4EEFG

Crystal structure of the designed inhibitor protein f-hb80.4 in complex with the 1918 influenza virus hemagglutinin.
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
45
structure length
45
Chain Sequence
PWKFSENIAFEIALSFTNKDTPDRWKKVAQYVKGRTPEEVKKHYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Optimization of affinity, specificity and function of designed influenza inhibitors using deep sequencing.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Immune system/inhibitor
molecule keywords Hemagglutinin HA1 chain
total genus 4
structure length 45
sequence length 45
chains with identical sequence H, I
ec nomenclature
pdb deposition date 2012-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4eefG00
1ZR2A 1MH4A 3FIWA 5FJ8J 1QVTA 3NARA 2WAQN 1TC3C 3O8HA 2LKXA 3ZQGA 3GTPJ 4MO7A 5FKMA 4GFBA 1FTTA 2M0CA 3IV5A 2R93J 1SANA 2ID6A 3IH4A 1QPIA 4DZJA 1ETVA 4FE7A 3JRHA 1FTZA 4DZPA 2XGEA 1APLC 2Y9YA 4A3KJ 2VKVA 1E3OC 2NS8A 1BA5A 1Y1WJ 4EEFG 3BR5A 1O4XA 3ZQLA 3M4OJ 1RETA 1XC5A 4ABZA 3CDLA 4DYRA 1K61A 1JUPA 2JA7J 3QPLA 1BJZA 2H1KA 2R7ZJ 3GTLJ 2XPWA 1ENHA 1TWAJ 2ME6A 1TWGJ 4IHXA 1WPKA 5DTDA 2N8GA 2DA1A 3K7AJ 2JK3A 3JRIA 4DYQA 2JJ7A 2CUFA 4A3EJ 2HYJA 4W97A 2DA5A 1I6HJ 4FCYA 1QRYA 1K83J 3HGGA 2ECCA 1Z0XA 4QIWN 1Q1VA 5FKKA 2L9RA 3Q0VA 1A6IA 2X9DA 3JRGA 4UUSA 1WCMJ 4X1EA 3TP0A 2DJNA 1WGXA 4A3JJ 2E2IJ 3JRCA 3Q3SA 1X2MA 3BR2A 2M9HA 5BNGA 2M2EA 3SFIA 2XB0X 4BBRJ 4M3FA 5FKOA 3G1LA 1GDTA 1F43A 2DMTA 1JKPC 2DA2A 3C2BA 1BW5A 2LLKA 4QTRA 4A69C 2O7OA 4XRMA 3ZOBA 3ZQFA 2H8RA 2ELKA 4W1UA 2CU7A 4Y52J 5GPAA 3HGYA 1GV2A 5J1RA 3BQZA 2K9SA 3JRAA 1JGGA 3JREA 3M3YJ 1POGA 2MW8A 2OPTA 2EZKA 2XPVA 3A01A 5E3NA 3HOVJ 2ECBA 3HOXJ 3BTCA 2R0QC 5K7HA 2GLOA 3ZQIA 1VNDA 1D5YA 2CUEA 2M34A 2JA6J 3TP3A 1RESA 1WH5A 1IJWC 2JMWA 3RZDJ 2CJJA 1IUFA 3PO2J 2XGCA 2O8KA 2EBIA 1MBKA 2LD5A 5HODA 2K40A 5EZHA 1JTXA 1MBGA 4V2GA 4D7MA 2P81A 2VPRA 1YRNB 5E3LA 5DS9A 1JKOC 2DA7A 4BY1J 2LP0A 1I50J 1MSFC 4C3IJ 1RPWA 1ZK8A 1X2NA 5F04A 1UMQA 1B8IA 4IEJA 2OF7A 1ETYA 2IEKA 3HM5A 3RKQA 3GTGJ 1U78A 2FJ1A 2GBYA 3O8GA 4MFEA 4NDLA 3BQYA 1JKQC 4AC0A 2L7ZA 2HOTA 1ETWA 5IP9J 2E2HJ 1ETXA 2NOGA 2X6OA 1P7JA 1AU7A 4RBOA 3SJMA 1UG2A 2EH3A 5F0FA 1VFCA 3S1NJ 2D5VA 3HOUJ 4FTHA 2Y30A 2O9LA 1IDYA 2R5ZB 1MBFA 3L1PA 3D1NI 2JA5J 4IHYA 2ZB9A 1MBHA 1RKTA 3BR1A 1CQTA 1U9OA 2L0KA 5JLWA 2E19A 2DMNA 4XIDA 2IAIA 1GVDA 3HBLA 4JX5A 2TCTA 4A3IJ 2JN6A 3UKGA 1B72A 1JT6A 3RQIA 3S15J 2XRLA 4M3BA 2FD5A 2AO9A 3BTJA 2I10A 3S1MJ 1YRNA 3VPRA 5EG0B 3BR6A 2WB1N 2LR8A 4AUXA 5C4JJ 2XSDC 4V2FA 2KT0A 2E1OA 2DA6A 2MGQA 5EEAA 3OOUA 2RAEA 3Q0UA 3OSFA 4JYKA 1OJLA 4B3AA 3E7LA 2AHQA 2XPUA 4RDUA 4XRSA 1AKHA 2NVXJ 3HOYJ 1Y1VJ 1MSEC 3S17J 3S2DJ 4A3CJ 2LY9A 5M3FJ 4A3MJ 2NVQJ 3HEFA 2CQXA 1ETQA 1RKWA 4BXXJ 5K7ZA 4AYBN 5J1YA 3QQAA 2DMPA 4HNVA 1B8IB 1BL0A 2R5YA 1IDZA 1MNMC 5M5WJ 2VI6A 3GTJJ 1HDPA 3BTLA 4A3GJ 5M3MJ 2MSYA 3B6CA 2L7MP 1WI3A 2R5ZA 3JR9A 1HCRA 5GPCA 5F08A 4M3EA 3LSRA 1LFUP 1AKHB 2W48A 1XG1A 3S14J 2XB5A 2YS9A 1Z77A 2FX0A 1T56A 4IHVA 2DMUA 5EGOA 3LSGA 5GP9A 3F0CA 1IC8A 2K9NA 4LOCA 3W6VA 3K2AA 3IH2A 2DA3A 3BT9A 3GTQJ 2YU9J 3B6AA 2KDZA 1NK2P 2XGDA 5E3MA 3FKIJ 1AHDP 2NS7A 5E3OA 1VF9A 4L5EA 3H0GJ 2HQ5A 1U9NA 4JX6A 5FKNA 1PUFB 3DCFA 2EQRA 5F27A 4D5CA 5F0HA 5M5YJ 3GTMJ 3RZOJ 1SFOJ 1ZQ3P 3TW6A 5F0CA 2HI3A 1OCTC 2JWTA 3BTIA 1ZTRA 2Y2ZA 2LFBA 3BR3A 2PMZN 5EYRA 5C4XJ 5IPAA 3HKZN 1S7EA 3GTKJ 4QSHA 3IH3A 4MIMA 1JJ6C 3CCYA 2Y9ZA 2QF7A 2ME0A 4Y7NJ 2R92J 1ITYA 5J3LA 3ZQCA 3TEDA 2HDDA 3I4MJ 1ZR4A 1PUFA 5EGOB 1EF4A 5C3EJ 1RR7A 2NVYJ 2E2JJ 4BBSJ 2QCOA 2LVSA 4XK4A 1TWFJ 1IRZA 4A3LJ 2VUMJ 1F36A 3HDDA 3A02A 3CMYA 2Y31A 1DU0A 3BG3A 1HOMA 1JUMA 4BY7J 4XICA 5C44J 1HF0A 5IYCJ 4D5FA 3BR0A 3S2HJ 2CQQA 1TWHJ 4DYCA 4G12A 4A3FJ 5IYBJ 4C2MJ 1OFCX 5EZGA 3JRBA 1H89C 4I76A 4C3HJ 2HOAA 2HXOA 2MG4A 4C3JJ 1ZGWA 1TWCJ 3OSGA 3JRFA 5IOZA 3HB9A 3MN2A 5F1JA 2EZLA 4M3GA 3NAUA 3CQZJ 3LNQA 3Q0WA 1NTCA 3LOCA 1GV5A 3G1OA 1VI0A 4CYCB 1IGNA 5FLVA 2YUSA 4UUSB 1FJLA 4J19A 5FKLA 2GM4A 3BG9A 2X48A 2IBDA 1JTYA 2NVTJ 1JT0A 1LE8A 3A03A 5EDNA 1GT0C 3FK6A 1MBEA 4FE4A 2LK2A 3MVPA 3BG5A 5EG0A 2CRGA 2EZHA 2EZIA 2L7FP 2K9QA 4XRSG 3S16J 3LSPA 1ETKA 5FLMJ 1FIPA 1OCPA 4A3BJ 4B1RA 2FQ4A 3OIOA 2G0EA 1NK3P 4M3DA 3LSJA 4JP0A 5JLXA 3HOWJ 4CYCA 2B63J 1ZKGA 2M8GX 4M6VA 5J1UA 1W0TA 1HLVA 2COBA 5IP7J 1W0UA 3G1MA 1HDDC 2LTPA 1MBJA 3PO3J 1FIAA 3A01B 4JX4A 3FK7A 2TRTA 1X58A 4I6ZA 4DW6A 5IP6A 5M5XJ 1QVUA 1JUSA 2HXIA 3S1RJ 4IHWA 4S0HB 1GUUA 2JA8J 5IYDJ 2DTZA 4UUTA 1P7IA 1JKRC 1ORKA 2DMQA 1XS9A 4A3DJ 2R5YB 3I4NJ 1T33A 4BKXA 1R9TJ 3HOZJ 2ID3A 3WHCA 4A93J 4MFDA 3FISA 3JRDA 3DEWA 1ETOA 1WH7A 1BW6A 4MLOA 4FISA 4X6AJ 3ZQHA 1FEXA 1MH3A 2WV1A 3WHBA 1LE8B 2DA4A 3H3VK 3GTOJ 4B4CA 5EF6A 1B72B 3QPSA 3TW7A 2HOSA 9ANTA 3PM1A 1G2HA 2DN0A 1UHSA 2Y0SN 5IOYA 1A5JA 1LFBA 1I3QJ 1DU6A 1U8BA 1H88C 3MKLA 3GBGA 1H8AC 2VKEA 5K7FA 1IG7A 1JJ8C 1IV6A 4D7NA 3SDGA 3S1QJ
chains in the Genus database with same CATH superfamily
3JTHA 4M72A 1ZR2A 1MH4A 1TP4A 1ZARA 2P5LC 4H0EA 4UVCA 3BROA 2RV8A 3RDIA 5FJ8J 4ZJZA 1FBUA 2QSHX 5TGTA 1KQ8A 2W00A 1TL8A 1S6LA 4GFBA 2JVHA 1FWZA 4E7SA 1U0JA 4CCLA 2R93J 1SANA 2ID6A 3IH4A 1W5CC 1MMSA 1UB9A 4YFKF 4DZJA 4BE0A 1ETVA 4GRIA 1VTNC 3KLOA 3JRHA 3O3KA 1SD6A 1APLC 4CZZA 3OWTA 2O6GE 4M9SA 1JI8A 1P4XA 4A3KJ 2FF4A 2LKPA 4F91B 1B9NA 1G59A 3M4OJ 1RETA 1XC5A 4ABZA 3AKZA 3Q5FA 3NRVA 1K61A 4A6DA 1BC7C 4L0YB 3QPLA 2A68F 3GTLJ 4GGGA 2DXIA 1ENHA 3HIFA 1YYVA 3KP5A 1WPKA 4RM2A 5DTDA 5F1RA 5JVGF 2N8GA 2P0WA 2ZCWA 3PQKA 3I4PA 2KL4A 5TJJA 4DYQA 1QZEA 2CUFA 4HPQA 1BIAA 1FX7A 2V1DA 3LA7A 5J4YA 1SAXA 2I8DA 3J81Z 1K83J 3IWZA 1S7OA 2J5PA 3CDIA 1Z0XA 3HOSA 5AIPA 3PNYA 3Q0VA 3JRGA 2UWMA 4HOBA 1WCMJ 2VKHA 2Q0OA 4CCKA 3JRCA 2L01A 1SVMA 1X2MA 2IA0A 2GA1A 4XLCA 3BR2A 3ABTA 5BNGA 3RTRA 1O3QA 2HVRA 1S9HA 1E0EA 3SFIA 4BBRJ 3ECHA 3CUOA 2MABA 4CUGA 2DMTA 3C2BA 4F93B 1BW5A 2VXZA 1LPQA 2OAZA 4BEHA 2DDAA 4QLCU 4ZDPA 3GZ6A 1X1CA 3KZZA 4HG2A 3MZHA 2A07F 5D5XB 2ELKA 1JE8A 5GPAA 1ERDA 2RREA 3F8FA 1LQ1A 2JRMA 2HKXA 1GV2A 4LB5A 2Q2EB 2VN2A 1WJDA 3BDDA 4LGWA 2QSFX 4M6YA 3BJ6A 3KX2A 2I5UA 2MW8A 3A01A 1EJ9A 5E3NA 2WV0A 3JW4A 1P9QC 1D0YA 5JVTA 4XLEA 3HSFA 2L9VA 2VLAA 1MJAA 5K7HA 4YFNF 3QYEA 3IAM2 3VSKA 4UVBA 3SEQA 1VNDA 1D5YA 2JA6J 1SD7A 2CO5A 1RESA 5E8IA 2XIGA 1DP3A 2JMWA 3RZDJ 5AONA 2CJJA 3WG7H 2W82A 1OKRA 3J7AY 2R7OA 1R1VA 3GZNB 1DPRA 4V2GA 4HF2A 1OPCA 4WX9A 2HS5A 4I98B 2HVQA 4HV6A 2Q1ZB 2LYCA 2QBYA 1MGTA 1BOAA 2VPRA 3QU6A 4F55A 5CQEA 3CCLI 5ILSA 2MLKA 1JKOC 2DA7A 3CCJI 1EKEA 2HNHA 1R36A 2MH9A 2JZYA 4DQ2A 1K79A 2HYFA 4C3IJ 3NWTA 2KZGA 2L54A 3DU5A 5H20A 1B6AA 1T0FC 4QWQA 3EQLF 3KEQA 2E5NA 3GTGJ 5D5WB 4PJ0C 3ROUA 4LLLA 5B1AH 3PSIA 1REPC 4MFEA 4NDLA 3BZ6A 2KISA 4AD9A 5H2FC 2L7ZA 2D1HA 1HKTA 1ETXA 4G6TB 1F1ZA 2F6CA 2CS3A 3SDBA 4RBOA 3HRTA 2HZDA 3FM5A 4IXAA 1VFCA 2JQ7A 2D5VA 3HOUJ 1VQ6I 3OL3A 1GHCA 2O9LA 2XKOA 1IDYA 3KZYA 1TLHB 2OJED 4IHYA 2G9WA 4AIHA 2ZB9A 2ZXJA 4R1HA 1KYZA 1SFUA 1MBHA 3LSKA 2V4JC 3O2PE 4CCJA 2IGOA 4KMFA 3FBIB 5B1BH 2E19A 1YG2A 2DMNA 3FXOA 4MGRA 4XIDA 3AL0B 3HL2A 3I58A 2TCTA 4A3IJ 2HQRA 2ZMEC 2Y48A 3ESWB 4FT8A 4J00A 1YJ9I 1B72A 1X4PA 3RQIA 4M74A 1K7AA 1Z67A 4KIBA 4M3BA 3S15J 2AO9A 2BW3A 2CFXA 3DF8A 3QOPA 1IN8A 2V6EA 2I10A 2EA4A 1W36D 2KDOA 5BOXA 2FNPA 3VPRA 1YRNA 5EG0B 2GOMA 2Z2SB 2LR8A 1IN4A 2IPQX 4BHBA 2E1OA 5FLXZ 3OIPA 3K0LA 5EEAA 1KYWA 3Q0UA 3OSFA 1X3WB 2FEZA 3BZCA 3N05A 5BQTA 1TZLA 4B3AA 4NB5A 1XPXA 4IKFA 3KP3A 1Y1VJ 1G8XA 1F5TA 3S2DJ 1OYIA 3EUAA 3CF5F 5M3FJ 3JAMZ 4UB8C 3T1BA 4UNOA 2Z99A 1P4WA 4BXUA 2CQXA 5FGMA 1WJ5A 4PZJA 5LFAA 1VQ7I 4BXXJ 2WC2A 5K7ZA 1OCZH 2BBYA 1MJ9A 2DMPA 3QQAA 3WU0A 4HNVA 3QRFF 5K5QA 4XLAA 4CICA 1O3RA 2IGKA 1BL0A 2UV1A 3F6OA 2R5YA 1MNMC 3C1DA 1FYKA 1D5VA 5TRDA 2QUFA 3OYJA 3BTLA 1WJAA 2IA2A 3S2WA 4DGWB 2IS2A 2M5WA 2R5ZA 3JR9A 2XAUA 3LSRA 3BJOA 1AKHB 1XG1A 3S14J 1SFEA 2XB5A 3FXLA 2HEOA 4IHVA 2DMUA 3V7SA 2E5ZA 3BCAA 2DU9A 2VASA 2ZMEB 1UHMA 1PP8F 4BU2A 2XHKA 3W6VA 2QKLB 2LOOA 3LFUA 2GIVA 2YU9J 4G6QA 3KZIC 3CDHA 1WKMA 2EILH 3S3MA 3ISPA 4PFPA 1AHDP 4XQFA 2NS7A 4XKCA 2WY7Q 1VQNI 2QGUA 3WU1B 5FKNA 3LAPA 3DCFA 2EQRA 5F0HA 1R6RA 4M9ZA 1X3UA 2PMZA 1T38A 1Q1HA 1LFPA 2ADUA 1JGSA 2CG4A 5JI6A 4UV8A 2BY3A 2K4JA 1ZQ3P 2Z5UA 2CUZA 4ON0A 5DCFA 1S7AA 3H36A 3BTIA 4OAYA 2DODA 5E1ZB 1ZTRA 1WJCA 2Y2ZA 3V42A 5FB2A 3J80Z 1NH3A 2K02A 5C4XJ 5IPAA 4IRIA 3HKZN 4UY8I 3M8EA 3OYBA 3GTKJ 2H6BA 1RI7A 2NS0A 3IH3A 4KITB 2V1XA 1D0XA 5HS9A 1BI1A 3RKYA 2V1NA 5J3LA 1K6OA 3I55I 2NRAC 1P2FA 3K2ZA 3CZ6A 4LIVA 1PUFA 4IQ4A 4M71A 2A3SA 3EUHA 3H0DA 2E2JJ 2VIXA 3GO5A 4EVIA 1VQPI 4BBSJ 2L9NA 5IT9K 2LVSA 1TWFJ 4HQMA 1F36A 3A02A 4OAZA 3H5NA 2GOXB 2Y31A 1D3YA 5C44J 3P9CA 1Z3XA 2UXNA 2O61A 3S2HJ 4CA0A 2FQ3A 4C2MJ 4A3FJ 3WGGA 4UHTA 4Z6YA 1T08B 1XX5A 4BHPA 1H89C 2VBYA 4C3JJ 1ZGWA 3OSGA 1XDUA 3MN2A 2EZLA 4G9YA 4M3GA 4S04A 3CQZJ 2M4KA 2F5VA 3DBRB 2DW4A 3Q0WA 3G1OA 4TV7A 1LDJA 1H9GA 2CW0F 2GQQA 2V6CA 2BEOA 1FJLA 4J19A 1V5EA 1ONVA 5LRRA 5GTHC 3HKZA 3ULQB 4KYWA 1QO0D 5J4VA 2IGMA 1JT0A 2BE5F 1U5TC 4OU0A 1YITI 5CPRB 2NNYA 2V79A 4F52A 3FK6A 3UR3C 1MBEA 2XF7A 5LEKA 3DV8A 2Z33A 2CRGA 2EZIA 1G4DA 1E17A 2A6TA 2LSOA 3DPTA 4XRSG 3LSMA 3S16J 5FLMJ 3ABKH 1OISA 4KIGA 1YHQI 4PSXA 3K1PA 2FQ4A 3A1YA 4JK1X 4LIUA 4O6JA 5E1XA 3F6VA 4MHGA 1NK3P 3P5JA 3HPGA 1BM9A 3TDUC 3L2QA 4BQAA 3ASNH 3OIQA 2EWNA 1DP7P 2BHZA 1BBYA 3WTVC 3QP6A 4JP0A 2CQNA 3M8JA 3HOWJ 4GCVA 4P9FA 2MH2A 4U7BA 4M6VA 1W0TA 2KPMA 2YX7A 5KK1A 2LTPA 1MBJA 3A01B 1HA8A 4U7DA 2VBWA 3OYFA 1Z6RA 4I6ZA 3CTAA 3RIRA 2Q2EA 4RAGA 4DW6A 5M5XJ 3KP2A 1V5FA 2DO7A 3S1RJ 4S0HB 3GZ5A 1YJNI 2DBBA 2RNGA 1JKRC 1ORKA 2MBFA 2CV0A 2F5DA 1YW8A 1A35A 3DXJF 2R5YB 3DFGA 3ASOH 4R8HA 1R9TJ 2ID3A 1ODDA 2VQHA 1PP7U 2ZNZA 5LEJA 2YX4A 3VSLA 4E7LA 2K85A 2FE3A 3GCMA 1FT9A 3CCRI 1EH8A 2Y69H 1FEXA 3LSHA 4BJTA 4CH7A 4MTEA 1Y39A 4B47A 1P6RA 3ABLH 3QPSA 2FBHA 4ZZLA 1ZG5A 1HKQA 2A5WA 2DN0A 1XSVA 2DOAA 1U8BA 2GXGA 3GBGA 2D45A 4IL6C 2HPMA 3HC7A 5K7FA 1IG7A 3ZN0A 2A69F 3ABUA 5K1YA 3GX4X 1R00A 4HLYA 2K7LA 4HW0A 1YLFA 2KRCA 4BEHB 3GXOA 1QNTA 4XLHA 3NARA 2WAQN 3KP7A 3O8HA 4PJLA 2P5KA 2B7EA 4FASD 2LKXA 3GTPJ 2F48A 2XKPA 2ACJA 2KZVA 4U0VA 2WWYA 2HR3A 1FP1D 2B9SA 1R5HA 3GFIA 4OMZA 2E7XA 1QPIA 3FWEA 2CV2A 2ESHA 2XGXA 1OQYA 4NHJA 3KETA 4A6EA 4FE7A 1FTZA 3HUGB 5LD2C 1QQIA 2Y9YA 5EJCA 3R61A 1E3OC 2ZXIA 2ISZA 4YFXF 3I9V2 3WG9A 3BR5A 3LQRA 3ZQLA 4F7ZA 1Y0UA 4AM3A 1YIJI 2XPWA 2JPCA 2P7VB 3OR2C 5CVVA 2ZKZA 4B3XA 1TWGJ 1X1PA 1KU3A 2V7FA 2AS5F 3R60A 1K4SA 2JK3A 1MMDA 3JRIA 3BOQA 4O3MA 2JJ7A 3H1CA 4W97A 4C2UA 1D1CA 2WAEA 3KP6A 2R7SA 4OINF 2NAZA 4L5IA 5J8FA 1Q1VA 4BDYA 1MDMA 4BGDA 3IKVA 4G7HF 3EUHC 3OOPA 4X1EA 4LLGF 2EFWA 4A3JJ 4U0YA 3Q3SA 2XAHA 3MZYA 2Z9OA 1Z1DA 2WTEA 3GEZA 4KMUX 2M9HA 2QA4I 2M2EA 1ZELA 2ISYA 2HZTA 4UB6C 5CVUA 1JKPC 2LLKA 4QTRA 2E71A 3AG2H 3F8BA 1IXCA 1K78B 3W2VA 4DBQA 4XRMA 4FETA 1QZYA 4P5OA 2DFHA 2ZFWA 3LSTA 1KU2A 2RQPA 3FXMA 1XMXA 3PFYA 5EEHA 2W24A 3M3YJ 3M1EA 2X51A 2OPTA 3W2AA 2EZKA 4IHSA 1UAAA 1YI2I 1OYYA 4M9XA 3EUKL 2QKMB 1ZH5A 3HOVJ 3M07A 4RA2A 2OCCH 1RZ4A 4WF2A 1MDMB 2M34A 3FXQA 1WH5A 2GA2A 3AFHA 2ELJA 3J81K 2XGCA 3FXJA 2O8KA 2W4SA 2LG4A 3MMYB 3G73A 4BXFA 2LD5A 5HODA 2K40A 2VJJA 3W3CA 2W25A 3ZPLA 1JTXA 2DT5A 5J40A 2MYSA 1Y0NA 3MKYB 1HSJA 3F8CA 2P81A 3VYTB 1YRNB 1K78A 1FSHA 2GXBA 5E3LA 3LL7A 3QOEA 1ZK8A 5J6XA 1X2NA 3WGIA 4KUMA 1Z6TA 1LNWA 2X1DA 2NVUB 5HLGA 1IXSB 4RB1A 2M0MA 3TBIA 4OMYA 2OF7A 3HM5A 2GAUA 3HRMA 4MNUA 5D5VB 1UELB 1BC8C 1YX3A 2FJ1A 3PUFA 4OOIA 2VT3A 1Z05A 3FZVA 3ZMDA 2H94A 2HOTA 3COAC 2NOGA 2QQBA 2X6OA 3FDYA 4NC8A 5KHDA 4HBLA 1AU7A 1OR7A 1XGNA 4E6KG 3DKYA 2EH3A 5F0FA 5DUKA 4L9VA 1ZGJA 4CHUA 1MBFA 3D1NI 2JA5J 3PIOF 4NNJA 2PEXA 4ASNA 3TOBA 1LKXA 4ESFA 4OWRB 1RKTA 1MNEA 3WTYC 1M1EB 3E97A 2DDBA 1UZCA 2L0KA 3GF2A 1STZA 2FOKA 5HOOA 4RLQA 1X1DA 3LA2A 2JVGA 1D8KA 2MC3A 1JT6A 1PVEA 2G7UA 2VE8A 4XN0A 4D0PA 2XRLA 3H35A 2QWWA 1TTYA 3BTJA 1X19A 1I1GA 1OCRH 2DPDA 2XRNA 2CW8A 3S1MJ 4LLNA 3CF2A 4XL9A 2B0LA 4NQWB 5DCMB 3E1SA 3BR6A 4ESJA 4JOMA 4AUXA 1MNDA 3ML6A 2KT0A 2MGQA 3W2WA 1YQAA 1RUOA 3KE2A 3OOUA 3OY9A 1QPMA 4HX4A 5DM6F 4EJTA 5IT9Z 1S3JA 2XPUA 1MMGA 2QM3A 4RB0A 2HKOA 5DDGA 3HOYJ 2VT2A 1MSEC 4J01A 3S17J 3H9QA 4P9UA 4A3MJ 3G71I 3L2VA 2NVQJ 3HEFA 4IO9F 1W7PB 2VXDA 4HA8A 1B59A 1G3YA 3HG9A 3P9IA 2DOEA 4KT5C 5J1YA 3I64A 2PN6A 5F64A 2ZJRF 2KQRA 3U21A 3GFMA 3K70C 3IC7A 1IXRC 2OD5A 3HHGA 5E18F 4QPOA 4JBAA 4E7KA 2V9KA 2RN7A 2IA1A 2OTLI 1HCRA 2IT0A 5GPCA 4CDGA 3K4MA 4BAYA 2W48A 3T0YA 5JHUA 4U0WA 3D5RC 1L0OC 5JFRA 2R4GA 2M7BA 5D4SA 1GXQA 5GP9A 3AL0C 1J9IA 5LGTA 5LHGA 3F0CA 1IC8A 3QAHA 1Y6IA 1OCOH 2BY1A 2KLOA 2L4AA 4LOCA 3K2AA 2EFPA 3IH2A 4ENKA 2DA3A 1G3SA 1OMIA 4A0ZA 1U8RA 5FLXK 2FA5A 4MQ9F 2VPLA 4CSWA 2KDZA 4OIRF 2Q8KA 3W6JB 3DKXA 2HVSA 1NK2P 1EV7A 2XGDA 3PL8A 2W57A 4FHTA 5E3MA 3EYIA 2R7VA 5E3OA 1VZ0A 5ILUA 3OYLA 5H6QA 4D5CA 4EJVA 3GTMJ 2F2EA 2QQAA 3CJNA 1I5ZA 2JSPA 1KA8A 1YJWI 3WTWC 1HXDA 2XROA 3JAMK 1XCVA 1YW7A 4O5VA 1ACIA 1R5GA 5F0CA 4Y4RA 4EM1A 3KEOA 2HI3A 1FY7A 2DLLA 2EB7A 2P6SA 2PMUA 4WCGA 1T2KA 3K6GA 2M30A 4YRVA 2PMZN 4KT6A 5EYRA 2E34A 1XMKA 1NG7A 3BG6A 1W5SA 4MIMA 2ZXWH 2F5FA 2GWRA 1JJ6C 3VOEA 1WVRA 2ME0A 1QA6A 4HAMA 2VJ4A 1ITYA 5HVQC 2EPFA 4YIFA 3ZQCA 1ZR4A 3K4BA 2K86A 3FF5A 3VB2A 1EF4A 2VL8A 5C3EJ 3PIPF 2NVYJ 3CP2A 3M7GA 3OYCA 1U3EM 4XSXF 3L2RA 5FD5A 2CUJA 1AA7A 1DU0A 1LEBA 3F8MA 3EETA 4RGRA 4ENMA 1HOMA 3C3WA 1LJ9A 1HF0A 1CF7A 3O6BB 1OCCH 1MIJA 3SXYA 1D0ZA 2YPRA 3OYEA 2L2OA 2BYVE 2QBYB 2H09A 3OMYA 1SVOA 4D9JA 1V54H 1W5TA 5HLHA 2ZXHA 3PNVA 5EZGA 3FX3A 3F21A 2HTSA 4EJWA 3NWSA 3U1DA 1Y8QB 1SMYF 4XLPF 1X4OA 1XN7A 4CXFA 3CLOA 5AIQA 5J47A 3UNGC 1GV5A 4BL0B 4CYDA 1T6SA 1IGNA 2CSOA 1BI2A 3R0AA 3ZMTA 2YUSA 1IF1A 3ZQ7A 4UUSB 1MJBA 2R3SA 2VE9A 3BG9A 3F22A 1CGPA 2X48A 4RGXA 2P4WA 2CMPA 5D5UB 3OYHA 2FU4A 5D8LB 5LBQA 1K6YA 3CCMI 2X6WA 5EDNA 3OS2A 3CCVI 4FE4A 1BR2A 5DCMA 2KIQA 2KIUA 2O03A 1O3TA 3P9KA 4ZZDA 3CJQB 2E1CA 2VOPA 1EH6A 2W84A 3LSPA 2VOOA 1OCPA 2E36A 3H9GA 3IWFA 4AVPA 3OIOA 2F5CA 1DUXC 2G0EA 2K4BA 3CCEI 4PSWA 3ZMVA 4XLFA 4BH9A 1YFHA 4KN7X 2LH9A 4L9TA 4I0AA 2FMLA 1XTAA 3VEPA 4EJOA 4CYCA 1HW5A 2B63J 4II2A 1ZKGA 5J1UA 2COBA 2XV4S 5ICGA 1W0UA 3CMEI 4ZTJA 4EQQA 1HDDC 1Z9CA 3FK7A 3OYKA 3U2RA 3KYLA 4Y3OA 2LKSA 2JTVA 5IP6A 1QVUA 2HPIA 3PUBA 4WXHA 1UJ8A 3HTUA 2M87A 3TDZC 4RS8A 1YE9A 4C30A 1PDNC 4EM0B 2JA8J 3E5UA 2ICWG 1R22A 4E7ZA 3ZXSA 2K9LA 2VKDA 1ZRFA 2PJRA 3BJAA 5LGUA 3HSEA 2FOWA 1HC8A 1T33A 3HOZJ 1ZLJA 2PQ8A 3WHCA 3VYSB 2L02A 3DTEA 3DWLE 3FISA 4MFDA 4CCMA 1T95A 1IN6A 2P8TA 2IS1A 3DEWA 1ETOA 1O7FA 3F72A 4X6AJ 2KIMA 3ZQHA 2X1CA 2DYRH 2WV1A 3ELKA 3WHBA 4L9JA 2FMYA 2QLZA 3GFJA 3TW7A 4XLNF 2MLGA 3BP8A 2ESNA 2HOSA 3PM1A 9ANTA 1G2HA 1UHSA 2VQCA 5HLTA 2DYSH 5D8KB 1BR4A 4AYBA 1VQMI 1H88C 2XF5A 4BJ6C 1H8AC 2VKEA 2A05A 1JJ8C 3U9GA 1XB4A 3T8TA 1R4NB 3SDGA 3WU2C 5JHFA 1FBSA 4K2EA 5CKTA 2J5OA 3ABMH 3I56I 4AWXB 1R23A 1QVTA 3LMMA 4BQNA 5DV5A 2PJRB 3DTIA 2XC7A 3I3LA 3DPLC 1FTTA 1A31A 3IV5A 3U1KA 3DBLB 4E4HA 5A2QK 3WTTC 4U88A 1TQIA 4PJMA 5HDKA 2MD0A 1S72I 2XAQA 1KGSA 4DZPA 4C2TA 3R6SA 4N9IA 2WAQA 2OBPA 5CJ9A 1ZHFA 4YIRX 2X0LA 1HKSA 2NS8A 1Y1WJ 4EEFG 1J7KA 3RPQA 3CUQC 1TW2A 3OYGA 3CDLA 2L5QA 3E6MA 5JR3A 1BJZA 4P55A 2NXNB 3CP8A 4IQJA 4IRGA 2ME6A 4HDUA 3DLAA 1O57A 3D5SC 4HV5A 4KDPA 3HRSA 3TOAA 3TL4X 4YG2F 3DEEA 4A3EJ 2P5VA 1I6HJ 1QRYA 3ZMUA 4RAFA 3ZP5A 2Z16A 4EV0A 1U2WA 5FKKA 2RVCA 3TGNA 1A6IA 3JSPA 4UUSA 4H4KC 2DJNA 1WGXA 3QU3A 2E2IJ 3KLNA 2GZWA 4S05A 1GVJA 4WWCA 4LMYA 1PUEE 1L3LA 3ERMA 1FYMA 5GAHJ 4M3FA 5DD8A 2OQGA 4XNFA 4OIOF 1GDTA 1ZRCA 1QGPA 5TISC 1F43A 2DA2A 3R0JA 5KAFC 4ZTFA 2BY0A 4PGHA 3WODF 2O7OA 2GXAA 2ZBKA 2LF7A 1Y8RB 1B9MA 3QPHA 3LFKA 1FZPB 3ZQFA 2XAFA 2HDCA 5L3BA 2H8RA 2CU7A 1ZRDA 1YW9A 2XAGA 1JHHA 5HNFA 2K9SA 3JRAA 2FBKA 1JGGA 2VQGA 2XPVA 5FFZA 4A5MA 4BDZA 2ELHA 2TDXA 4NC7A 2CWEA 1IN5A 4HLXA 2DPUA 3EDPA 4CZCA 2STTA 4UUVA 3BTCA 3WTSC 3E5XA 2EV6A 2IVMA 5DEQA 2PI0A 1FSEA 2DFEA 2DJIA 1HSTA 1QHGA 3TP3A 4EJUA 3DLLF 4B8XA 1IJWC 4MEYF 4Z2YA 1QHHD 5KAIC 1J75A 3SZPA 2DCEA 3CCQI 2NYXA 3PO2J 5FRNA 4II3A 1SD5A 2G7HA 2XDVA 3QYBA 3REOA 1OYWA 5EZHA 1MBGA 3S32A 1FMVA 1FOWA 3AG1H 1TT5B 4PJJA 5LRSA 5DS9A 4B09A 4BY1J 3GFLA 2E7WA 4RLFA 1I50J 1MSFC 3BLYA 2LY1A 2PMHA 5F04A 2PBIA 2NNNA 2UZKA 1B8IA 1UFMA 4IEJA 3HZJA 1IRXA 2ETHA 2UXXA 3CC4I 2EINH 1U78A 2ZSHB 2GBYA 2EIMH 3BQYA 1Z3YA 2RC4A 2BZTA 1BOBA 2DI3A 2IP2A 4AC0A 1H0MA 1PYVA 1JKQC 1IZ1A 2E2HJ 3V4GA 4HDVA 1P7JA 4RB3C 1VQKI 4I09A 3ZMSA 3OL4A 3MQ0A 3S1NJ 3SQNA 3MCZA 3A0BC 2Y30A 2BVLA 2DT7B 5A2QZ 2GIZA 3L00A 3L1PA 1J0RA 2M8EA 1YS7A 1BN5A 3E3VA 3ZQQA 3J80K 1YO5C 3BR1A 1MD0A 2P6TA 4HEA2 2VBZA 1D8JA 2FNAA 4KFCA 2QSGX 1U9OA 3HXLA 1SMTA 1T39A 1KZHA 1GVDA 3HBLA 4JX5A 3UKGA 1GXPA 5LGNA 2WADA 3J7YJ 3DEUA 4LK0F 4M6XA 3NQOA 1X1BA 2KFDA 2V26A 4N4OB 2MFZA 5D4RA 2D1VA 2OU2A 2K5CA 2DOFA 5C4JJ 1W4MA 2XVCA 3H5AA 1JHFA 3OYNA 4L9NA 1HQCA 5CVIA 3BPXA 2LY2A 4RGUA 4BS9A 2YR2A 3JCUC 1OJLA 1R1UA 2HQNA 1V55H 1N25A 3E7LA 2AQFA 2AHQA 4RDUA 1AKHA 2EK5A 2IW5A 4R79A 3N4MA 3K1MA 3PNTA 5DD4A 2ZJPF 2Y0SA 4ZYEA 4E70A 1BIBA 4UVAA 1VQ9I 2F4OB 2O0YA 3FXUA 3CUQA 3MFKA 4LG3A 2DFFA 2F5EA 3MKWB 4AYBN 3FM3A 3I59A 2A61A 1IRFA 2BW3B 2WBMA 3BPVA 3B02A 4GDFA 6PAXA 3GLXA 4LG0B 3V7CA 2QZ8A 3GTJJ 3QYFA 1OLTA 1HDPA 2M4GA 1BI3A 2QYOA 5M3MJ 1YS6A 2LMDA 4Q4ZF 2WAFA 1MMAA 1WI3A 3DKWA 3DTKA 5F08A 4LFUA 3PFIA 1LFUP 4IPAA 4B43A 4KISA 1R5ID 2BV6A 4ZDOA 2YS9A 1Z77A 5LHHA 1T56A 5EGOA 3BZKA 2ZFUA 3K4LA 4EGZA 2ZNYA 2BXYA 2K9NA 2E35A 1YIOA 4BJ5C 3ZN1A 3GTQJ 1V4RA 3B6AA 5HLIA 3HTSB 2FBIA 4X0GA 2IGNA 3FKIJ 2KIFA 1DQUA 1UCRA 3GUDA 4L5EA 3G2BA 4HF1A 3H0GJ 2HQ5A 1PUFB 5F27A 2W7NA 1J5YA 3RZOJ 2QQ9A 3SYTA 3TO7A 5E1WA 2Z3YA 4M73A 1DDNA 4NC6A 2ZSIB 1WWXA 1OCTC 2JWTA 2QQ8A 2M1BA 1E3HA 4LB6B 2LFBA 1SC7A 3BR3A 2RNJA 1WRJA 2DT6A 2BVMA 1J59A 3ZMZA 4AIKA 3SZGA 4QSHA 3HHHA 3NEUA 1DGRM 3I0TA 3CCYA 4A12A 2Y9ZA 2R7UA 3RYRA 3ECOA 1TNSA 2DK8A 4A0XA 2HDDA 3DQVC 4FQGA 4A0YA 4I2OA 4BNCA 4BACA 3ZR8X 3HUGA 2LNBA 4XORA 4ZDLA 1RR7A 2QCOA 3HYIA 4C9YA 1RRJA 1MW7A 4A3LJ 1Z21A 2L4MA 3CMYA 3BG3A 1JUMA 3RYPA 4ZYAA 4RAZA 1XGMA 5IYCJ 4CGZA 3BR0A 2CQQA 1TWHJ 3PQJA 4IOAF 4DYCA 4G12A 3CMMA 4I01A 2Y0MA 5CLSA 2R7XA 1OFCX 1S29A 3RCOA 4KIFA 1FOYA 4I76A 4C3HJ 2HOAA 2XUBA 4I02A 1FC3A 2ZC2A 2R7QA 1TT0A 2PG4A 2MG4A 2QVOA 3C2GA 4LJZF 1TWCJ 3BY6A 1LDDA 4BE1A 1QU3A 2BOLA 3CC2I 3KYCB 1RIOH 1GLNA 2E1MC 4RMNA 1NTCA 2OA4A 3LOCA 3T8RA 4XR6A 1I39A 1VI0A 5ICEA 3S3NA 5FKLA 1D1BA 5DYMA 3CD6I 1G3WA 3WE3A 1RNLA 4GYIA 1KONA 1JTYA 1VQ8I 3L2UA 3IKTA 4LD5A 2O3FA 3I71A 3M8FA 4L0ZB 2R7WA 4FX0A 3KYDB 3M1CA 4XONA 1GT0C 4KNYA 1O7LA 3MVPA 5EG0A 2FSWA 2L7FP 1WHUA 5BPIA 5CVRA 2P7CB 1XCBA 4G6DA 1RR8C 3SFZA 5GAGJ 4WXDA 1YTYA 2OCEA 1FIPA 1SD4A 3EPZA 4A3BJ 2JA2A 2XAJA 3G6EI 4B1RA 4G7ZF 1VQ4I 4N9HA 2H8WA 5E8GA 4XN3A 4Y13A 1P92A 4XM3A 5BPDA 5JLXA 2M3AA 2VJIA 2MC4A 3VFZA 1YOVB 2M8GX 2OC6A 1HLVA 5FRMA 2FXAA 1BR1A 3DBHB 1FIAA 1VQOI 4ETSA 4HNTA 4BE2A 1FP2A 1X58A 1J2XA 3F23A 4PCQA 2L9SA 3MAJA 1IRGA 2IRFG 5BS6A 4IHWA 1GUUA 5IYDJ 3RPUA 2PFBA 2LDUA 2WA0A 2DTZA 4UUTA 3CC7I 1XS9A 4N0BA 4A3DJ 2K3PA 5L3CA 2BHYA 3GYHX 3I4NJ 5ED4A 3JRDA 1WI9A 4G8XA 3CO7C 1BW6A 4MLOA 1OR7C 3GW2A 1WJBA 4FISA 3LA3A 4MQVA 4BHCA 3LSIA 3K9TA 4HSRA 1MZBA 1LE8B 3K1NA 4MEXF 4B4CA 5EF6A 1B72B 2V9VA 2LBFB 1TBXA 2KRFA 2ZJQF 1ZAOA 2Y0SN 1A5JA 1LFBA 1I3QJ 1NHAA 1DU6A 5FD6A 2HU9A 3TKYA 1WQ2A 3CJRB 4XOTA 1KQ9A 1N75A 3V7RA 3CJTB 3CMAI 2HDWA 5FROA 3N97A 4KN4X 3L7WA 3S1QJ 4OIPF 3LAJA 1E2XA 5E20A 3FIWA 1XGSA 3HSRA 4ENJA 3E6BA 3S93A 1TC3C 3RQ4A 4HSTA 3WTZA 3ZQGA 4MO7A 5FKMA 3FHNA 2LRDA 2M0CA 4EMSA 3GMEA 4OIQF 3PSFA 2YU3A 4ZH4F 2XF6A 3OV8A 4YELA 2KRHA 1V3FA 5D6EA 4XBFA 1FLIA 2XGEA 1UHWA 4IVNA 2VKVA 2EV5A 1BA5A 2X1EA 1W7PD 2BGCA 1O4XA 2RGVA 4DYRA 5GAEJ 4HX8A 1ZGAA 1JUPA 2JA7J 3FXKA 3OYAA 5H6RA 3A4CA 2H1KA 2IS4A 2R7ZJ 1I1SA 3LQQA 4HX7A 1W7PA 4LK1F 4CCOA 1TWAJ 2EIKH 3I54A 4IHXA 3DP7A 1BJAA 2DA1A 4XKBA 4HQEA 2KJCA 3K7AJ 1WJFA 1V5GA 1R1TA 2HOEA 3G3ZA 4ZYGA 2AQEA 5ILVA 2HYJA 2DA5A 4GYGA 5ICFA 4CCNA 3KCCA 4ZYHA 3FMQA 4FCYA 1DPUA 1IAWA 3C18A 2ECCA 3DPUA 3HGGA 4EGYA 5HNHA 4QIWN 1ON2A 2L9RA 2DK5A 2X9DA 4Q48A 2EFOA 4AIDA 5IT3A 3RJPA 3TP0A 3VYRB 1HW2A 3A0HC 2E1MB 4A2UA 2Y75A 5LLQA 4EATA 2FUG2 3ERED 4D1QA 2XB0X 1FBQA 5FKOA 3G1LA 3QODA 4BYYA 1PJRA 3RI4A 2LC2A 1ZLKA 4A69C 4E7JA 2CGPA 5B3SH 5KCMA 4IX7A 3HRUA 3K4NA 1TNTA 5DUIA 2OQRA 1BI0A 3ZOBA 4PUSA 1UG0A 2OUMA 4W1UA 4Y52J 3ZRGA 3WTXC 4GXOA 1KU9A 3V8LA 2XASA 3HGYA 5J1RA 4B44A 3BQZA 3ZCOA 3KIOA 2DTRA 1IV8A 1SVLA 4RAYA 2HGCA 3B73A 3JREA 4ZYDA 3PJRA 1POGA 3AG4H 3X2QH 2LF8A 1ZN2A 3QP5A 2PLYA 4DNCA 4XMYA 2ECBA 5L3GA 1FMWA 3HOXJ 2R0QC 2GLOA 2VC1A 1U6GA 3T5XA 3ZQIA 1U5TA 2BY2A 4PK4A 2CUEA 1E3PA 3R4KA 2X6YA 1SAUA 5IY5H 3RPUD 1IN7A 3W6KB 1IUFA 3BCBA 3MWMA 1WSUA 3OYIA 5KVRA 2EBIA 1MBKA 4ZC3A 4IJAA 3FMRA 4YIIA 1ZYRF 1I6XA 4D7MA 4MTDA 4B48A 1R7JA 4HZFA 4UV9A 3HJEA 3D5LA 3BWGA 2K27A 1FPQA 4N4NB 2LP0A 1FOKA 5L3DA 5BMZA 1RPWA 3F8NA 1UMQA 1USSA 3CESA 2DFIA 3TO6A 1ETYA 2IEKA 2EFNA 5L3EA 3RKQA 2ZJ2A 2CQ7A 2QEXI 2KMUA 5HS7A 3O8GA 2IXSA 4ESBA 2CH0A 3FKJA 2JRTA 1ETWA 5IP9J 4DJAA 3J7ZI 3K4KA 1MKMA 2OZ6A 3I5UA 1IO2A 1TQPA 1Z91A 4L5JA 3ZGKA 3SJMA 1UG2A 3K10A 4PFOA 3I59B 4GO1A 4XSZF 4FTHA 3WE2A 2R5ZB 3ONQA 1AOYA 2HQAA 1QBJA 1N77A 1O3SA 2DQRA 2BXZA 1R4MB 1CQTA 5JLWA 1P4AA 4U87A 3H92A 2IAIA 2V9PA 2JN6A 3IRQA 1LUJB 2FD5A 3JSOA 2KJBA 5FO5A 4WK8F 4IOCF 3LWFA 2M45A 1X3ZB 2CW7A 2OTJI 2M7AA 2WB1N 2XSDC 4V2FA 1ZREA 2DA6A 4IHTA 3MZ8A 2W85A 4BQQA 2RAEA 4JYKA 2O5RA 3L09A 3BG7A 3C7JA 1W36C 4XRSA 2NVXJ 4I0BA 3OS1A 2CV1A 4A5NA 3L2CA 4A3CJ 2LY9A 2VB6A 1ZG1A 1LB2A 1SFKA 1USTA 2R7DA 1ETQA 1RKWA 2X85A 3K70D 4IZZA 4NUBA 1X1AA 1T8IA 3RKWA 5HDNA 1MMNA 1EH7A 1B8IB 1Z7UA 1ZG3A 1C0WA 2EJRA 1S8NA 5CYVA 1WFXA 4Q47A 3SHFA 5K5RA 1IDZA 1FNNA 1A04A 2H6CA 4NQWA 5M5WJ 2VI6A 2X6XA 4BUPA 2OV7A 4A3GJ 4DIQA 2MSYA 3B6CA 3V8JA 2L7MP 4M3EA 3Q9VA 3D0SA 2VODA 4AU7A 3P7NA 5D6FA 1Y56A 3C2HA 2OZUA 5L3FA 2FX0A 3WTUC 4PJNA 4DOZA 3LSGA 4E7IA 3TQNA 2R7FA 3L9FA 4G7OF 2WB1A 4KJZA 1S5LC 2AXLA 3QWLA 3BT9A 1N78A 5F6FA 3IRRA 2HFHA 4AVZA 3E0JB 3K4JA 3MD2A 4JQFA 5GTIC 3K4CA 2D2WA 4F92B 3CCSI 2V1UA 3H3ZA 1ON1A 1VF9A 1W1WE 3OR1C 2COMA 3M9AA 1U9NA 4JX6A 5GADJ 5M5YJ 1B1BA 2LREA 1SFOJ 3CUQB 4EM2A 1KQ0A 3J7AO 5CVJA 2A6EF 5B5EC 3IAS2 2K3FA 1CF7B 1RUNA 2IJLA 3TW6A 2VQLA 3AG3H 3FXRA 3SZTA 2NOJB 4Y15A 3TO9A 4LITA 1DGWY 3I53A 1XD7A 2RDPA 2CFOA 1XDSA 2RQQA 2EFQA 1S7EA 4DBRA 3SEZA 4Q5SF 3CCUI 1A36A 1JXSA 2VC0A 2QF7A 5EEGA 3KP4A 3RSNA 3OS0A 4Y7NJ 3RKXA 3IUOA 2R92J 3DU6A 4ANJA 2DAOA 2DQLA 4RGSA 4Y33A 3TEDA 3I4MJ 2A6HF 1T98A 1A6QA 5EGOB 1FOXA 1Z7LA 5K5OA 4L18B 1VQLI 1LVAA 2VBXA 4XK4A 3AAFA 1IRZA 2H27A 3F3XA 2VUMJ 2CYYA 2O8XA 3HDDA 1R49A 2JUGA 5ERIA 5DM7F 4BY7J 4XICA 1F4KA 4D5FA 1XGOA 3GWZA 2JT1A 3CO6C 4UXNA 2ZMEA 5IYBJ 2MA3A 4P1WA 3FHZA 1TQMA 4PGGA 3JRBA 2HXOA 5HS8A 1H9TA 3WGHA 3JRFA 5IOZA 3HB9A 5F1JA 2Z1DA 4IRHA 2EA2A 1HBXG 1XSXA 4IF4A 3CLQA 3G4SI 2HTJA 2JUCA 2EV0A 2VJ5A 3NAUA 4P96A 1D1AA 1G3TA 3F9KA 3LNQA 1F9NA 4RB2C 4PDKA 3H5RA 2AXTC 2EIJH 3FMSA 3H9JA 2L7KA 4CYCB 4YEJA 5FLVA 2E1NA 3IP4B 2L3DA 4Y17A 2CQKA 3OYMA 1AWCA 3KPHA 3QPTA 2GM4A 2E60A 2LBFA 4XOPA 1EA3A 4XRFA 5E17F 1HW1A 3K69A 2IBDA 2NVTJ 3V8KA 1LE8A 2R7TA 1J09A 1U5TB 4BQOA 3A03A 1XMAA 2K9MA 3JTGA 2LK2A 2QENA 2JSCA 1NG6A 2EZHA 3BG5A 4G94A 1R71A 5HDGA 3GLLA 1SFXA 2RKHA 4F3QA 1WZ2A 2K9QA 2UUZA 3KFWX 4E7HA 2KP6A 1ETKA 3KEYA 4ENNA 4XKVA 2VONA 2WY8Q 3Q9SA 2H1LA 2KKOA 3H3UA 2IS6A 2MD5A 3OYDA 1YX5A 4M3DA 3LSJA 3E6DA 3VYUB 2C6YA 1TW3A 5KNLA 4NBQA 2XSJC 5LHIA 5IP7J 3VWBA 3G1MA 4ITVA 1RC9A 1T0FA 1B4AA 3L2WA 3PO3J 2STWA 4JX4A 2TRTA 5E79C 2HYGD 1K4TA 2W1OA 2X4HA 3IHUA 4I99C 2A5YB 4HYEA 4XKWA 4HNUA 4CO8A 1WJEA 1JUSA 3A2KA 2HXIA 4HRIA 4RM3A 4AIJA 1XSDA 1P7IA 2HWVA 3TMOA 3GVAA 2DMQA 3FBNB 3HOTA 3S3OA 1ULYA 3E6CC 2F4MB 4FX4A 1I3AA 1I27A 1KU7A 4I7HA 1LEAA 4BKXA 2JPBA 4A93J 3E5QA 2ZO4A 1LVKA 3HPHA 1WH7A 5ICCA 3VODA 3MKZA 4LG0A 3MEXA 4KICA 2KHMA 1MH3A 4HF0A 2R7RA 2DA4A 4V19K 3H3VK 3GTOJ 5FFXA 1VQ5I 5CQGA 1IW7F 1R58A 3EYYA 5IOYA 1LDKB 2F4IA 4QPQA 1FYLA 5B66C 3S8PA 2FRHA 4WXCA 3MKLA 5J8CA 4KA4A 2PJPA 3BC8A 1G6NA 3IL2A 1SEUA 1QZZA 3VDXA 1IV6A 2PX9A 4D7NA 2YSRA 1IUYA
chains in the Genus database with same CATH topology
1ZR2A 1MH4A 3FIWA 5FJ8J 1QVTA 3NARA 2WAQN 1TC3C 3O8HA 2LKXA 3ZQGA 3GTPJ 4MO7A 5FKMA 4GFBA 1FTTA 2M0CA 3IV5A 2R93J 1SANA 2ID6A 3IH4A 1QPIA 4DZJA 1ETVA 4FE7A 3JRHA 1FTZA 4DZPA 2XGEA 1APLC 2Y9YA 4A3KJ 2VKVA 1E3OC 2NS8A 1BA5A 1Y1WJ 4EEFG 3BR5A 1O4XA 3ZQLA 3M4OJ 1RETA 1XC5A 4ABZA 3CDLA 4DYRA 1K61A 1JUPA 2JA7J 3QPLA 1BJZA 2H1KA 2R7ZJ 3GTLJ 2XPWA 1ENHA 1TWAJ 2ME6A 1TWGJ 4IHXA 1WPKA 5DTDA 2N8GA 2DA1A 3K7AJ 2JK3A 3JRIA 4DYQA 2JJ7A 2CUFA 4A3EJ 2HYJA 4W97A 2DA5A 1I6HJ 4FCYA 1QRYA 1K83J 3HGGA 2ECCA 1Z0XA 4QIWN 1Q1VA 5FKKA 2L9RA 3Q0VA 1A6IA 2X9DA 3JRGA 4UUSA 1WCMJ 4X1EA 3TP0A 2DJNA 1WGXA 4A3JJ 2E2IJ 3JRCA 3Q3SA 1X2MA 3BR2A 2M9HA 5BNGA 2M2EA 3SFIA 2XB0X 4BBRJ 4M3FA 5FKOA 3G1LA 1GDTA 1F43A 2DMTA 1JKPC 2DA2A 3C2BA 1BW5A 2LLKA 4QTRA 4A69C 2O7OA 4XRMA 3ZOBA 3ZQFA 2H8RA 2ELKA 4W1UA 2CU7A 4Y52J 5GPAA 3HGYA 1GV2A 5J1RA 3BQZA 2K9SA 3JRAA 1JGGA 3JREA 3M3YJ 1POGA 2MW8A 2OPTA 2EZKA 2XPVA 3A01A 5E3NA 3HOVJ 2ECBA 3HOXJ 3BTCA 2R0QC 5K7HA 2GLOA 3ZQIA 1VNDA 1D5YA 2CUEA 2M34A 2JA6J 3TP3A 1RESA 1WH5A 1IJWC 2JMWA 3RZDJ 2CJJA 1IUFA 3PO2J 2XGCA 2O8KA 2EBIA 1MBKA 2LD5A 5HODA 2K40A 5EZHA 1JTXA 1MBGA 4V2GA 4D7MA 2P81A 2VPRA 1YRNB 5E3LA 5DS9A 1JKOC 2DA7A 4BY1J 2LP0A 1I50J 1MSFC 4C3IJ 1RPWA 1ZK8A 1X2NA 5F04A 1UMQA 1B8IA 4IEJA 2OF7A 1ETYA 2IEKA 3HM5A 3RKQA 3GTGJ 1U78A 2FJ1A 2GBYA 3O8GA 4MFEA 4NDLA 3BQYA 1JKQC 4AC0A 2L7ZA 2HOTA 1ETWA 5IP9J 2E2HJ 1ETXA 2NOGA 2X6OA 1P7JA 1AU7A 4RBOA 3SJMA 1UG2A 2EH3A 5F0FA 1VFCA 3S1NJ 2D5VA 3HOUJ 4FTHA 2Y30A 2O9LA 1IDYA 2R5ZB 1MBFA 3L1PA 3D1NI 2JA5J 4IHYA 2ZB9A 1MBHA 1RKTA 3BR1A 1CQTA 1U9OA 2L0KA 5JLWA 2E19A 2DMNA 4XIDA 2IAIA 1GVDA 3HBLA 4JX5A 2TCTA 4A3IJ 2JN6A 3UKGA 1B72A 1JT6A 3RQIA 3S15J 2XRLA 4M3BA 2FD5A 2AO9A 3BTJA 2I10A 3S1MJ 1YRNA 3VPRA 5EG0B 3BR6A 2WB1N 2LR8A 4AUXA 5C4JJ 2XSDC 4V2FA 2KT0A 2E1OA 2DA6A 2MGQA 5EEAA 3OOUA 2RAEA 3Q0UA 3OSFA 4JYKA 1OJLA 4B3AA 3E7LA 2AHQA 2XPUA 4RDUA 4XRSA 1AKHA 2NVXJ 3HOYJ 1Y1VJ 1MSEC 3S17J 3S2DJ 4A3CJ 2LY9A 5M3FJ 4A3MJ 2NVQJ 3HEFA 2CQXA 1ETQA 1RKWA 4BXXJ 5K7ZA 4AYBN 5J1YA 3QQAA 2DMPA 4HNVA 1B8IB 1BL0A 2R5YA 1IDZA 1MNMC 5M5WJ 2VI6A 3GTJJ 1HDPA 3BTLA 4A3GJ 5M3MJ 2MSYA 3B6CA 2L7MP 1WI3A 2R5ZA 3JR9A 1HCRA 5GPCA 5F08A 4M3EA 3LSRA 1LFUP 1AKHB 2W48A 1XG1A 3S14J 2XB5A 2YS9A 1Z77A 2FX0A 1T56A 4IHVA 2DMUA 5EGOA 3LSGA 5GP9A 3F0CA 1IC8A 2K9NA 4LOCA 3W6VA 3K2AA 3IH2A 2DA3A 3BT9A 3GTQJ 2YU9J 3B6AA 2KDZA 1NK2P 2XGDA 5E3MA 3FKIJ 1AHDP 2NS7A 5E3OA 1VF9A 4L5EA 3H0GJ 2HQ5A 1U9NA 4JX6A 5FKNA 1PUFB 3DCFA 2EQRA 5F27A 4D5CA 5F0HA 5M5YJ 3GTMJ 3RZOJ 1SFOJ 1ZQ3P 3TW6A 5F0CA 2HI3A 1OCTC 2JWTA 3BTIA 1ZTRA 2Y2ZA 2LFBA 3BR3A 2PMZN 5EYRA 5C4XJ 5IPAA 3HKZN 1S7EA 3GTKJ 4QSHA 3IH3A 4MIMA 1JJ6C 3CCYA 2Y9ZA 2QF7A 2ME0A 4Y7NJ 2R92J 1ITYA 5J3LA 3ZQCA 3TEDA 2HDDA 3I4MJ 1ZR4A 1PUFA 5EGOB 1EF4A 5C3EJ 1RR7A 2NVYJ 2E2JJ 4BBSJ 2QCOA 2LVSA 4XK4A 1TWFJ 1IRZA 4A3LJ 2VUMJ 1F36A 3HDDA 3A02A 3CMYA 2Y31A 1DU0A 3BG3A 1HOMA 1JUMA 4BY7J 4XICA 5C44J 1HF0A 5IYCJ 4D5FA 3BR0A 3S2HJ 2CQQA 1TWHJ 4DYCA 4G12A 4A3FJ 5IYBJ 4C2MJ 1OFCX 5EZGA 3JRBA 1H89C 4I76A 4C3HJ 2HOAA 2HXOA 2MG4A 4C3JJ 1ZGWA 1TWCJ 3OSGA 3JRFA 5IOZA 3HB9A 3MN2A 5F1JA 2EZLA 4M3GA 3NAUA 3CQZJ 3LNQA 3Q0WA 1NTCA 3LOCA 1GV5A 3G1OA 1VI0A 4CYCB 1IGNA 5FLVA 2YUSA 4UUSB 1FJLA 4J19A 5FKLA 2GM4A 3BG9A 2X48A 2IBDA 1JTYA 2NVTJ 1JT0A 1LE8A 3A03A 5EDNA 1GT0C 3FK6A 1MBEA 4FE4A 2LK2A 3MVPA 3BG5A 5EG0A 2CRGA 2EZHA 2EZIA 2L7FP 2K9QA 4XRSG 3S16J 3LSPA 1ETKA 5FLMJ 1FIPA 1OCPA 4A3BJ 4B1RA 2FQ4A 3OIOA 2G0EA 1NK3P 4M3DA 3LSJA 4JP0A 5JLXA 3HOWJ 4CYCA 2B63J 1ZKGA 2M8GX 4M6VA 5J1UA 1W0TA 1HLVA 2COBA 5IP7J 1W0UA 3G1MA 1HDDC 2LTPA 1MBJA 3PO3J 1FIAA 3A01B 4JX4A 3FK7A 2TRTA 1X58A 4I6ZA 4DW6A 5IP6A 5M5XJ 1QVUA 1JUSA 2HXIA 3S1RJ 4IHWA 4S0HB 1GUUA 2JA8J 5IYDJ 2DTZA 4UUTA 1P7IA 1JKRC 1ORKA 2DMQA 1XS9A 4A3DJ 2R5YB 3I4NJ 1T33A 4BKXA 1R9TJ 3HOZJ 2ID3A 3WHCA 4A93J 4MFDA 3FISA 3JRDA 3DEWA 1ETOA 1WH7A 1BW6A 4MLOA 4FISA 4X6AJ 3ZQHA 1FEXA 1MH3A 2WV1A 3WHBA 1LE8B 2DA4A 3H3VK 3GTOJ 4B4CA 5EF6A 1B72B 3QPSA 3TW7A 2HOSA 9ANTA 3PM1A 1G2HA 2DN0A 1UHSA 2Y0SN 5IOYA 1A5JA 1LFBA 1I3QJ 1DU6A 1U8BA 1H88C 3MKLA 3GBGA 1H8AC 2VKEA 5K7FA 1IG7A 1JJ8C 1IV6A 4D7NA 3SDGA 3S1QJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZR2 A;  1MH4 A;  3FIW A;  5FJ8 J;  1QVT A;  3NAR A;  2WAQ N;  1TC3 C;  3O8H A;  2LKX A;  3ZQG A;  3GTP J;  4MO7 A;  5FKM A;  4GFB A;  1FTT A;  2M0C A;  3IV5 A;  2R93 J;  1SAN A;  2ID6 A;  3IH4 A;  1QPI A;  4DZJ A;  1ETV A;  4FE7 A;  3JRH A;  1FTZ A;  4DZP A;  2XGE A;  1APL C;  2Y9Y A;  4A3K J;  2VKV A;  1E3O C;  2NS8 A;  1BA5 A;  1Y1W J;  4EEF G;  3BR5 A;  1O4X A;  3ZQL A;  3M4O J;  1RET A;  1XC5 A;  4ABZ A;  3CDL A;  4DYR A;  1K61 A;  1JUP A;  2JA7 J;  3QPL A;  1BJZ A;  2H1K A;  2R7Z J;  3GTL J;  2XPW A;  1ENH A;  1TWA J;  2ME6 A;  1TWG J;  4IHX A;  1WPK A;  5DTD A;  2N8G A;  2DA1 A;  3K7A J;  2JK3 A;  3JRI A;  4DYQ A;  2JJ7 A;  2CUF A;  4A3E J;  2HYJ A;  4W97 A;  2DA5 A;  1I6H J;  4FCY A;  1QRY A;  1K83 J;  3HGG A;  2ECC A;  1Z0X A;  4QIW N;  1Q1V A;  5FKK A;  2L9R A;  3Q0V A;  1A6I A;  2X9D A;  3JRG A;  4UUS A;  1WCM J;  4X1E A;  3TP0 A;  2DJN A;  1WGX A;  4A3J J;  2E2I J;  3JRC A;  3Q3S A;  1X2M A;  3BR2 A;  2M9H A;  5BNG A;  2M2E A;  3SFI A;  2XB0 X;  4BBR J;  4M3F A;  5FKO A;  3G1L A;  1GDT A;  1F43 A;  2DMT A;  1JKP C;  2DA2 A;  3C2B A;  1BW5 A;  2LLK A;  4QTR A;  4A69 C;  2O7O A;  4XRM A;  3ZOB A;  3ZQF A;  2H8R A;  2ELK A;  4W1U A;  2CU7 A;  4Y52 J;  5GPA A;  3HGY A;  1GV2 A;  5J1R A;  3BQZ A;  2K9S A;  3JRA A;  1JGG A;  3JRE A;  3M3Y J;  1POG A;  2MW8 A;  2OPT A;  2EZK A;  2XPV A;  3A01 A;  5E3N A;  3HOV J;  2ECB A;  3HOX J;  3BTC A;  2R0Q C;  5K7H A;  2GLO A;  3ZQI A;  1VND A;  1D5Y A;  2CUE A;  2M34 A;  2JA6 J;  3TP3 A;  1RES A;  1WH5 A;  1IJW C;  2JMW A;  3RZD J;  2CJJ A;  1IUF A;  3PO2 J;  2XGC A;  2O8K A;  2EBI A;  1MBK A;  2LD5 A;  5HOD A;  2K40 A;  5EZH A;  1JTX A;  1MBG A;  4V2G A;  4D7M A;  2P81 A;  2VPR A;  1YRN B;  5E3L A;  5DS9 A;  1JKO C;  2DA7 A;  4BY1 J;  2LP0 A;  1I50 J;  1MSF C;  4C3I J;  1RPW A;  1ZK8 A;  1X2N A;  5F04 A;  1UMQ A;  1B8I A;  4IEJ A;  2OF7 A;  1ETY A;  2IEK A;  3HM5 A;  3RKQ A;  3GTG J;  1U78 A;  2FJ1 A;  2GBY A;  3O8G A;  4MFE A;  4NDL A;  3BQY A;  1JKQ C;  4AC0 A;  2L7Z A;  2HOT A;  1ETW A;  5IP9 J;  2E2H J;  1ETX A;  2NOG A;  2X6O A;  1P7J A;  1AU7 A;  4RBO A;  3SJM A;  1UG2 A;  2EH3 A;  5F0F A;  1VFC A;  3S1N J;  2D5V A;  3HOU J;  4FTH A;  2Y30 A;  2O9L A;  1IDY A;  2R5Z B;  1MBF A;  3L1P A;  3D1N I;  2JA5 J;  4IHY A;  2ZB9 A;  1MBH A;  1RKT A;  3BR1 A;  1CQT A;  1U9O A;  2L0K A;  5JLW A;  2E19 A;  2DMN A;  4XID A;  2IAI A;  1GVD A;  3HBL A;  4JX5 A;  2TCT A;  4A3I J;  2JN6 A;  3UKG A;  1B72 A;  1JT6 A;  3RQI A;  3S15 J;  2XRL A;  4M3B A;  2FD5 A;  2AO9 A;  3BTJ A;  2I10 A;  3S1M J;  1YRN A;  3VPR A;  5EG0 B;  3BR6 A;  2WB1 N;  2LR8 A;  4AUX A;  5C4J J;  2XSD C;  4V2F A;  2KT0 A;  2E1O A;  2DA6 A;  2MGQ A;  5EEA A;  3OOU A;  2RAE A;  3Q0U A;  3OSF A;  4JYK A;  1OJL A;  4B3A A;  3E7L A;  2AHQ A;  2XPU A;  4RDU A;  4XRS A;  1AKH A;  2NVX J;  3HOY J;  1Y1V J;  1MSE C;  3S17 J;  3S2D J;  4A3C J;  2LY9 A;  5M3F J;  4A3M J;  2NVQ J;  3HEF A;  2CQX A;  1ETQ A;  1RKW A;  4BXX J;  5K7Z A;  4AYB N;  5J1Y A;  3QQA A;  2DMP A;  4HNV A;  1B8I B;  1BL0 A;  2R5Y A;  1IDZ A;  1MNM C;  5M5W J;  2VI6 A;  3GTJ J;  1HDP A;  3BTL A;  4A3G J;  5M3M J;  2MSY A;  3B6C A;  2L7M P;  1WI3 A;  2R5Z A;  3JR9 A;  1HCR A;  5GPC A;  5F08 A;  4M3E A;  3LSR A;  1LFU P;  1AKH B;  2W48 A;  1XG1 A;  3S14 J;  2XB5 A;  2YS9 A;  1Z77 A;  2FX0 A;  1T56 A;  4IHV A;  2DMU A;  5EGO A;  3LSG A;  5GP9 A;  3F0C A;  1IC8 A;  2K9N A;  4LOC A;  3W6V A;  3K2A A;  3IH2 A;  2DA3 A;  3BT9 A;  3GTQ J;  2YU9 J;  3B6A A;  2KDZ A;  1NK2 P;  2XGD A;  5E3M A;  3FKI J;  1AHD P;  2NS7 A;  5E3O A;  1VF9 A;  4L5E A;  3H0G J;  2HQ5 A;  1U9N A;  4JX6 A;  5FKN A;  1PUF B;  3DCF A;  2EQR A;  5F27 A;  4D5C A;  5F0H A;  5M5Y J;  3GTM J;  3RZO J;  1SFO J;  1ZQ3 P;  3TW6 A;  5F0C A;  2HI3 A;  1OCT C;  2JWT A;  3BTI A;  1ZTR A;  2Y2Z A;  2LFB A;  3BR3 A;  2PMZ N;  5EYR A;  5C4X J;  5IPA A;  3HKZ N;  1S7E A;  3GTK J;  4QSH A;  3IH3 A;  4MIM A;  1JJ6 C;  3CCY A;  2Y9Z A;  2QF7 A;  2ME0 A;  4Y7N J;  2R92 J;  1ITY A;  5J3L A;  3ZQC A;  3TED A;  2HDD A;  3I4M J;  1ZR4 A;  1PUF A;  5EGO B;  1EF4 A;  5C3E J;  1RR7 A;  2NVY J;  2E2J J;  4BBS J;  2QCO A;  2LVS A;  4XK4 A;  1TWF J;  1IRZ A;  4A3L J;  2VUM J;  1F36 A;  3HDD A;  3A02 A;  3CMY A;  2Y31 A;  1DU0 A;  3BG3 A;  1HOM A;  1JUM A;  4BY7 J;  4XIC A;  5C44 J;  1HF0 A;  5IYC J;  4D5F A;  3BR0 A;  3S2H J;  2CQQ A;  1TWH J;  4DYC A;  4G12 A;  4A3F J;  5IYB J;  4C2M J;  1OFC X;  5EZG A;  3JRB A;  1H89 C;  4I76 A;  4C3H J;  2HOA A;  2HXO A;  2MG4 A;  4C3J J;  1ZGW A;  1TWC J;  3OSG A;  3JRF A;  5IOZ A;  3HB9 A;  3MN2 A;  5F1J A;  2EZL A;  4M3G A;  3NAU A;  3CQZ J;  3LNQ A;  3Q0W A;  1NTC A;  3LOC A;  1GV5 A;  3G1O A;  1VI0 A;  4CYC B;  1IGN A;  5FLV A;  2YUS A;  4UUS B;  1FJL A;  4J19 A;  5FKL A;  2GM4 A;  3BG9 A;  2X48 A;  2IBD A;  1JTY A;  2NVT J;  1JT0 A;  1LE8 A;  3A03 A;  5EDN A;  1GT0 C;  3FK6 A;  1MBE A;  4FE4 A;  2LK2 A;  3MVP A;  3BG5 A;  5EG0 A;  2CRG A;  2EZH A;  2EZI A;  2L7F P;  2K9Q A;  4XRS G;  3S16 J;  3LSP A;  1ETK A;  5FLM J;  1FIP A;  1OCP A;  4A3B J;  4B1R A;  2FQ4 A;  3OIO A;  2G0E A;  1NK3 P;  4M3D A;  3LSJ A;  4JP0 A;  5JLX A;  3HOW J;  4CYC A;  2B63 J;  1ZKG A;  2M8G X;  4M6V A;  5J1U A;  1W0T A;  1HLV A;  2COB A;  5IP7 J;  1W0U A;  3G1M A;  1HDD C;  2LTP A;  1MBJ A;  3PO3 J;  1FIA A;  3A01 B;  4JX4 A;  3FK7 A;  2TRT A;  1X58 A;  4I6Z A;  4DW6 A;  5IP6 A;  5M5X J;  1QVU A;  1JUS A;  2HXI A;  3S1R J;  4IHW A;  4S0H B;  1GUU A;  2JA8 J;  5IYD J;  2DTZ A;  4UUT A;  1P7I A;  1JKR C;  1ORK A;  2DMQ A;  1XS9 A;  4A3D J;  2R5Y B;  3I4N J;  1T33 A;  4BKX A;  1R9T J;  3HOZ J;  2ID3 A;  3WHC A;  4A93 J;  4MFD A;  3FIS A;  3JRD A;  3DEW A;  1ETO A;  1WH7 A;  1BW6 A;  4MLO A;  4FIS A;  4X6A J;  3ZQH A;  1FEX A;  1MH3 A;  2WV1 A;  3WHB A;  1LE8 B;  2DA4 A;  3H3V K;  3GTO J;  4B4C A;  5EF6 A;  1B72 B;  3QPS A;  3TW7 A;  2HOS A;  9ANT A;  3PM1 A;  1G2H A;  2DN0 A;  1UHS A;  2Y0S N;  5IOY A;  1A5J A;  1LFB A;  1I3Q J;  1DU6 A;  1U8B A;  1H88 C;  3MKL A;  3GBG A;  1H8A C;  2VKE A;  5K7F A;  1IG7 A;  1JJ8 C;  1IV6 A;  4D7N A;  3SDG A;  3S1Q J; 
#chains in the Genus database with same CATH topology
 3JTH A;  4M72 A;  1ZR2 A;  1MH4 A;  1TP4 A;  1ZAR A;  2P5L C;  4H0E A;  4UVC A;  3BRO A;  2RV8 A;  3RDI A;  5FJ8 J;  4ZJZ A;  1FBU A;  2QSH X;  5TGT A;  1KQ8 A;  2W00 A;  1TL8 A;  1S6L A;  4GFB A;  2JVH A;  1FWZ A;  4E7S A;  1U0J A;  4CCL A;  2R93 J;  1SAN A;  2ID6 A;  3IH4 A;  1W5C C;  1MMS A;  1UB9 A;  4YFK F;  4DZJ A;  4BE0 A;  1ETV A;  4GRI A;  1VTN C;  3KLO A;  3JRH A;  3O3K A;  1SD6 A;  1APL C;  4CZZ A;  3OWT A;  2O6G E;  4M9S A;  1JI8 A;  1P4X A;  4A3K J;  2FF4 A;  2LKP A;  4F91 B;  1B9N A;  1G59 A;  3M4O J;  1RET A;  1XC5 A;  4ABZ A;  3AKZ A;  3Q5F A;  3NRV A;  1K61 A;  4A6D A;  1BC7 C;  4L0Y B;  3QPL A;  2A68 F;  3GTL J;  4GGG A;  2DXI A;  1ENH A;  3HIF A;  1YYV A;  3KP5 A;  1WPK A;  4RM2 A;  5DTD A;  5F1R A;  5JVG F;  2N8G A;  2P0W A;  2ZCW A;  3PQK A;  3I4P A;  2KL4 A;  5TJJ A;  4DYQ A;  1QZE A;  2CUF A;  4HPQ A;  1BIA A;  1FX7 A;  2V1D A;  3LA7 A;  5J4Y A;  1SAX A;  2I8D A;  3J81 Z;  1K83 J;  3IWZ A;  1S7O A;  2J5P A;  3CDI A;  1Z0X A;  3HOS A;  5AIP A;  3PNY A;  3Q0V A;  3JRG A;  2UWM A;  4HOB A;  1WCM J;  2VKH A;  2Q0O A;  4CCK A;  3JRC A;  2L01 A;  1SVM A;  1X2M A;  2IA0 A;  2GA1 A;  4XLC A;  3BR2 A;  3ABT A;  5BNG A;  3RTR A;  1O3Q A;  2HVR A;  1S9H A;  1E0E A;  3SFI A;  4BBR J;  3ECH A;  3CUO A;  2MAB A;  4CUG A;  2DMT A;  3C2B A;  4F93 B;  1BW5 A;  2VXZ A;  1LPQ A;  2OAZ A;  4BEH A;  2DDA A;  4QLC U;  4ZDP A;  3GZ6 A;  1X1C A;  3KZZ A;  4HG2 A;  3MZH A;  2A07 F;  5D5X B;  2ELK A;  1JE8 A;  5GPA A;  1ERD A;  2RRE A;  3F8F A;  1LQ1 A;  2JRM A;  2HKX A;  1GV2 A;  4LB5 A;  2Q2E B;  2VN2 A;  1WJD A;  3BDD A;  4LGW A;  2QSF X;  4M6Y A;  3BJ6 A;  3KX2 A;  2I5U A;  2MW8 A;  3A01 A;  1EJ9 A;  5E3N A;  2WV0 A;  3JW4 A;  1P9Q C;  1D0Y A;  5JVT A;  4XLE A;  3HSF A;  2L9V A;  2VLA A;  1MJA A;  5K7H A;  4YFN F;  3QYE A;  3IAM 2;  3VSK A;  4UVB A;  3SEQ A;  1VND A;  1D5Y A;  2JA6 J;  1SD7 A;  2CO5 A;  1RES A;  5E8I A;  2XIG A;  1DP3 A;  2JMW A;  3RZD J;  5AON A;  2CJJ A;  3WG7 H;  2W82 A;  1OKR A;  3J7A Y;  2R7O A;  1R1V A;  3GZN B;  1DPR A;  4V2G A;  4HF2 A;  1OPC A;  4WX9 A;  2HS5 A;  4I98 B;  2HVQ A;  4HV6 A;  2Q1Z B;  2LYC A;  2QBY A;  1MGT A;  1BOA A;  2VPR A;  3QU6 A;  4F55 A;  5CQE A;  3CCL I;  5ILS A;  2MLK A;  1JKO C;  2DA7 A;  3CCJ I;  1EKE A;  2HNH A;  1R36 A;  2MH9 A;  2JZY A;  4DQ2 A;  1K79 A;  2HYF A;  4C3I J;  3NWT A;  2KZG A;  2L54 A;  3DU5 A;  5H20 A;  1B6A A;  1T0F C;  4QWQ A;  3EQL F;  3KEQ A;  2E5N A;  3GTG J;  5D5W B;  4PJ0 C;  3ROU A;  4LLL A;  5B1A H;  3PSI A;  1REP C;  4MFE A;  4NDL A;  3BZ6 A;  2KIS A;  4AD9 A;  5H2F C;  2L7Z A;  2D1H A;  1HKT A;  1ETX A;  4G6T B;  1F1Z A;  2F6C A;  2CS3 A;  3SDB A;  4RBO A;  3HRT A;  2HZD A;  3FM5 A;  4IXA A;  1VFC A;  2JQ7 A;  2D5V A;  3HOU J;  1VQ6 I;  3OL3 A;  1GHC A;  2O9L A;  2XKO A;  1IDY A;  3KZY A;  1TLH B;  2OJE D;  4IHY A;  2G9W A;  4AIH A;  2ZB9 A;  2ZXJ A;  4R1H A;  1KYZ A;  1SFU A;  1MBH A;  3LSK A;  2V4J C;  3O2P E;  4CCJ A;  2IGO A;  4KMF A;  3FBI B;  5B1B H;  2E19 A;  1YG2 A;  2DMN A;  3FXO A;  4MGR A;  4XID A;  3AL0 B;  3HL2 A;  3I58 A;  2TCT A;  4A3I J;  2HQR A;  2ZME C;  2Y48 A;  3ESW B;  4FT8 A;  4J00 A;  1YJ9 I;  1B72 A;  1X4P A;  3RQI A;  4M74 A;  1K7A A;  1Z67 A;  4KIB A;  4M3B A;  3S15 J;  2AO9 A;  2BW3 A;  2CFX A;  3DF8 A;  3QOP A;  1IN8 A;  2V6E A;  2I10 A;  2EA4 A;  1W36 D;  2KDO A;  5BOX A;  2FNP A;  3VPR A;  1YRN A;  5EG0 B;  2GOM A;  2Z2S B;  2LR8 A;  1IN4 A;  2IPQ X;  4BHB A;  2E1O A;  5FLX Z;  3OIP A;  3K0L A;  5EEA A;  1KYW A;  3Q0U A;  3OSF A;  1X3W B;  2FEZ A;  3BZC A;  3N05 A;  5BQT A;  1TZL A;  4B3A A;  4NB5 A;  1XPX A;  4IKF A;  3KP3 A;  1Y1V J;  1G8X A;  1F5T A;  3S2D J;  1OYI A;  3EUA A;  3CF5 F;  5M3F J;  3JAM Z;  4UB8 C;  3T1B A;  4UNO A;  2Z99 A;  1P4W A;  4BXU A;  2CQX A;  5FGM A;  1WJ5 A;  4PZJ A;  5LFA A;  1VQ7 I;  4BXX J;  2WC2 A;  5K7Z A;  1OCZ H;  2BBY A;  1MJ9 A;  2DMP A;  3QQA A;  3WU0 A;  4HNV A;  3QRF F;  5K5Q A;  4XLA A;  4CIC A;  1O3R A;  2IGK A;  1BL0 A;  2UV1 A;  3F6O A;  2R5Y A;  1MNM C;  3C1D A;  1FYK A;  1D5V A;  5TRD A;  2QUF A;  3OYJ A;  3BTL A;  1WJA A;  2IA2 A;  3S2W A;  4DGW B;  2IS2 A;  2M5W A;  2R5Z A;  3JR9 A;  2XAU A;  3LSR A;  3BJO A;  1AKH B;  1XG1 A;  3S14 J;  1SFE A;  2XB5 A;  3FXL A;  2HEO A;  4IHV A;  2DMU A;  3V7S A;  2E5Z A;  3BCA A;  2DU9 A;  2VAS A;  2ZME B;  1UHM A;  1PP8 F;  4BU2 A;  2XHK A;  3W6V A;  2QKL B;  2LOO A;  3LFU A;  2GIV A;  2YU9 J;  4G6Q A;  3KZI C;  3CDH A;  1WKM A;  2EIL H;  3S3M A;  3ISP A;  4PFP A;  1AHD P;  4XQF A;  2NS7 A;  4XKC A;  2WY7 Q;  1VQN I;  2QGU A;  3WU1 B;  5FKN A;  3LAP A;  3DCF A;  2EQR A;  5F0H A;  1R6R A;  4M9Z A;  1X3U A;  2PMZ A;  1T38 A;  1Q1H A;  1LFP A;  2ADU A;  1JGS A;  2CG4 A;  5JI6 A;  4UV8 A;  2BY3 A;  2K4J A;  1ZQ3 P;  2Z5U A;  2CUZ A;  4ON0 A;  5DCF A;  1S7A A;  3H36 A;  3BTI A;  4OAY A;  2DOD A;  5E1Z B;  1ZTR A;  1WJC A;  2Y2Z A;  3V42 A;  5FB2 A;  3J80 Z;  1NH3 A;  2K02 A;  5C4X J;  5IPA A;  4IRI A;  3HKZ N;  4UY8 I;  3M8E A;  3OYB A;  3GTK J;  2H6B A;  1RI7 A;  2NS0 A;  3IH3 A;  4KIT B;  2V1X A;  1D0X A;  5HS9 A;  1BI1 A;  3RKY A;  2V1N A;  5J3L A;  1K6O A;  3I55 I;  2NRA C;  1P2F A;  3K2Z A;  3CZ6 A;  4LIV A;  1PUF A;  4IQ4 A;  4M71 A;  2A3S A;  3EUH A;  3H0D A;  2E2J J;  2VIX A;  3GO5 A;  4EVI A;  1VQP I;  4BBS J;  2L9N A;  5IT9 K;  2LVS A;  1TWF J;  4HQM A;  1F36 A;  3A02 A;  4OAZ A;  3H5N A;  2GOX B;  2Y31 A;  1D3Y A;  5C44 J;  3P9C A;  1Z3X A;  2UXN A;  2O61 A;  3S2H J;  4CA0 A;  2FQ3 A;  4C2M J;  4A3F J;  3WGG A;  4UHT A;  4Z6Y A;  1T08 B;  1XX5 A;  4BHP A;  1H89 C;  2VBY A;  4C3J J;  1ZGW A;  3OSG A;  1XDU A;  3MN2 A;  2EZL A;  4G9Y A;  4M3G A;  4S04 A;  3CQZ J;  2M4K A;  2F5V A;  3DBR B;  2DW4 A;  3Q0W A;  3G1O A;  4TV7 A;  1LDJ A;  1H9G A;  2CW0 F;  2GQQ A;  2V6C A;  2BEO A;  1FJL A;  4J19 A;  1V5E A;  1ONV A;  5LRR A;  5GTH C;  3HKZ A;  3ULQ B;  4KYW A;  1QO0 D;  5J4V A;  2IGM A;  1JT0 A;  2BE5 F;  1U5T C;  4OU0 A;  1YIT I;  5CPR B;  2NNY A;  2V79 A;  4F52 A;  3FK6 A;  3UR3 C;  1MBE A;  2XF7 A;  5LEK A;  3DV8 A;  2Z33 A;  2CRG A;  2EZI A;  1G4D A;  1E17 A;  2A6T A;  2LSO A;  3DPT A;  4XRS G;  3LSM A;  3S16 J;  5FLM J;  3ABK H;  1OIS A;  4KIG A;  1YHQ I;  4PSX A;  3K1P A;  2FQ4 A;  3A1Y A;  4JK1 X;  4LIU A;  4O6J A;  5E1X A;  3F6V A;  4MHG A;  1NK3 P;  3P5J A;  3HPG A;  1BM9 A;  3TDU C;  3L2Q A;  4BQA A;  3ASN H;  3OIQ A;  2EWN A;  1DP7 P;  2BHZ A;  1BBY A;  3WTV C;  3QP6 A;  4JP0 A;  2CQN A;  3M8J A;  3HOW J;  4GCV A;  4P9F A;  2MH2 A;  4U7B A;  4M6V A;  1W0T A;  2KPM A;  2YX7 A;  5KK1 A;  2LTP A;  1MBJ A;  3A01 B;  1HA8 A;  4U7D A;  2VBW A;  3OYF A;  1Z6R A;  4I6Z A;  3CTA A;  3RIR A;  2Q2E A;  4RAG A;  4DW6 A;  5M5X J;  3KP2 A;  1V5F A;  2DO7 A;  3S1R J;  4S0H B;  3GZ5 A;  1YJN I;  2DBB A;  2RNG A;  1JKR C;  1ORK A;  2MBF A;  2CV0 A;  2F5D A;  1YW8 A;  1A35 A;  3DXJ F;  2R5Y B;  3DFG A;  3ASO H;  4R8H A;  1R9T J;  2ID3 A;  1ODD A;  2VQH A;  1PP7 U;  2ZNZ A;  5LEJ A;  2YX4 A;  3VSL A;  4E7L A;  2K85 A;  2FE3 A;  3GCM A;  1FT9 A;  3CCR I;  1EH8 A;  2Y69 H;  1FEX A;  3LSH A;  4BJT A;  4CH7 A;  4MTE A;  1Y39 A;  4B47 A;  1P6R A;  3ABL H;  3QPS A;  2FBH A;  4ZZL A;  1ZG5 A;  1HKQ A;  2A5W A;  2DN0 A;  1XSV A;  2DOA A;  1U8B A;  2GXG A;  3GBG A;  2D45 A;  4IL6 C;  2HPM A;  3HC7 A;  5K7F A;  1IG7 A;  3ZN0 A;  2A69 F;  3ABU A;  5K1Y A;  3GX4 X;  1R00 A;  4HLY A;  2K7L A;  4HW0 A;  1YLF A;  2KRC A;  4BEH B;  3GXO A;  1QNT A;  4XLH A;  3NAR A;  2WAQ N;  3KP7 A;  3O8H A;  4PJL A;  2P5K A;  2B7E A;  4FAS D;  2LKX A;  3GTP J;  2F48 A;  2XKP A;  2ACJ A;  2KZV A;  4U0V A;  2WWY A;  2HR3 A;  1FP1 D;  2B9S A;  1R5H A;  3GFI A;  4OMZ A;  2E7X A;  1QPI A;  3FWE A;  2CV2 A;  2ESH A;  2XGX A;  1OQY A;  4NHJ A;  3KET A;  4A6E A;  4FE7 A;  1FTZ A;  3HUG B;  5LD2 C;  1QQI A;  2Y9Y A;  5EJC A;  3R61 A;  1E3O C;  2ZXI A;  2ISZ A;  4YFX F;  3I9V 2;  3WG9 A;  3BR5 A;  3LQR A;  3ZQL A;  4F7Z A;  1Y0U A;  4AM3 A;  1YIJ I;  2XPW A;  2JPC A;  2P7V B;  3OR2 C;  5CVV A;  2ZKZ A;  4B3X A;  1TWG J;  1X1P A;  1KU3 A;  2V7F A;  2AS5 F;  3R60 A;  1K4S A;  2JK3 A;  1MMD A;  3JRI A;  3BOQ A;  4O3M A;  2JJ7 A;  3H1C A;  4W97 A;  4C2U A;  1D1C A;  2WAE A;  3KP6 A;  2R7S A;  4OIN F;  2NAZ A;  4L5I A;  5J8F A;  1Q1V A;  4BDY A;  1MDM A;  4BGD A;  3IKV A;  4G7H F;  3EUH C;  3OOP A;  4X1E A;  4LLG F;  2EFW A;  4A3J J;  4U0Y A;  3Q3S A;  2XAH A;  3MZY A;  2Z9O A;  1Z1D A;  2WTE A;  3GEZ A;  4KMU X;  2M9H A;  2QA4 I;  2M2E A;  1ZEL A;  2ISY A;  2HZT A;  4UB6 C;  5CVU A;  1JKP C;  2LLK A;  4QTR A;  2E71 A;  3AG2 H;  3F8B A;  1IXC A;  1K78 B;  3W2V A;  4DBQ A;  4XRM A;  4FET A;  1QZY A;  4P5O A;  2DFH A;  2ZFW A;  3LST A;  1KU2 A;  2RQP A;  3FXM A;  1XMX A;  3PFY A;  5EEH A;  2W24 A;  3M3Y J;  3M1E A;  2X51 A;  2OPT A;  3W2A A;  2EZK A;  4IHS A;  1UAA A;  1YI2 I;  1OYY A;  4M9X A;  3EUK L;  2QKM B;  1ZH5 A;  3HOV J;  3M07 A;  4RA2 A;  2OCC H;  1RZ4 A;  4WF2 A;  1MDM B;  2M34 A;  3FXQ A;  1WH5 A;  2GA2 A;  3AFH A;  2ELJ A;  3J81 K;  2XGC A;  3FXJ A;  2O8K A;  2W4S A;  2LG4 A;  3MMY B;  3G73 A;  4BXF A;  2LD5 A;  5HOD A;  2K40 A;  2VJJ A;  3W3C A;  2W25 A;  3ZPL A;  1JTX A;  2DT5 A;  5J40 A;  2MYS A;  1Y0N A;  3MKY B;  1HSJ A;  3F8C A;  2P81 A;  3VYT B;  1YRN B;  1K78 A;  1FSH A;  2GXB A;  5E3L A;  3LL7 A;  3QOE A;  1ZK8 A;  5J6X A;  1X2N A;  3WGI A;  4KUM A;  1Z6T A;  1LNW A;  2X1D A;  2NVU B;  5HLG A;  1IXS B;  4RB1 A;  2M0M A;  3TBI A;  4OMY A;  2OF7 A;  3HM5 A;  2GAU A;  3HRM A;  4MNU A;  5D5V B;  1UEL B;  1BC8 C;  1YX3 A;  2FJ1 A;  3PUF A;  4OOI A;  2VT3 A;  1Z05 A;  3FZV A;  3ZMD A;  2H94 A;  2HOT A;  3COA C;  2NOG A;  2QQB A;  2X6O A;  3FDY A;  4NC8 A;  5KHD A;  4HBL A;  1AU7 A;  1OR7 A;  1XGN A;  4E6K G;  3DKY A;  2EH3 A;  5F0F A;  5DUK A;  4L9V A;  1ZGJ A;  4CHU A;  1MBF A;  3D1N I;  2JA5 J;  3PIO F;  4NNJ A;  2PEX A;  4ASN A;  3TOB A;  1LKX A;  4ESF A;  4OWR B;  1RKT A;  1MNE A;  3WTY C;  1M1E B;  3E97 A;  2DDB A;  1UZC A;  2L0K A;  3GF2 A;  1STZ A;  2FOK A;  5HOO A;  4RLQ A;  1X1D A;  3LA2 A;  2JVG A;  1D8K A;  2MC3 A;  1JT6 A;  1PVE A;  2G7U A;  2VE8 A;  4XN0 A;  4D0P A;  2XRL A;  3H35 A;  2QWW A;  1TTY A;  3BTJ A;  1X19 A;  1I1G A;  1OCR H;  2DPD A;  2XRN A;  2CW8 A;  3S1M J;  4LLN A;  3CF2 A;  4XL9 A;  2B0L A;  4NQW B;  5DCM B;  3E1S A;  3BR6 A;  4ESJ A;  4JOM A;  4AUX A;  1MND A;  3ML6 A;  2KT0 A;  2MGQ A;  3W2W A;  1YQA A;  1RUO A;  3KE2 A;  3OOU A;  3OY9 A;  1QPM A;  4HX4 A;  5DM6 F;  4EJT A;  5IT9 Z;  1S3J A;  2XPU A;  1MMG A;  2QM3 A;  4RB0 A;  2HKO A;  5DDG A;  3HOY J;  2VT2 A;  1MSE C;  4J01 A;  3S17 J;  3H9Q A;  4P9U A;  4A3M J;  3G71 I;  3L2V A;  2NVQ J;  3HEF A;  4IO9 F;  1W7P B;  2VXD A;  4HA8 A;  1B59 A;  1G3Y A;  3HG9 A;  3P9I A;  2DOE A;  4KT5 C;  5J1Y A;  3I64 A;  2PN6 A;  5F64 A;  2ZJR F;  2KQR A;  3U21 A;  3GFM A;  3K70 C;  3IC7 A;  1IXR C;  2OD5 A;  3HHG A;  5E18 F;  4QPO A;  4JBA A;  4E7K A;  2V9K A;  2RN7 A;  2IA1 A;  2OTL I;  1HCR A;  2IT0 A;  5GPC A;  4CDG A;  3K4M A;  4BAY A;  2W48 A;  3T0Y A;  5JHU A;  4U0W A;  3D5R C;  1L0O C;  5JFR A;  2R4G A;  2M7B A;  5D4S A;  1GXQ A;  5GP9 A;  3AL0 C;  1J9I A;  5LGT A;  5LHG A;  3F0C A;  1IC8 A;  3QAH A;  1Y6I A;  1OCO H;  2BY1 A;  2KLO A;  2L4A A;  4LOC A;  3K2A A;  2EFP A;  3IH2 A;  4ENK A;  2DA3 A;  1G3S A;  1OMI A;  4A0Z A;  1U8R A;  5FLX K;  2FA5 A;  4MQ9 F;  2VPL A;  4CSW A;  2KDZ A;  4OIR F;  2Q8K A;  3W6J B;  3DKX A;  2HVS A;  1NK2 P;  1EV7 A;  2XGD A;  3PL8 A;  2W57 A;  4FHT A;  5E3M A;  3EYI A;  2R7V A;  5E3O A;  1VZ0 A;  5ILU A;  3OYL A;  5H6Q A;  4D5C A;  4EJV A;  3GTM J;  2F2E A;  2QQA A;  3CJN A;  1I5Z A;  2JSP A;  1KA8 A;  1YJW I;  3WTW C;  1HXD A;  2XRO A;  3JAM K;  1XCV A;  1YW7 A;  4O5V A;  1ACI A;  1R5G A;  5F0C A;  4Y4R A;  4EM1 A;  3KEO A;  2HI3 A;  1FY7 A;  2DLL A;  2EB7 A;  2P6S A;  2PMU A;  4WCG A;  1T2K A;  3K6G A;  2M30 A;  4YRV A;  2PMZ N;  4KT6 A;  5EYR A;  2E34 A;  1XMK A;  1NG7 A;  3BG6 A;  1W5S A;  4MIM A;  2ZXW H;  2F5F A;  2GWR A;  1JJ6 C;  3VOE A;  1WVR A;  2ME0 A;  1QA6 A;  4HAM A;  2VJ4 A;  1ITY A;  5HVQ C;  2EPF A;  4YIF A;  3ZQC A;  1ZR4 A;  3K4B A;  2K86 A;  3FF5 A;  3VB2 A;  1EF4 A;  2VL8 A;  5C3E J;  3PIP F;  2NVY J;  3CP2 A;  3M7G A;  3OYC A;  1U3E M;  4XSX F;  3L2R A;  5FD5 A;  2CUJ A;  1AA7 A;  1DU0 A;  1LEB A;  3F8M A;  3EET A;  4RGR A;  4ENM A;  1HOM A;  3C3W A;  1LJ9 A;  1HF0 A;  1CF7 A;  3O6B B;  1OCC H;  1MIJ A;  3SXY A;  1D0Z A;  2YPR A;  3OYE A;  2L2O A;  2BYV E;  2QBY B;  2H09 A;  3OMY A;  1SVO A;  4D9J A;  1V54 H;  1W5T A;  5HLH A;  2ZXH A;  3PNV A;  5EZG A;  3FX3 A;  3F21 A;  2HTS A;  4EJW A;  3NWS A;  3U1D A;  1Y8Q B;  1SMY F;  4XLP F;  1X4O A;  1XN7 A;  4CXF A;  3CLO A;  5AIQ A;  5J47 A;  3UNG C;  1GV5 A;  4BL0 B;  4CYD A;  1T6S A;  1IGN A;  2CSO A;  1BI2 A;  3R0A A;  3ZMT A;  2YUS A;  1IF1 A;  3ZQ7 A;  4UUS B;  1MJB A;  2R3S A;  2VE9 A;  3BG9 A;  3F22 A;  1CGP A;  2X48 A;  4RGX A;  2P4W A;  2CMP A;  5D5U B;  3OYH A;  2FU4 A;  5D8L B;  5LBQ A;  1K6Y A;  3CCM I;  2X6W A;  5EDN A;  3OS2 A;  3CCV I;  4FE4 A;  1BR2 A;  5DCM A;  2KIQ A;  2KIU A;  2O03 A;  1O3T A;  3P9K A;  4ZZD A;  3CJQ B;  2E1C A;  2VOP A;  1EH6 A;  2W84 A;  3LSP A;  2VOO A;  1OCP A;  2E36 A;  3H9G A;  3IWF A;  4AVP A;  3OIO A;  2F5C A;  1DUX C;  2G0E A;  2K4B A;  3CCE I;  4PSW A;  3ZMV A;  4XLF A;  4BH9 A;  1YFH A;  4KN7 X;  2LH9 A;  4L9T A;  4I0A A;  2FML A;  1XTA A;  3VEP A;  4EJO A;  4CYC A;  1HW5 A;  2B63 J;  4II2 A;  1ZKG A;  5J1U A;  2COB A;  2XV4 S;  5ICG A;  1W0U A;  3CME I;  4ZTJ A;  4EQQ A;  1HDD C;  1Z9C A;  3FK7 A;  3OYK A;  3U2R A;  3KYL A;  4Y3O A;  2LKS A;  2JTV A;  5IP6 A;  1QVU A;  2HPI A;  3PUB A;  4WXH A;  1UJ8 A;  3HTU A;  2M87 A;  3TDZ C;  4RS8 A;  1YE9 A;  4C30 A;  1PDN C;  4EM0 B;  2JA8 J;  3E5U A;  2ICW G;  1R22 A;  4E7Z A;  3ZXS A;  2K9L A;  2VKD A;  1ZRF A;  2PJR A;  3BJA A;  5LGU A;  3HSE A;  2FOW A;  1HC8 A;  1T33 A;  3HOZ J;  1ZLJ A;  2PQ8 A;  3WHC A;  3VYS B;  2L02 A;  3DTE A;  3DWL E;  3FIS A;  4MFD A;  4CCM A;  1T95 A;  1IN6 A;  2P8T A;  2IS1 A;  3DEW A;  1ETO A;  1O7F A;  3F72 A;  4X6A J;  2KIM A;  3ZQH A;  2X1C A;  2DYR H;  2WV1 A;  3ELK A;  3WHB A;  4L9J A;  2FMY A;  2QLZ A;  3GFJ A;  3TW7 A;  4XLN F;  2MLG A;  3BP8 A;  2ESN A;  2HOS A;  3PM1 A;  9ANT A;  1G2H A;  1UHS A;  2VQC A;  5HLT A;  2DYS H;  5D8K B;  1BR4 A;  4AYB A;  1VQM I;  1H88 C;  2XF5 A;  4BJ6 C;  1H8A C;  2VKE A;  2A05 A;  1JJ8 C;  3U9G A;  1XB4 A;  3T8T A;  1R4N B;  3SDG A;  3WU2 C;  5JHF A;  1FBS A;  4K2E A;  5CKT A;  2J5O A;  3ABM H;  3I56 I;  4AWX B;  1R23 A;  1QVT A;  3LMM A;  4BQN A;  5DV5 A;  2PJR B;  3DTI A;  2XC7 A;  3I3L A;  3DPL C;  1FTT A;  1A31 A;  3IV5 A;  3U1K A;  3DBL B;  4E4H A;  5A2Q K;  3WTT C;  4U88 A;  1TQI A;  4PJM A;  5HDK A;  2MD0 A;  1S72 I;  2XAQ A;  1KGS A;  4DZP A;  4C2T A;  3R6S A;  4N9I A;  2WAQ A;  2OBP A;  5CJ9 A;  1ZHF A;  4YIR X;  2X0L A;  1HKS A;  2NS8 A;  1Y1W J;  4EEF G;  1J7K A;  3RPQ A;  3CUQ C;  1TW2 A;  3OYG A;  3CDL A;  2L5Q A;  3E6M A;  5JR3 A;  1BJZ A;  4P55 A;  2NXN B;  3CP8 A;  4IQJ A;  4IRG A;  2ME6 A;  4HDU A;  3DLA A;  1O57 A;  3D5S C;  4HV5 A;  4KDP A;  3HRS A;  3TOA A;  3TL4 X;  4YG2 F;  3DEE A;  4A3E J;  2P5V A;  1I6H J;  1QRY A;  3ZMU A;  4RAF A;  3ZP5 A;  2Z16 A;  4EV0 A;  1U2W A;  5FKK A;  2RVC A;  3TGN A;  1A6I A;  3JSP A;  4UUS A;  4H4K C;  2DJN A;  1WGX A;  3QU3 A;  2E2I J;  3KLN A;  2GZW A;  4S05 A;  1GVJ A;  4WWC A;  4LMY A;  1PUE E;  1L3L A;  3ERM A;  1FYM A;  5GAH J;  4M3F A;  5DD8 A;  2OQG A;  4XNF A;  4OIO F;  1GDT A;  1ZRC A;  1QGP A;  5TIS C;  1F43 A;  2DA2 A;  3R0J A;  5KAF C;  4ZTF A;  2BY0 A;  4PGH A;  3WOD F;  2O7O A;  2GXA A;  2ZBK A;  2LF7 A;  1Y8R B;  1B9M A;  3QPH A;  3LFK A;  1FZP B;  3ZQF A;  2XAF A;  2HDC A;  5L3B A;  2H8R A;  2CU7 A;  1ZRD A;  1YW9 A;  2XAG A;  1JHH A;  5HNF A;  2K9S A;  3JRA A;  2FBK A;  1JGG A;  2VQG A;  2XPV A;  5FFZ A;  4A5M A;  4BDZ A;  2ELH A;  2TDX A;  4NC7 A;  2CWE A;  1IN5 A;  4HLX A;  2DPU A;  3EDP A;  4CZC A;  2STT A;  4UUV A;  3BTC A;  3WTS C;  3E5X A;  2EV6 A;  2IVM A;  5DEQ A;  2PI0 A;  1FSE A;  2DFE A;  2DJI A;  1HST A;  1QHG A;  3TP3 A;  4EJU A;  3DLL F;  4B8X A;  1IJW C;  4MEY F;  4Z2Y A;  1QHH D;  5KAI C;  1J75 A;  3SZP A;  2DCE A;  3CCQ I;  2NYX A;  3PO2 J;  5FRN A;  4II3 A;  1SD5 A;  2G7H A;  2XDV A;  3QYB A;  3REO A;  1OYW A;  5EZH A;  1MBG A;  3S32 A;  1FMV A;  1FOW A;  3AG1 H;  1TT5 B;  4PJJ A;  5LRS A;  5DS9 A;  4B09 A;  4BY1 J;  3GFL A;  2E7W A;  4RLF A;  1I50 J;  1MSF C;  3BLY A;  2LY1 A;  2PMH A;  5F04 A;  2PBI A;  2NNN A;  2UZK A;  1B8I A;  1UFM A;  4IEJ A;  3HZJ A;  1IRX A;  2ETH A;  2UXX A;  3CC4 I;  2EIN H;  1U78 A;  2ZSH B;  2GBY A;  2EIM H;  3BQY A;  1Z3Y A;  2RC4 A;  2BZT A;  1BOB A;  2DI3 A;  2IP2 A;  4AC0 A;  1H0M A;  1PYV A;  1JKQ C;  1IZ1 A;  2E2H J;  3V4G A;  4HDV A;  1P7J A;  4RB3 C;  1VQK I;  4I09 A;  3ZMS A;  3OL4 A;  3MQ0 A;  3S1N J;  3SQN A;  3MCZ A;  3A0B C;  2Y30 A;  2BVL A;  2DT7 B;  5A2Q Z;  2GIZ A;  3L00 A;  3L1P A;  1J0R A;  2M8E A;  1YS7 A;  1BN5 A;  3E3V A;  3ZQQ A;  3J80 K;  1YO5 C;  3BR1 A;  1MD0 A;  2P6T A;  4HEA 2;  2VBZ A;  1D8J A;  2FNA A;  4KFC A;  2QSG X;  1U9O A;  3HXL A;  1SMT A;  1T39 A;  1KZH A;  1GVD A;  3HBL A;  4JX5 A;  3UKG A;  1GXP A;  5LGN A;  2WAD A;  3J7Y J;  3DEU A;  4LK0 F;  4M6X A;  3NQO A;  1X1B A;  2KFD A;  2V26 A;  4N4O B;  2MFZ A;  5D4R A;  2D1V A;  2OU2 A;  2K5C A;  2DOF A;  5C4J J;  1W4M A;  2XVC A;  3H5A A;  1JHF A;  3OYN A;  4L9N A;  1HQC A;  5CVI A;  3BPX A;  2LY2 A;  4RGU A;  4BS9 A;  2YR2 A;  3JCU C;  1OJL A;  1R1U A;  2HQN A;  1V55 H;  1N25 A;  3E7L A;  2AQF A;  2AHQ A;  4RDU A;  1AKH A;  2EK5 A;  2IW5 A;  4R79 A;  3N4M A;  3K1M A;  3PNT A;  5DD4 A;  2ZJP F;  2Y0S A;  4ZYE A;  4E70 A;  1BIB A;  4UVA A;  1VQ9 I;  2F4O B;  2O0Y A;  3FXU A;  3CUQ A;  3MFK A;  4LG3 A;  2DFF A;  2F5E A;  3MKW B;  4AYB N;  3FM3 A;  3I59 A;  2A61 A;  1IRF A;  2BW3 B;  2WBM A;  3BPV A;  3B02 A;  4GDF A;  6PAX A;  3GLX A;  4LG0 B;  3V7C A;  2QZ8 A;  3GTJ J;  3QYF A;  1OLT A;  1HDP A;  2M4G A;  1BI3 A;  2QYO A;  5M3M J;  1YS6 A;  2LMD A;  4Q4Z F;  2WAF A;  1MMA A;  1WI3 A;  3DKW A;  3DTK A;  5F08 A;  4LFU A;  3PFI A;  1LFU P;  4IPA A;  4B43 A;  4KIS A;  1R5I D;  2BV6 A;  4ZDO A;  2YS9 A;  1Z77 A;  5LHH A;  1T56 A;  5EGO A;  3BZK A;  2ZFU A;  3K4L A;  4EGZ A;  2ZNY A;  2BXY A;  2K9N A;  2E35 A;  1YIO A;  4BJ5 C;  3ZN1 A;  3GTQ J;  1V4R A;  3B6A A;  5HLI A;  3HTS B;  2FBI A;  4X0G A;  2IGN A;  3FKI J;  2KIF A;  1DQU A;  1UCR A;  3GUD A;  4L5E A;  3G2B A;  4HF1 A;  3H0G J;  2HQ5 A;  1PUF B;  5F27 A;  2W7N A;  1J5Y A;  3RZO J;  2QQ9 A;  3SYT A;  3TO7 A;  5E1W A;  2Z3Y A;  4M73 A;  1DDN A;  4NC6 A;  2ZSI B;  1WWX A;  1OCT C;  2JWT A;  2QQ8 A;  2M1B A;  1E3H A;  4LB6 B;  2LFB A;  1SC7 A;  3BR3 A;  2RNJ A;  1WRJ A;  2DT6 A;  2BVM A;  1J59 A;  3ZMZ A;  4AIK A;  3SZG A;  4QSH A;  3HHH A;  3NEU A;  1DGR M;  3I0T A;  3CCY A;  4A12 A;  2Y9Z A;  2R7U A;  3RYR A;  3ECO A;  1TNS A;  2DK8 A;  4A0X A;  2HDD A;  3DQV C;  4FQG A;  4A0Y A;  4I2O A;  4BNC A;  4BAC A;  3ZR8 X;  3HUG A;  2LNB A;  4XOR A;  4ZDL A;  1RR7 A;  2QCO A;  3HYI A;  4C9Y A;  1RRJ A;  1MW7 A;  4A3L J;  1Z21 A;  2L4M A;  3CMY A;  3BG3 A;  1JUM A;  3RYP A;  4ZYA A;  4RAZ A;  1XGM A;  5IYC J;  4CGZ A;  3BR0 A;  2CQQ A;  1TWH J;  3PQJ A;  4IOA F;  4DYC A;  4G12 A;  3CMM A;  4I01 A;  2Y0M A;  5CLS A;  2R7X A;  1OFC X;  1S29 A;  3RCO A;  4KIF A;  1FOY A;  4I76 A;  4C3H J;  2HOA A;  2XUB A;  4I02 A;  1FC3 A;  2ZC2 A;  2R7Q A;  1TT0 A;  2PG4 A;  2MG4 A;  2QVO A;  3C2G A;  4LJZ F;  1TWC J;  3BY6 A;  1LDD A;  4BE1 A;  1QU3 A;  2BOL A;  3CC2 I;  3KYC B;  1RIO H;  1GLN A;  2E1M C;  4RMN A;  1NTC A;  2OA4 A;  3LOC A;  3T8R A;  4XR6 A;  1I39 A;  1VI0 A;  5ICE A;  3S3N A;  5FKL A;  1D1B A;  5DYM A;  3CD6 I;  1G3W A;  3WE3 A;  1RNL A;  4GYI A;  1KON A;  1JTY A;  1VQ8 I;  3L2U A;  3IKT A;  4LD5 A;  2O3F A;  3I71 A;  3M8F A;  4L0Z B;  2R7W A;  4FX0 A;  3KYD B;  3M1C A;  4XON A;  1GT0 C;  4KNY A;  1O7L A;  3MVP A;  5EG0 A;  2FSW A;  2L7F P;  1WHU A;  5BPI A;  5CVR A;  2P7C B;  1XCB A;  4G6D A;  1RR8 C;  3SFZ A;  5GAG J;  4WXD A;  1YTY A;  2OCE A;  1FIP A;  1SD4 A;  3EPZ A;  4A3B J;  2JA2 A;  2XAJ A;  3G6E I;  4B1R A;  4G7Z F;  1VQ4 I;  4N9H A;  2H8W A;  5E8G A;  4XN3 A;  4Y13 A;  1P92 A;  4XM3 A;  5BPD A;  5JLX A;  2M3A A;  2VJI A;  2MC4 A;  3VFZ A;  1YOV B;  2M8G X;  2OC6 A;  1HLV A;  5FRM A;  2FXA A;  1BR1 A;  3DBH B;  1FIA A;  1VQO I;  4ETS A;  4HNT A;  4BE2 A;  1FP2 A;  1X58 A;  1J2X A;  3F23 A;  4PCQ A;  2L9S A;  3MAJ A;  1IRG A;  2IRF G;  5BS6 A;  4IHW A;  1GUU A;  5IYD J;  3RPU A;  2PFB A;  2LDU A;  2WA0 A;  2DTZ A;  4UUT A;  3CC7 I;  1XS9 A;  4N0B A;  4A3D J;  2K3P A;  5L3C A;  2BHY A;  3GYH X;  3I4N J;  5ED4 A;  3JRD A;  1WI9 A;  4G8X A;  3CO7 C;  1BW6 A;  4MLO A;  1OR7 C;  3GW2 A;  1WJB A;  4FIS A;  3LA3 A;  4MQV A;  4BHC A;  3LSI A;  3K9T A;  4HSR A;  1MZB A;  1LE8 B;  3K1N A;  4MEX F;  4B4C A;  5EF6 A;  1B72 B;  2V9V A;  2LBF B;  1TBX A;  2KRF A;  2ZJQ F;  1ZAO A;  2Y0S N;  1A5J A;  1LFB A;  1I3Q J;  1NHA A;  1DU6 A;  5FD6 A;  2HU9 A;  3TKY A;  1WQ2 A;  3CJR B;  4XOT A;  1KQ9 A;  1N75 A;  3V7R A;  3CJT B;  3CMA I;  2HDW A;  5FRO A;  3N97 A;  4KN4 X;  3L7W A;  3S1Q J;  4OIP F;  3LAJ A;  1E2X A;  5E20 A;  3FIW A;  1XGS A;  3HSR A;  4ENJ A;  3E6B A;  3S93 A;  1TC3 C;  3RQ4 A;  4HST A;  3WTZ A;  3ZQG A;  4MO7 A;  5FKM A;  3FHN A;  2LRD A;  2M0C A;  4EMS A;  3GME A;  4OIQ F;  3PSF A;  2YU3 A;  4ZH4 F;  2XF6 A;  3OV8 A;  4YEL A;  2KRH A;  1V3F A;  5D6E A;  4XBF A;  1FLI A;  2XGE A;  1UHW A;  4IVN A;  2VKV A;  2EV5 A;  1BA5 A;  2X1E A;  1W7P D;  2BGC A;  1O4X A;  2RGV A;  4DYR A;  5GAE J;  4HX8 A;  1ZGA A;  1JUP A;  2JA7 J;  3FXK A;  3OYA A;  5H6R A;  3A4C A;  2H1K A;  2IS4 A;  2R7Z J;  1I1S A;  3LQQ A;  4HX7 A;  1W7P A;  4LK1 F;  4CCO A;  1TWA J;  2EIK H;  3I54 A;  4IHX A;  3DP7 A;  1BJA A;  2DA1 A;  4XKB A;  4HQE A;  2KJC A;  3K7A J;  1WJF A;  1V5G A;  1R1T A;  2HOE A;  3G3Z A;  4ZYG A;  2AQE A;  5ILV A;  2HYJ A;  2DA5 A;  4GYG A;  5ICF A;  4CCN A;  3KCC A;  4ZYH A;  3FMQ A;  4FCY A;  1DPU A;  1IAW A;  3C18 A;  2ECC A;  3DPU A;  3HGG A;  4EGY A;  5HNH A;  4QIW N;  1ON2 A;  2L9R A;  2DK5 A;  2X9D A;  4Q48 A;  2EFO A;  4AID A;  5IT3 A;  3RJP A;  3TP0 A;  3VYR B;  1HW2 A;  3A0H C;  2E1M B;  4A2U A;  2Y75 A;  5LLQ A;  4EAT A;  2FUG 2;  3ERE D;  4D1Q A;  2XB0 X;  1FBQ A;  5FKO A;  3G1L A;  3QOD A;  4BYY A;  1PJR A;  3RI4 A;  2LC2 A;  1ZLK A;  4A69 C;  4E7J A;  2CGP A;  5B3S H;  5KCM A;  4IX7 A;  3HRU A;  3K4N A;  1TNT A;  5DUI A;  2OQR A;  1BI0 A;  3ZOB A;  4PUS A;  1UG0 A;  2OUM A;  4W1U A;  4Y52 J;  3ZRG A;  3WTX C;  4GXO A;  1KU9 A;  3V8L A;  2XAS A;  3HGY A;  5J1R A;  4B44 A;  3BQZ A;  3ZCO A;  3KIO A;  2DTR A;  1IV8 A;  1SVL A;  4RAY A;  2HGC A;  3B73 A;  3JRE A;  4ZYD A;  3PJR A;  1POG A;  3AG4 H;  3X2Q H;  2LF8 A;  1ZN2 A;  3QP5 A;  2PLY A;  4DNC A;  4XMY A;  2ECB A;  5L3G A;  1FMW A;  3HOX J;  2R0Q C;  2GLO A;  2VC1 A;  1U6G A;  3T5X A;  3ZQI A;  1U5T A;  2BY2 A;  4PK4 A;  2CUE A;  1E3P A;  3R4K A;  2X6Y A;  1SAU A;  5IY5 H;  3RPU D;  1IN7 A;  3W6K B;  1IUF A;  3BCB A;  3MWM A;  1WSU A;  3OYI A;  5KVR A;  2EBI A;  1MBK A;  4ZC3 A;  4IJA A;  3FMR A;  4YII A;  1ZYR F;  1I6X A;  4D7M A;  4MTD A;  4B48 A;  1R7J A;  4HZF A;  4UV9 A;  3HJE A;  3D5L A;  3BWG A;  2K27 A;  1FPQ A;  4N4N B;  2LP0 A;  1FOK A;  5L3D A;  5BMZ A;  1RPW A;  3F8N A;  1UMQ A;  1USS A;  3CES A;  2DFI A;  3TO6 A;  1ETY A;  2IEK A;  2EFN A;  5L3E A;  3RKQ A;  2ZJ2 A;  2CQ7 A;  2QEX I;  2KMU A;  5HS7 A;  3O8G A;  2IXS A;  4ESB A;  2CH0 A;  3FKJ A;  2JRT A;  1ETW A;  5IP9 J;  4DJA A;  3J7Z I;  3K4K A;  1MKM A;  2OZ6 A;  3I5U A;  1IO2 A;  1TQP A;  1Z91 A;  4L5J A;  3ZGK A;  3SJM A;  1UG2 A;  3K10 A;  4PFO A;  3I59 B;  4GO1 A;  4XSZ F;  4FTH A;  3WE2 A;  2R5Z B;  3ONQ A;  1AOY A;  2HQA A;  1QBJ A;  1N77 A;  1O3S A;  2DQR A;  2BXZ A;  1R4M B;  1CQT A;  5JLW A;  1P4A A;  4U87 A;  3H92 A;  2IAI A;  2V9P A;  2JN6 A;  3IRQ A;  1LUJ B;  2FD5 A;  3JSO A;  2KJB A;  5FO5 A;  4WK8 F;  4IOC F;  3LWF A;  2M45 A;  1X3Z B;  2CW7 A;  2OTJ I;  2M7A A;  2WB1 N;  2XSD C;  4V2F A;  1ZRE A;  2DA6 A;  4IHT A;  3MZ8 A;  2W85 A;  4BQQ A;  2RAE A;  4JYK A;  2O5R A;  3L09 A;  3BG7 A;  3C7J A;  1W36 C;  4XRS A;  2NVX J;  4I0B A;  3OS1 A;  2CV1 A;  4A5N A;  3L2C A;  4A3C J;  2LY9 A;  2VB6 A;  1ZG1 A;  1LB2 A;  1SFK A;  1UST A;  2R7D A;  1ETQ A;  1RKW A;  2X85 A;  3K70 D;  4IZZ A;  4NUB A;  1X1A A;  1T8I A;  3RKW A;  5HDN A;  1MMN A;  1EH7 A;  1B8I B;  1Z7U A;  1ZG3 A;  1C0W A;  2EJR A;  1S8N A;  5CYV A;  1WFX A;  4Q47 A;  3SHF A;  5K5R A;  1IDZ A;  1FNN A;  1A04 A;  2H6C A;  4NQW A;  5M5W J;  2VI6 A;  2X6X A;  4BUP A;  2OV7 A;  4A3G J;  4DIQ A;  2MSY A;  3B6C A;  3V8J A;  2L7M P;  4M3E A;  3Q9V A;  3D0S A;  2VOD A;  4AU7 A;  3P7N A;  5D6F A;  1Y56 A;  3C2H A;  2OZU A;  5L3F A;  2FX0 A;  3WTU C;  4PJN A;  4DOZ A;  3LSG A;  4E7I A;  3TQN A;  2R7F A;  3L9F A;  4G7O F;  2WB1 A;  4KJZ A;  1S5L C;  2AXL A;  3QWL A;  3BT9 A;  1N78 A;  5F6F A;  3IRR A;  2HFH A;  4AVZ A;  3E0J B;  3K4J A;  3MD2 A;  4JQF A;  5GTI C;  3K4C A;  2D2W A;  4F92 B;  3CCS I;  2V1U A;  3H3Z A;  1ON1 A;  1VF9 A;  1W1W E;  3OR1 C;  2COM A;  3M9A A;  1U9N A;  4JX6 A;  5GAD J;  5M5Y J;  1B1B A;  2LRE A;  1SFO J;  3CUQ B;  4EM2 A;  1KQ0 A;  3J7A O;  5CVJ A;  2A6E F;  5B5E C;  3IAS 2;  2K3F A;  1CF7 B;  1RUN A;  2IJL A;  3TW6 A;  2VQL A;  3AG3 H;  3FXR A;  3SZT A;  2NOJ B;  4Y15 A;  3TO9 A;  4LIT A;  1DGW Y;  3I53 A;  1XD7 A;  2RDP A;  2CFO A;  1XDS A;  2RQQ A;  2EFQ A;  1S7E A;  4DBR A;  3SEZ A;  4Q5S F;  3CCU I;  1A36 A;  1JXS A;  2VC0 A;  2QF7 A;  5EEG A;  3KP4 A;  3RSN A;  3OS0 A;  4Y7N J;  3RKX A;  3IUO A;  2R92 J;  3DU6 A;  4ANJ A;  2DAO A;  2DQL A;  4RGS A;  4Y33 A;  3TED A;  3I4M J;  2A6H F;  1T98 A;  1A6Q A;  5EGO B;  1FOX A;  1Z7L A;  5K5O A;  4L18 B;  1VQL I;  1LVA A;  2VBX A;  4XK4 A;  3AAF A;  1IRZ A;  2H27 A;  3F3X A;  2VUM J;  2CYY A;  2O8X A;  3HDD A;  1R49 A;  2JUG A;  5ERI A;  5DM7 F;  4BY7 J;  4XIC A;  1F4K A;  4D5F A;  1XGO A;  3GWZ A;  2JT1 A;  3CO6 C;  4UXN A;  2ZME A;  5IYB J;  2MA3 A;  4P1W A;  3FHZ A;  1TQM A;  4PGG A;  3JRB A;  2HXO A;  5HS8 A;  1H9T A;  3WGH A;  3JRF A;  5IOZ A;  3HB9 A;  5F1J A;  2Z1D A;  4IRH A;  2EA2 A;  1HBX G;  1XSX A;  4IF4 A;  3CLQ A;  3G4S I;  2HTJ A;  2JUC A;  2EV0 A;  2VJ5 A;  3NAU A;  4P96 A;  1D1A A;  1G3T A;  3F9K A;  3LNQ A;  1F9N A;  4RB2 C;  4PDK A;  3H5R A;  2AXT C;  2EIJ H;  3FMS A;  3H9J A;  2L7K A;  4CYC B;  4YEJ A;  5FLV A;  2E1N A;  3IP4 B;  2L3D A;  4Y17 A;  2CQK A;  3OYM A;  1AWC A;  3KPH A;  3QPT A;  2GM4 A;  2E60 A;  2LBF A;  4XOP A;  1EA3 A;  4XRF A;  5E17 F;  1HW1 A;  3K69 A;  2IBD A;  2NVT J;  3V8K A;  1LE8 A;  2R7T A;  1J09 A;  1U5T B;  4BQO A;  3A03 A;  1XMA A;  2K9M A;  3JTG A;  2LK2 A;  2QEN A;  2JSC A;  1NG6 A;  2EZH A;  3BG5 A;  4G94 A;  1R71 A;  5HDG A;  3GLL A;  1SFX A;  2RKH A;  4F3Q A;  1WZ2 A;  2K9Q A;  2UUZ A;  3KFW X;  4E7H A;  2KP6 A;  1ETK A;  3KEY A;  4ENN A;  4XKV A;  2VON A;  2WY8 Q;  3Q9S A;  2H1L A;  2KKO A;  3H3U A;  2IS6 A;  2MD5 A;  3OYD A;  1YX5 A;  4M3D A;  3LSJ A;  3E6D A;  3VYU B;  2C6Y A;  1TW3 A;  5KNL A;  4NBQ A;  2XSJ C;  5LHI A;  5IP7 J;  3VWB A;  3G1M A;  4ITV A;  1RC9 A;  1T0F A;  1B4A A;  3L2W A;  3PO3 J;  2STW A;  4JX4 A;  2TRT A;  5E79 C;  2HYG D;  1K4T A;  2W1O A;  2X4H A;  3IHU A;  4I99 C;  2A5Y B;  4HYE A;  4XKW A;  4HNU A;  4CO8 A;  1WJE A;  1JUS A;  3A2K A;  2HXI A;  4HRI A;  4RM3 A;  4AIJ A;  1XSD A;  1P7I A;  2HWV A;  3TMO A;  3GVA A;  2DMQ A;  3FBN B;  3HOT A;  3S3O A;  1ULY A;  3E6C C;  2F4M B;  4FX4 A;  1I3A A;  1I27 A;  1KU7 A;  4I7H A;  1LEA A;  4BKX A;  2JPB A;  4A93 J;  3E5Q A;  2ZO4 A;  1LVK A;  3HPH A;  1WH7 A;  5ICC A;  3VOD A;  3MKZ A;  4LG0 A;  3MEX A;  4KIC A;  2KHM A;  1MH3 A;  4HF0 A;  2R7R A;  2DA4 A;  4V19 K;  3H3V K;  3GTO J;  5FFX A;  1VQ5 I;  5CQG A;  1IW7 F;  1R58 A;  3EYY A;  5IOY A;  1LDK B;  2F4I A;  4QPQ A;  1FYL A;  5B66 C;  3S8P A;  2FRH A;  4WXC A;  3MKL A;  5J8C A;  4KA4 A;  2PJP A;  3BC8 A;  1G6N A;  3IL2 A;  1SEU A;  1QZZ A;  3VDX A;  1IV6 A;  2PX9 A;  4D7N A;  2YSR A;  1IUY A; 
#chains in the Genus database with same CATH homology
 1ZR2 A;  1MH4 A;  3FIW A;  5FJ8 J;  1QVT A;  3NAR A;  2WAQ N;  1TC3 C;  3O8H A;  2LKX A;  3ZQG A;  3GTP J;  4MO7 A;  5FKM A;  4GFB A;  1FTT A;  2M0C A;  3IV5 A;  2R93 J;  1SAN A;  2ID6 A;  3IH4 A;  1QPI A;  4DZJ A;  1ETV A;  4FE7 A;  3JRH A;  1FTZ A;  4DZP A;  2XGE A;  1APL C;  2Y9Y A;  4A3K J;  2VKV A;  1E3O C;  2NS8 A;  1BA5 A;  1Y1W J;  4EEF G;  3BR5 A;  1O4X A;  3ZQL A;  3M4O J;  1RET A;  1XC5 A;  4ABZ A;  3CDL A;  4DYR A;  1K61 A;  1JUP A;  2JA7 J;  3QPL A;  1BJZ A;  2H1K A;  2R7Z J;  3GTL J;  2XPW A;  1ENH A;  1TWA J;  2ME6 A;  1TWG J;  4IHX A;  1WPK A;  5DTD A;  2N8G A;  2DA1 A;  3K7A J;  2JK3 A;  3JRI A;  4DYQ A;  2JJ7 A;  2CUF A;  4A3E J;  2HYJ A;  4W97 A;  2DA5 A;  1I6H J;  4FCY A;  1QRY A;  1K83 J;  3HGG A;  2ECC A;  1Z0X A;  4QIW N;  1Q1V A;  5FKK A;  2L9R A;  3Q0V A;  1A6I A;  2X9D A;  3JRG A;  4UUS A;  1WCM J;  4X1E A;  3TP0 A;  2DJN A;  1WGX A;  4A3J J;  2E2I J;  3JRC A;  3Q3S A;  1X2M A;  3BR2 A;  2M9H A;  5BNG A;  2M2E A;  3SFI A;  2XB0 X;  4BBR J;  4M3F A;  5FKO A;  3G1L A;  1GDT A;  1F43 A;  2DMT A;  1JKP C;  2DA2 A;  3C2B A;  1BW5 A;  2LLK A;  4QTR A;  4A69 C;  2O7O A;  4XRM A;  3ZOB A;  3ZQF A;  2H8R A;  2ELK A;  4W1U A;  2CU7 A;  4Y52 J;  5GPA A;  3HGY A;  1GV2 A;  5J1R A;  3BQZ A;  2K9S A;  3JRA A;  1JGG A;  3JRE A;  3M3Y J;  1POG A;  2MW8 A;  2OPT A;  2EZK A;  2XPV A;  3A01 A;  5E3N A;  3HOV J;  2ECB A;  3HOX J;  3BTC A;  2R0Q C;  5K7H A;  2GLO A;  3ZQI A;  1VND A;  1D5Y A;  2CUE A;  2M34 A;  2JA6 J;  3TP3 A;  1RES A;  1WH5 A;  1IJW C;  2JMW A;  3RZD J;  2CJJ A;  1IUF A;  3PO2 J;  2XGC A;  2O8K A;  2EBI A;  1MBK A;  2LD5 A;  5HOD A;  2K40 A;  5EZH A;  1JTX A;  1MBG A;  4V2G A;  4D7M A;  2P81 A;  2VPR A;  1YRN B;  5E3L A;  5DS9 A;  1JKO C;  2DA7 A;  4BY1 J;  2LP0 A;  1I50 J;  1MSF C;  4C3I J;  1RPW A;  1ZK8 A;  1X2N A;  5F04 A;  1UMQ A;  1B8I A;  4IEJ A;  2OF7 A;  1ETY A;  2IEK A;  3HM5 A;  3RKQ A;  3GTG J;  1U78 A;  2FJ1 A;  2GBY A;  3O8G A;  4MFE A;  4NDL A;  3BQY A;  1JKQ C;  4AC0 A;  2L7Z A;  2HOT A;  1ETW A;  5IP9 J;  2E2H J;  1ETX A;  2NOG A;  2X6O A;  1P7J A;  1AU7 A;  4RBO A;  3SJM A;  1UG2 A;  2EH3 A;  5F0F A;  1VFC A;  3S1N J;  2D5V A;  3HOU J;  4FTH A;  2Y30 A;  2O9L A;  1IDY A;  2R5Z B;  1MBF A;  3L1P A;  3D1N I;  2JA5 J;  4IHY A;  2ZB9 A;  1MBH A;  1RKT A;  3BR1 A;  1CQT A;  1U9O A;  2L0K A;  5JLW A;  2E19 A;  2DMN A;  4XID A;  2IAI A;  1GVD A;  3HBL A;  4JX5 A;  2TCT A;  4A3I J;  2JN6 A;  3UKG A;  1B72 A;  1JT6 A;  3RQI A;  3S15 J;  2XRL A;  4M3B A;  2FD5 A;  2AO9 A;  3BTJ A;  2I10 A;  3S1M J;  1YRN A;  3VPR A;  5EG0 B;  3BR6 A;  2WB1 N;  2LR8 A;  4AUX A;  5C4J J;  2XSD C;  4V2F A;  2KT0 A;  2E1O A;  2DA6 A;  2MGQ A;  5EEA A;  3OOU A;  2RAE A;  3Q0U A;  3OSF A;  4JYK A;  1OJL A;  4B3A A;  3E7L A;  2AHQ A;  2XPU A;  4RDU A;  4XRS A;  1AKH A;  2NVX J;  3HOY J;  1Y1V J;  1MSE C;  3S17 J;  3S2D J;  4A3C J;  2LY9 A;  5M3F J;  4A3M J;  2NVQ J;  3HEF A;  2CQX A;  1ETQ A;  1RKW A;  4BXX J;  5K7Z A;  4AYB N;  5J1Y A;  3QQA A;  2DMP A;  4HNV A;  1B8I B;  1BL0 A;  2R5Y A;  1IDZ A;  1MNM C;  5M5W J;  2VI6 A;  3GTJ J;  1HDP A;  3BTL A;  4A3G J;  5M3M J;  2MSY A;  3B6C A;  2L7M P;  1WI3 A;  2R5Z A;  3JR9 A;  1HCR A;  5GPC A;  5F08 A;  4M3E A;  3LSR A;  1LFU P;  1AKH B;  2W48 A;  1XG1 A;  3S14 J;  2XB5 A;  2YS9 A;  1Z77 A;  2FX0 A;  1T56 A;  4IHV A;  2DMU A;  5EGO A;  3LSG A;  5GP9 A;  3F0C A;  1IC8 A;  2K9N A;  4LOC A;  3W6V A;  3K2A A;  3IH2 A;  2DA3 A;  3BT9 A;  3GTQ J;  2YU9 J;  3B6A A;  2KDZ A;  1NK2 P;  2XGD A;  5E3M A;  3FKI J;  1AHD P;  2NS7 A;  5E3O A;  1VF9 A;  4L5E A;  3H0G J;  2HQ5 A;  1U9N A;  4JX6 A;  5FKN A;  1PUF B;  3DCF A;  2EQR A;  5F27 A;  4D5C A;  5F0H A;  5M5Y J;  3GTM J;  3RZO J;  1SFO J;  1ZQ3 P;  3TW6 A;  5F0C A;  2HI3 A;  1OCT C;  2JWT A;  3BTI A;  1ZTR A;  2Y2Z A;  2LFB A;  3BR3 A;  2PMZ N;  5EYR A;  5C4X J;  5IPA A;  3HKZ N;  1S7E A;  3GTK J;  4QSH A;  3IH3 A;  4MIM A;  1JJ6 C;  3CCY A;  2Y9Z A;  2QF7 A;  2ME0 A;  4Y7N J;  2R92 J;  1ITY A;  5J3L A;  3ZQC A;  3TED A;  2HDD A;  3I4M J;  1ZR4 A;  1PUF A;  5EGO B;  1EF4 A;  5C3E J;  1RR7 A;  2NVY J;  2E2J J;  4BBS J;  2QCO A;  2LVS A;  4XK4 A;  1TWF J;  1IRZ A;  4A3L J;  2VUM J;  1F36 A;  3HDD A;  3A02 A;  3CMY A;  2Y31 A;  1DU0 A;  3BG3 A;  1HOM A;  1JUM A;  4BY7 J;  4XIC A;  5C44 J;  1HF0 A;  5IYC J;  4D5F A;  3BR0 A;  3S2H J;  2CQQ A;  1TWH J;  4DYC A;  4G12 A;  4A3F J;  5IYB J;  4C2M J;  1OFC X;  5EZG A;  3JRB A;  1H89 C;  4I76 A;  4C3H J;  2HOA A;  2HXO A;  2MG4 A;  4C3J J;  1ZGW A;  1TWC J;  3OSG A;  3JRF A;  5IOZ A;  3HB9 A;  3MN2 A;  5F1J A;  2EZL A;  4M3G A;  3NAU A;  3CQZ J;  3LNQ A;  3Q0W A;  1NTC A;  3LOC A;  1GV5 A;  3G1O A;  1VI0 A;  4CYC B;  1IGN A;  5FLV A;  2YUS A;  4UUS B;  1FJL A;  4J19 A;  5FKL A;  2GM4 A;  3BG9 A;  2X48 A;  2IBD A;  1JTY A;  2NVT J;  1JT0 A;  1LE8 A;  3A03 A;  5EDN A;  1GT0 C;  3FK6 A;  1MBE A;  4FE4 A;  2LK2 A;  3MVP A;  3BG5 A;  5EG0 A;  2CRG A;  2EZH A;  2EZI A;  2L7F P;  2K9Q A;  4XRS G;  3S16 J;  3LSP A;  1ETK A;  5FLM J;  1FIP A;  1OCP A;  4A3B J;  4B1R A;  2FQ4 A;  3OIO A;  2G0E A;  1NK3 P;  4M3D A;  3LSJ A;  4JP0 A;  5JLX A;  3HOW J;  4CYC A;  2B63 J;  1ZKG A;  2M8G X;  4M6V A;  5J1U A;  1W0T A;  1HLV A;  2COB A;  5IP7 J;  1W0U A;  3G1M A;  1HDD C;  2LTP A;  1MBJ A;  3PO3 J;  1FIA A;  3A01 B;  4JX4 A;  3FK7 A;  2TRT A;  1X58 A;  4I6Z A;  4DW6 A;  5IP6 A;  5M5X J;  1QVU A;  1JUS A;  2HXI A;  3S1R J;  4IHW A;  4S0H B;  1GUU A;  2JA8 J;  5IYD J;  2DTZ A;  4UUT A;  1P7I A;  1JKR C;  1ORK A;  2DMQ A;  1XS9 A;  4A3D J;  2R5Y B;  3I4N J;  1T33 A;  4BKX A;  1R9T J;  3HOZ J;  2ID3 A;  3WHC A;  4A93 J;  4MFD A;  3FIS A;  3JRD A;  3DEW A;  1ETO A;  1WH7 A;  1BW6 A;  4MLO A;  4FIS A;  4X6A J;  3ZQH A;  1FEX A;  1MH3 A;  2WV1 A;  3WHB A;  1LE8 B;  2DA4 A;  3H3V K;  3GTO J;  4B4C A;  5EF6 A;  1B72 B;  3QPS A;  3TW7 A;  2HOS A;  9ANT A;  3PM1 A;  1G2H A;  2DN0 A;  1UHS A;  2Y0S N;  5IOY A;  1A5J A;  1LFB A;  1I3Q J;  1DU6 A;  1U8B A;  1H88 C;  3MKL A;  3GBG A;  1H8A C;  2VKE A;  5K7F A;  1IG7 A;  1JJ8 C;  1IV6 A;  4D7N A;  3SDG A;  3S1Q J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...