4EEFG

Crystal structure of the designed inhibitor protein f-hb80.4 in complex with the 1918 influenza virus hemagglutinin.
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
45
structure length
45
Chain Sequence
PWKFSENIAFEIALSFTNKDTPDRWKKVAQYVKGRTPEEVKKHYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin HA1 chain
publication title Optimization of affinity, specificity and function of designed influenza inhibitors using deep sequencing.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Immune system/inhibitor
total genus 4
structure length 45
sequence length 45
chains with identical sequence H, I
ec nomenclature
pdb deposition date 2012-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4eefG00
4A3BJ 3BR6A 2HOAA 4M3GA 1TWFJ 2X48A 1RETA 3K7AJ 3IV5A 2PMZN 1IV6A 9ANTA 2MG4A 4V2FA 4ABZA 3LSRA 4FCYA 3NAUA 3L1PA 1AKHB 4JX6A 5FKKA 3B6CA 4IHVA 3CDLA 1MBEA 3JRBA 5JLXA 5M5WJ 2DMUA 1D5YA 3K2AA 1YRNB 4A3GJ 1F36A 3S14J 3BTLA 4XIDA 3S16J 2KT0A 1QPIA 2P81A 4BKXA 3BR2A 2Y9ZA 3S15J 4LOCA 2CQQA 2HI3A 2OF7A 4BXXJ 2CU7A 2HXOA 3IH3A 3GTJJ 3HOUJ 5FLVA 4UUTA 2LK2A 2ID6A 5F0CA 4B3AA 5EZHA 3BT9A 5C4XJ 2L7FP 2RAEA 1B72A 3SDGA 2XPWA 2GLOA 1BJZA 1TWHJ 2LD5A 3G1LA 4IEJA 4DZPA 2FJ1A 5FJ8J 3JRDA 3QPLA 1WPKA 5GPAA 1T56A 1RKWA 1TWAJ 1Y1VJ 1FIAA 4UUSB 1RR7A 1POGA 2HOSA 1FEXA 3Q0WA 5J1UA 3HOYJ 2R7ZJ 2DA3A 3S2HJ 2EZIA 5EG0B 2CUEA 2DMPA 4XK4A 5FLMJ 1JTXA 1IG7A 4FISA 1OCTC 2JWTA 1VFCA 2K9QA 4JP0A 2DN0A 1ZKGA 4X1EA 2NVQJ 3BTJA 4AYBN 1GVDA 4XRSG 2JA7J 2DMNA 3HB9A 2XSDC 1TC3C 1H89C 1MBHA 3TW6A 3HBLA 2QCOA 2W48A 2ZB9A 3TEDA 2Y30A 1QVUA 2R5YB 1ENHA 2IAIA 5F08A 1DU0A 3GTLJ 1P7JA 2DA4A 4GFBA 3FISA 4I76A 1PUFA 5IYDJ 2WB1N 1IDZA 3JRHA 1I50J 2LR8A 3WHCA 3C2BA 1JUSA 5J3LA 4IHXA 4W97A 4D7MA 1W0UA 5F0FA 2E19A 3WHBA 5F27A 1MSEC 2ECCA 1JJ8C 2XGCA 3HM5A 3RQIA 1GV5A 3OSFA 2VKEA 4CYCB 1Z77A 2XGDA 1TWCJ 2DJNA 1NTCA 3QPSA 3HEFA 5EF6A 3ZQCA 1GUUA 4DZJA 5K7HA 1RESA 2HXIA 2R93J 2DA6A 3FK7A 2JK3A 5K7ZA 1QRYA 2M2EA 1HLVA 1LE8B 3GTPJ 1VF9A 3OIOA 1IC8A 1ZK8A 2M8GX 3GTKJ 1AKHA 4L5EA 2DTZA 5DS9A 2E2JJ 3HKZN 3PM1A 3JRCA 2WV1A 4C2MJ 1RPWA 2DMTA 3TP3A 1R9TJ 3BTCA 2R0QC 1ETOA 2YUSA 2XB5A 2YS9A 2EBIA 4MO7A 2LTPA 2X9DA 1ZGWA 1YRNA 1IGNA 5J1RA 1BA5A 1MBFA 2L7MP 5IOYA 1X58A 3SJMA 3RZDJ 1E3OC 1FIPA 2DA5A 5JLWA 2O8KA 5IP9J 5EGOB 4BBSJ 1ORKA 2VUMJ 1IRZA 3D1NI 1U78A 3BG3A 4XICA 1APLC 2O9LA 1VI0A 4JX5A 3IH4A 4M6VA 5EYRA 3SFIA 2Y9YA 4A3KJ 4B4CA 2HYJA 1MNMC 3PO2J 1ZTRA 3JR9A 3RZOJ 3H3VK 3ZQFA 2TCTA 3BR1A 1WH5A 1I6HJ 2FQ4A 2K40A 3BTIA 2VKVA 3HGGA 1NK2P 1WGXA 2JA6J 3BR5A 2R5ZB 4C3IJ 3S17J 2D5VA 4JYKA 4NDLA 1JTYA 4G12A 4W1UA 3GTMJ 4A69C 1Z0XA 1ITYA 2JN6A 3IH2A 2H1KA 1WCMJ 2ID3A 2Y2ZA 3BR3A 4MFDA 1G2HA 1P7IA 3CQZJ 5BNGA 4C3JJ 2LLKA 2MW8A 4EEFG 1Y1WJ 2DMQA 2HOTA 4DYRA 1XC5A 3BQYA 4UUSA 2EZKA 4M3DA 1SFOJ 1HDDC 2N8GA 3BQZA 1XS9A 1UMQA 2L9RA 4AC0A 5EG0A 3FIWA 1IJWC 2X6OA 4FE4A 3A01B 3E7LA 2AHQA 3LOCA 1ZR4A 5IYCJ 2GBYA 3BG9A 3JRGA 5E3LA 4Y7NJ 5IP6A 1B8IB 3JRFA 3S1NJ 4QSHA 3JRAA 2NS7A 3H0GJ 4A3LJ 2HDDA 1K61A 1MBKA 5HODA 3ZQIA 5FKNA 2H8RA 3CCYA 3ZOBA 3S1QJ 1HDPA 3HGYA 2E1OA 1BL0A 4XRMA 2R5YA 1T33A 2LKXA 4A3FJ 4C3HJ 3OSGA 1K83J 3UKGA 3RKQA 5FKMA 4D5CA 1UG2A 3HOXJ 4MIMA 3G1OA 1O4XA 5GP9A 4RBOA 1A6IA 1ETVA 2M0CA 2K9SA 3Q0VA 2DA7A 1MBJA 3MN2A 2EH3A 1XG1A 2MGQA 4HNVA 2VI6A 1MSFC 3NARA 5C3EJ 3B6AA 2EZLA 2OPTA 3ZQLA 4M3EA 3Q0UA 4A3EJ 1EF4A 2FD5A 2O7OA 4J19A 5M3MJ 2Y0SN 3MKLA 1AU7A 2IEKA 3DEWA 5E3NA 4CYCA 3LSJA 2WAQN 2L0KA 1FJLA 1ETWA 3BG5A 1GV2A 1JJ6C 1AHDP 5IYBJ 3DCFA 5IP7J 2KDZA 3G1MA 3Q3SA 3LNQA 1S7EA 4FE7A 1U8BA 1JUPA 2JA5J 2NOGA 1OFCX 1LE8A 2CQXA 2G0EA 3LSPA 1VNDA 2M34A 2XPUA 3M4OJ 2LP0A 2NVYJ 5FKOA 1X2NA 2VPRA 3W6VA 1H88C 2HQ5A 3CMYA 2DA1A 1IUFA 2LFBA 2JMWA 3I4MJ 4DYCA 1JKOC 1ETQA 2XGEA 1ZQ3P 3O8HA 1WH7A 1MBGA 5DTDA 3JREA 5IPAA 4BY7J 1ETYA 5EGOA 2NVTJ 1JUMA 1LFUP 1F43A 2COBA 1WI3A 1FTTA 1MH3A 3GBGA 4B1RA 3HOVJ 1H8AC 3TP0A 2NVXJ 2LVSA 4A3CJ 3OOUA 1JT0A 3F0CA 1BW6A 2XB0X 2M9HA 1U9NA 1DU6A 5M3FJ 4A93J 3FKIJ 2K9NA 2R5ZA 1JKRC 1B72B 3PO3J 1U9OA 2ELKA 3HOWJ 3FK6A 2Y31A 4QIWN 4BBRJ 3JRIA 1CQTA 5J1YA 1FTZA 1JKQC 1ZR2A 2IBDA 2MSYA 3I4NJ 4RDUA 4Y52J 1HCRA 1UHSA 3TW7A 4V2GA 3HOZJ 3GTQJ 4IHYA 3A03A 1A5JA 5GPCA 4MFEA 1NK3P 1OCPA 1GT0C 1HF0A 2ME0A 3BR0A 2EZHA 2E2IJ 2LY9A 1OJLA 3LSGA 5M5XJ 4BY1J 2EQRA 2AO9A 3MVPA 4MLOA 3A01A 4AUXA 3M3YJ 1LFBA 4FTHA 4A3DJ 4JX4A 4X6AJ 3ZQGA 2TRTA 2JJ7A 1B8IA 2YU9J 4M3BA 1ETXA 3HDDA 2CUFA 2I10A 2E2HJ 1I3QJ 2CJJA 3ZQHA 5C4JJ 5EDNA 2DA2A 4D7NA 4DYQA 5EEAA 4A3JJ 1JGGA 5F1JA 2JA8J 1IDYA 2CRGA 2GM4A 2B63J 1X2MA 1JKPC 1Q1VA 1TWGJ 3GTGJ 5IOZA 3GTOJ 2XRLA 1QVTA 3VPRA 2ME6A 4S0HB 1PUFB 5E3MA 5FKLA 4M3FA 2L7ZA 2R92J 4I6ZA 3S1RJ 2NS8A 2ECBA 2QF7A 5C44J 4A3IJ 1W0TA 1SANA 1BW5A 5F04A 5EZGA 4XRSA 1RKTA 1JT6A 3A02A 1GDTA 2XPVA 1MH4A 4QTRA 4IHWA 1HOMA 1ETKA 5M5YJ 2FX0A 5F0HA 4A3MJ 4DW6A 5E3OA 3S2DJ 3O8GA 5K7FA 3QQAA 3S1MJ 4D5FA
chains in the Genus database with same CATH superfamily
3ZMDA 3K2ZA 4HPQA 3RPQA 2OTLI 2VKHA 3BCBA 4NC6A 4IF4A 1MDMB 1IV6A 9ANTA 5L3BA 2MG4A 1TT0A 3K1PA 2XAHA 3L1PA 1KGSA 3K4KA 4DQ2A 4JX6A 3MMYB 1DQUA 5LHGA 2FQ3A 3F23A 4AIHA 2TDXA 4IHVA 3JSOA 4XNFA 3KYDB 3KFWX 3JRBA 5M5WJ 3BZ6A 4PJJA 4CICA 4B8XA 4O5VA 3K2AA 4A3GJ 3SHFA 2K27A 5KAIC 4ZYAA 3Q5FA 5DD8A 3KIOA 3N97A 2BZTA 4XIDA 1EA3A 3ZMVA 3S16J 4LJZF 4MEXF 4LOCA 2VLAA 1MNDA 5BMZA 3EETA 4AIDA 2CU7A 1F4KA 2MD5A 3GTJJ 5FLVA 3E6CC 1DUXC 1WRJA 5CVVA 2ZMEA 3U1KA 1G3WA 4OIPF 2VBWA 2ID6A 3SZTA 4XRFA 5B5EC 2PJRA 3BT9A 4ENJA 3S93A 2L7FP 2RAEA 3J7AO 2F4OB 3TDZC 3DWLE 2CUJA 2JRTA 2MABA 1TWHJ 4KICA 3FM3A 1R7JA 1K4SA 2CS3A 4DZPA 2O03A 5IT3A 2A5WA 1QO0D 2BVMA 5D8LB 5J8FA 4UNOA 4Y33A 3JRDA 2BY2A 3QPLA 4XKBA 4CUGA 1Z1DA 3GZ6A 1FBQA 4LD5A 4L5IA 4XN0A 1JI8A 1RKWA 4II2A 2L01A 3FZVA 2HKXA 1FEXA 4DOZA 3ZMZA 2VBZA 2VL8A 3BC8A 2CUEA 5EG0B 2KZGA 5DUIA 2Q2EB 3OY9A 4YIIA 4MEYF 1IG7A 5DUKA 3FBIB 4BQQA 2XAQA 2Y0MA 4AYBN 3OS1A 3HHGA 2VN2A 1T8IA 1EKEA 2HU9A 5FFXA 3CMEI 4XRSG 4A0YA 5H6QA 2JA7J 2DMNA 4H0EA 4D0PA 1MBHA 2NOJB 4HF0A 1TQIA 2BY1A 2ZB9A 1QVUA 3IC7A 3VYRB 1ENHA 2VBXA 4PFOA 5F08A 2R5YB 1SVLA 4V19K 2QWWA 4ZZLA 1P7JA 2DA4A 2PFBA 3K4MA 1PUFA 1WJDA 2WB1N 2F2EA 2E7XA 1X1CA 1OLTA 2MLGA 5L3FA 3DTEA 1JXSA 4XLCA 2R4GA 2HFHA 3C2BA 4IX7A 1JUSA 5J3LA 1KQ8A 1Y8RB 2EILH 5FO5A 4N4NB 5L3GA 3R6SA 1W0UA 5F0FA 3FF5A 3WHBA 3K69A 4ASNA 3QRFF 3HRMA 4IHSA 3R61A 2WAFA 1XGNA 4Y4RA 3HUGA 4C2TA 3OSFA 2VKEA 3ASNH 4R1HA 1TBXA 2A05A 3ZQCA 1GUUA 2HR3A 5J40A 4DZJA 5BQTA 3L2UA 2XF7A 1I39A 3G3ZA 1XB4A 2DA6A 3AG3H 2WBMA 4Y15A 2JK3A 2MC3A 1MDMA 2A3SA 4BS9A 1YFHA 3OYHA 4HF2A 1OYYA 1HW1A 4ZJZA 1D1BA 1IUYA 2YPRA 3QYFA 1RR8C 1E2XA 4F52A 2DTZA 3HKZN 2ESNA 3TBIA 4ETSA 3DBHB 1R5ID 2XVCA 3KEOA 1W7PB 5LBQA 2R0QC 2YS9A 1P2FA 2CH0A 2EBIA 2IGKA 2LTPA 1MMDA 4FQGA 1YIOA 2P8TA 3CF5F 1IGNA 1BA5A 1MBFA 1YQAA 2L7MP 3RZDJ 2RREA 2X1DA 3FXKA 3KP5A 3GZ5A 3D5RC 1ORKA 3H9QA 5E1WA 4IQ4A 3F72A 1IRZA 2L7KA 1FX7A 3QU3A 4JQFA 5CLSA 4QPOA 5DV5A 4XORA 4XICA 1VI0A 2A6TA 3KETA 2O9LA 1BI0A 3IH4A 4RGXA 1S7AA 2OV7A 3C2HA 4I99C 3JR9A 3RZOJ 2QGUA 3FMRA 1OMIA 2MH2A 3H35A 3HSFA 1FWZA 2PEXA 1P4XA 2LY1A 3BTIA 3OYNA 4A2UA 2OJED 2FMLA 3JAMK 4C3IJ 3RJPA 2HVSA 1LNWA 4NDLA 5BPIA 1YJWI 3GTMJ 2K4JA 3L9FA 1Z0XA 4O6JA 1ITYA 2JN6A 3I64A 2Q0OA 2H1KA 4ZTJA 1WCMJ 2IGMA 1ZG5A 3FXUA 2Y2ZA 3BR3A 4OIRF 3S2WA 3R60A 1T2KA 4KITB 5BNGA 3AKZA 3OOPA 2MW8A 4CA0A 2DOFA 2L54A 3VYTB 5CQEA 1JGSA 1XC5A 3BQYA 2HNHA 1SFOJ 3CO7C 4B3XA 1GXQA 3BQZA 1YOVB 1J09A 4E6KG 4ZDLA 5EG0A 3FIWA 3B02A 2Q2EA 1R1VA 1X3WB 2M4GA 1EH6A 2H27A 2F5CA 2FBHA 2AHQA 4KUMA 1FLIA 2KP6A 3FDYA 1YJ9I 2JVGA 4XLHA 5FLXZ 3FMQA 2BE5F 3LFKA 4U0VA 2MD0A 1YLFA 1WWXA 4MTDA 3H0GJ 4A3LJ 1FNNA 2XAGA 2UXNA 1T39A 2KIFA 2GQQA 3AAFA 2DPUA 3I56I 3CCYA 2CSOA 2ZJ2A 1R49A 4CCNA 3ABLH 3H92A 2R5YA 1SD4A 2L9SA 4C3HJ 3PIPF 2EV0A 1UG2A 4XLPF 3M8EA 4MIMA 5GP9A 1ETVA 2M0CA 2QKMB 2JUGA 4WF2A 2DA7A 1MBJA 3GVAA 2CO5A 2XC7A 2CGPA 1O7FA 2B9SA 1DPRA 2VI6A 4U7BA 4AYBA 3BG6A 1U5TB 5HS7A 2XGXA 3W3CA 4M3EA 2ZO4A 3TO6A 4BJTA 1EF4A 2V79A 1TNSA 2ZFUA 2Y0SN 1YS6A 3DEWA 2AQEA 1QPMA 3ABMH 2XROA 2L0KA 1MJBA 3BG5A 1GV2A 2XSJC 1Y0UA 1AHDP 5D5XB 2IPQX 3Q3SA 4UXNA 1O7LA 3T0YA 2A69F 1S29A 5GAGJ 2JA5J 2BYVE 2NOGA 2OBPA 4GO1A 3W2VA 1V5GA 1HQCA 2XPUA 1H9GA 4JOMA 5CVJA 1YS7A 1X2NA 2VPRA 1MJ9A 3G2BA 1XMAA 3CMYA 1ZG1A 1SFXA 1BR1A 1G3TA 2EA2A 2DLLA 3D0SA 4CCLA 1YX3A 1W7PA 4LFUA 3J81K 1HXDA 3H5NA 2BY0A 4DYCA 3EPZA 1ZYRF 3O8HA 5B66C 3IRRA 3JREA 4Y3OA 1WKMA 4Q48A 1LEBA 4XL9A 1S5LC 1F43A 3GWZA 2COBA 2M4KA 1H8AC 4EGYA 3MEXA 4HQMA 3AL0C 3WODF 1JT0A 3HKZA 1VQKI 1ZLKA 1UFMA 5D4SA 4ZYEA 4L9VA 1PDNC 1V3FA 1DU6A 1LKXA 4PCQA 1UJ8A 4RM3A 2GAUA 1D3YA 2Z16A 1B72B 1FOKA 4PGGA 5FROA 4CH7A 3PO3J 1U9OA 1WVRA 2A6EF 3Q9VA 3S8PA 4BBRJ 4A6EA 5CJ9A 1LPQA 4NQWB 4PZJA 1FTZA 2P7VB 5HLHA 1YX5A 4BJ5C 4ENNA 1P9QC 1XTAA 3P5JA 4E7IA 1X4PA 2LBFB 3RIRA 1FY7A 4HSRA 1GHCA 2IVMA 2WY8Q 1EH7A 2EZHA 2K3PA 3BR0A 3WTSC 2E2IJ 3AFHA 2CQNA 1OJLA 2EQRA 4C2UA 4MLOA 2ZXHA 5HDNA 5A2QZ 3WE3A 1YJNI 3PL8A 2A07F 1IXCA 2ZCWA 3UR3C 4A3DJ 2F48A 1UB9A 4M3BA 1ETXA 2CUFA 4BE0A 2P5VA 4KIFA 4A5NA 1I3QJ 3J80K 4RAYA 3ZQHA 2KJCA 4IRGA 2DA2A 3LAPA 2NS0A 4DYQA 3QU6A 3H9GA 5E18F 4BDYA 2KRCA 3WGGA 3SFZA 3VDXA 4KFCA 1Q1VA 4EM2A 1FOYA 5IT9Z 4BXFA 3GTOJ 1VQ4I 2HVRA 4TV7A 1FT9A 1DGRM 2CQ7A 2YX7A 4F93B 4FT8A 2J5PA 3ZPLA 3V8JA 3Q9SA 3LMMA 4E4HA 4IOCF 2GOMA 2RC4A 1SANA 4HA8A 4P1WA 1BW5A 1DGWY 3FHZA 1U5TA 3L2RA 1W5CC 3DU6A 1RKTA 4XRSA 1Z6RA 4RS8A 1WJFA 3CJRB 1TZLA 2XF5A 2KLOA 1KA8A 1GDTA 3P7NA 5TJJA 5M5YJ 4PGHA 2FX0A 2DAOA 5KNLA 3OYMA 2IS2A 5E3OA 5DM7F 1R23A 1V5FA 3K6GA 3O8GA 3S1MJ 1T08B 3K1NA 4XSXF 2V26A 3WGHA 2DOEA 4M72A 2XRNA 2A5YB 3MAJA 3TOAA 2HZDA 2HOAA 4M3GA 1TWFJ 2X48A 1RETA 2CW8A 5E20A 2DXIA 1OKRA 2DU9A 2CWEA 3SXYA 4V2FA 3LSRA 1STZA 4FCYA 2STTA 5ICFA 1AKHB 2E1CA 4GXOA 3CLQA 2DODA 3ISPA 3V7CA 4KISA 5LEJA 1FSEA 2M1BA 4E7HA 3E0JB 2X51A 2CQKA 3U2RA 1YRNB 4AIJA 2Z99A 1IN7A 3BTLA 2QA4I 2F5FA 4Q47A 4HX4A 3X2QH 3CTAA 3ZN1A 2F5DA 1QPIA 4PK4A 4BDZA 3ECOA 4BKXA 4IZZA 1T0FC 3BR2A 4KDPA 4KA4A 3FXMA 2HI3A 2OCEA 2LREA 3FXOA 4UB8C 4BXXJ 1G3YA 1SFKA 2M8EA 1IW7F 3HOUJ 3BP8A 4AWXB 3O3KA 4M9SA 2Z9OA 5D5UB 2F5EA 4BHBA 4B3AA 3LSHA 5C4XJ 4C30A 2WC2A 3VYSB 1B72A 2PI0A 4FX4A 3I53A 2JPCA 2XPWA 4AU7A 2K85A 1BJZA 1W1WE 2KIMA 2X6XA 1ZGJA 5HDGA 3CD6I 2LD5A 1VQ5I 4NQWA 4ENMA 3VFZA 2CW7A 2KDOA 3GFLA 2DTRA 4RA2A 5FJ8J 3BOQA 4XONA 3F8MA 4AVZA 1YHQI 3BJAA 4G6DA 1WPKA 3FHNA 2BHZA 4XN3A 4EM1A 4LGWA 4B43A 2LBFA 2E5ZA 1IXRC 2O3FA 5CYVA 3B73A 1MZBA 1Y1VJ 1FIAA 1POGA 2KRFA 2HOSA 1WJBA 2E35A 5J1UA 4CXFA 1OCZH 4HAMA 2EZIA 1E3PA 1HSTA 3CZ6A 1PVEA 3UNGC 3DXJF 3OR2C 4FISA 3JSPA 3HJEA 3KLNA 5GTIC 1B6AA 1BI1A 1VFCA 2UUZA 1N25A 2QM3A 1ZKGA 3F6OA 4ZTFA 2A6HF 3E6MA 2DFIA 2CUZA 3VYUB 3J7ZI 5D8KB 1O3QA 2EIJH 4XLAA 4G9YA 1S9HA 1P6RA 2XSDC 1BN5A 1VQLI 4PFPA 3LSIA 2L2OA 2RNJA 4E70A 1ZH5A 2W48A 2B7EA 3TEDA 4KJZA 2ZXWH 3EUAA 4U0YA 2JRMA 3GTLJ 2BXYA 1OQYA 2LF7A 4I76A 5IYDJ 1XDUA 1IDZA 2W7NA 4P9UA 1S8NA 2LR8A 2MC4A 3G71I 4G7ZF 1QBJA 5K1YA 3DKXA 5HOOA 5JHFA 4W97A 4D7MA 2DT5A 3OYFA 5F27A 4Y13A 2OA4A 5ICCA 2FNAA 3K0LA 1XGOA 3HM5A 2J5OA 3RQIA 1WI9A 2Q8KA 5HNFA 4YG2F 1A35A 1UG0A 3TO9A 2ESHA 2WV0A 3KZYA 2QQ8A 3RCOA 1OPCA 3WE2A 3ROUA 2V1NA 3FK7A 3OYDA 4L0ZB 2PX9A 3S3NA 4HQEA 2H6CA 1L0OC 2RKHA 2RDPA 2QQAA 4GRIA 1LE8B 2KL4A 4CZZA 1CGPA 1VF9A 2EFWA 1OCOH 3ZMTA 3HTUA 3FX3A 1AKHA 4L5EA 4R8HA 4MGRA 4BAYA 1YE9A 2JQ7A 1UCRA 1XD7A 2UWMA 1R58A 1RPWA 4C2MJ 1G4DA 1Z3XA 1R9TJ 3RKXA 3K70D 1U3EM 4I0AA 4R79A 1TW2A 3OYCA 2XB5A 3E5XA 5E1XA 4MO7A 2X9DA 1YRNA 1PYVA 1SD6A 5JR3A 2IA0A 1SMTA 1OCCH 3SJMA 1X58A 3QAHA 4Q5SF 5JLWA 4LLNA 2O8KA 5EGOB 2EFNA 4AD9A 3DKYA 4G94A 4IRIA 2WADA 4BBSJ 3O2PE 1TLHB 2DDBA 2EJRA 1U78A 3BG3A 2R7SA 3PNVA 5AONA 2HYGD 1D0ZA 3ZMSA 2R7VA 4M6VA 3SFIA 2P6SA 4B4CA 4L9NA 3TQNA 4ESJA 3OS0A 2X4HA 2TCTA 2NYXA 1WH5A 2OZ6A 2Y69H 3BR1A 3LSMA 2K40A 3HGGA 2VKVA 4YELA 4F92B 2JA6J 3BR5A 4A0XA 3S17J 6PAXA 2VJ4A 4JYKA 3CO6C 2M45A 4G7HF 2ELJA 4G12A 4W1UA 3VWBA 3VSLA 4BYYA 1D5VA 3IH2A 2QQBA 4KMUX 3K4BA 3HL2A 1YO5C 4MHGA 1A6QA 1D8KA 3GYHX 1G2HA 1P7IA 3ABKH 3AL0B 3CQZJ 3BZKA 2LLKA 1Y1WJ 1Z7LA 1W4MA 1V4RA 4XOTA 1J7KA 1MNEA 1FMWA 1KU2A 4M3DA 4QPQA 3H1CA 2N8GA 5BS6A 2L9RA 4BQAA 4RAZA 2VC1A 1IN8A 2HEOA 2X85A 3E7LA 3H36A 3V42A 1ZR4A 4GCVA 3BG9A 4NB5A 3JRGA 1QNTA 3V4GA 2IA1A 1B8IB 3M8FA 1YW7A 3IKTA 3JRFA 4DGWB 3QOEA 3AG4H 1BR4A 2XAFA 3ZQ7A 5BPDA 1MBKA 2PMUA 5KVRA 2ZJQF 1FPQA 2I5UA 3BJ6A 1H9TA 2EV6A 3ERED 2ZBKA 1R4NB 2G7UA 3WU2C 4XRMA 2FOWA 2Z3YA 1VQ9I 4LB6B 1QZYA 1T33A 5JVGF 5CVRA 4A3FJ 3KX2A 3UKGA 3RKQA 2HKOA 2ACJA 1FP2A 2K86A 3HOXJ 4XSZF 1XSDA 1A6IA 1BC7C 2DJIA 3BCAA 5TRDA 3KZZA 2PBIA 1WFXA 3HOTA 1XG1A 2MGQA 1ZELA 1LDDA 1R6RA 2KMUA 3NARA 5C3EJ 1YTYA 2OPTA 2R7TA 3BPXA 3IWFA 4CHUA 4KT6A 4IPAA 4J19A 5M3MJ 3LA7A 2DFHA 2X6WA 3LSJA 3TL4X 1FSHA 3DPTA 1IRFA 3M1CA 2M3AA 3KYLA 2W85A 4EMSA 1ETWA 5AIPA 4IO9F 2K3FA 5DDGA 1I1SA 3F9KA 1WSUA 4E7JA 1S7EA 4AIKA 1JUPA 3I58A 1BC8C 4I7HA 1OFCX 1LB2A 1LE8A 3U1DA 5L3DA 1VNDA 2M34A 2FOKA 3HZJA 5GAEJ 3LSPA 4CSWA 2NXNB 2CV2A 3H9JA 2LF8A 3CJTB 3IUOA 4FX0A 1E3HA 4PJLA 3HIFA 1XDSA 3IAM2 1VQ7I 4XOPA 2W84A 1S7OA 3CUQC 3WGIA 4UB6C 3WTYC 1XCBA 1Y56A 2DQLA 4XKCA 4L9JA 2GIVA 3V8KA 1ETQA 3I3LA 3PFYA 3RQ4A 1O3RA 1ZQ3P 5ED4A 1BR2A 5KAFC 2WAQA 3RYRA 5IPAA 3GEZA 5EGOA 2LDUA 2VOPA 1ZN2A 4B1RA 1W36C 2VC0A 3HOVJ 2L9VA 1O57A 3A1YA 3HSEA 5AIQA 2JTVA 3W6KB 5GAHJ 2D1VA 5E8IA 1GXPA 1FZPB 3CCJI 2KZVA 1BW6A 3AG1H 5FGMA 1P4WA 3SZGA 3K4CA 1WHUA 2E1MC 2HTJA 4YFKF 1NG7A 3PSIA 4XLFA 3MFKA 4UVCA 2K9NA 1JKRC 3OWTA 3WTTC 2AXTC 4KN7X 2CMPA 1UZCA 3MZHA 4NC8A 2V4JC 2X6YA 3PQKA 1SVMA 3T8RA 5CKTA 4QIWN 2EFQA 3W2AA 1B59A 5J1YA 4CCMA 2IBDA 2MSYA 1DPUA 2ISZA 1HCRA 4ZYHA 3TW7A 3HOZJ 4ESFA 3GTQJ 1K7AA 3A03A 1A5JA 3OV8A 4K2EA 4P9FA 1HF0A 1J75A 2ME0A 3CMMA 4EJOA 2BXZA 2VJ5A 3C3WA 4ZDPA 2LY9A 1LVKA 4XMYA 4FASD 2O0YA 3WTVC 1DP7P 3CJQB 1ZRCA 4AUXA 2JPBA 2HGCA 2Z1DA 1WZ2A 2VB6A 3IHUA 4I01A 3F8NA 3ZQGA 1B8IA 1ZREA 4H4KC 2VE8A 3ASOH 1OR7C 1MMSA 2E34A 2W1OA 2I10A 3CCSI 1IXSB 1ZG3A 3OIQA 2VQCA 5J4YA 3SZPA 1IDYA 2GM4A 2IGOA 3GZNB 1K4TA 2B63J 2IA2A 3J81Z 1IZ1A 4Z2YA 2XKOA 5IOZA 1FC3A 2KHMA 3GTGJ 1QVTA 2YSRA 4IL6C 4UV9A 1SMYF 4BU2A 2E7WA 5E3MA 2IXSA 1HC8A 4A0ZA 1SAXA 2L7ZA 4J00A 2NS8A 2QF7A 2WAEA 2FNPA 2LNBA 5B3SH 1WQ2A 3MD2A 1SAUA 5HS9A 3OYJA 3HPGA 2V6EA 1VTNC 2OUMA 1ZRDA 3EYYA 4WWCA 1W5TA 2GXAA 5LGNA 2RQQA 5F0HA 4A3MJ 2FF4A 4MQ9F 1E17A 1XX5A 5F6FA 2LG4A 2HOEA 5LRSA 3WTUC 2KPMA 2VPLA 3CC7I 3FXRA 4WK8F 5IY5H 1H0MA 5LHHA 2MH9A 2OZUA 1FOXA 2UXXA 4OOIA 4LB5A 4HNUA 3K7AJ 1EH8A 2PMZN 2MYSA 1F1ZA 3FKJA 3ESWB 2DOAA 3LSKA 1RI7A 4MNUA 3RPUA 1K78B 4B09A 1D8JA 5FKKA 3NQOA 4BH9A 1VZ0A 3EYIA 1VQPI 4YRVA 3OYKA 3F22A 2Y75A 4BE1A 1D5YA 5H6RA 4OMYA 1CF7B 3S14J 4ANJA 2KT0A 1I3AA 2M5WA 2P81A 2ZFWA 1WJEA 2A68F 3MZ8A 4E7ZA 1KU9A 3S15J 1QHGA 2L5QA 3BROA 1ZGAA 2HXOA 4PJMA 3J80Z 4E7LA 1HW2A 2M7BA 3SDBA 2M0MA 2BW3B 1Z67A 4UUTA 5J8CA 2JSCA 3T1BA 2IS6A 2EIKH 4G8XA 3GFIA 4CCKA 3KP4A 5HVQC 5F0CA 1PP8F 4XBFA 4RLQA 2MA3A 1I27A 2BY3A 2FUG2 4EJWA 3CP8A 3SDGA 1TQMA 1L3LA 2GLOA 3GCMA 1P92A 2I8DA 2JT1A 1T0FA 5JFRA 3WU1B 3T8TA 4NHJA 4IEJA 1A31A 4HV6A 3DBRB 1E0EA 1IAWA 4EM0B 4DIQA 5GPAA 3TDUC 5J4VA 4JK1X 2RGVA 2OAZA 4UUSB 1RR7A 3KLOA 1BM9A 1K79A 4MTEA 3N05A 3HOYJ 2R7ZJ 4AM3A 1LJ9A 1HKTA 5FRNA 2DMPA 3DKWA 1BI2A 2HQAA 4XK4A 5FLMJ 2JWTA 4I98B 3OL3A 2K9QA 4JP0A 3FM5A 2DN0A 1R4MB 2LKPA 4X1EA 4KNYA 5KK1A 2R7UA 3KYCB 3R0AA 3OR1C 1MMAA 4HLYA 3NEUA 3TGNA 1ACIA 1R71A 1GVDA 3PNYA 2O61A 3HB9A 3COAC 3RSNA 1H89C 3TW6A 2ZC2A 3GF2A 2XF6A 3ML6A 5J47A 2W82A 3M07A 2M7AA 5KHDA 2LMDA 3EUHC 3GW2A 1FYKA 1J5YA 2AXLA 2JVHA 4YIFA 3FISA 4HEA2 2VBYA 3JRHA 2V9KA 1I50J 1G6NA 4MQVA 4S05A 1JE8A 4UVAA 4XR6A 2HDWA 4RAFA 4U0WA 3SYTA 4PDKA 2NNNA 3FXLA 2DBBA 1T6SA 3S3MA 2VIXA 3DF8A 2BOLA 4YIRX 1WJAA 2LOOA 4N0BA 2XGCA 1JJ8C 1V54H 3CP2A 2NNYA 2XGDA 1R5HA 1TWCJ 2DJNA 3QPSA 4I0BA 1OCRH 3QODA 1ZAOA 3OL4A 1M1EB 5K7HA 3HOSA 2CFOA 4RB0A 2R93J 3ERMA 4HZFA 1ZHFA 2CG4A 3I54A 3WU0A 2FE3A 5K7ZA 5A2QK 1QRYA 2M2EA 4PSXA 5BOXA 2YX4A 1IC8A 4RGSA 4RLFA 1ZK8A 2H1LA 3GTKJ 1AOYA 1WJ5A 1X1BA 2L3DA 2D2WA 4HOBA 2KJBA 3PM1A 1K78A 2W24A 3JRCA 1SD7A 4BL0B 2EFPA 1R5GA 1HKQA 5D5VB 1ETOA 2Q1ZB 2LSOA 1HOMA 2QSFX 1CF7A 2XAJA 1E3OC 4LK1F 1V5EA 1FIPA 1B9MA 1IN6A 1MIJA 3I59B 4ENKA 5IP9J 5IT9K 2STWA 2XAUA 1TP4A 4E7KA 2K4BA 3I0TA 5E79C 1K6OA 1XMXA 3D1NI 2PMZA 5ILVA 4JX5A 1XMKA 3I71A 5EYRA 3N4MA 1XGMA 1I6XA 1RZ4A 3VEPA 4A3KJ 2HYJA 2BW3A 1MNMC 1G3SA 4IHTA 3CUQB 1ZLJA 2EB7A 3EQLF 3ZQFA 4GGGA 3HYIA 4ON0A 5FB2A 1HBXG 3BLYA 4I2OA 3H3UA 1I6HJ 2FQ4A 2QZ8A 2RNGA 1NK2P 1WGXA 2P7CB 4KIBA 2R5ZB 1Z05A 2ZKZA 2K02A 2D5VA 2COMA 3BWGA 1XSXA 1JTYA 2OQGA 4G6QA 4HSTA 4LG3A 4IOAF 1TTYA 3GMEA 1UHMA 1R36A 2ID3A 2AQFA 4IXAA 1KU3A 2RV8A 3GLLA 4MFDA 4RAGA 3KZIC 4C3JJ 4N4OB 2MLKA 4EEFG 3I5UA 3SEZA 2HOTA 1RNLA 2O6GE 2GA1A 2R7RA 1KU7A 4UUSA 5DEQA 3MCZA 3EDPA 2E1MB 5DCFA 3A4CA 1VQ8I 1Y0NA 1XS9A 4UV8A 2R7DA 4AC0A 4CO8A 1F9NA 1IJWC 3PSFA 2BV6A 2P6TA 4DBQA 3A01B 1W7PD 3TMOA 2B0LA 1BIAA 4LK0F 1ODDA 1LDKB 5E3LA 2KRHA 5IP6A 3GFJA 3BPVA 2GWRA 3DEEA 3F3XA 2V1XA 3LFUA 4L5JA 5JHUA 3S1NJ 1TQPA 4L0YB 1IRXA 2VKDA 4P96A 3E97A 3OYGA 1J2XA 2HPIA 2VJIA 2HDDA 4GDFA 3KEQA 5HODA 3WTXC 3G4SI 4PUSA 5FKNA 3K9TA 2QKLB 4BHPA 2H8RA 2JUCA 5TISC 3E3VA 4IJAA 1K6YA 4EGZA 2L9NA 4OAYA 2FU4A 3E6BA 2O8XA 4O3MA 4RB2C 2BVLA 5FKMA 2YU3A 1O4XA 3G1OA 2EWNA 4RBOA 2K9SA 3Q0VA 2RQPA 5LGUA 4UHTA 3MN2A 1Y8QB 2EH3A 3R0JA 4HNVA 3PUFA 4M6YA 3OYAA 1RUOA 3B6AA 5CQGA 4M9XA 2OCCH 2QLZA 3Q0UA 5LLQA 1C0WA 2FD5A 2O7OA 1T38A 2PG4A 1AU7A 2WAQN 2W57A 2H94A 2F4MB 1FJLA 3L2CA 5HS8A 3MKWB 3RKYA 1JJ6C 4HF1A 5IP7J 2QVOA 2KDZA 3G1MA 3HRUA 4IQJA 2FBKA 3QPTA 1F5TA 2ETHA 3L2QA 2CQXA 1A04A 2QENA 2EIMH 2LP0A 3IL2A 1VQ6I 2NRAC 4ESBA 1LVAA 2HQ5A 2CYYA 3KPHA 3DP7A 2ADUA 3VOEA 3JW4A 2W4SA 1U6GA 2LFBA 3MKZA 3DEUA 2JA2A 3DPLC 2XGEA 4CYDA 3JCUC 5DTDA 5FRMA 1N77A 3I59A 3IRQA 1ETYA 2WWYA 2VT3A 1WI3A 1QGPA 1FTTA 1MH3A 3GBGA 1D1CA 3DLLF 4M9ZA 3FMSA 3WG9A 2LVSA 2NVXJ 1IN4A 3OOUA 3BY6A 4EV0A 4G6TB 4PJNA 3F8FA 4J01A 5FD5A 3F0CA 2H8WA 3CUQA 2OC6A 4WXHA 3ONQA 5M3FJ 4U7DA 1KYWA 4I02A 2R5ZA 5LGTA 1RC9A 3VB2A 3VSKA 2L02A 2JSPA 2DYSH 3HOWJ 4RMNA 1G8XA 2XV4S 3JRIA 1XCVA 2JZYA 2R7WA 2CV0A 4S04A 4BGDA 2EINH 1ONVA 1OYWA 5EJCA 1VQMI 4Y52J 2L4AA 4KN4X 4XKWA 1AA7A 3V7SA 3A0BC 1X1AA 4M74A 4B48A 2OQRA 1NK3P 1R1TA 1OCPA 1GT0C 4FETA 3W6JB 5LHIA 5M5XJ 2FEZA 4BY1J 3KCCA 1LFPA 1TNTA 2AO9A 4I09A 3A01A 1J59A 1BOBA 2LH9A 1X1PA 2PQ8A 3K10A 3M3YJ 1ON2A 3GFMA 4OINF 3CCEI 4X6AJ 5LD2C 5F1RA 1NH3A 1UHWA 2YU9J 2VJJA 5DM6F 5H2FC 1LUJB 2KIQA 4F3QA 2VE9A 2V9PA 2E2HJ 5E8GA 2DQRA 1OISA 2CJJA 1ERDA 2O5RA 3T5XA 2BGCA 3HRTA 5LRRA 5GADJ 4D7NA 1ON1A 4A3JJ 5F1JA 2JA8J 1X2MA 1NHAA 1JKPC 1UAAA 2OD5A 1TWGJ 4P55A 1EV7A 1IRGA 2V9VA 3DTKA 5JVTA 1D0XA 2ME6A 4OMZA 4M3FA 4I6ZA 1OR7A 4KT5C 2P5LC 3S1RJ 2ECBA 5C44J 4A3IJ 1W0TA 1Z21A 3FWEA 3KEYA 2AS5F 4LIVA 4UY8I 1Z7UA 4L18B 4OIQF 1JT6A 2DK8A 5TGTA 3WTZA 2E36A 3TKYA 4QTRA 4BEHB 2F5VA 1YI2I 2UV1A 3JAMZ 1DDNA 5LEKA 4DW6A 3ZRGA 5ICGA 5K7FA 1BBYA 3HXLA 3QWLA 1GVJA 4D5FA 4A3BJ 2CW0F 2E5NA 3F8CA 2DT7B 4JBAA 3LQQA 2QUFA 2P4WA 5ERIA 4E7SA 3BR6A 5GTHC 2ZJRF 2HPMA 1RIOH 3GX4X 3CC4I 4M6XA 4HV5A 3IV5A 2HVQA 1DP3A 4ABZA 3NAUA 2ISYA 2E1NA 4EJVA 3DPUA 2UZKA 2H6BA 2L4MA 3B6CA 3LA3A 3RTRA 3CDLA 1MBEA 2ZMEC 3LL7A 5JLXA 2GA2A 2K9LA 3O6BB 4GYIA 3W2WA 2DMUA 4M71A 2ZNZA 2EA4A 1F36A 1S3JA 3CESA 3HPHA 3DU5A 2K7LA 5F64A 4XM3A 3BDDA 2LKSA 3NWSA 1YW9A 3PNTA 5K5QA 1X1DA 2Y9ZA 2M87A 1B1BA 2CQQA 2OF7A 1FBUA 2ZXIA 3CC2I 4LG0B 1KQ0A 1QZEA 3IH3A 5K5OA 1TL8A 2LK2A 4L9TA 2XKPA 1LQ1A 2EFOA 5EZHA 3C2GA 3PIOF 2P5KA 3PJRA 2XASA 1YW8A 1YG2A 3H5RA 2EPFA 4ZYGA 3G1LA 3E5UA 2WA0A 3L7WA 2FJ1A 4CGZA 2ZSHB 3P9IA 4DJAA 2BBYA 1VQNI 4WX9A 1S6LA 2G7HA 1FYLA 4YFXF 5KCMA 2IGNA 1T56A 4HG2A 2IW5A 4CCJA 5DD4A 1TWAJ 1KONA 1R00A 1QHHD 4Z6YA 2GXGA 3QPHA 4EJTA 3Q0WA 2EV5A 4HBLA 2DA3A 3S2HJ 2LRDA 1Q1HA 3K4NA 4BHCA 4HNTA 3H3ZA 1JTXA 1MW7A 4KIGA 1OCTC 5CVIA 2XIGA 2G9WA 3RKWA 4BNCA 1MD0A 2KKOA 4LIUA 3REOA 2NVQJ 3BTJA 3M1EA 3E6DA 2M30A 3FBNB 2H09A 3MWMA 1QA6A 2OU2A 4C9YA 3DFGA 3DV8A 4CDGA 2VQGA 4RGRA 1TC3C 3J7AY 2K9MA 2PJPA 3QP6A 5B1AH 2BEOA 4F91B 3HBLA 4RB3C 2QCOA 2FMYA 5ILUA 2HYFA 4WXCA 2RN7A 1HSJA 4WCGA 2Y30A 3ABUA 1FP1D 2IAIA 3OIPA 4RB1A 1DU0A 3ABTA 3ZMUA 4BJ6C 4OU0A 4XLNF 4GFBA 1Y6IA 1RRJA 3ZN0A 2V1DA 3JTHA 2KIUA 3WHCA 1P4AA 4B47A 1SVOA 4IHXA 5DCMB 4WXDA 2E19A 3CDIA 1JHHA 4II3A 4HDVA 1MSEC 2ECCA 5ILSA 2GIZA 3OYEA 4BEHA 2PMHA 1GV5A 1Z91A 1W36D 2VODA 4CYCB 1Z77A 3SEQA 3K4JA 4HW0A 5EF6A 1NTCA 3HEFA 4PSWA 1I1GA 2R7OA 2X0LA 3EUHA 3LA2A 3TOBA 2E71A 1RESA 3NRVA 5ICEA 2HXIA 3C7JA 2GXBA 2ICWG 1TT5B 1NG6A 3KP6A 3LSTA 2Z33A 2QSHX 3OYLA 3CCQI 3FXJA 4ZC3A 3ZQQA 3CCRI 5FLXK 4B44A 4XKVA 1ULYA 2VASA 1BIBA 5FD6A 1HLVA 3GTPJ 2VONA 5CPRB 3K1MA 3OIOA 2WB1A 1VQOI 2K5CA 2VQHA 2M8GX 3F21A 1OYIA 5DS9A 1D0YA 4A5MA 2E2JJ 4BXUA 4OAZA 2WV1A 2DMTA 3TP3A 3ZR8X 3BTCA 2YUSA 2QBYB 1ZGWA 2V1UA 2R7XA 5J1RA 1O3TA 4N9HA 2DFEA 4IRHA 5IOYA 1PP7U 5L3CA 2IT0A 3KE2A 2DA5A 5K5RA 1IN5A 2MFZA 3EUKL 5FFZA 5CVUA 5E1ZB 2VUMJ 4F7ZA 1AWCA 3PFIA 1APLC 4LG0A 3D5SC 4ZYDA 3JTGA 1MGTA 2LC2A 2Z2SB 2ZXJA 2Y9YA 4BQNA 3P9KA 3PO2J 4UVBA 3IAS2 1ZTRA 2VOOA 5DYMA 3HHHA 3I4PA 1HKSA 3H3VK 3S3OA 5H20A 1W5SA 4HDUA 1QU3A 1U8RA 3I55I 3CJNA 3ZXSA 2DFFA 5HLIA 3ZP5A 1J0RA 2VXDA 4X0GA 2HS5A 4A69C 1XPXA 1MJAA 2HZTA 4NUBA 1U0JA 2XDVA 3ELKA 3QYBA 3ECHA 2ZSIB 3WTWC 1SC7A 3PUBA 5JI6A 1BI3A 2DMQA 4DYRA 1N75A 2EZKA 2VT2A 4AVPA 1HDDC 2DK5A 4ITVA 1TW3A 2VQLA 4RM2A 1UMQA 2D45A 2HWVA 2X6OA 4FE4A 3ULQB 3GO5A 3LOCA 3PQJA 1IO2A 5IYCJ 2GBYA 1LDJA 2DT6A 1HW5A 2HQRA 4Y7NJ 3OS2A 3V8LA 3CMAI 4ZH4F 3CCMI 4QSHA 4ZZDA 2HDCA 3L00A 3JRAA 3MQ0A 2DPDA 4DBRA 2CV1A 2NS7A 2KQRA 1USSA 2D1HA 1K61A 4LITA 5HNHA 1R22A 4FHTA 3ZQIA 3KP7A 2FSWA 3BJOA 3OMYA 1FMVA 3ZOBA 3S1QJ 4GYGA 1U2WA 1HDPA 3HGYA 3DQVC 4IKFA 2E1OA 2LYCA 1BL0A 5D5WB 1J9IA 4RGUA 2LKXA 2IS4A 2DI3A 3OSGA 1RUNA 1K83J 3R4KA 1XN7A 1KQ9A 2W25A 3F8BA 4D5CA 1QZZA 3I9V2 1YIJI 1ZRFA 2QSGX 1YITI 4EVIA 1JHFA 4XLEA 2FBIA 3CF2A 3HTSB 1MSFC 1UELB 2WY7Q 2LY2A 5DCMA 2YR2A 3A2KA 2EZLA 3BZCA 3ZQLA 1O3SA 3HC7A 3K4LA 3E1SA 3S32A 1KYZA 4A3EJ 4N9IA 4G7OF 4BUPA 4P5OA 1ZARA 3MKLA 1D1AA 1XSVA 2IEKA 5E3NA 3NWTA 5EEGA 1BJAA 4CYCA 3QP5A 3U9GA 1S72I 5HLGA 2Z5UA 5D4RA 5IYBJ 3DCFA 3C18A 2IJLA 2QQ9A 3H5AA 3G6EI 3LNQA 2FA5A 4FE7A 1YYVA 5EEHA 1U8BA 3QOPA 1SD5A 4XQFA 3U21A 3GUDA 2G0EA 4QLCU 3VODA 3M4OJ 1B9NA 2NVYJ 3DLAA 5FKOA 3M7GA 2DDAA 4KYWA 1MMNA 2RVCA 1R1UA 1H88C 3W6VA 3M8JA 1HA8A 4EATA 3CUOA 4LLGF 4BQOA 2DA1A 1IUFA 2DO7A 3RDIA 2QBYA 2JMWA 2F6CA 3I4MJ 3MZYA 2QYOA 1JKOC 2IP2A 2Y0SA 1WH7A 1MBGA 4F55A 4BY7J 2NVTJ 1PJRA 1JUMA 1LEAA 1EJ9A 1LFUP 3L09A 1I5ZA 2BHYA 3KP3A 3TP0A 5B1BH 1PUEE 2QEXI 4A3CJ 4NC7A 3FXQA 4HYEA 2F4IA 1N78A 2EK5A 3CDHA 2XB0X 1GLNA 4DNCA 2M9HA 4A12A 1U9NA 2ZNYA 2KISA 2ZMEB 3IWZA 4U88A 3OYIA 2E60A 3KP2A 1KZHA 3ZCOA 2DW4A 4A93J 5L3EA 4Q4ZF 2PJRB 3CCLI 3FKIJ 3LQRA 4HX8A 4BACA 2XHKA 2KFDA 2DCEA 2R7QA 2ELKA 3FK6A 2Y31A 2IRFG 1Y39A 3K70C 1CQTA 2XUBA 2W00A 2PLYA 1JKQC 1ZR2A 2V6CA 3IKVA 3I4NJ 1V55H 3ZGKA 4HX7A 4RDUA 2OTJI 3J7YJ 2NAZA 1UHSA 2P0WA 2HTSA 1X4OA 4V2GA 4IHYA 3QYEA 3CCVI 1XGSA 4YFNF 3DTIA 1X3ZB 3C1DA 5GPCA 4MFEA 2DYRH 3DBLB 3WG7H 3CCUI 4NNJA 1Z6TA 1T98A 3RPUD 2A61A 3HSRA 3LSGA 3M9AA 1MKMA 1A36A 2V7FA 3GXOA 3P9CA 3MVPA 4OWRB 2R7FA 3BG7A 4NBQA 4D1QA 3E5QA 1BOAA 5LFAA 1LFBA 4FTHA 2FRHA 1X19A 4JX4A 4LMYA 2TRTA 2JJ7A 1Z9CA 2PN6A 1SFUA 1FYMA 1T95A 2Y48A 4M73A 3V7RA 2WTEA 4Y17A 3G73A 1SEUA 3HDDA 4UUVA 1WJCA 2FXAA 3HRSA 5D6FA 2GZWA 2MBFA 4HRIA 4EQQA 2R3SA 2NVUB 1U5TC 5C4JJ 4OIOF 5EDNA 4D9JA 3SQNA 5EEAA 5HLTA 3L2WA 3HG9A 3D5LA 5D6EA 1JGGA 1FBSA 2CRGA 3MKYB 3RI4A 3OYBA 3CLOA 3LAJA 4ZDOA 1IV8A 3A0HC 4QWQA 4PJ0C 4HLXA 3IP4B 5HDKA 1REPC 2XRLA 3VPRA 1FOWA 2IS1A 1USTA 4S0HB 1PUFB 2X1EA 3TO7A 2HQNA 5FKLA 4CZCA 2R92J 3LWFA 4LLLA 2C6YA 1QQIA 2ZJPF 3F6VA 1B4AA 3RYPA 5F04A 3GLXA 5J6XA 5EZGA 4EJUA 4CCOA 4IVNA 2ELHA 1MMGA 2X1CA 3L2VA 3A02A 2VXZA 2XPVA 3HUGB 1MH4A 4YEJA 1SFEA 2CFXA 1Z3YA 3AG2H 1IF1A 4KMFA 1ETKA 4BE2A 4IHWA 5E17F 3S2DJ 2GOXB 1X3UA 4U87A 3H0DA 3QQAA 4A6DA 1G59A
chains in the Genus database with same CATH topology
4A3BJ 3BR6A 2HOAA 4M3GA 1TWFJ 2X48A 1RETA 3K7AJ 3IV5A 2PMZN 1IV6A 9ANTA 2MG4A 4V2FA 4ABZA 3LSRA 4FCYA 3NAUA 3L1PA 1AKHB 4JX6A 5FKKA 3B6CA 4IHVA 3CDLA 1MBEA 3JRBA 5JLXA 5M5WJ 2DMUA 1D5YA 3K2AA 1YRNB 4A3GJ 1F36A 3S14J 3BTLA 4XIDA 3S16J 2KT0A 1QPIA 2P81A 4BKXA 3BR2A 2Y9ZA 3S15J 4LOCA 2CQQA 2HI3A 2OF7A 4BXXJ 2CU7A 2HXOA 3IH3A 3GTJJ 3HOUJ 5FLVA 4UUTA 2LK2A 2ID6A 5F0CA 4B3AA 5EZHA 3BT9A 5C4XJ 2L7FP 2RAEA 1B72A 3SDGA 2XPWA 2GLOA 1BJZA 1TWHJ 2LD5A 3G1LA 4IEJA 4DZPA 2FJ1A 5FJ8J 3JRDA 3QPLA 1WPKA 5GPAA 1T56A 1RKWA 1TWAJ 1Y1VJ 1FIAA 4UUSB 1RR7A 1POGA 2HOSA 1FEXA 3Q0WA 5J1UA 3HOYJ 2R7ZJ 2DA3A 3S2HJ 2EZIA 5EG0B 2CUEA 2DMPA 4XK4A 5FLMJ 1JTXA 1IG7A 4FISA 1OCTC 2JWTA 1VFCA 2K9QA 4JP0A 2DN0A 1ZKGA 4X1EA 2NVQJ 3BTJA 4AYBN 1GVDA 4XRSG 2JA7J 2DMNA 3HB9A 2XSDC 1TC3C 1H89C 1MBHA 3TW6A 3HBLA 2QCOA 2W48A 2ZB9A 3TEDA 2Y30A 1QVUA 2R5YB 1ENHA 2IAIA 5F08A 1DU0A 3GTLJ 1P7JA 2DA4A 4GFBA 3FISA 4I76A 1PUFA 5IYDJ 2WB1N 1IDZA 3JRHA 1I50J 2LR8A 3WHCA 3C2BA 1JUSA 5J3LA 4IHXA 4W97A 4D7MA 1W0UA 5F0FA 2E19A 3WHBA 5F27A 1MSEC 2ECCA 1JJ8C 2XGCA 3HM5A 3RQIA 1GV5A 3OSFA 2VKEA 4CYCB 1Z77A 2XGDA 1TWCJ 2DJNA 1NTCA 3QPSA 3HEFA 5EF6A 3ZQCA 1GUUA 4DZJA 5K7HA 1RESA 2HXIA 2R93J 2DA6A 3FK7A 2JK3A 5K7ZA 1QRYA 2M2EA 1HLVA 1LE8B 3GTPJ 1VF9A 3OIOA 1IC8A 1ZK8A 2M8GX 3GTKJ 1AKHA 4L5EA 2DTZA 5DS9A 2E2JJ 3HKZN 3PM1A 3JRCA 2WV1A 4C2MJ 1RPWA 2DMTA 3TP3A 1R9TJ 3BTCA 2R0QC 1ETOA 2YUSA 2XB5A 2YS9A 2EBIA 4MO7A 2LTPA 2X9DA 1ZGWA 1YRNA 1IGNA 5J1RA 1BA5A 1MBFA 2L7MP 5IOYA 1X58A 3SJMA 3RZDJ 1E3OC 1FIPA 2DA5A 5JLWA 2O8KA 5IP9J 5EGOB 4BBSJ 1ORKA 2VUMJ 1IRZA 3D1NI 1U78A 3BG3A 4XICA 1APLC 2O9LA 1VI0A 4JX5A 3IH4A 4M6VA 5EYRA 3SFIA 2Y9YA 4A3KJ 4B4CA 2HYJA 1MNMC 3PO2J 1ZTRA 3JR9A 3RZOJ 3H3VK 3ZQFA 2TCTA 3BR1A 1WH5A 1I6HJ 2FQ4A 2K40A 3BTIA 2VKVA 3HGGA 1NK2P 1WGXA 2JA6J 3BR5A 2R5ZB 4C3IJ 3S17J 2D5VA 4JYKA 4NDLA 1JTYA 4G12A 4W1UA 3GTMJ 4A69C 1Z0XA 1ITYA 2JN6A 3IH2A 2H1KA 1WCMJ 2ID3A 2Y2ZA 3BR3A 4MFDA 1G2HA 1P7IA 3CQZJ 5BNGA 4C3JJ 2LLKA 2MW8A 4EEFG 1Y1WJ 2DMQA 2HOTA 4DYRA 1XC5A 3BQYA 4UUSA 2EZKA 4M3DA 1SFOJ 1HDDC 2N8GA 3BQZA 1XS9A 1UMQA 2L9RA 4AC0A 5EG0A 3FIWA 1IJWC 2X6OA 4FE4A 3A01B 3E7LA 2AHQA 3LOCA 1ZR4A 5IYCJ 2GBYA 3BG9A 3JRGA 5E3LA 4Y7NJ 5IP6A 1B8IB 3JRFA 3S1NJ 4QSHA 3JRAA 2NS7A 3H0GJ 4A3LJ 2HDDA 1K61A 1MBKA 5HODA 3ZQIA 5FKNA 2H8RA 3CCYA 3ZOBA 3S1QJ 1HDPA 3HGYA 2E1OA 1BL0A 4XRMA 2R5YA 1T33A 2LKXA 4A3FJ 4C3HJ 3OSGA 1K83J 3UKGA 3RKQA 5FKMA 4D5CA 1UG2A 3HOXJ 4MIMA 3G1OA 1O4XA 5GP9A 4RBOA 1A6IA 1ETVA 2M0CA 2K9SA 3Q0VA 2DA7A 1MBJA 3MN2A 2EH3A 1XG1A 2MGQA 4HNVA 2VI6A 1MSFC 3NARA 5C3EJ 3B6AA 2EZLA 2OPTA 3ZQLA 4M3EA 3Q0UA 4A3EJ 1EF4A 2FD5A 2O7OA 4J19A 5M3MJ 2Y0SN 3MKLA 1AU7A 2IEKA 3DEWA 5E3NA 4CYCA 3LSJA 2WAQN 2L0KA 1FJLA 1ETWA 3BG5A 1GV2A 1JJ6C 1AHDP 5IYBJ 3DCFA 5IP7J 2KDZA 3G1MA 3Q3SA 3LNQA 1S7EA 4FE7A 1U8BA 1JUPA 2JA5J 2NOGA 1OFCX 1LE8A 2CQXA 2G0EA 3LSPA 1VNDA 2M34A 2XPUA 3M4OJ 2LP0A 2NVYJ 5FKOA 1X2NA 2VPRA 3W6VA 1H88C 2HQ5A 3CMYA 2DA1A 1IUFA 2LFBA 2JMWA 3I4MJ 4DYCA 1JKOC 1ETQA 2XGEA 1ZQ3P 3O8HA 1WH7A 1MBGA 5DTDA 3JREA 5IPAA 4BY7J 1ETYA 5EGOA 2NVTJ 1JUMA 1LFUP 1F43A 2COBA 1WI3A 1FTTA 1MH3A 3GBGA 4B1RA 3HOVJ 1H8AC 3TP0A 2NVXJ 2LVSA 4A3CJ 3OOUA 1JT0A 3F0CA 1BW6A 2XB0X 2M9HA 1U9NA 1DU6A 5M3FJ 4A93J 3FKIJ 2K9NA 2R5ZA 1JKRC 1B72B 3PO3J 1U9OA 2ELKA 3HOWJ 3FK6A 2Y31A 4QIWN 4BBRJ 3JRIA 1CQTA 5J1YA 1FTZA 1JKQC 1ZR2A 2IBDA 2MSYA 3I4NJ 4RDUA 4Y52J 1HCRA 1UHSA 3TW7A 4V2GA 3HOZJ 3GTQJ 4IHYA 3A03A 1A5JA 5GPCA 4MFEA 1NK3P 1OCPA 1GT0C 1HF0A 2ME0A 3BR0A 2EZHA 2E2IJ 2LY9A 1OJLA 3LSGA 5M5XJ 4BY1J 2EQRA 2AO9A 3MVPA 4MLOA 3A01A 4AUXA 3M3YJ 1LFBA 4FTHA 4A3DJ 4JX4A 4X6AJ 3ZQGA 2TRTA 2JJ7A 1B8IA 2YU9J 4M3BA 1ETXA 3HDDA 2CUFA 2I10A 2E2HJ 1I3QJ 2CJJA 3ZQHA 5C4JJ 5EDNA 2DA2A 4D7NA 4DYQA 5EEAA 4A3JJ 1JGGA 5F1JA 2JA8J 1IDYA 2CRGA 2GM4A 2B63J 1X2MA 1JKPC 1Q1VA 1TWGJ 3GTGJ 5IOZA 3GTOJ 2XRLA 1QVTA 3VPRA 2ME6A 4S0HB 1PUFB 5E3MA 5FKLA 4M3FA 2L7ZA 2R92J 4I6ZA 3S1RJ 2NS8A 2ECBA 2QF7A 5C44J 4A3IJ 1W0TA 1SANA 1BW5A 5F04A 5EZGA 4XRSA 1RKTA 1JT6A 3A02A 1GDTA 2XPVA 1MH4A 4QTRA 4IHWA 1HOMA 1ETKA 5M5YJ 2FX0A 5F0HA 4A3MJ 4DW6A 5E3OA 3S2DJ 3O8GA 5K7FA 3QQAA 3S1MJ 4D5FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3B J;  3BR6 A;  2HOA A;  4M3G A;  1TWF J;  2X48 A;  1RET A;  3K7A J;  3IV5 A;  2PMZ N;  1IV6 A;  9ANT A;  2MG4 A;  4V2F A;  4ABZ A;  3LSR A;  4FCY A;  3NAU A;  3L1P A;  1AKH B;  4JX6 A;  5FKK A;  3B6C A;  4IHV A;  3CDL A;  1MBE A;  3JRB A;  5JLX A;  5M5W J;  2DMU A;  1D5Y A;  3K2A A;  1YRN B;  4A3G J;  1F36 A;  3S14 J;  3BTL A;  4XID A;  3S16 J;  2KT0 A;  1QPI A;  2P81 A;  4BKX A;  3BR2 A;  2Y9Z A;  3S15 J;  4LOC A;  2CQQ A;  2HI3 A;  2OF7 A;  4BXX J;  2CU7 A;  2HXO A;  3IH3 A;  3GTJ J;  3HOU J;  5FLV A;  4UUT A;  2LK2 A;  2ID6 A;  5F0C A;  4B3A A;  5EZH A;  3BT9 A;  5C4X J;  2L7F P;  2RAE A;  1B72 A;  3SDG A;  2XPW A;  2GLO A;  1BJZ A;  1TWH J;  2LD5 A;  3G1L A;  4IEJ A;  4DZP A;  2FJ1 A;  5FJ8 J;  3JRD A;  3QPL A;  1WPK A;  5GPA A;  1T56 A;  1RKW A;  1TWA J;  1Y1V J;  1FIA A;  4UUS B;  1RR7 A;  1POG A;  2HOS A;  1FEX A;  3Q0W A;  5J1U A;  3HOY J;  2R7Z J;  2DA3 A;  3S2H J;  2EZI A;  5EG0 B;  2CUE A;  2DMP A;  4XK4 A;  5FLM J;  1JTX A;  1IG7 A;  4FIS A;  1OCT C;  2JWT A;  1VFC A;  2K9Q A;  4JP0 A;  2DN0 A;  1ZKG A;  4X1E A;  2NVQ J;  3BTJ A;  4AYB N;  1GVD A;  4XRS G;  2JA7 J;  2DMN A;  3HB9 A;  2XSD C;  1TC3 C;  1H89 C;  1MBH A;  3TW6 A;  3HBL A;  2QCO A;  2W48 A;  2ZB9 A;  3TED A;  2Y30 A;  1QVU A;  2R5Y B;  1ENH A;  2IAI A;  5F08 A;  1DU0 A;  3GTL J;  1P7J A;  2DA4 A;  4GFB A;  3FIS A;  4I76 A;  1PUF A;  5IYD J;  2WB1 N;  1IDZ A;  3JRH A;  1I50 J;  2LR8 A;  3WHC A;  3C2B A;  1JUS A;  5J3L A;  4IHX A;  4W97 A;  4D7M A;  1W0U A;  5F0F A;  2E19 A;  3WHB A;  5F27 A;  1MSE C;  2ECC A;  1JJ8 C;  2XGC A;  3HM5 A;  3RQI A;  1GV5 A;  3OSF A;  2VKE A;  4CYC B;  1Z77 A;  2XGD A;  1TWC J;  2DJN A;  1NTC A;  3QPS A;  3HEF A;  5EF6 A;  3ZQC A;  1GUU A;  4DZJ A;  5K7H A;  1RES A;  2HXI A;  2R93 J;  2DA6 A;  3FK7 A;  2JK3 A;  5K7Z A;  1QRY A;  2M2E A;  1HLV A;  1LE8 B;  3GTP J;  1VF9 A;  3OIO A;  1IC8 A;  1ZK8 A;  2M8G X;  3GTK J;  1AKH A;  4L5E A;  2DTZ A;  5DS9 A;  2E2J J;  3HKZ N;  3PM1 A;  3JRC A;  2WV1 A;  4C2M J;  1RPW A;  2DMT A;  3TP3 A;  1R9T J;  3BTC A;  2R0Q C;  1ETO A;  2YUS A;  2XB5 A;  2YS9 A;  2EBI A;  4MO7 A;  2LTP A;  2X9D A;  1ZGW A;  1YRN A;  1IGN A;  5J1R A;  1BA5 A;  1MBF A;  2L7M P;  5IOY A;  1X58 A;  3SJM A;  3RZD J;  1E3O C;  1FIP A;  2DA5 A;  5JLW A;  2O8K A;  5IP9 J;  5EGO B;  4BBS J;  1ORK A;  2VUM J;  1IRZ A;  3D1N I;  1U78 A;  3BG3 A;  4XIC A;  1APL C;  2O9L A;  1VI0 A;  4JX5 A;  3IH4 A;  4M6V A;  5EYR A;  3SFI A;  2Y9Y A;  4A3K J;  4B4C A;  2HYJ A;  1MNM C;  3PO2 J;  1ZTR A;  3JR9 A;  3RZO J;  3H3V K;  3ZQF A;  2TCT A;  3BR1 A;  1WH5 A;  1I6H J;  2FQ4 A;  2K40 A;  3BTI A;  2VKV A;  3HGG A;  1NK2 P;  1WGX A;  2JA6 J;  3BR5 A;  2R5Z B;  4C3I J;  3S17 J;  2D5V A;  4JYK A;  4NDL A;  1JTY A;  4G12 A;  4W1U A;  3GTM J;  4A69 C;  1Z0X A;  1ITY A;  2JN6 A;  3IH2 A;  2H1K A;  1WCM J;  2ID3 A;  2Y2Z A;  3BR3 A;  4MFD A;  1G2H A;  1P7I A;  3CQZ J;  5BNG A;  4C3J J;  2LLK A;  2MW8 A;  4EEF G;  1Y1W J;  2DMQ A;  2HOT A;  4DYR A;  1XC5 A;  3BQY A;  4UUS A;  2EZK A;  4M3D A;  1SFO J;  1HDD C;  2N8G A;  3BQZ A;  1XS9 A;  1UMQ A;  2L9R A;  4AC0 A;  5EG0 A;  3FIW A;  1IJW C;  2X6O A;  4FE4 A;  3A01 B;  3E7L A;  2AHQ A;  3LOC A;  1ZR4 A;  5IYC J;  2GBY A;  3BG9 A;  3JRG A;  5E3L A;  4Y7N J;  5IP6 A;  1B8I B;  3JRF A;  3S1N J;  4QSH A;  3JRA A;  2NS7 A;  3H0G J;  4A3L J;  2HDD A;  1K61 A;  1MBK A;  5HOD A;  3ZQI A;  5FKN A;  2H8R A;  3CCY A;  3ZOB A;  3S1Q J;  1HDP A;  3HGY A;  2E1O A;  1BL0 A;  4XRM A;  2R5Y A;  1T33 A;  2LKX A;  4A3F J;  4C3H J;  3OSG A;  1K83 J;  3UKG A;  3RKQ A;  5FKM A;  4D5C A;  1UG2 A;  3HOX J;  4MIM A;  3G1O A;  1O4X A;  5GP9 A;  4RBO A;  1A6I A;  1ETV A;  2M0C A;  2K9S A;  3Q0V A;  2DA7 A;  1MBJ A;  3MN2 A;  2EH3 A;  1XG1 A;  2MGQ A;  4HNV A;  2VI6 A;  1MSF C;  3NAR A;  5C3E J;  3B6A A;  2EZL A;  2OPT A;  3ZQL A;  4M3E A;  3Q0U A;  4A3E J;  1EF4 A;  2FD5 A;  2O7O A;  4J19 A;  5M3M J;  2Y0S N;  3MKL A;  1AU7 A;  2IEK A;  3DEW A;  5E3N A;  4CYC A;  3LSJ A;  2WAQ N;  2L0K A;  1FJL A;  1ETW A;  3BG5 A;  1GV2 A;  1JJ6 C;  1AHD P;  5IYB J;  3DCF A;  5IP7 J;  2KDZ A;  3G1M A;  3Q3S A;  3LNQ A;  1S7E A;  4FE7 A;  1U8B A;  1JUP A;  2JA5 J;  2NOG A;  1OFC X;  1LE8 A;  2CQX A;  2G0E A;  3LSP A;  1VND A;  2M34 A;  2XPU A;  3M4O J;  2LP0 A;  2NVY J;  5FKO A;  1X2N A;  2VPR A;  3W6V A;  1H88 C;  2HQ5 A;  3CMY A;  2DA1 A;  1IUF A;  2LFB A;  2JMW A;  3I4M J;  4DYC A;  1JKO C;  1ETQ A;  2XGE A;  1ZQ3 P;  3O8H A;  1WH7 A;  1MBG A;  5DTD A;  3JRE A;  5IPA A;  4BY7 J;  1ETY A;  5EGO A;  2NVT J;  1JUM A;  1LFU P;  1F43 A;  2COB A;  1WI3 A;  1FTT A;  1MH3 A;  3GBG A;  4B1R A;  3HOV J;  1H8A C;  3TP0 A;  2NVX J;  2LVS A;  4A3C J;  3OOU A;  1JT0 A;  3F0C A;  1BW6 A;  2XB0 X;  2M9H A;  1U9N A;  1DU6 A;  5M3F J;  4A93 J;  3FKI J;  2K9N A;  2R5Z A;  1JKR C;  1B72 B;  3PO3 J;  1U9O A;  2ELK A;  3HOW J;  3FK6 A;  2Y31 A;  4QIW N;  4BBR J;  3JRI A;  1CQT A;  5J1Y A;  1FTZ A;  1JKQ C;  1ZR2 A;  2IBD A;  2MSY A;  3I4N J;  4RDU A;  4Y52 J;  1HCR A;  1UHS A;  3TW7 A;  4V2G A;  3HOZ J;  3GTQ J;  4IHY A;  3A03 A;  1A5J A;  5GPC A;  4MFE A;  1NK3 P;  1OCP A;  1GT0 C;  1HF0 A;  2ME0 A;  3BR0 A;  2EZH A;  2E2I J;  2LY9 A;  1OJL A;  3LSG A;  5M5X J;  4BY1 J;  2EQR A;  2AO9 A;  3MVP A;  4MLO A;  3A01 A;  4AUX A;  3M3Y J;  1LFB A;  4FTH A;  4A3D J;  4JX4 A;  4X6A J;  3ZQG A;  2TRT A;  2JJ7 A;  1B8I A;  2YU9 J;  4M3B A;  1ETX A;  3HDD A;  2CUF A;  2I10 A;  2E2H J;  1I3Q J;  2CJJ A;  3ZQH A;  5C4J J;  5EDN A;  2DA2 A;  4D7N A;  4DYQ A;  5EEA A;  4A3J J;  1JGG A;  5F1J A;  2JA8 J;  1IDY A;  2CRG A;  2GM4 A;  2B63 J;  1X2M A;  1JKP C;  1Q1V A;  1TWG J;  3GTG J;  5IOZ A;  3GTO J;  2XRL A;  1QVT A;  3VPR A;  2ME6 A;  4S0H B;  1PUF B;  5E3M A;  5FKL A;  4M3F A;  2L7Z A;  2R92 J;  4I6Z A;  3S1R J;  2NS8 A;  2ECB A;  2QF7 A;  5C44 J;  4A3I J;  1W0T A;  1SAN A;  1BW5 A;  5F04 A;  5EZG A;  4XRS A;  1RKT A;  1JT6 A;  3A02 A;  1GDT A;  2XPV A;  1MH4 A;  4QTR A;  4IHW A;  1HOM A;  1ETK A;  5M5Y J;  2FX0 A;  5F0H A;  4A3M J;  4DW6 A;  5E3O A;  3S2D J;  3O8G A;  5K7F A;  3QQA A;  3S1M J;  4D5F A; 
#chains in the Genus database with same CATH topology
 3ZMD A;  3K2Z A;  4HPQ A;  3RPQ A;  2OTL I;  2VKH A;  3BCB A;  4NC6 A;  4IF4 A;  1MDM B;  1IV6 A;  9ANT A;  5L3B A;  2MG4 A;  1TT0 A;  3K1P A;  2XAH A;  3L1P A;  1KGS A;  3K4K A;  4DQ2 A;  4JX6 A;  3MMY B;  1DQU A;  5LHG A;  2FQ3 A;  3F23 A;  4AIH A;  2TDX A;  4IHV A;  3JSO A;  4XNF A;  3KYD B;  3KFW X;  3JRB A;  5M5W J;  3BZ6 A;  4PJJ A;  4CIC A;  4B8X A;  4O5V A;  3K2A A;  4A3G J;  3SHF A;  2K27 A;  5KAI C;  4ZYA A;  3Q5F A;  5DD8 A;  3KIO A;  3N97 A;  2BZT A;  4XID A;  1EA3 A;  3ZMV A;  3S16 J;  4LJZ F;  4MEX F;  4LOC A;  2VLA A;  1MND A;  5BMZ A;  3EET A;  4AID A;  2CU7 A;  1F4K A;  2MD5 A;  3GTJ J;  5FLV A;  3E6C C;  1DUX C;  1WRJ A;  5CVV A;  2ZME A;  3U1K A;  1G3W A;  4OIP F;  2VBW A;  2ID6 A;  3SZT A;  4XRF A;  5B5E C;  2PJR A;  3BT9 A;  4ENJ A;  3S93 A;  2L7F P;  2RAE A;  3J7A O;  2F4O B;  3TDZ C;  3DWL E;  2CUJ A;  2JRT A;  2MAB A;  1TWH J;  4KIC A;  3FM3 A;  1R7J A;  1K4S A;  2CS3 A;  4DZP A;  2O03 A;  5IT3 A;  2A5W A;  1QO0 D;  2BVM A;  5D8L B;  5J8F A;  4UNO A;  4Y33 A;  3JRD A;  2BY2 A;  3QPL A;  4XKB A;  4CUG A;  1Z1D A;  3GZ6 A;  1FBQ A;  4LD5 A;  4L5I A;  4XN0 A;  1JI8 A;  1RKW A;  4II2 A;  2L01 A;  3FZV A;  2HKX A;  1FEX A;  4DOZ A;  3ZMZ A;  2VBZ A;  2VL8 A;  3BC8 A;  2CUE A;  5EG0 B;  2KZG A;  5DUI A;  2Q2E B;  3OY9 A;  4YII A;  4MEY F;  1IG7 A;  5DUK A;  3FBI B;  4BQQ A;  2XAQ A;  2Y0M A;  4AYB N;  3OS1 A;  3HHG A;  2VN2 A;  1T8I A;  1EKE A;  2HU9 A;  5FFX A;  3CME I;  4XRS G;  4A0Y A;  5H6Q A;  2JA7 J;  2DMN A;  4H0E A;  4D0P A;  1MBH A;  2NOJ B;  4HF0 A;  1TQI A;  2BY1 A;  2ZB9 A;  1QVU A;  3IC7 A;  3VYR B;  1ENH A;  2VBX A;  4PFO A;  5F08 A;  2R5Y B;  1SVL A;  4V19 K;  2QWW A;  4ZZL A;  1P7J A;  2DA4 A;  2PFB A;  3K4M A;  1PUF A;  1WJD A;  2WB1 N;  2F2E A;  2E7X A;  1X1C A;  1OLT A;  2MLG A;  5L3F A;  3DTE A;  1JXS A;  4XLC A;  2R4G A;  2HFH A;  3C2B A;  4IX7 A;  1JUS A;  5J3L A;  1KQ8 A;  1Y8R B;  2EIL H;  5FO5 A;  4N4N B;  5L3G A;  3R6S A;  1W0U A;  5F0F A;  3FF5 A;  3WHB A;  3K69 A;  4ASN A;  3QRF F;  3HRM A;  4IHS A;  3R61 A;  2WAF A;  1XGN A;  4Y4R A;  3HUG A;  4C2T A;  3OSF A;  2VKE A;  3ASN H;  4R1H A;  1TBX A;  2A05 A;  3ZQC A;  1GUU A;  2HR3 A;  5J40 A;  4DZJ A;  5BQT A;  3L2U A;  2XF7 A;  1I39 A;  3G3Z A;  1XB4 A;  2DA6 A;  3AG3 H;  2WBM A;  4Y15 A;  2JK3 A;  2MC3 A;  1MDM A;  2A3S A;  4BS9 A;  1YFH A;  3OYH A;  4HF2 A;  1OYY A;  1HW1 A;  4ZJZ A;  1D1B A;  1IUY A;  2YPR A;  3QYF A;  1RR8 C;  1E2X A;  4F52 A;  2DTZ A;  3HKZ N;  2ESN A;  3TBI A;  4ETS A;  3DBH B;  1R5I D;  2XVC A;  3KEO A;  1W7P B;  5LBQ A;  2R0Q C;  2YS9 A;  1P2F A;  2CH0 A;  2EBI A;  2IGK A;  2LTP A;  1MMD A;  4FQG A;  1YIO A;  2P8T A;  3CF5 F;  1IGN A;  1BA5 A;  1MBF A;  1YQA A;  2L7M P;  3RZD J;  2RRE A;  2X1D A;  3FXK A;  3KP5 A;  3GZ5 A;  3D5R C;  1ORK A;  3H9Q A;  5E1W A;  4IQ4 A;  3F72 A;  1IRZ A;  2L7K A;  1FX7 A;  3QU3 A;  4JQF A;  5CLS A;  4QPO A;  5DV5 A;  4XOR A;  4XIC A;  1VI0 A;  2A6T A;  3KET A;  2O9L A;  1BI0 A;  3IH4 A;  4RGX A;  1S7A A;  2OV7 A;  3C2H A;  4I99 C;  3JR9 A;  3RZO J;  2QGU A;  3FMR A;  1OMI A;  2MH2 A;  3H35 A;  3HSF A;  1FWZ A;  2PEX A;  1P4X A;  2LY1 A;  3BTI A;  3OYN A;  4A2U A;  2OJE D;  2FML A;  3JAM K;  4C3I J;  3RJP A;  2HVS A;  1LNW A;  4NDL A;  5BPI A;  1YJW I;  3GTM J;  2K4J A;  3L9F A;  1Z0X A;  4O6J A;  1ITY A;  2JN6 A;  3I64 A;  2Q0O A;  2H1K A;  4ZTJ A;  1WCM J;  2IGM A;  1ZG5 A;  3FXU A;  2Y2Z A;  3BR3 A;  4OIR F;  3S2W A;  3R60 A;  1T2K A;  4KIT B;  5BNG A;  3AKZ A;  3OOP A;  2MW8 A;  4CA0 A;  2DOF A;  2L54 A;  3VYT B;  5CQE A;  1JGS A;  1XC5 A;  3BQY A;  2HNH A;  1SFO J;  3CO7 C;  4B3X A;  1GXQ A;  3BQZ A;  1YOV B;  1J09 A;  4E6K G;  4ZDL A;  5EG0 A;  3FIW A;  3B02 A;  2Q2E A;  1R1V A;  1X3W B;  2M4G A;  1EH6 A;  2H27 A;  2F5C A;  2FBH A;  2AHQ A;  4KUM A;  1FLI A;  2KP6 A;  3FDY A;  1YJ9 I;  2JVG A;  4XLH A;  5FLX Z;  3FMQ A;  2BE5 F;  3LFK A;  4U0V A;  2MD0 A;  1YLF A;  1WWX A;  4MTD A;  3H0G J;  4A3L J;  1FNN A;  2XAG A;  2UXN A;  1T39 A;  2KIF A;  2GQQ A;  3AAF A;  2DPU A;  3I56 I;  3CCY A;  2CSO A;  2ZJ2 A;  1R49 A;  4CCN A;  3ABL H;  3H92 A;  2R5Y A;  1SD4 A;  2L9S A;  4C3H J;  3PIP F;  2EV0 A;  1UG2 A;  4XLP F;  3M8E A;  4MIM A;  5GP9 A;  1ETV A;  2M0C A;  2QKM B;  2JUG A;  4WF2 A;  2DA7 A;  1MBJ A;  3GVA A;  2CO5 A;  2XC7 A;  2CGP A;  1O7F A;  2B9S A;  1DPR A;  2VI6 A;  4U7B A;  4AYB A;  3BG6 A;  1U5T B;  5HS7 A;  2XGX A;  3W3C A;  4M3E A;  2ZO4 A;  3TO6 A;  4BJT A;  1EF4 A;  2V79 A;  1TNS A;  2ZFU A;  2Y0S N;  1YS6 A;  3DEW A;  2AQE A;  1QPM A;  3ABM H;  2XRO A;  2L0K A;  1MJB A;  3BG5 A;  1GV2 A;  2XSJ C;  1Y0U A;  1AHD P;  5D5X B;  2IPQ X;  3Q3S A;  4UXN A;  1O7L A;  3T0Y A;  2A69 F;  1S29 A;  5GAG J;  2JA5 J;  2BYV E;  2NOG A;  2OBP A;  4GO1 A;  3W2V A;  1V5G A;  1HQC A;  2XPU A;  1H9G A;  4JOM A;  5CVJ A;  1YS7 A;  1X2N A;  2VPR A;  1MJ9 A;  3G2B A;  1XMA A;  3CMY A;  1ZG1 A;  1SFX A;  1BR1 A;  1G3T A;  2EA2 A;  2DLL A;  3D0S A;  4CCL A;  1YX3 A;  1W7P A;  4LFU A;  3J81 K;  1HXD A;  3H5N A;  2BY0 A;  4DYC A;  3EPZ A;  1ZYR F;  3O8H A;  5B66 C;  3IRR A;  3JRE A;  4Y3O A;  1WKM A;  4Q48 A;  1LEB A;  4XL9 A;  1S5L C;  1F43 A;  3GWZ A;  2COB A;  2M4K A;  1H8A C;  4EGY A;  3MEX A;  4HQM A;  3AL0 C;  3WOD F;  1JT0 A;  3HKZ A;  1VQK I;  1ZLK A;  1UFM A;  5D4S A;  4ZYE A;  4L9V A;  1PDN C;  1V3F A;  1DU6 A;  1LKX A;  4PCQ A;  1UJ8 A;  4RM3 A;  2GAU A;  1D3Y A;  2Z16 A;  1B72 B;  1FOK A;  4PGG A;  5FRO A;  4CH7 A;  3PO3 J;  1U9O A;  1WVR A;  2A6E F;  3Q9V A;  3S8P A;  4BBR J;  4A6E A;  5CJ9 A;  1LPQ A;  4NQW B;  4PZJ A;  1FTZ A;  2P7V B;  5HLH A;  1YX5 A;  4BJ5 C;  4ENN A;  1P9Q C;  1XTA A;  3P5J A;  4E7I A;  1X4P A;  2LBF B;  3RIR A;  1FY7 A;  4HSR A;  1GHC A;  2IVM A;  2WY8 Q;  1EH7 A;  2EZH A;  2K3P A;  3BR0 A;  3WTS C;  2E2I J;  3AFH A;  2CQN A;  1OJL A;  2EQR A;  4C2U A;  4MLO A;  2ZXH A;  5HDN A;  5A2Q Z;  3WE3 A;  1YJN I;  3PL8 A;  2A07 F;  1IXC A;  2ZCW A;  3UR3 C;  4A3D J;  2F48 A;  1UB9 A;  4M3B A;  1ETX A;  2CUF A;  4BE0 A;  2P5V A;  4KIF A;  4A5N A;  1I3Q J;  3J80 K;  4RAY A;  3ZQH A;  2KJC A;  4IRG A;  2DA2 A;  3LAP A;  2NS0 A;  4DYQ A;  3QU6 A;  3H9G A;  5E18 F;  4BDY A;  2KRC A;  3WGG A;  3SFZ A;  3VDX A;  4KFC A;  1Q1V A;  4EM2 A;  1FOY A;  5IT9 Z;  4BXF A;  3GTO J;  1VQ4 I;  2HVR A;  4TV7 A;  1FT9 A;  1DGR M;  2CQ7 A;  2YX7 A;  4F93 B;  4FT8 A;  2J5P A;  3ZPL A;  3V8J A;  3Q9S A;  3LMM A;  4E4H A;  4IOC F;  2GOM A;  2RC4 A;  1SAN A;  4HA8 A;  4P1W A;  1BW5 A;  1DGW Y;  3FHZ A;  1U5T A;  3L2R A;  1W5C C;  3DU6 A;  1RKT A;  4XRS A;  1Z6R A;  4RS8 A;  1WJF A;  3CJR B;  1TZL A;  2XF5 A;  2KLO A;  1KA8 A;  1GDT A;  3P7N A;  5TJJ A;  5M5Y J;  4PGH A;  2FX0 A;  2DAO A;  5KNL A;  3OYM A;  2IS2 A;  5E3O A;  5DM7 F;  1R23 A;  1V5F A;  3K6G A;  3O8G A;  3S1M J;  1T08 B;  3K1N A;  4XSX F;  2V26 A;  3WGH A;  2DOE A;  4M72 A;  2XRN A;  2A5Y B;  3MAJ A;  3TOA A;  2HZD A;  2HOA A;  4M3G A;  1TWF J;  2X48 A;  1RET A;  2CW8 A;  5E20 A;  2DXI A;  1OKR A;  2DU9 A;  2CWE A;  3SXY A;  4V2F A;  3LSR A;  1STZ A;  4FCY A;  2STT A;  5ICF A;  1AKH B;  2E1C A;  4GXO A;  3CLQ A;  2DOD A;  3ISP A;  3V7C A;  4KIS A;  5LEJ A;  1FSE A;  2M1B A;  4E7H A;  3E0J B;  2X51 A;  2CQK A;  3U2R A;  1YRN B;  4AIJ A;  2Z99 A;  1IN7 A;  3BTL A;  2QA4 I;  2F5F A;  4Q47 A;  4HX4 A;  3X2Q H;  3CTA A;  3ZN1 A;  2F5D A;  1QPI A;  4PK4 A;  4BDZ A;  3ECO A;  4BKX A;  4IZZ A;  1T0F C;  3BR2 A;  4KDP A;  4KA4 A;  3FXM A;  2HI3 A;  2OCE A;  2LRE A;  3FXO A;  4UB8 C;  4BXX J;  1G3Y A;  1SFK A;  2M8E A;  1IW7 F;  3HOU J;  3BP8 A;  4AWX B;  3O3K A;  4M9S A;  2Z9O A;  5D5U B;  2F5E A;  4BHB A;  4B3A A;  3LSH A;  5C4X J;  4C30 A;  2WC2 A;  3VYS B;  1B72 A;  2PI0 A;  4FX4 A;  3I53 A;  2JPC A;  2XPW A;  4AU7 A;  2K85 A;  1BJZ A;  1W1W E;  2KIM A;  2X6X A;  1ZGJ A;  5HDG A;  3CD6 I;  2LD5 A;  1VQ5 I;  4NQW A;  4ENM A;  3VFZ A;  2CW7 A;  2KDO A;  3GFL A;  2DTR A;  4RA2 A;  5FJ8 J;  3BOQ A;  4XON A;  3F8M A;  4AVZ A;  1YHQ I;  3BJA A;  4G6D A;  1WPK A;  3FHN A;  2BHZ A;  4XN3 A;  4EM1 A;  4LGW A;  4B43 A;  2LBF A;  2E5Z A;  1IXR C;  2O3F A;  5CYV A;  3B73 A;  1MZB A;  1Y1V J;  1FIA A;  1POG A;  2KRF A;  2HOS A;  1WJB A;  2E35 A;  5J1U A;  4CXF A;  1OCZ H;  4HAM A;  2EZI A;  1E3P A;  1HST A;  3CZ6 A;  1PVE A;  3UNG C;  3DXJ F;  3OR2 C;  4FIS A;  3JSP A;  3HJE A;  3KLN A;  5GTI C;  1B6A A;  1BI1 A;  1VFC A;  2UUZ A;  1N25 A;  2QM3 A;  1ZKG A;  3F6O A;  4ZTF A;  2A6H F;  3E6M A;  2DFI A;  2CUZ A;  3VYU B;  3J7Z I;  5D8K B;  1O3Q A;  2EIJ H;  4XLA A;  4G9Y A;  1S9H A;  1P6R A;  2XSD C;  1BN5 A;  1VQL I;  4PFP A;  3LSI A;  2L2O A;  2RNJ A;  4E70 A;  1ZH5 A;  2W48 A;  2B7E A;  3TED A;  4KJZ A;  2ZXW H;  3EUA A;  4U0Y A;  2JRM A;  3GTL J;  2BXY A;  1OQY A;  2LF7 A;  4I76 A;  5IYD J;  1XDU A;  1IDZ A;  2W7N A;  4P9U A;  1S8N A;  2LR8 A;  2MC4 A;  3G71 I;  4G7Z F;  1QBJ A;  5K1Y A;  3DKX A;  5HOO A;  5JHF A;  4W97 A;  4D7M A;  2DT5 A;  3OYF A;  5F27 A;  4Y13 A;  2OA4 A;  5ICC A;  2FNA A;  3K0L A;  1XGO A;  3HM5 A;  2J5O A;  3RQI A;  1WI9 A;  2Q8K A;  5HNF A;  4YG2 F;  1A35 A;  1UG0 A;  3TO9 A;  2ESH A;  2WV0 A;  3KZY A;  2QQ8 A;  3RCO A;  1OPC A;  3WE2 A;  3ROU A;  2V1N A;  3FK7 A;  3OYD A;  4L0Z B;  2PX9 A;  3S3N A;  4HQE A;  2H6C A;  1L0O C;  2RKH A;  2RDP A;  2QQA A;  4GRI A;  1LE8 B;  2KL4 A;  4CZZ A;  1CGP A;  1VF9 A;  2EFW A;  1OCO H;  3ZMT A;  3HTU A;  3FX3 A;  1AKH A;  4L5E A;  4R8H A;  4MGR A;  4BAY A;  1YE9 A;  2JQ7 A;  1UCR A;  1XD7 A;  2UWM A;  1R58 A;  1RPW A;  4C2M J;  1G4D A;  1Z3X A;  1R9T J;  3RKX A;  3K70 D;  1U3E M;  4I0A A;  4R79 A;  1TW2 A;  3OYC A;  2XB5 A;  3E5X A;  5E1X A;  4MO7 A;  2X9D A;  1YRN A;  1PYV A;  1SD6 A;  5JR3 A;  2IA0 A;  1SMT A;  1OCC H;  3SJM A;  1X58 A;  3QAH A;  4Q5S F;  5JLW A;  4LLN A;  2O8K A;  5EGO B;  2EFN A;  4AD9 A;  3DKY A;  4G94 A;  4IRI A;  2WAD A;  4BBS J;  3O2P E;  1TLH B;  2DDB A;  2EJR A;  1U78 A;  3BG3 A;  2R7S A;  3PNV A;  5AON A;  2HYG D;  1D0Z A;  3ZMS A;  2R7V A;  4M6V A;  3SFI A;  2P6S A;  4B4C A;  4L9N A;  3TQN A;  4ESJ A;  3OS0 A;  2X4H A;  2TCT A;  2NYX A;  1WH5 A;  2OZ6 A;  2Y69 H;  3BR1 A;  3LSM A;  2K40 A;  3HGG A;  2VKV A;  4YEL A;  4F92 B;  2JA6 J;  3BR5 A;  4A0X A;  3S17 J;  6PAX A;  2VJ4 A;  4JYK A;  3CO6 C;  2M45 A;  4G7H F;  2ELJ A;  4G12 A;  4W1U A;  3VWB A;  3VSL A;  4BYY A;  1D5V A;  3IH2 A;  2QQB A;  4KMU X;  3K4B A;  3HL2 A;  1YO5 C;  4MHG A;  1A6Q A;  1D8K A;  3GYH X;  1G2H A;  1P7I A;  3ABK H;  3AL0 B;  3CQZ J;  3BZK A;  2LLK A;  1Y1W J;  1Z7L A;  1W4M A;  1V4R A;  4XOT A;  1J7K A;  1MNE A;  1FMW A;  1KU2 A;  4M3D A;  4QPQ A;  3H1C A;  2N8G A;  5BS6 A;  2L9R A;  4BQA A;  4RAZ A;  2VC1 A;  1IN8 A;  2HEO A;  2X85 A;  3E7L A;  3H36 A;  3V42 A;  1ZR4 A;  4GCV A;  3BG9 A;  4NB5 A;  3JRG A;  1QNT A;  3V4G A;  2IA1 A;  1B8I B;  3M8F A;  1YW7 A;  3IKT A;  3JRF A;  4DGW B;  3QOE A;  3AG4 H;  1BR4 A;  2XAF A;  3ZQ7 A;  5BPD A;  1MBK A;  2PMU A;  5KVR A;  2ZJQ F;  1FPQ A;  2I5U A;  3BJ6 A;  1H9T A;  2EV6 A;  3ERE D;  2ZBK A;  1R4N B;  2G7U A;  3WU2 C;  4XRM A;  2FOW A;  2Z3Y A;  1VQ9 I;  4LB6 B;  1QZY A;  1T33 A;  5JVG F;  5CVR A;  4A3F J;  3KX2 A;  3UKG A;  3RKQ A;  2HKO A;  2ACJ A;  1FP2 A;  2K86 A;  3HOX J;  4XSZ F;  1XSD A;  1A6I A;  1BC7 C;  2DJI A;  3BCA A;  5TRD A;  3KZZ A;  2PBI A;  1WFX A;  3HOT A;  1XG1 A;  2MGQ A;  1ZEL A;  1LDD A;  1R6R A;  2KMU A;  3NAR A;  5C3E J;  1YTY A;  2OPT A;  2R7T A;  3BPX A;  3IWF A;  4CHU A;  4KT6 A;  4IPA A;  4J19 A;  5M3M J;  3LA7 A;  2DFH A;  2X6W A;  3LSJ A;  3TL4 X;  1FSH A;  3DPT A;  1IRF A;  3M1C A;  2M3A A;  3KYL A;  2W85 A;  4EMS A;  1ETW A;  5AIP A;  4IO9 F;  2K3F A;  5DDG A;  1I1S A;  3F9K A;  1WSU A;  4E7J A;  1S7E A;  4AIK A;  1JUP A;  3I58 A;  1BC8 C;  4I7H A;  1OFC X;  1LB2 A;  1LE8 A;  3U1D A;  5L3D A;  1VND A;  2M34 A;  2FOK A;  3HZJ A;  5GAE J;  3LSP A;  4CSW A;  2NXN B;  2CV2 A;  3H9J A;  2LF8 A;  3CJT B;  3IUO A;  4FX0 A;  1E3H A;  4PJL A;  3HIF A;  1XDS A;  3IAM 2;  1VQ7 I;  4XOP A;  2W84 A;  1S7O A;  3CUQ C;  3WGI A;  4UB6 C;  3WTY C;  1XCB A;  1Y56 A;  2DQL A;  4XKC A;  4L9J A;  2GIV A;  3V8K A;  1ETQ A;  3I3L A;  3PFY A;  3RQ4 A;  1O3R A;  1ZQ3 P;  5ED4 A;  1BR2 A;  5KAF C;  2WAQ A;  3RYR A;  5IPA A;  3GEZ A;  5EGO A;  2LDU A;  2VOP A;  1ZN2 A;  4B1R A;  1W36 C;  2VC0 A;  3HOV J;  2L9V A;  1O57 A;  3A1Y A;  3HSE A;  5AIQ A;  2JTV A;  3W6K B;  5GAH J;  2D1V A;  5E8I A;  1GXP A;  1FZP B;  3CCJ I;  2KZV A;  1BW6 A;  3AG1 H;  5FGM A;  1P4W A;  3SZG A;  3K4C A;  1WHU A;  2E1M C;  2HTJ A;  4YFK F;  1NG7 A;  3PSI A;  4XLF A;  3MFK A;  4UVC A;  2K9N A;  1JKR C;  3OWT A;  3WTT C;  2AXT C;  4KN7 X;  2CMP A;  1UZC A;  3MZH A;  4NC8 A;  2V4J C;  2X6Y A;  3PQK A;  1SVM A;  3T8R A;  5CKT A;  4QIW N;  2EFQ A;  3W2A A;  1B59 A;  5J1Y A;  4CCM A;  2IBD A;  2MSY A;  1DPU A;  2ISZ A;  1HCR A;  4ZYH A;  3TW7 A;  3HOZ J;  4ESF A;  3GTQ J;  1K7A A;  3A03 A;  1A5J A;  3OV8 A;  4K2E A;  4P9F A;  1HF0 A;  1J75 A;  2ME0 A;  3CMM A;  4EJO A;  2BXZ A;  2VJ5 A;  3C3W A;  4ZDP A;  2LY9 A;  1LVK A;  4XMY A;  4FAS D;  2O0Y A;  3WTV C;  1DP7 P;  3CJQ B;  1ZRC A;  4AUX A;  2JPB A;  2HGC A;  2Z1D A;  1WZ2 A;  2VB6 A;  3IHU A;  4I01 A;  3F8N A;  3ZQG A;  1B8I A;  1ZRE A;  4H4K C;  2VE8 A;  3ASO H;  1OR7 C;  1MMS A;  2E34 A;  2W1O A;  2I10 A;  3CCS I;  1IXS B;  1ZG3 A;  3OIQ A;  2VQC A;  5J4Y A;  3SZP A;  1IDY A;  2GM4 A;  2IGO A;  3GZN B;  1K4T A;  2B63 J;  2IA2 A;  3J81 Z;  1IZ1 A;  4Z2Y A;  2XKO A;  5IOZ A;  1FC3 A;  2KHM A;  3GTG J;  1QVT A;  2YSR A;  4IL6 C;  4UV9 A;  1SMY F;  4BU2 A;  2E7W A;  5E3M A;  2IXS A;  1HC8 A;  4A0Z A;  1SAX A;  2L7Z A;  4J00 A;  2NS8 A;  2QF7 A;  2WAE A;  2FNP A;  2LNB A;  5B3S H;  1WQ2 A;  3MD2 A;  1SAU A;  5HS9 A;  3OYJ A;  3HPG A;  2V6E A;  1VTN C;  2OUM A;  1ZRD A;  3EYY A;  4WWC A;  1W5T A;  2GXA A;  5LGN A;  2RQQ A;  5F0H A;  4A3M J;  2FF4 A;  4MQ9 F;  1E17 A;  1XX5 A;  5F6F A;  2LG4 A;  2HOE A;  5LRS A;  3WTU C;  2KPM A;  2VPL A;  3CC7 I;  3FXR A;  4WK8 F;  5IY5 H;  1H0M A;  5LHH A;  2MH9 A;  2OZU A;  1FOX A;  2UXX A;  4OOI A;  4LB5 A;  4HNU A;  3K7A J;  1EH8 A;  2PMZ N;  2MYS A;  1F1Z A;  3FKJ A;  3ESW B;  2DOA A;  3LSK A;  1RI7 A;  4MNU A;  3RPU A;  1K78 B;  4B09 A;  1D8J A;  5FKK A;  3NQO A;  4BH9 A;  1VZ0 A;  3EYI A;  1VQP I;  4YRV A;  3OYK A;  3F22 A;  2Y75 A;  4BE1 A;  1D5Y A;  5H6R A;  4OMY A;  1CF7 B;  3S14 J;  4ANJ A;  2KT0 A;  1I3A A;  2M5W A;  2P81 A;  2ZFW A;  1WJE A;  2A68 F;  3MZ8 A;  4E7Z A;  1KU9 A;  3S15 J;  1QHG A;  2L5Q A;  3BRO A;  1ZGA A;  2HXO A;  4PJM A;  3J80 Z;  4E7L A;  1HW2 A;  2M7B A;  3SDB A;  2M0M A;  2BW3 B;  1Z67 A;  4UUT A;  5J8C A;  2JSC A;  3T1B A;  2IS6 A;  2EIK H;  4G8X A;  3GFI A;  4CCK A;  3KP4 A;  5HVQ C;  5F0C A;  1PP8 F;  4XBF A;  4RLQ A;  2MA3 A;  1I27 A;  2BY3 A;  2FUG 2;  4EJW A;  3CP8 A;  3SDG A;  1TQM A;  1L3L A;  2GLO A;  3GCM A;  1P92 A;  2I8D A;  2JT1 A;  1T0F A;  5JFR A;  3WU1 B;  3T8T A;  4NHJ A;  4IEJ A;  1A31 A;  4HV6 A;  3DBR B;  1E0E A;  1IAW A;  4EM0 B;  4DIQ A;  5GPA A;  3TDU C;  5J4V A;  4JK1 X;  2RGV A;  2OAZ A;  4UUS B;  1RR7 A;  3KLO A;  1BM9 A;  1K79 A;  4MTE A;  3N05 A;  3HOY J;  2R7Z J;  4AM3 A;  1LJ9 A;  1HKT A;  5FRN A;  2DMP A;  3DKW A;  1BI2 A;  2HQA A;  4XK4 A;  5FLM J;  2JWT A;  4I98 B;  3OL3 A;  2K9Q A;  4JP0 A;  3FM5 A;  2DN0 A;  1R4M B;  2LKP A;  4X1E A;  4KNY A;  5KK1 A;  2R7U A;  3KYC B;  3R0A A;  3OR1 C;  1MMA A;  4HLY A;  3NEU A;  3TGN A;  1ACI A;  1R71 A;  1GVD A;  3PNY A;  2O61 A;  3HB9 A;  3COA C;  3RSN A;  1H89 C;  3TW6 A;  2ZC2 A;  3GF2 A;  2XF6 A;  3ML6 A;  5J47 A;  2W82 A;  3M07 A;  2M7A A;  5KHD A;  2LMD A;  3EUH C;  3GW2 A;  1FYK A;  1J5Y A;  2AXL A;  2JVH A;  4YIF A;  3FIS A;  4HEA 2;  2VBY A;  3JRH A;  2V9K A;  1I50 J;  1G6N A;  4MQV A;  4S05 A;  1JE8 A;  4UVA A;  4XR6 A;  2HDW A;  4RAF A;  4U0W A;  3SYT A;  4PDK A;  2NNN A;  3FXL A;  2DBB A;  1T6S A;  3S3M A;  2VIX A;  3DF8 A;  2BOL A;  4YIR X;  1WJA A;  2LOO A;  4N0B A;  2XGC A;  1JJ8 C;  1V54 H;  3CP2 A;  2NNY A;  2XGD A;  1R5H A;  1TWC J;  2DJN A;  3QPS A;  4I0B A;  1OCR H;  3QOD A;  1ZAO A;  3OL4 A;  1M1E B;  5K7H A;  3HOS A;  2CFO A;  4RB0 A;  2R93 J;  3ERM A;  4HZF A;  1ZHF A;  2CG4 A;  3I54 A;  3WU0 A;  2FE3 A;  5K7Z A;  5A2Q K;  1QRY A;  2M2E A;  4PSX A;  5BOX A;  2YX4 A;  1IC8 A;  4RGS A;  4RLF A;  1ZK8 A;  2H1L A;  3GTK J;  1AOY A;  1WJ5 A;  1X1B A;  2L3D A;  2D2W A;  4HOB A;  2KJB A;  3PM1 A;  1K78 A;  2W24 A;  3JRC A;  1SD7 A;  4BL0 B;  2EFP A;  1R5G A;  1HKQ A;  5D5V B;  1ETO A;  2Q1Z B;  2LSO A;  1HOM A;  2QSF X;  1CF7 A;  2XAJ A;  1E3O C;  4LK1 F;  1V5E A;  1FIP A;  1B9M A;  1IN6 A;  1MIJ A;  3I59 B;  4ENK A;  5IP9 J;  5IT9 K;  2STW A;  2XAU A;  1TP4 A;  4E7K A;  2K4B A;  3I0T A;  5E79 C;  1K6O A;  1XMX A;  3D1N I;  2PMZ A;  5ILV A;  4JX5 A;  1XMK A;  3I71 A;  5EYR A;  3N4M A;  1XGM A;  1I6X A;  1RZ4 A;  3VEP A;  4A3K J;  2HYJ A;  2BW3 A;  1MNM C;  1G3S A;  4IHT A;  3CUQ B;  1ZLJ A;  2EB7 A;  3EQL F;  3ZQF A;  4GGG A;  3HYI A;  4ON0 A;  5FB2 A;  1HBX G;  3BLY A;  4I2O A;  3H3U A;  1I6H J;  2FQ4 A;  2QZ8 A;  2RNG A;  1NK2 P;  1WGX A;  2P7C B;  4KIB A;  2R5Z B;  1Z05 A;  2ZKZ A;  2K02 A;  2D5V A;  2COM A;  3BWG A;  1XSX A;  1JTY A;  2OQG A;  4G6Q A;  4HST A;  4LG3 A;  4IOA F;  1TTY A;  3GME A;  1UHM A;  1R36 A;  2ID3 A;  2AQF A;  4IXA A;  1KU3 A;  2RV8 A;  3GLL A;  4MFD A;  4RAG A;  3KZI C;  4C3J J;  4N4O B;  2MLK A;  4EEF G;  3I5U A;  3SEZ A;  2HOT A;  1RNL A;  2O6G E;  2GA1 A;  2R7R A;  1KU7 A;  4UUS A;  5DEQ A;  3MCZ A;  3EDP A;  2E1M B;  5DCF A;  3A4C A;  1VQ8 I;  1Y0N A;  1XS9 A;  4UV8 A;  2R7D A;  4AC0 A;  4CO8 A;  1F9N A;  1IJW C;  3PSF A;  2BV6 A;  2P6T A;  4DBQ A;  3A01 B;  1W7P D;  3TMO A;  2B0L A;  1BIA A;  4LK0 F;  1ODD A;  1LDK B;  5E3L A;  2KRH A;  5IP6 A;  3GFJ A;  3BPV A;  2GWR A;  3DEE A;  3F3X A;  2V1X A;  3LFU A;  4L5J A;  5JHU A;  3S1N J;  1TQP A;  4L0Y B;  1IRX A;  2VKD A;  4P96 A;  3E97 A;  3OYG A;  1J2X A;  2HPI A;  2VJI A;  2HDD A;  4GDF A;  3KEQ A;  5HOD A;  3WTX C;  3G4S I;  4PUS A;  5FKN A;  3K9T A;  2QKL B;  4BHP A;  2H8R A;  2JUC A;  5TIS C;  3E3V A;  4IJA A;  1K6Y A;  4EGZ A;  2L9N A;  4OAY A;  2FU4 A;  3E6B A;  2O8X A;  4O3M A;  4RB2 C;  2BVL A;  5FKM A;  2YU3 A;  1O4X A;  3G1O A;  2EWN A;  4RBO A;  2K9S A;  3Q0V A;  2RQP A;  5LGU A;  4UHT A;  3MN2 A;  1Y8Q B;  2EH3 A;  3R0J A;  4HNV A;  3PUF A;  4M6Y A;  3OYA A;  1RUO A;  3B6A A;  5CQG A;  4M9X A;  2OCC H;  2QLZ A;  3Q0U A;  5LLQ A;  1C0W A;  2FD5 A;  2O7O A;  1T38 A;  2PG4 A;  1AU7 A;  2WAQ N;  2W57 A;  2H94 A;  2F4M B;  1FJL A;  3L2C A;  5HS8 A;  3MKW B;  3RKY A;  1JJ6 C;  4HF1 A;  5IP7 J;  2QVO A;  2KDZ A;  3G1M A;  3HRU A;  4IQJ A;  2FBK A;  3QPT A;  1F5T A;  2ETH A;  3L2Q A;  2CQX A;  1A04 A;  2QEN A;  2EIM H;  2LP0 A;  3IL2 A;  1VQ6 I;  2NRA C;  4ESB A;  1LVA A;  2HQ5 A;  2CYY A;  3KPH A;  3DP7 A;  2ADU A;  3VOE A;  3JW4 A;  2W4S A;  1U6G A;  2LFB A;  3MKZ A;  3DEU A;  2JA2 A;  3DPL C;  2XGE A;  4CYD A;  3JCU C;  5DTD A;  5FRM A;  1N77 A;  3I59 A;  3IRQ A;  1ETY A;  2WWY A;  2VT3 A;  1WI3 A;  1QGP A;  1FTT A;  1MH3 A;  3GBG A;  1D1C A;  3DLL F;  4M9Z A;  3FMS A;  3WG9 A;  2LVS A;  2NVX J;  1IN4 A;  3OOU A;  3BY6 A;  4EV0 A;  4G6T B;  4PJN A;  3F8F A;  4J01 A;  5FD5 A;  3F0C A;  2H8W A;  3CUQ A;  2OC6 A;  4WXH A;  3ONQ A;  5M3F J;  4U7D A;  1KYW A;  4I02 A;  2R5Z A;  5LGT A;  1RC9 A;  3VB2 A;  3VSK A;  2L02 A;  2JSP A;  2DYS H;  3HOW J;  4RMN A;  1G8X A;  2XV4 S;  3JRI A;  1XCV A;  2JZY A;  2R7W A;  2CV0 A;  4S04 A;  4BGD A;  2EIN H;  1ONV A;  1OYW A;  5EJC A;  1VQM I;  4Y52 J;  2L4A A;  4KN4 X;  4XKW A;  1AA7 A;  3V7S A;  3A0B C;  1X1A A;  4M74 A;  4B48 A;  2OQR A;  1NK3 P;  1R1T A;  1OCP A;  1GT0 C;  4FET A;  3W6J B;  5LHI A;  5M5X J;  2FEZ A;  4BY1 J;  3KCC A;  1LFP A;  1TNT A;  2AO9 A;  4I09 A;  3A01 A;  1J59 A;  1BOB A;  2LH9 A;  1X1P A;  2PQ8 A;  3K10 A;  3M3Y J;  1ON2 A;  3GFM A;  4OIN F;  3CCE I;  4X6A J;  5LD2 C;  5F1R A;  1NH3 A;  1UHW A;  2YU9 J;  2VJJ A;  5DM6 F;  5H2F C;  1LUJ B;  2KIQ A;  4F3Q A;  2VE9 A;  2V9P A;  2E2H J;  5E8G A;  2DQR A;  1OIS A;  2CJJ A;  1ERD A;  2O5R A;  3T5X A;  2BGC A;  3HRT A;  5LRR A;  5GAD J;  4D7N A;  1ON1 A;  4A3J J;  5F1J A;  2JA8 J;  1X2M A;  1NHA A;  1JKP C;  1UAA A;  2OD5 A;  1TWG J;  4P55 A;  1EV7 A;  1IRG A;  2V9V A;  3DTK A;  5JVT A;  1D0X A;  2ME6 A;  4OMZ A;  4M3F A;  4I6Z A;  1OR7 A;  4KT5 C;  2P5L C;  3S1R J;  2ECB A;  5C44 J;  4A3I J;  1W0T A;  1Z21 A;  3FWE A;  3KEY A;  2AS5 F;  4LIV A;  4UY8 I;  1Z7U A;  4L18 B;  4OIQ F;  1JT6 A;  2DK8 A;  5TGT A;  3WTZ A;  2E36 A;  3TKY A;  4QTR A;  4BEH B;  2F5V A;  1YI2 I;  2UV1 A;  3JAM Z;  1DDN A;  5LEK A;  4DW6 A;  3ZRG A;  5ICG A;  5K7F A;  1BBY A;  3HXL A;  3QWL A;  1GVJ A;  4D5F A;  4A3B J;  2CW0 F;  2E5N A;  3F8C A;  2DT7 B;  4JBA A;  3LQQ A;  2QUF A;  2P4W A;  5ERI A;  4E7S A;  3BR6 A;  5GTH C;  2ZJR F;  2HPM A;  1RIO H;  3GX4 X;  3CC4 I;  4M6X A;  4HV5 A;  3IV5 A;  2HVQ A;  1DP3 A;  4ABZ A;  3NAU A;  2ISY A;  2E1N A;  4EJV A;  3DPU A;  2UZK A;  2H6B A;  2L4M A;  3B6C A;  3LA3 A;  3RTR A;  3CDL A;  1MBE A;  2ZME C;  3LL7 A;  5JLX A;  2GA2 A;  2K9L A;  3O6B B;  4GYI A;  3W2W A;  2DMU A;  4M71 A;  2ZNZ A;  2EA4 A;  1F36 A;  1S3J A;  3CES A;  3HPH A;  3DU5 A;  2K7L A;  5F64 A;  4XM3 A;  3BDD A;  2LKS A;  3NWS A;  1YW9 A;  3PNT A;  5K5Q A;  1X1D A;  2Y9Z A;  2M87 A;  1B1B A;  2CQQ A;  2OF7 A;  1FBU A;  2ZXI A;  3CC2 I;  4LG0 B;  1KQ0 A;  1QZE A;  3IH3 A;  5K5O A;  1TL8 A;  2LK2 A;  4L9T A;  2XKP A;  1LQ1 A;  2EFO A;  5EZH A;  3C2G A;  3PIO F;  2P5K A;  3PJR A;  2XAS A;  1YW8 A;  1YG2 A;  3H5R A;  2EPF A;  4ZYG A;  3G1L A;  3E5U A;  2WA0 A;  3L7W A;  2FJ1 A;  4CGZ A;  2ZSH B;  3P9I A;  4DJA A;  2BBY A;  1VQN I;  4WX9 A;  1S6L A;  2G7H A;  1FYL A;  4YFX F;  5KCM A;  2IGN A;  1T56 A;  4HG2 A;  2IW5 A;  4CCJ A;  5DD4 A;  1TWA J;  1KON A;  1R00 A;  1QHH D;  4Z6Y A;  2GXG A;  3QPH A;  4EJT A;  3Q0W A;  2EV5 A;  4HBL A;  2DA3 A;  3S2H J;  2LRD A;  1Q1H A;  3K4N A;  4BHC A;  4HNT A;  3H3Z A;  1JTX A;  1MW7 A;  4KIG A;  1OCT C;  5CVI A;  2XIG A;  2G9W A;  3RKW A;  4BNC A;  1MD0 A;  2KKO A;  4LIU A;  3REO A;  2NVQ J;  3BTJ A;  3M1E A;  3E6D A;  2M30 A;  3FBN B;  2H09 A;  3MWM A;  1QA6 A;  2OU2 A;  4C9Y A;  3DFG A;  3DV8 A;  4CDG A;  2VQG A;  4RGR A;  1TC3 C;  3J7A Y;  2K9M A;  2PJP A;  3QP6 A;  5B1A H;  2BEO A;  4F91 B;  3HBL A;  4RB3 C;  2QCO A;  2FMY A;  5ILU A;  2HYF A;  4WXC A;  2RN7 A;  1HSJ A;  4WCG A;  2Y30 A;  3ABU A;  1FP1 D;  2IAI A;  3OIP A;  4RB1 A;  1DU0 A;  3ABT A;  3ZMU A;  4BJ6 C;  4OU0 A;  4XLN F;  4GFB A;  1Y6I A;  1RRJ A;  3ZN0 A;  2V1D A;  3JTH A;  2KIU A;  3WHC A;  1P4A A;  4B47 A;  1SVO A;  4IHX A;  5DCM B;  4WXD A;  2E19 A;  3CDI A;  1JHH A;  4II3 A;  4HDV A;  1MSE C;  2ECC A;  5ILS A;  2GIZ A;  3OYE A;  4BEH A;  2PMH A;  1GV5 A;  1Z91 A;  1W36 D;  2VOD A;  4CYC B;  1Z77 A;  3SEQ A;  3K4J A;  4HW0 A;  5EF6 A;  1NTC A;  3HEF A;  4PSW A;  1I1G A;  2R7O A;  2X0L A;  3EUH A;  3LA2 A;  3TOB A;  2E71 A;  1RES A;  3NRV A;  5ICE A;  2HXI A;  3C7J A;  2GXB A;  2ICW G;  1TT5 B;  1NG6 A;  3KP6 A;  3LST A;  2Z33 A;  2QSH X;  3OYL A;  3CCQ I;  3FXJ A;  4ZC3 A;  3ZQQ A;  3CCR I;  5FLX K;  4B44 A;  4XKV A;  1ULY A;  2VAS A;  1BIB A;  5FD6 A;  1HLV A;  3GTP J;  2VON A;  5CPR B;  3K1M A;  3OIO A;  2WB1 A;  1VQO I;  2K5C A;  2VQH A;  2M8G X;  3F21 A;  1OYI A;  5DS9 A;  1D0Y A;  4A5M A;  2E2J J;  4BXU A;  4OAZ A;  2WV1 A;  2DMT A;  3TP3 A;  3ZR8 X;  3BTC A;  2YUS A;  2QBY B;  1ZGW A;  2V1U A;  2R7X A;  5J1R A;  1O3T A;  4N9H A;  2DFE A;  4IRH A;  5IOY A;  1PP7 U;  5L3C A;  2IT0 A;  3KE2 A;  2DA5 A;  5K5R A;  1IN5 A;  2MFZ A;  3EUK L;  5FFZ A;  5CVU A;  5E1Z B;  2VUM J;  4F7Z A;  1AWC A;  3PFI A;  1APL C;  4LG0 A;  3D5S C;  4ZYD A;  3JTG A;  1MGT A;  2LC2 A;  2Z2S B;  2ZXJ A;  2Y9Y A;  4BQN A;  3P9K A;  3PO2 J;  4UVB A;  3IAS 2;  1ZTR A;  2VOO A;  5DYM A;  3HHH A;  3I4P A;  1HKS A;  3H3V K;  3S3O A;  5H20 A;  1W5S A;  4HDU A;  1QU3 A;  1U8R A;  3I55 I;  3CJN A;  3ZXS A;  2DFF A;  5HLI A;  3ZP5 A;  1J0R A;  2VXD A;  4X0G A;  2HS5 A;  4A69 C;  1XPX A;  1MJA A;  2HZT A;  4NUB A;  1U0J A;  2XDV A;  3ELK A;  3QYB A;  3ECH A;  2ZSI B;  3WTW C;  1SC7 A;  3PUB A;  5JI6 A;  1BI3 A;  2DMQ A;  4DYR A;  1N75 A;  2EZK A;  2VT2 A;  4AVP A;  1HDD C;  2DK5 A;  4ITV A;  1TW3 A;  2VQL A;  4RM2 A;  1UMQ A;  2D45 A;  2HWV A;  2X6O A;  4FE4 A;  3ULQ B;  3GO5 A;  3LOC A;  3PQJ A;  1IO2 A;  5IYC J;  2GBY A;  1LDJ A;  2DT6 A;  1HW5 A;  2HQR A;  4Y7N J;  3OS2 A;  3V8L A;  3CMA I;  4ZH4 F;  3CCM I;  4QSH A;  4ZZD A;  2HDC A;  3L00 A;  3JRA A;  3MQ0 A;  2DPD A;  4DBR A;  2CV1 A;  2NS7 A;  2KQR A;  1USS A;  2D1H A;  1K61 A;  4LIT A;  5HNH A;  1R22 A;  4FHT A;  3ZQI A;  3KP7 A;  2FSW A;  3BJO A;  3OMY A;  1FMV A;  3ZOB A;  3S1Q J;  4GYG A;  1U2W A;  1HDP A;  3HGY A;  3DQV C;  4IKF A;  2E1O A;  2LYC A;  1BL0 A;  5D5W B;  1J9I A;  4RGU A;  2LKX A;  2IS4 A;  2DI3 A;  3OSG A;  1RUN A;  1K83 J;  3R4K A;  1XN7 A;  1KQ9 A;  2W25 A;  3F8B A;  4D5C A;  1QZZ A;  3I9V 2;  1YIJ I;  1ZRF A;  2QSG X;  1YIT I;  4EVI A;  1JHF A;  4XLE A;  2FBI A;  3CF2 A;  3HTS B;  1MSF C;  1UEL B;  2WY7 Q;  2LY2 A;  5DCM A;  2YR2 A;  3A2K A;  2EZL A;  3BZC A;  3ZQL A;  1O3S A;  3HC7 A;  3K4L A;  3E1S A;  3S32 A;  1KYZ A;  4A3E J;  4N9I A;  4G7O F;  4BUP A;  4P5O A;  1ZAR A;  3MKL A;  1D1A A;  1XSV A;  2IEK A;  5E3N A;  3NWT A;  5EEG A;  1BJA A;  4CYC A;  3QP5 A;  3U9G A;  1S72 I;  5HLG A;  2Z5U A;  5D4R A;  5IYB J;  3DCF A;  3C18 A;  2IJL A;  2QQ9 A;  3H5A A;  3G6E I;  3LNQ A;  2FA5 A;  4FE7 A;  1YYV A;  5EEH A;  1U8B A;  3QOP A;  1SD5 A;  4XQF A;  3U21 A;  3GUD A;  2G0E A;  4QLC U;  3VOD A;  3M4O J;  1B9N A;  2NVY J;  3DLA A;  5FKO A;  3M7G A;  2DDA A;  4KYW A;  1MMN A;  2RVC A;  1R1U A;  1H88 C;  3W6V A;  3M8J A;  1HA8 A;  4EAT A;  3CUO A;  4LLG F;  4BQO A;  2DA1 A;  1IUF A;  2DO7 A;  3RDI A;  2QBY A;  2JMW A;  2F6C A;  3I4M J;  3MZY A;  2QYO A;  1JKO C;  2IP2 A;  2Y0S A;  1WH7 A;  1MBG A;  4F55 A;  4BY7 J;  2NVT J;  1PJR A;  1JUM A;  1LEA A;  1EJ9 A;  1LFU P;  3L09 A;  1I5Z A;  2BHY A;  3KP3 A;  3TP0 A;  5B1B H;  1PUE E;  2QEX I;  4A3C J;  4NC7 A;  3FXQ A;  4HYE A;  2F4I A;  1N78 A;  2EK5 A;  3CDH A;  2XB0 X;  1GLN A;  4DNC A;  2M9H A;  4A12 A;  1U9N A;  2ZNY A;  2KIS A;  2ZME B;  3IWZ A;  4U88 A;  3OYI A;  2E60 A;  3KP2 A;  1KZH A;  3ZCO A;  2DW4 A;  4A93 J;  5L3E A;  4Q4Z F;  2PJR B;  3CCL I;  3FKI J;  3LQR A;  4HX8 A;  4BAC A;  2XHK A;  2KFD A;  2DCE A;  2R7Q A;  2ELK A;  3FK6 A;  2Y31 A;  2IRF G;  1Y39 A;  3K70 C;  1CQT A;  2XUB A;  2W00 A;  2PLY A;  1JKQ C;  1ZR2 A;  2V6C A;  3IKV A;  3I4N J;  1V55 H;  3ZGK A;  4HX7 A;  4RDU A;  2OTJ I;  3J7Y J;  2NAZ A;  1UHS A;  2P0W A;  2HTS A;  1X4O A;  4V2G A;  4IHY A;  3QYE A;  3CCV I;  1XGS A;  4YFN F;  3DTI A;  1X3Z B;  3C1D A;  5GPC A;  4MFE A;  2DYR H;  3DBL B;  3WG7 H;  3CCU I;  4NNJ A;  1Z6T A;  1T98 A;  3RPU D;  2A61 A;  3HSR A;  3LSG A;  3M9A A;  1MKM A;  1A36 A;  2V7F A;  3GXO A;  3P9C A;  3MVP A;  4OWR B;  2R7F A;  3BG7 A;  4NBQ A;  4D1Q A;  3E5Q A;  1BOA A;  5LFA A;  1LFB A;  4FTH A;  2FRH A;  1X19 A;  4JX4 A;  4LMY A;  2TRT A;  2JJ7 A;  1Z9C A;  2PN6 A;  1SFU A;  1FYM A;  1T95 A;  2Y48 A;  4M73 A;  3V7R A;  2WTE A;  4Y17 A;  3G73 A;  1SEU A;  3HDD A;  4UUV A;  1WJC A;  2FXA A;  3HRS A;  5D6F A;  2GZW A;  2MBF A;  4HRI A;  4EQQ A;  2R3S A;  2NVU B;  1U5T C;  5C4J J;  4OIO F;  5EDN A;  4D9J A;  3SQN A;  5EEA A;  5HLT A;  3L2W A;  3HG9 A;  3D5L A;  5D6E A;  1JGG A;  1FBS A;  2CRG A;  3MKY B;  3RI4 A;  3OYB A;  3CLO A;  3LAJ A;  4ZDO A;  1IV8 A;  3A0H C;  4QWQ A;  4PJ0 C;  4HLX A;  3IP4 B;  5HDK A;  1REP C;  2XRL A;  3VPR A;  1FOW A;  2IS1 A;  1UST A;  4S0H B;  1PUF B;  2X1E A;  3TO7 A;  2HQN A;  5FKL A;  4CZC A;  2R92 J;  3LWF A;  4LLL A;  2C6Y A;  1QQI A;  2ZJP F;  3F6V A;  1B4A A;  3RYP A;  5F04 A;  3GLX A;  5J6X A;  5EZG A;  4EJU A;  4CCO A;  4IVN A;  2ELH A;  1MMG A;  2X1C A;  3L2V A;  3A02 A;  2VXZ A;  2XPV A;  3HUG B;  1MH4 A;  4YEJ A;  1SFE A;  2CFX A;  1Z3Y A;  3AG2 H;  1IF1 A;  4KMF A;  1ETK A;  4BE2 A;  4IHW A;  5E17 F;  3S2D J;  2GOX B;  1X3U A;  4U87 A;  3H0D A;  3QQA A;  4A6D A;  1G59 A; 
#chains in the Genus database with same CATH homology
 4A3B J;  3BR6 A;  2HOA A;  4M3G A;  1TWF J;  2X48 A;  1RET A;  3K7A J;  3IV5 A;  2PMZ N;  1IV6 A;  9ANT A;  2MG4 A;  4V2F A;  4ABZ A;  3LSR A;  4FCY A;  3NAU A;  3L1P A;  1AKH B;  4JX6 A;  5FKK A;  3B6C A;  4IHV A;  3CDL A;  1MBE A;  3JRB A;  5JLX A;  5M5W J;  2DMU A;  1D5Y A;  3K2A A;  1YRN B;  4A3G J;  1F36 A;  3S14 J;  3BTL A;  4XID A;  3S16 J;  2KT0 A;  1QPI A;  2P81 A;  4BKX A;  3BR2 A;  2Y9Z A;  3S15 J;  4LOC A;  2CQQ A;  2HI3 A;  2OF7 A;  4BXX J;  2CU7 A;  2HXO A;  3IH3 A;  3GTJ J;  3HOU J;  5FLV A;  4UUT A;  2LK2 A;  2ID6 A;  5F0C A;  4B3A A;  5EZH A;  3BT9 A;  5C4X J;  2L7F P;  2RAE A;  1B72 A;  3SDG A;  2XPW A;  2GLO A;  1BJZ A;  1TWH J;  2LD5 A;  3G1L A;  4IEJ A;  4DZP A;  2FJ1 A;  5FJ8 J;  3JRD A;  3QPL A;  1WPK A;  5GPA A;  1T56 A;  1RKW A;  1TWA J;  1Y1V J;  1FIA A;  4UUS B;  1RR7 A;  1POG A;  2HOS A;  1FEX A;  3Q0W A;  5J1U A;  3HOY J;  2R7Z J;  2DA3 A;  3S2H J;  2EZI A;  5EG0 B;  2CUE A;  2DMP A;  4XK4 A;  5FLM J;  1JTX A;  1IG7 A;  4FIS A;  1OCT C;  2JWT A;  1VFC A;  2K9Q A;  4JP0 A;  2DN0 A;  1ZKG A;  4X1E A;  2NVQ J;  3BTJ A;  4AYB N;  1GVD A;  4XRS G;  2JA7 J;  2DMN A;  3HB9 A;  2XSD C;  1TC3 C;  1H89 C;  1MBH A;  3TW6 A;  3HBL A;  2QCO A;  2W48 A;  2ZB9 A;  3TED A;  2Y30 A;  1QVU A;  2R5Y B;  1ENH A;  2IAI A;  5F08 A;  1DU0 A;  3GTL J;  1P7J A;  2DA4 A;  4GFB A;  3FIS A;  4I76 A;  1PUF A;  5IYD J;  2WB1 N;  1IDZ A;  3JRH A;  1I50 J;  2LR8 A;  3WHC A;  3C2B A;  1JUS A;  5J3L A;  4IHX A;  4W97 A;  4D7M A;  1W0U A;  5F0F A;  2E19 A;  3WHB A;  5F27 A;  1MSE C;  2ECC A;  1JJ8 C;  2XGC A;  3HM5 A;  3RQI A;  1GV5 A;  3OSF A;  2VKE A;  4CYC B;  1Z77 A;  2XGD A;  1TWC J;  2DJN A;  1NTC A;  3QPS A;  3HEF A;  5EF6 A;  3ZQC A;  1GUU A;  4DZJ A;  5K7H A;  1RES A;  2HXI A;  2R93 J;  2DA6 A;  3FK7 A;  2JK3 A;  5K7Z A;  1QRY A;  2M2E A;  1HLV A;  1LE8 B;  3GTP J;  1VF9 A;  3OIO A;  1IC8 A;  1ZK8 A;  2M8G X;  3GTK J;  1AKH A;  4L5E A;  2DTZ A;  5DS9 A;  2E2J J;  3HKZ N;  3PM1 A;  3JRC A;  2WV1 A;  4C2M J;  1RPW A;  2DMT A;  3TP3 A;  1R9T J;  3BTC A;  2R0Q C;  1ETO A;  2YUS A;  2XB5 A;  2YS9 A;  2EBI A;  4MO7 A;  2LTP A;  2X9D A;  1ZGW A;  1YRN A;  1IGN A;  5J1R A;  1BA5 A;  1MBF A;  2L7M P;  5IOY A;  1X58 A;  3SJM A;  3RZD J;  1E3O C;  1FIP A;  2DA5 A;  5JLW A;  2O8K A;  5IP9 J;  5EGO B;  4BBS J;  1ORK A;  2VUM J;  1IRZ A;  3D1N I;  1U78 A;  3BG3 A;  4XIC A;  1APL C;  2O9L A;  1VI0 A;  4JX5 A;  3IH4 A;  4M6V A;  5EYR A;  3SFI A;  2Y9Y A;  4A3K J;  4B4C A;  2HYJ A;  1MNM C;  3PO2 J;  1ZTR A;  3JR9 A;  3RZO J;  3H3V K;  3ZQF A;  2TCT A;  3BR1 A;  1WH5 A;  1I6H J;  2FQ4 A;  2K40 A;  3BTI A;  2VKV A;  3HGG A;  1NK2 P;  1WGX A;  2JA6 J;  3BR5 A;  2R5Z B;  4C3I J;  3S17 J;  2D5V A;  4JYK A;  4NDL A;  1JTY A;  4G12 A;  4W1U A;  3GTM J;  4A69 C;  1Z0X A;  1ITY A;  2JN6 A;  3IH2 A;  2H1K A;  1WCM J;  2ID3 A;  2Y2Z A;  3BR3 A;  4MFD A;  1G2H A;  1P7I A;  3CQZ J;  5BNG A;  4C3J J;  2LLK A;  2MW8 A;  4EEF G;  1Y1W J;  2DMQ A;  2HOT A;  4DYR A;  1XC5 A;  3BQY A;  4UUS A;  2EZK A;  4M3D A;  1SFO J;  1HDD C;  2N8G A;  3BQZ A;  1XS9 A;  1UMQ A;  2L9R A;  4AC0 A;  5EG0 A;  3FIW A;  1IJW C;  2X6O A;  4FE4 A;  3A01 B;  3E7L A;  2AHQ A;  3LOC A;  1ZR4 A;  5IYC J;  2GBY A;  3BG9 A;  3JRG A;  5E3L A;  4Y7N J;  5IP6 A;  1B8I B;  3JRF A;  3S1N J;  4QSH A;  3JRA A;  2NS7 A;  3H0G J;  4A3L J;  2HDD A;  1K61 A;  1MBK A;  5HOD A;  3ZQI A;  5FKN A;  2H8R A;  3CCY A;  3ZOB A;  3S1Q J;  1HDP A;  3HGY A;  2E1O A;  1BL0 A;  4XRM A;  2R5Y A;  1T33 A;  2LKX A;  4A3F J;  4C3H J;  3OSG A;  1K83 J;  3UKG A;  3RKQ A;  5FKM A;  4D5C A;  1UG2 A;  3HOX J;  4MIM A;  3G1O A;  1O4X A;  5GP9 A;  4RBO A;  1A6I A;  1ETV A;  2M0C A;  2K9S A;  3Q0V A;  2DA7 A;  1MBJ A;  3MN2 A;  2EH3 A;  1XG1 A;  2MGQ A;  4HNV A;  2VI6 A;  1MSF C;  3NAR A;  5C3E J;  3B6A A;  2EZL A;  2OPT A;  3ZQL A;  4M3E A;  3Q0U A;  4A3E J;  1EF4 A;  2FD5 A;  2O7O A;  4J19 A;  5M3M J;  2Y0S N;  3MKL A;  1AU7 A;  2IEK A;  3DEW A;  5E3N A;  4CYC A;  3LSJ A;  2WAQ N;  2L0K A;  1FJL A;  1ETW A;  3BG5 A;  1GV2 A;  1JJ6 C;  1AHD P;  5IYB J;  3DCF A;  5IP7 J;  2KDZ A;  3G1M A;  3Q3S A;  3LNQ A;  1S7E A;  4FE7 A;  1U8B A;  1JUP A;  2JA5 J;  2NOG A;  1OFC X;  1LE8 A;  2CQX A;  2G0E A;  3LSP A;  1VND A;  2M34 A;  2XPU A;  3M4O J;  2LP0 A;  2NVY J;  5FKO A;  1X2N A;  2VPR A;  3W6V A;  1H88 C;  2HQ5 A;  3CMY A;  2DA1 A;  1IUF A;  2LFB A;  2JMW A;  3I4M J;  4DYC A;  1JKO C;  1ETQ A;  2XGE A;  1ZQ3 P;  3O8H A;  1WH7 A;  1MBG A;  5DTD A;  3JRE A;  5IPA A;  4BY7 J;  1ETY A;  5EGO A;  2NVT J;  1JUM A;  1LFU P;  1F43 A;  2COB A;  1WI3 A;  1FTT A;  1MH3 A;  3GBG A;  4B1R A;  3HOV J;  1H8A C;  3TP0 A;  2NVX J;  2LVS A;  4A3C J;  3OOU A;  1JT0 A;  3F0C A;  1BW6 A;  2XB0 X;  2M9H A;  1U9N A;  1DU6 A;  5M3F J;  4A93 J;  3FKI J;  2K9N A;  2R5Z A;  1JKR C;  1B72 B;  3PO3 J;  1U9O A;  2ELK A;  3HOW J;  3FK6 A;  2Y31 A;  4QIW N;  4BBR J;  3JRI A;  1CQT A;  5J1Y A;  1FTZ A;  1JKQ C;  1ZR2 A;  2IBD A;  2MSY A;  3I4N J;  4RDU A;  4Y52 J;  1HCR A;  1UHS A;  3TW7 A;  4V2G A;  3HOZ J;  3GTQ J;  4IHY A;  3A03 A;  1A5J A;  5GPC A;  4MFE A;  1NK3 P;  1OCP A;  1GT0 C;  1HF0 A;  2ME0 A;  3BR0 A;  2EZH A;  2E2I J;  2LY9 A;  1OJL A;  3LSG A;  5M5X J;  4BY1 J;  2EQR A;  2AO9 A;  3MVP A;  4MLO A;  3A01 A;  4AUX A;  3M3Y J;  1LFB A;  4FTH A;  4A3D J;  4JX4 A;  4X6A J;  3ZQG A;  2TRT A;  2JJ7 A;  1B8I A;  2YU9 J;  4M3B A;  1ETX A;  3HDD A;  2CUF A;  2I10 A;  2E2H J;  1I3Q J;  2CJJ A;  3ZQH A;  5C4J J;  5EDN A;  2DA2 A;  4D7N A;  4DYQ A;  5EEA A;  4A3J J;  1JGG A;  5F1J A;  2JA8 J;  1IDY A;  2CRG A;  2GM4 A;  2B63 J;  1X2M A;  1JKP C;  1Q1V A;  1TWG J;  3GTG J;  5IOZ A;  3GTO J;  2XRL A;  1QVT A;  3VPR A;  2ME6 A;  4S0H B;  1PUF B;  5E3M A;  5FKL A;  4M3F A;  2L7Z A;  2R92 J;  4I6Z A;  3S1R J;  2NS8 A;  2ECB A;  2QF7 A;  5C44 J;  4A3I J;  1W0T A;  1SAN A;  1BW5 A;  5F04 A;  5EZG A;  4XRS A;  1RKT A;  1JT6 A;  3A02 A;  1GDT A;  2XPV A;  1MH4 A;  4QTR A;  4IHW A;  1HOM A;  1ETK A;  5M5Y J;  2FX0 A;  5F0H A;  4A3M J;  4DW6 A;  5E3O A;  3S2D J;  3O8G A;  5K7F A;  3QQA A;  3S1M J;  4D5F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...