4EEFG

Crystal structure of the designed inhibitor protein f-hb80.4 in complex with the 1918 influenza virus hemagglutinin.
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
45
structure length
45
Chain Sequence
PWKFSENIAFEIALSFTNKDTPDRWKKVAQYVKGRTPEEVKKHYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin HA1 chain
publication title Optimization of affinity, specificity and function of designed influenza inhibitors using deep sequencing.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Immune system/inhibitor
total genus 4
structure length 45
sequence length 45
chains with identical sequence H, I
ec nomenclature
pdb deposition date 2012-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4eefG00
1HDDC 3HBLA 1WI3A 2M8GX 3FK6A 5F0HA 5M3MJ 1ZR2A 1H8AC 2R7ZJ 2R92J 3S15J 2CUEA 2L7ZA 3JR9A 1R9TJ 4AC0A 4M6VA 1GVDA 1JGGA 3BG5A 2M0CA 2XGDA 2DJNA 2XRLA 4FCYA 3F0CA 3B6AA 4W1UA 1JUSA 2E19A 2DMPA 4MO7A 2XGEA 2Y30A 1ETQA 4XK4A 1JT6A 2X9DA 2L7FP 5IYCJ 1TWHJ 3ZQCA 5IYDJ 3NARA 5K7FA 3H3VK 1ENHA 1GT0C 3CMYA 1QRYA 2HOTA 2L7MP 5C4JJ 3UKGA 2XPWA 1DU6A 3BG3A 1B8IB 1LFBA 1RETA 1F36A 1UMQA 4A3BJ 2K9SA 1Z77A 1TWAJ 3HEFA 4MFEA 3OIOA 5EYRA 1LFUP 1IGNA 5EGOB 4A3GJ 2MG4A 2O7OA 1ORKA 4Y7NJ 2KDZA 2XB5A 4M3FA 2LK2A 2JMWA 3SJMA 3I4MJ 4NDLA 3JRCA 3MN2A 2OPTA 3MVPA 1HF0A 3C2BA 3JRIA 4D5FA 3TP0A 2R5ZA 1HLVA 2DA4A 1ITYA 1F43A 1I3QJ 3LSPA 5F0FA 2NS8A 1TWGJ 1X2NA 1FIPA 1IDZA 1FIAA 4V2FA 2DA1A 5IYBJ 2EZLA 2HDDA 3JREA 3A01B 1MBEA 5F27A 4UUSA 5DS9A 1TWCJ 4MIMA 1JTYA 2M9HA 3BR1A 3GTJJ 4A3KJ 4A3JJ 2FQ4A 1FEXA 2E2HJ 2FD5A 2DMUA 4B1RA 2MGQA 4C3JJ 3HOYJ 4AUXA 5IOZA 1RPWA 1WPKA 1JKOC 4UUTA 2N8GA 3LSJA 3ZQFA 4XICA 5JLWA 4BXXJ 1XG1A 4FE4A 4AYBN 1IG7A 4G12A 4IHXA 1NK2P 2NS7A 2CRGA 2DA7A 2CU7A 3MKLA 3HB9A 1P7JA 2E2JJ 3DCFA 2ME0A 4XRSA 5EEAA 3H0GJ 5FLVA 3OSFA 1IRZA 3S17J 2K40A 3BQYA 3BR0A 2KT0A 1BW6A 3LOCA 4I6ZA 1AU7A 1BA5A 2CQQA 1RESA 3RZDJ 2HI3A 1U9NA 3ZQLA 3E7LA 4QIWN 2HOAA 3JRHA 3TW6A 4W97A 5M3FJ 1JTXA 2EZIA 2LTPA 4FTHA 2LP0A 2Y9ZA 4J19A 2DMTA 3GBGA 4XRSG 3JRGA 2DMQA 1MBHA 3HOXJ 4X1EA 3BR2A 1JKQC 2VKVA 2JA5J 1AHDP 2JN6A 5EG0B 4GFBA 2XPVA 1T56A 1HDPA 2JJ7A 2Y0SN 3CDLA 1LE8A 1WCMJ 1TWFJ 4JX6A 5IPAA 4CYCB 1BL0A 3S2DJ 1EF4A 1ZK8A 3ZQHA 3GTOJ 3S1QJ 2TRTA 3FISA 5FKMA 3K7AJ 1OJLA 5DTDA 1ETVA 1WGXA 4MFDA 1IC8A 4BY7J 4L5EA 4X6AJ 1Q1VA 1I6HJ 4A3LJ 2MSYA 4DYQA 1CQTA 3VPRA 2G0EA 3M3YJ 2COBA 4IEJA 5FKKA 1ETYA 5JLXA 4DZPA 4M3DA 1OCTC 1Z0XA 5EF6A 1MBGA 1QVUA 2L0KA 3G1MA 5E3LA 4JX5A 1K83J 2XB0X 2DA6A 1APLC 3HOWJ 4A3CJ 2VUMJ 3BTLA 4DZJA 2P81A 3OSGA 3ZQIA 1ZR4A 5E3NA 4DYCA 1PUFB 4FE7A 2EZHA 5F1JA 1GV2A 3RKQA 2HYJA 3G1LA 2LVSA 4DW6A 5GP9A 3OOUA 1MH4A 2H1KA 3RZOJ 5FKNA 1JJ6C 1SFOJ 2EH3A 3IH3A 1RR7A 4BKXA 3GTMJ 2IAIA 1XC5A 1FTZA 3JRDA 5IOYA 2NVYJ 1B8IA 1IDYA 3BT9A 4D7NA 5IP6A 2D5VA 4QTRA 4Y52J 5GPAA 1Y1WJ 5M5WJ 5EGOA 3S14J 3HOUJ 1W0UA 2Y9YA 3A03A 4B4CA 3CCYA 2R5YB 4JX4A 3PO3J 2DA2A 2GBYA 2ECBA 2VI6A 3BTJA 3S16J 1FTTA 3WHCA 2RAEA 1UHSA 3O8GA 3JRBA 4EEFG 1IJWC 4A3DJ 2H8RA 4M3GA 1Y1VJ 2ELKA 4IHWA 5M5YJ 3A02A 2R0QC 1YRNB 4A3EJ 9ANTA 3QPSA 2VKEA 1D5YA 1JJ8C 3O8HA 3D1NI 2ECCA 3A01A 2NVTJ 4MLOA 5J1UA 4XRMA 1ZQ3P 1AKHB 1HCRA 2ID3A 5F04A 2M2EA 2DA5A 2XPUA 4M3EA 4A93J 1JUMA 2K9QA 1H89C 3TP3A 1MBFA 2ID6A 2M34A 3HGGA 2GLOA 1ETKA 1U78A 2R5YA 1P7IA 3FIWA 1X58A 2OF7A 4DYRA 5FJ8J 3G1OA 3BR6A 4ABZA 1XS9A 1VNDA 2QCOA 5E3MA 1UG2A 1U9OA 5IP7J 4FISA 5C4XJ 1JUPA 5HODA 1GDTA 2JA7J 4A69C 2EQRA 5J3LA 2HOSA 2LLKA 3GTLJ 1H88C 2MW8A 3PM1A 3Q0WA 3Q0VA 4D5CA 1MH3A 1X2MA 3LNQA 1E3OC 1FJLA 1YRNA 5EDNA 1I50J 4JP0A 4S0HB 5K7ZA 2LR8A 3BTCA 1TC3C 2GM4A 3S2HJ 1T33A 1AKHA 3I4NJ 2EZKA 2EBIA 1QPIA 1NK3P 4V2GA 5GPCA 1O4XA 2NVQJ 4M3BA 1A6IA 2LD5A 4HNVA 1GV5A 1RKTA 2ZB9A 3M4OJ 2R93J 1VI0A 2AHQA 4A3IJ 3DEWA 3WHBA 2Y31A 4IHVA 2WAQN 5K7HA 5M5XJ 5C3EJ 2DTZA 5FLMJ 1K61A 2LFBA 3PO2J 1IUFA 3LSRA 2JA8J 3HOVJ 5EG0A 2VPRA 1G2HA 3RQIA 4A3FJ 1RKWA 2R5ZB 2AO9A 2I10A 1POGA 4XIDA 4C3HJ 4CYCA 2XSDC 1HOMA 1JKPC 1JT0A 3FK7A 2YU9J 2L9RA 1WH5A 1MBJA 4A3MJ 2FJ1A 2W48A 2WV1A 4D7MA 3TEDA 1BW5A 4C3IJ 3BR3A 3SFIA 4UUSB 2ME6A 4BY1J 2DN0A 1W0TA 3NAUA 2LKXA 5F0CA 2E2IJ 3QPLA 1A5JA 2HQ5A 4JYKA 4QSHA 1U8BA 1ZKGA 4C2MJ 3GTPJ 2IBDA 1OCPA 3BG9A 2Y2ZA 1BJZA 3S1RJ 1B72B 2B63J 3GTQJ 5E3OA 3FKIJ 2NOGA 2QF7A 4RDUA 5FKOA 4B3AA 3GTGJ 3JRFA 2HXOA 2WB1N 1GUUA 3CQZJ 1MSEC 3B6CA 3ZOBA 1PUFA 3HKZN 2X48A 2CJJA 2CUFA 3L1PA 1ZTRA 4BBRJ 5EZHA 1VF9A 1QVTA 3Q0UA 2FX0A 1DU0A 2YUSA 3HM5A 3S1NJ 2DA3A 1MBKA 2DMNA 2LY9A 5EZGA 5BNGA 1MNMC 3IH4A 5C44J 1ZGWA 2PMZN 2X6OA 2CQXA 2O9LA 1OFCX 3HDDA 4LOCA 4BBSJ 1B72A 1WH7A 5FKLA 3IH2A 4RBOA 1VFCA 1IV6A 3HGYA 3BTIA 5F08A 3HOZJ 2JK3A 2IEKA 2JWTA 2TCTA 2YS9A 3W6VA 3SDGA 5J1YA 1LE8B 3QQAA 3TW7A 1MSFC 2K9NA 1NTCA 1ETOA 1SANA 4I76A 3IV5A 3Q3SA 2XGCA 4IHYA 2E1OA 2HXIA 3BR5A 1ETXA 5IP9J 3ZQGA 3BQZA 5J1RA 3JRAA 3LSGA 1JKRC 2NVXJ 3K2AA 2O8KA 2JA6J 3S1MJ 1S7EA 3GTKJ 1ETWA
chains in the Genus database with same CATH superfamily
3DEEA 2BV6A 4PFPA 1D1CA 4XQFA 5M3MJ 1H8AC 2R7ZJ 3K4MA 3WE3A 3LQQA 3HKZA 4YIIA 4CCLA 2V4JC 3JR9A 4IJAA 1R9TJ 2RC4A 4C2UA 4AC0A 2BGCA 3OYLA 2A05A 1H0MA 3ASNH 3K4CA 1PP8F 2F5EA 4IF4A 2DJNA 3WTUC 2E19A 2MBFA 5DCMB 4MO7A 1DPUA 1G3SA 4XK4A 3U21A 3CCSI 2Y0MA 1IUYA 2VE8A 3R0JA 4G6QA 3TDUC 4L9TA 2L7FP 2QSHX 2PMZA 3ZQCA 3B02A 3NARA 1T6SA 5K7FA 3H3VK 2MYSA 2DI3A 2KHMA 1MMSA 5CVUA 2QKLB 4KMFA 4C9YA 5BMZA 2HOTA 2FMYA 2FQ3A 3DU5A 1KU2A 3KX2A 4AU7A 1F36A 2IGNA 2CS3A 3L2VA 4KJZA 2X1DA 1TWAJ 1SD5A 1YS6A 4D1QA 1MKMA 3OIOA 1VQ7I 1LFUP 1QPMA 3EQLF 1XGOA 2ELHA 2KDZA 1F9NA 5DUKA 2D1VA 2FU4A 4HYEA 4M3FA 1G3WA 4I98B 3FM3A 3PSFA 3MVPA 1HF0A 5HLIA 4E7LA 1HLVA 1KYZA 3F6OA 1F43A 1R36A 2HS5A 3LSPA 3GLXA 4BJTA 1YX5A 4BEHB 3K70C 4O6JA 4C30A 4AVZA 4BHPA 2DA1A 1TQMA 5IYBJ 3L2QA 4XN0A 2FRHA 2XAFA 1D0XA 2FE3A 3I3LA 2OQRA 1Y39A 5EJCA 3OOPA 5DS9A 1TWCJ 3SEQA 1SVLA 2XIGA 1VQPI 3M9AA 4GYIA 3GTJJ 2ZFUA 2WA0A 3CJQB 4NBQA 2FD5A 4HPQA 3IRRA 2DMUA 1XSVA 3T5XA 4OIQF 2O5RA 4AUXA 4KUMA 3HUGB 3TO6A 1WPKA 3FMRA 3E6BA 3L2UA 3ABUA 5JLWA 3V42A 5L3CA 4BXXJ 4RGUA 1Z6TA 1Z7LA 1OCOH 4IHXA 3P9IA 4HF1A 2DT7B 1T8IA 1U0JA 3JTHA 4AIKA 3HB9A 3V7RA 2VT2A 4R1HA 4FT8A 3PIPF 2H27A 1TNTA 1YW9A 2KMUA 3S17J 3DBLB 2MH2A 3BR0A 1WFXA 1BW6A 1WJFA 2K4JA 1FSHA 5BOXA 2ELJA 1LQ1A 4OU0A 3SYTA 1O7FA 1BN5A 3WGIA 4ETSA 1RESA 2CW0F 3M8EA 4QPOA 4BDYA 3E7LA 1XCBA 2DQLA 4BJ6C 4W97A 1BOBA 3OYCA 1BI2A 2H6CA 2LP0A 2UUZA 1PVEA 4J19A 2MH9A 3GBGA 4XRSG 3VYRB 2AS5F 2VC0A 1HA8A 2DMQA 1MBHA 3JTGA 5LRSA 1WI9A 4ESJA 1MW7A 3BR2A 1JKQC 2OBPA 2EV6A 1S3JA 3EDPA 4Y4RA 3V7CA 3PJRA 2XPVA 3QP5A 4EGYA 4KYWA 1TLHB 4WF2A 2IVMA 3CDLA 3LL7A 3KYLA 3TO7A 3S2DJ 2AXLA 5JR3A 2EA2A 3KEQA 2TRTA 3R0AA 5E79C 1D3YA 1TQIA 2W24A 4X6AJ 1Q1VA 3H92A 4A3LJ 2JPCA 3OL4A 1VQMI 2KIUA 3V8KA 2G0EA 1U6GA 2OTLI 4IOCF 3M3YJ 5B1BH 4OIOF 5J4YA 5EEHA 4M3DA 2R7RA 4UVCA 5JVTA 5EF6A 5LD2C 1XGSA 3ZMSA 2LBFB 1QVUA 4LG3A 4I2OA 2V26A 2WADA 2DTRA 2M0MA 2V7FA 4LLNA 4L5JA 2Q2EB 2XB0X 4WCGA 2DA6A 4LK0F 1APLC 2VODA 2L02A 3HOWJ 4A3CJ 1PDNC 2AQFA 2L2OA 1TW3A 3ZQIA 1ZR4A 4EMSA 2KDOA 5E3NA 1MIJA 2WV0A 4AVPA 4CXFA 4PGGA 2L9VA 5K1YA 5D5UB 5E17F 3OYJA 1WKMA 3K9TA 3SQNA 4PSXA 2LVSA 2KKOA 3GUDA 3FX3A 2HDWA 1VTNC 1WQ2A 4ZTJA 2IS1A 5KCMA 1MH4A 4FASD 5FKNA 3CC4I 4RB0A 5ICGA 4B8XA 5DDGA 3QPHA 1RR7A 5D6EA 1UG0A 4BKXA 3A0BC 3WGHA 1MNEA 3JSPA 1XD7A 1B8IA 4EV0A 1VQKI 2RQPA 3H5NA 4YFKF 2PJRA 4QTRA 2L01A 2L9SA 4Y52J 4KICA 2M1BA 4CZCA 3HOTA 1Y1WJ 5TRDA 1FT9A 3KEOA 1D0YA 3GZ5A 3A03A 4I01A 4IKFA 2G9WA 3PO3J 5HS7A 2V9PA 3RQ4A 2GBYA 3BTJA 3S16J 2H6BA 4CHUA 2IRFG 1R22A 2VC1A 3SFZA 3L2CA 3W6KB 4EEFG 2CUJA 1FC3A 1IO2A 2EPFA 3ERMA 3I71A 3HSEA 1Y1VJ 1YHQI 4PFOA 4HBLA 3VSKA 4HW0A 4KFCA 3WTSC 1QZZA 2HYFA 2LC2A 2R0QC 4Q48A 5KAFC 2ZNZA 3KP4A 2XKPA 1Y8QB 2Q0OA 1D5YA 1JJ8C 3O8HA 2DYRH 3D1NI 4U88A 4XL9A 2NVTJ 2Y75A 5J1UA 2QEXI 1E2XA 4G94A 2E60A 1HCRA 2M2EA 2A3SA 1GXPA 3ABLH 2A61A 2GA2A 2K9QA 1FMVA 3N97A 1H89C 5ICEA 3OS1A 2HYGD 1O3TA 2ID6A 2M34A 2GLOA 2ZXIA 1YYVA 2EWNA 2R5YA 1X58A 2XAHA 1B9MA 1MJBA 2X1EA 4ZDPA 1G4DA 3FXQA 3WTVC 1J09A 1XS9A 1VNDA 2I8DA 3HIFA 1TBXA 1VQ8I 2UXNA 5DD8A 3QU3A 2A07F 3WE2A 3H9JA 1ERDA 5FFZA 1JUPA 2NYXA 5HODA 2WY7Q 3ABMH 3GTLJ 1H88C 3Q0WA 2CV2A 1E3OC 2VBXA 1YRNA 4PK4A 4JP0A 2LR8A 1IRFA 2HVQA 2K7LA 2R7DA 2ZBKA 4NQWA 4A6EA 1IN4A 1MJ9A 1T33A 2IA2A 2Y69H 2NXNB 2FBKA 1HBXG 1D0ZA 1W5SA 1O4XA 2NVQJ 3CF2A 4BQQA 4WXHA 1H9TA 2JTVA 2RKHA 5HOOA 3R61A 5C3EJ 3Q9VA 4E7SA 2DTZA 2XF6A 3KYDB 1EV7A 3MKWB 1K61A 2Z9OA 2CQNA 4IQ4A 4QPQA 4EJOA 4EATA 2VJ4A 4IZZA 1FYMA 2EA4A 3PO2J 1IUFA 3LSRA 3G71I 1QQIA 5EG0A 1ZG3A 2VPRA 3OYNA 2DPUA 3RTRA 4HDVA 3LQRA 2F5FA 4UV8A 1QZEA 3C18A 4XIDA 4C3HJ 1HOMA 2XSDC 5LHHA 2CUZA 1JT0A 3AKZA 3SHFA 5EEGA 1O3SA 4A3MJ 5GAGJ 2FJ1A 2BXYA 1BW5A 4PDKA 2CH0A 1S5LC 4MNUA 3NWSA 2F2EA 4GO1A 2ME6A 3OMYA 1HC8A 3CMAI 1W0TA 2X6WA 3NAUA 2KFDA 2M45A 3OIPA 4JYKA 4QSHA 1I3AA 4C2MJ 3DTIA 3GTPJ 5LBQA 1TZLA 1VQOI 2CG4A 1P2FA 3ZN0A 1SAXA 4ENNA 2ZFWA 2B63J 2BBYA 1U5TA 5BPIA 4XOTA 1P4AA 2HXOA 3K1NA 2FNAA 3GYHX 1GUUA 5HDGA 1DUXC 1KGSA 3ZOBA 3HKZN 4IQJA 4ZZDA 2VOOA 3BCAA 4BU2A 1OCRH 5CYVA 1LEBA 1O57A 1FJLA 1VZ0A 2GOMA 3C2HA 2QBYA 1ZTRA 4BBRJ 2VXDA 5EZHA 1F4KA 1VF9A 1QVTA 5DEQA 2FF4A 2CW7A 2YUSA 2HOEA 2C6YA 2UXXA 3Q9SA 3UR3C 5K5RA 5E8GA 1OMIA 2K85A 5EZGA 3O6BB 2FOWA 3IH4A 2QA4I 1ZGWA 1X1PA 3E5UA 2PMZN 3GVAA 2CQXA 2EFPA 4F92B 4PSWA 3VODA 1ZHFA 3HDDA 1MZBA 4BBSJ 1WH7A 4U0WA 5FKLA 1IV6A 3BLYA 1N77A 4L9JA 1W7PB 2YPRA 2F5DA 4U0VA 4Y33A 1XSDA 2XRNA 5F08A 4BS9A 3HOZJ 2IGMA 1BR1A 2DK5A 2LG4A 3HG9A 4KA4A 2JWTA 3KP6A 2KPMA 3PUBA 3F9KA 3TOBA 5E18F 5J1YA 3FDYA 2OQGA 3QQAA 4NB5A 2E1NA 3EUKL 4CH7A 1W1WE 5LFAA 5J47A 4OIRF 1OCZH 4IHYA 1IN5A 1Z3XA 5TGTA 2YX7A 2E1OA 2HFHA 4IRGA 4XBFA 3TGNA 3TMOA 5IP9J 3ZQGA 3FM5A 1ZRDA 1UB9A 4JOMA 2DDBA 1W36D 1N75A 3LA3A 2HGCA 1TNSA 2JA6J 3IUOA 3S1MJ 1HDDC 3K4JA 4A0YA 3VWBA 1V4RA 1YJ9I 5F0HA 3FK6A 1ZR2A 2VXZA 1J75A 5IT9K 4L9VA 5DD4A 4DBRA 2ZSIB 3M8FA 3ABKH 3A2KA 3BZ6A 1H9GA 2V6EA 2KIMA 4FETA 5E1WA 4M6VA 1GVDA 1MJAA 3LA2A 3OL3A 4OAYA 4EGZA 2OA4A 3MZ8A 4W1UA 1NHAA 1R5HA 3FF5A 1LB2A 3E6CC 2XGEA 1JHHA 1RUNA 2P4WA 1JT6A 3IRQA 4HV6A 3K6GA 1FOKA 2GOXB 3K4KA 3FXLA 5IYDJ 4OWRB 1GT0C 3GFMA 3L2WA 4OOIA 3GF2A 3WTZA 2VBYA 1KQ8A 1QRYA 2IJLA 1S8NA 3SZTA 2QWWA 2ESNA 5C4JJ 3UKGA 4XN3A 3BG3A 5CVRA 1B8IB 2VKDA 1E3PA 2CFOA 1UMQA 4CUGA 2PJRB 2K9SA 3HEFA 1R5GA 3RKWA 1WJAA 4MFEA 2BY1A 5EYRA 4KITB 1IGNA 4M6XA 4J00A 1RI7A 2O7OA 3KZIC 4CCOA 1USSA 5IT3A 4XKWA 2PBIA 5HS8A 2ISZA 2XB5A 2STWA 2HQNA 3ML6A 3W2VA 4NDLA 3JRCA 3ECHA 1LUJB 2RN7A 2DODA 3C2BA 3JRIA 2V79A 1Z67A 1YITI 1YO5C 2QQ9A 2O61A 4BJ5C 4YIRX 2HZDA 1MNDA 1Z3YA 2GZWA 3BG7A 5F0FA 2NS8A 3DLAA 2V9VA 3TQNA 4E7ZA 1YFHA 2OAZA 4CA0A 3QRFF 3B73A 3F23A 4DOZA 2EZLA 2P5KA 2WBMA 3JREA 1OKRA 5F27A 1N78A 4OMYA 4MIMA 2DFHA 3ZR8X 3BR1A 3OYIA 5GTHC 4ZYHA 5ICFA 1OYYA 4UVBA 4QLCU 5E8IA 2E2HJ 2MGQA 4C3JJ 1HW1A 4XLPF 2ZXWH 4FX0A 2VT3A 4V19K 2IGOA 5ILSA 1L3LA 3CCQI 1IN8A 1JKOC 2PG4A 3T8RA 4IO9F 3F21A 1LNWA 2CV0A 1IG7A 2IT0A 1FOYA 1NK2P 3H9GA 2IS6A 3VB2A 1SD4A 1RNLA 3KLOA 4IRHA 1K4SA 3H0GJ 3OSFA 1T98A 2K40A 2LNBA 3G6EI 1HXDA 3J7AY 1W4MA 2MC4A 4F3QA 2I5UA 2KT0A 1JI8A 3LOCA 5D8LB 4I6ZA 2NAZA 4RMNA 2HKXA 1AU7A 2E34A 4XR6A 2JZYA 1GHCA 2HI3A 1UHWA 1UAAA 1U9NA 2BVMA 2QVOA 2OZ6A 3JRHA 2JRMA 2Y9ZA 3DPUA 3JRGA 2XKOA 3J7YJ 2FSWA 3GFJA 1Z9CA 2VKVA 1F5TA 2JA5J 4HRIA 3CC7I 3PUFA 1R4MB 4F7ZA 5EG0B 4GFBA 3HSRA 3MEXA 4XKCA 3OYEA 1KQ0A 1YX3A 2JJ7A 4RB2C 4KDPA 3EYYA 1TWFJ 1TW2A 4IX7A 5HLTA 3D5RC 1EF4A 1W5CC 3GTOJ 4GGGA 3H5RA 4ZTFA 3K7AJ 1BOAA 1WGXA 2OD5A 4BY7J 4B47A 4RAZA 2MSYA 4DYQA 3ZGKA 3IAM2 1FOXA 4IEJA 4DZPA 1N25A 3PIOF 4WX9A 1R1VA 1Z0XA 2HQAA 2VQHA 2JQ7A 3ZP5A 5JHFA 2L0KA 3KP2A 3C3WA 5E3LA 3V4GA 4AYBA 2M7AA 3LA7A 3SDBA 4F55A 1HQCA 2JUCA 4HV5A 2ICWG 2ZXJA 4LGWA 2XAUA 1B9NA 3FMSA 4FHTA 3RPUD 5D5WB 2VUMJ 1JHFA 3BTLA 1KU9A 4OINF 4KT5C 2Z33A 2VKHA 3FXRA 1IW7F 2RGVA 1U2WA 2PMUA 3WTXC 4HG2A 3ZQQA 2K9LA 5F1JA 2VLAA 2QBYB 2W57A 2HQRA 4E4HA 3PNVA 5CQGA 2H1KA 4XLAA 4MTEA 2EFWA 4N4NB 1FY7A 1DGRM 1Y56A 4EQQA 4ESFA 3A0HC 4U7DA 3I54A 1A6QA 3J80Z 2LY2A 2A6EF 1EH6A 4LB6B 1X1BA 2HTSA 4MHGA 3ZXSA 4ENMA 3HJEA 3ZQ7A 1LFPA 1TP4A 1WJEA 2MLKA 4RLFA 5IP6A 1VQ4I 2D5VA 3DWLE 3FWEA 4EM0B 3HOUJ 5B3SH 2X6YA 4NC6A 4B4CA 3TL4X 2JT1A 4EM2A 1DQUA 4N9HA 2DA2A 4Q47A 5FD6A 1FTTA 1J0RA 2ECBA 2ADUA 1G3TA 3WHCA 3C1DA 3O8GA 3CP8A 3W6JB 1R7JA 3K10A 2QZ8A 4M3GA 2HPMA 1OLTA 3BG6A 3I64A 2O03A 2F4OB 4RGSA 2PJPA 9ANTA 3QPSA 1DDNA 3DPTA 2VKEA 4BUPA 3GZNB 2F5VA 3A01A 3TBIA 3VOEA 4MLOA 3ELKA 4CCNA 1AKHB 4ZDLA 1TL8A 2ZO4A 2QQAA 1JXSA 3DBHB 1P4WA 1SAUA 4R79A 3CUOA 2IA0A 3CTAA 1MBFA 2F4MB 4ZYEA 2NRAC 5L3EA 1XSXA 2VJ5A 2M7BA 1KYWA 2LF8A 3OIQA 2OU2A 3OS0A 5FGMA 2L5QA 1Q1HA 5KNLA 4UNOA 4FISA 2FXAA 3I58A 3EUHA 1GDTA 3GEZA 2EQRA 2HOSA 1BR4A 5L3BA 3PM1A 3Q0VA 1X2MA 3ZRGA 4MGRA 4S0HB 2D1HA 2R7VA 1ON1A 2IA1A 2XDVA 2JSCA 5ILVA 2DW4A 2EZKA 4KMUX 4G7ZF 4MEXF 4UY8I 1VQ5I 4DGWB 3ULQB 3WU1B 3GW2A 3G73A 3QP6A 2R93J 1VI0A 4A3IJ 1YTYA 2BY3A 4EVIA 4BXFA 1KA8A 1FMWA 4B3XA 5DM6F 5K7HA 3HYIA 5JFRA 3CESA 2XF5A 2L7KA 2A5WA 2M4KA 4CYDA 3OY9A 1XGNA 4P55A 5F64A 1RKWA 2XROA 2AO9A 2WTEA 3L7WA 1POGA 3DKXA 1Y8RB 3I4PA 5L3GA 4CYCA 5K5OA 3SXYA 1C0WA 3FK7A 2ZJPF 2YU9J 1QNTA 1MBJA 4D7MA 2R7WA 5BQTA 4C3IJ 4S04A 4B09A 1X4OA 2QKMB 3IWFA 2RDPA 4A0XA 3I59B 3IHUA 1EH8A 1X1DA 4Y13A 2OZUA 3EUHC 2E2IJ 1A5JA 4G9YA 2HQ5A 4DBQA 2BYVE 2ZJQF 1QBJA 3CJTB 2CW8A 1ZKGA 4NC8A 1OCPA 2NVUB 2Y2ZA 2Z16A 4GDFA 4ENJA 3GTQJ 1LDJA 1WJBA 2E71A 2P5VA 3NWTA 2NOGA 2VL8A 3VSLA 4RB1A 3NRVA 2E35A 1ULYA 3KEYA 4Z2YA 3BJAA 1PUFA 3J80K 4UB6C 2AQEA 2CJJA 2JVGA 3CDIA 3MD2A 2M4GA 3MMYB 5D5VB 1IXCA 3PL8A 5F1RA 3E1SA 2IPQX 5LGTA 1YJNI 1UFMA 3HM5A 4LLGF 2LY9A 2WAFA 5BNGA 1MNMC 2WAQA 2VASA 3RYRA 3L9FA 5C44J 1IXSB 2K3FA 2LOOA 3SZGA 4A5MA 1T95A 2W84A 5DUIA 4Y3OA 5KK1A 3WTWC 4IVNA 1K78A 2V1UA 1B72A 2RQQA 4RBOA 5AIPA 4DNCA 1VFCA 5H2FC 2YR2A 1MDMA 4LIUA 2DK8A 3M07A 3CCMI 2LY1A 4ITVA 1X19A 3M8JA 3DBRB 2QSGX 4DQ2A 1LEAA 2TCTA 2LH9A 1SMTA 3SDGA 2HNHA 4AIJA 2UWMA 4CO8A 5F6FA 1DP3A 3TW7A 5FO5A 2GXGA 4IHSA 1MSFC 1SD7A 2Z2SB 1X1CA 1Z7UA 4P9UA 5IT9Z 4U0YA 4UVAA 4HF2A 4I7HA 4F91B 2K9MA 3LSKA 4BAYA 1FWZA 1ZYRF 2O8KA 2XGXA 2COMA 4YFNF 2M8EA 3GTKJ 1UHMA 4II2A 2X85A 1WI3A 1X3ZB 1YW8A 4XKBA 3S8PA 1E17A 2R92J 1YJWI 1T0FA 3S93A 3PFYA 2WB1A 1RIOH 3FBIB 4RAYA 4P9FA 4A5NA 4ZC3A 3BJOA 4IPAA 3W3CA 2L7ZA 4PJMA 1LDKB 4N0BA 5JI6A 3F8MA 2GXAA 1JGGA 5DYMA 2BVLA 3GLLA 1ZG5A 3F0CA 2LMDA 3DLLF 3GXOA 2Y30A 3PNYA 2HZTA 4MTDA 1HSJA 5GTIC 2X9DA 2P6SA 2XC7A 3H0DA 5D4RA 4L0ZB 2LRDA 3AG2H 3HC7A 2P6TA 1ENHA 5HVQC 2GXBA 1BIBA 3ZN1A 3CMYA 3MZYA 3VDXA 2KL4A 3VYTB 3CCRI 2L9NA 2ZMEA 1DU6A 5CKTA 1Y6IA 4M9XA 3LSTA 4IHTA 4YFXF 1T39A 1HSTA 3PFIA 5DV5A 4ESBA 1ORKA 1XMXA 4Y7NJ 3LSMA 3PSIA 4WXDA 2LK2A 2JMWA 3SJMA 3I4MJ 1VQNI 5H20A 2JRTA 4ZYAA 2EK5A 2OPTA 3C7JA 5DCMA 2BW3A 4B48A 6PAXA 2M30A 3TP0A 1W36C 4O3MA 2R5ZA 2EIJH 2QSFX 2DA4A 1ITYA 4CDGA 1I3QJ 1W5TA 2YU3A 1TWGJ 1X2NA 1QZYA 1T0FC 1FIAA 3GCMA 4I0AA 3U1KA 3OYBA 2EV5A 3A01B 4UUSA 2D45A 4KN4X 4A3JJ 1UELB 3CLQA 3HXLA 4A3KJ 1JGSA 3RYPA 2FQ4A 4B1RA 1Z05A 4Q5SF 2XUBA 5JVGF 1O3RA 1RPWA 4HNTA 2CSOA 2O0YA 3ZQFA 3LSJA 4XICA 2V9KA 4FE4A 4AYBN 3F8BA 1FNNA 3ABTA 2LSOA 2NS7A 2ZMEC 3ISPA 4OAZA 2CRGA 2CU7A 3MKLA 1P7JA 2E2JJ 3DCFA 3K0LA 3R60A 1YW7A 3EPZA 5FRMA 5JHUA 1SEUA 1IRZA 1AA7A 4M6YA 2R7OA 1A31A 5HDNA 3OR1C 3BQYA 4G6DA 3REOA 4HOBA 1IAWA 3OR2C 3QOEA 1ZN2A 1XPXA 3SEZA 4CSWA 3I5UA 1U5TC 2QYOA 3QAHA 4HEA2 3ZQLA 1EJ9A 3J7AO 4AIHA 4ENKA 1R23A 3TW6A 4CCKA 1JTXA 2EZIA 2LTPA 2O8XA 4HZFA 1USTA 4FTHA 3FXKA 2DMTA 3LFKA 1YIOA 1OPCA 5DCFA 3K4LA 2CQKA 5D4SA 4JQFA 1SFKA 4PGHA 1I6XA 2HEOA 3BZCA 4BQNA 1GVJA 3KETA 4E7IA 1MMAA 2MC3A 4IXAA 1HDPA 2EFOA 3OYDA 1BBYA 4JX6A 5IPAA 4CYCB 1I1GA 1OYWA 1ONVA 2NNYA 1HW2A 3LFUA 2X4HA 3U9GA 1ETVA 1I1SA 4MFDA 4L5EA 5J4VA 1HW5A 3BWGA 2VE9A 1ZLKA 1I6HJ 3VEPA 1CQTA 2KZVA 1IRGA 2Z3YA 5L3DA 3VYSB 2COBA 2KJBA 4LK1F 1T08B 2ZNYA 1ETYA 4BGDA 5GAEJ 1LDDA 2V1NA 3BZKA 2W7NA 4HQEA 2IP2A 1ZGAA 2VBWA 2DO7A 3JAMZ 3CCJI 3F3XA 4BE2A 5CVVA 3O2PE 1ZARA 4XSXF 2BXZA 2VN2A 1K83J 3CO7C 2A69F 2E7WA 4IOAF 3N4MA 4XLHA 4WWCA 3FXJA 1J59A 4IRIA 3RPUA 3HL2A 2HDCA 1TQPA 3GO5A 3TO9A 4YRVA 4HLYA 3K2ZA 2E1MC 1PUFB 3CUQA 2FEZA 2VQLA 1S72I 4GYGA 2R7XA 1GV2A 3RKQA 4PZJA 3G1LA 2RNGA 2A6TA 2M87A 3ZMTA 5D5XB 5GP9A 4DW6A 4A12A 1YI2I 4HA8A 4KNYA 1ZRFA 4HX8A 1OQYA 3RZOJ 4U87A 1R58A 2IXSA 2EH3A 3IH3A 3GTMJ 4NC7A 2YX4A 3FHZA 3JRDA 2LBFA 3P7NA 1OYIA 3DV8A 5IOYA 2K27A 2LF7A 2Z99A 1IDYA 3BT9A 4D7NA 3NEUA 2VQGA 5H6QA 1K78B 2QENA 3DF8A 4M71A 1G59A 1MDMB 5M5WJ 5EGOA 3I56I 5ED4A 1W0UA 2Y0SA 1UCRA 1DGWY 4L18B 1EH7A 2R5YB 4B43A 3OWTA 1SFUA 4PUSA 2F4IA 3P9CA 2RAEA 3JRBA 1ZGJA 5J8CA 1T2KA 1DPRA 2H8RA 2RV8A 4CGZA 2W00A 2ELKA 4IHWA 5J6XA 1BR2A 4H0EA 5HNHA 3OYKA 5M5YJ 1U8RA 3L2RA 3A02A 2DXIA 4AWXB 2BOLA 4A0ZA 3OYMA 4A3EJ 1YRNB 2CYYA 2MABA 4M74A 3KP7A 1HKQA 3G3ZA 1Y0UA 3QWLA 2ECCA 4JBAA 4NQWB 3FXOA 3LSHA 1R1UA 1EKEA 1ZQ3P 4F52A 1ZLJA 1B4AA 3TKYA 1QHHD 3H9QA 4D9JA 3CUQC 1Y0NA 4M3EA 4OMZA 1JUMA 4P5OA 3FBNB 4A93J 1X3UA 1HKTA 2FA5A 3HGGA 1ETKA 2W1OA 1U78A 1P7IA 3FIWA 2X51A 4AM3A 2OF7A 1BIAA 4RLQA 4DIQA 1V55H 5E1XA 1V3FA 2DOEA 3DKWA 1ZRCA 2QCOA 3KZZA 3BC8A 3V7SA 1UG2A 3QYBA 1BI0A 4DJAA 5IP7J 1J2XA 2JPBA 1D8KA 1ON2A 5C4XJ 1BM9A 2ESHA 2BHYA 2R7QA 4M72A 3PQKA 5J3LA 2LLKA 5DM7F 3E5XA 4D5CA 1MH3A 1BJAA 3LNQA 2QGUA 2XAGA 1DP7P 5ICCA 5J8FA 1I50J 2K86A 3ESWB 3KLNA 4KN7X 4HDUA 5K7ZA 2V6CA 2CV1A 1XCVA 4ZJZA 4AIDA 1YOVB 3DTEA 2EBIA 1O3QA 4V2GA 4R8HA 4Y17A 1R49A 4M3BA 2ZMEB 1GV5A 2E36A 2ZB9A 3M4OJ 1YQAA 2AHQA 2WC2A 3WHBA 2IS4A 3HTSB 3V8JA 4NNJA 2Y31A 4IHVA 2KLOA 2WAQN 2DQRA 2L4AA 3CF5F 4XLNF 3UNGC 2P7CB 1Z21A 4RAGA 3CLOA 5LEJA 2R7UA 5FLMJ 2O6GE 4LD5A 3HHGA 2BW3B 2JA8J 3HOVJ 1KQ9A 4I0BA 3OYAA 3CCEI 1G2HA 1KONA 1R4NB 1U5TB 2P7VB 3F8CA 4LJZF 2R5ZB 2EFNA 2XASA 1K6OA 2KP6A 4U7BA 1ZG1A 4GRIA 2R4GA 1FX7A 1SFEA 2KRCA 2M5WA 4BL0B 5HNFA 1JKPC 2OCCH 4BH9A 3DTKA 3JAMK 2W48A 3TEDA 2H8WA 1TT0A 2DU9A 1D1AA 4I02A 4UUSB 3RKXA 4BY1J 3ZPLA 1MGTA 2DN0A 3IL2A 4XSZF 2LKXA 4N9IA 5F0CA 2LREA 1XB4A 3CP2A 3DKYA 2WAEA 1MMDA 2JUGA 1U8BA 2LKPA 1WVRA 5HS9A 2PEXA 1BC7C 1R5ID 1FP2A 1K4TA 2NNNA 2IW5A 5E3OA 2QF7A 4EM1A 1HKSA 4PJJA 4RDUA 3AG3H 4H4KC 5FKOA 3GTGJ 1FSEA 2WB1N 1V5GA 2FBHA 3CQZJ 4XORA 2K5CA 2BEOA 3HRUA 3KZYA 2X48A 2DFEA 4A6DA 4CICA 4MQVA 3CZ6A 4RGXA 4YELA 4S05A 3L1PA 1A36A 3Q0UA 1DU0A 3HPGA 3IP4B 5FROA 3JCUC 1CF7A 2FBIA 3NQOA 1T38A 1QHGA 1MBKA 2VJIA 3WODF 2X6OA 3HTUA 3OYHA 2E1MB 5HLGA 2GWRA 2PX9A 4LOCA 3T1BA 4HX7A 1O7LA 3A1YA 1VQ6I 2CQ7A 1OCCH 3IH2A 1ODDA 3HGYA 3QYFA 3W2WA 3OV8A 4EJUA 3MZHA 2HWVA 2JK3A 2KIFA 4RM3A 3F8FA 1LPQA 4PCQA 3W6VA 3JW4A 1XMKA 1OR7A 1S7AA 1WZ2A 1B6AA 4Q4ZF 2QQ8A 2ZCWA 1NTCA 2K9NA 1SANA 5LHIA 1I27A 4I76A 3GFIA 5FD5A 2XAQA 3Q3SA 2VB6A 3D5SC 1IV8A 4PJNA 2HXIA 2EIMH 2HTJA 1PYVA 1FOWA 2X6XA 3P9KA 5L3FA 1FYKA 3JRAA 4XRFA 4RA2A 1ACIA 3BROA 3LSGA 4NUBA 1JKRC 3K2AA 3H3UA 3DQVC 3MKZA 3DEUA 2FMLA 1W7PA 3HBLA 1MMNA 2M8GX 4G7HF 3K70D 2MFZA 3S15J 2Z1DA 1VQ9I 1K6YA 1SD6A 3C2GA 2CUEA 5HDKA 2IS2A 2L54A 5A2QK 2FUG2 5LEKA 2A68F 2XV4S 5FLXZ 4BQAA 1MMGA 3BG5A 2M0CA 2XGDA 3MWMA 3J7ZI 2XRLA 1F1ZA 4FCYA 1SC7A 1E3HA 3B6AA 3G4SI 2EB7A 3CUQB 1JUSA 2DMPA 1ETQA 4FX4A 4KIGA 4FQGA 4UHTA 2DT6A 5IYCJ 4HLXA 5HLHA 1TWHJ 1YS7A 4O5VA 1I39A 2W85A 3CJRB 1IN6A 2CGPA 3X2QH 2F5CA 2CWEA 3CC2I 2DFIA 3M7GA 2L7MP 3P5JA 1S7OA 1WSUA 2XPWA 1OR7C 1LFBA 1RETA 1XDUA 5LGUA 2VJJA 4A3BJ 1Z77A 2KZGA 2PI0A 1SFXA 2DOFA 3LAJA 1R71A 2W82A 5EGOB 4A3GJ 2MG4A 3WG9A 2PMHA 3MCZA 1U3EM 1P4XA 5TJJA 1IN7A 1FBUA 3U2RA 3H1CA 1XTAA 2ZXHA 3MN2A 5CLSA 4LLLA 4D5FA 4E7KA 3M1EA 2EINH 4UV9A 1D1BA 1XX5A 3MQ0A 3AL0C 1FIPA 5D6FA 1GXQA 1IDZA 4GCVA 4V2FA 2L3DA 3G2BA 2HDDA 2ACJA 2KIQA 3KP5A 4PJ0C 4HSTA 1MBEA 3CDHA 1FP1D 2J5PA 1JTYA 2M9HA 2PLYA 3WG7H 3OS2A 2KRHA 1UJ8A 3K4BA 2VOPA 3IC7A 1FYLA 1CGPA 5LLQA 1RRJA 1FEXA 4IL6C 4LB5A 4M73A 1P92A 2LYCA 4XLEA 3HOYJ 2OC6A 3KYCB 5IOZA 2VQCA 3TDZC 1RC9A 2OUMA 2XVCA 2HPIA 4UUTA 2N8GA 1AWCA 3I53A 4HAMA 3RIRA 3H3ZA 3ECOA 1XG1A 2JSPA 3COAC 4G12A 5CVJA 1PJRA 2GQQA 3HSFA 2DYSH 2DA7A 2ME0A 2R3SA 2DPDA 1YG2A 2X1CA 4XRSA 5EEAA 3QU6A 4YIFA 4JK1X 3T8TA 5FLVA 3CCUI 1L0OC 4I99C 1ZREA 3FHNA 2F48A 4XNFA 4NHJA 3ZMUA 4KIFA 5GADJ 1BA5A 2CQQA 2MD0A 3F72A 3K1MA 2WY8Q 2ZKZA 3RZDJ 1R6RA 4QIWN 3EETA 2HOAA 2OV7A 2RNJA 5M3FJ 3HPHA 1W7PD 2OCEA 5BS6A 3IKVA 4XLFA 3HOXJ 1QGPA 5ILUA 4RS8A 4X1EA 3FMQA 3CD6I 5AIQA 3S2WA 4LMYA 1AHDP 2JN6A 4EJVA 2DOAA 5D8KB 4YG2F 2TDXA 4XMYA 1RZ4A 1T56A 2QUFA 3L00A 5B66C 2Y0SN 1EA3A 4P96A 1NH3A 3DU6A 4XOPA 1LE8A 1WCMJ 1SVMA 1BL0A 3CO6C 2L4MA 1ZK8A 3ZQHA 3S1QJ 3FISA 2GIVA 3J81Z 5FKMA 2EJRA 1OJLA 2NS0A 5AONA 5DTDA 1IC8A 3BPVA 3E97A 4X0GA 5CQEA 4LG0A 1X4PA 1FZPB 4N4OB 3VPRA 4HSRA 1QA6A 3AAFA 1WHUA 1K79A 4M9SA 2DFFA 2MA3A 2G7HA 1NG6A 5FKKA 5FLXK 5JLXA 1AOYA 3BPXA 2OJED 1OCTC 3V8LA 1MBGA 3LSIA 3ZMZA 3G1MA 2CFXA 4XONA 1LVAA 1ZH5A 5B5EC 4JX5A 2K02A 3S3OA 2HKOA 1YLFA 1R00A 4L0YB 4ANJA 3ZMVA 2ZC2A 1NG7A 3FXUA 4YEJA 2A5YB 1WJDA 3AFHA 3K1PA 4F93B 5KHDA 4DZJA 3IWZA 2PQ8A 2X0LA 4RAFA 2P81A 1VQLI 3WU2C 3I55I 5FFXA 3OSGA 4EJWA 3H5AA 1S29A 1K7AA 3E6DA 4DYCA 4FE7A 3GX4X 2EIKH 2EZHA 3KCCA 4BHCA 3VYUB 2HYJA 3KE2A 3KP3A 4BHBA 5CVIA 2JVHA 3OOUA 1D8JA 1UZCA 1SVOA 5LRRA 2HU9A 2IGKA 2BY0A 3D5LA 3CMEI 2STTA 1TT5B 4ZZLA 1JJ6C 4BYYA 1SFOJ 1CF7B 1XDSA 2E5NA 3ERED 1FLIA 2IAIA 1XC5A 3RSNA 4ZYDA 1FTZA 2LDUA 2NVYJ 3EUAA 2P0WA 3S32A 1XN7A 3GZ6A 2V1DA 1PUEE 1WRJA 2DCEA 5IY5H 3LWFA 5GPAA 1TTYA 3S14J 1FPQA 4J01A 2R7SA 1D5VA 1KU7A 2BHZA 2Y9YA 3A4CA 3HOSA 3FZVA 5BPDA 4M9ZA 3CCYA 3FXMA 4JX4A 3LAPA 2EV0A 5KAIC 5LGNA 3HRTA 1OISA 1KZHA 2VI6A 3WTTC 1UHSA 3CJNA 1KU3A 3PNTA 4KIBA 2BZTA 4XM3A 1YE9A 4RGRA 1IJWC 4A3DJ 1E0EA 1Z91A 3DFGA 2XSJC 4G7OF 3E0JB 1B59A 3RPQA 4CZZA 2BE5F 3EYIA 4BEHA 3RKYA 4E7HA 3H35A 4LIVA 3BY6A 4RM2A 3E5QA 2HVRA 2E7XA 2GAUA 2QQBA 4HX4A 3ZCOA 2B7EA 5CPRB 3ROUA 5TISC 1V5EA 4XRMA 3N05A 2DBBA 2ID3A 3DPLC 3E6MA 1LJ9A 4L9NA 5F04A 1RR8C 2DA5A 2XPUA 4L5IA 3E3VA 3GMEA 4II3A 2KISA 2O3FA 2P8TA 2W25A 1BC8C 3AL0B 1J9IA 3TP3A 3W2AA 2XHKA 3F8NA 1LKXA 3GFLA 3HUGA 4QWQA 4K2EA 3BCBA 3MKYB 4DYRA 5FJ8J 2P5LC 2MLGA 3G1OA 3BR6A 2QLZA 4ABZA 2UZKA 2H1LA 2VIXA 2DT5A 5E3MA 2JA2A 3ASOH 1U9OA 4WK8F 4UUVA 4ON0A 1V5FA 3GWZA 4B44A 3CCVI 4UB8C 3QYEA 3L09A 2JA7J 4A69C 2Z5UA 2VBZA 2MW8A 2R7FA 4BE1A 2XAJA 1A04A 5EDNA 3FKJA 3R4KA 3MAJA 1JE8A 3BTCA 2GA1A 1TC3C 5E1ZB 4OIPF 3HRSA 1REPC 2GM4A 3RDIA 3S2HJ 2VPLA 5CJ9A 1AKHA 3I4NJ 3AG4H 2KJCA 1NK3P 1QPIA 3H36A 5GPCA 3RI4A 2NOJB 1V54H 1A6IA 3M1CA 1XGMA 2Q8KA 3VFZA 4HNVA 1RKTA 3WTYC 2LD5A 1PP7U 4KISA 4ZH4F 4MQ9F 3DEWA 4LITA 4XKVA 1MD0A 3ZMDA 2Y48A 1RUOA 1B1BA 5LHGA 2OTJI 3K4NA 5M5XJ 4AD9A 2VONA 1J7KA 4E6KG 3TOAA 2PFBA 3J81K 1SMYF 3U1DA 3OYFA 3CMMA 4BNCA 1S6LA 3IKTA 4EJTA 2UV1A 5FB2A 1P9QC 2LFBA 2QM3A 5H6RA 4BE0A 3KIOA 1A35A 3RQIA 4A3FJ 2F6CA 2PN6A 4Y15A 2I10A 3DP7A 4C2TA 2AXTC 5GAHJ 3BOQA 4CCMA 2MD5A 2ZJRF 3PQJA 3RJPA 2D2WA 2L9RA 2GIZA 2LKSA 1QU3A 1WH5A 2R7TA 2WV1A 3BJ6A 4CCJA 3SZPA 2HVSA 2FNPA 4BQOA 3BR3A 3SFIA 4BACA 2DDAA 1GLNA 1WWXA 4D0PA 2J5OA 1G3YA 1M1EB 2ZSHB 2W4SA 2B9SA 3QPLA 2H94A 2K4BA 1G8XA 3F22A 2IBDA 1R1TA 3BG9A 2CMPA 5FRNA 1BJZA 5J40A 1S9HA 3HZJA 3S1RJ 1B72B 4G6TB 2Q2EA 2Q1ZB 3S3MA 3FKIJ 4BDZA 1IXRC 2EILH 4UXNA 4B3AA 3WU0A 3JRFA 1Z6RA 3T0YA 3HRMA 4GXOA 1MSEC 1FBQA 2RVCA 3B6CA 5B1AH 1YIJI 4HF0A 2FOKA 4A2UA 2K3PA 3QPTA 2E5ZA 2CUFA 3IAS2 4HQMA 1WJCA 1G6NA 5KVRA 2E1CA 2FX0A 1BI3A 3I59A 4TV7A 2EFQA 5K5QA 4ZYGA 3MFKA 5ERIA 3S1NJ 2DA3A 2DMNA 2G7UA 3BP8A 3I0TA 3BDDA 2O9LA 2XF7A 1OFCX 2KQRA 1XMAA 2BY2A 1BI1A 2ZJ2A 2HR3A 2KRFA 1IZ1A 1FBSA 3ONQA 2B0LA 1LVKA 2DLLA 3KPHA 3BTIA 2YSRA 3QODA 4KT6A 4RB3C 3OYGA 3JSOA 4I09A 1P6RA 2M3AA 3RCOA 2IEKA 3K69A 1I5ZA 2DAOA 3D0SA 3WGGA 2YS9A 3F6VA 1STZA 2RREA 3KFWX 1ZELA 3CCLI 1X1AA 4Z6YA 1LE8B 4LFUA 4PJLA 2H09A 5E20A 4HNUA 1ZAOA 4BXUA 3O3KA 2V1XA 1ETOA 4ASNA 2DJIA 4E70A 1QO0D 3HHHA 3IV5A 4E7JA 2XGCA 4ZDOA 1Z1DA 4MEYF 3AG1H 3I9V2 4LG0B 3BR5A 1WJ5A 2WWYA 4G8XA 1ETXA 4WXCA 5A2QZ 3Q5FA 2A6HF 1IRXA 3BQZA 4P1WA 4XLCA 5J1RA 1X3WB 3QOPA 2CO5A 2NVXJ 2ETHA 3DXJF 3R6SA 3LMMA 1S7EA 1J5YA 2ISYA 3S3NA 1ETWA 1IF1A
chains in the Genus database with same CATH topology
1HDDC 3HBLA 1WI3A 2M8GX 3FK6A 5F0HA 5M3MJ 1ZR2A 1H8AC 2R7ZJ 2R92J 3S15J 2CUEA 2L7ZA 3JR9A 1R9TJ 4AC0A 4M6VA 1GVDA 1JGGA 3BG5A 2M0CA 2XGDA 2DJNA 2XRLA 4FCYA 3F0CA 3B6AA 4W1UA 1JUSA 2E19A 2DMPA 4MO7A 2XGEA 2Y30A 1ETQA 4XK4A 1JT6A 2X9DA 2L7FP 5IYCJ 1TWHJ 3ZQCA 5IYDJ 3NARA 5K7FA 3H3VK 1ENHA 1GT0C 3CMYA 1QRYA 2HOTA 2L7MP 5C4JJ 3UKGA 2XPWA 1DU6A 3BG3A 1B8IB 1LFBA 1RETA 1F36A 1UMQA 4A3BJ 2K9SA 1Z77A 1TWAJ 3HEFA 4MFEA 3OIOA 5EYRA 1LFUP 1IGNA 5EGOB 4A3GJ 2MG4A 2O7OA 1ORKA 4Y7NJ 2KDZA 2XB5A 4M3FA 2LK2A 2JMWA 3SJMA 3I4MJ 4NDLA 3JRCA 3MN2A 2OPTA 3MVPA 1HF0A 3C2BA 3JRIA 4D5FA 3TP0A 2R5ZA 1HLVA 2DA4A 1ITYA 1F43A 1I3QJ 3LSPA 5F0FA 2NS8A 1TWGJ 1X2NA 1FIPA 1IDZA 1FIAA 4V2FA 2DA1A 5IYBJ 2EZLA 2HDDA 3JREA 3A01B 1MBEA 5F27A 4UUSA 5DS9A 1TWCJ 4MIMA 1JTYA 2M9HA 3BR1A 3GTJJ 4A3KJ 4A3JJ 2FQ4A 1FEXA 2E2HJ 2FD5A 2DMUA 4B1RA 2MGQA 4C3JJ 3HOYJ 4AUXA 5IOZA 1RPWA 1WPKA 1JKOC 4UUTA 2N8GA 3LSJA 3ZQFA 4XICA 5JLWA 4BXXJ 1XG1A 4FE4A 4AYBN 1IG7A 4G12A 4IHXA 1NK2P 2NS7A 2CRGA 2DA7A 2CU7A 3MKLA 3HB9A 1P7JA 2E2JJ 3DCFA 2ME0A 4XRSA 5EEAA 3H0GJ 5FLVA 3OSFA 1IRZA 3S17J 2K40A 3BQYA 3BR0A 2KT0A 1BW6A 3LOCA 4I6ZA 1AU7A 1BA5A 2CQQA 1RESA 3RZDJ 2HI3A 1U9NA 3ZQLA 3E7LA 4QIWN 2HOAA 3JRHA 3TW6A 4W97A 5M3FJ 1JTXA 2EZIA 2LTPA 4FTHA 2LP0A 2Y9ZA 4J19A 2DMTA 3GBGA 4XRSG 3JRGA 2DMQA 1MBHA 3HOXJ 4X1EA 3BR2A 1JKQC 2VKVA 2JA5J 1AHDP 2JN6A 5EG0B 4GFBA 2XPVA 1T56A 1HDPA 2JJ7A 2Y0SN 3CDLA 1LE8A 1WCMJ 1TWFJ 4JX6A 5IPAA 4CYCB 1BL0A 3S2DJ 1EF4A 1ZK8A 3ZQHA 3GTOJ 3S1QJ 2TRTA 3FISA 5FKMA 3K7AJ 1OJLA 5DTDA 1ETVA 1WGXA 4MFDA 1IC8A 4BY7J 4L5EA 4X6AJ 1Q1VA 1I6HJ 4A3LJ 2MSYA 4DYQA 1CQTA 3VPRA 2G0EA 3M3YJ 2COBA 4IEJA 5FKKA 1ETYA 5JLXA 4DZPA 4M3DA 1OCTC 1Z0XA 5EF6A 1MBGA 1QVUA 2L0KA 3G1MA 5E3LA 4JX5A 1K83J 2XB0X 2DA6A 1APLC 3HOWJ 4A3CJ 2VUMJ 3BTLA 4DZJA 2P81A 3OSGA 3ZQIA 1ZR4A 5E3NA 4DYCA 1PUFB 4FE7A 2EZHA 5F1JA 1GV2A 3RKQA 2HYJA 3G1LA 2LVSA 4DW6A 5GP9A 3OOUA 1MH4A 2H1KA 3RZOJ 5FKNA 1JJ6C 1SFOJ 2EH3A 3IH3A 1RR7A 4BKXA 3GTMJ 2IAIA 1XC5A 1FTZA 3JRDA 5IOYA 2NVYJ 1B8IA 1IDYA 3BT9A 4D7NA 5IP6A 2D5VA 4QTRA 4Y52J 5GPAA 1Y1WJ 5M5WJ 5EGOA 3S14J 3HOUJ 1W0UA 2Y9YA 3A03A 4B4CA 3CCYA 2R5YB 4JX4A 3PO3J 2DA2A 2GBYA 2ECBA 2VI6A 3BTJA 3S16J 1FTTA 3WHCA 2RAEA 1UHSA 3O8GA 3JRBA 4EEFG 1IJWC 4A3DJ 2H8RA 4M3GA 1Y1VJ 2ELKA 4IHWA 5M5YJ 3A02A 2R0QC 1YRNB 4A3EJ 9ANTA 3QPSA 2VKEA 1D5YA 1JJ8C 3O8HA 3D1NI 2ECCA 3A01A 2NVTJ 4MLOA 5J1UA 4XRMA 1ZQ3P 1AKHB 1HCRA 2ID3A 5F04A 2M2EA 2DA5A 2XPUA 4M3EA 4A93J 1JUMA 2K9QA 1H89C 3TP3A 1MBFA 2ID6A 2M34A 3HGGA 2GLOA 1ETKA 1U78A 2R5YA 1P7IA 3FIWA 1X58A 2OF7A 4DYRA 5FJ8J 3G1OA 3BR6A 4ABZA 1XS9A 1VNDA 2QCOA 5E3MA 1UG2A 1U9OA 5IP7J 4FISA 5C4XJ 1JUPA 5HODA 1GDTA 2JA7J 4A69C 2EQRA 5J3LA 2HOSA 2LLKA 3GTLJ 1H88C 2MW8A 3PM1A 3Q0WA 3Q0VA 4D5CA 1MH3A 1X2MA 3LNQA 1E3OC 1FJLA 1YRNA 5EDNA 1I50J 4JP0A 4S0HB 5K7ZA 2LR8A 3BTCA 1TC3C 2GM4A 3S2HJ 1T33A 1AKHA 3I4NJ 2EZKA 2EBIA 1QPIA 1NK3P 4V2GA 5GPCA 1O4XA 2NVQJ 4M3BA 1A6IA 2LD5A 4HNVA 1GV5A 1RKTA 2ZB9A 3M4OJ 2R93J 1VI0A 2AHQA 4A3IJ 3DEWA 3WHBA 2Y31A 4IHVA 2WAQN 5K7HA 5M5XJ 5C3EJ 2DTZA 5FLMJ 1K61A 2LFBA 3PO2J 1IUFA 3LSRA 2JA8J 3HOVJ 5EG0A 2VPRA 1G2HA 3RQIA 4A3FJ 1RKWA 2R5ZB 2AO9A 2I10A 1POGA 4XIDA 4C3HJ 4CYCA 2XSDC 1HOMA 1JKPC 1JT0A 3FK7A 2YU9J 2L9RA 1WH5A 1MBJA 4A3MJ 2FJ1A 2W48A 2WV1A 4D7MA 3TEDA 1BW5A 4C3IJ 3BR3A 3SFIA 4UUSB 2ME6A 4BY1J 2DN0A 1W0TA 3NAUA 2LKXA 5F0CA 2E2IJ 3QPLA 1A5JA 2HQ5A 4JYKA 4QSHA 1U8BA 1ZKGA 4C2MJ 3GTPJ 2IBDA 1OCPA 3BG9A 2Y2ZA 1BJZA 3S1RJ 1B72B 2B63J 3GTQJ 5E3OA 3FKIJ 2NOGA 2QF7A 4RDUA 5FKOA 4B3AA 3GTGJ 3JRFA 2HXOA 2WB1N 1GUUA 3CQZJ 1MSEC 3B6CA 3ZOBA 1PUFA 3HKZN 2X48A 2CJJA 2CUFA 3L1PA 1ZTRA 4BBRJ 5EZHA 1VF9A 1QVTA 3Q0UA 2FX0A 1DU0A 2YUSA 3HM5A 3S1NJ 2DA3A 1MBKA 2DMNA 2LY9A 5EZGA 5BNGA 1MNMC 3IH4A 5C44J 1ZGWA 2PMZN 2X6OA 2CQXA 2O9LA 1OFCX 3HDDA 4LOCA 4BBSJ 1B72A 1WH7A 5FKLA 3IH2A 4RBOA 1VFCA 1IV6A 3HGYA 3BTIA 5F08A 3HOZJ 2JK3A 2IEKA 2JWTA 2TCTA 2YS9A 3W6VA 3SDGA 5J1YA 1LE8B 3QQAA 3TW7A 1MSFC 2K9NA 1NTCA 1ETOA 1SANA 4I76A 3IV5A 3Q3SA 2XGCA 4IHYA 2E1OA 2HXIA 3BR5A 1ETXA 5IP9J 3ZQGA 3BQZA 5J1RA 3JRAA 3LSGA 1JKRC 2NVXJ 3K2AA 2O8KA 2JA6J 3S1MJ 1S7EA 3GTKJ 1ETWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HDD C;  3HBL A;  1WI3 A;  2M8G X;  3FK6 A;  5F0H A;  5M3M J;  1ZR2 A;  1H8A C;  2R7Z J;  2R92 J;  3S15 J;  2CUE A;  2L7Z A;  3JR9 A;  1R9T J;  4AC0 A;  4M6V A;  1GVD A;  1JGG A;  3BG5 A;  2M0C A;  2XGD A;  2DJN A;  2XRL A;  4FCY A;  3F0C A;  3B6A A;  4W1U A;  1JUS A;  2E19 A;  2DMP A;  4MO7 A;  2XGE A;  2Y30 A;  1ETQ A;  4XK4 A;  1JT6 A;  2X9D A;  2L7F P;  5IYC J;  1TWH J;  3ZQC A;  5IYD J;  3NAR A;  5K7F A;  3H3V K;  1ENH A;  1GT0 C;  3CMY A;  1QRY A;  2HOT A;  2L7M P;  5C4J J;  3UKG A;  2XPW A;  1DU6 A;  3BG3 A;  1B8I B;  1LFB A;  1RET A;  1F36 A;  1UMQ A;  4A3B J;  2K9S A;  1Z77 A;  1TWA J;  3HEF A;  4MFE A;  3OIO A;  5EYR A;  1LFU P;  1IGN A;  5EGO B;  4A3G J;  2MG4 A;  2O7O A;  1ORK A;  4Y7N J;  2KDZ A;  2XB5 A;  4M3F A;  2LK2 A;  2JMW A;  3SJM A;  3I4M J;  4NDL A;  3JRC A;  3MN2 A;  2OPT A;  3MVP A;  1HF0 A;  3C2B A;  3JRI A;  4D5F A;  3TP0 A;  2R5Z A;  1HLV A;  2DA4 A;  1ITY A;  1F43 A;  1I3Q J;  3LSP A;  5F0F A;  2NS8 A;  1TWG J;  1X2N A;  1FIP A;  1IDZ A;  1FIA A;  4V2F A;  2DA1 A;  5IYB J;  2EZL A;  2HDD A;  3JRE A;  3A01 B;  1MBE A;  5F27 A;  4UUS A;  5DS9 A;  1TWC J;  4MIM A;  1JTY A;  2M9H A;  3BR1 A;  3GTJ J;  4A3K J;  4A3J J;  2FQ4 A;  1FEX A;  2E2H J;  2FD5 A;  2DMU A;  4B1R A;  2MGQ A;  4C3J J;  3HOY J;  4AUX A;  5IOZ A;  1RPW A;  1WPK A;  1JKO C;  4UUT A;  2N8G A;  3LSJ A;  3ZQF A;  4XIC A;  5JLW A;  4BXX J;  1XG1 A;  4FE4 A;  4AYB N;  1IG7 A;  4G12 A;  4IHX A;  1NK2 P;  2NS7 A;  2CRG A;  2DA7 A;  2CU7 A;  3MKL A;  3HB9 A;  1P7J A;  2E2J J;  3DCF A;  2ME0 A;  4XRS A;  5EEA A;  3H0G J;  5FLV A;  3OSF A;  1IRZ A;  3S17 J;  2K40 A;  3BQY A;  3BR0 A;  2KT0 A;  1BW6 A;  3LOC A;  4I6Z A;  1AU7 A;  1BA5 A;  2CQQ A;  1RES A;  3RZD J;  2HI3 A;  1U9N A;  3ZQL A;  3E7L A;  4QIW N;  2HOA A;  3JRH A;  3TW6 A;  4W97 A;  5M3F J;  1JTX A;  2EZI A;  2LTP A;  4FTH A;  2LP0 A;  2Y9Z A;  4J19 A;  2DMT A;  3GBG A;  4XRS G;  3JRG A;  2DMQ A;  1MBH A;  3HOX J;  4X1E A;  3BR2 A;  1JKQ C;  2VKV A;  2JA5 J;  1AHD P;  2JN6 A;  5EG0 B;  4GFB A;  2XPV A;  1T56 A;  1HDP A;  2JJ7 A;  2Y0S N;  3CDL A;  1LE8 A;  1WCM J;  1TWF J;  4JX6 A;  5IPA A;  4CYC B;  1BL0 A;  3S2D J;  1EF4 A;  1ZK8 A;  3ZQH A;  3GTO J;  3S1Q J;  2TRT A;  3FIS A;  5FKM A;  3K7A J;  1OJL A;  5DTD A;  1ETV A;  1WGX A;  4MFD A;  1IC8 A;  4BY7 J;  4L5E A;  4X6A J;  1Q1V A;  1I6H J;  4A3L J;  2MSY A;  4DYQ A;  1CQT A;  3VPR A;  2G0E A;  3M3Y J;  2COB A;  4IEJ A;  5FKK A;  1ETY A;  5JLX A;  4DZP A;  4M3D A;  1OCT C;  1Z0X A;  5EF6 A;  1MBG A;  1QVU A;  2L0K A;  3G1M A;  5E3L A;  4JX5 A;  1K83 J;  2XB0 X;  2DA6 A;  1APL C;  3HOW J;  4A3C J;  2VUM J;  3BTL A;  4DZJ A;  2P81 A;  3OSG A;  3ZQI A;  1ZR4 A;  5E3N A;  4DYC A;  1PUF B;  4FE7 A;  2EZH A;  5F1J A;  1GV2 A;  3RKQ A;  2HYJ A;  3G1L A;  2LVS A;  4DW6 A;  5GP9 A;  3OOU A;  1MH4 A;  2H1K A;  3RZO J;  5FKN A;  1JJ6 C;  1SFO J;  2EH3 A;  3IH3 A;  1RR7 A;  4BKX A;  3GTM J;  2IAI A;  1XC5 A;  1FTZ A;  3JRD A;  5IOY A;  2NVY J;  1B8I A;  1IDY A;  3BT9 A;  4D7N A;  5IP6 A;  2D5V A;  4QTR A;  4Y52 J;  5GPA A;  1Y1W J;  5M5W J;  5EGO A;  3S14 J;  3HOU J;  1W0U A;  2Y9Y A;  3A03 A;  4B4C A;  3CCY A;  2R5Y B;  4JX4 A;  3PO3 J;  2DA2 A;  2GBY A;  2ECB A;  2VI6 A;  3BTJ A;  3S16 J;  1FTT A;  3WHC A;  2RAE A;  1UHS A;  3O8G A;  3JRB A;  4EEF G;  1IJW C;  4A3D J;  2H8R A;  4M3G A;  1Y1V J;  2ELK A;  4IHW A;  5M5Y J;  3A02 A;  2R0Q C;  1YRN B;  4A3E J;  9ANT A;  3QPS A;  2VKE A;  1D5Y A;  1JJ8 C;  3O8H A;  3D1N I;  2ECC A;  3A01 A;  2NVT J;  4MLO A;  5J1U A;  4XRM A;  1ZQ3 P;  1AKH B;  1HCR A;  2ID3 A;  5F04 A;  2M2E A;  2DA5 A;  2XPU A;  4M3E A;  4A93 J;  1JUM A;  2K9Q A;  1H89 C;  3TP3 A;  1MBF A;  2ID6 A;  2M34 A;  3HGG A;  2GLO A;  1ETK A;  1U78 A;  2R5Y A;  1P7I A;  3FIW A;  1X58 A;  2OF7 A;  4DYR A;  5FJ8 J;  3G1O A;  3BR6 A;  4ABZ A;  1XS9 A;  1VND A;  2QCO A;  5E3M A;  1UG2 A;  1U9O A;  5IP7 J;  4FIS A;  5C4X J;  1JUP A;  5HOD A;  1GDT A;  2JA7 J;  4A69 C;  2EQR A;  5J3L A;  2HOS A;  2LLK A;  3GTL J;  1H88 C;  2MW8 A;  3PM1 A;  3Q0W A;  3Q0V A;  4D5C A;  1MH3 A;  1X2M A;  3LNQ A;  1E3O C;  1FJL A;  1YRN A;  5EDN A;  1I50 J;  4JP0 A;  4S0H B;  5K7Z A;  2LR8 A;  3BTC A;  1TC3 C;  2GM4 A;  3S2H J;  1T33 A;  1AKH A;  3I4N J;  2EZK A;  2EBI A;  1QPI A;  1NK3 P;  4V2G A;  5GPC A;  1O4X A;  2NVQ J;  4M3B A;  1A6I A;  2LD5 A;  4HNV A;  1GV5 A;  1RKT A;  2ZB9 A;  3M4O J;  2R93 J;  1VI0 A;  2AHQ A;  4A3I J;  3DEW A;  3WHB A;  2Y31 A;  4IHV A;  2WAQ N;  5K7H A;  5M5X J;  5C3E J;  2DTZ A;  5FLM J;  1K61 A;  2LFB A;  3PO2 J;  1IUF A;  3LSR A;  2JA8 J;  3HOV J;  5EG0 A;  2VPR A;  1G2H A;  3RQI A;  4A3F J;  1RKW A;  2R5Z B;  2AO9 A;  2I10 A;  1POG A;  4XID A;  4C3H J;  4CYC A;  2XSD C;  1HOM A;  1JKP C;  1JT0 A;  3FK7 A;  2YU9 J;  2L9R A;  1WH5 A;  1MBJ A;  4A3M J;  2FJ1 A;  2W48 A;  2WV1 A;  4D7M A;  3TED A;  1BW5 A;  4C3I J;  3BR3 A;  3SFI A;  4UUS B;  2ME6 A;  4BY1 J;  2DN0 A;  1W0T A;  3NAU A;  2LKX A;  5F0C A;  2E2I J;  3QPL A;  1A5J A;  2HQ5 A;  4JYK A;  4QSH A;  1U8B A;  1ZKG A;  4C2M J;  3GTP J;  2IBD A;  1OCP A;  3BG9 A;  2Y2Z A;  1BJZ A;  3S1R J;  1B72 B;  2B63 J;  3GTQ J;  5E3O A;  3FKI J;  2NOG A;  2QF7 A;  4RDU A;  5FKO A;  4B3A A;  3GTG J;  3JRF A;  2HXO A;  2WB1 N;  1GUU A;  3CQZ J;  1MSE C;  3B6C A;  3ZOB A;  1PUF A;  3HKZ N;  2X48 A;  2CJJ A;  2CUF A;  3L1P A;  1ZTR A;  4BBR J;  5EZH A;  1VF9 A;  1QVT A;  3Q0U A;  2FX0 A;  1DU0 A;  2YUS A;  3HM5 A;  3S1N J;  2DA3 A;  1MBK A;  2DMN A;  2LY9 A;  5EZG A;  5BNG A;  1MNM C;  3IH4 A;  5C44 J;  1ZGW A;  2PMZ N;  2X6O A;  2CQX A;  2O9L A;  1OFC X;  3HDD A;  4LOC A;  4BBS J;  1B72 A;  1WH7 A;  5FKL A;  3IH2 A;  4RBO A;  1VFC A;  1IV6 A;  3HGY A;  3BTI A;  5F08 A;  3HOZ J;  2JK3 A;  2IEK A;  2JWT A;  2TCT A;  2YS9 A;  3W6V A;  3SDG A;  5J1Y A;  1LE8 B;  3QQA A;  3TW7 A;  1MSF C;  2K9N A;  1NTC A;  1ETO A;  1SAN A;  4I76 A;  3IV5 A;  3Q3S A;  2XGC A;  4IHY A;  2E1O A;  2HXI A;  3BR5 A;  1ETX A;  5IP9 J;  3ZQG A;  3BQZ A;  5J1R A;  3JRA A;  3LSG A;  1JKR C;  2NVX J;  3K2A A;  2O8K A;  2JA6 J;  3S1M J;  1S7E A;  3GTK J;  1ETW A; 
#chains in the Genus database with same CATH topology
 3DEE A;  2BV6 A;  4PFP A;  1D1C A;  4XQF A;  5M3M J;  1H8A C;  2R7Z J;  3K4M A;  3WE3 A;  3LQQ A;  3HKZ A;  4YII A;  4CCL A;  2V4J C;  3JR9 A;  4IJA A;  1R9T J;  2RC4 A;  4C2U A;  4AC0 A;  2BGC A;  3OYL A;  2A05 A;  1H0M A;  3ASN H;  3K4C A;  1PP8 F;  2F5E A;  4IF4 A;  2DJN A;  3WTU C;  2E19 A;  2MBF A;  5DCM B;  4MO7 A;  1DPU A;  1G3S A;  4XK4 A;  3U21 A;  3CCS I;  2Y0M A;  1IUY A;  2VE8 A;  3R0J A;  4G6Q A;  3TDU C;  4L9T A;  2L7F P;  2QSH X;  2PMZ A;  3ZQC A;  3B02 A;  3NAR A;  1T6S A;  5K7F A;  3H3V K;  2MYS A;  2DI3 A;  2KHM A;  1MMS A;  5CVU A;  2QKL B;  4KMF A;  4C9Y A;  5BMZ A;  2HOT A;  2FMY A;  2FQ3 A;  3DU5 A;  1KU2 A;  3KX2 A;  4AU7 A;  1F36 A;  2IGN A;  2CS3 A;  3L2V A;  4KJZ A;  2X1D A;  1TWA J;  1SD5 A;  1YS6 A;  4D1Q A;  1MKM A;  3OIO A;  1VQ7 I;  1LFU P;  1QPM A;  3EQL F;  1XGO A;  2ELH A;  2KDZ A;  1F9N A;  5DUK A;  2D1V A;  2FU4 A;  4HYE A;  4M3F A;  1G3W A;  4I98 B;  3FM3 A;  3PSF A;  3MVP A;  1HF0 A;  5HLI A;  4E7L A;  1HLV A;  1KYZ A;  3F6O A;  1F43 A;  1R36 A;  2HS5 A;  3LSP A;  3GLX A;  4BJT A;  1YX5 A;  4BEH B;  3K70 C;  4O6J A;  4C30 A;  4AVZ A;  4BHP A;  2DA1 A;  1TQM A;  5IYB J;  3L2Q A;  4XN0 A;  2FRH A;  2XAF A;  1D0X A;  2FE3 A;  3I3L A;  2OQR A;  1Y39 A;  5EJC A;  3OOP A;  5DS9 A;  1TWC J;  3SEQ A;  1SVL A;  2XIG A;  1VQP I;  3M9A A;  4GYI A;  3GTJ J;  2ZFU A;  2WA0 A;  3CJQ B;  4NBQ A;  2FD5 A;  4HPQ A;  3IRR A;  2DMU A;  1XSV A;  3T5X A;  4OIQ F;  2O5R A;  4AUX A;  4KUM A;  3HUG B;  3TO6 A;  1WPK A;  3FMR A;  3E6B A;  3L2U A;  3ABU A;  5JLW A;  3V42 A;  5L3C A;  4BXX J;  4RGU A;  1Z6T A;  1Z7L A;  1OCO H;  4IHX A;  3P9I A;  4HF1 A;  2DT7 B;  1T8I A;  1U0J A;  3JTH A;  4AIK A;  3HB9 A;  3V7R A;  2VT2 A;  4R1H A;  4FT8 A;  3PIP F;  2H27 A;  1TNT A;  1YW9 A;  2KMU A;  3S17 J;  3DBL B;  2MH2 A;  3BR0 A;  1WFX A;  1BW6 A;  1WJF A;  2K4J A;  1FSH A;  5BOX A;  2ELJ A;  1LQ1 A;  4OU0 A;  3SYT A;  1O7F A;  1BN5 A;  3WGI A;  4ETS A;  1RES A;  2CW0 F;  3M8E A;  4QPO A;  4BDY A;  3E7L A;  1XCB A;  2DQL A;  4BJ6 C;  4W97 A;  1BOB A;  3OYC A;  1BI2 A;  2H6C A;  2LP0 A;  2UUZ A;  1PVE A;  4J19 A;  2MH9 A;  3GBG A;  4XRS G;  3VYR B;  2AS5 F;  2VC0 A;  1HA8 A;  2DMQ A;  1MBH A;  3JTG A;  5LRS A;  1WI9 A;  4ESJ A;  1MW7 A;  3BR2 A;  1JKQ C;  2OBP A;  2EV6 A;  1S3J A;  3EDP A;  4Y4R A;  3V7C A;  3PJR A;  2XPV A;  3QP5 A;  4EGY A;  4KYW A;  1TLH B;  4WF2 A;  2IVM A;  3CDL A;  3LL7 A;  3KYL A;  3TO7 A;  3S2D J;  2AXL A;  5JR3 A;  2EA2 A;  3KEQ A;  2TRT A;  3R0A A;  5E79 C;  1D3Y A;  1TQI A;  2W24 A;  4X6A J;  1Q1V A;  3H92 A;  4A3L J;  2JPC A;  3OL4 A;  1VQM I;  2KIU A;  3V8K A;  2G0E A;  1U6G A;  2OTL I;  4IOC F;  3M3Y J;  5B1B H;  4OIO F;  5J4Y A;  5EEH A;  4M3D A;  2R7R A;  4UVC A;  5JVT A;  5EF6 A;  5LD2 C;  1XGS A;  3ZMS A;  2LBF B;  1QVU A;  4LG3 A;  4I2O A;  2V26 A;  2WAD A;  2DTR A;  2M0M A;  2V7F A;  4LLN A;  4L5J A;  2Q2E B;  2XB0 X;  4WCG A;  2DA6 A;  4LK0 F;  1APL C;  2VOD A;  2L02 A;  3HOW J;  4A3C J;  1PDN C;  2AQF A;  2L2O A;  1TW3 A;  3ZQI A;  1ZR4 A;  4EMS A;  2KDO A;  5E3N A;  1MIJ A;  2WV0 A;  4AVP A;  4CXF A;  4PGG A;  2L9V A;  5K1Y A;  5D5U B;  5E17 F;  3OYJ A;  1WKM A;  3K9T A;  3SQN A;  4PSX A;  2LVS A;  2KKO A;  3GUD A;  3FX3 A;  2HDW A;  1VTN C;  1WQ2 A;  4ZTJ A;  2IS1 A;  5KCM A;  1MH4 A;  4FAS D;  5FKN A;  3CC4 I;  4RB0 A;  5ICG A;  4B8X A;  5DDG A;  3QPH A;  1RR7 A;  5D6E A;  1UG0 A;  4BKX A;  3A0B C;  3WGH A;  1MNE A;  3JSP A;  1XD7 A;  1B8I A;  4EV0 A;  1VQK I;  2RQP A;  3H5N A;  4YFK F;  2PJR A;  4QTR A;  2L01 A;  2L9S A;  4Y52 J;  4KIC A;  2M1B A;  4CZC A;  3HOT A;  1Y1W J;  5TRD A;  1FT9 A;  3KEO A;  1D0Y A;  3GZ5 A;  3A03 A;  4I01 A;  4IKF A;  2G9W A;  3PO3 J;  5HS7 A;  2V9P A;  3RQ4 A;  2GBY A;  3BTJ A;  3S16 J;  2H6B A;  4CHU A;  2IRF G;  1R22 A;  2VC1 A;  3SFZ A;  3L2C A;  3W6K B;  4EEF G;  2CUJ A;  1FC3 A;  1IO2 A;  2EPF A;  3ERM A;  3I71 A;  3HSE A;  1Y1V J;  1YHQ I;  4PFO A;  4HBL A;  3VSK A;  4HW0 A;  4KFC A;  3WTS C;  1QZZ A;  2HYF A;  2LC2 A;  2R0Q C;  4Q48 A;  5KAF C;  2ZNZ A;  3KP4 A;  2XKP A;  1Y8Q B;  2Q0O A;  1D5Y A;  1JJ8 C;  3O8H A;  2DYR H;  3D1N I;  4U88 A;  4XL9 A;  2NVT J;  2Y75 A;  5J1U A;  2QEX I;  1E2X A;  4G94 A;  2E60 A;  1HCR A;  2M2E A;  2A3S A;  1GXP A;  3ABL H;  2A61 A;  2GA2 A;  2K9Q A;  1FMV A;  3N97 A;  1H89 C;  5ICE A;  3OS1 A;  2HYG D;  1O3T A;  2ID6 A;  2M34 A;  2GLO A;  2ZXI A;  1YYV A;  2EWN A;  2R5Y A;  1X58 A;  2XAH A;  1B9M A;  1MJB A;  2X1E A;  4ZDP A;  1G4D A;  3FXQ A;  3WTV C;  1J09 A;  1XS9 A;  1VND A;  2I8D A;  3HIF A;  1TBX A;  1VQ8 I;  2UXN A;  5DD8 A;  3QU3 A;  2A07 F;  3WE2 A;  3H9J A;  1ERD A;  5FFZ A;  1JUP A;  2NYX A;  5HOD A;  2WY7 Q;  3ABM H;  3GTL J;  1H88 C;  3Q0W A;  2CV2 A;  1E3O C;  2VBX A;  1YRN A;  4PK4 A;  4JP0 A;  2LR8 A;  1IRF A;  2HVQ A;  2K7L A;  2R7D A;  2ZBK A;  4NQW A;  4A6E A;  1IN4 A;  1MJ9 A;  1T33 A;  2IA2 A;  2Y69 H;  2NXN B;  2FBK A;  1HBX G;  1D0Z A;  1W5S A;  1O4X A;  2NVQ J;  3CF2 A;  4BQQ A;  4WXH A;  1H9T A;  2JTV A;  2RKH A;  5HOO A;  3R61 A;  5C3E J;  3Q9V A;  4E7S A;  2DTZ A;  2XF6 A;  3KYD B;  1EV7 A;  3MKW B;  1K61 A;  2Z9O A;  2CQN A;  4IQ4 A;  4QPQ A;  4EJO A;  4EAT A;  2VJ4 A;  4IZZ A;  1FYM A;  2EA4 A;  3PO2 J;  1IUF A;  3LSR A;  3G71 I;  1QQI A;  5EG0 A;  1ZG3 A;  2VPR A;  3OYN A;  2DPU A;  3RTR A;  4HDV A;  3LQR A;  2F5F A;  4UV8 A;  1QZE A;  3C18 A;  4XID A;  4C3H J;  1HOM A;  2XSD C;  5LHH A;  2CUZ A;  1JT0 A;  3AKZ A;  3SHF A;  5EEG A;  1O3S A;  4A3M J;  5GAG J;  2FJ1 A;  2BXY A;  1BW5 A;  4PDK A;  2CH0 A;  1S5L C;  4MNU A;  3NWS A;  2F2E A;  4GO1 A;  2ME6 A;  3OMY A;  1HC8 A;  3CMA I;  1W0T A;  2X6W A;  3NAU A;  2KFD A;  2M45 A;  3OIP A;  4JYK A;  4QSH A;  1I3A A;  4C2M J;  3DTI A;  3GTP J;  5LBQ A;  1TZL A;  1VQO I;  2CG4 A;  1P2F A;  3ZN0 A;  1SAX A;  4ENN A;  2ZFW A;  2B63 J;  2BBY A;  1U5T A;  5BPI A;  4XOT A;  1P4A A;  2HXO A;  3K1N A;  2FNA A;  3GYH X;  1GUU A;  5HDG A;  1DUX C;  1KGS A;  3ZOB A;  3HKZ N;  4IQJ A;  4ZZD A;  2VOO A;  3BCA A;  4BU2 A;  1OCR H;  5CYV A;  1LEB A;  1O57 A;  1FJL A;  1VZ0 A;  2GOM A;  3C2H A;  2QBY A;  1ZTR A;  4BBR J;  2VXD A;  5EZH A;  1F4K A;  1VF9 A;  1QVT A;  5DEQ A;  2FF4 A;  2CW7 A;  2YUS A;  2HOE A;  2C6Y A;  2UXX A;  3Q9S A;  3UR3 C;  5K5R A;  5E8G A;  1OMI A;  2K85 A;  5EZG A;  3O6B B;  2FOW A;  3IH4 A;  2QA4 I;  1ZGW A;  1X1P A;  3E5U A;  2PMZ N;  3GVA A;  2CQX A;  2EFP A;  4F92 B;  4PSW A;  3VOD A;  1ZHF A;  3HDD A;  1MZB A;  4BBS J;  1WH7 A;  4U0W A;  5FKL A;  1IV6 A;  3BLY A;  1N77 A;  4L9J A;  1W7P B;  2YPR A;  2F5D A;  4U0V A;  4Y33 A;  1XSD A;  2XRN A;  5F08 A;  4BS9 A;  3HOZ J;  2IGM A;  1BR1 A;  2DK5 A;  2LG4 A;  3HG9 A;  4KA4 A;  2JWT A;  3KP6 A;  2KPM A;  3PUB A;  3F9K A;  3TOB A;  5E18 F;  5J1Y A;  3FDY A;  2OQG A;  3QQA A;  4NB5 A;  2E1N A;  3EUK L;  4CH7 A;  1W1W E;  5LFA A;  5J47 A;  4OIR F;  1OCZ H;  4IHY A;  1IN5 A;  1Z3X A;  5TGT A;  2YX7 A;  2E1O A;  2HFH A;  4IRG A;  4XBF A;  3TGN A;  3TMO A;  5IP9 J;  3ZQG A;  3FM5 A;  1ZRD A;  1UB9 A;  4JOM A;  2DDB A;  1W36 D;  1N75 A;  3LA3 A;  2HGC A;  1TNS A;  2JA6 J;  3IUO A;  3S1M J;  1HDD C;  3K4J A;  4A0Y A;  3VWB A;  1V4R A;  1YJ9 I;  5F0H A;  3FK6 A;  1ZR2 A;  2VXZ A;  1J75 A;  5IT9 K;  4L9V A;  5DD4 A;  4DBR A;  2ZSI B;  3M8F A;  3ABK H;  3A2K A;  3BZ6 A;  1H9G A;  2V6E A;  2KIM A;  4FET A;  5E1W A;  4M6V A;  1GVD A;  1MJA A;  3LA2 A;  3OL3 A;  4OAY A;  4EGZ A;  2OA4 A;  3MZ8 A;  4W1U A;  1NHA A;  1R5H A;  3FF5 A;  1LB2 A;  3E6C C;  2XGE A;  1JHH A;  1RUN A;  2P4W A;  1JT6 A;  3IRQ A;  4HV6 A;  3K6G A;  1FOK A;  2GOX B;  3K4K A;  3FXL A;  5IYD J;  4OWR B;  1GT0 C;  3GFM A;  3L2W A;  4OOI A;  3GF2 A;  3WTZ A;  2VBY A;  1KQ8 A;  1QRY A;  2IJL A;  1S8N A;  3SZT A;  2QWW A;  2ESN A;  5C4J J;  3UKG A;  4XN3 A;  3BG3 A;  5CVR A;  1B8I B;  2VKD A;  1E3P A;  2CFO A;  1UMQ A;  4CUG A;  2PJR B;  2K9S A;  3HEF A;  1R5G A;  3RKW A;  1WJA A;  4MFE A;  2BY1 A;  5EYR A;  4KIT B;  1IGN A;  4M6X A;  4J00 A;  1RI7 A;  2O7O A;  3KZI C;  4CCO A;  1USS A;  5IT3 A;  4XKW A;  2PBI A;  5HS8 A;  2ISZ A;  2XB5 A;  2STW A;  2HQN A;  3ML6 A;  3W2V A;  4NDL A;  3JRC A;  3ECH A;  1LUJ B;  2RN7 A;  2DOD A;  3C2B A;  3JRI A;  2V79 A;  1Z67 A;  1YIT I;  1YO5 C;  2QQ9 A;  2O61 A;  4BJ5 C;  4YIR X;  2HZD A;  1MND A;  1Z3Y A;  2GZW A;  3BG7 A;  5F0F A;  2NS8 A;  3DLA A;  2V9V A;  3TQN A;  4E7Z A;  1YFH A;  2OAZ A;  4CA0 A;  3QRF F;  3B73 A;  3F23 A;  4DOZ A;  2EZL A;  2P5K A;  2WBM A;  3JRE A;  1OKR A;  5F27 A;  1N78 A;  4OMY A;  4MIM A;  2DFH A;  3ZR8 X;  3BR1 A;  3OYI A;  5GTH C;  4ZYH A;  5ICF A;  1OYY A;  4UVB A;  4QLC U;  5E8I A;  2E2H J;  2MGQ A;  4C3J J;  1HW1 A;  4XLP F;  2ZXW H;  4FX0 A;  2VT3 A;  4V19 K;  2IGO A;  5ILS A;  1L3L A;  3CCQ I;  1IN8 A;  1JKO C;  2PG4 A;  3T8R A;  4IO9 F;  3F21 A;  1LNW A;  2CV0 A;  1IG7 A;  2IT0 A;  1FOY A;  1NK2 P;  3H9G A;  2IS6 A;  3VB2 A;  1SD4 A;  1RNL A;  3KLO A;  4IRH A;  1K4S A;  3H0G J;  3OSF A;  1T98 A;  2K40 A;  2LNB A;  3G6E I;  1HXD A;  3J7A Y;  1W4M A;  2MC4 A;  4F3Q A;  2I5U A;  2KT0 A;  1JI8 A;  3LOC A;  5D8L B;  4I6Z A;  2NAZ A;  4RMN A;  2HKX A;  1AU7 A;  2E34 A;  4XR6 A;  2JZY A;  1GHC A;  2HI3 A;  1UHW A;  1UAA A;  1U9N A;  2BVM A;  2QVO A;  2OZ6 A;  3JRH A;  2JRM A;  2Y9Z A;  3DPU A;  3JRG A;  2XKO A;  3J7Y J;  2FSW A;  3GFJ A;  1Z9C A;  2VKV A;  1F5T A;  2JA5 J;  4HRI A;  3CC7 I;  3PUF A;  1R4M B;  4F7Z A;  5EG0 B;  4GFB A;  3HSR A;  3MEX A;  4XKC A;  3OYE A;  1KQ0 A;  1YX3 A;  2JJ7 A;  4RB2 C;  4KDP A;  3EYY A;  1TWF J;  1TW2 A;  4IX7 A;  5HLT A;  3D5R C;  1EF4 A;  1W5C C;  3GTO J;  4GGG A;  3H5R A;  4ZTF A;  3K7A J;  1BOA A;  1WGX A;  2OD5 A;  4BY7 J;  4B47 A;  4RAZ A;  2MSY A;  4DYQ A;  3ZGK A;  3IAM 2;  1FOX A;  4IEJ A;  4DZP A;  1N25 A;  3PIO F;  4WX9 A;  1R1V A;  1Z0X A;  2HQA A;  2VQH A;  2JQ7 A;  3ZP5 A;  5JHF A;  2L0K A;  3KP2 A;  3C3W A;  5E3L A;  3V4G A;  4AYB A;  2M7A A;  3LA7 A;  3SDB A;  4F55 A;  1HQC A;  2JUC A;  4HV5 A;  2ICW G;  2ZXJ A;  4LGW A;  2XAU A;  1B9N A;  3FMS A;  4FHT A;  3RPU D;  5D5W B;  2VUM J;  1JHF A;  3BTL A;  1KU9 A;  4OIN F;  4KT5 C;  2Z33 A;  2VKH A;  3FXR A;  1IW7 F;  2RGV A;  1U2W A;  2PMU A;  3WTX C;  4HG2 A;  3ZQQ A;  2K9L A;  5F1J A;  2VLA A;  2QBY B;  2W57 A;  2HQR A;  4E4H A;  3PNV A;  5CQG A;  2H1K A;  4XLA A;  4MTE A;  2EFW A;  4N4N B;  1FY7 A;  1DGR M;  1Y56 A;  4EQQ A;  4ESF A;  3A0H C;  4U7D A;  3I54 A;  1A6Q A;  3J80 Z;  2LY2 A;  2A6E F;  1EH6 A;  4LB6 B;  1X1B A;  2HTS A;  4MHG A;  3ZXS A;  4ENM A;  3HJE A;  3ZQ7 A;  1LFP A;  1TP4 A;  1WJE A;  2MLK A;  4RLF A;  5IP6 A;  1VQ4 I;  2D5V A;  3DWL E;  3FWE A;  4EM0 B;  3HOU J;  5B3S H;  2X6Y A;  4NC6 A;  4B4C A;  3TL4 X;  2JT1 A;  4EM2 A;  1DQU A;  4N9H A;  2DA2 A;  4Q47 A;  5FD6 A;  1FTT A;  1J0R A;  2ECB A;  2ADU A;  1G3T A;  3WHC A;  3C1D A;  3O8G A;  3CP8 A;  3W6J B;  1R7J A;  3K10 A;  2QZ8 A;  4M3G A;  2HPM A;  1OLT A;  3BG6 A;  3I64 A;  2O03 A;  2F4O B;  4RGS A;  2PJP A;  9ANT A;  3QPS A;  1DDN A;  3DPT A;  2VKE A;  4BUP A;  3GZN B;  2F5V A;  3A01 A;  3TBI A;  3VOE A;  4MLO A;  3ELK A;  4CCN A;  1AKH B;  4ZDL A;  1TL8 A;  2ZO4 A;  2QQA A;  1JXS A;  3DBH B;  1P4W A;  1SAU A;  4R79 A;  3CUO A;  2IA0 A;  3CTA A;  1MBF A;  2F4M B;  4ZYE A;  2NRA C;  5L3E A;  1XSX A;  2VJ5 A;  2M7B A;  1KYW A;  2LF8 A;  3OIQ A;  2OU2 A;  3OS0 A;  5FGM A;  2L5Q A;  1Q1H A;  5KNL A;  4UNO A;  4FIS A;  2FXA A;  3I58 A;  3EUH A;  1GDT A;  3GEZ A;  2EQR A;  2HOS A;  1BR4 A;  5L3B A;  3PM1 A;  3Q0V A;  1X2M A;  3ZRG A;  4MGR A;  4S0H B;  2D1H A;  2R7V A;  1ON1 A;  2IA1 A;  2XDV A;  2JSC A;  5ILV A;  2DW4 A;  2EZK A;  4KMU X;  4G7Z F;  4MEX F;  4UY8 I;  1VQ5 I;  4DGW B;  3ULQ B;  3WU1 B;  3GW2 A;  3G73 A;  3QP6 A;  2R93 J;  1VI0 A;  4A3I J;  1YTY A;  2BY3 A;  4EVI A;  4BXF A;  1KA8 A;  1FMW A;  4B3X A;  5DM6 F;  5K7H A;  3HYI A;  5JFR A;  3CES A;  2XF5 A;  2L7K A;  2A5W A;  2M4K A;  4CYD A;  3OY9 A;  1XGN A;  4P55 A;  5F64 A;  1RKW A;  2XRO A;  2AO9 A;  2WTE A;  3L7W A;  1POG A;  3DKX A;  1Y8R B;  3I4P A;  5L3G A;  4CYC A;  5K5O A;  3SXY A;  1C0W A;  3FK7 A;  2ZJP F;  2YU9 J;  1QNT A;  1MBJ A;  4D7M A;  2R7W A;  5BQT A;  4C3I J;  4S04 A;  4B09 A;  1X4O A;  2QKM B;  3IWF A;  2RDP A;  4A0X A;  3I59 B;  3IHU A;  1EH8 A;  1X1D A;  4Y13 A;  2OZU A;  3EUH C;  2E2I J;  1A5J A;  4G9Y A;  2HQ5 A;  4DBQ A;  2BYV E;  2ZJQ F;  1QBJ A;  3CJT B;  2CW8 A;  1ZKG A;  4NC8 A;  1OCP A;  2NVU B;  2Y2Z A;  2Z16 A;  4GDF A;  4ENJ A;  3GTQ J;  1LDJ A;  1WJB A;  2E71 A;  2P5V A;  3NWT A;  2NOG A;  2VL8 A;  3VSL A;  4RB1 A;  3NRV A;  2E35 A;  1ULY A;  3KEY A;  4Z2Y A;  3BJA A;  1PUF A;  3J80 K;  4UB6 C;  2AQE A;  2CJJ A;  2JVG A;  3CDI A;  3MD2 A;  2M4G A;  3MMY B;  5D5V B;  1IXC A;  3PL8 A;  5F1R A;  3E1S A;  2IPQ X;  5LGT A;  1YJN I;  1UFM A;  3HM5 A;  4LLG F;  2LY9 A;  2WAF A;  5BNG A;  1MNM C;  2WAQ A;  2VAS A;  3RYR A;  3L9F A;  5C44 J;  1IXS B;  2K3F A;  2LOO A;  3SZG A;  4A5M A;  1T95 A;  2W84 A;  5DUI A;  4Y3O A;  5KK1 A;  3WTW C;  4IVN A;  1K78 A;  2V1U A;  1B72 A;  2RQQ A;  4RBO A;  5AIP A;  4DNC A;  1VFC A;  5H2F C;  2YR2 A;  1MDM A;  4LIU A;  2DK8 A;  3M07 A;  3CCM I;  2LY1 A;  4ITV A;  1X19 A;  3M8J A;  3DBR B;  2QSG X;  4DQ2 A;  1LEA A;  2TCT A;  2LH9 A;  1SMT A;  3SDG A;  2HNH A;  4AIJ A;  2UWM A;  4CO8 A;  5F6F A;  1DP3 A;  3TW7 A;  5FO5 A;  2GXG A;  4IHS A;  1MSF C;  1SD7 A;  2Z2S B;  1X1C A;  1Z7U A;  4P9U A;  5IT9 Z;  4U0Y A;  4UVA A;  4HF2 A;  4I7H A;  4F91 B;  2K9M A;  3LSK A;  4BAY A;  1FWZ A;  1ZYR F;  2O8K A;  2XGX A;  2COM A;  4YFN F;  2M8E A;  3GTK J;  1UHM A;  4II2 A;  2X85 A;  1WI3 A;  1X3Z B;  1YW8 A;  4XKB A;  3S8P A;  1E17 A;  2R92 J;  1YJW I;  1T0F A;  3S93 A;  3PFY A;  2WB1 A;  1RIO H;  3FBI B;  4RAY A;  4P9F A;  4A5N A;  4ZC3 A;  3BJO A;  4IPA A;  3W3C A;  2L7Z A;  4PJM A;  1LDK B;  4N0B A;  5JI6 A;  3F8M A;  2GXA A;  1JGG A;  5DYM A;  2BVL A;  3GLL A;  1ZG5 A;  3F0C A;  2LMD A;  3DLL F;  3GXO A;  2Y30 A;  3PNY A;  2HZT A;  4MTD A;  1HSJ A;  5GTI C;  2X9D A;  2P6S A;  2XC7 A;  3H0D A;  5D4R A;  4L0Z B;  2LRD A;  3AG2 H;  3HC7 A;  2P6T A;  1ENH A;  5HVQ C;  2GXB A;  1BIB A;  3ZN1 A;  3CMY A;  3MZY A;  3VDX A;  2KL4 A;  3VYT B;  3CCR I;  2L9N A;  2ZME A;  1DU6 A;  5CKT A;  1Y6I A;  4M9X A;  3LST A;  4IHT A;  4YFX F;  1T39 A;  1HST A;  3PFI A;  5DV5 A;  4ESB A;  1ORK A;  1XMX A;  4Y7N J;  3LSM A;  3PSI A;  4WXD A;  2LK2 A;  2JMW A;  3SJM A;  3I4M J;  1VQN I;  5H20 A;  2JRT A;  4ZYA A;  2EK5 A;  2OPT A;  3C7J A;  5DCM A;  2BW3 A;  4B48 A;  6PAX A;  2M30 A;  3TP0 A;  1W36 C;  4O3M A;  2R5Z A;  2EIJ H;  2QSF X;  2DA4 A;  1ITY A;  4CDG A;  1I3Q J;  1W5T A;  2YU3 A;  1TWG J;  1X2N A;  1QZY A;  1T0F C;  1FIA A;  3GCM A;  4I0A A;  3U1K A;  3OYB A;  2EV5 A;  3A01 B;  4UUS A;  2D45 A;  4KN4 X;  4A3J J;  1UEL B;  3CLQ A;  3HXL A;  4A3K J;  1JGS A;  3RYP A;  2FQ4 A;  4B1R A;  1Z05 A;  4Q5S F;  2XUB A;  5JVG F;  1O3R A;  1RPW A;  4HNT A;  2CSO A;  2O0Y A;  3ZQF A;  3LSJ A;  4XIC A;  2V9K A;  4FE4 A;  4AYB N;  3F8B A;  1FNN A;  3ABT A;  2LSO A;  2NS7 A;  2ZME C;  3ISP A;  4OAZ A;  2CRG A;  2CU7 A;  3MKL A;  1P7J A;  2E2J J;  3DCF A;  3K0L A;  3R60 A;  1YW7 A;  3EPZ A;  5FRM A;  5JHU A;  1SEU A;  1IRZ A;  1AA7 A;  4M6Y A;  2R7O A;  1A31 A;  5HDN A;  3OR1 C;  3BQY A;  4G6D A;  3REO A;  4HOB A;  1IAW A;  3OR2 C;  3QOE A;  1ZN2 A;  1XPX A;  3SEZ A;  4CSW A;  3I5U A;  1U5T C;  2QYO A;  3QAH A;  4HEA 2;  3ZQL A;  1EJ9 A;  3J7A O;  4AIH A;  4ENK A;  1R23 A;  3TW6 A;  4CCK A;  1JTX A;  2EZI A;  2LTP A;  2O8X A;  4HZF A;  1UST A;  4FTH A;  3FXK A;  2DMT A;  3LFK A;  1YIO A;  1OPC A;  5DCF A;  3K4L A;  2CQK A;  5D4S A;  4JQF A;  1SFK A;  4PGH A;  1I6X A;  2HEO A;  3BZC A;  4BQN A;  1GVJ A;  3KET A;  4E7I A;  1MMA A;  2MC3 A;  4IXA A;  1HDP A;  2EFO A;  3OYD A;  1BBY A;  4JX6 A;  5IPA A;  4CYC B;  1I1G A;  1OYW A;  1ONV A;  2NNY A;  1HW2 A;  3LFU A;  2X4H A;  3U9G A;  1ETV A;  1I1S A;  4MFD A;  4L5E A;  5J4V A;  1HW5 A;  3BWG A;  2VE9 A;  1ZLK A;  1I6H J;  3VEP A;  1CQT A;  2KZV A;  1IRG A;  2Z3Y A;  5L3D A;  3VYS B;  2COB A;  2KJB A;  4LK1 F;  1T08 B;  2ZNY A;  1ETY A;  4BGD A;  5GAE J;  1LDD A;  2V1N A;  3BZK A;  2W7N A;  4HQE A;  2IP2 A;  1ZGA A;  2VBW A;  2DO7 A;  3JAM Z;  3CCJ I;  3F3X A;  4BE2 A;  5CVV A;  3O2P E;  1ZAR A;  4XSX F;  2BXZ A;  2VN2 A;  1K83 J;  3CO7 C;  2A69 F;  2E7W A;  4IOA F;  3N4M A;  4XLH A;  4WWC A;  3FXJ A;  1J59 A;  4IRI A;  3RPU A;  3HL2 A;  2HDC A;  1TQP A;  3GO5 A;  3TO9 A;  4YRV A;  4HLY A;  3K2Z A;  2E1M C;  1PUF B;  3CUQ A;  2FEZ A;  2VQL A;  1S72 I;  4GYG A;  2R7X A;  1GV2 A;  3RKQ A;  4PZJ A;  3G1L A;  2RNG A;  2A6T A;  2M87 A;  3ZMT A;  5D5X B;  5GP9 A;  4DW6 A;  4A12 A;  1YI2 I;  4HA8 A;  4KNY A;  1ZRF A;  4HX8 A;  1OQY A;  3RZO J;  4U87 A;  1R58 A;  2IXS A;  2EH3 A;  3IH3 A;  3GTM J;  4NC7 A;  2YX4 A;  3FHZ A;  3JRD A;  2LBF A;  3P7N A;  1OYI A;  3DV8 A;  5IOY A;  2K27 A;  2LF7 A;  2Z99 A;  1IDY A;  3BT9 A;  4D7N A;  3NEU A;  2VQG A;  5H6Q A;  1K78 B;  2QEN A;  3DF8 A;  4M71 A;  1G59 A;  1MDM B;  5M5W J;  5EGO A;  3I56 I;  5ED4 A;  1W0U A;  2Y0S A;  1UCR A;  1DGW Y;  4L18 B;  1EH7 A;  2R5Y B;  4B43 A;  3OWT A;  1SFU A;  4PUS A;  2F4I A;  3P9C A;  2RAE A;  3JRB A;  1ZGJ A;  5J8C A;  1T2K A;  1DPR A;  2H8R A;  2RV8 A;  4CGZ A;  2W00 A;  2ELK A;  4IHW A;  5J6X A;  1BR2 A;  4H0E A;  5HNH A;  3OYK A;  5M5Y J;  1U8R A;  3L2R A;  3A02 A;  2DXI A;  4AWX B;  2BOL A;  4A0Z A;  3OYM A;  4A3E J;  1YRN B;  2CYY A;  2MAB A;  4M74 A;  3KP7 A;  1HKQ A;  3G3Z A;  1Y0U A;  3QWL A;  2ECC A;  4JBA A;  4NQW B;  3FXO A;  3LSH A;  1R1U A;  1EKE A;  1ZQ3 P;  4F52 A;  1ZLJ A;  1B4A A;  3TKY A;  1QHH D;  3H9Q A;  4D9J A;  3CUQ C;  1Y0N A;  4M3E A;  4OMZ A;  1JUM A;  4P5O A;  3FBN B;  4A93 J;  1X3U A;  1HKT A;  2FA5 A;  3HGG A;  1ETK A;  2W1O A;  1U78 A;  1P7I A;  3FIW A;  2X51 A;  4AM3 A;  2OF7 A;  1BIA A;  4RLQ A;  4DIQ A;  1V55 H;  5E1X A;  1V3F A;  2DOE A;  3DKW A;  1ZRC A;  2QCO A;  3KZZ A;  3BC8 A;  3V7S A;  1UG2 A;  3QYB A;  1BI0 A;  4DJA A;  5IP7 J;  1J2X A;  2JPB A;  1D8K A;  1ON2 A;  5C4X J;  1BM9 A;  2ESH A;  2BHY A;  2R7Q A;  4M72 A;  3PQK A;  5J3L A;  2LLK A;  5DM7 F;  3E5X A;  4D5C A;  1MH3 A;  1BJA A;  3LNQ A;  2QGU A;  2XAG A;  1DP7 P;  5ICC A;  5J8F A;  1I50 J;  2K86 A;  3ESW B;  3KLN A;  4KN7 X;  4HDU A;  5K7Z A;  2V6C A;  2CV1 A;  1XCV A;  4ZJZ A;  4AID A;  1YOV B;  3DTE A;  2EBI A;  1O3Q A;  4V2G A;  4R8H A;  4Y17 A;  1R49 A;  4M3B A;  2ZME B;  1GV5 A;  2E36 A;  2ZB9 A;  3M4O J;  1YQA A;  2AHQ A;  2WC2 A;  3WHB A;  2IS4 A;  3HTS B;  3V8J A;  4NNJ A;  2Y31 A;  4IHV A;  2KLO A;  2WAQ N;  2DQR A;  2L4A A;  3CF5 F;  4XLN F;  3UNG C;  2P7C B;  1Z21 A;  4RAG A;  3CLO A;  5LEJ A;  2R7U A;  5FLM J;  2O6G E;  4LD5 A;  3HHG A;  2BW3 B;  2JA8 J;  3HOV J;  1KQ9 A;  4I0B A;  3OYA A;  3CCE I;  1G2H A;  1KON A;  1R4N B;  1U5T B;  2P7V B;  3F8C A;  4LJZ F;  2R5Z B;  2EFN A;  2XAS A;  1K6O A;  2KP6 A;  4U7B A;  1ZG1 A;  4GRI A;  2R4G A;  1FX7 A;  1SFE A;  2KRC A;  2M5W A;  4BL0 B;  5HNF A;  1JKP C;  2OCC H;  4BH9 A;  3DTK A;  3JAM K;  2W48 A;  3TED A;  2H8W A;  1TT0 A;  2DU9 A;  1D1A A;  4I02 A;  4UUS B;  3RKX A;  4BY1 J;  3ZPL A;  1MGT A;  2DN0 A;  3IL2 A;  4XSZ F;  2LKX A;  4N9I A;  5F0C A;  2LRE A;  1XB4 A;  3CP2 A;  3DKY A;  2WAE A;  1MMD A;  2JUG A;  1U8B A;  2LKP A;  1WVR A;  5HS9 A;  2PEX A;  1BC7 C;  1R5I D;  1FP2 A;  1K4T A;  2NNN A;  2IW5 A;  5E3O A;  2QF7 A;  4EM1 A;  1HKS A;  4PJJ A;  4RDU A;  3AG3 H;  4H4K C;  5FKO A;  3GTG J;  1FSE A;  2WB1 N;  1V5G A;  2FBH A;  3CQZ J;  4XOR A;  2K5C A;  2BEO A;  3HRU A;  3KZY A;  2X48 A;  2DFE A;  4A6D A;  4CIC A;  4MQV A;  3CZ6 A;  4RGX A;  4YEL A;  4S05 A;  3L1P A;  1A36 A;  3Q0U A;  1DU0 A;  3HPG A;  3IP4 B;  5FRO A;  3JCU C;  1CF7 A;  2FBI A;  3NQO A;  1T38 A;  1QHG A;  1MBK A;  2VJI A;  3WOD F;  2X6O A;  3HTU A;  3OYH A;  2E1M B;  5HLG A;  2GWR A;  2PX9 A;  4LOC A;  3T1B A;  4HX7 A;  1O7L A;  3A1Y A;  1VQ6 I;  2CQ7 A;  1OCC H;  3IH2 A;  1ODD A;  3HGY A;  3QYF A;  3W2W A;  3OV8 A;  4EJU A;  3MZH A;  2HWV A;  2JK3 A;  2KIF A;  4RM3 A;  3F8F A;  1LPQ A;  4PCQ A;  3W6V A;  3JW4 A;  1XMK A;  1OR7 A;  1S7A A;  1WZ2 A;  1B6A A;  4Q4Z F;  2QQ8 A;  2ZCW A;  1NTC A;  2K9N A;  1SAN A;  5LHI A;  1I27 A;  4I76 A;  3GFI A;  5FD5 A;  2XAQ A;  3Q3S A;  2VB6 A;  3D5S C;  1IV8 A;  4PJN A;  2HXI A;  2EIM H;  2HTJ A;  1PYV A;  1FOW A;  2X6X A;  3P9K A;  5L3F A;  1FYK A;  3JRA A;  4XRF A;  4RA2 A;  1ACI A;  3BRO A;  3LSG A;  4NUB A;  1JKR C;  3K2A A;  3H3U A;  3DQV C;  3MKZ A;  3DEU A;  2FML A;  1W7P A;  3HBL A;  1MMN A;  2M8G X;  4G7H F;  3K70 D;  2MFZ A;  3S15 J;  2Z1D A;  1VQ9 I;  1K6Y A;  1SD6 A;  3C2G A;  2CUE A;  5HDK A;  2IS2 A;  2L54 A;  5A2Q K;  2FUG 2;  5LEK A;  2A68 F;  2XV4 S;  5FLX Z;  4BQA A;  1MMG A;  3BG5 A;  2M0C A;  2XGD A;  3MWM A;  3J7Z I;  2XRL A;  1F1Z A;  4FCY A;  1SC7 A;  1E3H A;  3B6A A;  3G4S I;  2EB7 A;  3CUQ B;  1JUS A;  2DMP A;  1ETQ A;  4FX4 A;  4KIG A;  4FQG A;  4UHT A;  2DT6 A;  5IYC J;  4HLX A;  5HLH A;  1TWH J;  1YS7 A;  4O5V A;  1I39 A;  2W85 A;  3CJR B;  1IN6 A;  2CGP A;  3X2Q H;  2F5C A;  2CWE A;  3CC2 I;  2DFI A;  3M7G A;  2L7M P;  3P5J A;  1S7O A;  1WSU A;  2XPW A;  1OR7 C;  1LFB A;  1RET A;  1XDU A;  5LGU A;  2VJJ A;  4A3B J;  1Z77 A;  2KZG A;  2PI0 A;  1SFX A;  2DOF A;  3LAJ A;  1R71 A;  2W82 A;  5EGO B;  4A3G J;  2MG4 A;  3WG9 A;  2PMH A;  3MCZ A;  1U3E M;  1P4X A;  5TJJ A;  1IN7 A;  1FBU A;  3U2R A;  3H1C A;  1XTA A;  2ZXH A;  3MN2 A;  5CLS A;  4LLL A;  4D5F A;  4E7K A;  3M1E A;  2EIN H;  4UV9 A;  1D1B A;  1XX5 A;  3MQ0 A;  3AL0 C;  1FIP A;  5D6F A;  1GXQ A;  1IDZ A;  4GCV A;  4V2F A;  2L3D A;  3G2B A;  2HDD A;  2ACJ A;  2KIQ A;  3KP5 A;  4PJ0 C;  4HST A;  1MBE A;  3CDH A;  1FP1 D;  2J5P A;  1JTY A;  2M9H A;  2PLY A;  3WG7 H;  3OS2 A;  2KRH A;  1UJ8 A;  3K4B A;  2VOP A;  3IC7 A;  1FYL A;  1CGP A;  5LLQ A;  1RRJ A;  1FEX A;  4IL6 C;  4LB5 A;  4M73 A;  1P92 A;  2LYC A;  4XLE A;  3HOY J;  2OC6 A;  3KYC B;  5IOZ A;  2VQC A;  3TDZ C;  1RC9 A;  2OUM A;  2XVC A;  2HPI A;  4UUT A;  2N8G A;  1AWC A;  3I53 A;  4HAM A;  3RIR A;  3H3Z A;  3ECO A;  1XG1 A;  2JSP A;  3COA C;  4G12 A;  5CVJ A;  1PJR A;  2GQQ A;  3HSF A;  2DYS H;  2DA7 A;  2ME0 A;  2R3S A;  2DPD A;  1YG2 A;  2X1C A;  4XRS A;  5EEA A;  3QU6 A;  4YIF A;  4JK1 X;  3T8T A;  5FLV A;  3CCU I;  1L0O C;  4I99 C;  1ZRE A;  3FHN A;  2F48 A;  4XNF A;  4NHJ A;  3ZMU A;  4KIF A;  5GAD J;  1BA5 A;  2CQQ A;  2MD0 A;  3F72 A;  3K1M A;  2WY8 Q;  2ZKZ A;  3RZD J;  1R6R A;  4QIW N;  3EET A;  2HOA A;  2OV7 A;  2RNJ A;  5M3F J;  3HPH A;  1W7P D;  2OCE A;  5BS6 A;  3IKV A;  4XLF A;  3HOX J;  1QGP A;  5ILU A;  4RS8 A;  4X1E A;  3FMQ A;  3CD6 I;  5AIQ A;  3S2W A;  4LMY A;  1AHD P;  2JN6 A;  4EJV A;  2DOA A;  5D8K B;  4YG2 F;  2TDX A;  4XMY A;  1RZ4 A;  1T56 A;  2QUF A;  3L00 A;  5B66 C;  2Y0S N;  1EA3 A;  4P96 A;  1NH3 A;  3DU6 A;  4XOP A;  1LE8 A;  1WCM J;  1SVM A;  1BL0 A;  3CO6 C;  2L4M A;  1ZK8 A;  3ZQH A;  3S1Q J;  3FIS A;  2GIV A;  3J81 Z;  5FKM A;  2EJR A;  1OJL A;  2NS0 A;  5AON A;  5DTD A;  1IC8 A;  3BPV A;  3E97 A;  4X0G A;  5CQE A;  4LG0 A;  1X4P A;  1FZP B;  4N4O B;  3VPR A;  4HSR A;  1QA6 A;  3AAF A;  1WHU A;  1K79 A;  4M9S A;  2DFF A;  2MA3 A;  2G7H A;  1NG6 A;  5FKK A;  5FLX K;  5JLX A;  1AOY A;  3BPX A;  2OJE D;  1OCT C;  3V8L A;  1MBG A;  3LSI A;  3ZMZ A;  3G1M A;  2CFX A;  4XON A;  1LVA A;  1ZH5 A;  5B5E C;  4JX5 A;  2K02 A;  3S3O A;  2HKO A;  1YLF A;  1R00 A;  4L0Y B;  4ANJ A;  3ZMV A;  2ZC2 A;  1NG7 A;  3FXU A;  4YEJ A;  2A5Y B;  1WJD A;  3AFH A;  3K1P A;  4F93 B;  5KHD A;  4DZJ A;  3IWZ A;  2PQ8 A;  2X0L A;  4RAF A;  2P81 A;  1VQL I;  3WU2 C;  3I55 I;  5FFX A;  3OSG A;  4EJW A;  3H5A A;  1S29 A;  1K7A A;  3E6D A;  4DYC A;  4FE7 A;  3GX4 X;  2EIK H;  2EZH A;  3KCC A;  4BHC A;  3VYU B;  2HYJ A;  3KE2 A;  3KP3 A;  4BHB A;  5CVI A;  2JVH A;  3OOU A;  1D8J A;  1UZC A;  1SVO A;  5LRR A;  2HU9 A;  2IGK A;  2BY0 A;  3D5L A;  3CME I;  2STT A;  1TT5 B;  4ZZL A;  1JJ6 C;  4BYY A;  1SFO J;  1CF7 B;  1XDS A;  2E5N A;  3ERE D;  1FLI A;  2IAI A;  1XC5 A;  3RSN A;  4ZYD A;  1FTZ A;  2LDU A;  2NVY J;  3EUA A;  2P0W A;  3S32 A;  1XN7 A;  3GZ6 A;  2V1D A;  1PUE E;  1WRJ A;  2DCE A;  5IY5 H;  3LWF A;  5GPA A;  1TTY A;  3S14 J;  1FPQ A;  4J01 A;  2R7S A;  1D5V A;  1KU7 A;  2BHZ A;  2Y9Y A;  3A4C A;  3HOS A;  3FZV A;  5BPD A;  4M9Z A;  3CCY A;  3FXM A;  4JX4 A;  3LAP A;  2EV0 A;  5KAI C;  5LGN A;  3HRT A;  1OIS A;  1KZH A;  2VI6 A;  3WTT C;  1UHS A;  3CJN A;  1KU3 A;  3PNT A;  4KIB A;  2BZT A;  4XM3 A;  1YE9 A;  4RGR A;  1IJW C;  4A3D J;  1E0E A;  1Z91 A;  3DFG A;  2XSJ C;  4G7O F;  3E0J B;  1B59 A;  3RPQ A;  4CZZ A;  2BE5 F;  3EYI A;  4BEH A;  3RKY A;  4E7H A;  3H35 A;  4LIV A;  3BY6 A;  4RM2 A;  3E5Q A;  2HVR A;  2E7X A;  2GAU A;  2QQB A;  4HX4 A;  3ZCO A;  2B7E A;  5CPR B;  3ROU A;  5TIS C;  1V5E A;  4XRM A;  3N05 A;  2DBB A;  2ID3 A;  3DPL C;  3E6M A;  1LJ9 A;  4L9N A;  5F04 A;  1RR8 C;  2DA5 A;  2XPU A;  4L5I A;  3E3V A;  3GME A;  4II3 A;  2KIS A;  2O3F A;  2P8T A;  2W25 A;  1BC8 C;  3AL0 B;  1J9I A;  3TP3 A;  3W2A A;  2XHK A;  3F8N A;  1LKX A;  3GFL A;  3HUG A;  4QWQ A;  4K2E A;  3BCB A;  3MKY B;  4DYR A;  5FJ8 J;  2P5L C;  2MLG A;  3G1O A;  3BR6 A;  2QLZ A;  4ABZ A;  2UZK A;  2H1L A;  2VIX A;  2DT5 A;  5E3M A;  2JA2 A;  3ASO H;  1U9O A;  4WK8 F;  4UUV A;  4ON0 A;  1V5F A;  3GWZ A;  4B44 A;  3CCV I;  4UB8 C;  3QYE A;  3L09 A;  2JA7 J;  4A69 C;  2Z5U A;  2VBZ A;  2MW8 A;  2R7F A;  4BE1 A;  2XAJ A;  1A04 A;  5EDN A;  3FKJ A;  3R4K A;  3MAJ A;  1JE8 A;  3BTC A;  2GA1 A;  1TC3 C;  5E1Z B;  4OIP F;  3HRS A;  1REP C;  2GM4 A;  3RDI A;  3S2H J;  2VPL A;  5CJ9 A;  1AKH A;  3I4N J;  3AG4 H;  2KJC A;  1NK3 P;  1QPI A;  3H36 A;  5GPC A;  3RI4 A;  2NOJ B;  1V54 H;  1A6I A;  3M1C A;  1XGM A;  2Q8K A;  3VFZ A;  4HNV A;  1RKT A;  3WTY C;  2LD5 A;  1PP7 U;  4KIS A;  4ZH4 F;  4MQ9 F;  3DEW A;  4LIT A;  4XKV A;  1MD0 A;  3ZMD A;  2Y48 A;  1RUO A;  1B1B A;  5LHG A;  2OTJ I;  3K4N A;  5M5X J;  4AD9 A;  2VON A;  1J7K A;  4E6K G;  3TOA A;  2PFB A;  3J81 K;  1SMY F;  3U1D A;  3OYF A;  3CMM A;  4BNC A;  1S6L A;  3IKT A;  4EJT A;  2UV1 A;  5FB2 A;  1P9Q C;  2LFB A;  2QM3 A;  5H6R A;  4BE0 A;  3KIO A;  1A35 A;  3RQI A;  4A3F J;  2F6C A;  2PN6 A;  4Y15 A;  2I10 A;  3DP7 A;  4C2T A;  2AXT C;  5GAH J;  3BOQ A;  4CCM A;  2MD5 A;  2ZJR F;  3PQJ A;  3RJP A;  2D2W A;  2L9R A;  2GIZ A;  2LKS A;  1QU3 A;  1WH5 A;  2R7T A;  2WV1 A;  3BJ6 A;  4CCJ A;  3SZP A;  2HVS A;  2FNP A;  4BQO A;  3BR3 A;  3SFI A;  4BAC A;  2DDA A;  1GLN A;  1WWX A;  4D0P A;  2J5O A;  1G3Y A;  1M1E B;  2ZSH B;  2W4S A;  2B9S A;  3QPL A;  2H94 A;  2K4B A;  1G8X A;  3F22 A;  2IBD A;  1R1T A;  3BG9 A;  2CMP A;  5FRN A;  1BJZ A;  5J40 A;  1S9H A;  3HZJ A;  3S1R J;  1B72 B;  4G6T B;  2Q2E A;  2Q1Z B;  3S3M A;  3FKI J;  4BDZ A;  1IXR C;  2EIL H;  4UXN A;  4B3A A;  3WU0 A;  3JRF A;  1Z6R A;  3T0Y A;  3HRM A;  4GXO A;  1MSE C;  1FBQ A;  2RVC A;  3B6C A;  5B1A H;  1YIJ I;  4HF0 A;  2FOK A;  4A2U A;  2K3P A;  3QPT A;  2E5Z A;  2CUF A;  3IAS 2;  4HQM A;  1WJC A;  1G6N A;  5KVR A;  2E1C A;  2FX0 A;  1BI3 A;  3I59 A;  4TV7 A;  2EFQ A;  5K5Q A;  4ZYG A;  3MFK A;  5ERI A;  3S1N J;  2DA3 A;  2DMN A;  2G7U A;  3BP8 A;  3I0T A;  3BDD A;  2O9L A;  2XF7 A;  1OFC X;  2KQR A;  1XMA A;  2BY2 A;  1BI1 A;  2ZJ2 A;  2HR3 A;  2KRF A;  1IZ1 A;  1FBS A;  3ONQ A;  2B0L A;  1LVK A;  2DLL A;  3KPH A;  3BTI A;  2YSR A;  3QOD A;  4KT6 A;  4RB3 C;  3OYG A;  3JSO A;  4I09 A;  1P6R A;  2M3A A;  3RCO A;  2IEK A;  3K69 A;  1I5Z A;  2DAO A;  3D0S A;  3WGG A;  2YS9 A;  3F6V A;  1STZ A;  2RRE A;  3KFW X;  1ZEL A;  3CCL I;  1X1A A;  4Z6Y A;  1LE8 B;  4LFU A;  4PJL A;  2H09 A;  5E20 A;  4HNU A;  1ZAO A;  4BXU A;  3O3K A;  2V1X A;  1ETO A;  4ASN A;  2DJI A;  4E70 A;  1QO0 D;  3HHH A;  3IV5 A;  4E7J A;  2XGC A;  4ZDO A;  1Z1D A;  4MEY F;  3AG1 H;  3I9V 2;  4LG0 B;  3BR5 A;  1WJ5 A;  2WWY A;  4G8X A;  1ETX A;  4WXC A;  5A2Q Z;  3Q5F A;  2A6H F;  1IRX A;  3BQZ A;  4P1W A;  4XLC A;  5J1R A;  1X3W B;  3QOP A;  2CO5 A;  2NVX J;  2ETH A;  3DXJ F;  3R6S A;  3LMM A;  1S7E A;  1J5Y A;  2ISY A;  3S3N A;  1ETW A;  1IF1 A; 
#chains in the Genus database with same CATH homology
 1HDD C;  3HBL A;  1WI3 A;  2M8G X;  3FK6 A;  5F0H A;  5M3M J;  1ZR2 A;  1H8A C;  2R7Z J;  2R92 J;  3S15 J;  2CUE A;  2L7Z A;  3JR9 A;  1R9T J;  4AC0 A;  4M6V A;  1GVD A;  1JGG A;  3BG5 A;  2M0C A;  2XGD A;  2DJN A;  2XRL A;  4FCY A;  3F0C A;  3B6A A;  4W1U A;  1JUS A;  2E19 A;  2DMP A;  4MO7 A;  2XGE A;  2Y30 A;  1ETQ A;  4XK4 A;  1JT6 A;  2X9D A;  2L7F P;  5IYC J;  1TWH J;  3ZQC A;  5IYD J;  3NAR A;  5K7F A;  3H3V K;  1ENH A;  1GT0 C;  3CMY A;  1QRY A;  2HOT A;  2L7M P;  5C4J J;  3UKG A;  2XPW A;  1DU6 A;  3BG3 A;  1B8I B;  1LFB A;  1RET A;  1F36 A;  1UMQ A;  4A3B J;  2K9S A;  1Z77 A;  1TWA J;  3HEF A;  4MFE A;  3OIO A;  5EYR A;  1LFU P;  1IGN A;  5EGO B;  4A3G J;  2MG4 A;  2O7O A;  1ORK A;  4Y7N J;  2KDZ A;  2XB5 A;  4M3F A;  2LK2 A;  2JMW A;  3SJM A;  3I4M J;  4NDL A;  3JRC A;  3MN2 A;  2OPT A;  3MVP A;  1HF0 A;  3C2B A;  3JRI A;  4D5F A;  3TP0 A;  2R5Z A;  1HLV A;  2DA4 A;  1ITY A;  1F43 A;  1I3Q J;  3LSP A;  5F0F A;  2NS8 A;  1TWG J;  1X2N A;  1FIP A;  1IDZ A;  1FIA A;  4V2F A;  2DA1 A;  5IYB J;  2EZL A;  2HDD A;  3JRE A;  3A01 B;  1MBE A;  5F27 A;  4UUS A;  5DS9 A;  1TWC J;  4MIM A;  1JTY A;  2M9H A;  3BR1 A;  3GTJ J;  4A3K J;  4A3J J;  2FQ4 A;  1FEX A;  2E2H J;  2FD5 A;  2DMU A;  4B1R A;  2MGQ A;  4C3J J;  3HOY J;  4AUX A;  5IOZ A;  1RPW A;  1WPK A;  1JKO C;  4UUT A;  2N8G A;  3LSJ A;  3ZQF A;  4XIC A;  5JLW A;  4BXX J;  1XG1 A;  4FE4 A;  4AYB N;  1IG7 A;  4G12 A;  4IHX A;  1NK2 P;  2NS7 A;  2CRG A;  2DA7 A;  2CU7 A;  3MKL A;  3HB9 A;  1P7J A;  2E2J J;  3DCF A;  2ME0 A;  4XRS A;  5EEA A;  3H0G J;  5FLV A;  3OSF A;  1IRZ A;  3S17 J;  2K40 A;  3BQY A;  3BR0 A;  2KT0 A;  1BW6 A;  3LOC A;  4I6Z A;  1AU7 A;  1BA5 A;  2CQQ A;  1RES A;  3RZD J;  2HI3 A;  1U9N A;  3ZQL A;  3E7L A;  4QIW N;  2HOA A;  3JRH A;  3TW6 A;  4W97 A;  5M3F J;  1JTX A;  2EZI A;  2LTP A;  4FTH A;  2LP0 A;  2Y9Z A;  4J19 A;  2DMT A;  3GBG A;  4XRS G;  3JRG A;  2DMQ A;  1MBH A;  3HOX J;  4X1E A;  3BR2 A;  1JKQ C;  2VKV A;  2JA5 J;  1AHD P;  2JN6 A;  5EG0 B;  4GFB A;  2XPV A;  1T56 A;  1HDP A;  2JJ7 A;  2Y0S N;  3CDL A;  1LE8 A;  1WCM J;  1TWF J;  4JX6 A;  5IPA A;  4CYC B;  1BL0 A;  3S2D J;  1EF4 A;  1ZK8 A;  3ZQH A;  3GTO J;  3S1Q J;  2TRT A;  3FIS A;  5FKM A;  3K7A J;  1OJL A;  5DTD A;  1ETV A;  1WGX A;  4MFD A;  1IC8 A;  4BY7 J;  4L5E A;  4X6A J;  1Q1V A;  1I6H J;  4A3L J;  2MSY A;  4DYQ A;  1CQT A;  3VPR A;  2G0E A;  3M3Y J;  2COB A;  4IEJ A;  5FKK A;  1ETY A;  5JLX A;  4DZP A;  4M3D A;  1OCT C;  1Z0X A;  5EF6 A;  1MBG A;  1QVU A;  2L0K A;  3G1M A;  5E3L A;  4JX5 A;  1K83 J;  2XB0 X;  2DA6 A;  1APL C;  3HOW J;  4A3C J;  2VUM J;  3BTL A;  4DZJ A;  2P81 A;  3OSG A;  3ZQI A;  1ZR4 A;  5E3N A;  4DYC A;  1PUF B;  4FE7 A;  2EZH A;  5F1J A;  1GV2 A;  3RKQ A;  2HYJ A;  3G1L A;  2LVS A;  4DW6 A;  5GP9 A;  3OOU A;  1MH4 A;  2H1K A;  3RZO J;  5FKN A;  1JJ6 C;  1SFO J;  2EH3 A;  3IH3 A;  1RR7 A;  4BKX A;  3GTM J;  2IAI A;  1XC5 A;  1FTZ A;  3JRD A;  5IOY A;  2NVY J;  1B8I A;  1IDY A;  3BT9 A;  4D7N A;  5IP6 A;  2D5V A;  4QTR A;  4Y52 J;  5GPA A;  1Y1W J;  5M5W J;  5EGO A;  3S14 J;  3HOU J;  1W0U A;  2Y9Y A;  3A03 A;  4B4C A;  3CCY A;  2R5Y B;  4JX4 A;  3PO3 J;  2DA2 A;  2GBY A;  2ECB A;  2VI6 A;  3BTJ A;  3S16 J;  1FTT A;  3WHC A;  2RAE A;  1UHS A;  3O8G A;  3JRB A;  4EEF G;  1IJW C;  4A3D J;  2H8R A;  4M3G A;  1Y1V J;  2ELK A;  4IHW A;  5M5Y J;  3A02 A;  2R0Q C;  1YRN B;  4A3E J;  9ANT A;  3QPS A;  2VKE A;  1D5Y A;  1JJ8 C;  3O8H A;  3D1N I;  2ECC A;  3A01 A;  2NVT J;  4MLO A;  5J1U A;  4XRM A;  1ZQ3 P;  1AKH B;  1HCR A;  2ID3 A;  5F04 A;  2M2E A;  2DA5 A;  2XPU A;  4M3E A;  4A93 J;  1JUM A;  2K9Q A;  1H89 C;  3TP3 A;  1MBF A;  2ID6 A;  2M34 A;  3HGG A;  2GLO A;  1ETK A;  1U78 A;  2R5Y A;  1P7I A;  3FIW A;  1X58 A;  2OF7 A;  4DYR A;  5FJ8 J;  3G1O A;  3BR6 A;  4ABZ A;  1XS9 A;  1VND A;  2QCO A;  5E3M A;  1UG2 A;  1U9O A;  5IP7 J;  4FIS A;  5C4X J;  1JUP A;  5HOD A;  1GDT A;  2JA7 J;  4A69 C;  2EQR A;  5J3L A;  2HOS A;  2LLK A;  3GTL J;  1H88 C;  2MW8 A;  3PM1 A;  3Q0W A;  3Q0V A;  4D5C A;  1MH3 A;  1X2M A;  3LNQ A;  1E3O C;  1FJL A;  1YRN A;  5EDN A;  1I50 J;  4JP0 A;  4S0H B;  5K7Z A;  2LR8 A;  3BTC A;  1TC3 C;  2GM4 A;  3S2H J;  1T33 A;  1AKH A;  3I4N J;  2EZK A;  2EBI A;  1QPI A;  1NK3 P;  4V2G A;  5GPC A;  1O4X A;  2NVQ J;  4M3B A;  1A6I A;  2LD5 A;  4HNV A;  1GV5 A;  1RKT A;  2ZB9 A;  3M4O J;  2R93 J;  1VI0 A;  2AHQ A;  4A3I J;  3DEW A;  3WHB A;  2Y31 A;  4IHV A;  2WAQ N;  5K7H A;  5M5X J;  5C3E J;  2DTZ A;  5FLM J;  1K61 A;  2LFB A;  3PO2 J;  1IUF A;  3LSR A;  2JA8 J;  3HOV J;  5EG0 A;  2VPR A;  1G2H A;  3RQI A;  4A3F J;  1RKW A;  2R5Z B;  2AO9 A;  2I10 A;  1POG A;  4XID A;  4C3H J;  4CYC A;  2XSD C;  1HOM A;  1JKP C;  1JT0 A;  3FK7 A;  2YU9 J;  2L9R A;  1WH5 A;  1MBJ A;  4A3M J;  2FJ1 A;  2W48 A;  2WV1 A;  4D7M A;  3TED A;  1BW5 A;  4C3I J;  3BR3 A;  3SFI A;  4UUS B;  2ME6 A;  4BY1 J;  2DN0 A;  1W0T A;  3NAU A;  2LKX A;  5F0C A;  2E2I J;  3QPL A;  1A5J A;  2HQ5 A;  4JYK A;  4QSH A;  1U8B A;  1ZKG A;  4C2M J;  3GTP J;  2IBD A;  1OCP A;  3BG9 A;  2Y2Z A;  1BJZ A;  3S1R J;  1B72 B;  2B63 J;  3GTQ J;  5E3O A;  3FKI J;  2NOG A;  2QF7 A;  4RDU A;  5FKO A;  4B3A A;  3GTG J;  3JRF A;  2HXO A;  2WB1 N;  1GUU A;  3CQZ J;  1MSE C;  3B6C A;  3ZOB A;  1PUF A;  3HKZ N;  2X48 A;  2CJJ A;  2CUF A;  3L1P A;  1ZTR A;  4BBR J;  5EZH A;  1VF9 A;  1QVT A;  3Q0U A;  2FX0 A;  1DU0 A;  2YUS A;  3HM5 A;  3S1N J;  2DA3 A;  1MBK A;  2DMN A;  2LY9 A;  5EZG A;  5BNG A;  1MNM C;  3IH4 A;  5C44 J;  1ZGW A;  2PMZ N;  2X6O A;  2CQX A;  2O9L A;  1OFC X;  3HDD A;  4LOC A;  4BBS J;  1B72 A;  1WH7 A;  5FKL A;  3IH2 A;  4RBO A;  1VFC A;  1IV6 A;  3HGY A;  3BTI A;  5F08 A;  3HOZ J;  2JK3 A;  2IEK A;  2JWT A;  2TCT A;  2YS9 A;  3W6V A;  3SDG A;  5J1Y A;  1LE8 B;  3QQA A;  3TW7 A;  1MSF C;  2K9N A;  1NTC A;  1ETO A;  1SAN A;  4I76 A;  3IV5 A;  3Q3S A;  2XGC A;  4IHY A;  2E1O A;  2HXI A;  3BR5 A;  1ETX A;  5IP9 J;  3ZQG A;  3BQZ A;  5J1R A;  3JRA A;  3LSG A;  1JKR C;  2NVX J;  3K2A A;  2O8K A;  2JA6 J;  3S1M J;  1S7E A;  3GTK J;  1ETW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...