXO A;  4P96 A;  2V6C A;  1SMT A;  2Q8K A;  1TW2 A;  2D1V A;  3V7S A;  2QLZ A;  2EFN A;  3JSP A;  3TOB A;  2P4W A;  3ECH A;  5DCM B;  5LGT A;  1BC8 C;  2HDC A;  4UV9 A;  1ZLK A;  5DYM A;  2QQB A;  1IN5 A;  4H0E A;  2B0L A;  2OA4 A;  3FM5 A;  1ZHF A;  1J0R A;  3SFZ A;  5D6E A;  2DLL A;  1YW7 A;  1B4A A;  5EEG A;  5L3F A;  1RUO A;  2QUF A;  1BBY A;  3BJO A;  3IC7 A;  1H9T A;  3I5U A;  1IW7 F;  2NYX A;  4OMY A;  3F22 A;  5HS9 A;  5E18 F;  2MBF A;  2WC2 A;  3SXY A;  1HKS A;  2ELH A;  2KIM A;  4LK0 F;  1BI1 A;  3R0J A;  2VBW A;  3U1D A;  2JZY A;  1OYI A;  4U0V A;  1J9I A;  4EM1 A;  2STT A;  1B59 A;  2Y48 A;  3F6V A;  4O3M A;  2YX4 A;  1JHF A;  1FSH A;  1OR7 A;  4EGY A;  1OPC A;  1D8K A;  4DQ2 A;  2PBI A;  5BPD A;  2EFQ A;  3ZMV A;  1J7K A;  2QYO A;  1I5Z A;  2NRA C;  3JSO A;  2M1B A;  2K7L A;  5L3G A;  3LA3 A;  1O3S A;  1XGM A;  4OIP F;  3EYY A;  1DPR A;  1KYZ A;  1YIO A;  2GA2 A;  3QP6 A;  1ZG1 A;  3V8K A;  1PDN C;  4U0W A;  4A0Z A;  5ED4 A;  2EFP A;  2A5Y B;  2FMY A;  3RTR A;  3J81 K;  4M9S A;  3TDU C;  3J80 K;  3H92 A;  3KFW X;  1EH7 A;  2Z3Y A;  2MH9 A;  3BWG A;  3TQN A;  3HSE A;  2XAF A;  1XD7 A;  2MLK A;  3R61 A;  2JT1 A;  2FXA A;  3KZY A;  5DCF A;  1ULY A;  4GO1 A;  2A07 F;  2IJL A;  2DI3 A;  1E2X A;  3RKW A;  4U7D A;  3KZZ A;  3HRS A;  1G6N A;  4KYW A;  3WTY C;  1IXC A;  3QU6 A;  2VOD A;  3F72 A;  3K1P A;  1KU9 A;  3T0Y A;  5JR3 A;  1DDN A;  4KMU X;  1XSV A;  2DW4 A;  2CSO A;  1AWC A;  3F8F A;  4S04 A;  3K2Z A;  4UXN A;  3L00 A;  2OZU A;  5LRS A;  4CDG A;  1FBS A;  1I27 A;  4QWQ A;  2DBB A;  5D5W B;  2BEO A;  5DD8 A;  2KRF A;  5JFR A;  2K4J A;  3I59 B;  3WE3 A;  1YW9 A;  5CVR A;  2E1C A;  1OMI A;  1SFX A;  1YQA A;  4HX7 A;  2O0Y A;  1RNL A;  5BOX A;  4G6D A;  2LF8 A;  2RKH A;  5LHH A;  4KIB A;  2CW0 F;  2CO5 A;  2XKO A;  4HZF A;  2X4H A;  4BHC A;  1W4M A;  4L9V A;  2IT0 A;  3WTV C;  2ZNZ A;  2GXG A;  1WWX A;  3C18 A;  3QP5 A;  1SFE A;  4JQF A;  4UVA A;  2QBY B;  2DTR A;  4O6J A;  3TGN A;  4HX4 A;  4Q48 A;  3T1B A;  1F1Z A;  3F6O A;  3P9K A;  3SHF A;  4ENN A;  3VOE A;  1KU7 A;  3BY6 A;  2J5P A;  4HQM A;  4RB0 A;  5CVJ A;  4B8X A;  3TO6 A;  3H3Z A;  4M74 A;  4M6X A;  1FWZ A;  1JHH A;  4HAM A;  3CJN A;  3CDH A;  1V4R A;  2DQR A;  3DEU A;  1ZYR F;  2CG4 A;  1O7F A;  1J5Y A;  4ZH4 F;  4JBA A;  2IPQ X;  3NQO A;  1HQC A;  2XHK A;  4RB1 A;  2FNP A;  2HR3 A;  4IRH A;  1STZ A;  1MJ9 A;  4ZYE A;  5D8K B;  3B02 A;  4OIR F;  2V79 A;  4A5M A;  3F8B A;  2W25 A;  1SMY F;  3ABT A;  3K0L A;  2G7H A;  4NB5 A;  1EH6 A;  3WU1 B;  4EMS A;  3REO A;  3TDZ C;  3GUD A;  5D5V B;  2KJC A;  4KN7 X;  3BP8 A;  1HXD A;  3GFI A;  1REP C;  1C0W A;  2XUB A;  3Q5F A;  1YS7 A;  1O57 A;  2DFI A;  2OAZ A;  2Q2E A;  1G3Y A;  3ZMS A;  2ISZ A;  1JXS A;  4RB3 C;  2VC0 A;  1BM9 A;  3RKX A;  1BIB A;  1DP7 P;  3FMQ A;  2WV0 A;  3JAM Z;  3ELK A;  3I64 A;  1XDS A;  4RGX A;  4I0A A;  3K1M A;  3ZP5 A;  1YG2 A;  3QU3 A;  1OYY A;  1HKQ A;  3ROU A;  5DV5 A;  3BPV A;  1O7L A;  1GXP A;  2OD5 A;  1TNT A;  1XMA A;  5ILV A;  2F5D A;  1QO0 D;  2RNJ A;  3HYI A;  4FX0 A;  1K6O A;  3DKW A;  4IHS A;  3LA7 A;  2MD5 A;  4Y13 A;  5HLH A;  3V4G A;  1U2W A;  1EH8 A;  2JTV A;  3ZN1 A;  4ENM A;  1KQ0 A;  2RGV A;  2O8X A;  3T8R A;  3IRR A;  1PP8 F;  1ON1 A;  4PZJ A;  1H0M A;  2V9V A;  1QGP A;  5ILU A;  4HF2 A;  2A69 F;  4KIG A;  1TTY A;  2EJR A;  3VFZ A;  2Z5U A;  1Z91 A;  3ZN0 A;  1KQ9 A;  1MD0 A;  4MTD A;  1RIO H;  4WK8 F;  4MEY F;  2R7F A;  2PI0 A;  4NQW A;  3G3Z A;  4P5O A;  2E7X A;  4KMF A;  4YG2 F;  1CGP A;  3I53 A;  4LD5 A;  3GO5 A;  2L02 A;  3GFL A;  4E70 A;  2EB7 A;  1O3Q A;  3RI4 A;  4HF1 A;  1W7P A;  1FLI A;  2E1N A;  4L5I A;  2OQG A;  1KYW A;  2ETH A;  1E17 A;  1FP1 D;  3CLO A;  2VT3 A;  1Z7U A;  5F6F A;  3MZH A;  4AIH A;  2PEX A;  1KA8 A;  4RGU A;  4AWX B;  5K5Q A;  1TBX A;  2A6E F;  1K78 B;  5CVI A;  1XCV A;  1FX7 A;  1IRF A;  3E3V A;  1R1V A;  3SZP A;  1SFU A;  3BRO A;  1IN7 A;  4B09 A;  2K4B A;  3FXQ A;  1S6L A;  1S8N A;  4YFX F;  3E5Q A;  3E6B A;  5HS7 A;  4PDK A;  5HDN A;  2P6S A;  4OIO F;  4G7O F;  5LLQ A;  3KP6 A;  3RDI A;  2IA2 A;  4N9I A;  4XRF A;  2K27 A;  1RI7 A;  4WXH A;  3BZ6 A;  4XBF A;  4UV8 A;  5FLX Z;  2M87 A;  2UXX A;  2OBP A;  4I2O A;  3BJA A;  3DP7 A;  4IXA A;  4IRI A;  2EWN A;  3R0A A;  5FFZ A;  2JRT A;  3I59 A;  3GX4 X;  1ZRE A;  2R7D A;  3OV8 A;  1Z6T A;  1R36 A;  1ZH5 A;  1ZG3 A;  3HHG A;  2ZME B;  2P7V B;  2FBK A;  2YX7 A;  2NNN A;  4HF0 A;  5J8F A;  2W84 A;  1O3R A;  2HYG D;  2Z33 A;  2MH2 A;  3WGG A;  1HKT A;  2D45 A;  1F5T A;  3Q9V A;  3M1E A;  5L3B A;  1U5T B;  1Q1H A;  2HFH A;  2BBY A;  4S05 A;  4Q4Z F;  2CQK A;  1LDD A;  4M9X A;  1ZN2 A;  2W57 A;  1S3J A;  4F7Z A;  2ZKZ A;  3NEU A;  1H9G A;  2MLG A;  4JK1 X;  3HHH A;  3WTU C;  2UZK A;  5DUI A;  3GWZ A;  4LG0 A;  3WTS C;  4A6E A;  2CWE A;  2WTE A;  2BE5 F;  5L3E A;  2V1D A;  3N97 A;  4AIK A;  3TKY A;  2XKP A;  1O3T A;  1L3L A;  5J6X A;  4ZYH A;  2IA1 A;  1BI3 A;  3L7W A;  4FHT A;  1LDJ A;  2HQN A;  4CO8 A;  4AIJ A;  3KCC A;  3O2P E;  5D4S A;  1I1S A;  1BIA A;  2ZJ2 A;  2XAQ A;  1UCR A;  5FB2 A;  3DPT A;  1FYL A;  4ENJ A;  1ONV A;  3V7C A;  2PN6 A;  3LAP A;  5JHU A;  1SD5 A;  1BI2 A;  2JPB A;  3TOA A;  5IT3 A;  4KDP A;  2H6C A;  2O61 A;  2ADU A;  4HBL A;  2VN2 A;  1KU3 A;  1ZAO A;  3G73 A;  2PFB A;  2CYY A;  4P9U A;  3J7A O;  2D1H A;  1FNN A;  1ZLJ A;  3GW2 A;  3FMR A;  2ESH A;  1W7P D;  1KU2 A;  1Z05 A;  1T38 A;  3TO7 A;  5AIP A;  1IXR C;  6PAX A;  1XDU A;  4GYI A;  4LB6 B;  4PGH A;  2XIG A;  2FU4 A;  1KQ8 A;  2LDU A;  4YIF A;  3WTW C;  3V8L A;  4HV6 A;  3FXU A;  3MAJ A;  2YSR A;  3AAF A;  2J5O A;  4LB5 A;  3J80 Z;  1Z9C A;  4M72 A;  2D2W A;  2F5F A;  2GAU A;  5FGM A;  4MQ9 F;  3WU0 A;  4GGG A;  4AD9 A;  3QAH A;  4LLN A;  5JI6 A;  5BS6 A;  1MJB A;  1WQ2 A;  1HBX G;  3E5X A;  2QEN A;  2W85 A;  5H20 A;  3JTH A;  3FHZ A;  2GWR A;  5F64 A;  2DPD A;  3S2W A;  3R4K A;  2RV8 A;  4RGS A;  3ZMZ A;  1UST A;  1QNT A;  1U3E M;  2EV6 A;  3BJ6 A;  2EA2 A;  3MQ0 A;  2AS5 F;  3K69 A;  4UVC A;  2HZT A;  3LQR A;  1IF1 A;  4EGZ A;  5LEK A;  3P9I A;  5ICC A;  3I71 A;  2H09 A;  1G3W A;  4CGZ A;  5FFX A;  2BYV E;  1CF7 A;  2L01 A;  4Y15 A;  3DXJ F;  1G4D A;  3GEZ A;  2VE9 A;  4CXF A;  1LB2 A;  2V1U A;  4HDV A;  2EV0 A;  4P55 A;  1TNS A;  4I09 A;  3I0T A;  1IAW A;  3JAM K;  4BXU A;  4L9J A;  1P4W A;  3RKY A;  4BYY A;  4A6D A;  5JVT A;  3WTT C;  3T5X A;  4GCV A;  4EM0 B;  1TLH B;  4KT5 C;  5ICG A;  5IT9 Z;  4EJW A;  4U88 A;  1L0O C;  2ZXJ A;  3FX3 A;  3H3U A;  2W24 A;  2HQR A;  2IRF G;  2HKX A;  3C1D A;  1HW2 A;  1TW3 A;  2KKO A;  4G6Q A;  4KUM A;  1MDM A;  3RPQ A;  1EV7 A;  2O03 A;  1YFH A;  2DK5 A;  1ZRF A;  1B6A A;  1QPM A;  1ZG5 A;  1QZZ A;  2VBZ A;  4L0Z B;  3MZY A;  2IVM A;  4CZZ A;  5TJJ A;  3WOD F;  3O6B B;  3RJP A;  2M5W A;  5L3C A;  1FBQ A;  2EK5 A;  5KK1 A;  1R5H A;  4WX9 A;  1MGT A;  3WGH A;  3WGI A;  4ZYD A;  1FC3 A;  2HTJ A;  2VBX A;  2A6H F;  4YFN F;  1R22 A;  3BPX A;  1ZRD A;  3C7J A;  3OOP A;  4M71 A;  4N9H A;  4EJU A;  1J59 A;  5DCM A;  3LWF A;  4EM2 A;  3HUG A;  1XMK A;  1USS A;  4GYG A;  1HW1 A;  3GFM A;  1IN4 A;  2FOK A;  5HLI A;  4Q47 A;  3GVA A;  2CFX A;  1I6X A;  3U9G A;  4ZZD A;  3KP3 A;  1Z6R A;  4FX4 A;  4L18 B;  2HOE A;  1D5V A;  4A12 A;  2H6B A;  4YFK F;  3KP4 A;  3HSF A;  5LHI A;  2PQ8 A;  2COM A;  5AIQ A;  2QBY A;  3HOS A;  3GFJ A;  4G8X A;  1F9N A;  4PGG A;  4OOI A;  2QWW A;  2VOO A;  4L9N A;  5ILS A;  2XRO A;  3L09 A;  4ESF A;  4LMY A;  2VC1 A;  5DUK A;  2ZFW A;  3IWZ A;  2X0L A;  4ZYG A;  4N0B A;  3CUO A;  1R58 A;  2DK8 A;  3ML6 A;  3CUQ A;  3DV8 A;  1UHM A;  5F1R A;  4RAZ A;  4ENK A;  5CVU A;  1BN5 A;  2P5K A;  4WF2 A;  4EJT A;  2DU9 A;  3RYP A;  3I4P A;  1GXQ A;  4HW0 A;  2HWV A;  1LDK B;  1YLF A;  2L4M A;  3KP7 A;  3QPT A;  3U2R A;  3IL2 A;  4WCG A;  3KET A;  4LLL A;  1YW8 A;  3T8T A;  4LG0 B;  1T98 A;  4MHG A;  3VEP A;  2UWM A;  3WG9 A;  1IZ1 A;  1WI9 A;  1XSX A;  5HS8 A;  3V7R A;  3V8J A;  1Z1D A;  2L54 A;  2XAG A;  3HRM A;  2QM3 A;  1YYV A;  2JPC A;  2FBH A;  3LST A;  2KIU A;  3LA2 A;  1R1U A;  4XLP F;  1B1B A;  2M30 A;  1IN8 A;  2OZ6 A;  2GXB A;  4OIQ F;  2CGP A;  2OU2 A;  4LK1 F;  1MKM A;  4D0P A;  3IWF A;  1NHA A;  1T0F A;  3RIR A;  1FYK A;  4O5V A;  5FD6 A;  1D8J A;  2KIF A;  4HX8 A;  1WSU A;  5K5R A;  1U8R A;  3PQK A;  3E6M A;  2F5E A;  2HEO A;  2LNB A;  3R60 A;  5E17 F;  5E1W A;  1X3U A;  5E8I A;  2LKP A;  4EJV A;  4IRG A;  3N4M A;  4G9Y A;  1SD4 A;  2M45 A;  1LQ1 A;  2QQ9 A;  1J2X A;  4M9Z A;  2ESN A;  5LGU A;  3E6D A;  1FZP B;  2F5C A;  2DAO A;  4UHT A;  2YPR A;  3HSR A;  1DPU A;  2V1X A;  5ERI A;  3HIF A;  3E97 A;  5D8L B;  2RC4 A;  1UHW A;  2FEZ A;  3E5U A;  4KFC A;  2XV4 S;  2VOP A;  3F8M A;  3MWM A;  2H27 A;  5D5X B;  2EFW A;  3FMS A;  1FPQ A;  2TDX A;  3LQQ A;  2DPU A;  4WXC A;  2XVC A;  4XLN F;  1R5G A;  2Y75 A;  3O3K A;  2FRH A;  2JSC A;  2FNA A;  3QPH A;  3RPU A;  3HOT A;  4HQE A;  3KLO A;  4MGR A;  4HA8 A;  3IHU A;  3HTU A;  4DNC A;  4CHU A;  5ICE A;  2YR2 A;  1XB4 A;  3FM3 A;  2VXZ A;  2FBI A;  1XGO A;  5HVQ C;  3IRQ A;  3M8E A;  4ETS A;  4MTE A;  3MCZ A;  3DF8 A;  2OQR A;  1KGS A;  5A2Q Z;  1G3T A;  2P6T A;  2QZ8 A;  1FP2 A;  5E8G A;  3QRF F;  1W5T A;  4Q5S F;  4ZZL A;  3ZMD A;  1T6S A;  5TRD A;  3KEO A;  4AVP A;  2ISY A;  2KJB A;  2P5L C;  4BHP A;  4A5N A;  1XGN A;  2HKO A;  1BI0 A;  3ZQ7 A;  4L5J A;  2FML A;  2A3S A;  4IJA A;  3P7N A;  2Y0M A;  3JTG A;  2FA5 A;  5DDG A;  1LNW A;  4KIF A;  4I98 B;  5AON A;  2H94 A;  4I7H A;  2P8T A;  5KVR A;  4UVB A;  1P2F A;  3CTA A;  4HOB A;  5HDG A;  2EV5 A;  3W6J B;  2RVC A;  2FE3 A;  1ZGJ A;  5CYV A;  1WRJ A;  3GYH X;  4G7Z F;  4HLX A;  1TQI A;  1FT9 A;  3Q9S A;  5CLS A;  1LJ9 A;  4RGR A;  4R1H A;  2R3S A;  2XRN A;  4OU0 A;  1SD7 A;  2HYF A;  2F2E A;  5K1Y A;  1V3F A;  4ASN A;  2ZNY A;  1K78 A;  2IA0 A;  1GVJ A;  3EDP A;  3FWE A;  1K79 A;  3BDD A;  5L3D A;  5EEH A;  1FY7 A;  1YTY A;  5D5U B;  4HDU A;  1FOK A;  2MC3 A;  3E6C C;  5CVV A;  2P5V A;  3HRU A;  2BV6 A;  5J8C A;  3GZ5 A;  1W7P B;  5HLG A;  3M7G A;  2VBY A;  1D3Y A;  3MEX A;  3W6K B;  3F8C A;  1AOY A;  1HST A;  4HV5 A;  2WWY A;  2FQ3 A;  2IP2 A;  4U7B A;  2NS0 A;  2VE8 A;  1T2K A;  4KIC A;  1ZAR A;  1UB9 A;  4CYD A;  2L3D A;  4R79 A;  3M8F A;  1I1G A;  4XSZ F;  1GHC A;  1P4A A;  5CJ9 A;  1SD6 A;  1FBU A;  1F4K A;  1G3S A;  2NNY A;  1DUX C;  4WXD A;  4OIN F;  2P7C B;  1XCB A;  4P9F A;  3KP2 A;  4UUV A;  5D4R A;  1K7A A;  3CO7 C;  1RUN A;  5E20 A;  2ZO4 A;  3GF2 A;  3ERE D;  3LAJ A;  4RAY A;  4IHT A;  1ON2 A;  2FF4 A;  3F23 A;  3DQV C;  2HGC A;  4I01 A;  2IW5 A;  4CIC A;  1J75 A;  5DEQ A;  1B9N A;  5LBQ A;  1JGS A;  3WE2 A;  4M6Y A;  1U5T A;  3GXO A;  4HLY A;  2E7W A;  3MFK A;  5LRR A;  2K02 A;  3IKT A;  3PQJ A;  3EQL F;  1LEB A;  1PP7 U;  1CF7 B;  3CUQ C;  3L9F A;  1IRG A;  5E1X A;  5DD4 A;  2XAH A;  1ODD A;  1XN7 A;  4RS8 A;  2AXL A;  1P4X A;  1YO5 C;  1MDM B;  2BGC A;  4BNC A;  5D6F A;  2A68 F;  1A04 A;  4LLG F;  5A2Q K;  3WTX C;  4G94 A;  2O6G E;  3CUQ B;  2PMH A;  2LSO A;  1PUE E;  4K2E A;  3ZMU A;  2ZME A;  3WTZ A;  4PCQ A;  1HSJ A;  5LGN A;  4BQA A;  5LEJ A;  5HDK A;  2XAJ A;  3R6S A;  1R7J A;  1YS6 A;  5FO5 A;  5H6Q A;  3F21 A;  4LJZ F;  4XSX F;  4I0B A;  2ZBK A;  4U0Y A;  1R1T A;  1OYW A;  3F8N A;  3KE2 A;  2PLY A;  2PJP A;  3D0S A;  4LFU A;  1IUY A;  1P6R A;  2GQQ A;  1OKR A;  3D5L A;  3EET A;  4QLC U;  3VOD A;  1BOA A;  1BC7 C;  4I02 A;  2DQL A;  1VTN C;  1UFM A;  4WWC A;  2G9W A;  5E1Z B;  4TV7 A;  3ISP A;  1S7A A;  4EJO A;  4Z2Y A;  1QBJ A;  3ZPL A;  4IPA A;  4LGW A;  3HRT A;  4ESB A;  3FF5 A;  3SQN A;  1U5T C;  2YU3 A;  5LHG A;  3CO6 C;  1FSE A;  3M9A A;  3QOP A;  5FD5 A;  4A2U A;  4EV0 A;  2VT2 A;  1JE8 A;  2LF7 A;  3GZ6 A;  2Z9O A;  1W5S A;  2Q0O A;  1R23 A;  3KLN A;  3I54 A;  4MNU A;  1RZ4 A;  3B73 A;  2DT5 A;  4YII A;  3FZV A;  4OMZ A;  4M73 A;  3KP5 A;  2PMU A;  2EA4 A;  2ZCW A;  2EFO A;  3F3X A;  3DPL C;  1XGS A;  3JW4 A;  3COA C;  4HYE A;  4KN4 X;  4BHB A;  3KEQ A;  3SZT A;  3IKV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...