3RI4A

Ets1 cooperative binding to widely separated sites on promoter dna
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
136
structure length
136
Chain Sequence
GTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords Protein C-ets-1
publication title Structural basis of ets1 cooperative binding to widely separated sites on promoter DNA.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 136
sequence length 136
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ri4A00
3V4GA 3T8TA 1TW3A 2ZJ2A 3WTVC 2XAJA 2CSOA 4KFCA 3EDPA 1QNTA 2YPRA 1G3TA 1HW2A 3E6MA 4U0YA 2XGXA 1R23A 2HYGD 1FYLA 1IRGA 3GXOA 3TQNA 2ISYA 1W4MA 3OV8A 1E2XA 2HYFA 3M8FA 3I59A 2BBYA 3K1MA 1ZREA 4LLLA 4LLGF 3MFKA 2M5WA 3WGIA 3ABTA 2H94A 1ZLJA 4OMYA 1W5TA 3KEQA 3KP7A 1YFHA 2V1UA 3GX4X 4QLCU 2W85A 1K6OA 4ZYEA 3T5XA 1BJAA 4CGZA 2A68F 3ZMZA 2KRFA 1B4AA 1P4AA 2L4MA 4U88A 2Q0OA 3DFGA 3E97A 1FNNA 3ROUA 2OU2A 2P7CB 2ZFWA 1FBQA 3FF5A 2P6TA 2M8EA 4O3MA 3IKTA 1XGNA 1T98A 4LJZF 4EGYA 1USTA 2M1BA 3HUGA 2K86A 3VB2A 1SAXA 3FMQA 1J9IA 1S8NA 1XSXA 3V8JA 2XKPA 3Q5FA 5DCMB 5EEGA 2HDCA 1KU2A 2L3DA 4M9SA 2X0LA 4G6QA 2VC0A 1BN5A 1G6NA 4WWCA 4P5OA 5JI6A 1IF1A 4G7HF 3DV8A 5D8LB 4XBFA 2PEXA 5L3GA 1W7PB 4LMYA 1SMTA 2PLYA 1Q1HA 3WE3A 5D5VB 3DF8A 5L3BA 1P92A 4KIGA 3FMRA 3FXUA 2IRFG 1G3WA 3ZN0A 3HYIA 4O6JA 5HLHA 1Y0UA 1WWXA 1KQ9A 2K02A 3DPTA 4OMZA 3C3WA 4KDPA 5ED4A 1XGSA 3LA3A 1BI0A 3LSTA 3LWFA 3B02A 3AAFA 4I09A 1ZGJA 2JSCA 1DPRA 4ETSA 2XRNA 4A12A 3JAMZ 3NQOA 4ENNA 1LDDA 2O3FA 3IRRA 5L3CA 1BI2A 1BOAA 4MEYF 2KKOA 2EWNA 2Y48A 3V7CA 3R0JA 2FBHA 3IKVA 5CJ9A 2Z33A 3V8LA 4M9XA 3J80K 1LEBA 2LSOA 2EFQA 1CF7B 3ELKA 1VTNC 2OZ6A 5DCMA 1BBYA 1XDSA 4CO8A 3HHHA 2P5LC 2E7WA 5D5UB 2DTRA 3L00A 4Y17A 5LRSA 3TDUC 1BM9A 2V6CA 2PQ8A 5D6FA 3RYRA 4LK1F 3QAHA 5H6QA 2XVCA 1T0FA 3ISPA 2VE9A 3RPUA 4FX0A 4PDKA 2STTA 4FT8A 1HXDA 1OYIA 4LGWA 3KCCA 4OINF 4HX4A 4LLNA 2BGCA 2PG4A 3KZYA 4EJVA 4L0ZB 4Q5SF 3CUQA 2QENA 1KU3A 1L3LA 2OA4A 5IT9K 2FE3A 5D4SA 2Z3YA 2RNJA 2IA2A 4JBAA 3LA2A 3P7NA 2ZXJA 3I71A 2Z5UA 5A2QK 3RDIA 4MNUA 2A6HF 1XGMA 1FYKA 3K1PA 4B8XA 4BAYA 3KLNA 2GQQA 2J5OA 1P2FA 4M9ZA 2QQBA 5E18F 4BXUA 3TDZC 2MA3A 3WE2A 1JXSA 1AWCA 3EQLF 4RB1A 2GXGA 5ERIA 4OOIA 3KP6A 4HV5A 5FB2A 2A07F 2BV6A 1KU9A 3P9KA 3RKWA 3SZPA 4I2OA 2OAZA 4EMSA 2M87A 2A61A 5L3DA 4MQVA 2NRAC 5HVQC 2CW0F 1FLIA 1PDNC 1P4XA 3WODF 1U8RA 1GXQA 3WTWC 4IHSA 2VBYA 1ZLKA 4N9IA 4L5JA 3GUDA 2DO7A 4N9HA 2G9WA 3M9AA 5LGNA 5F64A 5AIPA 1I5ZA 3L09A 3BY6A 4G94A 2XHKA 1XCBA 4M6XA 2VONA 4HF1A 3I53A 2NNNA 5BMZA 2MD5A 5LHHA 1YTYA 4B09A 2GAUA 3RI4A 2L02A 3TKYA 2KIUA 2DT5A 4HAMA 2E1CA 2PMUA 1KGSA 4P96A 2MBFA 1J5YA 1U5TC 4UNOA 1FX7A 1UHWA 1BC7C 1ZH5A 1FOKA 1I6XA 1T39A 1HW5A 5TRDA 3GWZA 4QWQA 2QVOA 4LG0B 5E8IA 3MQ0A 3JTGA 1C0WA 2K4BA 2OD5A 3BP8A 4I01A 2EB7A 4OIRF 2QQAA 1G4DA 3TOAA 2NS0A 3QP5A 2A6EF 4A2UA 1MGTA 1KU7A 4M73A 1J59A 2LDUA 2VE8A 2EFOA 2F5CA 3HRSA 2GIVA 5FO5A 1U78A 5CVUA 1F9NA 3H92A 2ZMEB 3D0SA 2ZO4A 1YQAA 2FRHA 3F72A 4HLXA 3LAPA 3N4MA 3C1DA 2EK5A 5LGUA 2D1HA 3CLOA 4R79A 3WTSC 4ZYDA 5F1RA 3GFLA 5D4RA 1XSVA 2A3SA 3EUHA 3Q9VA 1F1ZA 3T1BA 5D5XB 3DEUA 2VBXA 5BPIA 3GO5A 4WXDA 4RB3C 2ZBKA 1LVAA 4BH9A 4ZZDA 1L0OC 2H09A 5E8GA 1ONVA 2FEZA 4ENMA 3F22A 1Z7UA 1E17A 4R1HA 3E5UA 4KICA 3RKXA 1S29A 3GLXA 4L18B 1P6RA 5ILUA 3F8CA 5BOXA 3HIFA 1LQ1A 2DQRA 2HKXA 3REOA 2V79A 1FWZA 1ZRFA 1R5GA 2ZMEA 4EJTA 1R1TA 4RGXA 3E5QA 5HOOA 5DDGA 1R22A 1LNWA 3M7GA 3JTHA 3DPLC 3WU0A 2FF4A 1YW9A 2RDPA 3U1DA 4YFKF 1IN7A 2ZNYA 1H0MA 2F2EA 1YG2A 1QBJA 3T0YA 1YW8A 2WV0A 3IWZA 2CYYA 3GW2A 2RC4A 1OMIA 5KVRA 4KN4X 4PGHA 2HWVA 2XAGA 5D6EA 1I1SA 1MZBA 4RGSA 3TO7A 1J2XA 2QYOA 3U2RA 2KJBA 5LEKA 4LD5A 5HS7A 2K4JA 1S6LA 1FP2A 1ZGAA 2VODA 1O3QA 4A0YA 4KIFA 3GFJA 2HQNA 2PJPA 4EVIA 4MTDA 4E70A 1TBXA 2MH9A 1KQ8A 4KNYA 1SMYF 4M6YA 3BPXA 2XROA 1TQMA 4RAZA 2DQLA 1FSEA 2O61A 3W6KB 3GZ6A 3ZMVA 2ESHA 2W25A 4CZZA 2STWA 4HW0A 4YG2F 1R36A 4HX8A 3GYHX 1EV7A 5JFRA 4WXHA 1NHAA 3B73A 3IHUA 2QZ8A 4EJOA 5D5WB 2A5YB 3T8RA 4G7ZF 5E20A 2VN2A 3WU1B 4TV7A 3FXQA 2FMLA 2Q8KA 3LFKA 1BIBA 4O5VA 3MWMA 4L0YB 4H0EA 3QPHA 1ZRDA 4EM0B 1HSTA 3FX3A 2FNAA 2QLZA 2MC3A 4YIIA 5LBQA 4WCGA 2HTSA 3JW4A 3HTSB 4AIHA 2D2WA 1TLHB 4P55A 2ISZA 1QZYA 2RVCA 4DQ2A 4BHPA 1O7FA 4EQQA 1KYWA 3MAJA 1XN7A 1HQCA 4HV6A 4Q4ZF 1GVJA 2XAHA 3JSPA 1FC3A 3EETA 4Q47A 3R6SA 4IRIA 2W24A 4IRHA 2VBWA 2XKOA 2A69F 1B59A 4HOBA 3WTXC 4P9FA 1PP8F 3BDDA 4NHJA 1XCVA 2NAZA 1YS7A 2FOKA 1EH6A 1XD7A 2UWMA 2IA1A 5LEJA 4WF2A 2DFIA 2LF8A 5DUIA 1FT9A 2DU9A 5HLGA 1ULYA 3RYPA 3R0AA 4AVPA 2P5VA 2J5PA 2B0LA 3GZ5A 1SFXA 4PCQA 4LK0F 3WTTC 4HLYA 1W7PA 3MZHA 3FZVA 2D45A 5L3EA 3KEOA 1IN5A 2GWRA 4ASNA 2AXLA 4XLNF 2DLLA 3WTZA 1I27A 3EYYA 4HZFA 3R61A 3DKWA 2WTEA 3KP2A 3F23A 2FBKA 4CDGA 1U5TB 1STZA 1FP1D 3TO9A 1BI1A 4PZJA 4YFNF 4ENJA 2O0YA 4CXFA 4OIPF 4KT5C 3HOSA 2R3SA 4KMFA 2TDXA 2JT1A 4RB2C 1T6SA 2ADUA 1DPUA 4ESBA 3TGNA 4UUVA 3E6BA 4MGRA 3NEUA 2BEOA 2YU3A 1CF7A 5E1XA 2F5EA 3BJ6A 2QBYB 2FMYA 1R00A 2GA2A 2RN7A 1F5TA 3ZMDA 3P9CA 2G7UA 1HKQA 3E5XA 2Q2EA 4GYIA 1SD6A 1QPMA 4L9TA 4ZYGA 2GXBA 4EV0A 3I0TA 2HOEA 4I02A 1K7AA 4FHTA 2CWEA 5CYVA 4BNCA 4XSZF 5K5QA 3HRMA 5CVJA 4ZYHA 2IT0A 5A2QZ 3BJOA 3E6CC 3MCZA 3S2WA 3F21A 4WK8F 1O3RA 1LEAA 4UV8A 1HKSA 2Y75A 1TQPA 1U5TA 4GGGA 3RTRA 3I64A 4I0BA 1ZAOA 4HF2A 2JPCA 2JTVA 3CO6C 2EFWA 4K2EA 3RPQA 1B6AA 1HW1A 5HDGA 1R5HA 2LNBA 5ICCA 2EA4A 4GYGA 1K78B 1YW7A 5FLXK 3KFWX 2X4HA 2LKPA 1O7LA 3H3UA 4G9YA 3QP6A 2G7HA 1S7OA 2XAQA 2QBYA 3IC7A 1JHFA 4YIFA 3W6JB 3GFMA 4XSXF 1PUEE 1G3SA 2VBZA 1GXPA 1R58A 5D8KB 4WX9A 2P5KA 1ZYRF 1IN8A 2C6YA 2BYVE 3K9TA 2DPDA 2NNYA 3O3KA 2P7VB 1XMAA 2MH2A 2DBBA 2R7FA 5ILVA 2WWYA 1UHMA 3VFZA 5DYMA 2WC2A 2ZCWA 3E3VA 4I7HA 2CO5A 1B9MA 5JHUA 1J75A 3TOBA 1RI7A 2VXZA 1RNLA 3BWGA 1RUOA 4CHUA 3BOQA 3COAC 4U0VA 3J81Z 1IN6A 1ODDA 3CUOA 3LA7A 4JQFA 1WQ2A 1BIAA 3P9IA 5BS6A 1FBSA 4IXAA 2OQRA 4LB5A 4IVNA 4P9UA 1J7KA 2EA2A 2YR2A 2IA0A 1D5VA 5JR3A 5HS9A 4KIBA 3HSRA 3EYIA 3ZP5A 1QGPA 2ACJA 3WTUC 3F8NA 2VOOA 1K79A 1FYMA 4ESFA 3M8EA 1R1VA 5ICFA 2BE5F 5DUKA 4BYYA 3L2CA 3QU6A 3FXRA 1XGOA 1MDMB 4HQEA 2O8XA 4UV9A 2CGPA 1B1BA 1UFMA 2R7DA 2QQ9A 1ZG3A 2Z9OA 1B9NA 4LG0A 5HDNA 4XRFA 1MD0A 3QRFF 1D8JA 3RJPA 3HHGA 1ZN2A 3I59B 4UVAA 3LQRA 2HZTA 1Z91A 1ZHFA 3QPTA 2VC1A 5E1ZB 4NB5A 4HBLA 4EJUA 2PMHA 1ZRCA 3K0LA 2QUFA 3QU3A 2VOPA 1XDUA 3V7RA 1TTYA 1RUNA 2Z99A 2OZUA 2KIMA 3CO7C 1D8KA 4AIJA 4M74A 2OBPA 2ESNA 2EV0A 1TNTA 4ZH4F 3BJAA 1WKMA 1G3YA 3MEXA 5HLIA 4GO1A 5HDKA 2Y0MA 3VODA 3PFIA 2GZWA 2RGVA 4BHBA 5CVRA 2L01A 5LGTA 2FQ3A 1J0RA 1YS6A 4HA8A 1MJBA 5DD4A 4AWXB 3L9FA 1O57A 2VT3A 4RS8A 4ZZLA 1MDMA 1RZ4A 4G6DA 4I98B 4L9JA 3H3ZA 1MJ9A 5CLSA 1BC8C 3SXYA 1UB9A 5E17F 3M1EA 2OQGA 3FMSA 3V8KA 3F8BA 1UCRA 2L54A 3SZTA 4U0WA 4CICA 5DEQA 2RKHA 1KA8A 1Z05A 3FWEA 4EM2A 4A6EA 1TW2A 3WGHA 5FD6A 5LRRA 3G73A 3GFIA 1S3JA 2EV5A 1Z9CA 1Z6TA 2FXAA 2UXXA 5LHIA 2UZKA 3GF2A 3KETA 2XUBA 2DW4A 2P8TA 2CG4A 3GEZA 2XV4S 4A0ZA 2VT2A 3K1NA 1QZZA 2V1XA 5FFZA 5JVTA 2F5DA 4A5MA 4HX7A 3K69A 4RGUA 3KP3A 1TQIA 4IJAA 4N0BA 1HSJA 2EV6A 1W5SA 4UVCA 1A04A 1YYVA 2D1VA 3ECOA 3JAMK 1IXSB 5KK1A 3JSOA 3C7JA 1OKRA 2KIFA 1KQ0A 1IXCA 1IUYA 2K7LA 1QQIA 4AD9A 5J8FA 4S05A 2NYXA 4A5NA 2JPBA 3F8FA 3I4PA 3MZYA 3R4KA 1Z1DA 1S7AA 4G7OF 1RIOH 4M72A 1JE8A 2O6GE 5DCFA 1GHCA 5H6RA 3E6DA 3C18A 2HFHA 4U7DA 3SFZA 5EEHA 4MHGA 1JGSA 3TO6A 1IXRC 2FU4A 3CUQB 2F5FA 5ICEA 5H20A 4U7BA 3CTAA 1T2KA 5J8CA 2HGCA 1USSA 4UXNA 1LJ9A 4A0XA 1Z6RA 2IVMA 4LFUA 3IL2A 4UHTA 3LAJA 3U9GA 4GCVA 3PQKA 3K2ZA 1T38A 4GXOA 5HS8A 3R60A 2M45A 1FZPB 4KN7X 2IP2A 3HSFA 4YFXF 2YSRA 3D5LA 2JZYA 4OU0A 4PGGA 1SFUA 4BQAA 4NQWA 5K5OA 1D3YA 3J80Z 1IN4A 3F6OA 2IJLA 1YO5C 1P4WA 5ICGA 1IW7F 1KYZA 1O3TA 2H6CA 2AS5F 4DNCA 4IHTA 2IPQX 5DD8A 4Y13A 1IRFA 3ZMUA 2LF7A 1O3SA 4WXCA 1FBUA 4HDUA 1OPCA 3HRUA 4ON0A 1BI3A 5TJJA 1R7JA 1V4RA 1MKMA 3KP5A 4MEXF 2V9VA 2E7XA 5FGMA 1EH7A 2UXNA 4Q48A 4EGZA 2P6SA 2PFBA 5IT9Z 4EJWA 2XIGA 4HF0A 4UVBA 2DI3A 4R8HA 6PAXA 4AIKA 1SFEA 3WG9A 2FBIA 4RAYA 2IW5A 3FHZA 3HTUA 3CUQC 1LDKB 3WTYC 4RB0A 3BPVA 2ZKZA 2YX4A 4L9NA 4EM1A 1REPC 4HYEA 1JHHA 2HR3A 1FY7A 2P4WA 2QM3A 1FPQA 2E1NA 5FFXA 2MLGA 1SD5A 1U6GA 4HDVA 3ZMSA 1XSDA 2O03A 4JK1X 4Z2YA 2DPUA 3BROA 3F6VA 1LDJA 5J6XA 2MLKA 3I58A 4HQMA 5E1WA 4LB6B 1CGPA 3O2PE 3G3ZA 5F6FA 2ELHA 3OOPA 2V1DA 1W7PD 2COMA 2FSWA 1SD4A 4I0AA 3IWFA 2QWWA 2W84A 1FSHA 3Q9SA 1TNSA 1YIOA 2YX7A 1DP7P 1HKTA 3ZPLA 1ON1A 1YLFA 3HOTA 2EJRA 3DQVC 5ILSA 2PI0A 3J81K 3VEPA 1I1GA 3O6BB 1X3UA 2GA1A 5CVVA 3ZMTA 3HSEA 4MQ9F 2H6BA 4KUMA 5FLXZ 1ON2A 1U3EM 3RIRA 1V3FA 3J7AO 1HBXG 3PQJA 2DAOA 2DK5A 4L5IA 2W57A 3ERED 3ABUA 4MTEA 3ZN1A 1WI9A 3DXJF 1ZG5A 3ML6A 5DV5A 2HS5A 4A6DA 4XLPF 2RQPA 1DDNA 1R1UA 5K5RA 3L7WA 4KA4A 3DP7A 2KJCA 3WGGA 2FNPA 3FM5A 4L9VA 1K78A 2PN6A 4G8XA 3CDHA 2ETHA 3FM3A 2EFNA 2CQKA 1PP7U 3N97A 2CFXA 4RGRA 4ESJA 1XMKA 1QO0D 2RV8A 5CVIA 3KZZA 4IRGA 3ECHA 3ULQB 5BPDA 5LHGA 4FX4A 3RKYA 4ENKA 1SD7A 4IF4A 5IT3A 1OR7A 3ZQ7A 3F8MA 3KE2A 1OYYA 1U2WA 2EFPA 2ZNZA 2XAFA 4KYWA 3NRVA 2XASA 1DUXC 1MJAA 1ZG1A 4S04A 1EH8A 1LB2A 4OIQF 3BZ6A 3QOPA 1F4KA 4F7ZA 2HQRA 2DK8A 3I54A 4KMUX 5L3FA 1OYWA 3LQQA 3GVAA 1WSUA 5AONA 4CYDA 3I5UA 5FD5A 1IAWA 3HRTA 2H27A 5AIQA 2FA5A 1ZARA 3V7SA 1H9GA 1H9TA 5K1YA 2HKOA 2K27A 3IRQA 5LLQA 4Y15A 3KLOA 1WRJA 2L4AA 1IZ1A 2PBIA 2HTJA 4IPAA 1XB4A 3CJNA 1AOYA 3F3XA 3VOEA 5BQTA 2M30A 4OIOF 4D0PA 2JRTA 2HEOA 4M71A 4BHCA 3SHFA 3KP4A 3SQNA
chains in the Genus database with same CATH superfamily
3K4MA 4F52A 4IOAF 3V4GA 3GTGJ 4YELA 3T8TA 1TW3A 2ZJ2A 1ETYA 3S93A 3WTVC 2XAJA 2CSOA 3ESWB 4KFCA 3EDPA 1QNTA 2LMDA 2QQ8A 1OJLA 2VPRA 1G3TA 2YPRA 4AYBA 1LFPA 3E6MA 3K4KA 3BQYA 4U0YA 1HW2A 2XGXA 3L2WA 2VJIA 3J7AY 1R23A 2XF6A 4H4KC 4MIMA 2KT0A 2HYGD 1FYLA 1IRGA 2E1MC 2CV1A 1NG6A 3OYBA 3GXOA 3SFIA 1ITYA 3TQNA 2HPMA 2ISYA 1ETXA 1MH3A 1W4MA 3OV8A 1Y1VJ 4HSTA 1VQPI 3TL4X 1E2XA 3NWTA 2HYFA 2E19A 3BG7A 3M8FA 1S5LC 2CRGA 1BR2A 3I59A 2BBYA 2TCTA 1VZ0A 1LPQA 3K1MA 2IS1A 2HPIA 4CSWA 1ZREA 4LLLA 2XB0X 3M8JA 4LLGF 3MFKA 4A3EJ 2M5WA 4J01A 1MW7A 3WGIA 5CQGA 4LG3A 2R4GA 2ZMEC 4CYCA 3S15J 3ABTA 2H94A 2EPFA 1ZLJA 4OMYA 1W5TA 4Z6YA 1IDZA 3KYDB 3KEQA 2DDAA 3KP7A 1YFHA 2V1UA 1TWCJ 2VQGA 3GX4X 3SYTA 3K4LA 1I6HJ 4QLCU 1BJZA 2W85A 5FKMA 3JRDA 2JQ7A 3C2BA 1K6OA 5F04A 2X1EA 3FKJA 2ECCA 3DPUA 2NS7A 4ZYEA 3T5XA 2R5ZA 1BJAA 2WAEA 4CGZA 2F4MB 2KRHA 4CCOA 2A68F 2K5CA 3ZMZA 3JRGA 4BEHA 2ID6A 2KRFA 2M2EA 1ETKA 1B4AA 1P4AA 3U21A 4YEJA 1A35A 1FTZA 2L4MA 4U88A 2LY1A 2Q0OA 3DFGA 4A93J 3AG3H 2CUJA 1WHUA 3E97A 3S32A 1FNNA 3OYDA 3ROUA 2OU2A 2P7CB 2ZFWA 1FBQA 3FF5A 3SDBA 3PIPF 1I39A 2P6TA 3I9V2 2M8EA 4O3MA 1JI8A 3IKTA 2R7WA 1XGNA 3CCRI 1T98A 1VF9A 3OYCA 4LJZF 3ZOBA 4EGYA 1USTA 2M1BA 3HUGA 2K86A 1X2NA 3VB2A 1SAXA 3FMQA 2L9RA 2BVMA 1J9IA 3HL2A 1FOXA 1S8NA 1XSXA 3V8JA 3CCJI 4IEJA 4XRSA 2XKPA 2CS3A 3Q5FA 5DCMB 5EEGA 4BS9A 2HDCA 3GTPJ 3V42A 1KU2A 3K10A 2L3DA 4M9SA 4QPOA 1MBHA 3ONQA 4RA2A 2X0LA 4IZZA 4BQQA 4G6QA 2CW7A 2VC0A 3MN2A 3BR6A 2HOTA 2KL4A 4Y33A 1BN5A 2W1OA 1G6NA 5IOZA 1DU6A 4WWCA 4BACA 5IYBJ 1FOYA 4P5OA 5JI6A 1IF1A 4G7HF 2OPTA 3DV8A 5D8LB 4XBFA 2PEXA 5TGTA 1BL0A 5L3GA 1W7PB 4LMYA 1SMTA 2PLYA 2O8KA 1Q1HA 2F48A 2O5RA 5J3LA 3WE3A 4GRIA 2XSDC 5D5VB 3DF8A 5L3BA 1P92A 2KHMA 2I10A 1D1AA 3A4CA 4KIGA 3FMRA 3FXUA 4M3BA 2IRFG 1MIJA 2W48A 1G3WA 3ZN0A 3HYIA 2PJRA 1R4NB 4O6JA 5HLHA 3GTOJ 1Y0UA 1WWXA 1KQ9A 1LFBA 2HDWA 3S16J 2K02A 2VPLA 3DPTA 2O7OA 3K4CA 4OMZA 4A3IJ 4IQJA 1IRZA 3CZ6A 3C3WA 4KDPA 4OWRB 5ED4A 1XGSA 3LA3A 3I4MJ 1BI0A 2XF5A 3LSTA 3I56I 3LWFA 3B02A 3AAFA 4I09A 5DTDA 1ZGJA 2JSCA 1DPRA 4I76A 2XRNA 4ETSA 4A12A 4B47A 3JRBA 3JAMZ 3QYEA 2FD5A 3NQOA 4ENNA 1LDDA 2O3FA 2RQQA 3X2QH 3IRRA 5L3CA 4XQFA 1BI2A 1BOAA 4MEYF 3HOVJ 3QQAA 2KKOA 3DKXA 2EWNA 2Y48A 3V7CA 3R0JA 2LG4A 4HSRA 2FBHA 2BXZA 3I3LA 3IKVA 3OYJA 1D5YA 2EINH 4FISA 3ZXSA 3K70D 5CJ9A 2EIMH 2Z33A 2CV2A 3S3MA 4E7JA 3V8LA 3K4JA 2QKLB 1MSFC 2X1CA 4M9XA 3J80K 4XRMA 1LEBA 2LSOA 4GDFA 2EFQA 2LBFB 3NWSA 1CF7B 2OUMA 3ELKA 1VTNC 2OZ6A 3PNYA 3VPRA 1MBGA 5DCMA 2VLAA 1WJBA 2CH0A 2X6WA 2XF7A 3OYGA 1BBYA 3ZGKA 3CDLA 3WG7H 1Q1VA 3K2AA 4KITB 3OYMA 1XDSA 2XGEA 4CO8A 3HHHA 2P5LC 2M7BA 2E7WA 3Q0WA 2Q2EB 2GM4A 5D5UB 2DTRA 3L00A 2DT6A 3DEEA 4Y17A 1R6RA 5LRSA 3TDUC 1BM9A 2V6CA 2PQ8A 5D6FA 4RLFA 4ZDOA 3RYRA 2OCCH 1TZLA 4LK1F 4W97A 3QAHA 1VQNI 1A31A 5H6QA 2XVCA 4CCLA 3JREA 1T0FA 2JRMA 3ISPA 2VE9A 3RPUA 2EZHA 2Y9YA 1IG7A 3FK6A 3RSNA 4XLAA 4FX0A 2E5NA 4PDKA 2STTA 4FT8A 1ZKGA 1ZQ3P 1HXDA 1Z0XA 1EA3A 3LOCA 4XK4A 1OYIA 4LGWA 1OCCH 3KCCA 4B4CA 2HNHA 2E2IJ 2LR8A 2L0KA 4OINF 4HX4A 2NXNB 2WAQN 4LLNA 4YIRX 2AHQA 1JKPC 1W5CC 2BGCA 2PG4A 3KZYA 4EJVA 4L0ZB 4XN3A 4E7IA 3CUQA 4Q5SF 2QENA 1KU3A 1L3LA 2OA4A 1NK2P 5IT9K 2DA3A 2FE3A 2NOGA 2K3FA 5D4SA 2Z3YA 2RNJA 4B48A 2IA2A 4JBAA 3LA2A 4ANJA 1YX3A 2DN0A 4E6KG 3KX2A 3P7NA 1R71A 3CC2I 2ELKA 2ZXJA 3M3YJ 1IJWC 3I71A 2Z5UA 2CQXA 3OL3A 5A2QK 1J09A 3RDIA 4MNUA 2ZXHA 1GVDA 2A6HF 1XGMA 4LITA 1FYKA 3K1PA 2LBFA 4B8XA 4BAYA 3KLNA 2GQQA 2J5OA 2XC7A 1X1PA 2R7ZJ 1P2FA 4M9ZA 2QQBA 5KCMA 3PNTA 4BXUA 3TDZC 5E18F 5M5WJ 2MA3A 4II3A 3SEQA 3WE2A 4BU2A 4IL6C 1JXSA 1AWCA 1AA7A 3EQLF 4RB1A 2DMQA 2GXGA 2Y2ZA 4N4NB 5ERIA 4OOIA 5EJCA 3KP6A 1TWHJ 4HV5A 2W00A 5FB2A 3BCBA 3DU5A 2X6XA 2A07F 5J1YA 2BV6A 1KU9A 3AG2H 3S2HJ 3P9KA 3RKWA 3P5JA 3SZPA 4I2OA 2OAZA 2MYSA 2X1DA 4EMSA 2M87A 4BBRJ 2ME0A 2A61A 5L3DA 3HM5A 4MQVA 2NRAC 5HVQC 2CW0F 1FLIA 1PDNC 1PVEA 1P4XA 2WA0A 3LMMA 3WODF 1JKOC 1U8RA 1GXQA 3H35A 4C2MJ 1F43A 4CH7A 3WTWC 2E2HJ 5FJ8J 4IHSA 3CC7I 1N78A 2VBYA 2QEXI 1ZELA 1ZLKA 4N9IA 4L5JA 4QPQA 1B8IB 3GUDA 4UY8I 1UAAA 1IUFA 2DO7A 1Z21A 3DKYA 2M7AA 2LY9A 4DW6A 5GTHC 1H88C 4N9HA 2L9VA 2G9WA 2Y30A 3M9AA 5LGNA 3AFHA 3VDXA 5F64A 3BCAA 2GXAA 3IH4A 5AIPA 1I5ZA 3L09A 1ETWA 2JA6J 2DMNA 3BY6A 1V54H 3RZDJ 3GTQJ 1H8AC 4A3DJ 4G94A 4Y4RA 2NVYJ 2XHKA 1XCBA 3DBRB 3G1OA 2F4OB 4M6XA 5EG0A 4ABZA 2VONA 4HF1A 1E3OC 2JVHA 3I53A 2L9SA 4XLEA 2NNNA 5BMZA 2MD5A 5LHHA 1YTYA 4B09A 2LOOA 2Y0SN 2GAUA 3L2UA 3BTJA 3RI4A 2L02A 1W0TA 3TKYA 1BR4A 2KIUA 3IP4B 2DT5A 2R92J 2WAFA 3OYLA 4HAMA 3BLYA 4AUXA 2E1CA 2PMUA 2XGDA 1MMAA 3PL8A 4IOCF 4D9JA 1KGSA 4P96A 3MMYB 5IOYA 1VQ7I 2L2OA 3IV5A 2MBFA 5JVGF 1J5YA 3CD6I 3B6AA 1TP4A 1U5TC 3DWLE 4UNOA 1FX7A 4ZC3A 1UHWA 3FXOA 1BC7C 1ZH5A 1FOKA 3CDIA 4M6VA 1I6XA 2VB6A 1T39A 1VQOI 5IP9J 1HW5A 5TRDA 3GWZA 4NC8A 4QWQA 3PUBA 2QVOA 4LG0B 5E8IA 3MQ0A 3JTGA 1C0WA 3OYEA 2K4BA 4XKCA 2OD5A 2VQCA 3BP8A 3VSKA 3CJQB 5DM7F 1NG7A 4I01A 3G1LA 3HG9A 2EB7A 1A36A 4OIRF 1B8IA 5GAGJ 2QQAA 1WPKA 1T56A 4XORA 1G4DA 2E36A 3TOAA 5C44J 2JUGA 2NS0A 1X3WB 3QP5A 3EUKL 1D0XA 4GFBA 4HG2A 2A6EF 2WADA 3LL7A 4A2UA 4BY1J 1MGTA 2PMZA 1KU7A 3RQIA 4QSHA 4DYCA 4M73A 1J59A 2LDUA 3MKYB 2VE8A 2EFOA 3W3CA 5DM6F 2DJNA 4EATA 1K61A 2F5CA 1OCPA 5CQEA 3HC7A 3HRSA 2GIVA 5FO5A 1U78A 2JUCA 1K83J 1Z77A 5CVUA 3BQZA 1F9NA 3H92A 3FBIB 4XLCA 1VFCA 2ZMEB 1MNEA 3D0SA 2ZO4A 2E5ZA 4F93B 1YQAA 2FRHA 3F72A 4HLXA 4V2FA 5GADJ 3LAPA 2Z1DA 3SHFA 3HPGA 3N4MA 2DT7B 3C1DA 2Z2SB 2P81A 3IH2A 2EK5A 5LGUA 3TW6A 2D1HA 1Y0NA 4L5EA 3CLOA 2B7EA 4R79A 3WTSC 1SFOJ 3CQZJ 2NOJB 4BQOA 5J4YA 4ZYDA 5F1RA 3GFLA 4B1RA 5D4RA 1XSVA 4E7HA 2A3SA 3EUHA 3PUFA 3Q9VA 1F1ZA 3T1BA 5D5XB 3CCUI 3DEUA 2JA8J 2XSJC 2VBXA 3BR0A 5BPIA 3IAS2 4MFDA 2W4SA 5M3MJ 3GO5A 3CCMI 4WXDA 2KZVA 2X9DA 1Y56A 4BGDA 3LSGA 5CKTA 4RB3C 1UG2A 3LSMA 4KISA 2ZBKA 1LVAA 3OOUA 4BH9A 1MMSA 4ZZDA 1L0OC 2H09A 2UV1A 5E8GA 3BZKA 4IKFA 1IV6A 4XIDA 4BUPA 1ONVA 2G0EA 1F36A 3OL4A 2FEZA 4IHWA 2IS2A 3TP0A 3ZQCA 1SVOA 4ENMA 1APLC 2FOWA 3F22A 1Z7UA 1E17A 4R1HA 1BOBA 2VJJA 3E5UA 4KICA 1SANA 3RKXA 1S29A 3GLXA 3W6VA 4FE7A 4L18B 1P6RA 2XGCA 5ILUA 2CW8A 2QF7A 2IGMA 3F8CA 3S2DJ 5BOXA 3HIFA 1LQ1A 2V1NA 2HDDA 4A3BJ 2DQRA 2JJ7A 2ECBA 2HKXA 3I55I 3PSFA 3REOA 2V79A 1FWZA 1ZRFA 1R5GA 2ZMEA 4EJTA 1R1TA 2KLOA 4YRVA 4RGXA 4E7ZA 4CCNA 3E5QA 5HOOA 2E2JJ 5DDGA 4XN0A 1IRXA 1R22A 2WB1N 2V7FA 3A2KA 3OYAA 4ZTFA 3NAUA 3LSHA 2W7NA 3O8HA 2RREA 1LNWA 4DIQA 2WBMA 3UNGC 3LSJA 3M7GA 4XOPA 2VKVA 1ZR2A 3JTHA 5B1BH 3DPLC 3PM1A 3WU0A 1HLVA 2FF4A 1YW9A 2KPMA 2LC2A 2RDPA 3VYRB 3U1DA 1U0JA 2DA2A 4YFKF 1IN7A 3K4NA 3UKGA 2DXIA 3BR2A 3DLAA 2ZNYA 4PUSA 4CZCA 1H0MA 2F2EA 1YG2A 4B3AA 3S1NJ 1QBJA 3T0YA 1YW8A 2WV0A 3IWZA 5HODA 2CYYA 3GW2A 2RC4A 1OMIA 4IHXA 5J1UA 3PIOF 2DDBA 5GPCA 1G59A 5KVRA 4KN4X 2JVGA 4PGHA 2HWVA 3ZR8X 2EZLA 2XAGA 4NUBA 5D6EA 1I1SA 2V9PA 2IGKA 1MZBA 4RGSA 3TO7A 1J2XA 1X4PA 3A01A 1H89C 1G2HA 2QYOA 3U2RA 1RESA 2KJBA 5LEKA 4PJ0C 4LD5A 5HS7A 2K4JA 3CCSI 1S6LA 1RR8C 1FP2A 1ZGAA 2VODA 9ANTA 3ZQHA 2IGNA 5BNGA 1O3QA 3GLLA 3NARA 4HPQA 4A0YA 4KIFA 3GFJA 2HQNA 4PJMA 3FDYA 2GOMA 2PJPA 4EVIA 2O9LA 2R7OA 3J7YJ 4MTDA 4E70A 1TBXA 1JJ6C 1VQ6I 2A05A 2MH9A 1KQ8A 1OCTC 1SMYF 4KNYA 1TWAJ 4M6YA 1BR1A 3BPXA 2XROA 2AQFA 4IQ4A 1TQMA 4RAZA 2DQLA 1FSEA 2O61A 4XONA 4UB8C 3W6KB 4FTHA 3GZ6A 3ZMVA 2ESHA 4XL9A 5DS9A 2W25A 4CZZA 2STWA 3CP8A 4HW0A 4YG2F 1R36A 3OS0A 1W1WE 4HX8A 4BDZA 5B3SH 5HNFA 4XNFA 3GYHX 1EV7A 5JFRA 4WXHA 1VQ8I 1NHAA 5EF6A 2M0CA 3Q3SA 3B73A 1ETOA 3IHUA 2QZ8A 1X1AA 4EJOA 5D5WB 2A5YB 2WAQA 3T8RA 5FKKA 4G7ZF 1Z3YA 5E20A 3K70C 3K6GA 1OQYA 1GT0C 4IX7A 2CMPA 2VN2A 4FASD 3WU1B 4TV7A 1ETQA 2MW8A 2X51A 3FXQA 2FMLA 4AVZA 4LIVA 3OS2A 2Q8KA 5IYCJ 2VQHA 3LFKA 1BIBA 1BW5A 4O5VA 3MWMA 2KFDA 3VSLA 4L0YB 4H0EA 3QPHA 1ZRDA 1R5ID 4EM0B 5EZHA 1V5FA 2K9QA 5F0FA 4BY7J 4D5FA 1HSTA 3FX3A 2FNAA 3SZGA 2QLZA 2MC3A 4YIIA 5IP7J 5LBQA 4WCGA 3SJMA 1VI0A 2HTSA 3FKIJ 3S3NA 2EZKA 3CF5F 3JW4A 3Q0UA 4AIHA 3HTSB 2D2WA 3HDDA 1TLHB 4KJZA 4P55A 2ISZA 1VQLI 4C2UA 1QZYA 1UZCA 2RVCA 4DQ2A 3F9KA 1HA8A 4QTRA 4BHPA 4NQWB 1O7FA 4EQQA 1KYWA 3MAJA 1XN7A 1HQCA 3QODA 4HV6A 4Q4ZF 1GVJA 2XAHA 5M3FJ 5IYDJ 3Q0VA 3JSPA 1JKRC 2IGOA 2DA7A 1QA6A 1FC3A 3EETA 1X19A 1SVMA 3HKZA 4Q47A 2VI6A 3R6SA 1N77A 3PJRA 1M1EB 1MBFA 2DA5A 4X1EA 4IRIA 1P7IA 2DFHA 4CCKA 2DODA 3ZQQA 1UELB 2W24A 5JLWA 4IRHA 3QYBA 2VBWA 2XKOA 2A69F 3OSGA 1B59A 4HOBA 3LNQA 4DBQA 4CA0A 2L7FP 1X1BA 3WTXC 4P9FA 1PP8F 1B72B 3S17J 1YJNI 3BDDA 2VKDA 5E3OA 2DOFA 4NHJA 1XCVA 2NAZA 1YS7A 2FOKA 2DYRH 5GPAA 1EH6A 3H5AA 2ZJRF 1XD7A 1YJ9I 3E7LA 2TRTA 4AYBN 1BW6A 2UWMA 3H0GJ 1QPIA 2VKEA 3VWBA 2IA1A 4F3QA 1POGA 4WF2A 1S9HA 5LEJA 4PSXA 2DFIA 2LF8A 4LIUA 5DUIA 3OWTA 1FT9A 2X48A 1GUUA 3OYNA 2DU9A 5EEAA 1DGRM 5HLGA 1ULYA 3RYPA 3R0AA 2CU7A 1YRNB 2KIQA 4AVPA 3DBHB 3BG6A 4X6AJ 2P5VA 4BDYA 1K4SA 3W2WA 4E7SA 1WJFA 1WJ5A 2J5PA 4NNJA 4D7NA 2XPVA 2B0LA 3GZ5A 1SFXA 4PCQA 4LK0F 2BXYA 3WTTC 4HLYA 1X1DA 2KDZA 1W7PA 2E35A 1JUSA 3MZHA 3PO3J 3FZVA 3TBIA 2M34A 2D45A 5L3EA 3KEOA 3S1QJ 1UJ8A 1EKEA 1KONA 1Y39A 1RRJA 1IN5A 3DU6A 3I4NJ 2GWRA 1MNDA 2R7UA 4ASNA 2AXLA 2ICWG 2JA2A 4XLNF 4XKBA 2DLLA 3VYUB 3WTZA 3OYFA 1I27A 2CV0A 3ABLH 3EYYA 4HZFA 1DU0A 3R61A 3DKWA 2WTEA 3KP2A 5J47A 3F23A 1FMVA 2FBKA 4CDGA 1U5TB 2KISA 2HYJA 1STZA 1FP1D 3TO9A 1BI1A 4PZJA 4YFNF 1DGWY 4ENJA 4ZDPA 2O0YA 4CXFA 4OIPF 2FUG2 4KT5C 1B72A 3HOSA 4ZTJA 2R3SA 2B63J 4KMFA 2TDXA 2CQ7A 2JT1A 3G2BA 2LKXA 4RB2C 4Y52J 4RAGA 1T6SA 1A6QA 2ADUA 4W1UA 1DPUA 3GCMA 4ESBA 3TGNA 4UUVA 2COBA 3E6BA 1IV8A 2LTPA 4MGRA 3VYSB 4V19K 3NEUA 2BEOA 1QRYA 2YU3A 1CF7A 2ZC2A 5E1XA 2F5EA 4FQGA 3BJ6A 3WHBA 2QBYB 2FMYA 1R00A 3AL0C 2GA2A 1RETA 2RN7A 2VJ5A 2IS6A 3CMAI 1F5TA 3MKLA 3ZMDA 1N25A 3JRIA 1YRNA 3P9CA 2G7UA 1HKQA 3E5XA 2R7XA 2OTLI 3SEZA 2AQEA 2Q2EA 4GYIA 1SD6A 2B9SA 1QPMA 3FHNA 1E0EA 4L9TA 4ZYGA 1JKQC 4FE4A 3K7AJ 2GXBA 4EV0A 1MSEC 2EZIA 5HLTA 3I0TA 2HI3A 3M4OJ 1WI3A 4M3DA 5IY5H 1FEXA 2HOEA 3HJEA 4I02A 3LFUA 3ZQIA 2JSPA 4E4HA 4FHTA 1K7AA 1W0UA 1PYVA 2CWEA 5KAIC 2KQRA 5CYVA 4BNCA 4XSZF 1HF0A 1MMGA 5K5QA 3L2RA 3HRMA 5CVJA 4ZYHA 2IT0A 2R7VA 3PSIA 3W2VA 5A2QZ 2LYCA 1NK3P 1ACIA 5CPRB 3BJOA 3GMEA 2V6EA 3OYIA 3L1PA 3E6CC 5FRNA 3MCZA 3S2WA 3F21A 3OIPA 4J19A 4E7KA 2XB5A 4XICA 2OC6A 4WK8F 1O3RA 1LEAA 2OF7A 3CLQA 3QPSA 4UV8A 1HKSA 3BR3A 2Y75A 1TQPA 1U5TA 2BHYA 4GGGA 5FRMA 4MO7A 2XPUA 3RTRA 3M1CA 2MC4A 3S1RJ 3I64A 4I0BA 1ZAOA 4HF2A 2JPCA 2JTVA 5FLMJ 3CO6C 2EFWA 4K2EA 4UB6C 1I3QJ 4RAFA 5EZGA 2BY2A 3FIWA 1QHGA 4Y7NJ 3RPQA 1B6AA 1HW1A 5HDGA 1FOWA 1YJWI 4CCJA 2JA5J 1R5HA 4PFOA 2K9MA 2LNBA 2DA6A 5ICCA 2EA4A 4GYGA 2DYSH 1YW7A 1K78B 3CCEI 1WFXA 5JLXA 5FLXK 3KFWX 2X4HA 2LKPA 1O7LA 3CCYA 3ASOH 3H3UA 1IDYA 3CF2A 3OR1C 4G9YA 3QP6A 4HNUA 2G7HA 1S7OA 3CCVI 1LE8B 1FIAA 1D0ZA 2XAQA 2QBYA 3RPUD 3IC7A 1JT6A 2DFFA 1AKHB 4HRIA 4XMYA 1JHFA 1MNMC 4YIFA 3HOZJ 3W6JB 1JUPA 3GFMA 4XSXF 3MZ8A 4I99C 1PUEE 1NH3A 4C3IJ 2LFBA 3RZOJ 2V9KA 1G3SA 2VBZA 4PJJA 1GXPA 3DLLF 1VQ4I 3W2AA 1R58A 5D8KB 2L7ZA 3F0CA 2HVSA 4WX9A 2P5KA 1ZYRF 1IN8A 1XMXA 2E1OA 2WB1A 2C6YA 4M3GA 2BYVE 3K9TA 2DPDA 2NNYA 3O3KA 2P7VB 1UG0A 3H9GA 1V5GA 1AHDP 3HB9A 1XMAA 2MH2A 2DBBA 2R7FA 5ILVA 1YIJI 1D1BA 2WWYA 1UHMA 2R5YB 4IHYA 3GTLJ 2A6TA 4NC6A 2I5UA 3VFZA 5C3EJ 5DYMA 2WC2A 2ZCWA 3DTEA 5F0CA 3E3VA 4F91B 2NVUB 4I7HA 5KHDA 2CO5A 1B9MA 5JHUA 5GTIC 1J75A 2JN6A 3TOBA 3AKZA 1RI7A 2CUEA 2VXZA 1RNLA 2D5VA 3BWGA 1HC8A 1RUOA 2K9NA 3A0HC 4CHUA 3BOQA 3COAC 4U0VA 3J81Z 1IN6A 1ODDA 3CUOA 3LA7A 5GAEJ 2E71A 2JMWA 4JQFA 1WQ2A 4BXXJ 1BIAA 3P9IA 2ELJA 5BS6A 1W36D 2QCOA 1FBSA 4IXAA 2VASA 2OQRA 4LB5A 4IVNA 4P9UA 3HGYA 1J7KA 2EIKH 2EA2A 2YR2A 1RR7A 2IA0A 3OIQA 1D5VA 4B43A 3CMEI 5JR3A 5HS9A 4CCMA 1SFKA 4KIBA 4PJNA 3HSRA 3IH3A 2HZDA 3EYIA 3ZP5A 1IO2A 1QGPA 2ACJA 3WTUC 2DOAA 3F8NA 2BOLA 4AU7A 1OLTA 4DJAA 2VOOA 3CMMA 1LE8A 2EQRA 3BG3A 1T95A 2K3PA 2R93J 4HNTA 1K79A 3KEYA 3HPHA 1FYMA 2F4IA 4ESFA 3M8EA 1R1VA 2WY7Q 5ICFA 2BE5F 2KZGA 5DUKA 4BYYA 3L2CA 2H1LA 2X6YA 3QU6A 3FXRA 1XGOA 1MDMB 4HQEA 2O8XA 4UV9A 2NVXJ 3DCFA 2CGPA 1B1BA 1UFMA 2R7DA 2QQ9A 1ZG3A 2Z9OA 5FKNA 1TWFJ 1B9NA 1WH5A 4B3XA 4LG0A 5HDNA 4XRSG 2H8RA 4XRFA 4MLOA 4EEFG 3MKWB 2XPWA 1MD0A 2MABA 2Q1ZB 3A02A 1T08B 3QRFF 1CQTA 1D8JA 3RJPA 2E34A 1ZN2A 3HHGA 2LP0A 3I59B 4UVAA 2E60A 3LQRA 1GDTA 2HQ5A 2HZTA 3EUAA 3FXKA 3S8PA 1Z91A 1ZHFA 3QPTA 2VC1A 5E1ZB 4NB5A 4XOTA 4HBLA 4EJUA 2PMHA 1ZRCA 2LH9A 2BY1A 5F27A 3K0LA 1OCOH 1WCMJ 2QUFA 2CJJA 3QU3A 2VOPA 4C3HJ 1XDUA 3V7RA 1TTYA 1RUNA 3HOXJ 2Z99A 2OZUA 2XRLA 1Z7LA 2KIMA 3CO7C 3U1KA 2R5ZB 1D8KA 4AIJA 4M74A 2OBPA 2ESNA 2EV0A 2ZXIA 1TNTA 4ZH4F 5IP6A 3CMYA 3BJAA 1WKMA 1HDDC 1X4OA 1G3YA 1OR7C 3MEXA 3HXLA 5HLIA 4BEHB 1DQUA 3VYTB 4GO1A 2IBDA 1A6IA 4BJTA 5HDKA 2Y0MA 1GV2A 2YU9J 1TWGJ 3IUOA 3VODA 2V26A 2K9LA 5GP9A 3PFIA 1K4TA 2ID3A 2GZWA 2NVTJ 3TW7A 1DP3A 3RQ4A 2RGVA 4OAYA 1LVKA 4BHBA 3E0JB 1OFCX 5CVRA 2L01A 5LGTA 2FQ3A 5E3NA 1J0RA 1YS6A 2IXSA 1G8XA 2BHZA 2F6CA 1MJBA 4HA8A 1GV5A 5DD4A 4AWXB 3L9FA 3HUGB 4JOMA 1O57A 2VT3A 4RS8A 1RKWA 2FJ1A 3CESA 4ZZLA 1YOVB 1MDMA 5J40A 2M3AA 1RZ4A 1RKTA 1V5EA 1WJDA 4G6DA 4I98B 4L9JA 3H3ZA 1MJ9A 5CLSA 1BC8C 3SXYA 2LY2A 1UB9A 3ERMA 1Y6IA 5E17F 3M1EA 2OQGA 3OR2C 3FMSA 3V8KA 4I6ZA 3N05A 3F8BA 2XAUA 1X3ZB 4BJ6C 1UCRA 2L54A 4DBRA 4UUSB 3SZTA 1YITI 4U0WA 4CICA 5DEQA 2RKHA 5KAFC 4A3GJ 1KA8A 1OISA 1WJCA 3M07A 3BTCA 2PMZN 2K85A 1T33A 2GIZA 3LSKA 3WHCA 3A1YA 5C4JJ 3GTJJ 1MMNA 1Z05A 2BVLA 3FWEA 2MFZA 1ZK8A 5F0HA 1YE9A 4EM2A 1ZGWA 4A6EA 3ZQGA 4DOZA 1EF4A 1TW2A 3WGHA 2QA4I 5EDNA 1X2MA 4OAZA 3H9JA 5FD6A 2PJRB 5LRRA 3G73A 3GFIA 1S3JA 2EV5A 2LK2A 1Z9CA 1Z6TA 2FXAA 2KMUA 2UXXA 2R7TA 5M5XJ 5LHIA 2LD5A 1TC3C 2UZKA 3GF2A 2QSGX 3H36A 2AO9A 3KETA 2HQAA 2XUBA 2DW4A 1UMQA 3DBLB 2P8TA 2HVRA 2CG4A 4X0GA 2FX0A 4BL0B 2L7MP 3GEZA 3PFYA 3ASNH 2XV4S 1XC5A 4A0ZA 3ABMH 3ZQLA 1WJAA 2VT2A 3K1NA 5LD2C 1QZZA 2V1XA 3HGGA 5FFZA 1YHQI 1EJ9A 5JVTA 2F5DA 4A5MA 4HX7A 3RKQA 3BTIA 3K69A 4RGUA 3KP3A 1TQIA 3ZRGA 2HU9A 4IJAA 4N0BA 1HSJA 2EV6A 1R4MB 2QKMB 1W5SA 3S3OA 4UVCA 1A04A 1VNDA 1YYVA 2D1VA 3CJTB 3ECOA 3JAMK 2CUFA 3WU2C 2QSHX 1VQKI 1HCRA 2HOSA 1IXSB 1S72I 5KK1A 3JSOA 2DMPA 3C7JA 1OKRA 5JHFA 5LFAA 4UUSA 4BE1A 3PO2J 3S1MJ 2KIFA 3AL0B 1KQ0A 1IXCA 1IUYA 2K7LA 1QQIA 3SDGA 4AD9A 5J8FA 5GAHJ 4S05A 2DJIA 2NYXA 4A5NA 1QU3A 1ZTRA 2JPBA 3IAM2 3OIOA 3F8FA 3I4PA 2YUSA 3FBNB 1V55H 3MZYA 3LSRA 1XX5A 3R4KA 2M4GA 1Z1DA 1S7AA 4G7OF 1N75A 5HNHA 3GBGA 2DMUA 1RIOH 3BC8A 4M72A 3D5RC 4XLFA 4DYRA 4P1WA 2K40A 1JE8A 2O6GE 5DCFA 1GHCA 5H6RA 1IGNA 3BZCA 4RM3A 3E6DA 4AM3A 2Y69H 3C18A 5J1RA 3E1SA 1T8IA 2HFHA 4U7DA 2OJED 3SFZA 5EEHA 5FROA 4MHGA 1JGSA 3TO6A 1D1CA 1RPWA 1IXRC 2FU4A 3CUQB 2F5FA 5ICEA 4A3LJ 3OYKA 2YS9A 1R9TJ 1P7JA 5H20A 4U7BA 1MBKA 3CTAA 5J8CA 1T2KA 3HOUJ 2HGCA 1USSA 3L2VA 4UXNA 2EH3A 1E3PA 4U87A 1LJ9A 4A0XA 2BY3A 3AG4H 1Z6RA 3FK7A 2IVMA 4LFUA 3IL2A 4UHTA 2VXDA 3LAJA 3U9GA 2DA4A 4GCVA 3PQKA 4F55A 4BE2A 2CQNA 3K2ZA 2EILH 3JRFA 1T38A 3KIOA 2LVSA 2WV1A 1IC8A 4GXOA 1FIPA 4BBSJ 2HVQA 1JT0A 5HS8A 3R60A 3DTIA 2M45A 2ZSIB 4JX6A 1SEUA 5F08A 1FZPB 4KN7X 3HBLA 2IP2A 2Y0SA 4PSWA 3HSFA 4XR6A 4YFXF 1WVRA 1ERDA 2YSRA 1S7EA 3D5LA 1D0YA 1RC9A 2JZYA 3D1NI 4OU0A 2Y9ZA 4PGGA 3MD2A 1SFUA 4BQAA 4NQWA 2OCEA 5EGOB 2VJ4A 5E79C 5K5OA 4M3EA 1SAUA 2Y31A 2KDOA 1D3YA 3J80Z 2R7RA 3JCUC 1R49A 3C2GA 3G4SI 2LLKA 4A3FJ 1IN4A 4DZJA 3F6OA 2IJLA 2DOEA 2R7SA 2ZB9A 3GZNB 1YO5C 4E7LA 1P4WA 4B44A 5ICGA 4AIDA 3KYLA 1IW7F 1KYZA 2DA1A 3CJRB 3H9QA 1O3TA 2H6CA 2AS5F 3QWLA 4DNCA 4XKVA 4IHTA 2IPQX 1SVLA 5DD8A 2DTZA 1WGXA 4Y13A 4MFEA 3OSFA 1Y1WJ 1IRFA 1VQMI 2V4JC 3ZMUA 4IHVA 1JUMA 3ZQFA 3L2QA 2LF7A 1K6YA 1U9OA 1O3SA 4WXCA 1MBJA 3FXJA 2Z16A 1FBUA 4HDUA 1OPCA 3MVPA 2F5VA 3HRUA 4ON0A 1BI3A 2EIJH 5EG0B 5TJJA 4M3FA 1R7JA 2JK3A 1V4RA 4G6TB 2LREA 1MKMA 2K9SA 2CUZA 3KP5A 4MEXF 2OV7A 4A69C 1Z67A 2LRDA 3G1MA 2V9VA 2E7XA 2IS4A 4QIWN 3OY9A 1T0FC 2ZSHB 5EYRA 3FXMA 5FGMA 3BTLA 3J7ZI 1XS9A 1EH7A 2UXNA 4Q48A 4EGZA 4JP0A 3K4BA 2P6SA 2PFBA 5IT9Z 3HEFA 4BXFA 4EJWA 2XIGA 4HF0A 4UVBA 2DI3A 2MGQA 3CP2A 4R8HA 3JRAA 1XG1A 3TP3A 4HEA2 2DCEA 6PAXA 3FISA 4AIKA 1SFEA 3WG9A 3A03A 2FBIA 4RAYA 2IW5A 2JA7J 3BR1A 4FETA 2RNGA 3BG5A 3HKZN 3JRCA 3FHZA 3HTUA 4N4OB 3CUQC 1MBEA 4PK4A 1LDKB 4S0HB 3WTYC 5EGOA 4RB0A 3BPVA 2ZKZA 4LOCA 1X1CA 2YX4A 4L9NA 4EM1A 4DZPA 4NBQA 4HYEA 1REPC 1JHHA 2HR3A 1FY7A 1HDPA 2HXOA 2P4WA 2QM3A 5J4VA 1JTXA 2H1KA 4A3KJ 5B1AH 1U8BA 4DYQA 1FPQA 2E1NA 5FFXA 2MLGA 1SD5A 1U6GA 3HOYJ 2P0WA 4HDVA 1ENHA 2MSYA 3ZMSA 2O03A 3H1CA 4JK1X 4Z2YA 3BROA 5E3MA 2ZJQF 1XSDA 2DPUA 4ITVA 3F6VA 2L9NA 1LDJA 5J6XA 2MLKA 2QSFX 3AG1H 3I58A 4HQMA 5E1WA 4LB6B 1FJLA 1CGPA 3S14J 1PJRA 3O2PE 3G3ZA 3FXLA 1QHHD 2EBIA 5F6FA 2ELHA 3DEWA 3OOPA 1W36C 4JYKA 2V1DA 4C2TA 1W7PD 2COMA 3QPLA 5B66C 1O4XA 3ZCOA 2FSWA 3KPHA 1SD4A 4I0AA 3IWFA 3H5RA 2QWWA 3O8GA 1XTAA 2ZFUA 4UUTA 2VIXA 2W84A 1ZR4A 3KZIC 4RMNA 1FSHA 2NVQJ 3H0DA 2H8WA 3TEDA 3Q9SA 1A5JA 2M9HA 1TNSA 2QGUA 3PNVA 2A5WA 3OYHA 4A3MJ 2ME6A 5FKOA 1YIOA 2YX7A 4XM3A 2BZTA 1DP7P 4Y3OA 4JX4A 5C4XJ 1HKTA 4D1QA 3LSPA 4BQNA 3ZPLA 3G6EI 4XLHA 3TMOA 3ABKH 1ON1A 1YLFA 3HOTA 2EJRA 4NC7A 3LSIA 3GTKJ 4D7MA 3DQVC 5ILSA 2PI0A 3J81K 3BR5A 2CQQA 3VEPA 4IO9F 1I1GA 2IEKA 4BKXA 3O6BB 1X3UA 2GA1A 3QYFA 5CVVA 2W82A 1U9NA 1FTTA 3ZMTA 1OCRH 3HSEA 1LKXA 2H6BA 4MQ9F 4V2GA 3DTKA 2CFOA 4KUMA 1KZHA 1ON2A 5FLXZ 1MMDA 1WH7A 1U3EM 3RIRA 1V3FA 3J7AO 1HBXG 3PQJA 2DAOA 4PJLA 2DK5A 5M5YJ 3D5SC 4L5IA 2KRCA 1LFUP 2X85A 1ETVA 2W57A 4J00A 1HOMA 4HNVA 3ERED 3ABUA 2VKHA 4MTEA 3G71I 3ZN1A 1WI9A 1JTYA 3DXJF 1ZG5A 3ML6A 5DV5A 1QVTA 2LKSA 2KP6A 4KT6A 3QOEA 1ORKA 1Z3XA 2HS5A 2XDVA 4A6DA 4XLPF 4CUGA 2RQPA 4C9YA 2E1MB 3BG9A 2R7QA 3A0BC 1TL8A 1DDNA 2MG4A 1R1UA 4C30A 5K5RA 2GOXB 1GLNA 5K7ZA 4RDUA 1Y8QB 2AXTC 3L7WA 1QZEA 4KA4A 3DP7A 1WJEA 2KJCA 2BY0A 2ZXWH 2JWTA 3WGGA 2FNPA 3FM5A 5E3LA 4A3CJ 4L9VA 1AU7A 2VUMJ 1K78A 1I3AA 2MD0A 2RAEA 2L5QA 1FMWA 2M0MA 2PN6A 4G8XA 2M4KA 3CDHA 2ETHA 4JX5A 2OTJI 2HXIA 3FM3A 1NTCA 2BW3B 3EPZA 1PUFB 2EFNA 2CQKA 2X6OA 2L7KA 1AKHA 1PP7U 3N97A 1UHSA 2CFXA 2I8DA 2UUZA 4RGRA 4ESJA 1TT5B 1XMKA 1QO0D 2RV8A 2FQ4A 5CVIA 3KZZA 4IRGA 4ZDLA 3ECHA 3ULQB 5KNLA 5TISC 5BPDA 5LHGA 4FX4A 3RKYA 1SC7A 4ENKA 2VQLA 1SD7A 2GLOA 4IF4A 1X58A 2NS8A 5IT3A 1OR7A 4C3JJ 3ZQ7A 5F1JA 3BT9A 4DGWB 3F8MA 3KE2A 1OYYA 2ZJPF 2R0QC 1JJ8C 1U2WA 2EFPA 2ZNZA 3H5NA 1XPXA 2XAFA 4KYWA 4RM2A 3NRVA 2XASA 5IPAA 1DUXC 1MJAA 5K7FA 1ZG1A 3HOWJ 4S04A 2R5YA 4ZJZA 1OCZH 3CCLI 1EH8A 3RCOA 1LB2A 4OIQF 4RLQA 3BZ6A 4BJ5C 4FCYA 1QVUA 3QOPA 1F4KA 1TT0A 2HQRA 4F7ZA 2DK8A 3I54A 4ZYAA 4KMUX 1JGGA 5L3FA 4XKWA 1OYWA 3A01B 3LQQA 3GVAA 1WSUA 1WZ2A 4CYCB 2WY8Q 2HOAA 4NDLA 5AONA 4CYDA 1I50J 1E3HA 4PFPA 5H2FC 5FKLA 5FLVA 3I5UA 5FD5A 2PX9A 1IAWA 3CC4I 3HRTA 2H27A 5AIQA 2FA5A 1ZARA 1VQ5I 5K7HA 3UR3C 3V7SA 3OS1A 1H9GA 4A3JJ 3JR9A 1H9TA 3H3VK 5K1YA 2HKOA 2K27A 4G12A 2DMTA 3IRQA 2VL8A 1YI2I 5LLQA 1MH4A 1Y8RB 1P9QC 4Y15A 3CCQI 3KLOA 1WRJA 3EUHC 4F92B 3MKZA 2L4AA 1IZ1A 5B5EC 2N8GA 3C2HA 4D5CA 1LUJB 3B6CA 1YX5A 2PBIA 2HTJA 4RBOA 4IPAA 1XB4A 4BE0A 3CJNA 1AOYA 4AC0A 4II2A 3F3XA 2M8GX 3VOEA 5BQTA 2BW3A 1PUFA 2DFEA 4OIOF 4D0PA 2JRTA 3HZJA 3KYCB 2IAIA 2HEOA 1VQ9I 4M71A 4BHCA 3JRHA 3GTMJ 1BA5A 2GBYA 2M30A 3KP4A 3OMYA 3SQNA
chains in the Genus database with same CATH topology
3V4GA 3T8TA 1TW3A 2ZJ2A 3WTVC 2XAJA 2CSOA 4KFCA 3EDPA 1QNTA 2YPRA 1G3TA 1HW2A 3E6MA 4U0YA 2XGXA 1R23A 2HYGD 1FYLA 1IRGA 3GXOA 3TQNA 2ISYA 1W4MA 3OV8A 1E2XA 2HYFA 3M8FA 3I59A 2BBYA 3K1MA 1ZREA 4LLLA 4LLGF 3MFKA 2M5WA 3WGIA 3ABTA 2H94A 1ZLJA 4OMYA 1W5TA 3KEQA 3KP7A 1YFHA 2V1UA 3GX4X 4QLCU 2W85A 1K6OA 4ZYEA 3T5XA 1BJAA 4CGZA 2A68F 3ZMZA 2KRFA 1B4AA 1P4AA 2L4MA 4U88A 2Q0OA 3DFGA 3E97A 1FNNA 3ROUA 2OU2A 2P7CB 2ZFWA 1FBQA 3FF5A 2P6TA 2M8EA 4O3MA 3IKTA 1XGNA 1T98A 4LJZF 4EGYA 1USTA 2M1BA 3HUGA 2K86A 3VB2A 1SAXA 3FMQA 1J9IA 1S8NA 1XSXA 3V8JA 2XKPA 3Q5FA 5DCMB 5EEGA 2HDCA 1KU2A 2L3DA 4M9SA 2X0LA 4G6QA 2VC0A 1BN5A 1G6NA 4WWCA 4P5OA 5JI6A 1IF1A 4G7HF 3DV8A 5D8LB 4XBFA 2PEXA 5L3GA 1W7PB 4LMYA 1SMTA 2PLYA 1Q1HA 3WE3A 5D5VB 3DF8A 5L3BA 1P92A 4KIGA 3FMRA 3FXUA 2IRFG 1G3WA 3ZN0A 3HYIA 4O6JA 5HLHA 1Y0UA 1WWXA 1KQ9A 2K02A 3DPTA 4OMZA 3C3WA 4KDPA 5ED4A 1XGSA 3LA3A 1BI0A 3LSTA 3LWFA 3B02A 3AAFA 4I09A 1ZGJA 2JSCA 1DPRA 4ETSA 2XRNA 4A12A 3JAMZ 3NQOA 4ENNA 1LDDA 2O3FA 3IRRA 5L3CA 1BI2A 1BOAA 4MEYF 2KKOA 2EWNA 2Y48A 3V7CA 3R0JA 2FBHA 3IKVA 5CJ9A 2Z33A 3V8LA 4M9XA 3J80K 1LEBA 2LSOA 2EFQA 1CF7B 3ELKA 1VTNC 2OZ6A 5DCMA 1BBYA 1XDSA 4CO8A 3HHHA 2P5LC 2E7WA 5D5UB 2DTRA 3L00A 4Y17A 5LRSA 3TDUC 1BM9A 2V6CA 2PQ8A 5D6FA 3RYRA 4LK1F 3QAHA 5H6QA 2XVCA 1T0FA 3ISPA 2VE9A 3RPUA 4FX0A 4PDKA 2STTA 4FT8A 1HXDA 1OYIA 4LGWA 3KCCA 4OINF 4HX4A 4LLNA 2BGCA 2PG4A 3KZYA 4EJVA 4L0ZB 4Q5SF 3CUQA 2QENA 1KU3A 1L3LA 2OA4A 5IT9K 2FE3A 5D4SA 2Z3YA 2RNJA 2IA2A 4JBAA 3LA2A 3P7NA 2ZXJA 3I71A 2Z5UA 5A2QK 3RDIA 4MNUA 2A6HF 1XGMA 1FYKA 3K1PA 4B8XA 4BAYA 3KLNA 2GQQA 2J5OA 1P2FA 4M9ZA 2QQBA 5E18F 4BXUA 3TDZC 2MA3A 3WE2A 1JXSA 1AWCA 3EQLF 4RB1A 2GXGA 5ERIA 4OOIA 3KP6A 4HV5A 5FB2A 2A07F 2BV6A 1KU9A 3P9KA 3RKWA 3SZPA 4I2OA 2OAZA 4EMSA 2M87A 2A61A 5L3DA 4MQVA 2NRAC 5HVQC 2CW0F 1FLIA 1PDNC 1P4XA 3WODF 1U8RA 1GXQA 3WTWC 4IHSA 2VBYA 1ZLKA 4N9IA 4L5JA 3GUDA 2DO7A 4N9HA 2G9WA 3M9AA 5LGNA 5F64A 5AIPA 1I5ZA 3L09A 3BY6A 4G94A 2XHKA 1XCBA 4M6XA 2VONA 4HF1A 3I53A 2NNNA 5BMZA 2MD5A 5LHHA 1YTYA 4B09A 2GAUA 3RI4A 2L02A 3TKYA 2KIUA 2DT5A 4HAMA 2E1CA 2PMUA 1KGSA 4P96A 2MBFA 1J5YA 1U5TC 4UNOA 1FX7A 1UHWA 1BC7C 1ZH5A 1FOKA 1I6XA 1T39A 1HW5A 5TRDA 3GWZA 4QWQA 2QVOA 4LG0B 5E8IA 3MQ0A 3JTGA 1C0WA 2K4BA 2OD5A 3BP8A 4I01A 2EB7A 4OIRF 2QQAA 1G4DA 3TOAA 2NS0A 3QP5A 2A6EF 4A2UA 1MGTA 1KU7A 4M73A 1J59A 2LDUA 2VE8A 2EFOA 2F5CA 3HRSA 2GIVA 5FO5A 1U78A 5CVUA 1F9NA 3H92A 2ZMEB 3D0SA 2ZO4A 1YQAA 2FRHA 3F72A 4HLXA 3LAPA 3N4MA 3C1DA 2EK5A 5LGUA 2D1HA 3CLOA 4R79A 3WTSC 4ZYDA 5F1RA 3GFLA 5D4RA 1XSVA 2A3SA 3EUHA 3Q9VA 1F1ZA 3T1BA 5D5XB 3DEUA 2VBXA 5BPIA 3GO5A 4WXDA 4RB3C 2ZBKA 1LVAA 4BH9A 4ZZDA 1L0OC 2H09A 5E8GA 1ONVA 2FEZA 4ENMA 3F22A 1Z7UA 1E17A 4R1HA 3E5UA 4KICA 3RKXA 1S29A 3GLXA 4L18B 1P6RA 5ILUA 3F8CA 5BOXA 3HIFA 1LQ1A 2DQRA 2HKXA 3REOA 2V79A 1FWZA 1ZRFA 1R5GA 2ZMEA 4EJTA 1R1TA 4RGXA 3E5QA 5HOOA 5DDGA 1R22A 1LNWA 3M7GA 3JTHA 3DPLC 3WU0A 2FF4A 1YW9A 2RDPA 3U1DA 4YFKF 1IN7A 2ZNYA 1H0MA 2F2EA 1YG2A 1QBJA 3T0YA 1YW8A 2WV0A 3IWZA 2CYYA 3GW2A 2RC4A 1OMIA 5KVRA 4KN4X 4PGHA 2HWVA 2XAGA 5D6EA 1I1SA 1MZBA 4RGSA 3TO7A 1J2XA 2QYOA 3U2RA 2KJBA 5LEKA 4LD5A 5HS7A 2K4JA 1S6LA 1FP2A 1ZGAA 2VODA 1O3QA 4A0YA 4KIFA 3GFJA 2HQNA 2PJPA 4EVIA 4MTDA 4E70A 1TBXA 2MH9A 1KQ8A 4KNYA 1SMYF 4M6YA 3BPXA 2XROA 1TQMA 4RAZA 2DQLA 1FSEA 2O61A 3W6KB 3GZ6A 3ZMVA 2ESHA 2W25A 4CZZA 2STWA 4HW0A 4YG2F 1R36A 4HX8A 3GYHX 1EV7A 5JFRA 4WXHA 1NHAA 3B73A 3IHUA 2QZ8A 4EJOA 5D5WB 2A5YB 3T8RA 4G7ZF 5E20A 2VN2A 3WU1B 4TV7A 3FXQA 2FMLA 2Q8KA 3LFKA 1BIBA 4O5VA 3MWMA 4L0YB 4H0EA 3QPHA 1ZRDA 4EM0B 1HSTA 3FX3A 2FNAA 2QLZA 2MC3A 4YIIA 5LBQA 4WCGA 2HTSA 3JW4A 3HTSB 4AIHA 2D2WA 1TLHB 4P55A 2ISZA 1QZYA 2RVCA 4DQ2A 4BHPA 1O7FA 4EQQA 1KYWA 3MAJA 1XN7A 1HQCA 4HV6A 4Q4ZF 1GVJA 2XAHA 3JSPA 1FC3A 3EETA 4Q47A 3R6SA 4IRIA 2W24A 4IRHA 2VBWA 2XKOA 2A69F 1B59A 4HOBA 3WTXC 4P9FA 1PP8F 3BDDA 4NHJA 1XCVA 2NAZA 1YS7A 2FOKA 1EH6A 1XD7A 2UWMA 2IA1A 5LEJA 4WF2A 2DFIA 2LF8A 5DUIA 1FT9A 2DU9A 5HLGA 1ULYA 3RYPA 3R0AA 4AVPA 2P5VA 2J5PA 2B0LA 3GZ5A 1SFXA 4PCQA 4LK0F 3WTTC 4HLYA 1W7PA 3MZHA 3FZVA 2D45A 5L3EA 3KEOA 1IN5A 2GWRA 4ASNA 2AXLA 4XLNF 2DLLA 3WTZA 1I27A 3EYYA 4HZFA 3R61A 3DKWA 2WTEA 3KP2A 3F23A 2FBKA 4CDGA 1U5TB 1STZA 1FP1D 3TO9A 1BI1A 4PZJA 4YFNF 4ENJA 2O0YA 4CXFA 4OIPF 4KT5C 3HOSA 2R3SA 4KMFA 2TDXA 2JT1A 4RB2C 1T6SA 2ADUA 1DPUA 4ESBA 3TGNA 4UUVA 3E6BA 4MGRA 3NEUA 2BEOA 2YU3A 1CF7A 5E1XA 2F5EA 3BJ6A 2QBYB 2FMYA 1R00A 2GA2A 2RN7A 1F5TA 3ZMDA 3P9CA 2G7UA 1HKQA 3E5XA 2Q2EA 4GYIA 1SD6A 1QPMA 4L9TA 4ZYGA 2GXBA 4EV0A 3I0TA 2HOEA 4I02A 1K7AA 4FHTA 2CWEA 5CYVA 4BNCA 4XSZF 5K5QA 3HRMA 5CVJA 4ZYHA 2IT0A 5A2QZ 3BJOA 3E6CC 3MCZA 3S2WA 3F21A 4WK8F 1O3RA 1LEAA 4UV8A 1HKSA 2Y75A 1TQPA 1U5TA 4GGGA 3RTRA 3I64A 4I0BA 1ZAOA 4HF2A 2JPCA 2JTVA 3CO6C 2EFWA 4K2EA 3RPQA 1B6AA 1HW1A 5HDGA 1R5HA 2LNBA 5ICCA 2EA4A 4GYGA 1K78B 1YW7A 5FLXK 3KFWX 2X4HA 2LKPA 1O7LA 3H3UA 4G9YA 3QP6A 2G7HA 1S7OA 2XAQA 2QBYA 3IC7A 1JHFA 4YIFA 3W6JB 3GFMA 4XSXF 1PUEE 1G3SA 2VBZA 1GXPA 1R58A 5D8KB 4WX9A 2P5KA 1ZYRF 1IN8A 2C6YA 2BYVE 3K9TA 2DPDA 2NNYA 3O3KA 2P7VB 1XMAA 2MH2A 2DBBA 2R7FA 5ILVA 2WWYA 1UHMA 3VFZA 5DYMA 2WC2A 2ZCWA 3E3VA 4I7HA 2CO5A 1B9MA 5JHUA 1J75A 3TOBA 1RI7A 2VXZA 1RNLA 3BWGA 1RUOA 4CHUA 3BOQA 3COAC 4U0VA 3J81Z 1IN6A 1ODDA 3CUOA 3LA7A 4JQFA 1WQ2A 1BIAA 3P9IA 5BS6A 1FBSA 4IXAA 2OQRA 4LB5A 4IVNA 4P9UA 1J7KA 2EA2A 2YR2A 2IA0A 1D5VA 5JR3A 5HS9A 4KIBA 3HSRA 3EYIA 3ZP5A 1QGPA 2ACJA 3WTUC 3F8NA 2VOOA 1K79A 1FYMA 4ESFA 3M8EA 1R1VA 5ICFA 2BE5F 5DUKA 4BYYA 3L2CA 3QU6A 3FXRA 1XGOA 1MDMB 4HQEA 2O8XA 4UV9A 2CGPA 1B1BA 1UFMA 2R7DA 2QQ9A 1ZG3A 2Z9OA 1B9NA 4LG0A 5HDNA 4XRFA 1MD0A 3QRFF 1D8JA 3RJPA 3HHGA 1ZN2A 3I59B 4UVAA 3LQRA 2HZTA 1Z91A 1ZHFA 3QPTA 2VC1A 5E1ZB 4NB5A 4HBLA 4EJUA 2PMHA 1ZRCA 3K0LA 2QUFA 3QU3A 2VOPA 1XDUA 3V7RA 1TTYA 1RUNA 2Z99A 2OZUA 2KIMA 3CO7C 1D8KA 4AIJA 4M74A 2OBPA 2ESNA 2EV0A 1TNTA 4ZH4F 3BJAA 1WKMA 1G3YA 3MEXA 5HLIA 4GO1A 5HDKA 2Y0MA 3VODA 3PFIA 2GZWA 2RGVA 4BHBA 5CVRA 2L01A 5LGTA 2FQ3A 1J0RA 1YS6A 4HA8A 1MJBA 5DD4A 4AWXB 3L9FA 1O57A 2VT3A 4RS8A 4ZZLA 1MDMA 1RZ4A 4G6DA 4I98B 4L9JA 3H3ZA 1MJ9A 5CLSA 1BC8C 3SXYA 1UB9A 5E17F 3M1EA 2OQGA 3FMSA 3V8KA 3F8BA 1UCRA 2L54A 3SZTA 4U0WA 4CICA 5DEQA 2RKHA 1KA8A 1Z05A 3FWEA 4EM2A 4A6EA 1TW2A 3WGHA 5FD6A 5LRRA 3G73A 3GFIA 1S3JA 2EV5A 1Z9CA 1Z6TA 2FXAA 2UXXA 5LHIA 2UZKA 3GF2A 3KETA 2XUBA 2DW4A 2P8TA 2CG4A 3GEZA 2XV4S 4A0ZA 2VT2A 3K1NA 1QZZA 2V1XA 5FFZA 5JVTA 2F5DA 4A5MA 4HX7A 3K69A 4RGUA 3KP3A 1TQIA 4IJAA 4N0BA 1HSJA 2EV6A 1W5SA 4UVCA 1A04A 1YYVA 2D1VA 3ECOA 3JAMK 1IXSB 5KK1A 3JSOA 3C7JA 1OKRA 2KIFA 1KQ0A 1IXCA 1IUYA 2K7LA 1QQIA 4AD9A 5J8FA 4S05A 2NYXA 4A5NA 2JPBA 3F8FA 3I4PA 3MZYA 3R4KA 1Z1DA 1S7AA 4G7OF 1RIOH 4M72A 1JE8A 2O6GE 5DCFA 1GHCA 5H6RA 3E6DA 3C18A 2HFHA 4U7DA 3SFZA 5EEHA 4MHGA 1JGSA 3TO6A 1IXRC 2FU4A 3CUQB 2F5FA 5ICEA 5H20A 4U7BA 3CTAA 1T2KA 5J8CA 2HGCA 1USSA 4UXNA 1LJ9A 4A0XA 1Z6RA 2IVMA 4LFUA 3IL2A 4UHTA 3LAJA 3U9GA 4GCVA 3PQKA 3K2ZA 1T38A 4GXOA 5HS8A 3R60A 2M45A 1FZPB 4KN7X 2IP2A 3HSFA 4YFXF 2YSRA 3D5LA 2JZYA 4OU0A 4PGGA 1SFUA 4BQAA 4NQWA 5K5OA 1D3YA 3J80Z 1IN4A 3F6OA 2IJLA 1YO5C 1P4WA 5ICGA 1IW7F 1KYZA 1O3TA 2H6CA 2AS5F 4DNCA 4IHTA 2IPQX 5DD8A 4Y13A 1IRFA 3ZMUA 2LF7A 1O3SA 4WXCA 1FBUA 4HDUA 1OPCA 3HRUA 4ON0A 1BI3A 5TJJA 1R7JA 1V4RA 1MKMA 3KP5A 4MEXF 2V9VA 2E7XA 5FGMA 1EH7A 2UXNA 4Q48A 4EGZA 2P6SA 2PFBA 5IT9Z 4EJWA 2XIGA 4HF0A 4UVBA 2DI3A 4R8HA 6PAXA 4AIKA 1SFEA 3WG9A 2FBIA 4RAYA 2IW5A 3FHZA 3HTUA 3CUQC 1LDKB 3WTYC 4RB0A 3BPVA 2ZKZA 2YX4A 4L9NA 4EM1A 1REPC 4HYEA 1JHHA 2HR3A 1FY7A 2P4WA 2QM3A 1FPQA 2E1NA 5FFXA 2MLGA 1SD5A 1U6GA 4HDVA 3ZMSA 1XSDA 2O03A 4JK1X 4Z2YA 2DPUA 3BROA 3F6VA 1LDJA 5J6XA 2MLKA 3I58A 4HQMA 5E1WA 4LB6B 1CGPA 3O2PE 3G3ZA 5F6FA 2ELHA 3OOPA 2V1DA 1W7PD 2COMA 2FSWA 1SD4A 4I0AA 3IWFA 2QWWA 2W84A 1FSHA 3Q9SA 1TNSA 1YIOA 2YX7A 1DP7P 1HKTA 3ZPLA 1ON1A 1YLFA 3HOTA 2EJRA 3DQVC 5ILSA 2PI0A 3J81K 3VEPA 1I1GA 3O6BB 1X3UA 2GA1A 5CVVA 3ZMTA 3HSEA 4MQ9F 2H6BA 4KUMA 5FLXZ 1ON2A 1U3EM 3RIRA 1V3FA 3J7AO 1HBXG 3PQJA 2DAOA 2DK5A 4L5IA 2W57A 3ERED 3ABUA 4MTEA 3ZN1A 1WI9A 3DXJF 1ZG5A 3ML6A 5DV5A 2HS5A 4A6DA 4XLPF 2RQPA 1DDNA 1R1UA 5K5RA 3L7WA 4KA4A 3DP7A 2KJCA 3WGGA 2FNPA 3FM5A 4L9VA 1K78A 2PN6A 4G8XA 3CDHA 2ETHA 3FM3A 2EFNA 2CQKA 1PP7U 3N97A 2CFXA 4RGRA 4ESJA 1XMKA 1QO0D 2RV8A 5CVIA 3KZZA 4IRGA 3ECHA 3ULQB 5BPDA 5LHGA 4FX4A 3RKYA 4ENKA 1SD7A 4IF4A 5IT3A 1OR7A 3ZQ7A 3F8MA 3KE2A 1OYYA 1U2WA 2EFPA 2ZNZA 2XAFA 4KYWA 3NRVA 2XASA 1DUXC 1MJAA 1ZG1A 4S04A 1EH8A 1LB2A 4OIQF 3BZ6A 3QOPA 1F4KA 4F7ZA 2HQRA 2DK8A 3I54A 4KMUX 5L3FA 1OYWA 3LQQA 3GVAA 1WSUA 5AONA 4CYDA 3I5UA 5FD5A 1IAWA 3HRTA 2H27A 5AIQA 2FA5A 1ZARA 3V7SA 1H9GA 1H9TA 5K1YA 2HKOA 2K27A 3IRQA 5LLQA 4Y15A 3KLOA 1WRJA 2L4AA 1IZ1A 2PBIA 2HTJA 4IPAA 1XB4A 3CJNA 1AOYA 3F3XA 3VOEA 5BQTA 2M30A 4OIOF 4D0PA 2JRTA 2HEOA 4M71A 4BHCA 3SHFA 3KP4A 3SQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V4G A;  3T8T A;  1TW3 A;  2ZJ2 A;  3WTV C;  2XAJ A;  2CSO A;  4KFC A;  3EDP A;  1QNT A;  2YPR A;  1G3T A;  1HW2 A;  3E6M A;  4U0Y A;  2XGX A;  1R23 A;  2HYG D;  1FYL A;  1IRG A;  3GXO A;  3TQN A;  2ISY A;  1W4M A;  3OV8 A;  1E2X A;  2HYF A;  3M8F A;  3I59 A;  2BBY A;  3K1M A;  1ZRE A;  4LLL A;  4LLG F;  3MFK A;  2M5W A;  3WGI A;  3ABT A;  2H94 A;  1ZLJ A;  4OMY A;  1W5T A;  3KEQ A;  3KP7 A;  1YFH A;  2V1U A;  3GX4 X;  4QLC U;  2W85 A;  1K6O A;  4ZYE A;  3T5X A;  1BJA A;  4CGZ A;  2A68 F;  3ZMZ A;  2KRF A;  1B4A A;  1P4A A;  2L4M A;  4U88 A;  2Q0O A;  3DFG A;  3E97 A;  1FNN A;  3ROU A;  2OU2 A;  2P7C B;  2ZFW A;  1FBQ A;  3FF5 A;  2P6T A;  2M8E A;  4O3M A;  3IKT A;  1XGN A;  1T98 A;  4LJZ F;  4EGY A;  1UST A;  2M1B A;  3HUG A;  2K86 A;  3VB2 A;  1SAX A;  3FMQ A;  1J9I A;  1S8N A;  1XSX A;  3V8J A;  2XKP A;  3Q5F A;  5DCM B;  5EEG A;  2HDC A;  1KU2 A;  2L3D A;  4M9S A;  2X0L A;  4G6Q A;  2VC0 A;  1BN5 A;  1G6N A;  4WWC A;  4P5O A;  5JI6 A;  1IF1 A;  4G7H F;  3DV8 A;  5D8L B;  4XBF A;  2PEX A;  5L3G A;  1W7P B;  4LMY A;  1SMT A;  2PLY A;  1Q1H A;  3WE3 A;  5D5V B;  3DF8 A;  5L3B A;  1P92 A;  4KIG A;  3FMR A;  3FXU A;  2IRF G;  1G3W A;  3ZN0 A;  3HYI A;  4O6J A;  5HLH A;  1Y0U A;  1WWX A;  1KQ9 A;  2K02 A;  3DPT A;  4OMZ A;  3C3W A;  4KDP A;  5ED4 A;  1XGS A;  3LA3 A;  1BI0 A;  3LST A;  3LWF A;  3B02 A;  3AAF A;  4I09 A;  1ZGJ A;  2JSC A;  1DPR A;  4ETS A;  2XRN A;  4A12 A;  3JAM Z;  3NQO A;  4ENN A;  1LDD A;  2O3F A;  3IRR A;  5L3C A;  1BI2 A;  1BOA A;  4MEY F;  2KKO A;  2EWN A;  2Y48 A;  3V7C A;  3R0J A;  2FBH A;  3IKV A;  5CJ9 A;  2Z33 A;  3V8L A;  4M9X A;  3J80 K;  1LEB A;  2LSO A;  2EFQ A;  1CF7 B;  3ELK A;  1VTN C;  2OZ6 A;  5DCM A;  1BBY A;  1XDS A;  4CO8 A;  3HHH A;  2P5L C;  2E7W A;  5D5U B;  2DTR A;  3L00 A;  4Y17 A;  5LRS A;  3TDU C;  1BM9 A;  2V6C A;  2PQ8 A;  5D6F A;  3RYR A;  4LK1 F;  3QAH A;  5H6Q A;  2XVC A;  1T0F A;  3ISP A;  2VE9 A;  3RPU A;  4FX0 A;  4PDK A;  2STT A;  4FT8 A;  1HXD A;  1OYI A;  4LGW A;  3KCC A;  4OIN F;  4HX4 A;  4LLN A;  2BGC A;  2PG4 A;  3KZY A;  4EJV A;  4L0Z B;  4Q5S F;  3CUQ A;  2QEN A;  1KU3 A;  1L3L A;  2OA4 A;  5IT9 K;  2FE3 A;  5D4S A;  2Z3Y A;  2RNJ A;  2IA2 A;  4JBA A;  3LA2 A;  3P7N A;  2ZXJ A;  3I71 A;  2Z5U A;  5A2Q K;  3RDI A;  4MNU A;  2A6H F;  1XGM A;  1FYK A;  3K1P A;  4B8X A;  4BAY A;  3KLN A;  2GQQ A;  2J5O A;  1P2F A;  4M9Z A;  2QQB A;  5E18 F;  4BXU A;  3TDZ C;  2MA3 A;  3WE2 A;  1JXS A;  1AWC A;  3EQL F;  4RB1 A;  2GXG A;  5ERI A;  4OOI A;  3KP6 A;  4HV5 A;  5FB2 A;  2A07 F;  2BV6 A;  1KU9 A;  3P9K A;  3RKW A;  3SZP A;  4I2O A;  2OAZ A;  4EMS A;  2M87 A;  2A61 A;  5L3D A;  4MQV A;  2NRA C;  5HVQ C;  2CW0 F;  1FLI A;  1PDN C;  1P4X A;  3WOD F;  1U8R A;  1GXQ A;  3WTW C;  4IHS A;  2VBY A;  1ZLK A;  4N9I A;  4L5J A;  3GUD A;  2DO7 A;  4N9H A;  2G9W A;  3M9A A;  5LGN A;  5F64 A;  5AIP A;  1I5Z A;  3L09 A;  3BY6 A;  4G94 A;  2XHK A;  1XCB A;  4M6X A;  2VON A;  4HF1 A;  3I53 A;  2NNN A;  5BMZ A;  2MD5 A;  5LHH A;  1YTY A;  4B09 A;  2GAU A;  3RI4 A;  2L02 A;  3TKY A;  2KIU A;  2DT5 A;  4HAM A;  2E1C A;  2PMU A;  1KGS A;  4P96 A;  2MBF A;  1J5Y A;  1U5T C;  4UNO A;  1FX7 A;  1UHW A;  1BC7 C;  1ZH5 A;  1FOK A;  1I6X A;  1T39 A;  1HW5 A;  5TRD A;  3GWZ A;  4QWQ A;  2QVO A;  4LG0 B;  5E8I A;  3MQ0 A;  3JTG A;  1C0W A;  2K4B A;  2OD5 A;  3BP8 A;  4I01 A;  2EB7 A;  4OIR F;  2QQA A;  1G4D A;  3TOA A;  2NS0 A;  3QP5 A;  2A6E F;  4A2U A;  1MGT A;  1KU7 A;  4M73 A;  1J59 A;  2LDU A;  2VE8 A;  2EFO A;  2F5C A;  3HRS A;  2GIV A;  5FO5 A;  1U78 A;  5CVU A;  1F9N A;  3H92 A;  2ZME B;  3D0S A;  2ZO4 A;  1YQA A;  2FRH A;  3F72 A;  4HLX A;  3LAP A;  3N4M A;  3C1D A;  2EK5 A;  5LGU A;  2D1H A;  3CLO A;  4R79 A;  3WTS C;  4ZYD A;  5F1R A;  3GFL A;  5D4R A;  1XSV A;  2A3S A;  3EUH A;  3Q9V A;  1F1Z A;  3T1B A;  5D5X B;  3DEU A;  2VBX A;  5BPI A;  3GO5 A;  4WXD A;  4RB3 C;  2ZBK A;  1LVA A;  4BH9 A;  4ZZD A;  1L0O C;  2H09 A;  5E8G A;  1ONV A;  2FEZ A;  4ENM A;  3F22 A;  1Z7U A;  1E17 A;  4R1H A;  3E5U A;  4KIC A;  3RKX A;  1S29 A;  3GLX A;  4L18 B;  1P6R A;  5ILU A;  3F8C A;  5BOX A;  3HIF A;  1LQ1 A;  2DQR A;  2HKX A;  3REO A;  2V79 A;  1FWZ A;  1ZRF A;  1R5G A;  2ZME A;  4EJT A;  1R1T A;  4RGX A;  3E5Q A;  5HOO A;  5DDG A;  1R22 A;  1LNW A;  3M7G A;  3JTH A;  3DPL C;  3WU0 A;  2FF4 A;  1YW9 A;  2RDP A;  3U1D A;  4YFK F;  1IN7 A;  2ZNY A;  1H0M A;  2F2E A;  1YG2 A;  1QBJ A;  3T0Y A;  1YW8 A;  2WV0 A;  3IWZ A;  2CYY A;  3GW2 A;  2RC4 A;  1OMI A;  5KVR A;  4KN4 X;  4PGH A;  2HWV A;  2XAG A;  5D6E A;  1I1S A;  1MZB A;  4RGS A;  3TO7 A;  1J2X A;  2QYO A;  3U2R A;  2KJB A;  5LEK A;  4LD5 A;  5HS7 A;  2K4J A;  1S6L A;  1FP2 A;  1ZGA A;  2VOD A;  1O3Q A;  4A0Y A;  4KIF A;  3GFJ A;  2HQN A;  2PJP A;  4EVI A;  4MTD A;  4E70 A;  1TBX A;  2MH9 A;  1KQ8 A;  4KNY A;  1SMY F;  4M6Y A;  3BPX A;  2XRO A;  1TQM A;  4RAZ A;  2DQL A;  1FSE A;  2O61 A;  3W6K B;  3GZ6 A;  3ZMV A;  2ESH A;  2W25 A;  4CZZ A;  2STW A;  4HW0 A;  4YG2 F;  1R36 A;  4HX8 A;  3GYH X;  1EV7 A;  5JFR A;  4WXH A;  1NHA A;  3B73 A;  3IHU A;  2QZ8 A;  4EJO A;  5D5W B;  2A5Y B;  3T8R A;  4G7Z F;  5E20 A;  2VN2 A;  3WU1 B;  4TV7 A;  3FXQ A;  2FML A;  2Q8K A;  3LFK A;  1BIB A;  4O5V A;  3MWM A;  4L0Y B;  4H0E A;  3QPH A;  1ZRD A;  4EM0 B;  1HST A;  3FX3 A;  2FNA A;  2QLZ A;  2MC3 A;  4YII A;  5LBQ A;  4WCG A;  2HTS A;  3JW4 A;  3HTS B;  4AIH A;  2D2W A;  1TLH B;  4P55 A;  2ISZ A;  1QZY A;  2RVC A;  4DQ2 A;  4BHP A;  1O7F A;  4EQQ A;  1KYW A;  3MAJ A;  1XN7 A;  1HQC A;  4HV6 A;  4Q4Z F;  1GVJ A;  2XAH A;  3JSP A;  1FC3 A;  3EET A;  4Q47 A;  3R6S A;  4IRI A;  2W24 A;  4IRH A;  2VBW A;  2XKO A;  2A69 F;  1B59 A;  4HOB A;  3WTX C;  4P9F A;  1PP8 F;  3BDD A;  4NHJ A;  1XCV A;  2NAZ A;  1YS7 A;  2FOK A;  1EH6 A;  1XD7 A;  2UWM A;  2IA1 A;  5LEJ A;  4WF2 A;  2DFI A;  2LF8 A;  5DUI A;  1FT9 A;  2DU9 A;  5HLG A;  1ULY A;  3RYP A;  3R0A A;  4AVP A;  2P5V A;  2J5P A;  2B0L A;  3GZ5 A;  1SFX A;  4PCQ A;  4LK0 F;  3WTT C;  4HLY A;  1W7P A;  3MZH A;  3FZV A;  2D45 A;  5L3E A;  3KEO A;  1IN5 A;  2GWR A;  4ASN A;  2AXL A;  4XLN F;  2DLL A;  3WTZ A;  1I27 A;  3EYY A;  4HZF A;  3R61 A;  3DKW A;  2WTE A;  3KP2 A;  3F23 A;  2FBK A;  4CDG A;  1U5T B;  1STZ A;  1FP1 D;  3TO9 A;  1BI1 A;  4PZJ A;  4YFN F;  4ENJ A;  2O0Y A;  4CXF A;  4OIP F;  4KT5 C;  3HOS A;  2R3S A;  4KMF A;  2TDX A;  2JT1 A;  4RB2 C;  1T6S A;  2ADU A;  1DPU A;  4ESB A;  3TGN A;  4UUV A;  3E6B A;  4MGR A;  3NEU A;  2BEO A;  2YU3 A;  1CF7 A;  5E1X A;  2F5E A;  3BJ6 A;  2QBY B;  2FMY A;  1R00 A;  2GA2 A;  2RN7 A;  1F5T A;  3ZMD A;  3P9C A;  2G7U A;  1HKQ A;  3E5X A;  2Q2E A;  4GYI A;  1SD6 A;  1QPM A;  4L9T A;  4ZYG A;  2GXB A;  4EV0 A;  3I0T A;  2HOE A;  4I02 A;  1K7A A;  4FHT A;  2CWE A;  5CYV A;  4BNC A;  4XSZ F;  5K5Q A;  3HRM A;  5CVJ A;  4ZYH A;  2IT0 A;  5A2Q Z;  3BJO A;  3E6C C;  3MCZ A;  3S2W A;  3F21 A;  4WK8 F;  1O3R A;  1LEA A;  4UV8 A;  1HKS A;  2Y75 A;  1TQP A;  1U5T A;  4GGG A;  3RTR A;  3I64 A;  4I0B A;  1ZAO A;  4HF2 A;  2JPC A;  2JTV A;  3CO6 C;  2EFW A;  4K2E A;  3RPQ A;  1B6A A;  1HW1 A;  5HDG A;  1R5H A;  2LNB A;  5ICC A;  2EA4 A;  4GYG A;  1K78 B;  1YW7 A;  5FLX K;  3KFW X;  2X4H A;  2LKP A;  1O7L A;  3H3U A;  4G9Y A;  3QP6 A;  2G7H A;  1S7O A;  2XAQ A;  2QBY A;  3IC7 A;  1JHF A;  4YIF A;  3W6J B;  3GFM A;  4XSX F;  1PUE E;  1G3S A;  2VBZ A;  1GXP A;  1R58 A;  5D8K B;  4WX9 A;  2P5K A;  1ZYR F;  1IN8 A;  2C6Y A;  2BYV E;  3K9T A;  2DPD A;  2NNY A;  3O3K A;  2P7V B;  1XMA A;  2MH2 A;  2DBB A;  2R7F A;  5ILV A;  2WWY A;  1UHM A;  3VFZ A;  5DYM A;  2WC2 A;  2ZCW A;  3E3V A;  4I7H A;  2CO5 A;  1B9M A;  5JHU A;  1J75 A;  3TOB A;  1RI7 A;  2VXZ A;  1RNL A;  3BWG A;  1RUO A;  4CHU A;  3BOQ A;  3COA C;  4U0V A;  3J81 Z;  1IN6 A;  1ODD A;  3CUO A;  3LA7 A;  4JQF A;  1WQ2 A;  1BIA A;  3P9I A;  5BS6 A;  1FBS A;  4IXA A;  2OQR A;  4LB5 A;  4IVN A;  4P9U A;  1J7K A;  2EA2 A;  2YR2 A;  2IA0 A;  1D5V A;  5JR3 A;  5HS9 A;  4KIB A;  3HSR A;  3EYI A;  3ZP5 A;  1QGP A;  2ACJ A;  3WTU C;  3F8N A;  2VOO A;  1K79 A;  1FYM A;  4ESF A;  3M8E A;  1R1V A;  5ICF A;  2BE5 F;  5DUK A;  4BYY A;  3L2C A;  3QU6 A;  3FXR A;  1XGO A;  1MDM B;  4HQE A;  2O8X A;  4UV9 A;  2CGP A;  1B1B A;  1UFM A;  2R7D A;  2QQ9 A;  1ZG3 A;  2Z9O A;  1B9N A;  4LG0 A;  5HDN A;  4XRF A;  1MD0 A;  3QRF F;  1D8J A;  3RJP A;  3HHG A;  1ZN2 A;  3I59 B;  4UVA A;  3LQR A;  2HZT A;  1Z91 A;  1ZHF A;  3QPT A;  2VC1 A;  5E1Z B;  4NB5 A;  4HBL A;  4EJU A;  2PMH A;  1ZRC A;  3K0L A;  2QUF A;  3QU3 A;  2VOP A;  1XDU A;  3V7R A;  1TTY A;  1RUN A;  2Z99 A;  2OZU A;  2KIM A;  3CO7 C;  1D8K A;  4AIJ A;  4M74 A;  2OBP A;  2ESN A;  2EV0 A;  1TNT A;  4ZH4 F;  3BJA A;  1WKM A;  1G3Y A;  3MEX A;  5HLI A;  4GO1 A;  5HDK A;  2Y0M A;  3VOD A;  3PFI A;  2GZW A;  2RGV A;  4BHB A;  5CVR A;  2L01 A;  5LGT A;  2FQ3 A;  1J0R A;  1YS6 A;  4HA8 A;  1MJB A;  5DD4 A;  4AWX B;  3L9F A;  1O57 A;  2VT3 A;  4RS8 A;  4ZZL A;  1MDM A;  1RZ4 A;  4G6D A;  4I98 B;  4L9J A;  3H3Z A;  1MJ9 A;  5CLS A;  1BC8 C;  3SXY A;  1UB9 A;  5E17 F;  3M1E A;  2OQG A;  3FMS A;  3V8K A;  3F8B A;  1UCR A;  2L54 A;  3SZT A;  4U0W A;  4CIC A;  5DEQ A;  2RKH A;  1KA8 A;  1Z05 A;  3FWE A;  4EM2 A;  4A6E A;  1TW2 A;  3WGH A;  5FD6 A;  5LRR A;  3G73 A;  3GFI A;  1S3J A;  2EV5 A;  1Z9C A;  1Z6T A;  2FXA A;  2UXX A;  5LHI A;  2UZK A;  3GF2 A;  3KET A;  2XUB A;  2DW4 A;  2P8T A;  2CG4 A;  3GEZ A;  2XV4 S;  4A0Z A;  2VT2 A;  3K1N A;  1QZZ A;  2V1X A;  5FFZ A;  5JVT A;  2F5D A;  4A5M A;  4HX7 A;  3K69 A;  4RGU A;  3KP3 A;  1TQI A;  4IJA A;  4N0B A;  1HSJ A;  2EV6 A;  1W5S A;  4UVC A;  1A04 A;  1YYV A;  2D1V A;  3ECO A;  3JAM K;  1IXS B;  5KK1 A;  3JSO A;  3C7J A;  1OKR A;  2KIF A;  1KQ0 A;  1IXC A;  1IUY A;  2K7L A;  1QQI A;  4AD9 A;  5J8F A;  4S05 A;  2NYX A;  4A5N A;  2JPB A;  3F8F A;  3I4P A;  3MZY A;  3R4K A;  1Z1D A;  1S7A A;  4G7O F;  1RIO H;  4M72 A;  1JE8 A;  2O6G E;  5DCF A;  1GHC A;  5H6R A;  3E6D A;  3C18 A;  2HFH A;  4U7D A;  3SFZ A;  5EEH A;  4MHG A;  1JGS A;  3TO6 A;  1IXR C;  2FU4 A;  3CUQ B;  2F5F A;  5ICE A;  5H20 A;  4U7B A;  3CTA A;  1T2K A;  5J8C A;  2HGC A;  1USS A;  4UXN A;  1LJ9 A;  4A0X A;  1Z6R A;  2IVM A;  4LFU A;  3IL2 A;  4UHT A;  3LAJ A;  3U9G A;  4GCV A;  3PQK A;  3K2Z A;  1T38 A;  4GXO A;  5HS8 A;  3R60 A;  2M45 A;  1FZP B;  4KN7 X;  2IP2 A;  3HSF A;  4YFX F;  2YSR A;  3D5L A;  2JZY A;  4OU0 A;  4PGG A;  1SFU A;  4BQA A;  4NQW A;  5K5O A;  1D3Y A;  3J80 Z;  1IN4 A;  3F6O A;  2IJL A;  1YO5 C;  1P4W A;  5ICG A;  1IW7 F;  1KYZ A;  1O3T A;  2H6C A;  2AS5 F;  4DNC A;  4IHT A;  2IPQ X;  5DD8 A;  4Y13 A;  1IRF A;  3ZMU A;  2LF7 A;  1O3S A;  4WXC A;  1FBU A;  4HDU A;  1OPC A;  3HRU A;  4ON0 A;  1BI3 A;  5TJJ A;  1R7J A;  1V4R A;  1MKM A;  3KP5 A;  4MEX F;  2V9V A;  2E7X A;  5FGM A;  1EH7 A;  2UXN A;  4Q48 A;  4EGZ A;  2P6S A;  2PFB A;  5IT9 Z;  4EJW A;  2XIG A;  4HF0 A;  4UVB A;  2DI3 A;  4R8H A;  6PAX A;  4AIK A;  1SFE A;  3WG9 A;  2FBI A;  4RAY A;  2IW5 A;  3FHZ A;  3HTU A;  3CUQ C;  1LDK B;  3WTY C;  4RB0 A;  3BPV A;  2ZKZ A;  2YX4 A;  4L9N A;  4EM1 A;  1REP C;  4HYE A;  1JHH A;  2HR3 A;  1FY7 A;  2P4W A;  2QM3 A;  1FPQ A;  2E1N A;  5FFX A;  2MLG A;  1SD5 A;  1U6G A;  4HDV A;  3ZMS A;  1XSD A;  2O03 A;  4JK1 X;  4Z2Y A;  2DPU A;  3BRO A;  3F6V A;  1LDJ A;  5J6X A;  2MLK A;  3I58 A;  4HQM A;  5E1W A;  4LB6 B;  1CGP A;  3O2P E;  3G3Z A;  5F6F A;  2ELH A;  3OOP A;  2V1D A;  1W7P D;  2COM A;  2FSW A;  1SD4 A;  4I0A A;  3IWF A;  2QWW A;  2W84 A;  1FSH A;  3Q9S A;  1TNS A;  1YIO A;  2YX7 A;  1DP7 P;  1HKT A;  3ZPL A;  1ON1 A;  1YLF A;  3HOT A;  2EJR A;  3DQV C;  5ILS A;  2PI0 A;  3J81 K;  3VEP A;  1I1G A;  3O6B B;  1X3U A;  2GA1 A;  5CVV A;  3ZMT A;  3HSE A;  4MQ9 F;  2H6B A;  4KUM A;  5FLX Z;  1ON2 A;  1U3E M;  3RIR A;  1V3F A;  3J7A O;  1HBX G;  3PQJ A;  2DAO A;  2DK5 A;  4L5I A;  2W57 A;  3ERE D;  3ABU A;  4MTE A;  3ZN1 A;  1WI9 A;  3DXJ F;  1ZG5 A;  3ML6 A;  5DV5 A;  2HS5 A;  4A6D A;  4XLP F;  2RQP A;  1DDN A;  1R1U A;  5K5R A;  3L7W A;  4KA4 A;  3DP7 A;  2KJC A;  3WGG A;  2FNP A;  3FM5 A;  4L9V A;  1K78 A;  2PN6 A;  4G8X A;  3CDH A;  2ETH A;  3FM3 A;  2EFN A;  2CQK A;  1PP7 U;  3N97 A;  2CFX A;  4RGR A;  4ESJ A;  1XMK A;  1QO0 D;  2RV8 A;  5CVI A;  3KZZ A;  4IRG A;  3ECH A;  3ULQ B;  5BPD A;  5LHG A;  4FX4 A;  3RKY A;  4ENK A;  1SD7 A;  4IF4 A;  5IT3 A;  1OR7 A;  3ZQ7 A;  3F8M A;  3KE2 A;  1OYY A;  1U2W A;  2EFP A;  2ZNZ A;  2XAF A;  4KYW A;  3NRV A;  2XAS A;  1DUX C;  1MJA A;  1ZG1 A;  4S04 A;  1EH8 A;  1LB2 A;  4OIQ F;  3BZ6 A;  3QOP A;  1F4K A;  4F7Z A;  2HQR A;  2DK8 A;  3I54 A;  4KMU X;  5L3F A;  1OYW A;  3LQQ A;  3GVA A;  1WSU A;  5AON A;  4CYD A;  3I5U A;  5FD5 A;  1IAW A;  3HRT A;  2H27 A;  5AIQ A;  2FA5 A;  1ZAR A;  3V7S A;  1H9G A;  1H9T A;  5K1Y A;  2HKO A;  2K27 A;  3IRQ A;  5LLQ A;  4Y15 A;  3KLO A;  1WRJ A;  2L4A A;  1IZ1 A;  2PBI A;  2HTJ A;  4IPA A;  1XB4 A;  3CJN A;  1AOY A;  3F3X A;  3VOE A;  5BQT A;  2M30 A;  4OIO F;  4D0P A;  2JRT A;  2HEO A;  4M71 A;  4BHC A;  3SHF A;  3KP4 A;  3SQN A; 
#chains in the Genus database with same CATH topology
 3K4M A;  4F52 A;  4IOA F;  3V4G A;  3GTG J;  4YEL A;  3T8T A;  1TW3 A;  2ZJ2 A;  1ETY A;  3S93 A;  3WTV C;  2XAJ A;  2CSO A;  3ESW B;  4KFC A;  3EDP A;  1QNT A;  2LMD A;  2QQ8 A;  1OJL A;  2VPR A;  1G3T A;  2YPR A;  4AYB A;  1LFP A;  3E6M A;  3K4K A;  3BQY A;  4U0Y A;  1HW2 A;  2XGX A;  3L2W A;  2VJI A;  3J7A Y;  1R23 A;  2XF6 A;  4H4K C;  4MIM A;  2KT0 A;  2HYG D;  1FYL A;  1IRG A;  2E1M C;  2CV1 A;  1NG6 A;  3OYB A;  3GXO A;  3SFI A;  1ITY A;  3TQN A;  2HPM A;  2ISY A;  1ETX A;  1MH3 A;  1W4M A;  3OV8 A;  1Y1V J;  4HST A;  1VQP I;  3TL4 X;  1E2X A;  3NWT A;  2HYF A;  2E19 A;  3BG7 A;  3M8F A;  1S5L C;  2CRG A;  1BR2 A;  3I59 A;  2BBY A;  2TCT A;  1VZ0 A;  1LPQ A;  3K1M A;  2IS1 A;  2HPI A;  4CSW A;  1ZRE A;  4LLL A;  2XB0 X;  3M8J A;  4LLG F;  3MFK A;  4A3E J;  2M5W A;  4J01 A;  1MW7 A;  3WGI A;  5CQG A;  4LG3 A;  2R4G A;  2ZME C;  4CYC A;  3S15 J;  3ABT A;  2H94 A;  2EPF A;  1ZLJ A;  4OMY A;  1W5T A;  4Z6Y A;  1IDZ A;  3KYD B;  3KEQ A;  2DDA A;  3KP7 A;  1YFH A;  2V1U A;  1TWC J;  2VQG A;  3GX4 X;  3SYT A;  3K4L A;  1I6H J;  4QLC U;  1BJZ A;  2W85 A;  5FKM A;  3JRD A;  2JQ7 A;  3C2B A;  1K6O A;  5F04 A;  2X1E A;  3FKJ A;  2ECC A;  3DPU A;  2NS7 A;  4ZYE A;  3T5X A;  2R5Z A;  1BJA A;  2WAE A;  4CGZ A;  2F4M B;  2KRH A;  4CCO A;  2A68 F;  2K5C A;  3ZMZ A;  3JRG A;  4BEH A;  2ID6 A;  2KRF A;  2M2E A;  1ETK A;  1B4A A;  1P4A A;  3U21 A;  4YEJ A;  1A35 A;  1FTZ A;  2L4M A;  4U88 A;  2LY1 A;  2Q0O A;  3DFG A;  4A93 J;  3AG3 H;  2CUJ A;  1WHU A;  3E97 A;  3S32 A;  1FNN A;  3OYD A;  3ROU A;  2OU2 A;  2P7C B;  2ZFW A;  1FBQ A;  3FF5 A;  3SDB A;  3PIP F;  1I39 A;  2P6T A;  3I9V 2;  2M8E A;  4O3M A;  1JI8 A;  3IKT A;  2R7W A;  1XGN A;  3CCR I;  1T98 A;  1VF9 A;  3OYC A;  4LJZ F;  3ZOB A;  4EGY A;  1UST A;  2M1B A;  3HUG A;  2K86 A;  1X2N A;  3VB2 A;  1SAX A;  3FMQ A;  2L9R A;  2BVM A;  1J9I A;  3HL2 A;  1FOX A;  1S8N A;  1XSX A;  3V8J A;  3CCJ I;  4IEJ A;  4XRS A;  2XKP A;  2CS3 A;  3Q5F A;  5DCM B;  5EEG A;  4BS9 A;  2HDC A;  3GTP J;  3V42 A;  1KU2 A;  3K10 A;  2L3D A;  4M9S A;  4QPO A;  1MBH A;  3ONQ A;  4RA2 A;  2X0L A;  4IZZ A;  4BQQ A;  4G6Q A;  2CW7 A;  2VC0 A;  3MN2 A;  3BR6 A;  2HOT A;  2KL4 A;  4Y33 A;  1BN5 A;  2W1O A;  1G6N A;  5IOZ A;  1DU6 A;  4WWC A;  4BAC A;  5IYB J;  1FOY A;  4P5O A;  5JI6 A;  1IF1 A;  4G7H F;  2OPT A;  3DV8 A;  5D8L B;  4XBF A;  2PEX A;  5TGT A;  1BL0 A;  5L3G A;  1W7P B;  4LMY A;  1SMT A;  2PLY A;  2O8K A;  1Q1H A;  2F48 A;  2O5R A;  5J3L A;  3WE3 A;  4GRI A;  2XSD C;  5D5V B;  3DF8 A;  5L3B A;  1P92 A;  2KHM A;  2I10 A;  1D1A A;  3A4C A;  4KIG A;  3FMR A;  3FXU A;  4M3B A;  2IRF G;  1MIJ A;  2W48 A;  1G3W A;  3ZN0 A;  3HYI A;  2PJR A;  1R4N B;  4O6J A;  5HLH A;  3GTO J;  1Y0U A;  1WWX A;  1KQ9 A;  1LFB A;  2HDW A;  3S16 J;  2K02 A;  2VPL A;  3DPT A;  2O7O A;  3K4C A;  4OMZ A;  4A3I J;  4IQJ A;  1IRZ A;  3CZ6 A;  3C3W A;  4KDP A;  4OWR B;  5ED4 A;  1XGS A;  3LA3 A;  3I4M J;  1BI0 A;  2XF5 A;  3LST A;  3I56 I;  3LWF A;  3B02 A;  3AAF A;  4I09 A;  5DTD A;  1ZGJ A;  2JSC A;  1DPR A;  4I76 A;  2XRN A;  4ETS A;  4A12 A;  4B47 A;  3JRB A;  3JAM Z;  3QYE A;  2FD5 A;  3NQO A;  4ENN A;  1LDD A;  2O3F A;  2RQQ A;  3X2Q H;  3IRR A;  5L3C A;  4XQF A;  1BI2 A;  1BOA A;  4MEY F;  3HOV J;  3QQA A;  2KKO A;  3DKX A;  2EWN A;  2Y48 A;  3V7C A;  3R0J A;  2LG4 A;  4HSR A;  2FBH A;  2BXZ A;  3I3L A;  3IKV A;  3OYJ A;  1D5Y A;  2EIN H;  4FIS A;  3ZXS A;  3K70 D;  5CJ9 A;  2EIM H;  2Z33 A;  2CV2 A;  3S3M A;  4E7J A;  3V8L A;  3K4J A;  2QKL B;  1MSF C;  2X1C A;  4M9X A;  3J80 K;  4XRM A;  1LEB A;  2LSO A;  4GDF A;  2EFQ A;  2LBF B;  3NWS A;  1CF7 B;  2OUM A;  3ELK A;  1VTN C;  2OZ6 A;  3PNY A;  3VPR A;  1MBG A;  5DCM A;  2VLA A;  1WJB A;  2CH0 A;  2X6W A;  2XF7 A;  3OYG A;  1BBY A;  3ZGK A;  3CDL A;  3WG7 H;  1Q1V A;  3K2A A;  4KIT B;  3OYM A;  1XDS A;  2XGE A;  4CO8 A;  3HHH A;  2P5L C;  2M7B A;  2E7W A;  3Q0W A;  2Q2E B;  2GM4 A;  5D5U B;  2DTR A;  3L00 A;  2DT6 A;  3DEE A;  4Y17 A;  1R6R A;  5LRS A;  3TDU C;  1BM9 A;  2V6C A;  2PQ8 A;  5D6F A;  4RLF A;  4ZDO A;  3RYR A;  2OCC H;  1TZL A;  4LK1 F;  4W97 A;  3QAH A;  1VQN I;  1A31 A;  5H6Q A;  2XVC A;  4CCL A;  3JRE A;  1T0F A;  2JRM A;  3ISP A;  2VE9 A;  3RPU A;  2EZH A;  2Y9Y A;  1IG7 A;  3FK6 A;  3RSN A;  4XLA A;  4FX0 A;  2E5N A;  4PDK A;  2STT A;  4FT8 A;  1ZKG A;  1ZQ3 P;  1HXD A;  1Z0X A;  1EA3 A;  3LOC A;  4XK4 A;  1OYI A;  4LGW A;  1OCC H;  3KCC A;  4B4C A;  2HNH A;  2E2I J;  2LR8 A;  2L0K A;  4OIN F;  4HX4 A;  2NXN B;  2WAQ N;  4LLN A;  4YIR X;  2AHQ A;  1JKP C;  1W5C C;  2BGC A;  2PG4 A;  3KZY A;  4EJV A;  4L0Z B;  4XN3 A;  4E7I A;  3CUQ A;  4Q5S F;  2QEN A;  1KU3 A;  1L3L A;  2OA4 A;  1NK2 P;  5IT9 K;  2DA3 A;  2FE3 A;  2NOG A;  2K3F A;  5D4S A;  2Z3Y A;  2RNJ A;  4B48 A;  2IA2 A;  4JBA A;  3LA2 A;  4ANJ A;  1YX3 A;  2DN0 A;  4E6K G;  3KX2 A;  3P7N A;  1R71 A;  3CC2 I;  2ELK A;  2ZXJ A;  3M3Y J;  1IJW C;  3I71 A;  2Z5U A;  2CQX A;  3OL3 A;  5A2Q K;  1J09 A;  3RDI A;  4MNU A;  2ZXH A;  1GVD A;  2A6H F;  1XGM A;  4LIT A;  1FYK A;  3K1P A;  2LBF A;  4B8X A;  4BAY A;  3KLN A;  2GQQ A;  2J5O A;  2XC7 A;  1X1P A;  2R7Z J;  1P2F A;  4M9Z A;  2QQB A;  5KCM A;  3PNT A;  4BXU A;  3TDZ C;  5E18 F;  5M5W J;  2MA3 A;  4II3 A;  3SEQ A;  3WE2 A;  4BU2 A;  4IL6 C;  1JXS A;  1AWC A;  1AA7 A;  3EQL F;  4RB1 A;  2DMQ A;  2GXG A;  2Y2Z A;  4N4N B;  5ERI A;  4OOI A;  5EJC A;  3KP6 A;  1TWH J;  4HV5 A;  2W00 A;  5FB2 A;  3BCB A;  3DU5 A;  2X6X A;  2A07 F;  5J1Y A;  2BV6 A;  1KU9 A;  3AG2 H;  3S2H J;  3P9K A;  3RKW A;  3P5J A;  3SZP A;  4I2O A;  2OAZ A;  2MYS A;  2X1D A;  4EMS A;  2M87 A;  4BBR J;  2ME0 A;  2A61 A;  5L3D A;  3HM5 A;  4MQV A;  2NRA C;  5HVQ C;  2CW0 F;  1FLI A;  1PDN C;  1PVE A;  1P4X A;  2WA0 A;  3LMM A;  3WOD F;  1JKO C;  1U8R A;  1GXQ A;  3H35 A;  4C2M J;  1F43 A;  4CH7 A;  3WTW C;  2E2H J;  5FJ8 J;  4IHS A;  3CC7 I;  1N78 A;  2VBY A;  2QEX I;  1ZEL A;  1ZLK A;  4N9I A;  4L5J A;  4QPQ A;  1B8I B;  3GUD A;  4UY8 I;  1UAA A;  1IUF A;  2DO7 A;  1Z21 A;  3DKY A;  2M7A A;  2LY9 A;  4DW6 A;  5GTH C;  1H88 C;  4N9H A;  2L9V A;  2G9W A;  2Y30 A;  3M9A A;  5LGN A;  3AFH A;  3VDX A;  5F64 A;  3BCA A;  2GXA A;  3IH4 A;  5AIP A;  1I5Z A;  3L09 A;  1ETW A;  2JA6 J;  2DMN A;  3BY6 A;  1V54 H;  3RZD J;  3GTQ J;  1H8A C;  4A3D J;  4G94 A;  4Y4R A;  2NVY J;  2XHK A;  1XCB A;  3DBR B;  3G1O A;  2F4O B;  4M6X A;  5EG0 A;  4ABZ A;  2VON A;  4HF1 A;  1E3O C;  2JVH A;  3I53 A;  2L9S A;  4XLE A;  2NNN A;  5BMZ A;  2MD5 A;  5LHH A;  1YTY A;  4B09 A;  2LOO A;  2Y0S N;  2GAU A;  3L2U A;  3BTJ A;  3RI4 A;  2L02 A;  1W0T A;  3TKY A;  1BR4 A;  2KIU A;  3IP4 B;  2DT5 A;  2R92 J;  2WAF A;  3OYL A;  4HAM A;  3BLY A;  4AUX A;  2E1C A;  2PMU A;  2XGD A;  1MMA A;  3PL8 A;  4IOC F;  4D9J A;  1KGS A;  4P96 A;  3MMY B;  5IOY A;  1VQ7 I;  2L2O A;  3IV5 A;  2MBF A;  5JVG F;  1J5Y A;  3CD6 I;  3B6A A;  1TP4 A;  1U5T C;  3DWL E;  4UNO A;  1FX7 A;  4ZC3 A;  1UHW A;  3FXO A;  1BC7 C;  1ZH5 A;  1FOK A;  3CDI A;  4M6V A;  1I6X A;  2VB6 A;  1T39 A;  1VQO I;  5IP9 J;  1HW5 A;  5TRD A;  3GWZ A;  4NC8 A;  4QWQ A;  3PUB A;  2QVO A;  4LG0 B;  5E8I A;  3MQ0 A;  3JTG A;  1C0W A;  3OYE A;  2K4B A;  4XKC A;  2OD5 A;  2VQC A;  3BP8 A;  3VSK A;  3CJQ B;  5DM7 F;  1NG7 A;  4I01 A;  3G1L A;  3HG9 A;  2EB7 A;  1A36 A;  4OIR F;  1B8I A;  5GAG J;  2QQA A;  1WPK A;  1T56 A;  4XOR A;  1G4D A;  2E36 A;  3TOA A;  5C44 J;  2JUG A;  2NS0 A;  1X3W B;  3QP5 A;  3EUK L;  1D0X A;  4GFB A;  4HG2 A;  2A6E F;  2WAD A;  3LL7 A;  4A2U A;  4BY1 J;  1MGT A;  2PMZ A;  1KU7 A;  3RQI A;  4QSH A;  4DYC A;  4M73 A;  1J59 A;  2LDU A;  3MKY B;  2VE8 A;  2EFO A;  3W3C A;  5DM6 F;  2DJN A;  4EAT A;  1K61 A;  2F5C A;  1OCP A;  5CQE A;  3HC7 A;  3HRS A;  2GIV A;  5FO5 A;  1U78 A;  2JUC A;  1K83 J;  1Z77 A;  5CVU A;  3BQZ A;  1F9N A;  3H92 A;  3FBI B;  4XLC A;  1VFC A;  2ZME B;  1MNE A;  3D0S A;  2ZO4 A;  2E5Z A;  4F93 B;  1YQA A;  2FRH A;  3F72 A;  4HLX A;  4V2F A;  5GAD J;  3LAP A;  2Z1D A;  3SHF A;  3HPG A;  3N4M A;  2DT7 B;  3C1D A;  2Z2S B;  2P81 A;  3IH2 A;  2EK5 A;  5LGU A;  3TW6 A;  2D1H A;  1Y0N A;  4L5E A;  3CLO A;  2B7E A;  4R79 A;  3WTS C;  1SFO J;  3CQZ J;  2NOJ B;  4BQO A;  5J4Y A;  4ZYD A;  5F1R A;  3GFL A;  4B1R A;  5D4R A;  1XSV A;  4E7H A;  2A3S A;  3EUH A;  3PUF A;  3Q9V A;  1F1Z A;  3T1B A;  5D5X B;  3CCU I;  3DEU A;  2JA8 J;  2XSJ C;  2VBX A;  3BR0 A;  5BPI A;  3IAS 2;  4MFD A;  2W4S A;  5M3M J;  3GO5 A;  3CCM I;  4WXD A;  2KZV A;  2X9D A;  1Y56 A;  4BGD A;  3LSG A;  5CKT A;  4RB3 C;  1UG2 A;  3LSM A;  4KIS A;  2ZBK A;  1LVA A;  3OOU A;  4BH9 A;  1MMS A;  4ZZD A;  1L0O C;  2H09 A;  2UV1 A;  5E8G A;  3BZK A;  4IKF A;  1IV6 A;  4XID A;  4BUP A;  1ONV A;  2G0E A;  1F36 A;  3OL4 A;  2FEZ A;  4IHW A;  2IS2 A;  3TP0 A;  3ZQC A;  1SVO A;  4ENM A;  1APL C;  2FOW A;  3F22 A;  1Z7U A;  1E17 A;  4R1H A;  1BOB A;  2VJJ A;  3E5U A;  4KIC A;  1SAN A;  3RKX A;  1S29 A;  3GLX A;  3W6V A;  4FE7 A;  4L18 B;  1P6R A;  2XGC A;  5ILU A;  2CW8 A;  2QF7 A;  2IGM A;  3F8C A;  3S2D J;  5BOX A;  3HIF A;  1LQ1 A;  2V1N A;  2HDD A;  4A3B J;  2DQR A;  2JJ7 A;  2ECB A;  2HKX A;  3I55 I;  3PSF A;  3REO A;  2V79 A;  1FWZ A;  1ZRF A;  1R5G A;  2ZME A;  4EJT A;  1R1T A;  2KLO A;  4YRV A;  4RGX A;  4E7Z A;  4CCN A;  3E5Q A;  5HOO A;  2E2J J;  5DDG A;  4XN0 A;  1IRX A;  1R22 A;  2WB1 N;  2V7F A;  3A2K A;  3OYA A;  4ZTF A;  3NAU A;  3LSH A;  2W7N A;  3O8H A;  2RRE A;  1LNW A;  4DIQ A;  2WBM A;  3UNG C;  3LSJ A;  3M7G A;  4XOP A;  2VKV A;  1ZR2 A;  3JTH A;  5B1B H;  3DPL C;  3PM1 A;  3WU0 A;  1HLV A;  2FF4 A;  1YW9 A;  2KPM A;  2LC2 A;  2RDP A;  3VYR B;  3U1D A;  1U0J A;  2DA2 A;  4YFK F;  1IN7 A;  3K4N A;  3UKG A;  2DXI A;  3BR2 A;  3DLA A;  2ZNY A;  4PUS A;  4CZC A;  1H0M A;  2F2E A;  1YG2 A;  4B3A A;  3S1N J;  1QBJ A;  3T0Y A;  1YW8 A;  2WV0 A;  3IWZ A;  5HOD A;  2CYY A;  3GW2 A;  2RC4 A;  1OMI A;  4IHX A;  5J1U A;  3PIO F;  2DDB A;  5GPC A;  1G59 A;  5KVR A;  4KN4 X;  2JVG A;  4PGH A;  2HWV A;  3ZR8 X;  2EZL A;  2XAG A;  4NUB A;  5D6E A;  1I1S A;  2V9P A;  2IGK A;  1MZB A;  4RGS A;  3TO7 A;  1J2X A;  1X4P A;  3A01 A;  1H89 C;  1G2H A;  2QYO A;  3U2R A;  1RES A;  2KJB A;  5LEK A;  4PJ0 C;  4LD5 A;  5HS7 A;  2K4J A;  3CCS I;  1S6L A;  1RR8 C;  1FP2 A;  1ZGA A;  2VOD A;  9ANT A;  3ZQH A;  2IGN A;  5BNG A;  1O3Q A;  3GLL A;  3NAR A;  4HPQ A;  4A0Y A;  4KIF A;  3GFJ A;  2HQN A;  4PJM A;  3FDY A;  2GOM A;  2PJP A;  4EVI A;  2O9L A;  2R7O A;  3J7Y J;  4MTD A;  4E70 A;  1TBX A;  1JJ6 C;  1VQ6 I;  2A05 A;  2MH9 A;  1KQ8 A;  1OCT C;  1SMY F;  4KNY A;  1TWA J;  4M6Y A;  1BR1 A;  3BPX A;  2XRO A;  2AQF A;  4IQ4 A;  1TQM A;  4RAZ A;  2DQL A;  1FSE A;  2O61 A;  4XON A;  4UB8 C;  3W6K B;  4FTH A;  3GZ6 A;  3ZMV A;  2ESH A;  4XL9 A;  5DS9 A;  2W25 A;  4CZZ A;  2STW A;  3CP8 A;  4HW0 A;  4YG2 F;  1R36 A;  3OS0 A;  1W1W E;  4HX8 A;  4BDZ A;  5B3S H;  5HNF A;  4XNF A;  3GYH X;  1EV7 A;  5JFR A;  4WXH A;  1VQ8 I;  1NHA A;  5EF6 A;  2M0C A;  3Q3S A;  3B73 A;  1ETO A;  3IHU A;  2QZ8 A;  1X1A A;  4EJO A;  5D5W B;  2A5Y B;  2WAQ A;  3T8R A;  5FKK A;  4G7Z F;  1Z3Y A;  5E20 A;  3K70 C;  3K6G A;  1OQY A;  1GT0 C;  4IX7 A;  2CMP A;  2VN2 A;  4FAS D;  3WU1 B;  4TV7 A;  1ETQ A;  2MW8 A;  2X51 A;  3FXQ A;  2FML A;  4AVZ A;  4LIV A;  3OS2 A;  2Q8K A;  5IYC J;  2VQH A;  3LFK A;  1BIB A;  1BW5 A;  4O5V A;  3MWM A;  2KFD A;  3VSL A;  4L0Y B;  4H0E A;  3QPH A;  1ZRD A;  1R5I D;  4EM0 B;  5EZH A;  1V5F A;  2K9Q A;  5F0F A;  4BY7 J;  4D5F A;  1HST A;  3FX3 A;  2FNA A;  3SZG A;  2QLZ A;  2MC3 A;  4YII A;  5IP7 J;  5LBQ A;  4WCG A;  3SJM A;  1VI0 A;  2HTS A;  3FKI J;  3S3N A;  2EZK A;  3CF5 F;  3JW4 A;  3Q0U A;  4AIH A;  3HTS B;  2D2W A;  3HDD A;  1TLH B;  4KJZ A;  4P55 A;  2ISZ A;  1VQL I;  4C2U A;  1QZY A;  1UZC A;  2RVC A;  4DQ2 A;  3F9K A;  1HA8 A;  4QTR A;  4BHP A;  4NQW B;  1O7F A;  4EQQ A;  1KYW A;  3MAJ A;  1XN7 A;  1HQC A;  3QOD A;  4HV6 A;  4Q4Z F;  1GVJ A;  2XAH A;  5M3F J;  5IYD J;  3Q0V A;  3JSP A;  1JKR C;  2IGO A;  2DA7 A;  1QA6 A;  1FC3 A;  3EET A;  1X19 A;  1SVM A;  3HKZ A;  4Q47 A;  2VI6 A;  3R6S A;  1N77 A;  3PJR A;  1M1E B;  1MBF A;  2DA5 A;  4X1E A;  4IRI A;  1P7I A;  2DFH A;  4CCK A;  2DOD A;  3ZQQ A;  1UEL B;  2W24 A;  5JLW A;  4IRH A;  3QYB A;  2VBW A;  2XKO A;  2A69 F;  3OSG A;  1B59 A;  4HOB A;  3LNQ A;  4DBQ A;  4CA0 A;  2L7F P;  1X1B A;  3WTX C;  4P9F A;  1PP8 F;  1B72 B;  3S17 J;  1YJN I;  3BDD A;  2VKD A;  5E3O A;  2DOF A;  4NHJ A;  1XCV A;  2NAZ A;  1YS7 A;  2FOK A;  2DYR H;  5GPA A;  1EH6 A;  3H5A A;  2ZJR F;  1XD7 A;  1YJ9 I;  3E7L A;  2TRT A;  4AYB N;  1BW6 A;  2UWM A;  3H0G J;  1QPI A;  2VKE A;  3VWB A;  2IA1 A;  4F3Q A;  1POG A;  4WF2 A;  1S9H A;  5LEJ A;  4PSX A;  2DFI A;  2LF8 A;  4LIU A;  5DUI A;  3OWT A;  1FT9 A;  2X48 A;  1GUU A;  3OYN A;  2DU9 A;  5EEA A;  1DGR M;  5HLG A;  1ULY A;  3RYP A;  3R0A A;  2CU7 A;  1YRN B;  2KIQ A;  4AVP A;  3DBH B;  3BG6 A;  4X6A J;  2P5V A;  4BDY A;  1K4S A;  3W2W A;  4E7S A;  1WJF A;  1WJ5 A;  2J5P A;  4NNJ A;  4D7N A;  2XPV A;  2B0L A;  3GZ5 A;  1SFX A;  4PCQ A;  4LK0 F;  2BXY A;  3WTT C;  4HLY A;  1X1D A;  2KDZ A;  1W7P A;  2E35 A;  1JUS A;  3MZH A;  3PO3 J;  3FZV A;  3TBI A;  2M34 A;  2D45 A;  5L3E A;  3KEO A;  3S1Q J;  1UJ8 A;  1EKE A;  1KON A;  1Y39 A;  1RRJ A;  1IN5 A;  3DU6 A;  3I4N J;  2GWR A;  1MND A;  2R7U A;  4ASN A;  2AXL A;  2ICW G;  2JA2 A;  4XLN F;  4XKB A;  2DLL A;  3VYU B;  3WTZ A;  3OYF A;  1I27 A;  2CV0 A;  3ABL H;  3EYY A;  4HZF A;  1DU0 A;  3R61 A;  3DKW A;  2WTE A;  3KP2 A;  5J47 A;  3F23 A;  1FMV A;  2FBK A;  4CDG A;  1U5T B;  2KIS A;  2HYJ A;  1STZ A;  1FP1 D;  3TO9 A;  1BI1 A;  4PZJ A;  4YFN F;  1DGW Y;  4ENJ A;  4ZDP A;  2O0Y A;  4CXF A;  4OIP F;  2FUG 2;  4KT5 C;  1B72 A;  3HOS A;  4ZTJ A;  2R3S A;  2B63 J;  4KMF A;  2TDX A;  2CQ7 A;  2JT1 A;  3G2B A;  2LKX A;  4RB2 C;  4Y52 J;  4RAG A;  1T6S A;  1A6Q A;  2ADU A;  4W1U A;  1DPU A;  3GCM A;  4ESB A;  3TGN A;  4UUV A;  2COB A;  3E6B A;  1IV8 A;  2LTP A;  4MGR A;  3VYS B;  4V19 K;  3NEU A;  2BEO A;  1QRY A;  2YU3 A;  1CF7 A;  2ZC2 A;  5E1X A;  2F5E A;  4FQG A;  3BJ6 A;  3WHB A;  2QBY B;  2FMY A;  1R00 A;  3AL0 C;  2GA2 A;  1RET A;  2RN7 A;  2VJ5 A;  2IS6 A;  3CMA I;  1F5T A;  3MKL A;  3ZMD A;  1N25 A;  3JRI A;  1YRN A;  3P9C A;  2G7U A;  1HKQ A;  3E5X A;  2R7X A;  2OTL I;  3SEZ A;  2AQE A;  2Q2E A;  4GYI A;  1SD6 A;  2B9S A;  1QPM A;  3FHN A;  1E0E A;  4L9T A;  4ZYG A;  1JKQ C;  4FE4 A;  3K7A J;  2GXB A;  4EV0 A;  1MSE C;  2EZI A;  5HLT A;  3I0T A;  2HI3 A;  3M4O J;  1WI3 A;  4M3D A;  5IY5 H;  1FEX A;  2HOE A;  3HJE A;  4I02 A;  3LFU A;  3ZQI A;  2JSP A;  4E4H A;  4FHT A;  1K7A A;  1W0U A;  1PYV A;  2CWE A;  5KAI C;  2KQR A;  5CYV A;  4BNC A;  4XSZ F;  1HF0 A;  1MMG A;  5K5Q A;  3L2R A;  3HRM A;  5CVJ A;  4ZYH A;  2IT0 A;  2R7V A;  3PSI A;  3W2V A;  5A2Q Z;  2LYC A;  1NK3 P;  1ACI A;  5CPR B;  3BJO A;  3GME A;  2V6E A;  3OYI A;  3L1P A;  3E6C C;  5FRN A;  3MCZ A;  3S2W A;  3F21 A;  3OIP A;  4J19 A;  4E7K A;  2XB5 A;  4XIC A;  2OC6 A;  4WK8 F;  1O3R A;  1LEA A;  2OF7 A;  3CLQ A;  3QPS A;  4UV8 A;  1HKS A;  3BR3 A;  2Y75 A;  1TQP A;  1U5T A;  2BHY A;  4GGG A;  5FRM A;  4MO7 A;  2XPU A;  3RTR A;  3M1C A;  2MC4 A;  3S1R J;  3I64 A;  4I0B A;  1ZAO A;  4HF2 A;  2JPC A;  2JTV A;  5FLM J;  3CO6 C;  2EFW A;  4K2E A;  4UB6 C;  1I3Q J;  4RAF A;  5EZG A;  2BY2 A;  3FIW A;  1QHG A;  4Y7N J;  3RPQ A;  1B6A A;  1HW1 A;  5HDG A;  1FOW A;  1YJW I;  4CCJ A;  2JA5 J;  1R5H A;  4PFO A;  2K9M A;  2LNB A;  2DA6 A;  5ICC A;  2EA4 A;  4GYG A;  2DYS H;  1YW7 A;  1K78 B;  3CCE I;  1WFX A;  5JLX A;  5FLX K;  3KFW X;  2X4H A;  2LKP A;  1O7L A;  3CCY A;  3ASO H;  3H3U A;  1IDY A;  3CF2 A;  3OR1 C;  4G9Y A;  3QP6 A;  4HNU A;  2G7H A;  1S7O A;  3CCV I;  1LE8 B;  1FIA A;  1D0Z A;  2XAQ A;  2QBY A;  3RPU D;  3IC7 A;  1JT6 A;  2DFF A;  1AKH B;  4HRI A;  4XMY A;  1JHF A;  1MNM C;  4YIF A;  3HOZ J;  3W6J B;  1JUP A;  3GFM A;  4XSX F;  3MZ8 A;  4I99 C;  1PUE E;  1NH3 A;  4C3I J;  2LFB A;  3RZO J;  2V9K A;  1G3S A;  2VBZ A;  4PJJ A;  1GXP A;  3DLL F;  1VQ4 I;  3W2A A;  1R58 A;  5D8K B;  2L7Z A;  3F0C A;  2HVS A;  4WX9 A;  2P5K A;  1ZYR F;  1IN8 A;  1XMX A;  2E1O A;  2WB1 A;  2C6Y A;  4M3G A;  2BYV E;  3K9T A;  2DPD A;  2NNY A;  3O3K A;  2P7V B;  1UG0 A;  3H9G A;  1V5G A;  1AHD P;  3HB9 A;  1XMA A;  2MH2 A;  2DBB A;  2R7F A;  5ILV A;  1YIJ I;  1D1B A;  2WWY A;  1UHM A;  2R5Y B;  4IHY A;  3GTL J;  2A6T A;  4NC6 A;  2I5U A;  3VFZ A;  5C3E J;  5DYM A;  2WC2 A;  2ZCW A;  3DTE A;  5F0C A;  3E3V A;  4F91 B;  2NVU B;  4I7H A;  5KHD A;  2CO5 A;  1B9M A;  5JHU A;  5GTI C;  1J75 A;  2JN6 A;  3TOB A;  3AKZ A;  1RI7 A;  2CUE A;  2VXZ A;  1RNL A;  2D5V A;  3BWG A;  1HC8 A;  1RUO A;  2K9N A;  3A0H C;  4CHU A;  3BOQ A;  3COA C;  4U0V A;  3J81 Z;  1IN6 A;  1ODD A;  3CUO A;  3LA7 A;  5GAE J;  2E71 A;  2JMW A;  4JQF A;  1WQ2 A;  4BXX J;  1BIA A;  3P9I A;  2ELJ A;  5BS6 A;  1W36 D;  2QCO A;  1FBS A;  4IXA A;  2VAS A;  2OQR A;  4LB5 A;  4IVN A;  4P9U A;  3HGY A;  1J7K A;  2EIK H;  2EA2 A;  2YR2 A;  1RR7 A;  2IA0 A;  3OIQ A;  1D5V A;  4B43 A;  3CME I;  5JR3 A;  5HS9 A;  4CCM A;  1SFK A;  4KIB A;  4PJN A;  3HSR A;  3IH3 A;  2HZD A;  3EYI A;  3ZP5 A;  1IO2 A;  1QGP A;  2ACJ A;  3WTU C;  2DOA A;  3F8N A;  2BOL A;  4AU7 A;  1OLT A;  4DJA A;  2VOO A;  3CMM A;  1LE8 A;  2EQR A;  3BG3 A;  1T95 A;  2K3P A;  2R93 J;  4HNT A;  1K79 A;  3KEY A;  3HPH A;  1FYM A;  2F4I A;  4ESF A;  3M8E A;  1R1V A;  2WY7 Q;  5ICF A;  2BE5 F;  2KZG A;  5DUK A;  4BYY A;  3L2C A;  2H1L A;  2X6Y A;  3QU6 A;  3FXR A;  1XGO A;  1MDM B;  4HQE A;  2O8X A;  4UV9 A;  2NVX J;  3DCF A;  2CGP A;  1B1B A;  1UFM A;  2R7D A;  2QQ9 A;  1ZG3 A;  2Z9O A;  5FKN A;  1TWF J;  1B9N A;  1WH5 A;  4B3X A;  4LG0 A;  5HDN A;  4XRS G;  2H8R A;  4XRF A;  4MLO A;  4EEF G;  3MKW B;  2XPW A;  1MD0 A;  2MAB A;  2Q1Z B;  3A02 A;  1T08 B;  3QRF F;  1CQT A;  1D8J A;  3RJP A;  2E34 A;  1ZN2 A;  3HHG A;  2LP0 A;  3I59 B;  4UVA A;  2E60 A;  3LQR A;  1GDT A;  2HQ5 A;  2HZT A;  3EUA A;  3FXK A;  3S8P A;  1Z91 A;  1ZHF A;  3QPT A;  2VC1 A;  5E1Z B;  4NB5 A;  4XOT A;  4HBL A;  4EJU A;  2PMH A;  1ZRC A;  2LH9 A;  2BY1 A;  5F27 A;  3K0L A;  1OCO H;  1WCM J;  2QUF A;  2CJJ A;  3QU3 A;  2VOP A;  4C3H J;  1XDU A;  3V7R A;  1TTY A;  1RUN A;  3HOX J;  2Z99 A;  2OZU A;  2XRL A;  1Z7L A;  2KIM A;  3CO7 C;  3U1K A;  2R5Z B;  1D8K A;  4AIJ A;  4M74 A;  2OBP A;  2ESN A;  2EV0 A;  2ZXI A;  1TNT A;  4ZH4 F;  5IP6 A;  3CMY A;  3BJA A;  1WKM A;  1HDD C;  1X4O A;  1G3Y A;  1OR7 C;  3MEX A;  3HXL A;  5HLI A;  4BEH B;  1DQU A;  3VYT B;  4GO1 A;  2IBD A;  1A6I A;  4BJT A;  5HDK A;  2Y0M A;  1GV2 A;  2YU9 J;  1TWG J;  3IUO A;  3VOD A;  2V26 A;  2K9L A;  5GP9 A;  3PFI A;  1K4T A;  2ID3 A;  2GZW A;  2NVT J;  3TW7 A;  1DP3 A;  3RQ4 A;  2RGV A;  4OAY A;  1LVK A;  4BHB A;  3E0J B;  1OFC X;  5CVR A;  2L01 A;  5LGT A;  2FQ3 A;  5E3N A;  1J0R A;  1YS6 A;  2IXS A;  1G8X A;  2BHZ A;  2F6C A;  1MJB A;  4HA8 A;  1GV5 A;  5DD4 A;  4AWX B;  3L9F A;  3HUG B;  4JOM A;  1O57 A;  2VT3 A;  4RS8 A;  1RKW A;  2FJ1 A;  3CES A;  4ZZL A;  1YOV B;  1MDM A;  5J40 A;  2M3A A;  1RZ4 A;  1RKT A;  1V5E A;  1WJD A;  4G6D A;  4I98 B;  4L9J A;  3H3Z A;  1MJ9 A;  5CLS A;  1BC8 C;  3SXY A;  2LY2 A;  1UB9 A;  3ERM A;  1Y6I A;  5E17 F;  3M1E A;  2OQG A;  3OR2 C;  3FMS A;  3V8K A;  4I6Z A;  3N05 A;  3F8B A;  2XAU A;  1X3Z B;  4BJ6 C;  1UCR A;  2L54 A;  4DBR A;  4UUS B;  3SZT A;  1YIT I;  4U0W A;  4CIC A;  5DEQ A;  2RKH A;  5KAF C;  4A3G J;  1KA8 A;  1OIS A;  1WJC A;  3M07 A;  3BTC A;  2PMZ N;  2K85 A;  1T33 A;  2GIZ A;  3LSK A;  3WHC A;  3A1Y A;  5C4J J;  3GTJ J;  1MMN A;  1Z05 A;  2BVL A;  3FWE A;  2MFZ A;  1ZK8 A;  5F0H A;  1YE9 A;  4EM2 A;  1ZGW A;  4A6E A;  3ZQG A;  4DOZ A;  1EF4 A;  1TW2 A;  3WGH A;  2QA4 I;  5EDN A;  1X2M A;  4OAZ A;  3H9J A;  5FD6 A;  2PJR B;  5LRR A;  3G73 A;  3GFI A;  1S3J A;  2EV5 A;  2LK2 A;  1Z9C A;  1Z6T A;  2FXA A;  2KMU A;  2UXX A;  2R7T A;  5M5X J;  5LHI A;  2LD5 A;  1TC3 C;  2UZK A;  3GF2 A;  2QSG X;  3H36 A;  2AO9 A;  3KET A;  2HQA A;  2XUB A;  2DW4 A;  1UMQ A;  3DBL B;  2P8T A;  2HVR A;  2CG4 A;  4X0G A;  2FX0 A;  4BL0 B;  2L7M P;  3GEZ A;  3PFY A;  3ASN H;  2XV4 S;  1XC5 A;  4A0Z A;  3ABM H;  3ZQL A;  1WJA A;  2VT2 A;  3K1N A;  5LD2 C;  1QZZ A;  2V1X A;  3HGG A;  5FFZ A;  1YHQ I;  1EJ9 A;  5JVT A;  2F5D A;  4A5M A;  4HX7 A;  3RKQ A;  3BTI A;  3K69 A;  4RGU A;  3KP3 A;  1TQI A;  3ZRG A;  2HU9 A;  4IJA A;  4N0B A;  1HSJ A;  2EV6 A;  1R4M B;  2QKM B;  1W5S A;  3S3O A;  4UVC A;  1A04 A;  1VND A;  1YYV A;  2D1V A;  3CJT B;  3ECO A;  3JAM K;  2CUF A;  3WU2 C;  2QSH X;  1VQK I;  1HCR A;  2HOS A;  1IXS B;  1S72 I;  5KK1 A;  3JSO A;  2DMP A;  3C7J A;  1OKR A;  5JHF A;  5LFA A;  4UUS A;  4BE1 A;  3PO2 J;  3S1M J;  2KIF A;  3AL0 B;  1KQ0 A;  1IXC A;  1IUY A;  2K7L A;  1QQI A;  3SDG A;  4AD9 A;  5J8F A;  5GAH J;  4S05 A;  2DJI A;  2NYX A;  4A5N A;  1QU3 A;  1ZTR A;  2JPB A;  3IAM 2;  3OIO A;  3F8F A;  3I4P A;  2YUS A;  3FBN B;  1V55 H;  3MZY A;  3LSR A;  1XX5 A;  3R4K A;  2M4G A;  1Z1D A;  1S7A A;  4G7O F;  1N75 A;  5HNH A;  3GBG A;  2DMU A;  1RIO H;  3BC8 A;  4M72 A;  3D5R C;  4XLF A;  4DYR A;  4P1W A;  2K40 A;  1JE8 A;  2O6G E;  5DCF A;  1GHC A;  5H6R A;  1IGN A;  3BZC A;  4RM3 A;  3E6D A;  4AM3 A;  2Y69 H;  3C18 A;  5J1R A;  3E1S A;  1T8I A;  2HFH A;  4U7D A;  2OJE D;  3SFZ A;  5EEH A;  5FRO A;  4MHG A;  1JGS A;  3TO6 A;  1D1C A;  1RPW A;  1IXR C;  2FU4 A;  3CUQ B;  2F5F A;  5ICE A;  4A3L J;  3OYK A;  2YS9 A;  1R9T J;  1P7J A;  5H20 A;  4U7B A;  1MBK A;  3CTA A;  5J8C A;  1T2K A;  3HOU J;  2HGC A;  1USS A;  3L2V A;  4UXN A;  2EH3 A;  1E3P A;  4U87 A;  1LJ9 A;  4A0X A;  2BY3 A;  3AG4 H;  1Z6R A;  3FK7 A;  2IVM A;  4LFU A;  3IL2 A;  4UHT A;  2VXD A;  3LAJ A;  3U9G A;  2DA4 A;  4GCV A;  3PQK A;  4F55 A;  4BE2 A;  2CQN A;  3K2Z A;  2EIL H;  3JRF A;  1T38 A;  3KIO A;  2LVS A;  2WV1 A;  1IC8 A;  4GXO A;  1FIP A;  4BBS J;  2HVQ A;  1JT0 A;  5HS8 A;  3R60 A;  3DTI A;  2M45 A;  2ZSI B;  4JX6 A;  1SEU A;  5F08 A;  1FZP B;  4KN7 X;  3HBL A;  2IP2 A;  2Y0S A;  4PSW A;  3HSF A;  4XR6 A;  4YFX F;  1WVR A;  1ERD A;  2YSR A;  1S7E A;  3D5L A;  1D0Y A;  1RC9 A;  2JZY A;  3D1N I;  4OU0 A;  2Y9Z A;  4PGG A;  3MD2 A;  1SFU A;  4BQA A;  4NQW A;  2OCE A;  5EGO B;  2VJ4 A;  5E79 C;  5K5O A;  4M3E A;  1SAU A;  2Y31 A;  2KDO A;  1D3Y A;  3J80 Z;  2R7R A;  3JCU C;  1R49 A;  3C2G A;  3G4S I;  2LLK A;  4A3F J;  1IN4 A;  4DZJ A;  3F6O A;  2IJL A;  2DOE A;  2R7S A;  2ZB9 A;  3GZN B;  1YO5 C;  4E7L A;  1P4W A;  4B44 A;  5ICG A;  4AID A;  3KYL A;  1IW7 F;  1KYZ A;  2DA1 A;  3CJR B;  3H9Q A;  1O3T A;  2H6C A;  2AS5 F;  3QWL A;  4DNC A;  4XKV A;  4IHT A;  2IPQ X;  1SVL A;  5DD8 A;  2DTZ A;  1WGX A;  4Y13 A;  4MFE A;  3OSF A;  1Y1W J;  1IRF A;  1VQM I;  2V4J C;  3ZMU A;  4IHV A;  1JUM A;  3ZQF A;  3L2Q A;  2LF7 A;  1K6Y A;  1U9O A;  1O3S A;  4WXC A;  1MBJ A;  3FXJ A;  2Z16 A;  1FBU A;  4HDU A;  1OPC A;  3MVP A;  2F5V A;  3HRU A;  4ON0 A;  1BI3 A;  2EIJ H;  5EG0 B;  5TJJ A;  4M3F A;  1R7J A;  2JK3 A;  1V4R A;  4G6T B;  2LRE A;  1MKM A;  2K9S A;  2CUZ A;  3KP5 A;  4MEX F;  2OV7 A;  4A69 C;  1Z67 A;  2LRD A;  3G1M A;  2V9V A;  2E7X A;  2IS4 A;  4QIW N;  3OY9 A;  1T0F C;  2ZSH B;  5EYR A;  3FXM A;  5FGM A;  3BTL A;  3J7Z I;  1XS9 A;  1EH7 A;  2UXN A;  4Q48 A;  4EGZ A;  4JP0 A;  3K4B A;  2P6S A;  2PFB A;  5IT9 Z;  3HEF A;  4BXF A;  4EJW A;  2XIG A;  4HF0 A;  4UVB A;  2DI3 A;  2MGQ A;  3CP2 A;  4R8H A;  3JRA A;  1XG1 A;  3TP3 A;  4HEA 2;  2DCE A;  6PAX A;  3FIS A;  4AIK A;  1SFE A;  3WG9 A;  3A03 A;  2FBI A;  4RAY A;  2IW5 A;  2JA7 J;  3BR1 A;  4FET A;  2RNG A;  3BG5 A;  3HKZ N;  3JRC A;  3FHZ A;  3HTU A;  4N4O B;  3CUQ C;  1MBE A;  4PK4 A;  1LDK B;  4S0H B;  3WTY C;  5EGO A;  4RB0 A;  3BPV A;  2ZKZ A;  4LOC A;  1X1C A;  2YX4 A;  4L9N A;  4EM1 A;  4DZP A;  4NBQ A;  4HYE A;  1REP C;  1JHH A;  2HR3 A;  1FY7 A;  1HDP A;  2HXO A;  2P4W A;  2QM3 A;  5J4V A;  1JTX A;  2H1K A;  4A3K J;  5B1A H;  1U8B A;  4DYQ A;  1FPQ A;  2E1N A;  5FFX A;  2MLG A;  1SD5 A;  1U6G A;  3HOY J;  2P0W A;  4HDV A;  1ENH A;  2MSY A;  3ZMS A;  2O03 A;  3H1C A;  4JK1 X;  4Z2Y A;  3BRO A;  5E3M A;  2ZJQ F;  1XSD A;  2DPU A;  4ITV A;  3F6V A;  2L9N A;  1LDJ A;  5J6X A;  2MLK A;  2QSF X;  3AG1 H;  3I58 A;  4HQM A;  5E1W A;  4LB6 B;  1FJL A;  1CGP A;  3S14 J;  1PJR A;  3O2P E;  3G3Z A;  3FXL A;  1QHH D;  2EBI A;  5F6F A;  2ELH A;  3DEW A;  3OOP A;  1W36 C;  4JYK A;  2V1D A;  4C2T A;  1W7P D;  2COM A;  3QPL A;  5B66 C;  1O4X A;  3ZCO A;  2FSW A;  3KPH A;  1SD4 A;  4I0A A;  3IWF A;  3H5R A;  2QWW A;  3O8G A;  1XTA A;  2ZFU A;  4UUT A;  2VIX A;  2W84 A;  1ZR4 A;  3KZI C;  4RMN A;  1FSH A;  2NVQ J;  3H0D A;  2H8W A;  3TED A;  3Q9S A;  1A5J A;  2M9H A;  1TNS A;  2QGU A;  3PNV A;  2A5W A;  3OYH A;  4A3M J;  2ME6 A;  5FKO A;  1YIO A;  2YX7 A;  4XM3 A;  2BZT A;  1DP7 P;  4Y3O A;  4JX4 A;  5C4X J;  1HKT A;  4D1Q A;  3LSP A;  4BQN A;  3ZPL A;  3G6E I;  4XLH A;  3TMO A;  3ABK H;  1ON1 A;  1YLF A;  3HOT A;  2EJR A;  4NC7 A;  3LSI A;  3GTK J;  4D7M A;  3DQV C;  5ILS A;  2PI0 A;  3J81 K;  3BR5 A;  2CQQ A;  3VEP A;  4IO9 F;  1I1G A;  2IEK A;  4BKX A;  3O6B B;  1X3U A;  2GA1 A;  3QYF A;  5CVV A;  2W82 A;  1U9N A;  1FTT A;  3ZMT A;  1OCR H;  3HSE A;  1LKX A;  2H6B A;  4MQ9 F;  4V2G A;  3DTK A;  2CFO A;  4KUM A;  1KZH A;  1ON2 A;  5FLX Z;  1MMD A;  1WH7 A;  1U3E M;  3RIR A;  1V3F A;  3J7A O;  1HBX G;  3PQJ A;  2DAO A;  4PJL A;  2DK5 A;  5M5Y J;  3D5S C;  4L5I A;  2KRC A;  1LFU P;  2X85 A;  1ETV A;  2W57 A;  4J00 A;  1HOM A;  4HNV A;  3ERE D;  3ABU A;  2VKH A;  4MTE A;  3G71 I;  3ZN1 A;  1WI9 A;  1JTY A;  3DXJ F;  1ZG5 A;  3ML6 A;  5DV5 A;  1QVT A;  2LKS A;  2KP6 A;  4KT6 A;  3QOE A;  1ORK A;  1Z3X A;  2HS5 A;  2XDV A;  4A6D A;  4XLP F;  4CUG A;  2RQP A;  4C9Y A;  2E1M B;  3BG9 A;  2R7Q A;  3A0B C;  1TL8 A;  1DDN A;  2MG4 A;  1R1U A;  4C30 A;  5K5R A;  2GOX B;  1GLN A;  5K7Z A;  4RDU A;  1Y8Q B;  2AXT C;  3L7W A;  1QZE A;  4KA4 A;  3DP7 A;  1WJE A;  2KJC A;  2BY0 A;  2ZXW H;  2JWT A;  3WGG A;  2FNP A;  3FM5 A;  5E3L A;  4A3C J;  4L9V A;  1AU7 A;  2VUM J;  1K78 A;  1I3A A;  2MD0 A;  2RAE A;  2L5Q A;  1FMW A;  2M0M A;  2PN6 A;  4G8X A;  2M4K A;  3CDH A;  2ETH A;  4JX5 A;  2OTJ I;  2HXI A;  3FM3 A;  1NTC A;  2BW3 B;  3EPZ A;  1PUF B;  2EFN A;  2CQK A;  2X6O A;  2L7K A;  1AKH A;  1PP7 U;  3N97 A;  1UHS A;  2CFX A;  2I8D A;  2UUZ A;  4RGR A;  4ESJ A;  1TT5 B;  1XMK A;  1QO0 D;  2RV8 A;  2FQ4 A;  5CVI A;  3KZZ A;  4IRG A;  4ZDL A;  3ECH A;  3ULQ B;  5KNL A;  5TIS C;  5BPD A;  5LHG A;  4FX4 A;  3RKY A;  1SC7 A;  4ENK A;  2VQL A;  1SD7 A;  2GLO A;  4IF4 A;  1X58 A;  2NS8 A;  5IT3 A;  1OR7 A;  4C3J J;  3ZQ7 A;  5F1J A;  3BT9 A;  4DGW B;  3F8M A;  3KE2 A;  1OYY A;  2ZJP F;  2R0Q C;  1JJ8 C;  1U2W A;  2EFP A;  2ZNZ A;  3H5N A;  1XPX A;  2XAF A;  4KYW A;  4RM2 A;  3NRV A;  2XAS A;  5IPA A;  1DUX C;  1MJA A;  5K7F A;  1ZG1 A;  3HOW J;  4S04 A;  2R5Y A;  4ZJZ A;  1OCZ H;  3CCL I;  1EH8 A;  3RCO A;  1LB2 A;  4OIQ F;  4RLQ A;  3BZ6 A;  4BJ5 C;  4FCY A;  1QVU A;  3QOP A;  1F4K A;  1TT0 A;  2HQR A;  4F7Z A;  2DK8 A;  3I54 A;  4ZYA A;  4KMU X;  1JGG A;  5L3F A;  4XKW A;  1OYW A;  3A01 B;  3LQQ A;  3GVA A;  1WSU A;  1WZ2 A;  4CYC B;  2WY8 Q;  2HOA A;  4NDL A;  5AON A;  4CYD A;  1I50 J;  1E3H A;  4PFP A;  5H2F C;  5FKL A;  5FLV A;  3I5U A;  5FD5 A;  2PX9 A;  1IAW A;  3CC4 I;  3HRT A;  2H27 A;  5AIQ A;  2FA5 A;  1ZAR A;  1VQ5 I;  5K7H A;  3UR3 C;  3V7S A;  3OS1 A;  1H9G A;  4A3J J;  3JR9 A;  1H9T A;  3H3V K;  5K1Y A;  2HKO A;  2K27 A;  4G12 A;  2DMT A;  3IRQ A;  2VL8 A;  1YI2 I;  5LLQ A;  1MH4 A;  1Y8R B;  1P9Q C;  4Y15 A;  3CCQ I;  3KLO A;  1WRJ A;  3EUH C;  4F92 B;  3MKZ A;  2L4A A;  1IZ1 A;  5B5E C;  2N8G A;  3C2H A;  4D5C A;  1LUJ B;  3B6C A;  1YX5 A;  2PBI A;  2HTJ A;  4RBO A;  4IPA A;  1XB4 A;  4BE0 A;  3CJN A;  1AOY A;  4AC0 A;  4II2 A;  3F3X A;  2M8G X;  3VOE A;  5BQT A;  2BW3 A;  1PUF A;  2DFE A;  4OIO F;  4D0P A;  2JRT A;  3HZJ A;  3KYC B;  2IAI A;  2HEO A;  1VQ9 I;  4M71 A;  4BHC A;  3JRH A;  3GTM J;  1BA5 A;  2GBY A;  2M30 A;  3KP4 A;  3OMY A;  3SQN A; 
#chains in the Genus database with same CATH homology
 3V4G A;  3T8T A;  1TW3 A;  2ZJ2 A;  3WTV C;  2XAJ A;  2CSO A;  4KFC A;  3EDP A;  1QNT A;  2YPR A;  1G3T A;  1HW2 A;  3E6M A;  4U0Y A;  2XGX A;  1R23 A;  2HYG D;  1FYL A;  1IRG A;  3GXO A;  3TQN A;  2ISY A;  1W4M A;  3OV8 A;  1E2X A;  2HYF A;  3M8F A;  3I59 A;  2BBY A;  3K1M A;  1ZRE A;  4LLL A;  4LLG F;  3MFK A;  2M5W A;  3WGI A;  3ABT A;  2H94 A;  1ZLJ A;  4OMY A;  1W5T A;  3KEQ A;  3KP7 A;  1YFH A;  2V1U A;  3GX4 X;  4QLC U;  2W85 A;  1K6O A;  4ZYE A;  3T5X A;  1BJA A;  4CGZ A;  2A68 F;  3ZMZ A;  2KRF A;  1B4A A;  1P4A A;  2L4M A;  4U88 A;  2Q0O A;  3DFG A;  3E97 A;  1FNN A;  3ROU A;  2OU2 A;  2P7C B;  2ZFW A;  1FBQ A;  3FF5 A;  2P6T A;  2M8E A;  4O3M A;  3IKT A;  1XGN A;  1T98 A;  4LJZ F;  4EGY A;  1UST A;  2M1B A;  3HUG A;  2K86 A;  3VB2 A;  1SAX A;  3FMQ A;  1J9I A;  1S8N A;  1XSX A;  3V8J A;  2XKP A;  3Q5F A;  5DCM B;  5EEG A;  2HDC A;  1KU2 A;  2L3D A;  4M9S A;  2X0L A;  4G6Q A;  2VC0 A;  1BN5 A;  1G6N A;  4WWC A;  4P5O A;  5JI6 A;  1IF1 A;  4G7H F;  3DV8 A;  5D8L B;  4XBF A;  2PEX A;  5L3G A;  1W7P B;  4LMY A;  1SMT A;  2PLY A;  1Q1H A;  3WE3 A;  5D5V B;  3DF8 A;  5L3B A;  1P92 A;  4KIG A;  3FMR A;  3FXU A;  2IRF G;  1G3W A;  3ZN0 A;  3HYI A;  4O6J A;  5HLH A;  1Y0U A;  1WWX A;  1KQ9 A;  2K02 A;  3DPT A;  4OMZ A;  3C3W A;  4KDP A;  5ED4 A;  1XGS A;  3LA3 A;  1BI0 A;  3LST A;  3LWF A;  3B02 A;  3AAF A;  4I09 A;  1ZGJ A;  2JSC A;  1DPR A;  4ETS A;  2XRN A;  4A12 A;  3JAM Z;  3NQO A;  4ENN A;  1LDD A;  2O3F A;  3IRR A;  5L3C A;  1BI2 A;  1BOA A;  4MEY F;  2KKO A;  2EWN A;  2Y48 A;  3V7C A;  3R0J A;  2FBH A;  3IKV A;  5CJ9 A;  2Z33 A;  3V8L A;  4M9X A;  3J80 K;  1LEB A;  2LSO A;  2EFQ A;  1CF7 B;  3ELK A;  1VTN C;  2OZ6 A;  5DCM A;  1BBY A;  1XDS A;  4CO8 A;  3HHH A;  2P5L C;  2E7W A;  5D5U B;  2DTR A;  3L00 A;  4Y17 A;  5LRS A;  3TDU C;  1BM9 A;  2V6C A;  2PQ8 A;  5D6F A;  3RYR A;  4LK1 F;  3QAH A;  5H6Q A;  2XVC A;  1T0F A;  3ISP A;  2VE9 A;  3RPU A;  4FX0 A;  4PDK A;  2STT A;  4FT8 A;  1HXD A;  1OYI A;  4LGW A;  3KCC A;  4OIN F;  4HX4 A;  4LLN A;  2BGC A;  2PG4 A;  3KZY A;  4EJV A;  4L0Z B;  4Q5S F;  3CUQ A;  2QEN A;  1KU3 A;  1L3L A;  2OA4 A;  5IT9 K;  2FE3 A;  5D4S A;  2Z3Y A;  2RNJ A;  2IA2 A;  4JBA A;  3LA2 A;  3P7N A;  2ZXJ A;  3I71 A;  2Z5U A;  5A2Q K;  3RDI A;  4MNU A;  2A6H F;  1XGM A;  1FYK A;  3K1P A;  4B8X A;  4BAY A;  3KLN A;  2GQQ A;  2J5O A;  1P2F A;  4M9Z A;  2QQB A;  5E18 F;  4BXU A;  3TDZ C;  2MA3 A;  3WE2 A;  1JXS A;  1AWC A;  3EQL F;  4RB1 A;  2GXG A;  5ERI A;  4OOI A;  3KP6 A;  4HV5 A;  5FB2 A;  2A07 F;  2BV6 A;  1KU9 A;  3P9K A;  3RKW A;  3SZP A;  4I2O A;  2OAZ A;  4EMS A;  2M87 A;  2A61 A;  5L3D A;  4MQV A;  2NRA C;  5HVQ C;  2CW0 F;  1FLI A;  1PDN C;  1P4X A;  3WOD F;  1U8R A;  1GXQ A;  3WTW C;  4IHS A;  2VBY A;  1ZLK A;  4N9I A;  4L5J A;  3GUD A;  2DO7 A;  4N9H A;  2G9W A;  3M9A A;  5LGN A;  5F64 A;  5AIP A;  1I5Z A;  3L09 A;  3BY6 A;  4G94 A;  2XHK A;  1XCB A;  4M6X A;  2VON A;  4HF1 A;  3I53 A;  2NNN A;  5BMZ A;  2MD5 A;  5LHH A;  1YTY A;  4B09 A;  2GAU A;  3RI4 A;  2L02 A;  3TKY A;  2KIU A;  2DT5 A;  4HAM A;  2E1C A;  2PMU A;  1KGS A;  4P96 A;  2MBF A;  1J5Y A;  1U5T C;  4UNO A;  1FX7 A;  1UHW A;  1BC7 C;  1ZH5 A;  1FOK A;  1I6X A;  1T39 A;  1HW5 A;  5TRD A;  3GWZ A;  4QWQ A;  2QVO A;  4LG0 B;  5E8I A;  3MQ0 A;  3JTG A;  1C0W A;  2K4B A;  2OD5 A;  3BP8 A;  4I01 A;  2EB7 A;  4OIR F;  2QQA A;  1G4D A;  3TOA A;  2NS0 A;  3QP5 A;  2A6E F;  4A2U A;  1MGT A;  1KU7 A;  4M73 A;  1J59 A;  2LDU A;  2VE8 A;  2EFO A;  2F5C A;  3HRS A;  2GIV A;  5FO5 A;  1U78 A;  5CVU A;  1F9N A;  3H92 A;  2ZME B;  3D0S A;  2ZO4 A;  1YQA A;  2FRH A;  3F72 A;  4HLX A;  3LAP A;  3N4M A;  3C1D A;  2EK5 A;  5LGU A;  2D1H A;  3CLO A;  4R79 A;  3WTS C;  4ZYD A;  5F1R A;  3GFL A;  5D4R A;  1XSV A;  2A3S A;  3EUH A;  3Q9V A;  1F1Z A;  3T1B A;  5D5X B;  3DEU A;  2VBX A;  5BPI A;  3GO5 A;  4WXD A;  4RB3 C;  2ZBK A;  1LVA A;  4BH9 A;  4ZZD A;  1L0O C;  2H09 A;  5E8G A;  1ONV A;  2FEZ A;  4ENM A;  3F22 A;  1Z7U A;  1E17 A;  4R1H A;  3E5U A;  4KIC A;  3RKX A;  1S29 A;  3GLX A;  4L18 B;  1P6R A;  5ILU A;  3F8C A;  5BOX A;  3HIF A;  1LQ1 A;  2DQR A;  2HKX A;  3REO A;  2V79 A;  1FWZ A;  1ZRF A;  1R5G A;  2ZME A;  4EJT A;  1R1T A;  4RGX A;  3E5Q A;  5HOO A;  5DDG A;  1R22 A;  1LNW A;  3M7G A;  3JTH A;  3DPL C;  3WU0 A;  2FF4 A;  1YW9 A;  2RDP A;  3U1D A;  4YFK F;  1IN7 A;  2ZNY A;  1H0M A;  2F2E A;  1YG2 A;  1QBJ A;  3T0Y A;  1YW8 A;  2WV0 A;  3IWZ A;  2CYY A;  3GW2 A;  2RC4 A;  1OMI A;  5KVR A;  4KN4 X;  4PGH A;  2HWV A;  2XAG A;  5D6E A;  1I1S A;  1MZB A;  4RGS A;  3TO7 A;  1J2X A;  2QYO A;  3U2R A;  2KJB A;  5LEK A;  4LD5 A;  5HS7 A;  2K4J A;  1S6L A;  1FP2 A;  1ZGA A;  2VOD A;  1O3Q A;  4A0Y A;  4KIF A;  3GFJ A;  2HQN A;  2PJP A;  4EVI A;  4MTD A;  4E70 A;  1TBX A;  2MH9 A;  1KQ8 A;  4KNY A;  1SMY F;  4M6Y A;  3BPX A;  2XRO A;  1TQM A;  4RAZ A;  2DQL A;  1FSE A;  2O61 A;  3W6K B;  3GZ6 A;  3ZMV A;  2ESH A;  2W25 A;  4CZZ A;  2STW A;  4HW0 A;  4YG2 F;  1R36 A;  4HX8 A;  3GYH X;  1EV7 A;  5JFR A;  4WXH A;  1NHA A;  3B73 A;  3IHU A;  2QZ8 A;  4EJO A;  5D5W B;  2A5Y B;  3T8R A;  4G7Z F;  5E20 A;  2VN2 A;  3WU1 B;  4TV7 A;  3FXQ A;  2FML A;  2Q8K A;  3LFK A;  1BIB A;  4O5V A;  3MWM A;  4L0Y B;  4H0E A;  3QPH A;  1ZRD A;  4EM0 B;  1HST A;  3FX3 A;  2FNA A;  2QLZ A;  2MC3 A;  4YII A;  5LBQ A;  4WCG A;  2HTS A;  3JW4 A;  3HTS B;  4AIH A;  2D2W A;  1TLH B;  4P55 A;  2ISZ A;  1QZY A;  2RVC A;  4DQ2 A;  4BHP A;  1O7F A;  4EQQ A;  1KYW A;  3MAJ A;  1XN7 A;  1HQC A;  4HV6 A;  4Q4Z F;  1GVJ A;  2XAH A;  3JSP A;  1FC3 A;  3EET A;  4Q47 A;  3R6S A;  4IRI A;  2W24 A;  4IRH A;  2VBW A;  2XKO A;  2A69 F;  1B59 A;  4HOB A;  3WTX C;  4P9F A;  1PP8 F;  3BDD A;  4NHJ A;  1XCV A;  2NAZ A;  1YS7 A;  2FOK A;  1EH6 A;  1XD7 A;  2UWM A;  2IA1 A;  5LEJ A;  4WF2 A;  2DFI A;  2LF8 A;  5DUI A;  1FT9 A;  2DU9 A;  5HLG A;  1ULY A;  3RYP A;  3R0A A;  4AVP A;  2P5V A;  2J5P A;  2B0L A;  3GZ5 A;  1SFX A;  4PCQ A;  4LK0 F;  3WTT C;  4HLY A;  1W7P A;  3MZH A;  3FZV A;  2D45 A;  5L3E A;  3KEO A;  1IN5 A;  2GWR A;  4ASN A;  2AXL A;  4XLN F;  2DLL A;  3WTZ A;  1I27 A;  3EYY A;  4HZF A;  3R61 A;  3DKW A;  2WTE A;  3KP2 A;  3F23 A;  2FBK A;  4CDG A;  1U5T B;  1STZ A;  1FP1 D;  3TO9 A;  1BI1 A;  4PZJ A;  4YFN F;  4ENJ A;  2O0Y A;  4CXF A;  4OIP F;  4KT5 C;  3HOS A;  2R3S A;  4KMF A;  2TDX A;  2JT1 A;  4RB2 C;  1T6S A;  2ADU A;  1DPU A;  4ESB A;  3TGN A;  4UUV A;  3E6B A;  4MGR A;  3NEU A;  2BEO A;  2YU3 A;  1CF7 A;  5E1X A;  2F5E A;  3BJ6 A;  2QBY B;  2FMY A;  1R00 A;  2GA2 A;  2RN7 A;  1F5T A;  3ZMD A;  3P9C A;  2G7U A;  1HKQ A;  3E5X A;  2Q2E A;  4GYI A;  1SD6 A;  1QPM A;  4L9T A;  4ZYG A;  2GXB A;  4EV0 A;  3I0T A;  2HOE A;  4I02 A;  1K7A A;  4FHT A;  2CWE A;  5CYV A;  4BNC A;  4XSZ F;  5K5Q A;  3HRM A;  5CVJ A;  4ZYH A;  2IT0 A;  5A2Q Z;  3BJO A;  3E6C C;  3MCZ A;  3S2W A;  3F21 A;  4WK8 F;  1O3R A;  1LEA A;  4UV8 A;  1HKS A;  2Y75 A;  1TQP A;  1U5T A;  4GGG A;  3RTR A;  3I64 A;  4I0B A;  1ZAO A;  4HF2 A;  2JPC A;  2JTV A;  3CO6 C;  2EFW A;  4K2E A;  3RPQ A;  1B6A A;  1HW1 A;  5HDG A;  1R5H A;  2LNB A;  5ICC A;  2EA4 A;  4GYG A;  1K78 B;  1YW7 A;  5FLX K;  3KFW X;  2X4H A;  2LKP A;  1O7L A;  3H3U A;  4G9Y A;  3QP6 A;  2G7H A;  1S7O A;  2XAQ A;  2QBY A;  3IC7 A;  1JHF A;  4YIF A;  3W6J B;  3GFM A;  4XSX F;  1PUE E;  1G3S A;  2VBZ A;  1GXP A;  1R58 A;  5D8K B;  4WX9 A;  2P5K A;  1ZYR F;  1IN8 A;  2C6Y A;  2BYV E;  3K9T A;  2DPD A;  2NNY A;  3O3K A;  2P7V B;  1XMA A;  2MH2 A;  2DBB A;  2R7F A;  5ILV A;  2WWY A;  1UHM A;  3VFZ A;  5DYM A;  2WC2 A;  2ZCW A;  3E3V A;  4I7H A;  2CO5 A;  1B9M A;  5JHU A;  1J75 A;  3TOB A;  1RI7 A;  2VXZ A;  1RNL A;  3BWG A;  1RUO A;  4CHU A;  3BOQ A;  3COA C;  4U0V A;  3J81 Z;  1IN6 A;  1ODD A;  3CUO A;  3LA7 A;  4JQF A;  1WQ2 A;  1BIA A;  3P9I A;  5BS6 A;  1FBS A;  4IXA A;  2OQR A;  4LB5 A;  4IVN A;  4P9U A;  1J7K A;  2EA2 A;  2YR2 A;  2IA0 A;  1D5V A;  5JR3 A;  5HS9 A;  4KIB A;  3HSR A;  3EYI A;  3ZP5 A;  1QGP A;  2ACJ A;  3WTU C;  3F8N A;  2VOO A;  1K79 A;  1FYM A;  4ESF A;  3M8E A;  1R1V A;  5ICF A;  2BE5 F;  5DUK A;  4BYY A;  3L2C A;  3QU6 A;  3FXR A;  1XGO A;  1MDM B;  4HQE A;  2O8X A;  4UV9 A;  2CGP A;  1B1B A;  1UFM A;  2R7D A;  2QQ9 A;  1ZG3 A;  2Z9O A;  1B9N A;  4LG0 A;  5HDN A;  4XRF A;  1MD0 A;  3QRF F;  1D8J A;  3RJP A;  3HHG A;  1ZN2 A;  3I59 B;  4UVA A;  3LQR A;  2HZT A;  1Z91 A;  1ZHF A;  3QPT A;  2VC1 A;  5E1Z B;  4NB5 A;  4HBL A;  4EJU A;  2PMH A;  1ZRC A;  3K0L A;  2QUF A;  3QU3 A;  2VOP A;  1XDU A;  3V7R A;  1TTY A;  1RUN A;  2Z99 A;  2OZU A;  2KIM A;  3CO7 C;  1D8K A;  4AIJ A;  4M74 A;  2OBP A;  2ESN A;  2EV0 A;  1TNT A;  4ZH4 F;  3BJA A;  1WKM A;  1G3Y A;  3MEX A;  5HLI A;  4GO1 A;  5HDK A;  2Y0M A;  3VOD A;  3PFI A;  2GZW A;  2RGV A;  4BHB A;  5CVR A;  2L01 A;  5LGT A;  2FQ3 A;  1J0R A;  1YS6 A;  4HA8 A;  1MJB A;  5DD4 A;  4AWX B;  3L9F A;  1O57 A;  2VT3 A;  4RS8 A;  4ZZL A;  1MDM A;  1RZ4 A;  4G6D A;  4I98 B;  4L9J A;  3H3Z A;  1MJ9 A;  5CLS A;  1BC8 C;  3SXY A;  1UB9 A;  5E17 F;  3M1E A;  2OQG A;  3FMS A;  3V8K A;  3F8B A;  1UCR A;  2L54 A;  3SZT A;  4U0W A;  4CIC A;  5DEQ A;  2RKH A;  1KA8 A;  1Z05 A;  3FWE A;  4EM2 A;  4A6E A;  1TW2 A;  3WGH A;  5FD6 A;  5LRR A;  3G73 A;  3GFI A;  1S3J A;  2EV5 A;  1Z9C A;  1Z6T A;  2FXA A;  2UXX A;  5LHI A;  2UZK A;  3GF2 A;  3KET A;  2XUB A;  2DW4 A;  2P8T A;  2CG4 A;  3GEZ A;  2XV4 S;  4A0Z A;  2VT2 A;  3K1N A;  1QZZ A;  2V1X A;  5FFZ A;  5JVT A;  2F5D A;  4A5M A;  4HX7 A;  3K69 A;  4RGU A;  3KP3 A;  1TQI A;  4IJA A;  4N0B A;  1HSJ A;  2EV6 A;  1W5S A;  4UVC A;  1A04 A;  1YYV A;  2D1V A;  3ECO A;  3JAM K;  1IXS B;  5KK1 A;  3JSO A;  3C7J A;  1OKR A;  2KIF A;  1KQ0 A;  1IXC A;  1IUY A;  2K7L A;  1QQI A;  4AD9 A;  5J8F A;  4S05 A;  2NYX A;  4A5N A;  2JPB A;  3F8F A;  3I4P A;  3MZY A;  3R4K A;  1Z1D A;  1S7A A;  4G7O F;  1RIO H;  4M72 A;  1JE8 A;  2O6G E;  5DCF A;  1GHC A;  5H6R A;  3E6D A;  3C18 A;  2HFH A;  4U7D A;  3SFZ A;  5EEH A;  4MHG A;  1JGS A;  3TO6 A;  1IXR C;  2FU4 A;  3CUQ B;  2F5F A;  5ICE A;  5H20 A;  4U7B A;  3CTA A;  1T2K A;  5J8C A;  2HGC A;  1USS A;  4UXN A;  1LJ9 A;  4A0X A;  1Z6R A;  2IVM A;  4LFU A;  3IL2 A;  4UHT A;  3LAJ A;  3U9G A;  4GCV A;  3PQK A;  3K2Z A;  1T38 A;  4GXO A;  5HS8 A;  3R60 A;  2M45 A;  1FZP B;  4KN7 X;  2IP2 A;  3HSF A;  4YFX F;  2YSR A;  3D5L A;  2JZY A;  4OU0 A;  4PGG A;  1SFU A;  4BQA A;  4NQW A;  5K5O A;  1D3Y A;  3J80 Z;  1IN4 A;  3F6O A;  2IJL A;  1YO5 C;  1P4W A;  5ICG A;  1IW7 F;  1KYZ A;  1O3T A;  2H6C A;  2AS5 F;  4DNC A;  4IHT A;  2IPQ X;  5DD8 A;  4Y13 A;  1IRF A;  3ZMU A;  2LF7 A;  1O3S A;  4WXC A;  1FBU A;  4HDU A;  1OPC A;  3HRU A;  4ON0 A;  1BI3 A;  5TJJ A;  1R7J A;  1V4R A;  1MKM A;  3KP5 A;  4MEX F;  2V9V A;  2E7X A;  5FGM A;  1EH7 A;  2UXN A;  4Q48 A;  4EGZ A;  2P6S A;  2PFB A;  5IT9 Z;  4EJW A;  2XIG A;  4HF0 A;  4UVB A;  2DI3 A;  4R8H A;  6PAX A;  4AIK A;  1SFE A;  3WG9 A;  2FBI A;  4RAY A;  2IW5 A;  3FHZ A;  3HTU A;  3CUQ C;  1LDK B;  3WTY C;  4RB0 A;  3BPV A;  2ZKZ A;  2YX4 A;  4L9N A;  4EM1 A;  1REP C;  4HYE A;  1JHH A;  2HR3 A;  1FY7 A;  2P4W A;  2QM3 A;  1FPQ A;  2E1N A;  5FFX A;  2MLG A;  1SD5 A;  1U6G A;  4HDV A;  3ZMS A;  1XSD A;  2O03 A;  4JK1 X;  4Z2Y A;  2DPU A;  3BRO A;  3F6V A;  1LDJ A;  5J6X A;  2MLK A;  3I58 A;  4HQM A;  5E1W A;  4LB6 B;  1CGP A;  3O2P E;  3G3Z A;  5F6F A;  2ELH A;  3OOP A;  2V1D A;  1W7P D;  2COM A;  2FSW A;  1SD4 A;  4I0A A;  3IWF A;  2QWW A;  2W84 A;  1FSH A;  3Q9S A;  1TNS A;  1YIO A;  2YX7 A;  1DP7 P;  1HKT A;  3ZPL A;  1ON1 A;  1YLF A;  3HOT A;  2EJR A;  3DQV C;  5ILS A;  2PI0 A;  3J81 K;  3VEP A;  1I1G A;  3O6B B;  1X3U A;  2GA1 A;  5CVV A;  3ZMT A;  3HSE A;  4MQ9 F;  2H6B A;  4KUM A;  5FLX Z;  1ON2 A;  1U3E M;  3RIR A;  1V3F A;  3J7A O;  1HBX G;  3PQJ A;  2DAO A;  2DK5 A;  4L5I A;  2W57 A;  3ERE D;  3ABU A;  4MTE A;  3ZN1 A;  1WI9 A;  3DXJ F;  1ZG5 A;  3ML6 A;  5DV5 A;  2HS5 A;  4A6D A;  4XLP F;  2RQP A;  1DDN A;  1R1U A;  5K5R A;  3L7W A;  4KA4 A;  3DP7 A;  2KJC A;  3WGG A;  2FNP A;  3FM5 A;  4L9V A;  1K78 A;  2PN6 A;  4G8X A;  3CDH A;  2ETH A;  3FM3 A;  2EFN A;  2CQK A;  1PP7 U;  3N97 A;  2CFX A;  4RGR A;  4ESJ A;  1XMK A;  1QO0 D;  2RV8 A;  5CVI A;  3KZZ A;  4IRG A;  3ECH A;  3ULQ B;  5BPD A;  5LHG A;  4FX4 A;  3RKY A;  4ENK A;  1SD7 A;  4IF4 A;  5IT3 A;  1OR7 A;  3ZQ7 A;  3F8M A;  3KE2 A;  1OYY A;  1U2W A;  2EFP A;  2ZNZ A;  2XAF A;  4KYW A;  3NRV A;  2XAS A;  1DUX C;  1MJA A;  1ZG1 A;  4S04 A;  1EH8 A;  1LB2 A;  4OIQ F;  3BZ6 A;  3QOP A;  1F4K A;  4F7Z A;  2HQR A;  2DK8 A;  3I54 A;  4KMU X;  5L3F A;  1OYW A;  3LQQ A;  3GVA A;  1WSU A;  5AON A;  4CYD A;  3I5U A;  5FD5 A;  1IAW A;  3HRT A;  2H27 A;  5AIQ A;  2FA5 A;  1ZAR A;  3V7S A;  1H9G A;  1H9T A;  5K1Y A;  2HKO A;  2K27 A;  3IRQ A;  5LLQ A;  4Y15 A;  3KLO A;  1WRJ A;  2L4A A;  1IZ1 A;  2PBI A;  2HTJ A;  4IPA A;  1XB4 A;  3CJN A;  1AOY A;  3F3X A;  3VOE A;  5BQT A;  2M30 A;  4OIO F;  4D0P A;  2JRT A;  2HEO A;  4M71 A;  4BHC A;  3SHF A;  3KP4 A;  3SQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...