4EEFG

Crystal structure of the designed inhibitor protein f-hb80.4 in complex with the 1918 influenza virus hemagglutinin.
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
45
structure length
45
Chain Sequence
PWKFSENIAFEIALSFTNKDTPDRWKKVAQYVKGRTPEEVKKHYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Optimization of affinity, specificity and function of designed influenza inhibitors using deep sequencing.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Immune system/inhibitor
molecule keywords Hemagglutinin HA1 chain
total genus 4
structure length 45
sequence length 45
chains with identical sequence H, I
ec nomenclature
pdb deposition date 2012-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4eefG00
5J1UA 1HF0A 5F08A 3PO3J 1UHSA 2DTZA 3JRFA 2DA3A 2COBA 1MBKA 1T56A 2R5YA 3BR0A 3RKQA 2YUSA 2JN6A 1MBFA 2LP0A 4W97A 1BA5A 1UG2A 1WH7A 2HI3A 1AKHA 1QVTA 3H0GJ 4M3GA 2VKVA 5E3NA 5FKNA 3L1PA 3W6VA 2E19A 1RR7A 3BR5A 3LSRA 2XRLA 4DW6A 1A5JA 5EGOA 2VI6A 1O4XA 1MBHA 1IUFA 1WI3A 3ZQCA 2NVQJ 2E2HJ 3G1LA 5FKKA 1R9TJ 2VUMJ 2O9LA 2Y0SN 4D5FA 4UUSA 4JX5A 2FQ4A 3SFIA 4QSHA 5FJ8J 5EG0B 3Q0UA 3JRDA 1BW5A 2XPWA 2DA4A 4A3KJ 2GLOA 3HOUJ 3GTMJ 5JLXA 2XPUA 3UKGA 3E7LA 1VI0A 1RETA 3S1NJ 4A3CJ 2R5YB 2K9QA 1VFCA 3RQIA 5EG0A 2TCTA 1JUSA 3K2AA 2CUFA 2YU9J 2ME0A 3A02A 3F0CA 1ETOA 1P7IA 2DJNA 1WPKA 2X9DA 2NVTJ 3S15J 3GTPJ 1ETKA 4HNVA 1ETWA 4XRSA 5C44J 2O7OA 2XGDA 1W0TA 1UMQA 1IGNA 2X48A 5HODA 3B6AA 2CUEA 3TEDA 5E3OA 1JUPA 1TWGJ 4D7NA 5E3LA 2JA5J 9ANTA 4BY1J 3BR6A 3HBLA 3FK7A 4DYRA 5FKMA 2DA5A 2LY9A 3B6CA 1LFBA 1H89C 3ZQLA 5F0CA 5EDNA 2ELKA 2E2IJ 3Q3SA 3S2HJ 3FIWA 1AHDP 3LSGA 2YS9A 1QRYA 5JLWA 1MSFC 2PMZN 4S0HB 5M3MJ 4IHYA 2LFBA 3BQYA 2R5ZA 1P7JA 3PO2J 4MIMA 3QPSA 1CQTA 3HOZJ 2HQ5A 2R0QC 1LE8B 4XRMA 1AKHB 1Q1VA 1ZK8A 2MSYA 4RBOA 3OOUA 4JX6A 3HKZN 5F0HA 3K7AJ 2DA7A 2EZLA 3LOCA 1FTZA 2CQQA 3S17J 3GTGJ 4UUTA 3IH3A 2P81A 2LKXA 3I4NJ 2CU7A 5IOYA 1U78A 1XG1A 1W0UA 4AC0A 2CQXA 3BTJA 2Y2ZA 3HDDA 1MBEA 2L7FP 1ENHA 3RZOJ 2K9NA 2JMWA 5E3MA 3OSGA 1U8BA 1FTTA 3HM5A 2FJ1A 3LSPA 4CYCB 2GM4A 3JREA 2K40A 2NOGA 1I3QJ 3S1RJ 1IJWC 3WHCA 1TWHJ 3DEWA 1YRNB 3I4MJ 2D5VA 3BQZA 4B1RA 2HXOA 5EYRA 4QIWN 2JA6J 4W1UA 3ZQGA 1I50J 1DU6A 2XB0X 3ZQHA 5M3FJ 4LOCA 3HOVJ 5FLMJ 1F36A 3TW6A 4A3MJ 3Q0WA 5J1YA 3GTLJ 1JKRC 2EH3A 4I6ZA 5DTDA 5IP6A 4NDLA 2R93J 4FCYA 1X2NA 2DA1A 4A93J 1S7EA 1BL0A 2Y9YA 4FISA 4X1EA 1BJZA 1RESA 5GPCA 2IEKA 2XB5A 2JA8J 1ETYA 1SFOJ 4MFEA 2JA7J 1JT0A 2TRTA 3SDGA 2XPVA 1MBGA 1PUFA 1B8IA 5IP7J 3DCFA 3HOXJ 1FJLA 2AO9A 2NS7A 1RPWA 1XC5A 4X6AJ 2LD5A 3CMYA 4A3LJ 2NVXJ 1QPIA 3TW7A 4Y52J 2X6OA 1TWFJ 1BW6A 2MW8A 5IYCJ 3HOWJ 4D7MA 3NAUA 1GT0C 2DMTA 1H8AC 2HYJA 3JRGA 3FISA 1A6IA 3SJMA 1RKWA 2L7MP 1ETQA 1B72A 5BNGA 1VNDA 3BR2A 3GTKJ 2L9RA 2HOSA 3HGYA 5FLVA 2EQRA 1WCMJ 2KDZA 5GPAA 1IRZA 1MBJA 1ETVA 1JUMA 4A3FJ 3LSJA 1JKPC 1ITYA 1JTYA 2LLKA 1HLVA 2ID3A 3JRAA 1QVUA 1ZGWA 1SANA 3BTCA 2XSDC 2JWTA 4GFBA 3FKIJ 3LNQA 4B3AA 1HOMA 2KT0A 4ABZA 4A3JJ 2M0CA 4C3HJ 3M4OJ 4XRSG 2VKEA 4G12A 4BXXJ 2WAQN 1NTCA 3VPRA 2M9HA 1OCTC 2H1KA 3CQZJ 2HXIA 2L0KA 1JJ6C 1H88C 3HEFA 1JJ8C 3MN2A 4JX4A 1LFUP 2HOTA 4QTRA 2R92J 1X58A 3CDLA 5FKLA 2JJ7A 4M3BA 3HGGA 3JRIA 3G1MA 3A01B 2R7ZJ 3QPLA 4A69C 5M5WJ 1RKTA 5IOZA 4DYQA 2LR8A 3BG3A 4AUXA 1ORKA 2FX0A 3BG9A 2IBDA 3C2BA 1WH5A 4BBSJ 5F04A 2EZHA 4A3GJ 2ECCA 1MNMC 1B72B 2LTPA 2VPRA 1GV2A 3MKLA 4C2MJ 4BKXA 5M5YJ 4XIDA 4M3DA 4C3JJ 2DMUA 4RDUA 5EZGA 1OCPA 2CJJA 4L5EA 1ZKGA 4A3BJ 2NS8A 3A01A 1JKOC 1DU0A 4J19A 1HDPA 3GTJJ 1JT6A 5IYBJ 4MLOA 1K83J 4IHWA 4A3IJ 3ZQIA 4I76A 2MG4A 2DA6A 2O8KA 4BBRJ 5GP9A 3D1NI 2I10A 3BTLA 3OSFA 1LE8A 1GV5A 1MSEC 1X2MA 1PUFB 2ID6A 1GUUA 4M6VA 2WB1N 3JRCA 2IAIA 1FIAA 1IDYA 2OPTA 1E3OC 1NK2P 1FEXA 4C3IJ 1EF4A 1Z0XA 1AU7A 3H3VK 2DA2A 2CRGA 3BG5A 5IYDJ 4FTHA 2M8GX 2WV1A 4IEJA 1FIPA 1ZR2A 3MVPA 1K61A 1OFCX 2EBIA 4XICA 1TWCJ 1VF9A 2QCOA 4FE7A 1NK3P 5EZHA 2MGQA 2GBYA 1ZQ3P 4JP0A 5K7ZA 2K9SA 2L7ZA 3FK6A 4EEFG 1ETXA 1HDDC 5J3LA 1GVDA 3ZQFA 3RZDJ 2XGCA 1U9NA 4V2GA 2E1OA 5K7HA 2JK3A 1ZR4A 3IV5A 2ZB9A 3JRBA 2EZKA 1Y1VJ 4M3EA 5K7FA 3PM1A 1IC8A 1F43A 1Z77A 5F1JA 4Y7NJ 3BR1A 3O8HA 1WGXA 2ECBA 4FE4A 4B4CA 3S14J 1TC3C 3JR9A 3GTQJ 1IG7A 4XK4A 1B8IB 3O8GA 3JRHA 2H8RA 1MH4A 5FKOA 1XS9A 2Y30A 4DZPA 2ME6A 5F27A 3QQAA 2G0EA 5EEAA 3M3YJ 2AHQA 2Y9ZA 5M5XJ 2LK2A 1Y1WJ 1HCRA 3S1MJ 3S2DJ 2FD5A 3CCYA 4DYCA 3A03A 1IDZA 3TP0A 4CYCA 1GDTA 2HOAA 1JGGA 3WHBA 3Q0VA 1TWAJ 4A3EJ 3HB9A 2DMQA 2M34A 5J1RA 5EF6A 2R5ZB 4M3FA 2NVYJ 2DMNA 1D5YA 2B63J 4D5CA 3NARA 1POGA 5EGOB 3G1OA 4V2FA 4IHVA 3S16J 2E2JJ 3GBGA 1U9OA 1APLC 1T33A 5C3EJ 2DMPA 5DS9A 2DN0A 4DZJA 1JTXA 3IH2A 3TP3A 1YRNA 3IH4A 5C4JJ 2OF7A 1MH3A 4AYBN 3BTIA 3OIOA 4BY7J 2QF7A 3BR3A 3GTOJ 1G2HA 5F0FA 5IP9J 5C4XJ 2N8GA 1ZTRA 2Y31A 4MO7A 2EZIA 2RAEA 4MFDA 3HOYJ 2M2EA 3S1QJ 2XGEA 3BT9A 2HDDA 4A3DJ 4UUSB 2LVSA 4IHXA 1OJLA 2W48A 3ZOBA 4JYKA 5IPAA 1JKQC 1IV6A 1I6HJ
chains in the Genus database with same CATH superfamily
2FBKA 1HF0A 2V9VA 4P9UA 4EM1A 4ZZLA 4CYDA 4ZTJA 1SC7A 4HA8A 3RKQA 2YUSA 2JN6A 2LP0A 3KZYA 2GXAA 3H3ZA 4XOTA 1BA5A 1YTYA 1MMDA 3FZVA 1WH7A 1XSXA 1MZBA 3CC7I 1AKHA 2W82A 3H9QA 3H0GJ 3TDZC 3K70C 2QQAA 4M3GA 2PX9A 2R4GA 4Y3OA 5FKNA 5HDNA 2XAHA 1RR7A 2M8EA 4XLAA 1HQCA 2O5RA 2XRLA 3OR2C 1WVRA 2HZDA 3GLLA 3S3NA 2QSHX 5EGOA 2VI6A 2EFPA 2J5PA 2WWYA 4HLXA 2JUGA 1Z3XA 3I58A 2E7WA 4KIFA 2HEOA 3OV8A 2Z9OA 4ENKA 5A2QZ 1YO5C 3G1LA 5FKKA 2E2HJ 4D5FA 2DJIA 4UUSA 1FY7A 4JX5A 3M9AA 4XRFA 5KHDA 1VTNC 3LSIA 1BW5A 2GLOA 1R36A 3G6EI 2E71A 2WY7Q 4D0PA 3J7YJ 3NWTA 4BEHB 3UKGA 2EIJH 3I4PA 4Y17A 5HLIA 3IRQA 2VXDA 1TQPA 5ILSA 1W7PA 3CJQB 4IPAA 4HF1A 5A2QK 2QBYA 1FYLA 1PDNC 4LG0A 2HS5A 2ME0A 1Z7UA 5TRDA 2IGKA 2K4BA 4G9YA 4XLPF 2VQLA 5H6QA 1WPKA 1S72I 3K4JA 2NVTJ 3S15J 1T98A 3GXOA 2QSFX 3CLQA 4ON0A 1IN7A 4G8XA 2BVMA 1ETWA 5ICGA 2QSGX 5B1AH 2BYVE 2EWNA 5HODA 3B6AA 4FQGA 5EJCA 2DT7B 2LBFA 3VDXA 1TWGJ 5ICCA 3PIPF 2ZKZA 4G7OF 2LH9A 3RYRA 4XM3A 3BR6A 3W3CA 3FK7A 1ZRFA 4KICA 5FKMA 3OOPA 2NVUB 5F0CA 2D1HA 1BBYA 2ELKA 1OYWA 1OYYA 1NG7A 2IW5A 3LSGA 5JLWA 3G71I 2PMZN 4AIJA 2BY0A 3SHFA 3OYLA 4RB0A 1HA8A 5DDGA 1MKMA 2OD5A 3HOZJ 2M87A 2R0QC 3ABMH 1MMSA 4RGUA 3H92A 1X1CA 1Q1VA 1B9MA 3CCJI 3OOUA 2EFNA 3H5RA 2UXNA 2E36A 2DA7A 4I98B 1S5LC 3I71A 1J5YA 2CQQA 3DKYA 3LL7A 1ULYA 4UUTA 5AIPA 5JHUA 2OTJI 1YE9A 2EINH 5KNLA 4RGRA 5DD4A 1ZAOA 1O3QA 5D6EA 1QHHD 2HVQA 4AC0A 5L3DA 2KL4A 5CQEA 2EV0A 3JTGA 2DK5A 2LNBA 3GFLA 3K1MA 1HC8A 2WAQA 1P92A 4EGZA 3BZKA 2Z16A 2VQGA 3WG9A 5GAGJ 4EMSA 1V55H 1SD7A 2BHYA 3DU6A 5LGNA 2A68F 1HW1A 2Y48A 4ENMA 2R7VA 3JCUC 2K40A 2NOGA 5GTIC 2VPLA 4OIOF 5FFXA 4QLCU 4FETA 3VWBA 3DEWA 4A12A 1IXCA 4XMYA 2HVRA 5EYRA 3QOPA 4QIWN 4XKCA 2R7DA 1ZH5A 3ZQHA 2L4AA 1WJEA 3IWZA 4A3MJ 1KYWA 4BJ6C 3KP7A 2QZ8A 2H6BA 5J1YA 1LEBA 1DGWY 1E17A 1KU7A 1Y56A 2I5UA 3H3UA 1TNSA 2JA2A 2R93J 4LLLA 3PSFA 2PLYA 2Y9YA 4X1EA 1JHFA 3VOEA 5HNFA 2IEKA 1VQ4I 4A0YA 2DDBA 3OWTA 1J0RA 1EH8A 4DBRA 1VQPI 1SFOJ 1JT0A 2TRTA 1ODDA 1X4PA 1Z05A 1TLHB 2CW8A 2HYGD 1MBGA 4BE0A 1IO2A 2LDUA 1K6OA 2P7CB 2XKPA 4LMYA 3WU1B 3DCFA 4LITA 2ZFWA 3HOXJ 1RPWA 2RDPA 4X6AJ 3ERED 1FPQA 2NVXJ 1ZYRF 3TW7A 1QPIA 4ZH4F 3E5QA 1TWFJ 3J80Z 2F5EA 1H0MA 1V4RA 3HOWJ 2R7SA 4HNUA 2EILH 3KEQA 1MW7A 3SFZA 4EM0B 3JRGA 2IS4A 4U87A 5JR3A 2L7MP 5BNGA 4B8XA 4U7BA 2H27A 1U2WA 1D1BA 3BR2A 3ML6A 3ASOH 3DKWA 2B0LA 4WX9A 2NYXA 2FSWA 2IP2A 2EB7A 4OU0A 2QQ9A 3JW4A 1IRZA 4CCLA 3I54A 1ETVA 1NG6A 4NNJA 4YIIA 2ZJ2A 1JKPC 1JTYA 1HLVA 2P5VA 3JRAA 3F3XA 1HXDA 1VQLI 4GFBA 2GIZA 1WRJA 2A69F 3FKIJ 3I0TA 2FNPA 4U7DA 4A3JJ 2Z3YA 4EJWA 3U1DA 3KX2A 2CFXA 1NTCA 2NAZA 3D0SA 3E0JB 1YIJI 1F4KA 4BNCA 3CQZJ 1AOYA 3OR1C 3WGGA 2GA2A 4XN0A 4A5MA 1PYVA 1PVEA 3HEFA 3RIRA 5TGTA 5GAHJ 5E17F 2E5NA 1LFUP 2HOTA 3OYMA 1FLIA 1X58A 3CDLA 4P9FA 4M3BA 4R8HA 3HGGA 1IN8A 2DK8A 3K1NA 2VONA 2R7ZJ 3DEUA 4GRIA 4CCNA 3WTUC 1TNTA 3S32A 1SFKA 3IRRA 2MH9A 4G7ZF 2G7HA 1WI9A 4N4NB 1ORKA 3K2ZA 3BG9A 2ZMEA 1O7LA 3A0BC 1G59A 4HV6A 1BR1A 3CP8A 2H8WA 4GYIA 4KMUX 1Y0NA 4A3GJ 2L2OA 2A5WA 1R4NB 1XN7A 3TQNA 1MJ9A 3MKLA 2EV6A 3RDIA 4C2MJ 2R7TA 2W4SA 2AQEA 1TW2A 4C3JJ 1K6YA 1J75A 2KRCA 3PSIA 1S3JA 3RKXA 1X1DA 4AIHA 1QO0D 2Y75A 1W5TA 3MKZA 1ZKGA 1YHQI 1FOYA 2V9PA 4M73A 2HQNA 3A01A 1DU0A 1Y39A 1QNTA 3GTJJ 1JT6A 4MLOA 1ZHFA 3ELKA 4FT8A 1O3SA 5LD2C 1WWXA 4PGGA 2DA6A 4PFPA 3BG6A 4LJZF 3CCVI 1GV5A 1ZGJA 1MDMB 2LRDA 3V7CA 5J4VA 2W00A 2L5QA 3OYHA 4M6VA 4BQAA 1WFXA 5BQTA 1C0WA 1RC9A 1WJBA 3K6GA 1FIAA 3QP6A 5CKTA 2QKLB 5HDKA 2CG4A 4CA0A 4DNCA 4ESBA 3RQ4A 4IHSA 2DA2A 3DLAA 2HDCA 2CSOA 1S8NA 5IYDJ 3K4MA 4IEJA 1KA8A 3E97A 1K61A 2EV5A 2CFOA 3CJTB 2P0WA 2PEXA 4ZTFA 1VF9A 3MCZA 4XLCA 4AIDA 3OIQA 4HF0A 2GIVA 1W7PB 1UJ8A 2MGQA 3DXJF 2A3SA 3QYFA 2GBYA 2KZGA 2O61A 4H0EA 2E7XA 2K7LA 5K7ZA 2K9SA 3FK6A 2ESNA 4IQJA 3WG7H 2VBWA 3JTHA 2RNGA 1IW7F 3RZDJ 2XGCA 3K70D 4M6YA 2QWWA 2JSPA 3JRBA 3REOA 2EZKA 1BC8C 5E18F 1VZ0A 2CV0A 2GXBA 1U0JA 4DQ2A 4I99C 3QPTA 5TJJA 1YQAA 2X1CA 1TC3C 1XGOA 1IG7A 2IGNA 1B8IB 1FMVA 3BCBA 3RKYA 2VIXA 3WTTC 2HPMA 4GYGA 1A36A 4CUGA 3S3OA 1R1VA 2G0EA 2E1NA 4BHBA 2L54A 3S93A 5M5XJ 2LK2A 3L00A 4CXFA 1IDZA 3TP0A 4CYCA 4RGXA 2F2EA 3WHBA 1OLTA 3O2PE 4IX7A 1X1PA 2DMQA 2Z2SB 1XCVA 2DMNA 4MQVA 4D5CA 2BEOA 3E5XA 3PNYA 2V1UA 2FUG2 4V2FA 4IHVA 2JUCA 1QZEA 3S16J 2E2JJ 1X3UA 3GBGA 4ITVA 3DTIA 4BL0B 1T33A 4HYEA 5C3EJ 1LQ1A 1FZPB 1KU2A 4PJNA 5L3FA 1RUOA 2DN0A 1OMIA 3F72A 3F8BA 2ZJPF 5IY5H 3Q9SA 4AYBN 1O7FA 4DBQA 5J8FA 2Y0SA 3VSKA 4UVAA 3GO5A 5CYVA 3I56I 2ZXJA 2CYYA 5F0FA 2OBPA 1G2HA 4XSXF 5IP9J 5C4XJ 3FBIB 1ZTRA 2KRFA 2IGMA 4OIPF 4XSZF 5HS7A 2VT2A 5JI6A 5H6RA 2XC7A 3S1QJ 3ZN1A 2PMUA 3AKZA 4UUSB 2QENA 3CD6I 2MH2A 1TZLA 3ZOBA 1ZRDA 1I1SA 2VLAA 2GA1A 5IPAA 3K0LA 3LSKA 4G6DA 5F08A 4MEYF 2COBA 3AG3H 4QPOA 2R5YA 2KIUA 5LGUA 3BR0A 2NXNB 4W97A 3OYIA 4KISA 4RB2C 3VEPA 3L2RA 5DCMB 4ZDPA 4PSXA 1FOXA 1PP8F 3HXLA 1QVTA 4CZZA 5ICEA 3K4LA 2R3SA 3HTSB 4L9NA 1U3EM 4RMNA 1T0FA 1OKRA 1GXQA 2VOPA 3LSRA 5L3EA 1EJ9A 4UUVA 5HNHA 1MGTA 2FBHA 4F7ZA 4LG0B 5FO5A 3HL2A 2VE8A 1Z9CA 2LF8A 1JGSA 4BH9A 2PJRA 4F3QA 1RI7A 4L5IA 3L9FA 5K5OA 2HYFA 2Y0SN 1K4TA 2NNNA 2QEXI 2O9LA 3F6OA 1LNWA 2FQ4A 3SFIA 3DKXA 5FD6A 3T5XA 4PFOA 1I1GA 4PJJA 5FJ8J 5CVIA 4AIKA 3K4CA 4L9JA 2XPWA 2JVHA 2K3FA 2YR2A 4M71A 5L3BA 4A3KJ 3TL4X 5K1YA 3GTMJ 2XPUA 2BGCA 3KE2A 2YSRA 1DDNA 1MMAA 1VI0A 3S1NJ 2IS6A 2K9QA 4UV8A 1B6AA 1VFCA 1TTYA 1UG0A 1D3YA 3RPUD 3IKVA 2IVMA 3WGIA 1Y8QB 3ZXSA 3F0CA 4D9JA 3M8EA 3R4KA 4BACA 2EPFA 3KYDB 1T2KA 1J9IA 1XGSA 2A05A 2KP6A 3W2WA 1FYMA 4JBAA 3J7AY 2HKXA 4ENNA 4HPQA 3HOTA 2CV1A 2H6CA 5ILUA 5C44J 2PBIA 2D45A 3BZCA 2O7OA 3H35A 1UMQA 1S9HA 1PUEE 2XAUA 2KRHA 4CH7A 3R0AA 2R7UA 2QQBA 1VQOI 2CQNA 2CUEA 3TEDA 5E3OA 2KJBA 1UCRA 4D7NA 1S7AA 2AXTC 2D2WA 4IOAF 4LIVA 1T95A 2KQRA 2LY1A 3HBLA 2P6SA 1LFBA 1H89C 3OMYA 1SAUA 2LREA 1VQNI 3EUHC 3ZQLA 4C2TA 2VXZA 4AVPA 3FIWA 4RB1A 4KT5C 2DPDA 2X51A 2M0MA 3W6KB 3PL8A 4XLNF 2DOEA 1O3TA 4XL9A 4S0HB 5BPIA 3U9GA 3BQYA 3KIOA 2HGCA 3K9TA 4H4KC 1ZGAA 3QODA 2IGOA 1FYKA 2M45A 2M7BA 1CQTA 2BOLA 2HQ5A 1LE8B 5CVVA 3DPTA 3CC2I 1BN5A 5GTHC 1MMNA 5HLGA 4S04A 1J09A 1ZK8A 5DM7F 1P4XA 2KFDA 4AWXB 1FNNA 1XMKA 3HG9A 4BXFA 5F0HA 2QM3A 3P5JA 3LOCA 4UY8I 2EA4A 3CDHA 3S17J 2CW7A 3A4CA 1NHAA 1XMAA 3SYTA 3IH3A 5K5QA 1U8RA 4RAZA 2CU7A 2RKHA 3OYJA 3QWLA 3BJAA 4PZJA 2CQXA 3BTJA 4JK1X 4JQFA 4F52A 3HDDA 4WXHA 1LUJB 2NNYA 4RAGA 1RR8C 1ZREA 4U0VA 2JMWA 1U8BA 3OSGA 2QYOA 4WF2A 1REPC 4FASD 3P9CA 3ONQA 3IUOA 2FJ1A 4E7HA 2DT5A 3SQNA 4RAYA 3P9IA 1I3QJ 3CMMA 2X0LA 4FX0A 2ZJQF 3D5RC 3KCCA 1W36D 1R22A 3FXLA 3GLXA 3BQZA 3PNTA 4XOPA 4B1RA 2XF6A 2PMZA 2IRFG 2JVGA 2VJ4A 4W1UA 3FF5A 4FHTA 2BXYA 3CF5F 5KAIC 1RZ4A 1WJDA 2W85A 1ERDA 1F36A 3TW6A 3Q0WA 1BJAA 2DFFA 2EH3A 4I6ZA 3JAMZ 5DTDA 5IP6A 3ZMDA 2L01A 3LFUA 1FSEA 1XTAA 2XASA 3CO6C 3CP2A 2RC4A 5J40A 1P4WA 4FCYA 3FXRA 2DT6A 1S7EA 5LHGA 3MMYB 2COMA 1MMGA 2TDXA 1LVAA 3ZR8X 3IP4B 4BU2A 1ETYA 1WJ5A 3MEXA 3SZPA 3F6VA 1U6GA 2R7FA 1X3WB 4QWQA 3ZMTA 3FWEA 5IP7J 2R7XA 4YIFA 4ENJA 2NS7A 1XC5A 3WTYC 2EK5A 2LD5A 1ON1A 3CMYA 3SEZA 3C18A 3F8NA 3WU2C 2EJRA 2BBYA 3PJRA 4M72A 4Y52J 3IAM2 5TISC 3WTVC 2O3FA 3D5LA 2MW8A 2UUZA 2DO7A 3BJ6A 1GT0C 3ZCOA 4KDPA 1J2XA 1YW9A 1IXRC 2ICWG 2V1NA 4A2UA 1ETQA 1LDDA 2FQ3A 1B72A 4NHJA 2XV4S 4L5JA 2LMDA 4UB6C 2L9RA 2MD5A 4RM3A 2V26A 2JRMA 2VN2A 5JVGF 1HBXG 4BQOA 2C6YA 2L3DA 2V7FA 1ON2A 4BHCA 3DBLB 3M7GA 1WCMJ 2LOOA 2KDZA 3KYLA 3GFIA 1JUMA 1XSVA 4A3FJ 1WJAA 1F1ZA 2GAUA 1Z21A 3J7ZI 3PQJA 2LLKA 1L3LA 3HJEA 4LG3A 1SANA 3BTCA 2OAZA 3CMEI 1DP3A 2DFIA 1OR7C 2V4JC 3BWGA 4ABZA 2IA1A 4N9HA 4XRSG 1D8JA 1OYIA 1FBQA 2JZYA 2BZTA 3H5AA 2F5FA 4BXXJ 1QQIA 4XLEA 2HVSA 4E7ZA 3L7WA 3HRSA 1MDMA 4L9VA 2HXIA 3CUQB 2DAOA 4BGDA 1H88C 3ERMA 4BQQA 1MIJA 5LHHA 2DW4A 2ZMEB 1D5VA 2M4GA 5JFRA 3JRIA 4PJMA 1XCBA 4WK8F 4NUBA 3DP7A 4NC7A 3IHUA 3ZGKA 4G7HF 5FB2A 5IT9Z 1YS7A 2BHZA 2JPBA 2P5LC 3M1EA 5CLSA 3KP4A 3PUFA 2FX0A 2IBDA 5KAFC 3PQKA 4OOIA 3C2BA 5JHFA 3KLOA 1YIOA 5F04A 2EZHA 2P6TA 5D5XB 1LPQA 1HKQA 2OU2A 3T8TA 2M7AA 3T1BA 1B72B 2VPRA 1FOKA 2PN6A 2X6WA 1GV2A 1YJWI 5M5YJ 2IS1A 1PJRA 1N78A 2IS2A 2JPCA 2DMUA 2ZNZA 3KYCB 5EZGA 1OCPA 4RDUA 3VB2A 4UB8C 4L5EA 4IXAA 3KZZA 3C1DA 1JKOC 3AL0B 5IYBJ 3KP6A 2PFBA 4IHWA 4IL6C 4M74A 4P1WA 4ESFA 3QOEA 2O8KA 3NQOA 1BIAA 5GP9A 3L2VA 2HTJA 1Y8RB 2YPRA 2I10A 3KEYA 4MNUA 4KMFA 4ZYAA 5J8CA 2XSJC 1LE8A 3IWFA 3VYUB 1YX3A 1PUFB 2PJPA 2M3AA 2ZO4A 2ID6A 3ABLH 3JRCA 1EH6A 2FXAA 1KONA 2V6CA 2R7OA 1IDYA 1E3OC 1RUNA 3RYPA 1VQ5I 3H3VK 5E79C 3BC8A 1WJCA 2CRGA 2K9LA 3HUGA 3NWSA 4A5NA 3BG5A 3HRMA 5ED4A 2EIMH 4HF2A 4I09A 4HQMA 2M8GX 3J81Z 3HOSA 2E1CA 1FIPA 1ZR2A 3MVPA 2Z5UA 3TO7A 1OFCX 3ZP5A 3HZJA 2QCOA 3C2HA 4FE7A 2X6XA 1NK3P 3BOQA 3WTZA 2O8XA 2CUJA 5E20A 2E1MC 4B48A 4LB5A 1WJFA 2IJLA 2QLZA 2ZXHA 3KLNA 4ZYGA 1KQ8A 1HDDC 4IQ4A 5J3LA 3ZMZA 4BQNA 1KGSA 1U9NA 4V2GA 2E1OA 2WY8Q 5K7HA 1K79A 1USSA 2JK3A 1YI2I 3IV5A 2ZB9A 4BS9A 2YU3A 4M3EA 5K7FA 2DFHA 4Y7NJ 1JE8A 1R23A 3BR1A 1XGNA 2ZCWA 2X4HA 4A0ZA 3CLOA 2UZKA 3S14J 3KZIC 2A6HF 2DCEA 4J01A 3UNGC 1NH3A 3EUKL 3EYIA 1GXPA 4CSWA 2G9WA 2XAJA 4E4HA 2WC2A 2Y9ZA 1Y1WJ 1B9NA 3S2DJ 2FD5A 4XBFA 4DYCA 3ABTA 4HSTA 1GDTA 1S7OA 6PAXA 4DOZA 3IC7A 3I9V2 4UVBA 1CF7B 5EEGA 1YOVB 5CVUA 4U0YA 5J1RA 3KPHA 3CCEI 1YW8A 3W2AA 1POGA 2XGXA 1VQMI 4E7SA 3WTXC 1USTA 2O6GE 1XDSA 3C2GA 3OYFA 1APLC 4CGZA 5DS9A 2FNAA 5E8GA 2DFEA 3DBHB 3IH4A 3JAMK 1W36C 3BTIA 1WZ2A 2F4OB 2WAEA 2QF7A 3OYAA 2WADA 4IOCF 4BEHA 1BI2A 3GZ5A 3I53A 2K5CA 4E7IA 4A6DA 3LSMA 1Z3YA 2N8GA 4HG2A 2Y31A 3C7JA 2RAEA 3H9GA 4MFDA 4EJTA 3G3ZA 3HOYJ 2M2EA 3F8CA 1TQMA 1I3AA 2XGEA 3BT9A 2LKPA 3HC7A 3L2QA 4IHXA 1UZCA 2W48A 4NB5A 5D5UB 3LWFA 1R49A 5DM6F 1BC7C 1I6XA 3N05A 4B44A 4O3MA 4JYKA 4C9YA 1HKSA 3AG2H 2FA5A 2MFZA 5D4SA 4Y33A 4OAZA 5J1UA 4BDYA 2L9NA 2DTZA 2XROA 1F5TA 1T56A 4OIQF 2LKSA 1MBFA 2W7NA 1UHWA 1OQYA 1UG2A 2DBBA 5B1BH 2F4MB 4E7JA 3DV8A 2VKVA 5ILVA 2GWRA 5E3NA 2CS3A 2OUMA 2WA0A 3AFHA 3TMOA 1LJ9A 2DI3A 1VQ7I 2E19A 1M1EB 3OL3A 3LA3A 3E1SA 2DOFA 1J59A 1A5JA 3F8MA 1TQIA 4I0BA 3U1KA 4HQEA 1A6QA 1X1AA 3VYRB 1SEUA 1O4XA 3CC4I 4ZYEA 3CCRI 4Y13A 5E1XA 1MBHA 1IUFA 4PDKA 2NVQJ 3E5UA 4F91B 1R9TJ 2FMLA 1YITI 2VB6A 3ZRGA 3OYGA 3LAJA 3FHZA 2ACJA 2GQQA 1YJ9I 2H94A 1T38A 4IVNA 5F1RA 2K3PA 3RKWA 4OINF 1IN4A 2M30A 4RM2A 2F5VA 1R4MB 4HRIA 2BY3A 2CO5A 3E7LA 4Z2YA 1RETA 4A3CJ 3V7RA 2R5YB 2HR3A 4PK4A 3RQIA 4UV9A 1I39A 1T6SA 5FFZA 2P7VB 4KITB 5LLQA 5FLXK 3A02A 1U5TB 1N77A 4HNTA 1ETOA 3EETA 3H9JA 1XB4A 2ZSIB 1FBUA 2X9DA 3KP3A 4GDFA 1ETKA 1S6LA 3LMMA 3LSTA 4HNVA 1X3ZB 1D0ZA 4XRSA 3DPUA 4BDZA 1W0TA 4HX8A 2KIQA 1IGNA 3DEEA 3OS2A 2WV0A 4XONA 4L18B 1TBXA 5E3LA 2JA5J 3L2UA 1FWZA 4BY1J 3F9KA 4DYRA 2DA5A 4KT6A 2LY9A 2HKOA 3LFKA 5EDNA 2WBMA 3HUGB 2E2IJ 4NBQA 2FU4A 5DYMA 1AHDP 2QKMB 2PJRB 1G3TA 2IA2A 1QRYA 3MWMA 2XAFA 3CCLI 2Q8KA 5M3MJ 1VQKI 4IHYA 3TDUC 2MBFA 1P7JA 3R61A 1B4AA 3QPSA 3O6BB 2E34A 2K4JA 1BI1A 4GGGA 1E2XA 4XRMA 2RQPA 3QYEA 2MSYA 3GZNB 2QUFA 4B47A 3K7AJ 3MD2A 2EZLA 2QGUA 2RGVA 1OR7A 3WE3A 3DFGA 3FXJA 3GTGJ 4YEJA 2DOAA 2X6YA 4G6QA 3T8RA 2LKXA 3V8JA 3EUAA 3RPQA 3BY6A 3WE2A 2VODA 3I4NJ 1FT9A 5IOYA 4WWCA 1XG1A 1U78A 1ACIA 2FOKA 3OYEA 4ZYDA 2LC2A 2Y2ZA 1MBEA 5D8LB 5HS8A 1ENHA 5BOXA 2W25A 2BXZA 1FTTA 4M9XA 3IL2A 4MHGA 3CCMI 3HM5A 4LLNA 4RLFA 4II3A 2VKHA 1BOAA 2CV2A 3CESA 1GHCA 1BIBA 1PP7U 3LSPA 4CYCB 2A5YB 1Z7LA 3JSOA 4N4OB 4MTEA 1FSHA 5E1ZB 3WHCA 1TWHJ 1IF1A 2HOEA 4XQFA 4CZCA 4ZDOA 3F23A 2HXOA 4C2UA 4E7KA 1R7JA 2HFHA 1I50J 1FX7A 2L7KA 2XB0X 5LHIA 5M3FJ 3G73A 3FM5A 4G6TB 5LBQA 3HOVJ 1DU6A 5FLMJ 2DXIA 3GTLJ 1X1BA 5ERIA 2WAFA 3BPVA 1P9QC 2QA4I 1JKRC 2ELHA 1IV8A 2IPQX 4YFNF 3H1CA 1W1WE 1MJBA 2K86A 4UXNA 3VYTB 1JHHA 3FX3A 1VQ6I 1X2NA 3CJNA 4A93J 1BL0A 4C30A 4FISA 2HNHA 1BJZA 1RESA 4TV7A 1BOBA 5GPCA 1R1TA 2XB5A 1P4AA 2MLKA 3KEOA 1BR2A 4AVZA 1QA6A 2VASA 3K4BA 5BS6A 4YRVA 4M6XA 3L2WA 2BV6A 1XMXA 3AL0C 2MABA 4MFEA 2JA7J 2K85A 3SDGA 3OIPA 1GVJA 3SDBA 4BJTA 2ZNYA 3GMEA 2XPVA 1Z67A 3RJPA 2PI0A 4Y4RA 4KN4X 1FJLA 3SZGA 2ZMEC 5B5EC 1HW2A 4BE2A 2OA4A 4A3LJ 2O0YA 5B3SH 2MYSA 1KQ0A 2X6OA 2ETHA 3IKTA 2KPMA 2DYSH 2GZWA 1SD5A 4D7MA 3NAUA 2OZ6A 3FISA 1A6IA 2Q2EA 5IT3A 1Z6RA 4V19K 2DU9A 4A6EA 2HWVA 3AG1H 1VNDA 2XVCA 4P5OA 5DUIA 3GTKJ 2ESHA 1CGPA 2KKOA 2CQKA 3K1PA 5B66C 2KHMA 4UVCA 1V5GA 3HGYA 3N97A 3QRFF 5FLVA 2VBYA 3K10A 4D1QA 1OPCA 3MAJA 2J5OA 2STWA 1Y6IA 4YFKF 2FOWA 2DODA 2ISZA 1ZG5A 2OC6A 1QVUA 2W24A 3KFWX 3HPGA 1ZGWA 1ZN2A 1JI8A 2JWTA 1TP4A 2LYCA 1E3HA 2W84A 2XF5A 5H20A 4B3AA 1XX5A 2KT0A 3OL4A 1AWCA 4B09A 4C3HJ 4FX4A 1SFUA 2VKEA 1L0OC 4G12A 2ISYA 2CW0F 2EA2A 2WAQN 2M9HA 5FGMA 1OCTC 3CCQI 2H1KA 3BZ6A 3HHGA 3F22A 2X85A 5CPRB 5LEKA 4ESJA 5CJ9A 4XLHA 3Q5FA 1A04A 3LQQA 4M9ZA 3MN2A 1HW5A 4JX4A 3I3LA 2CGPA 3K4KA 3MFKA 3ZPLA 1IAWA 4N9IA 5FKLA 2KDOA 2Z1DA 3F21A 1IRXA 4PGHA 1DQUA 4ZDLA 3ISPA 4I01A 2VJJA 3DU5A 3QPLA 4A69C 2DDAA 1ONVA 5GAEJ 1ZLJA 4DYQA 2LR8A 3QPHA 4AUXA 2VC1A 3MZYA 4II2A 1LEAA 4U0WA 4OWRB 3M1CA 1LFPA 3ROUA 5DEQA 4BBSJ 3COAC 4RS8A 3V42A 1YYVA 2ECCA 1MNMC 2FRHA 1JXSA 1K4SA 3V8LA 2P8TA 1FC3A 4CCKA 4LFUA 3GX4X 3MZ8A 4I7HA 4KNYA 1O57A 4K2EA 3FXUA 3QAHA 2F48A 1XDUA 2F5CA 1D1CA 2VQCA 1QZYA 3TOAA 4M3DA 4XIDA 4PCQA 5BPDA 4XKVA 3K4NA 1MD0A 1LDKB 2E1MB 2CJJA 3KP2A 5LRRA 3PIOF 4A3BJ 4BXUA 2JRTA 4J19A 1HDPA 3LQRA 1FBSA 4ZZDA 5FRNA 3UR3C 1K83J 3KP5A 4A3IJ 1E0EA 4GO1A 1BR4A 3ZQIA 4HDVA 3FXKA 3U2RA 3W6JB 3QYBA 1A31A 1YG2A 4R79A 4G94A 1QZZA 3OSFA 4QPQA 1X2MA 2HDWA 1N25A 3QU3A 4GXOA 1GUUA 4HOBA 2DTRA 2WB1N 2LF7A 4NQWA 4XKWA 1DUXC 5KK1A 3QU6A 1V5FA 2B7EA 2OPTA 3BDDA 4HDUA 3EPZA 2XKOA 1FEXA 4C3IJ 2PG4A 3VODA 1FMWA 1BI3A 4FTHA 5K5RA 4ZC3A 2WV1A 1E3PA 4XKBA 2FEZA 1K7AA 2XAGA 1V5EA 1TWCJ 3I59B 4XICA 2E35A 2FMYA 1ZLKA 4KFCA 4BE1A 2MA3A 2IA0A 4EEFG 3OS1A 1TL8A 1UHMA 1SFXA 3W2VA 3ZQFA 2ADUA 1YJNI 4GCVA 5L3GA 5J4YA 3BJOA 3VFZA 3FMRA 1ZR4A 3CTAA 2BW3B 3LA7A 2ZXIA 4IRIA 3CMAI 3S2WA 2JTVA 3HKZA 3PM1A 1IC8A 1F43A 3A1YA 2YX7A 5H2FC 3O8HA 2XUBA 1WGXA 2ECBA 4FE4A 2E5ZA 3GTQJ 1OCCH 4XK4A 3O8GA 3S3MA 3DQVC 2G7UA 3WU0A 2Y30A 4DZPA 3IAS2 3NEUA 3DPLC 2CMPA 2ME6A 5F27A 1H9GA 3QQAA 4BJ5C 3GZ6A 1QPMA 2AHQA 3CUQA 1HCRA 3S1MJ 3A03A 1AA7A 2E60A 4KA4A 1Y0UA 4OAYA 2HOAA 3WTSC 2RV8A 4A3EJ 1TWAJ 3FKJA 3HB9A 4PJLA 4M3FA 2NVYJ 4RGSA 1OISA 1D5YA 2B63J 5GADJ 5EGOB 1N75A 2ELJA 2EIKH 1Q1HA 3GW2A 2YX4A 2OZUA 3P7NA 4LGWA 1SAXA 2QBYB 1JTXA 3OYCA 2KIFA 3FXQA 5BMZA 2JT1A 3E3VA 4WCGA 1B1BA 5C4JJ 4CICA 3QP5A 5D8KB 3OIOA 3Q9VA 4LK1F 2F5DA 4I0AA 4PUSA 3BR3A 3GTOJ 2Q1ZB 1R6RA 2HQRA 2GXGA 4MO7A 3GFJA 3H5NA 5HLTA 1LDJA 4DGWB 2KZVA 4AU7A 2HDDA 1IXSB 4A3DJ 2LVSA 1FP1D 1OJLA 1R1UA 4CCMA 3DTKA 3MKYB 2BVLA 1HKTA 4LK0F 5LGTA 4WXDA 1JKQC 3AG4H 1IV6A 1I6HJ 5E8IA 2OJED 2A61A 4EJUA 1T8IA 3PO3J 2Y69H 1Z91A 1UHSA 4IJAA 3JRFA 1S29A 2DA3A 3ULQB 3FDYA 1MBKA 1P6RA 3WODF 1SVOA 1TT5B 4LD5A 2KISA 2HI3A 3OYDA 3HPHA 3BG7A 1G3SA 4IKFA 3CJRB 3ESWB 4ZJZA 1STZA 3L1PA 3TBIA 3W6VA 3BR5A 4Q5SF 3H0DA 2RN7A 4DW6A 4HW0A 2NRAC 1Z6TA 4KYWA 4JOMA 1H9TA 1ZRCA 2MD0A 2VL8A 3TGNA 1WI3A 4EGYA 3EYYA 4BYYA 3ZQCA 2X1DA 4X0GA 1QU3A 2VUMJ 2R7RA 3CUOA 4Y15A 4I02A 4AD9A 4QSHA 2A07F 5EG0B 5ICFA 3Q0UA 3JRDA 2V79A 2LG4A 3SZTA 1W5SA 2AS5F 4E7LA 2DA4A 3HOUJ 4HBLA 2XF7A 5JLXA 4WXCA 1SVLA 3PUBA 1QBJA 4HV5A 2KJCA 2HTSA 3TKYA 2F4IA 3BPXA 1IN6A 1G6NA 1R00A 3DTEA 5EG0A 1BM9A 2TCTA 3OYKA 1JUSA 1LB2A 2GOMA 3K2AA 5HS9A 1VQ9I 2CUFA 3BROA 2YU9J 1P7IA 3G4SI 3NRVA 3GF2A 2DJNA 3KETA 4KIGA 4S05A 3JSPA 1MNEA 2OTLI 3GTPJ 1W4MA 1YW7A 3HSFA 2VBZA 1ZG1A 2XGDA 2Z33A 4HSRA 1WHUA 3ECHA 3R60A 4KJZA 1U5TA 3FMQA 2X48A 3AAFA 3V4GA 3X2QH 4MGRA 4E70A 4OMYA 3V7SA 5FROA 1JUPA 1Z1DA 4CHUA 4Z6YA 9ANTA 3EDPA 4LB6B 4EM2A 3FMSA 2MLGA 1SD4A 2RREA 3DLLF 3B6CA 4ASNA 5AIQA 1P2FA 1OCOH 2HQAA 3Q3SA 3S2HJ 2CUZA 4O5VA 3ZN0A 1QHGA 1T0FC 1G3WA 4KIBA 2YS9A 3ECOA 4XNFA 4Q47A 1X4OA 2WTEA 2ZC2A 4EJOA 1MSFC 3P9KA 3CF2A 2LFBA 2PQ8A 4MEXF 2R5ZA 4RB3C 3PO2J 2BW3A 3HRTA 4MIMA 1I5ZA 1FP2A 4B43A 4BAYA 1AKHB 3PNVA 2LBFB 2W1OA 5DCMA 4RBOA 1K78A 2FF4A 2P5KA 3I55I 4JX6A 1KQ9A 3HKZN 4AM3A 4NC6A 2V6EA 2VOOA 2CWEA 2VKDA 1FTZA 4RAFA 1LKXA 2OV7A 2P81A 3HSEA 4NC8A 2WB1A 3GVAA 4DJAA 5LRSA 1B59A 1W0UA 3R6SA 2A6TA 2HPIA 2VC0A 3CDIA 3D5SC 4YIRX 2L7FP 2L9VA 2UV1A 3RZOJ 2K9NA 5E3MA 3HTUA 1W5CC 4BUPA 2L4MA 3G2BA 3RCOA 2GM4A 4L0ZB 1FOWA 2KLOA 3E6CC 3JREA 2EFWA 4Q4ZF 3S1RJ 1IJWC 3M8JA 1YRNB 3I4MJ 2D5VA 3A2KA 1UFMA 4F93B 2DYRH 3CO7C 2B9SA 2VQHA 5KCMA 1QGPA 4RLQA 3GCMA 2JA6J 3ZQGA 1MNDA 1TT0A 3M07A 3LSHA 4LOCA 5D4RA 5CQGA 4P55A 2RNJA 3T0YA 3EUHA 4J00A 3TO9A 1YX5A 1UAAA 1XD7A 2EFOA 2DQLA 2JSCA 1SMTA 4N0BA 4NDLA 3N4MA 2DA1A 4EVIA 2MC4A 3CCUI 5HLHA 1R71A 2ZBKA 3F8FA 3SXYA 2K9MA 4I2OA 2JA8J 4R1HA 2K27A 4LLGF 1HSTA 1XGMA 3VSLA 1MJAA 5LEJA 1PUFA 4IF4A 2XRNA 1B8IA 3E6BA 2AO9A 3BP8A 2KMUA 2KIMA 3DBRB 5D5VB 1F9NA 1W7PD 1T39A 5J47A 2X1EA 4HX7A 4RA2A 1SVMA 1BW6A 5IYCJ 2AQFA 3B02A 3TO6A 1H8AC 2DMTA 2XDVA 2HYJA 4XR6A 2DQRA 4UNOA 3SJMA 1RKWA 3ZMSA 2A6EF 3TOBA 4HLYA 2DLLA 4F55A 2P4WA 3RPUA 1CF7A 1IRGA 3HIFA 3J7AO 4IHTA 2HOSA 2NS0A 3FM3A 3MKWB 4E6KG 3ZQ7A 2EQRA 5F6FA 5L3CA 1WSUA 1XSDA 5GPAA 3E6MA 3GEZA 1D8KA 1MBJA 3RSNA 1HSJA 3LSJA 1ITYA 3V8KA 1DP7P 2ID3A 5IT9K 1R5HA 1OCZH 2XHKA 3SEQA 2XSDC 3U21A 2IXSA 3FXMA 2ZJRF 2VBXA 4LIUA 2W57A 2JQ7A 3OS0A 2OCEA 3LNQA 1HOMA 5FRMA 3FHNA 2M0CA 3M4OJ 2NOJB 1LVKA 5CVRA 2Q0OA 4YELA 4CCOA 4IRGA 2BE5F 2ZXWH 3VPRA 1RNLA 3HSRA 5DD8A 2OQRA 2RVCA 1YFHA 2L0KA 2M5WA 4P96A 4NQWB 2K02A 2D1VA 1JJ6C 1J7KA 1JJ8C 3OY9A 1XPXA 3WTWC 2F6CA 2Q2EB 5JVTA 4HX4A 4QTRA 2R92J 2JJ7A 2M4KA 1EH7A 2AXLA 5F64A 3G1MA 5DUKA 3I64A 3A01B 1X19A 5KVRA 3EQLF 5M5WJ 1YS6A 3LA2A 1RKTA 3I59A 4F92B 2L9SA 5IOZA 4PJ0C 3BG3A 4EJVA 2VJ5A 1SD6A 1G3YA 4DIQA 3WGHA 2Z99A 2RQQA 1WH5A 1WKMA 1D0YA 2GOXB 4YFXF 2H1LA 5DCFA 2LTPA 2V1XA 1DPRA 4BKXA 4L0YB 3ZMUA 3J80K 4IRHA 4BHPA 2FE3A 3I5UA 4IO9F 3FBNB 4Q48A 1BI0A 4ANJA 3E6DA 5J6XA 2EFQA 4OMZA 1IN5A 2NS8A 3DWLE 3MQ0A 2DPUA 3CUQC 3VYSB 4I76A 3OYNA 2MG4A 3H36A 4MTDA 4BBRJ 5FLXZ 3ZQQA 5HOOA 2BY2A 3D1NI 4ETSA 1KYZA 3BTLA 1EA3A 1I27A 1MSEC 3GYHX 1RRJA 1V3FA 2L02A 2IAIA 1EV7A 3GFMA 2OCCH 1NK2P 4ZYHA 1Z0XA 1EF4A 1AU7A 4CCJA 4U88A 3L2CA 2XIGA 1R5GA 1DGRM 1TW3A 1RIOH 4CDGA 3PFYA 2EBIA 2ZFUA 4O6JA 2V1DA 1O3RA 1G8XA 3C3WA 4A0XA 3BLYA 5EZHA 3CZ6A 4OIRF 2IT0A 2BY1A 1IZ1A 5EEHA 1ZQ3P 4JP0A 4HZFA 1IRFA 1R58A 2L7ZA 1EKEA 3HHHA 1ETXA 1GVDA 2R7QA 1D1AA 2CH0A 2UXXA 2OQGA 1A35A 4AYBA 4UHTA 4PSWA 3HYIA 1SFEA 3J81K 1ZG3A 1DPUA 3A0HC 4EQQA 3RI4A 5CVJA 1Y1VJ 2Y0MA 1Z77A 5F1JA 3ABKH 4XN3A 1YLFA 2MC3A 5LFAA 2HU9A 1G4DA 1R5ID 3DF8A 1V54H 4B4CA 3CCSI 1ZARA 3JR9A 2UWMA 3BCAA 4HEA2 3JRHA 3B73A 2H8RA 1MH4A 5FKOA 1XS9A 2HZTA 5EEAA 3M3YJ 3O3KA 3FXOA 1K78B 3CCYA 5HDGA 4HAMA 3GWZA 5DV5A 3RTRA 1JGGA 1D0XA 3Q0VA 2STTA 1OCRH 1UELB 2M34A 1GLNA 1WQ2A 5EF6A 2R5ZB 2XAQA 4XORA 1IUYA 1U5TC 2FBIA 2I8DA 4M9SA 3ASNH 3NARA 4L9TA 1KU9A 3G1OA 4IZZA 1T08B 3ZMVA 4KN7X 2R7WA 5D5WB 2O03A 3M8FA 2VJIA 1U9OA 2M1BA 2LY2A 2VT3A 5FD5A 3HRUA 2DMPA 3LAPA 4CO8A 4B3XA 3K69A 4DZJA 4KUMA 3L09A 3MZHA 3IH2A 5AONA 3TP3A 1YRNA 2OF7A 1MH3A 3OYBA 2H09A 2ZSHB 4BY7J 5HVQC 3S8PA 2CQ7A 5E1WA 3PFIA 1SMYF 4XLFA 1UB9A 3ABUA 2LSOA 2EZIA 2V9KA 2VE9A 4EV0A 1KU3A 3R0JA 2PMHA 1KZHA 2QQ8A 4YG2F 2QVOA 4EATA 1VQ8I 5D6FA 4MQ9F 3GUDA 1ZELA
chains in the Genus database with same CATH topology
5J1UA 1HF0A 5F08A 3PO3J 1UHSA 2DTZA 3JRFA 2DA3A 2COBA 1MBKA 1T56A 2R5YA 3BR0A 3RKQA 2YUSA 2JN6A 1MBFA 2LP0A 4W97A 1BA5A 1UG2A 1WH7A 2HI3A 1AKHA 1QVTA 3H0GJ 4M3GA 2VKVA 5E3NA 5FKNA 3L1PA 3W6VA 2E19A 1RR7A 3BR5A 3LSRA 2XRLA 4DW6A 1A5JA 5EGOA 2VI6A 1O4XA 1MBHA 1IUFA 1WI3A 3ZQCA 2NVQJ 2E2HJ 3G1LA 5FKKA 1R9TJ 2VUMJ 2O9LA 2Y0SN 4D5FA 4UUSA 4JX5A 2FQ4A 3SFIA 4QSHA 5FJ8J 5EG0B 3Q0UA 3JRDA 1BW5A 2XPWA 2DA4A 4A3KJ 2GLOA 3HOUJ 3GTMJ 5JLXA 2XPUA 3UKGA 3E7LA 1VI0A 1RETA 3S1NJ 4A3CJ 2R5YB 2K9QA 1VFCA 3RQIA 5EG0A 2TCTA 1JUSA 3K2AA 2CUFA 2YU9J 2ME0A 3A02A 3F0CA 1ETOA 1P7IA 2DJNA 1WPKA 2X9DA 2NVTJ 3S15J 3GTPJ 1ETKA 4HNVA 1ETWA 4XRSA 5C44J 2O7OA 2XGDA 1W0TA 1UMQA 1IGNA 2X48A 5HODA 3B6AA 2CUEA 3TEDA 5E3OA 1JUPA 1TWGJ 4D7NA 5E3LA 2JA5J 9ANTA 4BY1J 3BR6A 3HBLA 3FK7A 4DYRA 5FKMA 2DA5A 2LY9A 3B6CA 1LFBA 1H89C 3ZQLA 5F0CA 5EDNA 2ELKA 2E2IJ 3Q3SA 3S2HJ 3FIWA 1AHDP 3LSGA 2YS9A 1QRYA 5JLWA 1MSFC 2PMZN 4S0HB 5M3MJ 4IHYA 2LFBA 3BQYA 2R5ZA 1P7JA 3PO2J 4MIMA 3QPSA 1CQTA 3HOZJ 2HQ5A 2R0QC 1LE8B 4XRMA 1AKHB 1Q1VA 1ZK8A 2MSYA 4RBOA 3OOUA 4JX6A 3HKZN 5F0HA 3K7AJ 2DA7A 2EZLA 3LOCA 1FTZA 2CQQA 3S17J 3GTGJ 4UUTA 3IH3A 2P81A 2LKXA 3I4NJ 2CU7A 5IOYA 1U78A 1XG1A 1W0UA 4AC0A 2CQXA 3BTJA 2Y2ZA 3HDDA 1MBEA 2L7FP 1ENHA 3RZOJ 2K9NA 2JMWA 5E3MA 3OSGA 1U8BA 1FTTA 3HM5A 2FJ1A 3LSPA 4CYCB 2GM4A 3JREA 2K40A 2NOGA 1I3QJ 3S1RJ 1IJWC 3WHCA 1TWHJ 3DEWA 1YRNB 3I4MJ 2D5VA 3BQZA 4B1RA 2HXOA 5EYRA 4QIWN 2JA6J 4W1UA 3ZQGA 1I50J 1DU6A 2XB0X 3ZQHA 5M3FJ 4LOCA 3HOVJ 5FLMJ 1F36A 3TW6A 4A3MJ 3Q0WA 5J1YA 3GTLJ 1JKRC 2EH3A 4I6ZA 5DTDA 5IP6A 4NDLA 2R93J 4FCYA 1X2NA 2DA1A 4A93J 1S7EA 1BL0A 2Y9YA 4FISA 4X1EA 1BJZA 1RESA 5GPCA 2IEKA 2XB5A 2JA8J 1ETYA 1SFOJ 4MFEA 2JA7J 1JT0A 2TRTA 3SDGA 2XPVA 1MBGA 1PUFA 1B8IA 5IP7J 3DCFA 3HOXJ 1FJLA 2AO9A 2NS7A 1RPWA 1XC5A 4X6AJ 2LD5A 3CMYA 4A3LJ 2NVXJ 1QPIA 3TW7A 4Y52J 2X6OA 1TWFJ 1BW6A 2MW8A 5IYCJ 3HOWJ 4D7MA 3NAUA 1GT0C 2DMTA 1H8AC 2HYJA 3JRGA 3FISA 1A6IA 3SJMA 1RKWA 2L7MP 1ETQA 1B72A 5BNGA 1VNDA 3BR2A 3GTKJ 2L9RA 2HOSA 3HGYA 5FLVA 2EQRA 1WCMJ 2KDZA 5GPAA 1IRZA 1MBJA 1ETVA 1JUMA 4A3FJ 3LSJA 1JKPC 1ITYA 1JTYA 2LLKA 1HLVA 2ID3A 3JRAA 1QVUA 1ZGWA 1SANA 3BTCA 2XSDC 2JWTA 4GFBA 3FKIJ 3LNQA 4B3AA 1HOMA 2KT0A 4ABZA 4A3JJ 2M0CA 4C3HJ 3M4OJ 4XRSG 2VKEA 4G12A 4BXXJ 2WAQN 1NTCA 3VPRA 2M9HA 1OCTC 2H1KA 3CQZJ 2HXIA 2L0KA 1JJ6C 1H88C 3HEFA 1JJ8C 3MN2A 4JX4A 1LFUP 2HOTA 4QTRA 2R92J 1X58A 3CDLA 5FKLA 2JJ7A 4M3BA 3HGGA 3JRIA 3G1MA 3A01B 2R7ZJ 3QPLA 4A69C 5M5WJ 1RKTA 5IOZA 4DYQA 2LR8A 3BG3A 4AUXA 1ORKA 2FX0A 3BG9A 2IBDA 3C2BA 1WH5A 4BBSJ 5F04A 2EZHA 4A3GJ 2ECCA 1MNMC 1B72B 2LTPA 2VPRA 1GV2A 3MKLA 4C2MJ 4BKXA 5M5YJ 4XIDA 4M3DA 4C3JJ 2DMUA 4RDUA 5EZGA 1OCPA 2CJJA 4L5EA 1ZKGA 4A3BJ 2NS8A 3A01A 1JKOC 1DU0A 4J19A 1HDPA 3GTJJ 1JT6A 5IYBJ 4MLOA 1K83J 4IHWA 4A3IJ 3ZQIA 4I76A 2MG4A 2DA6A 2O8KA 4BBRJ 5GP9A 3D1NI 2I10A 3BTLA 3OSFA 1LE8A 1GV5A 1MSEC 1X2MA 1PUFB 2ID6A 1GUUA 4M6VA 2WB1N 3JRCA 2IAIA 1FIAA 1IDYA 2OPTA 1E3OC 1NK2P 1FEXA 4C3IJ 1EF4A 1Z0XA 1AU7A 3H3VK 2DA2A 2CRGA 3BG5A 5IYDJ 4FTHA 2M8GX 2WV1A 4IEJA 1FIPA 1ZR2A 3MVPA 1K61A 1OFCX 2EBIA 4XICA 1TWCJ 1VF9A 2QCOA 4FE7A 1NK3P 5EZHA 2MGQA 2GBYA 1ZQ3P 4JP0A 5K7ZA 2K9SA 2L7ZA 3FK6A 4EEFG 1ETXA 1HDDC 5J3LA 1GVDA 3ZQFA 3RZDJ 2XGCA 1U9NA 4V2GA 2E1OA 5K7HA 2JK3A 1ZR4A 3IV5A 2ZB9A 3JRBA 2EZKA 1Y1VJ 4M3EA 5K7FA 3PM1A 1IC8A 1F43A 1Z77A 5F1JA 4Y7NJ 3BR1A 3O8HA 1WGXA 2ECBA 4FE4A 4B4CA 3S14J 1TC3C 3JR9A 3GTQJ 1IG7A 4XK4A 1B8IB 3O8GA 3JRHA 2H8RA 1MH4A 5FKOA 1XS9A 2Y30A 4DZPA 2ME6A 5F27A 3QQAA 2G0EA 5EEAA 3M3YJ 2AHQA 2Y9ZA 5M5XJ 2LK2A 1Y1WJ 1HCRA 3S1MJ 3S2DJ 2FD5A 3CCYA 4DYCA 3A03A 1IDZA 3TP0A 4CYCA 1GDTA 2HOAA 1JGGA 3WHBA 3Q0VA 1TWAJ 4A3EJ 3HB9A 2DMQA 2M34A 5J1RA 5EF6A 2R5ZB 4M3FA 2NVYJ 2DMNA 1D5YA 2B63J 4D5CA 3NARA 1POGA 5EGOB 3G1OA 4V2FA 4IHVA 3S16J 2E2JJ 3GBGA 1U9OA 1APLC 1T33A 5C3EJ 2DMPA 5DS9A 2DN0A 4DZJA 1JTXA 3IH2A 3TP3A 1YRNA 3IH4A 5C4JJ 2OF7A 1MH3A 4AYBN 3BTIA 3OIOA 4BY7J 2QF7A 3BR3A 3GTOJ 1G2HA 5F0FA 5IP9J 5C4XJ 2N8GA 1ZTRA 2Y31A 4MO7A 2EZIA 2RAEA 4MFDA 3HOYJ 2M2EA 3S1QJ 2XGEA 3BT9A 2HDDA 4A3DJ 4UUSB 2LVSA 4IHXA 1OJLA 2W48A 3ZOBA 4JYKA 5IPAA 1JKQC 1IV6A 1I6HJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J1U A;  1HF0 A;  5F08 A;  3PO3 J;  1UHS A;  2DTZ A;  3JRF A;  2DA3 A;  2COB A;  1MBK A;  1T56 A;  2R5Y A;  3BR0 A;  3RKQ A;  2YUS A;  2JN6 A;  1MBF A;  2LP0 A;  4W97 A;  1BA5 A;  1UG2 A;  1WH7 A;  2HI3 A;  1AKH A;  1QVT A;  3H0G J;  4M3G A;  2VKV A;  5E3N A;  5FKN A;  3L1P A;  3W6V A;  2E19 A;  1RR7 A;  3BR5 A;  3LSR A;  2XRL A;  4DW6 A;  1A5J A;  5EGO A;  2VI6 A;  1O4X A;  1MBH A;  1IUF A;  1WI3 A;  3ZQC A;  2NVQ J;  2E2H J;  3G1L A;  5FKK A;  1R9T J;  2VUM J;  2O9L A;  2Y0S N;  4D5F A;  4UUS A;  4JX5 A;  2FQ4 A;  3SFI A;  4QSH A;  5FJ8 J;  5EG0 B;  3Q0U A;  3JRD A;  1BW5 A;  2XPW A;  2DA4 A;  4A3K J;  2GLO A;  3HOU J;  3GTM J;  5JLX A;  2XPU A;  3UKG A;  3E7L A;  1VI0 A;  1RET A;  3S1N J;  4A3C J;  2R5Y B;  2K9Q A;  1VFC A;  3RQI A;  5EG0 A;  2TCT A;  1JUS A;  3K2A A;  2CUF A;  2YU9 J;  2ME0 A;  3A02 A;  3F0C A;  1ETO A;  1P7I A;  2DJN A;  1WPK A;  2X9D A;  2NVT J;  3S15 J;  3GTP J;  1ETK A;  4HNV A;  1ETW A;  4XRS A;  5C44 J;  2O7O A;  2XGD A;  1W0T A;  1UMQ A;  1IGN A;  2X48 A;  5HOD A;  3B6A A;  2CUE A;  3TED A;  5E3O A;  1JUP A;  1TWG J;  4D7N A;  5E3L A;  2JA5 J;  9ANT A;  4BY1 J;  3BR6 A;  3HBL A;  3FK7 A;  4DYR A;  5FKM A;  2DA5 A;  2LY9 A;  3B6C A;  1LFB A;  1H89 C;  3ZQL A;  5F0C A;  5EDN A;  2ELK A;  2E2I J;  3Q3S A;  3S2H J;  3FIW A;  1AHD P;  3LSG A;  2YS9 A;  1QRY A;  5JLW A;  1MSF C;  2PMZ N;  4S0H B;  5M3M J;  4IHY A;  2LFB A;  3BQY A;  2R5Z A;  1P7J A;  3PO2 J;  4MIM A;  3QPS A;  1CQT A;  3HOZ J;  2HQ5 A;  2R0Q C;  1LE8 B;  4XRM A;  1AKH B;  1Q1V A;  1ZK8 A;  2MSY A;  4RBO A;  3OOU A;  4JX6 A;  3HKZ N;  5F0H A;  3K7A J;  2DA7 A;  2EZL A;  3LOC A;  1FTZ A;  2CQQ A;  3S17 J;  3GTG J;  4UUT A;  3IH3 A;  2P81 A;  2LKX A;  3I4N J;  2CU7 A;  5IOY A;  1U78 A;  1XG1 A;  1W0U A;  4AC0 A;  2CQX A;  3BTJ A;  2Y2Z A;  3HDD A;  1MBE A;  2L7F P;  1ENH A;  3RZO J;  2K9N A;  2JMW A;  5E3M A;  3OSG A;  1U8B A;  1FTT A;  3HM5 A;  2FJ1 A;  3LSP A;  4CYC B;  2GM4 A;  3JRE A;  2K40 A;  2NOG A;  1I3Q J;  3S1R J;  1IJW C;  3WHC A;  1TWH J;  3DEW A;  1YRN B;  3I4M J;  2D5V A;  3BQZ A;  4B1R A;  2HXO A;  5EYR A;  4QIW N;  2JA6 J;  4W1U A;  3ZQG A;  1I50 J;  1DU6 A;  2XB0 X;  3ZQH A;  5M3F J;  4LOC A;  3HOV J;  5FLM J;  1F36 A;  3TW6 A;  4A3M J;  3Q0W A;  5J1Y A;  3GTL J;  1JKR C;  2EH3 A;  4I6Z A;  5DTD A;  5IP6 A;  4NDL A;  2R93 J;  4FCY A;  1X2N A;  2DA1 A;  4A93 J;  1S7E A;  1BL0 A;  2Y9Y A;  4FIS A;  4X1E A;  1BJZ A;  1RES A;  5GPC A;  2IEK A;  2XB5 A;  2JA8 J;  1ETY A;  1SFO J;  4MFE A;  2JA7 J;  1JT0 A;  2TRT A;  3SDG A;  2XPV A;  1MBG A;  1PUF A;  1B8I A;  5IP7 J;  3DCF A;  3HOX J;  1FJL A;  2AO9 A;  2NS7 A;  1RPW A;  1XC5 A;  4X6A J;  2LD5 A;  3CMY A;  4A3L J;  2NVX J;  1QPI A;  3TW7 A;  4Y52 J;  2X6O A;  1TWF J;  1BW6 A;  2MW8 A;  5IYC J;  3HOW J;  4D7M A;  3NAU A;  1GT0 C;  2DMT A;  1H8A C;  2HYJ A;  3JRG A;  3FIS A;  1A6I A;  3SJM A;  1RKW A;  2L7M P;  1ETQ A;  1B72 A;  5BNG A;  1VND A;  3BR2 A;  3GTK J;  2L9R A;  2HOS A;  3HGY A;  5FLV A;  2EQR A;  1WCM J;  2KDZ A;  5GPA A;  1IRZ A;  1MBJ A;  1ETV A;  1JUM A;  4A3F J;  3LSJ A;  1JKP C;  1ITY A;  1JTY A;  2LLK A;  1HLV A;  2ID3 A;  3JRA A;  1QVU A;  1ZGW A;  1SAN A;  3BTC A;  2XSD C;  2JWT A;  4GFB A;  3FKI J;  3LNQ A;  4B3A A;  1HOM A;  2KT0 A;  4ABZ A;  4A3J J;  2M0C A;  4C3H J;  3M4O J;  4XRS G;  2VKE A;  4G12 A;  4BXX J;  2WAQ N;  1NTC A;  3VPR A;  2M9H A;  1OCT C;  2H1K A;  3CQZ J;  2HXI A;  2L0K A;  1JJ6 C;  1H88 C;  3HEF A;  1JJ8 C;  3MN2 A;  4JX4 A;  1LFU P;  2HOT A;  4QTR A;  2R92 J;  1X58 A;  3CDL A;  5FKL A;  2JJ7 A;  4M3B A;  3HGG A;  3JRI A;  3G1M A;  3A01 B;  2R7Z J;  3QPL A;  4A69 C;  5M5W J;  1RKT A;  5IOZ A;  4DYQ A;  2LR8 A;  3BG3 A;  4AUX A;  1ORK A;  2FX0 A;  3BG9 A;  2IBD A;  3C2B A;  1WH5 A;  4BBS J;  5F04 A;  2EZH A;  4A3G J;  2ECC A;  1MNM C;  1B72 B;  2LTP A;  2VPR A;  1GV2 A;  3MKL A;  4C2M J;  4BKX A;  5M5Y J;  4XID A;  4M3D A;  4C3J J;  2DMU A;  4RDU A;  5EZG A;  1OCP A;  2CJJ A;  4L5E A;  1ZKG A;  4A3B J;  2NS8 A;  3A01 A;  1JKO C;  1DU0 A;  4J19 A;  1HDP A;  3GTJ J;  1JT6 A;  5IYB J;  4MLO A;  1K83 J;  4IHW A;  4A3I J;  3ZQI A;  4I76 A;  2MG4 A;  2DA6 A;  2O8K A;  4BBR J;  5GP9 A;  3D1N I;  2I10 A;  3BTL A;  3OSF A;  1LE8 A;  1GV5 A;  1MSE C;  1X2M A;  1PUF B;  2ID6 A;  1GUU A;  4M6V A;  2WB1 N;  3JRC A;  2IAI A;  1FIA A;  1IDY A;  2OPT A;  1E3O C;  1NK2 P;  1FEX A;  4C3I J;  1EF4 A;  1Z0X A;  1AU7 A;  3H3V K;  2DA2 A;  2CRG A;  3BG5 A;  5IYD J;  4FTH A;  2M8G X;  2WV1 A;  4IEJ A;  1FIP A;  1ZR2 A;  3MVP A;  1K61 A;  1OFC X;  2EBI A;  4XIC A;  1TWC J;  1VF9 A;  2QCO A;  4FE7 A;  1NK3 P;  5EZH A;  2MGQ A;  2GBY A;  1ZQ3 P;  4JP0 A;  5K7Z A;  2K9S A;  2L7Z A;  3FK6 A;  4EEF G;  1ETX A;  1HDD C;  5J3L A;  1GVD A;  3ZQF A;  3RZD J;  2XGC A;  1U9N A;  4V2G A;  2E1O A;  5K7H A;  2JK3 A;  1ZR4 A;  3IV5 A;  2ZB9 A;  3JRB A;  2EZK A;  1Y1V J;  4M3E A;  5K7F A;  3PM1 A;  1IC8 A;  1F43 A;  1Z77 A;  5F1J A;  4Y7N J;  3BR1 A;  3O8H A;  1WGX A;  2ECB A;  4FE4 A;  4B4C A;  3S14 J;  1TC3 C;  3JR9 A;  3GTQ J;  1IG7 A;  4XK4 A;  1B8I B;  3O8G A;  3JRH A;  2H8R A;  1MH4 A;  5FKO A;  1XS9 A;  2Y30 A;  4DZP A;  2ME6 A;  5F27 A;  3QQA A;  2G0E A;  5EEA A;  3M3Y J;  2AHQ A;  2Y9Z A;  5M5X J;  2LK2 A;  1Y1W J;  1HCR A;  3S1M J;  3S2D J;  2FD5 A;  3CCY A;  4DYC A;  3A03 A;  1IDZ A;  3TP0 A;  4CYC A;  1GDT A;  2HOA A;  1JGG A;  3WHB A;  3Q0V A;  1TWA J;  4A3E J;  3HB9 A;  2DMQ A;  2M34 A;  5J1R A;  5EF6 A;  2R5Z B;  4M3F A;  2NVY J;  2DMN A;  1D5Y A;  2B63 J;  4D5C A;  3NAR A;  1POG A;  5EGO B;  3G1O A;  4V2F A;  4IHV A;  3S16 J;  2E2J J;  3GBG A;  1U9O A;  1APL C;  1T33 A;  5C3E J;  2DMP A;  5DS9 A;  2DN0 A;  4DZJ A;  1JTX A;  3IH2 A;  3TP3 A;  1YRN A;  3IH4 A;  5C4J J;  2OF7 A;  1MH3 A;  4AYB N;  3BTI A;  3OIO A;  4BY7 J;  2QF7 A;  3BR3 A;  3GTO J;  1G2H A;  5F0F A;  5IP9 J;  5C4X J;  2N8G A;  1ZTR A;  2Y31 A;  4MO7 A;  2EZI A;  2RAE A;  4MFD A;  3HOY J;  2M2E A;  3S1Q J;  2XGE A;  3BT9 A;  2HDD A;  4A3D J;  4UUS B;  2LVS A;  4IHX A;  1OJL A;  2W48 A;  3ZOB A;  4JYK A;  5IPA A;  1JKQ C;  1IV6 A;  1I6H J; 
#chains in the Genus database with same CATH topology
 2FBK A;  1HF0 A;  2V9V A;  4P9U A;  4EM1 A;  4ZZL A;  4CYD A;  4ZTJ A;  1SC7 A;  4HA8 A;  3RKQ A;  2YUS A;  2JN6 A;  2LP0 A;  3KZY A;  2GXA A;  3H3Z A;  4XOT A;  1BA5 A;  1YTY A;  1MMD A;  3FZV A;  1WH7 A;  1XSX A;  1MZB A;  3CC7 I;  1AKH A;  2W82 A;  3H9Q A;  3H0G J;  3TDZ C;  3K70 C;  2QQA A;  4M3G A;  2PX9 A;  2R4G A;  4Y3O A;  5FKN A;  5HDN A;  2XAH A;  1RR7 A;  2M8E A;  4XLA A;  1HQC A;  2O5R A;  2XRL A;  3OR2 C;  1WVR A;  2HZD A;  3GLL A;  3S3N A;  2QSH X;  5EGO A;  2VI6 A;  2EFP A;  2J5P A;  2WWY A;  4HLX A;  2JUG A;  1Z3X A;  3I58 A;  2E7W A;  4KIF A;  2HEO A;  3OV8 A;  2Z9O A;  4ENK A;  5A2Q Z;  1YO5 C;  3G1L A;  5FKK A;  2E2H J;  4D5F A;  2DJI A;  4UUS A;  1FY7 A;  4JX5 A;  3M9A A;  4XRF A;  5KHD A;  1VTN C;  3LSI A;  1BW5 A;  2GLO A;  1R36 A;  3G6E I;  2E71 A;  2WY7 Q;  4D0P A;  3J7Y J;  3NWT A;  4BEH B;  3UKG A;  2EIJ H;  3I4P A;  4Y17 A;  5HLI A;  3IRQ A;  2VXD A;  1TQP A;  5ILS A;  1W7P A;  3CJQ B;  4IPA A;  4HF1 A;  5A2Q K;  2QBY A;  1FYL A;  1PDN C;  4LG0 A;  2HS5 A;  2ME0 A;  1Z7U A;  5TRD A;  2IGK A;  2K4B A;  4G9Y A;  4XLP F;  2VQL A;  5H6Q A;  1WPK A;  1S72 I;  3K4J A;  2NVT J;  3S15 J;  1T98 A;  3GXO A;  2QSF X;  3CLQ A;  4ON0 A;  1IN7 A;  4G8X A;  2BVM A;  1ETW A;  5ICG A;  2QSG X;  5B1A H;  2BYV E;  2EWN A;  5HOD A;  3B6A A;  4FQG A;  5EJC A;  2DT7 B;  2LBF A;  3VDX A;  1TWG J;  5ICC A;  3PIP F;  2ZKZ A;  4G7O F;  2LH9 A;  3RYR A;  4XM3 A;  3BR6 A;  3W3C A;  3FK7 A;  1ZRF A;  4KIC A;  5FKM A;  3OOP A;  2NVU B;  5F0C A;  2D1H A;  1BBY A;  2ELK A;  1OYW A;  1OYY A;  1NG7 A;  2IW5 A;  3LSG A;  5JLW A;  3G71 I;  2PMZ N;  4AIJ A;  2BY0 A;  3SHF A;  3OYL A;  4RB0 A;  1HA8 A;  5DDG A;  1MKM A;  2OD5 A;  3HOZ J;  2M87 A;  2R0Q C;  3ABM H;  1MMS A;  4RGU A;  3H92 A;  1X1C A;  1Q1V A;  1B9M A;  3CCJ I;  3OOU A;  2EFN A;  3H5R A;  2UXN A;  2E36 A;  2DA7 A;  4I98 B;  1S5L C;  3I71 A;  1J5Y A;  2CQQ A;  3DKY A;  3LL7 A;  1ULY A;  4UUT A;  5AIP A;  5JHU A;  2OTJ I;  1YE9 A;  2EIN H;  5KNL A;  4RGR A;  5DD4 A;  1ZAO A;  1O3Q A;  5D6E A;  1QHH D;  2HVQ A;  4AC0 A;  5L3D A;  2KL4 A;  5CQE A;  2EV0 A;  3JTG A;  2DK5 A;  2LNB A;  3GFL A;  3K1M A;  1HC8 A;  2WAQ A;  1P92 A;  4EGZ A;  3BZK A;  2Z16 A;  2VQG A;  3WG9 A;  5GAG J;  4EMS A;  1V55 H;  1SD7 A;  2BHY A;  3DU6 A;  5LGN A;  2A68 F;  1HW1 A;  2Y48 A;  4ENM A;  2R7V A;  3JCU C;  2K40 A;  2NOG A;  5GTI C;  2VPL A;  4OIO F;  5FFX A;  4QLC U;  4FET A;  3VWB A;  3DEW A;  4A12 A;  1IXC A;  4XMY A;  2HVR A;  5EYR A;  3QOP A;  4QIW N;  4XKC A;  2R7D A;  1ZH5 A;  3ZQH A;  2L4A A;  1WJE A;  3IWZ A;  4A3M J;  1KYW A;  4BJ6 C;  3KP7 A;  2QZ8 A;  2H6B A;  5J1Y A;  1LEB A;  1DGW Y;  1E17 A;  1KU7 A;  1Y56 A;  2I5U A;  3H3U A;  1TNS A;  2JA2 A;  2R93 J;  4LLL A;  3PSF A;  2PLY A;  2Y9Y A;  4X1E A;  1JHF A;  3VOE A;  5HNF A;  2IEK A;  1VQ4 I;  4A0Y A;  2DDB A;  3OWT A;  1J0R A;  1EH8 A;  4DBR A;  1VQP I;  1SFO J;  1JT0 A;  2TRT A;  1ODD A;  1X4P A;  1Z05 A;  1TLH B;  2CW8 A;  2HYG D;  1MBG A;  4BE0 A;  1IO2 A;  2LDU A;  1K6O A;  2P7C B;  2XKP A;  4LMY A;  3WU1 B;  3DCF A;  4LIT A;  2ZFW A;  3HOX J;  1RPW A;  2RDP A;  4X6A J;  3ERE D;  1FPQ A;  2NVX J;  1ZYR F;  3TW7 A;  1QPI A;  4ZH4 F;  3E5Q A;  1TWF J;  3J80 Z;  2F5E A;  1H0M A;  1V4R A;  3HOW J;  2R7S A;  4HNU A;  2EIL H;  3KEQ A;  1MW7 A;  3SFZ A;  4EM0 B;  3JRG A;  2IS4 A;  4U87 A;  5JR3 A;  2L7M P;  5BNG A;  4B8X A;  4U7B A;  2H27 A;  1U2W A;  1D1B A;  3BR2 A;  3ML6 A;  3ASO H;  3DKW A;  2B0L A;  4WX9 A;  2NYX A;  2FSW A;  2IP2 A;  2EB7 A;  4OU0 A;  2QQ9 A;  3JW4 A;  1IRZ A;  4CCL A;  3I54 A;  1ETV A;  1NG6 A;  4NNJ A;  4YII A;  2ZJ2 A;  1JKP C;  1JTY A;  1HLV A;  2P5V A;  3JRA A;  3F3X A;  1HXD A;  1VQL I;  4GFB A;  2GIZ A;  1WRJ A;  2A69 F;  3FKI J;  3I0T A;  2FNP A;  4U7D A;  4A3J J;  2Z3Y A;  4EJW A;  3U1D A;  3KX2 A;  2CFX A;  1NTC A;  2NAZ A;  3D0S A;  3E0J B;  1YIJ I;  1F4K A;  4BNC A;  3CQZ J;  1AOY A;  3OR1 C;  3WGG A;  2GA2 A;  4XN0 A;  4A5M A;  1PYV A;  1PVE A;  3HEF A;  3RIR A;  5TGT A;  5GAH J;  5E17 F;  2E5N A;  1LFU P;  2HOT A;  3OYM A;  1FLI A;  1X58 A;  3CDL A;  4P9F A;  4M3B A;  4R8H A;  3HGG A;  1IN8 A;  2DK8 A;  3K1N A;  2VON A;  2R7Z J;  3DEU A;  4GRI A;  4CCN A;  3WTU C;  1TNT A;  3S32 A;  1SFK A;  3IRR A;  2MH9 A;  4G7Z F;  2G7H A;  1WI9 A;  4N4N B;  1ORK A;  3K2Z A;  3BG9 A;  2ZME A;  1O7L A;  3A0B C;  1G59 A;  4HV6 A;  1BR1 A;  3CP8 A;  2H8W A;  4GYI A;  4KMU X;  1Y0N A;  4A3G J;  2L2O A;  2A5W A;  1R4N B;  1XN7 A;  3TQN A;  1MJ9 A;  3MKL A;  2EV6 A;  3RDI A;  4C2M J;  2R7T A;  2W4S A;  2AQE A;  1TW2 A;  4C3J J;  1K6Y A;  1J75 A;  2KRC A;  3PSI A;  1S3J A;  3RKX A;  1X1D A;  4AIH A;  1QO0 D;  2Y75 A;  1W5T A;  3MKZ A;  1ZKG A;  1YHQ I;  1FOY A;  2V9P A;  4M73 A;  2HQN A;  3A01 A;  1DU0 A;  1Y39 A;  1QNT A;  3GTJ J;  1JT6 A;  4MLO A;  1ZHF A;  3ELK A;  4FT8 A;  1O3S A;  5LD2 C;  1WWX A;  4PGG A;  2DA6 A;  4PFP A;  3BG6 A;  4LJZ F;  3CCV I;  1GV5 A;  1ZGJ A;  1MDM B;  2LRD A;  3V7C A;  5J4V A;  2W00 A;  2L5Q A;  3OYH A;  4M6V A;  4BQA A;  1WFX A;  5BQT A;  1C0W A;  1RC9 A;  1WJB A;  3K6G A;  1FIA A;  3QP6 A;  5CKT A;  2QKL B;  5HDK A;  2CG4 A;  4CA0 A;  4DNC A;  4ESB A;  3RQ4 A;  4IHS A;  2DA2 A;  3DLA A;  2HDC A;  2CSO A;  1S8N A;  5IYD J;  3K4M A;  4IEJ A;  1KA8 A;  3E97 A;  1K61 A;  2EV5 A;  2CFO A;  3CJT B;  2P0W A;  2PEX A;  4ZTF A;  1VF9 A;  3MCZ A;  4XLC A;  4AID A;  3OIQ A;  4HF0 A;  2GIV A;  1W7P B;  1UJ8 A;  2MGQ A;  3DXJ F;  2A3S A;  3QYF A;  2GBY A;  2KZG A;  2O61 A;  4H0E A;  2E7X A;  2K7L A;  5K7Z A;  2K9S A;  3FK6 A;  2ESN A;  4IQJ A;  3WG7 H;  2VBW A;  3JTH A;  2RNG A;  1IW7 F;  3RZD J;  2XGC A;  3K70 D;  4M6Y A;  2QWW A;  2JSP A;  3JRB A;  3REO A;  2EZK A;  1BC8 C;  5E18 F;  1VZ0 A;  2CV0 A;  2GXB A;  1U0J A;  4DQ2 A;  4I99 C;  3QPT A;  5TJJ A;  1YQA A;  2X1C A;  1TC3 C;  1XGO A;  1IG7 A;  2IGN A;  1B8I B;  1FMV A;  3BCB A;  3RKY A;  2VIX A;  3WTT C;  2HPM A;  4GYG A;  1A36 A;  4CUG A;  3S3O A;  1R1V A;  2G0E A;  2E1N A;  4BHB A;  2L54 A;  3S93 A;  5M5X J;  2LK2 A;  3L00 A;  4CXF A;  1IDZ A;  3TP0 A;  4CYC A;  4RGX A;  2F2E A;  3WHB A;  1OLT A;  3O2P E;  4IX7 A;  1X1P A;  2DMQ A;  2Z2S B;  1XCV A;  2DMN A;  4MQV A;  4D5C A;  2BEO A;  3E5X A;  3PNY A;  2V1U A;  2FUG 2;  4V2F A;  4IHV A;  2JUC A;  1QZE A;  3S16 J;  2E2J J;  1X3U A;  3GBG A;  4ITV A;  3DTI A;  4BL0 B;  1T33 A;  4HYE A;  5C3E J;  1LQ1 A;  1FZP B;  1KU2 A;  4PJN A;  5L3F A;  1RUO A;  2DN0 A;  1OMI A;  3F72 A;  3F8B A;  2ZJP F;  5IY5 H;  3Q9S A;  4AYB N;  1O7F A;  4DBQ A;  5J8F A;  2Y0S A;  3VSK A;  4UVA A;  3GO5 A;  5CYV A;  3I56 I;  2ZXJ A;  2CYY A;  5F0F A;  2OBP A;  1G2H A;  4XSX F;  5IP9 J;  5C4X J;  3FBI B;  1ZTR A;  2KRF A;  2IGM A;  4OIP F;  4XSZ F;  5HS7 A;  2VT2 A;  5JI6 A;  5H6R A;  2XC7 A;  3S1Q J;  3ZN1 A;  2PMU A;  3AKZ A;  4UUS B;  2QEN A;  3CD6 I;  2MH2 A;  1TZL A;  3ZOB A;  1ZRD A;  1I1S A;  2VLA A;  2GA1 A;  5IPA A;  3K0L A;  3LSK A;  4G6D A;  5F08 A;  4MEY F;  2COB A;  3AG3 H;  4QPO A;  2R5Y A;  2KIU A;  5LGU A;  3BR0 A;  2NXN B;  4W97 A;  3OYI A;  4KIS A;  4RB2 C;  3VEP A;  3L2R A;  5DCM B;  4ZDP A;  4PSX A;  1FOX A;  1PP8 F;  3HXL A;  1QVT A;  4CZZ A;  5ICE A;  3K4L A;  2R3S A;  3HTS B;  4L9N A;  1U3E M;  4RMN A;  1T0F A;  1OKR A;  1GXQ A;  2VOP A;  3LSR A;  5L3E A;  1EJ9 A;  4UUV A;  5HNH A;  1MGT A;  2FBH A;  4F7Z A;  4LG0 B;  5FO5 A;  3HL2 A;  2VE8 A;  1Z9C A;  2LF8 A;  1JGS A;  4BH9 A;  2PJR A;  4F3Q A;  1RI7 A;  4L5I A;  3L9F A;  5K5O A;  2HYF A;  2Y0S N;  1K4T A;  2NNN A;  2QEX I;  2O9L A;  3F6O A;  1LNW A;  2FQ4 A;  3SFI A;  3DKX A;  5FD6 A;  3T5X A;  4PFO A;  1I1G A;  4PJJ A;  5FJ8 J;  5CVI A;  4AIK A;  3K4C A;  4L9J A;  2XPW A;  2JVH A;  2K3F A;  2YR2 A;  4M71 A;  5L3B A;  4A3K J;  3TL4 X;  5K1Y A;  3GTM J;  2XPU A;  2BGC A;  3KE2 A;  2YSR A;  1DDN A;  1MMA A;  1VI0 A;  3S1N J;  2IS6 A;  2K9Q A;  4UV8 A;  1B6A A;  1VFC A;  1TTY A;  1UG0 A;  1D3Y A;  3RPU D;  3IKV A;  2IVM A;  3WGI A;  1Y8Q B;  3ZXS A;  3F0C A;  4D9J A;  3M8E A;  3R4K A;  4BAC A;  2EPF A;  3KYD B;  1T2K A;  1J9I A;  1XGS A;  2A05 A;  2KP6 A;  3W2W A;  1FYM A;  4JBA A;  3J7A Y;  2HKX A;  4ENN A;  4HPQ A;  3HOT A;  2CV1 A;  2H6C A;  5ILU A;  5C44 J;  2PBI A;  2D45 A;  3BZC A;  2O7O A;  3H35 A;  1UMQ A;  1S9H A;  1PUE E;  2XAU A;  2KRH A;  4CH7 A;  3R0A A;  2R7U A;  2QQB A;  1VQO I;  2CQN A;  2CUE A;  3TED A;  5E3O A;  2KJB A;  1UCR A;  4D7N A;  1S7A A;  2AXT C;  2D2W A;  4IOA F;  4LIV A;  1T95 A;  2KQR A;  2LY1 A;  3HBL A;  2P6S A;  1LFB A;  1H89 C;  3OMY A;  1SAU A;  2LRE A;  1VQN I;  3EUH C;  3ZQL A;  4C2T A;  2VXZ A;  4AVP A;  3FIW A;  4RB1 A;  4KT5 C;  2DPD A;  2X51 A;  2M0M A;  3W6K B;  3PL8 A;  4XLN F;  2DOE A;  1O3T A;  4XL9 A;  4S0H B;  5BPI A;  3U9G A;  3BQY A;  3KIO A;  2HGC A;  3K9T A;  4H4K C;  1ZGA A;  3QOD A;  2IGO A;  1FYK A;  2M45 A;  2M7B A;  1CQT A;  2BOL A;  2HQ5 A;  1LE8 B;  5CVV A;  3DPT A;  3CC2 I;  1BN5 A;  5GTH C;  1MMN A;  5HLG A;  4S04 A;  1J09 A;  1ZK8 A;  5DM7 F;  1P4X A;  2KFD A;  4AWX B;  1FNN A;  1XMK A;  3HG9 A;  4BXF A;  5F0H A;  2QM3 A;  3P5J A;  3LOC A;  4UY8 I;  2EA4 A;  3CDH A;  3S17 J;  2CW7 A;  3A4C A;  1NHA A;  1XMA A;  3SYT A;  3IH3 A;  5K5Q A;  1U8R A;  4RAZ A;  2CU7 A;  2RKH A;  3OYJ A;  3QWL A;  3BJA A;  4PZJ A;  2CQX A;  3BTJ A;  4JK1 X;  4JQF A;  4F52 A;  3HDD A;  4WXH A;  1LUJ B;  2NNY A;  4RAG A;  1RR8 C;  1ZRE A;  4U0V A;  2JMW A;  1U8B A;  3OSG A;  2QYO A;  4WF2 A;  1REP C;  4FAS D;  3P9C A;  3ONQ A;  3IUO A;  2FJ1 A;  4E7H A;  2DT5 A;  3SQN A;  4RAY A;  3P9I A;  1I3Q J;  3CMM A;  2X0L A;  4FX0 A;  2ZJQ F;  3D5R C;  3KCC A;  1W36 D;  1R22 A;  3FXL A;  3GLX A;  3BQZ A;  3PNT A;  4XOP A;  4B1R A;  2XF6 A;  2PMZ A;  2IRF G;  2JVG A;  2VJ4 A;  4W1U A;  3FF5 A;  4FHT A;  2BXY A;  3CF5 F;  5KAI C;  1RZ4 A;  1WJD A;  2W85 A;  1ERD A;  1F36 A;  3TW6 A;  3Q0W A;  1BJA A;  2DFF A;  2EH3 A;  4I6Z A;  3JAM Z;  5DTD A;  5IP6 A;  3ZMD A;  2L01 A;  3LFU A;  1FSE A;  1XTA A;  2XAS A;  3CO6 C;  3CP2 A;  2RC4 A;  5J40 A;  1P4W A;  4FCY A;  3FXR A;  2DT6 A;  1S7E A;  5LHG A;  3MMY B;  2COM A;  1MMG A;  2TDX A;  1LVA A;  3ZR8 X;  3IP4 B;  4BU2 A;  1ETY A;  1WJ5 A;  3MEX A;  3SZP A;  3F6V A;  1U6G A;  2R7F A;  1X3W B;  4QWQ A;  3ZMT A;  3FWE A;  5IP7 J;  2R7X A;  4YIF A;  4ENJ A;  2NS7 A;  1XC5 A;  3WTY C;  2EK5 A;  2LD5 A;  1ON1 A;  3CMY A;  3SEZ A;  3C18 A;  3F8N A;  3WU2 C;  2EJR A;  2BBY A;  3PJR A;  4M72 A;  4Y52 J;  3IAM 2;  5TIS C;  3WTV C;  2O3F A;  3D5L A;  2MW8 A;  2UUZ A;  2DO7 A;  3BJ6 A;  1GT0 C;  3ZCO A;  4KDP A;  1J2X A;  1YW9 A;  1IXR C;  2ICW G;  2V1N A;  4A2U A;  1ETQ A;  1LDD A;  2FQ3 A;  1B72 A;  4NHJ A;  2XV4 S;  4L5J A;  2LMD A;  4UB6 C;  2L9R A;  2MD5 A;  4RM3 A;  2V26 A;  2JRM A;  2VN2 A;  5JVG F;  1HBX G;  4BQO A;  2C6Y A;  2L3D A;  2V7F A;  1ON2 A;  4BHC A;  3DBL B;  3M7G A;  1WCM J;  2LOO A;  2KDZ A;  3KYL A;  3GFI A;  1JUM A;  1XSV A;  4A3F J;  1WJA A;  1F1Z A;  2GAU A;  1Z21 A;  3J7Z I;  3PQJ A;  2LLK A;  1L3L A;  3HJE A;  4LG3 A;  1SAN A;  3BTC A;  2OAZ A;  3CME I;  1DP3 A;  2DFI A;  1OR7 C;  2V4J C;  3BWG A;  4ABZ A;  2IA1 A;  4N9H A;  4XRS G;  1D8J A;  1OYI A;  1FBQ A;  2JZY A;  2BZT A;  3H5A A;  2F5F A;  4BXX J;  1QQI A;  4XLE A;  2HVS A;  4E7Z A;  3L7W A;  3HRS A;  1MDM A;  4L9V A;  2HXI A;  3CUQ B;  2DAO A;  4BGD A;  1H88 C;  3ERM A;  4BQQ A;  1MIJ A;  5LHH A;  2DW4 A;  2ZME B;  1D5V A;  2M4G A;  5JFR A;  3JRI A;  4PJM A;  1XCB A;  4WK8 F;  4NUB A;  3DP7 A;  4NC7 A;  3IHU A;  3ZGK A;  4G7H F;  5FB2 A;  5IT9 Z;  1YS7 A;  2BHZ A;  2JPB A;  2P5L C;  3M1E A;  5CLS A;  3KP4 A;  3PUF A;  2FX0 A;  2IBD A;  5KAF C;  3PQK A;  4OOI A;  3C2B A;  5JHF A;  3KLO A;  1YIO A;  5F04 A;  2EZH A;  2P6T A;  5D5X B;  1LPQ A;  1HKQ A;  2OU2 A;  3T8T A;  2M7A A;  3T1B A;  1B72 B;  2VPR A;  1FOK A;  2PN6 A;  2X6W A;  1GV2 A;  1YJW I;  5M5Y J;  2IS1 A;  1PJR A;  1N78 A;  2IS2 A;  2JPC A;  2DMU A;  2ZNZ A;  3KYC B;  5EZG A;  1OCP A;  4RDU A;  3VB2 A;  4UB8 C;  4L5E A;  4IXA A;  3KZZ A;  3C1D A;  1JKO C;  3AL0 B;  5IYB J;  3KP6 A;  2PFB A;  4IHW A;  4IL6 C;  4M74 A;  4P1W A;  4ESF A;  3QOE A;  2O8K A;  3NQO A;  1BIA A;  5GP9 A;  3L2V A;  2HTJ A;  1Y8R B;  2YPR A;  2I10 A;  3KEY A;  4MNU A;  4KMF A;  4ZYA A;  5J8C A;  2XSJ C;  1LE8 A;  3IWF A;  3VYU B;  1YX3 A;  1PUF B;  2PJP A;  2M3A A;  2ZO4 A;  2ID6 A;  3ABL H;  3JRC A;  1EH6 A;  2FXA A;  1KON A;  2V6C A;  2R7O A;  1IDY A;  1E3O C;  1RUN A;  3RYP A;  1VQ5 I;  3H3V K;  5E79 C;  3BC8 A;  1WJC A;  2CRG A;  2K9L A;  3HUG A;  3NWS A;  4A5N A;  3BG5 A;  3HRM A;  5ED4 A;  2EIM H;  4HF2 A;  4I09 A;  4HQM A;  2M8G X;  3J81 Z;  3HOS A;  2E1C A;  1FIP A;  1ZR2 A;  3MVP A;  2Z5U A;  3TO7 A;  1OFC X;  3ZP5 A;  3HZJ A;  2QCO A;  3C2H A;  4FE7 A;  2X6X A;  1NK3 P;  3BOQ A;  3WTZ A;  2O8X A;  2CUJ A;  5E20 A;  2E1M C;  4B48 A;  4LB5 A;  1WJF A;  2IJL A;  2QLZ A;  2ZXH A;  3KLN A;  4ZYG A;  1KQ8 A;  1HDD C;  4IQ4 A;  5J3L A;  3ZMZ A;  4BQN A;  1KGS A;  1U9N A;  4V2G A;  2E1O A;  2WY8 Q;  5K7H A;  1K79 A;  1USS A;  2JK3 A;  1YI2 I;  3IV5 A;  2ZB9 A;  4BS9 A;  2YU3 A;  4M3E A;  5K7F A;  2DFH A;  4Y7N J;  1JE8 A;  1R23 A;  3BR1 A;  1XGN A;  2ZCW A;  2X4H A;  4A0Z A;  3CLO A;  2UZK A;  3S14 J;  3KZI C;  2A6H F;  2DCE A;  4J01 A;  3UNG C;  1NH3 A;  3EUK L;  3EYI A;  1GXP A;  4CSW A;  2G9W A;  2XAJ A;  4E4H A;  2WC2 A;  2Y9Z A;  1Y1W J;  1B9N A;  3S2D J;  2FD5 A;  4XBF A;  4DYC A;  3ABT A;  4HST A;  1GDT A;  1S7O A;  6PAX A;  4DOZ A;  3IC7 A;  3I9V 2;  4UVB A;  1CF7 B;  5EEG A;  1YOV B;  5CVU A;  4U0Y A;  5J1R A;  3KPH A;  3CCE I;  1YW8 A;  3W2A A;  1POG A;  2XGX A;  1VQM I;  4E7S A;  3WTX C;  1UST A;  2O6G E;  1XDS A;  3C2G A;  3OYF A;  1APL C;  4CGZ A;  5DS9 A;  2FNA A;  5E8G A;  2DFE A;  3DBH B;  3IH4 A;  3JAM K;  1W36 C;  3BTI A;  1WZ2 A;  2F4O B;  2WAE A;  2QF7 A;  3OYA A;  2WAD A;  4IOC F;  4BEH A;  1BI2 A;  3GZ5 A;  3I53 A;  2K5C A;  4E7I A;  4A6D A;  3LSM A;  1Z3Y A;  2N8G A;  4HG2 A;  2Y31 A;  3C7J A;  2RAE A;  3H9G A;  4MFD A;  4EJT A;  3G3Z A;  3HOY J;  2M2E A;  3F8C A;  1TQM A;  1I3A A;  2XGE A;  3BT9 A;  2LKP A;  3HC7 A;  3L2Q A;  4IHX A;  1UZC A;  2W48 A;  4NB5 A;  5D5U B;  3LWF A;  1R49 A;  5DM6 F;  1BC7 C;  1I6X A;  3N05 A;  4B44 A;  4O3M A;  4JYK A;  4C9Y A;  1HKS A;  3AG2 H;  2FA5 A;  2MFZ A;  5D4S A;  4Y33 A;  4OAZ A;  5J1U A;  4BDY A;  2L9N A;  2DTZ A;  2XRO A;  1F5T A;  1T56 A;  4OIQ F;  2LKS A;  1MBF A;  2W7N A;  1UHW A;  1OQY A;  1UG2 A;  2DBB A;  5B1B H;  2F4M B;  4E7J A;  3DV8 A;  2VKV A;  5ILV A;  2GWR A;  5E3N A;  2CS3 A;  2OUM A;  2WA0 A;  3AFH A;  3TMO A;  1LJ9 A;  2DI3 A;  1VQ7 I;  2E19 A;  1M1E B;  3OL3 A;  3LA3 A;  3E1S A;  2DOF A;  1J59 A;  1A5J A;  3F8M A;  1TQI A;  4I0B A;  3U1K A;  4HQE A;  1A6Q A;  1X1A A;  3VYR B;  1SEU A;  1O4X A;  3CC4 I;  4ZYE A;  3CCR I;  4Y13 A;  5E1X A;  1MBH A;  1IUF A;  4PDK A;  2NVQ J;  3E5U A;  4F91 B;  1R9T J;  2FML A;  1YIT I;  2VB6 A;  3ZRG A;  3OYG A;  3LAJ A;  3FHZ A;  2ACJ A;  2GQQ A;  1YJ9 I;  2H94 A;  1T38 A;  4IVN A;  5F1R A;  2K3P A;  3RKW A;  4OIN F;  1IN4 A;  2M30 A;  4RM2 A;  2F5V A;  1R4M B;  4HRI A;  2BY3 A;  2CO5 A;  3E7L A;  4Z2Y A;  1RET A;  4A3C J;  3V7R A;  2R5Y B;  2HR3 A;  4PK4 A;  3RQI A;  4UV9 A;  1I39 A;  1T6S A;  5FFZ A;  2P7V B;  4KIT B;  5LLQ A;  5FLX K;  3A02 A;  1U5T B;  1N77 A;  4HNT A;  1ETO A;  3EET A;  3H9J A;  1XB4 A;  2ZSI B;  1FBU A;  2X9D A;  3KP3 A;  4GDF A;  1ETK A;  1S6L A;  3LMM A;  3LST A;  4HNV A;  1X3Z B;  1D0Z A;  4XRS A;  3DPU A;  4BDZ A;  1W0T A;  4HX8 A;  2KIQ A;  1IGN A;  3DEE A;  3OS2 A;  2WV0 A;  4XON A;  4L18 B;  1TBX A;  5E3L A;  2JA5 J;  3L2U A;  1FWZ A;  4BY1 J;  3F9K A;  4DYR A;  2DA5 A;  4KT6 A;  2LY9 A;  2HKO A;  3LFK A;  5EDN A;  2WBM A;  3HUG B;  2E2I J;  4NBQ A;  2FU4 A;  5DYM A;  1AHD P;  2QKM B;  2PJR B;  1G3T A;  2IA2 A;  1QRY A;  3MWM A;  2XAF A;  3CCL I;  2Q8K A;  5M3M J;  1VQK I;  4IHY A;  3TDU C;  2MBF A;  1P7J A;  3R61 A;  1B4A A;  3QPS A;  3O6B B;  2E34 A;  2K4J A;  1BI1 A;  4GGG A;  1E2X A;  4XRM A;  2RQP A;  3QYE A;  2MSY A;  3GZN B;  2QUF A;  4B47 A;  3K7A J;  3MD2 A;  2EZL A;  2QGU A;  2RGV A;  1OR7 A;  3WE3 A;  3DFG A;  3FXJ A;  3GTG J;  4YEJ A;  2DOA A;  2X6Y A;  4G6Q A;  3T8R A;  2LKX A;  3V8J A;  3EUA A;  3RPQ A;  3BY6 A;  3WE2 A;  2VOD A;  3I4N J;  1FT9 A;  5IOY A;  4WWC A;  1XG1 A;  1U78 A;  1ACI A;  2FOK A;  3OYE A;  4ZYD A;  2LC2 A;  2Y2Z A;  1MBE A;  5D8L B;  5HS8 A;  1ENH A;  5BOX A;  2W25 A;  2BXZ A;  1FTT A;  4M9X A;  3IL2 A;  4MHG A;  3CCM I;  3HM5 A;  4LLN A;  4RLF A;  4II3 A;  2VKH A;  1BOA A;  2CV2 A;  3CES A;  1GHC A;  1BIB A;  1PP7 U;  3LSP A;  4CYC B;  2A5Y B;  1Z7L A;  3JSO A;  4N4O B;  4MTE A;  1FSH A;  5E1Z B;  3WHC A;  1TWH J;  1IF1 A;  2HOE A;  4XQF A;  4CZC A;  4ZDO A;  3F23 A;  2HXO A;  4C2U A;  4E7K A;  1R7J A;  2HFH A;  1I50 J;  1FX7 A;  2L7K A;  2XB0 X;  5LHI A;  5M3F J;  3G73 A;  3FM5 A;  4G6T B;  5LBQ A;  3HOV J;  1DU6 A;  5FLM J;  2DXI A;  3GTL J;  1X1B A;  5ERI A;  2WAF A;  3BPV A;  1P9Q C;  2QA4 I;  1JKR C;  2ELH A;  1IV8 A;  2IPQ X;  4YFN F;  3H1C A;  1W1W E;  1MJB A;  2K86 A;  4UXN A;  3VYT B;  1JHH A;  3FX3 A;  1VQ6 I;  1X2N A;  3CJN A;  4A93 J;  1BL0 A;  4C30 A;  4FIS A;  2HNH A;  1BJZ A;  1RES A;  4TV7 A;  1BOB A;  5GPC A;  1R1T A;  2XB5 A;  1P4A A;  2MLK A;  3KEO A;  1BR2 A;  4AVZ A;  1QA6 A;  2VAS A;  3K4B A;  5BS6 A;  4YRV A;  4M6X A;  3L2W A;  2BV6 A;  1XMX A;  3AL0 C;  2MAB A;  4MFE A;  2JA7 J;  2K85 A;  3SDG A;  3OIP A;  1GVJ A;  3SDB A;  4BJT A;  2ZNY A;  3GME A;  2XPV A;  1Z67 A;  3RJP A;  2PI0 A;  4Y4R A;  4KN4 X;  1FJL A;  3SZG A;  2ZME C;  5B5E C;  1HW2 A;  4BE2 A;  2OA4 A;  4A3L J;  2O0Y A;  5B3S H;  2MYS A;  1KQ0 A;  2X6O A;  2ETH A;  3IKT A;  2KPM A;  2DYS H;  2GZW A;  1SD5 A;  4D7M A;  3NAU A;  2OZ6 A;  3FIS A;  1A6I A;  2Q2E A;  5IT3 A;  1Z6R A;  4V19 K;  2DU9 A;  4A6E A;  2HWV A;  3AG1 H;  1VND A;  2XVC A;  4P5O A;  5DUI A;  3GTK J;  2ESH A;  1CGP A;  2KKO A;  2CQK A;  3K1P A;  5B66 C;  2KHM A;  4UVC A;  1V5G A;  3HGY A;  3N97 A;  3QRF F;  5FLV A;  2VBY A;  3K10 A;  4D1Q A;  1OPC A;  3MAJ A;  2J5O A;  2STW A;  1Y6I A;  4YFK F;  2FOW A;  2DOD A;  2ISZ A;  1ZG5 A;  2OC6 A;  1QVU A;  2W24 A;  3KFW X;  3HPG A;  1ZGW A;  1ZN2 A;  1JI8 A;  2JWT A;  1TP4 A;  2LYC A;  1E3H A;  2W84 A;  2XF5 A;  5H20 A;  4B3A A;  1XX5 A;  2KT0 A;  3OL4 A;  1AWC A;  4B09 A;  4C3H J;  4FX4 A;  1SFU A;  2VKE A;  1L0O C;  4G12 A;  2ISY A;  2CW0 F;  2EA2 A;  2WAQ N;  2M9H A;  5FGM A;  1OCT C;  3CCQ I;  2H1K A;  3BZ6 A;  3HHG A;  3F22 A;  2X85 A;  5CPR B;  5LEK A;  4ESJ A;  5CJ9 A;  4XLH A;  3Q5F A;  1A04 A;  3LQQ A;  4M9Z A;  3MN2 A;  1HW5 A;  4JX4 A;  3I3L A;  2CGP A;  3K4K A;  3MFK A;  3ZPL A;  1IAW A;  4N9I A;  5FKL A;  2KDO A;  2Z1D A;  3F21 A;  1IRX A;  4PGH A;  1DQU A;  4ZDL A;  3ISP A;  4I01 A;  2VJJ A;  3DU5 A;  3QPL A;  4A69 C;  2DDA A;  1ONV A;  5GAE J;  1ZLJ A;  4DYQ A;  2LR8 A;  3QPH A;  4AUX A;  2VC1 A;  3MZY A;  4II2 A;  1LEA A;  4U0W A;  4OWR B;  3M1C A;  1LFP A;  3ROU A;  5DEQ A;  4BBS J;  3COA C;  4RS8 A;  3V42 A;  1YYV A;  2ECC A;  1MNM C;  2FRH A;  1JXS A;  1K4S A;  3V8L A;  2P8T A;  1FC3 A;  4CCK A;  4LFU A;  3GX4 X;  3MZ8 A;  4I7H A;  4KNY A;  1O57 A;  4K2E A;  3FXU A;  3QAH A;  2F48 A;  1XDU A;  2F5C A;  1D1C A;  2VQC A;  1QZY A;  3TOA A;  4M3D A;  4XID A;  4PCQ A;  5BPD A;  4XKV A;  3K4N A;  1MD0 A;  1LDK B;  2E1M B;  2CJJ A;  3KP2 A;  5LRR A;  3PIO F;  4A3B J;  4BXU A;  2JRT A;  4J19 A;  1HDP A;  3LQR A;  1FBS A;  4ZZD A;  5FRN A;  3UR3 C;  1K83 J;  3KP5 A;  4A3I J;  1E0E A;  4GO1 A;  1BR4 A;  3ZQI A;  4HDV A;  3FXK A;  3U2R A;  3W6J B;  3QYB A;  1A31 A;  1YG2 A;  4R79 A;  4G94 A;  1QZZ A;  3OSF A;  4QPQ A;  1X2M A;  2HDW A;  1N25 A;  3QU3 A;  4GXO A;  1GUU A;  4HOB A;  2DTR A;  2WB1 N;  2LF7 A;  4NQW A;  4XKW A;  1DUX C;  5KK1 A;  3QU6 A;  1V5F A;  2B7E A;  2OPT A;  3BDD A;  4HDU A;  3EPZ A;  2XKO A;  1FEX A;  4C3I J;  2PG4 A;  3VOD A;  1FMW A;  1BI3 A;  4FTH A;  5K5R A;  4ZC3 A;  2WV1 A;  1E3P A;  4XKB A;  2FEZ A;  1K7A A;  2XAG A;  1V5E A;  1TWC J;  3I59 B;  4XIC A;  2E35 A;  2FMY A;  1ZLK A;  4KFC A;  4BE1 A;  2MA3 A;  2IA0 A;  4EEF G;  3OS1 A;  1TL8 A;  1UHM A;  1SFX A;  3W2V A;  3ZQF A;  2ADU A;  1YJN I;  4GCV A;  5L3G A;  5J4Y A;  3BJO A;  3VFZ A;  3FMR A;  1ZR4 A;  3CTA A;  2BW3 B;  3LA7 A;  2ZXI A;  4IRI A;  3CMA I;  3S2W A;  2JTV A;  3HKZ A;  3PM1 A;  1IC8 A;  1F43 A;  3A1Y A;  2YX7 A;  5H2F C;  3O8H A;  2XUB A;  1WGX A;  2ECB A;  4FE4 A;  2E5Z A;  3GTQ J;  1OCC H;  4XK4 A;  3O8G A;  3S3M A;  3DQV C;  2G7U A;  3WU0 A;  2Y30 A;  4DZP A;  3IAS 2;  3NEU A;  3DPL C;  2CMP A;  2ME6 A;  5F27 A;  1H9G A;  3QQA A;  4BJ5 C;  3GZ6 A;  1QPM A;  2AHQ A;  3CUQ A;  1HCR A;  3S1M J;  3A03 A;  1AA7 A;  2E60 A;  4KA4 A;  1Y0U A;  4OAY A;  2HOA A;  3WTS C;  2RV8 A;  4A3E J;  1TWA J;  3FKJ A;  3HB9 A;  4PJL A;  4M3F A;  2NVY J;  4RGS A;  1OIS A;  1D5Y A;  2B63 J;  5GAD J;  5EGO B;  1N75 A;  2ELJ A;  2EIK H;  1Q1H A;  3GW2 A;  2YX4 A;  2OZU A;  3P7N A;  4LGW A;  1SAX A;  2QBY B;  1JTX A;  3OYC A;  2KIF A;  3FXQ A;  5BMZ A;  2JT1 A;  3E3V A;  4WCG A;  1B1B A;  5C4J J;  4CIC A;  3QP5 A;  5D8K B;  3OIO A;  3Q9V A;  4LK1 F;  2F5D A;  4I0A A;  4PUS A;  3BR3 A;  3GTO J;  2Q1Z B;  1R6R A;  2HQR A;  2GXG A;  4MO7 A;  3GFJ A;  3H5N A;  5HLT A;  1LDJ A;  4DGW B;  2KZV A;  4AU7 A;  2HDD A;  1IXS B;  4A3D J;  2LVS A;  1FP1 D;  1OJL A;  1R1U A;  4CCM A;  3DTK A;  3MKY B;  2BVL A;  1HKT A;  4LK0 F;  5LGT A;  4WXD A;  1JKQ C;  3AG4 H;  1IV6 A;  1I6H J;  5E8I A;  2OJE D;  2A61 A;  4EJU A;  1T8I A;  3PO3 J;  2Y69 H;  1Z91 A;  1UHS A;  4IJA A;  3JRF A;  1S29 A;  2DA3 A;  3ULQ B;  3FDY A;  1MBK A;  1P6R A;  3WOD F;  1SVO A;  1TT5 B;  4LD5 A;  2KIS A;  2HI3 A;  3OYD A;  3HPH A;  3BG7 A;  1G3S A;  4IKF A;  3CJR B;  3ESW B;  4ZJZ A;  1STZ A;  3L1P A;  3TBI A;  3W6V A;  3BR5 A;  4Q5S F;  3H0D A;  2RN7 A;  4DW6 A;  4HW0 A;  2NRA C;  1Z6T A;  4KYW A;  4JOM A;  1H9T A;  1ZRC A;  2MD0 A;  2VL8 A;  3TGN A;  1WI3 A;  4EGY A;  3EYY A;  4BYY A;  3ZQC A;  2X1D A;  4X0G A;  1QU3 A;  2VUM J;  2R7R A;  3CUO A;  4Y15 A;  4I02 A;  4AD9 A;  4QSH A;  2A07 F;  5EG0 B;  5ICF A;  3Q0U A;  3JRD A;  2V79 A;  2LG4 A;  3SZT A;  1W5S A;  2AS5 F;  4E7L A;  2DA4 A;  3HOU J;  4HBL A;  2XF7 A;  5JLX A;  4WXC A;  1SVL A;  3PUB A;  1QBJ A;  4HV5 A;  2KJC A;  2HTS A;  3TKY A;  2F4I A;  3BPX A;  1IN6 A;  1G6N A;  1R00 A;  3DTE A;  5EG0 A;  1BM9 A;  2TCT A;  3OYK A;  1JUS A;  1LB2 A;  2GOM A;  3K2A A;  5HS9 A;  1VQ9 I;  2CUF A;  3BRO A;  2YU9 J;  1P7I A;  3G4S I;  3NRV A;  3GF2 A;  2DJN A;  3KET A;  4KIG A;  4S05 A;  3JSP A;  1MNE A;  2OTL I;  3GTP J;  1W4M A;  1YW7 A;  3HSF A;  2VBZ A;  1ZG1 A;  2XGD A;  2Z33 A;  4HSR A;  1WHU A;  3ECH A;  3R60 A;  4KJZ A;  1U5T A;  3FMQ A;  2X48 A;  3AAF A;  3V4G A;  3X2Q H;  4MGR A;  4E70 A;  4OMY A;  3V7S A;  5FRO A;  1JUP A;  1Z1D A;  4CHU A;  4Z6Y A;  9ANT A;  3EDP A;  4LB6 B;  4EM2 A;  3FMS A;  2MLG A;  1SD4 A;  2RRE A;  3DLL F;  3B6C A;  4ASN A;  5AIQ A;  1P2F A;  1OCO H;  2HQA A;  3Q3S A;  3S2H J;  2CUZ A;  4O5V A;  3ZN0 A;  1QHG A;  1T0F C;  1G3W A;  4KIB A;  2YS9 A;  3ECO A;  4XNF A;  4Q47 A;  1X4O A;  2WTE A;  2ZC2 A;  4EJO A;  1MSF C;  3P9K A;  3CF2 A;  2LFB A;  2PQ8 A;  4MEX F;  2R5Z A;  4RB3 C;  3PO2 J;  2BW3 A;  3HRT A;  4MIM A;  1I5Z A;  1FP2 A;  4B43 A;  4BAY A;  1AKH B;  3PNV A;  2LBF B;  2W1O A;  5DCM A;  4RBO A;  1K78 A;  2FF4 A;  2P5K A;  3I55 I;  4JX6 A;  1KQ9 A;  3HKZ N;  4AM3 A;  4NC6 A;  2V6E A;  2VOO A;  2CWE A;  2VKD A;  1FTZ A;  4RAF A;  1LKX A;  2OV7 A;  2P81 A;  3HSE A;  4NC8 A;  2WB1 A;  3GVA A;  4DJA A;  5LRS A;  1B59 A;  1W0U A;  3R6S A;  2A6T A;  2HPI A;  2VC0 A;  3CDI A;  3D5S C;  4YIR X;  2L7F P;  2L9V A;  2UV1 A;  3RZO J;  2K9N A;  5E3M A;  3HTU A;  1W5C C;  4BUP A;  2L4M A;  3G2B A;  3RCO A;  2GM4 A;  4L0Z B;  1FOW A;  2KLO A;  3E6C C;  3JRE A;  2EFW A;  4Q4Z F;  3S1R J;  1IJW C;  3M8J A;  1YRN B;  3I4M J;  2D5V A;  3A2K A;  1UFM A;  4F93 B;  2DYR H;  3CO7 C;  2B9S A;  2VQH A;  5KCM A;  1QGP A;  4RLQ A;  3GCM A;  2JA6 J;  3ZQG A;  1MND A;  1TT0 A;  3M07 A;  3LSH A;  4LOC A;  5D4R A;  5CQG A;  4P55 A;  2RNJ A;  3T0Y A;  3EUH A;  4J00 A;  3TO9 A;  1YX5 A;  1UAA A;  1XD7 A;  2EFO A;  2DQL A;  2JSC A;  1SMT A;  4N0B A;  4NDL A;  3N4M A;  2DA1 A;  4EVI A;  2MC4 A;  3CCU I;  5HLH A;  1R71 A;  2ZBK A;  3F8F A;  3SXY A;  2K9M A;  4I2O A;  2JA8 J;  4R1H A;  2K27 A;  4LLG F;  1HST A;  1XGM A;  3VSL A;  1MJA A;  5LEJ A;  1PUF A;  4IF4 A;  2XRN A;  1B8I A;  3E6B A;  2AO9 A;  3BP8 A;  2KMU A;  2KIM A;  3DBR B;  5D5V B;  1F9N A;  1W7P D;  1T39 A;  5J47 A;  2X1E A;  4HX7 A;  4RA2 A;  1SVM A;  1BW6 A;  5IYC J;  2AQF A;  3B02 A;  3TO6 A;  1H8A C;  2DMT A;  2XDV A;  2HYJ A;  4XR6 A;  2DQR A;  4UNO A;  3SJM A;  1RKW A;  3ZMS A;  2A6E F;  3TOB A;  4HLY A;  2DLL A;  4F55 A;  2P4W A;  3RPU A;  1CF7 A;  1IRG A;  3HIF A;  3J7A O;  4IHT A;  2HOS A;  2NS0 A;  3FM3 A;  3MKW B;  4E6K G;  3ZQ7 A;  2EQR A;  5F6F A;  5L3C A;  1WSU A;  1XSD A;  5GPA A;  3E6M A;  3GEZ A;  1D8K A;  1MBJ A;  3RSN A;  1HSJ A;  3LSJ A;  1ITY A;  3V8K A;  1DP7 P;  2ID3 A;  5IT9 K;  1R5H A;  1OCZ H;  2XHK A;  3SEQ A;  2XSD C;  3U21 A;  2IXS A;  3FXM A;  2ZJR F;  2VBX A;  4LIU A;  2W57 A;  2JQ7 A;  3OS0 A;  2OCE A;  3LNQ A;  1HOM A;  5FRM A;  3FHN A;  2M0C A;  3M4O J;  2NOJ B;  1LVK A;  5CVR A;  2Q0O A;  4YEL A;  4CCO A;  4IRG A;  2BE5 F;  2ZXW H;  3VPR A;  1RNL A;  3HSR A;  5DD8 A;  2OQR A;  2RVC A;  1YFH A;  2L0K A;  2M5W A;  4P96 A;  4NQW B;  2K02 A;  2D1V A;  1JJ6 C;  1J7K A;  1JJ8 C;  3OY9 A;  1XPX A;  3WTW C;  2F6C A;  2Q2E B;  5JVT A;  4HX4 A;  4QTR A;  2R92 J;  2JJ7 A;  2M4K A;  1EH7 A;  2AXL A;  5F64 A;  3G1M A;  5DUK A;  3I64 A;  3A01 B;  1X19 A;  5KVR A;  3EQL F;  5M5W J;  1YS6 A;  3LA2 A;  1RKT A;  3I59 A;  4F92 B;  2L9S A;  5IOZ A;  4PJ0 C;  3BG3 A;  4EJV A;  2VJ5 A;  1SD6 A;  1G3Y A;  4DIQ A;  3WGH A;  2Z99 A;  2RQQ A;  1WH5 A;  1WKM A;  1D0Y A;  2GOX B;  4YFX F;  2H1L A;  5DCF A;  2LTP A;  2V1X A;  1DPR A;  4BKX A;  4L0Y B;  3ZMU A;  3J80 K;  4IRH A;  4BHP A;  2FE3 A;  3I5U A;  4IO9 F;  3FBN B;  4Q48 A;  1BI0 A;  4ANJ A;  3E6D A;  5J6X A;  2EFQ A;  4OMZ A;  1IN5 A;  2NS8 A;  3DWL E;  3MQ0 A;  2DPU A;  3CUQ C;  3VYS B;  4I76 A;  3OYN A;  2MG4 A;  3H36 A;  4MTD A;  4BBR J;  5FLX Z;  3ZQQ A;  5HOO A;  2BY2 A;  3D1N I;  4ETS A;  1KYZ A;  3BTL A;  1EA3 A;  1I27 A;  1MSE C;  3GYH X;  1RRJ A;  1V3F A;  2L02 A;  2IAI A;  1EV7 A;  3GFM A;  2OCC H;  1NK2 P;  4ZYH A;  1Z0X A;  1EF4 A;  1AU7 A;  4CCJ A;  4U88 A;  3L2C A;  2XIG A;  1R5G A;  1DGR M;  1TW3 A;  1RIO H;  4CDG A;  3PFY A;  2EBI A;  2ZFU A;  4O6J A;  2V1D A;  1O3R A;  1G8X A;  3C3W A;  4A0X A;  3BLY A;  5EZH A;  3CZ6 A;  4OIR F;  2IT0 A;  2BY1 A;  1IZ1 A;  5EEH A;  1ZQ3 P;  4JP0 A;  4HZF A;  1IRF A;  1R58 A;  2L7Z A;  1EKE A;  3HHH A;  1ETX A;  1GVD A;  2R7Q A;  1D1A A;  2CH0 A;  2UXX A;  2OQG A;  1A35 A;  4AYB A;  4UHT A;  4PSW A;  3HYI A;  1SFE A;  3J81 K;  1ZG3 A;  1DPU A;  3A0H C;  4EQQ A;  3RI4 A;  5CVJ A;  1Y1V J;  2Y0M A;  1Z77 A;  5F1J A;  3ABK H;  4XN3 A;  1YLF A;  2MC3 A;  5LFA A;  2HU9 A;  1G4D A;  1R5I D;  3DF8 A;  1V54 H;  4B4C A;  3CCS I;  1ZAR A;  3JR9 A;  2UWM A;  3BCA A;  4HEA 2;  3JRH A;  3B73 A;  2H8R A;  1MH4 A;  5FKO A;  1XS9 A;  2HZT A;  5EEA A;  3M3Y J;  3O3K A;  3FXO A;  1K78 B;  3CCY A;  5HDG A;  4HAM A;  3GWZ A;  5DV5 A;  3RTR A;  1JGG A;  1D0X A;  3Q0V A;  2STT A;  1OCR H;  1UEL B;  2M34 A;  1GLN A;  1WQ2 A;  5EF6 A;  2R5Z B;  2XAQ A;  4XOR A;  1IUY A;  1U5T C;  2FBI A;  2I8D A;  4M9S A;  3ASN H;  3NAR A;  4L9T A;  1KU9 A;  3G1O A;  4IZZ A;  1T08 B;  3ZMV A;  4KN7 X;  2R7W A;  5D5W B;  2O03 A;  3M8F A;  2VJI A;  1U9O A;  2M1B A;  2LY2 A;  2VT3 A;  5FD5 A;  3HRU A;  2DMP A;  3LAP A;  4CO8 A;  4B3X A;  3K69 A;  4DZJ A;  4KUM A;  3L09 A;  3MZH A;  3IH2 A;  5AON A;  3TP3 A;  1YRN A;  2OF7 A;  1MH3 A;  3OYB A;  2H09 A;  2ZSH B;  4BY7 J;  5HVQ C;  3S8P A;  2CQ7 A;  5E1W A;  3PFI A;  1SMY F;  4XLF A;  1UB9 A;  3ABU A;  2LSO A;  2EZI A;  2V9K A;  2VE9 A;  4EV0 A;  1KU3 A;  3R0J A;  2PMH A;  1KZH A;  2QQ8 A;  4YG2 F;  2QVO A;  4EAT A;  1VQ8 I;  5D6F A;  4MQ9 F;  3GUD A;  1ZEL A; 
#chains in the Genus database with same CATH homology
 5J1U A;  1HF0 A;  5F08 A;  3PO3 J;  1UHS A;  2DTZ A;  3JRF A;  2DA3 A;  2COB A;  1MBK A;  1T56 A;  2R5Y A;  3BR0 A;  3RKQ A;  2YUS A;  2JN6 A;  1MBF A;  2LP0 A;  4W97 A;  1BA5 A;  1UG2 A;  1WH7 A;  2HI3 A;  1AKH A;  1QVT A;  3H0G J;  4M3G A;  2VKV A;  5E3N A;  5FKN A;  3L1P A;  3W6V A;  2E19 A;  1RR7 A;  3BR5 A;  3LSR A;  2XRL A;  4DW6 A;  1A5J A;  5EGO A;  2VI6 A;  1O4X A;  1MBH A;  1IUF A;  1WI3 A;  3ZQC A;  2NVQ J;  2E2H J;  3G1L A;  5FKK A;  1R9T J;  2VUM J;  2O9L A;  2Y0S N;  4D5F A;  4UUS A;  4JX5 A;  2FQ4 A;  3SFI A;  4QSH A;  5FJ8 J;  5EG0 B;  3Q0U A;  3JRD A;  1BW5 A;  2XPW A;  2DA4 A;  4A3K J;  2GLO A;  3HOU J;  3GTM J;  5JLX A;  2XPU A;  3UKG A;  3E7L A;  1VI0 A;  1RET A;  3S1N J;  4A3C J;  2R5Y B;  2K9Q A;  1VFC A;  3RQI A;  5EG0 A;  2TCT A;  1JUS A;  3K2A A;  2CUF A;  2YU9 J;  2ME0 A;  3A02 A;  3F0C A;  1ETO A;  1P7I A;  2DJN A;  1WPK A;  2X9D A;  2NVT J;  3S15 J;  3GTP J;  1ETK A;  4HNV A;  1ETW A;  4XRS A;  5C44 J;  2O7O A;  2XGD A;  1W0T A;  1UMQ A;  1IGN A;  2X48 A;  5HOD A;  3B6A A;  2CUE A;  3TED A;  5E3O A;  1JUP A;  1TWG J;  4D7N A;  5E3L A;  2JA5 J;  9ANT A;  4BY1 J;  3BR6 A;  3HBL A;  3FK7 A;  4DYR A;  5FKM A;  2DA5 A;  2LY9 A;  3B6C A;  1LFB A;  1H89 C;  3ZQL A;  5F0C A;  5EDN A;  2ELK A;  2E2I J;  3Q3S A;  3S2H J;  3FIW A;  1AHD P;  3LSG A;  2YS9 A;  1QRY A;  5JLW A;  1MSF C;  2PMZ N;  4S0H B;  5M3M J;  4IHY A;  2LFB A;  3BQY A;  2R5Z A;  1P7J A;  3PO2 J;  4MIM A;  3QPS A;  1CQT A;  3HOZ J;  2HQ5 A;  2R0Q C;  1LE8 B;  4XRM A;  1AKH B;  1Q1V A;  1ZK8 A;  2MSY A;  4RBO A;  3OOU A;  4JX6 A;  3HKZ N;  5F0H A;  3K7A J;  2DA7 A;  2EZL A;  3LOC A;  1FTZ A;  2CQQ A;  3S17 J;  3GTG J;  4UUT A;  3IH3 A;  2P81 A;  2LKX A;  3I4N J;  2CU7 A;  5IOY A;  1U78 A;  1XG1 A;  1W0U A;  4AC0 A;  2CQX A;  3BTJ A;  2Y2Z A;  3HDD A;  1MBE A;  2L7F P;  1ENH A;  3RZO J;  2K9N A;  2JMW A;  5E3M A;  3OSG A;  1U8B A;  1FTT A;  3HM5 A;  2FJ1 A;  3LSP A;  4CYC B;  2GM4 A;  3JRE A;  2K40 A;  2NOG A;  1I3Q J;  3S1R J;  1IJW C;  3WHC A;  1TWH J;  3DEW A;  1YRN B;  3I4M J;  2D5V A;  3BQZ A;  4B1R A;  2HXO A;  5EYR A;  4QIW N;  2JA6 J;  4W1U A;  3ZQG A;  1I50 J;  1DU6 A;  2XB0 X;  3ZQH A;  5M3F J;  4LOC A;  3HOV J;  5FLM J;  1F36 A;  3TW6 A;  4A3M J;  3Q0W A;  5J1Y A;  3GTL J;  1JKR C;  2EH3 A;  4I6Z A;  5DTD A;  5IP6 A;  4NDL A;  2R93 J;  4FCY A;  1X2N A;  2DA1 A;  4A93 J;  1S7E A;  1BL0 A;  2Y9Y A;  4FIS A;  4X1E A;  1BJZ A;  1RES A;  5GPC A;  2IEK A;  2XB5 A;  2JA8 J;  1ETY A;  1SFO J;  4MFE A;  2JA7 J;  1JT0 A;  2TRT A;  3SDG A;  2XPV A;  1MBG A;  1PUF A;  1B8I A;  5IP7 J;  3DCF A;  3HOX J;  1FJL A;  2AO9 A;  2NS7 A;  1RPW A;  1XC5 A;  4X6A J;  2LD5 A;  3CMY A;  4A3L J;  2NVX J;  1QPI A;  3TW7 A;  4Y52 J;  2X6O A;  1TWF J;  1BW6 A;  2MW8 A;  5IYC J;  3HOW J;  4D7M A;  3NAU A;  1GT0 C;  2DMT A;  1H8A C;  2HYJ A;  3JRG A;  3FIS A;  1A6I A;  3SJM A;  1RKW A;  2L7M P;  1ETQ A;  1B72 A;  5BNG A;  1VND A;  3BR2 A;  3GTK J;  2L9R A;  2HOS A;  3HGY A;  5FLV A;  2EQR A;  1WCM J;  2KDZ A;  5GPA A;  1IRZ A;  1MBJ A;  1ETV A;  1JUM A;  4A3F J;  3LSJ A;  1JKP C;  1ITY A;  1JTY A;  2LLK A;  1HLV A;  2ID3 A;  3JRA A;  1QVU A;  1ZGW A;  1SAN A;  3BTC A;  2XSD C;  2JWT A;  4GFB A;  3FKI J;  3LNQ A;  4B3A A;  1HOM A;  2KT0 A;  4ABZ A;  4A3J J;  2M0C A;  4C3H J;  3M4O J;  4XRS G;  2VKE A;  4G12 A;  4BXX J;  2WAQ N;  1NTC A;  3VPR A;  2M9H A;  1OCT C;  2H1K A;  3CQZ J;  2HXI A;  2L0K A;  1JJ6 C;  1H88 C;  3HEF A;  1JJ8 C;  3MN2 A;  4JX4 A;  1LFU P;  2HOT A;  4QTR A;  2R92 J;  1X58 A;  3CDL A;  5FKL A;  2JJ7 A;  4M3B A;  3HGG A;  3JRI A;  3G1M A;  3A01 B;  2R7Z J;  3QPL A;  4A69 C;  5M5W J;  1RKT A;  5IOZ A;  4DYQ A;  2LR8 A;  3BG3 A;  4AUX A;  1ORK A;  2FX0 A;  3BG9 A;  2IBD A;  3C2B A;  1WH5 A;  4BBS J;  5F04 A;  2EZH A;  4A3G J;  2ECC A;  1MNM C;  1B72 B;  2LTP A;  2VPR A;  1GV2 A;  3MKL A;  4C2M J;  4BKX A;  5M5Y J;  4XID A;  4M3D A;  4C3J J;  2DMU A;  4RDU A;  5EZG A;  1OCP A;  2CJJ A;  4L5E A;  1ZKG A;  4A3B J;  2NS8 A;  3A01 A;  1JKO C;  1DU0 A;  4J19 A;  1HDP A;  3GTJ J;  1JT6 A;  5IYB J;  4MLO A;  1K83 J;  4IHW A;  4A3I J;  3ZQI A;  4I76 A;  2MG4 A;  2DA6 A;  2O8K A;  4BBR J;  5GP9 A;  3D1N I;  2I10 A;  3BTL A;  3OSF A;  1LE8 A;  1GV5 A;  1MSE C;  1X2M A;  1PUF B;  2ID6 A;  1GUU A;  4M6V A;  2WB1 N;  3JRC A;  2IAI A;  1FIA A;  1IDY A;  2OPT A;  1E3O C;  1NK2 P;  1FEX A;  4C3I J;  1EF4 A;  1Z0X A;  1AU7 A;  3H3V K;  2DA2 A;  2CRG A;  3BG5 A;  5IYD J;  4FTH A;  2M8G X;  2WV1 A;  4IEJ A;  1FIP A;  1ZR2 A;  3MVP A;  1K61 A;  1OFC X;  2EBI A;  4XIC A;  1TWC J;  1VF9 A;  2QCO A;  4FE7 A;  1NK3 P;  5EZH A;  2MGQ A;  2GBY A;  1ZQ3 P;  4JP0 A;  5K7Z A;  2K9S A;  2L7Z A;  3FK6 A;  4EEF G;  1ETX A;  1HDD C;  5J3L A;  1GVD A;  3ZQF A;  3RZD J;  2XGC A;  1U9N A;  4V2G A;  2E1O A;  5K7H A;  2JK3 A;  1ZR4 A;  3IV5 A;  2ZB9 A;  3JRB A;  2EZK A;  1Y1V J;  4M3E A;  5K7F A;  3PM1 A;  1IC8 A;  1F43 A;  1Z77 A;  5F1J A;  4Y7N J;  3BR1 A;  3O8H A;  1WGX A;  2ECB A;  4FE4 A;  4B4C A;  3S14 J;  1TC3 C;  3JR9 A;  3GTQ J;  1IG7 A;  4XK4 A;  1B8I B;  3O8G A;  3JRH A;  2H8R A;  1MH4 A;  5FKO A;  1XS9 A;  2Y30 A;  4DZP A;  2ME6 A;  5F27 A;  3QQA A;  2G0E A;  5EEA A;  3M3Y J;  2AHQ A;  2Y9Z A;  5M5X J;  2LK2 A;  1Y1W J;  1HCR A;  3S1M J;  3S2D J;  2FD5 A;  3CCY A;  4DYC A;  3A03 A;  1IDZ A;  3TP0 A;  4CYC A;  1GDT A;  2HOA A;  1JGG A;  3WHB A;  3Q0V A;  1TWA J;  4A3E J;  3HB9 A;  2DMQ A;  2M34 A;  5J1R A;  5EF6 A;  2R5Z B;  4M3F A;  2NVY J;  2DMN A;  1D5Y A;  2B63 J;  4D5C A;  3NAR A;  1POG A;  5EGO B;  3G1O A;  4V2F A;  4IHV A;  3S16 J;  2E2J J;  3GBG A;  1U9O A;  1APL C;  1T33 A;  5C3E J;  2DMP A;  5DS9 A;  2DN0 A;  4DZJ A;  1JTX A;  3IH2 A;  3TP3 A;  1YRN A;  3IH4 A;  5C4J J;  2OF7 A;  1MH3 A;  4AYB N;  3BTI A;  3OIO A;  4BY7 J;  2QF7 A;  3BR3 A;  3GTO J;  1G2H A;  5F0F A;  5IP9 J;  5C4X J;  2N8G A;  1ZTR A;  2Y31 A;  4MO7 A;  2EZI A;  2RAE A;  4MFD A;  3HOY J;  2M2E A;  3S1Q J;  2XGE A;  3BT9 A;  2HDD A;  4A3D J;  4UUS B;  2LVS A;  4IHX A;  1OJL A;  2W48 A;  3ZOB A;  4JYK A;  5IPA A;  1JKQ C;  1IV6 A;  1I6H J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...