4EEFG

Crystal structure of the designed inhibitor protein f-hb80.4 in complex with the 1918 influenza virus hemagglutinin.
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
45
structure length
45
Chain Sequence
PWKFSENIAFEIALSFTNKDTPDRWKKVAQYVKGRTPEEVKKHYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/inhibitor
molecule keywords Hemagglutinin HA1 chain
publication title Optimization of affinity, specificity and function of designed influenza inhibitors using deep sequencing.
pubmed doi rcsb
source organism Influenza a virus
total genus 4
structure length 45
sequence length 45
chains with identical sequence H, I
ec nomenclature
pdb deposition date 2012-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4eefG00
2ID3A 4M3DA 3WHCA 1LE8B 4C3IJ 4V2FA 4QIWN 2DMUA 1IV6A 3JRCA 5M5XJ 4W1UA 3FISA 3HOUJ 4XICA 2R5YB 2EZKA 3F0CA 3BR0A 4BBSJ 1FTTA 1WH5A 4A3BJ 2M9HA 2HDDA 3M4OJ 3S1RJ 5DTDA 1UMQA 1ZTRA 1WH7A 3NAUA 1RR7A 5M3FJ 1FIPA 3SDGA 1Z77A 5M5YJ 2O9LA 4A3CJ 4S0HB 4RBOA 2Y2ZA 1IUFA 5F27A 2ID6A 2N8GA 1X58A 2OPTA 3FK6A 3S17J 3DEWA 3WHBA 3GTGJ 2O8KA 1PUFB 5FKNA 1JT6A 2LTPA 4DYQA 5IYDJ 1AU7A 3ZQHA 1U9OA 2K9SA 2JK3A 3MN2A 1RESA 4FCYA 1APLC 2RAEA 4ABZA 1I50J 1B8IB 2NVQJ 3LSPA 1U9NA 1HDDC 1X2MA 4UUSB 1JTYA 2WB1N 1RPWA 2E2HJ 4B4CA 4CYCA 4M3BA 5FLMJ 3JRFA 4I6ZA 4BKXA 4A3IJ 2JA5J 1POGA 4DW6A 5DS9A 1BW5A 3G1LA 3QPSA 2EZLA 2K9NA 1VNDA 1YRNB 3BTCA 1O4XA 5F04A 3ZOBA 1U78A 1DU6A 2JN6A 2R5ZB 2XPVA 1HOMA 3HM5A 1S7EA 2TCTA 3Q3SA 1Y1WJ 5EYRA 1NK2P 1MBEA 4IHWA 3HEFA 4AYBN 4D7NA 2MSYA 2LLKA 3IH3A 4FTHA 2XPUA 2COBA 2DMPA 3BR6A 2DA5A 4FE4A 3S1MJ 4IHVA 5K7HA 3IH4A 1OCPA 2MGQA 5C4JJ 2I10A 4MO7A 3VPRA 3FIWA 1MBJA 3A01A 2KDZA 4MIMA 2PMZN 2R93J 4AC0A 2O7OA 2LP0A 2LD5A 2CJJA 2DMQA 1QPIA 2LY9A 1OJLA 3TW6A 3I4NJ 3NARA 3OIOA 1LE8A 3A03A 2DTZA 4XK4A 2E1OA 2R92J 3OSFA 4UUTA 1XS9A 4DZPA 2JMWA 5IYBJ 2HOAA 1ETVA 5K7FA 2HXIA 3HOWJ 2R5YA 4D7MA 5GP9A 5J3LA 2FJ1A 4D5CA 3TW7A 1VF9A 1ZQ3P 3HBLA 4XRSA 1TWGJ 5EZHA 1JKOC 5GPAA 5C3EJ 1JGGA 3BR2A 2Y0SN 2JA8J 4LOCA 4JP0A 3HOYJ 1SFOJ 1QVUA 3C2BA 5M3MJ 3HOXJ 2LKXA 3CDLA 1VFCA 3LOCA 4C3JJ 2LVSA 3S2DJ 3ZQFA 2NVTJ 3CCYA 3BTIA 3B6AA 5J1UA 3MVPA 1PUFA 1QVTA 5GPCA 5E3MA 4A3MJ 3GTPJ 3PO3J 1ORKA 1ZR4A 1ZK8A 3LSGA 2E2JJ 1IRZA 2JA7J 3JRIA 1XC5A 3M3YJ 2R0QC 3S2HJ 2EQRA 4M6VA 4BY7J 2WV1A 1B8IA 2XGCA 3BTLA 3IH2A 3TP3A 5IP7J 5M5WJ 4XRSG 1F43A 1JUMA 4UUSA 1ETOA 2P81A 2EH3A 1ZR2A 1AHDP 3ZQIA 1T33A 5C44J 1ETWA 1MBFA 1TC3C 3JRHA 5EG0B 5E3OA 1IJWC 4D5FA 2X9DA 4EEFG 1MBKA 1RKWA 1YRNA 2Y30A 3BR5A 3RZOJ 2HI3A 2DA2A 2M0CA 2OF7A 1H89C 2R5ZA 2QF7A 3RQIA 4BY1J 2D5VA 2NVYJ 1P7IA 2Y31A 3CQZJ 2QCOA 4JX4A 3S1QJ 4BXXJ 1LFUP 4IHYA 4AUXA 1FTZA 1ITYA 1IDZA 2IBDA 3BTJA 1GVDA 1FEXA 3BQYA 5FKOA 4DYCA 1ETKA 5F0FA 3HDDA 5FKMA 3ZQCA 2HOSA 4FISA 1FJLA 3BR1A 4G12A 4NDLA 3K7AJ 2M2EA 5IP6A 1U8BA 5E3NA 3JREA 3SFIA 4MLOA 4MFEA 1NTCA 1GDTA 3JRAA 3E7LA 2XSDC 2IEKA 1CQTA 3GTOJ 5FKLA 2EBIA 1GT0C 1R9TJ 1WCMJ 3HOVJ 1RETA 4GFBA 2X48A 1MNMC 2IAIA 4A3GJ 4L5EA 1IDYA 1E3OC 4A3DJ 3MKLA 5F08A 5HODA 4M3EA 3BT9A 2E19A 1MH4A 2XGDA 3JRBA 4QSHA 4B1RA 2XRLA 2CRGA 4DZJA 5IOZA 1DU0A 2W48A 1BL0A 4MFDA 5EF6A 3L1PA 5J1RA 1ZGWA 4HNVA 3ZQLA 1ETQA 2FX0A 2KT0A 1H88C 1P7JA 2L0KA 2L7MP 3HKZN 1HDPA 1TWCJ 2DJNA 3DCFA 2DA6A 2ECBA 2MG4A 3O8HA 1ETXA 1GV2A 5JLXA 1B72A 4Y7NJ 3RZDJ 3BR3A 5EGOB 4A69C 3HGYA 1TWFJ 3TEDA 4DYRA 1MSEC 3FKIJ 1HF0A 1OCTC 1WPKA 1MSFC 4JYKA 3B6CA 3LNQA 1X2NA 1AKHB 5F1JA 1JJ8C 3O8GA 3GBGA 1BW6A 2K40A 1B72B 4M3GA 3PM1A 5EG0A 4A3LJ 2ME6A 3HGGA 1ZKGA 1IC8A 3W6VA 4X6AJ 1G2HA 2HXOA 2K9QA 5J1YA 2NVXJ 3HOZJ 1BJZA 1JUSA 4A3FJ 1HLVA 1A5JA 2LK2A 1H8AC 2L7FP 3BG5A 3H0GJ 1JKRC 2XGEA 1NK3P 2YS9A 5IOYA 2JA6J 2CUEA 3Q0WA 5IYCJ 3JRDA 2XB0X 2E2IJ 5F0CA 5BNGA 1MBGA 1WI3A 2LFBA 2TRTA 4FE7A 1A6IA 1I3QJ 3RKQA 2CU7A 1W0UA 3S16J 5C4XJ 2DA7A 2R7ZJ 2ELKA 2YUSA 1UHSA 1WGXA 3A02A 3S1NJ 5IP9J 2M34A 2DMTA 1LFBA 2X6OA 1Z0XA 2L9RA 3G1MA 2DN0A 1IGNA 1MBHA 4Y52J 3GTLJ 2CQQA 2XB5A 4XIDA 1K61A 4B3AA 2EZIA 1Y1VJ 3GTJJ 4A3JJ 1JT0A 1ETYA 2VI6A 2VKVA 4X1EA 1IG7A 1W0TA 1RKTA 2FD5A 3QPLA 2GLOA 3K2AA 3I4MJ 3IV5A 1K83J 2DA4A 4A3KJ 3ZQGA 2LR8A 3H3VK 1D5YA 4JX6A 3GTQJ 2GM4A 2H8RA 3SJMA 1HCRA 3HB9A 1F36A 3PO2J 3OOUA 3LSJA 3Q0VA 3JR9A 1ENHA 4IEJA 4CYCB 4IHXA 4J19A 2MW8A 4RDUA 1GV5A 3BG3A 2NS7A 1XG1A 1BA5A 4JX5A 5EZGA 9ANTA 2H1KA 2M8GX 2L7ZA 5K7ZA 1TWAJ 2ME0A 3S14J 5E3LA 2DA1A 5FKKA 2ECCA 4BBRJ 2JWTA 1JKPC 5IPAA 3OSGA 2Y9ZA 3CMYA 1JKQC 5FLVA 1UG2A 5EEAA 1VI0A 3LSRA 4C3HJ 2NS8A 1EF4A 1T56A 2Y9YA 2CQXA 2DA3A 3JRGA 1TWHJ 3G1OA 4QTRA 5EGOA 4A3EJ 5EDNA 3UKGA 1JTXA 1QRYA 2G0EA 2VUMJ 1Q1VA 2GBYA 3FK7A 2CUFA 5FJ8J 4V2GA 2DMNA 3S15J 1GUUA 1JJ6C 4C2MJ 4I76A 1AKHA 2EZHA 3BG9A 3QQAA 4M3FA 3GTKJ 2YU9J 2AHQA 1MH3A 2JJ7A 2VKEA 3D1NI 4W97A 5JLWA 2HQ5A 2FQ4A 2HOTA 3TP0A 2HYJA 3BQZA 1FIAA 2B63J 2NOGA 4A93J 4XRMA 1OFCX 3A01B 3GTMJ 3Q0UA 2AO9A 5F0HA 2ZB9A 1JUPA 1SANA 2XPWA 2VPRA 1I6HJ 2WAQN
chains in the Genus database with same CATH superfamily
4IX7A 1RI7A 1W5TA 3FMQA 3K1NA 3TOAA 2XAHA 1LQ1A 1MDMA 2HVSA 2ISYA 2F5FA 1VZ0A 2BVMA 4W1UA 1D8KA 5CYVA 3VFZA 3HOUJ 1QO0D 1X1DA 4M6YA 3VOEA 3GUDA 2R5YB 4V19K 3CUQB 3O6BB 3BJ6A 1IF1A 4CA0A 5A2QK 4A3BJ 1HKTA 4G9YA 4BAYA 2VKDA 3S1RJ 1UMQA 1ZTRA 1OYWA 3L7WA 2P4WA 1JHHA 5M3FJ 5J6XA 3KP2A 5DCMA 1R49A 2XIGA 2ZXWH 1O3TA 3FBNB 3I59A 1YYVA 2L7KA 4GXOA 4AYBA 4XLFA 3S17J 2K4BA 3N97A 1I3AA 3WHBA 3GTGJ 2O8KA 1EH6A 3BZ6A 1O7FA 4OAYA 4DYQA 4I98B 2DW4A 3ZQHA 1U9OA 4EJWA 4ZDOA 1MMSA 4OOIA 4HX7A 3MZHA 4HG2A 2E7WA 1SD5A 4CH7A 4ZTFA 4ZDPA 3AKZA 2KMUA 2VJIA 2RAEA 2PI0A 1I50J 2JUGA 3F8MA 5ICEA 1D5VA 1U9NA 4F52A 2EIKH 2L9VA 3JSPA 3F3XA 4LD5A 2MLGA 2OD5A 4MTDA 1X2MA 2WAEA 4MQVA 4UUSB 2WB1N 1H9GA 4AIKA 1RPWA 4CZCA 1IW7F 4UUVA 4M3BA 2KL4A 4I6ZA 4JQFA 2PJRB 5IT9K 3RDIA 1O7LA 4KT6A 3CMAI 1QA6A 3G1LA 2EZLA 2K9NA 1WRJA 3LFKA 3OL4A 3BPXA 2V1DA 3REOA 4IOAF 4EM1A 3FHZA 4E7IA 1K78B 2FOKA 5HS7A 3X2QH 3KEYA 4B8XA 1HOMA 2RVCA 3BZKA 3V7RA 2TCTA 1R1UA 2V79A 5EYRA 3KP5A 1L3LA 2QEXI 3DV8A 5B1AH 4BNCA 3W2AA 2LLKA 4ZJZA 3T8RA 2XPUA 4E7HA 1LVAA 3BR6A 4HX8A 2W57A 1XCVA 2P5VA 2A6TA 3IH4A 1OCPA 1B9MA 3V42A 1XGMA 4XOTA 1BC7C 2R7FA 4BDZA 1RC9A 4NC6A 3A01A 4E6KG 3OIQA 1IXSB 4HBLA 1YIJI 1SFEA 2O7OA 1UHMA 1F5TA 4Y13A 4KICA 2LY9A 2QQ8A 1S5LC 1UELB 3H3UA 2VKHA 3DFGA 2E1OA 1FC3A 1WVRA 4UUTA 3FX3A 1XS9A 2JMWA 3LAPA 2VXDA 3HOWJ 4D7MA 3I55I 2WBMA 4KN7X 2DI3A 5GP9A 2FJ1A 4D5CA 1X19A 3BCAA 2CUZA 3RI4A 1BM9A 3KLNA 5EZHA 3IWZA 2BY1A 2R7WA 3ASOH 4FX0A 2O3FA 3GO5A 3BR2A 5L3BA 3WGGA 2JA8J 4JK1X 2BXZA 5CQGA 2VPLA 4KA4A 1HW1A 1MIJA 4RGUA 3K70C 4C3JJ 2LVSA 2BXYA 3LMMA 3S2DJ 3CD6I 3TQNA 1FOYA 3B6AA 5J1UA 3K1PA 1J75A 1QVTA 5E3MA 3GTPJ 1XDSA 2Z16A 3L9FA 4XMYA 1ZR4A 2VL8A 1IRZA 5D5UB 1BI2A 2BVLA 3JRIA 3W6JB 4IO9F 2QQ9A 1B9NA 4DJAA 2VBWA 3H92A 1XSXA 3BTLA 1W1WE 3TP3A 3RSNA 2QWWA 2VE9A 2RGVA 4BQAA 4M74A 1ETOA 2UV1A 3LSMA 2EH3A 3JW4A 4AVZA 4N4NB 3OYKA 5C44J 2E7XA 5AONA 4HNUA 3C1DA 1TC3C 4XLCA 1OPCA 2Q1ZB 3U21A 2LNBA 5J47A 5E3OA 5CJ9A 3IKVA 1G3TA 3HPGA 5BOXA 2NRAC 1DPRA 3TO9A 1K79A 1RKWA 4LIUA 2Y30A 3BR5A 3RZOJ 4RAFA 4M9ZA 2E1NA 4GYIA 3MQ0A 4B48A 1Z05A 1BI3A 1PYVA 2A5YB 5EEGA 2R5ZA 3RQIA 4IRGA 2STWA 2V7FA 3VWBA 3RYPA 1ZGAA 4BEHA 2ZFUA 1DUXC 2OAZA 3T5XA 2KQRA 4JX4A 4UB6C 4EJUA 4H0EA 2QBYB 4IHYA 4LLLA 1W5CC 1IDZA 4GRIA 3BTJA 2DFHA 3KZIC 3F6OA 3EUKL 3WTXC 4OWRB 3VYRB 4QPQA 5FKMA 4ZYHA 4U7DA 5E17F 2VJ5A 2EFPA 2JVGA 4FISA 4A12A 1MNDA 1XGOA 1USTA 2KHMA 1LFPA 3BR1A 4G12A 1U8BA 2D1HA 2M2EA 3MAJA 4LIVA 3BWGA 3J7AY 2JPCA 5ICCA 4FASD 5FRNA 2IEKA 1E0EA 2KISA 5E79C 5J40A 2P7VB 2COMA 2KPMA 1GT0C 4EV0A 2LBFA 3ECHA 1Z6TA 2IGKA 1RETA 2HVQA 2Z3YA 5F1RA 2MBFA 5FFZA 4MNUA 1TNSA 1OCOH 3EDPA 1E3OC 4CO8A 2HTSA 4A3DJ 1FOXA 2B0LA 1V54H 2O5RA 5F08A 3J81Z 4YFKF 1RUOA 4PDKA 3BJOA 2NS0A 2CH0A 1MZBA 1UG0A 4OIPF 2HR3A 2XGDA 1FMVA 3IC7A 6PAXA 1T0FC 4RB1A 1GXQA 1ZHFA 2CRGA 3R4KA 1DU0A 2ELHA 2FBKA 2W48A 3M7GA 3L1PA 2GZWA 1MD0A 4HNVA 1LEAA 2UXNA 4XKVA 1TLHB 2K9MA 2KT0A 4LGWA 1P7JA 5LGTA 5LD2C 3HKZN 4WXHA 4F55A 4XKBA 4NNJA 2DJNA 4ZYEA 2MG4A 1XGNA 1GV2A 5IY5H 5KVRA 2K3FA 2IGOA 3HGYA 2CQNA 3P9IA 4BS9A 3P9KA 2RREA 2HOEA 1WJDA 2V1XA 3FKIJ 1X4OA 1WPKA 3UR3C 4ESJA 4IJAA 4E70A 1MNEA 1BBYA 1FY7A 2X4HA 5F1JA 1IUYA 3GBGA 2O61A 2KZGA 3OL3A 2VT2A 3PM1A 4GYGA 4PFOA 2ME6A 5DUIA 4KISA 2HXOA 2K9QA 3WTSC 2HGCA 5D4SA 2QKLB 2VLAA 3HOZJ 1FSHA 4F91B 1JUSA 4IRHA 2ZFWA 1HLVA 1A5JA 1MJBA 2L7FP 1IN8A 5JHUA 2MD5A 3BG5A 1YO5C 2NAZA 2VBZA 1JKRC 2YS9A 4IVNA 4XBFA 1QZZA 3SDBA 2AXLA 2ZKZA 3CZ6A 3JRDA 4KITB 3ZCOA 3DPLC 5F0CA 4A2UA 2J5PA 3CO7C 4KMUX 1SFXA 2TRTA 1YIOA 4HAMA 4BQQA 1OCCH 3QU3A 3ZMUA 1S3JA 3TL4X 2CU7A 1V5GA 2ESNA 5AIPA 1U2WA 2I5UA 5C4XJ 2DA7A 3PNYA 1J09A 4AIJA 1W7PA 2PLYA 3HTSB 2DBBA 3CCMI 5HNHA 2X6OA 3CLOA 2QSFX 3BOQA 2JUCA 3A2KA 4KIGA 4EM0B 1Z0XA 2L9RA 3SEQA 2D1VA 4XKWA 2DN0A 1IGNA 3LSHA 2CQQA 4M71A 2GOMA 4ZZLA 1YI2I 1DQUA 1Y1VJ 1WWXA 3LSIA 3K9TA 4B3XA 3CCLI 2PX9A 2XRNA 3VDXA 2VI6A 2NVUB 5KNLA 1N77A 3TDZC 3OYHA 1IV8A 1RKTA 2DODA 2FD5A 3QODA 3QPLA 5HLIA 3QYBA 1O3QA 2DA4A 3CC7I 2LR8A 2K27A 2MFZA 2XAQA 3DLLF 5HS8A 3GLXA 5LGUA 3RKXA 2DQLA 1EJ9A 2M7BA 3SJMA 1YTYA 2PQ8A 1TQMA 2Z1DA 3LWFA 4FQGA 3A4CA 4OU0A 3L2RA 3DPTA 2L5QA 3KYLA 4YIFA 3TKYA 1K6OA 4J19A 2PG4A 1FYMA 1T38A 2NS7A 1XG1A 3JTGA 5EZGA 2LY1A 1TWAJ 2ZXIA 3WU0A 1B6AA 1FZPB 2JWTA 3HOTA 5IPAA 3OSGA 2P7CB 1WJBA 2DFIA 3WTUC 2LKPA 1UG2A 5EEAA 1VI0A 2KKOA 4C3HJ 2DT6A 2Y9YA 3FDYA 3PQJA 1SVMA 3G1OA 3L2CA 5GADJ 5EDNA 1JTXA 2WAFA 2ISZA 1D8JA 3FXUA 1HSJA 5D6EA 2CUFA 5ILUA 3BJAA 4IXAA 2DMNA 2BYVE 3LA7A 3S15J 1TBXA 4C2MJ 1ZRFA 2VJJA 3S3MA 2EZHA 4XLAA 4PZJA 1LB2A 2DYRH 3GTKJ 3LAJA 1R71A 1MH3A 1MKMA 3L00A 3DTIA 4W97A 4IHTA 1ZG1A 2ZNYA 3WU2C 2HOTA 4Q5SF 3TP0A 3W2VA 2MD0A 2NOGA 3OYBA 4LLGF 1SVOA 3NWTA 4XRMA 2QQBA 2W84A 2LDUA 2AO9A 2WTEA 3U2RA 5F0HA 5F6FA 3CC4I 1T98A 2LD5A 2HZTA 2WAQN 1T6SA 4C30A 2ID3A 1ZRDA 2AQFA 4GGGA 2IW5A 4KIFA 3WHCA 1U3EM 2BHYA 4V2FA 1OYYA 1IV6A 3JRCA 1IXRC 3DTEA 1ZN2A 2EZKA 3F0CA 3BR0A 1OR7C 2L02A 1WH5A 1DP7P 4LB6B 2M9HA 3RPUD 4E7JA 4EMSA 2X85A 1VQ9I 1RR7A 2CQ7A 1RIOH 3COAC 1XCBA 1Z77A 2O9LA 1K4SA 1YHQI 3F8BA 4YELA 2Y2ZA 2Y48A 1IUFA 5CVVA 2N8GA 1X58A 3I4PA 5E20A 2M30A 4AIDA 4C9YA 4B47A 3P9CA 1FP2A 3FK6A 1KYWA 1Y39A 3B02A 2F4IA 4ASNA 5FKNA 1PUFB 5FO5A 2LTPA 3PJRA 2KIFA 2VBYA 4BE2A 1Z3YA 1R23A 2F4MB 2AXTC 3ZMDA 5ICGA 2K9SA 2JK3A 2DK8A 2K02A 2OJED 4FCYA 4BQNA 1B8IB 1O3RA 5E18F 2W24A 3IAM2 2DTRA 2ZJQF 1XN7A 2R3SA 4HW0A 3GFLA 4U7BA 4CYCA 4HLYA 4MTEA 3BCBA 3BPVA 2LMDA 1ZAOA 2PN6A 3G71I 2JA5J 1N25A 5DS9A 1BW5A 1J9IA 3MKZA 3QPSA 2ICWG 1VNDA 1YRNB 4LK0F 2VXZA 3UNGC 2H6BA 5B66C 5HLTA 2EFQA 4HOBA 3CDIA 2HKOA 4CCJA 2W82A 3ZOBA 2JTVA 2LG4A 3MKWB 2JN6A 5JVTA 2IS6A 1O3SA 2FRHA 2HDWA 2IP2A 2XPVA 2Y0SA 2XDVA 4P1WA 2LYCA 1J0RA 5E1XA 3K1MA 1DDNA 4L9TA 5E1WA 3J81K 1S7EA 1MMNA 1NG7A 5D4RA 3C2HA 1NH3A 4IQJA 3DKXA 5L3DA 1MBEA 5D8KB 3OYIA 4IHWA 3SZPA 1S29A 1XMKA 4D7NA 2MSYA 4BGDA 3IH3A 3P5JA 1W36D 2JSCA 4UV8A 1LDJA 2XHKA 2D45A 5D8LB 2COBA 3PIPF 3ZXSA 2H94A 3GZ5A 1Z9CA 3HRMA 4FE4A 3WTVC 4IHVA 1Y6IA 2CMPA 3WTZA 5FGMA 5K7HA 4ZTJA 5H6QA 3B73A 3HYIA 2IXSA 1TW3A 4DBQA 4BYYA 1IZ1A 4MO7A 4KNYA 1YS7A 3FIWA 1MBJA 3QYEA 2KDZA 2IVMA 2PMZN 2LREA 2CJJA 4CCNA 2FBIA 4XLPF 1FP1D 4KUMA 2HEOA 1IN4A 3MFKA 1LE8A 3LFUA 4BE1A 3GF2A 2DJIA 4Y17A 2R92J 2M4KA 5IYBJ 2KZVA 2ZXJA 3E1SA 2HXIA 1P92A 2BY2A 5J3LA 3HSRA 1XMXA 1QU3A 1REPC 2L3DA 4IPAA 2GXGA 3HBLA 4HF0A 1ERDA 2F5EA 1ZLJA 4XN3A 1EH8A 4LOCA 1QVUA 3HOXJ 5L3GA 3CDLA 1VFCA 2E1MC 2V9PA 1SAUA 2NVTJ 3CCYA 4QLCU 1VQ7I 4RGRA 4N0BA 1X1CA 4PGGA 1Y8QB 4AWXB 2KRCA 3CTAA 3M1CA 3WG9A 3HG9A 2LRDA 3WGHA 5FD6A 3QP6A 2RN7A 1A31A 1X3WB 3H5RA 4BY7J 2RNGA 3F21A 3D5LA 2CV2A 3IH2A 2X1DA 1F43A 3S8PA 1ZGJA 4U0VA 2P81A 4XLEA 2FXAA 3CDHA 5CVJA 4ENMA 3ZQIA 2HFHA 2NNNA 1ZARA 3MCZA 2E1MB 2PJPA 3AL0C 1MBFA 3OYJA 5DCFA 3IKTA 2OZ6A 5EG0B 3JRHA 4RM3A 4PUSA 3OWTA 5LGNA 4D5FA 1IJWC 1MBKA 3HXLA 3DU5A 4A6EA 1YE9A 2HI3A 4PJNA 1XMAA 2QF7A 3OY9A 5LHIA 1P7IA 1WJFA 4CUGA 4PJJA 2XKPA 2YU3A 3TOBA 3AL0B 2IS1A 3RPQA 2CV1A 2Q8KA 3J7YJ 2IBDA 2K86A 2KRFA 1VQ4I 3K4NA 1BJAA 3IAS2 1FEXA 3BQYA 3I53A 1ETKA 4XRFA 5F0FA 3F6VA 3CO6C 2VONA 3NRVA 5DM7F 5ERIA 2HOSA 4II2A 3K7AJ 5IP6A 5B1BH 2GQQA 3JREA 2GAUA 1X3ZB 1Z21A 1D0ZA 3BZCA 3EUHA 3QWLA 3SFIA 1NTCA 4NQWB 3VYSB 1EA3A 2K9LA 4ZZDA 2BZTA 2XSDC 4BE0A 3EPZA 1X1BA 3GTOJ 3R61A 1I6XA 3OYMA 2G7HA 1R36A 2EBIA 3CP8A 1U5TC 3KX2A 3BY6A 2QQAA 3HOVJ 2XF5A 1K7AA 3KZZA 3L09A 4ETSA 4MEXF 1MNMC 2HQNA 1IDYA 2KDOA 1R5ID 5TRDA 3OYFA 2ZSIB 1A6QA 1P2FA 3ABLH 4PSWA 4XSZF 4XLNF 4FX4A 1A04A 2VT3A 3KIOA 4LJZF 3BT9A 3WTYC 3ULQB 5FFXA 5LEJA 4Z2YA 3JRBA 5FROA 1I1SA 1XX5A 2XRLA 3CF5F 3HPHA 3ELKA 1BL0A 3PNVA 3RQ4A 3FBIB 5EF6A 2E34A 1ZGWA 2HPIA 3CCRI 3QP5A 3ZR8X 5DDGA 1ETQA 5JR3A 3ZQLA 1STZA 2FX0A 3C2GA 3DWLE 1U5TB 2JZYA 3J80Z 3RJPA 3E6CC 3U1KA 4LMYA 2Q0OA 2RNJA 3K4LA 2L7MP 2W00A 1TWCJ 4KN4X 3DCFA 2IRFG 2ECBA 4HSTA 2O03A 3BDDA 4CCMA 3D0SA 2DFEA 3OOPA 3RZDJ 3BR3A 5EGOB 1U0JA 3U1DA 3KP7A 3OR1C 2ZXHA 4E7LA 1MSEC 5KCMA 2HDCA 1OCTC 2L9NA 4M73A 4JYKA 4EATA 3QAHA 1AKHB 2D2WA 3O8GA 1R22A 1BR2A 4S05A 1BW6A 1ON1A 1B72B 2MH2A 2PMHA 2DOEA 3CCUI 4PFPA 4A3LJ 1RRJA 1WSUA 3QPHA 3W6VA 1G2HA 2RKHA 2A3SA 1BJZA 2F6CA 2R7RA 4R79A 5KAFC 1RNLA 2K4JA 4YIIA 3M8EA 2JPBA 3QOPA 4RAGA 4P9FA 2XGEA 2DPDA 3MEXA 3SZTA 3Q0WA 5IYCJ 3K70D 2ZMEA 2OZUA 4U0WA 3WTWC 3K6GA 3RYRA 1MDMB 4HX4A 4I0BA 2LFBA 3BP8A 4I2OA 1A6IA 1I3QJ 5H20A 4NC7A 4U87A 4Y3OA 4RB3C 3L2WA 2FNPA 1W0UA 4AD9A 1FOWA 4U0YA 2R7ZJ 2ELKA 3A02A 2L01A 2L9SA 2W7NA 3I0TA 5IP9J 2Z9OA 5ILSA 1G6NA 2CWEA 1FBUA 3CC2I 4P55A 2QA4I 2H27A 4IF4A 2IA0A 1MBHA 1A35A 1C0WA 4ENJA 3H9JA 4XIDA 2DXIA 3PNTA 1ZELA 1K61A 2ACJA 4GO1A 4LG3A 4WF2A 3VODA 4B3AA 2Q2EA 3H5AA 3OYEA 1X4PA 4S04A 4PJ0C 1BN5A 4YEJA 2VKVA 3L2QA 2F5CA 3RTRA 1IG7A 1FWZA 5K5OA 2GLOA 3K2AA 4PK4A 4DNCA 4AM3A 1KQ9A 3CMEI 3VSKA 3ZQGA 5GAGJ 2E36A 2OTJI 4L0YB 1P4WA 1FPQA 5JI6A 1VQOI 4BHBA 3F72A 2M4GA 3GTQJ 4L5IA 1KU3A 2H8RA 1VQ8I 3A1YA 2CS3A 4R1HA 2STTA 3F8CA 4OIQF 1IRFA 4GCVA 4M9XA 2M3AA 2IA2A 1DGRM 1SVLA 3DQVC 4YRVA 1F4KA 2F5VA 2L4AA 2YR2A 1VTNC 3HRTA 2HYGD 2H1KA 2EFNA 2ME0A 2GOXB 3T0YA 3HUGA 2R7VA 4EQQA 5FKKA 5GTHC 2OA4A 1WJ5A 2FA5A 4BBRJ 3TGNA 1JE8A 3DLAA 5B3SH 2DAOA 3ZP5A 2BY3A 2VIXA 1JKQC 3VYUB 2KIUA 5FLVA 3AG4H 3TO6A 1PVEA 1SD7A 3LSRA 1WHUA 2XSJC 5LHHA 2DOFA 3JRGA 1TWHJ 2CUJA 3MWMA 3KP4A 2HQRA 1XSDA 3OR2C 1Q1VA 4HV5A 4B09A 3D5RC 3HSEA 4WCGA 1Z3XA 3LL7A 1JJ6C 4HA8A 4DQ2A 2A07F 2QM3A 2DFFA 3QQAA 1TP4A 3K10A 2DO7A 4M3FA 2AHQA 2CW0F 2VKEA 2JJ7A 4A5NA 2FOWA 2WY8Q 2ZSHB 1JI8A 2HQ5A 2FQ4A 4DBRA 2MC3A 1P6RA 5CVRA 1YG2A 2HYJA 3BQZA 2B63J 3AG2H 1SMYF 4G8XA 4OAZA 2WB1A 3A01B 1P4XA 4HZFA 1TQIA 3KCCA 2Z5UA 1Q1HA 3EYIA 3W3CA 4IQ4A 4EM2A 5BMZA 5F04A 5FRMA 2M1BA 1I6HJ 5LHGA 4M3DA 1UHWA 4CICA 3CCQI 4C3IJ 1S6LA 4P96A 1ZLKA 5K5QA 2PFBA 4QIWN 4PJLA 4TV7A 4I7HA 4KFCA 3M8JA 2ZBKA 2P0WA 2P5LC 2VOOA 1XB4A 3PFIA 2KIQA 3GVAA 1O57A 4L9JA 2FE3A 3S32A 5KHDA 2HDDA 3M4OJ 5DTDA 1G3YA 2MLKA 3E6MA 1WH7A 3NAUA 3ML6A 3L2VA 1FIPA 3SDGA 2V4JC 5K1YA 3S3OA 1CF7A 5M5YJ 3DU6A 2LC2A 2M87A 1V55H 4A3CJ 3FWEA 4RBOA 3LSKA 4CHUA 5F27A 2ID6A 3ZQQA 1YX3A 2PMUA 3H35A 2JT1A 1D1BA 2OPTA 1IN6A 4ZYAA 2HTJA 2ZMEC 3DEWA 4MEYF 3R6SA 4U88A 4N4OB 4LG0A 2XKOA 5D5XB 2V6EA 5IYDJ 5TGTA 4HLXA 1AU7A 3K4MA 2JQ7A 5A2QZ 1IO2A 2QSGX 1D0YA 1FSEA 2K85A 3KETA 3MN2A 1HSTA 1APLC 4ABZA 4HF2A 3NWSA 4A0XA 3LSPA 4R8HA 5HDNA 2XVCA 2CG4A 1JTYA 5CLSA 4ENKA 3RCOA 2Y0MA 4B4CA 2QYOA 4WX9A 1V4RA 2P8TA 3TBIA 3DEEA 3KFWX 4XOPA 2A68F 1QGPA 1SFKA 4A3IJ 1POGA 4DW6A 4II3A 3BTCA 4G7ZF 1O4XA 1AA7A 1TT0A 1R1VA 1T8IA 3IUOA 1U78A 1P9QC 2UWMA 1DU6A 3OYAA 2F5DA 3K0LA 2R5ZB 4L5JA 4WWCA 2MABA 3W6KB 5H6RA 4PJMA 2V6CA 4BEHB 1BI1A 4KDPA 1QZEA 2CQKA 3DKWA 3HEFA 4AYBN 1G3SA 2W1OA 1R4MB 4FTHA 2C6YA 5F64A 2FQ3A 1F9NA 2DA5A 3OYLA 2E60A 5L3CA 3E5UA 2X1CA 3J80K 4BJTA 2JRTA 2OCCH 2MGQA 5HNFA 2HNHA 3K2ZA 2Z2SB 3O2PE 2I10A 4A0YA 1I39A 3E0JB 2VQLA 2WV0A 4MIMA 2NXNB 3VSLA 1USSA 4AC0A 5H2FC 5E8IA 1VQMI 4FT8A 2QZ8A 1VQLI 2LBFB 3QOEA 3TW6A 3ZN0A 1DGWY 2DOAA 4AIHA 1N75A 3NARA 2VN2A 3OIOA 5D5VB 2DTZA 4XK4A 1E3HA 3I58A 4E7KA 2HS5A 2V1NA 1HKSA 1XDUA 3OSFA 4DZPA 1QZYA 2HOAA 1ETVA 2OQRA 5J8CA 2R5YA 4KT5C 1ZRCA 2X51A 3CUQA 3IRQA 1R6RA 4F3QA 1LEBA 1ZQ3P 4IRIA 1MMAA 4XRSA 2QSHX 3Q9VA 2IT0A 2EA4A 2CFOA 4G94A 5GPAA 1EKEA 5L3FA 5C3EJ 3CCEI 2KIMA 3HOYJ 3RKWA 4E4HA 1TL8A 1SFOJ 4Q4ZF 1FBSA 3LOCA 1S72I 3CJRB 1ULYA 4LLNA 3H1CA 3E3VA 5BQTA 1WJAA 1SMTA 2E1CA 4HQEA 4A3MJ 5FLXZ 4O6JA 1ORKA 5DD4A 4EJOA 5GTIC 5BPIA 4XQFA 3PO3J 2DU9A 2X6YA 2WWYA 1ZK8A 2IS4A 2E5ZA 1XSVA 1XC5A 3ZGKA 1LDKB 3KEQA 4ESFA 4M6VA 2WV1A 4B43A 2XGCA 4BU2A 4KIBA 5M5WJ 4RGSA 1JUMA 4P9UA 4UUSA 4JOMA 1ZR2A 1AHDP 4MQ9F 5JFRA 5CKTA 4ZYGA 2BHZA 4EJTA 3MZYA 1KU2A 2M0MA 2PJRA 1FNNA 1FX7A 3OYDA 1EH7A 2ZNZA 3H9GA 1D1AA 2BGCA 3ONQA 1E2XA 3CCVI 4RAZA 3GFJA 3VB2A 4X0GA 1K78A 2YX4A 2DA2A 2M0CA 2OF7A 4HEA2 2B9SA 3E6BA 2JSPA 1TZLA 3DBLB 3ZMSA 3OS0A 1HKQA 2VQHA 4CXFA 3CQZJ 2NVYJ 2GWRA 2Y31A 1P4AA 2QCOA 3EETA 4BXXJ 4M72A 1LFUP 1UZCA 1FT9A 4XLHA 2V9KA 1ZG5A 4NQWA 1FTZA 1ITYA 2JVHA 1GVDA 1KYZA 3A0BC 5FKOA 2UXXA 1V3FA 4DYCA 2BE5F 5TISC 3HDDA 5J4YA 1Y0NA 2A6EF 1B1BA 1MMGA 1KONA 1FJLA 3WU1B 4NDLA 4OIOF 3W2WA 3MMYB 1AOYA 5E3NA 4BQOA 1KZHA 5D5WB 2L54A 4MLOA 4Q48A 4MFEA 2R7DA 1M1EB 3LSTA 4MGRA 2GXBA 1GDTA 3JRAA 3E7LA 4EJVA 5K5RA 1ZREA 3R60A 2EWNA 2VODA 1BR1A 1R9TJ 4DGWB 2RQQA 3RKYA 3FMSA 2X48A 4GFBA 1ON2A 4OMYA 1HW5A 4L5EA 4F93B 5B5EC 1OCZH 1RZ4A 2IGNA 1QBJA 3GX4X 5HODA 4M3EA 1Y56A 4BUPA 4E7ZA 3J7ZI 5FB2A 4OIRF 4RS8A 2FF4A 4QSHA 4B1RA 3HL2A 4DZJA 3CJQB 3KP3A 2OTLI 4O3MA 1S7OA 2PEXA 3OV8A 2YPRA 2L0KA 4IKFA 5IT3A 2G7UA 1TW2A 5FD5A 2EA2A 3AAFA 1VQPI 1QQIA 3DP7A 1YX5A 2AS5F 4AVPA 4YFXF 1ETXA 1UB9A 2M8EA 1B72A 3C18A 3K4CA 2G9WA 1FMWA 4QWQA 1Z7LA 3V8KA 1TWFJ 5CPRB 3MD2A 3TEDA 1JGSA 2K3PA 2OQGA 4PGHA 1MSFC 3B6CA 1Z7UA 2FU4A 1YFHA 3LNQA 1X2NA 4UXNA 1Z1DA 3PUFA 2LH9A 3DTKA 3PIOF 2K40A 2NYXA 3FM5A 2EK5A 2ZCWA 1ZKGA 1YJNI 4X6AJ 1J2XA 5J1YA 2NVXJ 4N9HA 1HBXG 1GLNA 4A3FJ 4WXCA 3H3ZA 3FXKA 3FXLA 3GCMA 2FMYA 3I64A 4LK1F 3KYCB 4XORA 3S2WA 2JA6J 2CUEA 4LITA 3FXMA 1I5ZA 4ON0A 2A69F 1FYKA 3ERMA 1MBGA 2WADA 1WI3A 3CCJI 1QPMA 4BJ6C 1UAAA 3CF2A 1BIAA 2QBYA 1SD4A 2BOLA 3VYTB 1BOBA 1Z91A 5LEKA 2DPUA 4FHTA 1FBQA 5HLGA 2EPFA 2YUSA 2FSWA 4I09A 1LFBA 2IGMA 1TNTA 1TT5B 2BY0A 3G4SI 2Y69H 3G1MA 3ROUA 5GAEJ 4LB5A 3H36A 2A5WA 3GTLJ 5DUKA 1HW2A 3HSFA 5HVQC 4XN0A 3OS2A 4YG2F 5D6FA 1QHHD 4A3JJ 4J01A 1R5GA 1JT0A 1ETYA 1YS6A 4X1EA 4NB5A 1R4NB 1UCRA 3N05A 4YFNF 2R7UA 3KP6A 1JXSA 1QHGA 2VQCA 4P5OA 1ZYRF 5AIQA 3I4MJ 2H1LA 4A3KJ 4BACA 3H3VK 2VOPA 4JX6A 5BS6A 3HRUA 1WQ2A 2GM4A 4DOZA 1HCRA 3WE2A 3IL2A 3PO2J 2HYFA 1MMDA 3LSJA 2MYSA 3P7NA 3Q0VA 1ENHA 4CYCB 2WAQA 3TMOA 3I71A 3GYHX 3BG3A 1BA5A 4NUBA 1LNWA 3PUBA 5DM6F 3IHUA 2EB7A 3GMEA 2M8GX 3KPHA 3HHHA 2FUG2 5E3LA 2DA1A 2FEZA 1RUNA 2ECCA 1JKPC 1J59A 5HS9A 3CMYA 2OC6A 2OU2A 3S93A 5HLHA 4A6DA 4HSRA 2EINH 3FXQA 4NHJA 2LOOA 2CQXA 1H0MA 3JCUC 2K5CA 1KU7A 4A3EJ 2ZJRF 2BW3B 1QRYA 2G0EA 2QVOA 1YW8A 4RM2A 3FK7A 1X1PA 4BH9A 5FJ8J 3ECOA 4XKCA 1T0FA 1TTYA 4V2GA 5HDKA 4L18B 2L2OA 1R00A 3OYCA 2QGUA 2P6SA 1IN7A 2KFDA 3BG9A 1XPXA 3FKJA 5J4VA 1T2KA 3GXOA 2JRMA 5E8GA 3QYFA 2E35A 4I99C 5DEQA 2LKSA 3L2UA 1FIAA 1D3YA 1WJEA 2LF7A 5FLXK 3IRRA 3HIFA 1G3WA 1PDNC 3Q0UA 2CW7A 4EVIA 2ZB9A 5L3EA 2XAJA 1SANA 2XPWA 2VPRA 1I1GA 3SYTA 3HJEA 3V8JA 1LE8B 1W5SA 3GEZA 2H8WA 4Y4RA 4G6TB 3S3NA 1Z67A 2DMUA 4IZZA 4CCOA 5ED4A 3WGIA 1S8NA 3FZVA 1YQAA 5M5XJ 3FISA 2H6CA 3JAMZ 2OUMA 2FNAA 3EYYA 4XICA 2DT7B 1TQPA 1T95A 3NQOA 4BBSJ 1FTTA 3FF5A 2CSOA 3CCSI 2DT5A 2M45A 1HXDA 4J00A 3BROA 3ZMZA 1GHCA 3OMYA 3E6DA 2M5WA 3J7AO 3FHNA 4S0HB 2ETHA 1Z6RA 2EFOA 1LJ9A 1BOAA 3CP2A 4XONA 1X1AA 2HVRA 3AG1H 2DCEA 3PL8A 3F23A 3ABUA 1R1TA 1WFXA 2H09A 1JT6A 2QUFA 2WY7Q 3G2BA 1SC7A 4FETA 1JHFA 2W85A 5DCMB 1Y8RB 3HZJA 1RESA 1WI9A 3V8LA 3QU6A 1G4DA 3I59B 2NVQJ 3ABKH 4C2TA 2O0YA 4O5VA 2ZJ2A 2XAGA 1HDDC 4ESBA 2KRHA 2PMZA 4NBQA 5LRRA 2E2HJ 3CJTB 1K4TA 1DP3A 3ESWB 1ZH5A 3G6EI 5FLMJ 3JRFA 4BKXA 4M6XA 3MZ8A 4UVAA 3RIRA 4BHCA 3BG6A 2EIMH 2LF8A 4I01A 3KE2A 3M8FA 3ISPA 4AU7A 3FXRA 4ZC3A 3M07A 3ZMTA 2F4OB 1PUEE 1SFUA 1YW7A 2JA2A 3EUHC 2P5KA 4OINF 2A61A 2GIVA 3FM3A 3SFZA 2EILH 3HM5A 3EUAA 5ICFA 3Q3SA 2UZKA 1BI0A 1SD6A 1Y1WJ 2PBIA 1SAXA 2XAUA 4LFUA 2XASA 1NK2P 2GA1A 5LLQA 4DIQA 5LBQA 2F2EA 3IP4B 3A0HC 2VC1A 4BHPA 3I3LA 2TDXA 3HHGA 2GXAA 4RLQA 3E5XA 3F8NA 2DMPA 2CW8A 3ASNH 1KQ8A 2E5NA 4RAYA 3S1MJ 1IRXA 1J5YA 3KYDB 1KGSA 3ABTA 4UY8I 4HV6A 1KU9A 3WTTC 3SZGA 3E97A 1F1ZA 5C4JJ 3DF8A 5HDGA 4RB0A 3VPRA 2DQRA 2R7SA 5JVGF 1FOKA 2EV0A 1NG6A 3V4GA 2R93J 2LP0A 4E7SA 3GZNB 2DMQA 4C2UA 1QPIA 4HNTA 1OJLA 2QLZA 3I5UA 4RGXA 4ZDLA 3A03A 3GWZA 3O3KA 3ZRGA 3SXYA 1Y0UA 2QKMB 1YJWI 1E3PA 1S7AA 1K6YA 5K7FA 4F92B 3RPUA 1EV7A 3DPUA 2YSRA 3TW7A 1VF9A 2XUBA 4KJZA 3SHFA 4K2EA 5J8FA 2A6HF 1H9TA 3DBHB 4L9VA 1TWGJ 1JKOC 1JGGA 2RC4A 2Y0SN 1ONVA 4JP0A 1G8XA 3C2BA 5M3MJ 2LKXA 1CGPA 3GW2A 3CLQA 5GAHJ 3DEUA 2J5OA 2EJRA 1MJ9A 2W25A 3ZQFA 2FBHA 3K4KA 3BTIA 4L9NA 3MVPA 3WG7H 1PUFA 5EEHA 5GPCA 3AG3H 1D1CA 4RLFA 5TJJA 1UJ8A 3H0DA 2V1UA 4HQMA 4RMNA 3LSGA 2E2JJ 3GZ6A 2JA7J 2I8DA 2A05A 1OR7A 3M3YJ 1MJAA 3BC8A 2F48A 2XROA 2R0QC 4BJ5C 3S2HJ 2EQRA 2M7AA 3FXOA 1B8IA 2XGXA 5IP7J 2VB6A 1B59A 1X3UA 2VBXA 4XRSG 2OBPA 5LRSA 1OYIA 3E5QA 3PQKA 1LDDA 2HKXA 2R7TA 2R7QA 5KAIC 1T33A 1IN5A 2FMLA 1U8RA 4ITVA 1ETWA 1V5FA 1HQCA 3PFYA 1I27A 2E71A 4RB2C 2IJLA 1XD7A 4UHTA 2X9DA 4KYWA 4EEFG 1YRNA 3ZN1A 4WXDA 2LSOA 4RA2A 1N78A 1S9HA 1H89C 4D1QA 4CZZA 4BXFA 2ZMEB 3K4JA 2R7OA 2WC2A 1J7KA 4BY1J 2EV5A 2RQPA 1PP8F 2D5VA 1D0XA 3HTUA 4UVBA 2MC4A 4F7ZA 4B44A 3M9AA 5EJCA 3TDUC 2XC7A 3MKYB 3LA2A 4EGYA 3S1QJ 2HQAA 3CESA 4AUXA 1ACIA 3CUOA 1YW9A 1OMIA 2OCEA 2KLOA 3G73A 2NNYA 4XNFA 1WKMA 3JSOA 3ZQCA 2EV6A 1QNTA 5HOOA 5BPDA 1U6GA 5IT9Z 2XF6A 2Q2EB 1UFMA 4BL0B 4IL6C 3HRSA 4EGZA 4BDYA 3JTHA 2R4GA 1VQ5I 4ANJA 1CQTA 5FKLA 1KA8A 2DK5A 3ZMVA 1LPQA 3QRFF 1PP7U 1WCMJ 3T1BA 2IA1A 2CO5A 4XL9A 2IAIA 4A3GJ 3I4NJ 2BV6A 3R0AA 4D9JA 1GXPA 3K4BA 1AWCA 5LFAA 1E17A 2DLLA 3MKLA 2VASA 1OKRA 2QENA 3ERED 4Y15A 3U9GA 2E19A 1LKXA 3C7JA 1MH4A 4CCKA 3I9V2 3K69A 3LA3A 3QPTA 2OV7A 2W4SA 3DKYA 3BLYA 5IOZA 4HYEA 4YIRX 4MFDA 2O6GE 3F8FA 5J1RA 2V26A 2X1EA 3HUGB 3LQRA 4CSWA 1VQ6I 3H5NA 1R5HA 5DYMA 1H88C 4XSXF 3OYNA 3BG7A 2DYSH 3EQLF 1XGSA 3IWFA 1HDPA 4KMFA 1GVJA 2DA6A 3KEOA 4CYDA 3O8HA 3PSFA 5JLXA 3I56I 4CGZA 3TO7A 3VEPA 1MGTA 4Y7NJ 3JAMK 3GFMA 4XR6A 3KZYA 5E1ZB 4A69C 2RDPA 3DXJF 4I02A 1OISA 4DYRA 2ZC2A 4D0PA 1HF0A 3OIPA 2KJCA 1ZG3A 4G7HF 3NEUA 4M9SA 2X6WA 2R7XA 4ZH4F 1JJ8C 1HA8A 1B4AA 4M3GA 4N9IA 1LVKA 5EG0A 3HGGA 1IC8A 1XTAA 1YITI 4NC8A 2BBYA 1W4MA 2ZJPF 4JBAA 2MH9A 1R58A 3M1EA 4XM3A 4UB8C 2LK2A 1H8AC 3OS1A 4UVCA 3WE3A 2CFXA 3GFIA 1HC8A 4ENNA 3H0GJ 4PCQA 1NK3P 1YOVB 2HWVA 4A5MA 2KJBA 5IOYA 1R7JA 2HPMA 2E2IJ 2XB0X 2V9VA 3CJNA 5BNGA 4QPOA 3SEZA 1RR8C 1WJCA 3ZPLA 4FE7A 5CQEA 3RKQA 3S16J 2HZDA 3ABMH 1UHSA 1WGXA 4MHGA 3S1NJ 2M34A 5DV5A 2DMTA 2GA2A 2VJ4A 1OCRH 4GDFA 2DDBA 5CVUA 4UV9A 1CF7B 4I0AA 4Y52J 1YJ9I 3CMMA 3N4MA 2CV0A 1NHAA 2XB5A 4A0ZA 2O8XA 1DPUA 2VE8A 3DBRB 3FMRA 2EZIA 3GTJJ 2HU9A 2VQGA 3HKZA 2X0LA 1W7PB 3KLOA 4HF1A 4G7OF 2GIZA 4LG0B 1W0TA 1W7PD 4HRIA 2Z33A 4BXUA 5CVIA 3I54A 2K7LA 3T8TA 3IV5A 3R0JA 1FYLA 1K83J 2XV4S 2ZO4A 5DD8A 2L4MA 1W36C 2DDAA 1D5YA 3AFHA 1T08B 1LUJB 1YLFA 1A36A 4IHSA 4L0ZB 2RV8A 4OMZA 3SQNA 4CDGA 3HB9A 2X6XA 1F36A 2VC0A 1SEUA 3OOUA 3JR9A 3HC7A 4IEJA 3C3WA 4G6QA 4IHXA 2CYYA 2MW8A 4RDUA 1GV5A 2XF7A 4WK8F 2XAFA 4JX5A 3PSIA 2EFWA 1BC8C 1G59A 9ANTA 2B7EA 2L7ZA 3F9KA 2ADUA 3V7SA 3ZQ7A 5K7ZA 2BW3A 2CGPA 3S14J 4H4KC 1U5TA 1KQ0A 1FLIA 4G6DA 1BR4A 3GLLA 2Y9ZA 1IRGA 3F22A 2WA0A 2Z99A 2EIJH 2NS8A 2UUZA 4HPQA 4UNOA 1EF4A 1T56A 3V7CA 1OLTA 2ELJA 2DA3A 3LQQA 2ESHA 4PSXA 4QTRA 1VQKI 5EGOA 3UKGA 1L0OC 4CCLA 2Y75A 5KK1A 1T39A 1VQNI 2P6TA 2VUMJ 1IAWA 2GBYA 4Q47A 4HDVA 2LY2A 2YX7A 4IOCF 1GUUA 4ZYDA 1PJRA 3WODF 4I76A 1AKHA 2KP6A 5JHFA 1WZ2A 2YU9J 1BIBA 2NOJB 3D1NI 3G3ZA 3CUQC 2IPQX 5JLWA 2BEOA 1V5EA 4HDUA 2IS2A 3Q5FA 3OYGA 3D5SC 1IXCA 1OQYA 3H9QA 4A93J 1OFCX 1MW7A 2MA3A 4Z6YA 3GTMJ 4Y33A 3HOSA 3FXJA 1JUPA 1ODDA 5ILVA 2AQEA 3Q9SA
chains in the Genus database with same CATH topology
2ID3A 4M3DA 3WHCA 1LE8B 4C3IJ 4V2FA 4QIWN 2DMUA 1IV6A 3JRCA 5M5XJ 4W1UA 3FISA 3HOUJ 4XICA 2R5YB 2EZKA 3F0CA 3BR0A 4BBSJ 1FTTA 1WH5A 4A3BJ 2M9HA 2HDDA 3M4OJ 3S1RJ 5DTDA 1UMQA 1ZTRA 1WH7A 3NAUA 1RR7A 5M3FJ 1FIPA 3SDGA 1Z77A 5M5YJ 2O9LA 4A3CJ 4S0HB 4RBOA 2Y2ZA 1IUFA 5F27A 2ID6A 2N8GA 1X58A 2OPTA 3FK6A 3S17J 3DEWA 3WHBA 3GTGJ 2O8KA 1PUFB 5FKNA 1JT6A 2LTPA 4DYQA 5IYDJ 1AU7A 3ZQHA 1U9OA 2K9SA 2JK3A 3MN2A 1RESA 4FCYA 1APLC 2RAEA 4ABZA 1I50J 1B8IB 2NVQJ 3LSPA 1U9NA 1HDDC 1X2MA 4UUSB 1JTYA 2WB1N 1RPWA 2E2HJ 4B4CA 4CYCA 4M3BA 5FLMJ 3JRFA 4I6ZA 4BKXA 4A3IJ 2JA5J 1POGA 4DW6A 5DS9A 1BW5A 3G1LA 3QPSA 2EZLA 2K9NA 1VNDA 1YRNB 3BTCA 1O4XA 5F04A 3ZOBA 1U78A 1DU6A 2JN6A 2R5ZB 2XPVA 1HOMA 3HM5A 1S7EA 2TCTA 3Q3SA 1Y1WJ 5EYRA 1NK2P 1MBEA 4IHWA 3HEFA 4AYBN 4D7NA 2MSYA 2LLKA 3IH3A 4FTHA 2XPUA 2COBA 2DMPA 3BR6A 2DA5A 4FE4A 3S1MJ 4IHVA 5K7HA 3IH4A 1OCPA 2MGQA 5C4JJ 2I10A 4MO7A 3VPRA 3FIWA 1MBJA 3A01A 2KDZA 4MIMA 2PMZN 2R93J 4AC0A 2O7OA 2LP0A 2LD5A 2CJJA 2DMQA 1QPIA 2LY9A 1OJLA 3TW6A 3I4NJ 3NARA 3OIOA 1LE8A 3A03A 2DTZA 4XK4A 2E1OA 2R92J 3OSFA 4UUTA 1XS9A 4DZPA 2JMWA 5IYBJ 2HOAA 1ETVA 5K7FA 2HXIA 3HOWJ 2R5YA 4D7MA 5GP9A 5J3LA 2FJ1A 4D5CA 3TW7A 1VF9A 1ZQ3P 3HBLA 4XRSA 1TWGJ 5EZHA 1JKOC 5GPAA 5C3EJ 1JGGA 3BR2A 2Y0SN 2JA8J 4LOCA 4JP0A 3HOYJ 1SFOJ 1QVUA 3C2BA 5M3MJ 3HOXJ 2LKXA 3CDLA 1VFCA 3LOCA 4C3JJ 2LVSA 3S2DJ 3ZQFA 2NVTJ 3CCYA 3BTIA 3B6AA 5J1UA 3MVPA 1PUFA 1QVTA 5GPCA 5E3MA 4A3MJ 3GTPJ 3PO3J 1ORKA 1ZR4A 1ZK8A 3LSGA 2E2JJ 1IRZA 2JA7J 3JRIA 1XC5A 3M3YJ 2R0QC 3S2HJ 2EQRA 4M6VA 4BY7J 2WV1A 1B8IA 2XGCA 3BTLA 3IH2A 3TP3A 5IP7J 5M5WJ 4XRSG 1F43A 1JUMA 4UUSA 1ETOA 2P81A 2EH3A 1ZR2A 1AHDP 3ZQIA 1T33A 5C44J 1ETWA 1MBFA 1TC3C 3JRHA 5EG0B 5E3OA 1IJWC 4D5FA 2X9DA 4EEFG 1MBKA 1RKWA 1YRNA 2Y30A 3BR5A 3RZOJ 2HI3A 2DA2A 2M0CA 2OF7A 1H89C 2R5ZA 2QF7A 3RQIA 4BY1J 2D5VA 2NVYJ 1P7IA 2Y31A 3CQZJ 2QCOA 4JX4A 3S1QJ 4BXXJ 1LFUP 4IHYA 4AUXA 1FTZA 1ITYA 1IDZA 2IBDA 3BTJA 1GVDA 1FEXA 3BQYA 5FKOA 4DYCA 1ETKA 5F0FA 3HDDA 5FKMA 3ZQCA 2HOSA 4FISA 1FJLA 3BR1A 4G12A 4NDLA 3K7AJ 2M2EA 5IP6A 1U8BA 5E3NA 3JREA 3SFIA 4MLOA 4MFEA 1NTCA 1GDTA 3JRAA 3E7LA 2XSDC 2IEKA 1CQTA 3GTOJ 5FKLA 2EBIA 1GT0C 1R9TJ 1WCMJ 3HOVJ 1RETA 4GFBA 2X48A 1MNMC 2IAIA 4A3GJ 4L5EA 1IDYA 1E3OC 4A3DJ 3MKLA 5F08A 5HODA 4M3EA 3BT9A 2E19A 1MH4A 2XGDA 3JRBA 4QSHA 4B1RA 2XRLA 2CRGA 4DZJA 5IOZA 1DU0A 2W48A 1BL0A 4MFDA 5EF6A 3L1PA 5J1RA 1ZGWA 4HNVA 3ZQLA 1ETQA 2FX0A 2KT0A 1H88C 1P7JA 2L0KA 2L7MP 3HKZN 1HDPA 1TWCJ 2DJNA 3DCFA 2DA6A 2ECBA 2MG4A 3O8HA 1ETXA 1GV2A 5JLXA 1B72A 4Y7NJ 3RZDJ 3BR3A 5EGOB 4A69C 3HGYA 1TWFJ 3TEDA 4DYRA 1MSEC 3FKIJ 1HF0A 1OCTC 1WPKA 1MSFC 4JYKA 3B6CA 3LNQA 1X2NA 1AKHB 5F1JA 1JJ8C 3O8GA 3GBGA 1BW6A 2K40A 1B72B 4M3GA 3PM1A 5EG0A 4A3LJ 2ME6A 3HGGA 1ZKGA 1IC8A 3W6VA 4X6AJ 1G2HA 2HXOA 2K9QA 5J1YA 2NVXJ 3HOZJ 1BJZA 1JUSA 4A3FJ 1HLVA 1A5JA 2LK2A 1H8AC 2L7FP 3BG5A 3H0GJ 1JKRC 2XGEA 1NK3P 2YS9A 5IOYA 2JA6J 2CUEA 3Q0WA 5IYCJ 3JRDA 2XB0X 2E2IJ 5F0CA 5BNGA 1MBGA 1WI3A 2LFBA 2TRTA 4FE7A 1A6IA 1I3QJ 3RKQA 2CU7A 1W0UA 3S16J 5C4XJ 2DA7A 2R7ZJ 2ELKA 2YUSA 1UHSA 1WGXA 3A02A 3S1NJ 5IP9J 2M34A 2DMTA 1LFBA 2X6OA 1Z0XA 2L9RA 3G1MA 2DN0A 1IGNA 1MBHA 4Y52J 3GTLJ 2CQQA 2XB5A 4XIDA 1K61A 4B3AA 2EZIA 1Y1VJ 3GTJJ 4A3JJ 1JT0A 1ETYA 2VI6A 2VKVA 4X1EA 1IG7A 1W0TA 1RKTA 2FD5A 3QPLA 2GLOA 3K2AA 3I4MJ 3IV5A 1K83J 2DA4A 4A3KJ 3ZQGA 2LR8A 3H3VK 1D5YA 4JX6A 3GTQJ 2GM4A 2H8RA 3SJMA 1HCRA 3HB9A 1F36A 3PO2J 3OOUA 3LSJA 3Q0VA 3JR9A 1ENHA 4IEJA 4CYCB 4IHXA 4J19A 2MW8A 4RDUA 1GV5A 3BG3A 2NS7A 1XG1A 1BA5A 4JX5A 5EZGA 9ANTA 2H1KA 2M8GX 2L7ZA 5K7ZA 1TWAJ 2ME0A 3S14J 5E3LA 2DA1A 5FKKA 2ECCA 4BBRJ 2JWTA 1JKPC 5IPAA 3OSGA 2Y9ZA 3CMYA 1JKQC 5FLVA 1UG2A 5EEAA 1VI0A 3LSRA 4C3HJ 2NS8A 1EF4A 1T56A 2Y9YA 2CQXA 2DA3A 3JRGA 1TWHJ 3G1OA 4QTRA 5EGOA 4A3EJ 5EDNA 3UKGA 1JTXA 1QRYA 2G0EA 2VUMJ 1Q1VA 2GBYA 3FK7A 2CUFA 5FJ8J 4V2GA 2DMNA 3S15J 1GUUA 1JJ6C 4C2MJ 4I76A 1AKHA 2EZHA 3BG9A 3QQAA 4M3FA 3GTKJ 2YU9J 2AHQA 1MH3A 2JJ7A 2VKEA 3D1NI 4W97A 5JLWA 2HQ5A 2FQ4A 2HOTA 3TP0A 2HYJA 3BQZA 1FIAA 2B63J 2NOGA 4A93J 4XRMA 1OFCX 3A01B 3GTMJ 3Q0UA 2AO9A 5F0HA 2ZB9A 1JUPA 1SANA 2XPWA 2VPRA 1I6HJ 2WAQN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ID3 A;  4M3D A;  3WHC A;  1LE8 B;  4C3I J;  4V2F A;  4QIW N;  2DMU A;  1IV6 A;  3JRC A;  5M5X J;  4W1U A;  3FIS A;  3HOU J;  4XIC A;  2R5Y B;  2EZK A;  3F0C A;  3BR0 A;  4BBS J;  1FTT A;  1WH5 A;  4A3B J;  2M9H A;  2HDD A;  3M4O J;  3S1R J;  5DTD A;  1UMQ A;  1ZTR A;  1WH7 A;  3NAU A;  1RR7 A;  5M3F J;  1FIP A;  3SDG A;  1Z77 A;  5M5Y J;  2O9L A;  4A3C J;  4S0H B;  4RBO A;  2Y2Z A;  1IUF A;  5F27 A;  2ID6 A;  2N8G A;  1X58 A;  2OPT A;  3FK6 A;  3S17 J;  3DEW A;  3WHB A;  3GTG J;  2O8K A;  1PUF B;  5FKN A;  1JT6 A;  2LTP A;  4DYQ A;  5IYD J;  1AU7 A;  3ZQH A;  1U9O A;  2K9S A;  2JK3 A;  3MN2 A;  1RES A;  4FCY A;  1APL C;  2RAE A;  4ABZ A;  1I50 J;  1B8I B;  2NVQ J;  3LSP A;  1U9N A;  1HDD C;  1X2M A;  4UUS B;  1JTY A;  2WB1 N;  1RPW A;  2E2H J;  4B4C A;  4CYC A;  4M3B A;  5FLM J;  3JRF A;  4I6Z A;  4BKX A;  4A3I J;  2JA5 J;  1POG A;  4DW6 A;  5DS9 A;  1BW5 A;  3G1L A;  3QPS A;  2EZL A;  2K9N A;  1VND A;  1YRN B;  3BTC A;  1O4X A;  5F04 A;  3ZOB A;  1U78 A;  1DU6 A;  2JN6 A;  2R5Z B;  2XPV A;  1HOM A;  3HM5 A;  1S7E A;  2TCT A;  3Q3S A;  1Y1W J;  5EYR A;  1NK2 P;  1MBE A;  4IHW A;  3HEF A;  4AYB N;  4D7N A;  2MSY A;  2LLK A;  3IH3 A;  4FTH A;  2XPU A;  2COB A;  2DMP A;  3BR6 A;  2DA5 A;  4FE4 A;  3S1M J;  4IHV A;  5K7H A;  3IH4 A;  1OCP A;  2MGQ A;  5C4J J;  2I10 A;  4MO7 A;  3VPR A;  3FIW A;  1MBJ A;  3A01 A;  2KDZ A;  4MIM A;  2PMZ N;  2R93 J;  4AC0 A;  2O7O A;  2LP0 A;  2LD5 A;  2CJJ A;  2DMQ A;  1QPI A;  2LY9 A;  1OJL A;  3TW6 A;  3I4N J;  3NAR A;  3OIO A;  1LE8 A;  3A03 A;  2DTZ A;  4XK4 A;  2E1O A;  2R92 J;  3OSF A;  4UUT A;  1XS9 A;  4DZP A;  2JMW A;  5IYB J;  2HOA A;  1ETV A;  5K7F A;  2HXI A;  3HOW J;  2R5Y A;  4D7M A;  5GP9 A;  5J3L A;  2FJ1 A;  4D5C A;  3TW7 A;  1VF9 A;  1ZQ3 P;  3HBL A;  4XRS A;  1TWG J;  5EZH A;  1JKO C;  5GPA A;  5C3E J;  1JGG A;  3BR2 A;  2Y0S N;  2JA8 J;  4LOC A;  4JP0 A;  3HOY J;  1SFO J;  1QVU A;  3C2B A;  5M3M J;  3HOX J;  2LKX A;  3CDL A;  1VFC A;  3LOC A;  4C3J J;  2LVS A;  3S2D J;  3ZQF A;  2NVT J;  3CCY A;  3BTI A;  3B6A A;  5J1U A;  3MVP A;  1PUF A;  1QVT A;  5GPC A;  5E3M A;  4A3M J;  3GTP J;  3PO3 J;  1ORK A;  1ZR4 A;  1ZK8 A;  3LSG A;  2E2J J;  1IRZ A;  2JA7 J;  3JRI A;  1XC5 A;  3M3Y J;  2R0Q C;  3S2H J;  2EQR A;  4M6V A;  4BY7 J;  2WV1 A;  1B8I A;  2XGC A;  3BTL A;  3IH2 A;  3TP3 A;  5IP7 J;  5M5W J;  4XRS G;  1F43 A;  1JUM A;  4UUS A;  1ETO A;  2P81 A;  2EH3 A;  1ZR2 A;  1AHD P;  3ZQI A;  1T33 A;  5C44 J;  1ETW A;  1MBF A;  1TC3 C;  3JRH A;  5EG0 B;  5E3O A;  1IJW C;  4D5F A;  2X9D A;  4EEF G;  1MBK A;  1RKW A;  1YRN A;  2Y30 A;  3BR5 A;  3RZO J;  2HI3 A;  2DA2 A;  2M0C A;  2OF7 A;  1H89 C;  2R5Z A;  2QF7 A;  3RQI A;  4BY1 J;  2D5V A;  2NVY J;  1P7I A;  2Y31 A;  3CQZ J;  2QCO A;  4JX4 A;  3S1Q J;  4BXX J;  1LFU P;  4IHY A;  4AUX A;  1FTZ A;  1ITY A;  1IDZ A;  2IBD A;  3BTJ A;  1GVD A;  1FEX A;  3BQY A;  5FKO A;  4DYC A;  1ETK A;  5F0F A;  3HDD A;  5FKM A;  3ZQC A;  2HOS A;  4FIS A;  1FJL A;  3BR1 A;  4G12 A;  4NDL A;  3K7A J;  2M2E A;  5IP6 A;  1U8B A;  5E3N A;  3JRE A;  3SFI A;  4MLO A;  4MFE A;  1NTC A;  1GDT A;  3JRA A;  3E7L A;  2XSD C;  2IEK A;  1CQT A;  3GTO J;  5FKL A;  2EBI A;  1GT0 C;  1R9T J;  1WCM J;  3HOV J;  1RET A;  4GFB A;  2X48 A;  1MNM C;  2IAI A;  4A3G J;  4L5E A;  1IDY A;  1E3O C;  4A3D J;  3MKL A;  5F08 A;  5HOD A;  4M3E A;  3BT9 A;  2E19 A;  1MH4 A;  2XGD A;  3JRB A;  4QSH A;  4B1R A;  2XRL A;  2CRG A;  4DZJ A;  5IOZ A;  1DU0 A;  2W48 A;  1BL0 A;  4MFD A;  5EF6 A;  3L1P A;  5J1R A;  1ZGW A;  4HNV A;  3ZQL A;  1ETQ A;  2FX0 A;  2KT0 A;  1H88 C;  1P7J A;  2L0K A;  2L7M P;  3HKZ N;  1HDP A;  1TWC J;  2DJN A;  3DCF A;  2DA6 A;  2ECB A;  2MG4 A;  3O8H A;  1ETX A;  1GV2 A;  5JLX A;  1B72 A;  4Y7N J;  3RZD J;  3BR3 A;  5EGO B;  4A69 C;  3HGY A;  1TWF J;  3TED A;  4DYR A;  1MSE C;  3FKI J;  1HF0 A;  1OCT C;  1WPK A;  1MSF C;  4JYK A;  3B6C A;  3LNQ A;  1X2N A;  1AKH B;  5F1J A;  1JJ8 C;  3O8G A;  3GBG A;  1BW6 A;  2K40 A;  1B72 B;  4M3G A;  3PM1 A;  5EG0 A;  4A3L J;  2ME6 A;  3HGG A;  1ZKG A;  1IC8 A;  3W6V A;  4X6A J;  1G2H A;  2HXO A;  2K9Q A;  5J1Y A;  2NVX J;  3HOZ J;  1BJZ A;  1JUS A;  4A3F J;  1HLV A;  1A5J A;  2LK2 A;  1H8A C;  2L7F P;  3BG5 A;  3H0G J;  1JKR C;  2XGE A;  1NK3 P;  2YS9 A;  5IOY A;  2JA6 J;  2CUE A;  3Q0W A;  5IYC J;  3JRD A;  2XB0 X;  2E2I J;  5F0C A;  5BNG A;  1MBG A;  1WI3 A;  2LFB A;  2TRT A;  4FE7 A;  1A6I A;  1I3Q J;  3RKQ A;  2CU7 A;  1W0U A;  3S16 J;  5C4X J;  2DA7 A;  2R7Z J;  2ELK A;  2YUS A;  1UHS A;  1WGX A;  3A02 A;  3S1N J;  5IP9 J;  2M34 A;  2DMT A;  1LFB A;  2X6O A;  1Z0X A;  2L9R A;  3G1M A;  2DN0 A;  1IGN A;  1MBH A;  4Y52 J;  3GTL J;  2CQQ A;  2XB5 A;  4XID A;  1K61 A;  4B3A A;  2EZI A;  1Y1V J;  3GTJ J;  4A3J J;  1JT0 A;  1ETY A;  2VI6 A;  2VKV A;  4X1E A;  1IG7 A;  1W0T A;  1RKT A;  2FD5 A;  3QPL A;  2GLO A;  3K2A A;  3I4M J;  3IV5 A;  1K83 J;  2DA4 A;  4A3K J;  3ZQG A;  2LR8 A;  3H3V K;  1D5Y A;  4JX6 A;  3GTQ J;  2GM4 A;  2H8R A;  3SJM A;  1HCR A;  3HB9 A;  1F36 A;  3PO2 J;  3OOU A;  3LSJ A;  3Q0V A;  3JR9 A;  1ENH A;  4IEJ A;  4CYC B;  4IHX A;  4J19 A;  2MW8 A;  4RDU A;  1GV5 A;  3BG3 A;  2NS7 A;  1XG1 A;  1BA5 A;  4JX5 A;  5EZG A;  9ANT A;  2H1K A;  2M8G X;  2L7Z A;  5K7Z A;  1TWA J;  2ME0 A;  3S14 J;  5E3L A;  2DA1 A;  5FKK A;  2ECC A;  4BBR J;  2JWT A;  1JKP C;  5IPA A;  3OSG A;  2Y9Z A;  3CMY A;  1JKQ C;  5FLV A;  1UG2 A;  5EEA A;  1VI0 A;  3LSR A;  4C3H J;  2NS8 A;  1EF4 A;  1T56 A;  2Y9Y A;  2CQX A;  2DA3 A;  3JRG A;  1TWH J;  3G1O A;  4QTR A;  5EGO A;  4A3E J;  5EDN A;  3UKG A;  1JTX A;  1QRY A;  2G0E A;  2VUM J;  1Q1V A;  2GBY A;  3FK7 A;  2CUF A;  5FJ8 J;  4V2G A;  2DMN A;  3S15 J;  1GUU A;  1JJ6 C;  4C2M J;  4I76 A;  1AKH A;  2EZH A;  3BG9 A;  3QQA A;  4M3F A;  3GTK J;  2YU9 J;  2AHQ A;  1MH3 A;  2JJ7 A;  2VKE A;  3D1N I;  4W97 A;  5JLW A;  2HQ5 A;  2FQ4 A;  2HOT A;  3TP0 A;  2HYJ A;  3BQZ A;  1FIA A;  2B63 J;  2NOG A;  4A93 J;  4XRM A;  1OFC X;  3A01 B;  3GTM J;  3Q0U A;  2AO9 A;  5F0H A;  2ZB9 A;  1JUP A;  1SAN A;  2XPW A;  2VPR A;  1I6H J;  2WAQ N; 
#chains in the Genus database with same CATH topology
 4IX7 A;  1RI7 A;  1W5T A;  3FMQ A;  3K1N A;  3TOA A;  2XAH A;  1LQ1 A;  1MDM A;  2HVS A;  2ISY A;  2F5F A;  1VZ0 A;  2BVM A;  4W1U A;  1D8K A;  5CYV A;  3VFZ A;  3HOU J;  1QO0 D;  1X1D A;  4M6Y A;  3VOE A;  3GUD A;  2R5Y B;  4V19 K;  3CUQ B;  3O6B B;  3BJ6 A;  1IF1 A;  4CA0 A;  5A2Q K;  4A3B J;  1HKT A;  4G9Y A;  4BAY A;  2VKD A;  3S1R J;  1UMQ A;  1ZTR A;  1OYW A;  3L7W A;  2P4W A;  1JHH A;  5M3F J;  5J6X A;  3KP2 A;  5DCM A;  1R49 A;  2XIG A;  2ZXW H;  1O3T A;  3FBN B;  3I59 A;  1YYV A;  2L7K A;  4GXO A;  4AYB A;  4XLF A;  3S17 J;  2K4B A;  3N97 A;  1I3A A;  3WHB A;  3GTG J;  2O8K A;  1EH6 A;  3BZ6 A;  1O7F A;  4OAY A;  4DYQ A;  4I98 B;  2DW4 A;  3ZQH A;  1U9O A;  4EJW A;  4ZDO A;  1MMS A;  4OOI A;  4HX7 A;  3MZH A;  4HG2 A;  2E7W A;  1SD5 A;  4CH7 A;  4ZTF A;  4ZDP A;  3AKZ A;  2KMU A;  2VJI A;  2RAE A;  2PI0 A;  1I50 J;  2JUG A;  3F8M A;  5ICE A;  1D5V A;  1U9N A;  4F52 A;  2EIK H;  2L9V A;  3JSP A;  3F3X A;  4LD5 A;  2MLG A;  2OD5 A;  4MTD A;  1X2M A;  2WAE A;  4MQV A;  4UUS B;  2WB1 N;  1H9G A;  4AIK A;  1RPW A;  4CZC A;  1IW7 F;  4UUV A;  4M3B A;  2KL4 A;  4I6Z A;  4JQF A;  2PJR B;  5IT9 K;  3RDI A;  1O7L A;  4KT6 A;  3CMA I;  1QA6 A;  3G1L A;  2EZL A;  2K9N A;  1WRJ A;  3LFK A;  3OL4 A;  3BPX A;  2V1D A;  3REO A;  4IOA F;  4EM1 A;  3FHZ A;  4E7I A;  1K78 B;  2FOK A;  5HS7 A;  3X2Q H;  3KEY A;  4B8X A;  1HOM A;  2RVC A;  3BZK A;  3V7R A;  2TCT A;  1R1U A;  2V79 A;  5EYR A;  3KP5 A;  1L3L A;  2QEX I;  3DV8 A;  5B1A H;  4BNC A;  3W2A A;  2LLK A;  4ZJZ A;  3T8R A;  2XPU A;  4E7H A;  1LVA A;  3BR6 A;  4HX8 A;  2W57 A;  1XCV A;  2P5V A;  2A6T A;  3IH4 A;  1OCP A;  1B9M A;  3V42 A;  1XGM A;  4XOT A;  1BC7 C;  2R7F A;  4BDZ A;  1RC9 A;  4NC6 A;  3A01 A;  4E6K G;  3OIQ A;  1IXS B;  4HBL A;  1YIJ I;  1SFE A;  2O7O A;  1UHM A;  1F5T A;  4Y13 A;  4KIC A;  2LY9 A;  2QQ8 A;  1S5L C;  1UEL B;  3H3U A;  2VKH A;  3DFG A;  2E1O A;  1FC3 A;  1WVR A;  4UUT A;  3FX3 A;  1XS9 A;  2JMW A;  3LAP A;  2VXD A;  3HOW J;  4D7M A;  3I55 I;  2WBM A;  4KN7 X;  2DI3 A;  5GP9 A;  2FJ1 A;  4D5C A;  1X19 A;  3BCA A;  2CUZ A;  3RI4 A;  1BM9 A;  3KLN A;  5EZH A;  3IWZ A;  2BY1 A;  2R7W A;  3ASO H;  4FX0 A;  2O3F A;  3GO5 A;  3BR2 A;  5L3B A;  3WGG A;  2JA8 J;  4JK1 X;  2BXZ A;  5CQG A;  2VPL A;  4KA4 A;  1HW1 A;  1MIJ A;  4RGU A;  3K70 C;  4C3J J;  2LVS A;  2BXY A;  3LMM A;  3S2D J;  3CD6 I;  3TQN A;  1FOY A;  3B6A A;  5J1U A;  3K1P A;  1J75 A;  1QVT A;  5E3M A;  3GTP J;  1XDS A;  2Z16 A;  3L9F A;  4XMY A;  1ZR4 A;  2VL8 A;  1IRZ A;  5D5U B;  1BI2 A;  2BVL A;  3JRI A;  3W6J B;  4IO9 F;  2QQ9 A;  1B9N A;  4DJA A;  2VBW A;  3H92 A;  1XSX A;  3BTL A;  1W1W E;  3TP3 A;  3RSN A;  2QWW A;  2VE9 A;  2RGV A;  4BQA A;  4M74 A;  1ETO A;  2UV1 A;  3LSM A;  2EH3 A;  3JW4 A;  4AVZ A;  4N4N B;  3OYK A;  5C44 J;  2E7X A;  5AON A;  4HNU A;  3C1D A;  1TC3 C;  4XLC A;  1OPC A;  2Q1Z B;  3U21 A;  2LNB A;  5J47 A;  5E3O A;  5CJ9 A;  3IKV A;  1G3T A;  3HPG A;  5BOX A;  2NRA C;  1DPR A;  3TO9 A;  1K79 A;  1RKW A;  4LIU A;  2Y30 A;  3BR5 A;  3RZO J;  4RAF A;  4M9Z A;  2E1N A;  4GYI A;  3MQ0 A;  4B48 A;  1Z05 A;  1BI3 A;  1PYV A;  2A5Y B;  5EEG A;  2R5Z A;  3RQI A;  4IRG A;  2STW A;  2V7F A;  3VWB A;  3RYP A;  1ZGA A;  4BEH A;  2ZFU A;  1DUX C;  2OAZ A;  3T5X A;  2KQR A;  4JX4 A;  4UB6 C;  4EJU A;  4H0E A;  2QBY B;  4IHY A;  4LLL A;  1W5C C;  1IDZ A;  4GRI A;  3BTJ A;  2DFH A;  3KZI C;  3F6O A;  3EUK L;  3WTX C;  4OWR B;  3VYR B;  4QPQ A;  5FKM A;  4ZYH A;  4U7D A;  5E17 F;  2VJ5 A;  2EFP A;  2JVG A;  4FIS A;  4A12 A;  1MND A;  1XGO A;  1UST A;  2KHM A;  1LFP A;  3BR1 A;  4G12 A;  1U8B A;  2D1H A;  2M2E A;  3MAJ A;  4LIV A;  3BWG A;  3J7A Y;  2JPC A;  5ICC A;  4FAS D;  5FRN A;  2IEK A;  1E0E A;  2KIS A;  5E79 C;  5J40 A;  2P7V B;  2COM A;  2KPM A;  1GT0 C;  4EV0 A;  2LBF A;  3ECH A;  1Z6T A;  2IGK A;  1RET A;  2HVQ A;  2Z3Y A;  5F1R A;  2MBF A;  5FFZ A;  4MNU A;  1TNS A;  1OCO H;  3EDP A;  1E3O C;  4CO8 A;  2HTS A;  4A3D J;  1FOX A;  2B0L A;  1V54 H;  2O5R A;  5F08 A;  3J81 Z;  4YFK F;  1RUO A;  4PDK A;  3BJO A;  2NS0 A;  2CH0 A;  1MZB A;  1UG0 A;  4OIP F;  2HR3 A;  2XGD A;  1FMV A;  3IC7 A;  6PAX A;  1T0F C;  4RB1 A;  1GXQ A;  1ZHF A;  2CRG A;  3R4K A;  1DU0 A;  2ELH A;  2FBK A;  2W48 A;  3M7G A;  3L1P A;  2GZW A;  1MD0 A;  4HNV A;  1LEA A;  2UXN A;  4XKV A;  1TLH B;  2K9M A;  2KT0 A;  4LGW A;  1P7J A;  5LGT A;  5LD2 C;  3HKZ N;  4WXH A;  4F55 A;  4XKB A;  4NNJ A;  2DJN A;  4ZYE A;  2MG4 A;  1XGN A;  1GV2 A;  5IY5 H;  5KVR A;  2K3F A;  2IGO A;  3HGY A;  2CQN A;  3P9I A;  4BS9 A;  3P9K A;  2RRE A;  2HOE A;  1WJD A;  2V1X A;  3FKI J;  1X4O A;  1WPK A;  3UR3 C;  4ESJ A;  4IJA A;  4E70 A;  1MNE A;  1BBY A;  1FY7 A;  2X4H A;  5F1J A;  1IUY A;  3GBG A;  2O61 A;  2KZG A;  3OL3 A;  2VT2 A;  3PM1 A;  4GYG A;  4PFO A;  2ME6 A;  5DUI A;  4KIS A;  2HXO A;  2K9Q A;  3WTS C;  2HGC A;  5D4S A;  2QKL B;  2VLA A;  3HOZ J;  1FSH A;  4F91 B;  1JUS A;  4IRH A;  2ZFW A;  1HLV A;  1A5J A;  1MJB A;  2L7F P;  1IN8 A;  5JHU A;  2MD5 A;  3BG5 A;  1YO5 C;  2NAZ A;  2VBZ A;  1JKR C;  2YS9 A;  4IVN A;  4XBF A;  1QZZ A;  3SDB A;  2AXL A;  2ZKZ A;  3CZ6 A;  3JRD A;  4KIT B;  3ZCO A;  3DPL C;  5F0C A;  4A2U A;  2J5P A;  3CO7 C;  4KMU X;  1SFX A;  2TRT A;  1YIO A;  4HAM A;  4BQQ A;  1OCC H;  3QU3 A;  3ZMU A;  1S3J A;  3TL4 X;  2CU7 A;  1V5G A;  2ESN A;  5AIP A;  1U2W A;  2I5U A;  5C4X J;  2DA7 A;  3PNY A;  1J09 A;  4AIJ A;  1W7P A;  2PLY A;  3HTS B;  2DBB A;  3CCM I;  5HNH A;  2X6O A;  3CLO A;  2QSF X;  3BOQ A;  2JUC A;  3A2K A;  4KIG A;  4EM0 B;  1Z0X A;  2L9R A;  3SEQ A;  2D1V A;  4XKW A;  2DN0 A;  1IGN A;  3LSH A;  2CQQ A;  4M71 A;  2GOM A;  4ZZL A;  1YI2 I;  1DQU A;  1Y1V J;  1WWX A;  3LSI A;  3K9T A;  4B3X A;  3CCL I;  2PX9 A;  2XRN A;  3VDX A;  2VI6 A;  2NVU B;  5KNL A;  1N77 A;  3TDZ C;  3OYH A;  1IV8 A;  1RKT A;  2DOD A;  2FD5 A;  3QOD A;  3QPL A;  5HLI A;  3QYB A;  1O3Q A;  2DA4 A;  3CC7 I;  2LR8 A;  2K27 A;  2MFZ A;  2XAQ A;  3DLL F;  5HS8 A;  3GLX A;  5LGU A;  3RKX A;  2DQL A;  1EJ9 A;  2M7B A;  3SJM A;  1YTY A;  2PQ8 A;  1TQM A;  2Z1D A;  3LWF A;  4FQG A;  3A4C A;  4OU0 A;  3L2R A;  3DPT A;  2L5Q A;  3KYL A;  4YIF A;  3TKY A;  1K6O A;  4J19 A;  2PG4 A;  1FYM A;  1T38 A;  2NS7 A;  1XG1 A;  3JTG A;  5EZG A;  2LY1 A;  1TWA J;  2ZXI A;  3WU0 A;  1B6A A;  1FZP B;  2JWT A;  3HOT A;  5IPA A;  3OSG A;  2P7C B;  1WJB A;  2DFI A;  3WTU C;  2LKP A;  1UG2 A;  5EEA A;  1VI0 A;  2KKO A;  4C3H J;  2DT6 A;  2Y9Y A;  3FDY A;  3PQJ A;  1SVM A;  3G1O A;  3L2C A;  5GAD J;  5EDN A;  1JTX A;  2WAF A;  2ISZ A;  1D8J A;  3FXU A;  1HSJ A;  5D6E A;  2CUF A;  5ILU A;  3BJA A;  4IXA A;  2DMN A;  2BYV E;  3LA7 A;  3S15 J;  1TBX A;  4C2M J;  1ZRF A;  2VJJ A;  3S3M A;  2EZH A;  4XLA A;  4PZJ A;  1LB2 A;  2DYR H;  3GTK J;  3LAJ A;  1R71 A;  1MH3 A;  1MKM A;  3L00 A;  3DTI A;  4W97 A;  4IHT A;  1ZG1 A;  2ZNY A;  3WU2 C;  2HOT A;  4Q5S F;  3TP0 A;  3W2V A;  2MD0 A;  2NOG A;  3OYB A;  4LLG F;  1SVO A;  3NWT A;  4XRM A;  2QQB A;  2W84 A;  2LDU A;  2AO9 A;  2WTE A;  3U2R A;  5F0H A;  5F6F A;  3CC4 I;  1T98 A;  2LD5 A;  2HZT A;  2WAQ N;  1T6S A;  4C30 A;  2ID3 A;  1ZRD A;  2AQF A;  4GGG A;  2IW5 A;  4KIF A;  3WHC A;  1U3E M;  2BHY A;  4V2F A;  1OYY A;  1IV6 A;  3JRC A;  1IXR C;  3DTE A;  1ZN2 A;  2EZK A;  3F0C A;  3BR0 A;  1OR7 C;  2L02 A;  1WH5 A;  1DP7 P;  4LB6 B;  2M9H A;  3RPU D;  4E7J A;  4EMS A;  2X85 A;  1VQ9 I;  1RR7 A;  2CQ7 A;  1RIO H;  3COA C;  1XCB A;  1Z77 A;  2O9L A;  1K4S A;  1YHQ I;  3F8B A;  4YEL A;  2Y2Z A;  2Y48 A;  1IUF A;  5CVV A;  2N8G A;  1X58 A;  3I4P A;  5E20 A;  2M30 A;  4AID A;  4C9Y A;  4B47 A;  3P9C A;  1FP2 A;  3FK6 A;  1KYW A;  1Y39 A;  3B02 A;  2F4I A;  4ASN A;  5FKN A;  1PUF B;  5FO5 A;  2LTP A;  3PJR A;  2KIF A;  2VBY A;  4BE2 A;  1Z3Y A;  1R23 A;  2F4M B;  2AXT C;  3ZMD A;  5ICG A;  2K9S A;  2JK3 A;  2DK8 A;  2K02 A;  2OJE D;  4FCY A;  4BQN A;  1B8I B;  1O3R A;  5E18 F;  2W24 A;  3IAM 2;  2DTR A;  2ZJQ F;  1XN7 A;  2R3S A;  4HW0 A;  3GFL A;  4U7B A;  4CYC A;  4HLY A;  4MTE A;  3BCB A;  3BPV A;  2LMD A;  1ZAO A;  2PN6 A;  3G71 I;  2JA5 J;  1N25 A;  5DS9 A;  1BW5 A;  1J9I A;  3MKZ A;  3QPS A;  2ICW G;  1VND A;  1YRN B;  4LK0 F;  2VXZ A;  3UNG C;  2H6B A;  5B66 C;  5HLT A;  2EFQ A;  4HOB A;  3CDI A;  2HKO A;  4CCJ A;  2W82 A;  3ZOB A;  2JTV A;  2LG4 A;  3MKW B;  2JN6 A;  5JVT A;  2IS6 A;  1O3S A;  2FRH A;  2HDW A;  2IP2 A;  2XPV A;  2Y0S A;  2XDV A;  4P1W A;  2LYC A;  1J0R A;  5E1X A;  3K1M A;  1DDN A;  4L9T A;  5E1W A;  3J81 K;  1S7E A;  1MMN A;  1NG7 A;  5D4R A;  3C2H A;  1NH3 A;  4IQJ A;  3DKX A;  5L3D A;  1MBE A;  5D8K B;  3OYI A;  4IHW A;  3SZP A;  1S29 A;  1XMK A;  4D7N A;  2MSY A;  4BGD A;  3IH3 A;  3P5J A;  1W36 D;  2JSC A;  4UV8 A;  1LDJ A;  2XHK A;  2D45 A;  5D8L B;  2COB A;  3PIP F;  3ZXS A;  2H94 A;  3GZ5 A;  1Z9C A;  3HRM A;  4FE4 A;  3WTV C;  4IHV A;  1Y6I A;  2CMP A;  3WTZ A;  5FGM A;  5K7H A;  4ZTJ A;  5H6Q A;  3B73 A;  3HYI A;  2IXS A;  1TW3 A;  4DBQ A;  4BYY A;  1IZ1 A;  4MO7 A;  4KNY A;  1YS7 A;  3FIW A;  1MBJ A;  3QYE A;  2KDZ A;  2IVM A;  2PMZ N;  2LRE A;  2CJJ A;  4CCN A;  2FBI A;  4XLP F;  1FP1 D;  4KUM A;  2HEO A;  1IN4 A;  3MFK A;  1LE8 A;  3LFU A;  4BE1 A;  3GF2 A;  2DJI A;  4Y17 A;  2R92 J;  2M4K A;  5IYB J;  2KZV A;  2ZXJ A;  3E1S A;  2HXI A;  1P92 A;  2BY2 A;  5J3L A;  3HSR A;  1XMX A;  1QU3 A;  1REP C;  2L3D A;  4IPA A;  2GXG A;  3HBL A;  4HF0 A;  1ERD A;  2F5E A;  1ZLJ A;  4XN3 A;  1EH8 A;  4LOC A;  1QVU A;  3HOX J;  5L3G A;  3CDL A;  1VFC A;  2E1M C;  2V9P A;  1SAU A;  2NVT J;  3CCY A;  4QLC U;  1VQ7 I;  4RGR A;  4N0B A;  1X1C A;  4PGG A;  1Y8Q B;  4AWX B;  2KRC A;  3CTA A;  3M1C A;  3WG9 A;  3HG9 A;  2LRD A;  3WGH A;  5FD6 A;  3QP6 A;  2RN7 A;  1A31 A;  1X3W B;  3H5R A;  4BY7 J;  2RNG A;  3F21 A;  3D5L A;  2CV2 A;  3IH2 A;  2X1D A;  1F43 A;  3S8P A;  1ZGJ A;  4U0V A;  2P81 A;  4XLE A;  2FXA A;  3CDH A;  5CVJ A;  4ENM A;  3ZQI A;  2HFH A;  2NNN A;  1ZAR A;  3MCZ A;  2E1M B;  2PJP A;  3AL0 C;  1MBF A;  3OYJ A;  5DCF A;  3IKT A;  2OZ6 A;  5EG0 B;  3JRH A;  4RM3 A;  4PUS A;  3OWT A;  5LGN A;  4D5F A;  1IJW C;  1MBK A;  3HXL A;  3DU5 A;  4A6E A;  1YE9 A;  2HI3 A;  4PJN A;  1XMA A;  2QF7 A;  3OY9 A;  5LHI A;  1P7I A;  1WJF A;  4CUG A;  4PJJ A;  2XKP A;  2YU3 A;  3TOB A;  3AL0 B;  2IS1 A;  3RPQ A;  2CV1 A;  2Q8K A;  3J7Y J;  2IBD A;  2K86 A;  2KRF A;  1VQ4 I;  3K4N A;  1BJA A;  3IAS 2;  1FEX A;  3BQY A;  3I53 A;  1ETK A;  4XRF A;  5F0F A;  3F6V A;  3CO6 C;  2VON A;  3NRV A;  5DM7 F;  5ERI A;  2HOS A;  4II2 A;  3K7A J;  5IP6 A;  5B1B H;  2GQQ A;  3JRE A;  2GAU A;  1X3Z B;  1Z21 A;  1D0Z A;  3BZC A;  3EUH A;  3QWL A;  3SFI A;  1NTC A;  4NQW B;  3VYS B;  1EA3 A;  2K9L A;  4ZZD A;  2BZT A;  2XSD C;  4BE0 A;  3EPZ A;  1X1B A;  3GTO J;  3R61 A;  1I6X A;  3OYM A;  2G7H A;  1R36 A;  2EBI A;  3CP8 A;  1U5T C;  3KX2 A;  3BY6 A;  2QQA A;  3HOV J;  2XF5 A;  1K7A A;  3KZZ A;  3L09 A;  4ETS A;  4MEX F;  1MNM C;  2HQN A;  1IDY A;  2KDO A;  1R5I D;  5TRD A;  3OYF A;  2ZSI B;  1A6Q A;  1P2F A;  3ABL H;  4PSW A;  4XSZ F;  4XLN F;  4FX4 A;  1A04 A;  2VT3 A;  3KIO A;  4LJZ F;  3BT9 A;  3WTY C;  3ULQ B;  5FFX A;  5LEJ A;  4Z2Y A;  3JRB A;  5FRO A;  1I1S A;  1XX5 A;  2XRL A;  3CF5 F;  3HPH A;  3ELK A;  1BL0 A;  3PNV A;  3RQ4 A;  3FBI B;  5EF6 A;  2E34 A;  1ZGW A;  2HPI A;  3CCR I;  3QP5 A;  3ZR8 X;  5DDG A;  1ETQ A;  5JR3 A;  3ZQL A;  1STZ A;  2FX0 A;  3C2G A;  3DWL E;  1U5T B;  2JZY A;  3J80 Z;  3RJP A;  3E6C C;  3U1K A;  4LMY A;  2Q0O A;  2RNJ A;  3K4L A;  2L7M P;  2W00 A;  1TWC J;  4KN4 X;  3DCF A;  2IRF G;  2ECB A;  4HST A;  2O03 A;  3BDD A;  4CCM A;  3D0S A;  2DFE A;  3OOP A;  3RZD J;  3BR3 A;  5EGO B;  1U0J A;  3U1D A;  3KP7 A;  3OR1 C;  2ZXH A;  4E7L A;  1MSE C;  5KCM A;  2HDC A;  1OCT C;  2L9N A;  4M73 A;  4JYK A;  4EAT A;  3QAH A;  1AKH B;  2D2W A;  3O8G A;  1R22 A;  1BR2 A;  4S05 A;  1BW6 A;  1ON1 A;  1B72 B;  2MH2 A;  2PMH A;  2DOE A;  3CCU I;  4PFP A;  4A3L J;  1RRJ A;  1WSU A;  3QPH A;  3W6V A;  1G2H A;  2RKH A;  2A3S A;  1BJZ A;  2F6C A;  2R7R A;  4R79 A;  5KAF C;  1RNL A;  2K4J A;  4YII A;  3M8E A;  2JPB A;  3QOP A;  4RAG A;  4P9F A;  2XGE A;  2DPD A;  3MEX A;  3SZT A;  3Q0W A;  5IYC J;  3K70 D;  2ZME A;  2OZU A;  4U0W A;  3WTW C;  3K6G A;  3RYR A;  1MDM B;  4HX4 A;  4I0B A;  2LFB A;  3BP8 A;  4I2O A;  1A6I A;  1I3Q J;  5H20 A;  4NC7 A;  4U87 A;  4Y3O A;  4RB3 C;  3L2W A;  2FNP A;  1W0U A;  4AD9 A;  1FOW A;  4U0Y A;  2R7Z J;  2ELK A;  3A02 A;  2L01 A;  2L9S A;  2W7N A;  3I0T A;  5IP9 J;  2Z9O A;  5ILS A;  1G6N A;  2CWE A;  1FBU A;  3CC2 I;  4P55 A;  2QA4 I;  2H27 A;  4IF4 A;  2IA0 A;  1MBH A;  1A35 A;  1C0W A;  4ENJ A;  3H9J A;  4XID A;  2DXI A;  3PNT A;  1ZEL A;  1K61 A;  2ACJ A;  4GO1 A;  4LG3 A;  4WF2 A;  3VOD A;  4B3A A;  2Q2E A;  3H5A A;  3OYE A;  1X4P A;  4S04 A;  4PJ0 C;  1BN5 A;  4YEJ A;  2VKV A;  3L2Q A;  2F5C A;  3RTR A;  1IG7 A;  1FWZ A;  5K5O A;  2GLO A;  3K2A A;  4PK4 A;  4DNC A;  4AM3 A;  1KQ9 A;  3CME I;  3VSK A;  3ZQG A;  5GAG J;  2E36 A;  2OTJ I;  4L0Y B;  1P4W A;  1FPQ A;  5JI6 A;  1VQO I;  4BHB A;  3F72 A;  2M4G A;  3GTQ J;  4L5I A;  1KU3 A;  2H8R A;  1VQ8 I;  3A1Y A;  2CS3 A;  4R1H A;  2STT A;  3F8C A;  4OIQ F;  1IRF A;  4GCV A;  4M9X A;  2M3A A;  2IA2 A;  1DGR M;  1SVL A;  3DQV C;  4YRV A;  1F4K A;  2F5V A;  2L4A A;  2YR2 A;  1VTN C;  3HRT A;  2HYG D;  2H1K A;  2EFN A;  2ME0 A;  2GOX B;  3T0Y A;  3HUG A;  2R7V A;  4EQQ A;  5FKK A;  5GTH C;  2OA4 A;  1WJ5 A;  2FA5 A;  4BBR J;  3TGN A;  1JE8 A;  3DLA A;  5B3S H;  2DAO A;  3ZP5 A;  2BY3 A;  2VIX A;  1JKQ C;  3VYU B;  2KIU A;  5FLV A;  3AG4 H;  3TO6 A;  1PVE A;  1SD7 A;  3LSR A;  1WHU A;  2XSJ C;  5LHH A;  2DOF A;  3JRG A;  1TWH J;  2CUJ A;  3MWM A;  3KP4 A;  2HQR A;  1XSD A;  3OR2 C;  1Q1V A;  4HV5 A;  4B09 A;  3D5R C;  3HSE A;  4WCG A;  1Z3X A;  3LL7 A;  1JJ6 C;  4HA8 A;  4DQ2 A;  2A07 F;  2QM3 A;  2DFF A;  3QQA A;  1TP4 A;  3K10 A;  2DO7 A;  4M3F A;  2AHQ A;  2CW0 F;  2VKE A;  2JJ7 A;  4A5N A;  2FOW A;  2WY8 Q;  2ZSH B;  1JI8 A;  2HQ5 A;  2FQ4 A;  4DBR A;  2MC3 A;  1P6R A;  5CVR A;  1YG2 A;  2HYJ A;  3BQZ A;  2B63 J;  3AG2 H;  1SMY F;  4G8X A;  4OAZ A;  2WB1 A;  3A01 B;  1P4X A;  4HZF A;  1TQI A;  3KCC A;  2Z5U A;  1Q1H A;  3EYI A;  3W3C A;  4IQ4 A;  4EM2 A;  5BMZ A;  5F04 A;  5FRM A;  2M1B A;  1I6H J;  5LHG A;  4M3D A;  1UHW A;  4CIC A;  3CCQ I;  4C3I J;  1S6L A;  4P96 A;  1ZLK A;  5K5Q A;  2PFB A;  4QIW N;  4PJL A;  4TV7 A;  4I7H A;  4KFC A;  3M8J A;  2ZBK A;  2P0W A;  2P5L C;  2VOO A;  1XB4 A;  3PFI A;  2KIQ A;  3GVA A;  1O57 A;  4L9J A;  2FE3 A;  3S32 A;  5KHD A;  2HDD A;  3M4O J;  5DTD A;  1G3Y A;  2MLK A;  3E6M A;  1WH7 A;  3NAU A;  3ML6 A;  3L2V A;  1FIP A;  3SDG A;  2V4J C;  5K1Y A;  3S3O A;  1CF7 A;  5M5Y J;  3DU6 A;  2LC2 A;  2M87 A;  1V55 H;  4A3C J;  3FWE A;  4RBO A;  3LSK A;  4CHU A;  5F27 A;  2ID6 A;  3ZQQ A;  1YX3 A;  2PMU A;  3H35 A;  2JT1 A;  1D1B A;  2OPT A;  1IN6 A;  4ZYA A;  2HTJ A;  2ZME C;  3DEW A;  4MEY F;  3R6S A;  4U88 A;  4N4O B;  4LG0 A;  2XKO A;  5D5X B;  2V6E A;  5IYD J;  5TGT A;  4HLX A;  1AU7 A;  3K4M A;  2JQ7 A;  5A2Q Z;  1IO2 A;  2QSG X;  1D0Y A;  1FSE A;  2K85 A;  3KET A;  3MN2 A;  1HST A;  1APL C;  4ABZ A;  4HF2 A;  3NWS A;  4A0X A;  3LSP A;  4R8H A;  5HDN A;  2XVC A;  2CG4 A;  1JTY A;  5CLS A;  4ENK A;  3RCO A;  2Y0M A;  4B4C A;  2QYO A;  4WX9 A;  1V4R A;  2P8T A;  3TBI A;  3DEE A;  3KFW X;  4XOP A;  2A68 F;  1QGP A;  1SFK A;  4A3I J;  1POG A;  4DW6 A;  4II3 A;  3BTC A;  4G7Z F;  1O4X A;  1AA7 A;  1TT0 A;  1R1V A;  1T8I A;  3IUO A;  1U78 A;  1P9Q C;  2UWM A;  1DU6 A;  3OYA A;  2F5D A;  3K0L A;  2R5Z B;  4L5J A;  4WWC A;  2MAB A;  3W6K B;  5H6R A;  4PJM A;  2V6C A;  4BEH B;  1BI1 A;  4KDP A;  1QZE A;  2CQK A;  3DKW A;  3HEF A;  4AYB N;  1G3S A;  2W1O A;  1R4M B;  4FTH A;  2C6Y A;  5F64 A;  2FQ3 A;  1F9N A;  2DA5 A;  3OYL A;  2E60 A;  5L3C A;  3E5U A;  2X1C A;  3J80 K;  4BJT A;  2JRT A;  2OCC H;  2MGQ A;  5HNF A;  2HNH A;  3K2Z A;  2Z2S B;  3O2P E;  2I10 A;  4A0Y A;  1I39 A;  3E0J B;  2VQL A;  2WV0 A;  4MIM A;  2NXN B;  3VSL A;  1USS A;  4AC0 A;  5H2F C;  5E8I A;  1VQM I;  4FT8 A;  2QZ8 A;  1VQL I;  2LBF B;  3QOE A;  3TW6 A;  3ZN0 A;  1DGW Y;  2DOA A;  4AIH A;  1N75 A;  3NAR A;  2VN2 A;  3OIO A;  5D5V B;  2DTZ A;  4XK4 A;  1E3H A;  3I58 A;  4E7K A;  2HS5 A;  2V1N A;  1HKS A;  1XDU A;  3OSF A;  4DZP A;  1QZY A;  2HOA A;  1ETV A;  2OQR A;  5J8C A;  2R5Y A;  4KT5 C;  1ZRC A;  2X51 A;  3CUQ A;  3IRQ A;  1R6R A;  4F3Q A;  1LEB A;  1ZQ3 P;  4IRI A;  1MMA A;  4XRS A;  2QSH X;  3Q9V A;  2IT0 A;  2EA4 A;  2CFO A;  4G94 A;  5GPA A;  1EKE A;  5L3F A;  5C3E J;  3CCE I;  2KIM A;  3HOY J;  3RKW A;  4E4H A;  1TL8 A;  1SFO J;  4Q4Z F;  1FBS A;  3LOC A;  1S72 I;  3CJR B;  1ULY A;  4LLN A;  3H1C A;  3E3V A;  5BQT A;  1WJA A;  1SMT A;  2E1C A;  4HQE A;  4A3M J;  5FLX Z;  4O6J A;  1ORK A;  5DD4 A;  4EJO A;  5GTI C;  5BPI A;  4XQF A;  3PO3 J;  2DU9 A;  2X6Y A;  2WWY A;  1ZK8 A;  2IS4 A;  2E5Z A;  1XSV A;  1XC5 A;  3ZGK A;  1LDK B;  3KEQ A;  4ESF A;  4M6V A;  2WV1 A;  4B43 A;  2XGC A;  4BU2 A;  4KIB A;  5M5W J;  4RGS A;  1JUM A;  4P9U A;  4UUS A;  4JOM A;  1ZR2 A;  1AHD P;  4MQ9 F;  5JFR A;  5CKT A;  4ZYG A;  2BHZ A;  4EJT A;  3MZY A;  1KU2 A;  2M0M A;  2PJR A;  1FNN A;  1FX7 A;  3OYD A;  1EH7 A;  2ZNZ A;  3H9G A;  1D1A A;  2BGC A;  3ONQ A;  1E2X A;  3CCV I;  4RAZ A;  3GFJ A;  3VB2 A;  4X0G A;  1K78 A;  2YX4 A;  2DA2 A;  2M0C A;  2OF7 A;  4HEA 2;  2B9S A;  3E6B A;  2JSP A;  1TZL A;  3DBL B;  3ZMS A;  3OS0 A;  1HKQ A;  2VQH A;  4CXF A;  3CQZ J;  2NVY J;  2GWR A;  2Y31 A;  1P4A A;  2QCO A;  3EET A;  4BXX J;  4M72 A;  1LFU P;  1UZC A;  1FT9 A;  4XLH A;  2V9K A;  1ZG5 A;  4NQW A;  1FTZ A;  1ITY A;  2JVH A;  1GVD A;  1KYZ A;  3A0B C;  5FKO A;  2UXX A;  1V3F A;  4DYC A;  2BE5 F;  5TIS C;  3HDD A;  5J4Y A;  1Y0N A;  2A6E F;  1B1B A;  1MMG A;  1KON A;  1FJL A;  3WU1 B;  4NDL A;  4OIO F;  3W2W A;  3MMY B;  1AOY A;  5E3N A;  4BQO A;  1KZH A;  5D5W B;  2L54 A;  4MLO A;  4Q48 A;  4MFE A;  2R7D A;  1M1E B;  3LST A;  4MGR A;  2GXB A;  1GDT A;  3JRA A;  3E7L A;  4EJV A;  5K5R A;  1ZRE A;  3R60 A;  2EWN A;  2VOD A;  1BR1 A;  1R9T J;  4DGW B;  2RQQ A;  3RKY A;  3FMS A;  2X48 A;  4GFB A;  1ON2 A;  4OMY A;  1HW5 A;  4L5E A;  4F93 B;  5B5E C;  1OCZ H;  1RZ4 A;  2IGN A;  1QBJ A;  3GX4 X;  5HOD A;  4M3E A;  1Y56 A;  4BUP A;  4E7Z A;  3J7Z I;  5FB2 A;  4OIR F;  4RS8 A;  2FF4 A;  4QSH A;  4B1R A;  3HL2 A;  4DZJ A;  3CJQ B;  3KP3 A;  2OTL I;  4O3M A;  1S7O A;  2PEX A;  3OV8 A;  2YPR A;  2L0K A;  4IKF A;  5IT3 A;  2G7U A;  1TW2 A;  5FD5 A;  2EA2 A;  3AAF A;  1VQP I;  1QQI A;  3DP7 A;  1YX5 A;  2AS5 F;  4AVP A;  4YFX F;  1ETX A;  1UB9 A;  2M8E A;  1B72 A;  3C18 A;  3K4C A;  2G9W A;  1FMW A;  4QWQ A;  1Z7L A;  3V8K A;  1TWF J;  5CPR B;  3MD2 A;  3TED A;  1JGS A;  2K3P A;  2OQG A;  4PGH A;  1MSF C;  3B6C A;  1Z7U A;  2FU4 A;  1YFH A;  3LNQ A;  1X2N A;  4UXN A;  1Z1D A;  3PUF A;  2LH9 A;  3DTK A;  3PIO F;  2K40 A;  2NYX A;  3FM5 A;  2EK5 A;  2ZCW A;  1ZKG A;  1YJN I;  4X6A J;  1J2X A;  5J1Y A;  2NVX J;  4N9H A;  1HBX G;  1GLN A;  4A3F J;  4WXC A;  3H3Z A;  3FXK A;  3FXL A;  3GCM A;  2FMY A;  3I64 A;  4LK1 F;  3KYC B;  4XOR A;  3S2W A;  2JA6 J;  2CUE A;  4LIT A;  3FXM A;  1I5Z A;  4ON0 A;  2A69 F;  1FYK A;  3ERM A;  1MBG A;  2WAD A;  1WI3 A;  3CCJ I;  1QPM A;  4BJ6 C;  1UAA A;  3CF2 A;  1BIA A;  2QBY A;  1SD4 A;  2BOL A;  3VYT B;  1BOB A;  1Z91 A;  5LEK A;  2DPU A;  4FHT A;  1FBQ A;  5HLG A;  2EPF A;  2YUS A;  2FSW A;  4I09 A;  1LFB A;  2IGM A;  1TNT A;  1TT5 B;  2BY0 A;  3G4S I;  2Y69 H;  3G1M A;  3ROU A;  5GAE J;  4LB5 A;  3H36 A;  2A5W A;  3GTL J;  5DUK A;  1HW2 A;  3HSF A;  5HVQ C;  4XN0 A;  3OS2 A;  4YG2 F;  5D6F A;  1QHH D;  4A3J J;  4J01 A;  1R5G A;  1JT0 A;  1ETY A;  1YS6 A;  4X1E A;  4NB5 A;  1R4N B;  1UCR A;  3N05 A;  4YFN F;  2R7U A;  3KP6 A;  1JXS A;  1QHG A;  2VQC A;  4P5O A;  1ZYR F;  5AIQ A;  3I4M J;  2H1L A;  4A3K J;  4BAC A;  3H3V K;  2VOP A;  4JX6 A;  5BS6 A;  3HRU A;  1WQ2 A;  2GM4 A;  4DOZ A;  1HCR A;  3WE2 A;  3IL2 A;  3PO2 J;  2HYF A;  1MMD A;  3LSJ A;  2MYS A;  3P7N A;  3Q0V A;  1ENH A;  4CYC B;  2WAQ A;  3TMO A;  3I71 A;  3GYH X;  3BG3 A;  1BA5 A;  4NUB A;  1LNW A;  3PUB A;  5DM6 F;  3IHU A;  2EB7 A;  3GME A;  2M8G X;  3KPH A;  3HHH A;  2FUG 2;  5E3L A;  2DA1 A;  2FEZ A;  1RUN A;  2ECC A;  1JKP C;  1J59 A;  5HS9 A;  3CMY A;  2OC6 A;  2OU2 A;  3S93 A;  5HLH A;  4A6D A;  4HSR A;  2EIN H;  3FXQ A;  4NHJ A;  2LOO A;  2CQX A;  1H0M A;  3JCU C;  2K5C A;  1KU7 A;  4A3E J;  2ZJR F;  2BW3 B;  1QRY A;  2G0E A;  2QVO A;  1YW8 A;  4RM2 A;  3FK7 A;  1X1P A;  4BH9 A;  5FJ8 J;  3ECO A;  4XKC A;  1T0F A;  1TTY A;  4V2G A;  5HDK A;  4L18 B;  2L2O A;  1R00 A;  3OYC A;  2QGU A;  2P6S A;  1IN7 A;  2KFD A;  3BG9 A;  1XPX A;  3FKJ A;  5J4V A;  1T2K A;  3GXO A;  2JRM A;  5E8G A;  3QYF A;  2E35 A;  4I99 C;  5DEQ A;  2LKS A;  3L2U A;  1FIA A;  1D3Y A;  1WJE A;  2LF7 A;  5FLX K;  3IRR A;  3HIF A;  1G3W A;  1PDN C;  3Q0U A;  2CW7 A;  4EVI A;  2ZB9 A;  5L3E A;  2XAJ A;  1SAN A;  2XPW A;  2VPR A;  1I1G A;  3SYT A;  3HJE A;  3V8J A;  1LE8 B;  1W5S A;  3GEZ A;  2H8W A;  4Y4R A;  4G6T B;  3S3N A;  1Z67 A;  2DMU A;  4IZZ A;  4CCO A;  5ED4 A;  3WGI A;  1S8N A;  3FZV A;  1YQA A;  5M5X J;  3FIS A;  2H6C A;  3JAM Z;  2OUM A;  2FNA A;  3EYY A;  4XIC A;  2DT7 B;  1TQP A;  1T95 A;  3NQO A;  4BBS J;  1FTT A;  3FF5 A;  2CSO A;  3CCS I;  2DT5 A;  2M45 A;  1HXD A;  4J00 A;  3BRO A;  3ZMZ A;  1GHC A;  3OMY A;  3E6D A;  2M5W A;  3J7A O;  3FHN A;  4S0H B;  2ETH A;  1Z6R A;  2EFO A;  1LJ9 A;  1BOA A;  3CP2 A;  4XON A;  1X1A A;  2HVR A;  3AG1 H;  2DCE A;  3PL8 A;  3F23 A;  3ABU A;  1R1T A;  1WFX A;  2H09 A;  1JT6 A;  2QUF A;  2WY7 Q;  3G2B A;  1SC7 A;  4FET A;  1JHF A;  2W85 A;  5DCM B;  1Y8R B;  3HZJ A;  1RES A;  1WI9 A;  3V8L A;  3QU6 A;  1G4D A;  3I59 B;  2NVQ J;  3ABK H;  4C2T A;  2O0Y A;  4O5V A;  2ZJ2 A;  2XAG A;  1HDD C;  4ESB A;  2KRH A;  2PMZ A;  4NBQ A;  5LRR A;  2E2H J;  3CJT B;  1K4T A;  1DP3 A;  3ESW B;  1ZH5 A;  3G6E I;  5FLM J;  3JRF A;  4BKX A;  4M6X A;  3MZ8 A;  4UVA A;  3RIR A;  4BHC A;  3BG6 A;  2EIM H;  2LF8 A;  4I01 A;  3KE2 A;  3M8F A;  3ISP A;  4AU7 A;  3FXR A;  4ZC3 A;  3M07 A;  3ZMT A;  2F4O B;  1PUE E;  1SFU A;  1YW7 A;  2JA2 A;  3EUH C;  2P5K A;  4OIN F;  2A61 A;  2GIV A;  3FM3 A;  3SFZ A;  2EIL H;  3HM5 A;  3EUA A;  5ICF A;  3Q3S A;  2UZK A;  1BI0 A;  1SD6 A;  1Y1W J;  2PBI A;  1SAX A;  2XAU A;  4LFU A;  2XAS A;  1NK2 P;  2GA1 A;  5LLQ A;  4DIQ A;  5LBQ A;  2F2E A;  3IP4 B;  3A0H C;  2VC1 A;  4BHP A;  3I3L A;  2TDX A;  3HHG A;  2GXA A;  4RLQ A;  3E5X A;  3F8N A;  2DMP A;  2CW8 A;  3ASN H;  1KQ8 A;  2E5N A;  4RAY A;  3S1M J;  1IRX A;  1J5Y A;  3KYD B;  1KGS A;  3ABT A;  4UY8 I;  4HV6 A;  1KU9 A;  3WTT C;  3SZG A;  3E97 A;  1F1Z A;  5C4J J;  3DF8 A;  5HDG A;  4RB0 A;  3VPR A;  2DQR A;  2R7S A;  5JVG F;  1FOK A;  2EV0 A;  1NG6 A;  3V4G A;  2R93 J;  2LP0 A;  4E7S A;  3GZN B;  2DMQ A;  4C2U A;  1QPI A;  4HNT A;  1OJL A;  2QLZ A;  3I5U A;  4RGX A;  4ZDL A;  3A03 A;  3GWZ A;  3O3K A;  3ZRG A;  3SXY A;  1Y0U A;  2QKM B;  1YJW I;  1E3P A;  1S7A A;  1K6Y A;  5K7F A;  4F92 B;  3RPU A;  1EV7 A;  3DPU A;  2YSR A;  3TW7 A;  1VF9 A;  2XUB A;  4KJZ A;  3SHF A;  4K2E A;  5J8F A;  2A6H F;  1H9T A;  3DBH B;  4L9V A;  1TWG J;  1JKO C;  1JGG A;  2RC4 A;  2Y0S N;  1ONV A;  4JP0 A;  1G8X A;  3C2B A;  5M3M J;  2LKX A;  1CGP A;  3GW2 A;  3CLQ A;  5GAH J;  3DEU A;  2J5O A;  2EJR A;  1MJ9 A;  2W25 A;  3ZQF A;  2FBH A;  3K4K A;  3BTI A;  4L9N A;  3MVP A;  3WG7 H;  1PUF A;  5EEH A;  5GPC A;  3AG3 H;  1D1C A;  4RLF A;  5TJJ A;  1UJ8 A;  3H0D A;  2V1U A;  4HQM A;  4RMN A;  3LSG A;  2E2J J;  3GZ6 A;  2JA7 J;  2I8D A;  2A05 A;  1OR7 A;  3M3Y J;  1MJA A;  3BC8 A;  2F48 A;  2XRO A;  2R0Q C;  4BJ5 C;  3S2H J;  2EQR A;  2M7A A;  3FXO A;  1B8I A;  2XGX A;  5IP7 J;  2VB6 A;  1B59 A;  1X3U A;  2VBX A;  4XRS G;  2OBP A;  5LRS A;  1OYI A;  3E5Q A;  3PQK A;  1LDD A;  2HKX A;  2R7T A;  2R7Q A;  5KAI C;  1T33 A;  1IN5 A;  2FML A;  1U8R A;  4ITV A;  1ETW A;  1V5F A;  1HQC A;  3PFY A;  1I27 A;  2E71 A;  4RB2 C;  2IJL A;  1XD7 A;  4UHT A;  2X9D A;  4KYW A;  4EEF G;  1YRN A;  3ZN1 A;  4WXD A;  2LSO A;  4RA2 A;  1N78 A;  1S9H A;  1H89 C;  4D1Q A;  4CZZ A;  4BXF A;  2ZME B;  3K4J A;  2R7O A;  2WC2 A;  1J7K A;  4BY1 J;  2EV5 A;  2RQP A;  1PP8 F;  2D5V A;  1D0X A;  3HTU A;  4UVB A;  2MC4 A;  4F7Z A;  4B44 A;  3M9A A;  5EJC A;  3TDU C;  2XC7 A;  3MKY B;  3LA2 A;  4EGY A;  3S1Q J;  2HQA A;  3CES A;  4AUX A;  1ACI A;  3CUO A;  1YW9 A;  1OMI A;  2OCE A;  2KLO A;  3G73 A;  2NNY A;  4XNF A;  1WKM A;  3JSO A;  3ZQC A;  2EV6 A;  1QNT A;  5HOO A;  5BPD A;  1U6G A;  5IT9 Z;  2XF6 A;  2Q2E B;  1UFM A;  4BL0 B;  4IL6 C;  3HRS A;  4EGZ A;  4BDY A;  3JTH A;  2R4G A;  1VQ5 I;  4ANJ A;  1CQT A;  5FKL A;  1KA8 A;  2DK5 A;  3ZMV A;  1LPQ A;  3QRF F;  1PP7 U;  1WCM J;  3T1B A;  2IA1 A;  2CO5 A;  4XL9 A;  2IAI A;  4A3G J;  3I4N J;  2BV6 A;  3R0A A;  4D9J A;  1GXP A;  3K4B A;  1AWC A;  5LFA A;  1E17 A;  2DLL A;  3MKL A;  2VAS A;  1OKR A;  2QEN A;  3ERE D;  4Y15 A;  3U9G A;  2E19 A;  1LKX A;  3C7J A;  1MH4 A;  4CCK A;  3I9V 2;  3K69 A;  3LA3 A;  3QPT A;  2OV7 A;  2W4S A;  3DKY A;  3BLY A;  5IOZ A;  4HYE A;  4YIR X;  4MFD A;  2O6G E;  3F8F A;  5J1R A;  2V26 A;  2X1E A;  3HUG B;  3LQR A;  4CSW A;  1VQ6 I;  3H5N A;  1R5H A;  5DYM A;  1H88 C;  4XSX F;  3OYN A;  3BG7 A;  2DYS H;  3EQL F;  1XGS A;  3IWF A;  1HDP A;  4KMF A;  1GVJ A;  2DA6 A;  3KEO A;  4CYD A;  3O8H A;  3PSF A;  5JLX A;  3I56 I;  4CGZ A;  3TO7 A;  3VEP A;  1MGT A;  4Y7N J;  3JAM K;  3GFM A;  4XR6 A;  3KZY A;  5E1Z B;  4A69 C;  2RDP A;  3DXJ F;  4I02 A;  1OIS A;  4DYR A;  2ZC2 A;  4D0P A;  1HF0 A;  3OIP A;  2KJC A;  1ZG3 A;  4G7H F;  3NEU A;  4M9S A;  2X6W A;  2R7X A;  4ZH4 F;  1JJ8 C;  1HA8 A;  1B4A A;  4M3G A;  4N9I A;  1LVK A;  5EG0 A;  3HGG A;  1IC8 A;  1XTA A;  1YIT I;  4NC8 A;  2BBY A;  1W4M A;  2ZJP F;  4JBA A;  2MH9 A;  1R58 A;  3M1E A;  4XM3 A;  4UB8 C;  2LK2 A;  1H8A C;  3OS1 A;  4UVC A;  3WE3 A;  2CFX A;  3GFI A;  1HC8 A;  4ENN A;  3H0G J;  4PCQ A;  1NK3 P;  1YOV B;  2HWV A;  4A5M A;  2KJB A;  5IOY A;  1R7J A;  2HPM A;  2E2I J;  2XB0 X;  2V9V A;  3CJN A;  5BNG A;  4QPO A;  3SEZ A;  1RR8 C;  1WJC A;  3ZPL A;  4FE7 A;  5CQE A;  3RKQ A;  3S16 J;  2HZD A;  3ABM H;  1UHS A;  1WGX A;  4MHG A;  3S1N J;  2M34 A;  5DV5 A;  2DMT A;  2GA2 A;  2VJ4 A;  1OCR H;  4GDF A;  2DDB A;  5CVU A;  4UV9 A;  1CF7 B;  4I0A A;  4Y52 J;  1YJ9 I;  3CMM A;  3N4M A;  2CV0 A;  1NHA A;  2XB5 A;  4A0Z A;  2O8X A;  1DPU A;  2VE8 A;  3DBR B;  3FMR A;  2EZI A;  3GTJ J;  2HU9 A;  2VQG A;  3HKZ A;  2X0L A;  1W7P B;  3KLO A;  4HF1 A;  4G7O F;  2GIZ A;  4LG0 B;  1W0T A;  1W7P D;  4HRI A;  2Z33 A;  4BXU A;  5CVI A;  3I54 A;  2K7L A;  3T8T A;  3IV5 A;  3R0J A;  1FYL A;  1K83 J;  2XV4 S;  2ZO4 A;  5DD8 A;  2L4M A;  1W36 C;  2DDA A;  1D5Y A;  3AFH A;  1T08 B;  1LUJ B;  1YLF A;  1A36 A;  4IHS A;  4L0Z B;  2RV8 A;  4OMZ A;  3SQN A;  4CDG A;  3HB9 A;  2X6X A;  1F36 A;  2VC0 A;  1SEU A;  3OOU A;  3JR9 A;  3HC7 A;  4IEJ A;  3C3W A;  4G6Q A;  4IHX A;  2CYY A;  2MW8 A;  4RDU A;  1GV5 A;  2XF7 A;  4WK8 F;  2XAF A;  4JX5 A;  3PSI A;  2EFW A;  1BC8 C;  1G59 A;  9ANT A;  2B7E A;  2L7Z A;  3F9K A;  2ADU A;  3V7S A;  3ZQ7 A;  5K7Z A;  2BW3 A;  2CGP A;  3S14 J;  4H4K C;  1U5T A;  1KQ0 A;  1FLI A;  4G6D A;  1BR4 A;  3GLL A;  2Y9Z A;  1IRG A;  3F22 A;  2WA0 A;  2Z99 A;  2EIJ H;  2NS8 A;  2UUZ A;  4HPQ A;  4UNO A;  1EF4 A;  1T56 A;  3V7C A;  1OLT A;  2ELJ A;  2DA3 A;  3LQQ A;  2ESH A;  4PSX A;  4QTR A;  1VQK I;  5EGO A;  3UKG A;  1L0O C;  4CCL A;  2Y75 A;  5KK1 A;  1T39 A;  1VQN I;  2P6T A;  2VUM J;  1IAW A;  2GBY A;  4Q47 A;  4HDV A;  2LY2 A;  2YX7 A;  4IOC F;  1GUU A;  4ZYD A;  1PJR A;  3WOD F;  4I76 A;  1AKH A;  2KP6 A;  5JHF A;  1WZ2 A;  2YU9 J;  1BIB A;  2NOJ B;  3D1N I;  3G3Z A;  3CUQ C;  2IPQ X;  5JLW A;  2BEO A;  1V5E A;  4HDU A;  2IS2 A;  3Q5F A;  3OYG A;  3D5S C;  1IXC A;  1OQY A;  3H9Q A;  4A93 J;  1OFC X;  1MW7 A;  2MA3 A;  4Z6Y A;  3GTM J;  4Y33 A;  3HOS A;  3FXJ A;  1JUP A;  1ODD A;  5ILV A;  2AQE A;  3Q9S A; 
#chains in the Genus database with same CATH homology
 2ID3 A;  4M3D A;  3WHC A;  1LE8 B;  4C3I J;  4V2F A;  4QIW N;  2DMU A;  1IV6 A;  3JRC A;  5M5X J;  4W1U A;  3FIS A;  3HOU J;  4XIC A;  2R5Y B;  2EZK A;  3F0C A;  3BR0 A;  4BBS J;  1FTT A;  1WH5 A;  4A3B J;  2M9H A;  2HDD A;  3M4O J;  3S1R J;  5DTD A;  1UMQ A;  1ZTR A;  1WH7 A;  3NAU A;  1RR7 A;  5M3F J;  1FIP A;  3SDG A;  1Z77 A;  5M5Y J;  2O9L A;  4A3C J;  4S0H B;  4RBO A;  2Y2Z A;  1IUF A;  5F27 A;  2ID6 A;  2N8G A;  1X58 A;  2OPT A;  3FK6 A;  3S17 J;  3DEW A;  3WHB A;  3GTG J;  2O8K A;  1PUF B;  5FKN A;  1JT6 A;  2LTP A;  4DYQ A;  5IYD J;  1AU7 A;  3ZQH A;  1U9O A;  2K9S A;  2JK3 A;  3MN2 A;  1RES A;  4FCY A;  1APL C;  2RAE A;  4ABZ A;  1I50 J;  1B8I B;  2NVQ J;  3LSP A;  1U9N A;  1HDD C;  1X2M A;  4UUS B;  1JTY A;  2WB1 N;  1RPW A;  2E2H J;  4B4C A;  4CYC A;  4M3B A;  5FLM J;  3JRF A;  4I6Z A;  4BKX A;  4A3I J;  2JA5 J;  1POG A;  4DW6 A;  5DS9 A;  1BW5 A;  3G1L A;  3QPS A;  2EZL A;  2K9N A;  1VND A;  1YRN B;  3BTC A;  1O4X A;  5F04 A;  3ZOB A;  1U78 A;  1DU6 A;  2JN6 A;  2R5Z B;  2XPV A;  1HOM A;  3HM5 A;  1S7E A;  2TCT A;  3Q3S A;  1Y1W J;  5EYR A;  1NK2 P;  1MBE A;  4IHW A;  3HEF A;  4AYB N;  4D7N A;  2MSY A;  2LLK A;  3IH3 A;  4FTH A;  2XPU A;  2COB A;  2DMP A;  3BR6 A;  2DA5 A;  4FE4 A;  3S1M J;  4IHV A;  5K7H A;  3IH4 A;  1OCP A;  2MGQ A;  5C4J J;  2I10 A;  4MO7 A;  3VPR A;  3FIW A;  1MBJ A;  3A01 A;  2KDZ A;  4MIM A;  2PMZ N;  2R93 J;  4AC0 A;  2O7O A;  2LP0 A;  2LD5 A;  2CJJ A;  2DMQ A;  1QPI A;  2LY9 A;  1OJL A;  3TW6 A;  3I4N J;  3NAR A;  3OIO A;  1LE8 A;  3A03 A;  2DTZ A;  4XK4 A;  2E1O A;  2R92 J;  3OSF A;  4UUT A;  1XS9 A;  4DZP A;  2JMW A;  5IYB J;  2HOA A;  1ETV A;  5K7F A;  2HXI A;  3HOW J;  2R5Y A;  4D7M A;  5GP9 A;  5J3L A;  2FJ1 A;  4D5C A;  3TW7 A;  1VF9 A;  1ZQ3 P;  3HBL A;  4XRS A;  1TWG J;  5EZH A;  1JKO C;  5GPA A;  5C3E J;  1JGG A;  3BR2 A;  2Y0S N;  2JA8 J;  4LOC A;  4JP0 A;  3HOY J;  1SFO J;  1QVU A;  3C2B A;  5M3M J;  3HOX J;  2LKX A;  3CDL A;  1VFC A;  3LOC A;  4C3J J;  2LVS A;  3S2D J;  3ZQF A;  2NVT J;  3CCY A;  3BTI A;  3B6A A;  5J1U A;  3MVP A;  1PUF A;  1QVT A;  5GPC A;  5E3M A;  4A3M J;  3GTP J;  3PO3 J;  1ORK A;  1ZR4 A;  1ZK8 A;  3LSG A;  2E2J J;  1IRZ A;  2JA7 J;  3JRI A;  1XC5 A;  3M3Y J;  2R0Q C;  3S2H J;  2EQR A;  4M6V A;  4BY7 J;  2WV1 A;  1B8I A;  2XGC A;  3BTL A;  3IH2 A;  3TP3 A;  5IP7 J;  5M5W J;  4XRS G;  1F43 A;  1JUM A;  4UUS A;  1ETO A;  2P81 A;  2EH3 A;  1ZR2 A;  1AHD P;  3ZQI A;  1T33 A;  5C44 J;  1ETW A;  1MBF A;  1TC3 C;  3JRH A;  5EG0 B;  5E3O A;  1IJW C;  4D5F A;  2X9D A;  4EEF G;  1MBK A;  1RKW A;  1YRN A;  2Y30 A;  3BR5 A;  3RZO J;  2HI3 A;  2DA2 A;  2M0C A;  2OF7 A;  1H89 C;  2R5Z A;  2QF7 A;  3RQI A;  4BY1 J;  2D5V A;  2NVY J;  1P7I A;  2Y31 A;  3CQZ J;  2QCO A;  4JX4 A;  3S1Q J;  4BXX J;  1LFU P;  4IHY A;  4AUX A;  1FTZ A;  1ITY A;  1IDZ A;  2IBD A;  3BTJ A;  1GVD A;  1FEX A;  3BQY A;  5FKO A;  4DYC A;  1ETK A;  5F0F A;  3HDD A;  5FKM A;  3ZQC A;  2HOS A;  4FIS A;  1FJL A;  3BR1 A;  4G12 A;  4NDL A;  3K7A J;  2M2E A;  5IP6 A;  1U8B A;  5E3N A;  3JRE A;  3SFI A;  4MLO A;  4MFE A;  1NTC A;  1GDT A;  3JRA A;  3E7L A;  2XSD C;  2IEK A;  1CQT A;  3GTO J;  5FKL A;  2EBI A;  1GT0 C;  1R9T J;  1WCM J;  3HOV J;  1RET A;  4GFB A;  2X48 A;  1MNM C;  2IAI A;  4A3G J;  4L5E A;  1IDY A;  1E3O C;  4A3D J;  3MKL A;  5F08 A;  5HOD A;  4M3E A;  3BT9 A;  2E19 A;  1MH4 A;  2XGD A;  3JRB A;  4QSH A;  4B1R A;  2XRL A;  2CRG A;  4DZJ A;  5IOZ A;  1DU0 A;  2W48 A;  1BL0 A;  4MFD A;  5EF6 A;  3L1P A;  5J1R A;  1ZGW A;  4HNV A;  3ZQL A;  1ETQ A;  2FX0 A;  2KT0 A;  1H88 C;  1P7J A;  2L0K A;  2L7M P;  3HKZ N;  1HDP A;  1TWC J;  2DJN A;  3DCF A;  2DA6 A;  2ECB A;  2MG4 A;  3O8H A;  1ETX A;  1GV2 A;  5JLX A;  1B72 A;  4Y7N J;  3RZD J;  3BR3 A;  5EGO B;  4A69 C;  3HGY A;  1TWF J;  3TED A;  4DYR A;  1MSE C;  3FKI J;  1HF0 A;  1OCT C;  1WPK A;  1MSF C;  4JYK A;  3B6C A;  3LNQ A;  1X2N A;  1AKH B;  5F1J A;  1JJ8 C;  3O8G A;  3GBG A;  1BW6 A;  2K40 A;  1B72 B;  4M3G A;  3PM1 A;  5EG0 A;  4A3L J;  2ME6 A;  3HGG A;  1ZKG A;  1IC8 A;  3W6V A;  4X6A J;  1G2H A;  2HXO A;  2K9Q A;  5J1Y A;  2NVX J;  3HOZ J;  1BJZ A;  1JUS A;  4A3F J;  1HLV A;  1A5J A;  2LK2 A;  1H8A C;  2L7F P;  3BG5 A;  3H0G J;  1JKR C;  2XGE A;  1NK3 P;  2YS9 A;  5IOY A;  2JA6 J;  2CUE A;  3Q0W A;  5IYC J;  3JRD A;  2XB0 X;  2E2I J;  5F0C A;  5BNG A;  1MBG A;  1WI3 A;  2LFB A;  2TRT A;  4FE7 A;  1A6I A;  1I3Q J;  3RKQ A;  2CU7 A;  1W0U A;  3S16 J;  5C4X J;  2DA7 A;  2R7Z J;  2ELK A;  2YUS A;  1UHS A;  1WGX A;  3A02 A;  3S1N J;  5IP9 J;  2M34 A;  2DMT A;  1LFB A;  2X6O A;  1Z0X A;  2L9R A;  3G1M A;  2DN0 A;  1IGN A;  1MBH A;  4Y52 J;  3GTL J;  2CQQ A;  2XB5 A;  4XID A;  1K61 A;  4B3A A;  2EZI A;  1Y1V J;  3GTJ J;  4A3J J;  1JT0 A;  1ETY A;  2VI6 A;  2VKV A;  4X1E A;  1IG7 A;  1W0T A;  1RKT A;  2FD5 A;  3QPL A;  2GLO A;  3K2A A;  3I4M J;  3IV5 A;  1K83 J;  2DA4 A;  4A3K J;  3ZQG A;  2LR8 A;  3H3V K;  1D5Y A;  4JX6 A;  3GTQ J;  2GM4 A;  2H8R A;  3SJM A;  1HCR A;  3HB9 A;  1F36 A;  3PO2 J;  3OOU A;  3LSJ A;  3Q0V A;  3JR9 A;  1ENH A;  4IEJ A;  4CYC B;  4IHX A;  4J19 A;  2MW8 A;  4RDU A;  1GV5 A;  3BG3 A;  2NS7 A;  1XG1 A;  1BA5 A;  4JX5 A;  5EZG A;  9ANT A;  2H1K A;  2M8G X;  2L7Z A;  5K7Z A;  1TWA J;  2ME0 A;  3S14 J;  5E3L A;  2DA1 A;  5FKK A;  2ECC A;  4BBR J;  2JWT A;  1JKP C;  5IPA A;  3OSG A;  2Y9Z A;  3CMY A;  1JKQ C;  5FLV A;  1UG2 A;  5EEA A;  1VI0 A;  3LSR A;  4C3H J;  2NS8 A;  1EF4 A;  1T56 A;  2Y9Y A;  2CQX A;  2DA3 A;  3JRG A;  1TWH J;  3G1O A;  4QTR A;  5EGO A;  4A3E J;  5EDN A;  3UKG A;  1JTX A;  1QRY A;  2G0E A;  2VUM J;  1Q1V A;  2GBY A;  3FK7 A;  2CUF A;  5FJ8 J;  4V2G A;  2DMN A;  3S15 J;  1GUU A;  1JJ6 C;  4C2M J;  4I76 A;  1AKH A;  2EZH A;  3BG9 A;  3QQA A;  4M3F A;  3GTK J;  2YU9 J;  2AHQ A;  1MH3 A;  2JJ7 A;  2VKE A;  3D1N I;  4W97 A;  5JLW A;  2HQ5 A;  2FQ4 A;  2HOT A;  3TP0 A;  2HYJ A;  3BQZ A;  1FIA A;  2B63 J;  2NOG A;  4A93 J;  4XRM A;  1OFC X;  3A01 B;  3GTM J;  3Q0U A;  2AO9 A;  5F0H A;  2ZB9 A;  1JUP A;  1SAN A;  2XPW A;  2VPR A;  1I6H J;  2WAQ N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...